5CYVA

Crystal structure of cour from rhodococcus jostii rha1 bound to p-coumaroyl-coa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
138
Chain Sequence
SQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFPTFVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcriptional regulator
molecule keywords Transcriptional regulator
publication title The activity of CouR, a MarR family transcriptional regulator, is modulated through a novel molecular mechanism.
pubmed doi rcsb
source organism Rhodococcus jostii (strain rha1)
total genus 48
structure length 138
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cyvA00
4KFCA 1JXSA 1LVAA 1TNSA 4D0PA 3V7CA 2HGCA 2JPBA 1RI7A 4MQVA 4KMFA 3WE3A 1LB2A 1ON1A 3C1DA 1SFXA 1RNLA 2F5FA 4PGGA 1LQ1A 2PEXA 4LJZF 3K0LA 2E1CA 2Y75A 1XB4A 2IA0A 2ZKZA 5BS6A 1K6OA 1MZBA 4FHTA 2DO7A 4L0YB 3M8FA 4HZFA 1G4DA 2L01A 1DDNA 4OIPF 4HYEA 2RDPA 3FHZA 1B6AA 2W85A 4O5VA 4EVIA 1R7JA 2MLKA 3LWFA 1BC7C 1P4WA 2ELHA 2ZNYA 2GA2A 4PZJA 3LA2A 5DD8A 4IRGA 4RGRA 3RKYA 4G6DA 4RGUA 3RKWA 4LGWA 3BJAA 4ENKA 2VT2A 1PP7U 2KJBA 1FOKA 3HYIA 2BV6A 4HX7A 2F2EA 2EFWA 1F5TA 4Z2YA 4UVCA 4EJWA 5E20A 2EV0A 2KKOA 3BWGA 2L4MA 3H3ZA 2FQ3A 1Z7UA 4MHGA 4HDVA 1R36A 2W84A 5FO5A 1U5TA 2A69F 1YQAA 2VBYA 2DU9A 1MKMA 4ESFA 5L3EA 2VOPA 3DFGA 3TDUC 4CZZA 1F1ZA 1XD7A 3Q9SA 2RN7A 3EETA 3MQ0A 3HOTA 2GAUA 4LB6B 2HQNA 5LGTA 1S6LA 1LDDA 5DCMA 2TDXA 3IWFA 3GUDA 3HRSA 3NEUA 1ZRCA 2QYOA 3SHFA 2EA2A 1ULYA 3RKXA 2ZFWA 4UV8A 5CVIA 2ZXJA 3ZMZA 3B73A 3WTSC 1IXCA 5D8KB 4B09A 2JTVA 4XLNF 4CXFA 1JHHA 4AVPA 2CG4A 2HWVA 2XAQA 2P8TA 2XAJA 2Q8KA 4L18B 2VE8A 1T6SA 2JPCA 3R61A 4LD5A 2ESHA 4DNCA 1BN5A 2AS5F 1G6NA 3G3ZA 3ERED 2OD5A 4WK8F 4KIBA 2NS0A 3CTAA 3RTRA 5LBQA 4EM0B 3L09A 3WTWC 1W5TA 1ZN2A 5D6FA 4UVBA 2K4BA 4U0YA 3OOPA 4P55A 3BOQA 1ZGJA 2DQLA 2FBHA 4WCGA 1V4RA 4UV9A 1J5YA 1KYZA 1HKSA 1XGMA 2M30A 1XGNA 1USSA 2HOEA 4RAYA 4BXUA 4RAZA 2ACJA 4KN7X 4I01A 2MH9A 4ENMA 3SZTA 2JRTA 3I5UA 1KU3A 2E1NA 4M74A 4XLPF 2KIUA 2RVCA 2ZJ2A 4YFKF 5F64A 4KYWA 1GHCA 3C3WA 1HSJA 1YYVA 3C7JA 3CUQC 3ZN0A 1XDSA 5CVUA 4ZYGA 1R1TA 1O57A 1SD5A 4F7ZA 2FMLA 2L4AA 4M72A 4M71A 3BROA 1QBJA 1BIBA 4Q5SF 4LK0F 2GIVA 3K9TA 1G3SA 1OPCA 4MGRA 2WTEA 4AIJA 1W4MA 3I64A 1FY7A 5EEHA 3QOPA 2KJCA 4LFUA 2IVMA 2Q0OA 1T0FA 4WX9A 3IRRA 1T39A 3KP7A 2P5LC 2HYFA 1FWZA 5H6RA 2QVOA 2OAZA 2P4WA 2Z3YA 3FXUA 1H9TA 3NQOA 1EH7A 1TQIA 1J7KA 5A2QZ 1B9NA 4I2OA 3HTSB 4MNUA 5F1RA 5K1YA 1O7FA 3HHHA 1BC8C 3ZMTA 2YX7A 4L5JA 1I6XA 1YTYA 4EGZA 2EA4A 4CDGA 5HDKA 5DUKA 4L9NA 1J0RA 2XKOA 2DBBA 2DW4A 3MCZA 1L0OC 3QP6A 2XIGA 3OV8A 3BDDA 4N9HA 2HS5A 3ZPLA 2ZMEA 3HRMA 4AWXB 1U3EM 4I7HA 3F6VA 3E97A 4OMYA 1P4AA 4P9UA 4P9FA 4XBFA 2XV4S 4ESJA 1IW7F 2V1XA 1K7AA 1E2XA 4WXDA 4GCVA 3KLNA 1E17A 1GVJA 1ZARA 2AXLA 3CUQB 3EQLF 4QLCU 2XRNA 2EJRA 2OQRA 4CICA 2QQAA 1S7AA 3QPHA 1REPC 4KDPA 3J80K 1FZPB 1NHAA 2OBPA 2O03A 3BJOA 3JAMK 3V8KA 2A68F 1CF7B 1FT9A 1OR7A 5JHUA 3WTVC 2NNNA 3ABTA 1QGPA 4HDUA 1EV7A 3EUHA 1IRFA 2FBIA 3GVAA 1MJ9A 4IRIA 4KUMA 4O6JA 3M7GA 2PJPA 3GYHX 2P5KA 2VBWA 3E6MA 1Z9CA 3E5XA 3VB2A 1YW7A 5ILSA 2Q2EA 2HFHA 3AAFA 1PP8F 4LLNA 4UUVA 1WWXA 2MA3A 2FOKA 3K1MA 4QWQA 4R8HA 1J75A 5IT3A 3KETA 5L3FA 3N97A 3O6BB 3FF5A 2M1BA 4I0AA 3DF8A 1MD0A 5DDGA 3GZ5A 3RYRA 4Y17A 3QP5A 2HTSA 3S2WA 5L3GA 1TBXA 1IN6A 2PG4A 1J9IA 2VT3A 1KQ9A 1WKMA 4JQFA 5HS7A 1B1BA 4EJTA 1SD7A 4HLYA 3F8FA 5DV5A 1UHMA 1A04A 2ZNZA 3GFMA 5HLHA 3SZPA 4U7DA 1XCVA 3KP4A 3FM5A 3T0YA 4WWCA 1JHFA 2DT5A 4A0XA 2D2WA 3QAHA 3W6JB 1RZ4A 6PAXA 3QU3A 2PFBA 3P9IA 4L9TA 4M9SA 5HS9A 2FNPA 5AIPA 4O3MA 2MBFA 1YIOA 1MJAA 4P5OA 3V4GA 3GXOA 4BHBA 1B9MA 5IT9K 4XSXF 4HX8A 3H92A 3WTUC 3WGHA 1U8RA 1ZAOA 2DI3A 3R0AA 2B0LA 3BJ6A 2EV6A 1TNTA 3F6OA 3KZZA 2G9WA 4ZH4F 3SFZA 4OINF 1WSUA 2IT0A 2CGPA 2WWYA 4YG2F 5JFRA 1WRJA 2Z9OA 2QZ8A 4A5NA 1IZ1A 5FGMA 2FSWA 2MC3A 2FMYA 4A5MA 5CVRA 1F9NA 4Y13A 4G6QA 3L7WA 4HA8A 3EYYA 1VTNC 2G7UA 1LNWA 2ZBKA 2K7LA 1FBQA 1XCBA 2EWNA 2IPQX 1R1UA 3HOSA 4KICA 4M9XA 2A6HF 2P5VA 1BI0A 3J81K 5DD4A 5D8LB 2HZTA 3T5XA 4FT8A 1EH6A 3RI4A 4L0ZB 5JR3A 1TQPA 2Y0MA 3HSEA 5LHIA 4XSZF 5HDNA 1P92A 4XRFA 1Z6TA 3LFKA 1SAXA 4TV7A 5BQTA 4HF1A 3FWEA 2QUFA 2EFPA 4U88A 1KU7A 2A3SA 2VODA 2W25A 3IRQA 1AOYA 5H20A 1JGSA 1FYMA 5CVJA 1Z1DA 2V9VA 4RGSA 1J59A 4MTEA 5BMZA 1USTA 4AIKA 1FP1D 1R00A 3WU1B 1XSXA 1SD6A 3M9AA 1W7PA 2QLZA 1XSVA 4G8XA 5FLXK 1C0WA 2FA5A 4KIGA 2ZO4A 1RUOA 3GLXA 3KFWX 2H6CA 2XHKA 4MEYF 2QBYA 4U0VA 4UVAA 1BI2A 4KA4A 2HQRA 5ILVA 3RPQA 4PCQA 5FFZA 1T2KA 2F5DA 1XN7A 4ZYHA 1BI3A 4I98B 4NB5A 2VXZA 1RIOH 3MWMA 5LLQA 3TO7A 3TDZC 4RGXA 2DPDA 3F22A 1DUXC 4HW0A 4IJAA 3FXQA 1LJ9A 3FM3A 2L3DA 4YFXF 1FYKA 5E18F 2P6SA 3I0TA 1D3YA 2CW0F 3DKWA 1BJAA 2M87A 4G94A 4IXAA 1S8NA 4EM1A 1OYIA 3E5QA 3IWZA 4HF0A 3F3XA 4LG0A 2O3FA 1SMTA 4I09A 3HTUA 1V3FA 2PI0A 2PQ8A 2CSOA 1YO5C 2MD5A 4WXCA 1IN5A 2PLYA 3I53A 2D1VA 5TJJA 3GF2A 2HR3A 4KN4X 2D45A 4CHUA 3TQNA 2DTRA 3IHUA 3LQQA 3L00A 3R6SA 2V79A 2IA1A 4HV5A 2A5YB 1UFMA 4WXHA 4U0WA 3MEXA 5HDGA 2XGXA 3Q5FA 1ZREA 2F5CA 4HQMA 5K5QA 2V6CA 3ABUA 2JSCA 3BPXA 1ODDA 5DCFA 3NRVA 2ZCWA 1FLIA 3KEQA 1XSDA 2OQGA 2LF8A 3BP8A 2YPRA 2ADUA 3WU0A 2P7CB 1IRGA 4Y15A 3JSOA 3WTTC 3WG9A 5KVRA 2XAGA 5L3CA 3GO5A 1P2FA 1O7LA 3V8LA 1ON2A 2E7WA 2HTJA 3I58A 5LGUA 1KQ8A 5ICGA 3BPVA 4AD9A 2ZMEB 4LLGF 1FSHA 3KEOA 2XUBA 2HKOA 1R22A 4Q4ZF 3KP2A 1O3QA 1FNNA 2HKXA 2HDCA 4MQ9F 1SFUA 2GZWA 2DAOA 3DPLC 3HHGA 1EH8A 1JE8A 4ENNA 3RDIA 4MTDA 2R7FA 2X0LA 2PBIA 2STTA 2DQRA 4A0YA 1R1VA 3WODF 3IKTA 2CO5A 4I0BA 4EV0A 1HW1A 4GO1A 1PDNC 3LA7A 4FX4A 2KIMA 5L3DA 3W6KB 4IHSA 3H3UA 2VBXA 3E3VA 4BHCA 3CUOA 4EMSA 2DLLA 1UB9A 2MH2A 3GEZA 3TOBA 2DK8A 3GWZA 2RGVA 1MDMA 3TOAA 1LEBA 3U2RA 2EFQA 2FBKA 5E1XA 2IP2A 1IN4A 2STWA 3JTHA 3IC7A 1IXRC 2VBZA 5LRRA 5E1ZB 4ETSA 5K5RA 1SD4A 4CGZA 1FBSA 2G7HA 5FD6A 2HEOA 1IUYA 2LDUA 3ISPA 3V7SA 3JW4A 5LGNA 3CLOA 1QNTA 3E6BA 2BBYA 1ZG5A 3O2PE 5HLGA 2F5EA 1I1GA 3E5UA 5CYVA 2W57A 2Z99A 2LSOA 2EFNA 1ZYRF 4OIQF 3HUGA 2FXAA 3ZMVA 5ILUA 3ZN1A 1QZZA 3ECHA 5D4RA 1TLHB 2EV5A 1DPRA 3CUQA 4UXNA 3MAJA 1AWCA 2JT1A 3WE2A 2R7DA 1K78B 4A12A 3N4MA 1ZRDA 4CO8A 5E1WA 5BPDA 1HXDA 4DQ2A 1KU9A 2K27A 1S3JA 2M45A 1I1SA 3EYIA 4BH9A 3DV8A 3HRTA 3QPTA 1TW3A 4KNYA 5CJ9A 5A2QK 2ESNA 1FYLA 4KIFA 1YS6A 1U5TC 4K2EA 4RB0A 2JZYA 2QQ9A 2H09A 2EB7A 3LQRA 1CGPA 3QRFF 2XROA 3FX3A 5ICFA 3PFIA 5LHGA 2R3SA 2H6BA 1HQCA 3I59A 3TKYA 2O61A 2LKPA 3PQKA 4N0BA 3SXYA 2K02A 1TTYA 1BIAA 5ED4A 2RKHA 4EJVA 1U2WA 1HKTA 1YLFA 4IRHA 2BEOA 4BYYA 5BPIA 4HLXA 2UXXA 3J7AO 1H9GA 2UXNA 5LEJA 1Q1HA 2PMHA 1G3TA 1STZA 5CVVA 2Z5UA 2IJLA 4LMYA 4LK1F 2VOOA 3M1EA 4EQQA 1U6GA 5D5UB 3D5LA 5D5VB 1BM9A 4KT5C 5HLIA 2ISYA 5AIQA 2PMUA 2P6TA 4ON0A 4RB3C 1UHWA 2DFIA 3KZYA 2A6EF 2FEZA 3FXRA 3R60A 4OIOF 4WF2A 1K79A 1DP7P 4A6EA 3V8JA 4RB2C 4M9ZA 3L9FA 1O3RA 4I02A 2Y48A 3MZYA 4RB1A 2V1DA 3RPUA 5H6QA 5J8FA 1U5TB 4S04A 2PN6A 4A2UA 2COMA 2QENA 3P7NA 2KRFA 3DXJF 1YS7A 3F23A 1XMKA 1XGOA 1HBXG 2UZKA 1FSEA 4L5IA 5AONA 4NHJA 3ZMSA 1GXPA 4A6DA 1W7PB 3GFLA 3RYPA 5DCMB 5TRDA 1B59A 5ICCA 3BY6A 1PUEE 1LDKB 4OOIA 4L9VA 4ENJA 1R5HA 4B8XA 3VFZA 1SMYF 3FMSA 1P6RA 1YW9A 4JBAA 2QWWA 2QBYB 4IHTA 3IL2A 4CYDA 2C6YA 5DEQA 4HF2A 2FE3A 2DK5A 1ZH5A 3IKVA 4BHPA 5D6EA 3WGIA 3WTZA 1U78A 5DUIA 4EM2A 4G7OF 4YFNF 2NAZA 4ZZDA 2OZ6A 2QM3A 2O0YA 3WTYC 1ONVA 3GW2A 3D0SA 4R79A 2GXGA 3VOEA 2CWEA 1IN8A 5E17F 1HW2A 1ZGAA 4U7BA 3BZ6A 2M5WA 1D8JA 1Z91A 2K4JA 4FX0A 3K69A 1ZG1A 2NRAC 4MEXF 1MGTA 3U1DA 1QZYA 4LG0B 1XGSA 4EJUA 1FPQA 4Q47A 3CO6C 5DYMA 2OU2A 4HV6A 2IW5A 1TW2A 5JVTA 1X3UA 2VE9A 2CFXA 3O3KA 4PGHA 4M73A 2ISZA 5LRSA 4M6YA 1XDUA 3I54A 3I4PA 4HAMA 5J6XA 1R5GA 3ZMUA 2LF7A 4OMZA 5HS8A 1UCRA 2HYGD 3KP3A 2YR2A 3DP7A 5BOXA 1HW5A 3KP5A 1YW8A 3T8RA 1XMAA 4PDKA 3GX4X 1S29A 4EJOA 2FF4A 4H0EA 3E6DA 1LEAA 3DQVC 1FC3A 1HSTA 1T38A 1I5ZA 2VONA 2IA2A 4OIRF 4ESBA 3HSFA 3G73A 1FBUA 3FMQA 4HOBA 1FX7A 1Y0UA 4ZYDA 2WC2A 3J80Z 1OYWA 4G9YA 3T8TA 3JAMZ 5D4SA 2XAFA 3QU6A 2L02A 4E70A 4RS8A 3CDHA 5D5XB 4GGGA 2MLGA 4BAYA 2IRFG 2YU3A 2X4HA 3EDPA 3P9CA 2J5PA 1QPMA 2P7VB 2FU4A 2H94A 5D5WB 3JSPA 1G3YA 1WQ2A 4GYGA 2ETHA 3CO7C 4P96A 1KQ0A 1QO0D 3ULQB 3ZP5A 5J8CA 5FB2A 4EGYA 3K1NA 1O3SA 1Z6RA 4YIFA 4IPAA 3T1BA 2W24A 1O3TA 3TGNA 2E7XA 3WTXC 3RJPA 3TO6A 1G3WA 2A61A 1D8KA 2XASA 1YFHA 1SFEA 2XKPA 3R0JA 3K2ZA 2CQKA 4ASNA 4IF4A 4OU0A 3L2CA 1DPUA 1MJBA 3DPTA 4S05A 3ML6A 2VN2A 1H0MA 5CLSA 3U9GA 1MDMB 3DEUA 3ELKA 2KIFA 1S7OA 3K1PA 3GFIA 3FZVA 1IAWA 2UWMA 2EFOA 3MZHA 3LSTA 3ZQ7A 2J5OA 3WGGA 1HKQA 2FNAA 2O8XA 1ZG3A 5K5OA 1T98A 4HX4A 1L3LA 4LB5A 5HOOA 2NYXA 1J2XA 1OYYA 2QQBA 1KGSA 3Q9VA 3KP6A 1FP2A 2NNYA 3V7RA 3CJNA 1ZRFA 1R58A 3HRUA 4IVNA 5LEKA 3ZMDA 4ZZLA 2BYVE 3PQJA 1KYWA 3RIRA 5L3BA 2L54A 5IT9Z 3F21A 1IN7A 3ECOA 3F72A 3TO9A 4AIHA 4N9IA 3VEPA 2GWRA 1WI9A 1Z05A 1D5VA 1OMIA 1QQIA 5E8IA 1BOAA 3KE2A 4G7ZF 1ZLKA 3FMRA 1LDJA 4R1HA 4LLLA 1IF1A 5JI6A 1ZHFA 3COAC 2VC1A 2DPUA 2O6GE 3F8MA 5FFXA 5ICEA 3F8NA 4YIIA 2M8EA 1W7PD 4BQAA 2GXBA 4L9JA 1BI1A 3LAPA 3C18A 1RUNA 4Q48A 1W5SA 2BE5F 1KU2A 2CYYA 3REOA 1KA8A 2EK5A 4GXOA 5HVQC 3E6CC 1GXQA 1CF7A 3I59B 2XAHA 2WV0A 3J81Z 3LA3A 3HSRA 3P9KA 5E8GA 2H27A 2RC4A 2FRHA 3VODA 3I71A 4KMUX 5ERIA 1F4KA 3KLOA 4GYIA 3SQNA 5EEGA 2Z33A 2RNJA 3ROUA 4JK1X 2YX4A 4M6XA 2LNBA 1TQMA 2VC0A 4UNOA 1OKRA 2D1HA 2YSRA 2BGCA 1B4AA 4G7HF 4NQWA 1I27A 3GZ6A 3GFJA 5FD5A 1P4XA 4ZYEA 3R4KA 4HBLA 1BBYA 2K86A 3HIFA 1IXSB 1YG2A 5LHHA 2A07F 1K78A 3LAJA 3F8BA 2OA4A 4HQEA 4UHTA 3KCCA 5F6FA 2GQQA 4A0ZA 3M8EA 2RV8A 5FLXZ 3JTGA 4BNCA 1R23A 2GA1A 1ZLJA 2RQPA 3B02A 3MFKA 5KK1A 2V1UA 2XVCA 3F8CA 2OZUA
chains in the Genus database with same CATH superfamily
1XC5A 4KFCA 5EZGA 1FMWA 1QRYA 1JXSA 1LVAA 2IBDA 2PX9A 1TNSA 4D0PA 3V7CA 2HOTA 2HGCA 3BQZA 2JPBA 1RI7A 2K3FA 4UY8I 4MQVA 2DMUA 2LKXA 3VYRB 3EUKL 4KMFA 3WE3A 1LB2A 2CUEA 1ON1A 3C1DA 1SFXA 3HGGA 3CF2A 1RNLA 2F5FA 4PGGA 4RLQA 1SVOA 2K9LA 1LQ1A 2PEXA 1WJ5A 4LJZF 1WFXA 2LBFA 3K0LA 1BL0A 2E1CA 2Y75A 4IL6C 1XB4A 4ZDLA 3J7YJ 3CCQI 2HXIA 4CGZA 5CPRB 2VPRA 2IA0A 2ZKZA 2JUGA 5BS6A 2JA5J 1K6OA 1MIJA 2LR8A 2KIQA 4Y7NJ 1MZBA 4FHTA 2DO7A 5IY5H 4L0YB 1X2MA 3M8FA 3A03A 3OYBA 5E3LA 4XLAA 4HZFA 1G4DA 2L01A 2GBYA 1DDNA 4OIPF 2CUZA 1MSEC 5EZHA 4HYEA 2RDPA 3FHZA 1B6AA 2W85A 4O5VA 2EIKH 3K4JA 4EVIA 4XN3A 2QKLB 1R7JA 2MLKA 3LWFA 1BC7C 1P4WA 2ELHA 1WVRA 2ZNYA 2GA2A 4PZJA 3PO3J 3LA2A 5DD8A 4IRGA 4RGRA 3JRIA 3CCMI 3RKYA 4G6DA 4N4OB 2LMDA 3LOCA 4RGUA 3I55I 3RKWA 3TP0A 4LGWA 3BJAA 1TC3C 2LG4A 4ENKA 4XIDA 3AKZA 3NWTA 1YRNA 2VT2A 1PP7U 2KJBA 1FOKA 1ENHA 3HYIA 5IP9J 2BV6A 4A3IJ 4F3QA 1YJ9I 4HX7A 4F55A 2F2EA 2EFWA 4XKWA 1BA5A 1F5TA 4Z2YA 4UVCA 1YI2I 2O9LA 4EJWA 2KMUA 5E20A 2EV0A 2KKOA 3BWGA 3OMYA 1IGNA 2L4MA 4IOCF 2R0QC 3A4CA 3H3ZA 2NVTJ 2FQ3A 3H9GA 1Z7UA 3VYTB 1Z0XA 4KISA 3S16J 4CCMA 3S8PA 3KIOA 3M1CA 4MHGA 4HDVA 1K4TA 3G2BA 5IPAA 1R36A 2W84A 5FO5A 3DBLB 1P7IA 3JREA 4Y52J 1U5TA 2A69F 4NNJA 1YQAA 3DU5A 2GM4A 2EIMH 2VBYA 3ZQGA 3W3CA 2DU9A 1MKMA 4ESFA 5L3EA 3HC7A 3CMEI 2MG4A 1MNDA 2VOPA 2IS6A 2WAQA 3M07A 4B48A 1RR7A 3DFGA 3TDUC 4CZZA 1F1ZA 1XD7A 3A2KA 3Q9SA 2RN7A 3EETA 1NG6A 4FE7A 5EG0B 2XF6A 4QPQA 3MQ0A 4II2A 3HOTA 2GAUA 3O8GA 4BJ6C 3CC2I 3ABKH 4LB6B 4DGWB 2HQNA 5LGTA 1S6LA 1S9HA 1LDDA 5DCMA 2TDXA 3IWFA 3GUDA 3HRSA 3NEUA 4CH7A 2QYOA 1ZRCA 3SHFA 1Y8QB 4FQGA 2EA2A 1X2NA 1ULYA 3RKXA 2ZFWA 3DKYA 1Y1WJ 4UV8A 2Y31A 2Y0SN 1UHSA 5CVIA 2LY1A 2JVHA 3L2RA 2ZXJA 3DEWA 3ZMZA 3B73A 3WTSC 1IXCA 2R7ZJ 1YOVB 2QSFX 5D8KB 3W6VA 4XRSA 4B09A 3BR0A 2CV2A 2JTVA 1DP3A 4XLNF 2HQAA 4CXFA 1JHHA 2ELKA 2IGOA 4AVPA 3S1NJ 1NG7A 2CG4A 2HWVA 3UKGA 2XAQA 3VPRA 3A01A 2P8TA 2XAJA 3DCFA 5FKMA 2Q8KA 4L18B 2VE8A 2BOLA 4PSXA 2DTZA 1T6SA 2JPCA 3R61A 3ASOH 3HXLA 2ESHA 4LD5A 4DNCA 1BN5A 2XF5A 1VNDA 4C2MJ 2AS5F 1R71A 4NC6A 2L9RA 1G6NA 3G3ZA 3H5RA 4H4KC 3ERED 1RESA 2OD5A 4WK8F 4XL9A 4KIBA 4ZC3A 4P1WA 2NS0A 3CTAA 2WBMA 4BACA 3RTRA 3OYJA 4F91B 4BS9A 4ITVA 3LSPA 1R49A 2W4SA 4E4HA 5LBQA 4EM0B 3L09A 1ORKA 3OYLA 3WTWC 1W5TA 1ZN2A 5D6FA 1E3HA 2ZB9A 4UVBA 2K4BA 2KRCA 4U0YA 4E7SA 4PSWA 4A3JJ 3I3LA 1IRZA 3OOPA 2DCEA 2IEKA 2L7MP 3BOQA 4P55A 2DJNA 1ZGJA 1V5FA 2DQLA 2FBHA 4WCGA 1V4RA 4UV9A 1J5YA 4A93J 1KYZA 1Y0NA 1HKSA 4BL0B 1XGMA 1OFCX 2M30A 2I8DA 1XGNA 1USSA 2HOEA 4RAYA 4BXUA 2QF7A 4RAZA 3F9KA 4KN7X 2ACJA 3H5AA 3BQYA 2MH9A 4I01A 5H2FC 4BU2A 4ENMA 5B5EC 3SZTA 2JRTA 4A3FJ 1V5EA 3I5UA 1KU3A 1YJWI 2E1NA 3CMYA 4M74A 3S1MJ 1B8IA 4XLPF 2KIUA 3QYEA 2RVCA 2ZJ2A 2GLOA 4X1EA 1MBJA 4YFKF 5F64A 1WJAA 4KYWA 4A3BJ 1GHCA 1GUUA 3C3WA 3I4NJ 3CDLA 3AFHA 3C7JA 1HSJA 1YYVA 3CUQC 1TWHJ 3VYSB 1R5ID 3ZN0A 1XDSA 3FIWA 3G1LA 4BEHB 5CVUA 1TP4A 2V7FA 4ZYGA 3CC7I 1R1TA 1O57A 1SD5A 2H1KA 2KHMA 1RKWA 3LL7A 2IGNA 4CCOA 4F7ZA 2FMLA 2L4AA 4M72A 4M71A 4W1UA 3BROA 1QBJA 1BIBA 2LTPA 4Q5SF 4LK0F 1GLNA 4G12A 1AHDP 4Z6YA 2GIVA 4XMYA 3K9TA 1N77A 5GAHJ 1WJEA 1G3SA 1OPCA 4MGRA 2WTEA 1A6IA 4AIJA 3DBHB 1W4MA 3I64A 2XSJC 1FY7A 1GT0C 2BY3A 3TW6A 2AXTC 5EEHA 2RQQA 3BZCA 3QOPA 5DTDA 2W7NA 2KJCA 3CD6I 4LFUA 2IS2A 2IVMA 2R7SA 2Q0OA 4IQ4A 1T0FA 1UJ8A 4WX9A 3IRRA 1AU7A 2DDAA 1T39A 1XX5A 1TWGJ 2X1EA 3KP7A 3OYEA 2BZTA 2P5LC 2HYFA 1FWZA 3OR1C 5FROA 2BXYA 2DMPA 5H6RA 2QVOA 2OAZA 2P4WA 2Z3YA 3FXUA 4HEA2 1H9TA 4G6TB 3NQOA 1EH7A 1TQIA 4HRIA 3IH3A 3WU2C 1J7KA 3GBGA 5A2QZ 1B9NA 4I2OA 2WAQN 4BY7J 4MNUA 4B47A 5KAFC 3HTSB 2QGUA 3LMMA 1V54H 5F1RA 4MFEA 5K1YA 1O7FA 1SVMA 3HHHA 1BC8C 3ZMTA 2YX7A 4F52A 1OCRH 2VKVA 3HEFA 1R9TJ 3FK6A 3MKWB 5JVGF 4L5JA 3RQIA 1I6XA 1YTYA 2H8RA 2M4KA 4HSRA 4EGZA 2EA4A 4I99C 3IAS2 3NWSA 4CDGA 2K40A 5HDKA 2AQEA 4L9NA 5DUKA 1J0RA 2XKOA 2DBBA 3CP2A 4XLFA 2DW4A 3MCZA 1L0OC 3QP6A 1VQ8I 2XIGA 2PMZA 1ZQ3P 2GOMA 3K2AA 3OV8A 1OCOH 3BDDA 4N9HA 4QPOA 4XLCA 2HS5A 2TRTA 2B9SA 3AG2H 2Z16A 3ZPLA 4IKFA 2ZMEA 3HRMA 4AWXB 1U3EM 4I7HA 2G0EA 2DYRH 1QHGA 3F6VA 3E97A 4OMYA 1P4AA 4P9UA 4P9FA 4PFOA 4XBFA 2F4MB 2XV4S 2IAIA 4ESJA 1IW7F 3EUAA 3HUGB 2ID3A 2V1XA 3M8JA 1K7AA 2ZC2A 2K9SA 1E2XA 2ZJRF 4WXDA 4AU7A 4A69C 3E0JB 5F1JA 4GCVA 3KLNA 1IC8A 1E17A 1GVJA 1ZARA 4IHYA 2AXLA 3CUQB 3EQLF 4AYBN 1MBKA 4IQJA 1OCTC 3PO2J 4QLCU 2XRNA 2EJRA 2OQRA 4CICA 2QQAA 1S7AA 3QPHA 3H3VK 1REPC 4KDPA 2NS7A 3J80K 1FZPB 2HVSA 3CCRI 1NHAA 2OBPA 2O03A 1LFPA 2Q1ZB 3BJOA 4RAGA 3JAMK 4MFDA 1U8BA 3V8KA 1W0UA 3K4LA 1O4XA 3GTPJ 3OS2A 3A02A 2W82A 2A68F 2L0KA 1YIJI 1CF7B 3DTIA 1FT9A 1OR7A 3GTGJ 5JHUA 3IP4B 3WTVC 3VSKA 1ACIA 3L2QA 2LOOA 2NNNA 2V9KA 3TP3A 3ABTA 3OYAA 2XGEA 5IYBJ 1QGPA 4HDUA 1EV7A 3EUHA 3PNVA 4GDFA 1WJDA 1IRFA 3PIPF 2FBIA 2VL8A 3GVAA 3FXMA 2EZHA 5TGTA 2V9PA 1PYVA 5B3SH 1T8IA 4DZJA 1MJ9A 1TL8A 4KUMA 4IRIA 2OCCH 4O6JA 5JHFA 4OWRB 1IUFA 3M7GA 2PJPA 1FIPA 2AO9A 3ERMA 3MVPA 3GYHX 5M3MJ 2HPMA 2P5KA 3MKZA 1U9NA 2VBWA 3E6MA 1Z9CA 1I39A 3E5XA 4HPQA 1JT0A 1I6HJ 3VB2A 1YW7A 5ILSA 3S14J 2Q2EA 2HFHA 3AAFA 1PP8F 4LLNA 4UUVA 1WWXA 1T08B 2MA3A 2FOKA 2X1CA 2MSYA 2DFFA 3K1MA 4QWQA 4R8HA 5KAIC 1J75A 5IT3A 3KETA 4D7NA 5L3FA 1ZR2A 3FXKA 2R5YA 3FBIB 3HPHA 3N97A 3O6BB 3BTJA 3FF5A 2M1BA 1Y8RB 4I0AA 3DF8A 4CYCA 2R5ZA 2L9SA 4PFPA 1MD0A 2BY1A 3C2HA 5DDGA 3GZ5A 3RYRA 1VQ4I 3LNQA 4Y17A 1TZLA 1KONA 3QP5A 5BNGA 1VQKI 4DBQA 1MSFC 3H1CA 5FRMA 2HTSA 3HPGA 4ZDOA 2LKSA 2ZXIA 3S2WA 2EZIA 5L3GA 1TBXA 1IN6A 2PG4A 1J9IA 2VT3A 4XRMA 1KQ9A 1WKMA 4JQFA 5HS7A 1JJ6C 1B1BA 3PIOF 4EJTA 3IUOA 1SD7A 3OYFA 4HLYA 3F8FA 5DV5A 3K4KA 3MMYB 4DZPA 1UHMA 1A04A 3QPLA 2ZNZA 1OJLA 5F04A 3CCYA 3SZGA 3GFMA 5HLHA 3SZPA 4U7DA 2M7BA 2RAEA 2DA6A 4JX6A 4PJ0C 4BQQA 1XCVA 3ZQQA 3KP4A 4YELA 3FM5A 3T0YA 4WWCA 1JHFA 1QZEA 2BHYA 2DT5A 4A0XA 2D2WA 3QAHA 3W6JB 2WY8Q 1EF4A 1ZELA 1RZ4A 1X3ZB 2N8GA 4RBOA 6PAXA 2VXDA 3QU3A 2PFBA 3P9IA 4L9TA 3RZDJ 3ESWB 2L7ZA 3OL4A 4M9SA 1JUPA 3KYDB 5FKOA 5HS9A 2FNPA 5AIPA 5C44J 4O3MA 2VKDA 4C2TA 2MBFA 1YIOA 3BCAA 1MJAA 3W2VA 3JR9A 1MBFA 4P5OA 3S32A 3V4GA 2WV1A 3GXOA 4BHBA 4HSTA 4DBRA 1DQUA 1B9MA 4II3A 5IT9K 4XSXF 1FIAA 5C3EJ 4HX8A 2JQ7A 3ABMH 4FISA 1G2HA 3H92A 2NXNB 3WTUC 1AKHA 3WGHA 1U8RA 1OCZH 1LE8A 1ZAOA 2AHQA 2LYCA 1K61A 4XLHA 2DI3A 2IS4A 3R0AA 1YE9A 4RM2A 3IH4A 1FTTA 2B0LA 3BJ6A 2EV6A 4YIRX 4IHWA 4XK4A 4BGDA 1TNTA 3F6OA 5KHDA 3KZZA 2G9WA 4ZH4F 5J1YA 3L2UA 3SFZA 4OINF 1WSUA 2IT0A 1SC7A 2CGPA 2WWYA 2DFEA 4YG2F 5JFRA 1WRJA 2Z9OA 5FKLA 2QZ8A 4B4CA 1V5GA 4A5NA 4MLOA 2E2IJ 1YHQI 2JRMA 1IZ1A 5FGMA 2FSWA 2MC3A 1X58A 1YRNB 3LSMA 2FMYA 4A5MA 2DA2A 5CVRA 2NVQJ 4IX7A 1F9NA 1POGA 4Y13A 3KYLA 2K9NA 1QHHD 1X1PA 3QYFA 4G6QA 2X51A 1FOXA 1MMAA 2NS8A 3L7WA 4HA8A 3HKZN 3EYYA 3HGYA 1VTNC 2G7UA 2WA0A 3BG6A 1LNWA 2ZBKA 1NK3P 3MZ8A 2NOGA 3AG3H 2CU7A 1UAAA 4CSWA 2K7LA 2F48A 2IPQX 1FBQA 1X1DA 1XCBA 2EWNA 1R1UA 2Y69H 3HOSA 3ZQLA 1HCRA 4KICA 3BC8A 2V1NA 4BBSJ 4M9XA 2A6HF 2P5VA 1BI0A 3BR2A 3J81K 2ELJA 5DD4A 5D8LB 2HZTA 1OQYA 1HOMA 4XICA 2O8KA 3VYUB 3T5XA 2QEXI 3BTCA 4FT8A 2FUG2 1EH6A 3RI4A 5M5YJ 4L0ZB 5JR3A 2OUMA 3DLLF 1TQPA 2Y0MA 3HSEA 5LHIA 1YITI 3H35A 2Y30A 3FXJA 1QU3A 4XSZF 5HDNA 1P92A 4XRFA 1Z6TA 3LFKA 1SAXA 2PJRA 1H88C 3H36A 4E7IA 4TV7A 4AVZA 2Y9YA 1VQ6I 3I56I 3BR6A 5BQTA 4HF1A 3FWEA 1J09A 1V55H 2E60A 2QUFA 2DMTA 1VQ9I 2EFPA 5FJ8J 2L5QA 3UR3C 4ABZA 2CV1A 4U88A 4A3KJ 1JTYA 1KU7A 1Z3YA 3SFIA 1YX5A 2A3SA 1ETYA 2VODA 2W25A 3IRQA 4CCNA 1AOYA 2XPWA 1Y56A 5H20A 1JGSA 1FYMA 3JRFA 1JKOC 5CVJA 1Z1DA 1ERDA 3Q0UA 2V9VA 1JI8A 3OSGA 1LUJB 4RGSA 1T95A 1ZKGA 4AUXA 1MMGA 3A01B 1J59A 5J40A 2IS1A 4MTEA 4DYQA 2XSDC 3CCUI 4LIVA 5BMZA 1USTA 4JX4A 3PNYA 3OYDA 4AIKA 3GLLA 2HNHA 2ZSIB 1FP1D 3BCBA 1R00A 4JOMA 1JKQC 1GDTA 3WU1B 1XSXA 1SD6A 3M9AA 4ZTFA 1QA6A 1W7PA 2QLZA 1T33A 1T0FC 1XSVA 5TISC 1FMVA 4G8XA 1D5YA 5FLXK 3HL2A 2VKHA 2FD5A 1C0WA 1S7EA 4D5CA 1U9OA 4LITA 2FA5A 4KIGA 4FASD 2ZO4A 3SEQA 1RUOA 1TWCJ 4W97A 2ZJPF 3GLXA 3KFWX 4MO7A 2H6CA 2L7FP 2XHKA 4MEYF 2QBYA 4U0VA 4UVAA 5EGOA 2ZFUA 1BI2A 4KA4A 2HQRA 5ILVA 3JRBA 3RPQA 4PCQA 1I3AA 5FFZA 2OPTA 2F5DA 3L2WA 1T2KA 1XN7A 2OC6A 4ZYHA 2EQRA 1BI3A 4I98B 4NB5A 5GADJ 2XF7A 2EZKA 2VXZA 1RIOH 5HNHA 3AL0C 2WB1A 3MWMA 2AQFA 2A6TA 3A0HC 5LLQA 1ETKA 4YEJA 3PUBA 3TO7A 1MBHA 3TDZC 4RGXA 1MNEA 4OAZA 4X6AJ 1LFBA 5IYDJ 2DPDA 3F22A 1DUXC 3K70C 4HW0A 4IJAA 5K7HA 1X1CA 1TT0A 3FXQA 1Y6IA 3CCEI 2HZDA 1LJ9A 3FM3A 4PJNA 2L3DA 4YFXF 1FYKA 1B8IB 3I9V2 5E18F 1XPXA 2F4OB 2P6SA 3I0TA 1D3YA 3S2HJ 2CW0F 3DKWA 2R92J 4A3MJ 1BJAA 2M87A 3M3YJ 4G94A 4IXAA 1S8NA 3LSIA 4EM1A 1OYIA 3GTJJ 3E5QA 3IWZA 4HF0A 5GAEJ 2R93J 3F3XA 2DA7A 2O3FA 4LG0A 1SMTA 1WJCA 3O8HA 3KEYA 4IEJA 4I09A 5J4VA 1ETOA 2LRDA 1VF9A 4A3GJ 2E34A 3HTUA 3FXLA 1V3FA 2PI0A 2W48A 5DS9A 2PQ8A 2CSOA 3GCMA 2MD5A 4WXCA 1IN5A 2KP6A 3OYCA 1YO5C 1G59A 2PLYA 3I53A 2D1VA 5TJJA 3B6AA 2IXSA 3GF2A 2GXAA 2CQQA 1HLVA 2HR3A 4KN4X 2D45A 2EIJH 1D0ZA 3TQNA 2DTRA 4CHUA 3IHUA 1I3QJ 3LQQA 3L00A 3R6SA 2V79A 3OYGA 2FOWA 1U0JA 2IA1A 4HV5A 2A5YB 3H9QA 3OYKA 1UFMA 4WXHA 3SDBA 4U0WA 3MEXA 4KITB 5HDGA 2XGXA 3BLYA 1HDDC 4D1QA 3KZIC 3Q5FA 1WHUA 2E19A 1ZREA 1JUMA 1SFOJ 5JLXA 4KJZA 3GTKJ 1D1BA 2F5CA 3K10A 2VJ5A 2LY9A 2NVXJ 4HQMA 3PSFA 5K5QA 3CDIA 2V6CA 1WJBA 2ICWG 3ABUA 3HOYJ 2E5ZA 2JSCA 2DODA 3BPXA 1UZCA 2OTJI 1ODDA 5DCFA 3NRVA 2ZCWA 1FLIA 3KEQA 1XSDA 2KT0A 2OQGA 2LF8A 3BP8A 2YPRA 2ADUA 4U87A 4CCKA 2JMWA 3WU0A 2P7CB 1IRGA 4FETA 4IHVA 4Y15A 1W1WE 2DA3A 4I76A 4RDUA 3JSOA 3WTTC 3WG9A 5KVRA 2FQ4A 5K7ZA 3AL0B 3JCUC 2VPLA 2XAGA 1HA8A 2Z2SB 5L3CA 2W1OA 3GO5A 1P2FA 1O7LA 3V8LA 1ON2A 2E7WA 2HOSA 1DGWY 2HTJA 3I58A 5LGUA 2FX0A 1KQ8A 5ICGA 3GMEA 1K4SA 3BPVA 1BW6A 4AD9A 2ZMEB 4LLGF 1FSHA 3OL3A 3KEOA 2EINH 1SANA 2XUBA 2HKOA 5B66C 3JRHA 1R22A 1R4NB 1YJNI 4Q4ZF 2GOXB 4LOCA 3KP2A 3S3OA 1O3QA 1FNNA 2HKXA 5FRNA 2JA2A 2QA4I 4MQ9F 2HDCA 1SFUA 2GZWA 2DAOA 2HVQA 2X9DA 3DPLC 4XOTA 3DKXA 3HHGA 2MFZA 1EH8A 1JE8A 4V19K 4ENNA 3RDIA 4MTDA 2R7FA 2X0LA 2PBIA 2STTA 2DQRA 1OISA 3S3NA 3HOWJ 4A0YA 4XR6A 1APLC 3RKQA 4FTHA 3ZR8X 1R1VA 3RPUD 2DT7B 2BVMA 3EPZA 3WODF 3HOZJ 3Q0WA 2E35A 3IKTA 2DXIA 1RETA 3DU6A 2V4JC 2CO5A 3D5SC 5IP7J 4I0BA 4UUTA 4EV0A 2E2HJ 1HW1A 1VFCA 4GO1A 1PDNC 2L7KA 3LA7A 3QPSA 2VLAA 4FX4A 1T56A 2KIMA 5L3DA 2CQ7A 3W6KB 3WHCA 1E3OC 4IHSA 2KL4A 3H3UA 2VBXA 3E3VA 1WJFA 4BHCA 3CUOA 4EMSA 2L2OA 2DLLA 5J1RA 1UB9A 2MH2A 2BVLA 3G6EI 2VUMJ 3GEZA 4UUSA 3HOVJ 2WB1N 1PUFA 3TOBA 2KPMA 2DK8A 2LY2A 3ASNH 1IV6A 3GWZA 4LIUA 2RGVA 1MDMA 3TOAA 1LEBA 3OSFA 5J4YA 2KQRA 3U2RA 2EFQA 2FBKA 5E1XA 2IP2A 1IN4A 2STWA 2EZLA 3JTHA 2ZJQF 1JUSA 1RRJA 3IC7A 1IXRC 2VBZA 5LRRA 2DDBA 1P7JA 2UUZA 1SD4A 5E1ZB 1FBSA 4ETSA 5K5RA 1D0YA 2NVYJ 2G7HA 2Q2EB 1KZHA 3KX2A 5FD6A 1FOYA 1VQOI 2HEOA 1UG2A 1IUYA 2LDUA 3FDYA 3ISPA 4MIMA 5IOZA 3V7SA 3JW4A 4NBQA 4RM3A 5LGNA 2R5YB 3CLOA 1QNTA 3J7ZI 3E6BA 2BBYA 4AC0A 3SJMA 1VI0A 1ZG5A 2R5ZB 4CYCB 1PJRA 3O2PE 3PSIA 5HLGA 2F5EA 1I1GA 3E5UA 5CYVA 2QCOA 3P5JA 2W57A 2Z99A 2LP0A 1BR1A 1Q1VA 2LSOA 2EFNA 1ZYRF 3AG4H 5F0CA 3AG1H 4OIQF 3HUGA 2FXAA 3CJRB 3ZMVA 3ZN1A 5ILUA 5F0FA 1QZZA 2K5CA 3S1RJ 1OCCH 4C30A 4PK4A 1DU0A 3S17J 2HI3A 4NQWB 3ECHA 3MN2A 5D4RA 1X4PA 1TLHB 2EV5A 2VB6A 1CQTA 1DPRA 3CUQA 1WGXA 4UXNA 3OS0A 3MAJA 3A1YA 1AWCA 3CC4I 2JT1A 2BHZA 2QSGX 4BE0A 1XMXA 2BW3B 2R7DA 3WE2A 1K78B 1WH5A 4A12A 5M5WJ 2JJ7A 3N4MA 4CA0A 1ZRDA 3HZJA 4CO8A 2OTLI 5E1WA 5BPDA 2DA5A 1HXDA 3OWTA 2UV1A 2CS3A 4DQ2A 2I10A 2FJ1A 2OF7A 1KU9A 5EEAA 2K27A 5EJCA 4L5EA 1S3JA 2M45A 1I1SA 3EYIA 2YS9A 3IH2A 3ABLH 4BH9A 5GTHC 3DV8A 3V42A 4DIQA 5C4JJ 3HRTA 2HOAA 3QPTA 1TW3A 4S0HB 4KNYA 2B63J 5CJ9A 2R7RA 2VQGA 5A2QK 2ESNA 1FYLA 4D7MA 2M8GX 1ETQA 4KIFA 1YS6A 1WCMJ 4N4NB 1U5TC 4K2EA 4ANJA 1VQLI 1W0TA 4RB0A 1AKHB 2JZYA 2QQ9A 1B72A 2H09A 2EB7A 3LQRA 1CGPA 3QRFF 2XROA 2DFHA 2HDWA 4M3EA 3IV5A 2LC2A 3FX3A 5ICFA 3ZGKA 3DTEA 3PFIA 1X19A 2OJED 4CZCA 5LHGA 1EJ9A 2ZXHA 5FKNA 3S1QJ 2R3SA 3QYBA 2ECBA 2M3AA 2CQNA 4RLFA 2H6BA 2R7QA 2Y0SA 3S93A 1VQNI 1HQCA 1WI3A 5IP6A 3I59A 3TKYA 1RKTA 2LBFB 2XPVA 2O61A 3ONQA 3OYHA 2COBA 2LKPA 3PQKA 4N0BA 2VQHA 3SXYA 2K02A 3CZ6A 3KPHA 1TTYA 2F6CA 4BJ5C 1BIAA 5ED4A 5F27A 2RKHA 4XLEA 4EJVA 1U2WA 1HKTA 2CMPA 3K6GA 2R7OA 1YLFA 4XKVA 1IV8A 4IRHA 2BEOA 5CQGA 1IDYA 1I50J 3LFUA 2MGQA 5CKTA 2JA6J 3S15J 4BYYA 2BY2A 3FBNB 4BJTA 2M0CA 5BPIA 4BDYA 4B3XA 4HLXA 2UXXA 3J7AO 5E3MA 3H0DA 1UELB 1H9GA 2UXNA 3D5RC 5GP9A 5LEJA 1Q1HA 2PMZN 1G3TA 2PMHA 1STZA 3FXOA 4B44A 3LSJA 2LFBA 5CVVA 4E7KA 1W36C 2Z5UA 1WH7A 3JRCA 2IJLA 4LMYA 3SDGA 1BOBA 4LK1F 2VOOA 3M1EA 4EQQA 1HC8A 1U6GA 5D5UB 1W5CC 2X6WA 3D5LA 3L2VA 5D5VB 2H1LA 1N75A 1BM9A 1D0XA 5JLWA 2DA4A 3CJQB 4KT5C 4F92B 5HLIA 2ISYA 2HQ5A 5AIQA 1IJWC 4GRIA 4E7JA 3OY9A 3GTLJ 2WADA 2K85A 1K83J 3CCVI 4E6KG 2PMUA 3JRDA 2LH9A 2P6TA 4ON0A 3CF5F 4BDZA 2R7UA 3HM5A 4CCJA 2E1OA 5KCMA 4RB3C 2VJJA 3BT9A 1UHWA 2DFIA 3KZYA 2A6EF 2PJRB 3FK7A 2FEZA 2BY0A 3FXRA 3R60A 1NH3A 4OIOF 4WF2A 5IYCJ 5DM6F 1K79A 1DP7P 2KFDA 4A6EA 3V8JA 4RB2C 1FTZA 4M9ZA 5GTIC 3L9FA 1VQ5I 1D1CA 1O3RA 3RSNA 4M3GA 4QSHA 1RPWA 4I02A 2Y48A 3MZYA 4RB1A 2V1DA 3RPUA 2HDDA 5H6QA 3PNTA 5J8FA 3W2AA 1U5TB 4S04A 3BG5A 3TL4X 2PN6A 2DOEA 4A2UA 2COMA 1OCPA 2QENA 3P7NA 2E2JJ 2KRFA 3DXJF 3U21A 4DYRA 1YS7A 2CUFA 3F23A 1XMKA 3GZNB 2HVRA 2EPFA 1XGOA 1HBXG 2UZKA 1FSEA 4L5IA 5AONA 2JA7J 3IAM2 3K4BA 4NHJA 4IZZA 1X4OA 4XKBA 2M9HA 4J19A 3ZMSA 1GXPA 3WHBA 4A6DA 4XRSG 3ZQCA 1W7PB 3GFLA 3RYPA 4ZDPA 5HNFA 2JK3A 2W00A 5DCMB 1Y39A 2M4GA 2E1MB 5TRDA 1B59A 5ICCA 2K9MA 2VJ4A 3BY6A 5F0HA 1PUEE 1LDKB 5EF6A 2A5WA 4OOIA 4L9VA 4YRVA 4ENJA 1R5HA 4B8XA 3VFZA 1SMYF 1N78A 2R7WA 3H0GJ 2VKEA 3FMSA 4OAYA 1P6RA 4RA2A 1YW9A 4JBAA 2QWWA 2WAEA 3QOEA 3OS1A 4C3HJ 5E3NA 3A0BC 4DJAA 2QBYB 4IHTA 5EGOB 2XGCA 4CYDA 3IL2A 2C6YA 1WPKA 3K70D 3HOUJ 5DEQA 2MC4A 4ZTJA 1MW7A 4ZJZA 2XDVA 4HF2A 2M34A 2FE3A 2DK5A 1ZH5A 3IKVA 4BHPA 3K4NA 2Y2ZA 5D6EA 4GFBA 4JYKA 3WGIA 3GTQJ 3WTZA 1U78A 5GAGJ 5DUIA 1HDPA 4EM2A 4J01A 4G7OF 1FJLA 4BY1J 5KNLA 4YFNF 2NAZA 4ZZDA 1ZR4A 2DN0A 2OZ6A 5E3OA 2QM3A 3G1MA 3HBLA 3W2WA 4X0GA 2O0YA 5C4XJ 2KLOA 3WTYC 1ONVA 3GW2A 3CCJI 3NARA 3D0SA 1GV5A 2LD5A 4LG3A 4R79A 2GXGA 2K9QA 4J00A 4B3AA 3VOEA 2CWEA 5LD2C 2ME0A 3BG3A 3FKIJ 1IN8A 5E17F 1R4MB 3QWLA 1HW2A 1ZGAA 4U7BA 3BZ6A 2M5WA 1ZTRA 4AM3A 3CP8A 1JKPC 3G71I 1PVEA 2V26A 1D8JA 1Z91A 2K4JA 4ZYAA 4FX0A 1X3WB 1YX3A 3K69A 4IO9F 1ZG1A 2NRAC 4MEXF 1MGTA 4M3DA 3U1DA 1LFUP 3TW7A 1QZYA 4LG0B 2KZGA 3BR5A 1XGSA 2IGKA 3ZRGA 4B43A 2X6XA 4EJUA 4Y3OA 2XAUA 1F36A 1FPQA 4Q47A 2TCTA 3CO6C 3MKLA 5DYMA 4A3DJ 3ZCOA 2NVUB 5FLMJ 2KDOA 2OU2A 4HV6A 2F4IA 2IW5A 1TW2A 5JVTA 4NC8A 1X3UA 2VE9A 3X2QH 2CFXA 4PJLA 1ZGWA 2HPIA 2KISA 3O3KA 3QQAA 4PGHA 3K4MA 2ZMEC 4M73A 4C3JJ 2ISZA 5LRSA 4NUBA 1S72I 4PUSA 4M6YA 4AYBA 1XDUA 3I54A 3PJRA 5EG0A 3I4PA 4HAMA 5J6XA 1FEXA 1R5GA 2R7VA 2VIXA 4C3IJ 2YU9J 2QKMB 3ZMUA 1Z21A 2LF7A 3OYIA 4OMZA 5HS8A 4JX5A 3MD2A 3Q3SA 1UCRA 1XG1A 2HYGD 4CUGA 3KP3A 4XORA 2YR2A 4HNVA 3CCLI 3DP7A 5BOXA 3BTIA 2CRGA 1HW5A 3KP5A 3S2DJ 1YW8A 2X1DA 3T8RA 1XMAA 2KRHA 4PDKA 3GX4X 1S29A 4EJOA 2FF4A 2ZSHB 4BBRJ 4H0EA 3E6DA 2JN6A 4BQNA 1LEAA 3DQVC 2A05A 1MH4A 1FC3A 1MMSA 3DBRB 3FKJA 2ME6A 2CH0A 3WG7H 3E1SA 1A5JA 3CJTB 2I5UA 1HSTA 1T38A 1I5ZA 2VONA 1OR7C 2IA2A 4OIRF 4ESBA 3B6CA 3HSFA 3CMMA 2CW7A 4B1RA 4C9YA 3G73A 1FBUA 1JTXA 3FMQA 4HOBA 3VSLA 1NK2P 2JSPA 1FX7A 3TMOA 1Y0UA 1MMNA 4ZYDA 2WC2A 3EUHC 5J1UA 3J80Z 1OYWA 4G9YA 4E7ZA 2ID6A 5M5XJ 3OOUA 3T8TA 3JAMZ 5D4SA 2XAFA 3QU6A 4NC7A 4XN0A 2L02A 1DGRM 3QODA 4BUPA 4E70A 4RS8A 1FOWA 3CDHA 2DT6A 1R6RA 2CW8A 4I6ZA 5D5XB 4GGGA 1Z3XA 3RQ4A 2MLGA 3DTKA 4KT6A 4BAYA 2IRFG 3RZOJ 2YU3A 3J7AY 4PJMA 2X4HA 1VQMI 3EDPA 2HU9A 4V2GA 2XGDA 3HDDA 1BJZA 3P9CA 4BE2A 2J5PA 1QPMA 2P7VB 2CQXA 2FU4A 1MMDA 2H94A 5D5WB 2JVGA 4DYCA 3JSPA 1G3YA 2DA1A 3BR3A 1WQ2A 3K7AJ 3NAUA 5FLVA 3GTOJ 4GYGA 1M1EB 2ETHA 3CO7C 1ETXA 3GTMJ 3HG9A 4P96A 2LK2A 1KQ0A 2XPUA 4D9JA 1QO0D 1UMQA 2CUJA 3ULQB 4CCLA 1VZ0A 5LFAA 5J8CA 3ZP5A 5FB2A 1MH3A 4M6VA 1GVDA 3K1NA 4EGYA 1O3SA 5IOYA 3FHNA 1HF0A 1Z6RA 4YIFA 4Y4RA 4IPAA 3T1BA 1VQPI 2W24A 1O3TA 3JRGA 1E3PA 3G4SI 2VI6A 4DOZA 3D1NI 2VQLA 3TGNA 2E7XA 5GPAA 3WTXC 4DW6A 3PUFA 3RJPA 4XKCA 3TO6A 1BR4A 2DOFA 1G3WA 1A35A 2A61A 3U1KA 1D8KA 2D5VA 2XASA 1YFHA 1SFEA 2XKPA 3R0JA 4F93B 1N25A 2CQKA 3K2ZA 3OYNA 3BTLA 2L9VA 2HYJA 3K4CA 1JJ8C 4ASNA 2QQ8A 2JUCA 4IF4A 4OU0A 3L2CA 1DPUA 2CV0A 4QIWN 3PL8A 1VQ7I 1UG0A 2BXZA 1MJBA 5E79C 3ZOBA 3DPTA 4FCYA 4UB6C 1TWAJ 2RREA 4S05A 3ML6A 2MW8A 3ZQHA 5DM7F 4UUSB 3H9JA 2O5RA 5F08A 1PUFB 2EILH 5GPCA 2VN2A 4BEHA 1H0MA 3DWLE 5CLSA 3U9GA 2M2EA 1MDMB 1EKEA 3DEUA 3ELKA 2KIFA 1RC9A 1S7OA 3K1PA 1SAUA 3GFIA 3Q0VA 3HJEA 5CQEA 1A6QA 2X6OA 1ETWA 1IG7A 3FZVA 2JA8J 1IAWA 2UWMA 2EFOA 2XRLA 3ZQFA 3MZHA 3LSTA 4M3FA 4NDLA 3ZQ7A 2R7XA 3BG7A 1BW5A 2J5OA 3E7LA 3WGGA 2H8WA 1HKQA 3TBIA 2XB0X 1MBEA 3VDXA 2X6YA 2GIZA 2FNAA 2ZXWH 4XQFA 2O8XA 1ZG3A 2DYSH 1X1AA 5HLTA 2E71A 3OIOA 9ANTA 4QTRA 5K5OA 1IRXA 2DJIA 1T98A 4HX4A 1L3LA 4LB5A 5HOOA 5K7FA 2HXOA 2NYXA 1J2XA 1OYYA 3UNGC 3ZXSA 3CCSI 2QQBA 1LPQA 1KGSA 5M3FJ 3DLAA 5EYRA 4BQOA 1Z77A 3Q9VA 3KP6A 1FP2A 2NNYA 3V7RA 3CJNA 4RMNA 5B1AH 1P9QC 3BZKA 1ZRFA 1R58A 2B7EA 2LVSA 3HRUA 3M4OJ 4IVNA 5LEKA 3ZMDA 4ZZLA 2F5VA 2BYVE 4Y33A 2M7AA 3PQJA 3MKYB 1KYWA 2XC7A 3RIRA 5J3LA 5L3BA 2L54A 5IT9Z 1IO2A 4E7HA 3F21A 2LREA 2EBIA 3VWBA 2P0WA 1IN7A 2VQCA 1DU6A 3ECOA 3F72A 1EA3A 3HKZA 3PM1A 4PJJA 3TO9A 4A3CJ 4AIHA 3FISA 5J47A 2V6EA 4N9IA 3VEPA 3OIPA 3I4MJ 1K6YA 4XONA 3LSKA 2GWRA 1MNMC 1WI9A 1Z05A 1D5VA 1OMIA 4HNTA 1QQIA 1QVUA 5E8IA 4A3LJ 4RAFA 4EEFG 1BOAA 3KE2A 2OCEA 1H89C 2P81A 4G7ZF 4FE4A 1ZLKA 3FMRA 1LDJA 4R1HA 4LLLA 2YUSA 1IF1A 3L1PA 2R7TA 1QVTA 5JI6A 1ZHFA 1SVLA 4BXFA 3COAC 2VC1A 5B1BH 2DPUA 3HB9A 2O6GE 1RR8C 4UB8C 3F8MA 5FFXA 5ICEA 3BG9A 2IGMA 3F8NA 1GV2A 3N05A 4BXXJ 4YIIA 2M8EA 1W7PD 3RCOA 4BQAA 1G8XA 3LSRA 2GXBA 2X85A 4L9JA 1BR2A 3HOXJ 3F0CA 1B72B 1BI1A 1JT6A 1LKXA 3LAPA 3C18A 1LVKA 1ITYA 1RUNA 4Q48A 1W5SA 2BE5F 1KU2A 2CYYA 3REOA 2LLKA 1F43A 1OLTA 1KA8A 2JWTA 3OYMA 4XOPA 2EK5A 1Y1VJ 4GXOA 4AIDA 3DPUA 3SEZA 1SEUA 5HVQC 2WY7Q 3E6CC 2VJIA 1QPIA 1GXQA 1CF7A 3I59B 2XAHA 2WV0A 5FKKA 3J81Z 3JRAA 3LA3A 3HSRA 4JP0A 3P9KA 5E8GA 2H27A 3LSHA 2XB5A 1XTAA 2RC4A 5EDNA 2FRHA 1W36D 1TWFJ 2WAFA 3VODA 1H8AC 3S3MA 3I71A 4KMUX 2DMNA 1JKRC 2EH3A 4HG2A 5ERIA 4IHXA 3KYCB 3LSGA 1F4KA 4BKXA 1ETVA 2NOJB 3KLOA 4GYIA 4HNUA 1S5LC 4E7LA 3SQNA 5EEGA 2Z33A 2RNJA 4D5FA 3ROUA 4JK1X 2YX4A 1LE8B 4M6XA 2LNBA 1TQMA 2VC0A 4UNOA 3OR2C 1OKRA 2KDZA 2RNGA 2D1HA 2YSRA 2Y9ZA 2R4GA 1D1AA 3SYTA 3C2GA 2BGCA 1B4AA 3CESA 3CLQA 4M3BA 4G7HF 1IDZA 2MD0A 3G1OA 4V2FA 2OV7A 1I27A 4NQWA 2M0MA 2E36A 3GZ6A 3TEDA 3GFJA 1XS9A 2E5NA 1MBGA 5FD5A 1P4XA 4ZYEA 2K3PA 2O7OA 3R4KA 4HBLA 1A36A 1BBYA 2K86A 2E1MC 3CMAI 3HIFA 1IXSB 4C2UA 2MYSA 3OIQA 4BE1A 2X48A 4EATA 2BW3A 1YG2A 5LHHA 4A3EJ 2A07F 1K78A 3LAJA 1NTCA 1X1BA 3CQZJ 3F8BA 4XNFA 3DEEA 2OA4A 4HQEA 2DMQA 4UHTA 2DOAA 2KZVA 3KCCA 1E0EA 2CFOA 1A31A 1Z7LA 2MABA 3BR1A 2ECCA 5F6FA 2CJJA 2GQQA 4A0ZA 1Z67A 3C2BA 3M8EA 2VASA 1TT5B 2RV8A 5FLXZ 1AA7A 2Z1DA 3JTGA 4IOAF 1SFKA 4BNCA 3ZQIA 4XM3A 1JGGA 1R23A 2GA1A 5HODA 2QSHX 1ZLJA 2L9NA 1WZ2A 2RQPA 3B02A 3H5NA 3MFKA 1ZK8A 3PFYA 5KK1A 2V1UA 2XVCA 3F8CA 2OZUA
chains in the Genus database with same CATH topology
4KFCA 1JXSA 1LVAA 1TNSA 4D0PA 3V7CA 2HGCA 2JPBA 1RI7A 4MQVA 4KMFA 3WE3A 1LB2A 1ON1A 3C1DA 1SFXA 1RNLA 2F5FA 4PGGA 1LQ1A 2PEXA 4LJZF 3K0LA 2E1CA 2Y75A 1XB4A 2IA0A 2ZKZA 5BS6A 1K6OA 1MZBA 4FHTA 2DO7A 4L0YB 3M8FA 4HZFA 1G4DA 2L01A 1DDNA 4OIPF 4HYEA 2RDPA 3FHZA 1B6AA 2W85A 4O5VA 4EVIA 1R7JA 2MLKA 3LWFA 1BC7C 1P4WA 2ELHA 2ZNYA 2GA2A 4PZJA 3LA2A 5DD8A 4IRGA 4RGRA 3RKYA 4G6DA 4RGUA 3RKWA 4LGWA 3BJAA 4ENKA 2VT2A 1PP7U 2KJBA 1FOKA 3HYIA 2BV6A 4HX7A 2F2EA 2EFWA 1F5TA 4Z2YA 4UVCA 4EJWA 5E20A 2EV0A 2KKOA 3BWGA 2L4MA 3H3ZA 2FQ3A 1Z7UA 4MHGA 4HDVA 1R36A 2W84A 5FO5A 1U5TA 2A69F 1YQAA 2VBYA 2DU9A 1MKMA 4ESFA 5L3EA 2VOPA 3DFGA 3TDUC 4CZZA 1F1ZA 1XD7A 3Q9SA 2RN7A 3EETA 3MQ0A 3HOTA 2GAUA 4LB6B 2HQNA 5LGTA 1S6LA 1LDDA 5DCMA 2TDXA 3IWFA 3GUDA 3HRSA 3NEUA 1ZRCA 2QYOA 3SHFA 2EA2A 1ULYA 3RKXA 2ZFWA 4UV8A 5CVIA 2ZXJA 3ZMZA 3B73A 3WTSC 1IXCA 5D8KB 4B09A 2JTVA 4XLNF 4CXFA 1JHHA 4AVPA 2CG4A 2HWVA 2XAQA 2P8TA 2XAJA 2Q8KA 4L18B 2VE8A 1T6SA 2JPCA 3R61A 4LD5A 2ESHA 4DNCA 1BN5A 2AS5F 1G6NA 3G3ZA 3ERED 2OD5A 4WK8F 4KIBA 2NS0A 3CTAA 3RTRA 5LBQA 4EM0B 3L09A 3WTWC 1W5TA 1ZN2A 5D6FA 4UVBA 2K4BA 4U0YA 3OOPA 4P55A 3BOQA 1ZGJA 2DQLA 2FBHA 4WCGA 1V4RA 4UV9A 1J5YA 1KYZA 1HKSA 1XGMA 2M30A 1XGNA 1USSA 2HOEA 4RAYA 4BXUA 4RAZA 2ACJA 4KN7X 4I01A 2MH9A 4ENMA 3SZTA 2JRTA 3I5UA 1KU3A 2E1NA 4M74A 4XLPF 2KIUA 2RVCA 2ZJ2A 4YFKF 5F64A 4KYWA 1GHCA 3C3WA 1HSJA 1YYVA 3C7JA 3CUQC 3ZN0A 1XDSA 5CVUA 4ZYGA 1R1TA 1O57A 1SD5A 4F7ZA 2FMLA 2L4AA 4M72A 4M71A 3BROA 1QBJA 1BIBA 4Q5SF 4LK0F 2GIVA 3K9TA 1G3SA 1OPCA 4MGRA 2WTEA 4AIJA 1W4MA 3I64A 1FY7A 5EEHA 3QOPA 2KJCA 4LFUA 2IVMA 2Q0OA 1T0FA 4WX9A 3IRRA 1T39A 3KP7A 2P5LC 2HYFA 1FWZA 5H6RA 2QVOA 2OAZA 2P4WA 2Z3YA 3FXUA 1H9TA 3NQOA 1EH7A 1TQIA 1J7KA 5A2QZ 1B9NA 4I2OA 3HTSB 4MNUA 5F1RA 5K1YA 1O7FA 3HHHA 1BC8C 3ZMTA 2YX7A 4L5JA 1I6XA 1YTYA 4EGZA 2EA4A 4CDGA 5HDKA 5DUKA 4L9NA 1J0RA 2XKOA 2DBBA 2DW4A 3MCZA 1L0OC 3QP6A 2XIGA 3OV8A 3BDDA 4N9HA 2HS5A 3ZPLA 2ZMEA 3HRMA 4AWXB 1U3EM 4I7HA 3F6VA 3E97A 4OMYA 1P4AA 4P9UA 4P9FA 4XBFA 2XV4S 4ESJA 1IW7F 2V1XA 1K7AA 1E2XA 4WXDA 4GCVA 3KLNA 1E17A 1GVJA 1ZARA 2AXLA 3CUQB 3EQLF 4QLCU 2XRNA 2EJRA 2OQRA 4CICA 2QQAA 1S7AA 3QPHA 1REPC 4KDPA 3J80K 1FZPB 1NHAA 2OBPA 2O03A 3BJOA 3JAMK 3V8KA 2A68F 1CF7B 1FT9A 1OR7A 5JHUA 3WTVC 2NNNA 3ABTA 1QGPA 4HDUA 1EV7A 3EUHA 1IRFA 2FBIA 3GVAA 1MJ9A 4IRIA 4KUMA 4O6JA 3M7GA 2PJPA 3GYHX 2P5KA 2VBWA 3E6MA 1Z9CA 3E5XA 3VB2A 1YW7A 5ILSA 2Q2EA 2HFHA 3AAFA 1PP8F 4LLNA 4UUVA 1WWXA 2MA3A 2FOKA 3K1MA 4QWQA 4R8HA 1J75A 5IT3A 3KETA 5L3FA 3N97A 3O6BB 3FF5A 2M1BA 4I0AA 3DF8A 1MD0A 5DDGA 3GZ5A 3RYRA 4Y17A 3QP5A 2HTSA 3S2WA 5L3GA 1TBXA 1IN6A 2PG4A 1J9IA 2VT3A 1KQ9A 1WKMA 4JQFA 5HS7A 1B1BA 4EJTA 1SD7A 4HLYA 3F8FA 5DV5A 1UHMA 1A04A 2ZNZA 3GFMA 5HLHA 3SZPA 4U7DA 1XCVA 3KP4A 3FM5A 3T0YA 4WWCA 1JHFA 2DT5A 4A0XA 2D2WA 3QAHA 3W6JB 1RZ4A 6PAXA 3QU3A 2PFBA 3P9IA 4L9TA 4M9SA 5HS9A 2FNPA 5AIPA 4O3MA 2MBFA 1YIOA 1MJAA 4P5OA 3V4GA 3GXOA 4BHBA 1B9MA 5IT9K 4XSXF 4HX8A 3H92A 3WTUC 3WGHA 1U8RA 1ZAOA 2DI3A 3R0AA 2B0LA 3BJ6A 2EV6A 1TNTA 3F6OA 3KZZA 2G9WA 4ZH4F 3SFZA 4OINF 1WSUA 2IT0A 2CGPA 2WWYA 4YG2F 5JFRA 1WRJA 2Z9OA 2QZ8A 4A5NA 1IZ1A 5FGMA 2FSWA 2MC3A 2FMYA 4A5MA 5CVRA 1F9NA 4Y13A 4G6QA 3L7WA 4HA8A 3EYYA 1VTNC 2G7UA 1LNWA 2ZBKA 2K7LA 1FBQA 1XCBA 2EWNA 2IPQX 1R1UA 3HOSA 4KICA 4M9XA 2A6HF 2P5VA 1BI0A 3J81K 5DD4A 5D8LB 2HZTA 3T5XA 4FT8A 1EH6A 3RI4A 4L0ZB 5JR3A 1TQPA 2Y0MA 3HSEA 5LHIA 4XSZF 5HDNA 1P92A 4XRFA 1Z6TA 3LFKA 1SAXA 4TV7A 5BQTA 4HF1A 3FWEA 2QUFA 2EFPA 4U88A 1KU7A 2A3SA 2VODA 2W25A 3IRQA 1AOYA 5H20A 1JGSA 1FYMA 5CVJA 1Z1DA 2V9VA 4RGSA 1J59A 4MTEA 5BMZA 1USTA 4AIKA 1FP1D 1R00A 3WU1B 1XSXA 1SD6A 3M9AA 1W7PA 2QLZA 1XSVA 4G8XA 5FLXK 1C0WA 2FA5A 4KIGA 2ZO4A 1RUOA 3GLXA 3KFWX 2H6CA 2XHKA 4MEYF 2QBYA 4U0VA 4UVAA 1BI2A 4KA4A 2HQRA 5ILVA 3RPQA 4PCQA 5FFZA 1T2KA 2F5DA 1XN7A 4ZYHA 1BI3A 4I98B 4NB5A 2VXZA 1RIOH 3MWMA 5LLQA 3TO7A 3TDZC 4RGXA 2DPDA 3F22A 1DUXC 4HW0A 4IJAA 3FXQA 1LJ9A 3FM3A 2L3DA 4YFXF 1FYKA 5E18F 2P6SA 3I0TA 1D3YA 2CW0F 3DKWA 1BJAA 2M87A 4G94A 4IXAA 1S8NA 4EM1A 1OYIA 3E5QA 3IWZA 4HF0A 3F3XA 4LG0A 2O3FA 1SMTA 4I09A 3HTUA 1V3FA 2PI0A 2PQ8A 2CSOA 1YO5C 2MD5A 4WXCA 1IN5A 2PLYA 3I53A 2D1VA 5TJJA 3GF2A 2HR3A 4KN4X 2D45A 4CHUA 3TQNA 2DTRA 3IHUA 3LQQA 3L00A 3R6SA 2V79A 2IA1A 4HV5A 2A5YB 1UFMA 4WXHA 4U0WA 3MEXA 5HDGA 2XGXA 3Q5FA 1ZREA 2F5CA 4HQMA 5K5QA 2V6CA 3ABUA 2JSCA 3BPXA 1ODDA 5DCFA 3NRVA 2ZCWA 1FLIA 3KEQA 1XSDA 2OQGA 2LF8A 3BP8A 2YPRA 2ADUA 3WU0A 2P7CB 1IRGA 4Y15A 3JSOA 3WTTC 3WG9A 5KVRA 2XAGA 5L3CA 3GO5A 1P2FA 1O7LA 3V8LA 1ON2A 2E7WA 2HTJA 3I58A 5LGUA 1KQ8A 5ICGA 3BPVA 4AD9A 2ZMEB 4LLGF 1FSHA 3KEOA 2XUBA 2HKOA 1R22A 4Q4ZF 3KP2A 1O3QA 1FNNA 2HKXA 2HDCA 4MQ9F 1SFUA 2GZWA 2DAOA 3DPLC 3HHGA 1EH8A 1JE8A 4ENNA 3RDIA 4MTDA 2R7FA 2X0LA 2PBIA 2STTA 2DQRA 4A0YA 1R1VA 3WODF 3IKTA 2CO5A 4I0BA 4EV0A 1HW1A 4GO1A 1PDNC 3LA7A 4FX4A 2KIMA 5L3DA 3W6KB 4IHSA 3H3UA 2VBXA 3E3VA 4BHCA 3CUOA 4EMSA 2DLLA 1UB9A 2MH2A 3GEZA 3TOBA 2DK8A 3GWZA 2RGVA 1MDMA 3TOAA 1LEBA 3U2RA 2EFQA 2FBKA 5E1XA 2IP2A 1IN4A 2STWA 3JTHA 3IC7A 1IXRC 2VBZA 5LRRA 5E1ZB 4ETSA 5K5RA 1SD4A 4CGZA 1FBSA 2G7HA 5FD6A 2HEOA 1IUYA 2LDUA 3ISPA 3V7SA 3JW4A 5LGNA 3CLOA 1QNTA 3E6BA 2BBYA 1ZG5A 3O2PE 5HLGA 2F5EA 1I1GA 3E5UA 5CYVA 2W57A 2Z99A 2LSOA 2EFNA 1ZYRF 4OIQF 3HUGA 2FXAA 3ZMVA 5ILUA 3ZN1A 1QZZA 3ECHA 5D4RA 1TLHB 2EV5A 1DPRA 3CUQA 4UXNA 3MAJA 1AWCA 2JT1A 3WE2A 2R7DA 1K78B 4A12A 3N4MA 1ZRDA 4CO8A 5E1WA 5BPDA 1HXDA 4DQ2A 1KU9A 2K27A 1S3JA 2M45A 1I1SA 3EYIA 4BH9A 3DV8A 3HRTA 3QPTA 1TW3A 4KNYA 5CJ9A 5A2QK 2ESNA 1FYLA 4KIFA 1YS6A 1U5TC 4K2EA 4RB0A 2JZYA 2QQ9A 2H09A 2EB7A 3LQRA 1CGPA 3QRFF 2XROA 3FX3A 5ICFA 3PFIA 5LHGA 2R3SA 2H6BA 1HQCA 3I59A 3TKYA 2O61A 2LKPA 3PQKA 4N0BA 3SXYA 2K02A 1TTYA 1BIAA 5ED4A 2RKHA 4EJVA 1U2WA 1HKTA 1YLFA 4IRHA 2BEOA 4BYYA 5BPIA 4HLXA 2UXXA 3J7AO 1H9GA 2UXNA 5LEJA 1Q1HA 2PMHA 1G3TA 1STZA 5CVVA 2Z5UA 2IJLA 4LMYA 4LK1F 2VOOA 3M1EA 4EQQA 1U6GA 5D5UB 3D5LA 5D5VB 1BM9A 4KT5C 5HLIA 2ISYA 5AIQA 2PMUA 2P6TA 4ON0A 4RB3C 1UHWA 2DFIA 3KZYA 2A6EF 2FEZA 3FXRA 3R60A 4OIOF 4WF2A 1K79A 1DP7P 4A6EA 3V8JA 4RB2C 4M9ZA 3L9FA 1O3RA 4I02A 2Y48A 3MZYA 4RB1A 2V1DA 3RPUA 5H6QA 5J8FA 1U5TB 4S04A 2PN6A 4A2UA 2COMA 2QENA 3P7NA 2KRFA 3DXJF 1YS7A 3F23A 1XMKA 1XGOA 1HBXG 2UZKA 1FSEA 4L5IA 5AONA 4NHJA 3ZMSA 1GXPA 4A6DA 1W7PB 3GFLA 3RYPA 5DCMB 5TRDA 1B59A 5ICCA 3BY6A 1PUEE 1LDKB 4OOIA 4L9VA 4ENJA 1R5HA 4B8XA 3VFZA 1SMYF 3FMSA 1P6RA 1YW9A 4JBAA 2QWWA 2QBYB 4IHTA 3IL2A 4CYDA 2C6YA 5DEQA 4HF2A 2FE3A 2DK5A 1ZH5A 3IKVA 4BHPA 5D6EA 3WGIA 3WTZA 1U78A 5DUIA 4EM2A 4G7OF 4YFNF 2NAZA 4ZZDA 2OZ6A 2QM3A 2O0YA 3WTYC 1ONVA 3GW2A 3D0SA 4R79A 2GXGA 3VOEA 2CWEA 1IN8A 5E17F 1HW2A 1ZGAA 4U7BA 3BZ6A 2M5WA 1D8JA 1Z91A 2K4JA 4FX0A 3K69A 1ZG1A 2NRAC 4MEXF 1MGTA 3U1DA 1QZYA 4LG0B 1XGSA 4EJUA 1FPQA 4Q47A 3CO6C 5DYMA 2OU2A 4HV6A 2IW5A 1TW2A 5JVTA 1X3UA 2VE9A 2CFXA 3O3KA 4PGHA 4M73A 2ISZA 5LRSA 4M6YA 1XDUA 3I54A 3I4PA 4HAMA 5J6XA 1R5GA 3ZMUA 2LF7A 4OMZA 5HS8A 1UCRA 2HYGD 3KP3A 2YR2A 3DP7A 5BOXA 1HW5A 3KP5A 1YW8A 3T8RA 1XMAA 4PDKA 3GX4X 1S29A 4EJOA 2FF4A 4H0EA 3E6DA 1LEAA 3DQVC 1FC3A 1HSTA 1T38A 1I5ZA 2VONA 2IA2A 4OIRF 4ESBA 3HSFA 3G73A 1FBUA 3FMQA 4HOBA 1FX7A 1Y0UA 4ZYDA 2WC2A 3J80Z 1OYWA 4G9YA 3T8TA 3JAMZ 5D4SA 2XAFA 3QU6A 2L02A 4E70A 4RS8A 3CDHA 5D5XB 4GGGA 2MLGA 4BAYA 2IRFG 2YU3A 2X4HA 3EDPA 3P9CA 2J5PA 1QPMA 2P7VB 2FU4A 2H94A 5D5WB 3JSPA 1G3YA 1WQ2A 4GYGA 2ETHA 3CO7C 4P96A 1KQ0A 1QO0D 3ULQB 3ZP5A 5J8CA 5FB2A 4EGYA 3K1NA 1O3SA 1Z6RA 4YIFA 4IPAA 3T1BA 2W24A 1O3TA 3TGNA 2E7XA 3WTXC 3RJPA 3TO6A 1G3WA 2A61A 1D8KA 2XASA 1YFHA 1SFEA 2XKPA 3R0JA 3K2ZA 2CQKA 4ASNA 4IF4A 4OU0A 3L2CA 1DPUA 1MJBA 3DPTA 4S05A 3ML6A 2VN2A 1H0MA 5CLSA 3U9GA 1MDMB 3DEUA 3ELKA 2KIFA 1S7OA 3K1PA 3GFIA 3FZVA 1IAWA 2UWMA 2EFOA 3MZHA 3LSTA 3ZQ7A 2J5OA 3WGGA 1HKQA 2FNAA 2O8XA 1ZG3A 5K5OA 1T98A 4HX4A 1L3LA 4LB5A 5HOOA 2NYXA 1J2XA 1OYYA 2QQBA 1KGSA 3Q9VA 3KP6A 1FP2A 2NNYA 3V7RA 3CJNA 1ZRFA 1R58A 3HRUA 4IVNA 5LEKA 3ZMDA 4ZZLA 2BYVE 3PQJA 1KYWA 3RIRA 5L3BA 2L54A 5IT9Z 3F21A 1IN7A 3ECOA 3F72A 3TO9A 4AIHA 4N9IA 3VEPA 2GWRA 1WI9A 1Z05A 1D5VA 1OMIA 1QQIA 5E8IA 1BOAA 3KE2A 4G7ZF 1ZLKA 3FMRA 1LDJA 4R1HA 4LLLA 1IF1A 5JI6A 1ZHFA 3COAC 2VC1A 2DPUA 2O6GE 3F8MA 5FFXA 5ICEA 3F8NA 4YIIA 2M8EA 1W7PD 4BQAA 2GXBA 4L9JA 1BI1A 3LAPA 3C18A 1RUNA 4Q48A 1W5SA 2BE5F 1KU2A 2CYYA 3REOA 1KA8A 2EK5A 4GXOA 5HVQC 3E6CC 1GXQA 1CF7A 3I59B 2XAHA 2WV0A 3J81Z 3LA3A 3HSRA 3P9KA 5E8GA 2H27A 2RC4A 2FRHA 3VODA 3I71A 4KMUX 5ERIA 1F4KA 3KLOA 4GYIA 3SQNA 5EEGA 2Z33A 2RNJA 3ROUA 4JK1X 2YX4A 4M6XA 2LNBA 1TQMA 2VC0A 4UNOA 1OKRA 2D1HA 2YSRA 2BGCA 1B4AA 4G7HF 4NQWA 1I27A 3GZ6A 3GFJA 5FD5A 1P4XA 4ZYEA 3R4KA 4HBLA 1BBYA 2K86A 3HIFA 1IXSB 1YG2A 5LHHA 2A07F 1K78A 3LAJA 3F8BA 2OA4A 4HQEA 4UHTA 3KCCA 5F6FA 2GQQA 4A0ZA 3M8EA 2RV8A 5FLXZ 3JTGA 4BNCA 1R23A 2GA1A 1ZLJA 2RQPA 3B02A 3MFKA 5KK1A 2V1UA 2XVCA 3F8CA 2OZUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KFC A;  1JXS A;  1LVA A;  1TNS A;  4D0P A;  3V7C A;  2HGC A;  2JPB A;  1RI7 A;  4MQV A;  4KMF A;  3WE3 A;  1LB2 A;  1ON1 A;  3C1D A;  1SFX A;  1RNL A;  2F5F A;  4PGG A;  1LQ1 A;  2PEX A;  4LJZ F;  3K0L A;  2E1C A;  2Y75 A;  1XB4 A;  2IA0 A;  2ZKZ A;  5BS6 A;  1K6O A;  1MZB A;  4FHT A;  2DO7 A;  4L0Y B;  3M8F A;  4HZF A;  1G4D A;  2L01 A;  1DDN A;  4OIP F;  4HYE A;  2RDP A;  3FHZ A;  1B6A A;  2W85 A;  4O5V A;  4EVI A;  1R7J A;  2MLK A;  3LWF A;  1BC7 C;  1P4W A;  2ELH A;  2ZNY A;  2GA2 A;  4PZJ A;  3LA2 A;  5DD8 A;  4IRG A;  4RGR A;  3RKY A;  4G6D A;  4RGU A;  3RKW A;  4LGW A;  3BJA A;  4ENK A;  2VT2 A;  1PP7 U;  2KJB A;  1FOK A;  3HYI A;  2BV6 A;  4HX7 A;  2F2E A;  2EFW A;  1F5T A;  4Z2Y A;  4UVC A;  4EJW A;  5E20 A;  2EV0 A;  2KKO A;  3BWG A;  2L4M A;  3H3Z A;  2FQ3 A;  1Z7U A;  4MHG A;  4HDV A;  1R36 A;  2W84 A;  5FO5 A;  1U5T A;  2A69 F;  1YQA A;  2VBY A;  2DU9 A;  1MKM A;  4ESF A;  5L3E A;  2VOP A;  3DFG A;  3TDU C;  4CZZ A;  1F1Z A;  1XD7 A;  3Q9S A;  2RN7 A;  3EET A;  3MQ0 A;  3HOT A;  2GAU A;  4LB6 B;  2HQN A;  5LGT A;  1S6L A;  1LDD A;  5DCM A;  2TDX A;  3IWF A;  3GUD A;  3HRS A;  3NEU A;  1ZRC A;  2QYO A;  3SHF A;  2EA2 A;  1ULY A;  3RKX A;  2ZFW A;  4UV8 A;  5CVI A;  2ZXJ A;  3ZMZ A;  3B73 A;  3WTS C;  1IXC A;  5D8K B;  4B09 A;  2JTV A;  4XLN F;  4CXF A;  1JHH A;  4AVP A;  2CG4 A;  2HWV A;  2XAQ A;  2P8T A;  2XAJ A;  2Q8K A;  4L18 B;  2VE8 A;  1T6S A;  2JPC A;  3R61 A;  4LD5 A;  2ESH A;  4DNC A;  1BN5 A;  2AS5 F;  1G6N A;  3G3Z A;  3ERE D;  2OD5 A;  4WK8 F;  4KIB A;  2NS0 A;  3CTA A;  3RTR A;  5LBQ A;  4EM0 B;  3L09 A;  3WTW C;  1W5T A;  1ZN2 A;  5D6F A;  4UVB A;  2K4B A;  4U0Y A;  3OOP A;  4P55 A;  3BOQ A;  1ZGJ A;  2DQL A;  2FBH A;  4WCG A;  1V4R A;  4UV9 A;  1J5Y A;  1KYZ A;  1HKS A;  1XGM A;  2M30 A;  1XGN A;  1USS A;  2HOE A;  4RAY A;  4BXU A;  4RAZ A;  2ACJ A;  4KN7 X;  4I01 A;  2MH9 A;  4ENM A;  3SZT A;  2JRT A;  3I5U A;  1KU3 A;  2E1N A;  4M74 A;  4XLP F;  2KIU A;  2RVC A;  2ZJ2 A;  4YFK F;  5F64 A;  4KYW A;  1GHC A;  3C3W A;  1HSJ A;  1YYV A;  3C7J A;  3CUQ C;  3ZN0 A;  1XDS A;  5CVU A;  4ZYG A;  1R1T A;  1O57 A;  1SD5 A;  4F7Z A;  2FML A;  2L4A A;  4M72 A;  4M71 A;  3BRO A;  1QBJ A;  1BIB A;  4Q5S F;  4LK0 F;  2GIV A;  3K9T A;  1G3S A;  1OPC A;  4MGR A;  2WTE A;  4AIJ A;  1W4M A;  3I64 A;  1FY7 A;  5EEH A;  3QOP A;  2KJC A;  4LFU A;  2IVM A;  2Q0O A;  1T0F A;  4WX9 A;  3IRR A;  1T39 A;  3KP7 A;  2P5L C;  2HYF A;  1FWZ A;  5H6R A;  2QVO A;  2OAZ A;  2P4W A;  2Z3Y A;  3FXU A;  1H9T A;  3NQO A;  1EH7 A;  1TQI A;  1J7K A;  5A2Q Z;  1B9N A;  4I2O A;  3HTS B;  4MNU A;  5F1R A;  5K1Y A;  1O7F A;  3HHH A;  1BC8 C;  3ZMT A;  2YX7 A;  4L5J A;  1I6X A;  1YTY A;  4EGZ A;  2EA4 A;  4CDG A;  5HDK A;  5DUK A;  4L9N A;  1J0R A;  2XKO A;  2DBB A;  2DW4 A;  3MCZ A;  1L0O C;  3QP6 A;  2XIG A;  3OV8 A;  3BDD A;  4N9H A;  2HS5 A;  3ZPL A;  2ZME A;  3HRM A;  4AWX B;  1U3E M;  4I7H A;  3F6V A;  3E97 A;  4OMY A;  1P4A A;  4P9U A;  4P9F A;  4XBF A;  2XV4 S;  4ESJ A;  1IW7 F;  2V1X A;  1K7A A;  1E2X A;  4WXD A;  4GCV A;  3KLN A;  1E17 A;  1GVJ A;  1ZAR A;  2AXL A;  3CUQ B;  3EQL F;  4QLC U;  2XRN A;  2EJR A;  2OQR A;  4CIC A;  2QQA A;  1S7A A;  3QPH A;  1REP C;  4KDP A;  3J80 K;  1FZP B;  1NHA A;  2OBP A;  2O03 A;  3BJO A;  3JAM K;  3V8K A;  2A68 F;  1CF7 B;  1FT9 A;  1OR7 A;  5JHU A;  3WTV C;  2NNN A;  3ABT A;  1QGP A;  4HDU A;  1EV7 A;  3EUH A;  1IRF A;  2FBI A;  3GVA A;  1MJ9 A;  4IRI A;  4KUM A;  4O6J A;  3M7G A;  2PJP A;  3GYH X;  2P5K A;  2VBW A;  3E6M A;  1Z9C A;  3E5X A;  3VB2 A;  1YW7 A;  5ILS A;  2Q2E A;  2HFH A;  3AAF A;  1PP8 F;  4LLN A;  4UUV A;  1WWX A;  2MA3 A;  2FOK A;  3K1M A;  4QWQ A;  4R8H A;  1J75 A;  5IT3 A;  3KET A;  5L3F A;  3N97 A;  3O6B B;  3FF5 A;  2M1B A;  4I0A A;  3DF8 A;  1MD0 A;  5DDG A;  3GZ5 A;  3RYR A;  4Y17 A;  3QP5 A;  2HTS A;  3S2W A;  5L3G A;  1TBX A;  1IN6 A;  2PG4 A;  1J9I A;  2VT3 A;  1KQ9 A;  1WKM A;  4JQF A;  5HS7 A;  1B1B A;  4EJT A;  1SD7 A;  4HLY A;  3F8F A;  5DV5 A;  1UHM A;  1A04 A;  2ZNZ A;  3GFM A;  5HLH A;  3SZP A;  4U7D A;  1XCV A;  3KP4 A;  3FM5 A;  3T0Y A;  4WWC A;  1JHF A;  2DT5 A;  4A0X A;  2D2W A;  3QAH A;  3W6J B;  1RZ4 A;  6PAX A;  3QU3 A;  2PFB A;  3P9I A;  4L9T A;  4M9S A;  5HS9 A;  2FNP A;  5AIP A;  4O3M A;  2MBF A;  1YIO A;  1MJA A;  4P5O A;  3V4G A;  3GXO A;  4BHB A;  1B9M A;  5IT9 K;  4XSX F;  4HX8 A;  3H92 A;  3WTU C;  3WGH A;  1U8R A;  1ZAO A;  2DI3 A;  3R0A A;  2B0L A;  3BJ6 A;  2EV6 A;  1TNT A;  3F6O A;  3KZZ A;  2G9W A;  4ZH4 F;  3SFZ A;  4OIN F;  1WSU A;  2IT0 A;  2CGP A;  2WWY A;  4YG2 F;  5JFR A;  1WRJ A;  2Z9O A;  2QZ8 A;  4A5N A;  1IZ1 A;  5FGM A;  2FSW A;  2MC3 A;  2FMY A;  4A5M A;  5CVR A;  1F9N A;  4Y13 A;  4G6Q A;  3L7W A;  4HA8 A;  3EYY A;  1VTN C;  2G7U A;  1LNW A;  2ZBK A;  2K7L A;  1FBQ A;  1XCB A;  2EWN A;  2IPQ X;  1R1U A;  3HOS A;  4KIC A;  4M9X A;  2A6H F;  2P5V A;  1BI0 A;  3J81 K;  5DD4 A;  5D8L B;  2HZT A;  3T5X A;  4FT8 A;  1EH6 A;  3RI4 A;  4L0Z B;  5JR3 A;  1TQP A;  2Y0M A;  3HSE A;  5LHI A;  4XSZ F;  5HDN A;  1P92 A;  4XRF A;  1Z6T A;  3LFK A;  1SAX A;  4TV7 A;  5BQT A;  4HF1 A;  3FWE A;  2QUF A;  2EFP A;  4U88 A;  1KU7 A;  2A3S A;  2VOD A;  2W25 A;  3IRQ A;  1AOY A;  5H20 A;  1JGS A;  1FYM A;  5CVJ A;  1Z1D A;  2V9V A;  4RGS A;  1J59 A;  4MTE A;  5BMZ A;  1UST A;  4AIK A;  1FP1 D;  1R00 A;  3WU1 B;  1XSX A;  1SD6 A;  3M9A A;  1W7P A;  2QLZ A;  1XSV A;  4G8X A;  5FLX K;  1C0W A;  2FA5 A;  4KIG A;  2ZO4 A;  1RUO A;  3GLX A;  3KFW X;  2H6C A;  2XHK A;  4MEY F;  2QBY A;  4U0V A;  4UVA A;  1BI2 A;  4KA4 A;  2HQR A;  5ILV A;  3RPQ A;  4PCQ A;  5FFZ A;  1T2K A;  2F5D A;  1XN7 A;  4ZYH A;  1BI3 A;  4I98 B;  4NB5 A;  2VXZ A;  1RIO H;  3MWM A;  5LLQ A;  3TO7 A;  3TDZ C;  4RGX A;  2DPD A;  3F22 A;  1DUX C;  4HW0 A;  4IJA A;  3FXQ A;  1LJ9 A;  3FM3 A;  2L3D A;  4YFX F;  1FYK A;  5E18 F;  2P6S A;  3I0T A;  1D3Y A;  2CW0 F;  3DKW A;  1BJA A;  2M87 A;  4G94 A;  4IXA A;  1S8N A;  4EM1 A;  1OYI A;  3E5Q A;  3IWZ A;  4HF0 A;  3F3X A;  4LG0 A;  2O3F A;  1SMT A;  4I09 A;  3HTU A;  1V3F A;  2PI0 A;  2PQ8 A;  2CSO A;  1YO5 C;  2MD5 A;  4WXC A;  1IN5 A;  2PLY A;  3I53 A;  2D1V A;  5TJJ A;  3GF2 A;  2HR3 A;  4KN4 X;  2D45 A;  4CHU A;  3TQN A;  2DTR A;  3IHU A;  3LQQ A;  3L00 A;  3R6S A;  2V79 A;  2IA1 A;  4HV5 A;  2A5Y B;  1UFM A;  4WXH A;  4U0W A;  3MEX A;  5HDG A;  2XGX A;  3Q5F A;  1ZRE A;  2F5C A;  4HQM A;  5K5Q A;  2V6C A;  3ABU A;  2JSC A;  3BPX A;  1ODD A;  5DCF A;  3NRV A;  2ZCW A;  1FLI A;  3KEQ A;  1XSD A;  2OQG A;  2LF8 A;  3BP8 A;  2YPR A;  2ADU A;  3WU0 A;  2P7C B;  1IRG A;  4Y15 A;  3JSO A;  3WTT C;  3WG9 A;  5KVR A;  2XAG A;  5L3C A;  3GO5 A;  1P2F A;  1O7L A;  3V8L A;  1ON2 A;  2E7W A;  2HTJ A;  3I58 A;  5LGU A;  1KQ8 A;  5ICG A;  3BPV A;  4AD9 A;  2ZME B;  4LLG F;  1FSH A;  3KEO A;  2XUB A;  2HKO A;  1R22 A;  4Q4Z F;  3KP2 A;  1O3Q A;  1FNN A;  2HKX A;  2HDC A;  4MQ9 F;  1SFU A;  2GZW A;  2DAO A;  3DPL C;  3HHG A;  1EH8 A;  1JE8 A;  4ENN A;  3RDI A;  4MTD A;  2R7F A;  2X0L A;  2PBI A;  2STT A;  2DQR A;  4A0Y A;  1R1V A;  3WOD F;  3IKT A;  2CO5 A;  4I0B A;  4EV0 A;  1HW1 A;  4GO1 A;  1PDN C;  3LA7 A;  4FX4 A;  2KIM A;  5L3D A;  3W6K B;  4IHS A;  3H3U A;  2VBX A;  3E3V A;  4BHC A;  3CUO A;  4EMS A;  2DLL A;  1UB9 A;  2MH2 A;  3GEZ A;  3TOB A;  2DK8 A;  3GWZ A;  2RGV A;  1MDM A;  3TOA A;  1LEB A;  3U2R A;  2EFQ A;  2FBK A;  5E1X A;  2IP2 A;  1IN4 A;  2STW A;  3JTH A;  3IC7 A;  1IXR C;  2VBZ A;  5LRR A;  5E1Z B;  4ETS A;  5K5R A;  1SD4 A;  4CGZ A;  1FBS A;  2G7H A;  5FD6 A;  2HEO A;  1IUY A;  2LDU A;  3ISP A;  3V7S A;  3JW4 A;  5LGN A;  3CLO A;  1QNT A;  3E6B A;  2BBY A;  1ZG5 A;  3O2P E;  5HLG A;  2F5E A;  1I1G A;  3E5U A;  5CYV A;  2W57 A;  2Z99 A;  2LSO A;  2EFN A;  1ZYR F;  4OIQ F;  3HUG A;  2FXA A;  3ZMV A;  5ILU A;  3ZN1 A;  1QZZ A;  3ECH A;  5D4R A;  1TLH B;  2EV5 A;  1DPR A;  3CUQ A;  4UXN A;  3MAJ A;  1AWC A;  2JT1 A;  3WE2 A;  2R7D A;  1K78 B;  4A12 A;  3N4M A;  1ZRD A;  4CO8 A;  5E1W A;  5BPD A;  1HXD A;  4DQ2 A;  1KU9 A;  2K27 A;  1S3J A;  2M45 A;  1I1S A;  3EYI A;  4BH9 A;  3DV8 A;  3HRT A;  3QPT A;  1TW3 A;  4KNY A;  5CJ9 A;  5A2Q K;  2ESN A;  1FYL A;  4KIF A;  1YS6 A;  1U5T C;  4K2E A;  4RB0 A;  2JZY A;  2QQ9 A;  2H09 A;  2EB7 A;  3LQR A;  1CGP A;  3QRF F;  2XRO A;  3FX3 A;  5ICF A;  3PFI A;  5LHG A;  2R3S A;  2H6B A;  1HQC A;  3I59 A;  3TKY A;  2O61 A;  2LKP A;  3PQK A;  4N0B A;  3SXY A;  2K02 A;  1TTY A;  1BIA A;  5ED4 A;  2RKH A;  4EJV A;  1U2W A;  1HKT A;  1YLF A;  4IRH A;  2BEO A;  4BYY A;  5BPI A;  4HLX A;  2UXX A;  3J7A O;  1H9G A;  2UXN A;  5LEJ A;  1Q1H A;  2PMH A;  1G3T A;  1STZ A;  5CVV A;  2Z5U A;  2IJL A;  4LMY A;  4LK1 F;  2VOO A;  3M1E A;  4EQQ A;  1U6G A;  5D5U B;  3D5L A;  5D5V B;  1BM9 A;  4KT5 C;  5HLI A;  2ISY A;  5AIQ A;  2PMU A;  2P6T A;  4ON0 A;  4RB3 C;  1UHW A;  2DFI A;  3KZY A;  2A6E F;  2FEZ A;  3FXR A;  3R60 A;  4OIO F;  4WF2 A;  1K79 A;  1DP7 P;  4A6E A;  3V8J A;  4RB2 C;  4M9Z A;  3L9F A;  1O3R A;  4I02 A;  2Y48 A;  3MZY A;  4RB1 A;  2V1D A;  3RPU A;  5H6Q A;  5J8F A;  1U5T B;  4S04 A;  2PN6 A;  4A2U A;  2COM A;  2QEN A;  3P7N A;  2KRF A;  3DXJ F;  1YS7 A;  3F23 A;  1XMK A;  1XGO A;  1HBX G;  2UZK A;  1FSE A;  4L5I A;  5AON A;  4NHJ A;  3ZMS A;  1GXP A;  4A6D A;  1W7P B;  3GFL A;  3RYP A;  5DCM B;  5TRD A;  1B59 A;  5ICC A;  3BY6 A;  1PUE E;  1LDK B;  4OOI A;  4L9V A;  4ENJ A;  1R5H A;  4B8X A;  3VFZ A;  1SMY F;  3FMS A;  1P6R A;  1YW9 A;  4JBA A;  2QWW A;  2QBY B;  4IHT A;  3IL2 A;  4CYD A;  2C6Y A;  5DEQ A;  4HF2 A;  2FE3 A;  2DK5 A;  1ZH5 A;  3IKV A;  4BHP A;  5D6E A;  3WGI A;  3WTZ A;  1U78 A;  5DUI A;  4EM2 A;  4G7O F;  4YFN F;  2NAZ A;  4ZZD A;  2OZ6 A;  2QM3 A;  2O0Y A;  3WTY C;  1ONV A;  3GW2 A;  3D0S A;  4R79 A;  2GXG A;  3VOE A;  2CWE A;  1IN8 A;  5E17 F;  1HW2 A;  1ZGA A;  4U7B A;  3BZ6 A;  2M5W A;  1D8J A;  1Z91 A;  2K4J A;  4FX0 A;  3K69 A;  1ZG1 A;  2NRA C;  4MEX F;  1MGT A;  3U1D A;  1QZY A;  4LG0 B;  1XGS A;  4EJU A;  1FPQ A;  4Q47 A;  3CO6 C;  5DYM A;  2OU2 A;  4HV6 A;  2IW5 A;  1TW2 A;  5JVT A;  1X3U A;  2VE9 A;  2CFX A;  3O3K A;  4PGH A;  4M73 A;  2ISZ A;  5LRS A;  4M6Y A;  1XDU A;  3I54 A;  3I4P A;  4HAM A;  5J6X A;  1R5G A;  3ZMU A;  2LF7 A;  4OMZ A;  5HS8 A;  1UCR A;  2HYG D;  3KP3 A;  2YR2 A;  3DP7 A;  5BOX A;  1HW5 A;  3KP5 A;  1YW8 A;  3T8R A;  1XMA A;  4PDK A;  3GX4 X;  1S29 A;  4EJO A;  2FF4 A;  4H0E A;  3E6D A;  1LEA A;  3DQV C;  1FC3 A;  1HST A;  1T38 A;  1I5Z A;  2VON A;  2IA2 A;  4OIR F;  4ESB A;  3HSF A;  3G73 A;  1FBU A;  3FMQ A;  4HOB A;  1FX7 A;  1Y0U A;  4ZYD A;  2WC2 A;  3J80 Z;  1OYW A;  4G9Y A;  3T8T A;  3JAM Z;  5D4S A;  2XAF A;  3QU6 A;  2L02 A;  4E70 A;  4RS8 A;  3CDH A;  5D5X B;  4GGG A;  2MLG A;  4BAY A;  2IRF G;  2YU3 A;  2X4H A;  3EDP A;  3P9C A;  2J5P A;  1QPM A;  2P7V B;  2FU4 A;  2H94 A;  5D5W B;  3JSP A;  1G3Y A;  1WQ2 A;  4GYG A;  2ETH A;  3CO7 C;  4P96 A;  1KQ0 A;  1QO0 D;  3ULQ B;  3ZP5 A;  5J8C A;  5FB2 A;  4EGY A;  3K1N A;  1O3S A;  1Z6R A;  4YIF A;  4IPA A;  3T1B A;  2W24 A;  1O3T A;  3TGN A;  2E7X A;  3WTX C;  3RJP A;  3TO6 A;  1G3W A;  2A61 A;  1D8K A;  2XAS A;  1YFH A;  1SFE A;  2XKP A;  3R0J A;  3K2Z A;  2CQK A;  4ASN A;  4IF4 A;  4OU0 A;  3L2C A;  1DPU A;  1MJB A;  3DPT A;  4S05 A;  3ML6 A;  2VN2 A;  1H0M A;  5CLS A;  3U9G A;  1MDM B;  3DEU A;  3ELK A;  2KIF A;  1S7O A;  3K1P A;  3GFI A;  3FZV A;  1IAW A;  2UWM A;  2EFO A;  3MZH A;  3LST A;  3ZQ7 A;  2J5O A;  3WGG A;  1HKQ A;  2FNA A;  2O8X A;  1ZG3 A;  5K5O A;  1T98 A;  4HX4 A;  1L3L A;  4LB5 A;  5HOO A;  2NYX A;  1J2X A;  1OYY A;  2QQB A;  1KGS A;  3Q9V A;  3KP6 A;  1FP2 A;  2NNY A;  3V7R A;  3CJN A;  1ZRF A;  1R58 A;  3HRU A;  4IVN A;  5LEK A;  3ZMD A;  4ZZL A;  2BYV E;  3PQJ A;  1KYW A;  3RIR A;  5L3B A;  2L54 A;  5IT9 Z;  3F21 A;  1IN7 A;  3ECO A;  3F72 A;  3TO9 A;  4AIH A;  4N9I A;  3VEP A;  2GWR A;  1WI9 A;  1Z05 A;  1D5V A;  1OMI A;  1QQI A;  5E8I A;  1BOA A;  3KE2 A;  4G7Z F;  1ZLK A;  3FMR A;  1LDJ A;  4R1H A;  4LLL A;  1IF1 A;  5JI6 A;  1ZHF A;  3COA C;  2VC1 A;  2DPU A;  2O6G E;  3F8M A;  5FFX A;  5ICE A;  3F8N A;  4YII A;  2M8E A;  1W7P D;  4BQA A;  2GXB A;  4L9J A;  1BI1 A;  3LAP A;  3C18 A;  1RUN A;  4Q48 A;  1W5S A;  2BE5 F;  1KU2 A;  2CYY A;  3REO A;  1KA8 A;  2EK5 A;  4GXO A;  5HVQ C;  3E6C C;  1GXQ A;  1CF7 A;  3I59 B;  2XAH A;  2WV0 A;  3J81 Z;  3LA3 A;  3HSR A;  3P9K A;  5E8G A;  2H27 A;  2RC4 A;  2FRH A;  3VOD A;  3I71 A;  4KMU X;  5ERI A;  1F4K A;  3KLO A;  4GYI A;  3SQN A;  5EEG A;  2Z33 A;  2RNJ A;  3ROU A;  4JK1 X;  2YX4 A;  4M6X A;  2LNB A;  1TQM A;  2VC0 A;  4UNO A;  1OKR A;  2D1H A;  2YSR A;  2BGC A;  1B4A A;  4G7H F;  4NQW A;  1I27 A;  3GZ6 A;  3GFJ A;  5FD5 A;  1P4X A;  4ZYE A;  3R4K A;  4HBL A;  1BBY A;  2K86 A;  3HIF A;  1IXS B;  1YG2 A;  5LHH A;  2A07 F;  1K78 A;  3LAJ A;  3F8B A;  2OA4 A;  4HQE A;  4UHT A;  3KCC A;  5F6F A;  2GQQ A;  4A0Z A;  3M8E A;  2RV8 A;  5FLX Z;  3JTG A;  4BNC A;  1R23 A;  2GA1 A;  1ZLJ A;  2RQP A;  3B02 A;  3MFK A;  5KK1 A;  2V1U A;  2XVC A;  3F8C A;  2OZU A; 
#chains in the Genus database with same CATH topology
 1XC5 A;  4KFC A;  5EZG A;  1FMW A;  1QRY A;  1JXS A;  1LVA A;  2IBD A;  2PX9 A;  1TNS A;  4D0P A;  3V7C A;  2HOT A;  2HGC A;  3BQZ A;  2JPB A;  1RI7 A;  2K3F A;  4UY8 I;  4MQV A;  2DMU A;  2LKX A;  3VYR B;  3EUK L;  4KMF A;  3WE3 A;  1LB2 A;  2CUE A;  1ON1 A;  3C1D A;  1SFX A;  3HGG A;  3CF2 A;  1RNL A;  2F5F A;  4PGG A;  4RLQ A;  1SVO A;  2K9L A;  1LQ1 A;  2PEX A;  1WJ5 A;  4LJZ F;  1WFX A;  2LBF A;  3K0L A;  1BL0 A;  2E1C A;  2Y75 A;  4IL6 C;  1XB4 A;  4ZDL A;  3J7Y J;  3CCQ I;  2HXI A;  4CGZ A;  5CPR B;  2VPR A;  2IA0 A;  2ZKZ A;  2JUG A;  5BS6 A;  2JA5 J;  1K6O A;  1MIJ A;  2LR8 A;  2KIQ A;  4Y7N J;  1MZB A;  4FHT A;  2DO7 A;  5IY5 H;  4L0Y B;  1X2M A;  3M8F A;  3A03 A;  3OYB A;  5E3L A;  4XLA A;  4HZF A;  1G4D A;  2L01 A;  2GBY A;  1DDN A;  4OIP F;  2CUZ A;  1MSE C;  5EZH A;  4HYE A;  2RDP A;  3FHZ A;  1B6A A;  2W85 A;  4O5V A;  2EIK H;  3K4J A;  4EVI A;  4XN3 A;  2QKL B;  1R7J A;  2MLK A;  3LWF A;  1BC7 C;  1P4W A;  2ELH A;  1WVR A;  2ZNY A;  2GA2 A;  4PZJ A;  3PO3 J;  3LA2 A;  5DD8 A;  4IRG A;  4RGR A;  3JRI A;  3CCM I;  3RKY A;  4G6D A;  4N4O B;  2LMD A;  3LOC A;  4RGU A;  3I55 I;  3RKW A;  3TP0 A;  4LGW A;  3BJA A;  1TC3 C;  2LG4 A;  4ENK A;  4XID A;  3AKZ A;  3NWT A;  1YRN A;  2VT2 A;  1PP7 U;  2KJB A;  1FOK A;  1ENH A;  3HYI A;  5IP9 J;  2BV6 A;  4A3I J;  4F3Q A;  1YJ9 I;  4HX7 A;  4F55 A;  2F2E A;  2EFW A;  4XKW A;  1BA5 A;  1F5T A;  4Z2Y A;  4UVC A;  1YI2 I;  2O9L A;  4EJW A;  2KMU A;  5E20 A;  2EV0 A;  2KKO A;  3BWG A;  3OMY A;  1IGN A;  2L4M A;  4IOC F;  2R0Q C;  3A4C A;  3H3Z A;  2NVT J;  2FQ3 A;  3H9G A;  1Z7U A;  3VYT B;  1Z0X A;  4KIS A;  3S16 J;  4CCM A;  3S8P A;  3KIO A;  3M1C A;  4MHG A;  4HDV A;  1K4T A;  3G2B A;  5IPA A;  1R36 A;  2W84 A;  5FO5 A;  3DBL B;  1P7I A;  3JRE A;  4Y52 J;  1U5T A;  2A69 F;  4NNJ A;  1YQA A;  3DU5 A;  2GM4 A;  2EIM H;  2VBY A;  3ZQG A;  3W3C A;  2DU9 A;  1MKM A;  4ESF A;  5L3E A;  3HC7 A;  3CME I;  2MG4 A;  1MND A;  2VOP A;  2IS6 A;  2WAQ A;  3M07 A;  4B48 A;  1RR7 A;  3DFG A;  3TDU C;  4CZZ A;  1F1Z A;  1XD7 A;  3A2K A;  3Q9S A;  2RN7 A;  3EET A;  1NG6 A;  4FE7 A;  5EG0 B;  2XF6 A;  4QPQ A;  3MQ0 A;  4II2 A;  3HOT A;  2GAU A;  3O8G A;  4BJ6 C;  3CC2 I;  3ABK H;  4LB6 B;  4DGW B;  2HQN A;  5LGT A;  1S6L A;  1S9H A;  1LDD A;  5DCM A;  2TDX A;  3IWF A;  3GUD A;  3HRS A;  3NEU A;  4CH7 A;  2QYO A;  1ZRC A;  3SHF A;  1Y8Q B;  4FQG A;  2EA2 A;  1X2N A;  1ULY A;  3RKX A;  2ZFW A;  3DKY A;  1Y1W J;  4UV8 A;  2Y31 A;  2Y0S N;  1UHS A;  5CVI A;  2LY1 A;  2JVH A;  3L2R A;  2ZXJ A;  3DEW A;  3ZMZ A;  3B73 A;  3WTS C;  1IXC A;  2R7Z J;  1YOV B;  2QSF X;  5D8K B;  3W6V A;  4XRS A;  4B09 A;  3BR0 A;  2CV2 A;  2JTV A;  1DP3 A;  4XLN F;  2HQA A;  4CXF A;  1JHH A;  2ELK A;  2IGO A;  4AVP A;  3S1N J;  1NG7 A;  2CG4 A;  2HWV A;  3UKG A;  2XAQ A;  3VPR A;  3A01 A;  2P8T A;  2XAJ A;  3DCF A;  5FKM A;  2Q8K A;  4L18 B;  2VE8 A;  2BOL A;  4PSX A;  2DTZ A;  1T6S A;  2JPC A;  3R61 A;  3ASO H;  3HXL A;  2ESH A;  4LD5 A;  4DNC A;  1BN5 A;  2XF5 A;  1VND A;  4C2M J;  2AS5 F;  1R71 A;  4NC6 A;  2L9R A;  1G6N A;  3G3Z A;  3H5R A;  4H4K C;  3ERE D;  1RES A;  2OD5 A;  4WK8 F;  4XL9 A;  4KIB A;  4ZC3 A;  4P1W A;  2NS0 A;  3CTA A;  2WBM A;  4BAC A;  3RTR A;  3OYJ A;  4F91 B;  4BS9 A;  4ITV A;  3LSP A;  1R49 A;  2W4S A;  4E4H A;  5LBQ A;  4EM0 B;  3L09 A;  1ORK A;  3OYL A;  3WTW C;  1W5T A;  1ZN2 A;  5D6F A;  1E3H A;  2ZB9 A;  4UVB A;  2K4B A;  2KRC A;  4U0Y A;  4E7S A;  4PSW A;  4A3J J;  3I3L A;  1IRZ A;  3OOP A;  2DCE A;  2IEK A;  2L7M P;  3BOQ A;  4P55 A;  2DJN A;  1ZGJ A;  1V5F A;  2DQL A;  2FBH A;  4WCG A;  1V4R A;  4UV9 A;  1J5Y A;  4A93 J;  1KYZ A;  1Y0N A;  1HKS A;  4BL0 B;  1XGM A;  1OFC X;  2M30 A;  2I8D A;  1XGN A;  1USS A;  2HOE A;  4RAY A;  4BXU A;  2QF7 A;  4RAZ A;  3F9K A;  4KN7 X;  2ACJ A;  3H5A A;  3BQY A;  2MH9 A;  4I01 A;  5H2F C;  4BU2 A;  4ENM A;  5B5E C;  3SZT A;  2JRT A;  4A3F J;  1V5E A;  3I5U A;  1KU3 A;  1YJW I;  2E1N A;  3CMY A;  4M74 A;  3S1M J;  1B8I A;  4XLP F;  2KIU A;  3QYE A;  2RVC A;  2ZJ2 A;  2GLO A;  4X1E A;  1MBJ A;  4YFK F;  5F64 A;  1WJA A;  4KYW A;  4A3B J;  1GHC A;  1GUU A;  3C3W A;  3I4N J;  3CDL A;  3AFH A;  3C7J A;  1HSJ A;  1YYV A;  3CUQ C;  1TWH J;  3VYS B;  1R5I D;  3ZN0 A;  1XDS A;  3FIW A;  3G1L A;  4BEH B;  5CVU A;  1TP4 A;  2V7F A;  4ZYG A;  3CC7 I;  1R1T A;  1O57 A;  1SD5 A;  2H1K A;  2KHM A;  1RKW A;  3LL7 A;  2IGN A;  4CCO A;  4F7Z A;  2FML A;  2L4A A;  4M72 A;  4M71 A;  4W1U A;  3BRO A;  1QBJ A;  1BIB A;  2LTP A;  4Q5S F;  4LK0 F;  1GLN A;  4G12 A;  1AHD P;  4Z6Y A;  2GIV A;  4XMY A;  3K9T A;  1N77 A;  5GAH J;  1WJE A;  1G3S A;  1OPC A;  4MGR A;  2WTE A;  1A6I A;  4AIJ A;  3DBH B;  1W4M A;  3I64 A;  2XSJ C;  1FY7 A;  1GT0 C;  2BY3 A;  3TW6 A;  2AXT C;  5EEH A;  2RQQ A;  3BZC A;  3QOP A;  5DTD A;  2W7N A;  2KJC A;  3CD6 I;  4LFU A;  2IS2 A;  2IVM A;  2R7S A;  2Q0O A;  4IQ4 A;  1T0F A;  1UJ8 A;  4WX9 A;  3IRR A;  1AU7 A;  2DDA A;  1T39 A;  1XX5 A;  1TWG J;  2X1E A;  3KP7 A;  3OYE A;  2BZT A;  2P5L C;  2HYF A;  1FWZ A;  3OR1 C;  5FRO A;  2BXY A;  2DMP A;  5H6R A;  2QVO A;  2OAZ A;  2P4W A;  2Z3Y A;  3FXU A;  4HEA 2;  1H9T A;  4G6T B;  3NQO A;  1EH7 A;  1TQI A;  4HRI A;  3IH3 A;  3WU2 C;  1J7K A;  3GBG A;  5A2Q Z;  1B9N A;  4I2O A;  2WAQ N;  4BY7 J;  4MNU A;  4B47 A;  5KAF C;  3HTS B;  2QGU A;  3LMM A;  1V54 H;  5F1R A;  4MFE A;  5K1Y A;  1O7F A;  1SVM A;  3HHH A;  1BC8 C;  3ZMT A;  2YX7 A;  4F52 A;  1OCR H;  2VKV A;  3HEF A;  1R9T J;  3FK6 A;  3MKW B;  5JVG F;  4L5J A;  3RQI A;  1I6X A;  1YTY A;  2H8R A;  2M4K A;  4HSR A;  4EGZ A;  2EA4 A;  4I99 C;  3IAS 2;  3NWS A;  4CDG A;  2K40 A;  5HDK A;  2AQE A;  4L9N A;  5DUK A;  1J0R A;  2XKO A;  2DBB A;  3CP2 A;  4XLF A;  2DW4 A;  3MCZ A;  1L0O C;  3QP6 A;  1VQ8 I;  2XIG A;  2PMZ A;  1ZQ3 P;  2GOM A;  3K2A A;  3OV8 A;  1OCO H;  3BDD A;  4N9H A;  4QPO A;  4XLC A;  2HS5 A;  2TRT A;  2B9S A;  3AG2 H;  2Z16 A;  3ZPL A;  4IKF A;  2ZME A;  3HRM A;  4AWX B;  1U3E M;  4I7H A;  2G0E A;  2DYR H;  1QHG A;  3F6V A;  3E97 A;  4OMY A;  1P4A A;  4P9U A;  4P9F A;  4PFO A;  4XBF A;  2F4M B;  2XV4 S;  2IAI A;  4ESJ A;  1IW7 F;  3EUA A;  3HUG B;  2ID3 A;  2V1X A;  3M8J A;  1K7A A;  2ZC2 A;  2K9S A;  1E2X A;  2ZJR F;  4WXD A;  4AU7 A;  4A69 C;  3E0J B;  5F1J A;  4GCV A;  3KLN A;  1IC8 A;  1E17 A;  1GVJ A;  1ZAR A;  4IHY A;  2AXL A;  3CUQ B;  3EQL F;  4AYB N;  1MBK A;  4IQJ A;  1OCT C;  3PO2 J;  4QLC U;  2XRN A;  2EJR A;  2OQR A;  4CIC A;  2QQA A;  1S7A A;  3QPH A;  3H3V K;  1REP C;  4KDP A;  2NS7 A;  3J80 K;  1FZP B;  2HVS A;  3CCR I;  1NHA A;  2OBP A;  2O03 A;  1LFP A;  2Q1Z B;  3BJO A;  4RAG A;  3JAM K;  4MFD A;  1U8B A;  3V8K A;  1W0U A;  3K4L A;  1O4X A;  3GTP J;  3OS2 A;  3A02 A;  2W82 A;  2A68 F;  2L0K A;  1YIJ I;  1CF7 B;  3DTI A;  1FT9 A;  1OR7 A;  3GTG J;  5JHU A;  3IP4 B;  3WTV C;  3VSK A;  1ACI A;  3L2Q A;  2LOO A;  2NNN A;  2V9K A;  3TP3 A;  3ABT A;  3OYA A;  2XGE A;  5IYB J;  1QGP A;  4HDU A;  1EV7 A;  3EUH A;  3PNV A;  4GDF A;  1WJD A;  1IRF A;  3PIP F;  2FBI A;  2VL8 A;  3GVA A;  3FXM A;  2EZH A;  5TGT A;  2V9P A;  1PYV A;  5B3S H;  1T8I A;  4DZJ A;  1MJ9 A;  1TL8 A;  4KUM A;  4IRI A;  2OCC H;  4O6J A;  5JHF A;  4OWR B;  1IUF A;  3M7G A;  2PJP A;  1FIP A;  2AO9 A;  3ERM A;  3MVP A;  3GYH X;  5M3M J;  2HPM A;  2P5K A;  3MKZ A;  1U9N A;  2VBW A;  3E6M A;  1Z9C A;  1I39 A;  3E5X A;  4HPQ A;  1JT0 A;  1I6H J;  3VB2 A;  1YW7 A;  5ILS A;  3S14 J;  2Q2E A;  2HFH A;  3AAF A;  1PP8 F;  4LLN A;  4UUV A;  1WWX A;  1T08 B;  2MA3 A;  2FOK A;  2X1C A;  2MSY A;  2DFF A;  3K1M A;  4QWQ A;  4R8H A;  5KAI C;  1J75 A;  5IT3 A;  3KET A;  4D7N A;  5L3F A;  1ZR2 A;  3FXK A;  2R5Y A;  3FBI B;  3HPH A;  3N97 A;  3O6B B;  3BTJ A;  3FF5 A;  2M1B A;  1Y8R B;  4I0A A;  3DF8 A;  4CYC A;  2R5Z A;  2L9S A;  4PFP A;  1MD0 A;  2BY1 A;  3C2H A;  5DDG A;  3GZ5 A;  3RYR A;  1VQ4 I;  3LNQ A;  4Y17 A;  1TZL A;  1KON A;  3QP5 A;  5BNG A;  1VQK I;  4DBQ A;  1MSF C;  3H1C A;  5FRM A;  2HTS A;  3HPG A;  4ZDO A;  2LKS A;  2ZXI A;  3S2W A;  2EZI A;  5L3G A;  1TBX A;  1IN6 A;  2PG4 A;  1J9I A;  2VT3 A;  4XRM A;  1KQ9 A;  1WKM A;  4JQF A;  5HS7 A;  1JJ6 C;  1B1B A;  3PIO F;  4EJT A;  3IUO A;  1SD7 A;  3OYF A;  4HLY A;  3F8F A;  5DV5 A;  3K4K A;  3MMY B;  4DZP A;  1UHM A;  1A04 A;  3QPL A;  2ZNZ A;  1OJL A;  5F04 A;  3CCY A;  3SZG A;  3GFM A;  5HLH A;  3SZP A;  4U7D A;  2M7B A;  2RAE A;  2DA6 A;  4JX6 A;  4PJ0 C;  4BQQ A;  1XCV A;  3ZQQ A;  3KP4 A;  4YEL A;  3FM5 A;  3T0Y A;  4WWC A;  1JHF A;  1QZE A;  2BHY A;  2DT5 A;  4A0X A;  2D2W A;  3QAH A;  3W6J B;  2WY8 Q;  1EF4 A;  1ZEL A;  1RZ4 A;  1X3Z B;  2N8G A;  4RBO A;  6PAX A;  2VXD A;  3QU3 A;  2PFB A;  3P9I A;  4L9T A;  3RZD J;  3ESW B;  2L7Z A;  3OL4 A;  4M9S A;  1JUP A;  3KYD B;  5FKO A;  5HS9 A;  2FNP A;  5AIP A;  5C44 J;  4O3M A;  2VKD A;  4C2T A;  2MBF A;  1YIO A;  3BCA A;  1MJA A;  3W2V A;  3JR9 A;  1MBF A;  4P5O A;  3S32 A;  3V4G A;  2WV1 A;  3GXO A;  4BHB A;  4HST A;  4DBR A;  1DQU A;  1B9M A;  4II3 A;  5IT9 K;  4XSX F;  1FIA A;  5C3E J;  4HX8 A;  2JQ7 A;  3ABM H;  4FIS A;  1G2H A;  3H92 A;  2NXN B;  3WTU C;  1AKH A;  3WGH A;  1U8R A;  1OCZ H;  1LE8 A;  1ZAO A;  2AHQ A;  2LYC A;  1K61 A;  4XLH A;  2DI3 A;  2IS4 A;  3R0A A;  1YE9 A;  4RM2 A;  3IH4 A;  1FTT A;  2B0L A;  3BJ6 A;  2EV6 A;  4YIR X;  4IHW A;  4XK4 A;  4BGD A;  1TNT A;  3F6O A;  5KHD A;  3KZZ A;  2G9W A;  4ZH4 F;  5J1Y A;  3L2U A;  3SFZ A;  4OIN F;  1WSU A;  2IT0 A;  1SC7 A;  2CGP A;  2WWY A;  2DFE A;  4YG2 F;  5JFR A;  1WRJ A;  2Z9O A;  5FKL A;  2QZ8 A;  4B4C A;  1V5G A;  4A5N A;  4MLO A;  2E2I J;  1YHQ I;  2JRM A;  1IZ1 A;  5FGM A;  2FSW A;  2MC3 A;  1X58 A;  1YRN B;  3LSM A;  2FMY A;  4A5M A;  2DA2 A;  5CVR A;  2NVQ J;  4IX7 A;  1F9N A;  1POG A;  4Y13 A;  3KYL A;  2K9N A;  1QHH D;  1X1P A;  3QYF A;  4G6Q A;  2X51 A;  1FOX A;  1MMA A;  2NS8 A;  3L7W A;  4HA8 A;  3HKZ N;  3EYY A;  3HGY A;  1VTN C;  2G7U A;  2WA0 A;  3BG6 A;  1LNW A;  2ZBK A;  1NK3 P;  3MZ8 A;  2NOG A;  3AG3 H;  2CU7 A;  1UAA A;  4CSW A;  2K7L A;  2F48 A;  2IPQ X;  1FBQ A;  1X1D A;  1XCB A;  2EWN A;  1R1U A;  2Y69 H;  3HOS A;  3ZQL A;  1HCR A;  4KIC A;  3BC8 A;  2V1N A;  4BBS J;  4M9X A;  2A6H F;  2P5V A;  1BI0 A;  3BR2 A;  3J81 K;  2ELJ A;  5DD4 A;  5D8L B;  2HZT A;  1OQY A;  1HOM A;  4XIC A;  2O8K A;  3VYU B;  3T5X A;  2QEX I;  3BTC A;  4FT8 A;  2FUG 2;  1EH6 A;  3RI4 A;  5M5Y J;  4L0Z B;  5JR3 A;  2OUM A;  3DLL F;  1TQP A;  2Y0M A;  3HSE A;  5LHI A;  1YIT I;  3H35 A;  2Y30 A;  3FXJ A;  1QU3 A;  4XSZ F;  5HDN A;  1P92 A;  4XRF A;  1Z6T A;  3LFK A;  1SAX A;  2PJR A;  1H88 C;  3H36 A;  4E7I A;  4TV7 A;  4AVZ A;  2Y9Y A;  1VQ6 I;  3I56 I;  3BR6 A;  5BQT A;  4HF1 A;  3FWE A;  1J09 A;  1V55 H;  2E60 A;  2QUF A;  2DMT A;  1VQ9 I;  2EFP A;  5FJ8 J;  2L5Q A;  3UR3 C;  4ABZ A;  2CV1 A;  4U88 A;  4A3K J;  1JTY A;  1KU7 A;  1Z3Y A;  3SFI A;  1YX5 A;  2A3S A;  1ETY A;  2VOD A;  2W25 A;  3IRQ A;  4CCN A;  1AOY A;  2XPW A;  1Y56 A;  5H20 A;  1JGS A;  1FYM A;  3JRF A;  1JKO C;  5CVJ A;  1Z1D A;  1ERD A;  3Q0U A;  2V9V A;  1JI8 A;  3OSG A;  1LUJ B;  4RGS A;  1T95 A;  1ZKG A;  4AUX A;  1MMG A;  3A01 B;  1J59 A;  5J40 A;  2IS1 A;  4MTE A;  4DYQ A;  2XSD C;  3CCU I;  4LIV A;  5BMZ A;  1UST A;  4JX4 A;  3PNY A;  3OYD A;  4AIK A;  3GLL A;  2HNH A;  2ZSI B;  1FP1 D;  3BCB A;  1R00 A;  4JOM A;  1JKQ C;  1GDT A;  3WU1 B;  1XSX A;  1SD6 A;  3M9A A;  4ZTF A;  1QA6 A;  1W7P A;  2QLZ A;  1T33 A;  1T0F C;  1XSV A;  5TIS C;  1FMV A;  4G8X A;  1D5Y A;  5FLX K;  3HL2 A;  2VKH A;  2FD5 A;  1C0W A;  1S7E A;  4D5C A;  1U9O A;  4LIT A;  2FA5 A;  4KIG A;  4FAS D;  2ZO4 A;  3SEQ A;  1RUO A;  1TWC J;  4W97 A;  2ZJP F;  3GLX A;  3KFW X;  4MO7 A;  2H6C A;  2L7F P;  2XHK A;  4MEY F;  2QBY A;  4U0V A;  4UVA A;  5EGO A;  2ZFU A;  1BI2 A;  4KA4 A;  2HQR A;  5ILV A;  3JRB A;  3RPQ A;  4PCQ A;  1I3A A;  5FFZ A;  2OPT A;  2F5D A;  3L2W A;  1T2K A;  1XN7 A;  2OC6 A;  4ZYH A;  2EQR A;  1BI3 A;  4I98 B;  4NB5 A;  5GAD J;  2XF7 A;  2EZK A;  2VXZ A;  1RIO H;  5HNH A;  3AL0 C;  2WB1 A;  3MWM A;  2AQF A;  2A6T A;  3A0H C;  5LLQ A;  1ETK A;  4YEJ A;  3PUB A;  3TO7 A;  1MBH A;  3TDZ C;  4RGX A;  1MNE A;  4OAZ A;  4X6A J;  1LFB A;  5IYD J;  2DPD A;  3F22 A;  1DUX C;  3K70 C;  4HW0 A;  4IJA A;  5K7H A;  1X1C A;  1TT0 A;  3FXQ A;  1Y6I A;  3CCE I;  2HZD A;  1LJ9 A;  3FM3 A;  4PJN A;  2L3D A;  4YFX F;  1FYK A;  1B8I B;  3I9V 2;  5E18 F;  1XPX A;  2F4O B;  2P6S A;  3I0T A;  1D3Y A;  3S2H J;  2CW0 F;  3DKW A;  2R92 J;  4A3M J;  1BJA A;  2M87 A;  3M3Y J;  4G94 A;  4IXA A;  1S8N A;  3LSI A;  4EM1 A;  1OYI A;  3GTJ J;  3E5Q A;  3IWZ A;  4HF0 A;  5GAE J;  2R93 J;  3F3X A;  2DA7 A;  2O3F A;  4LG0 A;  1SMT A;  1WJC A;  3O8H A;  3KEY A;  4IEJ A;  4I09 A;  5J4V A;  1ETO A;  2LRD A;  1VF9 A;  4A3G J;  2E34 A;  3HTU A;  3FXL A;  1V3F A;  2PI0 A;  2W48 A;  5DS9 A;  2PQ8 A;  2CSO A;  3GCM A;  2MD5 A;  4WXC A;  1IN5 A;  2KP6 A;  3OYC A;  1YO5 C;  1G59 A;  2PLY A;  3I53 A;  2D1V A;  5TJJ A;  3B6A A;  2IXS A;  3GF2 A;  2GXA A;  2CQQ A;  1HLV A;  2HR3 A;  4KN4 X;  2D45 A;  2EIJ H;  1D0Z A;  3TQN A;  2DTR A;  4CHU A;  3IHU A;  1I3Q J;  3LQQ A;  3L00 A;  3R6S A;  2V79 A;  3OYG A;  2FOW A;  1U0J A;  2IA1 A;  4HV5 A;  2A5Y B;  3H9Q A;  3OYK A;  1UFM A;  4WXH A;  3SDB A;  4U0W A;  3MEX A;  4KIT B;  5HDG A;  2XGX A;  3BLY A;  1HDD C;  4D1Q A;  3KZI C;  3Q5F A;  1WHU A;  2E19 A;  1ZRE A;  1JUM A;  1SFO J;  5JLX A;  4KJZ A;  3GTK J;  1D1B A;  2F5C A;  3K10 A;  2VJ5 A;  2LY9 A;  2NVX J;  4HQM A;  3PSF A;  5K5Q A;  3CDI A;  2V6C A;  1WJB A;  2ICW G;  3ABU A;  3HOY J;  2E5Z A;  2JSC A;  2DOD A;  3BPX A;  1UZC A;  2OTJ I;  1ODD A;  5DCF A;  3NRV A;  2ZCW A;  1FLI A;  3KEQ A;  1XSD A;  2KT0 A;  2OQG A;  2LF8 A;  3BP8 A;  2YPR A;  2ADU A;  4U87 A;  4CCK A;  2JMW A;  3WU0 A;  2P7C B;  1IRG A;  4FET A;  4IHV A;  4Y15 A;  1W1W E;  2DA3 A;  4I76 A;  4RDU A;  3JSO A;  3WTT C;  3WG9 A;  5KVR A;  2FQ4 A;  5K7Z A;  3AL0 B;  3JCU C;  2VPL A;  2XAG A;  1HA8 A;  2Z2S B;  5L3C A;  2W1O A;  3GO5 A;  1P2F A;  1O7L A;  3V8L A;  1ON2 A;  2E7W A;  2HOS A;  1DGW Y;  2HTJ A;  3I58 A;  5LGU A;  2FX0 A;  1KQ8 A;  5ICG A;  3GME A;  1K4S A;  3BPV A;  1BW6 A;  4AD9 A;  2ZME B;  4LLG F;  1FSH A;  3OL3 A;  3KEO A;  2EIN H;  1SAN A;  2XUB A;  2HKO A;  5B66 C;  3JRH A;  1R22 A;  1R4N B;  1YJN I;  4Q4Z F;  2GOX B;  4LOC A;  3KP2 A;  3S3O A;  1O3Q A;  1FNN A;  2HKX A;  5FRN A;  2JA2 A;  2QA4 I;  4MQ9 F;  2HDC A;  1SFU A;  2GZW A;  2DAO A;  2HVQ A;  2X9D A;  3DPL C;  4XOT A;  3DKX A;  3HHG A;  2MFZ A;  1EH8 A;  1JE8 A;  4V19 K;  4ENN A;  3RDI A;  4MTD A;  2R7F A;  2X0L A;  2PBI A;  2STT A;  2DQR A;  1OIS A;  3S3N A;  3HOW J;  4A0Y A;  4XR6 A;  1APL C;  3RKQ A;  4FTH A;  3ZR8 X;  1R1V A;  3RPU D;  2DT7 B;  2BVM A;  3EPZ A;  3WOD F;  3HOZ J;  3Q0W A;  2E35 A;  3IKT A;  2DXI A;  1RET A;  3DU6 A;  2V4J C;  2CO5 A;  3D5S C;  5IP7 J;  4I0B A;  4UUT A;  4EV0 A;  2E2H J;  1HW1 A;  1VFC A;  4GO1 A;  1PDN C;  2L7K A;  3LA7 A;  3QPS A;  2VLA A;  4FX4 A;  1T56 A;  2KIM A;  5L3D A;  2CQ7 A;  3W6K B;  3WHC A;  1E3O C;  4IHS A;  2KL4 A;  3H3U A;  2VBX A;  3E3V A;  1WJF A;  4BHC A;  3CUO A;  4EMS A;  2L2O A;  2DLL A;  5J1R A;  1UB9 A;  2MH2 A;  2BVL A;  3G6E I;  2VUM J;  3GEZ A;  4UUS A;  3HOV J;  2WB1 N;  1PUF A;  3TOB A;  2KPM A;  2DK8 A;  2LY2 A;  3ASN H;  1IV6 A;  3GWZ A;  4LIU A;  2RGV A;  1MDM A;  3TOA A;  1LEB A;  3OSF A;  5J4Y A;  2KQR A;  3U2R A;  2EFQ A;  2FBK A;  5E1X A;  2IP2 A;  1IN4 A;  2STW A;  2EZL A;  3JTH A;  2ZJQ F;  1JUS A;  1RRJ A;  3IC7 A;  1IXR C;  2VBZ A;  5LRR A;  2DDB A;  1P7J A;  2UUZ A;  1SD4 A;  5E1Z B;  1FBS A;  4ETS A;  5K5R A;  1D0Y A;  2NVY J;  2G7H A;  2Q2E B;  1KZH A;  3KX2 A;  5FD6 A;  1FOY A;  1VQO I;  2HEO A;  1UG2 A;  1IUY A;  2LDU A;  3FDY A;  3ISP A;  4MIM A;  5IOZ A;  3V7S A;  3JW4 A;  4NBQ A;  4RM3 A;  5LGN A;  2R5Y B;  3CLO A;  1QNT A;  3J7Z I;  3E6B A;  2BBY A;  4AC0 A;  3SJM A;  1VI0 A;  1ZG5 A;  2R5Z B;  4CYC B;  1PJR A;  3O2P E;  3PSI A;  5HLG A;  2F5E A;  1I1G A;  3E5U A;  5CYV A;  2QCO A;  3P5J A;  2W57 A;  2Z99 A;  2LP0 A;  1BR1 A;  1Q1V A;  2LSO A;  2EFN A;  1ZYR F;  3AG4 H;  5F0C A;  3AG1 H;  4OIQ F;  3HUG A;  2FXA A;  3CJR B;  3ZMV A;  3ZN1 A;  5ILU A;  5F0F A;  1QZZ A;  2K5C A;  3S1R J;  1OCC H;  4C30 A;  4PK4 A;  1DU0 A;  3S17 J;  2HI3 A;  4NQW B;  3ECH A;  3MN2 A;  5D4R A;  1X4P A;  1TLH B;  2EV5 A;  2VB6 A;  1CQT A;  1DPR A;  3CUQ A;  1WGX A;  4UXN A;  3OS0 A;  3MAJ A;  3A1Y A;  1AWC A;  3CC4 I;  2JT1 A;  2BHZ A;  2QSG X;  4BE0 A;  1XMX A;  2BW3 B;  2R7D A;  3WE2 A;  1K78 B;  1WH5 A;  4A12 A;  5M5W J;  2JJ7 A;  3N4M A;  4CA0 A;  1ZRD A;  3HZJ A;  4CO8 A;  2OTL I;  5E1W A;  5BPD A;  2DA5 A;  1HXD A;  3OWT A;  2UV1 A;  2CS3 A;  4DQ2 A;  2I10 A;  2FJ1 A;  2OF7 A;  1KU9 A;  5EEA A;  2K27 A;  5EJC A;  4L5E A;  1S3J A;  2M45 A;  1I1S A;  3EYI A;  2YS9 A;  3IH2 A;  3ABL H;  4BH9 A;  5GTH C;  3DV8 A;  3V42 A;  4DIQ A;  5C4J J;  3HRT A;  2HOA A;  3QPT A;  1TW3 A;  4S0H B;  4KNY A;  2B63 J;  5CJ9 A;  2R7R A;  2VQG A;  5A2Q K;  2ESN A;  1FYL A;  4D7M A;  2M8G X;  1ETQ A;  4KIF A;  1YS6 A;  1WCM J;  4N4N B;  1U5T C;  4K2E A;  4ANJ A;  1VQL I;  1W0T A;  4RB0 A;  1AKH B;  2JZY A;  2QQ9 A;  1B72 A;  2H09 A;  2EB7 A;  3LQR A;  1CGP A;  3QRF F;  2XRO A;  2DFH A;  2HDW A;  4M3E A;  3IV5 A;  2LC2 A;  3FX3 A;  5ICF A;  3ZGK A;  3DTE A;  3PFI A;  1X19 A;  2OJE D;  4CZC A;  5LHG A;  1EJ9 A;  2ZXH A;  5FKN A;  3S1Q J;  2R3S A;  3QYB A;  2ECB A;  2M3A A;  2CQN A;  4RLF A;  2H6B A;  2R7Q A;  2Y0S A;  3S93 A;  1VQN I;  1HQC A;  1WI3 A;  5IP6 A;  3I59 A;  3TKY A;  1RKT A;  2LBF B;  2XPV A;  2O61 A;  3ONQ A;  3OYH A;  2COB A;  2LKP A;  3PQK A;  4N0B A;  2VQH A;  3SXY A;  2K02 A;  3CZ6 A;  3KPH A;  1TTY A;  2F6C A;  4BJ5 C;  1BIA A;  5ED4 A;  5F27 A;  2RKH A;  4XLE A;  4EJV A;  1U2W A;  1HKT A;  2CMP A;  3K6G A;  2R7O A;  1YLF A;  4XKV A;  1IV8 A;  4IRH A;  2BEO A;  5CQG A;  1IDY A;  1I50 J;  3LFU A;  2MGQ A;  5CKT A;  2JA6 J;  3S15 J;  4BYY A;  2BY2 A;  3FBN B;  4BJT A;  2M0C A;  5BPI A;  4BDY A;  4B3X A;  4HLX A;  2UXX A;  3J7A O;  5E3M A;  3H0D A;  1UEL B;  1H9G A;  2UXN A;  3D5R C;  5GP9 A;  5LEJ A;  1Q1H A;  2PMZ N;  1G3T A;  2PMH A;  1STZ A;  3FXO A;  4B44 A;  3LSJ A;  2LFB A;  5CVV A;  4E7K A;  1W36 C;  2Z5U A;  1WH7 A;  3JRC A;  2IJL A;  4LMY A;  3SDG A;  1BOB A;  4LK1 F;  2VOO A;  3M1E A;  4EQQ A;  1HC8 A;  1U6G A;  5D5U B;  1W5C C;  2X6W A;  3D5L A;  3L2V A;  5D5V B;  2H1L A;  1N75 A;  1BM9 A;  1D0X A;  5JLW A;  2DA4 A;  3CJQ B;  4KT5 C;  4F92 B;  5HLI A;  2ISY A;  2HQ5 A;  5AIQ A;  1IJW C;  4GRI A;  4E7J A;  3OY9 A;  3GTL J;  2WAD A;  2K85 A;  1K83 J;  3CCV I;  4E6K G;  2PMU A;  3JRD A;  2LH9 A;  2P6T A;  4ON0 A;  3CF5 F;  4BDZ A;  2R7U A;  3HM5 A;  4CCJ A;  2E1O A;  5KCM A;  4RB3 C;  2VJJ A;  3BT9 A;  1UHW A;  2DFI A;  3KZY A;  2A6E F;  2PJR B;  3FK7 A;  2FEZ A;  2BY0 A;  3FXR A;  3R60 A;  1NH3 A;  4OIO F;  4WF2 A;  5IYC J;  5DM6 F;  1K79 A;  1DP7 P;  2KFD A;  4A6E A;  3V8J A;  4RB2 C;  1FTZ A;  4M9Z A;  5GTI C;  3L9F A;  1VQ5 I;  1D1C A;  1O3R A;  3RSN A;  4M3G A;  4QSH A;  1RPW A;  4I02 A;  2Y48 A;  3MZY A;  4RB1 A;  2V1D A;  3RPU A;  2HDD A;  5H6Q A;  3PNT A;  5J8F A;  3W2A A;  1U5T B;  4S04 A;  3BG5 A;  3TL4 X;  2PN6 A;  2DOE A;  4A2U A;  2COM A;  1OCP A;  2QEN A;  3P7N A;  2E2J J;  2KRF A;  3DXJ F;  3U21 A;  4DYR A;  1YS7 A;  2CUF A;  3F23 A;  1XMK A;  3GZN B;  2HVR A;  2EPF A;  1XGO A;  1HBX G;  2UZK A;  1FSE A;  4L5I A;  5AON A;  2JA7 J;  3IAM 2;  3K4B A;  4NHJ A;  4IZZ A;  1X4O A;  4XKB A;  2M9H A;  4J19 A;  3ZMS A;  1GXP A;  3WHB A;  4A6D A;  4XRS G;  3ZQC A;  1W7P B;  3GFL A;  3RYP A;  4ZDP A;  5HNF A;  2JK3 A;  2W00 A;  5DCM B;  1Y39 A;  2M4G A;  2E1M B;  5TRD A;  1B59 A;  5ICC A;  2K9M A;  2VJ4 A;  3BY6 A;  5F0H A;  1PUE E;  1LDK B;  5EF6 A;  2A5W A;  4OOI A;  4L9V A;  4YRV A;  4ENJ A;  1R5H A;  4B8X A;  3VFZ A;  1SMY F;  1N78 A;  2R7W A;  3H0G J;  2VKE A;  3FMS A;  4OAY A;  1P6R A;  4RA2 A;  1YW9 A;  4JBA A;  2QWW A;  2WAE A;  3QOE A;  3OS1 A;  4C3H J;  5E3N A;  3A0B C;  4DJA A;  2QBY B;  4IHT A;  5EGO B;  2XGC A;  4CYD A;  3IL2 A;  2C6Y A;  1WPK A;  3K70 D;  3HOU J;  5DEQ A;  2MC4 A;  4ZTJ A;  1MW7 A;  4ZJZ A;  2XDV A;  4HF2 A;  2M34 A;  2FE3 A;  2DK5 A;  1ZH5 A;  3IKV A;  4BHP A;  3K4N A;  2Y2Z A;  5D6E A;  4GFB A;  4JYK A;  3WGI A;  3GTQ J;  3WTZ A;  1U78 A;  5GAG J;  5DUI A;  1HDP A;  4EM2 A;  4J01 A;  4G7O F;  1FJL A;  4BY1 J;  5KNL A;  4YFN F;  2NAZ A;  4ZZD A;  1ZR4 A;  2DN0 A;  2OZ6 A;  5E3O A;  2QM3 A;  3G1M A;  3HBL A;  3W2W A;  4X0G A;  2O0Y A;  5C4X J;  2KLO A;  3WTY C;  1ONV A;  3GW2 A;  3CCJ I;  3NAR A;  3D0S A;  1GV5 A;  2LD5 A;  4LG3 A;  4R79 A;  2GXG A;  2K9Q A;  4J00 A;  4B3A A;  3VOE A;  2CWE A;  5LD2 C;  2ME0 A;  3BG3 A;  3FKI J;  1IN8 A;  5E17 F;  1R4M B;  3QWL A;  1HW2 A;  1ZGA A;  4U7B A;  3BZ6 A;  2M5W A;  1ZTR A;  4AM3 A;  3CP8 A;  1JKP C;  3G71 I;  1PVE A;  2V26 A;  1D8J A;  1Z91 A;  2K4J A;  4ZYA A;  4FX0 A;  1X3W B;  1YX3 A;  3K69 A;  4IO9 F;  1ZG1 A;  2NRA C;  4MEX F;  1MGT A;  4M3D A;  3U1D A;  1LFU P;  3TW7 A;  1QZY A;  4LG0 B;  2KZG A;  3BR5 A;  1XGS A;  2IGK A;  3ZRG A;  4B43 A;  2X6X A;  4EJU A;  4Y3O A;  2XAU A;  1F36 A;  1FPQ A;  4Q47 A;  2TCT A;  3CO6 C;  3MKL A;  5DYM A;  4A3D J;  3ZCO A;  2NVU B;  5FLM J;  2KDO A;  2OU2 A;  4HV6 A;  2F4I A;  2IW5 A;  1TW2 A;  5JVT A;  4NC8 A;  1X3U A;  2VE9 A;  3X2Q H;  2CFX A;  4PJL A;  1ZGW A;  2HPI A;  2KIS A;  3O3K A;  3QQA A;  4PGH A;  3K4M A;  2ZME C;  4M73 A;  4C3J J;  2ISZ A;  5LRS A;  4NUB A;  1S72 I;  4PUS A;  4M6Y A;  4AYB A;  1XDU A;  3I54 A;  3PJR A;  5EG0 A;  3I4P A;  4HAM A;  5J6X A;  1FEX A;  1R5G A;  2R7V A;  2VIX A;  4C3I J;  2YU9 J;  2QKM B;  3ZMU A;  1Z21 A;  2LF7 A;  3OYI A;  4OMZ A;  5HS8 A;  4JX5 A;  3MD2 A;  3Q3S A;  1UCR A;  1XG1 A;  2HYG D;  4CUG A;  3KP3 A;  4XOR A;  2YR2 A;  4HNV A;  3CCL I;  3DP7 A;  5BOX A;  3BTI A;  2CRG A;  1HW5 A;  3KP5 A;  3S2D J;  1YW8 A;  2X1D A;  3T8R A;  1XMA A;  2KRH A;  4PDK A;  3GX4 X;  1S29 A;  4EJO A;  2FF4 A;  2ZSH B;  4BBR J;  4H0E A;  3E6D A;  2JN6 A;  4BQN A;  1LEA A;  3DQV C;  2A05 A;  1MH4 A;  1FC3 A;  1MMS A;  3DBR B;  3FKJ A;  2ME6 A;  2CH0 A;  3WG7 H;  3E1S A;  1A5J A;  3CJT B;  2I5U A;  1HST A;  1T38 A;  1I5Z A;  2VON A;  1OR7 C;  2IA2 A;  4OIR F;  4ESB A;  3B6C A;  3HSF A;  3CMM A;  2CW7 A;  4B1R A;  4C9Y A;  3G73 A;  1FBU A;  1JTX A;  3FMQ A;  4HOB A;  3VSL A;  1NK2 P;  2JSP A;  1FX7 A;  3TMO A;  1Y0U A;  1MMN A;  4ZYD A;  2WC2 A;  3EUH C;  5J1U A;  3J80 Z;  1OYW A;  4G9Y A;  4E7Z A;  2ID6 A;  5M5X J;  3OOU A;  3T8T A;  3JAM Z;  5D4S A;  2XAF A;  3QU6 A;  4NC7 A;  4XN0 A;  2L02 A;  1DGR M;  3QOD A;  4BUP A;  4E70 A;  4RS8 A;  1FOW A;  3CDH A;  2DT6 A;  1R6R A;  2CW8 A;  4I6Z A;  5D5X B;  4GGG A;  1Z3X A;  3RQ4 A;  2MLG A;  3DTK A;  4KT6 A;  4BAY A;  2IRF G;  3RZO J;  2YU3 A;  3J7A Y;  4PJM A;  2X4H A;  1VQM I;  3EDP A;  2HU9 A;  4V2G A;  2XGD A;  3HDD A;  1BJZ A;  3P9C A;  4BE2 A;  2J5P A;  1QPM A;  2P7V B;  2CQX A;  2FU4 A;  1MMD A;  2H94 A;  5D5W B;  2JVG A;  4DYC A;  3JSP A;  1G3Y A;  2DA1 A;  3BR3 A;  1WQ2 A;  3K7A J;  3NAU A;  5FLV A;  3GTO J;  4GYG A;  1M1E B;  2ETH A;  3CO7 C;  1ETX A;  3GTM J;  3HG9 A;  4P96 A;  2LK2 A;  1KQ0 A;  2XPU A;  4D9J A;  1QO0 D;  1UMQ A;  2CUJ A;  3ULQ B;  4CCL A;  1VZ0 A;  5LFA A;  5J8C A;  3ZP5 A;  5FB2 A;  1MH3 A;  4M6V A;  1GVD A;  3K1N A;  4EGY A;  1O3S A;  5IOY A;  3FHN A;  1HF0 A;  1Z6R A;  4YIF A;  4Y4R A;  4IPA A;  3T1B A;  1VQP I;  2W24 A;  1O3T A;  3JRG A;  1E3P A;  3G4S I;  2VI6 A;  4DOZ A;  3D1N I;  2VQL A;  3TGN A;  2E7X A;  5GPA A;  3WTX C;  4DW6 A;  3PUF A;  3RJP A;  4XKC A;  3TO6 A;  1BR4 A;  2DOF A;  1G3W A;  1A35 A;  2A61 A;  3U1K A;  1D8K A;  2D5V A;  2XAS A;  1YFH A;  1SFE A;  2XKP A;  3R0J A;  4F93 B;  1N25 A;  2CQK A;  3K2Z A;  3OYN A;  3BTL A;  2L9V A;  2HYJ A;  3K4C A;  1JJ8 C;  4ASN A;  2QQ8 A;  2JUC A;  4IF4 A;  4OU0 A;  3L2C A;  1DPU A;  2CV0 A;  4QIW N;  3PL8 A;  1VQ7 I;  1UG0 A;  2BXZ A;  1MJB A;  5E79 C;  3ZOB A;  3DPT A;  4FCY A;  4UB6 C;  1TWA J;  2RRE A;  4S05 A;  3ML6 A;  2MW8 A;  3ZQH A;  5DM7 F;  4UUS B;  3H9J A;  2O5R A;  5F08 A;  1PUF B;  2EIL H;  5GPC A;  2VN2 A;  4BEH A;  1H0M A;  3DWL E;  5CLS A;  3U9G A;  2M2E A;  1MDM B;  1EKE A;  3DEU A;  3ELK A;  2KIF A;  1RC9 A;  1S7O A;  3K1P A;  1SAU A;  3GFI A;  3Q0V A;  3HJE A;  5CQE A;  1A6Q A;  2X6O A;  1ETW A;  1IG7 A;  3FZV A;  2JA8 J;  1IAW A;  2UWM A;  2EFO A;  2XRL A;  3ZQF A;  3MZH A;  3LST A;  4M3F A;  4NDL A;  3ZQ7 A;  2R7X A;  3BG7 A;  1BW5 A;  2J5O A;  3E7L A;  3WGG A;  2H8W A;  1HKQ A;  3TBI A;  2XB0 X;  1MBE A;  3VDX A;  2X6Y A;  2GIZ A;  2FNA A;  2ZXW H;  4XQF A;  2O8X A;  1ZG3 A;  2DYS H;  1X1A A;  5HLT A;  2E71 A;  3OIO A;  9ANT A;  4QTR A;  5K5O A;  1IRX A;  2DJI A;  1T98 A;  4HX4 A;  1L3L A;  4LB5 A;  5HOO A;  5K7F A;  2HXO A;  2NYX A;  1J2X A;  1OYY A;  3UNG C;  3ZXS A;  3CCS I;  2QQB A;  1LPQ A;  1KGS A;  5M3F J;  3DLA A;  5EYR A;  4BQO A;  1Z77 A;  3Q9V A;  3KP6 A;  1FP2 A;  2NNY A;  3V7R A;  3CJN A;  4RMN A;  5B1A H;  1P9Q C;  3BZK A;  1ZRF A;  1R58 A;  2B7E A;  2LVS A;  3HRU A;  3M4O J;  4IVN A;  5LEK A;  3ZMD A;  4ZZL A;  2F5V A;  2BYV E;  4Y33 A;  2M7A A;  3PQJ A;  3MKY B;  1KYW A;  2XC7 A;  3RIR A;  5J3L A;  5L3B A;  2L54 A;  5IT9 Z;  1IO2 A;  4E7H A;  3F21 A;  2LRE A;  2EBI A;  3VWB A;  2P0W A;  1IN7 A;  2VQC A;  1DU6 A;  3ECO A;  3F72 A;  1EA3 A;  3HKZ A;  3PM1 A;  4PJJ A;  3TO9 A;  4A3C J;  4AIH A;  3FIS A;  5J47 A;  2V6E A;  4N9I A;  3VEP A;  3OIP A;  3I4M J;  1K6Y A;  4XON A;  3LSK A;  2GWR A;  1MNM C;  1WI9 A;  1Z05 A;  1D5V A;  1OMI A;  4HNT A;  1QQI A;  1QVU A;  5E8I A;  4A3L J;  4RAF A;  4EEF G;  1BOA A;  3KE2 A;  2OCE A;  1H89 C;  2P81 A;  4G7Z F;  4FE4 A;  1ZLK A;  3FMR A;  1LDJ A;  4R1H A;  4LLL A;  2YUS A;  1IF1 A;  3L1P A;  2R7T A;  1QVT A;  5JI6 A;  1ZHF A;  1SVL A;  4BXF A;  3COA C;  2VC1 A;  5B1B H;  2DPU A;  3HB9 A;  2O6G E;  1RR8 C;  4UB8 C;  3F8M A;  5FFX A;  5ICE A;  3BG9 A;  2IGM A;  3F8N A;  1GV2 A;  3N05 A;  4BXX J;  4YII A;  2M8E A;  1W7P D;  3RCO A;  4BQA A;  1G8X A;  3LSR A;  2GXB A;  2X85 A;  4L9J A;  1BR2 A;  3HOX J;  3F0C A;  1B72 B;  1BI1 A;  1JT6 A;  1LKX A;  3LAP A;  3C18 A;  1LVK A;  1ITY A;  1RUN A;  4Q48 A;  1W5S A;  2BE5 F;  1KU2 A;  2CYY A;  3REO A;  2LLK A;  1F43 A;  1OLT A;  1KA8 A;  2JWT A;  3OYM A;  4XOP A;  2EK5 A;  1Y1V J;  4GXO A;  4AID A;  3DPU A;  3SEZ A;  1SEU A;  5HVQ C;  2WY7 Q;  3E6C C;  2VJI A;  1QPI A;  1GXQ A;  1CF7 A;  3I59 B;  2XAH A;  2WV0 A;  5FKK A;  3J81 Z;  3JRA A;  3LA3 A;  3HSR A;  4JP0 A;  3P9K A;  5E8G A;  2H27 A;  3LSH A;  2XB5 A;  1XTA A;  2RC4 A;  5EDN A;  2FRH A;  1W36 D;  1TWF J;  2WAF A;  3VOD A;  1H8A C;  3S3M A;  3I71 A;  4KMU X;  2DMN A;  1JKR C;  2EH3 A;  4HG2 A;  5ERI A;  4IHX A;  3KYC B;  3LSG A;  1F4K A;  4BKX A;  1ETV A;  2NOJ B;  3KLO A;  4GYI A;  4HNU A;  1S5L C;  4E7L A;  3SQN A;  5EEG A;  2Z33 A;  2RNJ A;  4D5F A;  3ROU A;  4JK1 X;  2YX4 A;  1LE8 B;  4M6X A;  2LNB A;  1TQM A;  2VC0 A;  4UNO A;  3OR2 C;  1OKR A;  2KDZ A;  2RNG A;  2D1H A;  2YSR A;  2Y9Z A;  2R4G A;  1D1A A;  3SYT A;  3C2G A;  2BGC A;  1B4A A;  3CES A;  3CLQ A;  4M3B A;  4G7H F;  1IDZ A;  2MD0 A;  3G1O A;  4V2F A;  2OV7 A;  1I27 A;  4NQW A;  2M0M A;  2E36 A;  3GZ6 A;  3TED A;  3GFJ A;  1XS9 A;  2E5N A;  1MBG A;  5FD5 A;  1P4X A;  4ZYE A;  2K3P A;  2O7O A;  3R4K A;  4HBL A;  1A36 A;  1BBY A;  2K86 A;  2E1M C;  3CMA I;  3HIF A;  1IXS B;  4C2U A;  2MYS A;  3OIQ A;  4BE1 A;  2X48 A;  4EAT A;  2BW3 A;  1YG2 A;  5LHH A;  4A3E J;  2A07 F;  1K78 A;  3LAJ A;  1NTC A;  1X1B A;  3CQZ J;  3F8B A;  4XNF A;  3DEE A;  2OA4 A;  4HQE A;  2DMQ A;  4UHT A;  2DOA A;  2KZV A;  3KCC A;  1E0E A;  2CFO A;  1A31 A;  1Z7L A;  2MAB A;  3BR1 A;  2ECC A;  5F6F A;  2CJJ A;  2GQQ A;  4A0Z A;  1Z67 A;  3C2B A;  3M8E A;  2VAS A;  1TT5 B;  2RV8 A;  5FLX Z;  1AA7 A;  2Z1D A;  3JTG A;  4IOA F;  1SFK A;  4BNC A;  3ZQI A;  4XM3 A;  1JGG A;  1R23 A;  2GA1 A;  5HOD A;  2QSH X;  1ZLJ A;  2L9N A;  1WZ2 A;  2RQP A;  3B02 A;  3H5N A;  3MFK A;  1ZK8 A;  3PFY A;  5KK1 A;  2V1U A;  2XVC A;  3F8C A;  2OZU A; 
#chains in the Genus database with same CATH homology
 4KFC A;  1JXS A;  1LVA A;  1TNS A;  4D0P A;  3V7C A;  2HGC A;  2JPB A;  1RI7 A;  4MQV A;  4KMF A;  3WE3 A;  1LB2 A;  1ON1 A;  3C1D A;  1SFX A;  1RNL A;  2F5F A;  4PGG A;  1LQ1 A;  2PEX A;  4LJZ F;  3K0L A;  2E1C A;  2Y75 A;  1XB4 A;  2IA0 A;  2ZKZ A;  5BS6 A;  1K6O A;  1MZB A;  4FHT A;  2DO7 A;  4L0Y B;  3M8F A;  4HZF A;  1G4D A;  2L01 A;  1DDN A;  4OIP F;  4HYE A;  2RDP A;  3FHZ A;  1B6A A;  2W85 A;  4O5V A;  4EVI A;  1R7J A;  2MLK A;  3LWF A;  1BC7 C;  1P4W A;  2ELH A;  2ZNY A;  2GA2 A;  4PZJ A;  3LA2 A;  5DD8 A;  4IRG A;  4RGR A;  3RKY A;  4G6D A;  4RGU A;  3RKW A;  4LGW A;  3BJA A;  4ENK A;  2VT2 A;  1PP7 U;  2KJB A;  1FOK A;  3HYI A;  2BV6 A;  4HX7 A;  2F2E A;  2EFW A;  1F5T A;  4Z2Y A;  4UVC A;  4EJW A;  5E20 A;  2EV0 A;  2KKO A;  3BWG A;  2L4M A;  3H3Z A;  2FQ3 A;  1Z7U A;  4MHG A;  4HDV A;  1R36 A;  2W84 A;  5FO5 A;  1U5T A;  2A69 F;  1YQA A;  2VBY A;  2DU9 A;  1MKM A;  4ESF A;  5L3E A;  2VOP A;  3DFG A;  3TDU C;  4CZZ A;  1F1Z A;  1XD7 A;  3Q9S A;  2RN7 A;  3EET A;  3MQ0 A;  3HOT A;  2GAU A;  4LB6 B;  2HQN A;  5LGT A;  1S6L A;  1LDD A;  5DCM A;  2TDX A;  3IWF A;  3GUD A;  3HRS A;  3NEU A;  1ZRC A;  2QYO A;  3SHF A;  2EA2 A;  1ULY A;  3RKX A;  2ZFW A;  4UV8 A;  5CVI A;  2ZXJ A;  3ZMZ A;  3B73 A;  3WTS C;  1IXC A;  5D8K B;  4B09 A;  2JTV A;  4XLN F;  4CXF A;  1JHH A;  4AVP A;  2CG4 A;  2HWV A;  2XAQ A;  2P8T A;  2XAJ A;  2Q8K A;  4L18 B;  2VE8 A;  1T6S A;  2JPC A;  3R61 A;  4LD5 A;  2ESH A;  4DNC A;  1BN5 A;  2AS5 F;  1G6N A;  3G3Z A;  3ERE D;  2OD5 A;  4WK8 F;  4KIB A;  2NS0 A;  3CTA A;  3RTR A;  5LBQ A;  4EM0 B;  3L09 A;  3WTW C;  1W5T A;  1ZN2 A;  5D6F A;  4UVB A;  2K4B A;  4U0Y A;  3OOP A;  4P55 A;  3BOQ A;  1ZGJ A;  2DQL A;  2FBH A;  4WCG A;  1V4R A;  4UV9 A;  1J5Y A;  1KYZ A;  1HKS A;  1XGM A;  2M30 A;  1XGN A;  1USS A;  2HOE A;  4RAY A;  4BXU A;  4RAZ A;  2ACJ A;  4KN7 X;  4I01 A;  2MH9 A;  4ENM A;  3SZT A;  2JRT A;  3I5U A;  1KU3 A;  2E1N A;  4M74 A;  4XLP F;  2KIU A;  2RVC A;  2ZJ2 A;  4YFK F;  5F64 A;  4KYW A;  1GHC A;  3C3W A;  1HSJ A;  1YYV A;  3C7J A;  3CUQ C;  3ZN0 A;  1XDS A;  5CVU A;  4ZYG A;  1R1T A;  1O57 A;  1SD5 A;  4F7Z A;  2FML A;  2L4A A;  4M72 A;  4M71 A;  3BRO A;  1QBJ A;  1BIB A;  4Q5S F;  4LK0 F;  2GIV A;  3K9T A;  1G3S A;  1OPC A;  4MGR A;  2WTE A;  4AIJ A;  1W4M A;  3I64 A;  1FY7 A;  5EEH A;  3QOP A;  2KJC A;  4LFU A;  2IVM A;  2Q0O A;  1T0F A;  4WX9 A;  3IRR A;  1T39 A;  3KP7 A;  2P5L C;  2HYF A;  1FWZ A;  5H6R A;  2QVO A;  2OAZ A;  2P4W A;  2Z3Y A;  3FXU A;  1H9T A;  3NQO A;  1EH7 A;  1TQI A;  1J7K A;  5A2Q Z;  1B9N A;  4I2O A;  3HTS B;  4MNU A;  5F1R A;  5K1Y A;  1O7F A;  3HHH A;  1BC8 C;  3ZMT A;  2YX7 A;  4L5J A;  1I6X A;  1YTY A;  4EGZ A;  2EA4 A;  4CDG A;  5HDK A;  5DUK A;  4L9N A;  1J0R A;  2XKO A;  2DBB A;  2DW4 A;  3MCZ A;  1L0O C;  3QP6 A;  2XIG A;  3OV8 A;  3BDD A;  4N9H A;  2HS5 A;  3ZPL A;  2ZME A;  3HRM A;  4AWX B;  1U3E M;  4I7H A;  3F6V A;  3E97 A;  4OMY A;  1P4A A;  4P9U A;  4P9F A;  4XBF A;  2XV4 S;  4ESJ A;  1IW7 F;  2V1X A;  1K7A A;  1E2X A;  4WXD A;  4GCV A;  3KLN A;  1E17 A;  1GVJ A;  1ZAR A;  2AXL A;  3CUQ B;  3EQL F;  4QLC U;  2XRN A;  2EJR A;  2OQR A;  4CIC A;  2QQA A;  1S7A A;  3QPH A;  1REP C;  4KDP A;  3J80 K;  1FZP B;  1NHA A;  2OBP A;  2O03 A;  3BJO A;  3JAM K;  3V8K A;  2A68 F;  1CF7 B;  1FT9 A;  1OR7 A;  5JHU A;  3WTV C;  2NNN A;  3ABT A;  1QGP A;  4HDU A;  1EV7 A;  3EUH A;  1IRF A;  2FBI A;  3GVA A;  1MJ9 A;  4IRI A;  4KUM A;  4O6J A;  3M7G A;  2PJP A;  3GYH X;  2P5K A;  2VBW A;  3E6M A;  1Z9C A;  3E5X A;  3VB2 A;  1YW7 A;  5ILS A;  2Q2E A;  2HFH A;  3AAF A;  1PP8 F;  4LLN A;  4UUV A;  1WWX A;  2MA3 A;  2FOK A;  3K1M A;  4QWQ A;  4R8H A;  1J75 A;  5IT3 A;  3KET A;  5L3F A;  3N97 A;  3O6B B;  3FF5 A;  2M1B A;  4I0A A;  3DF8 A;  1MD0 A;  5DDG A;  3GZ5 A;  3RYR A;  4Y17 A;  3QP5 A;  2HTS A;  3S2W A;  5L3G A;  1TBX A;  1IN6 A;  2PG4 A;  1J9I A;  2VT3 A;  1KQ9 A;  1WKM A;  4JQF A;  5HS7 A;  1B1B A;  4EJT A;  1SD7 A;  4HLY A;  3F8F A;  5DV5 A;  1UHM A;  1A04 A;  2ZNZ A;  3GFM A;  5HLH A;  3SZP A;  4U7D A;  1XCV A;  3KP4 A;  3FM5 A;  3T0Y A;  4WWC A;  1JHF A;  2DT5 A;  4A0X A;  2D2W A;  3QAH A;  3W6J B;  1RZ4 A;  6PAX A;  3QU3 A;  2PFB A;  3P9I A;  4L9T A;  4M9S A;  5HS9 A;  2FNP A;  5AIP A;  4O3M A;  2MBF A;  1YIO A;  1MJA A;  4P5O A;  3V4G A;  3GXO A;  4BHB A;  1B9M A;  5IT9 K;  4XSX F;  4HX8 A;  3H92 A;  3WTU C;  3WGH A;  1U8R A;  1ZAO A;  2DI3 A;  3R0A A;  2B0L A;  3BJ6 A;  2EV6 A;  1TNT A;  3F6O A;  3KZZ A;  2G9W A;  4ZH4 F;  3SFZ A;  4OIN F;  1WSU A;  2IT0 A;  2CGP A;  2WWY A;  4YG2 F;  5JFR A;  1WRJ A;  2Z9O A;  2QZ8 A;  4A5N A;  1IZ1 A;  5FGM A;  2FSW A;  2MC3 A;  2FMY A;  4A5M A;  5CVR A;  1F9N A;  4Y13 A;  4G6Q A;  3L7W A;  4HA8 A;  3EYY A;  1VTN C;  2G7U A;  1LNW A;  2ZBK A;  2K7L A;  1FBQ A;  1XCB A;  2EWN A;  2IPQ X;  1R1U A;  3HOS A;  4KIC A;  4M9X A;  2A6H F;  2P5V A;  1BI0 A;  3J81 K;  5DD4 A;  5D8L B;  2HZT A;  3T5X A;  4FT8 A;  1EH6 A;  3RI4 A;  4L0Z B;  5JR3 A;  1TQP A;  2Y0M A;  3HSE A;  5LHI A;  4XSZ F;  5HDN A;  1P92 A;  4XRF A;  1Z6T A;  3LFK A;  1SAX A;  4TV7 A;  5BQT A;  4HF1 A;  3FWE A;  2QUF A;  2EFP A;  4U88 A;  1KU7 A;  2A3S A;  2VOD A;  2W25 A;  3IRQ A;  1AOY A;  5H20 A;  1JGS A;  1FYM A;  5CVJ A;  1Z1D A;  2V9V A;  4RGS A;  1J59 A;  4MTE A;  5BMZ A;  1UST A;  4AIK A;  1FP1 D;  1R00 A;  3WU1 B;  1XSX A;  1SD6 A;  3M9A A;  1W7P A;  2QLZ A;  1XSV A;  4G8X A;  5FLX K;  1C0W A;  2FA5 A;  4KIG A;  2ZO4 A;  1RUO A;  3GLX A;  3KFW X;  2H6C A;  2XHK A;  4MEY F;  2QBY A;  4U0V A;  4UVA A;  1BI2 A;  4KA4 A;  2HQR A;  5ILV A;  3RPQ A;  4PCQ A;  5FFZ A;  1T2K A;  2F5D A;  1XN7 A;  4ZYH A;  1BI3 A;  4I98 B;  4NB5 A;  2VXZ A;  1RIO H;  3MWM A;  5LLQ A;  3TO7 A;  3TDZ C;  4RGX A;  2DPD A;  3F22 A;  1DUX C;  4HW0 A;  4IJA A;  3FXQ A;  1LJ9 A;  3FM3 A;  2L3D A;  4YFX F;  1FYK A;  5E18 F;  2P6S A;  3I0T A;  1D3Y A;  2CW0 F;  3DKW A;  1BJA A;  2M87 A;  4G94 A;  4IXA A;  1S8N A;  4EM1 A;  1OYI A;  3E5Q A;  3IWZ A;  4HF0 A;  3F3X A;  4LG0 A;  2O3F A;  1SMT A;  4I09 A;  3HTU A;  1V3F A;  2PI0 A;  2PQ8 A;  2CSO A;  1YO5 C;  2MD5 A;  4WXC A;  1IN5 A;  2PLY A;  3I53 A;  2D1V A;  5TJJ A;  3GF2 A;  2HR3 A;  4KN4 X;  2D45 A;  4CHU A;  3TQN A;  2DTR A;  3IHU A;  3LQQ A;  3L00 A;  3R6S A;  2V79 A;  2IA1 A;  4HV5 A;  2A5Y B;  1UFM A;  4WXH A;  4U0W A;  3MEX A;  5HDG A;  2XGX A;  3Q5F A;  1ZRE A;  2F5C A;  4HQM A;  5K5Q A;  2V6C A;  3ABU A;  2JSC A;  3BPX A;  1ODD A;  5DCF A;  3NRV A;  2ZCW A;  1FLI A;  3KEQ A;  1XSD A;  2OQG A;  2LF8 A;  3BP8 A;  2YPR A;  2ADU A;  3WU0 A;  2P7C B;  1IRG A;  4Y15 A;  3JSO A;  3WTT C;  3WG9 A;  5KVR A;  2XAG A;  5L3C A;  3GO5 A;  1P2F A;  1O7L A;  3V8L A;  1ON2 A;  2E7W A;  2HTJ A;  3I58 A;  5LGU A;  1KQ8 A;  5ICG A;  3BPV A;  4AD9 A;  2ZME B;  4LLG F;  1FSH A;  3KEO A;  2XUB A;  2HKO A;  1R22 A;  4Q4Z F;  3KP2 A;  1O3Q A;  1FNN A;  2HKX A;  2HDC A;  4MQ9 F;  1SFU A;  2GZW A;  2DAO A;  3DPL C;  3HHG A;  1EH8 A;  1JE8 A;  4ENN A;  3RDI A;  4MTD A;  2R7F A;  2X0L A;  2PBI A;  2STT A;  2DQR A;  4A0Y A;  1R1V A;  3WOD F;  3IKT A;  2CO5 A;  4I0B A;  4EV0 A;  1HW1 A;  4GO1 A;  1PDN C;  3LA7 A;  4FX4 A;  2KIM A;  5L3D A;  3W6K B;  4IHS A;  3H3U A;  2VBX A;  3E3V A;  4BHC A;  3CUO A;  4EMS A;  2DLL A;  1UB9 A;  2MH2 A;  3GEZ A;  3TOB A;  2DK8 A;  3GWZ A;  2RGV A;  1MDM A;  3TOA A;  1LEB A;  3U2R A;  2EFQ A;  2FBK A;  5E1X A;  2IP2 A;  1IN4 A;  2STW A;  3JTH A;  3IC7 A;  1IXR C;  2VBZ A;  5LRR A;  5E1Z B;  4ETS A;  5K5R A;  1SD4 A;  4CGZ A;  1FBS A;  2G7H A;  5FD6 A;  2HEO A;  1IUY A;  2LDU A;  3ISP A;  3V7S A;  3JW4 A;  5LGN A;  3CLO A;  1QNT A;  3E6B A;  2BBY A;  1ZG5 A;  3O2P E;  5HLG A;  2F5E A;  1I1G A;  3E5U A;  5CYV A;  2W57 A;  2Z99 A;  2LSO A;  2EFN A;  1ZYR F;  4OIQ F;  3HUG A;  2FXA A;  3ZMV A;  5ILU A;  3ZN1 A;  1QZZ A;  3ECH A;  5D4R A;  1TLH B;  2EV5 A;  1DPR A;  3CUQ A;  4UXN A;  3MAJ A;  1AWC A;  2JT1 A;  3WE2 A;  2R7D A;  1K78 B;  4A12 A;  3N4M A;  1ZRD A;  4CO8 A;  5E1W A;  5BPD A;  1HXD A;  4DQ2 A;  1KU9 A;  2K27 A;  1S3J A;  2M45 A;  1I1S A;  3EYI A;  4BH9 A;  3DV8 A;  3HRT A;  3QPT A;  1TW3 A;  4KNY A;  5CJ9 A;  5A2Q K;  2ESN A;  1FYL A;  4KIF A;  1YS6 A;  1U5T C;  4K2E A;  4RB0 A;  2JZY A;  2QQ9 A;  2H09 A;  2EB7 A;  3LQR A;  1CGP A;  3QRF F;  2XRO A;  3FX3 A;  5ICF A;  3PFI A;  5LHG A;  2R3S A;  2H6B A;  1HQC A;  3I59 A;  3TKY A;  2O61 A;  2LKP A;  3PQK A;  4N0B A;  3SXY A;  2K02 A;  1TTY A;  1BIA A;  5ED4 A;  2RKH A;  4EJV A;  1U2W A;  1HKT A;  1YLF A;  4IRH A;  2BEO A;  4BYY A;  5BPI A;  4HLX A;  2UXX A;  3J7A O;  1H9G A;  2UXN A;  5LEJ A;  1Q1H A;  2PMH A;  1G3T A;  1STZ A;  5CVV A;  2Z5U A;  2IJL A;  4LMY A;  4LK1 F;  2VOO A;  3M1E A;  4EQQ A;  1U6G A;  5D5U B;  3D5L A;  5D5V B;  1BM9 A;  4KT5 C;  5HLI A;  2ISY A;  5AIQ A;  2PMU A;  2P6T A;  4ON0 A;  4RB3 C;  1UHW A;  2DFI A;  3KZY A;  2A6E F;  2FEZ A;  3FXR A;  3R60 A;  4OIO F;  4WF2 A;  1K79 A;  1DP7 P;  4A6E A;  3V8J A;  4RB2 C;  4M9Z A;  3L9F A;  1O3R A;  4I02 A;  2Y48 A;  3MZY A;  4RB1 A;  2V1D A;  3RPU A;  5H6Q A;  5J8F A;  1U5T B;  4S04 A;  2PN6 A;  4A2U A;  2COM A;  2QEN A;  3P7N A;  2KRF A;  3DXJ F;  1YS7 A;  3F23 A;  1XMK A;  1XGO A;  1HBX G;  2UZK A;  1FSE A;  4L5I A;  5AON A;  4NHJ A;  3ZMS A;  1GXP A;  4A6D A;  1W7P B;  3GFL A;  3RYP A;  5DCM B;  5TRD A;  1B59 A;  5ICC A;  3BY6 A;  1PUE E;  1LDK B;  4OOI A;  4L9V A;  4ENJ A;  1R5H A;  4B8X A;  3VFZ A;  1SMY F;  3FMS A;  1P6R A;  1YW9 A;  4JBA A;  2QWW A;  2QBY B;  4IHT A;  3IL2 A;  4CYD A;  2C6Y A;  5DEQ A;  4HF2 A;  2FE3 A;  2DK5 A;  1ZH5 A;  3IKV A;  4BHP A;  5D6E A;  3WGI A;  3WTZ A;  1U78 A;  5DUI A;  4EM2 A;  4G7O F;  4YFN F;  2NAZ A;  4ZZD A;  2OZ6 A;  2QM3 A;  2O0Y A;  3WTY C;  1ONV A;  3GW2 A;  3D0S A;  4R79 A;  2GXG A;  3VOE A;  2CWE A;  1IN8 A;  5E17 F;  1HW2 A;  1ZGA A;  4U7B A;  3BZ6 A;  2M5W A;  1D8J A;  1Z91 A;  2K4J A;  4FX0 A;  3K69 A;  1ZG1 A;  2NRA C;  4MEX F;  1MGT A;  3U1D A;  1QZY A;  4LG0 B;  1XGS A;  4EJU A;  1FPQ A;  4Q47 A;  3CO6 C;  5DYM A;  2OU2 A;  4HV6 A;  2IW5 A;  1TW2 A;  5JVT A;  1X3U A;  2VE9 A;  2CFX A;  3O3K A;  4PGH A;  4M73 A;  2ISZ A;  5LRS A;  4M6Y A;  1XDU A;  3I54 A;  3I4P A;  4HAM A;  5J6X A;  1R5G A;  3ZMU A;  2LF7 A;  4OMZ A;  5HS8 A;  1UCR A;  2HYG D;  3KP3 A;  2YR2 A;  3DP7 A;  5BOX A;  1HW5 A;  3KP5 A;  1YW8 A;  3T8R A;  1XMA A;  4PDK A;  3GX4 X;  1S29 A;  4EJO A;  2FF4 A;  4H0E A;  3E6D A;  1LEA A;  3DQV C;  1FC3 A;  1HST A;  1T38 A;  1I5Z A;  2VON A;  2IA2 A;  4OIR F;  4ESB A;  3HSF A;  3G73 A;  1FBU A;  3FMQ A;  4HOB A;  1FX7 A;  1Y0U A;  4ZYD A;  2WC2 A;  3J80 Z;  1OYW A;  4G9Y A;  3T8T A;  3JAM Z;  5D4S A;  2XAF A;  3QU6 A;  2L02 A;  4E70 A;  4RS8 A;  3CDH A;  5D5X B;  4GGG A;  2MLG A;  4BAY A;  2IRF G;  2YU3 A;  2X4H A;  3EDP A;  3P9C A;  2J5P A;  1QPM A;  2P7V B;  2FU4 A;  2H94 A;  5D5W B;  3JSP A;  1G3Y A;  1WQ2 A;  4GYG A;  2ETH A;  3CO7 C;  4P96 A;  1KQ0 A;  1QO0 D;  3ULQ B;  3ZP5 A;  5J8C A;  5FB2 A;  4EGY A;  3K1N A;  1O3S A;  1Z6R A;  4YIF A;  4IPA A;  3T1B A;  2W24 A;  1O3T A;  3TGN A;  2E7X A;  3WTX C;  3RJP A;  3TO6 A;  1G3W A;  2A61 A;  1D8K A;  2XAS A;  1YFH A;  1SFE A;  2XKP A;  3R0J A;  3K2Z A;  2CQK A;  4ASN A;  4IF4 A;  4OU0 A;  3L2C A;  1DPU A;  1MJB A;  3DPT A;  4S05 A;  3ML6 A;  2VN2 A;  1H0M A;  5CLS A;  3U9G A;  1MDM B;  3DEU A;  3ELK A;  2KIF A;  1S7O A;  3K1P A;  3GFI A;  3FZV A;  1IAW A;  2UWM A;  2EFO A;  3MZH A;  3LST A;  3ZQ7 A;  2J5O A;  3WGG A;  1HKQ A;  2FNA A;  2O8X A;  1ZG3 A;  5K5O A;  1T98 A;  4HX4 A;  1L3L A;  4LB5 A;  5HOO A;  2NYX A;  1J2X A;  1OYY A;  2QQB A;  1KGS A;  3Q9V A;  3KP6 A;  1FP2 A;  2NNY A;  3V7R A;  3CJN A;  1ZRF A;  1R58 A;  3HRU A;  4IVN A;  5LEK A;  3ZMD A;  4ZZL A;  2BYV E;  3PQJ A;  1KYW A;  3RIR A;  5L3B A;  2L54 A;  5IT9 Z;  3F21 A;  1IN7 A;  3ECO A;  3F72 A;  3TO9 A;  4AIH A;  4N9I A;  3VEP A;  2GWR A;  1WI9 A;  1Z05 A;  1D5V A;  1OMI A;  1QQI A;  5E8I A;  1BOA A;  3KE2 A;  4G7Z F;  1ZLK A;  3FMR A;  1LDJ A;  4R1H A;  4LLL A;  1IF1 A;  5JI6 A;  1ZHF A;  3COA C;  2VC1 A;  2DPU A;  2O6G E;  3F8M A;  5FFX A;  5ICE A;  3F8N A;  4YII A;  2M8E A;  1W7P D;  4BQA A;  2GXB A;  4L9J A;  1BI1 A;  3LAP A;  3C18 A;  1RUN A;  4Q48 A;  1W5S A;  2BE5 F;  1KU2 A;  2CYY A;  3REO A;  1KA8 A;  2EK5 A;  4GXO A;  5HVQ C;  3E6C C;  1GXQ A;  1CF7 A;  3I59 B;  2XAH A;  2WV0 A;  3J81 Z;  3LA3 A;  3HSR A;  3P9K A;  5E8G A;  2H27 A;  2RC4 A;  2FRH A;  3VOD A;  3I71 A;  4KMU X;  5ERI A;  1F4K A;  3KLO A;  4GYI A;  3SQN A;  5EEG A;  2Z33 A;  2RNJ A;  3ROU A;  4JK1 X;  2YX4 A;  4M6X A;  2LNB A;  1TQM A;  2VC0 A;  4UNO A;  1OKR A;  2D1H A;  2YSR A;  2BGC A;  1B4A A;  4G7H F;  4NQW A;  1I27 A;  3GZ6 A;  3GFJ A;  5FD5 A;  1P4X A;  4ZYE A;  3R4K A;  4HBL A;  1BBY A;  2K86 A;  3HIF A;  1IXS B;  1YG2 A;  5LHH A;  2A07 F;  1K78 A;  3LAJ A;  3F8B A;  2OA4 A;  4HQE A;  4UHT A;  3KCC A;  5F6F A;  2GQQ A;  4A0Z A;  3M8E A;  2RV8 A;  5FLX Z;  3JTG A;  4BNC A;  1R23 A;  2GA1 A;  1ZLJ A;  2RQP A;  3B02 A;  3MFK A;  5KK1 A;  2V1U A;  2XVC A;  3F8C A;  2OZU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...