5CYVA

Crystal structure of cour from rhodococcus jostii rha1 bound to p-coumaroyl-coa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
138
Chain Sequence
SQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFPTFVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The activity of CouR, a MarR family transcriptional regulator, is modulated through a novel molecular mechanism.
pubmed doi rcsb
source organism Rhodococcus jostii (strain rha1)
molecule tags Transcriptional regulator
molecule keywords Transcriptional regulator
total genus 48
structure length 138
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cyvA00
1DP7P 1R36A 2IRFG 1T39A 1AWCA 3BOQA 3K1NA 4MQ9F 4LK0F 3ZP5A 4OMYA 2XV4S 3QOPA 3I5UA 4L0YB 3HIFA 3WTXC 3P7NA 4UVAA 4RB3C 3FXUA 1KGSA 2M45A 1ZRFA 1S29A 2Z99A 3ZMUA 1AOYA 3GLXA 2VE9A 2KKOA 2JT1A 2MC3A 3HYIA 1ZYRF 4HF2A 3TQNA 2DTRA 5CVRA 1F4KA 5H6QA 3Q5FA 2D1HA 4TV7A 2FBIA 5F6FA 3E5QA 2KIUA 5DD8A 3R0AA 4G8XA 3SQNA 1QNTA 2L02A 4LB6B 3IHUA 2NRAC 1MGTA 3R0JA 5ICCA 1HSTA 3B02A 2NNNA 1JGSA 1EH8A 4MNUA 1GVJA 3LA3A 3E6CC 4ZYDA 2K4JA 1YW8A 4EQQA 2E7WA 2HTJA 2DI3A 4YFKF 3MQ0A 1XGMA 2X4HA 5DCFA 1MDMA 1XGSA 1W5SA 2QQAA 3T8RA 4HA8A 4UVBA 4M72A 4A0XA 3FM3A 1WKMA 4KUMA 3H92A 2ACJA 1HQCA 1UFMA 1BOAA 1Z7UA 3KP2A 3M8EA 2GA1A 2IPQX 4EMSA 1D8KA 3BPXA 2B0LA 5ICGA 2EA4A 1JHHA 3M8FA 1PUEE 1Z6RA 3NEUA 4L9NA 3GFIA 1T0FA 2PJPA 2A3SA 3WU0A 4ZZLA 2MLKA 5JFRA 2GIVA 4MTEA 5E18F 1LVAA 2Z3YA 4RB2C 2ESHA 3F21A 3JW4A 2P8TA 2O0YA 4L9JA 3CJNA 2H6BA 4GO1A 3JTGA 2XUBA 2K4BA 2F5FA 1XCVA 4KYWA 3I0TA 2FE3A 4N9IA 3GYHX 2VC1A 3I58A 2P5LC 3ZN0A 2JZYA 5AIQA 2IJLA 2WV0A 4P5OA 1KA8A 3IWFA 3F8NA 4U7BA 2W85A 4HAMA 3TGNA 3HHHA 3LAPA 2H6CA 4YIFA 3I71A 3DV8A 2EFQA 3I59A 4KFCA 3WGGA 1IAWA 1GXPA 2R7DA 3ABUA 3V8KA 2BV6A 1U5TC 2D2WA 4Y13A 4XSZF 2MH2A 4WCGA 1R1VA 1CF7B 1K79A 3GX4X 4R8HA 1IXRC 4EJOA 1ZG1A 5LEJA 1GXQA 3IRQA 5A2QK 1TW2A 1R23A 3FXQA 1HKQA 2D45A 3CUQC 2L54A 1FSHA 3ZMSA 2AS5F 4L5IA 3J80K 4BHPA 2IP2A 2FOKA 3HRSA 2HYFA 2PLYA 2K7LA 1XSXA 1WWXA 1OYYA 1MKMA 2EFOA 2A68F 3QU6A 3SXYA 1GHCA 2ISZA 1L0OC 1IUYA 4OIPF 2PMUA 1RIOH 3VOEA 1R7JA 2P7VB 3G73A 4JQFA 2MH9A 1MJAA 3VODA 4G7ZF 4WWCA 1S3JA 4L9VA 2RVCA 1W7PB 3RDIA 3QAHA 1WRJA 5D6FA 3F8BA 2VXZA 3LQRA 5LRSA 3C3WA 1XMAA 2HWVA 5HOOA 3NRVA 2PMHA 3L9FA 5HLGA 2HDCA 2W24A 2MBFA 4EJUA 3BJ6A 5FFXA 3F22A 1BM9A 1ZGJA 2ZMEB 5LGUA 1FBQA 1YLFA 2HR3A 2Y75A 3WGHA 1YW9A 5FLXZ 3KP5A 2ZO4A 3WTVC 3WTWC 2ZNZA 2L01A 1FWZA 2RN7A 3KP4A 2ZFWA 4KA4A 4HDUA 2PFBA 5HS8A 2O8XA 4G6QA 5J6XA 5K5RA 4OIOF 1SFEA 2Z33A 4AVPA 1QO0D 2LNBA 4LGWA 4M6XA 2GA2A 4IVNA 4U88A 5BPIA 1T38A 2FXAA 5H20A 2Z5UA 5D6EA 1O3QA 4LLGF 5ICFA 1J5YA 3P9CA 1S6LA 2V9VA 4IF4A 1S8NA 1O7FA 1BI1A 4H0EA 1YG2A 2Z9OA 2W57A 2A07F 1I6XA 4D0PA 1FYMA 2ZXJA 3ELKA 3V4GA 2CO5A 1L3LA 3TDZC 3MEXA 3BWGA 1QZYA 4M6YA 1ZRCA 2Q0OA 2R7FA 4A6EA 5FB2A 1ZRDA 2BEOA 1RUNA 2X0LA 3IC7A 2E7XA 1SD6A 3F6OA 2IW5A 4IXAA 1XGNA 3K1MA 5L3BA 1IZ1A 4ON0A 3J7AO 2O03A 2W25A 1Z05A 5D8KB 3P9IA 5FD5A 2OQGA 2P5VA 2ETHA 1FBUA 1FX7A 3HOTA 2KJBA 2K02A 2OA4A 3PQJA 3D5LA 2CGPA 2OD5A 1DDNA 4RGXA 4N9HA 1FYKA 4WF2A 5HS7A 2WWYA 2XASA 1YQAA 5L3CA 3I4PA 3SZTA 2ZJ2A 2M1BA 2VODA 2A69F 4EJVA 2VT3A 4OINF 3ZMZA 2GZWA 2A61A 2K27A 1SMTA 2KRFA 2WTEA 1IN4A 1DPUA 3ROUA 5JR3A 4KIGA 3E5XA 3OOPA 4WXCA 4YIIA 5E8IA 4L9TA 5HDKA 4UNOA 3WG9A 4P55A 1EV7A 2J5OA 4EV0A 3GFMA 3KCCA 4G9YA 2LF8A 4CYDA 2FNPA 4EGZA 3M7GA 1T6SA 3CUQB 1FZPB 5IT9Z 5ILUA 1O3RA 1XSDA 3T0YA 5D4RA 3EUHA 4LG0B 2L4MA 4M9ZA 1TNSA 2ADUA 1ZLJA 4I01A 3I64A 2DLLA 1SD7A 5TJJA 3R4KA 4BQAA 3GF2A 4RAYA 3GW2A 2HQRA 4CGZA 3VEPA 1O57A 5FD6A 3FMQA 1HW5A 3KLNA 1IRGA 3ECOA 1BBYA 4NHJA 3ZMTA 4I0AA 1HBXG 2P5KA 3E3VA 4PDKA 4DNCA 4FX4A 1ZN2A 2O6GE 2CFXA 5F1RA 3HHGA 5D5UB 4KICA 2H27A 2VBWA 4NQWA 3CDHA 4MHGA 2RC4A 4F7ZA 3KE2A 3MZYA 1K6OA 2XAGA 4G7OF 1D5VA 1DPRA 2G7UA 2JPCA 3IRRA 4PZJA 4XSXF 2EV5A 2A6HF 1LQ1A 1LDJA 4B09A 1OKRA 2FF4A 4S04A 4ENJA 1ON1A 2EFWA 1KU7A 1IN6A 3KP6A 2XKOA 4Q4ZF 1B1BA 5E1ZB 2XAQA 4I09A 3HRTA 1CGPA 2P6SA 1IN7A 4LFUA 4CZZA 3BJAA 6PAXA 1J0RA 3WODF 5CYVA 3TKYA 4GYIA 3MZHA 5HDGA 1DUXC 1KYZA 5CVJA 3H3UA 3FM5A 2CQKA 1LJ9A 4Y15A 5E1XA 5CVUA 3DPTA 1XMKA 2VONA 3W6KB 4B8XA 3CTAA 5IT3A 2UXXA 4BHCA 4IPAA 1FY7A 5LEKA 2G7HA 3GZ6A 4HLXA 3BZ6A 1F5TA 3P9KA 3Q9SA 4AWXB 3NQOA 1MDMB 1V4RA 4UV9A 2ELHA 3LWFA 1HXDA 5BPDA 1TQIA 4RB1A 2RQPA 1XDSA 2M5WA 3TO7A 3DP7A 1SFXA 1UHWA 1ZLKA 1SD5A 4XLNF 3JSOA 1SMYF 2RV8A 2F2EA 3HTUA 2PI0A 1ZAOA 4OMZA 4LG0A 4EM2A 3R6SA 5DDGA 4HZFA 2DQRA 2FMLA 3ECHA 4GYGA 4UHTA 4G7HF 1B9NA 3JSPA 1ONVA 1ZARA 2AXLA 4P96A 1LEBA 2QVOA 3BJOA 1MJBA 5D5WB 2GAUA 3V8LA 1P6RA 3VB2A 1YO5C 5ILSA 4Z2YA 3MAJA 2M8EA 3CLOA 1U3EM 3ZN1A 3KZYA 5K1YA 3PQKA 2OAZA 2XAHA 2TDXA 2DT5A 3GUDA 1F1ZA 4N0BA 1V3FA 3TO9A 4OU0A 1KQ9A 2FA5A 2YX4A 2JTVA 4RS8A 4HX8A 4P9UA 3TOBA 1FLIA 4ENNA 2WC2A 2V1XA 3V7SA 1YFHA 3BY6A 1YYVA 1XB4A 4UUVA 4ASNA 5CVIA 3FMSA 4XLPF 3F3XA 2EK5A 2EFPA 4Q5SF 2XAJA 4ESBA 5HVQC 2E1CA 2GXBA 2MA3A 5J8CA 2EV6A 2HEOA 1KU3A 2NAZA 4GXOA 1Y0UA 1ON2A 3U9GA 3ZMDA 1EH6A 2DO7A 3K0LA 3JTHA 2CW0F 4MTDA 3J81K 3RPQA 3F23A 4PGGA 4KN7X 5DYMA 1H0MA 3WE3A 5LLQA 2HTSA 1O7LA 4KN4X 1SAXA 1XSVA 4HW0A 5ICEA 4MEXF 4A0ZA 3O2PE 2P4WA 4OIRF 3J80Z 1O3SA 2DK8A 4R1HA 5E1WA 5BMZA 2XVCA 4LB5A 4Y17A 1STZA 1QQIA 1T2KA 2FNAA 2JSCA 1IXSB 4LMYA 4BNCA 1XN7A 1YS6A 4OOIA 1HW2A 3V8JA 1J7KA 1W4MA 4R79A 5HLHA 5HS9A 2Q2EA 3K2ZA 4HV5A 1FNNA 1R1UA 1RUOA 2H09A 5BOXA 1U5TB 3KLOA 1USTA 2J5PA 3C18A 2FU4A 4GCVA 1H9GA 1MJ9A 2IVMA 3QU3A 1ZG5A 2L4AA 3E6BA 2YX7A 4HF1A 4AD9A 3M9AA 3LAJA 2HOEA 3W6JB 1CF7A 2FMYA 4U0WA 2PG4A 3SFZA 1U2WA 3BPVA 3EYIA 3EYYA 5AONA 4PGHA 2C6YA 2QYOA 3QP5A 2ZNYA 4U0YA 1RNLA 4I02A 3CO7C 3LA2A 3K9TA 1LEAA 2EWNA 4L5JA 1SD4A 4CDGA 5BQTA 4M73A 2QWWA 3GXOA 2LSOA 1P4XA 4KIBA 1J75A 4A6DA 5ED4A 4KMFA 1IRFA 3HOSA 2VOOA 3FHZA 4EVIA 1QPMA 3MFKA 1TBXA 1ZGAA 4MQVA 2DU9A 1A04A 2E1NA 5EEHA 5HLIA 4CO8A 2PN6A 2M30A 5DUKA 3IKVA 2YR2A 1BIBA 2XKPA 2VN2A 3COAC 1X3UA 4RGUA 4RGRA 4FX0A 2EFNA 1R00A 3RKYA 5JHUA 5DCMA 1B4AA 3HSRA 2HKOA 2KJCA 1TTYA 3U2RA 1K78B 4HX7A 1BI3A 4JK1X 1ZREA 1K7AA 4RGSA 4BAYA 1I27A 3EQLF 1FP1D 2XRNA 3GFLA 1IXCA 2CYYA 2ZCWA 3M1EA 3BP8A 4A12A 2FBHA 2QQ9A 3ABTA 4YFXF 1C0WA 1LB2A 4XBFA 1Z91A 3DKWA 2IA0A 4GGGA 2BGCA 5LHHA 3E97A 2PBIA 4A0YA 1J9IA 2QBYB 3FZVA 4WK8F 1EH7A 2FEZA 1FSEA 3VFZA 4IHTA 3K1PA 2EJRA 3AAFA 2ZMEA 3SZPA 2ISYA 3WGIA 3GWZA 3DEUA 1LDKB 2YPRA 3QPHA 2HYGD 2P7CB 1YW7A 2GWRA 3E5UA 3EDPA 2BYVE 1R58A 2LDUA 1YTYA 2A6EF 3HSEA 2ZBKA 3KFWX 5LRRA 3O6BB 1HSJA 1BC8C 2QLZA 4KDPA 3I53A 2P6TA 3CUOA 4KIFA 3KZZA 2O3FA 3F8CA 3FX3A 4U7DA 1WI9A 4KNYA 3D0SA 2ZKZA 2IT0A 2RNJA 1PDNC 2XAFA 3MWMA 5L3GA 2KIMA 1P2FA 2D1VA 2JPBA 3HTSB 2OZ6A 3DPLC 5JI6A 3RPUA 3KETA 1BI2A 3JAMZ 4KT5C 5IT9K 3LFKA 3C7JA 3RYRA 2H94A 2BBYA 2MD5A 3LSTA 4BH9A 3JAMK 3ULQB 1B9MA 1TW3A 2V1DA 2F5CA 1JHFA 2IA1A 4YFNF 4G94A 4YG2F 3L2CA 1PP7U 4IRIA 1PP8F 1ODDA 5CJ9A 4E70A 2VOPA 3Q9VA 4EGYA 2DBBA 4DQ2A 4IHSA 1G3TA 1QZZA 3H3ZA 5DUIA 2UZKA 3G3ZA 4Q48A 2O61A 3FXRA 3U1DA 4HX4A 1R1TA 3L09A 3S2WA 1P4AA 2DPUA 5FO5A 3WTZA 3RIRA 3I59B 1MD0A 2V6CA 3N4MA 2NS0A 1TQPA 2QQBA 1USSA 4RB0A 4I2OA 1TNTA 1E17A 3KEOA 5K5OA 4MGRA 4HLYA 5LHGA 1H9TA 1W7PD 2FRHA 5D8LB 2NNYA 2COMA 1UHMA 2M87A 4HQEA 1B59A 2R3SA 3F6VA 1UCRA 1IN8A 1S7OA 3IWZA 2QBYA 3QP6A 3DXJF 4WXDA 3RKWA 3EETA 2L3DA 2DQLA 1OYWA 3HUGA 3WTTC 2A5YB 2QENA 2QZ8A 3TDUC 4AIHA 1BI0A 1HKSA 1JE8A 3K69A 1REPC 4CHUA 4G6DA 4FT8A 1G3YA 3KP3A 5L3DA 1BN5A 2FQ3A 2OQRA 1T98A 3LQQA 3FMRA 4IRHA 3V7RA 3FWEA 4M9XA 4L0ZB 5DEQA 4L18B 1G3WA 1KQ0A 3REOA 3V7CA 5A2QZ 5KVRA 4ZYGA 1U6GA 4QLCU 4EM0B 2VBXA 2HFHA 1B6AA 3CO6C 3MCZA 3T1BA 4HDVA 3GFJA 3IKTA 2XHKA 4M9SA 2Y48A 1BJAA 4JBAA 3RKXA 5F64A 4ZYHA 5L3EA 5D4SA 1LNWA 3GO5A 4ESJA 1TQMA 1UB9A 2F5EA 5LBQA 3GEZA 5CVVA 5LGNA 3F72A 5ILVA 4LJZF 4AIJA 2DAOA 1J59A 4MEYF 2YSRA 1D3YA 4EJTA 1XGOA 1F9NA 3PFIA 3ZQ7A 4I98B 1P92A 2DK5A 4O3MA 3CUQA 2MLGA 3RTRA 1OR7A 2QM3A 2HKXA 3HRUA 2RDPA 1YIOA 4I7HA 1IW7F 1FT9A 1RZ4A 3ISPA 3R61A 2DW4A 4HQMA 5E8GA 1Q1HA 1WQ2A 4ZYEA 3LA7A 1U5TA 4I0BA 1XCBA 2KIFA 4LK1F 1W7PA 2GQQA 3WTSC 1R22A 4A2UA 1D8JA 4LLLA 4WX9A 4P9FA 2XGXA 5D5XB 3F8FA 4HYEA 4U0VA 3BDDA 1BC7C 2NYXA 4O6JA 1KQ8A 5CLSA 2VC0A 3RYPA 3GVAA 4ENMA 4M71A 4AIKA 5AIPA 4XRFA 2OBPA 2LKPA 3E6MA 3R60A 1J2XA 4HOBA 2JRTA 1MZBA 2RGVA 2CG4A 1K78A 1FBSA 5H6RA 4BYYA 3L7WA 5D5VB 3DQVC 3WU1B 4QWQA 5DCMB 1O3TA 5FFZA 4CICA 3ML6A 4KMUX 3F8MA 4EJWA 4A5NA 4ESFA 1S7AA 1Z1DA 1OMIA 1P4WA 3WTYC 2K86A 4UVCA 4OIQF 4UXNA 2HQNA 2Q8KA 5K5QA 4Q47A 1KU9A 4HV6A 1VTNC 1XD7A 1I5ZA 2VBZA 1U78A 5FGMA 4HBLA 1G3SA 2XIGA 3KEQA 1FP2A 1ZH5A 1TLHB 1WSUA 3RI4A 2V1UA 3E6DA 1HW1A 5FLXK 4M74A 2UWMA 5BS6A 4ETSA 3WTUC 4O5VA 4S05A 1QGPA 3KP7A 2CWEA 2VT2A 4ZH4F 1OYIA 4LLNA 3TOAA 4K2EA 1I1GA 4ENKA 3O3KA 5LHIA 3GZ5A 1YS7A 3L00A 3I54A 2VBYA 1R5HA 2LF7A 1FC3A 5KK1A 3TO6A 4LD5A 3DFGA 1FPQA 3ZMVA 3B73A 4NB5A 1KYWA 4UV8A 1FOKA 5TRDA 5E20A 1IN5A 4IJAA 1Z6TA 2CSOA 3IL2A 4EM1A 2HZTA 3RJPA 3BROA 2OU2A 2STWA 1G4DA 1W5TA 2OZUA 5J8FA 2EV0A 2PEXA 3T5XA 4BHBA 1KU2A 3ZPLA 5LGTA 4HF0A 2EA2A 1OPCA 5JVTA 1FYLA 3WE2A 2IA2A 1E2XA 1R5GA 1IF1A 2GXGA 2DFIA 1LDDA 2G9WA 1SFUA 1QBJA 2HS5A 2YU3A 2STTA 5HDNA 5E17F 4PCQA 1I1SA 3J81Z 1BIAA 2RKHA 3OV8A 1G6NA 1JXSA 1NHAA 3N97A 2QUFA 2Y0MA 5DD4A 3SHFA 1XDUA 3T8TA 1U8RA 3FF5A 2V79A 5EEGA 2EB7A 2PQ8A 1RI7A 2XROA 3HSFA 1Z9CA 1ZG3A 2UXNA 5ERIA 2VE8A 2HGCA 3QRFF 5L3FA 3DF8A 2ESNA 2BE5F 3ERED 2FSWA 4FHTA 4BXUA 1ZHFA 3C1DA 4A5MA 1HKTA 2FBKA 4ZZDA 2W84A 4RAZA 2F5DA 4IRGA 5DV5A 3HRMA 4WXHA 4CXFA 1ULYA 2DPDA 3QPTA
chains in the Genus database with same CATH superfamily
1VF9A 3SDBA 3J7YJ 2LC2A 1DP7P 1R36A 4U87A 4XKBA 4PK4A 2IRFG 1T39A 1AWCA 3BOQA 3K1NA 3M1CA 4MQ9F 4LK0F 5DTDA 1WJEA 5EZHA 3ZP5A 4OMYA 2XV4S 2BXZA 2L7FP 3QOPA 3CCSI 3I5UA 2KISA 4L0YB 3HIFA 3FBIB 3WTXC 1OCOH 3IH2A 3P7NA 1WJDA 4UVAA 4RB3C 2VQLA 3FXUA 1W36C 1IGNA 1KGSA 1BR2A 2M45A 4ZDPA 1ZRFA 4JYKA 1ENHA 3PUBA 2DA2A 3OS0A 1S29A 3CCQI 2PMZA 2CJJA 4DOZA 2Z99A 5M3MJ 5J1RA 3ZMUA 2E5NA 1NG6A 1AOYA 3GLXA 4C30A 2VE9A 2KKOA 2JT1A 2DTZA 2MC3A 1PUFA 1OCZH 3HYIA 1Z0XA 1ZYRF 1FOYA 4HF2A 2WAFA 4DBQA 3TQNA 3I55I 2DTRA 5CVRA 1F4KA 2COBA 5H6QA 3Q5FA 2PX9A 2D1HA 4KISA 2A05A 1JKPC 3BC8A 2Y69H 4TV7A 2FBIA 4BJTA 5F6FA 3GTPJ 3C2BA 1T8IA 2IBDA 3E5QA 2KIUA 3TW7A 4J01A 3K4KA 5DD8A 3R0AA 3HOXJ 4G8XA 3B6AA 4BQOA 3SQNA 1YE9A 1QNTA 2L02A 4LB6B 2B7EA 3WHBA 3IHUA 2LY2A 2NRAC 1MGTA 1VI0A 3R0JA 3H36A 4D5FA 5ICCA 1OCPA 1WJ5A 3OIPA 2HVRA 1HSTA 4A3FJ 3B02A 2NNNA 1JGSA 1JKQC 1EH8A 1RPWA 4IX7A 2IS2A 2HVSA 4MNUA 2R7RA 5CPRB 1GVJA 2AXTC 3LA3A 1LFBA 5IYCJ 3E6CC 2IS1A 1BW6A 4PJLA 4B4CA 2K4JA 4ZYDA 1YW8A 4EQQA 3HC7A 2E7WA 2JRMA 2HTJA 1UAAA 2HDDA 2DI3A 4YFKF 2V26A 3MQ0A 1XGMA 2JA5J 2X4HA 5DCFA 1MDMA 3OIQA 1XGSA 2CS3A 1W5SA 3HOWJ 3TP0A 2QQAA 3OYKA 3T8RA 4HA8A 1Z67A 1W5CC 4UVBA 3FKIJ 2ZB9A 2KP6A 4M72A 4A0XA 3FM3A 1WKMA 2Z1DA 3H92A 4KUMA 3M3YJ 4BJ5C 4F93B 5FKLA 1ZTRA 2ACJA 1AKHB 1HQCA 1V5GA 1N78A 1UFMA 1BOAA 1Z7UA 3KP2A 4ABZA 3OYGA 3M8EA 4G6TB 3ZQIA 2GA1A 2IPQX 4EMSA 1D8KA 3BPXA 5IYBJ 2B0LA 5ICGA 1I3QJ 3VYRB 1K6YA 5M5XJ 4NC6A 2EA4A 2DDBA 5FKKA 2VJIA 4N4NB 2F4MB 1JHHA 3M8FA 4YIRX 1PUEE 2MC4A 4AUXA 1Z6RA 1TWFJ 3NEUA 4L9NA 3GFIA 1JUSA 1T0FA 2PJPA 2A3SA 3WU0A 4ZZLA 2MLKA 3K7AJ 5JFRA 2GIVA 1X1AA 4MTEA 2MYSA 5E18F 3LNQA 1LVAA 2Z3YA 2JA6J 5GAHJ 4RB2C 2ESHA 2ELKA 3FXLA 1QU3A 3Q0WA 3F21A 3JW4A 2X6OA 1UZCA 2W00A 2P8TA 3FDYA 2E2HJ 2O0YA 1BJZA 4L9JA 3CJNA 2H6BA 2V9PA 4JX6A 4GO1A 3JTGA 1MBHA 2XUBA 4GRIA 3S1RJ 2K4BA 2F5FA 1N25A 2VJ4A 1RETA 1JJ8C 2X6YA 1QA6A 1XCVA 3I0TA 4KYWA 4Y33A 1XC5A 2FE3A 4N9IA 3G1OA 3PSFA 1FIAA 3GYHX 2VC1A 2ZXIA 1B72A 2MABA 4MIMA 1A6IA 3EUKL 3I58A 3S3OA 1OCRH 2MD0A 1AU7A 2P5LC 1KZHA 3ZN0A 3DPUA 2JZYA 1X4OA 2PMZN 2R7UA 2VQCA 2JMWA 5AIQA 2IJLA 2LRDA 3CMMA 2WV0A 4P5OA 2I10A 4A3JJ 1KA8A 2LD5A 2KMUA 3IWFA 3F8NA 4U7BA 2W85A 4HAMA 4BQQA 1D0ZA 2ZXWH 4IQJA 3O8GA 4ZC3A 2R7QA 3TGNA 3HHHA 3LAPA 2JJ7A 2H6CA 4YIFA 3EPZA 3I71A 4DW6A 4BJ6C 4F92B 3DV8A 2EFQA 3I59A 4KFCA 4X6AJ 3WGGA 4J00A 1S72I 2GOXB 1GXPA 1IAWA 3AG4H 1NTCA 2R7DA 3ABUA 3V8KA 2BV6A 1UJ8A 2A6TA 5F04A 2BY2A 1R9TJ 1U5TC 5GTIC 2D2WA 4Y13A 4XSZF 2MH2A 4WCGA 1R1VA 1CF7B 1K79A 4FISA 5J3LA 5HNFA 3GX4X 3QYEA 1IXRC 4R8HA 5EGOB 2XGDA 4EJOA 1ZG1A 3RSNA 4MFEA 5LEJA 1GXQA 2M34A 3IRQA 5TISC 4FE7A 1TW2A 2L7KA 3K4JA 5A2QK 5C3EJ 1OR7C 1R23A 3D5RC 3FXQA 3OS1A 3S15J 1VQPI 3K4BA 1HKQA 2D45A 2JUGA 3CCVI 3CUQC 2L54A 4XRMA 3ZMSA 3CMAI 2AS5F 1FSHA 2JN6A 4L5IA 3D5SC 3Q3SA 4AC0A 3J80K 4BHPA 2IP2A 2FOKA 3HRSA 2CQNA 1F43A 1SFKA 1Z7LA 2HYFA 3NAUA 2PLYA 2CV2A 2KLOA 4PSWA 1TL8A 2V6EA 4FE4A 3SZGA 2K7LA 1XSXA 4II3A 1TWCJ 1MMSA 1WWXA 1OYYA 3IH3A 3JCUC 5FLVA 2XGEA 5KHDA 1MKMA 2F4IA 2EFOA 2A68F 4BUPA 1YX5A 3QU6A 1SVLA 3SXYA 1GHCA 2ISZA 2XSDC 3H5AA 1L0OC 2Q1ZB 3KYCB 1IUYA 3S8PA 2XPVA 3CC2I 2R7ZJ 4OIPF 2W1OA 2L7ZA 2ME6A 3S14J 3A4CA 2PMUA 2XF7A 4S0HB 1RIOH 3IH4A 1R49A 4UUTA 3VOEA 1R7JA 2P7VB 4PJJA 3K70C 3DTKA 3G73A 1HCRA 4JQFA 4E7KA 3LFUA 2MH9A 1MJAA 3TMOA 3HKZA 3VODA 4G7ZF 1HDPA 2XGCA 4WWCA 1S3JA 4L9VA 2QSGX 2RVCA 1W7PB 3RDIA 2P81A 1WRJA 3QAHA 3A02A 4XL9A 1T95A 5B1AH 3G4SI 2R7TA 1WJCA 3I3LA 5D6FA 3F8BA 4CYCA 2EIMH 3A01B 2VXZA 3LQRA 5LRSA 3C3WA 1XMAA 2HWVA 2F6CA 3BR5A 3PL8A 3ASNH 5HOOA 2E71A 3NRVA 1EKEA 2PMHA 2R7SA 3L9FA 5HLGA 1I3AA 2HDCA 2W24A 3ZXSA 2DXIA 3H1CA 3JRFA 2EIKH 4ANJA 2MBFA 4B1RA 4EJUA 1QVUA 3BJ6A 5FFXA 2D5VA 3F22A 1BM9A 4CCNA 1ZGJA 2ZMEB 1FOXA 1P7IA 5LGUA 3V42A 1FBQA 2WY7Q 3CDLA 4KT6A 3SJMA 2WB1A 1YLFA 1YIJI 2HR3A 2CUJA 2HPIA 2Y75A 4NBQA 4HPQA 2M7AA 3QYFA 2OUMA 3WGHA 1YW9A 4ITVA 1D0XA 5FLXZ 3CP8A 3KP5A 4QSHA 2ZO4A 2XPUA 3WTVC 2FQ4A 1V5FA 3WTWC 2ZNZA 1A36A 4M6VA 1LVKA 2L01A 1FJLA 1FWZA 2RN7A 4B3XA 1X19A 4D1QA 3BZKA 2X1EA 3KP4A 2ZFWA 4KA4A 1PVEA 5E3NA 3QOEA 4IZZA 2LKXA 4HDUA 2PFBA 3LSMA 2XF6A 3K4CA 1VQKI 3CZ6A 3OYLA 5LD2C 1UG2A 3OYDA 3GTLJ 3H9JA 5HS8A 1VQ8I 2O8XA 1FTTA 2L9VA 4G6QA 5J6XA 5K5RA 3H35A 2BZTA 2ZFUA 3CLQA 1SFEA 4BY7J 2Z33A 4OIOF 1BA5A 4AVPA 2HOAA 1QO0D 2LNBA 3LOCA 4XLFA 4LGWA 4M6XA 1FOWA 2GA2A 3SEQA 4IVNA 4A93J 4U88A 3U1KA 3OYIA 2XRLA 3UNGC 5BPIA 1T38A 2FXAA 2M9HA 5H20A 1E3PA 2LVSA 4IHVA 2Z5UA 5D6EA 1VQ4I 2XPWA 2IGKA 1O3QA 4LLGF 4B47A 3QYBA 5ICFA 4HSTA 2DA5A 2EZKA 2HOTA 2L0KA 1J5YA 3P9CA 1S6LA 2V9VA 2Y9ZA 3PSIA 4IF4A 1S8NA 5TGTA 1BW5A 2L9SA 5GP9A 1O7FA 2EIJH 1BI1A 4H0EA 2Y31A 1JKOC 1YG2A 3F9KA 2Z9OA 2W57A 3G6EI 2A07F 1I6XA 4D0PA 1FYMA 2ZXJA 2X48A 3D1NI 4AYBN 4KITB 4D7MA 1T56A 1Y8RB 2GIZA 3ELKA 3V4GA 2CO5A 1LUJB 5J4VA 1L3LA 2HZDA 3TDZC 1ETOA 3MEXA 4AM3A 3BWGA 2WAQA 1JUPA 1QZYA 4DJAA 4M6YA 1ZRCA 4ZTFA 2TRTA 2Q0OA 2R7FA 4PFPA 3BTJA 3M07A 4A6EA 5FB2A 1ZRDA 3IAS2 1IV6A 2KHMA 2BY3A 2BEOA 1KONA 2CW7A 1RUNA 3OL4A 1IC8A 3E7LA 2X0LA 2F48A 3IC7A 3LSGA 4YRVA 1WPKA 2E7XA 1T0FC 3HOZJ 4M3DA 1SD6A 3F6OA 3L1PA 2IW5A 3BQZA 3K70D 4IXAA 1WZ2A 3JRHA 1XGNA 2FOWA 3K1MA 5L3BA 1IZ1A 2DA7A 3I4MJ 3PO3J 4BBSJ 4ON0A 4RLFA 3J7AO 2O03A 2W25A 2K3FA 5FKNA 1Z05A 4IO9F 4EEFG 3ASOH 3G1MA 3H9QA 2Y30A 2R4GA 3MVPA 5D8KB 2CQXA 3P9IA 1DP3A 5FD5A 3JRAA 2M4GA 1JKRC 2E36A 2MGQA 2LY9A 2DODA 1B8IA 2OQGA 2P5VA 3FISA 4QIWN 1FTZA 2ETHA 2HNHA 1FBUA 2OJED 1FX7A 1X58A 3HOTA 4ZJZA 2W4SA 2KJBA 3A01A 2K02A 3PNVA 2R5YA 2OA4A 3ZCOA 4G12A 3DLLF 5E3MA 2ZJRF 1DU0A 2MFZA 3PQJA 3D5LA 2CGPA 5F08A 2OD5A 4BE1A 1DGRM 4RGXA 4N9HA 1FYKA 1DDNA 4WF2A 5HS7A 1P9QC 2WWYA 4BE2A 2ZXHA 3AG1H 4RA2A 2XASA 4XNFA 5F27A 1YQAA 4BE0A 5L3CA 3PIPF 1GLNA 3I4PA 3SZTA 2Q2EB 2ZJ2A 4CCMA 2M1BA 2VODA 3DKYA 2A69F 4OINF 2VT3A 4EJVA 2KDZA 3ZMZA 2JA7J 2GZWA 2A61A 2K27A 1SMTA 4H4KC 2KRFA 2V1NA 3I9V2 4NC8A 1R71A 2WTEA 4M3BA 1IN4A 1QHHD 1POGA 4OAYA 2CQQA 1JJ6C 1DPUA 5IP9J 1YJNI 3ROUA 5JR3A 2XSJC 4KIGA 2FD5A 2DN0A 3E5XA 3OOPA 4WXCA 4YIIA 5E8IA 2ZMEC 4L9TA 4N4OB 5HDKA 4UNOA 3BR1A 2VKHA 3WG9A 1WHUA 4CH7A 2PJRA 4P55A 1EV7A 5F1JA 2J5OA 4CA0A 4EV0A 2VKVA 3GFMA 2YS9A 3KCCA 2DJNA 4G9YA 2LF8A 4CYDA 2FNPA 1PYVA 2GBYA 4EGZA 2VASA 3CDIA 5GAGJ 2ID3A 3M7GA 1T6SA 3A0HC 2X1CA 3CUQB 2RNGA 4W1UA 1FZPB 3BLYA 5IT9Z 4C3HJ 5ILUA 1O3RA 2KL4A 3BTIA 4HEA2 1XSDA 3T0YA 4BXFA 1YJ9I 3BTCA 5D4RA 3EUHA 5LFAA 1CQTA 4LG0B 2L4MA 4M9ZA 2DMTA 2CV0A 1TNSA 4MFDA 2ADUA 1ZLJA 3BTLA 5FLMJ 4I01A 3I64A 2QSFX 5EGOA 2DLLA 1SD7A 5TJJA 1RR8C 2H8RA 3GLLA 1VQOI 2RAEA 2DJIA 3R4KA 3ZQGA 4BACA 3GF2A 4RAYA 3W2AA 4BQAA 3GW2A 2HQRA 4D5CA 3BG7A 4CGZA 3S2HJ 3VEPA 1O57A 5EG0B 3F0CA 5FD6A 3FMQA 1HW5A 3KLNA 2MG4A 3VPRA 1IRGA 3OSFA 3ECOA 5FKMA 1BBYA 1MH4A 5J40A 4NHJA 4C2UA 5E3OA 4B3AA 3ZMTA 4HG2A 4I0AA 1HBXG 3HJEA 2P5KA 3E3VA 2DMQA 4PDKA 4DNCA 4FX4A 1ZN2A 2A5WA 1IG7A 2O6GE 1JT6A 2CFXA 5F1RA 2M8GX 3HHGA 5D5UB 1WCMJ 2Z2SB 1IJWC 3TEDA 2JWTA 3FXOA 3CF2A 4KICA 4IOAF 2H27A 2VBWA 4XQFA 4NQWA 4PJNA 5FROA 3VSLA 3CDHA 4MHGA 3OYFA 2RC4A 2R93J 3PO2J 4DIQA 4F7ZA 4DZJA 3KE2A 2CH0A 3MZYA 1K6OA 2O9LA 4PJ0C 2XAGA 4G7OF 1D5VA 4HSRA 1DPRA 3JRIA 4E7ZA 1UHSA 2ELJA 1D1BA 2O7OA 1D1AA 2G7UA 2JPCA 3IRRA 4PZJA 4C9YA 4KJZA 4PUSA 4XSXF 1LE8A 1OLTA 2A6HF 2EV5A 3WHCA 1LQ1A 1LDJA 4IHYA 2H1KA 3BR3A 3M4OJ 1R4MB 4B09A 1OKRA 2FF4A 4S04A 3FIWA 4ENJA 1ON1A 2EFWA 2GXAA 1HLVA 1KU7A 2CW8A 1IN6A 3KP6A 2XKOA 4Q4ZF 4UB8C 1VQNI 1B1BA 5E1ZB 5M5YJ 2XAQA 2XAUA 2ZJPF 4I09A 2RREA 2GM4A 2OTJI 3HRTA 1CGPA 4RAFA 2P6SA 1IN7A 4XKVA 4LFUA 4CZZA 3K6GA 3FHNA 2K40A 3BJAA 2CQ7A 6PAXA 2R0QC 2H8WA 2V9KA 5E3LA 3K4LA 1J0RA 3WODF 5EEAA 5CYVA 3TKYA 4GYIA 3MZHA 5HDGA 1DUXC 1KYZA 2CFOA 3IV5A 2QCOA 5CVJA 4W97A 1TP4A 2QSHX 5B3SH 3WU2C 2L9NA 2W7NA 3H3UA 3FM5A 2CQKA 1E3OC 1LJ9A 4Y15A 3HGYA 5E1XA 2JUCA 2E1MC 5CVUA 1G59A 1UMQA 2LR8A 4NQWB 1WJBA 3UR3C 3DPTA 2L2OA 1XMKA 5K7HA 1MBEA 2VONA 3W6KB 1HOMA 2P0WA 4B8XA 3CTAA 4RM2A 1AKHA 5IT3A 4F3QA 2KFDA 2UXXA 2F5VA 4BHCA 4IPAA 1FY7A 2FUG2 2DA1A 1D5YA 5LEKA 2G7HA 1MNMC 3GZ6A 4HLXA 3BZ6A 2HDWA 1F5TA 2VIXA 3P9KA 3Q9SA 1HA8A 2LOOA 4CCLA 3NWTA 4AWXB 3L2RA 5C44J 3NQOA 1MDMB 1DU6A 1V4RA 4UV9A 2ELHA 3LWFA 1HXDA 5BPDA 3DWLE 3CCRI 1TQIA 2DMUA 3KEYA 2LMDA 2EBIA 4RB1A 1YITI 2DYRH 3SFIA 1X1CA 2RQPA 1XDSA 2M5WA 3TO7A 5F0CA 3DP7A 1SFXA 1UHWA 1ZLKA 1SD5A 4XLNF 3JSOA 3DLAA 4Z6YA 1SMYF 2HU9A 3SYTA 2RV8A 3CQZJ 2F2EA 3JRDA 3HTUA 4DYCA 2PI0A 1ZAOA 4F91B 4OMZA 4LG0A 4EM2A 4Y4RA 3R6SA 5DDGA 3HZJA 4UUSA 3LSHA 4HZFA 4A69C 2DQRA 1JTYA 3OWTA 2FMLA 3ECHA 4GYGA 4DBRA 4UHTA 2CU7A 4G7HF 1B9NA 1JI8A 3HPHA 3JSPA 1SFOJ 1Y8QB 2Y9YA 3OYBA 4DYQA 3G71I 3S1NJ 1ONVA 5CQGA 5JLWA 2I5UA 2JK3A 5BNGA 2VXDA 2IXSA 1ZARA 2AXLA 4P96A 2L5QA 1RC9A 3CCLI 1LEBA 4ZYAA 3ZQHA 1ERDA 2QVOA 3BJOA 1MJBA 3I4NJ 4LOCA 5D5WB 2AQEA 2GAUA 1Y0NA 3V8LA 1P6RA 1E3HA 4PJMA 3LSRA 3VB2A 1YO5C 3ESWB 5ILSA 4Z2YA 3MAJA 1LE8B 3CJQB 3HG9A 2DOFA 2M8EA 1PJRA 4P1WA 4FETA 4LITA 2E34A 3CLOA 3OYAA 1U3EM 1ETQA 1SANA 2JVGA 3ZN1A 4FASD 3KZYA 4B43A 5K1YA 5DS9A 3PQKA 2OAZA 1JTXA 4NC7A 2XAHA 2IS6A 3ZQFA 2TDXA 2DT5A 3GUDA 1QVTA 2IS4A 1F1ZA 4N0BA 1V3FA 4BEHA 3TO9A 4OU0A 1KQ9A 2FA5A 2WY8Q 1WH7A 2YX4A 2JTVA 4RS8A 1O4XA 5JVGF 4HX8A 4P9UA 3TOBA 1FLIA 4ENNA 3GTMJ 2WC2A 2DFHA 4HNVA 4IL6C 2V1XA 4XLCA 3V7SA 1U9OA 2CUZA 3OL3A 1YFHA 5CKTA 3BY6A 3JREA 4FCYA 4NNJA 4PFOA 1YYVA 1XB4A 4UUVA 5JLXA 5HLTA 3S3MA 1X1DA 2H1LA 3HL2A 4ASNA 4OAZA 2CUEA 1FMVA 4X1EA 5CVIA 3FMSA 2EH3A 1GV5A 4XLPF 2DOEA 3F3XA 3CCYA 3RQIA 1IUFA 2EK5A 2JA8J 2EFPA 4NDLA 3ZQCA 4LIUA 4PSXA 1SEUA 5IOZA 4Q5SF 2XAJA 4ESBA 5HVQC 2KZVA 4A3KJ 2E1CA 2MA3A 4BGDA 5EG0A 3CCJI 2OTLI 5J8CA 2GXBA 1JT0A 4A3LJ 2WV1A 1XX5A 2EV6A 2HEOA 1VFCA 2E2IJ 1KU3A 3DBRB 2BHZA 3O8HA 1MSEC 2NAZA 3A0BC 4GXOA 1Y0UA 2BY0A 3JRGA 5EYRA 1MMNA 1RKTA 1ON2A 2JQ7A 3OS2A 1BL0A 3HKZN 3U9GA 4BL0B 3OYMA 4XN3A 3ZMDA 1EH6A 3NWSA 2E5ZA 2DO7A 3K0LA 3JTHA 3OIOA 2CW0F 3FK7A 4XORA 3J7ZI 4MTDA 3J81K 3RPQA 3F23A 4PGGA 4KN7X 3VYUB 2Y2ZA 4YEJA 2X85A 5DYMA 3MKLA 2XF5A 3WE3A 4X0GA 5LLQA 1H0MA 2HTSA 4A3MJ 1O7LA 4KN4X 1SAXA 3WG7H 1K4TA 1OQYA 1XSVA 4HW0A 5KAIC 5ICEA 2R7OA 4MEXF 4A0ZA 3O2PE 2P4WA 1S7EA 4OIRF 3J80Z 2DK8A 4R1HA 5E1WA 5BMZA 1O3SA 1VQ5I 4M3EA 5EJCA 2XVCA 4LB5A 4A3CJ 2R7WA 4Y17A 2X51A 2EZLA 1XMXA 1STZA 1QQIA 1HC8A 3RZDJ 3OOUA 3FKJA 1T2KA 2FNAA 2OV7A 3JRCA 2JSCA 1IXSB 4LMYA 1ORKA 4NUBA 4BNCA 1XN7A 4AU7A 1YS6A 4OOIA 1HW2A 3V8JA 1J7KA 1W4MA 1X1PA 4R79A 3MKYB 5HLHA 5HS9A 3QQAA 2Q2EA 3K2ZA 4HV5A 1U0JA 1FNNA 2QGUA 1R1UA 3ERMA 3RPUD 3DTIA 1RUOA 3CC4I 3SDGA 1GDTA 2H09A 4XR6A 3H0DA 1U5TB 3KLOA 5FKOA 4UUSB 1USTA 2J5PA 3C18A 2W48A 2FU4A 2LG4A 4XN0A 1Y1WJ 3H9GA 4GCVA 1H9GA 5KNLA 1MJ9A 2IVMA 2QKLB 3QU3A 2L4AA 3E6BA 1ETXA 2YX7A 1ZG5A 4HF1A 1OJLA 2AQFA 4AD9A 1W0UA 3M9AA 3LAJA 1MSFC 4V2GA 2R5YB 4C3JJ 2HOEA 2VL8A 3W6JB 1CF7A 2FMYA 2QF7A 1M1EB 2VB6A 4U0WA 2RQQA 4M3GA 2PG4A 2NVUB 3SFZA 4V19K 4A3EJ 1U2WA 3BPVA 3EYIA 2ECBA 2R92J 3EYYA 3TW6A 1T33A 5AONA 4PGHA 2C6YA 3ZGKA 2QYOA 4E4HA 2M7BA 3QP5A 2ZNYA 4U0YA 4RBOA 1RNLA 4I02A 3CO7C 1EJ9A 3IAM2 3LA2A 2BOLA 4BS9A 3K9TA 1LEAA 2EWNA 4L5JA 1SD4A 4CDGA 2OCEA 4B48A 4GFBA 4IQ4A 5BQTA 3S16J 4M73A 4HNUA 2LYCA 2M2EA 2QWWA 3GXOA 2LSOA 1P4XA 3HOUJ 2LK2A 2F4OB 4V2FA 2R7XA 4KIBA 2HQ5A 1J75A 1MNEA 1VQ7I 4A6DA 2LH9A 3HXLA 5ED4A 4KMFA 1IRFA 3HOSA 4II2A 2VOOA 3FHZA 3E0JB 4EVIA 2IAIA 4I99C 1K4SA 1QPMA 3KPHA 3MFKA 1TBXA 1ZGAA 4MQVA 2DU9A 2CUFA 2KDOA 3K10A 3L2WA 1A04A 2E1NA 2X6WA 5EEHA 3HOVJ 5HLIA 4CO8A 2PN6A 3LL7A 2M30A 5DUKA 3IKVA 1W36D 2Y0SA 2YR2A 2HI3A 1BIBA 2XKPA 4D9JA 2VN2A 3COAC 1MBKA 1X3UA 1V55H 5F0FA 4RGUA 3W6VA 4RGRA 4FX0A 2EFNA 3VYSB 1R00A 3RKYA 5JHUA 5DCMA 3AG2H 5J1UA 3GCMA 1B4AA 3HSRA 2HKOA 2KJCA 1TTYA 2NVYJ 1Y39A 3AG3H 3U2RA 1K78B 4HX7A 1ETWA 1BI3A 5IP7J 4JK1X 3BCBA 1XPXA 1ZREA 2KRHA 1K7AA 4RGSA 2O8KA 4BAYA 1I27A 3EQLF 4L5EA 1FP1D 1IRZA 1I50J 2YUSA 2XRNA 1A6QA 3GFLA 5EDNA 1IXCA 1GVDA 5M3FJ 2CYYA 2ZCWA 3W2WA 3M1EA 3QPSA 2TCTA 3BP8A 1YOVB 2ZSHB 4A12A 1LPQA 2FBHA 2QQ9A 1WJAA 4CCOA 2OPTA 4B44A 1GV2A 3E1SA 3ABTA 3CCEI 4YFXF 5B5EC 2ZSIB 5B1BH 1C0WA 3S17J 2N8GA 1LB2A 4XBFA 3TP3A 1RRJA 1Z91A 3A1YA 3DKWA 1G2HA 4HNTA 3LSJA 3EUAA 2IA0A 3EUHC 4GGGA 2BGCA 2W82A 4JP0A 1WVRA 5LHHA 2CV1A 3E97A 3ABLH 2PBIA 3L2VA 1YJWI 4A0YA 1J9IA 5GPCA 4IKFA 2ZC2A 3GTKJ 3KIOA 2L7MP 3DTEA 5CQEA 4C2TA 2QBYB 2DA6A 4BBRJ 5K7FA 3FZVA 1EA3A 2LREA 2OF7A 1MBJA 2UUZA 4WK8F 1EH7A 2E35A 2FEZA 1FSEA 3VFZA 1I39A 2LP0A 4XKWA 4IHTA 3LSKA 3K1PA 3DEEA 2EJRA 3AAFA 2ZMEA 3SZPA 1FIPA 1YRNB 2ISYA 4E7JA 3WGIA 1A35A 2BW3A 1V5EA 3GWZA 2EZHA 4BDYA 3DEUA 4C3IJ 1DQUA 1LDKB 2GOMA 1OCTC 2EZIA 4DZPA 2YPRA 3IP4B 3OYEA 3QPHA 2E60A 1R4NB 3IUOA 2FJ1A 4XRSG 1MNDA 2HYGD 1VNDA 2P7CB 1YW7A 2GWRA 3P5JA 3H5NA 3E5UA 2X1DA 3KYLA 3EDPA 3RZOJ 2BYVE 2DYSH 1R58A 2LDUA 1YTYA 2A6EF 3L2QA 3HSEA 2ZBKA 3KFWX 5LRRA 3O6BB 4E6KG 1HSJA 4D7NA 1BC8C 2QLZA 5J47A 4KDPA 1LKXA 2P6TA 3I53A 3CUOA 3MMYB 4XOTA 4KIFA 3FBNB 3KZZA 1R5ID 2O3FA 3F8CA 3OYJA 3DCFA 1K83J 3FX3A 3MD2A 4U7DA 3QWLA 1ZELA 4YELA 3ABMH 1WI9A 2KZGA 4KNYA 3D0SA 2ZKZA 2IT0A 3KX2A 2RNJA 1Y1VJ 1PDNC 5K7ZA 2XAFA 3MWMA 4RM3A 3FXJA 5L3GA 2KIMA 1P2FA 2D1VA 2JPBA 3AKZA 3HTSB 2K3PA 2OZ6A 3DPLC 1LFUP 5JI6A 3RPUA 3HBLA 4F55A 3KETA 2VUMJ 1BI2A 3JAMZ 1Z3XA 4KT5C 3AL0B 5IT9K 3LFKA 1Y56A 3C7JA 5FJ8J 3RYRA 2H94A 3CMEI 2ME0A 1QRYA 3OY9A 2BBYA 3GBGA 3CCMI 3BR6A 3VDXA 1YHQI 2MD5A 3LSTA 2I8DA 2ID6A 1VQ6I 4BH9A 1H8AC 1ETKA 3G2BA 3JAMK 3ULQB 1B9MA 1HF0A 3CJRB 1QHGA 1TW3A 2V1DA 3RQ4A 2HXOA 2F5CA 1JHFA 2IA1A 4YFNF 2HVQA 4G94A 4YG2F 3L2CA 3L2UA 2WAEA 1PP7U 4IRIA 4A3IJ 1PP8F 1ODDA 3HM5A 5CJ9A 4E70A 1VQ9I 2VOPA 3Q9VA 4EGYA 3Q0UA 2DBBA 4DQ2A 1AHDP 4IHSA 1G3TA 4BY1J 1R6RA 3S2DJ 1TWGJ 5C4JJ 1ZKGA 1QZZA 3H3ZA 4CZCA 5DUIA 3G3ZA 5HNHA 2UZKA 3OSGA 1DGWY 1ETVA 4Q48A 1B8IB 2VQHA 1VQLI 1XG1A 1ZR4A 4RMNA 3FXRA 3U1DA 4HX4A 3OR1C 4LG3A 2O61A 1EF4A 1R1TA 1W1WE 3BCAA 4XICA 1RR7A 3L09A 3S2WA 1P4AA 2DPUA 1YX3A 5FO5A 4FQGA 3WTZA 2DA4A 3RIRA 2VQGA 2IGMA 3I59B 1MD0A 4ZTJA 2R5ZA 2V6CA 3N4MA 2NS0A 3PFYA 1TQPA 2QQBA 1SAUA 5B66C 3S1QJ 1QZEA 3HPGA 2DDAA 1USSA 3C2GA 3FK6A 4RB0A 1P7JA 4I2OA 1TNTA 3H0GJ 3KEOA 1E17A 5K5OA 1TT0A 4MGRA 4HLYA 5LHGA 2XC7A 5KCMA 2O5RA 2VKDA 1X2MA 1H9TA 1W7PD 1Z77A 1YRNA 3RKQA 2ZJQF 1ITYA 4XLEA 1X3WB 2FRHA 4JOMA 5D8LB 3HOYJ 5DM7F 3S32A 2COMA 2NNYA 2AHQA 1UHMA 2M87A 5GTHC 4HQEA 1B59A 5GADJ 4CYCB 2R3SA 3F6VA 2HXIA 1UCRA 3DU5A 1IN8A 2B9SA 1S7OA 1SVMA 2QQ8A 3IWZA 3QP6A 2QBYA 4E7SA 1F36A 2WB1N 3DXJF 4AVZA 4WXDA 3RKWA 3EETA 2L3DA 3UKGA 2Y0SN 2DQLA 3PM1A 5M5WJ 1OYWA 3QODA 3DU6A 3HUGA 1APLC 3WTTC 3GTQJ 2ICWG 3OR2C 2VKEA 4XONA 2X9DA 2A5YB 2LBFA 3OMYA 2MSYA 2QENA 2QZ8A 1MBFA 3TDUC 4AIHA 1BI0A 5IYDJ 2BVMA 4CSWA 1HKSA 2K85A 2G0EA 1N75A 3K69A 3CCUI 3BG9A 1JE8A 1REPC 2ECCA 4CHUA 4Y52J 4G6DA 2QA4I 5IP6A 4FT8A 1GUUA 3KZIC 1G3YA 1E0EA 2LLKA 2NS8A 1ZR2A 1JGGA 3KP3A 4F52A 3GTOJ 5L3DA 1BN5A 3VSKA 2FQ3A 2OQRA 4AIDA 1G8XA 1T98A 3J7AY 1MIJA 3LQQA 3FMRA 4MLOA 4IRHA 3SEZA 1TZLA 4XKCA 3V7RA 3FWEA 3ZOBA 4M9XA 2K9QA 3TL4X 3U21A 2UV1A 4L0ZB 2DOAA 3PNYA 5DEQA 4L18B 2BXYA 1G3WA 1KQ0A 5FRNA 3REOA 2BVLA 2JA2A 1MW7A 4I76A 2MW8A 1NH3A 3W3CA 2NS7A 3V7CA 5A2QZ 2K9SA 5KVRA 4A3GJ 5GPAA 4ZDOA 4ZYGA 1U6GA 4QLCU 5JHFA 1LFPA 4EM0B 2VBXA 4MO7A 4Y7NJ 2HFHA 4I6ZA 1B6AA 3CO6C 3MCZA 3T1BA 4HDVA 3GFJA 5IPAA 3IKTA 2XHKA 2CRGA 2V4JC 2Y48A 4M9SA 4BQNA 1BJAA 4JBAA 3RKXA 3RCOA 5F64A 3ABKH 4ZYHA 1I6HJ 5L3EA 4RDUA 1TWAJ 3S3NA 5E79C 5D4SA 2WA0A 2IGNA 1JUMA 1LNWA 2NOGA 3GO5A 2E19A 4DYRA 2OCCH 1TQMA 4ESJA 1ZQ3P 1UB9A 1WJFA 2F5EA 5LBQA 3GEZA 1Z3YA 5CVVA 4RAGA 3F72A 5LGNA 1BOBA 5ILVA 4LJZF 4AIJA 9ANTA 3HEFA 2DAOA 1J59A 2DT7B 4MEYF 3CMYA 1WGXA 1D3YA 2YSRA 4HRIA 1FMWA 4EJTA 1MMGA 1XGOA 3BG5A 1F9NA 3FXMA 2QKMB 3K2AA 3PFIA 1TWHJ 3LSPA 3ZQ7A 3N05A 3G1LA 4I98B 1P92A 4XMYA 2DK5A 4E7IA 3KYDB 4O3MA 1B72B 1AA7A 1T08B 2MLGA 3CUQA 3RTRA 5IOYA 1ETYA 1K61A 1OR7A 4E7LA 4IHXA 1X3ZB 2QM3A 2HKXA 3HRUA 1SVOA 2YU9J 2BY1A 2RDPA 4XOPA 2K5CA 1YIOA 2PJRB 4I7HA 2HOSA 3H3VK 1IW7F 1FT9A 1RZ4A 2K9LA 2M3AA 3ISPA 3LMMA 3R61A 2DW4A 4HQMA 3ZQQA 2VI6A 5E8GA 2DCEA 5EF6A 3VYTB 2DT6A 1Q1HA 1WQ2A 4ZYEA 1VQMI 1MMAA 3LA7A 1NG7A 1U5TA 3B6CA 4I0BA 1XCBA 2KIFA 4LK1F 1W7PA 2GQQA 3WTSC 2KQRA 5J4YA 1R22A 2JSPA 5IY5H 4A2UA 1D8JA 3W2VA 4LLLA 3ZRGA 4WX9A 4P9FA 2K9MA 2DMNA 3CP2A 2XGXA 5D5XB 3F8FA 4HYEA 2WADA 4E7HA 1HDDC 4U0VA 3BDDA 2QEXI 1ZGWA 1BC7C 2VPRA 3PJRA 2NYXA 4O6JA 1KQ8A 5CLSA 5C4XJ 5GAEJ 2VC0A 2E1OA 1QPIA 3RYPA 2HYJA 3MKWB 3GVAA 1XS9A 1U9NA 2AO9A 1J09A 4ENMA 4M71A 4AIKA 3QPLA 2L9RA 5AIPA 4XRFA 2OBPA 2LKPA 2WAQN 3NARA 4CCKA 5KAFC 3E6MA 3R60A 3FXKA 1J2XA 2KIQA 4HOBA 2JRTA 1MZBA 4BDZA 2RGVA 3DKXA 2LY1A 2CG4A 1K78A 1FBSA 5H6RA 4BYYA 3L7WA 4JX4A 5D5VB 4GDFA 1W0TA 3HUGB 3ZQLA 3AFHA 3DQVC 3WU1B 2M4KA 1A5JA 4QWQA 5DCMB 1O3TA 2VJJA 5FFZA 4CICA 2XDVA 4J19A 4OWRB 3ML6A 3S1MJ 4KMUX 4BU2A 4UY8I 3F8MA 4EJWA 4A5NA 4M3FA 4ESFA 1S7AA 1Z1DA 1OMIA 1NK3P 1P4WA 1SC7A 3WTYC 1Y6IA 2K86A 4QTRA 4DGWB 1RKWA 4UVCA 4OIQF 4UXNA 2HQNA 2Q8KA 5K5QA 4Q47A 4XK4A 1KU9A 4HV6A 1VTNC 4CUGA 3AL0C 1XD7A 2IGOA 5FRMA 1I5ZA 2VBZA 1X1BA 2DFFA 3BR2A 1S9HA 5EZGA 1U78A 5FGMA 4C2MJ 4HBLA 5F0HA 4AYBA 1IDZA 1S5LC 2JVHA 1G3SA 3Q0VA 2NVTJ 1BR4A 2XIGA 4QPOA 1WI3A 3ONQA 2BW3B 3KEQA 1FP2A 1H88C 3JRBA 1ZH5A 1TLHB 1WSUA 4FTHA 2BHYA 1H89C 3RI4A 3CC7I 2V1UA 3E6DA 3H5RA 5H2FC 1HW1A 3LSIA 3OYNA 5FLXK 4A3BJ 4M74A 3BR0A 1OISA 2UWMA 3ZR8X 5BS6A 2EILH 4ETSA 3WTUC 4O5VA 3TBIA 1MMDA 4S05A 3M8JA 1QGPA 2NVXJ 3KP7A 2CWEA 2DFEA 2V7FA 1PUFB 1U8BA 2VLAA 3GZNB 3MN2A 2VT2A 3BT9A 2Z16A 4ZH4F 1OYIA 4LLNA 3TOAA 4K2EA 1I1GA 1IV8A 1Q1VA 2GLOA 2VPLA 4XIDA 2M0MA 1A31A 1Z21A 2KPMA 4BEHB 2E1MB 2KT0A 4ENKA 1ZK8A 3O3KA 5LHIA 2EPFA 1D1CA 3GZ5A 1YS7A 3DBLB 3L00A 3I54A 2VBYA 1R5HA 2LF7A 1FC3A 5KK1A 3TO6A 4RLQA 4LD5A 3I56I 3DFGA 2LTPA 1FPQA 3ZMVA 3B73A 1VZ0A 1N77A 4NB5A 1KYWA 4UB6C 4UV8A 3CESA 1FOKA 2DMPA 5TRDA 2K9NA 5E20A 2M0CA 1ACIA 1IN5A 3K4MA 5DM6F 1IRXA 3X2QH 2CMPA 4IJAA 1Z6TA 2CSOA 3IL2A 4EM1A 4XLAA 3HB9A 2HZTA 4BXXJ 3RJPA 2XB5A 2EINH 3BROA 2OU2A 2STWA 1G4DA 1W5TA 4IOCF 3CF5F 3BG3A 2LBFB 2OZUA 3A2KA 3PIOF 5J8FA 2EV0A 1TT5B 2PEXA 3T5XA 3VWBA 1X4PA 2X6XA 3K4NA 1OFCX 1YI2I 4XLHA 2OC6A 4BHBA 2LFBA 1KU2A 5J1YA 3ZPLA 3CD6I 5LGTA 4HF0A 2EA2A 4XRSA 1UG0A 3CJTB 1OPCA 5JVTA 2KRCA 1FYLA 3BG6A 4IHWA 3WE2A 3C2HA 4A3DJ 2IA2A 4QPQA 1E2XA 1R5GA 2IEKA 1IF1A 2GXGA 1WH5A 2R7VA 2DFIA 1LDDA 1BR1A 2G9WA 4IEJA 1SFUA 1QBJA 2HS5A 2YU3A 3BQYA 3PNTA 2STTA 3OYHA 1FEXA 5HDNA 3GMEA 5E17F 4PCQA 4EATA 1I1SA 2NXNB 2NOJB 3J81Z 3GTGJ 1RESA 1BIAA 4JX5A 1MBGA 3HGGA 2R5ZB 2RKHA 1MH3A 3OV8A 1G6NA 1JXSA 4LIVA 1NHAA 1GT0C 3N97A 2QUFA 2Y0MA 5DD4A 3S93A 1XDUA 3SHFA 3T8TA 1U8RA 2HPMA 3DEWA 1WFXA 3FF5A 4ZDLA 2B63J 2FX0A 2V79A 1V54H 5EEGA 1TC3C 2EB7A 2PQ8A 2EQRA 1IDYA 1RI7A 2XROA 3HSFA 1Z9CA 1ZG3A 4Y3OA 1XTAA 2LKSA 1OCCH 2UXNA 5ERIA 1NK2P 2VE8A 3A03A 3MZ8A 2HGCA 3QRFF 5L3FA 2WBMA 2ESNA 3DF8A 3JR9A 2BE5F 3ERED 2FSWA 4FHTA 2HQAA 4BXUA 1ZHFA 3C1DA 4A5MA 2DA3A 2FBKA 4ZZDA 5BOXA 2NVQJ 3OYCA 1HKTA 1D0YA 2W84A 4RAZA 4XM3A 2F5DA 1IO2A 3PUFA 5HODA 3BZCA 4IRGA 1X2NA 5DV5A 3DBHB 4BKXA 3HRMA 3MKZA 4WXHA 1UELB 4CCJA 4CXFA 1ULYA 3GTJJ 2DPDA 2VJ5A 2XB0X 3QPTA 3HDDA 2E2JJ
chains in the Genus database with same CATH topology
1DP7P 1R36A 2IRFG 1T39A 1AWCA 3BOQA 3K1NA 4MQ9F 4LK0F 3ZP5A 4OMYA 2XV4S 3QOPA 3I5UA 4L0YB 3HIFA 3WTXC 3P7NA 4UVAA 4RB3C 3FXUA 1KGSA 2M45A 1ZRFA 1S29A 2Z99A 3ZMUA 1AOYA 3GLXA 2VE9A 2KKOA 2JT1A 2MC3A 3HYIA 1ZYRF 4HF2A 3TQNA 2DTRA 5CVRA 1F4KA 5H6QA 3Q5FA 2D1HA 4TV7A 2FBIA 5F6FA 3E5QA 2KIUA 5DD8A 3R0AA 4G8XA 3SQNA 1QNTA 2L02A 4LB6B 3IHUA 2NRAC 1MGTA 3R0JA 5ICCA 1HSTA 3B02A 2NNNA 1JGSA 1EH8A 4MNUA 1GVJA 3LA3A 3E6CC 4ZYDA 2K4JA 1YW8A 4EQQA 2E7WA 2HTJA 2DI3A 4YFKF 3MQ0A 1XGMA 2X4HA 5DCFA 1MDMA 1XGSA 1W5SA 2QQAA 3T8RA 4HA8A 4UVBA 4M72A 4A0XA 3FM3A 1WKMA 4KUMA 3H92A 2ACJA 1HQCA 1UFMA 1BOAA 1Z7UA 3KP2A 3M8EA 2GA1A 2IPQX 4EMSA 1D8KA 3BPXA 2B0LA 5ICGA 2EA4A 1JHHA 3M8FA 1PUEE 1Z6RA 3NEUA 4L9NA 3GFIA 1T0FA 2PJPA 2A3SA 3WU0A 4ZZLA 2MLKA 5JFRA 2GIVA 4MTEA 5E18F 1LVAA 2Z3YA 4RB2C 2ESHA 3F21A 3JW4A 2P8TA 2O0YA 4L9JA 3CJNA 2H6BA 4GO1A 3JTGA 2XUBA 2K4BA 2F5FA 1XCVA 4KYWA 3I0TA 2FE3A 4N9IA 3GYHX 2VC1A 3I58A 2P5LC 3ZN0A 2JZYA 5AIQA 2IJLA 2WV0A 4P5OA 1KA8A 3IWFA 3F8NA 4U7BA 2W85A 4HAMA 3TGNA 3HHHA 3LAPA 2H6CA 4YIFA 3I71A 3DV8A 2EFQA 3I59A 4KFCA 3WGGA 1IAWA 1GXPA 2R7DA 3ABUA 3V8KA 2BV6A 1U5TC 2D2WA 4Y13A 4XSZF 2MH2A 4WCGA 1R1VA 1CF7B 1K79A 3GX4X 4R8HA 1IXRC 4EJOA 1ZG1A 5LEJA 1GXQA 3IRQA 5A2QK 1TW2A 1R23A 3FXQA 1HKQA 2D45A 3CUQC 2L54A 1FSHA 3ZMSA 2AS5F 4L5IA 3J80K 4BHPA 2IP2A 2FOKA 3HRSA 2HYFA 2PLYA 2K7LA 1XSXA 1WWXA 1OYYA 1MKMA 2EFOA 2A68F 3QU6A 3SXYA 1GHCA 2ISZA 1L0OC 1IUYA 4OIPF 2PMUA 1RIOH 3VOEA 1R7JA 2P7VB 3G73A 4JQFA 2MH9A 1MJAA 3VODA 4G7ZF 4WWCA 1S3JA 4L9VA 2RVCA 1W7PB 3RDIA 3QAHA 1WRJA 5D6FA 3F8BA 2VXZA 3LQRA 5LRSA 3C3WA 1XMAA 2HWVA 5HOOA 3NRVA 2PMHA 3L9FA 5HLGA 2HDCA 2W24A 2MBFA 4EJUA 3BJ6A 5FFXA 3F22A 1BM9A 1ZGJA 2ZMEB 5LGUA 1FBQA 1YLFA 2HR3A 2Y75A 3WGHA 1YW9A 5FLXZ 3KP5A 2ZO4A 3WTVC 3WTWC 2ZNZA 2L01A 1FWZA 2RN7A 3KP4A 2ZFWA 4KA4A 4HDUA 2PFBA 5HS8A 2O8XA 4G6QA 5J6XA 5K5RA 4OIOF 1SFEA 2Z33A 4AVPA 1QO0D 2LNBA 4LGWA 4M6XA 2GA2A 4IVNA 4U88A 5BPIA 1T38A 2FXAA 5H20A 2Z5UA 5D6EA 1O3QA 4LLGF 5ICFA 1J5YA 3P9CA 1S6LA 2V9VA 4IF4A 1S8NA 1O7FA 1BI1A 4H0EA 1YG2A 2Z9OA 2W57A 2A07F 1I6XA 4D0PA 1FYMA 2ZXJA 3ELKA 3V4GA 2CO5A 1L3LA 3TDZC 3MEXA 3BWGA 1QZYA 4M6YA 1ZRCA 2Q0OA 2R7FA 4A6EA 5FB2A 1ZRDA 2BEOA 1RUNA 2X0LA 3IC7A 2E7XA 1SD6A 3F6OA 2IW5A 4IXAA 1XGNA 3K1MA 5L3BA 1IZ1A 4ON0A 3J7AO 2O03A 2W25A 1Z05A 5D8KB 3P9IA 5FD5A 2OQGA 2P5VA 2ETHA 1FBUA 1FX7A 3HOTA 2KJBA 2K02A 2OA4A 3PQJA 3D5LA 2CGPA 2OD5A 1DDNA 4RGXA 4N9HA 1FYKA 4WF2A 5HS7A 2WWYA 2XASA 1YQAA 5L3CA 3I4PA 3SZTA 2ZJ2A 2M1BA 2VODA 2A69F 4EJVA 2VT3A 4OINF 3ZMZA 2GZWA 2A61A 2K27A 1SMTA 2KRFA 2WTEA 1IN4A 1DPUA 3ROUA 5JR3A 4KIGA 3E5XA 3OOPA 4WXCA 4YIIA 5E8IA 4L9TA 5HDKA 4UNOA 3WG9A 4P55A 1EV7A 2J5OA 4EV0A 3GFMA 3KCCA 4G9YA 2LF8A 4CYDA 2FNPA 4EGZA 3M7GA 1T6SA 3CUQB 1FZPB 5IT9Z 5ILUA 1O3RA 1XSDA 3T0YA 5D4RA 3EUHA 4LG0B 2L4MA 4M9ZA 1TNSA 2ADUA 1ZLJA 4I01A 3I64A 2DLLA 1SD7A 5TJJA 3R4KA 4BQAA 3GF2A 4RAYA 3GW2A 2HQRA 4CGZA 3VEPA 1O57A 5FD6A 3FMQA 1HW5A 3KLNA 1IRGA 3ECOA 1BBYA 4NHJA 3ZMTA 4I0AA 1HBXG 2P5KA 3E3VA 4PDKA 4DNCA 4FX4A 1ZN2A 2O6GE 2CFXA 5F1RA 3HHGA 5D5UB 4KICA 2H27A 2VBWA 4NQWA 3CDHA 4MHGA 2RC4A 4F7ZA 3KE2A 3MZYA 1K6OA 2XAGA 4G7OF 1D5VA 1DPRA 2G7UA 2JPCA 3IRRA 4PZJA 4XSXF 2EV5A 2A6HF 1LQ1A 1LDJA 4B09A 1OKRA 2FF4A 4S04A 4ENJA 1ON1A 2EFWA 1KU7A 1IN6A 3KP6A 2XKOA 4Q4ZF 1B1BA 5E1ZB 2XAQA 4I09A 3HRTA 1CGPA 2P6SA 1IN7A 4LFUA 4CZZA 3BJAA 6PAXA 1J0RA 3WODF 5CYVA 3TKYA 4GYIA 3MZHA 5HDGA 1DUXC 1KYZA 5CVJA 3H3UA 3FM5A 2CQKA 1LJ9A 4Y15A 5E1XA 5CVUA 3DPTA 1XMKA 2VONA 3W6KB 4B8XA 3CTAA 5IT3A 2UXXA 4BHCA 4IPAA 1FY7A 5LEKA 2G7HA 3GZ6A 4HLXA 3BZ6A 1F5TA 3P9KA 3Q9SA 4AWXB 3NQOA 1MDMB 1V4RA 4UV9A 2ELHA 3LWFA 1HXDA 5BPDA 1TQIA 4RB1A 2RQPA 1XDSA 2M5WA 3TO7A 3DP7A 1SFXA 1UHWA 1ZLKA 1SD5A 4XLNF 3JSOA 1SMYF 2RV8A 2F2EA 3HTUA 2PI0A 1ZAOA 4OMZA 4LG0A 4EM2A 3R6SA 5DDGA 4HZFA 2DQRA 2FMLA 3ECHA 4GYGA 4UHTA 4G7HF 1B9NA 3JSPA 1ONVA 1ZARA 2AXLA 4P96A 1LEBA 2QVOA 3BJOA 1MJBA 5D5WB 2GAUA 3V8LA 1P6RA 3VB2A 1YO5C 5ILSA 4Z2YA 3MAJA 2M8EA 3CLOA 1U3EM 3ZN1A 3KZYA 5K1YA 3PQKA 2OAZA 2XAHA 2TDXA 2DT5A 3GUDA 1F1ZA 4N0BA 1V3FA 3TO9A 4OU0A 1KQ9A 2FA5A 2YX4A 2JTVA 4RS8A 4HX8A 4P9UA 3TOBA 1FLIA 4ENNA 2WC2A 2V1XA 3V7SA 1YFHA 3BY6A 1YYVA 1XB4A 4UUVA 4ASNA 5CVIA 3FMSA 4XLPF 3F3XA 2EK5A 2EFPA 4Q5SF 2XAJA 4ESBA 5HVQC 2E1CA 2GXBA 2MA3A 5J8CA 2EV6A 2HEOA 1KU3A 2NAZA 4GXOA 1Y0UA 1ON2A 3U9GA 3ZMDA 1EH6A 2DO7A 3K0LA 3JTHA 2CW0F 4MTDA 3J81K 3RPQA 3F23A 4PGGA 4KN7X 5DYMA 1H0MA 3WE3A 5LLQA 2HTSA 1O7LA 4KN4X 1SAXA 1XSVA 4HW0A 5ICEA 4MEXF 4A0ZA 3O2PE 2P4WA 4OIRF 3J80Z 1O3SA 2DK8A 4R1HA 5E1WA 5BMZA 2XVCA 4LB5A 4Y17A 1STZA 1QQIA 1T2KA 2FNAA 2JSCA 1IXSB 4LMYA 4BNCA 1XN7A 1YS6A 4OOIA 1HW2A 3V8JA 1J7KA 1W4MA 4R79A 5HLHA 5HS9A 2Q2EA 3K2ZA 4HV5A 1FNNA 1R1UA 1RUOA 2H09A 5BOXA 1U5TB 3KLOA 1USTA 2J5PA 3C18A 2FU4A 4GCVA 1H9GA 1MJ9A 2IVMA 3QU3A 1ZG5A 2L4AA 3E6BA 2YX7A 4HF1A 4AD9A 3M9AA 3LAJA 2HOEA 3W6JB 1CF7A 2FMYA 4U0WA 2PG4A 3SFZA 1U2WA 3BPVA 3EYIA 3EYYA 5AONA 4PGHA 2C6YA 2QYOA 3QP5A 2ZNYA 4U0YA 1RNLA 4I02A 3CO7C 3LA2A 3K9TA 1LEAA 2EWNA 4L5JA 1SD4A 4CDGA 5BQTA 4M73A 2QWWA 3GXOA 2LSOA 1P4XA 4KIBA 1J75A 4A6DA 5ED4A 4KMFA 1IRFA 3HOSA 2VOOA 3FHZA 4EVIA 1QPMA 3MFKA 1TBXA 1ZGAA 4MQVA 2DU9A 1A04A 2E1NA 5EEHA 5HLIA 4CO8A 2PN6A 2M30A 5DUKA 3IKVA 2YR2A 1BIBA 2XKPA 2VN2A 3COAC 1X3UA 4RGUA 4RGRA 4FX0A 2EFNA 1R00A 3RKYA 5JHUA 5DCMA 1B4AA 3HSRA 2HKOA 2KJCA 1TTYA 3U2RA 1K78B 4HX7A 1BI3A 4JK1X 1ZREA 1K7AA 4RGSA 4BAYA 1I27A 3EQLF 1FP1D 2XRNA 3GFLA 1IXCA 2CYYA 2ZCWA 3M1EA 3BP8A 4A12A 2FBHA 2QQ9A 3ABTA 4YFXF 1C0WA 1LB2A 4XBFA 1Z91A 3DKWA 2IA0A 4GGGA 2BGCA 5LHHA 3E97A 2PBIA 4A0YA 1J9IA 2QBYB 3FZVA 4WK8F 1EH7A 2FEZA 1FSEA 3VFZA 4IHTA 3K1PA 2EJRA 3AAFA 2ZMEA 3SZPA 2ISYA 3WGIA 3GWZA 3DEUA 1LDKB 2YPRA 3QPHA 2HYGD 2P7CB 1YW7A 2GWRA 3E5UA 3EDPA 2BYVE 1R58A 2LDUA 1YTYA 2A6EF 3HSEA 2ZBKA 3KFWX 5LRRA 3O6BB 1HSJA 1BC8C 2QLZA 4KDPA 3I53A 2P6TA 3CUOA 4KIFA 3KZZA 2O3FA 3F8CA 3FX3A 4U7DA 1WI9A 4KNYA 3D0SA 2ZKZA 2IT0A 2RNJA 1PDNC 2XAFA 3MWMA 5L3GA 2KIMA 1P2FA 2D1VA 2JPBA 3HTSB 2OZ6A 3DPLC 5JI6A 3RPUA 3KETA 1BI2A 3JAMZ 4KT5C 5IT9K 3LFKA 3C7JA 3RYRA 2H94A 2BBYA 2MD5A 3LSTA 4BH9A 3JAMK 3ULQB 1B9MA 1TW3A 2V1DA 2F5CA 1JHFA 2IA1A 4YFNF 4G94A 4YG2F 3L2CA 1PP7U 4IRIA 1PP8F 1ODDA 5CJ9A 4E70A 2VOPA 3Q9VA 4EGYA 2DBBA 4DQ2A 4IHSA 1G3TA 1QZZA 3H3ZA 5DUIA 2UZKA 3G3ZA 4Q48A 2O61A 3FXRA 3U1DA 4HX4A 1R1TA 3L09A 3S2WA 1P4AA 2DPUA 5FO5A 3WTZA 3RIRA 3I59B 1MD0A 2V6CA 3N4MA 2NS0A 1TQPA 2QQBA 1USSA 4RB0A 4I2OA 1TNTA 1E17A 3KEOA 5K5OA 4MGRA 4HLYA 5LHGA 1H9TA 1W7PD 2FRHA 5D8LB 2NNYA 2COMA 1UHMA 2M87A 4HQEA 1B59A 2R3SA 3F6VA 1UCRA 1IN8A 1S7OA 3IWZA 2QBYA 3QP6A 3DXJF 4WXDA 3RKWA 3EETA 2L3DA 2DQLA 1OYWA 3HUGA 3WTTC 2A5YB 2QENA 2QZ8A 3TDUC 4AIHA 1BI0A 1HKSA 1JE8A 3K69A 1REPC 4CHUA 4G6DA 4FT8A 1G3YA 3KP3A 5L3DA 1BN5A 2FQ3A 2OQRA 1T98A 3LQQA 3FMRA 4IRHA 3V7RA 3FWEA 4M9XA 4L0ZB 5DEQA 4L18B 1G3WA 1KQ0A 3REOA 3V7CA 5A2QZ 5KVRA 4ZYGA 1U6GA 4QLCU 4EM0B 2VBXA 2HFHA 1B6AA 3CO6C 3MCZA 3T1BA 4HDVA 3GFJA 3IKTA 2XHKA 4M9SA 2Y48A 1BJAA 4JBAA 3RKXA 5F64A 4ZYHA 5L3EA 5D4SA 1LNWA 3GO5A 4ESJA 1TQMA 1UB9A 2F5EA 5LBQA 3GEZA 5CVVA 5LGNA 3F72A 5ILVA 4LJZF 4AIJA 2DAOA 1J59A 4MEYF 2YSRA 1D3YA 4EJTA 1XGOA 1F9NA 3PFIA 3ZQ7A 4I98B 1P92A 2DK5A 4O3MA 3CUQA 2MLGA 3RTRA 1OR7A 2QM3A 2HKXA 3HRUA 2RDPA 1YIOA 4I7HA 1IW7F 1FT9A 1RZ4A 3ISPA 3R61A 2DW4A 4HQMA 5E8GA 1Q1HA 1WQ2A 4ZYEA 3LA7A 1U5TA 4I0BA 1XCBA 2KIFA 4LK1F 1W7PA 2GQQA 3WTSC 1R22A 4A2UA 1D8JA 4LLLA 4WX9A 4P9FA 2XGXA 5D5XB 3F8FA 4HYEA 4U0VA 3BDDA 1BC7C 2NYXA 4O6JA 1KQ8A 5CLSA 2VC0A 3RYPA 3GVAA 4ENMA 4M71A 4AIKA 5AIPA 4XRFA 2OBPA 2LKPA 3E6MA 3R60A 1J2XA 4HOBA 2JRTA 1MZBA 2RGVA 2CG4A 1K78A 1FBSA 5H6RA 4BYYA 3L7WA 5D5VB 3DQVC 3WU1B 4QWQA 5DCMB 1O3TA 5FFZA 4CICA 3ML6A 4KMUX 3F8MA 4EJWA 4A5NA 4ESFA 1S7AA 1Z1DA 1OMIA 1P4WA 3WTYC 2K86A 4UVCA 4OIQF 4UXNA 2HQNA 2Q8KA 5K5QA 4Q47A 1KU9A 4HV6A 1VTNC 1XD7A 1I5ZA 2VBZA 1U78A 5FGMA 4HBLA 1G3SA 2XIGA 3KEQA 1FP2A 1ZH5A 1TLHB 1WSUA 3RI4A 2V1UA 3E6DA 1HW1A 5FLXK 4M74A 2UWMA 5BS6A 4ETSA 3WTUC 4O5VA 4S05A 1QGPA 3KP7A 2CWEA 2VT2A 4ZH4F 1OYIA 4LLNA 3TOAA 4K2EA 1I1GA 4ENKA 3O3KA 5LHIA 3GZ5A 1YS7A 3L00A 3I54A 2VBYA 1R5HA 2LF7A 1FC3A 5KK1A 3TO6A 4LD5A 3DFGA 1FPQA 3ZMVA 3B73A 4NB5A 1KYWA 4UV8A 1FOKA 5TRDA 5E20A 1IN5A 4IJAA 1Z6TA 2CSOA 3IL2A 4EM1A 2HZTA 3RJPA 3BROA 2OU2A 2STWA 1G4DA 1W5TA 2OZUA 5J8FA 2EV0A 2PEXA 3T5XA 4BHBA 1KU2A 3ZPLA 5LGTA 4HF0A 2EA2A 1OPCA 5JVTA 1FYLA 3WE2A 2IA2A 1E2XA 1R5GA 1IF1A 2GXGA 2DFIA 1LDDA 2G9WA 1SFUA 1QBJA 2HS5A 2YU3A 2STTA 5HDNA 5E17F 4PCQA 1I1SA 3J81Z 1BIAA 2RKHA 3OV8A 1G6NA 1JXSA 1NHAA 3N97A 2QUFA 2Y0MA 5DD4A 3SHFA 1XDUA 3T8TA 1U8RA 3FF5A 2V79A 5EEGA 2EB7A 2PQ8A 1RI7A 2XROA 3HSFA 1Z9CA 1ZG3A 2UXNA 5ERIA 2VE8A 2HGCA 3QRFF 5L3FA 3DF8A 2ESNA 2BE5F 3ERED 2FSWA 4FHTA 4BXUA 1ZHFA 3C1DA 4A5MA 1HKTA 2FBKA 4ZZDA 2W84A 4RAZA 2F5DA 4IRGA 5DV5A 3HRMA 4WXHA 4CXFA 1ULYA 2DPDA 3QPTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1DP7 P;  1R36 A;  2IRF G;  1T39 A;  1AWC A;  3BOQ A;  3K1N A;  4MQ9 F;  4LK0 F;  3ZP5 A;  4OMY A;  2XV4 S;  3QOP A;  3I5U A;  4L0Y B;  3HIF A;  3WTX C;  3P7N A;  4UVA A;  4RB3 C;  3FXU A;  1KGS A;  2M45 A;  1ZRF A;  1S29 A;  2Z99 A;  3ZMU A;  1AOY A;  3GLX A;  2VE9 A;  2KKO A;  2JT1 A;  2MC3 A;  3HYI A;  1ZYR F;  4HF2 A;  3TQN A;  2DTR A;  5CVR A;  1F4K A;  5H6Q A;  3Q5F A;  2D1H A;  4TV7 A;  2FBI A;  5F6F A;  3E5Q A;  2KIU A;  5DD8 A;  3R0A A;  4G8X A;  3SQN A;  1QNT A;  2L02 A;  4LB6 B;  3IHU A;  2NRA C;  1MGT A;  3R0J A;  5ICC A;  1HST A;  3B02 A;  2NNN A;  1JGS A;  1EH8 A;  4MNU A;  1GVJ A;  3LA3 A;  3E6C C;  4ZYD A;  2K4J A;  1YW8 A;  4EQQ A;  2E7W A;  2HTJ A;  2DI3 A;  4YFK F;  3MQ0 A;  1XGM A;  2X4H A;  5DCF A;  1MDM A;  1XGS A;  1W5S A;  2QQA A;  3T8R A;  4HA8 A;  4UVB A;  4M72 A;  4A0X A;  3FM3 A;  1WKM A;  4KUM A;  3H92 A;  2ACJ A;  1HQC A;  1UFM A;  1BOA A;  1Z7U A;  3KP2 A;  3M8E A;  2GA1 A;  2IPQ X;  4EMS A;  1D8K A;  3BPX A;  2B0L A;  5ICG A;  2EA4 A;  1JHH A;  3M8F A;  1PUE E;  1Z6R A;  3NEU A;  4L9N A;  3GFI A;  1T0F A;  2PJP A;  2A3S A;  3WU0 A;  4ZZL A;  2MLK A;  5JFR A;  2GIV A;  4MTE A;  5E18 F;  1LVA A;  2Z3Y A;  4RB2 C;  2ESH A;  3F21 A;  3JW4 A;  2P8T A;  2O0Y A;  4L9J A;  3CJN A;  2H6B A;  4GO1 A;  3JTG A;  2XUB A;  2K4B A;  2F5F A;  1XCV A;  4KYW A;  3I0T A;  2FE3 A;  4N9I A;  3GYH X;  2VC1 A;  3I58 A;  2P5L C;  3ZN0 A;  2JZY A;  5AIQ A;  2IJL A;  2WV0 A;  4P5O A;  1KA8 A;  3IWF A;  3F8N A;  4U7B A;  2W85 A;  4HAM A;  3TGN A;  3HHH A;  3LAP A;  2H6C A;  4YIF A;  3I71 A;  3DV8 A;  2EFQ A;  3I59 A;  4KFC A;  3WGG A;  1IAW A;  1GXP A;  2R7D A;  3ABU A;  3V8K A;  2BV6 A;  1U5T C;  2D2W A;  4Y13 A;  4XSZ F;  2MH2 A;  4WCG A;  1R1V A;  1CF7 B;  1K79 A;  3GX4 X;  4R8H A;  1IXR C;  4EJO A;  1ZG1 A;  5LEJ A;  1GXQ A;  3IRQ A;  5A2Q K;  1TW2 A;  1R23 A;  3FXQ A;  1HKQ A;  2D45 A;  3CUQ C;  2L54 A;  1FSH A;  3ZMS A;  2AS5 F;  4L5I A;  3J80 K;  4BHP A;  2IP2 A;  2FOK A;  3HRS A;  2HYF A;  2PLY A;  2K7L A;  1XSX A;  1WWX A;  1OYY A;  1MKM A;  2EFO A;  2A68 F;  3QU6 A;  3SXY A;  1GHC A;  2ISZ A;  1L0O C;  1IUY A;  4OIP F;  2PMU A;  1RIO H;  3VOE A;  1R7J A;  2P7V B;  3G73 A;  4JQF A;  2MH9 A;  1MJA A;  3VOD A;  4G7Z F;  4WWC A;  1S3J A;  4L9V A;  2RVC A;  1W7P B;  3RDI A;  3QAH A;  1WRJ A;  5D6F A;  3F8B A;  2VXZ A;  3LQR A;  5LRS A;  3C3W A;  1XMA A;  2HWV A;  5HOO A;  3NRV A;  2PMH A;  3L9F A;  5HLG A;  2HDC A;  2W24 A;  2MBF A;  4EJU A;  3BJ6 A;  5FFX A;  3F22 A;  1BM9 A;  1ZGJ A;  2ZME B;  5LGU A;  1FBQ A;  1YLF A;  2HR3 A;  2Y75 A;  3WGH A;  1YW9 A;  5FLX Z;  3KP5 A;  2ZO4 A;  3WTV C;  3WTW C;  2ZNZ A;  2L01 A;  1FWZ A;  2RN7 A;  3KP4 A;  2ZFW A;  4KA4 A;  4HDU A;  2PFB A;  5HS8 A;  2O8X A;  4G6Q A;  5J6X A;  5K5R A;  4OIO F;  1SFE A;  2Z33 A;  4AVP A;  1QO0 D;  2LNB A;  4LGW A;  4M6X A;  2GA2 A;  4IVN A;  4U88 A;  5BPI A;  1T38 A;  2FXA A;  5H20 A;  2Z5U A;  5D6E A;  1O3Q A;  4LLG F;  5ICF A;  1J5Y A;  3P9C A;  1S6L A;  2V9V A;  4IF4 A;  1S8N A;  1O7F A;  1BI1 A;  4H0E A;  1YG2 A;  2Z9O A;  2W57 A;  2A07 F;  1I6X A;  4D0P A;  1FYM A;  2ZXJ A;  3ELK A;  3V4G A;  2CO5 A;  1L3L A;  3TDZ C;  3MEX A;  3BWG A;  1QZY A;  4M6Y A;  1ZRC A;  2Q0O A;  2R7F A;  4A6E A;  5FB2 A;  1ZRD A;  2BEO A;  1RUN A;  2X0L A;  3IC7 A;  2E7X A;  1SD6 A;  3F6O A;  2IW5 A;  4IXA A;  1XGN A;  3K1M A;  5L3B A;  1IZ1 A;  4ON0 A;  3J7A O;  2O03 A;  2W25 A;  1Z05 A;  5D8K B;  3P9I A;  5FD5 A;  2OQG A;  2P5V A;  2ETH A;  1FBU A;  1FX7 A;  3HOT A;  2KJB A;  2K02 A;  2OA4 A;  3PQJ A;  3D5L A;  2CGP A;  2OD5 A;  1DDN A;  4RGX A;  4N9H A;  1FYK A;  4WF2 A;  5HS7 A;  2WWY A;  2XAS A;  1YQA A;  5L3C A;  3I4P A;  3SZT A;  2ZJ2 A;  2M1B A;  2VOD A;  2A69 F;  4EJV A;  2VT3 A;  4OIN F;  3ZMZ A;  2GZW A;  2A61 A;  2K27 A;  1SMT A;  2KRF A;  2WTE A;  1IN4 A;  1DPU A;  3ROU A;  5JR3 A;  4KIG A;  3E5X A;  3OOP A;  4WXC A;  4YII A;  5E8I A;  4L9T A;  5HDK A;  4UNO A;  3WG9 A;  4P55 A;  1EV7 A;  2J5O A;  4EV0 A;  3GFM A;  3KCC A;  4G9Y A;  2LF8 A;  4CYD A;  2FNP A;  4EGZ A;  3M7G A;  1T6S A;  3CUQ B;  1FZP B;  5IT9 Z;  5ILU A;  1O3R A;  1XSD A;  3T0Y A;  5D4R A;  3EUH A;  4LG0 B;  2L4M A;  4M9Z A;  1TNS A;  2ADU A;  1ZLJ A;  4I01 A;  3I64 A;  2DLL A;  1SD7 A;  5TJJ A;  3R4K A;  4BQA A;  3GF2 A;  4RAY A;  3GW2 A;  2HQR A;  4CGZ A;  3VEP A;  1O57 A;  5FD6 A;  3FMQ A;  1HW5 A;  3KLN A;  1IRG A;  3ECO A;  1BBY A;  4NHJ A;  3ZMT A;  4I0A A;  1HBX G;  2P5K A;  3E3V A;  4PDK A;  4DNC A;  4FX4 A;  1ZN2 A;  2O6G E;  2CFX A;  5F1R A;  3HHG A;  5D5U B;  4KIC A;  2H27 A;  2VBW A;  4NQW A;  3CDH A;  4MHG A;  2RC4 A;  4F7Z A;  3KE2 A;  3MZY A;  1K6O A;  2XAG A;  4G7O F;  1D5V A;  1DPR A;  2G7U A;  2JPC A;  3IRR A;  4PZJ A;  4XSX F;  2EV5 A;  2A6H F;  1LQ1 A;  1LDJ A;  4B09 A;  1OKR A;  2FF4 A;  4S04 A;  4ENJ A;  1ON1 A;  2EFW A;  1KU7 A;  1IN6 A;  3KP6 A;  2XKO A;  4Q4Z F;  1B1B A;  5E1Z B;  2XAQ A;  4I09 A;  3HRT A;  1CGP A;  2P6S A;  1IN7 A;  4LFU A;  4CZZ A;  3BJA A;  6PAX A;  1J0R A;  3WOD F;  5CYV A;  3TKY A;  4GYI A;  3MZH A;  5HDG A;  1DUX C;  1KYZ A;  5CVJ A;  3H3U A;  3FM5 A;  2CQK A;  1LJ9 A;  4Y15 A;  5E1X A;  5CVU A;  3DPT A;  1XMK A;  2VON A;  3W6K B;  4B8X A;  3CTA A;  5IT3 A;  2UXX A;  4BHC A;  4IPA A;  1FY7 A;  5LEK A;  2G7H A;  3GZ6 A;  4HLX A;  3BZ6 A;  1F5T A;  3P9K A;  3Q9S A;  4AWX B;  3NQO A;  1MDM B;  1V4R A;  4UV9 A;  2ELH A;  3LWF A;  1HXD A;  5BPD A;  1TQI A;  4RB1 A;  2RQP A;  1XDS A;  2M5W A;  3TO7 A;  3DP7 A;  1SFX A;  1UHW A;  1ZLK A;  1SD5 A;  4XLN F;  3JSO A;  1SMY F;  2RV8 A;  2F2E A;  3HTU A;  2PI0 A;  1ZAO A;  4OMZ A;  4LG0 A;  4EM2 A;  3R6S A;  5DDG A;  4HZF A;  2DQR A;  2FML A;  3ECH A;  4GYG A;  4UHT A;  4G7H F;  1B9N A;  3JSP A;  1ONV A;  1ZAR A;  2AXL A;  4P96 A;  1LEB A;  2QVO A;  3BJO A;  1MJB A;  5D5W B;  2GAU A;  3V8L A;  1P6R A;  3VB2 A;  1YO5 C;  5ILS A;  4Z2Y A;  3MAJ A;  2M8E A;  3CLO A;  1U3E M;  3ZN1 A;  3KZY A;  5K1Y A;  3PQK A;  2OAZ A;  2XAH A;  2TDX A;  2DT5 A;  3GUD A;  1F1Z A;  4N0B A;  1V3F A;  3TO9 A;  4OU0 A;  1KQ9 A;  2FA5 A;  2YX4 A;  2JTV A;  4RS8 A;  4HX8 A;  4P9U A;  3TOB A;  1FLI A;  4ENN A;  2WC2 A;  2V1X A;  3V7S A;  1YFH A;  3BY6 A;  1YYV A;  1XB4 A;  4UUV A;  4ASN A;  5CVI A;  3FMS A;  4XLP F;  3F3X A;  2EK5 A;  2EFP A;  4Q5S F;  2XAJ A;  4ESB A;  5HVQ C;  2E1C A;  2GXB A;  2MA3 A;  5J8C A;  2EV6 A;  2HEO A;  1KU3 A;  2NAZ A;  4GXO A;  1Y0U A;  1ON2 A;  3U9G A;  3ZMD A;  1EH6 A;  2DO7 A;  3K0L A;  3JTH A;  2CW0 F;  4MTD A;  3J81 K;  3RPQ A;  3F23 A;  4PGG A;  4KN7 X;  5DYM A;  1H0M A;  3WE3 A;  5LLQ A;  2HTS A;  1O7L A;  4KN4 X;  1SAX A;  1XSV A;  4HW0 A;  5ICE A;  4MEX F;  4A0Z A;  3O2P E;  2P4W A;  4OIR F;  3J80 Z;  1O3S A;  2DK8 A;  4R1H A;  5E1W A;  5BMZ A;  2XVC A;  4LB5 A;  4Y17 A;  1STZ A;  1QQI A;  1T2K A;  2FNA A;  2JSC A;  1IXS B;  4LMY A;  4BNC A;  1XN7 A;  1YS6 A;  4OOI A;  1HW2 A;  3V8J A;  1J7K A;  1W4M A;  4R79 A;  5HLH A;  5HS9 A;  2Q2E A;  3K2Z A;  4HV5 A;  1FNN A;  1R1U A;  1RUO A;  2H09 A;  5BOX A;  1U5T B;  3KLO A;  1UST A;  2J5P A;  3C18 A;  2FU4 A;  4GCV A;  1H9G A;  1MJ9 A;  2IVM A;  3QU3 A;  1ZG5 A;  2L4A A;  3E6B A;  2YX7 A;  4HF1 A;  4AD9 A;  3M9A A;  3LAJ A;  2HOE A;  3W6J B;  1CF7 A;  2FMY A;  4U0W A;  2PG4 A;  3SFZ A;  1U2W A;  3BPV A;  3EYI A;  3EYY A;  5AON A;  4PGH A;  2C6Y A;  2QYO A;  3QP5 A;  2ZNY A;  4U0Y A;  1RNL A;  4I02 A;  3CO7 C;  3LA2 A;  3K9T A;  1LEA A;  2EWN A;  4L5J A;  1SD4 A;  4CDG A;  5BQT A;  4M73 A;  2QWW A;  3GXO A;  2LSO A;  1P4X A;  4KIB A;  1J75 A;  4A6D A;  5ED4 A;  4KMF A;  1IRF A;  3HOS A;  2VOO A;  3FHZ A;  4EVI A;  1QPM A;  3MFK A;  1TBX A;  1ZGA A;  4MQV A;  2DU9 A;  1A04 A;  2E1N A;  5EEH A;  5HLI A;  4CO8 A;  2PN6 A;  2M30 A;  5DUK A;  3IKV A;  2YR2 A;  1BIB A;  2XKP A;  2VN2 A;  3COA C;  1X3U A;  4RGU A;  4RGR A;  4FX0 A;  2EFN A;  1R00 A;  3RKY A;  5JHU A;  5DCM A;  1B4A A;  3HSR A;  2HKO A;  2KJC A;  1TTY A;  3U2R A;  1K78 B;  4HX7 A;  1BI3 A;  4JK1 X;  1ZRE A;  1K7A A;  4RGS A;  4BAY A;  1I27 A;  3EQL F;  1FP1 D;  2XRN A;  3GFL A;  1IXC A;  2CYY A;  2ZCW A;  3M1E A;  3BP8 A;  4A12 A;  2FBH A;  2QQ9 A;  3ABT A;  4YFX F;  1C0W A;  1LB2 A;  4XBF A;  1Z91 A;  3DKW A;  2IA0 A;  4GGG A;  2BGC A;  5LHH A;  3E97 A;  2PBI A;  4A0Y A;  1J9I A;  2QBY B;  3FZV A;  4WK8 F;  1EH7 A;  2FEZ A;  1FSE A;  3VFZ A;  4IHT A;  3K1P A;  2EJR A;  3AAF A;  2ZME A;  3SZP A;  2ISY A;  3WGI A;  3GWZ A;  3DEU A;  1LDK B;  2YPR A;  3QPH A;  2HYG D;  2P7C B;  1YW7 A;  2GWR A;  3E5U A;  3EDP A;  2BYV E;  1R58 A;  2LDU A;  1YTY A;  2A6E F;  3HSE A;  2ZBK A;  3KFW X;  5LRR A;  3O6B B;  1HSJ A;  1BC8 C;  2QLZ A;  4KDP A;  3I53 A;  2P6T A;  3CUO A;  4KIF A;  3KZZ A;  2O3F A;  3F8C A;  3FX3 A;  4U7D A;  1WI9 A;  4KNY A;  3D0S A;  2ZKZ A;  2IT0 A;  2RNJ A;  1PDN C;  2XAF A;  3MWM A;  5L3G A;  2KIM A;  1P2F A;  2D1V A;  2JPB A;  3HTS B;  2OZ6 A;  3DPL C;  5JI6 A;  3RPU A;  3KET A;  1BI2 A;  3JAM Z;  4KT5 C;  5IT9 K;  3LFK A;  3C7J A;  3RYR A;  2H94 A;  2BBY A;  2MD5 A;  3LST A;  4BH9 A;  3JAM K;  3ULQ B;  1B9M A;  1TW3 A;  2V1D A;  2F5C A;  1JHF A;  2IA1 A;  4YFN F;  4G94 A;  4YG2 F;  3L2C A;  1PP7 U;  4IRI A;  1PP8 F;  1ODD A;  5CJ9 A;  4E70 A;  2VOP A;  3Q9V A;  4EGY A;  2DBB A;  4DQ2 A;  4IHS A;  1G3T A;  1QZZ A;  3H3Z A;  5DUI A;  2UZK A;  3G3Z A;  4Q48 A;  2O61 A;  3FXR A;  3U1D A;  4HX4 A;  1R1T A;  3L09 A;  3S2W A;  1P4A A;  2DPU A;  5FO5 A;  3WTZ A;  3RIR A;  3I59 B;  1MD0 A;  2V6C A;  3N4M A;  2NS0 A;  1TQP A;  2QQB A;  1USS A;  4RB0 A;  4I2O A;  1TNT A;  1E17 A;  3KEO A;  5K5O A;  4MGR A;  4HLY A;  5LHG A;  1H9T A;  1W7P D;  2FRH A;  5D8L B;  2NNY A;  2COM A;  1UHM A;  2M87 A;  4HQE A;  1B59 A;  2R3S A;  3F6V A;  1UCR A;  1IN8 A;  1S7O A;  3IWZ A;  2QBY A;  3QP6 A;  3DXJ F;  4WXD A;  3RKW A;  3EET A;  2L3D A;  2DQL A;  1OYW A;  3HUG A;  3WTT C;  2A5Y B;  2QEN A;  2QZ8 A;  3TDU C;  4AIH A;  1BI0 A;  1HKS A;  1JE8 A;  3K69 A;  1REP C;  4CHU A;  4G6D A;  4FT8 A;  1G3Y A;  3KP3 A;  5L3D A;  1BN5 A;  2FQ3 A;  2OQR A;  1T98 A;  3LQQ A;  3FMR A;  4IRH A;  3V7R A;  3FWE A;  4M9X A;  4L0Z B;  5DEQ A;  4L18 B;  1G3W A;  1KQ0 A;  3REO A;  3V7C A;  5A2Q Z;  5KVR A;  4ZYG A;  1U6G A;  4QLC U;  4EM0 B;  2VBX A;  2HFH A;  1B6A A;  3CO6 C;  3MCZ A;  3T1B A;  4HDV A;  3GFJ A;  3IKT A;  2XHK A;  4M9S A;  2Y48 A;  1BJA A;  4JBA A;  3RKX A;  5F64 A;  4ZYH A;  5L3E A;  5D4S A;  1LNW A;  3GO5 A;  4ESJ A;  1TQM A;  1UB9 A;  2F5E A;  5LBQ A;  3GEZ A;  5CVV A;  5LGN A;  3F72 A;  5ILV A;  4LJZ F;  4AIJ A;  2DAO A;  1J59 A;  4MEY F;  2YSR A;  1D3Y A;  4EJT A;  1XGO A;  1F9N A;  3PFI A;  3ZQ7 A;  4I98 B;  1P92 A;  2DK5 A;  4O3M A;  3CUQ A;  2MLG A;  3RTR A;  1OR7 A;  2QM3 A;  2HKX A;  3HRU A;  2RDP A;  1YIO A;  4I7H A;  1IW7 F;  1FT9 A;  1RZ4 A;  3ISP A;  3R61 A;  2DW4 A;  4HQM A;  5E8G A;  1Q1H A;  1WQ2 A;  4ZYE A;  3LA7 A;  1U5T A;  4I0B A;  1XCB A;  2KIF A;  4LK1 F;  1W7P A;  2GQQ A;  3WTS C;  1R22 A;  4A2U A;  1D8J A;  4LLL A;  4WX9 A;  4P9F A;  2XGX A;  5D5X B;  3F8F A;  4HYE A;  4U0V A;  3BDD A;  1BC7 C;  2NYX A;  4O6J A;  1KQ8 A;  5CLS A;  2VC0 A;  3RYP A;  3GVA A;  4ENM A;  4M71 A;  4AIK A;  5AIP A;  4XRF A;  2OBP A;  2LKP A;  3E6M A;  3R60 A;  1J2X A;  4HOB A;  2JRT A;  1MZB A;  2RGV A;  2CG4 A;  1K78 A;  1FBS A;  5H6R A;  4BYY A;  3L7W A;  5D5V B;  3DQV C;  3WU1 B;  4QWQ A;  5DCM B;  1O3T A;  5FFZ A;  4CIC A;  3ML6 A;  4KMU X;  3F8M A;  4EJW A;  4A5N A;  4ESF A;  1S7A A;  1Z1D A;  1OMI A;  1P4W A;  3WTY C;  2K86 A;  4UVC A;  4OIQ F;  4UXN A;  2HQN A;  2Q8K A;  5K5Q A;  4Q47 A;  1KU9 A;  4HV6 A;  1VTN C;  1XD7 A;  1I5Z A;  2VBZ A;  1U78 A;  5FGM A;  4HBL A;  1G3S A;  2XIG A;  3KEQ A;  1FP2 A;  1ZH5 A;  1TLH B;  1WSU A;  3RI4 A;  2V1U A;  3E6D A;  1HW1 A;  5FLX K;  4M74 A;  2UWM A;  5BS6 A;  4ETS A;  3WTU C;  4O5V A;  4S05 A;  1QGP A;  3KP7 A;  2CWE A;  2VT2 A;  4ZH4 F;  1OYI A;  4LLN A;  3TOA A;  4K2E A;  1I1G A;  4ENK A;  3O3K A;  5LHI A;  3GZ5 A;  1YS7 A;  3L00 A;  3I54 A;  2VBY A;  1R5H A;  2LF7 A;  1FC3 A;  5KK1 A;  3TO6 A;  4LD5 A;  3DFG A;  1FPQ A;  3ZMV A;  3B73 A;  4NB5 A;  1KYW A;  4UV8 A;  1FOK A;  5TRD A;  5E20 A;  1IN5 A;  4IJA A;  1Z6T A;  2CSO A;  3IL2 A;  4EM1 A;  2HZT A;  3RJP A;  3BRO A;  2OU2 A;  2STW A;  1G4D A;  1W5T A;  2OZU A;  5J8F A;  2EV0 A;  2PEX A;  3T5X A;  4BHB A;  1KU2 A;  3ZPL A;  5LGT A;  4HF0 A;  2EA2 A;  1OPC A;  5JVT A;  1FYL A;  3WE2 A;  2IA2 A;  1E2X A;  1R5G A;  1IF1 A;  2GXG A;  2DFI A;  1LDD A;  2G9W A;  1SFU A;  1QBJ A;  2HS5 A;  2YU3 A;  2STT A;  5HDN A;  5E17 F;  4PCQ A;  1I1S A;  3J81 Z;  1BIA A;  2RKH A;  3OV8 A;  1G6N A;  1JXS A;  1NHA A;  3N97 A;  2QUF A;  2Y0M A;  5DD4 A;  3SHF A;  1XDU A;  3T8T A;  1U8R A;  3FF5 A;  2V79 A;  5EEG A;  2EB7 A;  2PQ8 A;  1RI7 A;  2XRO A;  3HSF A;  1Z9C A;  1ZG3 A;  2UXN A;  5ERI A;  2VE8 A;  2HGC A;  3QRF F;  5L3F A;  3DF8 A;  2ESN A;  2BE5 F;  3ERE D;  2FSW A;  4FHT A;  4BXU A;  1ZHF A;  3C1D A;  4A5M A;  1HKT A;  2FBK A;  4ZZD A;  2W84 A;  4RAZ A;  2F5D A;  4IRG A;  5DV5 A;  3HRM A;  4WXH A;  4CXF A;  1ULY A;  2DPD A;  3QPT A; 
#chains in the Genus database with same CATH topology
 1VF9 A;  3SDB A;  3J7Y J;  2LC2 A;  1DP7 P;  1R36 A;  4U87 A;  4XKB A;  4PK4 A;  2IRF G;  1T39 A;  1AWC A;  3BOQ A;  3K1N A;  3M1C A;  4MQ9 F;  4LK0 F;  5DTD A;  1WJE A;  5EZH A;  3ZP5 A;  4OMY A;  2XV4 S;  2BXZ A;  2L7F P;  3QOP A;  3CCS I;  3I5U A;  2KIS A;  4L0Y B;  3HIF A;  3FBI B;  3WTX C;  1OCO H;  3IH2 A;  3P7N A;  1WJD A;  4UVA A;  4RB3 C;  2VQL A;  3FXU A;  1W36 C;  1IGN A;  1KGS A;  1BR2 A;  2M45 A;  4ZDP A;  1ZRF A;  4JYK A;  1ENH A;  3PUB A;  2DA2 A;  3OS0 A;  1S29 A;  3CCQ I;  2PMZ A;  2CJJ A;  4DOZ A;  2Z99 A;  5M3M J;  5J1R A;  3ZMU A;  2E5N A;  1NG6 A;  1AOY A;  3GLX A;  4C30 A;  2VE9 A;  2KKO A;  2JT1 A;  2DTZ A;  2MC3 A;  1PUF A;  1OCZ H;  3HYI A;  1Z0X A;  1ZYR F;  1FOY A;  4HF2 A;  2WAF A;  4DBQ A;  3TQN A;  3I55 I;  2DTR A;  5CVR A;  1F4K A;  2COB A;  5H6Q A;  3Q5F A;  2PX9 A;  2D1H A;  4KIS A;  2A05 A;  1JKP C;  3BC8 A;  2Y69 H;  4TV7 A;  2FBI A;  4BJT A;  5F6F A;  3GTP J;  3C2B A;  1T8I A;  2IBD A;  3E5Q A;  2KIU A;  3TW7 A;  4J01 A;  3K4K A;  5DD8 A;  3R0A A;  3HOX J;  4G8X A;  3B6A A;  4BQO A;  3SQN A;  1YE9 A;  1QNT A;  2L02 A;  4LB6 B;  2B7E A;  3WHB A;  3IHU A;  2LY2 A;  2NRA C;  1MGT A;  1VI0 A;  3R0J A;  3H36 A;  4D5F A;  5ICC A;  1OCP A;  1WJ5 A;  3OIP A;  2HVR A;  1HST A;  4A3F J;  3B02 A;  2NNN A;  1JGS A;  1JKQ C;  1EH8 A;  1RPW A;  4IX7 A;  2IS2 A;  2HVS A;  4MNU A;  2R7R A;  5CPR B;  1GVJ A;  2AXT C;  3LA3 A;  1LFB A;  5IYC J;  3E6C C;  2IS1 A;  1BW6 A;  4PJL A;  4B4C A;  2K4J A;  4ZYD A;  1YW8 A;  4EQQ A;  3HC7 A;  2E7W A;  2JRM A;  2HTJ A;  1UAA A;  2HDD A;  2DI3 A;  4YFK F;  2V26 A;  3MQ0 A;  1XGM A;  2JA5 J;  2X4H A;  5DCF A;  1MDM A;  3OIQ A;  1XGS A;  2CS3 A;  1W5S A;  3HOW J;  3TP0 A;  2QQA A;  3OYK A;  3T8R A;  4HA8 A;  1Z67 A;  1W5C C;  4UVB A;  3FKI J;  2ZB9 A;  2KP6 A;  4M72 A;  4A0X A;  3FM3 A;  1WKM A;  2Z1D A;  3H92 A;  4KUM A;  3M3Y J;  4BJ5 C;  4F93 B;  5FKL A;  1ZTR A;  2ACJ A;  1AKH B;  1HQC A;  1V5G A;  1N78 A;  1UFM A;  1BOA A;  1Z7U A;  3KP2 A;  4ABZ A;  3OYG A;  3M8E A;  4G6T B;  3ZQI A;  2GA1 A;  2IPQ X;  4EMS A;  1D8K A;  3BPX A;  5IYB J;  2B0L A;  5ICG A;  1I3Q J;  3VYR B;  1K6Y A;  5M5X J;  4NC6 A;  2EA4 A;  2DDB A;  5FKK A;  2VJI A;  4N4N B;  2F4M B;  1JHH A;  3M8F A;  4YIR X;  1PUE E;  2MC4 A;  4AUX A;  1Z6R A;  1TWF J;  3NEU A;  4L9N A;  3GFI A;  1JUS A;  1T0F A;  2PJP A;  2A3S A;  3WU0 A;  4ZZL A;  2MLK A;  3K7A J;  5JFR A;  2GIV A;  1X1A A;  4MTE A;  2MYS A;  5E18 F;  3LNQ A;  1LVA A;  2Z3Y A;  2JA6 J;  5GAH J;  4RB2 C;  2ESH A;  2ELK A;  3FXL A;  1QU3 A;  3Q0W A;  3F21 A;  3JW4 A;  2X6O A;  1UZC A;  2W00 A;  2P8T A;  3FDY A;  2E2H J;  2O0Y A;  1BJZ A;  4L9J A;  3CJN A;  2H6B A;  2V9P A;  4JX6 A;  4GO1 A;  3JTG A;  1MBH A;  2XUB A;  4GRI A;  3S1R J;  2K4B A;  2F5F A;  1N25 A;  2VJ4 A;  1RET A;  1JJ8 C;  2X6Y A;  1QA6 A;  1XCV A;  3I0T A;  4KYW A;  4Y33 A;  1XC5 A;  2FE3 A;  4N9I A;  3G1O A;  3PSF A;  1FIA A;  3GYH X;  2VC1 A;  2ZXI A;  1B72 A;  2MAB A;  4MIM A;  1A6I A;  3EUK L;  3I58 A;  3S3O A;  1OCR H;  2MD0 A;  1AU7 A;  2P5L C;  1KZH A;  3ZN0 A;  3DPU A;  2JZY A;  1X4O A;  2PMZ N;  2R7U A;  2VQC A;  2JMW A;  5AIQ A;  2IJL A;  2LRD A;  3CMM A;  2WV0 A;  4P5O A;  2I10 A;  4A3J J;  1KA8 A;  2LD5 A;  2KMU A;  3IWF A;  3F8N A;  4U7B A;  2W85 A;  4HAM A;  4BQQ A;  1D0Z A;  2ZXW H;  4IQJ A;  3O8G A;  4ZC3 A;  2R7Q A;  3TGN A;  3HHH A;  3LAP A;  2JJ7 A;  2H6C A;  4YIF A;  3EPZ A;  3I71 A;  4DW6 A;  4BJ6 C;  4F92 B;  3DV8 A;  2EFQ A;  3I59 A;  4KFC A;  4X6A J;  3WGG A;  4J00 A;  1S72 I;  2GOX B;  1GXP A;  1IAW A;  3AG4 H;  1NTC A;  2R7D A;  3ABU A;  3V8K A;  2BV6 A;  1UJ8 A;  2A6T A;  5F04 A;  2BY2 A;  1R9T J;  1U5T C;  5GTI C;  2D2W A;  4Y13 A;  4XSZ F;  2MH2 A;  4WCG A;  1R1V A;  1CF7 B;  1K79 A;  4FIS A;  5J3L A;  5HNF A;  3GX4 X;  3QYE A;  1IXR C;  4R8H A;  5EGO B;  2XGD A;  4EJO A;  1ZG1 A;  3RSN A;  4MFE A;  5LEJ A;  1GXQ A;  2M34 A;  3IRQ A;  5TIS C;  4FE7 A;  1TW2 A;  2L7K A;  3K4J A;  5A2Q K;  5C3E J;  1OR7 C;  1R23 A;  3D5R C;  3FXQ A;  3OS1 A;  3S15 J;  1VQP I;  3K4B A;  1HKQ A;  2D45 A;  2JUG A;  3CCV I;  3CUQ C;  2L54 A;  4XRM A;  3ZMS A;  3CMA I;  2AS5 F;  1FSH A;  2JN6 A;  4L5I A;  3D5S C;  3Q3S A;  4AC0 A;  3J80 K;  4BHP A;  2IP2 A;  2FOK A;  3HRS A;  2CQN A;  1F43 A;  1SFK A;  1Z7L A;  2HYF A;  3NAU A;  2PLY A;  2CV2 A;  2KLO A;  4PSW A;  1TL8 A;  2V6E A;  4FE4 A;  3SZG A;  2K7L A;  1XSX A;  4II3 A;  1TWC J;  1MMS A;  1WWX A;  1OYY A;  3IH3 A;  3JCU C;  5FLV A;  2XGE A;  5KHD A;  1MKM A;  2F4I A;  2EFO A;  2A68 F;  4BUP A;  1YX5 A;  3QU6 A;  1SVL A;  3SXY A;  1GHC A;  2ISZ A;  2XSD C;  3H5A A;  1L0O C;  2Q1Z B;  3KYC B;  1IUY A;  3S8P A;  2XPV A;  3CC2 I;  2R7Z J;  4OIP F;  2W1O A;  2L7Z A;  2ME6 A;  3S14 J;  3A4C A;  2PMU A;  2XF7 A;  4S0H B;  1RIO H;  3IH4 A;  1R49 A;  4UUT A;  3VOE A;  1R7J A;  2P7V B;  4PJJ A;  3K70 C;  3DTK A;  3G73 A;  1HCR A;  4JQF A;  4E7K A;  3LFU A;  2MH9 A;  1MJA A;  3TMO A;  3HKZ A;  3VOD A;  4G7Z F;  1HDP A;  2XGC A;  4WWC A;  1S3J A;  4L9V A;  2QSG X;  2RVC A;  1W7P B;  3RDI A;  2P81 A;  1WRJ A;  3QAH A;  3A02 A;  4XL9 A;  1T95 A;  5B1A H;  3G4S I;  2R7T A;  1WJC A;  3I3L A;  5D6F A;  3F8B A;  4CYC A;  2EIM H;  3A01 B;  2VXZ A;  3LQR A;  5LRS A;  3C3W A;  1XMA A;  2HWV A;  2F6C A;  3BR5 A;  3PL8 A;  3ASN H;  5HOO A;  2E71 A;  3NRV A;  1EKE A;  2PMH A;  2R7S A;  3L9F A;  5HLG A;  1I3A A;  2HDC A;  2W24 A;  3ZXS A;  2DXI A;  3H1C A;  3JRF A;  2EIK H;  4ANJ A;  2MBF A;  4B1R A;  4EJU A;  1QVU A;  3BJ6 A;  5FFX A;  2D5V A;  3F22 A;  1BM9 A;  4CCN A;  1ZGJ A;  2ZME B;  1FOX A;  1P7I A;  5LGU A;  3V42 A;  1FBQ A;  2WY7 Q;  3CDL A;  4KT6 A;  3SJM A;  2WB1 A;  1YLF A;  1YIJ I;  2HR3 A;  2CUJ A;  2HPI A;  2Y75 A;  4NBQ A;  4HPQ A;  2M7A A;  3QYF A;  2OUM A;  3WGH A;  1YW9 A;  4ITV A;  1D0X A;  5FLX Z;  3CP8 A;  3KP5 A;  4QSH A;  2ZO4 A;  2XPU A;  3WTV C;  2FQ4 A;  1V5F A;  3WTW C;  2ZNZ A;  1A36 A;  4M6V A;  1LVK A;  2L01 A;  1FJL A;  1FWZ A;  2RN7 A;  4B3X A;  1X19 A;  4D1Q A;  3BZK A;  2X1E A;  3KP4 A;  2ZFW A;  4KA4 A;  1PVE A;  5E3N A;  3QOE A;  4IZZ A;  2LKX A;  4HDU A;  2PFB A;  3LSM A;  2XF6 A;  3K4C A;  1VQK I;  3CZ6 A;  3OYL A;  5LD2 C;  1UG2 A;  3OYD A;  3GTL J;  3H9J A;  5HS8 A;  1VQ8 I;  2O8X A;  1FTT A;  2L9V A;  4G6Q A;  5J6X A;  5K5R A;  3H35 A;  2BZT A;  2ZFU A;  3CLQ A;  1SFE A;  4BY7 J;  2Z33 A;  4OIO F;  1BA5 A;  4AVP A;  2HOA A;  1QO0 D;  2LNB A;  3LOC A;  4XLF A;  4LGW A;  4M6X A;  1FOW A;  2GA2 A;  3SEQ A;  4IVN A;  4A93 J;  4U88 A;  3U1K A;  3OYI A;  2XRL A;  3UNG C;  5BPI A;  1T38 A;  2FXA A;  2M9H A;  5H20 A;  1E3P A;  2LVS A;  4IHV A;  2Z5U A;  5D6E A;  1VQ4 I;  2XPW A;  2IGK A;  1O3Q A;  4LLG F;  4B47 A;  3QYB A;  5ICF A;  4HST A;  2DA5 A;  2EZK A;  2HOT A;  2L0K A;  1J5Y A;  3P9C A;  1S6L A;  2V9V A;  2Y9Z A;  3PSI A;  4IF4 A;  1S8N A;  5TGT A;  1BW5 A;  2L9S A;  5GP9 A;  1O7F A;  2EIJ H;  1BI1 A;  4H0E A;  2Y31 A;  1JKO C;  1YG2 A;  3F9K A;  2Z9O A;  2W57 A;  3G6E I;  2A07 F;  1I6X A;  4D0P A;  1FYM A;  2ZXJ A;  2X48 A;  3D1N I;  4AYB N;  4KIT B;  4D7M A;  1T56 A;  1Y8R B;  2GIZ A;  3ELK A;  3V4G A;  2CO5 A;  1LUJ B;  5J4V A;  1L3L A;  2HZD A;  3TDZ C;  1ETO A;  3MEX A;  4AM3 A;  3BWG A;  2WAQ A;  1JUP A;  1QZY A;  4DJA A;  4M6Y A;  1ZRC A;  4ZTF A;  2TRT A;  2Q0O A;  2R7F A;  4PFP A;  3BTJ A;  3M07 A;  4A6E A;  5FB2 A;  1ZRD A;  3IAS 2;  1IV6 A;  2KHM A;  2BY3 A;  2BEO A;  1KON A;  2CW7 A;  1RUN A;  3OL4 A;  1IC8 A;  3E7L A;  2X0L A;  2F48 A;  3IC7 A;  3LSG A;  4YRV A;  1WPK A;  2E7X A;  1T0F C;  3HOZ J;  4M3D A;  1SD6 A;  3F6O A;  3L1P A;  2IW5 A;  3BQZ A;  3K70 D;  4IXA A;  1WZ2 A;  3JRH A;  1XGN A;  2FOW A;  3K1M A;  5L3B A;  1IZ1 A;  2DA7 A;  3I4M J;  3PO3 J;  4BBS J;  4ON0 A;  4RLF A;  3J7A O;  2O03 A;  2W25 A;  2K3F A;  5FKN A;  1Z05 A;  4IO9 F;  4EEF G;  3ASO H;  3G1M A;  3H9Q A;  2Y30 A;  2R4G A;  3MVP A;  5D8K B;  2CQX A;  3P9I A;  1DP3 A;  5FD5 A;  3JRA A;  2M4G A;  1JKR C;  2E36 A;  2MGQ A;  2LY9 A;  2DOD A;  1B8I A;  2OQG A;  2P5V A;  3FIS A;  4QIW N;  1FTZ A;  2ETH A;  2HNH A;  1FBU A;  2OJE D;  1FX7 A;  1X58 A;  3HOT A;  4ZJZ A;  2W4S A;  2KJB A;  3A01 A;  2K02 A;  3PNV A;  2R5Y A;  2OA4 A;  3ZCO A;  4G12 A;  3DLL F;  5E3M A;  2ZJR F;  1DU0 A;  2MFZ A;  3PQJ A;  3D5L A;  2CGP A;  5F08 A;  2OD5 A;  4BE1 A;  1DGR M;  4RGX A;  4N9H A;  1FYK A;  1DDN A;  4WF2 A;  5HS7 A;  1P9Q C;  2WWY A;  4BE2 A;  2ZXH A;  3AG1 H;  4RA2 A;  2XAS A;  4XNF A;  5F27 A;  1YQA A;  4BE0 A;  5L3C A;  3PIP F;  1GLN A;  3I4P A;  3SZT A;  2Q2E B;  2ZJ2 A;  4CCM A;  2M1B A;  2VOD A;  3DKY A;  2A69 F;  4OIN F;  2VT3 A;  4EJV A;  2KDZ A;  3ZMZ A;  2JA7 J;  2GZW A;  2A61 A;  2K27 A;  1SMT A;  4H4K C;  2KRF A;  2V1N A;  3I9V 2;  4NC8 A;  1R71 A;  2WTE A;  4M3B A;  1IN4 A;  1QHH D;  1POG A;  4OAY A;  2CQQ A;  1JJ6 C;  1DPU A;  5IP9 J;  1YJN I;  3ROU A;  5JR3 A;  2XSJ C;  4KIG A;  2FD5 A;  2DN0 A;  3E5X A;  3OOP A;  4WXC A;  4YII A;  5E8I A;  2ZME C;  4L9T A;  4N4O B;  5HDK A;  4UNO A;  3BR1 A;  2VKH A;  3WG9 A;  1WHU A;  4CH7 A;  2PJR A;  4P55 A;  1EV7 A;  5F1J A;  2J5O A;  4CA0 A;  4EV0 A;  2VKV A;  3GFM A;  2YS9 A;  3KCC A;  2DJN A;  4G9Y A;  2LF8 A;  4CYD A;  2FNP A;  1PYV A;  2GBY A;  4EGZ A;  2VAS A;  3CDI A;  5GAG J;  2ID3 A;  3M7G A;  1T6S A;  3A0H C;  2X1C A;  3CUQ B;  2RNG A;  4W1U A;  1FZP B;  3BLY A;  5IT9 Z;  4C3H J;  5ILU A;  1O3R A;  2KL4 A;  3BTI A;  4HEA 2;  1XSD A;  3T0Y A;  4BXF A;  1YJ9 I;  3BTC A;  5D4R A;  3EUH A;  5LFA A;  1CQT A;  4LG0 B;  2L4M A;  4M9Z A;  2DMT A;  2CV0 A;  1TNS A;  4MFD A;  2ADU A;  1ZLJ A;  3BTL A;  5FLM J;  4I01 A;  3I64 A;  2QSF X;  5EGO A;  2DLL A;  1SD7 A;  5TJJ A;  1RR8 C;  2H8R A;  3GLL A;  1VQO I;  2RAE A;  2DJI A;  3R4K A;  3ZQG A;  4BAC A;  3GF2 A;  4RAY A;  3W2A A;  4BQA A;  3GW2 A;  2HQR A;  4D5C A;  3BG7 A;  4CGZ A;  3S2H J;  3VEP A;  1O57 A;  5EG0 B;  3F0C A;  5FD6 A;  3FMQ A;  1HW5 A;  3KLN A;  2MG4 A;  3VPR A;  1IRG A;  3OSF A;  3ECO A;  5FKM A;  1BBY A;  1MH4 A;  5J40 A;  4NHJ A;  4C2U A;  5E3O A;  4B3A A;  3ZMT A;  4HG2 A;  4I0A A;  1HBX G;  3HJE A;  2P5K A;  3E3V A;  2DMQ A;  4PDK A;  4DNC A;  4FX4 A;  1ZN2 A;  2A5W A;  1IG7 A;  2O6G E;  1JT6 A;  2CFX A;  5F1R A;  2M8G X;  3HHG A;  5D5U B;  1WCM J;  2Z2S B;  1IJW C;  3TED A;  2JWT A;  3FXO A;  3CF2 A;  4KIC A;  4IOA F;  2H27 A;  2VBW A;  4XQF A;  4NQW A;  4PJN A;  5FRO A;  3VSL A;  3CDH A;  4MHG A;  3OYF A;  2RC4 A;  2R93 J;  3PO2 J;  4DIQ A;  4F7Z A;  4DZJ A;  3KE2 A;  2CH0 A;  3MZY A;  1K6O A;  2O9L A;  4PJ0 C;  2XAG A;  4G7O F;  1D5V A;  4HSR A;  1DPR A;  3JRI A;  4E7Z A;  1UHS A;  2ELJ A;  1D1B A;  2O7O A;  1D1A A;  2G7U A;  2JPC A;  3IRR A;  4PZJ A;  4C9Y A;  4KJZ A;  4PUS A;  4XSX F;  1LE8 A;  1OLT A;  2A6H F;  2EV5 A;  3WHC A;  1LQ1 A;  1LDJ A;  4IHY A;  2H1K A;  3BR3 A;  3M4O J;  1R4M B;  4B09 A;  1OKR A;  2FF4 A;  4S04 A;  3FIW A;  4ENJ A;  1ON1 A;  2EFW A;  2GXA A;  1HLV A;  1KU7 A;  2CW8 A;  1IN6 A;  3KP6 A;  2XKO A;  4Q4Z F;  4UB8 C;  1VQN I;  1B1B A;  5E1Z B;  5M5Y J;  2XAQ A;  2XAU A;  2ZJP F;  4I09 A;  2RRE A;  2GM4 A;  2OTJ I;  3HRT A;  1CGP A;  4RAF A;  2P6S A;  1IN7 A;  4XKV A;  4LFU A;  4CZZ A;  3K6G A;  3FHN A;  2K40 A;  3BJA A;  2CQ7 A;  6PAX A;  2R0Q C;  2H8W A;  2V9K A;  5E3L A;  3K4L A;  1J0R A;  3WOD F;  5EEA A;  5CYV A;  3TKY A;  4GYI A;  3MZH A;  5HDG A;  1DUX C;  1KYZ A;  2CFO A;  3IV5 A;  2QCO A;  5CVJ A;  4W97 A;  1TP4 A;  2QSH X;  5B3S H;  3WU2 C;  2L9N A;  2W7N A;  3H3U A;  3FM5 A;  2CQK A;  1E3O C;  1LJ9 A;  4Y15 A;  3HGY A;  5E1X A;  2JUC A;  2E1M C;  5CVU A;  1G59 A;  1UMQ A;  2LR8 A;  4NQW B;  1WJB A;  3UR3 C;  3DPT A;  2L2O A;  1XMK A;  5K7H A;  1MBE A;  2VON A;  3W6K B;  1HOM A;  2P0W A;  4B8X A;  3CTA A;  4RM2 A;  1AKH A;  5IT3 A;  4F3Q A;  2KFD A;  2UXX A;  2F5V A;  4BHC A;  4IPA A;  1FY7 A;  2FUG 2;  2DA1 A;  1D5Y A;  5LEK A;  2G7H A;  1MNM C;  3GZ6 A;  4HLX A;  3BZ6 A;  2HDW A;  1F5T A;  2VIX A;  3P9K A;  3Q9S A;  1HA8 A;  2LOO A;  4CCL A;  3NWT A;  4AWX B;  3L2R A;  5C44 J;  3NQO A;  1MDM B;  1DU6 A;  1V4R A;  4UV9 A;  2ELH A;  3LWF A;  1HXD A;  5BPD A;  3DWL E;  3CCR I;  1TQI A;  2DMU A;  3KEY A;  2LMD A;  2EBI A;  4RB1 A;  1YIT I;  2DYR H;  3SFI A;  1X1C A;  2RQP A;  1XDS A;  2M5W A;  3TO7 A;  5F0C A;  3DP7 A;  1SFX A;  1UHW A;  1ZLK A;  1SD5 A;  4XLN F;  3JSO A;  3DLA A;  4Z6Y A;  1SMY F;  2HU9 A;  3SYT A;  2RV8 A;  3CQZ J;  2F2E A;  3JRD A;  3HTU A;  4DYC A;  2PI0 A;  1ZAO A;  4F91 B;  4OMZ A;  4LG0 A;  4EM2 A;  4Y4R A;  3R6S A;  5DDG A;  3HZJ A;  4UUS A;  3LSH A;  4HZF A;  4A69 C;  2DQR A;  1JTY A;  3OWT A;  2FML A;  3ECH A;  4GYG A;  4DBR A;  4UHT A;  2CU7 A;  4G7H F;  1B9N A;  1JI8 A;  3HPH A;  3JSP A;  1SFO J;  1Y8Q B;  2Y9Y A;  3OYB A;  4DYQ A;  3G71 I;  3S1N J;  1ONV A;  5CQG A;  5JLW A;  2I5U A;  2JK3 A;  5BNG A;  2VXD A;  2IXS A;  1ZAR A;  2AXL A;  4P96 A;  2L5Q A;  1RC9 A;  3CCL I;  1LEB A;  4ZYA A;  3ZQH A;  1ERD A;  2QVO A;  3BJO A;  1MJB A;  3I4N J;  4LOC A;  5D5W B;  2AQE A;  2GAU A;  1Y0N A;  3V8L A;  1P6R A;  1E3H A;  4PJM A;  3LSR A;  3VB2 A;  1YO5 C;  3ESW B;  5ILS A;  4Z2Y A;  3MAJ A;  1LE8 B;  3CJQ B;  3HG9 A;  2DOF A;  2M8E A;  1PJR A;  4P1W A;  4FET A;  4LIT A;  2E34 A;  3CLO A;  3OYA A;  1U3E M;  1ETQ A;  1SAN A;  2JVG A;  3ZN1 A;  4FAS D;  3KZY A;  4B43 A;  5K1Y A;  5DS9 A;  3PQK A;  2OAZ A;  1JTX A;  4NC7 A;  2XAH A;  2IS6 A;  3ZQF A;  2TDX A;  2DT5 A;  3GUD A;  1QVT A;  2IS4 A;  1F1Z A;  4N0B A;  1V3F A;  4BEH A;  3TO9 A;  4OU0 A;  1KQ9 A;  2FA5 A;  2WY8 Q;  1WH7 A;  2YX4 A;  2JTV A;  4RS8 A;  1O4X A;  5JVG F;  4HX8 A;  4P9U A;  3TOB A;  1FLI A;  4ENN A;  3GTM J;  2WC2 A;  2DFH A;  4HNV A;  4IL6 C;  2V1X A;  4XLC A;  3V7S A;  1U9O A;  2CUZ A;  3OL3 A;  1YFH A;  5CKT A;  3BY6 A;  3JRE A;  4FCY A;  4NNJ A;  4PFO A;  1YYV A;  1XB4 A;  4UUV A;  5JLX A;  5HLT A;  3S3M A;  1X1D A;  2H1L A;  3HL2 A;  4ASN A;  4OAZ A;  2CUE A;  1FMV A;  4X1E A;  5CVI A;  3FMS A;  2EH3 A;  1GV5 A;  4XLP F;  2DOE A;  3F3X A;  3CCY A;  3RQI A;  1IUF A;  2EK5 A;  2JA8 J;  2EFP A;  4NDL A;  3ZQC A;  4LIU A;  4PSX A;  1SEU A;  5IOZ A;  4Q5S F;  2XAJ A;  4ESB A;  5HVQ C;  2KZV A;  4A3K J;  2E1C A;  2MA3 A;  4BGD A;  5EG0 A;  3CCJ I;  2OTL I;  5J8C A;  2GXB A;  1JT0 A;  4A3L J;  2WV1 A;  1XX5 A;  2EV6 A;  2HEO A;  1VFC A;  2E2I J;  1KU3 A;  3DBR B;  2BHZ A;  3O8H A;  1MSE C;  2NAZ A;  3A0B C;  4GXO A;  1Y0U A;  2BY0 A;  3JRG A;  5EYR A;  1MMN A;  1RKT A;  1ON2 A;  2JQ7 A;  3OS2 A;  1BL0 A;  3HKZ N;  3U9G A;  4BL0 B;  3OYM A;  4XN3 A;  3ZMD A;  1EH6 A;  3NWS A;  2E5Z A;  2DO7 A;  3K0L A;  3JTH A;  3OIO A;  2CW0 F;  3FK7 A;  4XOR A;  3J7Z I;  4MTD A;  3J81 K;  3RPQ A;  3F23 A;  4PGG A;  4KN7 X;  3VYU B;  2Y2Z A;  4YEJ A;  2X85 A;  5DYM A;  3MKL A;  2XF5 A;  3WE3 A;  4X0G A;  5LLQ A;  1H0M A;  2HTS A;  4A3M J;  1O7L A;  4KN4 X;  1SAX A;  3WG7 H;  1K4T A;  1OQY A;  1XSV A;  4HW0 A;  5KAI C;  5ICE A;  2R7O A;  4MEX F;  4A0Z A;  3O2P E;  2P4W A;  1S7E A;  4OIR F;  3J80 Z;  2DK8 A;  4R1H A;  5E1W A;  5BMZ A;  1O3S A;  1VQ5 I;  4M3E A;  5EJC A;  2XVC A;  4LB5 A;  4A3C J;  2R7W A;  4Y17 A;  2X51 A;  2EZL A;  1XMX A;  1STZ A;  1QQI A;  1HC8 A;  3RZD J;  3OOU A;  3FKJ A;  1T2K A;  2FNA A;  2OV7 A;  3JRC A;  2JSC A;  1IXS B;  4LMY A;  1ORK A;  4NUB A;  4BNC A;  1XN7 A;  4AU7 A;  1YS6 A;  4OOI A;  1HW2 A;  3V8J A;  1J7K A;  1W4M A;  1X1P A;  4R79 A;  3MKY B;  5HLH A;  5HS9 A;  3QQA A;  2Q2E A;  3K2Z A;  4HV5 A;  1U0J A;  1FNN A;  2QGU A;  1R1U A;  3ERM A;  3RPU D;  3DTI A;  1RUO A;  3CC4 I;  3SDG A;  1GDT A;  2H09 A;  4XR6 A;  3H0D A;  1U5T B;  3KLO A;  5FKO A;  4UUS B;  1UST A;  2J5P A;  3C18 A;  2W48 A;  2FU4 A;  2LG4 A;  4XN0 A;  1Y1W J;  3H9G A;  4GCV A;  1H9G A;  5KNL A;  1MJ9 A;  2IVM A;  2QKL B;  3QU3 A;  2L4A A;  3E6B A;  1ETX A;  2YX7 A;  1ZG5 A;  4HF1 A;  1OJL A;  2AQF A;  4AD9 A;  1W0U A;  3M9A A;  3LAJ A;  1MSF C;  4V2G A;  2R5Y B;  4C3J J;  2HOE A;  2VL8 A;  3W6J B;  1CF7 A;  2FMY A;  2QF7 A;  1M1E B;  2VB6 A;  4U0W A;  2RQQ A;  4M3G A;  2PG4 A;  2NVU B;  3SFZ A;  4V19 K;  4A3E J;  1U2W A;  3BPV A;  3EYI A;  2ECB A;  2R92 J;  3EYY A;  3TW6 A;  1T33 A;  5AON A;  4PGH A;  2C6Y A;  3ZGK A;  2QYO A;  4E4H A;  2M7B A;  3QP5 A;  2ZNY A;  4U0Y A;  4RBO A;  1RNL A;  4I02 A;  3CO7 C;  1EJ9 A;  3IAM 2;  3LA2 A;  2BOL A;  4BS9 A;  3K9T A;  1LEA A;  2EWN A;  4L5J A;  1SD4 A;  4CDG A;  2OCE A;  4B48 A;  4GFB A;  4IQ4 A;  5BQT A;  3S16 J;  4M73 A;  4HNU A;  2LYC A;  2M2E A;  2QWW A;  3GXO A;  2LSO A;  1P4X A;  3HOU J;  2LK2 A;  2F4O B;  4V2F A;  2R7X A;  4KIB A;  2HQ5 A;  1J75 A;  1MNE A;  1VQ7 I;  4A6D A;  2LH9 A;  3HXL A;  5ED4 A;  4KMF A;  1IRF A;  3HOS A;  4II2 A;  2VOO A;  3FHZ A;  3E0J B;  4EVI A;  2IAI A;  4I99 C;  1K4S A;  1QPM A;  3KPH A;  3MFK A;  1TBX A;  1ZGA A;  4MQV A;  2DU9 A;  2CUF A;  2KDO A;  3K10 A;  3L2W A;  1A04 A;  2E1N A;  2X6W A;  5EEH A;  3HOV J;  5HLI A;  4CO8 A;  2PN6 A;  3LL7 A;  2M30 A;  5DUK A;  3IKV A;  1W36 D;  2Y0S A;  2YR2 A;  2HI3 A;  1BIB A;  2XKP A;  4D9J A;  2VN2 A;  3COA C;  1MBK A;  1X3U A;  1V55 H;  5F0F A;  4RGU A;  3W6V A;  4RGR A;  4FX0 A;  2EFN A;  3VYS B;  1R00 A;  3RKY A;  5JHU A;  5DCM A;  3AG2 H;  5J1U A;  3GCM A;  1B4A A;  3HSR A;  2HKO A;  2KJC A;  1TTY A;  2NVY J;  1Y39 A;  3AG3 H;  3U2R A;  1K78 B;  4HX7 A;  1ETW A;  1BI3 A;  5IP7 J;  4JK1 X;  3BCB A;  1XPX A;  1ZRE A;  2KRH A;  1K7A A;  4RGS A;  2O8K A;  4BAY A;  1I27 A;  3EQL F;  4L5E A;  1FP1 D;  1IRZ A;  1I50 J;  2YUS A;  2XRN A;  1A6Q A;  3GFL A;  5EDN A;  1IXC A;  1GVD A;  5M3F J;  2CYY A;  2ZCW A;  3W2W A;  3M1E A;  3QPS A;  2TCT A;  3BP8 A;  1YOV B;  2ZSH B;  4A12 A;  1LPQ A;  2FBH A;  2QQ9 A;  1WJA A;  4CCO A;  2OPT A;  4B44 A;  1GV2 A;  3E1S A;  3ABT A;  3CCE I;  4YFX F;  5B5E C;  2ZSI B;  5B1B H;  1C0W A;  3S17 J;  2N8G A;  1LB2 A;  4XBF A;  3TP3 A;  1RRJ A;  1Z91 A;  3A1Y A;  3DKW A;  1G2H A;  4HNT A;  3LSJ A;  3EUA A;  2IA0 A;  3EUH C;  4GGG A;  2BGC A;  2W82 A;  4JP0 A;  1WVR A;  5LHH A;  2CV1 A;  3E97 A;  3ABL H;  2PBI A;  3L2V A;  1YJW I;  4A0Y A;  1J9I A;  5GPC A;  4IKF A;  2ZC2 A;  3GTK J;  3KIO A;  2L7M P;  3DTE A;  5CQE A;  4C2T A;  2QBY B;  2DA6 A;  4BBR J;  5K7F A;  3FZV A;  1EA3 A;  2LRE A;  2OF7 A;  1MBJ A;  2UUZ A;  4WK8 F;  1EH7 A;  2E35 A;  2FEZ A;  1FSE A;  3VFZ A;  1I39 A;  2LP0 A;  4XKW A;  4IHT A;  3LSK A;  3K1P A;  3DEE A;  2EJR A;  3AAF A;  2ZME A;  3SZP A;  1FIP A;  1YRN B;  2ISY A;  4E7J A;  3WGI A;  1A35 A;  2BW3 A;  1V5E A;  3GWZ A;  2EZH A;  4BDY A;  3DEU A;  4C3I J;  1DQU A;  1LDK B;  2GOM A;  1OCT C;  2EZI A;  4DZP A;  2YPR A;  3IP4 B;  3OYE A;  3QPH A;  2E60 A;  1R4N B;  3IUO A;  2FJ1 A;  4XRS G;  1MND A;  2HYG D;  1VND A;  2P7C B;  1YW7 A;  2GWR A;  3P5J A;  3H5N A;  3E5U A;  2X1D A;  3KYL A;  3EDP A;  3RZO J;  2BYV E;  2DYS H;  1R58 A;  2LDU A;  1YTY A;  2A6E F;  3L2Q A;  3HSE A;  2ZBK A;  3KFW X;  5LRR A;  3O6B B;  4E6K G;  1HSJ A;  4D7N A;  1BC8 C;  2QLZ A;  5J47 A;  4KDP A;  1LKX A;  2P6T A;  3I53 A;  3CUO A;  3MMY B;  4XOT A;  4KIF A;  3FBN B;  3KZZ A;  1R5I D;  2O3F A;  3F8C A;  3OYJ A;  3DCF A;  1K83 J;  3FX3 A;  3MD2 A;  4U7D A;  3QWL A;  1ZEL A;  4YEL A;  3ABM H;  1WI9 A;  2KZG A;  4KNY A;  3D0S A;  2ZKZ A;  2IT0 A;  3KX2 A;  2RNJ A;  1Y1V J;  1PDN C;  5K7Z A;  2XAF A;  3MWM A;  4RM3 A;  3FXJ A;  5L3G A;  2KIM A;  1P2F A;  2D1V A;  2JPB A;  3AKZ A;  3HTS B;  2K3P A;  2OZ6 A;  3DPL C;  1LFU P;  5JI6 A;  3RPU A;  3HBL A;  4F55 A;  3KET A;  2VUM J;  1BI2 A;  3JAM Z;  1Z3X A;  4KT5 C;  3AL0 B;  5IT9 K;  3LFK A;  1Y56 A;  3C7J A;  5FJ8 J;  3RYR A;  2H94 A;  3CME I;  2ME0 A;  1QRY A;  3OY9 A;  2BBY A;  3GBG A;  3CCM I;  3BR6 A;  3VDX A;  1YHQ I;  2MD5 A;  3LST A;  2I8D A;  2ID6 A;  1VQ6 I;  4BH9 A;  1H8A C;  1ETK A;  3G2B A;  3JAM K;  3ULQ B;  1B9M A;  1HF0 A;  3CJR B;  1QHG A;  1TW3 A;  2V1D A;  3RQ4 A;  2HXO A;  2F5C A;  1JHF A;  2IA1 A;  4YFN F;  2HVQ A;  4G94 A;  4YG2 F;  3L2C A;  3L2U A;  2WAE A;  1PP7 U;  4IRI A;  4A3I J;  1PP8 F;  1ODD A;  3HM5 A;  5CJ9 A;  4E70 A;  1VQ9 I;  2VOP A;  3Q9V A;  4EGY A;  3Q0U A;  2DBB A;  4DQ2 A;  1AHD P;  4IHS A;  1G3T A;  4BY1 J;  1R6R A;  3S2D J;  1TWG J;  5C4J J;  1ZKG A;  1QZZ A;  3H3Z A;  4CZC A;  5DUI A;  3G3Z A;  5HNH A;  2UZK A;  3OSG A;  1DGW Y;  1ETV A;  4Q48 A;  1B8I B;  2VQH A;  1VQL I;  1XG1 A;  1ZR4 A;  4RMN A;  3FXR A;  3U1D A;  4HX4 A;  3OR1 C;  4LG3 A;  2O61 A;  1EF4 A;  1R1T A;  1W1W E;  3BCA A;  4XIC A;  1RR7 A;  3L09 A;  3S2W A;  1P4A A;  2DPU A;  1YX3 A;  5FO5 A;  4FQG A;  3WTZ A;  2DA4 A;  3RIR A;  2VQG A;  2IGM A;  3I59 B;  1MD0 A;  4ZTJ A;  2R5Z A;  2V6C A;  3N4M A;  2NS0 A;  3PFY A;  1TQP A;  2QQB A;  1SAU A;  5B66 C;  3S1Q J;  1QZE A;  3HPG A;  2DDA A;  1USS A;  3C2G A;  3FK6 A;  4RB0 A;  1P7J A;  4I2O A;  1TNT A;  3H0G J;  3KEO A;  1E17 A;  5K5O A;  1TT0 A;  4MGR A;  4HLY A;  5LHG A;  2XC7 A;  5KCM A;  2O5R A;  2VKD A;  1X2M A;  1H9T A;  1W7P D;  1Z77 A;  1YRN A;  3RKQ A;  2ZJQ F;  1ITY A;  4XLE A;  1X3W B;  2FRH A;  4JOM A;  5D8L B;  3HOY J;  5DM7 F;  3S32 A;  2COM A;  2NNY A;  2AHQ A;  1UHM A;  2M87 A;  5GTH C;  4HQE A;  1B59 A;  5GAD J;  4CYC B;  2R3S A;  3F6V A;  2HXI A;  1UCR A;  3DU5 A;  1IN8 A;  2B9S A;  1S7O A;  1SVM A;  2QQ8 A;  3IWZ A;  3QP6 A;  2QBY A;  4E7S A;  1F36 A;  2WB1 N;  3DXJ F;  4AVZ A;  4WXD A;  3RKW A;  3EET A;  2L3D A;  3UKG A;  2Y0S N;  2DQL A;  3PM1 A;  5M5W J;  1OYW A;  3QOD A;  3DU6 A;  3HUG A;  1APL C;  3WTT C;  3GTQ J;  2ICW G;  3OR2 C;  2VKE A;  4XON A;  2X9D A;  2A5Y B;  2LBF A;  3OMY A;  2MSY A;  2QEN A;  2QZ8 A;  1MBF A;  3TDU C;  4AIH A;  1BI0 A;  5IYD J;  2BVM A;  4CSW A;  1HKS A;  2K85 A;  2G0E A;  1N75 A;  3K69 A;  3CCU I;  3BG9 A;  1JE8 A;  1REP C;  2ECC A;  4CHU A;  4Y52 J;  4G6D A;  2QA4 I;  5IP6 A;  4FT8 A;  1GUU A;  3KZI C;  1G3Y A;  1E0E A;  2LLK A;  2NS8 A;  1ZR2 A;  1JGG A;  3KP3 A;  4F52 A;  3GTO J;  5L3D A;  1BN5 A;  3VSK A;  2FQ3 A;  2OQR A;  4AID A;  1G8X A;  1T98 A;  3J7A Y;  1MIJ A;  3LQQ A;  3FMR A;  4MLO A;  4IRH A;  3SEZ A;  1TZL A;  4XKC A;  3V7R A;  3FWE A;  3ZOB A;  4M9X A;  2K9Q A;  3TL4 X;  3U21 A;  2UV1 A;  4L0Z B;  2DOA A;  3PNY A;  5DEQ A;  4L18 B;  2BXY A;  1G3W A;  1KQ0 A;  5FRN A;  3REO A;  2BVL A;  2JA2 A;  1MW7 A;  4I76 A;  2MW8 A;  1NH3 A;  3W3C A;  2NS7 A;  3V7C A;  5A2Q Z;  2K9S A;  5KVR A;  4A3G J;  5GPA A;  4ZDO A;  4ZYG A;  1U6G A;  4QLC U;  5JHF A;  1LFP A;  4EM0 B;  2VBX A;  4MO7 A;  4Y7N J;  2HFH A;  4I6Z A;  1B6A A;  3CO6 C;  3MCZ A;  3T1B A;  4HDV A;  3GFJ A;  5IPA A;  3IKT A;  2XHK A;  2CRG A;  2V4J C;  2Y48 A;  4M9S A;  4BQN A;  1BJA A;  4JBA A;  3RKX A;  3RCO A;  5F64 A;  3ABK H;  4ZYH A;  1I6H J;  5L3E A;  4RDU A;  1TWA J;  3S3N A;  5E79 C;  5D4S A;  2WA0 A;  2IGN A;  1JUM A;  1LNW A;  2NOG A;  3GO5 A;  2E19 A;  4DYR A;  2OCC H;  1TQM A;  4ESJ A;  1ZQ3 P;  1UB9 A;  1WJF A;  2F5E A;  5LBQ A;  3GEZ A;  1Z3Y A;  5CVV A;  4RAG A;  3F72 A;  5LGN A;  1BOB A;  5ILV A;  4LJZ F;  4AIJ A;  9ANT A;  3HEF A;  2DAO A;  1J59 A;  2DT7 B;  4MEY F;  3CMY A;  1WGX A;  1D3Y A;  2YSR A;  4HRI A;  1FMW A;  4EJT A;  1MMG A;  1XGO A;  3BG5 A;  1F9N A;  3FXM A;  2QKM B;  3K2A A;  3PFI A;  1TWH J;  3LSP A;  3ZQ7 A;  3N05 A;  3G1L A;  4I98 B;  1P92 A;  4XMY A;  2DK5 A;  4E7I A;  3KYD B;  4O3M A;  1B72 B;  1AA7 A;  1T08 B;  2MLG A;  3CUQ A;  3RTR A;  5IOY A;  1ETY A;  1K61 A;  1OR7 A;  4E7L A;  4IHX A;  1X3Z B;  2QM3 A;  2HKX A;  3HRU A;  1SVO A;  2YU9 J;  2BY1 A;  2RDP A;  4XOP A;  2K5C A;  1YIO A;  2PJR B;  4I7H A;  2HOS A;  3H3V K;  1IW7 F;  1FT9 A;  1RZ4 A;  2K9L A;  2M3A A;  3ISP A;  3LMM A;  3R61 A;  2DW4 A;  4HQM A;  3ZQQ A;  2VI6 A;  5E8G A;  2DCE A;  5EF6 A;  3VYT B;  2DT6 A;  1Q1H A;  1WQ2 A;  4ZYE A;  1VQM I;  1MMA A;  3LA7 A;  1NG7 A;  1U5T A;  3B6C A;  4I0B A;  1XCB A;  2KIF A;  4LK1 F;  1W7P A;  2GQQ A;  3WTS C;  2KQR A;  5J4Y A;  1R22 A;  2JSP A;  5IY5 H;  4A2U A;  1D8J A;  3W2V A;  4LLL A;  3ZRG A;  4WX9 A;  4P9F A;  2K9M A;  2DMN A;  3CP2 A;  2XGX A;  5D5X B;  3F8F A;  4HYE A;  2WAD A;  4E7H A;  1HDD C;  4U0V A;  3BDD A;  2QEX I;  1ZGW A;  1BC7 C;  2VPR A;  3PJR A;  2NYX A;  4O6J A;  1KQ8 A;  5CLS A;  5C4X J;  5GAE J;  2VC0 A;  2E1O A;  1QPI A;  3RYP A;  2HYJ A;  3MKW B;  3GVA A;  1XS9 A;  1U9N A;  2AO9 A;  1J09 A;  4ENM A;  4M71 A;  4AIK A;  3QPL A;  2L9R A;  5AIP A;  4XRF A;  2OBP A;  2LKP A;  2WAQ N;  3NAR A;  4CCK A;  5KAF C;  3E6M A;  3R60 A;  3FXK A;  1J2X A;  2KIQ A;  4HOB A;  2JRT A;  1MZB A;  4BDZ A;  2RGV A;  3DKX A;  2LY1 A;  2CG4 A;  1K78 A;  1FBS A;  5H6R A;  4BYY A;  3L7W A;  4JX4 A;  5D5V B;  4GDF A;  1W0T A;  3HUG B;  3ZQL A;  3AFH A;  3DQV C;  3WU1 B;  2M4K A;  1A5J A;  4QWQ A;  5DCM B;  1O3T A;  2VJJ A;  5FFZ A;  4CIC A;  2XDV A;  4J19 A;  4OWR B;  3ML6 A;  3S1M J;  4KMU X;  4BU2 A;  4UY8 I;  3F8M A;  4EJW A;  4A5N A;  4M3F A;  4ESF A;  1S7A A;  1Z1D A;  1OMI A;  1NK3 P;  1P4W A;  1SC7 A;  3WTY C;  1Y6I A;  2K86 A;  4QTR A;  4DGW B;  1RKW A;  4UVC A;  4OIQ F;  4UXN A;  2HQN A;  2Q8K A;  5K5Q A;  4Q47 A;  4XK4 A;  1KU9 A;  4HV6 A;  1VTN C;  4CUG A;  3AL0 C;  1XD7 A;  2IGO A;  5FRM A;  1I5Z A;  2VBZ A;  1X1B A;  2DFF A;  3BR2 A;  1S9H A;  5EZG A;  1U78 A;  5FGM A;  4C2M J;  4HBL A;  5F0H A;  4AYB A;  1IDZ A;  1S5L C;  2JVH A;  1G3S A;  3Q0V A;  2NVT J;  1BR4 A;  2XIG A;  4QPO A;  1WI3 A;  3ONQ A;  2BW3 B;  3KEQ A;  1FP2 A;  1H88 C;  3JRB A;  1ZH5 A;  1TLH B;  1WSU A;  4FTH A;  2BHY A;  1H89 C;  3RI4 A;  3CC7 I;  2V1U A;  3E6D A;  3H5R A;  5H2F C;  1HW1 A;  3LSI A;  3OYN A;  5FLX K;  4A3B J;  4M74 A;  3BR0 A;  1OIS A;  2UWM A;  3ZR8 X;  5BS6 A;  2EIL H;  4ETS A;  3WTU C;  4O5V A;  3TBI A;  1MMD A;  4S05 A;  3M8J A;  1QGP A;  2NVX J;  3KP7 A;  2CWE A;  2DFE A;  2V7F A;  1PUF B;  1U8B A;  2VLA A;  3GZN B;  3MN2 A;  2VT2 A;  3BT9 A;  2Z16 A;  4ZH4 F;  1OYI A;  4LLN A;  3TOA A;  4K2E A;  1I1G A;  1IV8 A;  1Q1V A;  2GLO A;  2VPL A;  4XID A;  2M0M A;  1A31 A;  1Z21 A;  2KPM A;  4BEH B;  2E1M B;  2KT0 A;  4ENK A;  1ZK8 A;  3O3K A;  5LHI A;  2EPF A;  1D1C A;  3GZ5 A;  1YS7 A;  3DBL B;  3L00 A;  3I54 A;  2VBY A;  1R5H A;  2LF7 A;  1FC3 A;  5KK1 A;  3TO6 A;  4RLQ A;  4LD5 A;  3I56 I;  3DFG A;  2LTP A;  1FPQ A;  3ZMV A;  3B73 A;  1VZ0 A;  1N77 A;  4NB5 A;  1KYW A;  4UB6 C;  4UV8 A;  3CES A;  1FOK A;  2DMP A;  5TRD A;  2K9N A;  5E20 A;  2M0C A;  1ACI A;  1IN5 A;  3K4M A;  5DM6 F;  1IRX A;  3X2Q H;  2CMP A;  4IJA A;  1Z6T A;  2CSO A;  3IL2 A;  4EM1 A;  4XLA A;  3HB9 A;  2HZT A;  4BXX J;  3RJP A;  2XB5 A;  2EIN H;  3BRO A;  2OU2 A;  2STW A;  1G4D A;  1W5T A;  4IOC F;  3CF5 F;  3BG3 A;  2LBF B;  2OZU A;  3A2K A;  3PIO F;  5J8F A;  2EV0 A;  1TT5 B;  2PEX A;  3T5X A;  3VWB A;  1X4P A;  2X6X A;  3K4N A;  1OFC X;  1YI2 I;  4XLH A;  2OC6 A;  4BHB A;  2LFB A;  1KU2 A;  5J1Y A;  3ZPL A;  3CD6 I;  5LGT A;  4HF0 A;  2EA2 A;  4XRS A;  1UG0 A;  3CJT B;  1OPC A;  5JVT A;  2KRC A;  1FYL A;  3BG6 A;  4IHW A;  3WE2 A;  3C2H A;  4A3D J;  2IA2 A;  4QPQ A;  1E2X A;  1R5G A;  2IEK A;  1IF1 A;  2GXG A;  1WH5 A;  2R7V A;  2DFI A;  1LDD A;  1BR1 A;  2G9W A;  4IEJ A;  1SFU A;  1QBJ A;  2HS5 A;  2YU3 A;  3BQY A;  3PNT A;  2STT A;  3OYH A;  1FEX A;  5HDN A;  3GME A;  5E17 F;  4PCQ A;  4EAT A;  1I1S A;  2NXN B;  2NOJ B;  3J81 Z;  3GTG J;  1RES A;  1BIA A;  4JX5 A;  1MBG A;  3HGG A;  2R5Z B;  2RKH A;  1MH3 A;  3OV8 A;  1G6N A;  1JXS A;  4LIV A;  1NHA A;  1GT0 C;  3N97 A;  2QUF A;  2Y0M A;  5DD4 A;  3S93 A;  1XDU A;  3SHF A;  3T8T A;  1U8R A;  2HPM A;  3DEW A;  1WFX A;  3FF5 A;  4ZDL A;  2B63 J;  2FX0 A;  2V79 A;  1V54 H;  5EEG A;  1TC3 C;  2EB7 A;  2PQ8 A;  2EQR A;  1IDY A;  1RI7 A;  2XRO A;  3HSF A;  1Z9C A;  1ZG3 A;  4Y3O A;  1XTA A;  2LKS A;  1OCC H;  2UXN A;  5ERI A;  1NK2 P;  2VE8 A;  3A03 A;  3MZ8 A;  2HGC A;  3QRF F;  5L3F A;  2WBM A;  2ESN A;  3DF8 A;  3JR9 A;  2BE5 F;  3ERE D;  2FSW A;  4FHT A;  2HQA A;  4BXU A;  1ZHF A;  3C1D A;  4A5M A;  2DA3 A;  2FBK A;  4ZZD A;  5BOX A;  2NVQ J;  3OYC A;  1HKT A;  1D0Y A;  2W84 A;  4RAZ A;  4XM3 A;  2F5D A;  1IO2 A;  3PUF A;  5HOD A;  3BZC A;  4IRG A;  1X2N A;  5DV5 A;  3DBH B;  4BKX A;  3HRM A;  3MKZ A;  4WXH A;  1UEL B;  4CCJ A;  4CXF A;  1ULY A;  3GTJ J;  2DPD A;  2VJ5 A;  2XB0 X;  3QPT A;  3HDD A;  2E2J J; 
#chains in the Genus database with same CATH homology
 1DP7 P;  1R36 A;  2IRF G;  1T39 A;  1AWC A;  3BOQ A;  3K1N A;  4MQ9 F;  4LK0 F;  3ZP5 A;  4OMY A;  2XV4 S;  3QOP A;  3I5U A;  4L0Y B;  3HIF A;  3WTX C;  3P7N A;  4UVA A;  4RB3 C;  3FXU A;  1KGS A;  2M45 A;  1ZRF A;  1S29 A;  2Z99 A;  3ZMU A;  1AOY A;  3GLX A;  2VE9 A;  2KKO A;  2JT1 A;  2MC3 A;  3HYI A;  1ZYR F;  4HF2 A;  3TQN A;  2DTR A;  5CVR A;  1F4K A;  5H6Q A;  3Q5F A;  2D1H A;  4TV7 A;  2FBI A;  5F6F A;  3E5Q A;  2KIU A;  5DD8 A;  3R0A A;  4G8X A;  3SQN A;  1QNT A;  2L02 A;  4LB6 B;  3IHU A;  2NRA C;  1MGT A;  3R0J A;  5ICC A;  1HST A;  3B02 A;  2NNN A;  1JGS A;  1EH8 A;  4MNU A;  1GVJ A;  3LA3 A;  3E6C C;  4ZYD A;  2K4J A;  1YW8 A;  4EQQ A;  2E7W A;  2HTJ A;  2DI3 A;  4YFK F;  3MQ0 A;  1XGM A;  2X4H A;  5DCF A;  1MDM A;  1XGS A;  1W5S A;  2QQA A;  3T8R A;  4HA8 A;  4UVB A;  4M72 A;  4A0X A;  3FM3 A;  1WKM A;  4KUM A;  3H92 A;  2ACJ A;  1HQC A;  1UFM A;  1BOA A;  1Z7U A;  3KP2 A;  3M8E A;  2GA1 A;  2IPQ X;  4EMS A;  1D8K A;  3BPX A;  2B0L A;  5ICG A;  2EA4 A;  1JHH A;  3M8F A;  1PUE E;  1Z6R A;  3NEU A;  4L9N A;  3GFI A;  1T0F A;  2PJP A;  2A3S A;  3WU0 A;  4ZZL A;  2MLK A;  5JFR A;  2GIV A;  4MTE A;  5E18 F;  1LVA A;  2Z3Y A;  4RB2 C;  2ESH A;  3F21 A;  3JW4 A;  2P8T A;  2O0Y A;  4L9J A;  3CJN A;  2H6B A;  4GO1 A;  3JTG A;  2XUB A;  2K4B A;  2F5F A;  1XCV A;  4KYW A;  3I0T A;  2FE3 A;  4N9I A;  3GYH X;  2VC1 A;  3I58 A;  2P5L C;  3ZN0 A;  2JZY A;  5AIQ A;  2IJL A;  2WV0 A;  4P5O A;  1KA8 A;  3IWF A;  3F8N A;  4U7B A;  2W85 A;  4HAM A;  3TGN A;  3HHH A;  3LAP A;  2H6C A;  4YIF A;  3I71 A;  3DV8 A;  2EFQ A;  3I59 A;  4KFC A;  3WGG A;  1IAW A;  1GXP A;  2R7D A;  3ABU A;  3V8K A;  2BV6 A;  1U5T C;  2D2W A;  4Y13 A;  4XSZ F;  2MH2 A;  4WCG A;  1R1V A;  1CF7 B;  1K79 A;  3GX4 X;  4R8H A;  1IXR C;  4EJO A;  1ZG1 A;  5LEJ A;  1GXQ A;  3IRQ A;  5A2Q K;  1TW2 A;  1R23 A;  3FXQ A;  1HKQ A;  2D45 A;  3CUQ C;  2L54 A;  1FSH A;  3ZMS A;  2AS5 F;  4L5I A;  3J80 K;  4BHP A;  2IP2 A;  2FOK A;  3HRS A;  2HYF A;  2PLY A;  2K7L A;  1XSX A;  1WWX A;  1OYY A;  1MKM A;  2EFO A;  2A68 F;  3QU6 A;  3SXY A;  1GHC A;  2ISZ A;  1L0O C;  1IUY A;  4OIP F;  2PMU A;  1RIO H;  3VOE A;  1R7J A;  2P7V B;  3G73 A;  4JQF A;  2MH9 A;  1MJA A;  3VOD A;  4G7Z F;  4WWC A;  1S3J A;  4L9V A;  2RVC A;  1W7P B;  3RDI A;  3QAH A;  1WRJ A;  5D6F A;  3F8B A;  2VXZ A;  3LQR A;  5LRS A;  3C3W A;  1XMA A;  2HWV A;  5HOO A;  3NRV A;  2PMH A;  3L9F A;  5HLG A;  2HDC A;  2W24 A;  2MBF A;  4EJU A;  3BJ6 A;  5FFX A;  3F22 A;  1BM9 A;  1ZGJ A;  2ZME B;  5LGU A;  1FBQ A;  1YLF A;  2HR3 A;  2Y75 A;  3WGH A;  1YW9 A;  5FLX Z;  3KP5 A;  2ZO4 A;  3WTV C;  3WTW C;  2ZNZ A;  2L01 A;  1FWZ A;  2RN7 A;  3KP4 A;  2ZFW A;  4KA4 A;  4HDU A;  2PFB A;  5HS8 A;  2O8X A;  4G6Q A;  5J6X A;  5K5R A;  4OIO F;  1SFE A;  2Z33 A;  4AVP A;  1QO0 D;  2LNB A;  4LGW A;  4M6X A;  2GA2 A;  4IVN A;  4U88 A;  5BPI A;  1T38 A;  2FXA A;  5H20 A;  2Z5U A;  5D6E A;  1O3Q A;  4LLG F;  5ICF A;  1J5Y A;  3P9C A;  1S6L A;  2V9V A;  4IF4 A;  1S8N A;  1O7F A;  1BI1 A;  4H0E A;  1YG2 A;  2Z9O A;  2W57 A;  2A07 F;  1I6X A;  4D0P A;  1FYM A;  2ZXJ A;  3ELK A;  3V4G A;  2CO5 A;  1L3L A;  3TDZ C;  3MEX A;  3BWG A;  1QZY A;  4M6Y A;  1ZRC A;  2Q0O A;  2R7F A;  4A6E A;  5FB2 A;  1ZRD A;  2BEO A;  1RUN A;  2X0L A;  3IC7 A;  2E7X A;  1SD6 A;  3F6O A;  2IW5 A;  4IXA A;  1XGN A;  3K1M A;  5L3B A;  1IZ1 A;  4ON0 A;  3J7A O;  2O03 A;  2W25 A;  1Z05 A;  5D8K B;  3P9I A;  5FD5 A;  2OQG A;  2P5V A;  2ETH A;  1FBU A;  1FX7 A;  3HOT A;  2KJB A;  2K02 A;  2OA4 A;  3PQJ A;  3D5L A;  2CGP A;  2OD5 A;  1DDN A;  4RGX A;  4N9H A;  1FYK A;  4WF2 A;  5HS7 A;  2WWY A;  2XAS A;  1YQA A;  5L3C A;  3I4P A;  3SZT A;  2ZJ2 A;  2M1B A;  2VOD A;  2A69 F;  4EJV A;  2VT3 A;  4OIN F;  3ZMZ A;  2GZW A;  2A61 A;  2K27 A;  1SMT A;  2KRF A;  2WTE A;  1IN4 A;  1DPU A;  3ROU A;  5JR3 A;  4KIG A;  3E5X A;  3OOP A;  4WXC A;  4YII A;  5E8I A;  4L9T A;  5HDK A;  4UNO A;  3WG9 A;  4P55 A;  1EV7 A;  2J5O A;  4EV0 A;  3GFM A;  3KCC A;  4G9Y A;  2LF8 A;  4CYD A;  2FNP A;  4EGZ A;  3M7G A;  1T6S A;  3CUQ B;  1FZP B;  5IT9 Z;  5ILU A;  1O3R A;  1XSD A;  3T0Y A;  5D4R A;  3EUH A;  4LG0 B;  2L4M A;  4M9Z A;  1TNS A;  2ADU A;  1ZLJ A;  4I01 A;  3I64 A;  2DLL A;  1SD7 A;  5TJJ A;  3R4K A;  4BQA A;  3GF2 A;  4RAY A;  3GW2 A;  2HQR A;  4CGZ A;  3VEP A;  1O57 A;  5FD6 A;  3FMQ A;  1HW5 A;  3KLN A;  1IRG A;  3ECO A;  1BBY A;  4NHJ A;  3ZMT A;  4I0A A;  1HBX G;  2P5K A;  3E3V A;  4PDK A;  4DNC A;  4FX4 A;  1ZN2 A;  2O6G E;  2CFX A;  5F1R A;  3HHG A;  5D5U B;  4KIC A;  2H27 A;  2VBW A;  4NQW A;  3CDH A;  4MHG A;  2RC4 A;  4F7Z A;  3KE2 A;  3MZY A;  1K6O A;  2XAG A;  4G7O F;  1D5V A;  1DPR A;  2G7U A;  2JPC A;  3IRR A;  4PZJ A;  4XSX F;  2EV5 A;  2A6H F;  1LQ1 A;  1LDJ A;  4B09 A;  1OKR A;  2FF4 A;  4S04 A;  4ENJ A;  1ON1 A;  2EFW A;  1KU7 A;  1IN6 A;  3KP6 A;  2XKO A;  4Q4Z F;  1B1B A;  5E1Z B;  2XAQ A;  4I09 A;  3HRT A;  1CGP A;  2P6S A;  1IN7 A;  4LFU A;  4CZZ A;  3BJA A;  6PAX A;  1J0R A;  3WOD F;  5CYV A;  3TKY A;  4GYI A;  3MZH A;  5HDG A;  1DUX C;  1KYZ A;  5CVJ A;  3H3U A;  3FM5 A;  2CQK A;  1LJ9 A;  4Y15 A;  5E1X A;  5CVU A;  3DPT A;  1XMK A;  2VON A;  3W6K B;  4B8X A;  3CTA A;  5IT3 A;  2UXX A;  4BHC A;  4IPA A;  1FY7 A;  5LEK A;  2G7H A;  3GZ6 A;  4HLX A;  3BZ6 A;  1F5T A;  3P9K A;  3Q9S A;  4AWX B;  3NQO A;  1MDM B;  1V4R A;  4UV9 A;  2ELH A;  3LWF A;  1HXD A;  5BPD A;  1TQI A;  4RB1 A;  2RQP A;  1XDS A;  2M5W A;  3TO7 A;  3DP7 A;  1SFX A;  1UHW A;  1ZLK A;  1SD5 A;  4XLN F;  3JSO A;  1SMY F;  2RV8 A;  2F2E A;  3HTU A;  2PI0 A;  1ZAO A;  4OMZ A;  4LG0 A;  4EM2 A;  3R6S A;  5DDG A;  4HZF A;  2DQR A;  2FML A;  3ECH A;  4GYG A;  4UHT A;  4G7H F;  1B9N A;  3JSP A;  1ONV A;  1ZAR A;  2AXL A;  4P96 A;  1LEB A;  2QVO A;  3BJO A;  1MJB A;  5D5W B;  2GAU A;  3V8L A;  1P6R A;  3VB2 A;  1YO5 C;  5ILS A;  4Z2Y A;  3MAJ A;  2M8E A;  3CLO A;  1U3E M;  3ZN1 A;  3KZY A;  5K1Y A;  3PQK A;  2OAZ A;  2XAH A;  2TDX A;  2DT5 A;  3GUD A;  1F1Z A;  4N0B A;  1V3F A;  3TO9 A;  4OU0 A;  1KQ9 A;  2FA5 A;  2YX4 A;  2JTV A;  4RS8 A;  4HX8 A;  4P9U A;  3TOB A;  1FLI A;  4ENN A;  2WC2 A;  2V1X A;  3V7S A;  1YFH A;  3BY6 A;  1YYV A;  1XB4 A;  4UUV A;  4ASN A;  5CVI A;  3FMS A;  4XLP F;  3F3X A;  2EK5 A;  2EFP A;  4Q5S F;  2XAJ A;  4ESB A;  5HVQ C;  2E1C A;  2GXB A;  2MA3 A;  5J8C A;  2EV6 A;  2HEO A;  1KU3 A;  2NAZ A;  4GXO A;  1Y0U A;  1ON2 A;  3U9G A;  3ZMD A;  1EH6 A;  2DO7 A;  3K0L A;  3JTH A;  2CW0 F;  4MTD A;  3J81 K;  3RPQ A;  3F23 A;  4PGG A;  4KN7 X;  5DYM A;  1H0M A;  3WE3 A;  5LLQ A;  2HTS A;  1O7L A;  4KN4 X;  1SAX A;  1XSV A;  4HW0 A;  5ICE A;  4MEX F;  4A0Z A;  3O2P E;  2P4W A;  4OIR F;  3J80 Z;  1O3S A;  2DK8 A;  4R1H A;  5E1W A;  5BMZ A;  2XVC A;  4LB5 A;  4Y17 A;  1STZ A;  1QQI A;  1T2K A;  2FNA A;  2JSC A;  1IXS B;  4LMY A;  4BNC A;  1XN7 A;  1YS6 A;  4OOI A;  1HW2 A;  3V8J A;  1J7K A;  1W4M A;  4R79 A;  5HLH A;  5HS9 A;  2Q2E A;  3K2Z A;  4HV5 A;  1FNN A;  1R1U A;  1RUO A;  2H09 A;  5BOX A;  1U5T B;  3KLO A;  1UST A;  2J5P A;  3C18 A;  2FU4 A;  4GCV A;  1H9G A;  1MJ9 A;  2IVM A;  3QU3 A;  1ZG5 A;  2L4A A;  3E6B A;  2YX7 A;  4HF1 A;  4AD9 A;  3M9A A;  3LAJ A;  2HOE A;  3W6J B;  1CF7 A;  2FMY A;  4U0W A;  2PG4 A;  3SFZ A;  1U2W A;  3BPV A;  3EYI A;  3EYY A;  5AON A;  4PGH A;  2C6Y A;  2QYO A;  3QP5 A;  2ZNY A;  4U0Y A;  1RNL A;  4I02 A;  3CO7 C;  3LA2 A;  3K9T A;  1LEA A;  2EWN A;  4L5J A;  1SD4 A;  4CDG A;  5BQT A;  4M73 A;  2QWW A;  3GXO A;  2LSO A;  1P4X A;  4KIB A;  1J75 A;  4A6D A;  5ED4 A;  4KMF A;  1IRF A;  3HOS A;  2VOO A;  3FHZ A;  4EVI A;  1QPM A;  3MFK A;  1TBX A;  1ZGA A;  4MQV A;  2DU9 A;  1A04 A;  2E1N A;  5EEH A;  5HLI A;  4CO8 A;  2PN6 A;  2M30 A;  5DUK A;  3IKV A;  2YR2 A;  1BIB A;  2XKP A;  2VN2 A;  3COA C;  1X3U A;  4RGU A;  4RGR A;  4FX0 A;  2EFN A;  1R00 A;  3RKY A;  5JHU A;  5DCM A;  1B4A A;  3HSR A;  2HKO A;  2KJC A;  1TTY A;  3U2R A;  1K78 B;  4HX7 A;  1BI3 A;  4JK1 X;  1ZRE A;  1K7A A;  4RGS A;  4BAY A;  1I27 A;  3EQL F;  1FP1 D;  2XRN A;  3GFL A;  1IXC A;  2CYY A;  2ZCW A;  3M1E A;  3BP8 A;  4A12 A;  2FBH A;  2QQ9 A;  3ABT A;  4YFX F;  1C0W A;  1LB2 A;  4XBF A;  1Z91 A;  3DKW A;  2IA0 A;  4GGG A;  2BGC A;  5LHH A;  3E97 A;  2PBI A;  4A0Y A;  1J9I A;  2QBY B;  3FZV A;  4WK8 F;  1EH7 A;  2FEZ A;  1FSE A;  3VFZ A;  4IHT A;  3K1P A;  2EJR A;  3AAF A;  2ZME A;  3SZP A;  2ISY A;  3WGI A;  3GWZ A;  3DEU A;  1LDK B;  2YPR A;  3QPH A;  2HYG D;  2P7C B;  1YW7 A;  2GWR A;  3E5U A;  3EDP A;  2BYV E;  1R58 A;  2LDU A;  1YTY A;  2A6E F;  3HSE A;  2ZBK A;  3KFW X;  5LRR A;  3O6B B;  1HSJ A;  1BC8 C;  2QLZ A;  4KDP A;  3I53 A;  2P6T A;  3CUO A;  4KIF A;  3KZZ A;  2O3F A;  3F8C A;  3FX3 A;  4U7D A;  1WI9 A;  4KNY A;  3D0S A;  2ZKZ A;  2IT0 A;  2RNJ A;  1PDN C;  2XAF A;  3MWM A;  5L3G A;  2KIM A;  1P2F A;  2D1V A;  2JPB A;  3HTS B;  2OZ6 A;  3DPL C;  5JI6 A;  3RPU A;  3KET A;  1BI2 A;  3JAM Z;  4KT5 C;  5IT9 K;  3LFK A;  3C7J A;  3RYR A;  2H94 A;  2BBY A;  2MD5 A;  3LST A;  4BH9 A;  3JAM K;  3ULQ B;  1B9M A;  1TW3 A;  2V1D A;  2F5C A;  1JHF A;  2IA1 A;  4YFN F;  4G94 A;  4YG2 F;  3L2C A;  1PP7 U;  4IRI A;  1PP8 F;  1ODD A;  5CJ9 A;  4E70 A;  2VOP A;  3Q9V A;  4EGY A;  2DBB A;  4DQ2 A;  4IHS A;  1G3T A;  1QZZ A;  3H3Z A;  5DUI A;  2UZK A;  3G3Z A;  4Q48 A;  2O61 A;  3FXR A;  3U1D A;  4HX4 A;  1R1T A;  3L09 A;  3S2W A;  1P4A A;  2DPU A;  5FO5 A;  3WTZ A;  3RIR A;  3I59 B;  1MD0 A;  2V6C A;  3N4M A;  2NS0 A;  1TQP A;  2QQB A;  1USS A;  4RB0 A;  4I2O A;  1TNT A;  1E17 A;  3KEO A;  5K5O A;  4MGR A;  4HLY A;  5LHG A;  1H9T A;  1W7P D;  2FRH A;  5D8L B;  2NNY A;  2COM A;  1UHM A;  2M87 A;  4HQE A;  1B59 A;  2R3S A;  3F6V A;  1UCR A;  1IN8 A;  1S7O A;  3IWZ A;  2QBY A;  3QP6 A;  3DXJ F;  4WXD A;  3RKW A;  3EET A;  2L3D A;  2DQL A;  1OYW A;  3HUG A;  3WTT C;  2A5Y B;  2QEN A;  2QZ8 A;  3TDU C;  4AIH A;  1BI0 A;  1HKS A;  1JE8 A;  3K69 A;  1REP C;  4CHU A;  4G6D A;  4FT8 A;  1G3Y A;  3KP3 A;  5L3D A;  1BN5 A;  2FQ3 A;  2OQR A;  1T98 A;  3LQQ A;  3FMR A;  4IRH A;  3V7R A;  3FWE A;  4M9X A;  4L0Z B;  5DEQ A;  4L18 B;  1G3W A;  1KQ0 A;  3REO A;  3V7C A;  5A2Q Z;  5KVR A;  4ZYG A;  1U6G A;  4QLC U;  4EM0 B;  2VBX A;  2HFH A;  1B6A A;  3CO6 C;  3MCZ A;  3T1B A;  4HDV A;  3GFJ A;  3IKT A;  2XHK A;  4M9S A;  2Y48 A;  1BJA A;  4JBA A;  3RKX A;  5F64 A;  4ZYH A;  5L3E A;  5D4S A;  1LNW A;  3GO5 A;  4ESJ A;  1TQM A;  1UB9 A;  2F5E A;  5LBQ A;  3GEZ A;  5CVV A;  5LGN A;  3F72 A;  5ILV A;  4LJZ F;  4AIJ A;  2DAO A;  1J59 A;  4MEY F;  2YSR A;  1D3Y A;  4EJT A;  1XGO A;  1F9N A;  3PFI A;  3ZQ7 A;  4I98 B;  1P92 A;  2DK5 A;  4O3M A;  3CUQ A;  2MLG A;  3RTR A;  1OR7 A;  2QM3 A;  2HKX A;  3HRU A;  2RDP A;  1YIO A;  4I7H A;  1IW7 F;  1FT9 A;  1RZ4 A;  3ISP A;  3R61 A;  2DW4 A;  4HQM A;  5E8G A;  1Q1H A;  1WQ2 A;  4ZYE A;  3LA7 A;  1U5T A;  4I0B A;  1XCB A;  2KIF A;  4LK1 F;  1W7P A;  2GQQ A;  3WTS C;  1R22 A;  4A2U A;  1D8J A;  4LLL A;  4WX9 A;  4P9F A;  2XGX A;  5D5X B;  3F8F A;  4HYE A;  4U0V A;  3BDD A;  1BC7 C;  2NYX A;  4O6J A;  1KQ8 A;  5CLS A;  2VC0 A;  3RYP A;  3GVA A;  4ENM A;  4M71 A;  4AIK A;  5AIP A;  4XRF A;  2OBP A;  2LKP A;  3E6M A;  3R60 A;  1J2X A;  4HOB A;  2JRT A;  1MZB A;  2RGV A;  2CG4 A;  1K78 A;  1FBS A;  5H6R A;  4BYY A;  3L7W A;  5D5V B;  3DQV C;  3WU1 B;  4QWQ A;  5DCM B;  1O3T A;  5FFZ A;  4CIC A;  3ML6 A;  4KMU X;  3F8M A;  4EJW A;  4A5N A;  4ESF A;  1S7A A;  1Z1D A;  1OMI A;  1P4W A;  3WTY C;  2K86 A;  4UVC A;  4OIQ F;  4UXN A;  2HQN A;  2Q8K A;  5K5Q A;  4Q47 A;  1KU9 A;  4HV6 A;  1VTN C;  1XD7 A;  1I5Z A;  2VBZ A;  1U78 A;  5FGM A;  4HBL A;  1G3S A;  2XIG A;  3KEQ A;  1FP2 A;  1ZH5 A;  1TLH B;  1WSU A;  3RI4 A;  2V1U A;  3E6D A;  1HW1 A;  5FLX K;  4M74 A;  2UWM A;  5BS6 A;  4ETS A;  3WTU C;  4O5V A;  4S05 A;  1QGP A;  3KP7 A;  2CWE A;  2VT2 A;  4ZH4 F;  1OYI A;  4LLN A;  3TOA A;  4K2E A;  1I1G A;  4ENK A;  3O3K A;  5LHI A;  3GZ5 A;  1YS7 A;  3L00 A;  3I54 A;  2VBY A;  1R5H A;  2LF7 A;  1FC3 A;  5KK1 A;  3TO6 A;  4LD5 A;  3DFG A;  1FPQ A;  3ZMV A;  3B73 A;  4NB5 A;  1KYW A;  4UV8 A;  1FOK A;  5TRD A;  5E20 A;  1IN5 A;  4IJA A;  1Z6T A;  2CSO A;  3IL2 A;  4EM1 A;  2HZT A;  3RJP A;  3BRO A;  2OU2 A;  2STW A;  1G4D A;  1W5T A;  2OZU A;  5J8F A;  2EV0 A;  2PEX A;  3T5X A;  4BHB A;  1KU2 A;  3ZPL A;  5LGT A;  4HF0 A;  2EA2 A;  1OPC A;  5JVT A;  1FYL A;  3WE2 A;  2IA2 A;  1E2X A;  1R5G A;  1IF1 A;  2GXG A;  2DFI A;  1LDD A;  2G9W A;  1SFU A;  1QBJ A;  2HS5 A;  2YU3 A;  2STT A;  5HDN A;  5E17 F;  4PCQ A;  1I1S A;  3J81 Z;  1BIA A;  2RKH A;  3OV8 A;  1G6N A;  1JXS A;  1NHA A;  3N97 A;  2QUF A;  2Y0M A;  5DD4 A;  3SHF A;  1XDU A;  3T8T A;  1U8R A;  3FF5 A;  2V79 A;  5EEG A;  2EB7 A;  2PQ8 A;  1RI7 A;  2XRO A;  3HSF A;  1Z9C A;  1ZG3 A;  2UXN A;  5ERI A;  2VE8 A;  2HGC A;  3QRF F;  5L3F A;  3DF8 A;  2ESN A;  2BE5 F;  3ERE D;  2FSW A;  4FHT A;  4BXU A;  1ZHF A;  3C1D A;  4A5M A;  1HKT A;  2FBK A;  4ZZD A;  2W84 A;  4RAZ A;  2F5D A;  4IRG A;  5DV5 A;  3HRM A;  4WXH A;  4CXF A;  1ULY A;  2DPD A;  3QPT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...