5CYVA

Crystal structure of cour from rhodococcus jostii rha1 bound to p-coumaroyl-coa
Total Genus 48
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
48
sequence length
143
structure length
138
Chain Sequence
SQALSDDIGFLLSRVGGMVLGAVNKALVPTGLRVRSYSVLVLACEQAEGVNQRGVAATMGLDPSQIVGLVDELEERGLVVRTLRNKLIAATEEGRRLRDDAKARVDAAHGRYFEGIPDTVVNQMRDTLQSIAFPTFVE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional regulator
publication title The activity of CouR, a MarR family transcriptional regulator, is modulated through a novel molecular mechanism.
pubmed doi rcsb
source organism Rhodococcus jostii (strain rha1)
molecule tags Transcriptional regulator
total genus 48
structure length 138
sequence length 143
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-07-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5cyvA00
4HF1A 2DK8A 4RAYA 3JTGA 3GWZA 3K9TA 1JHHA 1S3JA 4L5JA 2PJPA 3T0YA 1T6SA 2FQ3A 4XSXF 4ZZDA 2V79A 2DPDA 3F8FA 4QWQA 4P96A 3QPHA 5D5VB 1L0OC 3QRFF 2L02A 3GO5A 3WGIA 3QU3A 1B9NA 3W6KB 1R23A 4KIGA 5L3BA 1WRJA 4BH9A 1OYWA 4OIRF 1BI2A 1I5ZA 2FSWA 1XD7A 5LEKA 4FX0A 1YW7A 2MBFA 1UCRA 3G3ZA 5ICFA 4M9XA 3HRTA 1U2WA 1Z7UA 4M73A 2QBYA 1A04A 2HS5A 2WWYA 3H3ZA 1DUXC 2A6HF 2L4AA 3DKWA 3KEOA 2HTJA 3E6DA 4CHUA 2ACJA 2CW0F 3DEUA 5ED4A 3D5LA 1XCBA 4A5NA 5HS7A 1G3WA 1BIBA 2XRNA 4IRIA 3M7GA 3WGHA 3CO7C 4EM0B 2E7WA 3K0LA 5DDGA 4JQFA 2D1HA 2HOEA 3GFJA 1LQ1A 5K1YA 2PLYA 3V8JA 3RJPA 1ZYRF 4HV6A 1SD7A 4YFKF 3JSOA 4HDVA 3F6VA 2E1NA 3GX4X 2Q2EA 5IT3A 4K2EA 4U0WA 4WXHA 2ZJ2A 3E6MA 3C7JA 5H6QA 3I0TA 4XRFA 2ZNZA 3GFMA 4HV5A 1BI1A 4MTDA 1REPC 1FNNA 5FFZA 3T8RA 3KP6A 5J6XA 1RIOH 1DPUA 3LA7A 5DYMA 2J5PA 1BI0A 1FYMA 2HKOA 1R1VA 3QP6A 4I02A 3MQ0A 2FU4A 5H6RA 1IN5A 3MEXA 1FYLA 1G6NA 5E1XA 3EUHA 3QPTA 5CVRA 2BV6A 5DD4A 2FMYA 2M30A 1D5VA 1KU2A 1T38A 1ZRDA 1K7AA 1P92A 1QPMA 3ML6A 2FNAA 1S6LA 5DCMA 2XAHA 1UFMA 3ERED 2CSOA 1F5TA 2DBBA 3GEZA 1TQIA 5EEHA 1O57A 4Y15A 2IW5A 1USTA 3HHGA 5FD5A 2VE8A 2L4MA 2Y0MA 5ICEA 2RQPA 5D6FA 2GA2A 2YX7A 1XSVA 1W5TA 3KEQA 2EFWA 1FP2A 3L00A 4Q47A 3R0AA 4HOBA 1ZH5A 5DCMB 4CGZA 4HF0A 2VBZA 1SMYF 3CJNA 1IN6A 2RDPA 2LNBA 4LB5A 5E1ZB 6PAXA 1XGNA 2MLKA 1IZ1A 2F5EA 1H0MA 2OZ6A 5JHUA 3RKXA 2G7HA 2UZKA 3FF5A 4L0YB 3IC7A 2DTRA 3WTUC 1V4RA 2XHKA 4G7OF 1R22A 1R1UA 3W6JB 1O3SA 4HF2A 2DW4A 4I09A 2CQKA 1MD0A 3N4MA 3E5XA 2PG4A 3FMQA 3BP8A 3LWFA 3QP5A 2EFNA 1FSHA 4IF4A 3K1PA 1CGPA 1S7AA 3P9KA 5DEQA 4N9IA 3RDIA 3KZYA 4F7ZA 2NRAC 4HBLA 4WCGA 3O2PE 2MA3A 4IRGA 1HW2A 2K27A 1ZG5A 3U9GA 3FXQA 3B73A 1U8RA 3I5UA 1WSUA 3F23A 3GUDA 2HWVA 2A3SA 4A12A 2HEOA 3EYYA 2P7CB 1MDMA 3NQOA 2HYFA 4U88A 1SFUA 4XSZF 3SQNA 2EV0A 2QQAA 3ROUA 4YIFA 1LDKB 3L2CA 1HKSA 2GQQA 2K86A 3SZPA 4EM1A 3M1EA 5BS6A 1GHCA 2GXGA 2R7FA 3ZMUA 2BEOA 1D3YA 2ZNYA 3VEPA 3KCCA 1RI7A 4P9UA 3F3XA 5CYVA 2L01A 2DO7A 4IXAA 1XCVA 5LLQA 5E18F 1QZYA 1W4MA 4RAZA 1IN4A 4BXUA 3V8KA 4UXNA 3RKYA 4M6XA 1QQIA 4KIBA 2PFBA 1U5TA 1ZRFA 4GCVA 1B4AA 2EFOA 4AIKA 1BI3A 4L0ZB 4KT5C 2LF8A 1X3UA 2UWMA 2ZKZA 2M1BA 2FRHA 1Z05A 2DK5A 4MGRA 3T1BA 4R79A 3G73A 2IA0A 2ZXJA 2VE9A 4P5OA 4Q5SF 4I0AA 5JI6A 2V1DA 2PBIA 2VXZA 2KKOA 3WTTC 5ICGA 1UHMA 2CWEA 4HQEA 1U78A 2PEXA 3TDUC 4KN4X 3R6SA 3K69A 4HLYA 2QQBA 2E1CA 1XGSA 1BIAA 2EB7A 3QOPA 1GXQA 1RZ4A 1FBSA 4KNYA 2OD5A 2ZBKA 5AIPA 3CUQC 3TOAA 2XASA 4ZYDA 1YG2A 3ZQ7A 2O3FA 1XGMA 4AWXB 1FZPB 2TDXA 3ZMSA 1I1GA 4LLLA 5FLXZ 1TW2A 2DU9A 2H6BA 2RC4A 3JTHA 4U7BA 2EFQA 2BE5F 4N0BA 1FWZA 3FMSA 1TBXA 5HDNA 3ZP5A 1PUEE 1SD5A 2NNYA 4UV9A 2GA1A 2Z5UA 2D1VA 5D4RA 3P7NA 2A5YB 3GLXA 1NHAA 2CG4A 4RB0A 2P4WA 1AOYA 5BQTA 3F22A 2Z99A 4LB6B 1ONVA 1IXSB 1T0FA 4FHTA 2EJRA 1CF7A 2ADUA 2RVCA 3C18A 4ON0A 2HYGD 3P9IA 5A2QZ 2WV0A 5BOXA 2JT1A 3MCZA 1HBXG 1ZN2A 3WE2A 2GAUA 2JZYA 4I98B 4HYEA 3Q5FA 3FWEA 1IN7A 4OIQF 4L9TA 2WC2A 2M5WA 2V1UA 1O7FA 3V7RA 1J59A 3F8NA 3BJOA 1D8KA 5DV5A 3J80Z 3C3WA 4EJOA 1JE8A 4CZZA 1QO0D 5K5QA 3HOSA 4G6QA 1BJAA 2WTEA 1ZLJA 4BQAA 2LDUA 1K79A 4LK0F 2PI0A 5D5XB 1BOAA 2IP2A 4UVCA 1KA8A 2ESHA 3R61A 2HTSA 2IT0A 1ZG1A 2X0LA 1IRGA 3F21A 3QU6A 2IA2A 1PDNC 3LAJA 3MFKA 1YS7A 4KFCA 1SAXA 3M9AA 1IXRC 1LEAA 2GWRA 4NB5A 3GZ5A 3RYRA 2HZTA 2JTVA 3BY6A 3T8TA 4BHPA 3TQNA 1TQPA 1G3SA 3NEUA 2C6YA 5LGTA 4ETSA 3KLOA 2QYOA 4OMZA 2GXBA 1Z1DA 2DFIA 2K4BA 2CO5A 1LDDA 4KUMA 2QWWA 4B8XA 2BGCA 3E6BA 2CGPA 3U1DA 2K02A 1EV7A 4MTEA 3EETA 3KP3A 1LDJA 1XMKA 1YQAA 1YIOA 3ZPLA 3DV8A 4ENJA 5JVTA 5K5OA 2IRFG 1EH6A 2QBYB 5CVIA 5E8IA 4O3MA 5FFXA 3L09A 5LEJA 3I59A 3KP2A 2STWA 1FYKA 2LF7A 2NNNA 2OA4A 1Y0UA 4D0PA 3P9CA 2ETHA 1DPRA 5AONA 4OU0A 2ELHA 3M8EA 2QVOA 1TQMA 4U7DA 2R3SA 2XAFA 2COMA 4WXDA 5FLXK 3PQJA 3LQQA 3ZMZA 4MEYF 3HRUA 3JAMZ 5E1WA 3IWFA 3ABTA 4WX9A 4NQWA 3ZN0A 1FOKA 1XN7A 3F8MA 4ENMA 1PP7U 2Z9OA 4ZYHA 3IKTA 3LA2A 1IN8A 1OR7A 1QZZA 1BBYA 2Z33A 1TTYA 4MQ9F 2ZFWA 2F5DA 4O5VA 5DCFA 3FM3A 3H3UA 4RGUA 2XGXA 1R7JA 2KRFA 2FBIA 4EQQA 3IKVA 5A2QK 2KIFA 1W7PA 3FXUA 3JW4A 1ZGAA 2RKHA 4I2OA 3OV8A 3HRSA 1B59A 4IVNA 1KYZA 4L18B 1TNTA 4S04A 3BPXA 3DPTA 2DPUA 2YU3A 3E6CC 4RS8A 4G6DA 3TO9A 2FXAA 2P5KA 3F8CA 3TO6A 3SXYA 3KP7A 5LRSA 4G8XA 5TRDA 3J80K 4HQMA 1YLFA 4KDPA 1G4DA 1UB9A 1I27A 2L3DA 4PDKA 4LD5A 1HQCA 1QNTA 1MGTA 4MHGA 3EQLF 2IVMA 2P6SA 2IA1A 2EK5A 2EFPA 1FC3A 3E3VA 1Q1HA 3ZMVA 2F5CA 5D8LB 2P5VA 4CO8A 2F2EA 1WWXA 3KLNA 2Y75A 3MZYA 5CLSA 4KN7X 4EV0A 5D5WB 3HSFA 4MQVA 4R8HA 2RNJA 1C0WA 3ZN1A 3I54A 2IPQX 2VT2A 1ODDA 4NHJA 2A6EF 3U2RA 5IT9Z 4AIJA 3FZVA 3V4GA 2XROA 4IHTA 2OBPA 1ON1A 5HLIA 4FX4A 2O6GE 2GIVA 1XSXA 1MKMA 4H0EA 5JR3A 3KE2A 4CYDA 5LBQA 4YFNF 5BPDA 3J7AO 1KGSA 2KJCA 2M8EA 3R4KA 1OYIA 2A61A 3NRVA 1F1ZA 3HTSB 2V6CA 3AAFA 4G7ZF 1LVAA 4XLPF 3ULQB 5ILSA 2AS5F 4LG0A 4EJUA 2A68F 3C1DA 4LMYA 3GVAA 1K78A 1IW7F 3MWMA 4ZH4F 1H9TA 4CDGA 1DP7P 4EJVA 5F6FA 3RKWA 5HS9A 3OOPA 1LNWA 3DF8A 2HR3A 1MDMB 2HFHA 4IPAA 2CFXA 4PZJA 1ZGJA 1R36A 1FX7A 5CJ9A 3JAMK 1F9NA 2QUFA 1H9GA 5ICCA 1R1TA 1D8JA 3BPVA 5J8CA 4HX4A 3CDHA 4I01A 1LEBA 4ZYEA 4ZYGA 3RTRA 2W24A 2MD5A 1ZLKA 4LG0B 2LKPA 1XDUA 5K5RA 4G7HF 4AVPA 4WF2A 2W25A 4YG2F 2W57A 1P2FA 1SD4A 5J8FA 3I64A 4EM2A 1OMIA 4BAYA 5FGMA 2VONA 2OU2A 5D6EA 1KYWA 1LJ9A 3F8BA 3MAJA 1FP1D 1OKRA 2VOOA 1RUOA 3R60A 5FB2A 3WU0A 1U5TB 2H6CA 2D45A 4EGZA 4UVBA 1P4WA 3LA3A 5CVVA 3COAC 2XV4S 4LFUA 3WTXC 5KK1A 2QQ9A 1YW8A 2GZWA 3PQKA 1S7OA 3IL2A 1IRFA 3GF2A 3M8FA 2Z3YA 4IRHA 4HX7A 3O6BB 2ZMEA 2MC3A 4ESJA 4M6YA 1ULYA 1QGPA 3E5UA 4ZZLA 3N97A 1XB4A 4FT8A 4OINF 3L9FA 3L7WA 1TW3A 5LGUA 1FSEA 2NYXA 1YTYA 2VC1A 3BROA 3I71A 4UNOA 2RGVA 2W84A 5D4SA 1Z91A 3CO6C 4ESBA 4LGWA 1YYVA 4A2UA 3JSPA 4AD9A 2FF4A 4A0ZA 5F1RA 2O03A 3RPUA 1U5TC 3WU1B 1ZG3A 3WTSC 3ABUA 1JHFA 1ON2A 2ZMEB 1I6XA 1YFHA 4EGYA 2KJBA 4WK8F 2ISYA 1STZA 1S29A 2H27A 2A07F 3GFIA 1KU3A 1J2XA 3GXOA 4A6DA 3EYIA 2ZCWA 4KMFA 1JXSA 3D0SA 3WTWC 2P8TA 4PGGA 5IT9K 5ERIA 4XBFA 2J5OA 4GYGA 1MJ9A 1KQ8A 4M74A 2PMHA 2FE3A 4N9HA 5FD6A 1CF7B 2STTA 1QBJA 1KU9A 5D8KB 1S8NA 2ZO4A 3CTAA 4KYWA 5ILUA 2MLGA 3I58A 1Z9CA 3E97A 2VBYA 4EJWA 2O0YA 4P55A 5DUIA 1WKMA 2FMLA 2FNPA 2P6TA 1EH7A 4UV8A 4U0VA 1MJAA 4EJTA 5HLGA 3DQVC 1FPQA 4KICA 3BOQA 4HA8A 1JGSA 2OQRA 4MEXF 3DXJF 3I4PA 2HDCA 1TLHB 3LFKA 3ISPA 1K6OA 2YSRA 3TKYA 4JK1X 2V1XA 2YR2A 5HOOA 4AIHA 1F4KA 2OAZA 5HDGA 1UHWA 2XAJA 1GVJA 2Q0OA 4Q4ZF 4KMUX 3FMRA 2KIUA 5H20A 5F64A 1DDNA 3RYPA 1BC7C 1P4AA 4PGHA 2EWNA 3TO7A 1U6GA 1E2XA 2H09A 4LLGF 5FO5A 1O3TA 4BNCA 3LSTA 3BWGA 3WTVC 3DP7A 3VB2A 3J81Z 3ZMTA 2OZUA 3WODF 3TDZC 2HKXA 3SHFA 5HDKA 4DQ2A 1MZBA 3BZ6A 3VODA 4JBAA 1R00A 1HKTA 4Z2YA 4WXCA 1G3YA 1YS6A 2G9WA 2VN2A 1I1SA 4YIIA 2NS0A 1HSJA 5HLHA 2MH2A 4RB2C 2Y48A 2VT3A 5CVUA 2O8XA 2BBYA 2IJLA 3BDDA 4R1HA 3MZHA 2JPBA 3ECHA 5EEGA 2K7LA 3I59B 5LHGA 1ZREA 1FY7A 1V3FA 2ISZA 4LK1F 1J0RA 2JSCA 2Q8KA 2FEZA 3WE3A 2QZ8A 1MJBA 2DQLA 4RGRA 3WGGA 5HS8A 2HQNA 2DLLA 2VC0A 3H92A 1XSDA 3Q9SA 5AIQA 1T39A 4EMSA 3WG9A 3QAHA 1IUYA 3HSRA 2EA2A 3REOA 2V9VA 1XMAA 2XAGA 4M9SA 2E7XA 2PMUA 4HLXA 1P6RA 1SD6A 4RB3C 3ECOA 3ELKA 4A0YA 1J7KA 3RIRA 4HAMA 4YFXF 3KFWX 1XGOA 3B02A 1B9MA 1VTNC 3GZ6A 2VODA 2XIGA 2B0LA 1E17A 1RUNA 4KIFA 3VOEA 3CLOA 2XKPA 1W7PB 1J9IA 4OIPF 2AXLA 4S05A 1BM9A 5DUKA 2QLZA 4BHCA 1GXPA 2BYVE 1J5YA 2PQ8A 1BN5A 2JPCA 5KVRA 3FX3A 2D2WA 2DQRA 2VOPA 4CICA 2UXXA 2UXNA 3ZMDA 2EA4A 3BJ6A 3TOBA 1ZRCA 3BJAA 2R7DA 2VBWA 1HW5A 4BHBA 1P4XA 4RGXA 4DNCA 1IXCA 4CXFA 2O61A 3HUGA 5LHHA 3V7CA 2RV8A 4EVIA 2QENA 4G9YA 4U0YA 4ESFA 2PN6A 4LJZF 3LQRA 5E8GA 3IWZA 4Y13A 2X4HA 2L54A 4OOIA 2YPRA 4UHTA 1XDSA 5D5UB 4HW0A 5L3DA 1R58A 1YW9A 3HHHA 1R5HA 3KP4A 1B6AA 2F5FA 5DD8A 1SMTA 2QM3A 1RNLA 5L3EA 3KETA 3S2WA 1WQ2A 5LGNA 2XAQA 4XLNF 2DAOA 2KIMA 4E70A 3K1MA 5BMZA 1Z6TA 1FT9A 4P9FA 4OIOF 4M71A 4GYIA 1OYYA 3RPQA 3J81K 3O3KA 3CUQA 3IRRA 4O6JA 4IJAA 1ZARA 3KP5A 1G3TA 1W5SA 1R5GA 4I7HA 3SFZA 2G7UA 2RN7A 1HSTA 5ILVA 1J75A 2M87A 1FBUA 1O7LA 5TJJA 5L3GA 1ZAOA 2CYYA 1FBQA 2HQRA 4UVAA 5L3CA 4WWCA 4KA4A 2W85A 2FA5A 1KQ9A 3F72A 1O3RA 3CUQB 1K78B 3FHZA 3HSEA 4M9ZA 4QLCU 1HXDA 3VFZA 4G94A 4UUVA 2FBKA 4HX8A 2XKOA 1FLIA 2A69F 3SZTA 3V8LA 2OQGA 3KZZA 3HIFA 4ENNA 2FBHA 3E5QA 1TNSA 1WI9A 3V7SA 3TGNA 3R0JA 4PCQA 4A0XA 4HDUA 2LSOA 3T5XA 4RGSA 3LAPA 4GO1A 3F6OA 3HOTA 1KQ0A 4M72A 1OPCA 5LHIA 3DPLC 2MH9A 2NAZA 3I53A 4GXOA 3GFLA 2DT5A 4I0BA 2ESNA 5CVJA 3FM5A 2EV6A 4HZFA 2XVCA 3K1NA 4L5IA 1HKQA 1B1BA 1AWCA 3K2ZA 4RB1A 2YX4A 5E20A 4BYYA 4OMYA 2EV5A 3GW2A 3HTUA 1T98A 2HGCA 5LRRA 1YO5C 4TV7A 2XUBA 4L9VA 1Z6RA 1ZHFA 3IRQA 4LLNA 4Q48A 2P5LC 2VBXA 1KU7A 4A6EA 1USSA 3FXRA 3IHUA 2P7VB 3HRMA 4MNUA 3HYIA 4ASNA 2JRTA 1IAWA 3CUOA 5BPIA 3WTZA 4A5MA 3PFIA 1W7PD 1IF1A 5L3FA 4GGGA 1EH8A 4L9JA 4L9NA 4B09A 5E17F 2M45A 1L3LA 2K4JA 5HVQC 4IHSA 3GYHX 1LB2A 1U3EM 3DFGA 1BC8C 2DI3A 2H94A 3EDPA 1HW1A 3Q9VA 1O3QA 1PP8F 4ENKA 4Y17A 1SFXA 3RI4A 3WTYC 2FOKA 5JFRA 1T2KA 1SFEA
chains in the Genus database with same CATH superfamily
4HF1A 2DK8A 2ZMEC 4RAYA 3HOVJ 3JTGA 1VQKI 3L2WA 2NVXJ 2ELKA 3GWZA 1WZ2A 4XRSA 1YJNI 1BL0A 3JRBA 2EZHA 3K9TA 4XQFA 4CCMA 4AM3A 1JHHA 1S3JA 5IYCJ 4L5JA 4CCKA 2PJPA 2V4JC 3T0YA 1T6SA 1VI0A 1K4TA 2FQ3A 4UB6C 4BE0A 1ITYA 1YRNB 4XSXF 4ZZDA 5C3EJ 3CMMA 4N4OB 1W36C 2V79A 1Y0NA 2DPDA 3KIOA 2XAUA 3F8FA 4QWQA 5F0CA 1E3HA 4P96A 4B47A 3QPHA 5D5VB 1FOXA 1X1DA 1L0OC 2K9LA 3QRFF 1T0FC 2L02A 4B48A 3GO5A 3WGIA 2K3FA 3QU3A 5FRMA 1B9NA 4C2TA 3W6KB 3SZGA 1R23A 5GTIC 4KIGA 2EBIA 2LY1A 3HC7A 4JP0A 3K4BA 5L3BA 1WRJA 4BH9A 3CC7I 1OYWA 2K85A 2XF7A 1WH7A 5HODA 1YJWI 4OIRF 1BI2A 1I5ZA 2EIJH 2FSWA 1ACIA 3ABMH 3S1MJ 2L7KA 1XD7A 3KYCB 2D5VA 5LEKA 4FX0A 1YW7A 2MBFA 1UCRA 1X1BA 3G3ZA 5ICFA 4M9XA 3HRTA 1U2WA 2DTZA 2HOTA 1Z7UA 1TC3C 4DYQA 1E3OC 4BACA 4M73A 1PYVA 2QBYA 1A04A 2HS5A 2I8DA 1IRZA 4UB8C 1MBKA 3H3ZA 2WWYA 4A3FJ 4N4NB 3AG3H 2A6HF 1DUXC 2MG4A 3ZGKA 1MMSA 2L4AA 3DKWA 3KEOA 1TZLA 2HTJA 2VKVA 3E6DA 1HLVA 4CHUA 1RKTA 2ACJA 2CW0F 3G71I 3HOZJ 3DEUA 5ED4A 1ZR2A 2M2EA 3D5LA 3G1LA 1XCBA 5GPCA 1N25A 4A5NA 5HS7A 4BS9A 1FIPA 1G3WA 1FTZA 1BIBA 2XGCA 1DU6A 2XRNA 4IRIA 3M7GA 3WGHA 3CO7C 4Y7NJ 2BY2A 4D1QA 4EM0B 2E7WA 3K0LA 2ZJRF 5DDGA 5GADJ 4JQFA 1SFKA 2D1HA 2HOEA 3GFJA 1G2HA 3BZCA 1LQ1A 5K1YA 2PLYA 1Z3YA 3V8JA 3RJPA 1ZYRF 4HV6A 1SD7A 3CMAI 4YFKF 3JSOA 4HDVA 4ZDLA 3F6VA 1WJBA 2E1NA 3GX4X 1WJFA 2Q2EA 2DOFA 4MO7A 5IT3A 4K2EA 4U0WA 4WXHA 2R92J 1OCTC 2ZJ2A 3A4CA 3E6MA 5FKOA 3C7JA 5H6QA 4A3KJ 3I0TA 4XRFA 1RR8C 1YIJI 3RCOA 2ZNZA 3GFMA 4HV5A 1BI1A 3CJQB 4MTDA 4E7KA 2FOWA 4B43A 1REPC 1FNNA 4HG2A 1DP3A 5CKTA 5FFZA 3T8RA 3KP6A 5J6XA 2L2OA 3JRCA 1RIOH 1DPUA 3LA7A 2COBA 5DYMA 2J5PA 1XG1A 3I4MJ 1BI0A 1FYMA 2HKOA 1R1VA 2W48A 1HDPA 3QP6A 4I02A 3MQ0A 3OYNA 2OUMA 2BHZA 2L9RA 1IO2A 2XGEA 2CV1A 3OWTA 2FU4A 4MFEA 5H6RA 1IN5A 2IBDA 3MEXA 1MH4A 2Y30A 1FYLA 2E71A 2DJIA 2WY7Q 3BC8A 1G6NA 5E1XA 3K6GA 4AU7A 3EUHA 3QPTA 5CVRA 2BV6A 1ETKA 5DD4A 3OL3A 1X3ZB 4FCYA 5HNFA 3W2AA 2FMYA 4CA0A 1VQMI 3OL4A 4XN0A 2M30A 3DCFA 1D5VA 1KU2A 1T38A 1ZRDA 1K7AA 1P92A 1QPMA 3ML6A 2FNAA 1S6LA 3DTIA 5DCMA 3KZIC 2ICWG 2XAHA 1I50J 5IYDJ 1UFMA 3H3VK 2E1OA 3ERED 2CSOA 1F5TA 2DBBA 1BR2A 3GEZA 1TQIA 3H5AA 5EEHA 5FKKA 1O57A 3K4NA 3ONQA 1PUFB 3DKXA 3GTLJ 3PUFA 4A3MJ 4Y15A 2IW5A 1USTA 2QGUA 3HHGA 3HGGA 2VE8A 2XRLA 3O8GA 5FD5A 2L4MA 2Y0MA 5ICEA 2W7NA 2RQPA 2NVYJ 3HL2A 5D6FA 2GA2A 2NXNB 5EG0B 2YX7A 1XSVA 4E7IA 3OMYA 4UY8I 3HPHA 3J7AY 4PUSA 2Y69H 3S1QJ 1W5TA 1N78A 4M3EA 4XKVA 1LFBA 3DKYA 3KEQA 3PO3J 2EFWA 1FP2A 2CFOA 4BXXJ 3L00A 1S9HA 1Z77A 4W1UA 3NWSA 4Q47A 3R0AA 4HOBA 1ZH5A 2A6TA 5IOYA 2HOSA 5DCMB 1JUMA 4CGZA 4Y52J 4HF0A 2V1NA 2VBZA 1HA8A 1SMYF 1IDYA 3CJNA 4XKBA 4H4KC 1IN6A 4E6KG 2WADA 1DQUA 3HKZN 2RDPA 3U1KA 3CESA 3BQYA 2LNBA 4LB5A 1U0JA 5E1ZB 3I4NJ 3GTJJ 5M3FJ 6PAXA 1XGNA 2MLKA 1IZ1A 2F5EA 1H0MA 2OZ6A 4M3BA 5JHUA 2V26A 2F4OB 3RKXA 2OTLI 3K4CA 2G7HA 2UZKA 2BZTA 3FF5A 5K7ZA 3CF5F 4L0YB 3IC7A 2DTRA 3WTUC 2K9SA 1V4RA 2DA7A 3PNVA 3RPUD 2VQLA 1H89C 4JYKA 3FXOA 1RC9A 4IHVA 2XHKA 1JUPA 3K2AA 4G7OF 4BKXA 1R22A 1R1UA 5GAGJ 2VIXA 3FHNA 2JA7J 2M34A 2LLKA 3E7LA 1X4OA 3W6JB 3CCJI 5J1YA 2HYJA 5B66C 1O3SA 4HF2A 2R7TA 2DW4A 3Q0WA 1SVLA 5GPAA 2MD0A 5DS9A 1W0TA 4I09A 1Q1VA 2CQKA 1MD0A 3H0GJ 3VSKA 3OYKA 3N4MA 3E5XA 2PG4A 3FMQA 1P9QC 3BP8A 3LWFA 5J1RA 4AYBA 9ANTA 3QP5A 2EFNA 4X6AJ 1FSHA 2KIQA 4IF4A 1MMDA 4DOZA 1JKRC 3K1PA 1IDZA 2XF5A 1CGPA 1S7AA 3P9KA 2ZB9A 5DEQA 4N9IA 3RDIA 3KZYA 4LG3A 4F7ZA 2NRAC 4HBLA 4WCGA 2K9QA 4J19A 4AC0A 3O2PE 3LFUA 2EZKA 2MA3A 3CDLA 4IRGA 1WFXA 1HW2A 2IS2A 1QZEA 2K27A 1ZG5A 3ASOH 3U9GA 2ME0A 3FXQA 3LOCA 3B73A 1U8RA 3I5UA 1WSUA 3F23A 4XONA 3GUDA 2HWVA 5B5EC 3QWLA 2VQHA 4BEHA 2A3SA 2E35A 3BR1A 4A12A 1SC7A 3CCMI 2HEOA 3EYYA 2P7CB 2QSFX 3E1SA 1MDMA 3NQOA 2HYFA 4U88A 3C2BA 4FTHA 1SFUA 4XSZF 3SQNA 2EV0A 2QQAA 1ETWA 3ROUA 4YIFA 4F52A 2V6EA 1LDKB 3L2CA 1HKSA 4HNVA 1R4MB 2QF7A 2GQQA 3K4MA 4II2A 2K86A 3CCYA 3SZPA 4EM1A 3M1EA 1VNDA 4II3A 5BS6A 5CQGA 1GHCA 3AFHA 2GXGA 1B8IA 2R7FA 4GFBA 2XPUA 3ZMUA 2BEOA 1D3YA 2ID3A 2X51A 1PVEA 2ZNYA 3VEPA 3KCCA 1RI7A 5GTHC 1SVOA 4L5EA 4P9UA 4E7LA 3F3XA 2BXYA 1QHHD 2EINH 3FISA 5CYVA 2L01A 2DO7A 4IXAA 1XCVA 5LLQA 3LMMA 5E18F 3K4KA 1VQNI 2EPFA 1QZYA 1FOWA 3BG6A 1BR1A 5DM7F 1W4MA 1JJ8C 4RAZA 1IN4A 4BXUA 3V8KA 3IAS2 4UXNA 3ZQIA 3RKYA 3VYUB 4M6XA 1QQIA 4KIBA 1EKEA 2PFBA 5TISC 2CUZA 1U5TA 1N77A 5FROA 3IUOA 3QOEA 4GCVA 1ZRFA 1B4AA 5EYRA 2DA4A 2EFOA 1BI3A 4AIKA 5CPRB 4KT5C 4L0ZB 2KRHA 2LF8A 3A0HC 1X3UA 2UWMA 1GT0C 2ZKZA 2M1BA 2FRHA 1Z05A 2DK5A 4MGRA 3T1BA 4CCOA 4R79A 3G73A 1T95A 2X9DA 5J4YA 1KONA 2IA0A 1WVRA 2ZXJA 3OYEA 2VE9A 4P5OA 1IGNA 4Q5SF 4I0AA 5JI6A 4ZTJA 3GBGA 2V1DA 1X1PA 4A3LJ 3DWLE 2K5CA 2PBIA 2VXZA 4E7HA 2KKOA 5E79C 3TW7A 3WTTC 1K4SA 2QCOA 2LD5A 5ICGA 2KFDA 4CYCA 1UHMA 3HEFA 2CWEA 4HQEA 2Z16A 1U78A 2PEXA 1JKOC 3TDUC 4KN4X 2Z1DA 3R6SA 1X2NA 3PNTA 2ZXWH 3K69A 4HLYA 2QQBA 4ABZA 3A01B 2E1CA 1XGSA 1VQ9I 1OCOH 4GRIA 1BIAA 4HNTA 2EB7A 1BR4A 3QOPA 4NC6A 4F3QA 1GXQA 2Y2ZA 2DA6A 3J7YJ 1RZ4A 3QYFA 4BE2A 3OYHA 1WJ5A 1W0UA 1FBSA 4KNYA 1GV5A 3RSNA 2OD5A 2ZBKA 5AIPA 3CUQC 3S17J 3TOAA 2XASA 4ZYDA 1YG2A 3ZQ7A 2O3FA 1XGMA 4AWXB 1FZPB 2TDXA 5FLMJ 3ZMSA 1I1GA 2VUMJ 3BR5A 4MFDA 3AL0C 2EH3A 4LLLA 2R7QA 5FLXZ 1TW2A 2DU9A 2H6BA 2RC4A 3JTHA 4U7BA 1Z21A 4CYCB 2EFQA 2BE5F 4N0BA 3D5RC 1FWZA 3FMSA 1TBXA 2CV0A 1YE9A 5HDNA 3ZP5A 1PUEE 1SD5A 2CQNA 2HPMA 2NNYA 2DYSH 2OCEA 3SEQA 5IPAA 4UV9A 2IS6A 2GA1A 2Z5UA 2D1VA 1OCCH 1QVTA 4RLQA 4CCLA 5D4RA 3CF2A 3HOWJ 3P7NA 2A5YB 2DDAA 3GLXA 1NHAA 3DBLB 3W6VA 2CG4A 4RB0A 5J47A 2P4WA 3TP0A 2X48A 4KT6A 1XX5A 1MBJA 1AOYA 5BQTA 3F22A 2Z99A 4LB6B 2B63J 1ONVA 2GM4A 1IXSB 1GVDA 1T0FA 4FHTA 2XC7A 2EJRA 3F0CA 1CF7A 2ADUA 2VI6A 3HOUJ 5E3NA 2BVMA 5H2FC 2RVCA 3C18A 3PFYA 4ON0A 2EZLA 2HYGD 3FBNB 3P9IA 5A2QZ 2WV0A 3OIQA 5BOXA 2JT1A 1ZELA 3MCZA 3FK7A 4A93J 2QKMB 1HBXG 5C4XJ 1ZN2A 3WE2A 2GAUA 2JZYA 4I98B 3AG4H 1GUUA 3BR6A 3ZQQA 4HYEA 3S3OA 3Q5FA 4BQNA 4D5FA 3FWEA 3KEYA 1IN7A 4I6ZA 4OIQF 2EIKH 3IH3A 3LL7A 3JRHA 2IEKA 4L9TA 3HOXJ 2CW7A 1QPIA 2WC2A 1MMNA 2M5WA 2V1UA 2DFHA 1O7FA 4IQ4A 1D1AA 2DA5A 3L2VA 3E0JB 3V7RA 1LFPA 3PJRA 4GDFA 3OR2C 1J59A 3LSKA 2MFZA 3F8NA 1RESA 3BJOA 1D8KA 4NNJA 5DV5A 2BW3A 3H1CA 4ZYAA 3J80Z 1VZ0A 3C3WA 3VYRB 3S3MA 4EJOA 4IO9F 2R7RA 1JE8A 4CZZA 3DLAA 1QO0D 1D1CA 4BDYA 2XDVA 1UAAA 5FLVA 5K5QA 5K7FA 3RQIA 2DMNA 2L0KA 3ZRGA 3HOSA 2NOGA 4G6QA 3MKYB 1ORKA 2MGQA 1BJAA 2WTEA 2F6CA 1ZLJA 4BQAA 2GIZA 2E5ZA 2LDUA 4UUTA 1WPKA 1K79A 4LK0F 2E34A 4QSHA 2AHQA 2BOLA 2PI0A 1BOBA 5D5XB 3DBHB 1BOAA 2IP2A 4UVCA 1KA8A 2ESHA 3R61A 1YI2I 4XR6A 4YEJA 2HTSA 2IT0A 1ZG1A 3L2RA 2X0LA 1IRGA 4QPQA 3F21A 3HJEA 2IA2A 3QU6A 4LIVA 1PDNC 3LAJA 3MFKA 1A6IA 1YS7A 4KFCA 3OIOA 1SAXA 5KHDA 1D5YA 3ABKH 2AQEA 2K9MA 4JX5A 2MSYA 1IXRC 1LEAA 3M9AA 4D7NA 2GWRA 2QQ8A 2IGOA 3OR1C 4NB5A 3GZ5A 3RYRA 2ECBA 4A3BJ 3DLLF 2HZTA 2JTVA 2MC4A 1V5FA 3BY6A 2Y9YA 3T8TA 4BHPA 4Z6YA 1RR7A 3TQNA 1TQPA 1G3SA 3FXMA 3NEUA 2C6YA 2VJJA 3ABLH 4ETSA 3KLOA 2QYOA 3CP2A 4OMZA 5LGTA 2EILH 2GXBA 3UR3C 1Z1DA 2DFIA 2K4BA 2CO5A 1LDDA 4KUMA 2XSDC 2O8KA 1VQPI 2QWWA 1FMVA 3WU2C 2IGKA 3EUAA 2KT0A 4B3AA 3L1PA 4IOAF 4B8XA 2BGCA 3E6BA 2IS1A 2JK3A 2VLAA 2CGPA 2E60A 2LG4A 1TWGJ 3U1DA 2K02A 2OF7A 4DIQA 4DBRA 1EV7A 2X1DA 3K4LA 4MTEA 2JWTA 1HF0A 2DYRH 3FBIB 3EETA 1F43A 4XRSG 3RQ4A 3KP3A 1LDJA 1XMKA 1YQAA 3SFIA 1YIOA 2BY0A 2UV1A 2DODA 1X2MA 2HNHA 3V42A 3G1MA 3VPRA 3ZR8X 3ZPLA 3D5SC 2YU9J 2VJIA 3DV8A 4HRIA 2AXTC 3VWBA 3CC2I 3BG3A 2YS9A 2LR8A 4ENJA 3Q3SA 1MBEA 5JVTA 5K5OA 3WHCA 2IRFG 1EH6A 2VJ5A 2QBYB 5CVIA 5E8IA 1SVMA 4O3MA 2PX9A 5E3OA 5FFXA 3TEDA 2E1MB 4PK4A 5HNHA 3L09A 5LEJA 3I59A 3QPSA 3QODA 5CQEA 3KP2A 4C3HJ 1WCMJ 2LMDA 2E2HJ 2STWA 4OAYA 1FYKA 1SAUA 4XNFA 2LF7A 3CQZJ 2NNNA 2OA4A 1Y0UA 1ZKGA 3PM1A 4D0PA 1MBFA 3LSIA 3P9CA 2ETHA 1VQLI 1DPRA 5AONA 4OU0A 5B1BH 2E2JJ 1OCZH 2ELHA 5EF6A 3NWTA 3M8EA 2R4GA 1T08B 4U87A 3S32A 4MIMA 2QVOA 1TQMA 1IUFA 4U7DA 2R3SA 2XAFA 4X0GA 2COMA 4PJ0C 4WXDA 2KPMA 2BXZA 2N8GA 5FLXK 3PQJA 3LQQA 3ZMZA 4MEYF 2R0QC 3HRUA 3S16J 3JAMZ 4CSWA 5E1WA 3IWFA 3ZCOA 1SANA 3ABTA 4WX9A 4NQWA 4RLFA 1OFCX 3ZN0A 1XN7A 3F8MA 1FOKA 3M07A 4ENMA 2WAEA 1E0EA 1PP7U 2Z9OA 3BG7A 4ZYHA 2Q2EB 5IP7J 2R93J 3IKTA 2JN6A 3LA2A 1IN8A 1OR7A 1QZZA 4BJ5C 4J01A 3IV5A 1BBYA 2Z33A 1TTYA 2FD5A 5J40A 3S1NJ 2EZIA 4MQ9F 1NK3P 3WHBA 4BDZA 1XC5A 1TP4A 2ZFWA 4KJZA 1A35A 2DMUA 2LC2A 2F5DA 4O5VA 5DCFA 2XB5A 3FM3A 3H3UA 4F91B 4RGUA 2E1MC 2XGXA 1R7JA 2KRFA 3VSLA 3OYIA 4BQQA 2FBIA 4EQQA 5J3LA 4XK4A 1LE8A 3IKVA 1N75A 5A2QK 2KIFA 2KMUA 4XLHA 1YX3A 1X1CA 1W7PA 1TL8A 3FXUA 2V7FA 3JW4A 1ZGAA 2RKHA 1VQ8I 4I2OA 1I39A 3OV8A 3HRSA 1B59A 3Q0UA 4IVNA 4QPOA 3H9JA 3S2HJ 1KYZA 3H35A 3I3LA 1V55H 3CLQA 4L18B 1ZK8A 2ELJA 3LNQA 2GOXB 1TNTA 2HDDA 1TWCJ 4S04A 2W4SA 2IGNA 3BPXA 3A1YA 3DPTA 2DPUA 3JRGA 2YU3A 3E6CC 4ANJA 1OCRH 5KAIC 4IOCF 4RS8A 4G6DA 1SFOJ 3TO9A 1XPXA 2FXAA 2P5KA 3F8CA 3TO6A 2CS3A 1TWAJ 3SXYA 1BW5A 3KP7A 4G8XA 5LRSA 2WY8Q 5TRDA 3J80K 1LPQA 3S14J 2R7SA 4RDUA 1JI8A 2HQAA 4HQMA 4S0HB 1XTAA 3TMOA 3JREA 4M3DA 1YLFA 1LE8B 2JQ7A 2M9HA 2M0MA 1JT0A 1WGXA 4UUSA 4KDPA 3P5JA 1Y8RB 1IV8A 1QRYA 3ESWB 3S8PA 2I5UA 4RM3A 2V9PA 1G4DA 1V54H 1UB9A 3L2UA 3M8JA 3DEEA 1IRXA 2ZC2A 1I27A 2L3DA 4PDKA 1IC8A 3MKWB 4LD5A 1HQCA 2JRMA 4ZJZA 4V2FA 1QNTA 2LOOA 3OYDA 1MGTA 2LH9A 3JRAA 4MHGA 4A3GJ 1V5EA 1Y56A 3EQLF 4BBRJ 3B6CA 2IVMA 2P6SA 2R7UA 2IA1A 2EK5A 1WJAA 2EFPA 1FC3A 3E3VA 4PSWA 1Q1HA 3VYTB 3ZMVA 4FASD 2R7ZJ 2F5CA 4AUXA 4IKFA 3BCAA 5D8LB 2P5VA 4CO8A 4XOTA 2F2EA 3BCBA 1WWXA 3RZDJ 4DJAA 3KLNA 2Y75A 2L7MP 4XORA 4F55A 3MZYA 4BGDA 3OS0A 5CLSA 2DT7B 4KN7X 4EV0A 1H8AC 2WAFA 5D5WB 4EATA 2WB1N 3HSFA 4UUSB 4MQVA 3S1RJ 4R8HA 4Y33A 2RNJA 1C0WA 3ZN1A 3S3NA 5FKNA 1NH3A 3EUHC 3I54A 2OJED 1PJRA 2IPQX 2VT2A 4CH7A 2ZSIB 1ODDA 4NHJA 3G2BA 2A6EF 4BL0B 2W00A 3F9KA 2Z2SB 3U2RA 2W82A 4XRMA 5C4JJ 3OS1A 5IT9Z 5KNLA 1APLC 4BBSJ 4AIJA 3FZVA 3V4GA 2XROA 4IHTA 2YUSA 2A5WA 2OBPA 4LOCA 1FMWA 3I55I 1ON1A 3MKLA 3CCSI 5HLIA 2NVQJ 4FX4A 2HVRA 1JTYA 2O6GE 2GIVA 4MLOA 1XSXA 1MKMA 2DJNA 2EIMH 4E4HA 4H0EA 5JR3A 3KE2A 2RREA 4CYDA 5JLXA 1I3AA 2K3PA 3OIPA 2VKDA 5LBQA 4YFNF 5BPDA 5FKMA 3J7AO 1OISA 4RBOA 3CCRI 3GZNB 2BVLA 1KGSA 4PJJA 2KJCA 2M8EA 3BG9A 2M8GX 5JLWA 2WA0A 3R4KA 3ZXSA 1ERDA 1OYIA 1VQOI 2A61A 3NRVA 1F1ZA 3HTSB 2V6CA 4YELA 1DU0A 2ECCA 3AAFA 4G7ZF 1I3QJ 1LVAA 4XLPF 3HG9A 2ID6A 1YX5A 3ULQB 5ILSA 3HB9A 1WJDA 4E7JA 3BTLA 2AS5F 3EPZA 4LG0A 4EJUA 1ZR4A 2A68F 3OYMA 3C1DA 1NK2P 4LMYA 3GVAA 1K78A 1IW7F 2Q1ZB 3MWMA 4ZH4F 2X1EA 1H9TA 4BEHB 3CMEI 4CDGA 1DP7P 4EJVA 2XPVA 2XGDA 4YRVA 1P7IA 5F6FA 2PMZN 3RKWA 5HS9A 3OOPA 1LNWA 3DF8A 2HR3A 1UHSA 2CU7A 4QTRA 1MDMB 2X6WA 2HFHA 1D1BA 4IPAA 1UG2A 2TRTA 3IH4A 1QVUA 2OCCH 2Y0SN 3WG7H 3PIPF 2CFXA 5B3SH 1S72I 2R7OA 1ZGJA 2VXDA 4PZJA 1R36A 1FX7A 2FQ4A 4IX7A 3DU6A 5CJ9A 3JAMK 5EZGA 1F9NA 2QUFA 1H9GA 5ICCA 1R1TA 1D8JA 3BPVA 5J8CA 2GOMA 3LSJA 4HX4A 3CDHA 4I01A 1LEBA 1VQ4I 4ZYEA 3HKZA 2A05A 3DEWA 4ZYGA 2VKHA 3QQAA 3RTRA 4EEFG 2W24A 2H1LA 3X2QH 1B8IB 1R4NB 2MD5A 2MW8A 1ZLKA 4LG0B 3OYCA 2LKPA 1XDUA 5K5RA 4G7HF 4B1RA 4AVPA 2L7FP 3GTQJ 4WF2A 2W25A 2F48A 4BJTA 3QPLA 4YG2F 2W57A 1P2FA 1SD4A 1UJ8A 2I10A 2KLOA 5J8FA 1AU7A 3OYAA 1UZCA 3GMEA 3SEZA 5LD2C 2CJJA 3I64A 5F04A 4EM2A 2Y9ZA 1OMIA 4BAYA 2ZJPF 5FGMA 3ZQCA 2VONA 2OU2A 3FIWA 5D6EA 1KYWA 1LJ9A 2BY3A 3F8BA 3BQZA 4XL9A 1JJ6C 1BA5A 3MAJA 1FP1D 1OKRA 1R5ID 1ETXA 2VOOA 2KISA 1RUOA 4Y4RA 3R60A 5E3LA 3W3CA 1MH3A 2VQCA 5FB2A 3LSPA 3WU0A 4CCJA 1U5TB 4PJLA 1YHQI 2H6CA 4W97A 3PIOF 2D45A 1D0ZA 1R9TJ 4EGZA 4UVBA 1P4WA 3LA3A 1JUSA 3U21A 3OSGA 3PO2J 4RAGA 5CVVA 3COAC 2XV4S 4LFUA 3HM5A 3WTXC 5KK1A 2XSJC 1FJLA 2QQ9A 4FISA 1YW8A 3BR2A 2GZWA 3PQKA 3DPUA 1S7OA 3H9GA 2OV7A 2ME6A 3PSIA 3IL2A 1IRFA 3GF2A 3M8FA 2Z3YA 4IRHA 4HX7A 2WAQN 3O6BB 2ZMEA 4DZJA 5M5YJ 2MC3A 4ESJA 4IEJA 4XN3A 4M6YA 2F4MB 1ULYA 1QGPA 2HPIA 3C2HA 2VB6A 3FKJA 4M6VA 3E5UA 4B44A 4E7SA 1MBHA 4ZZLA 3N97A 1XB4A 4FT8A 4OINF 3UKGA 3CCQI 1VQ6I 3L9FA 3L7WA 4A3JJ 1T33A 3QYEA 1TW3A 5LGUA 1FSEA 3NARA 5E3MA 4XKCA 4IHYA 1JT6A 2NYXA 4XM3A 2CUEA 2VC1A 3BROA 3I71A 1YTYA 4UNOA 2RGVA 2W84A 1W1WE 2KZVA 1Z91A 5D4SA 3MKZA 3CO6C 4ESBA 4LGWA 1B72A 5DM6F 1YYVA 4A2UA 3JSPA 4AD9A 2FF4A 2H8WA 3GTGJ 3JRIA 4A0ZA 5F1RA 2O03A 3RPUA 3BR0A 2LTPA 1U5TC 4XOPA 2JJ7A 3WU1B 1ZG3A 3WTSC 1XS9A 3ABUA 4DYRA 2PJRA 1A5JA 2L9NA 2NOJB 1JHFA 1ON2A 2ZMEB 1IJWC 1MSFC 1I6XA 1YFHA 4EGYA 1MIJA 3NAUA 2KJBA 4WK8F 1MBGA 2ISYA 1NTCA 3CCUI 4HEA2 2X1CA 2KZGA 1ENHA 2QEXI 1STZA 1S29A 2H27A 1FEXA 1K83J 2A07F 3GLLA 3GFIA 1KU3A 1J2XA 3GXOA 4A6DA 1D0YA 4RMNA 3H5NA 3EYIA 3B6AA 2ZCWA 2DA2A 3MZ8A 4KMFA 3JR9A 1JXSA 3D0SA 4NBQA 4D9JA 3A03A 3WTWC 4PJNA 2VPRA 2P8TA 1KZHA 3K70D 4PGGA 5IT9K 3AG1H 5ERIA 4XBFA 2J5OA 4GYGA 4XLFA 1MJ9A 3LSHA 1KQ8A 2FX0A 2UUZA 4M74A 2JA5J 2CQXA 2PMHA 2IS4A 1NG6A 2FE3A 4N9HA 5FD6A 1CF7B 2STTA 1QBJA 2LREA 1KU9A 5D8KB 2KP6A 1VF9A 1MMGA 1WJCA 4XLEA 2QSHX 1S8NA 2ZO4A 2DA3A 1LFUP 1RPWA 3CTAA 2LY9A 1WJEA 4KYWA 5ILUA 2MLGA 3I58A 2KQRA 2BHYA 1O4XA 2NVTJ 2LBFA 1Z9CA 3MMYB 3E97A 2VBYA 2JA8J 2NS7A 4EJWA 4BY7J 3D1NI 2O0YA 4P55A 2M3AA 1GDTA 5IYBJ 4BU2A 5DUIA 1WKMA 2FMLA 2FNPA 2P6TA 3W2WA 4F92B 4NC7A 3TW6A 3S93A 2NVUB 1H88C 1EH7A 2BW3B 4UV8A 3BR3A 4U0VA 1MJAA 2O7OA 4EJTA 5HLGA 3DQVC 1FPQA 4KICA 2GXAA 2DXIA 3BOQA 3A02A 3MN2A 4HA8A 1JGSA 5KAFC 2OQRA 2LBFB 2DMTA 4MEXF 1VQ7I 3HBLA 3DXJF 4XLAA 3I4PA 2HDCA 1TLHB 3FDYA 3I56I 3SDBA 5JHFA 1TWFJ 2WAQA 3LFKA 3ISPA 1K6OA 2YSRA 3TKYA 4JK1X 2V1XA 1POGA 2YR2A 5HOOA 4AIHA 5GAHJ 1F4KA 2OAZA 2E2IJ 3DBRB 5HDGA 1ETQA 2K9NA 1UHWA 1S5LC 2L5QA 1Y6IA 2JMWA 4Y3OA 1IG7A 2XAJA 2WBMA 3K7AJ 3CCEI 4A3EJ 1J09A 1GVJA 5F0FA 4A3DJ 1FTTA 1P7JA 2LRDA 2JA6J 3EUKL 2Q0OA 3OYGA 4Q4ZF 4KMUX 3A0BC 3H9QA 3FMRA 2HXIA 3GCMA 1A36A 4G6TB 2KIUA 2R7VA 5H20A 5F64A 1DDNA 3RYPA 1BC7C 1EJ9A 1YOVB 1P4AA 2VASA 4PGHA 4G12A 1ZQ3P 2EWNA 3KYLA 3TO7A 1U6GA 3L2QA 2DDBA 1E2XA 2H09A 1R6RA 2P0WA 1SEUA 4LLGF 2DMPA 5FO5A 1JKPC 1HC8A 1O3TA 5F08A 4BNCA 1E3PA 3LSTA 3BWGA 3WTVC 2M4KA 2VJ4A 2L7ZA 4HSTA 1GLNA 3VDXA 1ETYA 3CMYA 4FQGA 5M3MJ 3DP7A 1AA7A 2CQQA 5M5WJ 3VB2A 3J81Z 3ZMTA 2XB0X 1YJ9I 1JGGA 2M0CA 2R5YA 2OZUA 3WODF 4CUGA 3H0DA 3TDZC 2HKXA 3SHFA 4BXFA 5HDKA 3O8HA 4DQ2A 2W1OA 1MZBA 1QHGA 3BZ6A 3VODA 4JBAA 1R00A 1HKTA 1T56A 2KRCA 3CJRB 4Z2YA 1T8IA 4DBQA 4PJMA 3SDGA 4WXCA 2R5ZA 2XPWA 1G3YA 1YS6A 3VYSB 2G9WA 2GBYA 2HOAA 3M3YJ 2LP0A 2VN2A 1RKWA 4XICA 1CQTA 1I1SA 4YIIA 2NS0A 1HSJA 2RNGA 1U9OA 3SJMA 4M3GA 2MH2A 5HLHA 1X19A 4RB2C 2Y48A 2VT3A 1ETOA 5BNGA 4DW6A 5CVUA 2O8XA 4AYBN 2BBYA 2IJLA 4P1WA 3BDDA 3MD2A 1R49A 5FRNA 5EDNA 4R1HA 3MZHA 2QKLB 2JPBA 4DYCA 3ECHA 5EEGA 2R5YB 2K7LA 2CW8A 3I59B 3HOYJ 5KCMA 1WH5A 2HVQA 4XMYA 5LHGA 3Q0VA 4IL6C 1U8BA 1ZREA 4PFPA 1FY7A 1ZTRA 5M5XJ 3IH2A 1V3FA 2CUJA 3BTIA 2ISZA 4LK1F 1MNEA 4NUBA 1J0RA 1Z3XA 2JSCA 4NDLA 4CZCA 2CRGA 2R7XA 2Q8KA 4C2MJ 2FEZA 1PUFA 3WE3A 2QZ8A 2HVSA 1MJBA 2HDWA 2DQLA 3PUBA 4RGRA 2R5ZB 3WGGA 5HS8A 2HQNA 2DLLA 3TP3A 2VC0A 3H92A 2B7EA 1XSDA 1K6YA 3Q9SA 5AIQA 4OWRB 4AVZA 3HPGA 1I6HJ 1T39A 4C3IJ 5EG0A 4HSRA 4EMSA 3WG9A 1IV6A 2IAIA 5LFAA 5F27A 3QAHA 5GAEJ 1IUYA 3HSRA 4NQWB 2EA2A 4V2GA 2VL8A 3JCUC 3REOA 2V9VA 2QA4I 1XMAA 2XAGA 4M9SA 2HI3A 2E7XA 2PMUA 4HLXA 1P6RA 1SD6A 3HGYA 4RB3C 3OYFA 3ECOA 3ELKA 4A0YA 1J7KA 1RRJA 3RIRA 2XF6A 2R7WA 4HAMA 4YFXF 2K40A 4A69C 3KFWX 1XGOA 3B02A 1B9MA 1VTNC 3GZ6A 2H8RA 1TT0A 2VODA 2XIGA 3M1CA 3OSFA 2KDZA 1EF4A 2E19A 3KPHA 2E5NA 4IZZA 3BLYA 4BJ6C 2B0LA 1E17A 1RUNA 4KIFA 5C44J 3VOEA 1A31A 3CLOA 1HOMA 2XKPA 1W7PB 4ZDPA 1MNMC 2LYCA 1J9IA 4OIPF 2F5VA 2B9SA 3OOUA 4V19K 2VQGA 2AXLA 5JVGF 5J4VA 4S05A 1BM9A 2JUGA 5DUKA 2QSGX 5J1UA 2QLZA 2OTJI 4BHCA 3I9V2 4C30A 1GXPA 2BYVE 5IOZA 1J5YA 2PQ8A 4RAFA 2BY1A 1BN5A 2JPCA 1F36A 5KVRA 3FX3A 3M4OJ 2D2WA 4DZPA 3CD6I 2LK2A 2F4IA 2DQRA 2VOPA 4BQOA 2X6YA 4CICA 1TT5B 1DGWY 2UXXA 2UXNA 3FKIJ 3ZMDA 2EA4A 2HZDA 3BJ6A 2GLOA 4IHWA 3FXKA 3TOBA 3FK6A 5EGOA 1MSEC 1ZRCA 4XLCA 2CUFA 3BJAA 5IP9J 2R7DA 1ZGWA 2VBWA 2VPLA 1HW5A 4BHBA 1P4XA 1W36D 2NS8A 4RGXA 4DNCA 1IXCA 2WV1A 1M1EB 1OR7C 4CXFA 3ZQGA 1FIAA 2O61A 2HU9A 4IHXA 3FXJA 1RETA 2Y31A 3HUGA 5LHHA 3V7CA 4E7ZA 2RV8A 2KHMA 3ASNH 4EVIA 2QENA 3BG5A 4G9YA 4U0YA 4ESFA 2PN6A 1VQ5I 4LJZF 1AKHA 4FETA 1D0XA 3LQRA 5E8GA 3IWZA 3BT9A 3C2GA 3PNYA 4Y13A 2X4HA 2L54A 4OOIA 2YPRA 4UHTA 1ETVA 2JSPA 2ZFUA 3IAM2 3HZJA 1XDSA 5D5UB 4HW0A 5L3DA 1R58A 1DGRM 1YW9A 3HHHA 1OQYA 1R5HA 3KP4A 1B6AA 2X6XA 3K70C 1OLTA 2F5FA 5DD8A 5EGOB 1SMTA 2QM3A 4I99C 1RNLA 1R71A 5L3EA 4BUPA 2HXOA 4BE1A 2KL4A 3KETA 3CCVI 1JTXA 3S2WA 4XIDA 3DTEA 1WQ2A 5LGNA 2XAQA 5HLTA 3CCLI 4XLNF 2DCEA 4ZC3A 3HUGB 2DAOA 2KIMA 4E70A 5F0HA 1TWHJ 3GTOJ 2KDOA 1X58A 1MMAA 3K1MA 1AKHB 2LY2A 5BMZA 1Z6TA 1FT9A 4P9FA 2CH0A 3IP4B 4OIOF 4M71A 4GYIA 2M4GA 3OY9A 1MNDA 1FOYA 1OYYA 2FUG2 3TBIA 3RPQA 4JOMA 4A3IJ 2M7AA 5IP6A 3J81K 3AKZA 2FJ1A 5IY5H 3FXLA 2JVHA 3BZKA 4RA2A 1S7EA 3S15J 2L9VA 3O3KA 3CUQA 1UELB 3IRRA 4O6JA 4IJAA 1ZARA 3ZQLA 3KP5A 1G3TA 1OCPA 3AG2H 1W5SA 2CMPA 1R5GA 4I7HA 3SFZA 4D5CA 2G7UA 1Z0XA 2RN7A 1AHDP 1HSTA 4JX6A 5ILVA 5B1AH 3JRFA 3JRDA 1J75A 2M87A 1FBUA 1O7LA 3ZQFA 3LSRA 4X1EA 5TJJA 3K4JA 5L3GA 3G4SI 1ZAOA 2CYYA 2AO9A 3S2DJ 1FBQA 3CC4I 2HQRA 3CJTB 3QYBA 4JX4A 4UVAA 3HDDA 3UNGC 2CV2A 5L3CA 4QIWN 4WWCA 2ZJQF 2W85A 2FA5A 4KA4A 1KQ9A 3F72A 3TL4X 1O3RA 4CCNA 3CUQB 1K78B 3FHZA 3HSEA 2DA1A 1VFCA 4M9ZA 2ZXHA 4QLCU 3AL0B 2TCTA 3MVPA 4C2UA 1HXDA 3A01A 1OJLA 4C9YA 3OYBA 3VFZA 4G94A 4UUVA 2FBKA 3OYJA 1HCRA 4HX8A 2XKOA 3ZOBA 2OPTA 3OYLA 5GP9A 1Y1WJ 1FLIA 3LSMA 2A69F 3SZTA 3V8LA 2DT6A 1BJZA 3G6EI 2OQGA 1G59A 3KZZA 4B4CA 4FE4A 2WB1A 3HIFA 1QA6A 1LVKA 2MYSA 4ENNA 2FBHA 3E5QA 1JKQC 1TNSA 3RKQA 4PFOA 1WI9A 3V7SA 3TGNA 2JA2A 3R0JA 2CQ7A 4PCQA 4A0XA 3OS2A 4HDUA 3K10A 2LSOA 3T5XA 4RGSA 3PSFA 1XMXA 4C3JJ 3LAPA 2H1KA 4GO1A 4NC8A 4J00A 3F6OA 4B3XA 2HQ5A 3CP8A 3HOTA 1KQ0A 1BW6A 3W2VA 1UMQA 5EJCA 4M72A 3HXLA 1OPCA 3DTKA 4AIDA 3DPLC 5LHIA 2MH9A 2P81A 2NAZA 3I53A 1YITI 4GXOA 3GFLA 2DT5A 4I0BA 2ESNA 3ZQHA 5CVJA 3FM5A 5FJ8J 2EV6A 1Y8QB 4OAZA 4HZFA 1HDDC 5K7HA 1LKXA 2XVCA 4ITVA 4ZDOA 3ERMA 1Y39A 2DFEA 3K1NA 4BY1J 1G8XA 4L5IA 3LSGA 1HKQA 3J7ZI 4RM2A 5F1JA 1X1AA 1B1BA 1AWCA 3K2ZA 4LIUA 2O5RA 4RB1A 5TGTA 2YX4A 5E20A 4BYYA 4OMYA 2DMQA 4YIRX 2EV5A 3GW2A 3HTUA 5EEAA 1T98A 2HGCA 5LRRA 4ZTFA 1YO5C 3SYTA 4TV7A 1Z7LA 2XUBA 4L9VA 1UG0A 2RQQA 2EQRA 2RAEA 4M3FA 2IGMA 1Z6RA 2LKXA 4PSXA 4KISA 1X4PA 2IXSA 1V5GA 1WHUA 4HNUA 1ZHFA 3IRQA 2JVGA 4LLNA 2M7BA 4Q48A 2DN0A 2DOAA 3H5RA 1Y1VJ 2VBXA 3N05A 2P5LC 1KU7A 4A6EA 1USSA 3FXRA 2L9SA 3KX2A 3IHUA 2P7VB 3A2KA 3HRMA 3KYDB 3HYIA 4MNUA 4ASNA 3GTKJ 1GV2A 2X6OA 3CDIA 4KITB 2PMZA 4HPQA 2DOEA 2JRTA 3GTMJ 4FE7A 1WI3A 2LKSA 3PL8A 1NG7A 1X3WB 3BTJA 1IAWA 1Z67A 3CUOA 3BTCA 5BPIA 3WTZA 4A5MA 2Y0SA 4XKWA 2ZXIA 5EZHA 3PFIA 2AQFA 3RZOJ 1B72B 2OC6A 1W7PD 1IF1A 4LITA 5L3FA 4IQJA 4GGGA 2DFFA 1EH8A 2JUCA 4L9JA 1LUJB 4L9NA 4B09A 3DU5A 5E17F 5DTDA 4I76A 4F93B 3GTPJ 2M45A 2G0EA 1L3LA 2O9LA 2K4JA 2LFBA 5HVQC 1A6QA 2PJRB 4IHSA 3GYHX 4DGWB 1LB2A 1YRNA 3CZ6A 1U3EM 3DFGA 2ZSHB 4D7MA 1BC8C 2DI3A 2H94A 3H36A 3EDPA 3G1OA 1HW1A 3Q9VA 1O3QA 2V9KA 4ENKA 2MABA 1PP8F 4Y17A 5FKLA 1SFXA 3RI4A 1QU3A 1W5CC 1MW7A 4A3CJ 3WTYC 1U9NA 2LVSA 2X85A 2FOKA 1K61A 5JFRA 2VKEA 2E36A 1T2KA 1EA3A 1SFEA
chains in the Genus database with same CATH topology
4HF1A 2DK8A 4RAYA 3JTGA 3GWZA 3K9TA 1JHHA 1S3JA 4L5JA 2PJPA 3T0YA 1T6SA 2FQ3A 4XSXF 4ZZDA 2V79A 2DPDA 3F8FA 4QWQA 4P96A 3QPHA 5D5VB 1L0OC 3QRFF 2L02A 3GO5A 3WGIA 3QU3A 1B9NA 3W6KB 1R23A 4KIGA 5L3BA 1WRJA 4BH9A 1OYWA 4OIRF 1BI2A 1I5ZA 2FSWA 1XD7A 5LEKA 4FX0A 1YW7A 2MBFA 1UCRA 3G3ZA 5ICFA 4M9XA 3HRTA 1U2WA 1Z7UA 4M73A 2QBYA 1A04A 2HS5A 2WWYA 3H3ZA 1DUXC 2A6HF 2L4AA 3DKWA 3KEOA 2HTJA 3E6DA 4CHUA 2ACJA 2CW0F 3DEUA 5ED4A 3D5LA 1XCBA 4A5NA 5HS7A 1G3WA 1BIBA 2XRNA 4IRIA 3M7GA 3WGHA 3CO7C 4EM0B 2E7WA 3K0LA 5DDGA 4JQFA 2D1HA 2HOEA 3GFJA 1LQ1A 5K1YA 2PLYA 3V8JA 3RJPA 1ZYRF 4HV6A 1SD7A 4YFKF 3JSOA 4HDVA 3F6VA 2E1NA 3GX4X 2Q2EA 5IT3A 4K2EA 4U0WA 4WXHA 2ZJ2A 3E6MA 3C7JA 5H6QA 3I0TA 4XRFA 2ZNZA 3GFMA 4HV5A 1BI1A 4MTDA 1REPC 1FNNA 5FFZA 3T8RA 3KP6A 5J6XA 1RIOH 1DPUA 3LA7A 5DYMA 2J5PA 1BI0A 1FYMA 2HKOA 1R1VA 3QP6A 4I02A 3MQ0A 2FU4A 5H6RA 1IN5A 3MEXA 1FYLA 1G6NA 5E1XA 3EUHA 3QPTA 5CVRA 2BV6A 5DD4A 2FMYA 2M30A 1D5VA 1KU2A 1T38A 1ZRDA 1K7AA 1P92A 1QPMA 3ML6A 2FNAA 1S6LA 5DCMA 2XAHA 1UFMA 3ERED 2CSOA 1F5TA 2DBBA 3GEZA 1TQIA 5EEHA 1O57A 4Y15A 2IW5A 1USTA 3HHGA 5FD5A 2VE8A 2L4MA 2Y0MA 5ICEA 2RQPA 5D6FA 2GA2A 2YX7A 1XSVA 1W5TA 3KEQA 2EFWA 1FP2A 3L00A 4Q47A 3R0AA 4HOBA 1ZH5A 5DCMB 4CGZA 4HF0A 2VBZA 1SMYF 3CJNA 1IN6A 2RDPA 2LNBA 4LB5A 5E1ZB 6PAXA 1XGNA 2MLKA 1IZ1A 2F5EA 1H0MA 2OZ6A 5JHUA 3RKXA 2G7HA 2UZKA 3FF5A 4L0YB 3IC7A 2DTRA 3WTUC 1V4RA 2XHKA 4G7OF 1R22A 1R1UA 3W6JB 1O3SA 4HF2A 2DW4A 4I09A 2CQKA 1MD0A 3N4MA 3E5XA 2PG4A 3FMQA 3BP8A 3LWFA 3QP5A 2EFNA 1FSHA 4IF4A 3K1PA 1CGPA 1S7AA 3P9KA 5DEQA 4N9IA 3RDIA 3KZYA 4F7ZA 2NRAC 4HBLA 4WCGA 3O2PE 2MA3A 4IRGA 1HW2A 2K27A 1ZG5A 3U9GA 3FXQA 3B73A 1U8RA 3I5UA 1WSUA 3F23A 3GUDA 2HWVA 2A3SA 4A12A 2HEOA 3EYYA 2P7CB 1MDMA 3NQOA 2HYFA 4U88A 1SFUA 4XSZF 3SQNA 2EV0A 2QQAA 3ROUA 4YIFA 1LDKB 3L2CA 1HKSA 2GQQA 2K86A 3SZPA 4EM1A 3M1EA 5BS6A 1GHCA 2GXGA 2R7FA 3ZMUA 2BEOA 1D3YA 2ZNYA 3VEPA 3KCCA 1RI7A 4P9UA 3F3XA 5CYVA 2L01A 2DO7A 4IXAA 1XCVA 5LLQA 5E18F 1QZYA 1W4MA 4RAZA 1IN4A 4BXUA 3V8KA 4UXNA 3RKYA 4M6XA 1QQIA 4KIBA 2PFBA 1U5TA 1ZRFA 4GCVA 1B4AA 2EFOA 4AIKA 1BI3A 4L0ZB 4KT5C 2LF8A 1X3UA 2UWMA 2ZKZA 2M1BA 2FRHA 1Z05A 2DK5A 4MGRA 3T1BA 4R79A 3G73A 2IA0A 2ZXJA 2VE9A 4P5OA 4Q5SF 4I0AA 5JI6A 2V1DA 2PBIA 2VXZA 2KKOA 3WTTC 5ICGA 1UHMA 2CWEA 4HQEA 1U78A 2PEXA 3TDUC 4KN4X 3R6SA 3K69A 4HLYA 2QQBA 2E1CA 1XGSA 1BIAA 2EB7A 3QOPA 1GXQA 1RZ4A 1FBSA 4KNYA 2OD5A 2ZBKA 5AIPA 3CUQC 3TOAA 2XASA 4ZYDA 1YG2A 3ZQ7A 2O3FA 1XGMA 4AWXB 1FZPB 2TDXA 3ZMSA 1I1GA 4LLLA 5FLXZ 1TW2A 2DU9A 2H6BA 2RC4A 3JTHA 4U7BA 2EFQA 2BE5F 4N0BA 1FWZA 3FMSA 1TBXA 5HDNA 3ZP5A 1PUEE 1SD5A 2NNYA 4UV9A 2GA1A 2Z5UA 2D1VA 5D4RA 3P7NA 2A5YB 3GLXA 1NHAA 2CG4A 4RB0A 2P4WA 1AOYA 5BQTA 3F22A 2Z99A 4LB6B 1ONVA 1IXSB 1T0FA 4FHTA 2EJRA 1CF7A 2ADUA 2RVCA 3C18A 4ON0A 2HYGD 3P9IA 5A2QZ 2WV0A 5BOXA 2JT1A 3MCZA 1HBXG 1ZN2A 3WE2A 2GAUA 2JZYA 4I98B 4HYEA 3Q5FA 3FWEA 1IN7A 4OIQF 4L9TA 2WC2A 2M5WA 2V1UA 1O7FA 3V7RA 1J59A 3F8NA 3BJOA 1D8KA 5DV5A 3J80Z 3C3WA 4EJOA 1JE8A 4CZZA 1QO0D 5K5QA 3HOSA 4G6QA 1BJAA 2WTEA 1ZLJA 4BQAA 2LDUA 1K79A 4LK0F 2PI0A 5D5XB 1BOAA 2IP2A 4UVCA 1KA8A 2ESHA 3R61A 2HTSA 2IT0A 1ZG1A 2X0LA 1IRGA 3F21A 3QU6A 2IA2A 1PDNC 3LAJA 3MFKA 1YS7A 4KFCA 1SAXA 3M9AA 1IXRC 1LEAA 2GWRA 4NB5A 3GZ5A 3RYRA 2HZTA 2JTVA 3BY6A 3T8TA 4BHPA 3TQNA 1TQPA 1G3SA 3NEUA 2C6YA 5LGTA 4ETSA 3KLOA 2QYOA 4OMZA 2GXBA 1Z1DA 2DFIA 2K4BA 2CO5A 1LDDA 4KUMA 2QWWA 4B8XA 2BGCA 3E6BA 2CGPA 3U1DA 2K02A 1EV7A 4MTEA 3EETA 3KP3A 1LDJA 1XMKA 1YQAA 1YIOA 3ZPLA 3DV8A 4ENJA 5JVTA 5K5OA 2IRFG 1EH6A 2QBYB 5CVIA 5E8IA 4O3MA 5FFXA 3L09A 5LEJA 3I59A 3KP2A 2STWA 1FYKA 2LF7A 2NNNA 2OA4A 1Y0UA 4D0PA 3P9CA 2ETHA 1DPRA 5AONA 4OU0A 2ELHA 3M8EA 2QVOA 1TQMA 4U7DA 2R3SA 2XAFA 2COMA 4WXDA 5FLXK 3PQJA 3LQQA 3ZMZA 4MEYF 3HRUA 3JAMZ 5E1WA 3IWFA 3ABTA 4WX9A 4NQWA 3ZN0A 1FOKA 1XN7A 3F8MA 4ENMA 1PP7U 2Z9OA 4ZYHA 3IKTA 3LA2A 1IN8A 1OR7A 1QZZA 1BBYA 2Z33A 1TTYA 4MQ9F 2ZFWA 2F5DA 4O5VA 5DCFA 3FM3A 3H3UA 4RGUA 2XGXA 1R7JA 2KRFA 2FBIA 4EQQA 3IKVA 5A2QK 2KIFA 1W7PA 3FXUA 3JW4A 1ZGAA 2RKHA 4I2OA 3OV8A 3HRSA 1B59A 4IVNA 1KYZA 4L18B 1TNTA 4S04A 3BPXA 3DPTA 2DPUA 2YU3A 3E6CC 4RS8A 4G6DA 3TO9A 2FXAA 2P5KA 3F8CA 3TO6A 3SXYA 3KP7A 5LRSA 4G8XA 5TRDA 3J80K 4HQMA 1YLFA 4KDPA 1G4DA 1UB9A 1I27A 2L3DA 4PDKA 4LD5A 1HQCA 1QNTA 1MGTA 4MHGA 3EQLF 2IVMA 2P6SA 2IA1A 2EK5A 2EFPA 1FC3A 3E3VA 1Q1HA 3ZMVA 2F5CA 5D8LB 2P5VA 4CO8A 2F2EA 1WWXA 3KLNA 2Y75A 3MZYA 5CLSA 4KN7X 4EV0A 5D5WB 3HSFA 4MQVA 4R8HA 2RNJA 1C0WA 3ZN1A 3I54A 2IPQX 2VT2A 1ODDA 4NHJA 2A6EF 3U2RA 5IT9Z 4AIJA 3FZVA 3V4GA 2XROA 4IHTA 2OBPA 1ON1A 5HLIA 4FX4A 2O6GE 2GIVA 1XSXA 1MKMA 4H0EA 5JR3A 3KE2A 4CYDA 5LBQA 4YFNF 5BPDA 3J7AO 1KGSA 2KJCA 2M8EA 3R4KA 1OYIA 2A61A 3NRVA 1F1ZA 3HTSB 2V6CA 3AAFA 4G7ZF 1LVAA 4XLPF 3ULQB 5ILSA 2AS5F 4LG0A 4EJUA 2A68F 3C1DA 4LMYA 3GVAA 1K78A 1IW7F 3MWMA 4ZH4F 1H9TA 4CDGA 1DP7P 4EJVA 5F6FA 3RKWA 5HS9A 3OOPA 1LNWA 3DF8A 2HR3A 1MDMB 2HFHA 4IPAA 2CFXA 4PZJA 1ZGJA 1R36A 1FX7A 5CJ9A 3JAMK 1F9NA 2QUFA 1H9GA 5ICCA 1R1TA 1D8JA 3BPVA 5J8CA 4HX4A 3CDHA 4I01A 1LEBA 4ZYEA 4ZYGA 3RTRA 2W24A 2MD5A 1ZLKA 4LG0B 2LKPA 1XDUA 5K5RA 4G7HF 4AVPA 4WF2A 2W25A 4YG2F 2W57A 1P2FA 1SD4A 5J8FA 3I64A 4EM2A 1OMIA 4BAYA 5FGMA 2VONA 2OU2A 5D6EA 1KYWA 1LJ9A 3F8BA 3MAJA 1FP1D 1OKRA 2VOOA 1RUOA 3R60A 5FB2A 3WU0A 1U5TB 2H6CA 2D45A 4EGZA 4UVBA 1P4WA 3LA3A 5CVVA 3COAC 2XV4S 4LFUA 3WTXC 5KK1A 2QQ9A 1YW8A 2GZWA 3PQKA 1S7OA 3IL2A 1IRFA 3GF2A 3M8FA 2Z3YA 4IRHA 4HX7A 3O6BB 2ZMEA 2MC3A 4ESJA 4M6YA 1ULYA 1QGPA 3E5UA 4ZZLA 3N97A 1XB4A 4FT8A 4OINF 3L9FA 3L7WA 1TW3A 5LGUA 1FSEA 2NYXA 1YTYA 2VC1A 3BROA 3I71A 4UNOA 2RGVA 2W84A 5D4SA 1Z91A 3CO6C 4ESBA 4LGWA 1YYVA 4A2UA 3JSPA 4AD9A 2FF4A 4A0ZA 5F1RA 2O03A 3RPUA 1U5TC 3WU1B 1ZG3A 3WTSC 3ABUA 1JHFA 1ON2A 2ZMEB 1I6XA 1YFHA 4EGYA 2KJBA 4WK8F 2ISYA 1STZA 1S29A 2H27A 2A07F 3GFIA 1KU3A 1J2XA 3GXOA 4A6DA 3EYIA 2ZCWA 4KMFA 1JXSA 3D0SA 3WTWC 2P8TA 4PGGA 5IT9K 5ERIA 4XBFA 2J5OA 4GYGA 1MJ9A 1KQ8A 4M74A 2PMHA 2FE3A 4N9HA 5FD6A 1CF7B 2STTA 1QBJA 1KU9A 5D8KB 1S8NA 2ZO4A 3CTAA 4KYWA 5ILUA 2MLGA 3I58A 1Z9CA 3E97A 2VBYA 4EJWA 2O0YA 4P55A 5DUIA 1WKMA 2FMLA 2FNPA 2P6TA 1EH7A 4UV8A 4U0VA 1MJAA 4EJTA 5HLGA 3DQVC 1FPQA 4KICA 3BOQA 4HA8A 1JGSA 2OQRA 4MEXF 3DXJF 3I4PA 2HDCA 1TLHB 3LFKA 3ISPA 1K6OA 2YSRA 3TKYA 4JK1X 2V1XA 2YR2A 5HOOA 4AIHA 1F4KA 2OAZA 5HDGA 1UHWA 2XAJA 1GVJA 2Q0OA 4Q4ZF 4KMUX 3FMRA 2KIUA 5H20A 5F64A 1DDNA 3RYPA 1BC7C 1P4AA 4PGHA 2EWNA 3TO7A 1U6GA 1E2XA 2H09A 4LLGF 5FO5A 1O3TA 4BNCA 3LSTA 3BWGA 3WTVC 3DP7A 3VB2A 3J81Z 3ZMTA 2OZUA 3WODF 3TDZC 2HKXA 3SHFA 5HDKA 4DQ2A 1MZBA 3BZ6A 3VODA 4JBAA 1R00A 1HKTA 4Z2YA 4WXCA 1G3YA 1YS6A 2G9WA 2VN2A 1I1SA 4YIIA 2NS0A 1HSJA 5HLHA 2MH2A 4RB2C 2Y48A 2VT3A 5CVUA 2O8XA 2BBYA 2IJLA 3BDDA 4R1HA 3MZHA 2JPBA 3ECHA 5EEGA 2K7LA 3I59B 5LHGA 1ZREA 1FY7A 1V3FA 2ISZA 4LK1F 1J0RA 2JSCA 2Q8KA 2FEZA 3WE3A 2QZ8A 1MJBA 2DQLA 4RGRA 3WGGA 5HS8A 2HQNA 2DLLA 2VC0A 3H92A 1XSDA 3Q9SA 5AIQA 1T39A 4EMSA 3WG9A 3QAHA 1IUYA 3HSRA 2EA2A 3REOA 2V9VA 1XMAA 2XAGA 4M9SA 2E7XA 2PMUA 4HLXA 1P6RA 1SD6A 4RB3C 3ECOA 3ELKA 4A0YA 1J7KA 3RIRA 4HAMA 4YFXF 3KFWX 1XGOA 3B02A 1B9MA 1VTNC 3GZ6A 2VODA 2XIGA 2B0LA 1E17A 1RUNA 4KIFA 3VOEA 3CLOA 2XKPA 1W7PB 1J9IA 4OIPF 2AXLA 4S05A 1BM9A 5DUKA 2QLZA 4BHCA 1GXPA 2BYVE 1J5YA 2PQ8A 1BN5A 2JPCA 5KVRA 3FX3A 2D2WA 2DQRA 2VOPA 4CICA 2UXXA 2UXNA 3ZMDA 2EA4A 3BJ6A 3TOBA 1ZRCA 3BJAA 2R7DA 2VBWA 1HW5A 4BHBA 1P4XA 4RGXA 4DNCA 1IXCA 4CXFA 2O61A 3HUGA 5LHHA 3V7CA 2RV8A 4EVIA 2QENA 4G9YA 4U0YA 4ESFA 2PN6A 4LJZF 3LQRA 5E8GA 3IWZA 4Y13A 2X4HA 2L54A 4OOIA 2YPRA 4UHTA 1XDSA 5D5UB 4HW0A 5L3DA 1R58A 1YW9A 3HHHA 1R5HA 3KP4A 1B6AA 2F5FA 5DD8A 1SMTA 2QM3A 1RNLA 5L3EA 3KETA 3S2WA 1WQ2A 5LGNA 2XAQA 4XLNF 2DAOA 2KIMA 4E70A 3K1MA 5BMZA 1Z6TA 1FT9A 4P9FA 4OIOF 4M71A 4GYIA 1OYYA 3RPQA 3J81K 3O3KA 3CUQA 3IRRA 4O6JA 4IJAA 1ZARA 3KP5A 1G3TA 1W5SA 1R5GA 4I7HA 3SFZA 2G7UA 2RN7A 1HSTA 5ILVA 1J75A 2M87A 1FBUA 1O7LA 5TJJA 5L3GA 1ZAOA 2CYYA 1FBQA 2HQRA 4UVAA 5L3CA 4WWCA 4KA4A 2W85A 2FA5A 1KQ9A 3F72A 1O3RA 3CUQB 1K78B 3FHZA 3HSEA 4M9ZA 4QLCU 1HXDA 3VFZA 4G94A 4UUVA 2FBKA 4HX8A 2XKOA 1FLIA 2A69F 3SZTA 3V8LA 2OQGA 3KZZA 3HIFA 4ENNA 2FBHA 3E5QA 1TNSA 1WI9A 3V7SA 3TGNA 3R0JA 4PCQA 4A0XA 4HDUA 2LSOA 3T5XA 4RGSA 3LAPA 4GO1A 3F6OA 3HOTA 1KQ0A 4M72A 1OPCA 5LHIA 3DPLC 2MH9A 2NAZA 3I53A 4GXOA 3GFLA 2DT5A 4I0BA 2ESNA 5CVJA 3FM5A 2EV6A 4HZFA 2XVCA 3K1NA 4L5IA 1HKQA 1B1BA 1AWCA 3K2ZA 4RB1A 2YX4A 5E20A 4BYYA 4OMYA 2EV5A 3GW2A 3HTUA 1T98A 2HGCA 5LRRA 1YO5C 4TV7A 2XUBA 4L9VA 1Z6RA 1ZHFA 3IRQA 4LLNA 4Q48A 2P5LC 2VBXA 1KU7A 4A6EA 1USSA 3FXRA 3IHUA 2P7VB 3HRMA 4MNUA 3HYIA 4ASNA 2JRTA 1IAWA 3CUOA 5BPIA 3WTZA 4A5MA 3PFIA 1W7PD 1IF1A 5L3FA 4GGGA 1EH8A 4L9JA 4L9NA 4B09A 5E17F 2M45A 1L3LA 2K4JA 5HVQC 4IHSA 3GYHX 1LB2A 1U3EM 3DFGA 1BC8C 2DI3A 2H94A 3EDPA 1HW1A 3Q9VA 1O3QA 1PP8F 4ENKA 4Y17A 1SFXA 3RI4A 3WTYC 2FOKA 5JFRA 1T2KA 1SFEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HF1 A;  2DK8 A;  4RAY A;  3JTG A;  3GWZ A;  3K9T A;  1JHH A;  1S3J A;  4L5J A;  2PJP A;  3T0Y A;  1T6S A;  2FQ3 A;  4XSX F;  4ZZD A;  2V79 A;  2DPD A;  3F8F A;  4QWQ A;  4P96 A;  3QPH A;  5D5V B;  1L0O C;  3QRF F;  2L02 A;  3GO5 A;  3WGI A;  3QU3 A;  1B9N A;  3W6K B;  1R23 A;  4KIG A;  5L3B A;  1WRJ A;  4BH9 A;  1OYW A;  4OIR F;  1BI2 A;  1I5Z A;  2FSW A;  1XD7 A;  5LEK A;  4FX0 A;  1YW7 A;  2MBF A;  1UCR A;  3G3Z A;  5ICF A;  4M9X A;  3HRT A;  1U2W A;  1Z7U A;  4M73 A;  2QBY A;  1A04 A;  2HS5 A;  2WWY A;  3H3Z A;  1DUX C;  2A6H F;  2L4A A;  3DKW A;  3KEO A;  2HTJ A;  3E6D A;  4CHU A;  2ACJ A;  2CW0 F;  3DEU A;  5ED4 A;  3D5L A;  1XCB A;  4A5N A;  5HS7 A;  1G3W A;  1BIB A;  2XRN A;  4IRI A;  3M7G A;  3WGH A;  3CO7 C;  4EM0 B;  2E7W A;  3K0L A;  5DDG A;  4JQF A;  2D1H A;  2HOE A;  3GFJ A;  1LQ1 A;  5K1Y A;  2PLY A;  3V8J A;  3RJP A;  1ZYR F;  4HV6 A;  1SD7 A;  4YFK F;  3JSO A;  4HDV A;  3F6V A;  2E1N A;  3GX4 X;  2Q2E A;  5IT3 A;  4K2E A;  4U0W A;  4WXH A;  2ZJ2 A;  3E6M A;  3C7J A;  5H6Q A;  3I0T A;  4XRF A;  2ZNZ A;  3GFM A;  4HV5 A;  1BI1 A;  4MTD A;  1REP C;  1FNN A;  5FFZ A;  3T8R A;  3KP6 A;  5J6X A;  1RIO H;  1DPU A;  3LA7 A;  5DYM A;  2J5P A;  1BI0 A;  1FYM A;  2HKO A;  1R1V A;  3QP6 A;  4I02 A;  3MQ0 A;  2FU4 A;  5H6R A;  1IN5 A;  3MEX A;  1FYL A;  1G6N A;  5E1X A;  3EUH A;  3QPT A;  5CVR A;  2BV6 A;  5DD4 A;  2FMY A;  2M30 A;  1D5V A;  1KU2 A;  1T38 A;  1ZRD A;  1K7A A;  1P92 A;  1QPM A;  3ML6 A;  2FNA A;  1S6L A;  5DCM A;  2XAH A;  1UFM A;  3ERE D;  2CSO A;  1F5T A;  2DBB A;  3GEZ A;  1TQI A;  5EEH A;  1O57 A;  4Y15 A;  2IW5 A;  1UST A;  3HHG A;  5FD5 A;  2VE8 A;  2L4M A;  2Y0M A;  5ICE A;  2RQP A;  5D6F A;  2GA2 A;  2YX7 A;  1XSV A;  1W5T A;  3KEQ A;  2EFW A;  1FP2 A;  3L00 A;  4Q47 A;  3R0A A;  4HOB A;  1ZH5 A;  5DCM B;  4CGZ A;  4HF0 A;  2VBZ A;  1SMY F;  3CJN A;  1IN6 A;  2RDP A;  2LNB A;  4LB5 A;  5E1Z B;  6PAX A;  1XGN A;  2MLK A;  1IZ1 A;  2F5E A;  1H0M A;  2OZ6 A;  5JHU A;  3RKX A;  2G7H A;  2UZK A;  3FF5 A;  4L0Y B;  3IC7 A;  2DTR A;  3WTU C;  1V4R A;  2XHK A;  4G7O F;  1R22 A;  1R1U A;  3W6J B;  1O3S A;  4HF2 A;  2DW4 A;  4I09 A;  2CQK A;  1MD0 A;  3N4M A;  3E5X A;  2PG4 A;  3FMQ A;  3BP8 A;  3LWF A;  3QP5 A;  2EFN A;  1FSH A;  4IF4 A;  3K1P A;  1CGP A;  1S7A A;  3P9K A;  5DEQ A;  4N9I A;  3RDI A;  3KZY A;  4F7Z A;  2NRA C;  4HBL A;  4WCG A;  3O2P E;  2MA3 A;  4IRG A;  1HW2 A;  2K27 A;  1ZG5 A;  3U9G A;  3FXQ A;  3B73 A;  1U8R A;  3I5U A;  1WSU A;  3F23 A;  3GUD A;  2HWV A;  2A3S A;  4A12 A;  2HEO A;  3EYY A;  2P7C B;  1MDM A;  3NQO A;  2HYF A;  4U88 A;  1SFU A;  4XSZ F;  3SQN A;  2EV0 A;  2QQA A;  3ROU A;  4YIF A;  1LDK B;  3L2C A;  1HKS A;  2GQQ A;  2K86 A;  3SZP A;  4EM1 A;  3M1E A;  5BS6 A;  1GHC A;  2GXG A;  2R7F A;  3ZMU A;  2BEO A;  1D3Y A;  2ZNY A;  3VEP A;  3KCC A;  1RI7 A;  4P9U A;  3F3X A;  5CYV A;  2L01 A;  2DO7 A;  4IXA A;  1XCV A;  5LLQ A;  5E18 F;  1QZY A;  1W4M A;  4RAZ A;  1IN4 A;  4BXU A;  3V8K A;  4UXN A;  3RKY A;  4M6X A;  1QQI A;  4KIB A;  2PFB A;  1U5T A;  1ZRF A;  4GCV A;  1B4A A;  2EFO A;  4AIK A;  1BI3 A;  4L0Z B;  4KT5 C;  2LF8 A;  1X3U A;  2UWM A;  2ZKZ A;  2M1B A;  2FRH A;  1Z05 A;  2DK5 A;  4MGR A;  3T1B A;  4R79 A;  3G73 A;  2IA0 A;  2ZXJ A;  2VE9 A;  4P5O A;  4Q5S F;  4I0A A;  5JI6 A;  2V1D A;  2PBI A;  2VXZ A;  2KKO A;  3WTT C;  5ICG A;  1UHM A;  2CWE A;  4HQE A;  1U78 A;  2PEX A;  3TDU C;  4KN4 X;  3R6S A;  3K69 A;  4HLY A;  2QQB A;  2E1C A;  1XGS A;  1BIA A;  2EB7 A;  3QOP A;  1GXQ A;  1RZ4 A;  1FBS A;  4KNY A;  2OD5 A;  2ZBK A;  5AIP A;  3CUQ C;  3TOA A;  2XAS A;  4ZYD A;  1YG2 A;  3ZQ7 A;  2O3F A;  1XGM A;  4AWX B;  1FZP B;  2TDX A;  3ZMS A;  1I1G A;  4LLL A;  5FLX Z;  1TW2 A;  2DU9 A;  2H6B A;  2RC4 A;  3JTH A;  4U7B A;  2EFQ A;  2BE5 F;  4N0B A;  1FWZ A;  3FMS A;  1TBX A;  5HDN A;  3ZP5 A;  1PUE E;  1SD5 A;  2NNY A;  4UV9 A;  2GA1 A;  2Z5U A;  2D1V A;  5D4R A;  3P7N A;  2A5Y B;  3GLX A;  1NHA A;  2CG4 A;  4RB0 A;  2P4W A;  1AOY A;  5BQT A;  3F22 A;  2Z99 A;  4LB6 B;  1ONV A;  1IXS B;  1T0F A;  4FHT A;  2EJR A;  1CF7 A;  2ADU A;  2RVC A;  3C18 A;  4ON0 A;  2HYG D;  3P9I A;  5A2Q Z;  2WV0 A;  5BOX A;  2JT1 A;  3MCZ A;  1HBX G;  1ZN2 A;  3WE2 A;  2GAU A;  2JZY A;  4I98 B;  4HYE A;  3Q5F A;  3FWE A;  1IN7 A;  4OIQ F;  4L9T A;  2WC2 A;  2M5W A;  2V1U A;  1O7F A;  3V7R A;  1J59 A;  3F8N A;  3BJO A;  1D8K A;  5DV5 A;  3J80 Z;  3C3W A;  4EJO A;  1JE8 A;  4CZZ A;  1QO0 D;  5K5Q A;  3HOS A;  4G6Q A;  1BJA A;  2WTE A;  1ZLJ A;  4BQA A;  2LDU A;  1K79 A;  4LK0 F;  2PI0 A;  5D5X B;  1BOA A;  2IP2 A;  4UVC A;  1KA8 A;  2ESH A;  3R61 A;  2HTS A;  2IT0 A;  1ZG1 A;  2X0L A;  1IRG A;  3F21 A;  3QU6 A;  2IA2 A;  1PDN C;  3LAJ A;  3MFK A;  1YS7 A;  4KFC A;  1SAX A;  3M9A A;  1IXR C;  1LEA A;  2GWR A;  4NB5 A;  3GZ5 A;  3RYR A;  2HZT A;  2JTV A;  3BY6 A;  3T8T A;  4BHP A;  3TQN A;  1TQP A;  1G3S A;  3NEU A;  2C6Y A;  5LGT A;  4ETS A;  3KLO A;  2QYO A;  4OMZ A;  2GXB A;  1Z1D A;  2DFI A;  2K4B A;  2CO5 A;  1LDD A;  4KUM A;  2QWW A;  4B8X A;  2BGC A;  3E6B A;  2CGP A;  3U1D A;  2K02 A;  1EV7 A;  4MTE A;  3EET A;  3KP3 A;  1LDJ A;  1XMK A;  1YQA A;  1YIO A;  3ZPL A;  3DV8 A;  4ENJ A;  5JVT A;  5K5O A;  2IRF G;  1EH6 A;  2QBY B;  5CVI A;  5E8I A;  4O3M A;  5FFX A;  3L09 A;  5LEJ A;  3I59 A;  3KP2 A;  2STW A;  1FYK A;  2LF7 A;  2NNN A;  2OA4 A;  1Y0U A;  4D0P A;  3P9C A;  2ETH A;  1DPR A;  5AON A;  4OU0 A;  2ELH A;  3M8E A;  2QVO A;  1TQM A;  4U7D A;  2R3S A;  2XAF A;  2COM A;  4WXD A;  5FLX K;  3PQJ A;  3LQQ A;  3ZMZ A;  4MEY F;  3HRU A;  3JAM Z;  5E1W A;  3IWF A;  3ABT A;  4WX9 A;  4NQW A;  3ZN0 A;  1FOK A;  1XN7 A;  3F8M A;  4ENM A;  1PP7 U;  2Z9O A;  4ZYH A;  3IKT A;  3LA2 A;  1IN8 A;  1OR7 A;  1QZZ A;  1BBY A;  2Z33 A;  1TTY A;  4MQ9 F;  2ZFW A;  2F5D A;  4O5V A;  5DCF A;  3FM3 A;  3H3U A;  4RGU A;  2XGX A;  1R7J A;  2KRF A;  2FBI A;  4EQQ A;  3IKV A;  5A2Q K;  2KIF A;  1W7P A;  3FXU A;  3JW4 A;  1ZGA A;  2RKH A;  4I2O A;  3OV8 A;  3HRS A;  1B59 A;  4IVN A;  1KYZ A;  4L18 B;  1TNT A;  4S04 A;  3BPX A;  3DPT A;  2DPU A;  2YU3 A;  3E6C C;  4RS8 A;  4G6D A;  3TO9 A;  2FXA A;  2P5K A;  3F8C A;  3TO6 A;  3SXY A;  3KP7 A;  5LRS A;  4G8X A;  5TRD A;  3J80 K;  4HQM A;  1YLF A;  4KDP A;  1G4D A;  1UB9 A;  1I27 A;  2L3D A;  4PDK A;  4LD5 A;  1HQC A;  1QNT A;  1MGT A;  4MHG A;  3EQL F;  2IVM A;  2P6S A;  2IA1 A;  2EK5 A;  2EFP A;  1FC3 A;  3E3V A;  1Q1H A;  3ZMV A;  2F5C A;  5D8L B;  2P5V A;  4CO8 A;  2F2E A;  1WWX A;  3KLN A;  2Y75 A;  3MZY A;  5CLS A;  4KN7 X;  4EV0 A;  5D5W B;  3HSF A;  4MQV A;  4R8H A;  2RNJ A;  1C0W A;  3ZN1 A;  3I54 A;  2IPQ X;  2VT2 A;  1ODD A;  4NHJ A;  2A6E F;  3U2R A;  5IT9 Z;  4AIJ A;  3FZV A;  3V4G A;  2XRO A;  4IHT A;  2OBP A;  1ON1 A;  5HLI A;  4FX4 A;  2O6G E;  2GIV A;  1XSX A;  1MKM A;  4H0E A;  5JR3 A;  3KE2 A;  4CYD A;  5LBQ A;  4YFN F;  5BPD A;  3J7A O;  1KGS A;  2KJC A;  2M8E A;  3R4K A;  1OYI A;  2A61 A;  3NRV A;  1F1Z A;  3HTS B;  2V6C A;  3AAF A;  4G7Z F;  1LVA A;  4XLP F;  3ULQ B;  5ILS A;  2AS5 F;  4LG0 A;  4EJU A;  2A68 F;  3C1D A;  4LMY A;  3GVA A;  1K78 A;  1IW7 F;  3MWM A;  4ZH4 F;  1H9T A;  4CDG A;  1DP7 P;  4EJV A;  5F6F A;  3RKW A;  5HS9 A;  3OOP A;  1LNW A;  3DF8 A;  2HR3 A;  1MDM B;  2HFH A;  4IPA A;  2CFX A;  4PZJ A;  1ZGJ A;  1R36 A;  1FX7 A;  5CJ9 A;  3JAM K;  1F9N A;  2QUF A;  1H9G A;  5ICC A;  1R1T A;  1D8J A;  3BPV A;  5J8C A;  4HX4 A;  3CDH A;  4I01 A;  1LEB A;  4ZYE A;  4ZYG A;  3RTR A;  2W24 A;  2MD5 A;  1ZLK A;  4LG0 B;  2LKP A;  1XDU A;  5K5R A;  4G7H F;  4AVP A;  4WF2 A;  2W25 A;  4YG2 F;  2W57 A;  1P2F A;  1SD4 A;  5J8F A;  3I64 A;  4EM2 A;  1OMI A;  4BAY A;  5FGM A;  2VON A;  2OU2 A;  5D6E A;  1KYW A;  1LJ9 A;  3F8B A;  3MAJ A;  1FP1 D;  1OKR A;  2VOO A;  1RUO A;  3R60 A;  5FB2 A;  3WU0 A;  1U5T B;  2H6C A;  2D45 A;  4EGZ A;  4UVB A;  1P4W A;  3LA3 A;  5CVV A;  3COA C;  2XV4 S;  4LFU A;  3WTX C;  5KK1 A;  2QQ9 A;  1YW8 A;  2GZW A;  3PQK A;  1S7O A;  3IL2 A;  1IRF A;  3GF2 A;  3M8F A;  2Z3Y A;  4IRH A;  4HX7 A;  3O6B B;  2ZME A;  2MC3 A;  4ESJ A;  4M6Y A;  1ULY A;  1QGP A;  3E5U A;  4ZZL A;  3N97 A;  1XB4 A;  4FT8 A;  4OIN F;  3L9F A;  3L7W A;  1TW3 A;  5LGU A;  1FSE A;  2NYX A;  1YTY A;  2VC1 A;  3BRO A;  3I71 A;  4UNO A;  2RGV A;  2W84 A;  5D4S A;  1Z91 A;  3CO6 C;  4ESB A;  4LGW A;  1YYV A;  4A2U A;  3JSP A;  4AD9 A;  2FF4 A;  4A0Z A;  5F1R A;  2O03 A;  3RPU A;  1U5T C;  3WU1 B;  1ZG3 A;  3WTS C;  3ABU A;  1JHF A;  1ON2 A;  2ZME B;  1I6X A;  1YFH A;  4EGY A;  2KJB A;  4WK8 F;  2ISY A;  1STZ A;  1S29 A;  2H27 A;  2A07 F;  3GFI A;  1KU3 A;  1J2X A;  3GXO A;  4A6D A;  3EYI A;  2ZCW A;  4KMF A;  1JXS A;  3D0S A;  3WTW C;  2P8T A;  4PGG A;  5IT9 K;  5ERI A;  4XBF A;  2J5O A;  4GYG A;  1MJ9 A;  1KQ8 A;  4M74 A;  2PMH A;  2FE3 A;  4N9H A;  5FD6 A;  1CF7 B;  2STT A;  1QBJ A;  1KU9 A;  5D8K B;  1S8N A;  2ZO4 A;  3CTA A;  4KYW A;  5ILU A;  2MLG A;  3I58 A;  1Z9C A;  3E97 A;  2VBY A;  4EJW A;  2O0Y A;  4P55 A;  5DUI A;  1WKM A;  2FML A;  2FNP A;  2P6T A;  1EH7 A;  4UV8 A;  4U0V A;  1MJA A;  4EJT A;  5HLG A;  3DQV C;  1FPQ A;  4KIC A;  3BOQ A;  4HA8 A;  1JGS A;  2OQR A;  4MEX F;  3DXJ F;  3I4P A;  2HDC A;  1TLH B;  3LFK A;  3ISP A;  1K6O A;  2YSR A;  3TKY A;  4JK1 X;  2V1X A;  2YR2 A;  5HOO A;  4AIH A;  1F4K A;  2OAZ A;  5HDG A;  1UHW A;  2XAJ A;  1GVJ A;  2Q0O A;  4Q4Z F;  4KMU X;  3FMR A;  2KIU A;  5H20 A;  5F64 A;  1DDN A;  3RYP A;  1BC7 C;  1P4A A;  4PGH A;  2EWN A;  3TO7 A;  1U6G A;  1E2X A;  2H09 A;  4LLG F;  5FO5 A;  1O3T A;  4BNC A;  3LST A;  3BWG A;  3WTV C;  3DP7 A;  3VB2 A;  3J81 Z;  3ZMT A;  2OZU A;  3WOD F;  3TDZ C;  2HKX A;  3SHF A;  5HDK A;  4DQ2 A;  1MZB A;  3BZ6 A;  3VOD A;  4JBA A;  1R00 A;  1HKT A;  4Z2Y A;  4WXC A;  1G3Y A;  1YS6 A;  2G9W A;  2VN2 A;  1I1S A;  4YII A;  2NS0 A;  1HSJ A;  5HLH A;  2MH2 A;  4RB2 C;  2Y48 A;  2VT3 A;  5CVU A;  2O8X A;  2BBY A;  2IJL A;  3BDD A;  4R1H A;  3MZH A;  2JPB A;  3ECH A;  5EEG A;  2K7L A;  3I59 B;  5LHG A;  1ZRE A;  1FY7 A;  1V3F A;  2ISZ A;  4LK1 F;  1J0R A;  2JSC A;  2Q8K A;  2FEZ A;  3WE3 A;  2QZ8 A;  1MJB A;  2DQL A;  4RGR A;  3WGG A;  5HS8 A;  2HQN A;  2DLL A;  2VC0 A;  3H92 A;  1XSD A;  3Q9S A;  5AIQ A;  1T39 A;  4EMS A;  3WG9 A;  3QAH A;  1IUY A;  3HSR A;  2EA2 A;  3REO A;  2V9V A;  1XMA A;  2XAG A;  4M9S A;  2E7X A;  2PMU A;  4HLX A;  1P6R A;  1SD6 A;  4RB3 C;  3ECO A;  3ELK A;  4A0Y A;  1J7K A;  3RIR A;  4HAM A;  4YFX F;  3KFW X;  1XGO A;  3B02 A;  1B9M A;  1VTN C;  3GZ6 A;  2VOD A;  2XIG A;  2B0L A;  1E17 A;  1RUN A;  4KIF A;  3VOE A;  3CLO A;  2XKP A;  1W7P B;  1J9I A;  4OIP F;  2AXL A;  4S05 A;  1BM9 A;  5DUK A;  2QLZ A;  4BHC A;  1GXP A;  2BYV E;  1J5Y A;  2PQ8 A;  1BN5 A;  2JPC A;  5KVR A;  3FX3 A;  2D2W A;  2DQR A;  2VOP A;  4CIC A;  2UXX A;  2UXN A;  3ZMD A;  2EA4 A;  3BJ6 A;  3TOB A;  1ZRC A;  3BJA A;  2R7D A;  2VBW A;  1HW5 A;  4BHB A;  1P4X A;  4RGX A;  4DNC A;  1IXC A;  4CXF A;  2O61 A;  3HUG A;  5LHH A;  3V7C A;  2RV8 A;  4EVI A;  2QEN A;  4G9Y A;  4U0Y A;  4ESF A;  2PN6 A;  4LJZ F;  3LQR A;  5E8G A;  3IWZ A;  4Y13 A;  2X4H A;  2L54 A;  4OOI A;  2YPR A;  4UHT A;  1XDS A;  5D5U B;  4HW0 A;  5L3D A;  1R58 A;  1YW9 A;  3HHH A;  1R5H A;  3KP4 A;  1B6A A;  2F5F A;  5DD8 A;  1SMT A;  2QM3 A;  1RNL A;  5L3E A;  3KET A;  3S2W A;  1WQ2 A;  5LGN A;  2XAQ A;  4XLN F;  2DAO A;  2KIM A;  4E70 A;  3K1M A;  5BMZ A;  1Z6T A;  1FT9 A;  4P9F A;  4OIO F;  4M71 A;  4GYI A;  1OYY A;  3RPQ A;  3J81 K;  3O3K A;  3CUQ A;  3IRR A;  4O6J A;  4IJA A;  1ZAR A;  3KP5 A;  1G3T A;  1W5S A;  1R5G A;  4I7H A;  3SFZ A;  2G7U A;  2RN7 A;  1HST A;  5ILV A;  1J75 A;  2M87 A;  1FBU A;  1O7L A;  5TJJ A;  5L3G A;  1ZAO A;  2CYY A;  1FBQ A;  2HQR A;  4UVA A;  5L3C A;  4WWC A;  4KA4 A;  2W85 A;  2FA5 A;  1KQ9 A;  3F72 A;  1O3R A;  3CUQ B;  1K78 B;  3FHZ A;  3HSE A;  4M9Z A;  4QLC U;  1HXD A;  3VFZ A;  4G94 A;  4UUV A;  2FBK A;  4HX8 A;  2XKO A;  1FLI A;  2A69 F;  3SZT A;  3V8L A;  2OQG A;  3KZZ A;  3HIF A;  4ENN A;  2FBH A;  3E5Q A;  1TNS A;  1WI9 A;  3V7S A;  3TGN A;  3R0J A;  4PCQ A;  4A0X A;  4HDU A;  2LSO A;  3T5X A;  4RGS A;  3LAP A;  4GO1 A;  3F6O A;  3HOT A;  1KQ0 A;  4M72 A;  1OPC A;  5LHI A;  3DPL C;  2MH9 A;  2NAZ A;  3I53 A;  4GXO A;  3GFL A;  2DT5 A;  4I0B A;  2ESN A;  5CVJ A;  3FM5 A;  2EV6 A;  4HZF A;  2XVC A;  3K1N A;  4L5I A;  1HKQ A;  1B1B A;  1AWC A;  3K2Z A;  4RB1 A;  2YX4 A;  5E20 A;  4BYY A;  4OMY A;  2EV5 A;  3GW2 A;  3HTU A;  1T98 A;  2HGC A;  5LRR A;  1YO5 C;  4TV7 A;  2XUB A;  4L9V A;  1Z6R A;  1ZHF A;  3IRQ A;  4LLN A;  4Q48 A;  2P5L C;  2VBX A;  1KU7 A;  4A6E A;  1USS A;  3FXR A;  3IHU A;  2P7V B;  3HRM A;  4MNU A;  3HYI A;  4ASN A;  2JRT A;  1IAW A;  3CUO A;  5BPI A;  3WTZ A;  4A5M A;  3PFI A;  1W7P D;  1IF1 A;  5L3F A;  4GGG A;  1EH8 A;  4L9J A;  4L9N A;  4B09 A;  5E17 F;  2M45 A;  1L3L A;  2K4J A;  5HVQ C;  4IHS A;  3GYH X;  1LB2 A;  1U3E M;  3DFG A;  1BC8 C;  2DI3 A;  2H94 A;  3EDP A;  1HW1 A;  3Q9V A;  1O3Q A;  1PP8 F;  4ENK A;  4Y17 A;  1SFX A;  3RI4 A;  3WTY C;  2FOK A;  5JFR A;  1T2K A;  1SFE A; 
#chains in the Genus database with same CATH topology
 4HF1 A;  2DK8 A;  2ZME C;  4RAY A;  3HOV J;  3JTG A;  1VQK I;  3L2W A;  2NVX J;  2ELK A;  3GWZ A;  1WZ2 A;  4XRS A;  1YJN I;  1BL0 A;  3JRB A;  2EZH A;  3K9T A;  4XQF A;  4CCM A;  4AM3 A;  1JHH A;  1S3J A;  5IYC J;  4L5J A;  4CCK A;  2PJP A;  2V4J C;  3T0Y A;  1T6S A;  1VI0 A;  1K4T A;  2FQ3 A;  4UB6 C;  4BE0 A;  1ITY A;  1YRN B;  4XSX F;  4ZZD A;  5C3E J;  3CMM A;  4N4O B;  1W36 C;  2V79 A;  1Y0N A;  2DPD A;  3KIO A;  2XAU A;  3F8F A;  4QWQ A;  5F0C A;  1E3H A;  4P96 A;  4B47 A;  3QPH A;  5D5V B;  1FOX A;  1X1D A;  1L0O C;  2K9L A;  3QRF F;  1T0F C;  2L02 A;  4B48 A;  3GO5 A;  3WGI A;  2K3F A;  3QU3 A;  5FRM A;  1B9N A;  4C2T A;  3W6K B;  3SZG A;  1R23 A;  5GTI C;  4KIG A;  2EBI A;  2LY1 A;  3HC7 A;  4JP0 A;  3K4B A;  5L3B A;  1WRJ A;  4BH9 A;  3CC7 I;  1OYW A;  2K85 A;  2XF7 A;  1WH7 A;  5HOD A;  1YJW I;  4OIR F;  1BI2 A;  1I5Z A;  2EIJ H;  2FSW A;  1ACI A;  3ABM H;  3S1M J;  2L7K A;  1XD7 A;  3KYC B;  2D5V A;  5LEK A;  4FX0 A;  1YW7 A;  2MBF A;  1UCR A;  1X1B A;  3G3Z A;  5ICF A;  4M9X A;  3HRT A;  1U2W A;  2DTZ A;  2HOT A;  1Z7U A;  1TC3 C;  4DYQ A;  1E3O C;  4BAC A;  4M73 A;  1PYV A;  2QBY A;  1A04 A;  2HS5 A;  2I8D A;  1IRZ A;  4UB8 C;  1MBK A;  3H3Z A;  2WWY A;  4A3F J;  4N4N B;  3AG3 H;  2A6H F;  1DUX C;  2MG4 A;  3ZGK A;  1MMS A;  2L4A A;  3DKW A;  3KEO A;  1TZL A;  2HTJ A;  2VKV A;  3E6D A;  1HLV A;  4CHU A;  1RKT A;  2ACJ A;  2CW0 F;  3G71 I;  3HOZ J;  3DEU A;  5ED4 A;  1ZR2 A;  2M2E A;  3D5L A;  3G1L A;  1XCB A;  5GPC A;  1N25 A;  4A5N A;  5HS7 A;  4BS9 A;  1FIP A;  1G3W A;  1FTZ A;  1BIB A;  2XGC A;  1DU6 A;  2XRN A;  4IRI A;  3M7G A;  3WGH A;  3CO7 C;  4Y7N J;  2BY2 A;  4D1Q A;  4EM0 B;  2E7W A;  3K0L A;  2ZJR F;  5DDG A;  5GAD J;  4JQF A;  1SFK A;  2D1H A;  2HOE A;  3GFJ A;  1G2H A;  3BZC A;  1LQ1 A;  5K1Y A;  2PLY A;  1Z3Y A;  3V8J A;  3RJP A;  1ZYR F;  4HV6 A;  1SD7 A;  3CMA I;  4YFK F;  3JSO A;  4HDV A;  4ZDL A;  3F6V A;  1WJB A;  2E1N A;  3GX4 X;  1WJF A;  2Q2E A;  2DOF A;  4MO7 A;  5IT3 A;  4K2E A;  4U0W A;  4WXH A;  2R92 J;  1OCT C;  2ZJ2 A;  3A4C A;  3E6M A;  5FKO A;  3C7J A;  5H6Q A;  4A3K J;  3I0T A;  4XRF A;  1RR8 C;  1YIJ I;  3RCO A;  2ZNZ A;  3GFM A;  4HV5 A;  1BI1 A;  3CJQ B;  4MTD A;  4E7K A;  2FOW A;  4B43 A;  1REP C;  1FNN A;  4HG2 A;  1DP3 A;  5CKT A;  5FFZ A;  3T8R A;  3KP6 A;  5J6X A;  2L2O A;  3JRC A;  1RIO H;  1DPU A;  3LA7 A;  2COB A;  5DYM A;  2J5P A;  1XG1 A;  3I4M J;  1BI0 A;  1FYM A;  2HKO A;  1R1V A;  2W48 A;  1HDP A;  3QP6 A;  4I02 A;  3MQ0 A;  3OYN A;  2OUM A;  2BHZ A;  2L9R A;  1IO2 A;  2XGE A;  2CV1 A;  3OWT A;  2FU4 A;  4MFE A;  5H6R A;  1IN5 A;  2IBD A;  3MEX A;  1MH4 A;  2Y30 A;  1FYL A;  2E71 A;  2DJI A;  2WY7 Q;  3BC8 A;  1G6N A;  5E1X A;  3K6G A;  4AU7 A;  3EUH A;  3QPT A;  5CVR A;  2BV6 A;  1ETK A;  5DD4 A;  3OL3 A;  1X3Z B;  4FCY A;  5HNF A;  3W2A A;  2FMY A;  4CA0 A;  1VQM I;  3OL4 A;  4XN0 A;  2M30 A;  3DCF A;  1D5V A;  1KU2 A;  1T38 A;  1ZRD A;  1K7A A;  1P92 A;  1QPM A;  3ML6 A;  2FNA A;  1S6L A;  3DTI A;  5DCM A;  3KZI C;  2ICW G;  2XAH A;  1I50 J;  5IYD J;  1UFM A;  3H3V K;  2E1O A;  3ERE D;  2CSO A;  1F5T A;  2DBB A;  1BR2 A;  3GEZ A;  1TQI A;  3H5A A;  5EEH A;  5FKK A;  1O57 A;  3K4N A;  3ONQ A;  1PUF B;  3DKX A;  3GTL J;  3PUF A;  4A3M J;  4Y15 A;  2IW5 A;  1UST A;  2QGU A;  3HHG A;  3HGG A;  2VE8 A;  2XRL A;  3O8G A;  5FD5 A;  2L4M A;  2Y0M A;  5ICE A;  2W7N A;  2RQP A;  2NVY J;  3HL2 A;  5D6F A;  2GA2 A;  2NXN B;  5EG0 B;  2YX7 A;  1XSV A;  4E7I A;  3OMY A;  4UY8 I;  3HPH A;  3J7A Y;  4PUS A;  2Y69 H;  3S1Q J;  1W5T A;  1N78 A;  4M3E A;  4XKV A;  1LFB A;  3DKY A;  3KEQ A;  3PO3 J;  2EFW A;  1FP2 A;  2CFO A;  4BXX J;  3L00 A;  1S9H A;  1Z77 A;  4W1U A;  3NWS A;  4Q47 A;  3R0A A;  4HOB A;  1ZH5 A;  2A6T A;  5IOY A;  2HOS A;  5DCM B;  1JUM A;  4CGZ A;  4Y52 J;  4HF0 A;  2V1N A;  2VBZ A;  1HA8 A;  1SMY F;  1IDY A;  3CJN A;  4XKB A;  4H4K C;  1IN6 A;  4E6K G;  2WAD A;  1DQU A;  3HKZ N;  2RDP A;  3U1K A;  3CES A;  3BQY A;  2LNB A;  4LB5 A;  1U0J A;  5E1Z B;  3I4N J;  3GTJ J;  5M3F J;  6PAX A;  1XGN A;  2MLK A;  1IZ1 A;  2F5E A;  1H0M A;  2OZ6 A;  4M3B A;  5JHU A;  2V26 A;  2F4O B;  3RKX A;  2OTL I;  3K4C A;  2G7H A;  2UZK A;  2BZT A;  3FF5 A;  5K7Z A;  3CF5 F;  4L0Y B;  3IC7 A;  2DTR A;  3WTU C;  2K9S A;  1V4R A;  2DA7 A;  3PNV A;  3RPU D;  2VQL A;  1H89 C;  4JYK A;  3FXO A;  1RC9 A;  4IHV A;  2XHK A;  1JUP A;  3K2A A;  4G7O F;  4BKX A;  1R22 A;  1R1U A;  5GAG J;  2VIX A;  3FHN A;  2JA7 J;  2M34 A;  2LLK A;  3E7L A;  1X4O A;  3W6J B;  3CCJ I;  5J1Y A;  2HYJ A;  5B66 C;  1O3S A;  4HF2 A;  2R7T A;  2DW4 A;  3Q0W A;  1SVL A;  5GPA A;  2MD0 A;  5DS9 A;  1W0T A;  4I09 A;  1Q1V A;  2CQK A;  1MD0 A;  3H0G J;  3VSK A;  3OYK A;  3N4M A;  3E5X A;  2PG4 A;  3FMQ A;  1P9Q C;  3BP8 A;  3LWF A;  5J1R A;  4AYB A;  9ANT A;  3QP5 A;  2EFN A;  4X6A J;  1FSH A;  2KIQ A;  4IF4 A;  1MMD A;  4DOZ A;  1JKR C;  3K1P A;  1IDZ A;  2XF5 A;  1CGP A;  1S7A A;  3P9K A;  2ZB9 A;  5DEQ A;  4N9I A;  3RDI A;  3KZY A;  4LG3 A;  4F7Z A;  2NRA C;  4HBL A;  4WCG A;  2K9Q A;  4J19 A;  4AC0 A;  3O2P E;  3LFU A;  2EZK A;  2MA3 A;  3CDL A;  4IRG A;  1WFX A;  1HW2 A;  2IS2 A;  1QZE A;  2K27 A;  1ZG5 A;  3ASO H;  3U9G A;  2ME0 A;  3FXQ A;  3LOC A;  3B73 A;  1U8R A;  3I5U A;  1WSU A;  3F23 A;  4XON A;  3GUD A;  2HWV A;  5B5E C;  3QWL A;  2VQH A;  4BEH A;  2A3S A;  2E35 A;  3BR1 A;  4A12 A;  1SC7 A;  3CCM I;  2HEO A;  3EYY A;  2P7C B;  2QSF X;  3E1S A;  1MDM A;  3NQO A;  2HYF A;  4U88 A;  3C2B A;  4FTH A;  1SFU A;  4XSZ F;  3SQN A;  2EV0 A;  2QQA A;  1ETW A;  3ROU A;  4YIF A;  4F52 A;  2V6E A;  1LDK B;  3L2C A;  1HKS A;  4HNV A;  1R4M B;  2QF7 A;  2GQQ A;  3K4M A;  4II2 A;  2K86 A;  3CCY A;  3SZP A;  4EM1 A;  3M1E A;  1VND A;  4II3 A;  5BS6 A;  5CQG A;  1GHC A;  3AFH A;  2GXG A;  1B8I A;  2R7F A;  4GFB A;  2XPU A;  3ZMU A;  2BEO A;  1D3Y A;  2ID3 A;  2X51 A;  1PVE A;  2ZNY A;  3VEP A;  3KCC A;  1RI7 A;  5GTH C;  1SVO A;  4L5E A;  4P9U A;  4E7L A;  3F3X A;  2BXY A;  1QHH D;  2EIN H;  3FIS A;  5CYV A;  2L01 A;  2DO7 A;  4IXA A;  1XCV A;  5LLQ A;  3LMM A;  5E18 F;  3K4K A;  1VQN I;  2EPF A;  1QZY A;  1FOW A;  3BG6 A;  1BR1 A;  5DM7 F;  1W4M A;  1JJ8 C;  4RAZ A;  1IN4 A;  4BXU A;  3V8K A;  3IAS 2;  4UXN A;  3ZQI A;  3RKY A;  3VYU B;  4M6X A;  1QQI A;  4KIB A;  1EKE A;  2PFB A;  5TIS C;  2CUZ A;  1U5T A;  1N77 A;  5FRO A;  3IUO A;  3QOE A;  4GCV A;  1ZRF A;  1B4A A;  5EYR A;  2DA4 A;  2EFO A;  1BI3 A;  4AIK A;  5CPR B;  4KT5 C;  4L0Z B;  2KRH A;  2LF8 A;  3A0H C;  1X3U A;  2UWM A;  1GT0 C;  2ZKZ A;  2M1B A;  2FRH A;  1Z05 A;  2DK5 A;  4MGR A;  3T1B A;  4CCO A;  4R79 A;  3G73 A;  1T95 A;  2X9D A;  5J4Y A;  1KON A;  2IA0 A;  1WVR A;  2ZXJ A;  3OYE A;  2VE9 A;  4P5O A;  1IGN A;  4Q5S F;  4I0A A;  5JI6 A;  4ZTJ A;  3GBG A;  2V1D A;  1X1P A;  4A3L J;  3DWL E;  2K5C A;  2PBI A;  2VXZ A;  4E7H A;  2KKO A;  5E79 C;  3TW7 A;  3WTT C;  1K4S A;  2QCO A;  2LD5 A;  5ICG A;  2KFD A;  4CYC A;  1UHM A;  3HEF A;  2CWE A;  4HQE A;  2Z16 A;  1U78 A;  2PEX A;  1JKO C;  3TDU C;  4KN4 X;  2Z1D A;  3R6S A;  1X2N A;  3PNT A;  2ZXW H;  3K69 A;  4HLY A;  2QQB A;  4ABZ A;  3A01 B;  2E1C A;  1XGS A;  1VQ9 I;  1OCO H;  4GRI A;  1BIA A;  4HNT A;  2EB7 A;  1BR4 A;  3QOP A;  4NC6 A;  4F3Q A;  1GXQ A;  2Y2Z A;  2DA6 A;  3J7Y J;  1RZ4 A;  3QYF A;  4BE2 A;  3OYH A;  1WJ5 A;  1W0U A;  1FBS A;  4KNY A;  1GV5 A;  3RSN A;  2OD5 A;  2ZBK A;  5AIP A;  3CUQ C;  3S17 J;  3TOA A;  2XAS A;  4ZYD A;  1YG2 A;  3ZQ7 A;  2O3F A;  1XGM A;  4AWX B;  1FZP B;  2TDX A;  5FLM J;  3ZMS A;  1I1G A;  2VUM J;  3BR5 A;  4MFD A;  3AL0 C;  2EH3 A;  4LLL A;  2R7Q A;  5FLX Z;  1TW2 A;  2DU9 A;  2H6B A;  2RC4 A;  3JTH A;  4U7B A;  1Z21 A;  4CYC B;  2EFQ A;  2BE5 F;  4N0B A;  3D5R C;  1FWZ A;  3FMS A;  1TBX A;  2CV0 A;  1YE9 A;  5HDN A;  3ZP5 A;  1PUE E;  1SD5 A;  2CQN A;  2HPM A;  2NNY A;  2DYS H;  2OCE A;  3SEQ A;  5IPA A;  4UV9 A;  2IS6 A;  2GA1 A;  2Z5U A;  2D1V A;  1OCC H;  1QVT A;  4RLQ A;  4CCL A;  5D4R A;  3CF2 A;  3HOW J;  3P7N A;  2A5Y B;  2DDA A;  3GLX A;  1NHA A;  3DBL B;  3W6V A;  2CG4 A;  4RB0 A;  5J47 A;  2P4W A;  3TP0 A;  2X48 A;  4KT6 A;  1XX5 A;  1MBJ A;  1AOY A;  5BQT A;  3F22 A;  2Z99 A;  4LB6 B;  2B63 J;  1ONV A;  2GM4 A;  1IXS B;  1GVD A;  1T0F A;  4FHT A;  2XC7 A;  2EJR A;  3F0C A;  1CF7 A;  2ADU A;  2VI6 A;  3HOU J;  5E3N A;  2BVM A;  5H2F C;  2RVC A;  3C18 A;  3PFY A;  4ON0 A;  2EZL A;  2HYG D;  3FBN B;  3P9I A;  5A2Q Z;  2WV0 A;  3OIQ A;  5BOX A;  2JT1 A;  1ZEL A;  3MCZ A;  3FK7 A;  4A93 J;  2QKM B;  1HBX G;  5C4X J;  1ZN2 A;  3WE2 A;  2GAU A;  2JZY A;  4I98 B;  3AG4 H;  1GUU A;  3BR6 A;  3ZQQ A;  4HYE A;  3S3O A;  3Q5F A;  4BQN A;  4D5F A;  3FWE A;  3KEY A;  1IN7 A;  4I6Z A;  4OIQ F;  2EIK H;  3IH3 A;  3LL7 A;  3JRH A;  2IEK A;  4L9T A;  3HOX J;  2CW7 A;  1QPI A;  2WC2 A;  1MMN A;  2M5W A;  2V1U A;  2DFH A;  1O7F A;  4IQ4 A;  1D1A A;  2DA5 A;  3L2V A;  3E0J B;  3V7R A;  1LFP A;  3PJR A;  4GDF A;  3OR2 C;  1J59 A;  3LSK A;  2MFZ A;  3F8N A;  1RES A;  3BJO A;  1D8K A;  4NNJ A;  5DV5 A;  2BW3 A;  3H1C A;  4ZYA A;  3J80 Z;  1VZ0 A;  3C3W A;  3VYR B;  3S3M A;  4EJO A;  4IO9 F;  2R7R A;  1JE8 A;  4CZZ A;  3DLA A;  1QO0 D;  1D1C A;  4BDY A;  2XDV A;  1UAA A;  5FLV A;  5K5Q A;  5K7F A;  3RQI A;  2DMN A;  2L0K A;  3ZRG A;  3HOS A;  2NOG A;  4G6Q A;  3MKY B;  1ORK A;  2MGQ A;  1BJA A;  2WTE A;  2F6C A;  1ZLJ A;  4BQA A;  2GIZ A;  2E5Z A;  2LDU A;  4UUT A;  1WPK A;  1K79 A;  4LK0 F;  2E34 A;  4QSH A;  2AHQ A;  2BOL A;  2PI0 A;  1BOB A;  5D5X B;  3DBH B;  1BOA A;  2IP2 A;  4UVC A;  1KA8 A;  2ESH A;  3R61 A;  1YI2 I;  4XR6 A;  4YEJ A;  2HTS A;  2IT0 A;  1ZG1 A;  3L2R A;  2X0L A;  1IRG A;  4QPQ A;  3F21 A;  3HJE A;  2IA2 A;  3QU6 A;  4LIV A;  1PDN C;  3LAJ A;  3MFK A;  1A6I A;  1YS7 A;  4KFC A;  3OIO A;  1SAX A;  5KHD A;  1D5Y A;  3ABK H;  2AQE A;  2K9M A;  4JX5 A;  2MSY A;  1IXR C;  1LEA A;  3M9A A;  4D7N A;  2GWR A;  2QQ8 A;  2IGO A;  3OR1 C;  4NB5 A;  3GZ5 A;  3RYR A;  2ECB A;  4A3B J;  3DLL F;  2HZT A;  2JTV A;  2MC4 A;  1V5F A;  3BY6 A;  2Y9Y A;  3T8T A;  4BHP A;  4Z6Y A;  1RR7 A;  3TQN A;  1TQP A;  1G3S A;  3FXM A;  3NEU A;  2C6Y A;  2VJJ A;  3ABL H;  4ETS A;  3KLO A;  2QYO A;  3CP2 A;  4OMZ A;  5LGT A;  2EIL H;  2GXB A;  3UR3 C;  1Z1D A;  2DFI A;  2K4B A;  2CO5 A;  1LDD A;  4KUM A;  2XSD C;  2O8K A;  1VQP I;  2QWW A;  1FMV A;  3WU2 C;  2IGK A;  3EUA A;  2KT0 A;  4B3A A;  3L1P A;  4IOA F;  4B8X A;  2BGC A;  3E6B A;  2IS1 A;  2JK3 A;  2VLA A;  2CGP A;  2E60 A;  2LG4 A;  1TWG J;  3U1D A;  2K02 A;  2OF7 A;  4DIQ A;  4DBR A;  1EV7 A;  2X1D A;  3K4L A;  4MTE A;  2JWT A;  1HF0 A;  2DYR H;  3FBI B;  3EET A;  1F43 A;  4XRS G;  3RQ4 A;  3KP3 A;  1LDJ A;  1XMK A;  1YQA A;  3SFI A;  1YIO A;  2BY0 A;  2UV1 A;  2DOD A;  1X2M A;  2HNH A;  3V42 A;  3G1M A;  3VPR A;  3ZR8 X;  3ZPL A;  3D5S C;  2YU9 J;  2VJI A;  3DV8 A;  4HRI A;  2AXT C;  3VWB A;  3CC2 I;  3BG3 A;  2YS9 A;  2LR8 A;  4ENJ A;  3Q3S A;  1MBE A;  5JVT A;  5K5O A;  3WHC A;  2IRF G;  1EH6 A;  2VJ5 A;  2QBY B;  5CVI A;  5E8I A;  1SVM A;  4O3M A;  2PX9 A;  5E3O A;  5FFX A;  3TED A;  2E1M B;  4PK4 A;  5HNH A;  3L09 A;  5LEJ A;  3I59 A;  3QPS A;  3QOD A;  5CQE A;  3KP2 A;  4C3H J;  1WCM J;  2LMD A;  2E2H J;  2STW A;  4OAY A;  1FYK A;  1SAU A;  4XNF A;  2LF7 A;  3CQZ J;  2NNN A;  2OA4 A;  1Y0U A;  1ZKG A;  3PM1 A;  4D0P A;  1MBF A;  3LSI A;  3P9C A;  2ETH A;  1VQL I;  1DPR A;  5AON A;  4OU0 A;  5B1B H;  2E2J J;  1OCZ H;  2ELH A;  5EF6 A;  3NWT A;  3M8E A;  2R4G A;  1T08 B;  4U87 A;  3S32 A;  4MIM A;  2QVO A;  1TQM A;  1IUF A;  4U7D A;  2R3S A;  2XAF A;  4X0G A;  2COM A;  4PJ0 C;  4WXD A;  2KPM A;  2BXZ A;  2N8G A;  5FLX K;  3PQJ A;  3LQQ A;  3ZMZ A;  4MEY F;  2R0Q C;  3HRU A;  3S16 J;  3JAM Z;  4CSW A;  5E1W A;  3IWF A;  3ZCO A;  1SAN A;  3ABT A;  4WX9 A;  4NQW A;  4RLF A;  1OFC X;  3ZN0 A;  1XN7 A;  3F8M A;  1FOK A;  3M07 A;  4ENM A;  2WAE A;  1E0E A;  1PP7 U;  2Z9O A;  3BG7 A;  4ZYH A;  2Q2E B;  5IP7 J;  2R93 J;  3IKT A;  2JN6 A;  3LA2 A;  1IN8 A;  1OR7 A;  1QZZ A;  4BJ5 C;  4J01 A;  3IV5 A;  1BBY A;  2Z33 A;  1TTY A;  2FD5 A;  5J40 A;  3S1N J;  2EZI A;  4MQ9 F;  1NK3 P;  3WHB A;  4BDZ A;  1XC5 A;  1TP4 A;  2ZFW A;  4KJZ A;  1A35 A;  2DMU A;  2LC2 A;  2F5D A;  4O5V A;  5DCF A;  2XB5 A;  3FM3 A;  3H3U A;  4F91 B;  4RGU A;  2E1M C;  2XGX A;  1R7J A;  2KRF A;  3VSL A;  3OYI A;  4BQQ A;  2FBI A;  4EQQ A;  5J3L A;  4XK4 A;  1LE8 A;  3IKV A;  1N75 A;  5A2Q K;  2KIF A;  2KMU A;  4XLH A;  1YX3 A;  1X1C A;  1W7P A;  1TL8 A;  3FXU A;  2V7F A;  3JW4 A;  1ZGA A;  2RKH A;  1VQ8 I;  4I2O A;  1I39 A;  3OV8 A;  3HRS A;  1B59 A;  3Q0U A;  4IVN A;  4QPO A;  3H9J A;  3S2H J;  1KYZ A;  3H35 A;  3I3L A;  1V55 H;  3CLQ A;  4L18 B;  1ZK8 A;  2ELJ A;  3LNQ A;  2GOX B;  1TNT A;  2HDD A;  1TWC J;  4S04 A;  2W4S A;  2IGN A;  3BPX A;  3A1Y A;  3DPT A;  2DPU A;  3JRG A;  2YU3 A;  3E6C C;  4ANJ A;  1OCR H;  5KAI C;  4IOC F;  4RS8 A;  4G6D A;  1SFO J;  3TO9 A;  1XPX A;  2FXA A;  2P5K A;  3F8C A;  3TO6 A;  2CS3 A;  1TWA J;  3SXY A;  1BW5 A;  3KP7 A;  4G8X A;  5LRS A;  2WY8 Q;  5TRD A;  3J80 K;  1LPQ A;  3S14 J;  2R7S A;  4RDU A;  1JI8 A;  2HQA A;  4HQM A;  4S0H B;  1XTA A;  3TMO A;  3JRE A;  4M3D A;  1YLF A;  1LE8 B;  2JQ7 A;  2M9H A;  2M0M A;  1JT0 A;  1WGX A;  4UUS A;  4KDP A;  3P5J A;  1Y8R B;  1IV8 A;  1QRY A;  3ESW B;  3S8P A;  2I5U A;  4RM3 A;  2V9P A;  1G4D A;  1V54 H;  1UB9 A;  3L2U A;  3M8J A;  3DEE A;  1IRX A;  2ZC2 A;  1I27 A;  2L3D A;  4PDK A;  1IC8 A;  3MKW B;  4LD5 A;  1HQC A;  2JRM A;  4ZJZ A;  4V2F A;  1QNT A;  2LOO A;  3OYD A;  1MGT A;  2LH9 A;  3JRA A;  4MHG A;  4A3G J;  1V5E A;  1Y56 A;  3EQL F;  4BBR J;  3B6C A;  2IVM A;  2P6S A;  2R7U A;  2IA1 A;  2EK5 A;  1WJA A;  2EFP A;  1FC3 A;  3E3V A;  4PSW A;  1Q1H A;  3VYT B;  3ZMV A;  4FAS D;  2R7Z J;  2F5C A;  4AUX A;  4IKF A;  3BCA A;  5D8L B;  2P5V A;  4CO8 A;  4XOT A;  2F2E A;  3BCB A;  1WWX A;  3RZD J;  4DJA A;  3KLN A;  2Y75 A;  2L7M P;  4XOR A;  4F55 A;  3MZY A;  4BGD A;  3OS0 A;  5CLS A;  2DT7 B;  4KN7 X;  4EV0 A;  1H8A C;  2WAF A;  5D5W B;  4EAT A;  2WB1 N;  3HSF A;  4UUS B;  4MQV A;  3S1R J;  4R8H A;  4Y33 A;  2RNJ A;  1C0W A;  3ZN1 A;  3S3N A;  5FKN A;  1NH3 A;  3EUH C;  3I54 A;  2OJE D;  1PJR A;  2IPQ X;  2VT2 A;  4CH7 A;  2ZSI B;  1ODD A;  4NHJ A;  3G2B A;  2A6E F;  4BL0 B;  2W00 A;  3F9K A;  2Z2S B;  3U2R A;  2W82 A;  4XRM A;  5C4J J;  3OS1 A;  5IT9 Z;  5KNL A;  1APL C;  4BBS J;  4AIJ A;  3FZV A;  3V4G A;  2XRO A;  4IHT A;  2YUS A;  2A5W A;  2OBP A;  4LOC A;  1FMW A;  3I55 I;  1ON1 A;  3MKL A;  3CCS I;  5HLI A;  2NVQ J;  4FX4 A;  2HVR A;  1JTY A;  2O6G E;  2GIV A;  4MLO A;  1XSX A;  1MKM A;  2DJN A;  2EIM H;  4E4H A;  4H0E A;  5JR3 A;  3KE2 A;  2RRE A;  4CYD A;  5JLX A;  1I3A A;  2K3P A;  3OIP A;  2VKD A;  5LBQ A;  4YFN F;  5BPD A;  5FKM A;  3J7A O;  1OIS A;  4RBO A;  3CCR I;  3GZN B;  2BVL A;  1KGS A;  4PJJ A;  2KJC A;  2M8E A;  3BG9 A;  2M8G X;  5JLW A;  2WA0 A;  3R4K A;  3ZXS A;  1ERD A;  1OYI A;  1VQO I;  2A61 A;  3NRV A;  1F1Z A;  3HTS B;  2V6C A;  4YEL A;  1DU0 A;  2ECC A;  3AAF A;  4G7Z F;  1I3Q J;  1LVA A;  4XLP F;  3HG9 A;  2ID6 A;  1YX5 A;  3ULQ B;  5ILS A;  3HB9 A;  1WJD A;  4E7J A;  3BTL A;  2AS5 F;  3EPZ A;  4LG0 A;  4EJU A;  1ZR4 A;  2A68 F;  3OYM A;  3C1D A;  1NK2 P;  4LMY A;  3GVA A;  1K78 A;  1IW7 F;  2Q1Z B;  3MWM A;  4ZH4 F;  2X1E A;  1H9T A;  4BEH B;  3CME I;  4CDG A;  1DP7 P;  4EJV A;  2XPV A;  2XGD A;  4YRV A;  1P7I A;  5F6F A;  2PMZ N;  3RKW A;  5HS9 A;  3OOP A;  1LNW A;  3DF8 A;  2HR3 A;  1UHS A;  2CU7 A;  4QTR A;  1MDM B;  2X6W A;  2HFH A;  1D1B A;  4IPA A;  1UG2 A;  2TRT A;  3IH4 A;  1QVU A;  2OCC H;  2Y0S N;  3WG7 H;  3PIP F;  2CFX A;  5B3S H;  1S72 I;  2R7O A;  1ZGJ A;  2VXD A;  4PZJ A;  1R36 A;  1FX7 A;  2FQ4 A;  4IX7 A;  3DU6 A;  5CJ9 A;  3JAM K;  5EZG A;  1F9N A;  2QUF A;  1H9G A;  5ICC A;  1R1T A;  1D8J A;  3BPV A;  5J8C A;  2GOM A;  3LSJ A;  4HX4 A;  3CDH A;  4I01 A;  1LEB A;  1VQ4 I;  4ZYE A;  3HKZ A;  2A05 A;  3DEW A;  4ZYG A;  2VKH A;  3QQA A;  3RTR A;  4EEF G;  2W24 A;  2H1L A;  3X2Q H;  1B8I B;  1R4N B;  2MD5 A;  2MW8 A;  1ZLK A;  4LG0 B;  3OYC A;  2LKP A;  1XDU A;  5K5R A;  4G7H F;  4B1R A;  4AVP A;  2L7F P;  3GTQ J;  4WF2 A;  2W25 A;  2F48 A;  4BJT A;  3QPL A;  4YG2 F;  2W57 A;  1P2F A;  1SD4 A;  1UJ8 A;  2I10 A;  2KLO A;  5J8F A;  1AU7 A;  3OYA A;  1UZC A;  3GME A;  3SEZ A;  5LD2 C;  2CJJ A;  3I64 A;  5F04 A;  4EM2 A;  2Y9Z A;  1OMI A;  4BAY A;  2ZJP F;  5FGM A;  3ZQC A;  2VON A;  2OU2 A;  3FIW A;  5D6E A;  1KYW A;  1LJ9 A;  2BY3 A;  3F8B A;  3BQZ A;  4XL9 A;  1JJ6 C;  1BA5 A;  3MAJ A;  1FP1 D;  1OKR A;  1R5I D;  1ETX A;  2VOO A;  2KIS A;  1RUO A;  4Y4R A;  3R60 A;  5E3L A;  3W3C A;  1MH3 A;  2VQC A;  5FB2 A;  3LSP A;  3WU0 A;  4CCJ A;  1U5T B;  4PJL A;  1YHQ I;  2H6C A;  4W97 A;  3PIO F;  2D45 A;  1D0Z A;  1R9T J;  4EGZ A;  4UVB A;  1P4W A;  3LA3 A;  1JUS A;  3U21 A;  3OSG A;  3PO2 J;  4RAG A;  5CVV A;  3COA C;  2XV4 S;  4LFU A;  3HM5 A;  3WTX C;  5KK1 A;  2XSJ C;  1FJL A;  2QQ9 A;  4FIS A;  1YW8 A;  3BR2 A;  2GZW A;  3PQK A;  3DPU A;  1S7O A;  3H9G A;  2OV7 A;  2ME6 A;  3PSI A;  3IL2 A;  1IRF A;  3GF2 A;  3M8F A;  2Z3Y A;  4IRH A;  4HX7 A;  2WAQ N;  3O6B B;  2ZME A;  4DZJ A;  5M5Y J;  2MC3 A;  4ESJ A;  4IEJ A;  4XN3 A;  4M6Y A;  2F4M B;  1ULY A;  1QGP A;  2HPI A;  3C2H A;  2VB6 A;  3FKJ A;  4M6V A;  3E5U A;  4B44 A;  4E7S A;  1MBH A;  4ZZL A;  3N97 A;  1XB4 A;  4FT8 A;  4OIN F;  3UKG A;  3CCQ I;  1VQ6 I;  3L9F A;  3L7W A;  4A3J J;  1T33 A;  3QYE A;  1TW3 A;  5LGU A;  1FSE A;  3NAR A;  5E3M A;  4XKC A;  4IHY A;  1JT6 A;  2NYX A;  4XM3 A;  2CUE A;  2VC1 A;  3BRO A;  3I71 A;  1YTY A;  4UNO A;  2RGV A;  2W84 A;  1W1W E;  2KZV A;  1Z91 A;  5D4S A;  3MKZ A;  3CO6 C;  4ESB A;  4LGW A;  1B72 A;  5DM6 F;  1YYV A;  4A2U A;  3JSP A;  4AD9 A;  2FF4 A;  2H8W A;  3GTG J;  3JRI A;  4A0Z A;  5F1R A;  2O03 A;  3RPU A;  3BR0 A;  2LTP A;  1U5T C;  4XOP A;  2JJ7 A;  3WU1 B;  1ZG3 A;  3WTS C;  1XS9 A;  3ABU A;  4DYR A;  2PJR A;  1A5J A;  2L9N A;  2NOJ B;  1JHF A;  1ON2 A;  2ZME B;  1IJW C;  1MSF C;  1I6X A;  1YFH A;  4EGY A;  1MIJ A;  3NAU A;  2KJB A;  4WK8 F;  1MBG A;  2ISY A;  1NTC A;  3CCU I;  4HEA 2;  2X1C A;  2KZG A;  1ENH A;  2QEX I;  1STZ A;  1S29 A;  2H27 A;  1FEX A;  1K83 J;  2A07 F;  3GLL A;  3GFI A;  1KU3 A;  1J2X A;  3GXO A;  4A6D A;  1D0Y A;  4RMN A;  3H5N A;  3EYI A;  3B6A A;  2ZCW A;  2DA2 A;  3MZ8 A;  4KMF A;  3JR9 A;  1JXS A;  3D0S A;  4NBQ A;  4D9J A;  3A03 A;  3WTW C;  4PJN A;  2VPR A;  2P8T A;  1KZH A;  3K70 D;  4PGG A;  5IT9 K;  3AG1 H;  5ERI A;  4XBF A;  2J5O A;  4GYG A;  4XLF A;  1MJ9 A;  3LSH A;  1KQ8 A;  2FX0 A;  2UUZ A;  4M74 A;  2JA5 J;  2CQX A;  2PMH A;  2IS4 A;  1NG6 A;  2FE3 A;  4N9H A;  5FD6 A;  1CF7 B;  2STT A;  1QBJ A;  2LRE A;  1KU9 A;  5D8K B;  2KP6 A;  1VF9 A;  1MMG A;  1WJC A;  4XLE A;  2QSH X;  1S8N A;  2ZO4 A;  2DA3 A;  1LFU P;  1RPW A;  3CTA A;  2LY9 A;  1WJE A;  4KYW A;  5ILU A;  2MLG A;  3I58 A;  2KQR A;  2BHY A;  1O4X A;  2NVT J;  2LBF A;  1Z9C A;  3MMY B;  3E97 A;  2VBY A;  2JA8 J;  2NS7 A;  4EJW A;  4BY7 J;  3D1N I;  2O0Y A;  4P55 A;  2M3A A;  1GDT A;  5IYB J;  4BU2 A;  5DUI A;  1WKM A;  2FML A;  2FNP A;  2P6T A;  3W2W A;  4F92 B;  4NC7 A;  3TW6 A;  3S93 A;  2NVU B;  1H88 C;  1EH7 A;  2BW3 B;  4UV8 A;  3BR3 A;  4U0V A;  1MJA A;  2O7O A;  4EJT A;  5HLG A;  3DQV C;  1FPQ A;  4KIC A;  2GXA A;  2DXI A;  3BOQ A;  3A02 A;  3MN2 A;  4HA8 A;  1JGS A;  5KAF C;  2OQR A;  2LBF B;  2DMT A;  4MEX F;  1VQ7 I;  3HBL A;  3DXJ F;  4XLA A;  3I4P A;  2HDC A;  1TLH B;  3FDY A;  3I56 I;  3SDB A;  5JHF A;  1TWF J;  2WAQ A;  3LFK A;  3ISP A;  1K6O A;  2YSR A;  3TKY A;  4JK1 X;  2V1X A;  1POG A;  2YR2 A;  5HOO A;  4AIH A;  5GAH J;  1F4K A;  2OAZ A;  2E2I J;  3DBR B;  5HDG A;  1ETQ A;  2K9N A;  1UHW A;  1S5L C;  2L5Q A;  1Y6I A;  2JMW A;  4Y3O A;  1IG7 A;  2XAJ A;  2WBM A;  3K7A J;  3CCE I;  4A3E J;  1J09 A;  1GVJ A;  5F0F A;  4A3D J;  1FTT A;  1P7J A;  2LRD A;  2JA6 J;  3EUK L;  2Q0O A;  3OYG A;  4Q4Z F;  4KMU X;  3A0B C;  3H9Q A;  3FMR A;  2HXI A;  3GCM A;  1A36 A;  4G6T B;  2KIU A;  2R7V A;  5H20 A;  5F64 A;  1DDN A;  3RYP A;  1BC7 C;  1EJ9 A;  1YOV B;  1P4A A;  2VAS A;  4PGH A;  4G12 A;  1ZQ3 P;  2EWN A;  3KYL A;  3TO7 A;  1U6G A;  3L2Q A;  2DDB A;  1E2X A;  2H09 A;  1R6R A;  2P0W A;  1SEU A;  4LLG F;  2DMP A;  5FO5 A;  1JKP C;  1HC8 A;  1O3T A;  5F08 A;  4BNC A;  1E3P A;  3LST A;  3BWG A;  3WTV C;  2M4K A;  2VJ4 A;  2L7Z A;  4HST A;  1GLN A;  3VDX A;  1ETY A;  3CMY A;  4FQG A;  5M3M J;  3DP7 A;  1AA7 A;  2CQQ A;  5M5W J;  3VB2 A;  3J81 Z;  3ZMT A;  2XB0 X;  1YJ9 I;  1JGG A;  2M0C A;  2R5Y A;  2OZU A;  3WOD F;  4CUG A;  3H0D A;  3TDZ C;  2HKX A;  3SHF A;  4BXF A;  5HDK A;  3O8H A;  4DQ2 A;  2W1O A;  1MZB A;  1QHG A;  3BZ6 A;  3VOD A;  4JBA A;  1R00 A;  1HKT A;  1T56 A;  2KRC A;  3CJR B;  4Z2Y A;  1T8I A;  4DBQ A;  4PJM A;  3SDG A;  4WXC A;  2R5Z A;  2XPW A;  1G3Y A;  1YS6 A;  3VYS B;  2G9W A;  2GBY A;  2HOA A;  3M3Y J;  2LP0 A;  2VN2 A;  1RKW A;  4XIC A;  1CQT A;  1I1S A;  4YII A;  2NS0 A;  1HSJ A;  2RNG A;  1U9O A;  3SJM A;  4M3G A;  2MH2 A;  5HLH A;  1X19 A;  4RB2 C;  2Y48 A;  2VT3 A;  1ETO A;  5BNG A;  4DW6 A;  5CVU A;  2O8X A;  4AYB N;  2BBY A;  2IJL A;  4P1W A;  3BDD A;  3MD2 A;  1R49 A;  5FRN A;  5EDN A;  4R1H A;  3MZH A;  2QKL B;  2JPB A;  4DYC A;  3ECH A;  5EEG A;  2R5Y B;  2K7L A;  2CW8 A;  3I59 B;  3HOY J;  5KCM A;  1WH5 A;  2HVQ A;  4XMY A;  5LHG A;  3Q0V A;  4IL6 C;  1U8B A;  1ZRE A;  4PFP A;  1FY7 A;  1ZTR A;  5M5X J;  3IH2 A;  1V3F A;  2CUJ A;  3BTI A;  2ISZ A;  4LK1 F;  1MNE A;  4NUB A;  1J0R A;  1Z3X A;  2JSC A;  4NDL A;  4CZC A;  2CRG A;  2R7X A;  2Q8K A;  4C2M J;  2FEZ A;  1PUF A;  3WE3 A;  2QZ8 A;  2HVS A;  1MJB A;  2HDW A;  2DQL A;  3PUB A;  4RGR A;  2R5Z B;  3WGG A;  5HS8 A;  2HQN A;  2DLL A;  3TP3 A;  2VC0 A;  3H92 A;  2B7E A;  1XSD A;  1K6Y A;  3Q9S A;  5AIQ A;  4OWR B;  4AVZ A;  3HPG A;  1I6H J;  1T39 A;  4C3I J;  5EG0 A;  4HSR A;  4EMS A;  3WG9 A;  1IV6 A;  2IAI A;  5LFA A;  5F27 A;  3QAH A;  5GAE J;  1IUY A;  3HSR A;  4NQW B;  2EA2 A;  4V2G A;  2VL8 A;  3JCU C;  3REO A;  2V9V A;  2QA4 I;  1XMA A;  2XAG A;  4M9S A;  2HI3 A;  2E7X A;  2PMU A;  4HLX A;  1P6R A;  1SD6 A;  3HGY A;  4RB3 C;  3OYF A;  3ECO A;  3ELK A;  4A0Y A;  1J7K A;  1RRJ A;  3RIR A;  2XF6 A;  2R7W A;  4HAM A;  4YFX F;  2K40 A;  4A69 C;  3KFW X;  1XGO A;  3B02 A;  1B9M A;  1VTN C;  3GZ6 A;  2H8R A;  1TT0 A;  2VOD A;  2XIG A;  3M1C A;  3OSF A;  2KDZ A;  1EF4 A;  2E19 A;  3KPH A;  2E5N A;  4IZZ A;  3BLY A;  4BJ6 C;  2B0L A;  1E17 A;  1RUN A;  4KIF A;  5C44 J;  3VOE A;  1A31 A;  3CLO A;  1HOM A;  2XKP A;  1W7P B;  4ZDP A;  1MNM C;  2LYC A;  1J9I A;  4OIP F;  2F5V A;  2B9S A;  3OOU A;  4V19 K;  2VQG A;  2AXL A;  5JVG F;  5J4V A;  4S05 A;  1BM9 A;  2JUG A;  5DUK A;  2QSG X;  5J1U A;  2QLZ A;  2OTJ I;  4BHC A;  3I9V 2;  4C30 A;  1GXP A;  2BYV E;  5IOZ A;  1J5Y A;  2PQ8 A;  4RAF A;  2BY1 A;  1BN5 A;  2JPC A;  1F36 A;  5KVR A;  3FX3 A;  3M4O J;  2D2W A;  4DZP A;  3CD6 I;  2LK2 A;  2F4I A;  2DQR A;  2VOP A;  4BQO A;  2X6Y A;  4CIC A;  1TT5 B;  1DGW Y;  2UXX A;  2UXN A;  3FKI J;  3ZMD A;  2EA4 A;  2HZD A;  3BJ6 A;  2GLO A;  4IHW A;  3FXK A;  3TOB A;  3FK6 A;  5EGO A;  1MSE C;  1ZRC A;  4XLC A;  2CUF A;  3BJA A;  5IP9 J;  2R7D A;  1ZGW A;  2VBW A;  2VPL A;  1HW5 A;  4BHB A;  1P4X A;  1W36 D;  2NS8 A;  4RGX A;  4DNC A;  1IXC A;  2WV1 A;  1M1E B;  1OR7 C;  4CXF A;  3ZQG A;  1FIA A;  2O61 A;  2HU9 A;  4IHX A;  3FXJ A;  1RET A;  2Y31 A;  3HUG A;  5LHH A;  3V7C A;  4E7Z A;  2RV8 A;  2KHM A;  3ASN H;  4EVI A;  2QEN A;  3BG5 A;  4G9Y A;  4U0Y A;  4ESF A;  2PN6 A;  1VQ5 I;  4LJZ F;  1AKH A;  4FET A;  1D0X A;  3LQR A;  5E8G A;  3IWZ A;  3BT9 A;  3C2G A;  3PNY A;  4Y13 A;  2X4H A;  2L54 A;  4OOI A;  2YPR A;  4UHT A;  1ETV A;  2JSP A;  2ZFU A;  3IAM 2;  3HZJ A;  1XDS A;  5D5U B;  4HW0 A;  5L3D A;  1R58 A;  1DGR M;  1YW9 A;  3HHH A;  1OQY A;  1R5H A;  3KP4 A;  1B6A A;  2X6X A;  3K70 C;  1OLT A;  2F5F A;  5DD8 A;  5EGO B;  1SMT A;  2QM3 A;  4I99 C;  1RNL A;  1R71 A;  5L3E A;  4BUP A;  2HXO A;  4BE1 A;  2KL4 A;  3KET A;  3CCV I;  1JTX A;  3S2W A;  4XID A;  3DTE A;  1WQ2 A;  5LGN A;  2XAQ A;  5HLT A;  3CCL I;  4XLN F;  2DCE A;  4ZC3 A;  3HUG B;  2DAO A;  2KIM A;  4E70 A;  5F0H A;  1TWH J;  3GTO J;  2KDO A;  1X58 A;  1MMA A;  3K1M A;  1AKH B;  2LY2 A;  5BMZ A;  1Z6T A;  1FT9 A;  4P9F A;  2CH0 A;  3IP4 B;  4OIO F;  4M71 A;  4GYI A;  2M4G A;  3OY9 A;  1MND A;  1FOY A;  1OYY A;  2FUG 2;  3TBI A;  3RPQ A;  4JOM A;  4A3I J;  2M7A A;  5IP6 A;  3J81 K;  3AKZ A;  2FJ1 A;  5IY5 H;  3FXL A;  2JVH A;  3BZK A;  4RA2 A;  1S7E A;  3S15 J;  2L9V A;  3O3K A;  3CUQ A;  1UEL B;  3IRR A;  4O6J A;  4IJA A;  1ZAR A;  3ZQL A;  3KP5 A;  1G3T A;  1OCP A;  3AG2 H;  1W5S A;  2CMP A;  1R5G A;  4I7H A;  3SFZ A;  4D5C A;  2G7U A;  1Z0X A;  2RN7 A;  1AHD P;  1HST A;  4JX6 A;  5ILV A;  5B1A H;  3JRF A;  3JRD A;  1J75 A;  2M87 A;  1FBU A;  1O7L A;  3ZQF A;  3LSR A;  4X1E A;  5TJJ A;  3K4J A;  5L3G A;  3G4S I;  1ZAO A;  2CYY A;  2AO9 A;  3S2D J;  1FBQ A;  3CC4 I;  2HQR A;  3CJT B;  3QYB A;  4JX4 A;  4UVA A;  3HDD A;  3UNG C;  2CV2 A;  5L3C A;  4QIW N;  4WWC A;  2ZJQ F;  2W85 A;  2FA5 A;  4KA4 A;  1KQ9 A;  3F72 A;  3TL4 X;  1O3R A;  4CCN A;  3CUQ B;  1K78 B;  3FHZ A;  3HSE A;  2DA1 A;  1VFC A;  4M9Z A;  2ZXH A;  4QLC U;  3AL0 B;  2TCT A;  3MVP A;  4C2U A;  1HXD A;  3A01 A;  1OJL A;  4C9Y A;  3OYB A;  3VFZ A;  4G94 A;  4UUV A;  2FBK A;  3OYJ A;  1HCR A;  4HX8 A;  2XKO A;  3ZOB A;  2OPT A;  3OYL A;  5GP9 A;  1Y1W J;  1FLI A;  3LSM A;  2A69 F;  3SZT A;  3V8L A;  2DT6 A;  1BJZ A;  3G6E I;  2OQG A;  1G59 A;  3KZZ A;  4B4C A;  4FE4 A;  2WB1 A;  3HIF A;  1QA6 A;  1LVK A;  2MYS A;  4ENN A;  2FBH A;  3E5Q A;  1JKQ C;  1TNS A;  3RKQ A;  4PFO A;  1WI9 A;  3V7S A;  3TGN A;  2JA2 A;  3R0J A;  2CQ7 A;  4PCQ A;  4A0X A;  3OS2 A;  4HDU A;  3K10 A;  2LSO A;  3T5X A;  4RGS A;  3PSF A;  1XMX A;  4C3J J;  3LAP A;  2H1K A;  4GO1 A;  4NC8 A;  4J00 A;  3F6O A;  4B3X A;  2HQ5 A;  3CP8 A;  3HOT A;  1KQ0 A;  1BW6 A;  3W2V A;  1UMQ A;  5EJC A;  4M72 A;  3HXL A;  1OPC A;  3DTK A;  4AID A;  3DPL C;  5LHI A;  2MH9 A;  2P81 A;  2NAZ A;  3I53 A;  1YIT I;  4GXO A;  3GFL A;  2DT5 A;  4I0B A;  2ESN A;  3ZQH A;  5CVJ A;  3FM5 A;  5FJ8 J;  2EV6 A;  1Y8Q B;  4OAZ A;  4HZF A;  1HDD C;  5K7H A;  1LKX A;  2XVC A;  4ITV A;  4ZDO A;  3ERM A;  1Y39 A;  2DFE A;  3K1N A;  4BY1 J;  1G8X A;  4L5I A;  3LSG A;  1HKQ A;  3J7Z I;  4RM2 A;  5F1J A;  1X1A A;  1B1B A;  1AWC A;  3K2Z A;  4LIU A;  2O5R A;  4RB1 A;  5TGT A;  2YX4 A;  5E20 A;  4BYY A;  4OMY A;  2DMQ A;  4YIR X;  2EV5 A;  3GW2 A;  3HTU A;  5EEA A;  1T98 A;  2HGC A;  5LRR A;  4ZTF A;  1YO5 C;  3SYT A;  4TV7 A;  1Z7L A;  2XUB A;  4L9V A;  1UG0 A;  2RQQ A;  2EQR A;  2RAE A;  4M3F A;  2IGM A;  1Z6R A;  2LKX A;  4PSX A;  4KIS A;  1X4P A;  2IXS A;  1V5G A;  1WHU A;  4HNU A;  1ZHF A;  3IRQ A;  2JVG A;  4LLN A;  2M7B A;  4Q48 A;  2DN0 A;  2DOA A;  3H5R A;  1Y1V J;  2VBX A;  3N05 A;  2P5L C;  1KU7 A;  4A6E A;  1USS A;  3FXR A;  2L9S A;  3KX2 A;  3IHU A;  2P7V B;  3A2K A;  3HRM A;  3KYD B;  3HYI A;  4MNU A;  4ASN A;  3GTK J;  1GV2 A;  2X6O A;  3CDI A;  4KIT B;  2PMZ A;  4HPQ A;  2DOE A;  2JRT A;  3GTM J;  4FE7 A;  1WI3 A;  2LKS A;  3PL8 A;  1NG7 A;  1X3W B;  3BTJ A;  1IAW A;  1Z67 A;  3CUO A;  3BTC A;  5BPI A;  3WTZ A;  4A5M A;  2Y0S A;  4XKW A;  2ZXI A;  5EZH A;  3PFI A;  2AQF A;  3RZO J;  1B72 B;  2OC6 A;  1W7P D;  1IF1 A;  4LIT A;  5L3F A;  4IQJ A;  4GGG A;  2DFF A;  1EH8 A;  2JUC A;  4L9J A;  1LUJ B;  4L9N A;  4B09 A;  3DU5 A;  5E17 F;  5DTD A;  4I76 A;  4F93 B;  3GTP J;  2M45 A;  2G0E A;  1L3L A;  2O9L A;  2K4J A;  2LFB A;  5HVQ C;  1A6Q A;  2PJR B;  4IHS A;  3GYH X;  4DGW B;  1LB2 A;  1YRN A;  3CZ6 A;  1U3E M;  3DFG A;  2ZSH B;  4D7M A;  1BC8 C;  2DI3 A;  2H94 A;  3H36 A;  3EDP A;  3G1O A;  1HW1 A;  3Q9V A;  1O3Q A;  2V9K A;  4ENK A;  2MAB A;  1PP8 F;  4Y17 A;  5FKL A;  1SFX A;  3RI4 A;  1QU3 A;  1W5C C;  1MW7 A;  4A3C J;  3WTY C;  1U9N A;  2LVS A;  2X85 A;  2FOK A;  1K61 A;  5JFR A;  2VKE A;  2E36 A;  1T2K A;  1EA3 A;  1SFE A; 
#chains in the Genus database with same CATH homology
 4HF1 A;  2DK8 A;  4RAY A;  3JTG A;  3GWZ A;  3K9T A;  1JHH A;  1S3J A;  4L5J A;  2PJP A;  3T0Y A;  1T6S A;  2FQ3 A;  4XSX F;  4ZZD A;  2V79 A;  2DPD A;  3F8F A;  4QWQ A;  4P96 A;  3QPH A;  5D5V B;  1L0O C;  3QRF F;  2L02 A;  3GO5 A;  3WGI A;  3QU3 A;  1B9N A;  3W6K B;  1R23 A;  4KIG A;  5L3B A;  1WRJ A;  4BH9 A;  1OYW A;  4OIR F;  1BI2 A;  1I5Z A;  2FSW A;  1XD7 A;  5LEK A;  4FX0 A;  1YW7 A;  2MBF A;  1UCR A;  3G3Z A;  5ICF A;  4M9X A;  3HRT A;  1U2W A;  1Z7U A;  4M73 A;  2QBY A;  1A04 A;  2HS5 A;  2WWY A;  3H3Z A;  1DUX C;  2A6H F;  2L4A A;  3DKW A;  3KEO A;  2HTJ A;  3E6D A;  4CHU A;  2ACJ A;  2CW0 F;  3DEU A;  5ED4 A;  3D5L A;  1XCB A;  4A5N A;  5HS7 A;  1G3W A;  1BIB A;  2XRN A;  4IRI A;  3M7G A;  3WGH A;  3CO7 C;  4EM0 B;  2E7W A;  3K0L A;  5DDG A;  4JQF A;  2D1H A;  2HOE A;  3GFJ A;  1LQ1 A;  5K1Y A;  2PLY A;  3V8J A;  3RJP A;  1ZYR F;  4HV6 A;  1SD7 A;  4YFK F;  3JSO A;  4HDV A;  3F6V A;  2E1N A;  3GX4 X;  2Q2E A;  5IT3 A;  4K2E A;  4U0W A;  4WXH A;  2ZJ2 A;  3E6M A;  3C7J A;  5H6Q A;  3I0T A;  4XRF A;  2ZNZ A;  3GFM A;  4HV5 A;  1BI1 A;  4MTD A;  1REP C;  1FNN A;  5FFZ A;  3T8R A;  3KP6 A;  5J6X A;  1RIO H;  1DPU A;  3LA7 A;  5DYM A;  2J5P A;  1BI0 A;  1FYM A;  2HKO A;  1R1V A;  3QP6 A;  4I02 A;  3MQ0 A;  2FU4 A;  5H6R A;  1IN5 A;  3MEX A;  1FYL A;  1G6N A;  5E1X A;  3EUH A;  3QPT A;  5CVR A;  2BV6 A;  5DD4 A;  2FMY A;  2M30 A;  1D5V A;  1KU2 A;  1T38 A;  1ZRD A;  1K7A A;  1P92 A;  1QPM A;  3ML6 A;  2FNA A;  1S6L A;  5DCM A;  2XAH A;  1UFM A;  3ERE D;  2CSO A;  1F5T A;  2DBB A;  3GEZ A;  1TQI A;  5EEH A;  1O57 A;  4Y15 A;  2IW5 A;  1UST A;  3HHG A;  5FD5 A;  2VE8 A;  2L4M A;  2Y0M A;  5ICE A;  2RQP A;  5D6F A;  2GA2 A;  2YX7 A;  1XSV A;  1W5T A;  3KEQ A;  2EFW A;  1FP2 A;  3L00 A;  4Q47 A;  3R0A A;  4HOB A;  1ZH5 A;  5DCM B;  4CGZ A;  4HF0 A;  2VBZ A;  1SMY F;  3CJN A;  1IN6 A;  2RDP A;  2LNB A;  4LB5 A;  5E1Z B;  6PAX A;  1XGN A;  2MLK A;  1IZ1 A;  2F5E A;  1H0M A;  2OZ6 A;  5JHU A;  3RKX A;  2G7H A;  2UZK A;  3FF5 A;  4L0Y B;  3IC7 A;  2DTR A;  3WTU C;  1V4R A;  2XHK A;  4G7O F;  1R22 A;  1R1U A;  3W6J B;  1O3S A;  4HF2 A;  2DW4 A;  4I09 A;  2CQK A;  1MD0 A;  3N4M A;  3E5X A;  2PG4 A;  3FMQ A;  3BP8 A;  3LWF A;  3QP5 A;  2EFN A;  1FSH A;  4IF4 A;  3K1P A;  1CGP A;  1S7A A;  3P9K A;  5DEQ A;  4N9I A;  3RDI A;  3KZY A;  4F7Z A;  2NRA C;  4HBL A;  4WCG A;  3O2P E;  2MA3 A;  4IRG A;  1HW2 A;  2K27 A;  1ZG5 A;  3U9G A;  3FXQ A;  3B73 A;  1U8R A;  3I5U A;  1WSU A;  3F23 A;  3GUD A;  2HWV A;  2A3S A;  4A12 A;  2HEO A;  3EYY A;  2P7C B;  1MDM A;  3NQO A;  2HYF A;  4U88 A;  1SFU A;  4XSZ F;  3SQN A;  2EV0 A;  2QQA A;  3ROU A;  4YIF A;  1LDK B;  3L2C A;  1HKS A;  2GQQ A;  2K86 A;  3SZP A;  4EM1 A;  3M1E A;  5BS6 A;  1GHC A;  2GXG A;  2R7F A;  3ZMU A;  2BEO A;  1D3Y A;  2ZNY A;  3VEP A;  3KCC A;  1RI7 A;  4P9U A;  3F3X A;  5CYV A;  2L01 A;  2DO7 A;  4IXA A;  1XCV A;  5LLQ A;  5E18 F;  1QZY A;  1W4M A;  4RAZ A;  1IN4 A;  4BXU A;  3V8K A;  4UXN A;  3RKY A;  4M6X A;  1QQI A;  4KIB A;  2PFB A;  1U5T A;  1ZRF A;  4GCV A;  1B4A A;  2EFO A;  4AIK A;  1BI3 A;  4L0Z B;  4KT5 C;  2LF8 A;  1X3U A;  2UWM A;  2ZKZ A;  2M1B A;  2FRH A;  1Z05 A;  2DK5 A;  4MGR A;  3T1B A;  4R79 A;  3G73 A;  2IA0 A;  2ZXJ A;  2VE9 A;  4P5O A;  4Q5S F;  4I0A A;  5JI6 A;  2V1D A;  2PBI A;  2VXZ A;  2KKO A;  3WTT C;  5ICG A;  1UHM A;  2CWE A;  4HQE A;  1U78 A;  2PEX A;  3TDU C;  4KN4 X;  3R6S A;  3K69 A;  4HLY A;  2QQB A;  2E1C A;  1XGS A;  1BIA A;  2EB7 A;  3QOP A;  1GXQ A;  1RZ4 A;  1FBS A;  4KNY A;  2OD5 A;  2ZBK A;  5AIP A;  3CUQ C;  3TOA A;  2XAS A;  4ZYD A;  1YG2 A;  3ZQ7 A;  2O3F A;  1XGM A;  4AWX B;  1FZP B;  2TDX A;  3ZMS A;  1I1G A;  4LLL A;  5FLX Z;  1TW2 A;  2DU9 A;  2H6B A;  2RC4 A;  3JTH A;  4U7B A;  2EFQ A;  2BE5 F;  4N0B A;  1FWZ A;  3FMS A;  1TBX A;  5HDN A;  3ZP5 A;  1PUE E;  1SD5 A;  2NNY A;  4UV9 A;  2GA1 A;  2Z5U A;  2D1V A;  5D4R A;  3P7N A;  2A5Y B;  3GLX A;  1NHA A;  2CG4 A;  4RB0 A;  2P4W A;  1AOY A;  5BQT A;  3F22 A;  2Z99 A;  4LB6 B;  1ONV A;  1IXS B;  1T0F A;  4FHT A;  2EJR A;  1CF7 A;  2ADU A;  2RVC A;  3C18 A;  4ON0 A;  2HYG D;  3P9I A;  5A2Q Z;  2WV0 A;  5BOX A;  2JT1 A;  3MCZ A;  1HBX G;  1ZN2 A;  3WE2 A;  2GAU A;  2JZY A;  4I98 B;  4HYE A;  3Q5F A;  3FWE A;  1IN7 A;  4OIQ F;  4L9T A;  2WC2 A;  2M5W A;  2V1U A;  1O7F A;  3V7R A;  1J59 A;  3F8N A;  3BJO A;  1D8K A;  5DV5 A;  3J80 Z;  3C3W A;  4EJO A;  1JE8 A;  4CZZ A;  1QO0 D;  5K5Q A;  3HOS A;  4G6Q A;  1BJA A;  2WTE A;  1ZLJ A;  4BQA A;  2LDU A;  1K79 A;  4LK0 F;  2PI0 A;  5D5X B;  1BOA A;  2IP2 A;  4UVC A;  1KA8 A;  2ESH A;  3R61 A;  2HTS A;  2IT0 A;  1ZG1 A;  2X0L A;  1IRG A;  3F21 A;  3QU6 A;  2IA2 A;  1PDN C;  3LAJ A;  3MFK A;  1YS7 A;  4KFC A;  1SAX A;  3M9A A;  1IXR C;  1LEA A;  2GWR A;  4NB5 A;  3GZ5 A;  3RYR A;  2HZT A;  2JTV A;  3BY6 A;  3T8T A;  4BHP A;  3TQN A;  1TQP A;  1G3S A;  3NEU A;  2C6Y A;  5LGT A;  4ETS A;  3KLO A;  2QYO A;  4OMZ A;  2GXB A;  1Z1D A;  2DFI A;  2K4B A;  2CO5 A;  1LDD A;  4KUM A;  2QWW A;  4B8X A;  2BGC A;  3E6B A;  2CGP A;  3U1D A;  2K02 A;  1EV7 A;  4MTE A;  3EET A;  3KP3 A;  1LDJ A;  1XMK A;  1YQA A;  1YIO A;  3ZPL A;  3DV8 A;  4ENJ A;  5JVT A;  5K5O A;  2IRF G;  1EH6 A;  2QBY B;  5CVI A;  5E8I A;  4O3M A;  5FFX A;  3L09 A;  5LEJ A;  3I59 A;  3KP2 A;  2STW A;  1FYK A;  2LF7 A;  2NNN A;  2OA4 A;  1Y0U A;  4D0P A;  3P9C A;  2ETH A;  1DPR A;  5AON A;  4OU0 A;  2ELH A;  3M8E A;  2QVO A;  1TQM A;  4U7D A;  2R3S A;  2XAF A;  2COM A;  4WXD A;  5FLX K;  3PQJ A;  3LQQ A;  3ZMZ A;  4MEY F;  3HRU A;  3JAM Z;  5E1W A;  3IWF A;  3ABT A;  4WX9 A;  4NQW A;  3ZN0 A;  1FOK A;  1XN7 A;  3F8M A;  4ENM A;  1PP7 U;  2Z9O A;  4ZYH A;  3IKT A;  3LA2 A;  1IN8 A;  1OR7 A;  1QZZ A;  1BBY A;  2Z33 A;  1TTY A;  4MQ9 F;  2ZFW A;  2F5D A;  4O5V A;  5DCF A;  3FM3 A;  3H3U A;  4RGU A;  2XGX A;  1R7J A;  2KRF A;  2FBI A;  4EQQ A;  3IKV A;  5A2Q K;  2KIF A;  1W7P A;  3FXU A;  3JW4 A;  1ZGA A;  2RKH A;  4I2O A;  3OV8 A;  3HRS A;  1B59 A;  4IVN A;  1KYZ A;  4L18 B;  1TNT A;  4S04 A;  3BPX A;  3DPT A;  2DPU A;  2YU3 A;  3E6C C;  4RS8 A;  4G6D A;  3TO9 A;  2FXA A;  2P5K A;  3F8C A;  3TO6 A;  3SXY A;  3KP7 A;  5LRS A;  4G8X A;  5TRD A;  3J80 K;  4HQM A;  1YLF A;  4KDP A;  1G4D A;  1UB9 A;  1I27 A;  2L3D A;  4PDK A;  4LD5 A;  1HQC A;  1QNT A;  1MGT A;  4MHG A;  3EQL F;  2IVM A;  2P6S A;  2IA1 A;  2EK5 A;  2EFP A;  1FC3 A;  3E3V A;  1Q1H A;  3ZMV A;  2F5C A;  5D8L B;  2P5V A;  4CO8 A;  2F2E A;  1WWX A;  3KLN A;  2Y75 A;  3MZY A;  5CLS A;  4KN7 X;  4EV0 A;  5D5W B;  3HSF A;  4MQV A;  4R8H A;  2RNJ A;  1C0W A;  3ZN1 A;  3I54 A;  2IPQ X;  2VT2 A;  1ODD A;  4NHJ A;  2A6E F;  3U2R A;  5IT9 Z;  4AIJ A;  3FZV A;  3V4G A;  2XRO A;  4IHT A;  2OBP A;  1ON1 A;  5HLI A;  4FX4 A;  2O6G E;  2GIV A;  1XSX A;  1MKM A;  4H0E A;  5JR3 A;  3KE2 A;  4CYD A;  5LBQ A;  4YFN F;  5BPD A;  3J7A O;  1KGS A;  2KJC A;  2M8E A;  3R4K A;  1OYI A;  2A61 A;  3NRV A;  1F1Z A;  3HTS B;  2V6C A;  3AAF A;  4G7Z F;  1LVA A;  4XLP F;  3ULQ B;  5ILS A;  2AS5 F;  4LG0 A;  4EJU A;  2A68 F;  3C1D A;  4LMY A;  3GVA A;  1K78 A;  1IW7 F;  3MWM A;  4ZH4 F;  1H9T A;  4CDG A;  1DP7 P;  4EJV A;  5F6F A;  3RKW A;  5HS9 A;  3OOP A;  1LNW A;  3DF8 A;  2HR3 A;  1MDM B;  2HFH A;  4IPA A;  2CFX A;  4PZJ A;  1ZGJ A;  1R36 A;  1FX7 A;  5CJ9 A;  3JAM K;  1F9N A;  2QUF A;  1H9G A;  5ICC A;  1R1T A;  1D8J A;  3BPV A;  5J8C A;  4HX4 A;  3CDH A;  4I01 A;  1LEB A;  4ZYE A;  4ZYG A;  3RTR A;  2W24 A;  2MD5 A;  1ZLK A;  4LG0 B;  2LKP A;  1XDU A;  5K5R A;  4G7H F;  4AVP A;  4WF2 A;  2W25 A;  4YG2 F;  2W57 A;  1P2F A;  1SD4 A;  5J8F A;  3I64 A;  4EM2 A;  1OMI A;  4BAY A;  5FGM A;  2VON A;  2OU2 A;  5D6E A;  1KYW A;  1LJ9 A;  3F8B A;  3MAJ A;  1FP1 D;  1OKR A;  2VOO A;  1RUO A;  3R60 A;  5FB2 A;  3WU0 A;  1U5T B;  2H6C A;  2D45 A;  4EGZ A;  4UVB A;  1P4W A;  3LA3 A;  5CVV A;  3COA C;  2XV4 S;  4LFU A;  3WTX C;  5KK1 A;  2QQ9 A;  1YW8 A;  2GZW A;  3PQK A;  1S7O A;  3IL2 A;  1IRF A;  3GF2 A;  3M8F A;  2Z3Y A;  4IRH A;  4HX7 A;  3O6B B;  2ZME A;  2MC3 A;  4ESJ A;  4M6Y A;  1ULY A;  1QGP A;  3E5U A;  4ZZL A;  3N97 A;  1XB4 A;  4FT8 A;  4OIN F;  3L9F A;  3L7W A;  1TW3 A;  5LGU A;  1FSE A;  2NYX A;  1YTY A;  2VC1 A;  3BRO A;  3I71 A;  4UNO A;  2RGV A;  2W84 A;  5D4S A;  1Z91 A;  3CO6 C;  4ESB A;  4LGW A;  1YYV A;  4A2U A;  3JSP A;  4AD9 A;  2FF4 A;  4A0Z A;  5F1R A;  2O03 A;  3RPU A;  1U5T C;  3WU1 B;  1ZG3 A;  3WTS C;  3ABU A;  1JHF A;  1ON2 A;  2ZME B;  1I6X A;  1YFH A;  4EGY A;  2KJB A;  4WK8 F;  2ISY A;  1STZ A;  1S29 A;  2H27 A;  2A07 F;  3GFI A;  1KU3 A;  1J2X A;  3GXO A;  4A6D A;  3EYI A;  2ZCW A;  4KMF A;  1JXS A;  3D0S A;  3WTW C;  2P8T A;  4PGG A;  5IT9 K;  5ERI A;  4XBF A;  2J5O A;  4GYG A;  1MJ9 A;  1KQ8 A;  4M74 A;  2PMH A;  2FE3 A;  4N9H A;  5FD6 A;  1CF7 B;  2STT A;  1QBJ A;  1KU9 A;  5D8K B;  1S8N A;  2ZO4 A;  3CTA A;  4KYW A;  5ILU A;  2MLG A;  3I58 A;  1Z9C A;  3E97 A;  2VBY A;  4EJW A;  2O0Y A;  4P55 A;  5DUI A;  1WKM A;  2FML A;  2FNP A;  2P6T A;  1EH7 A;  4UV8 A;  4U0V A;  1MJA A;  4EJT A;  5HLG A;  3DQV C;  1FPQ A;  4KIC A;  3BOQ A;  4HA8 A;  1JGS A;  2OQR A;  4MEX F;  3DXJ F;  3I4P A;  2HDC A;  1TLH B;  3LFK A;  3ISP A;  1K6O A;  2YSR A;  3TKY A;  4JK1 X;  2V1X A;  2YR2 A;  5HOO A;  4AIH A;  1F4K A;  2OAZ A;  5HDG A;  1UHW A;  2XAJ A;  1GVJ A;  2Q0O A;  4Q4Z F;  4KMU X;  3FMR A;  2KIU A;  5H20 A;  5F64 A;  1DDN A;  3RYP A;  1BC7 C;  1P4A A;  4PGH A;  2EWN A;  3TO7 A;  1U6G A;  1E2X A;  2H09 A;  4LLG F;  5FO5 A;  1O3T A;  4BNC A;  3LST A;  3BWG A;  3WTV C;  3DP7 A;  3VB2 A;  3J81 Z;  3ZMT A;  2OZU A;  3WOD F;  3TDZ C;  2HKX A;  3SHF A;  5HDK A;  4DQ2 A;  1MZB A;  3BZ6 A;  3VOD A;  4JBA A;  1R00 A;  1HKT A;  4Z2Y A;  4WXC A;  1G3Y A;  1YS6 A;  2G9W A;  2VN2 A;  1I1S A;  4YII A;  2NS0 A;  1HSJ A;  5HLH A;  2MH2 A;  4RB2 C;  2Y48 A;  2VT3 A;  5CVU A;  2O8X A;  2BBY A;  2IJL A;  3BDD A;  4R1H A;  3MZH A;  2JPB A;  3ECH A;  5EEG A;  2K7L A;  3I59 B;  5LHG A;  1ZRE A;  1FY7 A;  1V3F A;  2ISZ A;  4LK1 F;  1J0R A;  2JSC A;  2Q8K A;  2FEZ A;  3WE3 A;  2QZ8 A;  1MJB A;  2DQL A;  4RGR A;  3WGG A;  5HS8 A;  2HQN A;  2DLL A;  2VC0 A;  3H92 A;  1XSD A;  3Q9S A;  5AIQ A;  1T39 A;  4EMS A;  3WG9 A;  3QAH A;  1IUY A;  3HSR A;  2EA2 A;  3REO A;  2V9V A;  1XMA A;  2XAG A;  4M9S A;  2E7X A;  2PMU A;  4HLX A;  1P6R A;  1SD6 A;  4RB3 C;  3ECO A;  3ELK A;  4A0Y A;  1J7K A;  3RIR A;  4HAM A;  4YFX F;  3KFW X;  1XGO A;  3B02 A;  1B9M A;  1VTN C;  3GZ6 A;  2VOD A;  2XIG A;  2B0L A;  1E17 A;  1RUN A;  4KIF A;  3VOE A;  3CLO A;  2XKP A;  1W7P B;  1J9I A;  4OIP F;  2AXL A;  4S05 A;  1BM9 A;  5DUK A;  2QLZ A;  4BHC A;  1GXP A;  2BYV E;  1J5Y A;  2PQ8 A;  1BN5 A;  2JPC A;  5KVR A;  3FX3 A;  2D2W A;  2DQR A;  2VOP A;  4CIC A;  2UXX A;  2UXN A;  3ZMD A;  2EA4 A;  3BJ6 A;  3TOB A;  1ZRC A;  3BJA A;  2R7D A;  2VBW A;  1HW5 A;  4BHB A;  1P4X A;  4RGX A;  4DNC A;  1IXC A;  4CXF A;  2O61 A;  3HUG A;  5LHH A;  3V7C A;  2RV8 A;  4EVI A;  2QEN A;  4G9Y A;  4U0Y A;  4ESF A;  2PN6 A;  4LJZ F;  3LQR A;  5E8G A;  3IWZ A;  4Y13 A;  2X4H A;  2L54 A;  4OOI A;  2YPR A;  4UHT A;  1XDS A;  5D5U B;  4HW0 A;  5L3D A;  1R58 A;  1YW9 A;  3HHH A;  1R5H A;  3KP4 A;  1B6A A;  2F5F A;  5DD8 A;  1SMT A;  2QM3 A;  1RNL A;  5L3E A;  3KET A;  3S2W A;  1WQ2 A;  5LGN A;  2XAQ A;  4XLN F;  2DAO A;  2KIM A;  4E70 A;  3K1M A;  5BMZ A;  1Z6T A;  1FT9 A;  4P9F A;  4OIO F;  4M71 A;  4GYI A;  1OYY A;  3RPQ A;  3J81 K;  3O3K A;  3CUQ A;  3IRR A;  4O6J A;  4IJA A;  1ZAR A;  3KP5 A;  1G3T A;  1W5S A;  1R5G A;  4I7H A;  3SFZ A;  2G7U A;  2RN7 A;  1HST A;  5ILV A;  1J75 A;  2M87 A;  1FBU A;  1O7L A;  5TJJ A;  5L3G A;  1ZAO A;  2CYY A;  1FBQ A;  2HQR A;  4UVA A;  5L3C A;  4WWC A;  4KA4 A;  2W85 A;  2FA5 A;  1KQ9 A;  3F72 A;  1O3R A;  3CUQ B;  1K78 B;  3FHZ A;  3HSE A;  4M9Z A;  4QLC U;  1HXD A;  3VFZ A;  4G94 A;  4UUV A;  2FBK A;  4HX8 A;  2XKO A;  1FLI A;  2A69 F;  3SZT A;  3V8L A;  2OQG A;  3KZZ A;  3HIF A;  4ENN A;  2FBH A;  3E5Q A;  1TNS A;  1WI9 A;  3V7S A;  3TGN A;  3R0J A;  4PCQ A;  4A0X A;  4HDU A;  2LSO A;  3T5X A;  4RGS A;  3LAP A;  4GO1 A;  3F6O A;  3HOT A;  1KQ0 A;  4M72 A;  1OPC A;  5LHI A;  3DPL C;  2MH9 A;  2NAZ A;  3I53 A;  4GXO A;  3GFL A;  2DT5 A;  4I0B A;  2ESN A;  5CVJ A;  3FM5 A;  2EV6 A;  4HZF A;  2XVC A;  3K1N A;  4L5I A;  1HKQ A;  1B1B A;  1AWC A;  3K2Z A;  4RB1 A;  2YX4 A;  5E20 A;  4BYY A;  4OMY A;  2EV5 A;  3GW2 A;  3HTU A;  1T98 A;  2HGC A;  5LRR A;  1YO5 C;  4TV7 A;  2XUB A;  4L9V A;  1Z6R A;  1ZHF A;  3IRQ A;  4LLN A;  4Q48 A;  2P5L C;  2VBX A;  1KU7 A;  4A6E A;  1USS A;  3FXR A;  3IHU A;  2P7V B;  3HRM A;  4MNU A;  3HYI A;  4ASN A;  2JRT A;  1IAW A;  3CUO A;  5BPI A;  3WTZ A;  4A5M A;  3PFI A;  1W7P D;  1IF1 A;  5L3F A;  4GGG A;  1EH8 A;  4L9J A;  4L9N A;  4B09 A;  5E17 F;  2M45 A;  1L3L A;  2K4J A;  5HVQ C;  4IHS A;  3GYH X;  1LB2 A;  1U3E M;  3DFG A;  1BC8 C;  2DI3 A;  2H94 A;  3EDP A;  1HW1 A;  3Q9V A;  1O3Q A;  1PP8 F;  4ENK A;  4Y17 A;  1SFX A;  3RI4 A;  3WTY C;  2FOK A;  5JFR A;  1T2K A;  1SFE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...