5DCMA

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQDPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Signaling protein
molecule keywords PhoB family transcriptional regulator
publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmA00
1MZBA 4LLLA 1SFEA 2DQRA 5CVVA 3U1DA 3LAPA 4AIKA 3GZ6A 2KRFA 3ZMTA 3F8FA 2BBYA 4EMSA 4MEXF 4IHTA 5JR3A 2J5PA 1ON2A 5ICFA 4ON0A 2UXNA 1USTA 2DK8A 1ONVA 3F3XA 2NNNA 2P6TA 3ZN1A 5FGMA 4HBLA 2W57A 2YX7A 4GYGA 3HTSB 3LFKA 1TBXA 1SAXA 3GFJA 4ZZDA 4OINF 3C18A 4IPAA 3B73A 4P55A 1FWZA 5KVRA 1K78B 3FMSA 3OV8A 1HQCA 1RIOH 2DQLA 3F8CA 3WE2A 1QGPA 1U5TB 4A0ZA 1SD6A 2XHKA 5F64A 5FLXZ 5K5RA 2VE8A 3LAJA 2PFBA 2ESNA 1DPRA 4JQFA 4EM0B 4UXNA 3R61A 4D0PA 3FM3A 2XVCA 3BZ6A 3MWMA 3QU6A 3I59B 2VOOA 1LDDA 4G9YA 4UUVA 1S29A 4XLPF 3BJOA 2EFWA 4EJTA 2QM3A 4IRGA 4M9ZA 4AIHA 2FSWA 3CO6C 4H0EA 1C0WA 3RDIA 2LF8A 3QOPA 4FX4A 1LDJA 3WTSC 1WSUA 5L3EA 1QBJA 3O2PE 1NHAA 5E1XA 1FX7A 4OIRF 3LQQA 3RYRA 2Y48A 4PZJA 1YW8A 1XMKA 3EQLF 2LDUA 3DQVC 5ICCA 3N4MA 1BN5A 1YLFA 2PLYA 4EQQA 3HIFA 4KMUX 4ZH4F 4YG2F 3I58A 3DPLC 3P7NA 1G3SA 2VC0A 4BH9A 3KLOA 2VE9A 4I09A 1BJAA 2FXAA 3P9KA 3ZMSA 1FSHA 4HLXA 4OOIA 3KP7A 3HRSA 1ZGAA 2HS5A 1HKSA 1YG2A 5L3FA 4WCGA 4O6JA 3CLOA 4R79A 2PEXA 3MCZA 4I7HA 1GVJA 2OQRA 1GXPA 3KP6A 4RGRA 2VBWA 3RPQA 3J80Z 1P6RA 2HKOA 3W6JB 4LB5A 3U2RA 1XN7A 3DKWA 3HTUA 1O3TA 3KP2A 4L9JA 5HOOA 3BWGA 3ZMZA 2QQ9A 1J9IA 5ILUA 3BP8A 4EGYA 2A6EF 1XSXA 3WGIA 1FBUA 1FYKA 2OBPA 2HKXA 3S2WA 3IWFA 1I27A 3K1NA 1D5VA 5LGUA 3BJAA 2FEZA 5H6RA 3SQNA 3KEQA 3VB2A 3T8RA 1YYVA 1TNTA 1WWXA 2Z5UA 3PQJA 1SD7A 2RGVA 4U7BA 2XGXA 1RNLA 2QYOA 1X3UA 4ZYEA 2D45A 1OYWA 1IF1A 2L02A 2P5KA 2UXXA 3HHHA 3T8TA 1JHFA 3GF2A 4CDGA 4TV7A 1FYMA 2DFIA 3B02A 2UWMA 3MAJA 2OAZA 3GX4X 2ZXJA 1F1ZA 1KYWA 1H9TA 1RUOA 4O3MA 1LNWA 4G6QA 4CXFA 4HX8A 3GWZA 3JAMK 4IJAA 1W4MA 2V1XA 4L9TA 4AWXB 2QQBA 3EETA 3BOQA 4GGGA 5HDNA 1IZ1A 3IKTA 2KJCA 1U6GA 4BHPA 1IRFA 2P5LC 2BV6A 4LLGF 3GLXA 3JTHA 3WGGA 1MDMB 5HDKA 3GFMA 2MD5A 3WTXC 3NRVA 1SMTA 3WTTC 3E5XA 1J2XA 4I0AA 1QO0D 5LRRA 3FXUA 3BPXA 3HSRA 3LA2A 3TDUC 5HDGA 1L3LA 3K1PA 2JRTA 1G3WA 2PG4A 4RGUA 2Q8KA 4M9SA 1CF7A 5CVIA 2IJLA 2DAOA 1XCBA 3KEOA 2QUFA 4HQMA 3CO7C 3IWZA 4ZYGA 1U2WA 3H92A 2XROA 5BMZA 1BI3A 2IA1A 3O3KA 5J8FA 2VT2A 1K78A 3LA3A 2EA4A 1QPMA 2O3FA 4A5MA 3C3WA 2OD5A 5ICEA 3EDPA 1U5TA 2QENA 3L9FA 2HYFA 2YR2A 2B0LA 3HRMA 3KZZA 4S05A 2FRHA 4BXUA 3L09A 2KIMA 1XSDA 4KIFA 5FO5A 5BQTA 5F1RA 5ERIA 3I59A 5DCFA 2XAJA 2IA2A 5KK1A 2FBKA 2EV6A 4L9NA 3F6VA 4FX0A 1P2FA 4WXCA 2MA3A 3MQ0A 1ZG3A 2WV0A 1ZG1A 3TO6A 4MNUA 2MLGA 1O7LA 1BI2A 1MKMA 4ZYDA 2G7UA 4P5OA 4KICA 4KFCA 3IKVA 1KYZA 2GA1A 2FNPA 2J5OA 2D1VA 2EFPA 3HOTA 2STTA 1RZ4A 5DUKA 1G6NA 2ELHA 4Q47A 4RGXA 3IHUA 2M87A 5DCMA 3K1MA 2KIUA 4I01A 5BPIA 1EH7A 4EM2A 1OPCA 2HFHA 1QQIA 2FOKA 3RI4A 1T98A 2IP2A 4HW0A 2WWYA 2L01A 3R0JA 1BI1A 1OYIA 3JW4A 3COAC 4UHTA 1FSEA 1I1GA 5D4RA 1TTYA 4F7ZA 2VONA 1R5HA 2BYVE 1HKQA 1U3EM 1BOAA 2JPBA 2LF7A 1LEBA 2JTVA 4L5IA 2IRFG 4HAMA 1YW7A 2IA0A 4N0BA 1R1TA 4OIPF 4HV6A 2Z9OA 1ODDA 3P9CA 3ECOA 1HKTA 3E5UA 1ULYA 2DI3A 2P8TA 1WQ2A 3WTYC 2XAGA 2FQ3A 2V79A 5CJ9A 1KU9A 3KCCA 2GIVA 3ABTA 4I0BA 4IRIA 2VOPA 4BYYA 3I0TA 4G8XA 1TQPA 5HS8A 3GUDA 2XUBA 4EVIA 1JGSA 2GAUA 5LGNA 4JK1X 3J7AO 3P9IA 4RB0A 3FXQA 3I4PA 2QLZA 4CGZA 2ZMEA 4N9IA 3ML6A 1FT9A 3J80K 4HF2A 3IRRA 3TKYA 2VBYA 2A07F 3EUHA 3LA7A 2HEOA 1BIAA 1S6LA 4HX7A 3TQNA 2ZCWA 4R1HA 1LDKB 2EK5A 4FT8A 4MTEA 3V7SA 1FBSA 2LNBA 3PQKA 5CVRA 2PBIA 1I1SA 4ETSA 4CYDA 2EWNA 2DK5A 2NRAC 3BPVA 3DV8A 3ZMDA 2FU4A 4UV8A 1ZREA 3CUQC 3WU1B 2KKOA 4KN7X 3HRUA 1KA8A 2K27A 2DPUA 1K7AA 4OIOF 2ESHA 1T38A 1B9NA 2VT3A 4BHBA 5D8LB 4I98B 3HUGA 4EJUA 2ETHA 2FMLA 2CO5A 4ENNA 5K5OA 1ZN2A 2GWRA 3GFIA 3Q9VA 1O57A 1Z9CA 3DP7A 3HYIA 2L54A 4HOBA 1IAWA 4CHUA 4UVBA 2G7HA 1K6OA 5CVUA 3WU0A 5IT9Z 3HSFA 3I53A 3M8FA 4CICA 4EGZA 5ICGA 2Z99A 3E3VA 1W7PA 1B6AA 3Q9SA 1FOKA 5ILSA 2DO7A 1P4WA 1QZZA 2QZ8A 4L5JA 4UNOA 1J0RA 5D4SA 4IXAA 1XMAA 5TJJA 2AS5F 4NQWA 5HLIA 1QZYA 1BC7C 2ZNYA 4L9VA 2PQ8A 3E6MA 3FXRA 1UB9A 1LJ9A 5JI6A 3J81K 1MJBA 4I02A 1GXQA 1DP7P 4WXDA 5E8GA 4XRFA 3WTZA 1T6SA 3GFLA 1WKMA 1S3JA 3FHZA 2IW5A 1D8JA 2X0LA 2D2WA 1FY7A 2X4HA 1XGMA 1OMIA 2C6YA 1TNSA 2R3SA 4PDKA 2QBYB 5A2QK 3V7RA 4JBAA 4LG0B 1ZG5A 5E8IA 1ZGJA 1SFUA 2ZKZA 4EJVA 4LB6B 3FM5A 2A69F 2H09A 4HDVA 3BDDA 1E17A 2PN6A 2EA2A 3I5UA 1AOYA 3QP6A 1R7JA 2XRNA 5DYMA 3E6BA 5JFRA 1T0FA 5AONA 3F8MA 3RTRA 2KIFA 2H27A 3ECHA 5HS9A 2EV0A 1HW1A 3GO5A 5ILVA 3HSEA 2ISZA 3QPHA 2GXBA 1R1VA 2ISYA 3KE2A 1YS6A 2DW4A 2HYGD 4U7DA 2H6BA 4QLCU 1EH8A 2JPCA 2ZJ2A 4A12A 1OYYA 4Y17A 5LEKA 1STZA 3ZN0A 2F5DA 2P5VA 3E6CC 1W5SA 1ZLJA 2L4MA 4WXHA 4OIQF 6PAXA 3TGNA 3LWFA 1T2KA 2TDXA 1RUNA 4M6XA 3SFZA 1J5YA 2V1UA 5H20A 1Z6RA 5AIQA 2HWVA 3ERED 2M30A 3R4KA 4AIJA 2JSCA 1BIBA 4P9UA 3F22A 1XD7A 1R23A 2P6SA 4KT5C 3RKWA 5H6QA 3BROA 2VODA 5EEGA 1SD5A 4UV9A 5DUIA 1FZPB 1O3QA 2EB7A 2YU3A 1R5GA 2GA2A 1O3SA 2HGCA 4KUMA 3DFGA 5IT3A 2Y0MA 3SZPA 4P96A 4CO8A 1XGOA 5D6EA 1D3YA 4IRHA 3F8NA 1YIOA 4BQAA 4IF4A 2MBFA 1CGPA 1SD4A 3R60A 3ELKA 2EFQA 2DU9A 2XKOA 3TDZC 1IRGA 3M9AA 4L0YB 4S04A 4Q4ZF 2M8EA 4RS8A 2IT0A 4WX9A 2PMUA 5L3CA 1UFMA 1G3TA 4M73A 3H3UA 1QNTA 2GZWA 3D5LA 3V4GA 1R1UA 2G9WA 3WE3A 3Q5FA 5DD8A 1OR7A 1BBYA 3IL2A 3FZVA 4KA4A 2P7CB 5TRDA 1XGSA 2CGPA 4GCVA 2W25A 3KP5A 4ESFA 4LFUA 2OZUA 2V1DA 3V8KA 2A3SA 2WC2A 1IN5A 1R22A 1DDNA 1ZYRF 1FP1D 4XBFA 4HF0A 2XAHA 5E18F 3FWEA 4ZYHA 2XAQA 3ISPA 2O61A 2EJRA 3KLNA 1LQ1A 1P92A 1JXSA 4KMFA 3KETA 2EFOA 2F5CA 1S8NA 1YQAA 2K4BA 4U0VA 2L3DA 1HW2A 2RNJA 4KIGA 4ESJA 3H3ZA 3I54A 2E7XA 2BE5F 2R7DA 3NEUA 3BY6A 3DF8A 4UVCA 1KQ9A 2VBXA 5D6FA 1XSVA 2O8XA 2M5WA 1H0MA 3HOSA 5DD4A 2ZBKA 1FNNA 1R58A 1BM9A 5BS6A 5AIPA 2HOEA 4Q48A 4HLYA 4U0WA 3RKYA 4G6DA 5BPDA 1IXCA 4UVAA 3JAMZ 5FLXK 3TOAA 2O03A 3ROUA 4LGWA 2O6GE 4RB2C 3PFIA 2XKPA 4GO1A 1TLHB 1Y0UA 1HBXG 5FFZA 3NQOA 2K4JA 1HXDA 5LHIA 4BHCA 1P4AA 5K1YA 1K79A 1TQIA 1MJAA 3C7JA 3V8JA 5E1ZB 3W6KB 2COMA 2ZO4A 1V3FA 2Q2EA 4HX4A 2HQRA 2ADUA 3GVAA 2ZNZA 3L2CA 1XCVA 5CVJA 4A0XA 5HS7A 4L0ZB 1B4AA 4PGGA 3SXYA 1Q1HA 4A6DA 4KNYA 1IUYA 3M8EA 3F8BA 2AXLA 3QRFF 1J7KA 2DTRA 4M74A 4IHSA 3IC7A 3MFKA 3CDHA 3RPUA 1B59A 2Q0OA 1TQMA 4M72A 3K0LA 3TO7A 1BC8C 3QPTA 1TW2A 3OOPA 1FBQA 3K9TA 2RV8A 2K86A 4GXOA 5JHUA 4Z2YA 1GHCA 4BAYA 3KFWX 3WTWC 2F5FA 2MLKA 4A2UA 4FHTA 4KIBA 3BJ6A 2ZFWA 2VXZA 1O7FA 3LQRA 3DXJF 3I64A 4Y13A 4AVPA 5HLHA 2KJBA 1UHMA 4CZZA 1IW7F 4EJOA 4YIIA 1R00A 5FB2A 1CF7B 3R6SA 2JZYA 5L3DA 1DUXC 3IRQA 4YIFA 2O0YA 4PGHA 1ZLKA 5CLSA 1KGSA 4RAZA 5J6XA 3ZMUA 3CUQB 1S7AA 3AAFA 1FPQA 2QVOA 2XV4S 4BNCA 4MTDA 4EJWA 1E2XA 4KN4X 1MDMA 2BGCA 2A6HF 1U5TC 1Z7UA 1ZRFA 3G3ZA 1IXRC 2A68F 3GW2A 2FNAA 2CQKA 4L18B 5CYVA 3VFZA 4NHJA 5L3GA 1H9GA 1YO5C 2STWA 2HTJA 1XB4A 3M7GA 3MZHA 5EEHA 4RB3C 4LMYA 2XAFA 4O5VA 2CW0F 5E20A 4ASNA 4N9HA 1ZAOA 5JVTA 5D5WB 2CWEA 5LBQA 5DV5A 2IPQX 2LKPA 4YFKF 3WTUC 3EYYA 4EV0A 3FX3A 3GYHX 1HW5A 5F6FA 5FFXA 1YS7A 4MHGA 3R0AA 3QAHA 1FC3A 4HYEA 2W24A 5DCMB 5J8CA 1ZRDA 2H6CA 1P4XA 1V4RA 4HV5A 1Z91A 3U9GA 1ON1A 1XDUA 2DPDA 2JT1A 5LGTA 1HSJA 4I2OA 4MGRA 2OU2A 2HTSA 4RGSA 2GQQA 1U78A 2XIGA 2YX4A 1BI0A 2QWWA 2V6CA 4K2EA 4OMYA 2A5YB 1I5ZA 2Y75A 1F4KA 5LLQA 2A61A 3ZPLA 1O3RA 2QQAA 3L00A 3E6DA 5LEJA 3VOEA 3VODA 3T5XA 1W5TA 5D5VB 4LD5A 2HQNA 5D8KB 2RQPA 1Z1DA 3LSTA 4B8XA 3QP5A 5LHGA 2P7VB 4ENMA 1I6XA 2M1BA 1D8KA 2P4WA 3EYIA 2UZKA 3ZMVA 4G7OF 4AD9A 2E1NA 2RVCA 4WF2A 3SZTA 2HDCA 4XLNF 4M9XA 1F5TA 3ABUA 2R7FA 4DNCA 3N97A 1UHWA 3MEXA 2HZTA 3JSOA 3V8LA 3ZQ7A 5LRSA 4B09A 1MGTA 4EM1A 2PJPA 2ZMEB 4HZFA 3TO9A 4LLNA 3F72A 2DT5A 2LSOA 2NS0A 3GXOA 1YTYA 4G7HF 1XGNA 2NYXA 2HR3A 5FD5A 3FMRA 1R36A 1WI9A 1Z6TA 5E1WA 2IVMA 2RDPA 3KP3A 1TW3A 3K2ZA 4LK1F 4LK0F 4MEYF 4KYWA 2CYYA 2VN2A 4OMZA 3TOBA 3SHFA 1PP7U 3REOA 1B1BA 2F5EA 5HLGA 1FYLA 3J81Z 4G94A 3RKXA 4M6YA 3HHGA 1ZARA 3WTVC 5FD6A 1T39A 3L7WA 1IXSB 1Z05A 5HVQC 2EFNA 5ED4A 5A2QZ 1B9MA 2F2EA 2FA5A 3RJPA 2W85A 3G73A 1USSA 1A04A 4PCQA 1EH6A 4U0YA 3GZ5A 2WTEA 1IN4A 1W7PB 2W84A 1J59A 1KQ0A 3D0SA 1KU2A 1FLIA 2BEOA 3WODF 2Z3YA 3KZYA 4WK8F 3CUQA 4MQ9F 1IN8A 2OQGA 1EV7A 3ULQB 1KU3A 1AWCA 1F9NA 1MD0A 4R8HA 1SMYF 2L4AA 3HRTA 4M71A 2FBHA 1L0OC 2H94A 4U88A 1G3YA 4YFXF 4RB1A 3JTGA 3M1EA 4NB5A 4G7ZF 1ZH5A 1J75A 1LEAA 5DEQA 2GXGA 4ENKA 3KP4A 1YFHA 1G4DA 1MJ9A 1JHHA 2CG4A 2Z33A 2RN7A 4GYIA 2PI0A 4OU0A 4KDPA 2EV5A 2XASA 1WRJA 4DQ2A 4QWQA 4P9FA 4E70A 2FBIA 4Y15A 1FP2A 5D5UB 1IN6A 1KQ8A 3V7CA 4ZZLA 2FMYA 3I71A 4XSXF 2E1CA 4HF1A 4ESBA 1SFXA 5DDGA 1JE8A 4WWCA 5BOXA 1DPUA 2CSOA 2K7LA 2E7WA 3K69A 3RYPA 4A6EA 2M45A 3T1BA 1W7PD 5LHHA 5E17F 5L3BA 3C1DA 2RKHA 1KU7A 4YFNF 3MZYA 2MH2A 3WGHA 3RIRA 1UCRA 3O6BB 4HQEA 4ENJA 4XSZF 1U8RA 1OKRA 1PDNC 2VBZA 4LJZF 2FE3A 5D5XB 3DEUA 1IN7A 3WG9A 2QBYA 1PUEE 3DPTA 1RI7A 4LG0A 2MH9A 2VC1A 2D1HA 3CUOA 4A0YA 3VEPA 2CFXA 3F23A 1ZHFA 3CTAA 1PP8F 5IT9K 2V9VA 1HSTA 3FMQA 4IVNA 2ACJA 3T0YA 2YSRA 3CJNA 2FF4A 2DLLA 4MQVA 5K5QA 3E97A 1LB2A 1ZRCA 3E5QA 2PMHA 1YW9A 3F6OA 2K02A 2MC3A 2YPRA 2NAZA 3ZP5A 4A5NA 3FF5A 1S7OA 2DBBA 4Q5SF 1LVAA 2NNYA 2RC4A 2OA4A 1REPC 3F21A 1VTNC 2OZ6A 3JSPA 3QU3A 1XDSA 4RAYA 4HDUA 4HA8A 3GEZA
chains in the Genus database with same CATH superfamily
1MZBA 4LLLA 2EBIA 1A6IA 4F93B 2XSJC 1SFEA 2DQRA 4LG3A 1NG7A 5CVVA 3U1DA 4BDZA 1B72B 3LAPA 4AIKA 2L7FP 1Y39A 3FXLA 3GZ6A 2KRFA 2VL8A 3BCAA 3ZMTA 3OYMA 3F8FA 2BBYA 4E4HA 4EMSA 4MEXF 4IHTA 2DMTA 5JR3A 3PUFA 5GAEJ 2E5NA 1ON2A 2J5PA 2B9SA 5ICFA 4FE7A 4ON0A 3OYKA 1TZLA 5IYBJ 3RCOA 4F3QA 2UXNA 5C4JJ 3CMEI 1USTA 3LSJA 3TMOA 4YIRX 2DK8A 4QPOA 1ONVA 3F3XA 2NNNA 2P6TA 3JRAA 3ZN1A 5B66C 5FGMA 1GUUA 2VLAA 4HBLA 2W57A 3MVPA 3PNVA 2YX7A 4GYGA 3HTSB 1I50J 3LFKA 1TWCJ 1TBXA 5JVGF 1SAXA 1A35A 2V9PA 3GFJA 4ZZDA 4OINF 3C18A 4IPAA 4PFPA 2KQRA 1POGA 3B73A 4P55A 1FWZA 5KVRA 5FLMJ 1IDZA 1K78B 2G0EA 3FMSA 1ENHA 3OV8A 1HQCA 1RIOH 2DQLA 3HDDA 3F8CA 1LE8B 3WE2A 2Y2ZA 3IH3A 5DM6F 1QGPA 1U5TB 2M2EA 1WJAA 1SD6A 4A0ZA 4RDUA 2XHKA 2ELKA 5F64A 3JRFA 2D5VA 2RREA 5FLXZ 3G1OA 5K5RA 1U8BA 2VE8A 3LAJA 2PFBA 4BXXJ 4A69C 1NG6A 1OR7C 1DPRA 2ESNA 1G59A 4JQFA 4EM0B 4UXNA 3R61A 2Y69H 4D0PA 2ELJA 4MIMA 3CDLA 3FM3A 1Y8QB 2FX0A 2XVCA 2NXNB 3BZ6A 2QKMB 3MWMA 4RLFA 2F6CA 4IEJA 3QU6A 4EEFG 1JKQC 1W36D 3I59B 2VOOA 1VZ0A 1ERDA 3JRBA 2ME6A 1LDDA 4G9YA 3OSGA 1EJ9A 3AG2H 4UUVA 2R93J 3SZGA 1QVUA 3CD6I 2KZVA 2LD5A 3S14J 1T56A 1FTTA 1DGRM 3D5RC 1S29A 5M3MJ 4XLPF 3BJOA 1GV5A 2EFWA 4EJTA 2WAQN 4UUSB 1PJRA 3BTJA 4C2UA 2QM3A 1JJ8C 4IRGA 4M9ZA 4AIHA 2FSWA 3X2QH 3CO6C 4H0EA 1C0WA 3RDIA 4HSTA 4V19K 3HOZJ 5KCMA 2LF8A 2PX9A 3QOPA 4FX4A 1LDJA 3WTSC 2BHZA 5L3EA 2JK3A 2NOJB 1WSUA 4XRSG 1QBJA 3DKYA 3CCQI 3CLQA 3FXOA 3O2PE 3O8GA 1K6YA 4BY7J 1HDDC 1MBGA 1NHAA 5E1XA 1R71A 1FX7A 4OIRF 3LQQA 3RYRA 1JI8A 2Y48A 1HOMA 4PZJA 1YW8A 1XMKA 3EQLF 2LDUA 3DQVC 3IUOA 5ICCA 3N4MA 1BN5A 3K4NA 1YLFA 2PLYA 5CPRB 1Z77A 3GMEA 3OYNA 2HDWA 2X1CA 4EQQA 3HIFA 2XF6A 2CUJA 2EZLA 2L7ZA 3OIOA 4KMUX 4ZH4F 1WCMJ 4YG2F 3RZDJ 3I58A 2E1MC 3DPLC 1I39A 3M07A 3VDXA 3P7NA 1YRNB 5EGOB 1G3SA 2VC0A 2KMUA 4BH9A 4CH7A 3KLOA 3V42A 2VE9A 4I09A 4YELA 3F9KA 1BJAA 4F55A 3HB9A 2FXAA 3P9KA 3ZMSA 3K2AA 3NAUA 9ANTA 1FSHA 4HLXA 2HDDA 1IUFA 4OOIA 3KP7A 1U9OA 3HRSA 1D1BA 2DXIA 1ZGAA 2LH9A 4P1WA 1T95A 2HS5A 1HKSA 3PM1A 2LKXA 1SANA 1YG2A 1ZELA 1X4OA 2XDVA 5L3FA 1ACIA 4WCGA 4O6JA 4C2MJ 1SVOA 3CLOA 4R79A 2DMNA 1OFCX 2PEXA 3MCZA 4BE0A 4I7HA 1VQOI 4XRSA 1GVJA 2Q2EB 2OQRA 1GXPA 2MABA 1X1BA 1ZTRA 4C9YA 4H4KC 1NH3A 1N78A 3KP6A 3KZIC 2P81A 4FE4A 4RGRA 3ZQIA 3CC4I 2VBWA 3RPQA 2M0MA 3SFIA 3SEZA 3J80Z 2CQ7A 2HXOA 2NS7A 1P6RA 2HKOA 3W6JB 3UNGC 5GTHC 4LB5A 3U2RA 1XN7A 3DKWA 3HTUA 4RMNA 1W0UA 1O3TA 3S2HJ 3KP2A 3CP8A 1Y1VJ 4L9JA 5HOOA 3BWGA 3ZMZA 1FOXA 2QQ9A 1J9IA 5ILUA 3HEFA 3BP8A 4IKFA 5FRNA 4EGYA 2A6EF 1XSXA 3L1PA 1TWFJ 2VB6A 3TW6A 5K7FA 1IG7A 4U87A 1WJFA 5F0CA 2XRLA 3WGIA 1FBUA 4FASD 1FYKA 3M8JA 1SFKA 2OBPA 5CQEA 2HKXA 2FOWA 3S2WA 3IWFA 1I27A 3K1NA 5TISC 4XICA 2W00A 1D5VA 3KEYA 3FK7A 5LGUA 3BJAA 2FEZA 2XGCA 5H6RA 3SQNA 3KEQA 3VB2A 3T8RA 1YYVA 1FMWA 3K4KA 3MN2A 2PJRB 2JA5J 1TNTA 2KIQA 1WWXA 2Z5UA 3PQJA 1SD7A 2DN0A 2RGVA 1MNMC 4U7BA 2XGXA 1RNLA 2OCEA 2QYOA 1MNEA 1X3UA 4ZYEA 2D45A 4Y7NJ 1OYWA 1AA7A 1BR1A 1IF1A 2L02A 1WZ2A 2RAEA 2P5KA 2DTZA 4B1RA 2UXXA 4F52A 3HHHA 2JUCA 3T8TA 1JHFA 2R4GA 4HG2A 3GF2A 4CDGA 3DEWA 4TV7A 1FYMA 3BG5A 3L2UA 2DFIA 3B02A 3ZOBA 2DDAA 2HPIA 3OYAA 3HJEA 1YJWI 2UWMA 3MAJA 2OAZA 3GX4X 2ZXJA 1RKWA 5IP9J 1R9TJ 1F1ZA 1KYWA 4ABZA 3D1NI 2OC6A 1H9TA 1LPQA 2LYCA 4I6ZA 1J09A 2M7AA 2WB1A 3CJTB 2VKDA 1RUOA 4O3MA 2DJNA 4JX5A 1LNWA 4G6QA 5J1YA 4CXFA 2DA7A 4HX8A 1IRXA 2ME0A 3GWZA 2IGMA 3JAMK 4PJMA 4IJAA 1RC9A 1W5CC 4LIUA 1W4MA 2V1XA 4L9TA 4AWXB 3SEQA 1IC8A 2QQBA 3EETA 1VQKI 5B3SH 4BKXA 4DGWB 3BOQA 1AHDP 1LVKA 3GTLJ 4GGGA 5HDNA 3IH2A 1IZ1A 5EG0B 1V55H 3IKTA 4HRIA 2KJCA 1MBFA 1U6GA 4BHPA 5GAGJ 3KYLA 1IRFA 1MBKA 2JSPA 2P5LC 2BV6A 4LLGF 2WV1A 3GLXA 4JX4A 4OAYA 3JTHA 3M3YJ 3WGGA 1MDMB 5HDKA 4UB8C 2K40A 3GFMA 2MD5A 2JMWA 3WTXC 2YU9J 4NDLA 3MKWB 2DOEA 3HUGB 4BL0B 2OF7A 3RSNA 3NRVA 3QOEA 2X6WA 1SMTA 3WTTC 3E5XA 2TRTA 3RPUD 3K70D 2GXAA 4ITVA 1J2XA 4I0AA 1QO0D 5LRRA 3FXUA 2MG4A 2DT6A 1X3ZB 3BPXA 3HSRA 3LA2A 2K9NA 3TDUC 5HDGA 1L3LA 3K1PA 2JRTA 3OYBA 4FCYA 1G3WA 1VF9A 1Z67A 2LK2A 2M34A 1X4PA 2PG4A 4RGUA 5JHFA 1HC8A 2Q8KA 4M9SA 1CF7A 4E7JA 5CVIA 3H5AA 2ID6A 2IJLA 4V2FA 1JTYA 2DAOA 3RZOJ 1XCBA 4XIDA 1AKHB 1PVEA 3KEOA 2QUFA 2KISA 2XSDC 2MGQA 4HQMA 3CO7C 4A3LJ 3IWZA 4PUSA 3RQ4A 5IP7J 3A02A 2KT0A 4ZYGA 2TCTA 1U2WA 3H92A 2XROA 5BMZA 4ZDPA 1BI3A 2IA1A 3O3KA 5J8FA 2COBA 2VT2A 3BG6A 1K78A 2P0WA 3LA3A 2EA4A 1E0EA 1QPMA 3TW7A 2HQ5A 1ZR4A 4HSRA 2O3FA 4XKWA 4Y4RA 1A5JA 4A5MA 4F92B 3C3WA 2OD5A 5ICEA 3HBLA 1LE8A 3BR6A 3CCLI 3PSIA 1Y1WJ 3EDPA 1U5TA 2QENA 2JA2A 3L9FA 3K4CA 2LP0A 1XC5A 2HYFA 3LSKA 3NWSA 1SEUA 1IJWC 4M3DA 2YR2A 1CQTA 2B0LA 4DYQA 3HRMA 3KZZA 1X2NA 4S05A 3JCUC 2FRHA 4BXUA 1VQ5I 3OWTA 3L09A 4DZJA 2KIMA 1XSDA 4KIFA 3FKIJ 5FO5A 1VQ8I 1IDYA 5BQTA 5F1RA 1WH5A 3OYFA 2EZIA 3VSKA 5ERIA 3I59A 5DCFA 2XAJA 1MMSA 4M6VA 3CCJI 1WJBA 2IA2A 4YEJA 4C2TA 5KK1A 2FBKA 2EV6A 4L9NA 3F6VA 2DMUA 1P2FA 4FX0A 4WXCA 2HNHA 2MA3A 1XPXA 3MQ0A 1ZG3A 2IBDA 2M9HA 2R5ZB 2WV0A 1ZG1A 2ZC2A 3TO6A 4MNUA 2MLGA 1O7LA 3SYTA 4UUTA 3QWLA 3ABMH 1BI2A 2QSHX 3H3VK 1MKMA 4ZYDA 3HOYJ 2G7UA 4P5OA 2JRMA 4KICA 4AYBN 1YHQI 1TT0A 1MSEC 4KFCA 2KL4A 3IKVA 4ANJA 3W2VA 4A3CJ 2R0QC 2XF7A 4B3XA 2FUG2 2RNGA 1KYZA 2GA1A 3WHBA 3Q0UA 2V1NA 2FNPA 3HC7A 2J5OA 2D1VA 1MSFC 2IS4A 1P7IA 2EFPA 1HA8A 3HOTA 2STTA 3G71I 3QPSA 1RZ4A 2M3AA 5DUKA 1G6NA 2EH3A 1WJDA 2ELHA 4Q47A 3BCBA 5F0HA 1WJCA 4IHXA 4RGXA 3IHUA 2VJJA 2M87A 4FISA 2F4OB 5DCMA 3C2GA 3K1MA 3E1SA 3KYCB 4ZTFA 1YRNA 4FQGA 2X9DA 2KIUA 4I01A 1JJ6C 2NVXJ 4MFEA 4QPQA 2BXYA 5BPIA 3CCSI 1EH7A 2W1OA 4EM2A 1OPCA 2LR8A 2HFHA 1E3OC 2X85A 2W48A 1X1AA 1QQIA 1MMGA 2FOKA 3RI4A 4XLCA 1T98A 2IP2A 4HW0A 3M4OJ 2WWYA 1NTCA 3KX2A 2L01A 5CKTA 4I76A 3R0JA 2XPWA 3K4LA 2CV0A 2ZXWH 2DYSH 4FTHA 1BI1A 3E0JB 1OYIA 3JW4A 3GLLA 3COAC 4II2A 1OLTA 3LFUA 4RLQA 4UHTA 1FSEA 2LY2A 1I1GA 5D4RA 2K5CA 1TTYA 4F7ZA 4NC8A 2CRGA 2VONA 5M5WJ 3HG9A 1R5HA 1ZGWA 2BYVE 1HKQA 1U3EM 1BOAA 4LOCA 2JPBA 3OS1A 2LF7A 1LEBA 5GPAA 3HZJA 2JTVA 4L5IA 2IRFG 2LBFB 2KRCA 2L9VA 4HAMA 1VNDA 1YW7A 2IA0A 2L7KA 5EZHA 4N0BA 2KZGA 1X1PA 1JKOC 2JVHA 2V7FA 1R1TA 5IOZA 1OJLA 1GDTA 4OIPF 1FEXA 3DBRB 1A31A 2EIMH 2E34A 4HV6A 2Z9OA 1ODDA 3P9CA 2KHMA 3ECOA 1HKTA 3E5UA 3S1MJ 3KPHA 2I5UA 3CDIA 3WU2C 1ULYA 2DI3A 2P8TA 3OYEA 1WQ2A 3WTYC 4A93J 3I4NJ 2XAGA 2FQ3A 3CCUI 2V79A 3WHCA 5CJ9A 1KU9A 3JREA 3CMYA 3KCCA 1A6QA 2GIVA 3BR3A 5C4XJ 3ABTA 4I0BA 4GFBA 4IRIA 2VOPA 2B7EA 2DMPA 1MMAA 4BYYA 3I0TA 5FKLA 1DU6A 5EF6A 4G8XA 2WADA 1TQPA 5HS8A 3BTLA 1F36A 2BZTA 2IGKA 1XX5A 3VYSB 4ZYAA 3S1NJ 3GUDA 4KISA 1QZEA 2XUBA 2R7QA 4EVIA 5J4YA 2E35A 5JLXA 1JGSA 3H5NA 3AL0C 3PJRA 2GAUA 5LGNA 1DGWY 3WG7H 2R5YB 1IGNA 2GOXB 4JK1X 4J01A 4Z6YA 3J7AO 2CFOA 2CQNA 3P9IA 4RB0A 5FKNA 3FXQA 1DP3A 1R6RA 3I4PA 4B3AA 2QLZA 4CGZA 2ZMEA 4N9IA 2MC4A 3AKZA 3ML6A 1FT9A 2H8RA 3MD2A 3J80K 4HF2A 3IRRA 5FKMA 4M3BA 3TKYA 2VBYA 2YS9A 3DCFA 2A07F 3EUHA 3LA7A 2HEOA 1BIAA 1S6LA 4HX7A 2V9KA 4IQJA 4II3A 1D5YA 3TQNA 2X48A 4JYKA 2ZCWA 4R1HA 4CYCB 2CH0A 4BEHB 1LDKB 4L5EA 2EK5A 4FT8A 3QYEA 4MTEA 3V7SA 1FBSA 3NWTA 2LNBA 4IO9F 2LMDA 3PQKA 5CVRA 2PBIA 1I1SA 3CJQB 4ETSA 3O8HA 4CYDA 3DLAA 2EWNA 2DK5A 3ZRGA 2BY0A 2NRAC 3BPVA 4CCLA 3ABKH 3DV8A 3ZMDA 3H9GA 1ZK8A 2FU4A 4UV8A 1ZREA 3CUQC 3WU1B 3TEDA 5F27A 2KKOA 3LMMA 4KN7X 2HPMA 4XOTA 2DA2A 3HRUA 1KA8A 2K27A 2CMPA 2DPUA 1K7AA 2VPLA 4OIOF 3OL3A 2ESHA 4HPQA 1T38A 3VWBA 1B9NA 3HKZA 2VT3A 2E2HJ 4BHBA 4CSWA 5D8LB 2HVRA 4I98B 4D7MA 5TGTA 1TP4A 3HUGA 4EJUA 3PIOF 1VQ6I 3DTIA 4BE1A 2ETHA 2FMLA 2CO5A 1MBEA 4ENNA 1BJZA 1ZN2A 2GWRA 5K5OA 2K3FA 3GFIA 3Q9VA 4BQQA 1O57A 2V26A 1Z9CA 1V54H 2NVQJ 3DP7A 3HYIA 4BUPA 2L54A 4HOBA 5B5EC 1IAWA 4CHUA 5FJ8J 1A36A 3HGYA 4UVBA 2I8DA 1MMDA 2G7HA 1K6OA 4IHWA 3C2HA 3CMAI 5CVUA 1D0XA 3WU0A 5IT9Z 3HSFA 3I53A 3M8FA 3K4MA 4CICA 4EGZA 4BE2A 5ICGA 4A3MJ 2Z99A 3E3VA 5IOYA 1W7PA 2EZKA 2UV1A 3PSFA 1BR2A 4G12A 5LFAA 3W3CA 1B6AA 3PIPF 5CQGA 3L2WA 3Q9SA 1FOKA 5ILSA 3HOWJ 2DO7A 1P4WA 2E1MB 1QZZA 2QZ8A 3AFHA 2JN6A 5E3MA 2GBYA 2DFEA 3S2DJ 4CUGA 4L5JA 2Y9ZA 4UNOA 1J0RA 1MNDA 1LKXA 5D4SA 4IXAA 1XMAA 1HCRA 5TJJA 2FD5A 2FQ4A 2AS5F 3OYDA 3BQYA 4NQWA 2KLOA 5HLIA 1QZYA 1BC7C 1D0ZA 4ZC3A 2HOAA 2ZNYA 4L9VA 3AG3H 4RM3A 2PQ8A 4XR6A 3E6MA 2N8GA 1OCPA 2Z2SB 1SFOJ 3FXRA 1UB9A 2E1OA 1LJ9A 3ZQQA 1MJBA 4I02A 5JI6A 3J81K 2BW3B 1GXQA 1DP7P 3A2KA 1IV6A 4WXDA 4PJ0C 5E8GA 4XRFA 3L2QA 3G6EI 3OYLA 3WTZA 1T6SA 3GFLA 5GAHJ 1WKMA 1S3JA 3FHZA 2IW5A 1D8JA 2X0LA 2D2WA 1FY7A 2X4HA 2DA1A 1XGMA 1OMIA 4NBQA 2C6YA 3VSLA 1PUFB 2CUZA 3SDGA 4B47A 1TNSA 2R3SA 3A01B 4PDKA 2QBYB 5A2QK 2KDZA 3V7RA 4B44A 4JBAA 4QTRA 4LG0B 1K4TA 1BW6A 1ZG5A 5E8IA 1ETVA 4RA2A 4C3JJ 1ZGJA 5FROA 1SFUA 3G4SI 2ZKZA 5HODA 5M3FJ 4MO7A 4EJVA 4QIWN 4LB6B 3FM5A 2NS8A 1FIAA 2GLOA 2A69F 2H09A 1YJ9I 4HDVA 1E3HA 5FKOA 3BDDA 2CV1A 2E36A 5IP6A 1MH3A 3K7AJ 4OWRB 1OCZH 1E17A 2PN6A 1TL8A 2W82A 2EA2A 3I5UA 1AOYA 4XORA 3QP6A 4CCMA 1R7JA 1B8IB 2XRNA 3PL8A 5DYMA 4DBQA 3E6BA 1IO2A 5JFRA 1QHHD 1T0FA 1N75A 2H1LA 5AONA 1GVDA 3H1CA 3H36A 1UZCA 3F8MA 3QQAA 3RTRA 1JT6A 2KIFA 2H27A 2IS2A 3BR1A 3A4CA 3K4BA 4A3DJ 3ECHA 5HS9A 2KP6A 2EV0A 4J00A 3W2AA 2R7RA 4A3BJ 1PYVA 5F0FA 1HW1A 2BY3A 3GO5A 5ILVA 2W7NA 3HSEA 2DT7B 2ISZA 3QPHA 3QPLA 2GXBA 2KFDA 3LOCA 4E7SA 1R1VA 1G8XA 2ISYA 3KE2A 1TC3C 1YS6A 3DBLB 2DW4A 3EUKL 4RM2A 2HYGD 4U7DA 4NUBA 3NARA 2EIKH 2H6BA 4QLCU 1EH8A 2JPCA 5IYDJ 2ZJ2A 4A12A 1OYYA 4AC0A 2JQ7A 4Y17A 5LEKA 2VXDA 4KT6A 1Z0XA 2VKHA 2Q1ZB 1STZA 3ZN0A 2F5DA 1FOWA 2P5VA 1BW5A 4E7HA 3E6CC 1W5SA 2WB1N 3TBIA 1YX5A 1ZLJA 2L4MA 1N25A 1UHSA 4WXHA 1TWAJ 4OIQF 6PAXA 3TGNA 3LWFA 4XKVA 1T2KA 3ONQA 1LFUP 4RAGA 4N4OB 2TDXA 1RUNA 4M6XA 3SFZA 1J5YA 2V1UA 4NC7A 5H20A 2H1KA 1Z6RA 2LBFA 2F5VA 5AIQA 2OTJI 2HWVA 3ERED 2IS1A 2M30A 3DBHB 3CF2A 3BT9A 3CP2A 2VJ5A 4IQ4A 3R4KA 2ZMEC 4AIJA 1S9HA 3FIWA 2QSFX 2JSCA 2DOAA 1BIBA 1TWHJ 4P9UA 3JR9A 3F22A 1XD7A 5EEAA 4N4NB 1R23A 1P9QC 2AQFA 2VPRA 3GCMA 4JP0A 4HNUA 1RKTA 2K85A 2P6SA 3EUHC 4KT5C 5H6QA 2AHQA 3RKWA 2DMQA 3BROA 4RBOA 3BZKA 3DPUA 2VODA 5EEGA 4CCOA 1YITI 1SD5A 2DYRH 4UV9A 5DUIA 3BR0A 5B1AH 1FZPB 1LFPA 3TL4X 1O3QA 2CQQA 1XG1A 2EB7A 2YU3A 1R5GA 3N05A 2EIJH 2GA2A 2VJIA 3G2BA 1VQLI 1O3SA 3J7ZI 1B72A 5F1JA 2HGCA 3MMYB 4KUMA 1NK2P 3FHNA 3DFGA 5IT3A 1BR4A 4DOZA 3H0GJ 2KDOA 2QEXI 2AO9A 2Y0MA 2X1DA 1T08B 2IAIA 3LSGA 3SZPA 2VQHA 4P96A 4CO8A 1XGOA 1UAAA 2MFZA 3OL4A 5D6EA 1D3YA 3DTEA 4IRHA 2R7VA 2LC2A 3F8NA 4XN3A 1YIOA 4BQAA 2XAUA 4IF4A 2JWTA 3HGGA 2MBFA 3OYCA 1CGPA 3OR2C 2BVLA 1OCRH 3DWLE 1SD4A 1QHGA 3FXMA 3R60A 3ELKA 2EFQA 2DU9A 2XKOA 3TDZC 1IRGA 1OISA 3M9AA 5H2FC 4L0YB 4S04A 4Q4ZF 2M8EA 3BQZA 4PSWA 4RS8A 3I3LA 4NC6A 2V6EA 2IT0A 4B48A 3JRCA 4WX9A 1MBJA 2PMUA 1APLC 5L3CA 1UFMA 1G3TA 3VYTB 4B43A 5J3LA 3LNQA 4M73A 3H3UA 1WH7A 1K83J 5LD2C 2DJIA 1QNTA 2GZWA 1FIPA 3D5LA 3V4GA 3PUBA 1R1UA 2G9WA 1BA5A 2IXSA 3WE3A 1YE9A 5C3EJ 3Q5FA 3D5SC 2MW8A 1MIJA 4CYCA 3BTIA 5DD8A 1R49A 2L9SA 2BVMA 1OR7A 1YOVB 1H89C 1BBYA 3IL2A 3KYDB 1IRZA 3FZVA 4KA4A 2P7CB 3HOUJ 5TRDA 1XGSA 2CGPA 4GCVA 2W25A 2QCOA 3KP5A 4ESFA 4LFUA 3AG1H 2OZUA 3CQZJ 2X6OA 2L9NA 2V1DA 3V8KA 1TWGJ 2A3SA 2WC2A 4XRMA 1ZKGA 1WHUA 1HF0A 1IN5A 1R22A 1DDNA 1ZYRF 1FP1D 1SVLA 4XBFA 3K6GA 4CZCA 3E7LA 2DA6A 4HF0A 2XAHA 3MKZA 2LVSA 3S93A 5E18F 1BOBA 3FWEA 1I3AA 2Z1DA 2R7WA 4ZYHA 2XAQA 3ISPA 2O8KA 2O61A 2EJRA 2M4KA 3KLNA 1LQ1A 1P92A 1JXSA 4KMFA 3BZCA 4UUSA 3KETA 2EFOA 4PSXA 4ZJZA 2F5CA 1S8NA 1YQAA 2K4BA 1I6HJ 4U0VA 4BQNA 2L3DA 3Q3SA 4XK4A 1HW2A 2RNJA 4KIGA 4ESJA 3H3ZA 3I54A 2E7XA 2BE5F 2R7DA 2K9QA 1KZHA 3NEUA 4DW6A 3BY6A 2X6YA 1Y0NA 3DF8A 4UVCA 3PO3J 3FXKA 1KQ9A 2QQ8A 2VBXA 5D6FA 1XSVA 2M4GA 2O8XA 2M5WA 1Z7LA 1H0MA 3HOSA 5DD4A 1EA3A 2ZBKA 1FNNA 1R58A 3A0BC 1BM9A 5BS6A 3B6CA 2Y0SN 4NNJA 4IOAF 3S3NA 5AIPA 1VQ7I 2OPTA 2KPMA 3FISA 2HYJA 2HOEA 4XLAA 5DS9A 1JTXA 1GT0C 4Q48A 4G6TB 1ZQ3P 4HLYA 3S16J 4U0WA 3RKYA 4G6DA 1P7JA 5BPDA 1IXCA 2OJED 4UVAA 4AYBA 3JAMZ 4HNTA 5EGOA 2LFBA 3OY9A 3CF5F 3VYRB 5FLXK 3TOAA 3QODA 2EINH 2O03A 3ROUA 4X6AJ 3CZ6A 4LGWA 5C44J 5J4VA 2CW8A 1JKRC 2O6GE 4RB2C 1Y6IA 4LIVA 5F04A 3PFIA 2LTPA 2Y9YA 4XN0A 4BQOA 2XKPA 4GO1A 1TLHB 2CU7A 3CCMI 1ETKA 1T0FC 2E71A 1Y0UA 2ECCA 2DA4A 1HBXG 5FFZA 4DBRA 3NQOA 3ZQHA 2K4JA 3ZCOA 1HXDA 2L9RA 1QPIA 5IYCJ 1MH4A 3EPZA 5BNGA 2E19A 3P5JA 3DU5A 4BHCA 5LHIA 2WAEA 1H88C 1P4AA 2NOGA 5K1YA 1K79A 1TQIA 1MJAA 3C7JA 3PO2J 3OIQA 3V8JA 5E1ZB 3W6KB 2DFFA 2COMA 2ZO4A 4JOMA 1PUFA 4XMYA 1V3FA 1WJEA 2Q2EA 4HX4A 2HQRA 3HXLA 3LSMA 2VQGA 3UKGA 2ADUA 1V5FA 5FRMA 2ID3A 3GVAA 3BTCA 2ZNZA 3L2CA 1ORKA 3A03A 1XCVA 5CVJA 4A0XA 5HS7A 4L0ZB 1B4AA 4LITA 4GRIA 2B63J 1V5GA 4E7ZA 2LOOA 3S3MA 2R7SA 4PGGA 4XL9A 2ZB9A 3SXYA 3TP0A 3BR5A 3HPGA 2L2OA 1Q1HA 1QA6A 4A6DA 2IS6A 5EJCA 4KNYA 1IUYA 3M8EA 3F8BA 2AXLA 3QRFF 1J7KA 3ZQLA 2DTRA 4HEA2 2LY1A 4M74A 4M3FA 2PMZA 4IHSA 3IC7A 4XLEA 1WFXA 2GM4A 1B8IA 3MFKA 3CDHA 2XC7A 3RPUA 1Z3XA 1B59A 1VI0A 2Q0OA 1TQMA 4M72A 3DTKA 3K0LA 1W0TA 2PJRA 3TO7A 3W2WA 1BC8C 5J1RA 3I4MJ 2F4IA 3QPTA 1TW2A 3OOPA 2LREA 1FBQA 3K9TA 3AL0B 2RV8A 2QKLB 2K86A 3GBGA 2VQLA 4GXOA 1HDPA 1YX3A 5JHUA 4Z2YA 1GHCA 4BAYA 3KFWX 5F08A 3WTWC 2F5FA 3DEEA 4RAFA 2NVYJ 5JLWA 4E7IA 2MLKA 3TP3A 4A2UA 4FHTA 2Y30A 3HOXJ 3HPHA 4KIBA 3BJ6A 4X1EA 2ZFWA 2VXZA 4AIDA 3OIPA 4MFDA 1O7FA 3FBIB 3LQRA 1SAUA 3DXJF 3I64A 2OV7A 4Y13A 4AVPA 2ZJRF 3ABLH 5HLHA 3C2BA 1VQ9I 2KJBA 1F43A 1UHMA 4CZZA 4C3IJ 1IW7F 1XMXA 4EJOA 1VFCA 3J7YJ 4X0GA 2HOTA 3GTOJ 4YIIA 5M5YJ 4Y33A 1WGXA 1R00A 2A6TA 5FB2A 1CF7B 1M1EB 3Q0VA 2K9SA 2ECBA 3R6SA 3KIOA 4A3KJ 4XKCA 4A3IJ 1S72I 2JZYA 2XB0X 3OYJA 5L3DA 2O5RA 2AXTC 3CCYA 1FTZA 1DUXC 3OR1C 3IRQA 4YIFA 1GV2A 2O0YA 4PGHA 1D0YA 1JGGA 1ZLKA 4PFOA 5CLSA 3H9JA 1O4XA 1KGSA 1UELB 4RAZA 5J6XA 2F48A 3CCRI 3ZMUA 3CUQB 1S7AA 4AM3A 3AAFA 1FPQA 4DJAA 4ZDLA 4CCNA 4A3FJ 2XGEA 2EQRA 3OOUA 1JUPA 2QVOA 2ZJQF 2F4MB 2XV4S 3OS0A 3HKZN 4BU2A 5EG0A 5EZGA 2M0CA 3I56I 4BNCA 2R7XA 4XONA 4MTDA 2DA5A 4EJWA 2K9LA 3LSRA 1E2XA 5E79C 4KN4X 1MDMA 1X1CA 2BGCA 1MW7A 2A6HF 1RESA 1U5TC 2IEKA 1Z7UA 3QYBA 4PJNA 1ZRFA 3G3ZA 1WJ5A 3GTQJ 3U21A 1IXRC 3JRGA 3ESWB 2A68F 3GW2A 2FNAA 2CQKA 4L18B 2A5WA 2BY2A 2R7OA 5CYVA 3VFZA 2VIXA 4NHJA 5L3GA 1H9GA 1YO5C 2STWA 2HTJA 1XB4A 3M7GA 3K10A 2M7BA 1AU7A 3MZHA 2L7MP 5EEHA 4RB3C 2UUZA 4LMYA 4UB6C 3LSPA 1JUSA 2XAFA 1EKEA 4O5VA 2LRDA 2CW0F 3CESA 4BJTA 4D5FA 5E20A 5KHDA 3OSFA 4ASNA 2RQQA 4N9HA 4BJ6C 2HOSA 2JVGA 1ZAOA 1OCTC 2WAQA 5JVTA 5D5WB 1UMQA 3FKJA 2ZSIB 4D9JA 1AKHA 2CWEA 5HLTA 5LBQA 3CC2I 1QRYA 1D1AA 5GADJ 1SC7A 5DV5A 3HOVJ 3L2VA 4E6KG 2IPQX 3DU6A 2LKPA 2WY7Q 4YFKF 1S7EA 2CUEA 3WTUC 3EYYA 2NVUB 4DIQA 4EV0A 3FX3A 3GYHX 1HW5A 5F6FA 5FFXA 1FJLA 1YS7A 3H35A 4MHGA 3R0AA 3QAHA 1FC3A 4HYEA 2W24A 5DCMB 5J8CA 2EPFA 2LKSA 1ZRDA 2H6CA 1P4XA 1V4RA 4HV5A 1Z91A 3U9GA 3ZR8X 1ON1A 1XDUA 2DPDA 2R7UA 2LG4A 2JT1A 5LGTA 3BLYA 1X58A 1HSJA 4I2OA 4MGRA 1I3QJ 3QYFA 4PJJA 2OU2A 1BL0A 2HTSA 5GPCA 1ITYA 2E60A 1OCOH 2DCEA 2L5QA 1U9NA 1RETA 1V5EA 4RGSA 2GQQA 2I10A 5EYRA 1U78A 2R5ZA 3GZNB 3IAS2 1FMVA 2XIGA 1NK3P 2YX4A 1BI0A 2QWWA 2V6CA 2QF7A 3IV5A 4K2EA 4OMYA 3RKQA 1Y56A 3HL2A 3I9V2 1LFBA 5IY5H 2A5YB 1I5ZA 2Y75A 1F4KA 5LLQA 2A61A 2X6XA 3ZPLA 1G2HA 3M1CA 1HLVA 4Y3OA 1O3RA 4BGDA 3S32A 2QQAA 3L00A 4CCJA 3E6DA 2EZHA 5LEJA 3VOEA 4C3HJ 1OQYA 4ZDOA 3VODA 3SJMA 4HNVA 4BBSJ 3T5XA 5HNHA 1W5TA 2HQAA 5D5VB 4LD5A 4M3GA 2HQNA 3IP4B 5D8KB 2JJ7A 2QGUA 2RQPA 4DZPA 1Z1DA 3LSTA 1FOYA 4B8XA 3DLLF 3QP5A 5LHGA 2P7VB 1S5LC 1ETOA 1VQMI 4EATA 3K4JA 2DODA 4ENMA 2JA8J 1I6XA 2M1BA 1D8KA 2P4WA 1JUMA 3EYIA 3A1YA 1LUJB 2UZKA 2VUMJ 3ZMVA 3K70C 3Q0WA 4IZZA 4G7OF 4AD9A 5E3LA 2E1NA 2RVCA 4JX6A 5HNFA 4WF2A 3SZTA 1YIJI 2HDCA 4XLNF 4UY8I 2XPUA 3U1KA 4M9XA 1F5TA 3ABUA 2R7FA 4DNCA 1JKPC 3N97A 1Y8RB 4B4CA 1UHWA 2WAFA 3MEXA 4CA0A 2HZTA 3GTPJ 3JSOA 2LLKA 2GIZA 3V8LA 3ZQ7A 1RPWA 5LRSA 3GTGJ 4B09A 1IV8A 1MGTA 4EM1A 2PJPA 1YJNI 3SDBA 2ZMEB 4HZFA 3TO9A 4LLNA 1WI3A 3B6AA 3S1RJ 5J47A 2W4SA 1RR8C 2AQEA 2DT5A 3F72A 2LSOA 2NS0A 3G1MA 3GXOA 4J19A 1U0JA 1YTYA 1JT0A 4G7HF 4W1UA 3ZQCA 1XGNA 2HXIA 2NYXA 2YUSA 4PK4A 2HR3A 2CS3A 2E2JJ 5FD5A 3FMRA 1R36A 1Z21A 2E2IJ 3HM5A 1WI9A 1Z6TA 3OYIA 4IOCF 5E1WA 2IVMA 2RDPA 1RR7A 3KP3A 1TW3A 3K2ZA 2BOLA 3OMYA 4LK1F 4GDFA 1R5ID 4LK0F 4MEYF 4KYWA 3VYUB 2CYYA 2Z16A 3IAM2 3CJRB 2ZXIA 2VN2A 2IGNA 1X19A 4OMZA 1K4SA 1XTAA 4KITB 3PNTA 3TOBA 3SHFA 3ERMA 4A3JJ 2HI3A 4DYRA 2X51A 1PP7U 3REOA 4IHVA 3JRDA 1B1BA 2F5EA 5HLGA 4D7NA 2X1EA 1FYLA 3J81Z 4YRVA 1WPKA 3A0HC 3AG4H 4G94A 3H5RA 1ETYA 3RKXA 4M6YA 3GTKJ 3HHGA 3JRHA 4A3GJ 2DOFA 1ZARA 3WTVC 2EILH 3UR3C 2E5ZA 5E3OA 5FD6A 4D5CA 1T39A 3OYGA 2XGDA 2M8GX 3L7WA 1WVRA 3S17J 4I99C 4IHYA 4XLFA 4XKBA 2R5YA 1XS9A 4AVZA 1QVTA 2ICWG 1IXSB 1UJ8A 4E7LA 1Z3YA 4BACA 1Z05A 1KONA 2VJ4A 4XQFA 5HVQC 2EFNA 5ED4A 5A2QZ 4PJLA 1B9MA 4BS9A 2F2EA 2FA5A 3RJPA 2BY1A 2W85A 3G73A 3PFYA 4M3EA 1USSA 5DM7F 4DYCA 3FXJA 1A04A 4PCQA 2O9LA 1EH6A 1R4MB 4U0YA 1N77A 3GZ5A 3I55I 2KRHA 1T33A 3CMMA 2OUMA 3LSHA 3ZQGA 2ZXHA 5KAFC 4XLHA 2R7ZJ 1MBHA 2WTEA 1UG2A 1IN4A 4OAZA 1W7PB 2W84A 3L2RA 2JUGA 2OCCH 1RRJA 1J59A 1ETQA 1KQ0A 2XF5A 3D0SA 1D1CA 1KU2A 4BEHA 2BXZA 3H0DA 1FLIA 2QSGX 5FKKA 5KAIC 5FLVA 3LSIA 2BEOA 2LY9A 2MD0A 2Z3YA 3KZYA 3WODF 5KNLA 3CUQA 4WK8F 2R7TA 5J40A 2WBMA 1X2MA 2H8WA 2VKEA 4XOPA 4MQ9F 4NQWB 1T8IA 2ZJPF 1R4NB 1IN8A 2OQGA 4XM3A 3JRIA 1DQUA 1EV7A 2OTLI 3GTMJ 3ULQB 1ETWA 4BXFA 1KU3A 1AWCA 1F9NA 1MD0A 4R8HA 1SMYF 2JA6J 2L4AA 2A05A 3HRTA 3BG7A 3FK6A 4V2GA 4Y52J 5B1BH 4M71A 2FBHA 1L0OC 2H94A 4U88A 1G3YA 4YFXF 2VKVA 3BC8A 4RB1A 3H9QA 3JTGA 3M1EA 4NB5A 4G7ZF 3GTJJ 1ZH5A 1J75A 1QU3A 1LEAA 1YI2I 2WY8Q 4QSHA 5DEQA 2GXGA 5GTIC 4ENKA 5GP9A 1E3PA 3KP4A 4XNFA 3S3OA 1YFHA 3CC7I 1G4DA 1MJ9A 1OCCH 1JHHA 3MKYB 3MZ8A 2DDBA 2CG4A 3ZGKA 4D1QA 2Z33A 2RN7A 1SVMA 4GYIA 3S1QJ 3BG9A 2PI0A 4OU0A 4KDPA 2EV5A 2XASA 1WRJA 2QA4I 2JA7J 1TT5B 3RQIA 4DQ2A 4QWQA 2CW7A 4P9FA 5J1UA 4E70A 2HU9A 3PNYA 1Q1VA 2FBIA 4Y15A 3OYHA 2O7OA 4AUXA 1FP2A 5D5UB 3W6VA 1IN6A 1ETXA 2Y31A 1KQ8A 3V7CA 4ZZLA 2FMYA 2MSYA 4FETA 3I71A 4XSXF 3CCEI 2E1CA 2NVTJ 4HF1A 4ESBA 1SFXA 5DDGA 2DFHA 1JE8A 4C30A 4WWCA 2VQCA 3ZXSA 5BOXA 1DPUA 2CSOA 2K7LA 2E7WA 3K69A 3RYPA 4A6EA 2M45A 2HVSA 3T1BA 1W7PD 2HZDA 5LHHA 5E17F 2FJ1A 5L3BA 3C1DA 1X3WB 2RKHA 2BW3A 1KU7A 4YFNF 3J7AY 4BDYA 3MZYA 4IX7A 2Y0SA 2IGOA 2MH2A 3WGHA 2GOMA 3RIRA 1UCRA 3O6BB 4HQEA 4ENJA 4XSZF 1X1DA 1U8RA 4IL6C 1H8AC 3IH4A 4CCKA 5EDNA 1OKRA 1PDNC 1DU0A 4AU7A 2VBZA 4LJZF 2FE3A 2ZFUA 1VQ4I 4KJZA 3S15J 2V4JC 2CV2A 2XPVA 5D5XB 3DEUA 1IN7A 4A3EJ 3S8PA 5IPAA 3A01A 3WG9A 2QBYA 5K7HA 1PUEE 1GLNA 3DPTA 1RI7A 4LG0A 2MH9A 2VASA 2DA3A 2VC1A 2D1HA 1ZR2A 2MYSA 3CUOA 2CQXA 4A0YA 3VEPA 1UG0A 2CFXA 3F23A 1ZHFA 3MKLA 3CTAA 1W1WE 3OS2A 1PP8F 3EUAA 1MMNA 4BBRJ 3CCVI 1VQPI 4S0HB 5IT9K 2V9VA 5K7ZA 3ASOH 3ASNH 1HSTA 3BR2A 3FMQA 4IVNA 2ACJA 4MLOA 2XB5A 3T0YA 2CJJA 2CUFA 2PMZN 2YSRA 3LL7A 4F91B 3FDYA 3F0CA 3FBNB 2K3PA 4ZTJA 3CJNA 2FF4A 2DLLA 2BHYA 4BJ5C 4MQVA 2HVQA 5K5QA 3E97A 1LB2A 5DTDA 1ZRCA 3ZQFA 3E5QA 3VPRA 2PMHA 1YW9A 1EF4A 3F6OA 2K02A 5E3NA 4W97A 2MC3A 2YPRA 5M5XJ 2NAZA 3ZP5A 1VQNI 4A5NA 3FF5A 3BG3A 1S7OA 2DBBA 3DKXA 4Q5SF 1LVAA 4BY1J 2NNYA 2RC4A 2R92J 2OA4A 2ZSHB 2K9MA 1REPC 3F21A 1VTNC 1W36C 1K61A 2OZ6A 2WA0A 3JSPA 3QU3A 1XDSA 4E7KA 4RAYA 3G1LA 4HDUA 4HA8A 2L0KA 3GEZA 2VI6A
chains in the Genus database with same CATH topology
1MZBA 4LLLA 1SFEA 2DQRA 5CVVA 3U1DA 3LAPA 4AIKA 3GZ6A 2KRFA 3ZMTA 3F8FA 2BBYA 4EMSA 4MEXF 4IHTA 5JR3A 2J5PA 1ON2A 5ICFA 4ON0A 2UXNA 1USTA 2DK8A 1ONVA 3F3XA 2NNNA 2P6TA 3ZN1A 5FGMA 4HBLA 2W57A 2YX7A 4GYGA 3HTSB 3LFKA 1TBXA 1SAXA 3GFJA 4ZZDA 4OINF 3C18A 4IPAA 3B73A 4P55A 1FWZA 5KVRA 1K78B 3FMSA 3OV8A 1HQCA 1RIOH 2DQLA 3F8CA 3WE2A 1QGPA 1U5TB 4A0ZA 1SD6A 2XHKA 5F64A 5FLXZ 5K5RA 2VE8A 3LAJA 2PFBA 2ESNA 1DPRA 4JQFA 4EM0B 4UXNA 3R61A 4D0PA 3FM3A 2XVCA 3BZ6A 3MWMA 3QU6A 3I59B 2VOOA 1LDDA 4G9YA 4UUVA 1S29A 4XLPF 3BJOA 2EFWA 4EJTA 2QM3A 4IRGA 4M9ZA 4AIHA 2FSWA 3CO6C 4H0EA 1C0WA 3RDIA 2LF8A 3QOPA 4FX4A 1LDJA 3WTSC 1WSUA 5L3EA 1QBJA 3O2PE 1NHAA 5E1XA 1FX7A 4OIRF 3LQQA 3RYRA 2Y48A 4PZJA 1YW8A 1XMKA 3EQLF 2LDUA 3DQVC 5ICCA 3N4MA 1BN5A 1YLFA 2PLYA 4EQQA 3HIFA 4KMUX 4ZH4F 4YG2F 3I58A 3DPLC 3P7NA 1G3SA 2VC0A 4BH9A 3KLOA 2VE9A 4I09A 1BJAA 2FXAA 3P9KA 3ZMSA 1FSHA 4HLXA 4OOIA 3KP7A 3HRSA 1ZGAA 2HS5A 1HKSA 1YG2A 5L3FA 4WCGA 4O6JA 3CLOA 4R79A 2PEXA 3MCZA 4I7HA 1GVJA 2OQRA 1GXPA 3KP6A 4RGRA 2VBWA 3RPQA 3J80Z 1P6RA 2HKOA 3W6JB 4LB5A 3U2RA 1XN7A 3DKWA 3HTUA 1O3TA 3KP2A 4L9JA 5HOOA 3BWGA 3ZMZA 2QQ9A 1J9IA 5ILUA 3BP8A 4EGYA 2A6EF 1XSXA 3WGIA 1FBUA 1FYKA 2OBPA 2HKXA 3S2WA 3IWFA 1I27A 3K1NA 1D5VA 5LGUA 3BJAA 2FEZA 5H6RA 3SQNA 3KEQA 3VB2A 3T8RA 1YYVA 1TNTA 1WWXA 2Z5UA 3PQJA 1SD7A 2RGVA 4U7BA 2XGXA 1RNLA 2QYOA 1X3UA 4ZYEA 2D45A 1OYWA 1IF1A 2L02A 2P5KA 2UXXA 3HHHA 3T8TA 1JHFA 3GF2A 4CDGA 4TV7A 1FYMA 2DFIA 3B02A 2UWMA 3MAJA 2OAZA 3GX4X 2ZXJA 1F1ZA 1KYWA 1H9TA 1RUOA 4O3MA 1LNWA 4G6QA 4CXFA 4HX8A 3GWZA 3JAMK 4IJAA 1W4MA 2V1XA 4L9TA 4AWXB 2QQBA 3EETA 3BOQA 4GGGA 5HDNA 1IZ1A 3IKTA 2KJCA 1U6GA 4BHPA 1IRFA 2P5LC 2BV6A 4LLGF 3GLXA 3JTHA 3WGGA 1MDMB 5HDKA 3GFMA 2MD5A 3WTXC 3NRVA 1SMTA 3WTTC 3E5XA 1J2XA 4I0AA 1QO0D 5LRRA 3FXUA 3BPXA 3HSRA 3LA2A 3TDUC 5HDGA 1L3LA 3K1PA 2JRTA 1G3WA 2PG4A 4RGUA 2Q8KA 4M9SA 1CF7A 5CVIA 2IJLA 2DAOA 1XCBA 3KEOA 2QUFA 4HQMA 3CO7C 3IWZA 4ZYGA 1U2WA 3H92A 2XROA 5BMZA 1BI3A 2IA1A 3O3KA 5J8FA 2VT2A 1K78A 3LA3A 2EA4A 1QPMA 2O3FA 4A5MA 3C3WA 2OD5A 5ICEA 3EDPA 1U5TA 2QENA 3L9FA 2HYFA 2YR2A 2B0LA 3HRMA 3KZZA 4S05A 2FRHA 4BXUA 3L09A 2KIMA 1XSDA 4KIFA 5FO5A 5BQTA 5F1RA 5ERIA 3I59A 5DCFA 2XAJA 2IA2A 5KK1A 2FBKA 2EV6A 4L9NA 3F6VA 4FX0A 1P2FA 4WXCA 2MA3A 3MQ0A 1ZG3A 2WV0A 1ZG1A 3TO6A 4MNUA 2MLGA 1O7LA 1BI2A 1MKMA 4ZYDA 2G7UA 4P5OA 4KICA 4KFCA 3IKVA 1KYZA 2GA1A 2FNPA 2J5OA 2D1VA 2EFPA 3HOTA 2STTA 1RZ4A 5DUKA 1G6NA 2ELHA 4Q47A 4RGXA 3IHUA 2M87A 5DCMA 3K1MA 2KIUA 4I01A 5BPIA 1EH7A 4EM2A 1OPCA 2HFHA 1QQIA 2FOKA 3RI4A 1T98A 2IP2A 4HW0A 2WWYA 2L01A 3R0JA 1BI1A 1OYIA 3JW4A 3COAC 4UHTA 1FSEA 1I1GA 5D4RA 1TTYA 4F7ZA 2VONA 1R5HA 2BYVE 1HKQA 1U3EM 1BOAA 2JPBA 2LF7A 1LEBA 2JTVA 4L5IA 2IRFG 4HAMA 1YW7A 2IA0A 4N0BA 1R1TA 4OIPF 4HV6A 2Z9OA 1ODDA 3P9CA 3ECOA 1HKTA 3E5UA 1ULYA 2DI3A 2P8TA 1WQ2A 3WTYC 2XAGA 2FQ3A 2V79A 5CJ9A 1KU9A 3KCCA 2GIVA 3ABTA 4I0BA 4IRIA 2VOPA 4BYYA 3I0TA 4G8XA 1TQPA 5HS8A 3GUDA 2XUBA 4EVIA 1JGSA 2GAUA 5LGNA 4JK1X 3J7AO 3P9IA 4RB0A 3FXQA 3I4PA 2QLZA 4CGZA 2ZMEA 4N9IA 3ML6A 1FT9A 3J80K 4HF2A 3IRRA 3TKYA 2VBYA 2A07F 3EUHA 3LA7A 2HEOA 1BIAA 1S6LA 4HX7A 3TQNA 2ZCWA 4R1HA 1LDKB 2EK5A 4FT8A 4MTEA 3V7SA 1FBSA 2LNBA 3PQKA 5CVRA 2PBIA 1I1SA 4ETSA 4CYDA 2EWNA 2DK5A 2NRAC 3BPVA 3DV8A 3ZMDA 2FU4A 4UV8A 1ZREA 3CUQC 3WU1B 2KKOA 4KN7X 3HRUA 1KA8A 2K27A 2DPUA 1K7AA 4OIOF 2ESHA 1T38A 1B9NA 2VT3A 4BHBA 5D8LB 4I98B 3HUGA 4EJUA 2ETHA 2FMLA 2CO5A 4ENNA 5K5OA 1ZN2A 2GWRA 3GFIA 3Q9VA 1O57A 1Z9CA 3DP7A 3HYIA 2L54A 4HOBA 1IAWA 4CHUA 4UVBA 2G7HA 1K6OA 5CVUA 3WU0A 5IT9Z 3HSFA 3I53A 3M8FA 4CICA 4EGZA 5ICGA 2Z99A 3E3VA 1W7PA 1B6AA 3Q9SA 1FOKA 5ILSA 2DO7A 1P4WA 1QZZA 2QZ8A 4L5JA 4UNOA 1J0RA 5D4SA 4IXAA 1XMAA 5TJJA 2AS5F 4NQWA 5HLIA 1QZYA 1BC7C 2ZNYA 4L9VA 2PQ8A 3E6MA 3FXRA 1UB9A 1LJ9A 5JI6A 3J81K 1MJBA 4I02A 1GXQA 1DP7P 4WXDA 5E8GA 4XRFA 3WTZA 1T6SA 3GFLA 1WKMA 1S3JA 3FHZA 2IW5A 1D8JA 2X0LA 2D2WA 1FY7A 2X4HA 1XGMA 1OMIA 2C6YA 1TNSA 2R3SA 4PDKA 2QBYB 5A2QK 3V7RA 4JBAA 4LG0B 1ZG5A 5E8IA 1ZGJA 1SFUA 2ZKZA 4EJVA 4LB6B 3FM5A 2A69F 2H09A 4HDVA 3BDDA 1E17A 2PN6A 2EA2A 3I5UA 1AOYA 3QP6A 1R7JA 2XRNA 5DYMA 3E6BA 5JFRA 1T0FA 5AONA 3F8MA 3RTRA 2KIFA 2H27A 3ECHA 5HS9A 2EV0A 1HW1A 3GO5A 5ILVA 3HSEA 2ISZA 3QPHA 2GXBA 1R1VA 2ISYA 3KE2A 1YS6A 2DW4A 2HYGD 4U7DA 2H6BA 4QLCU 1EH8A 2JPCA 2ZJ2A 4A12A 1OYYA 4Y17A 5LEKA 1STZA 3ZN0A 2F5DA 2P5VA 3E6CC 1W5SA 1ZLJA 2L4MA 4WXHA 4OIQF 6PAXA 3TGNA 3LWFA 1T2KA 2TDXA 1RUNA 4M6XA 3SFZA 1J5YA 2V1UA 5H20A 1Z6RA 5AIQA 2HWVA 3ERED 2M30A 3R4KA 4AIJA 2JSCA 1BIBA 4P9UA 3F22A 1XD7A 1R23A 2P6SA 4KT5C 3RKWA 5H6QA 3BROA 2VODA 5EEGA 1SD5A 4UV9A 5DUIA 1FZPB 1O3QA 2EB7A 2YU3A 1R5GA 2GA2A 1O3SA 2HGCA 4KUMA 3DFGA 5IT3A 2Y0MA 3SZPA 4P96A 4CO8A 1XGOA 5D6EA 1D3YA 4IRHA 3F8NA 1YIOA 4BQAA 4IF4A 2MBFA 1CGPA 1SD4A 3R60A 3ELKA 2EFQA 2DU9A 2XKOA 3TDZC 1IRGA 3M9AA 4L0YB 4S04A 4Q4ZF 2M8EA 4RS8A 2IT0A 4WX9A 2PMUA 5L3CA 1UFMA 1G3TA 4M73A 3H3UA 1QNTA 2GZWA 3D5LA 3V4GA 1R1UA 2G9WA 3WE3A 3Q5FA 5DD8A 1OR7A 1BBYA 3IL2A 3FZVA 4KA4A 2P7CB 5TRDA 1XGSA 2CGPA 4GCVA 2W25A 3KP5A 4ESFA 4LFUA 2OZUA 2V1DA 3V8KA 2A3SA 2WC2A 1IN5A 1R22A 1DDNA 1ZYRF 1FP1D 4XBFA 4HF0A 2XAHA 5E18F 3FWEA 4ZYHA 2XAQA 3ISPA 2O61A 2EJRA 3KLNA 1LQ1A 1P92A 1JXSA 4KMFA 3KETA 2EFOA 2F5CA 1S8NA 1YQAA 2K4BA 4U0VA 2L3DA 1HW2A 2RNJA 4KIGA 4ESJA 3H3ZA 3I54A 2E7XA 2BE5F 2R7DA 3NEUA 3BY6A 3DF8A 4UVCA 1KQ9A 2VBXA 5D6FA 1XSVA 2O8XA 2M5WA 1H0MA 3HOSA 5DD4A 2ZBKA 1FNNA 1R58A 1BM9A 5BS6A 5AIPA 2HOEA 4Q48A 4HLYA 4U0WA 3RKYA 4G6DA 5BPDA 1IXCA 4UVAA 3JAMZ 5FLXK 3TOAA 2O03A 3ROUA 4LGWA 2O6GE 4RB2C 3PFIA 2XKPA 4GO1A 1TLHB 1Y0UA 1HBXG 5FFZA 3NQOA 2K4JA 1HXDA 5LHIA 4BHCA 1P4AA 5K1YA 1K79A 1TQIA 1MJAA 3C7JA 3V8JA 5E1ZB 3W6KB 2COMA 2ZO4A 1V3FA 2Q2EA 4HX4A 2HQRA 2ADUA 3GVAA 2ZNZA 3L2CA 1XCVA 5CVJA 4A0XA 5HS7A 4L0ZB 1B4AA 4PGGA 3SXYA 1Q1HA 4A6DA 4KNYA 1IUYA 3M8EA 3F8BA 2AXLA 3QRFF 1J7KA 2DTRA 4M74A 4IHSA 3IC7A 3MFKA 3CDHA 3RPUA 1B59A 2Q0OA 1TQMA 4M72A 3K0LA 3TO7A 1BC8C 3QPTA 1TW2A 3OOPA 1FBQA 3K9TA 2RV8A 2K86A 4GXOA 5JHUA 4Z2YA 1GHCA 4BAYA 3KFWX 3WTWC 2F5FA 2MLKA 4A2UA 4FHTA 4KIBA 3BJ6A 2ZFWA 2VXZA 1O7FA 3LQRA 3DXJF 3I64A 4Y13A 4AVPA 5HLHA 2KJBA 1UHMA 4CZZA 1IW7F 4EJOA 4YIIA 1R00A 5FB2A 1CF7B 3R6SA 2JZYA 5L3DA 1DUXC 3IRQA 4YIFA 2O0YA 4PGHA 1ZLKA 5CLSA 1KGSA 4RAZA 5J6XA 3ZMUA 3CUQB 1S7AA 3AAFA 1FPQA 2QVOA 2XV4S 4BNCA 4MTDA 4EJWA 1E2XA 4KN4X 1MDMA 2BGCA 2A6HF 1U5TC 1Z7UA 1ZRFA 3G3ZA 1IXRC 2A68F 3GW2A 2FNAA 2CQKA 4L18B 5CYVA 3VFZA 4NHJA 5L3GA 1H9GA 1YO5C 2STWA 2HTJA 1XB4A 3M7GA 3MZHA 5EEHA 4RB3C 4LMYA 2XAFA 4O5VA 2CW0F 5E20A 4ASNA 4N9HA 1ZAOA 5JVTA 5D5WB 2CWEA 5LBQA 5DV5A 2IPQX 2LKPA 4YFKF 3WTUC 3EYYA 4EV0A 3FX3A 3GYHX 1HW5A 5F6FA 5FFXA 1YS7A 4MHGA 3R0AA 3QAHA 1FC3A 4HYEA 2W24A 5DCMB 5J8CA 1ZRDA 2H6CA 1P4XA 1V4RA 4HV5A 1Z91A 3U9GA 1ON1A 1XDUA 2DPDA 2JT1A 5LGTA 1HSJA 4I2OA 4MGRA 2OU2A 2HTSA 4RGSA 2GQQA 1U78A 2XIGA 2YX4A 1BI0A 2QWWA 2V6CA 4K2EA 4OMYA 2A5YB 1I5ZA 2Y75A 1F4KA 5LLQA 2A61A 3ZPLA 1O3RA 2QQAA 3L00A 3E6DA 5LEJA 3VOEA 3VODA 3T5XA 1W5TA 5D5VB 4LD5A 2HQNA 5D8KB 2RQPA 1Z1DA 3LSTA 4B8XA 3QP5A 5LHGA 2P7VB 4ENMA 1I6XA 2M1BA 1D8KA 2P4WA 3EYIA 2UZKA 3ZMVA 4G7OF 4AD9A 2E1NA 2RVCA 4WF2A 3SZTA 2HDCA 4XLNF 4M9XA 1F5TA 3ABUA 2R7FA 4DNCA 3N97A 1UHWA 3MEXA 2HZTA 3JSOA 3V8LA 3ZQ7A 5LRSA 4B09A 1MGTA 4EM1A 2PJPA 2ZMEB 4HZFA 3TO9A 4LLNA 3F72A 2DT5A 2LSOA 2NS0A 3GXOA 1YTYA 4G7HF 1XGNA 2NYXA 2HR3A 5FD5A 3FMRA 1R36A 1WI9A 1Z6TA 5E1WA 2IVMA 2RDPA 3KP3A 1TW3A 3K2ZA 4LK1F 4LK0F 4MEYF 4KYWA 2CYYA 2VN2A 4OMZA 3TOBA 3SHFA 1PP7U 3REOA 1B1BA 2F5EA 5HLGA 1FYLA 3J81Z 4G94A 3RKXA 4M6YA 3HHGA 1ZARA 3WTVC 5FD6A 1T39A 3L7WA 1IXSB 1Z05A 5HVQC 2EFNA 5ED4A 5A2QZ 1B9MA 2F2EA 2FA5A 3RJPA 2W85A 3G73A 1USSA 1A04A 4PCQA 1EH6A 4U0YA 3GZ5A 2WTEA 1IN4A 1W7PB 2W84A 1J59A 1KQ0A 3D0SA 1KU2A 1FLIA 2BEOA 3WODF 2Z3YA 3KZYA 4WK8F 3CUQA 4MQ9F 1IN8A 2OQGA 1EV7A 3ULQB 1KU3A 1AWCA 1F9NA 1MD0A 4R8HA 1SMYF 2L4AA 3HRTA 4M71A 2FBHA 1L0OC 2H94A 4U88A 1G3YA 4YFXF 4RB1A 3JTGA 3M1EA 4NB5A 4G7ZF 1ZH5A 1J75A 1LEAA 5DEQA 2GXGA 4ENKA 3KP4A 1YFHA 1G4DA 1MJ9A 1JHHA 2CG4A 2Z33A 2RN7A 4GYIA 2PI0A 4OU0A 4KDPA 2EV5A 2XASA 1WRJA 4DQ2A 4QWQA 4P9FA 4E70A 2FBIA 4Y15A 1FP2A 5D5UB 1IN6A 1KQ8A 3V7CA 4ZZLA 2FMYA 3I71A 4XSXF 2E1CA 4HF1A 4ESBA 1SFXA 5DDGA 1JE8A 4WWCA 5BOXA 1DPUA 2CSOA 2K7LA 2E7WA 3K69A 3RYPA 4A6EA 2M45A 3T1BA 1W7PD 5LHHA 5E17F 5L3BA 3C1DA 2RKHA 1KU7A 4YFNF 3MZYA 2MH2A 3WGHA 3RIRA 1UCRA 3O6BB 4HQEA 4ENJA 4XSZF 1U8RA 1OKRA 1PDNC 2VBZA 4LJZF 2FE3A 5D5XB 3DEUA 1IN7A 3WG9A 2QBYA 1PUEE 3DPTA 1RI7A 4LG0A 2MH9A 2VC1A 2D1HA 3CUOA 4A0YA 3VEPA 2CFXA 3F23A 1ZHFA 3CTAA 1PP8F 5IT9K 2V9VA 1HSTA 3FMQA 4IVNA 2ACJA 3T0YA 2YSRA 3CJNA 2FF4A 2DLLA 4MQVA 5K5QA 3E97A 1LB2A 1ZRCA 3E5QA 2PMHA 1YW9A 3F6OA 2K02A 2MC3A 2YPRA 2NAZA 3ZP5A 4A5NA 3FF5A 1S7OA 2DBBA 4Q5SF 1LVAA 2NNYA 2RC4A 2OA4A 1REPC 3F21A 1VTNC 2OZ6A 3JSPA 3QU3A 1XDSA 4RAYA 4HDUA 4HA8A 3GEZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MZB A;  4LLL A;  1SFE A;  2DQR A;  5CVV A;  3U1D A;  3LAP A;  4AIK A;  3GZ6 A;  2KRF A;  3ZMT A;  3F8F A;  2BBY A;  4EMS A;  4MEX F;  4IHT A;  5JR3 A;  2J5P A;  1ON2 A;  5ICF A;  4ON0 A;  2UXN A;  1UST A;  2DK8 A;  1ONV A;  3F3X A;  2NNN A;  2P6T A;  3ZN1 A;  5FGM A;  4HBL A;  2W57 A;  2YX7 A;  4GYG A;  3HTS B;  3LFK A;  1TBX A;  1SAX A;  3GFJ A;  4ZZD A;  4OIN F;  3C18 A;  4IPA A;  3B73 A;  4P55 A;  1FWZ A;  5KVR A;  1K78 B;  3FMS A;  3OV8 A;  1HQC A;  1RIO H;  2DQL A;  3F8C A;  3WE2 A;  1QGP A;  1U5T B;  4A0Z A;  1SD6 A;  2XHK A;  5F64 A;  5FLX Z;  5K5R A;  2VE8 A;  3LAJ A;  2PFB A;  2ESN A;  1DPR A;  4JQF A;  4EM0 B;  4UXN A;  3R61 A;  4D0P A;  3FM3 A;  2XVC A;  3BZ6 A;  3MWM A;  3QU6 A;  3I59 B;  2VOO A;  1LDD A;  4G9Y A;  4UUV A;  1S29 A;  4XLP F;  3BJO A;  2EFW A;  4EJT A;  2QM3 A;  4IRG A;  4M9Z A;  4AIH A;  2FSW A;  3CO6 C;  4H0E A;  1C0W A;  3RDI A;  2LF8 A;  3QOP A;  4FX4 A;  1LDJ A;  3WTS C;  1WSU A;  5L3E A;  1QBJ A;  3O2P E;  1NHA A;  5E1X A;  1FX7 A;  4OIR F;  3LQQ A;  3RYR A;  2Y48 A;  4PZJ A;  1YW8 A;  1XMK A;  3EQL F;  2LDU A;  3DQV C;  5ICC A;  3N4M A;  1BN5 A;  1YLF A;  2PLY A;  4EQQ A;  3HIF A;  4KMU X;  4ZH4 F;  4YG2 F;  3I58 A;  3DPL C;  3P7N A;  1G3S A;  2VC0 A;  4BH9 A;  3KLO A;  2VE9 A;  4I09 A;  1BJA A;  2FXA A;  3P9K A;  3ZMS A;  1FSH A;  4HLX A;  4OOI A;  3KP7 A;  3HRS A;  1ZGA A;  2HS5 A;  1HKS A;  1YG2 A;  5L3F A;  4WCG A;  4O6J A;  3CLO A;  4R79 A;  2PEX A;  3MCZ A;  4I7H A;  1GVJ A;  2OQR A;  1GXP A;  3KP6 A;  4RGR A;  2VBW A;  3RPQ A;  3J80 Z;  1P6R A;  2HKO A;  3W6J B;  4LB5 A;  3U2R A;  1XN7 A;  3DKW A;  3HTU A;  1O3T A;  3KP2 A;  4L9J A;  5HOO A;  3BWG A;  3ZMZ A;  2QQ9 A;  1J9I A;  5ILU A;  3BP8 A;  4EGY A;  2A6E F;  1XSX A;  3WGI A;  1FBU A;  1FYK A;  2OBP A;  2HKX A;  3S2W A;  3IWF A;  1I27 A;  3K1N A;  1D5V A;  5LGU A;  3BJA A;  2FEZ A;  5H6R A;  3SQN A;  3KEQ A;  3VB2 A;  3T8R A;  1YYV A;  1TNT A;  1WWX A;  2Z5U A;  3PQJ A;  1SD7 A;  2RGV A;  4U7B A;  2XGX A;  1RNL A;  2QYO A;  1X3U A;  4ZYE A;  2D45 A;  1OYW A;  1IF1 A;  2L02 A;  2P5K A;  2UXX A;  3HHH A;  3T8T A;  1JHF A;  3GF2 A;  4CDG A;  4TV7 A;  1FYM A;  2DFI A;  3B02 A;  2UWM A;  3MAJ A;  2OAZ A;  3GX4 X;  2ZXJ A;  1F1Z A;  1KYW A;  1H9T A;  1RUO A;  4O3M A;  1LNW A;  4G6Q A;  4CXF A;  4HX8 A;  3GWZ A;  3JAM K;  4IJA A;  1W4M A;  2V1X A;  4L9T A;  4AWX B;  2QQB A;  3EET A;  3BOQ A;  4GGG A;  5HDN A;  1IZ1 A;  3IKT A;  2KJC A;  1U6G A;  4BHP A;  1IRF A;  2P5L C;  2BV6 A;  4LLG F;  3GLX A;  3JTH A;  3WGG A;  1MDM B;  5HDK A;  3GFM A;  2MD5 A;  3WTX C;  3NRV A;  1SMT A;  3WTT C;  3E5X A;  1J2X A;  4I0A A;  1QO0 D;  5LRR A;  3FXU A;  3BPX A;  3HSR A;  3LA2 A;  3TDU C;  5HDG A;  1L3L A;  3K1P A;  2JRT A;  1G3W A;  2PG4 A;  4RGU A;  2Q8K A;  4M9S A;  1CF7 A;  5CVI A;  2IJL A;  2DAO A;  1XCB A;  3KEO A;  2QUF A;  4HQM A;  3CO7 C;  3IWZ A;  4ZYG A;  1U2W A;  3H92 A;  2XRO A;  5BMZ A;  1BI3 A;  2IA1 A;  3O3K A;  5J8F A;  2VT2 A;  1K78 A;  3LA3 A;  2EA4 A;  1QPM A;  2O3F A;  4A5M A;  3C3W A;  2OD5 A;  5ICE A;  3EDP A;  1U5T A;  2QEN A;  3L9F A;  2HYF A;  2YR2 A;  2B0L A;  3HRM A;  3KZZ A;  4S05 A;  2FRH A;  4BXU A;  3L09 A;  2KIM A;  1XSD A;  4KIF A;  5FO5 A;  5BQT A;  5F1R A;  5ERI A;  3I59 A;  5DCF A;  2XAJ A;  2IA2 A;  5KK1 A;  2FBK A;  2EV6 A;  4L9N A;  3F6V A;  4FX0 A;  1P2F A;  4WXC A;  2MA3 A;  3MQ0 A;  1ZG3 A;  2WV0 A;  1ZG1 A;  3TO6 A;  4MNU A;  2MLG A;  1O7L A;  1BI2 A;  1MKM A;  4ZYD A;  2G7U A;  4P5O A;  4KIC A;  4KFC A;  3IKV A;  1KYZ A;  2GA1 A;  2FNP A;  2J5O A;  2D1V A;  2EFP A;  3HOT A;  2STT A;  1RZ4 A;  5DUK A;  1G6N A;  2ELH A;  4Q47 A;  4RGX A;  3IHU A;  2M87 A;  5DCM A;  3K1M A;  2KIU A;  4I01 A;  5BPI A;  1EH7 A;  4EM2 A;  1OPC A;  2HFH A;  1QQI A;  2FOK A;  3RI4 A;  1T98 A;  2IP2 A;  4HW0 A;  2WWY A;  2L01 A;  3R0J A;  1BI1 A;  1OYI A;  3JW4 A;  3COA C;  4UHT A;  1FSE A;  1I1G A;  5D4R A;  1TTY A;  4F7Z A;  2VON A;  1R5H A;  2BYV E;  1HKQ A;  1U3E M;  1BOA A;  2JPB A;  2LF7 A;  1LEB A;  2JTV A;  4L5I A;  2IRF G;  4HAM A;  1YW7 A;  2IA0 A;  4N0B A;  1R1T A;  4OIP F;  4HV6 A;  2Z9O A;  1ODD A;  3P9C A;  3ECO A;  1HKT A;  3E5U A;  1ULY A;  2DI3 A;  2P8T A;  1WQ2 A;  3WTY C;  2XAG A;  2FQ3 A;  2V79 A;  5CJ9 A;  1KU9 A;  3KCC A;  2GIV A;  3ABT A;  4I0B A;  4IRI A;  2VOP A;  4BYY A;  3I0T A;  4G8X A;  1TQP A;  5HS8 A;  3GUD A;  2XUB A;  4EVI A;  1JGS A;  2GAU A;  5LGN A;  4JK1 X;  3J7A O;  3P9I A;  4RB0 A;  3FXQ A;  3I4P A;  2QLZ A;  4CGZ A;  2ZME A;  4N9I A;  3ML6 A;  1FT9 A;  3J80 K;  4HF2 A;  3IRR A;  3TKY A;  2VBY A;  2A07 F;  3EUH A;  3LA7 A;  2HEO A;  1BIA A;  1S6L A;  4HX7 A;  3TQN A;  2ZCW A;  4R1H A;  1LDK B;  2EK5 A;  4FT8 A;  4MTE A;  3V7S A;  1FBS A;  2LNB A;  3PQK A;  5CVR A;  2PBI A;  1I1S A;  4ETS A;  4CYD A;  2EWN A;  2DK5 A;  2NRA C;  3BPV A;  3DV8 A;  3ZMD A;  2FU4 A;  4UV8 A;  1ZRE A;  3CUQ C;  3WU1 B;  2KKO A;  4KN7 X;  3HRU A;  1KA8 A;  2K27 A;  2DPU A;  1K7A A;  4OIO F;  2ESH A;  1T38 A;  1B9N A;  2VT3 A;  4BHB A;  5D8L B;  4I98 B;  3HUG A;  4EJU A;  2ETH A;  2FML A;  2CO5 A;  4ENN A;  5K5O A;  1ZN2 A;  2GWR A;  3GFI A;  3Q9V A;  1O57 A;  1Z9C A;  3DP7 A;  3HYI A;  2L54 A;  4HOB A;  1IAW A;  4CHU A;  4UVB A;  2G7H A;  1K6O A;  5CVU A;  3WU0 A;  5IT9 Z;  3HSF A;  3I53 A;  3M8F A;  4CIC A;  4EGZ A;  5ICG A;  2Z99 A;  3E3V A;  1W7P A;  1B6A A;  3Q9S A;  1FOK A;  5ILS A;  2DO7 A;  1P4W A;  1QZZ A;  2QZ8 A;  4L5J A;  4UNO A;  1J0R A;  5D4S A;  4IXA A;  1XMA A;  5TJJ A;  2AS5 F;  4NQW A;  5HLI A;  1QZY A;  1BC7 C;  2ZNY A;  4L9V A;  2PQ8 A;  3E6M A;  3FXR A;  1UB9 A;  1LJ9 A;  5JI6 A;  3J81 K;  1MJB A;  4I02 A;  1GXQ A;  1DP7 P;  4WXD A;  5E8G A;  4XRF A;  3WTZ A;  1T6S A;  3GFL A;  1WKM A;  1S3J A;  3FHZ A;  2IW5 A;  1D8J A;  2X0L A;  2D2W A;  1FY7 A;  2X4H A;  1XGM A;  1OMI A;  2C6Y A;  1TNS A;  2R3S A;  4PDK A;  2QBY B;  5A2Q K;  3V7R A;  4JBA A;  4LG0 B;  1ZG5 A;  5E8I A;  1ZGJ A;  1SFU A;  2ZKZ A;  4EJV A;  4LB6 B;  3FM5 A;  2A69 F;  2H09 A;  4HDV A;  3BDD A;  1E17 A;  2PN6 A;  2EA2 A;  3I5U A;  1AOY A;  3QP6 A;  1R7J A;  2XRN A;  5DYM A;  3E6B A;  5JFR A;  1T0F A;  5AON A;  3F8M A;  3RTR A;  2KIF A;  2H27 A;  3ECH A;  5HS9 A;  2EV0 A;  1HW1 A;  3GO5 A;  5ILV A;  3HSE A;  2ISZ A;  3QPH A;  2GXB A;  1R1V A;  2ISY A;  3KE2 A;  1YS6 A;  2DW4 A;  2HYG D;  4U7D A;  2H6B A;  4QLC U;  1EH8 A;  2JPC A;  2ZJ2 A;  4A12 A;  1OYY A;  4Y17 A;  5LEK A;  1STZ A;  3ZN0 A;  2F5D A;  2P5V A;  3E6C C;  1W5S A;  1ZLJ A;  2L4M A;  4WXH A;  4OIQ F;  6PAX A;  3TGN A;  3LWF A;  1T2K A;  2TDX A;  1RUN A;  4M6X A;  3SFZ A;  1J5Y A;  2V1U A;  5H20 A;  1Z6R A;  5AIQ A;  2HWV A;  3ERE D;  2M30 A;  3R4K A;  4AIJ A;  2JSC A;  1BIB A;  4P9U A;  3F22 A;  1XD7 A;  1R23 A;  2P6S A;  4KT5 C;  3RKW A;  5H6Q A;  3BRO A;  2VOD A;  5EEG A;  1SD5 A;  4UV9 A;  5DUI A;  1FZP B;  1O3Q A;  2EB7 A;  2YU3 A;  1R5G A;  2GA2 A;  1O3S A;  2HGC A;  4KUM A;  3DFG A;  5IT3 A;  2Y0M A;  3SZP A;  4P96 A;  4CO8 A;  1XGO A;  5D6E A;  1D3Y A;  4IRH A;  3F8N A;  1YIO A;  4BQA A;  4IF4 A;  2MBF A;  1CGP A;  1SD4 A;  3R60 A;  3ELK A;  2EFQ A;  2DU9 A;  2XKO A;  3TDZ C;  1IRG A;  3M9A A;  4L0Y B;  4S04 A;  4Q4Z F;  2M8E A;  4RS8 A;  2IT0 A;  4WX9 A;  2PMU A;  5L3C A;  1UFM A;  1G3T A;  4M73 A;  3H3U A;  1QNT A;  2GZW A;  3D5L A;  3V4G A;  1R1U A;  2G9W A;  3WE3 A;  3Q5F A;  5DD8 A;  1OR7 A;  1BBY A;  3IL2 A;  3FZV A;  4KA4 A;  2P7C B;  5TRD A;  1XGS A;  2CGP A;  4GCV A;  2W25 A;  3KP5 A;  4ESF A;  4LFU A;  2OZU A;  2V1D A;  3V8K A;  2A3S A;  2WC2 A;  1IN5 A;  1R22 A;  1DDN A;  1ZYR F;  1FP1 D;  4XBF A;  4HF0 A;  2XAH A;  5E18 F;  3FWE A;  4ZYH A;  2XAQ A;  3ISP A;  2O61 A;  2EJR A;  3KLN A;  1LQ1 A;  1P92 A;  1JXS A;  4KMF A;  3KET A;  2EFO A;  2F5C A;  1S8N A;  1YQA A;  2K4B A;  4U0V A;  2L3D A;  1HW2 A;  2RNJ A;  4KIG A;  4ESJ A;  3H3Z A;  3I54 A;  2E7X A;  2BE5 F;  2R7D A;  3NEU A;  3BY6 A;  3DF8 A;  4UVC A;  1KQ9 A;  2VBX A;  5D6F A;  1XSV A;  2O8X A;  2M5W A;  1H0M A;  3HOS A;  5DD4 A;  2ZBK A;  1FNN A;  1R58 A;  1BM9 A;  5BS6 A;  5AIP A;  2HOE A;  4Q48 A;  4HLY A;  4U0W A;  3RKY A;  4G6D A;  5BPD A;  1IXC A;  4UVA A;  3JAM Z;  5FLX K;  3TOA A;  2O03 A;  3ROU A;  4LGW A;  2O6G E;  4RB2 C;  3PFI A;  2XKP A;  4GO1 A;  1TLH B;  1Y0U A;  1HBX G;  5FFZ A;  3NQO A;  2K4J A;  1HXD A;  5LHI A;  4BHC A;  1P4A A;  5K1Y A;  1K79 A;  1TQI A;  1MJA A;  3C7J A;  3V8J A;  5E1Z B;  3W6K B;  2COM A;  2ZO4 A;  1V3F A;  2Q2E A;  4HX4 A;  2HQR A;  2ADU A;  3GVA A;  2ZNZ A;  3L2C A;  1XCV A;  5CVJ A;  4A0X A;  5HS7 A;  4L0Z B;  1B4A A;  4PGG A;  3SXY A;  1Q1H A;  4A6D A;  4KNY A;  1IUY A;  3M8E A;  3F8B A;  2AXL A;  3QRF F;  1J7K A;  2DTR A;  4M74 A;  4IHS A;  3IC7 A;  3MFK A;  3CDH A;  3RPU A;  1B59 A;  2Q0O A;  1TQM A;  4M72 A;  3K0L A;  3TO7 A;  1BC8 C;  3QPT A;  1TW2 A;  3OOP A;  1FBQ A;  3K9T A;  2RV8 A;  2K86 A;  4GXO A;  5JHU A;  4Z2Y A;  1GHC A;  4BAY A;  3KFW X;  3WTW C;  2F5F A;  2MLK A;  4A2U A;  4FHT A;  4KIB A;  3BJ6 A;  2ZFW A;  2VXZ A;  1O7F A;  3LQR A;  3DXJ F;  3I64 A;  4Y13 A;  4AVP A;  5HLH A;  2KJB A;  1UHM A;  4CZZ A;  1IW7 F;  4EJO A;  4YII A;  1R00 A;  5FB2 A;  1CF7 B;  3R6S A;  2JZY A;  5L3D A;  1DUX C;  3IRQ A;  4YIF A;  2O0Y A;  4PGH A;  1ZLK A;  5CLS A;  1KGS A;  4RAZ A;  5J6X A;  3ZMU A;  3CUQ B;  1S7A A;  3AAF A;  1FPQ A;  2QVO A;  2XV4 S;  4BNC A;  4MTD A;  4EJW A;  1E2X A;  4KN4 X;  1MDM A;  2BGC A;  2A6H F;  1U5T C;  1Z7U A;  1ZRF A;  3G3Z A;  1IXR C;  2A68 F;  3GW2 A;  2FNA A;  2CQK A;  4L18 B;  5CYV A;  3VFZ A;  4NHJ A;  5L3G A;  1H9G A;  1YO5 C;  2STW A;  2HTJ A;  1XB4 A;  3M7G A;  3MZH A;  5EEH A;  4RB3 C;  4LMY A;  2XAF A;  4O5V A;  2CW0 F;  5E20 A;  4ASN A;  4N9H A;  1ZAO A;  5JVT A;  5D5W B;  2CWE A;  5LBQ A;  5DV5 A;  2IPQ X;  2LKP A;  4YFK F;  3WTU C;  3EYY A;  4EV0 A;  3FX3 A;  3GYH X;  1HW5 A;  5F6F A;  5FFX A;  1YS7 A;  4MHG A;  3R0A A;  3QAH A;  1FC3 A;  4HYE A;  2W24 A;  5DCM B;  5J8C A;  1ZRD A;  2H6C A;  1P4X A;  1V4R A;  4HV5 A;  1Z91 A;  3U9G A;  1ON1 A;  1XDU A;  2DPD A;  2JT1 A;  5LGT A;  1HSJ A;  4I2O A;  4MGR A;  2OU2 A;  2HTS A;  4RGS A;  2GQQ A;  1U78 A;  2XIG A;  2YX4 A;  1BI0 A;  2QWW A;  2V6C A;  4K2E A;  4OMY A;  2A5Y B;  1I5Z A;  2Y75 A;  1F4K A;  5LLQ A;  2A61 A;  3ZPL A;  1O3R A;  2QQA A;  3L00 A;  3E6D A;  5LEJ A;  3VOE A;  3VOD A;  3T5X A;  1W5T A;  5D5V B;  4LD5 A;  2HQN A;  5D8K B;  2RQP A;  1Z1D A;  3LST A;  4B8X A;  3QP5 A;  5LHG A;  2P7V B;  4ENM A;  1I6X A;  2M1B A;  1D8K A;  2P4W A;  3EYI A;  2UZK A;  3ZMV A;  4G7O F;  4AD9 A;  2E1N A;  2RVC A;  4WF2 A;  3SZT A;  2HDC A;  4XLN F;  4M9X A;  1F5T A;  3ABU A;  2R7F A;  4DNC A;  3N97 A;  1UHW A;  3MEX A;  2HZT A;  3JSO A;  3V8L A;  3ZQ7 A;  5LRS A;  4B09 A;  1MGT A;  4EM1 A;  2PJP A;  2ZME B;  4HZF A;  3TO9 A;  4LLN A;  3F72 A;  2DT5 A;  2LSO A;  2NS0 A;  3GXO A;  1YTY A;  4G7H F;  1XGN A;  2NYX A;  2HR3 A;  5FD5 A;  3FMR A;  1R36 A;  1WI9 A;  1Z6T A;  5E1W A;  2IVM A;  2RDP A;  3KP3 A;  1TW3 A;  3K2Z A;  4LK1 F;  4LK0 F;  4MEY F;  4KYW A;  2CYY A;  2VN2 A;  4OMZ A;  3TOB A;  3SHF A;  1PP7 U;  3REO A;  1B1B A;  2F5E A;  5HLG A;  1FYL A;  3J81 Z;  4G94 A;  3RKX A;  4M6Y A;  3HHG A;  1ZAR A;  3WTV C;  5FD6 A;  1T39 A;  3L7W A;  1IXS B;  1Z05 A;  5HVQ C;  2EFN A;  5ED4 A;  5A2Q Z;  1B9M A;  2F2E A;  2FA5 A;  3RJP A;  2W85 A;  3G73 A;  1USS A;  1A04 A;  4PCQ A;  1EH6 A;  4U0Y A;  3GZ5 A;  2WTE A;  1IN4 A;  1W7P B;  2W84 A;  1J59 A;  1KQ0 A;  3D0S A;  1KU2 A;  1FLI A;  2BEO A;  3WOD F;  2Z3Y A;  3KZY A;  4WK8 F;  3CUQ A;  4MQ9 F;  1IN8 A;  2OQG A;  1EV7 A;  3ULQ B;  1KU3 A;  1AWC A;  1F9N A;  1MD0 A;  4R8H A;  1SMY F;  2L4A A;  3HRT A;  4M71 A;  2FBH A;  1L0O C;  2H94 A;  4U88 A;  1G3Y A;  4YFX F;  4RB1 A;  3JTG A;  3M1E A;  4NB5 A;  4G7Z F;  1ZH5 A;  1J75 A;  1LEA A;  5DEQ A;  2GXG A;  4ENK A;  3KP4 A;  1YFH A;  1G4D A;  1MJ9 A;  1JHH A;  2CG4 A;  2Z33 A;  2RN7 A;  4GYI A;  2PI0 A;  4OU0 A;  4KDP A;  2EV5 A;  2XAS A;  1WRJ A;  4DQ2 A;  4QWQ A;  4P9F A;  4E70 A;  2FBI A;  4Y15 A;  1FP2 A;  5D5U B;  1IN6 A;  1KQ8 A;  3V7C A;  4ZZL A;  2FMY A;  3I71 A;  4XSX F;  2E1C A;  4HF1 A;  4ESB A;  1SFX A;  5DDG A;  1JE8 A;  4WWC A;  5BOX A;  1DPU A;  2CSO A;  2K7L A;  2E7W A;  3K69 A;  3RYP A;  4A6E A;  2M45 A;  3T1B A;  1W7P D;  5LHH A;  5E17 F;  5L3B A;  3C1D A;  2RKH A;  1KU7 A;  4YFN F;  3MZY A;  2MH2 A;  3WGH A;  3RIR A;  1UCR A;  3O6B B;  4HQE A;  4ENJ A;  4XSZ F;  1U8R A;  1OKR A;  1PDN C;  2VBZ A;  4LJZ F;  2FE3 A;  5D5X B;  3DEU A;  1IN7 A;  3WG9 A;  2QBY A;  1PUE E;  3DPT A;  1RI7 A;  4LG0 A;  2MH9 A;  2VC1 A;  2D1H A;  3CUO A;  4A0Y A;  3VEP A;  2CFX A;  3F23 A;  1ZHF A;  3CTA A;  1PP8 F;  5IT9 K;  2V9V A;  1HST A;  3FMQ A;  4IVN A;  2ACJ A;  3T0Y A;  2YSR A;  3CJN A;  2FF4 A;  2DLL A;  4MQV A;  5K5Q A;  3E97 A;  1LB2 A;  1ZRC A;  3E5Q A;  2PMH A;  1YW9 A;  3F6O A;  2K02 A;  2MC3 A;  2YPR A;  2NAZ A;  3ZP5 A;  4A5N A;  3FF5 A;  1S7O A;  2DBB A;  4Q5S F;  1LVA A;  2NNY A;  2RC4 A;  2OA4 A;  1REP C;  3F21 A;  1VTN C;  2OZ6 A;  3JSP A;  3QU3 A;  1XDS A;  4RAY A;  4HDU A;  4HA8 A;  3GEZ A; 
#chains in the Genus database with same CATH topology
 1MZB A;  4LLL A;  2EBI A;  1A6I A;  4F93 B;  2XSJ C;  1SFE A;  2DQR A;  4LG3 A;  1NG7 A;  5CVV A;  3U1D A;  4BDZ A;  1B72 B;  3LAP A;  4AIK A;  2L7F P;  1Y39 A;  3FXL A;  3GZ6 A;  2KRF A;  2VL8 A;  3BCA A;  3ZMT A;  3OYM A;  3F8F A;  2BBY A;  4E4H A;  4EMS A;  4MEX F;  4IHT A;  2DMT A;  5JR3 A;  3PUF A;  5GAE J;  2E5N A;  1ON2 A;  2J5P A;  2B9S A;  5ICF A;  4FE7 A;  4ON0 A;  3OYK A;  1TZL A;  5IYB J;  3RCO A;  4F3Q A;  2UXN A;  5C4J J;  3CME I;  1UST A;  3LSJ A;  3TMO A;  4YIR X;  2DK8 A;  4QPO A;  1ONV A;  3F3X A;  2NNN A;  2P6T A;  3JRA A;  3ZN1 A;  5B66 C;  5FGM A;  1GUU A;  2VLA A;  4HBL A;  2W57 A;  3MVP A;  3PNV A;  2YX7 A;  4GYG A;  3HTS B;  1I50 J;  3LFK A;  1TWC J;  1TBX A;  5JVG F;  1SAX A;  1A35 A;  2V9P A;  3GFJ A;  4ZZD A;  4OIN F;  3C18 A;  4IPA A;  4PFP A;  2KQR A;  1POG A;  3B73 A;  4P55 A;  1FWZ A;  5KVR A;  5FLM J;  1IDZ A;  1K78 B;  2G0E A;  3FMS A;  1ENH A;  3OV8 A;  1HQC A;  1RIO H;  2DQL A;  3HDD A;  3F8C A;  1LE8 B;  3WE2 A;  2Y2Z A;  3IH3 A;  5DM6 F;  1QGP A;  1U5T B;  2M2E A;  1WJA A;  1SD6 A;  4A0Z A;  4RDU A;  2XHK A;  2ELK A;  5F64 A;  3JRF A;  2D5V A;  2RRE A;  5FLX Z;  3G1O A;  5K5R A;  1U8B A;  2VE8 A;  3LAJ A;  2PFB A;  4BXX J;  4A69 C;  1NG6 A;  1OR7 C;  1DPR A;  2ESN A;  1G59 A;  4JQF A;  4EM0 B;  4UXN A;  3R61 A;  2Y69 H;  4D0P A;  2ELJ A;  4MIM A;  3CDL A;  3FM3 A;  1Y8Q B;  2FX0 A;  2XVC A;  2NXN B;  3BZ6 A;  2QKM B;  3MWM A;  4RLF A;  2F6C A;  4IEJ A;  3QU6 A;  4EEF G;  1JKQ C;  1W36 D;  3I59 B;  2VOO A;  1VZ0 A;  1ERD A;  3JRB A;  2ME6 A;  1LDD A;  4G9Y A;  3OSG A;  1EJ9 A;  3AG2 H;  4UUV A;  2R93 J;  3SZG A;  1QVU A;  3CD6 I;  2KZV A;  2LD5 A;  3S14 J;  1T56 A;  1FTT A;  1DGR M;  3D5R C;  1S29 A;  5M3M J;  4XLP F;  3BJO A;  1GV5 A;  2EFW A;  4EJT A;  2WAQ N;  4UUS B;  1PJR A;  3BTJ A;  4C2U A;  2QM3 A;  1JJ8 C;  4IRG A;  4M9Z A;  4AIH A;  2FSW A;  3X2Q H;  3CO6 C;  4H0E A;  1C0W A;  3RDI A;  4HST A;  4V19 K;  3HOZ J;  5KCM A;  2LF8 A;  2PX9 A;  3QOP A;  4FX4 A;  1LDJ A;  3WTS C;  2BHZ A;  5L3E A;  2JK3 A;  2NOJ B;  1WSU A;  4XRS G;  1QBJ A;  3DKY A;  3CCQ I;  3CLQ A;  3FXO A;  3O2P E;  3O8G A;  1K6Y A;  4BY7 J;  1HDD C;  1MBG A;  1NHA A;  5E1X A;  1R71 A;  1FX7 A;  4OIR F;  3LQQ A;  3RYR A;  1JI8 A;  2Y48 A;  1HOM A;  4PZJ A;  1YW8 A;  1XMK A;  3EQL F;  2LDU A;  3DQV C;  3IUO A;  5ICC A;  3N4M A;  1BN5 A;  3K4N A;  1YLF A;  2PLY A;  5CPR B;  1Z77 A;  3GME A;  3OYN A;  2HDW A;  2X1C A;  4EQQ A;  3HIF A;  2XF6 A;  2CUJ A;  2EZL A;  2L7Z A;  3OIO A;  4KMU X;  4ZH4 F;  1WCM J;  4YG2 F;  3RZD J;  3I58 A;  2E1M C;  3DPL C;  1I39 A;  3M07 A;  3VDX A;  3P7N A;  1YRN B;  5EGO B;  1G3S A;  2VC0 A;  2KMU A;  4BH9 A;  4CH7 A;  3KLO A;  3V42 A;  2VE9 A;  4I09 A;  4YEL A;  3F9K A;  1BJA A;  4F55 A;  3HB9 A;  2FXA A;  3P9K A;  3ZMS A;  3K2A A;  3NAU A;  9ANT A;  1FSH A;  4HLX A;  2HDD A;  1IUF A;  4OOI A;  3KP7 A;  1U9O A;  3HRS A;  1D1B A;  2DXI A;  1ZGA A;  2LH9 A;  4P1W A;  1T95 A;  2HS5 A;  1HKS A;  3PM1 A;  2LKX A;  1SAN A;  1YG2 A;  1ZEL A;  1X4O A;  2XDV A;  5L3F A;  1ACI A;  4WCG A;  4O6J A;  4C2M J;  1SVO A;  3CLO A;  4R79 A;  2DMN A;  1OFC X;  2PEX A;  3MCZ A;  4BE0 A;  4I7H A;  1VQO I;  4XRS A;  1GVJ A;  2Q2E B;  2OQR A;  1GXP A;  2MAB A;  1X1B A;  1ZTR A;  4C9Y A;  4H4K C;  1NH3 A;  1N78 A;  3KP6 A;  3KZI C;  2P81 A;  4FE4 A;  4RGR A;  3ZQI A;  3CC4 I;  2VBW A;  3RPQ A;  2M0M A;  3SFI A;  3SEZ A;  3J80 Z;  2CQ7 A;  2HXO A;  2NS7 A;  1P6R A;  2HKO A;  3W6J B;  3UNG C;  5GTH C;  4LB5 A;  3U2R A;  1XN7 A;  3DKW A;  3HTU A;  4RMN A;  1W0U A;  1O3T A;  3S2H J;  3KP2 A;  3CP8 A;  1Y1V J;  4L9J A;  5HOO A;  3BWG A;  3ZMZ A;  1FOX A;  2QQ9 A;  1J9I A;  5ILU A;  3HEF A;  3BP8 A;  4IKF A;  5FRN A;  4EGY A;  2A6E F;  1XSX A;  3L1P A;  1TWF J;  2VB6 A;  3TW6 A;  5K7F A;  1IG7 A;  4U87 A;  1WJF A;  5F0C A;  2XRL A;  3WGI A;  1FBU A;  4FAS D;  1FYK A;  3M8J A;  1SFK A;  2OBP A;  5CQE A;  2HKX A;  2FOW A;  3S2W A;  3IWF A;  1I27 A;  3K1N A;  5TIS C;  4XIC A;  2W00 A;  1D5V A;  3KEY A;  3FK7 A;  5LGU A;  3BJA A;  2FEZ A;  2XGC A;  5H6R A;  3SQN A;  3KEQ A;  3VB2 A;  3T8R A;  1YYV A;  1FMW A;  3K4K A;  3MN2 A;  2PJR B;  2JA5 J;  1TNT A;  2KIQ A;  1WWX A;  2Z5U A;  3PQJ A;  1SD7 A;  2DN0 A;  2RGV A;  1MNM C;  4U7B A;  2XGX A;  1RNL A;  2OCE A;  2QYO A;  1MNE A;  1X3U A;  4ZYE A;  2D45 A;  4Y7N J;  1OYW A;  1AA7 A;  1BR1 A;  1IF1 A;  2L02 A;  1WZ2 A;  2RAE A;  2P5K A;  2DTZ A;  4B1R A;  2UXX A;  4F52 A;  3HHH A;  2JUC A;  3T8T A;  1JHF A;  2R4G A;  4HG2 A;  3GF2 A;  4CDG A;  3DEW A;  4TV7 A;  1FYM A;  3BG5 A;  3L2U A;  2DFI A;  3B02 A;  3ZOB A;  2DDA A;  2HPI A;  3OYA A;  3HJE A;  1YJW I;  2UWM A;  3MAJ A;  2OAZ A;  3GX4 X;  2ZXJ A;  1RKW A;  5IP9 J;  1R9T J;  1F1Z A;  1KYW A;  4ABZ A;  3D1N I;  2OC6 A;  1H9T A;  1LPQ A;  2LYC A;  4I6Z A;  1J09 A;  2M7A A;  2WB1 A;  3CJT B;  2VKD A;  1RUO A;  4O3M A;  2DJN A;  4JX5 A;  1LNW A;  4G6Q A;  5J1Y A;  4CXF A;  2DA7 A;  4HX8 A;  1IRX A;  2ME0 A;  3GWZ A;  2IGM A;  3JAM K;  4PJM A;  4IJA A;  1RC9 A;  1W5C C;  4LIU A;  1W4M A;  2V1X A;  4L9T A;  4AWX B;  3SEQ A;  1IC8 A;  2QQB A;  3EET A;  1VQK I;  5B3S H;  4BKX A;  4DGW B;  3BOQ A;  1AHD P;  1LVK A;  3GTL J;  4GGG A;  5HDN A;  3IH2 A;  1IZ1 A;  5EG0 B;  1V55 H;  3IKT A;  4HRI A;  2KJC A;  1MBF A;  1U6G A;  4BHP A;  5GAG J;  3KYL A;  1IRF A;  1MBK A;  2JSP A;  2P5L C;  2BV6 A;  4LLG F;  2WV1 A;  3GLX A;  4JX4 A;  4OAY A;  3JTH A;  3M3Y J;  3WGG A;  1MDM B;  5HDK A;  4UB8 C;  2K40 A;  3GFM A;  2MD5 A;  2JMW A;  3WTX C;  2YU9 J;  4NDL A;  3MKW B;  2DOE A;  3HUG B;  4BL0 B;  2OF7 A;  3RSN A;  3NRV A;  3QOE A;  2X6W A;  1SMT A;  3WTT C;  3E5X A;  2TRT A;  3RPU D;  3K70 D;  2GXA A;  4ITV A;  1J2X A;  4I0A A;  1QO0 D;  5LRR A;  3FXU A;  2MG4 A;  2DT6 A;  1X3Z B;  3BPX A;  3HSR A;  3LA2 A;  2K9N A;  3TDU C;  5HDG A;  1L3L A;  3K1P A;  2JRT A;  3OYB A;  4FCY A;  1G3W A;  1VF9 A;  1Z67 A;  2LK2 A;  2M34 A;  1X4P A;  2PG4 A;  4RGU A;  5JHF A;  1HC8 A;  2Q8K A;  4M9S A;  1CF7 A;  4E7J A;  5CVI A;  3H5A A;  2ID6 A;  2IJL A;  4V2F A;  1JTY A;  2DAO A;  3RZO J;  1XCB A;  4XID A;  1AKH B;  1PVE A;  3KEO A;  2QUF A;  2KIS A;  2XSD C;  2MGQ A;  4HQM A;  3CO7 C;  4A3L J;  3IWZ A;  4PUS A;  3RQ4 A;  5IP7 J;  3A02 A;  2KT0 A;  4ZYG A;  2TCT A;  1U2W A;  3H92 A;  2XRO A;  5BMZ A;  4ZDP A;  1BI3 A;  2IA1 A;  3O3K A;  5J8F A;  2COB A;  2VT2 A;  3BG6 A;  1K78 A;  2P0W A;  3LA3 A;  2EA4 A;  1E0E A;  1QPM A;  3TW7 A;  2HQ5 A;  1ZR4 A;  4HSR A;  2O3F A;  4XKW A;  4Y4R A;  1A5J A;  4A5M A;  4F92 B;  3C3W A;  2OD5 A;  5ICE A;  3HBL A;  1LE8 A;  3BR6 A;  3CCL I;  3PSI A;  1Y1W J;  3EDP A;  1U5T A;  2QEN A;  2JA2 A;  3L9F A;  3K4C A;  2LP0 A;  1XC5 A;  2HYF A;  3LSK A;  3NWS A;  1SEU A;  1IJW C;  4M3D A;  2YR2 A;  1CQT A;  2B0L A;  4DYQ A;  3HRM A;  3KZZ A;  1X2N A;  4S05 A;  3JCU C;  2FRH A;  4BXU A;  1VQ5 I;  3OWT A;  3L09 A;  4DZJ A;  2KIM A;  1XSD A;  4KIF A;  3FKI J;  5FO5 A;  1VQ8 I;  1IDY A;  5BQT A;  5F1R A;  1WH5 A;  3OYF A;  2EZI A;  3VSK A;  5ERI A;  3I59 A;  5DCF A;  2XAJ A;  1MMS A;  4M6V A;  3CCJ I;  1WJB A;  2IA2 A;  4YEJ A;  4C2T A;  5KK1 A;  2FBK A;  2EV6 A;  4L9N A;  3F6V A;  2DMU A;  1P2F A;  4FX0 A;  4WXC A;  2HNH A;  2MA3 A;  1XPX A;  3MQ0 A;  1ZG3 A;  2IBD A;  2M9H A;  2R5Z B;  2WV0 A;  1ZG1 A;  2ZC2 A;  3TO6 A;  4MNU A;  2MLG A;  1O7L A;  3SYT A;  4UUT A;  3QWL A;  3ABM H;  1BI2 A;  2QSH X;  3H3V K;  1MKM A;  4ZYD A;  3HOY J;  2G7U A;  4P5O A;  2JRM A;  4KIC A;  4AYB N;  1YHQ I;  1TT0 A;  1MSE C;  4KFC A;  2KL4 A;  3IKV A;  4ANJ A;  3W2V A;  4A3C J;  2R0Q C;  2XF7 A;  4B3X A;  2FUG 2;  2RNG A;  1KYZ A;  2GA1 A;  3WHB A;  3Q0U A;  2V1N A;  2FNP A;  3HC7 A;  2J5O A;  2D1V A;  1MSF C;  2IS4 A;  1P7I A;  2EFP A;  1HA8 A;  3HOT A;  2STT A;  3G71 I;  3QPS A;  1RZ4 A;  2M3A A;  5DUK A;  1G6N A;  2EH3 A;  1WJD A;  2ELH A;  4Q47 A;  3BCB A;  5F0H A;  1WJC A;  4IHX A;  4RGX A;  3IHU A;  2VJJ A;  2M87 A;  4FIS A;  2F4O B;  5DCM A;  3C2G A;  3K1M A;  3E1S A;  3KYC B;  4ZTF A;  1YRN A;  4FQG A;  2X9D A;  2KIU A;  4I01 A;  1JJ6 C;  2NVX J;  4MFE A;  4QPQ A;  2BXY A;  5BPI A;  3CCS I;  1EH7 A;  2W1O A;  4EM2 A;  1OPC A;  2LR8 A;  2HFH A;  1E3O C;  2X85 A;  2W48 A;  1X1A A;  1QQI A;  1MMG A;  2FOK A;  3RI4 A;  4XLC A;  1T98 A;  2IP2 A;  4HW0 A;  3M4O J;  2WWY A;  1NTC A;  3KX2 A;  2L01 A;  5CKT A;  4I76 A;  3R0J A;  2XPW A;  3K4L A;  2CV0 A;  2ZXW H;  2DYS H;  4FTH A;  1BI1 A;  3E0J B;  1OYI A;  3JW4 A;  3GLL A;  3COA C;  4II2 A;  1OLT A;  3LFU A;  4RLQ A;  4UHT A;  1FSE A;  2LY2 A;  1I1G A;  5D4R A;  2K5C A;  1TTY A;  4F7Z A;  4NC8 A;  2CRG A;  2VON A;  5M5W J;  3HG9 A;  1R5H A;  1ZGW A;  2BYV E;  1HKQ A;  1U3E M;  1BOA A;  4LOC A;  2JPB A;  3OS1 A;  2LF7 A;  1LEB A;  5GPA A;  3HZJ A;  2JTV A;  4L5I A;  2IRF G;  2LBF B;  2KRC A;  2L9V A;  4HAM A;  1VND A;  1YW7 A;  2IA0 A;  2L7K A;  5EZH A;  4N0B A;  2KZG A;  1X1P A;  1JKO C;  2JVH A;  2V7F A;  1R1T A;  5IOZ A;  1OJL A;  1GDT A;  4OIP F;  1FEX A;  3DBR B;  1A31 A;  2EIM H;  2E34 A;  4HV6 A;  2Z9O A;  1ODD A;  3P9C A;  2KHM A;  3ECO A;  1HKT A;  3E5U A;  3S1M J;  3KPH A;  2I5U A;  3CDI A;  3WU2 C;  1ULY A;  2DI3 A;  2P8T A;  3OYE A;  1WQ2 A;  3WTY C;  4A93 J;  3I4N J;  2XAG A;  2FQ3 A;  3CCU I;  2V79 A;  3WHC A;  5CJ9 A;  1KU9 A;  3JRE A;  3CMY A;  3KCC A;  1A6Q A;  2GIV A;  3BR3 A;  5C4X J;  3ABT A;  4I0B A;  4GFB A;  4IRI A;  2VOP A;  2B7E A;  2DMP A;  1MMA A;  4BYY A;  3I0T A;  5FKL A;  1DU6 A;  5EF6 A;  4G8X A;  2WAD A;  1TQP A;  5HS8 A;  3BTL A;  1F36 A;  2BZT A;  2IGK A;  1XX5 A;  3VYS B;  4ZYA A;  3S1N J;  3GUD A;  4KIS A;  1QZE A;  2XUB A;  2R7Q A;  4EVI A;  5J4Y A;  2E35 A;  5JLX A;  1JGS A;  3H5N A;  3AL0 C;  3PJR A;  2GAU A;  5LGN A;  1DGW Y;  3WG7 H;  2R5Y B;  1IGN A;  2GOX B;  4JK1 X;  4J01 A;  4Z6Y A;  3J7A O;  2CFO A;  2CQN A;  3P9I A;  4RB0 A;  5FKN A;  3FXQ A;  1DP3 A;  1R6R A;  3I4P A;  4B3A A;  2QLZ A;  4CGZ A;  2ZME A;  4N9I A;  2MC4 A;  3AKZ A;  3ML6 A;  1FT9 A;  2H8R A;  3MD2 A;  3J80 K;  4HF2 A;  3IRR A;  5FKM A;  4M3B A;  3TKY A;  2VBY A;  2YS9 A;  3DCF A;  2A07 F;  3EUH A;  3LA7 A;  2HEO A;  1BIA A;  1S6L A;  4HX7 A;  2V9K A;  4IQJ A;  4II3 A;  1D5Y A;  3TQN A;  2X48 A;  4JYK A;  2ZCW A;  4R1H A;  4CYC B;  2CH0 A;  4BEH B;  1LDK B;  4L5E A;  2EK5 A;  4FT8 A;  3QYE A;  4MTE A;  3V7S A;  1FBS A;  3NWT A;  2LNB A;  4IO9 F;  2LMD A;  3PQK A;  5CVR A;  2PBI A;  1I1S A;  3CJQ B;  4ETS A;  3O8H A;  4CYD A;  3DLA A;  2EWN A;  2DK5 A;  3ZRG A;  2BY0 A;  2NRA C;  3BPV A;  4CCL A;  3ABK H;  3DV8 A;  3ZMD A;  3H9G A;  1ZK8 A;  2FU4 A;  4UV8 A;  1ZRE A;  3CUQ C;  3WU1 B;  3TED A;  5F27 A;  2KKO A;  3LMM A;  4KN7 X;  2HPM A;  4XOT A;  2DA2 A;  3HRU A;  1KA8 A;  2K27 A;  2CMP A;  2DPU A;  1K7A A;  2VPL A;  4OIO F;  3OL3 A;  2ESH A;  4HPQ A;  1T38 A;  3VWB A;  1B9N A;  3HKZ A;  2VT3 A;  2E2H J;  4BHB A;  4CSW A;  5D8L B;  2HVR A;  4I98 B;  4D7M A;  5TGT A;  1TP4 A;  3HUG A;  4EJU A;  3PIO F;  1VQ6 I;  3DTI A;  4BE1 A;  2ETH A;  2FML A;  2CO5 A;  1MBE A;  4ENN A;  1BJZ A;  1ZN2 A;  2GWR A;  5K5O A;  2K3F A;  3GFI A;  3Q9V A;  4BQQ A;  1O57 A;  2V26 A;  1Z9C A;  1V54 H;  2NVQ J;  3DP7 A;  3HYI A;  4BUP A;  2L54 A;  4HOB A;  5B5E C;  1IAW A;  4CHU A;  5FJ8 J;  1A36 A;  3HGY A;  4UVB A;  2I8D A;  1MMD A;  2G7H A;  1K6O A;  4IHW A;  3C2H A;  3CMA I;  5CVU A;  1D0X A;  3WU0 A;  5IT9 Z;  3HSF A;  3I53 A;  3M8F A;  3K4M A;  4CIC A;  4EGZ A;  4BE2 A;  5ICG A;  4A3M J;  2Z99 A;  3E3V A;  5IOY A;  1W7P A;  2EZK A;  2UV1 A;  3PSF A;  1BR2 A;  4G12 A;  5LFA A;  3W3C A;  1B6A A;  3PIP F;  5CQG A;  3L2W A;  3Q9S A;  1FOK A;  5ILS A;  3HOW J;  2DO7 A;  1P4W A;  2E1M B;  1QZZ A;  2QZ8 A;  3AFH A;  2JN6 A;  5E3M A;  2GBY A;  2DFE A;  3S2D J;  4CUG A;  4L5J A;  2Y9Z A;  4UNO A;  1J0R A;  1MND A;  1LKX A;  5D4S A;  4IXA A;  1XMA A;  1HCR A;  5TJJ A;  2FD5 A;  2FQ4 A;  2AS5 F;  3OYD A;  3BQY A;  4NQW A;  2KLO A;  5HLI A;  1QZY A;  1BC7 C;  1D0Z A;  4ZC3 A;  2HOA A;  2ZNY A;  4L9V A;  3AG3 H;  4RM3 A;  2PQ8 A;  4XR6 A;  3E6M A;  2N8G A;  1OCP A;  2Z2S B;  1SFO J;  3FXR A;  1UB9 A;  2E1O A;  1LJ9 A;  3ZQQ A;  1MJB A;  4I02 A;  5JI6 A;  3J81 K;  2BW3 B;  1GXQ A;  1DP7 P;  3A2K A;  1IV6 A;  4WXD A;  4PJ0 C;  5E8G A;  4XRF A;  3L2Q A;  3G6E I;  3OYL A;  3WTZ A;  1T6S A;  3GFL A;  5GAH J;  1WKM A;  1S3J A;  3FHZ A;  2IW5 A;  1D8J A;  2X0L A;  2D2W A;  1FY7 A;  2X4H A;  2DA1 A;  1XGM A;  1OMI A;  4NBQ A;  2C6Y A;  3VSL A;  1PUF B;  2CUZ A;  3SDG A;  4B47 A;  1TNS A;  2R3S A;  3A01 B;  4PDK A;  2QBY B;  5A2Q K;  2KDZ A;  3V7R A;  4B44 A;  4JBA A;  4QTR A;  4LG0 B;  1K4T A;  1BW6 A;  1ZG5 A;  5E8I A;  1ETV A;  4RA2 A;  4C3J J;  1ZGJ A;  5FRO A;  1SFU A;  3G4S I;  2ZKZ A;  5HOD A;  5M3F J;  4MO7 A;  4EJV A;  4QIW N;  4LB6 B;  3FM5 A;  2NS8 A;  1FIA A;  2GLO A;  2A69 F;  2H09 A;  1YJ9 I;  4HDV A;  1E3H A;  5FKO A;  3BDD A;  2CV1 A;  2E36 A;  5IP6 A;  1MH3 A;  3K7A J;  4OWR B;  1OCZ H;  1E17 A;  2PN6 A;  1TL8 A;  2W82 A;  2EA2 A;  3I5U A;  1AOY A;  4XOR A;  3QP6 A;  4CCM A;  1R7J A;  1B8I B;  2XRN A;  3PL8 A;  5DYM A;  4DBQ A;  3E6B A;  1IO2 A;  5JFR A;  1QHH D;  1T0F A;  1N75 A;  2H1L A;  5AON A;  1GVD A;  3H1C A;  3H36 A;  1UZC A;  3F8M A;  3QQA A;  3RTR A;  1JT6 A;  2KIF A;  2H27 A;  2IS2 A;  3BR1 A;  3A4C A;  3K4B A;  4A3D J;  3ECH A;  5HS9 A;  2KP6 A;  2EV0 A;  4J00 A;  3W2A A;  2R7R A;  4A3B J;  1PYV A;  5F0F A;  1HW1 A;  2BY3 A;  3GO5 A;  5ILV A;  2W7N A;  3HSE A;  2DT7 B;  2ISZ A;  3QPH A;  3QPL A;  2GXB A;  2KFD A;  3LOC A;  4E7S A;  1R1V A;  1G8X A;  2ISY A;  3KE2 A;  1TC3 C;  1YS6 A;  3DBL B;  2DW4 A;  3EUK L;  4RM2 A;  2HYG D;  4U7D A;  4NUB A;  3NAR A;  2EIK H;  2H6B A;  4QLC U;  1EH8 A;  2JPC A;  5IYD J;  2ZJ2 A;  4A12 A;  1OYY A;  4AC0 A;  2JQ7 A;  4Y17 A;  5LEK A;  2VXD A;  4KT6 A;  1Z0X A;  2VKH A;  2Q1Z B;  1STZ A;  3ZN0 A;  2F5D A;  1FOW A;  2P5V A;  1BW5 A;  4E7H A;  3E6C C;  1W5S A;  2WB1 N;  3TBI A;  1YX5 A;  1ZLJ A;  2L4M A;  1N25 A;  1UHS A;  4WXH A;  1TWA J;  4OIQ F;  6PAX A;  3TGN A;  3LWF A;  4XKV A;  1T2K A;  3ONQ A;  1LFU P;  4RAG A;  4N4O B;  2TDX A;  1RUN A;  4M6X A;  3SFZ A;  1J5Y A;  2V1U A;  4NC7 A;  5H20 A;  2H1K A;  1Z6R A;  2LBF A;  2F5V A;  5AIQ A;  2OTJ I;  2HWV A;  3ERE D;  2IS1 A;  2M30 A;  3DBH B;  3CF2 A;  3BT9 A;  3CP2 A;  2VJ5 A;  4IQ4 A;  3R4K A;  2ZME C;  4AIJ A;  1S9H A;  3FIW A;  2QSF X;  2JSC A;  2DOA A;  1BIB A;  1TWH J;  4P9U A;  3JR9 A;  3F22 A;  1XD7 A;  5EEA A;  4N4N B;  1R23 A;  1P9Q C;  2AQF A;  2VPR A;  3GCM A;  4JP0 A;  4HNU A;  1RKT A;  2K85 A;  2P6S A;  3EUH C;  4KT5 C;  5H6Q A;  2AHQ A;  3RKW A;  2DMQ A;  3BRO A;  4RBO A;  3BZK A;  3DPU A;  2VOD A;  5EEG A;  4CCO A;  1YIT I;  1SD5 A;  2DYR H;  4UV9 A;  5DUI A;  3BR0 A;  5B1A H;  1FZP B;  1LFP A;  3TL4 X;  1O3Q A;  2CQQ A;  1XG1 A;  2EB7 A;  2YU3 A;  1R5G A;  3N05 A;  2EIJ H;  2GA2 A;  2VJI A;  3G2B A;  1VQL I;  1O3S A;  3J7Z I;  1B72 A;  5F1J A;  2HGC A;  3MMY B;  4KUM A;  1NK2 P;  3FHN A;  3DFG A;  5IT3 A;  1BR4 A;  4DOZ A;  3H0G J;  2KDO A;  2QEX I;  2AO9 A;  2Y0M A;  2X1D A;  1T08 B;  2IAI A;  3LSG A;  3SZP A;  2VQH A;  4P96 A;  4CO8 A;  1XGO A;  1UAA A;  2MFZ A;  3OL4 A;  5D6E A;  1D3Y A;  3DTE A;  4IRH A;  2R7V A;  2LC2 A;  3F8N A;  4XN3 A;  1YIO A;  4BQA A;  2XAU A;  4IF4 A;  2JWT A;  3HGG A;  2MBF A;  3OYC A;  1CGP A;  3OR2 C;  2BVL A;  1OCR H;  3DWL E;  1SD4 A;  1QHG A;  3FXM A;  3R60 A;  3ELK A;  2EFQ A;  2DU9 A;  2XKO A;  3TDZ C;  1IRG A;  1OIS A;  3M9A A;  5H2F C;  4L0Y B;  4S04 A;  4Q4Z F;  2M8E A;  3BQZ A;  4PSW A;  4RS8 A;  3I3L A;  4NC6 A;  2V6E A;  2IT0 A;  4B48 A;  3JRC A;  4WX9 A;  1MBJ A;  2PMU A;  1APL C;  5L3C A;  1UFM A;  1G3T A;  3VYT B;  4B43 A;  5J3L A;  3LNQ A;  4M73 A;  3H3U A;  1WH7 A;  1K83 J;  5LD2 C;  2DJI A;  1QNT A;  2GZW A;  1FIP A;  3D5L A;  3V4G A;  3PUB A;  1R1U A;  2G9W A;  1BA5 A;  2IXS A;  3WE3 A;  1YE9 A;  5C3E J;  3Q5F A;  3D5S C;  2MW8 A;  1MIJ A;  4CYC A;  3BTI A;  5DD8 A;  1R49 A;  2L9S A;  2BVM A;  1OR7 A;  1YOV B;  1H89 C;  1BBY A;  3IL2 A;  3KYD B;  1IRZ A;  3FZV A;  4KA4 A;  2P7C B;  3HOU J;  5TRD A;  1XGS A;  2CGP A;  4GCV A;  2W25 A;  2QCO A;  3KP5 A;  4ESF A;  4LFU A;  3AG1 H;  2OZU A;  3CQZ J;  2X6O A;  2L9N A;  2V1D A;  3V8K A;  1TWG J;  2A3S A;  2WC2 A;  4XRM A;  1ZKG A;  1WHU A;  1HF0 A;  1IN5 A;  1R22 A;  1DDN A;  1ZYR F;  1FP1 D;  1SVL A;  4XBF A;  3K6G A;  4CZC A;  3E7L A;  2DA6 A;  4HF0 A;  2XAH A;  3MKZ A;  2LVS A;  3S93 A;  5E18 F;  1BOB A;  3FWE A;  1I3A A;  2Z1D A;  2R7W A;  4ZYH A;  2XAQ A;  3ISP A;  2O8K A;  2O61 A;  2EJR A;  2M4K A;  3KLN A;  1LQ1 A;  1P92 A;  1JXS A;  4KMF A;  3BZC A;  4UUS A;  3KET A;  2EFO A;  4PSX A;  4ZJZ A;  2F5C A;  1S8N A;  1YQA A;  2K4B A;  1I6H J;  4U0V A;  4BQN A;  2L3D A;  3Q3S A;  4XK4 A;  1HW2 A;  2RNJ A;  4KIG A;  4ESJ A;  3H3Z A;  3I54 A;  2E7X A;  2BE5 F;  2R7D A;  2K9Q A;  1KZH A;  3NEU A;  4DW6 A;  3BY6 A;  2X6Y A;  1Y0N A;  3DF8 A;  4UVC A;  3PO3 J;  3FXK A;  1KQ9 A;  2QQ8 A;  2VBX A;  5D6F A;  1XSV A;  2M4G A;  2O8X A;  2M5W A;  1Z7L A;  1H0M A;  3HOS A;  5DD4 A;  1EA3 A;  2ZBK A;  1FNN A;  1R58 A;  3A0B C;  1BM9 A;  5BS6 A;  3B6C A;  2Y0S N;  4NNJ A;  4IOA F;  3S3N A;  5AIP A;  1VQ7 I;  2OPT A;  2KPM A;  3FIS A;  2HYJ A;  2HOE A;  4XLA A;  5DS9 A;  1JTX A;  1GT0 C;  4Q48 A;  4G6T B;  1ZQ3 P;  4HLY A;  3S16 J;  4U0W A;  3RKY A;  4G6D A;  1P7J A;  5BPD A;  1IXC A;  2OJE D;  4UVA A;  4AYB A;  3JAM Z;  4HNT A;  5EGO A;  2LFB A;  3OY9 A;  3CF5 F;  3VYR B;  5FLX K;  3TOA A;  3QOD A;  2EIN H;  2O03 A;  3ROU A;  4X6A J;  3CZ6 A;  4LGW A;  5C44 J;  5J4V A;  2CW8 A;  1JKR C;  2O6G E;  4RB2 C;  1Y6I A;  4LIV A;  5F04 A;  3PFI A;  2LTP A;  2Y9Y A;  4XN0 A;  4BQO A;  2XKP A;  4GO1 A;  1TLH B;  2CU7 A;  3CCM I;  1ETK A;  1T0F C;  2E71 A;  1Y0U A;  2ECC A;  2DA4 A;  1HBX G;  5FFZ A;  4DBR A;  3NQO A;  3ZQH A;  2K4J A;  3ZCO A;  1HXD A;  2L9R A;  1QPI A;  5IYC J;  1MH4 A;  3EPZ A;  5BNG A;  2E19 A;  3P5J A;  3DU5 A;  4BHC A;  5LHI A;  2WAE A;  1H88 C;  1P4A A;  2NOG A;  5K1Y A;  1K79 A;  1TQI A;  1MJA A;  3C7J A;  3PO2 J;  3OIQ A;  3V8J A;  5E1Z B;  3W6K B;  2DFF A;  2COM A;  2ZO4 A;  4JOM A;  1PUF A;  4XMY A;  1V3F A;  1WJE A;  2Q2E A;  4HX4 A;  2HQR A;  3HXL A;  3LSM A;  2VQG A;  3UKG A;  2ADU A;  1V5F A;  5FRM A;  2ID3 A;  3GVA A;  3BTC A;  2ZNZ A;  3L2C A;  1ORK A;  3A03 A;  1XCV A;  5CVJ A;  4A0X A;  5HS7 A;  4L0Z B;  1B4A A;  4LIT A;  4GRI A;  2B63 J;  1V5G A;  4E7Z A;  2LOO A;  3S3M A;  2R7S A;  4PGG A;  4XL9 A;  2ZB9 A;  3SXY A;  3TP0 A;  3BR5 A;  3HPG A;  2L2O A;  1Q1H A;  1QA6 A;  4A6D A;  2IS6 A;  5EJC A;  4KNY A;  1IUY A;  3M8E A;  3F8B A;  2AXL A;  3QRF F;  1J7K A;  3ZQL A;  2DTR A;  4HEA 2;  2LY1 A;  4M74 A;  4M3F A;  2PMZ A;  4IHS A;  3IC7 A;  4XLE A;  1WFX A;  2GM4 A;  1B8I A;  3MFK A;  3CDH A;  2XC7 A;  3RPU A;  1Z3X A;  1B59 A;  1VI0 A;  2Q0O A;  1TQM A;  4M72 A;  3DTK A;  3K0L A;  1W0T A;  2PJR A;  3TO7 A;  3W2W A;  1BC8 C;  5J1R A;  3I4M J;  2F4I A;  3QPT A;  1TW2 A;  3OOP A;  2LRE A;  1FBQ A;  3K9T A;  3AL0 B;  2RV8 A;  2QKL B;  2K86 A;  3GBG A;  2VQL A;  4GXO A;  1HDP A;  1YX3 A;  5JHU A;  4Z2Y A;  1GHC A;  4BAY A;  3KFW X;  5F08 A;  3WTW C;  2F5F A;  3DEE A;  4RAF A;  2NVY J;  5JLW A;  4E7I A;  2MLK A;  3TP3 A;  4A2U A;  4FHT A;  2Y30 A;  3HOX J;  3HPH A;  4KIB A;  3BJ6 A;  4X1E A;  2ZFW A;  2VXZ A;  4AID A;  3OIP A;  4MFD A;  1O7F A;  3FBI B;  3LQR A;  1SAU A;  3DXJ F;  3I64 A;  2OV7 A;  4Y13 A;  4AVP A;  2ZJR F;  3ABL H;  5HLH A;  3C2B A;  1VQ9 I;  2KJB A;  1F43 A;  1UHM A;  4CZZ A;  4C3I J;  1IW7 F;  1XMX A;  4EJO A;  1VFC A;  3J7Y J;  4X0G A;  2HOT A;  3GTO J;  4YII A;  5M5Y J;  4Y33 A;  1WGX A;  1R00 A;  2A6T A;  5FB2 A;  1CF7 B;  1M1E B;  3Q0V A;  2K9S A;  2ECB A;  3R6S A;  3KIO A;  4A3K J;  4XKC A;  4A3I J;  1S72 I;  2JZY A;  2XB0 X;  3OYJ A;  5L3D A;  2O5R A;  2AXT C;  3CCY A;  1FTZ A;  1DUX C;  3OR1 C;  3IRQ A;  4YIF A;  1GV2 A;  2O0Y A;  4PGH A;  1D0Y A;  1JGG A;  1ZLK A;  4PFO A;  5CLS A;  3H9J A;  1O4X A;  1KGS A;  1UEL B;  4RAZ A;  5J6X A;  2F48 A;  3CCR I;  3ZMU A;  3CUQ B;  1S7A A;  4AM3 A;  3AAF A;  1FPQ A;  4DJA A;  4ZDL A;  4CCN A;  4A3F J;  2XGE A;  2EQR A;  3OOU A;  1JUP A;  2QVO A;  2ZJQ F;  2F4M B;  2XV4 S;  3OS0 A;  3HKZ N;  4BU2 A;  5EG0 A;  5EZG A;  2M0C A;  3I56 I;  4BNC A;  2R7X A;  4XON A;  4MTD A;  2DA5 A;  4EJW A;  2K9L A;  3LSR A;  1E2X A;  5E79 C;  4KN4 X;  1MDM A;  1X1C A;  2BGC A;  1MW7 A;  2A6H F;  1RES A;  1U5T C;  2IEK A;  1Z7U A;  3QYB A;  4PJN A;  1ZRF A;  3G3Z A;  1WJ5 A;  3GTQ J;  3U21 A;  1IXR C;  3JRG A;  3ESW B;  2A68 F;  3GW2 A;  2FNA A;  2CQK A;  4L18 B;  2A5W A;  2BY2 A;  2R7O A;  5CYV A;  3VFZ A;  2VIX A;  4NHJ A;  5L3G A;  1H9G A;  1YO5 C;  2STW A;  2HTJ A;  1XB4 A;  3M7G A;  3K10 A;  2M7B A;  1AU7 A;  3MZH A;  2L7M P;  5EEH A;  4RB3 C;  2UUZ A;  4LMY A;  4UB6 C;  3LSP A;  1JUS A;  2XAF A;  1EKE A;  4O5V A;  2LRD A;  2CW0 F;  3CES A;  4BJT A;  4D5F A;  5E20 A;  5KHD A;  3OSF A;  4ASN A;  2RQQ A;  4N9H A;  4BJ6 C;  2HOS A;  2JVG A;  1ZAO A;  1OCT C;  2WAQ A;  5JVT A;  5D5W B;  1UMQ A;  3FKJ A;  2ZSI B;  4D9J A;  1AKH A;  2CWE A;  5HLT A;  5LBQ A;  3CC2 I;  1QRY A;  1D1A A;  5GAD J;  1SC7 A;  5DV5 A;  3HOV J;  3L2V A;  4E6K G;  2IPQ X;  3DU6 A;  2LKP A;  2WY7 Q;  4YFK F;  1S7E A;  2CUE A;  3WTU C;  3EYY A;  2NVU B;  4DIQ A;  4EV0 A;  3FX3 A;  3GYH X;  1HW5 A;  5F6F A;  5FFX A;  1FJL A;  1YS7 A;  3H35 A;  4MHG A;  3R0A A;  3QAH A;  1FC3 A;  4HYE A;  2W24 A;  5DCM B;  5J8C A;  2EPF A;  2LKS A;  1ZRD A;  2H6C A;  1P4X A;  1V4R A;  4HV5 A;  1Z91 A;  3U9G A;  3ZR8 X;  1ON1 A;  1XDU A;  2DPD A;  2R7U A;  2LG4 A;  2JT1 A;  5LGT A;  3BLY A;  1X58 A;  1HSJ A;  4I2O A;  4MGR A;  1I3Q J;  3QYF A;  4PJJ A;  2OU2 A;  1BL0 A;  2HTS A;  5GPC A;  1ITY A;  2E60 A;  1OCO H;  2DCE A;  2L5Q A;  1U9N A;  1RET A;  1V5E A;  4RGS A;  2GQQ A;  2I10 A;  5EYR A;  1U78 A;  2R5Z A;  3GZN B;  3IAS 2;  1FMV A;  2XIG A;  1NK3 P;  2YX4 A;  1BI0 A;  2QWW A;  2V6C A;  2QF7 A;  3IV5 A;  4K2E A;  4OMY A;  3RKQ A;  1Y56 A;  3HL2 A;  3I9V 2;  1LFB A;  5IY5 H;  2A5Y B;  1I5Z A;  2Y75 A;  1F4K A;  5LLQ A;  2A61 A;  2X6X A;  3ZPL A;  1G2H A;  3M1C A;  1HLV A;  4Y3O A;  1O3R A;  4BGD A;  3S32 A;  2QQA A;  3L00 A;  4CCJ A;  3E6D A;  2EZH A;  5LEJ A;  3VOE A;  4C3H J;  1OQY A;  4ZDO A;  3VOD A;  3SJM A;  4HNV A;  4BBS J;  3T5X A;  5HNH A;  1W5T A;  2HQA A;  5D5V B;  4LD5 A;  4M3G A;  2HQN A;  3IP4 B;  5D8K B;  2JJ7 A;  2QGU A;  2RQP A;  4DZP A;  1Z1D A;  3LST A;  1FOY A;  4B8X A;  3DLL F;  3QP5 A;  5LHG A;  2P7V B;  1S5L C;  1ETO A;  1VQM I;  4EAT A;  3K4J A;  2DOD A;  4ENM A;  2JA8 J;  1I6X A;  2M1B A;  1D8K A;  2P4W A;  1JUM A;  3EYI A;  3A1Y A;  1LUJ B;  2UZK A;  2VUM J;  3ZMV A;  3K70 C;  3Q0W A;  4IZZ A;  4G7O F;  4AD9 A;  5E3L A;  2E1N A;  2RVC A;  4JX6 A;  5HNF A;  4WF2 A;  3SZT A;  1YIJ I;  2HDC A;  4XLN F;  4UY8 I;  2XPU A;  3U1K A;  4M9X A;  1F5T A;  3ABU A;  2R7F A;  4DNC A;  1JKP C;  3N97 A;  1Y8R B;  4B4C A;  1UHW A;  2WAF A;  3MEX A;  4CA0 A;  2HZT A;  3GTP J;  3JSO A;  2LLK A;  2GIZ A;  3V8L A;  3ZQ7 A;  1RPW A;  5LRS A;  3GTG J;  4B09 A;  1IV8 A;  1MGT A;  4EM1 A;  2PJP A;  1YJN I;  3SDB A;  2ZME B;  4HZF A;  3TO9 A;  4LLN A;  1WI3 A;  3B6A A;  3S1R J;  5J47 A;  2W4S A;  1RR8 C;  2AQE A;  2DT5 A;  3F72 A;  2LSO A;  2NS0 A;  3G1M A;  3GXO A;  4J19 A;  1U0J A;  1YTY A;  1JT0 A;  4G7H F;  4W1U A;  3ZQC A;  1XGN A;  2HXI A;  2NYX A;  2YUS A;  4PK4 A;  2HR3 A;  2CS3 A;  2E2J J;  5FD5 A;  3FMR A;  1R36 A;  1Z21 A;  2E2I J;  3HM5 A;  1WI9 A;  1Z6T A;  3OYI A;  4IOC F;  5E1W A;  2IVM A;  2RDP A;  1RR7 A;  3KP3 A;  1TW3 A;  3K2Z A;  2BOL A;  3OMY A;  4LK1 F;  4GDF A;  1R5I D;  4LK0 F;  4MEY F;  4KYW A;  3VYU B;  2CYY A;  2Z16 A;  3IAM 2;  3CJR B;  2ZXI A;  2VN2 A;  2IGN A;  1X19 A;  4OMZ A;  1K4S A;  1XTA A;  4KIT B;  3PNT A;  3TOB A;  3SHF A;  3ERM A;  4A3J J;  2HI3 A;  4DYR A;  2X51 A;  1PP7 U;  3REO A;  4IHV A;  3JRD A;  1B1B A;  2F5E A;  5HLG A;  4D7N A;  2X1E A;  1FYL A;  3J81 Z;  4YRV A;  1WPK A;  3A0H C;  3AG4 H;  4G94 A;  3H5R A;  1ETY A;  3RKX A;  4M6Y A;  3GTK J;  3HHG A;  3JRH A;  4A3G J;  2DOF A;  1ZAR A;  3WTV C;  2EIL H;  3UR3 C;  2E5Z A;  5E3O A;  5FD6 A;  4D5C A;  1T39 A;  3OYG A;  2XGD A;  2M8G X;  3L7W A;  1WVR A;  3S17 J;  4I99 C;  4IHY A;  4XLF A;  4XKB A;  2R5Y A;  1XS9 A;  4AVZ A;  1QVT A;  2ICW G;  1IXS B;  1UJ8 A;  4E7L A;  1Z3Y A;  4BAC A;  1Z05 A;  1KON A;  2VJ4 A;  4XQF A;  5HVQ C;  2EFN A;  5ED4 A;  5A2Q Z;  4PJL A;  1B9M A;  4BS9 A;  2F2E A;  2FA5 A;  3RJP A;  2BY1 A;  2W85 A;  3G73 A;  3PFY A;  4M3E A;  1USS A;  5DM7 F;  4DYC A;  3FXJ A;  1A04 A;  4PCQ A;  2O9L A;  1EH6 A;  1R4M B;  4U0Y A;  1N77 A;  3GZ5 A;  3I55 I;  2KRH A;  1T33 A;  3CMM A;  2OUM A;  3LSH A;  3ZQG A;  2ZXH A;  5KAF C;  4XLH A;  2R7Z J;  1MBH A;  2WTE A;  1UG2 A;  1IN4 A;  4OAZ A;  1W7P B;  2W84 A;  3L2R A;  2JUG A;  2OCC H;  1RRJ A;  1J59 A;  1ETQ A;  1KQ0 A;  2XF5 A;  3D0S A;  1D1C A;  1KU2 A;  4BEH A;  2BXZ A;  3H0D A;  1FLI A;  2QSG X;  5FKK A;  5KAI C;  5FLV A;  3LSI A;  2BEO A;  2LY9 A;  2MD0 A;  2Z3Y A;  3KZY A;  3WOD F;  5KNL A;  3CUQ A;  4WK8 F;  2R7T A;  5J40 A;  2WBM A;  1X2M A;  2H8W A;  2VKE A;  4XOP A;  4MQ9 F;  4NQW B;  1T8I A;  2ZJP F;  1R4N B;  1IN8 A;  2OQG A;  4XM3 A;  3JRI A;  1DQU A;  1EV7 A;  2OTL I;  3GTM J;  3ULQ B;  1ETW A;  4BXF A;  1KU3 A;  1AWC A;  1F9N A;  1MD0 A;  4R8H A;  1SMY F;  2JA6 J;  2L4A A;  2A05 A;  3HRT A;  3BG7 A;  3FK6 A;  4V2G A;  4Y52 J;  5B1B H;  4M71 A;  2FBH A;  1L0O C;  2H94 A;  4U88 A;  1G3Y A;  4YFX F;  2VKV A;  3BC8 A;  4RB1 A;  3H9Q A;  3JTG A;  3M1E A;  4NB5 A;  4G7Z F;  3GTJ J;  1ZH5 A;  1J75 A;  1QU3 A;  1LEA A;  1YI2 I;  2WY8 Q;  4QSH A;  5DEQ A;  2GXG A;  5GTI C;  4ENK A;  5GP9 A;  1E3P A;  3KP4 A;  4XNF A;  3S3O A;  1YFH A;  3CC7 I;  1G4D A;  1MJ9 A;  1OCC H;  1JHH A;  3MKY B;  3MZ8 A;  2DDB A;  2CG4 A;  3ZGK A;  4D1Q A;  2Z33 A;  2RN7 A;  1SVM A;  4GYI A;  3S1Q J;  3BG9 A;  2PI0 A;  4OU0 A;  4KDP A;  2EV5 A;  2XAS A;  1WRJ A;  2QA4 I;  2JA7 J;  1TT5 B;  3RQI A;  4DQ2 A;  4QWQ A;  2CW7 A;  4P9F A;  5J1U A;  4E70 A;  2HU9 A;  3PNY A;  1Q1V A;  2FBI A;  4Y15 A;  3OYH A;  2O7O A;  4AUX A;  1FP2 A;  5D5U B;  3W6V A;  1IN6 A;  1ETX A;  2Y31 A;  1KQ8 A;  3V7C A;  4ZZL A;  2FMY A;  2MSY A;  4FET A;  3I71 A;  4XSX F;  3CCE I;  2E1C A;  2NVT J;  4HF1 A;  4ESB A;  1SFX A;  5DDG A;  2DFH A;  1JE8 A;  4C30 A;  4WWC A;  2VQC A;  3ZXS A;  5BOX A;  1DPU A;  2CSO A;  2K7L A;  2E7W A;  3K69 A;  3RYP A;  4A6E A;  2M45 A;  2HVS A;  3T1B A;  1W7P D;  2HZD A;  5LHH A;  5E17 F;  2FJ1 A;  5L3B A;  3C1D A;  1X3W B;  2RKH A;  2BW3 A;  1KU7 A;  4YFN F;  3J7A Y;  4BDY A;  3MZY A;  4IX7 A;  2Y0S A;  2IGO A;  2MH2 A;  3WGH A;  2GOM A;  3RIR A;  1UCR A;  3O6B B;  4HQE A;  4ENJ A;  4XSZ F;  1X1D A;  1U8R A;  4IL6 C;  1H8A C;  3IH4 A;  4CCK A;  5EDN A;  1OKR A;  1PDN C;  1DU0 A;  4AU7 A;  2VBZ A;  4LJZ F;  2FE3 A;  2ZFU A;  1VQ4 I;  4KJZ A;  3S15 J;  2V4J C;  2CV2 A;  2XPV A;  5D5X B;  3DEU A;  1IN7 A;  4A3E J;  3S8P A;  5IPA A;  3A01 A;  3WG9 A;  2QBY A;  5K7H A;  1PUE E;  1GLN A;  3DPT A;  1RI7 A;  4LG0 A;  2MH9 A;  2VAS A;  2DA3 A;  2VC1 A;  2D1H A;  1ZR2 A;  2MYS A;  3CUO A;  2CQX A;  4A0Y A;  3VEP A;  1UG0 A;  2CFX A;  3F23 A;  1ZHF A;  3MKL A;  3CTA A;  1W1W E;  3OS2 A;  1PP8 F;  3EUA A;  1MMN A;  4BBR J;  3CCV I;  1VQP I;  4S0H B;  5IT9 K;  2V9V A;  5K7Z A;  3ASO H;  3ASN H;  1HST A;  3BR2 A;  3FMQ A;  4IVN A;  2ACJ A;  4MLO A;  2XB5 A;  3T0Y A;  2CJJ A;  2CUF A;  2PMZ N;  2YSR A;  3LL7 A;  4F91 B;  3FDY A;  3F0C A;  3FBN B;  2K3P A;  4ZTJ A;  3CJN A;  2FF4 A;  2DLL A;  2BHY A;  4BJ5 C;  4MQV A;  2HVQ A;  5K5Q A;  3E97 A;  1LB2 A;  5DTD A;  1ZRC A;  3ZQF A;  3E5Q A;  3VPR A;  2PMH A;  1YW9 A;  1EF4 A;  3F6O A;  2K02 A;  5E3N A;  4W97 A;  2MC3 A;  2YPR A;  5M5X J;  2NAZ A;  3ZP5 A;  1VQN I;  4A5N A;  3FF5 A;  3BG3 A;  1S7O A;  2DBB A;  3DKX A;  4Q5S F;  1LVA A;  4BY1 J;  2NNY A;  2RC4 A;  2R92 J;  2OA4 A;  2ZSH B;  2K9M A;  1REP C;  3F21 A;  1VTN C;  1W36 C;  1K61 A;  2OZ6 A;  2WA0 A;  3JSP A;  3QU3 A;  1XDS A;  4E7K A;  4RAY A;  3G1L A;  4HDU A;  4HA8 A;  2L0K A;  3GEZ A;  2VI6 A; 
#chains in the Genus database with same CATH homology
 1MZB A;  4LLL A;  1SFE A;  2DQR A;  5CVV A;  3U1D A;  3LAP A;  4AIK A;  3GZ6 A;  2KRF A;  3ZMT A;  3F8F A;  2BBY A;  4EMS A;  4MEX F;  4IHT A;  5JR3 A;  2J5P A;  1ON2 A;  5ICF A;  4ON0 A;  2UXN A;  1UST A;  2DK8 A;  1ONV A;  3F3X A;  2NNN A;  2P6T A;  3ZN1 A;  5FGM A;  4HBL A;  2W57 A;  2YX7 A;  4GYG A;  3HTS B;  3LFK A;  1TBX A;  1SAX A;  3GFJ A;  4ZZD A;  4OIN F;  3C18 A;  4IPA A;  3B73 A;  4P55 A;  1FWZ A;  5KVR A;  1K78 B;  3FMS A;  3OV8 A;  1HQC A;  1RIO H;  2DQL A;  3F8C A;  3WE2 A;  1QGP A;  1U5T B;  4A0Z A;  1SD6 A;  2XHK A;  5F64 A;  5FLX Z;  5K5R A;  2VE8 A;  3LAJ A;  2PFB A;  2ESN A;  1DPR A;  4JQF A;  4EM0 B;  4UXN A;  3R61 A;  4D0P A;  3FM3 A;  2XVC A;  3BZ6 A;  3MWM A;  3QU6 A;  3I59 B;  2VOO A;  1LDD A;  4G9Y A;  4UUV A;  1S29 A;  4XLP F;  3BJO A;  2EFW A;  4EJT A;  2QM3 A;  4IRG A;  4M9Z A;  4AIH A;  2FSW A;  3CO6 C;  4H0E A;  1C0W A;  3RDI A;  2LF8 A;  3QOP A;  4FX4 A;  1LDJ A;  3WTS C;  1WSU A;  5L3E A;  1QBJ A;  3O2P E;  1NHA A;  5E1X A;  1FX7 A;  4OIR F;  3LQQ A;  3RYR A;  2Y48 A;  4PZJ A;  1YW8 A;  1XMK A;  3EQL F;  2LDU A;  3DQV C;  5ICC A;  3N4M A;  1BN5 A;  1YLF A;  2PLY A;  4EQQ A;  3HIF A;  4KMU X;  4ZH4 F;  4YG2 F;  3I58 A;  3DPL C;  3P7N A;  1G3S A;  2VC0 A;  4BH9 A;  3KLO A;  2VE9 A;  4I09 A;  1BJA A;  2FXA A;  3P9K A;  3ZMS A;  1FSH A;  4HLX A;  4OOI A;  3KP7 A;  3HRS A;  1ZGA A;  2HS5 A;  1HKS A;  1YG2 A;  5L3F A;  4WCG A;  4O6J A;  3CLO A;  4R79 A;  2PEX A;  3MCZ A;  4I7H A;  1GVJ A;  2OQR A;  1GXP A;  3KP6 A;  4RGR A;  2VBW A;  3RPQ A;  3J80 Z;  1P6R A;  2HKO A;  3W6J B;  4LB5 A;  3U2R A;  1XN7 A;  3DKW A;  3HTU A;  1O3T A;  3KP2 A;  4L9J A;  5HOO A;  3BWG A;  3ZMZ A;  2QQ9 A;  1J9I A;  5ILU A;  3BP8 A;  4EGY A;  2A6E F;  1XSX A;  3WGI A;  1FBU A;  1FYK A;  2OBP A;  2HKX A;  3S2W A;  3IWF A;  1I27 A;  3K1N A;  1D5V A;  5LGU A;  3BJA A;  2FEZ A;  5H6R A;  3SQN A;  3KEQ A;  3VB2 A;  3T8R A;  1YYV A;  1TNT A;  1WWX A;  2Z5U A;  3PQJ A;  1SD7 A;  2RGV A;  4U7B A;  2XGX A;  1RNL A;  2QYO A;  1X3U A;  4ZYE A;  2D45 A;  1OYW A;  1IF1 A;  2L02 A;  2P5K A;  2UXX A;  3HHH A;  3T8T A;  1JHF A;  3GF2 A;  4CDG A;  4TV7 A;  1FYM A;  2DFI A;  3B02 A;  2UWM A;  3MAJ A;  2OAZ A;  3GX4 X;  2ZXJ A;  1F1Z A;  1KYW A;  1H9T A;  1RUO A;  4O3M A;  1LNW A;  4G6Q A;  4CXF A;  4HX8 A;  3GWZ A;  3JAM K;  4IJA A;  1W4M A;  2V1X A;  4L9T A;  4AWX B;  2QQB A;  3EET A;  3BOQ A;  4GGG A;  5HDN A;  1IZ1 A;  3IKT A;  2KJC A;  1U6G A;  4BHP A;  1IRF A;  2P5L C;  2BV6 A;  4LLG F;  3GLX A;  3JTH A;  3WGG A;  1MDM B;  5HDK A;  3GFM A;  2MD5 A;  3WTX C;  3NRV A;  1SMT A;  3WTT C;  3E5X A;  1J2X A;  4I0A A;  1QO0 D;  5LRR A;  3FXU A;  3BPX A;  3HSR A;  3LA2 A;  3TDU C;  5HDG A;  1L3L A;  3K1P A;  2JRT A;  1G3W A;  2PG4 A;  4RGU A;  2Q8K A;  4M9S A;  1CF7 A;  5CVI A;  2IJL A;  2DAO A;  1XCB A;  3KEO A;  2QUF A;  4HQM A;  3CO7 C;  3IWZ A;  4ZYG A;  1U2W A;  3H92 A;  2XRO A;  5BMZ A;  1BI3 A;  2IA1 A;  3O3K A;  5J8F A;  2VT2 A;  1K78 A;  3LA3 A;  2EA4 A;  1QPM A;  2O3F A;  4A5M A;  3C3W A;  2OD5 A;  5ICE A;  3EDP A;  1U5T A;  2QEN A;  3L9F A;  2HYF A;  2YR2 A;  2B0L A;  3HRM A;  3KZZ A;  4S05 A;  2FRH A;  4BXU A;  3L09 A;  2KIM A;  1XSD A;  4KIF A;  5FO5 A;  5BQT A;  5F1R A;  5ERI A;  3I59 A;  5DCF A;  2XAJ A;  2IA2 A;  5KK1 A;  2FBK A;  2EV6 A;  4L9N A;  3F6V A;  4FX0 A;  1P2F A;  4WXC A;  2MA3 A;  3MQ0 A;  1ZG3 A;  2WV0 A;  1ZG1 A;  3TO6 A;  4MNU A;  2MLG A;  1O7L A;  1BI2 A;  1MKM A;  4ZYD A;  2G7U A;  4P5O A;  4KIC A;  4KFC A;  3IKV A;  1KYZ A;  2GA1 A;  2FNP A;  2J5O A;  2D1V A;  2EFP A;  3HOT A;  2STT A;  1RZ4 A;  5DUK A;  1G6N A;  2ELH A;  4Q47 A;  4RGX A;  3IHU A;  2M87 A;  5DCM A;  3K1M A;  2KIU A;  4I01 A;  5BPI A;  1EH7 A;  4EM2 A;  1OPC A;  2HFH A;  1QQI A;  2FOK A;  3RI4 A;  1T98 A;  2IP2 A;  4HW0 A;  2WWY A;  2L01 A;  3R0J A;  1BI1 A;  1OYI A;  3JW4 A;  3COA C;  4UHT A;  1FSE A;  1I1G A;  5D4R A;  1TTY A;  4F7Z A;  2VON A;  1R5H A;  2BYV E;  1HKQ A;  1U3E M;  1BOA A;  2JPB A;  2LF7 A;  1LEB A;  2JTV A;  4L5I A;  2IRF G;  4HAM A;  1YW7 A;  2IA0 A;  4N0B A;  1R1T A;  4OIP F;  4HV6 A;  2Z9O A;  1ODD A;  3P9C A;  3ECO A;  1HKT A;  3E5U A;  1ULY A;  2DI3 A;  2P8T A;  1WQ2 A;  3WTY C;  2XAG A;  2FQ3 A;  2V79 A;  5CJ9 A;  1KU9 A;  3KCC A;  2GIV A;  3ABT A;  4I0B A;  4IRI A;  2VOP A;  4BYY A;  3I0T A;  4G8X A;  1TQP A;  5HS8 A;  3GUD A;  2XUB A;  4EVI A;  1JGS A;  2GAU A;  5LGN A;  4JK1 X;  3J7A O;  3P9I A;  4RB0 A;  3FXQ A;  3I4P A;  2QLZ A;  4CGZ A;  2ZME A;  4N9I A;  3ML6 A;  1FT9 A;  3J80 K;  4HF2 A;  3IRR A;  3TKY A;  2VBY A;  2A07 F;  3EUH A;  3LA7 A;  2HEO A;  1BIA A;  1S6L A;  4HX7 A;  3TQN A;  2ZCW A;  4R1H A;  1LDK B;  2EK5 A;  4FT8 A;  4MTE A;  3V7S A;  1FBS A;  2LNB A;  3PQK A;  5CVR A;  2PBI A;  1I1S A;  4ETS A;  4CYD A;  2EWN A;  2DK5 A;  2NRA C;  3BPV A;  3DV8 A;  3ZMD A;  2FU4 A;  4UV8 A;  1ZRE A;  3CUQ C;  3WU1 B;  2KKO A;  4KN7 X;  3HRU A;  1KA8 A;  2K27 A;  2DPU A;  1K7A A;  4OIO F;  2ESH A;  1T38 A;  1B9N A;  2VT3 A;  4BHB A;  5D8L B;  4I98 B;  3HUG A;  4EJU A;  2ETH A;  2FML A;  2CO5 A;  4ENN A;  5K5O A;  1ZN2 A;  2GWR A;  3GFI A;  3Q9V A;  1O57 A;  1Z9C A;  3DP7 A;  3HYI A;  2L54 A;  4HOB A;  1IAW A;  4CHU A;  4UVB A;  2G7H A;  1K6O A;  5CVU A;  3WU0 A;  5IT9 Z;  3HSF A;  3I53 A;  3M8F A;  4CIC A;  4EGZ A;  5ICG A;  2Z99 A;  3E3V A;  1W7P A;  1B6A A;  3Q9S A;  1FOK A;  5ILS A;  2DO7 A;  1P4W A;  1QZZ A;  2QZ8 A;  4L5J A;  4UNO A;  1J0R A;  5D4S A;  4IXA A;  1XMA A;  5TJJ A;  2AS5 F;  4NQW A;  5HLI A;  1QZY A;  1BC7 C;  2ZNY A;  4L9V A;  2PQ8 A;  3E6M A;  3FXR A;  1UB9 A;  1LJ9 A;  5JI6 A;  3J81 K;  1MJB A;  4I02 A;  1GXQ A;  1DP7 P;  4WXD A;  5E8G A;  4XRF A;  3WTZ A;  1T6S A;  3GFL A;  1WKM A;  1S3J A;  3FHZ A;  2IW5 A;  1D8J A;  2X0L A;  2D2W A;  1FY7 A;  2X4H A;  1XGM A;  1OMI A;  2C6Y A;  1TNS A;  2R3S A;  4PDK A;  2QBY B;  5A2Q K;  3V7R A;  4JBA A;  4LG0 B;  1ZG5 A;  5E8I A;  1ZGJ A;  1SFU A;  2ZKZ A;  4EJV A;  4LB6 B;  3FM5 A;  2A69 F;  2H09 A;  4HDV A;  3BDD A;  1E17 A;  2PN6 A;  2EA2 A;  3I5U A;  1AOY A;  3QP6 A;  1R7J A;  2XRN A;  5DYM A;  3E6B A;  5JFR A;  1T0F A;  5AON A;  3F8M A;  3RTR A;  2KIF A;  2H27 A;  3ECH A;  5HS9 A;  2EV0 A;  1HW1 A;  3GO5 A;  5ILV A;  3HSE A;  2ISZ A;  3QPH A;  2GXB A;  1R1V A;  2ISY A;  3KE2 A;  1YS6 A;  2DW4 A;  2HYG D;  4U7D A;  2H6B A;  4QLC U;  1EH8 A;  2JPC A;  2ZJ2 A;  4A12 A;  1OYY A;  4Y17 A;  5LEK A;  1STZ A;  3ZN0 A;  2F5D A;  2P5V A;  3E6C C;  1W5S A;  1ZLJ A;  2L4M A;  4WXH A;  4OIQ F;  6PAX A;  3TGN A;  3LWF A;  1T2K A;  2TDX A;  1RUN A;  4M6X A;  3SFZ A;  1J5Y A;  2V1U A;  5H20 A;  1Z6R A;  5AIQ A;  2HWV A;  3ERE D;  2M30 A;  3R4K A;  4AIJ A;  2JSC A;  1BIB A;  4P9U A;  3F22 A;  1XD7 A;  1R23 A;  2P6S A;  4KT5 C;  3RKW A;  5H6Q A;  3BRO A;  2VOD A;  5EEG A;  1SD5 A;  4UV9 A;  5DUI A;  1FZP B;  1O3Q A;  2EB7 A;  2YU3 A;  1R5G A;  2GA2 A;  1O3S A;  2HGC A;  4KUM A;  3DFG A;  5IT3 A;  2Y0M A;  3SZP A;  4P96 A;  4CO8 A;  1XGO A;  5D6E A;  1D3Y A;  4IRH A;  3F8N A;  1YIO A;  4BQA A;  4IF4 A;  2MBF A;  1CGP A;  1SD4 A;  3R60 A;  3ELK A;  2EFQ A;  2DU9 A;  2XKO A;  3TDZ C;  1IRG A;  3M9A A;  4L0Y B;  4S04 A;  4Q4Z F;  2M8E A;  4RS8 A;  2IT0 A;  4WX9 A;  2PMU A;  5L3C A;  1UFM A;  1G3T A;  4M73 A;  3H3U A;  1QNT A;  2GZW A;  3D5L A;  3V4G A;  1R1U A;  2G9W A;  3WE3 A;  3Q5F A;  5DD8 A;  1OR7 A;  1BBY A;  3IL2 A;  3FZV A;  4KA4 A;  2P7C B;  5TRD A;  1XGS A;  2CGP A;  4GCV A;  2W25 A;  3KP5 A;  4ESF A;  4LFU A;  2OZU A;  2V1D A;  3V8K A;  2A3S A;  2WC2 A;  1IN5 A;  1R22 A;  1DDN A;  1ZYR F;  1FP1 D;  4XBF A;  4HF0 A;  2XAH A;  5E18 F;  3FWE A;  4ZYH A;  2XAQ A;  3ISP A;  2O61 A;  2EJR A;  3KLN A;  1LQ1 A;  1P92 A;  1JXS A;  4KMF A;  3KET A;  2EFO A;  2F5C A;  1S8N A;  1YQA A;  2K4B A;  4U0V A;  2L3D A;  1HW2 A;  2RNJ A;  4KIG A;  4ESJ A;  3H3Z A;  3I54 A;  2E7X A;  2BE5 F;  2R7D A;  3NEU A;  3BY6 A;  3DF8 A;  4UVC A;  1KQ9 A;  2VBX A;  5D6F A;  1XSV A;  2O8X A;  2M5W A;  1H0M A;  3HOS A;  5DD4 A;  2ZBK A;  1FNN A;  1R58 A;  1BM9 A;  5BS6 A;  5AIP A;  2HOE A;  4Q48 A;  4HLY A;  4U0W A;  3RKY A;  4G6D A;  5BPD A;  1IXC A;  4UVA A;  3JAM Z;  5FLX K;  3TOA A;  2O03 A;  3ROU A;  4LGW A;  2O6G E;  4RB2 C;  3PFI A;  2XKP A;  4GO1 A;  1TLH B;  1Y0U A;  1HBX G;  5FFZ A;  3NQO A;  2K4J A;  1HXD A;  5LHI A;  4BHC A;  1P4A A;  5K1Y A;  1K79 A;  1TQI A;  1MJA A;  3C7J A;  3V8J A;  5E1Z B;  3W6K B;  2COM A;  2ZO4 A;  1V3F A;  2Q2E A;  4HX4 A;  2HQR A;  2ADU A;  3GVA A;  2ZNZ A;  3L2C A;  1XCV A;  5CVJ A;  4A0X A;  5HS7 A;  4L0Z B;  1B4A A;  4PGG A;  3SXY A;  1Q1H A;  4A6D A;  4KNY A;  1IUY A;  3M8E A;  3F8B A;  2AXL A;  3QRF F;  1J7K A;  2DTR A;  4M74 A;  4IHS A;  3IC7 A;  3MFK A;  3CDH A;  3RPU A;  1B59 A;  2Q0O A;  1TQM A;  4M72 A;  3K0L A;  3TO7 A;  1BC8 C;  3QPT A;  1TW2 A;  3OOP A;  1FBQ A;  3K9T A;  2RV8 A;  2K86 A;  4GXO A;  5JHU A;  4Z2Y A;  1GHC A;  4BAY A;  3KFW X;  3WTW C;  2F5F A;  2MLK A;  4A2U A;  4FHT A;  4KIB A;  3BJ6 A;  2ZFW A;  2VXZ A;  1O7F A;  3LQR A;  3DXJ F;  3I64 A;  4Y13 A;  4AVP A;  5HLH A;  2KJB A;  1UHM A;  4CZZ A;  1IW7 F;  4EJO A;  4YII A;  1R00 A;  5FB2 A;  1CF7 B;  3R6S A;  2JZY A;  5L3D A;  1DUX C;  3IRQ A;  4YIF A;  2O0Y A;  4PGH A;  1ZLK A;  5CLS A;  1KGS A;  4RAZ A;  5J6X A;  3ZMU A;  3CUQ B;  1S7A A;  3AAF A;  1FPQ A;  2QVO A;  2XV4 S;  4BNC A;  4MTD A;  4EJW A;  1E2X A;  4KN4 X;  1MDM A;  2BGC A;  2A6H F;  1U5T C;  1Z7U A;  1ZRF A;  3G3Z A;  1IXR C;  2A68 F;  3GW2 A;  2FNA A;  2CQK A;  4L18 B;  5CYV A;  3VFZ A;  4NHJ A;  5L3G A;  1H9G A;  1YO5 C;  2STW A;  2HTJ A;  1XB4 A;  3M7G A;  3MZH A;  5EEH A;  4RB3 C;  4LMY A;  2XAF A;  4O5V A;  2CW0 F;  5E20 A;  4ASN A;  4N9H A;  1ZAO A;  5JVT A;  5D5W B;  2CWE A;  5LBQ A;  5DV5 A;  2IPQ X;  2LKP A;  4YFK F;  3WTU C;  3EYY A;  4EV0 A;  3FX3 A;  3GYH X;  1HW5 A;  5F6F A;  5FFX A;  1YS7 A;  4MHG A;  3R0A A;  3QAH A;  1FC3 A;  4HYE A;  2W24 A;  5DCM B;  5J8C A;  1ZRD A;  2H6C A;  1P4X A;  1V4R A;  4HV5 A;  1Z91 A;  3U9G A;  1ON1 A;  1XDU A;  2DPD A;  2JT1 A;  5LGT A;  1HSJ A;  4I2O A;  4MGR A;  2OU2 A;  2HTS A;  4RGS A;  2GQQ A;  1U78 A;  2XIG A;  2YX4 A;  1BI0 A;  2QWW A;  2V6C A;  4K2E A;  4OMY A;  2A5Y B;  1I5Z A;  2Y75 A;  1F4K A;  5LLQ A;  2A61 A;  3ZPL A;  1O3R A;  2QQA A;  3L00 A;  3E6D A;  5LEJ A;  3VOE A;  3VOD A;  3T5X A;  1W5T A;  5D5V B;  4LD5 A;  2HQN A;  5D8K B;  2RQP A;  1Z1D A;  3LST A;  4B8X A;  3QP5 A;  5LHG A;  2P7V B;  4ENM A;  1I6X A;  2M1B A;  1D8K A;  2P4W A;  3EYI A;  2UZK A;  3ZMV A;  4G7O F;  4AD9 A;  2E1N A;  2RVC A;  4WF2 A;  3SZT A;  2HDC A;  4XLN F;  4M9X A;  1F5T A;  3ABU A;  2R7F A;  4DNC A;  3N97 A;  1UHW A;  3MEX A;  2HZT A;  3JSO A;  3V8L A;  3ZQ7 A;  5LRS A;  4B09 A;  1MGT A;  4EM1 A;  2PJP A;  2ZME B;  4HZF A;  3TO9 A;  4LLN A;  3F72 A;  2DT5 A;  2LSO A;  2NS0 A;  3GXO A;  1YTY A;  4G7H F;  1XGN A;  2NYX A;  2HR3 A;  5FD5 A;  3FMR A;  1R36 A;  1WI9 A;  1Z6T A;  5E1W A;  2IVM A;  2RDP A;  3KP3 A;  1TW3 A;  3K2Z A;  4LK1 F;  4LK0 F;  4MEY F;  4KYW A;  2CYY A;  2VN2 A;  4OMZ A;  3TOB A;  3SHF A;  1PP7 U;  3REO A;  1B1B A;  2F5E A;  5HLG A;  1FYL A;  3J81 Z;  4G94 A;  3RKX A;  4M6Y A;  3HHG A;  1ZAR A;  3WTV C;  5FD6 A;  1T39 A;  3L7W A;  1IXS B;  1Z05 A;  5HVQ C;  2EFN A;  5ED4 A;  5A2Q Z;  1B9M A;  2F2E A;  2FA5 A;  3RJP A;  2W85 A;  3G73 A;  1USS A;  1A04 A;  4PCQ A;  1EH6 A;  4U0Y A;  3GZ5 A;  2WTE A;  1IN4 A;  1W7P B;  2W84 A;  1J59 A;  1KQ0 A;  3D0S A;  1KU2 A;  1FLI A;  2BEO A;  3WOD F;  2Z3Y A;  3KZY A;  4WK8 F;  3CUQ A;  4MQ9 F;  1IN8 A;  2OQG A;  1EV7 A;  3ULQ B;  1KU3 A;  1AWC A;  1F9N A;  1MD0 A;  4R8H A;  1SMY F;  2L4A A;  3HRT A;  4M71 A;  2FBH A;  1L0O C;  2H94 A;  4U88 A;  1G3Y A;  4YFX F;  4RB1 A;  3JTG A;  3M1E A;  4NB5 A;  4G7Z F;  1ZH5 A;  1J75 A;  1LEA A;  5DEQ A;  2GXG A;  4ENK A;  3KP4 A;  1YFH A;  1G4D A;  1MJ9 A;  1JHH A;  2CG4 A;  2Z33 A;  2RN7 A;  4GYI A;  2PI0 A;  4OU0 A;  4KDP A;  2EV5 A;  2XAS A;  1WRJ A;  4DQ2 A;  4QWQ A;  4P9F A;  4E70 A;  2FBI A;  4Y15 A;  1FP2 A;  5D5U B;  1IN6 A;  1KQ8 A;  3V7C A;  4ZZL A;  2FMY A;  3I71 A;  4XSX F;  2E1C A;  4HF1 A;  4ESB A;  1SFX A;  5DDG A;  1JE8 A;  4WWC A;  5BOX A;  1DPU A;  2CSO A;  2K7L A;  2E7W A;  3K69 A;  3RYP A;  4A6E A;  2M45 A;  3T1B A;  1W7P D;  5LHH A;  5E17 F;  5L3B A;  3C1D A;  2RKH A;  1KU7 A;  4YFN F;  3MZY A;  2MH2 A;  3WGH A;  3RIR A;  1UCR A;  3O6B B;  4HQE A;  4ENJ A;  4XSZ F;  1U8R A;  1OKR A;  1PDN C;  2VBZ A;  4LJZ F;  2FE3 A;  5D5X B;  3DEU A;  1IN7 A;  3WG9 A;  2QBY A;  1PUE E;  3DPT A;  1RI7 A;  4LG0 A;  2MH9 A;  2VC1 A;  2D1H A;  3CUO A;  4A0Y A;  3VEP A;  2CFX A;  3F23 A;  1ZHF A;  3CTA A;  1PP8 F;  5IT9 K;  2V9V A;  1HST A;  3FMQ A;  4IVN A;  2ACJ A;  3T0Y A;  2YSR A;  3CJN A;  2FF4 A;  2DLL A;  4MQV A;  5K5Q A;  3E97 A;  1LB2 A;  1ZRC A;  3E5Q A;  2PMH A;  1YW9 A;  3F6O A;  2K02 A;  2MC3 A;  2YPR A;  2NAZ A;  3ZP5 A;  4A5N A;  3FF5 A;  1S7O A;  2DBB A;  4Q5S F;  1LVA A;  2NNY A;  2RC4 A;  2OA4 A;  1REP C;  3F21 A;  1VTN C;  2OZ6 A;  3JSP A;  3QU3 A;  1XDS A;  4RAY A;  4HDU A;  4HA8 A;  3GEZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...