5DCMA

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
b'ELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQDPN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PhoB family transcriptional regulator
publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmA00
4Y15A 2MH2A 3VOEA 5LHHA 2UXNA 2IT0A 3DF8A 2L54A 2PLYA 1ZREA 1QZYA 2KJBA 1R00A 1SD5A 1MZBA 1YTYA 2QQ9A 2EB7A 4WCGA 3DV8A 2QBYB 2STTA 1FBQA 2V1XA 1SAXA 3NRVA 4M9XA 4PZJA 2D1VA 2DBBA 2D2WA 1U78A 1REPC 2M87A 4HLYA 3W6JB 2MA3A 2A07F 4M74A 3E6DA 2XAGA 3FX3A 4IHTA 2RDPA 2PFBA 2KKOA 1RIOH 4M6XA 3WE3A 5CJ9A 1DPUA 3HHGA 1UB9A 1G3SA 4OINF 5L3BA 4G6DA 2NAZA 3O6BB 1U3EM 1PDNC 2V79A 3ZQ7A 1TQPA 4IPAA 1XCVA 4XBFA 4LLNA 4HW0A 5E8IA 3W6KB 1UFMA 3CUQB 3VODA 1ZGAA 2FOKA 1HQCA 3J80Z 1T6SA 3JAMZ 4CZZA 2RNJA 3M8FA 3M8EA 3HRTA 3IWZA 2H09A 2VONA 3WTYC 1FWZA 3IHUA 3LA3A 1FSHA 4RB0A 3U9GA 2QZ8A 4AVPA 2DPUA 4GXOA 4IRIA 3M9AA 4MHGA 3ULQB 4U0VA 4M9SA 3BJAA 3L9FA 1GHCA 3I64A 1I6XA 4OU0A 3GW2A 1ZAOA 4EV0A 4LK0F 2LNBA 5HDGA 1ZG3A 4AIKA 2EFQA 3V7CA 4OOIA 1XSDA 1J7KA 2ZXJA 1BC8C 5D8KB 5A2QK 1KU2A 2VT2A 5K5QA 1YFHA 1R23A 1B6AA 2H6BA 5DCMB 1JE8A 2XAJA 5EEGA 1BIBA 4O5VA 4ETSA 4BH9A 4LK1F 2VBYA 4YIFA 2OZ6A 4IRHA 3V4GA 4ZYEA 3BWGA 4ESFA 1KU3A 2LDUA 2XROA 2DFIA 1IXCA 4LGWA 3MQ0A 4RS8A 2J5OA 4KYWA 3G73A 1B59A 2DO7A 5D6FA 1MGTA 5FB2A 3LA2A 1HKTA 2X0LA 2L02A 3K1MA 3QP5A 4KMUX 4LB5A 4OIPF 3ECHA 3DPLC 4RGRA 1K78B 3PQJA 2EFNA 2FBIA 3TDZC 1I27A 5JI6A 2CQKA 3CUOA 5HS9A 3QP6A 1Q1HA 3F8CA 2QENA 2OZUA 4EQQA 3GZ5A 4MNUA 2O3FA 1FC3A 2JT1A 3ZMVA 1YIOA 1XD7A 2ZNYA 3KEQA 1K78A 4Q4ZF 3IC7A 5DCFA 3REOA 2OQGA 2STWA 1JHFA 4ESBA 3BPXA 1F5TA 1O7FA 3F8BA 1B1BA 2DW4A 4HA8A 3CTAA 2QM3A 3HUGA 1YO5C 5HS7A 2A6EF 4BAYA 3RYPA 2F5FA 3EYIA 1ZN2A 5F64A 4L9TA 1FYKA 1BI2A 4ZZDA 3E5QA 4BQAA 3DXJF 4MQVA 4QWQA 3J81Z 1LDJA 4LD5A 1U8RA 1FZPB 1H9TA 4K2EA 2HTJA 4YFKF 4HOBA 5BPDA 2HTSA 5J6XA 5ICFA 3V8LA 1ZH5A 2FMYA 3KP4A 4L18B 4EVIA 3F3XA 5K1YA 2FQ3A 5CVIA 3E5UA 3GUDA 1T0FA 5L3DA 1QPMA 3E6BA 5LHIA 4N9HA 1BBYA 1SD7A 2OAZA 4IRGA 2CFXA 2PEXA 5F1RA 4IXAA 5DV5A 2G7HA 1XSVA 3QRFF 2ISZA 3DPTA 1Z6TA 2FBKA 2O61A 2LF7A 2FA5A 4CYDA 1D3YA 5KVRA 4EM0B 4I7HA 3IWFA 5BS6A 3R0AA 4HQMA 5LHGA 2BEOA 3K0LA 3GFIA 2KIUA 1RZ4A 2D45A 2ZMEB 1R22A 2E1NA 3TO9A 3ECOA 4L9VA 2IVMA 2MH9A 3IKTA 4UVBA 3T5XA 3WTUC 4L0ZB 3BROA 2KJCA 2CG4A 5K5RA 4A6EA 4HQEA 4CICA 3FWEA 5ERIA 1OYWA 2PN6A 2VBXA 2R7DA 3U2RA 2Y75A 1S29A 2L4AA 1WSUA 3F8MA 5E20A 3SXYA 1TQIA 4TV7A 5D4SA 3K2ZA 2HEOA 2ESNA 2EA2A 1Z7UA 4GO1A 2JRTA 2P7CB 4KFCA 3LQRA 4G7OF 3I54A 4A2UA 3P9CA 4E70A 4I02A 3MFKA 1ON1A 1G3TA 2DU9A 2XHKA 3ZN0A 4L9JA 2PMHA 4A5NA 4UV8A 1G4DA 4BXUA 4I01A 2VE8A 2G7UA 1MD0A 3FXQA 4Y17A 3S2WA 4U0WA 3DP7A 3JSPA 3V7SA 2LKPA 4ENKA 3OOPA 3HRSA 4RGXA 3KZYA 5L3FA 5D5VB 2NRAC 1KQ9A 5ILSA 3F72A 3H3ZA 2XKPA 3ROUA 4CGZA 1FNNA 4MGRA 4EJTA 2M45A 1Z91A 2HYGD 3WE2A 5K5OA 2DI3A 4MEYF 3HOTA 5DD8A 1HKSA 2FNAA 1P92A 2QVOA 4A12A 4XSZF 4I09A 3WTTC 1W7PB 2V1DA 3ELKA 4RAZA 5CLSA 4EJUA 4YIIA 3TO6A 5CVUA 1UHWA 3EUHA 3TOBA 4N9IA 4AIHA 2TDXA 3HHHA 4EM1A 1D5VA 3U1DA 1J2XA 2QYOA 1KQ0A 4HZFA 2X4HA 2GXBA 4ON0A 1OYYA 1HW5A 4WXDA 3SZTA 1IZ1A 2XRNA 1K7AA 2ELHA 2HGCA 3R0JA 1W7PD 2YX7A 2ZJ2A 5H20A 3F6OA 2GA1A 5IT9Z 4EJVA 4WWCA 3FM5A 3MWMA 1EH8A 3TO7A 4I0BA 3WGIA 1AOYA 4WK8F 1Z6RA 2HQNA 1XMKA 4G8XA 2QUFA 2FNPA 4RB1A 1FP1D 2L01A 2ZBKA 4U7DA 2EA4A 3JTGA 1R1TA 5H6RA 3EYYA 4XRFA 1BI0A 2BYVE 1L3LA 1O3SA 4EJOA 4WX9A 3V7RA 1ZGJA 4MQ9F 2WV0A 5ICCA 3WGGA 4ZYGA 3I0TA 1O3TA 2B0LA 4KN4X 1FP2A 2DPDA 3DKWA 3BJ6A 3CUQC 2IP2A 2VXZA 2V1UA 4Y13A 3FF5A 4QLCU 1ZHFA 4ENNA 4GGGA 2PI0A 3GFMA 3QPTA 1BJAA 2OQRA 1U5TB 1P4XA 3KP2A 3I71A 1O7LA 4KICA 1IN7A 2A68F 3GF2A 4RAYA 2DAOA 2F5CA 2HYFA 2QBYA 2L4MA 4UXNA 2YPRA 3WTXC 4LB6B 2NS0A 4XLNF 2ZCWA 4BNCA 1ODDA 3O3KA 1SFXA 5D5UB 5JFRA 3ML6A 3RKXA 3PQKA 2GQQA 2P6SA 3D5LA 5JR3A 4HYEA 3GVAA 4A6DA 1UHMA 5HOOA 3SQNA 2OA4A 4KMFA 1R58A 1TQMA 2CYYA 3EQLF 4U0YA 2RKHA 4R1HA 4ESJA 3CUQA 3FHZA 1ULYA 1JGSA 4ZYHA 3COAC 5HDKA 1HSTA 5L3CA 1BI1A 5J8CA 3WGHA 3BOQA 3JSOA 1R36A 3P7NA 5FD5A 3WU1B 4WXCA 5AIQA 2E1CA 5ILVA 2P8TA 2UZKA 4MEXF 1QO0D 4KN7X 3HIFA 3LQQA 3E5XA 3RJPA 4HX7A 4ZH4F 4LG0B 3ZPLA 3WG9A 4UVCA 1RNLA 5FFXA 2MLKA 1T38A 2VOOA 4G7HF 1YQAA 3ZMUA 1XSXA 1IXSB 2ACJA 4LG0A 5DCMA 1TW3A 3LWFA 2K86A 3F22A 1OMIA 1V3FA 2JSCA 3I4PA 2FRHA 1L0OC 3SHFA 1WKMA 1SMYF 4GCVA 4I0AA 3NQOA 3RDIA 3BP8A 4A5MA 3E6CC 5BOXA 5A2QZ 1FPQA 2W84A 4UUVA 5ILUA 4H0EA 1XDUA 4I98B 3I53A 2EV6A 2FXAA 3JTHA 4MTEA 2Z9OA 2IA0A 3FM3A 1CGPA 1GXPA 2QLZA 2DT5A 4JQFA 4RGSA 3SZPA 1FX7A 2IA2A 4ASNA 3LFKA 2DK5A 5AIPA 1MJ9A 5DUKA 5FGMA 1B9NA 5L3EA 1MKMA 1FSEA 1XGNA 3KCCA 2GWRA 2HOEA 4AIJA 1BI3A 2R3SA 4HV6A 3F6VA 3C7JA 2GAUA 1DUXC 1IUYA 1TW2A 3GWZA 3HSFA 3HRMA 1C0WA 4DQ2A 1TTYA 1S3JA 2DQLA 3VFZA 2VT3A 4I2OA 1IN5A 4BHCA 2VBZA 1Z05A 5KK1A 2GA2A 1J9IA 1H0MA 1R1VA 2XKOA 3T8RA 1A04A 4G94A 3Q9SA 3H92A 2PQ8A 1LEAA 2ISYA 2HDCA 2YR2A 4FHTA 1U2WA 2P6TA 1USTA 3MAJA 3E97A 3SFZA 5CYVA 2P5KA 1K79A 1SFEA 2RC4A 2RVCA 3GZ6A 1MJBA 4EGZA 3KP5A 1MDMB 1PP7U 2XV4S 1DP7P 3L00A 4KUMA 1FT9A 5BMZA 1FBUA 2WTEA 2XASA 3TGNA 3GO5A 2K4BA 2W25A 2J5PA 5FLXK 4M71A 3FMRA 1IF1A 4YFXF 2V6CA 1LQ1A 2NNNA 1MDMA 2BE5F 4R8HA 1RUOA 1S8NA 3RI4A 1OKRA 2MD5A 3HTUA 2H94A 1SMTA 4O3MA 3B73A 2ZMEA 2EJRA 1YS7A 2Q8KA 3RKYA 4CHUA 4KIFA 3KEOA 2A69F 5FO5A 3IRRA 4ENMA 1IRFA 3GFJA 2JTVA 4P9FA 1ZRFA 1LEBA 5HDNA 3GFLA 4AD9A 1T98A 4JBAA 2XAQA 2AS5F 2P5LC 4U7BA 2W57A 2Z5UA 5FD6A 2EFOA 1XMAA 2HS5A 3RIRA 2XAHA 3J7AO 1W4MA 1R5GA 1T2KA 3ZN1A 3G3ZA 5D5XB 1D8KA 1TBXA 4IF4A 3E3VA 3KP7A 1DDNA 2BV6A 1YW9A 4L5IA 1SD6A 3ZMZA 2A3SA 1O3RA 2RN7A 1TNSA 3MEXA 2OD5A 1SFUA 2RV8A 1WQ2A 1KQ8A 4UHTA 2HFHA 1IRGA 4HAMA 4G7ZF 1GVJA 3ERED 1ZLJA 1BM9A 3BPVA 2JPBA 1ZRCA 3EETA 3C18A 2QQBA 5TJJA 1TLHB 4A0XA 1W7PA 4CXFA 2PBIA 4EGYA 1OR7A 2EFWA 3KP6A 3IL2A 4FX0A 4B8XA 3ZP5A 4HDUA 3KFWX 4P55A 2DLLA 4UVAA 2P7VB 3LSTA 3H3UA 3VB2A 2P4WA 2UWMA 4M73A 2DTRA 1KGSA 5FFZA 4FT8A 2XIGA 5L3GA 2ZNZA 2Z3YA 2ZKZA 4PGGA 5J8FA 1U5TC 5EEHA 1IXRC 1IN4A 2CWEA 3BZ6A 3F8NA 3DEUA 4HX8A 3Q5FA 1YS6A 3MZYA 1J0RA 1GXQA 4RB2C 5D4RA 4IHSA 3T1BA 4HF1A 2PG4A 2HQRA 4GYIA 2NYXA 3AAFA 1G6NA 3R60A 4PGHA 2CSOA 2L3DA 1Z1DA 2G9WA 4S04A 2O8XA 3J80K 4MTDA 3JAMK 1YG2A 4Q5SF 2EWNA 3BDDA 5DUIA 1XDSA 1IW7F 3K1PA 2MC3A 2KIFA 3VEPA 1STZA 5CVJA 1CF7B 5TRDA 2HKOA 3FMSA 2KIMA 3WODF 2DQRA 1MJAA 3MCZA 1P2FA 2V9VA 3EDPA 5E1XA 5D6EA 1G3WA 2FBHA 1UCRA 2W85A 4OIRF 1B4AA 1ONVA 5DDGA 1G3YA 4EM2A 3IRQA 4NHJA 3ZMTA 1U5TA 1CF7A 4HBLA 1KYZA 5LRSA 1ZARA 1QBJA 2VC1A 3T8TA 3TQNA 1SD4A 3QU3A 1S7AA 4XLPF 3CO7C 3DFGA 5E1WA 4CO8A 3O2PE 1ZG1A 1ZLKA 3FZVA 1OYIA 2OU2A 5JHUA 2Y48A 2JZYA 3F23A 1RI7A 3I5UA 1HSJA 5BPIA 5ICGA 2FEZA 2ETHA 5IT3A 2QQAA 1O3QA 4A0ZA 2LSOA 3TDUC 2EK5A 3ABUA 2W24A 1XCBA 1S7OA 1PUEE 3K1NA 1QZZA 2CGPA 2K7LA 3KLOA 4OMZA 1H9GA 1XGOA 3HSEA 3QU6A 2MLGA 3BY6A 1P4AA 1T39A 1YLFA 3L2CA 4ZZLA 4O6JA 5LBQA 4P9UA 3F8FA 5JVTA 1WWXA 1IN8A 2EV0A 1VTNC 4XSXF 4BYYA 1YW8A 2D1HA 3KP3A 2ZO4A 1PP8F 4U88A 5E17F 3WU0A 1HW2A 4N0BA 4DNCA 4A0YA 2H27A 3FXUA 3PFIA 4LFUA 3CJNA 1FLIA 2E7XA 3LA7A 3GYHX 3K69A 5D8LB 5AONA 1BN5A 4PCQA 1HXDA 4RGUA 3HYIA 3R61A 2JPCA 5HLIA 2XAFA 3C1DA 4S05A 1F9NA 3CDHA 1FYMA 3F21A 3FXRA 3LAJA 3RKWA 1QQIA 4NB5A 3HRUA 4FX4A 1I5ZA 2Z99A 4NQWA 4L9NA 1ZRDA 3GLXA 3J81K 1YYVA 3V8JA 3T0YA 3WTWC 2KRFA 4EMSA 5CVRA 3HTSB 2F5DA 1WRJA 3LAPA 1I1GA 4LMYA 4LJZF 1ZG5A 4EJWA 1HKQA 5LEJA 2YU3A 1HBXG 5HLHA 1P6RA 5LGNA 3TKYA 2E7WA 3P9KA 2EFPA 5E8GA 2FSWA 4JK1X 1KU9A 3QPHA 2BBYA 2IPQX 2PMUA 1E17A 2YX4A 2XVCA 3KZZA 3GX4X 1FY7A 2O6GE 3QOPA 3ZMDA 2NNYA 4G6QA 3R4KA 2DK8A 4G9YA 1J5YA 2GIVA 2QWWA 4WXHA 4GYGA 2WWYA 2VBWA 4CDGA 2ZFWA 4M6YA 2A61A 3L7WA 4HV5A 3D0SA 2FMLA 1B9MA 4Q48A 1DPRA 2GXGA 4P96A 1XB4A 2FU4A 2FF4A 2Q0OA 2CO5A 4YG2F 5LRRA 1LJ9A 1FOKA 4P5OA 2HZTA 2XGXA 3JW4A 3ZMSA 2XUBA 3ABTA 2COMA 1USSA 2F5EA 1LB2A 5H6QA 1FBSA 3E6MA 1Z9CA 2Y0MA 4BHBA 1KA8A 2FE3A 4UV9A 1O57A 2HR3A 2RQPA 2O0YA 3HOSA 2K4JA 1QNTA 5LEKA 1FYLA 3FMQA 2F2EA 2BGCA 2VN2A 3RYRA 3KETA 3ISPA 3GEZA 1AWCA 6PAXA 1P4WA 2M30A 1J59A 1RUNA 1EV7A 1LNWA 3TOAA 4KNYA 4ZYDA 2YSRA 3HSRA 2K27A 4M72A 4HX4A 4KIGA 3KE2A 3KLNA 3MZHA 1XGSA 2IA1A 3N4MA 5LGUA 4OIOF 1J75A 4AWXB 3CLOA 4M9ZA 5DEQA 1HW1A 1IAWA 2VODA 1WI9A 2VE9A 2RGVA 3K9TA 2MBFA 4ENJA 3I59B 1V4RA 4KT5C 5E1ZB 4F7ZA 3L09A 4B09A 3NEUA 3CO6C 5ICEA 2UXXA 4KA4A 2O03A 5CVVA 1W5SA 1X3UA 2M8EA 2P5VA 3R6SA 5HLGA 1S6LA 2ADUA 3N97A 4L5JA 1LDKB 3I59A 5FLXZ 2VC0A 2VOPA 1LDDA 3C3WA 3RTRA 5HVQC 2OBPA 4Z2YA 1U6GA 1Y0UA 2WC2A 3P9IA 1R7JA 3I58A 1YW7A 4LLLA 5IT9K 4YFNF 1EH7A 2LF8A 2HKXA 5F6FA 2Q2EA 5LLQA 5D5WB 4Q47A 2GZWA 2A5YB 1KU7A 2IRFG 1ZYRF 2EV5A 4BHPA 4D0PA 1LVAA 2AXLA 4PDKA 1BIAA 1BC7C 3IKVA 1XGMA 3RPQA 4OIQF 2IW5A 4UNOA 5E18F 4R79A 2H6CA 2M1BA 1ON2A 2M5WA 4RB3C 1NHAA 3BJOA 4IJAA 1E2XA 1OPCA 3Q9VA 4LLGF 4KDPA 1F1ZA 4OMYA 2HWVA 4HLXA 5LGTA 1JHHA 5HS8A 1QGPA 3OV8A 2ESHA 4WF2A 3DQVC 4HDVA 2C6YA 3QAHA 1D8JA 1EH6A 2PJPA 2R7FA 4IVNA 2A6HF 1BOAA 1F4KA 5DD4A 4KIBA 3RPUA 1K6OA 1KYWA 3WTVC 2K02A 1IN6A 3B02A 2CW0F 5ED4A 4HF0A 3GXOA 3WTSC 2IJLA 1R5HA 4HF2A 3WTZA 3M1EA 4L0YB 2Z33A 5BQTA 1I1SA 1XN7A 1R1UA 3V8KA 1TNTA 3M7GA 1JXSA 1W5TA 5DYMA
chains in the Genus database with same CATH superfamily
4Y15A 2MH2A 3VOEA 5LHHA 2UXNA 4CCOA 2IT0A 5GAHJ 4IHXA 2CQNA 1LKXA 4Y52J 3U21A 3DF8A 2L54A 2ZXWH 3FBNB 3I3LA 2PLYA 3OYNA 3HZJA 1ZREA 1QZYA 1N77A 3OS2A 2KJBA 1R00A 1SD5A 3K4BA 1G59A 1MZBA 1YTYA 2QQ9A 2EB7A 1RC9A 4WCGA 3DV8A 5FLMJ 4NC8A 2QBYB 3IAS2 2NOJB 4JX6A 2STTA 3MVPA 5IP7J 1FBQA 2V1XA 1SAXA 1XMXA 3NRVA 2XB5A 4A3DJ 3ZGKA 1TWGJ 1QZEA 4M9XA 4PZJA 2IS4A 2D1VA 1H88C 2DBBA 3F9KA 1ETOA 2D2WA 1U78A 2HU9A 1REPC 2M87A 4X0GA 4HLYA 2IBDA 2HVQA 2MA3A 3W6JB 3CESA 2A07F 2X6YA 3KYDB 4M74A 3CF2A 3E6DA 2M7BA 2XAGA 1X58A 3PM1A 2L9NA 4A3GJ 4Y7NJ 3CDLA 1E3OC 2IGOA 3RCOA 3FX3A 1U9OA 3BQYA 4IHTA 4DJAA 2RDPA 2PFBA 2KKOA 3DTIA 3NWTA 1RIOH 1APLC 4M6XA 1CQTA 1S9HA 3WE3A 3LFUA 5CJ9A 1DPUA 2OJED 2CQ7A 1UB9A 1G3SA 1WPKA 3HHGA 4OINF 4IL6C 3H9JA 5L3BA 2NVQJ 3GZNB 4G6DA 4W97A 2NAZA 3O6BB 5LD2C 1U3EM 1PDNC 2V79A 3ZQ7A 1TQPA 1QU3A 4IPAA 1XCVA 4XBFA 4LLNA 1MW7A 4HW0A 5E8IA 2AQFA 3W6KB 1A5JA 1UFMA 3CUQB 3VODA 3MMYB 1ZGAA 2F4OB 5DM7F 2M0MA 1IC8A 2FOKA 1HQCA 3J80Z 1T6SA 3JAMZ 2L7FP 4CZZA 2RNJA 3M8FA 1D0YA 4JP0A 3M8EA 3HRTA 3IWZA 2FOWA 2I8DA 2H09A 2VONA 3WTYC 1FWZA 2JMWA 3OYMA 2WAEA 3IHUA 3JR9A 3LA3A 5TGTA 1FSHA 4RB0A 1WI3A 3SJMA 3W2WA 2KZGA 1WH7A 3U9GA 4BY1J 3S3OA 2QZ8A 2HI3A 1UMQA 4AVPA 5J3LA 3EUKL 2DPUA 2Z2SB 3G6EI 2F5VA 3K10A 4GXOA 4IRIA 1Y1WJ 3M9AA 3MKWB 4MHGA 2CMPA 2XF7A 3ULQB 4U0VA 3UKGA 4M9SA 4FCYA 3BJAA 3L9FA 1GHCA 3I64A 1I6XA 2LVSA 4OU0A 3BTIA 3GW2A 1MBEA 1NG7A 4IZZA 1ZAOA 4IO9F 4EV0A 2W4SA 1OLTA 4LK0F 2LNBA 5HDGA 3K4NA 2KRCA 3L2WA 4F92B 1ZG3A 1I3QJ 4AIKA 2EFQA 1QVTA 3VSKA 3DBRB 3V7CA 4OOIA 1XSDA 1J7KA 1Y1VJ 4CCMA 3OSGA 4BEHB 2ZXJA 2VQLA 1IGNA 1BC8C 5D8KB 5A2QK 4UY8I 1KU2A 2TCTA 2W00A 5KAFC 2VT2A 3VPRA 5K5QA 1YFHA 2GXAA 2W7NA 1R23A 2R0QC 3AG1H 1FJLA 1B6AA 2H6BA 3M4OJ 3AL0C 5DCMB 1JE8A 2XAJA 4XKCA 5EEGA 3K4LA 1BIBA 4D9JA 2H8WA 4O5VA 3Q0UA 3IUOA 4ETSA 3MKLA 2CV1A 4BH9A 2O7OA 4YIRX 4LK1F 2VBYA 1B72B 4BEHA 2LK2A 1XG1A 2OZ6A 4YIFA 4IRHA 2LBFB 3V4GA 4ZYEA 2R7WA 1T8IA 2E2HJ 3BWGA 3K4CA 4ESFA 1KU3A 5HODA 2LDUA 2XROA 2DFIA 2ZJRF 1AU7A 1IXCA 4LGWA 3MQ0A 5JVGF 3S93A 3S16J 3D5RC 4RS8A 2J5OA 4KYWA 3B6AA 3K70D 1WJCA 2Z1DA 2JVGA 3H3VK 2EINH 2A5WA 3G73A 1B59A 2DO7A 4IHWA 5D6FA 1MGTA 1ETKA 3LA2A 5FB2A 1HKTA 1X4OA 2X0LA 2L02A 2FJ1A 5F0CA 3K1MA 3QP5A 4KMUX 4LB5A 2F4MB 2KFDA 4OIPF 5E3NA 3ECHA 3DPLC 1MBGA 4RGRA 1K78B 3FIWA 1TWHJ 3PQJA 2EFNA 2FBIA 2DA4A 1B72A 3TDZC 1MSFC 1I27A 4A3EJ 1UELB 4OWRB 2VLAA 2R7XA 2JUCA 4DW6A 1ENHA 5JI6A 2CQKA 2BY2A 4FTHA 3CUOA 1ZK8A 4NC6A 5HS9A 3QP6A 3OYKA 1Q1HA 3F8CA 4A3MJ 3FKIJ 3IH4A 2QENA 2OZUA 4PJ0C 4EQQA 3GZ5A 4MNUA 2O3FA 1FC3A 2JT1A 5M5XJ 3FBIB 3ZMVA 1YIOA 1XD7A 2K3PA 1TZLA 2ZNYA 3KEQA 1K78A 2OTJI 2LLKA 4Q4ZF 3IC7A 2KISA 5DCFA 3REOA 2OQGA 2STWA 1JHFA 4ESBA 1OJLA 3BPXA 3JRFA 3OYGA 1F5TA 2LOOA 2BHZA 5KAIC 3CP2A 5J1RA 1O7FA 2IS2A 3F8BA 2WA0A 5DTDA 1B1BA 5GTHC 2JA6J 2EZKA 2DW4A 4HG2A 3BZCA 2QF7A 1QPIA 2KPMA 2KHMA 4HA8A 3CTAA 4QPQA 3G1OA 2QM3A 1YJWI 5GPCA 3EUAA 3DTKA 1O4XA 3HUGA 1YO5C 2A6TA 5HS7A 2A6EF 2OC6A 4BAYA 3RYPA 2O9LA 3LSHA 2F5FA 1X19A 3EYIA 3OS1A 1ZN2A 1QRYA 4L9TA 5F64A 1FYKA 1BI2A 4ZZDA 3E5QA 1DU6A 4BQAA 3DXJF 1FOXA 1HDPA 2V7FA 4MQVA 4QWQA 3J81Z 1LDJA 4LD5A 4E7JA 4ZJZA 1U8RA 2ZSIB 4ZTFA 1FZPB 1H9TA 4K2EA 2HOAA 2HTJA 4YFKF 4HOBA 2F48A 5BPDA 2HTSA 3HB9A 5J6XA 3RSNA 2PMZA 3ONQA 5ICFA 3V8LA 1VQ5I 2RREA 5CPRB 1ZH5A 2V26A 2FMYA 2ZXHA 3KP4A 4L18B 2FQ4A 4EVIA 1W36D 3F3XA 3HG9A 5K1YA 1JTYA 2DA1A 2ME0A 2FQ3A 1VQKI 2KP6A 2R7SA 5CVIA 3TW7A 3E5UA 3GUDA 1T0FA 3PL8A 1HA8A 4MLOA 2WAQN 3JRDA 4PK4A 4E7IA 1VZ0A 1WJ5A 5L3DA 4OAYA 1RR7A 4C30A 1QPMA 3E6BA 5LHIA 4N9HA 1BBYA 1OQYA 3W2VA 1SD7A 5B1AH 3QQAA 3S2HJ 2VKHA 5J47A 2CS3A 2OAZA 2L7MP 4LIVA 4IRGA 2CFXA 2PEXA 4BDZA 5F1RA 4IXAA 3CC2I 5DV5A 4DZPA 2G7HA 2K40A 1BOBA 2EIMH 1XSVA 2L2OA 3QRFF 2ISZA 2TRTA 2I10A 2E1MB 2CQQA 3DPTA 5EJCA 1Z6TA 2FBKA 3PUFA 1V55H 2LF7A 3QYBA 2FA5A 4CYDA 2O61A 1D3YA 5KVRA 4EM0B 2EIJH 4I7HA 3IWFA 1NH3A 2JA2A 5BS6A 1P7IA 3R0AA 1A36A 3FK6A 4HQMA 5LHGA 2Y9ZA 1E3HA 1K4TA 1IG7A 2BEOA 3K0LA 4RAGA 3GFIA 2KIUA 1LE8B 1RZ4A 2D45A 2ZMEB 1R22A 2K9QA 2E1NA 2MABA 3ECOA 3ESWB 3TO9A 3OR1C 3JCUC 4L9VA 1FTTA 5IY5H 2IVMA 2MH9A 4RA2A 1POGA 3IKTA 4UVBA 3T5XA 3WTUC 4L0ZB 2NOGA 3H5NA 3BROA 2KJCA 2CG4A 5K5RA 4A6EA 1TWAJ 4CICA 3FWEA 4HQEA 5ERIA 3K6GA 1FTZA 1OYWA 4FISA 2PN6A 2JK3A 3SDBA 2VBXA 3J7YJ 3LL7A 2R7DA 3U2RA 2Y75A 1S29A 1ERDA 4XLCA 1Y56A 2L4AA 3FXJA 1WSUA 3F8MA 1GUUA 2MC4A 5E20A 3SXYA 1TQIA 3J7AY 4TV7A 1WJEA 5D4SA 3K2ZA 2HEOA 1I50J 2ESNA 3BR5A 3A0BC 2EA2A 1Z7UA 3QODA 4GO1A 2JRTA 3BG3A 1SVLA 1FIPA 2G0EA 2P7CB 4KFCA 3LQRA 4G7OF 1ZELA 3I54A 2ZSHB 2CH0A 3P9CA 4A2UA 3I4NJ 4Y3OA 4E70A 4A3CJ 2CFOA 4I02A 1MH4A 3MFKA 1ON1A 1G3TA 1RPWA 2DU9A 2XSJC 4PJLA 2YU9J 2XHKA 3ZN0A 2B7EA 4L9JA 2R7RA 2PMHA 4A5NA 1Y39A 4UV8A 1G4DA 4I01A 4BXUA 2VE8A 5M5YJ 2G7UA 1MD0A 2DT6A 3FXQA 4Y17A 4ZC3A 3S2WA 2ECBA 4U0WA 1D5YA 4BBSJ 4MFEA 3DP7A 4XM3A 5F0HA 3JSPA 3V7SA 2LKPA 4ENKA 3OOPA 3PO2J 3HRSA 4BJ6C 4RGXA 1UG0A 3KZYA 5L3FA 5D5VB 2NRAC 2R7OA 3GMEA 1YI2I 1KQ9A 2CUFA 4IHVA 1X2NA 5ILSA 4XRMA 4QPOA 1Z67A 2EH3A 3LSMA 1JT6A 3F72A 3H3ZA 3V42A 3JRAA 2XKPA 3ROUA 4CGZA 1FNNA 3CCEI 4MGRA 2X6XA 4DBQA 4EJTA 2M45A 2OCCH 1Z91A 3LSKA 3BR0A 2HYGD 2BZTA 3OYCA 3ZRGA 3C2HA 2R7VA 3E7LA 3WE2A 5K5OA 1T95A 4M3DA 2DI3A 4MEYF 3HOTA 5DD8A 4BACA 4XONA 1HKSA 2FNAA 1P92A 2QVOA 3DLLF 2EQRA 4A12A 2M3AA 1YX3A 4I09A 4XSZF 3WTTC 1NK2P 1MBFA 2CV0A 4XOTA 1W7PB 2V1DA 3ELKA 1X4PA 4RAZA 2MD0A 4D7NA 5CLSA 4EJUA 4YIIA 4KJZA 2ZJQF 2LMDA 3GLLA 3TO6A 1W5CC 3BR6A 4HPQA 5HNFA 5K7HA 5CVUA 1UHWA 3EUHA 3S17J 3HKZN 4A3KJ 2V9PA 3TOBA 4N9IA 4AIHA 5FLVA 2X85A 2TDXA 2XF6A 3AFHA 3HHHA 3I9V2 4PSXA 2KQRA 4EM1A 4XLHA 2NVUB 3L2UA 1SFOJ 1UZCA 3VDXA 2VQHA 1VQMI 1D5VA 3U1DA 3LOCA 1J2XA 2QYOA 1KQ0A 4XN3A 3BTLA 4DIQA 4HZFA 2X4HA 2LY9A 2GXBA 4ON0A 2JA7J 1OYYA 1HC8A 1HW5A 4D1QA 1WJDA 2X48A 4WXDA 4XICA 3SZTA 1IZ1A 3L2RA 2VQCA 3GTJJ 1U8BA 2M9HA 4BKXA 2XRNA 4BL0B 1K7AA 1WCMJ 2VKEA 4AVZA 4BQNA 2ELHA 2HGCA 3R0JA 1W7PD 2YX7A 4MFDA 4AIDA 2ZJ2A 3DBLB 3PSFA 1R49A 3OOUA 5KCMA 5H20A 3F6OA 2GA1A 3SDGA 2R7QA 2HYJA 5E3OA 5IT9Z 1EJ9A 1I6HJ 4EJVA 4WWCA 3FM5A 3H0GJ 1ETYA 1FIAA 3MWMA 4XKWA 1EH8A 1JUMA 3QWLA 3TO7A 2LG4A 4I0BA 3WGIA 3JRCA 1AOYA 4WK8F 1Z6RA 2BVMA 2HQNA 1MNEA 1XMKA 4G8XA 2PJRB 3QPSA 2QUFA 5F0FA 1GVDA 2XAUA 2FNPA 5GPAA 1JGGA 4RB1A 1QHHD 1FP1D 2EZHA 2L01A 2L9SA 1GV5A 2ZBKA 5EZHA 2MFZA 3G4SI 4U7DA 2EA4A 2JWTA 2R5ZB 3JTGA 2VIXA 1VQ4I 2E5ZA 2Y9YA 1R1TA 5H6RA 1Y0NA 3CJQB 3EYYA 4XRFA 1BI0A 2BYVE 3A1YA 1L3LA 5E3LA 1O3SA 4GDFA 1LFPA 3OL4A 4EJOA 4WX9A 5B66C 3V7RA 1ZGJA 4MQ9F 2WV0A 5ICCA 3WGGA 2PJRA 4ZYGA 2DMUA 2GOXB 3I0TA 1O3TA 2B0LA 4KN4X 1FP2A 4Y33A 2DPDA 5M3MJ 3BG6A 3DKWA 3BJ6A 1GV2A 3BT9A 1PUFB 3K4KA 4PJJA 2FUG2 3CUQC 2IP2A 2VXZA 3CMEI 2V1UA 4Y13A 3FF5A 4QLCU 1ZHFA 4ENNA 4GGGA 4NC7A 3RZDJ 2PI0A 3GFMA 3QPTA 3BC8A 2MGQA 4MO7A 4XORA 2WB1N 1BJAA 5IP9J 1WFXA 2VL8A 2OQRA 1NK3P 1U5TB 4RMNA 1R4NB 2QSGX 1P4XA 2W48A 3KP2A 2IS6A 3I71A 1O7LA 3GBGA 4KICA 2BW3B 4RDUA 1IN7A 1K61A 2X6OA 2FD5A 3FDYA 2A68F 3KEYA 3HOUJ 3GF2A 3PNVA 4A3JJ 1VQ7I 3OSFA 5J4YA 4RAYA 2DAOA 2F5CA 2HYFA 2QBYA 2L4MA 4B44A 3BCAA 3MZ8A 4UXNA 1K83J 4A3IJ 3S14J 3CCUI 1ACIA 2YPRA 3WTXC 2DMPA 4D5FA 1JUPA 3DEWA 2W82A 3NARA 2HPIA 4LB6B 3BR2A 2NS0A 2HQ5A 4YELA 4XLNF 3ASNH 4UUTA 2ZCWA 4BNCA 1ODDA 2XRLA 2LR8A 3O3KA 1SFXA 5D5UB 3NWSA 5GADJ 5JFRA 2LYCA 3B6CA 4MIMA 3ML6A 3RKXA 2LKXA 3PQKA 3MKYB 3BZKA 2GQQA 2DCEA 2P6SA 3ABMH 3D5LA 1YE9A 3K70C 5JR3A 4HYEA 3AKZA 1FEXA 4H4KC 9ANTA 3GVAA 3Q3SA 1UHMA 4A6DA 3DU6A 5HOOA 3SQNA 4HNTA 2OA4A 4KMFA 2PX9A 4FE4A 1R58A 1TQMA 1K4SA 2MG4A 2OPTA 2NS7A 4RM3A 2CYYA 3EQLF 4U0YA 1WHUA 1RESA 2RKHA 4F93B 3K7AJ 4R1HA 1JT0A 4ESJA 1NG6A 3CUQA 3FHZA 1ULYA 1JGSA 4XN0A 4ZYHA 2R92J 3DKYA 3COAC 1XTAA 3HC7A 5J1UA 5HDKA 1HSTA 3BQZA 3HPHA 2BY3A 5L3CA 3ZQCA 2MYSA 1BI1A 4II3A 2KMUA 5J8CA 4GFBA 4X1EA 3BOQA 3WGHA 1R36A 2GIZA 5GAEJ 3JSOA 1YRNB 3L1PA 3P7NA 3HL2A 1D1CA 4BY7J 1TWCJ 3GTPJ 1OCZH 2VUMJ 4NBQA 5FD5A 1UG2A 4WXCA 3WU1B 3X2QH 4BGDA 5AIQA 2E1CA 4E7ZA 5ILVA 1UAAA 3O8GA 2P8TA 2UZKA 4MEXF 3HOWJ 1QO0D 4KN7X 3HIFA 4CCNA 4RAFA 3LQQA 2XPVA 4IOCF 3OL3A 2JA5J 4RM2A 3E5XA 1EA3A 1YRNA 3RJPA 5HLTA 3BG9A 4HX7A 1WVRA 1TL8A 4ZH4F 4LG0B 2V6EA 4FASD 3ZPLA 3S1NJ 3WG9A 4UVCA 4C3HJ 2R7UA 1RNLA 5FFXA 2L5QA 2MLKA 2NVTJ 4C3JJ 1GLNA 3JRHA 2CV2A 1D1AA 4I6ZA 1T38A 2VOOA 1ETVA 2KRHA 3MKZA 4G7HF 1YQAA 3ZMUA 2VPLA 1XSXA 4CUGA 1T33A 3ZCOA 1IXSB 3MD2A 3CCVI 2ACJA 4HRIA 4LG0A 5IOYA 2LC2A 5DCMA 4QSHA 1YITI 1HDDC 1TW3A 3LWFA 2K86A 4JX5A 3F22A 1Z77A 1H89C 2LREA 5EYRA 3CCRI 5C3EJ 1OMIA 1JJ8C 1V3FA 3J7ZI 2JSCA 3I4PA 5J1YA 2Y0SN 2FRHA 2XGDA 1L0OC 3SHFA 1BR2A 2QA4I 2VB6A 1W36C 1WKMA 1X2MA 3KPHA 4FQGA 2LBFA 2JQ7A 1SMYF 4GCVA 3H5RA 4M3FA 3C2GA 4I0AA 2L9VA 1IDZA 1MH3A 3OYDA 5C4JJ 5FRNA 3TP3A 3RQIA 3NQOA 3RDIA 3BP8A 3UNGC 4A5MA 3QOEA 1V5EA 3E6CC 3TL4X 1JUSA 1R6RA 2DOAA 4ITVA 5BOXA 2EIKH 3HEFA 5A2QZ 1FPQA 1T0FC 2W84A 4QTRA 3OWTA 4V2FA 4AU7A 4UUVA 2M4KA 5ILUA 4H0EA 1XDUA 4AYBN 4I98B 3I53A 2DFFA 2JJ7A 2RNGA 2EV6A 3VYRB 2UUZA 5F1JA 2FXAA 3JTHA 4MTEA 2Z9OA 3CLQA 2IA0A 3FM3A 1RRJA 2WAFA 1CGPA 1GXPA 2QLZA 2DT5A 2EZLA 4JQFA 4RGSA 3SZPA 1DU0A 1FX7A 5IYBJ 2IA2A 3M07A 1AA7A 4ASNA 5IYDJ 3LFKA 2DK5A 5AIPA 4B43A 3BLYA 2E36A 1LFUP 1MJ9A 5DUKA 4UUSB 2HOSA 5FGMA 1WJBA 4B4CA 2H1KA 1B9NA 2P0WA 3WU2C 5L3EA 1MKMA 3WHCA 1FSEA 1XGNA 2H1LA 3KCCA 4A3BJ 1YX5A 2GWRA 2HOEA 2HQAA 2VI6A 1LUJB 5DM6F 4AIJA 1BI3A 1A6IA 2R3SA 1DQUA 1BJZA 5IYCJ 4HV6A 3F6VA 3C7JA 1D1BA 1RKWA 5BNGA 2GAUA 1DUXC 1IUYA 2KIQA 2CUZA 4XRSG 1TW2A 3GWZA 3HSFA 1Y6IA 2E1MC 2DFHA 1BR4A 4E6KG 3HRMA 2Q1ZB 1C0WA 4DQ2A 2IAIA 1TTYA 1VQNI 1S3JA 2DQLA 3VFZA 3LSPA 4J00A 2VT3A 4I2OA 1IN5A 4BHCA 2VBZA 1Z05A 5KK1A 4M6VA 3E1SA 2GA2A 1P7JA 3FXOA 1ETQA 1J9IA 1H0MA 1R1VA 3OYLA 2XKOA 1A6QA 3T8RA 1A04A 2ZMEC 4DYRA 4M3EA 4G94A 3Q9SA 3K2AA 1V5FA 1PYVA 3OIQA 4CCJA 3H92A 2PQ8A 3PIPF 1LEAA 2ISYA 2CQXA 3Q0WA 1N75A 3MN2A 2VKVA 1YJ9I 2HDCA 2HVRA 2OF7A 1N25A 2YR2A 3A02A 4FHTA 1U2WA 2P6TA 1USTA 3MAJA 1W0TA 2R7TA 4UB8C 3E97A 5F04A 1MMGA 3SFZA 5CYVA 3GTGJ 2P5KA 4C2MJ 1K79A 2HPMA 1SFEA 4ZDOA 3PFYA 2DFEA 2Y30A 5E79C 2RC4A 2RVCA 3GZ6A 1MJBA 4EGZA 1X1AA 5IOZA 3KP5A 4P1WA 1SFKA 1LPQA 1MDMB 1PP7U 2M4GA 4IEJA 2XV4S 3HDDA 1DP7P 1E0EA 3GTOJ 4A93J 3L00A 4KUMA 1FT9A 4LOCA 5BMZA 2JUGA 1FBUA 2WTEA 2XASA 3TGNA 4IKFA 3GTMJ 3GO5A 2K4BA 2W25A 3BR3A 2J5PA 3FKJA 5FLXK 1F43A 4M71A 3FMRA 3IP4B 1IF1A 4E7HA 4YFXF 2V6CA 2AXTC 1LQ1A 2X51A 3O8HA 2NNNA 1YOVB 4RLFA 3U1KA 4B47A 1MDMA 3NAUA 3WG7H 2BE5F 2V4JC 3DEEA 2DA6A 4EATA 4R8HA 4Z6YA 3CJRB 1RUOA 1PJRA 1S8NA 1IRXA 3RI4A 1OKRA 2MD5A 3HTUA 3QYEA 2KL4A 2H94A 1SMTA 2DMQA 4IQJA 4O3MA 2ICWG 3B73A 2L0KA 4PFOA 1VNDA 1LE8A 2I5UA 2E71A 2ZMEA 2EJRA 1IV8A 1YS7A 2Q8KA 3AG3H 3RKYA 1ZGWA 2IGMA 2GLOA 2IEKA 4CHUA 2HXIA 2DDAA 2L7KA 3EUHC 2D5VA 3HOXJ 4DOZA 3HOVJ 4PUSA 4KIFA 2BXYA 1Z21A 3KEOA 5TISC 2M7AA 2LH9A 3BR1A 2A69F 3CCYA 5B3SH 5GTIC 3CC7I 5FO5A 5J4VA 3IRRA 3CMMA 4ENMA 1V54H 1IRFA 3GFJA 2JTVA 4P9FA 3SYTA 2DA3A 1ZRFA 1LEBA 4X6AJ 2RQQA 5HDNA 3GFLA 3F0CA 4AD9A 1T98A 4JBAA 2XAQA 2AS5F 1I39A 2EBIA 5EZGA 2P5LC 3D5SC 3A2KA 4U7BA 2W57A 2Z5UA 5FD6A 4HNUA 5EGOB 5FKLA 3VYTB 2O5RA 2EFOA 1Z0XA 2QKMB 4A69C 1G2HA 1XMAA 2X6WA 1U0JA 3CF5F 1RKTA 2HS5A 4BUPA 3PJRA 1YIJI 3IH3A 3RIRA 2XAHA 3M8JA 4CZCA 3J7AO 1W4MA 1R5GA 4XRSA 1T2KA 1SC7A 3A03A 1IV6A 3BCBA 2LFBA 3ZN1A 2R7ZJ 3G3ZA 5D5XB 1D8KA 1TBXA 4IF4A 3E3VA 3KP7A 4LG3A 1DDNA 2BV6A 1YW9A 4L5IA 3L2QA 1A35A 5EGOA 2QQ8A 4ZDLA 1SD6A 5K7ZA 3ZMZA 2A3SA 1O3RA 2DXIA 2RN7A 2M2EA 1TNSA 4DYQA 3MEXA 2OD5A 3OYJA 3DPUA 1SFUA 2RV8A 3FXKA 1WQ2A 1KQ8A 4UHTA 1X1BA 2XSDC 2HFHA 1IRGA 3TEDA 4HAMA 2HDDA 4G7ZF 1GVJA 3ZQIA 3ERED 3TW6A 1ZLJA 1LVKA 1BM9A 3BPVA 2NS8A 2JPBA 3ZXSA 5CQGA 1ZRCA 4IQ4A 3EETA 3C18A 2QQBA 1OCCH 5TJJA 2COBA 2OV7A 1Z7LA 2ECCA 4XNFA 1JI8A 1TLHB 2VJ5A 3LSJA 3KZIC 4A0XA 4J01A 4QIWN 3PUBA 1X1CA 1W7PA 2BOLA 4CXFA 2PBIA 2E60A 2M8GX 4EGYA 1OR7A 3HGYA 2EFWA 3KP6A 3IL2A 2R93J 4V2GA 4FX0A 4C2TA 3FHNA 3LNQA 2Y2ZA 4B8XA 3ZP5A 2E5NA 3FXLA 4HDUA 3EPZA 3KFWX 4P55A 2DLLA 4UVAA 2P7VB 4J19A 1NTCA 3LSTA 2NVXJ 3CQZJ 3H3UA 2UV1A 3VB2A 2LY1A 3ZQHA 2P4WA 2UWMA 4S0HB 2AHQA 4B1RA 2WY8Q 3FK7A 4M73A 2DTRA 1KGSA 5LFAA 5FFZA 4BE2A 2ID3A 4FT8A 3HGGA 2XIGA 4JYKA 5L3GA 2ZNZA 2Z3YA 4A3FJ 3KYCB 2DDBA 2LKSA 2ZKZA 1AKHB 3KX2A 4PGGA 1U5TC 5EEHA 2DMNA 2N8GA 5J8FA 5FJ8J 4ANJA 3JREA 3HJEA 2WAQA 4UB6C 4C9YA 1ETXA 5KNLA 1IXRC 1WGXA 4BE0A 1R4MB 1IN4A 2CRGA 2CWEA 3BZ6A 3F8NA 2LRDA 3DEUA 4HX8A 3CDIA 1VFCA 3Q5FA 1YS6A 3CD6I 1D0XA 3PIOF 3MZYA 1ZR4A 4DGWB 5FRMA 4B3AA 1J0RA 1MNMC 1GXQA 4RB2C 1R5ID 5D4RA 4IHSA 2JA8J 3T1BA 4HF1A 1T08B 3HBLA 2PG4A 2HQRA 1IUFA 3GCMA 4GYIA 4HEA2 2NYXA 1AKHA 3AAFA 3GTQJ 1G6NA 3ZQQA 2L9RA 3R60A 3PNTA 4PGHA 2CSOA 1ITYA 2L3DA 1Z1DA 2G9WA 2R5ZA 3S1MJ 3RZOJ 1QHGA 4YEJA 1X1DA 4S04A 4EEFG 2O8XA 5B1BH 3J80K 4E7KA 4MTDA 3JAMK 1YG2A 4Q5SF 2EWNA 2ID6A 3BDDA 1Y8QB 1GDTA 4V19K 2OUMA 2JRMA 5DUIA 3A01B 1XDSA 1IW7F 1UHSA 1JJ6C 3K1PA 3I56I 2XC7A 2MC3A 2KIFA 3VEPA 1STZA 3HPGA 5CVJA 4BE1A 2QCOA 1CF7B 4M3BA 5TRDA 1SANA 4I76A 2HKOA 3FMSA 2K9NA 2KDOA 2KIMA 2XGCA 2DQRA 3WODF 3LSIA 1MJAA 3MCZA 1P2FA 1S72I 2VJJA 2BXZA 5C44J 2V9VA 2XDVA 1WJAA 2X9DA 3EDPA 5E1XA 1PUFA 3H9GA 3S15J 5D6EA 1PVEA 1G3WA 3CCSI 2FBHA 1UCRA 2W85A 4PJMA 1W1WE 2JVHA 4OIRF 1B4AA 4LIUA 3A01A 1ONVA 4I99C 1EKEA 5DDGA 3SEZA 1G3YA 4EM2A 3IRQA 4NHJA 3ZMTA 2BY1A 3L2VA 1U5TA 4IX7A 4U87A 4HBLA 1CF7A 2HOTA 1KYZA 3PSIA 1P9QC 2LY2A 1ZARA 5LRSA 2QGUA 2NVYJ 1QBJA 2ZXIA 1MIJA 1OCPA 2BW3A 2DN0A 2VC1A 3T8TA 3TQNA 1SD4A 3QU3A 1VF9A 1S7AA 4XMYA 1ORKA 4XLPF 1VQOI 1B8IB 1BR1A 2QEXI 3CMAI 2OTLI 3CO7C 1EF4A 3DFGA 2DJIA 5E1WA 2IXSA 3O2PE 4CO8A 1ZG1A 2ELKA 1R71A 1ZLKA 3FZVA 4GRIA 2PMZN 1OYIA 2OU2A 2XPWA 5JHUA 2Y48A 2JZYA 3F23A 1RI7A 4C2UA 3I5UA 3GTKJ 2KZVA 1HSJA 2MW8A 2W1OA 2CW8A 3OYBA 5BPIA 1F36A 4F3QA 2FEZA 5ICGA 1ZKGA 2ETHA 3ABLH 1VQPI 2VXDA 2DOEA 2CUEA 2DOFA 3HXLA 1B8IA 2B63J 5IT3A 2QQAA 3DBHB 1O3QA 3CC4I 4A0ZA 2EILH 2LSOA 3TDUC 2EK5A 3OY9A 3ABUA 4E4HA 2W24A 4ABZA 1XCBA 4XR6A 1S7OA 4XIDA 1FOWA 5KHDA 1PUEE 4RLQA 1OFCX 3K1NA 1U9NA 2ZJPF 1MMNA 3H1CA 1QZZA 2F4IA 3W2AA 3BG5A 2CGPA 4OAZA 2K7LA 2L7ZA 1X3WB 3KLOA 1H9GA 1XGOA 4OMZA 3HSEA 3QU6A 1S7EA 2MLGA 4G6TB 3BY6A 3G1MA 1P4AA 1T39A 1BL0A 1YLFA 2VQGA 5HNHA 1E3PA 3L2CA 2KT0A 3LSRA 1HF0A 4ZZLA 1XX5A 4O6JA 5LBQA 3SFIA 1MBHA 4NNJA 3SEQA 3JRGA 3QPLA 5F27A 3HKZA 4P9UA 1D0ZA 2E2IJ 3F8FA 5JVTA 2BY0A 1WWXA 4PSWA 1IN8A 3C2BA 2EV0A 4XSXF 4BYYA 1VTNC 1YW8A 2D1HA 3KP3A 2ZO4A 4CH7A 2K3FA 1RETA 3KIOA 1PP8F 4U88A 5E17F 3WU0A 1HW2A 4E7SA 4N0BA 4DNCA 4A0YA 3WHBA 2H27A 3FXUA 3PFIA 4JOMA 4LFUA 3ABKH 1JKRC 3CJNA 1FLIA 3DKXA 3SZGA 1WJFA 1HCRA 2E7XA 4CYCB 3LA7A 3BTJA 3GYHX 3K69A 5D8LB 5AONA 1HOMA 1BN5A 4NQWB 4PCQA 1HXDA 5CQEA 1OCRH 5JLWA 1VQ8I 2YUSA 2K9LA 3DU5A 1OCOH 2E19A 2F6CA 3A0HC 2ZB9A 4RGUA 3GTLJ 4DBRA 2K9MA 3BG7A 2XGEA 3HYIA 4BXFA 3R61A 2JPCA 5HLIA 2XAFA 3C1DA 4M3GA 4CSWA 4S05A 4G12A 1F9NA 4BU2A 3CDHA 1FYMA 3F21A 2WV1A 3FXRA 2HVSA 1Q1VA 3LAJA 3RKWA 1QQIA 4CYCA 4NB5A 3HRUA 1SAUA 4PJNA 3M1CA 4FX4A 1I5ZA 2Z99A 4NQWA 4L9NA 5JHFA 1ZRDA 2IS1A 4IOAF 3GLXA 3J81K 1YYVA 3BTCA 3D1NI 2M34A 1MNDA 3V8JA 3CMYA 2DMTA 3T0YA 3WTWC 2KRFA 1DGRM 4EMSA 4F91B 5CVRA 3HTSB 3W6VA 4FETA 2F5DA 1WRJA 4D7MA 3LAPA 1I1GA 5EDNA 4LMYA 1FOYA 3AL0B 4LJZF 3TMOA 1OISA 4EJWA 1HKQA 1ZG5A 2R4GA 1IJWC 5LEJA 2YU3A 1HBXG 1R9TJ 4A3LJ 1JTXA 4II2A 5B5EC 1KONA 5HLHA 2XPUA 1P6RA 1WZ2A 5LGNA 1BA5A 3TKYA 1HLVA 3VYUB 3K4MA 3ZOBA 3HOZJ 2E7WA 4XKVA 3W3CA 2AQEA 3P9KA 5J40A 4BDYA 2EFPA 5E8GA 2FSWA 4JK1X 2MSYA 3HUGB 1KU9A 2QKLB 2X1CA 3QPHA 2BBYA 1TT0A 1TP4A 2WB1A 2IPQX 2PMUA 1E17A 1SVMA 3A4CA 2YX4A 2XVCA 3OIPA 2XF5A 2DA5A 3ZQLA 3CZ6A 3KZZA 3OYAA 4BQQA 3GX4X 1FY7A 2O6GE 3QOPA 2V9KA 3ZMDA 2NNYA 4G6QA 2QSHX 3R4KA 1G8XA 3S1RJ 2DK8A 1JKPC 4G9YA 3ASOH 1J5YA 2GIVA 3H35A 1IO2A 3LMMA 3RKQA 2QWWA 1H8AC 4WXHA 5IPAA 5CKTA 2BVLA 1Z3YA 2WADA 4GYGA 2WWYA 1M1EB 2VBWA 2XB0X 1XS9A 4UUSA 1VI0A 3TP0A 4BXXJ 3JRBA 2HNHA 4CDGA 2ZFWA 4M6YA 2A61A 3L7WA 1K6YA 3DLAA 1ZQ3P 2Z16A 3D0SA 4HV5A 2FMLA 3CCMI 1B9MA 3OYIA 4JX4A 4Q48A 3S3MA 1DPRA 2GXGA 4P96A 1X3ZB 5FROA 2DJNA 1XB4A 3IAM2 1BW5A 1OCTC 2FU4A 4AC0A 2FF4A 2OCEA 2Q0OA 2CO5A 2BHYA 3OIOA 3OMYA 4W1UA 5LRRA 4PFPA 1LJ9A 4YG2F 1FOKA 2VPRA 4P5OA 1DGWY 2HZTA 2LP0A 4BBRJ 3M3YJ 2XGXA 3JW4A 3CJTB 3ZMSA 1I3AA 2XUBA 3CP8A 3ABTA 2COMA 1USSA 2F5EA 1LB2A 5H6QA 2FX0A 1JKQC 1FBSA 3E6MA 5M3FJ 1W0UA 1Z9CA 2DA7A 2Y0MA 4BHBA 3CCJI 4XLFA 4BQOA 1KA8A 4HSTA 2FE3A 5EF6A 4UV9A 4KT6A 4IHYA 4HSRA 1O57A 2HR3A 2CU7A 1MMDA 1FMWA 2RQPA 1YHQI 2O0YA 2GM4A 3HOSA 2K4JA 1QNTA 1YJNI 1GT0C 5LEKA 1UJ8A 2DA2A 5FKNA 1FYLA 1JKOC 2AO9A 3ZQGA 3FMQA 2F2EA 2BGCA 2Y31A 3FXMA 1J09A 2VN2A 5DS9A 3RYRA 2M0CA 3PNYA 3ISPA 3KETA 2E2JJ 2LTPA 3VSLA 3GEZA 1AWCA 4B48A 6PAXA 4N4OB 1P4WA 2VASA 2M30A 4XL9A 3H0DA 3OS0A 3FISA 3N05A 1J59A 1RUNA 1EV7A 3VYSB 2HDWA 3K4JA 4Y4RA 4XOPA 3OYFA 1ZTRA 1LNWA 3TOAA 1TT5B 4KNYA 5FKOA 2CW7A 1AHDP 4BJTA 5M5WJ 4ZYDA 1MMSA 2YSRA 2GOMA 2DYRH 3HSRA 3VWBA 2K27A 3HOYJ 4M72A 4HX4A 4KIGA 3KE2A 3KLNA 2ZC2A 3MZHA 1XGSA 3Q0VA 2IA1A 2P81A 5FKKA 3N4MA 5LGUA 4OIOF 4F55A 5GAGJ 5IP6A 1J75A 4B3XA 4AWXB 1MBJA 3CLOA 4M9ZA 5DEQA 4FE7A 1T56A 1V5GA 1XC5A 2Y69H 1HW1A 1IAWA 4CCKA 1MBKA 2VODA 1WI9A 4CCLA 2VE9A 3DTEA 4XK4A 2RGVA 3RQ4A 3K9TA 2MBFA 2KDZA 4ENJA 3I59B 1V4RA 4KT5C 5E1ZB 2K85A 1XPXA 4F7ZA 2HXOA 3L09A 1OR7C 4B09A 3NEUA 3CO6C 1SEUA 1IRZA 5ICEA 2UXXA 2ZFUA 3DWLE 4KA4A 2O03A 2QSFX 2LD5A 5CVVA 3S32A 2Y0SA 2EZIA 1W5SA 4XQFA 1X3UA 4XLEA 4LITA 2M8EA 1TWFJ 2P5VA 3R6SA 4ZYAA 5HLGA 3I55I 1S6LA 3OYHA 2Q2EB 2ADUA 3N97A 5GP9A 4L5JA 1LDKB 2DTZA 2E1OA 3I59A 5FLXZ 4NDLA 2VC0A 2VOPA 1LDDA 3IV5A 2CJJA 3C3WA 2O8KA 2K5CA 3RTRA 1MSEC 5HVQC 3CCQI 1TC3C 1VQ6I 4ZDPA 2OBPA 2E35A 4Z2YA 1U6GA 2DODA 1Y0UA 2WC2A 3P9IA 1R7JA 3I58A 1KZHA 3CCLI 1VQLI 4XKBA 1YW7A 5H2FC 4LLLA 5IT9K 4YFNF 1EH7A 2LF8A 4XLAA 4AYBA 1IDYA 2HKXA 3G1LA 5F6FA 2Q2EA 3HM5A 5LLQA 1WH5A 3QYFA 5F08A 1A31A 5D5WB 3S2DJ 4Q47A 3KYLA 2GZWA 4N4NB 2JSPA 2A5YB 1KU7A 2IRFG 1ZYRF 2EV5A 4BHPA 5K7FA 4L5EA 4D0PA 1LVAA 3S1QJ 3H5AA 2AXLA 4PDKA 2YS9A 1BIAA 4AUXA 1BC7C 4D5CA 3AG2H 4C3IJ 3TBIA 2H8RA 2A05A 3G71I 3IKVA 1XGMA 2IGNA 3RPQA 4OIQF 2IW5A 4UNOA 5E18F 3PO3J 1Z3XA 4R79A 1Y8RB 5E3MA 2H6CA 4KISA 3P5JA 5C4XJ 2WBMA 1SVOA 2M1BA 1ON2A 2M5WA 4RB3C 3AG4H 1NHAA 4NUBA 2ME6A 3BJOA 4IJAA 1E2XA 1OPCA 4BS9A 3I4MJ 2V1NA 1RR8C 1VQ9I 1QVUA 5EG0B 3Q9VA 4DZJA 2GBYA 4LLGF 2R5YB 2HZDA 3E0JB 1F1ZA 4F52A 4KDPA 3JRIA 1QA6A 1ZR2A 2CUJA 2E34A 3ZR8X 3UR3C 4BJ5C 2X1EA 5FKMA 2HWVA 4HLXA 4YRVA 1JHHA 5LGTA 4OMYA 1N78A 5HS8A 1QGPA 3OV8A 2ESHA 4WF2A 2X1DA 3DQVC 5EEAA 4HDVA 2C6YA 3QAHA 1D8JA 4E7LA 4DYCA 1EH6A 2ELJA 2PJPA 2R7FA 4IVNA 2A6HF 1BOAA 1F4KA 5DD4A 2B9SA 1S5LC 4KIBA 2EPFA 2VKDA 3RPUA 5JLXA 1K6OA 1KYWA 3WTVC 4AM3A 2K02A 5EG0A 1IN6A 4ZTJA 2VJIA 1FMVA 4CA0A 1LFBA 2R5YA 2DT7B 3S3NA 1ETWA 3S8PA 4RBOA 3B02A 4HNVA 3ERMA 1X1PA 2CW0F 5ED4A 3G2BA 4HF0A 3GXOA 3H36A 3ZQFA 3WTSC 2IJLA 3H9QA 3RPUD 1R5HA 4HF2A 1BW6A 2DYSH 3WTZA 1MMAA 2WY7Q 2VJ4A 3M1EA 4L0YB 2IGKA 3LSGA 3OYEA 2Z33A 5BQTA 1I1SA 3OR2C 1XN7A 1R1UA 3V8KA 1TNTA 3DCFA 2NXNB 4KITB 3M7GA 2K9SA 1DP3A 1JXSA 1W5TA 2JN6A 2RAEA 5DYMA 3IH2A 2KLOA
chains in the Genus database with same CATH topology
4Y15A 2MH2A 3VOEA 5LHHA 2UXNA 2IT0A 3DF8A 2L54A 2PLYA 1ZREA 1QZYA 2KJBA 1R00A 1SD5A 1MZBA 1YTYA 2QQ9A 2EB7A 4WCGA 3DV8A 2QBYB 2STTA 1FBQA 2V1XA 1SAXA 3NRVA 4M9XA 4PZJA 2D1VA 2DBBA 2D2WA 1U78A 1REPC 2M87A 4HLYA 3W6JB 2MA3A 2A07F 4M74A 3E6DA 2XAGA 3FX3A 4IHTA 2RDPA 2PFBA 2KKOA 1RIOH 4M6XA 3WE3A 5CJ9A 1DPUA 3HHGA 1UB9A 1G3SA 4OINF 5L3BA 4G6DA 2NAZA 3O6BB 1U3EM 1PDNC 2V79A 3ZQ7A 1TQPA 4IPAA 1XCVA 4XBFA 4LLNA 4HW0A 5E8IA 3W6KB 1UFMA 3CUQB 3VODA 1ZGAA 2FOKA 1HQCA 3J80Z 1T6SA 3JAMZ 4CZZA 2RNJA 3M8FA 3M8EA 3HRTA 3IWZA 2H09A 2VONA 3WTYC 1FWZA 3IHUA 3LA3A 1FSHA 4RB0A 3U9GA 2QZ8A 4AVPA 2DPUA 4GXOA 4IRIA 3M9AA 4MHGA 3ULQB 4U0VA 4M9SA 3BJAA 3L9FA 1GHCA 3I64A 1I6XA 4OU0A 3GW2A 1ZAOA 4EV0A 4LK0F 2LNBA 5HDGA 1ZG3A 4AIKA 2EFQA 3V7CA 4OOIA 1XSDA 1J7KA 2ZXJA 1BC8C 5D8KB 5A2QK 1KU2A 2VT2A 5K5QA 1YFHA 1R23A 1B6AA 2H6BA 5DCMB 1JE8A 2XAJA 5EEGA 1BIBA 4O5VA 4ETSA 4BH9A 4LK1F 2VBYA 4YIFA 2OZ6A 4IRHA 3V4GA 4ZYEA 3BWGA 4ESFA 1KU3A 2LDUA 2XROA 2DFIA 1IXCA 4LGWA 3MQ0A 4RS8A 2J5OA 4KYWA 3G73A 1B59A 2DO7A 5D6FA 1MGTA 5FB2A 3LA2A 1HKTA 2X0LA 2L02A 3K1MA 3QP5A 4KMUX 4LB5A 4OIPF 3ECHA 3DPLC 4RGRA 1K78B 3PQJA 2EFNA 2FBIA 3TDZC 1I27A 5JI6A 2CQKA 3CUOA 5HS9A 3QP6A 1Q1HA 3F8CA 2QENA 2OZUA 4EQQA 3GZ5A 4MNUA 2O3FA 1FC3A 2JT1A 3ZMVA 1YIOA 1XD7A 2ZNYA 3KEQA 1K78A 4Q4ZF 3IC7A 5DCFA 3REOA 2OQGA 2STWA 1JHFA 4ESBA 3BPXA 1F5TA 1O7FA 3F8BA 1B1BA 2DW4A 4HA8A 3CTAA 2QM3A 3HUGA 1YO5C 5HS7A 2A6EF 4BAYA 3RYPA 2F5FA 3EYIA 1ZN2A 5F64A 4L9TA 1FYKA 1BI2A 4ZZDA 3E5QA 4BQAA 3DXJF 4MQVA 4QWQA 3J81Z 1LDJA 4LD5A 1U8RA 1FZPB 1H9TA 4K2EA 2HTJA 4YFKF 4HOBA 5BPDA 2HTSA 5J6XA 5ICFA 3V8LA 1ZH5A 2FMYA 3KP4A 4L18B 4EVIA 3F3XA 5K1YA 2FQ3A 5CVIA 3E5UA 3GUDA 1T0FA 5L3DA 1QPMA 3E6BA 5LHIA 4N9HA 1BBYA 1SD7A 2OAZA 4IRGA 2CFXA 2PEXA 5F1RA 4IXAA 5DV5A 2G7HA 1XSVA 3QRFF 2ISZA 3DPTA 1Z6TA 2FBKA 2O61A 2LF7A 2FA5A 4CYDA 1D3YA 5KVRA 4EM0B 4I7HA 3IWFA 5BS6A 3R0AA 4HQMA 5LHGA 2BEOA 3K0LA 3GFIA 2KIUA 1RZ4A 2D45A 2ZMEB 1R22A 2E1NA 3TO9A 3ECOA 4L9VA 2IVMA 2MH9A 3IKTA 4UVBA 3T5XA 3WTUC 4L0ZB 3BROA 2KJCA 2CG4A 5K5RA 4A6EA 4HQEA 4CICA 3FWEA 5ERIA 1OYWA 2PN6A 2VBXA 2R7DA 3U2RA 2Y75A 1S29A 2L4AA 1WSUA 3F8MA 5E20A 3SXYA 1TQIA 4TV7A 5D4SA 3K2ZA 2HEOA 2ESNA 2EA2A 1Z7UA 4GO1A 2JRTA 2P7CB 4KFCA 3LQRA 4G7OF 3I54A 4A2UA 3P9CA 4E70A 4I02A 3MFKA 1ON1A 1G3TA 2DU9A 2XHKA 3ZN0A 4L9JA 2PMHA 4A5NA 4UV8A 1G4DA 4BXUA 4I01A 2VE8A 2G7UA 1MD0A 3FXQA 4Y17A 3S2WA 4U0WA 3DP7A 3JSPA 3V7SA 2LKPA 4ENKA 3OOPA 3HRSA 4RGXA 3KZYA 5L3FA 5D5VB 2NRAC 1KQ9A 5ILSA 3F72A 3H3ZA 2XKPA 3ROUA 4CGZA 1FNNA 4MGRA 4EJTA 2M45A 1Z91A 2HYGD 3WE2A 5K5OA 2DI3A 4MEYF 3HOTA 5DD8A 1HKSA 2FNAA 1P92A 2QVOA 4A12A 4XSZF 4I09A 3WTTC 1W7PB 2V1DA 3ELKA 4RAZA 5CLSA 4EJUA 4YIIA 3TO6A 5CVUA 1UHWA 3EUHA 3TOBA 4N9IA 4AIHA 2TDXA 3HHHA 4EM1A 1D5VA 3U1DA 1J2XA 2QYOA 1KQ0A 4HZFA 2X4HA 2GXBA 4ON0A 1OYYA 1HW5A 4WXDA 3SZTA 1IZ1A 2XRNA 1K7AA 2ELHA 2HGCA 3R0JA 1W7PD 2YX7A 2ZJ2A 5H20A 3F6OA 2GA1A 5IT9Z 4EJVA 4WWCA 3FM5A 3MWMA 1EH8A 3TO7A 4I0BA 3WGIA 1AOYA 4WK8F 1Z6RA 2HQNA 1XMKA 4G8XA 2QUFA 2FNPA 4RB1A 1FP1D 2L01A 2ZBKA 4U7DA 2EA4A 3JTGA 1R1TA 5H6RA 3EYYA 4XRFA 1BI0A 2BYVE 1L3LA 1O3SA 4EJOA 4WX9A 3V7RA 1ZGJA 4MQ9F 2WV0A 5ICCA 3WGGA 4ZYGA 3I0TA 1O3TA 2B0LA 4KN4X 1FP2A 2DPDA 3DKWA 3BJ6A 3CUQC 2IP2A 2VXZA 2V1UA 4Y13A 3FF5A 4QLCU 1ZHFA 4ENNA 4GGGA 2PI0A 3GFMA 3QPTA 1BJAA 2OQRA 1U5TB 1P4XA 3KP2A 3I71A 1O7LA 4KICA 1IN7A 2A68F 3GF2A 4RAYA 2DAOA 2F5CA 2HYFA 2QBYA 2L4MA 4UXNA 2YPRA 3WTXC 4LB6B 2NS0A 4XLNF 2ZCWA 4BNCA 1ODDA 3O3KA 1SFXA 5D5UB 5JFRA 3ML6A 3RKXA 3PQKA 2GQQA 2P6SA 3D5LA 5JR3A 4HYEA 3GVAA 4A6DA 1UHMA 5HOOA 3SQNA 2OA4A 4KMFA 1R58A 1TQMA 2CYYA 3EQLF 4U0YA 2RKHA 4R1HA 4ESJA 3CUQA 3FHZA 1ULYA 1JGSA 4ZYHA 3COAC 5HDKA 1HSTA 5L3CA 1BI1A 5J8CA 3WGHA 3BOQA 3JSOA 1R36A 3P7NA 5FD5A 3WU1B 4WXCA 5AIQA 2E1CA 5ILVA 2P8TA 2UZKA 4MEXF 1QO0D 4KN7X 3HIFA 3LQQA 3E5XA 3RJPA 4HX7A 4ZH4F 4LG0B 3ZPLA 3WG9A 4UVCA 1RNLA 5FFXA 2MLKA 1T38A 2VOOA 4G7HF 1YQAA 3ZMUA 1XSXA 1IXSB 2ACJA 4LG0A 5DCMA 1TW3A 3LWFA 2K86A 3F22A 1OMIA 1V3FA 2JSCA 3I4PA 2FRHA 1L0OC 3SHFA 1WKMA 1SMYF 4GCVA 4I0AA 3NQOA 3RDIA 3BP8A 4A5MA 3E6CC 5BOXA 5A2QZ 1FPQA 2W84A 4UUVA 5ILUA 4H0EA 1XDUA 4I98B 3I53A 2EV6A 2FXAA 3JTHA 4MTEA 2Z9OA 2IA0A 3FM3A 1CGPA 1GXPA 2QLZA 2DT5A 4JQFA 4RGSA 3SZPA 1FX7A 2IA2A 4ASNA 3LFKA 2DK5A 5AIPA 1MJ9A 5DUKA 5FGMA 1B9NA 5L3EA 1MKMA 1FSEA 1XGNA 3KCCA 2GWRA 2HOEA 4AIJA 1BI3A 2R3SA 4HV6A 3F6VA 3C7JA 2GAUA 1DUXC 1IUYA 1TW2A 3GWZA 3HSFA 3HRMA 1C0WA 4DQ2A 1TTYA 1S3JA 2DQLA 3VFZA 2VT3A 4I2OA 1IN5A 4BHCA 2VBZA 1Z05A 5KK1A 2GA2A 1J9IA 1H0MA 1R1VA 2XKOA 3T8RA 1A04A 4G94A 3Q9SA 3H92A 2PQ8A 1LEAA 2ISYA 2HDCA 2YR2A 4FHTA 1U2WA 2P6TA 1USTA 3MAJA 3E97A 3SFZA 5CYVA 2P5KA 1K79A 1SFEA 2RC4A 2RVCA 3GZ6A 1MJBA 4EGZA 3KP5A 1MDMB 1PP7U 2XV4S 1DP7P 3L00A 4KUMA 1FT9A 5BMZA 1FBUA 2WTEA 2XASA 3TGNA 3GO5A 2K4BA 2W25A 2J5PA 5FLXK 4M71A 3FMRA 1IF1A 4YFXF 2V6CA 1LQ1A 2NNNA 1MDMA 2BE5F 4R8HA 1RUOA 1S8NA 3RI4A 1OKRA 2MD5A 3HTUA 2H94A 1SMTA 4O3MA 3B73A 2ZMEA 2EJRA 1YS7A 2Q8KA 3RKYA 4CHUA 4KIFA 3KEOA 2A69F 5FO5A 3IRRA 4ENMA 1IRFA 3GFJA 2JTVA 4P9FA 1ZRFA 1LEBA 5HDNA 3GFLA 4AD9A 1T98A 4JBAA 2XAQA 2AS5F 2P5LC 4U7BA 2W57A 2Z5UA 5FD6A 2EFOA 1XMAA 2HS5A 3RIRA 2XAHA 3J7AO 1W4MA 1R5GA 1T2KA 3ZN1A 3G3ZA 5D5XB 1D8KA 1TBXA 4IF4A 3E3VA 3KP7A 1DDNA 2BV6A 1YW9A 4L5IA 1SD6A 3ZMZA 2A3SA 1O3RA 2RN7A 1TNSA 3MEXA 2OD5A 1SFUA 2RV8A 1WQ2A 1KQ8A 4UHTA 2HFHA 1IRGA 4HAMA 4G7ZF 1GVJA 3ERED 1ZLJA 1BM9A 3BPVA 2JPBA 1ZRCA 3EETA 3C18A 2QQBA 5TJJA 1TLHB 4A0XA 1W7PA 4CXFA 2PBIA 4EGYA 1OR7A 2EFWA 3KP6A 3IL2A 4FX0A 4B8XA 3ZP5A 4HDUA 3KFWX 4P55A 2DLLA 4UVAA 2P7VB 3LSTA 3H3UA 3VB2A 2P4WA 2UWMA 4M73A 2DTRA 1KGSA 5FFZA 4FT8A 2XIGA 5L3GA 2ZNZA 2Z3YA 2ZKZA 4PGGA 5J8FA 1U5TC 5EEHA 1IXRC 1IN4A 2CWEA 3BZ6A 3F8NA 3DEUA 4HX8A 3Q5FA 1YS6A 3MZYA 1J0RA 1GXQA 4RB2C 5D4RA 4IHSA 3T1BA 4HF1A 2PG4A 2HQRA 4GYIA 2NYXA 3AAFA 1G6NA 3R60A 4PGHA 2CSOA 2L3DA 1Z1DA 2G9WA 4S04A 2O8XA 3J80K 4MTDA 3JAMK 1YG2A 4Q5SF 2EWNA 3BDDA 5DUIA 1XDSA 1IW7F 3K1PA 2MC3A 2KIFA 3VEPA 1STZA 5CVJA 1CF7B 5TRDA 2HKOA 3FMSA 2KIMA 3WODF 2DQRA 1MJAA 3MCZA 1P2FA 2V9VA 3EDPA 5E1XA 5D6EA 1G3WA 2FBHA 1UCRA 2W85A 4OIRF 1B4AA 1ONVA 5DDGA 1G3YA 4EM2A 3IRQA 4NHJA 3ZMTA 1U5TA 1CF7A 4HBLA 1KYZA 5LRSA 1ZARA 1QBJA 2VC1A 3T8TA 3TQNA 1SD4A 3QU3A 1S7AA 4XLPF 3CO7C 3DFGA 5E1WA 4CO8A 3O2PE 1ZG1A 1ZLKA 3FZVA 1OYIA 2OU2A 5JHUA 2Y48A 2JZYA 3F23A 1RI7A 3I5UA 1HSJA 5BPIA 5ICGA 2FEZA 2ETHA 5IT3A 2QQAA 1O3QA 4A0ZA 2LSOA 3TDUC 2EK5A 3ABUA 2W24A 1XCBA 1S7OA 1PUEE 3K1NA 1QZZA 2CGPA 2K7LA 3KLOA 4OMZA 1H9GA 1XGOA 3HSEA 3QU6A 2MLGA 3BY6A 1P4AA 1T39A 1YLFA 3L2CA 4ZZLA 4O6JA 5LBQA 4P9UA 3F8FA 5JVTA 1WWXA 1IN8A 2EV0A 1VTNC 4XSXF 4BYYA 1YW8A 2D1HA 3KP3A 2ZO4A 1PP8F 4U88A 5E17F 3WU0A 1HW2A 4N0BA 4DNCA 4A0YA 2H27A 3FXUA 3PFIA 4LFUA 3CJNA 1FLIA 2E7XA 3LA7A 3GYHX 3K69A 5D8LB 5AONA 1BN5A 4PCQA 1HXDA 4RGUA 3HYIA 3R61A 2JPCA 5HLIA 2XAFA 3C1DA 4S05A 1F9NA 3CDHA 1FYMA 3F21A 3FXRA 3LAJA 3RKWA 1QQIA 4NB5A 3HRUA 4FX4A 1I5ZA 2Z99A 4NQWA 4L9NA 1ZRDA 3GLXA 3J81K 1YYVA 3V8JA 3T0YA 3WTWC 2KRFA 4EMSA 5CVRA 3HTSB 2F5DA 1WRJA 3LAPA 1I1GA 4LMYA 4LJZF 1ZG5A 4EJWA 1HKQA 5LEJA 2YU3A 1HBXG 5HLHA 1P6RA 5LGNA 3TKYA 2E7WA 3P9KA 2EFPA 5E8GA 2FSWA 4JK1X 1KU9A 3QPHA 2BBYA 2IPQX 2PMUA 1E17A 2YX4A 2XVCA 3KZZA 3GX4X 1FY7A 2O6GE 3QOPA 3ZMDA 2NNYA 4G6QA 3R4KA 2DK8A 4G9YA 1J5YA 2GIVA 2QWWA 4WXHA 4GYGA 2WWYA 2VBWA 4CDGA 2ZFWA 4M6YA 2A61A 3L7WA 4HV5A 3D0SA 2FMLA 1B9MA 4Q48A 1DPRA 2GXGA 4P96A 1XB4A 2FU4A 2FF4A 2Q0OA 2CO5A 4YG2F 5LRRA 1LJ9A 1FOKA 4P5OA 2HZTA 2XGXA 3JW4A 3ZMSA 2XUBA 3ABTA 2COMA 1USSA 2F5EA 1LB2A 5H6QA 1FBSA 3E6MA 1Z9CA 2Y0MA 4BHBA 1KA8A 2FE3A 4UV9A 1O57A 2HR3A 2RQPA 2O0YA 3HOSA 2K4JA 1QNTA 5LEKA 1FYLA 3FMQA 2F2EA 2BGCA 2VN2A 3RYRA 3KETA 3ISPA 3GEZA 1AWCA 6PAXA 1P4WA 2M30A 1J59A 1RUNA 1EV7A 1LNWA 3TOAA 4KNYA 4ZYDA 2YSRA 3HSRA 2K27A 4M72A 4HX4A 4KIGA 3KE2A 3KLNA 3MZHA 1XGSA 2IA1A 3N4MA 5LGUA 4OIOF 1J75A 4AWXB 3CLOA 4M9ZA 5DEQA 1HW1A 1IAWA 2VODA 1WI9A 2VE9A 2RGVA 3K9TA 2MBFA 4ENJA 3I59B 1V4RA 4KT5C 5E1ZB 4F7ZA 3L09A 4B09A 3NEUA 3CO6C 5ICEA 2UXXA 4KA4A 2O03A 5CVVA 1W5SA 1X3UA 2M8EA 2P5VA 3R6SA 5HLGA 1S6LA 2ADUA 3N97A 4L5JA 1LDKB 3I59A 5FLXZ 2VC0A 2VOPA 1LDDA 3C3WA 3RTRA 5HVQC 2OBPA 4Z2YA 1U6GA 1Y0UA 2WC2A 3P9IA 1R7JA 3I58A 1YW7A 4LLLA 5IT9K 4YFNF 1EH7A 2LF8A 2HKXA 5F6FA 2Q2EA 5LLQA 5D5WB 4Q47A 2GZWA 2A5YB 1KU7A 2IRFG 1ZYRF 2EV5A 4BHPA 4D0PA 1LVAA 2AXLA 4PDKA 1BIAA 1BC7C 3IKVA 1XGMA 3RPQA 4OIQF 2IW5A 4UNOA 5E18F 4R79A 2H6CA 2M1BA 1ON2A 2M5WA 4RB3C 1NHAA 3BJOA 4IJAA 1E2XA 1OPCA 3Q9VA 4LLGF 4KDPA 1F1ZA 4OMYA 2HWVA 4HLXA 5LGTA 1JHHA 5HS8A 1QGPA 3OV8A 2ESHA 4WF2A 3DQVC 4HDVA 2C6YA 3QAHA 1D8JA 1EH6A 2PJPA 2R7FA 4IVNA 2A6HF 1BOAA 1F4KA 5DD4A 4KIBA 3RPUA 1K6OA 1KYWA 3WTVC 2K02A 1IN6A 3B02A 2CW0F 5ED4A 4HF0A 3GXOA 3WTSC 2IJLA 1R5HA 4HF2A 3WTZA 3M1EA 4L0YB 2Z33A 5BQTA 1I1SA 1XN7A 1R1UA 3V8KA 1TNTA 3M7GA 1JXSA 1W5TA 5DYMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4Y15 A;  2MH2 A;  3VOE A;  5LHH A;  2UXN A;  2IT0 A;  3DF8 A;  2L54 A;  2PLY A;  1ZRE A;  1QZY A;  2KJB A;  1R00 A;  1SD5 A;  1MZB A;  1YTY A;  2QQ9 A;  2EB7 A;  4WCG A;  3DV8 A;  2QBY B;  2STT A;  1FBQ A;  2V1X A;  1SAX A;  3NRV A;  4M9X A;  4PZJ A;  2D1V A;  2DBB A;  2D2W A;  1U78 A;  1REP C;  2M87 A;  4HLY A;  3W6J B;  2MA3 A;  2A07 F;  4M74 A;  3E6D A;  2XAG A;  3FX3 A;  4IHT A;  2RDP A;  2PFB A;  2KKO A;  1RIO H;  4M6X A;  3WE3 A;  5CJ9 A;  1DPU A;  3HHG A;  1UB9 A;  1G3S A;  4OIN F;  5L3B A;  4G6D A;  2NAZ A;  3O6B B;  1U3E M;  1PDN C;  2V79 A;  3ZQ7 A;  1TQP A;  4IPA A;  1XCV A;  4XBF A;  4LLN A;  4HW0 A;  5E8I A;  3W6K B;  1UFM A;  3CUQ B;  3VOD A;  1ZGA A;  2FOK A;  1HQC A;  3J80 Z;  1T6S A;  3JAM Z;  4CZZ A;  2RNJ A;  3M8F A;  3M8E A;  3HRT A;  3IWZ A;  2H09 A;  2VON A;  3WTY C;  1FWZ A;  3IHU A;  3LA3 A;  1FSH A;  4RB0 A;  3U9G A;  2QZ8 A;  4AVP A;  2DPU A;  4GXO A;  4IRI A;  3M9A A;  4MHG A;  3ULQ B;  4U0V A;  4M9S A;  3BJA A;  3L9F A;  1GHC A;  3I64 A;  1I6X A;  4OU0 A;  3GW2 A;  1ZAO A;  4EV0 A;  4LK0 F;  2LNB A;  5HDG A;  1ZG3 A;  4AIK A;  2EFQ A;  3V7C A;  4OOI A;  1XSD A;  1J7K A;  2ZXJ A;  1BC8 C;  5D8K B;  5A2Q K;  1KU2 A;  2VT2 A;  5K5Q A;  1YFH A;  1R23 A;  1B6A A;  2H6B A;  5DCM B;  1JE8 A;  2XAJ A;  5EEG A;  1BIB A;  4O5V A;  4ETS A;  4BH9 A;  4LK1 F;  2VBY A;  4YIF A;  2OZ6 A;  4IRH A;  3V4G A;  4ZYE A;  3BWG A;  4ESF A;  1KU3 A;  2LDU A;  2XRO A;  2DFI A;  1IXC A;  4LGW A;  3MQ0 A;  4RS8 A;  2J5O A;  4KYW A;  3G73 A;  1B59 A;  2DO7 A;  5D6F A;  1MGT A;  5FB2 A;  3LA2 A;  1HKT A;  2X0L A;  2L02 A;  3K1M A;  3QP5 A;  4KMU X;  4LB5 A;  4OIP F;  3ECH A;  3DPL C;  4RGR A;  1K78 B;  3PQJ A;  2EFN A;  2FBI A;  3TDZ C;  1I27 A;  5JI6 A;  2CQK A;  3CUO A;  5HS9 A;  3QP6 A;  1Q1H A;  3F8C A;  2QEN A;  2OZU A;  4EQQ A;  3GZ5 A;  4MNU A;  2O3F A;  1FC3 A;  2JT1 A;  3ZMV A;  1YIO A;  1XD7 A;  2ZNY A;  3KEQ A;  1K78 A;  4Q4Z F;  3IC7 A;  5DCF A;  3REO A;  2OQG A;  2STW A;  1JHF A;  4ESB A;  3BPX A;  1F5T A;  1O7F A;  3F8B A;  1B1B A;  2DW4 A;  4HA8 A;  3CTA A;  2QM3 A;  3HUG A;  1YO5 C;  5HS7 A;  2A6E F;  4BAY A;  3RYP A;  2F5F A;  3EYI A;  1ZN2 A;  5F64 A;  4L9T A;  1FYK A;  1BI2 A;  4ZZD A;  3E5Q A;  4BQA A;  3DXJ F;  4MQV A;  4QWQ A;  3J81 Z;  1LDJ A;  4LD5 A;  1U8R A;  1FZP B;  1H9T A;  4K2E A;  2HTJ A;  4YFK F;  4HOB A;  5BPD A;  2HTS A;  5J6X A;  5ICF A;  3V8L A;  1ZH5 A;  2FMY A;  3KP4 A;  4L18 B;  4EVI A;  3F3X A;  5K1Y A;  2FQ3 A;  5CVI A;  3E5U A;  3GUD A;  1T0F A;  5L3D A;  1QPM A;  3E6B A;  5LHI A;  4N9H A;  1BBY A;  1SD7 A;  2OAZ A;  4IRG A;  2CFX A;  2PEX A;  5F1R A;  4IXA A;  5DV5 A;  2G7H A;  1XSV A;  3QRF F;  2ISZ A;  3DPT A;  1Z6T A;  2FBK A;  2O61 A;  2LF7 A;  2FA5 A;  4CYD A;  1D3Y A;  5KVR A;  4EM0 B;  4I7H A;  3IWF A;  5BS6 A;  3R0A A;  4HQM A;  5LHG A;  2BEO A;  3K0L A;  3GFI A;  2KIU A;  1RZ4 A;  2D45 A;  2ZME B;  1R22 A;  2E1N A;  3TO9 A;  3ECO A;  4L9V A;  2IVM A;  2MH9 A;  3IKT A;  4UVB A;  3T5X A;  3WTU C;  4L0Z B;  3BRO A;  2KJC A;  2CG4 A;  5K5R A;  4A6E A;  4HQE A;  4CIC A;  3FWE A;  5ERI A;  1OYW A;  2PN6 A;  2VBX A;  2R7D A;  3U2R A;  2Y75 A;  1S29 A;  2L4A A;  1WSU A;  3F8M A;  5E20 A;  3SXY A;  1TQI A;  4TV7 A;  5D4S A;  3K2Z A;  2HEO A;  2ESN A;  2EA2 A;  1Z7U A;  4GO1 A;  2JRT A;  2P7C B;  4KFC A;  3LQR A;  4G7O F;  3I54 A;  4A2U A;  3P9C A;  4E70 A;  4I02 A;  3MFK A;  1ON1 A;  1G3T A;  2DU9 A;  2XHK A;  3ZN0 A;  4L9J A;  2PMH A;  4A5N A;  4UV8 A;  1G4D A;  4BXU A;  4I01 A;  2VE8 A;  2G7U A;  1MD0 A;  3FXQ A;  4Y17 A;  3S2W A;  4U0W A;  3DP7 A;  3JSP A;  3V7S A;  2LKP A;  4ENK A;  3OOP A;  3HRS A;  4RGX A;  3KZY A;  5L3F A;  5D5V B;  2NRA C;  1KQ9 A;  5ILS A;  3F72 A;  3H3Z A;  2XKP A;  3ROU A;  4CGZ A;  1FNN A;  4MGR A;  4EJT A;  2M45 A;  1Z91 A;  2HYG D;  3WE2 A;  5K5O A;  2DI3 A;  4MEY F;  3HOT A;  5DD8 A;  1HKS A;  2FNA A;  1P92 A;  2QVO A;  4A12 A;  4XSZ F;  4I09 A;  3WTT C;  1W7P B;  2V1D A;  3ELK A;  4RAZ A;  5CLS A;  4EJU A;  4YII A;  3TO6 A;  5CVU A;  1UHW A;  3EUH A;  3TOB A;  4N9I A;  4AIH A;  2TDX A;  3HHH A;  4EM1 A;  1D5V A;  3U1D A;  1J2X A;  2QYO A;  1KQ0 A;  4HZF A;  2X4H A;  2GXB A;  4ON0 A;  1OYY A;  1HW5 A;  4WXD A;  3SZT A;  1IZ1 A;  2XRN A;  1K7A A;  2ELH A;  2HGC A;  3R0J A;  1W7P D;  2YX7 A;  2ZJ2 A;  5H20 A;  3F6O A;  2GA1 A;  5IT9 Z;  4EJV A;  4WWC A;  3FM5 A;  3MWM A;  1EH8 A;  3TO7 A;  4I0B A;  3WGI A;  1AOY A;  4WK8 F;  1Z6R A;  2HQN A;  1XMK A;  4G8X A;  2QUF A;  2FNP A;  4RB1 A;  1FP1 D;  2L01 A;  2ZBK A;  4U7D A;  2EA4 A;  3JTG A;  1R1T A;  5H6R A;  3EYY A;  4XRF A;  1BI0 A;  2BYV E;  1L3L A;  1O3S A;  4EJO A;  4WX9 A;  3V7R A;  1ZGJ A;  4MQ9 F;  2WV0 A;  5ICC A;  3WGG A;  4ZYG A;  3I0T A;  1O3T A;  2B0L A;  4KN4 X;  1FP2 A;  2DPD A;  3DKW A;  3BJ6 A;  3CUQ C;  2IP2 A;  2VXZ A;  2V1U A;  4Y13 A;  3FF5 A;  4QLC U;  1ZHF A;  4ENN A;  4GGG A;  2PI0 A;  3GFM A;  3QPT A;  1BJA A;  2OQR A;  1U5T B;  1P4X A;  3KP2 A;  3I71 A;  1O7L A;  4KIC A;  1IN7 A;  2A68 F;  3GF2 A;  4RAY A;  2DAO A;  2F5C A;  2HYF A;  2QBY A;  2L4M A;  4UXN A;  2YPR A;  3WTX C;  4LB6 B;  2NS0 A;  4XLN F;  2ZCW A;  4BNC A;  1ODD A;  3O3K A;  1SFX A;  5D5U B;  5JFR A;  3ML6 A;  3RKX A;  3PQK A;  2GQQ A;  2P6S A;  3D5L A;  5JR3 A;  4HYE A;  3GVA A;  4A6D A;  1UHM A;  5HOO A;  3SQN A;  2OA4 A;  4KMF A;  1R58 A;  1TQM A;  2CYY A;  3EQL F;  4U0Y A;  2RKH A;  4R1H A;  4ESJ A;  3CUQ A;  3FHZ A;  1ULY A;  1JGS A;  4ZYH A;  3COA C;  5HDK A;  1HST A;  5L3C A;  1BI1 A;  5J8C A;  3WGH A;  3BOQ A;  3JSO A;  1R36 A;  3P7N A;  5FD5 A;  3WU1 B;  4WXC A;  5AIQ A;  2E1C A;  5ILV A;  2P8T A;  2UZK A;  4MEX F;  1QO0 D;  4KN7 X;  3HIF A;  3LQQ A;  3E5X A;  3RJP A;  4HX7 A;  4ZH4 F;  4LG0 B;  3ZPL A;  3WG9 A;  4UVC A;  1RNL A;  5FFX A;  2MLK A;  1T38 A;  2VOO A;  4G7H F;  1YQA A;  3ZMU A;  1XSX A;  1IXS B;  2ACJ A;  4LG0 A;  5DCM A;  1TW3 A;  3LWF A;  2K86 A;  3F22 A;  1OMI A;  1V3F A;  2JSC A;  3I4P A;  2FRH A;  1L0O C;  3SHF A;  1WKM A;  1SMY F;  4GCV A;  4I0A A;  3NQO A;  3RDI A;  3BP8 A;  4A5M A;  3E6C C;  5BOX A;  5A2Q Z;  1FPQ A;  2W84 A;  4UUV A;  5ILU A;  4H0E A;  1XDU A;  4I98 B;  3I53 A;  2EV6 A;  2FXA A;  3JTH A;  4MTE A;  2Z9O A;  2IA0 A;  3FM3 A;  1CGP A;  1GXP A;  2QLZ A;  2DT5 A;  4JQF A;  4RGS A;  3SZP A;  1FX7 A;  2IA2 A;  4ASN A;  3LFK A;  2DK5 A;  5AIP A;  1MJ9 A;  5DUK A;  5FGM A;  1B9N A;  5L3E A;  1MKM A;  1FSE A;  1XGN A;  3KCC A;  2GWR A;  2HOE A;  4AIJ A;  1BI3 A;  2R3S A;  4HV6 A;  3F6V A;  3C7J A;  2GAU A;  1DUX C;  1IUY A;  1TW2 A;  3GWZ A;  3HSF A;  3HRM A;  1C0W A;  4DQ2 A;  1TTY A;  1S3J A;  2DQL A;  3VFZ A;  2VT3 A;  4I2O A;  1IN5 A;  4BHC A;  2VBZ A;  1Z05 A;  5KK1 A;  2GA2 A;  1J9I A;  1H0M A;  1R1V A;  2XKO A;  3T8R A;  1A04 A;  4G94 A;  3Q9S A;  3H92 A;  2PQ8 A;  1LEA A;  2ISY A;  2HDC A;  2YR2 A;  4FHT A;  1U2W A;  2P6T A;  1UST A;  3MAJ A;  3E97 A;  3SFZ A;  5CYV A;  2P5K A;  1K79 A;  1SFE A;  2RC4 A;  2RVC A;  3GZ6 A;  1MJB A;  4EGZ A;  3KP5 A;  1MDM B;  1PP7 U;  2XV4 S;  1DP7 P;  3L00 A;  4KUM A;  1FT9 A;  5BMZ A;  1FBU A;  2WTE A;  2XAS A;  3TGN A;  3GO5 A;  2K4B A;  2W25 A;  2J5P A;  5FLX K;  4M71 A;  3FMR A;  1IF1 A;  4YFX F;  2V6C A;  1LQ1 A;  2NNN A;  1MDM A;  2BE5 F;  4R8H A;  1RUO A;  1S8N A;  3RI4 A;  1OKR A;  2MD5 A;  3HTU A;  2H94 A;  1SMT A;  4O3M A;  3B73 A;  2ZME A;  2EJR A;  1YS7 A;  2Q8K A;  3RKY A;  4CHU A;  4KIF A;  3KEO A;  2A69 F;  5FO5 A;  3IRR A;  4ENM A;  1IRF A;  3GFJ A;  2JTV A;  4P9F A;  1ZRF A;  1LEB A;  5HDN A;  3GFL A;  4AD9 A;  1T98 A;  4JBA A;  2XAQ A;  2AS5 F;  2P5L C;  4U7B A;  2W57 A;  2Z5U A;  5FD6 A;  2EFO A;  1XMA A;  2HS5 A;  3RIR A;  2XAH A;  3J7A O;  1W4M A;  1R5G A;  1T2K A;  3ZN1 A;  3G3Z A;  5D5X B;  1D8K A;  1TBX A;  4IF4 A;  3E3V A;  3KP7 A;  1DDN A;  2BV6 A;  1YW9 A;  4L5I A;  1SD6 A;  3ZMZ A;  2A3S A;  1O3R A;  2RN7 A;  1TNS A;  3MEX A;  2OD5 A;  1SFU A;  2RV8 A;  1WQ2 A;  1KQ8 A;  4UHT A;  2HFH A;  1IRG A;  4HAM A;  4G7Z F;  1GVJ A;  3ERE D;  1ZLJ A;  1BM9 A;  3BPV A;  2JPB A;  1ZRC A;  3EET A;  3C18 A;  2QQB A;  5TJJ A;  1TLH B;  4A0X A;  1W7P A;  4CXF A;  2PBI A;  4EGY A;  1OR7 A;  2EFW A;  3KP6 A;  3IL2 A;  4FX0 A;  4B8X A;  3ZP5 A;  4HDU A;  3KFW X;  4P55 A;  2DLL A;  4UVA A;  2P7V B;  3LST A;  3H3U A;  3VB2 A;  2P4W A;  2UWM A;  4M73 A;  2DTR A;  1KGS A;  5FFZ A;  4FT8 A;  2XIG A;  5L3G A;  2ZNZ A;  2Z3Y A;  2ZKZ A;  4PGG A;  5J8F A;  1U5T C;  5EEH A;  1IXR C;  1IN4 A;  2CWE A;  3BZ6 A;  3F8N A;  3DEU A;  4HX8 A;  3Q5F A;  1YS6 A;  3MZY A;  1J0R A;  1GXQ A;  4RB2 C;  5D4R A;  4IHS A;  3T1B A;  4HF1 A;  2PG4 A;  2HQR A;  4GYI A;  2NYX A;  3AAF A;  1G6N A;  3R60 A;  4PGH A;  2CSO A;  2L3D A;  1Z1D A;  2G9W A;  4S04 A;  2O8X A;  3J80 K;  4MTD A;  3JAM K;  1YG2 A;  4Q5S F;  2EWN A;  3BDD A;  5DUI A;  1XDS A;  1IW7 F;  3K1P A;  2MC3 A;  2KIF A;  3VEP A;  1STZ A;  5CVJ A;  1CF7 B;  5TRD A;  2HKO A;  3FMS A;  2KIM A;  3WOD F;  2DQR A;  1MJA A;  3MCZ A;  1P2F A;  2V9V A;  3EDP A;  5E1X A;  5D6E A;  1G3W A;  2FBH A;  1UCR A;  2W85 A;  4OIR F;  1B4A A;  1ONV A;  5DDG A;  1G3Y A;  4EM2 A;  3IRQ A;  4NHJ A;  3ZMT A;  1U5T A;  1CF7 A;  4HBL A;  1KYZ A;  5LRS A;  1ZAR A;  1QBJ A;  2VC1 A;  3T8T A;  3TQN A;  1SD4 A;  3QU3 A;  1S7A A;  4XLP F;  3CO7 C;  3DFG A;  5E1W A;  4CO8 A;  3O2P E;  1ZG1 A;  1ZLK A;  3FZV A;  1OYI A;  2OU2 A;  5JHU A;  2Y48 A;  2JZY A;  3F23 A;  1RI7 A;  3I5U A;  1HSJ A;  5BPI A;  5ICG A;  2FEZ A;  2ETH A;  5IT3 A;  2QQA A;  1O3Q A;  4A0Z A;  2LSO A;  3TDU C;  2EK5 A;  3ABU A;  2W24 A;  1XCB A;  1S7O A;  1PUE E;  3K1N A;  1QZZ A;  2CGP A;  2K7L A;  3KLO A;  4OMZ A;  1H9G A;  1XGO A;  3HSE A;  3QU6 A;  2MLG A;  3BY6 A;  1P4A A;  1T39 A;  1YLF A;  3L2C A;  4ZZL A;  4O6J A;  5LBQ A;  4P9U A;  3F8F A;  5JVT A;  1WWX A;  1IN8 A;  2EV0 A;  1VTN C;  4XSX F;  4BYY A;  1YW8 A;  2D1H A;  3KP3 A;  2ZO4 A;  1PP8 F;  4U88 A;  5E17 F;  3WU0 A;  1HW2 A;  4N0B A;  4DNC A;  4A0Y A;  2H27 A;  3FXU A;  3PFI A;  4LFU A;  3CJN A;  1FLI A;  2E7X A;  3LA7 A;  3GYH X;  3K69 A;  5D8L B;  5AON A;  1BN5 A;  4PCQ A;  1HXD A;  4RGU A;  3HYI A;  3R61 A;  2JPC A;  5HLI A;  2XAF A;  3C1D A;  4S05 A;  1F9N A;  3CDH A;  1FYM A;  3F21 A;  3FXR A;  3LAJ A;  3RKW A;  1QQI A;  4NB5 A;  3HRU A;  4FX4 A;  1I5Z A;  2Z99 A;  4NQW A;  4L9N A;  1ZRD A;  3GLX A;  3J81 K;  1YYV A;  3V8J A;  3T0Y A;  3WTW C;  2KRF A;  4EMS A;  5CVR A;  3HTS B;  2F5D A;  1WRJ A;  3LAP A;  1I1G A;  4LMY A;  4LJZ F;  1ZG5 A;  4EJW A;  1HKQ A;  5LEJ A;  2YU3 A;  1HBX G;  5HLH A;  1P6R A;  5LGN A;  3TKY A;  2E7W A;  3P9K A;  2EFP A;  5E8G A;  2FSW A;  4JK1 X;  1KU9 A;  3QPH A;  2BBY A;  2IPQ X;  2PMU A;  1E17 A;  2YX4 A;  2XVC A;  3KZZ A;  3GX4 X;  1FY7 A;  2O6G E;  3QOP A;  3ZMD A;  2NNY A;  4G6Q A;  3R4K A;  2DK8 A;  4G9Y A;  1J5Y A;  2GIV A;  2QWW A;  4WXH A;  4GYG A;  2WWY A;  2VBW A;  4CDG A;  2ZFW A;  4M6Y A;  2A61 A;  3L7W A;  4HV5 A;  3D0S A;  2FML A;  1B9M A;  4Q48 A;  1DPR A;  2GXG A;  4P96 A;  1XB4 A;  2FU4 A;  2FF4 A;  2Q0O A;  2CO5 A;  4YG2 F;  5LRR A;  1LJ9 A;  1FOK A;  4P5O A;  2HZT A;  2XGX A;  3JW4 A;  3ZMS A;  2XUB A;  3ABT A;  2COM A;  1USS A;  2F5E A;  1LB2 A;  5H6Q A;  1FBS A;  3E6M A;  1Z9C A;  2Y0M A;  4BHB A;  1KA8 A;  2FE3 A;  4UV9 A;  1O57 A;  2HR3 A;  2RQP A;  2O0Y A;  3HOS A;  2K4J A;  1QNT A;  5LEK A;  1FYL A;  3FMQ A;  2F2E A;  2BGC A;  2VN2 A;  3RYR A;  3KET A;  3ISP A;  3GEZ A;  1AWC A;  6PAX A;  1P4W A;  2M30 A;  1J59 A;  1RUN A;  1EV7 A;  1LNW A;  3TOA A;  4KNY A;  4ZYD A;  2YSR A;  3HSR A;  2K27 A;  4M72 A;  4HX4 A;  4KIG A;  3KE2 A;  3KLN A;  3MZH A;  1XGS A;  2IA1 A;  3N4M A;  5LGU A;  4OIO F;  1J75 A;  4AWX B;  3CLO A;  4M9Z A;  5DEQ A;  1HW1 A;  1IAW A;  2VOD A;  1WI9 A;  2VE9 A;  2RGV A;  3K9T A;  2MBF A;  4ENJ A;  3I59 B;  1V4R A;  4KT5 C;  5E1Z B;  4F7Z A;  3L09 A;  4B09 A;  3NEU A;  3CO6 C;  5ICE A;  2UXX A;  4KA4 A;  2O03 A;  5CVV A;  1W5S A;  1X3U A;  2M8E A;  2P5V A;  3R6S A;  5HLG A;  1S6L A;  2ADU A;  3N97 A;  4L5J A;  1LDK B;  3I59 A;  5FLX Z;  2VC0 A;  2VOP A;  1LDD A;  3C3W A;  3RTR A;  5HVQ C;  2OBP A;  4Z2Y A;  1U6G A;  1Y0U A;  2WC2 A;  3P9I A;  1R7J A;  3I58 A;  1YW7 A;  4LLL A;  5IT9 K;  4YFN F;  1EH7 A;  2LF8 A;  2HKX A;  5F6F A;  2Q2E A;  5LLQ A;  5D5W B;  4Q47 A;  2GZW A;  2A5Y B;  1KU7 A;  2IRF G;  1ZYR F;  2EV5 A;  4BHP A;  4D0P A;  1LVA A;  2AXL A;  4PDK A;  1BIA A;  1BC7 C;  3IKV A;  1XGM A;  3RPQ A;  4OIQ F;  2IW5 A;  4UNO A;  5E18 F;  4R79 A;  2H6C A;  2M1B A;  1ON2 A;  2M5W A;  4RB3 C;  1NHA A;  3BJO A;  4IJA A;  1E2X A;  1OPC A;  3Q9V A;  4LLG F;  4KDP A;  1F1Z A;  4OMY A;  2HWV A;  4HLX A;  5LGT A;  1JHH A;  5HS8 A;  1QGP A;  3OV8 A;  2ESH A;  4WF2 A;  3DQV C;  4HDV A;  2C6Y A;  3QAH A;  1D8J A;  1EH6 A;  2PJP A;  2R7F A;  4IVN A;  2A6H F;  1BOA A;  1F4K A;  5DD4 A;  4KIB A;  3RPU A;  1K6O A;  1KYW A;  3WTV C;  2K02 A;  1IN6 A;  3B02 A;  2CW0 F;  5ED4 A;  4HF0 A;  3GXO A;  3WTS C;  2IJL A;  1R5H A;  4HF2 A;  3WTZ A;  3M1E A;  4L0Y B;  2Z33 A;  5BQT A;  1I1S A;  1XN7 A;  1R1U A;  3V8K A;  1TNT A;  3M7G A;  1JXS A;  1W5T A;  5DYM A; 
#chains in the Genus database with same CATH topology
 4Y15 A;  2MH2 A;  3VOE A;  5LHH A;  2UXN A;  4CCO A;  2IT0 A;  5GAH J;  4IHX A;  2CQN A;  1LKX A;  4Y52 J;  3U21 A;  3DF8 A;  2L54 A;  2ZXW H;  3FBN B;  3I3L A;  2PLY A;  3OYN A;  3HZJ A;  1ZRE A;  1QZY A;  1N77 A;  3OS2 A;  2KJB A;  1R00 A;  1SD5 A;  3K4B A;  1G59 A;  1MZB A;  1YTY A;  2QQ9 A;  2EB7 A;  1RC9 A;  4WCG A;  3DV8 A;  5FLM J;  4NC8 A;  2QBY B;  3IAS 2;  2NOJ B;  4JX6 A;  2STT A;  3MVP A;  5IP7 J;  1FBQ A;  2V1X A;  1SAX A;  1XMX A;  3NRV A;  2XB5 A;  4A3D J;  3ZGK A;  1TWG J;  1QZE A;  4M9X A;  4PZJ A;  2IS4 A;  2D1V A;  1H88 C;  2DBB A;  3F9K A;  1ETO A;  2D2W A;  1U78 A;  2HU9 A;  1REP C;  2M87 A;  4X0G A;  4HLY A;  2IBD A;  2HVQ A;  2MA3 A;  3W6J B;  3CES A;  2A07 F;  2X6Y A;  3KYD B;  4M74 A;  3CF2 A;  3E6D A;  2M7B A;  2XAG A;  1X58 A;  3PM1 A;  2L9N A;  4A3G J;  4Y7N J;  3CDL A;  1E3O C;  2IGO A;  3RCO A;  3FX3 A;  1U9O A;  3BQY A;  4IHT A;  4DJA A;  2RDP A;  2PFB A;  2KKO A;  3DTI A;  3NWT A;  1RIO H;  1APL C;  4M6X A;  1CQT A;  1S9H A;  3WE3 A;  3LFU A;  5CJ9 A;  1DPU A;  2OJE D;  2CQ7 A;  1UB9 A;  1G3S A;  1WPK A;  3HHG A;  4OIN F;  4IL6 C;  3H9J A;  5L3B A;  2NVQ J;  3GZN B;  4G6D A;  4W97 A;  2NAZ A;  3O6B B;  5LD2 C;  1U3E M;  1PDN C;  2V79 A;  3ZQ7 A;  1TQP A;  1QU3 A;  4IPA A;  1XCV A;  4XBF A;  4LLN A;  1MW7 A;  4HW0 A;  5E8I A;  2AQF A;  3W6K B;  1A5J A;  1UFM A;  3CUQ B;  3VOD A;  3MMY B;  1ZGA A;  2F4O B;  5DM7 F;  2M0M A;  1IC8 A;  2FOK A;  1HQC A;  3J80 Z;  1T6S A;  3JAM Z;  2L7F P;  4CZZ A;  2RNJ A;  3M8F A;  1D0Y A;  4JP0 A;  3M8E A;  3HRT A;  3IWZ A;  2FOW A;  2I8D A;  2H09 A;  2VON A;  3WTY C;  1FWZ A;  2JMW A;  3OYM A;  2WAE A;  3IHU A;  3JR9 A;  3LA3 A;  5TGT A;  1FSH A;  4RB0 A;  1WI3 A;  3SJM A;  3W2W A;  2KZG A;  1WH7 A;  3U9G A;  4BY1 J;  3S3O A;  2QZ8 A;  2HI3 A;  1UMQ A;  4AVP A;  5J3L A;  3EUK L;  2DPU A;  2Z2S B;  3G6E I;  2F5V A;  3K10 A;  4GXO A;  4IRI A;  1Y1W J;  3M9A A;  3MKW B;  4MHG A;  2CMP A;  2XF7 A;  3ULQ B;  4U0V A;  3UKG A;  4M9S A;  4FCY A;  3BJA A;  3L9F A;  1GHC A;  3I64 A;  1I6X A;  2LVS A;  4OU0 A;  3BTI A;  3GW2 A;  1MBE A;  1NG7 A;  4IZZ A;  1ZAO A;  4IO9 F;  4EV0 A;  2W4S A;  1OLT A;  4LK0 F;  2LNB A;  5HDG A;  3K4N A;  2KRC A;  3L2W A;  4F92 B;  1ZG3 A;  1I3Q J;  4AIK A;  2EFQ A;  1QVT A;  3VSK A;  3DBR B;  3V7C A;  4OOI A;  1XSD A;  1J7K A;  1Y1V J;  4CCM A;  3OSG A;  4BEH B;  2ZXJ A;  2VQL A;  1IGN A;  1BC8 C;  5D8K B;  5A2Q K;  4UY8 I;  1KU2 A;  2TCT A;  2W00 A;  5KAF C;  2VT2 A;  3VPR A;  5K5Q A;  1YFH A;  2GXA A;  2W7N A;  1R23 A;  2R0Q C;  3AG1 H;  1FJL A;  1B6A A;  2H6B A;  3M4O J;  3AL0 C;  5DCM B;  1JE8 A;  2XAJ A;  4XKC A;  5EEG A;  3K4L A;  1BIB A;  4D9J A;  2H8W A;  4O5V A;  3Q0U A;  3IUO A;  4ETS A;  3MKL A;  2CV1 A;  4BH9 A;  2O7O A;  4YIR X;  4LK1 F;  2VBY A;  1B72 B;  4BEH A;  2LK2 A;  1XG1 A;  2OZ6 A;  4YIF A;  4IRH A;  2LBF B;  3V4G A;  4ZYE A;  2R7W A;  1T8I A;  2E2H J;  3BWG A;  3K4C A;  4ESF A;  1KU3 A;  5HOD A;  2LDU A;  2XRO A;  2DFI A;  2ZJR F;  1AU7 A;  1IXC A;  4LGW A;  3MQ0 A;  5JVG F;  3S93 A;  3S16 J;  3D5R C;  4RS8 A;  2J5O A;  4KYW A;  3B6A A;  3K70 D;  1WJC A;  2Z1D A;  2JVG A;  3H3V K;  2EIN H;  2A5W A;  3G73 A;  1B59 A;  2DO7 A;  4IHW A;  5D6F A;  1MGT A;  1ETK A;  3LA2 A;  5FB2 A;  1HKT A;  1X4O A;  2X0L A;  2L02 A;  2FJ1 A;  5F0C A;  3K1M A;  3QP5 A;  4KMU X;  4LB5 A;  2F4M B;  2KFD A;  4OIP F;  5E3N A;  3ECH A;  3DPL C;  1MBG A;  4RGR A;  1K78 B;  3FIW A;  1TWH J;  3PQJ A;  2EFN A;  2FBI A;  2DA4 A;  1B72 A;  3TDZ C;  1MSF C;  1I27 A;  4A3E J;  1UEL B;  4OWR B;  2VLA A;  2R7X A;  2JUC A;  4DW6 A;  1ENH A;  5JI6 A;  2CQK A;  2BY2 A;  4FTH A;  3CUO A;  1ZK8 A;  4NC6 A;  5HS9 A;  3QP6 A;  3OYK A;  1Q1H A;  3F8C A;  4A3M J;  3FKI J;  3IH4 A;  2QEN A;  2OZU A;  4PJ0 C;  4EQQ A;  3GZ5 A;  4MNU A;  2O3F A;  1FC3 A;  2JT1 A;  5M5X J;  3FBI B;  3ZMV A;  1YIO A;  1XD7 A;  2K3P A;  1TZL A;  2ZNY A;  3KEQ A;  1K78 A;  2OTJ I;  2LLK A;  4Q4Z F;  3IC7 A;  2KIS A;  5DCF A;  3REO A;  2OQG A;  2STW A;  1JHF A;  4ESB A;  1OJL A;  3BPX A;  3JRF A;  3OYG A;  1F5T A;  2LOO A;  2BHZ A;  5KAI C;  3CP2 A;  5J1R A;  1O7F A;  2IS2 A;  3F8B A;  2WA0 A;  5DTD A;  1B1B A;  5GTH C;  2JA6 J;  2EZK A;  2DW4 A;  4HG2 A;  3BZC A;  2QF7 A;  1QPI A;  2KPM A;  2KHM A;  4HA8 A;  3CTA A;  4QPQ A;  3G1O A;  2QM3 A;  1YJW I;  5GPC A;  3EUA A;  3DTK A;  1O4X A;  3HUG A;  1YO5 C;  2A6T A;  5HS7 A;  2A6E F;  2OC6 A;  4BAY A;  3RYP A;  2O9L A;  3LSH A;  2F5F A;  1X19 A;  3EYI A;  3OS1 A;  1ZN2 A;  1QRY A;  4L9T A;  5F64 A;  1FYK A;  1BI2 A;  4ZZD A;  3E5Q A;  1DU6 A;  4BQA A;  3DXJ F;  1FOX A;  1HDP A;  2V7F A;  4MQV A;  4QWQ A;  3J81 Z;  1LDJ A;  4LD5 A;  4E7J A;  4ZJZ A;  1U8R A;  2ZSI B;  4ZTF A;  1FZP B;  1H9T A;  4K2E A;  2HOA A;  2HTJ A;  4YFK F;  4HOB A;  2F48 A;  5BPD A;  2HTS A;  3HB9 A;  5J6X A;  3RSN A;  2PMZ A;  3ONQ A;  5ICF A;  3V8L A;  1VQ5 I;  2RRE A;  5CPR B;  1ZH5 A;  2V26 A;  2FMY A;  2ZXH A;  3KP4 A;  4L18 B;  2FQ4 A;  4EVI A;  1W36 D;  3F3X A;  3HG9 A;  5K1Y A;  1JTY A;  2DA1 A;  2ME0 A;  2FQ3 A;  1VQK I;  2KP6 A;  2R7S A;  5CVI A;  3TW7 A;  3E5U A;  3GUD A;  1T0F A;  3PL8 A;  1HA8 A;  4MLO A;  2WAQ N;  3JRD A;  4PK4 A;  4E7I A;  1VZ0 A;  1WJ5 A;  5L3D A;  4OAY A;  1RR7 A;  4C30 A;  1QPM A;  3E6B A;  5LHI A;  4N9H A;  1BBY A;  1OQY A;  3W2V A;  1SD7 A;  5B1A H;  3QQA A;  3S2H J;  2VKH A;  5J47 A;  2CS3 A;  2OAZ A;  2L7M P;  4LIV A;  4IRG A;  2CFX A;  2PEX A;  4BDZ A;  5F1R A;  4IXA A;  3CC2 I;  5DV5 A;  4DZP A;  2G7H A;  2K40 A;  1BOB A;  2EIM H;  1XSV A;  2L2O A;  3QRF F;  2ISZ A;  2TRT A;  2I10 A;  2E1M B;  2CQQ A;  3DPT A;  5EJC A;  1Z6T A;  2FBK A;  3PUF A;  1V55 H;  2LF7 A;  3QYB A;  2FA5 A;  4CYD A;  2O61 A;  1D3Y A;  5KVR A;  4EM0 B;  2EIJ H;  4I7H A;  3IWF A;  1NH3 A;  2JA2 A;  5BS6 A;  1P7I A;  3R0A A;  1A36 A;  3FK6 A;  4HQM A;  5LHG A;  2Y9Z A;  1E3H A;  1K4T A;  1IG7 A;  2BEO A;  3K0L A;  4RAG A;  3GFI A;  2KIU A;  1LE8 B;  1RZ4 A;  2D45 A;  2ZME B;  1R22 A;  2K9Q A;  2E1N A;  2MAB A;  3ECO A;  3ESW B;  3TO9 A;  3OR1 C;  3JCU C;  4L9V A;  1FTT A;  5IY5 H;  2IVM A;  2MH9 A;  4RA2 A;  1POG A;  3IKT A;  4UVB A;  3T5X A;  3WTU C;  4L0Z B;  2NOG A;  3H5N A;  3BRO A;  2KJC A;  2CG4 A;  5K5R A;  4A6E A;  1TWA J;  4CIC A;  3FWE A;  4HQE A;  5ERI A;  3K6G A;  1FTZ A;  1OYW A;  4FIS A;  2PN6 A;  2JK3 A;  3SDB A;  2VBX A;  3J7Y J;  3LL7 A;  2R7D A;  3U2R A;  2Y75 A;  1S29 A;  1ERD A;  4XLC A;  1Y56 A;  2L4A A;  3FXJ A;  1WSU A;  3F8M A;  1GUU A;  2MC4 A;  5E20 A;  3SXY A;  1TQI A;  3J7A Y;  4TV7 A;  1WJE A;  5D4S A;  3K2Z A;  2HEO A;  1I50 J;  2ESN A;  3BR5 A;  3A0B C;  2EA2 A;  1Z7U A;  3QOD A;  4GO1 A;  2JRT A;  3BG3 A;  1SVL A;  1FIP A;  2G0E A;  2P7C B;  4KFC A;  3LQR A;  4G7O F;  1ZEL A;  3I54 A;  2ZSH B;  2CH0 A;  3P9C A;  4A2U A;  3I4N J;  4Y3O A;  4E70 A;  4A3C J;  2CFO A;  4I02 A;  1MH4 A;  3MFK A;  1ON1 A;  1G3T A;  1RPW A;  2DU9 A;  2XSJ C;  4PJL A;  2YU9 J;  2XHK A;  3ZN0 A;  2B7E A;  4L9J A;  2R7R A;  2PMH A;  4A5N A;  1Y39 A;  4UV8 A;  1G4D A;  4I01 A;  4BXU A;  2VE8 A;  5M5Y J;  2G7U A;  1MD0 A;  2DT6 A;  3FXQ A;  4Y17 A;  4ZC3 A;  3S2W A;  2ECB A;  4U0W A;  1D5Y A;  4BBS J;  4MFE A;  3DP7 A;  4XM3 A;  5F0H A;  3JSP A;  3V7S A;  2LKP A;  4ENK A;  3OOP A;  3PO2 J;  3HRS A;  4BJ6 C;  4RGX A;  1UG0 A;  3KZY A;  5L3F A;  5D5V B;  2NRA C;  2R7O A;  3GME A;  1YI2 I;  1KQ9 A;  2CUF A;  4IHV A;  1X2N A;  5ILS A;  4XRM A;  4QPO A;  1Z67 A;  2EH3 A;  3LSM A;  1JT6 A;  3F72 A;  3H3Z A;  3V42 A;  3JRA A;  2XKP A;  3ROU A;  4CGZ A;  1FNN A;  3CCE I;  4MGR A;  2X6X A;  4DBQ A;  4EJT A;  2M45 A;  2OCC H;  1Z91 A;  3LSK A;  3BR0 A;  2HYG D;  2BZT A;  3OYC A;  3ZRG A;  3C2H A;  2R7V A;  3E7L A;  3WE2 A;  5K5O A;  1T95 A;  4M3D A;  2DI3 A;  4MEY F;  3HOT A;  5DD8 A;  4BAC A;  4XON A;  1HKS A;  2FNA A;  1P92 A;  2QVO A;  3DLL F;  2EQR A;  4A12 A;  2M3A A;  1YX3 A;  4I09 A;  4XSZ F;  3WTT C;  1NK2 P;  1MBF A;  2CV0 A;  4XOT A;  1W7P B;  2V1D A;  3ELK A;  1X4P A;  4RAZ A;  2MD0 A;  4D7N A;  5CLS A;  4EJU A;  4YII A;  4KJZ A;  2ZJQ F;  2LMD A;  3GLL A;  3TO6 A;  1W5C C;  3BR6 A;  4HPQ A;  5HNF A;  5K7H A;  5CVU A;  1UHW A;  3EUH A;  3S17 J;  3HKZ N;  4A3K J;  2V9P A;  3TOB A;  4N9I A;  4AIH A;  5FLV A;  2X85 A;  2TDX A;  2XF6 A;  3AFH A;  3HHH A;  3I9V 2;  4PSX A;  2KQR A;  4EM1 A;  4XLH A;  2NVU B;  3L2U A;  1SFO J;  1UZC A;  3VDX A;  2VQH A;  1VQM I;  1D5V A;  3U1D A;  3LOC A;  1J2X A;  2QYO A;  1KQ0 A;  4XN3 A;  3BTL A;  4DIQ A;  4HZF A;  2X4H A;  2LY9 A;  2GXB A;  4ON0 A;  2JA7 J;  1OYY A;  1HC8 A;  1HW5 A;  4D1Q A;  1WJD A;  2X48 A;  4WXD A;  4XIC A;  3SZT A;  1IZ1 A;  3L2R A;  2VQC A;  3GTJ J;  1U8B A;  2M9H A;  4BKX A;  2XRN A;  4BL0 B;  1K7A A;  1WCM J;  2VKE A;  4AVZ A;  4BQN A;  2ELH A;  2HGC A;  3R0J A;  1W7P D;  2YX7 A;  4MFD A;  4AID A;  2ZJ2 A;  3DBL B;  3PSF A;  1R49 A;  3OOU A;  5KCM A;  5H20 A;  3F6O A;  2GA1 A;  3SDG A;  2R7Q A;  2HYJ A;  5E3O A;  5IT9 Z;  1EJ9 A;  1I6H J;  4EJV A;  4WWC A;  3FM5 A;  3H0G J;  1ETY A;  1FIA A;  3MWM A;  4XKW A;  1EH8 A;  1JUM A;  3QWL A;  3TO7 A;  2LG4 A;  4I0B A;  3WGI A;  3JRC A;  1AOY A;  4WK8 F;  1Z6R A;  2BVM A;  2HQN A;  1MNE A;  1XMK A;  4G8X A;  2PJR B;  3QPS A;  2QUF A;  5F0F A;  1GVD A;  2XAU A;  2FNP A;  5GPA A;  1JGG A;  4RB1 A;  1QHH D;  1FP1 D;  2EZH A;  2L01 A;  2L9S A;  1GV5 A;  2ZBK A;  5EZH A;  2MFZ A;  3G4S I;  4U7D A;  2EA4 A;  2JWT A;  2R5Z B;  3JTG A;  2VIX A;  1VQ4 I;  2E5Z A;  2Y9Y A;  1R1T A;  5H6R A;  1Y0N A;  3CJQ B;  3EYY A;  4XRF A;  1BI0 A;  2BYV E;  3A1Y A;  1L3L A;  5E3L A;  1O3S A;  4GDF A;  1LFP A;  3OL4 A;  4EJO A;  4WX9 A;  5B66 C;  3V7R A;  1ZGJ A;  4MQ9 F;  2WV0 A;  5ICC A;  3WGG A;  2PJR A;  4ZYG A;  2DMU A;  2GOX B;  3I0T A;  1O3T A;  2B0L A;  4KN4 X;  1FP2 A;  4Y33 A;  2DPD A;  5M3M J;  3BG6 A;  3DKW A;  3BJ6 A;  1GV2 A;  3BT9 A;  1PUF B;  3K4K A;  4PJJ A;  2FUG 2;  3CUQ C;  2IP2 A;  2VXZ A;  3CME I;  2V1U A;  4Y13 A;  3FF5 A;  4QLC U;  1ZHF A;  4ENN A;  4GGG A;  4NC7 A;  3RZD J;  2PI0 A;  3GFM A;  3QPT A;  3BC8 A;  2MGQ A;  4MO7 A;  4XOR A;  2WB1 N;  1BJA A;  5IP9 J;  1WFX A;  2VL8 A;  2OQR A;  1NK3 P;  1U5T B;  4RMN A;  1R4N B;  2QSG X;  1P4X A;  2W48 A;  3KP2 A;  2IS6 A;  3I71 A;  1O7L A;  3GBG A;  4KIC A;  2BW3 B;  4RDU A;  1IN7 A;  1K61 A;  2X6O A;  2FD5 A;  3FDY A;  2A68 F;  3KEY A;  3HOU J;  3GF2 A;  3PNV A;  4A3J J;  1VQ7 I;  3OSF A;  5J4Y A;  4RAY A;  2DAO A;  2F5C A;  2HYF A;  2QBY A;  2L4M A;  4B44 A;  3BCA A;  3MZ8 A;  4UXN A;  1K83 J;  4A3I J;  3S14 J;  3CCU I;  1ACI A;  2YPR A;  3WTX C;  2DMP A;  4D5F A;  1JUP A;  3DEW A;  2W82 A;  3NAR A;  2HPI A;  4LB6 B;  3BR2 A;  2NS0 A;  2HQ5 A;  4YEL A;  4XLN F;  3ASN H;  4UUT A;  2ZCW A;  4BNC A;  1ODD A;  2XRL A;  2LR8 A;  3O3K A;  1SFX A;  5D5U B;  3NWS A;  5GAD J;  5JFR A;  2LYC A;  3B6C A;  4MIM A;  3ML6 A;  3RKX A;  2LKX A;  3PQK A;  3MKY B;  3BZK A;  2GQQ A;  2DCE A;  2P6S A;  3ABM H;  3D5L A;  1YE9 A;  3K70 C;  5JR3 A;  4HYE A;  3AKZ A;  1FEX A;  4H4K C;  9ANT A;  3GVA A;  3Q3S A;  1UHM A;  4A6D A;  3DU6 A;  5HOO A;  3SQN A;  4HNT A;  2OA4 A;  4KMF A;  2PX9 A;  4FE4 A;  1R58 A;  1TQM A;  1K4S A;  2MG4 A;  2OPT A;  2NS7 A;  4RM3 A;  2CYY A;  3EQL F;  4U0Y A;  1WHU A;  1RES A;  2RKH A;  4F93 B;  3K7A J;  4R1H A;  1JT0 A;  4ESJ A;  1NG6 A;  3CUQ A;  3FHZ A;  1ULY A;  1JGS A;  4XN0 A;  4ZYH A;  2R92 J;  3DKY A;  3COA C;  1XTA A;  3HC7 A;  5J1U A;  5HDK A;  1HST A;  3BQZ A;  3HPH A;  2BY3 A;  5L3C A;  3ZQC A;  2MYS A;  1BI1 A;  4II3 A;  2KMU A;  5J8C A;  4GFB A;  4X1E A;  3BOQ A;  3WGH A;  1R36 A;  2GIZ A;  5GAE J;  3JSO A;  1YRN B;  3L1P A;  3P7N A;  3HL2 A;  1D1C A;  4BY7 J;  1TWC J;  3GTP J;  1OCZ H;  2VUM J;  4NBQ A;  5FD5 A;  1UG2 A;  4WXC A;  3WU1 B;  3X2Q H;  4BGD A;  5AIQ A;  2E1C A;  4E7Z A;  5ILV A;  1UAA A;  3O8G A;  2P8T A;  2UZK A;  4MEX F;  3HOW J;  1QO0 D;  4KN7 X;  3HIF A;  4CCN A;  4RAF A;  3LQQ A;  2XPV A;  4IOC F;  3OL3 A;  2JA5 J;  4RM2 A;  3E5X A;  1EA3 A;  1YRN A;  3RJP A;  5HLT A;  3BG9 A;  4HX7 A;  1WVR A;  1TL8 A;  4ZH4 F;  4LG0 B;  2V6E A;  4FAS D;  3ZPL A;  3S1N J;  3WG9 A;  4UVC A;  4C3H J;  2R7U A;  1RNL A;  5FFX A;  2L5Q A;  2MLK A;  2NVT J;  4C3J J;  1GLN A;  3JRH A;  2CV2 A;  1D1A A;  4I6Z A;  1T38 A;  2VOO A;  1ETV A;  2KRH A;  3MKZ A;  4G7H F;  1YQA A;  3ZMU A;  2VPL A;  1XSX A;  4CUG A;  1T33 A;  3ZCO A;  1IXS B;  3MD2 A;  3CCV I;  2ACJ A;  4HRI A;  4LG0 A;  5IOY A;  2LC2 A;  5DCM A;  4QSH A;  1YIT I;  1HDD C;  1TW3 A;  3LWF A;  2K86 A;  4JX5 A;  3F22 A;  1Z77 A;  1H89 C;  2LRE A;  5EYR A;  3CCR I;  5C3E J;  1OMI A;  1JJ8 C;  1V3F A;  3J7Z I;  2JSC A;  3I4P A;  5J1Y A;  2Y0S N;  2FRH A;  2XGD A;  1L0O C;  3SHF A;  1BR2 A;  2QA4 I;  2VB6 A;  1W36 C;  1WKM A;  1X2M A;  3KPH A;  4FQG A;  2LBF A;  2JQ7 A;  1SMY F;  4GCV A;  3H5R A;  4M3F A;  3C2G A;  4I0A A;  2L9V A;  1IDZ A;  1MH3 A;  3OYD A;  5C4J J;  5FRN A;  3TP3 A;  3RQI A;  3NQO A;  3RDI A;  3BP8 A;  3UNG C;  4A5M A;  3QOE A;  1V5E A;  3E6C C;  3TL4 X;  1JUS A;  1R6R A;  2DOA A;  4ITV A;  5BOX A;  2EIK H;  3HEF A;  5A2Q Z;  1FPQ A;  1T0F C;  2W84 A;  4QTR A;  3OWT A;  4V2F A;  4AU7 A;  4UUV A;  2M4K A;  5ILU A;  4H0E A;  1XDU A;  4AYB N;  4I98 B;  3I53 A;  2DFF A;  2JJ7 A;  2RNG A;  2EV6 A;  3VYR B;  2UUZ A;  5F1J A;  2FXA A;  3JTH A;  4MTE A;  2Z9O A;  3CLQ A;  2IA0 A;  3FM3 A;  1RRJ A;  2WAF A;  1CGP A;  1GXP A;  2QLZ A;  2DT5 A;  2EZL A;  4JQF A;  4RGS A;  3SZP A;  1DU0 A;  1FX7 A;  5IYB J;  2IA2 A;  3M07 A;  1AA7 A;  4ASN A;  5IYD J;  3LFK A;  2DK5 A;  5AIP A;  4B43 A;  3BLY A;  2E36 A;  1LFU P;  1MJ9 A;  5DUK A;  4UUS B;  2HOS A;  5FGM A;  1WJB A;  4B4C A;  2H1K A;  1B9N A;  2P0W A;  3WU2 C;  5L3E A;  1MKM A;  3WHC A;  1FSE A;  1XGN A;  2H1L A;  3KCC A;  4A3B J;  1YX5 A;  2GWR A;  2HOE A;  2HQA A;  2VI6 A;  1LUJ B;  5DM6 F;  4AIJ A;  1BI3 A;  1A6I A;  2R3S A;  1DQU A;  1BJZ A;  5IYC J;  4HV6 A;  3F6V A;  3C7J A;  1D1B A;  1RKW A;  5BNG A;  2GAU A;  1DUX C;  1IUY A;  2KIQ A;  2CUZ A;  4XRS G;  1TW2 A;  3GWZ A;  3HSF A;  1Y6I A;  2E1M C;  2DFH A;  1BR4 A;  4E6K G;  3HRM A;  2Q1Z B;  1C0W A;  4DQ2 A;  2IAI A;  1TTY A;  1VQN I;  1S3J A;  2DQL A;  3VFZ A;  3LSP A;  4J00 A;  2VT3 A;  4I2O A;  1IN5 A;  4BHC A;  2VBZ A;  1Z05 A;  5KK1 A;  4M6V A;  3E1S A;  2GA2 A;  1P7J A;  3FXO A;  1ETQ A;  1J9I A;  1H0M A;  1R1V A;  3OYL A;  2XKO A;  1A6Q A;  3T8R A;  1A04 A;  2ZME C;  4DYR A;  4M3E A;  4G94 A;  3Q9S A;  3K2A A;  1V5F A;  1PYV A;  3OIQ A;  4CCJ A;  3H92 A;  2PQ8 A;  3PIP F;  1LEA A;  2ISY A;  2CQX A;  3Q0W A;  1N75 A;  3MN2 A;  2VKV A;  1YJ9 I;  2HDC A;  2HVR A;  2OF7 A;  1N25 A;  2YR2 A;  3A02 A;  4FHT A;  1U2W A;  2P6T A;  1UST A;  3MAJ A;  1W0T A;  2R7T A;  4UB8 C;  3E97 A;  5F04 A;  1MMG A;  3SFZ A;  5CYV A;  3GTG J;  2P5K A;  4C2M J;  1K79 A;  2HPM A;  1SFE A;  4ZDO A;  3PFY A;  2DFE A;  2Y30 A;  5E79 C;  2RC4 A;  2RVC A;  3GZ6 A;  1MJB A;  4EGZ A;  1X1A A;  5IOZ A;  3KP5 A;  4P1W A;  1SFK A;  1LPQ A;  1MDM B;  1PP7 U;  2M4G A;  4IEJ A;  2XV4 S;  3HDD A;  1DP7 P;  1E0E A;  3GTO J;  4A93 J;  3L00 A;  4KUM A;  1FT9 A;  4LOC A;  5BMZ A;  2JUG A;  1FBU A;  2WTE A;  2XAS A;  3TGN A;  4IKF A;  3GTM J;  3GO5 A;  2K4B A;  2W25 A;  3BR3 A;  2J5P A;  3FKJ A;  5FLX K;  1F43 A;  4M71 A;  3FMR A;  3IP4 B;  1IF1 A;  4E7H A;  4YFX F;  2V6C A;  2AXT C;  1LQ1 A;  2X51 A;  3O8H A;  2NNN A;  1YOV B;  4RLF A;  3U1K A;  4B47 A;  1MDM A;  3NAU A;  3WG7 H;  2BE5 F;  2V4J C;  3DEE A;  2DA6 A;  4EAT A;  4R8H A;  4Z6Y A;  3CJR B;  1RUO A;  1PJR A;  1S8N A;  1IRX A;  3RI4 A;  1OKR A;  2MD5 A;  3HTU A;  3QYE A;  2KL4 A;  2H94 A;  1SMT A;  2DMQ A;  4IQJ A;  4O3M A;  2ICW G;  3B73 A;  2L0K A;  4PFO A;  1VND A;  1LE8 A;  2I5U A;  2E71 A;  2ZME A;  2EJR A;  1IV8 A;  1YS7 A;  2Q8K A;  3AG3 H;  3RKY A;  1ZGW A;  2IGM A;  2GLO A;  2IEK A;  4CHU A;  2HXI A;  2DDA A;  2L7K A;  3EUH C;  2D5V A;  3HOX J;  4DOZ A;  3HOV J;  4PUS A;  4KIF A;  2BXY A;  1Z21 A;  3KEO A;  5TIS C;  2M7A A;  2LH9 A;  3BR1 A;  2A69 F;  3CCY A;  5B3S H;  5GTI C;  3CC7 I;  5FO5 A;  5J4V A;  3IRR A;  3CMM A;  4ENM A;  1V54 H;  1IRF A;  3GFJ A;  2JTV A;  4P9F A;  3SYT A;  2DA3 A;  1ZRF A;  1LEB A;  4X6A J;  2RQQ A;  5HDN A;  3GFL A;  3F0C A;  4AD9 A;  1T98 A;  4JBA A;  2XAQ A;  2AS5 F;  1I39 A;  2EBI A;  5EZG A;  2P5L C;  3D5S C;  3A2K A;  4U7B A;  2W57 A;  2Z5U A;  5FD6 A;  4HNU A;  5EGO B;  5FKL A;  3VYT B;  2O5R A;  2EFO A;  1Z0X A;  2QKM B;  4A69 C;  1G2H A;  1XMA A;  2X6W A;  1U0J A;  3CF5 F;  1RKT A;  2HS5 A;  4BUP A;  3PJR A;  1YIJ I;  3IH3 A;  3RIR A;  2XAH A;  3M8J A;  4CZC A;  3J7A O;  1W4M A;  1R5G A;  4XRS A;  1T2K A;  1SC7 A;  3A03 A;  1IV6 A;  3BCB A;  2LFB A;  3ZN1 A;  2R7Z J;  3G3Z A;  5D5X B;  1D8K A;  1TBX A;  4IF4 A;  3E3V A;  3KP7 A;  4LG3 A;  1DDN A;  2BV6 A;  1YW9 A;  4L5I A;  3L2Q A;  1A35 A;  5EGO A;  2QQ8 A;  4ZDL A;  1SD6 A;  5K7Z A;  3ZMZ A;  2A3S A;  1O3R A;  2DXI A;  2RN7 A;  2M2E A;  1TNS A;  4DYQ A;  3MEX A;  2OD5 A;  3OYJ A;  3DPU A;  1SFU A;  2RV8 A;  3FXK A;  1WQ2 A;  1KQ8 A;  4UHT A;  1X1B A;  2XSD C;  2HFH A;  1IRG A;  3TED A;  4HAM A;  2HDD A;  4G7Z F;  1GVJ A;  3ZQI A;  3ERE D;  3TW6 A;  1ZLJ A;  1LVK A;  1BM9 A;  3BPV A;  2NS8 A;  2JPB A;  3ZXS A;  5CQG A;  1ZRC A;  4IQ4 A;  3EET A;  3C18 A;  2QQB A;  1OCC H;  5TJJ A;  2COB A;  2OV7 A;  1Z7L A;  2ECC A;  4XNF A;  1JI8 A;  1TLH B;  2VJ5 A;  3LSJ A;  3KZI C;  4A0X A;  4J01 A;  4QIW N;  3PUB A;  1X1C A;  1W7P A;  2BOL A;  4CXF A;  2PBI A;  2E60 A;  2M8G X;  4EGY A;  1OR7 A;  3HGY A;  2EFW A;  3KP6 A;  3IL2 A;  2R93 J;  4V2G A;  4FX0 A;  4C2T A;  3FHN A;  3LNQ A;  2Y2Z A;  4B8X A;  3ZP5 A;  2E5N A;  3FXL A;  4HDU A;  3EPZ A;  3KFW X;  4P55 A;  2DLL A;  4UVA A;  2P7V B;  4J19 A;  1NTC A;  3LST A;  2NVX J;  3CQZ J;  3H3U A;  2UV1 A;  3VB2 A;  2LY1 A;  3ZQH A;  2P4W A;  2UWM A;  4S0H B;  2AHQ A;  4B1R A;  2WY8 Q;  3FK7 A;  4M73 A;  2DTR A;  1KGS A;  5LFA A;  5FFZ A;  4BE2 A;  2ID3 A;  4FT8 A;  3HGG A;  2XIG A;  4JYK A;  5L3G A;  2ZNZ A;  2Z3Y A;  4A3F J;  3KYC B;  2DDB A;  2LKS A;  2ZKZ A;  1AKH B;  3KX2 A;  4PGG A;  1U5T C;  5EEH A;  2DMN A;  2N8G A;  5J8F A;  5FJ8 J;  4ANJ A;  3JRE A;  3HJE A;  2WAQ A;  4UB6 C;  4C9Y A;  1ETX A;  5KNL A;  1IXR C;  1WGX A;  4BE0 A;  1R4M B;  1IN4 A;  2CRG A;  2CWE A;  3BZ6 A;  3F8N A;  2LRD A;  3DEU A;  4HX8 A;  3CDI A;  1VFC A;  3Q5F A;  1YS6 A;  3CD6 I;  1D0X A;  3PIO F;  3MZY A;  1ZR4 A;  4DGW B;  5FRM A;  4B3A A;  1J0R A;  1MNM C;  1GXQ A;  4RB2 C;  1R5I D;  5D4R A;  4IHS A;  2JA8 J;  3T1B A;  4HF1 A;  1T08 B;  3HBL A;  2PG4 A;  2HQR A;  1IUF A;  3GCM A;  4GYI A;  4HEA 2;  2NYX A;  1AKH A;  3AAF A;  3GTQ J;  1G6N A;  3ZQQ A;  2L9R A;  3R60 A;  3PNT A;  4PGH A;  2CSO A;  1ITY A;  2L3D A;  1Z1D A;  2G9W A;  2R5Z A;  3S1M J;  3RZO J;  1QHG A;  4YEJ A;  1X1D A;  4S04 A;  4EEF G;  2O8X A;  5B1B H;  3J80 K;  4E7K A;  4MTD A;  3JAM K;  1YG2 A;  4Q5S F;  2EWN A;  2ID6 A;  3BDD A;  1Y8Q B;  1GDT A;  4V19 K;  2OUM A;  2JRM A;  5DUI A;  3A01 B;  1XDS A;  1IW7 F;  1UHS A;  1JJ6 C;  3K1P A;  3I56 I;  2XC7 A;  2MC3 A;  2KIF A;  3VEP A;  1STZ A;  3HPG A;  5CVJ A;  4BE1 A;  2QCO A;  1CF7 B;  4M3B A;  5TRD A;  1SAN A;  4I76 A;  2HKO A;  3FMS A;  2K9N A;  2KDO A;  2KIM A;  2XGC A;  2DQR A;  3WOD F;  3LSI A;  1MJA A;  3MCZ A;  1P2F A;  1S72 I;  2VJJ A;  2BXZ A;  5C44 J;  2V9V A;  2XDV A;  1WJA A;  2X9D A;  3EDP A;  5E1X A;  1PUF A;  3H9G A;  3S15 J;  5D6E A;  1PVE A;  1G3W A;  3CCS I;  2FBH A;  1UCR A;  2W85 A;  4PJM A;  1W1W E;  2JVH A;  4OIR F;  1B4A A;  4LIU A;  3A01 A;  1ONV A;  4I99 C;  1EKE A;  5DDG A;  3SEZ A;  1G3Y A;  4EM2 A;  3IRQ A;  4NHJ A;  3ZMT A;  2BY1 A;  3L2V A;  1U5T A;  4IX7 A;  4U87 A;  4HBL A;  1CF7 A;  2HOT A;  1KYZ A;  3PSI A;  1P9Q C;  2LY2 A;  1ZAR A;  5LRS A;  2QGU A;  2NVY J;  1QBJ A;  2ZXI A;  1MIJ A;  1OCP A;  2BW3 A;  2DN0 A;  2VC1 A;  3T8T A;  3TQN A;  1SD4 A;  3QU3 A;  1VF9 A;  1S7A A;  4XMY A;  1ORK A;  4XLP F;  1VQO I;  1B8I B;  1BR1 A;  2QEX I;  3CMA I;  2OTL I;  3CO7 C;  1EF4 A;  3DFG A;  2DJI A;  5E1W A;  2IXS A;  3O2P E;  4CO8 A;  1ZG1 A;  2ELK A;  1R71 A;  1ZLK A;  3FZV A;  4GRI A;  2PMZ N;  1OYI A;  2OU2 A;  2XPW A;  5JHU A;  2Y48 A;  2JZY A;  3F23 A;  1RI7 A;  4C2U A;  3I5U A;  3GTK J;  2KZV A;  1HSJ A;  2MW8 A;  2W1O A;  2CW8 A;  3OYB A;  5BPI A;  1F36 A;  4F3Q A;  2FEZ A;  5ICG A;  1ZKG A;  2ETH A;  3ABL H;  1VQP I;  2VXD A;  2DOE A;  2CUE A;  2DOF A;  3HXL A;  1B8I A;  2B63 J;  5IT3 A;  2QQA A;  3DBH B;  1O3Q A;  3CC4 I;  4A0Z A;  2EIL H;  2LSO A;  3TDU C;  2EK5 A;  3OY9 A;  3ABU A;  4E4H A;  2W24 A;  4ABZ A;  1XCB A;  4XR6 A;  1S7O A;  4XID A;  1FOW A;  5KHD A;  1PUE E;  4RLQ A;  1OFC X;  3K1N A;  1U9N A;  2ZJP F;  1MMN A;  3H1C A;  1QZZ A;  2F4I A;  3W2A A;  3BG5 A;  2CGP A;  4OAZ A;  2K7L A;  2L7Z A;  1X3W B;  3KLO A;  1H9G A;  1XGO A;  4OMZ A;  3HSE A;  3QU6 A;  1S7E A;  2MLG A;  4G6T B;  3BY6 A;  3G1M A;  1P4A A;  1T39 A;  1BL0 A;  1YLF A;  2VQG A;  5HNH A;  1E3P A;  3L2C A;  2KT0 A;  3LSR A;  1HF0 A;  4ZZL A;  1XX5 A;  4O6J A;  5LBQ A;  3SFI A;  1MBH A;  4NNJ A;  3SEQ A;  3JRG A;  3QPL A;  5F27 A;  3HKZ A;  4P9U A;  1D0Z A;  2E2I J;  3F8F A;  5JVT A;  2BY0 A;  1WWX A;  4PSW A;  1IN8 A;  3C2B A;  2EV0 A;  4XSX F;  4BYY A;  1VTN C;  1YW8 A;  2D1H A;  3KP3 A;  2ZO4 A;  4CH7 A;  2K3F A;  1RET A;  3KIO A;  1PP8 F;  4U88 A;  5E17 F;  3WU0 A;  1HW2 A;  4E7S A;  4N0B A;  4DNC A;  4A0Y A;  3WHB A;  2H27 A;  3FXU A;  3PFI A;  4JOM A;  4LFU A;  3ABK H;  1JKR C;  3CJN A;  1FLI A;  3DKX A;  3SZG A;  1WJF A;  1HCR A;  2E7X A;  4CYC B;  3LA7 A;  3BTJ A;  3GYH X;  3K69 A;  5D8L B;  5AON A;  1HOM A;  1BN5 A;  4NQW B;  4PCQ A;  1HXD A;  5CQE A;  1OCR H;  5JLW A;  1VQ8 I;  2YUS A;  2K9L A;  3DU5 A;  1OCO H;  2E19 A;  2F6C A;  3A0H C;  2ZB9 A;  4RGU A;  3GTL J;  4DBR A;  2K9M A;  3BG7 A;  2XGE A;  3HYI A;  4BXF A;  3R61 A;  2JPC A;  5HLI A;  2XAF A;  3C1D A;  4M3G A;  4CSW A;  4S05 A;  4G12 A;  1F9N A;  4BU2 A;  3CDH A;  1FYM A;  3F21 A;  2WV1 A;  3FXR A;  2HVS A;  1Q1V A;  3LAJ A;  3RKW A;  1QQI A;  4CYC A;  4NB5 A;  3HRU A;  1SAU A;  4PJN A;  3M1C A;  4FX4 A;  1I5Z A;  2Z99 A;  4NQW A;  4L9N A;  5JHF A;  1ZRD A;  2IS1 A;  4IOA F;  3GLX A;  3J81 K;  1YYV A;  3BTC A;  3D1N I;  2M34 A;  1MND A;  3V8J A;  3CMY A;  2DMT A;  3T0Y A;  3WTW C;  2KRF A;  1DGR M;  4EMS A;  4F91 B;  5CVR A;  3HTS B;  3W6V A;  4FET A;  2F5D A;  1WRJ A;  4D7M A;  3LAP A;  1I1G A;  5EDN A;  4LMY A;  1FOY A;  3AL0 B;  4LJZ F;  3TMO A;  1OIS A;  4EJW A;  1HKQ A;  1ZG5 A;  2R4G A;  1IJW C;  5LEJ A;  2YU3 A;  1HBX G;  1R9T J;  4A3L J;  1JTX A;  4II2 A;  5B5E C;  1KON A;  5HLH A;  2XPU A;  1P6R A;  1WZ2 A;  5LGN A;  1BA5 A;  3TKY A;  1HLV A;  3VYU B;  3K4M A;  3ZOB A;  3HOZ J;  2E7W A;  4XKV A;  3W3C A;  2AQE A;  3P9K A;  5J40 A;  4BDY A;  2EFP A;  5E8G A;  2FSW A;  4JK1 X;  2MSY A;  3HUG B;  1KU9 A;  2QKL B;  2X1C A;  3QPH A;  2BBY A;  1TT0 A;  1TP4 A;  2WB1 A;  2IPQ X;  2PMU A;  1E17 A;  1SVM A;  3A4C A;  2YX4 A;  2XVC A;  3OIP A;  2XF5 A;  2DA5 A;  3ZQL A;  3CZ6 A;  3KZZ A;  3OYA A;  4BQQ A;  3GX4 X;  1FY7 A;  2O6G E;  3QOP A;  2V9K A;  3ZMD A;  2NNY A;  4G6Q A;  2QSH X;  3R4K A;  1G8X A;  3S1R J;  2DK8 A;  1JKP C;  4G9Y A;  3ASO H;  1J5Y A;  2GIV A;  3H35 A;  1IO2 A;  3LMM A;  3RKQ A;  2QWW A;  1H8A C;  4WXH A;  5IPA A;  5CKT A;  2BVL A;  1Z3Y A;  2WAD A;  4GYG A;  2WWY A;  1M1E B;  2VBW A;  2XB0 X;  1XS9 A;  4UUS A;  1VI0 A;  3TP0 A;  4BXX J;  3JRB A;  2HNH A;  4CDG A;  2ZFW A;  4M6Y A;  2A61 A;  3L7W A;  1K6Y A;  3DLA A;  1ZQ3 P;  2Z16 A;  3D0S A;  4HV5 A;  2FML A;  3CCM I;  1B9M A;  3OYI A;  4JX4 A;  4Q48 A;  3S3M A;  1DPR A;  2GXG A;  4P96 A;  1X3Z B;  5FRO A;  2DJN A;  1XB4 A;  3IAM 2;  1BW5 A;  1OCT C;  2FU4 A;  4AC0 A;  2FF4 A;  2OCE A;  2Q0O A;  2CO5 A;  2BHY A;  3OIO A;  3OMY A;  4W1U A;  5LRR A;  4PFP A;  1LJ9 A;  4YG2 F;  1FOK A;  2VPR A;  4P5O A;  1DGW Y;  2HZT A;  2LP0 A;  4BBR J;  3M3Y J;  2XGX A;  3JW4 A;  3CJT B;  3ZMS A;  1I3A A;  2XUB A;  3CP8 A;  3ABT A;  2COM A;  1USS A;  2F5E A;  1LB2 A;  5H6Q A;  2FX0 A;  1JKQ C;  1FBS A;  3E6M A;  5M3F J;  1W0U A;  1Z9C A;  2DA7 A;  2Y0M A;  4BHB A;  3CCJ I;  4XLF A;  4BQO A;  1KA8 A;  4HST A;  2FE3 A;  5EF6 A;  4UV9 A;  4KT6 A;  4IHY A;  4HSR A;  1O57 A;  2HR3 A;  2CU7 A;  1MMD A;  1FMW A;  2RQP A;  1YHQ I;  2O0Y A;  2GM4 A;  3HOS A;  2K4J A;  1QNT A;  1YJN I;  1GT0 C;  5LEK A;  1UJ8 A;  2DA2 A;  5FKN A;  1FYL A;  1JKO C;  2AO9 A;  3ZQG A;  3FMQ A;  2F2E A;  2BGC A;  2Y31 A;  3FXM A;  1J09 A;  2VN2 A;  5DS9 A;  3RYR A;  2M0C A;  3PNY A;  3ISP A;  3KET A;  2E2J J;  2LTP A;  3VSL A;  3GEZ A;  1AWC A;  4B48 A;  6PAX A;  4N4O B;  1P4W A;  2VAS A;  2M30 A;  4XL9 A;  3H0D A;  3OS0 A;  3FIS A;  3N05 A;  1J59 A;  1RUN A;  1EV7 A;  3VYS B;  2HDW A;  3K4J A;  4Y4R A;  4XOP A;  3OYF A;  1ZTR A;  1LNW A;  3TOA A;  1TT5 B;  4KNY A;  5FKO A;  2CW7 A;  1AHD P;  4BJT A;  5M5W J;  4ZYD A;  1MMS A;  2YSR A;  2GOM A;  2DYR H;  3HSR A;  3VWB A;  2K27 A;  3HOY J;  4M72 A;  4HX4 A;  4KIG A;  3KE2 A;  3KLN A;  2ZC2 A;  3MZH A;  1XGS A;  3Q0V A;  2IA1 A;  2P81 A;  5FKK A;  3N4M A;  5LGU A;  4OIO F;  4F55 A;  5GAG J;  5IP6 A;  1J75 A;  4B3X A;  4AWX B;  1MBJ A;  3CLO A;  4M9Z A;  5DEQ A;  4FE7 A;  1T56 A;  1V5G A;  1XC5 A;  2Y69 H;  1HW1 A;  1IAW A;  4CCK A;  1MBK A;  2VOD A;  1WI9 A;  4CCL A;  2VE9 A;  3DTE A;  4XK4 A;  2RGV A;  3RQ4 A;  3K9T A;  2MBF A;  2KDZ A;  4ENJ A;  3I59 B;  1V4R A;  4KT5 C;  5E1Z B;  2K85 A;  1XPX A;  4F7Z A;  2HXO A;  3L09 A;  1OR7 C;  4B09 A;  3NEU A;  3CO6 C;  1SEU A;  1IRZ A;  5ICE A;  2UXX A;  2ZFU A;  3DWL E;  4KA4 A;  2O03 A;  2QSF X;  2LD5 A;  5CVV A;  3S32 A;  2Y0S A;  2EZI A;  1W5S A;  4XQF A;  1X3U A;  4XLE A;  4LIT A;  2M8E A;  1TWF J;  2P5V A;  3R6S A;  4ZYA A;  5HLG A;  3I55 I;  1S6L A;  3OYH A;  2Q2E B;  2ADU A;  3N97 A;  5GP9 A;  4L5J A;  1LDK B;  2DTZ A;  2E1O A;  3I59 A;  5FLX Z;  4NDL A;  2VC0 A;  2VOP A;  1LDD A;  3IV5 A;  2CJJ A;  3C3W A;  2O8K A;  2K5C A;  3RTR A;  1MSE C;  5HVQ C;  3CCQ I;  1TC3 C;  1VQ6 I;  4ZDP A;  2OBP A;  2E35 A;  4Z2Y A;  1U6G A;  2DOD A;  1Y0U A;  2WC2 A;  3P9I A;  1R7J A;  3I58 A;  1KZH A;  3CCL I;  1VQL I;  4XKB A;  1YW7 A;  5H2F C;  4LLL A;  5IT9 K;  4YFN F;  1EH7 A;  2LF8 A;  4XLA A;  4AYB A;  1IDY A;  2HKX A;  3G1L A;  5F6F A;  2Q2E A;  3HM5 A;  5LLQ A;  1WH5 A;  3QYF A;  5F08 A;  1A31 A;  5D5W B;  3S2D J;  4Q47 A;  3KYL A;  2GZW A;  4N4N B;  2JSP A;  2A5Y B;  1KU7 A;  2IRF G;  1ZYR F;  2EV5 A;  4BHP A;  5K7F A;  4L5E A;  4D0P A;  1LVA A;  3S1Q J;  3H5A A;  2AXL A;  4PDK A;  2YS9 A;  1BIA A;  4AUX A;  1BC7 C;  4D5C A;  3AG2 H;  4C3I J;  3TBI A;  2H8R A;  2A05 A;  3G71 I;  3IKV A;  1XGM A;  2IGN A;  3RPQ A;  4OIQ F;  2IW5 A;  4UNO A;  5E18 F;  3PO3 J;  1Z3X A;  4R79 A;  1Y8R B;  5E3M A;  2H6C A;  4KIS A;  3P5J A;  5C4X J;  2WBM A;  1SVO A;  2M1B A;  1ON2 A;  2M5W A;  4RB3 C;  3AG4 H;  1NHA A;  4NUB A;  2ME6 A;  3BJO A;  4IJA A;  1E2X A;  1OPC A;  4BS9 A;  3I4M J;  2V1N A;  1RR8 C;  1VQ9 I;  1QVU A;  5EG0 B;  3Q9V A;  4DZJ A;  2GBY A;  4LLG F;  2R5Y B;  2HZD A;  3E0J B;  1F1Z A;  4F52 A;  4KDP A;  3JRI A;  1QA6 A;  1ZR2 A;  2CUJ A;  2E34 A;  3ZR8 X;  3UR3 C;  4BJ5 C;  2X1E A;  5FKM A;  2HWV A;  4HLX A;  4YRV A;  1JHH A;  5LGT A;  4OMY A;  1N78 A;  5HS8 A;  1QGP A;  3OV8 A;  2ESH A;  4WF2 A;  2X1D A;  3DQV C;  5EEA A;  4HDV A;  2C6Y A;  3QAH A;  1D8J A;  4E7L A;  4DYC A;  1EH6 A;  2ELJ A;  2PJP A;  2R7F A;  4IVN A;  2A6H F;  1BOA A;  1F4K A;  5DD4 A;  2B9S A;  1S5L C;  4KIB A;  2EPF A;  2VKD A;  3RPU A;  5JLX A;  1K6O A;  1KYW A;  3WTV C;  4AM3 A;  2K02 A;  5EG0 A;  1IN6 A;  4ZTJ A;  2VJI A;  1FMV A;  4CA0 A;  1LFB A;  2R5Y A;  2DT7 B;  3S3N A;  1ETW A;  3S8P A;  4RBO A;  3B02 A;  4HNV A;  3ERM A;  1X1P A;  2CW0 F;  5ED4 A;  3G2B A;  4HF0 A;  3GXO A;  3H36 A;  3ZQF A;  3WTS C;  2IJL A;  3H9Q A;  3RPU D;  1R5H A;  4HF2 A;  1BW6 A;  2DYS H;  3WTZ A;  1MMA A;  2WY7 Q;  2VJ4 A;  3M1E A;  4L0Y B;  2IGK A;  3LSG A;  3OYE A;  2Z33 A;  5BQT A;  1I1S A;  3OR2 C;  1XN7 A;  1R1U A;  3V8K A;  1TNT A;  3DCF A;  2NXN B;  4KIT B;  3M7G A;  2K9S A;  1DP3 A;  1JXS A;  1W5T A;  2JN6 A;  2RAE A;  5DYM A;  3IH2 A;  2KLO A; 
#chains in the Genus database with same CATH homology
 4Y15 A;  2MH2 A;  3VOE A;  5LHH A;  2UXN A;  2IT0 A;  3DF8 A;  2L54 A;  2PLY A;  1ZRE A;  1QZY A;  2KJB A;  1R00 A;  1SD5 A;  1MZB A;  1YTY A;  2QQ9 A;  2EB7 A;  4WCG A;  3DV8 A;  2QBY B;  2STT A;  1FBQ A;  2V1X A;  1SAX A;  3NRV A;  4M9X A;  4PZJ A;  2D1V A;  2DBB A;  2D2W A;  1U78 A;  1REP C;  2M87 A;  4HLY A;  3W6J B;  2MA3 A;  2A07 F;  4M74 A;  3E6D A;  2XAG A;  3FX3 A;  4IHT A;  2RDP A;  2PFB A;  2KKO A;  1RIO H;  4M6X A;  3WE3 A;  5CJ9 A;  1DPU A;  3HHG A;  1UB9 A;  1G3S A;  4OIN F;  5L3B A;  4G6D A;  2NAZ A;  3O6B B;  1U3E M;  1PDN C;  2V79 A;  3ZQ7 A;  1TQP A;  4IPA A;  1XCV A;  4XBF A;  4LLN A;  4HW0 A;  5E8I A;  3W6K B;  1UFM A;  3CUQ B;  3VOD A;  1ZGA A;  2FOK A;  1HQC A;  3J80 Z;  1T6S A;  3JAM Z;  4CZZ A;  2RNJ A;  3M8F A;  3M8E A;  3HRT A;  3IWZ A;  2H09 A;  2VON A;  3WTY C;  1FWZ A;  3IHU A;  3LA3 A;  1FSH A;  4RB0 A;  3U9G A;  2QZ8 A;  4AVP A;  2DPU A;  4GXO A;  4IRI A;  3M9A A;  4MHG A;  3ULQ B;  4U0V A;  4M9S A;  3BJA A;  3L9F A;  1GHC A;  3I64 A;  1I6X A;  4OU0 A;  3GW2 A;  1ZAO A;  4EV0 A;  4LK0 F;  2LNB A;  5HDG A;  1ZG3 A;  4AIK A;  2EFQ A;  3V7C A;  4OOI A;  1XSD A;  1J7K A;  2ZXJ A;  1BC8 C;  5D8K B;  5A2Q K;  1KU2 A;  2VT2 A;  5K5Q A;  1YFH A;  1R23 A;  1B6A A;  2H6B A;  5DCM B;  1JE8 A;  2XAJ A;  5EEG A;  1BIB A;  4O5V A;  4ETS A;  4BH9 A;  4LK1 F;  2VBY A;  4YIF A;  2OZ6 A;  4IRH A;  3V4G A;  4ZYE A;  3BWG A;  4ESF A;  1KU3 A;  2LDU A;  2XRO A;  2DFI A;  1IXC A;  4LGW A;  3MQ0 A;  4RS8 A;  2J5O A;  4KYW A;  3G73 A;  1B59 A;  2DO7 A;  5D6F A;  1MGT A;  5FB2 A;  3LA2 A;  1HKT A;  2X0L A;  2L02 A;  3K1M A;  3QP5 A;  4KMU X;  4LB5 A;  4OIP F;  3ECH A;  3DPL C;  4RGR A;  1K78 B;  3PQJ A;  2EFN A;  2FBI A;  3TDZ C;  1I27 A;  5JI6 A;  2CQK A;  3CUO A;  5HS9 A;  3QP6 A;  1Q1H A;  3F8C A;  2QEN A;  2OZU A;  4EQQ A;  3GZ5 A;  4MNU A;  2O3F A;  1FC3 A;  2JT1 A;  3ZMV A;  1YIO A;  1XD7 A;  2ZNY A;  3KEQ A;  1K78 A;  4Q4Z F;  3IC7 A;  5DCF A;  3REO A;  2OQG A;  2STW A;  1JHF A;  4ESB A;  3BPX A;  1F5T A;  1O7F A;  3F8B A;  1B1B A;  2DW4 A;  4HA8 A;  3CTA A;  2QM3 A;  3HUG A;  1YO5 C;  5HS7 A;  2A6E F;  4BAY A;  3RYP A;  2F5F A;  3EYI A;  1ZN2 A;  5F64 A;  4L9T A;  1FYK A;  1BI2 A;  4ZZD A;  3E5Q A;  4BQA A;  3DXJ F;  4MQV A;  4QWQ A;  3J81 Z;  1LDJ A;  4LD5 A;  1U8R A;  1FZP B;  1H9T A;  4K2E A;  2HTJ A;  4YFK F;  4HOB A;  5BPD A;  2HTS A;  5J6X A;  5ICF A;  3V8L A;  1ZH5 A;  2FMY A;  3KP4 A;  4L18 B;  4EVI A;  3F3X A;  5K1Y A;  2FQ3 A;  5CVI A;  3E5U A;  3GUD A;  1T0F A;  5L3D A;  1QPM A;  3E6B A;  5LHI A;  4N9H A;  1BBY A;  1SD7 A;  2OAZ A;  4IRG A;  2CFX A;  2PEX A;  5F1R A;  4IXA A;  5DV5 A;  2G7H A;  1XSV A;  3QRF F;  2ISZ A;  3DPT A;  1Z6T A;  2FBK A;  2O61 A;  2LF7 A;  2FA5 A;  4CYD A;  1D3Y A;  5KVR A;  4EM0 B;  4I7H A;  3IWF A;  5BS6 A;  3R0A A;  4HQM A;  5LHG A;  2BEO A;  3K0L A;  3GFI A;  2KIU A;  1RZ4 A;  2D45 A;  2ZME B;  1R22 A;  2E1N A;  3TO9 A;  3ECO A;  4L9V A;  2IVM A;  2MH9 A;  3IKT A;  4UVB A;  3T5X A;  3WTU C;  4L0Z B;  3BRO A;  2KJC A;  2CG4 A;  5K5R A;  4A6E A;  4HQE A;  4CIC A;  3FWE A;  5ERI A;  1OYW A;  2PN6 A;  2VBX A;  2R7D A;  3U2R A;  2Y75 A;  1S29 A;  2L4A A;  1WSU A;  3F8M A;  5E20 A;  3SXY A;  1TQI A;  4TV7 A;  5D4S A;  3K2Z A;  2HEO A;  2ESN A;  2EA2 A;  1Z7U A;  4GO1 A;  2JRT A;  2P7C B;  4KFC A;  3LQR A;  4G7O F;  3I54 A;  4A2U A;  3P9C A;  4E70 A;  4I02 A;  3MFK A;  1ON1 A;  1G3T A;  2DU9 A;  2XHK A;  3ZN0 A;  4L9J A;  2PMH A;  4A5N A;  4UV8 A;  1G4D A;  4BXU A;  4I01 A;  2VE8 A;  2G7U A;  1MD0 A;  3FXQ A;  4Y17 A;  3S2W A;  4U0W A;  3DP7 A;  3JSP A;  3V7S A;  2LKP A;  4ENK A;  3OOP A;  3HRS A;  4RGX A;  3KZY A;  5L3F A;  5D5V B;  2NRA C;  1KQ9 A;  5ILS A;  3F72 A;  3H3Z A;  2XKP A;  3ROU A;  4CGZ A;  1FNN A;  4MGR A;  4EJT A;  2M45 A;  1Z91 A;  2HYG D;  3WE2 A;  5K5O A;  2DI3 A;  4MEY F;  3HOT A;  5DD8 A;  1HKS A;  2FNA A;  1P92 A;  2QVO A;  4A12 A;  4XSZ F;  4I09 A;  3WTT C;  1W7P B;  2V1D A;  3ELK A;  4RAZ A;  5CLS A;  4EJU A;  4YII A;  3TO6 A;  5CVU A;  1UHW A;  3EUH A;  3TOB A;  4N9I A;  4AIH A;  2TDX A;  3HHH A;  4EM1 A;  1D5V A;  3U1D A;  1J2X A;  2QYO A;  1KQ0 A;  4HZF A;  2X4H A;  2GXB A;  4ON0 A;  1OYY A;  1HW5 A;  4WXD A;  3SZT A;  1IZ1 A;  2XRN A;  1K7A A;  2ELH A;  2HGC A;  3R0J A;  1W7P D;  2YX7 A;  2ZJ2 A;  5H20 A;  3F6O A;  2GA1 A;  5IT9 Z;  4EJV A;  4WWC A;  3FM5 A;  3MWM A;  1EH8 A;  3TO7 A;  4I0B A;  3WGI A;  1AOY A;  4WK8 F;  1Z6R A;  2HQN A;  1XMK A;  4G8X A;  2QUF A;  2FNP A;  4RB1 A;  1FP1 D;  2L01 A;  2ZBK A;  4U7D A;  2EA4 A;  3JTG A;  1R1T A;  5H6R A;  3EYY A;  4XRF A;  1BI0 A;  2BYV E;  1L3L A;  1O3S A;  4EJO A;  4WX9 A;  3V7R A;  1ZGJ A;  4MQ9 F;  2WV0 A;  5ICC A;  3WGG A;  4ZYG A;  3I0T A;  1O3T A;  2B0L A;  4KN4 X;  1FP2 A;  2DPD A;  3DKW A;  3BJ6 A;  3CUQ C;  2IP2 A;  2VXZ A;  2V1U A;  4Y13 A;  3FF5 A;  4QLC U;  1ZHF A;  4ENN A;  4GGG A;  2PI0 A;  3GFM A;  3QPT A;  1BJA A;  2OQR A;  1U5T B;  1P4X A;  3KP2 A;  3I71 A;  1O7L A;  4KIC A;  1IN7 A;  2A68 F;  3GF2 A;  4RAY A;  2DAO A;  2F5C A;  2HYF A;  2QBY A;  2L4M A;  4UXN A;  2YPR A;  3WTX C;  4LB6 B;  2NS0 A;  4XLN F;  2ZCW A;  4BNC A;  1ODD A;  3O3K A;  1SFX A;  5D5U B;  5JFR A;  3ML6 A;  3RKX A;  3PQK A;  2GQQ A;  2P6S A;  3D5L A;  5JR3 A;  4HYE A;  3GVA A;  4A6D A;  1UHM A;  5HOO A;  3SQN A;  2OA4 A;  4KMF A;  1R58 A;  1TQM A;  2CYY A;  3EQL F;  4U0Y A;  2RKH A;  4R1H A;  4ESJ A;  3CUQ A;  3FHZ A;  1ULY A;  1JGS A;  4ZYH A;  3COA C;  5HDK A;  1HST A;  5L3C A;  1BI1 A;  5J8C A;  3WGH A;  3BOQ A;  3JSO A;  1R36 A;  3P7N A;  5FD5 A;  3WU1 B;  4WXC A;  5AIQ A;  2E1C A;  5ILV A;  2P8T A;  2UZK A;  4MEX F;  1QO0 D;  4KN7 X;  3HIF A;  3LQQ A;  3E5X A;  3RJP A;  4HX7 A;  4ZH4 F;  4LG0 B;  3ZPL A;  3WG9 A;  4UVC A;  1RNL A;  5FFX A;  2MLK A;  1T38 A;  2VOO A;  4G7H F;  1YQA A;  3ZMU A;  1XSX A;  1IXS B;  2ACJ A;  4LG0 A;  5DCM A;  1TW3 A;  3LWF A;  2K86 A;  3F22 A;  1OMI A;  1V3F A;  2JSC A;  3I4P A;  2FRH A;  1L0O C;  3SHF A;  1WKM A;  1SMY F;  4GCV A;  4I0A A;  3NQO A;  3RDI A;  3BP8 A;  4A5M A;  3E6C C;  5BOX A;  5A2Q Z;  1FPQ A;  2W84 A;  4UUV A;  5ILU A;  4H0E A;  1XDU A;  4I98 B;  3I53 A;  2EV6 A;  2FXA A;  3JTH A;  4MTE A;  2Z9O A;  2IA0 A;  3FM3 A;  1CGP A;  1GXP A;  2QLZ A;  2DT5 A;  4JQF A;  4RGS A;  3SZP A;  1FX7 A;  2IA2 A;  4ASN A;  3LFK A;  2DK5 A;  5AIP A;  1MJ9 A;  5DUK A;  5FGM A;  1B9N A;  5L3E A;  1MKM A;  1FSE A;  1XGN A;  3KCC A;  2GWR A;  2HOE A;  4AIJ A;  1BI3 A;  2R3S A;  4HV6 A;  3F6V A;  3C7J A;  2GAU A;  1DUX C;  1IUY A;  1TW2 A;  3GWZ A;  3HSF A;  3HRM A;  1C0W A;  4DQ2 A;  1TTY A;  1S3J A;  2DQL A;  3VFZ A;  2VT3 A;  4I2O A;  1IN5 A;  4BHC A;  2VBZ A;  1Z05 A;  5KK1 A;  2GA2 A;  1J9I A;  1H0M A;  1R1V A;  2XKO A;  3T8R A;  1A04 A;  4G94 A;  3Q9S A;  3H92 A;  2PQ8 A;  1LEA A;  2ISY A;  2HDC A;  2YR2 A;  4FHT A;  1U2W A;  2P6T A;  1UST A;  3MAJ A;  3E97 A;  3SFZ A;  5CYV A;  2P5K A;  1K79 A;  1SFE A;  2RC4 A;  2RVC A;  3GZ6 A;  1MJB A;  4EGZ A;  3KP5 A;  1MDM B;  1PP7 U;  2XV4 S;  1DP7 P;  3L00 A;  4KUM A;  1FT9 A;  5BMZ A;  1FBU A;  2WTE A;  2XAS A;  3TGN A;  3GO5 A;  2K4B A;  2W25 A;  2J5P A;  5FLX K;  4M71 A;  3FMR A;  1IF1 A;  4YFX F;  2V6C A;  1LQ1 A;  2NNN A;  1MDM A;  2BE5 F;  4R8H A;  1RUO A;  1S8N A;  3RI4 A;  1OKR A;  2MD5 A;  3HTU A;  2H94 A;  1SMT A;  4O3M A;  3B73 A;  2ZME A;  2EJR A;  1YS7 A;  2Q8K A;  3RKY A;  4CHU A;  4KIF A;  3KEO A;  2A69 F;  5FO5 A;  3IRR A;  4ENM A;  1IRF A;  3GFJ A;  2JTV A;  4P9F A;  1ZRF A;  1LEB A;  5HDN A;  3GFL A;  4AD9 A;  1T98 A;  4JBA A;  2XAQ A;  2AS5 F;  2P5L C;  4U7B A;  2W57 A;  2Z5U A;  5FD6 A;  2EFO A;  1XMA A;  2HS5 A;  3RIR A;  2XAH A;  3J7A O;  1W4M A;  1R5G A;  1T2K A;  3ZN1 A;  3G3Z A;  5D5X B;  1D8K A;  1TBX A;  4IF4 A;  3E3V A;  3KP7 A;  1DDN A;  2BV6 A;  1YW9 A;  4L5I A;  1SD6 A;  3ZMZ A;  2A3S A;  1O3R A;  2RN7 A;  1TNS A;  3MEX A;  2OD5 A;  1SFU A;  2RV8 A;  1WQ2 A;  1KQ8 A;  4UHT A;  2HFH A;  1IRG A;  4HAM A;  4G7Z F;  1GVJ A;  3ERE D;  1ZLJ A;  1BM9 A;  3BPV A;  2JPB A;  1ZRC A;  3EET A;  3C18 A;  2QQB A;  5TJJ A;  1TLH B;  4A0X A;  1W7P A;  4CXF A;  2PBI A;  4EGY A;  1OR7 A;  2EFW A;  3KP6 A;  3IL2 A;  4FX0 A;  4B8X A;  3ZP5 A;  4HDU A;  3KFW X;  4P55 A;  2DLL A;  4UVA A;  2P7V B;  3LST A;  3H3U A;  3VB2 A;  2P4W A;  2UWM A;  4M73 A;  2DTR A;  1KGS A;  5FFZ A;  4FT8 A;  2XIG A;  5L3G A;  2ZNZ A;  2Z3Y A;  2ZKZ A;  4PGG A;  5J8F A;  1U5T C;  5EEH A;  1IXR C;  1IN4 A;  2CWE A;  3BZ6 A;  3F8N A;  3DEU A;  4HX8 A;  3Q5F A;  1YS6 A;  3MZY A;  1J0R A;  1GXQ A;  4RB2 C;  5D4R A;  4IHS A;  3T1B A;  4HF1 A;  2PG4 A;  2HQR A;  4GYI A;  2NYX A;  3AAF A;  1G6N A;  3R60 A;  4PGH A;  2CSO A;  2L3D A;  1Z1D A;  2G9W A;  4S04 A;  2O8X A;  3J80 K;  4MTD A;  3JAM K;  1YG2 A;  4Q5S F;  2EWN A;  3BDD A;  5DUI A;  1XDS A;  1IW7 F;  3K1P A;  2MC3 A;  2KIF A;  3VEP A;  1STZ A;  5CVJ A;  1CF7 B;  5TRD A;  2HKO A;  3FMS A;  2KIM A;  3WOD F;  2DQR A;  1MJA A;  3MCZ A;  1P2F A;  2V9V A;  3EDP A;  5E1X A;  5D6E A;  1G3W A;  2FBH A;  1UCR A;  2W85 A;  4OIR F;  1B4A A;  1ONV A;  5DDG A;  1G3Y A;  4EM2 A;  3IRQ A;  4NHJ A;  3ZMT A;  1U5T A;  1CF7 A;  4HBL A;  1KYZ A;  5LRS A;  1ZAR A;  1QBJ A;  2VC1 A;  3T8T A;  3TQN A;  1SD4 A;  3QU3 A;  1S7A A;  4XLP F;  3CO7 C;  3DFG A;  5E1W A;  4CO8 A;  3O2P E;  1ZG1 A;  1ZLK A;  3FZV A;  1OYI A;  2OU2 A;  5JHU A;  2Y48 A;  2JZY A;  3F23 A;  1RI7 A;  3I5U A;  1HSJ A;  5BPI A;  5ICG A;  2FEZ A;  2ETH A;  5IT3 A;  2QQA A;  1O3Q A;  4A0Z A;  2LSO A;  3TDU C;  2EK5 A;  3ABU A;  2W24 A;  1XCB A;  1S7O A;  1PUE E;  3K1N A;  1QZZ A;  2CGP A;  2K7L A;  3KLO A;  4OMZ A;  1H9G A;  1XGO A;  3HSE A;  3QU6 A;  2MLG A;  3BY6 A;  1P4A A;  1T39 A;  1YLF A;  3L2C A;  4ZZL A;  4O6J A;  5LBQ A;  4P9U A;  3F8F A;  5JVT A;  1WWX A;  1IN8 A;  2EV0 A;  1VTN C;  4XSX F;  4BYY A;  1YW8 A;  2D1H A;  3KP3 A;  2ZO4 A;  1PP8 F;  4U88 A;  5E17 F;  3WU0 A;  1HW2 A;  4N0B A;  4DNC A;  4A0Y A;  2H27 A;  3FXU A;  3PFI A;  4LFU A;  3CJN A;  1FLI A;  2E7X A;  3LA7 A;  3GYH X;  3K69 A;  5D8L B;  5AON A;  1BN5 A;  4PCQ A;  1HXD A;  4RGU A;  3HYI A;  3R61 A;  2JPC A;  5HLI A;  2XAF A;  3C1D A;  4S05 A;  1F9N A;  3CDH A;  1FYM A;  3F21 A;  3FXR A;  3LAJ A;  3RKW A;  1QQI A;  4NB5 A;  3HRU A;  4FX4 A;  1I5Z A;  2Z99 A;  4NQW A;  4L9N A;  1ZRD A;  3GLX A;  3J81 K;  1YYV A;  3V8J A;  3T0Y A;  3WTW C;  2KRF A;  4EMS A;  5CVR A;  3HTS B;  2F5D A;  1WRJ A;  3LAP A;  1I1G A;  4LMY A;  4LJZ F;  1ZG5 A;  4EJW A;  1HKQ A;  5LEJ A;  2YU3 A;  1HBX G;  5HLH A;  1P6R A;  5LGN A;  3TKY A;  2E7W A;  3P9K A;  2EFP A;  5E8G A;  2FSW A;  4JK1 X;  1KU9 A;  3QPH A;  2BBY A;  2IPQ X;  2PMU A;  1E17 A;  2YX4 A;  2XVC A;  3KZZ A;  3GX4 X;  1FY7 A;  2O6G E;  3QOP A;  3ZMD A;  2NNY A;  4G6Q A;  3R4K A;  2DK8 A;  4G9Y A;  1J5Y A;  2GIV A;  2QWW A;  4WXH A;  4GYG A;  2WWY A;  2VBW A;  4CDG A;  2ZFW A;  4M6Y A;  2A61 A;  3L7W A;  4HV5 A;  3D0S A;  2FML A;  1B9M A;  4Q48 A;  1DPR A;  2GXG A;  4P96 A;  1XB4 A;  2FU4 A;  2FF4 A;  2Q0O A;  2CO5 A;  4YG2 F;  5LRR A;  1LJ9 A;  1FOK A;  4P5O A;  2HZT A;  2XGX A;  3JW4 A;  3ZMS A;  2XUB A;  3ABT A;  2COM A;  1USS A;  2F5E A;  1LB2 A;  5H6Q A;  1FBS A;  3E6M A;  1Z9C A;  2Y0M A;  4BHB A;  1KA8 A;  2FE3 A;  4UV9 A;  1O57 A;  2HR3 A;  2RQP A;  2O0Y A;  3HOS A;  2K4J A;  1QNT A;  5LEK A;  1FYL A;  3FMQ A;  2F2E A;  2BGC A;  2VN2 A;  3RYR A;  3KET A;  3ISP A;  3GEZ A;  1AWC A;  6PAX A;  1P4W A;  2M30 A;  1J59 A;  1RUN A;  1EV7 A;  1LNW A;  3TOA A;  4KNY A;  4ZYD A;  2YSR A;  3HSR A;  2K27 A;  4M72 A;  4HX4 A;  4KIG A;  3KE2 A;  3KLN A;  3MZH A;  1XGS A;  2IA1 A;  3N4M A;  5LGU A;  4OIO F;  1J75 A;  4AWX B;  3CLO A;  4M9Z A;  5DEQ A;  1HW1 A;  1IAW A;  2VOD A;  1WI9 A;  2VE9 A;  2RGV A;  3K9T A;  2MBF A;  4ENJ A;  3I59 B;  1V4R A;  4KT5 C;  5E1Z B;  4F7Z A;  3L09 A;  4B09 A;  3NEU A;  3CO6 C;  5ICE A;  2UXX A;  4KA4 A;  2O03 A;  5CVV A;  1W5S A;  1X3U A;  2M8E A;  2P5V A;  3R6S A;  5HLG A;  1S6L A;  2ADU A;  3N97 A;  4L5J A;  1LDK B;  3I59 A;  5FLX Z;  2VC0 A;  2VOP A;  1LDD A;  3C3W A;  3RTR A;  5HVQ C;  2OBP A;  4Z2Y A;  1U6G A;  1Y0U A;  2WC2 A;  3P9I A;  1R7J A;  3I58 A;  1YW7 A;  4LLL A;  5IT9 K;  4YFN F;  1EH7 A;  2LF8 A;  2HKX A;  5F6F A;  2Q2E A;  5LLQ A;  5D5W B;  4Q47 A;  2GZW A;  2A5Y B;  1KU7 A;  2IRF G;  1ZYR F;  2EV5 A;  4BHP A;  4D0P A;  1LVA A;  2AXL A;  4PDK A;  1BIA A;  1BC7 C;  3IKV A;  1XGM A;  3RPQ A;  4OIQ F;  2IW5 A;  4UNO A;  5E18 F;  4R79 A;  2H6C A;  2M1B A;  1ON2 A;  2M5W A;  4RB3 C;  1NHA A;  3BJO A;  4IJA A;  1E2X A;  1OPC A;  3Q9V A;  4LLG F;  4KDP A;  1F1Z A;  4OMY A;  2HWV A;  4HLX A;  5LGT A;  1JHH A;  5HS8 A;  1QGP A;  3OV8 A;  2ESH A;  4WF2 A;  3DQV C;  4HDV A;  2C6Y A;  3QAH A;  1D8J A;  1EH6 A;  2PJP A;  2R7F A;  4IVN A;  2A6H F;  1BOA A;  1F4K A;  5DD4 A;  4KIB A;  3RPU A;  1K6O A;  1KYW A;  3WTV C;  2K02 A;  1IN6 A;  3B02 A;  2CW0 F;  5ED4 A;  4HF0 A;  3GXO A;  3WTS C;  2IJL A;  1R5H A;  4HF2 A;  3WTZ A;  3M1E A;  4L0Y B;  2Z33 A;  5BQT A;  1I1S A;  1XN7 A;  1R1U A;  3V8K A;  1TNT A;  3M7G A;  1JXS A;  1W5T A;  5DYM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...