5DCMA

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQDPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords PhoB family transcriptional regulator
publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmA00
3HIFA 1IXCA 2E1CA 1SFUA 3DKWA 1EH8A 3NEUA 1G3YA 1Z7UA 4YFKF 3BJAA 2XAJA 4LLLA 3E6MA 5E8GA 1V3FA 4Q47A 3FZVA 2QQBA 1P2FA 3DPLC 1SD7A 4OU0A 1FP2A 4FX0A 2LDUA 2FU4A 2IT0A 4CO8A 3CUQB 4OIQF 3L00A 2VXZA 1W4MA 3FMQA 4RGRA 1W7PB 3L9FA 2YSRA 2CWEA 2HTSA 1G6NA 3WODF 2VBZA 4EM0B 4FX4A 4LK0F 3IHUA 5IT9K 1B4AA 2CW0F 1XSVA 1BI3A 2K4JA 1BI2A 4MEYF 5F64A 4L0ZB 3ZMUA 2HYFA 1DPUA 3E97A 2DQRA 2F5CA 5FD5A 2Z99A 3JW4A 3FXUA 3LA3A 3I64A 4M72A 3BJ6A 1QBJA 5D5XB 4LMYA 1RI7A 2FQ3A 2F2EA 3WU0A 3EETA 4S04A 4G7OF 2HGCA 2HOEA 3ZP5A 2ETHA 3J80K 5H6QA 3KP5A 4WK8F 4GCVA 2DPUA 1KQ9A 2FE3A 4U0WA 2CSOA 3WTYC 3ML6A 4LD5A 2YR2A 1O3RA 4LGWA 3JTHA 2H09A 1S8NA 2XV4S 2E1NA 1IXRC 3ZN0A 1AWCA 1PP7U 3I54A 3GEZA 5CVIA 4WXDA 2HQRA 1YQAA 1P4AA 3K1MA 4S05A 2W84A 3J81K 2FBHA 2XIGA 5J8CA 2PQ8A 3SZPA 1D3YA 3V7RA 1Z05A 1LEAA 3COAC 3KCCA 4HX7A 5BS6A 1FY7A 5D5VB 1ZH5A 2ZMEA 1IXSB 1IAWA 1USTA 3BDDA 4UNOA 1VTNC 1LVAA 1USSA 2IRFG 3F23A 2HZTA 2MBFA 3QP5A 5K5RA 2IA1A 2ZJ2A 4ETSA 5L3EA 3E6DA 2FMYA 3PQJA 4IPAA 3MZYA 2ZKZA 3JTGA 1XSXA 3LAJA 3FM5A 2QYOA 4UV8A 4KNYA 5BPIA 2HWVA 3BWGA 3NRVA 3FM3A 3JSPA 5KVRA 1FYKA 4HX8A 3CLOA 5L3BA 5HDKA 4WWCA 1U78A 3E5XA 5DD8A 2DW4A 2P4WA 4HQMA 2BV6A 2HEOA 4OMZA 1TQIA 3F22A 1HW1A 3ECOA 4IRHA 1JXSA 4PDKA 4CXFA 3HRTA 3N97A 2QBYA 3IRRA 2GIVA 2JPBA 4G8XA 3MZHA 1YYVA 1U3EM 3BY6A 2VT2A 3O6BB 3K9TA 2WWYA 4IRIA 3DF8A 4ENNA 1I1SA 4MNUA 4HDUA 2XAGA 5L3FA 4XBFA 1H9TA 3DFGA 4I0AA 1WKMA 3R61A 5BMZA 1QGPA 1O7FA 3RKXA 1QZYA 4RB3C 5DV5A 4UVCA 4HBLA 4MQVA 4HX4A 2A6EF 2Y48A 3G73A 1HKQA 2ZNYA 4DQ2A 3BROA 2KKOA 3ROUA 3R0AA 1K78B 2NNNA 4LLNA 2IA0A 3Q9SA 3RTRA 2P6SA 1FOKA 1FYMA 2OBPA 4KMUX 3V4GA 3HRSA 3SHFA 3KP3A 2LF7A 3BP8A 2P7VB 2PMHA 4RS8A 1GVJA 5FB2A 3HHHA 2HS5A 4RGSA 4KIBA 5HOOA 2O03A 4L9VA 1K79A 2A3SA 2NRAC 3ISPA 1I27A 2DU9A 1U5TB 5ICCA 4KYWA 4BH9A 3TO9A 4O3MA 4BHPA 4I2OA 2ZMEB 1U5TC 2KIFA 4U88A 3M1EA 1ZLKA 1FSHA 4L9NA 1IN8A 1UFMA 3LQQA 4ZZLA 1IN7A 4HV5A 2BE5F 1G3TA 3B73A 3H92A 4HLYA 2PLYA 3T0YA 4CZZA 5E1XA 3R6SA 3TOAA 1ONVA 5CVUA 4LB6B 4LLGF 1BC8C 2P6TA 1HSJA 5A2QZ 1P92A 3DV8A 3V7SA 1H9GA 3WGHA 3CUQA 4AWXB 2L02A 1R23A 3P9IA 2VC0A 3FWEA 2DAOA 1LEBA 4AD9A 2A69F 4HYEA 3GFLA 2HDCA 1IRFA 1IW7F 1XN7A 1ZG3A 2XASA 5D5WB 3M8EA 2DLLA 1W5SA 3IKTA 2RQPA 3LSTA 4A0ZA 2L4AA 3DXJF 2RNJA 4QLCU 2C6YA 4BXUA 3OV8A 3RIRA 4JBAA 3KZYA 2J5PA 2LF8A 4CGZA 3GVAA 4UVBA 3C18A 4H0EA 4EQQA 3ZN1A 3H3UA 3TDZC 4BYYA 4M9XA 1O57A 5D4RA 1R36A 1EH7A 2GA1A 3F21A 3E3VA 4GGGA 2UXNA 1T6SA 3Q9VA 1XDSA 1EH6A 3FXRA 1L0OC 2P5LC 1F5TA 3C3WA 3LAPA 1BIBA 5ICGA 1RIOH 3GUDA 1U6GA 5IT9Z 2KRFA 4AIHA 1UCRA 1SMYF 3IRQA 4LFUA 1B6AA 2IVMA 1YW8A 4FT8A 2V1DA 4P55A 2IJLA 4E70A 1XGNA 4ESBA 3GX4X 1KYWA 3SFZA 2M45A 3JSOA 3R0JA 1ZGAA 3FF5A 1I1GA 5ILVA 3JAMK 2FEZA 4GXOA 4HF2A 2PMUA 4G7HF 5DCMA 1ON2A 3J80Z 3O3KA 1SFXA 3L09A 1KU7A 3HHGA 1YO5C 4RGXA 1MGTA 5K5QA 3FXQA 2COMA 2W24A 5D5UB 5FFZA 2EFNA 2A61A 2OA4A 3GO5A 5JR3A 4EGYA 1YW7A 2M5WA 1GXQA 1BBYA 5JVTA 2CQKA 1ODDA 3NQOA 2HKXA 5ERIA 2R7FA 4BQAA 1QNTA 1MZBA 2RV8A 4ON0A 4R8HA 3RI4A 4PGGA 3WE2A 3J81Z 4PCQA 2QENA 2VOOA 4I0BA 1SD6A 3BOQA 2QM3A 4RAZA 1AOYA 5EEHA 4M74A 3IC7A 2DK5A 3I0TA 2O8XA 1XDUA 3ZMZA 3GLXA 4TV7A 4RGUA 2RGVA 5AIQA 1XGOA 1YLFA 4ENMA 2O6GE 4WXCA 3U9GA 1CF7B 4UV9A 3WTWC 2ESNA 2XKPA 5LHHA 1XMAA 1IF1A 3LWFA 3I59A 1KU2A 2EFPA 4ZYEA 2M8EA 4HDVA 3WGGA 2IP2A 1FNNA 1LDJA 5HVQC 4OIOF 2DK8A 3WTUC 4HQEA 3HSRA 5DEQA 2V9VA 1KA8A 2K7LA 5CLSA 2DO7A 5JHUA 4IRGA 1KQ0A 2MH2A 2RKHA 1K78A 1DDNA 5EEGA 2OAZA 3F3XA 3V7CA 3IWZA 4U7BA 1R1UA 1TNTA 3K2ZA 5J6XA 2NYXA 3CTAA 3MWMA 5L3CA 1S6LA 3WE3A 5D8KB 4R1HA 1LDDA 4R79A 1WRJA 2STTA 1HXDA 1XGSA 3C1DA 5FD6A 4A0XA 1C0WA 2L3DA 4IJAA 3ULQB 1Y0UA 1U5TA 4AIKA 2V79A 1V4RA 1RUOA 4LK1F 3U2RA 3L7WA 4Y15A 2XAQA 5HLGA 3T1BA 3VEPA 1W7PD 4EJTA 3O2PE 2HKOA 4A0YA 2P8TA 5D8LB 3WTVC 1ZREA 2EA2A 5DCMB 3J7AO 1F9NA 4ZZDA 4LJZF 1P4XA 3T5XA 2ELHA 4KA4A 4D0PA 3HOTA 1IN6A 1XSDA 2PG4A 3BZ6A 2QQAA 4OIRF 5FLXK 3N4MA 1PP8F 2J5OA 2PEXA 5JI6A 4HV6A 3TO6A 5LGNA 2LNBA 1B9MA 2FA5A 2IW5A 2NNYA 2EFQA 1WSUA 5DUKA 2XUBA 3EUHA 4M9ZA 3RPQA 1TQPA 1YIOA 2VODA 4UVAA 1XGMA 4PZJA 4HF0A 1H0MA 2Z3YA 2TDXA 3BPVA 2PBIA 2Q0OA 3QPTA 3QOPA 4EJOA 1ZHFA 1JGSA 3DPTA 1FBSA 2CYYA 2JRTA 4KIFA 5ED4A 3DEUA 3IL2A 3KZZA 1BN5A 4ENJA 1TW3A 3CDHA 3KE2A 4OMYA 2O0YA 1JHFA 3I59B 3I4PA 3ZQ7A 4U7DA 3ECHA 5ICEA 2DPDA 3F8MA 6PAXA 4BNCA 4XRFA 5HDGA 2O3FA 2K02A 4YIIA 4HA8A 4Q48A 2H6BA 3DQVC 1O3QA 2K4BA 1X3UA 5E8IA 5CYVA 2W25A 2QUFA 1HW5A 1JE8A 2JT1A 3HTSB 2X0LA 1LB2A 4KDPA 2XVCA 4B09A 1HKSA 3LFKA 5L3DA 1SD4A 5CVRA 4F7ZA 2ADUA 1TBXA 3V8LA 3HSFA 4QWQA 3RJPA 2YX7A 4EJUA 2XKOA 2XAHA 1O3SA 2Z33A 2L01A 1XCVA 1OKRA 4EGZA 2CG4A 2V6CA 3I71A 5H20A 3P9KA 3GWZA 1HSTA 4UUVA 1BIAA 3HYIA 4ENKA 2MLGA 1R58A 1MDMA 4GO1A 1E17A 4WCGA 1ZLJA 2XGXA 1XMKA 3K1NA 1PUEE 3MEXA 2FXAA 2ZCWA 1WQ2A 1R00A 4WXHA 1YS7A 2WTEA 3REOA 1O3TA 1TLHB 2XROA 1BM9A 2ISYA 4M6XA 2F5DA 3I5UA 1T39A 1S7OA 3F8BA 1SFEA 4I7HA 2R3SA 2KJCA 2GA2A 2JTVA 4BHCA 3AAFA 2VBYA 2ZBKA 3FMSA 3LQRA 4IF4A 2VT3A 2V1XA 3B02A 4KT5C 4L9TA 3T8TA 1FBUA 4U0VA 1FZPB 4NQWA 3GZ5A 4MGRA 2DI3A 3JAMZ 3MQ0A 1J5YA 4BAYA 1ZYRF 1J2XA 2W85A 1CF7A 1UB9A 5HDNA 5BOXA 5K5OA 4HF1A 1GXPA 3F8FA 1BI0A 1IRGA 1MJBA 2A68F 1OYYA 4A5NA 4EJVA 4KN4X 2H27A 4OOIA 4YIFA 5LEJA 3WTSC 2IPQX 5H6RA 2PJPA 4HW0A 1BC7C 3P7NA 3ZMSA 3TOBA 2FMLA 1ZN2A 3KP7A 1R22A 1FWZA 1P6RA 1IN4A 2HTJA 1OYIA 5LBQA 5F6FA 4A5MA 1Z6TA 1HQCA 1EV7A 4EM1A 1PDNC 4JK1X 2BYVE 2VE8A 1ZRDA 4Q5SF 4G9YA 5DDGA 3FX3A 3PFIA 2P5KA 2QZ8A 5J8FA 2PFBA 1ZRCA 5TJJA 4I01A 2FBIA 4NHJA 3P9CA 2GZWA 4EV0A 2AXLA 2QQ9A 2QVOA 3VFZA 1MJ9A 2WV0A 3GW2A 3W6KB 1MKMA 1K6OA 2L54A 2HYGD 3F72A 2L4MA 2G7UA 2QLZA 4G6QA 1OYWA 4ASNA 3GFIA 2FOKA 4KN7X 3VODA 2PI0A 1WWXA 1JHHA 1U8RA 1T2KA 1G3WA 5IT3A 2EJRA 2ISZA 5K1YA 2OZ6A 4KIGA 1J75A 2W57A 4IXAA 5DCFA 2XRNA 1FPQA 4XLPF 2HR3A 1G3SA 1O7LA 2CFXA 1G4DA 3HRMA 1MDMB 3ELKA 5ILSA 4DNCA 2MLKA 4WX9A 1RZ4A 1QQIA 3MFKA 1R7JA 2EV6A 2GXGA 1LJ9A 2E7WA 4G7ZF 1CGPA 2RVCA 3VB2A 4YG2F 4CDGA 1I6XA 4GYIA 1TTYA 2OQRA 2A6HF 2OZUA 5FFXA 4HOBA 2DBBA 1T0FA 3CUOA 5LLQA 2EK5A 5FGMA 4ZYGA 3F8NA 2K86A 1FP1D 3HOSA 1TNSA 2CO5A 1YFHA 2VONA 5LGUA 3KEQA 1DPRA 1OMIA 2FSWA 2OU2A 2O61A 2FF4A 2EWNA 2OQGA 4Y17A 3S2WA 1P4WA 4EMSA 2D45A 3ZMTA 2DFIA 2G7HA 1B59A 1YS6A 3PQKA 4XSZF 3CUQC 3E5UA 3EYIA 2RC4A 4G94A 2GXBA 1ZAOA 4P5OA 4M71A 3ZMDA 1QPMA 5E17F 1Z1DA 3RYPA 2Q8KA 3WTZA 3WTXC 5FLXZ 3HTUA 2MH9A 4O6JA 4YFNF 1Z9CA 2M87A 3E5QA 1GHCA 4L9JA 2EFOA 3RKWA 5ILUA 2A5YB 5TRDA 1FX7A 3H3ZA 4CHUA 4MQ9F 4XLNF 3EDPA 3KLNA 1XD7A 3GFJA 4P9UA 4B8XA 3ABTA 2LSOA 4M73A 1XCBA 3BJOA 2KJBA 3GFMA 1KU3A 2K27A 3WU1B 1LQ1A 3TGNA 1D5VA 1S7AA 3ERED 4MTDA 1K7AA 5AIPA 4L0YB 2FRHA 3RKYA 3K0LA 2FBKA 5HS9A 3IWFA 2YX4A 2UZKA 2ZFWA 3I53A 2X4HA 1RNLA 1F1ZA 2F5FA 4NB5A 2EB7A 2D1HA 3IKVA 4ESFA 1YTYA 3VOEA 2A07F 1BI1A 4KUMA 2WC2A 4LB5A 1SAXA 3I58A 2GWRA 2NAZA 5F1RA 1WI9A 4IHSA 3E6CC 5E1WA 3KP2A 3KP4A 2VBWA 3QAHA 1R1VA 4G6DA 1HKTA 4FHTA 5LHIA 5D6FA 3Q5FA 1FSEA 5BPDA 1TW2A 5BQTA 2M30A 3D0SA 1LNWA 2EA4A 2P7CB 3RDIA 5E18F 2IA2A 2VN2A 3GXOA 1UHWA 1RUNA 5DYMA 2FNPA 1SD5A 3KP6A 3WGIA 2E7XA 1IUYA 1E2XA 4N0BA 1YW9A 1OPCA 2EV5A 1NHAA 1D8JA 2Z9OA 3HRUA 2GAUA 1Q1HA 3KEOA 2H94A 1J0RA 5KK1A 3RPUA 5ICFA 5LGTA 1B1BA 2RN7A 4HZFA 1MJAA 4KMFA 2BGCA 2VBXA 4U0YA 3SZTA 4YFXF 1BJAA 3KETA 3OOPA 2D2WA 3EQLF 3LA7A 4ESJA 4Q4ZF 1J59A 1R5GA 2B0LA 4LG0A 1REPC 4AVPA 4M9SA 1ZG5A 1QO0D 3MCZA 1KU9A 4PGHA 2Q2EA 2ZNZA 2ESHA 3E6BA 4KICA 1ZARA 4N9IA 3BPXA 2RDPA 1KGSA 3T8RA 3U1DA 2DTRA 3ZPLA 4ZYHA 1A04A 4UXNA 4HAMA 3TQNA 2ZO4A 3HSEA 1LDKB 4Z2YA 3GYHX 2HQNA 4OIPF 5JFRA 1MD0A 3GF2A 1FBQA 5DUIA 3KFWX 5CVJA 4Y13A 1FYLA 4KFCA 3D5LA 1B9NA 4OINF 4I02A 4WF2A 2AS5F 3EYYA 2FNAA 1FLIA 5DD4A 2VC1A 1TQMA 1ZRFA 3FMRA 1UHMA 1T38A 4CYDA 3ZMVA 3CJNA 2DQLA 2OD5A 1R1TA 4N9HA 3M7GA 2P5VA 3DP7A 2UWMA 4L5IA 4P96A 1F4KA 3WG9A 2LKPA 3GZ6A 3F6VA 2M1BA 3SXYA 5HS8A 4RB0A 3M9AA 3QPHA 1Z6RA 2JPCA 1FC3A 2YU3A 4L18B 1J9IA 1SMTA 4HLXA 4L5JA 1BOAA 2PN6A 4A12A 5LHGA 4MTEA 4A2UA 4RB1A 2ZXJA 2MC3A 1KYZA 3R4KA 1D8KA 4BHBA 3FHZA 2EV0A 5HLIA 2EFWA 2F5EA 2CGPA 3QP6A 1I5ZA 1STZA 4K2EA 1R5HA 5D6EA 4JQFA 4A6EA 1IZ1A 3WTTC 2DT5A 2JSCA 5HLHA 1J7KA 4AIJA 1W7PA 1ZGJA 4UHTA 5E1ZB 3KLOA 1ULYA 5CJ9A 3CO6C 4I09A 5FO5A 2XHKA 3HUGA 2MA3A 1ZG1A 3ABUA 1L3LA 1DUXC 2YPRA 5AONA 2STWA 2GQQA 3L2CA 2XAFA 5LRRA 2QBYB 3SQNA 5L3GA 2BEOA 3F6OA 4IVNA 2VOPA 2MD5A 3LA2A 1T98A 1DP7P 3F8CA 2BBYA 4LG0B 3C7JA 1OR7A 4MHGA 4EJWA 4P9FA 4EVIA 2G9WA 5D4SA 2R7DA 1U2WA 3V8KA 2Y75A 2Z5UA 1S29A 5LRSA 1QZZA 1HBXG 2H6CA 4EM2A 5HS7A 4GYGA 3QRFF 5CVVA 2KIMA 4M6YA 3TKYA 5A2QK 1FT9A 4RB2C 1W5TA 4O5VA 4MEXF 1XB4A 1HW2A 2VE9A 2V1UA 4I98B 2NS0A 3K1PA 3QU3A 1Z91A 3QU6A 1YG2A 3RYRA 2JZYA 3M8FA 4ZYDA 1S3JA 1IN5A 5LEKA 3TDUC 2ACJA 2HFHA 2QWWA 3W6JB 2D1VA 4XSXF 3V8JA 3G3ZA 2KIUA 1ON1A 4ZH4F 2UXXA 3R60A 3TO7A 3CO7C 5E20A 4RAYA 2Y0MA 3K69A 4CICA 3MAJA 1KQ8A 4IHTA 4A6DA
chains in the Genus database with same CATH superfamily
1XG1A 3HIFA 3BCAA 5FLMJ 3CMAI 1N25A 4JYKA 3LL7A 1IXCA 2EPFA 1SFUA 2E1CA 1IDZA 3DKWA 3JRHA 1X4OA 1RPWA 1EH8A 1X4PA 3NEUA 1G3YA 1Z7UA 2WB1N 4YFKF 3BJAA 2XAJA 4LLLA 1MBGA 3E6MA 1I3AA 4M3DA 3DU5A 2UV1A 1ENHA 5E8GA 1V3FA 2CUFA 4Q47A 3FZVA 2KDZA 4QSHA 3PJRA 3S1QJ 1D5YA 2QQBA 3WHCA 2HXOA 3M1CA 1P2FA 1MH3A 2ZXIA 3IH2A 2RQQA 3DPLC 1SD7A 4OU0A 3ZXSA 3H9JA 4NNJA 2E5ZA 4QIWN 1FP2A 4FX0A 2LDUA 3OYGA 3LSIA 2FU4A 2IT0A 2E5NA 4CO8A 3CUQB 4OIQF 3L00A 1LUJB 5KNLA 2VXZA 1W4MA 3FMQA 4RGRA 1V55H 1W7PB 2YSRA 3H36A 3L9FA 3SDBA 3OSFA 1V54H 2CWEA 2HTSA 1Y39A 1G6NA 3EPZA 3WODF 2VBZA 2AXTC 4EM0B 4FX4A 4LK0F 1LE8B 3IHUA 3IAM2 3S93A 2DDBA 5IT9K 1B4AA 4E7HA 2CW0F 1YRNB 1XSVA 1BI3A 4F91B 2K4JA 1BI2A 4MEYF 2DT7B 5F64A 4L0ZB 3ZMUA 3MKZA 4XKBA 4F55A 2HYFA 1DPUA 4BY7J 2CU7A 3E97A 1CQTA 2DQRA 4AVZA 2F5CA 5FD5A 2DA4A 3PO3J 2VQHA 2Z99A 3JW4A 3PNVA 3FXUA 3LA3A 3A01A 3I64A 3GCMA 4M72A 3BJ6A 1QBJA 5EDNA 5D5XB 4LMYA 1RI7A 2FQ3A 1TWCJ 1BL0A 2F2EA 3WU0A 1BW6A 5IYBJ 3EETA 1B8IA 3VYTB 4S04A 4G7OF 3BQZA 2RNGA 2HGCA 2HOEA 3ZP5A 2ETHA 4JX5A 4N4OB 1BW5A 3J80K 5H6QA 3KP5A 4WK8F 2A6TA 4GCVA 2DPUA 2LOOA 4HNTA 1KQ9A 3F0CA 1Q1VA 2FE3A 4U0WA 4XONA 1R49A 1I3QJ 3KZIC 1JJ6C 2CSOA 3WTYC 3KX2A 1Z21A 3ML6A 4LD5A 2YR2A 1O3RA 4LGWA 3LSPA 3JTHA 4BS9A 2R5ZB 2H09A 3L2VA 1S8NA 2XV4S 2E1NA 3DCFA 1IXRC 3ZN0A 1HA8A 1AWCA 1PP7U 3J7AY 1B72A 3I54A 2VUMJ 2M34A 1A6QA 2B9SA 3GEZA 5CVIA 5EF6A 2DYSH 4WXDA 2HQRA 2ZJPF 1PUFB 4BY1J 1YQAA 1P4AA 1SAUA 3K1MA 1TWAJ 1GT0C 2EIMH 4S05A 4IHYA 2VIXA 2W84A 3J81K 2FBHA 2XIGA 2XGCA 3DTIA 4J00A 3L1PA 5J8CA 2PQ8A 2O5RA 2LBFB 4PJJA 3SZPA 1AU7A 1WH7A 1X1DA 4NUBA 2VJ5A 4ZTJA 3A4CA 1D3YA 2H8WA 3V7RA 2E2JJ 3IP4B 1Z05A 1LEAA 1YJWI 5GPCA 3COAC 2NVTJ 3ABLH 3K4MA 4F3QA 5B3SH 1H8AC 4ZYAA 3KCCA 4HX7A 5BS6A 3OIQA 1FY7A 5D5VB 1ZH5A 3TW7A 2ZMEA 1IXSB 3DEEA 1IAWA 1USTA 2I10A 3BDDA 2R5YA 4UNOA 1VTNC 3S3NA 3K7AJ 1LVAA 5DTDA 2BW3B 4QTRA 1USSA 2IRFG 3F23A 2K85A 2HZTA 3W2VA 4JX4A 2MBFA 3QP5A 4GRIA 4BJTA 2VLAA 2MSYA 5K5RA 3CMMA 4PK4A 2IA1A 4JX6A 9ANTA 4XNFA 1LKXA 2KIQA 2ZJ2A 2R4GA 3DBLB 4ETSA 5L3EA 1TT5B 2LKXA 1OCPA 2FMYA 3E6DA 3PQJA 3RQIA 4IPAA 3MZYA 3CCRI 3J7ZI 1RETA 2ZKZA 3JTGA 1XSXA 3LAJA 3FM5A 2QYOA 3FXOA 3K6GA 4UV8A 4BACA 4OWRB 4GFBA 4KNYA 4MIMA 5BPIA 4EEFG 5FRNA 2HWVA 3BWGA 4YIRX 3NRVA 2JA6J 2M7BA 3GBGA 1JKQC 3BG7A 3FM3A 3JSPA 5KVRA 1ETXA 2V7FA 4MO7A 5IYDJ 1LVKA 2NVUB 1IV8A 2IEKA 1FYKA 4E6KG 2L7MP 1YJNI 3HG9A 4HX8A 3CLOA 4BEHA 2LY2A 1A6IA 1X58A 5L3BA 5HDKA 4WWCA 4MFDA 1U78A 4U87A 3E5XA 5DD8A 2DW4A 2P4WA 4HQMA 2BV6A 2M9HA 3BR3A 1ETVA 3F9KA 2HEOA 4OMZA 1TQIA 3F22A 1HW1A 3CJRB 3ECOA 3FKJA 1T0FC 4IRHA 1QZEA 1JXSA 4PDKA 2LVSA 3TP0A 3HRTA 4CXFA 4J19A 3N97A 2QBYA 1ITYA 4XK4A 3IRRA 4A3FJ 2GIVA 1MBEA 2JPBA 4G8XA 4IO9F 3S14J 1VQ8I 2LR8A 3MZHA 1YYVA 4IKFA 1U3EM 2JUCA 3UNGC 1VF9A 3BY6A 1XPXA 2VT2A 3O6BB 3K9TA 1EJ9A 1X1AA 2WWYA 3OWTA 2K9MA 4IRIA 3JCUC 1LFUP 2OPTA 3DF8A 2VKDA 4ENNA 1I1SA 5J4YA 4MNUA 4HDUA 2XAGA 1WJCA 2VB6A 3A01B 5L3FA 2L9NA 2GXAA 1BR2A 4XBFA 3N05A 5GP9A 1H9TA 3DFGA 2A5WA 1D1CA 1WFXA 2OTJI 1MMNA 4I0AA 1WKMA 3CESA 2KZVA 3R61A 3GTKJ 5BMZA 1QGPA 1O7FA 3NWTA 3RKXA 1QZYA 2BHYA 4RB3C 5DV5A 4UVCA 3OYLA 4HBLA 1HDPA 3MVPA 3L2WA 4MQVA 4HX4A 2CV0A 2G0EA 2A6EF 2Y48A 3G73A 1HKQA 4C3IJ 4V19K 2ZNYA 4A3EJ 4DQ2A 3BROA 3G71I 2VXDA 3VDXA 2KKOA 3ROUA 3R0AA 1FMWA 1K78B 2NNNA 4LLNA 2W00A 3QYEA 2IA0A 3Q9SA 4F92B 1UG2A 3M07A 3RTRA 2P6SA 2P0WA 1FOKA 3W3CA 1FYMA 2CW7A 2OBPA 4KMUX 2AO9A 3V4GA 3CP2A 4M3GA 4A3LJ 2V6EA 2DODA 4IOAF 2HZDA 3DTEA 3HEFA 4XORA 1Y8QB 2M2EA 1B72B 2ZXWH 3HRSA 4I76A 1V5GA 4RMNA 3KP3A 3SHFA 2LF7A 3BP8A 1IDYA 2P7VB 2PMHA 2R0QC 1O4XA 3I55I 4RS8A 1GVJA 3BTCA 5FB2A 2OTLI 5BNGA 4A3JJ 3GTGJ 2XF5A 3HHHA 4J01A 2HS5A 1MBHA 4RGSA 4JP0A 2HQAA 2DOFA 4UY8I 4KIBA 4D7MA 5HOOA 3OYMA 2DOAA 1NK3P 5CQGA 2O03A 2VKEA 4CCNA 1ZKGA 1YE9A 1VQ4I 2LMDA 4DZPA 4L9VA 1K79A 4ABZA 1TZLA 2A3SA 2E1MB 3ISPA 2NRAC 1I27A 1Y56A 2DU9A 3S1NJ 1U5TB 4D5CA 4V2GA 4HSTA 2MC4A 5ICCA 2WAEA 4KYWA 4BH9A 5EG0A 3TO9A 4O3MA 4BHPA 4I2OA 2ZMEB 1IC8A 3I4MJ 1U5TC 4RM2A 2KIFA 1YX3A 3FXMA 4U88A 3ZOBA 3M1EA 1ZLKA 2Y9YA 2R5YB 4JOMA 1FSHA 2DFFA 4L9NA 1IN8A 1UFMA 2ZSIB 3LQQA 4ZZLA 3OSGA 2TRTA 1IN7A 4HV5A 1VQPI 2BE5F 2LG4A 4AUXA 4PFPA 1G3TA 3B73A 3H92A 4HLYA 1H89C 2PLYA 3T0YA 4CZZA 4F93B 5E1XA 3R6SA 3TOAA 1ONVA 5CVUA 4LB6B 3I9V2 4LLGF 3EUAA 1BC8C 2P6TA 1WH5A 1HSJA 1OJLA 3CC7I 5A2QZ 1D1AA 3M8JA 2W7NA 1P92A 2PX9A 1MBJA 3DV8A 2H8RA 3V7SA 1H9GA 4IOCF 2BHZA 3WGHA 3CUQA 3LSMA 3OR2C 4AWXB 2Z1DA 1A35A 2L02A 1R23A 2LFBA 3P9IA 1LE8A 4XKCA 2WV1A 2VC0A 3FWEA 2DAOA 1YI2I 1LEBA 3ABMH 1YRNA 2QSGX 3SJMA 4AD9A 2A69F 4HYEA 1BJZA 2LYCA 3GFLA 3O8HA 2HDCA 3KYCB 2HXIA 2FQ4A 1IRFA 1IW7F 1XN7A 1ZG3A 2XASA 3ERMA 3M8EA 5D5WB 4NBQA 2M7AA 5F08A 2DLLA 2K40A 5E3LA 1W5SA 4CYCB 4MLOA 3H3VK 3GTQJ 5JLWA 5KAFC 3EUHC 5JHFA 3IKTA 2RQPA 3LSTA 5GPAA 2AQEA 3Q0WA 4A0ZA 2L4AA 2XB0X 1S9HA 2RNJA 3DXJF 4QLCU 2C6YA 3QPLA 2WAQA 4PUSA 3SYTA 4BXUA 1E3OC 2BOLA 3OV8A 1NG6A 1MSEC 2Y31A 4PFOA 4F52A 3RIRA 4JBAA 3HPGA 2N8GA 5M3FJ 5M5YJ 3KZYA 4XM3A 4DBQA 2J5PA 2F4MB 3JRFA 2JA5J 5E3NA 2KFDA 1N77A 4KT6A 2LF8A 4RAGA 2QKLB 3OOUA 4CGZA 4A3DJ 1N75A 3GVAA 4EATA 4YRVA 4B1RA 4XLCA 4FETA 3L2RA 3GLLA 1W0TA 4UVBA 4AYBA 3C18A 4H0EA 2H1KA 4EQQA 3ZN1A 4Y52J 3H3UA 2MGQA 3D5SC 3TDZC 4BYYA 4M9XA 2CS3A 5H2FC 1O57A 2R7VA 4C3JJ 5D4RA 1R36A 1EH7A 2GA1A 3F21A 2R5ZA 3E3VA 2KMUA 4GGGA 4RLFA 5K7FA 2IBDA 1T6SA 2UXNA 3Q9VA 1XDSA 1EH6A 3FXRA 4A3BJ 1L0OC 1QRYA 2B7EA 5E3MA 1SC7A 1QA6A 2P5LC 4A3GJ 1F5TA 1PUFA 3C3WA 3C2HA 1UAAA 3LAPA 4FTHA 3CQZJ 1BIBA 5ICGA 1RIOH 3GUDA 1U6GA 3JR9A 5J1YA 4XLFA 5IT9Z 1R9TJ 2CQ7A 2KRFA 1UCRA 3G2BA 1SMYF 4AIHA 3IRQA 2ECBA 3AL0C 4LFUA 2HPIA 1B6AA 2IVMA 2LBFA 2D5VA 5J3LA 4D9JA 2DFHA 1YW8A 4FT8A 2V1DA 4P55A 3PIPF 2IJLA 4E70A 1XGNA 1VQ5I 4ESBA 4NC8A 1XMXA 2ELKA 2GM4A 3OYEA 4MFEA 3GX4X 2IS6A 3KEYA 1KYWA 2EQRA 4XQFA 3SFZA 2M45A 3D1NI 3JSOA 3R0JA 1ZGAA 2Z2SB 3DLAA 4DYRA 3FF5A 1I1GA 1R71A 4Y4RA 1Z3XA 4DJAA 5ILVA 4A3IJ 3JAMK 2PJRA 2FEZA 4M3FA 4RM3A 4GXOA 4HF2A 1VQKI 2PMUA 4G7HF 3IH4A 3MKWB 4XLAA 4DZJA 5GAHJ 5DCMA 1ON2A 3B6AA 5B1BH 3GTMJ 1H88C 3J80Z 2WA0A 3O3KA 1SFXA 4FQGA 3L09A 4X1EA 1KU7A 3E7LA 1T95A 5DM7F 3HHGA 1YO5C 3RPUD 4RGXA 1V5EA 1MGTA 2RAEA 5K5QA 1TP4A 3FXQA 2LY9A 2COMA 5M3MJ 4N4NB 2W24A 5D5UB 2BXYA 5FFZA 2EFNA 1HOMA 2A61A 2OA4A 1DGWY 4E7SA 3GO5A 5CKTA 5JR3A 4EGYA 3QQAA 3DBRB 2HVSA 1YW7A 2M5WA 1GXQA 2GLOA 1BBYA 2LC2A 3TMOA 4PJLA 5JVTA 2CQKA 1ODDA 3NQOA 2HKXA 5J40A 5FLVA 2KDOA 2L9SA 1GV2A 3PUBA 4DW6A 5ERIA 2R7FA 4PJMA 4BQAA 1QNTA 1MZBA 2RV8A 4ON0A 4R8HA 1G8XA 3RI4A 2K9SA 4PGGA 4XLEA 1DQUA 3WE2A 3J81Z 2VQCA 2TCTA 2VJIA 3D5RC 2QENA 4PCQA 4DGWB 1ZQ3P 3W6VA 2VOOA 4I0BA 1SD6A 2V4JC 2CQNA 3VYUB 3BOQA 3ONQA 2QM3A 4RAZA 3NARA 3TP3A 1VFCA 1AOYA 5EEHA 3QYFA 4M74A 3IC7A 2E2HJ 2DK5A 3I0TA 2O8XA 3QPSA 1XDUA 2WAQN 1JGGA 1SEUA 2EH3A 3ZMZA 1MH4A 4B3AA 2BXZA 3GLXA 4TV7A 4RGUA 2RGVA 4BU2A 5AIQA 3P5JA 1XGOA 1YLFA 5B66C 4ENMA 2O6GE 4WXCA 2YU9J 3U9GA 2LRDA 2MFZA 2EIKH 4QPOA 1K4TA 1CF7B 4UV9A 2E2IJ 2CUJA 2XPWA 3WTWC 2ESNA 1QVTA 2DMQA 1JTXA 2XKPA 5LHHA 1XMAA 1IF1A 3LWFA 2DA3A 3I59A 2KL4A 4E4HA 1KU2A 2EFPA 4ZYEA 2MW8A 4BQQA 2M8EA 4C30A 4AYBN 1BOBA 2R7SA 3PNYA 4HDVA 1WZ2A 3WGGA 2CRGA 4C2MJ 4RDUA 3PSFA 2IP2A 1FNNA 5IP9J 1LDJA 5HVQC 2HVQA 4OIOF 2DK8A 2JK3A 3WTUC 2E60A 4HQEA 2XSJC 3HSRA 2DMNA 5DEQA 2V9VA 5GADJ 1KA8A 2DT6A 2K7LA 5CLSA 3IV5A 5B1AH 2DO7A 3FHNA 3ZR8X 5IP6A 5JHUA 4IRGA 1KQ0A 3CDLA 1ZR4A 2VPRA 3CCJI 2MH2A 1FOYA 2RKHA 1K78A 1DDNA 5EEGA 1R4MB 2OAZA 3AG3H 1TL8A 1UG0A 3F3XA 4HNUA 2F48A 2R7WA 2X1EA 5KCMA 3IWZA 3V7CA 2XDVA 1NG7A 3CCMI 4U7BA 2ME0A 3Q0UA 1E3HA 3BCBA 2LP0A 2LKSA 1R1UA 1TNTA 4PSXA 4HNVA 3K2ZA 1SVOA 2DMPA 3WG7H 3L2QA 1JTYA 1OR7C 4ZDOA 5J6XA 2NYXA 1Y1VJ 3CTAA 3MWMA 2EINH 5J47A 5L3CA 1JKOC 2X48A 1S6LA 4IZZA 3WE3A 5D8KB 4R1HA 2L5QA 4CCLA 1LDDA 1RKWA 4R79A 1WRJA 3Q0VA 2STTA 1HXDA 1XGSA 3C1DA 3BR1A 5FKOA 5FD6A 2R7ZJ 3TL4X 1QHGA 3AG2H 4A0XA 1OISA 1C0WA 2Y9ZA 2L3DA 5TISC 1DU0A 3MN2A 4IJAA 5IP7J 2X1DA 3ULQB 1Y0UA 1U5TA 4B48A 2DMUA 2M0CA 4AIKA 2V79A 1V4RA 1RUOA 2E36A 5FKNA 3MKYB 2DFEA 4LK1F 3U2RA 4II3A 2R93J 2L7FP 3L7WA 4Y15A 4C2UA 2X51A 2XAQA 1UMQA 5HLGA 2OUMA 3T1BA 4KITB 2PJRB 3VEPA 1W7PD 5E79C 4EJTA 3O2PE 2HKOA 4A0YA 2P8TA 5D8LB 3WTVC 4I6ZA 1ZREA 2EA2A 3K4LA 2E34A 5DCMB 3J7AO 1VQNI 1F9NA 4ZZDA 1MIJA 1U9NA 3VSLA 4LJZF 1HDDC 2R7RA 3E0JB 2VKVA 4BE1A 4OAZA 4NDLA 2COBA 4KISA 1P4XA 3ZQIA 3T5XA 2ELHA 1FOXA 4KA4A 4D0PA 3HOTA 1IN6A 3G6EI 1XSDA 2DYRH 3VSKA 2PG4A 3BZ6A 3K70D 1WJDA 3ZCOA 4DYQA 4FE4A 1WPKA 2QQAA 4OIRF 5FLXK 1AKHB 2K9QA 5GTHC 5HODA 5EGOA 3N4MA 4X6AJ 1JKRC 4E7LA 1PP8F 2R7TA 2KRHA 2K9LA 2J5OA 2PEXA 3E1SA 2WADA 1WJFA 5JI6A 4HV6A 1VI0A 3TO6A 5LGNA 2LNBA 1B9MA 1D0YA 2FA5A 3H0DA 3LSHA 2IW5A 1W0UA 2NNYA 1R6RA 2EFQA 1HF0A 1WSUA 2GOMA 5DUKA 2XUBA 3EUHA 4M9ZA 3RPQA 3S17J 3BG5A 3CJTB 3HPHA 5GAGJ 1TQPA 1YIOA 2ID6A 1VQOI 2VODA 4UVAA 1XGMA 2ZB9A 3OIOA 1XC5A 3ZRGA 4PZJA 4HF0A 1H0MA 4CYCA 2Z3YA 2TDXA 3OS1A 3BPVA 2PBIA 2Q0OA 3QPTA 1KONA 3QOPA 3JRGA 4EJOA 1I6HJ 1ZHFA 2BZTA 2L0KA 1JGSA 3DPTA 3HOUJ 1FBSA 2V26A 2CYYA 2JRTA 4KIFA 1MMAA 4CCJA 3OYIA 5ED4A 3CCVI 3DEUA 2R7OA 3IL2A 3KZZA 5HNFA 5FJ8J 1BN5A 4FE7A 4ENJA 1TW3A 3CDHA 2KZGA 1ETKA 3KE2A 2KLOA 3MKLA 4OMYA 1IRZA 3CCSI 4CUGA 1X1BA 2O0YA 4BBSJ 2JA2A 1JHFA 2JVGA 3I59B 3I4PA 4D5FA 3PO2J 3ZQ7A 3QOEA 4U7DA 2LD5A 2DCEA 3ECHA 2K5CA 5ICEA 5IOYA 2DPDA 3F8MA 3BLYA 4BE0A 3BC8A 4KJZA 2HYJA 1J09A 2EZHA 3VWBA 4BNCA 6PAXA 3TW6A 2KQRA 4XRFA 5HDGA 2O3FA 4S0HB 2K02A 3FDYA 4UUSB 3RCOA 4YIIA 3AKZA 2QGUA 3FBNB 2KHMA 4HA8A 4B44A 2MD0A 4Q48A 1SVMA 2H6BA 3RSNA 3DQVC 1O3QA 3AG1H 4RAFA 3FK6A 2K4BA 1ZELA 1ZK8A 1X3UA 3S3OA 5E8IA 3QYBA 5CYVA 3HOVJ 2W25A 2QUFA 1IJWC 1HW5A 1JE8A 3CC4I 2JT1A 3GZNB 3HTSB 2CQQA 1OCZH 4V2FA 2X0LA 1LB2A 4AC0A 1Y1WJ 3BTJA 3K4NA 2F6CA 4KDPA 2XVCA 4B09A 4LG3A 1HKSA 2FD5A 3LFKA 5L3DA 1SD4A 5CVRA 3HOZJ 2UUZA 3FK7A 4XICA 4F7ZA 3PM1A 3OYFA 1RRJA 2ADUA 1TBXA 3V8LA 3HSFA 1G2HA 3O8GA 2DA7A 3HZJA 4QWQA 3RJPA 1BR4A 1K6YA 2YX7A 1ETYA 3OL3A 4EJUA 2XKOA 4XIDA 3QWLA 2XAHA 5B5EC 1O3SA 1EKEA 2DJNA 3HOXJ 3SEQA 1HC8A 1XX5A 3CLQA 2Z33A 2L01A 1XCVA 1QVUA 3PL8A 1Z3YA 1OKRA 4EGZA 2CG4A 4A3MJ 2V6CA 3I71A 3I4NJ 3OYJA 2O7OA 1WHUA 1DU6A 5H20A 3P9KA 3OYKA 3NAUA 3GWZA 1HSTA 1WJ5A 4UUVA 3S2HJ 3ESWB 1BIAA 2IXSA 1S5LC 3HYIA 4LIVA 4ENKA 4A3KJ 3VYSB 1IO2A 2MLGA 1R58A 1MDMA 2FJ1A 3J7YJ 4GO1A 1E17A 3CP8A 4WCGA 1ZLJA 2X6OA 2XGXA 1XMKA 2Y69H 3HXLA 3K1NA 1PUEE 2RREA 3MEXA 2FXAA 2ZCWA 3RZOJ 1Y8RB 2IAIA 1ZGWA 2CJJA 3OYCA 3OY9A 4A69C 2M8GX 1WQ2A 1R00A 4WXHA 1XS9A 2JA7J 1YS7A 4IHTA 1JI8A 3CCQI 1ETOA 2WTEA 4E7IA 3REOA 4B3XA 3FXLA 1O3TA 2JMWA 4NC7A 1TLHB 2WY8Q 2XROA 3S1MJ 1BM9A 2ISYA 3B6CA 2F5DA 3I5UA 4M6XA 5EGOB 1T39A 3QODA 2R7QA 1S7OA 3F8BA 1SFEA 4I7HA 2R3SA 3W2AA 2KJCA 2GA2A 2JTVA 4BHCA 3HKZA 3AAFA 2A05A 2VBYA 1MNDA 1YIJI 2ZBKA 3FMSA 3LQRA 4IF4A 3RKQA 2VT3A 2V1XA 1JT6A 2CFOA 3B02A 4KT5C 2L2OA 4L9TA 3T8TA 2BY0A 1FBUA 2CV2A 4U0VA 1T8IA 2VI6A 2BY3A 2DA1A 4HG2A 5FRMA 1FZPB 4NQWA 4CCKA 3K10A 3GZ5A 4MGRA 2DI3A 1EA3A 1WGXA 3JAMZ 5FKKA 3MQ0A 3ASNH 1J5YA 2BY1A 4BAYA 1ZYRF 2X1CA 2ME6A 1ERDA 1J2XA 2E19A 2W85A 1CF7A 1UB9A 5HDNA 3DKYA 5BOXA 2ICWG 1TT0A 5K5OA 4HF1A 1GXPA 3F8FA 5C4XJ 2XC7A 1BI0A 1ZR2A 1IRGA 3KIOA 2ZJQF 1MJBA 1X2MA 2A68F 4CSWA 3CC2I 1NH3A 1OYYA 3S2DJ 1VQ9I 4A5NA 4EJVA 4KN4X 2H27A 2WBMA 4OOIA 2WAFA 1RR8C 4YIFA 5LEJA 3WTSC 1OFCX 3OS0A 4CA0A 2IPQX 5H6RA 2PJPA 3G1LA 4HW0A 1BC7C 3P7NA 3ZMSA 3TOBA 1A31A 1YITI 2FMLA 1QHHD 1WI3A 4E7JA 1ZN2A 3KP7A 3MD2A 1R22A 1FWZA 1P6RA 2EIJH 4ZJZA 3PUFA 1IN4A 2HTJA 2FUG2 1OYIA 5LBQA 2JA8J 2OC6A 5F6FA 4A5MA 1Z6TA 1HQCA 4XRMA 1EV7A 4EM1A 3NWSA 4JK1X 1PDNC 3GTOJ 2BYVE 2VE8A 2K3FA 2M3AA 3CZ6A 4YELA 1Z7LA 1P7JA 2Q2EB 1ZRDA 2CMPA 4Q5SF 4G9YA 5DDGA 3FX3A 5C3EJ 3PFIA 2P5KA 3S15J 2QZ8A 2YUSA 5J8FA 2PFBA 2X6WA 3AL0B 2OV7A 2DXIA 3AFHA 1ZRCA 5EZHA 4RA2A 1UHSA 3EUKL 5TJJA 3HOYJ 3ZQFA 4I01A 2FBIA 4NHJA 3P9CA 3K4KA 2GZWA 4EV0A 2XF7A 1MBFA 2AXLA 2XGEA 2QQ9A 3H5NA 2Z16A 2QVOA 2JSPA 3VFZA 1MJ9A 2WV0A 3GW2A 2QF7A 3W6KB 1MKMA 1HLVA 1QPIA 1K6OA 4BXXJ 4Y33A 2L54A 2HYGD 3F72A 3H0GJ 2L4MA 2G7UA 3LFUA 2QLZA 1W5CC 1P9QC 4G6QA 1OYWA 1K61A 3DU6A 3MZ8A 2VPLA 4ASNA 3GFIA 2FOKA 4KN7X 3HJEA 3VODA 1IG7A 4IQJA 1R5ID 2PI0A 1WWXA 1JHHA 2W82A 5C44J 1U8RA 1T2KA 2F4OB 1G3WA 5IT3A 3CF5F 2EJRA 2ISZA 5K1YA 2OZ6A 4KIGA 1J75A 4CH7A 2X9DA 2W57A 3ZGKA 4IXAA 2EILH 5DCFA 3PNTA 2XRNA 1FPQA 4XLPF 2HR3A 5FROA 1G3SA 1O7LA 1MNEA 3X2QH 2CFXA 1G4DA 3HRMA 1FIPA 1GDTA 1RESA 1MDMB 3ELKA 5FKLA 5ILSA 4AU7A 2MLKA 4DNCA 4WX9A 1I50J 2DTZA 1RZ4A 1U0JA 2R92J 1QQIA 3MFKA 1R7JA 2EV6A 2GXGA 3ABKH 3SZGA 2I5UA 2YS9A 1AKHA 1LJ9A 2E7WA 3HC7A 4G7ZF 3A2KA 2DA2A 1CGPA 2RVCA 3W2WA 2HNHA 3VB2A 1MMGA 3HKZN 1Z77A 4CDGA 4YG2F 3UKGA 1I6XA 3JRCA 1ETWA 2R7XA 2W48A 4GYIA 1TC3C 1TTYA 2OQRA 3S16J 2KRCA 1X1PA 2A6HF 2OZUA 5FFXA 2F4IA 1FIAA 4HOBA 2DBBA 1T0FA 1WCMJ 3CUOA 5LLQA 3V42A 2EK5A 1FEXA 2AQFA 2QQ8A 4G12A 5FGMA 2QSHX 3LSRA 4ZYGA 4CZCA 1X19A 3F8NA 2K86A 1FP1D 3HOSA 1TNSA 4XOPA 2CO5A 2ZJRF 1YFHA 4II2A 2VONA 3MMYB 2NS8A 5LGUA 4DBRA 3KEQA 3JRAA 1DPRA 1UZCA 1OMIA 2FSWA 2OU2A 3TEDA 2O61A 2NOJB 4UUTA 4NQWB 2FF4A 2EWNA 2OQGA 4Y17A 2IS2A 4BUPA 1W36D 3S2WA 1GUUA 1P4WA 4EMSA 2D45A 3ZMTA 2XSDC 2DFIA 2G7HA 4BQNA 1B59A 1YS6A 3PQKA 4XSZF 2JRMA 4A93J 4IQ4A 3CDIA 4XN0A 1YJ9I 4A3CJ 3CUQC 3E5UA 3EYIA 3HUGB 2RC4A 4G94A 2GXBA 1ZAOA 1N78A 1IV6A 4P5OA 4M71A 1T33A 3H1CA 3ZMDA 2HOSA 3IH3A 1QPMA 3K2AA 1OLTA 5E17F 1X3ZB 4PJNA 2HDWA 4FCYA 1Z1DA 3RYPA 2Q8KA 3BTLA 3WTZA 3WTXC 5FLXZ 4UUSA 3HTUA 2MH9A 4O6JA 5CPRB 4YFNF 2NS7A 2QCOA 1Z9CA 2M87A 3E5QA 4ANJA 1GHCA 4L9JA 2V1NA 3K70C 2EFOA 3RKWA 5ILUA 4BQOA 2CUEA 2HVRA 2A5YB 1FX7A 5TRDA 3H3ZA 4CHUA 4MQ9F 2VASA 1Y6IA 4XLNF 3EDPA 2VJ4A 4C2TA 3KLNA 5HNHA 1XD7A 1V5FA 3OYAA 3GFJA 2KP6A 1VQLI 2V9KA 1QU3A 3A0HC 4P9UA 4FISA 4B8XA 4UB8C 3ABTA 3BR6A 4P1WA 2LSOA 4M73A 2LY1A 1XCBA 3BJOA 1K4SA 2KJBA 3ZQHA 3GFMA 1KU3A 1ETQA 4IEJA 3FKIJ 3H5AA 2K27A 4IHVA 1WJAA 3WU1B 5LD2C 1ACIA 1LQ1A 3TGNA 1D5VA 1S7AA 3ERED 4MTDA 1K7AA 5AIPA 4L0YB 2FRHA 1UELB 3RKYA 2NVQJ 1M1EB 3K0LA 2FBKA 5K7ZA 4CCOA 5HS9A 3IWFA 1MBKA 3H9QA 3DPUA 2DA6A 2WY7Q 2YX4A 2UZKA 2ZFWA 3I53A 5EYRA 2X4HA 2Y30A 1RNLA 2OJED 3OYHA 1F1ZA 4C9YA 2F5FA 1MNMC 3BG9A 2X6YA 4NB5A 2EB7A 2D1HA 3IKVA 4ESFA 5GTIC 1YTYA 3VOEA 2A07F 1BI1A 2F5VA 3AG4H 4KUMA 2IGOA 2WC2A 3HGYA 4LB5A 1SAXA 1BA5A 1T08B 2XPVA 4PSWA 2QKMB 2X85A 3JRIA 3I58A 2XB5A 5TGTA 2GWRA 2VJJA 1JUPA 2NAZA 3WHBA 5F1RA 1WI9A 4XRSA 1YOVB 4BL0B 5FKMA 4IHSA 1KZHA 3E6CC 5E1WA 2HDDA 2DJIA 3KP2A 5C4JJ 3KP4A 3LSKA 2VBWA 3QAHA 2W1OA 4X0GA 1R1VA 4G6DA 1HKTA 2CUZA 4FHTA 1FOWA 5J4VA 3M3YJ 3BG3A 3G1MA 3IAS2 5LHIA 5D6FA 4XN3A 3Q5FA 1FSEA 5BPDA 4BGDA 4W97A 3GTPJ 1FTZA 2EBIA 1TW2A 5BQTA 1D0XA 4FASD 2NVYJ 2M30A 2L7KA 1A36A 4Y7NJ 3D0SA 1LNWA 2EA4A 4ZDPA 2GOXB 2P7CB 1DGRM 3RDIA 3CCUI 5E18F 2IA2A 2ZC2A 3BZCA 2VN2A 3GXOA 1UHWA 1RUNA 2LK2A 2X6XA 5DYMA 2FNPA 1SD5A 3KP6A 1IGNA 3WGIA 1VQ6I 2E7XA 1IUYA 2XGDA 1E2XA 4N0BA 2O9LA 2P81A 1YW9A 3LOCA 5F0FA 1OPCA 3C2BA 4HRIA 2E35A 2EV5A 1NHAA 1D8JA 1ORKA 2Z9OA 4XL9A 3GTJJ 1WJEA 2ID3A 3HRUA 3FXJA 3A02A 3SFIA 2XF6A 4LIUA 5GAEJ 2GAUA 2LREA 4G6TB 3CCEI 1Q1HA 4Z6YA 3KEOA 2H94A 3A1YA 1J0RA 3OS2A 5KK1A 3RPUA 1D1BA 5ICFA 5LGTA 4XOTA 3CCLI 1B1BA 2RN7A 3H9GA 1RC9A 4HZFA 4RBOA 4ZDLA 4OAYA 1MJAA 3LSGA 4KMFA 1AHDP 2BGCA 2H1LA 1U9OA 2VBXA 3CMYA 4U0YA 4AM3A 5KAIC 1F43A 4HEA2 2VQLA 3SZTA 4YFXF 1BJAA 3KETA 2AHQA 4BBRJ 3OOPA 4L5EA 2D2WA 3GTLJ 1NK2P 3EQLF 4BJ6C 3LA7A 1E0EA 3I3LA 4XRSG 3BR0A 3K4BA 4ESJA 1R4NB 2CW8A 1JUSA 4E7ZA 5IYCJ 4Q4ZF 1J59A 4AIDA 1R5GA 2B0LA 4LG0A 2Y0SA 1REPC 2ZSHB 2K3PA 3OR1C 4AVPA 3BR2A 4M9SA 3BG6A 1QO0D 1ZG5A 3MCZA 4GDFA 2EZKA 1KU9A 2NOGA 4PGHA 2Q2EA 2ZNZA 2ESHA 3PFYA 3E6BA 4KICA 1ZARA 2ZFUA 4N9IA 2E1OA 3BPXA 2NXNB 1X1CA 2EZLA 2HOAA 2RDPA 3A03A 1KGSA 3DWLE 1B8IB 3T8RA 3U1DA 2IGMA 1GVDA 4RLQA 2VL8A 2DTRA 3ZPLA 4C3HJ 5LFAA 2DOEA 2BVLA 2CV1A 3G1OA 1WVRA 2M0MA 1TWFJ 4ZYHA 1A04A 2JWTA 1IUFA 3L2UA 4UXNA 4HAMA 3TQNA 1WJBA 4D1QA 5F0HA 3IUOA 2ZO4A 4LOCA 3HSEA 3K4JA 3OMYA 1LDKB 2IGNA 3JREA 4Z2YA 3GYHX 2HQNA 4OIPF 5JFRA 2I8DA 3JRDA 2HPMA 2FOWA 3CF2A 1MD0A 3GF2A 5CQEA 2KPMA 2M4KA 3FISA 3VYRB 1FBQA 1YHQI 3HDDA 5DUIA 3KFWX 2DDAA 5CVJA 4Y13A 1FYLA 4KFCA 1NTCA 3D5LA 1K83J 1B9NA 3U21A 2B63J 4OINF 2JVHA 1FMVA 4I02A 4WF2A 2AS5F 3EYYA 2R7UA 2FNAA 1FLIA 2JUGA 1EF4A 3K4CA 1SVLA 1JJ8C 5DD4A 2VC1A 1I39A 1VZ0A 2CH0A 4XKWA 1TQMA 2XAUA 1JKPC 1ZRFA 2LLKA 3FMRA 1UHMA 1T38A 4CYDA 3ZMVA 5IY5H 3CJNA 2BY2A 4XKVA 2DQLA 2OD5A 1POGA 1R1TA 4N9HA 2QA4I 1VNDA 3M7GA 2P5VA 2IS4A 3DP7A 2K9NA 3U1KA 4BJ5C 2UWMA 3ZQQA 4L5IA 1Z0XA 2ZXHA 4P96A 1F4KA 2IGKA 3WG9A 2LKPA 5J1RA 3GZ6A 3BQYA 3F6VA 2M1BA 2MYSA 3SXYA 1PVEA 5HS8A 1PYVA 4RB0A 3M9AA 3DKXA 3QPHA 4XLHA 4BXFA 1Z6RA 1VQ7I 2JPCA 4BDYA 1FC3A 2Y2ZA 2YU3A 1MW7A 4L18B 1J9IA 3UR3C 1SMTA 3KPHA 1E3PA 1S72I 2E1MC 4HLXA 4CCMA 1GV5A 4L5JA 1BOAA 1HCRA 2PN6A 4A12A 5LHGA 1PJRA 4MTEA 4A2UA 4RB1A 3PIOF 1P7IA 2ZXJA 5E3OA 2MC3A 1KYZA 3R4KA 1D8KA 4BHBA 3FHZA 3HBLA 5EEAA 2EV0A 5HLIA 2EFWA 3HOWJ 1ZTRA 2F5EA 3HL2A 2ZMEC 5JVGF 1MMDA 2V9PA 1D0ZA 2CGPA 3QP6A 1I5ZA 5EZGA 2PMZA 3GMEA 5F04A 4UB6C 4I99C 5F0CA 1STZA 3S8PA 2L9RA 4M6VA 4K2EA 1R5HA 3WU2C 3BZKA 5KHDA 5J1UA 5D6EA 4JQFA 1JUMA 1OCCH 1UJ8A 2OCEA 4A6EA 4E7KA 1IZ1A 3WTTC 1A5JA 4PJ0C 2HOTA 2DT5A 2QSFX 3BTIA 2JSCA 3OYNA 2WB1A 4IX7A 1AA7A 3HGGA 5HLHA 1S7EA 3KYDB 3CCYA 1J7KA 4AIJA 3OL4A 1W7PA 4D7NA 3ZQLA 1Y0NA 3LSJA 3S32A 1ZGJA 4UHTA 4XMYA 5E1ZB 3KLOA 4BEHB 4H4KC 2M4GA 4IHXA 4IL6C 5F27A 1ULYA 5CJ9A 3CO6C 3KYLA 4I09A 5FO5A 4W1UA 4DIQA 1MMSA 2XHKA 3HUGA 3JRBA 2MA3A 1ZG1A 3ABUA 1L3LA 1FTTA 5K7HA 1DUXC 2CQXA 2YPRA 5AONA 2Y0SN 4YEJA 2STWA 1GLNA 2JQ7A 2FX0A 2GQQA 3L2CA 5IPAA 2XAFA 2GBYA 2LTPA 3DTKA 4M3BA 5LRRA 4ZC3A 2QBYB 3SQNA 5L3GA 3DEWA 2BEOA 3F6OA 4IVNA 4Y3OA 2XRLA 2NVXJ 5JLXA 4IHWA 1T56A 2ELJA 5F1JA 2VOPA 3A0BC 3OIPA 1OCOH 2E71A 2MD5A 3LA2A 1OCTC 1T98A 1DP7P 4XR6A 3F8CA 2BBYA 3PSIA 4LG0B 2OF7A 4BKXA 1LFPA 3FBIB 2ECCA 4B43A 1IRXA 4NC6A 3C7JA 1OR7A 2DA5A 4MHGA 4ZTFA 2HQ5A 4EJWA 1X2NA 3LNQA 5M5WJ 4P9FA 1MSFC 4HSRA 1X3WB 1LPQA 3BT9A 1SFOJ 2OCCH 4EVIA 2LH9A 3ZQCA 4M3EA 2G9WA 5DS9A 5D4SA 4B47A 2R7DA 1U2WA 3V8KA 3TBIA 2MABA 3VPRA 1Z67A 2Y75A 2Z5UA 1S29A 1APLC 2KISA 5LRSA 1QZZA 1HBXG 3RZDJ 1SANA 3Q3SA 2H6CA 3ZQGA 1RR7A 4EM2A 2EZIA 4GYGA 5HS7A 3QRFF 1F36A 5HLTA 5CVVA 2KIMA 4BE2A 2BVMA 4M6YA 3RQ4A 3CMEI 1LFBA 4HPQA 3TKYA 3FXKA 3ASOH 3OYDA 4LITA 1DP3A 3HM5A 1FT9A 4DOZA 4RB2C 5A2QK 1W5TA 1TWHJ 4O5VA 1W36C 4MEXF 3BR5A 2VKHA 2JN6A 4ITVA 3SDGA 1XB4A 2W4SA 1HW2A 2DMTA 4BDZA 2VE9A 2V1UA 4I98B 2NS0A 2HI3A 3K1PA 3QU3A 1Z91A 3QU6A 5DM6F 3FIWA 3OYBA 1YG2A 3DBHB 3CJQB 3RYRA 1G59A 3I56I 3HB9A 3SEZA 2JZYA 3M8FA 1OQYA 2KT0A 5M5XJ 4ZYDA 1S3JA 3C2GA 1IN5A 2VQGA 5LEKA 3TDUC 1U8BA 2O8KA 2IS1A 3G4SI 3H35A 2QEXI 3H5RA 2HU9A 1BR1A 1W1WE 2ACJA 1FJLA 2HFHA 1YX5A 2QWWA 3LMMA 3W6JB 2D1VA 4XSXF 4QPQA 4DYCA 2L9VA 2GIZA 2JJ7A 3V8JA 3DLLF 3M4OJ 1SFKA 2L7ZA 3G3ZA 2BW3A 2KIUA 1ON1A 4ZH4F 1VQMI 2UXXA 3R60A 3TO7A 3CO7C 2Q1ZB 5E20A 1JT0A 3S3MA 2DN0A 1TWGJ 4RAYA 3CD6I 2PMZN 2XPUA 2Y0MA 5EG0B 3S1RJ 3K69A 2MG4A 1RKTA 1XTAA 4CICA 4B4CA 1OCRH 5EJCA 3MAJA 1KQ8A 5IOZA 4A6DA
chains in the Genus database with same CATH topology
3HIFA 1IXCA 2E1CA 1SFUA 3DKWA 1EH8A 3NEUA 1G3YA 1Z7UA 4YFKF 3BJAA 2XAJA 4LLLA 3E6MA 5E8GA 1V3FA 4Q47A 3FZVA 2QQBA 1P2FA 3DPLC 1SD7A 4OU0A 1FP2A 4FX0A 2LDUA 2FU4A 2IT0A 4CO8A 3CUQB 4OIQF 3L00A 2VXZA 1W4MA 3FMQA 4RGRA 1W7PB 3L9FA 2YSRA 2CWEA 2HTSA 1G6NA 3WODF 2VBZA 4EM0B 4FX4A 4LK0F 3IHUA 5IT9K 1B4AA 2CW0F 1XSVA 1BI3A 2K4JA 1BI2A 4MEYF 5F64A 4L0ZB 3ZMUA 2HYFA 1DPUA 3E97A 2DQRA 2F5CA 5FD5A 2Z99A 3JW4A 3FXUA 3LA3A 3I64A 4M72A 3BJ6A 1QBJA 5D5XB 4LMYA 1RI7A 2FQ3A 2F2EA 3WU0A 3EETA 4S04A 4G7OF 2HGCA 2HOEA 3ZP5A 2ETHA 3J80K 5H6QA 3KP5A 4WK8F 4GCVA 2DPUA 1KQ9A 2FE3A 4U0WA 2CSOA 3WTYC 3ML6A 4LD5A 2YR2A 1O3RA 4LGWA 3JTHA 2H09A 1S8NA 2XV4S 2E1NA 1IXRC 3ZN0A 1AWCA 1PP7U 3I54A 3GEZA 5CVIA 4WXDA 2HQRA 1YQAA 1P4AA 3K1MA 4S05A 2W84A 3J81K 2FBHA 2XIGA 5J8CA 2PQ8A 3SZPA 1D3YA 3V7RA 1Z05A 1LEAA 3COAC 3KCCA 4HX7A 5BS6A 1FY7A 5D5VB 1ZH5A 2ZMEA 1IXSB 1IAWA 1USTA 3BDDA 4UNOA 1VTNC 1LVAA 1USSA 2IRFG 3F23A 2HZTA 2MBFA 3QP5A 5K5RA 2IA1A 2ZJ2A 4ETSA 5L3EA 3E6DA 2FMYA 3PQJA 4IPAA 3MZYA 2ZKZA 3JTGA 1XSXA 3LAJA 3FM5A 2QYOA 4UV8A 4KNYA 5BPIA 2HWVA 3BWGA 3NRVA 3FM3A 3JSPA 5KVRA 1FYKA 4HX8A 3CLOA 5L3BA 5HDKA 4WWCA 1U78A 3E5XA 5DD8A 2DW4A 2P4WA 4HQMA 2BV6A 2HEOA 4OMZA 1TQIA 3F22A 1HW1A 3ECOA 4IRHA 1JXSA 4PDKA 4CXFA 3HRTA 3N97A 2QBYA 3IRRA 2GIVA 2JPBA 4G8XA 3MZHA 1YYVA 1U3EM 3BY6A 2VT2A 3O6BB 3K9TA 2WWYA 4IRIA 3DF8A 4ENNA 1I1SA 4MNUA 4HDUA 2XAGA 5L3FA 4XBFA 1H9TA 3DFGA 4I0AA 1WKMA 3R61A 5BMZA 1QGPA 1O7FA 3RKXA 1QZYA 4RB3C 5DV5A 4UVCA 4HBLA 4MQVA 4HX4A 2A6EF 2Y48A 3G73A 1HKQA 2ZNYA 4DQ2A 3BROA 2KKOA 3ROUA 3R0AA 1K78B 2NNNA 4LLNA 2IA0A 3Q9SA 3RTRA 2P6SA 1FOKA 1FYMA 2OBPA 4KMUX 3V4GA 3HRSA 3SHFA 3KP3A 2LF7A 3BP8A 2P7VB 2PMHA 4RS8A 1GVJA 5FB2A 3HHHA 2HS5A 4RGSA 4KIBA 5HOOA 2O03A 4L9VA 1K79A 2A3SA 2NRAC 3ISPA 1I27A 2DU9A 1U5TB 5ICCA 4KYWA 4BH9A 3TO9A 4O3MA 4BHPA 4I2OA 2ZMEB 1U5TC 2KIFA 4U88A 3M1EA 1ZLKA 1FSHA 4L9NA 1IN8A 1UFMA 3LQQA 4ZZLA 1IN7A 4HV5A 2BE5F 1G3TA 3B73A 3H92A 4HLYA 2PLYA 3T0YA 4CZZA 5E1XA 3R6SA 3TOAA 1ONVA 5CVUA 4LB6B 4LLGF 1BC8C 2P6TA 1HSJA 5A2QZ 1P92A 3DV8A 3V7SA 1H9GA 3WGHA 3CUQA 4AWXB 2L02A 1R23A 3P9IA 2VC0A 3FWEA 2DAOA 1LEBA 4AD9A 2A69F 4HYEA 3GFLA 2HDCA 1IRFA 1IW7F 1XN7A 1ZG3A 2XASA 5D5WB 3M8EA 2DLLA 1W5SA 3IKTA 2RQPA 3LSTA 4A0ZA 2L4AA 3DXJF 2RNJA 4QLCU 2C6YA 4BXUA 3OV8A 3RIRA 4JBAA 3KZYA 2J5PA 2LF8A 4CGZA 3GVAA 4UVBA 3C18A 4H0EA 4EQQA 3ZN1A 3H3UA 3TDZC 4BYYA 4M9XA 1O57A 5D4RA 1R36A 1EH7A 2GA1A 3F21A 3E3VA 4GGGA 2UXNA 1T6SA 3Q9VA 1XDSA 1EH6A 3FXRA 1L0OC 2P5LC 1F5TA 3C3WA 3LAPA 1BIBA 5ICGA 1RIOH 3GUDA 1U6GA 5IT9Z 2KRFA 4AIHA 1UCRA 1SMYF 3IRQA 4LFUA 1B6AA 2IVMA 1YW8A 4FT8A 2V1DA 4P55A 2IJLA 4E70A 1XGNA 4ESBA 3GX4X 1KYWA 3SFZA 2M45A 3JSOA 3R0JA 1ZGAA 3FF5A 1I1GA 5ILVA 3JAMK 2FEZA 4GXOA 4HF2A 2PMUA 4G7HF 5DCMA 1ON2A 3J80Z 3O3KA 1SFXA 3L09A 1KU7A 3HHGA 1YO5C 4RGXA 1MGTA 5K5QA 3FXQA 2COMA 2W24A 5D5UB 5FFZA 2EFNA 2A61A 2OA4A 3GO5A 5JR3A 4EGYA 1YW7A 2M5WA 1GXQA 1BBYA 5JVTA 2CQKA 1ODDA 3NQOA 2HKXA 5ERIA 2R7FA 4BQAA 1QNTA 1MZBA 2RV8A 4ON0A 4R8HA 3RI4A 4PGGA 3WE2A 3J81Z 4PCQA 2QENA 2VOOA 4I0BA 1SD6A 3BOQA 2QM3A 4RAZA 1AOYA 5EEHA 4M74A 3IC7A 2DK5A 3I0TA 2O8XA 1XDUA 3ZMZA 3GLXA 4TV7A 4RGUA 2RGVA 5AIQA 1XGOA 1YLFA 4ENMA 2O6GE 4WXCA 3U9GA 1CF7B 4UV9A 3WTWC 2ESNA 2XKPA 5LHHA 1XMAA 1IF1A 3LWFA 3I59A 1KU2A 2EFPA 4ZYEA 2M8EA 4HDVA 3WGGA 2IP2A 1FNNA 1LDJA 5HVQC 4OIOF 2DK8A 3WTUC 4HQEA 3HSRA 5DEQA 2V9VA 1KA8A 2K7LA 5CLSA 2DO7A 5JHUA 4IRGA 1KQ0A 2MH2A 2RKHA 1K78A 1DDNA 5EEGA 2OAZA 3F3XA 3V7CA 3IWZA 4U7BA 1R1UA 1TNTA 3K2ZA 5J6XA 2NYXA 3CTAA 3MWMA 5L3CA 1S6LA 3WE3A 5D8KB 4R1HA 1LDDA 4R79A 1WRJA 2STTA 1HXDA 1XGSA 3C1DA 5FD6A 4A0XA 1C0WA 2L3DA 4IJAA 3ULQB 1Y0UA 1U5TA 4AIKA 2V79A 1V4RA 1RUOA 4LK1F 3U2RA 3L7WA 4Y15A 2XAQA 5HLGA 3T1BA 3VEPA 1W7PD 4EJTA 3O2PE 2HKOA 4A0YA 2P8TA 5D8LB 3WTVC 1ZREA 2EA2A 5DCMB 3J7AO 1F9NA 4ZZDA 4LJZF 1P4XA 3T5XA 2ELHA 4KA4A 4D0PA 3HOTA 1IN6A 1XSDA 2PG4A 3BZ6A 2QQAA 4OIRF 5FLXK 3N4MA 1PP8F 2J5OA 2PEXA 5JI6A 4HV6A 3TO6A 5LGNA 2LNBA 1B9MA 2FA5A 2IW5A 2NNYA 2EFQA 1WSUA 5DUKA 2XUBA 3EUHA 4M9ZA 3RPQA 1TQPA 1YIOA 2VODA 4UVAA 1XGMA 4PZJA 4HF0A 1H0MA 2Z3YA 2TDXA 3BPVA 2PBIA 2Q0OA 3QPTA 3QOPA 4EJOA 1ZHFA 1JGSA 3DPTA 1FBSA 2CYYA 2JRTA 4KIFA 5ED4A 3DEUA 3IL2A 3KZZA 1BN5A 4ENJA 1TW3A 3CDHA 3KE2A 4OMYA 2O0YA 1JHFA 3I59B 3I4PA 3ZQ7A 4U7DA 3ECHA 5ICEA 2DPDA 3F8MA 6PAXA 4BNCA 4XRFA 5HDGA 2O3FA 2K02A 4YIIA 4HA8A 4Q48A 2H6BA 3DQVC 1O3QA 2K4BA 1X3UA 5E8IA 5CYVA 2W25A 2QUFA 1HW5A 1JE8A 2JT1A 3HTSB 2X0LA 1LB2A 4KDPA 2XVCA 4B09A 1HKSA 3LFKA 5L3DA 1SD4A 5CVRA 4F7ZA 2ADUA 1TBXA 3V8LA 3HSFA 4QWQA 3RJPA 2YX7A 4EJUA 2XKOA 2XAHA 1O3SA 2Z33A 2L01A 1XCVA 1OKRA 4EGZA 2CG4A 2V6CA 3I71A 5H20A 3P9KA 3GWZA 1HSTA 4UUVA 1BIAA 3HYIA 4ENKA 2MLGA 1R58A 1MDMA 4GO1A 1E17A 4WCGA 1ZLJA 2XGXA 1XMKA 3K1NA 1PUEE 3MEXA 2FXAA 2ZCWA 1WQ2A 1R00A 4WXHA 1YS7A 2WTEA 3REOA 1O3TA 1TLHB 2XROA 1BM9A 2ISYA 4M6XA 2F5DA 3I5UA 1T39A 1S7OA 3F8BA 1SFEA 4I7HA 2R3SA 2KJCA 2GA2A 2JTVA 4BHCA 3AAFA 2VBYA 2ZBKA 3FMSA 3LQRA 4IF4A 2VT3A 2V1XA 3B02A 4KT5C 4L9TA 3T8TA 1FBUA 4U0VA 1FZPB 4NQWA 3GZ5A 4MGRA 2DI3A 3JAMZ 3MQ0A 1J5YA 4BAYA 1ZYRF 1J2XA 2W85A 1CF7A 1UB9A 5HDNA 5BOXA 5K5OA 4HF1A 1GXPA 3F8FA 1BI0A 1IRGA 1MJBA 2A68F 1OYYA 4A5NA 4EJVA 4KN4X 2H27A 4OOIA 4YIFA 5LEJA 3WTSC 2IPQX 5H6RA 2PJPA 4HW0A 1BC7C 3P7NA 3ZMSA 3TOBA 2FMLA 1ZN2A 3KP7A 1R22A 1FWZA 1P6RA 1IN4A 2HTJA 1OYIA 5LBQA 5F6FA 4A5MA 1Z6TA 1HQCA 1EV7A 4EM1A 1PDNC 4JK1X 2BYVE 2VE8A 1ZRDA 4Q5SF 4G9YA 5DDGA 3FX3A 3PFIA 2P5KA 2QZ8A 5J8FA 2PFBA 1ZRCA 5TJJA 4I01A 2FBIA 4NHJA 3P9CA 2GZWA 4EV0A 2AXLA 2QQ9A 2QVOA 3VFZA 1MJ9A 2WV0A 3GW2A 3W6KB 1MKMA 1K6OA 2L54A 2HYGD 3F72A 2L4MA 2G7UA 2QLZA 4G6QA 1OYWA 4ASNA 3GFIA 2FOKA 4KN7X 3VODA 2PI0A 1WWXA 1JHHA 1U8RA 1T2KA 1G3WA 5IT3A 2EJRA 2ISZA 5K1YA 2OZ6A 4KIGA 1J75A 2W57A 4IXAA 5DCFA 2XRNA 1FPQA 4XLPF 2HR3A 1G3SA 1O7LA 2CFXA 1G4DA 3HRMA 1MDMB 3ELKA 5ILSA 4DNCA 2MLKA 4WX9A 1RZ4A 1QQIA 3MFKA 1R7JA 2EV6A 2GXGA 1LJ9A 2E7WA 4G7ZF 1CGPA 2RVCA 3VB2A 4YG2F 4CDGA 1I6XA 4GYIA 1TTYA 2OQRA 2A6HF 2OZUA 5FFXA 4HOBA 2DBBA 1T0FA 3CUOA 5LLQA 2EK5A 5FGMA 4ZYGA 3F8NA 2K86A 1FP1D 3HOSA 1TNSA 2CO5A 1YFHA 2VONA 5LGUA 3KEQA 1DPRA 1OMIA 2FSWA 2OU2A 2O61A 2FF4A 2EWNA 2OQGA 4Y17A 3S2WA 1P4WA 4EMSA 2D45A 3ZMTA 2DFIA 2G7HA 1B59A 1YS6A 3PQKA 4XSZF 3CUQC 3E5UA 3EYIA 2RC4A 4G94A 2GXBA 1ZAOA 4P5OA 4M71A 3ZMDA 1QPMA 5E17F 1Z1DA 3RYPA 2Q8KA 3WTZA 3WTXC 5FLXZ 3HTUA 2MH9A 4O6JA 4YFNF 1Z9CA 2M87A 3E5QA 1GHCA 4L9JA 2EFOA 3RKWA 5ILUA 2A5YB 5TRDA 1FX7A 3H3ZA 4CHUA 4MQ9F 4XLNF 3EDPA 3KLNA 1XD7A 3GFJA 4P9UA 4B8XA 3ABTA 2LSOA 4M73A 1XCBA 3BJOA 2KJBA 3GFMA 1KU3A 2K27A 3WU1B 1LQ1A 3TGNA 1D5VA 1S7AA 3ERED 4MTDA 1K7AA 5AIPA 4L0YB 2FRHA 3RKYA 3K0LA 2FBKA 5HS9A 3IWFA 2YX4A 2UZKA 2ZFWA 3I53A 2X4HA 1RNLA 1F1ZA 2F5FA 4NB5A 2EB7A 2D1HA 3IKVA 4ESFA 1YTYA 3VOEA 2A07F 1BI1A 4KUMA 2WC2A 4LB5A 1SAXA 3I58A 2GWRA 2NAZA 5F1RA 1WI9A 4IHSA 3E6CC 5E1WA 3KP2A 3KP4A 2VBWA 3QAHA 1R1VA 4G6DA 1HKTA 4FHTA 5LHIA 5D6FA 3Q5FA 1FSEA 5BPDA 1TW2A 5BQTA 2M30A 3D0SA 1LNWA 2EA4A 2P7CB 3RDIA 5E18F 2IA2A 2VN2A 3GXOA 1UHWA 1RUNA 5DYMA 2FNPA 1SD5A 3KP6A 3WGIA 2E7XA 1IUYA 1E2XA 4N0BA 1YW9A 1OPCA 2EV5A 1NHAA 1D8JA 2Z9OA 3HRUA 2GAUA 1Q1HA 3KEOA 2H94A 1J0RA 5KK1A 3RPUA 5ICFA 5LGTA 1B1BA 2RN7A 4HZFA 1MJAA 4KMFA 2BGCA 2VBXA 4U0YA 3SZTA 4YFXF 1BJAA 3KETA 3OOPA 2D2WA 3EQLF 3LA7A 4ESJA 4Q4ZF 1J59A 1R5GA 2B0LA 4LG0A 1REPC 4AVPA 4M9SA 1ZG5A 1QO0D 3MCZA 1KU9A 4PGHA 2Q2EA 2ZNZA 2ESHA 3E6BA 4KICA 1ZARA 4N9IA 3BPXA 2RDPA 1KGSA 3T8RA 3U1DA 2DTRA 3ZPLA 4ZYHA 1A04A 4UXNA 4HAMA 3TQNA 2ZO4A 3HSEA 1LDKB 4Z2YA 3GYHX 2HQNA 4OIPF 5JFRA 1MD0A 3GF2A 1FBQA 5DUIA 3KFWX 5CVJA 4Y13A 1FYLA 4KFCA 3D5LA 1B9NA 4OINF 4I02A 4WF2A 2AS5F 3EYYA 2FNAA 1FLIA 5DD4A 2VC1A 1TQMA 1ZRFA 3FMRA 1UHMA 1T38A 4CYDA 3ZMVA 3CJNA 2DQLA 2OD5A 1R1TA 4N9HA 3M7GA 2P5VA 3DP7A 2UWMA 4L5IA 4P96A 1F4KA 3WG9A 2LKPA 3GZ6A 3F6VA 2M1BA 3SXYA 5HS8A 4RB0A 3M9AA 3QPHA 1Z6RA 2JPCA 1FC3A 2YU3A 4L18B 1J9IA 1SMTA 4HLXA 4L5JA 1BOAA 2PN6A 4A12A 5LHGA 4MTEA 4A2UA 4RB1A 2ZXJA 2MC3A 1KYZA 3R4KA 1D8KA 4BHBA 3FHZA 2EV0A 5HLIA 2EFWA 2F5EA 2CGPA 3QP6A 1I5ZA 1STZA 4K2EA 1R5HA 5D6EA 4JQFA 4A6EA 1IZ1A 3WTTC 2DT5A 2JSCA 5HLHA 1J7KA 4AIJA 1W7PA 1ZGJA 4UHTA 5E1ZB 3KLOA 1ULYA 5CJ9A 3CO6C 4I09A 5FO5A 2XHKA 3HUGA 2MA3A 1ZG1A 3ABUA 1L3LA 1DUXC 2YPRA 5AONA 2STWA 2GQQA 3L2CA 2XAFA 5LRRA 2QBYB 3SQNA 5L3GA 2BEOA 3F6OA 4IVNA 2VOPA 2MD5A 3LA2A 1T98A 1DP7P 3F8CA 2BBYA 4LG0B 3C7JA 1OR7A 4MHGA 4EJWA 4P9FA 4EVIA 2G9WA 5D4SA 2R7DA 1U2WA 3V8KA 2Y75A 2Z5UA 1S29A 5LRSA 1QZZA 1HBXG 2H6CA 4EM2A 5HS7A 4GYGA 3QRFF 5CVVA 2KIMA 4M6YA 3TKYA 5A2QK 1FT9A 4RB2C 1W5TA 4O5VA 4MEXF 1XB4A 1HW2A 2VE9A 2V1UA 4I98B 2NS0A 3K1PA 3QU3A 1Z91A 3QU6A 1YG2A 3RYRA 2JZYA 3M8FA 4ZYDA 1S3JA 1IN5A 5LEKA 3TDUC 2ACJA 2HFHA 2QWWA 3W6JB 2D1VA 4XSXF 3V8JA 3G3ZA 2KIUA 1ON1A 4ZH4F 2UXXA 3R60A 3TO7A 3CO7C 5E20A 4RAYA 2Y0MA 3K69A 4CICA 3MAJA 1KQ8A 4IHTA 4A6DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3HIF A;  1IXC A;  2E1C A;  1SFU A;  3DKW A;  1EH8 A;  3NEU A;  1G3Y A;  1Z7U A;  4YFK F;  3BJA A;  2XAJ A;  4LLL A;  3E6M A;  5E8G A;  1V3F A;  4Q47 A;  3FZV A;  2QQB A;  1P2F A;  3DPL C;  1SD7 A;  4OU0 A;  1FP2 A;  4FX0 A;  2LDU A;  2FU4 A;  2IT0 A;  4CO8 A;  3CUQ B;  4OIQ F;  3L00 A;  2VXZ A;  1W4M A;  3FMQ A;  4RGR A;  1W7P B;  3L9F A;  2YSR A;  2CWE A;  2HTS A;  1G6N A;  3WOD F;  2VBZ A;  4EM0 B;  4FX4 A;  4LK0 F;  3IHU A;  5IT9 K;  1B4A A;  2CW0 F;  1XSV A;  1BI3 A;  2K4J A;  1BI2 A;  4MEY F;  5F64 A;  4L0Z B;  3ZMU A;  2HYF A;  1DPU A;  3E97 A;  2DQR A;  2F5C A;  5FD5 A;  2Z99 A;  3JW4 A;  3FXU A;  3LA3 A;  3I64 A;  4M72 A;  3BJ6 A;  1QBJ A;  5D5X B;  4LMY A;  1RI7 A;  2FQ3 A;  2F2E A;  3WU0 A;  3EET A;  4S04 A;  4G7O F;  2HGC A;  2HOE A;  3ZP5 A;  2ETH A;  3J80 K;  5H6Q A;  3KP5 A;  4WK8 F;  4GCV A;  2DPU A;  1KQ9 A;  2FE3 A;  4U0W A;  2CSO A;  3WTY C;  3ML6 A;  4LD5 A;  2YR2 A;  1O3R A;  4LGW A;  3JTH A;  2H09 A;  1S8N A;  2XV4 S;  2E1N A;  1IXR C;  3ZN0 A;  1AWC A;  1PP7 U;  3I54 A;  3GEZ A;  5CVI A;  4WXD A;  2HQR A;  1YQA A;  1P4A A;  3K1M A;  4S05 A;  2W84 A;  3J81 K;  2FBH A;  2XIG A;  5J8C A;  2PQ8 A;  3SZP A;  1D3Y A;  3V7R A;  1Z05 A;  1LEA A;  3COA C;  3KCC A;  4HX7 A;  5BS6 A;  1FY7 A;  5D5V B;  1ZH5 A;  2ZME A;  1IXS B;  1IAW A;  1UST A;  3BDD A;  4UNO A;  1VTN C;  1LVA A;  1USS A;  2IRF G;  3F23 A;  2HZT A;  2MBF A;  3QP5 A;  5K5R A;  2IA1 A;  2ZJ2 A;  4ETS A;  5L3E A;  3E6D A;  2FMY A;  3PQJ A;  4IPA A;  3MZY A;  2ZKZ A;  3JTG A;  1XSX A;  3LAJ A;  3FM5 A;  2QYO A;  4UV8 A;  4KNY A;  5BPI A;  2HWV A;  3BWG A;  3NRV A;  3FM3 A;  3JSP A;  5KVR A;  1FYK A;  4HX8 A;  3CLO A;  5L3B A;  5HDK A;  4WWC A;  1U78 A;  3E5X A;  5DD8 A;  2DW4 A;  2P4W A;  4HQM A;  2BV6 A;  2HEO A;  4OMZ A;  1TQI A;  3F22 A;  1HW1 A;  3ECO A;  4IRH A;  1JXS A;  4PDK A;  4CXF A;  3HRT A;  3N97 A;  2QBY A;  3IRR A;  2GIV A;  2JPB A;  4G8X A;  3MZH A;  1YYV A;  1U3E M;  3BY6 A;  2VT2 A;  3O6B B;  3K9T A;  2WWY A;  4IRI A;  3DF8 A;  4ENN A;  1I1S A;  4MNU A;  4HDU A;  2XAG A;  5L3F A;  4XBF A;  1H9T A;  3DFG A;  4I0A A;  1WKM A;  3R61 A;  5BMZ A;  1QGP A;  1O7F A;  3RKX A;  1QZY A;  4RB3 C;  5DV5 A;  4UVC A;  4HBL A;  4MQV A;  4HX4 A;  2A6E F;  2Y48 A;  3G73 A;  1HKQ A;  2ZNY A;  4DQ2 A;  3BRO A;  2KKO A;  3ROU A;  3R0A A;  1K78 B;  2NNN A;  4LLN A;  2IA0 A;  3Q9S A;  3RTR A;  2P6S A;  1FOK A;  1FYM A;  2OBP A;  4KMU X;  3V4G A;  3HRS A;  3SHF A;  3KP3 A;  2LF7 A;  3BP8 A;  2P7V B;  2PMH A;  4RS8 A;  1GVJ A;  5FB2 A;  3HHH A;  2HS5 A;  4RGS A;  4KIB A;  5HOO A;  2O03 A;  4L9V A;  1K79 A;  2A3S A;  2NRA C;  3ISP A;  1I27 A;  2DU9 A;  1U5T B;  5ICC A;  4KYW A;  4BH9 A;  3TO9 A;  4O3M A;  4BHP A;  4I2O A;  2ZME B;  1U5T C;  2KIF A;  4U88 A;  3M1E A;  1ZLK A;  1FSH A;  4L9N A;  1IN8 A;  1UFM A;  3LQQ A;  4ZZL A;  1IN7 A;  4HV5 A;  2BE5 F;  1G3T A;  3B73 A;  3H92 A;  4HLY A;  2PLY A;  3T0Y A;  4CZZ A;  5E1X A;  3R6S A;  3TOA A;  1ONV A;  5CVU A;  4LB6 B;  4LLG F;  1BC8 C;  2P6T A;  1HSJ A;  5A2Q Z;  1P92 A;  3DV8 A;  3V7S A;  1H9G A;  3WGH A;  3CUQ A;  4AWX B;  2L02 A;  1R23 A;  3P9I A;  2VC0 A;  3FWE A;  2DAO A;  1LEB A;  4AD9 A;  2A69 F;  4HYE A;  3GFL A;  2HDC A;  1IRF A;  1IW7 F;  1XN7 A;  1ZG3 A;  2XAS A;  5D5W B;  3M8E A;  2DLL A;  1W5S A;  3IKT A;  2RQP A;  3LST A;  4A0Z A;  2L4A A;  3DXJ F;  2RNJ A;  4QLC U;  2C6Y A;  4BXU A;  3OV8 A;  3RIR A;  4JBA A;  3KZY A;  2J5P A;  2LF8 A;  4CGZ A;  3GVA A;  4UVB A;  3C18 A;  4H0E A;  4EQQ A;  3ZN1 A;  3H3U A;  3TDZ C;  4BYY A;  4M9X A;  1O57 A;  5D4R A;  1R36 A;  1EH7 A;  2GA1 A;  3F21 A;  3E3V A;  4GGG A;  2UXN A;  1T6S A;  3Q9V A;  1XDS A;  1EH6 A;  3FXR A;  1L0O C;  2P5L C;  1F5T A;  3C3W A;  3LAP A;  1BIB A;  5ICG A;  1RIO H;  3GUD A;  1U6G A;  5IT9 Z;  2KRF A;  4AIH A;  1UCR A;  1SMY F;  3IRQ A;  4LFU A;  1B6A A;  2IVM A;  1YW8 A;  4FT8 A;  2V1D A;  4P55 A;  2IJL A;  4E70 A;  1XGN A;  4ESB A;  3GX4 X;  1KYW A;  3SFZ A;  2M45 A;  3JSO A;  3R0J A;  1ZGA A;  3FF5 A;  1I1G A;  5ILV A;  3JAM K;  2FEZ A;  4GXO A;  4HF2 A;  2PMU A;  4G7H F;  5DCM A;  1ON2 A;  3J80 Z;  3O3K A;  1SFX A;  3L09 A;  1KU7 A;  3HHG A;  1YO5 C;  4RGX A;  1MGT A;  5K5Q A;  3FXQ A;  2COM A;  2W24 A;  5D5U B;  5FFZ A;  2EFN A;  2A61 A;  2OA4 A;  3GO5 A;  5JR3 A;  4EGY A;  1YW7 A;  2M5W A;  1GXQ A;  1BBY A;  5JVT A;  2CQK A;  1ODD A;  3NQO A;  2HKX A;  5ERI A;  2R7F A;  4BQA A;  1QNT A;  1MZB A;  2RV8 A;  4ON0 A;  4R8H A;  3RI4 A;  4PGG A;  3WE2 A;  3J81 Z;  4PCQ A;  2QEN A;  2VOO A;  4I0B A;  1SD6 A;  3BOQ A;  2QM3 A;  4RAZ A;  1AOY A;  5EEH A;  4M74 A;  3IC7 A;  2DK5 A;  3I0T A;  2O8X A;  1XDU A;  3ZMZ A;  3GLX A;  4TV7 A;  4RGU A;  2RGV A;  5AIQ A;  1XGO A;  1YLF A;  4ENM A;  2O6G E;  4WXC A;  3U9G A;  1CF7 B;  4UV9 A;  3WTW C;  2ESN A;  2XKP A;  5LHH A;  1XMA A;  1IF1 A;  3LWF A;  3I59 A;  1KU2 A;  2EFP A;  4ZYE A;  2M8E A;  4HDV A;  3WGG A;  2IP2 A;  1FNN A;  1LDJ A;  5HVQ C;  4OIO F;  2DK8 A;  3WTU C;  4HQE A;  3HSR A;  5DEQ A;  2V9V A;  1KA8 A;  2K7L A;  5CLS A;  2DO7 A;  5JHU A;  4IRG A;  1KQ0 A;  2MH2 A;  2RKH A;  1K78 A;  1DDN A;  5EEG A;  2OAZ A;  3F3X A;  3V7C A;  3IWZ A;  4U7B A;  1R1U A;  1TNT A;  3K2Z A;  5J6X A;  2NYX A;  3CTA A;  3MWM A;  5L3C A;  1S6L A;  3WE3 A;  5D8K B;  4R1H A;  1LDD A;  4R79 A;  1WRJ A;  2STT A;  1HXD A;  1XGS A;  3C1D A;  5FD6 A;  4A0X A;  1C0W A;  2L3D A;  4IJA A;  3ULQ B;  1Y0U A;  1U5T A;  4AIK A;  2V79 A;  1V4R A;  1RUO A;  4LK1 F;  3U2R A;  3L7W A;  4Y15 A;  2XAQ A;  5HLG A;  3T1B A;  3VEP A;  1W7P D;  4EJT A;  3O2P E;  2HKO A;  4A0Y A;  2P8T A;  5D8L B;  3WTV C;  1ZRE A;  2EA2 A;  5DCM B;  3J7A O;  1F9N A;  4ZZD A;  4LJZ F;  1P4X A;  3T5X A;  2ELH A;  4KA4 A;  4D0P A;  3HOT A;  1IN6 A;  1XSD A;  2PG4 A;  3BZ6 A;  2QQA A;  4OIR F;  5FLX K;  3N4M A;  1PP8 F;  2J5O A;  2PEX A;  5JI6 A;  4HV6 A;  3TO6 A;  5LGN A;  2LNB A;  1B9M A;  2FA5 A;  2IW5 A;  2NNY A;  2EFQ A;  1WSU A;  5DUK A;  2XUB A;  3EUH A;  4M9Z A;  3RPQ A;  1TQP A;  1YIO A;  2VOD A;  4UVA A;  1XGM A;  4PZJ A;  4HF0 A;  1H0M A;  2Z3Y A;  2TDX A;  3BPV A;  2PBI A;  2Q0O A;  3QPT A;  3QOP A;  4EJO A;  1ZHF A;  1JGS A;  3DPT A;  1FBS A;  2CYY A;  2JRT A;  4KIF A;  5ED4 A;  3DEU A;  3IL2 A;  3KZZ A;  1BN5 A;  4ENJ A;  1TW3 A;  3CDH A;  3KE2 A;  4OMY A;  2O0Y A;  1JHF A;  3I59 B;  3I4P A;  3ZQ7 A;  4U7D A;  3ECH A;  5ICE A;  2DPD A;  3F8M A;  6PAX A;  4BNC A;  4XRF A;  5HDG A;  2O3F A;  2K02 A;  4YII A;  4HA8 A;  4Q48 A;  2H6B A;  3DQV C;  1O3Q A;  2K4B A;  1X3U A;  5E8I A;  5CYV A;  2W25 A;  2QUF A;  1HW5 A;  1JE8 A;  2JT1 A;  3HTS B;  2X0L A;  1LB2 A;  4KDP A;  2XVC A;  4B09 A;  1HKS A;  3LFK A;  5L3D A;  1SD4 A;  5CVR A;  4F7Z A;  2ADU A;  1TBX A;  3V8L A;  3HSF A;  4QWQ A;  3RJP A;  2YX7 A;  4EJU A;  2XKO A;  2XAH A;  1O3S A;  2Z33 A;  2L01 A;  1XCV A;  1OKR A;  4EGZ A;  2CG4 A;  2V6C A;  3I71 A;  5H20 A;  3P9K A;  3GWZ A;  1HST A;  4UUV A;  1BIA A;  3HYI A;  4ENK A;  2MLG A;  1R58 A;  1MDM A;  4GO1 A;  1E17 A;  4WCG A;  1ZLJ A;  2XGX A;  1XMK A;  3K1N A;  1PUE E;  3MEX A;  2FXA A;  2ZCW A;  1WQ2 A;  1R00 A;  4WXH A;  1YS7 A;  2WTE A;  3REO A;  1O3T A;  1TLH B;  2XRO A;  1BM9 A;  2ISY A;  4M6X A;  2F5D A;  3I5U A;  1T39 A;  1S7O A;  3F8B A;  1SFE A;  4I7H A;  2R3S A;  2KJC A;  2GA2 A;  2JTV A;  4BHC A;  3AAF A;  2VBY A;  2ZBK A;  3FMS A;  3LQR A;  4IF4 A;  2VT3 A;  2V1X A;  3B02 A;  4KT5 C;  4L9T A;  3T8T A;  1FBU A;  4U0V A;  1FZP B;  4NQW A;  3GZ5 A;  4MGR A;  2DI3 A;  3JAM Z;  3MQ0 A;  1J5Y A;  4BAY A;  1ZYR F;  1J2X A;  2W85 A;  1CF7 A;  1UB9 A;  5HDN A;  5BOX A;  5K5O A;  4HF1 A;  1GXP A;  3F8F A;  1BI0 A;  1IRG A;  1MJB A;  2A68 F;  1OYY A;  4A5N A;  4EJV A;  4KN4 X;  2H27 A;  4OOI A;  4YIF A;  5LEJ A;  3WTS C;  2IPQ X;  5H6R A;  2PJP A;  4HW0 A;  1BC7 C;  3P7N A;  3ZMS A;  3TOB A;  2FML A;  1ZN2 A;  3KP7 A;  1R22 A;  1FWZ A;  1P6R A;  1IN4 A;  2HTJ A;  1OYI A;  5LBQ A;  5F6F A;  4A5M A;  1Z6T A;  1HQC A;  1EV7 A;  4EM1 A;  1PDN C;  4JK1 X;  2BYV E;  2VE8 A;  1ZRD A;  4Q5S F;  4G9Y A;  5DDG A;  3FX3 A;  3PFI A;  2P5K A;  2QZ8 A;  5J8F A;  2PFB A;  1ZRC A;  5TJJ A;  4I01 A;  2FBI A;  4NHJ A;  3P9C A;  2GZW A;  4EV0 A;  2AXL A;  2QQ9 A;  2QVO A;  3VFZ A;  1MJ9 A;  2WV0 A;  3GW2 A;  3W6K B;  1MKM A;  1K6O A;  2L54 A;  2HYG D;  3F72 A;  2L4M A;  2G7U A;  2QLZ A;  4G6Q A;  1OYW A;  4ASN A;  3GFI A;  2FOK A;  4KN7 X;  3VOD A;  2PI0 A;  1WWX A;  1JHH A;  1U8R A;  1T2K A;  1G3W A;  5IT3 A;  2EJR A;  2ISZ A;  5K1Y A;  2OZ6 A;  4KIG A;  1J75 A;  2W57 A;  4IXA A;  5DCF A;  2XRN A;  1FPQ A;  4XLP F;  2HR3 A;  1G3S A;  1O7L A;  2CFX A;  1G4D A;  3HRM A;  1MDM B;  3ELK A;  5ILS A;  4DNC A;  2MLK A;  4WX9 A;  1RZ4 A;  1QQI A;  3MFK A;  1R7J A;  2EV6 A;  2GXG A;  1LJ9 A;  2E7W A;  4G7Z F;  1CGP A;  2RVC A;  3VB2 A;  4YG2 F;  4CDG A;  1I6X A;  4GYI A;  1TTY A;  2OQR A;  2A6H F;  2OZU A;  5FFX A;  4HOB A;  2DBB A;  1T0F A;  3CUO A;  5LLQ A;  2EK5 A;  5FGM A;  4ZYG A;  3F8N A;  2K86 A;  1FP1 D;  3HOS A;  1TNS A;  2CO5 A;  1YFH A;  2VON A;  5LGU A;  3KEQ A;  1DPR A;  1OMI A;  2FSW A;  2OU2 A;  2O61 A;  2FF4 A;  2EWN A;  2OQG A;  4Y17 A;  3S2W A;  1P4W A;  4EMS A;  2D45 A;  3ZMT A;  2DFI A;  2G7H A;  1B59 A;  1YS6 A;  3PQK A;  4XSZ F;  3CUQ C;  3E5U A;  3EYI A;  2RC4 A;  4G94 A;  2GXB A;  1ZAO A;  4P5O A;  4M71 A;  3ZMD A;  1QPM A;  5E17 F;  1Z1D A;  3RYP A;  2Q8K A;  3WTZ A;  3WTX C;  5FLX Z;  3HTU A;  2MH9 A;  4O6J A;  4YFN F;  1Z9C A;  2M87 A;  3E5Q A;  1GHC A;  4L9J A;  2EFO A;  3RKW A;  5ILU A;  2A5Y B;  5TRD A;  1FX7 A;  3H3Z A;  4CHU A;  4MQ9 F;  4XLN F;  3EDP A;  3KLN A;  1XD7 A;  3GFJ A;  4P9U A;  4B8X A;  3ABT A;  2LSO A;  4M73 A;  1XCB A;  3BJO A;  2KJB A;  3GFM A;  1KU3 A;  2K27 A;  3WU1 B;  1LQ1 A;  3TGN A;  1D5V A;  1S7A A;  3ERE D;  4MTD A;  1K7A A;  5AIP A;  4L0Y B;  2FRH A;  3RKY A;  3K0L A;  2FBK A;  5HS9 A;  3IWF A;  2YX4 A;  2UZK A;  2ZFW A;  3I53 A;  2X4H A;  1RNL A;  1F1Z A;  2F5F A;  4NB5 A;  2EB7 A;  2D1H A;  3IKV A;  4ESF A;  1YTY A;  3VOE A;  2A07 F;  1BI1 A;  4KUM A;  2WC2 A;  4LB5 A;  1SAX A;  3I58 A;  2GWR A;  2NAZ A;  5F1R A;  1WI9 A;  4IHS A;  3E6C C;  5E1W A;  3KP2 A;  3KP4 A;  2VBW A;  3QAH A;  1R1V A;  4G6D A;  1HKT A;  4FHT A;  5LHI A;  5D6F A;  3Q5F A;  1FSE A;  5BPD A;  1TW2 A;  5BQT A;  2M30 A;  3D0S A;  1LNW A;  2EA4 A;  2P7C B;  3RDI A;  5E18 F;  2IA2 A;  2VN2 A;  3GXO A;  1UHW A;  1RUN A;  5DYM A;  2FNP A;  1SD5 A;  3KP6 A;  3WGI A;  2E7X A;  1IUY A;  1E2X A;  4N0B A;  1YW9 A;  1OPC A;  2EV5 A;  1NHA A;  1D8J A;  2Z9O A;  3HRU A;  2GAU A;  1Q1H A;  3KEO A;  2H94 A;  1J0R A;  5KK1 A;  3RPU A;  5ICF A;  5LGT A;  1B1B A;  2RN7 A;  4HZF A;  1MJA A;  4KMF A;  2BGC A;  2VBX A;  4U0Y A;  3SZT A;  4YFX F;  1BJA A;  3KET A;  3OOP A;  2D2W A;  3EQL F;  3LA7 A;  4ESJ A;  4Q4Z F;  1J59 A;  1R5G A;  2B0L A;  4LG0 A;  1REP C;  4AVP A;  4M9S A;  1ZG5 A;  1QO0 D;  3MCZ A;  1KU9 A;  4PGH A;  2Q2E A;  2ZNZ A;  2ESH A;  3E6B A;  4KIC A;  1ZAR A;  4N9I A;  3BPX A;  2RDP A;  1KGS A;  3T8R A;  3U1D A;  2DTR A;  3ZPL A;  4ZYH A;  1A04 A;  4UXN A;  4HAM A;  3TQN A;  2ZO4 A;  3HSE A;  1LDK B;  4Z2Y A;  3GYH X;  2HQN A;  4OIP F;  5JFR A;  1MD0 A;  3GF2 A;  1FBQ A;  5DUI A;  3KFW X;  5CVJ A;  4Y13 A;  1FYL A;  4KFC A;  3D5L A;  1B9N A;  4OIN F;  4I02 A;  4WF2 A;  2AS5 F;  3EYY A;  2FNA A;  1FLI A;  5DD4 A;  2VC1 A;  1TQM A;  1ZRF A;  3FMR A;  1UHM A;  1T38 A;  4CYD A;  3ZMV A;  3CJN A;  2DQL A;  2OD5 A;  1R1T A;  4N9H A;  3M7G A;  2P5V A;  3DP7 A;  2UWM A;  4L5I A;  4P96 A;  1F4K A;  3WG9 A;  2LKP A;  3GZ6 A;  3F6V A;  2M1B A;  3SXY A;  5HS8 A;  4RB0 A;  3M9A A;  3QPH A;  1Z6R A;  2JPC A;  1FC3 A;  2YU3 A;  4L18 B;  1J9I A;  1SMT A;  4HLX A;  4L5J A;  1BOA A;  2PN6 A;  4A12 A;  5LHG A;  4MTE A;  4A2U A;  4RB1 A;  2ZXJ A;  2MC3 A;  1KYZ A;  3R4K A;  1D8K A;  4BHB A;  3FHZ A;  2EV0 A;  5HLI A;  2EFW A;  2F5E A;  2CGP A;  3QP6 A;  1I5Z A;  1STZ A;  4K2E A;  1R5H A;  5D6E A;  4JQF A;  4A6E A;  1IZ1 A;  3WTT C;  2DT5 A;  2JSC A;  5HLH A;  1J7K A;  4AIJ A;  1W7P A;  1ZGJ A;  4UHT A;  5E1Z B;  3KLO A;  1ULY A;  5CJ9 A;  3CO6 C;  4I09 A;  5FO5 A;  2XHK A;  3HUG A;  2MA3 A;  1ZG1 A;  3ABU A;  1L3L A;  1DUX C;  2YPR A;  5AON A;  2STW A;  2GQQ A;  3L2C A;  2XAF A;  5LRR A;  2QBY B;  3SQN A;  5L3G A;  2BEO A;  3F6O A;  4IVN A;  2VOP A;  2MD5 A;  3LA2 A;  1T98 A;  1DP7 P;  3F8C A;  2BBY A;  4LG0 B;  3C7J A;  1OR7 A;  4MHG A;  4EJW A;  4P9F A;  4EVI A;  2G9W A;  5D4S A;  2R7D A;  1U2W A;  3V8K A;  2Y75 A;  2Z5U A;  1S29 A;  5LRS A;  1QZZ A;  1HBX G;  2H6C A;  4EM2 A;  5HS7 A;  4GYG A;  3QRF F;  5CVV A;  2KIM A;  4M6Y A;  3TKY A;  5A2Q K;  1FT9 A;  4RB2 C;  1W5T A;  4O5V A;  4MEX F;  1XB4 A;  1HW2 A;  2VE9 A;  2V1U A;  4I98 B;  2NS0 A;  3K1P A;  3QU3 A;  1Z91 A;  3QU6 A;  1YG2 A;  3RYR A;  2JZY A;  3M8F A;  4ZYD A;  1S3J A;  1IN5 A;  5LEK A;  3TDU C;  2ACJ A;  2HFH A;  2QWW A;  3W6J B;  2D1V A;  4XSX F;  3V8J A;  3G3Z A;  2KIU A;  1ON1 A;  4ZH4 F;  2UXX A;  3R60 A;  3TO7 A;  3CO7 C;  5E20 A;  4RAY A;  2Y0M A;  3K69 A;  4CIC A;  3MAJ A;  1KQ8 A;  4IHT A;  4A6D A; 
#chains in the Genus database with same CATH topology
 1XG1 A;  3HIF A;  3BCA A;  5FLM J;  3CMA I;  1N25 A;  4JYK A;  3LL7 A;  1IXC A;  2EPF A;  1SFU A;  2E1C A;  1IDZ A;  3DKW A;  3JRH A;  1X4O A;  1RPW A;  1EH8 A;  1X4P A;  3NEU A;  1G3Y A;  1Z7U A;  2WB1 N;  4YFK F;  3BJA A;  2XAJ A;  4LLL A;  1MBG A;  3E6M A;  1I3A A;  4M3D A;  3DU5 A;  2UV1 A;  1ENH A;  5E8G A;  1V3F A;  2CUF A;  4Q47 A;  3FZV A;  2KDZ A;  4QSH A;  3PJR A;  3S1Q J;  1D5Y A;  2QQB A;  3WHC A;  2HXO A;  3M1C A;  1P2F A;  1MH3 A;  2ZXI A;  3IH2 A;  2RQQ A;  3DPL C;  1SD7 A;  4OU0 A;  3ZXS A;  3H9J A;  4NNJ A;  2E5Z A;  4QIW N;  1FP2 A;  4FX0 A;  2LDU A;  3OYG A;  3LSI A;  2FU4 A;  2IT0 A;  2E5N A;  4CO8 A;  3CUQ B;  4OIQ F;  3L00 A;  1LUJ B;  5KNL A;  2VXZ A;  1W4M A;  3FMQ A;  4RGR A;  1V55 H;  1W7P B;  2YSR A;  3H36 A;  3L9F A;  3SDB A;  3OSF A;  1V54 H;  2CWE A;  2HTS A;  1Y39 A;  1G6N A;  3EPZ A;  3WOD F;  2VBZ A;  2AXT C;  4EM0 B;  4FX4 A;  4LK0 F;  1LE8 B;  3IHU A;  3IAM 2;  3S93 A;  2DDB A;  5IT9 K;  1B4A A;  4E7H A;  2CW0 F;  1YRN B;  1XSV A;  1BI3 A;  4F91 B;  2K4J A;  1BI2 A;  4MEY F;  2DT7 B;  5F64 A;  4L0Z B;  3ZMU A;  3MKZ A;  4XKB A;  4F55 A;  2HYF A;  1DPU A;  4BY7 J;  2CU7 A;  3E97 A;  1CQT A;  2DQR A;  4AVZ A;  2F5C A;  5FD5 A;  2DA4 A;  3PO3 J;  2VQH A;  2Z99 A;  3JW4 A;  3PNV A;  3FXU A;  3LA3 A;  3A01 A;  3I64 A;  3GCM A;  4M72 A;  3BJ6 A;  1QBJ A;  5EDN A;  5D5X B;  4LMY A;  1RI7 A;  2FQ3 A;  1TWC J;  1BL0 A;  2F2E A;  3WU0 A;  1BW6 A;  5IYB J;  3EET A;  1B8I A;  3VYT B;  4S04 A;  4G7O F;  3BQZ A;  2RNG A;  2HGC A;  2HOE A;  3ZP5 A;  2ETH A;  4JX5 A;  4N4O B;  1BW5 A;  3J80 K;  5H6Q A;  3KP5 A;  4WK8 F;  2A6T A;  4GCV A;  2DPU A;  2LOO A;  4HNT A;  1KQ9 A;  3F0C A;  1Q1V A;  2FE3 A;  4U0W A;  4XON A;  1R49 A;  1I3Q J;  3KZI C;  1JJ6 C;  2CSO A;  3WTY C;  3KX2 A;  1Z21 A;  3ML6 A;  4LD5 A;  2YR2 A;  1O3R A;  4LGW A;  3LSP A;  3JTH A;  4BS9 A;  2R5Z B;  2H09 A;  3L2V A;  1S8N A;  2XV4 S;  2E1N A;  3DCF A;  1IXR C;  3ZN0 A;  1HA8 A;  1AWC A;  1PP7 U;  3J7A Y;  1B72 A;  3I54 A;  2VUM J;  2M34 A;  1A6Q A;  2B9S A;  3GEZ A;  5CVI A;  5EF6 A;  2DYS H;  4WXD A;  2HQR A;  2ZJP F;  1PUF B;  4BY1 J;  1YQA A;  1P4A A;  1SAU A;  3K1M A;  1TWA J;  1GT0 C;  2EIM H;  4S05 A;  4IHY A;  2VIX A;  2W84 A;  3J81 K;  2FBH A;  2XIG A;  2XGC A;  3DTI A;  4J00 A;  3L1P A;  5J8C A;  2PQ8 A;  2O5R A;  2LBF B;  4PJJ A;  3SZP A;  1AU7 A;  1WH7 A;  1X1D A;  4NUB A;  2VJ5 A;  4ZTJ A;  3A4C A;  1D3Y A;  2H8W A;  3V7R A;  2E2J J;  3IP4 B;  1Z05 A;  1LEA A;  1YJW I;  5GPC A;  3COA C;  2NVT J;  3ABL H;  3K4M A;  4F3Q A;  5B3S H;  1H8A C;  4ZYA A;  3KCC A;  4HX7 A;  5BS6 A;  3OIQ A;  1FY7 A;  5D5V B;  1ZH5 A;  3TW7 A;  2ZME A;  1IXS B;  3DEE A;  1IAW A;  1UST A;  2I10 A;  3BDD A;  2R5Y A;  4UNO A;  1VTN C;  3S3N A;  3K7A J;  1LVA A;  5DTD A;  2BW3 B;  4QTR A;  1USS A;  2IRF G;  3F23 A;  2K85 A;  2HZT A;  3W2V A;  4JX4 A;  2MBF A;  3QP5 A;  4GRI A;  4BJT A;  2VLA A;  2MSY A;  5K5R A;  3CMM A;  4PK4 A;  2IA1 A;  4JX6 A;  9ANT A;  4XNF A;  1LKX A;  2KIQ A;  2ZJ2 A;  2R4G A;  3DBL B;  4ETS A;  5L3E A;  1TT5 B;  2LKX A;  1OCP A;  2FMY A;  3E6D A;  3PQJ A;  3RQI A;  4IPA A;  3MZY A;  3CCR I;  3J7Z I;  1RET A;  2ZKZ A;  3JTG A;  1XSX A;  3LAJ A;  3FM5 A;  2QYO A;  3FXO A;  3K6G A;  4UV8 A;  4BAC A;  4OWR B;  4GFB A;  4KNY A;  4MIM A;  5BPI A;  4EEF G;  5FRN A;  2HWV A;  3BWG A;  4YIR X;  3NRV A;  2JA6 J;  2M7B A;  3GBG A;  1JKQ C;  3BG7 A;  3FM3 A;  3JSP A;  5KVR A;  1ETX A;  2V7F A;  4MO7 A;  5IYD J;  1LVK A;  2NVU B;  1IV8 A;  2IEK A;  1FYK A;  4E6K G;  2L7M P;  1YJN I;  3HG9 A;  4HX8 A;  3CLO A;  4BEH A;  2LY2 A;  1A6I A;  1X58 A;  5L3B A;  5HDK A;  4WWC A;  4MFD A;  1U78 A;  4U87 A;  3E5X A;  5DD8 A;  2DW4 A;  2P4W A;  4HQM A;  2BV6 A;  2M9H A;  3BR3 A;  1ETV A;  3F9K A;  2HEO A;  4OMZ A;  1TQI A;  3F22 A;  1HW1 A;  3CJR B;  3ECO A;  3FKJ A;  1T0F C;  4IRH A;  1QZE A;  1JXS A;  4PDK A;  2LVS A;  3TP0 A;  3HRT A;  4CXF A;  4J19 A;  3N97 A;  2QBY A;  1ITY A;  4XK4 A;  3IRR A;  4A3F J;  2GIV A;  1MBE A;  2JPB A;  4G8X A;  4IO9 F;  3S14 J;  1VQ8 I;  2LR8 A;  3MZH A;  1YYV A;  4IKF A;  1U3E M;  2JUC A;  3UNG C;  1VF9 A;  3BY6 A;  1XPX A;  2VT2 A;  3O6B B;  3K9T A;  1EJ9 A;  1X1A A;  2WWY A;  3OWT A;  2K9M A;  4IRI A;  3JCU C;  1LFU P;  2OPT A;  3DF8 A;  2VKD A;  4ENN A;  1I1S A;  5J4Y A;  4MNU A;  4HDU A;  2XAG A;  1WJC A;  2VB6 A;  3A01 B;  5L3F A;  2L9N A;  2GXA A;  1BR2 A;  4XBF A;  3N05 A;  5GP9 A;  1H9T A;  3DFG A;  2A5W A;  1D1C A;  1WFX A;  2OTJ I;  1MMN A;  4I0A A;  1WKM A;  3CES A;  2KZV A;  3R61 A;  3GTK J;  5BMZ A;  1QGP A;  1O7F A;  3NWT A;  3RKX A;  1QZY A;  2BHY A;  4RB3 C;  5DV5 A;  4UVC A;  3OYL A;  4HBL A;  1HDP A;  3MVP A;  3L2W A;  4MQV A;  4HX4 A;  2CV0 A;  2G0E A;  2A6E F;  2Y48 A;  3G73 A;  1HKQ A;  4C3I J;  4V19 K;  2ZNY A;  4A3E J;  4DQ2 A;  3BRO A;  3G71 I;  2VXD A;  3VDX A;  2KKO A;  3ROU A;  3R0A A;  1FMW A;  1K78 B;  2NNN A;  4LLN A;  2W00 A;  3QYE A;  2IA0 A;  3Q9S A;  4F92 B;  1UG2 A;  3M07 A;  3RTR A;  2P6S A;  2P0W A;  1FOK A;  3W3C A;  1FYM A;  2CW7 A;  2OBP A;  4KMU X;  2AO9 A;  3V4G A;  3CP2 A;  4M3G A;  4A3L J;  2V6E A;  2DOD A;  4IOA F;  2HZD A;  3DTE A;  3HEF A;  4XOR A;  1Y8Q B;  2M2E A;  1B72 B;  2ZXW H;  3HRS A;  4I76 A;  1V5G A;  4RMN A;  3KP3 A;  3SHF A;  2LF7 A;  3BP8 A;  1IDY A;  2P7V B;  2PMH A;  2R0Q C;  1O4X A;  3I55 I;  4RS8 A;  1GVJ A;  3BTC A;  5FB2 A;  2OTL I;  5BNG A;  4A3J J;  3GTG J;  2XF5 A;  3HHH A;  4J01 A;  2HS5 A;  1MBH A;  4RGS A;  4JP0 A;  2HQA A;  2DOF A;  4UY8 I;  4KIB A;  4D7M A;  5HOO A;  3OYM A;  2DOA A;  1NK3 P;  5CQG A;  2O03 A;  2VKE A;  4CCN A;  1ZKG A;  1YE9 A;  1VQ4 I;  2LMD A;  4DZP A;  4L9V A;  1K79 A;  4ABZ A;  1TZL A;  2A3S A;  2E1M B;  3ISP A;  2NRA C;  1I27 A;  1Y56 A;  2DU9 A;  3S1N J;  1U5T B;  4D5C A;  4V2G A;  4HST A;  2MC4 A;  5ICC A;  2WAE A;  4KYW A;  4BH9 A;  5EG0 A;  3TO9 A;  4O3M A;  4BHP A;  4I2O A;  2ZME B;  1IC8 A;  3I4M J;  1U5T C;  4RM2 A;  2KIF A;  1YX3 A;  3FXM A;  4U88 A;  3ZOB A;  3M1E A;  1ZLK A;  2Y9Y A;  2R5Y B;  4JOM A;  1FSH A;  2DFF A;  4L9N A;  1IN8 A;  1UFM A;  2ZSI B;  3LQQ A;  4ZZL A;  3OSG A;  2TRT A;  1IN7 A;  4HV5 A;  1VQP I;  2BE5 F;  2LG4 A;  4AUX A;  4PFP A;  1G3T A;  3B73 A;  3H92 A;  4HLY A;  1H89 C;  2PLY A;  3T0Y A;  4CZZ A;  4F93 B;  5E1X A;  3R6S A;  3TOA A;  1ONV A;  5CVU A;  4LB6 B;  3I9V 2;  4LLG F;  3EUA A;  1BC8 C;  2P6T A;  1WH5 A;  1HSJ A;  1OJL A;  3CC7 I;  5A2Q Z;  1D1A A;  3M8J A;  2W7N A;  1P92 A;  2PX9 A;  1MBJ A;  3DV8 A;  2H8R A;  3V7S A;  1H9G A;  4IOC F;  2BHZ A;  3WGH A;  3CUQ A;  3LSM A;  3OR2 C;  4AWX B;  2Z1D A;  1A35 A;  2L02 A;  1R23 A;  2LFB A;  3P9I A;  1LE8 A;  4XKC A;  2WV1 A;  2VC0 A;  3FWE A;  2DAO A;  1YI2 I;  1LEB A;  3ABM H;  1YRN A;  2QSG X;  3SJM A;  4AD9 A;  2A69 F;  4HYE A;  1BJZ A;  2LYC A;  3GFL A;  3O8H A;  2HDC A;  3KYC B;  2HXI A;  2FQ4 A;  1IRF A;  1IW7 F;  1XN7 A;  1ZG3 A;  2XAS A;  3ERM A;  3M8E A;  5D5W B;  4NBQ A;  2M7A A;  5F08 A;  2DLL A;  2K40 A;  5E3L A;  1W5S A;  4CYC B;  4MLO A;  3H3V K;  3GTQ J;  5JLW A;  5KAF C;  3EUH C;  5JHF A;  3IKT A;  2RQP A;  3LST A;  5GPA A;  2AQE A;  3Q0W A;  4A0Z A;  2L4A A;  2XB0 X;  1S9H A;  2RNJ A;  3DXJ F;  4QLC U;  2C6Y A;  3QPL A;  2WAQ A;  4PUS A;  3SYT A;  4BXU A;  1E3O C;  2BOL A;  3OV8 A;  1NG6 A;  1MSE C;  2Y31 A;  4PFO A;  4F52 A;  3RIR A;  4JBA A;  3HPG A;  2N8G A;  5M3F J;  5M5Y J;  3KZY A;  4XM3 A;  4DBQ A;  2J5P A;  2F4M B;  3JRF A;  2JA5 J;  5E3N A;  2KFD A;  1N77 A;  4KT6 A;  2LF8 A;  4RAG A;  2QKL B;  3OOU A;  4CGZ A;  4A3D J;  1N75 A;  3GVA A;  4EAT A;  4YRV A;  4B1R A;  4XLC A;  4FET A;  3L2R A;  3GLL A;  1W0T A;  4UVB A;  4AYB A;  3C18 A;  4H0E A;  2H1K A;  4EQQ A;  3ZN1 A;  4Y52 J;  3H3U A;  2MGQ A;  3D5S C;  3TDZ C;  4BYY A;  4M9X A;  2CS3 A;  5H2F C;  1O57 A;  2R7V A;  4C3J J;  5D4R A;  1R36 A;  1EH7 A;  2GA1 A;  3F21 A;  2R5Z A;  3E3V A;  2KMU A;  4GGG A;  4RLF A;  5K7F A;  2IBD A;  1T6S A;  2UXN A;  3Q9V A;  1XDS A;  1EH6 A;  3FXR A;  4A3B J;  1L0O C;  1QRY A;  2B7E A;  5E3M A;  1SC7 A;  1QA6 A;  2P5L C;  4A3G J;  1F5T A;  1PUF A;  3C3W A;  3C2H A;  1UAA A;  3LAP A;  4FTH A;  3CQZ J;  1BIB A;  5ICG A;  1RIO H;  3GUD A;  1U6G A;  3JR9 A;  5J1Y A;  4XLF A;  5IT9 Z;  1R9T J;  2CQ7 A;  2KRF A;  1UCR A;  3G2B A;  1SMY F;  4AIH A;  3IRQ A;  2ECB A;  3AL0 C;  4LFU A;  2HPI A;  1B6A A;  2IVM A;  2LBF A;  2D5V A;  5J3L A;  4D9J A;  2DFH A;  1YW8 A;  4FT8 A;  2V1D A;  4P55 A;  3PIP F;  2IJL A;  4E70 A;  1XGN A;  1VQ5 I;  4ESB A;  4NC8 A;  1XMX A;  2ELK A;  2GM4 A;  3OYE A;  4MFE A;  3GX4 X;  2IS6 A;  3KEY A;  1KYW A;  2EQR A;  4XQF A;  3SFZ A;  2M45 A;  3D1N I;  3JSO A;  3R0J A;  1ZGA A;  2Z2S B;  3DLA A;  4DYR A;  3FF5 A;  1I1G A;  1R71 A;  4Y4R A;  1Z3X A;  4DJA A;  5ILV A;  4A3I J;  3JAM K;  2PJR A;  2FEZ A;  4M3F A;  4RM3 A;  4GXO A;  4HF2 A;  1VQK I;  2PMU A;  4G7H F;  3IH4 A;  3MKW B;  4XLA A;  4DZJ A;  5GAH J;  5DCM A;  1ON2 A;  3B6A A;  5B1B H;  3GTM J;  1H88 C;  3J80 Z;  2WA0 A;  3O3K A;  1SFX A;  4FQG A;  3L09 A;  4X1E A;  1KU7 A;  3E7L A;  1T95 A;  5DM7 F;  3HHG A;  1YO5 C;  3RPU D;  4RGX A;  1V5E A;  1MGT A;  2RAE A;  5K5Q A;  1TP4 A;  3FXQ A;  2LY9 A;  2COM A;  5M3M J;  4N4N B;  2W24 A;  5D5U B;  2BXY A;  5FFZ A;  2EFN A;  1HOM A;  2A61 A;  2OA4 A;  1DGW Y;  4E7S A;  3GO5 A;  5CKT A;  5JR3 A;  4EGY A;  3QQA A;  3DBR B;  2HVS A;  1YW7 A;  2M5W A;  1GXQ A;  2GLO A;  1BBY A;  2LC2 A;  3TMO A;  4PJL A;  5JVT A;  2CQK A;  1ODD A;  3NQO A;  2HKX A;  5J40 A;  5FLV A;  2KDO A;  2L9S A;  1GV2 A;  3PUB A;  4DW6 A;  5ERI A;  2R7F A;  4PJM A;  4BQA A;  1QNT A;  1MZB A;  2RV8 A;  4ON0 A;  4R8H A;  1G8X A;  3RI4 A;  2K9S A;  4PGG A;  4XLE A;  1DQU A;  3WE2 A;  3J81 Z;  2VQC A;  2TCT A;  2VJI A;  3D5R C;  2QEN A;  4PCQ A;  4DGW B;  1ZQ3 P;  3W6V A;  2VOO A;  4I0B A;  1SD6 A;  2V4J C;  2CQN A;  3VYU B;  3BOQ A;  3ONQ A;  2QM3 A;  4RAZ A;  3NAR A;  3TP3 A;  1VFC A;  1AOY A;  5EEH A;  3QYF A;  4M74 A;  3IC7 A;  2E2H J;  2DK5 A;  3I0T A;  2O8X A;  3QPS A;  1XDU A;  2WAQ N;  1JGG A;  1SEU A;  2EH3 A;  3ZMZ A;  1MH4 A;  4B3A A;  2BXZ A;  3GLX A;  4TV7 A;  4RGU A;  2RGV A;  4BU2 A;  5AIQ A;  3P5J A;  1XGO A;  1YLF A;  5B66 C;  4ENM A;  2O6G E;  4WXC A;  2YU9 J;  3U9G A;  2LRD A;  2MFZ A;  2EIK H;  4QPO A;  1K4T A;  1CF7 B;  4UV9 A;  2E2I J;  2CUJ A;  2XPW A;  3WTW C;  2ESN A;  1QVT A;  2DMQ A;  1JTX A;  2XKP A;  5LHH A;  1XMA A;  1IF1 A;  3LWF A;  2DA3 A;  3I59 A;  2KL4 A;  4E4H A;  1KU2 A;  2EFP A;  4ZYE A;  2MW8 A;  4BQQ A;  2M8E A;  4C30 A;  4AYB N;  1BOB A;  2R7S A;  3PNY A;  4HDV A;  1WZ2 A;  3WGG A;  2CRG A;  4C2M J;  4RDU A;  3PSF A;  2IP2 A;  1FNN A;  5IP9 J;  1LDJ A;  5HVQ C;  2HVQ A;  4OIO F;  2DK8 A;  2JK3 A;  3WTU C;  2E60 A;  4HQE A;  2XSJ C;  3HSR A;  2DMN A;  5DEQ A;  2V9V A;  5GAD J;  1KA8 A;  2DT6 A;  2K7L A;  5CLS A;  3IV5 A;  5B1A H;  2DO7 A;  3FHN A;  3ZR8 X;  5IP6 A;  5JHU A;  4IRG A;  1KQ0 A;  3CDL A;  1ZR4 A;  2VPR A;  3CCJ I;  2MH2 A;  1FOY A;  2RKH A;  1K78 A;  1DDN A;  5EEG A;  1R4M B;  2OAZ A;  3AG3 H;  1TL8 A;  1UG0 A;  3F3X A;  4HNU A;  2F48 A;  2R7W A;  2X1E A;  5KCM A;  3IWZ A;  3V7C A;  2XDV A;  1NG7 A;  3CCM I;  4U7B A;  2ME0 A;  3Q0U A;  1E3H A;  3BCB A;  2LP0 A;  2LKS A;  1R1U A;  1TNT A;  4PSX A;  4HNV A;  3K2Z A;  1SVO A;  2DMP A;  3WG7 H;  3L2Q A;  1JTY A;  1OR7 C;  4ZDO A;  5J6X A;  2NYX A;  1Y1V J;  3CTA A;  3MWM A;  2EIN H;  5J47 A;  5L3C A;  1JKO C;  2X48 A;  1S6L A;  4IZZ A;  3WE3 A;  5D8K B;  4R1H A;  2L5Q A;  4CCL A;  1LDD A;  1RKW A;  4R79 A;  1WRJ A;  3Q0V A;  2STT A;  1HXD A;  1XGS A;  3C1D A;  3BR1 A;  5FKO A;  5FD6 A;  2R7Z J;  3TL4 X;  1QHG A;  3AG2 H;  4A0X A;  1OIS A;  1C0W A;  2Y9Z A;  2L3D A;  5TIS C;  1DU0 A;  3MN2 A;  4IJA A;  5IP7 J;  2X1D A;  3ULQ B;  1Y0U A;  1U5T A;  4B48 A;  2DMU A;  2M0C A;  4AIK A;  2V79 A;  1V4R A;  1RUO A;  2E36 A;  5FKN A;  3MKY B;  2DFE A;  4LK1 F;  3U2R A;  4II3 A;  2R93 J;  2L7F P;  3L7W A;  4Y15 A;  4C2U A;  2X51 A;  2XAQ A;  1UMQ A;  5HLG A;  2OUM A;  3T1B A;  4KIT B;  2PJR B;  3VEP A;  1W7P D;  5E79 C;  4EJT A;  3O2P E;  2HKO A;  4A0Y A;  2P8T A;  5D8L B;  3WTV C;  4I6Z A;  1ZRE A;  2EA2 A;  3K4L A;  2E34 A;  5DCM B;  3J7A O;  1VQN I;  1F9N A;  4ZZD A;  1MIJ A;  1U9N A;  3VSL A;  4LJZ F;  1HDD C;  2R7R A;  3E0J B;  2VKV A;  4BE1 A;  4OAZ A;  4NDL A;  2COB A;  4KIS A;  1P4X A;  3ZQI A;  3T5X A;  2ELH A;  1FOX A;  4KA4 A;  4D0P A;  3HOT A;  1IN6 A;  3G6E I;  1XSD A;  2DYR H;  3VSK A;  2PG4 A;  3BZ6 A;  3K70 D;  1WJD A;  3ZCO A;  4DYQ A;  4FE4 A;  1WPK A;  2QQA A;  4OIR F;  5FLX K;  1AKH B;  2K9Q A;  5GTH C;  5HOD A;  5EGO A;  3N4M A;  4X6A J;  1JKR C;  4E7L A;  1PP8 F;  2R7T A;  2KRH A;  2K9L A;  2J5O A;  2PEX A;  3E1S A;  2WAD A;  1WJF A;  5JI6 A;  4HV6 A;  1VI0 A;  3TO6 A;  5LGN A;  2LNB A;  1B9M A;  1D0Y A;  2FA5 A;  3H0D A;  3LSH A;  2IW5 A;  1W0U A;  2NNY A;  1R6R A;  2EFQ A;  1HF0 A;  1WSU A;  2GOM A;  5DUK A;  2XUB A;  3EUH A;  4M9Z A;  3RPQ A;  3S17 J;  3BG5 A;  3CJT B;  3HPH A;  5GAG J;  1TQP A;  1YIO A;  2ID6 A;  1VQO I;  2VOD A;  4UVA A;  1XGM A;  2ZB9 A;  3OIO A;  1XC5 A;  3ZRG A;  4PZJ A;  4HF0 A;  1H0M A;  4CYC A;  2Z3Y A;  2TDX A;  3OS1 A;  3BPV A;  2PBI A;  2Q0O A;  3QPT A;  1KON A;  3QOP A;  3JRG A;  4EJO A;  1I6H J;  1ZHF A;  2BZT A;  2L0K A;  1JGS A;  3DPT A;  3HOU J;  1FBS A;  2V26 A;  2CYY A;  2JRT A;  4KIF A;  1MMA A;  4CCJ A;  3OYI A;  5ED4 A;  3CCV I;  3DEU A;  2R7O A;  3IL2 A;  3KZZ A;  5HNF A;  5FJ8 J;  1BN5 A;  4FE7 A;  4ENJ A;  1TW3 A;  3CDH A;  2KZG A;  1ETK A;  3KE2 A;  2KLO A;  3MKL A;  4OMY A;  1IRZ A;  3CCS I;  4CUG A;  1X1B A;  2O0Y A;  4BBS J;  2JA2 A;  1JHF A;  2JVG A;  3I59 B;  3I4P A;  4D5F A;  3PO2 J;  3ZQ7 A;  3QOE A;  4U7D A;  2LD5 A;  2DCE A;  3ECH A;  2K5C A;  5ICE A;  5IOY A;  2DPD A;  3F8M A;  3BLY A;  4BE0 A;  3BC8 A;  4KJZ A;  2HYJ A;  1J09 A;  2EZH A;  3VWB A;  4BNC A;  6PAX A;  3TW6 A;  2KQR A;  4XRF A;  5HDG A;  2O3F A;  4S0H B;  2K02 A;  3FDY A;  4UUS B;  3RCO A;  4YII A;  3AKZ A;  2QGU A;  3FBN B;  2KHM A;  4HA8 A;  4B44 A;  2MD0 A;  4Q48 A;  1SVM A;  2H6B A;  3RSN A;  3DQV C;  1O3Q A;  3AG1 H;  4RAF A;  3FK6 A;  2K4B A;  1ZEL A;  1ZK8 A;  1X3U A;  3S3O A;  5E8I A;  3QYB A;  5CYV A;  3HOV J;  2W25 A;  2QUF A;  1IJW C;  1HW5 A;  1JE8 A;  3CC4 I;  2JT1 A;  3GZN B;  3HTS B;  2CQQ A;  1OCZ H;  4V2F A;  2X0L A;  1LB2 A;  4AC0 A;  1Y1W J;  3BTJ A;  3K4N A;  2F6C A;  4KDP A;  2XVC A;  4B09 A;  4LG3 A;  1HKS A;  2FD5 A;  3LFK A;  5L3D A;  1SD4 A;  5CVR A;  3HOZ J;  2UUZ A;  3FK7 A;  4XIC A;  4F7Z A;  3PM1 A;  3OYF A;  1RRJ A;  2ADU A;  1TBX A;  3V8L A;  3HSF A;  1G2H A;  3O8G A;  2DA7 A;  3HZJ A;  4QWQ A;  3RJP A;  1BR4 A;  1K6Y A;  2YX7 A;  1ETY A;  3OL3 A;  4EJU A;  2XKO A;  4XID A;  3QWL A;  2XAH A;  5B5E C;  1O3S A;  1EKE A;  2DJN A;  3HOX J;  3SEQ A;  1HC8 A;  1XX5 A;  3CLQ A;  2Z33 A;  2L01 A;  1XCV A;  1QVU A;  3PL8 A;  1Z3Y A;  1OKR A;  4EGZ A;  2CG4 A;  4A3M J;  2V6C A;  3I71 A;  3I4N J;  3OYJ A;  2O7O A;  1WHU A;  1DU6 A;  5H20 A;  3P9K A;  3OYK A;  3NAU A;  3GWZ A;  1HST A;  1WJ5 A;  4UUV A;  3S2H J;  3ESW B;  1BIA A;  2IXS A;  1S5L C;  3HYI A;  4LIV A;  4ENK A;  4A3K J;  3VYS B;  1IO2 A;  2MLG A;  1R58 A;  1MDM A;  2FJ1 A;  3J7Y J;  4GO1 A;  1E17 A;  3CP8 A;  4WCG A;  1ZLJ A;  2X6O A;  2XGX A;  1XMK A;  2Y69 H;  3HXL A;  3K1N A;  1PUE E;  2RRE A;  3MEX A;  2FXA A;  2ZCW A;  3RZO J;  1Y8R B;  2IAI A;  1ZGW A;  2CJJ A;  3OYC A;  3OY9 A;  4A69 C;  2M8G X;  1WQ2 A;  1R00 A;  4WXH A;  1XS9 A;  2JA7 J;  1YS7 A;  4IHT A;  1JI8 A;  3CCQ I;  1ETO A;  2WTE A;  4E7I A;  3REO A;  4B3X A;  3FXL A;  1O3T A;  2JMW A;  4NC7 A;  1TLH B;  2WY8 Q;  2XRO A;  3S1M J;  1BM9 A;  2ISY A;  3B6C A;  2F5D A;  3I5U A;  4M6X A;  5EGO B;  1T39 A;  3QOD A;  2R7Q A;  1S7O A;  3F8B A;  1SFE A;  4I7H A;  2R3S A;  3W2A A;  2KJC A;  2GA2 A;  2JTV A;  4BHC A;  3HKZ A;  3AAF A;  2A05 A;  2VBY A;  1MND A;  1YIJ I;  2ZBK A;  3FMS A;  3LQR A;  4IF4 A;  3RKQ A;  2VT3 A;  2V1X A;  1JT6 A;  2CFO A;  3B02 A;  4KT5 C;  2L2O A;  4L9T A;  3T8T A;  2BY0 A;  1FBU A;  2CV2 A;  4U0V A;  1T8I A;  2VI6 A;  2BY3 A;  2DA1 A;  4HG2 A;  5FRM A;  1FZP B;  4NQW A;  4CCK A;  3K10 A;  3GZ5 A;  4MGR A;  2DI3 A;  1EA3 A;  1WGX A;  3JAM Z;  5FKK A;  3MQ0 A;  3ASN H;  1J5Y A;  2BY1 A;  4BAY A;  1ZYR F;  2X1C A;  2ME6 A;  1ERD A;  1J2X A;  2E19 A;  2W85 A;  1CF7 A;  1UB9 A;  5HDN A;  3DKY A;  5BOX A;  2ICW G;  1TT0 A;  5K5O A;  4HF1 A;  1GXP A;  3F8F A;  5C4X J;  2XC7 A;  1BI0 A;  1ZR2 A;  1IRG A;  3KIO A;  2ZJQ F;  1MJB A;  1X2M A;  2A68 F;  4CSW A;  3CC2 I;  1NH3 A;  1OYY A;  3S2D J;  1VQ9 I;  4A5N A;  4EJV A;  4KN4 X;  2H27 A;  2WBM A;  4OOI A;  2WAF A;  1RR8 C;  4YIF A;  5LEJ A;  3WTS C;  1OFC X;  3OS0 A;  4CA0 A;  2IPQ X;  5H6R A;  2PJP A;  3G1L A;  4HW0 A;  1BC7 C;  3P7N A;  3ZMS A;  3TOB A;  1A31 A;  1YIT I;  2FML A;  1QHH D;  1WI3 A;  4E7J A;  1ZN2 A;  3KP7 A;  3MD2 A;  1R22 A;  1FWZ A;  1P6R A;  2EIJ H;  4ZJZ A;  3PUF A;  1IN4 A;  2HTJ A;  2FUG 2;  1OYI A;  5LBQ A;  2JA8 J;  2OC6 A;  5F6F A;  4A5M A;  1Z6T A;  1HQC A;  4XRM A;  1EV7 A;  4EM1 A;  3NWS A;  4JK1 X;  1PDN C;  3GTO J;  2BYV E;  2VE8 A;  2K3F A;  2M3A A;  3CZ6 A;  4YEL A;  1Z7L A;  1P7J A;  2Q2E B;  1ZRD A;  2CMP A;  4Q5S F;  4G9Y A;  5DDG A;  3FX3 A;  5C3E J;  3PFI A;  2P5K A;  3S15 J;  2QZ8 A;  2YUS A;  5J8F A;  2PFB A;  2X6W A;  3AL0 B;  2OV7 A;  2DXI A;  3AFH A;  1ZRC A;  5EZH A;  4RA2 A;  1UHS A;  3EUK L;  5TJJ A;  3HOY J;  3ZQF A;  4I01 A;  2FBI A;  4NHJ A;  3P9C A;  3K4K A;  2GZW A;  4EV0 A;  2XF7 A;  1MBF A;  2AXL A;  2XGE A;  2QQ9 A;  3H5N A;  2Z16 A;  2QVO A;  2JSP A;  3VFZ A;  1MJ9 A;  2WV0 A;  3GW2 A;  2QF7 A;  3W6K B;  1MKM A;  1HLV A;  1QPI A;  1K6O A;  4BXX J;  4Y33 A;  2L54 A;  2HYG D;  3F72 A;  3H0G J;  2L4M A;  2G7U A;  3LFU A;  2QLZ A;  1W5C C;  1P9Q C;  4G6Q A;  1OYW A;  1K61 A;  3DU6 A;  3MZ8 A;  2VPL A;  4ASN A;  3GFI A;  2FOK A;  4KN7 X;  3HJE A;  3VOD A;  1IG7 A;  4IQJ A;  1R5I D;  2PI0 A;  1WWX A;  1JHH A;  2W82 A;  5C44 J;  1U8R A;  1T2K A;  2F4O B;  1G3W A;  5IT3 A;  3CF5 F;  2EJR A;  2ISZ A;  5K1Y A;  2OZ6 A;  4KIG A;  1J75 A;  4CH7 A;  2X9D A;  2W57 A;  3ZGK A;  4IXA A;  2EIL H;  5DCF A;  3PNT A;  2XRN A;  1FPQ A;  4XLP F;  2HR3 A;  5FRO A;  1G3S A;  1O7L A;  1MNE A;  3X2Q H;  2CFX A;  1G4D A;  3HRM A;  1FIP A;  1GDT A;  1RES A;  1MDM B;  3ELK A;  5FKL A;  5ILS A;  4AU7 A;  2MLK A;  4DNC A;  4WX9 A;  1I50 J;  2DTZ A;  1RZ4 A;  1U0J A;  2R92 J;  1QQI A;  3MFK A;  1R7J A;  2EV6 A;  2GXG A;  3ABK H;  3SZG A;  2I5U A;  2YS9 A;  1AKH A;  1LJ9 A;  2E7W A;  3HC7 A;  4G7Z F;  3A2K A;  2DA2 A;  1CGP A;  2RVC A;  3W2W A;  2HNH A;  3VB2 A;  1MMG A;  3HKZ N;  1Z77 A;  4CDG A;  4YG2 F;  3UKG A;  1I6X A;  3JRC A;  1ETW A;  2R7X A;  2W48 A;  4GYI A;  1TC3 C;  1TTY A;  2OQR A;  3S16 J;  2KRC A;  1X1P A;  2A6H F;  2OZU A;  5FFX A;  2F4I A;  1FIA A;  4HOB A;  2DBB A;  1T0F A;  1WCM J;  3CUO A;  5LLQ A;  3V42 A;  2EK5 A;  1FEX A;  2AQF A;  2QQ8 A;  4G12 A;  5FGM A;  2QSH X;  3LSR A;  4ZYG A;  4CZC A;  1X19 A;  3F8N A;  2K86 A;  1FP1 D;  3HOS A;  1TNS A;  4XOP A;  2CO5 A;  2ZJR F;  1YFH A;  4II2 A;  2VON A;  3MMY B;  2NS8 A;  5LGU A;  4DBR A;  3KEQ A;  3JRA A;  1DPR A;  1UZC A;  1OMI A;  2FSW A;  2OU2 A;  3TED A;  2O61 A;  2NOJ B;  4UUT A;  4NQW B;  2FF4 A;  2EWN A;  2OQG A;  4Y17 A;  2IS2 A;  4BUP A;  1W36 D;  3S2W A;  1GUU A;  1P4W A;  4EMS A;  2D45 A;  3ZMT A;  2XSD C;  2DFI A;  2G7H A;  4BQN A;  1B59 A;  1YS6 A;  3PQK A;  4XSZ F;  2JRM A;  4A93 J;  4IQ4 A;  3CDI A;  4XN0 A;  1YJ9 I;  4A3C J;  3CUQ C;  3E5U A;  3EYI A;  3HUG B;  2RC4 A;  4G94 A;  2GXB A;  1ZAO A;  1N78 A;  1IV6 A;  4P5O A;  4M71 A;  1T33 A;  3H1C A;  3ZMD A;  2HOS A;  3IH3 A;  1QPM A;  3K2A A;  1OLT A;  5E17 F;  1X3Z B;  4PJN A;  2HDW A;  4FCY A;  1Z1D A;  3RYP A;  2Q8K A;  3BTL A;  3WTZ A;  3WTX C;  5FLX Z;  4UUS A;  3HTU A;  2MH9 A;  4O6J A;  5CPR B;  4YFN F;  2NS7 A;  2QCO A;  1Z9C A;  2M87 A;  3E5Q A;  4ANJ A;  1GHC A;  4L9J A;  2V1N A;  3K70 C;  2EFO A;  3RKW A;  5ILU A;  4BQO A;  2CUE A;  2HVR A;  2A5Y B;  1FX7 A;  5TRD A;  3H3Z A;  4CHU A;  4MQ9 F;  2VAS A;  1Y6I A;  4XLN F;  3EDP A;  2VJ4 A;  4C2T A;  3KLN A;  5HNH A;  1XD7 A;  1V5F A;  3OYA A;  3GFJ A;  2KP6 A;  1VQL I;  2V9K A;  1QU3 A;  3A0H C;  4P9U A;  4FIS A;  4B8X A;  4UB8 C;  3ABT A;  3BR6 A;  4P1W A;  2LSO A;  4M73 A;  2LY1 A;  1XCB A;  3BJO A;  1K4S A;  2KJB A;  3ZQH A;  3GFM A;  1KU3 A;  1ETQ A;  4IEJ A;  3FKI J;  3H5A A;  2K27 A;  4IHV A;  1WJA A;  3WU1 B;  5LD2 C;  1ACI A;  1LQ1 A;  3TGN A;  1D5V A;  1S7A A;  3ERE D;  4MTD A;  1K7A A;  5AIP A;  4L0Y B;  2FRH A;  1UEL B;  3RKY A;  2NVQ J;  1M1E B;  3K0L A;  2FBK A;  5K7Z A;  4CCO A;  5HS9 A;  3IWF A;  1MBK A;  3H9Q A;  3DPU A;  2DA6 A;  2WY7 Q;  2YX4 A;  2UZK A;  2ZFW A;  3I53 A;  5EYR A;  2X4H A;  2Y30 A;  1RNL A;  2OJE D;  3OYH A;  1F1Z A;  4C9Y A;  2F5F A;  1MNM C;  3BG9 A;  2X6Y A;  4NB5 A;  2EB7 A;  2D1H A;  3IKV A;  4ESF A;  5GTI C;  1YTY A;  3VOE A;  2A07 F;  1BI1 A;  2F5V A;  3AG4 H;  4KUM A;  2IGO A;  2WC2 A;  3HGY A;  4LB5 A;  1SAX A;  1BA5 A;  1T08 B;  2XPV A;  4PSW A;  2QKM B;  2X85 A;  3JRI A;  3I58 A;  2XB5 A;  5TGT A;  2GWR A;  2VJJ A;  1JUP A;  2NAZ A;  3WHB A;  5F1R A;  1WI9 A;  4XRS A;  1YOV B;  4BL0 B;  5FKM A;  4IHS A;  1KZH A;  3E6C C;  5E1W A;  2HDD A;  2DJI A;  3KP2 A;  5C4J J;  3KP4 A;  3LSK A;  2VBW A;  3QAH A;  2W1O A;  4X0G A;  1R1V A;  4G6D A;  1HKT A;  2CUZ A;  4FHT A;  1FOW A;  5J4V A;  3M3Y J;  3BG3 A;  3G1M A;  3IAS 2;  5LHI A;  5D6F A;  4XN3 A;  3Q5F A;  1FSE A;  5BPD A;  4BGD A;  4W97 A;  3GTP J;  1FTZ A;  2EBI A;  1TW2 A;  5BQT A;  1D0X A;  4FAS D;  2NVY J;  2M30 A;  2L7K A;  1A36 A;  4Y7N J;  3D0S A;  1LNW A;  2EA4 A;  4ZDP A;  2GOX B;  2P7C B;  1DGR M;  3RDI A;  3CCU I;  5E18 F;  2IA2 A;  2ZC2 A;  3BZC A;  2VN2 A;  3GXO A;  1UHW A;  1RUN A;  2LK2 A;  2X6X A;  5DYM A;  2FNP A;  1SD5 A;  3KP6 A;  1IGN A;  3WGI A;  1VQ6 I;  2E7X A;  1IUY A;  2XGD A;  1E2X A;  4N0B A;  2O9L A;  2P81 A;  1YW9 A;  3LOC A;  5F0F A;  1OPC A;  3C2B A;  4HRI A;  2E35 A;  2EV5 A;  1NHA A;  1D8J A;  1ORK A;  2Z9O A;  4XL9 A;  3GTJ J;  1WJE A;  2ID3 A;  3HRU A;  3FXJ A;  3A02 A;  3SFI A;  2XF6 A;  4LIU A;  5GAE J;  2GAU A;  2LRE A;  4G6T B;  3CCE I;  1Q1H A;  4Z6Y A;  3KEO A;  2H94 A;  3A1Y A;  1J0R A;  3OS2 A;  5KK1 A;  3RPU A;  1D1B A;  5ICF A;  5LGT A;  4XOT A;  3CCL I;  1B1B A;  2RN7 A;  3H9G A;  1RC9 A;  4HZF A;  4RBO A;  4ZDL A;  4OAY A;  1MJA A;  3LSG A;  4KMF A;  1AHD P;  2BGC A;  2H1L A;  1U9O A;  2VBX A;  3CMY A;  4U0Y A;  4AM3 A;  5KAI C;  1F43 A;  4HEA 2;  2VQL A;  3SZT A;  4YFX F;  1BJA A;  3KET A;  2AHQ A;  4BBR J;  3OOP A;  4L5E A;  2D2W A;  3GTL J;  1NK2 P;  3EQL F;  4BJ6 C;  3LA7 A;  1E0E A;  3I3L A;  4XRS G;  3BR0 A;  3K4B A;  4ESJ A;  1R4N B;  2CW8 A;  1JUS A;  4E7Z A;  5IYC J;  4Q4Z F;  1J59 A;  4AID A;  1R5G A;  2B0L A;  4LG0 A;  2Y0S A;  1REP C;  2ZSH B;  2K3P A;  3OR1 C;  4AVP A;  3BR2 A;  4M9S A;  3BG6 A;  1QO0 D;  1ZG5 A;  3MCZ A;  4GDF A;  2EZK A;  1KU9 A;  2NOG A;  4PGH A;  2Q2E A;  2ZNZ A;  2ESH A;  3PFY A;  3E6B A;  4KIC A;  1ZAR A;  2ZFU A;  4N9I A;  2E1O A;  3BPX A;  2NXN B;  1X1C A;  2EZL A;  2HOA A;  2RDP A;  3A03 A;  1KGS A;  3DWL E;  1B8I B;  3T8R A;  3U1D A;  2IGM A;  1GVD A;  4RLQ A;  2VL8 A;  2DTR A;  3ZPL A;  4C3H J;  5LFA A;  2DOE A;  2BVL A;  2CV1 A;  3G1O A;  1WVR A;  2M0M A;  1TWF J;  4ZYH A;  1A04 A;  2JWT A;  1IUF A;  3L2U A;  4UXN A;  4HAM A;  3TQN A;  1WJB A;  4D1Q A;  5F0H A;  3IUO A;  2ZO4 A;  4LOC A;  3HSE A;  3K4J A;  3OMY A;  1LDK B;  2IGN A;  3JRE A;  4Z2Y A;  3GYH X;  2HQN A;  4OIP F;  5JFR A;  2I8D A;  3JRD A;  2HPM A;  2FOW A;  3CF2 A;  1MD0 A;  3GF2 A;  5CQE A;  2KPM A;  2M4K A;  3FIS A;  3VYR B;  1FBQ A;  1YHQ I;  3HDD A;  5DUI A;  3KFW X;  2DDA A;  5CVJ A;  4Y13 A;  1FYL A;  4KFC A;  1NTC A;  3D5L A;  1K83 J;  1B9N A;  3U21 A;  2B63 J;  4OIN F;  2JVH A;  1FMV A;  4I02 A;  4WF2 A;  2AS5 F;  3EYY A;  2R7U A;  2FNA A;  1FLI A;  2JUG A;  1EF4 A;  3K4C A;  1SVL A;  1JJ8 C;  5DD4 A;  2VC1 A;  1I39 A;  1VZ0 A;  2CH0 A;  4XKW A;  1TQM A;  2XAU A;  1JKP C;  1ZRF A;  2LLK A;  3FMR A;  1UHM A;  1T38 A;  4CYD A;  3ZMV A;  5IY5 H;  3CJN A;  2BY2 A;  4XKV A;  2DQL A;  2OD5 A;  1POG A;  1R1T A;  4N9H A;  2QA4 I;  1VND A;  3M7G A;  2P5V A;  2IS4 A;  3DP7 A;  2K9N A;  3U1K A;  4BJ5 C;  2UWM A;  3ZQQ A;  4L5I A;  1Z0X A;  2ZXH A;  4P96 A;  1F4K A;  2IGK A;  3WG9 A;  2LKP A;  5J1R A;  3GZ6 A;  3BQY A;  3F6V A;  2M1B A;  2MYS A;  3SXY A;  1PVE A;  5HS8 A;  1PYV A;  4RB0 A;  3M9A A;  3DKX A;  3QPH A;  4XLH A;  4BXF A;  1Z6R A;  1VQ7 I;  2JPC A;  4BDY A;  1FC3 A;  2Y2Z A;  2YU3 A;  1MW7 A;  4L18 B;  1J9I A;  3UR3 C;  1SMT A;  3KPH A;  1E3P A;  1S72 I;  2E1M C;  4HLX A;  4CCM A;  1GV5 A;  4L5J A;  1BOA A;  1HCR A;  2PN6 A;  4A12 A;  5LHG A;  1PJR A;  4MTE A;  4A2U A;  4RB1 A;  3PIO F;  1P7I A;  2ZXJ A;  5E3O A;  2MC3 A;  1KYZ A;  3R4K A;  1D8K A;  4BHB A;  3FHZ A;  3HBL A;  5EEA A;  2EV0 A;  5HLI A;  2EFW A;  3HOW J;  1ZTR A;  2F5E A;  3HL2 A;  2ZME C;  5JVG F;  1MMD A;  2V9P A;  1D0Z A;  2CGP A;  3QP6 A;  1I5Z A;  5EZG A;  2PMZ A;  3GME A;  5F04 A;  4UB6 C;  4I99 C;  5F0C A;  1STZ A;  3S8P A;  2L9R A;  4M6V A;  4K2E A;  1R5H A;  3WU2 C;  3BZK A;  5KHD A;  5J1U A;  5D6E A;  4JQF A;  1JUM A;  1OCC H;  1UJ8 A;  2OCE A;  4A6E A;  4E7K A;  1IZ1 A;  3WTT C;  1A5J A;  4PJ0 C;  2HOT A;  2DT5 A;  2QSF X;  3BTI A;  2JSC A;  3OYN A;  2WB1 A;  4IX7 A;  1AA7 A;  3HGG A;  5HLH A;  1S7E A;  3KYD B;  3CCY A;  1J7K A;  4AIJ A;  3OL4 A;  1W7P A;  4D7N A;  3ZQL A;  1Y0N A;  3LSJ A;  3S32 A;  1ZGJ A;  4UHT A;  4XMY A;  5E1Z B;  3KLO A;  4BEH B;  4H4K C;  2M4G A;  4IHX A;  4IL6 C;  5F27 A;  1ULY A;  5CJ9 A;  3CO6 C;  3KYL A;  4I09 A;  5FO5 A;  4W1U A;  4DIQ A;  1MMS A;  2XHK A;  3HUG A;  3JRB A;  2MA3 A;  1ZG1 A;  3ABU A;  1L3L A;  1FTT A;  5K7H A;  1DUX C;  2CQX A;  2YPR A;  5AON A;  2Y0S N;  4YEJ A;  2STW A;  1GLN A;  2JQ7 A;  2FX0 A;  2GQQ A;  3L2C A;  5IPA A;  2XAF A;  2GBY A;  2LTP A;  3DTK A;  4M3B A;  5LRR A;  4ZC3 A;  2QBY B;  3SQN A;  5L3G A;  3DEW A;  2BEO A;  3F6O A;  4IVN A;  4Y3O A;  2XRL A;  2NVX J;  5JLX A;  4IHW A;  1T56 A;  2ELJ A;  5F1J A;  2VOP A;  3A0B C;  3OIP A;  1OCO H;  2E71 A;  2MD5 A;  3LA2 A;  1OCT C;  1T98 A;  1DP7 P;  4XR6 A;  3F8C A;  2BBY A;  3PSI A;  4LG0 B;  2OF7 A;  4BKX A;  1LFP A;  3FBI B;  2ECC A;  4B43 A;  1IRX A;  4NC6 A;  3C7J A;  1OR7 A;  2DA5 A;  4MHG A;  4ZTF A;  2HQ5 A;  4EJW A;  1X2N A;  3LNQ A;  5M5W J;  4P9F A;  1MSF C;  4HSR A;  1X3W B;  1LPQ A;  3BT9 A;  1SFO J;  2OCC H;  4EVI A;  2LH9 A;  3ZQC A;  4M3E A;  2G9W A;  5DS9 A;  5D4S A;  4B47 A;  2R7D A;  1U2W A;  3V8K A;  3TBI A;  2MAB A;  3VPR A;  1Z67 A;  2Y75 A;  2Z5U A;  1S29 A;  1APL C;  2KIS A;  5LRS A;  1QZZ A;  1HBX G;  3RZD J;  1SAN A;  3Q3S A;  2H6C A;  3ZQG A;  1RR7 A;  4EM2 A;  2EZI A;  4GYG A;  5HS7 A;  3QRF F;  1F36 A;  5HLT A;  5CVV A;  2KIM A;  4BE2 A;  2BVM A;  4M6Y A;  3RQ4 A;  3CME I;  1LFB A;  4HPQ A;  3TKY A;  3FXK A;  3ASO H;  3OYD A;  4LIT A;  1DP3 A;  3HM5 A;  1FT9 A;  4DOZ A;  4RB2 C;  5A2Q K;  1W5T A;  1TWH J;  4O5V A;  1W36 C;  4MEX F;  3BR5 A;  2VKH A;  2JN6 A;  4ITV A;  3SDG A;  1XB4 A;  2W4S A;  1HW2 A;  2DMT A;  4BDZ A;  2VE9 A;  2V1U A;  4I98 B;  2NS0 A;  2HI3 A;  3K1P A;  3QU3 A;  1Z91 A;  3QU6 A;  5DM6 F;  3FIW A;  3OYB A;  1YG2 A;  3DBH B;  3CJQ B;  3RYR A;  1G59 A;  3I56 I;  3HB9 A;  3SEZ A;  2JZY A;  3M8F A;  1OQY A;  2KT0 A;  5M5X J;  4ZYD A;  1S3J A;  3C2G A;  1IN5 A;  2VQG A;  5LEK A;  3TDU C;  1U8B A;  2O8K A;  2IS1 A;  3G4S I;  3H35 A;  2QEX I;  3H5R A;  2HU9 A;  1BR1 A;  1W1W E;  2ACJ A;  1FJL A;  2HFH A;  1YX5 A;  2QWW A;  3LMM A;  3W6J B;  2D1V A;  4XSX F;  4QPQ A;  4DYC A;  2L9V A;  2GIZ A;  2JJ7 A;  3V8J A;  3DLL F;  3M4O J;  1SFK A;  2L7Z A;  3G3Z A;  2BW3 A;  2KIU A;  1ON1 A;  4ZH4 F;  1VQM I;  2UXX A;  3R60 A;  3TO7 A;  3CO7 C;  2Q1Z B;  5E20 A;  1JT0 A;  3S3M A;  2DN0 A;  1TWG J;  4RAY A;  3CD6 I;  2PMZ N;  2XPU A;  2Y0M A;  5EG0 B;  3S1R J;  3K69 A;  2MG4 A;  1RKT A;  1XTA A;  4CIC A;  4B4C A;  1OCR H;  5EJC A;  3MAJ A;  1KQ8 A;  5IOZ A;  4A6D A; 
#chains in the Genus database with same CATH homology
 3HIF A;  1IXC A;  2E1C A;  1SFU A;  3DKW A;  1EH8 A;  3NEU A;  1G3Y A;  1Z7U A;  4YFK F;  3BJA A;  2XAJ A;  4LLL A;  3E6M A;  5E8G A;  1V3F A;  4Q47 A;  3FZV A;  2QQB A;  1P2F A;  3DPL C;  1SD7 A;  4OU0 A;  1FP2 A;  4FX0 A;  2LDU A;  2FU4 A;  2IT0 A;  4CO8 A;  3CUQ B;  4OIQ F;  3L00 A;  2VXZ A;  1W4M A;  3FMQ A;  4RGR A;  1W7P B;  3L9F A;  2YSR A;  2CWE A;  2HTS A;  1G6N A;  3WOD F;  2VBZ A;  4EM0 B;  4FX4 A;  4LK0 F;  3IHU A;  5IT9 K;  1B4A A;  2CW0 F;  1XSV A;  1BI3 A;  2K4J A;  1BI2 A;  4MEY F;  5F64 A;  4L0Z B;  3ZMU A;  2HYF A;  1DPU A;  3E97 A;  2DQR A;  2F5C A;  5FD5 A;  2Z99 A;  3JW4 A;  3FXU A;  3LA3 A;  3I64 A;  4M72 A;  3BJ6 A;  1QBJ A;  5D5X B;  4LMY A;  1RI7 A;  2FQ3 A;  2F2E A;  3WU0 A;  3EET A;  4S04 A;  4G7O F;  2HGC A;  2HOE A;  3ZP5 A;  2ETH A;  3J80 K;  5H6Q A;  3KP5 A;  4WK8 F;  4GCV A;  2DPU A;  1KQ9 A;  2FE3 A;  4U0W A;  2CSO A;  3WTY C;  3ML6 A;  4LD5 A;  2YR2 A;  1O3R A;  4LGW A;  3JTH A;  2H09 A;  1S8N A;  2XV4 S;  2E1N A;  1IXR C;  3ZN0 A;  1AWC A;  1PP7 U;  3I54 A;  3GEZ A;  5CVI A;  4WXD A;  2HQR A;  1YQA A;  1P4A A;  3K1M A;  4S05 A;  2W84 A;  3J81 K;  2FBH A;  2XIG A;  5J8C A;  2PQ8 A;  3SZP A;  1D3Y A;  3V7R A;  1Z05 A;  1LEA A;  3COA C;  3KCC A;  4HX7 A;  5BS6 A;  1FY7 A;  5D5V B;  1ZH5 A;  2ZME A;  1IXS B;  1IAW A;  1UST A;  3BDD A;  4UNO A;  1VTN C;  1LVA A;  1USS A;  2IRF G;  3F23 A;  2HZT A;  2MBF A;  3QP5 A;  5K5R A;  2IA1 A;  2ZJ2 A;  4ETS A;  5L3E A;  3E6D A;  2FMY A;  3PQJ A;  4IPA A;  3MZY A;  2ZKZ A;  3JTG A;  1XSX A;  3LAJ A;  3FM5 A;  2QYO A;  4UV8 A;  4KNY A;  5BPI A;  2HWV A;  3BWG A;  3NRV A;  3FM3 A;  3JSP A;  5KVR A;  1FYK A;  4HX8 A;  3CLO A;  5L3B A;  5HDK A;  4WWC A;  1U78 A;  3E5X A;  5DD8 A;  2DW4 A;  2P4W A;  4HQM A;  2BV6 A;  2HEO A;  4OMZ A;  1TQI A;  3F22 A;  1HW1 A;  3ECO A;  4IRH A;  1JXS A;  4PDK A;  4CXF A;  3HRT A;  3N97 A;  2QBY A;  3IRR A;  2GIV A;  2JPB A;  4G8X A;  3MZH A;  1YYV A;  1U3E M;  3BY6 A;  2VT2 A;  3O6B B;  3K9T A;  2WWY A;  4IRI A;  3DF8 A;  4ENN A;  1I1S A;  4MNU A;  4HDU A;  2XAG A;  5L3F A;  4XBF A;  1H9T A;  3DFG A;  4I0A A;  1WKM A;  3R61 A;  5BMZ A;  1QGP A;  1O7F A;  3RKX A;  1QZY A;  4RB3 C;  5DV5 A;  4UVC A;  4HBL A;  4MQV A;  4HX4 A;  2A6E F;  2Y48 A;  3G73 A;  1HKQ A;  2ZNY A;  4DQ2 A;  3BRO A;  2KKO A;  3ROU A;  3R0A A;  1K78 B;  2NNN A;  4LLN A;  2IA0 A;  3Q9S A;  3RTR A;  2P6S A;  1FOK A;  1FYM A;  2OBP A;  4KMU X;  3V4G A;  3HRS A;  3SHF A;  3KP3 A;  2LF7 A;  3BP8 A;  2P7V B;  2PMH A;  4RS8 A;  1GVJ A;  5FB2 A;  3HHH A;  2HS5 A;  4RGS A;  4KIB A;  5HOO A;  2O03 A;  4L9V A;  1K79 A;  2A3S A;  2NRA C;  3ISP A;  1I27 A;  2DU9 A;  1U5T B;  5ICC A;  4KYW A;  4BH9 A;  3TO9 A;  4O3M A;  4BHP A;  4I2O A;  2ZME B;  1U5T C;  2KIF A;  4U88 A;  3M1E A;  1ZLK A;  1FSH A;  4L9N A;  1IN8 A;  1UFM A;  3LQQ A;  4ZZL A;  1IN7 A;  4HV5 A;  2BE5 F;  1G3T A;  3B73 A;  3H92 A;  4HLY A;  2PLY A;  3T0Y A;  4CZZ A;  5E1X A;  3R6S A;  3TOA A;  1ONV A;  5CVU A;  4LB6 B;  4LLG F;  1BC8 C;  2P6T A;  1HSJ A;  5A2Q Z;  1P92 A;  3DV8 A;  3V7S A;  1H9G A;  3WGH A;  3CUQ A;  4AWX B;  2L02 A;  1R23 A;  3P9I A;  2VC0 A;  3FWE A;  2DAO A;  1LEB A;  4AD9 A;  2A69 F;  4HYE A;  3GFL A;  2HDC A;  1IRF A;  1IW7 F;  1XN7 A;  1ZG3 A;  2XAS A;  5D5W B;  3M8E A;  2DLL A;  1W5S A;  3IKT A;  2RQP A;  3LST A;  4A0Z A;  2L4A A;  3DXJ F;  2RNJ A;  4QLC U;  2C6Y A;  4BXU A;  3OV8 A;  3RIR A;  4JBA A;  3KZY A;  2J5P A;  2LF8 A;  4CGZ A;  3GVA A;  4UVB A;  3C18 A;  4H0E A;  4EQQ A;  3ZN1 A;  3H3U A;  3TDZ C;  4BYY A;  4M9X A;  1O57 A;  5D4R A;  1R36 A;  1EH7 A;  2GA1 A;  3F21 A;  3E3V A;  4GGG A;  2UXN A;  1T6S A;  3Q9V A;  1XDS A;  1EH6 A;  3FXR A;  1L0O C;  2P5L C;  1F5T A;  3C3W A;  3LAP A;  1BIB A;  5ICG A;  1RIO H;  3GUD A;  1U6G A;  5IT9 Z;  2KRF A;  4AIH A;  1UCR A;  1SMY F;  3IRQ A;  4LFU A;  1B6A A;  2IVM A;  1YW8 A;  4FT8 A;  2V1D A;  4P55 A;  2IJL A;  4E70 A;  1XGN A;  4ESB A;  3GX4 X;  1KYW A;  3SFZ A;  2M45 A;  3JSO A;  3R0J A;  1ZGA A;  3FF5 A;  1I1G A;  5ILV A;  3JAM K;  2FEZ A;  4GXO A;  4HF2 A;  2PMU A;  4G7H F;  5DCM A;  1ON2 A;  3J80 Z;  3O3K A;  1SFX A;  3L09 A;  1KU7 A;  3HHG A;  1YO5 C;  4RGX A;  1MGT A;  5K5Q A;  3FXQ A;  2COM A;  2W24 A;  5D5U B;  5FFZ A;  2EFN A;  2A61 A;  2OA4 A;  3GO5 A;  5JR3 A;  4EGY A;  1YW7 A;  2M5W A;  1GXQ A;  1BBY A;  5JVT A;  2CQK A;  1ODD A;  3NQO A;  2HKX A;  5ERI A;  2R7F A;  4BQA A;  1QNT A;  1MZB A;  2RV8 A;  4ON0 A;  4R8H A;  3RI4 A;  4PGG A;  3WE2 A;  3J81 Z;  4PCQ A;  2QEN A;  2VOO A;  4I0B A;  1SD6 A;  3BOQ A;  2QM3 A;  4RAZ A;  1AOY A;  5EEH A;  4M74 A;  3IC7 A;  2DK5 A;  3I0T A;  2O8X A;  1XDU A;  3ZMZ A;  3GLX A;  4TV7 A;  4RGU A;  2RGV A;  5AIQ A;  1XGO A;  1YLF A;  4ENM A;  2O6G E;  4WXC A;  3U9G A;  1CF7 B;  4UV9 A;  3WTW C;  2ESN A;  2XKP A;  5LHH A;  1XMA A;  1IF1 A;  3LWF A;  3I59 A;  1KU2 A;  2EFP A;  4ZYE A;  2M8E A;  4HDV A;  3WGG A;  2IP2 A;  1FNN A;  1LDJ A;  5HVQ C;  4OIO F;  2DK8 A;  3WTU C;  4HQE A;  3HSR A;  5DEQ A;  2V9V A;  1KA8 A;  2K7L A;  5CLS A;  2DO7 A;  5JHU A;  4IRG A;  1KQ0 A;  2MH2 A;  2RKH A;  1K78 A;  1DDN A;  5EEG A;  2OAZ A;  3F3X A;  3V7C A;  3IWZ A;  4U7B A;  1R1U A;  1TNT A;  3K2Z A;  5J6X A;  2NYX A;  3CTA A;  3MWM A;  5L3C A;  1S6L A;  3WE3 A;  5D8K B;  4R1H A;  1LDD A;  4R79 A;  1WRJ A;  2STT A;  1HXD A;  1XGS A;  3C1D A;  5FD6 A;  4A0X A;  1C0W A;  2L3D A;  4IJA A;  3ULQ B;  1Y0U A;  1U5T A;  4AIK A;  2V79 A;  1V4R A;  1RUO A;  4LK1 F;  3U2R A;  3L7W A;  4Y15 A;  2XAQ A;  5HLG A;  3T1B A;  3VEP A;  1W7P D;  4EJT A;  3O2P E;  2HKO A;  4A0Y A;  2P8T A;  5D8L B;  3WTV C;  1ZRE A;  2EA2 A;  5DCM B;  3J7A O;  1F9N A;  4ZZD A;  4LJZ F;  1P4X A;  3T5X A;  2ELH A;  4KA4 A;  4D0P A;  3HOT A;  1IN6 A;  1XSD A;  2PG4 A;  3BZ6 A;  2QQA A;  4OIR F;  5FLX K;  3N4M A;  1PP8 F;  2J5O A;  2PEX A;  5JI6 A;  4HV6 A;  3TO6 A;  5LGN A;  2LNB A;  1B9M A;  2FA5 A;  2IW5 A;  2NNY A;  2EFQ A;  1WSU A;  5DUK A;  2XUB A;  3EUH A;  4M9Z A;  3RPQ A;  1TQP A;  1YIO A;  2VOD A;  4UVA A;  1XGM A;  4PZJ A;  4HF0 A;  1H0M A;  2Z3Y A;  2TDX A;  3BPV A;  2PBI A;  2Q0O A;  3QPT A;  3QOP A;  4EJO A;  1ZHF A;  1JGS A;  3DPT A;  1FBS A;  2CYY A;  2JRT A;  4KIF A;  5ED4 A;  3DEU A;  3IL2 A;  3KZZ A;  1BN5 A;  4ENJ A;  1TW3 A;  3CDH A;  3KE2 A;  4OMY A;  2O0Y A;  1JHF A;  3I59 B;  3I4P A;  3ZQ7 A;  4U7D A;  3ECH A;  5ICE A;  2DPD A;  3F8M A;  6PAX A;  4BNC A;  4XRF A;  5HDG A;  2O3F A;  2K02 A;  4YII A;  4HA8 A;  4Q48 A;  2H6B A;  3DQV C;  1O3Q A;  2K4B A;  1X3U A;  5E8I A;  5CYV A;  2W25 A;  2QUF A;  1HW5 A;  1JE8 A;  2JT1 A;  3HTS B;  2X0L A;  1LB2 A;  4KDP A;  2XVC A;  4B09 A;  1HKS A;  3LFK A;  5L3D A;  1SD4 A;  5CVR A;  4F7Z A;  2ADU A;  1TBX A;  3V8L A;  3HSF A;  4QWQ A;  3RJP A;  2YX7 A;  4EJU A;  2XKO A;  2XAH A;  1O3S A;  2Z33 A;  2L01 A;  1XCV A;  1OKR A;  4EGZ A;  2CG4 A;  2V6C A;  3I71 A;  5H20 A;  3P9K A;  3GWZ A;  1HST A;  4UUV A;  1BIA A;  3HYI A;  4ENK A;  2MLG A;  1R58 A;  1MDM A;  4GO1 A;  1E17 A;  4WCG A;  1ZLJ A;  2XGX A;  1XMK A;  3K1N A;  1PUE E;  3MEX A;  2FXA A;  2ZCW A;  1WQ2 A;  1R00 A;  4WXH A;  1YS7 A;  2WTE A;  3REO A;  1O3T A;  1TLH B;  2XRO A;  1BM9 A;  2ISY A;  4M6X A;  2F5D A;  3I5U A;  1T39 A;  1S7O A;  3F8B A;  1SFE A;  4I7H A;  2R3S A;  2KJC A;  2GA2 A;  2JTV A;  4BHC A;  3AAF A;  2VBY A;  2ZBK A;  3FMS A;  3LQR A;  4IF4 A;  2VT3 A;  2V1X A;  3B02 A;  4KT5 C;  4L9T A;  3T8T A;  1FBU A;  4U0V A;  1FZP B;  4NQW A;  3GZ5 A;  4MGR A;  2DI3 A;  3JAM Z;  3MQ0 A;  1J5Y A;  4BAY A;  1ZYR F;  1J2X A;  2W85 A;  1CF7 A;  1UB9 A;  5HDN A;  5BOX A;  5K5O A;  4HF1 A;  1GXP A;  3F8F A;  1BI0 A;  1IRG A;  1MJB A;  2A68 F;  1OYY A;  4A5N A;  4EJV A;  4KN4 X;  2H27 A;  4OOI A;  4YIF A;  5LEJ A;  3WTS C;  2IPQ X;  5H6R A;  2PJP A;  4HW0 A;  1BC7 C;  3P7N A;  3ZMS A;  3TOB A;  2FML A;  1ZN2 A;  3KP7 A;  1R22 A;  1FWZ A;  1P6R A;  1IN4 A;  2HTJ A;  1OYI A;  5LBQ A;  5F6F A;  4A5M A;  1Z6T A;  1HQC A;  1EV7 A;  4EM1 A;  1PDN C;  4JK1 X;  2BYV E;  2VE8 A;  1ZRD A;  4Q5S F;  4G9Y A;  5DDG A;  3FX3 A;  3PFI A;  2P5K A;  2QZ8 A;  5J8F A;  2PFB A;  1ZRC A;  5TJJ A;  4I01 A;  2FBI A;  4NHJ A;  3P9C A;  2GZW A;  4EV0 A;  2AXL A;  2QQ9 A;  2QVO A;  3VFZ A;  1MJ9 A;  2WV0 A;  3GW2 A;  3W6K B;  1MKM A;  1K6O A;  2L54 A;  2HYG D;  3F72 A;  2L4M A;  2G7U A;  2QLZ A;  4G6Q A;  1OYW A;  4ASN A;  3GFI A;  2FOK A;  4KN7 X;  3VOD A;  2PI0 A;  1WWX A;  1JHH A;  1U8R A;  1T2K A;  1G3W A;  5IT3 A;  2EJR A;  2ISZ A;  5K1Y A;  2OZ6 A;  4KIG A;  1J75 A;  2W57 A;  4IXA A;  5DCF A;  2XRN A;  1FPQ A;  4XLP F;  2HR3 A;  1G3S A;  1O7L A;  2CFX A;  1G4D A;  3HRM A;  1MDM B;  3ELK A;  5ILS A;  4DNC A;  2MLK A;  4WX9 A;  1RZ4 A;  1QQI A;  3MFK A;  1R7J A;  2EV6 A;  2GXG A;  1LJ9 A;  2E7W A;  4G7Z F;  1CGP A;  2RVC A;  3VB2 A;  4YG2 F;  4CDG A;  1I6X A;  4GYI A;  1TTY A;  2OQR A;  2A6H F;  2OZU A;  5FFX A;  4HOB A;  2DBB A;  1T0F A;  3CUO A;  5LLQ A;  2EK5 A;  5FGM A;  4ZYG A;  3F8N A;  2K86 A;  1FP1 D;  3HOS A;  1TNS A;  2CO5 A;  1YFH A;  2VON A;  5LGU A;  3KEQ A;  1DPR A;  1OMI A;  2FSW A;  2OU2 A;  2O61 A;  2FF4 A;  2EWN A;  2OQG A;  4Y17 A;  3S2W A;  1P4W A;  4EMS A;  2D45 A;  3ZMT A;  2DFI A;  2G7H A;  1B59 A;  1YS6 A;  3PQK A;  4XSZ F;  3CUQ C;  3E5U A;  3EYI A;  2RC4 A;  4G94 A;  2GXB A;  1ZAO A;  4P5O A;  4M71 A;  3ZMD A;  1QPM A;  5E17 F;  1Z1D A;  3RYP A;  2Q8K A;  3WTZ A;  3WTX C;  5FLX Z;  3HTU A;  2MH9 A;  4O6J A;  4YFN F;  1Z9C A;  2M87 A;  3E5Q A;  1GHC A;  4L9J A;  2EFO A;  3RKW A;  5ILU A;  2A5Y B;  5TRD A;  1FX7 A;  3H3Z A;  4CHU A;  4MQ9 F;  4XLN F;  3EDP A;  3KLN A;  1XD7 A;  3GFJ A;  4P9U A;  4B8X A;  3ABT A;  2LSO A;  4M73 A;  1XCB A;  3BJO A;  2KJB A;  3GFM A;  1KU3 A;  2K27 A;  3WU1 B;  1LQ1 A;  3TGN A;  1D5V A;  1S7A A;  3ERE D;  4MTD A;  1K7A A;  5AIP A;  4L0Y B;  2FRH A;  3RKY A;  3K0L A;  2FBK A;  5HS9 A;  3IWF A;  2YX4 A;  2UZK A;  2ZFW A;  3I53 A;  2X4H A;  1RNL A;  1F1Z A;  2F5F A;  4NB5 A;  2EB7 A;  2D1H A;  3IKV A;  4ESF A;  1YTY A;  3VOE A;  2A07 F;  1BI1 A;  4KUM A;  2WC2 A;  4LB5 A;  1SAX A;  3I58 A;  2GWR A;  2NAZ A;  5F1R A;  1WI9 A;  4IHS A;  3E6C C;  5E1W A;  3KP2 A;  3KP4 A;  2VBW A;  3QAH A;  1R1V A;  4G6D A;  1HKT A;  4FHT A;  5LHI A;  5D6F A;  3Q5F A;  1FSE A;  5BPD A;  1TW2 A;  5BQT A;  2M30 A;  3D0S A;  1LNW A;  2EA4 A;  2P7C B;  3RDI A;  5E18 F;  2IA2 A;  2VN2 A;  3GXO A;  1UHW A;  1RUN A;  5DYM A;  2FNP A;  1SD5 A;  3KP6 A;  3WGI A;  2E7X A;  1IUY A;  1E2X A;  4N0B A;  1YW9 A;  1OPC A;  2EV5 A;  1NHA A;  1D8J A;  2Z9O A;  3HRU A;  2GAU A;  1Q1H A;  3KEO A;  2H94 A;  1J0R A;  5KK1 A;  3RPU A;  5ICF A;  5LGT A;  1B1B A;  2RN7 A;  4HZF A;  1MJA A;  4KMF A;  2BGC A;  2VBX A;  4U0Y A;  3SZT A;  4YFX F;  1BJA A;  3KET A;  3OOP A;  2D2W A;  3EQL F;  3LA7 A;  4ESJ A;  4Q4Z F;  1J59 A;  1R5G A;  2B0L A;  4LG0 A;  1REP C;  4AVP A;  4M9S A;  1ZG5 A;  1QO0 D;  3MCZ A;  1KU9 A;  4PGH A;  2Q2E A;  2ZNZ A;  2ESH A;  3E6B A;  4KIC A;  1ZAR A;  4N9I A;  3BPX A;  2RDP A;  1KGS A;  3T8R A;  3U1D A;  2DTR A;  3ZPL A;  4ZYH A;  1A04 A;  4UXN A;  4HAM A;  3TQN A;  2ZO4 A;  3HSE A;  1LDK B;  4Z2Y A;  3GYH X;  2HQN A;  4OIP F;  5JFR A;  1MD0 A;  3GF2 A;  1FBQ A;  5DUI A;  3KFW X;  5CVJ A;  4Y13 A;  1FYL A;  4KFC A;  3D5L A;  1B9N A;  4OIN F;  4I02 A;  4WF2 A;  2AS5 F;  3EYY A;  2FNA A;  1FLI A;  5DD4 A;  2VC1 A;  1TQM A;  1ZRF A;  3FMR A;  1UHM A;  1T38 A;  4CYD A;  3ZMV A;  3CJN A;  2DQL A;  2OD5 A;  1R1T A;  4N9H A;  3M7G A;  2P5V A;  3DP7 A;  2UWM A;  4L5I A;  4P96 A;  1F4K A;  3WG9 A;  2LKP A;  3GZ6 A;  3F6V A;  2M1B A;  3SXY A;  5HS8 A;  4RB0 A;  3M9A A;  3QPH A;  1Z6R A;  2JPC A;  1FC3 A;  2YU3 A;  4L18 B;  1J9I A;  1SMT A;  4HLX A;  4L5J A;  1BOA A;  2PN6 A;  4A12 A;  5LHG A;  4MTE A;  4A2U A;  4RB1 A;  2ZXJ A;  2MC3 A;  1KYZ A;  3R4K A;  1D8K A;  4BHB A;  3FHZ A;  2EV0 A;  5HLI A;  2EFW A;  2F5E A;  2CGP A;  3QP6 A;  1I5Z A;  1STZ A;  4K2E A;  1R5H A;  5D6E A;  4JQF A;  4A6E A;  1IZ1 A;  3WTT C;  2DT5 A;  2JSC A;  5HLH A;  1J7K A;  4AIJ A;  1W7P A;  1ZGJ A;  4UHT A;  5E1Z B;  3KLO A;  1ULY A;  5CJ9 A;  3CO6 C;  4I09 A;  5FO5 A;  2XHK A;  3HUG A;  2MA3 A;  1ZG1 A;  3ABU A;  1L3L A;  1DUX C;  2YPR A;  5AON A;  2STW A;  2GQQ A;  3L2C A;  2XAF A;  5LRR A;  2QBY B;  3SQN A;  5L3G A;  2BEO A;  3F6O A;  4IVN A;  2VOP A;  2MD5 A;  3LA2 A;  1T98 A;  1DP7 P;  3F8C A;  2BBY A;  4LG0 B;  3C7J A;  1OR7 A;  4MHG A;  4EJW A;  4P9F A;  4EVI A;  2G9W A;  5D4S A;  2R7D A;  1U2W A;  3V8K A;  2Y75 A;  2Z5U A;  1S29 A;  5LRS A;  1QZZ A;  1HBX G;  2H6C A;  4EM2 A;  5HS7 A;  4GYG A;  3QRF F;  5CVV A;  2KIM A;  4M6Y A;  3TKY A;  5A2Q K;  1FT9 A;  4RB2 C;  1W5T A;  4O5V A;  4MEX F;  1XB4 A;  1HW2 A;  2VE9 A;  2V1U A;  4I98 B;  2NS0 A;  3K1P A;  3QU3 A;  1Z91 A;  3QU6 A;  1YG2 A;  3RYR A;  2JZY A;  3M8F A;  4ZYD A;  1S3J A;  1IN5 A;  5LEK A;  3TDU C;  2ACJ A;  2HFH A;  2QWW A;  3W6J B;  2D1V A;  4XSX F;  3V8J A;  3G3Z A;  2KIU A;  1ON1 A;  4ZH4 F;  2UXX A;  3R60 A;  3TO7 A;  3CO7 C;  5E20 A;  4RAY A;  2Y0M A;  3K69 A;  4CIC A;  3MAJ A;  1KQ8 A;  4IHT A;  4A6D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...