5DCMA

Structure of a lantibiotic response regulator: c-terminal domain of the nisin resistance regulator nsrr
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
97
structure length
97
Chain Sequence
ELTFGGFTLTREGLLSSQDKEVILSPTENKILSILLMHPKQVVSKESLLEKLWENDSFIDQNTLNVNMTRLRKKIVPIGFDYIHTVRGVGYLLQDPN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structure of the Response Regulator NsrR from Streptococcus agalactiae, Which Is Involved in Lantibiotic Resistance.
pubmed doi rcsb
source organism Streptococcus agalactiae
molecule tags Signaling protein
molecule keywords PhoB family transcriptional regulator
total genus 32
structure length 97
sequence length 97
ec nomenclature
pdb deposition date 2015-08-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00072 Response_reg Response regulator receiver domain
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5dcmA00
2EFQA 3T1BA 3ZMZA 4JBAA 2EWNA 4KMUX 2QUFA 3TOAA 1YQAA 2H6CA 2OBPA 5ILUA 3H3UA 1LJ9A 4KMFA 3GX4X 2HYFA 1IW7F 5CVRA 4DNCA 1QZYA 1U5TA 4LLGF 3ZQ7A 1XD7A 2WC2A 1MGTA 4HLYA 3V7RA 4L9JA 1AWCA 3HHGA 2ZFWA 2IP2A 2CO5A 2CYYA 3IKTA 4L5IA 3QU3A 3COAC 3BOQA 1FP1D 4I0BA 1KQ9A 2BEOA 1G3YA 2A69F 3HTUA 4AD9A 3TO6A 3C3WA 1R23A 1ON2A 3J81K 3HUGA 3I71A 2PJPA 3LA3A 3FM5A 4I09A 3SZTA 1ULYA 1T39A 1MKMA 2QENA 2VN2A 3KP5A 1TNSA 4KIGA 3J81Z 2QWWA 2YU3A 1EH7A 3KFWX 3WTVC 4UHTA 5ILVA 4HAMA 4RGRA 4JK1X 1S3JA 1HXDA 3NQOA 2H6BA 4A6EA 3IHUA 3QP5A 1A04A 4ZYGA 3TO9A 3J7AO 2ADUA 1MD0A 2Q8KA 4MEYF 2WV0A 2IT0A 2ZNZA 5HLIA 2OAZA 2COMA 3LA2A 1XGOA 3F22A 3GWZA 4YG2F 1I1SA 1ONVA 2LKPA 1SFUA 2UXXA 1ZRCA 4Q47A 2FXAA 3M9AA 1XSXA 3TQNA 2QQ9A 1XDSA 2EFWA 4P5OA 2DLLA 1CF7A 3RPQA 1KGSA 3GEZA 3FMRA 1H9TA 1IN5A 4ZH4F 4L5JA 1BC8C 3EQLF 2GWRA 2A68F 2DO7A 2CQKA 4RB0A 4LFUA 3O3KA 2FSWA 2HS5A 5ERIA 3RYRA 2PI0A 2PFBA 1JHHA 5E8IA 4ZYDA 1TNTA 1MJ9A 4IPAA 2FRHA 2FQ3A 2OQGA 5HS7A 5ICGA 4WK8F 1FYMA 3KZYA 3SHFA 4BH9A 4A2UA 4IF4A 4KUMA 5JFRA 4RB3C 2P5VA 1DPUA 1EH8A 2V9VA 3FMQA 1ZLKA 3FX3A 4MGRA 2NRAC 3RKXA 1BM9A 1SD5A 2W24A 2EK5A 4LB6B 1DP7P 4ASNA 4L9VA 2GA2A 3M8EA 3ML6A 3MFKA 4OOIA 1Q1HA 2JSCA 3KLNA 2X0LA 1WSUA 2P7VB 2PMUA 5HDNA 2C6YA 4R8HA 4G6DA 4RB2C 3BP8A 1KU7A 1I5ZA 4YIFA 2EV6A 4Y13A 3J80K 1WI9A 3SQNA 3ISPA 4EGZA 4IRGA 3EYIA 5DCFA 5DCMB 1YW9A 5AIQA 3F3XA 1O7LA 3CO6C 3GVAA 1O57A 3DFGA 1LQ1A 5LHIA 4HX8A 3L09A 4EM2A 5FO5A 4P9UA 1R1VA 2DQRA 2HQNA 2OZ6A 1EH6A 4PZJA 2BGCA 5E8GA 3ZMSA 2D45A 4OINF 4RGUA 3DF8A 2DK8A 1ZREA 2VBWA 2B0LA 3C18A 4AIJA 5BOXA 2LSOA 3TDUC 3LAPA 1AOYA 3LFKA 3JTHA 1QO0D 4O6JA 3KP7A 3QPTA 4K2EA 4M6XA 2CSOA 1T38A 3LSTA 4HV6A 1IUYA 4GYIA 2PN6A 2BV6A 2F5EA 3RKYA 3M1EA 1KU3A 2L3DA 2M30A 2L54A 2RGVA 1IXRC 3E5UA 1XCVA 1S6LA 1QQIA 3Q9SA 1NHAA 1FLIA 1R7JA 4CICA 2FEZA 1P4WA 2FNPA 1K6OA 4M9XA 4A0ZA 2ZMEB 4RS8A 1OPCA 2DTRA 1S7OA 4HBLA 3WE3A 4NB5A 2HKOA 5D6FA 2RDPA 2YX7A 5HLHA 2HEOA 4OIQF 4PCQA 3HIFA 3TO7A 4KN7X 2ZNYA 5DYMA 1SD4A 3PQKA 5E18F 4UV9A 4IHSA 5LBQA 1RUOA 1XMAA 5BMZA 3SZPA 1YS6A 5F1RA 1ZN2A 3BZ6A 2WTEA 3D0SA 3K1MA 5IT9Z 2FNAA 3WTUC 2NNNA 3EUHA 3FXUA 2G7HA 4PDKA 2G9WA 1H9GA 3F8FA 2JPBA 3QPHA 4I01A 2UWMA 3DQVC 1K79A 1D8JA 2VC0A 3S2WA 1W7PA 4CGZA 4M71A 1YIOA 2NYXA 5CVJA 2DK5A 1SAXA 3RIRA 4CHUA 3F23A 3REOA 5DUKA 4N9HA 1FBSA 3BROA 1D3YA 3GW2A 5AIPA 3IWFA 4FX4A 1K78A 4LGWA 3F21A 4KIBA 1ZG5A 4RAYA 4UV8A 2QQBA 2L4AA 2HTSA 1EV7A 1Z6RA 3CDHA 3NRVA 2YPRA 4M9ZA 3ULQB 3KLOA 1U6GA 4I7HA 1R22A 4Q4ZF 2PBIA 5L3DA 2MA3A 5ED4A 2IPQX 3ROUA 4HF2A 4ZZDA 5FD6A 2BBYA 3WE2A 2CFXA 3U9GA 4HDVA 1FBQA 2VE8A 3O6BB 2EB7A 5H6RA 3FF5A 1LEAA 5DV5A 5BPDA 2VOOA 1FX7A 1DDNA 5D8KB 3G73A 2XKOA 3RYPA 2F5CA 3DXJF 1FNNA 4HQMA 1P92A 3PQJA 4EGYA 1KYZA 3ECHA 3TKYA 4CXFA 3BPVA 3VOEA 2FOKA 4HA8A 5ICFA 3KE2A 5E17F 4BHCA 5E1WA 4EJOA 2XUBA 2VBXA 1R58A 1SD6A 3I0TA 4LMYA 1O3TA 4ENJA 1TTYA 4ZYHA 3R6SA 2STTA 2K7LA 3GLXA 4ESBA 3L7WA 1YW8A 4EV0A 4L9TA 1F1ZA 4IRHA 1D8KA 3HOTA 2OZUA 5HDKA 4OIOF 5CVVA 3HYIA 2FA5A 3TGNA 2O8XA 1F5TA 5DD8A 4WF2A 1Z7UA 5LLQA 4HV5A 1G6NA 4UUVA 5K1YA 1B9NA 4OMYA 4N0BA 1ZRFA 2F5DA 4YFNF 4IRIA 4EJWA 2P7CB 2CWEA 1L0OC 1RI7A 1TQPA 3JW4A 1F9NA 3VEPA 3CUQB 1E2XA 4MHGA 4IVNA 4GCVA 1KQ0A 2YX4A 3HSFA 2UZKA 3GZ5A 1SMYF 2FBHA 4HZFA 3AAFA 1TBXA 1O7FA 5HDGA 4WXCA 3GO5A 4HX7A 4QLCU 3DEUA 5L3EA 2VONA 1KYWA 3JSOA 4MQVA 3GFMA 4CO8A 4EMSA 2O61A 3FXRA 5D5XB 4HOBA 4BXUA 1RIOH 1BJAA 1ZGAA 2J5OA 2VBZA 2M1BA 1R5GA 2DW4A 5HLGA 1QBJA 2YSRA 1Z91A 2ELHA 5KK1A 4EJUA 1XSDA 2MH9A 3R0AA 4UXNA 1YW7A 2E1CA 2HFHA 1IN4A 1R00A 5E1XA 1HKSA 1MZBA 2Z3YA 1P4AA 2PLYA 3P9IA 3WG9A 4EJTA 1Z05A 3F6VA 1P4XA 3GFIA 4G9YA 4U0WA 2D1VA 1HSJA 3QAHA 5CVIA 2KRFA 1S29A 4HW0A 4CDGA 2CGPA 2A6HF 2IVMA 1ODDA 2DFIA 4U0VA 4S05A 1JE8A 2ZO4A 3GF2A 5D6EA 2MC3A 1Y0UA 4KFCA 1XMKA 5D5VB 1I27A 2HTJA 2V1DA 4I0AA 4B09A 3P7NA 1T2KA 3KETA 4D0PA 5FD5A 2P5LC 1PUEE 3B73A 4EVIA 2FBIA 5KVRA 2K4BA 3IRRA 4IXAA 2ZXJA 2K02A 3TOBA 3DKWA 3WU0A 4B8XA 2STWA 2K86A 5AONA 3T0YA 1FSEA 5JI6A 2JTVA 3WTYC 3LQRA 1PP8F 5ICCA 1P6RA 3R0JA 1SFEA 2UXNA 3Q5FA 1UHMA 4ON0A 1YTYA 5D5UB 1FY7A 2ZCWA 2EJRA 3C1DA 4MNUA 4G94A 3F8MA 1W7PB 3RTRA 2RVCA 3I59B 3HSRA 4MTDA 3CTAA 2OA4A 1B6AA 2QVOA 2Z5UA 1OYYA 1OYWA 2W84A 1RZ4A 3ZMTA 2JPCA 3V8LA 2DPUA 1FYKA 3I5UA 3HRUA 2QQAA 3ABTA 3MWMA 2VT2A 1J5YA 2E7WA 3E3VA 3FWEA 2NS0A 4TV7A 3L00A 2LF7A 2FU4A 1XGSA 5BQTA 2MLKA 4IHTA 1J59A 3H92A 4WXDA 1DUXC 1ZRDA 1FC3A 2X4HA 1XGNA 2RC4A 2ACJA 2NAZA 1MJBA 5LRSA 4U88A 2XV4S 4KDPA 5FLXK 2D1HA 4L0YB 1GHCA 1IN6A 2P8TA 4EJVA 4G7OF 3G3ZA 1ZG1A 2OU2A 3GZ6A 5IT9K 3Q9VA 3U1DA 1SMTA 5LHGA 2HGCA 2MBFA 4LG0A 3HRSA 2XGXA 5FLXZ 1LDJA 3GUDA 2YR2A 1T0FA 3RI4A 4CYDA 2LNBA 3HHHA 3E6DA 3V7SA 2F2EA 2PEXA 4M74A 1V4RA 3BJ6A 5JR3A 4Y17A 4G7ZF 3P9CA 1F4KA 2QYOA 4ZZLA 4HQEA 4H0EA 5CJ9A 4DQ2A 3ZP5A 4M6YA 4WX9A 4LB5A 2GXBA 4OIRF 2VE9A 2XKPA 1HKQA 6PAXA 2O3FA 4FT8A 3KP6A 2W25A 2WWYA 1V3FA 4ZYEA 1BOAA 1SFXA 2OD5A 4A5NA 4M9SA 4YFKF 1IRGA 3E6BA 4G6QA 3LQQA 2IJLA 2QZ8A 3CJNA 2VC1A 5L3FA 3IL2A 3IWZA 4P9FA 5LGTA 3R4KA 4HLXA 4XBFA 2XAHA 3VFZA 1QNTA 1UCRA 5A2QZ 3ABUA 1FOKA 5K5RA 3DP7A 5DCMA 2J5PA 1HW1A 4WXHA 3WGGA 3E5QA 2MD5A 1WWXA 2ETHA 1WQ2A 4BHBA 3WGIA 3V8JA 4AIHA 3KEOA 4WWCA 4LD5A 1IN8A 2V1UA 1JXSA 2XVCA 1BI3A 3RJPA 3WU1B 3VODA 1IXCA 3T5XA 2XIGA 2EA2A 1BN5A 2O0YA 1HKTA 3LA7A 1JGSA 5DUIA 2H27A 1GVJA 2D2WA 1YO5C 2QM3A 2GQQA 4L0ZB 5LGUA 4BAYA 4M73A 2QBYA 1FZPB 3V4GA 1BI2A 1BI0A 1DPRA 1LDDA 1BIBA 2HDCA 1G4DA 3BWGA 5DDGA 1REPC 3MZHA 4BNCA 3KCCA 1ZH5A 2DI3A 4GXOA 2JT1A 4HDUA 5HS8A 2DU9A 2CG4A 2ISZA 2HZTA 1FT9A 2E1NA 2A5YB 1ON1A 4XRFA 1SD7A 1TLHB 3IRQA 1ZG3A 1R36A 4KICA 1MDMB 2HR3A 5L3GA 2A6EF 1BIAA 1ZGJA 1FWZA 3JAMZ 4GYGA 5D5WB 2BE5F 4EM0B 2IA0A 1HW5A 1G3TA 3K9TA 2P4WA 5HVQC 2GAUA 1W5SA 3MEXA 3KZZA 4Q5SF 1G3WA 2GIVA 3JAMK 5LEJA 1ZYRF 1TW3A 4EQQA 3RKWA 1XGMA 4AVPA 2GA1A 2ESHA 2KKOA 4KA4A 1CF7B 3WTXC 1I1GA 4OMZA 4HYEA 5LEKA 1RNLA 4PGHA 1W5TA 5H6QA 4A5MA 1LEBA 1FP2A 1OMIA 3ZN0A 1S8NA 1LDKB 3DPTA 1FPQA 2TDXA 1MDMA 1B1BA 4O5VA 4XLNF 1IF1A 3FXQA 2L02A 4Y15A 1UHWA 3I58A 2IRFG 2Q2EA 3ZMVA 3HOSA 3R60A 2R7FA 4L9NA 2ZBKA 1XN7A 3JSPA 3ZN1A 2ZJ2A 5FFZA 1QGPA 4F7ZA 3F8NA 3M8FA 2PG4A 4I02A 3GXOA 1LVAA 5F6FA 1X3UA 2HWVA 3EETA 2FMLA 4CZZA 2KIMA 2O03A 2DPDA 2R7DA 4KIFA 3HSEA 1W4MA 3E6CC 4LG0B 3P9KA 3T8TA 3QU6A 3IC7A 1IAWA 3FZVA 3ERED 2RKHA 2RN7A 2M8EA 3BJOA 1Z9CA 2DQLA 2P5KA 5DD4A 3QRFF 1TQIA 2K27A 3EDPA 3QP6A 4NHJA 4S04A 2P6TA 2Y48A 3VB2A 1XCBA 2FMYA 4KN4X 1XDUA 5HS9A 3EYYA 2DAOA 2VBYA 1R5HA 2IA2A 2XRNA 2FBKA 1YFHA 4PGGA 2L4MA 2HKXA 3F8BA 1IXSB 4G7HF 1KQ8A 3D5LA 4LK1F 2XASA 1JHFA 5L3BA 2HOEA 4HF1A 1S7AA 1ZHFA 1TW2A 3FM3A 1FYLA 3K69A 1U8RA 3WTWC 4UVCA 4BYYA 2P6SA 5TJJA 1ZARA 4JQFA 1J2XA 1OYIA 5CLSA 3RDIA 4A12A 5CYVA 4U7BA 3H3ZA 1HSTA 3F6OA 1IN7A 3W6JB 3U2RA 2XAJA 2H94A 3WODF 1B59A 4R1HA 3B02A 3HRTA 3CUOA 2Z9OA 3ELKA 4EM1A 2EV5A 5D8LB 2A3SA 3SFZA 4GO1A 1LB2A 5BS6A 2PMHA 3F72A 4HX4A 1U5TC 5E20A 5E1ZB 5K5OA 3MZYA 2BYVE 3WTZA 5ICEA 3WTTC 1J0RA 4O3MA 2A61A 4OIPF 2RQPA 2NNYA 4LLLA 3LAJA 3CUQA 5D4RA 4MTEA 3FHZA 2ZMEA 3E97A 3J80Z 2EFPA 2VODA 2EA4A 2FF4A 1L3LA 2R3SA 4YIIA 3GYHX 1P2FA 4XSXF 3ZMUA 4OU0A 3IKVA 4RGSA 2AS5F 4WCGA 4RAZA 1HBXG 2JRTA 2V79A 2ESNA 3KEQA 1Z1DA 4I98B 5ILSA 2LDUA 2HYGD 4KNYA 4BQAA 3L9FA 1K78B 2IW5A 2EFOA 4ESFA 3L2CA 1FBUA 3PFIA 5FGMA 1LNWA 5FB2A 4UVBA 3GFLA 4ETSA 4U7DA 3R61A 1O3SA 5J8CA 2RV8A 2Z33A 2QLZA 1U78A 1GXQA 3I64A 3CO7C 4RGXA 4L18B 1UFMA 1O3RA 4LK0F 2MLGA 4G8XA 3V8KA 5D4SA 5J8FA 3MCZA 5K5QA 2ZKZA 3DV8A 1BI1A 1H0MA 3NEUA 1E17A 3OV8A 5A2QK 1J75A 4LLNA 2XHKA 5J6XA 4XLPF 4XSZF 1FSHA 2XAFA 4KT5C 1OKRA 1CGPA 1KU9A 1MJAA 2OQRA 1TQMA 1BC7C 2Y75A 2M45A 4E70A 4ENMA 5BPIA 3ECOA 3K1PA 2ISYA 3O2PE 4YFXF 1USTA 2L01A 1UB9A 1I6XA 5EEGA 3CUQC 1PDNC 2VT3A 5LGNA 2W57A 2JZYA 1R1TA 5TRDA 3GFJA 1KA8A 4FHTA 1U5TB 5LHHA 2VOPA 1HW2A 2IA1A 3K0LA 1Z6TA 3BJAA 1W7PD 3WGHA 1XSVA 4ENKA 4GGGA 1J7KA 1R1UA 1B4AA 5DEQA 3E5XA 3I59A 2KIUA 3ZPLA 5EEHA 4Z2YA 1QPMA 2KJCA 1J9IA 4MQ9F 4N9IA 3KP3A 3K1NA 5CVUA 1WRJA 3MAJA 1D5VA 4LJZF 3M7GA 2Q0OA 3BDDA 5F64A 4NQWA 4A0XA 4KYWA 2K4JA 3ZMDA 2HQRA 3BY6A 2G7UA 4HF0A 4ENNA 1HQCA 3FMSA 1U3EM 3CLOA 3BPXA 4QWQA 2A07F 4RB1A 5HOOA 1ZAOA 3K2ZA 1YG2A 3SXYA 4I2OA 2V1XA 3T8RA 2VXZA 1K7AA 1T98A 4ESJA 4BHPA 1KU2A 3RPUA 4UNOA 1YS7A 3F8CA 5FFXA 1YYVA 1O3QA 2XAQA 3C7JA 4P96A 3OOPA 4AIKA 3I54A 3N97A 1YLFA 3TDZC 1U2WA 2GZWA 3KP4A 1STZA 4MEXF 4UVAA 1GXPA 1G3SA 2DT5A 1IRFA 2M87A 2CW0F 4Q48A 2W85A 4P55A 2KIFA 4AWXB 3HRMA 2RNJA 1WKMA 2H09A 1ZLJA 1USSA 3I4PA 1XB4A 2GXGA 1OR7A 3LWFA 3I53A 1VTNC 3WTSC 5LRRA 1QZZA 1T6SA 2FE3A 2KJBA 3KP2A 4M72A 1BBYA 1IZ1A 2LF8A 3N4MA 3W6KB 2E7XA 5IT3A 3DPLC 3E6MA 4U0YA 4R79A 2EV0A 2Z99A 2V6CA 3HTSB 2XAGA 4A6DA 2XROA 1C0WA 2M5WA 5L3CA 3JTGA 5H20A 2PQ8A 2EFNA 2DBBA 3MQ0A 2QBYB 2Y0MA 2MH2A 2AXLA 1RUNA 1B9MA 3V7CA 4IJAA 5JHUA 5JVTA 3QOPA 1PP7U 2O6GE 4FX0A 2F5FA 4A0YA
chains in the Genus database with same CATH superfamily
2EFQA 2XPVA 3T1BA 3ZMZA 2HI3A 2R93J 4JBAA 2EWNA 1W5CC 4KMUX 2QUFA 3TOAA 1ETOA 1YQAA 4LITA 1IUFA 3OYLA 2H6CA 2OBPA 5ILUA 1LFBA 5M5WJ 2LG4A 3H3UA 1LJ9A 4XLCA 2W4SA 3CCRI 3GX4X 4KMFA 1OCTC 2HYFA 2LYCA 1HDDC 1IW7F 5CVRA 4DNCA 1X1DA 1U5TA 1QZYA 4LLGF 3SDGA 4V19K 4LIVA 1T56A 5TISC 4XM3A 5B1BH 1XD7A 3BR1A 2WC2A 3ZQ7A 4D5FA 1N77A 1MGTA 4HLYA 1GT0C 4BQOA 3V7RA 4L9JA 4BUPA 1AWCA 3HHGA 3ONQA 2ZFWA 3CCJI 2IP2A 2MW8A 2CO5A 2CYYA 3Q0VA 3IKTA 3OYAA 1R6RA 4DZJA 4L5IA 3QU3A 4C2UA 3COAC 4BJTA 3BOQA 5GPAA 1FP1D 2ELJA 1G2HA 4I0BA 2H1LA 1KQ9A 2BEOA 1G3YA 2HOTA 4E7HA 2M0CA 3ZOBA 3CCMI 2A69F 3HDDA 2X1EA 3S16J 3HTUA 2NVQJ 4AD9A 1SVMA 2R7UA 3KIOA 3TO6A 3C3WA 1R23A 1ON2A 2LKSA 4AYBN 1OR7C 3HUGA 3J81K 1VQ7I 5DS9A 3I71A 2PJPA 3LA3A 3FM5A 4I09A 1JUMA 3FBNB 2WB1A 3SZTA 3JRGA 1ULYA 1T39A 2ZXWH 1MKMA 2E1OA 1LVKA 2QENA 2VN2A 5BNGA 3GTGJ 1P7JA 3KP5A 4PFPA 3QYEA 1TNSA 4KIGA 2P0WA 2WA0A 3J81Z 1GUUA 2DA6A 3I3LA 2CRGA 4AM3A 1QVTA 2BY3A 2QWWA 1EH7A 2YU3A 3KFWX 3WTVC 2R0QC 3KEYA 4UHTA 2DYSH 4XKWA 5ILVA 4HAMA 5M5XJ 4RGRA 4JK1X 4A3DJ 2IS6A 1S3JA 1HXDA 3NQOA 1P9QC 2H6BA 4G12A 4A6EA 3BG7A 3ZQCA 3IHUA 3VYTB 3QP5A 1A04A 4ZYGA 2CQQA 3TO9A 3J7AO 1X19A 2MD0A 2ADUA 1MD0A 2KRCA 2Q8KA 1AHDP 4IHXA 4D1QA 4MEYF 2WV0A 2M7AA 2IT0A 2ZNZA 3UKGA 5HLIA 3B6AA 3DBRB 4M3FA 2AQFA 2DMNA 2OAZA 1MNEA 2COMA 3LA2A 4RBOA 3GTKJ 5FRMA 3S15J 1XGOA 3F22A 3GWZA 2FQ4A 2O5RA 1T95A 2LH9A 4MO7A 1LFPA 2LP0A 4YG2F 1H8AC 1I1SA 4KITB 1S9HA 3D5RC 3DU6A 1ONVA 2Y9YA 4GDFA 2LKPA 1SFUA 2UXXA 3Q3SA 2RNGA 1ZRCA 1H88C 3G6EI 4Q47A 2FXAA 2JRMA 2HPMA 2JVGA 3M9AA 1PVEA 1XSXA 3TQNA 1XX5A 2QQ9A 3CP8A 1XDSA 3K4JA 2EFWA 4P5OA 2DLLA 4X1EA 3BG3A 2KDOA 3EUHC 1CF7A 4L5EA 3MKLA 3RPQA 4CUGA 3H9JA 2VQCA 1KGSA 2I8DA 1POGA 3FMRA 3GEZA 1H9TA 2EIMH 2HQAA 1IRZA 2EZLA 1IN5A 2X1CA 1Y56A 4V2FA 4ZH4F 4E7SA 4L5JA 4XOPA 5M3MJ 1BC8C 3EQLF 5E3LA 2GWRA 4QIWN 3CCVI 3CCSI 2A68F 3O8HA 2DO7A 2CQKA 4RB0A 4PJLA 4LFUA 3FKJA 3O3KA 1QU3A 2Y9ZA 2FSWA 2HS5A 1OFCX 5ERIA 1B8IB 1BR2A 3RYRA 2CW7A 2PFBA 2PI0A 1JHHA 3MVPA 5E8IA 3FK6A 3FXOA 4RDUA 2XAUA 2OTJI 2R5ZA 4N4OB 4A93J 4ZYDA 1Z21A 1TNTA 4ZDPA 1MJ9A 4IPAA 4XOTA 2FRHA 2FQ3A 3SFIA 3FXKA 2OQGA 4II3A 2DFEA 3I56I 5HS7A 5FJ8J 3J7YJ 2L9RA 5ICGA 2H8RA 1Z77A 2LRDA 4D9JA 2WY7Q 4WK8F 1FYMA 3KZYA 3SHFA 2L9NA 4A3CJ 4BH9A 4A2UA 4IF4A 4XKCA 4KUMA 3HOXJ 4PJ0C 2NOGA 3VPRA 5JFRA 4F92B 4RB3C 2P5VA 1DPUA 1EH8A 2IGKA 2V9VA 4BU2A 3FMQA 1ZLKA 1D0XA 2IS2A 3FX3A 4MGRA 3RKXA 1Y1WJ 2NRAC 1BM9A 1SD5A 2W24A 2EK5A 3G2BA 3FHNA 1WJAA 4LB6B 4CCOA 1MIJA 1V5FA 1DP7P 4ASNA 4L9VA 2DA5A 2GA2A 3M8EA 2EZKA 3ML6A 3MFKA 4OOIA 3AL0B 1Q1HA 3CP2A 2JSCA 3KLNA 5K7FA 3L1PA 4AYBA 2BW3B 2X0LA 1WSUA 2P7VB 2COBA 2L7FP 2PMUA 5HDNA 3S3OA 2C6YA 3H35A 4R8HA 4G6DA 4RB2C 2R7VA 1FMWA 3BP8A 1KU7A 1I5ZA 1X2NA 4YIFA 2EV6A 4Y13A 3OS1A 3J80K 1UG2A 4QSHA 1WI9A 3SQNA 4BXXJ 3JR9A 4C2TA 1ETYA 2F5VA 3PM1A 1FOYA 3ISPA 4B3AA 4EGZA 4IRGA 1A5JA 3EYIA 5DCFA 5DCMB 1YW9A 5AIQA 1BL0A 2BVLA 2E19A 3F3XA 1O7LA 3CO6C 1JKPC 2V6EA 1T8IA 3GVAA 4A3KJ 1O57A 1DU6A 3H0GJ 3DFGA 1RR7A 2QF7A 1LQ1A 2NVYJ 5LHIA 4HX8A 5GADJ 3L09A 1D1AA 1WJDA 5J3LA 4EM2A 5FO5A 4P9UA 4Z6YA 1M1EB 1R1VA 3H0DA 3C2GA 2DQRA 2HQNA 1Y8RB 2ID3A 2OZ6A 1D0ZA 1EH6A 1X4PA 4PZJA 1XS9A 1LFUP 2BGCA 4PFOA 2QSGX 5E8GA 3ZMSA 2LBFA 2D45A 4OINF 1XC5A 4RGUA 3DF8A 3L2QA 2DK8A 3GTPJ 3OOUA 4B43A 1ZREA 1HDPA 2VBWA 3MD2A 3RQ4A 1ERDA 1BW6A 2B0LA 3C18A 4AIJA 5BOXA 2LSOA 3TDUC 3LAPA 3CJRB 5CQGA 1AOYA 2Y2ZA 3LFKA 1K6YA 3JTHA 4XRSA 2EH3A 3PFYA 1I6HJ 2OTLI 1QO0D 4O6JA 4C3HJ 2ECBA 3KP7A 3QPTA 5IPAA 2RAEA 4K2EA 2QSHX 4M6XA 3G4SI 4M3GA 2CSOA 3ZRGA 1T38A 1MNDA 2O8KA 4B3XA 2JJ7A 3LSTA 3SEZA 3DLAA 4E7LA 4HV6A 4IHVA 1IV6A 2B9SA 1ZR2A 1WGXA 5JLXA 1IUYA 2HVRA 3MKZA 4BEHB 3L2VA 3LSPA 3Q0WA 4GYIA 2PN6A 2R5YB 1D1BA 2BV6A 2F5EA 2W1OA 4BDYA 1U8BA 3RKYA 3M1EA 1KU3A 3WG7H 5F27A 2L3DA 4XIDA 4I99C 2M30A 1I3QJ 2L54A 2RGVA 1EKEA 1IXRC 2XGDA 3E5UA 1VZ0A 1XCVA 5F0CA 5B1AH 1R5ID 4B48A 1S6LA 1QQIA 3OIPA 3Q9SA 3QQAA 1J09A 1NHAA 2LY2A 2CFOA 1NK2P 1MMSA 2HOAA 1R7JA 4F55A 1FLIA 4CICA 2FEZA 1P4WA 2QEXI 2R4GA 2E1MC 1UHSA 3RZOJ 2FNPA 1K6OA 4M9XA 3OS0A 4A0ZA 3H5RA 2ZMEB 4HPQA 3QPSA 4RS8A 3OYHA 2GM4A 1OPCA 2BOLA 2DTRA 1VNDA 4PUSA 4BBSJ 4A3BJ 1R4NB 1S7OA 4HBLA 4ANJA 5IY5H 3WE3A 4NB5A 4KISA 2HKOA 5D6FA 1R9TJ 4CA0A 2RDPA 2YX7A 4JOMA 3OY9A 2LR8A 2VXDA 5HLHA 2HEOA 4OIQF 4PCQA 3HIFA 1TT0A 3TO7A 2ID6A 4KN7X 1FMVA 3FK7A 3A0HC 3OYBA 2CV0A 2ZNYA 1TP4A 2KDZA 1F36A 1Z0XA 5DYMA 1SD4A 3PQKA 1OCPA 2QGUA 2V26A 5E18F 4UV9A 3O8GA 4IHSA 5LBQA 1WJ5A 2LMDA 2DA2A 2YS9A 1RUOA 2ME0A 1XMAA 3VYRB 3PIPF 1YHQI 1ZGWA 5BMZA 3N05A 4OAYA 3SZPA 4YRVA 3H3VK 4NNJA 1YS6A 5F1RA 3FXLA 1ZN2A 3BZ6A 2WTEA 3MKWB 1WJCA 3IAM2 3D0SA 4ITVA 2HPIA 3DCFA 3ASOH 3K1MA 5KAFC 5IT9Z 3M4OJ 3PNVA 2FNAA 2JVHA 4E7IA 3WTUC 2NNNA 3BTLA 3EUHA 3FXUA 2G7HA 4PDKA 2E71A 2OPTA 1K61A 2G9WA 1H9GA 3F8FA 2XC7A 4RAFA 2JPBA 3QPHA 3HC7A 4I01A 3TP0A 4V2GA 4C9YA 2UWMA 3DQVC 2V9KA 2F4OB 2BZTA 3H9QA 1K79A 2JQ7A 2DT7B 2HXIA 4XKVA 1D8JA 1SVOA 2VC0A 4HSRA 1LE8B 3BT9A 3S2WA 2MSYA 3SDBA 1W7PA 2MFZA 5FLVA 1Y1VJ 3L2RA 4I76A 4M71A 4CGZA 1YIOA 3ZR8X 2NYXA 5CVJA 3HOWJ 4F91B 3JRIA 2DK5A 3MMYB 1G8XA 1SAXA 3RIRA 4CHUA 2HVQA 3F23A 3REOA 2DMQA 1ETXA 3CLQA 5DUKA 4N9HA 4BEHA 1FBSA 2Z1DA 3BROA 1D3YA 3GW2A 5AIPA 2ZSIB 3IWFA 4FX4A 1K78A 2LKXA 1CQTA 1YOVB 3M3YJ 2UUZA 2V1NA 4LGWA 2K9MA 3F21A 2E60A 2RQQA 3D1NI 4KIBA 3LSGA 2HYJA 4M3BA 1ZG5A 2JA7J 4C3IJ 2E2JJ 3BZKA 4RAYA 4UV8A 2E35A 2QQBA 2L4AA 2HTSA 1EV7A 1Z6RA 3CDHA 3K70D 3NRVA 1JKOC 2YPRA 4M9ZA 3ULQB 1YJWI 2V4JC 3KLOA 3UR3C 4NDLA 4ZDOA 1U6GA 4A3EJ 4I7HA 2XRLA 4XRSG 1R22A 2DODA 4Q4ZF 2PBIA 5L3DA 2MA3A 2QQ8A 5ED4A 1RESA 1FIPA 3OIQA 4UUSB 3HOUJ 2KT0A 3OYNA 1X1AA 2IPQX 2Y30A 3ROUA 4HF2A 2WBMA 4ZZDA 4QPQA 5FD6A 1S7EA 2BBYA 3WE2A 2CFXA 3U9GA 3JRHA 4HDVA 1FBQA 2VE8A 2GLOA 3O6BB 2CV2A 2EB7A 2FUG2 5H6RA 1SC7A 3FF5A 3IP4B 1LEAA 5DV5A 2ELKA 5BPDA 5IYDJ 3OSGA 2M9HA 2QSFX 1N25A 1FX7A 3HKZN 1DDNA 2VOOA 5D8KB 1V54H 2ZMEC 3G73A 2XKOA 2FD5A 3D5SC 2CJJA 2E1MB 1MNMC 3HXLA 3RYPA 2F5CA 2IS1A 1SFOJ 3DXJF 2L7KA 1FNNA 4HQMA 1P92A 1MMAA 3PQJA 3K4KA 4EGYA 4FE4A 1KYZA 5C3EJ 2NVTJ 3ECHA 3TKYA 4CXFA 3BPVA 3VOEA 2FOKA 4HA8A 1IRXA 5ICFA 3KE2A 2W48A 4MIMA 5E17F 1IV8A 1O4XA 4BHCA 5E1WA 3G1OA 2F4MB 4EJOA 1I50J 2XUBA 2VBXA 1R58A 1SD6A 3G1MA 3I0TA 4LMYA 1O3TA 3JCUC 4ENJA 3HEFA 1OLTA 1TTYA 4ZYHA 5HLTA 3R6SA 3BTJA 2STTA 2WB1N 2K7LA 3GLXA 4ESBA 3L7WA 4IL6C 2ICWG 1YW8A 4EV0A 4L9TA 4UB8C 1F1ZA 1VQOI 4IRHA 2EZIA 3OYIA 1D8KA 3BG6A 3HOTA 1TWHJ 2OZUA 5HDKA 4OIOF 5CVVA 2DTZA 3HYIA 2K9SA 3F0CA 2FA5A 2VQLA 3TGNA 4H4KC 4X0GA 2OF7A 2O8XA 4J01A 1F5TA 5DD8A 4WF2A 3DTIA 1R4MB 1Z7UA 2XB0X 2NXNB 5LLQA 5FLMJ 4DBRA 4HV5A 1G6NA 3CC2I 5H2FC 4UUVA 2NVUB 5K1YA 1B9NA 2DXIA 4HNTA 4OMYA 4N0BA 1ZRFA 2F5DA 1BR4A 3GTLJ 1JJ8C 5DM7F 4YFNF 3OIOA 4IRIA 4U87A 4EJWA 2VQGA 2P7CB 2CWEA 1L0OC 1RI7A 1TQPA 3JW4A 1F9NA 3VEPA 2A05A 5GP9A 3CUQB 1E2XA 4MHGA 1TWCJ 3CQZJ 4IVNA 1SFKA 1UMQA 3BZCA 4GCVA 3WU2C 1VQ9I 1OCZH 1KQ0A 2YX4A 3HSFA 1IG7A 4NC7A 5C4JJ 2UZKA 3GZ5A 4RLFA 4EATA 4YELA 1SMYF 2FBHA 3LSIA 4HZFA 2CUEA 3AAFA 5KAIC 1TBXA 1O7FA 2CQ7A 5HDGA 4JP0A 4WXCA 5F04A 3GO5A 2PMZA 4HX7A 4XN0A 1PJRA 3IV5A 1D5YA 4QLCU 1BR1A 3DEUA 5L3EA 4QTRA 3HJEA 3M8JA 3DKXA 2VONA 1KYWA 3KYLA 3JSOA 2NS8A 4MQVA 3GFMA 3BLYA 2NS7A 4CO8A 2F4IA 4EMSA 2O61A 4MLOA 3FXRA 2X1DA 2JMWA 5D5XB 4HOBA 2X6XA 4BXUA 1RIOH 2KL4A 1BJAA 1UELB 1MSEC 3BG9A 3OL3A 2YU9J 5J1YA 1ZGAA 2L7MP 3FIWA 2J5OA 2X9DA 2VBZA 1W0TA 2R5ZB 2M1BA 2CQNA 1ORKA 1R5GA 2DW4A 1P7IA 5HLGA 2XGCA 1QBJA 1ACIA 1XG1A 2YSRA 1Z91A 4A3IJ 2IBDA 2ELHA 5KK1A 1WFXA 4EJUA 2XPUA 4Y7NJ 2IXSA 5J4YA 2AXTC 1XSDA 3F9KA 2MH9A 3R0AA 2CUFA 2R5YA 1V5EA 4F52A 2VKEA 1YW7A 2W00A 4UXNA 2E1CA 2HFHA 1IN4A 1ZTRA 1YJ9I 3K6GA 1R00A 3WHCA 5E1XA 1HKSA 1MZBA 2Z3YA 3W3CA 4BE2A 1P4AA 2PLYA 1XPXA 2NOJB 3P9IA 3WG9A 3S17J 4EJTA 2EQRA 1Z05A 2L7ZA 2TCTA 1B72B 2E2HJ 3F6VA 1P4XA 1GV2A 4G9YA 4U0WA 3GFIA 2D1VA 1HSJA 3QAHA 5CVIA 1JGGA 2KRFA 1S29A 4HW0A 4CDGA 2CGPA 3JRAA 2VQHA 3FKIJ 2K3FA 2A6HF 2L5QA 3NAUA 2IVMA 4LIUA 4ZC3A 4DZPA 4UB6C 1ODDA 4P1WA 4BJ6C 2HOSA 3HOZJ 2DFIA 4U0VA 4S05A 1JE8A 2XSDC 2ZO4A 3GF2A 5FKLA 1GVDA 5D6EA 2MC3A 1Y0UA 2EPFA 4KFCA 4FISA 2DA3A 1XMKA 5D5VB 1I27A 2HTJA 1Z3YA 2V1DA 4I0AA 4BJ5C 4B09A 1R49A 3P7NA 1T2KA 3KETA 1MBKA 5FD5A 4D0PA 4FE7A 2P5LC 1QA6A 1PUEE 3G71I 1ENHA 3B73A 4HEA2 2FJ1A 2FBIA 5KVRA 4EVIA 2K4BA 3IRRA 2QKLB 4IXAA 2ZXJA 3SZGA 2K02A 3TOBA 3DKWA 3WU0A 4B8XA 2HXOA 1UG0A 4IQ4A 2STWA 2HZDA 2R92J 1N75A 1JKQC 3CF5F 2K86A 5AONA 3T0YA 1FSEA 5JI6A 4UUSA 1T08B 4AIDA 4B47A 3PIOF 2JTVA 3WTYC 3LQRA 1MW7A 5ICCA 1PP8F 1P6RA 3R0JA 1SFEA 2UXNA 1A35A 3Q5FA 1UHMA 2CU7A 2XF7A 1W0UA 3PSFA 2HVSA 2DDBA 1TT5B 4ON0A 1YTYA 5J47A 5D5UB 2PX9A 1FY7A 2WY8Q 1VQ5I 2DT6A 2ZCWA 2EJRA 4J19A 4BACA 4F93B 3C1DA 1RETA 4MNUA 3W2WA 2IGNA 3OYGA 1B8IA 4G94A 4CCJA 3F8MA 5FRNA 2G0EA 2I5UA 1W7PB 3RTRA 2RVCA 4J00A 4Y52J 3I59B 4JX4A 3HSRA 2KZGA 4MTDA 3CTAA 2VB6A 2OA4A 3A02A 2OV7A 1B6AA 4NUBA 2QVOA 2Z5UA 3L2WA 1OYYA 5J1RA 1MBEA 1OYWA 2W84A 1RZ4A 3SJMA 3ZMTA 2JPCA 4NC6A 3OL4A 1X2MA 4RM3A 3V8LA 5IOZA 1MSFC 2Y69H 2E5NA 3DLLF 2DPUA 1FYKA 4XONA 2A6TA 1Z67A 3KYCB 3I5UA 3NARA 3JRFA 3HRUA 2QQAA 3ABTA 2VJJA 2EIKH 3MWMA 2E5ZA 1J5YA 2VT2A 2EIJH 2E7WA 3E3VA 3FWEA 2XB5A 3LSKA 2K9LA 2NS0A 4CCLA 4TV7A 2MYSA 1TWAJ 3L00A 2LF7A 3PJRA 2FU4A 1XGSA 3FXMA 2XF6A 5BQTA 2Y0SA 2MLKA 1U9NA 4IHTA 2V7FA 4ABZA 3A01B 1J59A 1VQNI 3H92A 1FOWA 4WXDA 1DUXC 2CMPA 1ZRDA 1FC3A 4E7KA 5C44J 1GLNA 2VASA 2X4HA 4CH7A 9ANTA 1XGNA 2RC4A 3DWLE 4AVZA 2ACJA 3CESA 2NAZA 1MJBA 1PUFA 4BE1A 5LRSA 1JI8A 4U88A 2XV4S 4KDPA 3DEEA 2Y31A 3X2QH 5FLXK 2D1HA 4E4HA 4L0YB 1GHCA 5F08A 1IN6A 3ZCOA 1K4TA 2P8TA 4EJVA 3BTIA 3Q0UA 2M8GX 3DU5A 3GLLA 4G7OF 3G3ZA 5EGOB 3CMYA 1ZG1A 5CPRB 2OU2A 1Y39A 3GZ6A 2Z2SB 5B66C 1FIAA 2CV1A 5IT9K 3Q9VA 1ZQ3P 1UAAA 4DJAA 3S1RJ 1LKXA 3U1DA 3OYMA 1SMTA 3TW6A 5LHGA 1PUFB 3L2UA 2HGCA 2QCOA 4IEJA 1X3ZB 2MBFA 4E6KG 2KLOA 4LG0A 3HRSA 2XGXA 5FLXZ 1LDJA 2K40A 3GUDA 2YR2A 4S0HB 1T0FA 3RI4A 4CYDA 1JTXA 2LNBA 4B44A 3HHHA 3E6DA 3V7SA 1ETWA 3IH4A 1FOXA 1A6IA 5M3FJ 2F2EA 2PEXA 4M74A 4YEJA 1V4RA 4E7JA 4PJJA 3BJ6A 5JR3A 1Z3XA 4DBQA 4Y17A 4IOCF 4G7ZF 5EYRA 3P9CA 2DDAA 2ZXIA 1F4KA 2QA4I 2B7EA 2QYOA 4ZZLA 3TBIA 5GPCA 2ZJPF 4H0EA 4HQEA 2M7BA 1OCOH 2VJIA 3AG1H 5CJ9A 2H8WA 1VFCA 4DQ2A 3K7AJ 2X6WA 3HG9A 1TC3C 4OWRB 3ZP5A 2X6OA 4M6YA 4WX9A 4ZTJA 1MMNA 4LB5A 2GXBA 1SAUA 1IO2A 3GCMA 4BXFA 5J4VA 4OIRF 1D0YA 2VE9A 1DQUA 1MH3A 2XKPA 1HKQA 6PAXA 3LSRA 2O3FA 4FT8A 2W82A 5EZGA 4M3EA 3KP6A 2IS4A 2WAQN 2W25A 3ERMA 2WWYA 3DTKA 1V3FA 4ZYEA 1BOAA 1SFXA 2OD5A 5CQEA 4A5NA 1RKTA 4M9SA 2M4KA 3PUFA 4YFKF 3LMMA 2VLAA 1IRGA 4XQFA 3E6BA 3DTEA 1E3PA 3M07A 5J1UA 4G6QA 5DTDA 3GTOJ 3DPUA 3LQQA 1YITI 3OSFA 2IJLA 1AKHA 2OJED 3H36A 2QZ8A 2JA8J 2KIQA 3CJNA 5CKTA 3ABMH 1JTYA 2VC1A 3NWSA 3HGYA 1T33A 4HNUA 5L3FA 1NTCA 3AG2H 3IL2A 3IWZA 4I6ZA 4GFBA 1EA3A 4P9FA 4XL9A 5LGTA 3HL2A 4CCKA 1YJNI 3CDIA 1KONA 1WI3A 3R4KA 3BR2A 4X6AJ 3K4LA 4HLXA 4XBFA 4DIQA 1RR8C 4BL0B 3AKZA 2XAHA 5KCMA 3VFZA 3AL0C 4YIRX 1QNTA 1UCRA 5A2QZ 3ABUA 2P81A 4FASD 1FOKA 3CMEI 5K5RA 3DP7A 5EG0B 3S2HJ 5DCMA 2J5PA 1HW1A 4WXHA 1JUPA 3WGGA 4PSWA 3E5QA 2MD5A 3DBHB 1VQ6I 1WWXA 3BCAA 4XK4A 2ETHA 5IYCJ 1WQ2A 4BHBA 2V9PA 3H5AA 3WGIA 3CC7I 3V8JA 4AIHA 3PUBA 5J40A 3KEOA 4WWCA 2ZSHB 4LD5A 1IN8A 2V1UA 4ZYAA 1JXSA 3E7LA 2XVCA 1BI3A 4Y3OA 3RJPA 3V42A 2OCCH 3WU1B 4A3FJ 3VODA 1IXCA 5LFAA 1F43A 2FX0A 3T5XA 2H1KA 2XIGA 2EA2A 1MBHA 1A6QA 1IC8A 2VKVA 2ZB9A 1BN5A 4XN3A 2M34A 2O0YA 1HKTA 1WPKA 3LA7A 1JGSA 3LOCA 5DUIA 2H27A 3AG4H 2MGQA 1AU7A 1GVJA 4FETA 3VWBA 3CD6I 2D2WA 3HBLA 1YO5C 2QM3A 3WHBA 3AFHA 3K2AA 1MMGA 2GQQA 4L0ZB 5F1JA 2LC2A 4CCMA 4ZDLA 5LGUA 3EUAA 4BAYA 4AUXA 4M73A 2QBYA 5E3OA 2DOEA 3CJQB 3CC4I 4RLQA 1FZPB 2PMZN 3V4GA 1BI2A 1BI0A 4C2MJ 1DPRA 1LDDA 2F48A 1BIBA 2HDCA 1FTTA 2M0MA 5HNHA 2VJ4A 3PO2J 2DMPA 4BY7J 3I55I 3JRBA 1G4DA 3BWGA 3TEDA 1QPIA 1YX3A 1DU0A 5DDGA 1REPC 2AO9A 5TGTA 3ABLH 3UNGC 5B3SH 3MZHA 2HDWA 4BNCA 5FROA 3KCCA 1ZH5A 1N78A 1X58A 2DI3A 2DA7A 3KX2A 4GXOA 2JT1A 4HDUA 5HS8A 2DU9A 2CG4A 3U21A 3OYFA 3S14J 3H1CA 5FKMA 2ISZA 2HZTA 4HNVA 1YX5A 1FT9A 2E1NA 2A5YB 1ON1A 4XRFA 1SD7A 1LE8A 1TLHB 3IRQA 3HPHA 1ZG3A 4UUTA 1R36A 4KICA 4PSXA 3IH2A 1LPQA 1MDMB 2HR3A 3LL7A 5L3GA 1JT0A 2A6EF 1BIAA 1ZGJA 3GTJJ 1FWZA 4RMNA 3JAMZ 2VPRA 4Y4RA 4GYGA 2OUMA 1X1CA 1X1BA 1OQYA 5D5WB 3W2VA 4DYCA 2BE5F 2K9NA 4BDZA 4XR6A 1IGNA 4EM0B 2IA0A 1WH7A 2L9SA 2BXZA 2XF5A 5GAGJ 4BQNA 1HW5A 1G3TA 2GIZA 3K9TA 4F3QA 2P4WA 4CZCA 5HVQC 2GAUA 1W5SA 3RZDJ 2M2EA 3MEXA 3KZZA 3TW7A 2JWTA 4Q5SF 1G3WA 2GIVA 3JAMK 4DGWB 1ZYRF 2KQRA 5LEJA 1IDYA 1TW3A 3S8PA 4EQQA 2W7NA 3RKWA 1XGMA 1TZLA 2FOWA 4AVPA 2D5VA 2GA1A 1XTAA 4BKXA 2ESHA 2MC4A 2CH0A 3ZXSA 1NG7A 2KKOA 2M3AA 4KA4A 1CF7B 1QHHD 3WTXC 3MKYB 1I1GA 4OMZA 4HYEA 4XKBA 5LEKA 1Y8QB 1RNLA 2QKMB 3HPGA 4IQJA 3BR0A 1ZK8A 4PGHA 3S3MA 1W5TA 5H6QA 3KYDB 4A5MA 1LEBA 1FP2A 1OMIA 2CQXA 4JX6A 2WADA 3ZN0A 4D7NA 1S8NA 1LDKB 3DPTA 4IHYA 1FPQA 1K83J 2BY0A 2TDXA 2DFFA 1B1BA 1MDMA 4O5VA 4XORA 4XLNF 1IF1A 2YUSA 3FXQA 2L02A 3FISA 4Y15A 3GZNB 5B5EC 1UHWA 3I58A 2EZHA 3LFUA 2HQ5A 3I4NJ 5FKNA 2IRFG 2Q2EA 3A1YA 3ZMVA 1Q1VA 3HOSA 3QOEA 3VDXA 3R60A 3OR2C 4CYCA 2R7FA 4PJNA 2HDDA 1VQMI 3C2HA 2ZBKA 1XN7A 4L9NA 3ZQQA 3ZN1A 3JSPA 2LD5A 2DJNA 2ZJ2A 1EF4A 5FFZA 1QGPA 4F7ZA 4OAZA 2BY2A 1X1PA 3F8NA 2XPWA 3M8FA 4E7ZA 2KPMA 2LFBA 2PG4A 1RPWA 5IP6A 4I02A 3GXOA 2AQEA 1LVAA 3DBLB 1S5LC 3SYTA 4A69C 5F6FA 1BOBA 2E2IJ 1X3UA 5EG0A 2HWVA 3EETA 3HUGB 5JHFA 2FMLA 4CZZA 3CCLI 2KIMA 2O03A 1WJFA 2DPDA 2M4GA 2Q1ZB 2R7DA 4KIFA 3HSEA 1W4MA 3ZQGA 3E6CC 4LG0B 3C2BA 3K4CA 2L0KA 3FBIB 4KT6A 3QPLA 3P9KA 3T8TA 3QU6A 3IC7A 3JRDA 1KZHA 3MN2A 1IAWA 3FZVA 3ERED 2RKHA 2RN7A 4Y33A 2B63J 2M8EA 1I39A 3NWTA 2L9VA 3BJOA 3CMMA 3KPHA 1Z9CA 5GAHJ 2DQLA 2P5KA 2Z16A 5DD4A 1RRJA 3QRFF 1V55H 5F0HA 3S3NA 1TQIA 3H9GA 4KJZA 2VIXA 2K27A 3EDPA 3QP6A 2EILH 3E1SA 4NHJA 3K4NA 4S04A 2R7RA 2P6TA 2Y48A 3VB2A 1XCBA 2FMYA 2BVMA 1XDUA 4KN4X 5HS9A 3W6VA 2ZJQF 3EYYA 3ZGKA 2DAOA 2XGEA 2VBYA 1R5HA 2IA2A 2XRNA 2FBKA 2LY9A 1YFHA 5IOYA 4A3LJ 4PGGA 3EPZA 2L4MA 1T0FC 2HKXA 2JK3A 3CCEI 1A36A 2VKDA 4BS9A 4D5CA 1W1WE 1GV5A 4BY1J 3JREA 3A0BC 3F8BA 4BGDA 3S1QJ 1IXSB 4G7HF 4MFDA 1KQ8A 5GAEJ 4PK4A 3D5LA 2WV1A 4LK1F 1HA8A 1U0JA 1SEUA 1NK3P 1WCMJ 3VSKA 2XASA 1JHFA 3PL8A 5L3BA 2HOEA 2MG4A 4HF1A 2IGMA 2WAFA 1TL8A 1S7AA 3LSJA 1WH5A 2DOFA 1SANA 1ZHFA 1TW2A 3FM3A 4ZTFA 1FYLA 3K69A 1U8RA 3WTWC 3OYJA 4UVCA 2VUMJ 4BYYA 2P6SA 1BJZA 5TJJA 1ZARA 4JQFA 4C3JJ 4LOCA 3ZQFA 4II2A 1J2XA 1OYIA 3IH3A 3U1KA 3BC8A 5CLSA 3RDIA 5EDNA 4A12A 3BQYA 5CYVA 4U7BA 3HM5A 4ZJZA 3BG5A 1TWFJ 3K70C 3OYKA 3K4MA 1VQLI 4IZZA 3H3ZA 4XNFA 1HSTA 4RM2A 3F6OA 1IN7A 3W6JB 2DFHA 3U2RA 3VSLA 2XAJA 4EEFG 2H94A 3WODF 3S32A 1B59A 4DYRA 4R1HA 1X3WB 3HOYJ 1HF0A 2WAEA 3B02A 5JLWA 1OCCH 2DJIA 3HRTA 2O9LA 4HRIA 3CUOA 2Z9OA 3ELKA 4EM1A 2R7XA 2EV5A 5D8LB 2A3SA 1DGRM 4GO1A 3SFZA 3VYUB 1LB2A 5BS6A 4AU7A 2PMHA 3F72A 4HX4A 1U5TC 2MABA 3OYEA 5E20A 5E1ZB 5EEAA 5K5OA 3MZYA 2BYVE 2UV1A 4D7MA 2ECCA 5DM6F 5JVGF 4BBRJ 2AHQA 3S93A 2VI6A 3WTZA 5ICEA 3JRCA 5KNLA 3WTTC 1J0RA 4O3MA 2A61A 2GBYA 4OIPF 3IAS2 1BW5A 2RQPA 4XLEA 3S1MJ 2NNYA 1ETVA 4LLLA 3ZQLA 3LAJA 3E0JB 2R7ZJ 1WZ2A 4HG2A 3CUQA 5D4RA 2VJ5A 4MTEA 3FHZA 2ZMEA 3E97A 5E3NA 2NVXJ 2CW8A 1H89C 2VKHA 3J80Z 1UZCA 2EFPA 2VODA 2EA4A 3S1NJ 4DOZA 2K5CA 2FF4A 5IYBJ 3QYBA 2DOAA 1L3LA 4IHWA 1D1CA 2R3SA 5KHDA 4YIIA 2KZVA 3GYHX 1P2FA 4RAGA 4XSXF 3ZMUA 2IEKA 5HODA 3J7AY 1AA7A 1LUJB 1PYVA 3IKVA 4OU0A 4RGSA 2AS5F 2KMUA 4WCGA 4RAZA 1HBXG 1HLVA 2JRTA 2V79A 3ASNH 2ESNA 3KEQA 1Z1DA 4I98B 5ILSA 2LDUA 2HYGD 4KNYA 4BQAA 3L9FA 1K78B 1AKHB 2IW5A 2EFOA 4ESFA 3L2CA 1FBUA 2DYRH 3PFIA 1JJ6C 5FGMA 1LNWA 4LG3A 4GRIA 5FB2A 3KZIC 3BQZA 4QPOA 4UVBA 3GFLA 4ETSA 5C4XJ 3AG3H 4U7DA 2HU9A 3CCUI 2KHMA 3GTQJ 3R61A 1O3SA 2GOMA 4DW6A 3CF2A 5J8CA 2BXYA 2RV8A 2Z33A 2QLZA 2LOOA 1U78A 1GXQA 3IUOA 2EINH 3I64A 3DEWA 4RGXA 3CO7C 4A3MJ 4L18B 1VQPI 2BHZA 3QYFA 4NBQA 1UFMA 1O3RA 3SEQA 3RQIA 3HGGA 4N4NB 3CZ6A 2RREA 3LSHA 4LK0F 3RKQA 2MLGA 4G8XA 4B1RA 3V8KA 5D4SA 1VQKI 5J8FA 4XRMA 1G59A 3MCZA 5K5QA 2K9QA 2ZKZA 3S2DJ 3CMAI 1JT6A 4A3JJ 1WJBA 3DV8A 3PNYA 4M3DA 1BI1A 1H0MA 2KP6A 3NEUA 1E17A 3RCOA 3OV8A 5A2QK 2E34A 2Y0SN 1J75A 4LLNA 3HZJA 2XHKA 5J6XA 1QHGA 1YRNB 3GTMJ 4XLPF 4XSZF 1SVLA 1FSHA 2XAFA 1UJ8A 1WHUA 4KT5C 5E79C 4B4CA 1OKRA 3BR3A 1CGPA 1KU9A 1MJAA 2OQRA 1TQMA 5EJCA 2Y75A 2M45A 1BC7C 4G6TB 4E70A 4ENMA 3A03A 1NG6A 2DN0A 4MFEA 2I10A 5BPIA 3ECOA 3K1PA 1GDTA 1MMDA 2ISYA 2X85A 2IGOA 3O2PE 3TL4X 3RPUD 4YFXF 1E0EA 4XMYA 1USTA 2L01A 2WAQA 1UB9A 1I6XA 5EEGA 1IDZA 3CUQC 1PDNC 2VT3A 5LGNA 3LSMA 2W57A 2BW3A 3FDYA 2JZYA 5E3MA 1QVUA 2CUZA 1DP3A 2JN6A 2EBIA 1R1TA 2JA6J 3OYCA 5TRDA 3GFJA 3BCBA 2PJRB 1KA8A 2OC6A 3CDLA 4FHTA 3CJTB 4A3GJ 3ESWB 1U5TB 3I9V2 5LHHA 2VOPA 2F6CA 1HW2A 2IA1A 3K0LA 1W36D 1YRNA 1Z6TA 3BJAA 1JKRC 5GTIC 1X4OA 1W7PD 3WGHA 1K4SA 2R7OA 2KRHA 1XSVA 2JA2A 4ENKA 4GGGA 2K3PA 4PJMA 1J7KA 1FJLA 2L2OA 5K7HA 3A4CA 3EUKL 1R1UA 1B4AA 2Q2EB 1WJEA 2VL8A 3B6CA 3A01A 2TRTA 4IKFA 2LVSA 4JX5A 5DEQA 5F0FA 3E5XA 4CCNA 3I59A 3HOVJ 2PJRA 1XMXA 2KIUA 2R7WA 3ZPLA 3OWTA 5IP9J 2LTPA 1E3OC 3GMEA 5EEHA 3HKZA 4Z2YA 1QPMA 1A31A 4FTHA 2KJCA 2ZXHA 1J9IA 4CSWA 2XSJC 2VPLA 1R71A 2LY1A 4MQ9F 3LNQA 4N9IA 3G1LA 3KP3A 5EF6A 3K1NA 4AC0A 1APLC 5CVUA 1ETKA 1WRJA 3MAJA 1B72A 1TWGJ 1D5VA 4LJZF 3M7GA 2BHYA 4IOAF 3TP3A 2K85A 2Q0OA 3BDDA 5F64A 4NQWA 4A0XA 1FEXA 3QODA 3TMOA 2BY1A 2DCEA 4KYWA 1I3AA 1S72I 2K4JA 1U9OA 2X48A 2CUJA 1ZELA 2HQRA 3BY6A 3ZMDA 2G7UA 4HF0A 3K10A 1V5GA 1HQCA 3FMSA 5IP7J 4ENNA 3CLOA 3OMYA 1U3EM 3BPXA 4QWQA 2A07F 3CCYA 4RB1A 5HOOA 4CYCB 1ZAOA 3K2ZA 1VI0A 1QRYA 1MBGA 1YG2A 3PNTA 3SXYA 2X51A 4I2OA 1DGWY 2V1XA 2JUGA 3T8RA 1MH4A 2VXZA 4RA2A 1K7AA 1T98A 4UY8I 5EGOA 3ABKH 2ZJRF 3VYSB 3HB9A 4ESJA 4BHPA 4IX7A 1KU2A 3RPUA 4UNOA 1YS7A 3I4MJ 3BR5A 3F8CA 5FFXA 5LD2C 1YYVA 1O3QA 2XAQA 3C7JA 4FCYA 1JUSA 3OOPA 4P96A 2ZFUA 4AIKA 2JA5J 2DMTA 3I54A 2R7QA 3N97A 1YLFA 3TDZC 1NH3A 1U2WA 2GZWA 2HNHA 2R7SA 3KP4A 1STZA 4MEXF 4UVAA 2LREA 2ZC2A 1GXPA 1G3SA 2DT5A 3DKYA 4M6VA 2KISA 2DMUA 2LK2A 1IRFA 2M87A 1MBJA 2DA4A 4NQWB 1OCRH 2CW0F 4Q48A 2IAIA 1W36C 2A5WA 2W85A 4P55A 2CS3A 3OYDA 4BQQA 4W1UA 4HSTA 3QWLA 2KIFA 5GTHC 4AWXB 2N8GA 5M5YJ 1RKWA 3HRMA 2RNJA 1ZKGA 1WKMA 2H09A 4IO9F 4XLFA 2XDVA 4XLHA 1HCRA 2E36A 1ZLJA 3PO3J 1USSA 3ZQIA 4DYQA 1ETQA 1FTZA 3I4PA 1XB4A 1OJLA 5FKKA 2GXGA 1HC8A 2KFDA 3M1CA 1OR7A 1BA5A 2JSPA 3GBGA 1EJ9A 3LWFA 3I53A 2LBFB 3J7ZI 1VTNC 1ZR4A 5FKOA 3WTSC 1VF9A 5LRRA 1YE9A 1QZZA 1E3HA 1T6SA 1Y6IA 2FE3A 2KJBA 1VQ4I 3KP2A 3ZQHA 4M72A 2R7TA 1BBYA 1IZ1A 3PSIA 5K7ZA 1Z7LA 2LF8A 3N4MA 2LLKA 3BR6A 3W6KB 2E7XA 5IT3A 3DPLC 3E6MA 3MZ8A 4FQGA 4U0YA 2OCEA 4R79A 2EV0A 2X6YA 2Z99A 2JUCA 1OISA 2V6CA 3HTSB 2XAGA 4W97A 3K4BA 1Y0NA 4A6DA 2GOXB 2XROA 1QZEA 3OR1C 4BE0A 4NC8A 5EZHA 1ITYA 1C0WA 2M5WA 5L3CA 3H5NA 3JTGA 5H20A 4C30A 3W2AA 2PQ8A 5HNFA 2EFNA 3P5JA 2GXAA 1VQ8I 3BTCA 3OS2A 3A2KA 2DBBA 2ME6A 3MQ0A 3RSNA 2QBYB 1MBFA 1YI2I 1YIJI 2Y0MA 1RC9A 2MH2A 3CCQI 2AXLA 3FXJA 4JYKA 1RUNA 1B9MA 2DA1A 3V7CA 4XLAA 4IJAA 5JHUA 5JVTA 3QOPA 1IJWC 1PP7U 2O6GE 4FX0A 1HOMA 4XICA 2F5FA 1WVRA 2O7OA 4A0YA
chains in the Genus database with same CATH topology
2EFQA 3T1BA 3ZMZA 4JBAA 2EWNA 4KMUX 2QUFA 3TOAA 1YQAA 2H6CA 2OBPA 5ILUA 3H3UA 1LJ9A 4KMFA 3GX4X 2HYFA 1IW7F 5CVRA 4DNCA 1QZYA 1U5TA 4LLGF 3ZQ7A 1XD7A 2WC2A 1MGTA 4HLYA 3V7RA 4L9JA 1AWCA 3HHGA 2ZFWA 2IP2A 2CO5A 2CYYA 3IKTA 4L5IA 3QU3A 3COAC 3BOQA 1FP1D 4I0BA 1KQ9A 2BEOA 1G3YA 2A69F 3HTUA 4AD9A 3TO6A 3C3WA 1R23A 1ON2A 3J81K 3HUGA 3I71A 2PJPA 3LA3A 3FM5A 4I09A 3SZTA 1ULYA 1T39A 1MKMA 2QENA 2VN2A 3KP5A 1TNSA 4KIGA 3J81Z 2QWWA 2YU3A 1EH7A 3KFWX 3WTVC 4UHTA 5ILVA 4HAMA 4RGRA 4JK1X 1S3JA 1HXDA 3NQOA 2H6BA 4A6EA 3IHUA 3QP5A 1A04A 4ZYGA 3TO9A 3J7AO 2ADUA 1MD0A 2Q8KA 4MEYF 2WV0A 2IT0A 2ZNZA 5HLIA 2OAZA 2COMA 3LA2A 1XGOA 3F22A 3GWZA 4YG2F 1I1SA 1ONVA 2LKPA 1SFUA 2UXXA 1ZRCA 4Q47A 2FXAA 3M9AA 1XSXA 3TQNA 2QQ9A 1XDSA 2EFWA 4P5OA 2DLLA 1CF7A 3RPQA 1KGSA 3GEZA 3FMRA 1H9TA 1IN5A 4ZH4F 4L5JA 1BC8C 3EQLF 2GWRA 2A68F 2DO7A 2CQKA 4RB0A 4LFUA 3O3KA 2FSWA 2HS5A 5ERIA 3RYRA 2PI0A 2PFBA 1JHHA 5E8IA 4ZYDA 1TNTA 1MJ9A 4IPAA 2FRHA 2FQ3A 2OQGA 5HS7A 5ICGA 4WK8F 1FYMA 3KZYA 3SHFA 4BH9A 4A2UA 4IF4A 4KUMA 5JFRA 4RB3C 2P5VA 1DPUA 1EH8A 2V9VA 3FMQA 1ZLKA 3FX3A 4MGRA 2NRAC 3RKXA 1BM9A 1SD5A 2W24A 2EK5A 4LB6B 1DP7P 4ASNA 4L9VA 2GA2A 3M8EA 3ML6A 3MFKA 4OOIA 1Q1HA 2JSCA 3KLNA 2X0LA 1WSUA 2P7VB 2PMUA 5HDNA 2C6YA 4R8HA 4G6DA 4RB2C 3BP8A 1KU7A 1I5ZA 4YIFA 2EV6A 4Y13A 3J80K 1WI9A 3SQNA 3ISPA 4EGZA 4IRGA 3EYIA 5DCFA 5DCMB 1YW9A 5AIQA 3F3XA 1O7LA 3CO6C 3GVAA 1O57A 3DFGA 1LQ1A 5LHIA 4HX8A 3L09A 4EM2A 5FO5A 4P9UA 1R1VA 2DQRA 2HQNA 2OZ6A 1EH6A 4PZJA 2BGCA 5E8GA 3ZMSA 2D45A 4OINF 4RGUA 3DF8A 2DK8A 1ZREA 2VBWA 2B0LA 3C18A 4AIJA 5BOXA 2LSOA 3TDUC 3LAPA 1AOYA 3LFKA 3JTHA 1QO0D 4O6JA 3KP7A 3QPTA 4K2EA 4M6XA 2CSOA 1T38A 3LSTA 4HV6A 1IUYA 4GYIA 2PN6A 2BV6A 2F5EA 3RKYA 3M1EA 1KU3A 2L3DA 2M30A 2L54A 2RGVA 1IXRC 3E5UA 1XCVA 1S6LA 1QQIA 3Q9SA 1NHAA 1FLIA 1R7JA 4CICA 2FEZA 1P4WA 2FNPA 1K6OA 4M9XA 4A0ZA 2ZMEB 4RS8A 1OPCA 2DTRA 1S7OA 4HBLA 3WE3A 4NB5A 2HKOA 5D6FA 2RDPA 2YX7A 5HLHA 2HEOA 4OIQF 4PCQA 3HIFA 3TO7A 4KN7X 2ZNYA 5DYMA 1SD4A 3PQKA 5E18F 4UV9A 4IHSA 5LBQA 1RUOA 1XMAA 5BMZA 3SZPA 1YS6A 5F1RA 1ZN2A 3BZ6A 2WTEA 3D0SA 3K1MA 5IT9Z 2FNAA 3WTUC 2NNNA 3EUHA 3FXUA 2G7HA 4PDKA 2G9WA 1H9GA 3F8FA 2JPBA 3QPHA 4I01A 2UWMA 3DQVC 1K79A 1D8JA 2VC0A 3S2WA 1W7PA 4CGZA 4M71A 1YIOA 2NYXA 5CVJA 2DK5A 1SAXA 3RIRA 4CHUA 3F23A 3REOA 5DUKA 4N9HA 1FBSA 3BROA 1D3YA 3GW2A 5AIPA 3IWFA 4FX4A 1K78A 4LGWA 3F21A 4KIBA 1ZG5A 4RAYA 4UV8A 2QQBA 2L4AA 2HTSA 1EV7A 1Z6RA 3CDHA 3NRVA 2YPRA 4M9ZA 3ULQB 3KLOA 1U6GA 4I7HA 1R22A 4Q4ZF 2PBIA 5L3DA 2MA3A 5ED4A 2IPQX 3ROUA 4HF2A 4ZZDA 5FD6A 2BBYA 3WE2A 2CFXA 3U9GA 4HDVA 1FBQA 2VE8A 3O6BB 2EB7A 5H6RA 3FF5A 1LEAA 5DV5A 5BPDA 2VOOA 1FX7A 1DDNA 5D8KB 3G73A 2XKOA 3RYPA 2F5CA 3DXJF 1FNNA 4HQMA 1P92A 3PQJA 4EGYA 1KYZA 3ECHA 3TKYA 4CXFA 3BPVA 3VOEA 2FOKA 4HA8A 5ICFA 3KE2A 5E17F 4BHCA 5E1WA 4EJOA 2XUBA 2VBXA 1R58A 1SD6A 3I0TA 4LMYA 1O3TA 4ENJA 1TTYA 4ZYHA 3R6SA 2STTA 2K7LA 3GLXA 4ESBA 3L7WA 1YW8A 4EV0A 4L9TA 1F1ZA 4IRHA 1D8KA 3HOTA 2OZUA 5HDKA 4OIOF 5CVVA 3HYIA 2FA5A 3TGNA 2O8XA 1F5TA 5DD8A 4WF2A 1Z7UA 5LLQA 4HV5A 1G6NA 4UUVA 5K1YA 1B9NA 4OMYA 4N0BA 1ZRFA 2F5DA 4YFNF 4IRIA 4EJWA 2P7CB 2CWEA 1L0OC 1RI7A 1TQPA 3JW4A 1F9NA 3VEPA 3CUQB 1E2XA 4MHGA 4IVNA 4GCVA 1KQ0A 2YX4A 3HSFA 2UZKA 3GZ5A 1SMYF 2FBHA 4HZFA 3AAFA 1TBXA 1O7FA 5HDGA 4WXCA 3GO5A 4HX7A 4QLCU 3DEUA 5L3EA 2VONA 1KYWA 3JSOA 4MQVA 3GFMA 4CO8A 4EMSA 2O61A 3FXRA 5D5XB 4HOBA 4BXUA 1RIOH 1BJAA 1ZGAA 2J5OA 2VBZA 2M1BA 1R5GA 2DW4A 5HLGA 1QBJA 2YSRA 1Z91A 2ELHA 5KK1A 4EJUA 1XSDA 2MH9A 3R0AA 4UXNA 1YW7A 2E1CA 2HFHA 1IN4A 1R00A 5E1XA 1HKSA 1MZBA 2Z3YA 1P4AA 2PLYA 3P9IA 3WG9A 4EJTA 1Z05A 3F6VA 1P4XA 3GFIA 4G9YA 4U0WA 2D1VA 1HSJA 3QAHA 5CVIA 2KRFA 1S29A 4HW0A 4CDGA 2CGPA 2A6HF 2IVMA 1ODDA 2DFIA 4U0VA 4S05A 1JE8A 2ZO4A 3GF2A 5D6EA 2MC3A 1Y0UA 4KFCA 1XMKA 5D5VB 1I27A 2HTJA 2V1DA 4I0AA 4B09A 3P7NA 1T2KA 3KETA 4D0PA 5FD5A 2P5LC 1PUEE 3B73A 4EVIA 2FBIA 5KVRA 2K4BA 3IRRA 4IXAA 2ZXJA 2K02A 3TOBA 3DKWA 3WU0A 4B8XA 2STWA 2K86A 5AONA 3T0YA 1FSEA 5JI6A 2JTVA 3WTYC 3LQRA 1PP8F 5ICCA 1P6RA 3R0JA 1SFEA 2UXNA 3Q5FA 1UHMA 4ON0A 1YTYA 5D5UB 1FY7A 2ZCWA 2EJRA 3C1DA 4MNUA 4G94A 3F8MA 1W7PB 3RTRA 2RVCA 3I59B 3HSRA 4MTDA 3CTAA 2OA4A 1B6AA 2QVOA 2Z5UA 1OYYA 1OYWA 2W84A 1RZ4A 3ZMTA 2JPCA 3V8LA 2DPUA 1FYKA 3I5UA 3HRUA 2QQAA 3ABTA 3MWMA 2VT2A 1J5YA 2E7WA 3E3VA 3FWEA 2NS0A 4TV7A 3L00A 2LF7A 2FU4A 1XGSA 5BQTA 2MLKA 4IHTA 1J59A 3H92A 4WXDA 1DUXC 1ZRDA 1FC3A 2X4HA 1XGNA 2RC4A 2ACJA 2NAZA 1MJBA 5LRSA 4U88A 2XV4S 4KDPA 5FLXK 2D1HA 4L0YB 1GHCA 1IN6A 2P8TA 4EJVA 4G7OF 3G3ZA 1ZG1A 2OU2A 3GZ6A 5IT9K 3Q9VA 3U1DA 1SMTA 5LHGA 2HGCA 2MBFA 4LG0A 3HRSA 2XGXA 5FLXZ 1LDJA 3GUDA 2YR2A 1T0FA 3RI4A 4CYDA 2LNBA 3HHHA 3E6DA 3V7SA 2F2EA 2PEXA 4M74A 1V4RA 3BJ6A 5JR3A 4Y17A 4G7ZF 3P9CA 1F4KA 2QYOA 4ZZLA 4HQEA 4H0EA 5CJ9A 4DQ2A 3ZP5A 4M6YA 4WX9A 4LB5A 2GXBA 4OIRF 2VE9A 2XKPA 1HKQA 6PAXA 2O3FA 4FT8A 3KP6A 2W25A 2WWYA 1V3FA 4ZYEA 1BOAA 1SFXA 2OD5A 4A5NA 4M9SA 4YFKF 1IRGA 3E6BA 4G6QA 3LQQA 2IJLA 2QZ8A 3CJNA 2VC1A 5L3FA 3IL2A 3IWZA 4P9FA 5LGTA 3R4KA 4HLXA 4XBFA 2XAHA 3VFZA 1QNTA 1UCRA 5A2QZ 3ABUA 1FOKA 5K5RA 3DP7A 5DCMA 2J5PA 1HW1A 4WXHA 3WGGA 3E5QA 2MD5A 1WWXA 2ETHA 1WQ2A 4BHBA 3WGIA 3V8JA 4AIHA 3KEOA 4WWCA 4LD5A 1IN8A 2V1UA 1JXSA 2XVCA 1BI3A 3RJPA 3WU1B 3VODA 1IXCA 3T5XA 2XIGA 2EA2A 1BN5A 2O0YA 1HKTA 3LA7A 1JGSA 5DUIA 2H27A 1GVJA 2D2WA 1YO5C 2QM3A 2GQQA 4L0ZB 5LGUA 4BAYA 4M73A 2QBYA 1FZPB 3V4GA 1BI2A 1BI0A 1DPRA 1LDDA 1BIBA 2HDCA 1G4DA 3BWGA 5DDGA 1REPC 3MZHA 4BNCA 3KCCA 1ZH5A 2DI3A 4GXOA 2JT1A 4HDUA 5HS8A 2DU9A 2CG4A 2ISZA 2HZTA 1FT9A 2E1NA 2A5YB 1ON1A 4XRFA 1SD7A 1TLHB 3IRQA 1ZG3A 1R36A 4KICA 1MDMB 2HR3A 5L3GA 2A6EF 1BIAA 1ZGJA 1FWZA 3JAMZ 4GYGA 5D5WB 2BE5F 4EM0B 2IA0A 1HW5A 1G3TA 3K9TA 2P4WA 5HVQC 2GAUA 1W5SA 3MEXA 3KZZA 4Q5SF 1G3WA 2GIVA 3JAMK 5LEJA 1ZYRF 1TW3A 4EQQA 3RKWA 1XGMA 4AVPA 2GA1A 2ESHA 2KKOA 4KA4A 1CF7B 3WTXC 1I1GA 4OMZA 4HYEA 5LEKA 1RNLA 4PGHA 1W5TA 5H6QA 4A5MA 1LEBA 1FP2A 1OMIA 3ZN0A 1S8NA 1LDKB 3DPTA 1FPQA 2TDXA 1MDMA 1B1BA 4O5VA 4XLNF 1IF1A 3FXQA 2L02A 4Y15A 1UHWA 3I58A 2IRFG 2Q2EA 3ZMVA 3HOSA 3R60A 2R7FA 4L9NA 2ZBKA 1XN7A 3JSPA 3ZN1A 2ZJ2A 5FFZA 1QGPA 4F7ZA 3F8NA 3M8FA 2PG4A 4I02A 3GXOA 1LVAA 5F6FA 1X3UA 2HWVA 3EETA 2FMLA 4CZZA 2KIMA 2O03A 2DPDA 2R7DA 4KIFA 3HSEA 1W4MA 3E6CC 4LG0B 3P9KA 3T8TA 3QU6A 3IC7A 1IAWA 3FZVA 3ERED 2RKHA 2RN7A 2M8EA 3BJOA 1Z9CA 2DQLA 2P5KA 5DD4A 3QRFF 1TQIA 2K27A 3EDPA 3QP6A 4NHJA 4S04A 2P6TA 2Y48A 3VB2A 1XCBA 2FMYA 4KN4X 1XDUA 5HS9A 3EYYA 2DAOA 2VBYA 1R5HA 2IA2A 2XRNA 2FBKA 1YFHA 4PGGA 2L4MA 2HKXA 3F8BA 1IXSB 4G7HF 1KQ8A 3D5LA 4LK1F 2XASA 1JHFA 5L3BA 2HOEA 4HF1A 1S7AA 1ZHFA 1TW2A 3FM3A 1FYLA 3K69A 1U8RA 3WTWC 4UVCA 4BYYA 2P6SA 5TJJA 1ZARA 4JQFA 1J2XA 1OYIA 5CLSA 3RDIA 4A12A 5CYVA 4U7BA 3H3ZA 1HSTA 3F6OA 1IN7A 3W6JB 3U2RA 2XAJA 2H94A 3WODF 1B59A 4R1HA 3B02A 3HRTA 3CUOA 2Z9OA 3ELKA 4EM1A 2EV5A 5D8LB 2A3SA 3SFZA 4GO1A 1LB2A 5BS6A 2PMHA 3F72A 4HX4A 1U5TC 5E20A 5E1ZB 5K5OA 3MZYA 2BYVE 3WTZA 5ICEA 3WTTC 1J0RA 4O3MA 2A61A 4OIPF 2RQPA 2NNYA 4LLLA 3LAJA 3CUQA 5D4RA 4MTEA 3FHZA 2ZMEA 3E97A 3J80Z 2EFPA 2VODA 2EA4A 2FF4A 1L3LA 2R3SA 4YIIA 3GYHX 1P2FA 4XSXF 3ZMUA 4OU0A 3IKVA 4RGSA 2AS5F 4WCGA 4RAZA 1HBXG 2JRTA 2V79A 2ESNA 3KEQA 1Z1DA 4I98B 5ILSA 2LDUA 2HYGD 4KNYA 4BQAA 3L9FA 1K78B 2IW5A 2EFOA 4ESFA 3L2CA 1FBUA 3PFIA 5FGMA 1LNWA 5FB2A 4UVBA 3GFLA 4ETSA 4U7DA 3R61A 1O3SA 5J8CA 2RV8A 2Z33A 2QLZA 1U78A 1GXQA 3I64A 3CO7C 4RGXA 4L18B 1UFMA 1O3RA 4LK0F 2MLGA 4G8XA 3V8KA 5D4SA 5J8FA 3MCZA 5K5QA 2ZKZA 3DV8A 1BI1A 1H0MA 3NEUA 1E17A 3OV8A 5A2QK 1J75A 4LLNA 2XHKA 5J6XA 4XLPF 4XSZF 1FSHA 2XAFA 4KT5C 1OKRA 1CGPA 1KU9A 1MJAA 2OQRA 1TQMA 1BC7C 2Y75A 2M45A 4E70A 4ENMA 5BPIA 3ECOA 3K1PA 2ISYA 3O2PE 4YFXF 1USTA 2L01A 1UB9A 1I6XA 5EEGA 3CUQC 1PDNC 2VT3A 5LGNA 2W57A 2JZYA 1R1TA 5TRDA 3GFJA 1KA8A 4FHTA 1U5TB 5LHHA 2VOPA 1HW2A 2IA1A 3K0LA 1Z6TA 3BJAA 1W7PD 3WGHA 1XSVA 4ENKA 4GGGA 1J7KA 1R1UA 1B4AA 5DEQA 3E5XA 3I59A 2KIUA 3ZPLA 5EEHA 4Z2YA 1QPMA 2KJCA 1J9IA 4MQ9F 4N9IA 3KP3A 3K1NA 5CVUA 1WRJA 3MAJA 1D5VA 4LJZF 3M7GA 2Q0OA 3BDDA 5F64A 4NQWA 4A0XA 4KYWA 2K4JA 3ZMDA 2HQRA 3BY6A 2G7UA 4HF0A 4ENNA 1HQCA 3FMSA 1U3EM 3CLOA 3BPXA 4QWQA 2A07F 4RB1A 5HOOA 1ZAOA 3K2ZA 1YG2A 3SXYA 4I2OA 2V1XA 3T8RA 2VXZA 1K7AA 1T98A 4ESJA 4BHPA 1KU2A 3RPUA 4UNOA 1YS7A 3F8CA 5FFXA 1YYVA 1O3QA 2XAQA 3C7JA 4P96A 3OOPA 4AIKA 3I54A 3N97A 1YLFA 3TDZC 1U2WA 2GZWA 3KP4A 1STZA 4MEXF 4UVAA 1GXPA 1G3SA 2DT5A 1IRFA 2M87A 2CW0F 4Q48A 2W85A 4P55A 2KIFA 4AWXB 3HRMA 2RNJA 1WKMA 2H09A 1ZLJA 1USSA 3I4PA 1XB4A 2GXGA 1OR7A 3LWFA 3I53A 1VTNC 3WTSC 5LRRA 1QZZA 1T6SA 2FE3A 2KJBA 3KP2A 4M72A 1BBYA 1IZ1A 2LF8A 3N4MA 3W6KB 2E7XA 5IT3A 3DPLC 3E6MA 4U0YA 4R79A 2EV0A 2Z99A 2V6CA 3HTSB 2XAGA 4A6DA 2XROA 1C0WA 2M5WA 5L3CA 3JTGA 5H20A 2PQ8A 2EFNA 2DBBA 3MQ0A 2QBYB 2Y0MA 2MH2A 2AXLA 1RUNA 1B9MA 3V7CA 4IJAA 5JHUA 5JVTA 3QOPA 1PP7U 2O6GE 4FX0A 2F5FA 4A0YA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EFQ A;  3T1B A;  3ZMZ A;  4JBA A;  2EWN A;  4KMU X;  2QUF A;  3TOA A;  1YQA A;  2H6C A;  2OBP A;  5ILU A;  3H3U A;  1LJ9 A;  4KMF A;  3GX4 X;  2HYF A;  1IW7 F;  5CVR A;  4DNC A;  1QZY A;  1U5T A;  4LLG F;  3ZQ7 A;  1XD7 A;  2WC2 A;  1MGT A;  4HLY A;  3V7R A;  4L9J A;  1AWC A;  3HHG A;  2ZFW A;  2IP2 A;  2CO5 A;  2CYY A;  3IKT A;  4L5I A;  3QU3 A;  3COA C;  3BOQ A;  1FP1 D;  4I0B A;  1KQ9 A;  2BEO A;  1G3Y A;  2A69 F;  3HTU A;  4AD9 A;  3TO6 A;  3C3W A;  1R23 A;  1ON2 A;  3J81 K;  3HUG A;  3I71 A;  2PJP A;  3LA3 A;  3FM5 A;  4I09 A;  3SZT A;  1ULY A;  1T39 A;  1MKM A;  2QEN A;  2VN2 A;  3KP5 A;  1TNS A;  4KIG A;  3J81 Z;  2QWW A;  2YU3 A;  1EH7 A;  3KFW X;  3WTV C;  4UHT A;  5ILV A;  4HAM A;  4RGR A;  4JK1 X;  1S3J A;  1HXD A;  3NQO A;  2H6B A;  4A6E A;  3IHU A;  3QP5 A;  1A04 A;  4ZYG A;  3TO9 A;  3J7A O;  2ADU A;  1MD0 A;  2Q8K A;  4MEY F;  2WV0 A;  2IT0 A;  2ZNZ A;  5HLI A;  2OAZ A;  2COM A;  3LA2 A;  1XGO A;  3F22 A;  3GWZ A;  4YG2 F;  1I1S A;  1ONV A;  2LKP A;  1SFU A;  2UXX A;  1ZRC A;  4Q47 A;  2FXA A;  3M9A A;  1XSX A;  3TQN A;  2QQ9 A;  1XDS A;  2EFW A;  4P5O A;  2DLL A;  1CF7 A;  3RPQ A;  1KGS A;  3GEZ A;  3FMR A;  1H9T A;  1IN5 A;  4ZH4 F;  4L5J A;  1BC8 C;  3EQL F;  2GWR A;  2A68 F;  2DO7 A;  2CQK A;  4RB0 A;  4LFU A;  3O3K A;  2FSW A;  2HS5 A;  5ERI A;  3RYR A;  2PI0 A;  2PFB A;  1JHH A;  5E8I A;  4ZYD A;  1TNT A;  1MJ9 A;  4IPA A;  2FRH A;  2FQ3 A;  2OQG A;  5HS7 A;  5ICG A;  4WK8 F;  1FYM A;  3KZY A;  3SHF A;  4BH9 A;  4A2U A;  4IF4 A;  4KUM A;  5JFR A;  4RB3 C;  2P5V A;  1DPU A;  1EH8 A;  2V9V A;  3FMQ A;  1ZLK A;  3FX3 A;  4MGR A;  2NRA C;  3RKX A;  1BM9 A;  1SD5 A;  2W24 A;  2EK5 A;  4LB6 B;  1DP7 P;  4ASN A;  4L9V A;  2GA2 A;  3M8E A;  3ML6 A;  3MFK A;  4OOI A;  1Q1H A;  2JSC A;  3KLN A;  2X0L A;  1WSU A;  2P7V B;  2PMU A;  5HDN A;  2C6Y A;  4R8H A;  4G6D A;  4RB2 C;  3BP8 A;  1KU7 A;  1I5Z A;  4YIF A;  2EV6 A;  4Y13 A;  3J80 K;  1WI9 A;  3SQN A;  3ISP A;  4EGZ A;  4IRG A;  3EYI A;  5DCF A;  5DCM B;  1YW9 A;  5AIQ A;  3F3X A;  1O7L A;  3CO6 C;  3GVA A;  1O57 A;  3DFG A;  1LQ1 A;  5LHI A;  4HX8 A;  3L09 A;  4EM2 A;  5FO5 A;  4P9U A;  1R1V A;  2DQR A;  2HQN A;  2OZ6 A;  1EH6 A;  4PZJ A;  2BGC A;  5E8G A;  3ZMS A;  2D45 A;  4OIN F;  4RGU A;  3DF8 A;  2DK8 A;  1ZRE A;  2VBW A;  2B0L A;  3C18 A;  4AIJ A;  5BOX A;  2LSO A;  3TDU C;  3LAP A;  1AOY A;  3LFK A;  3JTH A;  1QO0 D;  4O6J A;  3KP7 A;  3QPT A;  4K2E A;  4M6X A;  2CSO A;  1T38 A;  3LST A;  4HV6 A;  1IUY A;  4GYI A;  2PN6 A;  2BV6 A;  2F5E A;  3RKY A;  3M1E A;  1KU3 A;  2L3D A;  2M30 A;  2L54 A;  2RGV A;  1IXR C;  3E5U A;  1XCV A;  1S6L A;  1QQI A;  3Q9S A;  1NHA A;  1FLI A;  1R7J A;  4CIC A;  2FEZ A;  1P4W A;  2FNP A;  1K6O A;  4M9X A;  4A0Z A;  2ZME B;  4RS8 A;  1OPC A;  2DTR A;  1S7O A;  4HBL A;  3WE3 A;  4NB5 A;  2HKO A;  5D6F A;  2RDP A;  2YX7 A;  5HLH A;  2HEO A;  4OIQ F;  4PCQ A;  3HIF A;  3TO7 A;  4KN7 X;  2ZNY A;  5DYM A;  1SD4 A;  3PQK A;  5E18 F;  4UV9 A;  4IHS A;  5LBQ A;  1RUO A;  1XMA A;  5BMZ A;  3SZP A;  1YS6 A;  5F1R A;  1ZN2 A;  3BZ6 A;  2WTE A;  3D0S A;  3K1M A;  5IT9 Z;  2FNA A;  3WTU C;  2NNN A;  3EUH A;  3FXU A;  2G7H A;  4PDK A;  2G9W A;  1H9G A;  3F8F A;  2JPB A;  3QPH A;  4I01 A;  2UWM A;  3DQV C;  1K79 A;  1D8J A;  2VC0 A;  3S2W A;  1W7P A;  4CGZ A;  4M71 A;  1YIO A;  2NYX A;  5CVJ A;  2DK5 A;  1SAX A;  3RIR A;  4CHU A;  3F23 A;  3REO A;  5DUK A;  4N9H A;  1FBS A;  3BRO A;  1D3Y A;  3GW2 A;  5AIP A;  3IWF A;  4FX4 A;  1K78 A;  4LGW A;  3F21 A;  4KIB A;  1ZG5 A;  4RAY A;  4UV8 A;  2QQB A;  2L4A A;  2HTS A;  1EV7 A;  1Z6R A;  3CDH A;  3NRV A;  2YPR A;  4M9Z A;  3ULQ B;  3KLO A;  1U6G A;  4I7H A;  1R22 A;  4Q4Z F;  2PBI A;  5L3D A;  2MA3 A;  5ED4 A;  2IPQ X;  3ROU A;  4HF2 A;  4ZZD A;  5FD6 A;  2BBY A;  3WE2 A;  2CFX A;  3U9G A;  4HDV A;  1FBQ A;  2VE8 A;  3O6B B;  2EB7 A;  5H6R A;  3FF5 A;  1LEA A;  5DV5 A;  5BPD A;  2VOO A;  1FX7 A;  1DDN A;  5D8K B;  3G73 A;  2XKO A;  3RYP A;  2F5C A;  3DXJ F;  1FNN A;  4HQM A;  1P92 A;  3PQJ A;  4EGY A;  1KYZ A;  3ECH A;  3TKY A;  4CXF A;  3BPV A;  3VOE A;  2FOK A;  4HA8 A;  5ICF A;  3KE2 A;  5E17 F;  4BHC A;  5E1W A;  4EJO A;  2XUB A;  2VBX A;  1R58 A;  1SD6 A;  3I0T A;  4LMY A;  1O3T A;  4ENJ A;  1TTY A;  4ZYH A;  3R6S A;  2STT A;  2K7L A;  3GLX A;  4ESB A;  3L7W A;  1YW8 A;  4EV0 A;  4L9T A;  1F1Z A;  4IRH A;  1D8K A;  3HOT A;  2OZU A;  5HDK A;  4OIO F;  5CVV A;  3HYI A;  2FA5 A;  3TGN A;  2O8X A;  1F5T A;  5DD8 A;  4WF2 A;  1Z7U A;  5LLQ A;  4HV5 A;  1G6N A;  4UUV A;  5K1Y A;  1B9N A;  4OMY A;  4N0B A;  1ZRF A;  2F5D A;  4YFN F;  4IRI A;  4EJW A;  2P7C B;  2CWE A;  1L0O C;  1RI7 A;  1TQP A;  3JW4 A;  1F9N A;  3VEP A;  3CUQ B;  1E2X A;  4MHG A;  4IVN A;  4GCV A;  1KQ0 A;  2YX4 A;  3HSF A;  2UZK A;  3GZ5 A;  1SMY F;  2FBH A;  4HZF A;  3AAF A;  1TBX A;  1O7F A;  5HDG A;  4WXC A;  3GO5 A;  4HX7 A;  4QLC U;  3DEU A;  5L3E A;  2VON A;  1KYW A;  3JSO A;  4MQV A;  3GFM A;  4CO8 A;  4EMS A;  2O61 A;  3FXR A;  5D5X B;  4HOB A;  4BXU A;  1RIO H;  1BJA A;  1ZGA A;  2J5O A;  2VBZ A;  2M1B A;  1R5G A;  2DW4 A;  5HLG A;  1QBJ A;  2YSR A;  1Z91 A;  2ELH A;  5KK1 A;  4EJU A;  1XSD A;  2MH9 A;  3R0A A;  4UXN A;  1YW7 A;  2E1C A;  2HFH A;  1IN4 A;  1R00 A;  5E1X A;  1HKS A;  1MZB A;  2Z3Y A;  1P4A A;  2PLY A;  3P9I A;  3WG9 A;  4EJT A;  1Z05 A;  3F6V A;  1P4X A;  3GFI A;  4G9Y A;  4U0W A;  2D1V A;  1HSJ A;  3QAH A;  5CVI A;  2KRF A;  1S29 A;  4HW0 A;  4CDG A;  2CGP A;  2A6H F;  2IVM A;  1ODD A;  2DFI A;  4U0V A;  4S05 A;  1JE8 A;  2ZO4 A;  3GF2 A;  5D6E A;  2MC3 A;  1Y0U A;  4KFC A;  1XMK A;  5D5V B;  1I27 A;  2HTJ A;  2V1D A;  4I0A A;  4B09 A;  3P7N A;  1T2K A;  3KET A;  4D0P A;  5FD5 A;  2P5L C;  1PUE E;  3B73 A;  4EVI A;  2FBI A;  5KVR A;  2K4B A;  3IRR A;  4IXA A;  2ZXJ A;  2K02 A;  3TOB A;  3DKW A;  3WU0 A;  4B8X A;  2STW A;  2K86 A;  5AON A;  3T0Y A;  1FSE A;  5JI6 A;  2JTV A;  3WTY C;  3LQR A;  1PP8 F;  5ICC A;  1P6R A;  3R0J A;  1SFE A;  2UXN A;  3Q5F A;  1UHM A;  4ON0 A;  1YTY A;  5D5U B;  1FY7 A;  2ZCW A;  2EJR A;  3C1D A;  4MNU A;  4G94 A;  3F8M A;  1W7P B;  3RTR A;  2RVC A;  3I59 B;  3HSR A;  4MTD A;  3CTA A;  2OA4 A;  1B6A A;  2QVO A;  2Z5U A;  1OYY A;  1OYW A;  2W84 A;  1RZ4 A;  3ZMT A;  2JPC A;  3V8L A;  2DPU A;  1FYK A;  3I5U A;  3HRU A;  2QQA A;  3ABT A;  3MWM A;  2VT2 A;  1J5Y A;  2E7W A;  3E3V A;  3FWE A;  2NS0 A;  4TV7 A;  3L00 A;  2LF7 A;  2FU4 A;  1XGS A;  5BQT A;  2MLK A;  4IHT A;  1J59 A;  3H92 A;  4WXD A;  1DUX C;  1ZRD A;  1FC3 A;  2X4H A;  1XGN A;  2RC4 A;  2ACJ A;  2NAZ A;  1MJB A;  5LRS A;  4U88 A;  2XV4 S;  4KDP A;  5FLX K;  2D1H A;  4L0Y B;  1GHC A;  1IN6 A;  2P8T A;  4EJV A;  4G7O F;  3G3Z A;  1ZG1 A;  2OU2 A;  3GZ6 A;  5IT9 K;  3Q9V A;  3U1D A;  1SMT A;  5LHG A;  2HGC A;  2MBF A;  4LG0 A;  3HRS A;  2XGX A;  5FLX Z;  1LDJ A;  3GUD A;  2YR2 A;  1T0F A;  3RI4 A;  4CYD A;  2LNB A;  3HHH A;  3E6D A;  3V7S A;  2F2E A;  2PEX A;  4M74 A;  1V4R A;  3BJ6 A;  5JR3 A;  4Y17 A;  4G7Z F;  3P9C A;  1F4K A;  2QYO A;  4ZZL A;  4HQE A;  4H0E A;  5CJ9 A;  4DQ2 A;  3ZP5 A;  4M6Y A;  4WX9 A;  4LB5 A;  2GXB A;  4OIR F;  2VE9 A;  2XKP A;  1HKQ A;  6PAX A;  2O3F A;  4FT8 A;  3KP6 A;  2W25 A;  2WWY A;  1V3F A;  4ZYE A;  1BOA A;  1SFX A;  2OD5 A;  4A5N A;  4M9S A;  4YFK F;  1IRG A;  3E6B A;  4G6Q A;  3LQQ A;  2IJL A;  2QZ8 A;  3CJN A;  2VC1 A;  5L3F A;  3IL2 A;  3IWZ A;  4P9F A;  5LGT A;  3R4K A;  4HLX A;  4XBF A;  2XAH A;  3VFZ A;  1QNT A;  1UCR A;  5A2Q Z;  3ABU A;  1FOK A;  5K5R A;  3DP7 A;  5DCM A;  2J5P A;  1HW1 A;  4WXH A;  3WGG A;  3E5Q A;  2MD5 A;  1WWX A;  2ETH A;  1WQ2 A;  4BHB A;  3WGI A;  3V8J A;  4AIH A;  3KEO A;  4WWC A;  4LD5 A;  1IN8 A;  2V1U A;  1JXS A;  2XVC A;  1BI3 A;  3RJP A;  3WU1 B;  3VOD A;  1IXC A;  3T5X A;  2XIG A;  2EA2 A;  1BN5 A;  2O0Y A;  1HKT A;  3LA7 A;  1JGS A;  5DUI A;  2H27 A;  1GVJ A;  2D2W A;  1YO5 C;  2QM3 A;  2GQQ A;  4L0Z B;  5LGU A;  4BAY A;  4M73 A;  2QBY A;  1FZP B;  3V4G A;  1BI2 A;  1BI0 A;  1DPR A;  1LDD A;  1BIB A;  2HDC A;  1G4D A;  3BWG A;  5DDG A;  1REP C;  3MZH A;  4BNC A;  3KCC A;  1ZH5 A;  2DI3 A;  4GXO A;  2JT1 A;  4HDU A;  5HS8 A;  2DU9 A;  2CG4 A;  2ISZ A;  2HZT A;  1FT9 A;  2E1N A;  2A5Y B;  1ON1 A;  4XRF A;  1SD7 A;  1TLH B;  3IRQ A;  1ZG3 A;  1R36 A;  4KIC A;  1MDM B;  2HR3 A;  5L3G A;  2A6E F;  1BIA A;  1ZGJ A;  1FWZ A;  3JAM Z;  4GYG A;  5D5W B;  2BE5 F;  4EM0 B;  2IA0 A;  1HW5 A;  1G3T A;  3K9T A;  2P4W A;  5HVQ C;  2GAU A;  1W5S A;  3MEX A;  3KZZ A;  4Q5S F;  1G3W A;  2GIV A;  3JAM K;  5LEJ A;  1ZYR F;  1TW3 A;  4EQQ A;  3RKW A;  1XGM A;  4AVP A;  2GA1 A;  2ESH A;  2KKO A;  4KA4 A;  1CF7 B;  3WTX C;  1I1G A;  4OMZ A;  4HYE A;  5LEK A;  1RNL A;  4PGH A;  1W5T A;  5H6Q A;  4A5M A;  1LEB A;  1FP2 A;  1OMI A;  3ZN0 A;  1S8N A;  1LDK B;  3DPT A;  1FPQ A;  2TDX A;  1MDM A;  1B1B A;  4O5V A;  4XLN F;  1IF1 A;  3FXQ A;  2L02 A;  4Y15 A;  1UHW A;  3I58 A;  2IRF G;  2Q2E A;  3ZMV A;  3HOS A;  3R60 A;  2R7F A;  4L9N A;  2ZBK A;  1XN7 A;  3JSP A;  3ZN1 A;  2ZJ2 A;  5FFZ A;  1QGP A;  4F7Z A;  3F8N A;  3M8F A;  2PG4 A;  4I02 A;  3GXO A;  1LVA A;  5F6F A;  1X3U A;  2HWV A;  3EET A;  2FML A;  4CZZ A;  2KIM A;  2O03 A;  2DPD A;  2R7D A;  4KIF A;  3HSE A;  1W4M A;  3E6C C;  4LG0 B;  3P9K A;  3T8T A;  3QU6 A;  3IC7 A;  1IAW A;  3FZV A;  3ERE D;  2RKH A;  2RN7 A;  2M8E A;  3BJO A;  1Z9C A;  2DQL A;  2P5K A;  5DD4 A;  3QRF F;  1TQI A;  2K27 A;  3EDP A;  3QP6 A;  4NHJ A;  4S04 A;  2P6T A;  2Y48 A;  3VB2 A;  1XCB A;  2FMY A;  4KN4 X;  1XDU A;  5HS9 A;  3EYY A;  2DAO A;  2VBY A;  1R5H A;  2IA2 A;  2XRN A;  2FBK A;  1YFH A;  4PGG A;  2L4M A;  2HKX A;  3F8B A;  1IXS B;  4G7H F;  1KQ8 A;  3D5L A;  4LK1 F;  2XAS A;  1JHF A;  5L3B A;  2HOE A;  4HF1 A;  1S7A A;  1ZHF A;  1TW2 A;  3FM3 A;  1FYL A;  3K69 A;  1U8R A;  3WTW C;  4UVC A;  4BYY A;  2P6S A;  5TJJ A;  1ZAR A;  4JQF A;  1J2X A;  1OYI A;  5CLS A;  3RDI A;  4A12 A;  5CYV A;  4U7B A;  3H3Z A;  1HST A;  3F6O A;  1IN7 A;  3W6J B;  3U2R A;  2XAJ A;  2H94 A;  3WOD F;  1B59 A;  4R1H A;  3B02 A;  3HRT A;  3CUO A;  2Z9O A;  3ELK A;  4EM1 A;  2EV5 A;  5D8L B;  2A3S A;  3SFZ A;  4GO1 A;  1LB2 A;  5BS6 A;  2PMH A;  3F72 A;  4HX4 A;  1U5T C;  5E20 A;  5E1Z B;  5K5O A;  3MZY A;  2BYV E;  3WTZ A;  5ICE A;  3WTT C;  1J0R A;  4O3M A;  2A61 A;  4OIP F;  2RQP A;  2NNY A;  4LLL A;  3LAJ A;  3CUQ A;  5D4R A;  4MTE A;  3FHZ A;  2ZME A;  3E97 A;  3J80 Z;  2EFP A;  2VOD A;  2EA4 A;  2FF4 A;  1L3L A;  2R3S A;  4YII A;  3GYH X;  1P2F A;  4XSX F;  3ZMU A;  4OU0 A;  3IKV A;  4RGS A;  2AS5 F;  4WCG A;  4RAZ A;  1HBX G;  2JRT A;  2V79 A;  2ESN A;  3KEQ A;  1Z1D A;  4I98 B;  5ILS A;  2LDU A;  2HYG D;  4KNY A;  4BQA A;  3L9F A;  1K78 B;  2IW5 A;  2EFO A;  4ESF A;  3L2C A;  1FBU A;  3PFI A;  5FGM A;  1LNW A;  5FB2 A;  4UVB A;  3GFL A;  4ETS A;  4U7D A;  3R61 A;  1O3S A;  5J8C A;  2RV8 A;  2Z33 A;  2QLZ A;  1U78 A;  1GXQ A;  3I64 A;  3CO7 C;  4RGX A;  4L18 B;  1UFM A;  1O3R A;  4LK0 F;  2MLG A;  4G8X A;  3V8K A;  5D4S A;  5J8F A;  3MCZ A;  5K5Q A;  2ZKZ A;  3DV8 A;  1BI1 A;  1H0M A;  3NEU A;  1E17 A;  3OV8 A;  5A2Q K;  1J75 A;  4LLN A;  2XHK A;  5J6X A;  4XLP F;  4XSZ F;  1FSH A;  2XAF A;  4KT5 C;  1OKR A;  1CGP A;  1KU9 A;  1MJA A;  2OQR A;  1TQM A;  1BC7 C;  2Y75 A;  2M45 A;  4E70 A;  4ENM A;  5BPI A;  3ECO A;  3K1P A;  2ISY A;  3O2P E;  4YFX F;  1UST A;  2L01 A;  1UB9 A;  1I6X A;  5EEG A;  3CUQ C;  1PDN C;  2VT3 A;  5LGN A;  2W57 A;  2JZY A;  1R1T A;  5TRD A;  3GFJ A;  1KA8 A;  4FHT A;  1U5T B;  5LHH A;  2VOP A;  1HW2 A;  2IA1 A;  3K0L A;  1Z6T A;  3BJA A;  1W7P D;  3WGH A;  1XSV A;  4ENK A;  4GGG A;  1J7K A;  1R1U A;  1B4A A;  5DEQ A;  3E5X A;  3I59 A;  2KIU A;  3ZPL A;  5EEH A;  4Z2Y A;  1QPM A;  2KJC A;  1J9I A;  4MQ9 F;  4N9I A;  3KP3 A;  3K1N A;  5CVU A;  1WRJ A;  3MAJ A;  1D5V A;  4LJZ F;  3M7G A;  2Q0O A;  3BDD A;  5F64 A;  4NQW A;  4A0X A;  4KYW A;  2K4J A;  3ZMD A;  2HQR A;  3BY6 A;  2G7U A;  4HF0 A;  4ENN A;  1HQC A;  3FMS A;  1U3E M;  3CLO A;  3BPX A;  4QWQ A;  2A07 F;  4RB1 A;  5HOO A;  1ZAO A;  3K2Z A;  1YG2 A;  3SXY A;  4I2O A;  2V1X A;  3T8R A;  2VXZ A;  1K7A A;  1T98 A;  4ESJ A;  4BHP A;  1KU2 A;  3RPU A;  4UNO A;  1YS7 A;  3F8C A;  5FFX A;  1YYV A;  1O3Q A;  2XAQ A;  3C7J A;  4P96 A;  3OOP A;  4AIK A;  3I54 A;  3N97 A;  1YLF A;  3TDZ C;  1U2W A;  2GZW A;  3KP4 A;  1STZ A;  4MEX F;  4UVA A;  1GXP A;  1G3S A;  2DT5 A;  1IRF A;  2M87 A;  2CW0 F;  4Q48 A;  2W85 A;  4P55 A;  2KIF A;  4AWX B;  3HRM A;  2RNJ A;  1WKM A;  2H09 A;  1ZLJ A;  1USS A;  3I4P A;  1XB4 A;  2GXG A;  1OR7 A;  3LWF A;  3I53 A;  1VTN C;  3WTS C;  5LRR A;  1QZZ A;  1T6S A;  2FE3 A;  2KJB A;  3KP2 A;  4M72 A;  1BBY A;  1IZ1 A;  2LF8 A;  3N4M A;  3W6K B;  2E7X A;  5IT3 A;  3DPL C;  3E6M A;  4U0Y A;  4R79 A;  2EV0 A;  2Z99 A;  2V6C A;  3HTS B;  2XAG A;  4A6D A;  2XRO A;  1C0W A;  2M5W A;  5L3C A;  3JTG A;  5H20 A;  2PQ8 A;  2EFN A;  2DBB A;  3MQ0 A;  2QBY B;  2Y0M A;  2MH2 A;  2AXL A;  1RUN A;  1B9M A;  3V7C A;  4IJA A;  5JHU A;  5JVT A;  3QOP A;  1PP7 U;  2O6G E;  4FX0 A;  2F5F A;  4A0Y A; 
#chains in the Genus database with same CATH topology
 2EFQ A;  2XPV A;  3T1B A;  3ZMZ A;  2HI3 A;  2R93 J;  4JBA A;  2EWN A;  1W5C C;  4KMU X;  2QUF A;  3TOA A;  1ETO A;  1YQA A;  4LIT A;  1IUF A;  3OYL A;  2H6C A;  2OBP A;  5ILU A;  1LFB A;  5M5W J;  2LG4 A;  3H3U A;  1LJ9 A;  4XLC A;  2W4S A;  3CCR I;  3GX4 X;  4KMF A;  1OCT C;  2HYF A;  2LYC A;  1HDD C;  1IW7 F;  5CVR A;  4DNC A;  1X1D A;  1U5T A;  1QZY A;  4LLG F;  3SDG A;  4V19 K;  4LIV A;  1T56 A;  5TIS C;  4XM3 A;  5B1B H;  1XD7 A;  3BR1 A;  2WC2 A;  3ZQ7 A;  4D5F A;  1N77 A;  1MGT A;  4HLY A;  1GT0 C;  4BQO A;  3V7R A;  4L9J A;  4BUP A;  1AWC A;  3HHG A;  3ONQ A;  2ZFW A;  3CCJ I;  2IP2 A;  2MW8 A;  2CO5 A;  2CYY A;  3Q0V A;  3IKT A;  3OYA A;  1R6R A;  4DZJ A;  4L5I A;  3QU3 A;  4C2U A;  3COA C;  4BJT A;  3BOQ A;  5GPA A;  1FP1 D;  2ELJ A;  1G2H A;  4I0B A;  2H1L A;  1KQ9 A;  2BEO A;  1G3Y A;  2HOT A;  4E7H A;  2M0C A;  3ZOB A;  3CCM I;  2A69 F;  3HDD A;  2X1E A;  3S16 J;  3HTU A;  2NVQ J;  4AD9 A;  1SVM A;  2R7U A;  3KIO A;  3TO6 A;  3C3W A;  1R23 A;  1ON2 A;  2LKS A;  4AYB N;  1OR7 C;  3HUG A;  3J81 K;  1VQ7 I;  5DS9 A;  3I71 A;  2PJP A;  3LA3 A;  3FM5 A;  4I09 A;  1JUM A;  3FBN B;  2WB1 A;  3SZT A;  3JRG A;  1ULY A;  1T39 A;  2ZXW H;  1MKM A;  2E1O A;  1LVK A;  2QEN A;  2VN2 A;  5BNG A;  3GTG J;  1P7J A;  3KP5 A;  4PFP A;  3QYE A;  1TNS A;  4KIG A;  2P0W A;  2WA0 A;  3J81 Z;  1GUU A;  2DA6 A;  3I3L A;  2CRG A;  4AM3 A;  1QVT A;  2BY3 A;  2QWW A;  1EH7 A;  2YU3 A;  3KFW X;  3WTV C;  2R0Q C;  3KEY A;  4UHT A;  2DYS H;  4XKW A;  5ILV A;  4HAM A;  5M5X J;  4RGR A;  4JK1 X;  4A3D J;  2IS6 A;  1S3J A;  1HXD A;  3NQO A;  1P9Q C;  2H6B A;  4G12 A;  4A6E A;  3BG7 A;  3ZQC A;  3IHU A;  3VYT B;  3QP5 A;  1A04 A;  4ZYG A;  2CQQ A;  3TO9 A;  3J7A O;  1X19 A;  2MD0 A;  2ADU A;  1MD0 A;  2KRC A;  2Q8K A;  1AHD P;  4IHX A;  4D1Q A;  4MEY F;  2WV0 A;  2M7A A;  2IT0 A;  2ZNZ A;  3UKG A;  5HLI A;  3B6A A;  3DBR B;  4M3F A;  2AQF A;  2DMN A;  2OAZ A;  1MNE A;  2COM A;  3LA2 A;  4RBO A;  3GTK J;  5FRM A;  3S15 J;  1XGO A;  3F22 A;  3GWZ A;  2FQ4 A;  2O5R A;  1T95 A;  2LH9 A;  4MO7 A;  1LFP A;  2LP0 A;  4YG2 F;  1H8A C;  1I1S A;  4KIT B;  1S9H A;  3D5R C;  3DU6 A;  1ONV A;  2Y9Y A;  4GDF A;  2LKP A;  1SFU A;  2UXX A;  3Q3S A;  2RNG A;  1ZRC A;  1H88 C;  3G6E I;  4Q47 A;  2FXA A;  2JRM A;  2HPM A;  2JVG A;  3M9A A;  1PVE A;  1XSX A;  3TQN A;  1XX5 A;  2QQ9 A;  3CP8 A;  1XDS A;  3K4J A;  2EFW A;  4P5O A;  2DLL A;  4X1E A;  3BG3 A;  2KDO A;  3EUH C;  1CF7 A;  4L5E A;  3MKL A;  3RPQ A;  4CUG A;  3H9J A;  2VQC A;  1KGS A;  2I8D A;  1POG A;  3FMR A;  3GEZ A;  1H9T A;  2EIM H;  2HQA A;  1IRZ A;  2EZL A;  1IN5 A;  2X1C A;  1Y56 A;  4V2F A;  4ZH4 F;  4E7S A;  4L5J A;  4XOP A;  5M3M J;  1BC8 C;  3EQL F;  5E3L A;  2GWR A;  4QIW N;  3CCV I;  3CCS I;  2A68 F;  3O8H A;  2DO7 A;  2CQK A;  4RB0 A;  4PJL A;  4LFU A;  3FKJ A;  3O3K A;  1QU3 A;  2Y9Z A;  2FSW A;  2HS5 A;  1OFC X;  5ERI A;  1B8I B;  1BR2 A;  3RYR A;  2CW7 A;  2PFB A;  2PI0 A;  1JHH A;  3MVP A;  5E8I A;  3FK6 A;  3FXO A;  4RDU A;  2XAU A;  2OTJ I;  2R5Z A;  4N4O B;  4A93 J;  4ZYD A;  1Z21 A;  1TNT A;  4ZDP A;  1MJ9 A;  4IPA A;  4XOT A;  2FRH A;  2FQ3 A;  3SFI A;  3FXK A;  2OQG A;  4II3 A;  2DFE A;  3I56 I;  5HS7 A;  5FJ8 J;  3J7Y J;  2L9R A;  5ICG A;  2H8R A;  1Z77 A;  2LRD A;  4D9J A;  2WY7 Q;  4WK8 F;  1FYM A;  3KZY A;  3SHF A;  2L9N A;  4A3C J;  4BH9 A;  4A2U A;  4IF4 A;  4XKC A;  4KUM A;  3HOX J;  4PJ0 C;  2NOG A;  3VPR A;  5JFR A;  4F92 B;  4RB3 C;  2P5V A;  1DPU A;  1EH8 A;  2IGK A;  2V9V A;  4BU2 A;  3FMQ A;  1ZLK A;  1D0X A;  2IS2 A;  3FX3 A;  4MGR A;  3RKX A;  1Y1W J;  2NRA C;  1BM9 A;  1SD5 A;  2W24 A;  2EK5 A;  3G2B A;  3FHN A;  1WJA A;  4LB6 B;  4CCO A;  1MIJ A;  1V5F A;  1DP7 P;  4ASN A;  4L9V A;  2DA5 A;  2GA2 A;  3M8E A;  2EZK A;  3ML6 A;  3MFK A;  4OOI A;  3AL0 B;  1Q1H A;  3CP2 A;  2JSC A;  3KLN A;  5K7F A;  3L1P A;  4AYB A;  2BW3 B;  2X0L A;  1WSU A;  2P7V B;  2COB A;  2L7F P;  2PMU A;  5HDN A;  3S3O A;  2C6Y A;  3H35 A;  4R8H A;  4G6D A;  4RB2 C;  2R7V A;  1FMW A;  3BP8 A;  1KU7 A;  1I5Z A;  1X2N A;  4YIF A;  2EV6 A;  4Y13 A;  3OS1 A;  3J80 K;  1UG2 A;  4QSH A;  1WI9 A;  3SQN A;  4BXX J;  3JR9 A;  4C2T A;  1ETY A;  2F5V A;  3PM1 A;  1FOY A;  3ISP A;  4B3A A;  4EGZ A;  4IRG A;  1A5J A;  3EYI A;  5DCF A;  5DCM B;  1YW9 A;  5AIQ A;  1BL0 A;  2BVL A;  2E19 A;  3F3X A;  1O7L A;  3CO6 C;  1JKP C;  2V6E A;  1T8I A;  3GVA A;  4A3K J;  1O57 A;  1DU6 A;  3H0G J;  3DFG A;  1RR7 A;  2QF7 A;  1LQ1 A;  2NVY J;  5LHI A;  4HX8 A;  5GAD J;  3L09 A;  1D1A A;  1WJD A;  5J3L A;  4EM2 A;  5FO5 A;  4P9U A;  4Z6Y A;  1M1E B;  1R1V A;  3H0D A;  3C2G A;  2DQR A;  2HQN A;  1Y8R B;  2ID3 A;  2OZ6 A;  1D0Z A;  1EH6 A;  1X4P A;  4PZJ A;  1XS9 A;  1LFU P;  2BGC A;  4PFO A;  2QSG X;  5E8G A;  3ZMS A;  2LBF A;  2D45 A;  4OIN F;  1XC5 A;  4RGU A;  3DF8 A;  3L2Q A;  2DK8 A;  3GTP J;  3OOU A;  4B43 A;  1ZRE A;  1HDP A;  2VBW A;  3MD2 A;  3RQ4 A;  1ERD A;  1BW6 A;  2B0L A;  3C18 A;  4AIJ A;  5BOX A;  2LSO A;  3TDU C;  3LAP A;  3CJR B;  5CQG A;  1AOY A;  2Y2Z A;  3LFK A;  1K6Y A;  3JTH A;  4XRS A;  2EH3 A;  3PFY A;  1I6H J;  2OTL I;  1QO0 D;  4O6J A;  4C3H J;  2ECB A;  3KP7 A;  3QPT A;  5IPA A;  2RAE A;  4K2E A;  2QSH X;  4M6X A;  3G4S I;  4M3G A;  2CSO A;  3ZRG A;  1T38 A;  1MND A;  2O8K A;  4B3X A;  2JJ7 A;  3LST A;  3SEZ A;  3DLA A;  4E7L A;  4HV6 A;  4IHV A;  1IV6 A;  2B9S A;  1ZR2 A;  1WGX A;  5JLX A;  1IUY A;  2HVR A;  3MKZ A;  4BEH B;  3L2V A;  3LSP A;  3Q0W A;  4GYI A;  2PN6 A;  2R5Y B;  1D1B A;  2BV6 A;  2F5E A;  2W1O A;  4BDY A;  1U8B A;  3RKY A;  3M1E A;  1KU3 A;  3WG7 H;  5F27 A;  2L3D A;  4XID A;  4I99 C;  2M30 A;  1I3Q J;  2L54 A;  2RGV A;  1EKE A;  1IXR C;  2XGD A;  3E5U A;  1VZ0 A;  1XCV A;  5F0C A;  5B1A H;  1R5I D;  4B48 A;  1S6L A;  1QQI A;  3OIP A;  3Q9S A;  3QQA A;  1J09 A;  1NHA A;  2LY2 A;  2CFO A;  1NK2 P;  1MMS A;  2HOA A;  1R7J A;  4F55 A;  1FLI A;  4CIC A;  2FEZ A;  1P4W A;  2QEX I;  2R4G A;  2E1M C;  1UHS A;  3RZO J;  2FNP A;  1K6O A;  4M9X A;  3OS0 A;  4A0Z A;  3H5R A;  2ZME B;  4HPQ A;  3QPS A;  4RS8 A;  3OYH A;  2GM4 A;  1OPC A;  2BOL A;  2DTR A;  1VND A;  4PUS A;  4BBS J;  4A3B J;  1R4N B;  1S7O A;  4HBL A;  4ANJ A;  5IY5 H;  3WE3 A;  4NB5 A;  4KIS A;  2HKO A;  5D6F A;  1R9T J;  4CA0 A;  2RDP A;  2YX7 A;  4JOM A;  3OY9 A;  2LR8 A;  2VXD A;  5HLH A;  2HEO A;  4OIQ F;  4PCQ A;  3HIF A;  1TT0 A;  3TO7 A;  2ID6 A;  4KN7 X;  1FMV A;  3FK7 A;  3A0H C;  3OYB A;  2CV0 A;  2ZNY A;  1TP4 A;  2KDZ A;  1F36 A;  1Z0X A;  5DYM A;  1SD4 A;  3PQK A;  1OCP A;  2QGU A;  2V26 A;  5E18 F;  4UV9 A;  3O8G A;  4IHS A;  5LBQ A;  1WJ5 A;  2LMD A;  2DA2 A;  2YS9 A;  1RUO A;  2ME0 A;  1XMA A;  3VYR B;  3PIP F;  1YHQ I;  1ZGW A;  5BMZ A;  3N05 A;  4OAY A;  3SZP A;  4YRV A;  3H3V K;  4NNJ A;  1YS6 A;  5F1R A;  3FXL A;  1ZN2 A;  3BZ6 A;  2WTE A;  3MKW B;  1WJC A;  3IAM 2;  3D0S A;  4ITV A;  2HPI A;  3DCF A;  3ASO H;  3K1M A;  5KAF C;  5IT9 Z;  3M4O J;  3PNV A;  2FNA A;  2JVH A;  4E7I A;  3WTU C;  2NNN A;  3BTL A;  3EUH A;  3FXU A;  2G7H A;  4PDK A;  2E71 A;  2OPT A;  1K61 A;  2G9W A;  1H9G A;  3F8F A;  2XC7 A;  4RAF A;  2JPB A;  3QPH A;  3HC7 A;  4I01 A;  3TP0 A;  4V2G A;  4C9Y A;  2UWM A;  3DQV C;  2V9K A;  2F4O B;  2BZT A;  3H9Q A;  1K79 A;  2JQ7 A;  2DT7 B;  2HXI A;  4XKV A;  1D8J A;  1SVO A;  2VC0 A;  4HSR A;  1LE8 B;  3BT9 A;  3S2W A;  2MSY A;  3SDB A;  1W7P A;  2MFZ A;  5FLV A;  1Y1V J;  3L2R A;  4I76 A;  4M71 A;  4CGZ A;  1YIO A;  3ZR8 X;  2NYX A;  5CVJ A;  3HOW J;  4F91 B;  3JRI A;  2DK5 A;  3MMY B;  1G8X A;  1SAX A;  3RIR A;  4CHU A;  2HVQ A;  3F23 A;  3REO A;  2DMQ A;  1ETX A;  3CLQ A;  5DUK A;  4N9H A;  4BEH A;  1FBS A;  2Z1D A;  3BRO A;  1D3Y A;  3GW2 A;  5AIP A;  2ZSI B;  3IWF A;  4FX4 A;  1K78 A;  2LKX A;  1CQT A;  1YOV B;  3M3Y J;  2UUZ A;  2V1N A;  4LGW A;  2K9M A;  3F21 A;  2E60 A;  2RQQ A;  3D1N I;  4KIB A;  3LSG A;  2HYJ A;  4M3B A;  1ZG5 A;  2JA7 J;  4C3I J;  2E2J J;  3BZK A;  4RAY A;  4UV8 A;  2E35 A;  2QQB A;  2L4A A;  2HTS A;  1EV7 A;  1Z6R A;  3CDH A;  3K70 D;  3NRV A;  1JKO C;  2YPR A;  4M9Z A;  3ULQ B;  1YJW I;  2V4J C;  3KLO A;  3UR3 C;  4NDL A;  4ZDO A;  1U6G A;  4A3E J;  4I7H A;  2XRL A;  4XRS G;  1R22 A;  2DOD A;  4Q4Z F;  2PBI A;  5L3D A;  2MA3 A;  2QQ8 A;  5ED4 A;  1RES A;  1FIP A;  3OIQ A;  4UUS B;  3HOU J;  2KT0 A;  3OYN A;  1X1A A;  2IPQ X;  2Y30 A;  3ROU A;  4HF2 A;  2WBM A;  4ZZD A;  4QPQ A;  5FD6 A;  1S7E A;  2BBY A;  3WE2 A;  2CFX A;  3U9G A;  3JRH A;  4HDV A;  1FBQ A;  2VE8 A;  2GLO A;  3O6B B;  2CV2 A;  2EB7 A;  2FUG 2;  5H6R A;  1SC7 A;  3FF5 A;  3IP4 B;  1LEA A;  5DV5 A;  2ELK A;  5BPD A;  5IYD J;  3OSG A;  2M9H A;  2QSF X;  1N25 A;  1FX7 A;  3HKZ N;  1DDN A;  2VOO A;  5D8K B;  1V54 H;  2ZME C;  3G73 A;  2XKO A;  2FD5 A;  3D5S C;  2CJJ A;  2E1M B;  1MNM C;  3HXL A;  3RYP A;  2F5C A;  2IS1 A;  1SFO J;  3DXJ F;  2L7K A;  1FNN A;  4HQM A;  1P92 A;  1MMA A;  3PQJ A;  3K4K A;  4EGY A;  4FE4 A;  1KYZ A;  5C3E J;  2NVT J;  3ECH A;  3TKY A;  4CXF A;  3BPV A;  3VOE A;  2FOK A;  4HA8 A;  1IRX A;  5ICF A;  3KE2 A;  2W48 A;  4MIM A;  5E17 F;  1IV8 A;  1O4X A;  4BHC A;  5E1W A;  3G1O A;  2F4M B;  4EJO A;  1I50 J;  2XUB A;  2VBX A;  1R58 A;  1SD6 A;  3G1M A;  3I0T A;  4LMY A;  1O3T A;  3JCU C;  4ENJ A;  3HEF A;  1OLT A;  1TTY A;  4ZYH A;  5HLT A;  3R6S A;  3BTJ A;  2STT A;  2WB1 N;  2K7L A;  3GLX A;  4ESB A;  3L7W A;  4IL6 C;  2ICW G;  1YW8 A;  4EV0 A;  4L9T A;  4UB8 C;  1F1Z A;  1VQO I;  4IRH A;  2EZI A;  3OYI A;  1D8K A;  3BG6 A;  3HOT A;  1TWH J;  2OZU A;  5HDK A;  4OIO F;  5CVV A;  2DTZ A;  3HYI A;  2K9S A;  3F0C A;  2FA5 A;  2VQL A;  3TGN A;  4H4K C;  4X0G A;  2OF7 A;  2O8X A;  4J01 A;  1F5T A;  5DD8 A;  4WF2 A;  3DTI A;  1R4M B;  1Z7U A;  2XB0 X;  2NXN B;  5LLQ A;  5FLM J;  4DBR A;  4HV5 A;  1G6N A;  3CC2 I;  5H2F C;  4UUV A;  2NVU B;  5K1Y A;  1B9N A;  2DXI A;  4HNT A;  4OMY A;  4N0B A;  1ZRF A;  2F5D A;  1BR4 A;  3GTL J;  1JJ8 C;  5DM7 F;  4YFN F;  3OIO A;  4IRI A;  4U87 A;  4EJW A;  2VQG A;  2P7C B;  2CWE A;  1L0O C;  1RI7 A;  1TQP A;  3JW4 A;  1F9N A;  3VEP A;  2A05 A;  5GP9 A;  3CUQ B;  1E2X A;  4MHG A;  1TWC J;  3CQZ J;  4IVN A;  1SFK A;  1UMQ A;  3BZC A;  4GCV A;  3WU2 C;  1VQ9 I;  1OCZ H;  1KQ0 A;  2YX4 A;  3HSF A;  1IG7 A;  4NC7 A;  5C4J J;  2UZK A;  3GZ5 A;  4RLF A;  4EAT A;  4YEL A;  1SMY F;  2FBH A;  3LSI A;  4HZF A;  2CUE A;  3AAF A;  5KAI C;  1TBX A;  1O7F A;  2CQ7 A;  5HDG A;  4JP0 A;  4WXC A;  5F04 A;  3GO5 A;  2PMZ A;  4HX7 A;  4XN0 A;  1PJR A;  3IV5 A;  1D5Y A;  4QLC U;  1BR1 A;  3DEU A;  5L3E A;  4QTR A;  3HJE A;  3M8J A;  3DKX A;  2VON A;  1KYW A;  3KYL A;  3JSO A;  2NS8 A;  4MQV A;  3GFM A;  3BLY A;  2NS7 A;  4CO8 A;  2F4I A;  4EMS A;  2O61 A;  4MLO A;  3FXR A;  2X1D A;  2JMW A;  5D5X B;  4HOB A;  2X6X A;  4BXU A;  1RIO H;  2KL4 A;  1BJA A;  1UEL B;  1MSE C;  3BG9 A;  3OL3 A;  2YU9 J;  5J1Y A;  1ZGA A;  2L7M P;  3FIW A;  2J5O A;  2X9D A;  2VBZ A;  1W0T A;  2R5Z B;  2M1B A;  2CQN A;  1ORK A;  1R5G A;  2DW4 A;  1P7I A;  5HLG A;  2XGC A;  1QBJ A;  1ACI A;  1XG1 A;  2YSR A;  1Z91 A;  4A3I J;  2IBD A;  2ELH A;  5KK1 A;  1WFX A;  4EJU A;  2XPU A;  4Y7N J;  2IXS A;  5J4Y A;  2AXT C;  1XSD A;  3F9K A;  2MH9 A;  3R0A A;  2CUF A;  2R5Y A;  1V5E A;  4F52 A;  2VKE A;  1YW7 A;  2W00 A;  4UXN A;  2E1C A;  2HFH A;  1IN4 A;  1ZTR A;  1YJ9 I;  3K6G A;  1R00 A;  3WHC A;  5E1X A;  1HKS A;  1MZB A;  2Z3Y A;  3W3C A;  4BE2 A;  1P4A A;  2PLY A;  1XPX A;  2NOJ B;  3P9I A;  3WG9 A;  3S17 J;  4EJT A;  2EQR A;  1Z05 A;  2L7Z A;  2TCT A;  1B72 B;  2E2H J;  3F6V A;  1P4X A;  1GV2 A;  4G9Y A;  4U0W A;  3GFI A;  2D1V A;  1HSJ A;  3QAH A;  5CVI A;  1JGG A;  2KRF A;  1S29 A;  4HW0 A;  4CDG A;  2CGP A;  3JRA A;  2VQH A;  3FKI J;  2K3F A;  2A6H F;  2L5Q A;  3NAU A;  2IVM A;  4LIU A;  4ZC3 A;  4DZP A;  4UB6 C;  1ODD A;  4P1W A;  4BJ6 C;  2HOS A;  3HOZ J;  2DFI A;  4U0V A;  4S05 A;  1JE8 A;  2XSD C;  2ZO4 A;  3GF2 A;  5FKL A;  1GVD A;  5D6E A;  2MC3 A;  1Y0U A;  2EPF A;  4KFC A;  4FIS A;  2DA3 A;  1XMK A;  5D5V B;  1I27 A;  2HTJ A;  1Z3Y A;  2V1D A;  4I0A A;  4BJ5 C;  4B09 A;  1R49 A;  3P7N A;  1T2K A;  3KET A;  1MBK A;  5FD5 A;  4D0P A;  4FE7 A;  2P5L C;  1QA6 A;  1PUE E;  3G71 I;  1ENH A;  3B73 A;  4HEA 2;  2FJ1 A;  2FBI A;  5KVR A;  4EVI A;  2K4B A;  3IRR A;  2QKL B;  4IXA A;  2ZXJ A;  3SZG A;  2K02 A;  3TOB A;  3DKW A;  3WU0 A;  4B8X A;  2HXO A;  1UG0 A;  4IQ4 A;  2STW A;  2HZD A;  2R92 J;  1N75 A;  1JKQ C;  3CF5 F;  2K86 A;  5AON A;  3T0Y A;  1FSE A;  5JI6 A;  4UUS A;  1T08 B;  4AID A;  4B47 A;  3PIO F;  2JTV A;  3WTY C;  3LQR A;  1MW7 A;  5ICC A;  1PP8 F;  1P6R A;  3R0J A;  1SFE A;  2UXN A;  1A35 A;  3Q5F A;  1UHM A;  2CU7 A;  2XF7 A;  1W0U A;  3PSF A;  2HVS A;  2DDB A;  1TT5 B;  4ON0 A;  1YTY A;  5J47 A;  5D5U B;  2PX9 A;  1FY7 A;  2WY8 Q;  1VQ5 I;  2DT6 A;  2ZCW A;  2EJR A;  4J19 A;  4BAC A;  4F93 B;  3C1D A;  1RET A;  4MNU A;  3W2W A;  2IGN A;  3OYG A;  1B8I A;  4G94 A;  4CCJ A;  3F8M A;  5FRN A;  2G0E A;  2I5U A;  1W7P B;  3RTR A;  2RVC A;  4J00 A;  4Y52 J;  3I59 B;  4JX4 A;  3HSR A;  2KZG A;  4MTD A;  3CTA A;  2VB6 A;  2OA4 A;  3A02 A;  2OV7 A;  1B6A A;  4NUB A;  2QVO A;  2Z5U A;  3L2W A;  1OYY A;  5J1R A;  1MBE A;  1OYW A;  2W84 A;  1RZ4 A;  3SJM A;  3ZMT A;  2JPC A;  4NC6 A;  3OL4 A;  1X2M A;  4RM3 A;  3V8L A;  5IOZ A;  1MSF C;  2Y69 H;  2E5N A;  3DLL F;  2DPU A;  1FYK A;  4XON A;  2A6T A;  1Z67 A;  3KYC B;  3I5U A;  3NAR A;  3JRF A;  3HRU A;  2QQA A;  3ABT A;  2VJJ A;  2EIK H;  3MWM A;  2E5Z A;  1J5Y A;  2VT2 A;  2EIJ H;  2E7W A;  3E3V A;  3FWE A;  2XB5 A;  3LSK A;  2K9L A;  2NS0 A;  4CCL A;  4TV7 A;  2MYS A;  1TWA J;  3L00 A;  2LF7 A;  3PJR A;  2FU4 A;  1XGS A;  3FXM A;  2XF6 A;  5BQT A;  2Y0S A;  2MLK A;  1U9N A;  4IHT A;  2V7F A;  4ABZ A;  3A01 B;  1J59 A;  1VQN I;  3H92 A;  1FOW A;  4WXD A;  1DUX C;  2CMP A;  1ZRD A;  1FC3 A;  4E7K A;  5C44 J;  1GLN A;  2VAS A;  2X4H A;  4CH7 A;  9ANT A;  1XGN A;  2RC4 A;  3DWL E;  4AVZ A;  2ACJ A;  3CES A;  2NAZ A;  1MJB A;  1PUF A;  4BE1 A;  5LRS A;  1JI8 A;  4U88 A;  2XV4 S;  4KDP A;  3DEE A;  2Y31 A;  3X2Q H;  5FLX K;  2D1H A;  4E4H A;  4L0Y B;  1GHC A;  5F08 A;  1IN6 A;  3ZCO A;  1K4T A;  2P8T A;  4EJV A;  3BTI A;  3Q0U A;  2M8G X;  3DU5 A;  3GLL A;  4G7O F;  3G3Z A;  5EGO B;  3CMY A;  1ZG1 A;  5CPR B;  2OU2 A;  1Y39 A;  3GZ6 A;  2Z2S B;  5B66 C;  1FIA A;  2CV1 A;  5IT9 K;  3Q9V A;  1ZQ3 P;  1UAA A;  4DJA A;  3S1R J;  1LKX A;  3U1D A;  3OYM A;  1SMT A;  3TW6 A;  5LHG A;  1PUF B;  3L2U A;  2HGC A;  2QCO A;  4IEJ A;  1X3Z B;  2MBF A;  4E6K G;  2KLO A;  4LG0 A;  3HRS A;  2XGX A;  5FLX Z;  1LDJ A;  2K40 A;  3GUD A;  2YR2 A;  4S0H B;  1T0F A;  3RI4 A;  4CYD A;  1JTX A;  2LNB A;  4B44 A;  3HHH A;  3E6D A;  3V7S A;  1ETW A;  3IH4 A;  1FOX A;  1A6I A;  5M3F J;  2F2E A;  2PEX A;  4M74 A;  4YEJ A;  1V4R A;  4E7J A;  4PJJ A;  3BJ6 A;  5JR3 A;  1Z3X A;  4DBQ A;  4Y17 A;  4IOC F;  4G7Z F;  5EYR A;  3P9C A;  2DDA A;  2ZXI A;  1F4K A;  2QA4 I;  2B7E A;  2QYO A;  4ZZL A;  3TBI A;  5GPC A;  2ZJP F;  4H0E A;  4HQE A;  2M7B A;  1OCO H;  2VJI A;  3AG1 H;  5CJ9 A;  2H8W A;  1VFC A;  4DQ2 A;  3K7A J;  2X6W A;  3HG9 A;  1TC3 C;  4OWR B;  3ZP5 A;  2X6O A;  4M6Y A;  4WX9 A;  4ZTJ A;  1MMN A;  4LB5 A;  2GXB A;  1SAU A;  1IO2 A;  3GCM A;  4BXF A;  5J4V A;  4OIR F;  1D0Y A;  2VE9 A;  1DQU A;  1MH3 A;  2XKP A;  1HKQ A;  6PAX A;  3LSR A;  2O3F A;  4FT8 A;  2W82 A;  5EZG A;  4M3E A;  3KP6 A;  2IS4 A;  2WAQ N;  2W25 A;  3ERM A;  2WWY A;  3DTK A;  1V3F A;  4ZYE A;  1BOA A;  1SFX A;  2OD5 A;  5CQE A;  4A5N A;  1RKT A;  4M9S A;  2M4K A;  3PUF A;  4YFK F;  3LMM A;  2VLA A;  1IRG A;  4XQF A;  3E6B A;  3DTE A;  1E3P A;  3M07 A;  5J1U A;  4G6Q A;  5DTD A;  3GTO J;  3DPU A;  3LQQ A;  1YIT I;  3OSF A;  2IJL A;  1AKH A;  2OJE D;  3H36 A;  2QZ8 A;  2JA8 J;  2KIQ A;  3CJN A;  5CKT A;  3ABM H;  1JTY A;  2VC1 A;  3NWS A;  3HGY A;  1T33 A;  4HNU A;  5L3F A;  1NTC A;  3AG2 H;  3IL2 A;  3IWZ A;  4I6Z A;  4GFB A;  1EA3 A;  4P9F A;  4XL9 A;  5LGT A;  3HL2 A;  4CCK A;  1YJN I;  3CDI A;  1KON A;  1WI3 A;  3R4K A;  3BR2 A;  4X6A J;  3K4L A;  4HLX A;  4XBF A;  4DIQ A;  1RR8 C;  4BL0 B;  3AKZ A;  2XAH A;  5KCM A;  3VFZ A;  3AL0 C;  4YIR X;  1QNT A;  1UCR A;  5A2Q Z;  3ABU A;  2P81 A;  4FAS D;  1FOK A;  3CME I;  5K5R A;  3DP7 A;  5EG0 B;  3S2H J;  5DCM A;  2J5P A;  1HW1 A;  4WXH A;  1JUP A;  3WGG A;  4PSW A;  3E5Q A;  2MD5 A;  3DBH B;  1VQ6 I;  1WWX A;  3BCA A;  4XK4 A;  2ETH A;  5IYC J;  1WQ2 A;  4BHB A;  2V9P A;  3H5A A;  3WGI A;  3CC7 I;  3V8J A;  4AIH A;  3PUB A;  5J40 A;  3KEO A;  4WWC A;  2ZSH B;  4LD5 A;  1IN8 A;  2V1U A;  4ZYA A;  1JXS A;  3E7L A;  2XVC A;  1BI3 A;  4Y3O A;  3RJP A;  3V42 A;  2OCC H;  3WU1 B;  4A3F J;  3VOD A;  1IXC A;  5LFA A;  1F43 A;  2FX0 A;  3T5X A;  2H1K A;  2XIG A;  2EA2 A;  1MBH A;  1A6Q A;  1IC8 A;  2VKV A;  2ZB9 A;  1BN5 A;  4XN3 A;  2M34 A;  2O0Y A;  1HKT A;  1WPK A;  3LA7 A;  1JGS A;  3LOC A;  5DUI A;  2H27 A;  3AG4 H;  2MGQ A;  1AU7 A;  1GVJ A;  4FET A;  3VWB A;  3CD6 I;  2D2W A;  3HBL A;  1YO5 C;  2QM3 A;  3WHB A;  3AFH A;  3K2A A;  1MMG A;  2GQQ A;  4L0Z B;  5F1J A;  2LC2 A;  4CCM A;  4ZDL A;  5LGU A;  3EUA A;  4BAY A;  4AUX A;  4M73 A;  2QBY A;  5E3O A;  2DOE A;  3CJQ B;  3CC4 I;  4RLQ A;  1FZP B;  2PMZ N;  3V4G A;  1BI2 A;  1BI0 A;  4C2M J;  1DPR A;  1LDD A;  2F48 A;  1BIB A;  2HDC A;  1FTT A;  2M0M A;  5HNH A;  2VJ4 A;  3PO2 J;  2DMP A;  4BY7 J;  3I55 I;  3JRB A;  1G4D A;  3BWG A;  3TED A;  1QPI A;  1YX3 A;  1DU0 A;  5DDG A;  1REP C;  2AO9 A;  5TGT A;  3ABL H;  3UNG C;  5B3S H;  3MZH A;  2HDW A;  4BNC A;  5FRO A;  3KCC A;  1ZH5 A;  1N78 A;  1X58 A;  2DI3 A;  2DA7 A;  3KX2 A;  4GXO A;  2JT1 A;  4HDU A;  5HS8 A;  2DU9 A;  2CG4 A;  3U21 A;  3OYF A;  3S14 J;  3H1C A;  5FKM A;  2ISZ A;  2HZT A;  4HNV A;  1YX5 A;  1FT9 A;  2E1N A;  2A5Y B;  1ON1 A;  4XRF A;  1SD7 A;  1LE8 A;  1TLH B;  3IRQ A;  3HPH A;  1ZG3 A;  4UUT A;  1R36 A;  4KIC A;  4PSX A;  3IH2 A;  1LPQ A;  1MDM B;  2HR3 A;  3LL7 A;  5L3G A;  1JT0 A;  2A6E F;  1BIA A;  1ZGJ A;  3GTJ J;  1FWZ A;  4RMN A;  3JAM Z;  2VPR A;  4Y4R A;  4GYG A;  2OUM A;  1X1C A;  1X1B A;  1OQY A;  5D5W B;  3W2V A;  4DYC A;  2BE5 F;  2K9N A;  4BDZ A;  4XR6 A;  1IGN A;  4EM0 B;  2IA0 A;  1WH7 A;  2L9S A;  2BXZ A;  2XF5 A;  5GAG J;  4BQN A;  1HW5 A;  1G3T A;  2GIZ A;  3K9T A;  4F3Q A;  2P4W A;  4CZC A;  5HVQ C;  2GAU A;  1W5S A;  3RZD J;  2M2E A;  3MEX A;  3KZZ A;  3TW7 A;  2JWT A;  4Q5S F;  1G3W A;  2GIV A;  3JAM K;  4DGW B;  1ZYR F;  2KQR A;  5LEJ A;  1IDY A;  1TW3 A;  3S8P A;  4EQQ A;  2W7N A;  3RKW A;  1XGM A;  1TZL A;  2FOW A;  4AVP A;  2D5V A;  2GA1 A;  1XTA A;  4BKX A;  2ESH A;  2MC4 A;  2CH0 A;  3ZXS A;  1NG7 A;  2KKO A;  2M3A A;  4KA4 A;  1CF7 B;  1QHH D;  3WTX C;  3MKY B;  1I1G A;  4OMZ A;  4HYE A;  4XKB A;  5LEK A;  1Y8Q B;  1RNL A;  2QKM B;  3HPG A;  4IQJ A;  3BR0 A;  1ZK8 A;  4PGH A;  3S3M A;  1W5T A;  5H6Q A;  3KYD B;  4A5M A;  1LEB A;  1FP2 A;  1OMI A;  2CQX A;  4JX6 A;  2WAD A;  3ZN0 A;  4D7N A;  1S8N A;  1LDK B;  3DPT A;  4IHY A;  1FPQ A;  1K83 J;  2BY0 A;  2TDX A;  2DFF A;  1B1B A;  1MDM A;  4O5V A;  4XOR A;  4XLN F;  1IF1 A;  2YUS A;  3FXQ A;  2L02 A;  3FIS A;  4Y15 A;  3GZN B;  5B5E C;  1UHW A;  3I58 A;  2EZH A;  3LFU A;  2HQ5 A;  3I4N J;  5FKN A;  2IRF G;  2Q2E A;  3A1Y A;  3ZMV A;  1Q1V A;  3HOS A;  3QOE A;  3VDX A;  3R60 A;  3OR2 C;  4CYC A;  2R7F A;  4PJN A;  2HDD A;  1VQM I;  3C2H A;  2ZBK A;  1XN7 A;  4L9N A;  3ZQQ A;  3ZN1 A;  3JSP A;  2LD5 A;  2DJN A;  2ZJ2 A;  1EF4 A;  5FFZ A;  1QGP A;  4F7Z A;  4OAZ A;  2BY2 A;  1X1P A;  3F8N A;  2XPW A;  3M8F A;  4E7Z A;  2KPM A;  2LFB A;  2PG4 A;  1RPW A;  5IP6 A;  4I02 A;  3GXO A;  2AQE A;  1LVA A;  3DBL B;  1S5L C;  3SYT A;  4A69 C;  5F6F A;  1BOB A;  2E2I J;  1X3U A;  5EG0 A;  2HWV A;  3EET A;  3HUG B;  5JHF A;  2FML A;  4CZZ A;  3CCL I;  2KIM A;  2O03 A;  1WJF A;  2DPD A;  2M4G A;  2Q1Z B;  2R7D A;  4KIF A;  3HSE A;  1W4M A;  3ZQG A;  3E6C C;  4LG0 B;  3C2B A;  3K4C A;  2L0K A;  3FBI B;  4KT6 A;  3QPL A;  3P9K A;  3T8T A;  3QU6 A;  3IC7 A;  3JRD A;  1KZH A;  3MN2 A;  1IAW A;  3FZV A;  3ERE D;  2RKH A;  2RN7 A;  4Y33 A;  2B63 J;  2M8E A;  1I39 A;  3NWT A;  2L9V A;  3BJO A;  3CMM A;  3KPH A;  1Z9C A;  5GAH J;  2DQL A;  2P5K A;  2Z16 A;  5DD4 A;  1RRJ A;  3QRF F;  1V55 H;  5F0H A;  3S3N A;  1TQI A;  3H9G A;  4KJZ A;  2VIX A;  2K27 A;  3EDP A;  3QP6 A;  2EIL H;  3E1S A;  4NHJ A;  3K4N A;  4S04 A;  2R7R A;  2P6T A;  2Y48 A;  3VB2 A;  1XCB A;  2FMY A;  2BVM A;  1XDU A;  4KN4 X;  5HS9 A;  3W6V A;  2ZJQ F;  3EYY A;  3ZGK A;  2DAO A;  2XGE A;  2VBY A;  1R5H A;  2IA2 A;  2XRN A;  2FBK A;  2LY9 A;  1YFH A;  5IOY A;  4A3L J;  4PGG A;  3EPZ A;  2L4M A;  1T0F C;  2HKX A;  2JK3 A;  3CCE I;  1A36 A;  2VKD A;  4BS9 A;  4D5C A;  1W1W E;  1GV5 A;  4BY1 J;  3JRE A;  3A0B C;  3F8B A;  4BGD A;  3S1Q J;  1IXS B;  4G7H F;  4MFD A;  1KQ8 A;  5GAE J;  4PK4 A;  3D5L A;  2WV1 A;  4LK1 F;  1HA8 A;  1U0J A;  1SEU A;  1NK3 P;  1WCM J;  3VSK A;  2XAS A;  1JHF A;  3PL8 A;  5L3B A;  2HOE A;  2MG4 A;  4HF1 A;  2IGM A;  2WAF A;  1TL8 A;  1S7A A;  3LSJ A;  1WH5 A;  2DOF A;  1SAN A;  1ZHF A;  1TW2 A;  3FM3 A;  4ZTF A;  1FYL A;  3K69 A;  1U8R A;  3WTW C;  3OYJ A;  4UVC A;  2VUM J;  4BYY A;  2P6S A;  1BJZ A;  5TJJ A;  1ZAR A;  4JQF A;  4C3J J;  4LOC A;  3ZQF A;  4II2 A;  1J2X A;  1OYI A;  3IH3 A;  3U1K A;  3BC8 A;  5CLS A;  3RDI A;  5EDN A;  4A12 A;  3BQY A;  5CYV A;  4U7B A;  3HM5 A;  4ZJZ A;  3BG5 A;  1TWF J;  3K70 C;  3OYK A;  3K4M A;  1VQL I;  4IZZ A;  3H3Z A;  4XNF A;  1HST A;  4RM2 A;  3F6O A;  1IN7 A;  3W6J B;  2DFH A;  3U2R A;  3VSL A;  2XAJ A;  4EEF G;  2H94 A;  3WOD F;  3S32 A;  1B59 A;  4DYR A;  4R1H A;  1X3W B;  3HOY J;  1HF0 A;  2WAE A;  3B02 A;  5JLW A;  1OCC H;  2DJI A;  3HRT A;  2O9L A;  4HRI A;  3CUO A;  2Z9O A;  3ELK A;  4EM1 A;  2R7X A;  2EV5 A;  5D8L B;  2A3S A;  1DGR M;  4GO1 A;  3SFZ A;  3VYU B;  1LB2 A;  5BS6 A;  4AU7 A;  2PMH A;  3F72 A;  4HX4 A;  1U5T C;  2MAB A;  3OYE A;  5E20 A;  5E1Z B;  5EEA A;  5K5O A;  3MZY A;  2BYV E;  2UV1 A;  4D7M A;  2ECC A;  5DM6 F;  5JVG F;  4BBR J;  2AHQ A;  3S93 A;  2VI6 A;  3WTZ A;  5ICE A;  3JRC A;  5KNL A;  3WTT C;  1J0R A;  4O3M A;  2A61 A;  2GBY A;  4OIP F;  3IAS 2;  1BW5 A;  2RQP A;  4XLE A;  3S1M J;  2NNY A;  1ETV A;  4LLL A;  3ZQL A;  3LAJ A;  3E0J B;  2R7Z J;  1WZ2 A;  4HG2 A;  3CUQ A;  5D4R A;  2VJ5 A;  4MTE A;  3FHZ A;  2ZME A;  3E97 A;  5E3N A;  2NVX J;  2CW8 A;  1H89 C;  2VKH A;  3J80 Z;  1UZC A;  2EFP A;  2VOD A;  2EA4 A;  3S1N J;  4DOZ A;  2K5C A;  2FF4 A;  5IYB J;  3QYB A;  2DOA A;  1L3L A;  4IHW A;  1D1C A;  2R3S A;  5KHD A;  4YII A;  2KZV A;  3GYH X;  1P2F A;  4RAG A;  4XSX F;  3ZMU A;  2IEK A;  5HOD A;  3J7A Y;  1AA7 A;  1LUJ B;  1PYV A;  3IKV A;  4OU0 A;  4RGS A;  2AS5 F;  2KMU A;  4WCG A;  4RAZ A;  1HBX G;  1HLV A;  2JRT A;  2V79 A;  3ASN H;  2ESN A;  3KEQ A;  1Z1D A;  4I98 B;  5ILS A;  2LDU A;  2HYG D;  4KNY A;  4BQA A;  3L9F A;  1K78 B;  1AKH B;  2IW5 A;  2EFO A;  4ESF A;  3L2C A;  1FBU A;  2DYR H;  3PFI A;  1JJ6 C;  5FGM A;  1LNW A;  4LG3 A;  4GRI A;  5FB2 A;  3KZI C;  3BQZ A;  4QPO A;  4UVB A;  3GFL A;  4ETS A;  5C4X J;  3AG3 H;  4U7D A;  2HU9 A;  3CCU I;  2KHM A;  3GTQ J;  3R61 A;  1O3S A;  2GOM A;  4DW6 A;  3CF2 A;  5J8C A;  2BXY A;  2RV8 A;  2Z33 A;  2QLZ A;  2LOO A;  1U78 A;  1GXQ A;  3IUO A;  2EIN H;  3I64 A;  3DEW A;  4RGX A;  3CO7 C;  4A3M J;  4L18 B;  1VQP I;  2BHZ A;  3QYF A;  4NBQ A;  1UFM A;  1O3R A;  3SEQ A;  3RQI A;  3HGG A;  4N4N B;  3CZ6 A;  2RRE A;  3LSH A;  4LK0 F;  3RKQ A;  2MLG A;  4G8X A;  4B1R A;  3V8K A;  5D4S A;  1VQK I;  5J8F A;  4XRM A;  1G59 A;  3MCZ A;  5K5Q A;  2K9Q A;  2ZKZ A;  3S2D J;  3CMA I;  1JT6 A;  4A3J J;  1WJB A;  3DV8 A;  3PNY A;  4M3D A;  1BI1 A;  1H0M A;  2KP6 A;  3NEU A;  1E17 A;  3RCO A;  3OV8 A;  5A2Q K;  2E34 A;  2Y0S N;  1J75 A;  4LLN A;  3HZJ A;  2XHK A;  5J6X A;  1QHG A;  1YRN B;  3GTM J;  4XLP F;  4XSZ F;  1SVL A;  1FSH A;  2XAF A;  1UJ8 A;  1WHU A;  4KT5 C;  5E79 C;  4B4C A;  1OKR A;  3BR3 A;  1CGP A;  1KU9 A;  1MJA A;  2OQR A;  1TQM A;  5EJC A;  2Y75 A;  2M45 A;  1BC7 C;  4G6T B;  4E70 A;  4ENM A;  3A03 A;  1NG6 A;  2DN0 A;  4MFE A;  2I10 A;  5BPI A;  3ECO A;  3K1P A;  1GDT A;  1MMD A;  2ISY A;  2X85 A;  2IGO A;  3O2P E;  3TL4 X;  3RPU D;  4YFX F;  1E0E A;  4XMY A;  1UST A;  2L01 A;  2WAQ A;  1UB9 A;  1I6X A;  5EEG A;  1IDZ A;  3CUQ C;  1PDN C;  2VT3 A;  5LGN A;  3LSM A;  2W57 A;  2BW3 A;  3FDY A;  2JZY A;  5E3M A;  1QVU A;  2CUZ A;  1DP3 A;  2JN6 A;  2EBI A;  1R1T A;  2JA6 J;  3OYC A;  5TRD A;  3GFJ A;  3BCB A;  2PJR B;  1KA8 A;  2OC6 A;  3CDL A;  4FHT A;  3CJT B;  4A3G J;  3ESW B;  1U5T B;  3I9V 2;  5LHH A;  2VOP A;  2F6C A;  1HW2 A;  2IA1 A;  3K0L A;  1W36 D;  1YRN A;  1Z6T A;  3BJA A;  1JKR C;  5GTI C;  1X4O A;  1W7P D;  3WGH A;  1K4S A;  2R7O A;  2KRH A;  1XSV A;  2JA2 A;  4ENK A;  4GGG A;  2K3P A;  4PJM A;  1J7K A;  1FJL A;  2L2O A;  5K7H A;  3A4C A;  3EUK L;  1R1U A;  1B4A A;  2Q2E B;  1WJE A;  2VL8 A;  3B6C A;  3A01 A;  2TRT A;  4IKF A;  2LVS A;  4JX5 A;  5DEQ A;  5F0F A;  3E5X A;  4CCN A;  3I59 A;  3HOV J;  2PJR A;  1XMX A;  2KIU A;  2R7W A;  3ZPL A;  3OWT A;  5IP9 J;  2LTP A;  1E3O C;  3GME A;  5EEH A;  3HKZ A;  4Z2Y A;  1QPM A;  1A31 A;  4FTH A;  2KJC A;  2ZXH A;  1J9I A;  4CSW A;  2XSJ C;  2VPL A;  1R71 A;  2LY1 A;  4MQ9 F;  3LNQ A;  4N9I A;  3G1L A;  3KP3 A;  5EF6 A;  3K1N A;  4AC0 A;  1APL C;  5CVU A;  1ETK A;  1WRJ A;  3MAJ A;  1B72 A;  1TWG J;  1D5V A;  4LJZ F;  3M7G A;  2BHY A;  4IOA F;  3TP3 A;  2K85 A;  2Q0O A;  3BDD A;  5F64 A;  4NQW A;  4A0X A;  1FEX A;  3QOD A;  3TMO A;  2BY1 A;  2DCE A;  4KYW A;  1I3A A;  1S72 I;  2K4J A;  1U9O A;  2X48 A;  2CUJ A;  1ZEL A;  2HQR A;  3BY6 A;  3ZMD A;  2G7U A;  4HF0 A;  3K10 A;  1V5G A;  1HQC A;  3FMS A;  5IP7 J;  4ENN A;  3CLO A;  3OMY A;  1U3E M;  3BPX A;  4QWQ A;  2A07 F;  3CCY A;  4RB1 A;  5HOO A;  4CYC B;  1ZAO A;  3K2Z A;  1VI0 A;  1QRY A;  1MBG A;  1YG2 A;  3PNT A;  3SXY A;  2X51 A;  4I2O A;  1DGW Y;  2V1X A;  2JUG A;  3T8R A;  1MH4 A;  2VXZ A;  4RA2 A;  1K7A A;  1T98 A;  4UY8 I;  5EGO A;  3ABK H;  2ZJR F;  3VYS B;  3HB9 A;  4ESJ A;  4BHP A;  4IX7 A;  1KU2 A;  3RPU A;  4UNO A;  1YS7 A;  3I4M J;  3BR5 A;  3F8C A;  5FFX A;  5LD2 C;  1YYV A;  1O3Q A;  2XAQ A;  3C7J A;  4FCY A;  1JUS A;  3OOP A;  4P96 A;  2ZFU A;  4AIK A;  2JA5 J;  2DMT A;  3I54 A;  2R7Q A;  3N97 A;  1YLF A;  3TDZ C;  1NH3 A;  1U2W A;  2GZW A;  2HNH A;  2R7S A;  3KP4 A;  1STZ A;  4MEX F;  4UVA A;  2LRE A;  2ZC2 A;  1GXP A;  1G3S A;  2DT5 A;  3DKY A;  4M6V A;  2KIS A;  2DMU A;  2LK2 A;  1IRF A;  2M87 A;  1MBJ A;  2DA4 A;  4NQW B;  1OCR H;  2CW0 F;  4Q48 A;  2IAI A;  1W36 C;  2A5W A;  2W85 A;  4P55 A;  2CS3 A;  3OYD A;  4BQQ A;  4W1U A;  4HST A;  3QWL A;  2KIF A;  5GTH C;  4AWX B;  2N8G A;  5M5Y J;  1RKW A;  3HRM A;  2RNJ A;  1ZKG A;  1WKM A;  2H09 A;  4IO9 F;  4XLF A;  2XDV A;  4XLH A;  1HCR A;  2E36 A;  1ZLJ A;  3PO3 J;  1USS A;  3ZQI A;  4DYQ A;  1ETQ A;  1FTZ A;  3I4P A;  1XB4 A;  1OJL A;  5FKK A;  2GXG A;  1HC8 A;  2KFD A;  3M1C A;  1OR7 A;  1BA5 A;  2JSP A;  3GBG A;  1EJ9 A;  3LWF A;  3I53 A;  2LBF B;  3J7Z I;  1VTN C;  1ZR4 A;  5FKO A;  3WTS C;  1VF9 A;  5LRR A;  1YE9 A;  1QZZ A;  1E3H A;  1T6S A;  1Y6I A;  2FE3 A;  2KJB A;  1VQ4 I;  3KP2 A;  3ZQH A;  4M72 A;  2R7T A;  1BBY A;  1IZ1 A;  3PSI A;  5K7Z A;  1Z7L A;  2LF8 A;  3N4M A;  2LLK A;  3BR6 A;  3W6K B;  2E7X A;  5IT3 A;  3DPL C;  3E6M A;  3MZ8 A;  4FQG A;  4U0Y A;  2OCE A;  4R79 A;  2EV0 A;  2X6Y A;  2Z99 A;  2JUC A;  1OIS A;  2V6C A;  3HTS B;  2XAG A;  4W97 A;  3K4B A;  1Y0N A;  4A6D A;  2GOX B;  2XRO A;  1QZE A;  3OR1 C;  4BE0 A;  4NC8 A;  5EZH A;  1ITY A;  1C0W A;  2M5W A;  5L3C A;  3H5N A;  3JTG A;  5H20 A;  4C30 A;  3W2A A;  2PQ8 A;  5HNF A;  2EFN A;  3P5J A;  2GXA A;  1VQ8 I;  3BTC A;  3OS2 A;  3A2K A;  2DBB A;  2ME6 A;  3MQ0 A;  3RSN A;  2QBY B;  1MBF A;  1YI2 I;  1YIJ I;  2Y0M A;  1RC9 A;  2MH2 A;  3CCQ I;  2AXL A;  3FXJ A;  4JYK A;  1RUN A;  1B9M A;  2DA1 A;  3V7C A;  4XLA A;  4IJA A;  5JHU A;  5JVT A;  3QOP A;  1IJW C;  1PP7 U;  2O6G E;  4FX0 A;  1HOM A;  4XIC A;  2F5F A;  1WVR A;  2O7O A;  4A0Y A; 
#chains in the Genus database with same CATH homology
 2EFQ A;  3T1B A;  3ZMZ A;  4JBA A;  2EWN A;  4KMU X;  2QUF A;  3TOA A;  1YQA A;  2H6C A;  2OBP A;  5ILU A;  3H3U A;  1LJ9 A;  4KMF A;  3GX4 X;  2HYF A;  1IW7 F;  5CVR A;  4DNC A;  1QZY A;  1U5T A;  4LLG F;  3ZQ7 A;  1XD7 A;  2WC2 A;  1MGT A;  4HLY A;  3V7R A;  4L9J A;  1AWC A;  3HHG A;  2ZFW A;  2IP2 A;  2CO5 A;  2CYY A;  3IKT A;  4L5I A;  3QU3 A;  3COA C;  3BOQ A;  1FP1 D;  4I0B A;  1KQ9 A;  2BEO A;  1G3Y A;  2A69 F;  3HTU A;  4AD9 A;  3TO6 A;  3C3W A;  1R23 A;  1ON2 A;  3J81 K;  3HUG A;  3I71 A;  2PJP A;  3LA3 A;  3FM5 A;  4I09 A;  3SZT A;  1ULY A;  1T39 A;  1MKM A;  2QEN A;  2VN2 A;  3KP5 A;  1TNS A;  4KIG A;  3J81 Z;  2QWW A;  2YU3 A;  1EH7 A;  3KFW X;  3WTV C;  4UHT A;  5ILV A;  4HAM A;  4RGR A;  4JK1 X;  1S3J A;  1HXD A;  3NQO A;  2H6B A;  4A6E A;  3IHU A;  3QP5 A;  1A04 A;  4ZYG A;  3TO9 A;  3J7A O;  2ADU A;  1MD0 A;  2Q8K A;  4MEY F;  2WV0 A;  2IT0 A;  2ZNZ A;  5HLI A;  2OAZ A;  2COM A;  3LA2 A;  1XGO A;  3F22 A;  3GWZ A;  4YG2 F;  1I1S A;  1ONV A;  2LKP A;  1SFU A;  2UXX A;  1ZRC A;  4Q47 A;  2FXA A;  3M9A A;  1XSX A;  3TQN A;  2QQ9 A;  1XDS A;  2EFW A;  4P5O A;  2DLL A;  1CF7 A;  3RPQ A;  1KGS A;  3GEZ A;  3FMR A;  1H9T A;  1IN5 A;  4ZH4 F;  4L5J A;  1BC8 C;  3EQL F;  2GWR A;  2A68 F;  2DO7 A;  2CQK A;  4RB0 A;  4LFU A;  3O3K A;  2FSW A;  2HS5 A;  5ERI A;  3RYR A;  2PI0 A;  2PFB A;  1JHH A;  5E8I A;  4ZYD A;  1TNT A;  1MJ9 A;  4IPA A;  2FRH A;  2FQ3 A;  2OQG A;  5HS7 A;  5ICG A;  4WK8 F;  1FYM A;  3KZY A;  3SHF A;  4BH9 A;  4A2U A;  4IF4 A;  4KUM A;  5JFR A;  4RB3 C;  2P5V A;  1DPU A;  1EH8 A;  2V9V A;  3FMQ A;  1ZLK A;  3FX3 A;  4MGR A;  2NRA C;  3RKX A;  1BM9 A;  1SD5 A;  2W24 A;  2EK5 A;  4LB6 B;  1DP7 P;  4ASN A;  4L9V A;  2GA2 A;  3M8E A;  3ML6 A;  3MFK A;  4OOI A;  1Q1H A;  2JSC A;  3KLN A;  2X0L A;  1WSU A;  2P7V B;  2PMU A;  5HDN A;  2C6Y A;  4R8H A;  4G6D A;  4RB2 C;  3BP8 A;  1KU7 A;  1I5Z A;  4YIF A;  2EV6 A;  4Y13 A;  3J80 K;  1WI9 A;  3SQN A;  3ISP A;  4EGZ A;  4IRG A;  3EYI A;  5DCF A;  5DCM B;  1YW9 A;  5AIQ A;  3F3X A;  1O7L A;  3CO6 C;  3GVA A;  1O57 A;  3DFG A;  1LQ1 A;  5LHI A;  4HX8 A;  3L09 A;  4EM2 A;  5FO5 A;  4P9U A;  1R1V A;  2DQR A;  2HQN A;  2OZ6 A;  1EH6 A;  4PZJ A;  2BGC A;  5E8G A;  3ZMS A;  2D45 A;  4OIN F;  4RGU A;  3DF8 A;  2DK8 A;  1ZRE A;  2VBW A;  2B0L A;  3C18 A;  4AIJ A;  5BOX A;  2LSO A;  3TDU C;  3LAP A;  1AOY A;  3LFK A;  3JTH A;  1QO0 D;  4O6J A;  3KP7 A;  3QPT A;  4K2E A;  4M6X A;  2CSO A;  1T38 A;  3LST A;  4HV6 A;  1IUY A;  4GYI A;  2PN6 A;  2BV6 A;  2F5E A;  3RKY A;  3M1E A;  1KU3 A;  2L3D A;  2M30 A;  2L54 A;  2RGV A;  1IXR C;  3E5U A;  1XCV A;  1S6L A;  1QQI A;  3Q9S A;  1NHA A;  1FLI A;  1R7J A;  4CIC A;  2FEZ A;  1P4W A;  2FNP A;  1K6O A;  4M9X A;  4A0Z A;  2ZME B;  4RS8 A;  1OPC A;  2DTR A;  1S7O A;  4HBL A;  3WE3 A;  4NB5 A;  2HKO A;  5D6F A;  2RDP A;  2YX7 A;  5HLH A;  2HEO A;  4OIQ F;  4PCQ A;  3HIF A;  3TO7 A;  4KN7 X;  2ZNY A;  5DYM A;  1SD4 A;  3PQK A;  5E18 F;  4UV9 A;  4IHS A;  5LBQ A;  1RUO A;  1XMA A;  5BMZ A;  3SZP A;  1YS6 A;  5F1R A;  1ZN2 A;  3BZ6 A;  2WTE A;  3D0S A;  3K1M A;  5IT9 Z;  2FNA A;  3WTU C;  2NNN A;  3EUH A;  3FXU A;  2G7H A;  4PDK A;  2G9W A;  1H9G A;  3F8F A;  2JPB A;  3QPH A;  4I01 A;  2UWM A;  3DQV C;  1K79 A;  1D8J A;  2VC0 A;  3S2W A;  1W7P A;  4CGZ A;  4M71 A;  1YIO A;  2NYX A;  5CVJ A;  2DK5 A;  1SAX A;  3RIR A;  4CHU A;  3F23 A;  3REO A;  5DUK A;  4N9H A;  1FBS A;  3BRO A;  1D3Y A;  3GW2 A;  5AIP A;  3IWF A;  4FX4 A;  1K78 A;  4LGW A;  3F21 A;  4KIB A;  1ZG5 A;  4RAY A;  4UV8 A;  2QQB A;  2L4A A;  2HTS A;  1EV7 A;  1Z6R A;  3CDH A;  3NRV A;  2YPR A;  4M9Z A;  3ULQ B;  3KLO A;  1U6G A;  4I7H A;  1R22 A;  4Q4Z F;  2PBI A;  5L3D A;  2MA3 A;  5ED4 A;  2IPQ X;  3ROU A;  4HF2 A;  4ZZD A;  5FD6 A;  2BBY A;  3WE2 A;  2CFX A;  3U9G A;  4HDV A;  1FBQ A;  2VE8 A;  3O6B B;  2EB7 A;  5H6R A;  3FF5 A;  1LEA A;  5DV5 A;  5BPD A;  2VOO A;  1FX7 A;  1DDN A;  5D8K B;  3G73 A;  2XKO A;  3RYP A;  2F5C A;  3DXJ F;  1FNN A;  4HQM A;  1P92 A;  3PQJ A;  4EGY A;  1KYZ A;  3ECH A;  3TKY A;  4CXF A;  3BPV A;  3VOE A;  2FOK A;  4HA8 A;  5ICF A;  3KE2 A;  5E17 F;  4BHC A;  5E1W A;  4EJO A;  2XUB A;  2VBX A;  1R58 A;  1SD6 A;  3I0T A;  4LMY A;  1O3T A;  4ENJ A;  1TTY A;  4ZYH A;  3R6S A;  2STT A;  2K7L A;  3GLX A;  4ESB A;  3L7W A;  1YW8 A;  4EV0 A;  4L9T A;  1F1Z A;  4IRH A;  1D8K A;  3HOT A;  2OZU A;  5HDK A;  4OIO F;  5CVV A;  3HYI A;  2FA5 A;  3TGN A;  2O8X A;  1F5T A;  5DD8 A;  4WF2 A;  1Z7U A;  5LLQ A;  4HV5 A;  1G6N A;  4UUV A;  5K1Y A;  1B9N A;  4OMY A;  4N0B A;  1ZRF A;  2F5D A;  4YFN F;  4IRI A;  4EJW A;  2P7C B;  2CWE A;  1L0O C;  1RI7 A;  1TQP A;  3JW4 A;  1F9N A;  3VEP A;  3CUQ B;  1E2X A;  4MHG A;  4IVN A;  4GCV A;  1KQ0 A;  2YX4 A;  3HSF A;  2UZK A;  3GZ5 A;  1SMY F;  2FBH A;  4HZF A;  3AAF A;  1TBX A;  1O7F A;  5HDG A;  4WXC A;  3GO5 A;  4HX7 A;  4QLC U;  3DEU A;  5L3E A;  2VON A;  1KYW A;  3JSO A;  4MQV A;  3GFM A;  4CO8 A;  4EMS A;  2O61 A;  3FXR A;  5D5X B;  4HOB A;  4BXU A;  1RIO H;  1BJA A;  1ZGA A;  2J5O A;  2VBZ A;  2M1B A;  1R5G A;  2DW4 A;  5HLG A;  1QBJ A;  2YSR A;  1Z91 A;  2ELH A;  5KK1 A;  4EJU A;  1XSD A;  2MH9 A;  3R0A A;  4UXN A;  1YW7 A;  2E1C A;  2HFH A;  1IN4 A;  1R00 A;  5E1X A;  1HKS A;  1MZB A;  2Z3Y A;  1P4A A;  2PLY A;  3P9I A;  3WG9 A;  4EJT A;  1Z05 A;  3F6V A;  1P4X A;  3GFI A;  4G9Y A;  4U0W A;  2D1V A;  1HSJ A;  3QAH A;  5CVI A;  2KRF A;  1S29 A;  4HW0 A;  4CDG A;  2CGP A;  2A6H F;  2IVM A;  1ODD A;  2DFI A;  4U0V A;  4S05 A;  1JE8 A;  2ZO4 A;  3GF2 A;  5D6E A;  2MC3 A;  1Y0U A;  4KFC A;  1XMK A;  5D5V B;  1I27 A;  2HTJ A;  2V1D A;  4I0A A;  4B09 A;  3P7N A;  1T2K A;  3KET A;  4D0P A;  5FD5 A;  2P5L C;  1PUE E;  3B73 A;  4EVI A;  2FBI A;  5KVR A;  2K4B A;  3IRR A;  4IXA A;  2ZXJ A;  2K02 A;  3TOB A;  3DKW A;  3WU0 A;  4B8X A;  2STW A;  2K86 A;  5AON A;  3T0Y A;  1FSE A;  5JI6 A;  2JTV A;  3WTY C;  3LQR A;  1PP8 F;  5ICC A;  1P6R A;  3R0J A;  1SFE A;  2UXN A;  3Q5F A;  1UHM A;  4ON0 A;  1YTY A;  5D5U B;  1FY7 A;  2ZCW A;  2EJR A;  3C1D A;  4MNU A;  4G94 A;  3F8M A;  1W7P B;  3RTR A;  2RVC A;  3I59 B;  3HSR A;  4MTD A;  3CTA A;  2OA4 A;  1B6A A;  2QVO A;  2Z5U A;  1OYY A;  1OYW A;  2W84 A;  1RZ4 A;  3ZMT A;  2JPC A;  3V8L A;  2DPU A;  1FYK A;  3I5U A;  3HRU A;  2QQA A;  3ABT A;  3MWM A;  2VT2 A;  1J5Y A;  2E7W A;  3E3V A;  3FWE A;  2NS0 A;  4TV7 A;  3L00 A;  2LF7 A;  2FU4 A;  1XGS A;  5BQT A;  2MLK A;  4IHT A;  1J59 A;  3H92 A;  4WXD A;  1DUX C;  1ZRD A;  1FC3 A;  2X4H A;  1XGN A;  2RC4 A;  2ACJ A;  2NAZ A;  1MJB A;  5LRS A;  4U88 A;  2XV4 S;  4KDP A;  5FLX K;  2D1H A;  4L0Y B;  1GHC A;  1IN6 A;  2P8T A;  4EJV A;  4G7O F;  3G3Z A;  1ZG1 A;  2OU2 A;  3GZ6 A;  5IT9 K;  3Q9V A;  3U1D A;  1SMT A;  5LHG A;  2HGC A;  2MBF A;  4LG0 A;  3HRS A;  2XGX A;  5FLX Z;  1LDJ A;  3GUD A;  2YR2 A;  1T0F A;  3RI4 A;  4CYD A;  2LNB A;  3HHH A;  3E6D A;  3V7S A;  2F2E A;  2PEX A;  4M74 A;  1V4R A;  3BJ6 A;  5JR3 A;  4Y17 A;  4G7Z F;  3P9C A;  1F4K A;  2QYO A;  4ZZL A;  4HQE A;  4H0E A;  5CJ9 A;  4DQ2 A;  3ZP5 A;  4M6Y A;  4WX9 A;  4LB5 A;  2GXB A;  4OIR F;  2VE9 A;  2XKP A;  1HKQ A;  6PAX A;  2O3F A;  4FT8 A;  3KP6 A;  2W25 A;  2WWY A;  1V3F A;  4ZYE A;  1BOA A;  1SFX A;  2OD5 A;  4A5N A;  4M9S A;  4YFK F;  1IRG A;  3E6B A;  4G6Q A;  3LQQ A;  2IJL A;  2QZ8 A;  3CJN A;  2VC1 A;  5L3F A;  3IL2 A;  3IWZ A;  4P9F A;  5LGT A;  3R4K A;  4HLX A;  4XBF A;  2XAH A;  3VFZ A;  1QNT A;  1UCR A;  5A2Q Z;  3ABU A;  1FOK A;  5K5R A;  3DP7 A;  5DCM A;  2J5P A;  1HW1 A;  4WXH A;  3WGG A;  3E5Q A;  2MD5 A;  1WWX A;  2ETH A;  1WQ2 A;  4BHB A;  3WGI A;  3V8J A;  4AIH A;  3KEO A;  4WWC A;  4LD5 A;  1IN8 A;  2V1U A;  1JXS A;  2XVC A;  1BI3 A;  3RJP A;  3WU1 B;  3VOD A;  1IXC A;  3T5X A;  2XIG A;  2EA2 A;  1BN5 A;  2O0Y A;  1HKT A;  3LA7 A;  1JGS A;  5DUI A;  2H27 A;  1GVJ A;  2D2W A;  1YO5 C;  2QM3 A;  2GQQ A;  4L0Z B;  5LGU A;  4BAY A;  4M73 A;  2QBY A;  1FZP B;  3V4G A;  1BI2 A;  1BI0 A;  1DPR A;  1LDD A;  1BIB A;  2HDC A;  1G4D A;  3BWG A;  5DDG A;  1REP C;  3MZH A;  4BNC A;  3KCC A;  1ZH5 A;  2DI3 A;  4GXO A;  2JT1 A;  4HDU A;  5HS8 A;  2DU9 A;  2CG4 A;  2ISZ A;  2HZT A;  1FT9 A;  2E1N A;  2A5Y B;  1ON1 A;  4XRF A;  1SD7 A;  1TLH B;  3IRQ A;  1ZG3 A;  1R36 A;  4KIC A;  1MDM B;  2HR3 A;  5L3G A;  2A6E F;  1BIA A;  1ZGJ A;  1FWZ A;  3JAM Z;  4GYG A;  5D5W B;  2BE5 F;  4EM0 B;  2IA0 A;  1HW5 A;  1G3T A;  3K9T A;  2P4W A;  5HVQ C;  2GAU A;  1W5S A;  3MEX A;  3KZZ A;  4Q5S F;  1G3W A;  2GIV A;  3JAM K;  5LEJ A;  1ZYR F;  1TW3 A;  4EQQ A;  3RKW A;  1XGM A;  4AVP A;  2GA1 A;  2ESH A;  2KKO A;  4KA4 A;  1CF7 B;  3WTX C;  1I1G A;  4OMZ A;  4HYE A;  5LEK A;  1RNL A;  4PGH A;  1W5T A;  5H6Q A;  4A5M A;  1LEB A;  1FP2 A;  1OMI A;  3ZN0 A;  1S8N A;  1LDK B;  3DPT A;  1FPQ A;  2TDX A;  1MDM A;  1B1B A;  4O5V A;  4XLN F;  1IF1 A;  3FXQ A;  2L02 A;  4Y15 A;  1UHW A;  3I58 A;  2IRF G;  2Q2E A;  3ZMV A;  3HOS A;  3R60 A;  2R7F A;  4L9N A;  2ZBK A;  1XN7 A;  3JSP A;  3ZN1 A;  2ZJ2 A;  5FFZ A;  1QGP A;  4F7Z A;  3F8N A;  3M8F A;  2PG4 A;  4I02 A;  3GXO A;  1LVA A;  5F6F A;  1X3U A;  2HWV A;  3EET A;  2FML A;  4CZZ A;  2KIM A;  2O03 A;  2DPD A;  2R7D A;  4KIF A;  3HSE A;  1W4M A;  3E6C C;  4LG0 B;  3P9K A;  3T8T A;  3QU6 A;  3IC7 A;  1IAW A;  3FZV A;  3ERE D;  2RKH A;  2RN7 A;  2M8E A;  3BJO A;  1Z9C A;  2DQL A;  2P5K A;  5DD4 A;  3QRF F;  1TQI A;  2K27 A;  3EDP A;  3QP6 A;  4NHJ A;  4S04 A;  2P6T A;  2Y48 A;  3VB2 A;  1XCB A;  2FMY A;  4KN4 X;  1XDU A;  5HS9 A;  3EYY A;  2DAO A;  2VBY A;  1R5H A;  2IA2 A;  2XRN A;  2FBK A;  1YFH A;  4PGG A;  2L4M A;  2HKX A;  3F8B A;  1IXS B;  4G7H F;  1KQ8 A;  3D5L A;  4LK1 F;  2XAS A;  1JHF A;  5L3B A;  2HOE A;  4HF1 A;  1S7A A;  1ZHF A;  1TW2 A;  3FM3 A;  1FYL A;  3K69 A;  1U8R A;  3WTW C;  4UVC A;  4BYY A;  2P6S A;  5TJJ A;  1ZAR A;  4JQF A;  1J2X A;  1OYI A;  5CLS A;  3RDI A;  4A12 A;  5CYV A;  4U7B A;  3H3Z A;  1HST A;  3F6O A;  1IN7 A;  3W6J B;  3U2R A;  2XAJ A;  2H94 A;  3WOD F;  1B59 A;  4R1H A;  3B02 A;  3HRT A;  3CUO A;  2Z9O A;  3ELK A;  4EM1 A;  2EV5 A;  5D8L B;  2A3S A;  3SFZ A;  4GO1 A;  1LB2 A;  5BS6 A;  2PMH A;  3F72 A;  4HX4 A;  1U5T C;  5E20 A;  5E1Z B;  5K5O A;  3MZY A;  2BYV E;  3WTZ A;  5ICE A;  3WTT C;  1J0R A;  4O3M A;  2A61 A;  4OIP F;  2RQP A;  2NNY A;  4LLL A;  3LAJ A;  3CUQ A;  5D4R A;  4MTE A;  3FHZ A;  2ZME A;  3E97 A;  3J80 Z;  2EFP A;  2VOD A;  2EA4 A;  2FF4 A;  1L3L A;  2R3S A;  4YII A;  3GYH X;  1P2F A;  4XSX F;  3ZMU A;  4OU0 A;  3IKV A;  4RGS A;  2AS5 F;  4WCG A;  4RAZ A;  1HBX G;  2JRT A;  2V79 A;  2ESN A;  3KEQ A;  1Z1D A;  4I98 B;  5ILS A;  2LDU A;  2HYG D;  4KNY A;  4BQA A;  3L9F A;  1K78 B;  2IW5 A;  2EFO A;  4ESF A;  3L2C A;  1FBU A;  3PFI A;  5FGM A;  1LNW A;  5FB2 A;  4UVB A;  3GFL A;  4ETS A;  4U7D A;  3R61 A;  1O3S A;  5J8C A;  2RV8 A;  2Z33 A;  2QLZ A;  1U78 A;  1GXQ A;  3I64 A;  3CO7 C;  4RGX A;  4L18 B;  1UFM A;  1O3R A;  4LK0 F;  2MLG A;  4G8X A;  3V8K A;  5D4S A;  5J8F A;  3MCZ A;  5K5Q A;  2ZKZ A;  3DV8 A;  1BI1 A;  1H0M A;  3NEU A;  1E17 A;  3OV8 A;  5A2Q K;  1J75 A;  4LLN A;  2XHK A;  5J6X A;  4XLP F;  4XSZ F;  1FSH A;  2XAF A;  4KT5 C;  1OKR A;  1CGP A;  1KU9 A;  1MJA A;  2OQR A;  1TQM A;  1BC7 C;  2Y75 A;  2M45 A;  4E70 A;  4ENM A;  5BPI A;  3ECO A;  3K1P A;  2ISY A;  3O2P E;  4YFX F;  1UST A;  2L01 A;  1UB9 A;  1I6X A;  5EEG A;  3CUQ C;  1PDN C;  2VT3 A;  5LGN A;  2W57 A;  2JZY A;  1R1T A;  5TRD A;  3GFJ A;  1KA8 A;  4FHT A;  1U5T B;  5LHH A;  2VOP A;  1HW2 A;  2IA1 A;  3K0L A;  1Z6T A;  3BJA A;  1W7P D;  3WGH A;  1XSV A;  4ENK A;  4GGG A;  1J7K A;  1R1U A;  1B4A A;  5DEQ A;  3E5X A;  3I59 A;  2KIU A;  3ZPL A;  5EEH A;  4Z2Y A;  1QPM A;  2KJC A;  1J9I A;  4MQ9 F;  4N9I A;  3KP3 A;  3K1N A;  5CVU A;  1WRJ A;  3MAJ A;  1D5V A;  4LJZ F;  3M7G A;  2Q0O A;  3BDD A;  5F64 A;  4NQW A;  4A0X A;  4KYW A;  2K4J A;  3ZMD A;  2HQR A;  3BY6 A;  2G7U A;  4HF0 A;  4ENN A;  1HQC A;  3FMS A;  1U3E M;  3CLO A;  3BPX A;  4QWQ A;  2A07 F;  4RB1 A;  5HOO A;  1ZAO A;  3K2Z A;  1YG2 A;  3SXY A;  4I2O A;  2V1X A;  3T8R A;  2VXZ A;  1K7A A;  1T98 A;  4ESJ A;  4BHP A;  1KU2 A;  3RPU A;  4UNO A;  1YS7 A;  3F8C A;  5FFX A;  1YYV A;  1O3Q A;  2XAQ A;  3C7J A;  4P96 A;  3OOP A;  4AIK A;  3I54 A;  3N97 A;  1YLF A;  3TDZ C;  1U2W A;  2GZW A;  3KP4 A;  1STZ A;  4MEX F;  4UVA A;  1GXP A;  1G3S A;  2DT5 A;  1IRF A;  2M87 A;  2CW0 F;  4Q48 A;  2W85 A;  4P55 A;  2KIF A;  4AWX B;  3HRM A;  2RNJ A;  1WKM A;  2H09 A;  1ZLJ A;  1USS A;  3I4P A;  1XB4 A;  2GXG A;  1OR7 A;  3LWF A;  3I53 A;  1VTN C;  3WTS C;  5LRR A;  1QZZ A;  1T6S A;  2FE3 A;  2KJB A;  3KP2 A;  4M72 A;  1BBY A;  1IZ1 A;  2LF8 A;  3N4M A;  3W6K B;  2E7X A;  5IT3 A;  3DPL C;  3E6M A;  4U0Y A;  4R79 A;  2EV0 A;  2Z99 A;  2V6C A;  3HTS B;  2XAG A;  4A6D A;  2XRO A;  1C0W A;  2M5W A;  5L3C A;  3JTG A;  5H20 A;  2PQ8 A;  2EFN A;  2DBB A;  3MQ0 A;  2QBY B;  2Y0M A;  2MH2 A;  2AXL A;  1RUN A;  1B9M A;  3V7C A;  4IJA A;  5JHU A;  5JVT A;  3QOP A;  1PP7 U;  2O6G E;  4FX0 A;  2F5F A;  4A0Y A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...