1IDYA

Structure of myb transforming protein, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
54
structure length
54
Chain Sequence
b'MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
molecule tags Dna binding protein
source organism Mus musculus
publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
total genus 12
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idyA00
2PMZN 4HNVA 3ZQHA 5FLMJ 4M3EA 4MO7A 3BTLA 3C2BA 2HI3A 1K83J 3FK6A 5IP9J 2XPWA 2JA8J 1ZKGA 3CMYA 1MBFA 3DEWA 3G1MA 5EEAA 3SJMA 5FLVA 3GTMJ 2ME0A 5E3LA 4BBSJ 1D5YA 1I6HJ 2IAIA 1AKHB 1IGNA 2E2IJ 1TWCJ 5IYDJ 3BR1A 4A69C 4BKXA 1E3OC 2XRLA 5F0CA 3HDDA 4A3GJ 3BG5A 3RKQA 5FKKA 2EZKA 3S1NJ 2CQXA 4EEFG 4B4CA 2NVTJ 1UG2A 1JUSA 3O8HA 5F04A 1MH4A 2WV1A 5M5WJ 2Y30A 2Y9ZA 1G2HA 3PO3J 2DA5A 1W0UA 1FJLA 1PUFA 2JA7J 2DMNA 1ZK8A 2AO9A 2R5YB 1QPIA 3LSJA 4I76A 5JLXA 3MN2A 3G1OA 2DMUA 2FX0A 5FKLA 4C2MJ 2XGDA 4FE4A 3S1QJ 2EZLA 1RETA 3ZOBA 1XG1A 1UHSA 2GBYA 1JTXA 2ELKA 2WAQN 3M3YJ 3JRFA 1Y1VJ 2X6OA 2CUEA 1IC8A 3VPRA 3S1MJ 2LLKA 2LTPA 1O4XA 5J1RA 5E3NA 2O8KA 3F0CA 3BR5A 2GLOA 2M0CA 4JYKA 4FCYA 3DCFA 4A3DJ 1YRNB 3BT9A 2ID3A 1MSFC 1VF9A 1H8AC 5F1JA 4RBOA 1APLC 2EH3A 5M3MJ 3JRHA 3FIWA 2DA6A 1ORKA 2VI6A 4A3EJ 4M3BA 1U8BA 3S2DJ 4A3CJ 2MSYA 3IV5A 2D5VA 3LSPA 3S17J 2O9LA 4A3IJ 2R92J 1TC3C 3G1LA 5K7ZA 2DA3A 1P7IA 3K7AJ 1ZQ3P 1FIAA 5FJ8J 2NVQJ 4MFEA 1IDZA 2MGQA 5EG0B 3GTJJ 3BR0A 3PM1A 3ZQGA 1BW6A 2R93J 3HBLA 4BXXJ 4NDLA 1W0TA 3BR2A 3JRCA 1HDPA 3JRAA 1IUFA 1RESA 4QSHA 1HDDC 1ZR2A 4DW6A 2DJNA 2E1OA 2OF7A 1ZTRA 3JRGA 1WPKA 4RDUA 2GM4A 1TWAJ 2K9NA 1IDYA 3OSFA 4FISA 4C3IJ 2B63J 2M34A 2NS8A 2COBA 3QPLA 5IOZA 1WH7A 2DMPA 2ZB9A 1YRNA 3OSGA 2OPTA 1JKOC 2M8GX 3PO2J 2TRTA 2ID6A 4C3JJ 3HOZJ 5EZHA 4D5CA 4JP0A 2DN0A 2JK3A 3HOXJ 1I50J 3FISA 1WI3A 1ETWA 4D7NA 1BL0A 1CQTA 2L9RA 2KDZA 1MBGA 2YS9A 2HOAA 5EDNA 1HF0A 3S16J 2L7MP 3FKIJ 3JRIA 4MIMA 3A02A 3D1NI 1UMQA 1SFOJ 1Y1WJ 3SFIA 3BR3A 1ZR4A 2W48A 1H88C 2X48A 4AC0A 4A3BJ 3CCYA 1GV2A 4LOCA 9ANTA 4A3MJ 4DYCA 1U9NA 1MNMC 1VNDA 3ZQIA 3ZQCA 4UUSA 1B72A 1U78A 3NARA 3IH2A 3GTOJ 1U9OA 4MLOA 4MFDA 1JKPC 3ZQLA 2FQ4A 2EBIA 2DA7A 4M3DA 3CQZJ 5C3EJ 1IJWC 1LE8A 2LD5A 2DA4A 1FIPA 4D5FA 2NVXJ 2P81A 4M6VA 2JN6A 1Z0XA 2XSDC 2RAEA 5F27A 3RZOJ 2FJ1A 2MG4A 2VKVA 4AYBN 2HDDA 1ENHA 1Z77A 5C4JJ 4JX4A 3HGGA 2XGEA 2VKEA 2R5YA 1AU7A 5F08A 4IHXA 2R5ZA 1A5JA 2HXOA 4M3GA 1ETQA 2CRGA 3Q0UA 5IYCJ 3A01B 2K9SA 5J1UA 1AHDP 3LSRA 2K9QA 2FD5A 2EZHA 1I3QJ 3O8GA 3QQAA 2H1KA 1HCRA 5M5YJ 1ETYA 2XPUA 5C44J 4BBRJ 1OJLA 2IEKA 2I10A 4IHYA 1A6IA 5FKMA 3IH4A 1B8IB 3BQYA 3WHCA 4ABZA 5IP6A 3ZQFA 5BNGA 1TWGJ 3E7LA 4I6ZA 3L1PA 2DMQA 2JA5J 3BTCA 1RR7A 4BY7J 2AHQA 1JKQC 3SDGA 1OCPA 3TP3A 1NK3P 1R9TJ 1JUMA 3FK7A 1JJ6C 2Y2ZA 3OOUA 2CQQA 2CU7A 5IOYA 1BJZA 1GUUA 2KT0A 1H89C 2MW8A 2X9DA 4W97A 3H0GJ 4DYRA 5K7FA 2XGCA 3M4OJ 3LNQA 1ITYA 3GBGA 5EF6A 1B8IA 2Y0SN 4A3FJ 4BY1J 3GTPJ 1GT0C 2R7ZJ 3HKZN 1FEXA 3BG9A 1TWFJ 5E3OA 4DYQA 4QIWN 2QCOA 2NOGA 2XB0X 1WH5A 3A03A 3S15J 3HEFA 4IEJA 3JRDA 1PUFB 3A01A 1RKTA 4C3HJ 3RZDJ 4CYCA 1RKWA 4JX6A 2R5ZB 5IPAA 1OCTC 2E2HJ 2VUMJ 2LY9A 3S14J 4AUXA 2CJJA 2EZIA 1MH3A 2HQ5A 5IP7J 1BW5A 1MSEC 2XB5A 2CUFA 3LOCA 3JREA 1T56A 1EF4A 1ETVA 4X1EA 2NVYJ 1JUPA 1GV5A 3Q3SA 5EGOB 1XC5A 2LP0A 2M2EA 1ETKA 3GTKJ 5K7HA 3BTIA 3HM5A 1AKHA 4FE7A 2HOTA 1X58A 1F43A 4L5EA 5FKOA 3TP0A 2ECBA 2Y9YA 1FTTA 5F0HA 1P7JA 2YUSA 4S0HB 4XK4A 3UKGA 2JA6J 2YU9J 4A3LJ 1LFUP 1ETOA 2XPVA 5F0FA 4XRSA 4DZJA 3BTJA 4W1UA 3HOWJ 5M3FJ 4X6AJ 3MKLA 3K2AA 2E2JJ 1DU0A 4IHWA 1XS9A 2DA2A 2NS7A 2VPRA 4D7MA 4QTRA 3S1RJ 1JKRC 4DZPA 3GTLJ 4M3FA 5EZGA 4IHVA 3I4NJ 2HYJA 1TWHJ 3HB9A 2IBDA 3B6AA 3TW7A 3OIOA 1LE8B 2K40A 3BG3A 1QVTA 3I4MJ 2DA1A 2E19A 5GPAA 2N8GA 2L7ZA 2HOSA 1SANA 1JTYA 1QVUA 4J19A 2JMWA 2H8RA 5HODA 2M9HA 2L0KA 5M5XJ 4B3AA 3IH3A 1WGXA 2LR8A 3Q0VA 4XRSG 4FTHA 2LK2A 3LSGA 2EQRA 1RPWA 4UUSB 1B72B 4A3JJ 4XICA 2L7FP 1ZGWA 3GTGJ 1IG7A 1T33A 4Y52J 3QPSA 3JR9A 4A3KJ 1HOMA 3B6CA 5C4XJ 1JT6A 1NK2P 2QF7A 1JT0A 1IRZA 1FTZA 3RQIA 1GVDA 2R0QC 5EYRA 3CDLA 5J3LA 1VI0A 5EG0A 4V2FA 1BA5A 4V2GA 5GPCA 1POGA 1QRYA 3TW6A 1ETXA 2LFBA 5IYBJ 2JJ7A 2DMTA 1HLVA 3W6VA 3H3VK 1LFBA 5EGOA 1MBEA 5DTDA 2ECCA 3BQZA 3NAUA 1Q1VA 1X2MA 2WB1N 4XIDA 1DU6A 1GDTA 3JRBA 1F36A 3MVPA 3Q0WA 5FKNA 1IV6A 2G0EA 3TEDA 4UUTA 5JLWA 1S7EA 1MBJA 4B1RA 2LKXA 3HOUJ 3WHBA 2ME6A 3HGYA 2JWTA 5J1YA 5GP9A 4CYCB 1WCMJ 3HOYJ 4Y7NJ 1OFCX 4JX5A 1MBKA 1X2NA 1K61A 1JGGA 4XRMA 4GFBA 2LVSA 2Y31A 5E3MA 2TCTA 1JJ8C 2DTZA 3GTQJ 1MBHA 3BR6A 3HOVJ 2O7OA 3S2HJ 2HXIA 4A93J 1VFCA 1NTCA 4G12A 5DS9A
chains in the Genus database with same CATH superfamily
2VJ4A 3FXLA 4XL9A 3ZQHA 4EATA 2HOEA 3GYHX 3BP8A 2HR3A 5FLMJ 5K5QA 3BTLA 1OPCA 3OOPA 5IP9J 3RTRA 1VQPI 1ZKGA 1V5EA 3PNTA 3CMYA 1JI8A 2RNGA 5EEAA 5IT9K 1SMTA 5FLVA 1MIJA 3GTMJ 2ME0A 2GZWA 5E3LA 3CCSI 1IAWA 1I6HJ 2KMUA 2X51A 3FDYA 5ICCA 4NC7A 1S3JA 3CF2A 1FPQA 2WY8Q 3WG7H 2LY2A 2HFHA 1E3OC 5A2QZ 3J81Z 4Y13A 4RB1A 3S1NJ 1TW3A 2X6XA 4EEFG 3LMMA 2UWMA 5GTHC 2P5LC 3ASOH 2L7KA 3HRMA 1UG2A 1JUSA 1OISA 3O8HA 2LRDA 2XASA 5M5WJ 1P4WA 4YFNF 2BHYA 3U1KA 2DU9A 4RAFA 5AIQA 2AO9A 2R5YB 1QPIA 3LSJA 3TBIA 2VJ5A 3DEEA 3G1OA 1QA6A 4CCNA 1UELB 5FKLA 1G4DA 2JUGA 4BQOA 2DBBA 2BY3A 3H5NA 1Z3XA 3MZHA 2EZLA 4YRVA 4L9VA 3LSHA 1AOYA 1UHSA 3GEZA 3OIQA 2GBYA 1JTXA 1FT9A 4BJ6C 1WZ2A 1R7JA 5AONA 4A12A 1IC8A 2GAUA 3VPRA 3S1MJ 5DUKA 2LLKA 2Z33A 1O4XA 2V7FA 3SDBA 3Q9SA 3AG1H 4JYKA 2R4GA 5H20A 2BBYA 1YRNB 3I56I 1TNSA 3SFZA 1APLC 4E6KG 5M3MJ 2EV5A 3FXJA 3FM3A 2VI6A 3AG2H 2VBWA 4BHBA 1Z1DA 4PK4A 1P4XA 3V8JA 2VT3A 3TDUC 2MSYA 4YELA 3LSPA 3CUQB 4A3IJ 1TC3C 2DA3A 3SXYA 1O3RA 1QBJA 4R79A 4A5NA 5LHGA 1ZQ3P 1FIAA 4MFEA 2BXYA 3ML6A 4A0YA 5D5VB 1IDZA 5EG0B 2F2EA 2DJIA 3PM1A 1KQ0A 3BR2A 1HDPA 3KP7A 4WXCA 3FWEA 2DOAA 4QSHA 1CGPA 1SVLA 1WJFA 3Q9VA 4GO1A 4BQNA 1YTYA 3OMYA 5H2FC 3CJTB 2R7UA 2QEXI 4OINF 4XORA 3DXJF 1IDYA 1W36D 4ITVA 2P0WA 4FISA 1S7OA 3PIPF 1OCOH 3KZZA 2VONA 2KDOA 2B63J 3ZQ7A 2E60A 2EIKH 2J5OA 1MMAA 3ECHA 1PUEE 5IOZA 1FMWA 1Z91A 1X1CA 2OPTA 1VQ6I 4G94A 4ON0A 1UCRA 3KLOA 2LF7A 1FYLA 1VQ8I 3PQJA 4C3JJ 2CG4A 3HOZJ 3KETA 4NNJA 4JP0A 1R5HA 3NWTA 5L3BA 1Z9CA 3E3VA 5LGTA 2AQEA 2RNJA 1WI3A 4D7NA 4AD9A 1BL0A 3PFYA 2E1CA 2L9RA 3K4JA 1VQ7I 1Y0UA 2I5UA 1RR8C 1VQNI 4QPQA 5LFAA 3FXQA 2L7MP 3F72A 3FKIJ 3BWGA 5DCFA 1UMQA 1YFHA 1SVMA 2V6CA 2ZXJA 2CW7A 4ESJA 3OS2A 4PDKA 4A3BJ 3CCYA 4H4KC 3L2UA 3S3OA 1U9NA 3ZQIA 5CVJA 1LDKB 4HPQA 2FXAA 2GXGA 2V1XA 1QNTA 4EM0B 2L9VA 4GYGA 3WU2C 3DLLF 2JA2A 1U9OA 4MFDA 3TDZC 1JKPC 4HG2A 3ZQLA 2EBIA 2A6EF 1FP2A 5K5OA 3CQZJ 5JFRA 1KQ9A 2MYSA 2DA4A 1EKEA 3DBHB 3H35A 4Y17A 3EYIA 2NYXA 4EJOA 4HDUA 4M6VA 5FFZA 3W2VA 3V4GA 3ZRGA 2XHKA 2RAEA 2QQAA 2NVUB 1O3TA 4IQJA 1Z6RA 1SFKA 4G7ZF 1ENHA 2VE8A 2DAOA 4RB0A 3C3WA 3K1NA 1IN8A 1UHMA 2WAFA 2X1CA 5C4JJ 2XGEA 4CHUA 2L9NA 4BE2A 2JRMA 2BZTA 2QVOA 2BGCA 2EV0A 2Z16A 4XLEA 1YG2A 1X19A 1YYVA 2CRGA 4KITB 5IYCJ 1AHDP 2O61A 5J1UA 2HZTA 4FX0A 2EZHA 3M8EA 2Z2SB 3A4CA 1DGRM 3S93A 4AYBA 4J00A 2H1KA 1HCRA 1BI2A 1ETYA 2XAQA 5M5YJ 4BACA 2A68F 3TO6A 3OL4A 2IEKA 3CUQA 2W57A 2KHMA 2CS3A 1WHUA 2RKHA 3Q5FA 1FSHA 5E79C 3BQYA 1YJ9I 4J01A 5L3GA 1OR7C 2QWWA 2X85A 4NUBA 3S3NA 3W3CA 2DXIA 4F93B 3E7LA 4X0GA 3V7RA 2R7DA 3DEUA 4BDYA 4RGSA 1SVOA 1TW2A 2EFQA 4BY7J 5J4YA 1JKQC 2E1MB 5CJ9A 3JTGA 4YFKF 1U8RA 2VQGA 2FSWA 4A0XA 1JJ6C 2Y2ZA 2UUZA 3EUHA 3FHZA 2KT0A 2XV4S 3H92A 3WE3A 2KRFA 5FD6A 3WTVC 3OYBA 2X9DA 5K7FA 2ELJA 3M4OJ 4ZYDA 3OYLA 4EQQA 3SQNA 2EFOA 2XDVA 3J80K 2XSJC 3LSKA 4BY1J 2BY0A 4IHSA 5FB2A 2QENA 5ILUA 2WADA 1TT0A 3WGHA 2VL8A 4PFPA 3H9JA 1SD4A 3IKTA 4DYQA 2KPMA 2QCOA 2NOGA 2Q2EA 3A03A 2STTA 1JXSA 2E36A 4IEJA 2QSGX 4B44A 1ZRDA 4MNUA 1RKTA 5FO5A 3RZDJ 2CFXA 2OUMA 3RI4A 2KJBA 4JX6A 2R5ZB 2COMA 2O5RA 3A1YA 2Y69H 3WTXC 2CJJA 2E7WA 4LLLA 3K4KA 4G7HF 1P2FA 2K02A 5J8CA 2KRCA 4DBQA 3JREA 4UNOA 3JTHA 3MZYA 3K4BA 1BIAA 1HW2A 5HVQC 1U0JA 1A36A 3JAMZ 3RYPA 2M2EA 4KISA 1ETKA 4Z2YA 3ZMDA 4B3XA 3OYEA 1FOKA 1AKHA 2UXXA 3BZKA 1X58A 5FKOA 5LEKA 2Y9YA 1VQ5I 1FTTA 3DV8A 3G3ZA 2IGKA 4ZDPA 3WTYC 2O0YA 4QPOA 3CCQI 3ABUA 4HDVA 5IT3A 3UKGA 2YU9J 2FNPA 1OKRA 4O3MA 1A35A 2R7VA 5F0FA 3LA3A 2GQQA 2DQLA 3MKLA 1VZ0A 2HDWA 1DU0A 4FT8A 4IHWA 1XS9A 2DA2A 2NS7A 2DDBA 1JKRC 1YLFA 2DCEA 3F9KA 5B1BH 4DZPA 2L4AA 3I71A 3QPTA 1KU9A 4D0PA 3GTLJ 2PJRB 1N77A 3BPXA 2LMDA 4IKFA 3ASNH 3JW4A 3MD2A 4PJJA 4XMYA 3HB9A 2IBDA 4U0WA 3TW7A 1ZG3A 3GFLA 2HYFA 4BAYA 2E19A 3OYCA 3VWBA 1TQPA 5DM7F 2QQ8A 5GPAA 4BHPA 2L7ZA 1SANA 1QVUA 2HZDA 3ULQB 5HODA 3I64A 2Y0MA 1GVJA 2L0KA 4ENKA 2W4SA 2L54A 1B1BA 1FC3A 1B6AA 2X6WA 4JK1X 1D8JA 3LSGA 2VJJA 1B72B 3FX3A 2C6YA 4A3JJ 4XICA 2BE5F 3QRFF 2L7FP 1J09A 1TT5B 2PMUA 3JR9A 1WVRA 2FA5A 3KZIC 4GRIA 4H0EA 1PDNC 2IA2A 2QQ9A 1R1UA 1WI9A 1FTZA 2VQLA 4KMFA 1NG7A 2B9SA 4F52A 4V2FA 2WAEA 4ZYAA 2W84A 3F6OA 4AWXB 2W25A 2JQ7A 5GPCA 4HLYA 5IT9Z 2BY2A 2KP6A 1ETXA 4P9UA 3KYDB 1SAUA 2YSRA 4M6XA 3DBLB 4HAMA 5HDNA 2DMTA 5CVVA 1BJAA 2O8XA 2BHZA 1LFBA 1Z6TA 5EGOA 3MAJA 3RSNA 3DU6A 2FMYA 4XQFA 4RB3C 4HRIA 2WB1N 2P8TA 3R60A 4XIDA 4HZFA 4DBRA 4HEA2 3LL7A 1HSTA 1F36A 3JRBA 1M1EB 1SD6A 4IOAF 2M0MA 2QM3A 4HNTA 1OCZH 2CQ7A 2XKPA 2HVSA 1OR7A 2V9PA 1VQMI 3K70D 2LKXA 2ME6A 1Z67A 1EH7A 1XCVA 3OIPA 2VOOA 3HGYA 2NOJB 2OTLI 1WCMJ 3ZP5A 3CUQC 4Y7NJ 2Y0SA 3V7SA 1D1CA 1K61A 4GFBA 3FBNB 2R7WA 1D3YA 5LRRA 2DTZA 1JJ8C 2WA0A 2VE9A 3OYNA 4ZH4F 3PIOF 3N97A 3S2HJ 2MH2A 2HXIA 4IX7A 2EPFA 1KU3A 2EJRA 1PJRA 1TBXA 1YIOA 2MA3A 1VQOI 4HNVA 4OOIA 3CLOA 1N75A 1G3SA 3CO6C 1ZGJA 2LF8A 5D5WB 1PP8F 2Z99A 4EV0A 5DUIA 4CZCA 3FXUA 2H27A 2KQRA 3G1MA 2OCEA 3K1MA 3OYDA 4L5JA 5B66C 2IS2A 4LD5A 4U87A 1AKHB 3C1DA 4JQFA 1R49A 4ZDOA 3R0JA 5IYDJ 4OAZA 3I55I 4NQWB 4A69C 1Y8QB 3T1BA 5CQEA 4A3GJ 3DKXA 1LQ1A 3OYIA 2J5PA 1AA7A 3ESWB 3K2ZA 1Y8RB 1FZPB 3DU5A 4B4CA 3L2QA 4BEHB 1N25A 2HEOA 1Y39A 1J2XA 2VN2A 2MLGA 2R7OA 2Y30A 3I5UA 2XRNA 3CMMA 1FJLA 5D6FA 2DMNA 1ZH5A 1ZK8A 4CZZA 2V79A 1X1DA 5JLXA 2RQQA 3DPTA 3MN2A 1TLHB 2DMUA 4EJTA 1X4OA 4YFXF 2MFZA 3GZNB 2JPBA 4FE4A 2LC2A 4C2MJ 1HW1A 2HPIA 4KT6A 1YS6A 1ZHFA 2F6CA 1U6GA 5D4SA 5K5RA 2CMPA 3CUOA 3O6BB 4NC8A 2ZSIB 3G71I 5HS7A 4CICA 2A3SA 5JR3A 5DV5A 1Y1VJ 2X6OA 3CMEI 5FGMA 5KAIC 1VQLI 1T0FA 4U0VA 1NHAA 2LTPA 1RUOA 2O8KA 1ULYA 4XONA 4ENJA 1OMIA 3DF8A 2M0CA 2DLLA 3HUGB 4OU0A 3DCFA 4HLXA 1GLNA 5DCMA 3KYLA 5E8IA 1MSFC 1SEUA 1ERDA 4RBOA 3FF5A 2RN7A 3JRHA 2K7LA 2DA6A 1ORKA 4A3EJ 2NAZA 2EA4A 3IRQA 2G7HA 3HG9A 3KYCB 2Y48A 4BH9A 1R1TA 4M74A 3G1LA 2OD5A 5L3FA 2UXNA 3DTEA 4OIRF 5H6QA 2E1NA 1YX5A 1YQAA 2DOEA 3CCRI 5LBQA 3GTJJ 1Y56A 3HBLA 3HIFA 2D45A 2HYGD 3JRAA 1IUFA 1RESA 2ZJPF 5L3EA 1K6OA 3TMOA 4ENNA 2HQRA 1ZTRA 1MGTA 5D8KB 4RDUA 3BROA 1YITI 1O3SA 3H3UA 1O7LA 3OSFA 5CVIA 5D6EA 2QSHX 4M9ZA 1FOXA 1AWCA 4ASNA 3PUFA 4A5MA 2MBFA 3QPLA 2OC6A 3EYYA 5JVTA 1R00A 1QZEA 1QGPA 5FD5A 1XPXA 1U2WA 1WSUA 3PO2J 4IRHA 3W6JB 3OYAA 5EZHA 4D5CA 1QQIA 2PFBA 3BDDA 1K78B 3KP4A 3DLAA 1FYKA 2EFWA 3T8RA 3FISA 1ETWA 3KP6A 3CC2I 1T8IA 1MBGA 3K4CA 3FMRA 2ICWG 4F3QA 3WU1B 2CO5A 2HOAA 2QBYA 3FBIB 2QZ8A 1IF1A 4V19K 3RIRA 2YX7A 2RV8A 3SFIA 1V54H 3BR3A 2VKDA 2W48A 1ZR4A 4CH7A 2LKPA 1XB4A 1KU7A 4AC0A 2XKOA 9ANTA 5FROA 1VNDA 3K4LA 5D5XB 1BIBA 2G7UA 4Y33A 1BR4A 4E7ZA 3OYKA 4LG0B 3GLLA 1KZHA 2NS0A 3IH2A 4IZZA 3GTOJ 4UB8C 2LREA 2QGUA 5BMZA 3HHGA 3FXMA 2H1LA 2OAZA 2MD5A 1LE8A 3E5XA 1FNNA 4S04A 2ZJRF 1FIPA 1TQMA 3E97A 2NVXJ 4YIFA 4BXUA 1Z0XA 3JCUC 4I7HA 1B9MA 3OR2C 3A2KA 1E3PA 2MG4A 2VKVA 2W85A 4Q48A 2HDDA 3GWZA 2DPUA 3CCEI 2K4BA 4RGXA 5ICEA 3PNVA 2R5YA 2FOKA 1UAAA 4XLPF 1R6RA 3H36A 2W00A 3BJ6A 4CYDA 3Q0UA 3A01B 2K9SA 2FD5A 2A6HF 5CVRA 1A04A 2X1DA 3O8GA 2A05A 2XPUA 3D5SC 3O3KA 1REPC 3I58A 3CP8A 4DOZA 4IHYA 1A6IA 2HQNA 1T6SA 4HV6A 5FKMA 4XRFA 3IH4A 5TISC 3WHCA 1W7PD 5KCMA 4UV9A 2L02A 1TWGJ 2P7CB 2XF5A 3HSRA 1F1ZA 3BPVA 3BG7A 2B0LA 2O6GE 2DW4A 2NNNA 4RAGA 1RZ4A 3SDGA 2K3FA 1OLTA 1QHHD 4G7OF 1JUMA 5HDKA 1W5CC 2CQQA 4HF2A 4ESBA 4C9YA 1GUUA 3NRVA 4BXFA 2A5WA 1YI2I 3WTTC 3ZMZA 3H0GJ 2E71A 4B48A 2R7TA 4B8XA 5CQGA 3O2PE 1GXQA 2P4WA 5K1YA 4DNCA 4A3FJ 1G3YA 2GIZA 2HKXA 4P9FA 1K4TA 2WAQA 1KA8A 1YE9A 2VQCA 3KPHA 1U5TA 3ABKH 4BL0B 1FEXA 1HSJA 1NG6A 2QA4I 2E7XA 2EV6A 1Z7LA 4LGWA 4WF2A 1WH5A 2HU9A 3S15J 3JRDA 2UV1A 1ZELA 2ESHA 2CQNA 1HW5A 4ZTJA 2F5FA 2DODA 2LBFB 1TNTA 2W1OA 4PCQA 4WCGA 1IN4A 4AUXA 2E35A 2EZIA 5DYMA 1MSEC 5FRMA 1IRXA 2X6YA 3RPUD 1EF4A 4XKBA 3I54A 2QLZA 1J7KA 4GCVA 3OS1A 1J5YA 4XLNF 2KISA 3WG9A 2ACJA 1I1SA 1JUPA 4ZZLA 2BV6A 3GTKJ 3BTIA 2FEZA 3CJNA 1FBSA 2G9WA 4L5EA 4BUPA 2ECBA 2XIGA 1FLIA 5LLQA 2HKOA 1LDDA 2JSCA 3ABMH 5GTIC 4YIRX 5CPRB 2XPVA 1XSXA 2JT1A 4OMZA 2A5YB 1S29A 5D8LB 2WB1A 4I01A 3VOEA 5B5EC 3D5LA 1LJ9A 2FNAA 2CW8A 2OA4A 2VASA 2E2JJ 4D7MA 3S1RJ 2DI3A 2Q0OA 2XAJA 4IJAA 4LIVA 5ILSA 2EILH 4IQ4A 2PBIA 2GOMA 3I3LA 4ENMA 1TWHJ 3HYIA 3IWFA 1SC7A 5GADJ 3REOA 2XAHA 3OIOA 3RYRA 1LE8B 3OYMA 3MKWB 1FWZA 3B02A 4DIQA 3T0YA 3SYTA 3QYBA 1T08B 2IPQX 4N0BA 3RCOA 3RPQA 3KEOA 3ZMTA 4KIBA 4O5VA 1JTYA 4EM2A 3LAPA 4J19A 1WJCA 1T39A 4RGUA 2H8RA 1S72I 3J7AY 1J9IA 5LEJA 3H3ZA 4LG0A 5E1WA 5M5XJ 4B3AA 2UZKA 2M45A 1SMYF 3Q0VA 4XRSG 4FTHA 2LK2A 3GO5A 1WJDA 4UUSB 3JSPA 2H94A 2XUBA 4HX7A 1QHGA 2VC0A 1ZRFA 1T33A 1K79A 4XR6A 4A3KJ 2BW3B 4E7SA 3PFIA 2NNYA 3UNGC 5CKTA 3M7GA 5C4XJ 3GMEA 3PNYA 2L01A 1NK2P 2KRHA 2QF7A 1R22A 1ZLKA 1JT0A 2VKHA 1K6YA 2M3AA 3RQIA 3HPGA 3J7ZI 3LQQA 3CDLA 5EYRA 5EG0A 2AXTC 1PVEA 4V2GA 1K78A 3QYEA 4C2TA 1A6QA 3F8MA 4L0ZB 3GXOA 2AXLA 1U5TB 1VQ4I 3R6SA 1BOAA 2MLKA 5IYBJ 4A2UA 4F91B 5IY5H 3ZMVA 3KE2A 1KONA 4Y3OA 3V8LA 3WTWC 1HLVA 3H3VK 5DTDA 3E6DA 3IL2A 1VQ9I 2V9KA 3BQZA 3M07A 3NAUA 2KLOA 2PEXA 2IXSA 2ZMEA 3B73A 1UB9A 4MEYF 1P92A 3KZYA 1KU2A 1EH6A 3OYFA 5ILVA 2MC4A 2Z9OA 1JHFA 5LHHA 2FE3A 1MBJA 4B1RA 2ZBKA 4BNCA 2K4JA 3MWMA 1LUJB 2JWTA 4CCJA 5GP9A 4CYCB 3CCLI 3HOYJ 1SD7A 1H9GA 3SEQA 5DDGA 1OFCX 2PQ8A 2V1DA 4JX5A 1FBQA 4XRMA 2FQ3A 2JVHA 2LSOA 4RAZA 2PLYA 3EPZA 1CF7B 1MBHA 3BR6A 4F7ZA 3HTUA 4UVCA 5B3SH 4BGDA 4IL6C 4I09A 5JHFA 4A93J 1VFCA 4ZTFA 1NTCA 4KIGA 4AIHA 3IUOA 1R1VA 2PMZN 4P1WA 3WE2A 3L09A 2GOXB 3BJOA 4ESFA 4M3EA 1IXSB 2HI3A 5H6RA 3TGNA 2H09A 3LFUA 4CXFA 2JA8J 3DP7A 4PJ0C 5DCMB 2STWA 1OYWA 2V9VA 3DEWA 5ERIA 4I98B 2AQFA 3VSKA 4BBSJ 2IAIA 3GFMA 1IGNA 1TWCJ 1XTAA 2CV1A 4GYIA 4ANJA 1ZGAA 3BR1A 1R4MB 2XRLA 1BI0A 5F0CA 3BG5A 4HF1A 2DK5A 2FBHA 3HOSA 2CQXA 3CO7C 3ZGKA 4CO8A 2IGOA 1BBYA 2NVTJ 1XSVA 2QSFX 5BS6A 2VPLA 1P6RA 5F04A 4BQAA 2L5QA 1X1BA 4L5IA 1MH4A 2WV1A 2Y9ZA 3OWTA 1SFEA 3FMQA 2F5VA 2HS5A 1MJAA 2DPDA 2JA7J 4ZYEA 2P5VA 4KNYA 4L18B 1SD5A 3ERMA 3CDHA 3MMYB 1ON2A 4BEHA 2LNBA 2CUJA 1G3WA 1T95A 2FX0A 2OU2A 3LWFA 3LSIA 4IVNA 5DD4A 1S6LA 1RETA 3IWZA 1B9NA 4G9YA 1BI3A 2M87A 3ZOBA 3UR3C 4I0BA 1XG1A 2KIFA 4U88A 4E7KA 1MMSA 3DKYA 4HSRA 3M1CA 2IA1A 4CCMA 2IS6A 1KYZA 1G6NA 1MZBA 1WRJA 1BR1A 3F21A 3JRFA 2CUEA 3ZR8X 2ZO4A 2JSPA 4C2UA 5KAFC 3C2GA 1YS7A 1GHCA 3BT9A 2ID3A 4XKVA 2ZJ2A 1E0EA 1VF9A 1H8AC 1W1WE 3FIWA 4M3BA 1PP7U 2DK8A 3QU6A 2EFNA 4UVAA 1YIJI 3S2DJ 4A3CJ 3H5RA 2BYVE 4IRGA 2D5VA 4PFOA 2JRTA 1YJNI 3QP6A 3RJPA 5K7ZA 2ZCWA 4GDFA 3K7AJ 2EIJH 4XSXF 2NVQJ 1B4AA 2I8DA 2ZC2A 2DFEA 4PGHA 1U5TC 3ZQGA 5BPDA 2R93J 1QU3A 1E3HA 4CUGA 1W0TA 5D4RA 4KIFA 3JRCA 1I1GA 1V5GA 4LLNA 1VQKI 3I53A 4LITA 4DW6A 1DP3A 2DJNA 2OF7A 2ZXWH 3HKZA 3PQKA 3TOBA 3JRGA 5F6FA 1WPKA 2GM4A 3CESA 4BYYA 1TWAJ 2K9NA 2RVCA 3NQOA 4DQ2A 1RC9A 4LK0F 4A6EA 1HA8A 4XNFA 3F8NA 2YR2A 5JVGF 1IZ1A 4C3IJ 2NS8A 4Q47A 1ZYRF 2DQRA 3I59B 1LKXA 1WH7A 4LJZF 2NXNB 2DMPA 1YRNA 1TZLA 2OZ6A 2M8GX 2XAUA 1MKMA 1D0ZA 3KX2A 2VBXA 4CSWA 2ID6A 3TO7A 3J80Z 3G4SI 3A0HC 1QO0D 4LLGF 1OYIA 4HA8A 4ZJZA 3ZN1A 2JK3A 4AVPA 3HOXJ 4XN0A 4WX9A 4MHGA 3EDPA 1CQTA 1XGNA 2KDZA 3RKXA 3V7CA 4R8HA 2H8WA 4FQGA 3J81K 1HF0A 3I4PA 1J0RA 1YOVB 1OQYA 3K4MA 3D1NI 4OIOF 1W4MA 1YO5C 3BY6A 4E4HA 5EEGA 2OTJI 1DPUA 5BQTA 4HX4A 1H88C 2X48A 2ZSHB 3N4MA 2A69F 4KN4X 4LOCA 1GV2A 4NHJA 4A3MJ 4XOPA 4DYCA 1WJAA 1P9QC 4N9HA 1TTYA 1MNMC 2MABA 3CJQB 3ZQCA 1W5TA 1X3WB 1B72A 1U78A 4HV5A 3ABTA 4RLQA 2BEOA 2ISYA 3NARA 4JOMA 4XM3A 1VTNC 1X1AA 3TL4X 1FMVA 4MLOA 2FQ4A 2DA7A 2IA0A 2VODA 2MC3A 2ZFUA 4WK8F 1IJWC 1RRJA 1V55H 2EA2A 3P5JA 1O57A 4D5FA 2IP2A 1R36A 3I59A 2KKOA 2JN6A 3OS0A 3ABLH 2XSDC 5J8FA 3HPHA 1BM9A 1E17A 4KUMA 5E1XA 4AYBN 4ZYHA 1ZLJA 2ETHA 4M9XA 3WODF 1Z77A 4E7HA 3TO9A 3X2QH 3HRSA 4PJLA 4II3A 4CDGA 2F5EA 3HGGA 3HL2A 2FMLA 1AU7A 4IHXA 2R5ZA 2QYOA 4LB6B 3L7WA 4IXAA 2M30A 3WU0A 2HXOA 3K4NA 4OIQF 1IRGA 3KP2A 1B59A 3LSRA 2Q8KA 2CQKA 5E1ZB 1D0XA 1I3QJ 3PUBA 3QQAA 1R5GA 2LDUA 1Z21A 4HQEA 2EFPA 2ESNA 1LVKA 2BVMA 2O3FA 2KJCA 2ZJQF 2DT6A 3E0JB 2D2WA 1TP4A 1BR2A 3S8PA 3SZTA 1ZN2A 3CC4I 4IOCF 4ABZA 5IP6A 2YU3A 3ZQFA 5BNGA 4LIUA 4XLAA 1STZA 1OYYA 2KIUA 3VODA 4I6ZA 4XKCA 2JA5J 3LSTA 1BN5A 2ZMEC 1X3UA 2AHQA 3LA7A 1YX3A 2HNHA 2BY1A 1WJBA 3KEYA 3WTZA 1F9NA 3ZQQA 5KNLA 1OCPA 5GAHJ 1NK3P 2VJIA 3V8KA 2LG4A 3FK7A 3OOUA 2Z5UA 3RKWA 1BJZA 4TV7A 2F4IA 5IOYA 3MKZA 3BG6A 2MW8A 4W97A 4DYRA 2JPCA 3GFIA 4RAYA 3GUDA 3HJEA 1FOWA 4OWRB 1ITYA 1V4RA 3U9GA 3OYHA 5EF6A 4YG2F 2Y0SN 1F4KA 3GTPJ 2DYSH 2R7ZJ 2OZUA 3HKZN 2QKLB 2KFDA 3ZMUA 4F92B 2PMHA 5F64A 1FYMA 2DYRH 3BG9A 1IN6A 5E3OA 3RKYA 2RDPA 3DPUA 2FF4A 3HSEA 4EMSA 3HEFA 3CD6I 3TKYA 1I3AA 2HOSA 1MMNA 4OAYA 4RB2C 3E6CC 4HW0A 4E7IA 3A01A 4C3HJ 2V26A 4O6JA 1RKWA 1OCTC 2YX4A 1LFPA 1I6XA 2EIMH 2LY9A 4KJZA 3VYTB 3FXRA 4C30A 4IPAA 2HQ5A 3MCZA 4KT5C 1BW5A 2DT7B 4U7DA 2XB5A 3LOCA 1UZCA 2OBPA 3F8FA 2M8EA 3KP3A 5HS9A 3TOAA 1ON1A 2MH9A 2HVRA 1XDUA 2NVYJ 2WY7Q 3L2VA 1T0FC 4S05A 2O03A 3QOPA 4NQWA 4CCLA 2L3DA 3FM5A 3Q3SA 4PSXA 1XC5A 3RQ4A 3K6GA 4BE0A 5K7HA 3HM5A 3QWLA 4FE7A 1X4PA 4KDPA 4HQMA 3PSFA 4AIDA 2WBMA 3FHNA 4E7LA 5FRNA 1WJEA 4RMNA 1YW7A 4N4NB 2CV0A 4NBQA 1P7JA 2YUSA 1HKQA 3AFHA 5E8GA 2DFHA 3MQ0A 4LB5A 2JA6J 1BC7C 1DPRA 3HOTA 2K85A 1ETOA 3CCMI 2ZKZA 4XRSA 4DZJA 1FX7A 2VBYA 3BTJA 2XGXA 4W1UA 3HOWJ 5M3FJ 4X6AJ 5KVRA 3K2AA 4CA0A 2WC2A 2VPRA 3I0TA 4QTRA 1N78A 3BCAA 5HOOA 2VXZA 1ZG1A 4IHVA 3I4NJ 4Q5SF 3VFZA 4IF4A 2DDAA 4MTEA 3OV8A 5HLTA 2HDCA 3AL0C 4XLFA 1U3EM 2K3PA 3BG3A 3EETA 4D1QA 2QKMB 1QVTA 4RS8A 3I4MJ 4JBAA 4BJ5C 4P55A 4XLCA 2N8GA 4M71A 1XGSA 4YEJA 2JMWA 4CGZA 2L9SA 2M9HA 4A0ZA 3P9KA 2XROA 3JSOA 3L9FA 1XN7A 2LR8A 2XAFA 3VDXA 2WTEA 2EQRA 2DFIA 3QPHA 1RPWA 1EV7A 4AIJA 3MFKA 5E18F 4XN3A 4IRIA 1IG7A 2BVLA 1HKTA 3CDIA 5EJCA 2IRFG 2HTJA 2X0LA 1T38A 1HOMA 2EK5A 1JT6A 1DGWY 4P96A 3QOEA 1WFXA 3A0BC 3GCMA 5A2QK 5FLXZ 1IRZA 1GVDA 2HQAA 2R0QC 3ZXSA 2R3SA 5J3LA 1VI0A 1Q1HA 1G3TA 2Z1DA 2B7EA 1POGA 1OCRH 3E5UA 2PJPA 3TW6A 2D1VA 1Z3YA 2ZXHA 2LFBA 2A61A 3BCBA 4EJUA 2HVQA 3WTUC 1UG0A 1XDSA 1HQCA 1IXCA 3S2WA 1G8XA 1QZYA 3W6VA 2FBIA 2F5DA 2V1NA 3QAHA 5CVUA 1Q1VA 1X2MA 4RGRA 3RDIA 3H9QA 4D9JA 1GDTA 3BJAA 3Q0WA 5FKNA 3TEDA 2K9MA 4UY8I 2GXBA 5JLWA 1MDMA 3R0AA 1S7EA 3VSLA 2LH9A 3HOUJ 3HRTA 3MEXA 5J1YA 1WQ2A 4RLFA 2F4MB 2BXZA 4Y4RA 2JTVA 3D5RC 3GW2A 1MBKA 1IN5A 1JGGA 4IHTA 2LVSA 2Y31A 4L9JA 5E3MA 1KQ8A 1MNDA 3BZCA 3DWLE 5D5UB 3QYFA 2TCTA 2VBZA 4MQVA 3GTQJ 3KEQA 4E70A 4A6DA 4UHTA 4HNUA 5LRSA 3RPUA 3AG3H 3GVAA 3E5QA 1RNLA 2BW3A 3DBRB 5DS9A 4U0YA 1QZZA 3F23A 4RM2A 2L4MA 5GAGJ 4MO7A 2DO7A 3C2BA 3DQVC 1K83J 3VB2A 3FK6A 4K2EA 5E17F 2XPWA 3NWSA 1DQUA 1MBFA 1DP7P 3SJMA 2FRHA 1J75A 4UXNA 1S5LC 2X1EA 1NH3A 4AM3A 2WV0A 5L3CA 3COAC 1D5YA 4MQ9F 1ZREA 4KFCA 1E2XA 2E2IJ 5HLIA 4ZYGA 1IXRC 2JZYA 2FOWA 4EGYA 2WWYA 4BKXA 2R7FA 2W24A 4MEXF 3VEPA 1ZRCA 3HDDA 2PG4A 4G8XA 4WXDA 3RKQA 4WWCA 1XGMA 5FKKA 1V3FA 2EZKA 3K70C 3T5XA 3CCUI 2V6EA 3T8TA 4WXHA 5TJJA 2VB6A 2IS1A 3ECOA 2XVCA 1LPQA 4FETA 1UFMA 3U1DA 1K7AA 1G2HA 1I5ZA 2E34A 4UB6C 3HTSB 3PO3J 2M1BA 4BJTA 2M7BA 4N9IA 4P5OA 2DA5A 3E1SA 1W0UA 1PUFA 2HPMA 4DGWB 3BLYA 2OV7A 1W36C 3K0LA 1RI7A 4I76A 1GXPA 1HXDA 3IC7A 3HRUA 4KYWA 4EGZA 1D8KA 3QODA 3ONQA 2M7AA 1S7AA 1L0OC 5FFXA 2XGDA 3S1QJ 1ZG5A 4PZJA 2CV2A 1IRFA 1XX5A 1A31A 2IW5A 3WGGA 5HLHA 2HGCA 4LK1F 2RREA 2GXAA 5HLGA 5ED4A 2P6SA 3FMSA 2KIMA 2PMZA 2ELKA 2AS5F 2WAQN 3M3YJ 4HBLA 2GIVA 2ZXIA 3KLNA 1DDNA 4CCOA 1D1AA 2HWVA 4R1HA 4BE1A 3P7NA 4KN7X 5J1RA 5E3NA 3F0CA 2A6TA 3BR5A 5KK1A 2GLOA 2IGMA 4FCYA 4A3DJ 3F6VA 2IGNA 3L00A 3HHHA 3S32A 2PX9A 5F1JA 2EH3A 3OYJA 3CF5F 2XC7A 4EM1A 4Q4ZF 1U8BA 2NRAC 3LAJA 2ZFWA 3W2WA 3IV5A 3ERED 2P5KA 3S17J 2XF7A 2O9LA 1UJ8A 2R92J 1HKSA 3L2RA 5CYVA 1S9HA 1P7IA 2IJLA 5J40A 5FJ8J 2JUCA 3QU3A 4FHTA 1ZARA 2MGQA 3GLXA 3BR0A 1BW6A 4LMYA 3MKYB 1TL8A 4NDLA 4BXXJ 5KHDA 5HNHA 4UUVA 2W7NA 1HDDC 1FSEA 1EH8A 3K1PA 1ZR2A 3OYGA 1MNEA 2E1OA 1MMDA 1TQIA 1Z7UA 3H0DA 2QUFA 2TDXA 5B1AH 3HZJA 3M8FA 4FX4A 1Z05A 3GFJA 3EUHC 1XGOA 4I0AA 2RGVA 1USSA 2E1MC 1ZAOA 2M34A 2COBA 1D1BA 4LG3A 4XSZF 3TQNA 4B43A 3PL8A 2ZB9A 2DTRA 3I9V2 4I02A 3OSGA 1JKOC 2K9LA 4EJVA 1MMGA 1BOBA 2TRTA 3C2HA 3D0SA 1RIOH 2F5CA 3H1CA 2DN0A 2CSOA 2GA1A 4F55A 1I50J 2V4JC 4Y15A 1LB2A 1F5TA 3IAS2 5LGNA 5TRDA 1X3ZB 2IS4A 2ZNYA 3CCJI 4ZDLA 2YS9A 1JE8A 5EDNA 3DTIA 4OMYA 2H6BA 2GWRA 3S16J 3JRIA 2LOOA 3A02A 4MIMA 2F48A 3NEUA 3M8JA 1SFOJ 1YW8A 1PYVA 4II2A 2EINH 3N05A 3J7YJ 1Y1WJ 4MGRA 3CC7I 3FKJA 3ROUA 2VQHA 6PAXA 1R71A 4UUSA 1LEBA 5DD8A 1SAXA 1MW7A 2JVGA 3HUGA 4GGGA 1QPMA 1S8NA 3E6MA 4L0YB 4M3DA 2CH0A 4BS9A 2ELHA 1FY7A 2M5WA 3OL3A 5C3EJ 3FXKA 2LD5A 4L9NA 4KMUX 3AKZA 5TGTA 3GX4X 2P81A 1I27A 1MJ9A 4YIIA 4ZZDA 4M6YA 3M1EA 2R7QA 1MD0A 2K27A 5F27A 3RZOJ 2FJ1A 2Q1ZB 2PJRA 4G6QA 1IV8A 1Y0NA 4JX4A 4Z6YA 2VKEA 3HSFA 2Y75A 1LEAA 5F08A 2LBFA 1A5JA 3CMAI 3ZMSA 5CLSA 4BDZA 4M3GA 1ETQA 3IHUA 5L3DA 4PJNA 1XMAA 3GF2A 2DFFA 2VOPA 2K9QA 3HC7A 2ISZA 4DJAA 3AL0B 1HC8A 1P4AA 2OQRA 5C44J 4BBRJ 1JHHA 1OJLA 4L9TA 3CJRB 2BOLA 3W6KB 2I10A 1CF7A 1IN7A 1B8IB 3R4KA 4HOBA 1XSDA 4KICA 2OJED 2MD0A 3L1PA 2DMQA 4B09A 4EVIA 1R5ID 3BTCA 2FUG2 1RR7A 1O7FA 2CGPA 1O3QA 5FLXK 3TP3A 5DEQA 2QQBA 3IAM2 3L2WA 1R9TJ 4RM3A 3IP4B 3ISPA 2CU7A 4I99C 3PJRA 2P7VB 1X1PA 1H89C 4KA4A 1EJ9A 3F22A 2H6CA 4I2OA 1MJBA 4IO9F 2Q2EB 4UVBA 5EEHA 2XGCA 2EB7A 1LDJA 2GA2A 3LNQA 3GBGA 1B8IA 2KZVA 3G6EI 2ZNZA 3AAFA 2FBKA 1LVAA 3DPLC 1GT0C 1W7PA 2IT0A 1W7PB 3PSIA 3LFKA 5ICGA 1G59A 3OR1C 1TWFJ 4QIWN 2XB0X 2EWNA 3LSMA 1PUFB 4G6DA 2K86A 1D0YA 3C7JA 1ONVA 2OCCH 4UV8A 1ACIA 3EQLF 4CYCA 4XOTA 3KIOA 5IPAA 3MZ8A 2A07F 2E2HJ 2VUMJ 3S14J 3K10A 1XCBA 3IRRA 3SEZA 1MH3A 5IP7J 2P6TA 2XF6A 2CUFA 1T98A 3G2BA 4E7JA 2CUZA 1T56A 4EJWA 1KGSA 5GAEJ 2KL4A 1ETVA 3CTAA 4GXOA 1HBXG 4X1EA 1W5SA 3GZ5A 4HF0A 1USTA 1FP1D 2DOFA 1GV5A 2V1UA 5EGOB 2R7XA 2LP0A 4U7BA 5LGUA 1EA3A 4QLCU 4AIKA 1J59A 3R61A 2HOTA 1L3LA 3ELKA 4XBFA 2E5ZA 5BOXA 3TP0A 1F43A 3SZPA 3EUAA 4M9SA 3BZ6A 5F0HA 5J4VA 3F3XA 4S0HB 1SFUA 2OQGA 2CFOA 4XK4A 4A3LJ 1LFUP 2D1HA 5HDGA 2XAGA 3L2CA 3FZVA 2HTSA 3JAMK 1R58A 5E20A 4N4OB 2LY1A 2FU4A 5F1RA 1SFXA 2R7RA 3V42A 2Z3YA 1C0WA 4PGGA 3KCCA 1YHQI 4M3FA 3QP5A 5EZGA 3H5AA 4B47A 2HYJA 3CCVI 4XKWA 2VC1A 4PUSA 3OY9A 1FBUA 3SHFA 3B6AA 4LFUA 3E6BA 2KZGA 5ICFA 2K40A 1IO2A 2DA1A 5HS8A 1WJ5A 1BI1A 1IW7F 1YJWI 5J47A 2PI0A 2PN6A 1D5VA 2RQPA 3LA2A 4NB5A 3CP2A 1LNWA 3CLQA 1I39A 3DTKA 1MDMB 3IH3A 5J6XA 1WGXA 2L2OA 3F8BA 4G6TB 3WTSC 3DFGA 2ZMEB 2E5NA 2LKSA 2VLAA 2CW0F 3AG4H 3J7AO 3FXOA 3EUKL 1ZGWA 3BOQA 3GTGJ 4Y52J 2IVMA 1XD7A 3QPSA 3U21A 3WGIA 5LD2C 3DKWA 1XMXA 4AU7A 1JGSA 1WWXA 4PSWA 1WKMA 1YW9A 4FASD 1Y6IA 3B6CA 3M9AA 1K4SA 3K9TA 2QBYB 2CYYA 3VYRB 1KYWA 1R23A 4BQQA 1T2KA 3ZN0A 1H9TA 3ZCOA 1BA5A 5AIPA 1R4NB 2VXDA 3G73A 2K5CA 1QRYA 2F4OB 2M4GA 4PJMA 2ADUA 4ETSA 5JI6A 3H9GA 4HX8A 2JJ7A 5HNFA 1UHWA 3U2RA 3K69A 2VIXA 1MBEA 1BC8C 4HSTA 3VYUB 3HXLA 1XMKA 2ECCA 2YPRA 2X4HA 2DT5A 3GZ6A 1DU6A 2W82A 4M73A 2M4KA 3VYSB 3MVPA 5DM6F 2G0EA 1IV6A 5BPIA 2VT2A 4UUTA 3F8CA 5JHUA 5LHIA 4BU2A 4HYEA 3WHBA 4NC6A 4RA2A 4AVZA 2CWEA 1V5FA 3P9CA 4XLHA 3KP5A 4ZC3A 1X2NA 3IKVA 3ZPLA 4MTDA 4CCKA 2KIQA 3C18A 2LYCA 4M72A 4BHCA 3SZGA 3W2AA 3LQRA 3HOVJ 2R7SA 3BC8A 3CZ6A 1H0MA 1DUXC 2O7OA 4QWQA 1IUYA 1FOYA 4OIPF 3KFWX 1ODDA 3S3MA 3P9IA 1RUNA 4G12A 1OCCH 2RC4A
chains in the Genus database with same CATH topology
2PMZN 4HNVA 3ZQHA 5FLMJ 4M3EA 4MO7A 3BTLA 3C2BA 2HI3A 1K83J 3FK6A 5IP9J 2XPWA 2JA8J 1ZKGA 3CMYA 1MBFA 3DEWA 3G1MA 5EEAA 3SJMA 5FLVA 3GTMJ 2ME0A 5E3LA 4BBSJ 1D5YA 1I6HJ 2IAIA 1AKHB 1IGNA 2E2IJ 1TWCJ 5IYDJ 3BR1A 4A69C 4BKXA 1E3OC 2XRLA 5F0CA 3HDDA 4A3GJ 3BG5A 3RKQA 5FKKA 2EZKA 3S1NJ 2CQXA 4EEFG 4B4CA 2NVTJ 1UG2A 1JUSA 3O8HA 5F04A 1MH4A 2WV1A 5M5WJ 2Y30A 2Y9ZA 1G2HA 3PO3J 2DA5A 1W0UA 1FJLA 1PUFA 2JA7J 2DMNA 1ZK8A 2AO9A 2R5YB 1QPIA 3LSJA 4I76A 5JLXA 3MN2A 3G1OA 2DMUA 2FX0A 5FKLA 4C2MJ 2XGDA 4FE4A 3S1QJ 2EZLA 1RETA 3ZOBA 1XG1A 1UHSA 2GBYA 1JTXA 2ELKA 2WAQN 3M3YJ 3JRFA 1Y1VJ 2X6OA 2CUEA 1IC8A 3VPRA 3S1MJ 2LLKA 2LTPA 1O4XA 5J1RA 5E3NA 2O8KA 3F0CA 3BR5A 2GLOA 2M0CA 4JYKA 4FCYA 3DCFA 4A3DJ 1YRNB 3BT9A 2ID3A 1MSFC 1VF9A 1H8AC 5F1JA 4RBOA 1APLC 2EH3A 5M3MJ 3JRHA 3FIWA 2DA6A 1ORKA 2VI6A 4A3EJ 4M3BA 1U8BA 3S2DJ 4A3CJ 2MSYA 3IV5A 2D5VA 3LSPA 3S17J 2O9LA 4A3IJ 2R92J 1TC3C 3G1LA 5K7ZA 2DA3A 1P7IA 3K7AJ 1ZQ3P 1FIAA 5FJ8J 2NVQJ 4MFEA 1IDZA 2MGQA 5EG0B 3GTJJ 3BR0A 3PM1A 3ZQGA 1BW6A 2R93J 3HBLA 4BXXJ 4NDLA 1W0TA 3BR2A 3JRCA 1HDPA 3JRAA 1IUFA 1RESA 4QSHA 1HDDC 1ZR2A 4DW6A 2DJNA 2E1OA 2OF7A 1ZTRA 3JRGA 1WPKA 4RDUA 2GM4A 1TWAJ 2K9NA 1IDYA 3OSFA 4FISA 4C3IJ 2B63J 2M34A 2NS8A 2COBA 3QPLA 5IOZA 1WH7A 2DMPA 2ZB9A 1YRNA 3OSGA 2OPTA 1JKOC 2M8GX 3PO2J 2TRTA 2ID6A 4C3JJ 3HOZJ 5EZHA 4D5CA 4JP0A 2DN0A 2JK3A 3HOXJ 1I50J 3FISA 1WI3A 1ETWA 4D7NA 1BL0A 1CQTA 2L9RA 2KDZA 1MBGA 2YS9A 2HOAA 5EDNA 1HF0A 3S16J 2L7MP 3FKIJ 3JRIA 4MIMA 3A02A 3D1NI 1UMQA 1SFOJ 1Y1WJ 3SFIA 3BR3A 1ZR4A 2W48A 1H88C 2X48A 4AC0A 4A3BJ 3CCYA 1GV2A 4LOCA 9ANTA 4A3MJ 4DYCA 1U9NA 1MNMC 1VNDA 3ZQIA 3ZQCA 4UUSA 1B72A 1U78A 3NARA 3IH2A 3GTOJ 1U9OA 4MLOA 4MFDA 1JKPC 3ZQLA 2FQ4A 2EBIA 2DA7A 4M3DA 3CQZJ 5C3EJ 1IJWC 1LE8A 2LD5A 2DA4A 1FIPA 4D5FA 2NVXJ 2P81A 4M6VA 2JN6A 1Z0XA 2XSDC 2RAEA 5F27A 3RZOJ 2FJ1A 2MG4A 2VKVA 4AYBN 2HDDA 1ENHA 1Z77A 5C4JJ 4JX4A 3HGGA 2XGEA 2VKEA 2R5YA 1AU7A 5F08A 4IHXA 2R5ZA 1A5JA 2HXOA 4M3GA 1ETQA 2CRGA 3Q0UA 5IYCJ 3A01B 2K9SA 5J1UA 1AHDP 3LSRA 2K9QA 2FD5A 2EZHA 1I3QJ 3O8GA 3QQAA 2H1KA 1HCRA 5M5YJ 1ETYA 2XPUA 5C44J 4BBRJ 1OJLA 2IEKA 2I10A 4IHYA 1A6IA 5FKMA 3IH4A 1B8IB 3BQYA 3WHCA 4ABZA 5IP6A 3ZQFA 5BNGA 1TWGJ 3E7LA 4I6ZA 3L1PA 2DMQA 2JA5J 3BTCA 1RR7A 4BY7J 2AHQA 1JKQC 3SDGA 1OCPA 3TP3A 1NK3P 1R9TJ 1JUMA 3FK7A 1JJ6C 2Y2ZA 3OOUA 2CQQA 2CU7A 5IOYA 1BJZA 1GUUA 2KT0A 1H89C 2MW8A 2X9DA 4W97A 3H0GJ 4DYRA 5K7FA 2XGCA 3M4OJ 3LNQA 1ITYA 3GBGA 5EF6A 1B8IA 2Y0SN 4A3FJ 4BY1J 3GTPJ 1GT0C 2R7ZJ 3HKZN 1FEXA 3BG9A 1TWFJ 5E3OA 4DYQA 4QIWN 2QCOA 2NOGA 2XB0X 1WH5A 3A03A 3S15J 3HEFA 4IEJA 3JRDA 1PUFB 3A01A 1RKTA 4C3HJ 3RZDJ 4CYCA 1RKWA 4JX6A 2R5ZB 5IPAA 1OCTC 2E2HJ 2VUMJ 2LY9A 3S14J 4AUXA 2CJJA 2EZIA 1MH3A 2HQ5A 5IP7J 1BW5A 1MSEC 2XB5A 2CUFA 3LOCA 3JREA 1T56A 1EF4A 1ETVA 4X1EA 2NVYJ 1JUPA 1GV5A 3Q3SA 5EGOB 1XC5A 2LP0A 2M2EA 1ETKA 3GTKJ 5K7HA 3BTIA 3HM5A 1AKHA 4FE7A 2HOTA 1X58A 1F43A 4L5EA 5FKOA 3TP0A 2ECBA 2Y9YA 1FTTA 5F0HA 1P7JA 2YUSA 4S0HB 4XK4A 3UKGA 2JA6J 2YU9J 4A3LJ 1LFUP 1ETOA 2XPVA 5F0FA 4XRSA 4DZJA 3BTJA 4W1UA 3HOWJ 5M3FJ 4X6AJ 3MKLA 3K2AA 2E2JJ 1DU0A 4IHWA 1XS9A 2DA2A 2NS7A 2VPRA 4D7MA 4QTRA 3S1RJ 1JKRC 4DZPA 3GTLJ 4M3FA 5EZGA 4IHVA 3I4NJ 2HYJA 1TWHJ 3HB9A 2IBDA 3B6AA 3TW7A 3OIOA 1LE8B 2K40A 3BG3A 1QVTA 3I4MJ 2DA1A 2E19A 5GPAA 2N8GA 2L7ZA 2HOSA 1SANA 1JTYA 1QVUA 4J19A 2JMWA 2H8RA 5HODA 2M9HA 2L0KA 5M5XJ 4B3AA 3IH3A 1WGXA 2LR8A 3Q0VA 4XRSG 4FTHA 2LK2A 3LSGA 2EQRA 1RPWA 4UUSB 1B72B 4A3JJ 4XICA 2L7FP 1ZGWA 3GTGJ 1IG7A 1T33A 4Y52J 3QPSA 3JR9A 4A3KJ 1HOMA 3B6CA 5C4XJ 1JT6A 1NK2P 2QF7A 1JT0A 1IRZA 1FTZA 3RQIA 1GVDA 2R0QC 5EYRA 3CDLA 5J3LA 1VI0A 5EG0A 4V2FA 1BA5A 4V2GA 5GPCA 1POGA 1QRYA 3TW6A 1ETXA 2LFBA 5IYBJ 2JJ7A 2DMTA 1HLVA 3W6VA 3H3VK 1LFBA 5EGOA 1MBEA 5DTDA 2ECCA 3BQZA 3NAUA 1Q1VA 1X2MA 2WB1N 4XIDA 1DU6A 1GDTA 3JRBA 1F36A 3MVPA 3Q0WA 5FKNA 1IV6A 2G0EA 3TEDA 4UUTA 5JLWA 1S7EA 1MBJA 4B1RA 2LKXA 3HOUJ 3WHBA 2ME6A 3HGYA 2JWTA 5J1YA 5GP9A 4CYCB 1WCMJ 3HOYJ 4Y7NJ 1OFCX 4JX5A 1MBKA 1X2NA 1K61A 1JGGA 4XRMA 4GFBA 2LVSA 2Y31A 5E3MA 2TCTA 1JJ8C 2DTZA 3GTQJ 1MBHA 3BR6A 3HOVJ 2O7OA 3S2HJ 2HXIA 4A93J 1VFCA 1NTCA 4G12A 5DS9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2PMZ N;  4HNV A;  3ZQH A;  5FLM J;  4M3E A;  4MO7 A;  3BTL A;  3C2B A;  2HI3 A;  1K83 J;  3FK6 A;  5IP9 J;  2XPW A;  2JA8 J;  1ZKG A;  3CMY A;  1MBF A;  3DEW A;  3G1M A;  5EEA A;  3SJM A;  5FLV A;  3GTM J;  2ME0 A;  5E3L A;  4BBS J;  1D5Y A;  1I6H J;  2IAI A;  1AKH B;  1IGN A;  2E2I J;  1TWC J;  5IYD J;  3BR1 A;  4A69 C;  4BKX A;  1E3O C;  2XRL A;  5F0C A;  3HDD A;  4A3G J;  3BG5 A;  3RKQ A;  5FKK A;  2EZK A;  3S1N J;  2CQX A;  4EEF G;  4B4C A;  2NVT J;  1UG2 A;  1JUS A;  3O8H A;  5F04 A;  1MH4 A;  2WV1 A;  5M5W J;  2Y30 A;  2Y9Z A;  1G2H A;  3PO3 J;  2DA5 A;  1W0U A;  1FJL A;  1PUF A;  2JA7 J;  2DMN A;  1ZK8 A;  2AO9 A;  2R5Y B;  1QPI A;  3LSJ A;  4I76 A;  5JLX A;  3MN2 A;  3G1O A;  2DMU A;  2FX0 A;  5FKL A;  4C2M J;  2XGD A;  4FE4 A;  3S1Q J;  2EZL A;  1RET A;  3ZOB A;  1XG1 A;  1UHS A;  2GBY A;  1JTX A;  2ELK A;  2WAQ N;  3M3Y J;  3JRF A;  1Y1V J;  2X6O A;  2CUE A;  1IC8 A;  3VPR A;  3S1M J;  2LLK A;  2LTP A;  1O4X A;  5J1R A;  5E3N A;  2O8K A;  3F0C A;  3BR5 A;  2GLO A;  2M0C A;  4JYK A;  4FCY A;  3DCF A;  4A3D J;  1YRN B;  3BT9 A;  2ID3 A;  1MSF C;  1VF9 A;  1H8A C;  5F1J A;  4RBO A;  1APL C;  2EH3 A;  5M3M J;  3JRH A;  3FIW A;  2DA6 A;  1ORK A;  2VI6 A;  4A3E J;  4M3B A;  1U8B A;  3S2D J;  4A3C J;  2MSY A;  3IV5 A;  2D5V A;  3LSP A;  3S17 J;  2O9L A;  4A3I J;  2R92 J;  1TC3 C;  3G1L A;  5K7Z A;  2DA3 A;  1P7I A;  3K7A J;  1ZQ3 P;  1FIA A;  5FJ8 J;  2NVQ J;  4MFE A;  1IDZ A;  2MGQ A;  5EG0 B;  3GTJ J;  3BR0 A;  3PM1 A;  3ZQG A;  1BW6 A;  2R93 J;  3HBL A;  4BXX J;  4NDL A;  1W0T A;  3BR2 A;  3JRC A;  1HDP A;  3JRA A;  1IUF A;  1RES A;  4QSH A;  1HDD C;  1ZR2 A;  4DW6 A;  2DJN A;  2E1O A;  2OF7 A;  1ZTR A;  3JRG A;  1WPK A;  4RDU A;  2GM4 A;  1TWA J;  2K9N A;  1IDY A;  3OSF A;  4FIS A;  4C3I J;  2B63 J;  2M34 A;  2NS8 A;  2COB A;  3QPL A;  5IOZ A;  1WH7 A;  2DMP A;  2ZB9 A;  1YRN A;  3OSG A;  2OPT A;  1JKO C;  2M8G X;  3PO2 J;  2TRT A;  2ID6 A;  4C3J J;  3HOZ J;  5EZH A;  4D5C A;  4JP0 A;  2DN0 A;  2JK3 A;  3HOX J;  1I50 J;  3FIS A;  1WI3 A;  1ETW A;  4D7N A;  1BL0 A;  1CQT A;  2L9R A;  2KDZ A;  1MBG A;  2YS9 A;  2HOA A;  5EDN A;  1HF0 A;  3S16 J;  2L7M P;  3FKI J;  3JRI A;  4MIM A;  3A02 A;  3D1N I;  1UMQ A;  1SFO J;  1Y1W J;  3SFI A;  3BR3 A;  1ZR4 A;  2W48 A;  1H88 C;  2X48 A;  4AC0 A;  4A3B J;  3CCY A;  1GV2 A;  4LOC A;  9ANT A;  4A3M J;  4DYC A;  1U9N A;  1MNM C;  1VND A;  3ZQI A;  3ZQC A;  4UUS A;  1B72 A;  1U78 A;  3NAR A;  3IH2 A;  3GTO J;  1U9O A;  4MLO A;  4MFD A;  1JKP C;  3ZQL A;  2FQ4 A;  2EBI A;  2DA7 A;  4M3D A;  3CQZ J;  5C3E J;  1IJW C;  1LE8 A;  2LD5 A;  2DA4 A;  1FIP A;  4D5F A;  2NVX J;  2P81 A;  4M6V A;  2JN6 A;  1Z0X A;  2XSD C;  2RAE A;  5F27 A;  3RZO J;  2FJ1 A;  2MG4 A;  2VKV A;  4AYB N;  2HDD A;  1ENH A;  1Z77 A;  5C4J J;  4JX4 A;  3HGG A;  2XGE A;  2VKE A;  2R5Y A;  1AU7 A;  5F08 A;  4IHX A;  2R5Z A;  1A5J A;  2HXO A;  4M3G A;  1ETQ A;  2CRG A;  3Q0U A;  5IYC J;  3A01 B;  2K9S A;  5J1U A;  1AHD P;  3LSR A;  2K9Q A;  2FD5 A;  2EZH A;  1I3Q J;  3O8G A;  3QQA A;  2H1K A;  1HCR A;  5M5Y J;  1ETY A;  2XPU A;  5C44 J;  4BBR J;  1OJL A;  2IEK A;  2I10 A;  4IHY A;  1A6I A;  5FKM A;  3IH4 A;  1B8I B;  3BQY A;  3WHC A;  4ABZ A;  5IP6 A;  3ZQF A;  5BNG A;  1TWG J;  3E7L A;  4I6Z A;  3L1P A;  2DMQ A;  2JA5 J;  3BTC A;  1RR7 A;  4BY7 J;  2AHQ A;  1JKQ C;  3SDG A;  1OCP A;  3TP3 A;  1NK3 P;  1R9T J;  1JUM A;  3FK7 A;  1JJ6 C;  2Y2Z A;  3OOU A;  2CQQ A;  2CU7 A;  5IOY A;  1BJZ A;  1GUU A;  2KT0 A;  1H89 C;  2MW8 A;  2X9D A;  4W97 A;  3H0G J;  4DYR A;  5K7F A;  2XGC A;  3M4O J;  3LNQ A;  1ITY A;  3GBG A;  5EF6 A;  1B8I A;  2Y0S N;  4A3F J;  4BY1 J;  3GTP J;  1GT0 C;  2R7Z J;  3HKZ N;  1FEX A;  3BG9 A;  1TWF J;  5E3O A;  4DYQ A;  4QIW N;  2QCO A;  2NOG A;  2XB0 X;  1WH5 A;  3A03 A;  3S15 J;  3HEF A;  4IEJ A;  3JRD A;  1PUF B;  3A01 A;  1RKT A;  4C3H J;  3RZD J;  4CYC A;  1RKW A;  4JX6 A;  2R5Z B;  5IPA A;  1OCT C;  2E2H J;  2VUM J;  2LY9 A;  3S14 J;  4AUX A;  2CJJ A;  2EZI A;  1MH3 A;  2HQ5 A;  5IP7 J;  1BW5 A;  1MSE C;  2XB5 A;  2CUF A;  3LOC A;  3JRE A;  1T56 A;  1EF4 A;  1ETV A;  4X1E A;  2NVY J;  1JUP A;  1GV5 A;  3Q3S A;  5EGO B;  1XC5 A;  2LP0 A;  2M2E A;  1ETK A;  3GTK J;  5K7H A;  3BTI A;  3HM5 A;  1AKH A;  4FE7 A;  2HOT A;  1X58 A;  1F43 A;  4L5E A;  5FKO A;  3TP0 A;  2ECB A;  2Y9Y A;  1FTT A;  5F0H A;  1P7J A;  2YUS A;  4S0H B;  4XK4 A;  3UKG A;  2JA6 J;  2YU9 J;  4A3L J;  1LFU P;  1ETO A;  2XPV A;  5F0F A;  4XRS A;  4DZJ A;  3BTJ A;  4W1U A;  3HOW J;  5M3F J;  4X6A J;  3MKL A;  3K2A A;  2E2J J;  1DU0 A;  4IHW A;  1XS9 A;  2DA2 A;  2NS7 A;  2VPR A;  4D7M A;  4QTR A;  3S1R J;  1JKR C;  4DZP A;  3GTL J;  4M3F A;  5EZG A;  4IHV A;  3I4N J;  2HYJ A;  1TWH J;  3HB9 A;  2IBD A;  3B6A A;  3TW7 A;  3OIO A;  1LE8 B;  2K40 A;  3BG3 A;  1QVT A;  3I4M J;  2DA1 A;  2E19 A;  5GPA A;  2N8G A;  2L7Z A;  2HOS A;  1SAN A;  1JTY A;  1QVU A;  4J19 A;  2JMW A;  2H8R A;  5HOD A;  2M9H A;  2L0K A;  5M5X J;  4B3A A;  3IH3 A;  1WGX A;  2LR8 A;  3Q0V A;  4XRS G;  4FTH A;  2LK2 A;  3LSG A;  2EQR A;  1RPW A;  4UUS B;  1B72 B;  4A3J J;  4XIC A;  2L7F P;  1ZGW A;  3GTG J;  1IG7 A;  1T33 A;  4Y52 J;  3QPS A;  3JR9 A;  4A3K J;  1HOM A;  3B6C A;  5C4X J;  1JT6 A;  1NK2 P;  2QF7 A;  1JT0 A;  1IRZ A;  1FTZ A;  3RQI A;  1GVD A;  2R0Q C;  5EYR A;  3CDL A;  5J3L A;  1VI0 A;  5EG0 A;  4V2F A;  1BA5 A;  4V2G A;  5GPC A;  1POG A;  1QRY A;  3TW6 A;  1ETX A;  2LFB A;  5IYB J;  2JJ7 A;  2DMT A;  1HLV A;  3W6V A;  3H3V K;  1LFB A;  5EGO A;  1MBE A;  5DTD A;  2ECC A;  3BQZ A;  3NAU A;  1Q1V A;  1X2M A;  2WB1 N;  4XID A;  1DU6 A;  1GDT A;  3JRB A;  1F36 A;  3MVP A;  3Q0W A;  5FKN A;  1IV6 A;  2G0E A;  3TED A;  4UUT A;  5JLW A;  1S7E A;  1MBJ A;  4B1R A;  2LKX A;  3HOU J;  3WHB A;  2ME6 A;  3HGY A;  2JWT A;  5J1Y A;  5GP9 A;  4CYC B;  1WCM J;  3HOY J;  4Y7N J;  1OFC X;  4JX5 A;  1MBK A;  1X2N A;  1K61 A;  1JGG A;  4XRM A;  4GFB A;  2LVS A;  2Y31 A;  5E3M A;  2TCT A;  1JJ8 C;  2DTZ A;  3GTQ J;  1MBH A;  3BR6 A;  3HOV J;  2O7O A;  3S2H J;  2HXI A;  4A93 J;  1VFC A;  1NTC A;  4G12 A;  5DS9 A; 
#chains in the Genus database with same CATH topology
 2VJ4 A;  3FXL A;  4XL9 A;  3ZQH A;  4EAT A;  2HOE A;  3GYH X;  3BP8 A;  2HR3 A;  5FLM J;  5K5Q A;  3BTL A;  1OPC A;  3OOP A;  5IP9 J;  3RTR A;  1VQP I;  1ZKG A;  1V5E A;  3PNT A;  3CMY A;  1JI8 A;  2RNG A;  5EEA A;  5IT9 K;  1SMT A;  5FLV A;  1MIJ A;  3GTM J;  2ME0 A;  2GZW A;  5E3L A;  3CCS I;  1IAW A;  1I6H J;  2KMU A;  2X51 A;  3FDY A;  5ICC A;  4NC7 A;  1S3J A;  3CF2 A;  1FPQ A;  2WY8 Q;  3WG7 H;  2LY2 A;  2HFH A;  1E3O C;  5A2Q Z;  3J81 Z;  4Y13 A;  4RB1 A;  3S1N J;  1TW3 A;  2X6X A;  4EEF G;  3LMM A;  2UWM A;  5GTH C;  2P5L C;  3ASO H;  2L7K A;  3HRM A;  1UG2 A;  1JUS A;  1OIS A;  3O8H A;  2LRD A;  2XAS A;  5M5W J;  1P4W A;  4YFN F;  2BHY A;  3U1K A;  2DU9 A;  4RAF A;  5AIQ A;  2AO9 A;  2R5Y B;  1QPI A;  3LSJ A;  3TBI A;  2VJ5 A;  3DEE A;  3G1O A;  1QA6 A;  4CCN A;  1UEL B;  5FKL A;  1G4D A;  2JUG A;  4BQO A;  2DBB A;  2BY3 A;  3H5N A;  1Z3X A;  3MZH A;  2EZL A;  4YRV A;  4L9V A;  3LSH A;  1AOY A;  1UHS A;  3GEZ A;  3OIQ A;  2GBY A;  1JTX A;  1FT9 A;  4BJ6 C;  1WZ2 A;  1R7J A;  5AON A;  4A12 A;  1IC8 A;  2GAU A;  3VPR A;  3S1M J;  5DUK A;  2LLK A;  2Z33 A;  1O4X A;  2V7F A;  3SDB A;  3Q9S A;  3AG1 H;  4JYK A;  2R4G A;  5H20 A;  2BBY A;  1YRN B;  3I56 I;  1TNS A;  3SFZ A;  1APL C;  4E6K G;  5M3M J;  2EV5 A;  3FXJ A;  3FM3 A;  2VI6 A;  3AG2 H;  2VBW A;  4BHB A;  1Z1D A;  4PK4 A;  1P4X A;  3V8J A;  2VT3 A;  3TDU C;  2MSY A;  4YEL A;  3LSP A;  3CUQ B;  4A3I J;  1TC3 C;  2DA3 A;  3SXY A;  1O3R A;  1QBJ A;  4R79 A;  4A5N A;  5LHG A;  1ZQ3 P;  1FIA A;  4MFE A;  2BXY A;  3ML6 A;  4A0Y A;  5D5V B;  1IDZ A;  5EG0 B;  2F2E A;  2DJI A;  3PM1 A;  1KQ0 A;  3BR2 A;  1HDP A;  3KP7 A;  4WXC A;  3FWE A;  2DOA A;  4QSH A;  1CGP A;  1SVL A;  1WJF A;  3Q9V A;  4GO1 A;  4BQN A;  1YTY A;  3OMY A;  5H2F C;  3CJT B;  2R7U A;  2QEX I;  4OIN F;  4XOR A;  3DXJ F;  1IDY A;  1W36 D;  4ITV A;  2P0W A;  4FIS A;  1S7O A;  3PIP F;  1OCO H;  3KZZ A;  2VON A;  2KDO A;  2B63 J;  3ZQ7 A;  2E60 A;  2EIK H;  2J5O A;  1MMA A;  3ECH A;  1PUE E;  5IOZ A;  1FMW A;  1Z91 A;  1X1C A;  2OPT A;  1VQ6 I;  4G94 A;  4ON0 A;  1UCR A;  3KLO A;  2LF7 A;  1FYL A;  1VQ8 I;  3PQJ A;  4C3J J;  2CG4 A;  3HOZ J;  3KET A;  4NNJ A;  4JP0 A;  1R5H A;  3NWT A;  5L3B A;  1Z9C A;  3E3V A;  5LGT A;  2AQE A;  2RNJ A;  1WI3 A;  4D7N A;  4AD9 A;  1BL0 A;  3PFY A;  2E1C A;  2L9R A;  3K4J A;  1VQ7 I;  1Y0U A;  2I5U A;  1RR8 C;  1VQN I;  4QPQ A;  5LFA A;  3FXQ A;  2L7M P;  3F72 A;  3FKI J;  3BWG A;  5DCF A;  1UMQ A;  1YFH A;  1SVM A;  2V6C A;  2ZXJ A;  2CW7 A;  4ESJ A;  3OS2 A;  4PDK A;  4A3B J;  3CCY A;  4H4K C;  3L2U A;  3S3O A;  1U9N A;  3ZQI A;  5CVJ A;  1LDK B;  4HPQ A;  2FXA A;  2GXG A;  2V1X A;  1QNT A;  4EM0 B;  2L9V A;  4GYG A;  3WU2 C;  3DLL F;  2JA2 A;  1U9O A;  4MFD A;  3TDZ C;  1JKP C;  4HG2 A;  3ZQL A;  2EBI A;  2A6E F;  1FP2 A;  5K5O A;  3CQZ J;  5JFR A;  1KQ9 A;  2MYS A;  2DA4 A;  1EKE A;  3DBH B;  3H35 A;  4Y17 A;  3EYI A;  2NYX A;  4EJO A;  4HDU A;  4M6V A;  5FFZ A;  3W2V A;  3V4G A;  3ZRG A;  2XHK A;  2RAE A;  2QQA A;  2NVU B;  1O3T A;  4IQJ A;  1Z6R A;  1SFK A;  4G7Z F;  1ENH A;  2VE8 A;  2DAO A;  4RB0 A;  3C3W A;  3K1N A;  1IN8 A;  1UHM A;  2WAF A;  2X1C A;  5C4J J;  2XGE A;  4CHU A;  2L9N A;  4BE2 A;  2JRM A;  2BZT A;  2QVO A;  2BGC A;  2EV0 A;  2Z16 A;  4XLE A;  1YG2 A;  1X19 A;  1YYV A;  2CRG A;  4KIT B;  5IYC J;  1AHD P;  2O61 A;  5J1U A;  2HZT A;  4FX0 A;  2EZH A;  3M8E A;  2Z2S B;  3A4C A;  1DGR M;  3S93 A;  4AYB A;  4J00 A;  2H1K A;  1HCR A;  1BI2 A;  1ETY A;  2XAQ A;  5M5Y J;  4BAC A;  2A68 F;  3TO6 A;  3OL4 A;  2IEK A;  3CUQ A;  2W57 A;  2KHM A;  2CS3 A;  1WHU A;  2RKH A;  3Q5F A;  1FSH A;  5E79 C;  3BQY A;  1YJ9 I;  4J01 A;  5L3G A;  1OR7 C;  2QWW A;  2X85 A;  4NUB A;  3S3N A;  3W3C A;  2DXI A;  4F93 B;  3E7L A;  4X0G A;  3V7R A;  2R7D A;  3DEU A;  4BDY A;  4RGS A;  1SVO A;  1TW2 A;  2EFQ A;  4BY7 J;  5J4Y A;  1JKQ C;  2E1M B;  5CJ9 A;  3JTG A;  4YFK F;  1U8R A;  2VQG A;  2FSW A;  4A0X A;  1JJ6 C;  2Y2Z A;  2UUZ A;  3EUH A;  3FHZ A;  2KT0 A;  2XV4 S;  3H92 A;  3WE3 A;  2KRF A;  5FD6 A;  3WTV C;  3OYB A;  2X9D A;  5K7F A;  2ELJ A;  3M4O J;  4ZYD A;  3OYL A;  4EQQ A;  3SQN A;  2EFO A;  2XDV A;  3J80 K;  2XSJ C;  3LSK A;  4BY1 J;  2BY0 A;  4IHS A;  5FB2 A;  2QEN A;  5ILU A;  2WAD A;  1TT0 A;  3WGH A;  2VL8 A;  4PFP A;  3H9J A;  1SD4 A;  3IKT A;  4DYQ A;  2KPM A;  2QCO A;  2NOG A;  2Q2E A;  3A03 A;  2STT A;  1JXS A;  2E36 A;  4IEJ A;  2QSG X;  4B44 A;  1ZRD A;  4MNU A;  1RKT A;  5FO5 A;  3RZD J;  2CFX A;  2OUM A;  3RI4 A;  2KJB A;  4JX6 A;  2R5Z B;  2COM A;  2O5R A;  3A1Y A;  2Y69 H;  3WTX C;  2CJJ A;  2E7W A;  4LLL A;  3K4K A;  4G7H F;  1P2F A;  2K02 A;  5J8C A;  2KRC A;  4DBQ A;  3JRE A;  4UNO A;  3JTH A;  3MZY A;  3K4B A;  1BIA A;  1HW2 A;  5HVQ C;  1U0J A;  1A36 A;  3JAM Z;  3RYP A;  2M2E A;  4KIS A;  1ETK A;  4Z2Y A;  3ZMD A;  4B3X A;  3OYE A;  1FOK A;  1AKH A;  2UXX A;  3BZK A;  1X58 A;  5FKO A;  5LEK A;  2Y9Y A;  1VQ5 I;  1FTT A;  3DV8 A;  3G3Z A;  2IGK A;  4ZDP A;  3WTY C;  2O0Y A;  4QPO A;  3CCQ I;  3ABU A;  4HDV A;  5IT3 A;  3UKG A;  2YU9 J;  2FNP A;  1OKR A;  4O3M A;  1A35 A;  2R7V A;  5F0F A;  3LA3 A;  2GQQ A;  2DQL A;  3MKL A;  1VZ0 A;  2HDW A;  1DU0 A;  4FT8 A;  4IHW A;  1XS9 A;  2DA2 A;  2NS7 A;  2DDB A;  1JKR C;  1YLF A;  2DCE A;  3F9K A;  5B1B H;  4DZP A;  2L4A A;  3I71 A;  3QPT A;  1KU9 A;  4D0P A;  3GTL J;  2PJR B;  1N77 A;  3BPX A;  2LMD A;  4IKF A;  3ASN H;  3JW4 A;  3MD2 A;  4PJJ A;  4XMY A;  3HB9 A;  2IBD A;  4U0W A;  3TW7 A;  1ZG3 A;  3GFL A;  2HYF A;  4BAY A;  2E19 A;  3OYC A;  3VWB A;  1TQP A;  5DM7 F;  2QQ8 A;  5GPA A;  4BHP A;  2L7Z A;  1SAN A;  1QVU A;  2HZD A;  3ULQ B;  5HOD A;  3I64 A;  2Y0M A;  1GVJ A;  2L0K A;  4ENK A;  2W4S A;  2L54 A;  1B1B A;  1FC3 A;  1B6A A;  2X6W A;  4JK1 X;  1D8J A;  3LSG A;  2VJJ A;  1B72 B;  3FX3 A;  2C6Y A;  4A3J J;  4XIC A;  2BE5 F;  3QRF F;  2L7F P;  1J09 A;  1TT5 B;  2PMU A;  3JR9 A;  1WVR A;  2FA5 A;  3KZI C;  4GRI A;  4H0E A;  1PDN C;  2IA2 A;  2QQ9 A;  1R1U A;  1WI9 A;  1FTZ A;  2VQL A;  4KMF A;  1NG7 A;  2B9S A;  4F52 A;  4V2F A;  2WAE A;  4ZYA A;  2W84 A;  3F6O A;  4AWX B;  2W25 A;  2JQ7 A;  5GPC A;  4HLY A;  5IT9 Z;  2BY2 A;  2KP6 A;  1ETX A;  4P9U A;  3KYD B;  1SAU A;  2YSR A;  4M6X A;  3DBL B;  4HAM A;  5HDN A;  2DMT A;  5CVV A;  1BJA A;  2O8X A;  2BHZ A;  1LFB A;  1Z6T A;  5EGO A;  3MAJ A;  3RSN A;  3DU6 A;  2FMY A;  4XQF A;  4RB3 C;  4HRI A;  2WB1 N;  2P8T A;  3R60 A;  4XID A;  4HZF A;  4DBR A;  4HEA 2;  3LL7 A;  1HST A;  1F36 A;  3JRB A;  1M1E B;  1SD6 A;  4IOA F;  2M0M A;  2QM3 A;  4HNT A;  1OCZ H;  2CQ7 A;  2XKP A;  2HVS A;  1OR7 A;  2V9P A;  1VQM I;  3K70 D;  2LKX A;  2ME6 A;  1Z67 A;  1EH7 A;  1XCV A;  3OIP A;  2VOO A;  3HGY A;  2NOJ B;  2OTL I;  1WCM J;  3ZP5 A;  3CUQ C;  4Y7N J;  2Y0S A;  3V7S A;  1D1C A;  1K61 A;  4GFB A;  3FBN B;  2R7W A;  1D3Y A;  5LRR A;  2DTZ A;  1JJ8 C;  2WA0 A;  2VE9 A;  3OYN A;  4ZH4 F;  3PIO F;  3N97 A;  3S2H J;  2MH2 A;  2HXI A;  4IX7 A;  2EPF A;  1KU3 A;  2EJR A;  1PJR A;  1TBX A;  1YIO A;  2MA3 A;  1VQO I;  4HNV A;  4OOI A;  3CLO A;  1N75 A;  1G3S A;  3CO6 C;  1ZGJ A;  2LF8 A;  5D5W B;  1PP8 F;  2Z99 A;  4EV0 A;  5DUI A;  4CZC A;  3FXU A;  2H27 A;  2KQR A;  3G1M A;  2OCE A;  3K1M A;  3OYD A;  4L5J A;  5B66 C;  2IS2 A;  4LD5 A;  4U87 A;  1AKH B;  3C1D A;  4JQF A;  1R49 A;  4ZDO A;  3R0J A;  5IYD J;  4OAZ A;  3I55 I;  4NQW B;  4A69 C;  1Y8Q B;  3T1B A;  5CQE A;  4A3G J;  3DKX A;  1LQ1 A;  3OYI A;  2J5P A;  1AA7 A;  3ESW B;  3K2Z A;  1Y8R B;  1FZP B;  3DU5 A;  4B4C A;  3L2Q A;  4BEH B;  1N25 A;  2HEO A;  1Y39 A;  1J2X A;  2VN2 A;  2MLG A;  2R7O A;  2Y30 A;  3I5U A;  2XRN A;  3CMM A;  1FJL A;  5D6F A;  2DMN A;  1ZH5 A;  1ZK8 A;  4CZZ A;  2V79 A;  1X1D A;  5JLX A;  2RQQ A;  3DPT A;  3MN2 A;  1TLH B;  2DMU A;  4EJT A;  1X4O A;  4YFX F;  2MFZ A;  3GZN B;  2JPB A;  4FE4 A;  2LC2 A;  4C2M J;  1HW1 A;  2HPI A;  4KT6 A;  1YS6 A;  1ZHF A;  2F6C A;  1U6G A;  5D4S A;  5K5R A;  2CMP A;  3CUO A;  3O6B B;  4NC8 A;  2ZSI B;  3G71 I;  5HS7 A;  4CIC A;  2A3S A;  5JR3 A;  5DV5 A;  1Y1V J;  2X6O A;  3CME I;  5FGM A;  5KAI C;  1VQL I;  1T0F A;  4U0V A;  1NHA A;  2LTP A;  1RUO A;  2O8K A;  1ULY A;  4XON A;  4ENJ A;  1OMI A;  3DF8 A;  2M0C A;  2DLL A;  3HUG B;  4OU0 A;  3DCF A;  4HLX A;  1GLN A;  5DCM A;  3KYL A;  5E8I A;  1MSF C;  1SEU A;  1ERD A;  4RBO A;  3FF5 A;  2RN7 A;  3JRH A;  2K7L A;  2DA6 A;  1ORK A;  4A3E J;  2NAZ A;  2EA4 A;  3IRQ A;  2G7H A;  3HG9 A;  3KYC B;  2Y48 A;  4BH9 A;  1R1T A;  4M74 A;  3G1L A;  2OD5 A;  5L3F A;  2UXN A;  3DTE A;  4OIR F;  5H6Q A;  2E1N A;  1YX5 A;  1YQA A;  2DOE A;  3CCR I;  5LBQ A;  3GTJ J;  1Y56 A;  3HBL A;  3HIF A;  2D45 A;  2HYG D;  3JRA A;  1IUF A;  1RES A;  2ZJP F;  5L3E A;  1K6O A;  3TMO A;  4ENN A;  2HQR A;  1ZTR A;  1MGT A;  5D8K B;  4RDU A;  3BRO A;  1YIT I;  1O3S A;  3H3U A;  1O7L A;  3OSF A;  5CVI A;  5D6E A;  2QSH X;  4M9Z A;  1FOX A;  1AWC A;  4ASN A;  3PUF A;  4A5M A;  2MBF A;  3QPL A;  2OC6 A;  3EYY A;  5JVT A;  1R00 A;  1QZE A;  1QGP A;  5FD5 A;  1XPX A;  1U2W A;  1WSU A;  3PO2 J;  4IRH A;  3W6J B;  3OYA A;  5EZH A;  4D5C A;  1QQI A;  2PFB A;  3BDD A;  1K78 B;  3KP4 A;  3DLA A;  1FYK A;  2EFW A;  3T8R A;  3FIS A;  1ETW A;  3KP6 A;  3CC2 I;  1T8I A;  1MBG A;  3K4C A;  3FMR A;  2ICW G;  4F3Q A;  3WU1 B;  2CO5 A;  2HOA A;  2QBY A;  3FBI B;  2QZ8 A;  1IF1 A;  4V19 K;  3RIR A;  2YX7 A;  2RV8 A;  3SFI A;  1V54 H;  3BR3 A;  2VKD A;  2W48 A;  1ZR4 A;  4CH7 A;  2LKP A;  1XB4 A;  1KU7 A;  4AC0 A;  2XKO A;  9ANT A;  5FRO A;  1VND A;  3K4L A;  5D5X B;  1BIB A;  2G7U A;  4Y33 A;  1BR4 A;  4E7Z A;  3OYK A;  4LG0 B;  3GLL A;  1KZH A;  2NS0 A;  3IH2 A;  4IZZ A;  3GTO J;  4UB8 C;  2LRE A;  2QGU A;  5BMZ A;  3HHG A;  3FXM A;  2H1L A;  2OAZ A;  2MD5 A;  1LE8 A;  3E5X A;  1FNN A;  4S04 A;  2ZJR F;  1FIP A;  1TQM A;  3E97 A;  2NVX J;  4YIF A;  4BXU A;  1Z0X A;  3JCU C;  4I7H A;  1B9M A;  3OR2 C;  3A2K A;  1E3P A;  2MG4 A;  2VKV A;  2W85 A;  4Q48 A;  2HDD A;  3GWZ A;  2DPU A;  3CCE I;  2K4B A;  4RGX A;  5ICE A;  3PNV A;  2R5Y A;  2FOK A;  1UAA A;  4XLP F;  1R6R A;  3H36 A;  2W00 A;  3BJ6 A;  4CYD A;  3Q0U A;  3A01 B;  2K9S A;  2FD5 A;  2A6H F;  5CVR A;  1A04 A;  2X1D A;  3O8G A;  2A05 A;  2XPU A;  3D5S C;  3O3K A;  1REP C;  3I58 A;  3CP8 A;  4DOZ A;  4IHY A;  1A6I A;  2HQN A;  1T6S A;  4HV6 A;  5FKM A;  4XRF A;  3IH4 A;  5TIS C;  3WHC A;  1W7P D;  5KCM A;  4UV9 A;  2L02 A;  1TWG J;  2P7C B;  2XF5 A;  3HSR A;  1F1Z A;  3BPV A;  3BG7 A;  2B0L A;  2O6G E;  2DW4 A;  2NNN A;  4RAG A;  1RZ4 A;  3SDG A;  2K3F A;  1OLT A;  1QHH D;  4G7O F;  1JUM A;  5HDK A;  1W5C C;  2CQQ A;  4HF2 A;  4ESB A;  4C9Y A;  1GUU A;  3NRV A;  4BXF A;  2A5W A;  1YI2 I;  3WTT C;  3ZMZ A;  3H0G J;  2E71 A;  4B48 A;  2R7T A;  4B8X A;  5CQG A;  3O2P E;  1GXQ A;  2P4W A;  5K1Y A;  4DNC A;  4A3F J;  1G3Y A;  2GIZ A;  2HKX A;  4P9F A;  1K4T A;  2WAQ A;  1KA8 A;  1YE9 A;  2VQC A;  3KPH A;  1U5T A;  3ABK H;  4BL0 B;  1FEX A;  1HSJ A;  1NG6 A;  2QA4 I;  2E7X A;  2EV6 A;  1Z7L A;  4LGW A;  4WF2 A;  1WH5 A;  2HU9 A;  3S15 J;  3JRD A;  2UV1 A;  1ZEL A;  2ESH A;  2CQN A;  1HW5 A;  4ZTJ A;  2F5F A;  2DOD A;  2LBF B;  1TNT A;  2W1O A;  4PCQ A;  4WCG A;  1IN4 A;  4AUX A;  2E35 A;  2EZI A;  5DYM A;  1MSE C;  5FRM A;  1IRX A;  2X6Y A;  3RPU D;  1EF4 A;  4XKB A;  3I54 A;  2QLZ A;  1J7K A;  4GCV A;  3OS1 A;  1J5Y A;  4XLN F;  2KIS A;  3WG9 A;  2ACJ A;  1I1S A;  1JUP A;  4ZZL A;  2BV6 A;  3GTK J;  3BTI A;  2FEZ A;  3CJN A;  1FBS A;  2G9W A;  4L5E A;  4BUP A;  2ECB A;  2XIG A;  1FLI A;  5LLQ A;  2HKO A;  1LDD A;  2JSC A;  3ABM H;  5GTI C;  4YIR X;  5CPR B;  2XPV A;  1XSX A;  2JT1 A;  4OMZ A;  2A5Y B;  1S29 A;  5D8L B;  2WB1 A;  4I01 A;  3VOE A;  5B5E C;  3D5L A;  1LJ9 A;  2FNA A;  2CW8 A;  2OA4 A;  2VAS A;  2E2J J;  4D7M A;  3S1R J;  2DI3 A;  2Q0O A;  2XAJ A;  4IJA A;  4LIV A;  5ILS A;  2EIL H;  4IQ4 A;  2PBI A;  2GOM A;  3I3L A;  4ENM A;  1TWH J;  3HYI A;  3IWF A;  1SC7 A;  5GAD J;  3REO A;  2XAH A;  3OIO A;  3RYR A;  1LE8 B;  3OYM A;  3MKW B;  1FWZ A;  3B02 A;  4DIQ A;  3T0Y A;  3SYT A;  3QYB A;  1T08 B;  2IPQ X;  4N0B A;  3RCO A;  3RPQ A;  3KEO A;  3ZMT A;  4KIB A;  4O5V A;  1JTY A;  4EM2 A;  3LAP A;  4J19 A;  1WJC A;  1T39 A;  4RGU A;  2H8R A;  1S72 I;  3J7A Y;  1J9I A;  5LEJ A;  3H3Z A;  4LG0 A;  5E1W A;  5M5X J;  4B3A A;  2UZK A;  2M45 A;  1SMY F;  3Q0V A;  4XRS G;  4FTH A;  2LK2 A;  3GO5 A;  1WJD A;  4UUS B;  3JSP A;  2H94 A;  2XUB A;  4HX7 A;  1QHG A;  2VC0 A;  1ZRF A;  1T33 A;  1K79 A;  4XR6 A;  4A3K J;  2BW3 B;  4E7S A;  3PFI A;  2NNY A;  3UNG C;  5CKT A;  3M7G A;  5C4X J;  3GME A;  3PNY A;  2L01 A;  1NK2 P;  2KRH A;  2QF7 A;  1R22 A;  1ZLK A;  1JT0 A;  2VKH A;  1K6Y A;  2M3A A;  3RQI A;  3HPG A;  3J7Z I;  3LQQ A;  3CDL A;  5EYR A;  5EG0 A;  2AXT C;  1PVE A;  4V2G A;  1K78 A;  3QYE A;  4C2T A;  1A6Q A;  3F8M A;  4L0Z B;  3GXO A;  2AXL A;  1U5T B;  1VQ4 I;  3R6S A;  1BOA A;  2MLK A;  5IYB J;  4A2U A;  4F91 B;  5IY5 H;  3ZMV A;  3KE2 A;  1KON A;  4Y3O A;  3V8L A;  3WTW C;  1HLV A;  3H3V K;  5DTD A;  3E6D A;  3IL2 A;  1VQ9 I;  2V9K A;  3BQZ A;  3M07 A;  3NAU A;  2KLO A;  2PEX A;  2IXS A;  2ZME A;  3B73 A;  1UB9 A;  4MEY F;  1P92 A;  3KZY A;  1KU2 A;  1EH6 A;  3OYF A;  5ILV A;  2MC4 A;  2Z9O A;  1JHF A;  5LHH A;  2FE3 A;  1MBJ A;  4B1R A;  2ZBK A;  4BNC A;  2K4J A;  3MWM A;  1LUJ B;  2JWT A;  4CCJ A;  5GP9 A;  4CYC B;  3CCL I;  3HOY J;  1SD7 A;  1H9G A;  3SEQ A;  5DDG A;  1OFC X;  2PQ8 A;  2V1D A;  4JX5 A;  1FBQ A;  4XRM A;  2FQ3 A;  2JVH A;  2LSO A;  4RAZ A;  2PLY A;  3EPZ A;  1CF7 B;  1MBH A;  3BR6 A;  4F7Z A;  3HTU A;  4UVC A;  5B3S H;  4BGD A;  4IL6 C;  4I09 A;  5JHF A;  4A93 J;  1VFC A;  4ZTF A;  1NTC A;  4KIG A;  4AIH A;  3IUO A;  1R1V A;  2PMZ N;  4P1W A;  3WE2 A;  3L09 A;  2GOX B;  3BJO A;  4ESF A;  4M3E A;  1IXS B;  2HI3 A;  5H6R A;  3TGN A;  2H09 A;  3LFU A;  4CXF A;  2JA8 J;  3DP7 A;  4PJ0 C;  5DCM B;  2STW A;  1OYW A;  2V9V A;  3DEW A;  5ERI A;  4I98 B;  2AQF A;  3VSK A;  4BBS J;  2IAI A;  3GFM A;  1IGN A;  1TWC J;  1XTA A;  2CV1 A;  4GYI A;  4ANJ A;  1ZGA A;  3BR1 A;  1R4M B;  2XRL A;  1BI0 A;  5F0C A;  3BG5 A;  4HF1 A;  2DK5 A;  2FBH A;  3HOS A;  2CQX A;  3CO7 C;  3ZGK A;  4CO8 A;  2IGO A;  1BBY A;  2NVT J;  1XSV A;  2QSF X;  5BS6 A;  2VPL A;  1P6R A;  5F04 A;  4BQA A;  2L5Q A;  1X1B A;  4L5I A;  1MH4 A;  2WV1 A;  2Y9Z A;  3OWT A;  1SFE A;  3FMQ A;  2F5V A;  2HS5 A;  1MJA A;  2DPD A;  2JA7 J;  4ZYE A;  2P5V A;  4KNY A;  4L18 B;  1SD5 A;  3ERM A;  3CDH A;  3MMY B;  1ON2 A;  4BEH A;  2LNB A;  2CUJ A;  1G3W A;  1T95 A;  2FX0 A;  2OU2 A;  3LWF A;  3LSI A;  4IVN A;  5DD4 A;  1S6L A;  1RET A;  3IWZ A;  1B9N A;  4G9Y A;  1BI3 A;  2M87 A;  3ZOB A;  3UR3 C;  4I0B A;  1XG1 A;  2KIF A;  4U88 A;  4E7K A;  1MMS A;  3DKY A;  4HSR A;  3M1C A;  2IA1 A;  4CCM A;  2IS6 A;  1KYZ A;  1G6N A;  1MZB A;  1WRJ A;  1BR1 A;  3F21 A;  3JRF A;  2CUE A;  3ZR8 X;  2ZO4 A;  2JSP A;  4C2U A;  5KAF C;  3C2G A;  1YS7 A;  1GHC A;  3BT9 A;  2ID3 A;  4XKV A;  2ZJ2 A;  1E0E A;  1VF9 A;  1H8A C;  1W1W E;  3FIW A;  4M3B A;  1PP7 U;  2DK8 A;  3QU6 A;  2EFN A;  4UVA A;  1YIJ I;  3S2D J;  4A3C J;  3H5R A;  2BYV E;  4IRG A;  2D5V A;  4PFO A;  2JRT A;  1YJN I;  3QP6 A;  3RJP A;  5K7Z A;  2ZCW A;  4GDF A;  3K7A J;  2EIJ H;  4XSX F;  2NVQ J;  1B4A A;  2I8D A;  2ZC2 A;  2DFE A;  4PGH A;  1U5T C;  3ZQG A;  5BPD A;  2R93 J;  1QU3 A;  1E3H A;  4CUG A;  1W0T A;  5D4R A;  4KIF A;  3JRC A;  1I1G A;  1V5G A;  4LLN A;  1VQK I;  3I53 A;  4LIT A;  4DW6 A;  1DP3 A;  2DJN A;  2OF7 A;  2ZXW H;  3HKZ A;  3PQK A;  3TOB A;  3JRG A;  5F6F A;  1WPK A;  2GM4 A;  3CES A;  4BYY A;  1TWA J;  2K9N A;  2RVC A;  3NQO A;  4DQ2 A;  1RC9 A;  4LK0 F;  4A6E A;  1HA8 A;  4XNF A;  3F8N A;  2YR2 A;  5JVG F;  1IZ1 A;  4C3I J;  2NS8 A;  4Q47 A;  1ZYR F;  2DQR A;  3I59 B;  1LKX A;  1WH7 A;  4LJZ F;  2NXN B;  2DMP A;  1YRN A;  1TZL A;  2OZ6 A;  2M8G X;  2XAU A;  1MKM A;  1D0Z A;  3KX2 A;  2VBX A;  4CSW A;  2ID6 A;  3TO7 A;  3J80 Z;  3G4S I;  3A0H C;  1QO0 D;  4LLG F;  1OYI A;  4HA8 A;  4ZJZ A;  3ZN1 A;  2JK3 A;  4AVP A;  3HOX J;  4XN0 A;  4WX9 A;  4MHG A;  3EDP A;  1CQT A;  1XGN A;  2KDZ A;  3RKX A;  3V7C A;  4R8H A;  2H8W A;  4FQG A;  3J81 K;  1HF0 A;  3I4P A;  1J0R A;  1YOV B;  1OQY A;  3K4M A;  3D1N I;  4OIO F;  1W4M A;  1YO5 C;  3BY6 A;  4E4H A;  5EEG A;  2OTJ I;  1DPU A;  5BQT A;  4HX4 A;  1H88 C;  2X48 A;  2ZSH B;  3N4M A;  2A69 F;  4KN4 X;  4LOC A;  1GV2 A;  4NHJ A;  4A3M J;  4XOP A;  4DYC A;  1WJA A;  1P9Q C;  4N9H A;  1TTY A;  1MNM C;  2MAB A;  3CJQ B;  3ZQC A;  1W5T A;  1X3W B;  1B72 A;  1U78 A;  4HV5 A;  3ABT A;  4RLQ A;  2BEO A;  2ISY A;  3NAR A;  4JOM A;  4XM3 A;  1VTN C;  1X1A A;  3TL4 X;  1FMV A;  4MLO A;  2FQ4 A;  2DA7 A;  2IA0 A;  2VOD A;  2MC3 A;  2ZFU A;  4WK8 F;  1IJW C;  1RRJ A;  1V55 H;  2EA2 A;  3P5J A;  1O57 A;  4D5F A;  2IP2 A;  1R36 A;  3I59 A;  2KKO A;  2JN6 A;  3OS0 A;  3ABL H;  2XSD C;  5J8F A;  3HPH A;  1BM9 A;  1E17 A;  4KUM A;  5E1X A;  4AYB N;  4ZYH A;  1ZLJ A;  2ETH A;  4M9X A;  3WOD F;  1Z77 A;  4E7H A;  3TO9 A;  3X2Q H;  3HRS A;  4PJL A;  4II3 A;  4CDG A;  2F5E A;  3HGG A;  3HL2 A;  2FML A;  1AU7 A;  4IHX A;  2R5Z A;  2QYO A;  4LB6 B;  3L7W A;  4IXA A;  2M30 A;  3WU0 A;  2HXO A;  3K4N A;  4OIQ F;  1IRG A;  3KP2 A;  1B59 A;  3LSR A;  2Q8K A;  2CQK A;  5E1Z B;  1D0X A;  1I3Q J;  3PUB A;  3QQA A;  1R5G A;  2LDU A;  1Z21 A;  4HQE A;  2EFP A;  2ESN A;  1LVK A;  2BVM A;  2O3F A;  2KJC A;  2ZJQ F;  2DT6 A;  3E0J B;  2D2W A;  1TP4 A;  1BR2 A;  3S8P A;  3SZT A;  1ZN2 A;  3CC4 I;  4IOC F;  4ABZ A;  5IP6 A;  2YU3 A;  3ZQF A;  5BNG A;  4LIU A;  4XLA A;  1STZ A;  1OYY A;  2KIU A;  3VOD A;  4I6Z A;  4XKC A;  2JA5 J;  3LST A;  1BN5 A;  2ZME C;  1X3U A;  2AHQ A;  3LA7 A;  1YX3 A;  2HNH A;  2BY1 A;  1WJB A;  3KEY A;  3WTZ A;  1F9N A;  3ZQQ A;  5KNL A;  1OCP A;  5GAH J;  1NK3 P;  2VJI A;  3V8K A;  2LG4 A;  3FK7 A;  3OOU A;  2Z5U A;  3RKW A;  1BJZ A;  4TV7 A;  2F4I A;  5IOY A;  3MKZ A;  3BG6 A;  2MW8 A;  4W97 A;  4DYR A;  2JPC A;  3GFI A;  4RAY A;  3GUD A;  3HJE A;  1FOW A;  4OWR B;  1ITY A;  1V4R A;  3U9G A;  3OYH A;  5EF6 A;  4YG2 F;  2Y0S N;  1F4K A;  3GTP J;  2DYS H;  2R7Z J;  2OZU A;  3HKZ N;  2QKL B;  2KFD A;  3ZMU A;  4F92 B;  2PMH A;  5F64 A;  1FYM A;  2DYR H;  3BG9 A;  1IN6 A;  5E3O A;  3RKY A;  2RDP A;  3DPU A;  2FF4 A;  3HSE A;  4EMS A;  3HEF A;  3CD6 I;  3TKY A;  1I3A A;  2HOS A;  1MMN A;  4OAY A;  4RB2 C;  3E6C C;  4HW0 A;  4E7I A;  3A01 A;  4C3H J;  2V26 A;  4O6J A;  1RKW A;  1OCT C;  2YX4 A;  1LFP A;  1I6X A;  2EIM H;  2LY9 A;  4KJZ A;  3VYT B;  3FXR A;  4C30 A;  4IPA A;  2HQ5 A;  3MCZ A;  4KT5 C;  1BW5 A;  2DT7 B;  4U7D A;  2XB5 A;  3LOC A;  1UZC A;  2OBP A;  3F8F A;  2M8E A;  3KP3 A;  5HS9 A;  3TOA A;  1ON1 A;  2MH9 A;  2HVR A;  1XDU A;  2NVY J;  2WY7 Q;  3L2V A;  1T0F C;  4S05 A;  2O03 A;  3QOP A;  4NQW A;  4CCL A;  2L3D A;  3FM5 A;  3Q3S A;  4PSX A;  1XC5 A;  3RQ4 A;  3K6G A;  4BE0 A;  5K7H A;  3HM5 A;  3QWL A;  4FE7 A;  1X4P A;  4KDP A;  4HQM A;  3PSF A;  4AID A;  2WBM A;  3FHN A;  4E7L A;  5FRN A;  1WJE A;  4RMN A;  1YW7 A;  4N4N B;  2CV0 A;  4NBQ A;  1P7J A;  2YUS A;  1HKQ A;  3AFH A;  5E8G A;  2DFH A;  3MQ0 A;  4LB5 A;  2JA6 J;  1BC7 C;  1DPR A;  3HOT A;  2K85 A;  1ETO A;  3CCM I;  2ZKZ A;  4XRS A;  4DZJ A;  1FX7 A;  2VBY A;  3BTJ A;  2XGX A;  4W1U A;  3HOW J;  5M3F J;  4X6A J;  5KVR A;  3K2A A;  4CA0 A;  2WC2 A;  2VPR A;  3I0T A;  4QTR A;  1N78 A;  3BCA A;  5HOO A;  2VXZ A;  1ZG1 A;  4IHV A;  3I4N J;  4Q5S F;  3VFZ A;  4IF4 A;  2DDA A;  4MTE A;  3OV8 A;  5HLT A;  2HDC A;  3AL0 C;  4XLF A;  1U3E M;  2K3P A;  3BG3 A;  3EET A;  4D1Q A;  2QKM B;  1QVT A;  4RS8 A;  3I4M J;  4JBA A;  4BJ5 C;  4P55 A;  4XLC A;  2N8G A;  4M71 A;  1XGS A;  4YEJ A;  2JMW A;  4CGZ A;  2L9S A;  2M9H A;  4A0Z A;  3P9K A;  2XRO A;  3JSO A;  3L9F A;  1XN7 A;  2LR8 A;  2XAF A;  3VDX A;  2WTE A;  2EQR A;  2DFI A;  3QPH A;  1RPW A;  1EV7 A;  4AIJ A;  3MFK A;  5E18 F;  4XN3 A;  4IRI A;  1IG7 A;  2BVL A;  1HKT A;  3CDI A;  5EJC A;  2IRF G;  2HTJ A;  2X0L A;  1T38 A;  1HOM A;  2EK5 A;  1JT6 A;  1DGW Y;  4P96 A;  3QOE A;  1WFX A;  3A0B C;  3GCM A;  5A2Q K;  5FLX Z;  1IRZ A;  1GVD A;  2HQA A;  2R0Q C;  3ZXS A;  2R3S A;  5J3L A;  1VI0 A;  1Q1H A;  1G3T A;  2Z1D A;  2B7E A;  1POG A;  1OCR H;  3E5U A;  2PJP A;  3TW6 A;  2D1V A;  1Z3Y A;  2ZXH A;  2LFB A;  2A61 A;  3BCB A;  4EJU A;  2HVQ A;  3WTU C;  1UG0 A;  1XDS A;  1HQC A;  1IXC A;  3S2W A;  1G8X A;  1QZY A;  3W6V A;  2FBI A;  2F5D A;  2V1N A;  3QAH A;  5CVU A;  1Q1V A;  1X2M A;  4RGR A;  3RDI A;  3H9Q A;  4D9J A;  1GDT A;  3BJA A;  3Q0W A;  5FKN A;  3TED A;  2K9M A;  4UY8 I;  2GXB A;  5JLW A;  1MDM A;  3R0A A;  1S7E A;  3VSL A;  2LH9 A;  3HOU J;  3HRT A;  3MEX A;  5J1Y A;  1WQ2 A;  4RLF A;  2F4M B;  2BXZ A;  4Y4R A;  2JTV A;  3D5R C;  3GW2 A;  1MBK A;  1IN5 A;  1JGG A;  4IHT A;  2LVS A;  2Y31 A;  4L9J A;  5E3M A;  1KQ8 A;  1MND A;  3BZC A;  3DWL E;  5D5U B;  3QYF A;  2TCT A;  2VBZ A;  4MQV A;  3GTQ J;  3KEQ A;  4E70 A;  4A6D A;  4UHT A;  4HNU A;  5LRS A;  3RPU A;  3AG3 H;  3GVA A;  3E5Q A;  1RNL A;  2BW3 A;  3DBR B;  5DS9 A;  4U0Y A;  1QZZ A;  3F23 A;  4RM2 A;  2L4M A;  5GAG J;  4MO7 A;  2DO7 A;  3C2B A;  3DQV C;  1K83 J;  3VB2 A;  3FK6 A;  4K2E A;  5E17 F;  2XPW A;  3NWS A;  1DQU A;  1MBF A;  1DP7 P;  3SJM A;  2FRH A;  1J75 A;  4UXN A;  1S5L C;  2X1E A;  1NH3 A;  4AM3 A;  2WV0 A;  5L3C A;  3COA C;  1D5Y A;  4MQ9 F;  1ZRE A;  4KFC A;  1E2X A;  2E2I J;  5HLI A;  4ZYG A;  1IXR C;  2JZY A;  2FOW A;  4EGY A;  2WWY A;  4BKX A;  2R7F A;  2W24 A;  4MEX F;  3VEP A;  1ZRC A;  3HDD A;  2PG4 A;  4G8X A;  4WXD A;  3RKQ A;  4WWC A;  1XGM A;  5FKK A;  1V3F A;  2EZK A;  3K70 C;  3T5X A;  3CCU I;  2V6E A;  3T8T A;  4WXH A;  5TJJ A;  2VB6 A;  2IS1 A;  3ECO A;  2XVC A;  1LPQ A;  4FET A;  1UFM A;  3U1D A;  1K7A A;  1G2H A;  1I5Z A;  2E34 A;  4UB6 C;  3HTS B;  3PO3 J;  2M1B A;  4BJT A;  2M7B A;  4N9I A;  4P5O A;  2DA5 A;  3E1S A;  1W0U A;  1PUF A;  2HPM A;  4DGW B;  3BLY A;  2OV7 A;  1W36 C;  3K0L A;  1RI7 A;  4I76 A;  1GXP A;  1HXD A;  3IC7 A;  3HRU A;  4KYW A;  4EGZ A;  1D8K A;  3QOD A;  3ONQ A;  2M7A A;  1S7A A;  1L0O C;  5FFX A;  2XGD A;  3S1Q J;  1ZG5 A;  4PZJ A;  2CV2 A;  1IRF A;  1XX5 A;  1A31 A;  2IW5 A;  3WGG A;  5HLH A;  2HGC A;  4LK1 F;  2RRE A;  2GXA A;  5HLG A;  5ED4 A;  2P6S A;  3FMS A;  2KIM A;  2PMZ A;  2ELK A;  2AS5 F;  2WAQ N;  3M3Y J;  4HBL A;  2GIV A;  2ZXI A;  3KLN A;  1DDN A;  4CCO A;  1D1A A;  2HWV A;  4R1H A;  4BE1 A;  3P7N A;  4KN7 X;  5J1R A;  5E3N A;  3F0C A;  2A6T A;  3BR5 A;  5KK1 A;  2GLO A;  2IGM A;  4FCY A;  4A3D J;  3F6V A;  2IGN A;  3L00 A;  3HHH A;  3S32 A;  2PX9 A;  5F1J A;  2EH3 A;  3OYJ A;  3CF5 F;  2XC7 A;  4EM1 A;  4Q4Z F;  1U8B A;  2NRA C;  3LAJ A;  2ZFW A;  3W2W A;  3IV5 A;  3ERE D;  2P5K A;  3S17 J;  2XF7 A;  2O9L A;  1UJ8 A;  2R92 J;  1HKS A;  3L2R A;  5CYV A;  1S9H A;  1P7I A;  2IJL A;  5J40 A;  5FJ8 J;  2JUC A;  3QU3 A;  4FHT A;  1ZAR A;  2MGQ A;  3GLX A;  3BR0 A;  1BW6 A;  4LMY A;  3MKY B;  1TL8 A;  4NDL A;  4BXX J;  5KHD A;  5HNH A;  4UUV A;  2W7N A;  1HDD C;  1FSE A;  1EH8 A;  3K1P A;  1ZR2 A;  3OYG A;  1MNE A;  2E1O A;  1MMD A;  1TQI A;  1Z7U A;  3H0D A;  2QUF A;  2TDX A;  5B1A H;  3HZJ A;  3M8F A;  4FX4 A;  1Z05 A;  3GFJ A;  3EUH C;  1XGO A;  4I0A A;  2RGV A;  1USS A;  2E1M C;  1ZAO A;  2M34 A;  2COB A;  1D1B A;  4LG3 A;  4XSZ F;  3TQN A;  4B43 A;  3PL8 A;  2ZB9 A;  2DTR A;  3I9V 2;  4I02 A;  3OSG A;  1JKO C;  2K9L A;  4EJV A;  1MMG A;  1BOB A;  2TRT A;  3C2H A;  3D0S A;  1RIO H;  2F5C A;  3H1C A;  2DN0 A;  2CSO A;  2GA1 A;  4F55 A;  1I50 J;  2V4J C;  4Y15 A;  1LB2 A;  1F5T A;  3IAS 2;  5LGN A;  5TRD A;  1X3Z B;  2IS4 A;  2ZNY A;  3CCJ I;  4ZDL A;  2YS9 A;  1JE8 A;  5EDN A;  3DTI A;  4OMY A;  2H6B A;  2GWR A;  3S16 J;  3JRI A;  2LOO A;  3A02 A;  4MIM A;  2F48 A;  3NEU A;  3M8J A;  1SFO J;  1YW8 A;  1PYV A;  4II2 A;  2EIN H;  3N05 A;  3J7Y J;  1Y1W J;  4MGR A;  3CC7 I;  3FKJ A;  3ROU A;  2VQH A;  6PAX A;  1R71 A;  4UUS A;  1LEB A;  5DD8 A;  1SAX A;  1MW7 A;  2JVG A;  3HUG A;  4GGG A;  1QPM A;  1S8N A;  3E6M A;  4L0Y B;  4M3D A;  2CH0 A;  4BS9 A;  2ELH A;  1FY7 A;  2M5W A;  3OL3 A;  5C3E J;  3FXK A;  2LD5 A;  4L9N A;  4KMU X;  3AKZ A;  5TGT A;  3GX4 X;  2P81 A;  1I27 A;  1MJ9 A;  4YII A;  4ZZD A;  4M6Y A;  3M1E A;  2R7Q A;  1MD0 A;  2K27 A;  5F27 A;  3RZO J;  2FJ1 A;  2Q1Z B;  2PJR A;  4G6Q A;  1IV8 A;  1Y0N A;  4JX4 A;  4Z6Y A;  2VKE A;  3HSF A;  2Y75 A;  1LEA A;  5F08 A;  2LBF A;  1A5J A;  3CMA I;  3ZMS A;  5CLS A;  4BDZ A;  4M3G A;  1ETQ A;  3IHU A;  5L3D A;  4PJN A;  1XMA A;  3GF2 A;  2DFF A;  2VOP A;  2K9Q A;  3HC7 A;  2ISZ A;  4DJA A;  3AL0 B;  1HC8 A;  1P4A A;  2OQR A;  5C44 J;  4BBR J;  1JHH A;  1OJL A;  4L9T A;  3CJR B;  2BOL A;  3W6K B;  2I10 A;  1CF7 A;  1IN7 A;  1B8I B;  3R4K A;  4HOB A;  1XSD A;  4KIC A;  2OJE D;  2MD0 A;  3L1P A;  2DMQ A;  4B09 A;  4EVI A;  1R5I D;  3BTC A;  2FUG 2;  1RR7 A;  1O7F A;  2CGP A;  1O3Q A;  5FLX K;  3TP3 A;  5DEQ A;  2QQB A;  3IAM 2;  3L2W A;  1R9T J;  4RM3 A;  3IP4 B;  3ISP A;  2CU7 A;  4I99 C;  3PJR A;  2P7V B;  1X1P A;  1H89 C;  4KA4 A;  1EJ9 A;  3F22 A;  2H6C A;  4I2O A;  1MJB A;  4IO9 F;  2Q2E B;  4UVB A;  5EEH A;  2XGC A;  2EB7 A;  1LDJ A;  2GA2 A;  3LNQ A;  3GBG A;  1B8I A;  2KZV A;  3G6E I;  2ZNZ A;  3AAF A;  2FBK A;  1LVA A;  3DPL C;  1GT0 C;  1W7P A;  2IT0 A;  1W7P B;  3PSI A;  3LFK A;  5ICG A;  1G59 A;  3OR1 C;  1TWF J;  4QIW N;  2XB0 X;  2EWN A;  3LSM A;  1PUF B;  4G6D A;  2K86 A;  1D0Y A;  3C7J A;  1ONV A;  2OCC H;  4UV8 A;  1ACI A;  3EQL F;  4CYC A;  4XOT A;  3KIO A;  5IPA A;  3MZ8 A;  2A07 F;  2E2H J;  2VUM J;  3S14 J;  3K10 A;  1XCB A;  3IRR A;  3SEZ A;  1MH3 A;  5IP7 J;  2P6T A;  2XF6 A;  2CUF A;  1T98 A;  3G2B A;  4E7J A;  2CUZ A;  1T56 A;  4EJW A;  1KGS A;  5GAE J;  2KL4 A;  1ETV A;  3CTA A;  4GXO A;  1HBX G;  4X1E A;  1W5S A;  3GZ5 A;  4HF0 A;  1UST A;  1FP1 D;  2DOF A;  1GV5 A;  2V1U A;  5EGO B;  2R7X A;  2LP0 A;  4U7B A;  5LGU A;  1EA3 A;  4QLC U;  4AIK A;  1J59 A;  3R61 A;  2HOT A;  1L3L A;  3ELK A;  4XBF A;  2E5Z A;  5BOX A;  3TP0 A;  1F43 A;  3SZP A;  3EUA A;  4M9S A;  3BZ6 A;  5F0H A;  5J4V A;  3F3X A;  4S0H B;  1SFU A;  2OQG A;  2CFO A;  4XK4 A;  4A3L J;  1LFU P;  2D1H A;  5HDG A;  2XAG A;  3L2C A;  3FZV A;  2HTS A;  3JAM K;  1R58 A;  5E20 A;  4N4O B;  2LY1 A;  2FU4 A;  5F1R A;  1SFX A;  2R7R A;  3V42 A;  2Z3Y A;  1C0W A;  4PGG A;  3KCC A;  1YHQ I;  4M3F A;  3QP5 A;  5EZG A;  3H5A A;  4B47 A;  2HYJ A;  3CCV I;  4XKW A;  2VC1 A;  4PUS A;  3OY9 A;  1FBU A;  3SHF A;  3B6A A;  4LFU A;  3E6B A;  2KZG A;  5ICF A;  2K40 A;  1IO2 A;  2DA1 A;  5HS8 A;  1WJ5 A;  1BI1 A;  1IW7 F;  1YJW I;  5J47 A;  2PI0 A;  2PN6 A;  1D5V A;  2RQP A;  3LA2 A;  4NB5 A;  3CP2 A;  1LNW A;  3CLQ A;  1I39 A;  3DTK A;  1MDM B;  3IH3 A;  5J6X A;  1WGX A;  2L2O A;  3F8B A;  4G6T B;  3WTS C;  3DFG A;  2ZME B;  2E5N A;  2LKS A;  2VLA A;  2CW0 F;  3AG4 H;  3J7A O;  3FXO A;  3EUK L;  1ZGW A;  3BOQ A;  3GTG J;  4Y52 J;  2IVM A;  1XD7 A;  3QPS A;  3U21 A;  3WGI A;  5LD2 C;  3DKW A;  1XMX A;  4AU7 A;  1JGS A;  1WWX A;  4PSW A;  1WKM A;  1YW9 A;  4FAS D;  1Y6I A;  3B6C A;  3M9A A;  1K4S A;  3K9T A;  2QBY B;  2CYY A;  3VYR B;  1KYW A;  1R23 A;  4BQQ A;  1T2K A;  3ZN0 A;  1H9T A;  3ZCO A;  1BA5 A;  5AIP A;  1R4N B;  2VXD A;  3G73 A;  2K5C A;  1QRY A;  2F4O B;  2M4G A;  4PJM A;  2ADU A;  4ETS A;  5JI6 A;  3H9G A;  4HX8 A;  2JJ7 A;  5HNF A;  1UHW A;  3U2R A;  3K69 A;  2VIX A;  1MBE A;  1BC8 C;  4HST A;  3VYU B;  3HXL A;  1XMK A;  2ECC A;  2YPR A;  2X4H A;  2DT5 A;  3GZ6 A;  1DU6 A;  2W82 A;  4M73 A;  2M4K A;  3VYS B;  3MVP A;  5DM6 F;  2G0E A;  1IV6 A;  5BPI A;  2VT2 A;  4UUT A;  3F8C A;  5JHU A;  5LHI A;  4BU2 A;  4HYE A;  3WHB A;  4NC6 A;  4RA2 A;  4AVZ A;  2CWE A;  1V5F A;  3P9C A;  4XLH A;  3KP5 A;  4ZC3 A;  1X2N A;  3IKV A;  3ZPL A;  4MTD A;  4CCK A;  2KIQ A;  3C18 A;  2LYC A;  4M72 A;  4BHC A;  3SZG A;  3W2A A;  3LQR A;  3HOV J;  2R7S A;  3BC8 A;  3CZ6 A;  1H0M A;  1DUX C;  2O7O A;  4QWQ A;  1IUY A;  1FOY A;  4OIP F;  3KFW X;  1ODD A;  3S3M A;  3P9I A;  1RUN A;  4G12 A;  1OCC H;  2RC4 A; 
#chains in the Genus database with same CATH homology
 2PMZ N;  4HNV A;  3ZQH A;  5FLM J;  4M3E A;  4MO7 A;  3BTL A;  3C2B A;  2HI3 A;  1K83 J;  3FK6 A;  5IP9 J;  2XPW A;  2JA8 J;  1ZKG A;  3CMY A;  1MBF A;  3DEW A;  3G1M A;  5EEA A;  3SJM A;  5FLV A;  3GTM J;  2ME0 A;  5E3L A;  4BBS J;  1D5Y A;  1I6H J;  2IAI A;  1AKH B;  1IGN A;  2E2I J;  1TWC J;  5IYD J;  3BR1 A;  4A69 C;  4BKX A;  1E3O C;  2XRL A;  5F0C A;  3HDD A;  4A3G J;  3BG5 A;  3RKQ A;  5FKK A;  2EZK A;  3S1N J;  2CQX A;  4EEF G;  4B4C A;  2NVT J;  1UG2 A;  1JUS A;  3O8H A;  5F04 A;  1MH4 A;  2WV1 A;  5M5W J;  2Y30 A;  2Y9Z A;  1G2H A;  3PO3 J;  2DA5 A;  1W0U A;  1FJL A;  1PUF A;  2JA7 J;  2DMN A;  1ZK8 A;  2AO9 A;  2R5Y B;  1QPI A;  3LSJ A;  4I76 A;  5JLX A;  3MN2 A;  3G1O A;  2DMU A;  2FX0 A;  5FKL A;  4C2M J;  2XGD A;  4FE4 A;  3S1Q J;  2EZL A;  1RET A;  3ZOB A;  1XG1 A;  1UHS A;  2GBY A;  1JTX A;  2ELK A;  2WAQ N;  3M3Y J;  3JRF A;  1Y1V J;  2X6O A;  2CUE A;  1IC8 A;  3VPR A;  3S1M J;  2LLK A;  2LTP A;  1O4X A;  5J1R A;  5E3N A;  2O8K A;  3F0C A;  3BR5 A;  2GLO A;  2M0C A;  4JYK A;  4FCY A;  3DCF A;  4A3D J;  1YRN B;  3BT9 A;  2ID3 A;  1MSF C;  1VF9 A;  1H8A C;  5F1J A;  4RBO A;  1APL C;  2EH3 A;  5M3M J;  3JRH A;  3FIW A;  2DA6 A;  1ORK A;  2VI6 A;  4A3E J;  4M3B A;  1U8B A;  3S2D J;  4A3C J;  2MSY A;  3IV5 A;  2D5V A;  3LSP A;  3S17 J;  2O9L A;  4A3I J;  2R92 J;  1TC3 C;  3G1L A;  5K7Z A;  2DA3 A;  1P7I A;  3K7A J;  1ZQ3 P;  1FIA A;  5FJ8 J;  2NVQ J;  4MFE A;  1IDZ A;  2MGQ A;  5EG0 B;  3GTJ J;  3BR0 A;  3PM1 A;  3ZQG A;  1BW6 A;  2R93 J;  3HBL A;  4BXX J;  4NDL A;  1W0T A;  3BR2 A;  3JRC A;  1HDP A;  3JRA A;  1IUF A;  1RES A;  4QSH A;  1HDD C;  1ZR2 A;  4DW6 A;  2DJN A;  2E1O A;  2OF7 A;  1ZTR A;  3JRG A;  1WPK A;  4RDU A;  2GM4 A;  1TWA J;  2K9N A;  1IDY A;  3OSF A;  4FIS A;  4C3I J;  2B63 J;  2M34 A;  2NS8 A;  2COB A;  3QPL A;  5IOZ A;  1WH7 A;  2DMP A;  2ZB9 A;  1YRN A;  3OSG A;  2OPT A;  1JKO C;  2M8G X;  3PO2 J;  2TRT A;  2ID6 A;  4C3J J;  3HOZ J;  5EZH A;  4D5C A;  4JP0 A;  2DN0 A;  2JK3 A;  3HOX J;  1I50 J;  3FIS A;  1WI3 A;  1ETW A;  4D7N A;  1BL0 A;  1CQT A;  2L9R A;  2KDZ A;  1MBG A;  2YS9 A;  2HOA A;  5EDN A;  1HF0 A;  3S16 J;  2L7M P;  3FKI J;  3JRI A;  4MIM A;  3A02 A;  3D1N I;  1UMQ A;  1SFO J;  1Y1W J;  3SFI A;  3BR3 A;  1ZR4 A;  2W48 A;  1H88 C;  2X48 A;  4AC0 A;  4A3B J;  3CCY A;  1GV2 A;  4LOC A;  9ANT A;  4A3M J;  4DYC A;  1U9N A;  1MNM C;  1VND A;  3ZQI A;  3ZQC A;  4UUS A;  1B72 A;  1U78 A;  3NAR A;  3IH2 A;  3GTO J;  1U9O A;  4MLO A;  4MFD A;  1JKP C;  3ZQL A;  2FQ4 A;  2EBI A;  2DA7 A;  4M3D A;  3CQZ J;  5C3E J;  1IJW C;  1LE8 A;  2LD5 A;  2DA4 A;  1FIP A;  4D5F A;  2NVX J;  2P81 A;  4M6V A;  2JN6 A;  1Z0X A;  2XSD C;  2RAE A;  5F27 A;  3RZO J;  2FJ1 A;  2MG4 A;  2VKV A;  4AYB N;  2HDD A;  1ENH A;  1Z77 A;  5C4J J;  4JX4 A;  3HGG A;  2XGE A;  2VKE A;  2R5Y A;  1AU7 A;  5F08 A;  4IHX A;  2R5Z A;  1A5J A;  2HXO A;  4M3G A;  1ETQ A;  2CRG A;  3Q0U A;  5IYC J;  3A01 B;  2K9S A;  5J1U A;  1AHD P;  3LSR A;  2K9Q A;  2FD5 A;  2EZH A;  1I3Q J;  3O8G A;  3QQA A;  2H1K A;  1HCR A;  5M5Y J;  1ETY A;  2XPU A;  5C44 J;  4BBR J;  1OJL A;  2IEK A;  2I10 A;  4IHY A;  1A6I A;  5FKM A;  3IH4 A;  1B8I B;  3BQY A;  3WHC A;  4ABZ A;  5IP6 A;  3ZQF A;  5BNG A;  1TWG J;  3E7L A;  4I6Z A;  3L1P A;  2DMQ A;  2JA5 J;  3BTC A;  1RR7 A;  4BY7 J;  2AHQ A;  1JKQ C;  3SDG A;  1OCP A;  3TP3 A;  1NK3 P;  1R9T J;  1JUM A;  3FK7 A;  1JJ6 C;  2Y2Z A;  3OOU A;  2CQQ A;  2CU7 A;  5IOY A;  1BJZ A;  1GUU A;  2KT0 A;  1H89 C;  2MW8 A;  2X9D A;  4W97 A;  3H0G J;  4DYR A;  5K7F A;  2XGC A;  3M4O J;  3LNQ A;  1ITY A;  3GBG A;  5EF6 A;  1B8I A;  2Y0S N;  4A3F J;  4BY1 J;  3GTP J;  1GT0 C;  2R7Z J;  3HKZ N;  1FEX A;  3BG9 A;  1TWF J;  5E3O A;  4DYQ A;  4QIW N;  2QCO A;  2NOG A;  2XB0 X;  1WH5 A;  3A03 A;  3S15 J;  3HEF A;  4IEJ A;  3JRD A;  1PUF B;  3A01 A;  1RKT A;  4C3H J;  3RZD J;  4CYC A;  1RKW A;  4JX6 A;  2R5Z B;  5IPA A;  1OCT C;  2E2H J;  2VUM J;  2LY9 A;  3S14 J;  4AUX A;  2CJJ A;  2EZI A;  1MH3 A;  2HQ5 A;  5IP7 J;  1BW5 A;  1MSE C;  2XB5 A;  2CUF A;  3LOC A;  3JRE A;  1T56 A;  1EF4 A;  1ETV A;  4X1E A;  2NVY J;  1JUP A;  1GV5 A;  3Q3S A;  5EGO B;  1XC5 A;  2LP0 A;  2M2E A;  1ETK A;  3GTK J;  5K7H A;  3BTI A;  3HM5 A;  1AKH A;  4FE7 A;  2HOT A;  1X58 A;  1F43 A;  4L5E A;  5FKO A;  3TP0 A;  2ECB A;  2Y9Y A;  1FTT A;  5F0H A;  1P7J A;  2YUS A;  4S0H B;  4XK4 A;  3UKG A;  2JA6 J;  2YU9 J;  4A3L J;  1LFU P;  1ETO A;  2XPV A;  5F0F A;  4XRS A;  4DZJ A;  3BTJ A;  4W1U A;  3HOW J;  5M3F J;  4X6A J;  3MKL A;  3K2A A;  2E2J J;  1DU0 A;  4IHW A;  1XS9 A;  2DA2 A;  2NS7 A;  2VPR A;  4D7M A;  4QTR A;  3S1R J;  1JKR C;  4DZP A;  3GTL J;  4M3F A;  5EZG A;  4IHV A;  3I4N J;  2HYJ A;  1TWH J;  3HB9 A;  2IBD A;  3B6A A;  3TW7 A;  3OIO A;  1LE8 B;  2K40 A;  3BG3 A;  1QVT A;  3I4M J;  2DA1 A;  2E19 A;  5GPA A;  2N8G A;  2L7Z A;  2HOS A;  1SAN A;  1JTY A;  1QVU A;  4J19 A;  2JMW A;  2H8R A;  5HOD A;  2M9H A;  2L0K A;  5M5X J;  4B3A A;  3IH3 A;  1WGX A;  2LR8 A;  3Q0V A;  4XRS G;  4FTH A;  2LK2 A;  3LSG A;  2EQR A;  1RPW A;  4UUS B;  1B72 B;  4A3J J;  4XIC A;  2L7F P;  1ZGW A;  3GTG J;  1IG7 A;  1T33 A;  4Y52 J;  3QPS A;  3JR9 A;  4A3K J;  1HOM A;  3B6C A;  5C4X J;  1JT6 A;  1NK2 P;  2QF7 A;  1JT0 A;  1IRZ A;  1FTZ A;  3RQI A;  1GVD A;  2R0Q C;  5EYR A;  3CDL A;  5J3L A;  1VI0 A;  5EG0 A;  4V2F A;  1BA5 A;  4V2G A;  5GPC A;  1POG A;  1QRY A;  3TW6 A;  1ETX A;  2LFB A;  5IYB J;  2JJ7 A;  2DMT A;  1HLV A;  3W6V A;  3H3V K;  1LFB A;  5EGO A;  1MBE A;  5DTD A;  2ECC A;  3BQZ A;  3NAU A;  1Q1V A;  1X2M A;  2WB1 N;  4XID A;  1DU6 A;  1GDT A;  3JRB A;  1F36 A;  3MVP A;  3Q0W A;  5FKN A;  1IV6 A;  2G0E A;  3TED A;  4UUT A;  5JLW A;  1S7E A;  1MBJ A;  4B1R A;  2LKX A;  3HOU J;  3WHB A;  2ME6 A;  3HGY A;  2JWT A;  5J1Y A;  5GP9 A;  4CYC B;  1WCM J;  3HOY J;  4Y7N J;  1OFC X;  4JX5 A;  1MBK A;  1X2N A;  1K61 A;  1JGG A;  4XRM A;  4GFB A;  2LVS A;  2Y31 A;  5E3M A;  2TCT A;  1JJ8 C;  2DTZ A;  3GTQ J;  1MBH A;  3BR6 A;  3HOV J;  2O7O A;  3S2H J;  2HXI A;  4A93 J;  1VFC A;  1NTC A;  4G12 A;  5DS9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...