1IDYA

Structure of myb transforming protein, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
54
structure length
54
Chain Sequence
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 12
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idyA00
2DA2A 3D1NI 1HDDC 3BG3A 1DU0A 4IHVA 2EZLA 4FE7A 4A3JJ 1U9OA 2JJ7A 3BT9A 3OOUA 4V2FA 2OF7A 2DN0A 4C3IJ 4DZPA 5EF6A 2TRTA 3C2BA 2CQXA 3BG5A 5GPCA 1AU7A 2L7FP 3GTGJ 2W48A 2DA4A 2JMWA 3H3VK 2EQRA 1IC8A 1I50J 1UG2A 2M9HA 2PMZN 3K2AA 2DMQA 1R9TJ 3RZOJ 1ENHA 4M3BA 4BBSJ 2YU9J 3JR9A 2YS9A 1QVTA 5HODA 2DMPA 3ZQFA 4MFDA 2P81A 3S1RJ 2E2JJ 1FTTA 1JUPA 4BXXJ 1Y1VJ 1GT0C 1ZTRA 2ELKA 5DS9A 1P7JA 1NK2P 1RETA 3E7LA 4A3FJ 1HCRA 3GTKJ 4Y7NJ 2AHQA 3JREA 2LK2A 3B6CA 3QQAA 1GV2A 2JA5J 2Y2ZA 1K61A 3JRBA 4DYRA 2X48A 1IGNA 3BR1A 3NARA 1JKOC 4BY1J 2ECCA 3G1MA 1XS9A 1IRZA 2QF7A 4JX6A 5F0HA 2MGQA 2XGDA 2VUMJ 1WH5A 2NVYJ 3F0CA 1JUSA 4M3GA 1B72A 1JKQC 2Y0SN 2H1KA 2X9DA 2KDZA 2XGCA 1T33A 2E19A 3PM1A 4JX5A 1FEXA 2IBDA 2LR8A 1QRYA 4JYKA 1JJ6C 4C3HJ 5IYDJ 1RPWA 5EG0A 2NS7A 4M3DA 5JLWA 4JX4A 1JT0A 3L1PA 3TEDA 1YRNB 1HDPA 5FKNA 2E2IJ 1T56A 1IJWC 4HNVA 1S7EA 3GTOJ 2JA7J 5FKKA 1QPIA 5FKOA 1B8IB 3GBGA 3LNQA 3RZDJ 2DTZA 3RQIA 2M0CA 2RAEA 1FTZA 5IOZA 1O4XA 2FX0A 1MH3A 4S0HB 4CYCA 1BW5A 3VPRA 4IHXA 2JWTA 5IYBJ 4CYCB 1X2MA 1BJZA 4A3BJ 2VPRA 1RKWA 4M3FA 2JA6J 4AC0A 5C3EJ 3G1OA 1I6HJ 2XSDC 3SFIA 4QIWN 5EZHA 2JN6A 1AKHA 5EGOA 3JRIA 2CUFA 2DJNA 3Q0UA 4W1UA 1U8BA 2NVTJ 3S1NJ 3GTMJ 2EBIA 1IDYA 2EH3A 3TP0A 1AKHB 5EGOB 3BG9A 1IG7A 4C2MJ 1U9NA 1JT6A 3JRHA 3PO2J 3S2HJ 1JKPC 3LSGA 4BY7J 2XPVA 3TW6A 3JRDA 4A3EJ 1XC5A 2M2EA 3PO3J 2FJ1A 1X58A 4V2GA 3JRGA 1MBKA 2H8RA 3TP3A 2K40A 3JRAA 3K7AJ 1TWFJ 2LY9A 4X1EA 3LOCA 3A02A 1RKTA 3BTIA 3HM5A 1JKRC 2KT0A 3HOZJ 3BR3A 4BKXA 2LLKA 1Y1WJ 1ZQ3P 4MIMA 4A3CJ 3CMYA 1W0UA 2DA3A 5C4JJ 1VI0A 5FKLA 4M6VA 4EEFG 1APLC 1NK3P 1ZR2A 4A93J 2WAQN 1VNDA 3OSFA 2EZHA 1LFUP 3IV5A 5BNGA 2QCOA 1ETYA 4Y52J 4B3AA 3BTCA 2Y9YA 5E3MA 1H89C 2NS8A 3ZQIA 3I4MJ 2HOAA 5IP6A 3HOUJ 5J1YA 3IH3A 5E3OA 3JRCA 2E2HJ 3GTQJ 4RDUA 4XRSG 4A3GJ 2LP0A 1TWCJ 1GDTA 3SJMA 4FTHA 4FE4A 1FIAA 4A3DJ 1RR7A 4DZJA 5EYRA 9ANTA 3ZQHA 4I76A 1P7IA 2HDDA 2EZIA 2L7MP 3S14J 3HKZN 3NAUA 3HB9A 2ME6A 4XRMA 3HOYJ 1MNMC 2XPUA 2R7ZJ 3S1QJ 1B72B 2R0QC 2ID3A 2LD5A 1EF4A 1ETQA 4IHYA 2VI6A 1VF9A 3CQZJ 3LSPA 2HOTA 1JTXA 2HQ5A 4A3IJ 5C44J 1X2NA 1OCPA 4BBRJ 5EG0B 4B4CA 3MVPA 3LSRA 2JK3A 4FISA 1AHDP 1MSFC 2CQQA 1TWAJ 2YUSA 1VFCA 5J3LA 4AYBN 2NVQJ 1HLVA 2O7OA 1JJ8C 2M8GX 1IV6A 5IP9J 5F0FA 2O8KA 1FJLA 2XGEA 1POGA 1MBHA 1WH7A 1Z0XA 3B6AA 3GTJJ 3CCYA 4MLOA 1MBGA 5EZGA 1MBEA 2NOGA 2ME0A 2XB5A 1LE8A 2LVSA 2Y31A 4UUTA 3OSGA 2MG4A 1CQTA 1GVDA 2R92J 1UHSA 4NDLA 2L7ZA 5EDNA 3O8HA 3Q3SA 2CUEA 3LSJA 2XPWA 3QPLA 3ZQCA 1SANA 4D7NA 3WHBA 1Q1VA 4LOCA 5K7HA 4UUSA 1ITYA 1HOMA 1WCMJ 2LTPA 3SDGA 3G1LA 4UUSB 2DMUA 1K83J 3BR6A 5F0CA 3IH2A 2B63J 2CJJA 3JRFA 1FIPA 3DEWA 2R5ZA 1U78A 4C3JJ 2K9QA 2DA1A 1OJLA 3FK6A 2EZKA 5EEAA 1ETVA 3QPSA 4A69C 2ECBA 3S2DJ 3W6VA 5M5YJ 5IPAA 3S17J 2DA7A 1G2HA 3HOWJ 5GPAA 4RBOA 1BA5A 1DU6A 3FK7A 4A3MJ 5F27A 2CU7A 1ORKA 2AO9A 4DYCA 2K9SA 1MBJA 3HEFA 1BL0A 4AUXA 1IUFA 5F08A 1NTCA 2FQ4A 4IEJA 1H8AC 2E1OA 4X6AJ 3S1MJ 5IOYA 4GFBA 3Q0WA 1GUUA 2NVXJ 3ZOBA 4D5FA 4XICA 1HF0A 1QVUA 4M3EA 4B1RA 3HBLA 2M34A 3WHCA 3A01A 5J1UA 5E3NA 3HGGA 1Z77A 3O8GA 5IP7J 3FISA 2I10A 1ZR4A 4JP0A 3A01B 3FIWA 4FCYA 1ZGWA 4XK4A 1OCTC 1WPKA 1IDZA 1JGGA 1MBFA 3RKQA 2LFBA 3OIOA 2HXOA 2OPTA 1ETXA 2HI3A 4QSHA 2GLOA 5F1JA 5FKMA 1MSEC 3ZQGA 1SFOJ 4W97A 3IH4A 1RESA 1ZKGA 3UKGA 5F04A 2JA8J 4DYQA 3A03A 2L0KA 3H0GJ 1WGXA 3CDLA 2GBYA 4MFEA 2VKEA 3BR0A 1D5YA 1A5JA 1WI3A 2O9LA 1GV5A 2LKXA 2DA6A 4A3KJ 5C4XJ 2WV1A 1YRNA 2N8GA 2XB0X 4DW6A 2IAIA 3S15J 5J1RA 3ZQLA 3BR5A 4D7MA 1B8IA 3BQYA 5IYCJ 3Q0VA 1XG1A 3I4NJ 2R93J 1F43A 2Y9ZA 5E3LA 2ID6A 3DCFA 4L5EA 4D5CA 2GM4A 1TC3C 1OFCX 2VKVA 1F36A 2FD5A 2DMTA 5M3MJ 1ETOA 4QTRA 2TCTA 1LE8B 2G0EA 4A3LJ 1JTYA 5K7FA 1I3QJ 2WB1N 2HOSA 3GTPJ 3S16J 5FJ8J 2MSYA 3MN2A 2X6OA 4XRSA 2DA5A 3HOXJ 1E3OC 4ABZA 4XIDA 4MO7A 1PUFA 1MH4A 2HYJA 3BR2A 5GP9A 1UMQA 1ETKA 5M5XJ 1H88C 1PUFB 3GTLJ 1A6IA 4IHWA 1TWGJ 1ZK8A 2CRGA 5M5WJ 2Y30A 3M4OJ 2R5YA 1JUMA 3MKLA 3M3YJ 2D5VA 2MW8A 1LFBA 3HDDA 3BTLA 5JLXA 2R5YB 5K7ZA 2R5ZB 2COBA 2IEKA 2K9NA 1BW6A 5M3FJ 3FKIJ 2HXIA 4G12A 1W0TA 2L9RA 2DMNA 5DTDA 1ETWA 4J19A 3TW7A 3HGYA 5FLMJ 3HOVJ 2ZB9A 3BQZA 4I6ZA 2XRLA 5FLVA 3BTJA 1TWHJ
chains in the Genus database with same CATH superfamily
4KJZA 3SEQA 2ZJ2A 5TGTA 5ILUA 4IHVA 2K4JA 4FE7A 3HIFA 3GXOA 1U9OA 1B9NA 1O3TA 1YO5C 2V9PA 3H9GA 4OOIA 4GGGA 3LQRA 2DAOA 1MGTA 1KYWA 3C2BA 3F8NA 6PAXA 3DTEA 2O61A 2HQNA 4IRIA 5LEJA 4E4HA 4EGZA 2JMWA 3H3VK 4F91B 1YJWI 4IKFA 2Q0OA 2QKMB 2ZXJA 1QGPA 3EUHA 3RZOJ 4XKBA 4S04A 4CGZA 3AFHA 3JR9A 2P7VB 5ICGA 1QVTA 5JFRA 1I5ZA 1TZLA 1XMKA 3ZQFA 2F48A 4A12A 4MFDA 3S1RJ 1QA6A 1OMIA 2E2JJ 1FTTA 1JUPA 3TBIA 1WQ2A 2GQQA 3N4MA 5DS9A 1P7JA 1NK2P 4A3FJ 3GYHX 1S72I 3E6MA 3MMYB 2MA3A 3A0BC 5CQEA 4RGSA 3B6CA 3BG7A 1W36D 4CDGA 1SFKA 3WGIA 3TOBA 4IO9F 2Y2ZA 1B4AA 2PN6A 3JRBA 1OPCA 4DYRA 2IPQX 1B6AA 3HHHA 1SMYF 4OU0A 2BGCA 1IGNA 1JKOC 2L9NA 4BY1J 2EIJH 1IV8A 2MD5A 1USTA 1XS9A 4BJTA 2QF7A 3CP8A 1YIOA 4JX6A 5F0HA 4MEYF 1WH5A 3F0CA 1JUSA 4M3GA 1HKTA 2H1KA 3RPUD 2CS3A 1ZG5A 1AA7A 2L3DA 4JX5A 1FEXA 4HOBA 4FHTA 1HA8A 4MTDA 2IBDA 1QRYA 1J0RA 2VT3A 4JYKA 4A2UA 5EG0A 2WWYA 5JLWA 4R8HA 3TEDA 2EFQA 1HDPA 4IOAF 1IJWC 3JSPA 4DJAA 1YJNI 1S7EA 4CCOA 1Q1HA 3CCMI 3FZVA 1ON1A 2EFOA 1LJ9A 2W85A 1X1PA 3TDZC 3RQIA 4P9FA 3FMSA 4RMNA 3RI4A 2H27A 3L00A 4S0HB 1E17A 4PSXA 2NVUB 2E5ZA 1BW5A 3GZ5A 3PUBA 1P6RA 4CXFA 3LFUA 1RUOA 3I58A 4A3BJ 4M3FA 5D4RA 3GLXA 4GXOA 1ULYA 2L54A 2YR2A 3LSIA 2NAZA 4IVNA 3G1OA 4NC7A 2P5LC 3ZP5A 3FM5A 3SFIA 3KP7A 5EZHA 1R5GA 1WWXA 2IS2A 5HOOA 3HZJA 2V9KA 5EGOA 3Q0UA 1U8BA 3RPQA 4BH9A 1HSJA 3K2ZA 2Z3YA 3OYEA 3OYIA 5EGOB 1IG7A 2XAHA 1A35A 1VQ6I 3OIPA 3CCSI 4C30A 1FC3A 2BW3B 4BGDA 1JT6A 1OCOH 3AG2H 3JRHA 3H5NA 3WTTC 3I55I 3PO2J 1LQ1A 3RIRA 3ZN1A 2DODA 2A68F 2IP2A 3P7NA 3IRRA 2HZDA 1XC5A 2CMPA 2M2EA 4IXAA 3OYKA 1P4AA 3D5SC 4DBQA 1O3RA 2XF5A 3TP3A 3OYNA 2Z9OA 2K40A 1FOYA 2WBMA 2BEOA 2A5WA 3LSTA 1BI2A 1RZ4A 2KZGA 1VQPI 4A6EA 1FMWA 1OISA 3QU3A 2RNGA 2NYXA 3HOZJ 3FF5A 2M4KA 2LLKA 2QQ8A 2VONA 1Y1WJ 1D3YA 3JTHA 4MIMA 3F8MA 3PFYA 3JAMZ 3RTRA 3IHUA 1KQ0A 4LJZF 1SAXA 4U87A 1W0UA 3OV8A 1K78A 3OMYA 3RYPA 2DFEA 2XROA 4MTEA 1APLC 5F6FA 1IN5A 4XORA 4A93J 2WAQN 3G2BA 3FKJA 3OSFA 2E35A 4D0PA 2R7QA 1XGMA 1GVJA 3EUKL 2DK5A 2HWVA 5BNGA 3QP5A 1I1GA 2QCOA 4Y52J 2HR3A 2VOOA 3UNGC 5E3MA 1H89C 3SQNA 1ZYRF 1H0MA 1RI7A 3QYBA 2DYRH 5CKTA 1T6SA 2PMZA 3MFKA 1DGWY 4B47A 4HQEA 5E3OA 4BE1A 2JTVA 4I2OA 3SJMA 4XLPF 4AIDA 2X1EA 2HGCA 5TJJA 4DZJA 3ZQHA 2LBFA 4I76A 3TO9A 4CSWA 2E34A 3HTSB 1S8NA 4UV8A 1MNMC 1S3JA 2XPUA 2KRFA 2R0QC 2LD5A 1UFMA 3HJEA 3KYCB 1QBJA 1EF4A 2CUZA 4OIQF 2EA2A 1SEUA 2G7UA 2HOTA 2A3SA 4CCMA 5K5RA 3QOPA 1TLHB 2QBYA 3WE3A 4B4CA 2B7EA 1XTAA 4RB3C 4CO8A 3RDIA 2QBYB 4MNUA 1VFCA 3L2VA 4CICA 1D8JA 1HLVA 2EWNA 3DU6A 3GMEA 1IO2A 2O8KA 1POGA 4RAZA 3BCAA 3KIOA 1JXSA 3BC8A 5K5QA 4XBFA 1R23A 5E8IA 4RB1A 2KMUA 4HAMA 5EZGA 2R7VA 1UJ8A 2M0MA 1JI8A 1MKMA 1BOBA 2ME0A 3N97A 1B59A 5J47A 1YW8A 1CQTA 3DTIA 4MHGA 3H35A 4NDLA 4TV7A 2L7ZA 3O8HA 2XV4S 4B44A 4X0GA 2K27A 4XONA 5EEHA 3QPLA 5D4SA 4D7NA 4KIBA 2P8TA 2K86A 4M9ZA 5K7HA 3K4MA 1HOMA 2R7UA 2DLLA 3BZKA 2HVSA 2Z5UA 1P4XA 4YRVA 4IRGA 3RYRA 5GTHC 3KP4A 1R5HA 4LG3A 4OAYA 2XF6A 2GIZA 1BM9A 2VC0A 3IH2A 4RAGA 4O5VA 4LFUA 4ANJA 2XF7A 3DEWA 1WHUA 2KIFA 1ZLJA 2R5ZA 2FF4A 1E2XA 1KU7A 4C3JJ 2K9QA 3W2VA 3M1CA 2DXIA 5E1ZB 1EA3A 2EV0A 3ASNH 1QNTA 2ECBA 2EB7A 3DPUA 3S2DJ 1V5FA 4LIVA 4J00A 4BQAA 2DFIA 4A0XA 4XN0A 2HDCA 2PMHA 4ZDLA 1T95A 4RBOA 1YLFA 4PFPA 1UB9A 2V1DA 3JTGA 1SFUA 3BZCA 5F27A 2OD5A 4G7HF 5TRDA 4LITA 3LAPA 2LRDA 4CCJA 4XMYA 2K9SA 1LUJB 2L5QA 3R0JA 4AUXA 4F52A 3K70C 3VYTB 3E6DA 1H8AC 3TO6A 4X6AJ 2MFZA 1L0OC 2NVXJ 2RGVA 5ED4A 3OYGA 2MC4A 4M3EA 2HYFA 4B1RA 4HX8A 2D1HA 2E7XA 4F92B 4IF4A 4OAZA 2L4MA 4OIRF 2V7FA 4I09A 5E3NA 1TNSA 4AIKA 4JP0A 1VQLI 3GEZA 2STTA 3SXYA 4XK4A 1OCTC 5HNFA 1JGGA 2FMLA 2GOXB 4E7KA 1GXQA 4ZYGA 1LVKA 5HNHA 2OCCH 2E36A 2ZSIB 4BDYA 2C6YA 2EV5A 2VC1A 4I01A 2Z1DA 2CV0A 4NBQA 3W6KB 2R7FA 2L4AA 2X1DA 3EPZA 2MC3A 2JA8J 2KL4A 2VB6A 1SD6A 1WGXA 1IRFA 2M8EA 4LG0A 2O8XA 4GYGA 2O9LA 2LKXA 2J5PA 5AIQA 3ABMH 4L9NA 1T2KA 5AONA 1FX7A 2CUJA 4LG0B 2WV1A 3KP2A 2XB0X 4C9YA 3ABLH 2IAIA 3F8FA 3S15J 4IX7A 5J1RA 5BPIA 4Z6YA 3M07A 3BQYA 1AOYA 1OR7C 1KA8A 1XG1A 5JHUA 2L01A 3COAC 2Y9ZA 5E3LA 4L0YB 2GM4A 4AYBA 1NH3A 2FD5A 1F4KA 2QENA 3ML6A 2GWRA 3TMOA 1XMXA 4YIFA 2X6WA 1LE8B 5BMZA 2G0EA 4A3LJ 5DV5A 1I3QJ 3BJAA 3EDPA 1UELB 4RB0A 1VQ8I 2RDPA 1O57A 5F1RA 3MWMA 5CQGA 4XRSA 4CYDA 2NNNA 3IKVA 5DUIA 3NQOA 4HLYA 1H9TA 2HYJA 2EINH 4YEJA 3F6VA 4B8XA 5M5XJ 5FLXZ 3NEUA 1MMNA 3CF5F 2GA1A 3M4OJ 1S29A 4E6KG 3ROUA 1U2WA 3WGHA 1X1CA 2PLYA 1LFBA 3BZ6A 1U5TA 4FETA 2BVLA 2W1OA 5JLXA 1T8IA 3M8FA 2IEKA 2L9SA 4LLGF 2K9NA 3J7YJ 1J75A 2F6CA 1TQPA 5M3FJ 4G12A 1KQ9A 2L9RA 4F7ZA 2AQEA 2VLAA 4J19A 3TW7A 3GFMA 1Y8RB 2KZVA 3TGNA 3LQQA 2D1VA 3HSFA 2VL8A 5FLVA 2UUZA 2CV2A 4BEHA 2PMUA 3QODA 4XOTA 4C2TA 2DA2A 4PFOA 3BG3A 1R58A 2DYSH 4A3JJ 4BEHB 2MYSA 2JJ7A 4LD5A 4QWQA 3KPHA 2OF7A 3GF2A 4HQMA 2QZ8A 3IL2A 2TRTA 3HSRA 3SDBA 2B0LA 1EKEA 3OYJA 2ZO4A 3WODF 3ZMUA 4XM3A 3KEOA 1BIAA 2QSFX 3L7WA 5D5WB 3K2AA 4OWRB 2VXZA 2EIMH 1R9TJ 3DKXA 1ENHA 2OQRA 3ZRGA 3KYLA 2KKOA 1MJAA 2GXAA 2DMPA 2Y75A 1XMAA 1DPRA 2P81A 2CW7A 1BR4A 4II3A 4BXXJ 1GT0C 4HYEA 2DFFA 4PJJA 3MZYA 5DD4A 4E7LA 1UZCA 4UHTA 1MIJA 4AVZA 4Y7NJ 1LKXA 1I27A 2AHQA 3JREA 1IF1A 3FM3A 1UAAA 4U0YA 1RC9A 2BBYA 1FBSA 1GV2A 1YS6A 5D5VB 3CD6I 3O6BB 4E7ZA 4ZDOA 2ESNA 1U3EM 3F23A 4RS8A 3V8KA 1REPC 1ZAOA 2ECCA 3G1MA 3ELKA 1IRZA 2XUBA 1B72A 2Y0SN 2KDZA 1T33A 2M30A 2E19A 3PM1A 1EJ9A 1W4MA 2OQGA 2HPIA 2IT0A 3EYYA 1LFPA 2EJRA 2FUG2 1QU3A 2LR8A 4NQWA 3QRFF 4IOCF 4HF1A 2NS7A 3H36A 3CCLI 4Q4ZF 5FKNA 2E2IJ 4G7ZF 1MDMB 1B1BA 2W7NA 3CCUI 4HSTA 2FRHA 1ZREA 2DTZA 1X1DA 2VXDA 3DPLC 2RAEA 5IOZA 1PVEA 4HF2A 4EJVA 1R22A 3F72A 1MH3A 2RQPA 4CYCA 4M6YA 1CF7A 4IHXA 3H9JA 2AXLA 2JWTA 2V4JC 4KISA 4CYCB 1BJZA 3LSMA 3HHGA 1CF7B 1BI3A 2BHZA 1ACIA 2LYCA 4G7OF 4AC0A 5C3EJ 2H6BA 2UXXA 4PJLA 1XDSA 1O7FA 2RQQA 2XSDC 2QWWA 5CVIA 2IS1A 1TTYA 4HV5A 1BC8C 2BYVE 5EJCA 2CUFA 4UB6C 3ECOA 3D0SA 5DCMB 1VQ4I 2NVTJ 2H8WA 3S1NJ 3CC7I 2EBIA 2EH3A 3BY6A 5HS9A 3TOAA 3X2QH 4NUBA 4C2MJ 4HV6A 1G6NA 2QEXI 2EV6A 3R60A 2ISYA 3KFWX 3OY9A 4BXUA 4G6TB 4XQFA 4EJOA 1JKPC 3TW6A 2XPVA 2ZSHB 1OR7A 2X6YA 2QA4I 2OTJI 3F9KA 4V2GA 2H8RA 3JRAA 4Q5SF 3E0JB 5FROA 3LSHA 1EV7A 1IN7A 1W1WE 3LOCA 2ZCWA 4LGWA 2O03A 2A61A 4XRFA 3ERED 2I5UA 3WTWC 3VODA 2M4GA 2FOKA 3HOTA 4HG2A 1TNTA 3BR3A 4BKXA 3LSKA 2XKOA 1ZQ3P 2K5CA 3CMYA 3CJTB 4HPQA 4IL6C 2VQHA 1VI0A 5FRMA 2ELJA 4S05A 5KK1A 3BDDA 4A0ZA 1X4OA 3IWFA 1WJBA 1IN4A 3IV5A 2A6EF 3OOPA 3IWZA 1ZGAA 1WJAA 4B3AA 2ISZA 1TW2A 2NS8A 5CVRA 4I0AA 5L3EA 1KYZA 3P9KA 5IT3A 1VQ9I 2XIGA 1Z3XA 4LLLA 3IH3A 1W5TA 2JRMA 1IAWA 1MD0A 2E2HJ 4A3GJ 4RDUA 2LP0A 1TWCJ 4ZZLA 4FTHA 5L3GA 3RKXA 4FE4A 5BS6A 3UR3C 1FLIA 1FIAA 1PUEE 2OCEA 3DLAA 5EYRA 2EPFA 9ANTA 1P7IA 5KVRA 1RNLA 1USSA 3SFZA 2L7MP 1D1BA 4UNOA 3HKZN 3HC7A 3BWGA 3H1CA 2DPUA 4XRMA 3IAM2 4UVCA 1M1EB 1ZG1A 5LBQA 4ESJA 2VI6A 4YIIA 4IQJA 1V55H 5KNLA 4MEXF 4XLAA 2CWEA 3R4KA 4HNTA 2HQ5A 2ZC2A 4A3IJ 3U9GA 3DFGA 1OCPA 3PL8A 5EG0B 4M9SA 4PJNA 3LSRA 2R7OA 3HUGA 3DWLE 3HPGA 3K1PA 3VYRB 3E6CC 1FWZA 1AHDP 1R6RA 2DK8A 3HUGB 5J3LA 3C1DA 4G9YA 1JJ8C 5F0FA 4BS9A 2BVMA 2X4HA 5LHIA 4RA2A 5J4VA 3H3ZA 1OYIA 4U0WA 1J7KA 2R4GA 1MBHA 1WH7A 4YG2F 1HKQA 1A6QA 1Z0XA 3B6AA 3FXUA 2DO7A 1YX5A 1TBXA 2MLGA 2CQKA 2O0YA 2VASA 2YX4A 3CCYA 3K6GA 1MBGA 3KEQA 4L9JA 1B9MA 1ZRDA 2R7DA 2NOGA 4UV9A 2V1UA 1G8XA 2EFPA 4PUSA 2XB5A 1T0FA 3SYTA 3GZNB 3I64A 2L7KA 4Y4RA 2MG4A 2R92J 1GVDA 2LC2A 4HEA2 3CCVI 1JE8A 2CUEA 3OS1A 1YJ9I 3KCCA 3P9IA 4KITB 2PG4A 3BROA 1MMSA 4AWXB 2E5NA 3WHBA 1J9IA 5B66C 1YOVB 2F5DA 3W2WA 1WCMJ 1WJ5A 3F8CA 4LB5A 2LDUA 2IGMA 3DV8A 3CMMA 3A2KA 2CO5A 3BR6A 5F0CA 2M5WA 1BN5A 3ASOH 4U7DA 1ONVA 3JRFA 2VJ4A 3QYEA 4NB5A 3F8BA 4LK1F 4I98B 1PP7U 3I9V2 2A6HF 4UB8C 2XASA 2R7WA 1LPQA 1G3YA 2DA1A 4XLEA 5EEGA 1OJLA 3FK6A 5EEAA 2VE8A 4CA0A 5E1XA 1MW7A 3W6VA 5CVUA 3FXOA 5J4YA 2L9VA 3O2PE 2DCEA 1Y56A 2FE3A 2KIMA 1L3LA 3OYMA 5IT9Z 3HOWJ 4II2A 1BA5A 1T98A 2CU7A 5HDKA 2DDBA 2VPLA 2COMA 2ETHA 1ORKA 2EK5A 1K78B 1HW2A 5F08A 1NTCA 2OA4A 1OCZH 4IEJA 3CUQA 2OZUA 4DIQA 3J7AY 3ONQA 4B3XA 3WTSC 3CUQB 2ZMEA 3PFIA 4RGUA 1TW3A 1ERDA 1XGSA 2IS4A 5LRRA 1N77A 2ZMEB 2DTRA 3WHCA 3CC4I 1ON2A 2OZ6A 2IA1A 3O8GA 2K9LA 3OYLA 3FISA 2P4WA 3L2UA 2I10A 4D9JA 1ZR4A 2JQ7A 3K70D 4G8XA 2GOMA 3FIWA 1S6LA 1ZGWA 2BY2A 2LSOA 3CCEI 5GAHJ 2FOWA 3OIOA 3I56I 2QQBA 4BYYA 1DQUA 4WCGA 3S32A 2LBFB 1R1VA 2UZKA 4CHUA 1MJBA 2JVHA 1D1AA 3WU1B 4D1QA 2LOOA 3NWTA 1A36A 1BJAA 3LA3A 5J8CA 4IHTA 2XAJA 4WXCA 4N0BA 2H94A 2HFHA 2L0KA 3BPXA 4WF2A 1DDNA 3H5RA 3DPTA 3CDLA 3DKYA 2BY1A 1FOKA 2F5VA 3J81Z 3BR0A 1A5JA 2HTSA 1D0ZA 1WI3A 3CMAI 2ZJQF 1JGSA 1XX5A 2VQCA 4WX9A 3S3NA 4I7HA 1U5TC 4ZZDA 4EJWA 3K69A 2P6SA 2K4BA 1YRNA 5L3CA 2N8GA 3TQNA 3HOSA 1KU3A 4DW6A 5LHHA 1QZYA 2OTLI 3IRQA 2FBHA 1Z05A 2G7HA 4D7MA 1B8IA 2JZYA 4IRHA 5IYCJ 3Q0VA 4N9IA 3I4NJ 1Z21A 4CH7A 2E71A 1I6XA 1T08B 1HKSA 2LNBA 2YPRA 2NNYA 2EILH 4D5CA 2BXYA 4EJUA 2HDWA 2CG4A 1R71A 1J2XA 1Y8QB 2DMTA 1ETOA 1V5GA 3E5QA 5M3MJ 2F5EA 3ERMA 5LD2C 2CYYA 3F6OA 4QTRA 2TCTA 3K4BA 4PCQA 2CW0F 2A6TA 4FX0A 3CO6C 2HOSA 2DOAA 3S16J 2FSWA 4P96A 3P5JA 2GAUA 3T1BA 2X6OA 3CDIA 4OMZA 4ABZA 1R4MB 4MO7A 2ZFUA 3GWZA 5D8LB 1N75A 1X3WB 1P92A 1BR1A 2G9WA 5GP9A 1UMQA 2O3FA 3A4CA 4ZYAA 1I39A 4R1HA 4KMUX 4AVPA 1A6IA 2QUFA 3KLNA 3WG9A 4IHWA 3ZMZA 4EMSA 4ZYEA 2Y30A 1RR8C 1STZA 1FP1D 4IHSA 2MW8A 1G59A 1WJEA 3HDDA 1SMTA 4B48A 3AL0B 2GXBA 1W5SA 1KONA 2R5ZB 2IS6A 1OQYA 3CO7C 2KLOA 3PNVA 2UXNA 1W0TA 2OC6A 1S7OA 5DTDA 2OU2A 3JCUC 3K1MA 3DP7A 1YFHA 1D0YA 1ZHFA 5FLMJ 5BQTA 2WY7Q 3BQZA 2CQ7A 3HOVJ 5DM6F 4I6ZA 1LEBA 3BTJA 3FBNB 3QOEA 4KT6A 3AG3H 4Q48A 5IY5H 3D1NI 3KE2A 1DU0A 2EZLA 2FBIA 1D5VA 3RJPA 4LK0F 3BT9A 3OOUA 4Y13A 2CFXA 1EH8A 2DN0A 4C3IJ 4DZPA 2VQGA 4MGRA 1QZEA 1K6YA 4FQGA 4M9XA 3BG5A 1N78A 5GPCA 4PDKA 1A04A 2L7FP 2W4SA 3ZMDA 2W48A 3PSFA 3H9QA 4FASD 1IC8A 1I50J 2DI3A 1UG2A 2EFWA 2M9HA 2PMZN 5H2FC 2PX9A 2KIUA 3JSOA 4BBSJ 3DEEA 2YU9J 2YS9A 1R7JA 3TKYA 5JR3A 2VJ5A 3CESA 1H9GA 2KP6A 1WJDA 3HXLA 1QHHD 5B5EC 4ZJZA 1LB2A 1HCRA 4E7HA 3E1SA 2VIXA 3H5AA 2LK2A 5K5OA 3FBIB 4L18B 5HLHA 2QGUA 2JA5J 2ADUA 2XC7A 3FHZA 2IRFG 2X48A 2PJRA 3NARA 4XLHA 1ZH5A 5CVJA 3OYDA 2IVMA 2DFHA 1KQ8A 1BC7C 2VN2A 2W24A 1F5TA 2VUMJ 2W25A 4B09A 2R7SA 2IGNA 3PIOF 1JKQC 2RKHA 2X9DA 4DQ2A 3OWTA 2Q2EA 2V1NA 4ZDPA 1WJCA 3ABTA 3K4LA 3Q9VA 2EA4A 1PJRA 3MKZA 2B9SA 3HG9A 3FXQA 4M3DA 3V7SA 3VOEA 3L1PA 4XLFA 3MZHA 2VBXA 4EATA 1QZZA 1T56A 2JUCA 1FMVA 2K9MA 3PUFA 5D8KB 1Y0UA 2YSRA 2ZXHA 4CUGA 4HNVA 3GTOJ 2JA7J 5FKKA 1G3SA 4A6DA 4EV0A 3GBGA 3BG6A 3RZDJ 2Y69H 3S8PA 4EM0B 3GUDA 2M0CA 2P5VA 3OS0A 5D6FA 3EQLF 4XSZF 3B02A 3IUOA 3ZMSA 4E70A 4ZH4F 1O4XA 4L9VA 3K1NA 1F9NA 2R7RA 5JVGF 2WAFA 2QSHX 1UHMA 4RM2A 4R79A 1TQIA 4Y3OA 3FHNA 5IYBJ 3GX4X 5LGTA 2P6TA 3CJRB 2E1CA 2E1MB 1WJFA 2NXNB 5HLIA 3M8EA 1I6HJ 5JHFA 2JUGA 4N9HA 1WKMA 3K4KA 5DYMA 2OAZA 4O3MA 3JRIA 5L3DA 2NS0A 3HRMA 5HLTA 4A0YA 3GTMJ 3CJQB 1BBYA 3F22A 1IDYA 2WB1A 3BG9A 4I0BA 2BV6A 2F5FA 5CYVA 1HQCA 3QPHA 1FSEA 1X3UA 2HU9A 3NWSA 4E7JA 2DT5A 2KRCA 1U5TB 2OJED 3DBRB 3BP8A 3OYAA 2XVCA 3JRDA 3TDUC 5D5UB 1SD4A 1BI0A 1RUNA 1LDJA 2E60A 3GFJA 4BDZA 3QWLA 3AKZA 1X1BA 2FJ1A 1X58A 4P55A 4KA4A 5LFAA 1VQOI 4BU2A 3RKWA 4ESBA 4XOPA 2LY9A 4X1EA 5DEQA 3W3CA 2RREA 3V42A 3FX3A 3A02A 1RKTA 4CZZA 3BTIA 3WE2A 3BJ6A 2LG4A 5KHDA 1JKRC 1AWCA 1DP7P 2KT0A 1FBQA 1UHWA 3I5UA 5LLQA 4WXHA 4L0ZB 3J7AO 4BQNA 5CVVA 3OYHA 4A3CJ 1NG6A 2WV0A 5H6RA 2DA3A 5C4JJ 5FKLA 4M6VA 1XN7A 4EEFG 1ZR2A 2DQRA 5DM7F 3L2WA 3DBHB 1PDNC 3RCOA 4ZTJA 5DUKA 1LFUP 3SZGA 2IA0A 2LKSA 5HDGA 3VDXA 3J80Z 3BTCA 1U8RA 1E3HA 2QSGX 5E8GA 3EYIA 3AAFA 5L3FA 2UV1A 4IJAA 3ZQIA 1FYMA 5H20A 2V6EA 2HOAA 2CV1A 1K79A 3ECHA 1R1UA 4ENMA 2YU3A 1S7AA 2OV7A 5J8FA 1BR2A 3GFLA 3G4SI 1T0FC 3QYFA 1MJ9A 1RR7A 3A0HC 3PQJA 5B1AH 2EZIA 1MMAA 3CCQI 4EVIA 2MH2A 2R7ZJ 1ZN2A 1OYWA 4KT5C 1P9QC 3F21A 1B72B 2ZBKA 2M7AA 1FOXA 2ID3A 3HRTA 3BLYA 1ETQA 4FT8A 3CQZJ 4JQFA 4CCNA 2PQ8A 4EGYA 1JTXA 4E7IA 5DD8A 4NQWB 5C44J 1K4SA 1J5YA 1XDUA 3IAS2 2FU4A 2M3AA 2FBKA 3HKZA 5FLXK 4FISA 4WXDA 1MSFC 2YUSA 1R36A 2D45A 4AYBN 2HVQA 2NVQJ 5LEKA 3LL7A 3V8JA 4ON0A 3ZMTA 2R7TA 2JPBA 1FJLA 2XGEA 3RKYA 1D0XA 1SVMA 3OYCA 5CJ9A 2HEOA 3ZQQA 4HDUA 2LMDA 5LGUA 4Z2YA 1U6GA 2QQ9A 2HKXA 4MLOA 4BJ5C 4E7SA 3GTJJ 3CMEI 1DPUA 1MBEA 2Y48A 1TP4A 1IZ1A 3GCMA 5BPDA 3H3UA 3WG7H 4UUTA 3OSGA 3D5RC 4NC8A 2F4IA 4PZJA 3Q3SA 3B73A 1FNNA 3LSJA 2XPWA 3DBLB 4UUVA 4ZYHA 3ZQCA 2KPMA 3CUQC 1ITYA 3NRVA 2ACJA 3SEZA 3M7GA 3G1LA 3RSNA 2ZMEC 2X51A 2BY3A 5AIPA 1K83J 2LY2A 4A5NA 2LH9A 2ZNZA 1WRJA 1UG0A 2ZKZA 3GO5A 2CJJA 5KAFC 1NHAA 3A1YA 4KIGA 2K02A 4G6QA 3O3KA 1X3ZB 2JSCA 1IN6A 1FBUA 1O7LA 1YG2A 1IXRC 2QQAA 2WY8Q 1K4TA 1G4DA 2IJLA 5FFZA 5B3SH 2EZKA 3Q9SA 1ETVA 3QPSA 1XD7A 5JI6A 3PNYA 2WC2A 1I1SA 3RQ4A 2DBBA 2M1BA 3FXRA 3S17J 1FZPB 1G2HA 2VE9A 4KNYA 2JRTA 2XAFA 3FK7A 1QQIA 4Y17A 3M1EA 5L3BA 3G3ZA 4LB6B 2QYOA 1RRJA 1YITI 1BL0A 1IUFA 1MMDA 2VODA 2E1OA 1WSUA 1QO0D 2VQLA 3S1MJ 2KIQA 3SZPA 2VBZA 1MNEA 4OIOF 2R3SA 3Q0WA 3GLLA 1SVOA 1Y6IA 4MQ9F 3MKWB 2BZTA 3FXMA 3PSIA 3ZOBA 1VTNC 2MD0A 1HF0A 2PFBA 1OCCH 3MCZA 1XGOA 2MH9A 1TT5B 1FP2A 2WAQA 1DP3A 4XKCA 1QPMA 5J1UA 3GVAA 1IRGA 5IP7J 1MZBA 2V79A 4FCYA 3MEXA 4GDFA 4IQ4A 2ZFWA 1MBFA 3RKQA 5JVTA 2LFBA 4XSXF 2HXOA 2OPTA 1ETXA 4Y15A 2HI3A 3FMRA 1YS7A 4QSHA 1SAUA 2V6CA 4M6XA 3U1KA 4JK1X 5E79C 4B43A 5LRSA 2GLOA 1LVAA 1MSEC 3MD2A 3VFZA 3ZQGA 4AM3A 2GA2A 2FNPA 4BJ6C 4YFKF 4L5JA 2XAQA 3UKGA 1ZARA 4DYQA 3ABUA 4RM3A 3ESWB 3V4GA 3K9TA 3IP4B 1V54H 1LNWA 4YIRX 2F5CA 2VKEA 3AL0C 5FB2A 3DEUA 5A2QK 4A3KJ 3TO7A 4QPOA 2J5OA 1P4WA 2DU9A 1C0WA 2O6GE 2DOEA 3CP2A 3CJNA 2DT7B 2DW4A 2KJCA 4U7BA 3G73A 3BR5A 3ZQLA 4A5MA 2HKOA 3HL2A 3CTAA 3J7ZI 4ITVA 4I99C 1FT9A 3LA2A 3SHFA 2ID6A 2KRHA 3C2GA 1UCRA 3LA7A 1VZ0A 3DCFA 2VKDA 5K1YA 4LLNA 1X1AA 1TC3C 1OFCX 2VKVA 1F36A 3DLLF 4HRIA 3MAJA 3VEPA 3QPTA 1T39A 4RAYA 3L09A 1FSHA 4AIJA 3P9CA 4UY8I 3FXJA 2AXTC 2GIVA 1R1TA 4KN7X 2X85A 3GTPJ 3WGGA 5D5XB 4N4OB 5FJ8J 2V26A 2TDXA 2QM3A 2E7WA 1FPQA 3U2RA 3CC2I 3OS2A 2DA5A 1KGSA 2I8DA 1XSDA 1PUFA 1LDKB 2JT1A 1MH4A 4RLQA 3GZ6A 3PIPF 1YIJI 3C2HA 4HW0A 1GXPA 1ETKA 2RV8A 3DTKA 1PUFB 3S2WA 4ENNA 2D2WA 3TL4X 5M5WJ 3E97A 4QPQA 2BW3A 4I02A 2IXSA 3M3YJ 2D5VA 4NHJA 4XKWA 1LEAA 3EUAA 5LGNA 2COBA 3ULQB 3KYDB 1BW6A 4BHBA 3CLOA 1Z3YA 4QLCU 3CCRI 1Y39A 4H4KC 1ZLKA 2ZB9A 2XRLA 2AO9A 4BACA 3I71A 1VQ5I 1HDDC 1OYYA 1Y0NA 2CFOA 1FYKA 4LIUA 3T0YA 4UXNA 2PBIA 3PNTA 1Z9CA 3VB2A 1O3SA 1VQMI 2PJPA 4V2FA 2LF8A 3G71I 2XRNA 3U1DA 5EF6A 2NOJB 3KEYA 1S9HA 2CQXA 1AU7A 3I0TA 3GTGJ 2XHKA 4UVBA 4YFXF 2DA4A 2EQRA 3OL4A 2WTEA 1W36C 2A07F 4WK8F 1K7AA 2DMQA 4RB2C 3VWBA 1ZRFA 4M3BA 3K4NA 2JSPA 3VYSB 4GYIA 5HODA 2AS5F 3E3VA 3CDHA 2HPMA 1Y1VJ 1ZTRA 2ELKA 3C18A 1BIBA 1RETA 3E7LA 3GTKJ 4L5IA 4HF0A 4KFCA 4ZC3A 2Z99A 1XSXA 2E1MC 3VSKA 2A05A 3QQAA 1YX3A 1Z7LA 4Q47A 1SD5A 2P0WA 3BCBA 1K61A 5E17F 4NC6A 2Q8KA 5GAGJ 2WA0A 3BR1A 1IUYA 2GZWA 4ENJA 5B1BH 2JPCA 3VYUB 5ERIA 2MGQA 1XGNA 2XGDA 2NVYJ 4YFNF 3WU0A 2KISA 1PYVA 2MBFA 1Z6RA 2JA2A 3DU5A 2XGCA 3HRUA 1K6OA 4AU7A 4BXFA 2Z33A 1TL8A 3N05A 5D6EA 4GCVA 2ZXIA 2VKHA 1JJ6C 4C3HJ 3BPVA 4RLFA 4XLCA 5IYDJ 2Q1ZB 1RPWA 1CGPA 2V1XA 2QKLB 4JX4A 4ENKA 1JT0A 1YRNB 1XCBA 1WVRA 1LDDA 5HS8A 3KETA 4DGWB 1R49A 1QPIA 1YQAA 4ESFA 5FKOA 1B8IB 3V8LA 3LNQA 3S3OA 5GADJ 1FTZA 3MKYB 5H6QA 3T8TA 2FX0A 2BXZA 2BOLA 2X1CA 3WTXC 2HNHA 2ZJPF 4M74A 3V7CA 2HZTA 3VPRA 1OCRH 3JW4A 3CZ6A 1SFEA 2DPDA 1X2MA 2VPRA 4P5OA 1RKWA 1SD7A 2RVCA 3HPHA 3K4CA 2JA6J 3WTZA 2WAEA 3ZN0A 1J09A 2HYGD 2W00A 4XLNF 4PSWA 4QIWN 4BE2A 4EJTA 1ZGJA 1Z1DA 5FGMA 2QLZA 2JN6A 3GFIA 2XDVA 3JAMK 1ZELA 1AKHA 5IT9K 2DJNA 3ZR8X 4W1UA 4KUMA 2M87A 2KHMA 3TP0A 1AKHB 1U9NA 2XGXA 1EH6A 2OUMA 3WTYC 2V9VA 3FDYA 3OR2C 1ZRCA 3LWFA 4L9TA 3S2HJ 4HDVA 2ZNYA 2HQAA 3HSEA 3LSGA 1KU2A 4BY7J 3SZTA 4A3EJ 2FEZA 2K3PA 1JHFA 3EETA 1IN8A 3KX2A 3MQ0A 4O6JA 5J6XA 2FA5A 1Z91A 2WADA 3PO3J 2HS5A 1MBKA 2W57A 3JRGA 3LMMA 4H0EA 5FO5A 3I54A 3K7AJ 3Q5FA 1JHHA 1TWFJ 4RGXA 2H09A 3E5XA 4BHPA 1W7PA 2PEXA 1PP8F 2PI0A 1WI9A 1ZG3A 1NG7A 2GXGA 1YTYA 4PJMA 1W7PB 3I3LA 4F93B 4KDPA 1HW5A 3HM5A 3QAHA 2X0LA 4BE0A 2FNAA 1FYLA 2XAUA 4CZCA 1S5LC 1E0EA 3G6EI 3W6JB 4RAFA 2MABA 3KZZA 1VQNI 5HLGA 2DOFA 1R4NB 2IGKA 3BJOA 2ZJRF 2CGPA 2UWMA 4HBLA 4JOMA 1NK3P 2CSOA 5ILSA 2STWA 1VNDA 3C3WA 2VOPA 2L02A 2EZHA 3K10A 4V19K 2A69F 3J81K 1RIOH 2E1NA 1Z6TA 1ETYA 2FQ3A 5FD6A 2K3FA 2VBYA 2Y9YA 2BHYA 4KICA 5E18F 3ABKH 4G6DA 3WTVC 2JVGA 4NNJA 5E1WA 2ZXWH 3I4MJ 4EM2A 3KLOA 2CH0A 4HSRA 2FMYA 2Y0MA 5IP6A 1XSVA 2LF7A 4F3QA 5J1YA 3HOUJ 4U88A 1U0JA 2ICWG 3JRCA 3ZCOA 3GTQJ 4U0VA 4XRSG 1WFXA 1GDTA 3DF8A 4IPAA 4EM1A 1SVLA 2KDOA 2F2EA 4A3DJ 3CCJI 3WTUC 2PJRB 2HDDA 1EH7A 3S14J 3KP5A 2LREA 3HB9A 3NAUA 4RGRA 2ME6A 1N25A 3HOYJ 3S1QJ 4YELA 2BE5F 3PQKA 2IW5A 2ELHA 2Q2EB 1HW1A 4IHYA 1VF9A 1OLTA 3LSPA 3V7RA 1MMGA 1X2NA 5LHGA 1YE9A 4BBRJ 3M9AA 3MVPA 4IZZA 3CUOA 3REOA 2JK3A 2Y0SA 4HX4A 2P7CB 4HNUA 2CQQA 1TWAJ 4J01A 3T5XA 2H6CA 3I4PA 2O7OA 2M8GX 1ODDA 1IV6A 5IP9J 4G94A 5CLSA 3ZPLA 1MNDA 3RPUA 1V4RA 4K2EA 2KJBA 3S3MA 2QVOA 4HA8A 5HVQC 2W84A 1IRXA 2RC4A 2FXAA 3I59A 4GRIA 4EQQA 1LE8A 4ETSA 1O3QA 2LVSA 2Y31A 2IGOA 1XB4A 3I59B 2HQRA 1UHSA 3H0DA 5EDNA 4ZYDA 3IC7A 3IKTA 1SANA 2ESHA 1Q1VA 1TT0A 3F3XA 4LOCA 4BL0B 4UUSA 2AQFA 3LAJA 3ISPA 5DCFA 2LTPA 1DUXC 2VBWA 3SDGA 3FMQA 5HDNA 1BOAA 4UUSB 2DMUA 3KP6A 4OMYA 5CPRB 1IXCA 3EUHC 3R6SA 2DJIA 2B63J 1Z7UA 2VJJA 4M72A 1FIPA 2NRAC 3AG1H 3L2CA 1T38A 4CCLA 4C2UA 2RNJA 4ASNA 1U78A 1X19A 2W82A 3R0AA 2K7LA 4KN4X 1HBXG 2EFNA 1KU9A 5FRNA 3HRSA 2L2OA 1TQMA 2MLKA 3ZGKA 1IXSB 3ZMVA 4A69C 5FFXA 2M7BA 1V3FA 5M5YJ 5IPAA 3KZIC 1J59A 2DA7A 5HS7A 4PGGA 4JBAA 4OIPF 5GPAA 5ICEA 3W2AA 1DU6A 4HX7A 2XAGA 1HSTA 3HYIA 3LFKA 4A3MJ 1YI2I 4LMYA 3WU2C 2XKPA 3OYBA 2M45A 4FX4A 2YX7A 2R7XA 1OKRA 3K0LA 4DYCA 1MBJA 4XL9A 1P2FA 3HEFA 1G3WA 3H92A 2KQRA 1V5EA 4WWCA 2FQ4A 3OIQA 5IOYA 1DGRM 4GFBA 2HOEA 1IW7F 1GUUA 1I3AA 5KCMA 5TISC 4XN3A 4XNFA 2Z16A 1SFXA 2HVRA 4D5FA 4XICA 1QVUA 2O5RA 4F55A 2IA2A 3HBLA 2M34A 2P5KA 3A01A 1R00A 4AD9A 1XCVA 1YW9A 3HGGA 1D1CA 1Z77A 5BOXA 3DQVC 3AG4H 4CCKA 3D5LA 4BQQA 3HTUA 1E3PA 3A01B 2LKPA 4P1WA 3L9FA 1IDZA 1WPKA 1D8KA 1QHGA 3U21A 1SC7A 2A5YB 5ICFA 5F1JA 5FKMA 3FWEA 3GW2A 4MQVA 1HXDA 3E6BA 4KMFA 3FXLA 4UVAA 1SFOJ 4W97A 3IH4A 1RESA 1ZKGA 1VQ7I 4DNCA 2KFDA 3DXJF 5F04A 3A03A 4GO1A 4M71A 3H0GJ 3BOQA 2CQNA 3CLQA 2DDAA 2GBYA 4MFEA 1D5YA 4DBRA 2LY1A 1GV5A 2DA6A 3OL3A 2OBPA 5C4XJ 2DT6A 1F1ZA 3ZQ7A 4ZTFA 1XPXA 3PJRA 2HTJA 4M73A 1KZHA 5GTIC 5ICCA 3ZXSA 2CW8A 1VQKI 1MDMA 2BY0A 3L2QA 3I53A 1G3TA 4BNCA 3VSLA 2F4OB 4P9UA 4HLXA 2R93J 1F43A 1Z67A 3K4JA 1YHQI 5ILVA 4L5EA 1X4PA 4PGHA 4KIFA 3E5UA 1W5CC 1WZ2A 1HC8A 1JTYA 4BHCA 5K7FA 2WB1N 1BI1A 3QP6A 3KZYA 4XKVA 2MSYA 2DQLA 3CF2A 3MN2A 3T8RA 3HOXJ 4AIHA 1E3OC 4XR6A 3KP3A 4XIDA 2XSJC 3FXKA 5DCMA 2VT2A 5J40A 1GLNA 3BR2A 5GAEJ 1A31A 1H88C 5E20A 1W7PD 3GTLJ 4PK4A 4BUPA 1R5ID 1TWGJ 1ZK8A 2CRGA 5A2QZ 3QU6A 2F4MB 4DOZA 3S93A 3DKWA 2Z2SB 4KYWA 4BAYA 1JUMA 3MKLA 5F64A 2R5YA 1FY7A 3BTLA 3C7JA 2VJIA 5KAIC 2X6XA 4OINF 3OR1C 2R5YB 5K7ZA 3J80K 4PJ0C 1GHCA 5DDGA 3FKIJ 2HXIA 4HZFA 3MZ8A 4N4NB 2DMNA 3R61A 1ETWA 2EIKH 1YW7A 3M8JA 4BQOA 5FD5A 3OYFA 3HGYA 4Y33A 3L2RA 2K85A 1YYVA 1FOWA 2RN7A 2H1LA 1TWHJ
chains in the Genus database with same CATH topology
2DA2A 3D1NI 1HDDC 3BG3A 1DU0A 4IHVA 2EZLA 4FE7A 4A3JJ 1U9OA 2JJ7A 3BT9A 3OOUA 4V2FA 2OF7A 2DN0A 4C3IJ 4DZPA 5EF6A 2TRTA 3C2BA 2CQXA 3BG5A 5GPCA 1AU7A 2L7FP 3GTGJ 2W48A 2DA4A 2JMWA 3H3VK 2EQRA 1IC8A 1I50J 1UG2A 2M9HA 2PMZN 3K2AA 2DMQA 1R9TJ 3RZOJ 1ENHA 4M3BA 4BBSJ 2YU9J 3JR9A 2YS9A 1QVTA 5HODA 2DMPA 3ZQFA 4MFDA 2P81A 3S1RJ 2E2JJ 1FTTA 1JUPA 4BXXJ 1Y1VJ 1GT0C 1ZTRA 2ELKA 5DS9A 1P7JA 1NK2P 1RETA 3E7LA 4A3FJ 1HCRA 3GTKJ 4Y7NJ 2AHQA 3JREA 2LK2A 3B6CA 3QQAA 1GV2A 2JA5J 2Y2ZA 1K61A 3JRBA 4DYRA 2X48A 1IGNA 3BR1A 3NARA 1JKOC 4BY1J 2ECCA 3G1MA 1XS9A 1IRZA 2QF7A 4JX6A 5F0HA 2MGQA 2XGDA 2VUMJ 1WH5A 2NVYJ 3F0CA 1JUSA 4M3GA 1B72A 1JKQC 2Y0SN 2H1KA 2X9DA 2KDZA 2XGCA 1T33A 2E19A 3PM1A 4JX5A 1FEXA 2IBDA 2LR8A 1QRYA 4JYKA 1JJ6C 4C3HJ 5IYDJ 1RPWA 5EG0A 2NS7A 4M3DA 5JLWA 4JX4A 1JT0A 3L1PA 3TEDA 1YRNB 1HDPA 5FKNA 2E2IJ 1T56A 1IJWC 4HNVA 1S7EA 3GTOJ 2JA7J 5FKKA 1QPIA 5FKOA 1B8IB 3GBGA 3LNQA 3RZDJ 2DTZA 3RQIA 2M0CA 2RAEA 1FTZA 5IOZA 1O4XA 2FX0A 1MH3A 4S0HB 4CYCA 1BW5A 3VPRA 4IHXA 2JWTA 5IYBJ 4CYCB 1X2MA 1BJZA 4A3BJ 2VPRA 1RKWA 4M3FA 2JA6J 4AC0A 5C3EJ 3G1OA 1I6HJ 2XSDC 3SFIA 4QIWN 5EZHA 2JN6A 1AKHA 5EGOA 3JRIA 2CUFA 2DJNA 3Q0UA 4W1UA 1U8BA 2NVTJ 3S1NJ 3GTMJ 2EBIA 1IDYA 2EH3A 3TP0A 1AKHB 5EGOB 3BG9A 1IG7A 4C2MJ 1U9NA 1JT6A 3JRHA 3PO2J 3S2HJ 1JKPC 3LSGA 4BY7J 2XPVA 3TW6A 3JRDA 4A3EJ 1XC5A 2M2EA 3PO3J 2FJ1A 1X58A 4V2GA 3JRGA 1MBKA 2H8RA 3TP3A 2K40A 3JRAA 3K7AJ 1TWFJ 2LY9A 4X1EA 3LOCA 3A02A 1RKTA 3BTIA 3HM5A 1JKRC 2KT0A 3HOZJ 3BR3A 4BKXA 2LLKA 1Y1WJ 1ZQ3P 4MIMA 4A3CJ 3CMYA 1W0UA 2DA3A 5C4JJ 1VI0A 5FKLA 4M6VA 4EEFG 1APLC 1NK3P 1ZR2A 4A93J 2WAQN 1VNDA 3OSFA 2EZHA 1LFUP 3IV5A 5BNGA 2QCOA 1ETYA 4Y52J 4B3AA 3BTCA 2Y9YA 5E3MA 1H89C 2NS8A 3ZQIA 3I4MJ 2HOAA 5IP6A 3HOUJ 5J1YA 3IH3A 5E3OA 3JRCA 2E2HJ 3GTQJ 4RDUA 4XRSG 4A3GJ 2LP0A 1TWCJ 1GDTA 3SJMA 4FTHA 4FE4A 1FIAA 4A3DJ 1RR7A 4DZJA 5EYRA 9ANTA 3ZQHA 4I76A 1P7IA 2HDDA 2EZIA 2L7MP 3S14J 3HKZN 3NAUA 3HB9A 2ME6A 4XRMA 3HOYJ 1MNMC 2XPUA 2R7ZJ 3S1QJ 1B72B 2R0QC 2ID3A 2LD5A 1EF4A 1ETQA 4IHYA 2VI6A 1VF9A 3CQZJ 3LSPA 2HOTA 1JTXA 2HQ5A 4A3IJ 5C44J 1X2NA 1OCPA 4BBRJ 5EG0B 4B4CA 3MVPA 3LSRA 2JK3A 4FISA 1AHDP 1MSFC 2CQQA 1TWAJ 2YUSA 1VFCA 5J3LA 4AYBN 2NVQJ 1HLVA 2O7OA 1JJ8C 2M8GX 1IV6A 5IP9J 5F0FA 2O8KA 1FJLA 2XGEA 1POGA 1MBHA 1WH7A 1Z0XA 3B6AA 3GTJJ 3CCYA 4MLOA 1MBGA 5EZGA 1MBEA 2NOGA 2ME0A 2XB5A 1LE8A 2LVSA 2Y31A 4UUTA 3OSGA 2MG4A 1CQTA 1GVDA 2R92J 1UHSA 4NDLA 2L7ZA 5EDNA 3O8HA 3Q3SA 2CUEA 3LSJA 2XPWA 3QPLA 3ZQCA 1SANA 4D7NA 3WHBA 1Q1VA 4LOCA 5K7HA 4UUSA 1ITYA 1HOMA 1WCMJ 2LTPA 3SDGA 3G1LA 4UUSB 2DMUA 1K83J 3BR6A 5F0CA 3IH2A 2B63J 2CJJA 3JRFA 1FIPA 3DEWA 2R5ZA 1U78A 4C3JJ 2K9QA 2DA1A 1OJLA 3FK6A 2EZKA 5EEAA 1ETVA 3QPSA 4A69C 2ECBA 3S2DJ 3W6VA 5M5YJ 5IPAA 3S17J 2DA7A 1G2HA 3HOWJ 5GPAA 4RBOA 1BA5A 1DU6A 3FK7A 4A3MJ 5F27A 2CU7A 1ORKA 2AO9A 4DYCA 2K9SA 1MBJA 3HEFA 1BL0A 4AUXA 1IUFA 5F08A 1NTCA 2FQ4A 4IEJA 1H8AC 2E1OA 4X6AJ 3S1MJ 5IOYA 4GFBA 3Q0WA 1GUUA 2NVXJ 3ZOBA 4D5FA 4XICA 1HF0A 1QVUA 4M3EA 4B1RA 3HBLA 2M34A 3WHCA 3A01A 5J1UA 5E3NA 3HGGA 1Z77A 3O8GA 5IP7J 3FISA 2I10A 1ZR4A 4JP0A 3A01B 3FIWA 4FCYA 1ZGWA 4XK4A 1OCTC 1WPKA 1IDZA 1JGGA 1MBFA 3RKQA 2LFBA 3OIOA 2HXOA 2OPTA 1ETXA 2HI3A 4QSHA 2GLOA 5F1JA 5FKMA 1MSEC 3ZQGA 1SFOJ 4W97A 3IH4A 1RESA 1ZKGA 3UKGA 5F04A 2JA8J 4DYQA 3A03A 2L0KA 3H0GJ 1WGXA 3CDLA 2GBYA 4MFEA 2VKEA 3BR0A 1D5YA 1A5JA 1WI3A 2O9LA 1GV5A 2LKXA 2DA6A 4A3KJ 5C4XJ 2WV1A 1YRNA 2N8GA 2XB0X 4DW6A 2IAIA 3S15J 5J1RA 3ZQLA 3BR5A 4D7MA 1B8IA 3BQYA 5IYCJ 3Q0VA 1XG1A 3I4NJ 2R93J 1F43A 2Y9ZA 5E3LA 2ID6A 3DCFA 4L5EA 4D5CA 2GM4A 1TC3C 1OFCX 2VKVA 1F36A 2FD5A 2DMTA 5M3MJ 1ETOA 4QTRA 2TCTA 1LE8B 2G0EA 4A3LJ 1JTYA 5K7FA 1I3QJ 2WB1N 2HOSA 3GTPJ 3S16J 5FJ8J 2MSYA 3MN2A 2X6OA 4XRSA 2DA5A 3HOXJ 1E3OC 4ABZA 4XIDA 4MO7A 1PUFA 1MH4A 2HYJA 3BR2A 5GP9A 1UMQA 1ETKA 5M5XJ 1H88C 1PUFB 3GTLJ 1A6IA 4IHWA 1TWGJ 1ZK8A 2CRGA 5M5WJ 2Y30A 3M4OJ 2R5YA 1JUMA 3MKLA 3M3YJ 2D5VA 2MW8A 1LFBA 3HDDA 3BTLA 5JLXA 2R5YB 5K7ZA 2R5ZB 2COBA 2IEKA 2K9NA 1BW6A 5M3FJ 3FKIJ 2HXIA 4G12A 1W0TA 2L9RA 2DMNA 5DTDA 1ETWA 4J19A 3TW7A 3HGYA 5FLMJ 3HOVJ 2ZB9A 3BQZA 4I6ZA 2XRLA 5FLVA 3BTJA 1TWHJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA2 A;  3D1N I;  1HDD C;  3BG3 A;  1DU0 A;  4IHV A;  2EZL A;  4FE7 A;  4A3J J;  1U9O A;  2JJ7 A;  3BT9 A;  3OOU A;  4V2F A;  2OF7 A;  2DN0 A;  4C3I J;  4DZP A;  5EF6 A;  2TRT A;  3C2B A;  2CQX A;  3BG5 A;  5GPC A;  1AU7 A;  2L7F P;  3GTG J;  2W48 A;  2DA4 A;  2JMW A;  3H3V K;  2EQR A;  1IC8 A;  1I50 J;  1UG2 A;  2M9H A;  2PMZ N;  3K2A A;  2DMQ A;  1R9T J;  3RZO J;  1ENH A;  4M3B A;  4BBS J;  2YU9 J;  3JR9 A;  2YS9 A;  1QVT A;  5HOD A;  2DMP A;  3ZQF A;  4MFD A;  2P81 A;  3S1R J;  2E2J J;  1FTT A;  1JUP A;  4BXX J;  1Y1V J;  1GT0 C;  1ZTR A;  2ELK A;  5DS9 A;  1P7J A;  1NK2 P;  1RET A;  3E7L A;  4A3F J;  1HCR A;  3GTK J;  4Y7N J;  2AHQ A;  3JRE A;  2LK2 A;  3B6C A;  3QQA A;  1GV2 A;  2JA5 J;  2Y2Z A;  1K61 A;  3JRB A;  4DYR A;  2X48 A;  1IGN A;  3BR1 A;  3NAR A;  1JKO C;  4BY1 J;  2ECC A;  3G1M A;  1XS9 A;  1IRZ A;  2QF7 A;  4JX6 A;  5F0H A;  2MGQ A;  2XGD A;  2VUM J;  1WH5 A;  2NVY J;  3F0C A;  1JUS A;  4M3G A;  1B72 A;  1JKQ C;  2Y0S N;  2H1K A;  2X9D A;  2KDZ A;  2XGC A;  1T33 A;  2E19 A;  3PM1 A;  4JX5 A;  1FEX A;  2IBD A;  2LR8 A;  1QRY A;  4JYK A;  1JJ6 C;  4C3H J;  5IYD J;  1RPW A;  5EG0 A;  2NS7 A;  4M3D A;  5JLW A;  4JX4 A;  1JT0 A;  3L1P A;  3TED A;  1YRN B;  1HDP A;  5FKN A;  2E2I J;  1T56 A;  1IJW C;  4HNV A;  1S7E A;  3GTO J;  2JA7 J;  5FKK A;  1QPI A;  5FKO A;  1B8I B;  3GBG A;  3LNQ A;  3RZD J;  2DTZ A;  3RQI A;  2M0C A;  2RAE A;  1FTZ A;  5IOZ A;  1O4X A;  2FX0 A;  1MH3 A;  4S0H B;  4CYC A;  1BW5 A;  3VPR A;  4IHX A;  2JWT A;  5IYB J;  4CYC B;  1X2M A;  1BJZ A;  4A3B J;  2VPR A;  1RKW A;  4M3F A;  2JA6 J;  4AC0 A;  5C3E J;  3G1O A;  1I6H J;  2XSD C;  3SFI A;  4QIW N;  5EZH A;  2JN6 A;  1AKH A;  5EGO A;  3JRI A;  2CUF A;  2DJN A;  3Q0U A;  4W1U A;  1U8B A;  2NVT J;  3S1N J;  3GTM J;  2EBI A;  1IDY A;  2EH3 A;  3TP0 A;  1AKH B;  5EGO B;  3BG9 A;  1IG7 A;  4C2M J;  1U9N A;  1JT6 A;  3JRH A;  3PO2 J;  3S2H J;  1JKP C;  3LSG A;  4BY7 J;  2XPV A;  3TW6 A;  3JRD A;  4A3E J;  1XC5 A;  2M2E A;  3PO3 J;  2FJ1 A;  1X58 A;  4V2G A;  3JRG A;  1MBK A;  2H8R A;  3TP3 A;  2K40 A;  3JRA A;  3K7A J;  1TWF J;  2LY9 A;  4X1E A;  3LOC A;  3A02 A;  1RKT A;  3BTI A;  3HM5 A;  1JKR C;  2KT0 A;  3HOZ J;  3BR3 A;  4BKX A;  2LLK A;  1Y1W J;  1ZQ3 P;  4MIM A;  4A3C J;  3CMY A;  1W0U A;  2DA3 A;  5C4J J;  1VI0 A;  5FKL A;  4M6V A;  4EEF G;  1APL C;  1NK3 P;  1ZR2 A;  4A93 J;  2WAQ N;  1VND A;  3OSF A;  2EZH A;  1LFU P;  3IV5 A;  5BNG A;  2QCO A;  1ETY A;  4Y52 J;  4B3A A;  3BTC A;  2Y9Y A;  5E3M A;  1H89 C;  2NS8 A;  3ZQI A;  3I4M J;  2HOA A;  5IP6 A;  3HOU J;  5J1Y A;  3IH3 A;  5E3O A;  3JRC A;  2E2H J;  3GTQ J;  4RDU A;  4XRS G;  4A3G J;  2LP0 A;  1TWC J;  1GDT A;  3SJM A;  4FTH A;  4FE4 A;  1FIA A;  4A3D J;  1RR7 A;  4DZJ A;  5EYR A;  9ANT A;  3ZQH A;  4I76 A;  1P7I A;  2HDD A;  2EZI A;  2L7M P;  3S14 J;  3HKZ N;  3NAU A;  3HB9 A;  2ME6 A;  4XRM A;  3HOY J;  1MNM C;  2XPU A;  2R7Z J;  3S1Q J;  1B72 B;  2R0Q C;  2ID3 A;  2LD5 A;  1EF4 A;  1ETQ A;  4IHY A;  2VI6 A;  1VF9 A;  3CQZ J;  3LSP A;  2HOT A;  1JTX A;  2HQ5 A;  4A3I J;  5C44 J;  1X2N A;  1OCP A;  4BBR J;  5EG0 B;  4B4C A;  3MVP A;  3LSR A;  2JK3 A;  4FIS A;  1AHD P;  1MSF C;  2CQQ A;  1TWA J;  2YUS A;  1VFC A;  5J3L A;  4AYB N;  2NVQ J;  1HLV A;  2O7O A;  1JJ8 C;  2M8G X;  1IV6 A;  5IP9 J;  5F0F A;  2O8K A;  1FJL A;  2XGE A;  1POG A;  1MBH A;  1WH7 A;  1Z0X A;  3B6A A;  3GTJ J;  3CCY A;  4MLO A;  1MBG A;  5EZG A;  1MBE A;  2NOG A;  2ME0 A;  2XB5 A;  1LE8 A;  2LVS A;  2Y31 A;  4UUT A;  3OSG A;  2MG4 A;  1CQT A;  1GVD A;  2R92 J;  1UHS A;  4NDL A;  2L7Z A;  5EDN A;  3O8H A;  3Q3S A;  2CUE A;  3LSJ A;  2XPW A;  3QPL A;  3ZQC A;  1SAN A;  4D7N A;  3WHB A;  1Q1V A;  4LOC A;  5K7H A;  4UUS A;  1ITY A;  1HOM A;  1WCM J;  2LTP A;  3SDG A;  3G1L A;  4UUS B;  2DMU A;  1K83 J;  3BR6 A;  5F0C A;  3IH2 A;  2B63 J;  2CJJ A;  3JRF A;  1FIP A;  3DEW A;  2R5Z A;  1U78 A;  4C3J J;  2K9Q A;  2DA1 A;  1OJL A;  3FK6 A;  2EZK A;  5EEA A;  1ETV A;  3QPS A;  4A69 C;  2ECB A;  3S2D J;  3W6V A;  5M5Y J;  5IPA A;  3S17 J;  2DA7 A;  1G2H A;  3HOW J;  5GPA A;  4RBO A;  1BA5 A;  1DU6 A;  3FK7 A;  4A3M J;  5F27 A;  2CU7 A;  1ORK A;  2AO9 A;  4DYC A;  2K9S A;  1MBJ A;  3HEF A;  1BL0 A;  4AUX A;  1IUF A;  5F08 A;  1NTC A;  2FQ4 A;  4IEJ A;  1H8A C;  2E1O A;  4X6A J;  3S1M J;  5IOY A;  4GFB A;  3Q0W A;  1GUU A;  2NVX J;  3ZOB A;  4D5F A;  4XIC A;  1HF0 A;  1QVU A;  4M3E A;  4B1R A;  3HBL A;  2M34 A;  3WHC A;  3A01 A;  5J1U A;  5E3N A;  3HGG A;  1Z77 A;  3O8G A;  5IP7 J;  3FIS A;  2I10 A;  1ZR4 A;  4JP0 A;  3A01 B;  3FIW A;  4FCY A;  1ZGW A;  4XK4 A;  1OCT C;  1WPK A;  1IDZ A;  1JGG A;  1MBF A;  3RKQ A;  2LFB A;  3OIO A;  2HXO A;  2OPT A;  1ETX A;  2HI3 A;  4QSH A;  2GLO A;  5F1J A;  5FKM A;  1MSE C;  3ZQG A;  1SFO J;  4W97 A;  3IH4 A;  1RES A;  1ZKG A;  3UKG A;  5F04 A;  2JA8 J;  4DYQ A;  3A03 A;  2L0K A;  3H0G J;  1WGX A;  3CDL A;  2GBY A;  4MFE A;  2VKE A;  3BR0 A;  1D5Y A;  1A5J A;  1WI3 A;  2O9L A;  1GV5 A;  2LKX A;  2DA6 A;  4A3K J;  5C4X J;  2WV1 A;  1YRN A;  2N8G A;  2XB0 X;  4DW6 A;  2IAI A;  3S15 J;  5J1R A;  3ZQL A;  3BR5 A;  4D7M A;  1B8I A;  3BQY A;  5IYC J;  3Q0V A;  1XG1 A;  3I4N J;  2R93 J;  1F43 A;  2Y9Z A;  5E3L A;  2ID6 A;  3DCF A;  4L5E A;  4D5C A;  2GM4 A;  1TC3 C;  1OFC X;  2VKV A;  1F36 A;  2FD5 A;  2DMT A;  5M3M J;  1ETO A;  4QTR A;  2TCT A;  1LE8 B;  2G0E A;  4A3L J;  1JTY A;  5K7F A;  1I3Q J;  2WB1 N;  2HOS A;  3GTP J;  3S16 J;  5FJ8 J;  2MSY A;  3MN2 A;  2X6O A;  4XRS A;  2DA5 A;  3HOX J;  1E3O C;  4ABZ A;  4XID A;  4MO7 A;  1PUF A;  1MH4 A;  2HYJ A;  3BR2 A;  5GP9 A;  1UMQ A;  1ETK A;  5M5X J;  1H88 C;  1PUF B;  3GTL J;  1A6I A;  4IHW A;  1TWG J;  1ZK8 A;  2CRG A;  5M5W J;  2Y30 A;  3M4O J;  2R5Y A;  1JUM A;  3MKL A;  3M3Y J;  2D5V A;  2MW8 A;  1LFB A;  3HDD A;  3BTL A;  5JLX A;  2R5Y B;  5K7Z A;  2R5Z B;  2COB A;  2IEK A;  2K9N A;  1BW6 A;  5M3F J;  3FKI J;  2HXI A;  4G12 A;  1W0T A;  2L9R A;  2DMN A;  5DTD A;  1ETW A;  4J19 A;  3TW7 A;  3HGY A;  5FLM J;  3HOV J;  2ZB9 A;  3BQZ A;  4I6Z A;  2XRL A;  5FLV A;  3BTJ A;  1TWH J; 
#chains in the Genus database with same CATH topology
 4KJZ A;  3SEQ A;  2ZJ2 A;  5TGT A;  5ILU A;  4IHV A;  2K4J A;  4FE7 A;  3HIF A;  3GXO A;  1U9O A;  1B9N A;  1O3T A;  1YO5 C;  2V9P A;  3H9G A;  4OOI A;  4GGG A;  3LQR A;  2DAO A;  1MGT A;  1KYW A;  3C2B A;  3F8N A;  6PAX A;  3DTE A;  2O61 A;  2HQN A;  4IRI A;  5LEJ A;  4E4H A;  4EGZ A;  2JMW A;  3H3V K;  4F91 B;  1YJW I;  4IKF A;  2Q0O A;  2QKM B;  2ZXJ A;  1QGP A;  3EUH A;  3RZO J;  4XKB A;  4S04 A;  4CGZ A;  3AFH A;  3JR9 A;  2P7V B;  5ICG A;  1QVT A;  5JFR A;  1I5Z A;  1TZL A;  1XMK A;  3ZQF A;  2F48 A;  4A12 A;  4MFD A;  3S1R J;  1QA6 A;  1OMI A;  2E2J J;  1FTT A;  1JUP A;  3TBI A;  1WQ2 A;  2GQQ A;  3N4M A;  5DS9 A;  1P7J A;  1NK2 P;  4A3F J;  3GYH X;  1S72 I;  3E6M A;  3MMY B;  2MA3 A;  3A0B C;  5CQE A;  4RGS A;  3B6C A;  3BG7 A;  1W36 D;  4CDG A;  1SFK A;  3WGI A;  3TOB A;  4IO9 F;  2Y2Z A;  1B4A A;  2PN6 A;  3JRB A;  1OPC A;  4DYR A;  2IPQ X;  1B6A A;  3HHH A;  1SMY F;  4OU0 A;  2BGC A;  1IGN A;  1JKO C;  2L9N A;  4BY1 J;  2EIJ H;  1IV8 A;  2MD5 A;  1UST A;  1XS9 A;  4BJT A;  2QF7 A;  3CP8 A;  1YIO A;  4JX6 A;  5F0H A;  4MEY F;  1WH5 A;  3F0C A;  1JUS A;  4M3G A;  1HKT A;  2H1K A;  3RPU D;  2CS3 A;  1ZG5 A;  1AA7 A;  2L3D A;  4JX5 A;  1FEX A;  4HOB A;  4FHT A;  1HA8 A;  4MTD A;  2IBD A;  1QRY A;  1J0R A;  2VT3 A;  4JYK A;  4A2U A;  5EG0 A;  2WWY A;  5JLW A;  4R8H A;  3TED A;  2EFQ A;  1HDP A;  4IOA F;  1IJW C;  3JSP A;  4DJA A;  1YJN I;  1S7E A;  4CCO A;  1Q1H A;  3CCM I;  3FZV A;  1ON1 A;  2EFO A;  1LJ9 A;  2W85 A;  1X1P A;  3TDZ C;  3RQI A;  4P9F A;  3FMS A;  4RMN A;  3RI4 A;  2H27 A;  3L00 A;  4S0H B;  1E17 A;  4PSX A;  2NVU B;  2E5Z A;  1BW5 A;  3GZ5 A;  3PUB A;  1P6R A;  4CXF A;  3LFU A;  1RUO A;  3I58 A;  4A3B J;  4M3F A;  5D4R A;  3GLX A;  4GXO A;  1ULY A;  2L54 A;  2YR2 A;  3LSI A;  2NAZ A;  4IVN A;  3G1O A;  4NC7 A;  2P5L C;  3ZP5 A;  3FM5 A;  3SFI A;  3KP7 A;  5EZH A;  1R5G A;  1WWX A;  2IS2 A;  5HOO A;  3HZJ A;  2V9K A;  5EGO A;  3Q0U A;  1U8B A;  3RPQ A;  4BH9 A;  1HSJ A;  3K2Z A;  2Z3Y A;  3OYE A;  3OYI A;  5EGO B;  1IG7 A;  2XAH A;  1A35 A;  1VQ6 I;  3OIP A;  3CCS I;  4C30 A;  1FC3 A;  2BW3 B;  4BGD A;  1JT6 A;  1OCO H;  3AG2 H;  3JRH A;  3H5N A;  3WTT C;  3I55 I;  3PO2 J;  1LQ1 A;  3RIR A;  3ZN1 A;  2DOD A;  2A68 F;  2IP2 A;  3P7N A;  3IRR A;  2HZD A;  1XC5 A;  2CMP A;  2M2E A;  4IXA A;  3OYK A;  1P4A A;  3D5S C;  4DBQ A;  1O3R A;  2XF5 A;  3TP3 A;  3OYN A;  2Z9O A;  2K40 A;  1FOY A;  2WBM A;  2BEO A;  2A5W A;  3LST A;  1BI2 A;  1RZ4 A;  2KZG A;  1VQP I;  4A6E A;  1FMW A;  1OIS A;  3QU3 A;  2RNG A;  2NYX A;  3HOZ J;  3FF5 A;  2M4K A;  2LLK A;  2QQ8 A;  2VON A;  1Y1W J;  1D3Y A;  3JTH A;  4MIM A;  3F8M A;  3PFY A;  3JAM Z;  3RTR A;  3IHU A;  1KQ0 A;  4LJZ F;  1SAX A;  4U87 A;  1W0U A;  3OV8 A;  1K78 A;  3OMY A;  3RYP A;  2DFE A;  2XRO A;  4MTE A;  1APL C;  5F6F A;  1IN5 A;  4XOR A;  4A93 J;  2WAQ N;  3G2B A;  3FKJ A;  3OSF A;  2E35 A;  4D0P A;  2R7Q A;  1XGM A;  1GVJ A;  3EUK L;  2DK5 A;  2HWV A;  5BNG A;  3QP5 A;  1I1G A;  2QCO A;  4Y52 J;  2HR3 A;  2VOO A;  3UNG C;  5E3M A;  1H89 C;  3SQN A;  1ZYR F;  1H0M A;  1RI7 A;  3QYB A;  2DYR H;  5CKT A;  1T6S A;  2PMZ A;  3MFK A;  1DGW Y;  4B47 A;  4HQE A;  5E3O A;  4BE1 A;  2JTV A;  4I2O A;  3SJM A;  4XLP F;  4AID A;  2X1E A;  2HGC A;  5TJJ A;  4DZJ A;  3ZQH A;  2LBF A;  4I76 A;  3TO9 A;  4CSW A;  2E34 A;  3HTS B;  1S8N A;  4UV8 A;  1MNM C;  1S3J A;  2XPU A;  2KRF A;  2R0Q C;  2LD5 A;  1UFM A;  3HJE A;  3KYC B;  1QBJ A;  1EF4 A;  2CUZ A;  4OIQ F;  2EA2 A;  1SEU A;  2G7U A;  2HOT A;  2A3S A;  4CCM A;  5K5R A;  3QOP A;  1TLH B;  2QBY A;  3WE3 A;  4B4C A;  2B7E A;  1XTA A;  4RB3 C;  4CO8 A;  3RDI A;  2QBY B;  4MNU A;  1VFC A;  3L2V A;  4CIC A;  1D8J A;  1HLV A;  2EWN A;  3DU6 A;  3GME A;  1IO2 A;  2O8K A;  1POG A;  4RAZ A;  3BCA A;  3KIO A;  1JXS A;  3BC8 A;  5K5Q A;  4XBF A;  1R23 A;  5E8I A;  4RB1 A;  2KMU A;  4HAM A;  5EZG A;  2R7V A;  1UJ8 A;  2M0M A;  1JI8 A;  1MKM A;  1BOB A;  2ME0 A;  3N97 A;  1B59 A;  5J47 A;  1YW8 A;  1CQT A;  3DTI A;  4MHG A;  3H35 A;  4NDL A;  4TV7 A;  2L7Z A;  3O8H A;  2XV4 S;  4B44 A;  4X0G A;  2K27 A;  4XON A;  5EEH A;  3QPL A;  5D4S A;  4D7N A;  4KIB A;  2P8T A;  2K86 A;  4M9Z A;  5K7H A;  3K4M A;  1HOM A;  2R7U A;  2DLL A;  3BZK A;  2HVS A;  2Z5U A;  1P4X A;  4YRV A;  4IRG A;  3RYR A;  5GTH C;  3KP4 A;  1R5H A;  4LG3 A;  4OAY A;  2XF6 A;  2GIZ A;  1BM9 A;  2VC0 A;  3IH2 A;  4RAG A;  4O5V A;  4LFU A;  4ANJ A;  2XF7 A;  3DEW A;  1WHU A;  2KIF A;  1ZLJ A;  2R5Z A;  2FF4 A;  1E2X A;  1KU7 A;  4C3J J;  2K9Q A;  3W2V A;  3M1C A;  2DXI A;  5E1Z B;  1EA3 A;  2EV0 A;  3ASN H;  1QNT A;  2ECB A;  2EB7 A;  3DPU A;  3S2D J;  1V5F A;  4LIV A;  4J00 A;  4BQA A;  2DFI A;  4A0X A;  4XN0 A;  2HDC A;  2PMH A;  4ZDL A;  1T95 A;  4RBO A;  1YLF A;  4PFP A;  1UB9 A;  2V1D A;  3JTG A;  1SFU A;  3BZC A;  5F27 A;  2OD5 A;  4G7H F;  5TRD A;  4LIT A;  3LAP A;  2LRD A;  4CCJ A;  4XMY A;  2K9S A;  1LUJ B;  2L5Q A;  3R0J A;  4AUX A;  4F52 A;  3K70 C;  3VYT B;  3E6D A;  1H8A C;  3TO6 A;  4X6A J;  2MFZ A;  1L0O C;  2NVX J;  2RGV A;  5ED4 A;  3OYG A;  2MC4 A;  4M3E A;  2HYF A;  4B1R A;  4HX8 A;  2D1H A;  2E7X A;  4F92 B;  4IF4 A;  4OAZ A;  2L4M A;  4OIR F;  2V7F A;  4I09 A;  5E3N A;  1TNS A;  4AIK A;  4JP0 A;  1VQL I;  3GEZ A;  2STT A;  3SXY A;  4XK4 A;  1OCT C;  5HNF A;  1JGG A;  2FML A;  2GOX B;  4E7K A;  1GXQ A;  4ZYG A;  1LVK A;  5HNH A;  2OCC H;  2E36 A;  2ZSI B;  4BDY A;  2C6Y A;  2EV5 A;  2VC1 A;  4I01 A;  2Z1D A;  2CV0 A;  4NBQ A;  3W6K B;  2R7F A;  2L4A A;  2X1D A;  3EPZ A;  2MC3 A;  2JA8 J;  2KL4 A;  2VB6 A;  1SD6 A;  1WGX A;  1IRF A;  2M8E A;  4LG0 A;  2O8X A;  4GYG A;  2O9L A;  2LKX A;  2J5P A;  5AIQ A;  3ABM H;  4L9N A;  1T2K A;  5AON A;  1FX7 A;  2CUJ A;  4LG0 B;  2WV1 A;  3KP2 A;  2XB0 X;  4C9Y A;  3ABL H;  2IAI A;  3F8F A;  3S15 J;  4IX7 A;  5J1R A;  5BPI A;  4Z6Y A;  3M07 A;  3BQY A;  1AOY A;  1OR7 C;  1KA8 A;  1XG1 A;  5JHU A;  2L01 A;  3COA C;  2Y9Z A;  5E3L A;  4L0Y B;  2GM4 A;  4AYB A;  1NH3 A;  2FD5 A;  1F4K A;  2QEN A;  3ML6 A;  2GWR A;  3TMO A;  1XMX A;  4YIF A;  2X6W A;  1LE8 B;  5BMZ A;  2G0E A;  4A3L J;  5DV5 A;  1I3Q J;  3BJA A;  3EDP A;  1UEL B;  4RB0 A;  1VQ8 I;  2RDP A;  1O57 A;  5F1R A;  3MWM A;  5CQG A;  4XRS A;  4CYD A;  2NNN A;  3IKV A;  5DUI A;  3NQO A;  4HLY A;  1H9T A;  2HYJ A;  2EIN H;  4YEJ A;  3F6V A;  4B8X A;  5M5X J;  5FLX Z;  3NEU A;  1MMN A;  3CF5 F;  2GA1 A;  3M4O J;  1S29 A;  4E6K G;  3ROU A;  1U2W A;  3WGH A;  1X1C A;  2PLY A;  1LFB A;  3BZ6 A;  1U5T A;  4FET A;  2BVL A;  2W1O A;  5JLX A;  1T8I A;  3M8F A;  2IEK A;  2L9S A;  4LLG F;  2K9N A;  3J7Y J;  1J75 A;  2F6C A;  1TQP A;  5M3F J;  4G12 A;  1KQ9 A;  2L9R A;  4F7Z A;  2AQE A;  2VLA A;  4J19 A;  3TW7 A;  3GFM A;  1Y8R B;  2KZV A;  3TGN A;  3LQQ A;  2D1V A;  3HSF A;  2VL8 A;  5FLV A;  2UUZ A;  2CV2 A;  4BEH A;  2PMU A;  3QOD A;  4XOT A;  4C2T A;  2DA2 A;  4PFO A;  3BG3 A;  1R58 A;  2DYS H;  4A3J J;  4BEH B;  2MYS A;  2JJ7 A;  4LD5 A;  4QWQ A;  3KPH A;  2OF7 A;  3GF2 A;  4HQM A;  2QZ8 A;  3IL2 A;  2TRT A;  3HSR A;  3SDB A;  2B0L A;  1EKE A;  3OYJ A;  2ZO4 A;  3WOD F;  3ZMU A;  4XM3 A;  3KEO A;  1BIA A;  2QSF X;  3L7W A;  5D5W B;  3K2A A;  4OWR B;  2VXZ A;  2EIM H;  1R9T J;  3DKX A;  1ENH A;  2OQR A;  3ZRG A;  3KYL A;  2KKO A;  1MJA A;  2GXA A;  2DMP A;  2Y75 A;  1XMA A;  1DPR A;  2P81 A;  2CW7 A;  1BR4 A;  4II3 A;  4BXX J;  1GT0 C;  4HYE A;  2DFF A;  4PJJ A;  3MZY A;  5DD4 A;  4E7L A;  1UZC A;  4UHT A;  1MIJ A;  4AVZ A;  4Y7N J;  1LKX A;  1I27 A;  2AHQ A;  3JRE A;  1IF1 A;  3FM3 A;  1UAA A;  4U0Y A;  1RC9 A;  2BBY A;  1FBS A;  1GV2 A;  1YS6 A;  5D5V B;  3CD6 I;  3O6B B;  4E7Z A;  4ZDO A;  2ESN A;  1U3E M;  3F23 A;  4RS8 A;  3V8K A;  1REP C;  1ZAO A;  2ECC A;  3G1M A;  3ELK A;  1IRZ A;  2XUB A;  1B72 A;  2Y0S N;  2KDZ A;  1T33 A;  2M30 A;  2E19 A;  3PM1 A;  1EJ9 A;  1W4M A;  2OQG A;  2HPI A;  2IT0 A;  3EYY A;  1LFP A;  2EJR A;  2FUG 2;  1QU3 A;  2LR8 A;  4NQW A;  3QRF F;  4IOC F;  4HF1 A;  2NS7 A;  3H36 A;  3CCL I;  4Q4Z F;  5FKN A;  2E2I J;  4G7Z F;  1MDM B;  1B1B A;  2W7N A;  3CCU I;  4HST A;  2FRH A;  1ZRE A;  2DTZ A;  1X1D A;  2VXD A;  3DPL C;  2RAE A;  5IOZ A;  1PVE A;  4HF2 A;  4EJV A;  1R22 A;  3F72 A;  1MH3 A;  2RQP A;  4CYC A;  4M6Y A;  1CF7 A;  4IHX A;  3H9J A;  2AXL A;  2JWT A;  2V4J C;  4KIS A;  4CYC B;  1BJZ A;  3LSM A;  3HHG A;  1CF7 B;  1BI3 A;  2BHZ A;  1ACI A;  2LYC A;  4G7O F;  4AC0 A;  5C3E J;  2H6B A;  2UXX A;  4PJL A;  1XDS A;  1O7F A;  2RQQ A;  2XSD C;  2QWW A;  5CVI A;  2IS1 A;  1TTY A;  4HV5 A;  1BC8 C;  2BYV E;  5EJC A;  2CUF A;  4UB6 C;  3ECO A;  3D0S A;  5DCM B;  1VQ4 I;  2NVT J;  2H8W A;  3S1N J;  3CC7 I;  2EBI A;  2EH3 A;  3BY6 A;  5HS9 A;  3TOA A;  3X2Q H;  4NUB A;  4C2M J;  4HV6 A;  1G6N A;  2QEX I;  2EV6 A;  3R60 A;  2ISY A;  3KFW X;  3OY9 A;  4BXU A;  4G6T B;  4XQF A;  4EJO A;  1JKP C;  3TW6 A;  2XPV A;  2ZSH B;  1OR7 A;  2X6Y A;  2QA4 I;  2OTJ I;  3F9K A;  4V2G A;  2H8R A;  3JRA A;  4Q5S F;  3E0J B;  5FRO A;  3LSH A;  1EV7 A;  1IN7 A;  1W1W E;  3LOC A;  2ZCW A;  4LGW A;  2O03 A;  2A61 A;  4XRF A;  3ERE D;  2I5U A;  3WTW C;  3VOD A;  2M4G A;  2FOK A;  3HOT A;  4HG2 A;  1TNT A;  3BR3 A;  4BKX A;  3LSK A;  2XKO A;  1ZQ3 P;  2K5C A;  3CMY A;  3CJT B;  4HPQ A;  4IL6 C;  2VQH A;  1VI0 A;  5FRM A;  2ELJ A;  4S05 A;  5KK1 A;  3BDD A;  4A0Z A;  1X4O A;  3IWF A;  1WJB A;  1IN4 A;  3IV5 A;  2A6E F;  3OOP A;  3IWZ A;  1ZGA A;  1WJA A;  4B3A A;  2ISZ A;  1TW2 A;  2NS8 A;  5CVR A;  4I0A A;  5L3E A;  1KYZ A;  3P9K A;  5IT3 A;  1VQ9 I;  2XIG A;  1Z3X A;  4LLL A;  3IH3 A;  1W5T A;  2JRM A;  1IAW A;  1MD0 A;  2E2H J;  4A3G J;  4RDU A;  2LP0 A;  1TWC J;  4ZZL A;  4FTH A;  5L3G A;  3RKX A;  4FE4 A;  5BS6 A;  3UR3 C;  1FLI A;  1FIA A;  1PUE E;  2OCE A;  3DLA A;  5EYR A;  2EPF A;  9ANT A;  1P7I A;  5KVR A;  1RNL A;  1USS A;  3SFZ A;  2L7M P;  1D1B A;  4UNO A;  3HKZ N;  3HC7 A;  3BWG A;  3H1C A;  2DPU A;  4XRM A;  3IAM 2;  4UVC A;  1M1E B;  1ZG1 A;  5LBQ A;  4ESJ A;  2VI6 A;  4YII A;  4IQJ A;  1V55 H;  5KNL A;  4MEX F;  4XLA A;  2CWE A;  3R4K A;  4HNT A;  2HQ5 A;  2ZC2 A;  4A3I J;  3U9G A;  3DFG A;  1OCP A;  3PL8 A;  5EG0 B;  4M9S A;  4PJN A;  3LSR A;  2R7O A;  3HUG A;  3DWL E;  3HPG A;  3K1P A;  3VYR B;  3E6C C;  1FWZ A;  1AHD P;  1R6R A;  2DK8 A;  3HUG B;  5J3L A;  3C1D A;  4G9Y A;  1JJ8 C;  5F0F A;  4BS9 A;  2BVM A;  2X4H A;  5LHI A;  4RA2 A;  5J4V A;  3H3Z A;  1OYI A;  4U0W A;  1J7K A;  2R4G A;  1MBH A;  1WH7 A;  4YG2 F;  1HKQ A;  1A6Q A;  1Z0X A;  3B6A A;  3FXU A;  2DO7 A;  1YX5 A;  1TBX A;  2MLG A;  2CQK A;  2O0Y A;  2VAS A;  2YX4 A;  3CCY A;  3K6G A;  1MBG A;  3KEQ A;  4L9J A;  1B9M A;  1ZRD A;  2R7D A;  2NOG A;  4UV9 A;  2V1U A;  1G8X A;  2EFP A;  4PUS A;  2XB5 A;  1T0F A;  3SYT A;  3GZN B;  3I64 A;  2L7K A;  4Y4R A;  2MG4 A;  2R92 J;  1GVD A;  2LC2 A;  4HEA 2;  3CCV I;  1JE8 A;  2CUE A;  3OS1 A;  1YJ9 I;  3KCC A;  3P9I A;  4KIT B;  2PG4 A;  3BRO A;  1MMS A;  4AWX B;  2E5N A;  3WHB A;  1J9I A;  5B66 C;  1YOV B;  2F5D A;  3W2W A;  1WCM J;  1WJ5 A;  3F8C A;  4LB5 A;  2LDU A;  2IGM A;  3DV8 A;  3CMM A;  3A2K A;  2CO5 A;  3BR6 A;  5F0C A;  2M5W A;  1BN5 A;  3ASO H;  4U7D A;  1ONV A;  3JRF A;  2VJ4 A;  3QYE A;  4NB5 A;  3F8B A;  4LK1 F;  4I98 B;  1PP7 U;  3I9V 2;  2A6H F;  4UB8 C;  2XAS A;  2R7W A;  1LPQ A;  1G3Y A;  2DA1 A;  4XLE A;  5EEG A;  1OJL A;  3FK6 A;  5EEA A;  2VE8 A;  4CA0 A;  5E1X A;  1MW7 A;  3W6V A;  5CVU A;  3FXO A;  5J4Y A;  2L9V A;  3O2P E;  2DCE A;  1Y56 A;  2FE3 A;  2KIM A;  1L3L A;  3OYM A;  5IT9 Z;  3HOW J;  4II2 A;  1BA5 A;  1T98 A;  2CU7 A;  5HDK A;  2DDB A;  2VPL A;  2COM A;  2ETH A;  1ORK A;  2EK5 A;  1K78 B;  1HW2 A;  5F08 A;  1NTC A;  2OA4 A;  1OCZ H;  4IEJ A;  3CUQ A;  2OZU A;  4DIQ A;  3J7A Y;  3ONQ A;  4B3X A;  3WTS C;  3CUQ B;  2ZME A;  3PFI A;  4RGU A;  1TW3 A;  1ERD A;  1XGS A;  2IS4 A;  5LRR A;  1N77 A;  2ZME B;  2DTR A;  3WHC A;  3CC4 I;  1ON2 A;  2OZ6 A;  2IA1 A;  3O8G A;  2K9L A;  3OYL A;  3FIS A;  2P4W A;  3L2U A;  2I10 A;  4D9J A;  1ZR4 A;  2JQ7 A;  3K70 D;  4G8X A;  2GOM A;  3FIW A;  1S6L A;  1ZGW A;  2BY2 A;  2LSO A;  3CCE I;  5GAH J;  2FOW A;  3OIO A;  3I56 I;  2QQB A;  4BYY A;  1DQU A;  4WCG A;  3S32 A;  2LBF B;  1R1V A;  2UZK A;  4CHU A;  1MJB A;  2JVH A;  1D1A A;  3WU1 B;  4D1Q A;  2LOO A;  3NWT A;  1A36 A;  1BJA A;  3LA3 A;  5J8C A;  4IHT A;  2XAJ A;  4WXC A;  4N0B A;  2H94 A;  2HFH A;  2L0K A;  3BPX A;  4WF2 A;  1DDN A;  3H5R A;  3DPT A;  3CDL A;  3DKY A;  2BY1 A;  1FOK A;  2F5V A;  3J81 Z;  3BR0 A;  1A5J A;  2HTS A;  1D0Z A;  1WI3 A;  3CMA I;  2ZJQ F;  1JGS A;  1XX5 A;  2VQC A;  4WX9 A;  3S3N A;  4I7H A;  1U5T C;  4ZZD A;  4EJW A;  3K69 A;  2P6S A;  2K4B A;  1YRN A;  5L3C A;  2N8G A;  3TQN A;  3HOS A;  1KU3 A;  4DW6 A;  5LHH A;  1QZY A;  2OTL I;  3IRQ A;  2FBH A;  1Z05 A;  2G7H A;  4D7M A;  1B8I A;  2JZY A;  4IRH A;  5IYC J;  3Q0V A;  4N9I A;  3I4N J;  1Z21 A;  4CH7 A;  2E71 A;  1I6X A;  1T08 B;  1HKS A;  2LNB A;  2YPR A;  2NNY A;  2EIL H;  4D5C A;  2BXY A;  4EJU A;  2HDW A;  2CG4 A;  1R71 A;  1J2X A;  1Y8Q B;  2DMT A;  1ETO A;  1V5G A;  3E5Q A;  5M3M J;  2F5E A;  3ERM A;  5LD2 C;  2CYY A;  3F6O A;  4QTR A;  2TCT A;  3K4B A;  4PCQ A;  2CW0 F;  2A6T A;  4FX0 A;  3CO6 C;  2HOS A;  2DOA A;  3S16 J;  2FSW A;  4P96 A;  3P5J A;  2GAU A;  3T1B A;  2X6O A;  3CDI A;  4OMZ A;  4ABZ A;  1R4M B;  4MO7 A;  2ZFU A;  3GWZ A;  5D8L B;  1N75 A;  1X3W B;  1P92 A;  1BR1 A;  2G9W A;  5GP9 A;  1UMQ A;  2O3F A;  3A4C A;  4ZYA A;  1I39 A;  4R1H A;  4KMU X;  4AVP A;  1A6I A;  2QUF A;  3KLN A;  3WG9 A;  4IHW A;  3ZMZ A;  4EMS A;  4ZYE A;  2Y30 A;  1RR8 C;  1STZ A;  1FP1 D;  4IHS A;  2MW8 A;  1G59 A;  1WJE A;  3HDD A;  1SMT A;  4B48 A;  3AL0 B;  2GXB A;  1W5S A;  1KON A;  2R5Z B;  2IS6 A;  1OQY A;  3CO7 C;  2KLO A;  3PNV A;  2UXN A;  1W0T A;  2OC6 A;  1S7O A;  5DTD A;  2OU2 A;  3JCU C;  3K1M A;  3DP7 A;  1YFH A;  1D0Y A;  1ZHF A;  5FLM J;  5BQT A;  2WY7 Q;  3BQZ A;  2CQ7 A;  3HOV J;  5DM6 F;  4I6Z A;  1LEB A;  3BTJ A;  3FBN B;  3QOE A;  4KT6 A;  3AG3 H;  4Q48 A;  5IY5 H;  3D1N I;  3KE2 A;  1DU0 A;  2EZL A;  2FBI A;  1D5V A;  3RJP A;  4LK0 F;  3BT9 A;  3OOU A;  4Y13 A;  2CFX A;  1EH8 A;  2DN0 A;  4C3I J;  4DZP A;  2VQG A;  4MGR A;  1QZE A;  1K6Y A;  4FQG A;  4M9X A;  3BG5 A;  1N78 A;  5GPC A;  4PDK A;  1A04 A;  2L7F P;  2W4S A;  3ZMD A;  2W48 A;  3PSF A;  3H9Q A;  4FAS D;  1IC8 A;  1I50 J;  2DI3 A;  1UG2 A;  2EFW A;  2M9H A;  2PMZ N;  5H2F C;  2PX9 A;  2KIU A;  3JSO A;  4BBS J;  3DEE A;  2YU9 J;  2YS9 A;  1R7J A;  3TKY A;  5JR3 A;  2VJ5 A;  3CES A;  1H9G A;  2KP6 A;  1WJD A;  3HXL A;  1QHH D;  5B5E C;  4ZJZ A;  1LB2 A;  1HCR A;  4E7H A;  3E1S A;  2VIX A;  3H5A A;  2LK2 A;  5K5O A;  3FBI B;  4L18 B;  5HLH A;  2QGU A;  2JA5 J;  2ADU A;  2XC7 A;  3FHZ A;  2IRF G;  2X48 A;  2PJR A;  3NAR A;  4XLH A;  1ZH5 A;  5CVJ A;  3OYD A;  2IVM A;  2DFH A;  1KQ8 A;  1BC7 C;  2VN2 A;  2W24 A;  1F5T A;  2VUM J;  2W25 A;  4B09 A;  2R7S A;  2IGN A;  3PIO F;  1JKQ C;  2RKH A;  2X9D A;  4DQ2 A;  3OWT A;  2Q2E A;  2V1N A;  4ZDP A;  1WJC A;  3ABT A;  3K4L A;  3Q9V A;  2EA4 A;  1PJR A;  3MKZ A;  2B9S A;  3HG9 A;  3FXQ A;  4M3D A;  3V7S A;  3VOE A;  3L1P A;  4XLF A;  3MZH A;  2VBX A;  4EAT A;  1QZZ A;  1T56 A;  2JUC A;  1FMV A;  2K9M A;  3PUF A;  5D8K B;  1Y0U A;  2YSR A;  2ZXH A;  4CUG A;  4HNV A;  3GTO J;  2JA7 J;  5FKK A;  1G3S A;  4A6D A;  4EV0 A;  3GBG A;  3BG6 A;  3RZD J;  2Y69 H;  3S8P A;  4EM0 B;  3GUD A;  2M0C A;  2P5V A;  3OS0 A;  5D6F A;  3EQL F;  4XSZ F;  3B02 A;  3IUO A;  3ZMS A;  4E70 A;  4ZH4 F;  1O4X A;  4L9V A;  3K1N A;  1F9N A;  2R7R A;  5JVG F;  2WAF A;  2QSH X;  1UHM A;  4RM2 A;  4R79 A;  1TQI A;  4Y3O A;  3FHN A;  5IYB J;  3GX4 X;  5LGT A;  2P6T A;  3CJR B;  2E1C A;  2E1M B;  1WJF A;  2NXN B;  5HLI A;  3M8E A;  1I6H J;  5JHF A;  2JUG A;  4N9H A;  1WKM A;  3K4K A;  5DYM A;  2OAZ A;  4O3M A;  3JRI A;  5L3D A;  2NS0 A;  3HRM A;  5HLT A;  4A0Y A;  3GTM J;  3CJQ B;  1BBY A;  3F22 A;  1IDY A;  2WB1 A;  3BG9 A;  4I0B A;  2BV6 A;  2F5F A;  5CYV A;  1HQC A;  3QPH A;  1FSE A;  1X3U A;  2HU9 A;  3NWS A;  4E7J A;  2DT5 A;  2KRC A;  1U5T B;  2OJE D;  3DBR B;  3BP8 A;  3OYA A;  2XVC A;  3JRD A;  3TDU C;  5D5U B;  1SD4 A;  1BI0 A;  1RUN A;  1LDJ A;  2E60 A;  3GFJ A;  4BDZ A;  3QWL A;  3AKZ A;  1X1B A;  2FJ1 A;  1X58 A;  4P55 A;  4KA4 A;  5LFA A;  1VQO I;  4BU2 A;  3RKW A;  4ESB A;  4XOP A;  2LY9 A;  4X1E A;  5DEQ A;  3W3C A;  2RRE A;  3V42 A;  3FX3 A;  3A02 A;  1RKT A;  4CZZ A;  3BTI A;  3WE2 A;  3BJ6 A;  2LG4 A;  5KHD A;  1JKR C;  1AWC A;  1DP7 P;  2KT0 A;  1FBQ A;  1UHW A;  3I5U A;  5LLQ A;  4WXH A;  4L0Z B;  3J7A O;  4BQN A;  5CVV A;  3OYH A;  4A3C J;  1NG6 A;  2WV0 A;  5H6R A;  2DA3 A;  5C4J J;  5FKL A;  4M6V A;  1XN7 A;  4EEF G;  1ZR2 A;  2DQR A;  5DM7 F;  3L2W A;  3DBH B;  1PDN C;  3RCO A;  4ZTJ A;  5DUK A;  1LFU P;  3SZG A;  2IA0 A;  2LKS A;  5HDG A;  3VDX A;  3J80 Z;  3BTC A;  1U8R A;  1E3H A;  2QSG X;  5E8G A;  3EYI A;  3AAF A;  5L3F A;  2UV1 A;  4IJA A;  3ZQI A;  1FYM A;  5H20 A;  2V6E A;  2HOA A;  2CV1 A;  1K79 A;  3ECH A;  1R1U A;  4ENM A;  2YU3 A;  1S7A A;  2OV7 A;  5J8F A;  1BR2 A;  3GFL A;  3G4S I;  1T0F C;  3QYF A;  1MJ9 A;  1RR7 A;  3A0H C;  3PQJ A;  5B1A H;  2EZI A;  1MMA A;  3CCQ I;  4EVI A;  2MH2 A;  2R7Z J;  1ZN2 A;  1OYW A;  4KT5 C;  1P9Q C;  3F21 A;  1B72 B;  2ZBK A;  2M7A A;  1FOX A;  2ID3 A;  3HRT A;  3BLY A;  1ETQ A;  4FT8 A;  3CQZ J;  4JQF A;  4CCN A;  2PQ8 A;  4EGY A;  1JTX A;  4E7I A;  5DD8 A;  4NQW B;  5C44 J;  1K4S A;  1J5Y A;  1XDU A;  3IAS 2;  2FU4 A;  2M3A A;  2FBK A;  3HKZ A;  5FLX K;  4FIS A;  4WXD A;  1MSF C;  2YUS A;  1R36 A;  2D45 A;  4AYB N;  2HVQ A;  2NVQ J;  5LEK A;  3LL7 A;  3V8J A;  4ON0 A;  3ZMT A;  2R7T A;  2JPB A;  1FJL A;  2XGE A;  3RKY A;  1D0X A;  1SVM A;  3OYC A;  5CJ9 A;  2HEO A;  3ZQQ A;  4HDU A;  2LMD A;  5LGU A;  4Z2Y A;  1U6G A;  2QQ9 A;  2HKX A;  4MLO A;  4BJ5 C;  4E7S A;  3GTJ J;  3CME I;  1DPU A;  1MBE A;  2Y48 A;  1TP4 A;  1IZ1 A;  3GCM A;  5BPD A;  3H3U A;  3WG7 H;  4UUT A;  3OSG A;  3D5R C;  4NC8 A;  2F4I A;  4PZJ A;  3Q3S A;  3B73 A;  1FNN A;  3LSJ A;  2XPW A;  3DBL B;  4UUV A;  4ZYH A;  3ZQC A;  2KPM A;  3CUQ C;  1ITY A;  3NRV A;  2ACJ A;  3SEZ A;  3M7G A;  3G1L A;  3RSN A;  2ZME C;  2X51 A;  2BY3 A;  5AIP A;  1K83 J;  2LY2 A;  4A5N A;  2LH9 A;  2ZNZ A;  1WRJ A;  1UG0 A;  2ZKZ A;  3GO5 A;  2CJJ A;  5KAF C;  1NHA A;  3A1Y A;  4KIG A;  2K02 A;  4G6Q A;  3O3K A;  1X3Z B;  2JSC A;  1IN6 A;  1FBU A;  1O7L A;  1YG2 A;  1IXR C;  2QQA A;  2WY8 Q;  1K4T A;  1G4D A;  2IJL A;  5FFZ A;  5B3S H;  2EZK A;  3Q9S A;  1ETV A;  3QPS A;  1XD7 A;  5JI6 A;  3PNY A;  2WC2 A;  1I1S A;  3RQ4 A;  2DBB A;  2M1B A;  3FXR A;  3S17 J;  1FZP B;  1G2H A;  2VE9 A;  4KNY A;  2JRT A;  2XAF A;  3FK7 A;  1QQI A;  4Y17 A;  3M1E A;  5L3B A;  3G3Z A;  4LB6 B;  2QYO A;  1RRJ A;  1YIT I;  1BL0 A;  1IUF A;  1MMD A;  2VOD A;  2E1O A;  1WSU A;  1QO0 D;  2VQL A;  3S1M J;  2KIQ A;  3SZP A;  2VBZ A;  1MNE A;  4OIO F;  2R3S A;  3Q0W A;  3GLL A;  1SVO A;  1Y6I A;  4MQ9 F;  3MKW B;  2BZT A;  3FXM A;  3PSI A;  3ZOB A;  1VTN C;  2MD0 A;  1HF0 A;  2PFB A;  1OCC H;  3MCZ A;  1XGO A;  2MH9 A;  1TT5 B;  1FP2 A;  2WAQ A;  1DP3 A;  4XKC A;  1QPM A;  5J1U A;  3GVA A;  1IRG A;  5IP7 J;  1MZB A;  2V79 A;  4FCY A;  3MEX A;  4GDF A;  4IQ4 A;  2ZFW A;  1MBF A;  3RKQ A;  5JVT A;  2LFB A;  4XSX F;  2HXO A;  2OPT A;  1ETX A;  4Y15 A;  2HI3 A;  3FMR A;  1YS7 A;  4QSH A;  1SAU A;  2V6C A;  4M6X A;  3U1K A;  4JK1 X;  5E79 C;  4B43 A;  5LRS A;  2GLO A;  1LVA A;  1MSE C;  3MD2 A;  3VFZ A;  3ZQG A;  4AM3 A;  2GA2 A;  2FNP A;  4BJ6 C;  4YFK F;  4L5J A;  2XAQ A;  3UKG A;  1ZAR A;  4DYQ A;  3ABU A;  4RM3 A;  3ESW B;  3V4G A;  3K9T A;  3IP4 B;  1V54 H;  1LNW A;  4YIR X;  2F5C A;  2VKE A;  3AL0 C;  5FB2 A;  3DEU A;  5A2Q K;  4A3K J;  3TO7 A;  4QPO A;  2J5O A;  1P4W A;  2DU9 A;  1C0W A;  2O6G E;  2DOE A;  3CP2 A;  3CJN A;  2DT7 B;  2DW4 A;  2KJC A;  4U7B A;  3G73 A;  3BR5 A;  3ZQL A;  4A5M A;  2HKO A;  3HL2 A;  3CTA A;  3J7Z I;  4ITV A;  4I99 C;  1FT9 A;  3LA2 A;  3SHF A;  2ID6 A;  2KRH A;  3C2G A;  1UCR A;  3LA7 A;  1VZ0 A;  3DCF A;  2VKD A;  5K1Y A;  4LLN A;  1X1A A;  1TC3 C;  1OFC X;  2VKV A;  1F36 A;  3DLL F;  4HRI A;  3MAJ A;  3VEP A;  3QPT A;  1T39 A;  4RAY A;  3L09 A;  1FSH A;  4AIJ A;  3P9C A;  4UY8 I;  3FXJ A;  2AXT C;  2GIV A;  1R1T A;  4KN7 X;  2X85 A;  3GTP J;  3WGG A;  5D5X B;  4N4O B;  5FJ8 J;  2V26 A;  2TDX A;  2QM3 A;  2E7W A;  1FPQ A;  3U2R A;  3CC2 I;  3OS2 A;  2DA5 A;  1KGS A;  2I8D A;  1XSD A;  1PUF A;  1LDK B;  2JT1 A;  1MH4 A;  4RLQ A;  3GZ6 A;  3PIP F;  1YIJ I;  3C2H A;  4HW0 A;  1GXP A;  1ETK A;  2RV8 A;  3DTK A;  1PUF B;  3S2W A;  4ENN A;  2D2W A;  3TL4 X;  5M5W J;  3E97 A;  4QPQ A;  2BW3 A;  4I02 A;  2IXS A;  3M3Y J;  2D5V A;  4NHJ A;  4XKW A;  1LEA A;  3EUA A;  5LGN A;  2COB A;  3ULQ B;  3KYD B;  1BW6 A;  4BHB A;  3CLO A;  1Z3Y A;  4QLC U;  3CCR I;  1Y39 A;  4H4K C;  1ZLK A;  2ZB9 A;  2XRL A;  2AO9 A;  4BAC A;  3I71 A;  1VQ5 I;  1HDD C;  1OYY A;  1Y0N A;  2CFO A;  1FYK A;  4LIU A;  3T0Y A;  4UXN A;  2PBI A;  3PNT A;  1Z9C A;  3VB2 A;  1O3S A;  1VQM I;  2PJP A;  4V2F A;  2LF8 A;  3G71 I;  2XRN A;  3U1D A;  5EF6 A;  2NOJ B;  3KEY A;  1S9H A;  2CQX A;  1AU7 A;  3I0T A;  3GTG J;  2XHK A;  4UVB A;  4YFX F;  2DA4 A;  2EQR A;  3OL4 A;  2WTE A;  1W36 C;  2A07 F;  4WK8 F;  1K7A A;  2DMQ A;  4RB2 C;  3VWB A;  1ZRF A;  4M3B A;  3K4N A;  2JSP A;  3VYS B;  4GYI A;  5HOD A;  2AS5 F;  3E3V A;  3CDH A;  2HPM A;  1Y1V J;  1ZTR A;  2ELK A;  3C18 A;  1BIB A;  1RET A;  3E7L A;  3GTK J;  4L5I A;  4HF0 A;  4KFC A;  4ZC3 A;  2Z99 A;  1XSX A;  2E1M C;  3VSK A;  2A05 A;  3QQA A;  1YX3 A;  1Z7L A;  4Q47 A;  1SD5 A;  2P0W A;  3BCB A;  1K61 A;  5E17 F;  4NC6 A;  2Q8K A;  5GAG J;  2WA0 A;  3BR1 A;  1IUY A;  2GZW A;  4ENJ A;  5B1B H;  2JPC A;  3VYU B;  5ERI A;  2MGQ A;  1XGN A;  2XGD A;  2NVY J;  4YFN F;  3WU0 A;  2KIS A;  1PYV A;  2MBF A;  1Z6R A;  2JA2 A;  3DU5 A;  2XGC A;  3HRU A;  1K6O A;  4AU7 A;  4BXF A;  2Z33 A;  1TL8 A;  3N05 A;  5D6E A;  4GCV A;  2ZXI A;  2VKH A;  1JJ6 C;  4C3H J;  3BPV A;  4RLF A;  4XLC A;  5IYD J;  2Q1Z B;  1RPW A;  1CGP A;  2V1X A;  2QKL B;  4JX4 A;  4ENK A;  1JT0 A;  1YRN B;  1XCB A;  1WVR A;  1LDD A;  5HS8 A;  3KET A;  4DGW B;  1R49 A;  1QPI A;  1YQA A;  4ESF A;  5FKO A;  1B8I B;  3V8L A;  3LNQ A;  3S3O A;  5GAD J;  1FTZ A;  3MKY B;  5H6Q A;  3T8T A;  2FX0 A;  2BXZ A;  2BOL A;  2X1C A;  3WTX C;  2HNH A;  2ZJP F;  4M74 A;  3V7C A;  2HZT A;  3VPR A;  1OCR H;  3JW4 A;  3CZ6 A;  1SFE A;  2DPD A;  1X2M A;  2VPR A;  4P5O A;  1RKW A;  1SD7 A;  2RVC A;  3HPH A;  3K4C A;  2JA6 J;  3WTZ A;  2WAE A;  3ZN0 A;  1J09 A;  2HYG D;  2W00 A;  4XLN F;  4PSW A;  4QIW N;  4BE2 A;  4EJT A;  1ZGJ A;  1Z1D A;  5FGM A;  2QLZ A;  2JN6 A;  3GFI A;  2XDV A;  3JAM K;  1ZEL A;  1AKH A;  5IT9 K;  2DJN A;  3ZR8 X;  4W1U A;  4KUM A;  2M87 A;  2KHM A;  3TP0 A;  1AKH B;  1U9N A;  2XGX A;  1EH6 A;  2OUM A;  3WTY C;  2V9V A;  3FDY A;  3OR2 C;  1ZRC A;  3LWF A;  4L9T A;  3S2H J;  4HDV A;  2ZNY A;  2HQA A;  3HSE A;  3LSG A;  1KU2 A;  4BY7 J;  3SZT A;  4A3E J;  2FEZ A;  2K3P A;  1JHF A;  3EET A;  1IN8 A;  3KX2 A;  3MQ0 A;  4O6J A;  5J6X A;  2FA5 A;  1Z91 A;  2WAD A;  3PO3 J;  2HS5 A;  1MBK A;  2W57 A;  3JRG A;  3LMM A;  4H0E A;  5FO5 A;  3I54 A;  3K7A J;  3Q5F A;  1JHH A;  1TWF J;  4RGX A;  2H09 A;  3E5X A;  4BHP A;  1W7P A;  2PEX A;  1PP8 F;  2PI0 A;  1WI9 A;  1ZG3 A;  1NG7 A;  2GXG A;  1YTY A;  4PJM A;  1W7P B;  3I3L A;  4F93 B;  4KDP A;  1HW5 A;  3HM5 A;  3QAH A;  2X0L A;  4BE0 A;  2FNA A;  1FYL A;  2XAU A;  4CZC A;  1S5L C;  1E0E A;  3G6E I;  3W6J B;  4RAF A;  2MAB A;  3KZZ A;  1VQN I;  5HLG A;  2DOF A;  1R4N B;  2IGK A;  3BJO A;  2ZJR F;  2CGP A;  2UWM A;  4HBL A;  4JOM A;  1NK3 P;  2CSO A;  5ILS A;  2STW A;  1VND A;  3C3W A;  2VOP A;  2L02 A;  2EZH A;  3K10 A;  4V19 K;  2A69 F;  3J81 K;  1RIO H;  2E1N A;  1Z6T A;  1ETY A;  2FQ3 A;  5FD6 A;  2K3F A;  2VBY A;  2Y9Y A;  2BHY A;  4KIC A;  5E18 F;  3ABK H;  4G6D A;  3WTV C;  2JVG A;  4NNJ A;  5E1W A;  2ZXW H;  3I4M J;  4EM2 A;  3KLO A;  2CH0 A;  4HSR A;  2FMY A;  2Y0M A;  5IP6 A;  1XSV A;  2LF7 A;  4F3Q A;  5J1Y A;  3HOU J;  4U88 A;  1U0J A;  2ICW G;  3JRC A;  3ZCO A;  3GTQ J;  4U0V A;  4XRS G;  1WFX A;  1GDT A;  3DF8 A;  4IPA A;  4EM1 A;  1SVL A;  2KDO A;  2F2E A;  4A3D J;  3CCJ I;  3WTU C;  2PJR B;  2HDD A;  1EH7 A;  3S14 J;  3KP5 A;  2LRE A;  3HB9 A;  3NAU A;  4RGR A;  2ME6 A;  1N25 A;  3HOY J;  3S1Q J;  4YEL A;  2BE5 F;  3PQK A;  2IW5 A;  2ELH A;  2Q2E B;  1HW1 A;  4IHY A;  1VF9 A;  1OLT A;  3LSP A;  3V7R A;  1MMG A;  1X2N A;  5LHG A;  1YE9 A;  4BBR J;  3M9A A;  3MVP A;  4IZZ A;  3CUO A;  3REO A;  2JK3 A;  2Y0S A;  4HX4 A;  2P7C B;  4HNU A;  2CQQ A;  1TWA J;  4J01 A;  3T5X A;  2H6C A;  3I4P A;  2O7O A;  2M8G X;  1ODD A;  1IV6 A;  5IP9 J;  4G94 A;  5CLS A;  3ZPL A;  1MND A;  3RPU A;  1V4R A;  4K2E A;  2KJB A;  3S3M A;  2QVO A;  4HA8 A;  5HVQ C;  2W84 A;  1IRX A;  2RC4 A;  2FXA A;  3I59 A;  4GRI A;  4EQQ A;  1LE8 A;  4ETS A;  1O3Q A;  2LVS A;  2Y31 A;  2IGO A;  1XB4 A;  3I59 B;  2HQR A;  1UHS A;  3H0D A;  5EDN A;  4ZYD A;  3IC7 A;  3IKT A;  1SAN A;  2ESH A;  1Q1V A;  1TT0 A;  3F3X A;  4LOC A;  4BL0 B;  4UUS A;  2AQF A;  3LAJ A;  3ISP A;  5DCF A;  2LTP A;  1DUX C;  2VBW A;  3SDG A;  3FMQ A;  5HDN A;  1BOA A;  4UUS B;  2DMU A;  3KP6 A;  4OMY A;  5CPR B;  1IXC A;  3EUH C;  3R6S A;  2DJI A;  2B63 J;  1Z7U A;  2VJJ A;  4M72 A;  1FIP A;  2NRA C;  3AG1 H;  3L2C A;  1T38 A;  4CCL A;  4C2U A;  2RNJ A;  4ASN A;  1U78 A;  1X19 A;  2W82 A;  3R0A A;  2K7L A;  4KN4 X;  1HBX G;  2EFN A;  1KU9 A;  5FRN A;  3HRS A;  2L2O A;  1TQM A;  2MLK A;  3ZGK A;  1IXS B;  3ZMV A;  4A69 C;  5FFX A;  2M7B A;  1V3F A;  5M5Y J;  5IPA A;  3KZI C;  1J59 A;  2DA7 A;  5HS7 A;  4PGG A;  4JBA A;  4OIP F;  5GPA A;  5ICE A;  3W2A A;  1DU6 A;  4HX7 A;  2XAG A;  1HST A;  3HYI A;  3LFK A;  4A3M J;  1YI2 I;  4LMY A;  3WU2 C;  2XKP A;  3OYB A;  2M45 A;  4FX4 A;  2YX7 A;  2R7X A;  1OKR A;  3K0L A;  4DYC A;  1MBJ A;  4XL9 A;  1P2F A;  3HEF A;  1G3W A;  3H92 A;  2KQR A;  1V5E A;  4WWC A;  2FQ4 A;  3OIQ A;  5IOY A;  1DGR M;  4GFB A;  2HOE A;  1IW7 F;  1GUU A;  1I3A A;  5KCM A;  5TIS C;  4XN3 A;  4XNF A;  2Z16 A;  1SFX A;  2HVR A;  4D5F A;  4XIC A;  1QVU A;  2O5R A;  4F55 A;  2IA2 A;  3HBL A;  2M34 A;  2P5K A;  3A01 A;  1R00 A;  4AD9 A;  1XCV A;  1YW9 A;  3HGG A;  1D1C A;  1Z77 A;  5BOX A;  3DQV C;  3AG4 H;  4CCK A;  3D5L A;  4BQQ A;  3HTU A;  1E3P A;  3A01 B;  2LKP A;  4P1W A;  3L9F A;  1IDZ A;  1WPK A;  1D8K A;  1QHG A;  3U21 A;  1SC7 A;  2A5Y B;  5ICF A;  5F1J A;  5FKM A;  3FWE A;  3GW2 A;  4MQV A;  1HXD A;  3E6B A;  4KMF A;  3FXL A;  4UVA A;  1SFO J;  4W97 A;  3IH4 A;  1RES A;  1ZKG A;  1VQ7 I;  4DNC A;  2KFD A;  3DXJ F;  5F04 A;  3A03 A;  4GO1 A;  4M71 A;  3H0G J;  3BOQ A;  2CQN A;  3CLQ A;  2DDA A;  2GBY A;  4MFE A;  1D5Y A;  4DBR A;  2LY1 A;  1GV5 A;  2DA6 A;  3OL3 A;  2OBP A;  5C4X J;  2DT6 A;  1F1Z A;  3ZQ7 A;  4ZTF A;  1XPX A;  3PJR A;  2HTJ A;  4M73 A;  1KZH A;  5GTI C;  5ICC A;  3ZXS A;  2CW8 A;  1VQK I;  1MDM A;  2BY0 A;  3L2Q A;  3I53 A;  1G3T A;  4BNC A;  3VSL A;  2F4O B;  4P9U A;  4HLX A;  2R93 J;  1F43 A;  1Z67 A;  3K4J A;  1YHQ I;  5ILV A;  4L5E A;  1X4P A;  4PGH A;  4KIF A;  3E5U A;  1W5C C;  1WZ2 A;  1HC8 A;  1JTY A;  4BHC A;  5K7F A;  2WB1 N;  1BI1 A;  3QP6 A;  3KZY A;  4XKV A;  2MSY A;  2DQL A;  3CF2 A;  3MN2 A;  3T8R A;  3HOX J;  4AIH A;  1E3O C;  4XR6 A;  3KP3 A;  4XID A;  2XSJ C;  3FXK A;  5DCM A;  2VT2 A;  5J40 A;  1GLN A;  3BR2 A;  5GAE J;  1A31 A;  1H88 C;  5E20 A;  1W7P D;  3GTL J;  4PK4 A;  4BUP A;  1R5I D;  1TWG J;  1ZK8 A;  2CRG A;  5A2Q Z;  3QU6 A;  2F4M B;  4DOZ A;  3S93 A;  3DKW A;  2Z2S B;  4KYW A;  4BAY A;  1JUM A;  3MKL A;  5F64 A;  2R5Y A;  1FY7 A;  3BTL A;  3C7J A;  2VJI A;  5KAI C;  2X6X A;  4OIN F;  3OR1 C;  2R5Y B;  5K7Z A;  3J80 K;  4PJ0 C;  1GHC A;  5DDG A;  3FKI J;  2HXI A;  4HZF A;  3MZ8 A;  4N4N B;  2DMN A;  3R61 A;  1ETW A;  2EIK H;  1YW7 A;  3M8J A;  4BQO A;  5FD5 A;  3OYF A;  3HGY A;  4Y33 A;  3L2R A;  2K85 A;  1YYV A;  1FOW A;  2RN7 A;  2H1L A;  1TWH J; 
#chains in the Genus database with same CATH homology
 2DA2 A;  3D1N I;  1HDD C;  3BG3 A;  1DU0 A;  4IHV A;  2EZL A;  4FE7 A;  4A3J J;  1U9O A;  2JJ7 A;  3BT9 A;  3OOU A;  4V2F A;  2OF7 A;  2DN0 A;  4C3I J;  4DZP A;  5EF6 A;  2TRT A;  3C2B A;  2CQX A;  3BG5 A;  5GPC A;  1AU7 A;  2L7F P;  3GTG J;  2W48 A;  2DA4 A;  2JMW A;  3H3V K;  2EQR A;  1IC8 A;  1I50 J;  1UG2 A;  2M9H A;  2PMZ N;  3K2A A;  2DMQ A;  1R9T J;  3RZO J;  1ENH A;  4M3B A;  4BBS J;  2YU9 J;  3JR9 A;  2YS9 A;  1QVT A;  5HOD A;  2DMP A;  3ZQF A;  4MFD A;  2P81 A;  3S1R J;  2E2J J;  1FTT A;  1JUP A;  4BXX J;  1Y1V J;  1GT0 C;  1ZTR A;  2ELK A;  5DS9 A;  1P7J A;  1NK2 P;  1RET A;  3E7L A;  4A3F J;  1HCR A;  3GTK J;  4Y7N J;  2AHQ A;  3JRE A;  2LK2 A;  3B6C A;  3QQA A;  1GV2 A;  2JA5 J;  2Y2Z A;  1K61 A;  3JRB A;  4DYR A;  2X48 A;  1IGN A;  3BR1 A;  3NAR A;  1JKO C;  4BY1 J;  2ECC A;  3G1M A;  1XS9 A;  1IRZ A;  2QF7 A;  4JX6 A;  5F0H A;  2MGQ A;  2XGD A;  2VUM J;  1WH5 A;  2NVY J;  3F0C A;  1JUS A;  4M3G A;  1B72 A;  1JKQ C;  2Y0S N;  2H1K A;  2X9D A;  2KDZ A;  2XGC A;  1T33 A;  2E19 A;  3PM1 A;  4JX5 A;  1FEX A;  2IBD A;  2LR8 A;  1QRY A;  4JYK A;  1JJ6 C;  4C3H J;  5IYD J;  1RPW A;  5EG0 A;  2NS7 A;  4M3D A;  5JLW A;  4JX4 A;  1JT0 A;  3L1P A;  3TED A;  1YRN B;  1HDP A;  5FKN A;  2E2I J;  1T56 A;  1IJW C;  4HNV A;  1S7E A;  3GTO J;  2JA7 J;  5FKK A;  1QPI A;  5FKO A;  1B8I B;  3GBG A;  3LNQ A;  3RZD J;  2DTZ A;  3RQI A;  2M0C A;  2RAE A;  1FTZ A;  5IOZ A;  1O4X A;  2FX0 A;  1MH3 A;  4S0H B;  4CYC A;  1BW5 A;  3VPR A;  4IHX A;  2JWT A;  5IYB J;  4CYC B;  1X2M A;  1BJZ A;  4A3B J;  2VPR A;  1RKW A;  4M3F A;  2JA6 J;  4AC0 A;  5C3E J;  3G1O A;  1I6H J;  2XSD C;  3SFI A;  4QIW N;  5EZH A;  2JN6 A;  1AKH A;  5EGO A;  3JRI A;  2CUF A;  2DJN A;  3Q0U A;  4W1U A;  1U8B A;  2NVT J;  3S1N J;  3GTM J;  2EBI A;  1IDY A;  2EH3 A;  3TP0 A;  1AKH B;  5EGO B;  3BG9 A;  1IG7 A;  4C2M J;  1U9N A;  1JT6 A;  3JRH A;  3PO2 J;  3S2H J;  1JKP C;  3LSG A;  4BY7 J;  2XPV A;  3TW6 A;  3JRD A;  4A3E J;  1XC5 A;  2M2E A;  3PO3 J;  2FJ1 A;  1X58 A;  4V2G A;  3JRG A;  1MBK A;  2H8R A;  3TP3 A;  2K40 A;  3JRA A;  3K7A J;  1TWF J;  2LY9 A;  4X1E A;  3LOC A;  3A02 A;  1RKT A;  3BTI A;  3HM5 A;  1JKR C;  2KT0 A;  3HOZ J;  3BR3 A;  4BKX A;  2LLK A;  1Y1W J;  1ZQ3 P;  4MIM A;  4A3C J;  3CMY A;  1W0U A;  2DA3 A;  5C4J J;  1VI0 A;  5FKL A;  4M6V A;  4EEF G;  1APL C;  1NK3 P;  1ZR2 A;  4A93 J;  2WAQ N;  1VND A;  3OSF A;  2EZH A;  1LFU P;  3IV5 A;  5BNG A;  2QCO A;  1ETY A;  4Y52 J;  4B3A A;  3BTC A;  2Y9Y A;  5E3M A;  1H89 C;  2NS8 A;  3ZQI A;  3I4M J;  2HOA A;  5IP6 A;  3HOU J;  5J1Y A;  3IH3 A;  5E3O A;  3JRC A;  2E2H J;  3GTQ J;  4RDU A;  4XRS G;  4A3G J;  2LP0 A;  1TWC J;  1GDT A;  3SJM A;  4FTH A;  4FE4 A;  1FIA A;  4A3D J;  1RR7 A;  4DZJ A;  5EYR A;  9ANT A;  3ZQH A;  4I76 A;  1P7I A;  2HDD A;  2EZI A;  2L7M P;  3S14 J;  3HKZ N;  3NAU A;  3HB9 A;  2ME6 A;  4XRM A;  3HOY J;  1MNM C;  2XPU A;  2R7Z J;  3S1Q J;  1B72 B;  2R0Q C;  2ID3 A;  2LD5 A;  1EF4 A;  1ETQ A;  4IHY A;  2VI6 A;  1VF9 A;  3CQZ J;  3LSP A;  2HOT A;  1JTX A;  2HQ5 A;  4A3I J;  5C44 J;  1X2N A;  1OCP A;  4BBR J;  5EG0 B;  4B4C A;  3MVP A;  3LSR A;  2JK3 A;  4FIS A;  1AHD P;  1MSF C;  2CQQ A;  1TWA J;  2YUS A;  1VFC A;  5J3L A;  4AYB N;  2NVQ J;  1HLV A;  2O7O A;  1JJ8 C;  2M8G X;  1IV6 A;  5IP9 J;  5F0F A;  2O8K A;  1FJL A;  2XGE A;  1POG A;  1MBH A;  1WH7 A;  1Z0X A;  3B6A A;  3GTJ J;  3CCY A;  4MLO A;  1MBG A;  5EZG A;  1MBE A;  2NOG A;  2ME0 A;  2XB5 A;  1LE8 A;  2LVS A;  2Y31 A;  4UUT A;  3OSG A;  2MG4 A;  1CQT A;  1GVD A;  2R92 J;  1UHS A;  4NDL A;  2L7Z A;  5EDN A;  3O8H A;  3Q3S A;  2CUE A;  3LSJ A;  2XPW A;  3QPL A;  3ZQC A;  1SAN A;  4D7N A;  3WHB A;  1Q1V A;  4LOC A;  5K7H A;  4UUS A;  1ITY A;  1HOM A;  1WCM J;  2LTP A;  3SDG A;  3G1L A;  4UUS B;  2DMU A;  1K83 J;  3BR6 A;  5F0C A;  3IH2 A;  2B63 J;  2CJJ A;  3JRF A;  1FIP A;  3DEW A;  2R5Z A;  1U78 A;  4C3J J;  2K9Q A;  2DA1 A;  1OJL A;  3FK6 A;  2EZK A;  5EEA A;  1ETV A;  3QPS A;  4A69 C;  2ECB A;  3S2D J;  3W6V A;  5M5Y J;  5IPA A;  3S17 J;  2DA7 A;  1G2H A;  3HOW J;  5GPA A;  4RBO A;  1BA5 A;  1DU6 A;  3FK7 A;  4A3M J;  5F27 A;  2CU7 A;  1ORK A;  2AO9 A;  4DYC A;  2K9S A;  1MBJ A;  3HEF A;  1BL0 A;  4AUX A;  1IUF A;  5F08 A;  1NTC A;  2FQ4 A;  4IEJ A;  1H8A C;  2E1O A;  4X6A J;  3S1M J;  5IOY A;  4GFB A;  3Q0W A;  1GUU A;  2NVX J;  3ZOB A;  4D5F A;  4XIC A;  1HF0 A;  1QVU A;  4M3E A;  4B1R A;  3HBL A;  2M34 A;  3WHC A;  3A01 A;  5J1U A;  5E3N A;  3HGG A;  1Z77 A;  3O8G A;  5IP7 J;  3FIS A;  2I10 A;  1ZR4 A;  4JP0 A;  3A01 B;  3FIW A;  4FCY A;  1ZGW A;  4XK4 A;  1OCT C;  1WPK A;  1IDZ A;  1JGG A;  1MBF A;  3RKQ A;  2LFB A;  3OIO A;  2HXO A;  2OPT A;  1ETX A;  2HI3 A;  4QSH A;  2GLO A;  5F1J A;  5FKM A;  1MSE C;  3ZQG A;  1SFO J;  4W97 A;  3IH4 A;  1RES A;  1ZKG A;  3UKG A;  5F04 A;  2JA8 J;  4DYQ A;  3A03 A;  2L0K A;  3H0G J;  1WGX A;  3CDL A;  2GBY A;  4MFE A;  2VKE A;  3BR0 A;  1D5Y A;  1A5J A;  1WI3 A;  2O9L A;  1GV5 A;  2LKX A;  2DA6 A;  4A3K J;  5C4X J;  2WV1 A;  1YRN A;  2N8G A;  2XB0 X;  4DW6 A;  2IAI A;  3S15 J;  5J1R A;  3ZQL A;  3BR5 A;  4D7M A;  1B8I A;  3BQY A;  5IYC J;  3Q0V A;  1XG1 A;  3I4N J;  2R93 J;  1F43 A;  2Y9Z A;  5E3L A;  2ID6 A;  3DCF A;  4L5E A;  4D5C A;  2GM4 A;  1TC3 C;  1OFC X;  2VKV A;  1F36 A;  2FD5 A;  2DMT A;  5M3M J;  1ETO A;  4QTR A;  2TCT A;  1LE8 B;  2G0E A;  4A3L J;  1JTY A;  5K7F A;  1I3Q J;  2WB1 N;  2HOS A;  3GTP J;  3S16 J;  5FJ8 J;  2MSY A;  3MN2 A;  2X6O A;  4XRS A;  2DA5 A;  3HOX J;  1E3O C;  4ABZ A;  4XID A;  4MO7 A;  1PUF A;  1MH4 A;  2HYJ A;  3BR2 A;  5GP9 A;  1UMQ A;  1ETK A;  5M5X J;  1H88 C;  1PUF B;  3GTL J;  1A6I A;  4IHW A;  1TWG J;  1ZK8 A;  2CRG A;  5M5W J;  2Y30 A;  3M4O J;  2R5Y A;  1JUM A;  3MKL A;  3M3Y J;  2D5V A;  2MW8 A;  1LFB A;  3HDD A;  3BTL A;  5JLX A;  2R5Y B;  5K7Z A;  2R5Z B;  2COB A;  2IEK A;  2K9N A;  1BW6 A;  5M3F J;  3FKI J;  2HXI A;  4G12 A;  1W0T A;  2L9R A;  2DMN A;  5DTD A;  1ETW A;  4J19 A;  3TW7 A;  3HGY A;  5FLM J;  3HOV J;  2ZB9 A;  3BQZ A;  4I6Z A;  2XRL A;  5FLV A;  3BTJ A;  1TWH J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...