1IDYA

Structure of myb transforming protein, nmr, minimized average structure
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
54
structure length
54
Chain Sequence
MEVKKTSWTEEEDRILYQAHKRLGNRWAEIAKLLPGRTDNAIKNHWNSTMRRKV
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords MOUSE C-MYB DNA-BINDING DOMAIN REPEAT 3
publication title A small engineered protein lacks structural uniqueness by increasing the side-chain conformational entropy.
pubmed doi rcsb
source organism Mus musculus
molecule tags Dna binding protein
total genus 12
structure length 54
sequence length 54
ec nomenclature
pdb deposition date 1996-08-15

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1idyA00
3OOUA 1FIPA 5J3LA 3VPRA 4A3JJ 5M3FJ 1H88C 1ETXA 2O9LA 4UUSA 1LFBA 2RAEA 2CQQA 2DA4A 4UUSB 1VFCA 1ZR2A 1ZK8A 4BBSJ 4M6VA 3GTPJ 4XICA 2DA5A 3ZQLA 1LFUP 2HXOA 1W0UA 3BQZA 2LTPA 3Q0WA 4XRMA 4C3HJ 2DA6A 1H8AC 2HOSA 1A5JA 1GUUA 3HB9A 2IAIA 2NVQJ 3SDGA 2JA8J 2YU9J 2HOTA 4FTHA 5IOZA 1POGA 2DN0A 3OIOA 5EZHA 1IC8A 1EF4A 1JTYA 3JRDA 2DMNA 4W1UA 1H89C 2G0EA 3PO3J 4MFEA 1Q1VA 2M9HA 2LK2A 1HDPA 3I4NJ 4V2GA 4D5CA 3LSJA 4I6ZA 1RESA 3NAUA 1S7EA 3FIWA 4DZPA 1E3OC 3S1QJ 3HGYA 1HLVA 3LSRA 1ZKGA 1ETYA 2ECCA 2L7MP 4A3MJ 1JUPA 3Q0UA 3OSGA 3IV5A 3S2DJ 1RKWA 2ECBA 3CCYA 1UG2A 3I4MJ 4FE4A 5F1JA 1AHDP 2DMTA 2TRTA 5EGOA 2EH3A 3CDLA 5EGOB 3GTOJ 2XPWA 2FX0A 4V2FA 1XG1A 2R0QC 5EF6A 2YUSA 2XPUA 3HOZJ 2JMWA 3S15J 2MSYA 4A3LJ 2COBA 3GTQJ 4XRSG 1FIAA 3MN2A 3W6VA 2OPTA 5JLWA 5EZGA 2PMZN 4BBRJ 4C3JJ 4NDLA 3ZQIA 5FKMA 2R5YA 1UHSA 2R5YB 1RKTA 2ME6A 1RETA 3PM1A 3LOCA 4A3KJ 3JRBA 5HODA 2DA7A 2XB0X 3HOWJ 4DYRA 4W97A 2AHQA 3QPSA 4RDUA 1ZQ3P 1W0TA 1OFCX 2CJJA 4A3DJ 3BG9A 4A3BJ 3BR2A 4XRSA 2R7ZJ 4S0HB 3K2AA 2LKXA 3HDDA 2HOAA 3A02A 3RQIA 1DU6A 4L5EA 1HDDC 2L0KA 1TWFJ 1P7JA 2ID6A 4A3CJ 5C44J 4AUXA 2Y31A 1OCTC 3BR6A 1IRZA 2I10A 4FE7A 1YRNA 5EDNA 4QTRA 1RPWA 2DJNA 3BTIA 2HQ5A 2JA5J 4C2MJ 2E2JJ 5IYDJ 1IJWC 5FKNA 1WPKA 2CUEA 2CU7A 3H3VK 5GPAA 4M3GA 1T56A 5E3NA 1BJZA 1ZGWA 1JT0A 4UUTA 3K7AJ 4AC0A 1QRYA 2GBYA 1QVUA 3UKGA 1T33A 4X6AJ 2MW8A 2DTZA 5DS9A 2NVXJ 1BL0A 4D7NA 1QPIA 2E2IJ 1D5YA 5M3MJ 1IGNA 1ZTRA 3B6AA 2JWTA 1U9OA 3F0CA 4ABZA 3GTMJ 2E2HJ 3FKIJ 3BQYA 2FJ1A 2HI3A 5C4JJ 1IG7A 2M34A 4DYCA 2LD5A 2EZIA 2AO9A 2K40A 2EQRA 4FISA 5EG0A 5F0CA 9ANTA 5EG0B 3HEFA 1P7IA 2DA1A 3JREA 3QPLA 3Q3SA 4MIMA 3JRIA 1CQTA 3S1MJ 1ENHA 2WB1N 1B72A 2X48A 2HDDA 4C3IJ 3H0GJ 1B72B 2H1KA 4MFDA 3IH2A 1ETQA 3S1NJ 5IOYA 1GDTA 2K9QA 5JLXA 2ZB9A 4I76A 1X2MA 3SFIA 2QCOA 2B63J 2CRGA 2MGQA 2NS8A 3BG5A 2VPRA 4RBOA 3HGGA 2CUFA 1JKPC 2O8KA 3Q0VA 2NVTJ 2HYJA 3TP3A 1GV5A 2M2EA 2LVSA 2M0CA 1RR7A 2JK3A 2Y0SN 3JRGA 5IPAA 2LR8A 2LY9A 1NK2P 4IEJA 4EEFG 3FK7A 2XRLA 1JGGA 4A93J 4D7MA 2R92J 2Y9ZA 3LSPA 1SANA 4MO7A 3G1OA 4B1RA 1QVTA 3BR3A 3SJMA 3HOUJ 2EZKA 3TP0A 2NS7A 1JTXA 5J1RA 3HKZN 3TEDA 2GLOA 2LLKA 2IBDA 1NTCA 3RKQA 2E19A 4LOCA 5FJ8J 1UMQA 4JX6A 4B3AA 1OCPA 2XGEA 4J19A 1MBJA 2DA2A 1OJLA 3BR1A 4G12A 5FKLA 3BT9A 5F0HA 3GTKJ 1ITYA 4IHXA 2N8GA 3BTLA 1TWGJ 1NK3P 4D5FA 2VKVA 3HM5A 3BR5A 1GT0C 5K7HA 1O4XA 3D1NI 3JRAA 5M5XJ 4GFBA 3GBGA 1WH5A 1WI3A 2W48A 3HOYJ 3G1MA 3IH3A 4JX5A 3BTCA 4DW6A 1FTTA 3A03A 2TCTA 4A3FJ 5E3OA 1YRNB 1FTZA 5F27A 5K7FA 1MSFC 4IHYA 1MBHA 1Z77A 1ETOA 3S2HJ 2NOGA 2FD5A 2KDZA 5M5WJ 3GTJJ 4M3FA 3JR9A 2Y2ZA 2L7FP 4A3GJ 3ZQGA 3A01A 1IUFA 1JT6A 3BG3A 2DMPA 4Y52J 1F43A 3A01B 4A3IJ 1TWAJ 4BY1J 1MBGA 2CQXA 1JKRC 3OSFA 1WCMJ 3TW7A 3BR0A 1Z0XA 1MSEC 1ZR4A 2NVYJ 3S1RJ 3GTLJ 1MBKA 4DYQA 5C3EJ 2KT0A 2HXIA 1U8BA 2H8RA 2O7OA 3O8HA 2LP0A 1F36A 2ID3A 5IYCJ 4A3EJ 3PO2J 2FQ4A 1B8IA 5F08A 5GPCA 2L7ZA 1B8IB 1IDZA 2R5ZA 1I50J 2XPVA 2P81A 2R5ZB 5GP9A 2D5VA 2WV1A 2VKEA 3BTJA 1XS9A 3ZQCA 3WHCA 4M3EA 2E1OA 4MLOA 3ZQFA 1BW6A 2XB5A 4B4CA 1X58A 1K83J 4FCYA 2M8GX 1R9TJ 3HBLA 5C4XJ 3S17J 1I6HJ 3HOXJ 2K9SA 1IDYA 1DU0A 1MH4A 4JYKA 1XC5A 2L9RA 2EZHA 3ZOBA 3GTGJ 3CMYA 1JKOC 4JX4A 3TW6A 1K61A 4IHVA 1ETWA 1ORKA 2R93J 2EZLA 2WAQN 5FLMJ 1HOMA 1Y1WJ 5F0FA 2EBIA 2Y30A 1WGXA 2JA7J 2OF7A 4AYBN 2ME0A 1I3QJ 2YS9A 4CYCA 2JN6A 1FJLA 2XSDC 4JP0A 4M3DA 4CYCB 1WH7A 3M4OJ 4BKXA 5J1YA 1TC3C 1VF9A 5EYRA 5BNGA 1GV2A 1AU7A 2DMUA 2XGCA 3WHBA 1FEXA 3HOVJ 5IYBJ 3FISA 4A69C 3RZDJ 2DMQA 2X6OA 2XGDA 3LSGA 4QIWN 1IV6A 2JA6J 1TWCJ 1X2NA 2K9NA 3C2BA 3JRFA 3S16J 1JJ6C 2QF7A 5EEAA 2ELKA 2MG4A 5IP9J 1LE8A 4DZJA 1LE8B 1ETVA 1U78A 4X1EA 2LFBA 1MH3A 4Y7NJ 1TWHJ 3FK6A 3IH4A 2VUMJ 3DEWA 3M3YJ 3LNQA 1JJ8C 2IEKA 3O8GA 3NARA 3ZQHA 1BW5A 4HNVA 1ETKA 1PUFA 3B6CA 1VNDA 1U9NA 1PUFB 2X9DA 1HF0A 3G1LA 5FLVA 3E7LA 2Y9YA 1MNMC 1AKHA 1JUMA 5DTDA 1AKHB 2VI6A 2GM4A 1Y1VJ 5M5YJ 1A6IA 5FKOA 4BY7J 3MKLA 1VI0A 4M3BA 4XK4A 4IHWA 3JRHA 1JUSA 1JKQC 3MVPA 5IP6A 1HCRA 2DA3A 5FKKA 5E3LA 3DCFA 5F04A 3L1PA 1MBFA 1BA5A 3QQAA 1SFOJ 1GVDA 5IP7J 2JJ7A 1G2HA 3CQZJ 5J1UA 5K7ZA 4BXXJ 4QSHA 1MBEA 3S14J 4XIDA 3JRCA 3RZOJ 1APLC 5E3MA
chains in the Genus database with same CATH superfamily
1P2FA 2GA2A 3QP6A 4A3JJ 1H88C 2EV6A 4UUSA 2RAEA 2CQQA 2HS5A 1FSHA 3F21A 3HRTA 4XICA 4BQAA 4AWXB 4ETSA 1LFUP 3ZXSA 1W0UA 1Z7LA 3LSHA 3Q0WA 5B3SH 3U9GA 2KP6A 2DA6A 4P1WA 2RQQA 3KEYA 1CF7A 1G6NA 3CO6C 2GQQA 2VJIA 4CCOA 2NVQJ 1VZ0A 3ELKA 2RREA 4F93B 1J0RA 3OYMA 4FTHA 3S32A 4HDVA 3J80K 1Z67A 4M9SA 4P55A 2VXDA 4RB0A 3OYNA 3OIOA 5EZHA 3V4GA 3JRDA 4J00A 4W1UA 1QPMA 5D5UB 4MFEA 2W1OA 2UXXA 3O2PE 1FP1D 2EINH 4CSWA 2LK2A 4BEHA 3S8PA 2ZJ2A 2WAEA 4OAYA 4HLYA 1SAXA 4D5CA 4I6ZA 4U0VA 2XAHA 3F6OA 1V5GA 2F4IA 4L9JA 4XM3A 3J7AY 5DUKA 4RGXA 2BHYA 1JUPA 3Q0UA 3OSGA 3OL3A 1RRJA 4EM2A 2VJ5A 3RI4A 3WU2C 1AHDP 2DMTA 1X4PA 5KK1A 5EGOA 3NRVA 2IXSA 2EH3A 2Y0MA 3CDLA 4HZFA 2XPWA 1BJAA 4V2FA 2ZNYA 1OR7A 1XCBA 2R0QC 2AXLA 2HDCA 2QKMB 2VBZA 5TISC 3HOZJ 5K1YA 4L5IA 3IUOA 2P6SA 1HSJA 3PSIA 5CVIA 2KJBA 1FIAA 5FB2A 3KP2A 3MN2A 1K78B 3L09A 1A36A 2R7VA 4MQVA 3BDDA 2R5YA 2GOMA 3OY9A 1R6RA 2RNGA 3HPHA 1RKTA 2CQKA 3FF5A 4LLGF 2XB0X 3HOSA 4GYIA 4IRGA 4Q48A 4HNTA 1NHAA 3CCUI 2GWRA 1ZQ3P 3WTZA 2CJJA 3EPZA 4GXOA 4BL0B 2LKSA 4C9YA 4LK1F 4EVIA 3MKYB 1Z91A 2P6TA 4A3DJ 3ECHA 3BG9A 4XKBA 2JVGA 3BR2A 3DBRB 2RV8A 4XRSA 3EYYA 5H20A 4U7BA 2XAFA 1OLTA 5LLQA 2HOAA 4N4NB 4ZJZA 3RQIA 2CUZA 2K9MA 4RM2A 1F1ZA 1R5HA 1TWFJ 2WV0A 4AUXA 1IRZA 4UY8I 3H3ZA 3PFIA 2W84A 4NNJA 2DJNA 3FHNA 2KL4A 2HQ5A 4CA0A 2JA5J 2OTLI 2W57A 2LNBA 2ZKZA 3GZNB 1YYVA 2CU7A 2ZSHB 4M3GA 4HX8A 2HTSA 1J2XA 2DDAA 4EM1A 3K7AJ 4N4OB 1QRYA 1T33A 2VT2A 3EUAA 4O5VA 4B3XA 2MW8A 3FXJA 3C18A 1BL0A 3ABTA 3OS1A 2L3DA 1TNSA 3LA3A 4U0YA 1K79A 1D5YA 1ZTRA 2OBPA 2X4HA 4IPAA 3ONQA 4ABZA 3GTMJ 3OYDA 1IRGA 3G2BA 4LFUA 1OMIA 4DNCA 2VBXA 3DV8A 2FJ1A 1FC3A 3U21A 2A5WA 1IG7A 2BXYA 1B9NA 1G8XA 4PGGA 2K40A 4PSWA 3VDXA 5FRNA 4LGWA 3JRIA 1ENHA 4IOCF 1QU3A 5JHFA 1IRXA 1B72B 2VN2A 3CCSI 1ULYA 3HSFA 4XSXF 3SZGA 4BDYA 2FBHA 3DPTA 2A68F 2MH2A 2NNNA 5B1BH 3QODA 1X2MA 2KRCA 2V9VA 2CRGA 1XMAA 4BHCA 1YX3A 2R7WA 3BG5A 2VPRA 4Y4RA 3G4SI 1EH6A 2MFZA 2BEOA 3HGGA 3OIPA 1RUNA 4XONA 3SEZA 1FY7A 2BXZA 2KJCA 2JK3A 3ZPLA 1OQYA 3E1SA 3OYIA 2Z5UA 1O3RA 5IPAA 2LR8A 3DEUA 3MZ8A 1RZ4A 2YSRA 1MJ9A 3PJRA 2BYVE 3IKTA 2XRLA 1T38A 5JVTA 4NBQA 4D7MA 3E6BA 2FQ3A 1X4OA 2XAGA 3G1OA 1BC7C 1QVTA 2XASA 2V79A 2EZKA 4F3QA 1JTXA 3PNTA 5J1RA 4M71A 2HDWA 5DCMB 2LSOA 3GFIA 3GFMA 4PCQA 3ZCOA 4I01A 5IT3A 2B7EA 2X6YA 5JHUA 3KYDB 4LOCA 1K7AA 2NXNB 5FJ8J 3F8FA 1JI8A 2HOEA 2L02A 4AYBA 3IC7A 4FT8A 1QA6A 5BPIA 3NWSA 3PIOF 3BR1A 2KMUA 3I0TA 1WWXA 4G12A 3GTKJ 2HWVA 3LSKA 1TLHB 2N8GA 4OWRB 3IP4B 2EFOA 1UAAA 1W1WE 4KDPA 1NK3P 4D5FA 3B73A 3DKWA 3LQQA 5JI6A 3P9KA 4GFBA 1HKTA 3WU1B 2ISYA 3E5QA 3HUGB 1HW5A 2W48A 4Y13A 1LVAA 1TP4A 3EQLF 1O7LA 2EIKH 2VXZA 3TO6A 1XPXA 4KMUX 1YRNB 2QQBA 2VKHA 2F5VA 2DPUA 3LA2A 5FROA 2MBFA 1YLFA 3A4CA 1VQPI 1D1CA 1Z77A 1ETOA 4NQWA 4ENJA 2QSGX 2KDZA 3FXKA 3FHZA 1R4NB 4M3FA 2L7FP 3ZQGA 3DXJF 3A01A 1IUFA 1B59A 1S7AA 3E0JB 4Y33A 1GLNA 4BAYA 1TWAJ 5CKTA 3RYRA 3OYCA 1J09A 1QZYA 2CQXA 4HQEA 5ILUA 1JKRC 3AL0C 2VIXA 3CTAA 2DFHA 4N0BA 3W6JB 4KICA 2F48A 2WA0A 2BOLA 3I71A 3LSMA 1UHMA 2GXGA 3FZVA 4OMYA 3S1RJ 2J5OA 2X6XA 3DFGA 5C3EJ 2HXIA 2OTJI 3DKYA 1U8BA 3O8HA 2Q2EA 3K1MA 4D9JA 4IL6C 3OYAA 2FQ4A 2KIMA 2R7SA 1YJ9I 2H27A 3I64A 4UV9A 3RJPA 4WXHA 1SAUA 4BU2A 3LQRA 2O8XA 1OKRA 3ASNH 3WHCA 3EUHA 2C6YA 1S8NA 1T0FA 4MLOA 3ZQFA 3K10A 1BW6A 2EPFA 4DBQA 2XB5A 1TQMA 1X58A 4FCYA 1FYMA 2M8GX 1IV8A 1KZHA 3ERED 2QBYA 3O3KA 1W36D 5C4XJ 4JQFA 2FOKA 2PI0A 2ETHA 4EJWA 2M30A 2EWNA 1YJNI 1XMXA 2LREA 3DKXA 1DU0A 2DPDA 1B1BA 2CQ7A 4JYKA 5FFXA 2ZXIA 3T0YA 1HXDA 5D6FA 1GXQA 2GAUA 3ZOBA 3HJEA 1TTYA 4JX4A 1BI3A 3CCQI 5AIPA 1ETWA 3GXOA 2GA1A 2JZYA 2R93J 1HOMA 5FLMJ 5F0FA 2EBIA 2HU9A 3H5RA 3IRQA 4PJMA 2Y30A 4ESFA 4QLCU 1WGXA 4XMYA 1R71A 4AYBN 3E3VA 2FE3A 3D5SC 4CCLA 3F8MA 2EA2A 3KLNA 1X1AA 4JP0A 1WH7A 2QWWA 1E2XA 1ZARA 2DMUA 2LMDA 3FX3A 3K1NA 5GTIC 2XF5A 2RC4A 2HZTA 4LB6B 1ZRCA 3OYLA 2K9NA 4HSTA 3I4PA 4LG0A 4DBRA 5ICGA 3FM5A 2BY0A 2VC0A 1SD4A 4G6DA 4DZJA 3CUQC 2VBWA 2XKPA 4IRHA 2OA4A 3CO7C 3T8TA 3DTKA 2UXNA 4Y7NJ 1U2WA 4UB6C 2O61A 3ZN0A 1HW1A 1MMDA 2J5PA 1IN8A 3IWZA 4XKCA 3NARA 4PSXA 1BW5A 1QHGA 4M73A 3ML6A 4HNVA 3HC7A 3ZRGA 4ZDLA 3HRSA 1REPC 1U9NA 2X9DA 2EIJH 4GRIA 4KNYA 1LPQA 3D5RC 2VL8A 4A0YA 4RLQA 1JUMA 2KLOA 1AKHB 2IA0A 3WE2A 1T98A 1R5ID 2GM4A 1SD6A 1Y1VJ 3MWMA 5M5YJ 4BHPA 1ACIA 1P92A 3VYRB 1YX5A 2DW4A 3TKYA 1BBYA 4M3BA 4A12A 2DFIA 1IN4A 3HG9A 4XK4A 4IHWA 4RGUA 3JRHA 2K5CA 1JUSA 4KUMA 3EYIA 1HCRA 5FKKA 3GO5A 4L9NA 2E7WA 4FX0A 3L1PA 1BA5A 5LRRA 1SFOJ 1GVDA 1G2HA 3OV8A 3BC8A 3JCUC 2NNYA 2XAJA 2ZC2A 1VQ8I 2PJRA 3HXLA 2X1CA 1R4MB 2OZ6A 4IX7A 4M9ZA 4HLXA 3KZZA 3GLXA 1VQ9I 3CCEI 5JVGF 4ZC3A 4HAMA 2O9LA 1ETXA 3IAS2 4XNFA 1SC7A 2VB6A 2K85A 5B66C 2UUZA 3ASOH 3E5XA 3KIOA 4UUSB 4Q47A 4BBSJ 1T95A 4PK4A 3FXLA 3C3WA 3E97A 4IQ4A 4BGDA 5ILSA 1RR8C 2A3SA 2VQLA 4C3HJ 2L01A 4G6TB 3I58A 3MCZA 2FUG2 3R60A 1H8AC 1A6QA 1A5JA 4B43A 3BOQA 1DDNA 4KFCA 1CF7B 2EIMH 1Z3YA 3SDGA 3FXUA 4PUSA 1FBUA 1PVEA 1DPUA 4XKVA 1MJBA 4HA8A 1EF4A 1JTYA 2O0YA 2DMNA 3AG3H 2G0EA 3DLAA 5FD5A 3ZR8X 3JAMZ 4WX9A 3PO3J 3RKYA 2M9HA 4RAYA 4XN3A 5A2QZ 1SMTA 2PN6A 1K6OA 4M9XA 1X19A 3A0BC 4BEHB 1MZBA 2W82A 1Z6TA 4CZZA 1DP3A 2WB1A 3NAUA 3JSOA 3F8BA 4DZPA 5HDKA 3AG4H 5LFAA 3HGYA 1HLVA 2CUJA 2STTA 3LSRA 3BZ6A 1PP8F 1ZKGA 1G4DA 3KZYA 2PJPA 3IV5A 1EA3A 3H35A 3RDIA 2XV4S 5D4SA 1IW7F 3S2DJ 4C30A 2JVHA 3I4MJ 2L9VA 4DOZA 2TRTA 3HHGA 4YFKF 3QPTA 1I39A 1OYYA 5EGOB 5HLTA 1D8JA 2VQGA 1BC8C 1XG1A 4KYWA 1U6GA 4RLFA 2CW7A 1G3SA 5J40A 1XGMA 4P9FA 2Y0SA 3CJNA 3S15J 1OYIA 5L3DA 2CV1A 4HYEA 4EV0A 4E7KA 3GTQJ 5BS6A 2YPRA 1FLIA 3W6VA 2X6WA 5EZGA 4BBRJ 2DQRA 4MQ9F 1UHSA 1WJ5A 1IXSB 2R5YB 1S72I 2MD5A 3PUBA 4A3KJ 3ROUA 4ESBA 4JK1X 2CH0A 4LG3A 3BWGA 1R00A 1M1EB 2AHQA 1X1BA 1RNLA 3QPSA 4UVCA 3RTRA 1SMYF 4LK0F 3QAHA 5A2QK 2DODA 2FNPA 1OFCX 1D5VA 2DQLA 3H36A 3AAFA 2ZMEC 3SZPA 1YQAA 3K4CA 4M74A 5EJCA 4A3BJ 1O3QA 3GZ6A 2R7ZJ 4BHBA 3K2AA 4UV8A 3KP3A 1E3HA 1JE8A 4XL9A 1PUEE 2DOFA 4NUBA 2VBYA 4DGWB 1HDDC 4IHTA 2P0WA 2L0KA 1OISA 1OCRH 3FMQA 3ZMTA 5E1ZB 1ZYRF 3HL2A 3ZMDA 3CJRB 4E70A 3LAJA 2I10A 4FE7A 3L00A 1ZLJA 4QTRA 3OYJA 1RPWA 3BTIA 3V7SA 3KZIC 2QQ8A 4H4KC 4C2MJ 2E2JJ 5LEJA 1Y39A 1IJWC 4XQFA 1IZ1A 2CUEA 3ESWB 4PJNA 2K02A 2LKPA 3H3VK 5GPAA 3UNGC 1QQIA 1T56A 2LOOA 3DU5A 2K4BA 2H09A 2GBYA 4S05A 2CSOA 1ZRFA 1JHHA 2I5UA 3GEZA 1SFUA 1D0ZA 2LG4A 1S3JA 2L7KA 3CESA 4K2EA 4D7NA 5FD6A 1QPIA 4PGHA 1IGNA 5M3MJ 3OOPA 3I56I 4GYGA 4MNUA 1U9OA 2COMA 2JQ7A 2Z9OA 2HPMA 1R36A 2E2HJ 1UELB 2QEXI 5ILVA 3BQYA 4F7ZA 4CH7A 2QKLB 1XX5A 3FDYA 4DYCA 2EZIA 2GOXB 3M1CA 3CCMI 9ANTA 3HEFA 1MDMA 3SQNA 1H0MA 3QPLA 3Q3SA 4Q5SF 2ZFWA 4MIMA 1V3FA 3S1MJ 3JSPA 2NOJB 3L7WA 2WB1N 2QGUA 3AG1H 4I99C 4ZYAA 3KETA 2HDDA 1AOYA 1W5CC 4XLFA 1ETQA 1GDTA 3WGGA 2AS5F 2E1CA 1FMWA 2VC1A 1IF1A 5HLGA 4ZZDA 2R7RA 1G3TA 4DQ2A 4OU0A 3ABUA 2MABA 3KYCB 1XMKA 2KPMA 1V54H 1OCOH 1D8KA 2DYSH 1AWCA 3PFYA 2IS2A 4BE2A 2R7QA 1FX7A 1Z1DA 3TP3A 2Y0SN 3JRGA 3WTYC 3M7GA 1YIJI 3NQOA 3K2ZA 1BI2A 2KHMA 2LY9A 4KT6A 1KQ0A 4XR6A 1K4SA 4IKFA 2A61A 2ADUA 4BH9A 2DDBA 3LSPA 2A05A 3K70D 2KZVA 4B1RA 2YX7A 3ERMA 3SJMA 3HOUJ 1WI9A 1YG2A 4CXFA 2VONA 3I53A 3N97A 2EFWA 1T2KA 1ZLKA 1BR4A 2IBDA 2LLKA 4PJLA 2XROA 3MAJA 2M3AA 3ZQ7A 1XTAA 2KDOA 3FM3A 4B47A 5E79C 3RKQA 3PNYA 2E19A 2QQ9A 3M8FA 4A6EA 5L3GA 2HKXA 2PQ8A 3OYBA 5HS9A 4OINF 4II2A 2EFNA 3P5JA 5H6RA 4J19A 2BGCA 4P9UA 5F64A 3W6KB 4LLNA 2WAFA 3ZGKA 1IXRC 1Y6IA 3SXYA 2AQFA 1WRJA 3PUFA 1GT0C 3IWFA 1O4XA 4CCJA 2MH9A 2IP2A 3TO9A 3IH3A 3RPUA 3IL2A 3BG7A 4JX5A 4I0AA 2XF7A 3A03A 2TCTA 4KA4A 4ZTJA 2K3FA 2XRNA 4AD9A 1V5EA 1HW2A 2X0LA 2V1DA 4AM3A 1VQ7I 3CLQA 3BP8A 4NQWB 4ZYGA 2WY7Q 5M5WJ 3GTJJ 1MMAA 1YW8A 3K4BA 3TQNA 3BY6A 3A01B 4V19K 2UWMA 3OR1C 2VE9A 2UZKA 3DEEA 1FOWA 1YTYA 4BY1J 2QQAA 5D8KB 1MBGA 3E6CC 3M07A 1WCMJ 4ASNA 1VQ5I 3BR0A 1L3LA 2PMHA 2LBFA 5J4VA 3F72A 3KE2A 1MSEC 3CUQA 1UB9A 1ZR4A 2NVYJ 1MBKA 3WGIA 2RVCA 3PQKA 2A6TA 2LC2A 1U3EM 2B0LA 3I3LA 3BJ6A 2O7OA 1F9NA 5IYCJ 3G73A 5LEKA 2OAZA 2Q2EB 4A3EJ 3L9FA 2KISA 3PO2J 4I7HA 1B8IA 5F08A 1D3YA 2A6HF 1IDZA 2L2OA 4L0ZB 2Y48A 2R5ZA 3GFJA 2XPVA 2A5YB 5GP9A 2B9SA 3F6VA 4FETA 4RM3A 3VYSB 4EGYA 5CYVA 1TT0A 3F8NA 3BTJA 3H9JA 2NAZA 3OS0A 3A2KA 2JPBA 3F9KA 4IJAA 4E4HA 4B4CA 1K83J 5CVJA 1R9TJ 1Y0NA 2QBYB 3S17J 2X51A 2W25A 2WY8Q 3VOEA 2D45A 2XUBA 2BBYA 4UVAA 1D0YA 1XC5A 3GFLA 2DU9A 4X0GA 2F5CA 1N78A 4EMSA 3WG9A 2L9RA 4A5NA 2EZHA 4C2TA 3E6MA 4EJTA 2A07F 3SZTA 5EEGA 3TW6A 2ISZA 1R5GA 3E6DA 4ZTFA 3HOTA 4HF1A 4AIHA 2BW3A 2KFDA 3BCBA 1BN5A 3Q9SA 2IVMA 4XRFA 4FQGA 2JA7J 2IA2A 4RAFA 1SD7A 3TOBA 1I3QJ 1FWZA 4LJZF 3I5UA 2HQAA 3OIQA 5BNGA 1GV2A 1T6SA 4KITB 3WHBA 2XGCA 2RDPA 2F4OB 2HVQA 3CC7I 1C0WA 4A69C 4XLEA 3RZDJ 5EEHA 4QIWN 3WTUC 2JA6J 1SEUA 3BLYA 3JRFA 2QSFX 1O3TA 2XHKA 2QENA 4LG0B 2QF7A 4UB8C 4LD5A 5EEAA 2MG4A 3C1DA 1P4XA 5GAHJ 1U5TC 1LE8A 5ERIA 3K0LA 4ZDOA 1ETVA 1MMGA 3OYHA 3LWFA 5LD2C 2IS6A 1QO0D 2M4KA 1WQ2A 2L5QA 3GCMA 1WJFA 3R0AA 1W36C 3FK6A 1HQCA 3IH4A 4BNCA 3DEWA 2VUMJ 3CCRI 1JJ8C 2E1NA 4QPQA 3HIFA 2CFOA 3KP4A 4Q4ZF 2MLKA 3ZQHA 3K6GA 4BQOA 1ETKA 4IVNA 5D5WB 1PUFA 5LHIA 2YU3A 2L4AA 2FMLA 2R4GA 1BI1A 3GF2A 3Q9VA 3CC4I 2DXIA 1MNMC 1S7OA 3RSNA 5DTDA 2Z16A 1HKSA 4R79A 1UHWA 1FPQA 3FBIB 4P5OA 1R1UA 4BY7J 3MKLA 2JUCA 3W2VA 1VI0A 5CVUA 1XGOA 2HNHA 1NH3A 5IP6A 5AONA 5E3LA 2M7AA 3DCFA 4U88A 3C7JA 4D0PA 5HDGA 1PYVA 3QQAA 1O3SA 5IP7J 2JJ7A 1N25A 3CP2A 3PQJA 5J1UA 4BXUA 3DWLE 5K7ZA 4BXXJ 4KMFA 4I09A 2PJRB 3S14J 5FLXK 3JRCA 3HTSB 1APLC 4BQNA 5E3MA 4YRVA 3OOUA 2KQRA 4HG2A 1FIPA 2Z2SB 2LDUA 2RQPA 5E8IA 2IS1A 5J3LA 1TQPA 2KRFA 2L4MA 3VEPA 3VPRA 4GCVA 4IRIA 2DJIA 2DA4A 3L2VA 1ZR2A 1LJ9A 4HF0A 3ECOA 4ENMA 3GTPJ 2OD5A 2JSCA 1RUOA 3QPHA 2WWYA 3ZQLA 4H0EA 3H5NA 3CLOA 3N05A 3KP6A 2HXOA 3CCLI 4E7JA 3MKZA 4XN0A 2JPCA 1FOXA 2CG4A 4KIGA 4E7IA 2HOSA 1Z3XA 1VQKI 2FXAA 3HB9A 2IAIA 2ZMEA 3FXOA 2DYRH 1XB4A 3KFWX 2Y69H 5BQTA 1A04A 3WTSC 2HOTA 2Q8KA 1XDSA 3CP8A 1POGA 3R6SA 1BOAA 2DN0A 2VASA 4YELA 4RB3C 2Q1ZB 3GUDA 3LAPA 1IC8A 1H89C 2DBBA 1Q1VA 5HOOA 5DCFA 2ZO4A 3BCAA 1HDPA 3GMEA 5DEQA 2VKDA 2CYYA 2ZBKA 1MMNA 5DYMA 3W2WA 3LSJA 1YFHA 5F6FA 4HNUA 3S3MA 2F6CA 2Z1DA 3QRFF 3OMYA 2WC2A 3OYEA 1E3OC 3OL4A 3S1QJ 2HVSA 3AG2H 1FOYA 4KN7X 3WTTC 1ETYA 2ECCA 2DFFA 2OCEA 1K4TA 4AVPA 2L7MP 4N9IA 5KNLA 1RKWA 1YHQI 5DD4A 4S04A 2ECBA 3CCYA 2IRFG 1UG2A 4FE4A 1A35A 2V1UA 2ZJPF 1N77A 2O3FA 2F5EA 3VYUB 1BR1A 2A6EF 2CWEA 4ESJA 1I1GA 5EF6A 2YUSA 2JMWA 1MKMA 2MLGA 1XN7A 2MSYA 3GWZA 1OYWA 1T8IA 2FF4A 4XRSG 1MW7A 5L3FA 2H6CA 1EV7A 4EM0B 4IO9F 4NB5A 5TGTA 4B48A 2DK5A 2R7FA 3PM1A 1WZ2A 3LOCA 2HQNA 3MQ0A 3HOWJ 4YG2F 1T08B 4PZJA 2YR2A 2VPLA 2PMUA 3CJQB 5ED4A 2HEOA 4R8HA 1FP2A 1O57A 5DM7F 3T5XA 3GLLA 1MMSA 4S0HB 2IGOA 2LKXA 2V26A 2RNJA 2V9PA 2OUMA 4KJZA 1DU6A 2DT5A 2YX4A 1LFPA 3BPVA 4NC8A 3M8JA 1AA7A 3TL4X 4C2UA 4A3CJ 1P7JA 1TW3A 2HYGD 2Y31A 1ZREA 1YRNA 1YO5C 2WADA 1J59A 1UG0A 3BG6A 3L2QA 2IPQX 3OWTA 3QU3A 3CMMA 3LA7A 1B4AA 2QUFA 3KP5A 5FKNA 2FSWA 1X3UA 2F4MB 3VWBA 2HKOA 2VJ4A 5E3NA 1ZGWA 1JT0A 4UUTA 2E7XA 3R61A 4GO1A 1XGSA 4B44A 1TBXA 4X6AJ 3KX2A 3CCVI 5DS9A 2NVXJ 4N9HA 4WK8F 2LRDA 4BDZA 1LDKB 1BR2A 4HF2A 3B6AA 1BM9A 2JWTA 3F0CA 5DD8A 1DGWY 2XF6A 3RPUD 4UUVA 2GXAA 2FBIA 4EJUA 2FU4A 1FMVA 1FBSA 1G3WA 2P5KA 2CQNA 3WGHA 2PX9A 2HI3A 5C4JJ 1SVLA 1LNWA 3IHUA 2M34A 2QM3A 1R23A 2EJRA 4A5MA 2AO9A 3QOEA 1J9IA 2Y75A 3S3OA 5EG0A 5F0CA 3U1KA 4AVZA 3EDPA 4CUGA 3JREA 1J5YA 3QOPA 3X2QH 1MDMB 1CQTA 3OYGA 4ZZLA 5J8FA 2X48A 1S6LA 3FXRA 3H0GJ 3B02A 3IH2A 2KIQA 2F5DA 4E7SA 3ZP5A 3S1NJ 4KIFA 2M45A 4I98B 5TRDA 4IZZA 1USSA 1GVJA 3SFIA 2QCOA 2B63J 2PBIA 3WU0A 2MGQA 4A0ZA 3QP5A 1ZRDA 2NS8A 2ZSIB 2OC6A 2KZGA 1H9GA 2K4JA 4RBOA 1CGPA 1W4MA 2CUFA 3GVAA 2F2EA 1YW7A 1PP7U 2V7FA 3V7CA 4CO8A 4L18B 1YS7A 2M2EA 2ZNZA 2M0CA 5LGTA 2D2WA 3FBNB 1Y56A 2H1LA 1UFMA 2XC7A 4HV5A 3K4MA 2IW5A 1NK2P 3AL0B 3VSKA 2BHZA 4EEFG 2EV5A 4MHGA 3FK7A 5E1XA 2TDXA 5IT9Z 2R92J 2P5VA 4WWCA 2Y9ZA 3J81Z 5E1WA 4G7ZF 5D8LB 3BR3A 4NC7A 2NS7A 3TMOA 2EV0A 3S2WA 3ISPA 4CGZA 3DTEA 5J4YA 2WAQA 2OCCH 1U8RA 5HLHA 2CW8A 1UMQA 1XSDA 3FXQA 4B3AA 3L2RA 4HDUA 1OCPA 3EUKL 5FGMA 1SD5A 3Q5FA 2LF8A 1JXSA 2HPIA 2DTRA 5JFRA 2DA2A 1OJLA 1R22A 2VOOA 1VQNI 5FKLA 3T1BA 2HFHA 5F0HA 3F22A 3BTLA 1FZPB 4P96A 1TWGJ 4NHJA 3MKWB 1LB2A 3BR5A 2CFXA 2IGMA 3HSEA 1XSVA 3D1NI 4IF4A 3JRAA 3GW2A 4CZCA 2MYSA 3GBGA 1TT5B 4CCKA 3PSFA 1WI3A 2OU2A 1S9HA 4M6XA 1U0JA 3ABKH 3BJAA 1FTTA 2X1EA 3KEQA 1ZELA 3SFZA 2I8DA 4A3FJ 3H92A 6PAXA 1MNEA 1L0OC 4G7OF 5IT9K 4TV7A 3EUHC 1RI7A 1R7JA 3J81K 2G9WA 2OZUA 5HNFA 1W7PA 1X3ZB 3H9QA 2ELJA 1SVOA 2JA2A 3JR9A 1VQ6I 2IJLA 3BG3A 4HW0A 4CCMA 2DMPA 3MD2A 2QA4I 1YE9A 2O03A 4NC6A 4CICA 1B6AA 1WKMA 1E17A 3OSFA 5J8CA 2DFEA 1FT9A 2XAUA 3ZMSA 4OIPF 2O6GE 1Y8QB 3CD6I 2ZXJA 2LBFB 1U5TA 4WCGA 5BOXA 2ESHA 4DJAA 2DOAA 3CMEI 3CUQB 1VTNC 3GTLJ 1QZZA 3VB2A 1MJAA 4CCNA 2KT0A 2GIZA 1QNTA 4YIIA 3WTXC 2BVLA 2E34A 2H8RA 2LP0A 2ID3A 2XVCA 4OIOF 1R49A 2IGKA 2EFPA 2LF7A 5B1AH 1B8IB 4KT5C 3QYFA 4A6DA 1I50J 1PDNC 2R5ZB 3L2WA 2WV1A 2CW0F 2EA4A 3HYIA 1XS9A 3ZQCA 2LY2A 5L3BA 1TQIA 2VODA 1P4WA 4M3EA 4UXNA 3I54A 3C2GA 1WJAA 3UR3C 2NYXA 3I55I 4HEA2 2R3SA 3HBLA 4WXCA 3R4KA 3HOXJ 3V42A 2K9SA 3LMMA 1IDYA 1LKXA 3G3ZA 2QYOA 1MGTA 4M6YA 1ZGJA 3ULQB 4BJ5C 1X1PA 2UV1A 5CVVA 4B8XA 4XKWA 3C2HA 3CMYA 4IHVA 1K61A 5KAFC 1K6YA 1KYWA 2WAQN 2BW3B 1Y1WJ 2R7TA 4XBFA 2E35A 1R1VA 4ENKA 1FBQA 4PJJA 3I59A 2MC3A 3CMAI 2YS9A 2G7HA 1ZGAA 1HSTA 1V5FA 4CYCA 2ESNA 3H9GA 4LMYA 2XSDC 1QHHD 4BKXA 1TC3C 2V1XA 1VF9A 3R0JA 2BV6A 3J7AO 3HOVJ 5IYBJ 5HVQC 2PFBA 1XDUA 2DMQA 2X6OA 2K86A 3U1DA 2XGDA 3LSGA 4F91B 1IRFA 1X2NA 1V55H 3C2BA 1ZH5A 3S16J 3CDHA 1JJ6C 2ELKA 2DOEA 3H5AA 1LE8B 3I9V2 5GAGJ 3V8KA 4X1EA 3QYBA 1X1DA 3J7YJ 4WXDA 3LFKA 1LDDA 3BJOA 1TWHJ 2XAQA 5K5RA 3LNQA 1WVRA 4IQJA 3OR2C 1WFXA 2IEKA 3O8GA 1VQ4I 3LSIA 3HPGA 3IRRA 4BJ6C 2VOPA 3B6CA 3DTIA 1VNDA 1PUFB 1QZEA 3QYEA 2E1MB 4DIQA 4ZYHA 1ODDA 1JGSA 2Y9YA 4RGRA 2PMZA 5LGNA 3JTGA 2NS0A 4HV6A 3V8JA 2QVOA 2VI6A 4HOBA 3DQVC 5FKOA 3FWEA 1PJRA 1WJBA 2DCEA 3U2RA 2V1NA 4UVBA 3S93A 3KCCA 3ABLH 2CO5A 3MVPA 1WJDA 2DA3A 3VFZA 5D4RA 2FMYA 4G6QA 3CQZJ 3JW4A 1KGSA 4A0XA 2QSHX 4QSHA 1MBEA 3M1EA 3BPXA 3V8LA 5BMZA 4XIDA 1USTA 2VE8A 3RZOJ 2W85A 4FASD 3K69A 4MTEA 2KIUA 4G7HF 4MEYF 2ZXWH 5M3FJ 1KU7A 1LFBA 3OS2A 3MEXA 1VFCA 1ZK8A 4M6VA 3TO7A 3V7RA 2DA5A 3N4MA 4ZYDA 2GXBA 3BQZA 2LTPA 3A1YA 5LGUA 3K1PA 4XRMA 3W2AA 2V6EA 5D6EA 4RB2C 3K4NA 1GUUA 3OYKA 2P7VB 1KU9A 2ZMEB 4RMNA 2JA8J 1KYZA 1F4KA 2YU9J 3FMSA 3SHFA 3T8RA 5IOZA 4CDGA 1BIAA 3A0HC 1MIJA 5CVRA 1A31A 4Y3OA 2M4GA 2QLZA 3CUOA 3TDZC 5CLSA 1R58A 3SEQA 1Z21A 1YI2I 4HBLA 2R7DA 2H94A 3F3XA 2VLAA 1E0EA 3SDBA 3CDIA 3I4NJ 4GGGA 4V2GA 1XCVA 2D1VA 1ONVA 1Y0UA 2HR3A 1RESA 4ZYEA 5KAIC 1S7EA 3FIWA 1B9MA 1LQ1A 4Y17A 1S29A 3HRUA 4A3MJ 3WTWC 1KU2A 2MD0A 4RS8A 1NG6A 4XLPF 3W3CA 2M5WA 2OV7A 5F1JA 5BPDA 1Z9CA 2BY2A 2X85A 1ZN2A 3K4KA 4O3MA 3GTOJ 4II3A 5F1RA 1SFEA 1XSXA 2FX0A 2JSPA 5FLXZ 1I6XA 4YIRX 4E7LA 2Z99A 5CQEA 2XPUA 5IY5H 5DDGA 1TZLA 4OAZA 2ELHA 2LY1A 3K4JA 3F8CA 4KN4X 4A3LJ 2COBA 5JR3A 1WSUA 1K78A 2CV0A 2RGVA 2OPTA 1NG7A 3MMYB 4HX4A 5HS8A 5JLWA 2PMZN 5ICFA 4C3JJ 4NDLA 3ZQIA 4PFOA 5FKMA 3GYHX 1IN6A 2MC4A 2ME6A 5LRSA 1RETA 2RKHA 3AFHA 5HODA 3DP7A 3JRBA 2DA7A 1EJ9A 5AIQA 1SVMA 4DYRA 1KQ8A 3DLLF 4W97A 1J7KA 3DPLC 3L2UA 4RDUA 3HKZA 2DT7B 1W0TA 2FBKA 4XLCA 4U0WA 1HKQA 2ICWG 4XLHA 1I1SA 3WG7H 2ZXHA 4BE0A 2FNAA 3PIPF 1RIOH 4KISA 2FRHA 5HLIA 2XSJC 3HZJA 3TOAA 2K7LA 1Z7UA 2IS4A 4ON0A 3HDDA 3ZMZA 2DI3A 3A02A 4ZH4F 5FFZA 5LHHA 4L5EA 2HYFA 1DUXC 2STWA 4EJVA 4YIFA 2ID6A 1FOKA 5C44J 1Y8RB 1OCTC 3BR6A 5KCMA 2QZ8A 1I27A 1G3YA 5EDNA 3F23A 4EGZA 5E17F 3RKWA 3ABMH 1ON1A 1RC9A 1YOVB 1IUYA 4Z2YA 2JUGA 5IYDJ 1WPKA 4YFXF 2K27A 2PG4A 3KP7A 1XD7A 3AKZA 1BJZA 3MZYA 3TDUC 4AC0A 1UJ8A 1QVUA 3UKGA 2R7UA 1EH8A 2P7CB 3O6BB 4B09A 5H2FC 1FYLA 2DTZA 1UCRA 2XKOA 2E2IJ 4QPOA 1KU3A 2AQEA 2GIVA 1VQOI 3HSRA 1XGNA 4A2UA 3BZCA 3G71I 1MD0A 1DGRM 1G59A 1P6RA 2ZFUA 4WF2A 3FKIJ 2D1HA 1OR7C 3VSLA 5KHDA 1IO2A 2E5ZA 3LSTA 3CC2I 3IAM2 2HGCA 2LD5A 1W7PD 4FISA 2EQRA 4OIRF 4IOAF 4JBAA 5EG0B 1P7IA 2DA1A 2EFQA 1ZG1A 2EILH 2O5RA 1B72A 4C3IJ 2H1KA 5CPRB 4MFDA 3FKJA 5IOYA 1T39A 4I0BA 2Q0OA 1YW9A 2V6CA 3ZMVA 2K9QA 2OJED 2XDVA 3PNVA 1D1AA 2EB7A 5JLXA 3RPQA 3J7ZI 2ZB9A 5K5OA 4OIQF 4I76A 3H3UA 2IGNA 1FNNA 3DBHB 4Y15A 2CGPA 2XGXA 5DUIA 4O6JA 1SFXA 2W7NA 2VQHA 2G7UA 4F52A 3GZ5A 1JKPC 2O8KA 3Q0VA 2NVTJ 2HYJA 1GV5A 1BOBA 2LVSA 1RR7A 3HHHA 3VYTB 4MEXF 2DT6A 4ANJA 1ZG3A 4EQQA 2LYCA 2M8EA 1DP7P 5FRMA 4IEJA 3KYLA 4G94A 4I02A 5HDNA 1HC8A 1JGGA 4A93J 3DU6A 2K3PA 1D1BA 3HRMA 1BI0A 1F5TA 4BYYA 1SANA 1YIOA 2IT0A 4PDKA 4MO7A 3EETA 3RQ4A 4XLAA 1LVKA 1Q1HA 1JHFA 4ENNA 4PFPA 3TP0A 2BZTA 5DCMA 3HKZN 5HNHA 4BQQA 2ZJQF 3TEDA 2JTVA 2GLOA 4RAGA 1IXCA 5J47A 2ZCWA 1NTCA 3NEUA 3RYPA 4BE1A 2E60A 2JRTA 4HQMA 1OCZH 2DO7A 2LH9A 5D5VB 4JX6A 3FMRA 4XOTA 4MTDA 3D0SA 2XGEA 1EKEA 1MBJA 4HSRA 3OYFA 3KEOA 4FHTA 3KLOA 2HTJA 3BT9A 1S5LC 5J6XA 4HPQA 3TBIA 2PEXA 3LL7A 4D1QA 1ITYA 5D5XB 4IHXA 1YS6A 1IAWA 4FX4A 2JRMA 2W24A 4RA2A 3CCJI 2P5LC 2CS3A 2VKVA 3HM5A 2M87A 1LDJA 3CF5F 4AIJA 5KVRA 4BUPA 5K7HA 4L9VA 3VODA 5DV5A 1D0XA 3K9TA 3G6EI 5M5XJ 4OMZA 3HUGA 5FO5A 5L3CA 1WH5A 2KRHA 3HOYJ 3SYTA 4YFNF 3G1MA 3WTVC 2NRAC 3BTCA 4DW6A 3L2CA 4RB1A 1VQLI 5E3OA 1FTZA 5F27A 5K7FA 1ON2A 5ICCA 2WBMA 1KONA 1J75A 2OQRA 2CMPA 1MSFC 2JT1A 4IHYA 2VJJA 1MBHA 5E20A 5L3EA 3S2HJ 1ZHFA 1HBXG 4UNOA 2NOGA 2R7XA 2FD5A 1Z6RA 2M1BA 4E7ZA 1W7PB 2E5NA 2Z33A 2Y2ZA 3P7NA 4A3GJ 1P4AA 1JT6A 2FOWA 2IA1A 4Y52J 1F43A 1TL8A 4A3IJ 4BS9A 4GDFA 4CYDA 4U87A 4LLLA 3TW7A 1I3AA 4YEJA 2DAOA 3H0DA 3JTHA 2XIGA 1LUJB 1Z0XA 4LITA 1X3WB 2HZDA 3CJTB 1IN5A 1U5TB 5GAEJ 5H6QA 4LB5A 4HX7A 4DYQA 2HVRA 2V4JC 2H6BA 4E6KG 4U7DA 3RIRA 5CJ9A 1O7FA 1TNTA 4OOIA 2VQCA 4XSZF 1F36A 1OCCH 2RN7A 2F5FA 3BZKA 3ZMUA 5GPCA 2L7ZA 4AU7A 1ZAOA 3D5LA 4ZDPA 4Z6YA 1VQMI 2L54A 3COAC 2P81A 2BVMA 2W00A 2P4WA 4F55A 4E7HA 4LIUA 4MGRA 2D5VA 1DPRA 2DLLA 2VKEA 3M9AA 2PLYA 2BY3A 4XOPA 1KA8A 2E1OA 4XLNF 3DPUA 1DQUA 3RKXA 2K9LA 3FXMA 2FA5A 3QU6A 5HS7A 3ZN1A 2HQRA 1I6HJ 2WTEA 2L9SA 3CF2A 3QWLA 4EJOA 1STZA 3WE3A 1WJCA 4F92B 1MH4A 1E3PA 2MA3A 3S3NA 3DBLB 1FYKA 4IHSA 5GTHC 4XORA 3GTGJ 1JKOC 4UHTA 1LEBA 2X1DA 1LEAA 1UZCA 1ORKA 2E1MC 2EK5A 5GADJ 3IKVA 4AIKA 1YJWI 4CHUA 2EZLA 2P8TA 1FSEA 3KPHA 1Z05A 2H8WA 2E71A 2OF7A 1W5TA 2ME0A 3I59B 1WJEA 4AIDA 4EATA 1ERDA 2JN6A 1FJLA 1QBJA 3PL8A 4CYCB 4M3DA 3M4OJ 5J1YA 5EYRA 4R1HA 3CZ6A 5TJJA 3ZQQA 3RCOA 4BACA 1AU7A 3MZHA 1FEXA 5CQGA 2AXTC 1YITI 3FISA 4L0YB 3REOA 4IXAA 1IN7A 4L9TA 4BJTA 4I2OA 3GX4X 1IV6A 5DM6F 1TWCJ 4RGSA 1EH7A 2V9KA 1W5SA 2NVUB 5E18F 4PJ0C 2M7BA 2A69F 5IP9J 2ZJRF 3H1CA 4HRIA 1HA8A 1N75A 4L5JA 1U78A 2FEZA 4LIVA 2LFBA 1MH3A 1H9TA 2ACJA 1X1CA 3HTUA 1WHUA 3M3YJ 1KQ9A 1V4RA 3WODF 1BIBA 3M8EA 5K5QA 2VT3A 1P9QC 4ITVA 3JAMK 2E36A 3E5UA 1MNDA 3P9IA 4KIBA 3K4LA 1HF0A 3G1LA 2M0MA 5FLVA 3E7LA 1QGPA 3P9CA 1AKHA 2OQGA 4M72A 4RAZA 5LHGA 4JOMA 5LBQA 3MFKA 1I5ZA 3K70C 1T0FC 2DK8A 3J80Z 2Z3YA 1ZG5A 2CV2A 2KIFA 1A6IA 4BXFA 1TW2A 3LFUA 2GZWA 5B5EC 1JKQC 2BE5F 2R7OA 3BROA 2KKOA 3NWTA 4G9YA 5F04A 1MBFA 1SFKA 1R1TA 4QWQA 4J01A 1GXPA 2L9NA 1GHCA 5E8GA 4G8XA 2BY1A 1OPCA 2W4SA 3DF8A 3TGNA 5ICEA
chains in the Genus database with same CATH topology
3OOUA 1FIPA 5J3LA 3VPRA 4A3JJ 5M3FJ 1H88C 1ETXA 2O9LA 4UUSA 1LFBA 2RAEA 2CQQA 2DA4A 4UUSB 1VFCA 1ZR2A 1ZK8A 4BBSJ 4M6VA 3GTPJ 4XICA 2DA5A 3ZQLA 1LFUP 2HXOA 1W0UA 3BQZA 2LTPA 3Q0WA 4XRMA 4C3HJ 2DA6A 1H8AC 2HOSA 1A5JA 1GUUA 3HB9A 2IAIA 2NVQJ 3SDGA 2JA8J 2YU9J 2HOTA 4FTHA 5IOZA 1POGA 2DN0A 3OIOA 5EZHA 1IC8A 1EF4A 1JTYA 3JRDA 2DMNA 4W1UA 1H89C 2G0EA 3PO3J 4MFEA 1Q1VA 2M9HA 2LK2A 1HDPA 3I4NJ 4V2GA 4D5CA 3LSJA 4I6ZA 1RESA 3NAUA 1S7EA 3FIWA 4DZPA 1E3OC 3S1QJ 3HGYA 1HLVA 3LSRA 1ZKGA 1ETYA 2ECCA 2L7MP 4A3MJ 1JUPA 3Q0UA 3OSGA 3IV5A 3S2DJ 1RKWA 2ECBA 3CCYA 1UG2A 3I4MJ 4FE4A 5F1JA 1AHDP 2DMTA 2TRTA 5EGOA 2EH3A 3CDLA 5EGOB 3GTOJ 2XPWA 2FX0A 4V2FA 1XG1A 2R0QC 5EF6A 2YUSA 2XPUA 3HOZJ 2JMWA 3S15J 2MSYA 4A3LJ 2COBA 3GTQJ 4XRSG 1FIAA 3MN2A 3W6VA 2OPTA 5JLWA 5EZGA 2PMZN 4BBRJ 4C3JJ 4NDLA 3ZQIA 5FKMA 2R5YA 1UHSA 2R5YB 1RKTA 2ME6A 1RETA 3PM1A 3LOCA 4A3KJ 3JRBA 5HODA 2DA7A 2XB0X 3HOWJ 4DYRA 4W97A 2AHQA 3QPSA 4RDUA 1ZQ3P 1W0TA 1OFCX 2CJJA 4A3DJ 3BG9A 4A3BJ 3BR2A 4XRSA 2R7ZJ 4S0HB 3K2AA 2LKXA 3HDDA 2HOAA 3A02A 3RQIA 1DU6A 4L5EA 1HDDC 2L0KA 1TWFJ 1P7JA 2ID6A 4A3CJ 5C44J 4AUXA 2Y31A 1OCTC 3BR6A 1IRZA 2I10A 4FE7A 1YRNA 5EDNA 4QTRA 1RPWA 2DJNA 3BTIA 2HQ5A 2JA5J 4C2MJ 2E2JJ 5IYDJ 1IJWC 5FKNA 1WPKA 2CUEA 2CU7A 3H3VK 5GPAA 4M3GA 1T56A 5E3NA 1BJZA 1ZGWA 1JT0A 4UUTA 3K7AJ 4AC0A 1QRYA 2GBYA 1QVUA 3UKGA 1T33A 4X6AJ 2MW8A 2DTZA 5DS9A 2NVXJ 1BL0A 4D7NA 1QPIA 2E2IJ 1D5YA 5M3MJ 1IGNA 1ZTRA 3B6AA 2JWTA 1U9OA 3F0CA 4ABZA 3GTMJ 2E2HJ 3FKIJ 3BQYA 2FJ1A 2HI3A 5C4JJ 1IG7A 2M34A 4DYCA 2LD5A 2EZIA 2AO9A 2K40A 2EQRA 4FISA 5EG0A 5F0CA 9ANTA 5EG0B 3HEFA 1P7IA 2DA1A 3JREA 3QPLA 3Q3SA 4MIMA 3JRIA 1CQTA 3S1MJ 1ENHA 2WB1N 1B72A 2X48A 2HDDA 4C3IJ 3H0GJ 1B72B 2H1KA 4MFDA 3IH2A 1ETQA 3S1NJ 5IOYA 1GDTA 2K9QA 5JLXA 2ZB9A 4I76A 1X2MA 3SFIA 2QCOA 2B63J 2CRGA 2MGQA 2NS8A 3BG5A 2VPRA 4RBOA 3HGGA 2CUFA 1JKPC 2O8KA 3Q0VA 2NVTJ 2HYJA 3TP3A 1GV5A 2M2EA 2LVSA 2M0CA 1RR7A 2JK3A 2Y0SN 3JRGA 5IPAA 2LR8A 2LY9A 1NK2P 4IEJA 4EEFG 3FK7A 2XRLA 1JGGA 4A93J 4D7MA 2R92J 2Y9ZA 3LSPA 1SANA 4MO7A 3G1OA 4B1RA 1QVTA 3BR3A 3SJMA 3HOUJ 2EZKA 3TP0A 2NS7A 1JTXA 5J1RA 3HKZN 3TEDA 2GLOA 2LLKA 2IBDA 1NTCA 3RKQA 2E19A 4LOCA 5FJ8J 1UMQA 4JX6A 4B3AA 1OCPA 2XGEA 4J19A 1MBJA 2DA2A 1OJLA 3BR1A 4G12A 5FKLA 3BT9A 5F0HA 3GTKJ 1ITYA 4IHXA 2N8GA 3BTLA 1TWGJ 1NK3P 4D5FA 2VKVA 3HM5A 3BR5A 1GT0C 5K7HA 1O4XA 3D1NI 3JRAA 5M5XJ 4GFBA 3GBGA 1WH5A 1WI3A 2W48A 3HOYJ 3G1MA 3IH3A 4JX5A 3BTCA 4DW6A 1FTTA 3A03A 2TCTA 4A3FJ 5E3OA 1YRNB 1FTZA 5F27A 5K7FA 1MSFC 4IHYA 1MBHA 1Z77A 1ETOA 3S2HJ 2NOGA 2FD5A 2KDZA 5M5WJ 3GTJJ 4M3FA 3JR9A 2Y2ZA 2L7FP 4A3GJ 3ZQGA 3A01A 1IUFA 1JT6A 3BG3A 2DMPA 4Y52J 1F43A 3A01B 4A3IJ 1TWAJ 4BY1J 1MBGA 2CQXA 1JKRC 3OSFA 1WCMJ 3TW7A 3BR0A 1Z0XA 1MSEC 1ZR4A 2NVYJ 3S1RJ 3GTLJ 1MBKA 4DYQA 5C3EJ 2KT0A 2HXIA 1U8BA 2H8RA 2O7OA 3O8HA 2LP0A 1F36A 2ID3A 5IYCJ 4A3EJ 3PO2J 2FQ4A 1B8IA 5F08A 5GPCA 2L7ZA 1B8IB 1IDZA 2R5ZA 1I50J 2XPVA 2P81A 2R5ZB 5GP9A 2D5VA 2WV1A 2VKEA 3BTJA 1XS9A 3ZQCA 3WHCA 4M3EA 2E1OA 4MLOA 3ZQFA 1BW6A 2XB5A 4B4CA 1X58A 1K83J 4FCYA 2M8GX 1R9TJ 3HBLA 5C4XJ 3S17J 1I6HJ 3HOXJ 2K9SA 1IDYA 1DU0A 1MH4A 4JYKA 1XC5A 2L9RA 2EZHA 3ZOBA 3GTGJ 3CMYA 1JKOC 4JX4A 3TW6A 1K61A 4IHVA 1ETWA 1ORKA 2R93J 2EZLA 2WAQN 5FLMJ 1HOMA 1Y1WJ 5F0FA 2EBIA 2Y30A 1WGXA 2JA7J 2OF7A 4AYBN 2ME0A 1I3QJ 2YS9A 4CYCA 2JN6A 1FJLA 2XSDC 4JP0A 4M3DA 4CYCB 1WH7A 3M4OJ 4BKXA 5J1YA 1TC3C 1VF9A 5EYRA 5BNGA 1GV2A 1AU7A 2DMUA 2XGCA 3WHBA 1FEXA 3HOVJ 5IYBJ 3FISA 4A69C 3RZDJ 2DMQA 2X6OA 2XGDA 3LSGA 4QIWN 1IV6A 2JA6J 1TWCJ 1X2NA 2K9NA 3C2BA 3JRFA 3S16J 1JJ6C 2QF7A 5EEAA 2ELKA 2MG4A 5IP9J 1LE8A 4DZJA 1LE8B 1ETVA 1U78A 4X1EA 2LFBA 1MH3A 4Y7NJ 1TWHJ 3FK6A 3IH4A 2VUMJ 3DEWA 3M3YJ 3LNQA 1JJ8C 2IEKA 3O8GA 3NARA 3ZQHA 1BW5A 4HNVA 1ETKA 1PUFA 3B6CA 1VNDA 1U9NA 1PUFB 2X9DA 1HF0A 3G1LA 5FLVA 3E7LA 2Y9YA 1MNMC 1AKHA 1JUMA 5DTDA 1AKHB 2VI6A 2GM4A 1Y1VJ 5M5YJ 1A6IA 5FKOA 4BY7J 3MKLA 1VI0A 4M3BA 4XK4A 4IHWA 3JRHA 1JUSA 1JKQC 3MVPA 5IP6A 1HCRA 2DA3A 5FKKA 5E3LA 3DCFA 5F04A 3L1PA 1MBFA 1BA5A 3QQAA 1SFOJ 1GVDA 5IP7J 2JJ7A 1G2HA 3CQZJ 5J1UA 5K7ZA 4BXXJ 4QSHA 1MBEA 3S14J 4XIDA 3JRCA 3RZOJ 1APLC 5E3MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3OOU A;  1FIP A;  5J3L A;  3VPR A;  4A3J J;  5M3F J;  1H88 C;  1ETX A;  2O9L A;  4UUS A;  1LFB A;  2RAE A;  2CQQ A;  2DA4 A;  4UUS B;  1VFC A;  1ZR2 A;  1ZK8 A;  4BBS J;  4M6V A;  3GTP J;  4XIC A;  2DA5 A;  3ZQL A;  1LFU P;  2HXO A;  1W0U A;  3BQZ A;  2LTP A;  3Q0W A;  4XRM A;  4C3H J;  2DA6 A;  1H8A C;  2HOS A;  1A5J A;  1GUU A;  3HB9 A;  2IAI A;  2NVQ J;  3SDG A;  2JA8 J;  2YU9 J;  2HOT A;  4FTH A;  5IOZ A;  1POG A;  2DN0 A;  3OIO A;  5EZH A;  1IC8 A;  1EF4 A;  1JTY A;  3JRD A;  2DMN A;  4W1U A;  1H89 C;  2G0E A;  3PO3 J;  4MFE A;  1Q1V A;  2M9H A;  2LK2 A;  1HDP A;  3I4N J;  4V2G A;  4D5C A;  3LSJ A;  4I6Z A;  1RES A;  3NAU A;  1S7E A;  3FIW A;  4DZP A;  1E3O C;  3S1Q J;  3HGY A;  1HLV A;  3LSR A;  1ZKG A;  1ETY A;  2ECC A;  2L7M P;  4A3M J;  1JUP A;  3Q0U A;  3OSG A;  3IV5 A;  3S2D J;  1RKW A;  2ECB A;  3CCY A;  1UG2 A;  3I4M J;  4FE4 A;  5F1J A;  1AHD P;  2DMT A;  2TRT A;  5EGO A;  2EH3 A;  3CDL A;  5EGO B;  3GTO J;  2XPW A;  2FX0 A;  4V2F A;  1XG1 A;  2R0Q C;  5EF6 A;  2YUS A;  2XPU A;  3HOZ J;  2JMW A;  3S15 J;  2MSY A;  4A3L J;  2COB A;  3GTQ J;  4XRS G;  1FIA A;  3MN2 A;  3W6V A;  2OPT A;  5JLW A;  5EZG A;  2PMZ N;  4BBR J;  4C3J J;  4NDL A;  3ZQI A;  5FKM A;  2R5Y A;  1UHS A;  2R5Y B;  1RKT A;  2ME6 A;  1RET A;  3PM1 A;  3LOC A;  4A3K J;  3JRB A;  5HOD A;  2DA7 A;  2XB0 X;  3HOW J;  4DYR A;  4W97 A;  2AHQ A;  3QPS A;  4RDU A;  1ZQ3 P;  1W0T A;  1OFC X;  2CJJ A;  4A3D J;  3BG9 A;  4A3B J;  3BR2 A;  4XRS A;  2R7Z J;  4S0H B;  3K2A A;  2LKX A;  3HDD A;  2HOA A;  3A02 A;  3RQI A;  1DU6 A;  4L5E A;  1HDD C;  2L0K A;  1TWF J;  1P7J A;  2ID6 A;  4A3C J;  5C44 J;  4AUX A;  2Y31 A;  1OCT C;  3BR6 A;  1IRZ A;  2I10 A;  4FE7 A;  1YRN A;  5EDN A;  4QTR A;  1RPW A;  2DJN A;  3BTI A;  2HQ5 A;  2JA5 J;  4C2M J;  2E2J J;  5IYD J;  1IJW C;  5FKN A;  1WPK A;  2CUE A;  2CU7 A;  3H3V K;  5GPA A;  4M3G A;  1T56 A;  5E3N A;  1BJZ A;  1ZGW A;  1JT0 A;  4UUT A;  3K7A J;  4AC0 A;  1QRY A;  2GBY A;  1QVU A;  3UKG A;  1T33 A;  4X6A J;  2MW8 A;  2DTZ A;  5DS9 A;  2NVX J;  1BL0 A;  4D7N A;  1QPI A;  2E2I J;  1D5Y A;  5M3M J;  1IGN A;  1ZTR A;  3B6A A;  2JWT A;  1U9O A;  3F0C A;  4ABZ A;  3GTM J;  2E2H J;  3FKI J;  3BQY A;  2FJ1 A;  2HI3 A;  5C4J J;  1IG7 A;  2M34 A;  4DYC A;  2LD5 A;  2EZI A;  2AO9 A;  2K40 A;  2EQR A;  4FIS A;  5EG0 A;  5F0C A;  9ANT A;  5EG0 B;  3HEF A;  1P7I A;  2DA1 A;  3JRE A;  3QPL A;  3Q3S A;  4MIM A;  3JRI A;  1CQT A;  3S1M J;  1ENH A;  2WB1 N;  1B72 A;  2X48 A;  2HDD A;  4C3I J;  3H0G J;  1B72 B;  2H1K A;  4MFD A;  3IH2 A;  1ETQ A;  3S1N J;  5IOY A;  1GDT A;  2K9Q A;  5JLX A;  2ZB9 A;  4I76 A;  1X2M A;  3SFI A;  2QCO A;  2B63 J;  2CRG A;  2MGQ A;  2NS8 A;  3BG5 A;  2VPR A;  4RBO A;  3HGG A;  2CUF A;  1JKP C;  2O8K A;  3Q0V A;  2NVT J;  2HYJ A;  3TP3 A;  1GV5 A;  2M2E A;  2LVS A;  2M0C A;  1RR7 A;  2JK3 A;  2Y0S N;  3JRG A;  5IPA A;  2LR8 A;  2LY9 A;  1NK2 P;  4IEJ A;  4EEF G;  3FK7 A;  2XRL A;  1JGG A;  4A93 J;  4D7M A;  2R92 J;  2Y9Z A;  3LSP A;  1SAN A;  4MO7 A;  3G1O A;  4B1R A;  1QVT A;  3BR3 A;  3SJM A;  3HOU J;  2EZK A;  3TP0 A;  2NS7 A;  1JTX A;  5J1R A;  3HKZ N;  3TED A;  2GLO A;  2LLK A;  2IBD A;  1NTC A;  3RKQ A;  2E19 A;  4LOC A;  5FJ8 J;  1UMQ A;  4JX6 A;  4B3A A;  1OCP A;  2XGE A;  4J19 A;  1MBJ A;  2DA2 A;  1OJL A;  3BR1 A;  4G12 A;  5FKL A;  3BT9 A;  5F0H A;  3GTK J;  1ITY A;  4IHX A;  2N8G A;  3BTL A;  1TWG J;  1NK3 P;  4D5F A;  2VKV A;  3HM5 A;  3BR5 A;  1GT0 C;  5K7H A;  1O4X A;  3D1N I;  3JRA A;  5M5X J;  4GFB A;  3GBG A;  1WH5 A;  1WI3 A;  2W48 A;  3HOY J;  3G1M A;  3IH3 A;  4JX5 A;  3BTC A;  4DW6 A;  1FTT A;  3A03 A;  2TCT A;  4A3F J;  5E3O A;  1YRN B;  1FTZ A;  5F27 A;  5K7F A;  1MSF C;  4IHY A;  1MBH A;  1Z77 A;  1ETO A;  3S2H J;  2NOG A;  2FD5 A;  2KDZ A;  5M5W J;  3GTJ J;  4M3F A;  3JR9 A;  2Y2Z A;  2L7F P;  4A3G J;  3ZQG A;  3A01 A;  1IUF A;  1JT6 A;  3BG3 A;  2DMP A;  4Y52 J;  1F43 A;  3A01 B;  4A3I J;  1TWA J;  4BY1 J;  1MBG A;  2CQX A;  1JKR C;  3OSF A;  1WCM J;  3TW7 A;  3BR0 A;  1Z0X A;  1MSE C;  1ZR4 A;  2NVY J;  3S1R J;  3GTL J;  1MBK A;  4DYQ A;  5C3E J;  2KT0 A;  2HXI A;  1U8B A;  2H8R A;  2O7O A;  3O8H A;  2LP0 A;  1F36 A;  2ID3 A;  5IYC J;  4A3E J;  3PO2 J;  2FQ4 A;  1B8I A;  5F08 A;  5GPC A;  2L7Z A;  1B8I B;  1IDZ A;  2R5Z A;  1I50 J;  2XPV A;  2P81 A;  2R5Z B;  5GP9 A;  2D5V A;  2WV1 A;  2VKE A;  3BTJ A;  1XS9 A;  3ZQC A;  3WHC A;  4M3E A;  2E1O A;  4MLO A;  3ZQF A;  1BW6 A;  2XB5 A;  4B4C A;  1X58 A;  1K83 J;  4FCY A;  2M8G X;  1R9T J;  3HBL A;  5C4X J;  3S17 J;  1I6H J;  3HOX J;  2K9S A;  1IDY A;  1DU0 A;  1MH4 A;  4JYK A;  1XC5 A;  2L9R A;  2EZH A;  3ZOB A;  3GTG J;  3CMY A;  1JKO C;  4JX4 A;  3TW6 A;  1K61 A;  4IHV A;  1ETW A;  1ORK A;  2R93 J;  2EZL A;  2WAQ N;  5FLM J;  1HOM A;  1Y1W J;  5F0F A;  2EBI A;  2Y30 A;  1WGX A;  2JA7 J;  2OF7 A;  4AYB N;  2ME0 A;  1I3Q J;  2YS9 A;  4CYC A;  2JN6 A;  1FJL A;  2XSD C;  4JP0 A;  4M3D A;  4CYC B;  1WH7 A;  3M4O J;  4BKX A;  5J1Y A;  1TC3 C;  1VF9 A;  5EYR A;  5BNG A;  1GV2 A;  1AU7 A;  2DMU A;  2XGC A;  3WHB A;  1FEX A;  3HOV J;  5IYB J;  3FIS A;  4A69 C;  3RZD J;  2DMQ A;  2X6O A;  2XGD A;  3LSG A;  4QIW N;  1IV6 A;  2JA6 J;  1TWC J;  1X2N A;  2K9N A;  3C2B A;  3JRF A;  3S16 J;  1JJ6 C;  2QF7 A;  5EEA A;  2ELK A;  2MG4 A;  5IP9 J;  1LE8 A;  4DZJ A;  1LE8 B;  1ETV A;  1U78 A;  4X1E A;  2LFB A;  1MH3 A;  4Y7N J;  1TWH J;  3FK6 A;  3IH4 A;  2VUM J;  3DEW A;  3M3Y J;  3LNQ A;  1JJ8 C;  2IEK A;  3O8G A;  3NAR A;  3ZQH A;  1BW5 A;  4HNV A;  1ETK A;  1PUF A;  3B6C A;  1VND A;  1U9N A;  1PUF B;  2X9D A;  1HF0 A;  3G1L A;  5FLV A;  3E7L A;  2Y9Y A;  1MNM C;  1AKH A;  1JUM A;  5DTD A;  1AKH B;  2VI6 A;  2GM4 A;  1Y1V J;  5M5Y J;  1A6I A;  5FKO A;  4BY7 J;  3MKL A;  1VI0 A;  4M3B A;  4XK4 A;  4IHW A;  3JRH A;  1JUS A;  1JKQ C;  3MVP A;  5IP6 A;  1HCR A;  2DA3 A;  5FKK A;  5E3L A;  3DCF A;  5F04 A;  3L1P A;  1MBF A;  1BA5 A;  3QQA A;  1SFO J;  1GVD A;  5IP7 J;  2JJ7 A;  1G2H A;  3CQZ J;  5J1U A;  5K7Z A;  4BXX J;  4QSH A;  1MBE A;  3S14 J;  4XID A;  3JRC A;  3RZO J;  1APL C;  5E3M A; 
#chains in the Genus database with same CATH topology
 1P2F A;  2GA2 A;  3QP6 A;  4A3J J;  1H88 C;  2EV6 A;  4UUS A;  2RAE A;  2CQQ A;  2HS5 A;  1FSH A;  3F21 A;  3HRT A;  4XIC A;  4BQA A;  4AWX B;  4ETS A;  1LFU P;  3ZXS A;  1W0U A;  1Z7L A;  3LSH A;  3Q0W A;  5B3S H;  3U9G A;  2KP6 A;  2DA6 A;  4P1W A;  2RQQ A;  3KEY A;  1CF7 A;  1G6N A;  3CO6 C;  2GQQ A;  2VJI A;  4CCO A;  2NVQ J;  1VZ0 A;  3ELK A;  2RRE A;  4F93 B;  1J0R A;  3OYM A;  4FTH A;  3S32 A;  4HDV A;  3J80 K;  1Z67 A;  4M9S A;  4P55 A;  2VXD A;  4RB0 A;  3OYN A;  3OIO A;  5EZH A;  3V4G A;  3JRD A;  4J00 A;  4W1U A;  1QPM A;  5D5U B;  4MFE A;  2W1O A;  2UXX A;  3O2P E;  1FP1 D;  2EIN H;  4CSW A;  2LK2 A;  4BEH A;  3S8P A;  2ZJ2 A;  2WAE A;  4OAY A;  4HLY A;  1SAX A;  4D5C A;  4I6Z A;  4U0V A;  2XAH A;  3F6O A;  1V5G A;  2F4I A;  4L9J A;  4XM3 A;  3J7A Y;  5DUK A;  4RGX A;  2BHY A;  1JUP A;  3Q0U A;  3OSG A;  3OL3 A;  1RRJ A;  4EM2 A;  2VJ5 A;  3RI4 A;  3WU2 C;  1AHD P;  2DMT A;  1X4P A;  5KK1 A;  5EGO A;  3NRV A;  2IXS A;  2EH3 A;  2Y0M A;  3CDL A;  4HZF A;  2XPW A;  1BJA A;  4V2F A;  2ZNY A;  1OR7 A;  1XCB A;  2R0Q C;  2AXL A;  2HDC A;  2QKM B;  2VBZ A;  5TIS C;  3HOZ J;  5K1Y A;  4L5I A;  3IUO A;  2P6S A;  1HSJ A;  3PSI A;  5CVI A;  2KJB A;  1FIA A;  5FB2 A;  3KP2 A;  3MN2 A;  1K78 B;  3L09 A;  1A36 A;  2R7V A;  4MQV A;  3BDD A;  2R5Y A;  2GOM A;  3OY9 A;  1R6R A;  2RNG A;  3HPH A;  1RKT A;  2CQK A;  3FF5 A;  4LLG F;  2XB0 X;  3HOS A;  4GYI A;  4IRG A;  4Q48 A;  4HNT A;  1NHA A;  3CCU I;  2GWR A;  1ZQ3 P;  3WTZ A;  2CJJ A;  3EPZ A;  4GXO A;  4BL0 B;  2LKS A;  4C9Y A;  4LK1 F;  4EVI A;  3MKY B;  1Z91 A;  2P6T A;  4A3D J;  3ECH A;  3BG9 A;  4XKB A;  2JVG A;  3BR2 A;  3DBR B;  2RV8 A;  4XRS A;  3EYY A;  5H20 A;  4U7B A;  2XAF A;  1OLT A;  5LLQ A;  2HOA A;  4N4N B;  4ZJZ A;  3RQI A;  2CUZ A;  2K9M A;  4RM2 A;  1F1Z A;  1R5H A;  1TWF J;  2WV0 A;  4AUX A;  1IRZ A;  4UY8 I;  3H3Z A;  3PFI A;  2W84 A;  4NNJ A;  2DJN A;  3FHN A;  2KL4 A;  2HQ5 A;  4CA0 A;  2JA5 J;  2OTL I;  2W57 A;  2LNB A;  2ZKZ A;  3GZN B;  1YYV A;  2CU7 A;  2ZSH B;  4M3G A;  4HX8 A;  2HTS A;  1J2X A;  2DDA A;  4EM1 A;  3K7A J;  4N4O B;  1QRY A;  1T33 A;  2VT2 A;  3EUA A;  4O5V A;  4B3X A;  2MW8 A;  3FXJ A;  3C18 A;  1BL0 A;  3ABT A;  3OS1 A;  2L3D A;  1TNS A;  3LA3 A;  4U0Y A;  1K79 A;  1D5Y A;  1ZTR A;  2OBP A;  2X4H A;  4IPA A;  3ONQ A;  4ABZ A;  3GTM J;  3OYD A;  1IRG A;  3G2B A;  4LFU A;  1OMI A;  4DNC A;  2VBX A;  3DV8 A;  2FJ1 A;  1FC3 A;  3U21 A;  2A5W A;  1IG7 A;  2BXY A;  1B9N A;  1G8X A;  4PGG A;  2K40 A;  4PSW A;  3VDX A;  5FRN A;  4LGW A;  3JRI A;  1ENH A;  4IOC F;  1QU3 A;  5JHF A;  1IRX A;  1B72 B;  2VN2 A;  3CCS I;  1ULY A;  3HSF A;  4XSX F;  3SZG A;  4BDY A;  2FBH A;  3DPT A;  2A68 F;  2MH2 A;  2NNN A;  5B1B H;  3QOD A;  1X2M A;  2KRC A;  2V9V A;  2CRG A;  1XMA A;  4BHC A;  1YX3 A;  2R7W A;  3BG5 A;  2VPR A;  4Y4R A;  3G4S I;  1EH6 A;  2MFZ A;  2BEO A;  3HGG A;  3OIP A;  1RUN A;  4XON A;  3SEZ A;  1FY7 A;  2BXZ A;  2KJC A;  2JK3 A;  3ZPL A;  1OQY A;  3E1S A;  3OYI A;  2Z5U A;  1O3R A;  5IPA A;  2LR8 A;  3DEU A;  3MZ8 A;  1RZ4 A;  2YSR A;  1MJ9 A;  3PJR A;  2BYV E;  3IKT A;  2XRL A;  1T38 A;  5JVT A;  4NBQ A;  4D7M A;  3E6B A;  2FQ3 A;  1X4O A;  2XAG A;  3G1O A;  1BC7 C;  1QVT A;  2XAS A;  2V79 A;  2EZK A;  4F3Q A;  1JTX A;  3PNT A;  5J1R A;  4M71 A;  2HDW A;  5DCM B;  2LSO A;  3GFI A;  3GFM A;  4PCQ A;  3ZCO A;  4I01 A;  5IT3 A;  2B7E A;  2X6Y A;  5JHU A;  3KYD B;  4LOC A;  1K7A A;  2NXN B;  5FJ8 J;  3F8F A;  1JI8 A;  2HOE A;  2L02 A;  4AYB A;  3IC7 A;  4FT8 A;  1QA6 A;  5BPI A;  3NWS A;  3PIO F;  3BR1 A;  2KMU A;  3I0T A;  1WWX A;  4G12 A;  3GTK J;  2HWV A;  3LSK A;  1TLH B;  2N8G A;  4OWR B;  3IP4 B;  2EFO A;  1UAA A;  1W1W E;  4KDP A;  1NK3 P;  4D5F A;  3B73 A;  3DKW A;  3LQQ A;  5JI6 A;  3P9K A;  4GFB A;  1HKT A;  3WU1 B;  2ISY A;  3E5Q A;  3HUG B;  1HW5 A;  2W48 A;  4Y13 A;  1LVA A;  1TP4 A;  3EQL F;  1O7L A;  2EIK H;  2VXZ A;  3TO6 A;  1XPX A;  4KMU X;  1YRN B;  2QQB A;  2VKH A;  2F5V A;  2DPU A;  3LA2 A;  5FRO A;  2MBF A;  1YLF A;  3A4C A;  1VQP I;  1D1C A;  1Z77 A;  1ETO A;  4NQW A;  4ENJ A;  2QSG X;  2KDZ A;  3FXK A;  3FHZ A;  1R4N B;  4M3F A;  2L7F P;  3ZQG A;  3DXJ F;  3A01 A;  1IUF A;  1B59 A;  1S7A A;  3E0J B;  4Y33 A;  1GLN A;  4BAY A;  1TWA J;  5CKT A;  3RYR A;  3OYC A;  1J09 A;  1QZY A;  2CQX A;  4HQE A;  5ILU A;  1JKR C;  3AL0 C;  2VIX A;  3CTA A;  2DFH A;  4N0B A;  3W6J B;  4KIC A;  2F48 A;  2WA0 A;  2BOL A;  3I71 A;  3LSM A;  1UHM A;  2GXG A;  3FZV A;  4OMY A;  3S1R J;  2J5O A;  2X6X A;  3DFG A;  5C3E J;  2HXI A;  2OTJ I;  3DKY A;  1U8B A;  3O8H A;  2Q2E A;  3K1M A;  4D9J A;  4IL6 C;  3OYA A;  2FQ4 A;  2KIM A;  2R7S A;  1YJ9 I;  2H27 A;  3I64 A;  4UV9 A;  3RJP A;  4WXH A;  1SAU A;  4BU2 A;  3LQR A;  2O8X A;  1OKR A;  3ASN H;  3WHC A;  3EUH A;  2C6Y A;  1S8N A;  1T0F A;  4MLO A;  3ZQF A;  3K10 A;  1BW6 A;  2EPF A;  4DBQ A;  2XB5 A;  1TQM A;  1X58 A;  4FCY A;  1FYM A;  2M8G X;  1IV8 A;  1KZH A;  3ERE D;  2QBY A;  3O3K A;  1W36 D;  5C4X J;  4JQF A;  2FOK A;  2PI0 A;  2ETH A;  4EJW A;  2M30 A;  2EWN A;  1YJN I;  1XMX A;  2LRE A;  3DKX A;  1DU0 A;  2DPD A;  1B1B A;  2CQ7 A;  4JYK A;  5FFX A;  2ZXI A;  3T0Y A;  1HXD A;  5D6F A;  1GXQ A;  2GAU A;  3ZOB A;  3HJE A;  1TTY A;  4JX4 A;  1BI3 A;  3CCQ I;  5AIP A;  1ETW A;  3GXO A;  2GA1 A;  2JZY A;  2R93 J;  1HOM A;  5FLM J;  5F0F A;  2EBI A;  2HU9 A;  3H5R A;  3IRQ A;  4PJM A;  2Y30 A;  4ESF A;  4QLC U;  1WGX A;  4XMY A;  1R71 A;  4AYB N;  3E3V A;  2FE3 A;  3D5S C;  4CCL A;  3F8M A;  2EA2 A;  3KLN A;  1X1A A;  4JP0 A;  1WH7 A;  2QWW A;  1E2X A;  1ZAR A;  2DMU A;  2LMD A;  3FX3 A;  3K1N A;  5GTI C;  2XF5 A;  2RC4 A;  2HZT A;  4LB6 B;  1ZRC A;  3OYL A;  2K9N A;  4HST A;  3I4P A;  4LG0 A;  4DBR A;  5ICG A;  3FM5 A;  2BY0 A;  2VC0 A;  1SD4 A;  4G6D A;  4DZJ A;  3CUQ C;  2VBW A;  2XKP A;  4IRH A;  2OA4 A;  3CO7 C;  3T8T A;  3DTK A;  2UXN A;  4Y7N J;  1U2W A;  4UB6 C;  2O61 A;  3ZN0 A;  1HW1 A;  1MMD A;  2J5P A;  1IN8 A;  3IWZ A;  4XKC A;  3NAR A;  4PSX A;  1BW5 A;  1QHG A;  4M73 A;  3ML6 A;  4HNV A;  3HC7 A;  3ZRG A;  4ZDL A;  3HRS A;  1REP C;  1U9N A;  2X9D A;  2EIJ H;  4GRI A;  4KNY A;  1LPQ A;  3D5R C;  2VL8 A;  4A0Y A;  4RLQ A;  1JUM A;  2KLO A;  1AKH B;  2IA0 A;  3WE2 A;  1T98 A;  1R5I D;  2GM4 A;  1SD6 A;  1Y1V J;  3MWM A;  5M5Y J;  4BHP A;  1ACI A;  1P92 A;  3VYR B;  1YX5 A;  2DW4 A;  3TKY A;  1BBY A;  4M3B A;  4A12 A;  2DFI A;  1IN4 A;  3HG9 A;  4XK4 A;  4IHW A;  4RGU A;  3JRH A;  2K5C A;  1JUS A;  4KUM A;  3EYI A;  1HCR A;  5FKK A;  3GO5 A;  4L9N A;  2E7W A;  4FX0 A;  3L1P A;  1BA5 A;  5LRR A;  1SFO J;  1GVD A;  1G2H A;  3OV8 A;  3BC8 A;  3JCU C;  2NNY A;  2XAJ A;  2ZC2 A;  1VQ8 I;  2PJR A;  3HXL A;  2X1C A;  1R4M B;  2OZ6 A;  4IX7 A;  4M9Z A;  4HLX A;  3KZZ A;  3GLX A;  1VQ9 I;  3CCE I;  5JVG F;  4ZC3 A;  4HAM A;  2O9L A;  1ETX A;  3IAS 2;  4XNF A;  1SC7 A;  2VB6 A;  2K85 A;  5B66 C;  2UUZ A;  3ASO H;  3E5X A;  3KIO A;  4UUS B;  4Q47 A;  4BBS J;  1T95 A;  4PK4 A;  3FXL A;  3C3W A;  3E97 A;  4IQ4 A;  4BGD A;  5ILS A;  1RR8 C;  2A3S A;  2VQL A;  4C3H J;  2L01 A;  4G6T B;  3I58 A;  3MCZ A;  2FUG 2;  3R60 A;  1H8A C;  1A6Q A;  1A5J A;  4B43 A;  3BOQ A;  1DDN A;  4KFC A;  1CF7 B;  2EIM H;  1Z3Y A;  3SDG A;  3FXU A;  4PUS A;  1FBU A;  1PVE A;  1DPU A;  4XKV A;  1MJB A;  4HA8 A;  1EF4 A;  1JTY A;  2O0Y A;  2DMN A;  3AG3 H;  2G0E A;  3DLA A;  5FD5 A;  3ZR8 X;  3JAM Z;  4WX9 A;  3PO3 J;  3RKY A;  2M9H A;  4RAY A;  4XN3 A;  5A2Q Z;  1SMT A;  2PN6 A;  1K6O A;  4M9X A;  1X19 A;  3A0B C;  4BEH B;  1MZB A;  2W82 A;  1Z6T A;  4CZZ A;  1DP3 A;  2WB1 A;  3NAU A;  3JSO A;  3F8B A;  4DZP A;  5HDK A;  3AG4 H;  5LFA A;  3HGY A;  1HLV A;  2CUJ A;  2STT A;  3LSR A;  3BZ6 A;  1PP8 F;  1ZKG A;  1G4D A;  3KZY A;  2PJP A;  3IV5 A;  1EA3 A;  3H35 A;  3RDI A;  2XV4 S;  5D4S A;  1IW7 F;  3S2D J;  4C30 A;  2JVH A;  3I4M J;  2L9V A;  4DOZ A;  2TRT A;  3HHG A;  4YFK F;  3QPT A;  1I39 A;  1OYY A;  5EGO B;  5HLT A;  1D8J A;  2VQG A;  1BC8 C;  1XG1 A;  4KYW A;  1U6G A;  4RLF A;  2CW7 A;  1G3S A;  5J40 A;  1XGM A;  4P9F A;  2Y0S A;  3CJN A;  3S15 J;  1OYI A;  5L3D A;  2CV1 A;  4HYE A;  4EV0 A;  4E7K A;  3GTQ J;  5BS6 A;  2YPR A;  1FLI A;  3W6V A;  2X6W A;  5EZG A;  4BBR J;  2DQR A;  4MQ9 F;  1UHS A;  1WJ5 A;  1IXS B;  2R5Y B;  1S72 I;  2MD5 A;  3PUB A;  4A3K J;  3ROU A;  4ESB A;  4JK1 X;  2CH0 A;  4LG3 A;  3BWG A;  1R00 A;  1M1E B;  2AHQ A;  1X1B A;  1RNL A;  3QPS A;  4UVC A;  3RTR A;  1SMY F;  4LK0 F;  3QAH A;  5A2Q K;  2DOD A;  2FNP A;  1OFC X;  1D5V A;  2DQL A;  3H36 A;  3AAF A;  2ZME C;  3SZP A;  1YQA A;  3K4C A;  4M74 A;  5EJC A;  4A3B J;  1O3Q A;  3GZ6 A;  2R7Z J;  4BHB A;  3K2A A;  4UV8 A;  3KP3 A;  1E3H A;  1JE8 A;  4XL9 A;  1PUE E;  2DOF A;  4NUB A;  2VBY A;  4DGW B;  1HDD C;  4IHT A;  2P0W A;  2L0K A;  1OIS A;  1OCR H;  3FMQ A;  3ZMT A;  5E1Z B;  1ZYR F;  3HL2 A;  3ZMD A;  3CJR B;  4E70 A;  3LAJ A;  2I10 A;  4FE7 A;  3L00 A;  1ZLJ A;  4QTR A;  3OYJ A;  1RPW A;  3BTI A;  3V7S A;  3KZI C;  2QQ8 A;  4H4K C;  4C2M J;  2E2J J;  5LEJ A;  1Y39 A;  1IJW C;  4XQF A;  1IZ1 A;  2CUE A;  3ESW B;  4PJN A;  2K02 A;  2LKP A;  3H3V K;  5GPA A;  3UNG C;  1QQI A;  1T56 A;  2LOO A;  3DU5 A;  2K4B A;  2H09 A;  2GBY A;  4S05 A;  2CSO A;  1ZRF A;  1JHH A;  2I5U A;  3GEZ A;  1SFU A;  1D0Z A;  2LG4 A;  1S3J A;  2L7K A;  3CES A;  4K2E A;  4D7N A;  5FD6 A;  1QPI A;  4PGH A;  1IGN A;  5M3M J;  3OOP A;  3I56 I;  4GYG A;  4MNU A;  1U9O A;  2COM A;  2JQ7 A;  2Z9O A;  2HPM A;  1R36 A;  2E2H J;  1UEL B;  2QEX I;  5ILV A;  3BQY A;  4F7Z A;  4CH7 A;  2QKL B;  1XX5 A;  3FDY A;  4DYC A;  2EZI A;  2GOX B;  3M1C A;  3CCM I;  9ANT A;  3HEF A;  1MDM A;  3SQN A;  1H0M A;  3QPL A;  3Q3S A;  4Q5S F;  2ZFW A;  4MIM A;  1V3F A;  3S1M J;  3JSP A;  2NOJ B;  3L7W A;  2WB1 N;  2QGU A;  3AG1 H;  4I99 C;  4ZYA A;  3KET A;  2HDD A;  1AOY A;  1W5C C;  4XLF A;  1ETQ A;  1GDT A;  3WGG A;  2AS5 F;  2E1C A;  1FMW A;  2VC1 A;  1IF1 A;  5HLG A;  4ZZD A;  2R7R A;  1G3T A;  4DQ2 A;  4OU0 A;  3ABU A;  2MAB A;  3KYC B;  1XMK A;  2KPM A;  1V54 H;  1OCO H;  1D8K A;  2DYS H;  1AWC A;  3PFY A;  2IS2 A;  4BE2 A;  2R7Q A;  1FX7 A;  1Z1D A;  3TP3 A;  2Y0S N;  3JRG A;  3WTY C;  3M7G A;  1YIJ I;  3NQO A;  3K2Z A;  1BI2 A;  2KHM A;  2LY9 A;  4KT6 A;  1KQ0 A;  4XR6 A;  1K4S A;  4IKF A;  2A61 A;  2ADU A;  4BH9 A;  2DDB A;  3LSP A;  2A05 A;  3K70 D;  2KZV A;  4B1R A;  2YX7 A;  3ERM A;  3SJM A;  3HOU J;  1WI9 A;  1YG2 A;  4CXF A;  2VON A;  3I53 A;  3N97 A;  2EFW A;  1T2K A;  1ZLK A;  1BR4 A;  2IBD A;  2LLK A;  4PJL A;  2XRO A;  3MAJ A;  2M3A A;  3ZQ7 A;  1XTA A;  2KDO A;  3FM3 A;  4B47 A;  5E79 C;  3RKQ A;  3PNY A;  2E19 A;  2QQ9 A;  3M8F A;  4A6E A;  5L3G A;  2HKX A;  2PQ8 A;  3OYB A;  5HS9 A;  4OIN F;  4II2 A;  2EFN A;  3P5J A;  5H6R A;  4J19 A;  2BGC A;  4P9U A;  5F64 A;  3W6K B;  4LLN A;  2WAF A;  3ZGK A;  1IXR C;  1Y6I A;  3SXY A;  2AQF A;  1WRJ A;  3PUF A;  1GT0 C;  3IWF A;  1O4X A;  4CCJ A;  2MH9 A;  2IP2 A;  3TO9 A;  3IH3 A;  3RPU A;  3IL2 A;  3BG7 A;  4JX5 A;  4I0A A;  2XF7 A;  3A03 A;  2TCT A;  4KA4 A;  4ZTJ A;  2K3F A;  2XRN A;  4AD9 A;  1V5E A;  1HW2 A;  2X0L A;  2V1D A;  4AM3 A;  1VQ7 I;  3CLQ A;  3BP8 A;  4NQW B;  4ZYG A;  2WY7 Q;  5M5W J;  3GTJ J;  1MMA A;  1YW8 A;  3K4B A;  3TQN A;  3BY6 A;  3A01 B;  4V19 K;  2UWM A;  3OR1 C;  2VE9 A;  2UZK A;  3DEE A;  1FOW A;  1YTY A;  4BY1 J;  2QQA A;  5D8K B;  1MBG A;  3E6C C;  3M07 A;  1WCM J;  4ASN A;  1VQ5 I;  3BR0 A;  1L3L A;  2PMH A;  2LBF A;  5J4V A;  3F72 A;  3KE2 A;  1MSE C;  3CUQ A;  1UB9 A;  1ZR4 A;  2NVY J;  1MBK A;  3WGI A;  2RVC A;  3PQK A;  2A6T A;  2LC2 A;  1U3E M;  2B0L A;  3I3L A;  3BJ6 A;  2O7O A;  1F9N A;  5IYC J;  3G73 A;  5LEK A;  2OAZ A;  2Q2E B;  4A3E J;  3L9F A;  2KIS A;  3PO2 J;  4I7H A;  1B8I A;  5F08 A;  1D3Y A;  2A6H F;  1IDZ A;  2L2O A;  4L0Z B;  2Y48 A;  2R5Z A;  3GFJ A;  2XPV A;  2A5Y B;  5GP9 A;  2B9S A;  3F6V A;  4FET A;  4RM3 A;  3VYS B;  4EGY A;  5CYV A;  1TT0 A;  3F8N A;  3BTJ A;  3H9J A;  2NAZ A;  3OS0 A;  3A2K A;  2JPB A;  3F9K A;  4IJA A;  4E4H A;  4B4C A;  1K83 J;  5CVJ A;  1R9T J;  1Y0N A;  2QBY B;  3S17 J;  2X51 A;  2W25 A;  2WY8 Q;  3VOE A;  2D45 A;  2XUB A;  2BBY A;  4UVA A;  1D0Y A;  1XC5 A;  3GFL A;  2DU9 A;  4X0G A;  2F5C A;  1N78 A;  4EMS A;  3WG9 A;  2L9R A;  4A5N A;  2EZH A;  4C2T A;  3E6M A;  4EJT A;  2A07 F;  3SZT A;  5EEG A;  3TW6 A;  2ISZ A;  1R5G A;  3E6D A;  4ZTF A;  3HOT A;  4HF1 A;  4AIH A;  2BW3 A;  2KFD A;  3BCB A;  1BN5 A;  3Q9S A;  2IVM A;  4XRF A;  4FQG A;  2JA7 J;  2IA2 A;  4RAF A;  1SD7 A;  3TOB A;  1I3Q J;  1FWZ A;  4LJZ F;  3I5U A;  2HQA A;  3OIQ A;  5BNG A;  1GV2 A;  1T6S A;  4KIT B;  3WHB A;  2XGC A;  2RDP A;  2F4O B;  2HVQ A;  3CC7 I;  1C0W A;  4A69 C;  4XLE A;  3RZD J;  5EEH A;  4QIW N;  3WTU C;  2JA6 J;  1SEU A;  3BLY A;  3JRF A;  2QSF X;  1O3T A;  2XHK A;  2QEN A;  4LG0 B;  2QF7 A;  4UB8 C;  4LD5 A;  5EEA A;  2MG4 A;  3C1D A;  1P4X A;  5GAH J;  1U5T C;  1LE8 A;  5ERI A;  3K0L A;  4ZDO A;  1ETV A;  1MMG A;  3OYH A;  3LWF A;  5LD2 C;  2IS6 A;  1QO0 D;  2M4K A;  1WQ2 A;  2L5Q A;  3GCM A;  1WJF A;  3R0A A;  1W36 C;  3FK6 A;  1HQC A;  3IH4 A;  4BNC A;  3DEW A;  2VUM J;  3CCR I;  1JJ8 C;  2E1N A;  4QPQ A;  3HIF A;  2CFO A;  3KP4 A;  4Q4Z F;  2MLK A;  3ZQH A;  3K6G A;  4BQO A;  1ETK A;  4IVN A;  5D5W B;  1PUF A;  5LHI A;  2YU3 A;  2L4A A;  2FML A;  2R4G A;  1BI1 A;  3GF2 A;  3Q9V A;  3CC4 I;  2DXI A;  1MNM C;  1S7O A;  3RSN A;  5DTD A;  2Z16 A;  1HKS A;  4R79 A;  1UHW A;  1FPQ A;  3FBI B;  4P5O A;  1R1U A;  4BY7 J;  3MKL A;  2JUC A;  3W2V A;  1VI0 A;  5CVU A;  1XGO A;  2HNH A;  1NH3 A;  5IP6 A;  5AON A;  5E3L A;  2M7A A;  3DCF A;  4U88 A;  3C7J A;  4D0P A;  5HDG A;  1PYV A;  3QQA A;  1O3S A;  5IP7 J;  2JJ7 A;  1N25 A;  3CP2 A;  3PQJ A;  5J1U A;  4BXU A;  3DWL E;  5K7Z A;  4BXX J;  4KMF A;  4I09 A;  2PJR B;  3S14 J;  5FLX K;  3JRC A;  3HTS B;  1APL C;  4BQN A;  5E3M A;  4YRV A;  3OOU A;  2KQR A;  4HG2 A;  1FIP A;  2Z2S B;  2LDU A;  2RQP A;  5E8I A;  2IS1 A;  5J3L A;  1TQP A;  2KRF A;  2L4M A;  3VEP A;  3VPR A;  4GCV A;  4IRI A;  2DJI A;  2DA4 A;  3L2V A;  1ZR2 A;  1LJ9 A;  4HF0 A;  3ECO A;  4ENM A;  3GTP J;  2OD5 A;  2JSC A;  1RUO A;  3QPH A;  2WWY A;  3ZQL A;  4H0E A;  3H5N A;  3CLO A;  3N05 A;  3KP6 A;  2HXO A;  3CCL I;  4E7J A;  3MKZ A;  4XN0 A;  2JPC A;  1FOX A;  2CG4 A;  4KIG A;  4E7I A;  2HOS A;  1Z3X A;  1VQK I;  2FXA A;  3HB9 A;  2IAI A;  2ZME A;  3FXO A;  2DYR H;  1XB4 A;  3KFW X;  2Y69 H;  5BQT A;  1A04 A;  3WTS C;  2HOT A;  2Q8K A;  1XDS A;  3CP8 A;  1POG A;  3R6S A;  1BOA A;  2DN0 A;  2VAS A;  4YEL A;  4RB3 C;  2Q1Z B;  3GUD A;  3LAP A;  1IC8 A;  1H89 C;  2DBB A;  1Q1V A;  5HOO A;  5DCF A;  2ZO4 A;  3BCA A;  1HDP A;  3GME A;  5DEQ A;  2VKD A;  2CYY A;  2ZBK A;  1MMN A;  5DYM A;  3W2W A;  3LSJ A;  1YFH A;  5F6F A;  4HNU A;  3S3M A;  2F6C A;  2Z1D A;  3QRF F;  3OMY A;  2WC2 A;  3OYE A;  1E3O C;  3OL4 A;  3S1Q J;  2HVS A;  3AG2 H;  1FOY A;  4KN7 X;  3WTT C;  1ETY A;  2ECC A;  2DFF A;  2OCE A;  1K4T A;  4AVP A;  2L7M P;  4N9I A;  5KNL A;  1RKW A;  1YHQ I;  5DD4 A;  4S04 A;  2ECB A;  3CCY A;  2IRF G;  1UG2 A;  4FE4 A;  1A35 A;  2V1U A;  2ZJP F;  1N77 A;  2O3F A;  2F5E A;  3VYU B;  1BR1 A;  2A6E F;  2CWE A;  4ESJ A;  1I1G A;  5EF6 A;  2YUS A;  2JMW A;  1MKM A;  2MLG A;  1XN7 A;  2MSY A;  3GWZ A;  1OYW A;  1T8I A;  2FF4 A;  4XRS G;  1MW7 A;  5L3F A;  2H6C A;  1EV7 A;  4EM0 B;  4IO9 F;  4NB5 A;  5TGT A;  4B48 A;  2DK5 A;  2R7F A;  3PM1 A;  1WZ2 A;  3LOC A;  2HQN A;  3MQ0 A;  3HOW J;  4YG2 F;  1T08 B;  4PZJ A;  2YR2 A;  2VPL A;  2PMU A;  3CJQ B;  5ED4 A;  2HEO A;  4R8H A;  1FP2 A;  1O57 A;  5DM7 F;  3T5X A;  3GLL A;  1MMS A;  4S0H B;  2IGO A;  2LKX A;  2V26 A;  2RNJ A;  2V9P A;  2OUM A;  4KJZ A;  1DU6 A;  2DT5 A;  2YX4 A;  1LFP A;  3BPV A;  4NC8 A;  3M8J A;  1AA7 A;  3TL4 X;  4C2U A;  4A3C J;  1P7J A;  1TW3 A;  2HYG D;  2Y31 A;  1ZRE A;  1YRN A;  1YO5 C;  2WAD A;  1J59 A;  1UG0 A;  3BG6 A;  3L2Q A;  2IPQ X;  3OWT A;  3QU3 A;  3CMM A;  3LA7 A;  1B4A A;  2QUF A;  3KP5 A;  5FKN A;  2FSW A;  1X3U A;  2F4M B;  3VWB A;  2HKO A;  2VJ4 A;  5E3N A;  1ZGW A;  1JT0 A;  4UUT A;  2E7X A;  3R61 A;  4GO1 A;  1XGS A;  4B44 A;  1TBX A;  4X6A J;  3KX2 A;  3CCV I;  5DS9 A;  2NVX J;  4N9H A;  4WK8 F;  2LRD A;  4BDZ A;  1LDK B;  1BR2 A;  4HF2 A;  3B6A A;  1BM9 A;  2JWT A;  3F0C A;  5DD8 A;  1DGW Y;  2XF6 A;  3RPU D;  4UUV A;  2GXA A;  2FBI A;  4EJU A;  2FU4 A;  1FMV A;  1FBS A;  1G3W A;  2P5K A;  2CQN A;  3WGH A;  2PX9 A;  2HI3 A;  5C4J J;  1SVL A;  1LNW A;  3IHU A;  2M34 A;  2QM3 A;  1R23 A;  2EJR A;  4A5M A;  2AO9 A;  3QOE A;  1J9I A;  2Y75 A;  3S3O A;  5EG0 A;  5F0C A;  3U1K A;  4AVZ A;  3EDP A;  4CUG A;  3JRE A;  1J5Y A;  3QOP A;  3X2Q H;  1MDM B;  1CQT A;  3OYG A;  4ZZL A;  5J8F A;  2X48 A;  1S6L A;  3FXR A;  3H0G J;  3B02 A;  3IH2 A;  2KIQ A;  2F5D A;  4E7S A;  3ZP5 A;  3S1N J;  4KIF A;  2M45 A;  4I98 B;  5TRD A;  4IZZ A;  1USS A;  1GVJ A;  3SFI A;  2QCO A;  2B63 J;  2PBI A;  3WU0 A;  2MGQ A;  4A0Z A;  3QP5 A;  1ZRD A;  2NS8 A;  2ZSI B;  2OC6 A;  2KZG A;  1H9G A;  2K4J A;  4RBO A;  1CGP A;  1W4M A;  2CUF A;  3GVA A;  2F2E A;  1YW7 A;  1PP7 U;  2V7F A;  3V7C A;  4CO8 A;  4L18 B;  1YS7 A;  2M2E A;  2ZNZ A;  2M0C A;  5LGT A;  2D2W A;  3FBN B;  1Y56 A;  2H1L A;  1UFM A;  2XC7 A;  4HV5 A;  3K4M A;  2IW5 A;  1NK2 P;  3AL0 B;  3VSK A;  2BHZ A;  4EEF G;  2EV5 A;  4MHG A;  3FK7 A;  5E1X A;  2TDX A;  5IT9 Z;  2R92 J;  2P5V A;  4WWC A;  2Y9Z A;  3J81 Z;  5E1W A;  4G7Z F;  5D8L B;  3BR3 A;  4NC7 A;  2NS7 A;  3TMO A;  2EV0 A;  3S2W A;  3ISP A;  4CGZ A;  3DTE A;  5J4Y A;  2WAQ A;  2OCC H;  1U8R A;  5HLH A;  2CW8 A;  1UMQ A;  1XSD A;  3FXQ A;  4B3A A;  3L2R A;  4HDU A;  1OCP A;  3EUK L;  5FGM A;  1SD5 A;  3Q5F A;  2LF8 A;  1JXS A;  2HPI A;  2DTR A;  5JFR A;  2DA2 A;  1OJL A;  1R22 A;  2VOO A;  1VQN I;  5FKL A;  3T1B A;  2HFH A;  5F0H A;  3F22 A;  3BTL A;  1FZP B;  4P96 A;  1TWG J;  4NHJ A;  3MKW B;  1LB2 A;  3BR5 A;  2CFX A;  2IGM A;  3HSE A;  1XSV A;  3D1N I;  4IF4 A;  3JRA A;  3GW2 A;  4CZC A;  2MYS A;  3GBG A;  1TT5 B;  4CCK A;  3PSF A;  1WI3 A;  2OU2 A;  1S9H A;  4M6X A;  1U0J A;  3ABK H;  3BJA A;  1FTT A;  2X1E A;  3KEQ A;  1ZEL A;  3SFZ A;  2I8D A;  4A3F J;  3H92 A;  6PAX A;  1MNE A;  1L0O C;  4G7O F;  5IT9 K;  4TV7 A;  3EUH C;  1RI7 A;  1R7J A;  3J81 K;  2G9W A;  2OZU A;  5HNF A;  1W7P A;  1X3Z B;  3H9Q A;  2ELJ A;  1SVO A;  2JA2 A;  3JR9 A;  1VQ6 I;  2IJL A;  3BG3 A;  4HW0 A;  4CCM A;  2DMP A;  3MD2 A;  2QA4 I;  1YE9 A;  2O03 A;  4NC6 A;  4CIC A;  1B6A A;  1WKM A;  1E17 A;  3OSF A;  5J8C A;  2DFE A;  1FT9 A;  2XAU A;  3ZMS A;  4OIP F;  2O6G E;  1Y8Q B;  3CD6 I;  2ZXJ A;  2LBF B;  1U5T A;  4WCG A;  5BOX A;  2ESH A;  4DJA A;  2DOA A;  3CME I;  3CUQ B;  1VTN C;  3GTL J;  1QZZ A;  3VB2 A;  1MJA A;  4CCN A;  2KT0 A;  2GIZ A;  1QNT A;  4YII A;  3WTX C;  2BVL A;  2E34 A;  2H8R A;  2LP0 A;  2ID3 A;  2XVC A;  4OIO F;  1R49 A;  2IGK A;  2EFP A;  2LF7 A;  5B1A H;  1B8I B;  4KT5 C;  3QYF A;  4A6D A;  1I50 J;  1PDN C;  2R5Z B;  3L2W A;  2WV1 A;  2CW0 F;  2EA4 A;  3HYI A;  1XS9 A;  3ZQC A;  2LY2 A;  5L3B A;  1TQI A;  2VOD A;  1P4W A;  4M3E A;  4UXN A;  3I54 A;  3C2G A;  1WJA A;  3UR3 C;  2NYX A;  3I55 I;  4HEA 2;  2R3S A;  3HBL A;  4WXC A;  3R4K A;  3HOX J;  3V42 A;  2K9S A;  3LMM A;  1IDY A;  1LKX A;  3G3Z A;  2QYO A;  1MGT A;  4M6Y A;  1ZGJ A;  3ULQ B;  4BJ5 C;  1X1P A;  2UV1 A;  5CVV A;  4B8X A;  4XKW A;  3C2H A;  3CMY A;  4IHV A;  1K61 A;  5KAF C;  1K6Y A;  1KYW A;  2WAQ N;  2BW3 B;  1Y1W J;  2R7T A;  4XBF A;  2E35 A;  1R1V A;  4ENK A;  1FBQ A;  4PJJ A;  3I59 A;  2MC3 A;  3CMA I;  2YS9 A;  2G7H A;  1ZGA A;  1HST A;  1V5F A;  4CYC A;  2ESN A;  3H9G A;  4LMY A;  2XSD C;  1QHH D;  4BKX A;  1TC3 C;  2V1X A;  1VF9 A;  3R0J A;  2BV6 A;  3J7A O;  3HOV J;  5IYB J;  5HVQ C;  2PFB A;  1XDU A;  2DMQ A;  2X6O A;  2K86 A;  3U1D A;  2XGD A;  3LSG A;  4F91 B;  1IRF A;  1X2N A;  1V55 H;  3C2B A;  1ZH5 A;  3S16 J;  3CDH A;  1JJ6 C;  2ELK A;  2DOE A;  3H5A A;  1LE8 B;  3I9V 2;  5GAG J;  3V8K A;  4X1E A;  3QYB A;  1X1D A;  3J7Y J;  4WXD A;  3LFK A;  1LDD A;  3BJO A;  1TWH J;  2XAQ A;  5K5R A;  3LNQ A;  1WVR A;  4IQJ A;  3OR2 C;  1WFX A;  2IEK A;  3O8G A;  1VQ4 I;  3LSI A;  3HPG A;  3IRR A;  4BJ6 C;  2VOP A;  3B6C A;  3DTI A;  1VND A;  1PUF B;  1QZE A;  3QYE A;  2E1M B;  4DIQ A;  4ZYH A;  1ODD A;  1JGS A;  2Y9Y A;  4RGR A;  2PMZ A;  5LGN A;  3JTG A;  2NS0 A;  4HV6 A;  3V8J A;  2QVO A;  2VI6 A;  4HOB A;  3DQV C;  5FKO A;  3FWE A;  1PJR A;  1WJB A;  2DCE A;  3U2R A;  2V1N A;  4UVB A;  3S93 A;  3KCC A;  3ABL H;  2CO5 A;  3MVP A;  1WJD A;  2DA3 A;  3VFZ A;  5D4R A;  2FMY A;  4G6Q A;  3CQZ J;  3JW4 A;  1KGS A;  4A0X A;  2QSH X;  4QSH A;  1MBE A;  3M1E A;  3BPX A;  3V8L A;  5BMZ A;  4XID A;  1UST A;  2VE8 A;  3RZO J;  2W85 A;  4FAS D;  3K69 A;  4MTE A;  2KIU A;  4G7H F;  4MEY F;  2ZXW H;  5M3F J;  1KU7 A;  1LFB A;  3OS2 A;  3MEX A;  1VFC A;  1ZK8 A;  4M6V A;  3TO7 A;  3V7R A;  2DA5 A;  3N4M A;  4ZYD A;  2GXB A;  3BQZ A;  2LTP A;  3A1Y A;  5LGU A;  3K1P A;  4XRM A;  3W2A A;  2V6E A;  5D6E A;  4RB2 C;  3K4N A;  1GUU A;  3OYK A;  2P7V B;  1KU9 A;  2ZME B;  4RMN A;  2JA8 J;  1KYZ A;  1F4K A;  2YU9 J;  3FMS A;  3SHF A;  3T8R A;  5IOZ A;  4CDG A;  1BIA A;  3A0H C;  1MIJ A;  5CVR A;  1A31 A;  4Y3O A;  2M4G A;  2QLZ A;  3CUO A;  3TDZ C;  5CLS A;  1R58 A;  3SEQ A;  1Z21 A;  1YI2 I;  4HBL A;  2R7D A;  2H94 A;  3F3X A;  2VLA A;  1E0E A;  3SDB A;  3CDI A;  3I4N J;  4GGG A;  4V2G A;  1XCV A;  2D1V A;  1ONV A;  1Y0U A;  2HR3 A;  1RES A;  4ZYE A;  5KAI C;  1S7E A;  3FIW A;  1B9M A;  1LQ1 A;  4Y17 A;  1S29 A;  3HRU A;  4A3M J;  3WTW C;  1KU2 A;  2MD0 A;  4RS8 A;  1NG6 A;  4XLP F;  3W3C A;  2M5W A;  2OV7 A;  5F1J A;  5BPD A;  1Z9C A;  2BY2 A;  2X85 A;  1ZN2 A;  3K4K A;  4O3M A;  3GTO J;  4II3 A;  5F1R A;  1SFE A;  1XSX A;  2FX0 A;  2JSP A;  5FLX Z;  1I6X A;  4YIR X;  4E7L A;  2Z99 A;  5CQE A;  2XPU A;  5IY5 H;  5DDG A;  1TZL A;  4OAZ A;  2ELH A;  2LY1 A;  3K4J A;  3F8C A;  4KN4 X;  4A3L J;  2COB A;  5JR3 A;  1WSU A;  1K78 A;  2CV0 A;  2RGV A;  2OPT A;  1NG7 A;  3MMY B;  4HX4 A;  5HS8 A;  5JLW A;  2PMZ N;  5ICF A;  4C3J J;  4NDL A;  3ZQI A;  4PFO A;  5FKM A;  3GYH X;  1IN6 A;  2MC4 A;  2ME6 A;  5LRS A;  1RET A;  2RKH A;  3AFH A;  5HOD A;  3DP7 A;  3JRB A;  2DA7 A;  1EJ9 A;  5AIQ A;  1SVM A;  4DYR A;  1KQ8 A;  3DLL F;  4W97 A;  1J7K A;  3DPL C;  3L2U A;  4RDU A;  3HKZ A;  2DT7 B;  1W0T A;  2FBK A;  4XLC A;  4U0W A;  1HKQ A;  2ICW G;  4XLH A;  1I1S A;  3WG7 H;  2ZXH A;  4BE0 A;  2FNA A;  3PIP F;  1RIO H;  4KIS A;  2FRH A;  5HLI A;  2XSJ C;  3HZJ A;  3TOA A;  2K7L A;  1Z7U A;  2IS4 A;  4ON0 A;  3HDD A;  3ZMZ A;  2DI3 A;  3A02 A;  4ZH4 F;  5FFZ A;  5LHH A;  4L5E A;  2HYF A;  1DUX C;  2STW A;  4EJV A;  4YIF A;  2ID6 A;  1FOK A;  5C44 J;  1Y8R B;  1OCT C;  3BR6 A;  5KCM A;  2QZ8 A;  1I27 A;  1G3Y A;  5EDN A;  3F23 A;  4EGZ A;  5E17 F;  3RKW A;  3ABM H;  1ON1 A;  1RC9 A;  1YOV B;  1IUY A;  4Z2Y A;  2JUG A;  5IYD J;  1WPK A;  4YFX F;  2K27 A;  2PG4 A;  3KP7 A;  1XD7 A;  3AKZ A;  1BJZ A;  3MZY A;  3TDU C;  4AC0 A;  1UJ8 A;  1QVU A;  3UKG A;  2R7U A;  1EH8 A;  2P7C B;  3O6B B;  4B09 A;  5H2F C;  1FYL A;  2DTZ A;  1UCR A;  2XKO A;  2E2I J;  4QPO A;  1KU3 A;  2AQE A;  2GIV A;  1VQO I;  3HSR A;  1XGN A;  4A2U A;  3BZC A;  3G71 I;  1MD0 A;  1DGR M;  1G59 A;  1P6R A;  2ZFU A;  4WF2 A;  3FKI J;  2D1H A;  1OR7 C;  3VSL A;  5KHD A;  1IO2 A;  2E5Z A;  3LST A;  3CC2 I;  3IAM 2;  2HGC A;  2LD5 A;  1W7P D;  4FIS A;  2EQR A;  4OIR F;  4IOA F;  4JBA A;  5EG0 B;  1P7I A;  2DA1 A;  2EFQ A;  1ZG1 A;  2EIL H;  2O5R A;  1B72 A;  4C3I J;  2H1K A;  5CPR B;  4MFD A;  3FKJ A;  5IOY A;  1T39 A;  4I0B A;  2Q0O A;  1YW9 A;  2V6C A;  3ZMV A;  2K9Q A;  2OJE D;  2XDV A;  3PNV A;  1D1A A;  2EB7 A;  5JLX A;  3RPQ A;  3J7Z I;  2ZB9 A;  5K5O A;  4OIQ F;  4I76 A;  3H3U A;  2IGN A;  1FNN A;  3DBH B;  4Y15 A;  2CGP A;  2XGX A;  5DUI A;  4O6J A;  1SFX A;  2W7N A;  2VQH A;  2G7U A;  4F52 A;  3GZ5 A;  1JKP C;  2O8K A;  3Q0V A;  2NVT J;  2HYJ A;  1GV5 A;  1BOB A;  2LVS A;  1RR7 A;  3HHH A;  3VYT B;  4MEX F;  2DT6 A;  4ANJ A;  1ZG3 A;  4EQQ A;  2LYC A;  2M8E A;  1DP7 P;  5FRM A;  4IEJ A;  3KYL A;  4G94 A;  4I02 A;  5HDN A;  1HC8 A;  1JGG A;  4A93 J;  3DU6 A;  2K3P A;  1D1B A;  3HRM A;  1BI0 A;  1F5T A;  4BYY A;  1SAN A;  1YIO A;  2IT0 A;  4PDK A;  4MO7 A;  3EET A;  3RQ4 A;  4XLA A;  1LVK A;  1Q1H A;  1JHF A;  4ENN A;  4PFP A;  3TP0 A;  2BZT A;  5DCM A;  3HKZ N;  5HNH A;  4BQQ A;  2ZJQ F;  3TED A;  2JTV A;  2GLO A;  4RAG A;  1IXC A;  5J47 A;  2ZCW A;  1NTC A;  3NEU A;  3RYP A;  4BE1 A;  2E60 A;  2JRT A;  4HQM A;  1OCZ H;  2DO7 A;  2LH9 A;  5D5V B;  4JX6 A;  3FMR A;  4XOT A;  4MTD A;  3D0S A;  2XGE A;  1EKE A;  1MBJ A;  4HSR A;  3OYF A;  3KEO A;  4FHT A;  3KLO A;  2HTJ A;  3BT9 A;  1S5L C;  5J6X A;  4HPQ A;  3TBI A;  2PEX A;  3LL7 A;  4D1Q A;  1ITY A;  5D5X B;  4IHX A;  1YS6 A;  1IAW A;  4FX4 A;  2JRM A;  2W24 A;  4RA2 A;  3CCJ I;  2P5L C;  2CS3 A;  2VKV A;  3HM5 A;  2M87 A;  1LDJ A;  3CF5 F;  4AIJ A;  5KVR A;  4BUP A;  5K7H A;  4L9V A;  3VOD A;  5DV5 A;  1D0X A;  3K9T A;  3G6E I;  5M5X J;  4OMZ A;  3HUG A;  5FO5 A;  5L3C A;  1WH5 A;  2KRH A;  3HOY J;  3SYT A;  4YFN F;  3G1M A;  3WTV C;  2NRA C;  3BTC A;  4DW6 A;  3L2C A;  4RB1 A;  1VQL I;  5E3O A;  1FTZ A;  5F27 A;  5K7F A;  1ON2 A;  5ICC A;  2WBM A;  1KON A;  1J75 A;  2OQR A;  2CMP A;  1MSF C;  2JT1 A;  4IHY A;  2VJJ A;  1MBH A;  5E20 A;  5L3E A;  3S2H J;  1ZHF A;  1HBX G;  4UNO A;  2NOG A;  2R7X A;  2FD5 A;  1Z6R A;  2M1B A;  4E7Z A;  1W7P B;  2E5N A;  2Z33 A;  2Y2Z A;  3P7N A;  4A3G J;  1P4A A;  1JT6 A;  2FOW A;  2IA1 A;  4Y52 J;  1F43 A;  1TL8 A;  4A3I J;  4BS9 A;  4GDF A;  4CYD A;  4U87 A;  4LLL A;  3TW7 A;  1I3A A;  4YEJ A;  2DAO A;  3H0D A;  3JTH A;  2XIG A;  1LUJ B;  1Z0X A;  4LIT A;  1X3W B;  2HZD A;  3CJT B;  1IN5 A;  1U5T B;  5GAE J;  5H6Q A;  4LB5 A;  4HX7 A;  4DYQ A;  2HVR A;  2V4J C;  2H6B A;  4E6K G;  4U7D A;  3RIR A;  5CJ9 A;  1O7F A;  1TNT A;  4OOI A;  2VQC A;  4XSZ F;  1F36 A;  1OCC H;  2RN7 A;  2F5F A;  3BZK A;  3ZMU A;  5GPC A;  2L7Z A;  4AU7 A;  1ZAO A;  3D5L A;  4ZDP A;  4Z6Y A;  1VQM I;  2L54 A;  3COA C;  2P81 A;  2BVM A;  2W00 A;  2P4W A;  4F55 A;  4E7H A;  4LIU A;  4MGR A;  2D5V A;  1DPR A;  2DLL A;  2VKE A;  3M9A A;  2PLY A;  2BY3 A;  4XOP A;  1KA8 A;  2E1O A;  4XLN F;  3DPU A;  1DQU A;  3RKX A;  2K9L A;  3FXM A;  2FA5 A;  3QU6 A;  5HS7 A;  3ZN1 A;  2HQR A;  1I6H J;  2WTE A;  2L9S A;  3CF2 A;  3QWL A;  4EJO A;  1STZ A;  3WE3 A;  1WJC A;  4F92 B;  1MH4 A;  1E3P A;  2MA3 A;  3S3N A;  3DBL B;  1FYK A;  4IHS A;  5GTH C;  4XOR A;  3GTG J;  1JKO C;  4UHT A;  1LEB A;  2X1D A;  1LEA A;  1UZC A;  1ORK A;  2E1M C;  2EK5 A;  5GAD J;  3IKV A;  4AIK A;  1YJW I;  4CHU A;  2EZL A;  2P8T A;  1FSE A;  3KPH A;  1Z05 A;  2H8W A;  2E71 A;  2OF7 A;  1W5T A;  2ME0 A;  3I59 B;  1WJE A;  4AID A;  4EAT A;  1ERD A;  2JN6 A;  1FJL A;  1QBJ A;  3PL8 A;  4CYC B;  4M3D A;  3M4O J;  5J1Y A;  5EYR A;  4R1H A;  3CZ6 A;  5TJJ A;  3ZQQ A;  3RCO A;  4BAC A;  1AU7 A;  3MZH A;  1FEX A;  5CQG A;  2AXT C;  1YIT I;  3FIS A;  4L0Y B;  3REO A;  4IXA A;  1IN7 A;  4L9T A;  4BJT A;  4I2O A;  3GX4 X;  1IV6 A;  5DM6 F;  1TWC J;  4RGS A;  1EH7 A;  2V9K A;  1W5S A;  2NVU B;  5E18 F;  4PJ0 C;  2M7B A;  2A69 F;  5IP9 J;  2ZJR F;  3H1C A;  4HRI A;  1HA8 A;  1N75 A;  4L5J A;  1U78 A;  2FEZ A;  4LIV A;  2LFB A;  1MH3 A;  1H9T A;  2ACJ A;  1X1C A;  3HTU A;  1WHU A;  3M3Y J;  1KQ9 A;  1V4R A;  3WOD F;  1BIB A;  3M8E A;  5K5Q A;  2VT3 A;  1P9Q C;  4ITV A;  3JAM K;  2E36 A;  3E5U A;  1MND A;  3P9I A;  4KIB A;  3K4L A;  1HF0 A;  3G1L A;  2M0M A;  5FLV A;  3E7L A;  1QGP A;  3P9C A;  1AKH A;  2OQG A;  4M72 A;  4RAZ A;  5LHG A;  4JOM A;  5LBQ A;  3MFK A;  1I5Z A;  3K70 C;  1T0F C;  2DK8 A;  3J80 Z;  2Z3Y A;  1ZG5 A;  2CV2 A;  2KIF A;  1A6I A;  4BXF A;  1TW2 A;  3LFU A;  2GZW A;  5B5E C;  1JKQ C;  2BE5 F;  2R7O A;  3BRO A;  2KKO A;  3NWT A;  4G9Y A;  5F04 A;  1MBF A;  1SFK A;  1R1T A;  4QWQ A;  4J01 A;  1GXP A;  2L9N A;  1GHC A;  5E8G A;  4G8X A;  2BY1 A;  1OPC A;  2W4S A;  3DF8 A;  3TGN A;  5ICE A; 
#chains in the Genus database with same CATH homology
 3OOU A;  1FIP A;  5J3L A;  3VPR A;  4A3J J;  5M3F J;  1H88 C;  1ETX A;  2O9L A;  4UUS A;  1LFB A;  2RAE A;  2CQQ A;  2DA4 A;  4UUS B;  1VFC A;  1ZR2 A;  1ZK8 A;  4BBS J;  4M6V A;  3GTP J;  4XIC A;  2DA5 A;  3ZQL A;  1LFU P;  2HXO A;  1W0U A;  3BQZ A;  2LTP A;  3Q0W A;  4XRM A;  4C3H J;  2DA6 A;  1H8A C;  2HOS A;  1A5J A;  1GUU A;  3HB9 A;  2IAI A;  2NVQ J;  3SDG A;  2JA8 J;  2YU9 J;  2HOT A;  4FTH A;  5IOZ A;  1POG A;  2DN0 A;  3OIO A;  5EZH A;  1IC8 A;  1EF4 A;  1JTY A;  3JRD A;  2DMN A;  4W1U A;  1H89 C;  2G0E A;  3PO3 J;  4MFE A;  1Q1V A;  2M9H A;  2LK2 A;  1HDP A;  3I4N J;  4V2G A;  4D5C A;  3LSJ A;  4I6Z A;  1RES A;  3NAU A;  1S7E A;  3FIW A;  4DZP A;  1E3O C;  3S1Q J;  3HGY A;  1HLV A;  3LSR A;  1ZKG A;  1ETY A;  2ECC A;  2L7M P;  4A3M J;  1JUP A;  3Q0U A;  3OSG A;  3IV5 A;  3S2D J;  1RKW A;  2ECB A;  3CCY A;  1UG2 A;  3I4M J;  4FE4 A;  5F1J A;  1AHD P;  2DMT A;  2TRT A;  5EGO A;  2EH3 A;  3CDL A;  5EGO B;  3GTO J;  2XPW A;  2FX0 A;  4V2F A;  1XG1 A;  2R0Q C;  5EF6 A;  2YUS A;  2XPU A;  3HOZ J;  2JMW A;  3S15 J;  2MSY A;  4A3L J;  2COB A;  3GTQ J;  4XRS G;  1FIA A;  3MN2 A;  3W6V A;  2OPT A;  5JLW A;  5EZG A;  2PMZ N;  4BBR J;  4C3J J;  4NDL A;  3ZQI A;  5FKM A;  2R5Y A;  1UHS A;  2R5Y B;  1RKT A;  2ME6 A;  1RET A;  3PM1 A;  3LOC A;  4A3K J;  3JRB A;  5HOD A;  2DA7 A;  2XB0 X;  3HOW J;  4DYR A;  4W97 A;  2AHQ A;  3QPS A;  4RDU A;  1ZQ3 P;  1W0T A;  1OFC X;  2CJJ A;  4A3D J;  3BG9 A;  4A3B J;  3BR2 A;  4XRS A;  2R7Z J;  4S0H B;  3K2A A;  2LKX A;  3HDD A;  2HOA A;  3A02 A;  3RQI A;  1DU6 A;  4L5E A;  1HDD C;  2L0K A;  1TWF J;  1P7J A;  2ID6 A;  4A3C J;  5C44 J;  4AUX A;  2Y31 A;  1OCT C;  3BR6 A;  1IRZ A;  2I10 A;  4FE7 A;  1YRN A;  5EDN A;  4QTR A;  1RPW A;  2DJN A;  3BTI A;  2HQ5 A;  2JA5 J;  4C2M J;  2E2J J;  5IYD J;  1IJW C;  5FKN A;  1WPK A;  2CUE A;  2CU7 A;  3H3V K;  5GPA A;  4M3G A;  1T56 A;  5E3N A;  1BJZ A;  1ZGW A;  1JT0 A;  4UUT A;  3K7A J;  4AC0 A;  1QRY A;  2GBY A;  1QVU A;  3UKG A;  1T33 A;  4X6A J;  2MW8 A;  2DTZ A;  5DS9 A;  2NVX J;  1BL0 A;  4D7N A;  1QPI A;  2E2I J;  1D5Y A;  5M3M J;  1IGN A;  1ZTR A;  3B6A A;  2JWT A;  1U9O A;  3F0C A;  4ABZ A;  3GTM J;  2E2H J;  3FKI J;  3BQY A;  2FJ1 A;  2HI3 A;  5C4J J;  1IG7 A;  2M34 A;  4DYC A;  2LD5 A;  2EZI A;  2AO9 A;  2K40 A;  2EQR A;  4FIS A;  5EG0 A;  5F0C A;  9ANT A;  5EG0 B;  3HEF A;  1P7I A;  2DA1 A;  3JRE A;  3QPL A;  3Q3S A;  4MIM A;  3JRI A;  1CQT A;  3S1M J;  1ENH A;  2WB1 N;  1B72 A;  2X48 A;  2HDD A;  4C3I J;  3H0G J;  1B72 B;  2H1K A;  4MFD A;  3IH2 A;  1ETQ A;  3S1N J;  5IOY A;  1GDT A;  2K9Q A;  5JLX A;  2ZB9 A;  4I76 A;  1X2M A;  3SFI A;  2QCO A;  2B63 J;  2CRG A;  2MGQ A;  2NS8 A;  3BG5 A;  2VPR A;  4RBO A;  3HGG A;  2CUF A;  1JKP C;  2O8K A;  3Q0V A;  2NVT J;  2HYJ A;  3TP3 A;  1GV5 A;  2M2E A;  2LVS A;  2M0C A;  1RR7 A;  2JK3 A;  2Y0S N;  3JRG A;  5IPA A;  2LR8 A;  2LY9 A;  1NK2 P;  4IEJ A;  4EEF G;  3FK7 A;  2XRL A;  1JGG A;  4A93 J;  4D7M A;  2R92 J;  2Y9Z A;  3LSP A;  1SAN A;  4MO7 A;  3G1O A;  4B1R A;  1QVT A;  3BR3 A;  3SJM A;  3HOU J;  2EZK A;  3TP0 A;  2NS7 A;  1JTX A;  5J1R A;  3HKZ N;  3TED A;  2GLO A;  2LLK A;  2IBD A;  1NTC A;  3RKQ A;  2E19 A;  4LOC A;  5FJ8 J;  1UMQ A;  4JX6 A;  4B3A A;  1OCP A;  2XGE A;  4J19 A;  1MBJ A;  2DA2 A;  1OJL A;  3BR1 A;  4G12 A;  5FKL A;  3BT9 A;  5F0H A;  3GTK J;  1ITY A;  4IHX A;  2N8G A;  3BTL A;  1TWG J;  1NK3 P;  4D5F A;  2VKV A;  3HM5 A;  3BR5 A;  1GT0 C;  5K7H A;  1O4X A;  3D1N I;  3JRA A;  5M5X J;  4GFB A;  3GBG A;  1WH5 A;  1WI3 A;  2W48 A;  3HOY J;  3G1M A;  3IH3 A;  4JX5 A;  3BTC A;  4DW6 A;  1FTT A;  3A03 A;  2TCT A;  4A3F J;  5E3O A;  1YRN B;  1FTZ A;  5F27 A;  5K7F A;  1MSF C;  4IHY A;  1MBH A;  1Z77 A;  1ETO A;  3S2H J;  2NOG A;  2FD5 A;  2KDZ A;  5M5W J;  3GTJ J;  4M3F A;  3JR9 A;  2Y2Z A;  2L7F P;  4A3G J;  3ZQG A;  3A01 A;  1IUF A;  1JT6 A;  3BG3 A;  2DMP A;  4Y52 J;  1F43 A;  3A01 B;  4A3I J;  1TWA J;  4BY1 J;  1MBG A;  2CQX A;  1JKR C;  3OSF A;  1WCM J;  3TW7 A;  3BR0 A;  1Z0X A;  1MSE C;  1ZR4 A;  2NVY J;  3S1R J;  3GTL J;  1MBK A;  4DYQ A;  5C3E J;  2KT0 A;  2HXI A;  1U8B A;  2H8R A;  2O7O A;  3O8H A;  2LP0 A;  1F36 A;  2ID3 A;  5IYC J;  4A3E J;  3PO2 J;  2FQ4 A;  1B8I A;  5F08 A;  5GPC A;  2L7Z A;  1B8I B;  1IDZ A;  2R5Z A;  1I50 J;  2XPV A;  2P81 A;  2R5Z B;  5GP9 A;  2D5V A;  2WV1 A;  2VKE A;  3BTJ A;  1XS9 A;  3ZQC A;  3WHC A;  4M3E A;  2E1O A;  4MLO A;  3ZQF A;  1BW6 A;  2XB5 A;  4B4C A;  1X58 A;  1K83 J;  4FCY A;  2M8G X;  1R9T J;  3HBL A;  5C4X J;  3S17 J;  1I6H J;  3HOX J;  2K9S A;  1IDY A;  1DU0 A;  1MH4 A;  4JYK A;  1XC5 A;  2L9R A;  2EZH A;  3ZOB A;  3GTG J;  3CMY A;  1JKO C;  4JX4 A;  3TW6 A;  1K61 A;  4IHV A;  1ETW A;  1ORK A;  2R93 J;  2EZL A;  2WAQ N;  5FLM J;  1HOM A;  1Y1W J;  5F0F A;  2EBI A;  2Y30 A;  1WGX A;  2JA7 J;  2OF7 A;  4AYB N;  2ME0 A;  1I3Q J;  2YS9 A;  4CYC A;  2JN6 A;  1FJL A;  2XSD C;  4JP0 A;  4M3D A;  4CYC B;  1WH7 A;  3M4O J;  4BKX A;  5J1Y A;  1TC3 C;  1VF9 A;  5EYR A;  5BNG A;  1GV2 A;  1AU7 A;  2DMU A;  2XGC A;  3WHB A;  1FEX A;  3HOV J;  5IYB J;  3FIS A;  4A69 C;  3RZD J;  2DMQ A;  2X6O A;  2XGD A;  3LSG A;  4QIW N;  1IV6 A;  2JA6 J;  1TWC J;  1X2N A;  2K9N A;  3C2B A;  3JRF A;  3S16 J;  1JJ6 C;  2QF7 A;  5EEA A;  2ELK A;  2MG4 A;  5IP9 J;  1LE8 A;  4DZJ A;  1LE8 B;  1ETV A;  1U78 A;  4X1E A;  2LFB A;  1MH3 A;  4Y7N J;  1TWH J;  3FK6 A;  3IH4 A;  2VUM J;  3DEW A;  3M3Y J;  3LNQ A;  1JJ8 C;  2IEK A;  3O8G A;  3NAR A;  3ZQH A;  1BW5 A;  4HNV A;  1ETK A;  1PUF A;  3B6C A;  1VND A;  1U9N A;  1PUF B;  2X9D A;  1HF0 A;  3G1L A;  5FLV A;  3E7L A;  2Y9Y A;  1MNM C;  1AKH A;  1JUM A;  5DTD A;  1AKH B;  2VI6 A;  2GM4 A;  1Y1V J;  5M5Y J;  1A6I A;  5FKO A;  4BY7 J;  3MKL A;  1VI0 A;  4M3B A;  4XK4 A;  4IHW A;  3JRH A;  1JUS A;  1JKQ C;  3MVP A;  5IP6 A;  1HCR A;  2DA3 A;  5FKK A;  5E3L A;  3DCF A;  5F04 A;  3L1P A;  1MBF A;  1BA5 A;  3QQA A;  1SFO J;  1GVD A;  5IP7 J;  2JJ7 A;  1G2H A;  3CQZ J;  5J1U A;  5K7Z A;  4BXX J;  4QSH A;  1MBE A;  3S14 J;  4XID A;  3JRC A;  3RZO J;  1APL C;  5E3M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...