1XG1A

Solution structure of myb-domain of human trf2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
GSHMEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords Telomeric repeat binding factor 2
publication title NMR studies of telomeric nucleoprotein complexes involving the Myb-like domain of the human telomeric protein TRF2
pubmed doi rcsb
source organism Homo sapiens
total genus 19
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xg1A00
3G1OA 1CQTA 1X2NA 4ABZA 3JRBA 1HCRA 4XIDA 2JK3A 2XPUA 4MIMA 2O8KA 1G2HA 3LSRA 2GLOA 3JRGA 1RR7A 2E2JJ 3B6CA 2IBDA 3ZQHA 2ID6A 2R5YA 3BR2A 4JYKA 5E3LA 1BJZA 2HXOA 2HQ5A 3Q0WA 4IHYA 2IAIA 1MBJA 4A3DJ 3BR0A 3S16J 5EEAA 3HGYA 1NK3P 2DA2A 3BTIA 3H3VK 3TEDA 5EZHA 3D1NI 4MFEA 3BG9A 1AU7A 3HB9A 1B72A 3BQYA 1MSEC 1HLVA 2JN6A 2E2HJ 3FKIJ 4JX4A 4M3BA 1B8IA 5FLVA 1Q1VA 1HOMA 4A3LJ 2EZLA 2CUFA 3BG5A 3I4MJ 3ZQCA 1JKPC 5C4JJ 3A01B 1B72B 2X6OA 2VI6A 1VNDA 4A3FJ 3PO3J 2FX0A 1O4XA 5E3MA 3JRCA 1B8IB 3GTQJ 2EH3A 2K9SA 3HM5A 2XGEA 3BG3A 2R0QC 1MBEA 3C2BA 1FTTA 5C3EJ 3S2HJ 2LTPA 5DTDA 4XRSG 5F1JA 1IDYA 1NK2P 2R92J 4BY7J 3MVPA 2NS7A 3DCFA 2LLKA 3HGGA 1DU6A 1RETA 2HOSA 1I50J 3SFIA 1VFCA 1UG2A 4C3IJ 3QPLA 2COBA 1Z77A 2KT0A 1AKHA 5M3MJ 2M8GX 3GBGA 2EQRA 3K2AA 2NVXJ 3HOYJ 2XGDA 2Y9YA 2DA4A 3OSGA 2HOTA 3BR5A 1GV2A 1MBHA 5EZGA 1IJWC 4QSHA 4DZPA 3HOUJ 1ZQ3P 2DTZA 2H1KA 1MNMC 4J19A 1ZK8A 3VPRA 1U8BA 5K7ZA 1HDPA 1K61A 3WHBA 2E1OA 4IEJA 4A3MJ 4FISA 4NDLA 1QVTA 4M3DA 5FLMJ 1AKHB 3BR3A 1TWGJ 4BY1J 2MGQA 3E7LA 3BTCA 4EEFG 1MBGA 4A3IJ 2EZHA 3BR1A 4V2FA 1IDZA 2B63J 1RESA 4X1EA 5GPAA 1JJ8C 2NVTJ 1T33A 4QIWN 3GTMJ 2LY9A 2VUMJ 2R93J 1HDDC 3ZQGA 1ETWA 2DN0A 2NS8A 1ZGWA 1ETYA 1MH4A 4I6ZA 2R5ZA 2HYJA 4XICA 5EYRA 3S1MJ 1OCPA 3IV5A 1TWFJ 5IP9J 1ENHA 2O7OA 4DYCA 4M3GA 2EZKA 4MO7A 2NVQJ 4JP0A 4BBSJ 4M6VA 3BTJA 2ID3A 1YRNA 3A02A 1S7EA 2AO9A 3HOZJ 3O8HA 3HDDA 2R5ZB 1IRZA 1U9OA 1BL0A 4C3HJ 3JRIA 5M5WJ 1Y1VJ 1JKQC 4RBOA 4V2GA 4DYQA 2K9QA 5JLXA 4Y7NJ 1AHDP 5J1RA 4UUTA 3RZOJ 4W1UA 1U9NA 4XRMA 3WHCA 4BBRJ 1R9TJ 3HBLA 1YRNB 2DMNA 2L7FP 4M3EA 5J1YA 2E2IJ 1PUFA 4HNVA 2NVYJ 3BT9A 1SFOJ 3A01A 1ETQA 1H89C 1H88C 5IP7J 3GTLJ 3ZOBA 2GBYA 2YU9J 2XRLA 2KDZA 2XSDC 5F04A 5F0FA 1OCTC 2O9LA 1PUFB 3TW6A 5M5YJ 1POGA 3LSGA 5FKNA 3MKLA 4FE4A 5M5XJ 1IG7A 2DA7A 3GTGJ 1FIAA 4FTHA 5J1UA 5K7HA 2DMTA 4A3GJ 4DW6A 1XG1A 2Y9ZA 1APLC 4Y52J 2CJJA 1JT0A 5FJ8J 1DU0A 5BNGA 3IH3A 4A3KJ 2HI3A 1LFUP 2R7ZJ 5FKLA 2JA6J 4RDUA 3JR9A 1ETXA 3JRHA 4S0HB 3HOWJ 1WH7A 4I76A 5JLWA 3I4NJ 1WPKA 1FTZA 1A6IA 4C3JJ 2JA7J 4XRSA 1MBKA 2DA3A 1A5JA 1ETOA 2E19A 3HKZN 2TRTA 5C4XJ 1ETVA 2D5VA 2CRGA 3QQAA 3GTOJ 4A69C 2MW8A 1GUUA 2P81A 1VF9A 3RQIA 1JT6A 2LFBA 2HXIA 3S17J 3FISA 3NARA 3TP0A 2YUSA 3S1QJ 2XPVA 2LD5A 2TCTA 5IPAA 2CUEA 4X6AJ 1JKRC 2HOAA 3SJMA 1ZR2A 2H8RA 2HDDA 2FD5A 2PMZN 4W97A 2XPWA 3FK7A 2DA5A 4LOCA 1IUFA 4A3CJ 2DA1A 2LR8A 4B3AA 4G12A 2IEKA 3TP3A 5K7FA 1F36A 1JUSA 3GTJJ 1W0UA 1TWCJ 4XK4A 2LVSA 1LE8A 1JKOC 2QCOA 2ECCA 1TWHJ 3H0GJ 2G0EA 4BKXA 3GTKJ 2RAEA 5E3NA 5IYDJ 2XB5A 5M3FJ 2Y0SN 1LFBA 4BXXJ 1D5YA 1GV5A 2NOGA 4MFDA 3ZQLA 1H8AC 4D5CA 1RKWA 4QTRA 1UMQA 1ZKGA 1P7JA 1JJ6C 2CQXA 1VI0A 3ZQIA 2MSYA 3CMYA 2L7ZA 1LE8B 1RPWA 4FCYA 1E3OC 2M9HA 3CQZJ 2YS9A 1WGXA 5EG0A 1W0TA 1P7IA 2DMPA 4DZJA 1ETKA 3ZQFA 2I10A 4AUXA 1WH5A 5HODA 4CYCA 2JA5J 3RKQA 9ANTA 1SANA 2EBIA 2VPRA 3B6AA 2LK2A 1FIPA 3HOXJ 2LKXA 1JTYA 2JA8J 1U78A 3IH2A 3M3YJ 2L0KA 3LNQA 1JGGA 2AHQA 2M0CA 2Y31A 2XB0X 3FIWA 3QPSA 5EG0B 1K83J 1BW6A 4CYCB 3Q3SA 2ME0A 4MLOA 1QPIA 1UHSA 1IGNA 4M3FA 4D5FA 5C44J 1WCMJ 1IC8A 1TWAJ 2WB1N 3S1RJ 3BQZA 3MN2A 2MG4A 4FE7A 4C2MJ 4A93J 1I6HJ 2ECBA 3O8GA 3HOVJ 3Q0UA 3LSPA 2R5YB 1XS9A 1MSFC 5FKKA 4IHVA 3G1MA 5IP6A 1BA5A 3RZDJ 2VKEA 3JRAA 4UUSA 2X48A 4DYRA 5FKOA 1NTCA 5FKMA 1Z0XA 1QRYA 4IHWA 3OSFA 3BTLA 3DEWA 3OIOA 2ELKA 1MH3A 2K9NA 5EGOA 1IV6A 1FJLA 2JJ7A 2JMWA 4A3BJ 2WV1A 2Y30A 5GP9A 1OFCX 5E3OA 2DJNA 4UUSB 5EF6A 1X2MA 2DMQA 2L7MP 2ZB9A 5F27A 3A03A 3S14J 2VKVA 1TC3C 2EZIA 2JWTA 3S2DJ 2CU7A 2OF7A 5EGOB 2Y2ZA 1XC5A 4JX6A 1JTXA 1ITYA 3NAUA 2M34A 5F0HA 5F08A 1OJLA 3TW7A 3S1NJ 2XGCA 2W48A 1GDTA 3JRFA 4B4CA 3JREA 2DMUA 5IYCJ 1MBFA 4L5EA 3SDGA 1I3QJ 2K40A 5IOZA 2M2EA 5GPCA 3IH4A 4IHXA 2X9DA 3JRDA 1ZR4A 3LOCA 4AYBN 1BW5A 3CCYA 5DS9A 1FEXA 5IYBJ 2LP0A 2N8GA 4D7MA 3W6VA 3S15J 2QF7A 1ZTRA 3FK6A 1GT0C 3UKGA 3CDLA 1GVDA 2CQQA 4D7NA 1JUPA 1Y1WJ 2FJ1A 4JX5A 4A3JJ 3L1PA 2GM4A 3HEFA 3G1LA 3PM1A 4B1RA 2ME6A 2L9RA 3PO2J 2WAQN 1F43A 4GFBA 5EDNA 1ORKA 1QVUA 3Q0VA 2FQ4A 3OOUA 1JUMA 3M4OJ 5F0CA 3BR6A 1HF0A 2OPTA 1EF4A 1RKTA 5J3LA 3F0CA 5IOYA 2DA6A 1X58A 3GTPJ 4AC0A 1T56A 1WI3A 3K7AJ 3LSJA 4A3EJ
chains in the Genus database with same CATH superfamily
2DDBA 3IWZA 5JFRA 2E5ZA 3A4CA 1CQTA 4HV5A 4ABZA 3JRBA 5F1RA 1SD4A 3SEQA 2K85A 2E7WA 5JHFA 1HSJA 4MIMA 2O8KA 1G2HA 3E5UA 4Y13A 2R7UA 3JRGA 1LB2A 1K4SA 1O3SA 4O6JA 2JQ7A 2BY1A 4G6DA 2J5OA 2IVMA 2M30A 2ID6A 1LFPA 2LY2A 3BR2A 1G8XA 5E3LA 1YS7A 1YFHA 1SEUA 4Q47A 3VSLA 3HRMA 4AIHA 2IAIA 2VJJA 3RJPA 3HRUA 2EILH 1OLTA 4A3DJ 5E79C 2G7UA 2HZTA 2JSPA 4XOPA 5HS9A 5EEAA 3L2VA 1KQ0A 3H3VK 3TEDA 2CW0F 4BXFA 4ZDPA 1FOXA 3CMAI 1STZA 4ASNA 2LMDA 2EPFA 3PFIA 2E2HJ 3GWZA 4HAMA 4C30A 3SEZA 3WTZA 2LKPA 2E34A 1H0MA 2R7FA 4RM2A 1Z1DA 3KP3A 3PUBA 1MIJA 3O6BB 3IKVA 1FOYA 1FBSA 4G7ZF 5C4JJ 1MMGA 4ENMA 4LLNA 1HKSA 2EA4A 2XIGA 2VI6A 2F5EA 3E6DA 1ONVA 3DEUA 3ZXSA 2FX0A 2HU9A 2M7BA 3LAPA 2RQPA 2VKDA 1U2WA 1T2KA 3QOPA 5CKTA 3W2AA 3LA3A 3AG1H 2XGEA 2CW8A 3CDIA 3MQ0A 2FBIA 4ETSA 4E7ZA 5E1ZB 2KFDA 3C2BA 3V42A 4CUGA 5CVUA 3ESWB 2P5VA 4BGDA 5F1JA 1MJ9A 3KFWX 2R92J 4YFXF 1YI2I 4UY8I 2L54A 3GF2A 5AIPA 3T5XA 3FWEA 1X1BA 3DTKA 2Z5UA 1FBQA 3WTVC 1Z77A 2M8GX 1ZRCA 3GBGA 2NVXJ 3T1BA 2WTEA 2MABA 1FT9A 1GV2A 5EZGA 4QSHA 3HG9A 2EIKH 2STTA 3SFZA 4IXAA 5TRDA 4B8XA 4LG0A 4J19A 3CCMI 2V1UA 2MC3A 1XTAA 5CQGA 3CD6I 2JTVA 2KKOA 5A2QZ 1DUXC 4ANJA 3SZPA 2ZMEC 2XF7A 3KP4A 3K0LA 2I8DA 1IXCA 3BR3A 5DYMA 5KK1A 5J47A 4BQAA 2LOOA 3MKWB 5HNFA 4BUPA 4KMUX 2KZVA 2HQRA 1BI3A 4A3IJ 1SD5A 4WF2A 1IDZA 3LMMA 2GXBA 2NVTJ 4PJLA 1ON2A 1T33A 4QIWN 5HS8A 4AWXB 2EINH 2R93J 2XF5A 3E6CC 4CZCA 1HKQA 2ZJPF 2DAOA 4CCKA 2P5LC 1KU2A 2KRFA 4HLXA 3V8KA 1GHCA 2R7WA 3GO5A 3G2BA 4I2OA 2P4WA 3OYBA 4XICA 2DBBA 4XBFA 5IP9J 4HF2A 5AONA 2F5CA 4OIQF 3AFHA 3BTJA 2ICWG 1ZLJA 1D1BA 1YRNA 1HKTA 3K4LA 1P4AA 1YJNI 3O8HA 3WTWC 3EDPA 3ZMTA 1IRZA 3MMYB 1HC8A 2VC1A 4NQWA 2HYGD 1A36A 5M5WJ 1JKQC 4RBOA 1RRJA 1KQ9A 4DYQA 5JLXA 1S72I 4AIDA 4J01A 4UUTA 3RZOJ 3KP5A 4W1UA 1QHGA 4L9VA 2DK5A 2CQ7A 3WHCA 1YRNB 5J4YA 4HF0A 4M9XA 3PIOF 4KUMA 4U7DA 4OWRB 2NVYJ 3S93A 1R71A 4HOBA 1H89C 1P92A 1O7LA 5GAEJ 2VXZA 5HLTA 1J75A 3BPXA 3L09A 4M6YA 3GTLJ 2GBYA 1LEAA 2YU9J 2D45A 4ENKA 2XSDC 3GX4X 4II2A 3BCAA 5HDNA 1K7AA 2HVSA 1Y56A 3V7RA 4BJTA 2EB7A 3E1SA 2FF4A 4XLNF 3CCUI 3TW6A 1ZREA 2JVGA 5FKNA 3MKLA 3EYYA 2F6CA 2V6EA 2X1DA 5M5XJ 5F6FA 4S04A 3GTGJ 3HTSB 2CFOA 3L2WA 2QZ8A 1RIOH 4FTHA 1ZGJA 5K5OA 2DMTA 1X4PA 3ML6A 4DW6A 4U7BA 2R7TA 1UFMA 2Z99A 3K4NA 4KICA 2F48A 2IGNA 4E7JA 2F4OB 2K27A 2Z1DA 3IH3A 1LFUP 5D6EA 3CO7C 1CGPA 3VWBA 3FMSA 5F64A 5LD2C 3HOWJ 2WADA 3I58A 3CCVI 5JLWA 4BNCA 3BDDA 4KT6A 2HYFA 2IGMA 2F5DA 2H1LA 2JA7J 1MJBA 3FHNA 1SVLA 2E19A 2L9NA 2TRTA 3HKZN 2RN7A 4KFCA 1UHWA 4HLYA 2CRGA 3GTOJ 3BG7A 1X19A 4M9SA 1VQ9I 2MW8A 1Z21A 2FUG2 2IS6A 1VF9A 1TZLA 3NQOA 3S17J 2MLGA 3FISA 4HQMA 1B9MA 2F4MB 2XV4S 1N78A 4GYGA 4P1WA 3GUDA 1IV8A 1KU7A 1L3LA 5K5RA 2A68F 2XAUA 4BQNA 1ZN2A 2XPWA 1QU3A 3FK7A 2L5QA 4XLEA 2D2WA 1O3QA 2QEXI 3H0DA 4U87A 2ZJQF 3V8LA 2LR8A 4EMSA 1LUJB 4AU7A 5K7FA 1IN5A 1F36A 1JUSA 2QYOA 3GTJJ 2QWWA 4BE2A 5DD8A 4XK4A 2XAJA 1R58A 2ECCA 4XMYA 4B47A 3OL4A 2XB5A 3KZYA 2Y0SN 1OYWA 4QPOA 1D5YA 2OBPA 2IGOA 4D5CA 2FEZA 2PMZA 2DDAA 4EV0A 2ZO4A 1VI0A 4UB6C 4G7OF 1BI2A 1ON1A 2MSYA 1LVAA 5J8FA 3CMYA 4XN0A 1TW3A 2DU9A 2UXXA 2UZKA 2HOEA 1QZEA 2YS9A 5EG0A 1MNEA 3RYPA 1L0OC 3HSFA 4IKFA 4AUXA 1SD6A 1XGMA 1LDDA 3K4CA 4TV7A 2EIJH 1LDJA 4ZZLA 3N4MA 2RC4A 3B6AA 3VOEA 2A5YB 1J7KA 2VASA 3U2RA 2AHQA 2Y31A 2DCEA 2JZYA 3QPSA 2BHYA 4IJAA 5EG0B 2W85A 1DPRA 1BW6A 3GLXA 4PUSA 2ME0A 3DF8A 4YIFA 2GOXB 2E71A 2FMLA 3TDUC 2Y0MA 1QPIA 3MWMA 4EM2A 4L9TA 1Z7LA 4LLGF 1IUYA 4U0VA 1WCMJ 1U3EM 1IC8A 2WB1N 5CVRA 3S1RJ 3MN2A 1OCZH 1O3TA 4P55A 3DTIA 2K9MA 4G94A 3DQVC 5B1AH 2R5YB 4IZZA 1MSFC 1HW1A 4XR6A 3OR2C 2A6HF 1SFKA 3L2UA 2VKEA 4PJ0C 4ZYAA 3JRAA 5ILVA 1I27A 3F21A 1TP4A 4BACA 1TQPA 4F55A 3BTLA 1YQAA 3DEWA 2HS5A 1MH3A 1F1ZA 4EM0B 3GFMA 5ICGA 1FJLA 4FETA 5IT9K 2JMWA 4A3BJ 1HW2A 2WV1A 4KIFA 4C9YA 1WHUA 2BY2A 2A5WA 4ZDLA 5LFAA 4OINF 4WXDA 2FQ3A 5EF6A 1X2MA 2ZB9A 4N0BA 2VKVA 3C1DA 4HSTA 2PEXA 1VQ8I 4Y3OA 2ZXJA 3O3KA 4YRVA 3AL0B 3U1DA 3C3WA 3S1NJ 2XGCA 1GDTA 1OYIA 4BQQA 1S8NA 3JREA 5IYCJ 4L5EA 3SDGA 5BQTA 1FPQA 3I59A 2M2EA 3CLQA 1QO0D 2X9DA 2K3FA 3ZR8X 1QBJA 1VQ4I 1BW5A 2DW4A 3ABUA 3RDIA 5HNHA 1SAUA 5IYBJ 4I0AA 2N8GA 1CF7A 1T0FC 3S15J 1S3JA 1YLFA 1ZTRA 3NWTA 2DFEA 3HHGA 1GVDA 2X1CA 2PJRB 3MKZA 1USSA 1NG6A 2FJ1A 4WK8F 1WJ5A 1BJAA 4H0EA 2DODA 3LAJA 5LRSA 4KYWA 1OPCA 1X3ZB 4B1RA 5HDKA 2ME6A 3I4PA 3I64A 4E6KG 2FE3A 2WAQN 3CUOA 4GDFA 1KA8A 4A5MA 1UZCA 1BC8C 2O8XA 3Q0VA 3WTXC 2NXNB 3GVAA 2E1NA 2UXNA 2JVHA 1I1SA 1EH7A 1DP7P 4RAFA 1RNLA 3BR6A 3IRRA 2OPTA 2BVMA 3TO6A 1EF4A 3F0CA 2DA6A 2H8WA 1P6RA 1T56A 3F6OA 2LREA 2HQNA 1YO5C 2ZXWH 4BL0B 3ZP5A 3OYDA 4KDPA 2XKOA 1V5EA 2HKOA 2KZGA 5D5XB 4XIDA 2EV6A 2FXAA 3K4KA 2XPUA 1FSEA 1XMKA 3J81Z 3BWGA 5LGUA 1KGSA 1R22A 3M8JA 1RR7A 3K1MA 2E2JJ 2XAQA 2Y69H 4IOCF 1W1WE 3B6CA 2C6YA 1HQCA 3H9QA 2IBDA 2WY8Q 4K2EA 3K9TA 4NUBA 2EFQA 4DIQA 2HXOA 3PL8A 4BQOA 2WV0A 2CV0A 2DT7B 1XCVA 2VXDA 2Y48A 3HTUA 1X1PA 5CJ9A 1MMNA 4Y4RA 3D1NI 4OIOF 3ZQQA 1AU7A 3HB9A 1B72A 1UAAA 1HLVA 1KYZA 3OYNA 2JN6A 1IW7F 4NNJA 5KHDA 4AVPA 2M4KA 5FLVA 3ZPLA 2H6CA 1M1EB 1Q1VA 1GVJA 3IHUA 3WGGA 4HX7A 1NH3A 1U5TB 5GTIC 3AKZA 4LB6B 4FHTA 3RKXA 2CUJA 4RB3C 4ESJA 1D3YA 1SD7A 2ZMEA 5LRRA 4B43A 3ZQCA 1W7PD 1BC7C 4PSXA 1B72B 1ACIA 4ZYEA 1VNDA 2L4AA 2LF7A 1WJCA 4UHTA 3PO3J 4ON0A 4IRHA 2JPBA 3F8BA 2DOAA 3PNVA 5E3MA 4G6QA 3I9V2 4DJAA 1QZYA 3ZGKA 4CDGA 2K9SA 3EETA 1S7AA 1VQ5I 2K7LA 2ZJ2A 4ZJZA 4IVNA 2QBYA 2R0QC 3J7YJ 3DV8A 1TQMA 4ESBA 3G71I 5C3EJ 3JSPA 2O5RA 2LTPA 2MBFA 1R7JA 3D5RC 3I54A 5DTDA 1IDYA 2BE5F 3FXOA 3WTTC 1NK2P 2CGPA 4XKCA 2E36A 4BY7J 3MVPA 2UWMA 4AIJA 4ZYDA 3HGGA 3FZVA 2EWNA 3WTYC 1LDKB 4C3IJ 1QA6A 2A6TA 3WTSC 4MGRA 2BW3A 2V4JC 5M3MJ 4KIGA 2XGDA 2MD0A 3IP4B 2IW5A 1A35A 3H9JA 1VQOI 2DTZA 2W57A 3ROUA 3DU5A 4XLAA 2H1KA 1ZK8A 5K7ZA 3TDZC 3D5SC 5D5UB 2OQGA 4IQ4A 4BAYA 1REPC 1BM9A 1EJ9A 4U88A 4M3DA 3WU2C 5FFZA 2BW3B 3AL0C 2Y75A 4UVBA 1I39A 3VYRB 3PQJA 5D8KB 5DM6F 3M1EA 1F5TA 4BY1J 2MGQA 2K9LA 3ERMA 3K70D 1Z6TA 4NBQA 4JOMA 4UUVA 2AQFA 4HYEA 3BTCA 5E1WA 4EEFG 3JSOA 1MBGA 1ZHFA 2EZHA 5ERIA 5GADJ 5DD4A 2CW7A 3VEPA 4EATA 4B09A 4XLFA 6PAXA 2LY9A 1VQPI 2VUMJ 1DGWY 3X2QH 1DPUA 3RYRA 3ZQGA 4HQEA 3TKYA 1USTA 1WZ2A 4MTDA 2ZCWA 1MH4A 4I6ZA 1KQ8A 2IJLA 2KRHA 3GZ5A 3JAMK 2R5ZA 2IA1A 4E7SA 2HYJA 5LLQA 3KETA 4BEHA 4LK0F 3S1MJ 1XMAA 1DDNA 4P5OA 4RB0A 2CH0A 4RGSA 4M3GA 3HSEA 2LG4A 1QZZA 2HTJA 2NVQJ 1V54H 3OOPA 2WWYA 4GGGA 5KAIC 3ZMSA 3A0HC 4HA8A 2R5ZB 3HDDA 4L18B 1AOYA 2YR2A 2MC4A 1U9OA 3ZCOA 1OR7A 3C2HA 4BEHB 2IS1A 3JRIA 3KEYA 3QOEA 4G7HF 3BLYA 3QAHA 3HBLA 1IF1A 1MGTA 3FBNB 1WFXA 2L7FP 4M3EA 2EFNA 2V1XA 1PUFA 3BT9A 1Z9CA 1UHMA 1QPMA 1IO2A 2JUGA 2XAHA 3PJRA 4UNOA 5DCFA 3QU3A 2R4GA 4F7ZA 1HA8A 2PLYA 1SFEA 2QUFA 3UNGC 4BHPA 3ZOBA 1BOBA 5IT3A 3L2RA 1RUOA 1IN4A 2O9LA 1IAWA 1PUFB 1AA7A 1FC3A 3F3XA 2A07F 1VQ6I 1POGA 4C2TA 4DNCA 2R7VA 2ETHA 1B59A 4I98B 3MZ8A 2DA7A 2KIFA 5BPIA 2QENA 1YOVB 4MTEA 5K7HA 2E1CA 4A3GJ 1XG1A 2KJBA 1VQ7I 2CJJA 5FJ8J 1DU0A 2OJED 1XGOA 1LNWA 3CCEI 5FKLA 5LHGA 2HPIA 3RPUA 3JRHA 1PJRA 5DV5A 2X6WA 2DTRA 3GZNB 2M0MA 1N25A 3DPUA 1U5TC 3I4NJ 1WPKA 3WGHA 5EJCA 1A6IA 2PJPA 1WJAA 1B4AA 2M4GA 5FLXZ 1A5JA 3KPHA 3OYEA 2YPRA 1P2FA 5C4XJ 4IHSA 3HZJA 3T8RA 2D5VA 2W25A 5EEHA 3ZN0A 1OISA 5K1YA 3L9FA 2P81A 3LQQA 2VLAA 3JW4A 4IQJA 2M87A 1NHAA 1XCBA 3CESA 2G9WA 3NARA 3CCRI 5CQEA 2YSRA 1W36C 2W84A 2ACJA 3FMRA 2WY7Q 5FFXA 1R4NB 2IPQX 1WVRA 4LITA 4R1HA 2CUEA 3QYFA 1BIBA 5E20A 3SJMA 4LFUA 1ZR2A 2LYCA 2V79A 3HIFA 1SAXA 3KE2A 4WX9A 4A6EA 2R7QA 2ZJRF 1F9NA 4HG2A 3H3ZA 1T8IA 2VBZA 1IUFA 3PUFA 2DA1A 4LMYA 4IRIA 3TP3A 3RPQA 1OCOH 3CCJI 1I3AA 3LSMA 3BJOA 4PJNA 3GW2A 3WTUC 1JKOC 2QCOA 1TWHJ 3MD2A 4BKXA 3OYJA 2RAEA 2HR3A 3ABKH 2CMPA 1BBYA 4P9FA 1AWCA 4PFPA 2HDCA 2VQLA 1K4TA 3PIPF 4MFDA 2WAFA 1GXQA 1C0WA 1RKWA 1ZKGA 3G4SI 3E6BA 2HKXA 3GMEA 2CWEA 3CF2A 1RPWA 1O57A 2M9HA 3OIQA 2HEOA 1W0TA 2DMPA 4YFKF 5HLHA 1FOKA 1WH5A 3OS1A 4CYCA 2JA5J 1SANA 2EBIA 1ZYRF 4XLHA 2Y0SA 1MDMA 2OD5A 3J80K 4AM3A 1FIPA 3HOXJ 2PMHA 3QU6A 3TBIA 2LKXA 1X1CA 4BE0A 2JA8J 4D1QA 3M3YJ 3AAFA 1TQIA 3LNQA 3FM3A 5BPDA 3FIWA 4U0WA 3RSNA 1FSHA 1D1AA 3JTGA 3DBHB 4CYCB 3Q3SA 3EUHC 4PGGA 1MDMB 3NEUA 1IGNA 4D5FA 2OZ6A 3H36A 3OIPA 3BQZA 3NRVA 3M9AA 3U9GA 4E7HA 2MG4A 3V8JA 1I6HJ 4Q48A 5B5EC 2V9PA 1MMAA 3CMMA 5FD5A 3LSPA 1XS9A 3KP2A 2P6TA 2KIMA 4IOAF 2K5CA 3G1MA 5IP6A 3RZDJ 1ZH5A 3AG2H 1FBUA 3ELKA 3QYEA 2X48A 1T0FA 5FKMA 1Z0XA 3Q9VA 1SC7A 1OR7C 4BJ5C 1QRYA 2QLZA 4KIBA 4J00A 3CUQC 3OSFA 1XSXA 4L9NA 3BROA 2GXAA 2WB1A 2K9NA 3DPLC 2X85A 2M5WA 2JJ7A 2FRHA 3HRTA 5B3SH 1YX5A 4G9YA 3K69A 1F4KA 5GP9A 4M9ZA 2VOPA 3PQKA 2CV1A 1B9NA 2FOWA 3REOA 3V7SA 1ZRDA 3HC7A 4XSXF 2DMQA 1I6XA 3S14J 3WG9A 1P9QC 1XGSA 2GAUA 3S2DJ 4I7HA 3GFIA 3K4MA 4PJJA 4D0PA 2Y2ZA 3CC4I 4A0ZA 4JX6A 3DTEA 2GIVA 3NAUA 2M34A 3PSFA 5F0HA 3TW7A 5FD6A 1FMVA 2ZFWA 2J5PA 2RREA 3ULQB 4B4CA 3R61A 2JUCA 3FXQA 1V5GA 5IY5H 4CZZA 1I3QJ 5ILSA 2K40A 3BZCA 1VQKI 2DFIA 2ESHA 3LOCA 5B1BH 1G59A 2X4HA 3CCYA 3CP2A 4MQVA 3A2KA 1R36A 2EIMH 4OAZA 3L7WA 2LP0A 2ZXIA 3I71A 3W2VA 1UB9A 3FK6A 1MW7A 3H5AA 2Q1ZB 3M8EA 3CDLA 2NRAC 1R1UA 2JT1A 2GA1A 1UG0A 1Y1WJ 4WWCA 3OS2A 4JX5A 4KISA 2QGUA 3ONQA 2OCEA 2OUMA 5LGTA 5DUIA 1H9GA 1LKXA 2M1BA 5E18F 2COMA 1JE8A 3T8TA 4KMFA 2GZWA 2AS5F 1V5FA 3J7AO 4RM3A 3D0SA 3PO2J 4GFBA 1FX7A 4OU0A 4F52A 2XVCA 3R6SA 4XKBA 1QVUA 4UVAA 5FB2A 1FP2A 3QP6A 2HVQA 4DBRA 2CG4A 1ZELA 2Q2EA 5F0CA 1HF0A 3SXYA 4XQFA 4S05A 3S3OA 3BJAA 3ECHA 5IOYA 2DPDA 3Q5FA 2DT6A 3GTPJ 2L4MA 5HDGA 3K7AJ 3LFKA 1IRGA 1Z05A 2V9VA 4WXCA 3Q9SA 1HCRA 1OYYA 4P96A 3FDYA 2HPMA 5HLIA 4EJTA 1YJ9I 2RDPA 3OS0A 2Q2EB 1S29A 4Y33A 2VOOA 2BVLA 2V7FA 4PJMA 1KU3A 2XAFA 1Y0UA 2PG4A 1E3PA 1EH8A 1MJAA 2R5YA 1XSVA 1B6AA 3S32A 4GCVA 4JYKA 1JXSA 4E4HA 1BJZA 2ISYA 2Z33A 2HQ5A 3Q0WA 4IHYA 4A5NA 5HS7A 2NNYA 1Z91A 3BR0A 3LFUA 1SVOA 3S16J 1YTYA 5LGNA 3HGYA 4F91B 1YG2A 2DA2A 2VODA 2CQKA 2I5UA 2DFFA 4MFEA 1R1TA 4B44A 1QHHD 1J09A 1XDUA 2D1VA 4L0ZB 1UELB 2KIQA 5GAHJ 2QQAA 3FKIJ 4M3BA 1RC9A 1B8IA 2KJCA 2DK8A 4A3LJ 4PFOA 4EJOA 2JRTA 2MA3A 1R5ID 1W5TA 1JI8A 3BG5A 3H1CA 2Z3YA 1XDSA 3ZN1A 3LQRA 4D9JA 1JKPC 3A01B 1Z6RA 3W3CA 1J59A 4M6XA 1T08B 2V1NA 3IAS2 4A3FJ 1O4XA 4Z2YA 2R7DA 2BV6A 3JRCA 1B8IB 3F8CA 1R23A 4OMZA 2EH3A 1BI1A 2CV2A 4L5JA 4CYDA 4A2UA 1T98A 2XC7A 3BG3A 4EVIA 2VKHA 3HOSA 1MBEA 4RB1A 4XRSG 2VN2A 2O3FA 5D5VB 2A05A 1V4RA 3DCFA 2PJRA 2WA0A 1RETA 4JQFA 2HOSA 4JK1X 4NC8A 3SFIA 1SVMA 1UG2A 3QPLA 4IHTA 2COBA 2X6XA 1FYMA 2KT0A 1D5VA 2E7XA 3P7NA 3PNTA 2DA4A 2EJRA 5ICEA 3OSGA 3KYDB 3DU6A 5D4SA 1MBHA 4QLCU 4BDYA 3HSRA 2QSGX 1I1GA 4PSWA 1ZQ3P 3MKYB 5IT9Z 4CCMA 4FASD 2W7NA 1K79A 3VPRA 3S3MA 1HDPA 3I5UA 1K61A 2K4BA 2E1OA 2KDOA 3WU1B 4HW0A 2YU3A 4M72A 5D4RA 4A3MJ 4BHCA 2P7VB 3FXMA 4ENNA 4HNTA 2K02A 1V55H 3G73A 4FX4A 4RAGA 2AXLA 1E2XA 4AYBA 1MD0A 1SFXA 2VJ4A 2W24A 3OL3A 4EGYA 1UCRA 1TT0A 3M7GA 4V2FA 3RQ4A 3W6KB 5GPAA 1JJ8C 2Z9OA 1K6YA 5H6RA 4LIUA 1LPQA 2NS0A 3J81K 3C2GA 1ZG1A 1E0EA 1ETWA 2NS8A 4CICA 4YIRX 4OIPF 2IP2A 3BZ6A 2GQQA 3AG4H 5E8IA 2ZXHA 2HVRA 1YW8A 4E7LA 5EYRA 2MLKA 2M8EA 1OCPA 4N9IA 3CJQB 1SMTA 1TWFJ 2W00A 2O7OA 1G3WA 2VT2A 2R7RA 4XM3A 2ZNZA 2VIXA 4JP0A 5CVIA 3GEZA 2NOJB 2ZFUA 3P9CA 3SQNA 4N9HA 1S7EA 3HOZJ 3K6GA 4L9JA 4GXOA 3GCMA 3JCUC 1S7OA 1DGRM 4C3HJ 1BL0A 2L01A 1Y1VJ 3ABMH 2DI3A 1FYKA 1AHDP 1YITI 1W4MA 4I02A 5L3FA 4BBRJ 3KCCA 2DMNA 1U5TA 4Y17A 4EGZA 4EJVA 1X1AA 2OTJI 1T39A 2E2IJ 1R4MB 1HSTA 4L5IA 4HNVA 1SFOJ 1LQ1A 3QYBA 1DQUA 1ETQA 3RCOA 1H88C 5IP7J 3H92A 1YIJI 3BOQA 3WGIA 1U8RA 4WXHA 3PFYA 5TJJA 2XRLA 2KDZA 5TGTA 1KYWA 4XNFA 5KCMA 2WC2A 2XASA 4JBAA 2CYYA 1R5HA 1IRFA 1U6GA 1YHQI 5M5YJ 2FNAA 3CP8A 1ULYA 3LSGA 5LBQA 2DFHA 4FE4A 5DUKA 5KVRA 1IG7A 5D8LB 3K4BA 4DGWB 2EFWA 5J1UA 3EYIA 1S6LA 1XX5A 3F23A 4CCNA 1APLC 2DJIA 1TNTA 3MZYA 5E17F 2LC2A 1YYVA 3TQNA 2HI3A 3TOBA 2R7ZJ 2JA6J 3HPHA 1D0XA 3GXOA 3JR9A 1ETXA 3MCZA 4KN7X 4XORA 1WH7A 3RKYA 3BG6A 1O7FA 3DPTA 1FTZA 5BMZA 2FSWA 3M1CA 1BN5A 4KT5C 1MBKA 4G8XA 1ETOA 4A0YA 1FLIA 1ETVA 2KISA 4FQGA 1Z7UA 3QQAA 1W7PB 1WJFA 4QPQA 1E3HA 4UVCA 1GUUA 4F93B 5E8GA 3HRSA 1Z3YA 2R7SA 2IXSA 3RQIA 3R0AA 1JT6A 3FXJA 2HXIA 2P6SA 3TP0A 2YUSA 1IN7A 2XSJC 4BDZA 2AXTC 4II3A 3WU0A 5IPAA 3CMEI 3E6MA 1FP1D 2CUZA 2BZTA 2XHKA 2H8RA 2HDDA 3HJEA 2BHZA 4HNUA 2EV5A 2HDWA 2OU2A 1ERDA 2XKPA 3M07A 4NC6A 4BH9A 1PYVA 2DA5A 4LOCA 2KMUA 4A3CJ 1EV7A 1HW5A 2O03A 3WG7H 4B3AA 4DQ2A 2IEKA 1D1CA 4BS9A 1W5CC 3EUHA 5TISC 3F8NA 4NHJA 1S5LC 4RLFA 2LVSA 4QWQA 2DO7A 1LE8A 3I56I 3H0GJ 2QQ9A 1TLHB 2G0EA 3FM5A 3GTKJ 5LEJA 1A6QA 5CVJA 2IGKA 3GLLA 4N4NB 1K78A 4BXXJ 1GV5A 4M73A 2OQRA 3ZQLA 1H8AC 2LY1A 1UMQA 3VFZA 5JHUA 1P7JA 3FX3A 4I09A 1FY7A 4MHGA 4HX4A 2JPCA 1PVEA 4CHUA 3PNYA 1YS6A 3E5XA 4ENJA 3RTRA 3BCBA 1FYLA 3E3VA 1LE8B 3C7JA 5DCMB 4ITVA 1E3OC 2OZUA 2LBFA 1Q1HA 1N77A 3KEQA 1WGXA 1ZG3A 4DZJA 1K78B 1ETKA 5E1XA 3ZQFA 3S8PA 3N05A 4GRIA 1QNTA 4PGHA 5HODA 3CUQA 5DM7F 3RKQA 3IKTA 5AIQA 3OYGA 3DKYA 1OKRA 2LK2A 2VPLA 3KEOA 1OQYA 1U78A 1K6OA 3OWTA 1RR8C 4IRGA 4EM1A 2ZNYA 2LBFB 2M0CA 5B66C 2XB0X 1B1BA 2H09A 3M8FA 4PK4A 3DFGA 2EFOA 5HOOA 1T38A 3JAMZ 3PSIA 3DLLF 3CUQB 4H4KC 4MEXF 3LSIA 2OCCH 4MLOA 2OTLI 2EA2A 2MH9A 2E1MC 4IL6C 5C44J 3W2WA 2D1HA 3VB2A 1VZ0A 1TWAJ 1MNDA 1OMIA 3FF5A 2RKHA 2NNNA 3D5LA 3H5RA 1VQLI 2EK5A 3CZ6A 4A93J 2R7XA 2ECBA 2Z16A 3O8GA 1J5YA 2DXIA 4HPQA 1IXRC 2KQRA 2RV8A 3LA2A 3Q0UA 3QODA 4MNUA 3H5NA 3WODF 2CSOA 3IC7A 2O6GE 3DBLB 4CCLA 3CC7I 1BA5A 1MKMA 2PQ8A 4UUSA 3QRFF 3K1PA 2QQ8A 5FKOA 3U1KA 1BI0A 1XMXA 2VBWA 5FLXK 3L2CA 2PFBA 2Q8KA 4KITB 3ZRGA 3OIOA 4N4OB 2ELKA 3QPHA 3A0BC 2VQGA 4ZDOA 2KL4A 1XB4A 5EGOA 1IV6A 1NG7A 1N75A 3RPUD 2Y30A 2P8TA 1OFCX 5A2QK 2DJNA 3AG3H 4UUSB 3RIRA 2Q0OA 3E5QA 5F27A 3A03A 3WE3A 1YW7A 1TC3C 2PI0A 4CGZA 2CU7A 5CPRB 1QGPA 4NC7A 4A0XA 5EGOB 1XC5A 1ITYA 5F08A 1R1VA 2NYXA 3HXLA 1RUNA 1FMWA 4BJ6C 2GXGA 5KNLA 2QQBA 3ZMVA 2JRMA 2RNGA 5IOZA 5GPCA 3IH4A 1ZR4A 2IA2A 3ISPA 2M7AA 3UR3C 4BXUA 3HKZA 3CJTB 4YELA 2DLLA 1X1DA 4AVZA 5J6XA 3W6VA 3KIOA 2A61A 3UKGA 1X4OA 2CQQA 1JUPA 3COAC 2KP6A 5FROA 1LEBA 1PDNC 3F72A 3SZGA 3FXRA 2YX7A 3L1PA 1IN6A 2AQEA 3KLOA 1ODDA 3PM1A 4YFNF 1TW2A 2H94A 2F5VA 3GFJA 4LG0B 4F3QA 1S9HA 1WJDA 3CDHA 1JUMA 2X6YA 2K3PA 5D5WB 4FX0A 3OMYA 2X0LA 1R00A 3OYAA 2EV0A 4HRIA 1RKTA 4IX7A 1RI7A 2LDUA 1X58A 2NAZA 1G4DA 1KU9A 3VODA 3DKWA 5JVTA 4IPAA 3CJNA 2HFHA 3G1OA 2HNHA 4XL9A 1JHHA 2BOLA 1X2NA 2K4JA 1FOWA 2ZBKA 4RA2A 2JK3A 2VBXA 4CH7A 3HOTA 1YX3A 3O2PE 3G3ZA 5J4VA 5ILUA 3LL7A 2DT5A 3LSRA 3F6VA 3L2QA 2GLOA 2XAGA 1G3SA 2OA4A 2RGVA 2XF6A 4LIVA 2O61A 2FOKA 3ZQHA 3CCSI 2RNJA 1WJBA 2ELHA 3K70C 2NVUB 3F22A 1J9IA 2IS2A 1WKMA 2VQHA 2WAEA 1MBJA 4O3MA 1FNNA 2ADUA 1Y8QB 4DOZA 4PDKA 3F9KA 1P4XA 3E97A 1SFUA 1NK3P 3BTIA 2ZC2A 5EZHA 1YW9A 1I5ZA 1QQIA 2L3DA 3BG9A 4NQWB 4DBQA 3FXKA 4Y15A 3BQYA 1MSEC 4KA4A 3J80Z 2OC6A 4RAYA 3KP7A 1KONA 3I53A 3FKJA 4JX4A 2DYRH 5BS6A 4YEJA 1HOMA 2XDVA 4YG2F 3I55I 1SMYF 2EZLA 4IF4A 4OOIA 3B02A 5JVGF 5JI6A 2LF8A 1WI9A 2CUFA 3TGNA 3HHHA 3I4MJ 4XONA 2H6BA 4F92B 3OYFA 2X6OA 1Y39A 2L2OA 3E0JB 1OCRH 3VDXA 4EJWA 1WSUA 1BR1A 4LJZF 3V7CA 4HZFA 5CVVA 1BR4A 4CCJA 3TO9A 3GTQJ 1JHFA 2RQQA 3HM5A 1Z3XA 3LSKA 4XLCA 1FTTA 1UJ8A 3S2HJ 4M74A 3JTHA 2ZSIB 1H9TA 3DWLE 3BJ6A 1YIOA 1ZLKA 5H6QA 1T95A 2NS7A 2LLKA 1DU6A 4ZZDA 4HDVA 1I50J 1VFCA 3OYIA 5LHHA 4LB5A 2RVCA 2VQCA 2STWA 1AKHA 2JA2A 4L0YB 1ZAOA 2EQRA 3DKXA 3K2AA 3MFKA 3HOYJ 2Y9YA 1PUEE 2DPUA 2HOTA 3BR5A 4ESFA 1IJWC 1D8JA 4DZPA 3HOUJ 2CS3A 1ZRFA 2O0YA 1MNMC 1MMDA 2LRDA 4KJZA 2LSOA 1BR2A 1U8BA 3WHBA 2CQNA 3ABTA 3J7ZI 4IEJA 4FISA 4NDLA 1QVTA 3EUAA 5HLGA 4XKWA 5GTHC 5FLMJ 1AKHB 5L3GA 3OV8A 3IL2A 1TWGJ 4P9UA 3E7LA 3GYHX 3T0YA 3ERED 4HX8A 1TNSA 2FBHA 2L7KA 1XSDA 3P5JA 4CA0A 3CF5F 4Z6YA 3KYLA 1Z67A 3BR1A 2B63J 1RESA 4X1EA 3FXUA 5EEGA 4RGXA 5ICCA 3MZHA 2F2EA 2QA4I 3GTMJ 3B73A 3S2WA 1EH6A 1HDDC 3FBIB 2Z2SB 4Q4ZF 1GLNA 4NB5A 4FT8A 2DN0A 4XOTA 1ZGWA 1J0RA 1ETYA 2HZDA 2BY3A 5FRNA 2VC0A 5J8CA 3HYIA 3ABLH 4A6DA 3I3LA 3IWFA 2UUZA 2BGCA 3L00A 1KZHA 2WAQA 4UB8C 3IV5A 3GZ6A 2FA5A 2L9VA 1FZPB 1ENHA 2PX9A 2XGXA 4DYCA 3QP5A 1LVKA 2XRNA 2EZKA 3BP8A 4MO7A 3OYKA 3K2ZA 4BBSJ 3KLNA 4M6VA 2IS4A 4R79A 2IT0A 1XD7A 2CO5A 3DEEA 3VYUB 4XSZF 4AD9A 2ID3A 3A02A 1T6SA 1YJWI 3TO7A 2AO9A 1IXSB 2ZKZA 5CYVA 2X51A 3CO6C 1A31A 4RAZA 3W6JB 4V2GA 3OYHA 1VTNC 2B0LA 4PZJA 1G3TA 1TBXA 1XN7A 2K9QA 4Y7NJ 5J1RA 1U9NA 3ZMZA 4XRMA 2ELJA 1R9TJ 4YIIA 5DDGA 5J1YA 2W82A 2VL8A 2HGCA 2V9KA 3N97A 4PCQA 1YE9A 3R0JA 3A01A 3IRQA 3C18A 1HBXG 3OYLA 1WQ2A 2GWRA 1LJ9A 4OIRF 5F04A 3GFLA 4UV8A 3KP6A 5F0FA 3H9GA 4OAYA 2BY0A 5ED4A 2FBKA 3RKWA 3G6EI 1OCTC 4CSWA 1D0YA 3WE2A 3ZMUA 2QKLB 3EQLF 4ZYHA 2BYVE 3IAM2 2V1DA 1FIAA 2M45A 1TT5B 3MEXA 3P9IA 2Y9ZA 2E60A 3CC2I 4HV6A 4Y52J 2L02A 4E7IA 2FU4A 1JGSA 2FMYA 1JT0A 3U21A 1X3UA 2CFXA 4GO1A 5BNGA 2VBYA 2GIZA 4HSRA 2P7CB 4A3KJ 1ZGAA 3OYMA 4RDUA 2KIUA 4RLQA 4S0HB 3NWSA 2PBIA 4RGRA 2VJ5A 4I76A 3VYSB 1O3RA 3SYTA 4KNYA 3ZMDA 4C3JJ 4XRSA 2DA3A 5K5QA 2LNBA 3FXLA 2IA0A 3K10A 4MQ9F 4A69C 2MFZA 4OMYA 1P4WA 2EFPA 1R5GA 2HTSA 4XLPF 5H20A 2BBYA 2LKSA 2L9SA 3OR1C 2LFBA 4LD5A 3FHZA 3KZZA 4XKVA 1J2XA 3S1QJ 2R3SA 2XPVA 2LD5A 2TCTA 5ICFA 2QSFX 3S3NA 3SHFA 4BE1A 3KZIC 4X6AJ 1JKRC 2HOAA 2A3SA 1EA3A 3LSTA 2F5FA 1ZG5A 2FD5A 2PMZN 5KAFC 4W97A 4LLLA 4RS8A 2KRCA 2W1OA 3A1YA 3BPVA 2B7EA 3CTAA 4G12A 3V4GA 4CCOA 3I59B 4UV9A 2E35A 1XGNA 1W0UA 1TWCJ 4BHBA 1BIAA 2MD5A 2BXZA 1W5SA 3R60A 1RZ4A 4ZH4F 5E3NA 1IZ1A 1VQNI 5IYDJ 5M3FJ 1CF7B 4MEYF 1LFBA 4XRFA 2NOGA 3HPGA 3BC8A 4AIKA 3OY9A 4Q5SF 3TOAA 2VB6A 4QTRA 2DYSH 1JJ6C 2E5NA 2CQXA 2WBMA 3ZQIA 3DP7A 4G6TB 5L3BA 3F8FA 4O5VA 2ESNA 2L7ZA 4R8HA 4FCYA 4EJUA 3HUGA 4LG3A 3KYCB 5GAGJ 3CQZJ 3DLAA 2E1MB 3LWFA 5L3EA 4ZTFA 1P7IA 1Y6IA 3IUOA 1WWXA 4B48A 2TDXA 2I10A 4A12A 2GOMA 4GYIA 9ANTA 2MYSA 3P9KA 4HEA2 5FGMA 1OCCH 2VPRA 5H2FC 5HVQC 1EKEA 1JTYA 4C2UA 3IH2A 2L0KA 2HWVA 5DEQA 2A6EF 3HUGB 1Y0NA 3ZQ7A 1R49A 1JGGA 3SZTA 3VYTB 2LH9A 1PP7U 1K83J 4ZC3A 2DQRA 4WCGA 3OYCA 2HQAA 3HL2A 4RMNA 4BYYA 1UHSA 4M3FA 2FNPA 3DBRB 3CCLI 5JR3A 2VT3A 1G3YA 2F4IA 2VJIA 3BY6A 4LK1F 2PMUA 2KPMA 4ZTJA 4FE7A 4C2MJ 1ZARA 2ISZA 3HOVJ 1PP8F 1W36D 5CLSA 4RGUA 5FKKA 4RB2C 3ASNH 3J7AY 1WJEA 5D6FA 4IHVA 3K4JA 3SDBA 2VE8A 4DYRA 2YX4A 1NTCA 5LEKA 4IHWA 3K1NA 3H35A 4V19K 1IN8A 5BOXA 3LA7A 2QKMB 2JSCA 3QWLA 1W7PA 4HDUA 3CCQI 2DQLA 4HF1A 2ZSHB 2IRFG 4U0YA 2OAZA 3VSKA 5E3OA 1U0JA 2KHMA 2QM3A 3KX2A 4I01A 2L7MP 3EUKL 4B3XA 2G7HA 2B9SA 2EZIA 2JWTA 2OF7A 4HBLA 2M3AA 2X1EA 4UXNA 1IRXA 1MZBA 1JTXA 2ZMEB 2W4SA 3MAJA 1OJLA 1VQMI 2W48A 3JRFA 1HXDA 5L3DA 2DMUA 2KLOA 1MBFA 4M71A 3TL4X 3CJRB 1X3WB 3DXJF 4I0BA 5FRMA 4IHXA 3JRDA 3BZKA 2V26A 2A69F 3H3UA 4AYBN 2QBYB 5DS9A 5J40A 2H27A 2BXYA 5LHIA 1FEXA 4LGWA 1R6RA 4D7MA 2QF7A 1D8KA 3LSHA 4BU2A 2GA2A 2K86A 1FWZA 1GT0C 2PN6A 1D0ZA 4D7NA 3EPZA 2UV1A 4XN3A 4ZYGA 4X0GA 1V3FA 2QVOA 2R7OA 4EQQA 4A3JJ 2DOFA 2XUBA 2OV7A 3HEFA 2GM4A 1DP3A 3ECOA 1G6NA 2P0WA 3G1LA 5DCMA 1TL8A 1MMSA 2VONA 4E7KA 2BEOA 3FMQA 3F8MA 2XROA 1BOAA 2L9RA 2VE9A 1XPXA 1F43A 3I0TA 5EDNA 5L3CA 1E17A 2P5KA 4I99C 1ORKA 3RI4A 3TMOA 2MH2A 2FQ4A 2V6CA 3ASOH 3OOUA 1TTYA 4CO8A 3R4KA 4E70A 3QPTA 4CXFA 2DOEA 3M4OJ 5J3LA 1A04A 4KN4X 3CLOA 4IO9F 2QSHX 5FO5A 4AC0A 1Y8RB 1WI3A 3LSJA 1GXPA 1WRJA 4A3EJ
chains in the Genus database with same CATH topology
3G1OA 1CQTA 1X2NA 4ABZA 3JRBA 1HCRA 4XIDA 2JK3A 2XPUA 4MIMA 2O8KA 1G2HA 3LSRA 2GLOA 3JRGA 1RR7A 2E2JJ 3B6CA 2IBDA 3ZQHA 2ID6A 2R5YA 3BR2A 4JYKA 5E3LA 1BJZA 2HXOA 2HQ5A 3Q0WA 4IHYA 2IAIA 1MBJA 4A3DJ 3BR0A 3S16J 5EEAA 3HGYA 1NK3P 2DA2A 3BTIA 3H3VK 3TEDA 5EZHA 3D1NI 4MFEA 3BG9A 1AU7A 3HB9A 1B72A 3BQYA 1MSEC 1HLVA 2JN6A 2E2HJ 3FKIJ 4JX4A 4M3BA 1B8IA 5FLVA 1Q1VA 1HOMA 4A3LJ 2EZLA 2CUFA 3BG5A 3I4MJ 3ZQCA 1JKPC 5C4JJ 3A01B 1B72B 2X6OA 2VI6A 1VNDA 4A3FJ 3PO3J 2FX0A 1O4XA 5E3MA 3JRCA 1B8IB 3GTQJ 2EH3A 2K9SA 3HM5A 2XGEA 3BG3A 2R0QC 1MBEA 3C2BA 1FTTA 5C3EJ 3S2HJ 2LTPA 5DTDA 4XRSG 5F1JA 1IDYA 1NK2P 2R92J 4BY7J 3MVPA 2NS7A 3DCFA 2LLKA 3HGGA 1DU6A 1RETA 2HOSA 1I50J 3SFIA 1VFCA 1UG2A 4C3IJ 3QPLA 2COBA 1Z77A 2KT0A 1AKHA 5M3MJ 2M8GX 3GBGA 2EQRA 3K2AA 2NVXJ 3HOYJ 2XGDA 2Y9YA 2DA4A 3OSGA 2HOTA 3BR5A 1GV2A 1MBHA 5EZGA 1IJWC 4QSHA 4DZPA 3HOUJ 1ZQ3P 2DTZA 2H1KA 1MNMC 4J19A 1ZK8A 3VPRA 1U8BA 5K7ZA 1HDPA 1K61A 3WHBA 2E1OA 4IEJA 4A3MJ 4FISA 4NDLA 1QVTA 4M3DA 5FLMJ 1AKHB 3BR3A 1TWGJ 4BY1J 2MGQA 3E7LA 3BTCA 4EEFG 1MBGA 4A3IJ 2EZHA 3BR1A 4V2FA 1IDZA 2B63J 1RESA 4X1EA 5GPAA 1JJ8C 2NVTJ 1T33A 4QIWN 3GTMJ 2LY9A 2VUMJ 2R93J 1HDDC 3ZQGA 1ETWA 2DN0A 2NS8A 1ZGWA 1ETYA 1MH4A 4I6ZA 2R5ZA 2HYJA 4XICA 5EYRA 3S1MJ 1OCPA 3IV5A 1TWFJ 5IP9J 1ENHA 2O7OA 4DYCA 4M3GA 2EZKA 4MO7A 2NVQJ 4JP0A 4BBSJ 4M6VA 3BTJA 2ID3A 1YRNA 3A02A 1S7EA 2AO9A 3HOZJ 3O8HA 3HDDA 2R5ZB 1IRZA 1U9OA 1BL0A 4C3HJ 3JRIA 5M5WJ 1Y1VJ 1JKQC 4RBOA 4V2GA 4DYQA 2K9QA 5JLXA 4Y7NJ 1AHDP 5J1RA 4UUTA 3RZOJ 4W1UA 1U9NA 4XRMA 3WHCA 4BBRJ 1R9TJ 3HBLA 1YRNB 2DMNA 2L7FP 4M3EA 5J1YA 2E2IJ 1PUFA 4HNVA 2NVYJ 3BT9A 1SFOJ 3A01A 1ETQA 1H89C 1H88C 5IP7J 3GTLJ 3ZOBA 2GBYA 2YU9J 2XRLA 2KDZA 2XSDC 5F04A 5F0FA 1OCTC 2O9LA 1PUFB 3TW6A 5M5YJ 1POGA 3LSGA 5FKNA 3MKLA 4FE4A 5M5XJ 1IG7A 2DA7A 3GTGJ 1FIAA 4FTHA 5J1UA 5K7HA 2DMTA 4A3GJ 4DW6A 1XG1A 2Y9ZA 1APLC 4Y52J 2CJJA 1JT0A 5FJ8J 1DU0A 5BNGA 3IH3A 4A3KJ 2HI3A 1LFUP 2R7ZJ 5FKLA 2JA6J 4RDUA 3JR9A 1ETXA 3JRHA 4S0HB 3HOWJ 1WH7A 4I76A 5JLWA 3I4NJ 1WPKA 1FTZA 1A6IA 4C3JJ 2JA7J 4XRSA 1MBKA 2DA3A 1A5JA 1ETOA 2E19A 3HKZN 2TRTA 5C4XJ 1ETVA 2D5VA 2CRGA 3QQAA 3GTOJ 4A69C 2MW8A 1GUUA 2P81A 1VF9A 3RQIA 1JT6A 2LFBA 2HXIA 3S17J 3FISA 3NARA 3TP0A 2YUSA 3S1QJ 2XPVA 2LD5A 2TCTA 5IPAA 2CUEA 4X6AJ 1JKRC 2HOAA 3SJMA 1ZR2A 2H8RA 2HDDA 2FD5A 2PMZN 4W97A 2XPWA 3FK7A 2DA5A 4LOCA 1IUFA 4A3CJ 2DA1A 2LR8A 4B3AA 4G12A 2IEKA 3TP3A 5K7FA 1F36A 1JUSA 3GTJJ 1W0UA 1TWCJ 4XK4A 2LVSA 1LE8A 1JKOC 2QCOA 2ECCA 1TWHJ 3H0GJ 2G0EA 4BKXA 3GTKJ 2RAEA 5E3NA 5IYDJ 2XB5A 5M3FJ 2Y0SN 1LFBA 4BXXJ 1D5YA 1GV5A 2NOGA 4MFDA 3ZQLA 1H8AC 4D5CA 1RKWA 4QTRA 1UMQA 1ZKGA 1P7JA 1JJ6C 2CQXA 1VI0A 3ZQIA 2MSYA 3CMYA 2L7ZA 1LE8B 1RPWA 4FCYA 1E3OC 2M9HA 3CQZJ 2YS9A 1WGXA 5EG0A 1W0TA 1P7IA 2DMPA 4DZJA 1ETKA 3ZQFA 2I10A 4AUXA 1WH5A 5HODA 4CYCA 2JA5J 3RKQA 9ANTA 1SANA 2EBIA 2VPRA 3B6AA 2LK2A 1FIPA 3HOXJ 2LKXA 1JTYA 2JA8J 1U78A 3IH2A 3M3YJ 2L0KA 3LNQA 1JGGA 2AHQA 2M0CA 2Y31A 2XB0X 3FIWA 3QPSA 5EG0B 1K83J 1BW6A 4CYCB 3Q3SA 2ME0A 4MLOA 1QPIA 1UHSA 1IGNA 4M3FA 4D5FA 5C44J 1WCMJ 1IC8A 1TWAJ 2WB1N 3S1RJ 3BQZA 3MN2A 2MG4A 4FE7A 4C2MJ 4A93J 1I6HJ 2ECBA 3O8GA 3HOVJ 3Q0UA 3LSPA 2R5YB 1XS9A 1MSFC 5FKKA 4IHVA 3G1MA 5IP6A 1BA5A 3RZDJ 2VKEA 3JRAA 4UUSA 2X48A 4DYRA 5FKOA 1NTCA 5FKMA 1Z0XA 1QRYA 4IHWA 3OSFA 3BTLA 3DEWA 3OIOA 2ELKA 1MH3A 2K9NA 5EGOA 1IV6A 1FJLA 2JJ7A 2JMWA 4A3BJ 2WV1A 2Y30A 5GP9A 1OFCX 5E3OA 2DJNA 4UUSB 5EF6A 1X2MA 2DMQA 2L7MP 2ZB9A 5F27A 3A03A 3S14J 2VKVA 1TC3C 2EZIA 2JWTA 3S2DJ 2CU7A 2OF7A 5EGOB 2Y2ZA 1XC5A 4JX6A 1JTXA 1ITYA 3NAUA 2M34A 5F0HA 5F08A 1OJLA 3TW7A 3S1NJ 2XGCA 2W48A 1GDTA 3JRFA 4B4CA 3JREA 2DMUA 5IYCJ 1MBFA 4L5EA 3SDGA 1I3QJ 2K40A 5IOZA 2M2EA 5GPCA 3IH4A 4IHXA 2X9DA 3JRDA 1ZR4A 3LOCA 4AYBN 1BW5A 3CCYA 5DS9A 1FEXA 5IYBJ 2LP0A 2N8GA 4D7MA 3W6VA 3S15J 2QF7A 1ZTRA 3FK6A 1GT0C 3UKGA 3CDLA 1GVDA 2CQQA 4D7NA 1JUPA 1Y1WJ 2FJ1A 4JX5A 4A3JJ 3L1PA 2GM4A 3HEFA 3G1LA 3PM1A 4B1RA 2ME6A 2L9RA 3PO2J 2WAQN 1F43A 4GFBA 5EDNA 1ORKA 1QVUA 3Q0VA 2FQ4A 3OOUA 1JUMA 3M4OJ 5F0CA 3BR6A 1HF0A 2OPTA 1EF4A 1RKTA 5J3LA 3F0CA 5IOYA 2DA6A 1X58A 3GTPJ 4AC0A 1T56A 1WI3A 3K7AJ 3LSJA 4A3EJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3G1O A;  1CQT A;  1X2N A;  4ABZ A;  3JRB A;  1HCR A;  4XID A;  2JK3 A;  2XPU A;  4MIM A;  2O8K A;  1G2H A;  3LSR A;  2GLO A;  3JRG A;  1RR7 A;  2E2J J;  3B6C A;  2IBD A;  3ZQH A;  2ID6 A;  2R5Y A;  3BR2 A;  4JYK A;  5E3L A;  1BJZ A;  2HXO A;  2HQ5 A;  3Q0W A;  4IHY A;  2IAI A;  1MBJ A;  4A3D J;  3BR0 A;  3S16 J;  5EEA A;  3HGY A;  1NK3 P;  2DA2 A;  3BTI A;  3H3V K;  3TED A;  5EZH A;  3D1N I;  4MFE A;  3BG9 A;  1AU7 A;  3HB9 A;  1B72 A;  3BQY A;  1MSE C;  1HLV A;  2JN6 A;  2E2H J;  3FKI J;  4JX4 A;  4M3B A;  1B8I A;  5FLV A;  1Q1V A;  1HOM A;  4A3L J;  2EZL A;  2CUF A;  3BG5 A;  3I4M J;  3ZQC A;  1JKP C;  5C4J J;  3A01 B;  1B72 B;  2X6O A;  2VI6 A;  1VND A;  4A3F J;  3PO3 J;  2FX0 A;  1O4X A;  5E3M A;  3JRC A;  1B8I B;  3GTQ J;  2EH3 A;  2K9S A;  3HM5 A;  2XGE A;  3BG3 A;  2R0Q C;  1MBE A;  3C2B A;  1FTT A;  5C3E J;  3S2H J;  2LTP A;  5DTD A;  4XRS G;  5F1J A;  1IDY A;  1NK2 P;  2R92 J;  4BY7 J;  3MVP A;  2NS7 A;  3DCF A;  2LLK A;  3HGG A;  1DU6 A;  1RET A;  2HOS A;  1I50 J;  3SFI A;  1VFC A;  1UG2 A;  4C3I J;  3QPL A;  2COB A;  1Z77 A;  2KT0 A;  1AKH A;  5M3M J;  2M8G X;  3GBG A;  2EQR A;  3K2A A;  2NVX J;  3HOY J;  2XGD A;  2Y9Y A;  2DA4 A;  3OSG A;  2HOT A;  3BR5 A;  1GV2 A;  1MBH A;  5EZG A;  1IJW C;  4QSH A;  4DZP A;  3HOU J;  1ZQ3 P;  2DTZ A;  2H1K A;  1MNM C;  4J19 A;  1ZK8 A;  3VPR A;  1U8B A;  5K7Z A;  1HDP A;  1K61 A;  3WHB A;  2E1O A;  4IEJ A;  4A3M J;  4FIS A;  4NDL A;  1QVT A;  4M3D A;  5FLM J;  1AKH B;  3BR3 A;  1TWG J;  4BY1 J;  2MGQ A;  3E7L A;  3BTC A;  4EEF G;  1MBG A;  4A3I J;  2EZH A;  3BR1 A;  4V2F A;  1IDZ A;  2B63 J;  1RES A;  4X1E A;  5GPA A;  1JJ8 C;  2NVT J;  1T33 A;  4QIW N;  3GTM J;  2LY9 A;  2VUM J;  2R93 J;  1HDD C;  3ZQG A;  1ETW A;  2DN0 A;  2NS8 A;  1ZGW A;  1ETY A;  1MH4 A;  4I6Z A;  2R5Z A;  2HYJ A;  4XIC A;  5EYR A;  3S1M J;  1OCP A;  3IV5 A;  1TWF J;  5IP9 J;  1ENH A;  2O7O A;  4DYC A;  4M3G A;  2EZK A;  4MO7 A;  2NVQ J;  4JP0 A;  4BBS J;  4M6V A;  3BTJ A;  2ID3 A;  1YRN A;  3A02 A;  1S7E A;  2AO9 A;  3HOZ J;  3O8H A;  3HDD A;  2R5Z B;  1IRZ A;  1U9O A;  1BL0 A;  4C3H J;  3JRI A;  5M5W J;  1Y1V J;  1JKQ C;  4RBO A;  4V2G A;  4DYQ A;  2K9Q A;  5JLX A;  4Y7N J;  1AHD P;  5J1R A;  4UUT A;  3RZO J;  4W1U A;  1U9N A;  4XRM A;  3WHC A;  4BBR J;  1R9T J;  3HBL A;  1YRN B;  2DMN A;  2L7F P;  4M3E A;  5J1Y A;  2E2I J;  1PUF A;  4HNV A;  2NVY J;  3BT9 A;  1SFO J;  3A01 A;  1ETQ A;  1H89 C;  1H88 C;  5IP7 J;  3GTL J;  3ZOB A;  2GBY A;  2YU9 J;  2XRL A;  2KDZ A;  2XSD C;  5F04 A;  5F0F A;  1OCT C;  2O9L A;  1PUF B;  3TW6 A;  5M5Y J;  1POG A;  3LSG A;  5FKN A;  3MKL A;  4FE4 A;  5M5X J;  1IG7 A;  2DA7 A;  3GTG J;  1FIA A;  4FTH A;  5J1U A;  5K7H A;  2DMT A;  4A3G J;  4DW6 A;  1XG1 A;  2Y9Z A;  1APL C;  4Y52 J;  2CJJ A;  1JT0 A;  5FJ8 J;  1DU0 A;  5BNG A;  3IH3 A;  4A3K J;  2HI3 A;  1LFU P;  2R7Z J;  5FKL A;  2JA6 J;  4RDU A;  3JR9 A;  1ETX A;  3JRH A;  4S0H B;  3HOW J;  1WH7 A;  4I76 A;  5JLW A;  3I4N J;  1WPK A;  1FTZ A;  1A6I A;  4C3J J;  2JA7 J;  4XRS A;  1MBK A;  2DA3 A;  1A5J A;  1ETO A;  2E19 A;  3HKZ N;  2TRT A;  5C4X J;  1ETV A;  2D5V A;  2CRG A;  3QQA A;  3GTO J;  4A69 C;  2MW8 A;  1GUU A;  2P81 A;  1VF9 A;  3RQI A;  1JT6 A;  2LFB A;  2HXI A;  3S17 J;  3FIS A;  3NAR A;  3TP0 A;  2YUS A;  3S1Q J;  2XPV A;  2LD5 A;  2TCT A;  5IPA A;  2CUE A;  4X6A J;  1JKR C;  2HOA A;  3SJM A;  1ZR2 A;  2H8R A;  2HDD A;  2FD5 A;  2PMZ N;  4W97 A;  2XPW A;  3FK7 A;  2DA5 A;  4LOC A;  1IUF A;  4A3C J;  2DA1 A;  2LR8 A;  4B3A A;  4G12 A;  2IEK A;  3TP3 A;  5K7F A;  1F36 A;  1JUS A;  3GTJ J;  1W0U A;  1TWC J;  4XK4 A;  2LVS A;  1LE8 A;  1JKO C;  2QCO A;  2ECC A;  1TWH J;  3H0G J;  2G0E A;  4BKX A;  3GTK J;  2RAE A;  5E3N A;  5IYD J;  2XB5 A;  5M3F J;  2Y0S N;  1LFB A;  4BXX J;  1D5Y A;  1GV5 A;  2NOG A;  4MFD A;  3ZQL A;  1H8A C;  4D5C A;  1RKW A;  4QTR A;  1UMQ A;  1ZKG A;  1P7J A;  1JJ6 C;  2CQX A;  1VI0 A;  3ZQI A;  2MSY A;  3CMY A;  2L7Z A;  1LE8 B;  1RPW A;  4FCY A;  1E3O C;  2M9H A;  3CQZ J;  2YS9 A;  1WGX A;  5EG0 A;  1W0T A;  1P7I A;  2DMP A;  4DZJ A;  1ETK A;  3ZQF A;  2I10 A;  4AUX A;  1WH5 A;  5HOD A;  4CYC A;  2JA5 J;  3RKQ A;  9ANT A;  1SAN A;  2EBI A;  2VPR A;  3B6A A;  2LK2 A;  1FIP A;  3HOX J;  2LKX A;  1JTY A;  2JA8 J;  1U78 A;  3IH2 A;  3M3Y J;  2L0K A;  3LNQ A;  1JGG A;  2AHQ A;  2M0C A;  2Y31 A;  2XB0 X;  3FIW A;  3QPS A;  5EG0 B;  1K83 J;  1BW6 A;  4CYC B;  3Q3S A;  2ME0 A;  4MLO A;  1QPI A;  1UHS A;  1IGN A;  4M3F A;  4D5F A;  5C44 J;  1WCM J;  1IC8 A;  1TWA J;  2WB1 N;  3S1R J;  3BQZ A;  3MN2 A;  2MG4 A;  4FE7 A;  4C2M J;  4A93 J;  1I6H J;  2ECB A;  3O8G A;  3HOV J;  3Q0U A;  3LSP A;  2R5Y B;  1XS9 A;  1MSF C;  5FKK A;  4IHV A;  3G1M A;  5IP6 A;  1BA5 A;  3RZD J;  2VKE A;  3JRA A;  4UUS A;  2X48 A;  4DYR A;  5FKO A;  1NTC A;  5FKM A;  1Z0X A;  1QRY A;  4IHW A;  3OSF A;  3BTL A;  3DEW A;  3OIO A;  2ELK A;  1MH3 A;  2K9N A;  5EGO A;  1IV6 A;  1FJL A;  2JJ7 A;  2JMW A;  4A3B J;  2WV1 A;  2Y30 A;  5GP9 A;  1OFC X;  5E3O A;  2DJN A;  4UUS B;  5EF6 A;  1X2M A;  2DMQ A;  2L7M P;  2ZB9 A;  5F27 A;  3A03 A;  3S14 J;  2VKV A;  1TC3 C;  2EZI A;  2JWT A;  3S2D J;  2CU7 A;  2OF7 A;  5EGO B;  2Y2Z A;  1XC5 A;  4JX6 A;  1JTX A;  1ITY A;  3NAU A;  2M34 A;  5F0H A;  5F08 A;  1OJL A;  3TW7 A;  3S1N J;  2XGC A;  2W48 A;  1GDT A;  3JRF A;  4B4C A;  3JRE A;  2DMU A;  5IYC J;  1MBF A;  4L5E A;  3SDG A;  1I3Q J;  2K40 A;  5IOZ A;  2M2E A;  5GPC A;  3IH4 A;  4IHX A;  2X9D A;  3JRD A;  1ZR4 A;  3LOC A;  4AYB N;  1BW5 A;  3CCY A;  5DS9 A;  1FEX A;  5IYB J;  2LP0 A;  2N8G A;  4D7M A;  3W6V A;  3S15 J;  2QF7 A;  1ZTR A;  3FK6 A;  1GT0 C;  3UKG A;  3CDL A;  1GVD A;  2CQQ A;  4D7N A;  1JUP A;  1Y1W J;  2FJ1 A;  4JX5 A;  4A3J J;  3L1P A;  2GM4 A;  3HEF A;  3G1L A;  3PM1 A;  4B1R A;  2ME6 A;  2L9R A;  3PO2 J;  2WAQ N;  1F43 A;  4GFB A;  5EDN A;  1ORK A;  1QVU A;  3Q0V A;  2FQ4 A;  3OOU A;  1JUM A;  3M4O J;  5F0C A;  3BR6 A;  1HF0 A;  2OPT A;  1EF4 A;  1RKT A;  5J3L A;  3F0C A;  5IOY A;  2DA6 A;  1X58 A;  3GTP J;  4AC0 A;  1T56 A;  1WI3 A;  3K7A J;  3LSJ A;  4A3E J; 
#chains in the Genus database with same CATH topology
 2DDB A;  3IWZ A;  5JFR A;  2E5Z A;  3A4C A;  1CQT A;  4HV5 A;  4ABZ A;  3JRB A;  5F1R A;  1SD4 A;  3SEQ A;  2K85 A;  2E7W A;  5JHF A;  1HSJ A;  4MIM A;  2O8K A;  1G2H A;  3E5U A;  4Y13 A;  2R7U A;  3JRG A;  1LB2 A;  1K4S A;  1O3S A;  4O6J A;  2JQ7 A;  2BY1 A;  4G6D A;  2J5O A;  2IVM A;  2M30 A;  2ID6 A;  1LFP A;  2LY2 A;  3BR2 A;  1G8X A;  5E3L A;  1YS7 A;  1YFH A;  1SEU A;  4Q47 A;  3VSL A;  3HRM A;  4AIH A;  2IAI A;  2VJJ A;  3RJP A;  3HRU A;  2EIL H;  1OLT A;  4A3D J;  5E79 C;  2G7U A;  2HZT A;  2JSP A;  4XOP A;  5HS9 A;  5EEA A;  3L2V A;  1KQ0 A;  3H3V K;  3TED A;  2CW0 F;  4BXF A;  4ZDP A;  1FOX A;  3CMA I;  1STZ A;  4ASN A;  2LMD A;  2EPF A;  3PFI A;  2E2H J;  3GWZ A;  4HAM A;  4C30 A;  3SEZ A;  3WTZ A;  2LKP A;  2E34 A;  1H0M A;  2R7F A;  4RM2 A;  1Z1D A;  3KP3 A;  3PUB A;  1MIJ A;  3O6B B;  3IKV A;  1FOY A;  1FBS A;  4G7Z F;  5C4J J;  1MMG A;  4ENM A;  4LLN A;  1HKS A;  2EA4 A;  2XIG A;  2VI6 A;  2F5E A;  3E6D A;  1ONV A;  3DEU A;  3ZXS A;  2FX0 A;  2HU9 A;  2M7B A;  3LAP A;  2RQP A;  2VKD A;  1U2W A;  1T2K A;  3QOP A;  5CKT A;  3W2A A;  3LA3 A;  3AG1 H;  2XGE A;  2CW8 A;  3CDI A;  3MQ0 A;  2FBI A;  4ETS A;  4E7Z A;  5E1Z B;  2KFD A;  3C2B A;  3V42 A;  4CUG A;  5CVU A;  3ESW B;  2P5V A;  4BGD A;  5F1J A;  1MJ9 A;  3KFW X;  2R92 J;  4YFX F;  1YI2 I;  4UY8 I;  2L54 A;  3GF2 A;  5AIP A;  3T5X A;  3FWE A;  1X1B A;  3DTK A;  2Z5U A;  1FBQ A;  3WTV C;  1Z77 A;  2M8G X;  1ZRC A;  3GBG A;  2NVX J;  3T1B A;  2WTE A;  2MAB A;  1FT9 A;  1GV2 A;  5EZG A;  4QSH A;  3HG9 A;  2EIK H;  2STT A;  3SFZ A;  4IXA A;  5TRD A;  4B8X A;  4LG0 A;  4J19 A;  3CCM I;  2V1U A;  2MC3 A;  1XTA A;  5CQG A;  3CD6 I;  2JTV A;  2KKO A;  5A2Q Z;  1DUX C;  4ANJ A;  3SZP A;  2ZME C;  2XF7 A;  3KP4 A;  3K0L A;  2I8D A;  1IXC A;  3BR3 A;  5DYM A;  5KK1 A;  5J47 A;  4BQA A;  2LOO A;  3MKW B;  5HNF A;  4BUP A;  4KMU X;  2KZV A;  2HQR A;  1BI3 A;  4A3I J;  1SD5 A;  4WF2 A;  1IDZ A;  3LMM A;  2GXB A;  2NVT J;  4PJL A;  1ON2 A;  1T33 A;  4QIW N;  5HS8 A;  4AWX B;  2EIN H;  2R93 J;  2XF5 A;  3E6C C;  4CZC A;  1HKQ A;  2ZJP F;  2DAO A;  4CCK A;  2P5L C;  1KU2 A;  2KRF A;  4HLX A;  3V8K A;  1GHC A;  2R7W A;  3GO5 A;  3G2B A;  4I2O A;  2P4W A;  3OYB A;  4XIC A;  2DBB A;  4XBF A;  5IP9 J;  4HF2 A;  5AON A;  2F5C A;  4OIQ F;  3AFH A;  3BTJ A;  2ICW G;  1ZLJ A;  1D1B A;  1YRN A;  1HKT A;  3K4L A;  1P4A A;  1YJN I;  3O8H A;  3WTW C;  3EDP A;  3ZMT A;  1IRZ A;  3MMY B;  1HC8 A;  2VC1 A;  4NQW A;  2HYG D;  1A36 A;  5M5W J;  1JKQ C;  4RBO A;  1RRJ A;  1KQ9 A;  4DYQ A;  5JLX A;  1S72 I;  4AID A;  4J01 A;  4UUT A;  3RZO J;  3KP5 A;  4W1U A;  1QHG A;  4L9V A;  2DK5 A;  2CQ7 A;  3WHC A;  1YRN B;  5J4Y A;  4HF0 A;  4M9X A;  3PIO F;  4KUM A;  4U7D A;  4OWR B;  2NVY J;  3S93 A;  1R71 A;  4HOB A;  1H89 C;  1P92 A;  1O7L A;  5GAE J;  2VXZ A;  5HLT A;  1J75 A;  3BPX A;  3L09 A;  4M6Y A;  3GTL J;  2GBY A;  1LEA A;  2YU9 J;  2D45 A;  4ENK A;  2XSD C;  3GX4 X;  4II2 A;  3BCA A;  5HDN A;  1K7A A;  2HVS A;  1Y56 A;  3V7R A;  4BJT A;  2EB7 A;  3E1S A;  2FF4 A;  4XLN F;  3CCU I;  3TW6 A;  1ZRE A;  2JVG A;  5FKN A;  3MKL A;  3EYY A;  2F6C A;  2V6E A;  2X1D A;  5M5X J;  5F6F A;  4S04 A;  3GTG J;  3HTS B;  2CFO A;  3L2W A;  2QZ8 A;  1RIO H;  4FTH A;  1ZGJ A;  5K5O A;  2DMT A;  1X4P A;  3ML6 A;  4DW6 A;  4U7B A;  2R7T A;  1UFM A;  2Z99 A;  3K4N A;  4KIC A;  2F48 A;  2IGN A;  4E7J A;  2F4O B;  2K27 A;  2Z1D A;  3IH3 A;  1LFU P;  5D6E A;  3CO7 C;  1CGP A;  3VWB A;  3FMS A;  5F64 A;  5LD2 C;  3HOW J;  2WAD A;  3I58 A;  3CCV I;  5JLW A;  4BNC A;  3BDD A;  4KT6 A;  2HYF A;  2IGM A;  2F5D A;  2H1L A;  2JA7 J;  1MJB A;  3FHN A;  1SVL A;  2E19 A;  2L9N A;  2TRT A;  3HKZ N;  2RN7 A;  4KFC A;  1UHW A;  4HLY A;  2CRG A;  3GTO J;  3BG7 A;  1X19 A;  4M9S A;  1VQ9 I;  2MW8 A;  1Z21 A;  2FUG 2;  2IS6 A;  1VF9 A;  1TZL A;  3NQO A;  3S17 J;  2MLG A;  3FIS A;  4HQM A;  1B9M A;  2F4M B;  2XV4 S;  1N78 A;  4GYG A;  4P1W A;  3GUD A;  1IV8 A;  1KU7 A;  1L3L A;  5K5R A;  2A68 F;  2XAU A;  4BQN A;  1ZN2 A;  2XPW A;  1QU3 A;  3FK7 A;  2L5Q A;  4XLE A;  2D2W A;  1O3Q A;  2QEX I;  3H0D A;  4U87 A;  2ZJQ F;  3V8L A;  2LR8 A;  4EMS A;  1LUJ B;  4AU7 A;  5K7F A;  1IN5 A;  1F36 A;  1JUS A;  2QYO A;  3GTJ J;  2QWW A;  4BE2 A;  5DD8 A;  4XK4 A;  2XAJ A;  1R58 A;  2ECC A;  4XMY A;  4B47 A;  3OL4 A;  2XB5 A;  3KZY A;  2Y0S N;  1OYW A;  4QPO A;  1D5Y A;  2OBP A;  2IGO A;  4D5C A;  2FEZ A;  2PMZ A;  2DDA A;  4EV0 A;  2ZO4 A;  1VI0 A;  4UB6 C;  4G7O F;  1BI2 A;  1ON1 A;  2MSY A;  1LVA A;  5J8F A;  3CMY A;  4XN0 A;  1TW3 A;  2DU9 A;  2UXX A;  2UZK A;  2HOE A;  1QZE A;  2YS9 A;  5EG0 A;  1MNE A;  3RYP A;  1L0O C;  3HSF A;  4IKF A;  4AUX A;  1SD6 A;  1XGM A;  1LDD A;  3K4C A;  4TV7 A;  2EIJ H;  1LDJ A;  4ZZL A;  3N4M A;  2RC4 A;  3B6A A;  3VOE A;  2A5Y B;  1J7K A;  2VAS A;  3U2R A;  2AHQ A;  2Y31 A;  2DCE A;  2JZY A;  3QPS A;  2BHY A;  4IJA A;  5EG0 B;  2W85 A;  1DPR A;  1BW6 A;  3GLX A;  4PUS A;  2ME0 A;  3DF8 A;  4YIF A;  2GOX B;  2E71 A;  2FML A;  3TDU C;  2Y0M A;  1QPI A;  3MWM A;  4EM2 A;  4L9T A;  1Z7L A;  4LLG F;  1IUY A;  4U0V A;  1WCM J;  1U3E M;  1IC8 A;  2WB1 N;  5CVR A;  3S1R J;  3MN2 A;  1OCZ H;  1O3T A;  4P55 A;  3DTI A;  2K9M A;  4G94 A;  3DQV C;  5B1A H;  2R5Y B;  4IZZ A;  1MSF C;  1HW1 A;  4XR6 A;  3OR2 C;  2A6H F;  1SFK A;  3L2U A;  2VKE A;  4PJ0 C;  4ZYA A;  3JRA A;  5ILV A;  1I27 A;  3F21 A;  1TP4 A;  4BAC A;  1TQP A;  4F55 A;  3BTL A;  1YQA A;  3DEW A;  2HS5 A;  1MH3 A;  1F1Z A;  4EM0 B;  3GFM A;  5ICG A;  1FJL A;  4FET A;  5IT9 K;  2JMW A;  4A3B J;  1HW2 A;  2WV1 A;  4KIF A;  4C9Y A;  1WHU A;  2BY2 A;  2A5W A;  4ZDL A;  5LFA A;  4OIN F;  4WXD A;  2FQ3 A;  5EF6 A;  1X2M A;  2ZB9 A;  4N0B A;  2VKV A;  3C1D A;  4HST A;  2PEX A;  1VQ8 I;  4Y3O A;  2ZXJ A;  3O3K A;  4YRV A;  3AL0 B;  3U1D A;  3C3W A;  3S1N J;  2XGC A;  1GDT A;  1OYI A;  4BQQ A;  1S8N A;  3JRE A;  5IYC J;  4L5E A;  3SDG A;  5BQT A;  1FPQ A;  3I59 A;  2M2E A;  3CLQ A;  1QO0 D;  2X9D A;  2K3F A;  3ZR8 X;  1QBJ A;  1VQ4 I;  1BW5 A;  2DW4 A;  3ABU A;  3RDI A;  5HNH A;  1SAU A;  5IYB J;  4I0A A;  2N8G A;  1CF7 A;  1T0F C;  3S15 J;  1S3J A;  1YLF A;  1ZTR A;  3NWT A;  2DFE A;  3HHG A;  1GVD A;  2X1C A;  2PJR B;  3MKZ A;  1USS A;  1NG6 A;  2FJ1 A;  4WK8 F;  1WJ5 A;  1BJA A;  4H0E A;  2DOD A;  3LAJ A;  5LRS A;  4KYW A;  1OPC A;  1X3Z B;  4B1R A;  5HDK A;  2ME6 A;  3I4P A;  3I64 A;  4E6K G;  2FE3 A;  2WAQ N;  3CUO A;  4GDF A;  1KA8 A;  4A5M A;  1UZC A;  1BC8 C;  2O8X A;  3Q0V A;  3WTX C;  2NXN B;  3GVA A;  2E1N A;  2UXN A;  2JVH A;  1I1S A;  1EH7 A;  1DP7 P;  4RAF A;  1RNL A;  3BR6 A;  3IRR A;  2OPT A;  2BVM A;  3TO6 A;  1EF4 A;  3F0C A;  2DA6 A;  2H8W A;  1P6R A;  1T56 A;  3F6O A;  2LRE A;  2HQN A;  1YO5 C;  2ZXW H;  4BL0 B;  3ZP5 A;  3OYD A;  4KDP A;  2XKO A;  1V5E A;  2HKO A;  2KZG A;  5D5X B;  4XID A;  2EV6 A;  2FXA A;  3K4K A;  2XPU A;  1FSE A;  1XMK A;  3J81 Z;  3BWG A;  5LGU A;  1KGS A;  1R22 A;  3M8J A;  1RR7 A;  3K1M A;  2E2J J;  2XAQ A;  2Y69 H;  4IOC F;  1W1W E;  3B6C A;  2C6Y A;  1HQC A;  3H9Q A;  2IBD A;  2WY8 Q;  4K2E A;  3K9T A;  4NUB A;  2EFQ A;  4DIQ A;  2HXO A;  3PL8 A;  4BQO A;  2WV0 A;  2CV0 A;  2DT7 B;  1XCV A;  2VXD A;  2Y48 A;  3HTU A;  1X1P A;  5CJ9 A;  1MMN A;  4Y4R A;  3D1N I;  4OIO F;  3ZQQ A;  1AU7 A;  3HB9 A;  1B72 A;  1UAA A;  1HLV A;  1KYZ A;  3OYN A;  2JN6 A;  1IW7 F;  4NNJ A;  5KHD A;  4AVP A;  2M4K A;  5FLV A;  3ZPL A;  2H6C A;  1M1E B;  1Q1V A;  1GVJ A;  3IHU A;  3WGG A;  4HX7 A;  1NH3 A;  1U5T B;  5GTI C;  3AKZ A;  4LB6 B;  4FHT A;  3RKX A;  2CUJ A;  4RB3 C;  4ESJ A;  1D3Y A;  1SD7 A;  2ZME A;  5LRR A;  4B43 A;  3ZQC A;  1W7P D;  1BC7 C;  4PSX A;  1B72 B;  1ACI A;  4ZYE A;  1VND A;  2L4A A;  2LF7 A;  1WJC A;  4UHT A;  3PO3 J;  4ON0 A;  4IRH A;  2JPB A;  3F8B A;  2DOA A;  3PNV A;  5E3M A;  4G6Q A;  3I9V 2;  4DJA A;  1QZY A;  3ZGK A;  4CDG A;  2K9S A;  3EET A;  1S7A A;  1VQ5 I;  2K7L A;  2ZJ2 A;  4ZJZ A;  4IVN A;  2QBY A;  2R0Q C;  3J7Y J;  3DV8 A;  1TQM A;  4ESB A;  3G71 I;  5C3E J;  3JSP A;  2O5R A;  2LTP A;  2MBF A;  1R7J A;  3D5R C;  3I54 A;  5DTD A;  1IDY A;  2BE5 F;  3FXO A;  3WTT C;  1NK2 P;  2CGP A;  4XKC A;  2E36 A;  4BY7 J;  3MVP A;  2UWM A;  4AIJ A;  4ZYD A;  3HGG A;  3FZV A;  2EWN A;  3WTY C;  1LDK B;  4C3I J;  1QA6 A;  2A6T A;  3WTS C;  4MGR A;  2BW3 A;  2V4J C;  5M3M J;  4KIG A;  2XGD A;  2MD0 A;  3IP4 B;  2IW5 A;  1A35 A;  3H9J A;  1VQO I;  2DTZ A;  2W57 A;  3ROU A;  3DU5 A;  4XLA A;  2H1K A;  1ZK8 A;  5K7Z A;  3TDZ C;  3D5S C;  5D5U B;  2OQG A;  4IQ4 A;  4BAY A;  1REP C;  1BM9 A;  1EJ9 A;  4U88 A;  4M3D A;  3WU2 C;  5FFZ A;  2BW3 B;  3AL0 C;  2Y75 A;  4UVB A;  1I39 A;  3VYR B;  3PQJ A;  5D8K B;  5DM6 F;  3M1E A;  1F5T A;  4BY1 J;  2MGQ A;  2K9L A;  3ERM A;  3K70 D;  1Z6T A;  4NBQ A;  4JOM A;  4UUV A;  2AQF A;  4HYE A;  3BTC A;  5E1W A;  4EEF G;  3JSO A;  1MBG A;  1ZHF A;  2EZH A;  5ERI A;  5GAD J;  5DD4 A;  2CW7 A;  3VEP A;  4EAT A;  4B09 A;  4XLF A;  6PAX A;  2LY9 A;  1VQP I;  2VUM J;  1DGW Y;  3X2Q H;  1DPU A;  3RYR A;  3ZQG A;  4HQE A;  3TKY A;  1UST A;  1WZ2 A;  4MTD A;  2ZCW A;  1MH4 A;  4I6Z A;  1KQ8 A;  2IJL A;  2KRH A;  3GZ5 A;  3JAM K;  2R5Z A;  2IA1 A;  4E7S A;  2HYJ A;  5LLQ A;  3KET A;  4BEH A;  4LK0 F;  3S1M J;  1XMA A;  1DDN A;  4P5O A;  4RB0 A;  2CH0 A;  4RGS A;  4M3G A;  3HSE A;  2LG4 A;  1QZZ A;  2HTJ A;  2NVQ J;  1V54 H;  3OOP A;  2WWY A;  4GGG A;  5KAI C;  3ZMS A;  3A0H C;  4HA8 A;  2R5Z B;  3HDD A;  4L18 B;  1AOY A;  2YR2 A;  2MC4 A;  1U9O A;  3ZCO A;  1OR7 A;  3C2H A;  4BEH B;  2IS1 A;  3JRI A;  3KEY A;  3QOE A;  4G7H F;  3BLY A;  3QAH A;  3HBL A;  1IF1 A;  1MGT A;  3FBN B;  1WFX A;  2L7F P;  4M3E A;  2EFN A;  2V1X A;  1PUF A;  3BT9 A;  1Z9C A;  1UHM A;  1QPM A;  1IO2 A;  2JUG A;  2XAH A;  3PJR A;  4UNO A;  5DCF A;  3QU3 A;  2R4G A;  4F7Z A;  1HA8 A;  2PLY A;  1SFE A;  2QUF A;  3UNG C;  4BHP A;  3ZOB A;  1BOB A;  5IT3 A;  3L2R A;  1RUO A;  1IN4 A;  2O9L A;  1IAW A;  1PUF B;  1AA7 A;  1FC3 A;  3F3X A;  2A07 F;  1VQ6 I;  1POG A;  4C2T A;  4DNC A;  2R7V A;  2ETH A;  1B59 A;  4I98 B;  3MZ8 A;  2DA7 A;  2KIF A;  5BPI A;  2QEN A;  1YOV B;  4MTE A;  5K7H A;  2E1C A;  4A3G J;  1XG1 A;  2KJB A;  1VQ7 I;  2CJJ A;  5FJ8 J;  1DU0 A;  2OJE D;  1XGO A;  1LNW A;  3CCE I;  5FKL A;  5LHG A;  2HPI A;  3RPU A;  3JRH A;  1PJR A;  5DV5 A;  2X6W A;  2DTR A;  3GZN B;  2M0M A;  1N25 A;  3DPU A;  1U5T C;  3I4N J;  1WPK A;  3WGH A;  5EJC A;  1A6I A;  2PJP A;  1WJA A;  1B4A A;  2M4G A;  5FLX Z;  1A5J A;  3KPH A;  3OYE A;  2YPR A;  1P2F A;  5C4X J;  4IHS A;  3HZJ A;  3T8R A;  2D5V A;  2W25 A;  5EEH A;  3ZN0 A;  1OIS A;  5K1Y A;  3L9F A;  2P81 A;  3LQQ A;  2VLA A;  3JW4 A;  4IQJ A;  2M87 A;  1NHA A;  1XCB A;  3CES A;  2G9W A;  3NAR A;  3CCR I;  5CQE A;  2YSR A;  1W36 C;  2W84 A;  2ACJ A;  3FMR A;  2WY7 Q;  5FFX A;  1R4N B;  2IPQ X;  1WVR A;  4LIT A;  4R1H A;  2CUE A;  3QYF A;  1BIB A;  5E20 A;  3SJM A;  4LFU A;  1ZR2 A;  2LYC A;  2V79 A;  3HIF A;  1SAX A;  3KE2 A;  4WX9 A;  4A6E A;  2R7Q A;  2ZJR F;  1F9N A;  4HG2 A;  3H3Z A;  1T8I A;  2VBZ A;  1IUF A;  3PUF A;  2DA1 A;  4LMY A;  4IRI A;  3TP3 A;  3RPQ A;  1OCO H;  3CCJ I;  1I3A A;  3LSM A;  3BJO A;  4PJN A;  3GW2 A;  3WTU C;  1JKO C;  2QCO A;  1TWH J;  3MD2 A;  4BKX A;  3OYJ A;  2RAE A;  2HR3 A;  3ABK H;  2CMP A;  1BBY A;  4P9F A;  1AWC A;  4PFP A;  2HDC A;  2VQL A;  1K4T A;  3PIP F;  4MFD A;  2WAF A;  1GXQ A;  1C0W A;  1RKW A;  1ZKG A;  3G4S I;  3E6B A;  2HKX A;  3GME A;  2CWE A;  3CF2 A;  1RPW A;  1O57 A;  2M9H A;  3OIQ A;  2HEO A;  1W0T A;  2DMP A;  4YFK F;  5HLH A;  1FOK A;  1WH5 A;  3OS1 A;  4CYC A;  2JA5 J;  1SAN A;  2EBI A;  1ZYR F;  4XLH A;  2Y0S A;  1MDM A;  2OD5 A;  3J80 K;  4AM3 A;  1FIP A;  3HOX J;  2PMH A;  3QU6 A;  3TBI A;  2LKX A;  1X1C A;  4BE0 A;  2JA8 J;  4D1Q A;  3M3Y J;  3AAF A;  1TQI A;  3LNQ A;  3FM3 A;  5BPD A;  3FIW A;  4U0W A;  3RSN A;  1FSH A;  1D1A A;  3JTG A;  3DBH B;  4CYC B;  3Q3S A;  3EUH C;  4PGG A;  1MDM B;  3NEU A;  1IGN A;  4D5F A;  2OZ6 A;  3H36 A;  3OIP A;  3BQZ A;  3NRV A;  3M9A A;  3U9G A;  4E7H A;  2MG4 A;  3V8J A;  1I6H J;  4Q48 A;  5B5E C;  2V9P A;  1MMA A;  3CMM A;  5FD5 A;  3LSP A;  1XS9 A;  3KP2 A;  2P6T A;  2KIM A;  4IOA F;  2K5C A;  3G1M A;  5IP6 A;  3RZD J;  1ZH5 A;  3AG2 H;  1FBU A;  3ELK A;  3QYE A;  2X48 A;  1T0F A;  5FKM A;  1Z0X A;  3Q9V A;  1SC7 A;  1OR7 C;  4BJ5 C;  1QRY A;  2QLZ A;  4KIB A;  4J00 A;  3CUQ C;  3OSF A;  1XSX A;  4L9N A;  3BRO A;  2GXA A;  2WB1 A;  2K9N A;  3DPL C;  2X85 A;  2M5W A;  2JJ7 A;  2FRH A;  3HRT A;  5B3S H;  1YX5 A;  4G9Y A;  3K69 A;  1F4K A;  5GP9 A;  4M9Z A;  2VOP A;  3PQK A;  2CV1 A;  1B9N A;  2FOW A;  3REO A;  3V7S A;  1ZRD A;  3HC7 A;  4XSX F;  2DMQ A;  1I6X A;  3S14 J;  3WG9 A;  1P9Q C;  1XGS A;  2GAU A;  3S2D J;  4I7H A;  3GFI A;  3K4M A;  4PJJ A;  4D0P A;  2Y2Z A;  3CC4 I;  4A0Z A;  4JX6 A;  3DTE A;  2GIV A;  3NAU A;  2M34 A;  3PSF A;  5F0H A;  3TW7 A;  5FD6 A;  1FMV A;  2ZFW A;  2J5P A;  2RRE A;  3ULQ B;  4B4C A;  3R61 A;  2JUC A;  3FXQ A;  1V5G A;  5IY5 H;  4CZZ A;  1I3Q J;  5ILS A;  2K40 A;  3BZC A;  1VQK I;  2DFI A;  2ESH A;  3LOC A;  5B1B H;  1G59 A;  2X4H A;  3CCY A;  3CP2 A;  4MQV A;  3A2K A;  1R36 A;  2EIM H;  4OAZ A;  3L7W A;  2LP0 A;  2ZXI A;  3I71 A;  3W2V A;  1UB9 A;  3FK6 A;  1MW7 A;  3H5A A;  2Q1Z B;  3M8E A;  3CDL A;  2NRA C;  1R1U A;  2JT1 A;  2GA1 A;  1UG0 A;  1Y1W J;  4WWC A;  3OS2 A;  4JX5 A;  4KIS A;  2QGU A;  3ONQ A;  2OCE A;  2OUM A;  5LGT A;  5DUI A;  1H9G A;  1LKX A;  2M1B A;  5E18 F;  2COM A;  1JE8 A;  3T8T A;  4KMF A;  2GZW A;  2AS5 F;  1V5F A;  3J7A O;  4RM3 A;  3D0S A;  3PO2 J;  4GFB A;  1FX7 A;  4OU0 A;  4F52 A;  2XVC A;  3R6S A;  4XKB A;  1QVU A;  4UVA A;  5FB2 A;  1FP2 A;  3QP6 A;  2HVQ A;  4DBR A;  2CG4 A;  1ZEL A;  2Q2E A;  5F0C A;  1HF0 A;  3SXY A;  4XQF A;  4S05 A;  3S3O A;  3BJA A;  3ECH A;  5IOY A;  2DPD A;  3Q5F A;  2DT6 A;  3GTP J;  2L4M A;  5HDG A;  3K7A J;  3LFK A;  1IRG A;  1Z05 A;  2V9V A;  4WXC A;  3Q9S A;  1HCR A;  1OYY A;  4P96 A;  3FDY A;  2HPM A;  5HLI A;  4EJT A;  1YJ9 I;  2RDP A;  3OS0 A;  2Q2E B;  1S29 A;  4Y33 A;  2VOO A;  2BVL A;  2V7F A;  4PJM A;  1KU3 A;  2XAF A;  1Y0U A;  2PG4 A;  1E3P A;  1EH8 A;  1MJA A;  2R5Y A;  1XSV A;  1B6A A;  3S32 A;  4GCV A;  4JYK A;  1JXS A;  4E4H A;  1BJZ A;  2ISY A;  2Z33 A;  2HQ5 A;  3Q0W A;  4IHY A;  4A5N A;  5HS7 A;  2NNY A;  1Z91 A;  3BR0 A;  3LFU A;  1SVO A;  3S16 J;  1YTY A;  5LGN A;  3HGY A;  4F91 B;  1YG2 A;  2DA2 A;  2VOD A;  2CQK A;  2I5U A;  2DFF A;  4MFE A;  1R1T A;  4B44 A;  1QHH D;  1J09 A;  1XDU A;  2D1V A;  4L0Z B;  1UEL B;  2KIQ A;  5GAH J;  2QQA A;  3FKI J;  4M3B A;  1RC9 A;  1B8I A;  2KJC A;  2DK8 A;  4A3L J;  4PFO A;  4EJO A;  2JRT A;  2MA3 A;  1R5I D;  1W5T A;  1JI8 A;  3BG5 A;  3H1C A;  2Z3Y A;  1XDS A;  3ZN1 A;  3LQR A;  4D9J A;  1JKP C;  3A01 B;  1Z6R A;  3W3C A;  1J59 A;  4M6X A;  1T08 B;  2V1N A;  3IAS 2;  4A3F J;  1O4X A;  4Z2Y A;  2R7D A;  2BV6 A;  3JRC A;  1B8I B;  3F8C A;  1R23 A;  4OMZ A;  2EH3 A;  1BI1 A;  2CV2 A;  4L5J A;  4CYD A;  4A2U A;  1T98 A;  2XC7 A;  3BG3 A;  4EVI A;  2VKH A;  3HOS A;  1MBE A;  4RB1 A;  4XRS G;  2VN2 A;  2O3F A;  5D5V B;  2A05 A;  1V4R A;  3DCF A;  2PJR A;  2WA0 A;  1RET A;  4JQF A;  2HOS A;  4JK1 X;  4NC8 A;  3SFI A;  1SVM A;  1UG2 A;  3QPL A;  4IHT A;  2COB A;  2X6X A;  1FYM A;  2KT0 A;  1D5V A;  2E7X A;  3P7N A;  3PNT A;  2DA4 A;  2EJR A;  5ICE A;  3OSG A;  3KYD B;  3DU6 A;  5D4S A;  1MBH A;  4QLC U;  4BDY A;  3HSR A;  2QSG X;  1I1G A;  4PSW A;  1ZQ3 P;  3MKY B;  5IT9 Z;  4CCM A;  4FAS D;  2W7N A;  1K79 A;  3VPR A;  3S3M A;  1HDP A;  3I5U A;  1K61 A;  2K4B A;  2E1O A;  2KDO A;  3WU1 B;  4HW0 A;  2YU3 A;  4M72 A;  5D4R A;  4A3M J;  4BHC A;  2P7V B;  3FXM A;  4ENN A;  4HNT A;  2K02 A;  1V55 H;  3G73 A;  4FX4 A;  4RAG A;  2AXL A;  1E2X A;  4AYB A;  1MD0 A;  1SFX A;  2VJ4 A;  2W24 A;  3OL3 A;  4EGY A;  1UCR A;  1TT0 A;  3M7G A;  4V2F A;  3RQ4 A;  3W6K B;  5GPA A;  1JJ8 C;  2Z9O A;  1K6Y A;  5H6R A;  4LIU A;  1LPQ A;  2NS0 A;  3J81 K;  3C2G A;  1ZG1 A;  1E0E A;  1ETW A;  2NS8 A;  4CIC A;  4YIR X;  4OIP F;  2IP2 A;  3BZ6 A;  2GQQ A;  3AG4 H;  5E8I A;  2ZXH A;  2HVR A;  1YW8 A;  4E7L A;  5EYR A;  2MLK A;  2M8E A;  1OCP A;  4N9I A;  3CJQ B;  1SMT A;  1TWF J;  2W00 A;  2O7O A;  1G3W A;  2VT2 A;  2R7R A;  4XM3 A;  2ZNZ A;  2VIX A;  4JP0 A;  5CVI A;  3GEZ A;  2NOJ B;  2ZFU A;  3P9C A;  3SQN A;  4N9H A;  1S7E A;  3HOZ J;  3K6G A;  4L9J A;  4GXO A;  3GCM A;  3JCU C;  1S7O A;  1DGR M;  4C3H J;  1BL0 A;  2L01 A;  1Y1V J;  3ABM H;  2DI3 A;  1FYK A;  1AHD P;  1YIT I;  1W4M A;  4I02 A;  5L3F A;  4BBR J;  3KCC A;  2DMN A;  1U5T A;  4Y17 A;  4EGZ A;  4EJV A;  1X1A A;  2OTJ I;  1T39 A;  2E2I J;  1R4M B;  1HST A;  4L5I A;  4HNV A;  1SFO J;  1LQ1 A;  3QYB A;  1DQU A;  1ETQ A;  3RCO A;  1H88 C;  5IP7 J;  3H92 A;  1YIJ I;  3BOQ A;  3WGI A;  1U8R A;  4WXH A;  3PFY A;  5TJJ A;  2XRL A;  2KDZ A;  5TGT A;  1KYW A;  4XNF A;  5KCM A;  2WC2 A;  2XAS A;  4JBA A;  2CYY A;  1R5H A;  1IRF A;  1U6G A;  1YHQ I;  5M5Y J;  2FNA A;  3CP8 A;  1ULY A;  3LSG A;  5LBQ A;  2DFH A;  4FE4 A;  5DUK A;  5KVR A;  1IG7 A;  5D8L B;  3K4B A;  4DGW B;  2EFW A;  5J1U A;  3EYI A;  1S6L A;  1XX5 A;  3F23 A;  4CCN A;  1APL C;  2DJI A;  1TNT A;  3MZY A;  5E17 F;  2LC2 A;  1YYV A;  3TQN A;  2HI3 A;  3TOB A;  2R7Z J;  2JA6 J;  3HPH A;  1D0X A;  3GXO A;  3JR9 A;  1ETX A;  3MCZ A;  4KN7 X;  4XOR A;  1WH7 A;  3RKY A;  3BG6 A;  1O7F A;  3DPT A;  1FTZ A;  5BMZ A;  2FSW A;  3M1C A;  1BN5 A;  4KT5 C;  1MBK A;  4G8X A;  1ETO A;  4A0Y A;  1FLI A;  1ETV A;  2KIS A;  4FQG A;  1Z7U A;  3QQA A;  1W7P B;  1WJF A;  4QPQ A;  1E3H A;  4UVC A;  1GUU A;  4F93 B;  5E8G A;  3HRS A;  1Z3Y A;  2R7S A;  2IXS A;  3RQI A;  3R0A A;  1JT6 A;  3FXJ A;  2HXI A;  2P6S A;  3TP0 A;  2YUS A;  1IN7 A;  2XSJ C;  4BDZ A;  2AXT C;  4II3 A;  3WU0 A;  5IPA A;  3CME I;  3E6M A;  1FP1 D;  2CUZ A;  2BZT A;  2XHK A;  2H8R A;  2HDD A;  3HJE A;  2BHZ A;  4HNU A;  2EV5 A;  2HDW A;  2OU2 A;  1ERD A;  2XKP A;  3M07 A;  4NC6 A;  4BH9 A;  1PYV A;  2DA5 A;  4LOC A;  2KMU A;  4A3C J;  1EV7 A;  1HW5 A;  2O03 A;  3WG7 H;  4B3A A;  4DQ2 A;  2IEK A;  1D1C A;  4BS9 A;  1W5C C;  3EUH A;  5TIS C;  3F8N A;  4NHJ A;  1S5L C;  4RLF A;  2LVS A;  4QWQ A;  2DO7 A;  1LE8 A;  3I56 I;  3H0G J;  2QQ9 A;  1TLH B;  2G0E A;  3FM5 A;  3GTK J;  5LEJ A;  1A6Q A;  5CVJ A;  2IGK A;  3GLL A;  4N4N B;  1K78 A;  4BXX J;  1GV5 A;  4M73 A;  2OQR A;  3ZQL A;  1H8A C;  2LY1 A;  1UMQ A;  3VFZ A;  5JHU A;  1P7J A;  3FX3 A;  4I09 A;  1FY7 A;  4MHG A;  4HX4 A;  2JPC A;  1PVE A;  4CHU A;  3PNY A;  1YS6 A;  3E5X A;  4ENJ A;  3RTR A;  3BCB A;  1FYL A;  3E3V A;  1LE8 B;  3C7J A;  5DCM B;  4ITV A;  1E3O C;  2OZU A;  2LBF A;  1Q1H A;  1N77 A;  3KEQ A;  1WGX A;  1ZG3 A;  4DZJ A;  1K78 B;  1ETK A;  5E1X A;  3ZQF A;  3S8P A;  3N05 A;  4GRI A;  1QNT A;  4PGH A;  5HOD A;  3CUQ A;  5DM7 F;  3RKQ A;  3IKT A;  5AIQ A;  3OYG A;  3DKY A;  1OKR A;  2LK2 A;  2VPL A;  3KEO A;  1OQY A;  1U78 A;  1K6O A;  3OWT A;  1RR8 C;  4IRG A;  4EM1 A;  2ZNY A;  2LBF B;  2M0C A;  5B66 C;  2XB0 X;  1B1B A;  2H09 A;  3M8F A;  4PK4 A;  3DFG A;  2EFO A;  5HOO A;  1T38 A;  3JAM Z;  3PSI A;  3DLL F;  3CUQ B;  4H4K C;  4MEX F;  3LSI A;  2OCC H;  4MLO A;  2OTL I;  2EA2 A;  2MH9 A;  2E1M C;  4IL6 C;  5C44 J;  3W2W A;  2D1H A;  3VB2 A;  1VZ0 A;  1TWA J;  1MND A;  1OMI A;  3FF5 A;  2RKH A;  2NNN A;  3D5L A;  3H5R A;  1VQL I;  2EK5 A;  3CZ6 A;  4A93 J;  2R7X A;  2ECB A;  2Z16 A;  3O8G A;  1J5Y A;  2DXI A;  4HPQ A;  1IXR C;  2KQR A;  2RV8 A;  3LA2 A;  3Q0U A;  3QOD A;  4MNU A;  3H5N A;  3WOD F;  2CSO A;  3IC7 A;  2O6G E;  3DBL B;  4CCL A;  3CC7 I;  1BA5 A;  1MKM A;  2PQ8 A;  4UUS A;  3QRF F;  3K1P A;  2QQ8 A;  5FKO A;  3U1K A;  1BI0 A;  1XMX A;  2VBW A;  5FLX K;  3L2C A;  2PFB A;  2Q8K A;  4KIT B;  3ZRG A;  3OIO A;  4N4O B;  2ELK A;  3QPH A;  3A0B C;  2VQG A;  4ZDO A;  2KL4 A;  1XB4 A;  5EGO A;  1IV6 A;  1NG7 A;  1N75 A;  3RPU D;  2Y30 A;  2P8T A;  1OFC X;  5A2Q K;  2DJN A;  3AG3 H;  4UUS B;  3RIR A;  2Q0O A;  3E5Q A;  5F27 A;  3A03 A;  3WE3 A;  1YW7 A;  1TC3 C;  2PI0 A;  4CGZ A;  2CU7 A;  5CPR B;  1QGP A;  4NC7 A;  4A0X A;  5EGO B;  1XC5 A;  1ITY A;  5F08 A;  1R1V A;  2NYX A;  3HXL A;  1RUN A;  1FMW A;  4BJ6 C;  2GXG A;  5KNL A;  2QQB A;  3ZMV A;  2JRM A;  2RNG A;  5IOZ A;  5GPC A;  3IH4 A;  1ZR4 A;  2IA2 A;  3ISP A;  2M7A A;  3UR3 C;  4BXU A;  3HKZ A;  3CJT B;  4YEL A;  2DLL A;  1X1D A;  4AVZ A;  5J6X A;  3W6V A;  3KIO A;  2A61 A;  3UKG A;  1X4O A;  2CQQ A;  1JUP A;  3COA C;  2KP6 A;  5FRO A;  1LEB A;  1PDN C;  3F72 A;  3SZG A;  3FXR A;  2YX7 A;  3L1P A;  1IN6 A;  2AQE A;  3KLO A;  1ODD A;  3PM1 A;  4YFN F;  1TW2 A;  2H94 A;  2F5V A;  3GFJ A;  4LG0 B;  4F3Q A;  1S9H A;  1WJD A;  3CDH A;  1JUM A;  2X6Y A;  2K3P A;  5D5W B;  4FX0 A;  3OMY A;  2X0L A;  1R00 A;  3OYA A;  2EV0 A;  4HRI A;  1RKT A;  4IX7 A;  1RI7 A;  2LDU A;  1X58 A;  2NAZ A;  1G4D A;  1KU9 A;  3VOD A;  3DKW A;  5JVT A;  4IPA A;  3CJN A;  2HFH A;  3G1O A;  2HNH A;  4XL9 A;  1JHH A;  2BOL A;  1X2N A;  2K4J A;  1FOW A;  2ZBK A;  4RA2 A;  2JK3 A;  2VBX A;  4CH7 A;  3HOT A;  1YX3 A;  3O2P E;  3G3Z A;  5J4V A;  5ILU A;  3LL7 A;  2DT5 A;  3LSR A;  3F6V A;  3L2Q A;  2GLO A;  2XAG A;  1G3S A;  2OA4 A;  2RGV A;  2XF6 A;  4LIV A;  2O61 A;  2FOK A;  3ZQH A;  3CCS I;  2RNJ A;  1WJB A;  2ELH A;  3K70 C;  2NVU B;  3F22 A;  1J9I A;  2IS2 A;  1WKM A;  2VQH A;  2WAE A;  1MBJ A;  4O3M A;  1FNN A;  2ADU A;  1Y8Q B;  4DOZ A;  4PDK A;  3F9K A;  1P4X A;  3E97 A;  1SFU A;  1NK3 P;  3BTI A;  2ZC2 A;  5EZH A;  1YW9 A;  1I5Z A;  1QQI A;  2L3D A;  3BG9 A;  4NQW B;  4DBQ A;  3FXK A;  4Y15 A;  3BQY A;  1MSE C;  4KA4 A;  3J80 Z;  2OC6 A;  4RAY A;  3KP7 A;  1KON A;  3I53 A;  3FKJ A;  4JX4 A;  2DYR H;  5BS6 A;  4YEJ A;  1HOM A;  2XDV A;  4YG2 F;  3I55 I;  1SMY F;  2EZL A;  4IF4 A;  4OOI A;  3B02 A;  5JVG F;  5JI6 A;  2LF8 A;  1WI9 A;  2CUF A;  3TGN A;  3HHH A;  3I4M J;  4XON A;  2H6B A;  4F92 B;  3OYF A;  2X6O A;  1Y39 A;  2L2O A;  3E0J B;  1OCR H;  3VDX A;  4EJW A;  1WSU A;  1BR1 A;  4LJZ F;  3V7C A;  4HZF A;  5CVV A;  1BR4 A;  4CCJ A;  3TO9 A;  3GTQ J;  1JHF A;  2RQQ A;  3HM5 A;  1Z3X A;  3LSK A;  4XLC A;  1FTT A;  1UJ8 A;  3S2H J;  4M74 A;  3JTH A;  2ZSI B;  1H9T A;  3DWL E;  3BJ6 A;  1YIO A;  1ZLK A;  5H6Q A;  1T95 A;  2NS7 A;  2LLK A;  1DU6 A;  4ZZD A;  4HDV A;  1I50 J;  1VFC A;  3OYI A;  5LHH A;  4LB5 A;  2RVC A;  2VQC A;  2STW A;  1AKH A;  2JA2 A;  4L0Y B;  1ZAO A;  2EQR A;  3DKX A;  3K2A A;  3MFK A;  3HOY J;  2Y9Y A;  1PUE E;  2DPU A;  2HOT A;  3BR5 A;  4ESF A;  1IJW C;  1D8J A;  4DZP A;  3HOU J;  2CS3 A;  1ZRF A;  2O0Y A;  1MNM C;  1MMD A;  2LRD A;  4KJZ A;  2LSO A;  1BR2 A;  1U8B A;  3WHB A;  2CQN A;  3ABT A;  3J7Z I;  4IEJ A;  4FIS A;  4NDL A;  1QVT A;  3EUA A;  5HLG A;  4XKW A;  5GTH C;  5FLM J;  1AKH B;  5L3G A;  3OV8 A;  3IL2 A;  1TWG J;  4P9U A;  3E7L A;  3GYH X;  3T0Y A;  3ERE D;  4HX8 A;  1TNS A;  2FBH A;  2L7K A;  1XSD A;  3P5J A;  4CA0 A;  3CF5 F;  4Z6Y A;  3KYL A;  1Z67 A;  3BR1 A;  2B63 J;  1RES A;  4X1E A;  3FXU A;  5EEG A;  4RGX A;  5ICC A;  3MZH A;  2F2E A;  2QA4 I;  3GTM J;  3B73 A;  3S2W A;  1EH6 A;  1HDD C;  3FBI B;  2Z2S B;  4Q4Z F;  1GLN A;  4NB5 A;  4FT8 A;  2DN0 A;  4XOT A;  1ZGW A;  1J0R A;  1ETY A;  2HZD A;  2BY3 A;  5FRN A;  2VC0 A;  5J8C A;  3HYI A;  3ABL H;  4A6D A;  3I3L A;  3IWF A;  2UUZ A;  2BGC A;  3L00 A;  1KZH A;  2WAQ A;  4UB8 C;  3IV5 A;  3GZ6 A;  2FA5 A;  2L9V A;  1FZP B;  1ENH A;  2PX9 A;  2XGX A;  4DYC A;  3QP5 A;  1LVK A;  2XRN A;  2EZK A;  3BP8 A;  4MO7 A;  3OYK A;  3K2Z A;  4BBS J;  3KLN A;  4M6V A;  2IS4 A;  4R79 A;  2IT0 A;  1XD7 A;  2CO5 A;  3DEE A;  3VYU B;  4XSZ F;  4AD9 A;  2ID3 A;  3A02 A;  1T6S A;  1YJW I;  3TO7 A;  2AO9 A;  1IXS B;  2ZKZ A;  5CYV A;  2X51 A;  3CO6 C;  1A31 A;  4RAZ A;  3W6J B;  4V2G A;  3OYH A;  1VTN C;  2B0L A;  4PZJ A;  1G3T A;  1TBX A;  1XN7 A;  2K9Q A;  4Y7N J;  5J1R A;  1U9N A;  3ZMZ A;  4XRM A;  2ELJ A;  1R9T J;  4YII A;  5DDG A;  5J1Y A;  2W82 A;  2VL8 A;  2HGC A;  2V9K A;  3N97 A;  4PCQ A;  1YE9 A;  3R0J A;  3A01 A;  3IRQ A;  3C18 A;  1HBX G;  3OYL A;  1WQ2 A;  2GWR A;  1LJ9 A;  4OIR F;  5F04 A;  3GFL A;  4UV8 A;  3KP6 A;  5F0F A;  3H9G A;  4OAY A;  2BY0 A;  5ED4 A;  2FBK A;  3RKW A;  3G6E I;  1OCT C;  4CSW A;  1D0Y A;  3WE2 A;  3ZMU A;  2QKL B;  3EQL F;  4ZYH A;  2BYV E;  3IAM 2;  2V1D A;  1FIA A;  2M45 A;  1TT5 B;  3MEX A;  3P9I A;  2Y9Z A;  2E60 A;  3CC2 I;  4HV6 A;  4Y52 J;  2L02 A;  4E7I A;  2FU4 A;  1JGS A;  2FMY A;  1JT0 A;  3U21 A;  1X3U A;  2CFX A;  4GO1 A;  5BNG A;  2VBY A;  2GIZ A;  4HSR A;  2P7C B;  4A3K J;  1ZGA A;  3OYM A;  4RDU A;  2KIU A;  4RLQ A;  4S0H B;  3NWS A;  2PBI A;  4RGR A;  2VJ5 A;  4I76 A;  3VYS B;  1O3R A;  3SYT A;  4KNY A;  3ZMD A;  4C3J J;  4XRS A;  2DA3 A;  5K5Q A;  2LNB A;  3FXL A;  2IA0 A;  3K10 A;  4MQ9 F;  4A69 C;  2MFZ A;  4OMY A;  1P4W A;  2EFP A;  1R5G A;  2HTS A;  4XLP F;  5H20 A;  2BBY A;  2LKS A;  2L9S A;  3OR1 C;  2LFB A;  4LD5 A;  3FHZ A;  3KZZ A;  4XKV A;  1J2X A;  3S1Q J;  2R3S A;  2XPV A;  2LD5 A;  2TCT A;  5ICF A;  2QSF X;  3S3N A;  3SHF A;  4BE1 A;  3KZI C;  4X6A J;  1JKR C;  2HOA A;  2A3S A;  1EA3 A;  3LST A;  2F5F A;  1ZG5 A;  2FD5 A;  2PMZ N;  5KAF C;  4W97 A;  4LLL A;  4RS8 A;  2KRC A;  2W1O A;  3A1Y A;  3BPV A;  2B7E A;  3CTA A;  4G12 A;  3V4G A;  4CCO A;  3I59 B;  4UV9 A;  2E35 A;  1XGN A;  1W0U A;  1TWC J;  4BHB A;  1BIA A;  2MD5 A;  2BXZ A;  1W5S A;  3R60 A;  1RZ4 A;  4ZH4 F;  5E3N A;  1IZ1 A;  1VQN I;  5IYD J;  5M3F J;  1CF7 B;  4MEY F;  1LFB A;  4XRF A;  2NOG A;  3HPG A;  3BC8 A;  4AIK A;  3OY9 A;  4Q5S F;  3TOA A;  2VB6 A;  4QTR A;  2DYS H;  1JJ6 C;  2E5N A;  2CQX A;  2WBM A;  3ZQI A;  3DP7 A;  4G6T B;  5L3B A;  3F8F A;  4O5V A;  2ESN A;  2L7Z A;  4R8H A;  4FCY A;  4EJU A;  3HUG A;  4LG3 A;  3KYC B;  5GAG J;  3CQZ J;  3DLA A;  2E1M B;  3LWF A;  5L3E A;  4ZTF A;  1P7I A;  1Y6I A;  3IUO A;  1WWX A;  4B48 A;  2TDX A;  2I10 A;  4A12 A;  2GOM A;  4GYI A;  9ANT A;  2MYS A;  3P9K A;  4HEA 2;  5FGM A;  1OCC H;  2VPR A;  5H2F C;  5HVQ C;  1EKE A;  1JTY A;  4C2U A;  3IH2 A;  2L0K A;  2HWV A;  5DEQ A;  2A6E F;  3HUG B;  1Y0N A;  3ZQ7 A;  1R49 A;  1JGG A;  3SZT A;  3VYT B;  2LH9 A;  1PP7 U;  1K83 J;  4ZC3 A;  2DQR A;  4WCG A;  3OYC A;  2HQA A;  3HL2 A;  4RMN A;  4BYY A;  1UHS A;  4M3F A;  2FNP A;  3DBR B;  3CCL I;  5JR3 A;  2VT3 A;  1G3Y A;  2F4I A;  2VJI A;  3BY6 A;  4LK1 F;  2PMU A;  2KPM A;  4ZTJ A;  4FE7 A;  4C2M J;  1ZAR A;  2ISZ A;  3HOV J;  1PP8 F;  1W36 D;  5CLS A;  4RGU A;  5FKK A;  4RB2 C;  3ASN H;  3J7A Y;  1WJE A;  5D6F A;  4IHV A;  3K4J A;  3SDB A;  2VE8 A;  4DYR A;  2YX4 A;  1NTC A;  5LEK A;  4IHW A;  3K1N A;  3H35 A;  4V19 K;  1IN8 A;  5BOX A;  3LA7 A;  2QKM B;  2JSC A;  3QWL A;  1W7P A;  4HDU A;  3CCQ I;  2DQL A;  4HF1 A;  2ZSH B;  2IRF G;  4U0Y A;  2OAZ A;  3VSK A;  5E3O A;  1U0J A;  2KHM A;  2QM3 A;  3KX2 A;  4I01 A;  2L7M P;  3EUK L;  4B3X A;  2G7H A;  2B9S A;  2EZI A;  2JWT A;  2OF7 A;  4HBL A;  2M3A A;  2X1E A;  4UXN A;  1IRX A;  1MZB A;  1JTX A;  2ZME B;  2W4S A;  3MAJ A;  1OJL A;  1VQM I;  2W48 A;  3JRF A;  1HXD A;  5L3D A;  2DMU A;  2KLO A;  1MBF A;  4M71 A;  3TL4 X;  3CJR B;  1X3W B;  3DXJ F;  4I0B A;  5FRM A;  4IHX A;  3JRD A;  3BZK A;  2V26 A;  2A69 F;  3H3U A;  4AYB N;  2QBY B;  5DS9 A;  5J40 A;  2H27 A;  2BXY A;  5LHI A;  1FEX A;  4LGW A;  1R6R A;  4D7M A;  2QF7 A;  1D8K A;  3LSH A;  4BU2 A;  2GA2 A;  2K86 A;  1FWZ A;  1GT0 C;  2PN6 A;  1D0Z A;  4D7N A;  3EPZ A;  2UV1 A;  4XN3 A;  4ZYG A;  4X0G A;  1V3F A;  2QVO A;  2R7O A;  4EQQ A;  4A3J J;  2DOF A;  2XUB A;  2OV7 A;  3HEF A;  2GM4 A;  1DP3 A;  3ECO A;  1G6N A;  2P0W A;  3G1L A;  5DCM A;  1TL8 A;  1MMS A;  2VON A;  4E7K A;  2BEO A;  3FMQ A;  3F8M A;  2XRO A;  1BOA A;  2L9R A;  2VE9 A;  1XPX A;  1F43 A;  3I0T A;  5EDN A;  5L3C A;  1E17 A;  2P5K A;  4I99 C;  1ORK A;  3RI4 A;  3TMO A;  2MH2 A;  2FQ4 A;  2V6C A;  3ASO H;  3OOU A;  1TTY A;  4CO8 A;  3R4K A;  4E70 A;  3QPT A;  4CXF A;  2DOE A;  3M4O J;  5J3L A;  1A04 A;  4KN4 X;  3CLO A;  4IO9 F;  2QSH X;  5FO5 A;  4AC0 A;  1Y8R B;  1WI3 A;  3LSJ A;  1GXP A;  1WRJ A;  4A3E J; 
#chains in the Genus database with same CATH homology
 3G1O A;  1CQT A;  1X2N A;  4ABZ A;  3JRB A;  1HCR A;  4XID A;  2JK3 A;  2XPU A;  4MIM A;  2O8K A;  1G2H A;  3LSR A;  2GLO A;  3JRG A;  1RR7 A;  2E2J J;  3B6C A;  2IBD A;  3ZQH A;  2ID6 A;  2R5Y A;  3BR2 A;  4JYK A;  5E3L A;  1BJZ A;  2HXO A;  2HQ5 A;  3Q0W A;  4IHY A;  2IAI A;  1MBJ A;  4A3D J;  3BR0 A;  3S16 J;  5EEA A;  3HGY A;  1NK3 P;  2DA2 A;  3BTI A;  3H3V K;  3TED A;  5EZH A;  3D1N I;  4MFE A;  3BG9 A;  1AU7 A;  3HB9 A;  1B72 A;  3BQY A;  1MSE C;  1HLV A;  2JN6 A;  2E2H J;  3FKI J;  4JX4 A;  4M3B A;  1B8I A;  5FLV A;  1Q1V A;  1HOM A;  4A3L J;  2EZL A;  2CUF A;  3BG5 A;  3I4M J;  3ZQC A;  1JKP C;  5C4J J;  3A01 B;  1B72 B;  2X6O A;  2VI6 A;  1VND A;  4A3F J;  3PO3 J;  2FX0 A;  1O4X A;  5E3M A;  3JRC A;  1B8I B;  3GTQ J;  2EH3 A;  2K9S A;  3HM5 A;  2XGE A;  3BG3 A;  2R0Q C;  1MBE A;  3C2B A;  1FTT A;  5C3E J;  3S2H J;  2LTP A;  5DTD A;  4XRS G;  5F1J A;  1IDY A;  1NK2 P;  2R92 J;  4BY7 J;  3MVP A;  2NS7 A;  3DCF A;  2LLK A;  3HGG A;  1DU6 A;  1RET A;  2HOS A;  1I50 J;  3SFI A;  1VFC A;  1UG2 A;  4C3I J;  3QPL A;  2COB A;  1Z77 A;  2KT0 A;  1AKH A;  5M3M J;  2M8G X;  3GBG A;  2EQR A;  3K2A A;  2NVX J;  3HOY J;  2XGD A;  2Y9Y A;  2DA4 A;  3OSG A;  2HOT A;  3BR5 A;  1GV2 A;  1MBH A;  5EZG A;  1IJW C;  4QSH A;  4DZP A;  3HOU J;  1ZQ3 P;  2DTZ A;  2H1K A;  1MNM C;  4J19 A;  1ZK8 A;  3VPR A;  1U8B A;  5K7Z A;  1HDP A;  1K61 A;  3WHB A;  2E1O A;  4IEJ A;  4A3M J;  4FIS A;  4NDL A;  1QVT A;  4M3D A;  5FLM J;  1AKH B;  3BR3 A;  1TWG J;  4BY1 J;  2MGQ A;  3E7L A;  3BTC A;  4EEF G;  1MBG A;  4A3I J;  2EZH A;  3BR1 A;  4V2F A;  1IDZ A;  2B63 J;  1RES A;  4X1E A;  5GPA A;  1JJ8 C;  2NVT J;  1T33 A;  4QIW N;  3GTM J;  2LY9 A;  2VUM J;  2R93 J;  1HDD C;  3ZQG A;  1ETW A;  2DN0 A;  2NS8 A;  1ZGW A;  1ETY A;  1MH4 A;  4I6Z A;  2R5Z A;  2HYJ A;  4XIC A;  5EYR A;  3S1M J;  1OCP A;  3IV5 A;  1TWF J;  5IP9 J;  1ENH A;  2O7O A;  4DYC A;  4M3G A;  2EZK A;  4MO7 A;  2NVQ J;  4JP0 A;  4BBS J;  4M6V A;  3BTJ A;  2ID3 A;  1YRN A;  3A02 A;  1S7E A;  2AO9 A;  3HOZ J;  3O8H A;  3HDD A;  2R5Z B;  1IRZ A;  1U9O A;  1BL0 A;  4C3H J;  3JRI A;  5M5W J;  1Y1V J;  1JKQ C;  4RBO A;  4V2G A;  4DYQ A;  2K9Q A;  5JLX A;  4Y7N J;  1AHD P;  5J1R A;  4UUT A;  3RZO J;  4W1U A;  1U9N A;  4XRM A;  3WHC A;  4BBR J;  1R9T J;  3HBL A;  1YRN B;  2DMN A;  2L7F P;  4M3E A;  5J1Y A;  2E2I J;  1PUF A;  4HNV A;  2NVY J;  3BT9 A;  1SFO J;  3A01 A;  1ETQ A;  1H89 C;  1H88 C;  5IP7 J;  3GTL J;  3ZOB A;  2GBY A;  2YU9 J;  2XRL A;  2KDZ A;  2XSD C;  5F04 A;  5F0F A;  1OCT C;  2O9L A;  1PUF B;  3TW6 A;  5M5Y J;  1POG A;  3LSG A;  5FKN A;  3MKL A;  4FE4 A;  5M5X J;  1IG7 A;  2DA7 A;  3GTG J;  1FIA A;  4FTH A;  5J1U A;  5K7H A;  2DMT A;  4A3G J;  4DW6 A;  1XG1 A;  2Y9Z A;  1APL C;  4Y52 J;  2CJJ A;  1JT0 A;  5FJ8 J;  1DU0 A;  5BNG A;  3IH3 A;  4A3K J;  2HI3 A;  1LFU P;  2R7Z J;  5FKL A;  2JA6 J;  4RDU A;  3JR9 A;  1ETX A;  3JRH A;  4S0H B;  3HOW J;  1WH7 A;  4I76 A;  5JLW A;  3I4N J;  1WPK A;  1FTZ A;  1A6I A;  4C3J J;  2JA7 J;  4XRS A;  1MBK A;  2DA3 A;  1A5J A;  1ETO A;  2E19 A;  3HKZ N;  2TRT A;  5C4X J;  1ETV A;  2D5V A;  2CRG A;  3QQA A;  3GTO J;  4A69 C;  2MW8 A;  1GUU A;  2P81 A;  1VF9 A;  3RQI A;  1JT6 A;  2LFB A;  2HXI A;  3S17 J;  3FIS A;  3NAR A;  3TP0 A;  2YUS A;  3S1Q J;  2XPV A;  2LD5 A;  2TCT A;  5IPA A;  2CUE A;  4X6A J;  1JKR C;  2HOA A;  3SJM A;  1ZR2 A;  2H8R A;  2HDD A;  2FD5 A;  2PMZ N;  4W97 A;  2XPW A;  3FK7 A;  2DA5 A;  4LOC A;  1IUF A;  4A3C J;  2DA1 A;  2LR8 A;  4B3A A;  4G12 A;  2IEK A;  3TP3 A;  5K7F A;  1F36 A;  1JUS A;  3GTJ J;  1W0U A;  1TWC J;  4XK4 A;  2LVS A;  1LE8 A;  1JKO C;  2QCO A;  2ECC A;  1TWH J;  3H0G J;  2G0E A;  4BKX A;  3GTK J;  2RAE A;  5E3N A;  5IYD J;  2XB5 A;  5M3F J;  2Y0S N;  1LFB A;  4BXX J;  1D5Y A;  1GV5 A;  2NOG A;  4MFD A;  3ZQL A;  1H8A C;  4D5C A;  1RKW A;  4QTR A;  1UMQ A;  1ZKG A;  1P7J A;  1JJ6 C;  2CQX A;  1VI0 A;  3ZQI A;  2MSY A;  3CMY A;  2L7Z A;  1LE8 B;  1RPW A;  4FCY A;  1E3O C;  2M9H A;  3CQZ J;  2YS9 A;  1WGX A;  5EG0 A;  1W0T A;  1P7I A;  2DMP A;  4DZJ A;  1ETK A;  3ZQF A;  2I10 A;  4AUX A;  1WH5 A;  5HOD A;  4CYC A;  2JA5 J;  3RKQ A;  9ANT A;  1SAN A;  2EBI A;  2VPR A;  3B6A A;  2LK2 A;  1FIP A;  3HOX J;  2LKX A;  1JTY A;  2JA8 J;  1U78 A;  3IH2 A;  3M3Y J;  2L0K A;  3LNQ A;  1JGG A;  2AHQ A;  2M0C A;  2Y31 A;  2XB0 X;  3FIW A;  3QPS A;  5EG0 B;  1K83 J;  1BW6 A;  4CYC B;  3Q3S A;  2ME0 A;  4MLO A;  1QPI A;  1UHS A;  1IGN A;  4M3F A;  4D5F A;  5C44 J;  1WCM J;  1IC8 A;  1TWA J;  2WB1 N;  3S1R J;  3BQZ A;  3MN2 A;  2MG4 A;  4FE7 A;  4C2M J;  4A93 J;  1I6H J;  2ECB A;  3O8G A;  3HOV J;  3Q0U A;  3LSP A;  2R5Y B;  1XS9 A;  1MSF C;  5FKK A;  4IHV A;  3G1M A;  5IP6 A;  1BA5 A;  3RZD J;  2VKE A;  3JRA A;  4UUS A;  2X48 A;  4DYR A;  5FKO A;  1NTC A;  5FKM A;  1Z0X A;  1QRY A;  4IHW A;  3OSF A;  3BTL A;  3DEW A;  3OIO A;  2ELK A;  1MH3 A;  2K9N A;  5EGO A;  1IV6 A;  1FJL A;  2JJ7 A;  2JMW A;  4A3B J;  2WV1 A;  2Y30 A;  5GP9 A;  1OFC X;  5E3O A;  2DJN A;  4UUS B;  5EF6 A;  1X2M A;  2DMQ A;  2L7M P;  2ZB9 A;  5F27 A;  3A03 A;  3S14 J;  2VKV A;  1TC3 C;  2EZI A;  2JWT A;  3S2D J;  2CU7 A;  2OF7 A;  5EGO B;  2Y2Z A;  1XC5 A;  4JX6 A;  1JTX A;  1ITY A;  3NAU A;  2M34 A;  5F0H A;  5F08 A;  1OJL A;  3TW7 A;  3S1N J;  2XGC A;  2W48 A;  1GDT A;  3JRF A;  4B4C A;  3JRE A;  2DMU A;  5IYC J;  1MBF A;  4L5E A;  3SDG A;  1I3Q J;  2K40 A;  5IOZ A;  2M2E A;  5GPC A;  3IH4 A;  4IHX A;  2X9D A;  3JRD A;  1ZR4 A;  3LOC A;  4AYB N;  1BW5 A;  3CCY A;  5DS9 A;  1FEX A;  5IYB J;  2LP0 A;  2N8G A;  4D7M A;  3W6V A;  3S15 J;  2QF7 A;  1ZTR A;  3FK6 A;  1GT0 C;  3UKG A;  3CDL A;  1GVD A;  2CQQ A;  4D7N A;  1JUP A;  1Y1W J;  2FJ1 A;  4JX5 A;  4A3J J;  3L1P A;  2GM4 A;  3HEF A;  3G1L A;  3PM1 A;  4B1R A;  2ME6 A;  2L9R A;  3PO2 J;  2WAQ N;  1F43 A;  4GFB A;  5EDN A;  1ORK A;  1QVU A;  3Q0V A;  2FQ4 A;  3OOU A;  1JUM A;  3M4O J;  5F0C A;  3BR6 A;  1HF0 A;  2OPT A;  1EF4 A;  1RKT A;  5J3L A;  3F0C A;  5IOY A;  2DA6 A;  1X58 A;  3GTP J;  4AC0 A;  1T56 A;  1WI3 A;  3K7A J;  3LSJ A;  4A3E J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...