1XG1A

Solution structure of myb-domain of human trf2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
GSHMEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomeric repeat binding factor 2
publication title NMR studies of telomeric nucleoprotein complexes involving the Myb-like domain of the human telomeric protein TRF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xg1A00
1S7EA 1FTTA 1B72B 3BR6A 1ZR4A 4IHYA 2PMZN 2DMNA 4A3IJ 5IP9J 4L5EA 5IYBJ 2MG4A 4CYCA 3JRCA 4DZPA 2R5YA 1U8BA 2QF7A 3FIWA 2I10A 5F27A 2M34A 3LSPA 2HI3A 3JRBA 5EG0B 2ME6A 2HOSA 2JA8J 5F0CA 3GTKJ 3WHBA 3HOVJ 3H0GJ 1WGXA 1H88C 1GDTA 1G2HA 2ID6A 1IC8A 3JRFA 1FJLA 2JA7J 4DW6A 3GTPJ 2JJ7A 3F0CA 1JTYA 2HYJA 1F36A 4BXXJ 2VUMJ 4FTHA 2DA2A 2KT0A 1HDDC 1ETQA 2TCTA 2XPUA 1IJWC 1IUFA 2FQ4A 5IPAA 2YU9J 4A3MJ 2DMTA 1ZTRA 3S2HJ 3S14J 1RESA 1DU0A 1EF4A 2L9RA 1A6IA 1Q1VA 4DYRA 3JRDA 1HOMA 3PM1A 4JP0A 4M3DA 3BTLA 2IBDA 4V2GA 3A03A 1GT0C 1BA5A 1QVUA 3LOCA 3GTGJ 2JN6A 2E2HJ 2NOGA 3IH2A 2E1OA 3RQIA 2LK2A 3GTQJ 4X1EA 2B63J 3W6VA 4Y52J 1MBKA 3BG3A 2XRLA 1RPWA 2HOTA 3JRIA 3HBLA 2LVSA 1TWGJ 2LFBA 2NVQJ 5DTDA 3HM5A 1ETKA 2QCOA 4W97A 4IHXA 4FCYA 1NTCA 1FEXA 5J1RA 3K7AJ 3S15J 1BW6A 2YS9A 2CUFA 2EQRA 2NVYJ 1YRNB 2VPRA 3G1LA 5C44J 1AKHB 3ZOBA 2JMWA 1Z77A 2MGQA 3BR3A 3SDGA 1W0TA 1QVTA 4A3JJ 3E7LA 1E3OC 2R5ZB 5IOZA 3BR1A 3BR5A 1RR7A 1POGA 3DCFA 1UG2A 5IYDJ 1JJ8C 1JGGA 3B6CA 2Y30A 2XB5A 1RETA 4AUXA 2ID3A 1JUPA 5E3MA 3GTOJ 4V2FA 1IGNA 3Q0UA 1FTZA 5EF6A 4DYCA 4FISA 1IG7A 1XC5A 3S17J 2L7ZA 4C3HJ 4AYBN 2K9QA 3A01B 2O7OA 1X2NA 3VPRA 4Y7NJ 3HOXJ 3JRHA 2Y31A 2OF7A 2W48A 2GM4A 1MBEA 1WI3A 5EZHA 1IDYA 5J1YA 2L7MP 4MIMA 2GLOA 3GTLJ 5GPAA 4UUSB 1H8AC 4A3GJ 3HGYA 1HDPA 5FKLA 4A69C 2ME0A 2P81A 1I3QJ 1JTXA 4S0HB 2XSDC 4I76A 1D5YA 1NK3P 4M6VA 3ZQGA 5EGOB 3NARA 2JA5J 2EZKA 4ABZA 2LR8A 3CCYA 1AKHA 3CMYA 1JKQC 5IP7J 5F1JA 3ZQCA 1GUUA 1P7IA 1U9OA 2EZLA 3LSGA 1PUFB 1JKOC 4NDLA 3G1OA 3M3YJ 3D1NI 5M3MJ 2L0KA 3HOWJ 3Q3SA 2VKVA 3A02A 2NS7A 1TC3C 5FKKA 3OSGA 1I6HJ 5J1UA 1F43A 1MH4A 3MKLA 3O8HA 1U9NA 5E3OA 4M3FA 2LTPA 2Y9ZA 2JA6J 2HOAA 2DA4A 1ITYA 4M3EA 2M9HA 4A3LJ 3A01A 3Q0VA 3S1MJ 2COBA 3G1MA 4J19A 1OCPA 3ZQIA 1NK2P 3S1QJ 1T56A 2K40A 1R9TJ 3RZDJ 2DJNA 1JUMA 2HXOA 3HOZJ 3TW6A 5E3NA 4QTRA 1B72A 5F0HA 4IEJA 1JT6A 5C4JJ 3BT9A 3I4NJ 5F08A 2IEKA 2YUSA 3HDDA 2LKXA 1WPKA 4UUSA 1ETYA 4D5CA 1MSEC 2GBYA 3S1RJ 1ETWA 4RBOA 1LE8B 1CQTA 1OJLA 5IOYA 1HF0A 2AO9A 1ZK8A 4M3BA 3OOUA 2WB1N 5EGOA 2VKEA 5EG0A 2XPVA 3JRGA 5FKOA 4DZJA 3PO3J 2EBIA 1ETOA 5EDNA 1AU7A 1TWFJ 1X2MA 4BY7J 3O8GA 2IAIA 5C3EJ 1ENHA 3BTIA 4A3EJ 3BG9A 3HOUJ 3MN2A 1MNMC 4B1RA 3GBGA 2XPWA 4D5FA 1AHDP 3HGGA 1ZGWA 5EEAA 4G12A 4JX4A 2X6OA 2R5YB 2DMPA 1TWCJ 1RKWA 3BTJA 4QSHA 2MSYA 2H8RA 2DA6A 2FX0A 1IDZA 1Y1WJ 4GFBA 2Y2ZA 4BKXA 2E2JJ 4W1UA 3QQAA 4D7MA 5K7HA 3GTMJ 4BBSJ 2L7FP 3BQYA 4JYKA 5F04A 2NS8A 2K9SA 1APLC 1XG1A 2O8KA 1VNDA 1LFUP 1A5JA 1TWAJ 2Y9YA 9ANTA 1ORKA 5E3LA 2WV1A 2FJ1A 2M0CA 4XRSA 5C4XJ 1MBFA 2R0QC 3PO2J 2DA3A 2RAEA 1U78A 1FIAA 4XK4A 3UKGA 3JR9A 3NAUA 3FK6A 3JREA 3Q0WA 2DA5A 2K9NA 5IYCJ 4I6ZA 1RKTA 1XS9A 1LE8A 3C2BA 2LD5A 1VF9A 4B4CA 5K7ZA 3RKQA 1B8IB 2WAQN 5FJ8J 1MBGA 4X6AJ 2ZB9A 4DYQA 1IV6A 3QPSA 3TP0A 5GPCA 4QIWN 1T33A 1YRNA 1FIPA 3ZQHA 2NVXJ 1K83J 1UMQA 5JLXA 5EYRA 2AHQA 1QRYA 3FK7A 2JWTA 1MBHA 4IHVA 1ZKGA 2DTZA 5JLWA 1JKRC 4C3JJ 1P7JA 3L1PA 1MBJA 2XB0X 5M3FJ 2R5ZA 2EZIA 4MO7A 3K2AA 2XGEA 3BR0A 2N8GA 5FKMA 2XGCA 1DU6A 2DN0A 3CQZJ 1HLVA 4BY1J 2TRTA 3JRAA 1JJ6C 3BG5A 1H89C 1ZQ3P 4EEFG 4B3AA 2E2IJ 1O4XA 3HKZN 4UUTA 1JT0A 2CRGA 3RZOJ 4XRSG 2R92J 2ELKA 3ZQFA 2R93J 5FKNA 2DA1A 1BJZA 3LNQA 2MW8A 5GP9A 5M5YJ 3S1NJ 3DEWA 3BR2A 4AC0A 1SFOJ 2DA7A 3I4MJ 3TEDA 2X9DA 2OPTA 1VI0A 2HDDA 1Y1VJ 3FISA 1WCMJ 1OFCX 2G0EA 1B8IA 3TW7A 1IRZA 3QPLA 4BBRJ 1ZR2A 1OCTC 3S2DJ 1HCRA 3OSFA 4A3BJ 1ETVA 1BW5A 2CQQA 2CUEA 3IH3A 2NVTJ 4A3KJ 1Z0XA 2VI6A 3IV5A 3IH4A 5K7FA 1W0UA 2DMUA 5FLVA 3M4OJ 2CJJA 1X58A 4JX6A 3H3VK 1PUFA 4A3CJ 1UHSA 4C2MJ 1JUSA 2EH3A 5J3LA 4JX5A 3TP3A 2M8GX 3GTJJ 5EZGA 2E19A 1WH5A 4D7NA 2DMQA 4MLOA 4CYCB 5M5WJ 4A93J 2XGDA 3SFIA 5F0FA 3ZQLA 3MVPA 4A3FJ 1BL0A 1JKPC 3BTCA 4XIDA 2O9LA 2KDZA 3BQZA 3WHCA 3SJMA 1ETXA 5IP6A 1WH7A 2CU7A 5FLMJ 3LSRA 3OIOA 5BNGA 2JK3A 3HEFA 2FD5A 3LSJA 1K61A 3FKIJ 3HB9A 1VFCA 5M5XJ 5HODA 4HNVA 2HQ5A 4LOCA 5DS9A 1GV5A 2CQXA 1MH3A 2ECCA 4FE7A 3B6AA 4MFEA 4XRMA 1QPIA 2M2EA 2LY9A 4FE4A 4XICA 2EZHA 1SANA 1MSFC 2Y0SN 4M3GA 4A3DJ 1LFBA 2HXIA 2R7ZJ 2D5VA 1GVDA 4C3IJ 2LLKA 3HOYJ 2X48A 2LP0A 4MFDA 4RDUA 1TWHJ 3S16J 1GV2A 2H1KA 3CDLA 1I50J 4IHWA 2ECBA
chains in the Genus database with same CATH superfamily
2ZC2A 3OIPA 2WC2A 2CV1A 3J7AO 3ZN1A 4ZTFA 4IHYA 3K69A 3GYHX 2PMZN 2DMNA 4A3IJ 1OYIA 3BJAA 4XNFA 1EJ9A 3ZQ7A 5KAIC 1I3AA 3EUHC 2VQGA 4CYCA 4CSWA 1LNWA 1IN6A 3FIWA 2EV6A 2FQ3A 1ZH5A 4ENJA 1FLIA 5EG0B 4KNYA 1IN7A 2JA8J 3KEOA 3PNYA 4JOMA 2KIMA 3TDUC 4I0BA 3HOVJ 1SFKA 3H0GJ 3REOA 1SD5A 2VN2A 4D0PA 5K1YA 4X0GA 4IQ4A 1H88C 3WTTC 1G2HA 1S5LC 2R7RA 2VXZA 3K1PA 1YHQI 4DW6A 3GTPJ 2KRHA 1DDNA 2HWVA 4AIHA 3F0CA 3OYMA 1T39A 2VOOA 1JTYA 2DODA 5FROA 2RC4A 5FFZA 4KDPA 4BXXJ 4V19K 3FDYA 4L5JA 4CZZA 3KP7A 2DA2A 3QYEA 2V1NA 4KUMA 1X1AA 2FBKA 5DV5A 1IUFA 1JGSA 4OINF 2E60A 4U88A 2B0LA 4RAYA 2O61A 4PFPA 1Y6IA 1FPQA 3PSIA 2KJBA 1IN8A 2QZ8A 3SZPA 4OMZA 1EF4A 2JVGA 2MD5A 5KK1A 5HLTA 1HW5A 4OOIA 4M3DA 1I1SA 2DK5A 2FNAA 4P9UA 4V2GA 5D4SA 3I71A 5CQEA 1GT0C 2DYRH 1UZCA 1C0WA 1SVMA 1QZYA 2LRDA 2M8EA 3GTGJ 2JN6A 2W25A 2E2HJ 1QZZA 2CMPA 2NOGA 3RQIA 3HTUA 3L2WA 3Q9VA 4NQWA 3TGNA 3P9IA 1IRFA 5KCMA 3LA2A 4Y52J 2XASA 4IJAA 3PQKA 3E6BA 1W7PA 1RPWA 1XDSA 2HOTA 4ENKA 5DCFA 2DLLA 4RB2C 5DTDA 4AVZA 1MNEA 1ETKA 4F52A 4L9JA 4AM3A 4IHXA 2R7SA 1T0FC 2KZGA 4FCYA 4FETA 1KA8A 2L5QA 4ESFA 3K7AJ 1RIOH 2HTSA 3KYDB 1HC8A 1YW7A 1YRNB 3QWLA 4XLFA 4F55A 5C44J 1TQPA 3IRQA 2LY1A 2WAQA 1T08B 2K3PA 2GOMA 3OMYA 1OCZH 3P7NA 1W0TA 3KFWX 1QVTA 3CC2I 3BR5A 1RR7A 2IGNA 1L0OC 3K2ZA 5J6XA 1UG2A 2BVMA 1O3RA 2ID3A 4IL6C 2VJIA 2HVRA 4V2FA 3Q0UA 5EF6A 3JSOA 2DCEA 3HYIA 5CVJA 1B4AA 3COAC 4B48A 4S05A 3WU1B 3KE2A 1X2NA 3VPRA 4WCGA 1LJ9A 2XAFA 4G94A 4M9ZA 4PK4A 4BACA 3JRHA 3J80Z 2Y31A 2LF8A 2DQLA 1PDNC 3GX4X 1ON2A 3TDZC 4EATA 3CF5F 4A6EA 2LNBA 3P9KA 2VJ5A 1IDYA 2QBYB 2YU3A 1Y8QB 2RQPA 4HF0A 4PJMA 5GPAA 3GTLJ 4M71A 3ZCOA 3HRMA 4OIRF 1HDPA 3LA3A 2C6YA 4Z6YA 4B09A 2E71A 3AG1H 3QPTA 4BEHA 2PI0A 1D5YA 3W2WA 4M6VA 1ZG1A 1SVLA 1YIOA 1TT0A 2EZKA 3JCUC 2P0WA 2RV8A 5LFAA 1ON1A 3CCYA 1AKHA 3CMYA 3X2QH 2UUZA 3ZQCA 1W1WE 2ESHA 1Y39A 2VBWA 3VYRB 2IS6A 1U9OA 2CW0F 2WB1A 1E3HA 4NDLA 4ZYGA 1OCCH 2PG4A 4IRIA 2XRNA 2QWWA 3SZTA 3Q3SA 2BHYA 3V8KA 2VKVA 4HQMA 5F64A 2ZJRF 4KT6A 1WJAA 2NS7A 2Y0MA 1WFXA 1XX5A 2JSCA 3E0JB 4CCLA 2O3FA 1U9NA 3EETA 4B44A 2QENA 3KZIC 3E6CC 2DA4A 1HKSA 1ITYA 2Z2SB 3KP4A 2O8XA 1ZG3A 3DLLF 4A0ZA 1VQPI 4HA8A 2E1NA 3G4SI 4J19A 1OCPA 3UR3C 3ZQIA 2PLYA 2QQ8A 3S1QJ 2I5UA 2DI3A 4GCVA 2COMA 1KU2A 4WXDA 3PIOF 2DJNA 4CCJA 3RSNA 5F0HA 3M7GA 3MCZA 4TV7A 4IEJA 3CUQC 1Z1DA 1JT6A 2K86A 2M87A 2D1VA 2M3AA 3KLOA 4P55A 3EPZA 3K1MA 3S1RJ 1YJ9I 2DW4A 4GDFA 1LE8B 1CQTA 1ZK8A 2A5YB 4HF2A 5EG0A 2XPVA 2WY7Q 5FKOA 3A4CA 3PO3J 2W85A 2EBIA 4L0ZB 4QLCU 4BY7J 4AWXB 5HDKA 3BTIA 1BM9A 3BG9A 2DOAA 3KZYA 1RI7A 2DDBA 3WTSC 1USSA 3K0LA 2XF5A 2KHMA 2KJCA 4LITA 3OYCA 2PX9A 2M45A 4D5FA 1IAWA 1ZGWA 4LK0F 3B73A 4WWCA 2I8DA 2R5YB 2DMPA 5E17F 3KP6A 2L01A 2HQRA 3G71I 5BPDA 1P4WA 2MSYA 2H8RA 4CUGA 3DWLE 4MGRA 3HSFA 3C7JA 4LLGF 4HRIA 3WGHA 4JYKA 3LAJA 1WKMA 2WADA 3BZ6A 5B1AH 1G8XA 2JTVA 1IXSB 3IP4B 4ZZLA 3K4NA 1VNDA 2O8KA 5E8GA 4PFOA 1QQIA 1IZ1A 2BVLA 2NAZA 1TWAJ 3PQJA 4HW0A 2Y9YA 5GTHC 9ANTA 3MD2A 5E3LA 1NHAA 1UG0A 3M9AA 2FJ1A 2M0CA 4XRSA 3BJOA 1QHHD 1Z21A 2Y69H 2R0QC 4XK4A 2L4MA 4BNCA 3UKGA 1U5TB 2BY0A 2BW3A 3WE2A 3JREA 2KZVA 3CDIA 1LDJA 2BOLA 2F5FA 4OWRB 2WTEA 1XS9A 1VF9A 4UVBA 5K7ZA 1E17A 2R7TA 2JPCA 2AQEA 3RKQA 4A5NA 4X6AJ 2WAQN 2ZBKA 2FU4A 5JVGF 1R5GA 3ELKA 4DYQA 1IV6A 2NRAC 2EB7A 2IRFG 2GAUA 1YRNA 4U0YA 1A04A 2HZTA 1O7LA 1K83J 5JLXA 2V9VA 2AHQA 4E70A 2KP6A 1ZKGA 2HVQA 3HHHA 5JLWA 4RGRA 3RJPA 4CYDA 3PL8A 5HDNA 4NBQA 1ZYRF 3KEYA 2XGCA 3GUDA 4XONA 4EGYA 1DU6A 2DN0A 5CLSA 4YG2F 3FM3A 3S32A 4B3AA 5JHUA 3H36A 2CYYA 1Z3YA 1QGPA 3JTGA 2UZKA 3LSHA 3OIQA 3ZQFA 3PFYA 1BOAA 3I64A 4L9TA 4RB3C 2M7BA 3DXJF 2AQFA 3I0TA 5GP9A 4DBQA 1VQ7I 1FZPB 2F5VA 3ZXSA 3GZ6A 4E7LA 1EKEA 2K9MA 5J8CA 1ERDA 2V1XA 2X9DA 1WJBA 1VI0A 2KISA 3F72A 2XAGA 3KIOA 2ZFUA 1HXDA 1OFCX 1WCMJ 2G0EA 4I0AA 1KONA 3CCMI 4F92B 1ZR2A 4B47A 4WXCA 1HCRA 3FXKA 3OSFA 4Y13A 2JRTA 3U1KA 3AL0C 2CUEA 2UXNA 3HC7A 3GLXA 4A3KJ 3WU2C 4PJ0C 5DM7F 3IV5A 2CWEA 1XGNA 2MA3A 2DMUA 3IH4A 5FLVA 2EIJH 4LMYA 5E20A 4WX9A 4KFCA 1DPRA 2DTRA 1VQNI 3H3VK 1OYYA 4A3CJ 2BE5F 3KEQA 1R00A 2R7FA 4C2MJ 4M74A 2ISZA 1FMWA 2VBZA 2GOXB 3J80K 3ASNH 3BCBA 4BDYA 2HPIA 2Z99A 4D7NA 4CYCB 4IXAA 3OL4A 1YG2A 2XGDA 3SFIA 4EVIA 4UV8A 4G7HF 3FXLA 4UY8I 2PMZA 5F0FA 3F8BA 2EINH 3JSPA 3MVPA 5DM6F 4A3FJ 3Q5FA 1JKPC 1Z3XA 3W2VA 3CCUI 4J00A 4GGGA 4Y17A 2OZ6A 1K4TA 2O9LA 1WZ2A 3WHCA 3SEZA 5IP6A 1WH7A 1G3SA 3LSRA 1YJWI 5E1XA 1B1BA 2IPQX 2V4JC 5BNGA 3OYAA 2JK3A 1MJ9A 2KL4A 1Z91A 2HYGD 2OTLI 4A12A 4O6JA 4BQAA 4BS9A 1YO5C 5HODA 1UELB 2DFIA 1BJAA 2LH9A 1R36A 3S93A 1MH3A 2ECCA 5TISC 3I5UA 2IA2A 4B43A 1STZA 4MFEA 1QPIA 1D3YA 5CQGA 1V3FA 1Z6TA 4HV6A 5FFXA 3CO7C 5IY5H 1SANA 4M3GA 1LFBA 1LUJB 4Y15A 4HX4A 3RPUA 4OMYA 3HOYJ 2X48A 3DU5A 4OU0A 5ILUA 3CF2A 2QVOA 1TWHJ 4RDUA 2H1KA 1ZRCA 2MH9A 2A6EF 2Q1ZB 5DYMA 1TWFJ 1S7EA 2QKLB 1B72B 3WTZA 3J7ZI 4I99C 2BHZA 5IYBJ 1ZGAA 4KITB 1MMSA 4CGZA 3JRCA 2CUJA 1W7PB 2R5YA 1FSHA 5HS8A 3OL3A 2VC1A 2QF7A 2M34A 4ZDPA 4M73A 3T5XA 1R71A 3CTAA 4O5VA 2Q8KA 4RLQA 4Z2YA 1E3PA 4P9FA 3F8MA 4YFNF 1GDTA 4XQFA 1QA6A 2JQ7A 2GA2A 3U21A 1FJLA 5LHHA 2JA7J 2JJ7A 2L7KA 3BCAA 5D6EA 1F36A 3HOSA 1FOWA 1G4DA 4XSXF 2KT0A 1LVKA 1YOVB 4XKWA 1D5VA 4AIKA 1Z7UA 1ETQA 2TCTA 2XPUA 1ZLKA 4PJJA 2FQ4A 4YFKF 4E7HA 1YITI 5IPAA 4EM0B 3OYLA 1I27A 2MH2A 4M6YA 1XPXA 1FBQA 2UV1A 4ETSA 3AG2H 1RESA 2CH0A 2L02A 2QLZA 5ED4A 4U0WA 5FLXK 4XORA 5B5EC 4HNTA 3L09A 3J81K 4JP0A 4IOAF 2IBDA 3G3ZA 1U5TC 5LHIA 2L4AA 2IJLA 3K6GA 1TW2A 1FOXA 4RS8A 1OR7A 2L9NA 3FHNA 2KRFA 3ISPA 2E1OA 2EA4A 4EV0A 1HBXG 3QP5A 1K4SA 3W6VA 3HJEA 1X1BA 3JRIA 1EH7A 5CVVA 3CO6C 1AWCA 2Z16A 3CESA 4PJNA 5J1RA 2BY1A 3I58A 4F3QA 1XGSA 1MW7A 2YS9A 4NUBA 3GFJA 2EFWA 4DNCA 2ZNYA 1I1GA 1D1BA 3DEEA 1AKHB 3ZOBA 4CCMA 4I98B 2A69F 1LQ1A 2X6XA 3AFHA 3SDGA 1A31A 1F4KA 2Z5UA 4A3JJ 3QOPA 1E3OC 3OR1C 2PJRA 3QOEA 4JBAA 3JAMK 2XDVA 3R61A 1JGGA 3C18A 4EJOA 4G9YA 4E4HA 4WXHA 4D1QA 1RETA 3VDXA 5E8IA 4AUXA 3CUOA 1TW3A 1JUPA 5E3MA 5LBQA 1YIJI 1IGNA 1FTZA 2F48A 3BJ6A 4FISA 1IG7A 2FA5A 3S17J 1XMKA 3W6KB 1YW9A 1SAUA 4M9SA 2L7ZA 4C3HJ 4BHPA 4EJTA 1BOBA 1Y56A 2NOJB 4BQOA 3PNVA 4Y7NJ 4R1HA 2CV2A 3T8TA 2STWA 3ECHA 1Y8RB 4EQQA 3PIPF 1WI3A 5EZHA 4CH7A 4ITVA 4BAYA 2W7NA 3CP2A 1TP4A 2KRCA 1VQ8I 2E1MC 3KZZA 4YIFA 2IS2A 1G3WA 1H8AC 2FOKA 3QPHA 4U87A 1KU3A 3ZMSA 2NXNB 5FKLA 4A69C 2ME0A 1X3WB 1I3QJ 1JTXA 3DLAA 1WWXA 1TT5B 1K7AA 1XTAA 1UFMA 1FMVA 2OQGA 5CVUA 3EUAA 3FF5A 4A0XA 1SFXA 1DGWY 5IP7J 4R8HA 3CCVI 1P7IA 4HYEA 2EZLA 2A6HF 1PUFB 1JKOC 4HNUA 3G1OA 1WJEA 2J5OA 3WTVC 3D1NI 4JQFA 2IS1A 3HOWJ 4KJZA 4KIGA 4XOTA 1Z67A 2M4KA 3O3KA 1I6HJ 1S7AA 3H92A 5FRNA 5J1UA 4YIIA 2QEXI 3MKLA 3O8HA 5E3OA 4M3FA 4HOBA 1XGOA 2MBFA 2HKXA 1KYZA 1RC9A 1AOYA 3A01A 2BGCA 1ZRFA 4PZJA 3S1MJ 2COBA 4XL9A 3RTRA 1NK2P 2BY2A 3E3VA 1T56A 2K40A 3F6VA 4NNJA 2P5KA 4XM3A 2DOFA 3MZHA 2HXOA 4QTRA 2L54A 1S9HA 1N25A 3K10A 1B72A 4KIFA 5EEHA 2DT5A 5C4JJ 3BT9A 4BHBA 3I4NJ 1R1UA 2IEKA 2YUSA 3HDDA 2KQRA 1WPKA 2VIXA 1VQMI 4IVNA 2R7XA 1ETYA 4IKFA 3MWMA 1FOYA 4HPQA 2BW3B 4E7ZA 1SMTA 2WA0A 2JT1A 2F4IA 4MNUA 1OJLA 4M3BA 3CC4I 1R7JA 3DTIA 5JI6A 2W84A 2RNJA 3A0BC 1WJFA 5EGOA 2VKEA 3MEXA 2O03A 3JRGA 1R1TA 3I9V2 1EH6A 3FMSA 3ZPLA 5EDNA 3O2PE 2K85A 3BWGA 4M9XA 4L0YB 1AU7A 5L3BA 3V8JA 1HQCA 5C3EJ 1WHUA 3FZVA 5H20A 1JI8A 4A3EJ 1ZLJA 3TKYA 3HOUJ 2OJED 1YLFA 4GYGA 3DU6A 2DQRA 3GBGA 4B1RA 1HW2A 4B3XA 3LFUA 1AHDP 3BG7A 3VYTB 4JX4A 2OUMA 4P5OA 2VKHA 1KQ9A 4HBLA 2HR3A 1BC7C 1IDZA 4FX0A 5ILVA 3S3NA 4L5IA 3SQNA 1VQ4I 3NRVA 2Y2ZA 3K4MA 4BKXA 1FP2A 3ESWB 2E2JJ 2XAHA 3MZ8A 3QQAA 2LKPA 4D7MA 1S6LA 3R0AA 3SHFA 5J4YA 5E1WA 2V1UA 5F04A 5CKTA 4RAFA 1APLC 1PP7U 1XCVA 2H6BA 1HKQA 2ZJQF 1USTA 1ORKA 4FQGA 1H0MA 3E5XA 2WV1A 1N75A 1MMGA 3ERED 5C4XJ 4LG3A 1MBFA 1YX5A 2FBIA 2RAEA 3R0JA 1U78A 3H9QA 1IV8A 2K4BA 3Q0WA 2IW5A 3FHZA 2DA5A 2K9NA 4IF4A 1XD7A 1RKTA 2LD5A 4B4CA 2GIZA 1DUXC 2JRMA 2X6YA 4UB6C 1ONVA 2ZB9A 4BJTA 2FMYA 3QPSA 3TP0A 5D5VB 3LQRA 1T33A 2PFBA 3ZQHA 2F5CA 2NVXJ 3F3XA 3FK7A 1MBHA 4C3JJ 2VBXA 3K4BA 3L1PA 2ELJA 1YTYA 5M3FJ 1PYVA 4YELA 2LMDA 3SDBA 2WV0A 3TQNA 3FKJA 5DCMB 3FXOA 2DT6A 4B8XA 3K2AA 2EILH 3BR0A 5LRRA 2N8GA 2GXGA 4U0VA 3AKZA 5DDGA 3PUFA 3CQZJ 3E6MA 1R23A 2TRTA 1JJ6C 2QSHX 4UUVA 3D5LA 2Z1DA 3LAPA 1BBYA 1A6QA 2KFDA 3GFMA 1MD0A 3F6OA 1O3SA 1S3JA 4EJWA 4E7IA 1SFEA 2IP2A 4DOZA 1NH3A 3OYDA 1YS6A 2IA1A 1BJZA 1B59A 1OLTA 4ZYEA 3HOTA 2HDWA 1P6RA 2F4OB 5GADJ 5KHDA 3VEPA 2IGKA 3F8CA 1SFOJ 3DFGA 3QU3A 5EEGA 1K78A 1DP7P 2V9PA 3TEDA 4II2A 2HDDA 2BEOA 3FISA 1RUOA 1TNTA 3WTXC 1SC7A 3UNGC 2XVCA 3CCJI 1XDUA 3IRRA 3QPLA 4BBRJ 2EK5A 3GMEA 2QUFA 4S04A 3S2DJ 1YI2I 3AG4H 3PSFA 3DF8A 3F23A 2CQ7A 1DP3A 3SXYA 4DBRA 1ACIA 1ETVA 3ZMVA 3IH3A 4KN7X 2NVTJ 1MNDA 2QYOA 2VQCA 4GRIA 5K7FA 3ECOA 4AYBA 3H1CA 2JA2A 3MAJA 4JX6A 1X58A 4ZH4F 4N0BA 1PUFA 3I54A 1FYKA 2HVSA 2VC0A 2BZTA 2EJRA 4HZFA 2EIMH 4JX5A 3TP3A 5EZGA 5D5UB 4A93J 5LLQA 1Z9CA 3V8LA 3N97A 5FLXZ 3J81Z 2NS0A 2XKOA 3ABMH 1VQLI 3ZQLA 1MDMA 1P4XA 2FUG2 4Q5SF 4F91B 2X6WA 2ZSIB 2VKDA 3BG6A 3H9JA 4EMSA 5JHFA 4HDVA 1YE9A 4QPOA 1Q1HA 4QWQA 2XKPA 5HNFA 1VQKI 2VT3A 3JTHA 3TL4X 2CU7A 2RVCA 3OIOA 1OPCA 3CC7I 3HEFA 3OYEA 3LSJA 1OYWA 3FKIJ 3HB9A 5HS7A 3TO6A 4CICA 1VFCA 2CV0A 5J40A 1JHFA 4HNVA 3C1DA 5HS9A 3IL2A 1UHMA 2HEOA 4P96A 3FX3A 3B6AA 4MHGA 3WE3A 4NC7A 2QSFX 2K3FA 5ERIA 3KP5A 5CVIA 4XICA 2EZHA 3CLQA 2YR2A 2Y0SN 3KYLA 3OYKA 5LEJA 2R7ZJ 2D5VA 1GVDA 2LYCA 3GW2A 2ISYA 2LP0A 3I59B 1GV2A 4HLXA 4YEJA 2CG4A 4C9YA 3IC7A 2ECBA 1PVEA 2R7OA 2Z3YA 1JE8A 1FTTA 1QBJA 3BR6A 3JAMZ 2JPBA 1YYVA 5CPRB 1ZR4A 4IX7A 4IO9F 1V5EA 3QODA 5IP9J 3IUOA 1E2XA 4MQ9F 3CJQB 3TMOA 2FBHA 5KNLA 3E1SA 2A07F 3LFKA 3IKTA 4DJAA 1U8BA 4HAMA 2MLKA 1QHGA 3Q9SA 3F8NA 3ZMZA 4F7ZA 3KPHA 3HXLA 3LSPA 3F22A 2HQNA 2HOSA 4LJZF 2JVHA 3L2RA 2O5RA 2OCCH 3EQLF 2H6CA 1W36C 3GO5A 3DKXA 3GFLA 3DP7A 5GAGJ 2DFEA 2H94A 3KYCB 3QAHA 2P6TA 2VOPA 1G3YA 1R4MB 3ZR8X 2PJRB 2ZMEB 1HDDC 2KLOA 2R7UA 1BR2A 2XV4S 2H09A 2ZXIA 1BIAA 3TOBA 2KIUA 1MKMA 2YU9J 4A3MJ 4UVCA 2CW7A 1FOKA 3S14J 4CDGA 1KQ8A 4AVPA 2L9RA 1W36D 1A6IA 3CP8A 4G7ZF 4DYRA 2LBFA 1FYLA 3BTLA 4KICA 2MC4A 3F9KA 1BIBA 1J09A 2FSWA 2OV7A 5AIPA 5JVTA 2DFFA 3E97A 2WAFA 5FD5A 5EJCA 1QVUA 1BA5A 2FE3A 3LOCA 5E18F 1GHCA 2VQLA 5GTIC 3CCSI 3BG3A 1X1DA 5DCMA 1K6OA 2E35A 1FBSA 4UB8C 1R4NB 3KLNA 5D8KB 3A2KA 3HBLA 3RKXA 2LVSA 3SZGA 4RGSA 3LSKA 1L3LA 2QCOA 1W5CC 2M1BA 3CZ6A 4LK1F 1J2XA 5B3SH 4UNOA 5DD8A 4ESBA 1BW6A 5TGTA 2CUFA 2WWYA 1D0YA 1G3TA 1UB9A 2K5CA 4XSZF 2MGQA 2FOWA 4ZC3A 3TOAA 1SAXA 2A61A 2P7CB 1BI3A 3GWZA 2R5ZB 2IXSA 3BR1A 2HPMA 2BV6A 2BBYA 5IYDJ 1LPQA 1JJ8C 3BY6A 5K5QA 4ZZDA 2XB5A 3CCLI 3H35A 2W1OA 2XAQA 4D9JA 2RGVA 1D1AA 1B9NA 5JR3A 3L2VA 3I55I 3GTOJ 1G6NA 2K27A 1IN4A 4DYCA 2ZSHB 3ZGKA 3CLOA 3H5RA 1UJ8A 1A36A 5GAHJ 4AYBN 2K9QA 1G59A 4I01A 3A01B 4KISA 2O7OA 1MMNA 3HRSA 5AONA 1S29A 5K5RA 5D8LB 5DUIA 1LEBA 2MFZA 2OF7A 2W48A 5D5XB 1MGTA 3BPVA 2EFOA 5BQTA 2OC6A 2K7LA 3EUKL 4GYIA 2DJIA 2L7MP 3RKWA 2GLOA 1XMAA 4PJLA 2IA0A 1V5FA 4HEA2 1CF7A 4A3GJ 1RUNA 2Z9OA 2ZXJA 3R60A 2P81A 3FM5A 4HLYA 3EYYA 4S0HB 2XSDC 4N9HA 1NK3P 2KDOA 3BLYA 2G7HA 3ZQGA 5ICCA 5EGOB 1FWZA 3OOPA 5H6QA 2JA5J 5HLHA 4ABZA 2DYSH 3HPGA 3RCOA 4JK1X 4BGDA 4Q48A 3B02A 3ULQB 3OS1A 1Y0UA 1VZ0A 5HLGA 4IPAA 3IAS2 3LSGA 3W3CA 2DT7B 2ZCWA 4A0YA 4E7JA 4ENNA 2VODA 2ZJPF 1QZEA 1HA8A 4ZTJA 3RPUD 5LGNA 4K2EA 3ZN0A 2L0KA 3U1DA 5HDGA 3TO7A 4MEYF 2P7VB 3A02A 3MMYB 5HNHA 1VQ6I 3K4JA 5FKKA 1PUEE 1F43A 1ODDA 2B7EA 2W82A 2QM3A 1FP1D 3CD6I 4M3EA 2M9HA 2ACJA 5D6FA 1Z6RA 2FXAA 3I59A 2PMUA 5L3FA 1IXRC 1R9TJ 1B6AA 1OMIA 1JUMA 5E3NA 3BZKA 3AAFA 4H0EA 3CCEI 2V1DA 4A6DA 3R4KA 5F08A 1U6GA 4GXOA 2AS5F 4UUSA 3GZNB 2Q2EB 1X4OA 2QKMB 1WJCA 3M1CA 4CXFA 1MSEC 5A2QK 2XC7A 4BU2A 1FYMA 3LSMA 1TQIA 3DKYA 2D45A 1UCRA 5IOYA 1HF0A 1IRXA 3OOUA 3QU6A 4UVAA 1D8JA 3GZ5A 3L00A 2ELHA 3V7CA 3CJTB 3BZCA 3VFZA 1OR7C 4ASNA 2E34A 1D8KA 1FBUA 2OBPA 4XLCA 3IHUA 3L2CA 1X2MA 2IAIA 1ENHA 1X3UA 2GA1A 2HGCA 3H3ZA 3OYFA 4HQEA 3QYFA 2G7UA 2E7WA 2X85A 5DD4A 4LIUA 2XAUA 3QP6A 3C3WA 2XPWA 2X0LA 2LY2A 3FMRA 3OY9A 2ZMEA 4G12A 2W57A 5FRMA 3HUGA 1ZELA 3WG9A 1BC8C 3BTJA 1RKWA 4QSHA 1IN5A 2EV5A 2DA6A 2IVMA 2FX0A 5H2FC 4XRFA 4XLHA 4E7SA 5J4VA 1O3QA 4XN3A 4BBSJ 5K7HA 2GWRA 5AIQA 2V6CA 3WGIA 4NB5A 2VE8A 3WTYC 1XG1A 3SFZA 3ZRGA 2BXZA 3DBHB 3ROUA 1LFUP 1WRJA 1A5JA 1XGMA 2J5PA 3LSTA 2VPLA 1H9GA 3V7RA 4ZJZA 2OCEA 3QYBA 2W4SA 3FWEA 5F6FA 4IHTA 3NAUA 3RYPA 2QQ9A 3HTSB 5IYCJ 2EFPA 3K1NA 4I6ZA 1EA3A 1K78B 2JSPA 2OU2A 3C2BA 5FD6A 2K02A 4XLEA 2VONA 4M6XA 2YX4A 1MZBA 4RAGA 2R3SA 1MBGA 3EUHA 3OS2A 1JHHA 3IAM2 5ICFA 5GPCA 2K4JA 3WTUC 3L7WA 2GXBA 4QIWN 5DUKA 2K9LA 3RYRA 1FIPA 3MFKA 1KZHA 1D1CA 3HSRA 1X1PA 3VOEA 1F5TA 1UMQA 1RR8C 2EIKH 3I4PA 5EYRA 3NWSA 1QRYA 2E5ZA 3P5JA 2JWTA 4OIPF 1FC3A 4IHVA 2M0MA 3TO9A 4WF2A 2ESNA 2F5EA 1IXCA 2VXDA 4RM2A 2ZXHA 2XB0X 1J7KA 5J8FA 2R5ZA 4XR6A 1Z05A 1OISA 1IO2A 4ZYHA 3RKYA 2XF6A 4KT5C 1ZAOA 1SMYF 1GVJA 4LB6B 4KN4X 2XGEA 1DGRM 5LRSA 3ML6A 1WQ2A 2A3SA 2B9SA 3H9GA 5FKMA 1K79A 1HLVA 1WJ5A 4BY1J 1CGPA 1S7OA 4IRGA 4RM3A 3JRAA 1H89C 1VQ9I 3FBNB 3BROA 1MDMB 3ASOH 3M8FA 4CCKA 4EEFG 2W24A 1OKRA 1SFUA 1O4XA 2MLGA 3HKZN 4UUTA 4Y33A 4BUPA 1V55H 2STTA 4Y4RA 2R93J 2Y48A 2CFOA 2EWNA 3ABUA 3KP3A 5JFRA 3WODF 2MD0A 3ZP5A 1X4PA 2DBBA 3I53A 3DEWA 3MKZA 2X51A 4AC0A 2DA7A 4MQVA 1WI9A 3BP8A 1YW8A 2ZFWA 2OPTA 4HSTA 4DGWB 1Y1VJ 1ZRDA 3CMMA 2GIVA 4EM2A 2P8TA 1GXPA 1B8IA 3H0DA 2YSRA 1IRZA 1V54H 3HIFA 4LIVA 1I39A 1E0EA 2RQQA 1AA7A 3H5AA 1X19A 3M8EA 1YJNI 3HRTA 1R5HA 2DAOA 5TRDA 2CQQA 3VYUB 2VT2A 4KA4A 1T0FA 4A5MA 1X3ZB 3VSLA 2VI6A 3M4OJ 2HOEA 2CJJA 2Y0SA 5HOOA 3MKYB 1JXSA 1KQ0A 1F9NA 4N4NB 3U2RA 2HYFA 3WGGA 1ZHFA 2XF7A 3NEUA 3LA7A 3SYTA 4WK8F 2QQAA 3DEUA 2HTJA 3PNTA 2DMQA 2A05A 1FNNA 2ZKZA 4OAZA 3PJRA 2QQBA 2CO5A 2EFNA 2QA4I 3DQVC 1BL0A 2CUZA 1QO0D 3NWTA 2A68F 3A1YA 1O3TA 3BDDA 2O6GE 3BTCA 4XOPA 1U3EM 2QSGX 1HSTA 5ICGA 5KAFC 3BQZA 3KX2A 3SJMA 1W7PD 2BYVE 5FB2A 4IQJA 3FXMA 5FLMJ 3J7YJ 2X1CA 1LDDA 3CDHA 3HRUA 4RA2A 4C2TA 2UWMA 2EV0A 2DPUA 3GLLA 5M5XJ 1UHWA 4BJ5C 4FT8A 1T95A 3O6BB 3DV8A 4LOCA 4XBFA 1KYWA 3G73A 2Q2EA 4MEXF 2R4GA 3C2HA 4FE7A 1S72I 2VBYA 4OIOF 4XRMA 2M2EA 4HG2A 2OD5A 2CGPA 3WG7H 1MSFC 4A3DJ 3G2BA 2HNHA 4PGGA 3LL7A 2V6EA 3KP2A 1HSJA 2LLKA 1WVRA 1EV7A 2LBFB 4HX8A 4MFDA 4U7DA 3S16J 1I50J 1S8NA 2VB6A 4HSRA 2VE9A 4IHWA 2XAJA 4CCNA 3W2AA 1FY7A 4M72A 2M5WA 3AL0B 2LC2A 3NQOA 3WU0A 4BYYA 1P92A 2AXLA 2YX7A 5CJ9A 5F1RA 4L5EA 5LHGA 2MG4A 3M8JA 4N9IA 1TL8A 5J47A 5KVRA 1H9TA 1FT9A 4DZPA 4YFXF 2M7AA 1F1ZA 2L3DA 3J7AY 4IZZA 2I10A 4G6TB 5F27A 5TJJA 4UV9A 2HI3A 3JRBA 2ME6A 5L3DA 2A5WA 5F0CA 1SD4A 2JZYA 3GTKJ 3WHBA 2CQNA 1LEAA 5BOXA 1WGXA 4AU7A 5IT3A 1IW7F 2ID6A 2P6SA 1IC8A 1QNTA 2R7DA 5CYVA 3MZYA 4R79A 3JRFA 1J59A 4LB5A 4XN0A 2MABA 2HYJA 2VUMJ 4FTHA 2YPRA 1D0ZA 4AD9A 3KCCA 3K4KA 4MTDA 3OS0A 4C30A 1IJWC 3FXUA 1XMXA 5GAEJ 2DMTA 1ZTRA 3FXRA 5FO5A 2R7WA 3CUQA 3V4GA 1BI1A 4PSWA 2ZNZA 3DPUA 3S2HJ 4UXNA 4DQ2A 1DU0A 1T2KA 3HPHA 5IT9K 4I2OA 4KMFA 1Q1VA 2NNYA 3K9TA 5D5WB 1U8RA 2GXAA 3JRDA 1HOMA 1XB4A 3PM1A 1M1EB 3HZJA 4BE2A 3AG3H 1R5ID 2V9KA 1PJRA 3A03A 4LG0B 4LLNA 2XSJC 1XSXA 4P1WA 2DO7A 2VASA 3IH2A 3K4CA 3GTQJ 2LK2A 4HV5A 4X1EA 1MMAA 2B63J 4NC6A 3LQQA 1MBKA 2VQHA 1QPMA 2XRLA 2JUGA 1CF7B 1TWGJ 2LFBA 2NVQJ 2E7XA 3HM5A 1ZREA 4W97A 4BDZA 1BR1A 1SEUA 2RDPA 2WAEA 2ZXWH 3ZMDA 1NTCA 1FEXA 3S15J 4G7OF 4PGHA 2EQRA 2NVYJ 4XMYA 2VPRA 4LD5A 2HU9A 3G1LA 4ENMA 1I6XA 1LVAA 2LDUA 3RPQA 2JMWA 1Z77A 4ESJA 4BH9A 2JUCA 3BR3A 1EH8A 2PBIA 1DPUA 4IOCF 3L2QA 1YS7A 2FNPA 2R7QA 5BS6A 2L2OA 2ZO4A 2IGMA 3E7LA 5IOZA 3DCFA 1POGA 2CSOA 5A2QZ 4L9VA 1GLNA 4CCOA 2VLAA 5BMZA 2LF7A 2PN6A 3B6CA 2ADUA 2Y30A 3EDPA 4I02A 5E79C 3G6EI 2Q0OA 3IWFA 2H27A 2G9WA 3H3UA 1R1VA 3FMQA 1XC5A 3VWBA 1W4MA 1PP8F 1OQYA 2UXXA 3HOXJ 3VSKA 2LG4A 1T6SA 3LMMA 3FBIB 2GM4A 1K6YA 1MBEA 1P4AA 3MKWB 5LGTA 1T38A 1OCOH 5D4RA 1TBXA 3DPLC 5J1YA 2HDCA 1D0XA 3LSIA 4MIMA 3FXJA 4XLAA 4UUSB 3IWZA 1IRGA 2CQKA 2KIQA 4PDKA 1LDKB 3HGYA 2OQRA 1SD6A 3A0HC 3DTEA 3GF2A 3ABTA 5LD2C 3FXQA 2X1DA 4RB0A 2QGUA 3D5SC 4I76A 3H5NA 4F93B 1RRJA 3NARA 3U9GA 4CO8A 2LR8A 3L2UA 4RLFA 1I5ZA 4IRHA 3VODA 5HVQC 4BE0A 4AIDA 1JKQC 2X4HA 1SVOA 3F8FA 5F1JA 2GZWA 2M30A 1GUUA 4EM1A 2Z33A 2BXYA 3VYSB 2F4MB 4N4OB 3OWTA 1W5TA 3HHGA 3PUBA 3OR2C 2D1HA 4O3MA 3M3YJ 5DEQA 5M3MJ 1QU3A 4CHUA 1UAAA 3M07A 1VQOI 3E6DA 4KIBA 4ZDOA 2W00A 2MYSA 2H1LA 3HUGB 3V42A 1J0RA 1TC3C 3OSGA 1MIJA 4HX7A 3RIRA 1MH4A 1LKXA 2FRHA 4L9NA 2V26A 2KIFA 2LTPA 2Y9ZA 3QRFF 2JA6J 2HOAA 5LEKA 1NG7A 1N78A 1TNSA 2OAZA 3DKWA 4KMUX 4A3LJ 3ABKH 3Q0VA 3CCRI 3BC8A 1P9QC 3G1MA 2XHKA 2P5LC 3S2WA 1TTYA 2WY8Q 3RZDJ 4HDUA 3DPTA 1YFHA 3GFIA 1BI0A 3HOZJ 2TDXA 1RNLA 3TW6A 5CVRA 2DOEA 3T0YA 2OA4A 1ULYA 2AXTC 4I7HA 2H8WA 4RGXA 5E1ZB 2EA2A 3CJRB 4QPQA 2QBYA 2LKXA 2HQAA 4XLPF 1T8IA 2L9SA 1GXQA 2KMUA 2KKOA 4D5CA 2PMHA 2GBYA 2DFHA 4ON0A 1TZLA 2P4WA 1KU7A 1ETWA 3C2GA 4RBOA 2E1MB 1LFPA 3GCMA 2AO9A 2WB1N 2V79A 4DZJA 2OZUA 2P5VA 1ETOA 4E6KG 3E5UA 3IKVA 3T8RA 2PQ8A 3O8GA 3CCQI 2E5NA 4BXFA 3V7SA 4ZYAA 3MN2A 1MNMC 2VJJA 4FHTA 2ETHA 3CMAI 1YX3A 2XGXA 3HGGA 5EEAA 1OCRH 4MTEA 3BOQA 2X6OA 3D0SA 4RB1A 1TWCJ 1BN5A 1TLHB 1U2WA 3KETA 2EPFA 3R6SA 2E1CA 1Y0NA 1VQ5I 1Y1WJ 4GFBA 5B1BH 5BPIA 1KU9A 3K4LA 1MJBA 2E36A 4W1UA 3GTMJ 2L7FP 3RQ4A 5L3EA 3BQYA 3EYIA 4NC8A 3CJNA 2NS8A 2K9SA 2CW8A 3ZQQA 2L9VA 1YQAA 4LG0A 3S3MA 1V4RA 3P9CA 3OYNA 1R22A 2FMLA 4CZCA 4C2UA 5B66C 2NVUB 3ZMTA 2X1EA 3LWFA 5H6RA 2F6CA 3GXOA 1T98A 3PO2J 3HKZA 2DA3A 4I09A 1FIAA 3JR9A 2FEZA 3ZMUA 3FK6A 4Y3OA 4HF1A 1B9MA 1NG6A 2DDAA 1LE8A 3T1BA 3N4MA 2DPDA 1J9IA 1HKTA 5ILSA 2FF4A 1XCBA 1ZARA 4LGWA 1B8IB 5FJ8J 4XKBA 1XN7A 4CA0A 1TQMA 3GEZA 3DTKA 4BXUA 1O7FA 3OYGA 4PSXA 2NNNA 1MMDA 2DTZA 1JKRC 1P7JA 1X1CA 1LB2A 1XSDA 1O57A 4NQWB 1MBJA 2Y75A 4L18B 2EZIA 3W6JB 3HSEA 4MO7A 4NHJA 4RAZA 1J75A 1DQUA 1R58A 2KPMA 1BR4A 3RDIA 4BE1A 2WBMA 5L3CA 1U0JA 1RZ4A 2RKHA 4H4KC 2RNGA 3S8PA 4G8XA 4U7BA 2R7VA 1ZQ3P 1HW1A 1WJDA 3BG5A 4PCQA 1IUYA 2E2IJ 3E5QA 3GVAA 4Q4ZF 1JT0A 3SEQA 2CRGA 2RREA 3RI4A 3RZOJ 4J01A 4ANJA 2XUBA 4XRSG 4YIRX 2R92J 2ELKA 4Q47A 5FKNA 2DA1A 3N05A 3BPXA 2LREA 2LKSA 1KGSA 2PEXA 4RMNA 2MW8A 3LNQA 4BL0B 1ZG5A 1U5TA 5M5YJ 3S1NJ 2HZDA 3BR2A 3D5RC 1FX7A 2ICWG 4BQNA 4FASD 3WTWC 2RN7A 4DIQA 4E7KA 3I4MJ 5ICEA 1J5YA 3TW7A 4GO1A 2F5DA 1N77A 2IGOA 2M4GA 4LFUA 2CS3A 2NYXA 1OCTC 1W5SA 4A3BJ 4KYWA 1MJAA 2LOOA 3L9FA 3HG9A 1BW5A 3OYHA 1ZGJA 4AIJA 1ZN2A 2DU9A 1Z0XA 4PUSA 5L3GA 2LSOA 1W0UA 4EGZA 4XKVA 4XKCA 2XROA 4EJUA 3OV8A 2CFXA 4OAYA 4LLLA 1UHSA 1R6RA 2A6TA 1JUSA 2EH3A 2OTJI 1REPC 4G6QA 1Z7LA 5J3LA 2M8GX 3GTJJ 3PFIA 4RGUA 2HFHA 2E19A 1WH5A 5M5WJ 4MLOA 2VJ4A 5IT9Z 2MC3A 2XIGA 6PAXA 4IHSA 4BEHB 2IT0A 2O0YA 1FSEA 5HLIA 1R49A 2F2EA 3DBLB 3ABLH 1V5GA 4ZYDA 3CMEI 1WSUA 4XIDA 3K70C 2KDZA 1VTNC 4A2UA 2IS4A 1ETXA 2VL8A 2ZMEC 1SD7A 3OYBA 4EJVA 2ZJ2A 2GQQA 5K5OA 3S3OA 4FX4A 2FD5A 1K61A 1P2FA 4II3A 4BQQA 3HL2A 1IF1A 2HQ5A 3M1EA 1XSVA 2HS5A 2V7FA 5DS9A 1GV5A 3DBRB 2HKOA 2CQXA 2DXIA 2EFQA 4BHCA 5FGMA 4UHTA 3MQ0A 4XLNF 4BJ6C 3I3LA 2BY3A 2LY9A 4FE4A 4OIQF 4G6DA 3I56I 3CUQB 3K70D 1A35A 4ZDLA 3TBIA 4YRVA 2HXIA 2D2WA 4C3IJ 3ONQA 3VB2A 3JW4A 3OYJA 3F21A 1BI2A 3OYIA 3CDLA 3ERMA 2PJPA 2DK8A 5LGUA
chains in the Genus database with same CATH topology
1S7EA 1FTTA 1B72B 3BR6A 1ZR4A 4IHYA 2PMZN 2DMNA 4A3IJ 5IP9J 4L5EA 5IYBJ 2MG4A 4CYCA 3JRCA 4DZPA 2R5YA 1U8BA 2QF7A 3FIWA 2I10A 5F27A 2M34A 3LSPA 2HI3A 3JRBA 5EG0B 2ME6A 2HOSA 2JA8J 5F0CA 3GTKJ 3WHBA 3HOVJ 3H0GJ 1WGXA 1H88C 1GDTA 1G2HA 2ID6A 1IC8A 3JRFA 1FJLA 2JA7J 4DW6A 3GTPJ 2JJ7A 3F0CA 1JTYA 2HYJA 1F36A 4BXXJ 2VUMJ 4FTHA 2DA2A 2KT0A 1HDDC 1ETQA 2TCTA 2XPUA 1IJWC 1IUFA 2FQ4A 5IPAA 2YU9J 4A3MJ 2DMTA 1ZTRA 3S2HJ 3S14J 1RESA 1DU0A 1EF4A 2L9RA 1A6IA 1Q1VA 4DYRA 3JRDA 1HOMA 3PM1A 4JP0A 4M3DA 3BTLA 2IBDA 4V2GA 3A03A 1GT0C 1BA5A 1QVUA 3LOCA 3GTGJ 2JN6A 2E2HJ 2NOGA 3IH2A 2E1OA 3RQIA 2LK2A 3GTQJ 4X1EA 2B63J 3W6VA 4Y52J 1MBKA 3BG3A 2XRLA 1RPWA 2HOTA 3JRIA 3HBLA 2LVSA 1TWGJ 2LFBA 2NVQJ 5DTDA 3HM5A 1ETKA 2QCOA 4W97A 4IHXA 4FCYA 1NTCA 1FEXA 5J1RA 3K7AJ 3S15J 1BW6A 2YS9A 2CUFA 2EQRA 2NVYJ 1YRNB 2VPRA 3G1LA 5C44J 1AKHB 3ZOBA 2JMWA 1Z77A 2MGQA 3BR3A 3SDGA 1W0TA 1QVTA 4A3JJ 3E7LA 1E3OC 2R5ZB 5IOZA 3BR1A 3BR5A 1RR7A 1POGA 3DCFA 1UG2A 5IYDJ 1JJ8C 1JGGA 3B6CA 2Y30A 2XB5A 1RETA 4AUXA 2ID3A 1JUPA 5E3MA 3GTOJ 4V2FA 1IGNA 3Q0UA 1FTZA 5EF6A 4DYCA 4FISA 1IG7A 1XC5A 3S17J 2L7ZA 4C3HJ 4AYBN 2K9QA 3A01B 2O7OA 1X2NA 3VPRA 4Y7NJ 3HOXJ 3JRHA 2Y31A 2OF7A 2W48A 2GM4A 1MBEA 1WI3A 5EZHA 1IDYA 5J1YA 2L7MP 4MIMA 2GLOA 3GTLJ 5GPAA 4UUSB 1H8AC 4A3GJ 3HGYA 1HDPA 5FKLA 4A69C 2ME0A 2P81A 1I3QJ 1JTXA 4S0HB 2XSDC 4I76A 1D5YA 1NK3P 4M6VA 3ZQGA 5EGOB 3NARA 2JA5J 2EZKA 4ABZA 2LR8A 3CCYA 1AKHA 3CMYA 1JKQC 5IP7J 5F1JA 3ZQCA 1GUUA 1P7IA 1U9OA 2EZLA 3LSGA 1PUFB 1JKOC 4NDLA 3G1OA 3M3YJ 3D1NI 5M3MJ 2L0KA 3HOWJ 3Q3SA 2VKVA 3A02A 2NS7A 1TC3C 5FKKA 3OSGA 1I6HJ 5J1UA 1F43A 1MH4A 3MKLA 3O8HA 1U9NA 5E3OA 4M3FA 2LTPA 2Y9ZA 2JA6J 2HOAA 2DA4A 1ITYA 4M3EA 2M9HA 4A3LJ 3A01A 3Q0VA 3S1MJ 2COBA 3G1MA 4J19A 1OCPA 3ZQIA 1NK2P 3S1QJ 1T56A 2K40A 1R9TJ 3RZDJ 2DJNA 1JUMA 2HXOA 3HOZJ 3TW6A 5E3NA 4QTRA 1B72A 5F0HA 4IEJA 1JT6A 5C4JJ 3BT9A 3I4NJ 5F08A 2IEKA 2YUSA 3HDDA 2LKXA 1WPKA 4UUSA 1ETYA 4D5CA 1MSEC 2GBYA 3S1RJ 1ETWA 4RBOA 1LE8B 1CQTA 1OJLA 5IOYA 1HF0A 2AO9A 1ZK8A 4M3BA 3OOUA 2WB1N 5EGOA 2VKEA 5EG0A 2XPVA 3JRGA 5FKOA 4DZJA 3PO3J 2EBIA 1ETOA 5EDNA 1AU7A 1TWFJ 1X2MA 4BY7J 3O8GA 2IAIA 5C3EJ 1ENHA 3BTIA 4A3EJ 3BG9A 3HOUJ 3MN2A 1MNMC 4B1RA 3GBGA 2XPWA 4D5FA 1AHDP 3HGGA 1ZGWA 5EEAA 4G12A 4JX4A 2X6OA 2R5YB 2DMPA 1TWCJ 1RKWA 3BTJA 4QSHA 2MSYA 2H8RA 2DA6A 2FX0A 1IDZA 1Y1WJ 4GFBA 2Y2ZA 4BKXA 2E2JJ 4W1UA 3QQAA 4D7MA 5K7HA 3GTMJ 4BBSJ 2L7FP 3BQYA 4JYKA 5F04A 2NS8A 2K9SA 1APLC 1XG1A 2O8KA 1VNDA 1LFUP 1A5JA 1TWAJ 2Y9YA 9ANTA 1ORKA 5E3LA 2WV1A 2FJ1A 2M0CA 4XRSA 5C4XJ 1MBFA 2R0QC 3PO2J 2DA3A 2RAEA 1U78A 1FIAA 4XK4A 3UKGA 3JR9A 3NAUA 3FK6A 3JREA 3Q0WA 2DA5A 2K9NA 5IYCJ 4I6ZA 1RKTA 1XS9A 1LE8A 3C2BA 2LD5A 1VF9A 4B4CA 5K7ZA 3RKQA 1B8IB 2WAQN 5FJ8J 1MBGA 4X6AJ 2ZB9A 4DYQA 1IV6A 3QPSA 3TP0A 5GPCA 4QIWN 1T33A 1YRNA 1FIPA 3ZQHA 2NVXJ 1K83J 1UMQA 5JLXA 5EYRA 2AHQA 1QRYA 3FK7A 2JWTA 1MBHA 4IHVA 1ZKGA 2DTZA 5JLWA 1JKRC 4C3JJ 1P7JA 3L1PA 1MBJA 2XB0X 5M3FJ 2R5ZA 2EZIA 4MO7A 3K2AA 2XGEA 3BR0A 2N8GA 5FKMA 2XGCA 1DU6A 2DN0A 3CQZJ 1HLVA 4BY1J 2TRTA 3JRAA 1JJ6C 3BG5A 1H89C 1ZQ3P 4EEFG 4B3AA 2E2IJ 1O4XA 3HKZN 4UUTA 1JT0A 2CRGA 3RZOJ 4XRSG 2R92J 2ELKA 3ZQFA 2R93J 5FKNA 2DA1A 1BJZA 3LNQA 2MW8A 5GP9A 5M5YJ 3S1NJ 3DEWA 3BR2A 4AC0A 1SFOJ 2DA7A 3I4MJ 3TEDA 2X9DA 2OPTA 1VI0A 2HDDA 1Y1VJ 3FISA 1WCMJ 1OFCX 2G0EA 1B8IA 3TW7A 1IRZA 3QPLA 4BBRJ 1ZR2A 1OCTC 3S2DJ 1HCRA 3OSFA 4A3BJ 1ETVA 1BW5A 2CQQA 2CUEA 3IH3A 2NVTJ 4A3KJ 1Z0XA 2VI6A 3IV5A 3IH4A 5K7FA 1W0UA 2DMUA 5FLVA 3M4OJ 2CJJA 1X58A 4JX6A 3H3VK 1PUFA 4A3CJ 1UHSA 4C2MJ 1JUSA 2EH3A 5J3LA 4JX5A 3TP3A 2M8GX 3GTJJ 5EZGA 2E19A 1WH5A 4D7NA 2DMQA 4MLOA 4CYCB 5M5WJ 4A93J 2XGDA 3SFIA 5F0FA 3ZQLA 3MVPA 4A3FJ 1BL0A 1JKPC 3BTCA 4XIDA 2O9LA 2KDZA 3BQZA 3WHCA 3SJMA 1ETXA 5IP6A 1WH7A 2CU7A 5FLMJ 3LSRA 3OIOA 5BNGA 2JK3A 3HEFA 2FD5A 3LSJA 1K61A 3FKIJ 3HB9A 1VFCA 5M5XJ 5HODA 4HNVA 2HQ5A 4LOCA 5DS9A 1GV5A 2CQXA 1MH3A 2ECCA 4FE7A 3B6AA 4MFEA 4XRMA 1QPIA 2M2EA 2LY9A 4FE4A 4XICA 2EZHA 1SANA 1MSFC 2Y0SN 4M3GA 4A3DJ 1LFBA 2HXIA 2R7ZJ 2D5VA 1GVDA 4C3IJ 2LLKA 3HOYJ 2X48A 2LP0A 4MFDA 4RDUA 1TWHJ 3S16J 1GV2A 2H1KA 3CDLA 1I50J 4IHWA 2ECBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1S7E A;  1FTT A;  1B72 B;  3BR6 A;  1ZR4 A;  4IHY A;  2PMZ N;  2DMN A;  4A3I J;  5IP9 J;  4L5E A;  5IYB J;  2MG4 A;  4CYC A;  3JRC A;  4DZP A;  2R5Y A;  1U8B A;  2QF7 A;  3FIW A;  2I10 A;  5F27 A;  2M34 A;  3LSP A;  2HI3 A;  3JRB A;  5EG0 B;  2ME6 A;  2HOS A;  2JA8 J;  5F0C A;  3GTK J;  3WHB A;  3HOV J;  3H0G J;  1WGX A;  1H88 C;  1GDT A;  1G2H A;  2ID6 A;  1IC8 A;  3JRF A;  1FJL A;  2JA7 J;  4DW6 A;  3GTP J;  2JJ7 A;  3F0C A;  1JTY A;  2HYJ A;  1F36 A;  4BXX J;  2VUM J;  4FTH A;  2DA2 A;  2KT0 A;  1HDD C;  1ETQ A;  2TCT A;  2XPU A;  1IJW C;  1IUF A;  2FQ4 A;  5IPA A;  2YU9 J;  4A3M J;  2DMT A;  1ZTR A;  3S2H J;  3S14 J;  1RES A;  1DU0 A;  1EF4 A;  2L9R A;  1A6I A;  1Q1V A;  4DYR A;  3JRD A;  1HOM A;  3PM1 A;  4JP0 A;  4M3D A;  3BTL A;  2IBD A;  4V2G A;  3A03 A;  1GT0 C;  1BA5 A;  1QVU A;  3LOC A;  3GTG J;  2JN6 A;  2E2H J;  2NOG A;  3IH2 A;  2E1O A;  3RQI A;  2LK2 A;  3GTQ J;  4X1E A;  2B63 J;  3W6V A;  4Y52 J;  1MBK A;  3BG3 A;  2XRL A;  1RPW A;  2HOT A;  3JRI A;  3HBL A;  2LVS A;  1TWG J;  2LFB A;  2NVQ J;  5DTD A;  3HM5 A;  1ETK A;  2QCO A;  4W97 A;  4IHX A;  4FCY A;  1NTC A;  1FEX A;  5J1R A;  3K7A J;  3S15 J;  1BW6 A;  2YS9 A;  2CUF A;  2EQR A;  2NVY J;  1YRN B;  2VPR A;  3G1L A;  5C44 J;  1AKH B;  3ZOB A;  2JMW A;  1Z77 A;  2MGQ A;  3BR3 A;  3SDG A;  1W0T A;  1QVT A;  4A3J J;  3E7L A;  1E3O C;  2R5Z B;  5IOZ A;  3BR1 A;  3BR5 A;  1RR7 A;  1POG A;  3DCF A;  1UG2 A;  5IYD J;  1JJ8 C;  1JGG A;  3B6C A;  2Y30 A;  2XB5 A;  1RET A;  4AUX A;  2ID3 A;  1JUP A;  5E3M A;  3GTO J;  4V2F A;  1IGN A;  3Q0U A;  1FTZ A;  5EF6 A;  4DYC A;  4FIS A;  1IG7 A;  1XC5 A;  3S17 J;  2L7Z A;  4C3H J;  4AYB N;  2K9Q A;  3A01 B;  2O7O A;  1X2N A;  3VPR A;  4Y7N J;  3HOX J;  3JRH A;  2Y31 A;  2OF7 A;  2W48 A;  2GM4 A;  1MBE A;  1WI3 A;  5EZH A;  1IDY A;  5J1Y A;  2L7M P;  4MIM A;  2GLO A;  3GTL J;  5GPA A;  4UUS B;  1H8A C;  4A3G J;  3HGY A;  1HDP A;  5FKL A;  4A69 C;  2ME0 A;  2P81 A;  1I3Q J;  1JTX A;  4S0H B;  2XSD C;  4I76 A;  1D5Y A;  1NK3 P;  4M6V A;  3ZQG A;  5EGO B;  3NAR A;  2JA5 J;  2EZK A;  4ABZ A;  2LR8 A;  3CCY A;  1AKH A;  3CMY A;  1JKQ C;  5IP7 J;  5F1J A;  3ZQC A;  1GUU A;  1P7I A;  1U9O A;  2EZL A;  3LSG A;  1PUF B;  1JKO C;  4NDL A;  3G1O A;  3M3Y J;  3D1N I;  5M3M J;  2L0K A;  3HOW J;  3Q3S A;  2VKV A;  3A02 A;  2NS7 A;  1TC3 C;  5FKK A;  3OSG A;  1I6H J;  5J1U A;  1F43 A;  1MH4 A;  3MKL A;  3O8H A;  1U9N A;  5E3O A;  4M3F A;  2LTP A;  2Y9Z A;  2JA6 J;  2HOA A;  2DA4 A;  1ITY A;  4M3E A;  2M9H A;  4A3L J;  3A01 A;  3Q0V A;  3S1M J;  2COB A;  3G1M A;  4J19 A;  1OCP A;  3ZQI A;  1NK2 P;  3S1Q J;  1T56 A;  2K40 A;  1R9T J;  3RZD J;  2DJN A;  1JUM A;  2HXO A;  3HOZ J;  3TW6 A;  5E3N A;  4QTR A;  1B72 A;  5F0H A;  4IEJ A;  1JT6 A;  5C4J J;  3BT9 A;  3I4N J;  5F08 A;  2IEK A;  2YUS A;  3HDD A;  2LKX A;  1WPK A;  4UUS A;  1ETY A;  4D5C A;  1MSE C;  2GBY A;  3S1R J;  1ETW A;  4RBO A;  1LE8 B;  1CQT A;  1OJL A;  5IOY A;  1HF0 A;  2AO9 A;  1ZK8 A;  4M3B A;  3OOU A;  2WB1 N;  5EGO A;  2VKE A;  5EG0 A;  2XPV A;  3JRG A;  5FKO A;  4DZJ A;  3PO3 J;  2EBI A;  1ETO A;  5EDN A;  1AU7 A;  1TWF J;  1X2M A;  4BY7 J;  3O8G A;  2IAI A;  5C3E J;  1ENH A;  3BTI A;  4A3E J;  3BG9 A;  3HOU J;  3MN2 A;  1MNM C;  4B1R A;  3GBG A;  2XPW A;  4D5F A;  1AHD P;  3HGG A;  1ZGW A;  5EEA A;  4G12 A;  4JX4 A;  2X6O A;  2R5Y B;  2DMP A;  1TWC J;  1RKW A;  3BTJ A;  4QSH A;  2MSY A;  2H8R A;  2DA6 A;  2FX0 A;  1IDZ A;  1Y1W J;  4GFB A;  2Y2Z A;  4BKX A;  2E2J J;  4W1U A;  3QQA A;  4D7M A;  5K7H A;  3GTM J;  4BBS J;  2L7F P;  3BQY A;  4JYK A;  5F04 A;  2NS8 A;  2K9S A;  1APL C;  1XG1 A;  2O8K A;  1VND A;  1LFU P;  1A5J A;  1TWA J;  2Y9Y A;  9ANT A;  1ORK A;  5E3L A;  2WV1 A;  2FJ1 A;  2M0C A;  4XRS A;  5C4X J;  1MBF A;  2R0Q C;  3PO2 J;  2DA3 A;  2RAE A;  1U78 A;  1FIA A;  4XK4 A;  3UKG A;  3JR9 A;  3NAU A;  3FK6 A;  3JRE A;  3Q0W A;  2DA5 A;  2K9N A;  5IYC J;  4I6Z A;  1RKT A;  1XS9 A;  1LE8 A;  3C2B A;  2LD5 A;  1VF9 A;  4B4C A;  5K7Z A;  3RKQ A;  1B8I B;  2WAQ N;  5FJ8 J;  1MBG A;  4X6A J;  2ZB9 A;  4DYQ A;  1IV6 A;  3QPS A;  3TP0 A;  5GPC A;  4QIW N;  1T33 A;  1YRN A;  1FIP A;  3ZQH A;  2NVX J;  1K83 J;  1UMQ A;  5JLX A;  5EYR A;  2AHQ A;  1QRY A;  3FK7 A;  2JWT A;  1MBH A;  4IHV A;  1ZKG A;  2DTZ A;  5JLW A;  1JKR C;  4C3J J;  1P7J A;  3L1P A;  1MBJ A;  2XB0 X;  5M3F J;  2R5Z A;  2EZI A;  4MO7 A;  3K2A A;  2XGE A;  3BR0 A;  2N8G A;  5FKM A;  2XGC A;  1DU6 A;  2DN0 A;  3CQZ J;  1HLV A;  4BY1 J;  2TRT A;  3JRA A;  1JJ6 C;  3BG5 A;  1H89 C;  1ZQ3 P;  4EEF G;  4B3A A;  2E2I J;  1O4X A;  3HKZ N;  4UUT A;  1JT0 A;  2CRG A;  3RZO J;  4XRS G;  2R92 J;  2ELK A;  3ZQF A;  2R93 J;  5FKN A;  2DA1 A;  1BJZ A;  3LNQ A;  2MW8 A;  5GP9 A;  5M5Y J;  3S1N J;  3DEW A;  3BR2 A;  4AC0 A;  1SFO J;  2DA7 A;  3I4M J;  3TED A;  2X9D A;  2OPT A;  1VI0 A;  2HDD A;  1Y1V J;  3FIS A;  1WCM J;  1OFC X;  2G0E A;  1B8I A;  3TW7 A;  1IRZ A;  3QPL A;  4BBR J;  1ZR2 A;  1OCT C;  3S2D J;  1HCR A;  3OSF A;  4A3B J;  1ETV A;  1BW5 A;  2CQQ A;  2CUE A;  3IH3 A;  2NVT J;  4A3K J;  1Z0X A;  2VI6 A;  3IV5 A;  3IH4 A;  5K7F A;  1W0U A;  2DMU A;  5FLV A;  3M4O J;  2CJJ A;  1X58 A;  4JX6 A;  3H3V K;  1PUF A;  4A3C J;  1UHS A;  4C2M J;  1JUS A;  2EH3 A;  5J3L A;  4JX5 A;  3TP3 A;  2M8G X;  3GTJ J;  5EZG A;  2E19 A;  1WH5 A;  4D7N A;  2DMQ A;  4MLO A;  4CYC B;  5M5W J;  4A93 J;  2XGD A;  3SFI A;  5F0F A;  3ZQL A;  3MVP A;  4A3F J;  1BL0 A;  1JKP C;  3BTC A;  4XID A;  2O9L A;  2KDZ A;  3BQZ A;  3WHC A;  3SJM A;  1ETX A;  5IP6 A;  1WH7 A;  2CU7 A;  5FLM J;  3LSR A;  3OIO A;  5BNG A;  2JK3 A;  3HEF A;  2FD5 A;  3LSJ A;  1K61 A;  3FKI J;  3HB9 A;  1VFC A;  5M5X J;  5HOD A;  4HNV A;  2HQ5 A;  4LOC A;  5DS9 A;  1GV5 A;  2CQX A;  1MH3 A;  2ECC A;  4FE7 A;  3B6A A;  4MFE A;  4XRM A;  1QPI A;  2M2E A;  2LY9 A;  4FE4 A;  4XIC A;  2EZH A;  1SAN A;  1MSF C;  2Y0S N;  4M3G A;  4A3D J;  1LFB A;  2HXI A;  2R7Z J;  2D5V A;  1GVD A;  4C3I J;  2LLK A;  3HOY J;  2X48 A;  2LP0 A;  4MFD A;  4RDU A;  1TWH J;  3S16 J;  1GV2 A;  2H1K A;  3CDL A;  1I50 J;  4IHW A;  2ECB A; 
#chains in the Genus database with same CATH topology
 2ZC2 A;  3OIP A;  2WC2 A;  2CV1 A;  3J7A O;  3ZN1 A;  4ZTF A;  4IHY A;  3K69 A;  3GYH X;  2PMZ N;  2DMN A;  4A3I J;  1OYI A;  3BJA A;  4XNF A;  1EJ9 A;  3ZQ7 A;  5KAI C;  1I3A A;  3EUH C;  2VQG A;  4CYC A;  4CSW A;  1LNW A;  1IN6 A;  3FIW A;  2EV6 A;  2FQ3 A;  1ZH5 A;  4ENJ A;  1FLI A;  5EG0 B;  4KNY A;  1IN7 A;  2JA8 J;  3KEO A;  3PNY A;  4JOM A;  2KIM A;  3TDU C;  4I0B A;  3HOV J;  1SFK A;  3H0G J;  3REO A;  1SD5 A;  2VN2 A;  4D0P A;  5K1Y A;  4X0G A;  4IQ4 A;  1H88 C;  3WTT C;  1G2H A;  1S5L C;  2R7R A;  2VXZ A;  3K1P A;  1YHQ I;  4DW6 A;  3GTP J;  2KRH A;  1DDN A;  2HWV A;  4AIH A;  3F0C A;  3OYM A;  1T39 A;  2VOO A;  1JTY A;  2DOD A;  5FRO A;  2RC4 A;  5FFZ A;  4KDP A;  4BXX J;  4V19 K;  3FDY A;  4L5J A;  4CZZ A;  3KP7 A;  2DA2 A;  3QYE A;  2V1N A;  4KUM A;  1X1A A;  2FBK A;  5DV5 A;  1IUF A;  1JGS A;  4OIN F;  2E60 A;  4U88 A;  2B0L A;  4RAY A;  2O61 A;  4PFP A;  1Y6I A;  1FPQ A;  3PSI A;  2KJB A;  1IN8 A;  2QZ8 A;  3SZP A;  4OMZ A;  1EF4 A;  2JVG A;  2MD5 A;  5KK1 A;  5HLT A;  1HW5 A;  4OOI A;  4M3D A;  1I1S A;  2DK5 A;  2FNA A;  4P9U A;  4V2G A;  5D4S A;  3I71 A;  5CQE A;  1GT0 C;  2DYR H;  1UZC A;  1C0W A;  1SVM A;  1QZY A;  2LRD A;  2M8E A;  3GTG J;  2JN6 A;  2W25 A;  2E2H J;  1QZZ A;  2CMP A;  2NOG A;  3RQI A;  3HTU A;  3L2W A;  3Q9V A;  4NQW A;  3TGN A;  3P9I A;  1IRF A;  5KCM A;  3LA2 A;  4Y52 J;  2XAS A;  4IJA A;  3PQK A;  3E6B A;  1W7P A;  1RPW A;  1XDS A;  2HOT A;  4ENK A;  5DCF A;  2DLL A;  4RB2 C;  5DTD A;  4AVZ A;  1MNE A;  1ETK A;  4F52 A;  4L9J A;  4AM3 A;  4IHX A;  2R7S A;  1T0F C;  2KZG A;  4FCY A;  4FET A;  1KA8 A;  2L5Q A;  4ESF A;  3K7A J;  1RIO H;  2HTS A;  3KYD B;  1HC8 A;  1YW7 A;  1YRN B;  3QWL A;  4XLF A;  4F55 A;  5C44 J;  1TQP A;  3IRQ A;  2LY1 A;  2WAQ A;  1T08 B;  2K3P A;  2GOM A;  3OMY A;  1OCZ H;  3P7N A;  1W0T A;  3KFW X;  1QVT A;  3CC2 I;  3BR5 A;  1RR7 A;  2IGN A;  1L0O C;  3K2Z A;  5J6X A;  1UG2 A;  2BVM A;  1O3R A;  2ID3 A;  4IL6 C;  2VJI A;  2HVR A;  4V2F A;  3Q0U A;  5EF6 A;  3JSO A;  2DCE A;  3HYI A;  5CVJ A;  1B4A A;  3COA C;  4B48 A;  4S05 A;  3WU1 B;  3KE2 A;  1X2N A;  3VPR A;  4WCG A;  1LJ9 A;  2XAF A;  4G94 A;  4M9Z A;  4PK4 A;  4BAC A;  3JRH A;  3J80 Z;  2Y31 A;  2LF8 A;  2DQL A;  1PDN C;  3GX4 X;  1ON2 A;  3TDZ C;  4EAT A;  3CF5 F;  4A6E A;  2LNB A;  3P9K A;  2VJ5 A;  1IDY A;  2QBY B;  2YU3 A;  1Y8Q B;  2RQP A;  4HF0 A;  4PJM A;  5GPA A;  3GTL J;  4M71 A;  3ZCO A;  3HRM A;  4OIR F;  1HDP A;  3LA3 A;  2C6Y A;  4Z6Y A;  4B09 A;  2E71 A;  3AG1 H;  3QPT A;  4BEH A;  2PI0 A;  1D5Y A;  3W2W A;  4M6V A;  1ZG1 A;  1SVL A;  1YIO A;  1TT0 A;  2EZK A;  3JCU C;  2P0W A;  2RV8 A;  5LFA A;  1ON1 A;  3CCY A;  1AKH A;  3CMY A;  3X2Q H;  2UUZ A;  3ZQC A;  1W1W E;  2ESH A;  1Y39 A;  2VBW A;  3VYR B;  2IS6 A;  1U9O A;  2CW0 F;  2WB1 A;  1E3H A;  4NDL A;  4ZYG A;  1OCC H;  2PG4 A;  4IRI A;  2XRN A;  2QWW A;  3SZT A;  3Q3S A;  2BHY A;  3V8K A;  2VKV A;  4HQM A;  5F64 A;  2ZJR F;  4KT6 A;  1WJA A;  2NS7 A;  2Y0M A;  1WFX A;  1XX5 A;  2JSC A;  3E0J B;  4CCL A;  2O3F A;  1U9N A;  3EET A;  4B44 A;  2QEN A;  3KZI C;  3E6C C;  2DA4 A;  1HKS A;  1ITY A;  2Z2S B;  3KP4 A;  2O8X A;  1ZG3 A;  3DLL F;  4A0Z A;  1VQP I;  4HA8 A;  2E1N A;  3G4S I;  4J19 A;  1OCP A;  3UR3 C;  3ZQI A;  2PLY A;  2QQ8 A;  3S1Q J;  2I5U A;  2DI3 A;  4GCV A;  2COM A;  1KU2 A;  4WXD A;  3PIO F;  2DJN A;  4CCJ A;  3RSN A;  5F0H A;  3M7G A;  3MCZ A;  4TV7 A;  4IEJ A;  3CUQ C;  1Z1D A;  1JT6 A;  2K86 A;  2M87 A;  2D1V A;  2M3A A;  3KLO A;  4P55 A;  3EPZ A;  3K1M A;  3S1R J;  1YJ9 I;  2DW4 A;  4GDF A;  1LE8 B;  1CQT A;  1ZK8 A;  2A5Y B;  4HF2 A;  5EG0 A;  2XPV A;  2WY7 Q;  5FKO A;  3A4C A;  3PO3 J;  2W85 A;  2EBI A;  4L0Z B;  4QLC U;  4BY7 J;  4AWX B;  5HDK A;  3BTI A;  1BM9 A;  3BG9 A;  2DOA A;  3KZY A;  1RI7 A;  2DDB A;  3WTS C;  1USS A;  3K0L A;  2XF5 A;  2KHM A;  2KJC A;  4LIT A;  3OYC A;  2PX9 A;  2M45 A;  4D5F A;  1IAW A;  1ZGW A;  4LK0 F;  3B73 A;  4WWC A;  2I8D A;  2R5Y B;  2DMP A;  5E17 F;  3KP6 A;  2L01 A;  2HQR A;  3G71 I;  5BPD A;  1P4W A;  2MSY A;  2H8R A;  4CUG A;  3DWL E;  4MGR A;  3HSF A;  3C7J A;  4LLG F;  4HRI A;  3WGH A;  4JYK A;  3LAJ A;  1WKM A;  2WAD A;  3BZ6 A;  5B1A H;  1G8X A;  2JTV A;  1IXS B;  3IP4 B;  4ZZL A;  3K4N A;  1VND A;  2O8K A;  5E8G A;  4PFO A;  1QQI A;  1IZ1 A;  2BVL A;  2NAZ A;  1TWA J;  3PQJ A;  4HW0 A;  2Y9Y A;  5GTH C;  9ANT A;  3MD2 A;  5E3L A;  1NHA A;  1UG0 A;  3M9A A;  2FJ1 A;  2M0C A;  4XRS A;  3BJO A;  1QHH D;  1Z21 A;  2Y69 H;  2R0Q C;  4XK4 A;  2L4M A;  4BNC A;  3UKG A;  1U5T B;  2BY0 A;  2BW3 A;  3WE2 A;  3JRE A;  2KZV A;  3CDI A;  1LDJ A;  2BOL A;  2F5F A;  4OWR B;  2WTE A;  1XS9 A;  1VF9 A;  4UVB A;  5K7Z A;  1E17 A;  2R7T A;  2JPC A;  2AQE A;  3RKQ A;  4A5N A;  4X6A J;  2WAQ N;  2ZBK A;  2FU4 A;  5JVG F;  1R5G A;  3ELK A;  4DYQ A;  1IV6 A;  2NRA C;  2EB7 A;  2IRF G;  2GAU A;  1YRN A;  4U0Y A;  1A04 A;  2HZT A;  1O7L A;  1K83 J;  5JLX A;  2V9V A;  2AHQ A;  4E70 A;  2KP6 A;  1ZKG A;  2HVQ A;  3HHH A;  5JLW A;  4RGR A;  3RJP A;  4CYD A;  3PL8 A;  5HDN A;  4NBQ A;  1ZYR F;  3KEY A;  2XGC A;  3GUD A;  4XON A;  4EGY A;  1DU6 A;  2DN0 A;  5CLS A;  4YG2 F;  3FM3 A;  3S32 A;  4B3A A;  5JHU A;  3H36 A;  2CYY A;  1Z3Y A;  1QGP A;  3JTG A;  2UZK A;  3LSH A;  3OIQ A;  3ZQF A;  3PFY A;  1BOA A;  3I64 A;  4L9T A;  4RB3 C;  2M7B A;  3DXJ F;  2AQF A;  3I0T A;  5GP9 A;  4DBQ A;  1VQ7 I;  1FZP B;  2F5V A;  3ZXS A;  3GZ6 A;  4E7L A;  1EKE A;  2K9M A;  5J8C A;  1ERD A;  2V1X A;  2X9D A;  1WJB A;  1VI0 A;  2KIS A;  3F72 A;  2XAG A;  3KIO A;  2ZFU A;  1HXD A;  1OFC X;  1WCM J;  2G0E A;  4I0A A;  1KON A;  3CCM I;  4F92 B;  1ZR2 A;  4B47 A;  4WXC A;  1HCR A;  3FXK A;  3OSF A;  4Y13 A;  2JRT A;  3U1K A;  3AL0 C;  2CUE A;  2UXN A;  3HC7 A;  3GLX A;  4A3K J;  3WU2 C;  4PJ0 C;  5DM7 F;  3IV5 A;  2CWE A;  1XGN A;  2MA3 A;  2DMU A;  3IH4 A;  5FLV A;  2EIJ H;  4LMY A;  5E20 A;  4WX9 A;  4KFC A;  1DPR A;  2DTR A;  1VQN I;  3H3V K;  1OYY A;  4A3C J;  2BE5 F;  3KEQ A;  1R00 A;  2R7F A;  4C2M J;  4M74 A;  2ISZ A;  1FMW A;  2VBZ A;  2GOX B;  3J80 K;  3ASN H;  3BCB A;  4BDY A;  2HPI A;  2Z99 A;  4D7N A;  4CYC B;  4IXA A;  3OL4 A;  1YG2 A;  2XGD A;  3SFI A;  4EVI A;  4UV8 A;  4G7H F;  3FXL A;  4UY8 I;  2PMZ A;  5F0F A;  3F8B A;  2EIN H;  3JSP A;  3MVP A;  5DM6 F;  4A3F J;  3Q5F A;  1JKP C;  1Z3X A;  3W2V A;  3CCU I;  4J00 A;  4GGG A;  4Y17 A;  2OZ6 A;  1K4T A;  2O9L A;  1WZ2 A;  3WHC A;  3SEZ A;  5IP6 A;  1WH7 A;  1G3S A;  3LSR A;  1YJW I;  5E1X A;  1B1B A;  2IPQ X;  2V4J C;  5BNG A;  3OYA A;  2JK3 A;  1MJ9 A;  2KL4 A;  1Z91 A;  2HYG D;  2OTL I;  4A12 A;  4O6J A;  4BQA A;  4BS9 A;  1YO5 C;  5HOD A;  1UEL B;  2DFI A;  1BJA A;  2LH9 A;  1R36 A;  3S93 A;  1MH3 A;  2ECC A;  5TIS C;  3I5U A;  2IA2 A;  4B43 A;  1STZ A;  4MFE A;  1QPI A;  1D3Y A;  5CQG A;  1V3F A;  1Z6T A;  4HV6 A;  5FFX A;  3CO7 C;  5IY5 H;  1SAN A;  4M3G A;  1LFB A;  1LUJ B;  4Y15 A;  4HX4 A;  3RPU A;  4OMY A;  3HOY J;  2X48 A;  3DU5 A;  4OU0 A;  5ILU A;  3CF2 A;  2QVO A;  1TWH J;  4RDU A;  2H1K A;  1ZRC A;  2MH9 A;  2A6E F;  2Q1Z B;  5DYM A;  1TWF J;  1S7E A;  2QKL B;  1B72 B;  3WTZ A;  3J7Z I;  4I99 C;  2BHZ A;  5IYB J;  1ZGA A;  4KIT B;  1MMS A;  4CGZ A;  3JRC A;  2CUJ A;  1W7P B;  2R5Y A;  1FSH A;  5HS8 A;  3OL3 A;  2VC1 A;  2QF7 A;  2M34 A;  4ZDP A;  4M73 A;  3T5X A;  1R71 A;  3CTA A;  4O5V A;  2Q8K A;  4RLQ A;  4Z2Y A;  1E3P A;  4P9F A;  3F8M A;  4YFN F;  1GDT A;  4XQF A;  1QA6 A;  2JQ7 A;  2GA2 A;  3U21 A;  1FJL A;  5LHH A;  2JA7 J;  2JJ7 A;  2L7K A;  3BCA A;  5D6E A;  1F36 A;  3HOS A;  1FOW A;  1G4D A;  4XSX F;  2KT0 A;  1LVK A;  1YOV B;  4XKW A;  1D5V A;  4AIK A;  1Z7U A;  1ETQ A;  2TCT A;  2XPU A;  1ZLK A;  4PJJ A;  2FQ4 A;  4YFK F;  4E7H A;  1YIT I;  5IPA A;  4EM0 B;  3OYL A;  1I27 A;  2MH2 A;  4M6Y A;  1XPX A;  1FBQ A;  2UV1 A;  4ETS A;  3AG2 H;  1RES A;  2CH0 A;  2L02 A;  2QLZ A;  5ED4 A;  4U0W A;  5FLX K;  4XOR A;  5B5E C;  4HNT A;  3L09 A;  3J81 K;  4JP0 A;  4IOA F;  2IBD A;  3G3Z A;  1U5T C;  5LHI A;  2L4A A;  2IJL A;  3K6G A;  1TW2 A;  1FOX A;  4RS8 A;  1OR7 A;  2L9N A;  3FHN A;  2KRF A;  3ISP A;  2E1O A;  2EA4 A;  4EV0 A;  1HBX G;  3QP5 A;  1K4S A;  3W6V A;  3HJE A;  1X1B A;  3JRI A;  1EH7 A;  5CVV A;  3CO6 C;  1AWC A;  2Z16 A;  3CES A;  4PJN A;  5J1R A;  2BY1 A;  3I58 A;  4F3Q A;  1XGS A;  1MW7 A;  2YS9 A;  4NUB A;  3GFJ A;  2EFW A;  4DNC A;  2ZNY A;  1I1G A;  1D1B A;  3DEE A;  1AKH B;  3ZOB A;  4CCM A;  4I98 B;  2A69 F;  1LQ1 A;  2X6X A;  3AFH A;  3SDG A;  1A31 A;  1F4K A;  2Z5U A;  4A3J J;  3QOP A;  1E3O C;  3OR1 C;  2PJR A;  3QOE A;  4JBA A;  3JAM K;  2XDV A;  3R61 A;  1JGG A;  3C18 A;  4EJO A;  4G9Y A;  4E4H A;  4WXH A;  4D1Q A;  1RET A;  3VDX A;  5E8I A;  4AUX A;  3CUO A;  1TW3 A;  1JUP A;  5E3M A;  5LBQ A;  1YIJ I;  1IGN A;  1FTZ A;  2F48 A;  3BJ6 A;  4FIS A;  1IG7 A;  2FA5 A;  3S17 J;  1XMK A;  3W6K B;  1YW9 A;  1SAU A;  4M9S A;  2L7Z A;  4C3H J;  4BHP A;  4EJT A;  1BOB A;  1Y56 A;  2NOJ B;  4BQO A;  3PNV A;  4Y7N J;  4R1H A;  2CV2 A;  3T8T A;  2STW A;  3ECH A;  1Y8R B;  4EQQ A;  3PIP F;  1WI3 A;  5EZH A;  4CH7 A;  4ITV A;  4BAY A;  2W7N A;  3CP2 A;  1TP4 A;  2KRC A;  1VQ8 I;  2E1M C;  3KZZ A;  4YIF A;  2IS2 A;  1G3W A;  1H8A C;  2FOK A;  3QPH A;  4U87 A;  1KU3 A;  3ZMS A;  2NXN B;  5FKL A;  4A69 C;  2ME0 A;  1X3W B;  1I3Q J;  1JTX A;  3DLA A;  1WWX A;  1TT5 B;  1K7A A;  1XTA A;  1UFM A;  1FMV A;  2OQG A;  5CVU A;  3EUA A;  3FF5 A;  4A0X A;  1SFX A;  1DGW Y;  5IP7 J;  4R8H A;  3CCV I;  1P7I A;  4HYE A;  2EZL A;  2A6H F;  1PUF B;  1JKO C;  4HNU A;  3G1O A;  1WJE A;  2J5O A;  3WTV C;  3D1N I;  4JQF A;  2IS1 A;  3HOW J;  4KJZ A;  4KIG A;  4XOT A;  1Z67 A;  2M4K A;  3O3K A;  1I6H J;  1S7A A;  3H92 A;  5FRN A;  5J1U A;  4YII A;  2QEX I;  3MKL A;  3O8H A;  5E3O A;  4M3F A;  4HOB A;  1XGO A;  2MBF A;  2HKX A;  1KYZ A;  1RC9 A;  1AOY A;  3A01 A;  2BGC A;  1ZRF A;  4PZJ A;  3S1M J;  2COB A;  4XL9 A;  3RTR A;  1NK2 P;  2BY2 A;  3E3V A;  1T56 A;  2K40 A;  3F6V A;  4NNJ A;  2P5K A;  4XM3 A;  2DOF A;  3MZH A;  2HXO A;  4QTR A;  2L54 A;  1S9H A;  1N25 A;  3K10 A;  1B72 A;  4KIF A;  5EEH A;  2DT5 A;  5C4J J;  3BT9 A;  4BHB A;  3I4N J;  1R1U A;  2IEK A;  2YUS A;  3HDD A;  2KQR A;  1WPK A;  2VIX A;  1VQM I;  4IVN A;  2R7X A;  1ETY A;  4IKF A;  3MWM A;  1FOY A;  4HPQ A;  2BW3 B;  4E7Z A;  1SMT A;  2WA0 A;  2JT1 A;  2F4I A;  4MNU A;  1OJL A;  4M3B A;  3CC4 I;  1R7J A;  3DTI A;  5JI6 A;  2W84 A;  2RNJ A;  3A0B C;  1WJF A;  5EGO A;  2VKE A;  3MEX A;  2O03 A;  3JRG A;  1R1T A;  3I9V 2;  1EH6 A;  3FMS A;  3ZPL A;  5EDN A;  3O2P E;  2K85 A;  3BWG A;  4M9X A;  4L0Y B;  1AU7 A;  5L3B A;  3V8J A;  1HQC A;  5C3E J;  1WHU A;  3FZV A;  5H20 A;  1JI8 A;  4A3E J;  1ZLJ A;  3TKY A;  3HOU J;  2OJE D;  1YLF A;  4GYG A;  3DU6 A;  2DQR A;  3GBG A;  4B1R A;  1HW2 A;  4B3X A;  3LFU A;  1AHD P;  3BG7 A;  3VYT B;  4JX4 A;  2OUM A;  4P5O A;  2VKH A;  1KQ9 A;  4HBL A;  2HR3 A;  1BC7 C;  1IDZ A;  4FX0 A;  5ILV A;  3S3N A;  4L5I A;  3SQN A;  1VQ4 I;  3NRV A;  2Y2Z A;  3K4M A;  4BKX A;  1FP2 A;  3ESW B;  2E2J J;  2XAH A;  3MZ8 A;  3QQA A;  2LKP A;  4D7M A;  1S6L A;  3R0A A;  3SHF A;  5J4Y A;  5E1W A;  2V1U A;  5F04 A;  5CKT A;  4RAF A;  1APL C;  1PP7 U;  1XCV A;  2H6B A;  1HKQ A;  2ZJQ F;  1UST A;  1ORK A;  4FQG A;  1H0M A;  3E5X A;  2WV1 A;  1N75 A;  1MMG A;  3ERE D;  5C4X J;  4LG3 A;  1MBF A;  1YX5 A;  2FBI A;  2RAE A;  3R0J A;  1U78 A;  3H9Q A;  1IV8 A;  2K4B A;  3Q0W A;  2IW5 A;  3FHZ A;  2DA5 A;  2K9N A;  4IF4 A;  1XD7 A;  1RKT A;  2LD5 A;  4B4C A;  2GIZ A;  1DUX C;  2JRM A;  2X6Y A;  4UB6 C;  1ONV A;  2ZB9 A;  4BJT A;  2FMY A;  3QPS A;  3TP0 A;  5D5V B;  3LQR A;  1T33 A;  2PFB A;  3ZQH A;  2F5C A;  2NVX J;  3F3X A;  3FK7 A;  1MBH A;  4C3J J;  2VBX A;  3K4B A;  3L1P A;  2ELJ A;  1YTY A;  5M3F J;  1PYV A;  4YEL A;  2LMD A;  3SDB A;  2WV0 A;  3TQN A;  3FKJ A;  5DCM B;  3FXO A;  2DT6 A;  4B8X A;  3K2A A;  2EIL H;  3BR0 A;  5LRR A;  2N8G A;  2GXG A;  4U0V A;  3AKZ A;  5DDG A;  3PUF A;  3CQZ J;  3E6M A;  1R23 A;  2TRT A;  1JJ6 C;  2QSH X;  4UUV A;  3D5L A;  2Z1D A;  3LAP A;  1BBY A;  1A6Q A;  2KFD A;  3GFM A;  1MD0 A;  3F6O A;  1O3S A;  1S3J A;  4EJW A;  4E7I A;  1SFE A;  2IP2 A;  4DOZ A;  1NH3 A;  3OYD A;  1YS6 A;  2IA1 A;  1BJZ A;  1B59 A;  1OLT A;  4ZYE A;  3HOT A;  2HDW A;  1P6R A;  2F4O B;  5GAD J;  5KHD A;  3VEP A;  2IGK A;  3F8C A;  1SFO J;  3DFG A;  3QU3 A;  5EEG A;  1K78 A;  1DP7 P;  2V9P A;  3TED A;  4II2 A;  2HDD A;  2BEO A;  3FIS A;  1RUO A;  1TNT A;  3WTX C;  1SC7 A;  3UNG C;  2XVC A;  3CCJ I;  1XDU A;  3IRR A;  3QPL A;  4BBR J;  2EK5 A;  3GME A;  2QUF A;  4S04 A;  3S2D J;  1YI2 I;  3AG4 H;  3PSF A;  3DF8 A;  3F23 A;  2CQ7 A;  1DP3 A;  3SXY A;  4DBR A;  1ACI A;  1ETV A;  3ZMV A;  3IH3 A;  4KN7 X;  2NVT J;  1MND A;  2QYO A;  2VQC A;  4GRI A;  5K7F A;  3ECO A;  4AYB A;  3H1C A;  2JA2 A;  3MAJ A;  4JX6 A;  1X58 A;  4ZH4 F;  4N0B A;  1PUF A;  3I54 A;  1FYK A;  2HVS A;  2VC0 A;  2BZT A;  2EJR A;  4HZF A;  2EIM H;  4JX5 A;  3TP3 A;  5EZG A;  5D5U B;  4A93 J;  5LLQ A;  1Z9C A;  3V8L A;  3N97 A;  5FLX Z;  3J81 Z;  2NS0 A;  2XKO A;  3ABM H;  1VQL I;  3ZQL A;  1MDM A;  1P4X A;  2FUG 2;  4Q5S F;  4F91 B;  2X6W A;  2ZSI B;  2VKD A;  3BG6 A;  3H9J A;  4EMS A;  5JHF A;  4HDV A;  1YE9 A;  4QPO A;  1Q1H A;  4QWQ A;  2XKP A;  5HNF A;  1VQK I;  2VT3 A;  3JTH A;  3TL4 X;  2CU7 A;  2RVC A;  3OIO A;  1OPC A;  3CC7 I;  3HEF A;  3OYE A;  3LSJ A;  1OYW A;  3FKI J;  3HB9 A;  5HS7 A;  3TO6 A;  4CIC A;  1VFC A;  2CV0 A;  5J40 A;  1JHF A;  4HNV A;  3C1D A;  5HS9 A;  3IL2 A;  1UHM A;  2HEO A;  4P96 A;  3FX3 A;  3B6A A;  4MHG A;  3WE3 A;  4NC7 A;  2QSF X;  2K3F A;  5ERI A;  3KP5 A;  5CVI A;  4XIC A;  2EZH A;  3CLQ A;  2YR2 A;  2Y0S N;  3KYL A;  3OYK A;  5LEJ A;  2R7Z J;  2D5V A;  1GVD A;  2LYC A;  3GW2 A;  2ISY A;  2LP0 A;  3I59 B;  1GV2 A;  4HLX A;  4YEJ A;  2CG4 A;  4C9Y A;  3IC7 A;  2ECB A;  1PVE A;  2R7O A;  2Z3Y A;  1JE8 A;  1FTT A;  1QBJ A;  3BR6 A;  3JAM Z;  2JPB A;  1YYV A;  5CPR B;  1ZR4 A;  4IX7 A;  4IO9 F;  1V5E A;  3QOD A;  5IP9 J;  3IUO A;  1E2X A;  4MQ9 F;  3CJQ B;  3TMO A;  2FBH A;  5KNL A;  3E1S A;  2A07 F;  3LFK A;  3IKT A;  4DJA A;  1U8B A;  4HAM A;  2MLK A;  1QHG A;  3Q9S A;  3F8N A;  3ZMZ A;  4F7Z A;  3KPH A;  3HXL A;  3LSP A;  3F22 A;  2HQN A;  2HOS A;  4LJZ F;  2JVH A;  3L2R A;  2O5R A;  2OCC H;  3EQL F;  2H6C A;  1W36 C;  3GO5 A;  3DKX A;  3GFL A;  3DP7 A;  5GAG J;  2DFE A;  2H94 A;  3KYC B;  3QAH A;  2P6T A;  2VOP A;  1G3Y A;  1R4M B;  3ZR8 X;  2PJR B;  2ZME B;  1HDD C;  2KLO A;  2R7U A;  1BR2 A;  2XV4 S;  2H09 A;  2ZXI A;  1BIA A;  3TOB A;  2KIU A;  1MKM A;  2YU9 J;  4A3M J;  4UVC A;  2CW7 A;  1FOK A;  3S14 J;  4CDG A;  1KQ8 A;  4AVP A;  2L9R A;  1W36 D;  1A6I A;  3CP8 A;  4G7Z F;  4DYR A;  2LBF A;  1FYL A;  3BTL A;  4KIC A;  2MC4 A;  3F9K A;  1BIB A;  1J09 A;  2FSW A;  2OV7 A;  5AIP A;  5JVT A;  2DFF A;  3E97 A;  2WAF A;  5FD5 A;  5EJC A;  1QVU A;  1BA5 A;  2FE3 A;  3LOC A;  5E18 F;  1GHC A;  2VQL A;  5GTI C;  3CCS I;  3BG3 A;  1X1D A;  5DCM A;  1K6O A;  2E35 A;  1FBS A;  4UB8 C;  1R4N B;  3KLN A;  5D8K B;  3A2K A;  3HBL A;  3RKX A;  2LVS A;  3SZG A;  4RGS A;  3LSK A;  1L3L A;  2QCO A;  1W5C C;  2M1B A;  3CZ6 A;  4LK1 F;  1J2X A;  5B3S H;  4UNO A;  5DD8 A;  4ESB A;  1BW6 A;  5TGT A;  2CUF A;  2WWY A;  1D0Y A;  1G3T A;  1UB9 A;  2K5C A;  4XSZ F;  2MGQ A;  2FOW A;  4ZC3 A;  3TOA A;  1SAX A;  2A61 A;  2P7C B;  1BI3 A;  3GWZ A;  2R5Z B;  2IXS A;  3BR1 A;  2HPM A;  2BV6 A;  2BBY A;  5IYD J;  1LPQ A;  1JJ8 C;  3BY6 A;  5K5Q A;  4ZZD A;  2XB5 A;  3CCL I;  3H35 A;  2W1O A;  2XAQ A;  4D9J A;  2RGV A;  1D1A A;  1B9N A;  5JR3 A;  3L2V A;  3I55 I;  3GTO J;  1G6N A;  2K27 A;  1IN4 A;  4DYC A;  2ZSH B;  3ZGK A;  3CLO A;  3H5R A;  1UJ8 A;  1A36 A;  5GAH J;  4AYB N;  2K9Q A;  1G59 A;  4I01 A;  3A01 B;  4KIS A;  2O7O A;  1MMN A;  3HRS A;  5AON A;  1S29 A;  5K5R A;  5D8L B;  5DUI A;  1LEB A;  2MFZ A;  2OF7 A;  2W48 A;  5D5X B;  1MGT A;  3BPV A;  2EFO A;  5BQT A;  2OC6 A;  2K7L A;  3EUK L;  4GYI A;  2DJI A;  2L7M P;  3RKW A;  2GLO A;  1XMA A;  4PJL A;  2IA0 A;  1V5F A;  4HEA 2;  1CF7 A;  4A3G J;  1RUN A;  2Z9O A;  2ZXJ A;  3R60 A;  2P81 A;  3FM5 A;  4HLY A;  3EYY A;  4S0H B;  2XSD C;  4N9H A;  1NK3 P;  2KDO A;  3BLY A;  2G7H A;  3ZQG A;  5ICC A;  5EGO B;  1FWZ A;  3OOP A;  5H6Q A;  2JA5 J;  5HLH A;  4ABZ A;  2DYS H;  3HPG A;  3RCO A;  4JK1 X;  4BGD A;  4Q48 A;  3B02 A;  3ULQ B;  3OS1 A;  1Y0U A;  1VZ0 A;  5HLG A;  4IPA A;  3IAS 2;  3LSG A;  3W3C A;  2DT7 B;  2ZCW A;  4A0Y A;  4E7J A;  4ENN A;  2VOD A;  2ZJP F;  1QZE A;  1HA8 A;  4ZTJ A;  3RPU D;  5LGN A;  4K2E A;  3ZN0 A;  2L0K A;  3U1D A;  5HDG A;  3TO7 A;  4MEY F;  2P7V B;  3A02 A;  3MMY B;  5HNH A;  1VQ6 I;  3K4J A;  5FKK A;  1PUE E;  1F43 A;  1ODD A;  2B7E A;  2W82 A;  2QM3 A;  1FP1 D;  3CD6 I;  4M3E A;  2M9H A;  2ACJ A;  5D6F A;  1Z6R A;  2FXA A;  3I59 A;  2PMU A;  5L3F A;  1IXR C;  1R9T J;  1B6A A;  1OMI A;  1JUM A;  5E3N A;  3BZK A;  3AAF A;  4H0E A;  3CCE I;  2V1D A;  4A6D A;  3R4K A;  5F08 A;  1U6G A;  4GXO A;  2AS5 F;  4UUS A;  3GZN B;  2Q2E B;  1X4O A;  2QKM B;  1WJC A;  3M1C A;  4CXF A;  1MSE C;  5A2Q K;  2XC7 A;  4BU2 A;  1FYM A;  3LSM A;  1TQI A;  3DKY A;  2D45 A;  1UCR A;  5IOY A;  1HF0 A;  1IRX A;  3OOU A;  3QU6 A;  4UVA A;  1D8J A;  3GZ5 A;  3L00 A;  2ELH A;  3V7C A;  3CJT B;  3BZC A;  3VFZ A;  1OR7 C;  4ASN A;  2E34 A;  1D8K A;  1FBU A;  2OBP A;  4XLC A;  3IHU A;  3L2C A;  1X2M A;  2IAI A;  1ENH A;  1X3U A;  2GA1 A;  2HGC A;  3H3Z A;  3OYF A;  4HQE A;  3QYF A;  2G7U A;  2E7W A;  2X85 A;  5DD4 A;  4LIU A;  2XAU A;  3QP6 A;  3C3W A;  2XPW A;  2X0L A;  2LY2 A;  3FMR A;  3OY9 A;  2ZME A;  4G12 A;  2W57 A;  5FRM A;  3HUG A;  1ZEL A;  3WG9 A;  1BC8 C;  3BTJ A;  1RKW A;  4QSH A;  1IN5 A;  2EV5 A;  2DA6 A;  2IVM A;  2FX0 A;  5H2F C;  4XRF A;  4XLH A;  4E7S A;  5J4V A;  1O3Q A;  4XN3 A;  4BBS J;  5K7H A;  2GWR A;  5AIQ A;  2V6C A;  3WGI A;  4NB5 A;  2VE8 A;  3WTY C;  1XG1 A;  3SFZ A;  3ZRG A;  2BXZ A;  3DBH B;  3ROU A;  1LFU P;  1WRJ A;  1A5J A;  1XGM A;  2J5P A;  3LST A;  2VPL A;  1H9G A;  3V7R A;  4ZJZ A;  2OCE A;  3QYB A;  2W4S A;  3FWE A;  5F6F A;  4IHT A;  3NAU A;  3RYP A;  2QQ9 A;  3HTS B;  5IYC J;  2EFP A;  3K1N A;  4I6Z A;  1EA3 A;  1K78 B;  2JSP A;  2OU2 A;  3C2B A;  5FD6 A;  2K02 A;  4XLE A;  2VON A;  4M6X A;  2YX4 A;  1MZB A;  4RAG A;  2R3S A;  1MBG A;  3EUH A;  3OS2 A;  1JHH A;  3IAM 2;  5ICF A;  5GPC A;  2K4J A;  3WTU C;  3L7W A;  2GXB A;  4QIW N;  5DUK A;  2K9L A;  3RYR A;  1FIP A;  3MFK A;  1KZH A;  1D1C A;  3HSR A;  1X1P A;  3VOE A;  1F5T A;  1UMQ A;  1RR8 C;  2EIK H;  3I4P A;  5EYR A;  3NWS A;  1QRY A;  2E5Z A;  3P5J A;  2JWT A;  4OIP F;  1FC3 A;  4IHV A;  2M0M A;  3TO9 A;  4WF2 A;  2ESN A;  2F5E A;  1IXC A;  2VXD A;  4RM2 A;  2ZXH A;  2XB0 X;  1J7K A;  5J8F A;  2R5Z A;  4XR6 A;  1Z05 A;  1OIS A;  1IO2 A;  4ZYH A;  3RKY A;  2XF6 A;  4KT5 C;  1ZAO A;  1SMY F;  1GVJ A;  4LB6 B;  4KN4 X;  2XGE A;  1DGR M;  5LRS A;  3ML6 A;  1WQ2 A;  2A3S A;  2B9S A;  3H9G A;  5FKM A;  1K79 A;  1HLV A;  1WJ5 A;  4BY1 J;  1CGP A;  1S7O A;  4IRG A;  4RM3 A;  3JRA A;  1H89 C;  1VQ9 I;  3FBN B;  3BRO A;  1MDM B;  3ASO H;  3M8F A;  4CCK A;  4EEF G;  2W24 A;  1OKR A;  1SFU A;  1O4X A;  2MLG A;  3HKZ N;  4UUT A;  4Y33 A;  4BUP A;  1V55 H;  2STT A;  4Y4R A;  2R93 J;  2Y48 A;  2CFO A;  2EWN A;  3ABU A;  3KP3 A;  5JFR A;  3WOD F;  2MD0 A;  3ZP5 A;  1X4P A;  2DBB A;  3I53 A;  3DEW A;  3MKZ A;  2X51 A;  4AC0 A;  2DA7 A;  4MQV A;  1WI9 A;  3BP8 A;  1YW8 A;  2ZFW A;  2OPT A;  4HST A;  4DGW B;  1Y1V J;  1ZRD A;  3CMM A;  2GIV A;  4EM2 A;  2P8T A;  1GXP A;  1B8I A;  3H0D A;  2YSR A;  1IRZ A;  1V54 H;  3HIF A;  4LIV A;  1I39 A;  1E0E A;  2RQQ A;  1AA7 A;  3H5A A;  1X19 A;  3M8E A;  1YJN I;  3HRT A;  1R5H A;  2DAO A;  5TRD A;  2CQQ A;  3VYU B;  2VT2 A;  4KA4 A;  1T0F A;  4A5M A;  1X3Z B;  3VSL A;  2VI6 A;  3M4O J;  2HOE A;  2CJJ A;  2Y0S A;  5HOO A;  3MKY B;  1JXS A;  1KQ0 A;  1F9N A;  4N4N B;  3U2R A;  2HYF A;  3WGG A;  1ZHF A;  2XF7 A;  3NEU A;  3LA7 A;  3SYT A;  4WK8 F;  2QQA A;  3DEU A;  2HTJ A;  3PNT A;  2DMQ A;  2A05 A;  1FNN A;  2ZKZ A;  4OAZ A;  3PJR A;  2QQB A;  2CO5 A;  2EFN A;  2QA4 I;  3DQV C;  1BL0 A;  2CUZ A;  1QO0 D;  3NWT A;  2A68 F;  3A1Y A;  1O3T A;  3BDD A;  2O6G E;  3BTC A;  4XOP A;  1U3E M;  2QSG X;  1HST A;  5ICG A;  5KAF C;  3BQZ A;  3KX2 A;  3SJM A;  1W7P D;  2BYV E;  5FB2 A;  4IQJ A;  3FXM A;  5FLM J;  3J7Y J;  2X1C A;  1LDD A;  3CDH A;  3HRU A;  4RA2 A;  4C2T A;  2UWM A;  2EV0 A;  2DPU A;  3GLL A;  5M5X J;  1UHW A;  4BJ5 C;  4FT8 A;  1T95 A;  3O6B B;  3DV8 A;  4LOC A;  4XBF A;  1KYW A;  3G73 A;  2Q2E A;  4MEX F;  2R4G A;  3C2H A;  4FE7 A;  1S72 I;  2VBY A;  4OIO F;  4XRM A;  2M2E A;  4HG2 A;  2OD5 A;  2CGP A;  3WG7 H;  1MSF C;  4A3D J;  3G2B A;  2HNH A;  4PGG A;  3LL7 A;  2V6E A;  3KP2 A;  1HSJ A;  2LLK A;  1WVR A;  1EV7 A;  2LBF B;  4HX8 A;  4MFD A;  4U7D A;  3S16 J;  1I50 J;  1S8N A;  2VB6 A;  4HSR A;  2VE9 A;  4IHW A;  2XAJ A;  4CCN A;  3W2A A;  1FY7 A;  4M72 A;  2M5W A;  3AL0 B;  2LC2 A;  3NQO A;  3WU0 A;  4BYY A;  1P92 A;  2AXL A;  2YX7 A;  5CJ9 A;  5F1R A;  4L5E A;  5LHG A;  2MG4 A;  3M8J A;  4N9I A;  1TL8 A;  5J47 A;  5KVR A;  1H9T A;  1FT9 A;  4DZP A;  4YFX F;  2M7A A;  1F1Z A;  2L3D A;  3J7A Y;  4IZZ A;  2I10 A;  4G6T B;  5F27 A;  5TJJ A;  4UV9 A;  2HI3 A;  3JRB A;  2ME6 A;  5L3D A;  2A5W A;  5F0C A;  1SD4 A;  2JZY A;  3GTK J;  3WHB A;  2CQN A;  1LEA A;  5BOX A;  1WGX A;  4AU7 A;  5IT3 A;  1IW7 F;  2ID6 A;  2P6S A;  1IC8 A;  1QNT A;  2R7D A;  5CYV A;  3MZY A;  4R79 A;  3JRF A;  1J59 A;  4LB5 A;  4XN0 A;  2MAB A;  2HYJ A;  2VUM J;  4FTH A;  2YPR A;  1D0Z A;  4AD9 A;  3KCC A;  3K4K A;  4MTD A;  3OS0 A;  4C30 A;  1IJW C;  3FXU A;  1XMX A;  5GAE J;  2DMT A;  1ZTR A;  3FXR A;  5FO5 A;  2R7W A;  3CUQ A;  3V4G A;  1BI1 A;  4PSW A;  2ZNZ A;  3DPU A;  3S2H J;  4UXN A;  4DQ2 A;  1DU0 A;  1T2K A;  3HPH A;  5IT9 K;  4I2O A;  4KMF A;  1Q1V A;  2NNY A;  3K9T A;  5D5W B;  1U8R A;  2GXA A;  3JRD A;  1HOM A;  1XB4 A;  3PM1 A;  1M1E B;  3HZJ A;  4BE2 A;  3AG3 H;  1R5I D;  2V9K A;  1PJR A;  3A03 A;  4LG0 B;  4LLN A;  2XSJ C;  1XSX A;  4P1W A;  2DO7 A;  2VAS A;  3IH2 A;  3K4C A;  3GTQ J;  2LK2 A;  4HV5 A;  4X1E A;  1MMA A;  2B63 J;  4NC6 A;  3LQQ A;  1MBK A;  2VQH A;  1QPM A;  2XRL A;  2JUG A;  1CF7 B;  1TWG J;  2LFB A;  2NVQ J;  2E7X A;  3HM5 A;  1ZRE A;  4W97 A;  4BDZ A;  1BR1 A;  1SEU A;  2RDP A;  2WAE A;  2ZXW H;  3ZMD A;  1NTC A;  1FEX A;  3S15 J;  4G7O F;  4PGH A;  2EQR A;  2NVY J;  4XMY A;  2VPR A;  4LD5 A;  2HU9 A;  3G1L A;  4ENM A;  1I6X A;  1LVA A;  2LDU A;  3RPQ A;  2JMW A;  1Z77 A;  4ESJ A;  4BH9 A;  2JUC A;  3BR3 A;  1EH8 A;  2PBI A;  1DPU A;  4IOC F;  3L2Q A;  1YS7 A;  2FNP A;  2R7Q A;  5BS6 A;  2L2O A;  2ZO4 A;  2IGM A;  3E7L A;  5IOZ A;  3DCF A;  1POG A;  2CSO A;  5A2Q Z;  4L9V A;  1GLN A;  4CCO A;  2VLA A;  5BMZ A;  2LF7 A;  2PN6 A;  3B6C A;  2ADU A;  2Y30 A;  3EDP A;  4I02 A;  5E79 C;  3G6E I;  2Q0O A;  3IWF A;  2H27 A;  2G9W A;  3H3U A;  1R1V A;  3FMQ A;  1XC5 A;  3VWB A;  1W4M A;  1PP8 F;  1OQY A;  2UXX A;  3HOX J;  3VSK A;  2LG4 A;  1T6S A;  3LMM A;  3FBI B;  2GM4 A;  1K6Y A;  1MBE A;  1P4A A;  3MKW B;  5LGT A;  1T38 A;  1OCO H;  5D4R A;  1TBX A;  3DPL C;  5J1Y A;  2HDC A;  1D0X A;  3LSI A;  4MIM A;  3FXJ A;  4XLA A;  4UUS B;  3IWZ A;  1IRG A;  2CQK A;  2KIQ A;  4PDK A;  1LDK B;  3HGY A;  2OQR A;  1SD6 A;  3A0H C;  3DTE A;  3GF2 A;  3ABT A;  5LD2 C;  3FXQ A;  2X1D A;  4RB0 A;  2QGU A;  3D5S C;  4I76 A;  3H5N A;  4F93 B;  1RRJ A;  3NAR A;  3U9G A;  4CO8 A;  2LR8 A;  3L2U A;  4RLF A;  1I5Z A;  4IRH A;  3VOD A;  5HVQ C;  4BE0 A;  4AID A;  1JKQ C;  2X4H A;  1SVO A;  3F8F A;  5F1J A;  2GZW A;  2M30 A;  1GUU A;  4EM1 A;  2Z33 A;  2BXY A;  3VYS B;  2F4M B;  4N4O B;  3OWT A;  1W5T A;  3HHG A;  3PUB A;  3OR2 C;  2D1H A;  4O3M A;  3M3Y J;  5DEQ A;  5M3M J;  1QU3 A;  4CHU A;  1UAA A;  3M07 A;  1VQO I;  3E6D A;  4KIB A;  4ZDO A;  2W00 A;  2MYS A;  2H1L A;  3HUG B;  3V42 A;  1J0R A;  1TC3 C;  3OSG A;  1MIJ A;  4HX7 A;  3RIR A;  1MH4 A;  1LKX A;  2FRH A;  4L9N A;  2V26 A;  2KIF A;  2LTP A;  2Y9Z A;  3QRF F;  2JA6 J;  2HOA A;  5LEK A;  1NG7 A;  1N78 A;  1TNS A;  2OAZ A;  3DKW A;  4KMU X;  4A3L J;  3ABK H;  3Q0V A;  3CCR I;  3BC8 A;  1P9Q C;  3G1M A;  2XHK A;  2P5L C;  3S2W A;  1TTY A;  2WY8 Q;  3RZD J;  4HDU A;  3DPT A;  1YFH A;  3GFI A;  1BI0 A;  3HOZ J;  2TDX A;  1RNL A;  3TW6 A;  5CVR A;  2DOE A;  3T0Y A;  2OA4 A;  1ULY A;  2AXT C;  4I7H A;  2H8W A;  4RGX A;  5E1Z B;  2EA2 A;  3CJR B;  4QPQ A;  2QBY A;  2LKX A;  2HQA A;  4XLP F;  1T8I A;  2L9S A;  1GXQ A;  2KMU A;  2KKO A;  4D5C A;  2PMH A;  2GBY A;  2DFH A;  4ON0 A;  1TZL A;  2P4W A;  1KU7 A;  1ETW A;  3C2G A;  4RBO A;  2E1M B;  1LFP A;  3GCM A;  2AO9 A;  2WB1 N;  2V79 A;  4DZJ A;  2OZU A;  2P5V A;  1ETO A;  4E6K G;  3E5U A;  3IKV A;  3T8R A;  2PQ8 A;  3O8G A;  3CCQ I;  2E5N A;  4BXF A;  3V7S A;  4ZYA A;  3MN2 A;  1MNM C;  2VJJ A;  4FHT A;  2ETH A;  3CMA I;  1YX3 A;  2XGX A;  3HGG A;  5EEA A;  1OCR H;  4MTE A;  3BOQ A;  2X6O A;  3D0S A;  4RB1 A;  1TWC J;  1BN5 A;  1TLH B;  1U2W A;  3KET A;  2EPF A;  3R6S A;  2E1C A;  1Y0N A;  1VQ5 I;  1Y1W J;  4GFB A;  5B1B H;  5BPI A;  1KU9 A;  3K4L A;  1MJB A;  2E36 A;  4W1U A;  3GTM J;  2L7F P;  3RQ4 A;  5L3E A;  3BQY A;  3EYI A;  4NC8 A;  3CJN A;  2NS8 A;  2K9S A;  2CW8 A;  3ZQQ A;  2L9V A;  1YQA A;  4LG0 A;  3S3M A;  1V4R A;  3P9C A;  3OYN A;  1R22 A;  2FML A;  4CZC A;  4C2U A;  5B66 C;  2NVU B;  3ZMT A;  2X1E A;  3LWF A;  5H6R A;  2F6C A;  3GXO A;  1T98 A;  3PO2 J;  3HKZ A;  2DA3 A;  4I09 A;  1FIA A;  3JR9 A;  2FEZ A;  3ZMU A;  3FK6 A;  4Y3O A;  4HF1 A;  1B9M A;  1NG6 A;  2DDA A;  1LE8 A;  3T1B A;  3N4M A;  2DPD A;  1J9I A;  1HKT A;  5ILS A;  2FF4 A;  1XCB A;  1ZAR A;  4LGW A;  1B8I B;  5FJ8 J;  4XKB A;  1XN7 A;  4CA0 A;  1TQM A;  3GEZ A;  3DTK A;  4BXU A;  1O7F A;  3OYG A;  4PSX A;  2NNN A;  1MMD A;  2DTZ A;  1JKR C;  1P7J A;  1X1C A;  1LB2 A;  1XSD A;  1O57 A;  4NQW B;  1MBJ A;  2Y75 A;  4L18 B;  2EZI A;  3W6J B;  3HSE A;  4MO7 A;  4NHJ A;  4RAZ A;  1J75 A;  1DQU A;  1R58 A;  2KPM A;  1BR4 A;  3RDI A;  4BE1 A;  2WBM A;  5L3C A;  1U0J A;  1RZ4 A;  2RKH A;  4H4K C;  2RNG A;  3S8P A;  4G8X A;  4U7B A;  2R7V A;  1ZQ3 P;  1HW1 A;  1WJD A;  3BG5 A;  4PCQ A;  1IUY A;  2E2I J;  3E5Q A;  3GVA A;  4Q4Z F;  1JT0 A;  3SEQ A;  2CRG A;  2RRE A;  3RI4 A;  3RZO J;  4J01 A;  4ANJ A;  2XUB A;  4XRS G;  4YIR X;  2R92 J;  2ELK A;  4Q47 A;  5FKN A;  2DA1 A;  3N05 A;  3BPX A;  2LRE A;  2LKS A;  1KGS A;  2PEX A;  4RMN A;  2MW8 A;  3LNQ A;  4BL0 B;  1ZG5 A;  1U5T A;  5M5Y J;  3S1N J;  2HZD A;  3BR2 A;  3D5R C;  1FX7 A;  2ICW G;  4BQN A;  4FAS D;  3WTW C;  2RN7 A;  4DIQ A;  4E7K A;  3I4M J;  5ICE A;  1J5Y A;  3TW7 A;  4GO1 A;  2F5D A;  1N77 A;  2IGO A;  2M4G A;  4LFU A;  2CS3 A;  2NYX A;  1OCT C;  1W5S A;  4A3B J;  4KYW A;  1MJA A;  2LOO A;  3L9F A;  3HG9 A;  1BW5 A;  3OYH A;  1ZGJ A;  4AIJ A;  1ZN2 A;  2DU9 A;  1Z0X A;  4PUS A;  5L3G A;  2LSO A;  1W0U A;  4EGZ A;  4XKV A;  4XKC A;  2XRO A;  4EJU A;  3OV8 A;  2CFX A;  4OAY A;  4LLL A;  1UHS A;  1R6R A;  2A6T A;  1JUS A;  2EH3 A;  2OTJ I;  1REP C;  4G6Q A;  1Z7L A;  5J3L A;  2M8G X;  3GTJ J;  3PFI A;  4RGU A;  2HFH A;  2E19 A;  1WH5 A;  5M5W J;  4MLO A;  2VJ4 A;  5IT9 Z;  2MC3 A;  2XIG A;  6PAX A;  4IHS A;  4BEH B;  2IT0 A;  2O0Y A;  1FSE A;  5HLI A;  1R49 A;  2F2E A;  3DBL B;  3ABL H;  1V5G A;  4ZYD A;  3CME I;  1WSU A;  4XID A;  3K70 C;  2KDZ A;  1VTN C;  4A2U A;  2IS4 A;  1ETX A;  2VL8 A;  2ZME C;  1SD7 A;  3OYB A;  4EJV A;  2ZJ2 A;  2GQQ A;  5K5O A;  3S3O A;  4FX4 A;  2FD5 A;  1K61 A;  1P2F A;  4II3 A;  4BQQ A;  3HL2 A;  1IF1 A;  2HQ5 A;  3M1E A;  1XSV A;  2HS5 A;  2V7F A;  5DS9 A;  1GV5 A;  3DBR B;  2HKO A;  2CQX A;  2DXI A;  2EFQ A;  4BHC A;  5FGM A;  4UHT A;  3MQ0 A;  4XLN F;  4BJ6 C;  3I3L A;  2BY3 A;  2LY9 A;  4FE4 A;  4OIQ F;  4G6D A;  3I56 I;  3CUQ B;  3K70 D;  1A35 A;  4ZDL A;  3TBI A;  4YRV A;  2HXI A;  2D2W A;  4C3I J;  3ONQ A;  3VB2 A;  3JW4 A;  3OYJ A;  3F21 A;  1BI2 A;  3OYI A;  3CDL A;  3ERM A;  2PJP A;  2DK8 A;  5LGU A; 
#chains in the Genus database with same CATH homology
 1S7E A;  1FTT A;  1B72 B;  3BR6 A;  1ZR4 A;  4IHY A;  2PMZ N;  2DMN A;  4A3I J;  5IP9 J;  4L5E A;  5IYB J;  2MG4 A;  4CYC A;  3JRC A;  4DZP A;  2R5Y A;  1U8B A;  2QF7 A;  3FIW A;  2I10 A;  5F27 A;  2M34 A;  3LSP A;  2HI3 A;  3JRB A;  5EG0 B;  2ME6 A;  2HOS A;  2JA8 J;  5F0C A;  3GTK J;  3WHB A;  3HOV J;  3H0G J;  1WGX A;  1H88 C;  1GDT A;  1G2H A;  2ID6 A;  1IC8 A;  3JRF A;  1FJL A;  2JA7 J;  4DW6 A;  3GTP J;  2JJ7 A;  3F0C A;  1JTY A;  2HYJ A;  1F36 A;  4BXX J;  2VUM J;  4FTH A;  2DA2 A;  2KT0 A;  1HDD C;  1ETQ A;  2TCT A;  2XPU A;  1IJW C;  1IUF A;  2FQ4 A;  5IPA A;  2YU9 J;  4A3M J;  2DMT A;  1ZTR A;  3S2H J;  3S14 J;  1RES A;  1DU0 A;  1EF4 A;  2L9R A;  1A6I A;  1Q1V A;  4DYR A;  3JRD A;  1HOM A;  3PM1 A;  4JP0 A;  4M3D A;  3BTL A;  2IBD A;  4V2G A;  3A03 A;  1GT0 C;  1BA5 A;  1QVU A;  3LOC A;  3GTG J;  2JN6 A;  2E2H J;  2NOG A;  3IH2 A;  2E1O A;  3RQI A;  2LK2 A;  3GTQ J;  4X1E A;  2B63 J;  3W6V A;  4Y52 J;  1MBK A;  3BG3 A;  2XRL A;  1RPW A;  2HOT A;  3JRI A;  3HBL A;  2LVS A;  1TWG J;  2LFB A;  2NVQ J;  5DTD A;  3HM5 A;  1ETK A;  2QCO A;  4W97 A;  4IHX A;  4FCY A;  1NTC A;  1FEX A;  5J1R A;  3K7A J;  3S15 J;  1BW6 A;  2YS9 A;  2CUF A;  2EQR A;  2NVY J;  1YRN B;  2VPR A;  3G1L A;  5C44 J;  1AKH B;  3ZOB A;  2JMW A;  1Z77 A;  2MGQ A;  3BR3 A;  3SDG A;  1W0T A;  1QVT A;  4A3J J;  3E7L A;  1E3O C;  2R5Z B;  5IOZ A;  3BR1 A;  3BR5 A;  1RR7 A;  1POG A;  3DCF A;  1UG2 A;  5IYD J;  1JJ8 C;  1JGG A;  3B6C A;  2Y30 A;  2XB5 A;  1RET A;  4AUX A;  2ID3 A;  1JUP A;  5E3M A;  3GTO J;  4V2F A;  1IGN A;  3Q0U A;  1FTZ A;  5EF6 A;  4DYC A;  4FIS A;  1IG7 A;  1XC5 A;  3S17 J;  2L7Z A;  4C3H J;  4AYB N;  2K9Q A;  3A01 B;  2O7O A;  1X2N A;  3VPR A;  4Y7N J;  3HOX J;  3JRH A;  2Y31 A;  2OF7 A;  2W48 A;  2GM4 A;  1MBE A;  1WI3 A;  5EZH A;  1IDY A;  5J1Y A;  2L7M P;  4MIM A;  2GLO A;  3GTL J;  5GPA A;  4UUS B;  1H8A C;  4A3G J;  3HGY A;  1HDP A;  5FKL A;  4A69 C;  2ME0 A;  2P81 A;  1I3Q J;  1JTX A;  4S0H B;  2XSD C;  4I76 A;  1D5Y A;  1NK3 P;  4M6V A;  3ZQG A;  5EGO B;  3NAR A;  2JA5 J;  2EZK A;  4ABZ A;  2LR8 A;  3CCY A;  1AKH A;  3CMY A;  1JKQ C;  5IP7 J;  5F1J A;  3ZQC A;  1GUU A;  1P7I A;  1U9O A;  2EZL A;  3LSG A;  1PUF B;  1JKO C;  4NDL A;  3G1O A;  3M3Y J;  3D1N I;  5M3M J;  2L0K A;  3HOW J;  3Q3S A;  2VKV A;  3A02 A;  2NS7 A;  1TC3 C;  5FKK A;  3OSG A;  1I6H J;  5J1U A;  1F43 A;  1MH4 A;  3MKL A;  3O8H A;  1U9N A;  5E3O A;  4M3F A;  2LTP A;  2Y9Z A;  2JA6 J;  2HOA A;  2DA4 A;  1ITY A;  4M3E A;  2M9H A;  4A3L J;  3A01 A;  3Q0V A;  3S1M J;  2COB A;  3G1M A;  4J19 A;  1OCP A;  3ZQI A;  1NK2 P;  3S1Q J;  1T56 A;  2K40 A;  1R9T J;  3RZD J;  2DJN A;  1JUM A;  2HXO A;  3HOZ J;  3TW6 A;  5E3N A;  4QTR A;  1B72 A;  5F0H A;  4IEJ A;  1JT6 A;  5C4J J;  3BT9 A;  3I4N J;  5F08 A;  2IEK A;  2YUS A;  3HDD A;  2LKX A;  1WPK A;  4UUS A;  1ETY A;  4D5C A;  1MSE C;  2GBY A;  3S1R J;  1ETW A;  4RBO A;  1LE8 B;  1CQT A;  1OJL A;  5IOY A;  1HF0 A;  2AO9 A;  1ZK8 A;  4M3B A;  3OOU A;  2WB1 N;  5EGO A;  2VKE A;  5EG0 A;  2XPV A;  3JRG A;  5FKO A;  4DZJ A;  3PO3 J;  2EBI A;  1ETO A;  5EDN A;  1AU7 A;  1TWF J;  1X2M A;  4BY7 J;  3O8G A;  2IAI A;  5C3E J;  1ENH A;  3BTI A;  4A3E J;  3BG9 A;  3HOU J;  3MN2 A;  1MNM C;  4B1R A;  3GBG A;  2XPW A;  4D5F A;  1AHD P;  3HGG A;  1ZGW A;  5EEA A;  4G12 A;  4JX4 A;  2X6O A;  2R5Y B;  2DMP A;  1TWC J;  1RKW A;  3BTJ A;  4QSH A;  2MSY A;  2H8R A;  2DA6 A;  2FX0 A;  1IDZ A;  1Y1W J;  4GFB A;  2Y2Z A;  4BKX A;  2E2J J;  4W1U A;  3QQA A;  4D7M A;  5K7H A;  3GTM J;  4BBS J;  2L7F P;  3BQY A;  4JYK A;  5F04 A;  2NS8 A;  2K9S A;  1APL C;  1XG1 A;  2O8K A;  1VND A;  1LFU P;  1A5J A;  1TWA J;  2Y9Y A;  9ANT A;  1ORK A;  5E3L A;  2WV1 A;  2FJ1 A;  2M0C A;  4XRS A;  5C4X J;  1MBF A;  2R0Q C;  3PO2 J;  2DA3 A;  2RAE A;  1U78 A;  1FIA A;  4XK4 A;  3UKG A;  3JR9 A;  3NAU A;  3FK6 A;  3JRE A;  3Q0W A;  2DA5 A;  2K9N A;  5IYC J;  4I6Z A;  1RKT A;  1XS9 A;  1LE8 A;  3C2B A;  2LD5 A;  1VF9 A;  4B4C A;  5K7Z A;  3RKQ A;  1B8I B;  2WAQ N;  5FJ8 J;  1MBG A;  4X6A J;  2ZB9 A;  4DYQ A;  1IV6 A;  3QPS A;  3TP0 A;  5GPC A;  4QIW N;  1T33 A;  1YRN A;  1FIP A;  3ZQH A;  2NVX J;  1K83 J;  1UMQ A;  5JLX A;  5EYR A;  2AHQ A;  1QRY A;  3FK7 A;  2JWT A;  1MBH A;  4IHV A;  1ZKG A;  2DTZ A;  5JLW A;  1JKR C;  4C3J J;  1P7J A;  3L1P A;  1MBJ A;  2XB0 X;  5M3F J;  2R5Z A;  2EZI A;  4MO7 A;  3K2A A;  2XGE A;  3BR0 A;  2N8G A;  5FKM A;  2XGC A;  1DU6 A;  2DN0 A;  3CQZ J;  1HLV A;  4BY1 J;  2TRT A;  3JRA A;  1JJ6 C;  3BG5 A;  1H89 C;  1ZQ3 P;  4EEF G;  4B3A A;  2E2I J;  1O4X A;  3HKZ N;  4UUT A;  1JT0 A;  2CRG A;  3RZO J;  4XRS G;  2R92 J;  2ELK A;  3ZQF A;  2R93 J;  5FKN A;  2DA1 A;  1BJZ A;  3LNQ A;  2MW8 A;  5GP9 A;  5M5Y J;  3S1N J;  3DEW A;  3BR2 A;  4AC0 A;  1SFO J;  2DA7 A;  3I4M J;  3TED A;  2X9D A;  2OPT A;  1VI0 A;  2HDD A;  1Y1V J;  3FIS A;  1WCM J;  1OFC X;  2G0E A;  1B8I A;  3TW7 A;  1IRZ A;  3QPL A;  4BBR J;  1ZR2 A;  1OCT C;  3S2D J;  1HCR A;  3OSF A;  4A3B J;  1ETV A;  1BW5 A;  2CQQ A;  2CUE A;  3IH3 A;  2NVT J;  4A3K J;  1Z0X A;  2VI6 A;  3IV5 A;  3IH4 A;  5K7F A;  1W0U A;  2DMU A;  5FLV A;  3M4O J;  2CJJ A;  1X58 A;  4JX6 A;  3H3V K;  1PUF A;  4A3C J;  1UHS A;  4C2M J;  1JUS A;  2EH3 A;  5J3L A;  4JX5 A;  3TP3 A;  2M8G X;  3GTJ J;  5EZG A;  2E19 A;  1WH5 A;  4D7N A;  2DMQ A;  4MLO A;  4CYC B;  5M5W J;  4A93 J;  2XGD A;  3SFI A;  5F0F A;  3ZQL A;  3MVP A;  4A3F J;  1BL0 A;  1JKP C;  3BTC A;  4XID A;  2O9L A;  2KDZ A;  3BQZ A;  3WHC A;  3SJM A;  1ETX A;  5IP6 A;  1WH7 A;  2CU7 A;  5FLM J;  3LSR A;  3OIO A;  5BNG A;  2JK3 A;  3HEF A;  2FD5 A;  3LSJ A;  1K61 A;  3FKI J;  3HB9 A;  1VFC A;  5M5X J;  5HOD A;  4HNV A;  2HQ5 A;  4LOC A;  5DS9 A;  1GV5 A;  2CQX A;  1MH3 A;  2ECC A;  4FE7 A;  3B6A A;  4MFE A;  4XRM A;  1QPI A;  2M2E A;  2LY9 A;  4FE4 A;  4XIC A;  2EZH A;  1SAN A;  1MSF C;  2Y0S N;  4M3G A;  4A3D J;  1LFB A;  2HXI A;  2R7Z J;  2D5V A;  1GVD A;  4C3I J;  2LLK A;  3HOY J;  2X48 A;  2LP0 A;  4MFD A;  4RDU A;  1TWH J;  3S16 J;  1GV2 A;  2H1K A;  3CDL A;  1I50 J;  4IHW A;  2ECB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...