1XG1A

Solution structure of myb-domain of human trf2
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
67
structure length
67
Chain Sequence
b'GSHMEDSTTNITKKQKWTVEESEWVKAGVQKYGEGNWAAISKNYPFVNRTAVMIKDRWRTMKRLGMN'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Telomeric repeat binding factor 2
publication title NMR studies of telomeric nucleoprotein complexes involving the Myb-like domain of the human telomeric protein TRF2
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein
total genus 19
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2004-09-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00249 Myb_DNA-binding Myb-like DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1xg1A00
1IG7A 5J1RA 2DMPA 4V2GA 2CUFA 3CQZJ 2K9SA 3TP3A 2E19A 3OIOA 1Y1WJ 5FLMJ 2JWTA 1F43A 1MBGA 5F0HA 3BQZA 3ZQIA 1TWHJ 2HXIA 4FTHA 1BA5A 4M3GA 3GTQJ 5M3FJ 2JJ7A 3FKIJ 3OOUA 3QPSA 4NDLA 5JLXA 2DJNA 5K7HA 1HOMA 3HB9A 1B8IB 1W0UA 1POGA 3G1MA 4W97A 1X2MA 3A03A 2DA4A 2QF7A 1GV5A 1MBHA 5IP6A 3ZQLA 1FIAA 5F08A 1ZGWA 3S2DJ 3FK6A 2EZHA 2DA2A 3HGYA 2Y2ZA 1A6IA 5F0FA 1GDTA 1MBKA 3FK7A 3HOVJ 4M3DA 1LFUP 1BW5A 1ZQ3P 1K83J 1Z0XA 2I10A 2R0QC 2O9LA 1U9OA 1E3OC 2XSDC 4A3BJ 1GV2A 2LD5A 4RDUA 1H88C 2X48A 2LVSA 3GBGA 4AYBN 5EDNA 4A3JJ 2M8GX 3NARA 3G1OA 4I76A 2D5VA 1JUMA 3SFIA 4IHXA 2NVYJ 4JP0A 4BXXJ 1X2NA 1JJ6C 3TEDA 4JYKA 5C4JJ 1Y1VJ 2DA7A 4L5EA 1S7EA 2ECBA 1RESA 4D5FA 3K2AA 2CQQA 4QIWN 1JKPC 1B72A 3BQYA 3ZQFA 3GTGJ 1QVTA 1RETA 5FKMA 3LSGA 3JRIA 1Z77A 4M3FA 3TP0A 4C3IJ 4A93J 1DU0A 4IHWA 1NTCA 1XC5A 2DA5A 4M3BA 2R7ZJ 4MO7A 2E2IJ 3K7AJ 2XGCA 3MKLA 3LNQA 4UUSA 2H1KA 2LR8A 3PO2J 5EYRA 4JX5A 2VKEA 1FEXA 3DEWA 3HGGA 1QRYA 3A02A 2EQRA 3BTLA 2EZLA 3BG5A 2TCTA 5J1YA 3S16J 2R92J 1T56A 1JKRC 3MVPA 1FJLA 3O8HA 5EGOB 5IYDJ 2EZIA 3JRFA 3A01B 3JRAA 2NVQJ 4X1EA 4C3JJ 3UKGA 3LSPA 3BR5A 1FIPA 5GP9A 3NAUA 4XICA 2L7FP 2QCOA 2WV1A 4D7NA 1TC3C 1UG2A 5M5WJ 3HEFA 4QSHA 3HBLA 2HOAA 5C44J 3FIWA 4XK4A 2HI3A 2XPUA 5IPAA 1GVDA 2R93J 3M3YJ 3JRDA 1HCRA 5EF6A 1MH4A 2LFBA 2N8GA 5J3LA 3S1RJ 1GUUA 2M0CA 4A3FJ 2B63J 3MN2A 3C2BA 2O7OA 1IC8A 1RR7A 4DZPA 2RAEA 2Y30A 5EZHA 3JR9A 1ETXA 1IJWC 3S1MJ 3LSRA 1HLVA 4CYCA 2DA6A 1F36A 3CDLA 1IDYA 2XPWA 3BR1A 3GTJJ 5IP9J 2DMTA 2DA1A 3BR3A 2ID3A 2GLOA 3HM5A 5M3MJ 2YU9J 2ME6A 5IYBJ 5GPAA 3LSJA 1H8AC 5F27A 1BW6A 2JA8J 3IH2A 4FISA 4M6VA 2HOTA 3BT9A 1ENHA 2Y31A 5EZGA 4S0HB 4BY7J 2VKVA 5IOYA 3DCFA 1W0TA 1AKHA 1ETKA 1MBFA 2CJJA 1CQTA 3GTOJ 3JREA 1MH3A 2LKXA 2AO9A 3Q0UA 1XS9A 5K7ZA 2L9RA 4A3GJ 4I6ZA 1HDPA 3OSFA 2W48A 2XB5A 1B72B 3TW7A 1VFCA 3PM1A 1UMQA 1IV6A 2NVTJ 3S2HJ 3BR2A 4Y52J 3S14J 1JT6A 5JLWA 4BBSJ 2E1OA 4MFDA 3ZOBA 2LY9A 2HQ5A 2FD5A 2R5YA 1FTZA 5IOZA 3Q0WA 4JX6A 4UUSB 1TWAJ 2TRTA 5C3EJ 1U8BA 2NOGA 1WI3A 2E2HJ 2JA7J 2ECCA 3FISA 2KT0A 1WH7A 1IGNA 2NVXJ 2X9DA 2NS7A 3GTKJ 1BL0A 2Y9ZA 5DS9A 1IRZA 3S1NJ 3HKZN 3PO3J 2COBA 5M5YJ 1NK3P 3IH4A 1U9NA 2LK2A 3M4OJ 2ELKA 1ETYA 2G0EA 2JK3A 4A69C 4XIDA 4FE4A 5F0CA 4A3KJ 3BG3A 4XRSG 5FKOA 1JKQC 3IH3A 1G2HA 2DN0A 4BBRJ 2FQ4A 5EG0A 5HODA 1ZR2A 2HYJA 2XB0X 5C4XJ 4BY1J 3Q3SA 1GT0C 2DA3A 3RZDJ 1WGXA 1QVUA 1WPKA 1JUPA 2JN6A 3H0GJ 2DTZA 4AUXA 3F0CA 1OCTC 3ZQHA 2K40A 2YS9A 1U78A 3RQIA 3D1NI 3SJMA 3VPRA 1AHDP 4DYCA 2XGDA 3IV5A 4ABZA 3JRHA 5BNGA 1UHSA 1NK2P 2L7MP 1ZR4A 3BR0A 1K61A 5FKLA 2L0KA 1MBEA 3L1PA 3BTIA 1LE8B 3I4NJ 4MLOA 1DU6A 1T33A 3HDDA 4JX4A 4DYQA 5GPCA 4RBOA 3BTCA 4A3EJ 4CYCB 1JT0A 1BJZA 1IDZA 2MSYA 4A3IJ 1VNDA 1LE8A 1I3QJ 5F1JA 2IBDA 1ITYA 1VI0A 2EBIA 2HXOA 3S15J 1O4XA 2X6OA 1P7IA 2LP0A 2MG4A 3BG9A 2AHQA 3ZQCA 2IAIA 3QQAA 2CU7A 4X6AJ 3OSGA 2H8RA 4C2MJ 4QTRA 3HOUJ 4UUTA 1OJLA 3GTLJ 3WHCA 4D5CA 2EZKA 2XRLA 4V2FA 1AKHB 2E2JJ 3HOZJ 1RKWA 3ZQGA 1X58A 5E3NA 3JRCA 4IEJA 1I6HJ 2VPRA 2NS8A 4B4CA 3E7LA 1IUFA 5J1UA 1JTYA 1B8IA 4DYRA 3HOYJ 5E3LA 1FTTA 9ANTA 2O8KA 5FLVA 4XRSA 2ID6A 3JRBA 5F04A 2IEKA 3B6CA 1JKOC 4EEFG 2L7ZA 2R5YB 3H3VK 1ETOA 2XGEA 2DMUA 1RPWA 5FJ8J 2HDDA 1ETWA 4B3AA 2CUEA 1ORKA 1OFCX 1VF9A 3CMYA 1WCMJ 2Y9YA 2P81A 5FKKA 2M34A 3QPLA 3B6AA 1D5YA 2Y0SN 1H89C 1JTXA 4D7MA 1QPIA 1ZKGA 2HOSA 5M5XJ 5IYCJ 2WAQN 3Q0VA 2ZB9A 4W1UA 3SDGA 4FCYA 2OPTA 1TWFJ 1HF0A 4A3MJ 2DMQA 4HNVA 1LFBA 3I4MJ 1MBJA 5IP7J 2R5ZB 3JRGA 1JJ8C 2MGQA 3RZOJ 1R9TJ 4A3CJ 2GM4A 5EG0B 1APLC 4A3LJ 3HOWJ 4IHYA 4DZJA 3TW6A 1PUFB 4FE7A 3S1QJ 3GTMJ 2R5ZA 1Q1VA 2FX0A 4MFEA 2JA5J 1SFOJ 1OCPA 1JGGA 3BTJA 4J19A 1EF4A 1AU7A 1MSEC 2XPVA 4IHVA 4DW6A 1TWCJ 1PUFA 1RKTA 3HOXJ 2M2EA 1ETVA 3G1LA 2ME0A 4Y7NJ 2KDZA 2VUMJ 2DMNA 2OF7A 5EEAA 4GFBA 2CQXA 5K7FA 1XG1A 3S17J 2K9NA 4XRMA 1TWGJ 1ZK8A 2JMWA 5FKNA 3W6VA 2VI6A 2YUSA 4B1RA 1A5JA 4BKXA 4G12A 1WH5A 1MSFC 3LOCA 2K9QA 3O8GA 1HDDC 4AC0A 1ZTRA 5E3OA 4M3EA 4MIMA 3BR6A 1P7JA 3WHBA 2EH3A 2PMZN 2JA6J 3GTPJ 4A3DJ 4LOCA 1I50J 1YRNB 1MNMC 1SANA 1JUSA 3RKQA 4C3HJ 5EGOA 2LTPA 2WB1N 2GBYA 2MW8A 3A01A 3CCYA 2CRGA 1ETQA 2FJ1A 2LLKA 2M9HA 5E3MA 5DTDA 1YRNA
chains in the Genus database with same CATH superfamily
1J9IA 1XSDA 4RB0A 3F22A 3FXJA 4A0YA 4Y17A 4ZJZA 4I01A 3CQZJ 5H6QA 4IHTA 2K9SA 3TP3A 5LBQA 3J7AY 4L9NA 3GZ5A 3NRVA 1LVKA 1BA5A 1TWHJ 2MH2A 1OKRA 4M9SA 5HLHA 1DPUA 3OOUA 3ZMVA 1P92A 3B73A 1BM9A 1X4PA 5K7HA 2ZMEB 1W0UA 2BHZA 2OZ6A 2W57A 3G1MA 3CJRB 3BCBA 2CSOA 1X2MA 4LB6B 2DLLA 3ZN0A 5LFAA 4L5JA 1LEAA 1GV5A 1WJEA 1J7KA 3C18A 2ZNZA 3WU1B 2XAGA 2P7VB 1IAWA 5GTIC 5EJCA 2F4MB 2PX9A 1BC8C 5KK1A 2CW8A 3E5XA 3MKZA 4CHUA 4JBAA 3HOVJ 4M3DA 2MLGA 4G9YA 1QU3A 1K83J 4P9FA 4CCKA 2H94A 2A07F 4QWQA 5FRMA 2H09A 3WTTC 1U9OA 1QZEA 3DPTA 2LD5A 1H88C 5KAIC 5A2QK 1JHHA 4XLAA 4AYBN 1E2XA 3CCSI 3BZ6A 2Q2EA 3F9KA 1FNNA 2M8GX 2BEOA 1HKSA 4OIRF 2D5VA 2XHKA 1BN5A 4IKFA 4LITA 3AG2H 3QP5A 3B02A 4YIFA 3H1CA 1EJ9A 2Z33A 1M1EB 4BXXJ 2Z1DA 5DD4A 2LOOA 2Y0SA 3SEZA 2A6EF 1RUNA 2BV6A 3DEUA 3M8FA 3I4PA 1DP7P 2PG4A 3K2AA 1JKPC 5CVUA 2OC6A 3I5UA 1QVTA 3LL7A 5CPRB 4C3IJ 1T0FC 1D5VA 2EA2A 1NTCA 1XC5A 4IZZA 4BAYA 4XLEA 3WGIA 4Y13A 4E6KG 4M3BA 5DV5A 2R7ZJ 2E2IJ 1VQNI 3HHGA 2G7UA 4GXOA 4UUSA 1WWXA 2NNNA 1YG2A 2IS6A 3H35A 3U9GA 4RAYA 2H1KA 1VQ9I 4D9JA 2E71A 1ZYRF 2B0LA 5HS9A 2DDBA 3QU3A 3I64A 4WXHA 1O7LA 1QRYA 1DGWY 3BTLA 3BG5A 3GFJA 2RQPA 3S16J 3RI4A 1RRJA 5J8CA 1FBQA 5LGTA 4PJMA 2OTLI 3OYJA 3HOTA 2EILH 3H9GA 1KONA 5DCMB 3JRFA 5IYDJ 2VKDA 4EJUA 3A01B 4ZYGA 1E3PA 4BE0A 3IHUA 3ASOH 2K3FA 4CZCA 3JRAA 3V8JA 1N78A 2EFPA 5BS6A 3LSPA 3F6VA 3RTRA 2BXYA 4HV5A 3K4KA 2DW4A 2QCOA 2WV1A 2A6HF 1QNTA 2COMA 3R4KA 3FXOA 2OQGA 3HTUA 2KIQA 2FNPA 2PMZA 2R7QA 5C44J 3RCOA 1MGTA 5L3BA 4XK4A 1XN7A 2HI3A 2P5LC 1YITI 1YJWI 1WI9A 3ABLH 4ON0A 1YS7A 1A04A 1B1BA 4ZZLA 2MC4A 2R7XA 4G7ZF 4RB3C 1WJAA 2OCEA 4B3XA 2P6SA 3KZZA 3MN2A 3C2BA 1P9QC 2K9LA 2XF6A 1MMAA 4UUVA 1W7PD 2RDPA 2Y30A 3QAHA 1V54H 4KA4A 3IAM2 1TNSA 4ZDPA 3LSRA 4XBFA 3R61A 2V7FA 5LHIA 2CMPA 3LSHA 4CYCA 2DA6A 3PSFA 2XPWA 3QYBA 5IP9J 4IHSA 1FZPB 3ZXSA 5GADJ 2HZTA 3RYPA 3ESWB 3HM5A 1SEUA 4AD9A 3MMYB 4FX4A 2ZFWA 2RNJA 3T1BA 3LSJA 3S8PA 1H8AC 2ETHA 3HJEA 1QQIA 3TQNA 4FISA 3I55I 2GIZA 1MD0A 4XQFA 2FBHA 2W24A 1SD5A 2Q0OA 3BT9A 4G7HF 1ENHA 2R7VA 5EZGA 5F64A 4YFNF 2R7RA 1QBJA 4S04A 2VKVA 5IOYA 2CV1A 2LF7A 4ITVA 1AKHA 4A6DA 3BJOA 1FY7A 1MJAA 3FXKA 1G3TA 2LKXA 2L3DA 3KLNA 1XGNA 1XS9A 4A3GJ 2W48A 1SFKA 2LKPA 4LLLA 1UMQA 2HS5A 4C2TA 1MNDA 3S14J 4UB6C 4Z6YA 3OYCA 2VE9A 1SD6A 4EM2A 3ZOBA 3FMQA 3EPZA 2L5QA 1F5TA 1X1AA 4X0GA 1U5TA 2VPLA 1LDKB 4UUSB 2P6TA 4M6YA 2TRTA 5C3EJ 1F9NA 1T6SA 1TNTA 3W2AA 2ECCA 3MQ0A 2JA7J 1OCOH 1BOAA 2KT0A 3W3CA 2IT0A 3L2CA 2IGOA 3KCCA 1DDNA 2PJRB 3J81Z 1Y0NA 1R00A 2HYGD 4A6EA 2EK5A 4H0EA 3HKZN 4BQQA 4OWRB 4R79A 5FRNA 4CICA 5ILSA 3HSRA 1J59A 3M4OJ 4MTDA 2ELKA 1ETYA 2JK3A 5DD8A 4A69C 2E1MB 4XIDA 1SVOA 4KDPA 4B47A 3JTHA 4CDGA 3IH3A 4XR6A 4BBRJ 4HRIA 2K02A 1I39A 4BJ5C 3L9FA 4E4HA 1ZG1A 1QVUA 1WPKA 3H0GJ 3K4LA 2DTZA 4RA2A 4EVIA 3D5SC 1OCTC 3OIQA 3ZQHA 2XIGA 3DU6A 5CKTA 2B7EA 1I5ZA 1YHQI 3SJMA 3CUQC 4RGRA 3VPRA 1AHDP 2QKMB 1IRFA 2XGDA 4ABZA 2IS1A 2DOFA 1Y56A 1ACIA 1K61A 2P4WA 5FD6A 3SFZA 3L1PA 1R1UA 3I9V2 3R60A 1WZ2A 4MLOA 5HOOA 2CQKA 2JSPA 1SFUA 2K5CA 4JX4A 4A3EJ 1UCRA 1UHWA 3BTCA 3DPLC 4CYCB 4YFKF 2MSYA 4F7ZA 3FWEA 1VNDA 2DYRH 3Q9SA 3GLXA 5F1JA 4I99C 4O6JA 4P1WA 2EBIA 2HXOA 2JVGA 4PFOA 4E7IA 4UVAA 3GXOA 1N75A 3LSTA 3GVAA 3T8RA 1JXSA 4ZC3A 1G4DA 4NNJA 2KRHA 2IAIA 3ZQCA 2BVMA 4N4NB 4PGHA 5DUKA 3OSGA 2H8RA 2KFDA 4F91B 4G6DA 2PQ8A 2KJBA 5J8FA 4EATA 4M71A 4U0WA 2QGUA 5CYVA 1AKHB 3DBHB 4UV9A 2XAQA 2LY2A 3TDZC 1NH3A 3HTSB 3H5AA 2BY0A 2VJ4A 2V6CA 3DU5A 1I6HJ 1PJRA 5IT3A 2VODA 2DFEA 2NVUB 1SC7A 4DYRA 4KNYA 3UR3C 1YS6A 5E3LA 4GCVA 1Z7LA 9ANTA 2O8KA 5FLVA 1FTTA 2ID6A 2BY3A 1TQMA 1W7PA 2WADA 1X19A 1R6RA 3B6CA 2LY1A 1YW8A 1UB9A 1I27A 2L7ZA 1SFXA 1U5TB 2XF7A 1EV7A 2HDDA 1ETWA 1QHHD 1ORKA 2ZJQF 2QZ8A 2QM3A 3OYNA 1OPCA 2CO5A 2LRDA 2K86A 3OL3A 3RDIA 1QPIA 2O61A 2HOSA 2RREA 4RB1A 1IUYA 4E7SA 4W1UA 3TMOA 4LB5A 4KICA 3SDBA 3HYIA 3L2UA 1HF0A 1Z6RA 1LFBA 2OD5A 3QRFF 4BHCA 3JRGA 5L3DA 2MGQA 4KIGA 1Q1HA 5JFRA 2WAEA 4HOBA 1IV8A 2GM4A 4A3LJ 1APLC 1LEBA 1QZYA 1J5YA 2X1DA 4IHYA 3I58A 3ZMTA 2M0MA 1Q1VA 1XD7A 2GA2A 4BNCA 1JGGA 1X1PA 2RC4A 3LSIA 2LNBA 1AU7A 2DT7B 2PMUA 2UXXA 3LSKA 4P55A 4DW6A 1TWCJ 4BQAA 2KZGA 2WY7Q 2W84A 3CO6C 1YFHA 1TLHB 3LSMA 4KMUX 4ENMA 3RPUA 4O3MA 2HYFA 5HDGA 2LF8A 3GYHX 2QEXI 5JR3A 3ABTA 3GMEA 1ZK8A 4ZYDA 2Z9OA 5FKNA 4AIDA 5DUIA 4Y4RA 4B1RA 1V3FA 4BKXA 1YTYA 1XSVA 3O8GA 1HDDC 1ZLJA 1WJCA 3S3OA 5ICEA 4ZTFA 3G71I 3BR6A 3EUHA 1DQUA 4A3DJ 3GTPJ 3ECOA 1SANA 1YW9A 3RKQA 2K4BA 3N4MA 2ZC2A 4IVNA 2WWYA 1XB4A 3FZVA 2LC2A 4XLCA 3MZ8A 3ZQQA 1BC7C 4E70A 1IN4A 1KU3A 5B3SH 3RIRA 1STZA 2Q1ZB 3F8BA 2R3SA 2DMPA 1BOBA 4XORA 2XRNA 3J7YJ 1WSUA 4C30A 2R7DA 4CCNA 1F43A 5D5WB 3NWTA 1S7AA 1YX5A 3BQZA 2XVCA 3ZQIA 3GTQJ 5M3FJ 5JLXA 3J80K 4NDLA 2DJIA 1HOMA 2Z5UA 3HB9A 2F5CA 1OYWA 2RGVA 3CCEI 4W97A 3BZCA 1W7PB 1KQ8A 3OYKA 2ZXIA 4BYYA 3PQJA 3OYEA 4WK8F 1MBHA 1R7JA 5D5UB 3ZQLA 3J7AO 3IP4B 1FIAA 5D8KB 2ZMEA 4HDVA 2FF4A 3W6KB 3E97A 2EZHA 4Q48A 3DBRB 2FEZA 2UUZA 2HQAA 4LG3A 3WTSC 3F8MA 3FXRA 1MJBA 3H36A 2KJCA 3ZPLA 2R0QC 4KYWA 2YX4A 3K0LA 1KGSA 2IJLA 2L54A 2M87A 2LVSA 4I02A 5ICGA 3FKJA 3ZMZA 4Y33A 5CVRA 3AFHA 2NVYJ 2Y48A 3M8EA 3KLOA 4JP0A 2XAHA 1J09A 1I3AA 1O7FA 2DK5A 5C4JJ 3ELKA 2QQAA 5L3GA 1SD4A 2JUCA 2E35A 2JZYA 1S7EA 2HPIA 1YJNI 1RESA 4II2A 5ICFA 2A69F 1RETA 3QPTA 2PN6A 2DK8A 1O3TA 2KLOA 4M3FA 3JRIA 1ZRCA 4A93J 4UB8C 2KISA 3HZJA 4XKWA 2HTJA 4HNUA 1YLFA 4U0VA 4MO7A 3K7AJ 3IRRA 1PVEA 3MKLA 4DGWB 1LQ1A 1OCZH 2ZO4A 1VQKI 3GFMA 3VWBA 1A35A 4JX5A 3E5UA 2VKEA 1FEXA 3HG9A 2HWVA 3I59A 3HGGA 3CO7C 2V1DA 2EPFA 3ML6A 5HS7A 1F1ZA 5DDGA 3V7RA 2EA4A 1SMYF 1FX7A 1P6RA 1T56A 1EH7A 5BQTA 3FBNB 3WGHA 3G6EI 3DPUA 3MVPA 1LKXA 2XV4S 3O8HA 2VLAA 4ENKA 1RZ4A 5FROA 4LJZF 4MHGA 4X1EA 2QVOA 3R0AA 3ZRGA 5F6FA 3KP6A 1QGPA 4C3JJ 3M9AA 3UKGA 2M4GA 3F3XA 3MFKA 4PJ0C 2KMUA 4XLNF 3Q9VA 3GZ6A 5M5WJ 2GXGA 3DTIA 3CCJI 2HOAA 3ABMH 3TOBA 2DXIA 4D0PA 2XPUA 5IPAA 1X3ZB 1GVDA 2VKHA 5HDNA 2FBIA 1HCRA 1MH4A 4ZDOA 1ON2A 2N8GA 1K7AA 2V9VA 2HGCA 1GUUA 2M0CA 1MMNA 2B63J 2FOKA 2J5OA 3HSFA 3CCMI 4B48A 2HR3A 2E7WA 2O7OA 3K1MA 4IXAA 3G73A 2KRFA 4DZPA 3F72A 4YEJA 3CZ6A 3IRQA 2IGMA 1MIJA 4A0ZA 2BW3B 3DLLF 1RR8C 1TT5B 3DQVC 3M1EA 1VQLI 3D0SA 1HLVA 3OWTA 5HVQC 1F36A 3R0JA 1RUOA 3BR1A 1IDYA 3CDLA 2LH9A 4F3QA 5AIQA 1F4KA 2DA1A 3BR3A 3K4BA 5FO5A 2OBPA 3LFKA 2YU9J 1N25A 4ZDLA 2ME6A 5IYBJ 5GPAA 4CCOA 3GX4X 2Z3YA 2ISYA 2KQRA 5HLTA 4OAYA 4H4KC 3C2HA 2GQQA 1YYVA 2YR2A 4MQ9F 1C0WA 3VB2A 2VBXA 2OA4A 1VQ5I 1IRGA 4U7DA 3DCFA 2CQNA 4AVPA 1VQMI 5E17F 3KP2A 1MBFA 4HW0A 5LRSA 3JREA 1MH3A 1XMXA 2OJED 1ZN2A 2QSGX 2DAOA 5K7ZA 1XX5A 4I6ZA 3OSFA 1JHFA 3O3KA 1XMAA 3A2KA 2DFIA 1VFCA 1IV6A 2ZSHB 3BR2A 4BUPA 1JT6A 5JLWA 1USTA 2ZNYA 2CYYA 5K5OA 4RAFA 3OS1A 2F48A 3V8KA 1K6YA 2DTRA 2JSCA 5IOZA 3JTGA 3CP8A 2ELJA 5E20A 3Q0WA 3OYGA 2JPCA 3VYTB 4ZH4F 3S2HJ 2VOOA 5FLXZ 4ASNA 2LBFB 2Y75A 1CF7A 2FU4A 3FISA 1MMDA 4HSTA 1IN5A 1PYVA 1ZRDA 3I59B 2E1NA 3JW4A 3PQKA 2DQLA 3TDUC 4YRVA 2HVRA 1Y8QB 2WY8Q 3L00A 2Y9ZA 2CH0A 2BGCA 4I7HA 2COBA 2EJRA 5M5YJ 2R7UA 1NK3P 2CUJA 3CCRI 4HNTA 1U9NA 5KVRA 2PJRA 4RS8A 2D2WA 1CGPA 1I6XA 3DWLE 1TT0A 1Y0UA 5FKOA 4XLFA 1G2HA 4BXFA 2FQ4A 5EG0A 2JT1A 1ZR2A 2HYJA 2XB0X 3OR1C 1MMSA 3CLOA 4FT8A 3HRSA 3GEZA 3LMMA 4RM3A 2V4JC 1WGXA 1VQPI 1U2WA 4KJZA 4WXDA 5D5XB 2XSJC 5B66C 2Y69H 3DXJF 4Z2YA 3E3VA 3I71A 3RQIA 1YJ9I 4PGGA 4PSXA 1TTYA 2IVMA 1HXDA 1OQYA 2HDWA 3DF8A 4HYEA 3K69A 2WAFA 3VYUB 3E6MA 3CESA 3ONQA 4DBRA 3HRMA 1NK2P 2L7MP 3KYDB 5ERIA 3SZTA 2GA1A 4II3A 1A36A 1G6NA 5FKLA 2PMHA 4C9YA 1MBEA 4GGGA 3ROUA 2X6YA 1O57A 3CCLI 3BTIA 1QZZA 1HW2A 5DYMA 3CCQI 1ZH5A 2DPUA 1GHCA 2NYXA 3HDDA 4DYQA 5GAEJ 1MNEA 2JPBA 3FM3A 1JT0A 1BJZA 5D6FA 2BE5F 3WG9A 2RV8A 3SQNA 2F5DA 2JRTA 3CMMA 3OYLA 3OY9A 3J81K 2IBDA 2JTVA 1VI0A 3LWFA 5LLQA 1YO5C 2MD5A 3CMEI 3S15J 4O5VA 2W25A 4FQGA 4HX4A 1D3YA 3ZP5A 2V9PA 3S2WA 2MG4A 2X6WA 4GYGA 3COAC 4X6AJ 2V1NA 3Q5FA 1OJLA 3L7WA 2M1BA 3F8NA 2KIFA 3TL4X 2AQFA 3WHCA 3BZKA 2EZKA 4D5CA 4S05A 4L9VA 4YIRX 1S8NA 3FBIB 3HOZJ 1IN8A 1FOYA 5K5QA 4HSRA 3ZN1A 2P5VA 4BEHA 5TISC 1XDUA 3AAFA 1HKTA 4IO9F 3RKXA 4XMYA 1X58A 2QSHX 1OR7C 4Q47A 1O3QA 1IN7A 2VPRA 5J1UA 1ERDA 1JTYA 4XM3A 2IS2A 2R4GA 3AL0C 1ONVA 1FSHA 1XPXA 3JRBA 1W5CC 1KQ9A 2O3FA 3EQLF 2IEKA 1H9GA 1KU9A 3S3NA 5B1AH 2DMUA 4AYBA 4RLQA 4L18B 4B3AA 1CF7B 4HG2A 4BJTA 1VF9A 3EYYA 1S7OA 2OZUA 2GOMA 4HAMA 3CMYA 1WCMJ 3AG4H 4LIVA 4R1HA 3CUQA 1T2KA 3I56I 2M34A 2OAZA 1ZRFA 1NG7A 4MEXF 1H89C 4WXCA 3G3ZA 2KDOA 1ZKGA 1MJ9A 1TBXA 3MWMA 5J6XA 5M5XJ 3SDGA 4BACA 2ZB9A 4FCYA 1TWFJ 4A3MJ 4HNVA 1D0XA 3QWLA 3SYTA 1IXCA 3I4MJ 5IP7J 2R5ZB 4NC8A 1YIJI 4XRFA 1JJ8C 3TOAA 1E17A 1TQIA 3FM5A 4OINF 1R9TJ 4A3CJ 5D4SA 1DUXC 5EG0B 4LMYA 3TW6A 4PZJA 1PUFB 1I1SA 2EFOA 1AA7A 3JAMZ 3GTMJ 3KETA 2ISZA 2JA5J 2LREA 4J19A 2EIKH 3C2GA 2K9MA 4OAZA 4XKCA 3W6JB 1VQ4I 1YE9A 4IHVA 3SEQA 4KIFA 2L7KA 1HKQA 3QP6A 2NAZA 2K3PA 4N4OB 4YFXF 3BLYA 4XNFA 1MKMA 3L09A 2CV0A 1RKTA 4CSWA 2KL4A 1B59A 2L01A 2M2EA 1ETVA 1TQPA 2VT3A 3G1LA 2OF7A 1UHMA 4NUBA 4GFBA 1TW2A 1Z6TA 3K9TA 4CH7A 3VSKA 2CQXA 1IF1A 1D8JA 4QPQA 2L4AA 4XL9A 1FLIA 3T8TA 1FWZA 5FFXA 4XRMA 1TWGJ 2QUFA 4MNUA 2V6EA 3W6VA 3RJPA 4DQ2A 1H9TA 2YUSA 1X3UA 1A5JA 4HQEA 2GXBA 4PK4A 3S3MA 1E0EA 2E7XA 1LDJA 5BPIA 2X85A 2A3SA 1R58A 5E3OA 2VQLA 2JA6J 1J2XA 1I50J 1MNMC 3D5RC 1V55H 1JUSA 3P7NA 2DDAA 5EGOA 1FBSA 1TW3A 2MW8A 3EUAA 3CCYA 4IX7A 1Y6IA 2WV0A 2X0LA 4IJAA 2Z16A 3H5RA 1U6GA 3M07A 1K6OA 4R8HA 5J1RA 4EQQA 4L5IA 1GXPA 5TJJA 2BY1A 1WHUA 3E6BA 3LFUA 2W1OA 2E19A 2LKSA 1Y1WJ 2NXNB 5FLMJ 3KYLA 1U0JA 2JWTA 4G8XA 3CCVI 4BEHB 1MBGA 5F0HA 4ZTJA 3SZGA 3JSOA 2HXIA 4FTHA 4M3GA 2FMLA 3O2PE 2P0WA 3VSLA 2JJ7A 3PNYA 2JUGA 2FSWA 1SFEA 2DJNA 5ICCA 3FXUA 2Z99A 1LB2A 2CV2A 3PUFA 3WE2A 4HBLA 2XF5A 3WTXC 1IRXA 4RMNA 2V79A 3QYEA 2L9NA 3R6SA 2P8TA 3A03A 2DA4A 2ZCWA 4BQNA 4KITB 3RPQA 3VYSB 1ZGWA 3CP2A 3FK6A 2M7BA 3OOPA 4BE2A 2DA2A 4BHPA 1A6IA 1XGMA 1GDTA 4TV7A 2HVSA 1LJ9A 3FK7A 1LNWA 1MW7A 3VEPA 1LFUP 3CUQB 3KP3A 1FP2A 1ZQ3P 5HNHA 3DKXA 2FBKA 3K10A 4YELA 2O9LA 1N77A 3LQQA 2QBYA 1ZHFA 2XSDC 1S3JA 2D1HA 3WTZA 1GV2A 4A3BJ 4RDUA 2X48A 2H27A 2HQNA 5EDNA 2OU2A 2L9SA 5ILUA 4A3JJ 3WTUC 1R5ID 4A12A 2IA0A 2DYSH 4ZZDA 2M3AA 2DQRA 4HV6A 1JUMA 4F52A 4IHXA 1X2NA 2QLZA 3H0DA 1D0YA 3KX2A 4FETA 4LK0F 3BROA 3A0HC 4L5EA 4OIPF 1L0OC 2ECBA 4P5OA 4D5FA 4OIOF 1AWCA 2JVHA 1YQAA 4OU0A 1R49A 1B72A 3ZQFA 3PNTA 4HF0A 4LLNA 4N9IA 2CQ7A 2OTJI 1Z77A 3GW2A 3TP0A 1R71A 1JE8A 1K78A 3I3LA 3KP7A 3HKZA 3MKWB 4ESJA 2YSRA 2WC2A 1VZ0A 3LNQA 2FMYA 4G6QA 2DO7A 4UHTA 2X51A 3LQRA 5BMZA 2G7HA 1X1CA 2RQQA 3KIOA 4NB5A 2LR8A 4PUSA 3PO2J 2LMDA 5EYRA 2AQEA 1W36D 2HZDA 2F2EA 3VDXA 1LPQA 3ERED 2CG4A 2VJJA 3HRTA 2PI0A 1KQ0A 2RN7A 2R92J 3CJQB 4BQOA 4IQ4A 3EETA 1DPRA 1JKRC 3M8JA 3JSPA 1FJLA 5H2FC 4N9HA 5EGOB 3DV8A 2EZIA 3U1DA 5HDKA 1GLNA 2IRFG 4EJVA 1S6LA 2AXTC 2EB7A 4BDYA 2NVQJ 4ZYEA 3GWZA 4XKVA 2E5ZA 2EFNA 4DIQA 3BR5A 1FIPA 4XSZF 5LGNA 5GP9A 4RM2A 2PBIA 1ZAOA 4YG2F 2GXAA 3A0BC 3PSIA 4MEYF 1G3YA 1TC3C 1R36A 2F5VA 3CJNA 3TO7A 3HBLA 4ZYHA 2ZXJA 3BC8A 1XSXA 4QPOA 1WVRA 2I5UA 4LLGF 5GAHJ 2GOXB 4FX0A 3CCUI 1FC3A 1XMKA 4LIUA 3M3YJ 1YI2I 2XAJA 1REPC 2KZVA 1R23A 2X1CA 3LA2A 5EF6A 3GCMA 2HNHA 3BCAA 5J4VA 2W7NA 2LG4A 3S1RJ 2XDVA 4B44A 4D1QA 2MYSA 1IC8A 2BOLA 1SAXA 2R7SA 1R4NB 2O5RA 5EZHA 3EYIA 2LSOA 1ETXA 5D5VB 4BH9A 3S1MJ 1FT9A 1Z3YA 2V1UA 5LD2C 5E18F 2LDUA 4RGXA 4KUMA 1T38A 3HL2A 2VONA 1D0ZA 3GTJJ 1FP1D 4U87A 3V7CA 1AOYA 2ZKZA 4ESFA 2EIMH 2HPMA 5E1ZB 2BW3A 2GLOA 2X4HA 3IWFA 5FFZA 2KRCA 2BBYA 4NQWB 2VJ5A 5F27A 1BW6A 5TRDA 2QBYB 4M6VA 1V5GA 2HOTA 3F21A 4KN7X 2HDCA 4NC6A 1P4AA 4S0HB 1HA8A 1V5FA 4RAGA 3OMYA 2FRHA 4BY7J 3P9IA 2EIJH 1MDMA 4RB2C 1PUEE 2CJJA 2X1EA 4A5MA 4PCQA 5CJ9A 3GTOJ 1YIOA 4XKBA 1PDNC 3WG7H 3HOSA 3Q0UA 2HU9A 3F8CA 1B72B 2VL8A 3PM1A 4UVCA 1ODDA 4Y52J 3ISPA 1K78B 4BBSJ 3K1PA 2YX7A 2E1OA 2LY9A 5ILVA 2FD5A 1FTZA 4G94A 2DOEA 2CGPA 5L3CA 1ULYA 1J0RA 4JX6A 1PP7U 1TWAJ 3KZYA 2UXNA 1RIOH 2NOGA 3HHHA 5K5RA 1WI3A 4WF2A 4EV0A 1HBXG 2E2HJ 1T98A 2PEXA 1FOXA 4N0BA 4E7KA 1ZARA 3U1KA 2DBBA 2X9DA 4GO1A 4AWXB 1XGOA 3C7JA 4P96A 3N05A 2LBFA 4JK1X 3GTKJ 3P9KA 2UV1A 5DS9A 1IRZA 5J40A 4C2UA 3PO3J 1Y39A 1V4RA 2CW0F 4UNOA 3K1NA 3KPHA 2AXLA 3IH4A 4HPQA 4PJJA 4FASD 2E36A 2LK2A 1A6QA 3TBIA 2K27A 2H8WA 4XN3A 4QLCU 1H0MA 2A61A 1WRJA 1WJBA 1TP4A 4XRSG 3L2VA 1ZLKA 2MBFA 1R4MB 2DN0A 1LFPA 1RI7A 1Z91A 4CCMA 5HODA 4BXUA 3K6GA 3RZDJ 1BI0A 2VBWA 2IS4A 3SXYA 4AVZA 2OQRA 1JUPA 2JN6A 1SMTA 3WU2C 1UJ8A 2RKHA 2VE8A 3F0CA 4BJ6C 2K40A 2YS9A 1Y8RB 3D1NI 2MLKA 5IT9Z 5EEHA 3PFIA 4DYCA 1TZLA 4GDFA 2E60A 3GUDA 1UHSA 1ZR4A 2K7LA 4XLPF 2DFHA 1PP8F 2DPDA 1FMVA 4UVBA 1O3SA 1HW1A 4EJWA 1TL8A 2RNGA 3I4NJ 1LE8B 2G9WA 4ANJA 4BS9A 4J01A 3NEUA 1T33A 4Y15A 3LAPA 5FLXK 4RBOA 5GPCA 5DM7F 5DEQA 1QO0D 4L0ZB 2KIMA 3KFWX 2UZKA 4A3IJ 1BI3A 2F4IA 2W00A 1ITYA 3ASNH 1Z67A 2D1VA 3QYFA 5CQEA 4B09A 2X6OA 1O4XA 1P7IA 1T0FA 2IW5A 2LP0A 3BG9A 1OISA 3QQAA 4EGYA 3BJAA 2M8EA 3ZGKA 4C2MJ 4QTRA 3HOUJ 1T08B 3K4NA 3H3ZA 4PSWA 2FQ3A 4M6XA 1MDMB 1IW7F 2E2JJ 1UAAA 1RKWA 4U0YA 4CXFA 3F23A 4L0YB 4I98B 2CFXA 4IF4A 6PAXA 3MEXA 5H6RA 2Q8KA 4JQFA 5E3NA 4UV8A 3RKWA 1FYLA 2STTA 4B4CA 3T5XA 3FMSA 1W36C 1B8IA 1W4MA 3HOYJ 3HXLA 3KZIC 3MD2A 5D6EA 2PJPA 4GRIA 1D1AA 3LA7A 4WWCA 3L2QA 2ZSIB 5F04A 1HC8A 1B6AA 1W5TA 1JKOC 1G3WA 2VC0A 2CUZA 3E0JB 2XGEA 4AIJA 3H9QA 3UNGC 3AG3H 3IWZA 3I0TA 4HF2A 1OFCX 2CFOA 1WJDA 2VIXA 3VFZA 4EM0B 3AKZA 1OLTA 2ESNA 5LRRA 3E5QA 3E1SA 3IC7A 4NBQA 2E34A 3G2BA 2QYOA 3BG7A 3F6OA 2VBZA 2ZJRF 4D7MA 1KU7A 1P4XA 5IYCJ 2WAQN 2J5PA 2EV0A 2GWRA 3V4GA 3SHFA 3CF2A 2ZJPF 2DMQA 5K1YA 2Z2SB 4EJOA 4M74A 5CVJA 3E6DA 3VOEA 1MBJA 4BE1A 2ZXWH 3OV8A 3MZYA 3JCUC 3RZOJ 2VN2A 1OMIA 2Y0MA 4IRGA 4A5NA 4CGZA 3BJ6A 1S5LC 1L3LA 1FYMA 3FXMA 1T39A 1QPMA 2P7CB 2CS3A 4FE7A 3S1QJ 2L9VA 2R5ZA 2FX0A 1SFOJ 4I0AA 4E7ZA 3OYFA 3S93A 1MSEC 2RVCA 2XPVA 3K70C 5E8IA 3FX3A 3GLLA 1PUFA 3RSNA 3TO9A 4XOPA 5KHDA 3HOXJ 2GAUA 2KDZA 2ME0A 1OYYA 4Y7NJ 3MKYB 4LD5A 1T8IA 3QODA 2AS5F 5KCMA 5K7FA 5ED4A 1Z21A 4MQVA 1XTAA 2JMWA 3V8LA 1LUJB 3HPHA 5E8GA 4CCJA 2VI6A 1HSJA 5JHUA 4UY8I 4RGSA 1IZ1A 1OR7A 4G12A 1WH5A 2O6GE 5B1BH 2R7OA 1ZELA 3LOCA 3VYRB 1BI1A 2M5WA 1ZG5A 5J47A 4AC0A 1ZTRA 2XAUA 3LA3A 4M3EA 3OS2A 2R7TA 2EV5A 3WHBA 5CLSA 1YRNB 3EUKL 4F55A 5JI6A 2BVLA 5EEGA 5A2QZ 2BYVE 2WB1N 2GBYA 1NHAA 4BU2A 3ULQB 2MFZA 1XDSA 2JRMA 2FJ1A 2XC7A 5E3MA 4A3KJ 5DTDA 3BWGA 5CVVA 4BHBA 1IG7A 1EH6A 1IXSB 2BHYA 4V2GA 3MZHA 1RNLA 2NOJB 2CUFA 2M30A 3A1YA 5JVGF 4U88A 4DOZA 3OIOA 4XONA 4LK1F 2DU9A 4WX9A 5LHHA 2HEOA 3I54A 3JAMK 3FKIJ 3QPSA 2HFHA 2L2OA 5D8LB 3PUBA 2B9SA 1B8IB 2ZXHA 4KIBA 1POGA 1Z05A 2EFQA 3KP4A 4L9JA 4IOAF 5IP6A 2QF7A 3FHNA 2W82A 1X4OA 2ADUA 3U2RA 3S2DJ 5F08A 3KEYA 2LYCA 2E1MC 3TKYA 2IGNA 2KKOA 4EM1A 3CC2I 2V1XA 3HGYA 3CC7I 3FXLA 2Y2ZA 2M4KA 2HKXA 5F0FA 1MBKA 2ELHA 4LG0A 3ZMDA 3W2WA 2H6BA 4F92B 3PJRA 3K4CA 1BW5A 2X6XA 1FOKA 3M1CA 1Z0XA 2I10A 2GIVA 2Q2EB 4IL6C 4IOCF 1OCCH 2VOPA 3WGGA 3GF2A 3S32A 3HPGA 2A6TA 3RQ4A 3PNVA 3PFYA 1FSEA 4AU7A 4DBQA 2EV6A 1E3OC 1S29A 3TGNA 1BR4A 3D5LA 3GBGA 1KYWA 2FUG2 3P9CA 2M7AA 4HZFA 1J75A 3C1DA 3NARA 3DKYA 4MGRA 1K4TA 1FBUA 3G1OA 4I76A 3ZMUA 3SFIA 3FF5A 4DNCA 2R7FA 2BY2A 4BGDA 4KN4X 1JJ6C 1SVLA 4JYKA 3TEDA 3DLAA 5H20A 4KMFA 4XSXF 1Y1VJ 2DA7A 1UFMA 3OS0A 2CQQA 4QIWN 2WAQA 4G6TB 2FE3A 4AIHA 1EKEA 2MA3A 3BQYA 3GTGJ 2FA5A 3DEEA 5FKMA 3LSGA 3GO5A 4EGZA 2OV7A 1DU0A 4IHWA 2H6CA 3RPUD 2WBMA 1MMGA 2DA5A 4HLYA 3QU6A 2YPRA 3BOQA 2MH9A 2XGCA 1DP3A 2OCCH 3T0YA 3BG6A 1LDDA 3TO6A 4BL0B 4ESBA 4HEA2 4YIIA 5FGMA 2EINH 3E6CC 2IP2A 3DEWA 3A02A 4HX8A 2MC3A 1Z9CA 2EQRA 1RC9A 4RLFA 2EZLA 2TCTA 5J1YA 1R1TA 3OYAA 4KFCA 4OMYA 3AL0B 4RAZA 5HS8A 4HF1A 4CZZA 3DTKA 1VQ8I 1NG6A 2DODA 4I0BA 3OL4A 2MABA 1X1DA 2ZJ2A 1DGRM 1YOVB 2M45A 3HIFA 2QWWA 4PDKA 3DTEA 3HSEA 5JVTA 1X3WB 2QQ8A 3NAUA 1X1BA 4XICA 2L7FP 3QPHA 1WQ2A 4D7NA 2VXDA 1FOWA 1UG2A 1K4SA 1U5TC 3HEFA 4QSHA 4CO8A 2EFWA 3FIWA 3L2RA 2KHMA 2DT6A 5TGTA 5CQGA 1LVAA 2R7WA 2E1CA 1I1GA 1D8KA 2QA4I 2A5YB 5LEJA 2WB1A 1ON1A 2IXSA 4LFUA 1WJ5A 2R93J 4OOIA 2F5FA 3JRDA 1SVMA 1BJAA 1ZG3A 3FDYA 1IN6A 4M73A 4CUGA 1XCVA 1Z3XA 3L2WA 2LFBA 5J3LA 1YX3A 5L3EA 4A3FJ 1OYIA 5LEKA 4ENJA 3LAJA 1ZGAA 2NRAC 1OCRH 5CVIA 3V7SA 4ETSA 1RR7A 2RAEA 3IKVA 2OUMA 3JR9A 4Q4ZF 4M72A 1KZHA 2W4SA 1KU2A 3KEOA 1EH8A 1IJWC 1UELB 5E1WA 4RGUA 5LGUA 2IA2A 3RKYA 1WKMA 4I2OA 5BPDA 3I53A 3C3WA 4LG0B 3MCZA 4HA8A 2DMTA 4AM3A 2ID3A 5M3MJ 2HTSA 1XCBA 3FXQA 3GFLA 3RYRA 2ZFUA 4CCLA 5LHGA 1QHGA 2JA8J 3IH2A 2F5EA 2A5WA 2UWMA 3PIOF 2FNAA 2Y31A 4G7OF 3BY6A 1G3SA 2QQ9A 3CJTB 3HUGA 4NQWA 2L4MA 2V9KA 1W0TA 1ETKA 3ZMSA 1CQTA 3PIPF 3OYBA 2FXAA 2AO9A 5E79C 4EMSA 5AONA 2DOAA 2I8DA 4L9TA 4Y3OA 1O3RA 2L9RA 1HDPA 1HSTA 1U3EM 2XB5A 2WTEA 3TW7A 3ZR8X 1MZBA 1IXRC 2FOWA 2VT2A 2E5NA 1KYZA 1P2FA 3OYDA 2HQRA 2NVTJ 1GXQA 2TDXA 3CDHA 4IRHA 4Q5SF 4MFDA 1KA8A 1B9MA 2HQ5A 5F1RA 3GFIA 3O6BB 2R5YA 1VTNC 3FHZA 2DCEA 5D4RA 3MAJA 2DFFA 3OR2C 1U8BA 1G8XA 2EWNA 4HLXA 1A31A 4CA0A 5DCFA 5J4YA 2VJIA 4J00A 4KISA 1Z7UA 2XROA 1WH7A 3CDIA 1IGNA 2NVXJ 3BDDA 2NS7A 3DKWA 2XAFA 3K2ZA 1JGSA 3X2QH 2QENA 1BL0A 2PFBA 2VXZA 3S1NJ 3NQOA 3OYHA 1VQ7I 4B8XA 3A4CA 1ZREA 1JI8A 2A68F 3KEQA 4PJNA 4HDUA 2STWA 2G0EA 2YU3A 4FE4A 5F0CA 1WJFA 3BG3A 4KT6A 2D45A 4K2EA 2KIUA 2IGKA 2XGXA 1JKQC 5JHFA 3FMRA 2IPQX 5FD5A 3F8FA 5C4XJ 3PL8A 4XN0A 3WTYC 4BY1J 3Q3SA 2XKOA 1GT0C 2DA3A 3ECHA 1B4AA 1Z1DA 1VQ6I 2IA1A 4AUXA 3J7ZI 1V5EA 2JA2A 1U78A 3K4JA 2DT5A 2K4JA 3CUOA 4NHJA 1HQCA 3IV5A 4KT5C 1YW7A 2QKLB 5BNGA 1BBYA 3JRHA 1BIBA 3VODA 3BR0A 4CYDA 1U8RA 4M9ZA 3M7GA 2L0KA 3HC7A 1T95A 4UXNA 3BPVA 3P5JA 4M9XA 3WTWC 2F6CA 4IPAA 1DU6A 1W1WE 2XASA 3ABUA 2L02A 1IDZA 3KP5A 2A05A 3QOEA 5DM6F 2VQHA 2NS0A 3K70D 1LE8A 1I3QJ 1HW5A 4E7HA 2KPMA 2HKOA 2K85A 1P4WA 4IRIA 4E7JA 2VB6A 5FB2A 1WFXA 3H9JA 4FHTA 2W85A 2AHQA 3WE3A 2VQGA 1XGSA 5E1XA 2CU7A 3H3UA 3HUGB 4UUTA 3EDPA 1BR2A 3GTLJ 3OYIA 3V42A 1K79A 3IL2A 2XRLA 4V2FA 4HX7A 4HQMA 3CF5F 1BI2A 3ZCOA 1SAUA 3IAS2 3QOPA 3ZQGA 4P9UA 3JRCA 4BDZA 4ZYAA 5HNFA 4IEJA 2O0YA 4XOTA 2NS8A 3E7LA 1IUFA 3WODF 2HOEA 4LGWA 1USSA 3BP8A 4DJAA 3EUHC 4XRSA 5IT9K 2ICWG 5GAGJ 1R5HA 4EEFG 4A2UA 2R5YB 4ENNA 2QSFX 1ETOA 3H3VK 2BXZA 1RPWA 5FJ8J 3CMAI 1S72I 3K4MA 2CUEA 1R1VA 1QA6A 3WU0A 3KYCB 4E7LA 2GZWA 3N97A 3REOA 2Y9YA 2P81A 5FKKA 2F4OB 5L3FA 3OYMA 3QPLA 3B6AA 1D5YA 2Y0SN 3HRUA 3U21A 3DFGA 1JTXA 2C6YA 3CTAA 3CLQA 3Q0VA 2VASA 3DBLB 1FMWA 1W5SA 2OPTA 1R22A 2O03A 2XUBA 2VC1A 1G59A 1B9NA 1ZGJA 2CW7A 4EJTA 4GYIA 3IUOA 3HOWJ 4DZJA 3WTVC 3OIPA 1FYKA 2H1LA 2QQBA 2ZMEC 1D1BA 2VQCA 4MFEA 3J80Z 1OCPA 3DP7A 3BTJA 1EF4A 3ERMA 5BOXA 2ZBKA 2ACJA 3H92A 3NWSA 3ZQ7A 4A0XA 5HLGA 2PLYA 4IQJA 5AIPA 4B43A 1S9HA 2NNYA 4V19K 3AG1H 2CWEA 2ESHA 2MD0A 4XLHA 2XKPA 2VBYA 3KE2A 4NC7A 3CC4I 2VUMJ 2DMNA 4MTEA 3G4SI 1UG0A 5EEAA 4PFPA 1VQOI 1UZCA 2BZTA 4I09A 1XG1A 3S17J 2K9NA 2HVQA 2WA0A 3BPXA 5IY5H 1R5GA 2DI3A 1GVJA 1MSFC 3CD6I 2K9QA 1D1CA 1EA3A 2V26A 2JQ7A 4AIKA 4U7BA 3W2VA 2P5KA 4MIMA 5GTHC 1P7JA 2KP6A 4JOMA 2EH3A 2PMZN 1IO2A 4LOCA 4F93B 4OMZA 5KNLA 4PJLA 3IKTA 1BIAA 1FPQA 4OIQF 3SZPA 1BR1A 4C3HJ 5DCMA 5B5EC 2LTPA 2O8XA 4WCGA 3A01A 1E3HA 2CRGA 1ETQA 1SD7A 2LLKA 5KAFC 3H5NA 2M9HA 3ABKH 3GZNB 5HLIA 1YRNA
chains in the Genus database with same CATH topology
1IG7A 5J1RA 2DMPA 4V2GA 2CUFA 3CQZJ 2K9SA 3TP3A 2E19A 3OIOA 1Y1WJ 5FLMJ 2JWTA 1F43A 1MBGA 5F0HA 3BQZA 3ZQIA 1TWHJ 2HXIA 4FTHA 1BA5A 4M3GA 3GTQJ 5M3FJ 2JJ7A 3FKIJ 3OOUA 3QPSA 4NDLA 5JLXA 2DJNA 5K7HA 1HOMA 3HB9A 1B8IB 1W0UA 1POGA 3G1MA 4W97A 1X2MA 3A03A 2DA4A 2QF7A 1GV5A 1MBHA 5IP6A 3ZQLA 1FIAA 5F08A 1ZGWA 3S2DJ 3FK6A 2EZHA 2DA2A 3HGYA 2Y2ZA 1A6IA 5F0FA 1GDTA 1MBKA 3FK7A 3HOVJ 4M3DA 1LFUP 1BW5A 1ZQ3P 1K83J 1Z0XA 2I10A 2R0QC 2O9LA 1U9OA 1E3OC 2XSDC 4A3BJ 1GV2A 2LD5A 4RDUA 1H88C 2X48A 2LVSA 3GBGA 4AYBN 5EDNA 4A3JJ 2M8GX 3NARA 3G1OA 4I76A 2D5VA 1JUMA 3SFIA 4IHXA 2NVYJ 4JP0A 4BXXJ 1X2NA 1JJ6C 3TEDA 4JYKA 5C4JJ 1Y1VJ 2DA7A 4L5EA 1S7EA 2ECBA 1RESA 4D5FA 3K2AA 2CQQA 4QIWN 1JKPC 1B72A 3BQYA 3ZQFA 3GTGJ 1QVTA 1RETA 5FKMA 3LSGA 3JRIA 1Z77A 4M3FA 3TP0A 4C3IJ 4A93J 1DU0A 4IHWA 1NTCA 1XC5A 2DA5A 4M3BA 2R7ZJ 4MO7A 2E2IJ 3K7AJ 2XGCA 3MKLA 3LNQA 4UUSA 2H1KA 2LR8A 3PO2J 5EYRA 4JX5A 2VKEA 1FEXA 3DEWA 3HGGA 1QRYA 3A02A 2EQRA 3BTLA 2EZLA 3BG5A 2TCTA 5J1YA 3S16J 2R92J 1T56A 1JKRC 3MVPA 1FJLA 3O8HA 5EGOB 5IYDJ 2EZIA 3JRFA 3A01B 3JRAA 2NVQJ 4X1EA 4C3JJ 3UKGA 3LSPA 3BR5A 1FIPA 5GP9A 3NAUA 4XICA 2L7FP 2QCOA 2WV1A 4D7NA 1TC3C 1UG2A 5M5WJ 3HEFA 4QSHA 3HBLA 2HOAA 5C44J 3FIWA 4XK4A 2HI3A 2XPUA 5IPAA 1GVDA 2R93J 3M3YJ 3JRDA 1HCRA 5EF6A 1MH4A 2LFBA 2N8GA 5J3LA 3S1RJ 1GUUA 2M0CA 4A3FJ 2B63J 3MN2A 3C2BA 2O7OA 1IC8A 1RR7A 4DZPA 2RAEA 2Y30A 5EZHA 3JR9A 1ETXA 1IJWC 3S1MJ 3LSRA 1HLVA 4CYCA 2DA6A 1F36A 3CDLA 1IDYA 2XPWA 3BR1A 3GTJJ 5IP9J 2DMTA 2DA1A 3BR3A 2ID3A 2GLOA 3HM5A 5M3MJ 2YU9J 2ME6A 5IYBJ 5GPAA 3LSJA 1H8AC 5F27A 1BW6A 2JA8J 3IH2A 4FISA 4M6VA 2HOTA 3BT9A 1ENHA 2Y31A 5EZGA 4S0HB 4BY7J 2VKVA 5IOYA 3DCFA 1W0TA 1AKHA 1ETKA 1MBFA 2CJJA 1CQTA 3GTOJ 3JREA 1MH3A 2LKXA 2AO9A 3Q0UA 1XS9A 5K7ZA 2L9RA 4A3GJ 4I6ZA 1HDPA 3OSFA 2W48A 2XB5A 1B72B 3TW7A 1VFCA 3PM1A 1UMQA 1IV6A 2NVTJ 3S2HJ 3BR2A 4Y52J 3S14J 1JT6A 5JLWA 4BBSJ 2E1OA 4MFDA 3ZOBA 2LY9A 2HQ5A 2FD5A 2R5YA 1FTZA 5IOZA 3Q0WA 4JX6A 4UUSB 1TWAJ 2TRTA 5C3EJ 1U8BA 2NOGA 1WI3A 2E2HJ 2JA7J 2ECCA 3FISA 2KT0A 1WH7A 1IGNA 2NVXJ 2X9DA 2NS7A 3GTKJ 1BL0A 2Y9ZA 5DS9A 1IRZA 3S1NJ 3HKZN 3PO3J 2COBA 5M5YJ 1NK3P 3IH4A 1U9NA 2LK2A 3M4OJ 2ELKA 1ETYA 2G0EA 2JK3A 4A69C 4XIDA 4FE4A 5F0CA 4A3KJ 3BG3A 4XRSG 5FKOA 1JKQC 3IH3A 1G2HA 2DN0A 4BBRJ 2FQ4A 5EG0A 5HODA 1ZR2A 2HYJA 2XB0X 5C4XJ 4BY1J 3Q3SA 1GT0C 2DA3A 3RZDJ 1WGXA 1QVUA 1WPKA 1JUPA 2JN6A 3H0GJ 2DTZA 4AUXA 3F0CA 1OCTC 3ZQHA 2K40A 2YS9A 1U78A 3RQIA 3D1NI 3SJMA 3VPRA 1AHDP 4DYCA 2XGDA 3IV5A 4ABZA 3JRHA 5BNGA 1UHSA 1NK2P 2L7MP 1ZR4A 3BR0A 1K61A 5FKLA 2L0KA 1MBEA 3L1PA 3BTIA 1LE8B 3I4NJ 4MLOA 1DU6A 1T33A 3HDDA 4JX4A 4DYQA 5GPCA 4RBOA 3BTCA 4A3EJ 4CYCB 1JT0A 1BJZA 1IDZA 2MSYA 4A3IJ 1VNDA 1LE8A 1I3QJ 5F1JA 2IBDA 1ITYA 1VI0A 2EBIA 2HXOA 3S15J 1O4XA 2X6OA 1P7IA 2LP0A 2MG4A 3BG9A 2AHQA 3ZQCA 2IAIA 3QQAA 2CU7A 4X6AJ 3OSGA 2H8RA 4C2MJ 4QTRA 3HOUJ 4UUTA 1OJLA 3GTLJ 3WHCA 4D5CA 2EZKA 2XRLA 4V2FA 1AKHB 2E2JJ 3HOZJ 1RKWA 3ZQGA 1X58A 5E3NA 3JRCA 4IEJA 1I6HJ 2VPRA 2NS8A 4B4CA 3E7LA 1IUFA 5J1UA 1JTYA 1B8IA 4DYRA 3HOYJ 5E3LA 1FTTA 9ANTA 2O8KA 5FLVA 4XRSA 2ID6A 3JRBA 5F04A 2IEKA 3B6CA 1JKOC 4EEFG 2L7ZA 2R5YB 3H3VK 1ETOA 2XGEA 2DMUA 1RPWA 5FJ8J 2HDDA 1ETWA 4B3AA 2CUEA 1ORKA 1OFCX 1VF9A 3CMYA 1WCMJ 2Y9YA 2P81A 5FKKA 2M34A 3QPLA 3B6AA 1D5YA 2Y0SN 1H89C 1JTXA 4D7MA 1QPIA 1ZKGA 2HOSA 5M5XJ 5IYCJ 2WAQN 3Q0VA 2ZB9A 4W1UA 3SDGA 4FCYA 2OPTA 1TWFJ 1HF0A 4A3MJ 2DMQA 4HNVA 1LFBA 3I4MJ 1MBJA 5IP7J 2R5ZB 3JRGA 1JJ8C 2MGQA 3RZOJ 1R9TJ 4A3CJ 2GM4A 5EG0B 1APLC 4A3LJ 3HOWJ 4IHYA 4DZJA 3TW6A 1PUFB 4FE7A 3S1QJ 3GTMJ 2R5ZA 1Q1VA 2FX0A 4MFEA 2JA5J 1SFOJ 1OCPA 1JGGA 3BTJA 4J19A 1EF4A 1AU7A 1MSEC 2XPVA 4IHVA 4DW6A 1TWCJ 1PUFA 1RKTA 3HOXJ 2M2EA 1ETVA 3G1LA 2ME0A 4Y7NJ 2KDZA 2VUMJ 2DMNA 2OF7A 5EEAA 4GFBA 2CQXA 5K7FA 1XG1A 3S17J 2K9NA 4XRMA 1TWGJ 1ZK8A 2JMWA 5FKNA 3W6VA 2VI6A 2YUSA 4B1RA 1A5JA 4BKXA 4G12A 1WH5A 1MSFC 3LOCA 2K9QA 3O8GA 1HDDC 4AC0A 1ZTRA 5E3OA 4M3EA 4MIMA 3BR6A 1P7JA 3WHBA 2EH3A 2PMZN 2JA6J 3GTPJ 4A3DJ 4LOCA 1I50J 1YRNB 1MNMC 1SANA 1JUSA 3RKQA 4C3HJ 5EGOA 2LTPA 2WB1N 2GBYA 2MW8A 3A01A 3CCYA 2CRGA 1ETQA 2FJ1A 2LLKA 2M9HA 5E3MA 5DTDA 1YRNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IG7 A;  5J1R A;  2DMP A;  4V2G A;  2CUF A;  3CQZ J;  2K9S A;  3TP3 A;  2E19 A;  3OIO A;  1Y1W J;  5FLM J;  2JWT A;  1F43 A;  1MBG A;  5F0H A;  3BQZ A;  3ZQI A;  1TWH J;  2HXI A;  4FTH A;  1BA5 A;  4M3G A;  3GTQ J;  5M3F J;  2JJ7 A;  3FKI J;  3OOU A;  3QPS A;  4NDL A;  5JLX A;  2DJN A;  5K7H A;  1HOM A;  3HB9 A;  1B8I B;  1W0U A;  1POG A;  3G1M A;  4W97 A;  1X2M A;  3A03 A;  2DA4 A;  2QF7 A;  1GV5 A;  1MBH A;  5IP6 A;  3ZQL A;  1FIA A;  5F08 A;  1ZGW A;  3S2D J;  3FK6 A;  2EZH A;  2DA2 A;  3HGY A;  2Y2Z A;  1A6I A;  5F0F A;  1GDT A;  1MBK A;  3FK7 A;  3HOV J;  4M3D A;  1LFU P;  1BW5 A;  1ZQ3 P;  1K83 J;  1Z0X A;  2I10 A;  2R0Q C;  2O9L A;  1U9O A;  1E3O C;  2XSD C;  4A3B J;  1GV2 A;  2LD5 A;  4RDU A;  1H88 C;  2X48 A;  2LVS A;  3GBG A;  4AYB N;  5EDN A;  4A3J J;  2M8G X;  3NAR A;  3G1O A;  4I76 A;  2D5V A;  1JUM A;  3SFI A;  4IHX A;  2NVY J;  4JP0 A;  4BXX J;  1X2N A;  1JJ6 C;  3TED A;  4JYK A;  5C4J J;  1Y1V J;  2DA7 A;  4L5E A;  1S7E A;  2ECB A;  1RES A;  4D5F A;  3K2A A;  2CQQ A;  4QIW N;  1JKP C;  1B72 A;  3BQY A;  3ZQF A;  3GTG J;  1QVT A;  1RET A;  5FKM A;  3LSG A;  3JRI A;  1Z77 A;  4M3F A;  3TP0 A;  4C3I J;  4A93 J;  1DU0 A;  4IHW A;  1NTC A;  1XC5 A;  2DA5 A;  4M3B A;  2R7Z J;  4MO7 A;  2E2I J;  3K7A J;  2XGC A;  3MKL A;  3LNQ A;  4UUS A;  2H1K A;  2LR8 A;  3PO2 J;  5EYR A;  4JX5 A;  2VKE A;  1FEX A;  3DEW A;  3HGG A;  1QRY A;  3A02 A;  2EQR A;  3BTL A;  2EZL A;  3BG5 A;  2TCT A;  5J1Y A;  3S16 J;  2R92 J;  1T56 A;  1JKR C;  3MVP A;  1FJL A;  3O8H A;  5EGO B;  5IYD J;  2EZI A;  3JRF A;  3A01 B;  3JRA A;  2NVQ J;  4X1E A;  4C3J J;  3UKG A;  3LSP A;  3BR5 A;  1FIP A;  5GP9 A;  3NAU A;  4XIC A;  2L7F P;  2QCO A;  2WV1 A;  4D7N A;  1TC3 C;  1UG2 A;  5M5W J;  3HEF A;  4QSH A;  3HBL A;  2HOA A;  5C44 J;  3FIW A;  4XK4 A;  2HI3 A;  2XPU A;  5IPA A;  1GVD A;  2R93 J;  3M3Y J;  3JRD A;  1HCR A;  5EF6 A;  1MH4 A;  2LFB A;  2N8G A;  5J3L A;  3S1R J;  1GUU A;  2M0C A;  4A3F J;  2B63 J;  3MN2 A;  3C2B A;  2O7O A;  1IC8 A;  1RR7 A;  4DZP A;  2RAE A;  2Y30 A;  5EZH A;  3JR9 A;  1ETX A;  1IJW C;  3S1M J;  3LSR A;  1HLV A;  4CYC A;  2DA6 A;  1F36 A;  3CDL A;  1IDY A;  2XPW A;  3BR1 A;  3GTJ J;  5IP9 J;  2DMT A;  2DA1 A;  3BR3 A;  2ID3 A;  2GLO A;  3HM5 A;  5M3M J;  2YU9 J;  2ME6 A;  5IYB J;  5GPA A;  3LSJ A;  1H8A C;  5F27 A;  1BW6 A;  2JA8 J;  3IH2 A;  4FIS A;  4M6V A;  2HOT A;  3BT9 A;  1ENH A;  2Y31 A;  5EZG A;  4S0H B;  4BY7 J;  2VKV A;  5IOY A;  3DCF A;  1W0T A;  1AKH A;  1ETK A;  1MBF A;  2CJJ A;  1CQT A;  3GTO J;  3JRE A;  1MH3 A;  2LKX A;  2AO9 A;  3Q0U A;  1XS9 A;  5K7Z A;  2L9R A;  4A3G J;  4I6Z A;  1HDP A;  3OSF A;  2W48 A;  2XB5 A;  1B72 B;  3TW7 A;  1VFC A;  3PM1 A;  1UMQ A;  1IV6 A;  2NVT J;  3S2H J;  3BR2 A;  4Y52 J;  3S14 J;  1JT6 A;  5JLW A;  4BBS J;  2E1O A;  4MFD A;  3ZOB A;  2LY9 A;  2HQ5 A;  2FD5 A;  2R5Y A;  1FTZ A;  5IOZ A;  3Q0W A;  4JX6 A;  4UUS B;  1TWA J;  2TRT A;  5C3E J;  1U8B A;  2NOG A;  1WI3 A;  2E2H J;  2JA7 J;  2ECC A;  3FIS A;  2KT0 A;  1WH7 A;  1IGN A;  2NVX J;  2X9D A;  2NS7 A;  3GTK J;  1BL0 A;  2Y9Z A;  5DS9 A;  1IRZ A;  3S1N J;  3HKZ N;  3PO3 J;  2COB A;  5M5Y J;  1NK3 P;  3IH4 A;  1U9N A;  2LK2 A;  3M4O J;  2ELK A;  1ETY A;  2G0E A;  2JK3 A;  4A69 C;  4XID A;  4FE4 A;  5F0C A;  4A3K J;  3BG3 A;  4XRS G;  5FKO A;  1JKQ C;  3IH3 A;  1G2H A;  2DN0 A;  4BBR J;  2FQ4 A;  5EG0 A;  5HOD A;  1ZR2 A;  2HYJ A;  2XB0 X;  5C4X J;  4BY1 J;  3Q3S A;  1GT0 C;  2DA3 A;  3RZD J;  1WGX A;  1QVU A;  1WPK A;  1JUP A;  2JN6 A;  3H0G J;  2DTZ A;  4AUX A;  3F0C A;  1OCT C;  3ZQH A;  2K40 A;  2YS9 A;  1U78 A;  3RQI A;  3D1N I;  3SJM A;  3VPR A;  1AHD P;  4DYC A;  2XGD A;  3IV5 A;  4ABZ A;  3JRH A;  5BNG A;  1UHS A;  1NK2 P;  2L7M P;  1ZR4 A;  3BR0 A;  1K61 A;  5FKL A;  2L0K A;  1MBE A;  3L1P A;  3BTI A;  1LE8 B;  3I4N J;  4MLO A;  1DU6 A;  1T33 A;  3HDD A;  4JX4 A;  4DYQ A;  5GPC A;  4RBO A;  3BTC A;  4A3E J;  4CYC B;  1JT0 A;  1BJZ A;  1IDZ A;  2MSY A;  4A3I J;  1VND A;  1LE8 A;  1I3Q J;  5F1J A;  2IBD A;  1ITY A;  1VI0 A;  2EBI A;  2HXO A;  3S15 J;  1O4X A;  2X6O A;  1P7I A;  2LP0 A;  2MG4 A;  3BG9 A;  2AHQ A;  3ZQC A;  2IAI A;  3QQA A;  2CU7 A;  4X6A J;  3OSG A;  2H8R A;  4C2M J;  4QTR A;  3HOU J;  4UUT A;  1OJL A;  3GTL J;  3WHC A;  4D5C A;  2EZK A;  2XRL A;  4V2F A;  1AKH B;  2E2J J;  3HOZ J;  1RKW A;  3ZQG A;  1X58 A;  5E3N A;  3JRC A;  4IEJ A;  1I6H J;  2VPR A;  2NS8 A;  4B4C A;  3E7L A;  1IUF A;  5J1U A;  1JTY A;  1B8I A;  4DYR A;  3HOY J;  5E3L A;  1FTT A;  9ANT A;  2O8K A;  5FLV A;  4XRS A;  2ID6 A;  3JRB A;  5F04 A;  2IEK A;  3B6C A;  1JKO C;  4EEF G;  2L7Z A;  2R5Y B;  3H3V K;  1ETO A;  2XGE A;  2DMU A;  1RPW A;  5FJ8 J;  2HDD A;  1ETW A;  4B3A A;  2CUE A;  1ORK A;  1OFC X;  1VF9 A;  3CMY A;  1WCM J;  2Y9Y A;  2P81 A;  5FKK A;  2M34 A;  3QPL A;  3B6A A;  1D5Y A;  2Y0S N;  1H89 C;  1JTX A;  4D7M A;  1QPI A;  1ZKG A;  2HOS A;  5M5X J;  5IYC J;  2WAQ N;  3Q0V A;  2ZB9 A;  4W1U A;  3SDG A;  4FCY A;  2OPT A;  1TWF J;  1HF0 A;  4A3M J;  2DMQ A;  4HNV A;  1LFB A;  3I4M J;  1MBJ A;  5IP7 J;  2R5Z B;  3JRG A;  1JJ8 C;  2MGQ A;  3RZO J;  1R9T J;  4A3C J;  2GM4 A;  5EG0 B;  1APL C;  4A3L J;  3HOW J;  4IHY A;  4DZJ A;  3TW6 A;  1PUF B;  4FE7 A;  3S1Q J;  3GTM J;  2R5Z A;  1Q1V A;  2FX0 A;  4MFE A;  2JA5 J;  1SFO J;  1OCP A;  1JGG A;  3BTJ A;  4J19 A;  1EF4 A;  1AU7 A;  1MSE C;  2XPV A;  4IHV A;  4DW6 A;  1TWC J;  1PUF A;  1RKT A;  3HOX J;  2M2E A;  1ETV A;  3G1L A;  2ME0 A;  4Y7N J;  2KDZ A;  2VUM J;  2DMN A;  2OF7 A;  5EEA A;  4GFB A;  2CQX A;  5K7F A;  1XG1 A;  3S17 J;  2K9N A;  4XRM A;  1TWG J;  1ZK8 A;  2JMW A;  5FKN A;  3W6V A;  2VI6 A;  2YUS A;  4B1R A;  1A5J A;  4BKX A;  4G12 A;  1WH5 A;  1MSF C;  3LOC A;  2K9Q A;  3O8G A;  1HDD C;  4AC0 A;  1ZTR A;  5E3O A;  4M3E A;  4MIM A;  3BR6 A;  1P7J A;  3WHB A;  2EH3 A;  2PMZ N;  2JA6 J;  3GTP J;  4A3D J;  4LOC A;  1I50 J;  1YRN B;  1MNM C;  1SAN A;  1JUS A;  3RKQ A;  4C3H J;  5EGO A;  2LTP A;  2WB1 N;  2GBY A;  2MW8 A;  3A01 A;  3CCY A;  2CRG A;  1ETQ A;  2FJ1 A;  2LLK A;  2M9H A;  5E3M A;  5DTD A;  1YRN A; 
#chains in the Genus database with same CATH topology
 1J9I A;  1XSD A;  4RB0 A;  3F22 A;  3FXJ A;  4A0Y A;  4Y17 A;  4ZJZ A;  4I01 A;  3CQZ J;  5H6Q A;  4IHT A;  2K9S A;  3TP3 A;  5LBQ A;  3J7A Y;  4L9N A;  3GZ5 A;  3NRV A;  1LVK A;  1BA5 A;  1TWH J;  2MH2 A;  1OKR A;  4M9S A;  5HLH A;  1DPU A;  3OOU A;  3ZMV A;  1P92 A;  3B73 A;  1BM9 A;  1X4P A;  5K7H A;  2ZME B;  1W0U A;  2BHZ A;  2OZ6 A;  2W57 A;  3G1M A;  3CJR B;  3BCB A;  2CSO A;  1X2M A;  4LB6 B;  2DLL A;  3ZN0 A;  5LFA A;  4L5J A;  1LEA A;  1GV5 A;  1WJE A;  1J7K A;  3C18 A;  2ZNZ A;  3WU1 B;  2XAG A;  2P7V B;  1IAW A;  5GTI C;  5EJC A;  2F4M B;  2PX9 A;  1BC8 C;  5KK1 A;  2CW8 A;  3E5X A;  3MKZ A;  4CHU A;  4JBA A;  3HOV J;  4M3D A;  2MLG A;  4G9Y A;  1QU3 A;  1K83 J;  4P9F A;  4CCK A;  2H94 A;  2A07 F;  4QWQ A;  5FRM A;  2H09 A;  3WTT C;  1U9O A;  1QZE A;  3DPT A;  2LD5 A;  1H88 C;  5KAI C;  5A2Q K;  1JHH A;  4XLA A;  4AYB N;  1E2X A;  3CCS I;  3BZ6 A;  2Q2E A;  3F9K A;  1FNN A;  2M8G X;  2BEO A;  1HKS A;  4OIR F;  2D5V A;  2XHK A;  1BN5 A;  4IKF A;  4LIT A;  3AG2 H;  3QP5 A;  3B02 A;  4YIF A;  3H1C A;  1EJ9 A;  2Z33 A;  1M1E B;  4BXX J;  2Z1D A;  5DD4 A;  2LOO A;  2Y0S A;  3SEZ A;  2A6E F;  1RUN A;  2BV6 A;  3DEU A;  3M8F A;  3I4P A;  1DP7 P;  2PG4 A;  3K2A A;  1JKP C;  5CVU A;  2OC6 A;  3I5U A;  1QVT A;  3LL7 A;  5CPR B;  4C3I J;  1T0F C;  1D5V A;  2EA2 A;  1NTC A;  1XC5 A;  4IZZ A;  4BAY A;  4XLE A;  3WGI A;  4Y13 A;  4E6K G;  4M3B A;  5DV5 A;  2R7Z J;  2E2I J;  1VQN I;  3HHG A;  2G7U A;  4GXO A;  4UUS A;  1WWX A;  2NNN A;  1YG2 A;  2IS6 A;  3H35 A;  3U9G A;  4RAY A;  2H1K A;  1VQ9 I;  4D9J A;  2E71 A;  1ZYR F;  2B0L A;  5HS9 A;  2DDB A;  3QU3 A;  3I64 A;  4WXH A;  1O7L A;  1QRY A;  1DGW Y;  3BTL A;  3BG5 A;  3GFJ A;  2RQP A;  3S16 J;  3RI4 A;  1RRJ A;  5J8C A;  1FBQ A;  5LGT A;  4PJM A;  2OTL I;  3OYJ A;  3HOT A;  2EIL H;  3H9G A;  1KON A;  5DCM B;  3JRF A;  5IYD J;  2VKD A;  4EJU A;  3A01 B;  4ZYG A;  1E3P A;  4BE0 A;  3IHU A;  3ASO H;  2K3F A;  4CZC A;  3JRA A;  3V8J A;  1N78 A;  2EFP A;  5BS6 A;  3LSP A;  3F6V A;  3RTR A;  2BXY A;  4HV5 A;  3K4K A;  2DW4 A;  2QCO A;  2WV1 A;  2A6H F;  1QNT A;  2COM A;  3R4K A;  3FXO A;  2OQG A;  3HTU A;  2KIQ A;  2FNP A;  2PMZ A;  2R7Q A;  5C44 J;  3RCO A;  1MGT A;  5L3B A;  4XK4 A;  1XN7 A;  2HI3 A;  2P5L C;  1YIT I;  1YJW I;  1WI9 A;  3ABL H;  4ON0 A;  1YS7 A;  1A04 A;  1B1B A;  4ZZL A;  2MC4 A;  2R7X A;  4G7Z F;  4RB3 C;  1WJA A;  2OCE A;  4B3X A;  2P6S A;  3KZZ A;  3MN2 A;  3C2B A;  1P9Q C;  2K9L A;  2XF6 A;  1MMA A;  4UUV A;  1W7P D;  2RDP A;  2Y30 A;  3QAH A;  1V54 H;  4KA4 A;  3IAM 2;  1TNS A;  4ZDP A;  3LSR A;  4XBF A;  3R61 A;  2V7F A;  5LHI A;  2CMP A;  3LSH A;  4CYC A;  2DA6 A;  3PSF A;  2XPW A;  3QYB A;  5IP9 J;  4IHS A;  1FZP B;  3ZXS A;  5GAD J;  2HZT A;  3RYP A;  3ESW B;  3HM5 A;  1SEU A;  4AD9 A;  3MMY B;  4FX4 A;  2ZFW A;  2RNJ A;  3T1B A;  3LSJ A;  3S8P A;  1H8A C;  2ETH A;  3HJE A;  1QQI A;  3TQN A;  4FIS A;  3I55 I;  2GIZ A;  1MD0 A;  4XQF A;  2FBH A;  2W24 A;  1SD5 A;  2Q0O A;  3BT9 A;  4G7H F;  1ENH A;  2R7V A;  5EZG A;  5F64 A;  4YFN F;  2R7R A;  1QBJ A;  4S04 A;  2VKV A;  5IOY A;  2CV1 A;  2LF7 A;  4ITV A;  1AKH A;  4A6D A;  3BJO A;  1FY7 A;  1MJA A;  3FXK A;  1G3T A;  2LKX A;  2L3D A;  3KLN A;  1XGN A;  1XS9 A;  4A3G J;  2W48 A;  1SFK A;  2LKP A;  4LLL A;  1UMQ A;  2HS5 A;  4C2T A;  1MND A;  3S14 J;  4UB6 C;  4Z6Y A;  3OYC A;  2VE9 A;  1SD6 A;  4EM2 A;  3ZOB A;  3FMQ A;  3EPZ A;  2L5Q A;  1F5T A;  1X1A A;  4X0G A;  1U5T A;  2VPL A;  1LDK B;  4UUS B;  2P6T A;  4M6Y A;  2TRT A;  5C3E J;  1F9N A;  1T6S A;  1TNT A;  3W2A A;  2ECC A;  3MQ0 A;  2JA7 J;  1OCO H;  1BOA A;  2KT0 A;  3W3C A;  2IT0 A;  3L2C A;  2IGO A;  3KCC A;  1DDN A;  2PJR B;  3J81 Z;  1Y0N A;  1R00 A;  2HYG D;  4A6E A;  2EK5 A;  4H0E A;  3HKZ N;  4BQQ A;  4OWR B;  4R79 A;  5FRN A;  4CIC A;  5ILS A;  3HSR A;  1J59 A;  3M4O J;  4MTD A;  2ELK A;  1ETY A;  2JK3 A;  5DD8 A;  4A69 C;  2E1M B;  4XID A;  1SVO A;  4KDP A;  4B47 A;  3JTH A;  4CDG A;  3IH3 A;  4XR6 A;  4BBR J;  4HRI A;  2K02 A;  1I39 A;  4BJ5 C;  3L9F A;  4E4H A;  1ZG1 A;  1QVU A;  1WPK A;  3H0G J;  3K4L A;  2DTZ A;  4RA2 A;  4EVI A;  3D5S C;  1OCT C;  3OIQ A;  3ZQH A;  2XIG A;  3DU6 A;  5CKT A;  2B7E A;  1I5Z A;  1YHQ I;  3SJM A;  3CUQ C;  4RGR A;  3VPR A;  1AHD P;  2QKM B;  1IRF A;  2XGD A;  4ABZ A;  2IS1 A;  2DOF A;  1Y56 A;  1ACI A;  1K61 A;  2P4W A;  5FD6 A;  3SFZ A;  3L1P A;  1R1U A;  3I9V 2;  3R60 A;  1WZ2 A;  4MLO A;  5HOO A;  2CQK A;  2JSP A;  1SFU A;  2K5C A;  4JX4 A;  4A3E J;  1UCR A;  1UHW A;  3BTC A;  3DPL C;  4CYC B;  4YFK F;  2MSY A;  4F7Z A;  3FWE A;  1VND A;  2DYR H;  3Q9S A;  3GLX A;  5F1J A;  4I99 C;  4O6J A;  4P1W A;  2EBI A;  2HXO A;  2JVG A;  4PFO A;  4E7I A;  4UVA A;  3GXO A;  1N75 A;  3LST A;  3GVA A;  3T8R A;  1JXS A;  4ZC3 A;  1G4D A;  4NNJ A;  2KRH A;  2IAI A;  3ZQC A;  2BVM A;  4N4N B;  4PGH A;  5DUK A;  3OSG A;  2H8R A;  2KFD A;  4F91 B;  4G6D A;  2PQ8 A;  2KJB A;  5J8F A;  4EAT A;  4M71 A;  4U0W A;  2QGU A;  5CYV A;  1AKH B;  3DBH B;  4UV9 A;  2XAQ A;  2LY2 A;  3TDZ C;  1NH3 A;  3HTS B;  3H5A A;  2BY0 A;  2VJ4 A;  2V6C A;  3DU5 A;  1I6H J;  1PJR A;  5IT3 A;  2VOD A;  2DFE A;  2NVU B;  1SC7 A;  4DYR A;  4KNY A;  3UR3 C;  1YS6 A;  5E3L A;  4GCV A;  1Z7L A;  9ANT A;  2O8K A;  5FLV A;  1FTT A;  2ID6 A;  2BY3 A;  1TQM A;  1W7P A;  2WAD A;  1X19 A;  1R6R A;  3B6C A;  2LY1 A;  1YW8 A;  1UB9 A;  1I27 A;  2L7Z A;  1SFX A;  1U5T B;  2XF7 A;  1EV7 A;  2HDD A;  1ETW A;  1QHH D;  1ORK A;  2ZJQ F;  2QZ8 A;  2QM3 A;  3OYN A;  1OPC A;  2CO5 A;  2LRD A;  2K86 A;  3OL3 A;  3RDI A;  1QPI A;  2O61 A;  2HOS A;  2RRE A;  4RB1 A;  1IUY A;  4E7S A;  4W1U A;  3TMO A;  4LB5 A;  4KIC A;  3SDB A;  3HYI A;  3L2U A;  1HF0 A;  1Z6R A;  1LFB A;  2OD5 A;  3QRF F;  4BHC A;  3JRG A;  5L3D A;  2MGQ A;  4KIG A;  1Q1H A;  5JFR A;  2WAE A;  4HOB A;  1IV8 A;  2GM4 A;  4A3L J;  1APL C;  1LEB A;  1QZY A;  1J5Y A;  2X1D A;  4IHY A;  3I58 A;  3ZMT A;  2M0M A;  1Q1V A;  1XD7 A;  2GA2 A;  4BNC A;  1JGG A;  1X1P A;  2RC4 A;  3LSI A;  2LNB A;  1AU7 A;  2DT7 B;  2PMU A;  2UXX A;  3LSK A;  4P55 A;  4DW6 A;  1TWC J;  4BQA A;  2KZG A;  2WY7 Q;  2W84 A;  3CO6 C;  1YFH A;  1TLH B;  3LSM A;  4KMU X;  4ENM A;  3RPU A;  4O3M A;  2HYF A;  5HDG A;  2LF8 A;  3GYH X;  2QEX I;  5JR3 A;  3ABT A;  3GME A;  1ZK8 A;  4ZYD A;  2Z9O A;  5FKN A;  4AID A;  5DUI A;  4Y4R A;  4B1R A;  1V3F A;  4BKX A;  1YTY A;  1XSV A;  3O8G A;  1HDD C;  1ZLJ A;  1WJC A;  3S3O A;  5ICE A;  4ZTF A;  3G71 I;  3BR6 A;  3EUH A;  1DQU A;  4A3D J;  3GTP J;  3ECO A;  1SAN A;  1YW9 A;  3RKQ A;  2K4B A;  3N4M A;  2ZC2 A;  4IVN A;  2WWY A;  1XB4 A;  3FZV A;  2LC2 A;  4XLC A;  3MZ8 A;  3ZQQ A;  1BC7 C;  4E70 A;  1IN4 A;  1KU3 A;  5B3S H;  3RIR A;  1STZ A;  2Q1Z B;  3F8B A;  2R3S A;  2DMP A;  1BOB A;  4XOR A;  2XRN A;  3J7Y J;  1WSU A;  4C30 A;  2R7D A;  4CCN A;  1F43 A;  5D5W B;  3NWT A;  1S7A A;  1YX5 A;  3BQZ A;  2XVC A;  3ZQI A;  3GTQ J;  5M3F J;  5JLX A;  3J80 K;  4NDL A;  2DJI A;  1HOM A;  2Z5U A;  3HB9 A;  2F5C A;  1OYW A;  2RGV A;  3CCE I;  4W97 A;  3BZC A;  1W7P B;  1KQ8 A;  3OYK A;  2ZXI A;  4BYY A;  3PQJ A;  3OYE A;  4WK8 F;  1MBH A;  1R7J A;  5D5U B;  3ZQL A;  3J7A O;  3IP4 B;  1FIA A;  5D8K B;  2ZME A;  4HDV A;  2FF4 A;  3W6K B;  3E97 A;  2EZH A;  4Q48 A;  3DBR B;  2FEZ A;  2UUZ A;  2HQA A;  4LG3 A;  3WTS C;  3F8M A;  3FXR A;  1MJB A;  3H36 A;  2KJC A;  3ZPL A;  2R0Q C;  4KYW A;  2YX4 A;  3K0L A;  1KGS A;  2IJL A;  2L54 A;  2M87 A;  2LVS A;  4I02 A;  5ICG A;  3FKJ A;  3ZMZ A;  4Y33 A;  5CVR A;  3AFH A;  2NVY J;  2Y48 A;  3M8E A;  3KLO A;  4JP0 A;  2XAH A;  1J09 A;  1I3A A;  1O7F A;  2DK5 A;  5C4J J;  3ELK A;  2QQA A;  5L3G A;  1SD4 A;  2JUC A;  2E35 A;  2JZY A;  1S7E A;  2HPI A;  1YJN I;  1RES A;  4II2 A;  5ICF A;  2A69 F;  1RET A;  3QPT A;  2PN6 A;  2DK8 A;  1O3T A;  2KLO A;  4M3F A;  3JRI A;  1ZRC A;  4A93 J;  4UB8 C;  2KIS A;  3HZJ A;  4XKW A;  2HTJ A;  4HNU A;  1YLF A;  4U0V A;  4MO7 A;  3K7A J;  3IRR A;  1PVE A;  3MKL A;  4DGW B;  1LQ1 A;  1OCZ H;  2ZO4 A;  1VQK I;  3GFM A;  3VWB A;  1A35 A;  4JX5 A;  3E5U A;  2VKE A;  1FEX A;  3HG9 A;  2HWV A;  3I59 A;  3HGG A;  3CO7 C;  2V1D A;  2EPF A;  3ML6 A;  5HS7 A;  1F1Z A;  5DDG A;  3V7R A;  2EA4 A;  1SMY F;  1FX7 A;  1P6R A;  1T56 A;  1EH7 A;  5BQT A;  3FBN B;  3WGH A;  3G6E I;  3DPU A;  3MVP A;  1LKX A;  2XV4 S;  3O8H A;  2VLA A;  4ENK A;  1RZ4 A;  5FRO A;  4LJZ F;  4MHG A;  4X1E A;  2QVO A;  3R0A A;  3ZRG A;  5F6F A;  3KP6 A;  1QGP A;  4C3J J;  3M9A A;  3UKG A;  2M4G A;  3F3X A;  3MFK A;  4PJ0 C;  2KMU A;  4XLN F;  3Q9V A;  3GZ6 A;  5M5W J;  2GXG A;  3DTI A;  3CCJ I;  2HOA A;  3ABM H;  3TOB A;  2DXI A;  4D0P A;  2XPU A;  5IPA A;  1X3Z B;  1GVD A;  2VKH A;  5HDN A;  2FBI A;  1HCR A;  1MH4 A;  4ZDO A;  1ON2 A;  2N8G A;  1K7A A;  2V9V A;  2HGC A;  1GUU A;  2M0C A;  1MMN A;  2B63 J;  2FOK A;  2J5O A;  3HSF A;  3CCM I;  4B48 A;  2HR3 A;  2E7W A;  2O7O A;  3K1M A;  4IXA A;  3G73 A;  2KRF A;  4DZP A;  3F72 A;  4YEJ A;  3CZ6 A;  3IRQ A;  2IGM A;  1MIJ A;  4A0Z A;  2BW3 B;  3DLL F;  1RR8 C;  1TT5 B;  3DQV C;  3M1E A;  1VQL I;  3D0S A;  1HLV A;  3OWT A;  5HVQ C;  1F36 A;  3R0J A;  1RUO A;  3BR1 A;  1IDY A;  3CDL A;  2LH9 A;  4F3Q A;  5AIQ A;  1F4K A;  2DA1 A;  3BR3 A;  3K4B A;  5FO5 A;  2OBP A;  3LFK A;  2YU9 J;  1N25 A;  4ZDL A;  2ME6 A;  5IYB J;  5GPA A;  4CCO A;  3GX4 X;  2Z3Y A;  2ISY A;  2KQR A;  5HLT A;  4OAY A;  4H4K C;  3C2H A;  2GQQ A;  1YYV A;  2YR2 A;  4MQ9 F;  1C0W A;  3VB2 A;  2VBX A;  2OA4 A;  1VQ5 I;  1IRG A;  4U7D A;  3DCF A;  2CQN A;  4AVP A;  1VQM I;  5E17 F;  3KP2 A;  1MBF A;  4HW0 A;  5LRS A;  3JRE A;  1MH3 A;  1XMX A;  2OJE D;  1ZN2 A;  2QSG X;  2DAO A;  5K7Z A;  1XX5 A;  4I6Z A;  3OSF A;  1JHF A;  3O3K A;  1XMA A;  3A2K A;  2DFI A;  1VFC A;  1IV6 A;  2ZSH B;  3BR2 A;  4BUP A;  1JT6 A;  5JLW A;  1UST A;  2ZNY A;  2CYY A;  5K5O A;  4RAF A;  3OS1 A;  2F48 A;  3V8K A;  1K6Y A;  2DTR A;  2JSC A;  5IOZ A;  3JTG A;  3CP8 A;  2ELJ A;  5E20 A;  3Q0W A;  3OYG A;  2JPC A;  3VYT B;  4ZH4 F;  3S2H J;  2VOO A;  5FLX Z;  4ASN A;  2LBF B;  2Y75 A;  1CF7 A;  2FU4 A;  3FIS A;  1MMD A;  4HST A;  1IN5 A;  1PYV A;  1ZRD A;  3I59 B;  2E1N A;  3JW4 A;  3PQK A;  2DQL A;  3TDU C;  4YRV A;  2HVR A;  1Y8Q B;  2WY8 Q;  3L00 A;  2Y9Z A;  2CH0 A;  2BGC A;  4I7H A;  2COB A;  2EJR A;  5M5Y J;  2R7U A;  1NK3 P;  2CUJ A;  3CCR I;  4HNT A;  1U9N A;  5KVR A;  2PJR A;  4RS8 A;  2D2W A;  1CGP A;  1I6X A;  3DWL E;  1TT0 A;  1Y0U A;  5FKO A;  4XLF A;  1G2H A;  4BXF A;  2FQ4 A;  5EG0 A;  2JT1 A;  1ZR2 A;  2HYJ A;  2XB0 X;  3OR1 C;  1MMS A;  3CLO A;  4FT8 A;  3HRS A;  3GEZ A;  3LMM A;  4RM3 A;  2V4J C;  1WGX A;  1VQP I;  1U2W A;  4KJZ A;  4WXD A;  5D5X B;  2XSJ C;  5B66 C;  2Y69 H;  3DXJ F;  4Z2Y A;  3E3V A;  3I71 A;  3RQI A;  1YJ9 I;  4PGG A;  4PSX A;  1TTY A;  2IVM A;  1HXD A;  1OQY A;  2HDW A;  3DF8 A;  4HYE A;  3K69 A;  2WAF A;  3VYU B;  3E6M A;  3CES A;  3ONQ A;  4DBR A;  3HRM A;  1NK2 P;  2L7M P;  3KYD B;  5ERI A;  3SZT A;  2GA1 A;  4II3 A;  1A36 A;  1G6N A;  5FKL A;  2PMH A;  4C9Y A;  1MBE A;  4GGG A;  3ROU A;  2X6Y A;  1O57 A;  3CCL I;  3BTI A;  1QZZ A;  1HW2 A;  5DYM A;  3CCQ I;  1ZH5 A;  2DPU A;  1GHC A;  2NYX A;  3HDD A;  4DYQ A;  5GAE J;  1MNE A;  2JPB A;  3FM3 A;  1JT0 A;  1BJZ A;  5D6F A;  2BE5 F;  3WG9 A;  2RV8 A;  3SQN A;  2F5D A;  2JRT A;  3CMM A;  3OYL A;  3OY9 A;  3J81 K;  2IBD A;  2JTV A;  1VI0 A;  3LWF A;  5LLQ A;  1YO5 C;  2MD5 A;  3CME I;  3S15 J;  4O5V A;  2W25 A;  4FQG A;  4HX4 A;  1D3Y A;  3ZP5 A;  2V9P A;  3S2W A;  2MG4 A;  2X6W A;  4GYG A;  3COA C;  4X6A J;  2V1N A;  3Q5F A;  1OJL A;  3L7W A;  2M1B A;  3F8N A;  2KIF A;  3TL4 X;  2AQF A;  3WHC A;  3BZK A;  2EZK A;  4D5C A;  4S05 A;  4L9V A;  4YIR X;  1S8N A;  3FBI B;  3HOZ J;  1IN8 A;  1FOY A;  5K5Q A;  4HSR A;  3ZN1 A;  2P5V A;  4BEH A;  5TIS C;  1XDU A;  3AAF A;  1HKT A;  4IO9 F;  3RKX A;  4XMY A;  1X58 A;  2QSH X;  1OR7 C;  4Q47 A;  1O3Q A;  1IN7 A;  2VPR A;  5J1U A;  1ERD A;  1JTY A;  4XM3 A;  2IS2 A;  2R4G A;  3AL0 C;  1ONV A;  1FSH A;  1XPX A;  3JRB A;  1W5C C;  1KQ9 A;  2O3F A;  3EQL F;  2IEK A;  1H9G A;  1KU9 A;  3S3N A;  5B1A H;  2DMU A;  4AYB A;  4RLQ A;  4L18 B;  4B3A A;  1CF7 B;  4HG2 A;  4BJT A;  1VF9 A;  3EYY A;  1S7O A;  2OZU A;  2GOM A;  4HAM A;  3CMY A;  1WCM J;  3AG4 H;  4LIV A;  4R1H A;  3CUQ A;  1T2K A;  3I56 I;  2M34 A;  2OAZ A;  1ZRF A;  1NG7 A;  4MEX F;  1H89 C;  4WXC A;  3G3Z A;  2KDO A;  1ZKG A;  1MJ9 A;  1TBX A;  3MWM A;  5J6X A;  5M5X J;  3SDG A;  4BAC A;  2ZB9 A;  4FCY A;  1TWF J;  4A3M J;  4HNV A;  1D0X A;  3QWL A;  3SYT A;  1IXC A;  3I4M J;  5IP7 J;  2R5Z B;  4NC8 A;  1YIJ I;  4XRF A;  1JJ8 C;  3TOA A;  1E17 A;  1TQI A;  3FM5 A;  4OIN F;  1R9T J;  4A3C J;  5D4S A;  1DUX C;  5EG0 B;  4LMY A;  3TW6 A;  4PZJ A;  1PUF B;  1I1S A;  2EFO A;  1AA7 A;  3JAM Z;  3GTM J;  3KET A;  2ISZ A;  2JA5 J;  2LRE A;  4J19 A;  2EIK H;  3C2G A;  2K9M A;  4OAZ A;  4XKC A;  3W6J B;  1VQ4 I;  1YE9 A;  4IHV A;  3SEQ A;  4KIF A;  2L7K A;  1HKQ A;  3QP6 A;  2NAZ A;  2K3P A;  4N4O B;  4YFX F;  3BLY A;  4XNF A;  1MKM A;  3L09 A;  2CV0 A;  1RKT A;  4CSW A;  2KL4 A;  1B59 A;  2L01 A;  2M2E A;  1ETV A;  1TQP A;  2VT3 A;  3G1L A;  2OF7 A;  1UHM A;  4NUB A;  4GFB A;  1TW2 A;  1Z6T A;  3K9T A;  4CH7 A;  3VSK A;  2CQX A;  1IF1 A;  1D8J A;  4QPQ A;  2L4A A;  4XL9 A;  1FLI A;  3T8T A;  1FWZ A;  5FFX A;  4XRM A;  1TWG J;  2QUF A;  4MNU A;  2V6E A;  3W6V A;  3RJP A;  4DQ2 A;  1H9T A;  2YUS A;  1X3U A;  1A5J A;  4HQE A;  2GXB A;  4PK4 A;  3S3M A;  1E0E A;  2E7X A;  1LDJ A;  5BPI A;  2X85 A;  2A3S A;  1R58 A;  5E3O A;  2VQL A;  2JA6 J;  1J2X A;  1I50 J;  1MNM C;  3D5R C;  1V55 H;  1JUS A;  3P7N A;  2DDA A;  5EGO A;  1FBS A;  1TW3 A;  2MW8 A;  3EUA A;  3CCY A;  4IX7 A;  1Y6I A;  2WV0 A;  2X0L A;  4IJA A;  2Z16 A;  3H5R A;  1U6G A;  3M07 A;  1K6O A;  4R8H A;  5J1R A;  4EQQ A;  4L5I A;  1GXP A;  5TJJ A;  2BY1 A;  1WHU A;  3E6B A;  3LFU A;  2W1O A;  2E19 A;  2LKS A;  1Y1W J;  2NXN B;  5FLM J;  3KYL A;  1U0J A;  2JWT A;  4G8X A;  3CCV I;  4BEH B;  1MBG A;  5F0H A;  4ZTJ A;  3SZG A;  3JSO A;  2HXI A;  4FTH A;  4M3G A;  2FML A;  3O2P E;  2P0W A;  3VSL A;  2JJ7 A;  3PNY A;  2JUG A;  2FSW A;  1SFE A;  2DJN A;  5ICC A;  3FXU A;  2Z99 A;  1LB2 A;  2CV2 A;  3PUF A;  3WE2 A;  4HBL A;  2XF5 A;  3WTX C;  1IRX A;  4RMN A;  2V79 A;  3QYE A;  2L9N A;  3R6S A;  2P8T A;  3A03 A;  2DA4 A;  2ZCW A;  4BQN A;  4KIT B;  3RPQ A;  3VYS B;  1ZGW A;  3CP2 A;  3FK6 A;  2M7B A;  3OOP A;  4BE2 A;  2DA2 A;  4BHP A;  1A6I A;  1XGM A;  1GDT A;  4TV7 A;  2HVS A;  1LJ9 A;  3FK7 A;  1LNW A;  1MW7 A;  3VEP A;  1LFU P;  3CUQ B;  3KP3 A;  1FP2 A;  1ZQ3 P;  5HNH A;  3DKX A;  2FBK A;  3K10 A;  4YEL A;  2O9L A;  1N77 A;  3LQQ A;  2QBY A;  1ZHF A;  2XSD C;  1S3J A;  2D1H A;  3WTZ A;  1GV2 A;  4A3B J;  4RDU A;  2X48 A;  2H27 A;  2HQN A;  5EDN A;  2OU2 A;  2L9S A;  5ILU A;  4A3J J;  3WTU C;  1R5I D;  4A12 A;  2IA0 A;  2DYS H;  4ZZD A;  2M3A A;  2DQR A;  4HV6 A;  1JUM A;  4F52 A;  4IHX A;  1X2N A;  2QLZ A;  3H0D A;  1D0Y A;  3KX2 A;  4FET A;  4LK0 F;  3BRO A;  3A0H C;  4L5E A;  4OIP F;  1L0O C;  2ECB A;  4P5O A;  4D5F A;  4OIO F;  1AWC A;  2JVH A;  1YQA A;  4OU0 A;  1R49 A;  1B72 A;  3ZQF A;  3PNT A;  4HF0 A;  4LLN A;  4N9I A;  2CQ7 A;  2OTJ I;  1Z77 A;  3GW2 A;  3TP0 A;  1R71 A;  1JE8 A;  1K78 A;  3I3L A;  3KP7 A;  3HKZ A;  3MKW B;  4ESJ A;  2YSR A;  2WC2 A;  1VZ0 A;  3LNQ A;  2FMY A;  4G6Q A;  2DO7 A;  4UHT A;  2X51 A;  3LQR A;  5BMZ A;  2G7H A;  1X1C A;  2RQQ A;  3KIO A;  4NB5 A;  2LR8 A;  4PUS A;  3PO2 J;  2LMD A;  5EYR A;  2AQE A;  1W36 D;  2HZD A;  2F2E A;  3VDX A;  1LPQ A;  3ERE D;  2CG4 A;  2VJJ A;  3HRT A;  2PI0 A;  1KQ0 A;  2RN7 A;  2R92 J;  3CJQ B;  4BQO A;  4IQ4 A;  3EET A;  1DPR A;  1JKR C;  3M8J A;  3JSP A;  1FJL A;  5H2F C;  4N9H A;  5EGO B;  3DV8 A;  2EZI A;  3U1D A;  5HDK A;  1GLN A;  2IRF G;  4EJV A;  1S6L A;  2AXT C;  2EB7 A;  4BDY A;  2NVQ J;  4ZYE A;  3GWZ A;  4XKV A;  2E5Z A;  2EFN A;  4DIQ A;  3BR5 A;  1FIP A;  4XSZ F;  5LGN A;  5GP9 A;  4RM2 A;  2PBI A;  1ZAO A;  4YG2 F;  2GXA A;  3A0B C;  3PSI A;  4MEY F;  1G3Y A;  1TC3 C;  1R36 A;  2F5V A;  3CJN A;  3TO7 A;  3HBL A;  4ZYH A;  2ZXJ A;  3BC8 A;  1XSX A;  4QPO A;  1WVR A;  2I5U A;  4LLG F;  5GAH J;  2GOX B;  4FX0 A;  3CCU I;  1FC3 A;  1XMK A;  4LIU A;  3M3Y J;  1YI2 I;  2XAJ A;  1REP C;  2KZV A;  1R23 A;  2X1C A;  3LA2 A;  5EF6 A;  3GCM A;  2HNH A;  3BCA A;  5J4V A;  2W7N A;  2LG4 A;  3S1R J;  2XDV A;  4B44 A;  4D1Q A;  2MYS A;  1IC8 A;  2BOL A;  1SAX A;  2R7S A;  1R4N B;  2O5R A;  5EZH A;  3EYI A;  2LSO A;  1ETX A;  5D5V B;  4BH9 A;  3S1M J;  1FT9 A;  1Z3Y A;  2V1U A;  5LD2 C;  5E18 F;  2LDU A;  4RGX A;  4KUM A;  1T38 A;  3HL2 A;  2VON A;  1D0Z A;  3GTJ J;  1FP1 D;  4U87 A;  3V7C A;  1AOY A;  2ZKZ A;  4ESF A;  2EIM H;  2HPM A;  5E1Z B;  2BW3 A;  2GLO A;  2X4H A;  3IWF A;  5FFZ A;  2KRC A;  2BBY A;  4NQW B;  2VJ5 A;  5F27 A;  1BW6 A;  5TRD A;  2QBY B;  4M6V A;  1V5G A;  2HOT A;  3F21 A;  4KN7 X;  2HDC A;  4NC6 A;  1P4A A;  4S0H B;  1HA8 A;  1V5F A;  4RAG A;  3OMY A;  2FRH A;  4BY7 J;  3P9I A;  2EIJ H;  1MDM A;  4RB2 C;  1PUE E;  2CJJ A;  2X1E A;  4A5M A;  4PCQ A;  5CJ9 A;  3GTO J;  1YIO A;  4XKB A;  1PDN C;  3WG7 H;  3HOS A;  3Q0U A;  2HU9 A;  3F8C A;  1B72 B;  2VL8 A;  3PM1 A;  4UVC A;  1ODD A;  4Y52 J;  3ISP A;  1K78 B;  4BBS J;  3K1P A;  2YX7 A;  2E1O A;  2LY9 A;  5ILV A;  2FD5 A;  1FTZ A;  4G94 A;  2DOE A;  2CGP A;  5L3C A;  1ULY A;  1J0R A;  4JX6 A;  1PP7 U;  1TWA J;  3KZY A;  2UXN A;  1RIO H;  2NOG A;  3HHH A;  5K5R A;  1WI3 A;  4WF2 A;  4EV0 A;  1HBX G;  2E2H J;  1T98 A;  2PEX A;  1FOX A;  4N0B A;  4E7K A;  1ZAR A;  3U1K A;  2DBB A;  2X9D A;  4GO1 A;  4AWX B;  1XGO A;  3C7J A;  4P96 A;  3N05 A;  2LBF A;  4JK1 X;  3GTK J;  3P9K A;  2UV1 A;  5DS9 A;  1IRZ A;  5J40 A;  4C2U A;  3PO3 J;  1Y39 A;  1V4R A;  2CW0 F;  4UNO A;  3K1N A;  3KPH A;  2AXL A;  3IH4 A;  4HPQ A;  4PJJ A;  4FAS D;  2E36 A;  2LK2 A;  1A6Q A;  3TBI A;  2K27 A;  2H8W A;  4XN3 A;  4QLC U;  1H0M A;  2A61 A;  1WRJ A;  1WJB A;  1TP4 A;  4XRS G;  3L2V A;  1ZLK A;  2MBF A;  1R4M B;  2DN0 A;  1LFP A;  1RI7 A;  1Z91 A;  4CCM A;  5HOD A;  4BXU A;  3K6G A;  3RZD J;  1BI0 A;  2VBW A;  2IS4 A;  3SXY A;  4AVZ A;  2OQR A;  1JUP A;  2JN6 A;  1SMT A;  3WU2 C;  1UJ8 A;  2RKH A;  2VE8 A;  3F0C A;  4BJ6 C;  2K40 A;  2YS9 A;  1Y8R B;  3D1N I;  2MLK A;  5IT9 Z;  5EEH A;  3PFI A;  4DYC A;  1TZL A;  4GDF A;  2E60 A;  3GUD A;  1UHS A;  1ZR4 A;  2K7L A;  4XLP F;  2DFH A;  1PP8 F;  2DPD A;  1FMV A;  4UVB A;  1O3S A;  1HW1 A;  4EJW A;  1TL8 A;  2RNG A;  3I4N J;  1LE8 B;  2G9W A;  4ANJ A;  4BS9 A;  4J01 A;  3NEU A;  1T33 A;  4Y15 A;  3LAP A;  5FLX K;  4RBO A;  5GPC A;  5DM7 F;  5DEQ A;  1QO0 D;  4L0Z B;  2KIM A;  3KFW X;  2UZK A;  4A3I J;  1BI3 A;  2F4I A;  2W00 A;  1ITY A;  3ASN H;  1Z67 A;  2D1V A;  3QYF A;  5CQE A;  4B09 A;  2X6O A;  1O4X A;  1P7I A;  1T0F A;  2IW5 A;  2LP0 A;  3BG9 A;  1OIS A;  3QQA A;  4EGY A;  3BJA A;  2M8E A;  3ZGK A;  4C2M J;  4QTR A;  3HOU J;  1T08 B;  3K4N A;  3H3Z A;  4PSW A;  2FQ3 A;  4M6X A;  1MDM B;  1IW7 F;  2E2J J;  1UAA A;  1RKW A;  4U0Y A;  4CXF A;  3F23 A;  4L0Y B;  4I98 B;  2CFX A;  4IF4 A;  6PAX A;  3MEX A;  5H6R A;  2Q8K A;  4JQF A;  5E3N A;  4UV8 A;  3RKW A;  1FYL A;  2STT A;  4B4C A;  3T5X A;  3FMS A;  1W36 C;  1B8I A;  1W4M A;  3HOY J;  3HXL A;  3KZI C;  3MD2 A;  5D6E A;  2PJP A;  4GRI A;  1D1A A;  3LA7 A;  4WWC A;  3L2Q A;  2ZSI B;  5F04 A;  1HC8 A;  1B6A A;  1W5T A;  1JKO C;  1G3W A;  2VC0 A;  2CUZ A;  3E0J B;  2XGE A;  4AIJ A;  3H9Q A;  3UNG C;  3AG3 H;  3IWZ A;  3I0T A;  4HF2 A;  1OFC X;  2CFO A;  1WJD A;  2VIX A;  3VFZ A;  4EM0 B;  3AKZ A;  1OLT A;  2ESN A;  5LRR A;  3E5Q A;  3E1S A;  3IC7 A;  4NBQ A;  2E34 A;  3G2B A;  2QYO A;  3BG7 A;  3F6O A;  2VBZ A;  2ZJR F;  4D7M A;  1KU7 A;  1P4X A;  5IYC J;  2WAQ N;  2J5P A;  2EV0 A;  2GWR A;  3V4G A;  3SHF A;  3CF2 A;  2ZJP F;  2DMQ A;  5K1Y A;  2Z2S B;  4EJO A;  4M74 A;  5CVJ A;  3E6D A;  3VOE A;  1MBJ A;  4BE1 A;  2ZXW H;  3OV8 A;  3MZY A;  3JCU C;  3RZO J;  2VN2 A;  1OMI A;  2Y0M A;  4IRG A;  4A5N A;  4CGZ A;  3BJ6 A;  1S5L C;  1L3L A;  1FYM A;  3FXM A;  1T39 A;  1QPM A;  2P7C B;  2CS3 A;  4FE7 A;  3S1Q J;  2L9V A;  2R5Z A;  2FX0 A;  1SFO J;  4I0A A;  4E7Z A;  3OYF A;  3S93 A;  1MSE C;  2RVC A;  2XPV A;  3K70 C;  5E8I A;  3FX3 A;  3GLL A;  1PUF A;  3RSN A;  3TO9 A;  4XOP A;  5KHD A;  3HOX J;  2GAU A;  2KDZ A;  2ME0 A;  1OYY A;  4Y7N J;  3MKY B;  4LD5 A;  1T8I A;  3QOD A;  2AS5 F;  5KCM A;  5K7F A;  5ED4 A;  1Z21 A;  4MQV A;  1XTA A;  2JMW A;  3V8L A;  1LUJ B;  3HPH A;  5E8G A;  4CCJ A;  2VI6 A;  1HSJ A;  5JHU A;  4UY8 I;  4RGS A;  1IZ1 A;  1OR7 A;  4G12 A;  1WH5 A;  2O6G E;  5B1B H;  2R7O A;  1ZEL A;  3LOC A;  3VYR B;  1BI1 A;  2M5W A;  1ZG5 A;  5J47 A;  4AC0 A;  1ZTR A;  2XAU A;  3LA3 A;  4M3E A;  3OS2 A;  2R7T A;  2EV5 A;  3WHB A;  5CLS A;  1YRN B;  3EUK L;  4F55 A;  5JI6 A;  2BVL A;  5EEG A;  5A2Q Z;  2BYV E;  2WB1 N;  2GBY A;  1NHA A;  4BU2 A;  3ULQ B;  2MFZ A;  1XDS A;  2JRM A;  2FJ1 A;  2XC7 A;  5E3M A;  4A3K J;  5DTD A;  3BWG A;  5CVV A;  4BHB A;  1IG7 A;  1EH6 A;  1IXS B;  2BHY A;  4V2G A;  3MZH A;  1RNL A;  2NOJ B;  2CUF A;  2M30 A;  3A1Y A;  5JVG F;  4U88 A;  4DOZ A;  3OIO A;  4XON A;  4LK1 F;  2DU9 A;  4WX9 A;  5LHH A;  2HEO A;  3I54 A;  3JAM K;  3FKI J;  3QPS A;  2HFH A;  2L2O A;  5D8L B;  3PUB A;  2B9S A;  1B8I B;  2ZXH A;  4KIB A;  1POG A;  1Z05 A;  2EFQ A;  3KP4 A;  4L9J A;  4IOA F;  5IP6 A;  2QF7 A;  3FHN A;  2W82 A;  1X4O A;  2ADU A;  3U2R A;  3S2D J;  5F08 A;  3KEY A;  2LYC A;  2E1M C;  3TKY A;  2IGN A;  2KKO A;  4EM1 A;  3CC2 I;  2V1X A;  3HGY A;  3CC7 I;  3FXL A;  2Y2Z A;  2M4K A;  2HKX A;  5F0F A;  1MBK A;  2ELH A;  4LG0 A;  3ZMD A;  3W2W A;  2H6B A;  4F92 B;  3PJR A;  3K4C A;  1BW5 A;  2X6X A;  1FOK A;  3M1C A;  1Z0X A;  2I10 A;  2GIV A;  2Q2E B;  4IL6 C;  4IOC F;  1OCC H;  2VOP A;  3WGG A;  3GF2 A;  3S32 A;  3HPG A;  2A6T A;  3RQ4 A;  3PNV A;  3PFY A;  1FSE A;  4AU7 A;  4DBQ A;  2EV6 A;  1E3O C;  1S29 A;  3TGN A;  1BR4 A;  3D5L A;  3GBG A;  1KYW A;  2FUG 2;  3P9C A;  2M7A A;  4HZF A;  1J75 A;  3C1D A;  3NAR A;  3DKY A;  4MGR A;  1K4T A;  1FBU A;  3G1O A;  4I76 A;  3ZMU A;  3SFI A;  3FF5 A;  4DNC A;  2R7F A;  2BY2 A;  4BGD A;  4KN4 X;  1JJ6 C;  1SVL A;  4JYK A;  3TED A;  3DLA A;  5H20 A;  4KMF A;  4XSX F;  1Y1V J;  2DA7 A;  1UFM A;  3OS0 A;  2CQQ A;  4QIW N;  2WAQ A;  4G6T B;  2FE3 A;  4AIH A;  1EKE A;  2MA3 A;  3BQY A;  3GTG J;  2FA5 A;  3DEE A;  5FKM A;  3LSG A;  3GO5 A;  4EGZ A;  2OV7 A;  1DU0 A;  4IHW A;  2H6C A;  3RPU D;  2WBM A;  1MMG A;  2DA5 A;  4HLY A;  3QU6 A;  2YPR A;  3BOQ A;  2MH9 A;  2XGC A;  1DP3 A;  2OCC H;  3T0Y A;  3BG6 A;  1LDD A;  3TO6 A;  4BL0 B;  4ESB A;  4HEA 2;  4YII A;  5FGM A;  2EIN H;  3E6C C;  2IP2 A;  3DEW A;  3A02 A;  4HX8 A;  2MC3 A;  1Z9C A;  2EQR A;  1RC9 A;  4RLF A;  2EZL A;  2TCT A;  5J1Y A;  1R1T A;  3OYA A;  4KFC A;  4OMY A;  3AL0 B;  4RAZ A;  5HS8 A;  4HF1 A;  4CZZ A;  3DTK A;  1VQ8 I;  1NG6 A;  2DOD A;  4I0B A;  3OL4 A;  2MAB A;  1X1D A;  2ZJ2 A;  1DGR M;  1YOV B;  2M45 A;  3HIF A;  2QWW A;  4PDK A;  3DTE A;  3HSE A;  5JVT A;  1X3W B;  2QQ8 A;  3NAU A;  1X1B A;  4XIC A;  2L7F P;  3QPH A;  1WQ2 A;  4D7N A;  2VXD A;  1FOW A;  1UG2 A;  1K4S A;  1U5T C;  3HEF A;  4QSH A;  4CO8 A;  2EFW A;  3FIW A;  3L2R A;  2KHM A;  2DT6 A;  5TGT A;  5CQG A;  1LVA A;  2R7W A;  2E1C A;  1I1G A;  1D8K A;  2QA4 I;  2A5Y B;  5LEJ A;  2WB1 A;  1ON1 A;  2IXS A;  4LFU A;  1WJ5 A;  2R93 J;  4OOI A;  2F5F A;  3JRD A;  1SVM A;  1BJA A;  1ZG3 A;  3FDY A;  1IN6 A;  4M73 A;  4CUG A;  1XCV A;  1Z3X A;  3L2W A;  2LFB A;  5J3L A;  1YX3 A;  5L3E A;  4A3F J;  1OYI A;  5LEK A;  4ENJ A;  3LAJ A;  1ZGA A;  2NRA C;  1OCR H;  5CVI A;  3V7S A;  4ETS A;  1RR7 A;  2RAE A;  3IKV A;  2OUM A;  3JR9 A;  4Q4Z F;  4M72 A;  1KZH A;  2W4S A;  1KU2 A;  3KEO A;  1EH8 A;  1IJW C;  1UEL B;  5E1W A;  4RGU A;  5LGU A;  2IA2 A;  3RKY A;  1WKM A;  4I2O A;  5BPD A;  3I53 A;  3C3W A;  4LG0 B;  3MCZ A;  4HA8 A;  2DMT A;  4AM3 A;  2ID3 A;  5M3M J;  2HTS A;  1XCB A;  3FXQ A;  3GFL A;  3RYR A;  2ZFU A;  4CCL A;  5LHG A;  1QHG A;  2JA8 J;  3IH2 A;  2F5E A;  2A5W A;  2UWM A;  3PIO F;  2FNA A;  2Y31 A;  4G7O F;  3BY6 A;  1G3S A;  2QQ9 A;  3CJT B;  3HUG A;  4NQW A;  2L4M A;  2V9K A;  1W0T A;  1ETK A;  3ZMS A;  1CQT A;  3PIP F;  3OYB A;  2FXA A;  2AO9 A;  5E79 C;  4EMS A;  5AON A;  2DOA A;  2I8D A;  4L9T A;  4Y3O A;  1O3R A;  2L9R A;  1HDP A;  1HST A;  1U3E M;  2XB5 A;  2WTE A;  3TW7 A;  3ZR8 X;  1MZB A;  1IXR C;  2FOW A;  2VT2 A;  2E5N A;  1KYZ A;  1P2F A;  3OYD A;  2HQR A;  2NVT J;  1GXQ A;  2TDX A;  3CDH A;  4IRH A;  4Q5S F;  4MFD A;  1KA8 A;  1B9M A;  2HQ5 A;  5F1R A;  3GFI A;  3O6B B;  2R5Y A;  1VTN C;  3FHZ A;  2DCE A;  5D4R A;  3MAJ A;  2DFF A;  3OR2 C;  1U8B A;  1G8X A;  2EWN A;  4HLX A;  1A31 A;  4CA0 A;  5DCF A;  5J4Y A;  2VJI A;  4J00 A;  4KIS A;  1Z7U A;  2XRO A;  1WH7 A;  3CDI A;  1IGN A;  2NVX J;  3BDD A;  2NS7 A;  3DKW A;  2XAF A;  3K2Z A;  1JGS A;  3X2Q H;  2QEN A;  1BL0 A;  2PFB A;  2VXZ A;  3S1N J;  3NQO A;  3OYH A;  1VQ7 I;  4B8X A;  3A4C A;  1ZRE A;  1JI8 A;  2A68 F;  3KEQ A;  4PJN A;  4HDU A;  2STW A;  2G0E A;  2YU3 A;  4FE4 A;  5F0C A;  1WJF A;  3BG3 A;  4KT6 A;  2D45 A;  4K2E A;  2KIU A;  2IGK A;  2XGX A;  1JKQ C;  5JHF A;  3FMR A;  2IPQ X;  5FD5 A;  3F8F A;  5C4X J;  3PL8 A;  4XN0 A;  3WTY C;  4BY1 J;  3Q3S A;  2XKO A;  1GT0 C;  2DA3 A;  3ECH A;  1B4A A;  1Z1D A;  1VQ6 I;  2IA1 A;  4AUX A;  3J7Z I;  1V5E A;  2JA2 A;  1U78 A;  3K4J A;  2DT5 A;  2K4J A;  3CUO A;  4NHJ A;  1HQC A;  3IV5 A;  4KT5 C;  1YW7 A;  2QKL B;  5BNG A;  1BBY A;  3JRH A;  1BIB A;  3VOD A;  3BR0 A;  4CYD A;  1U8R A;  4M9Z A;  3M7G A;  2L0K A;  3HC7 A;  1T95 A;  4UXN A;  3BPV A;  3P5J A;  4M9X A;  3WTW C;  2F6C A;  4IPA A;  1DU6 A;  1W1W E;  2XAS A;  3ABU A;  2L02 A;  1IDZ A;  3KP5 A;  2A05 A;  3QOE A;  5DM6 F;  2VQH A;  2NS0 A;  3K70 D;  1LE8 A;  1I3Q J;  1HW5 A;  4E7H A;  2KPM A;  2HKO A;  2K85 A;  1P4W A;  4IRI A;  4E7J A;  2VB6 A;  5FB2 A;  1WFX A;  3H9J A;  4FHT A;  2W85 A;  2AHQ A;  3WE3 A;  2VQG A;  1XGS A;  5E1X A;  2CU7 A;  3H3U A;  3HUG B;  4UUT A;  3EDP A;  1BR2 A;  3GTL J;  3OYI A;  3V42 A;  1K79 A;  3IL2 A;  2XRL A;  4V2F A;  4HX7 A;  4HQM A;  3CF5 F;  1BI2 A;  3ZCO A;  1SAU A;  3IAS 2;  3QOP A;  3ZQG A;  4P9U A;  3JRC A;  4BDZ A;  4ZYA A;  5HNF A;  4IEJ A;  2O0Y A;  4XOT A;  2NS8 A;  3E7L A;  1IUF A;  3WOD F;  2HOE A;  4LGW A;  1USS A;  3BP8 A;  4DJA A;  3EUH C;  4XRS A;  5IT9 K;  2ICW G;  5GAG J;  1R5H A;  4EEF G;  4A2U A;  2R5Y B;  4ENN A;  2QSF X;  1ETO A;  3H3V K;  2BXZ A;  1RPW A;  5FJ8 J;  3CMA I;  1S72 I;  3K4M A;  2CUE A;  1R1V A;  1QA6 A;  3WU0 A;  3KYC B;  4E7L A;  2GZW A;  3N97 A;  3REO A;  2Y9Y A;  2P81 A;  5FKK A;  2F4O B;  5L3F A;  3OYM A;  3QPL A;  3B6A A;  1D5Y A;  2Y0S N;  3HRU A;  3U21 A;  3DFG A;  1JTX A;  2C6Y A;  3CTA A;  3CLQ A;  3Q0V A;  2VAS A;  3DBL B;  1FMW A;  1W5S A;  2OPT A;  1R22 A;  2O03 A;  2XUB A;  2VC1 A;  1G59 A;  1B9N A;  1ZGJ A;  2CW7 A;  4EJT A;  4GYI A;  3IUO A;  3HOW J;  4DZJ A;  3WTV C;  3OIP A;  1FYK A;  2H1L A;  2QQB A;  2ZME C;  1D1B A;  2VQC A;  4MFE A;  3J80 Z;  1OCP A;  3DP7 A;  3BTJ A;  1EF4 A;  3ERM A;  5BOX A;  2ZBK A;  2ACJ A;  3H92 A;  3NWS A;  3ZQ7 A;  4A0X A;  5HLG A;  2PLY A;  4IQJ A;  5AIP A;  4B43 A;  1S9H A;  2NNY A;  4V19 K;  3AG1 H;  2CWE A;  2ESH A;  2MD0 A;  4XLH A;  2XKP A;  2VBY A;  3KE2 A;  4NC7 A;  3CC4 I;  2VUM J;  2DMN A;  4MTE A;  3G4S I;  1UG0 A;  5EEA A;  4PFP A;  1VQO I;  1UZC A;  2BZT A;  4I09 A;  1XG1 A;  3S17 J;  2K9N A;  2HVQ A;  2WA0 A;  3BPX A;  5IY5 H;  1R5G A;  2DI3 A;  1GVJ A;  1MSF C;  3CD6 I;  2K9Q A;  1D1C A;  1EA3 A;  2V26 A;  2JQ7 A;  4AIK A;  4U7B A;  3W2V A;  2P5K A;  4MIM A;  5GTH C;  1P7J A;  2KP6 A;  4JOM A;  2EH3 A;  2PMZ N;  1IO2 A;  4LOC A;  4F93 B;  4OMZ A;  5KNL A;  4PJL A;  3IKT A;  1BIA A;  1FPQ A;  4OIQ F;  3SZP A;  1BR1 A;  4C3H J;  5DCM A;  5B5E C;  2LTP A;  2O8X A;  4WCG A;  3A01 A;  1E3H A;  2CRG A;  1ETQ A;  1SD7 A;  2LLK A;  5KAF C;  3H5N A;  2M9H A;  3ABK H;  3GZN B;  5HLI A;  1YRN A; 
#chains in the Genus database with same CATH homology
 1IG7 A;  5J1R A;  2DMP A;  4V2G A;  2CUF A;  3CQZ J;  2K9S A;  3TP3 A;  2E19 A;  3OIO A;  1Y1W J;  5FLM J;  2JWT A;  1F43 A;  1MBG A;  5F0H A;  3BQZ A;  3ZQI A;  1TWH J;  2HXI A;  4FTH A;  1BA5 A;  4M3G A;  3GTQ J;  5M3F J;  2JJ7 A;  3FKI J;  3OOU A;  3QPS A;  4NDL A;  5JLX A;  2DJN A;  5K7H A;  1HOM A;  3HB9 A;  1B8I B;  1W0U A;  1POG A;  3G1M A;  4W97 A;  1X2M A;  3A03 A;  2DA4 A;  2QF7 A;  1GV5 A;  1MBH A;  5IP6 A;  3ZQL A;  1FIA A;  5F08 A;  1ZGW A;  3S2D J;  3FK6 A;  2EZH A;  2DA2 A;  3HGY A;  2Y2Z A;  1A6I A;  5F0F A;  1GDT A;  1MBK A;  3FK7 A;  3HOV J;  4M3D A;  1LFU P;  1BW5 A;  1ZQ3 P;  1K83 J;  1Z0X A;  2I10 A;  2R0Q C;  2O9L A;  1U9O A;  1E3O C;  2XSD C;  4A3B J;  1GV2 A;  2LD5 A;  4RDU A;  1H88 C;  2X48 A;  2LVS A;  3GBG A;  4AYB N;  5EDN A;  4A3J J;  2M8G X;  3NAR A;  3G1O A;  4I76 A;  2D5V A;  1JUM A;  3SFI A;  4IHX A;  2NVY J;  4JP0 A;  4BXX J;  1X2N A;  1JJ6 C;  3TED A;  4JYK A;  5C4J J;  1Y1V J;  2DA7 A;  4L5E A;  1S7E A;  2ECB A;  1RES A;  4D5F A;  3K2A A;  2CQQ A;  4QIW N;  1JKP C;  1B72 A;  3BQY A;  3ZQF A;  3GTG J;  1QVT A;  1RET A;  5FKM A;  3LSG A;  3JRI A;  1Z77 A;  4M3F A;  3TP0 A;  4C3I J;  4A93 J;  1DU0 A;  4IHW A;  1NTC A;  1XC5 A;  2DA5 A;  4M3B A;  2R7Z J;  4MO7 A;  2E2I J;  3K7A J;  2XGC A;  3MKL A;  3LNQ A;  4UUS A;  2H1K A;  2LR8 A;  3PO2 J;  5EYR A;  4JX5 A;  2VKE A;  1FEX A;  3DEW A;  3HGG A;  1QRY A;  3A02 A;  2EQR A;  3BTL A;  2EZL A;  3BG5 A;  2TCT A;  5J1Y A;  3S16 J;  2R92 J;  1T56 A;  1JKR C;  3MVP A;  1FJL A;  3O8H A;  5EGO B;  5IYD J;  2EZI A;  3JRF A;  3A01 B;  3JRA A;  2NVQ J;  4X1E A;  4C3J J;  3UKG A;  3LSP A;  3BR5 A;  1FIP A;  5GP9 A;  3NAU A;  4XIC A;  2L7F P;  2QCO A;  2WV1 A;  4D7N A;  1TC3 C;  1UG2 A;  5M5W J;  3HEF A;  4QSH A;  3HBL A;  2HOA A;  5C44 J;  3FIW A;  4XK4 A;  2HI3 A;  2XPU A;  5IPA A;  1GVD A;  2R93 J;  3M3Y J;  3JRD A;  1HCR A;  5EF6 A;  1MH4 A;  2LFB A;  2N8G A;  5J3L A;  3S1R J;  1GUU A;  2M0C A;  4A3F J;  2B63 J;  3MN2 A;  3C2B A;  2O7O A;  1IC8 A;  1RR7 A;  4DZP A;  2RAE A;  2Y30 A;  5EZH A;  3JR9 A;  1ETX A;  1IJW C;  3S1M J;  3LSR A;  1HLV A;  4CYC A;  2DA6 A;  1F36 A;  3CDL A;  1IDY A;  2XPW A;  3BR1 A;  3GTJ J;  5IP9 J;  2DMT A;  2DA1 A;  3BR3 A;  2ID3 A;  2GLO A;  3HM5 A;  5M3M J;  2YU9 J;  2ME6 A;  5IYB J;  5GPA A;  3LSJ A;  1H8A C;  5F27 A;  1BW6 A;  2JA8 J;  3IH2 A;  4FIS A;  4M6V A;  2HOT A;  3BT9 A;  1ENH A;  2Y31 A;  5EZG A;  4S0H B;  4BY7 J;  2VKV A;  5IOY A;  3DCF A;  1W0T A;  1AKH A;  1ETK A;  1MBF A;  2CJJ A;  1CQT A;  3GTO J;  3JRE A;  1MH3 A;  2LKX A;  2AO9 A;  3Q0U A;  1XS9 A;  5K7Z A;  2L9R A;  4A3G J;  4I6Z A;  1HDP A;  3OSF A;  2W48 A;  2XB5 A;  1B72 B;  3TW7 A;  1VFC A;  3PM1 A;  1UMQ A;  1IV6 A;  2NVT J;  3S2H J;  3BR2 A;  4Y52 J;  3S14 J;  1JT6 A;  5JLW A;  4BBS J;  2E1O A;  4MFD A;  3ZOB A;  2LY9 A;  2HQ5 A;  2FD5 A;  2R5Y A;  1FTZ A;  5IOZ A;  3Q0W A;  4JX6 A;  4UUS B;  1TWA J;  2TRT A;  5C3E J;  1U8B A;  2NOG A;  1WI3 A;  2E2H J;  2JA7 J;  2ECC A;  3FIS A;  2KT0 A;  1WH7 A;  1IGN A;  2NVX J;  2X9D A;  2NS7 A;  3GTK J;  1BL0 A;  2Y9Z A;  5DS9 A;  1IRZ A;  3S1N J;  3HKZ N;  3PO3 J;  2COB A;  5M5Y J;  1NK3 P;  3IH4 A;  1U9N A;  2LK2 A;  3M4O J;  2ELK A;  1ETY A;  2G0E A;  2JK3 A;  4A69 C;  4XID A;  4FE4 A;  5F0C A;  4A3K J;  3BG3 A;  4XRS G;  5FKO A;  1JKQ C;  3IH3 A;  1G2H A;  2DN0 A;  4BBR J;  2FQ4 A;  5EG0 A;  5HOD A;  1ZR2 A;  2HYJ A;  2XB0 X;  5C4X J;  4BY1 J;  3Q3S A;  1GT0 C;  2DA3 A;  3RZD J;  1WGX A;  1QVU A;  1WPK A;  1JUP A;  2JN6 A;  3H0G J;  2DTZ A;  4AUX A;  3F0C A;  1OCT C;  3ZQH A;  2K40 A;  2YS9 A;  1U78 A;  3RQI A;  3D1N I;  3SJM A;  3VPR A;  1AHD P;  4DYC A;  2XGD A;  3IV5 A;  4ABZ A;  3JRH A;  5BNG A;  1UHS A;  1NK2 P;  2L7M P;  1ZR4 A;  3BR0 A;  1K61 A;  5FKL A;  2L0K A;  1MBE A;  3L1P A;  3BTI A;  1LE8 B;  3I4N J;  4MLO A;  1DU6 A;  1T33 A;  3HDD A;  4JX4 A;  4DYQ A;  5GPC A;  4RBO A;  3BTC A;  4A3E J;  4CYC B;  1JT0 A;  1BJZ A;  1IDZ A;  2MSY A;  4A3I J;  1VND A;  1LE8 A;  1I3Q J;  5F1J A;  2IBD A;  1ITY A;  1VI0 A;  2EBI A;  2HXO A;  3S15 J;  1O4X A;  2X6O A;  1P7I A;  2LP0 A;  2MG4 A;  3BG9 A;  2AHQ A;  3ZQC A;  2IAI A;  3QQA A;  2CU7 A;  4X6A J;  3OSG A;  2H8R A;  4C2M J;  4QTR A;  3HOU J;  4UUT A;  1OJL A;  3GTL J;  3WHC A;  4D5C A;  2EZK A;  2XRL A;  4V2F A;  1AKH B;  2E2J J;  3HOZ J;  1RKW A;  3ZQG A;  1X58 A;  5E3N A;  3JRC A;  4IEJ A;  1I6H J;  2VPR A;  2NS8 A;  4B4C A;  3E7L A;  1IUF A;  5J1U A;  1JTY A;  1B8I A;  4DYR A;  3HOY J;  5E3L A;  1FTT A;  9ANT A;  2O8K A;  5FLV A;  4XRS A;  2ID6 A;  3JRB A;  5F04 A;  2IEK A;  3B6C A;  1JKO C;  4EEF G;  2L7Z A;  2R5Y B;  3H3V K;  1ETO A;  2XGE A;  2DMU A;  1RPW A;  5FJ8 J;  2HDD A;  1ETW A;  4B3A A;  2CUE A;  1ORK A;  1OFC X;  1VF9 A;  3CMY A;  1WCM J;  2Y9Y A;  2P81 A;  5FKK A;  2M34 A;  3QPL A;  3B6A A;  1D5Y A;  2Y0S N;  1H89 C;  1JTX A;  4D7M A;  1QPI A;  1ZKG A;  2HOS A;  5M5X J;  5IYC J;  2WAQ N;  3Q0V A;  2ZB9 A;  4W1U A;  3SDG A;  4FCY A;  2OPT A;  1TWF J;  1HF0 A;  4A3M J;  2DMQ A;  4HNV A;  1LFB A;  3I4M J;  1MBJ A;  5IP7 J;  2R5Z B;  3JRG A;  1JJ8 C;  2MGQ A;  3RZO J;  1R9T J;  4A3C J;  2GM4 A;  5EG0 B;  1APL C;  4A3L J;  3HOW J;  4IHY A;  4DZJ A;  3TW6 A;  1PUF B;  4FE7 A;  3S1Q J;  3GTM J;  2R5Z A;  1Q1V A;  2FX0 A;  4MFE A;  2JA5 J;  1SFO J;  1OCP A;  1JGG A;  3BTJ A;  4J19 A;  1EF4 A;  1AU7 A;  1MSE C;  2XPV A;  4IHV A;  4DW6 A;  1TWC J;  1PUF A;  1RKT A;  3HOX J;  2M2E A;  1ETV A;  3G1L A;  2ME0 A;  4Y7N J;  2KDZ A;  2VUM J;  2DMN A;  2OF7 A;  5EEA A;  4GFB A;  2CQX A;  5K7F A;  1XG1 A;  3S17 J;  2K9N A;  4XRM A;  1TWG J;  1ZK8 A;  2JMW A;  5FKN A;  3W6V A;  2VI6 A;  2YUS A;  4B1R A;  1A5J A;  4BKX A;  4G12 A;  1WH5 A;  1MSF C;  3LOC A;  2K9Q A;  3O8G A;  1HDD C;  4AC0 A;  1ZTR A;  5E3O A;  4M3E A;  4MIM A;  3BR6 A;  1P7J A;  3WHB A;  2EH3 A;  2PMZ N;  2JA6 J;  3GTP J;  4A3D J;  4LOC A;  1I50 J;  1YRN B;  1MNM C;  1SAN A;  1JUS A;  3RKQ A;  4C3H J;  5EGO A;  2LTP A;  2WB1 N;  2GBY A;  2MW8 A;  3A01 A;  3CCY A;  2CRG A;  1ETQ A;  2FJ1 A;  2LLK A;  2M9H A;  5E3M A;  5DTD A;  1YRN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...