4XRMA

Homodimer of tale type homeobox transcription factor meis1 complexes with specific dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
IFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords DNA (5'-D(P*AP*GP*CP*TP*GP*AP*CP*AP*GP*CP*TP*GP*TP*CP*AP*AP*
total genus 21
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xrmA00
1MH3A 2ECCA 4AC0A 1K61A 2COBA 5FKKA 4XRSG 5F08A 2E2JJ 3A02A 2JK3A 2HDDA 4A3BJ 1I50J 1JUPA 1Y1VJ 2XSDC 2IEKA 2Y31A 1HOMA 2ID6A 2L9RA 3TP3A 1A6IA 4A3DJ 5M3FJ 4JX4A 2ELKA 2HI3A 2XGDA 1JKPC 4JX5A 3WHBA 5GP9A 4C3HJ 2P81A 3G1OA 4B4CA 1IJWC 3QPLA 3PO2J 4MFDA 4JX6A 5IP9J 2NOGA 2DJNA 4I76A 5EF6A 2QCOA 1JTYA 4DYCA 5E3OA 2EBIA 1H88C 3BG3A 3BQZA 4X6AJ 1HF0A 3DCFA 1ITYA 3RQIA 4Y7NJ 3FK6A 5EZHA 2EZIA 3W6VA 4XK4A 1I6HJ 1K83J 2K9NA 3HM5A 3QPSA 2L7FP 3BTLA 1DU0A 1F36A 2W48A 1ETVA 2XPUA 2DA5A 4IHXA 4L5EA 5F1JA 5EZGA 3O8HA 5IOYA 2EH3A 1IGNA 5DTDA 2YU9J 2L0KA 5JLWA 3CCYA 2EZHA 5FLVA 2PMZN 3ZQIA 1MBHA 1RETA 2CQQA 3Q0UA 2R0QC 3S1RJ 5EYRA 2LY9A 3TP0A 5HODA 4AUXA 4BXXJ 2XB5A 1POGA 3IH4A 1JGGA 5BNGA 1BW6A 1ENHA 3ZQGA 3H0GJ 1B8IB 3IH3A 4M3DA 1AKHA 1A5JA 1ETKA 1TWAJ 3F0CA 2VUMJ 3E7LA 2GM4A 2DA7A 1B8IA 3JREA 1U78A 1FEXA 1LFUP 2HOAA 4A3CJ 2DA2A 1TWCJ 3GTGJ 1HCRA 3LSRA 2DMPA 2HXIA 3I4NJ 5IYBJ 3ZQLA 1TWHJ 1BJZA 3FKIJ 2WV1A 4QSHA 1PUFA 1BW5A 3S16J 2LR8A 1QVTA 5J1RA 3JRBA 1HLVA 3G1LA 2LD5A 2TCTA 5IPAA 1B72A 2DMQA 2X9DA 1ZGWA 2H8RA 3GTLJ 1R9TJ 1VNDA 4IHWA 2M0CA 2O9LA 1GVDA 3BG5A 4CYCA 1X2MA 1Q1VA 3JR9A 4CYCB 4XIDA 3S1QJ 3JRDA 1VF9A 1GUUA 3OSGA 4JYKA 2O8KA 2MSYA 2EZKA 1JUSA 1WH7A 2Y30A 2CU7A 4D7NA 2XGEA 3GBGA 1EF4A 2M34A 3B6AA 2D5VA 3S17J 3HOVJ 4JP0A 5F0HA 3JRHA 3ZQHA 4QTRA 3S1NJ 5IOZA 3G1MA 4BBRJ 1OCPA 3CQZJ 1MBFA 5IP7J 1XS9A 1O4XA 4C3JJ 1ZQ3P 1AKHB 1MBGA 2K9SA 2EZLA 4M3GA 1P7JA 3A01B 5EG0B 3FIWA 1FTTA 3TW6A 2AO9A 1JKRC 2Y2ZA 1QRYA 3BTJA 4X1EA 1SFOJ 4XRMA 5FLMJ 1H8AC 3JRFA 3HKZN 1S7EA 1FIPA 1IV6A 2JA6J 4MO7A 1GV2A 3BR5A 1ETOA 1LFBA 4MIMA 1MBEA 1ETYA 1ETXA 4FE7A 2NS8A 4S0HB 4FCYA 1GV5A 1H89C 3WHCA 2E2IJ 4IEJA 1U8BA 2CJJA 2KDZA 3FISA 2K9QA 2CUEA 3DEWA 2EQRA 3MKLA 2B63J 5M5XJ 4A69C 3LSGA 5IYCJ 2KT0A 2VKVA 4FE4A 5DS9A 4A3MJ 5F0CA 1XG1A 1VI0A 3S2DJ 3S1MJ 2DMNA 2JWTA 3JRIA 2AHQA 3BTCA 3L1PA 4QIWN 5M3MJ 1JT0A 3HGYA 4EEFG 1NK3P 2FQ4A 2LK2A 1WI3A 2L7MP 2E2HJ 4C3IJ 2NVTJ 1RPWA 1YRNB 5E3LA 1UHSA 5M5YJ 5GPCA 2Y9ZA 5JLXA 1TC3C 5E3MA 5EGOB 4A3JJ 2HOTA 2CQXA 2L7ZA 1ORKA 2E1OA 2VPRA 1TWFJ 4V2FA 3IV5A 3BR1A 2YS9A 1PUFB 2ECBA 3LOCA 4B3AA 2OPTA 3JRAA 5FKLA 5J1YA 1X2NA 5C4JJ 3LSJA 3SJMA 1ETQA 5K7ZA 4Y52J 2XGCA 3BR6A 2DA3A 5J1UA 1AHDP 3BR2A 5E3NA 4D5FA 5C3EJ 1MBJA 1OFCX 1JUMA 2ME6A 4UUSA 3ZQFA 5F27A 2MGQA 4LOCA 1IDZA 3BG9A 1NTCA 2DA6A 1AU7A 1I3QJ 2R5YB 1OJLA 2M9HA 3LSPA 4I6ZA 1HDDC 3HDDA 2DMUA 2DMTA 2XB0X 1ZTRA 2JA7J 1U9NA 2MG4A 1T56A 4BY1J 3HBLA 2M2EA 2FJ1A 5FKOA 1RKWA 2GBYA 3OIOA 4A3IJ 1DU6A 1MSFC 4DYQA 3PO3J 5EDNA 2M8GX 2IBDA 2ZB9A 4BY7J 2N8GA 3I4MJ 2WAQN 2R5ZA 2XPVA 1BL0A 1G2HA 2R5ZB 3GTPJ 4HNVA 1NK2P 4A3GJ 5FJ8J 1MSEC 1QPIA 1D5YA 2LKXA 1WCMJ 2NVQJ 2JJ7A 4D5CA 5K7HA 1LE8A 3HOXJ 2G0EA 4A93J 3S14J 2LLKA 2DA1A 4A3FJ 3A03A 3C2BA 3OSFA 1JJ8C 3NARA 4BKXA 2O7OA 1GDTA 4IHVA 1ZR4A 3MN2A 3S15J 4AYBN 2VKEA 3TEDA 3SDGA 3UKGA 4BBSJ 3GTOJ 3Q3SA 3HOWJ 4DZJA 3MVPA 2TRTA 4W1UA 1CQTA 4G12A 1ZK8A 2Y9YA 3D1NI 2FD5A 1Z0XA 1P7IA 5EGOA 1JKOC 2H1KA 1W0TA 3CDLA 2WB1N 4DYRA 2I10A 2R92J 1YRNA 4J19A 4RBOA 1F43A 2ID3A 3HGGA 4A3EJ 1JT6A 4FTHA 1JJ6C 1RESA 3HEFA 4NDLA 1APLC 1IDYA 2YUSA 3SFIA 1JKQC 5K7FA 2LTPA 3VPRA 1ZR2A 1IUFA 1LE8B 1FJLA 3GTJJ 2DN0A 5F0FA 3BR3A 4RDUA 3NAUA 2E19A 4B1RA 1VFCA 1GT0C 2HXOA 2IAIA 2HOSA 3HOYJ 2JA8J 2QF7A 3S2HJ 1ETWA 5IYDJ 1Z77A 3FK7A 1E3OC 5F04A 1Y1WJ 3BQYA 4UUTA 5GPAA 3M4OJ 2R7ZJ 3QQAA 2VI6A 3HOUJ 2R93J 1U9OA 3TW7A 1OCTC 1FTZA 2LFBA 2LP0A 2FX0A 3IH2A 3RZDJ 4W97A 3JRCA 4DZPA 3M3YJ 2NS7A 3HB9A 3Q0VA 2DA4A 1T33A 4MFEA 9ANTA 1RR7A 4ABZA 2HQ5A 2OF7A 2LVSA 5C4XJ 2MW8A 2X48A 1IC8A 1UMQA 4IHYA 5J3LA 1WH5A 2NVYJ 3O8GA 4M6VA 2CRGA 2NVXJ 3RZOJ 1MBKA 5C44J 1IG7A 3GTQJ 4XRSA 1BA5A 4GFBA 3A01A 1TWGJ 4UUSB 5M5WJ 3K2AA 1UG2A 4M3EA 3B6CA 1FIAA 4V2GA 1XC5A 1HDPA 2JN6A 2X6OA 1RKTA 1JTXA 3BT9A 5EEAA 3JRGA 4A3KJ 4D7MA 1MNMC 2Y0SN 1QVUA 3PM1A 4A3LJ 4M3BA 1B72B 2ME0A 2DTZA 3Q0WA 2XPWA 2JA5J 2XRLA 2RAEA 3RKQA 1MH4A 4FISA 2R5YA 1SANA 4DW6A 1ZKGA 3GTMJ 3HOZJ 3BR0A 3H3VK 1W0UA 3ZOBA 1IRZA 3BTIA 2HYJA 5IP6A 3GTKJ 5EG0A 5FKNA 2GLOA 4C2MJ 2JMWA 1X58A 1WPKA 3LNQA 2K40A 4MLOA 4XICA 3ZQCA 5FKMA 2CUFA 4M3FA 1WGXA 3K7AJ 3CMYA 3OOUA
chains in the Genus database with same CATH superfamily
1SEUA 1IUYA 2MD0A 2ECCA 1HBXG 1UJ8A 1K61A 3QOEA 4XRSG 4XBFA 1UAAA 1Y1VJ 2FU4A 2HOEA 4Y15A 5L3DA 2BW3B 3LL7A 4ENKA 1KONA 2L9RA 3L7WA 4XOTA 3CUQA 4UB8C 5M3FJ 3C2HA 1ONVA 2L54A 1YYVA 1Z7LA 4HLYA 2V6EA 1JKPC 3DTIA 3L2WA 5D8KB 3PSFA 5GP9A 2BOLA 3CP8A 2GIVA 1DGWY 2Q0OA 4N9HA 4EJOA 4IXAA 4ENMA 2WAFA 1LB2A 2F5CA 2Y75A 1MMDA 3UR3C 4MEYF 1UELB 4MFDA 4JX6A 2Z2SB 2GA2A 4AWXB 5CVRA 4MEXF 2KQRA 3F8FA 1LVAA 5GADJ 4I02A 1STZA 1IAWA 1JTYA 1H88C 4L9NA 3V8JA 4CCNA 4X6AJ 1IRGA 2DK5A 4RAFA 2PI0A 1FT9A 2R7QA 4XLNF 1RC9A 3FK6A 3Q9VA 1SFKA 2M7BA 4RAGA 6PAXA 2Z5UA 1YQAA 5L3FA 3OS1A 1L3LA 1I6HJ 3HM5A 2K9NA 3ABLH 3CMEI 3BTLA 5L3CA 4EJUA 3F22A 3QRFF 3HUGB 1O3TA 2W48A 1BIAA 2VOPA 1NG7A 2WBMA 1X1DA 1ETVA 1X3UA 4IRIA 2XF6A 2DA5A 4HW0A 3NWSA 5F1JA 3EUHA 3H1CA 5IOYA 3SHFA 3PQKA 2CH0A 4RA2A 4M71A 5JLWA 4KN7X 4II3A 1RRJA 1HKQA 1V3FA 3HIFA 1ODDA 5FLVA 4E7SA 4A5NA 1LPQA 2XAJA 3I59A 5D6EA 3Q0UA 2HGCA 3FF5A 3NRVA 1DP3A 1ZRCA 4R8HA 1ACIA 3ZRGA 3LFKA 4BXXJ 1Y8RB 4PGHA 4GCVA 1TNSA 1JGGA 4LIUA 5BNGA 1ENHA 3DFGA 1SD6A 3MAJA 4DJAA 4GGGA 1P92A 3ABMH 1I5ZA 1D1BA 3BG7A 1HW2A 3BC8A 2ISZA 3K4JA 3PIOF 1S7AA 1A5JA 2QQAA 4I0BA 1J7KA 2GM4A 4GDFA 2VN2A 3H9JA 1FEXA 1W36D 2DFIA 4G6TB 3L2RA 4HF1A 3GF2A 3KYDB 5DUIA 2EFOA 3KCCA 3AG2H 3LSRA 4IOAF 4BDZA 5IYBJ 4KICA 2KIQA 2X85A 2W1OA 3RKYA 3CESA 2DCEA 1U2WA 4LB6B 2WV0A 2KHMA 1Y39A 3JRBA 3QWLA 1HLVA 2VODA 3FKJA 4EM0B 2K27A 2BW3A 3GW2A 1DP7P 1TW2A 1B72A 4HV5A 2FMYA 2X9DA 1DQUA 5BS6A 1EV7A 2M0CA 2QGUA 2O3FA 3BG5A 4IRGA 4M74A 5E1ZB 4CYCA 3GFJA 2MABA 3CC2I 1Q1VA 3RSNA 3M9AA 3PNYA 2XAFA 4DIQA 1GUUA 4JYKA 4PCQA 2KLOA 3LMMA 2EZKA 2OJED 4PFPA 4N9IA 3JAMZ 1MMSA 1B1BA 2Y30A 2CU7A 2XGEA 3CJTB 3I58A 2D5VA 3CLOA 4R79A 2VQGA 3S1NJ 1D1AA 5DM6F 3G1MA 4AIHA 3R4KA 3IWFA 1HSTA 1OCPA 2F2EA 3MWMA 1YJWI 1MBFA 3WTYC 1XS9A 2W85A 1V5EA 1WKMA 3WTUC 1ZQ3P 2IJLA 2DO7A 3QODA 2IGMA 1UCRA 2CGPA 4XN0A 1J59A 2DFFA 4BXUA 4X1EA 1SFOJ 3WODF 5FLMJ 1BC7C 2ZMEC 4BQOA 5DDGA 3PQJA 4BQQA 4MNUA 4NQWB 2XAHA 2ACJA 1B9MA 3BROA 3HC7A 1FIPA 1X4OA 4YIIA 2JA6J 2DLLA 5J4VA 2W4SA 4MIMA 1ETYA 1ETXA 3DTEA 3GFIA 4G6DA 4FCYA 3EYIA 3SFZA 2YU3A 3ZR8X 1W7PA 4ZYDA 1H89C 2VPLA 2V79A 3IC7A 2H1LA 4IEJA 2CJJA 3NWTA 3FISA 3DEWA 2CUEA 2EQRA 3MKLA 2R7SA 3RYRA 5M5XJ 3LSGA 5IYCJ 4XLAA 2F5VA 4A3MJ 2JQ7A 1XG1A 4KMFA 1XMAA 3S2DJ 3AG4H 2L4MA 5JR3A 2O0YA 3KP7A 4RAYA 5M3MJ 4S04A 1JT0A 2HDWA 5DD4A 2PQ8A 2E2HJ 3VB2A 4C3IJ 5J6XA 2A05A 3IRQA 1YRNB 3LA7A 1QPMA 2NVUB 2EA4A 5GPCA 1X19A 2CS3A 4NC8A 5EGOB 2HOTA 2CQXA 1T39A 2PX9A 1EKEA 4OIRF 4HOBA 1Y6IA 5AIQA 1FPQA 2M45A 2OPTA 3CF5F 3OMYA 3JRAA 4NQWA 3FX3A 4UB6C 5LEKA 3E5QA 3SJMA 1BOBA 1FP1D 4ZDPA 5K7ZA 5KNLA 4Y52J 1X1BA 5ICCA 1AOYA 1MJ9A 2DA3A 3DF8A 2JRTA 3T5XA 4PSWA 1JHHA 2E1MC 3M7GA 4D5FA 1IRFA 1ZGAA 2PMZA 1IN4A 4D9JA 2LH9A 4KYWA 5F27A 1OYWA 4LOCA 1VQ8I 1OYYA 1OCZH 4D0PA 2DA6A 2ZSHB 4L0ZB 1GXPA 2NYXA 2IGKA 3ZQQA 1OJLA 3LSPA 1BM9A 2NAZA 1HDDC 2V1XA 3HDDA 4J01A 2XB0X 2D2WA 2HTSA 3T1BA 4UVCA 5JHUA 3X2QH 2M2EA 2X4HA 1RKWA 4B48A 2P6TA 3OIOA 2ADUA 4A3IJ 2P4WA 3TBIA 2PJRB 3HKZA 5EDNA 4EJWA 1RR8C 4BY7J 3KE2A 1MNDA 1XGMA 3QYFA 4EGYA 3HUGA 3CLQA 3LFUA 2QYOA 4EM2A 4F7ZA 2WY7Q 3AG3H 3OYLA 3IL2A 2R5ZB 1K4TA 2XRNA 4A3GJ 2M7AA 1LJ9A 1KZHA 3VWBA 2OV7A 1XMXA 1YIOA 4BJ6C 2LLKA 1UFMA 3O6BB 4A3FJ 4OIQF 4UY8I 4RB1A 4LLNA 3C2BA 4RAZA 3KLOA 3NQOA 3VYTB 3HSFA 4MQVA 3NARA 2CV0A 1SVOA 1AA7A 3W2VA 3G73A 5DCMA 2CW0F 4EQQA 4CSWA 3ZMSA 2LY1A 3UKGA 1N77A 5BQTA 5E17F 4A5MA 4IJAA 5TISC 2X6YA 1RI7A 2OZ6A 3Q3SA 4CA0A 4G12A 1CQTA 1ZH5A 3VODA 1PDNC 1YS6A 2FSWA 3G6EI 4E70A 3W2AA 3FBNB 3W3CA 2LOOA 1TTYA 2IXSA 5LD2C 2I10A 4J19A 2E7XA 1FP2A 3GFMA 1JJ6C 3GLLA 1USTA 3KP4A 3EUAA 3QU6A 4LLGF 3F23A 1OR7A 1ZAOA 3N4MA 1LE8B 4ZZDA 4UXNA 1BC8C 3S32A 1YE9A 4KJZA 5ERIA 2E19A 4LIVA 3ZCOA 1BI3A 4B1RA 1VFCA 1GT0C 2HXOA 1FYKA 1XTAA 3PL8A 4Z6YA 2EK5A 2HOSA 2JA8J 2K9LA 5KK1A 3HRTA 1CF7B 2KL4A 3I4PA 4LGWA 5F04A 1R22A 3GVAA 4B09A 1Y1WJ 3IAS2 2MD5A 4UUTA 2MA3A 3U21A 2CQ7A 2VI6A 5ILSA 2FUG2 4B3XA 3ISPA 4BQAA 4YFKF 3BOQA 5FRMA 1UZCA 3OYHA 4HG2A 2CWEA 3IWZA 4L5JA 1U9OA 2HKXA 1VTNC 1VQ6I 3L2CA 2M3AA 2ZMEA 3HTUA 4L5IA 2CMPA 2LP0A 3CZ6A 3JRCA 2PJPA 2ETHA 3CD6I 5DCMB 3KFWX 3ZN1A 3KP2A 4ZDOA 1FC3A 2HZDA 4LB5A 4N0BA 2YX4A 1WJCA 1YW8A 3K1NA 3LA2A 4M6XA 3I0TA 2ZNZA 1IC8A 3ASNH 4LG3A 3AG1H 4RLFA 1A6QA 1LEBA 5E20A 3LSHA 1WH5A 2F4OB 2NVYJ 5TJJA 2B7EA 1S6LA 4A0ZA 4DGWB 2OTLI 2NS0A 3QYEA 3RZOJ 3ESWB 1A35A 1S8NA 1Y0UA 1R58A 3DV8A 2ISYA 1BA5A 4QWQA 3DBHB 4GFBA 1B4AA 2L4AA 2PMUA 1LUJB 3RJPA 2JA2A 3GEZA 2OAZA 3KYLA 2LREA 1MW7A 3B6CA 3DBRB 3K69A 1D0YA 1P6RA 1XC5A 2BVMA 3EPZA 4WWCA 4H0EA 2DPUA 2JN6A 3I3LA 4F92B 1RKTA 5EEAA 1K6YA 1UHWA 4D7MA 1SAXA 1FY7A 3COAC 4BAYA 2ME0A 3F8BA 4XORA 4ZTFA 1MD0A 2XPWA 3HRUA 2ELHA 2RAEA 2EB7A 1YTYA 3G4SI 1SANA 3M1EA 1ZKGA 3DEEA 4DW6A 1IXSB 5HDGA 2K85A 4KA4A 5E79C 4HF2A 1ZGJA 2OD5A 3CMMA 3G3ZA 4OAYA 3BTIA 4M6YA 1LFPA 1Y8QB 3L2VA 2A3SA 2K40A 3EYYA 3FM5A 3KZYA 2KDOA 3ROUA 1O3RA 3WG9A 3DLLF 3K7AJ 1G4DA 3CMYA 2GXAA 3L9FA 2ID6A 3OOUA 4DBRA 4LG0A 1KU3A 1RNLA 4AC0A 2L2OA 3CP2A 1QZZA 5GAGJ 1HKSA 1ZLJA 3S3OA 3BJAA 3CDIA 2IEKA 3S2WA 2QQ8A 3LSKA 3SZGA 1WJDA 2YPRA 1SFEA 3F8CA 4M73A 1HOMA 3A4CA 4CXFA 1WJFA 3TP3A 1A6IA 4UV9A 3CC4I 3IKVA 3CTAA 2ELKA 1T8IA 4PJNA 4XKBA 1AWCA 3E6DA 2ELJA 2CV1A 1W7PD 1JXSA 4ZTJA 1WWXA 2P81A 2BBYA 1SMYF 4B4CA 5HVQC 2BXZA 4XOPA 3PO2J 5FD6A 2NOGA 2DJNA 3CJRB 4WXDA 2VE9A 5EF6A 2EFWA 1PP8F 2DU9A 4U0WA 2EIMH 3GUDA 1REPC 3H5RA 4EJVA 4AVPA 3BG3A 5FRNA 3BQZA 1FOYA 4FETA 4E7ZA 1ITYA 2L3DA 3RQIA 2L02A 5EZHA 3S8PA 5LEJA 2E35A 3W6VA 1Z05A 1BJAA 2DYSH 2Q1ZB 2X1CA 4F52A 4F93B 3QPSA 4A0YA 2L7FP 1VZ0A 3OYMA 4WK8F 2VOOA 1F36A 3BJ6A 2OU2A 2GQQA 4ZYHA 1P2FA 2XPUA 4L5EA 3J7AY 2GOMA 3O8HA 4BHBA 5DTDA 2FEZA 1ZG3A 2A68F 3HTSB 2K7LA 1EH6A 2YU9J 3JSOA 5KHDA 3CCYA 2BY0A 1DDNA 3H5NA 3A2KA 3WU1B 3EUKL 3ZQIA 4I7HA 4I01A 1O57A 1V4RA 1G8XA 1W5SA 2AQFA 4PJLA 3D5RC 4C2TA 2X1EA 5HODA 4AUXA 1YLFA 3QOPA 3IH4A 1HQCA 4LJZF 2STTA 4B43A 1NHAA 1KA8A 1W5CC 3JW4A 5FFZA 2TDXA 2R7FA 2IA2A 4PGGA 2Z3YA 3WU0A 2HU9A 2VJJA 3V42A 2R7WA 1F9NA 5DD8A 1ETKA 1TWAJ 5CVIA 3TL4X 3V8LA 3W6JB 2VUMJ 1PVEA 1V55H 2DA7A 3E7LA 1VQ7I 3ASOH 1TP4A 3JREA 1JI8A 4UVBA 3WTSC 1LFUP 1I1SA 2DW4A 1FNNA 3OIQA 1DUXC 3TOAA 4PSXA 3I4NJ 3HSRA 1VQ9I 3RDIA 3FKIJ 2K5CA 1LDKB 3GZ6A 2FOWA 4YELA 2LR8A 2ZJPF 4WX9A 2Y0MA 5B66C 2LD5A 4IOCF 3HJEA 2L01A 3B73A 3RPUD 3CCLI 4FT8A 2DMQA 2H8RA 1R9TJ 4IHWA 3L00A 2RREA 2O9LA 4ANJA 1XSDA 2OTJI 1W1WE 3QPHA 3DPUA 2V1DA 2RDPA 3JRDA 3C18A 2D1HA 1TLHB 2QBYA 3OSGA 1M1EB 3BZ6A 3MZYA 2FA5A 1T38A 2O8KA 2CV2A 3KEQA 3RPUA 2K3PA 1JUSA 3DKYA 4D7NA 2VXZA 2ICWG 3B6AA 1XPXA 3S17J 2A6TA 3ZPLA 5HDKA 2RV8A 3DXJF 1R4MB 2F6CA 5IP7J 1P4AA 4HSRA 2I5UA 2JSPA 1BOAA 2QZ8A 4C3JJ 1YIJI 1O4XA 1MBGA 2K9SA 3ERMA 2EZLA 4M3GA 2K4BA 5EG0B 3FIWA 4FQGA 5J40A 3TW6A 1JKRC 2IGNA 2Y2ZA 4HPQA 4U0VA 1QRYA 4XRMA 1I6XA 2EWNA 1UG0A 3HKZN 1ZARA 1S7EA 2XASA 5LLQA 1G3YA 1WFXA 4CGZA 1MGTA 5LGNA 1EJ9A 5LHHA 4C30A 2HPIA 2NS8A 4RS8A 4S0HB 4OAZA 5IY5H 1MJBA 3BWGA 3WHCA 5H2FC 3E5XA 2VJ5A 4C9YA 2FQ3A 3I64A 1LVKA 2K9QA 5DEQA 3E3VA 4G9YA 2VKVA 3RKWA 3QPTA 2L5QA 4RB2C 2P7CB 2MYSA 1IO2A 1WQ2A 1YX5A 2CUZA 2JWTA 3EQLF 2P0WA 3JRIA 2IS1A 3K0LA 2H6CA 5AONA 3HGYA 3J80Z 1WRJA 2A61A 4D1QA 1FOWA 4E7KA 2FQ4A 1O3SA 1NK3P 3WE2A 3K70C 4ESBA 3K9TA 2WTEA 5CKTA 5IT9Z 1PJRA 2XGXA 3MEXA 3IKTA 1T2KA 4Q5SF 2L7ZA 3KPHA 1YG2A 4X0GA 3GWZA 3TGNA 5L3BA 3BR1A 1MMNA 1B6AA 3WG7H 3T0YA 1MNEA 3PUFA 5B1BH 3P5JA 5K5OA 5FKLA 5A2QZ 2F4IA 1SC7A 5J1YA 3OWTA 5C4JJ 3LSJA 5KAIC 2CQKA 1ETQA 2Y48A 2HVRA 4MHGA 1K78A 3UNGC 1TQMA 3BR6A 2DDBA 2F4MB 3OR2C 3CUQB 1AHDP 4EV0A 2E5ZA 3SQNA 4B8XA 1JUMA 2QA4I 2ME6A 3ZQFA 3OY9A 2MGQA 2RC4A 1IDZA 3T8RA 3D5SC 4EM1A 1TL8A 5H6RA 4IL6C 2DT6A 2R5YB 3OV8A 4XSZF 4M72A 2M9HA 1DGRM 4I6ZA 5CQEA 4P96A 2R7UA 2DMUA 2LBFB 2DMTA 1U8RA 2WB1A 4PDKA 1ZN2A 3KIOA 1L0OC 2MG4A 3FMQA 3K10A 4I0AA 4NB5A 2FJ1A 3VDXA 4KITB 1X1CA 3ZMUA 2GBYA 1DU6A 2IT0A 4DYQA 5TGTA 2GAUA 1TW3A 4UVAA 2V4JC 3A1YA 2IBDA 2HYGD 2ZB9A 3OYGA 1FBSA 2RKHA 2KPMA 1TBXA 1KQ8A 2JT1A 4A6EA 4G6QA 1BIBA 1LDDA 4R1HA 1O3QA 1A04A 1KU9A 4HNVA 1NK2P 3I55I 1FSHA 5FJ8J 4YG2F 4PJMA 1QPIA 3K6GA 1LNWA 4IO9F 4ASNA 4UV8A 2BHYA 5ICGA 2NVQJ 3AL0C 2F5FA 3B02A 3S14J 4B44A 2DA1A 2Z33A 3H3UA 3M8JA 1I1GA 5ICEA 1E3PA 1ERDA 4P9FA 3SYTA 2CG4A 4ETSA 2VBYA 2O7OA 3MN2A 4WXHA 2H6BA 2QENA 3GO5A 3KYCB 2E60A 2JZYA 1VQ5I 4QLCU 3GTOJ 3C1DA 2FBIA 3RPQA 4ESJA 4DZJA 3HOWJ 1S9HA 1T0FA 2FD5A 4A12A 4GYGA 1LKXA 2X6XA 3FM3A 4LK0F 1Z7UA 5LRRA 1FMVA 5IT3A 1UHMA 1YRNA 3ABTA 1XSXA 2R7DA 4A3EJ 2RN7A 2AS5F 4O6JA 1JT6A 1RESA 1KQ9A 4NDLA 4OOIA 1IDYA 5K7FA 1V54H 2BXYA 5HDNA 3KEYA 1USSA 5BPDA 1IUFA 2DAOA 2HQRA 2VBWA 2DN0A 3OL4A 5GTHC 2WAQA 3NAUA 4KNYA 2JPBA 2Q2EA 3JTHA 3CC7I 2E36A 3MCZA 5GAHJ 3DPLC 4XLCA 3BG6A 2W82A 5E8GA 1MDMA 3S2HJ 2XDVA 2ZCWA 5D5UB 1K4SA 4XMYA 1Z9CA 4BDYA 1X1AA 1WHUA 3M8FA 3U1DA 4BE1A 1JE8A 2OZUA 3M4OJ 3QQAA 5CLSA 2VQHA 2E1NA 5JI6A 2WY8Q 5GAEJ 1N75A 1CF7A 2KKOA 4V19K 1HW5A 1V5FA 1YO5C 2NOJB 2FX0A 2XROA 1SFUA 3MKWB 3PUBA 4P55A 2LNBA 2DDAA 2P8TA 3KLNA 1VQOI 3HB9A 4MFEA 5K5QA 9ANTA 1RR7A 2HQ5A 2R7OA 3DEUA 2LVSA 4AIDA 2MW8A 1F4KA 4UUVA 2MLKA 3F6OA 3CMAI 3P9CA 5J3LA 3O8GA 2Z16A 4M6VA 3WTVC 1Z1DA 4BU2A 2VIXA 1KYZA 2CRGA 5CQGA 2D45A 1MBKA 1WJBA 4XRSA 2Z1DA 2JVHA 3MKZA 2RGVA 2H8WA 3PNVA 3F8MA 4TV7A 5D4SA 2BHZA 1TWGJ 5HS9A 2WADA 2DQLA 4M3EA 3H5AA 4V2GA 3ZMVA 3V7SA 2FXAA 2FNPA 1HDPA 4DBQA 5B5EC 3E1SA 3HHHA 3VYUB 1JTXA 3K4CA 5KCMA 2NNYA 4QPOA 4A3KJ 2Y0SN 1OCOH 1QVUA 2M30A 4CH7A 2OCEA 5D8LB 4E6KG 3EDPA 3E6MA 3PFIA 3RKQA 3I59B 2BEOA 2FOKA 3U9GA 5K5RA 2LRDA 3KP3A 3HOZJ 2W84A 5CYVA 4HYEA 3CCJI 1GHCA 1W0UA 3ZOBA 4LITA 1VQ4I 4ENJA 2EIJH 5EG0A 3GTKJ 1XDUA 5FKNA 1WSUA 2LC2A 1OISA 1D1CA 3WGHA 1QHHD 1NG6A 1XGOA 1QBJA 3TOBA 1N25A 3M8EA 4U0YA 2VB6A 3HSEA 1ZG5A 2W25A 2CUFA 2HS5A 3LSMA 1YW7A 4M3FA 2PJRA 2BVLA 4LG0B 4BEHB 1MH3A 3HOTA 3R6SA 4NNJA 2MC3A 3FXRA 2COBA 2E2JJ 5F08A 4M9ZA 2JK3A 3TDZC 5LGTA 4A3BJ 1JUPA 5CJ9A 2XSDC 4L0YB 1TT0A 1MIJA 2DT5A 3OYFA 3S3MA 3LAJA 4A3DJ 3A0BC 4YIFA 2QQBA 2G9WA 4JX4A 1XB4A 2XGDA 3WHBA 1TQIA 4HDUA 4G7HF 2CFOA 3E6BA 1R71A 2VJ4A 3OIPA 2R7VA 3F3XA 2JVGA 2O8XA 4XN3A 3QPLA 3N97A 4U87A 5IP9J 1QQIA 3FXOA 3ZP5A 2OA4A 2P7VB 5FD5A 3DLAA 2P6SA 2QCOA 5E3OA 2EBIA 1ZREA 2W57A 5K1YA 1F1ZA 3CF2A 1HF0A 3RKXA 3DCFA 4L18B 3RYPA 1HW1A 4U7DA 5CVJA 1SD7A 1RZ4A 2XF7A 4KMUX 3RCOA 2EZIA 4HA8A 3DBLB 1ZELA 3F9KA 4KT6A 4XK4A 3V8KA 1YITI 1K83J 1R5ID 1S7OA 4K2EA 2ZNYA 1DU0A 3DKXA 1U5TC 4IHXA 5EZGA 3OYCA 5HS8A 3AFHA 2V6CA 2NNNA 3FXUA 1Z3XA 1D8JA 2L0KA 2XAUA 4RMNA 2DXIA 1FYLA 2DPDA 4P5OA 1ON1A 5EJCA 3HL2A 3HXLA 1MBHA 1RETA 3H35A 2EA2A 3GZ5A 2G7HA 2R0QC 3S1RJ 1YFHA 2LY9A 2YX7A 4OMZA 5HLHA 1XGNA 4L9JA 4LMYA 2AQEA 1BW6A 1SAUA 3H0GJ 2QQ9A 1B8IB 3IH3A 1U5TA 1SD5A 3R0AA 1AKHA 1IN7A 2GXGA 3HRSA 5J8CA 3F0CA 4BACA 4F3QA 2DK8A 4BJTA 4CCLA 1FZPB 2VONA 2BY2A 3OYKA 1D0XA 3SDBA 1MZBA 2WWYA 1HCRA 5J8FA 2DMPA 2HXIA 2LMDA 3ZQLA 1TWHJ 1BJZA 4L9VA 4KT5C 2DOEA 2WV1A 2O6GE 1PUFA 4XKCA 5CVUA 2CUJA 3PIPF 2QUFA 1QVTA 5J1RA 1R6RA 4YFNF 1VQKI 4ZH4F 3VEPA 4AIKA 3G1LA 5TRDA 2V9VA 2ZJRF 1RUNA 1GXQA 2BZTA 4BXFA 1ZGWA 4HDVA 4DQ2A 2J5PA 1GVDA 3U1KA 3GFLA 3DU5A 2EV0A 1X3WB 2FRHA 3JR9A 3L2UA 4XIDA 3K70D 4GYIA 2FMLA 3ML6A 2ESNA 2LG4A 2ZKZA 1OQYA 2PEXA 3GXOA 3AKZA 3I9V2 3FXKA 3ZN0A 1FMWA 3GBGA 1EF4A 1Z21A 2M34A 3BZKA 3FMSA 3OR1C 3ABKH 3JRHA 2KIFA 3ZQHA 4QTRA 1TNTA 4PJJA 2P5VA 1I27A 5HLTA 1QZEA 2PLYA 2Z99A 2V1UA 3TMOA 1EA3A 1AKHB 4XLEA 3WTZA 1P7JA 3A01B 3G2BA 2LY2A 4XRFA 5B1AH 1K6OA 1FTTA 2ZC2A 4PZJA 3ULQB 1E3HA 4M9SA 3TKYA 2HDCA 1QO0D 1X4PA 2JPCA 2QSHX 4HBLA 3CO7C 2W24A 3WTXC 4H4KC 2FBHA 1IV6A 2EFPA 3BR5A 1ETOA 1XCVA 3GLXA 3RI4A 3ABUA 1HC8A 4II2A 1QHGA 1IRXA 1U8BA 1G6NA 2M4GA 4I09A 1HA8A 4A69C 4EJTA 1YHQI 2YSRA 4AM3A 2PN6A 2OCCH 5D6FA 1VI0A 2XVCA 2ZSIB 2HVQA 3ZMTA 3S1MJ 2DMNA 5BMZA 2VJIA 3ZMZA 3ZXSA 3OYIA 3FXJA 4FX0A 4EATA 4MTDA 4EEFG 4IX7A 4BE2A 4BQNA 3CUQC 3MD2A 2LK2A 1WI3A 3C2GA 2KJBA 2DT7B 2CO5A 4XM3A 2A6HF 1UHSA 1WJAA 3DPTA 4I98B 5M5YJ 5E3MA 3OOPA 1WI9A 4A3JJ 3BCBA 3HRMA 2P5KA 1ORKA 3WU2C 2E1OA 2AXTC 2VPRA 1TWFJ 4V2FA 2YS9A 1PUFB 3LOCA 2A07F 4B3AA 1IN6A 2O61A 2EPFA 2BY3A 2L7KA 1N78A 2OQRA 3AAFA 1X2NA 2K86A 4E7HA 3OYNA 2KJCA 3WGGA 2QKMB 5JVTA 2XGCA 3ZMDA 5J1UA 4EVIA 1NH3A 5E3NA 2B9SA 2ZMEB 3VSLA 2O5RA 5FLXZ 5C3EJ 2EV6A 1PUEE 3HHGA 4XONA 1R1TA 4UUSA 4GO1A 4F91B 4ZC3A 2BGCA 2UZKA 1Z6TA 3CCVI 4OIOF 3IHUA 3HG9A 1EH8A 1AU7A 1Z67A 1R49A 1W7PB 2XKPA 2DOAA 4CCJA 5DCFA 3HZJA 3JSPA 2JA7J 1V5GA 1U9NA 5L3EA 2UV1A 3HBLA 2IW5A 4I2OA 5FKOA 1D5VA 3RIRA 1S3JA 1BI0A 4Y4RA 2XC7A 3VFZA 4E7IA 1P9QC 1OCCH 3GZNB 4HSTA 2N8GA 3K1MA 5D4RA 3K1PA 3H9QA 4ZZLA 3U2RA 2H27A 5IT9K 1BL0A 2IVMA 3CJQB 1G2HA 3BZCA 4B47A 2R7XA 3H0DA 1MSEC 1Z6RA 2FNAA 1H9TA 4G7OF 2BE5F 5JHFA 2LKXA 1WCMJ 1FX7A 5K7HA 3CJNA 2XIGA 1LE8A 5D5XB 1EH7A 1P4XA 1FYMA 3A03A 4C2UA 1ZYRF 4ZYGA 1JJ8C 1R5HA 4CCOA 2OQGA 4BKXA 4UNOA 5F6FA 1GDTA 2LKPA 3BLYA 3S15J 4AYBN 1FWZA 3MMYB 3TEDA 3OL3A 4BBSJ 3MVPA 4N4NB 4W1UA 1ZK8A 2DOFA 2QWWA 2Y9YA 1K7AA 1P7IA 4XNFA 5EGOA 3CCSI 2H1KA 2BV6A 3S93A 1XN7A 3FXLA 1LQ1A 5LHIA 2R92J 3BP8A 4HQEA 3I71A 4RBOA 4IQ4A 1F43A 2ID3A 3HGGA 4OIPF 3HEFA 1FOXA 1APLC 4E4HA 2YUSA 3FHNA 2R3SA 3FXMA 4Z2YA 3SFIA 1OKRA 2LTPA 3VPRA 4ZJZA 2JRMA 3K4MA 1FJLA 3GTJJ 5LBQA 3D5LA 4NC7A 5F0FA 4YFXF 2DBBA 2XAGA 1T95A 4HEA2 3M1CA 2QF7A 4G7ZF 4XLHA 4KN4X 2EILH 3ERED 1MDMB 3F21A 1U3EM 1X1PA 3C7JA 5IYDJ 2RNJA 1E3OC 4E7LA 2VXDA 4ITVA 2FBKA 3BPXA 3BQYA 3IUOA 2COMA 5BPIA 1F5TA 5GPAA 5CVVA 3MFKA 3H92A 5FFXA 3VYSB 2WAEA 3G71I 1XSVA 4BNCA 5ED4A 1B9NA 3HOUJ 3GCMA 3I54A 4BL0B 3P7NA 3DP7A 3FMRA 4YEJA 1QGPA 2LFBA 2R7RA 1VQNI 3KX2A 4W97A 2M4KA 2OBPA 5HLIA 2A69F 4AU7A 4BYYA 1FBQA 2NS7A 1RUOA 2DA4A 1IF1A 2JUCA 4RGUA 4U88A 2OF7A 4L9TA 1YJNI 3LQQA 5E18F 5C4XJ 2X48A 2GIZA 3CCEI 2FF4A 2HEOA 4XLFA 1ULYA 3HYIA 4A0XA 3LA3A 2HQNA 4IHYA 1QA6A 2QKLB 1IZ1A 4U7BA 2NVXJ 1K78B 1I39A 5C44J 5ICFA 1IG7A 2L9NA 3N05A 2HNHA 4OINF 3E97A 2V26A 4HQMA 2CYYA 1TQPA 4IHTA 2C6YA 4MGRA 2E71A 2K3FA 4EGZA 1UG2A 2VBXA 4RGRA 3VYRB 4IVNA 4CZZA 5D5WB 2X6OA 3F8NA 2HPMA 1XGSA 3BT9A 4Q47A 3JRGA 3LSIA 4A3LJ 1ZLKA 4M3BA 2UXXA 2ESHA 3JAMK 1B72B 3H9GA 3PNTA 3Q0WA 1HSJA 2JTVA 1G3WA 3PSIA 2XRLA 4Y17A 2R5YA 3W2WA 3GTMJ 2VE8A 3GMEA 4NC6A 4CYDA 3EUHC 3D0SA 2ZXHA 2DJIA 2IPQX 4JOMA 1WZ2A 4KIGA 3CCRI 4DNCA 1IRZA 5IP6A 2HYJA 1MMAA 5CPRB 3R61A 4C2MJ 1X58A 2L9VA 4XLPF 1Z3YA 1QU3A 2XF5A 4J00A 3A0HC 1TT5B 3ZQCA 2V1NA 4BGDA 3CCMI 1WGXA 4CICA 1W5TA 4OWRB 2X1DA 1S29A 5EEHA 1E17A 1KU7A 5FROA 1XMKA 4XR6A 3F6VA 5FKKA 5JVGF 3A02A 1E2XA 4AVZA 2HDDA 1HXDA 1I50J 1OCRH 1J0RA 5E8IA 2K02A 2Y31A 2RQPA 1T08B 5J4YA 3K4KA 4BJ5C 2Q8KA 4XKWA 2MH9A 1U0JA 1YW9A 2HI3A 3P9IA 1G3SA 1FOKA 4JX5A 3JCUC 2UWMA 4CCMA 4MQ9F 4C3HJ 4ENNA 5LFAA 1YI2I 2QBYB 3GX4X 3J7AO 4HX4A 3G1OA 3BJOA 3ECOA 1JGSA 1IJWC 3CO6C 3MZ8A 1IN8A 3RQ4A 4LLLA 2DTRA 3TQNA 3J80K 4I76A 3FBIB 5H20A 1OPCA 3ZQ7A 1LDJA 4UHTA 5ILVA 2QEXI 5AIPA 4DYCA 2JUGA 2EV5A 1PP7U 3E5UA 1J09A 3K4NA 1XCBA 3I53A 4IKFA 4YIRX 4KIBA 2OUMA 3OYAA 3QU3A 4Y7NJ 3V4GA 2RQQA 2IS4A 1OYIA 3PJRA 3JTGA 2KZVA 2K9MA 1G59A 5DM7F 1WVRA 5DV5A 4XL9A 2LYCA 3IRRA 4CUGA 2VKHA 5ILUA 1XD7A 2Q2EB 2EH3A 1IGNA 2QLZA 3OYDA 2H09A 2QVOA 3FDYA 4IHSA 2LDUA 5DYMA 2EZHA 3RTRA 2KFDA 4AYBA 2PMZN 4S05A 4AD9A 4HV6A 1OMIA 2CQQA 2VASA 5EYRA 1H0MA 3Q9SA 1SVLA 3TP0A 3BCAA 5F1RA 1R1VA 2XB5A 2RNGA 1POGA 2X6WA 4NUBA 4LD5A 5H6QA 5HNFA 3ZQGA 2A5WA 1Q1HA 2V9PA 3SEQA 3HPHA 4RB3C 4KUMA 3WTWC 4M3DA 2CQNA 3OS2A 3FHZA 4KDPA 3IAM2 5KAFC 3CUOA 5A2QK 1OLTA 3WTTC 1VQPI 1MKMA 2VBZA 1B8IA 2W7NA 1XX5A 1U78A 2KISA 1R23A 2O03A 2HOAA 4A3CJ 3K4LA 4HNUA 2DA2A 1TWCJ 3LSTA 3GTGJ 5FGMA 2X51A 2D1VA 1R36A 2A5YB 3F72A 4RGXA 1IXRC 4QSHA 1BW5A 4A6DA 3S16J 4KISA 1JHFA 1ON2A 2IRFG 3TO7A 2DYRH 4JK1X 4YRVA 1YJ9I 2A6EF 4P1WA 1YOVB 2TCTA 5IPAA 2HR3A 3TO6A 4IPAA 1G3TA 1BN5A 1MJAA 1MMGA 3GTLJ 1VNDA 2HVSA 1KQ0A 1X2MA 3T8TA 4CYCB 3S3NA 3S1QJ 1VQMI 1VF9A 3V7RA 2Y0SA 1O7LA 3QAHA 1R7JA 1W36C 4HNTA 2MSYA 2IS2A 2F48A 4ZYEA 5FB2A 1Y56A 1WH7A 3IP4B 4G94A 3HOVJ 4I99C 4JP0A 5F0HA 1ZHFA 3ELKA 5IOZA 2MC4A 3I56I 1SMTA 4BBRJ 3KETA 4N4OB 3CQZJ 3L2QA 1QZYA 2KIUA 2K4JA 2E5NA 1KYWA 4OMYA 3DU6A 1R5GA 3EETA 2E34A 3DTKA 2M1BA 1IN5A 3HOSA 4OU0A 2AO9A 3DKWA 3BTJA 3DQVC 2KZGA 2XKOA 1I3AA 1H8AC 3JRFA 4WF2A 1H9GA 2ZFUA 4BUPA 5E1XA 1D3YA 3CCQI 4MO7A 1YS7A 4CCKA 1GV2A 3J81Z 3H36A 4O3MA 2RVCA 1LFBA 4IQJA 2Y69H 1MBEA 4FE7A 4HF0A 2R4GA 2GZWA 1R4NB 1GV5A 1S5LC 2XUBA 1J5YA 2M5WA 1KGSA 2EIKH 3J7ZI 2KDZA 2E2IJ 2DFHA 4KFCA 2V7FA 2CW8A 2VLAA 4ZDLA 4ZYAA 2B63J 2KT0A 4FE4A 5DS9A 2CW7A 4IZZA 1J75A 5F0CA 3PFYA 4F55A 3P9KA 2ZXWH 5L3GA 2AHQA 3BTCA 4PFOA 1K79A 1BBYA 3L1PA 4QIWN 1J2XA 1S72I 1PYVA 3K2ZA 5LGUA 3V7CA 4NBQA 3MZHA 2L7MP 2NVTJ 3H3ZA 1RPWA 3LWFA 4GRIA 5E3LA 3O3KA 4P9UA 1W4MA 2Y9ZA 1ZG1A 4IF4A 5JLXA 1TC3C 3AL0B 4BHCA 3QP6A 4BE0A 2EINH 2HKOA 2CFXA 4HX7A 3ECHA 3IV5A 1BI1A 2E1CA 2ZXIA 3HPGA 2ECBA 3O2PE 1E0EA 2OC6A 3FWEA 1DPRA 2MBFA 5D5VB 3KP5A 3VOEA 2AXLA 4BEHA 1SVMA 2IGOA 2HZTA 1Y0NA 4LK1F 1CGPA 4FASD 2VT2A 2VT3A 5LHGA 2UUZA 2GOXB 3BR2A 4Q48A 1T98A 2LKSA 3BY6A 5J47A 1YX3A 3KZIC 1MBJA 1OFCX 1B59A 4M9XA 2QSFX 1IV8A 2W00A 1UB9A 4XQFA 2PBIA 3BG9A 1NTCA 2HFHA 2M87A 1IW7F 3LQRA 4G8XA 1I3QJ 2LF8A 5EEGA 4AIJA 4E7JA 4CDGA 3ONQA 2G7UA 3E0JB 3QP5A 3KZZA 4HAMA 1ZTRA 3C3WA 3Q5FA 1T56A 2DQRA 4BY1J 4QPQA 2F5EA 2VL8A 4HRIA 2E1MB 1O7FA 1MSFC 2GWRA 3PO3J 1T6SA 2F5DA 2M8GX 2HYFA 4Q4ZF 3I4MJ 2P5LC 5HS7A 5HOOA 1WJEA 2QM3A 2WAQN 4CO8A 1IXCA 2KIMA 5BOXA 5LRSA 2R5ZA 2XPVA 3BPVA 3FZVA 3GTPJ 3OS0A 2WA0A 2XSJC 4JBAA 1T0FC 1D5YA 4O5VA 2IA0A 1DPUA 2JJ7A 4D5CA 2V9KA 4Y33A 2DI3A 2G0EA 4FHTA 3HOXJ 4A93J 1X3ZB 3LAPA 2ZBKA 4Y13A 1ZRFA 2FE3A 3KEOA 1XDSA 5FO5A 3OSFA 1BR1A 2Z9OA 2PFBA 1ZR4A 4IHVA 3OYEA 2VKEA 2NXNB 1LEAA 3SDGA 4PK4A 4ON0A 2KRHA 3CDHA 4RM3A 3SXYA 1FBUA 2TRTA 2XHKA 3D1NI 1Z0XA 5HNHA 4HLXA 3OYJA 1JKOC 3SZPA 1TZLA 3R60A 1W0TA 3CDLA 2WB1N 4DYRA 1ZRDA 2IP2A 2PMHA 4IRHA 2M0MA 1BR4A 4HX8A 1D0ZA 1J9IA 4ESFA 3BDDA 3TO9A 4FTHA 4RM2A 2LSOA 3J7YJ 2ZXJA 1JKQC 4WCGA 1SD4A 1ZR2A 4RLQA 2VC1A 4FX4A 3BR3A 4RDUA 4XKVA 4GXOA 2HTJA 5B3SH 1BI2A 2EFNA 1C0WA 2IAIA 3HOYJ 3R0JA 2M8EA 2KMUA 3OYBA 1GLNA 1ETWA 1Z77A 4EMSA 3REOA 4HZFA 3FK7A 4LFUA 2UXNA 3W6KB 2CSOA 2L9SA 2I8DA 2R7ZJ 2XV4S 1Z91A 3GYHX 1R1UA 2VC0A 4RGSA 2QSGX 2R93J 4CHUA 3I5UA 3TW7A 3KP6A 1OCTC 4JQFA 1SFXA 4MTEA 2MFZA 1FTZA 3IH2A 4CZCA 3RZDJ 4PJ0C 4DZPA 1FLIA 3M3YJ 3NEUA 3ZGKA 5GTIC 4WXCA 1R00A 5FLXK 3Q0VA 3MKYB 1T33A 4BHPA 3FXQA 2B0LA 3VSKA 2R7TA 4ABZA 3J81K 2ZJQF 1QNTA 1U6GA 4NHJA 3QYBA 2LBFA 1UMQA 1KU2A 3DWLE 5KVRA 2ZO4A 2YR2A 2PG4A 3L09A 3K4BA 3GTQJ 2DODA 1VQLI 2VKDA 5HLGA 1WJ5A 3A01A 2XAQA 3SEZA 2X0LA 2ZFWA 3CCUI 4UUSB 5M5WJ 1RIOH 3K2AA 2ZJ2A 2KRCA 1FIAA 2VQCA 3WE3A 3WGIA 1D8KA 1P4WA 2GA1A 2H94A 2GXBA 1FSEA 2LF7A 1A36A 1MNMC 2KRFA 3PM1A 4XSXF 2HQAA 2EFQA 2DTZA 1BR2A 1OR7C 2IA1A 2JA5J 3TDUC 2HWVA 4RB0A 3MQ0A 1MH4A 4FISA 1A31A 2BY1A 5E1WA 5JFRA 2MH2A 4A2UA 1HKTA 2J5OA 2VQLA 2MLGA 4BH9A 4BS9A 2IS6A 2KP6A 3BR0A 2DFEA 3H3VK 4PUSA 2WC2A 5F64A 1GVJA 2JMWA 2GLOA 3SZTA 2JSCA 4KIFA 1WPKA 2E7WA 4Y3OA 3LNQA 1U5TB 2STWA 3M07A 2BYVE 4MLOA 4XICA 2NRAC 2EJRA 5FKMA 4DOZA 5DUKA 3E6CC
chains in the Genus database with same CATH topology
1MH3A 2ECCA 4AC0A 1K61A 2COBA 5FKKA 4XRSG 5F08A 2E2JJ 3A02A 2JK3A 2HDDA 4A3BJ 1I50J 1JUPA 1Y1VJ 2XSDC 2IEKA 2Y31A 1HOMA 2ID6A 2L9RA 3TP3A 1A6IA 4A3DJ 5M3FJ 4JX4A 2ELKA 2HI3A 2XGDA 1JKPC 4JX5A 3WHBA 5GP9A 4C3HJ 2P81A 3G1OA 4B4CA 1IJWC 3QPLA 3PO2J 4MFDA 4JX6A 5IP9J 2NOGA 2DJNA 4I76A 5EF6A 2QCOA 1JTYA 4DYCA 5E3OA 2EBIA 1H88C 3BG3A 3BQZA 4X6AJ 1HF0A 3DCFA 1ITYA 3RQIA 4Y7NJ 3FK6A 5EZHA 2EZIA 3W6VA 4XK4A 1I6HJ 1K83J 2K9NA 3HM5A 3QPSA 2L7FP 3BTLA 1DU0A 1F36A 2W48A 1ETVA 2XPUA 2DA5A 4IHXA 4L5EA 5F1JA 5EZGA 3O8HA 5IOYA 2EH3A 1IGNA 5DTDA 2YU9J 2L0KA 5JLWA 3CCYA 2EZHA 5FLVA 2PMZN 3ZQIA 1MBHA 1RETA 2CQQA 3Q0UA 2R0QC 3S1RJ 5EYRA 2LY9A 3TP0A 5HODA 4AUXA 4BXXJ 2XB5A 1POGA 3IH4A 1JGGA 5BNGA 1BW6A 1ENHA 3ZQGA 3H0GJ 1B8IB 3IH3A 4M3DA 1AKHA 1A5JA 1ETKA 1TWAJ 3F0CA 2VUMJ 3E7LA 2GM4A 2DA7A 1B8IA 3JREA 1U78A 1FEXA 1LFUP 2HOAA 4A3CJ 2DA2A 1TWCJ 3GTGJ 1HCRA 3LSRA 2DMPA 2HXIA 3I4NJ 5IYBJ 3ZQLA 1TWHJ 1BJZA 3FKIJ 2WV1A 4QSHA 1PUFA 1BW5A 3S16J 2LR8A 1QVTA 5J1RA 3JRBA 1HLVA 3G1LA 2LD5A 2TCTA 5IPAA 1B72A 2DMQA 2X9DA 1ZGWA 2H8RA 3GTLJ 1R9TJ 1VNDA 4IHWA 2M0CA 2O9LA 1GVDA 3BG5A 4CYCA 1X2MA 1Q1VA 3JR9A 4CYCB 4XIDA 3S1QJ 3JRDA 1VF9A 1GUUA 3OSGA 4JYKA 2O8KA 2MSYA 2EZKA 1JUSA 1WH7A 2Y30A 2CU7A 4D7NA 2XGEA 3GBGA 1EF4A 2M34A 3B6AA 2D5VA 3S17J 3HOVJ 4JP0A 5F0HA 3JRHA 3ZQHA 4QTRA 3S1NJ 5IOZA 3G1MA 4BBRJ 1OCPA 3CQZJ 1MBFA 5IP7J 1XS9A 1O4XA 4C3JJ 1ZQ3P 1AKHB 1MBGA 2K9SA 2EZLA 4M3GA 1P7JA 3A01B 5EG0B 3FIWA 1FTTA 3TW6A 2AO9A 1JKRC 2Y2ZA 1QRYA 3BTJA 4X1EA 1SFOJ 4XRMA 5FLMJ 1H8AC 3JRFA 3HKZN 1S7EA 1FIPA 1IV6A 2JA6J 4MO7A 1GV2A 3BR5A 1ETOA 1LFBA 4MIMA 1MBEA 1ETYA 1ETXA 4FE7A 2NS8A 4S0HB 4FCYA 1GV5A 1H89C 3WHCA 2E2IJ 4IEJA 1U8BA 2CJJA 2KDZA 3FISA 2K9QA 2CUEA 3DEWA 2EQRA 3MKLA 2B63J 5M5XJ 4A69C 3LSGA 5IYCJ 2KT0A 2VKVA 4FE4A 5DS9A 4A3MJ 5F0CA 1XG1A 1VI0A 3S2DJ 3S1MJ 2DMNA 2JWTA 3JRIA 2AHQA 3BTCA 3L1PA 4QIWN 5M3MJ 1JT0A 3HGYA 4EEFG 1NK3P 2FQ4A 2LK2A 1WI3A 2L7MP 2E2HJ 4C3IJ 2NVTJ 1RPWA 1YRNB 5E3LA 1UHSA 5M5YJ 5GPCA 2Y9ZA 5JLXA 1TC3C 5E3MA 5EGOB 4A3JJ 2HOTA 2CQXA 2L7ZA 1ORKA 2E1OA 2VPRA 1TWFJ 4V2FA 3IV5A 3BR1A 2YS9A 1PUFB 2ECBA 3LOCA 4B3AA 2OPTA 3JRAA 5FKLA 5J1YA 1X2NA 5C4JJ 3LSJA 3SJMA 1ETQA 5K7ZA 4Y52J 2XGCA 3BR6A 2DA3A 5J1UA 1AHDP 3BR2A 5E3NA 4D5FA 5C3EJ 1MBJA 1OFCX 1JUMA 2ME6A 4UUSA 3ZQFA 5F27A 2MGQA 4LOCA 1IDZA 3BG9A 1NTCA 2DA6A 1AU7A 1I3QJ 2R5YB 1OJLA 2M9HA 3LSPA 4I6ZA 1HDDC 3HDDA 2DMUA 2DMTA 2XB0X 1ZTRA 2JA7J 1U9NA 2MG4A 1T56A 4BY1J 3HBLA 2M2EA 2FJ1A 5FKOA 1RKWA 2GBYA 3OIOA 4A3IJ 1DU6A 1MSFC 4DYQA 3PO3J 5EDNA 2M8GX 2IBDA 2ZB9A 4BY7J 2N8GA 3I4MJ 2WAQN 2R5ZA 2XPVA 1BL0A 1G2HA 2R5ZB 3GTPJ 4HNVA 1NK2P 4A3GJ 5FJ8J 1MSEC 1QPIA 1D5YA 2LKXA 1WCMJ 2NVQJ 2JJ7A 4D5CA 5K7HA 1LE8A 3HOXJ 2G0EA 4A93J 3S14J 2LLKA 2DA1A 4A3FJ 3A03A 3C2BA 3OSFA 1JJ8C 3NARA 4BKXA 2O7OA 1GDTA 4IHVA 1ZR4A 3MN2A 3S15J 4AYBN 2VKEA 3TEDA 3SDGA 3UKGA 4BBSJ 3GTOJ 3Q3SA 3HOWJ 4DZJA 3MVPA 2TRTA 4W1UA 1CQTA 4G12A 1ZK8A 2Y9YA 3D1NI 2FD5A 1Z0XA 1P7IA 5EGOA 1JKOC 2H1KA 1W0TA 3CDLA 2WB1N 4DYRA 2I10A 2R92J 1YRNA 4J19A 4RBOA 1F43A 2ID3A 3HGGA 4A3EJ 1JT6A 4FTHA 1JJ6C 1RESA 3HEFA 4NDLA 1APLC 1IDYA 2YUSA 3SFIA 1JKQC 5K7FA 2LTPA 3VPRA 1ZR2A 1IUFA 1LE8B 1FJLA 3GTJJ 2DN0A 5F0FA 3BR3A 4RDUA 3NAUA 2E19A 4B1RA 1VFCA 1GT0C 2HXOA 2IAIA 2HOSA 3HOYJ 2JA8J 2QF7A 3S2HJ 1ETWA 5IYDJ 1Z77A 3FK7A 1E3OC 5F04A 1Y1WJ 3BQYA 4UUTA 5GPAA 3M4OJ 2R7ZJ 3QQAA 2VI6A 3HOUJ 2R93J 1U9OA 3TW7A 1OCTC 1FTZA 2LFBA 2LP0A 2FX0A 3IH2A 3RZDJ 4W97A 3JRCA 4DZPA 3M3YJ 2NS7A 3HB9A 3Q0VA 2DA4A 1T33A 4MFEA 9ANTA 1RR7A 4ABZA 2HQ5A 2OF7A 2LVSA 5C4XJ 2MW8A 2X48A 1IC8A 1UMQA 4IHYA 5J3LA 1WH5A 2NVYJ 3O8GA 4M6VA 2CRGA 2NVXJ 3RZOJ 1MBKA 5C44J 1IG7A 3GTQJ 4XRSA 1BA5A 4GFBA 3A01A 1TWGJ 4UUSB 5M5WJ 3K2AA 1UG2A 4M3EA 3B6CA 1FIAA 4V2GA 1XC5A 1HDPA 2JN6A 2X6OA 1RKTA 1JTXA 3BT9A 5EEAA 3JRGA 4A3KJ 4D7MA 1MNMC 2Y0SN 1QVUA 3PM1A 4A3LJ 4M3BA 1B72B 2ME0A 2DTZA 3Q0WA 2XPWA 2JA5J 2XRLA 2RAEA 3RKQA 1MH4A 4FISA 2R5YA 1SANA 4DW6A 1ZKGA 3GTMJ 3HOZJ 3BR0A 3H3VK 1W0UA 3ZOBA 1IRZA 3BTIA 2HYJA 5IP6A 3GTKJ 5EG0A 5FKNA 2GLOA 4C2MJ 2JMWA 1X58A 1WPKA 3LNQA 2K40A 4MLOA 4XICA 3ZQCA 5FKMA 2CUFA 4M3FA 1WGXA 3K7AJ 3CMYA 3OOUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MH3 A;  2ECC A;  4AC0 A;  1K61 A;  2COB A;  5FKK A;  4XRS G;  5F08 A;  2E2J J;  3A02 A;  2JK3 A;  2HDD A;  4A3B J;  1I50 J;  1JUP A;  1Y1V J;  2XSD C;  2IEK A;  2Y31 A;  1HOM A;  2ID6 A;  2L9R A;  3TP3 A;  1A6I A;  4A3D J;  5M3F J;  4JX4 A;  2ELK A;  2HI3 A;  2XGD A;  1JKP C;  4JX5 A;  3WHB A;  5GP9 A;  4C3H J;  2P81 A;  3G1O A;  4B4C A;  1IJW C;  3QPL A;  3PO2 J;  4MFD A;  4JX6 A;  5IP9 J;  2NOG A;  2DJN A;  4I76 A;  5EF6 A;  2QCO A;  1JTY A;  4DYC A;  5E3O A;  2EBI A;  1H88 C;  3BG3 A;  3BQZ A;  4X6A J;  1HF0 A;  3DCF A;  1ITY A;  3RQI A;  4Y7N J;  3FK6 A;  5EZH A;  2EZI A;  3W6V A;  4XK4 A;  1I6H J;  1K83 J;  2K9N A;  3HM5 A;  3QPS A;  2L7F P;  3BTL A;  1DU0 A;  1F36 A;  2W48 A;  1ETV A;  2XPU A;  2DA5 A;  4IHX A;  4L5E A;  5F1J A;  5EZG A;  3O8H A;  5IOY A;  2EH3 A;  1IGN A;  5DTD A;  2YU9 J;  2L0K A;  5JLW A;  3CCY A;  2EZH A;  5FLV A;  2PMZ N;  3ZQI A;  1MBH A;  1RET A;  2CQQ A;  3Q0U A;  2R0Q C;  3S1R J;  5EYR A;  2LY9 A;  3TP0 A;  5HOD A;  4AUX A;  4BXX J;  2XB5 A;  1POG A;  3IH4 A;  1JGG A;  5BNG A;  1BW6 A;  1ENH A;  3ZQG A;  3H0G J;  1B8I B;  3IH3 A;  4M3D A;  1AKH A;  1A5J A;  1ETK A;  1TWA J;  3F0C A;  2VUM J;  3E7L A;  2GM4 A;  2DA7 A;  1B8I A;  3JRE A;  1U78 A;  1FEX A;  1LFU P;  2HOA A;  4A3C J;  2DA2 A;  1TWC J;  3GTG J;  1HCR A;  3LSR A;  2DMP A;  2HXI A;  3I4N J;  5IYB J;  3ZQL A;  1TWH J;  1BJZ A;  3FKI J;  2WV1 A;  4QSH A;  1PUF A;  1BW5 A;  3S16 J;  2LR8 A;  1QVT A;  5J1R A;  3JRB A;  1HLV A;  3G1L A;  2LD5 A;  2TCT A;  5IPA A;  1B72 A;  2DMQ A;  2X9D A;  1ZGW A;  2H8R A;  3GTL J;  1R9T J;  1VND A;  4IHW A;  2M0C A;  2O9L A;  1GVD A;  3BG5 A;  4CYC A;  1X2M A;  1Q1V A;  3JR9 A;  4CYC B;  4XID A;  3S1Q J;  3JRD A;  1VF9 A;  1GUU A;  3OSG A;  4JYK A;  2O8K A;  2MSY A;  2EZK A;  1JUS A;  1WH7 A;  2Y30 A;  2CU7 A;  4D7N A;  2XGE A;  3GBG A;  1EF4 A;  2M34 A;  3B6A A;  2D5V A;  3S17 J;  3HOV J;  4JP0 A;  5F0H A;  3JRH A;  3ZQH A;  4QTR A;  3S1N J;  5IOZ A;  3G1M A;  4BBR J;  1OCP A;  3CQZ J;  1MBF A;  5IP7 J;  1XS9 A;  1O4X A;  4C3J J;  1ZQ3 P;  1AKH B;  1MBG A;  2K9S A;  2EZL A;  4M3G A;  1P7J A;  3A01 B;  5EG0 B;  3FIW A;  1FTT A;  3TW6 A;  2AO9 A;  1JKR C;  2Y2Z A;  1QRY A;  3BTJ A;  4X1E A;  1SFO J;  4XRM A;  5FLM J;  1H8A C;  3JRF A;  3HKZ N;  1S7E A;  1FIP A;  1IV6 A;  2JA6 J;  4MO7 A;  1GV2 A;  3BR5 A;  1ETO A;  1LFB A;  4MIM A;  1MBE A;  1ETY A;  1ETX A;  4FE7 A;  2NS8 A;  4S0H B;  4FCY A;  1GV5 A;  1H89 C;  3WHC A;  2E2I J;  4IEJ A;  1U8B A;  2CJJ A;  2KDZ A;  3FIS A;  2K9Q A;  2CUE A;  3DEW A;  2EQR A;  3MKL A;  2B63 J;  5M5X J;  4A69 C;  3LSG A;  5IYC J;  2KT0 A;  2VKV A;  4FE4 A;  5DS9 A;  4A3M J;  5F0C A;  1XG1 A;  1VI0 A;  3S2D J;  3S1M J;  2DMN A;  2JWT A;  3JRI A;  2AHQ A;  3BTC A;  3L1P A;  4QIW N;  5M3M J;  1JT0 A;  3HGY A;  4EEF G;  1NK3 P;  2FQ4 A;  2LK2 A;  1WI3 A;  2L7M P;  2E2H J;  4C3I J;  2NVT J;  1RPW A;  1YRN B;  5E3L A;  1UHS A;  5M5Y J;  5GPC A;  2Y9Z A;  5JLX A;  1TC3 C;  5E3M A;  5EGO B;  4A3J J;  2HOT A;  2CQX A;  2L7Z A;  1ORK A;  2E1O A;  2VPR A;  1TWF J;  4V2F A;  3IV5 A;  3BR1 A;  2YS9 A;  1PUF B;  2ECB A;  3LOC A;  4B3A A;  2OPT A;  3JRA A;  5FKL A;  5J1Y A;  1X2N A;  5C4J J;  3LSJ A;  3SJM A;  1ETQ A;  5K7Z A;  4Y52 J;  2XGC A;  3BR6 A;  2DA3 A;  5J1U A;  1AHD P;  3BR2 A;  5E3N A;  4D5F A;  5C3E J;  1MBJ A;  1OFC X;  1JUM A;  2ME6 A;  4UUS A;  3ZQF A;  5F27 A;  2MGQ A;  4LOC A;  1IDZ A;  3BG9 A;  1NTC A;  2DA6 A;  1AU7 A;  1I3Q J;  2R5Y B;  1OJL A;  2M9H A;  3LSP A;  4I6Z A;  1HDD C;  3HDD A;  2DMU A;  2DMT A;  2XB0 X;  1ZTR A;  2JA7 J;  1U9N A;  2MG4 A;  1T56 A;  4BY1 J;  3HBL A;  2M2E A;  2FJ1 A;  5FKO A;  1RKW A;  2GBY A;  3OIO A;  4A3I J;  1DU6 A;  1MSF C;  4DYQ A;  3PO3 J;  5EDN A;  2M8G X;  2IBD A;  2ZB9 A;  4BY7 J;  2N8G A;  3I4M J;  2WAQ N;  2R5Z A;  2XPV A;  1BL0 A;  1G2H A;  2R5Z B;  3GTP J;  4HNV A;  1NK2 P;  4A3G J;  5FJ8 J;  1MSE C;  1QPI A;  1D5Y A;  2LKX A;  1WCM J;  2NVQ J;  2JJ7 A;  4D5C A;  5K7H A;  1LE8 A;  3HOX J;  2G0E A;  4A93 J;  3S14 J;  2LLK A;  2DA1 A;  4A3F J;  3A03 A;  3C2B A;  3OSF A;  1JJ8 C;  3NAR A;  4BKX A;  2O7O A;  1GDT A;  4IHV A;  1ZR4 A;  3MN2 A;  3S15 J;  4AYB N;  2VKE A;  3TED A;  3SDG A;  3UKG A;  4BBS J;  3GTO J;  3Q3S A;  3HOW J;  4DZJ A;  3MVP A;  2TRT A;  4W1U A;  1CQT A;  4G12 A;  1ZK8 A;  2Y9Y A;  3D1N I;  2FD5 A;  1Z0X A;  1P7I A;  5EGO A;  1JKO C;  2H1K A;  1W0T A;  3CDL A;  2WB1 N;  4DYR A;  2I10 A;  2R92 J;  1YRN A;  4J19 A;  4RBO A;  1F43 A;  2ID3 A;  3HGG A;  4A3E J;  1JT6 A;  4FTH A;  1JJ6 C;  1RES A;  3HEF A;  4NDL A;  1APL C;  1IDY A;  2YUS A;  3SFI A;  1JKQ C;  5K7F A;  2LTP A;  3VPR A;  1ZR2 A;  1IUF A;  1LE8 B;  1FJL A;  3GTJ J;  2DN0 A;  5F0F A;  3BR3 A;  4RDU A;  3NAU A;  2E19 A;  4B1R A;  1VFC A;  1GT0 C;  2HXO A;  2IAI A;  2HOS A;  3HOY J;  2JA8 J;  2QF7 A;  3S2H J;  1ETW A;  5IYD J;  1Z77 A;  3FK7 A;  1E3O C;  5F04 A;  1Y1W J;  3BQY A;  4UUT A;  5GPA A;  3M4O J;  2R7Z J;  3QQA A;  2VI6 A;  3HOU J;  2R93 J;  1U9O A;  3TW7 A;  1OCT C;  1FTZ A;  2LFB A;  2LP0 A;  2FX0 A;  3IH2 A;  3RZD J;  4W97 A;  3JRC A;  4DZP A;  3M3Y J;  2NS7 A;  3HB9 A;  3Q0V A;  2DA4 A;  1T33 A;  4MFE A;  9ANT A;  1RR7 A;  4ABZ A;  2HQ5 A;  2OF7 A;  2LVS A;  5C4X J;  2MW8 A;  2X48 A;  1IC8 A;  1UMQ A;  4IHY A;  5J3L A;  1WH5 A;  2NVY J;  3O8G A;  4M6V A;  2CRG A;  2NVX J;  3RZO J;  1MBK A;  5C44 J;  1IG7 A;  3GTQ J;  4XRS A;  1BA5 A;  4GFB A;  3A01 A;  1TWG J;  4UUS B;  5M5W J;  3K2A A;  1UG2 A;  4M3E A;  3B6C A;  1FIA A;  4V2G A;  1XC5 A;  1HDP A;  2JN6 A;  2X6O A;  1RKT A;  1JTX A;  3BT9 A;  5EEA A;  3JRG A;  4A3K J;  4D7M A;  1MNM C;  2Y0S N;  1QVU A;  3PM1 A;  4A3L J;  4M3B A;  1B72 B;  2ME0 A;  2DTZ A;  3Q0W A;  2XPW A;  2JA5 J;  2XRL A;  2RAE A;  3RKQ A;  1MH4 A;  4FIS A;  2R5Y A;  1SAN A;  4DW6 A;  1ZKG A;  3GTM J;  3HOZ J;  3BR0 A;  3H3V K;  1W0U A;  3ZOB A;  1IRZ A;  3BTI A;  2HYJ A;  5IP6 A;  3GTK J;  5EG0 A;  5FKN A;  2GLO A;  4C2M J;  2JMW A;  1X58 A;  1WPK A;  3LNQ A;  2K40 A;  4MLO A;  4XIC A;  3ZQC A;  5FKM A;  2CUF A;  4M3F A;  1WGX A;  3K7A J;  3CMY A;  3OOU A; 
#chains in the Genus database with same CATH topology
 1SEU A;  1IUY A;  2MD0 A;  2ECC A;  1HBX G;  1UJ8 A;  1K61 A;  3QOE A;  4XRS G;  4XBF A;  1UAA A;  1Y1V J;  2FU4 A;  2HOE A;  4Y15 A;  5L3D A;  2BW3 B;  3LL7 A;  4ENK A;  1KON A;  2L9R A;  3L7W A;  4XOT A;  3CUQ A;  4UB8 C;  5M3F J;  3C2H A;  1ONV A;  2L54 A;  1YYV A;  1Z7L A;  4HLY A;  2V6E A;  1JKP C;  3DTI A;  3L2W A;  5D8K B;  3PSF A;  5GP9 A;  2BOL A;  3CP8 A;  2GIV A;  1DGW Y;  2Q0O A;  4N9H A;  4EJO A;  4IXA A;  4ENM A;  2WAF A;  1LB2 A;  2F5C A;  2Y75 A;  1MMD A;  3UR3 C;  4MEY F;  1UEL B;  4MFD A;  4JX6 A;  2Z2S B;  2GA2 A;  4AWX B;  5CVR A;  4MEX F;  2KQR A;  3F8F A;  1LVA A;  5GAD J;  4I02 A;  1STZ A;  1IAW A;  1JTY A;  1H88 C;  4L9N A;  3V8J A;  4CCN A;  4X6A J;  1IRG A;  2DK5 A;  4RAF A;  2PI0 A;  1FT9 A;  2R7Q A;  4XLN F;  1RC9 A;  3FK6 A;  3Q9V A;  1SFK A;  2M7B A;  4RAG A;  6PAX A;  2Z5U A;  1YQA A;  5L3F A;  3OS1 A;  1L3L A;  1I6H J;  3HM5 A;  2K9N A;  3ABL H;  3CME I;  3BTL A;  5L3C A;  4EJU A;  3F22 A;  3QRF F;  3HUG B;  1O3T A;  2W48 A;  1BIA A;  2VOP A;  1NG7 A;  2WBM A;  1X1D A;  1ETV A;  1X3U A;  4IRI A;  2XF6 A;  2DA5 A;  4HW0 A;  3NWS A;  5F1J A;  3EUH A;  3H1C A;  5IOY A;  3SHF A;  3PQK A;  2CH0 A;  4RA2 A;  4M71 A;  5JLW A;  4KN7 X;  4II3 A;  1RRJ A;  1HKQ A;  1V3F A;  3HIF A;  1ODD A;  5FLV A;  4E7S A;  4A5N A;  1LPQ A;  2XAJ A;  3I59 A;  5D6E A;  3Q0U A;  2HGC A;  3FF5 A;  3NRV A;  1DP3 A;  1ZRC A;  4R8H A;  1ACI A;  3ZRG A;  3LFK A;  4BXX J;  1Y8R B;  4PGH A;  4GCV A;  1TNS A;  1JGG A;  4LIU A;  5BNG A;  1ENH A;  3DFG A;  1SD6 A;  3MAJ A;  4DJA A;  4GGG A;  1P92 A;  3ABM H;  1I5Z A;  1D1B A;  3BG7 A;  1HW2 A;  3BC8 A;  2ISZ A;  3K4J A;  3PIO F;  1S7A A;  1A5J A;  2QQA A;  4I0B A;  1J7K A;  2GM4 A;  4GDF A;  2VN2 A;  3H9J A;  1FEX A;  1W36 D;  2DFI A;  4G6T B;  3L2R A;  4HF1 A;  3GF2 A;  3KYD B;  5DUI A;  2EFO A;  3KCC A;  3AG2 H;  3LSR A;  4IOA F;  4BDZ A;  5IYB J;  4KIC A;  2KIQ A;  2X85 A;  2W1O A;  3RKY A;  3CES A;  2DCE A;  1U2W A;  4LB6 B;  2WV0 A;  2KHM A;  1Y39 A;  3JRB A;  3QWL A;  1HLV A;  2VOD A;  3FKJ A;  4EM0 B;  2K27 A;  2BW3 A;  3GW2 A;  1DP7 P;  1TW2 A;  1B72 A;  4HV5 A;  2FMY A;  2X9D A;  1DQU A;  5BS6 A;  1EV7 A;  2M0C A;  2QGU A;  2O3F A;  3BG5 A;  4IRG A;  4M74 A;  5E1Z B;  4CYC A;  3GFJ A;  2MAB A;  3CC2 I;  1Q1V A;  3RSN A;  3M9A A;  3PNY A;  2XAF A;  4DIQ A;  1GUU A;  4JYK A;  4PCQ A;  2KLO A;  3LMM A;  2EZK A;  2OJE D;  4PFP A;  4N9I A;  3JAM Z;  1MMS A;  1B1B A;  2Y30 A;  2CU7 A;  2XGE A;  3CJT B;  3I58 A;  2D5V A;  3CLO A;  4R79 A;  2VQG A;  3S1N J;  1D1A A;  5DM6 F;  3G1M A;  4AIH A;  3R4K A;  3IWF A;  1HST A;  1OCP A;  2F2E A;  3MWM A;  1YJW I;  1MBF A;  3WTY C;  1XS9 A;  2W85 A;  1V5E A;  1WKM A;  3WTU C;  1ZQ3 P;  2IJL A;  2DO7 A;  3QOD A;  2IGM A;  1UCR A;  2CGP A;  4XN0 A;  1J59 A;  2DFF A;  4BXU A;  4X1E A;  1SFO J;  3WOD F;  5FLM J;  1BC7 C;  2ZME C;  4BQO A;  5DDG A;  3PQJ A;  4BQQ A;  4MNU A;  4NQW B;  2XAH A;  2ACJ A;  1B9M A;  3BRO A;  3HC7 A;  1FIP A;  1X4O A;  4YII A;  2JA6 J;  2DLL A;  5J4V A;  2W4S A;  4MIM A;  1ETY A;  1ETX A;  3DTE A;  3GFI A;  4G6D A;  4FCY A;  3EYI A;  3SFZ A;  2YU3 A;  3ZR8 X;  1W7P A;  4ZYD A;  1H89 C;  2VPL A;  2V79 A;  3IC7 A;  2H1L A;  4IEJ A;  2CJJ A;  3NWT A;  3FIS A;  3DEW A;  2CUE A;  2EQR A;  3MKL A;  2R7S A;  3RYR A;  5M5X J;  3LSG A;  5IYC J;  4XLA A;  2F5V A;  4A3M J;  2JQ7 A;  1XG1 A;  4KMF A;  1XMA A;  3S2D J;  3AG4 H;  2L4M A;  5JR3 A;  2O0Y A;  3KP7 A;  4RAY A;  5M3M J;  4S04 A;  1JT0 A;  2HDW A;  5DD4 A;  2PQ8 A;  2E2H J;  3VB2 A;  4C3I J;  5J6X A;  2A05 A;  3IRQ A;  1YRN B;  3LA7 A;  1QPM A;  2NVU B;  2EA4 A;  5GPC A;  1X19 A;  2CS3 A;  4NC8 A;  5EGO B;  2HOT A;  2CQX A;  1T39 A;  2PX9 A;  1EKE A;  4OIR F;  4HOB A;  1Y6I A;  5AIQ A;  1FPQ A;  2M45 A;  2OPT A;  3CF5 F;  3OMY A;  3JRA A;  4NQW A;  3FX3 A;  4UB6 C;  5LEK A;  3E5Q A;  3SJM A;  1BOB A;  1FP1 D;  4ZDP A;  5K7Z A;  5KNL A;  4Y52 J;  1X1B A;  5ICC A;  1AOY A;  1MJ9 A;  2DA3 A;  3DF8 A;  2JRT A;  3T5X A;  4PSW A;  1JHH A;  2E1M C;  3M7G A;  4D5F A;  1IRF A;  1ZGA A;  2PMZ A;  1IN4 A;  4D9J A;  2LH9 A;  4KYW A;  5F27 A;  1OYW A;  4LOC A;  1VQ8 I;  1OYY A;  1OCZ H;  4D0P A;  2DA6 A;  2ZSH B;  4L0Z B;  1GXP A;  2NYX A;  2IGK A;  3ZQQ A;  1OJL A;  3LSP A;  1BM9 A;  2NAZ A;  1HDD C;  2V1X A;  3HDD A;  4J01 A;  2XB0 X;  2D2W A;  2HTS A;  3T1B A;  4UVC A;  5JHU A;  3X2Q H;  2M2E A;  2X4H A;  1RKW A;  4B48 A;  2P6T A;  3OIO A;  2ADU A;  4A3I J;  2P4W A;  3TBI A;  2PJR B;  3HKZ A;  5EDN A;  4EJW A;  1RR8 C;  4BY7 J;  3KE2 A;  1MND A;  1XGM A;  3QYF A;  4EGY A;  3HUG A;  3CLQ A;  3LFU A;  2QYO A;  4EM2 A;  4F7Z A;  2WY7 Q;  3AG3 H;  3OYL A;  3IL2 A;  2R5Z B;  1K4T A;  2XRN A;  4A3G J;  2M7A A;  1LJ9 A;  1KZH A;  3VWB A;  2OV7 A;  1XMX A;  1YIO A;  4BJ6 C;  2LLK A;  1UFM A;  3O6B B;  4A3F J;  4OIQ F;  4UY8 I;  4RB1 A;  4LLN A;  3C2B A;  4RAZ A;  3KLO A;  3NQO A;  3VYT B;  3HSF A;  4MQV A;  3NAR A;  2CV0 A;  1SVO A;  1AA7 A;  3W2V A;  3G73 A;  5DCM A;  2CW0 F;  4EQQ A;  4CSW A;  3ZMS A;  2LY1 A;  3UKG A;  1N77 A;  5BQT A;  5E17 F;  4A5M A;  4IJA A;  5TIS C;  2X6Y A;  1RI7 A;  2OZ6 A;  3Q3S A;  4CA0 A;  4G12 A;  1CQT A;  1ZH5 A;  3VOD A;  1PDN C;  1YS6 A;  2FSW A;  3G6E I;  4E70 A;  3W2A A;  3FBN B;  3W3C A;  2LOO A;  1TTY A;  2IXS A;  5LD2 C;  2I10 A;  4J19 A;  2E7X A;  1FP2 A;  3GFM A;  1JJ6 C;  3GLL A;  1UST A;  3KP4 A;  3EUA A;  3QU6 A;  4LLG F;  3F23 A;  1OR7 A;  1ZAO A;  3N4M A;  1LE8 B;  4ZZD A;  4UXN A;  1BC8 C;  3S32 A;  1YE9 A;  4KJZ A;  5ERI A;  2E19 A;  4LIV A;  3ZCO A;  1BI3 A;  4B1R A;  1VFC A;  1GT0 C;  2HXO A;  1FYK A;  1XTA A;  3PL8 A;  4Z6Y A;  2EK5 A;  2HOS A;  2JA8 J;  2K9L A;  5KK1 A;  3HRT A;  1CF7 B;  2KL4 A;  3I4P A;  4LGW A;  5F04 A;  1R22 A;  3GVA A;  4B09 A;  1Y1W J;  3IAS 2;  2MD5 A;  4UUT A;  2MA3 A;  3U21 A;  2CQ7 A;  2VI6 A;  5ILS A;  2FUG 2;  4B3X A;  3ISP A;  4BQA A;  4YFK F;  3BOQ A;  5FRM A;  1UZC A;  3OYH A;  4HG2 A;  2CWE A;  3IWZ A;  4L5J A;  1U9O A;  2HKX A;  1VTN C;  1VQ6 I;  3L2C A;  2M3A A;  2ZME A;  3HTU A;  4L5I A;  2CMP A;  2LP0 A;  3CZ6 A;  3JRC A;  2PJP A;  2ETH A;  3CD6 I;  5DCM B;  3KFW X;  3ZN1 A;  3KP2 A;  4ZDO A;  1FC3 A;  2HZD A;  4LB5 A;  4N0B A;  2YX4 A;  1WJC A;  1YW8 A;  3K1N A;  3LA2 A;  4M6X A;  3I0T A;  2ZNZ A;  1IC8 A;  3ASN H;  4LG3 A;  3AG1 H;  4RLF A;  1A6Q A;  1LEB A;  5E20 A;  3LSH A;  1WH5 A;  2F4O B;  2NVY J;  5TJJ A;  2B7E A;  1S6L A;  4A0Z A;  4DGW B;  2OTL I;  2NS0 A;  3QYE A;  3RZO J;  3ESW B;  1A35 A;  1S8N A;  1Y0U A;  1R58 A;  3DV8 A;  2ISY A;  1BA5 A;  4QWQ A;  3DBH B;  4GFB A;  1B4A A;  2L4A A;  2PMU A;  1LUJ B;  3RJP A;  2JA2 A;  3GEZ A;  2OAZ A;  3KYL A;  2LRE A;  1MW7 A;  3B6C A;  3DBR B;  3K69 A;  1D0Y A;  1P6R A;  1XC5 A;  2BVM A;  3EPZ A;  4WWC A;  4H0E A;  2DPU A;  2JN6 A;  3I3L A;  4F92 B;  1RKT A;  5EEA A;  1K6Y A;  1UHW A;  4D7M A;  1SAX A;  1FY7 A;  3COA C;  4BAY A;  2ME0 A;  3F8B A;  4XOR A;  4ZTF A;  1MD0 A;  2XPW A;  3HRU A;  2ELH A;  2RAE A;  2EB7 A;  1YTY A;  3G4S I;  1SAN A;  3M1E A;  1ZKG A;  3DEE A;  4DW6 A;  1IXS B;  5HDG A;  2K85 A;  4KA4 A;  5E79 C;  4HF2 A;  1ZGJ A;  2OD5 A;  3CMM A;  3G3Z A;  4OAY A;  3BTI A;  4M6Y A;  1LFP A;  1Y8Q B;  3L2V A;  2A3S A;  2K40 A;  3EYY A;  3FM5 A;  3KZY A;  2KDO A;  3ROU A;  1O3R A;  3WG9 A;  3DLL F;  3K7A J;  1G4D A;  3CMY A;  2GXA A;  3L9F A;  2ID6 A;  3OOU A;  4DBR A;  4LG0 A;  1KU3 A;  1RNL A;  4AC0 A;  2L2O A;  3CP2 A;  1QZZ A;  5GAG J;  1HKS A;  1ZLJ A;  3S3O A;  3BJA A;  3CDI A;  2IEK A;  3S2W A;  2QQ8 A;  3LSK A;  3SZG A;  1WJD A;  2YPR A;  1SFE A;  3F8C A;  4M73 A;  1HOM A;  3A4C A;  4CXF A;  1WJF A;  3TP3 A;  1A6I A;  4UV9 A;  3CC4 I;  3IKV A;  3CTA A;  2ELK A;  1T8I A;  4PJN A;  4XKB A;  1AWC A;  3E6D A;  2ELJ A;  2CV1 A;  1W7P D;  1JXS A;  4ZTJ A;  1WWX A;  2P81 A;  2BBY A;  1SMY F;  4B4C A;  5HVQ C;  2BXZ A;  4XOP A;  3PO2 J;  5FD6 A;  2NOG A;  2DJN A;  3CJR B;  4WXD A;  2VE9 A;  5EF6 A;  2EFW A;  1PP8 F;  2DU9 A;  4U0W A;  2EIM H;  3GUD A;  1REP C;  3H5R A;  4EJV A;  4AVP A;  3BG3 A;  5FRN A;  3BQZ A;  1FOY A;  4FET A;  4E7Z A;  1ITY A;  2L3D A;  3RQI A;  2L02 A;  5EZH A;  3S8P A;  5LEJ A;  2E35 A;  3W6V A;  1Z05 A;  1BJA A;  2DYS H;  2Q1Z B;  2X1C A;  4F52 A;  4F93 B;  3QPS A;  4A0Y A;  2L7F P;  1VZ0 A;  3OYM A;  4WK8 F;  2VOO A;  1F36 A;  3BJ6 A;  2OU2 A;  2GQQ A;  4ZYH A;  1P2F A;  2XPU A;  4L5E A;  3J7A Y;  2GOM A;  3O8H A;  4BHB A;  5DTD A;  2FEZ A;  1ZG3 A;  2A68 F;  3HTS B;  2K7L A;  1EH6 A;  2YU9 J;  3JSO A;  5KHD A;  3CCY A;  2BY0 A;  1DDN A;  3H5N A;  3A2K A;  3WU1 B;  3EUK L;  3ZQI A;  4I7H A;  4I01 A;  1O57 A;  1V4R A;  1G8X A;  1W5S A;  2AQF A;  4PJL A;  3D5R C;  4C2T A;  2X1E A;  5HOD A;  4AUX A;  1YLF A;  3QOP A;  3IH4 A;  1HQC A;  4LJZ F;  2STT A;  4B43 A;  1NHA A;  1KA8 A;  1W5C C;  3JW4 A;  5FFZ A;  2TDX A;  2R7F A;  2IA2 A;  4PGG A;  2Z3Y A;  3WU0 A;  2HU9 A;  2VJJ A;  3V42 A;  2R7W A;  1F9N A;  5DD8 A;  1ETK A;  1TWA J;  5CVI A;  3TL4 X;  3V8L A;  3W6J B;  2VUM J;  1PVE A;  1V55 H;  2DA7 A;  3E7L A;  1VQ7 I;  3ASO H;  1TP4 A;  3JRE A;  1JI8 A;  4UVB A;  3WTS C;  1LFU P;  1I1S A;  2DW4 A;  1FNN A;  3OIQ A;  1DUX C;  3TOA A;  4PSX A;  3I4N J;  3HSR A;  1VQ9 I;  3RDI A;  3FKI J;  2K5C A;  1LDK B;  3GZ6 A;  2FOW A;  4YEL A;  2LR8 A;  2ZJP F;  4WX9 A;  2Y0M A;  5B66 C;  2LD5 A;  4IOC F;  3HJE A;  2L01 A;  3B73 A;  3RPU D;  3CCL I;  4FT8 A;  2DMQ A;  2H8R A;  1R9T J;  4IHW A;  3L00 A;  2RRE A;  2O9L A;  4ANJ A;  1XSD A;  2OTJ I;  1W1W E;  3QPH A;  3DPU A;  2V1D A;  2RDP A;  3JRD A;  3C18 A;  2D1H A;  1TLH B;  2QBY A;  3OSG A;  1M1E B;  3BZ6 A;  3MZY A;  2FA5 A;  1T38 A;  2O8K A;  2CV2 A;  3KEQ A;  3RPU A;  2K3P A;  1JUS A;  3DKY A;  4D7N A;  2VXZ A;  2ICW G;  3B6A A;  1XPX A;  3S17 J;  2A6T A;  3ZPL A;  5HDK A;  2RV8 A;  3DXJ F;  1R4M B;  2F6C A;  5IP7 J;  1P4A A;  4HSR A;  2I5U A;  2JSP A;  1BOA A;  2QZ8 A;  4C3J J;  1YIJ I;  1O4X A;  1MBG A;  2K9S A;  3ERM A;  2EZL A;  4M3G A;  2K4B A;  5EG0 B;  3FIW A;  4FQG A;  5J40 A;  3TW6 A;  1JKR C;  2IGN A;  2Y2Z A;  4HPQ A;  4U0V A;  1QRY A;  4XRM A;  1I6X A;  2EWN A;  1UG0 A;  3HKZ N;  1ZAR A;  1S7E A;  2XAS A;  5LLQ A;  1G3Y A;  1WFX A;  4CGZ A;  1MGT A;  5LGN A;  1EJ9 A;  5LHH A;  4C30 A;  2HPI A;  2NS8 A;  4RS8 A;  4S0H B;  4OAZ A;  5IY5 H;  1MJB A;  3BWG A;  3WHC A;  5H2F C;  3E5X A;  2VJ5 A;  4C9Y A;  2FQ3 A;  3I64 A;  1LVK A;  2K9Q A;  5DEQ A;  3E3V A;  4G9Y A;  2VKV A;  3RKW A;  3QPT A;  2L5Q A;  4RB2 C;  2P7C B;  2MYS A;  1IO2 A;  1WQ2 A;  1YX5 A;  2CUZ A;  2JWT A;  3EQL F;  2P0W A;  3JRI A;  2IS1 A;  3K0L A;  2H6C A;  5AON A;  3HGY A;  3J80 Z;  1WRJ A;  2A61 A;  4D1Q A;  1FOW A;  4E7K A;  2FQ4 A;  1O3S A;  1NK3 P;  3WE2 A;  3K70 C;  4ESB A;  3K9T A;  2WTE A;  5CKT A;  5IT9 Z;  1PJR A;  2XGX A;  3MEX A;  3IKT A;  1T2K A;  4Q5S F;  2L7Z A;  3KPH A;  1YG2 A;  4X0G A;  3GWZ A;  3TGN A;  5L3B A;  3BR1 A;  1MMN A;  1B6A A;  3WG7 H;  3T0Y A;  1MNE A;  3PUF A;  5B1B H;  3P5J A;  5K5O A;  5FKL A;  5A2Q Z;  2F4I A;  1SC7 A;  5J1Y A;  3OWT A;  5C4J J;  3LSJ A;  5KAI C;  2CQK A;  1ETQ A;  2Y48 A;  2HVR A;  4MHG A;  1K78 A;  3UNG C;  1TQM A;  3BR6 A;  2DDB A;  2F4M B;  3OR2 C;  3CUQ B;  1AHD P;  4EV0 A;  2E5Z A;  3SQN A;  4B8X A;  1JUM A;  2QA4 I;  2ME6 A;  3ZQF A;  3OY9 A;  2MGQ A;  2RC4 A;  1IDZ A;  3T8R A;  3D5S C;  4EM1 A;  1TL8 A;  5H6R A;  4IL6 C;  2DT6 A;  2R5Y B;  3OV8 A;  4XSZ F;  4M72 A;  2M9H A;  1DGR M;  4I6Z A;  5CQE A;  4P96 A;  2R7U A;  2DMU A;  2LBF B;  2DMT A;  1U8R A;  2WB1 A;  4PDK A;  1ZN2 A;  3KIO A;  1L0O C;  2MG4 A;  3FMQ A;  3K10 A;  4I0A A;  4NB5 A;  2FJ1 A;  3VDX A;  4KIT B;  1X1C A;  3ZMU A;  2GBY A;  1DU6 A;  2IT0 A;  4DYQ A;  5TGT A;  2GAU A;  1TW3 A;  4UVA A;  2V4J C;  3A1Y A;  2IBD A;  2HYG D;  2ZB9 A;  3OYG A;  1FBS A;  2RKH A;  2KPM A;  1TBX A;  1KQ8 A;  2JT1 A;  4A6E A;  4G6Q A;  1BIB A;  1LDD A;  4R1H A;  1O3Q A;  1A04 A;  1KU9 A;  4HNV A;  1NK2 P;  3I55 I;  1FSH A;  5FJ8 J;  4YG2 F;  4PJM A;  1QPI A;  3K6G A;  1LNW A;  4IO9 F;  4ASN A;  4UV8 A;  2BHY A;  5ICG A;  2NVQ J;  3AL0 C;  2F5F A;  3B02 A;  3S14 J;  4B44 A;  2DA1 A;  2Z33 A;  3H3U A;  3M8J A;  1I1G A;  5ICE A;  1E3P A;  1ERD A;  4P9F A;  3SYT A;  2CG4 A;  4ETS A;  2VBY A;  2O7O A;  3MN2 A;  4WXH A;  2H6B A;  2QEN A;  3GO5 A;  3KYC B;  2E60 A;  2JZY A;  1VQ5 I;  4QLC U;  3GTO J;  3C1D A;  2FBI A;  3RPQ A;  4ESJ A;  4DZJ A;  3HOW J;  1S9H A;  1T0F A;  2FD5 A;  4A12 A;  4GYG A;  1LKX A;  2X6X A;  3FM3 A;  4LK0 F;  1Z7U A;  5LRR A;  1FMV A;  5IT3 A;  1UHM A;  1YRN A;  3ABT A;  1XSX A;  2R7D A;  4A3E J;  2RN7 A;  2AS5 F;  4O6J A;  1JT6 A;  1RES A;  1KQ9 A;  4NDL A;  4OOI A;  1IDY A;  5K7F A;  1V54 H;  2BXY A;  5HDN A;  3KEY A;  1USS A;  5BPD A;  1IUF A;  2DAO A;  2HQR A;  2VBW A;  2DN0 A;  3OL4 A;  5GTH C;  2WAQ A;  3NAU A;  4KNY A;  2JPB A;  2Q2E A;  3JTH A;  3CC7 I;  2E36 A;  3MCZ A;  5GAH J;  3DPL C;  4XLC A;  3BG6 A;  2W82 A;  5E8G A;  1MDM A;  3S2H J;  2XDV A;  2ZCW A;  5D5U B;  1K4S A;  4XMY A;  1Z9C A;  4BDY A;  1X1A A;  1WHU A;  3M8F A;  3U1D A;  4BE1 A;  1JE8 A;  2OZU A;  3M4O J;  3QQA A;  5CLS A;  2VQH A;  2E1N A;  5JI6 A;  2WY8 Q;  5GAE J;  1N75 A;  1CF7 A;  2KKO A;  4V19 K;  1HW5 A;  1V5F A;  1YO5 C;  2NOJ B;  2FX0 A;  2XRO A;  1SFU A;  3MKW B;  3PUB A;  4P55 A;  2LNB A;  2DDA A;  2P8T A;  3KLN A;  1VQO I;  3HB9 A;  4MFE A;  5K5Q A;  9ANT A;  1RR7 A;  2HQ5 A;  2R7O A;  3DEU A;  2LVS A;  4AID A;  2MW8 A;  1F4K A;  4UUV A;  2MLK A;  3F6O A;  3CMA I;  3P9C A;  5J3L A;  3O8G A;  2Z16 A;  4M6V A;  3WTV C;  1Z1D A;  4BU2 A;  2VIX A;  1KYZ A;  2CRG A;  5CQG A;  2D45 A;  1MBK A;  1WJB A;  4XRS A;  2Z1D A;  2JVH A;  3MKZ A;  2RGV A;  2H8W A;  3PNV A;  3F8M A;  4TV7 A;  5D4S A;  2BHZ A;  1TWG J;  5HS9 A;  2WAD A;  2DQL A;  4M3E A;  3H5A A;  4V2G A;  3ZMV A;  3V7S A;  2FXA A;  2FNP A;  1HDP A;  4DBQ A;  5B5E C;  3E1S A;  3HHH A;  3VYU B;  1JTX A;  3K4C A;  5KCM A;  2NNY A;  4QPO A;  4A3K J;  2Y0S N;  1OCO H;  1QVU A;  2M30 A;  4CH7 A;  2OCE A;  5D8L B;  4E6K G;  3EDP A;  3E6M A;  3PFI A;  3RKQ A;  3I59 B;  2BEO A;  2FOK A;  3U9G A;  5K5R A;  2LRD A;  3KP3 A;  3HOZ J;  2W84 A;  5CYV A;  4HYE A;  3CCJ I;  1GHC A;  1W0U A;  3ZOB A;  4LIT A;  1VQ4 I;  4ENJ A;  2EIJ H;  5EG0 A;  3GTK J;  1XDU A;  5FKN A;  1WSU A;  2LC2 A;  1OIS A;  1D1C A;  3WGH A;  1QHH D;  1NG6 A;  1XGO A;  1QBJ A;  3TOB A;  1N25 A;  3M8E A;  4U0Y A;  2VB6 A;  3HSE A;  1ZG5 A;  2W25 A;  2CUF A;  2HS5 A;  3LSM A;  1YW7 A;  4M3F A;  2PJR A;  2BVL A;  4LG0 B;  4BEH B;  1MH3 A;  3HOT A;  3R6S A;  4NNJ A;  2MC3 A;  3FXR A;  2COB A;  2E2J J;  5F08 A;  4M9Z A;  2JK3 A;  3TDZ C;  5LGT A;  4A3B J;  1JUP A;  5CJ9 A;  2XSD C;  4L0Y B;  1TT0 A;  1MIJ A;  2DT5 A;  3OYF A;  3S3M A;  3LAJ A;  4A3D J;  3A0B C;  4YIF A;  2QQB A;  2G9W A;  4JX4 A;  1XB4 A;  2XGD A;  3WHB A;  1TQI A;  4HDU A;  4G7H F;  2CFO A;  3E6B A;  1R71 A;  2VJ4 A;  3OIP A;  2R7V A;  3F3X A;  2JVG A;  2O8X A;  4XN3 A;  3QPL A;  3N97 A;  4U87 A;  5IP9 J;  1QQI A;  3FXO A;  3ZP5 A;  2OA4 A;  2P7V B;  5FD5 A;  3DLA A;  2P6S A;  2QCO A;  5E3O A;  2EBI A;  1ZRE A;  2W57 A;  5K1Y A;  1F1Z A;  3CF2 A;  1HF0 A;  3RKX A;  3DCF A;  4L18 B;  3RYP A;  1HW1 A;  4U7D A;  5CVJ A;  1SD7 A;  1RZ4 A;  2XF7 A;  4KMU X;  3RCO A;  2EZI A;  4HA8 A;  3DBL B;  1ZEL A;  3F9K A;  4KT6 A;  4XK4 A;  3V8K A;  1YIT I;  1K83 J;  1R5I D;  1S7O A;  4K2E A;  2ZNY A;  1DU0 A;  3DKX A;  1U5T C;  4IHX A;  5EZG A;  3OYC A;  5HS8 A;  3AFH A;  2V6C A;  2NNN A;  3FXU A;  1Z3X A;  1D8J A;  2L0K A;  2XAU A;  4RMN A;  2DXI A;  1FYL A;  2DPD A;  4P5O A;  1ON1 A;  5EJC A;  3HL2 A;  3HXL A;  1MBH A;  1RET A;  3H35 A;  2EA2 A;  3GZ5 A;  2G7H A;  2R0Q C;  3S1R J;  1YFH A;  2LY9 A;  2YX7 A;  4OMZ A;  5HLH A;  1XGN A;  4L9J A;  4LMY A;  2AQE A;  1BW6 A;  1SAU A;  3H0G J;  2QQ9 A;  1B8I B;  3IH3 A;  1U5T A;  1SD5 A;  3R0A A;  1AKH A;  1IN7 A;  2GXG A;  3HRS A;  5J8C A;  3F0C A;  4BAC A;  4F3Q A;  2DK8 A;  4BJT A;  4CCL A;  1FZP B;  2VON A;  2BY2 A;  3OYK A;  1D0X A;  3SDB A;  1MZB A;  2WWY A;  1HCR A;  5J8F A;  2DMP A;  2HXI A;  2LMD A;  3ZQL A;  1TWH J;  1BJZ A;  4L9V A;  4KT5 C;  2DOE A;  2WV1 A;  2O6G E;  1PUF A;  4XKC A;  5CVU A;  2CUJ A;  3PIP F;  2QUF A;  1QVT A;  5J1R A;  1R6R A;  4YFN F;  1VQK I;  4ZH4 F;  3VEP A;  4AIK A;  3G1L A;  5TRD A;  2V9V A;  2ZJR F;  1RUN A;  1GXQ A;  2BZT A;  4BXF A;  1ZGW A;  4HDV A;  4DQ2 A;  2J5P A;  1GVD A;  3U1K A;  3GFL A;  3DU5 A;  2EV0 A;  1X3W B;  2FRH A;  3JR9 A;  3L2U A;  4XID A;  3K70 D;  4GYI A;  2FML A;  3ML6 A;  2ESN A;  2LG4 A;  2ZKZ A;  1OQY A;  2PEX A;  3GXO A;  3AKZ A;  3I9V 2;  3FXK A;  3ZN0 A;  1FMW A;  3GBG A;  1EF4 A;  1Z21 A;  2M34 A;  3BZK A;  3FMS A;  3OR1 C;  3ABK H;  3JRH A;  2KIF A;  3ZQH A;  4QTR A;  1TNT A;  4PJJ A;  2P5V A;  1I27 A;  5HLT A;  1QZE A;  2PLY A;  2Z99 A;  2V1U A;  3TMO A;  1EA3 A;  1AKH B;  4XLE A;  3WTZ A;  1P7J A;  3A01 B;  3G2B A;  2LY2 A;  4XRF A;  5B1A H;  1K6O A;  1FTT A;  2ZC2 A;  4PZJ A;  3ULQ B;  1E3H A;  4M9S A;  3TKY A;  2HDC A;  1QO0 D;  1X4P A;  2JPC A;  2QSH X;  4HBL A;  3CO7 C;  2W24 A;  3WTX C;  4H4K C;  2FBH A;  1IV6 A;  2EFP A;  3BR5 A;  1ETO A;  1XCV A;  3GLX A;  3RI4 A;  3ABU A;  1HC8 A;  4II2 A;  1QHG A;  1IRX A;  1U8B A;  1G6N A;  2M4G A;  4I09 A;  1HA8 A;  4A69 C;  4EJT A;  1YHQ I;  2YSR A;  4AM3 A;  2PN6 A;  2OCC H;  5D6F A;  1VI0 A;  2XVC A;  2ZSI B;  2HVQ A;  3ZMT A;  3S1M J;  2DMN A;  5BMZ A;  2VJI A;  3ZMZ A;  3ZXS A;  3OYI A;  3FXJ A;  4FX0 A;  4EAT A;  4MTD A;  4EEF G;  4IX7 A;  4BE2 A;  4BQN A;  3CUQ C;  3MD2 A;  2LK2 A;  1WI3 A;  3C2G A;  2KJB A;  2DT7 B;  2CO5 A;  4XM3 A;  2A6H F;  1UHS A;  1WJA A;  3DPT A;  4I98 B;  5M5Y J;  5E3M A;  3OOP A;  1WI9 A;  4A3J J;  3BCB A;  3HRM A;  2P5K A;  1ORK A;  3WU2 C;  2E1O A;  2AXT C;  2VPR A;  1TWF J;  4V2F A;  2YS9 A;  1PUF B;  3LOC A;  2A07 F;  4B3A A;  1IN6 A;  2O61 A;  2EPF A;  2BY3 A;  2L7K A;  1N78 A;  2OQR A;  3AAF A;  1X2N A;  2K86 A;  4E7H A;  3OYN A;  2KJC A;  3WGG A;  2QKM B;  5JVT A;  2XGC A;  3ZMD A;  5J1U A;  4EVI A;  1NH3 A;  5E3N A;  2B9S A;  2ZME B;  3VSL A;  2O5R A;  5FLX Z;  5C3E J;  2EV6 A;  1PUE E;  3HHG A;  4XON A;  1R1T A;  4UUS A;  4GO1 A;  4F91 B;  4ZC3 A;  2BGC A;  2UZK A;  1Z6T A;  3CCV I;  4OIO F;  3IHU A;  3HG9 A;  1EH8 A;  1AU7 A;  1Z67 A;  1R49 A;  1W7P B;  2XKP A;  2DOA A;  4CCJ A;  5DCF A;  3HZJ A;  3JSP A;  2JA7 J;  1V5G A;  1U9N A;  5L3E A;  2UV1 A;  3HBL A;  2IW5 A;  4I2O A;  5FKO A;  1D5V A;  3RIR A;  1S3J A;  1BI0 A;  4Y4R A;  2XC7 A;  3VFZ A;  4E7I A;  1P9Q C;  1OCC H;  3GZN B;  4HST A;  2N8G A;  3K1M A;  5D4R A;  3K1P A;  3H9Q A;  4ZZL A;  3U2R A;  2H27 A;  5IT9 K;  1BL0 A;  2IVM A;  3CJQ B;  1G2H A;  3BZC A;  4B47 A;  2R7X A;  3H0D A;  1MSE C;  1Z6R A;  2FNA A;  1H9T A;  4G7O F;  2BE5 F;  5JHF A;  2LKX A;  1WCM J;  1FX7 A;  5K7H A;  3CJN A;  2XIG A;  1LE8 A;  5D5X B;  1EH7 A;  1P4X A;  1FYM A;  3A03 A;  4C2U A;  1ZYR F;  4ZYG A;  1JJ8 C;  1R5H A;  4CCO A;  2OQG A;  4BKX A;  4UNO A;  5F6F A;  1GDT A;  2LKP A;  3BLY A;  3S15 J;  4AYB N;  1FWZ A;  3MMY B;  3TED A;  3OL3 A;  4BBS J;  3MVP A;  4N4N B;  4W1U A;  1ZK8 A;  2DOF A;  2QWW A;  2Y9Y A;  1K7A A;  1P7I A;  4XNF A;  5EGO A;  3CCS I;  2H1K A;  2BV6 A;  3S93 A;  1XN7 A;  3FXL A;  1LQ1 A;  5LHI A;  2R92 J;  3BP8 A;  4HQE A;  3I71 A;  4RBO A;  4IQ4 A;  1F43 A;  2ID3 A;  3HGG A;  4OIP F;  3HEF A;  1FOX A;  1APL C;  4E4H A;  2YUS A;  3FHN A;  2R3S A;  3FXM A;  4Z2Y A;  3SFI A;  1OKR A;  2LTP A;  3VPR A;  4ZJZ A;  2JRM A;  3K4M A;  1FJL A;  3GTJ J;  5LBQ A;  3D5L A;  4NC7 A;  5F0F A;  4YFX F;  2DBB A;  2XAG A;  1T95 A;  4HEA 2;  3M1C A;  2QF7 A;  4G7Z F;  4XLH A;  4KN4 X;  2EIL H;  3ERE D;  1MDM B;  3F21 A;  1U3E M;  1X1P A;  3C7J A;  5IYD J;  2RNJ A;  1E3O C;  4E7L A;  2VXD A;  4ITV A;  2FBK A;  3BPX A;  3BQY A;  3IUO A;  2COM A;  5BPI A;  1F5T A;  5GPA A;  5CVV A;  3MFK A;  3H92 A;  5FFX A;  3VYS B;  2WAE A;  3G71 I;  1XSV A;  4BNC A;  5ED4 A;  1B9N A;  3HOU J;  3GCM A;  3I54 A;  4BL0 B;  3P7N A;  3DP7 A;  3FMR A;  4YEJ A;  1QGP A;  2LFB A;  2R7R A;  1VQN I;  3KX2 A;  4W97 A;  2M4K A;  2OBP A;  5HLI A;  2A69 F;  4AU7 A;  4BYY A;  1FBQ A;  2NS7 A;  1RUO A;  2DA4 A;  1IF1 A;  2JUC A;  4RGU A;  4U88 A;  2OF7 A;  4L9T A;  1YJN I;  3LQQ A;  5E18 F;  5C4X J;  2X48 A;  2GIZ A;  3CCE I;  2FF4 A;  2HEO A;  4XLF A;  1ULY A;  3HYI A;  4A0X A;  3LA3 A;  2HQN A;  4IHY A;  1QA6 A;  2QKL B;  1IZ1 A;  4U7B A;  2NVX J;  1K78 B;  1I39 A;  5C44 J;  5ICF A;  1IG7 A;  2L9N A;  3N05 A;  2HNH A;  4OIN F;  3E97 A;  2V26 A;  4HQM A;  2CYY A;  1TQP A;  4IHT A;  2C6Y A;  4MGR A;  2E71 A;  2K3F A;  4EGZ A;  1UG2 A;  2VBX A;  4RGR A;  3VYR B;  4IVN A;  4CZZ A;  5D5W B;  2X6O A;  3F8N A;  2HPM A;  1XGS A;  3BT9 A;  4Q47 A;  3JRG A;  3LSI A;  4A3L J;  1ZLK A;  4M3B A;  2UXX A;  2ESH A;  3JAM K;  1B72 B;  3H9G A;  3PNT A;  3Q0W A;  1HSJ A;  2JTV A;  1G3W A;  3PSI A;  2XRL A;  4Y17 A;  2R5Y A;  3W2W A;  3GTM J;  2VE8 A;  3GME A;  4NC6 A;  4CYD A;  3EUH C;  3D0S A;  2ZXH A;  2DJI A;  2IPQ X;  4JOM A;  1WZ2 A;  4KIG A;  3CCR I;  4DNC A;  1IRZ A;  5IP6 A;  2HYJ A;  1MMA A;  5CPR B;  3R61 A;  4C2M J;  1X58 A;  2L9V A;  4XLP F;  1Z3Y A;  1QU3 A;  2XF5 A;  4J00 A;  3A0H C;  1TT5 B;  3ZQC A;  2V1N A;  4BGD A;  3CCM I;  1WGX A;  4CIC A;  1W5T A;  4OWR B;  2X1D A;  1S29 A;  5EEH A;  1E17 A;  1KU7 A;  5FRO A;  1XMK A;  4XR6 A;  3F6V A;  5FKK A;  5JVG F;  3A02 A;  1E2X A;  4AVZ A;  2HDD A;  1HXD A;  1I50 J;  1OCR H;  1J0R A;  5E8I A;  2K02 A;  2Y31 A;  2RQP A;  1T08 B;  5J4Y A;  3K4K A;  4BJ5 C;  2Q8K A;  4XKW A;  2MH9 A;  1U0J A;  1YW9 A;  2HI3 A;  3P9I A;  1G3S A;  1FOK A;  4JX5 A;  3JCU C;  2UWM A;  4CCM A;  4MQ9 F;  4C3H J;  4ENN A;  5LFA A;  1YI2 I;  2QBY B;  3GX4 X;  3J7A O;  4HX4 A;  3G1O A;  3BJO A;  3ECO A;  1JGS A;  1IJW C;  3CO6 C;  3MZ8 A;  1IN8 A;  3RQ4 A;  4LLL A;  2DTR A;  3TQN A;  3J80 K;  4I76 A;  3FBI B;  5H20 A;  1OPC A;  3ZQ7 A;  1LDJ A;  4UHT A;  5ILV A;  2QEX I;  5AIP A;  4DYC A;  2JUG A;  2EV5 A;  1PP7 U;  3E5U A;  1J09 A;  3K4N A;  1XCB A;  3I53 A;  4IKF A;  4YIR X;  4KIB A;  2OUM A;  3OYA A;  3QU3 A;  4Y7N J;  3V4G A;  2RQQ A;  2IS4 A;  1OYI A;  3PJR A;  3JTG A;  2KZV A;  2K9M A;  1G59 A;  5DM7 F;  1WVR A;  5DV5 A;  4XL9 A;  2LYC A;  3IRR A;  4CUG A;  2VKH A;  5ILU A;  1XD7 A;  2Q2E B;  2EH3 A;  1IGN A;  2QLZ A;  3OYD A;  2H09 A;  2QVO A;  3FDY A;  4IHS A;  2LDU A;  5DYM A;  2EZH A;  3RTR A;  2KFD A;  4AYB A;  2PMZ N;  4S05 A;  4AD9 A;  4HV6 A;  1OMI A;  2CQQ A;  2VAS A;  5EYR A;  1H0M A;  3Q9S A;  1SVL A;  3TP0 A;  3BCA A;  5F1R A;  1R1V A;  2XB5 A;  2RNG A;  1POG A;  2X6W A;  4NUB A;  4LD5 A;  5H6Q A;  5HNF A;  3ZQG A;  2A5W A;  1Q1H A;  2V9P A;  3SEQ A;  3HPH A;  4RB3 C;  4KUM A;  3WTW C;  4M3D A;  2CQN A;  3OS2 A;  3FHZ A;  4KDP A;  3IAM 2;  5KAF C;  3CUO A;  5A2Q K;  1OLT A;  3WTT C;  1VQP I;  1MKM A;  2VBZ A;  1B8I A;  2W7N A;  1XX5 A;  1U78 A;  2KIS A;  1R23 A;  2O03 A;  2HOA A;  4A3C J;  3K4L A;  4HNU A;  2DA2 A;  1TWC J;  3LST A;  3GTG J;  5FGM A;  2X51 A;  2D1V A;  1R36 A;  2A5Y B;  3F72 A;  4RGX A;  1IXR C;  4QSH A;  1BW5 A;  4A6D A;  3S16 J;  4KIS A;  1JHF A;  1ON2 A;  2IRF G;  3TO7 A;  2DYR H;  4JK1 X;  4YRV A;  1YJ9 I;  2A6E F;  4P1W A;  1YOV B;  2TCT A;  5IPA A;  2HR3 A;  3TO6 A;  4IPA A;  1G3T A;  1BN5 A;  1MJA A;  1MMG A;  3GTL J;  1VND A;  2HVS A;  1KQ0 A;  1X2M A;  3T8T A;  4CYC B;  3S3N A;  3S1Q J;  1VQM I;  1VF9 A;  3V7R A;  2Y0S A;  1O7L A;  3QAH A;  1R7J A;  1W36 C;  4HNT A;  2MSY A;  2IS2 A;  2F48 A;  4ZYE A;  5FB2 A;  1Y56 A;  1WH7 A;  3IP4 B;  4G94 A;  3HOV J;  4I99 C;  4JP0 A;  5F0H A;  1ZHF A;  3ELK A;  5IOZ A;  2MC4 A;  3I56 I;  1SMT A;  4BBR J;  3KET A;  4N4O B;  3CQZ J;  3L2Q A;  1QZY A;  2KIU A;  2K4J A;  2E5N A;  1KYW A;  4OMY A;  3DU6 A;  1R5G A;  3EET A;  2E34 A;  3DTK A;  2M1B A;  1IN5 A;  3HOS A;  4OU0 A;  2AO9 A;  3DKW A;  3BTJ A;  3DQV C;  2KZG A;  2XKO A;  1I3A A;  1H8A C;  3JRF A;  4WF2 A;  1H9G A;  2ZFU A;  4BUP A;  5E1X A;  1D3Y A;  3CCQ I;  4MO7 A;  1YS7 A;  4CCK A;  1GV2 A;  3J81 Z;  3H36 A;  4O3M A;  2RVC A;  1LFB A;  4IQJ A;  2Y69 H;  1MBE A;  4FE7 A;  4HF0 A;  2R4G A;  2GZW A;  1R4N B;  1GV5 A;  1S5L C;  2XUB A;  1J5Y A;  2M5W A;  1KGS A;  2EIK H;  3J7Z I;  2KDZ A;  2E2I J;  2DFH A;  4KFC A;  2V7F A;  2CW8 A;  2VLA A;  4ZDL A;  4ZYA A;  2B63 J;  2KT0 A;  4FE4 A;  5DS9 A;  2CW7 A;  4IZZ A;  1J75 A;  5F0C A;  3PFY A;  4F55 A;  3P9K A;  2ZXW H;  5L3G A;  2AHQ A;  3BTC A;  4PFO A;  1K79 A;  1BBY A;  3L1P A;  4QIW N;  1J2X A;  1S72 I;  1PYV A;  3K2Z A;  5LGU A;  3V7C A;  4NBQ A;  3MZH A;  2L7M P;  2NVT J;  3H3Z A;  1RPW A;  3LWF A;  4GRI A;  5E3L A;  3O3K A;  4P9U A;  1W4M A;  2Y9Z A;  1ZG1 A;  4IF4 A;  5JLX A;  1TC3 C;  3AL0 B;  4BHC A;  3QP6 A;  4BE0 A;  2EIN H;  2HKO A;  2CFX A;  4HX7 A;  3ECH A;  3IV5 A;  1BI1 A;  2E1C A;  2ZXI A;  3HPG A;  2ECB A;  3O2P E;  1E0E A;  2OC6 A;  3FWE A;  1DPR A;  2MBF A;  5D5V B;  3KP5 A;  3VOE A;  2AXL A;  4BEH A;  1SVM A;  2IGO A;  2HZT A;  1Y0N A;  4LK1 F;  1CGP A;  4FAS D;  2VT2 A;  2VT3 A;  5LHG A;  2UUZ A;  2GOX B;  3BR2 A;  4Q48 A;  1T98 A;  2LKS A;  3BY6 A;  5J47 A;  1YX3 A;  3KZI C;  1MBJ A;  1OFC X;  1B59 A;  4M9X A;  2QSF X;  1IV8 A;  2W00 A;  1UB9 A;  4XQF A;  2PBI A;  3BG9 A;  1NTC A;  2HFH A;  2M87 A;  1IW7 F;  3LQR A;  4G8X A;  1I3Q J;  2LF8 A;  5EEG A;  4AIJ A;  4E7J A;  4CDG A;  3ONQ A;  2G7U A;  3E0J B;  3QP5 A;  3KZZ A;  4HAM A;  1ZTR A;  3C3W A;  3Q5F A;  1T56 A;  2DQR A;  4BY1 J;  4QPQ A;  2F5E A;  2VL8 A;  4HRI A;  2E1M B;  1O7F A;  1MSF C;  2GWR A;  3PO3 J;  1T6S A;  2F5D A;  2M8G X;  2HYF A;  4Q4Z F;  3I4M J;  2P5L C;  5HS7 A;  5HOO A;  1WJE A;  2QM3 A;  2WAQ N;  4CO8 A;  1IXC A;  2KIM A;  5BOX A;  5LRS A;  2R5Z A;  2XPV A;  3BPV A;  3FZV A;  3GTP J;  3OS0 A;  2WA0 A;  2XSJ C;  4JBA A;  1T0F C;  1D5Y A;  4O5V A;  2IA0 A;  1DPU A;  2JJ7 A;  4D5C A;  2V9K A;  4Y33 A;  2DI3 A;  2G0E A;  4FHT A;  3HOX J;  4A93 J;  1X3Z B;  3LAP A;  2ZBK A;  4Y13 A;  1ZRF A;  2FE3 A;  3KEO A;  1XDS A;  5FO5 A;  3OSF A;  1BR1 A;  2Z9O A;  2PFB A;  1ZR4 A;  4IHV A;  3OYE A;  2VKE A;  2NXN B;  1LEA A;  3SDG A;  4PK4 A;  4ON0 A;  2KRH A;  3CDH A;  4RM3 A;  3SXY A;  1FBU A;  2TRT A;  2XHK A;  3D1N I;  1Z0X A;  5HNH A;  4HLX A;  3OYJ A;  1JKO C;  3SZP A;  1TZL A;  3R60 A;  1W0T A;  3CDL A;  2WB1 N;  4DYR A;  1ZRD A;  2IP2 A;  2PMH A;  4IRH A;  2M0M A;  1BR4 A;  4HX8 A;  1D0Z A;  1J9I A;  4ESF A;  3BDD A;  3TO9 A;  4FTH A;  4RM2 A;  2LSO A;  3J7Y J;  2ZXJ A;  1JKQ C;  4WCG A;  1SD4 A;  1ZR2 A;  4RLQ A;  2VC1 A;  4FX4 A;  3BR3 A;  4RDU A;  4XKV A;  4GXO A;  2HTJ A;  5B3S H;  1BI2 A;  2EFN A;  1C0W A;  2IAI A;  3HOY J;  3R0J A;  2M8E A;  2KMU A;  3OYB A;  1GLN A;  1ETW A;  1Z77 A;  4EMS A;  3REO A;  4HZF A;  3FK7 A;  4LFU A;  2UXN A;  3W6K B;  2CSO A;  2L9S A;  2I8D A;  2R7Z J;  2XV4 S;  1Z91 A;  3GYH X;  1R1U A;  2VC0 A;  4RGS A;  2QSG X;  2R93 J;  4CHU A;  3I5U A;  3TW7 A;  3KP6 A;  1OCT C;  4JQF A;  1SFX A;  4MTE A;  2MFZ A;  1FTZ A;  3IH2 A;  4CZC A;  3RZD J;  4PJ0 C;  4DZP A;  1FLI A;  3M3Y J;  3NEU A;  3ZGK A;  5GTI C;  4WXC A;  1R00 A;  5FLX K;  3Q0V A;  3MKY B;  1T33 A;  4BHP A;  3FXQ A;  2B0L A;  3VSK A;  2R7T A;  4ABZ A;  3J81 K;  2ZJQ F;  1QNT A;  1U6G A;  4NHJ A;  3QYB A;  2LBF A;  1UMQ A;  1KU2 A;  3DWL E;  5KVR A;  2ZO4 A;  2YR2 A;  2PG4 A;  3L09 A;  3K4B A;  3GTQ J;  2DOD A;  1VQL I;  2VKD A;  5HLG A;  1WJ5 A;  3A01 A;  2XAQ A;  3SEZ A;  2X0L A;  2ZFW A;  3CCU I;  4UUS B;  5M5W J;  1RIO H;  3K2A A;  2ZJ2 A;  2KRC A;  1FIA A;  2VQC A;  3WE3 A;  3WGI A;  1D8K A;  1P4W A;  2GA1 A;  2H94 A;  2GXB A;  1FSE A;  2LF7 A;  1A36 A;  1MNM C;  2KRF A;  3PM1 A;  4XSX F;  2HQA A;  2EFQ A;  2DTZ A;  1BR2 A;  1OR7 C;  2IA1 A;  2JA5 J;  3TDU C;  2HWV A;  4RB0 A;  3MQ0 A;  1MH4 A;  4FIS A;  1A31 A;  2BY1 A;  5E1W A;  5JFR A;  2MH2 A;  4A2U A;  1HKT A;  2J5O A;  2VQL A;  2MLG A;  4BH9 A;  4BS9 A;  2IS6 A;  2KP6 A;  3BR0 A;  2DFE A;  3H3V K;  4PUS A;  2WC2 A;  5F64 A;  1GVJ A;  2JMW A;  2GLO A;  3SZT A;  2JSC A;  4KIF A;  1WPK A;  2E7W A;  4Y3O A;  3LNQ A;  1U5T B;  2STW A;  3M07 A;  2BYV E;  4MLO A;  4XIC A;  2NRA C;  2EJR A;  5FKM A;  4DOZ A;  5DUK A;  3E6C C; 
#chains in the Genus database with same CATH homology
 1MH3 A;  2ECC A;  4AC0 A;  1K61 A;  2COB A;  5FKK A;  4XRS G;  5F08 A;  2E2J J;  3A02 A;  2JK3 A;  2HDD A;  4A3B J;  1I50 J;  1JUP A;  1Y1V J;  2XSD C;  2IEK A;  2Y31 A;  1HOM A;  2ID6 A;  2L9R A;  3TP3 A;  1A6I A;  4A3D J;  5M3F J;  4JX4 A;  2ELK A;  2HI3 A;  2XGD A;  1JKP C;  4JX5 A;  3WHB A;  5GP9 A;  4C3H J;  2P81 A;  3G1O A;  4B4C A;  1IJW C;  3QPL A;  3PO2 J;  4MFD A;  4JX6 A;  5IP9 J;  2NOG A;  2DJN A;  4I76 A;  5EF6 A;  2QCO A;  1JTY A;  4DYC A;  5E3O A;  2EBI A;  1H88 C;  3BG3 A;  3BQZ A;  4X6A J;  1HF0 A;  3DCF A;  1ITY A;  3RQI A;  4Y7N J;  3FK6 A;  5EZH A;  2EZI A;  3W6V A;  4XK4 A;  1I6H J;  1K83 J;  2K9N A;  3HM5 A;  3QPS A;  2L7F P;  3BTL A;  1DU0 A;  1F36 A;  2W48 A;  1ETV A;  2XPU A;  2DA5 A;  4IHX A;  4L5E A;  5F1J A;  5EZG A;  3O8H A;  5IOY A;  2EH3 A;  1IGN A;  5DTD A;  2YU9 J;  2L0K A;  5JLW A;  3CCY A;  2EZH A;  5FLV A;  2PMZ N;  3ZQI A;  1MBH A;  1RET A;  2CQQ A;  3Q0U A;  2R0Q C;  3S1R J;  5EYR A;  2LY9 A;  3TP0 A;  5HOD A;  4AUX A;  4BXX J;  2XB5 A;  1POG A;  3IH4 A;  1JGG A;  5BNG A;  1BW6 A;  1ENH A;  3ZQG A;  3H0G J;  1B8I B;  3IH3 A;  4M3D A;  1AKH A;  1A5J A;  1ETK A;  1TWA J;  3F0C A;  2VUM J;  3E7L A;  2GM4 A;  2DA7 A;  1B8I A;  3JRE A;  1U78 A;  1FEX A;  1LFU P;  2HOA A;  4A3C J;  2DA2 A;  1TWC J;  3GTG J;  1HCR A;  3LSR A;  2DMP A;  2HXI A;  3I4N J;  5IYB J;  3ZQL A;  1TWH J;  1BJZ A;  3FKI J;  2WV1 A;  4QSH A;  1PUF A;  1BW5 A;  3S16 J;  2LR8 A;  1QVT A;  5J1R A;  3JRB A;  1HLV A;  3G1L A;  2LD5 A;  2TCT A;  5IPA A;  1B72 A;  2DMQ A;  2X9D A;  1ZGW A;  2H8R A;  3GTL J;  1R9T J;  1VND A;  4IHW A;  2M0C A;  2O9L A;  1GVD A;  3BG5 A;  4CYC A;  1X2M A;  1Q1V A;  3JR9 A;  4CYC B;  4XID A;  3S1Q J;  3JRD A;  1VF9 A;  1GUU A;  3OSG A;  4JYK A;  2O8K A;  2MSY A;  2EZK A;  1JUS A;  1WH7 A;  2Y30 A;  2CU7 A;  4D7N A;  2XGE A;  3GBG A;  1EF4 A;  2M34 A;  3B6A A;  2D5V A;  3S17 J;  3HOV J;  4JP0 A;  5F0H A;  3JRH A;  3ZQH A;  4QTR A;  3S1N J;  5IOZ A;  3G1M A;  4BBR J;  1OCP A;  3CQZ J;  1MBF A;  5IP7 J;  1XS9 A;  1O4X A;  4C3J J;  1ZQ3 P;  1AKH B;  1MBG A;  2K9S A;  2EZL A;  4M3G A;  1P7J A;  3A01 B;  5EG0 B;  3FIW A;  1FTT A;  3TW6 A;  2AO9 A;  1JKR C;  2Y2Z A;  1QRY A;  3BTJ A;  4X1E A;  1SFO J;  4XRM A;  5FLM J;  1H8A C;  3JRF A;  3HKZ N;  1S7E A;  1FIP A;  1IV6 A;  2JA6 J;  4MO7 A;  1GV2 A;  3BR5 A;  1ETO A;  1LFB A;  4MIM A;  1MBE A;  1ETY A;  1ETX A;  4FE7 A;  2NS8 A;  4S0H B;  4FCY A;  1GV5 A;  1H89 C;  3WHC A;  2E2I J;  4IEJ A;  1U8B A;  2CJJ A;  2KDZ A;  3FIS A;  2K9Q A;  2CUE A;  3DEW A;  2EQR A;  3MKL A;  2B63 J;  5M5X J;  4A69 C;  3LSG A;  5IYC J;  2KT0 A;  2VKV A;  4FE4 A;  5DS9 A;  4A3M J;  5F0C A;  1XG1 A;  1VI0 A;  3S2D J;  3S1M J;  2DMN A;  2JWT A;  3JRI A;  2AHQ A;  3BTC A;  3L1P A;  4QIW N;  5M3M J;  1JT0 A;  3HGY A;  4EEF G;  1NK3 P;  2FQ4 A;  2LK2 A;  1WI3 A;  2L7M P;  2E2H J;  4C3I J;  2NVT J;  1RPW A;  1YRN B;  5E3L A;  1UHS A;  5M5Y J;  5GPC A;  2Y9Z A;  5JLX A;  1TC3 C;  5E3M A;  5EGO B;  4A3J J;  2HOT A;  2CQX A;  2L7Z A;  1ORK A;  2E1O A;  2VPR A;  1TWF J;  4V2F A;  3IV5 A;  3BR1 A;  2YS9 A;  1PUF B;  2ECB A;  3LOC A;  4B3A A;  2OPT A;  3JRA A;  5FKL A;  5J1Y A;  1X2N A;  5C4J J;  3LSJ A;  3SJM A;  1ETQ A;  5K7Z A;  4Y52 J;  2XGC A;  3BR6 A;  2DA3 A;  5J1U A;  1AHD P;  3BR2 A;  5E3N A;  4D5F A;  5C3E J;  1MBJ A;  1OFC X;  1JUM A;  2ME6 A;  4UUS A;  3ZQF A;  5F27 A;  2MGQ A;  4LOC A;  1IDZ A;  3BG9 A;  1NTC A;  2DA6 A;  1AU7 A;  1I3Q J;  2R5Y B;  1OJL A;  2M9H A;  3LSP A;  4I6Z A;  1HDD C;  3HDD A;  2DMU A;  2DMT A;  2XB0 X;  1ZTR A;  2JA7 J;  1U9N A;  2MG4 A;  1T56 A;  4BY1 J;  3HBL A;  2M2E A;  2FJ1 A;  5FKO A;  1RKW A;  2GBY A;  3OIO A;  4A3I J;  1DU6 A;  1MSF C;  4DYQ A;  3PO3 J;  5EDN A;  2M8G X;  2IBD A;  2ZB9 A;  4BY7 J;  2N8G A;  3I4M J;  2WAQ N;  2R5Z A;  2XPV A;  1BL0 A;  1G2H A;  2R5Z B;  3GTP J;  4HNV A;  1NK2 P;  4A3G J;  5FJ8 J;  1MSE C;  1QPI A;  1D5Y A;  2LKX A;  1WCM J;  2NVQ J;  2JJ7 A;  4D5C A;  5K7H A;  1LE8 A;  3HOX J;  2G0E A;  4A93 J;  3S14 J;  2LLK A;  2DA1 A;  4A3F J;  3A03 A;  3C2B A;  3OSF A;  1JJ8 C;  3NAR A;  4BKX A;  2O7O A;  1GDT A;  4IHV A;  1ZR4 A;  3MN2 A;  3S15 J;  4AYB N;  2VKE A;  3TED A;  3SDG A;  3UKG A;  4BBS J;  3GTO J;  3Q3S A;  3HOW J;  4DZJ A;  3MVP A;  2TRT A;  4W1U A;  1CQT A;  4G12 A;  1ZK8 A;  2Y9Y A;  3D1N I;  2FD5 A;  1Z0X A;  1P7I A;  5EGO A;  1JKO C;  2H1K A;  1W0T A;  3CDL A;  2WB1 N;  4DYR A;  2I10 A;  2R92 J;  1YRN A;  4J19 A;  4RBO A;  1F43 A;  2ID3 A;  3HGG A;  4A3E J;  1JT6 A;  4FTH A;  1JJ6 C;  1RES A;  3HEF A;  4NDL A;  1APL C;  1IDY A;  2YUS A;  3SFI A;  1JKQ C;  5K7F A;  2LTP A;  3VPR A;  1ZR2 A;  1IUF A;  1LE8 B;  1FJL A;  3GTJ J;  2DN0 A;  5F0F A;  3BR3 A;  4RDU A;  3NAU A;  2E19 A;  4B1R A;  1VFC A;  1GT0 C;  2HXO A;  2IAI A;  2HOS A;  3HOY J;  2JA8 J;  2QF7 A;  3S2H J;  1ETW A;  5IYD J;  1Z77 A;  3FK7 A;  1E3O C;  5F04 A;  1Y1W J;  3BQY A;  4UUT A;  5GPA A;  3M4O J;  2R7Z J;  3QQA A;  2VI6 A;  3HOU J;  2R93 J;  1U9O A;  3TW7 A;  1OCT C;  1FTZ A;  2LFB A;  2LP0 A;  2FX0 A;  3IH2 A;  3RZD J;  4W97 A;  3JRC A;  4DZP A;  3M3Y J;  2NS7 A;  3HB9 A;  3Q0V A;  2DA4 A;  1T33 A;  4MFE A;  9ANT A;  1RR7 A;  4ABZ A;  2HQ5 A;  2OF7 A;  2LVS A;  5C4X J;  2MW8 A;  2X48 A;  1IC8 A;  1UMQ A;  4IHY A;  5J3L A;  1WH5 A;  2NVY J;  3O8G A;  4M6V A;  2CRG A;  2NVX J;  3RZO J;  1MBK A;  5C44 J;  1IG7 A;  3GTQ J;  4XRS A;  1BA5 A;  4GFB A;  3A01 A;  1TWG J;  4UUS B;  5M5W J;  3K2A A;  1UG2 A;  4M3E A;  3B6C A;  1FIA A;  4V2G A;  1XC5 A;  1HDP A;  2JN6 A;  2X6O A;  1RKT A;  1JTX A;  3BT9 A;  5EEA A;  3JRG A;  4A3K J;  4D7M A;  1MNM C;  2Y0S N;  1QVU A;  3PM1 A;  4A3L J;  4M3B A;  1B72 B;  2ME0 A;  2DTZ A;  3Q0W A;  2XPW A;  2JA5 J;  2XRL A;  2RAE A;  3RKQ A;  1MH4 A;  4FIS A;  2R5Y A;  1SAN A;  4DW6 A;  1ZKG A;  3GTM J;  3HOZ J;  3BR0 A;  3H3V K;  1W0U A;  3ZOB A;  1IRZ A;  3BTI A;  2HYJ A;  5IP6 A;  3GTK J;  5EG0 A;  5FKN A;  2GLO A;  4C2M J;  2JMW A;  1X58 A;  1WPK A;  3LNQ A;  2K40 A;  4MLO A;  4XIC A;  3ZQC A;  5FKM A;  2CUF A;  4M3F A;  1WGX A;  3K7A J;  3CMY A;  3OOU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...