4XRMA

Homodimer of tale type homeobox transcription factor meis1 complexes with specific dna
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
59
structure length
59
Chain Sequence
IFPKVATNIMRAWLFQHLTHPYPSEEQKKQLAQDTGLTILQVNNWFINARRRIVQPMID
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(P*AP*GP*CP*TP*GP*AP*CP*AP*GP*CP*TP*GP*TP*CP*AP*AP*
publication title DNA-dependent formation of transcription factor pairs alters their binding specificity.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 21
structure length 59
sequence length 59
chains with identical sequence B
ec nomenclature
pdb deposition date 2015-01-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05920 Homeobox_KN Homeobox KN domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4xrmA00
4MFDA 3O8HA 3DCFA 1DU0A 4C3HJ 4M6VA 2YS9A 3WHBA 1QPIA 2JA5J 4DYRA 1ETQA 1JUMA 3A03A 9ANTA 3BG9A 4MIMA 2MSYA 1BW6A 3HOZJ 2JA8J 2LY9A 3JRBA 1RKWA 1WH7A 3ZQIA 1JT0A 3JRFA 5F27A 3HGGA 2XPWA 2H1KA 1SANA 4ABZA 1B72B 1BA5A 3H3VK 4JX5A 1ETXA 2JA6J 2HOAA 1JUPA 1JKRC 2NS8A 1Q1VA 3TP0A 1AKHA 4HNVA 4C3IJ 4I6ZA 3JREA 1ZKGA 5IYBJ 1IJWC 2HXIA 4JX6A 1R9TJ 1FIAA 1JJ6C 2TCTA 4UUTA 3ZQHA 2ECCA 2Y9YA 2QCOA 1VNDA 3K2AA 3GTQJ 1MBJA 1TWCJ 2IBDA 4D5FA 2K9QA 2LP0A 1MNMC 4UUSB 1GDTA 1ENHA 2KT0A 4X1EA 1RKTA 5IOYA 5IP7J 3GTGJ 2IAIA 2N8GA 2ID6A 3BQYA 2LD5A 2LTPA 1OCPA 5M5WJ 4A69C 1LFBA 4LOCA 1JTXA 1TC3C 2VKEA 3SFIA 5BNGA 3HOXJ 4A3MJ 1JUSA 1X2MA 1DU6A 2M8GX 1T33A 4M3DA 2AO9A 2YUSA 2B63J 4A3GJ 1IC8A 3F0CA 1GVDA 1U78A 3RKQA 3BR6A 2DA3A 2NS7A 2DTZA 2GM4A 1D5YA 2FD5A 5J1UA 2DA6A 5M3MJ 5C4XJ 3QQAA 1A5JA 3S2DJ 1I50J 1HOMA 4BY1J 4MLOA 3S2HJ 1JT6A 4XICA 3W6VA 5FJ8J 1JTYA 5GPCA 1BL0A 4Y52J 2JMWA 4JYKA 2M34A 4M3GA 4XIDA 1TWGJ 5GP9A 3BTIA 2K40A 2DMTA 1IUFA 2Y0SN 3SJMA 1WCMJ 3C2BA 2G0EA 2E2HJ 1ETOA 5IYDJ 2LR8A 4CYCB 1ETKA 2ID3A 5HODA 5IP9J 1ETVA 1WGXA 2LVSA 2NVYJ 1B8IA 1FTTA 4M3FA 5EG0A 5F0HA 1YRNB 3OSFA 2Y31A 2CUEA 1AU7A 2DJNA 3JRGA 3HB9A 4AUXA 2QF7A 5JLXA 1FIPA 4M3EA 1X58A 1XC5A 3CDLA 2E2JJ 2JA7J 1Z0XA 1HLVA 2EZLA 1PUFA 3LSGA 1Y1VJ 2OPTA 3MVPA 3HM5A 1ZGWA 3S1QJ 2EZIA 1U8BA 1LFUP 1OCTC 3S1RJ 3TEDA 4B4CA 2K9SA 3VPRA 3S1MJ 2L7ZA 3G1LA 3IH2A 1Y1WJ 2P81A 1QRYA 2R0QC 1QVTA 5EDNA 3HGYA 4QTRA 4QIWN 2HXOA 3S17J 5K7ZA 5E3MA 1G2HA 3BR2A 2CJJA 3O8GA 5K7FA 1UHSA 1JKQC 5DS9A 3HOVJ 1NK3P 3LNQA 2XPVA 3GTLJ 3BTJA 3BG3A 4BKXA 2YU9J 3LSJA 2JN6A 2VUMJ 2VKVA 2NVTJ 3RZOJ 2DMNA 1E3OC 1ETWA 3I4NJ 4A3BJ 3JRCA 1O4XA 2FX0A 2CQQA 4FISA 1MSFC 1LE8A 2Y2ZA 3QPSA 5EYRA 4GFBA 3GTMJ 1ITYA 1NK2P 2D5VA 3NARA 3B6AA 3I4MJ 4D7NA 2R5ZA 2O8KA 1H88C 4RDUA 2Y9ZA 2TRTA 2GLOA 3HOWJ 3TW6A 5IOZA 3A01A 3BG5A 3ZQFA 1WI3A 4BY7J 5EG0B 2LFBA 2DN0A 4D7MA 3Q0UA 4I76A 2X6OA 1F43A 4A3DJ 1GV2A 4JX4A 2VPRA 4MO7A 4A3KJ 5E3LA 3TP3A 1HDDC 5E3OA 1FEXA 2EQRA 1K83J 3PO3J 4QSHA 1JJ8C 1QVUA 4S0HB 1UMQA 2HYJA 2LK2A 1BW5A 2X9DA 4W1UA 3BR3A 4V2GA 1JKPC 4BBSJ 1W0TA 3JRAA 2DMUA 4IHXA 3GTOJ 1MH4A 1GV5A 1S7EA 3GTJJ 1HF0A 2E1OA 3BR0A 2Y30A 3FKIJ 1TWFJ 2R5YA 4A3LJ 2R92J 2DMQA 4DYCA 1FTZA 1MBFA 1UG2A 3HKZN 2HQ5A 3FK6A 2RAEA 4M3BA 3LSPA 3QPLA 3LOCA 1JGGA 3H0GJ 4A3CJ 1VI0A 3S14J 2XB0X 3JRHA 3GTKJ 2VI6A 2ME6A 1W0UA 1RETA 3A02A 3K7AJ 3SDGA 1POGA 3Q0WA 4AC0A 3S16J 4A93J 2M2EA 1AKHB 2XGEA 2X48A 1LE8B 4DW6A 2ZB9A 1ZR4A 3HOUJ 2XGDA 3MKLA 1IV6A 5EGOA 1JKOC 2MG4A 3RZDJ 5J1RA 2COBA 2CRGA 3D1NI 1ORKA 2R5ZB 4BBRJ 3HOYJ 4FE4A 3HBLA 2M0CA 3A01B 1MBHA 5IP6A 2JK3A 3PO2J 3WHCA 5F1JA 1GUUA 4UUSA 2L7MP 2PMZN 3FISA 4Y7NJ 2CQXA 3G1MA 1P7JA 3NAUA 5FKLA 1NTCA 3BT9A 1K61A 1MH3A 2AHQA 2XGCA 1I3QJ 2R93J 1ZQ3P 3ZOBA 1F36A 5F08A 2NVQJ 2E2IJ 2E19A 4XRSG 2HDDA 5DTDA 1SFOJ 3IH3A 1H8AC 4XK4A 1U9NA 2H8RA 3FIWA 2R5YB 1OFCX 2KDZA 2JJ7A 2NOGA 1IG7A 1MBKA 2NVXJ 2ELKA 5M5XJ 3TW7A 2IEKA 3OSGA 1HCRA 1TWAJ 1ZTRA 4J19A 2DA2A 3CMYA 1CQTA 4JP0A 1IDZA 5F0FA 1H89C 4DYQA 3GBGA 2EZKA 4IHYA 1GT0C 4AYBN 3S1NJ 4CYCA 5FKNA 4W97A 1ETYA 2K9NA 3BR5A 3S15J 2DA4A 5E3NA 1B8IB 2CUFA 2M9HA 3IH4A 1IGNA 5J1YA 2CU7A 1YRNA 3HEFA 4G12A 2L0KA 3LSRA 4FTHA 2W48A 2FJ1A 4XRSA 2ECBA 2EZHA 5F04A 2R7ZJ 1ZK8A 5EGOB 1RESA 4B1RA 5K7HA 3ZQCA 2O7OA 2HI3A 3DEWA 5EEAA 2XSDC 1ZR2A 1PUFB 3MN2A 4IEJA 3IV5A 1Z77A 4C2MJ 5C44J 5IPAA 1XS9A 3ZQLA 2DA7A 2L9RA 2MGQA 2ME0A 5FLVA 1BJZA 1HDPA 5EZGA 4A3JJ 3CCYA 1U9OA 5FKKA 3BTLA 4DZPA 1P7IA 3OIOA 3JRDA 4RBOA 3E7LA 3BTCA 2JWTA 5C3EJ 3CQZJ 2HOSA 1MBEA 4C3JJ 1APLC 1VFCA 1FJLA 1IDYA 2WV1A 3PM1A 3BR1A 5M3FJ 5F0CA 1B72A 4A3IJ 4L5EA 1WPKA 4V2FA 3HDDA 1TWHJ 2XPUA 3M4OJ 2LKXA 3JR9A 3M3YJ 4A3EJ 4B3AA 1X2NA 4D5CA 2GBYA 5GPAA 2XRLA 5JLWA 5C4JJ 3JRIA 3UKGA 2EBIA 4FE7A 2HOTA 5M5YJ 1OJLA 2O9LA 1I6HJ 1XG1A 2DA1A 1T56A 1WH5A 5FKOA 2OF7A 4EEFG 3G1OA 4FCYA 2XB5A 2WAQN 3OOUA 3GTPJ 5EZHA 4IHVA 1EF4A 1MBGA 2WB1N 3Q3SA 2L7FP 1AHDP 1A6IA 5FKMA 4X6AJ 3FK7A 1IRZA 5FLMJ 4MFEA 3ZQGA 1RPWA 2LLKA 2DMPA 3Q0VA 5J3LA 3L1PA 2FQ4A 4A3FJ 5IYCJ 2DA5A 3BQZA 1VF9A 4DZJA 2EH3A 4IHWA 2MW8A 4NDLA 3B6CA 5EF6A 2I10A 1RR7A 4XRMA 1MSEC 3RQIA 4BXXJ
chains in the Genus database with same CATH superfamily
4MFDA 3O8HA 3A0BC 1S7OA 2QWWA 3E1SA 3R61A 4KICA 1DU0A 2CW7A 1QQIA 1P4XA 3A2KA 4XKCA 2R7WA 2VBZA 1R1VA 1JUMA 3BG9A 3MZ8A 2OCCH 2F4MB 2LY9A 5FROA 1IN6A 2Q1ZB 4HOBA 2E1CA 4X0GA 2W25A 3DU6A 3M8JA 3ZN1A 3HUGB 3BPXA 3L2QA 1FZPB 2WC2A 4J00A 2H1KA 4ABZA 2HVSA 2PMUA 4MHGA 2KLOA 3OYEA 4CCMA 1XSVA 4JX5A 2JA6J 4ASNA 3PQJA 4BQQA 2KQRA 4HF1A 3TP0A 3GFIA 1KQ0A 2XKOA 4ETSA 1IV8A 4BJ5C 5IYBJ 2O5RA 3CJNA 1FIAA 1NG7A 2HKXA 3V7RA 3JCUC 4GYGA 2HKOA 2QCOA 1O57A 1G3TA 3PQKA 4M9ZA 5DYMA 3VSLA 2RDPA 2VN2A 3E6BA 3EYIA 3K2AA 3KFWX 3MEXA 5BS6A 2FNPA 4RB2C 4LK0F 2F5VA 4YELA 2IS1A 1T0FC 1ENHA 4MQVA 4O3MA 2KT0A 4NQWB 4X1EA 2HTSA 3BROA 5IP7J 2QVOA 2ESHA 2IAIA 2N8GA 2EK5A 4N4OB 5FD5A 1PDNC 5M5WJ 4CCLA 5CVVA 5E1ZB 4Q5SF 3E97A 1I6XA 5BNGA 5LLQA 1G3SA 3ML6A 2RKHA 1T08B 3CUQB 4UXNA 3VB2A 3BLYA 2YUSA 3R0AA 1XSDA 1NHAA 2B63J 4A3GJ 4NC7A 1GVDA 2OU2A 2NS7A 1A35A 2GM4A 2FD5A 5J1UA 3DPUA 2KMUA 5AIPA 3L2VA 5C4XJ 1P92A 3ZXSA 3S2DJ 2FBIA 3ERMA 1Y0UA 3ABMH 2GXGA 3MD2A 2M34A 4RGUA 4M3GA 3KYCB 1EH6A 5JVGF 5GP9A 3BTIA 2ACJA 5LFAA 1IUFA 3SJMA 3IAM2 2QM3A 2X6YA 3K0LA 2V1NA 2V7FA 2PN6A 4FX4A 2KRHA 2VT3A 2VKDA 3QYBA 2OCEA 2KP6A 3CCVI 1B8IA 3ABTA 2D2WA 2Z16A 1FTTA 1J59A 5EG0A 3GZ6A 3K4KA 1Z6TA 3OSFA 3RPQA 2P7CB 3CJQB 1BN5A 3CF2A 3HXLA 4I7HA 5AONA 1AU7A 2DJNA 1ZRFA 2BBYA 3JRGA 3TQNA 2V6EA 1UJ8A 2LC2A 2CSOA 1FIPA 1OPCA 3QODA 4ZH4F 2DTRA 1X58A 1BI0A 2P6TA 1Z9CA 4DBQA 4P55A 2DOAA 1HSJA 3BP8A 1S29A 3HPGA 3ZMVA 2E2JJ 2JA7J 3H3ZA 1FOKA 1PUFA 2P6SA 3LSGA 2OPTA 1J5YA 2BXZA 2A3SA 1X1AA 2EFPA 4OU0A 1IW7F 4Q4ZF 1OCCH 2OD5A 3HKZA 3S1RJ 1LFUP 4NBQA 2QZ8A 4Q47A 3AAFA 3KP2A 3FMSA 1GLNA 1P2FA 3E6DA 1Y39A 2K9SA 3S1MJ 1G59A 1K7AA 2HQAA 3P9IA 3S3OA 4AIHA 4LK1F 4HSRA 2HEOA 2HVRA 1C0WA 1R5GA 2K86A 3D5LA 1JXSA 2QYOA 3I59B 3EQLF 1LQ1A 1G2HA 3DLAA 4KJZA 3BR2A 5FLXZ 2PQ8A 3KP7A 2DBBA 4XLCA 2PJPA 1NK3P 2IXSA 1FT9A 3QAHA 2XPVA 4BEHB 4BHCA 3CF5F 4DGWB 4HDUA 1BC8C 4WXDA 2JN6A 4CCKA 4CZZA 2NVTJ 1A31A 2DMNA 1JGSA 1RC9A 2JUGA 2R7RA 2B7EA 1BR2A 2YR2A 3S93A 1U8RA 2V4JC 3OYIA 3F22A 4A3BJ 3JRCA 3ELKA 2WTEA 3FZVA 2CQQA 1LE8A 2M0MA 3LAPA 2JRMA 3GTMJ 1ITYA 4G7OF 2M3AA 4UB8C 4XLFA 1I1GA 4WWCA 1BR4A 2L4AA 4U7BA 4G6QA 2MH2A 1VQ4I 2PEXA 2BY2A 4EJOA 2XSJC 3BOQA 2ZJ2A 4RB1A 5LGNA 1XDSA 2Y9ZA 3QRFF 2Z99A 3HOWJ 4P96A 3TW6A 5IOZA 4I01A 5D8LB 2OZUA 3DBHB 5D6EA 5DDGA 4BY7J 2LFBA 4XKWA 1V4RA 2BE5F 4D7MA 3Q0UA 5CKTA 4I76A 4Z2YA 4CICA 4E7SA 2NAZA 4A5NA 3GFJA 1KU7A 3MZHA 3LQRA 4A3KJ 3SZGA 3FM3A 5DUKA 3W6KB 4ZZLA 2EQRA 2PLYA 2IP2A 3PO3J 1YW9A 3GX4X 3FBIB 3A1YA 4UB6C 4QLCU 4W1UA 1FBUA 3BR3A 4V2GA 4FX0A 5BPDA 3RKWA 2A6EF 4IHXA 4N9HA 3GTOJ 3CCSI 1FC3A 2WA0A 2R4GA 3GTJJ 5CLSA 1HF0A 1AOYA 1ZELA 3F9KA 2Y30A 4PZJA 4F7ZA 4EGZA 1B4AA 3CJRB 2DODA 1FTZA 2BY3A 1KU3A 2IT0A 1SD4A 4M3BA 3QPLA 1YYVA 2HYGD 1SVOA 4IRIA 4XKVA 1JGGA 2K5CA 4P5OA 2LREA 2Y48A 4PJNA 1EV7A 2FOKA 5F6FA 2ME6A 3M1EA 1UFMA 3J81K 1DP3A 2X85A 3Q0WA 1YQAA 2UUZA 2XAGA 3RQ4A 2IPQX 2ZNZA 2DDBA 2VJIA 2W84A 2ZC2A 3EDPA 2X48A 4DW6A 1MIJA 1S5LC 2XGDA 1IV6A 1GXQA 3H5AA 3OMYA 1YJNI 3RDIA 2CRGA 3D1NI 1W7PA 1ZREA 1I39A 1XMAA 3GWZA 3N05A 5IP6A 4GCVA 3WHCA 3KLOA 2EB7A 3VODA 4CUGA 1GVJA 2HU9A 1FBQA 3BCAA 2K02A 2L7MP 2Q0OA 5L3DA 3ZRGA 1XMKA 3BDDA 1XX5A 2W4SA 3H0DA 1CGPA 4B44A 3G1MA 1P7JA 3ONQA 3C7JA 1NTCA 4PDKA 3OV8A 5KK1A 3P9KA 2GQQA 4WK8F 1CF7B 1D8JA 4BJ6C 3CMAI 3WTVC 2EILH 3TDUC 2DW4A 3DEUA 3HSFA 2E19A 3WGGA 4XRSG 1A36A 2E5ZA 2W1OA 2XDVA 3AG3H 1SFOJ 3IH3A 1H8AC 4EM2A 1XD7A 1QZEA 2CQKA 4DOZA 4G7HF 2QKLB 2R5YB 2I5UA 2VC0A 1W4MA 2QQAA 1V3FA 1IG7A 4GYIA 3TOBA 1KGSA 3DP7A 1R7JA 3FXOA 1R22A 1X3WB 1B6AA 1X3ZB 2DA2A 3F8BA 3CMYA 1UHWA 2L4MA 4HV6A 4F91B 2AQEA 5F0FA 2VLAA 1IDZA 2HR3A 2R7SA 2EZKA 4IHYA 2VE8A 4RS8A 3FWEA 1FP1D 2J5PA 1J7KA 4M74A 1LEAA 1RUNA 1FYLA 3S15J 1B59A 5E3NA 1B8IB 2HVQA 2VASA 3ECOA 2JSPA 5J1YA 3OYFA 3CCJI 1K79A 2KJCA 2XUBA 2ZKZA 3DXJF 4BE0A 5D5UB 1ZG1A 2X1EA 4I99C 2P7VB 3WU1B 2D45A 2R7QA 5EGOB 1ERDA 1D0ZA 4S05A 3BPVA 4E7HA 3K1NA 3ZQCA 3N97A 3MZYA 4EV0A 2RVCA 4CXFA 2VJ5A 2NYXA 1PUFB 2ICWG 2BV6A 4A5MA 5D4RA 3IV5A 3IL2A 2IGNA 5IPAA 2DOEA 2L9RA 3M07A 2ME0A 4U0YA 3F21A 4LB5A 5FLVA 5EZGA 4L9TA 4BNCA 1PYVA 1U9OA 2F48A 4ANJA 4DZPA 2AS5F 1MJ9A 3H3UA 1MMDA 1O7FA 2K9LA 5DCFA 4IJAA 3JRDA 1FP2A 2W7NA 1Q1HA 5ILSA 2GIVA 3BC8A 2RREA 3EUHC 3RTRA 3HUGA 3LSIA 1OCRH 3PM1A 4IKFA 2VQLA 4HW0A 4KYWA 3FDYA 2YPRA 3QP6A 2K27A 2DK5A 2JQ7A 3FXKA 4E7LA 1U0JA 1TWHJ 2J5OA 1F1ZA 3JR9A 1WSUA 4D0PA 4B3AA 3CDIA 3CLOA 3QOPA 2GBYA 5GPAA 3UKGA 3JRIA 1YJ9I 5B66C 2IJLA 2DA1A 2WY8Q 2GOXB 2OC6A 1T56A 1IN4A 2ELJA 5CVUA 1RZ4A 4U0WA 2IA0A 2WBMA 2XB5A 1WJFA 4KIFA 1V5FA 4IHVA 1EF4A 4IQ4A 1MBGA 2L3DA 5GAHJ 1BI2A 1XB4A 2KIQA 1AHDP 2A6TA 3HYIA 4HX7A 4DBRA 5ICGA 4X6AJ 3E5QA 4OOIA 5HLIA 5L3FA 1PP7U 4MFEA 4N0BA 3ZQGA 1RPWA 5CQEA 1K6YA 5J3LA 2EA4A 3BZCA 5EEHA 3L1PA 2FBKA 3E6MA 4FETA 5IYCJ 3LQQA 3CCMI 3BQZA 1Z6RA 2FSWA 1LDKB 2MW8A 1J09A 1ZH5A 2O8XA 5F1RA 3B6CA 4XRMA 2KRCA 3H5RA 3I4NJ 4RGSA 1K78A 1VQPI 2LF7A 1SD5A 3S8PA 2BY1A 1J9IA 4C3HJ 3KLNA 2DT7B 4M6VA 1QPIA 3TOAA 2DT6A 4DYRA 2JA5J 3CLQA 3IUOA 4HF0A 5DD8A 3VYTB 2XAFA 4YEJA 3N4MA 4EJTA 4KDPA 4EGYA 9ANTA 4LIUA 1IUYA 2DFEA 3JAMZ 3OYGA 4HX8A 1WH7A 1UAAA 6PAXA 2AQFA 1EJ9A 3FXRA 1OKRA 4G6TB 4YFXF 5F27A 2M8EA 3FMRA 1ZRDA 2IGMA 4AIJA 2FBHA 3LA2A 3WU0A 2P4WA 1B72B 1TT5B 1E17A 3QPTA 5A2QZ 3FX3A 1W36C 4EATA 2H6BA 3G3ZA 4N9IA 1R4MB 2HOAA 3ZMTA 1JUPA 4XM3A 1PVEA 5HVQC 2RNGA 2VOOA 3K4CA 1SFXA 1N75A 3GW2A 1X1DA 3EPZA 1IJWC 5CPRB 3IKVA 1UHMA 2ZJPF 4ENKA 1VNDA 2VKHA 3H36A 3M7GA 3MKYB 4IF4A 4QWQA 4RMNA 1TWCJ 2FU4A 1MNMC 2LKPA 1TL8A 3G71I 4LLNA 4KMFA 3GLLA 4CCNA 2ISZA 1RKTA 5IOYA 4QPQA 1OCPA 5K5QA 3L2RA 1FYKA 2L5QA 1LFBA 1TQMA 2MC4A 2X51A 4ENMA 5H20A 1TC3C 2IGKA 3SFIA 3G73A 3E6CC 1JUSA 1X2MA 3GXOA 1JE8A 3I59A 4ON0A 1YITI 3OYNA 5HLHA 4M3DA 3VEPA 1R49A 2AO9A 3CESA 3F0CA 4L9NA 4AWXB 3MKZA 5DCMB 3RKQA 3F8NA 4FASD 3REOA 3FXJA 4CDGA 3R0JA 5B3SH 4NB5A 4RAFA 5LBQA 3QQAA 1HOMA 2V9VA 1OYYA 2MH9A 4XICA 3W6VA 1T98A 4U87A 2EWNA 1TW3A 3K4NA 1UELB 3W2VA 2JMWA 4JYKA 4Y52J 2EPFA 2O3FA 5D5VB 1R71A 4XIDA 1HSTA 2V26A 1MMSA 1TWGJ 3GZ5A 1WCMJ 3D5RC 2L9NA 3C2BA 1HBXG 4WX9A 4KN4X 1VQ7I 1FOWA 1ETKA 1H9GA 1U5TC 1SFKA 4WXCA 4PFOA 1SD6A 2Y31A 2CUEA 3HOTA 4FHTA 4AVZA 1VQ9I 3RYRA 4OWRB 2GA2A 4AUXA 2EV6A 2QF7A 3Q9SA 4R1HA 5JLXA 3CCEI 2WADA 5E1XA 3PIPF 1Z05A 1WJBA 2UWMA 3OWTA 3KEOA 1RUOA 3KYLA 2UZKA 1Y1VJ 3IAS2 1ZGWA 1XGMA 1U8BA 3MCZA 4XQFA 2EJRA 2LMDA 4CCOA 3OOPA 2DPDA 2A5YB 5J4YA 3VPRA 1WJ5A 3G1LA 2XGXA 3AG2H 2R0QC 2JPCA 1QVTA 4I0AA 5EDNA 3HGYA 3L09A 2HXOA 4HEA2 4K2EA 4P9FA 4ZYHA 3S17J 3C1DA 3K4LA 3F23A 5K7ZA 4D9JA 5E3MA 1QHGA 1SAUA 2VJ4A 3CO7C 3HOVJ 3SZPA 2K3PA 1ONVA 3FM5A 2GOMA 3BTJA 1I3AA 2IW5A 4BKXA 2YU9J 3LSJA 2VKVA 4L5JA 3RZOJ 1ETWA 2VL8A 3KETA 3PSIA 4BACA 4XOPA 4C9YA 2OBPA 1FMWA 2XV4S 1MSFC 2Y2ZA 2H27A 3QPSA 2BHZA 4GFBA 4UVCA 3QU6A 1VQ6I 2F5EA 4BU2A 1R1TA 2HZTA 3FHZA 1NK2P 3NARA 1QBJA 3WGHA 3I4MJ 2O8KA 4BQNA 1ZHFA 4IL6C 2VOPA 2TRTA 3HRMA 2DK8A 3BG5A 3DF8A 5B5EC 2GXAA 1X4PA 3DKXA 4KISA 4I09A 4I02A 2FMLA 1WQ2A 2X6OA 5K5OA 4RM2A 4CCJA 3CCQI 1F4KA 1R4NB 1X3UA 2H09A 4XSXF 3OIQA 1K83J 4I98B 5E20A 1XPXA 3IHUA 1CF7A 1QVUA 2K7LA 2CFOA 4CA0A 1I5ZA 2HYJA 2WAFA 2ZCWA 1ZLJA 2BVLA 2X9DA 4RAYA 2A5WA 5LGUA 1JKPC 4BBSJ 1W1WE 1W0TA 1O3SA 2DMUA 1K78B 4RM3A 3DTKA 3KIOA 1I27A 3DLLF 2PBIA 3RI4A 4LIVA 3MMYB 1TWFJ 2R5YA 2CH0A 2DMQA 4DYCA 3FXMA 3T8TA 1UG2A 4NC6A 2RN7A 2E34A 5HLTA 3KP5A 3U9GA 2RAEA 3TGNA 5LGTA 1D1AA 2UV1A 1YHQI 3LOCA 1Z7UA 5CQGA 3H0GJ 4Y4RA 1WJAA 1V54H 4U0VA 1JHFA 2Z1DA 4PJ0C 4L0YB 5CJ9A 1QU3A 1RETA 3A02A 4EQQA 3EETA 5BQTA 3HRTA 5HOOA 3PL8A 2VQHA 3UR3C 1RRJA 1J75A 5FRNA 1S8NA 2CYYA 3SZTA 4A93J 3ASOH 1ZGJA 2VIXA 1ZR4A 3HRSA 2F5DA 2HNHA 3A0HC 5EGOA 3MWMA 1JKOC 4GGGA 3WG9A 3RZDJ 2VBWA 2R5ZB 3VYRB 4BBRJ 3OYBA 4B8XA 1O3TA 3HBLA 3A01B 1MBHA 2JK3A 1U2WA 2R7OA 3TMOA 2PMZN 4JK1X 1WRJA 2XF7A 4I2OA 2XF5A 2Y69H 3GVAA 3DFGA 2OUMA 1TT0A 5FKLA 5HS7A 1RR8C 2E36A 5L3GA 2L9SA 3A4CA 1I3QJ 1DGWY 3CCRI 2R93J 1LEBA 2A69F 2XASA 1ZQ3P 1Z91A 2LRDA 4HYEA 3JSOA 4KA4A 2EFOA 2Z5UA 5DTDA 2CFXA 2P0WA 4A6EA 3ZP5A 2MYSA 4ZYAA 3MFKA 5IT9K 2Y0SA 1U9NA 3OR2C 3ZGKA 1W36D 2KDZA 1OYWA 2JJ7A 1LUJB 1DPRA 4DNCA 1SEUA 1QPMA 2NOGA 4PCQA 5ED4A 3CC4I 4UV9A 2NXNB 3KE2A 5KAIC 5B1AH 3R6SA 1IN5A 1ZTRA 4J19A 1T0FA 2CS3A 3CZ6A 3VYSB 4XN3A 4DYQA 1YE9A 1LJ9A 2MD0A 1R36A 4AYBN 4AIDA 5HS8A 2ZXIA 1VQNI 1DDNA 2XHKA 1KONA 4W97A 1ETYA 5FGMA 3FXUA 4XBFA 2ELHA 4KUMA 3OYAA 2LOOA 2HZDA 3LSMA 3CDHA 1DGRM 2M9HA 4HLYA 1MDMB 1IGNA 2CU7A 4RAZA 1YRNA 2E7XA 2W48A 2R7XA 2PX9A 3BJOA 4XRSA 2CV0A 2YU3A 3F3XA 4H4KC 4C2UA 4V19K 3F6OA 1BC7C 3DU5A 1G3YA 4CYDA 2OV7A 2ZBKA 1RESA 4J01A 1ZRCA 1OR7C 1MJBA 1MNDA 3DEWA 1ZR2A 4NHJA 4EMSA 3CMMA 2F6CA 1IN8A 1ZG5A 1Z77A 3OR1C 3M9AA 4BH9A 1FSHA 5C44J 1W5SA 2MGQA 4NNJA 2QQ8A 2E60A 1BJZA 5H6RA 4HNUA 1Y8QB 3CCYA 5B1BH 4A12A 2WAEA 3BTLA 1P7IA 2M7BA 1BJAA 2WV0A 1E2XA 4RBOA 4RA2A 4KFCA 3E7LA 3BTCA 2JWTA 3OY9A 4KT5C 3PUFA 4HRIA 4YG2F 3HOSA 2VPLA 4C3JJ 1APLC 4LLLA 1VQ8I 1IDYA 2RC4A 4KN7X 5M3FJ 5F0CA 1B72A 4A3IJ 1IO2A 2F5CA 1WPKA 4V2FA 1MD0A 1KYZA 4ENJA 3I64A 3HDDA 3FF5A 2MFZA 2FQ3A 3U2RA 1SFUA 4OAZA 3M3YJ 3CP2A 3OL3A 2XIGA 1X2NA 5ILVA 3FMQA 1XTAA 2XRLA 1STZA 4G8XA 3CJTB 1OJLA 5GTIC 4UVBA 1TQIA 1XG1A 2JTVA 2KZGA 2MLGA 1V5GA 3HRUA 3GEZA 1P6RA 4B48A 4FCYA 1ZYRF 3AG1H 2R7DA 1KA8A 3OS1A 3T0YA 3AKZA 2L7FP 4ZDPA 3LA3A 1Z1DA 4ZDLA 5ILUA 4B09A 1MW7A 5JHUA 1A6IA 3HPHA 1MJAA 2CW0F 3DWLE 3KP4A 1YIJI 1IRZA 1TW2A 3PJRA 2XC7A 3EYYA 1KQ8A 5J8CA 2LLKA 2DMPA 5HS9A 1WI9A 5EEGA 1P9QC 3NQOA 3EUKL 4BQOA 4A3FJ 2GIZA 2DA5A 2O03A 3COAC 4BXUA 4IHWA 1M1EB 4NDLA 1MSEC 4F93B 4EM0B 5DCMA 4BXXJ 4GO1A 4BUPA 3LFUA 2WY7Q 3ZMDA 4GRIA 4M9SA 1SAXA 4LLGF 3WHBA 4ESBA 2JUCA 1D5VA 1SMYF 1T8IA 3CMEI 2MSYA 1BW6A 3J7AO 2P8TA 2JA8J 4JBAA 3JRBA 3S2WA 1RKWA 1U5TB 2HTJA 3AL0C 2K85A 3RIRA 1JT0A 2FRHA 2VB6A 3OYJA 2A07F 2CV2A 1ZARA 2DXIA 2L02A 1SANA 2CMPA 2LY2A 1BA5A 4PK4A 2P5LC 1YTYA 3V7CA 5FRMA 3LMMA 4OAYA 2DYRH 1OR7A 4JOMA 4BDYA 1Q1VA 2W24A 3VDXA 1AKHA 3C3WA 2K4JA 2F4IA 5ERIA 3ZQ7A 4C3IJ 4BQAA 3FXLA 3JREA 4IX7A 2HQNA 1R9TJ 1N77A 2TCTA 3BZKA 4UUTA 1HKTA 3M1CA 2Y9YA 1D0XA 3S3MA 2DU9A 1LDJA 1USTA 2DPUA 2W00A 1HW1A 1MBJA 2CO5A 2FNAA 1MMGA 2K9QA 2LP0A 4E4HA 3ABLH 2HQRA 1GDTA 2H8WA 2Q2EB 5TJJA 3RKXA 1YS6A 2DOFA 1EKEA 3U1DA 1FLIA 2CG4A 2ID6A 4BS9A 2JSCA 2LTPA 4PSXA 5GAGJ 3VSKA 4I0BA 4B43A 3I9V2 4EJWA 4XRFA 2E1MC 4ZC3A 5ICFA 3B02A 3K70C 4A3MJ 2FMYA 1U3EM 2XAHA 2M8GX 4YIFA 1EH8A 2ISYA 1HKSA 3UNGC 3HHHA 1TQPA 2CUJA 4EM1A 1YX5A 1U78A 3P9CA 3DQVC 1ZLKA 1SMTA 2EV0A 4KNYA 1D5YA 1JHHA 4ENNA 5M3MJ 1A5JA 4P1WA 2QEXI 2V1UA 4MLOA 2X4HA 5FJ8J 1JTYA 5GPCA 2H94A 2OA4A 2FF4A 2FA5A 2K40A 2DMTA 2Y0SN 4E7KA 2G0EA 4IPAA 1ETOA 5IYDJ 2LR8A 3IRQA 3C2HA 4NC8A 3DKYA 3KEYA 1BOBA 4E7ZA 3V8LA 5HODA 3J80K 1ETVA 1WGXA 2AXTC 4LFUA 1FX7A 3NWSA 4M3FA 4IZZA 5F0HA 1YRNB 2MABA 3JTGA 3LA7A 4B47A 1TP4A 3BG6A 1YX3A 3IC7A 3HB9A 3QWLA 4FT8A 5HLGA 4MTDA 4M3EA 5J47A 2VJJA 2H6CA 1SVLA 3W2AA 2VXZA 1HW5A 2EA2A 1Z0XA 2EZLA 3S32A 3MVPA 2STWA 1USSA 3S1QJ 2EZIA 3J81Z 3CC7I 1WVRA 5H2FC 3D5SC 3WTUC 2OTLI 1OCTC 4CGZA 1GHCA 1RIOH 5DEQA 4B4CA 4ZZDA 2PJRB 1ZN2A 2MBFA 3IRRA 1O3RA 4O6JA 2P81A 4RB0A 1QRYA 5E1WA 3BZ6A 4KIBA 3IP4B 1VQKI 5IT3A 1S9HA 1T39A 5LHHA 2QA4I 1E0EA 4B3XA 2CJJA 3E5UA 2NVUB 1JKQC 3LNQA 5CVRA 3HHGA 3GTLJ 4HZFA 1R1UA 3MKWB 2VUMJ 4UY8I 3K1MA 1E3OC 3K1PA 3J7YJ 4OMZA 1NH3A 4RGXA 4XKBA 4GDFA 2FX0A 3F8FA 5AIQA 5K1YA 5EYRA 3ULQB 1OYIA 2VQCA 4M71A 2PMZA 3L2WA 1FWZA 4PGGA 2D5VA 4RLQA 4PGHA 3B6AA 4XLNF 3LAJA 3ZR8X 2R5ZA 4LJZF 5HDNA 2CV1A 2QGUA 3JW4A 1DPUA 3ZN0A 2DT5A 2KPMA 4XLEA 3A01A 2ZFWA 4A6DA 2BYVE 2MLKA 2FEZA 2P5VA 2IS6A 2YSRA 3EUHA 1O7LA 1GV2A 3I58A 1ZG3A 4JX4A 4MO7A 1UB9A 5E3LA 5BOXA 5J40A 4RB3C 1HDDC 5E3OA 1Z21A 3I53A 3K69A 5JHFA 2LYCA 1TBXA 4DQ2A 2HWVA 4HX4A 4QSHA 1JJ8C 1UMQA 2ZMEC 3BCBA 2LK2A 3OS0A 3CO6C 1MNEA 4G6DA 4NUBA 3OIPA 3GO5A 2GZWA 1TLHB 4HSTA 3SQNA 1MH4A 1LB2A 2VT2A 3GF2A 2A61A 1LFPA 1S7EA 2R7VA 2E1OA 3TBIA 4AYBA 3FKIJ 2QUFA 2DLLA 2JZYA 4BL0B 4DJAA 4F55A 3O6BB 1A04A 4GXOA 4Z6YA 4UNOA 2R92J 2ZXWH 4A3LJ 4C2TA 4H0EA 2HQ5A 3FK6A 2VONA 2BHYA 2OJED 2X6XA 3LSPA 2RQQA 1YS7A 2CW8A 4N4NB 1VI0A 3PFIA 2A68F 3S14J 3VYUB 1IRGA 4XL9A 3JRHA 3GTKJ 3ZMSA 5L3CA 2LSOA 2DAOA 3I71A 2L54A 3GZNB 3KP6A 1XCVA 4HV5A 3J7ZI 3SDGA 1MDMA 1YFHA 3S16J 2M2EA 1R00A 1AKHB 5E79C 3M8FA 2ZB9A 4A0YA 1T38A 4L0ZB 1L0OC 3KYDB 3R60A 3V8JA 1XGOA 4QPOA 2QBYB 1KQ9A 3WTTC 3HG9A 4KITB 1IXRC 2MG4A 3SHFA 1X1CA 2COBA 4BJTA 1IXSB 1QNTA 3Q5FA 2QSGX 2QLZA 2QQ9A 4L5IA 3OL4A 5FLXK 2OAZA 3HOYJ 4YIIA 2M0CA 2ZJRF 1PP8F 2Z9OA 2ZNYA 4UUSA 2UXNA 5GADJ 3FISA 2JT1A 1G6NA 4Y7NJ 3OYKA 2CQXA 1O3QA 1FMVA 4EJVA 3CC2I 2ETHA 1B1BA 3NAUA 2GWRA 2O0YA 2EIMH 2JVGA 1MH3A 5LRRA 1WFXA 1K61A 4WXHA 1BI3A 2IVMA 4IRGA 3BJ6A 3CP8A 4OINF 3E0JB 4HDVA 2EFQA 3H35A 3ZOBA 2ZSIB 5F08A 2E2IJ 3QYFA 1BBYA 3P5JA 1D1BA 1HA8A 1WKMA 4HNTA 4XK4A 3MAJA 2BW3B 3GLXA 4MGRA 3WE3A 2H8RA 5BPIA 2KL4A 1ZAOA 1S72I 1MBKA 4BGDA 5M5XJ 3OSGA 2NVXJ 2IEKA 1HCRA 1B9NA 3ZCOA 4E6KG 4M9XA 4MEYF 4JP0A 2X6WA 1H89C 2Z2SB 1VZ0A 1TZLA 1YIOA 3GBGA 1BIAA 2YX4A 3S1NJ 4CYCA 1YI2I 2DI3A 5FKNA 1S3JA 2IRFG 4OIRF 2PFBA 1IAWA 1FOXA 1WWXA 2CUFA 4LG3A 2H1LA 3IH4A 3I0TA 3H1CA 3LSRA 2BXYA 3I56I 5L3EA 2ZMEA 4OIPF 2CGPA 3ERED 5J8FA 1WZ2A 2AXLA 3T8RA 4P9UA 2R7ZJ 1ZK8A 4AIKA 1DQUA 3I3LA 2QSHX 5J4VA 2X0LA 5K7HA 2O7OA 4PJJA 2BZTA 2FUG2 5EEAA 4BXFA 1FPQA 3WTZA 1ON2A 4XR6A 3K70D 2UXXA 3MN2A 4IEJA 3VWBA 4C2MJ 1XS9A 2DA7A 3WE2A 3VFZA 1YW7A 3AL0B 2QENA 1HDPA 4XOTA 3TO7A 5FKKA 1ZGAA 4Y3OA 2V6CA 5CVJA 2KISA 3OIOA 3OYLA 4F3QA 2XRNA 3KZZA 4CO8A 5C3EJ 2HOSA 4PJLA 1U5TA 4EVIA 1E3PA 2CUZA 4PSWA 4IHSA 2G7HA 3PNYA 1FJLA 3OYCA 3SEZA 3BG7A 2M30A 3DBLB 3M8EA 4L5EA 3WTXC 2EV5A 3F8MA 4CZCA 3EUAA 2X1DA 4A3EJ 2PI0A 2VODA 1ULYA 4D5CA 2DQRA 2D1VA 5JI6A 5JLWA 1XN7A 2KHMA 2KRFA 3BJAA 2VQGA 2EBIA 5M5YJ 3HTUA 2O9LA 3ABUA 2V9PA 3QPHA 4S04A 2DYSH 5E18F 2BY0A 3OYDA 3F8CA 1WH5A 3DTIA 4EEFG 4ZYDA 3G1OA 1P4AA 5EZHA 2YX7A 3CCUI 2E71A 3HSRA 2WB1N 3Q3SA 2E1MB 3IKTA 5DUIA 2Q2EA 4IRHA 3HZJA 2HS5A 1EH7A 4F92B 3HTSB 3FK7A 5KCMA 1SVMA 3DBRB 4BHPA 2XVCA 4E7IA 3Q0VA 4MTEA 1X1BA 1R5HA 3L00A 5ICEA 5ICCA 2M4KA 5LHGA 4G9YA 1YLFA 4DZJA 2EH3A 2ZXHA 5IY5H 1H0MA 1SD7A 3RSNA 3V8KA 2I10A 1RR7A 5FFZA 5EF6A 4IVNA 1IRXA 3DCFA 1RI7A 3LWFA 4M73A 3G2BA 4LG0A 5JR3A 1F5TA 2YS9A 2STTA 1QHHD 3QU3A 1ETQA 3A03A 4MIMA 3KCCA 3HOZJ 3C18A 4XN0A 5K5RA 3LSTA 3ZQIA 3CTAA 2DFIA 3DKWA 4PJMA 1VQOI 3G6EI 3JRFA 3BWGA 1Z3XA 3HGGA 4Y15A 2XAQA 3DV8A 2XPWA 3PUBA 4OMYA 1S7AA 3H3VK 3E5XA 3WTYC 2VBYA 5LEJA 4U88A 3CCLI 1ETXA 4UHTA 5FFXA 1JKRC 4RGRA 2NS8A 1QZZA 2MD5A 4HNVA 4C30A 2VBXA 3I55I 4R79A 1H9TA 4I6ZA 1ZKGA 2HXIA 4JX6A 1JJ6C 2KKOA 2KDOA 1KZHA 2F2EA 3ZQHA 4OIQF 3ASNH 2ECCA 3W3CA 1R23A 1YW8A 2JVHA 1D3YA 3GCMA 3PNVA 3GTQJ 3WTWC 2IBDA 4D5FA 5FD6A 2F4OB 2CQNA 4M72A 3R4KA 1OCZH 4UUSB 1XGNA 3K4JA 3E3VA 3WTSC 2E35A 2IS2A 4IXAA 2PJRA 1N25A 3GTGJ 1F9NA 1X4OA 2K3FA 3H5NA 3TO6A 3BQYA 1BIBA 2LD5A 2R7FA 1MKMA 4A69C 5E17F 2O61A 4LGWA 4LOCA 2MC3A 1JTXA 2VKEA 1PUEE 3LL7A 2E1NA 1OMIA 3HOXJ 1DU6A 3QYEA 1QGPA 4HQMA 1V5EA 3ABKH 3BY6A 1T33A 1K4TA 3TL4X 4WF2A 3KZYA 3CUOA 1IC8A 1BI1A 2JRTA 3DPLC 1Z67A 2KIUA 3BR6A 2DA3A 5D4SA 2DTZA 3RCOA 5D5XB 1G3WA 5D5WB 2DA6A 4Y13A 3HL2A 2L7KA 2BOLA 2R7TA 4ZYGA 1ODDA 3S3NA 1I50J 1VTNC 1AWCA 4BY1J 4IHTA 2MA3A 3ZQQA 3S2HJ 3C2GA 2HPMA 2V79A 1JT6A 1W5CC 4OIOF 2RQPA 3K2ZA 5KAFC 1BL0A 3TO9A 4WCGA 4MQ9F 3LSHA 1OLTA 2RNJA 3PIOF 4CSWA 2VC1A 1HKQA 2DCEA 2E2HJ 4CYCB 2ID3A 4II2A 1XGSA 5IP9J 4LB6B 2LVSA 2NVYJ 1XSXA 3ZMUA 1HXDA 2DJIA 5TRDA 2IA2A 1K6OA 4EJUA 3GYHX 1BOAA 1LPQA 4HF2A 2ZMEB 2OTJI 2HYFA 2LKSA 3SYTA 2F5FA 3G4SI 2Z33A 5DV5A 1T95A 3NRVA 1E3HA 3JAMK 1XC5A 3RKYA 2OQRA 1CQTA 2ZFUA 3CDLA 5CYVA 1YG2A 2OZ6A 5JVTA 1HLVA 5FB2A 2W57A 3HM5A 1T2KA 1EA3A 1LKXA 1W5TA 3X2QH 2LBFA 4A0XA 3TEDA 4BE1A 1VQLI 1LVKA 5A2QK 1V55H 2L7ZA 2W85A 3IH2A 1XMXA 3LFKA 4BYYA 4ESJA 1Y1WJ 3ZMZA 5HNHA 1L3LA 4LD5A 1IF1A 4KT6A 2V1XA 4QTRA 4QIWN 3GUDA 2W82A 5LHIA 2HGCA 4D1QA 2LY1A 2E7WA 2ADUA 1VQMI 2XROA 4IOAF 3O8GA 5K7FA 1UHSA 4FQGA 5DS9A 2RGVA 1DP7P 5L3BA 2FE3A 4LMYA 3BG3A 2CQ7A 2VXDA 3MQ0A 4XLAA 2ZO4A 2XKPA 1YJWI 2IGOA 1DUXC 1S6LA 4BDZA 1NG6A 2OQGA 5LRSA 3CUQC 5GAEJ 3RYPA 4AVPA 1U6GA 3RJPA 3L9FA 3HSEA 4G94A 1O4XA 2EIKH 2WAQA 1XDUA 4FISA 2DFFA 3H9JA 2QBYA 2DO7A 3H9QA 2XF6A 2FXAA 4HPQA 1WJEA 1KYWA 1YOVB 2I8DA 1PJRA 1RNLA 3WG7H 4D7NA 1IN7A 3CD6I 2BGCA 2COMA 1H88C 3O3KA 4RDUA 2GLOA 4UVAA 5IT9Z 5CVIA 4CHUA 4JQFA 3H9GA 2M5WA 3ZQFA 1WI3A 1AA7A 2IA1A 4ZJZA 5EG0B 3GFMA 2DN0A 1FSEA 4A0ZA 4ZDOA 3NEUA 1F43A 2NOJB 1BM9A 4A3DJ 3HC7A 2IS4A 2A6HF 2K4BA 2VPRA 4YRVA 3OYHA 3TP3A 3KEQA 4ESFA 1FEXA 4CH7A 1Z3YA 4S0HB 4HAMA 3FBNB 2D1HA 1BW5A 1R6RA 2LDUA 1GXPA 3TKYA 2FOWA 1OISA 2QQBA 4L18B 4RAGA 3V42A 5KVRA 3JRAA 4Q48A 2Q8KA 1GV5A 2ZSHB 3FXQA 2KFDA 3L7WA 1HQCA 5BMZA 4LG0B 1Z7LA 3RPUA 3BR0A 2BW3A 2L9VA 1WHUA 5KNLA 4XONA 4AD9A 5F64A 2GAUA 1MBFA 3HKZN 2HDWA 2TDXA 2M1BA 1UZCA 4E70A 4HG2A 1MMAA 3AFHA 4AM3A 1XCBA 4A3CJ 1JI8A 2XB0X 2HDCA 1ON1A 3D0SA 2VI6A 1Y6IA 4DIQA 1W0UA 1G4DA 4Y17A 2Y0MA 2B9SA 2O6GE 1A6QA 3K7AJ 1POGA 1WJCA 2ZXJA 4AC0A 4ZTJA 3JTHA 3FKJA 2CWEA 2NNNA 2P5KA 1X19A 2XGEA 1LE8B 3O2PE 4IO9F 3HOUJ 3DEEA 3ZPLA 4BAYA 1TTYA 1G8XA 3MKLA 1IZ1A 3T1BA 2ESNA 3K4MA 4KMUX 4MNUA 5J1RA 2M87A 2M7AA 1ORKA 3WGIA 3PNTA 2LG4A 4XNFA 4FE4A 5EJCA 4XSZF 3I54A 4MEXF 3PO2J 3T5XA 3V7SA 5F1JA 1GUUA 2KIFA 2PMHA 3K4BA 4NQWA 5DM7F 1T6SA 1BR1A 3IWFA 3ISPA 2X1CA 2GA1A 5KHDA 1LVAA 2LNBA 2HPIA 2NS0A 3BT9A 1W7PD 2DQLA 2L2OA 1QA6A 2R7UA 2AHQA 2BVMA 3PSFA 1Y56A 3DTEA 3K10A 4XORA 2XGCA 1QZYA 1MZBA 1Y0NA 3QP5A 1FY7A 3CUQA 3PFYA 2WWYA 1WJDA 4YFNF 3V4GA 4O5VA 5LEKA 1F36A 2NVQJ 3JSPA 2HDDA 1FBSA 4PUSA 5HDGA 4KIGA 3GFLA 1SC7A 2EFNA 1MGTA 2DFHA 3H92A 4XLHA 2L01A 3LSKA 3FIWA 3WODF 1OFCX 5H6QA 4M6XA 4HBLA 4F52A 2ELKA 1MMNA 5DD4A 2WB1A 3TW7A 2A05A 1HW2A 1N78A 1TWAJ 4II3A 3ROUA 4M6YA 3J7AY 2XAUA 2VE9A 1GT0C 3SFZA 1P4WA 3VOEA 5TGTA 1HC8A 4ITVA 2K9NA 1IXCA 3HJEA 3BR5A 3KX2A 2HOEA 2DA4A 3U1KA 3OS2A 1TNTA 3F6VA 3HEFA 4G12A 2L0KA 4FTHA 1IRFA 2FJ1A 1SFEA 2EINH 2ECBA 4HQEA 2RV8A 3SEQA 2EZHA 2KJBA 5F04A 2HFHA 3B73A 4ZTFA 3SXYA 2PG4A 1J0RA 4B1RA 1TNSA 1W7PB 2B0LA 3Q9VA 4L9JA 2V1DA 5JFRA 2HI3A 5HNFA 2XSDC 3W6JB 3F72A 2R3SA 1D1CA 4YFKF 1OCOH 2G9WA 1B9MA 2LBFB 4E7JA 3ZQLA 5D8KB 2BEOA 4BHBA 4A3JJ 1I1SA 2JA2A 2EIJH 1YO5C 1KU9A 3SDBA 1X1PA 2ZJQF 2Z3YA 3KZIC 1QO0D 1LDDA 1UCRA 5E8GA 3U21A 4U7DA 3CQZJ 2E5NA 1MBEA 2KZVA 4AU7A 2G7UA 2LH9A 1VFCA 4XMYA 2DDAA 3KP3A 2EFWA 2WV1A 5LD2C 4BE2A 4BEHA 3BR1A 2QKMB 5E8IA 5J6XA 2M4GA 3RPUD 3HIFA 1D0YA 4XLPF 5FO5A 4UUVA 1ACIA 3KPHA 1OQYA 1LNWA 2XPUA 3L2CA 3M4OJ 2LKXA 1J2XA 2Y75A 1KU2A 1D8KA 4HLXA 1R58A 4R8HA 2NNYA 4LITA 3AG4H 5C4JJ 1REPC 3NWTA 2LF8A 4FE7A 4A2UA 3L2UA 2HOTA 3TDZC 1UG0A 5GTHC 1I6HJ 2C6YA 3FHNA 2M45A 4HA8A 2JPBA 1FYMA 5FKOA 3I4PA 2QSFX 2OF7A 4IQJA 3W2WA 3QOEA 4RLFA 3ECHA 4YIRX 2WAQN 3OOUA 3GTPJ 3WU2C 5DM6F 3ESWB 1K4SA 3IWZA 4L9VA 1VQ5I 5FKMA 3OYMA 5D6FA 4ZYEA 1FOYA 5FLMJ 3I5UA 4TV7A 4IOCF 4Y33A 2KIMA 3K6GA 2V9KA 3P7NA 4G7ZF 1FNNA 2FQ4A 2K9MA 5HDKA 4UV8A 2XAJA 1VF9A 1Y8RB 4PFPA 1R5ID 2GXBA 3J80Z 3DPTA 3GMEA 2NRAC 3RQIA 5TISC 3K9TA
chains in the Genus database with same CATH topology
4MFDA 3O8HA 3DCFA 1DU0A 4C3HJ 4M6VA 2YS9A 3WHBA 1QPIA 2JA5J 4DYRA 1ETQA 1JUMA 3A03A 9ANTA 3BG9A 4MIMA 2MSYA 1BW6A 3HOZJ 2JA8J 2LY9A 3JRBA 1RKWA 1WH7A 3ZQIA 1JT0A 3JRFA 5F27A 3HGGA 2XPWA 2H1KA 1SANA 4ABZA 1B72B 1BA5A 3H3VK 4JX5A 1ETXA 2JA6J 2HOAA 1JUPA 1JKRC 2NS8A 1Q1VA 3TP0A 1AKHA 4HNVA 4C3IJ 4I6ZA 3JREA 1ZKGA 5IYBJ 1IJWC 2HXIA 4JX6A 1R9TJ 1FIAA 1JJ6C 2TCTA 4UUTA 3ZQHA 2ECCA 2Y9YA 2QCOA 1VNDA 3K2AA 3GTQJ 1MBJA 1TWCJ 2IBDA 4D5FA 2K9QA 2LP0A 1MNMC 4UUSB 1GDTA 1ENHA 2KT0A 4X1EA 1RKTA 5IOYA 5IP7J 3GTGJ 2IAIA 2N8GA 2ID6A 3BQYA 2LD5A 2LTPA 1OCPA 5M5WJ 4A69C 1LFBA 4LOCA 1JTXA 1TC3C 2VKEA 3SFIA 5BNGA 3HOXJ 4A3MJ 1JUSA 1X2MA 1DU6A 2M8GX 1T33A 4M3DA 2AO9A 2YUSA 2B63J 4A3GJ 1IC8A 3F0CA 1GVDA 1U78A 3RKQA 3BR6A 2DA3A 2NS7A 2DTZA 2GM4A 1D5YA 2FD5A 5J1UA 2DA6A 5M3MJ 5C4XJ 3QQAA 1A5JA 3S2DJ 1I50J 1HOMA 4BY1J 4MLOA 3S2HJ 1JT6A 4XICA 3W6VA 5FJ8J 1JTYA 5GPCA 1BL0A 4Y52J 2JMWA 4JYKA 2M34A 4M3GA 4XIDA 1TWGJ 5GP9A 3BTIA 2K40A 2DMTA 1IUFA 2Y0SN 3SJMA 1WCMJ 3C2BA 2G0EA 2E2HJ 1ETOA 5IYDJ 2LR8A 4CYCB 1ETKA 2ID3A 5HODA 5IP9J 1ETVA 1WGXA 2LVSA 2NVYJ 1B8IA 1FTTA 4M3FA 5EG0A 5F0HA 1YRNB 3OSFA 2Y31A 2CUEA 1AU7A 2DJNA 3JRGA 3HB9A 4AUXA 2QF7A 5JLXA 1FIPA 4M3EA 1X58A 1XC5A 3CDLA 2E2JJ 2JA7J 1Z0XA 1HLVA 2EZLA 1PUFA 3LSGA 1Y1VJ 2OPTA 3MVPA 3HM5A 1ZGWA 3S1QJ 2EZIA 1U8BA 1LFUP 1OCTC 3S1RJ 3TEDA 4B4CA 2K9SA 3VPRA 3S1MJ 2L7ZA 3G1LA 3IH2A 1Y1WJ 2P81A 1QRYA 2R0QC 1QVTA 5EDNA 3HGYA 4QTRA 4QIWN 2HXOA 3S17J 5K7ZA 5E3MA 1G2HA 3BR2A 2CJJA 3O8GA 5K7FA 1UHSA 1JKQC 5DS9A 3HOVJ 1NK3P 3LNQA 2XPVA 3GTLJ 3BTJA 3BG3A 4BKXA 2YU9J 3LSJA 2JN6A 2VUMJ 2VKVA 2NVTJ 3RZOJ 2DMNA 1E3OC 1ETWA 3I4NJ 4A3BJ 3JRCA 1O4XA 2FX0A 2CQQA 4FISA 1MSFC 1LE8A 2Y2ZA 3QPSA 5EYRA 4GFBA 3GTMJ 1ITYA 1NK2P 2D5VA 3NARA 3B6AA 3I4MJ 4D7NA 2R5ZA 2O8KA 1H88C 4RDUA 2Y9ZA 2TRTA 2GLOA 3HOWJ 3TW6A 5IOZA 3A01A 3BG5A 3ZQFA 1WI3A 4BY7J 5EG0B 2LFBA 2DN0A 4D7MA 3Q0UA 4I76A 2X6OA 1F43A 4A3DJ 1GV2A 4JX4A 2VPRA 4MO7A 4A3KJ 5E3LA 3TP3A 1HDDC 5E3OA 1FEXA 2EQRA 1K83J 3PO3J 4QSHA 1JJ8C 1QVUA 4S0HB 1UMQA 2HYJA 2LK2A 1BW5A 2X9DA 4W1UA 3BR3A 4V2GA 1JKPC 4BBSJ 1W0TA 3JRAA 2DMUA 4IHXA 3GTOJ 1MH4A 1GV5A 1S7EA 3GTJJ 1HF0A 2E1OA 3BR0A 2Y30A 3FKIJ 1TWFJ 2R5YA 4A3LJ 2R92J 2DMQA 4DYCA 1FTZA 1MBFA 1UG2A 3HKZN 2HQ5A 3FK6A 2RAEA 4M3BA 3LSPA 3QPLA 3LOCA 1JGGA 3H0GJ 4A3CJ 1VI0A 3S14J 2XB0X 3JRHA 3GTKJ 2VI6A 2ME6A 1W0UA 1RETA 3A02A 3K7AJ 3SDGA 1POGA 3Q0WA 4AC0A 3S16J 4A93J 2M2EA 1AKHB 2XGEA 2X48A 1LE8B 4DW6A 2ZB9A 1ZR4A 3HOUJ 2XGDA 3MKLA 1IV6A 5EGOA 1JKOC 2MG4A 3RZDJ 5J1RA 2COBA 2CRGA 3D1NI 1ORKA 2R5ZB 4BBRJ 3HOYJ 4FE4A 3HBLA 2M0CA 3A01B 1MBHA 5IP6A 2JK3A 3PO2J 3WHCA 5F1JA 1GUUA 4UUSA 2L7MP 2PMZN 3FISA 4Y7NJ 2CQXA 3G1MA 1P7JA 3NAUA 5FKLA 1NTCA 3BT9A 1K61A 1MH3A 2AHQA 2XGCA 1I3QJ 2R93J 1ZQ3P 3ZOBA 1F36A 5F08A 2NVQJ 2E2IJ 2E19A 4XRSG 2HDDA 5DTDA 1SFOJ 3IH3A 1H8AC 4XK4A 1U9NA 2H8RA 3FIWA 2R5YB 1OFCX 2KDZA 2JJ7A 2NOGA 1IG7A 1MBKA 2NVXJ 2ELKA 5M5XJ 3TW7A 2IEKA 3OSGA 1HCRA 1TWAJ 1ZTRA 4J19A 2DA2A 3CMYA 1CQTA 4JP0A 1IDZA 5F0FA 1H89C 4DYQA 3GBGA 2EZKA 4IHYA 1GT0C 4AYBN 3S1NJ 4CYCA 5FKNA 4W97A 1ETYA 2K9NA 3BR5A 3S15J 2DA4A 5E3NA 1B8IB 2CUFA 2M9HA 3IH4A 1IGNA 5J1YA 2CU7A 1YRNA 3HEFA 4G12A 2L0KA 3LSRA 4FTHA 2W48A 2FJ1A 4XRSA 2ECBA 2EZHA 5F04A 2R7ZJ 1ZK8A 5EGOB 1RESA 4B1RA 5K7HA 3ZQCA 2O7OA 2HI3A 3DEWA 5EEAA 2XSDC 1ZR2A 1PUFB 3MN2A 4IEJA 3IV5A 1Z77A 4C2MJ 5C44J 5IPAA 1XS9A 3ZQLA 2DA7A 2L9RA 2MGQA 2ME0A 5FLVA 1BJZA 1HDPA 5EZGA 4A3JJ 3CCYA 1U9OA 5FKKA 3BTLA 4DZPA 1P7IA 3OIOA 3JRDA 4RBOA 3E7LA 3BTCA 2JWTA 5C3EJ 3CQZJ 2HOSA 1MBEA 4C3JJ 1APLC 1VFCA 1FJLA 1IDYA 2WV1A 3PM1A 3BR1A 5M3FJ 5F0CA 1B72A 4A3IJ 4L5EA 1WPKA 4V2FA 3HDDA 1TWHJ 2XPUA 3M4OJ 2LKXA 3JR9A 3M3YJ 4A3EJ 4B3AA 1X2NA 4D5CA 2GBYA 5GPAA 2XRLA 5JLWA 5C4JJ 3JRIA 3UKGA 2EBIA 4FE7A 2HOTA 5M5YJ 1OJLA 2O9LA 1I6HJ 1XG1A 2DA1A 1T56A 1WH5A 5FKOA 2OF7A 4EEFG 3G1OA 4FCYA 2XB5A 2WAQN 3OOUA 3GTPJ 5EZHA 4IHVA 1EF4A 1MBGA 2WB1N 3Q3SA 2L7FP 1AHDP 1A6IA 5FKMA 4X6AJ 3FK7A 1IRZA 5FLMJ 4MFEA 3ZQGA 1RPWA 2LLKA 2DMPA 3Q0VA 5J3LA 3L1PA 2FQ4A 4A3FJ 5IYCJ 2DA5A 3BQZA 1VF9A 4DZJA 2EH3A 4IHWA 2MW8A 4NDLA 3B6CA 5EF6A 2I10A 1RR7A 4XRMA 1MSEC 3RQIA 4BXXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4MFD A;  3O8H A;  3DCF A;  1DU0 A;  4C3H J;  4M6V A;  2YS9 A;  3WHB A;  1QPI A;  2JA5 J;  4DYR A;  1ETQ A;  1JUM A;  3A03 A;  9ANT A;  3BG9 A;  4MIM A;  2MSY A;  1BW6 A;  3HOZ J;  2JA8 J;  2LY9 A;  3JRB A;  1RKW A;  1WH7 A;  3ZQI A;  1JT0 A;  3JRF A;  5F27 A;  3HGG A;  2XPW A;  2H1K A;  1SAN A;  4ABZ A;  1B72 B;  1BA5 A;  3H3V K;  4JX5 A;  1ETX A;  2JA6 J;  2HOA A;  1JUP A;  1JKR C;  2NS8 A;  1Q1V A;  3TP0 A;  1AKH A;  4HNV A;  4C3I J;  4I6Z A;  3JRE A;  1ZKG A;  5IYB J;  1IJW C;  2HXI A;  4JX6 A;  1R9T J;  1FIA A;  1JJ6 C;  2TCT A;  4UUT A;  3ZQH A;  2ECC A;  2Y9Y A;  2QCO A;  1VND A;  3K2A A;  3GTQ J;  1MBJ A;  1TWC J;  2IBD A;  4D5F A;  2K9Q A;  2LP0 A;  1MNM C;  4UUS B;  1GDT A;  1ENH A;  2KT0 A;  4X1E A;  1RKT A;  5IOY A;  5IP7 J;  3GTG J;  2IAI A;  2N8G A;  2ID6 A;  3BQY A;  2LD5 A;  2LTP A;  1OCP A;  5M5W J;  4A69 C;  1LFB A;  4LOC A;  1JTX A;  1TC3 C;  2VKE A;  3SFI A;  5BNG A;  3HOX J;  4A3M J;  1JUS A;  1X2M A;  1DU6 A;  2M8G X;  1T33 A;  4M3D A;  2AO9 A;  2YUS A;  2B63 J;  4A3G J;  1IC8 A;  3F0C A;  1GVD A;  1U78 A;  3RKQ A;  3BR6 A;  2DA3 A;  2NS7 A;  2DTZ A;  2GM4 A;  1D5Y A;  2FD5 A;  5J1U A;  2DA6 A;  5M3M J;  5C4X J;  3QQA A;  1A5J A;  3S2D J;  1I50 J;  1HOM A;  4BY1 J;  4MLO A;  3S2H J;  1JT6 A;  4XIC A;  3W6V A;  5FJ8 J;  1JTY A;  5GPC A;  1BL0 A;  4Y52 J;  2JMW A;  4JYK A;  2M34 A;  4M3G A;  4XID A;  1TWG J;  5GP9 A;  3BTI A;  2K40 A;  2DMT A;  1IUF A;  2Y0S N;  3SJM A;  1WCM J;  3C2B A;  2G0E A;  2E2H J;  1ETO A;  5IYD J;  2LR8 A;  4CYC B;  1ETK A;  2ID3 A;  5HOD A;  5IP9 J;  1ETV A;  1WGX A;  2LVS A;  2NVY J;  1B8I A;  1FTT A;  4M3F A;  5EG0 A;  5F0H A;  1YRN B;  3OSF A;  2Y31 A;  2CUE A;  1AU7 A;  2DJN A;  3JRG A;  3HB9 A;  4AUX A;  2QF7 A;  5JLX A;  1FIP A;  4M3E A;  1X58 A;  1XC5 A;  3CDL A;  2E2J J;  2JA7 J;  1Z0X A;  1HLV A;  2EZL A;  1PUF A;  3LSG A;  1Y1V J;  2OPT A;  3MVP A;  3HM5 A;  1ZGW A;  3S1Q J;  2EZI A;  1U8B A;  1LFU P;  1OCT C;  3S1R J;  3TED A;  4B4C A;  2K9S A;  3VPR A;  3S1M J;  2L7Z A;  3G1L A;  3IH2 A;  1Y1W J;  2P81 A;  1QRY A;  2R0Q C;  1QVT A;  5EDN A;  3HGY A;  4QTR A;  4QIW N;  2HXO A;  3S17 J;  5K7Z A;  5E3M A;  1G2H A;  3BR2 A;  2CJJ A;  3O8G A;  5K7F A;  1UHS A;  1JKQ C;  5DS9 A;  3HOV J;  1NK3 P;  3LNQ A;  2XPV A;  3GTL J;  3BTJ A;  3BG3 A;  4BKX A;  2YU9 J;  3LSJ A;  2JN6 A;  2VUM J;  2VKV A;  2NVT J;  3RZO J;  2DMN A;  1E3O C;  1ETW A;  3I4N J;  4A3B J;  3JRC A;  1O4X A;  2FX0 A;  2CQQ A;  4FIS A;  1MSF C;  1LE8 A;  2Y2Z A;  3QPS A;  5EYR A;  4GFB A;  3GTM J;  1ITY A;  1NK2 P;  2D5V A;  3NAR A;  3B6A A;  3I4M J;  4D7N A;  2R5Z A;  2O8K A;  1H88 C;  4RDU A;  2Y9Z A;  2TRT A;  2GLO A;  3HOW J;  3TW6 A;  5IOZ A;  3A01 A;  3BG5 A;  3ZQF A;  1WI3 A;  4BY7 J;  5EG0 B;  2LFB A;  2DN0 A;  4D7M A;  3Q0U A;  4I76 A;  2X6O A;  1F43 A;  4A3D J;  1GV2 A;  4JX4 A;  2VPR A;  4MO7 A;  4A3K J;  5E3L A;  3TP3 A;  1HDD C;  5E3O A;  1FEX A;  2EQR A;  1K83 J;  3PO3 J;  4QSH A;  1JJ8 C;  1QVU A;  4S0H B;  1UMQ A;  2HYJ A;  2LK2 A;  1BW5 A;  2X9D A;  4W1U A;  3BR3 A;  4V2G A;  1JKP C;  4BBS J;  1W0T A;  3JRA A;  2DMU A;  4IHX A;  3GTO J;  1MH4 A;  1GV5 A;  1S7E A;  3GTJ J;  1HF0 A;  2E1O A;  3BR0 A;  2Y30 A;  3FKI J;  1TWF J;  2R5Y A;  4A3L J;  2R92 J;  2DMQ A;  4DYC A;  1FTZ A;  1MBF A;  1UG2 A;  3HKZ N;  2HQ5 A;  3FK6 A;  2RAE A;  4M3B A;  3LSP A;  3QPL A;  3LOC A;  1JGG A;  3H0G J;  4A3C J;  1VI0 A;  3S14 J;  2XB0 X;  3JRH A;  3GTK J;  2VI6 A;  2ME6 A;  1W0U A;  1RET A;  3A02 A;  3K7A J;  3SDG A;  1POG A;  3Q0W A;  4AC0 A;  3S16 J;  4A93 J;  2M2E A;  1AKH B;  2XGE A;  2X48 A;  1LE8 B;  4DW6 A;  2ZB9 A;  1ZR4 A;  3HOU J;  2XGD A;  3MKL A;  1IV6 A;  5EGO A;  1JKO C;  2MG4 A;  3RZD J;  5J1R A;  2COB A;  2CRG A;  3D1N I;  1ORK A;  2R5Z B;  4BBR J;  3HOY J;  4FE4 A;  3HBL A;  2M0C A;  3A01 B;  1MBH A;  5IP6 A;  2JK3 A;  3PO2 J;  3WHC A;  5F1J A;  1GUU A;  4UUS A;  2L7M P;  2PMZ N;  3FIS A;  4Y7N J;  2CQX A;  3G1M A;  1P7J A;  3NAU A;  5FKL A;  1NTC A;  3BT9 A;  1K61 A;  1MH3 A;  2AHQ A;  2XGC A;  1I3Q J;  2R93 J;  1ZQ3 P;  3ZOB A;  1F36 A;  5F08 A;  2NVQ J;  2E2I J;  2E19 A;  4XRS G;  2HDD A;  5DTD A;  1SFO J;  3IH3 A;  1H8A C;  4XK4 A;  1U9N A;  2H8R A;  3FIW A;  2R5Y B;  1OFC X;  2KDZ A;  2JJ7 A;  2NOG A;  1IG7 A;  1MBK A;  2NVX J;  2ELK A;  5M5X J;  3TW7 A;  2IEK A;  3OSG A;  1HCR A;  1TWA J;  1ZTR A;  4J19 A;  2DA2 A;  3CMY A;  1CQT A;  4JP0 A;  1IDZ A;  5F0F A;  1H89 C;  4DYQ A;  3GBG A;  2EZK A;  4IHY A;  1GT0 C;  4AYB N;  3S1N J;  4CYC A;  5FKN A;  4W97 A;  1ETY A;  2K9N A;  3BR5 A;  3S15 J;  2DA4 A;  5E3N A;  1B8I B;  2CUF A;  2M9H A;  3IH4 A;  1IGN A;  5J1Y A;  2CU7 A;  1YRN A;  3HEF A;  4G12 A;  2L0K A;  3LSR A;  4FTH A;  2W48 A;  2FJ1 A;  4XRS A;  2ECB A;  2EZH A;  5F04 A;  2R7Z J;  1ZK8 A;  5EGO B;  1RES A;  4B1R A;  5K7H A;  3ZQC A;  2O7O A;  2HI3 A;  3DEW A;  5EEA A;  2XSD C;  1ZR2 A;  1PUF B;  3MN2 A;  4IEJ A;  3IV5 A;  1Z77 A;  4C2M J;  5C44 J;  5IPA A;  1XS9 A;  3ZQL A;  2DA7 A;  2L9R A;  2MGQ A;  2ME0 A;  5FLV A;  1BJZ A;  1HDP A;  5EZG A;  4A3J J;  3CCY A;  1U9O A;  5FKK A;  3BTL A;  4DZP A;  1P7I A;  3OIO A;  3JRD A;  4RBO A;  3E7L A;  3BTC A;  2JWT A;  5C3E J;  3CQZ J;  2HOS A;  1MBE A;  4C3J J;  1APL C;  1VFC A;  1FJL A;  1IDY A;  2WV1 A;  3PM1 A;  3BR1 A;  5M3F J;  5F0C A;  1B72 A;  4A3I J;  4L5E A;  1WPK A;  4V2F A;  3HDD A;  1TWH J;  2XPU A;  3M4O J;  2LKX A;  3JR9 A;  3M3Y J;  4A3E J;  4B3A A;  1X2N A;  4D5C A;  2GBY A;  5GPA A;  2XRL A;  5JLW A;  5C4J J;  3JRI A;  3UKG A;  2EBI A;  4FE7 A;  2HOT A;  5M5Y J;  1OJL A;  2O9L A;  1I6H J;  1XG1 A;  2DA1 A;  1T56 A;  1WH5 A;  5FKO A;  2OF7 A;  4EEF G;  3G1O A;  4FCY A;  2XB5 A;  2WAQ N;  3OOU A;  3GTP J;  5EZH A;  4IHV A;  1EF4 A;  1MBG A;  2WB1 N;  3Q3S A;  2L7F P;  1AHD P;  1A6I A;  5FKM A;  4X6A J;  3FK7 A;  1IRZ A;  5FLM J;  4MFE A;  3ZQG A;  1RPW A;  2LLK A;  2DMP A;  3Q0V A;  5J3L A;  3L1P A;  2FQ4 A;  4A3F J;  5IYC J;  2DA5 A;  3BQZ A;  1VF9 A;  4DZJ A;  2EH3 A;  4IHW A;  2MW8 A;  4NDL A;  3B6C A;  5EF6 A;  2I10 A;  1RR7 A;  4XRM A;  1MSE C;  3RQI A;  4BXX J; 
#chains in the Genus database with same CATH topology
 4MFD A;  3O8H A;  3A0B C;  1S7O A;  2QWW A;  3E1S A;  3R61 A;  4KIC A;  1DU0 A;  2CW7 A;  1QQI A;  1P4X A;  3A2K A;  4XKC A;  2R7W A;  2VBZ A;  1R1V A;  1JUM A;  3BG9 A;  3MZ8 A;  2OCC H;  2F4M B;  2LY9 A;  5FRO A;  1IN6 A;  2Q1Z B;  4HOB A;  2E1C A;  4X0G A;  2W25 A;  3DU6 A;  3M8J A;  3ZN1 A;  3HUG B;  3BPX A;  3L2Q A;  1FZP B;  2WC2 A;  4J00 A;  2H1K A;  4ABZ A;  2HVS A;  2PMU A;  4MHG A;  2KLO A;  3OYE A;  4CCM A;  1XSV A;  4JX5 A;  2JA6 J;  4ASN A;  3PQJ A;  4BQQ A;  2KQR A;  4HF1 A;  3TP0 A;  3GFI A;  1KQ0 A;  2XKO A;  4ETS A;  1IV8 A;  4BJ5 C;  5IYB J;  2O5R A;  3CJN A;  1FIA A;  1NG7 A;  2HKX A;  3V7R A;  3JCU C;  4GYG A;  2HKO A;  2QCO A;  1O57 A;  1G3T A;  3PQK A;  4M9Z A;  5DYM A;  3VSL A;  2RDP A;  2VN2 A;  3E6B A;  3EYI A;  3K2A A;  3KFW X;  3MEX A;  5BS6 A;  2FNP A;  4RB2 C;  4LK0 F;  2F5V A;  4YEL A;  2IS1 A;  1T0F C;  1ENH A;  4MQV A;  4O3M A;  2KT0 A;  4NQW B;  4X1E A;  2HTS A;  3BRO A;  5IP7 J;  2QVO A;  2ESH A;  2IAI A;  2N8G A;  2EK5 A;  4N4O B;  5FD5 A;  1PDN C;  5M5W J;  4CCL A;  5CVV A;  5E1Z B;  4Q5S F;  3E97 A;  1I6X A;  5BNG A;  5LLQ A;  1G3S A;  3ML6 A;  2RKH A;  1T08 B;  3CUQ B;  4UXN A;  3VB2 A;  3BLY A;  2YUS A;  3R0A A;  1XSD A;  1NHA A;  2B63 J;  4A3G J;  4NC7 A;  1GVD A;  2OU2 A;  2NS7 A;  1A35 A;  2GM4 A;  2FD5 A;  5J1U A;  3DPU A;  2KMU A;  5AIP A;  3L2V A;  5C4X J;  1P92 A;  3ZXS A;  3S2D J;  2FBI A;  3ERM A;  1Y0U A;  3ABM H;  2GXG A;  3MD2 A;  2M34 A;  4RGU A;  4M3G A;  3KYC B;  1EH6 A;  5JVG F;  5GP9 A;  3BTI A;  2ACJ A;  5LFA A;  1IUF A;  3SJM A;  3IAM 2;  2QM3 A;  2X6Y A;  3K0L A;  2V1N A;  2V7F A;  2PN6 A;  4FX4 A;  2KRH A;  2VT3 A;  2VKD A;  3QYB A;  2OCE A;  2KP6 A;  3CCV I;  1B8I A;  3ABT A;  2D2W A;  2Z16 A;  1FTT A;  1J59 A;  5EG0 A;  3GZ6 A;  3K4K A;  1Z6T A;  3OSF A;  3RPQ A;  2P7C B;  3CJQ B;  1BN5 A;  3CF2 A;  3HXL A;  4I7H A;  5AON A;  1AU7 A;  2DJN A;  1ZRF A;  2BBY A;  3JRG A;  3TQN A;  2V6E A;  1UJ8 A;  2LC2 A;  2CSO A;  1FIP A;  1OPC A;  3QOD A;  4ZH4 F;  2DTR A;  1X58 A;  1BI0 A;  2P6T A;  1Z9C A;  4DBQ A;  4P55 A;  2DOA A;  1HSJ A;  3BP8 A;  1S29 A;  3HPG A;  3ZMV A;  2E2J J;  2JA7 J;  3H3Z A;  1FOK A;  1PUF A;  2P6S A;  3LSG A;  2OPT A;  1J5Y A;  2BXZ A;  2A3S A;  1X1A A;  2EFP A;  4OU0 A;  1IW7 F;  4Q4Z F;  1OCC H;  2OD5 A;  3HKZ A;  3S1R J;  1LFU P;  4NBQ A;  2QZ8 A;  4Q47 A;  3AAF A;  3KP2 A;  3FMS A;  1GLN A;  1P2F A;  3E6D A;  1Y39 A;  2K9S A;  3S1M J;  1G59 A;  1K7A A;  2HQA A;  3P9I A;  3S3O A;  4AIH A;  4LK1 F;  4HSR A;  2HEO A;  2HVR A;  1C0W A;  1R5G A;  2K86 A;  3D5L A;  1JXS A;  2QYO A;  3I59 B;  3EQL F;  1LQ1 A;  1G2H A;  3DLA A;  4KJZ A;  3BR2 A;  5FLX Z;  2PQ8 A;  3KP7 A;  2DBB A;  4XLC A;  2PJP A;  1NK3 P;  2IXS A;  1FT9 A;  3QAH A;  2XPV A;  4BEH B;  4BHC A;  3CF5 F;  4DGW B;  4HDU A;  1BC8 C;  4WXD A;  2JN6 A;  4CCK A;  4CZZ A;  2NVT J;  1A31 A;  2DMN A;  1JGS A;  1RC9 A;  2JUG A;  2R7R A;  2B7E A;  1BR2 A;  2YR2 A;  3S93 A;  1U8R A;  2V4J C;  3OYI A;  3F22 A;  4A3B J;  3JRC A;  3ELK A;  2WTE A;  3FZV A;  2CQQ A;  1LE8 A;  2M0M A;  3LAP A;  2JRM A;  3GTM J;  1ITY A;  4G7O F;  2M3A A;  4UB8 C;  4XLF A;  1I1G A;  4WWC A;  1BR4 A;  2L4A A;  4U7B A;  4G6Q A;  2MH2 A;  1VQ4 I;  2PEX A;  2BY2 A;  4EJO A;  2XSJ C;  3BOQ A;  2ZJ2 A;  4RB1 A;  5LGN A;  1XDS A;  2Y9Z A;  3QRF F;  2Z99 A;  3HOW J;  4P96 A;  3TW6 A;  5IOZ A;  4I01 A;  5D8L B;  2OZU A;  3DBH B;  5D6E A;  5DDG A;  4BY7 J;  2LFB A;  4XKW A;  1V4R A;  2BE5 F;  4D7M A;  3Q0U A;  5CKT A;  4I76 A;  4Z2Y A;  4CIC A;  4E7S A;  2NAZ A;  4A5N A;  3GFJ A;  1KU7 A;  3MZH A;  3LQR A;  4A3K J;  3SZG A;  3FM3 A;  5DUK A;  3W6K B;  4ZZL A;  2EQR A;  2PLY A;  2IP2 A;  3PO3 J;  1YW9 A;  3GX4 X;  3FBI B;  3A1Y A;  4UB6 C;  4QLC U;  4W1U A;  1FBU A;  3BR3 A;  4V2G A;  4FX0 A;  5BPD A;  3RKW A;  2A6E F;  4IHX A;  4N9H A;  3GTO J;  3CCS I;  1FC3 A;  2WA0 A;  2R4G A;  3GTJ J;  5CLS A;  1HF0 A;  1AOY A;  1ZEL A;  3F9K A;  2Y30 A;  4PZJ A;  4F7Z A;  4EGZ A;  1B4A A;  3CJR B;  2DOD A;  1FTZ A;  2BY3 A;  1KU3 A;  2IT0 A;  1SD4 A;  4M3B A;  3QPL A;  1YYV A;  2HYG D;  1SVO A;  4IRI A;  4XKV A;  1JGG A;  2K5C A;  4P5O A;  2LRE A;  2Y48 A;  4PJN A;  1EV7 A;  2FOK A;  5F6F A;  2ME6 A;  3M1E A;  1UFM A;  3J81 K;  1DP3 A;  2X85 A;  3Q0W A;  1YQA A;  2UUZ A;  2XAG A;  3RQ4 A;  2IPQ X;  2ZNZ A;  2DDB A;  2VJI A;  2W84 A;  2ZC2 A;  3EDP A;  2X48 A;  4DW6 A;  1MIJ A;  1S5L C;  2XGD A;  1IV6 A;  1GXQ A;  3H5A A;  3OMY A;  1YJN I;  3RDI A;  2CRG A;  3D1N I;  1W7P A;  1ZRE A;  1I39 A;  1XMA A;  3GWZ A;  3N05 A;  5IP6 A;  4GCV A;  3WHC A;  3KLO A;  2EB7 A;  3VOD A;  4CUG A;  1GVJ A;  2HU9 A;  1FBQ A;  3BCA A;  2K02 A;  2L7M P;  2Q0O A;  5L3D A;  3ZRG A;  1XMK A;  3BDD A;  1XX5 A;  2W4S A;  3H0D A;  1CGP A;  4B44 A;  3G1M A;  1P7J A;  3ONQ A;  3C7J A;  1NTC A;  4PDK A;  3OV8 A;  5KK1 A;  3P9K A;  2GQQ A;  4WK8 F;  1CF7 B;  1D8J A;  4BJ6 C;  3CMA I;  3WTV C;  2EIL H;  3TDU C;  2DW4 A;  3DEU A;  3HSF A;  2E19 A;  3WGG A;  4XRS G;  1A36 A;  2E5Z A;  2W1O A;  2XDV A;  3AG3 H;  1SFO J;  3IH3 A;  1H8A C;  4EM2 A;  1XD7 A;  1QZE A;  2CQK A;  4DOZ A;  4G7H F;  2QKL B;  2R5Y B;  2I5U A;  2VC0 A;  1W4M A;  2QQA A;  1V3F A;  1IG7 A;  4GYI A;  3TOB A;  1KGS A;  3DP7 A;  1R7J A;  3FXO A;  1R22 A;  1X3W B;  1B6A A;  1X3Z B;  2DA2 A;  3F8B A;  3CMY A;  1UHW A;  2L4M A;  4HV6 A;  4F91 B;  2AQE A;  5F0F A;  2VLA A;  1IDZ A;  2HR3 A;  2R7S A;  2EZK A;  4IHY A;  2VE8 A;  4RS8 A;  3FWE A;  1FP1 D;  2J5P A;  1J7K A;  4M74 A;  1LEA A;  1RUN A;  1FYL A;  3S15 J;  1B59 A;  5E3N A;  1B8I B;  2HVQ A;  2VAS A;  3ECO A;  2JSP A;  5J1Y A;  3OYF A;  3CCJ I;  1K79 A;  2KJC A;  2XUB A;  2ZKZ A;  3DXJ F;  4BE0 A;  5D5U B;  1ZG1 A;  2X1E A;  4I99 C;  2P7V B;  3WU1 B;  2D45 A;  2R7Q A;  5EGO B;  1ERD A;  1D0Z A;  4S05 A;  3BPV A;  4E7H A;  3K1N A;  3ZQC A;  3N97 A;  3MZY A;  4EV0 A;  2RVC A;  4CXF A;  2VJ5 A;  2NYX A;  1PUF B;  2ICW G;  2BV6 A;  4A5M A;  5D4R A;  3IV5 A;  3IL2 A;  2IGN A;  5IPA A;  2DOE A;  2L9R A;  3M07 A;  2ME0 A;  4U0Y A;  3F21 A;  4LB5 A;  5FLV A;  5EZG A;  4L9T A;  4BNC A;  1PYV A;  1U9O A;  2F48 A;  4ANJ A;  4DZP A;  2AS5 F;  1MJ9 A;  3H3U A;  1MMD A;  1O7F A;  2K9L A;  5DCF A;  4IJA A;  3JRD A;  1FP2 A;  2W7N A;  1Q1H A;  5ILS A;  2GIV A;  3BC8 A;  2RRE A;  3EUH C;  3RTR A;  3HUG A;  3LSI A;  1OCR H;  3PM1 A;  4IKF A;  2VQL A;  4HW0 A;  4KYW A;  3FDY A;  2YPR A;  3QP6 A;  2K27 A;  2DK5 A;  2JQ7 A;  3FXK A;  4E7L A;  1U0J A;  1TWH J;  2J5O A;  1F1Z A;  3JR9 A;  1WSU A;  4D0P A;  4B3A A;  3CDI A;  3CLO A;  3QOP A;  2GBY A;  5GPA A;  3UKG A;  3JRI A;  1YJ9 I;  5B66 C;  2IJL A;  2DA1 A;  2WY8 Q;  2GOX B;  2OC6 A;  1T56 A;  1IN4 A;  2ELJ A;  5CVU A;  1RZ4 A;  4U0W A;  2IA0 A;  2WBM A;  2XB5 A;  1WJF A;  4KIF A;  1V5F A;  4IHV A;  1EF4 A;  4IQ4 A;  1MBG A;  2L3D A;  5GAH J;  1BI2 A;  1XB4 A;  2KIQ A;  1AHD P;  2A6T A;  3HYI A;  4HX7 A;  4DBR A;  5ICG A;  4X6A J;  3E5Q A;  4OOI A;  5HLI A;  5L3F A;  1PP7 U;  4MFE A;  4N0B A;  3ZQG A;  1RPW A;  5CQE A;  1K6Y A;  5J3L A;  2EA4 A;  3BZC A;  5EEH A;  3L1P A;  2FBK A;  3E6M A;  4FET A;  5IYC J;  3LQQ A;  3CCM I;  3BQZ A;  1Z6R A;  2FSW A;  1LDK B;  2MW8 A;  1J09 A;  1ZH5 A;  2O8X A;  5F1R A;  3B6C A;  4XRM A;  2KRC A;  3H5R A;  3I4N J;  4RGS A;  1K78 A;  1VQP I;  2LF7 A;  1SD5 A;  3S8P A;  2BY1 A;  1J9I A;  4C3H J;  3KLN A;  2DT7 B;  4M6V A;  1QPI A;  3TOA A;  2DT6 A;  4DYR A;  2JA5 J;  3CLQ A;  3IUO A;  4HF0 A;  5DD8 A;  3VYT B;  2XAF A;  4YEJ A;  3N4M A;  4EJT A;  4KDP A;  4EGY A;  9ANT A;  4LIU A;  1IUY A;  2DFE A;  3JAM Z;  3OYG A;  4HX8 A;  1WH7 A;  1UAA A;  6PAX A;  2AQF A;  1EJ9 A;  3FXR A;  1OKR A;  4G6T B;  4YFX F;  5F27 A;  2M8E A;  3FMR A;  1ZRD A;  2IGM A;  4AIJ A;  2FBH A;  3LA2 A;  3WU0 A;  2P4W A;  1B72 B;  1TT5 B;  1E17 A;  3QPT A;  5A2Q Z;  3FX3 A;  1W36 C;  4EAT A;  2H6B A;  3G3Z A;  4N9I A;  1R4M B;  2HOA A;  3ZMT A;  1JUP A;  4XM3 A;  1PVE A;  5HVQ C;  2RNG A;  2VOO A;  3K4C A;  1SFX A;  1N75 A;  3GW2 A;  1X1D A;  3EPZ A;  1IJW C;  5CPR B;  3IKV A;  1UHM A;  2ZJP F;  4ENK A;  1VND A;  2VKH A;  3H36 A;  3M7G A;  3MKY B;  4IF4 A;  4QWQ A;  4RMN A;  1TWC J;  2FU4 A;  1MNM C;  2LKP A;  1TL8 A;  3G71 I;  4LLN A;  4KMF A;  3GLL A;  4CCN A;  2ISZ A;  1RKT A;  5IOY A;  4QPQ A;  1OCP A;  5K5Q A;  3L2R A;  1FYK A;  2L5Q A;  1LFB A;  1TQM A;  2MC4 A;  2X51 A;  4ENM A;  5H20 A;  1TC3 C;  2IGK A;  3SFI A;  3G73 A;  3E6C C;  1JUS A;  1X2M A;  3GXO A;  1JE8 A;  3I59 A;  4ON0 A;  1YIT I;  3OYN A;  5HLH A;  4M3D A;  3VEP A;  1R49 A;  2AO9 A;  3CES A;  3F0C A;  4L9N A;  4AWX B;  3MKZ A;  5DCM B;  3RKQ A;  3F8N A;  4FAS D;  3REO A;  3FXJ A;  4CDG A;  3R0J A;  5B3S H;  4NB5 A;  4RAF A;  5LBQ A;  3QQA A;  1HOM A;  2V9V A;  1OYY A;  2MH9 A;  4XIC A;  3W6V A;  1T98 A;  4U87 A;  2EWN A;  1TW3 A;  3K4N A;  1UEL B;  3W2V A;  2JMW A;  4JYK A;  4Y52 J;  2EPF A;  2O3F A;  5D5V B;  1R71 A;  4XID A;  1HST A;  2V26 A;  1MMS A;  1TWG J;  3GZ5 A;  1WCM J;  3D5R C;  2L9N A;  3C2B A;  1HBX G;  4WX9 A;  4KN4 X;  1VQ7 I;  1FOW A;  1ETK A;  1H9G A;  1U5T C;  1SFK A;  4WXC A;  4PFO A;  1SD6 A;  2Y31 A;  2CUE A;  3HOT A;  4FHT A;  4AVZ A;  1VQ9 I;  3RYR A;  4OWR B;  2GA2 A;  4AUX A;  2EV6 A;  2QF7 A;  3Q9S A;  4R1H A;  5JLX A;  3CCE I;  2WAD A;  5E1X A;  3PIP F;  1Z05 A;  1WJB A;  2UWM A;  3OWT A;  3KEO A;  1RUO A;  3KYL A;  2UZK A;  1Y1V J;  3IAS 2;  1ZGW A;  1XGM A;  1U8B A;  3MCZ A;  4XQF A;  2EJR A;  2LMD A;  4CCO A;  3OOP A;  2DPD A;  2A5Y B;  5J4Y A;  3VPR A;  1WJ5 A;  3G1L A;  2XGX A;  3AG2 H;  2R0Q C;  2JPC A;  1QVT A;  4I0A A;  5EDN A;  3HGY A;  3L09 A;  2HXO A;  4HEA 2;  4K2E A;  4P9F A;  4ZYH A;  3S17 J;  3C1D A;  3K4L A;  3F23 A;  5K7Z A;  4D9J A;  5E3M A;  1QHG A;  1SAU A;  2VJ4 A;  3CO7 C;  3HOV J;  3SZP A;  2K3P A;  1ONV A;  3FM5 A;  2GOM A;  3BTJ A;  1I3A A;  2IW5 A;  4BKX A;  2YU9 J;  3LSJ A;  2VKV A;  4L5J A;  3RZO J;  1ETW A;  2VL8 A;  3KET A;  3PSI A;  4BAC A;  4XOP A;  4C9Y A;  2OBP A;  1FMW A;  2XV4 S;  1MSF C;  2Y2Z A;  2H27 A;  3QPS A;  2BHZ A;  4GFB A;  4UVC A;  3QU6 A;  1VQ6 I;  2F5E A;  4BU2 A;  1R1T A;  2HZT A;  3FHZ A;  1NK2 P;  3NAR A;  1QBJ A;  3WGH A;  3I4M J;  2O8K A;  4BQN A;  1ZHF A;  4IL6 C;  2VOP A;  2TRT A;  3HRM A;  2DK8 A;  3BG5 A;  3DF8 A;  5B5E C;  2GXA A;  1X4P A;  3DKX A;  4KIS A;  4I09 A;  4I02 A;  2FML A;  1WQ2 A;  2X6O A;  5K5O A;  4RM2 A;  4CCJ A;  3CCQ I;  1F4K A;  1R4N B;  1X3U A;  2H09 A;  4XSX F;  3OIQ A;  1K83 J;  4I98 B;  5E20 A;  1XPX A;  3IHU A;  1CF7 A;  1QVU A;  2K7L A;  2CFO A;  4CA0 A;  1I5Z A;  2HYJ A;  2WAF A;  2ZCW A;  1ZLJ A;  2BVL A;  2X9D A;  4RAY A;  2A5W A;  5LGU A;  1JKP C;  4BBS J;  1W1W E;  1W0T A;  1O3S A;  2DMU A;  1K78 B;  4RM3 A;  3DTK A;  3KIO A;  1I27 A;  3DLL F;  2PBI A;  3RI4 A;  4LIV A;  3MMY B;  1TWF J;  2R5Y A;  2CH0 A;  2DMQ A;  4DYC A;  3FXM A;  3T8T A;  1UG2 A;  4NC6 A;  2RN7 A;  2E34 A;  5HLT A;  3KP5 A;  3U9G A;  2RAE A;  3TGN A;  5LGT A;  1D1A A;  2UV1 A;  1YHQ I;  3LOC A;  1Z7U A;  5CQG A;  3H0G J;  4Y4R A;  1WJA A;  1V54 H;  4U0V A;  1JHF A;  2Z1D A;  4PJ0 C;  4L0Y B;  5CJ9 A;  1QU3 A;  1RET A;  3A02 A;  4EQQ A;  3EET A;  5BQT A;  3HRT A;  5HOO A;  3PL8 A;  2VQH A;  3UR3 C;  1RRJ A;  1J75 A;  5FRN A;  1S8N A;  2CYY A;  3SZT A;  4A93 J;  3ASO H;  1ZGJ A;  2VIX A;  1ZR4 A;  3HRS A;  2F5D A;  2HNH A;  3A0H C;  5EGO A;  3MWM A;  1JKO C;  4GGG A;  3WG9 A;  3RZD J;  2VBW A;  2R5Z B;  3VYR B;  4BBR J;  3OYB A;  4B8X A;  1O3T A;  3HBL A;  3A01 B;  1MBH A;  2JK3 A;  1U2W A;  2R7O A;  3TMO A;  2PMZ N;  4JK1 X;  1WRJ A;  2XF7 A;  4I2O A;  2XF5 A;  2Y69 H;  3GVA A;  3DFG A;  2OUM A;  1TT0 A;  5FKL A;  5HS7 A;  1RR8 C;  2E36 A;  5L3G A;  2L9S A;  3A4C A;  1I3Q J;  1DGW Y;  3CCR I;  2R93 J;  1LEB A;  2A69 F;  2XAS A;  1ZQ3 P;  1Z91 A;  2LRD A;  4HYE A;  3JSO A;  4KA4 A;  2EFO A;  2Z5U A;  5DTD A;  2CFX A;  2P0W A;  4A6E A;  3ZP5 A;  2MYS A;  4ZYA A;  3MFK A;  5IT9 K;  2Y0S A;  1U9N A;  3OR2 C;  3ZGK A;  1W36 D;  2KDZ A;  1OYW A;  2JJ7 A;  1LUJ B;  1DPR A;  4DNC A;  1SEU A;  1QPM A;  2NOG A;  4PCQ A;  5ED4 A;  3CC4 I;  4UV9 A;  2NXN B;  3KE2 A;  5KAI C;  5B1A H;  3R6S A;  1IN5 A;  1ZTR A;  4J19 A;  1T0F A;  2CS3 A;  3CZ6 A;  3VYS B;  4XN3 A;  4DYQ A;  1YE9 A;  1LJ9 A;  2MD0 A;  1R36 A;  4AYB N;  4AID A;  5HS8 A;  2ZXI A;  1VQN I;  1DDN A;  2XHK A;  1KON A;  4W97 A;  1ETY A;  5FGM A;  3FXU A;  4XBF A;  2ELH A;  4KUM A;  3OYA A;  2LOO A;  2HZD A;  3LSM A;  3CDH A;  1DGR M;  2M9H A;  4HLY A;  1MDM B;  1IGN A;  2CU7 A;  4RAZ A;  1YRN A;  2E7X A;  2W48 A;  2R7X A;  2PX9 A;  3BJO A;  4XRS A;  2CV0 A;  2YU3 A;  3F3X A;  4H4K C;  4C2U A;  4V19 K;  3F6O A;  1BC7 C;  3DU5 A;  1G3Y A;  4CYD A;  2OV7 A;  2ZBK A;  1RES A;  4J01 A;  1ZRC A;  1OR7 C;  1MJB A;  1MND A;  3DEW A;  1ZR2 A;  4NHJ A;  4EMS A;  3CMM A;  2F6C A;  1IN8 A;  1ZG5 A;  1Z77 A;  3OR1 C;  3M9A A;  4BH9 A;  1FSH A;  5C44 J;  1W5S A;  2MGQ A;  4NNJ A;  2QQ8 A;  2E60 A;  1BJZ A;  5H6R A;  4HNU A;  1Y8Q B;  3CCY A;  5B1B H;  4A12 A;  2WAE A;  3BTL A;  1P7I A;  2M7B A;  1BJA A;  2WV0 A;  1E2X A;  4RBO A;  4RA2 A;  4KFC A;  3E7L A;  3BTC A;  2JWT A;  3OY9 A;  4KT5 C;  3PUF A;  4HRI A;  4YG2 F;  3HOS A;  2VPL A;  4C3J J;  1APL C;  4LLL A;  1VQ8 I;  1IDY A;  2RC4 A;  4KN7 X;  5M3F J;  5F0C A;  1B72 A;  4A3I J;  1IO2 A;  2F5C A;  1WPK A;  4V2F A;  1MD0 A;  1KYZ A;  4ENJ A;  3I64 A;  3HDD A;  3FF5 A;  2MFZ A;  2FQ3 A;  3U2R A;  1SFU A;  4OAZ A;  3M3Y J;  3CP2 A;  3OL3 A;  2XIG A;  1X2N A;  5ILV A;  3FMQ A;  1XTA A;  2XRL A;  1STZ A;  4G8X A;  3CJT B;  1OJL A;  5GTI C;  4UVB A;  1TQI A;  1XG1 A;  2JTV A;  2KZG A;  2MLG A;  1V5G A;  3HRU A;  3GEZ A;  1P6R A;  4B48 A;  4FCY A;  1ZYR F;  3AG1 H;  2R7D A;  1KA8 A;  3OS1 A;  3T0Y A;  3AKZ A;  2L7F P;  4ZDP A;  3LA3 A;  1Z1D A;  4ZDL A;  5ILU A;  4B09 A;  1MW7 A;  5JHU A;  1A6I A;  3HPH A;  1MJA A;  2CW0 F;  3DWL E;  3KP4 A;  1YIJ I;  1IRZ A;  1TW2 A;  3PJR A;  2XC7 A;  3EYY A;  1KQ8 A;  5J8C A;  2LLK A;  2DMP A;  5HS9 A;  1WI9 A;  5EEG A;  1P9Q C;  3NQO A;  3EUK L;  4BQO A;  4A3F J;  2GIZ A;  2DA5 A;  2O03 A;  3COA C;  4BXU A;  4IHW A;  1M1E B;  4NDL A;  1MSE C;  4F93 B;  4EM0 B;  5DCM A;  4BXX J;  4GO1 A;  4BUP A;  3LFU A;  2WY7 Q;  3ZMD A;  4GRI A;  4M9S A;  1SAX A;  4LLG F;  3WHB A;  4ESB A;  2JUC A;  1D5V A;  1SMY F;  1T8I A;  3CME I;  2MSY A;  1BW6 A;  3J7A O;  2P8T A;  2JA8 J;  4JBA A;  3JRB A;  3S2W A;  1RKW A;  1U5T B;  2HTJ A;  3AL0 C;  2K85 A;  3RIR A;  1JT0 A;  2FRH A;  2VB6 A;  3OYJ A;  2A07 F;  2CV2 A;  1ZAR A;  2DXI A;  2L02 A;  1SAN A;  2CMP A;  2LY2 A;  1BA5 A;  4PK4 A;  2P5L C;  1YTY A;  3V7C A;  5FRM A;  3LMM A;  4OAY A;  2DYR H;  1OR7 A;  4JOM A;  4BDY A;  1Q1V A;  2W24 A;  3VDX A;  1AKH A;  3C3W A;  2K4J A;  2F4I A;  5ERI A;  3ZQ7 A;  4C3I J;  4BQA A;  3FXL A;  3JRE A;  4IX7 A;  2HQN A;  1R9T J;  1N77 A;  2TCT A;  3BZK A;  4UUT A;  1HKT A;  3M1C A;  2Y9Y A;  1D0X A;  3S3M A;  2DU9 A;  1LDJ A;  1UST A;  2DPU A;  2W00 A;  1HW1 A;  1MBJ A;  2CO5 A;  2FNA A;  1MMG A;  2K9Q A;  2LP0 A;  4E4H A;  3ABL H;  2HQR A;  1GDT A;  2H8W A;  2Q2E B;  5TJJ A;  3RKX A;  1YS6 A;  2DOF A;  1EKE A;  3U1D A;  1FLI A;  2CG4 A;  2ID6 A;  4BS9 A;  2JSC A;  2LTP A;  4PSX A;  5GAG J;  3VSK A;  4I0B A;  4B43 A;  3I9V 2;  4EJW A;  4XRF A;  2E1M C;  4ZC3 A;  5ICF A;  3B02 A;  3K70 C;  4A3M J;  2FMY A;  1U3E M;  2XAH A;  2M8G X;  4YIF A;  1EH8 A;  2ISY A;  1HKS A;  3UNG C;  3HHH A;  1TQP A;  2CUJ A;  4EM1 A;  1YX5 A;  1U78 A;  3P9C A;  3DQV C;  1ZLK A;  1SMT A;  2EV0 A;  4KNY A;  1D5Y A;  1JHH A;  4ENN A;  5M3M J;  1A5J A;  4P1W A;  2QEX I;  2V1U A;  4MLO A;  2X4H A;  5FJ8 J;  1JTY A;  5GPC A;  2H94 A;  2OA4 A;  2FF4 A;  2FA5 A;  2K40 A;  2DMT A;  2Y0S N;  4E7K A;  2G0E A;  4IPA A;  1ETO A;  5IYD J;  2LR8 A;  3IRQ A;  3C2H A;  4NC8 A;  3DKY A;  3KEY A;  1BOB A;  4E7Z A;  3V8L A;  5HOD A;  3J80 K;  1ETV A;  1WGX A;  2AXT C;  4LFU A;  1FX7 A;  3NWS A;  4M3F A;  4IZZ A;  5F0H A;  1YRN B;  2MAB A;  3JTG A;  3LA7 A;  4B47 A;  1TP4 A;  3BG6 A;  1YX3 A;  3IC7 A;  3HB9 A;  3QWL A;  4FT8 A;  5HLG A;  4MTD A;  4M3E A;  5J47 A;  2VJJ A;  2H6C A;  1SVL A;  3W2A A;  2VXZ A;  1HW5 A;  2EA2 A;  1Z0X A;  2EZL A;  3S32 A;  3MVP A;  2STW A;  1USS A;  3S1Q J;  2EZI A;  3J81 Z;  3CC7 I;  1WVR A;  5H2F C;  3D5S C;  3WTU C;  2OTL I;  1OCT C;  4CGZ A;  1GHC A;  1RIO H;  5DEQ A;  4B4C A;  4ZZD A;  2PJR B;  1ZN2 A;  2MBF A;  3IRR A;  1O3R A;  4O6J A;  2P81 A;  4RB0 A;  1QRY A;  5E1W A;  3BZ6 A;  4KIB A;  3IP4 B;  1VQK I;  5IT3 A;  1S9H A;  1T39 A;  5LHH A;  2QA4 I;  1E0E A;  4B3X A;  2CJJ A;  3E5U A;  2NVU B;  1JKQ C;  3LNQ A;  5CVR A;  3HHG A;  3GTL J;  4HZF A;  1R1U A;  3MKW B;  2VUM J;  4UY8 I;  3K1M A;  1E3O C;  3K1P A;  3J7Y J;  4OMZ A;  1NH3 A;  4RGX A;  4XKB A;  4GDF A;  2FX0 A;  3F8F A;  5AIQ A;  5K1Y A;  5EYR A;  3ULQ B;  1OYI A;  2VQC A;  4M71 A;  2PMZ A;  3L2W A;  1FWZ A;  4PGG A;  2D5V A;  4RLQ A;  4PGH A;  3B6A A;  4XLN F;  3LAJ A;  3ZR8 X;  2R5Z A;  4LJZ F;  5HDN A;  2CV1 A;  2QGU A;  3JW4 A;  1DPU A;  3ZN0 A;  2DT5 A;  2KPM A;  4XLE A;  3A01 A;  2ZFW A;  4A6D A;  2BYV E;  2MLK A;  2FEZ A;  2P5V A;  2IS6 A;  2YSR A;  3EUH A;  1O7L A;  1GV2 A;  3I58 A;  1ZG3 A;  4JX4 A;  4MO7 A;  1UB9 A;  5E3L A;  5BOX A;  5J40 A;  4RB3 C;  1HDD C;  5E3O A;  1Z21 A;  3I53 A;  3K69 A;  5JHF A;  2LYC A;  1TBX A;  4DQ2 A;  2HWV A;  4HX4 A;  4QSH A;  1JJ8 C;  1UMQ A;  2ZME C;  3BCB A;  2LK2 A;  3OS0 A;  3CO6 C;  1MNE A;  4G6D A;  4NUB A;  3OIP A;  3GO5 A;  2GZW A;  1TLH B;  4HST A;  3SQN A;  1MH4 A;  1LB2 A;  2VT2 A;  3GF2 A;  2A61 A;  1LFP A;  1S7E A;  2R7V A;  2E1O A;  3TBI A;  4AYB A;  3FKI J;  2QUF A;  2DLL A;  2JZY A;  4BL0 B;  4DJA A;  4F55 A;  3O6B B;  1A04 A;  4GXO A;  4Z6Y A;  4UNO A;  2R92 J;  2ZXW H;  4A3L J;  4C2T A;  4H0E A;  2HQ5 A;  3FK6 A;  2VON A;  2BHY A;  2OJE D;  2X6X A;  3LSP A;  2RQQ A;  1YS7 A;  2CW8 A;  4N4N B;  1VI0 A;  3PFI A;  2A68 F;  3S14 J;  3VYU B;  1IRG A;  4XL9 A;  3JRH A;  3GTK J;  3ZMS A;  5L3C A;  2LSO A;  2DAO A;  3I71 A;  2L54 A;  3GZN B;  3KP6 A;  1XCV A;  4HV5 A;  3J7Z I;  3SDG A;  1MDM A;  1YFH A;  3S16 J;  2M2E A;  1R00 A;  1AKH B;  5E79 C;  3M8F A;  2ZB9 A;  4A0Y A;  1T38 A;  4L0Z B;  1L0O C;  3KYD B;  3R60 A;  3V8J A;  1XGO A;  4QPO A;  2QBY B;  1KQ9 A;  3WTT C;  3HG9 A;  4KIT B;  1IXR C;  2MG4 A;  3SHF A;  1X1C A;  2COB A;  4BJT A;  1IXS B;  1QNT A;  3Q5F A;  2QSG X;  2QLZ A;  2QQ9 A;  4L5I A;  3OL4 A;  5FLX K;  2OAZ A;  3HOY J;  4YII A;  2M0C A;  2ZJR F;  1PP8 F;  2Z9O A;  2ZNY A;  4UUS A;  2UXN A;  5GAD J;  3FIS A;  2JT1 A;  1G6N A;  4Y7N J;  3OYK A;  2CQX A;  1O3Q A;  1FMV A;  4EJV A;  3CC2 I;  2ETH A;  1B1B A;  3NAU A;  2GWR A;  2O0Y A;  2EIM H;  2JVG A;  1MH3 A;  5LRR A;  1WFX A;  1K61 A;  4WXH A;  1BI3 A;  2IVM A;  4IRG A;  3BJ6 A;  3CP8 A;  4OIN F;  3E0J B;  4HDV A;  2EFQ A;  3H35 A;  3ZOB A;  2ZSI B;  5F08 A;  2E2I J;  3QYF A;  1BBY A;  3P5J A;  1D1B A;  1HA8 A;  1WKM A;  4HNT A;  4XK4 A;  3MAJ A;  2BW3 B;  3GLX A;  4MGR A;  3WE3 A;  2H8R A;  5BPI A;  2KL4 A;  1ZAO A;  1S72 I;  1MBK A;  4BGD A;  5M5X J;  3OSG A;  2NVX J;  2IEK A;  1HCR A;  1B9N A;  3ZCO A;  4E6K G;  4M9X A;  4MEY F;  4JP0 A;  2X6W A;  1H89 C;  2Z2S B;  1VZ0 A;  1TZL A;  1YIO A;  3GBG A;  1BIA A;  2YX4 A;  3S1N J;  4CYC A;  1YI2 I;  2DI3 A;  5FKN A;  1S3J A;  2IRF G;  4OIR F;  2PFB A;  1IAW A;  1FOX A;  1WWX A;  2CUF A;  4LG3 A;  2H1L A;  3IH4 A;  3I0T A;  3H1C A;  3LSR A;  2BXY A;  3I56 I;  5L3E A;  2ZME A;  4OIP F;  2CGP A;  3ERE D;  5J8F A;  1WZ2 A;  2AXL A;  3T8R A;  4P9U A;  2R7Z J;  1ZK8 A;  4AIK A;  1DQU A;  3I3L A;  2QSH X;  5J4V A;  2X0L A;  5K7H A;  2O7O A;  4PJJ A;  2BZT A;  2FUG 2;  5EEA A;  4BXF A;  1FPQ A;  3WTZ A;  1ON2 A;  4XR6 A;  3K70 D;  2UXX A;  3MN2 A;  4IEJ A;  3VWB A;  4C2M J;  1XS9 A;  2DA7 A;  3WE2 A;  3VFZ A;  1YW7 A;  3AL0 B;  2QEN A;  1HDP A;  4XOT A;  3TO7 A;  5FKK A;  1ZGA A;  4Y3O A;  2V6C A;  5CVJ A;  2KIS A;  3OIO A;  3OYL A;  4F3Q A;  2XRN A;  3KZZ A;  4CO8 A;  5C3E J;  2HOS A;  4PJL A;  1U5T A;  4EVI A;  1E3P A;  2CUZ A;  4PSW A;  4IHS A;  2G7H A;  3PNY A;  1FJL A;  3OYC A;  3SEZ A;  3BG7 A;  2M30 A;  3DBL B;  3M8E A;  4L5E A;  3WTX C;  2EV5 A;  3F8M A;  4CZC A;  3EUA A;  2X1D A;  4A3E J;  2PI0 A;  2VOD A;  1ULY A;  4D5C A;  2DQR A;  2D1V A;  5JI6 A;  5JLW A;  1XN7 A;  2KHM A;  2KRF A;  3BJA A;  2VQG A;  2EBI A;  5M5Y J;  3HTU A;  2O9L A;  3ABU A;  2V9P A;  3QPH A;  4S04 A;  2DYS H;  5E18 F;  2BY0 A;  3OYD A;  3F8C A;  1WH5 A;  3DTI A;  4EEF G;  4ZYD A;  3G1O A;  1P4A A;  5EZH A;  2YX7 A;  3CCU I;  2E71 A;  3HSR A;  2WB1 N;  3Q3S A;  2E1M B;  3IKT A;  5DUI A;  2Q2E A;  4IRH A;  3HZJ A;  2HS5 A;  1EH7 A;  4F92 B;  3HTS B;  3FK7 A;  5KCM A;  1SVM A;  3DBR B;  4BHP A;  2XVC A;  4E7I A;  3Q0V A;  4MTE A;  1X1B A;  1R5H A;  3L00 A;  5ICE A;  5ICC A;  2M4K A;  5LHG A;  4G9Y A;  1YLF A;  4DZJ A;  2EH3 A;  2ZXH A;  5IY5 H;  1H0M A;  1SD7 A;  3RSN A;  3V8K A;  2I10 A;  1RR7 A;  5FFZ A;  5EF6 A;  4IVN A;  1IRX A;  3DCF A;  1RI7 A;  3LWF A;  4M73 A;  3G2B A;  4LG0 A;  5JR3 A;  1F5T A;  2YS9 A;  2STT A;  1QHH D;  3QU3 A;  1ETQ A;  3A03 A;  4MIM A;  3KCC A;  3HOZ J;  3C18 A;  4XN0 A;  5K5R A;  3LST A;  3ZQI A;  3CTA A;  2DFI A;  3DKW A;  4PJM A;  1VQO I;  3G6E I;  3JRF A;  3BWG A;  1Z3X A;  3HGG A;  4Y15 A;  2XAQ A;  3DV8 A;  2XPW A;  3PUB A;  4OMY A;  1S7A A;  3H3V K;  3E5X A;  3WTY C;  2VBY A;  5LEJ A;  4U88 A;  3CCL I;  1ETX A;  4UHT A;  5FFX A;  1JKR C;  4RGR A;  2NS8 A;  1QZZ A;  2MD5 A;  4HNV A;  4C30 A;  2VBX A;  3I55 I;  4R79 A;  1H9T A;  4I6Z A;  1ZKG A;  2HXI A;  4JX6 A;  1JJ6 C;  2KKO A;  2KDO A;  1KZH A;  2F2E A;  3ZQH A;  4OIQ F;  3ASN H;  2ECC A;  3W3C A;  1R23 A;  1YW8 A;  2JVH A;  1D3Y A;  3GCM A;  3PNV A;  3GTQ J;  3WTW C;  2IBD A;  4D5F A;  5FD6 A;  2F4O B;  2CQN A;  4M72 A;  3R4K A;  1OCZ H;  4UUS B;  1XGN A;  3K4J A;  3E3V A;  3WTS C;  2E35 A;  2IS2 A;  4IXA A;  2PJR A;  1N25 A;  3GTG J;  1F9N A;  1X4O A;  2K3F A;  3H5N A;  3TO6 A;  3BQY A;  1BIB A;  2LD5 A;  2R7F A;  1MKM A;  4A69 C;  5E17 F;  2O61 A;  4LGW A;  4LOC A;  2MC3 A;  1JTX A;  2VKE A;  1PUE E;  3LL7 A;  2E1N A;  1OMI A;  3HOX J;  1DU6 A;  3QYE A;  1QGP A;  4HQM A;  1V5E A;  3ABK H;  3BY6 A;  1T33 A;  1K4T A;  3TL4 X;  4WF2 A;  3KZY A;  3CUO A;  1IC8 A;  1BI1 A;  2JRT A;  3DPL C;  1Z67 A;  2KIU A;  3BR6 A;  2DA3 A;  5D4S A;  2DTZ A;  3RCO A;  5D5X B;  1G3W A;  5D5W B;  2DA6 A;  4Y13 A;  3HL2 A;  2L7K A;  2BOL A;  2R7T A;  4ZYG A;  1ODD A;  3S3N A;  1I50 J;  1VTN C;  1AWC A;  4BY1 J;  4IHT A;  2MA3 A;  3ZQQ A;  3S2H J;  3C2G A;  2HPM A;  2V79 A;  1JT6 A;  1W5C C;  4OIO F;  2RQP A;  3K2Z A;  5KAF C;  1BL0 A;  3TO9 A;  4WCG A;  4MQ9 F;  3LSH A;  1OLT A;  2RNJ A;  3PIO F;  4CSW A;  2VC1 A;  1HKQ A;  2DCE A;  2E2H J;  4CYC B;  2ID3 A;  4II2 A;  1XGS A;  5IP9 J;  4LB6 B;  2LVS A;  2NVY J;  1XSX A;  3ZMU A;  1HXD A;  2DJI A;  5TRD A;  2IA2 A;  1K6O A;  4EJU A;  3GYH X;  1BOA A;  1LPQ A;  4HF2 A;  2ZME B;  2OTJ I;  2HYF A;  2LKS A;  3SYT A;  2F5F A;  3G4S I;  2Z33 A;  5DV5 A;  1T95 A;  3NRV A;  1E3H A;  3JAM K;  1XC5 A;  3RKY A;  2OQR A;  1CQT A;  2ZFU A;  3CDL A;  5CYV A;  1YG2 A;  2OZ6 A;  5JVT A;  1HLV A;  5FB2 A;  2W57 A;  3HM5 A;  1T2K A;  1EA3 A;  1LKX A;  1W5T A;  3X2Q H;  2LBF A;  4A0X A;  3TED A;  4BE1 A;  1VQL I;  1LVK A;  5A2Q K;  1V55 H;  2L7Z A;  2W85 A;  3IH2 A;  1XMX A;  3LFK A;  4BYY A;  4ESJ A;  1Y1W J;  3ZMZ A;  5HNH A;  1L3L A;  4LD5 A;  1IF1 A;  4KT6 A;  2V1X A;  4QTR A;  4QIW N;  3GUD A;  2W82 A;  5LHI A;  2HGC A;  4D1Q A;  2LY1 A;  2E7W A;  2ADU A;  1VQM I;  2XRO A;  4IOA F;  3O8G A;  5K7F A;  1UHS A;  4FQG A;  5DS9 A;  2RGV A;  1DP7 P;  5L3B A;  2FE3 A;  4LMY A;  3BG3 A;  2CQ7 A;  2VXD A;  3MQ0 A;  4XLA A;  2ZO4 A;  2XKP A;  1YJW I;  2IGO A;  1DUX C;  1S6L A;  4BDZ A;  1NG6 A;  2OQG A;  5LRS A;  3CUQ C;  5GAE J;  3RYP A;  4AVP A;  1U6G A;  3RJP A;  3L9F A;  3HSE A;  4G94 A;  1O4X A;  2EIK H;  2WAQ A;  1XDU A;  4FIS A;  2DFF A;  3H9J A;  2QBY A;  2DO7 A;  3H9Q A;  2XF6 A;  2FXA A;  4HPQ A;  1WJE A;  1KYW A;  1YOV B;  2I8D A;  1PJR A;  1RNL A;  3WG7 H;  4D7N A;  1IN7 A;  3CD6 I;  2BGC A;  2COM A;  1H88 C;  3O3K A;  4RDU A;  2GLO A;  4UVA A;  5IT9 Z;  5CVI A;  4CHU A;  4JQF A;  3H9G A;  2M5W A;  3ZQF A;  1WI3 A;  1AA7 A;  2IA1 A;  4ZJZ A;  5EG0 B;  3GFM A;  2DN0 A;  1FSE A;  4A0Z A;  4ZDO A;  3NEU A;  1F43 A;  2NOJ B;  1BM9 A;  4A3D J;  3HC7 A;  2IS4 A;  2A6H F;  2K4B A;  2VPR A;  4YRV A;  3OYH A;  3TP3 A;  3KEQ A;  4ESF A;  1FEX A;  4CH7 A;  1Z3Y A;  4S0H B;  4HAM A;  3FBN B;  2D1H A;  1BW5 A;  1R6R A;  2LDU A;  1GXP A;  3TKY A;  2FOW A;  1OIS A;  2QQB A;  4L18 B;  4RAG A;  3V42 A;  5KVR A;  3JRA A;  4Q48 A;  2Q8K A;  1GV5 A;  2ZSH B;  3FXQ A;  2KFD A;  3L7W A;  1HQC A;  5BMZ A;  4LG0 B;  1Z7L A;  3RPU A;  3BR0 A;  2BW3 A;  2L9V A;  1WHU A;  5KNL A;  4XON A;  4AD9 A;  5F64 A;  2GAU A;  1MBF A;  3HKZ N;  2HDW A;  2TDX A;  2M1B A;  1UZC A;  4E70 A;  4HG2 A;  1MMA A;  3AFH A;  4AM3 A;  1XCB A;  4A3C J;  1JI8 A;  2XB0 X;  2HDC A;  1ON1 A;  3D0S A;  2VI6 A;  1Y6I A;  4DIQ A;  1W0U A;  1G4D A;  4Y17 A;  2Y0M A;  2B9S A;  2O6G E;  1A6Q A;  3K7A J;  1POG A;  1WJC A;  2ZXJ A;  4AC0 A;  4ZTJ A;  3JTH A;  3FKJ A;  2CWE A;  2NNN A;  2P5K A;  1X19 A;  2XGE A;  1LE8 B;  3O2P E;  4IO9 F;  3HOU J;  3DEE A;  3ZPL A;  4BAY A;  1TTY A;  1G8X A;  3MKL A;  1IZ1 A;  3T1B A;  2ESN A;  3K4M A;  4KMU X;  4MNU A;  5J1R A;  2M87 A;  2M7A A;  1ORK A;  3WGI A;  3PNT A;  2LG4 A;  4XNF A;  4FE4 A;  5EJC A;  4XSZ F;  3I54 A;  4MEX F;  3PO2 J;  3T5X A;  3V7S A;  5F1J A;  1GUU A;  2KIF A;  2PMH A;  3K4B A;  4NQW A;  5DM7 F;  1T6S A;  1BR1 A;  3IWF A;  3ISP A;  2X1C A;  2GA1 A;  5KHD A;  1LVA A;  2LNB A;  2HPI A;  2NS0 A;  3BT9 A;  1W7P D;  2DQL A;  2L2O A;  1QA6 A;  2R7U A;  2AHQ A;  2BVM A;  3PSF A;  1Y56 A;  3DTE A;  3K10 A;  4XOR A;  2XGC A;  1QZY A;  1MZB A;  1Y0N A;  3QP5 A;  1FY7 A;  3CUQ A;  3PFY A;  2WWY A;  1WJD A;  4YFN F;  3V4G A;  4O5V A;  5LEK A;  1F36 A;  2NVQ J;  3JSP A;  2HDD A;  1FBS A;  4PUS A;  5HDG A;  4KIG A;  3GFL A;  1SC7 A;  2EFN A;  1MGT A;  2DFH A;  3H92 A;  4XLH A;  2L01 A;  3LSK A;  3FIW A;  3WOD F;  1OFC X;  5H6Q A;  4M6X A;  4HBL A;  4F52 A;  2ELK A;  1MMN A;  5DD4 A;  2WB1 A;  3TW7 A;  2A05 A;  1HW2 A;  1N78 A;  1TWA J;  4II3 A;  3ROU A;  4M6Y A;  3J7A Y;  2XAU A;  2VE9 A;  1GT0 C;  3SFZ A;  1P4W A;  3VOE A;  5TGT A;  1HC8 A;  4ITV A;  2K9N A;  1IXC A;  3HJE A;  3BR5 A;  3KX2 A;  2HOE A;  2DA4 A;  3U1K A;  3OS2 A;  1TNT A;  3F6V A;  3HEF A;  4G12 A;  2L0K A;  4FTH A;  1IRF A;  2FJ1 A;  1SFE A;  2EIN H;  2ECB A;  4HQE A;  2RV8 A;  3SEQ A;  2EZH A;  2KJB A;  5F04 A;  2HFH A;  3B73 A;  4ZTF A;  3SXY A;  2PG4 A;  1J0R A;  4B1R A;  1TNS A;  1W7P B;  2B0L A;  3Q9V A;  4L9J A;  2V1D A;  5JFR A;  2HI3 A;  5HNF A;  2XSD C;  3W6J B;  3F72 A;  2R3S A;  1D1C A;  4YFK F;  1OCO H;  2G9W A;  1B9M A;  2LBF B;  4E7J A;  3ZQL A;  5D8K B;  2BEO A;  4BHB A;  4A3J J;  1I1S A;  2JA2 A;  2EIJ H;  1YO5 C;  1KU9 A;  3SDB A;  1X1P A;  2ZJQ F;  2Z3Y A;  3KZI C;  1QO0 D;  1LDD A;  1UCR A;  5E8G A;  3U21 A;  4U7D A;  3CQZ J;  2E5N A;  1MBE A;  2KZV A;  4AU7 A;  2G7U A;  2LH9 A;  1VFC A;  4XMY A;  2DDA A;  3KP3 A;  2EFW A;  2WV1 A;  5LD2 C;  4BE2 A;  4BEH A;  3BR1 A;  2QKM B;  5E8I A;  5J6X A;  2M4G A;  3RPU D;  3HIF A;  1D0Y A;  4XLP F;  5FO5 A;  4UUV A;  1ACI A;  3KPH A;  1OQY A;  1LNW A;  2XPU A;  3L2C A;  3M4O J;  2LKX A;  1J2X A;  2Y75 A;  1KU2 A;  1D8K A;  4HLX A;  1R58 A;  4R8H A;  2NNY A;  4LIT A;  3AG4 H;  5C4J J;  1REP C;  3NWT A;  2LF8 A;  4FE7 A;  4A2U A;  3L2U A;  2HOT A;  3TDZ C;  1UG0 A;  5GTH C;  1I6H J;  2C6Y A;  3FHN A;  2M45 A;  4HA8 A;  2JPB A;  1FYM A;  5FKO A;  3I4P A;  2QSF X;  2OF7 A;  4IQJ A;  3W2W A;  3QOE A;  4RLF A;  3ECH A;  4YIR X;  2WAQ N;  3OOU A;  3GTP J;  3WU2 C;  5DM6 F;  3ESW B;  1K4S A;  3IWZ A;  4L9V A;  1VQ5 I;  5FKM A;  3OYM A;  5D6F A;  4ZYE A;  1FOY A;  5FLM J;  3I5U A;  4TV7 A;  4IOC F;  4Y33 A;  2KIM A;  3K6G A;  2V9K A;  3P7N A;  4G7Z F;  1FNN A;  2FQ4 A;  2K9M A;  5HDK A;  4UV8 A;  2XAJ A;  1VF9 A;  1Y8R B;  4PFP A;  1R5I D;  2GXB A;  3J80 Z;  3DPT A;  3GME A;  2NRA C;  3RQI A;  5TIS C;  3K9T A; 
#chains in the Genus database with same CATH homology
 4MFD A;  3O8H A;  3DCF A;  1DU0 A;  4C3H J;  4M6V A;  2YS9 A;  3WHB A;  1QPI A;  2JA5 J;  4DYR A;  1ETQ A;  1JUM A;  3A03 A;  9ANT A;  3BG9 A;  4MIM A;  2MSY A;  1BW6 A;  3HOZ J;  2JA8 J;  2LY9 A;  3JRB A;  1RKW A;  1WH7 A;  3ZQI A;  1JT0 A;  3JRF A;  5F27 A;  3HGG A;  2XPW A;  2H1K A;  1SAN A;  4ABZ A;  1B72 B;  1BA5 A;  3H3V K;  4JX5 A;  1ETX A;  2JA6 J;  2HOA A;  1JUP A;  1JKR C;  2NS8 A;  1Q1V A;  3TP0 A;  1AKH A;  4HNV A;  4C3I J;  4I6Z A;  3JRE A;  1ZKG A;  5IYB J;  1IJW C;  2HXI A;  4JX6 A;  1R9T J;  1FIA A;  1JJ6 C;  2TCT A;  4UUT A;  3ZQH A;  2ECC A;  2Y9Y A;  2QCO A;  1VND A;  3K2A A;  3GTQ J;  1MBJ A;  1TWC J;  2IBD A;  4D5F A;  2K9Q A;  2LP0 A;  1MNM C;  4UUS B;  1GDT A;  1ENH A;  2KT0 A;  4X1E A;  1RKT A;  5IOY A;  5IP7 J;  3GTG J;  2IAI A;  2N8G A;  2ID6 A;  3BQY A;  2LD5 A;  2LTP A;  1OCP A;  5M5W J;  4A69 C;  1LFB A;  4LOC A;  1JTX A;  1TC3 C;  2VKE A;  3SFI A;  5BNG A;  3HOX J;  4A3M J;  1JUS A;  1X2M A;  1DU6 A;  2M8G X;  1T33 A;  4M3D A;  2AO9 A;  2YUS A;  2B63 J;  4A3G J;  1IC8 A;  3F0C A;  1GVD A;  1U78 A;  3RKQ A;  3BR6 A;  2DA3 A;  2NS7 A;  2DTZ A;  2GM4 A;  1D5Y A;  2FD5 A;  5J1U A;  2DA6 A;  5M3M J;  5C4X J;  3QQA A;  1A5J A;  3S2D J;  1I50 J;  1HOM A;  4BY1 J;  4MLO A;  3S2H J;  1JT6 A;  4XIC A;  3W6V A;  5FJ8 J;  1JTY A;  5GPC A;  1BL0 A;  4Y52 J;  2JMW A;  4JYK A;  2M34 A;  4M3G A;  4XID A;  1TWG J;  5GP9 A;  3BTI A;  2K40 A;  2DMT A;  1IUF A;  2Y0S N;  3SJM A;  1WCM J;  3C2B A;  2G0E A;  2E2H J;  1ETO A;  5IYD J;  2LR8 A;  4CYC B;  1ETK A;  2ID3 A;  5HOD A;  5IP9 J;  1ETV A;  1WGX A;  2LVS A;  2NVY J;  1B8I A;  1FTT A;  4M3F A;  5EG0 A;  5F0H A;  1YRN B;  3OSF A;  2Y31 A;  2CUE A;  1AU7 A;  2DJN A;  3JRG A;  3HB9 A;  4AUX A;  2QF7 A;  5JLX A;  1FIP A;  4M3E A;  1X58 A;  1XC5 A;  3CDL A;  2E2J J;  2JA7 J;  1Z0X A;  1HLV A;  2EZL A;  1PUF A;  3LSG A;  1Y1V J;  2OPT A;  3MVP A;  3HM5 A;  1ZGW A;  3S1Q J;  2EZI A;  1U8B A;  1LFU P;  1OCT C;  3S1R J;  3TED A;  4B4C A;  2K9S A;  3VPR A;  3S1M J;  2L7Z A;  3G1L A;  3IH2 A;  1Y1W J;  2P81 A;  1QRY A;  2R0Q C;  1QVT A;  5EDN A;  3HGY A;  4QTR A;  4QIW N;  2HXO A;  3S17 J;  5K7Z A;  5E3M A;  1G2H A;  3BR2 A;  2CJJ A;  3O8G A;  5K7F A;  1UHS A;  1JKQ C;  5DS9 A;  3HOV J;  1NK3 P;  3LNQ A;  2XPV A;  3GTL J;  3BTJ A;  3BG3 A;  4BKX A;  2YU9 J;  3LSJ A;  2JN6 A;  2VUM J;  2VKV A;  2NVT J;  3RZO J;  2DMN A;  1E3O C;  1ETW A;  3I4N J;  4A3B J;  3JRC A;  1O4X A;  2FX0 A;  2CQQ A;  4FIS A;  1MSF C;  1LE8 A;  2Y2Z A;  3QPS A;  5EYR A;  4GFB A;  3GTM J;  1ITY A;  1NK2 P;  2D5V A;  3NAR A;  3B6A A;  3I4M J;  4D7N A;  2R5Z A;  2O8K A;  1H88 C;  4RDU A;  2Y9Z A;  2TRT A;  2GLO A;  3HOW J;  3TW6 A;  5IOZ A;  3A01 A;  3BG5 A;  3ZQF A;  1WI3 A;  4BY7 J;  5EG0 B;  2LFB A;  2DN0 A;  4D7M A;  3Q0U A;  4I76 A;  2X6O A;  1F43 A;  4A3D J;  1GV2 A;  4JX4 A;  2VPR A;  4MO7 A;  4A3K J;  5E3L A;  3TP3 A;  1HDD C;  5E3O A;  1FEX A;  2EQR A;  1K83 J;  3PO3 J;  4QSH A;  1JJ8 C;  1QVU A;  4S0H B;  1UMQ A;  2HYJ A;  2LK2 A;  1BW5 A;  2X9D A;  4W1U A;  3BR3 A;  4V2G A;  1JKP C;  4BBS J;  1W0T A;  3JRA A;  2DMU A;  4IHX A;  3GTO J;  1MH4 A;  1GV5 A;  1S7E A;  3GTJ J;  1HF0 A;  2E1O A;  3BR0 A;  2Y30 A;  3FKI J;  1TWF J;  2R5Y A;  4A3L J;  2R92 J;  2DMQ A;  4DYC A;  1FTZ A;  1MBF A;  1UG2 A;  3HKZ N;  2HQ5 A;  3FK6 A;  2RAE A;  4M3B A;  3LSP A;  3QPL A;  3LOC A;  1JGG A;  3H0G J;  4A3C J;  1VI0 A;  3S14 J;  2XB0 X;  3JRH A;  3GTK J;  2VI6 A;  2ME6 A;  1W0U A;  1RET A;  3A02 A;  3K7A J;  3SDG A;  1POG A;  3Q0W A;  4AC0 A;  3S16 J;  4A93 J;  2M2E A;  1AKH B;  2XGE A;  2X48 A;  1LE8 B;  4DW6 A;  2ZB9 A;  1ZR4 A;  3HOU J;  2XGD A;  3MKL A;  1IV6 A;  5EGO A;  1JKO C;  2MG4 A;  3RZD J;  5J1R A;  2COB A;  2CRG A;  3D1N I;  1ORK A;  2R5Z B;  4BBR J;  3HOY J;  4FE4 A;  3HBL A;  2M0C A;  3A01 B;  1MBH A;  5IP6 A;  2JK3 A;  3PO2 J;  3WHC A;  5F1J A;  1GUU A;  4UUS A;  2L7M P;  2PMZ N;  3FIS A;  4Y7N J;  2CQX A;  3G1M A;  1P7J A;  3NAU A;  5FKL A;  1NTC A;  3BT9 A;  1K61 A;  1MH3 A;  2AHQ A;  2XGC A;  1I3Q J;  2R93 J;  1ZQ3 P;  3ZOB A;  1F36 A;  5F08 A;  2NVQ J;  2E2I J;  2E19 A;  4XRS G;  2HDD A;  5DTD A;  1SFO J;  3IH3 A;  1H8A C;  4XK4 A;  1U9N A;  2H8R A;  3FIW A;  2R5Y B;  1OFC X;  2KDZ A;  2JJ7 A;  2NOG A;  1IG7 A;  1MBK A;  2NVX J;  2ELK A;  5M5X J;  3TW7 A;  2IEK A;  3OSG A;  1HCR A;  1TWA J;  1ZTR A;  4J19 A;  2DA2 A;  3CMY A;  1CQT A;  4JP0 A;  1IDZ A;  5F0F A;  1H89 C;  4DYQ A;  3GBG A;  2EZK A;  4IHY A;  1GT0 C;  4AYB N;  3S1N J;  4CYC A;  5FKN A;  4W97 A;  1ETY A;  2K9N A;  3BR5 A;  3S15 J;  2DA4 A;  5E3N A;  1B8I B;  2CUF A;  2M9H A;  3IH4 A;  1IGN A;  5J1Y A;  2CU7 A;  1YRN A;  3HEF A;  4G12 A;  2L0K A;  3LSR A;  4FTH A;  2W48 A;  2FJ1 A;  4XRS A;  2ECB A;  2EZH A;  5F04 A;  2R7Z J;  1ZK8 A;  5EGO B;  1RES A;  4B1R A;  5K7H A;  3ZQC A;  2O7O A;  2HI3 A;  3DEW A;  5EEA A;  2XSD C;  1ZR2 A;  1PUF B;  3MN2 A;  4IEJ A;  3IV5 A;  1Z77 A;  4C2M J;  5C44 J;  5IPA A;  1XS9 A;  3ZQL A;  2DA7 A;  2L9R A;  2MGQ A;  2ME0 A;  5FLV A;  1BJZ A;  1HDP A;  5EZG A;  4A3J J;  3CCY A;  1U9O A;  5FKK A;  3BTL A;  4DZP A;  1P7I A;  3OIO A;  3JRD A;  4RBO A;  3E7L A;  3BTC A;  2JWT A;  5C3E J;  3CQZ J;  2HOS A;  1MBE A;  4C3J J;  1APL C;  1VFC A;  1FJL A;  1IDY A;  2WV1 A;  3PM1 A;  3BR1 A;  5M3F J;  5F0C A;  1B72 A;  4A3I J;  4L5E A;  1WPK A;  4V2F A;  3HDD A;  1TWH J;  2XPU A;  3M4O J;  2LKX A;  3JR9 A;  3M3Y J;  4A3E J;  4B3A A;  1X2N A;  4D5C A;  2GBY A;  5GPA A;  2XRL A;  5JLW A;  5C4J J;  3JRI A;  3UKG A;  2EBI A;  4FE7 A;  2HOT A;  5M5Y J;  1OJL A;  2O9L A;  1I6H J;  1XG1 A;  2DA1 A;  1T56 A;  1WH5 A;  5FKO A;  2OF7 A;  4EEF G;  3G1O A;  4FCY A;  2XB5 A;  2WAQ N;  3OOU A;  3GTP J;  5EZH A;  4IHV A;  1EF4 A;  1MBG A;  2WB1 N;  3Q3S A;  2L7F P;  1AHD P;  1A6I A;  5FKM A;  4X6A J;  3FK7 A;  1IRZ A;  5FLM J;  4MFE A;  3ZQG A;  1RPW A;  2LLK A;  2DMP A;  3Q0V A;  5J3L A;  3L1P A;  2FQ4 A;  4A3F J;  5IYC J;  2DA5 A;  3BQZ A;  1VF9 A;  4DZJ A;  2EH3 A;  4IHW A;  2MW8 A;  4NDL A;  3B6C A;  5EF6 A;  2I10 A;  1RR7 A;  4XRM A;  1MSE C;  3RQI A;  4BXX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...