2NVTJ

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvtJ00
2DMNA 2ID3A 3ZQHA 3E7LA 5FJ8J 1FTTA 1NK2P 2LD5A 2DMPA 2CJJA 2XPWA 3HOUJ 5F08A 2JJ7A 1G2HA 1JTXA 5IOYA 1JKRC 1RESA 2HXOA 1FJLA 3LOCA 4A3LJ 2OF7A 2CQXA 3FKIJ 2AO9A 3VPRA 2WB1N 1SFOJ 3MN2A 1TWFJ 3Q0UA 2O7OA 2DA5A 1H88C 1IUFA 1X2MA 2JA6J 3JRAA 3RZOJ 4X6AJ 1S7EA 2X6OA 1ETOA 3HOXJ 3S2HJ 1W0UA 5EZHA 3Q3SA 4XIDA 2CUEA 1E3OC 1ITYA 5EGOB 4QTRA 1LE8B 4XRSA 5GP9A 5J1YA 3JRDA 4ABZA 3JRGA 1WI3A 3MVPA 5EDNA 1U8BA 1T56A 5IP7J 1MBHA 5M5YJ 2FJ1A 2JA5J 5FKOA 2DA2A 2L7MP 1QPIA 4I76A 5C4XJ 1IGNA 2HOAA 2XB5A 3RZDJ 1O4XA 4B4CA 2GLOA 5IYDJ 4BBRJ 1FTZA 1WPKA 3RKQA 2VKEA 4D7NA 1ZQ3P 3Q0WA 3HOWJ 5FKKA 1XC5A 2ME0A 4XICA 3HOVJ 1BW5A 1IC8A 4D5FA 3M4OJ 2FQ4A 1AU7A 3OIOA 3GTMJ 3WHCA 1HCRA 3S15J 2LK2A 2MG4A 2COBA 9ANTA 2CQQA 1WH5A 2W48A 5FKLA 3G1MA 5JLWA 2ME6A 1GT0C 2JWTA 1JKOC 2E2HJ 3JR9A 1GDTA 4BKXA 3GTLJ 4BY7J 2R5ZA 1LFUP 1OJLA 4M6VA 1BJZA 3PM1A 2OPTA 1ETYA 2LLKA 5FLMJ 1MBGA 2HDDA 4CYCB 1ETKA 4GFBA 2JA8J 4M3BA 3LSJA 4QIWN 1WH7A 2K40A 2ECCA 5FKMA 3I4MJ 1ENHA 1Z0XA 5F04A 3S17J 2FD5A 2E1OA 1TWGJ 2K9NA 5EG0B 2IEKA 2N8GA 1PUFA 1QVTA 2D5VA 2YUSA 1UHSA 1OCTC 5IYCJ 4B1RA 3HB9A 4FCYA 3TP0A 2I10A 5IOZA 3JRFA 4UUSB 2KT0A 1UG2A 2IBDA 1ETXA 1ZR4A 4C3JJ 3IH3A 4M3DA 5K7ZA 2O9LA 2YU9J 3TEDA 5F0FA 4FTHA 2H1KA 3JREA 1MNMC 1TWAJ 1X2NA 1TWHJ 1K61A 4AUXA 1QRYA 5K7HA 3ZQGA 2M9HA 5EYRA 1MSEC 3HDDA 3S1MJ 5C3EJ 1ZK8A 4MFDA 2NS7A 1P7IA 3S14J 1MH3A 2JMWA 4A69C 4DYRA 5IP9J 1UMQA 3A02A 3BTIA 2HI3A 2XB0X 3TW6A 2R7ZJ 2EBIA 2LTPA 3Q0VA 3S1NJ 2DA6A 1GV2A 1X58A 5IPAA 2ECBA 3BG5A 5IP6A 3RQIA 1TWCJ 4J19A 4A3JJ 3JRCA 1QVUA 2E19A 3K7AJ 1APLC 3GTOJ 1HDDC 4XRSG 1JKQC 1HDPA 2XPVA 2Y31A 2DMQA 2HQ5A 4XRMA 4C3HJ 4A3KJ 1EF4A 4S0HB 4RBOA 1GV5A 5F0CA 4CYCA 1GVDA 5M3FJ 4D5CA 1BL0A 2NVYJ 3CDLA 3MKLA 2ID6A 3OSGA 4A3BJ 4IEJA 2E2JJ 2Y2ZA 3GTQJ 1JT0A 2Y0SN 2XPUA 3LNQA 2WV1A 3G1LA 1T33A 4Y7NJ 2HOSA 2DA1A 2XGDA 3BTCA 3TP3A 1U9OA 5HODA 2R5YA 3S16J 2M0CA 5M3MJ 3S1QJ 4C3IJ 1B8IA 4MFEA 3HM5A 2TCTA 4X1EA 5E3MA 3GTJJ 4IHVA 2DMTA 2LP0A 4UUSA 3BG9A 2R92J 5IYBJ 1H89C 1U9NA 1RPWA 2DA3A 2Y9ZA 4B3AA 1A6IA 4RDUA 2GBYA 1RKTA 1Y1WJ 3HBLA 3HOZJ 1I6HJ 3ZOBA 4MO7A 1XG1A 3GBGA 4V2GA 1LFBA 2X9DA 2JK3A 3UKGA 3QQAA 1VI0A 3QPLA 4A3DJ 5K7FA 2R5YB 3BQZA 3CCYA 4NDLA 1JT6A 3LSPA 2X48A 3OOUA 2EZIA 3CMYA 3SFIA 3ZQFA 3HKZN 3IV5A 1PUFB 1IDZA 4IHXA 3BG3A 3BR3A 1B8IB 3BQYA 1RETA 1SANA 3LSGA 3D1NI 1HF0A 2DA7A 2VUMJ 4M3FA 4A3EJ 1U78A 4W1UA 1GUUA 3K2AA 2HYJA 5C44J 2LVSA 2LR8A 4FE4A 5BNGA 2LKXA 2HOTA 4JX6A 5J1RA 2DMUA 1AKHA 2CU7A 3S1RJ 1FIPA 1DU6A 3H3VK 5GPCA 4C2MJ 4LOCA 3H0GJ 1ZKGA 1JKPC 4A3GJ 1K83J 5EG0A 1JTYA 3BTLA 4M3GA 2G0EA 3C2BA 3M3YJ 3NARA 4L5EA 3O8GA 5EZGA 1MSFC 4BXXJ 4DYCA 1Y1VJ 2WAQN 3PO2J 2LFBA 4BY1J 3A01B 4Y52J 3F0CA 1FIAA 5F0HA 2E2IJ 1W0TA 1MBJA 4FE7A 4V2FA 3I4NJ 4MLOA 1Z77A 1JUMA 1NTCA 2TRTA 3B6AA 2VKVA 1VF9A 3IH2A 5E3LA 2RAEA 3S2DJ 1A5JA 5J3LA 4JP0A 2H8RA 5E3NA 1BA5A 2DTZA 3WHBA 1I50J 2IAIA 2KDZA 4AYBN 1WCMJ 3SJMA 4JX5A 3HOYJ 2VI6A 4A3IJ 2L9RA 5M5XJ 1IG7A 1ETWA 2Y30A 2R0QC 1HOMA 3FK6A 3LSRA 2R93J 1CQTA 4A3CJ 3FIWA 1MBEA 2L7FP 5F1JA 1JJ6C 1JJ8C 1JUPA 1B72A 3GTGJ 1ETVA 2DA4A 5JLXA 5F27A 2K9SA 1H8AC 3QPSA 1AHDP 1P7JA 2LY9A 1IDYA 4DW6A 4IHWA 4M3EA 1JUSA 3HEFA 4W97A 3A01A 1TC3C 1POGA 1ZGWA 1IRZA 1LE8A 2YS9A 3DEWA 5FKNA 1ORKA 2MSYA 2L7ZA 3ZQIA 2XGCA 4IHYA 1YRNB 2XRLA 3FK7A 2K9QA 2R5ZB 1XS9A 3PO3J 2AHQA 2ELKA 1R9TJ 4DZPA 1BW6A 2L0KA 1MH4A 1B72B 3IH4A 1OCPA 3BR0A 2MGQA 2HXIA 3NAUA 3GTPJ 2NVQJ 4EEFG 2EZHA 3JRBA 3A03A 3FISA 1MBFA 2CRGA 1NK3P 1FEXA 3G1OA 3TW7A 2M34A 2VPRA 1DU0A 5J1UA 2Y9YA 4A3FJ 3HGYA 2EZLA 5EEAA 2PMZN 1IV6A 4JX4A 1F36A 5GPAA 3JRIA 4XK4A 2NS8A 2NVXJ 3BT9A 1WGXA 3O8HA 4I6ZA 2NVTJ 4A3MJ 1I3QJ 3CQZJ 2P81A 4A93J 5DS9A 5C4JJ 4UUTA 1OFCX 4JYKA 3OSFA 1JGGA 1ZR2A 1AKHB 4D7MA 3BR1A 3JRHA 2DN0A 3BR2A 3BR5A 1ETQA 3DCFA 1YRNA 2M2EA 2O8KA 1ZTRA 2CUFA 3BR6A 2NOGA 4DZJA 2QF7A 4FISA 4G12A 4HNVA 1RKWA 2GM4A 5DTDA 1HLVA 2B63J 2JA7J 5M5WJ 3HGGA 2EH3A 4AC0A 2EZKA 2XSDC 3L1PA 2FX0A 2MW8A 3BTJA 5FLVA 4BBSJ 2EQRA 1D5YA 5E3OA 3W6VA 3GTKJ 1F43A 3ZQLA 3ZQCA 4QSHA 5EGOA 2ZB9A 1MBKA 5EF6A 4DYQA 2XGEA 4MIMA 1VFCA 1RR7A 2QCOA 1VNDA 2JN6A 3SDGA 1Q1VA 3B6CA 1IJWC 2DJNA 2M8GX
chains in the Genus database with same CATH superfamily
4AYBA 2ID3A 4RAFA 3E7LA 4AM3A 2FMLA 3U2RA 2LD5A 4Y3OA 2CJJA 3IP4B 1QA6A 2IT0A 1G2HA 2R7QA 3W2AA 1ZELA 3SZPA 2HXOA 1FJLA 3IRQA 1I5ZA 1T0FA 3IL2A 4UNOA 1D0ZA 3QPHA 3S32A 4AIHA 1WSUA 2VB6A 3GLXA 4BYYA 3FKIJ 3D5SC 3VYSB 3IAS2 3E6DA 3MN2A 4UB8C 2QSGX 4M9SA 1SFXA 2HNHA 3ZMVA 4L9VA 3OYHA 1DPRA 5AIQA 4PGGA 1H9TA 2X6WA 2QBYB 3E0JB 1X2MA 3N4MA 1FY7A 4KJZA 3RCOA 3F9KA 2EFQA 5E1ZB 1S7EA 5ICCA 3K4LA 1SFKA 4XIDA 2CUEA 1E3OC 3MEXA 5EGOB 4KA4A 4QTRA 2BE5F 1LB2A 2E1MC 4UV8A 3GFLA 5ILVA 2K4JA 4JOMA 4ABZA 3BPXA 3FXUA 3MAJA 1Z6RA 3JRGA 4PUSA 4XLNF 1V54H 3WTSC 5HLTA 2XF6A 5JHFA 5FROA 2M0MA 4HF1A 3K4MA 1LPQA 1IGNA 5HS8A 1O4XA 4P5OA 1IUYA 1W1WE 5CKTA 5IYDJ 2F5FA 4BBRJ 3L2VA 2AQEA 2PEXA 2UV1A 4U7BA 1S5LC 3HZJA 4XICA 2WY7Q 2LDUA 4PJJA 4D5FA 1AU7A 3F23A 1FBSA 3H1CA 3U9GA 1HW1A 1OISA 1Y0UA 4ON0A 3ZMDA 3VODA 1Z91A 3J81Z 5E79C 2ZJQF 2BVMA 2W48A 5FKLA 1LEAA 5JLWA 5J47A 3RYPA 2JTVA 4B3XA 4BXUA 4DIQA 1GT0C 1Y0NA 3H5RA 1JKOC 1AWCA 1YX5A 1G3YA 2ELJA 2HYGD 1X3WB 1LFUP 1OJLA 1ZGJA 3LFUA 4RMNA 1ETYA 4L18B 2PQ8A 2V6EA 2LF8A 1MBGA 3FDYA 1TQMA 2HDDA 2JA8J 4M3BA 4QIWN 3OYMA 1OLTA 2K40A 3ABLH 2ECCA 2BY0A 3I4MJ 2EINH 3TO7A 4YFNF 1ZG5A 1MMDA 1S7AA 4AIDA 2FD5A 3RKYA 2OU2A 2K9NA 4XORA 2IEKA 2L7KA 2TDXA 1E0EA 1G3TA 4WK8F 4XOTA 2D1HA 4RGSA 1IXCA 4MNUA 1OCTC 3ABKH 3HB9A 3HTSB 4UUSB 1OCZH 5J4VA 2KT0A 1A31A 1I27A 3K4NA 1JHFA 1ETXA 4C3JJ 2O9LA 5K7ZA 2W85A 1LDJA 1YTYA 3K70D 4PGHA 2LKPA 4LB6B 4IF4A 4I2OA 1QRYA 2EFNA 5CLSA 3ZQGA 2K27A 3KYDB 3AG1H 1Z9CA 1OR7C 2DOAA 2WB1A 1ZK8A 1HQCA 1SD7A 3IWZA 4LFUA 4Y13A 3KE2A 2VJ5A 1DDNA 4IQJA 2JMWA 2W4SA 3KZIC 2NS0A 2HVRA 2P6SA 2DODA 3DPUA 1UFMA 2PBIA 3VDXA 3BTIA 4XN3A 3JAMK 3OYEA 2OTLI 4CGZA 4UUVA 4LIUA 5DD4A 5D8LB 3Q0VA 3S1NJ 2O0YA 4XKWA 2ECBA 2GOXB 4RAGA 5IP6A 1KZHA 2X1CA 5E8IA 3JRCA 4G7ZF 3GTOJ 2BHZA 1FYLA 3LAPA 4XRSG 1XGOA 1JKQC 1ZRDA 2M5WA 3ZMTA 2JUCA 4FT8A 3CCEI 4ENJA 4D0PA 4E7JA 5LD2C 4IVNA 1MNDA 2R7DA 2IGMA 4F92B 1R1TA 1PUEE 1R1VA 3JTGA 2VXDA 1MDMA 3KP7A 2NNYA 4G7HF 4CYCA 3SEQA 1GVDA 3CF5F 3M1CA 3FM5A 2NVYJ 1X3ZB 1BL0A 2L9VA 2L01A 2E2JJ 2Y2ZA 3CUOA 3TL4X 4IZZA 1LEBA 4Y7NJ 1R23A 3KLNA 2DA1A 2XGDA 3TP3A 1HSTA 1TTYA 5CVUA 2BV6A 4C3IJ 1B8IA 2CMPA 3GVAA 2LSOA 3HM5A 2OJED 2L2OA 4X1EA 5E3MA 3CO7C 4E7SA 1U3EM 1YJNI 2HZTA 3JSPA 1UAAA 1ZREA 3KIOA 2DA3A 3UNGC 2XV4S 2CV1A 3L2WA 2GBYA 4E7LA 1Y8QB 2COMA 1ZARA 2XASA 1XG1A 4V2GA 4HF0A 4NC6A 3WTYC 4CHUA 1IF1A 3HPHA 4IL6C 2QKMB 2VL8A 1YITI 4KFCA 2UXXA 5H2FC 3BZ6A 5GAEJ 3QPLA 4A3DJ 3EYYA 3BOQA 1XSDA 1VQ5I 3JSOA 4JQFA 1DPUA 1MJAA 2EFWA 1R1UA 3K1PA 2X48A 3OOUA 5EEHA 5JHUA 4WCGA 2EZIA 3FM3A 3SFIA 2ZC2A 2WAQA 2Z5UA 1PUFB 1IDZA 1VQLI 3BG3A 3K6GA 1B8IB 5JVTA 1RETA 2XAJA 2Q1ZB 4N0BA 1USSA 3NRVA 1HF0A 4ETSA 3I64A 3I5UA 2KISA 2QSFX 5HLIA 4YIFA 4N4OB 4BS9A 4A3EJ 1U78A 4W1UA 5BPDA 2E7WA 2HZDA 2MH9A 1DUXC 1GUUA 1WHUA 2M7AA 3K2AA 2ZNZA 1UZCA 5C44J 2LVSA 2A5WA 4OAYA 2LKXA 2NVUB 1PDNC 4DJAA 5J1RA 1S7OA 1FSEA 4CXFA 3S1RJ 3H3VK 1TLHB 4ITVA 3H0GJ 5D6FA 4FX0A 4EATA 4A3GJ 3TDZC 4MQVA 2RQQA 5EG0A 1BOBA 4NC7A 1YOVB 5CVJA 3IHUA 2M1BA 3BWGA 2O6GE 1RR8C 3DBRB 1QQIA 1X1BA 4AU7A 2DQLA 1G3SA 1K79A 3HKZA 3PO2J 2K7LA 3K2ZA 3A01B 2HDWA 5L3BA 1XX5A 2LF7A 1ZG1A 5FD5A 2E2IJ 2VPLA 2Z9OA 1FP2A 2W82A 4L9TA 4XRFA 2HS5A 1G4DA 2GIVA 3GX4X 3S3NA 3S2DJ 4OMYA 1ZRCA 1HBXG 5J3LA 5K5QA 1BA5A 2K3PA 1I50J 1O7FA 4NUBA 2HKOA 2HQRA 2E36A 4JX5A 3HHHA 3I58A 3HJEA 2L9RA 3GCMA 1XDSA 2A68F 2XRNA 2I5UA 3FHNA 2CQKA 4IX7A 5BOXA 4XNFA 3IKTA 3QYBA 4A3CJ 2MFZA 1HKQA 1J59A 4LLNA 4YIRX 1MBEA 2L7FP 2DBBA 2EIKH 4KMUX 5F1JA 1D3YA 3K1MA 1ETVA 5ICFA 2CO5A 2QBYA 3O3KA 4C2TA 2K9SA 3BCBA 1IDYA 5HNHA 4BAYA 4XSZF 4M3EA 3I4PA 1PYVA 1IV8A 4B43A 1EH6A 4GRIA 2YX7A 3A01A 1PVEA 1TC3C 1ZGWA 3P7NA 3HUGB 4YRVA 2V1UA 4WXDA 1FLIA 1R4NB 2ZFWA 2B9SA 3TKYA 4BHCA 1ORKA 3CCRI 3R0JA 2OTJI 1SD5A 3LWFA 3RSNA 4LB5A 3PUBA 3LSKA 1U2WA 4RLFA 1H9GA 2K9QA 2DLLA 1R9TJ 4DZPA 5HVQC 2PMUA 3H9QA 3IH4A 2VQGA 5LHIA 1K4TA 4AIKA 2HXIA 3NAUA 1F5TA 2VC0A 1HKSA 3E5XA 4EEFG 3JRBA 3SHFA 4HDUA 4XLEA 3VFZA 3OWTA 2Y69H 4J01A 3FISA 2BXYA 4E7KA 4BDYA 1H0MA 4M73A 1FEXA 1OR7A 3S8PA 2M34A 2Y0MA 4RB3C 2P5VA 1DU0A 1JI8A 3RPQA 4HG2A 2DFHA 3KPHA 2PMZN 1XDUA 3QAHA 5GADJ 1RC9A 1F36A 3NEUA 2NS8A 2NVTJ 1WGXA 2OC6A 1D1BA 4F7ZA 1I3QJ 2CV0A 4CA0A 3CQZJ 5DS9A 3A1YA 4XLPF 3VEPA 2ICWG 4HEA2 3AAFA 3ZCOA 2J5OA 3R61A 1OFCX 3EUHA 4JYKA 3H35A 5J6XA 1ZR2A 2OZ6A 1QBJA 2PJPA 4D7MA 2VQCA 1IN8A 3BR2A 3BR5A 4WX9A 1KYWA 3LQQA 2CUFA 1Z1DA 1T6SA 2YSRA 4NBQA 4YEJA 2QF7A 2XVCA 2YPRA 3SZGA 3BG6A 1NH3A 3H5AA 5DTDA 3WTVC 4HNUA 2JA7J 2F5DA 3T8TA 2EJRA 4WWCA 2MABA 3EDPA 4A5NA 5IT9Z 2EZKA 2XSDC 2QYOA 4M72A 1R7JA 4UVCA 3V7RA 2MW8A 4ZTFA 4BBSJ 4XKBA 3GFIA 3CESA 1VQOI 3ZQCA 4QSHA 1T98A 3QODA 1MBKA 3BCAA 2LBFB 1X1DA 5EF6A 4DYQA 1YIJI 1QNTA 2BY1A 1RR7A 4N9IA 2QCOA 2IS4A 2JN6A 2X6XA 3SDGA 3C18A 2DJNA 3I9V2 2M8GX 4L5JA 4GXOA 1MJ9A 4U0WA 2O8XA 1R5HA 1TT5B 3O2PE 1BIAA 1KU2A 2L3DA 1NK2P 3ZMSA 2M7BA 2XPWA 3HOUJ 3ONQA 2KL4A 1YQAA 1JTXA 2Z33A 4P96A 4P9FA 1YE9A 5TGTA 1JKRC 3CCSI 1I6XA 4HV5A 1WJDA 2LRDA 4GDFA 2OF7A 2KP6A 1S8NA 1QZEA 1SFOJ 2EIJH 1TWFJ 4NQWA 4CSWA 3H3ZA 1V4RA 2DA5A 1H88C 4UXNA 4HQEA 1XCBA 2WA0A 3JRAA 3WU2C 5LEKA 2FOWA 2BY2A 3ABMH 3AG4H 3V7CA 1Z7LA 2V9VA 4UV9A 4BEHA 4G9YA 5EZHA 1X4OA 1AOYA 2PI0A 1ITYA 4PJLA 3J7AO 4GYGA 3K0LA 1MMNA 1FOXA 4YIIA 4BUPA 2VN2A 1OCCH 2L02A 3ERMA 4IXAA 1WI3A 1GXPA 1HW2A 3DF8A 3GZ5A 3MVPA 5EDNA 2LY2A 5IP7J 2JA5J 4E7HA 2J5PA 5FKOA 1QPIA 2L7MP 2HPIA 5C4XJ 2VLAA 1ULYA 1A6QA 4LK0F 4D1QA 2RGVA 1UELB 4CDGA 4CICA 3VOEA 3EUAA 2HPMA 1WPKA 1FTZA 3RKQA 1FYMA 2XAUA 5HLGA 1W5SA 2VJ4A 3HSRA 3O6BB 5HDNA 2Y0SA 1TL8A 4QLCU 1XC5A 4ENKA 1QZZA 4ZDPA 1G6NA 2GXGA 3U21A 3HOVJ 1BW5A 1IC8A 3NQOA 3M4OJ 2VBWA 3OIOA 5D5XB 3GTMJ 2GAUA 4XN0A 2D45A 2K5CA 3PIPF 2FMYA 2COBA 4MTDA 4HBLA 2L5QA 3WTUC 2VBZA 5F1RA 1T8IA 1WH5A 2QQ9A 1M1EB 3VYRB 2RC4A 5B5EC 3IRRA 1XSXA 1LNWA 2KIMA 2ME6A 2JWTA 4N9HA 2M3AA 1A36A 4I02A 2E2HJ 2ZBKA 4BKXA 4R79A 3FHZA 1BJZA 1DP3A 3R60A 2K9MA 5ICGA 1ERDA 2LLKA 5FLMJ 5KK1A 3WTZA 3H3UA 3QU6A 4J00A 4GFBA 3VYTB 2PMHA 1O3TA 2X1DA 3C2HA 4HV6A 1Z0XA 1WKMA 3MQ0A 2LY1A 3S17J 1IXSB 3QU3A 3CC2I 4RGRA 2ZMEC 3BDDA 2CFOA 1PUFA 1HKTA 2KJBA 5JI6A 1Z6TA 2BGCA 5IYCJ 3SXYA 3ROUA 3TP0A 2I10A 4Q47A 3ZMUA 2VE8A 4FCYA 5IOZA 4BH9A 1ZH5A 3JRFA 3FKJA 4KISA 3G6EI 3S3MA 3E6CC 3I71A 3I59A 4HZFA 2K4BA 2CG4A 3PNVA 2OAZA 2DCEA 3HRSA 4Y15A 2MLKA 1X2NA 3F8CA 1FP1D 1TWHJ 3G4SI 5B1AH 4XLFA 1FWZA 3PJRA 2Y48A 1GLNA 2V6CA 2F4OB 2M9HA 5DCMB 1OKRA 1W7PB 5L3FA 4HPQA 2XSJC 4HDVA 1WVRA 3S1MJ 2P6TA 2E1MB 1U5TB 3S14J 2VBXA 1RRJA 2DJIA 2XAFA 3R4KA 2FRHA 3JTHA 3BY6A 2DK8A 4NB5A 2XB0X 2M45A 5D5VB 2R7ZJ 2V1XA 1SAUA 3ABTA 1GV2A 2BW3B 1A35A 1L0OC 2H8WA 1X58A 2L54A 4HLXA 5IPAA 2C6YA 2GXAA 5FRMA 1TWCJ 2LC2A 1KU9A 1R22A 1LDDA 1OCOH 2B7EA 3K7AJ 3PFIA 4EGZA 4U87A 2W24A 3T8RA 1IAWA 4XRMA 4NNJA 1LQ1A 5BS6A 3LQRA 1QHGA 4CO8A 2FF4A 1KU3A 2Z16A 5HOOA 4C3HJ 2FA5A 4HW0A 3VB2A 3K4KA 5E8GA 2ELHA 2IVMA 2P7CB 2ZMEA 1GV5A 2QA4I 1Z3YA 3GO5A 5F0CA 3KYLA 4D5CA 5DEQA 3AG2H 1VQ8I 3MKLA 2JSCA 2RREA 1K4SA 2ADUA 2Y0SN 2XPUA 3GFMA 1JT0A 1NHAA 2WV1A 3G1LA 1SMTA 1A04A 1T33A 5L3CA 2Y75A 4WXCA 5IT3A 1TW3A 3PUFA 3TOAA 4XKVA 1F4KA 1P4XA 1P4WA 3L2RA 2DMTA 5DV5A 1TNSA 3GUDA 4KITB 3CMAI 4M9XA 2R92J 5H20A 4OIRF 5IYBJ 1K6OA 4K2EA 2Q0OA 2QQAA 2HEOA 2HKXA 1F9NA 3LSTA 2DDBA 1RPWA 3C2GA 2ZJ2A 1FC3A 4MEYF 4PCQA 5AIPA 1Y1WJ 4BXFA 3HBLA 1KU7A 2DTRA 5D5WB 1I6HJ 2FBIA 3ZOBA 2LG4A 3GBGA 3PSFA 1LFBA 4BACA 2X9DA 5CYVA 3ZPLA 3G2BA 3MZ8A 1GXQA 3QQAA 3JAMZ 5LGUA 1KGSA 2KQRA 4EM2A 4IPAA 4BQOA 5LRSA 3BQZA 4KNYA 3W6KB 1JT6A 1W36C 1G3WA 2KRHA 2V9PA 1JHHA 3K70C 1KQ9A 4TV7A 2CUZA 3KX2A 1W36D 2AS5F 1I1GA 3CP2A 3ZXSA 3BR3A 4II2A 4X0GA 2H6CA 1R6RA 2RVCA 2RV8A 3OL4A 4FQGA 2NRAC 2DA7A 4M3FA 1SVOA 4XLHA 1IRGA 3K9TA 2AXTC 3HRUA 2E7XA 2QM3A 3S3OA 2EV0A 3KYCB 2M30A 2WC2A 2WAEA 3HHGA 5F64A 3HTUA 5BNGA 2HOTA 2O61A 4JX6A 1DGRM 1FMVA 4RGUA 5FO5A 3LL7A 3SEZA 2JUGA 1DU6A 2BXZA 2MBFA 4LOCA 1RUNA 1B6AA 2LH9A 1FZPB 2IGKA 2JSPA 4C9YA 4OWRB 2L9NA 2DOFA 3HSFA 1E3PA 1D1CA 2M4KA 2MLGA 2KDOA 4PDKA 1FBQA 2G0EA 2QENA 2W7NA 4LD5A 3M3YJ 3NARA 4OINF 3DPTA 3MFKA 1S72I 3ZN1A 1KYZA 4BDZA 1HW5A 4CZZA 2DYRH 2JA2A 2LFBA 2XKPA 1R5GA 3F0CA 1YO5C 2XAQA 1TT0A 3B73A 3FMRA 4FE7A 4BQNA 5D4RA 4MLOA 1ZHFA 4B8XA 3I0TA 3COAC 3DTIA 3BJ6A 1T95A 1K78A 3BZKA 2HQNA 3DKYA 2VT2A 2RAEA 2HU9A 1Y56A 3TGNA 3WTTC 5E3NA 1IN7A 4O3MA 3TOBA 1UJ8A 1WCMJ 3CJTB 2O03A 3FXQA 3HOYJ 4A3IJ 1YW8A 5CQGA 2FNAA 1ETWA 2Y30A 1R4MB 3F8MA 2R0QC 5HDGA 3FK6A 4Z2YA 2R7FA 2QWWA 4U0YA 4FHTA 1CQTA 1WJBA 4CCOA 3ASOH 5BMZA 4XLAA 1JJ6C 5LHHA 5JLXA 1MW7A 5F27A 2A69F 3SZTA 3PQJA 1AHDP 1P7JA 2LY9A 5CVIA 2ZKZA 4ZDLA 2QUFA 4IHWA 2KLOA 2QGUA 2DOEA 2JRTA 2LOOA 3FMSA 1JUSA 4PJ0C 4RS8A 3E1SA 3HEFA 1VQKI 3FX3A 4BGDA 3LAJA 3AL0B 2E1CA 2EA2A 1LE8A 4EMSA 3HXLA 4KT6A 2MSYA 3TO9A 3OYAA 3RKXA 3ZQIA 1N75A 5FLXZ 4H4KC 3SQNA 4UVBA 2XRLA 3D0SA 3ZP5A 2R5ZB 1XS9A 3PO3J 2L0KA 1O3QA 2HQAA 4XOPA 3OYFA 5JVGF 1OCPA 2KFDA 5FLXK 4XBFA 2P4WA 2XHKA 2NVQJ 5IT9K 2EZHA 4MGRA 3P5JA 1WZ2A 4U0VA 1XMAA 2ACJA 2CRGA 2NAZA 2OD5A 1LKXA 3I3LA 3K1NA 2VKHA 3ESWB 4BJTA 5CPRB 4DOZA 3CCQI 2EZLA 1R71A 3RI4A 1IV6A 4DQ2A 3A4CA 3E97A 3V8LA 4WF2A 1W5TA 1YIOA 5GPAA 2A05A 2G7HA 2QLZA 3ZMZA 4ZTJA 3D5RC 4A93J 2ZJRF 5C4JJ 1QO0D 3AL0C 1IZ1A 3V7SA 3DBHB 2IW5A 4LJZF 1B9MA 2VODA 1JGGA 1IRFA 4LGWA 4CCJA 3OIPA 3BR1A 4XM3A 2Z3YA 2DU9A 5A2QZ 1QPMA 4B09A 4NQWB 2F2EA 2Q2EB 4EVIA 4DZJA 1G59A 4PZJA 4FISA 1XD7A 4G12A 4I0AA 1RKWA 2GM4A 2F5CA 5HS7A 1YYVA 3MKYB 1HLVA 2B63J 4UY8I 5M5WJ 1WQ2A 1Z7UA 3HGGA 1YS6A 2EH3A 4YELA 4F52A 3L1PA 1CGPA 1IN4A 4P9UA 1LVAA 3F6OA 1XGMA 3BTJA 4MTEA 3GZ6A 3W6VA 3GTKJ 1U8RA 1T39A 3QOEA 2P7VB 4A0XA 3ZQLA 5DCFA 4EJVA 5DM6F 2OA4A 2GIZA 5DYMA 5EGOA 3T5XA 2ZB9A 3CLQA 3FXJA 2LYCA 5E20A 3L00A 2XGEA 4PJMA 1VFCA 3H9JA 3ZR8X 3CJRB 1VNDA 4N4NB 1XCVA 3CC4I 1W5CC 3B6CA 4ZYHA 1WJAA 2DMNA 2QSHX 3ZQHA 2DW4A 1FTTA 2K85A 2OBPA 2EV6A 1MMSA 4BJ5C 2VOPA 3ISPA 1T38A 1S29A 2JJ7A 2ZXHA 1WJEA 4F93B 1RZ4A 2WV0A 2A5YB 1S3JA 2KRCA 2M87A 4U7DA 3HG9A 3NWTA 4A3LJ 1WJ5A 2M8EA 2WADA 2HGCA 2EFOA 3WTXC 2X1EA 5HDKA 2FSWA 3OS2A 3JW4A 1SD4A 2FBHA 1IUFA 3QPTA 2BW3A 5DUKA 1BBYA 3FXLA 4EM0B 3ZRGA 3E3VA 2X6OA 2VJJA 1R36A 3HOXJ 3QRFF 3S2HJ 1IW7F 3SYTA 4RAYA 2VE9A 1W0UA 2FOKA 2KHMA 1LJ9A 1KONA 5DDGA 5B3SH 2B0LA 5E1WA 2JVHA 1LE8B 4G6QA 5GP9A 5J1YA 3HPGA 5LFAA 1VTNC 4NC8A 3CMMA 2KRFA 4KMFA 2XF7A 3ZN0A 1BC8C 3CDHA 3J7AY 5D8KB 1T56A 3BPVA 5M5YJ 2PN6A 4BE0A 4I76A 4XMYA 2E71A 2K9LA 4MEXF 2HOAA 2DT5A 1W7PA 1YLFA 2K3FA 2KZGA 2XB5A 4KN7X 3SDBA 1X1PA 2GLOA 5FD6A 3E6MA 2E34A 2HVQA 3KZZA 2VKEA 2MH2A 4ZYAA 1ZLKA 4ZZLA 1B9NA 1ZQ3P 2H27A 3Q0WA 1ONVA 1MMAA 2PMZA 1QGPA 5FKKA 3OOPA 1ZAOA 4PSXA 1YI2I 2L4AA 3IWFA 1P4AA 2FQ4A 3EETA 4HNTA 3F21A 4OIQF 4B47A 2LK2A 2MG4A 5B1BH 2QQ8A 1BR4A 1MNEA 3WTWC 9ANTA 2WTEA 2D1VA 2MD0A 1EKEA 1NG6A 1TQPA 2VQLA 3OYGA 4RA2A 4G94A 4LLLA 2V79A 3N97A 3RPUD 2F5VA 2P0WA 4I99C 2JPBA 4BY7J 5DCMA 1T2KA 3PM1A 4M6VA 2OPTA 4HRIA 2YU3A 1KQ0A 4OU0A 1SMYF 3A2KA 4WXHA 1N77A 3OYCA 4CYCB 1ETKA 2HR3A 4LG0B 1CF7A 2FE3A 3LSJA 3DPLC 1WH7A 2V7FA 3CLOA 3L2UA 1D8KA 3GLLA 5FKMA 4C30A 4FASD 1ENHA 1R5ID 2W57A 4IHTA 1FYKA 5F04A 2HDCA 5TISC 1J7KA 4CCLA 1TWGJ 2E1OA 3WU1B 1BC7C 2YUSA 1KQ8A 4ZYDA 2V9KA 3H5NA 3GFJA 3CDIA 2HYFA 2GQQA 5FRNA 3CO6C 3CCMI 4GYIA 2STTA 4BE2A 1FOKA 2IBDA 2CQ7A 3IH3A 3SFZA 1LVKA 3ERED 3TEDA 4LMYA 1E2XA 4LITA 2H1KA 3JREA 5BQTA 1FBUA 4EJUA 1YJ9I 1BI3A 5K7HA 1V5EA 2PG4A 3W2WA 5EYRA 1MSEC 2KIFA 3KCCA 1I3AA 3R0AA 4KIFA 4RB0A 3ULQB 3HDDA 2R7SA 4M71A 2ZSIB 3W6JB 1YG2A 3EYIA 2RDPA 3GWZA 4RAZA 3I55I 1CF7B 3TDUC 5CJ9A 2QVOA 4DYRA 5IP9J 3A02A 3FXKA 2W84A 2KKOA 2HI3A 3TW6A 3L2CA 3G3ZA 3J81K 2EBIA 2LTPA 5KAIC 1PP8F 4E7IA 2W1OA 5J8CA 1BIBA 4O5VA 3IKVA 1GVJA 1IRXA 2ZNYA 1QVUA 2E19A 4I0BA 5LLQA 1XPXA 2MA3A 1HDDC 4RGXA 2XPVA 1XSVA 2EIMH 2Y31A 3OR1C 2HQ5A 3HUGA 3PNYA 4BQAA 1ZYRF 1N25A 1T08B 1EF4A 1B4AA 3ABUA 4S0HB 3FXMA 3F8NA 5K5OA 3VYUB 4ESFA 3C1DA 2E1NA 2BY3A 4G6TB 1ZG3A 2ID6A 3LA7A 3CZ6A 3PFYA 2FQ3A 3RTRA 1RUOA 2BBYA 3CUQA 4LK1F 4O6JA 4XSXF 2HOSA 5HODA 2UUZA 3PNTA 2VJIA 2M0CA 3S1QJ 1SEUA 3HRTA 2QKLB 4E7ZA 1XGSA 4MFEA 2PJRB 2TCTA 2HVSA 1YHQI 1SVMA 4OIPF 1USTA 4XLCA 4IHVA 2LP0A 2XAHA 4KN4X 3M7GA 4M6XA 4Y4RA 5FFZA 4D9JA 2DQRA 1H89C 1WJCA 2IS2A 3BLYA 4L9NA 4B3AA 1A6IA 1OQYA 3L9FA 4IOAF 1MIJA 1RKTA 3OYIA 1K78B 5KNLA 5CQEA 5FGMA 1QU3A 3EPZA 4DGWB 3W2VA 3CUQC 3M8EA 2F6CA 2JK3A 5J8FA 1WWXA 3WODF 4OAZA 2CW7A 1XMXA 3ECHA 3MKZA 3DEEA 1VI0A 2FNPA 4HSTA 5FFXA 2X0LA 2R5YB 5KVRA 3D5LA 4NDLA 1WI9A 2JZYA 1EJ9A 1UHMA 5CVVA 1LUJB 3IC7A 2O5RA 4KDPA 1RNLA 3AKZA 4F91B 3CMYA 3ZQFA 2M4GA 4KYWA 3H92A 3HKZN 4Y17A 1REPC 2MC4A 4GO1A 4IHXA 4IRGA 3RQ4A 2ISZA 2VBYA 3RPUA 2CV2A 3F6VA 1SANA 4CCKA 2DAOA 4CCNA 1S9HA 3AFHA 2BVLA 3FBNB 2VUMJ 2K86A 2DPDA 2L4MA 4EJWA 1ZN2A 5F6FA 2CWEA 5JFRA 3TMOA 2HYJA 1XMKA 2UWMA 3OV8A 3GMEA 2DMUA 2CU7A 3DU5A 1MJBA 1FIPA 4ESJA 4HLYA 4ZYGA 1W7PD 5GPCA 4V19K 4Q5SF 1ZKGA 4IOCF 2V4JC 2VASA 4BJ6C 3K10A 2MYSA 4HX8A 1JTYA 3BTLA 3DTKA 1XB4A 3C2BA 1V5GA 4HA8A 4EJOA 4L5EA 3R6SA 1G8XA 3KLOA 3O8GA 1MSFC 2CQNA 2XDVA 3Q9SA 4BXXJ 2GZWA 3FXRA 1FT9A 3L09A 1OYYA 1Y1VJ 2WAQN 2QZ8A 1U0JA 3ZGKA 4BY1J 3REOA 5E18F 4Y52J 5GTIC 5D6EA 1FIAA 3GZNB 4QPQA 5E17F 2XIGA 4BU2A 2GOMA 4DNCA 4L0ZB 1MBJA 4V2FA 4BL0B 2CW8A 2GA1A 1J9IA 2PLYA 2X6YA 1Z77A 1JUMA 2A6EF 3QP6A 1NTCA 1WRJA 2TRTA 5DD8A 4S05A 1VF9A 3OR2C 2ZXWH 4HAMA 2H8RA 2DTZA 2X51A 3WHBA 5FB2A 2KDZA 4AYBN 4CYDA 3AG3H 3SJMA 2VI6A 5ICEA 2R7RA 1U5TA 1YS7A 4I01A 3WE2A 1MKMA 2YR2A 5LRRA 4G7OF 1FMWA 3JCUC 2OUMA 1J0RA 1HOMA 3HSEA 3BZCA 4QWQA 2R93J 3CCLI 3CCVI 3FIWA 5ILSA 1ZLJA 2IA0A 1JUPA 1BM9A 4M9ZA 3GTGJ 4RB2C 2Z99A 4LLGF 1H8AC 2CW0F 4R1HA 2HWVA 3GYHX 4DW6A 2K02A 4AWXB 1PP7U 1Y8RB 1D0YA 4W97A 4PJNA 2WWYA 3KZYA 1POGA 3GEZA 2F4MB 1MMGA 1IRZA 4XONA 3MZHA 1FPQA 3LSIA 1F1ZA 3FBIB 3DEWA 2A61A 5FKNA 3M9AA 3V4GA 5D5UB 4IHYA 2ZFUA 2HFHA 4ZC3A 3ASNH 5DM7F 1K7AA 2ELKA 2NOJB 3CD6I 1BW6A 2ISYA 1B72B 1FOWA 2R3SA 4ZJZA 3OYDA 3E6BA 2IP2A 1X19A 2E5ZA 4OIOF 2JRMA 3CJQB 3MMYB 2VONA 3A03A 2V1NA 3WGGA 1MBFA 1S6LA 2DT6A 1R58A 1NK3P 4JBAA 2STWA 2VPRA 3V42A 2Q2EA 5J1UA 1UB9A 2Y9YA 3LA2A 2CGPA 2UZKA 1Y39A 2BZTA 4S04A 5EEAA 2IXSA 1X1AA 3F22A 2DK5A 4JX4A 3FF5A 4Z6YA 2DPUA 1GHCA 3IUOA 1JXSA 3JRIA 2NVXJ 4I6ZA 3O8HA 2OCCH 1YW7A 2PJRA 3G73A 3ZQ7A 4FX4A 2P81A 3DBLB 3TQNA 4I09A 4UUTA 3DKWA 5JR3A 1U6GA 6PAXA 2FXAA 2LBFA 3OSFA 1V5FA 1VQ4I 1WFXA 1AKHB 1BR1A 3JRHA 2DN0A 2HTJA 2VKDA 4YFXF 3DCFA 1YRNA 2MD5A 2M2EA 4HYEA 3QP5A 4MQ9F 4XR6A 3LA3A 3DU6A 3KETA 2IA1A 4A0ZA 3BC8A 3P9CA 5K1YA 2VC1A 3DP7A 3M1EA 4JK1X 1TQIA 3TBIA 4E6KG 1XN7A 1K6YA 1TZLA 1J09A 1Z21A 4BHBA 4AC0A 4HX7A 2IJLA 4FETA 1FOYA 5E3OA 1D5YA 3X2QH 3CF2A 1R00A 3N05A 2ZO4A 2KPMA 1DGWY 1VQ9I 3RYRA 5J40A 3KP6A 4E4HA 2PX9A 2W25A 4YG2F 5LEJA 4P1WA 5KHDA 1Q1VA 1EH7A 4NHJA 1R49A 2EQRA 3Q5FA 3KEOA 3HC7A 5FJ8J 2IS6A 2DMPA 1ON1A 3VSLA 5F08A 4Q4ZF 4GCVA 5IOYA 4UVAA 2O3FA 2Z1DA 1RESA 1OYWA 3QYFA 2ZMEB 4ENMA 4ASNA 5DUIA 1IN5A 3LOCA 3F8FA 2CQXA 2AO9A 3VPRA 2WB1N 4IRHA 4II3A 4YFKF 1YW9A 3Q0UA 3DWLE 2O7OA 1Q1HA 3LMMA 3U1DA 3NWSA 3HYIA 4BQQA 2JPCA 4CH7A 1Y6IA 2DYSH 4C2UA 3OMYA 2JA6J 3RZOJ 1OYIA 3KP3A 4BNCA 4X6AJ 1ETOA 3T0YA 2G7UA 3Q3SA 4AD9A 4XRSA 3JRDA 3CCJI 3PSIA 3WU0A 1HXDA 4IHSA 1U8BA 1MBHA 2FJ1A 2DA2A 2R7VA 1IO2A 3RZDJ 4RM3A 4B4CA 2H94A 2AQFA 3HOTA 4D7NA 3HOWJ 1AA7A 5B66C 3DLAA 2VT3A 2NXNB 2X85A 5H6RA 2ME0A 3J80Z 5HS9A 2P8TA 4L0YB 1V3FA 1EH8A 1FX7A 3K4BA 5GAGJ 3WHCA 1HCRA 3EQLF 1YJWI 3S15J 5ED4A 3UR3C 5CVRA 4KT5C 1P2FA 2CQQA 3OYBA 2CS3A 2E5NA 2FBKA 3G1MA 3RDIA 4AIJA 2H1LA 2UXNA 5LBQA 3JR9A 2VXZA 1GDTA 1I1SA 3GTLJ 3CP8A 3ZQQA 2R5ZA 2KIQA 1ACIA 1KA8A 2XC7A 1QHHD 2A07F 2Q8KA 3OYNA 2HTSA 5LGNA 1DP7P 3DKXA 4QPOA 2R7WA 3M8JA 5KCMA 2MC3A 5EG0B 2HOEA 2N8GA 2QQBA 1VZ0A 1QVTA 3H0DA 2D5VA 1UHSA 2ZXJA 4GGGA 4B1RA 4PSWA 2OZUA 3B02A 1O7LA 2ZSHB 3F72A 1UG2A 4BEHB 4XL9A 3K4JA 1XGNA 2RNGA 5L3EA 2LREA 4F3QA 1ZR4A 4M3DA 2YU9J 1WJFA 4P55A 1SC7A 5F0FA 4UHTA 4FTHA 4AVZA 4EQQA 1MNMC 1TWAJ 2CFXA 2EFPA 1K61A 3W3CA 3C7JA 4UB6C 2OQGA 4AUXA 1TBXA 3FMQA 5L3DA 1D8JA 1D0XA 4EM1A 3KP2A 3HRMA 3RKWA 3V8JA 3E5UA 5C3EJ 3OYLA 4MFDA 2NS7A 1P7IA 1ZRFA 1OMIA 1BOAA 2RNJA 3DEUA 1MH3A 2FUG2 3BROA 4A69C 1STZA 1J2XA 1UMQA 1OCRH 2ZCWA 3WG9A 3DFGA 2FEZA 3ECOA 1J5YA 1RI7A 5HLHA 2DA6A 3G71I 2XUBA 4DBRA 1Z67A 4IKFA 3BG5A 3RQIA 1J75A 2DI3A 4J19A 1SVLA 2V26A 4A3JJ 2H6BA 2ETHA 4IJAA 4A12A 2CUJA 1APLC 2R7OA 4I7HA 5EJCA 1HDPA 2RQPA 4KIGA 2DMQA 3PIOF 2F4IA 2XF5A 4G8XA 3CCUI 3I59B 3FZVA 5A2QK 3DV8A 2WAFA 2IRFG 3HOSA 4A3KJ 2AXLA 3DXJF 5E1XA 4CCMA 4F55A 5HNFA 1O3SA 5L3GA 4CUGA 4RBOA 3CTAA 3MCZA 5M3FJ 3S2WA 5H6QA 3CDLA 1BN5A 3OSGA 1P6RA 4IEJA 4A3BJ 2JVGA 3GTQJ 2LNBA 1FSHA 3LNQA 2OV7A 3WG7H 3BTCA 3LSMA 3S16J 1U9OA 2R5YA 3H36A 3BJAA 5M3MJ 3MWMA 1JE8A 1BR2A 4M6YA 3V8KA 3F3XA 1P9QC 3GTJJ 2R4GA 3OYJA 3L7WA 4UUSA 1ODDA 3FXOA 2CH0A 4ZZDA 3BG9A 4MHGA 1BJAA 1D1AA 1LFPA 1YX3A 3WE3A 2RN7A 4ZH4F 2FU4A 1PJRA 1U9NA 4Q48A 5GTHC 1B59A 1SFUA 2XKOA 2Y9ZA 1HC8A 3HIFA 4G6DA 2DFEA 1QZYA 4IQ4A 2GA2A 2E60A 4RDUA 4A6DA 3HOZJ 3H9GA 4MO7A 1SD6A 2DDAA 3KP5A 3UKGA 3P9KA 4H0EA 5K7FA 4M74A 3M07A 2VIXA 3CCYA 2EILH 4HX4A 3LSPA 1DQUA 2BYVE 4HOBA 2VQHA 1TNTA 3LFKA 4OMZA 2P5LC 1Z3XA 2EWNA 4BE1A 3IV5A 4RM2A 4E70A 1IXRC 1TP4A 2LMDA 5AONA 3CMEI 3BQYA 2NYXA 3ELKA 3MZYA 2P5KA 4A0YA 2R7XA 1EV7A 1X1CA 3LSGA 4CZCA 3D1NI 3QOPA 2LKSA 3OS1A 4KICA 5ERIA 4RB1A 2LR8A 4FE4A 1TW2A 1I39A 4A6EA 3Q9VA 5EEGA 2BEOA 2NNNA 5D4SA 1AKHA 3M8FA 1FNNA 3P9IA 1SFEA 1Z05A 3F8BA 4C2MJ 3OS0A 5ILUA 4ZYEA 4LIVA 1JKPC 1UG0A 1K83J 3KFWX 1N78A 3A0BC 4ANJA 4M3GA 3I54A 3EUKL 1BI0A 4IRIA 1E3HA 2L9SA 2RKHA 5EZGA 5LHGA 4DYCA 1BI1A 2DFIA 3RJPA 4I98B 3E5QA 3L2QA 3PQKA 1MD0A 3OIQA 4ZDOA 1V55H 5F0HA 1UCRA 1W0TA 2F48A 5TJJA 3I4NJ 1O3RA 2IGOA 3U1KA 2JQ7A 3DLLF 4PK4A 3DTEA 4ESBA 3KEYA 3B6AA 3WGIA 2XROA 2VKVA 3IH2A 4U88A 2ZXIA 5E3LA 4R8HA 5GAHJ 1A5JA 1O57A 1YFHA 4JP0A 3QYEA 1C0WA 1B1BA 2IAIA 3OYKA 3I56I 2DT7B 2CSOA 1ON2A 2D2WA 4EV0A 4BHPA 5M5XJ 1VQNI 1IG7A 3GXOA 1VQ7I 3VSKA 2X4HA 3LSRA 2R7UA 5TRDA 4KUMA 5IY5H 2PFBA 1RIOH 3T1BA 2A6TA 1JJ8C 2R7TA 3K69A 2E35A 1B72A 1NG7A 3ML6A 2DA4A 2EPFA 2OCEA 3DQVC 1VQ6I 2A6HF 3KP4A 3FWEA 3MKWB 3QPSA 1X3UA 3HL2A 4Y33A 4EGYA 4IO9F 1P92A 3OL3A 4XKCA 4PFOA 3PL8A 1MGTA 4L9JA 1HSJA 1SAXA 5LGTA 1ZGAA 4AVPA 3RIRA 2YS9A 3LSHA 1LDKB 3GF2A 4OOIA 2L7ZA 2IPQX 1T0FC 2XGCA 3I53A 2GWRA 1YRNB 2BOLA 4A5MA 3FK7A 5KAFC 2AHQA 2G9WA 1VQMI 2KZVA 3KEQA 1MH4A 2EK5A 2ESNA 5BPIA 3WGHA 2CYYA 3BR0A 2MGQA 3IAM2 4PFPA 2IS1A 3CUQB 3GTPJ 2DO7A 3A0HC 2WY8Q 4KIBA 4LG0A 1L3LA 4DBQA 2H09A 3G1OA 3TW7A 2IGNA 4A3FJ 3HGYA 4EJTA 3BJOA 1OPCA 3S93A 1VQPI 4B48A 2EA4A 4XK4A 3BT9A 5J4YA 1U5TC 4A3MJ 1E17A 4B44A 3EUHC 4RLQA 2IA2A 2XGXA 2Z2SB 1D5VA 2VOOA 3VWBA 2JT1A 1BI2A 3CJNA 4LG3A 2A3SA 4HF2A 1W4MA 4XQFA 2F5EA 4A2UA 1JGSA 3J7YJ 1MZBA 1EA3A 2GXBA 1ETQA 4L5IA 2KMUA 3BP8A 1ZTRA 3QWLA 2KJCA 1IN6A 4HSRA 2O8KA 2I8DA 3TO6A 1UHWA 3BR6A 2V1DA 3J80K 2NOGA 2WBMA 3GW2A 4HNVA 3C3WA 2XAGA 3MD2A 2EB7A 2QEXI 3CC7I 2W00A 2BHYA 2EV5A 2FX0A 2ZJPF 5FLVA 2KIUA 1HA8A 1F43A 3BG7A 3J7ZI 1X4PA 3K4CA 2DFFA 2OQRA 5K5RA 2YX4A 4ENNA 4MIMA 2ESHA 4HQMA 3OY9A 1XTAA 2DXIA 1MDMB 1IJWC
chains in the Genus database with same CATH topology
2DMNA 2ID3A 3ZQHA 3E7LA 5FJ8J 1FTTA 1NK2P 2LD5A 2DMPA 2CJJA 2XPWA 3HOUJ 5F08A 2JJ7A 1G2HA 1JTXA 5IOYA 1JKRC 1RESA 2HXOA 1FJLA 3LOCA 4A3LJ 2OF7A 2CQXA 3FKIJ 2AO9A 3VPRA 2WB1N 1SFOJ 3MN2A 1TWFJ 3Q0UA 2O7OA 2DA5A 1H88C 1IUFA 1X2MA 2JA6J 3JRAA 3RZOJ 4X6AJ 1S7EA 2X6OA 1ETOA 3HOXJ 3S2HJ 1W0UA 5EZHA 3Q3SA 4XIDA 2CUEA 1E3OC 1ITYA 5EGOB 4QTRA 1LE8B 4XRSA 5GP9A 5J1YA 3JRDA 4ABZA 3JRGA 1WI3A 3MVPA 5EDNA 1U8BA 1T56A 5IP7J 1MBHA 5M5YJ 2FJ1A 2JA5J 5FKOA 2DA2A 2L7MP 1QPIA 4I76A 5C4XJ 1IGNA 2HOAA 2XB5A 3RZDJ 1O4XA 4B4CA 2GLOA 5IYDJ 4BBRJ 1FTZA 1WPKA 3RKQA 2VKEA 4D7NA 1ZQ3P 3Q0WA 3HOWJ 5FKKA 1XC5A 2ME0A 4XICA 3HOVJ 1BW5A 1IC8A 4D5FA 3M4OJ 2FQ4A 1AU7A 3OIOA 3GTMJ 3WHCA 1HCRA 3S15J 2LK2A 2MG4A 2COBA 9ANTA 2CQQA 1WH5A 2W48A 5FKLA 3G1MA 5JLWA 2ME6A 1GT0C 2JWTA 1JKOC 2E2HJ 3JR9A 1GDTA 4BKXA 3GTLJ 4BY7J 2R5ZA 1LFUP 1OJLA 4M6VA 1BJZA 3PM1A 2OPTA 1ETYA 2LLKA 5FLMJ 1MBGA 2HDDA 4CYCB 1ETKA 4GFBA 2JA8J 4M3BA 3LSJA 4QIWN 1WH7A 2K40A 2ECCA 5FKMA 3I4MJ 1ENHA 1Z0XA 5F04A 3S17J 2FD5A 2E1OA 1TWGJ 2K9NA 5EG0B 2IEKA 2N8GA 1PUFA 1QVTA 2D5VA 2YUSA 1UHSA 1OCTC 5IYCJ 4B1RA 3HB9A 4FCYA 3TP0A 2I10A 5IOZA 3JRFA 4UUSB 2KT0A 1UG2A 2IBDA 1ETXA 1ZR4A 4C3JJ 3IH3A 4M3DA 5K7ZA 2O9LA 2YU9J 3TEDA 5F0FA 4FTHA 2H1KA 3JREA 1MNMC 1TWAJ 1X2NA 1TWHJ 1K61A 4AUXA 1QRYA 5K7HA 3ZQGA 2M9HA 5EYRA 1MSEC 3HDDA 3S1MJ 5C3EJ 1ZK8A 4MFDA 2NS7A 1P7IA 3S14J 1MH3A 2JMWA 4A69C 4DYRA 5IP9J 1UMQA 3A02A 3BTIA 2HI3A 2XB0X 3TW6A 2R7ZJ 2EBIA 2LTPA 3Q0VA 3S1NJ 2DA6A 1GV2A 1X58A 5IPAA 2ECBA 3BG5A 5IP6A 3RQIA 1TWCJ 4J19A 4A3JJ 3JRCA 1QVUA 2E19A 3K7AJ 1APLC 3GTOJ 1HDDC 4XRSG 1JKQC 1HDPA 2XPVA 2Y31A 2DMQA 2HQ5A 4XRMA 4C3HJ 4A3KJ 1EF4A 4S0HB 4RBOA 1GV5A 5F0CA 4CYCA 1GVDA 5M3FJ 4D5CA 1BL0A 2NVYJ 3CDLA 3MKLA 2ID6A 3OSGA 4A3BJ 4IEJA 2E2JJ 2Y2ZA 3GTQJ 1JT0A 2Y0SN 2XPUA 3LNQA 2WV1A 3G1LA 1T33A 4Y7NJ 2HOSA 2DA1A 2XGDA 3BTCA 3TP3A 1U9OA 5HODA 2R5YA 3S16J 2M0CA 5M3MJ 3S1QJ 4C3IJ 1B8IA 4MFEA 3HM5A 2TCTA 4X1EA 5E3MA 3GTJJ 4IHVA 2DMTA 2LP0A 4UUSA 3BG9A 2R92J 5IYBJ 1H89C 1U9NA 1RPWA 2DA3A 2Y9ZA 4B3AA 1A6IA 4RDUA 2GBYA 1RKTA 1Y1WJ 3HBLA 3HOZJ 1I6HJ 3ZOBA 4MO7A 1XG1A 3GBGA 4V2GA 1LFBA 2X9DA 2JK3A 3UKGA 3QQAA 1VI0A 3QPLA 4A3DJ 5K7FA 2R5YB 3BQZA 3CCYA 4NDLA 1JT6A 3LSPA 2X48A 3OOUA 2EZIA 3CMYA 3SFIA 3ZQFA 3HKZN 3IV5A 1PUFB 1IDZA 4IHXA 3BG3A 3BR3A 1B8IB 3BQYA 1RETA 1SANA 3LSGA 3D1NI 1HF0A 2DA7A 2VUMJ 4M3FA 4A3EJ 1U78A 4W1UA 1GUUA 3K2AA 2HYJA 5C44J 2LVSA 2LR8A 4FE4A 5BNGA 2LKXA 2HOTA 4JX6A 5J1RA 2DMUA 1AKHA 2CU7A 3S1RJ 1FIPA 1DU6A 3H3VK 5GPCA 4C2MJ 4LOCA 3H0GJ 1ZKGA 1JKPC 4A3GJ 1K83J 5EG0A 1JTYA 3BTLA 4M3GA 2G0EA 3C2BA 3M3YJ 3NARA 4L5EA 3O8GA 5EZGA 1MSFC 4BXXJ 4DYCA 1Y1VJ 2WAQN 3PO2J 2LFBA 4BY1J 3A01B 4Y52J 3F0CA 1FIAA 5F0HA 2E2IJ 1W0TA 1MBJA 4FE7A 4V2FA 3I4NJ 4MLOA 1Z77A 1JUMA 1NTCA 2TRTA 3B6AA 2VKVA 1VF9A 3IH2A 5E3LA 2RAEA 3S2DJ 1A5JA 5J3LA 4JP0A 2H8RA 5E3NA 1BA5A 2DTZA 3WHBA 1I50J 2IAIA 2KDZA 4AYBN 1WCMJ 3SJMA 4JX5A 3HOYJ 2VI6A 4A3IJ 2L9RA 5M5XJ 1IG7A 1ETWA 2Y30A 2R0QC 1HOMA 3FK6A 3LSRA 2R93J 1CQTA 4A3CJ 3FIWA 1MBEA 2L7FP 5F1JA 1JJ6C 1JJ8C 1JUPA 1B72A 3GTGJ 1ETVA 2DA4A 5JLXA 5F27A 2K9SA 1H8AC 3QPSA 1AHDP 1P7JA 2LY9A 1IDYA 4DW6A 4IHWA 4M3EA 1JUSA 3HEFA 4W97A 3A01A 1TC3C 1POGA 1ZGWA 1IRZA 1LE8A 2YS9A 3DEWA 5FKNA 1ORKA 2MSYA 2L7ZA 3ZQIA 2XGCA 4IHYA 1YRNB 2XRLA 3FK7A 2K9QA 2R5ZB 1XS9A 3PO3J 2AHQA 2ELKA 1R9TJ 4DZPA 1BW6A 2L0KA 1MH4A 1B72B 3IH4A 1OCPA 3BR0A 2MGQA 2HXIA 3NAUA 3GTPJ 2NVQJ 4EEFG 2EZHA 3JRBA 3A03A 3FISA 1MBFA 2CRGA 1NK3P 1FEXA 3G1OA 3TW7A 2M34A 2VPRA 1DU0A 5J1UA 2Y9YA 4A3FJ 3HGYA 2EZLA 5EEAA 2PMZN 1IV6A 4JX4A 1F36A 5GPAA 3JRIA 4XK4A 2NS8A 2NVXJ 3BT9A 1WGXA 3O8HA 4I6ZA 2NVTJ 4A3MJ 1I3QJ 3CQZJ 2P81A 4A93J 5DS9A 5C4JJ 4UUTA 1OFCX 4JYKA 3OSFA 1JGGA 1ZR2A 1AKHB 4D7MA 3BR1A 3JRHA 2DN0A 3BR2A 3BR5A 1ETQA 3DCFA 1YRNA 2M2EA 2O8KA 1ZTRA 2CUFA 3BR6A 2NOGA 4DZJA 2QF7A 4FISA 4G12A 4HNVA 1RKWA 2GM4A 5DTDA 1HLVA 2B63J 2JA7J 5M5WJ 3HGGA 2EH3A 4AC0A 2EZKA 2XSDC 3L1PA 2FX0A 2MW8A 3BTJA 5FLVA 4BBSJ 2EQRA 1D5YA 5E3OA 3W6VA 3GTKJ 1F43A 3ZQLA 3ZQCA 4QSHA 5EGOA 2ZB9A 1MBKA 5EF6A 4DYQA 2XGEA 4MIMA 1VFCA 1RR7A 2QCOA 1VNDA 2JN6A 3SDGA 1Q1VA 3B6CA 1IJWC 2DJNA 2M8GX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DMN A;  2ID3 A;  3ZQH A;  3E7L A;  5FJ8 J;  1FTT A;  1NK2 P;  2LD5 A;  2DMP A;  2CJJ A;  2XPW A;  3HOU J;  5F08 A;  2JJ7 A;  1G2H A;  1JTX A;  5IOY A;  1JKR C;  1RES A;  2HXO A;  1FJL A;  3LOC A;  4A3L J;  2OF7 A;  2CQX A;  3FKI J;  2AO9 A;  3VPR A;  2WB1 N;  1SFO J;  3MN2 A;  1TWF J;  3Q0U A;  2O7O A;  2DA5 A;  1H88 C;  1IUF A;  1X2M A;  2JA6 J;  3JRA A;  3RZO J;  4X6A J;  1S7E A;  2X6O A;  1ETO A;  3HOX J;  3S2H J;  1W0U A;  5EZH A;  3Q3S A;  4XID A;  2CUE A;  1E3O C;  1ITY A;  5EGO B;  4QTR A;  1LE8 B;  4XRS A;  5GP9 A;  5J1Y A;  3JRD A;  4ABZ A;  3JRG A;  1WI3 A;  3MVP A;  5EDN A;  1U8B A;  1T56 A;  5IP7 J;  1MBH A;  5M5Y J;  2FJ1 A;  2JA5 J;  5FKO A;  2DA2 A;  2L7M P;  1QPI A;  4I76 A;  5C4X J;  1IGN A;  2HOA A;  2XB5 A;  3RZD J;  1O4X A;  4B4C A;  2GLO A;  5IYD J;  4BBR J;  1FTZ A;  1WPK A;  3RKQ A;  2VKE A;  4D7N A;  1ZQ3 P;  3Q0W A;  3HOW J;  5FKK A;  1XC5 A;  2ME0 A;  4XIC A;  3HOV J;  1BW5 A;  1IC8 A;  4D5F A;  3M4O J;  2FQ4 A;  1AU7 A;  3OIO A;  3GTM J;  3WHC A;  1HCR A;  3S15 J;  2LK2 A;  2MG4 A;  2COB A;  9ANT A;  2CQQ A;  1WH5 A;  2W48 A;  5FKL A;  3G1M A;  5JLW A;  2ME6 A;  1GT0 C;  2JWT A;  1JKO C;  2E2H J;  3JR9 A;  1GDT A;  4BKX A;  3GTL J;  4BY7 J;  2R5Z A;  1LFU P;  1OJL A;  4M6V A;  1BJZ A;  3PM1 A;  2OPT A;  1ETY A;  2LLK A;  5FLM J;  1MBG A;  2HDD A;  4CYC B;  1ETK A;  4GFB A;  2JA8 J;  4M3B A;  3LSJ A;  4QIW N;  1WH7 A;  2K40 A;  2ECC A;  5FKM A;  3I4M J;  1ENH A;  1Z0X A;  5F04 A;  3S17 J;  2FD5 A;  2E1O A;  1TWG J;  2K9N A;  5EG0 B;  2IEK A;  2N8G A;  1PUF A;  1QVT A;  2D5V A;  2YUS A;  1UHS A;  1OCT C;  5IYC J;  4B1R A;  3HB9 A;  4FCY A;  3TP0 A;  2I10 A;  5IOZ A;  3JRF A;  4UUS B;  2KT0 A;  1UG2 A;  2IBD A;  1ETX A;  1ZR4 A;  4C3J J;  3IH3 A;  4M3D A;  5K7Z A;  2O9L A;  2YU9 J;  3TED A;  5F0F A;  4FTH A;  2H1K A;  3JRE A;  1MNM C;  1TWA J;  1X2N A;  1TWH J;  1K61 A;  4AUX A;  1QRY A;  5K7H A;  3ZQG A;  2M9H A;  5EYR A;  1MSE C;  3HDD A;  3S1M J;  5C3E J;  1ZK8 A;  4MFD A;  2NS7 A;  1P7I A;  3S14 J;  1MH3 A;  2JMW A;  4A69 C;  4DYR A;  5IP9 J;  1UMQ A;  3A02 A;  3BTI A;  2HI3 A;  2XB0 X;  3TW6 A;  2R7Z J;  2EBI A;  2LTP A;  3Q0V A;  3S1N J;  2DA6 A;  1GV2 A;  1X58 A;  5IPA A;  2ECB A;  3BG5 A;  5IP6 A;  3RQI A;  1TWC J;  4J19 A;  4A3J J;  3JRC A;  1QVU A;  2E19 A;  3K7A J;  1APL C;  3GTO J;  1HDD C;  4XRS G;  1JKQ C;  1HDP A;  2XPV A;  2Y31 A;  2DMQ A;  2HQ5 A;  4XRM A;  4C3H J;  4A3K J;  1EF4 A;  4S0H B;  4RBO A;  1GV5 A;  5F0C A;  4CYC A;  1GVD A;  5M3F J;  4D5C A;  1BL0 A;  2NVY J;  3CDL A;  3MKL A;  2ID6 A;  3OSG A;  4A3B J;  4IEJ A;  2E2J J;  2Y2Z A;  3GTQ J;  1JT0 A;  2Y0S N;  2XPU A;  3LNQ A;  2WV1 A;  3G1L A;  1T33 A;  4Y7N J;  2HOS A;  2DA1 A;  2XGD A;  3BTC A;  3TP3 A;  1U9O A;  5HOD A;  2R5Y A;  3S16 J;  2M0C A;  5M3M J;  3S1Q J;  4C3I J;  1B8I A;  4MFE A;  3HM5 A;  2TCT A;  4X1E A;  5E3M A;  3GTJ J;  4IHV A;  2DMT A;  2LP0 A;  4UUS A;  3BG9 A;  2R92 J;  5IYB J;  1H89 C;  1U9N A;  1RPW A;  2DA3 A;  2Y9Z A;  4B3A A;  1A6I A;  4RDU A;  2GBY A;  1RKT A;  1Y1W J;  3HBL A;  3HOZ J;  1I6H J;  3ZOB A;  4MO7 A;  1XG1 A;  3GBG A;  4V2G A;  1LFB A;  2X9D A;  2JK3 A;  3UKG A;  3QQA A;  1VI0 A;  3QPL A;  4A3D J;  5K7F A;  2R5Y B;  3BQZ A;  3CCY A;  4NDL A;  1JT6 A;  3LSP A;  2X48 A;  3OOU A;  2EZI A;  3CMY A;  3SFI A;  3ZQF A;  3HKZ N;  3IV5 A;  1PUF B;  1IDZ A;  4IHX A;  3BG3 A;  3BR3 A;  1B8I B;  3BQY A;  1RET A;  1SAN A;  3LSG A;  3D1N I;  1HF0 A;  2DA7 A;  2VUM J;  4M3F A;  4A3E J;  1U78 A;  4W1U A;  1GUU A;  3K2A A;  2HYJ A;  5C44 J;  2LVS A;  2LR8 A;  4FE4 A;  5BNG A;  2LKX A;  2HOT A;  4JX6 A;  5J1R A;  2DMU A;  1AKH A;  2CU7 A;  3S1R J;  1FIP A;  1DU6 A;  3H3V K;  5GPC A;  4C2M J;  4LOC A;  3H0G J;  1ZKG A;  1JKP C;  4A3G J;  1K83 J;  5EG0 A;  1JTY A;  3BTL A;  4M3G A;  2G0E A;  3C2B A;  3M3Y J;  3NAR A;  4L5E A;  3O8G A;  5EZG A;  1MSF C;  4BXX J;  4DYC A;  1Y1V J;  2WAQ N;  3PO2 J;  2LFB A;  4BY1 J;  3A01 B;  4Y52 J;  3F0C A;  1FIA A;  5F0H A;  2E2I J;  1W0T A;  1MBJ A;  4FE7 A;  4V2F A;  3I4N J;  4MLO A;  1Z77 A;  1JUM A;  1NTC A;  2TRT A;  3B6A A;  2VKV A;  1VF9 A;  3IH2 A;  5E3L A;  2RAE A;  3S2D J;  1A5J A;  5J3L A;  4JP0 A;  2H8R A;  5E3N A;  1BA5 A;  2DTZ A;  3WHB A;  1I50 J;  2IAI A;  2KDZ A;  4AYB N;  1WCM J;  3SJM A;  4JX5 A;  3HOY J;  2VI6 A;  4A3I J;  2L9R A;  5M5X J;  1IG7 A;  1ETW A;  2Y30 A;  2R0Q C;  1HOM A;  3FK6 A;  3LSR A;  2R93 J;  1CQT A;  4A3C J;  3FIW A;  1MBE A;  2L7F P;  5F1J A;  1JJ6 C;  1JJ8 C;  1JUP A;  1B72 A;  3GTG J;  1ETV A;  2DA4 A;  5JLX A;  5F27 A;  2K9S A;  1H8A C;  3QPS A;  1AHD P;  1P7J A;  2LY9 A;  1IDY A;  4DW6 A;  4IHW A;  4M3E A;  1JUS A;  3HEF A;  4W97 A;  3A01 A;  1TC3 C;  1POG A;  1ZGW A;  1IRZ A;  1LE8 A;  2YS9 A;  3DEW A;  5FKN A;  1ORK A;  2MSY A;  2L7Z A;  3ZQI A;  2XGC A;  4IHY A;  1YRN B;  2XRL A;  3FK7 A;  2K9Q A;  2R5Z B;  1XS9 A;  3PO3 J;  2AHQ A;  2ELK A;  1R9T J;  4DZP A;  1BW6 A;  2L0K A;  1MH4 A;  1B72 B;  3IH4 A;  1OCP A;  3BR0 A;  2MGQ A;  2HXI A;  3NAU A;  3GTP J;  2NVQ J;  4EEF G;  2EZH A;  3JRB A;  3A03 A;  3FIS A;  1MBF A;  2CRG A;  1NK3 P;  1FEX A;  3G1O A;  3TW7 A;  2M34 A;  2VPR A;  1DU0 A;  5J1U A;  2Y9Y A;  4A3F J;  3HGY A;  2EZL A;  5EEA A;  2PMZ N;  1IV6 A;  4JX4 A;  1F36 A;  5GPA A;  3JRI A;  4XK4 A;  2NS8 A;  2NVX J;  3BT9 A;  1WGX A;  3O8H A;  4I6Z A;  2NVT J;  4A3M J;  1I3Q J;  3CQZ J;  2P81 A;  4A93 J;  5DS9 A;  5C4J J;  4UUT A;  1OFC X;  4JYK A;  3OSF A;  1JGG A;  1ZR2 A;  1AKH B;  4D7M A;  3BR1 A;  3JRH A;  2DN0 A;  3BR2 A;  3BR5 A;  1ETQ A;  3DCF A;  1YRN A;  2M2E A;  2O8K A;  1ZTR A;  2CUF A;  3BR6 A;  2NOG A;  4DZJ A;  2QF7 A;  4FIS A;  4G12 A;  4HNV A;  1RKW A;  2GM4 A;  5DTD A;  1HLV A;  2B63 J;  2JA7 J;  5M5W J;  3HGG A;  2EH3 A;  4AC0 A;  2EZK A;  2XSD C;  3L1P A;  2FX0 A;  2MW8 A;  3BTJ A;  5FLV A;  4BBS J;  2EQR A;  1D5Y A;  5E3O A;  3W6V A;  3GTK J;  1F43 A;  3ZQL A;  3ZQC A;  4QSH A;  5EGO A;  2ZB9 A;  1MBK A;  5EF6 A;  4DYQ A;  2XGE A;  4MIM A;  1VFC A;  1RR7 A;  2QCO A;  1VND A;  2JN6 A;  3SDG A;  1Q1V A;  3B6C A;  1IJW C;  2DJN A;  2M8G X; 
#chains in the Genus database with same CATH topology
 4AYB A;  2ID3 A;  4RAF A;  3E7L A;  4AM3 A;  2FML A;  3U2R A;  2LD5 A;  4Y3O A;  2CJJ A;  3IP4 B;  1QA6 A;  2IT0 A;  1G2H A;  2R7Q A;  3W2A A;  1ZEL A;  3SZP A;  2HXO A;  1FJL A;  3IRQ A;  1I5Z A;  1T0F A;  3IL2 A;  4UNO A;  1D0Z A;  3QPH A;  3S32 A;  4AIH A;  1WSU A;  2VB6 A;  3GLX A;  4BYY A;  3FKI J;  3D5S C;  3VYS B;  3IAS 2;  3E6D A;  3MN2 A;  4UB8 C;  2QSG X;  4M9S A;  1SFX A;  2HNH A;  3ZMV A;  4L9V A;  3OYH A;  1DPR A;  5AIQ A;  4PGG A;  1H9T A;  2X6W A;  2QBY B;  3E0J B;  1X2M A;  3N4M A;  1FY7 A;  4KJZ A;  3RCO A;  3F9K A;  2EFQ A;  5E1Z B;  1S7E A;  5ICC A;  3K4L A;  1SFK A;  4XID A;  2CUE A;  1E3O C;  3MEX A;  5EGO B;  4KA4 A;  4QTR A;  2BE5 F;  1LB2 A;  2E1M C;  4UV8 A;  3GFL A;  5ILV A;  2K4J A;  4JOM A;  4ABZ A;  3BPX A;  3FXU A;  3MAJ A;  1Z6R A;  3JRG A;  4PUS A;  4XLN F;  1V54 H;  3WTS C;  5HLT A;  2XF6 A;  5JHF A;  5FRO A;  2M0M A;  4HF1 A;  3K4M A;  1LPQ A;  1IGN A;  5HS8 A;  1O4X A;  4P5O A;  1IUY A;  1W1W E;  5CKT A;  5IYD J;  2F5F A;  4BBR J;  3L2V A;  2AQE A;  2PEX A;  2UV1 A;  4U7B A;  1S5L C;  3HZJ A;  4XIC A;  2WY7 Q;  2LDU A;  4PJJ A;  4D5F A;  1AU7 A;  3F23 A;  1FBS A;  3H1C A;  3U9G A;  1HW1 A;  1OIS A;  1Y0U A;  4ON0 A;  3ZMD A;  3VOD A;  1Z91 A;  3J81 Z;  5E79 C;  2ZJQ F;  2BVM A;  2W48 A;  5FKL A;  1LEA A;  5JLW A;  5J47 A;  3RYP A;  2JTV A;  4B3X A;  4BXU A;  4DIQ A;  1GT0 C;  1Y0N A;  3H5R A;  1JKO C;  1AWC A;  1YX5 A;  1G3Y A;  2ELJ A;  2HYG D;  1X3W B;  1LFU P;  1OJL A;  1ZGJ A;  3LFU A;  4RMN A;  1ETY A;  4L18 B;  2PQ8 A;  2V6E A;  2LF8 A;  1MBG A;  3FDY A;  1TQM A;  2HDD A;  2JA8 J;  4M3B A;  4QIW N;  3OYM A;  1OLT A;  2K40 A;  3ABL H;  2ECC A;  2BY0 A;  3I4M J;  2EIN H;  3TO7 A;  4YFN F;  1ZG5 A;  1MMD A;  1S7A A;  4AID A;  2FD5 A;  3RKY A;  2OU2 A;  2K9N A;  4XOR A;  2IEK A;  2L7K A;  2TDX A;  1E0E A;  1G3T A;  4WK8 F;  4XOT A;  2D1H A;  4RGS A;  1IXC A;  4MNU A;  1OCT C;  3ABK H;  3HB9 A;  3HTS B;  4UUS B;  1OCZ H;  5J4V A;  2KT0 A;  1A31 A;  1I27 A;  3K4N A;  1JHF A;  1ETX A;  4C3J J;  2O9L A;  5K7Z A;  2W85 A;  1LDJ A;  1YTY A;  3K70 D;  4PGH A;  2LKP A;  4LB6 B;  4IF4 A;  4I2O A;  1QRY A;  2EFN A;  5CLS A;  3ZQG A;  2K27 A;  3KYD B;  3AG1 H;  1Z9C A;  1OR7 C;  2DOA A;  2WB1 A;  1ZK8 A;  1HQC A;  1SD7 A;  3IWZ A;  4LFU A;  4Y13 A;  3KE2 A;  2VJ5 A;  1DDN A;  4IQJ A;  2JMW A;  2W4S A;  3KZI C;  2NS0 A;  2HVR A;  2P6S A;  2DOD A;  3DPU A;  1UFM A;  2PBI A;  3VDX A;  3BTI A;  4XN3 A;  3JAM K;  3OYE A;  2OTL I;  4CGZ A;  4UUV A;  4LIU A;  5DD4 A;  5D8L B;  3Q0V A;  3S1N J;  2O0Y A;  4XKW A;  2ECB A;  2GOX B;  4RAG A;  5IP6 A;  1KZH A;  2X1C A;  5E8I A;  3JRC A;  4G7Z F;  3GTO J;  2BHZ A;  1FYL A;  3LAP A;  4XRS G;  1XGO A;  1JKQ C;  1ZRD A;  2M5W A;  3ZMT A;  2JUC A;  4FT8 A;  3CCE I;  4ENJ A;  4D0P A;  4E7J A;  5LD2 C;  4IVN A;  1MND A;  2R7D A;  2IGM A;  4F92 B;  1R1T A;  1PUE E;  1R1V A;  3JTG A;  2VXD A;  1MDM A;  3KP7 A;  2NNY A;  4G7H F;  4CYC A;  3SEQ A;  1GVD A;  3CF5 F;  3M1C A;  3FM5 A;  2NVY J;  1X3Z B;  1BL0 A;  2L9V A;  2L01 A;  2E2J J;  2Y2Z A;  3CUO A;  3TL4 X;  4IZZ A;  1LEB A;  4Y7N J;  1R23 A;  3KLN A;  2DA1 A;  2XGD A;  3TP3 A;  1HST A;  1TTY A;  5CVU A;  2BV6 A;  4C3I J;  1B8I A;  2CMP A;  3GVA A;  2LSO A;  3HM5 A;  2OJE D;  2L2O A;  4X1E A;  5E3M A;  3CO7 C;  4E7S A;  1U3E M;  1YJN I;  2HZT A;  3JSP A;  1UAA A;  1ZRE A;  3KIO A;  2DA3 A;  3UNG C;  2XV4 S;  2CV1 A;  3L2W A;  2GBY A;  4E7L A;  1Y8Q B;  2COM A;  1ZAR A;  2XAS A;  1XG1 A;  4V2G A;  4HF0 A;  4NC6 A;  3WTY C;  4CHU A;  1IF1 A;  3HPH A;  4IL6 C;  2QKM B;  2VL8 A;  1YIT I;  4KFC A;  2UXX A;  5H2F C;  3BZ6 A;  5GAE J;  3QPL A;  4A3D J;  3EYY A;  3BOQ A;  1XSD A;  1VQ5 I;  3JSO A;  4JQF A;  1DPU A;  1MJA A;  2EFW A;  1R1U A;  3K1P A;  2X48 A;  3OOU A;  5EEH A;  5JHU A;  4WCG A;  2EZI A;  3FM3 A;  3SFI A;  2ZC2 A;  2WAQ A;  2Z5U A;  1PUF B;  1IDZ A;  1VQL I;  3BG3 A;  3K6G A;  1B8I B;  5JVT A;  1RET A;  2XAJ A;  2Q1Z B;  4N0B A;  1USS A;  3NRV A;  1HF0 A;  4ETS A;  3I64 A;  3I5U A;  2KIS A;  2QSF X;  5HLI A;  4YIF A;  4N4O B;  4BS9 A;  4A3E J;  1U78 A;  4W1U A;  5BPD A;  2E7W A;  2HZD A;  2MH9 A;  1DUX C;  1GUU A;  1WHU A;  2M7A A;  3K2A A;  2ZNZ A;  1UZC A;  5C44 J;  2LVS A;  2A5W A;  4OAY A;  2LKX A;  2NVU B;  1PDN C;  4DJA A;  5J1R A;  1S7O A;  1FSE A;  4CXF A;  3S1R J;  3H3V K;  1TLH B;  4ITV A;  3H0G J;  5D6F A;  4FX0 A;  4EAT A;  4A3G J;  3TDZ C;  4MQV A;  2RQQ A;  5EG0 A;  1BOB A;  4NC7 A;  1YOV B;  5CVJ A;  3IHU A;  2M1B A;  3BWG A;  2O6G E;  1RR8 C;  3DBR B;  1QQI A;  1X1B A;  4AU7 A;  2DQL A;  1G3S A;  1K79 A;  3HKZ A;  3PO2 J;  2K7L A;  3K2Z A;  3A01 B;  2HDW A;  5L3B A;  1XX5 A;  2LF7 A;  1ZG1 A;  5FD5 A;  2E2I J;  2VPL A;  2Z9O A;  1FP2 A;  2W82 A;  4L9T A;  4XRF A;  2HS5 A;  1G4D A;  2GIV A;  3GX4 X;  3S3N A;  3S2D J;  4OMY A;  1ZRC A;  1HBX G;  5J3L A;  5K5Q A;  1BA5 A;  2K3P A;  1I50 J;  1O7F A;  4NUB A;  2HKO A;  2HQR A;  2E36 A;  4JX5 A;  3HHH A;  3I58 A;  3HJE A;  2L9R A;  3GCM A;  1XDS A;  2A68 F;  2XRN A;  2I5U A;  3FHN A;  2CQK A;  4IX7 A;  5BOX A;  4XNF A;  3IKT A;  3QYB A;  4A3C J;  2MFZ A;  1HKQ A;  1J59 A;  4LLN A;  4YIR X;  1MBE A;  2L7F P;  2DBB A;  2EIK H;  4KMU X;  5F1J A;  1D3Y A;  3K1M A;  1ETV A;  5ICF A;  2CO5 A;  2QBY A;  3O3K A;  4C2T A;  2K9S A;  3BCB A;  1IDY A;  5HNH A;  4BAY A;  4XSZ F;  4M3E A;  3I4P A;  1PYV A;  1IV8 A;  4B43 A;  1EH6 A;  4GRI A;  2YX7 A;  3A01 A;  1PVE A;  1TC3 C;  1ZGW A;  3P7N A;  3HUG B;  4YRV A;  2V1U A;  4WXD A;  1FLI A;  1R4N B;  2ZFW A;  2B9S A;  3TKY A;  4BHC A;  1ORK A;  3CCR I;  3R0J A;  2OTJ I;  1SD5 A;  3LWF A;  3RSN A;  4LB5 A;  3PUB A;  3LSK A;  1U2W A;  4RLF A;  1H9G A;  2K9Q A;  2DLL A;  1R9T J;  4DZP A;  5HVQ C;  2PMU A;  3H9Q A;  3IH4 A;  2VQG A;  5LHI A;  1K4T A;  4AIK A;  2HXI A;  3NAU A;  1F5T A;  2VC0 A;  1HKS A;  3E5X A;  4EEF G;  3JRB A;  3SHF A;  4HDU A;  4XLE A;  3VFZ A;  3OWT A;  2Y69 H;  4J01 A;  3FIS A;  2BXY A;  4E7K A;  4BDY A;  1H0M A;  4M73 A;  1FEX A;  1OR7 A;  3S8P A;  2M34 A;  2Y0M A;  4RB3 C;  2P5V A;  1DU0 A;  1JI8 A;  3RPQ A;  4HG2 A;  2DFH A;  3KPH A;  2PMZ N;  1XDU A;  3QAH A;  5GAD J;  1RC9 A;  1F36 A;  3NEU A;  2NS8 A;  2NVT J;  1WGX A;  2OC6 A;  1D1B A;  4F7Z A;  1I3Q J;  2CV0 A;  4CA0 A;  3CQZ J;  5DS9 A;  3A1Y A;  4XLP F;  3VEP A;  2ICW G;  4HEA 2;  3AAF A;  3ZCO A;  2J5O A;  3R61 A;  1OFC X;  3EUH A;  4JYK A;  3H35 A;  5J6X A;  1ZR2 A;  2OZ6 A;  1QBJ A;  2PJP A;  4D7M A;  2VQC A;  1IN8 A;  3BR2 A;  3BR5 A;  4WX9 A;  1KYW A;  3LQQ A;  2CUF A;  1Z1D A;  1T6S A;  2YSR A;  4NBQ A;  4YEJ A;  2QF7 A;  2XVC A;  2YPR A;  3SZG A;  3BG6 A;  1NH3 A;  3H5A A;  5DTD A;  3WTV C;  4HNU A;  2JA7 J;  2F5D A;  3T8T A;  2EJR A;  4WWC A;  2MAB A;  3EDP A;  4A5N A;  5IT9 Z;  2EZK A;  2XSD C;  2QYO A;  4M72 A;  1R7J A;  4UVC A;  3V7R A;  2MW8 A;  4ZTF A;  4BBS J;  4XKB A;  3GFI A;  3CES A;  1VQO I;  3ZQC A;  4QSH A;  1T98 A;  3QOD A;  1MBK A;  3BCA A;  2LBF B;  1X1D A;  5EF6 A;  4DYQ A;  1YIJ I;  1QNT A;  2BY1 A;  1RR7 A;  4N9I A;  2QCO A;  2IS4 A;  2JN6 A;  2X6X A;  3SDG A;  3C18 A;  2DJN A;  3I9V 2;  2M8G X;  4L5J A;  4GXO A;  1MJ9 A;  4U0W A;  2O8X A;  1R5H A;  1TT5 B;  3O2P E;  1BIA A;  1KU2 A;  2L3D A;  1NK2 P;  3ZMS A;  2M7B A;  2XPW A;  3HOU J;  3ONQ A;  2KL4 A;  1YQA A;  1JTX A;  2Z33 A;  4P96 A;  4P9F A;  1YE9 A;  5TGT A;  1JKR C;  3CCS I;  1I6X A;  4HV5 A;  1WJD A;  2LRD A;  4GDF A;  2OF7 A;  2KP6 A;  1S8N A;  1QZE A;  1SFO J;  2EIJ H;  1TWF J;  4NQW A;  4CSW A;  3H3Z A;  1V4R A;  2DA5 A;  1H88 C;  4UXN A;  4HQE A;  1XCB A;  2WA0 A;  3JRA A;  3WU2 C;  5LEK A;  2FOW A;  2BY2 A;  3ABM H;  3AG4 H;  3V7C A;  1Z7L A;  2V9V A;  4UV9 A;  4BEH A;  4G9Y A;  5EZH A;  1X4O A;  1AOY A;  2PI0 A;  1ITY A;  4PJL A;  3J7A O;  4GYG A;  3K0L A;  1MMN A;  1FOX A;  4YII A;  4BUP A;  2VN2 A;  1OCC H;  2L02 A;  3ERM A;  4IXA A;  1WI3 A;  1GXP A;  1HW2 A;  3DF8 A;  3GZ5 A;  3MVP A;  5EDN A;  2LY2 A;  5IP7 J;  2JA5 J;  4E7H A;  2J5P A;  5FKO A;  1QPI A;  2L7M P;  2HPI A;  5C4X J;  2VLA A;  1ULY A;  1A6Q A;  4LK0 F;  4D1Q A;  2RGV A;  1UEL B;  4CDG A;  4CIC A;  3VOE A;  3EUA A;  2HPM A;  1WPK A;  1FTZ A;  3RKQ A;  1FYM A;  2XAU A;  5HLG A;  1W5S A;  2VJ4 A;  3HSR A;  3O6B B;  5HDN A;  2Y0S A;  1TL8 A;  4QLC U;  1XC5 A;  4ENK A;  1QZZ A;  4ZDP A;  1G6N A;  2GXG A;  3U21 A;  3HOV J;  1BW5 A;  1IC8 A;  3NQO A;  3M4O J;  2VBW A;  3OIO A;  5D5X B;  3GTM J;  2GAU A;  4XN0 A;  2D45 A;  2K5C A;  3PIP F;  2FMY A;  2COB A;  4MTD A;  4HBL A;  2L5Q A;  3WTU C;  2VBZ A;  5F1R A;  1T8I A;  1WH5 A;  2QQ9 A;  1M1E B;  3VYR B;  2RC4 A;  5B5E C;  3IRR A;  1XSX A;  1LNW A;  2KIM A;  2ME6 A;  2JWT A;  4N9H A;  2M3A A;  1A36 A;  4I02 A;  2E2H J;  2ZBK A;  4BKX A;  4R79 A;  3FHZ A;  1BJZ A;  1DP3 A;  3R60 A;  2K9M A;  5ICG A;  1ERD A;  2LLK A;  5FLM J;  5KK1 A;  3WTZ A;  3H3U A;  3QU6 A;  4J00 A;  4GFB A;  3VYT B;  2PMH A;  1O3T A;  2X1D A;  3C2H A;  4HV6 A;  1Z0X A;  1WKM A;  3MQ0 A;  2LY1 A;  3S17 J;  1IXS B;  3QU3 A;  3CC2 I;  4RGR A;  2ZME C;  3BDD A;  2CFO A;  1PUF A;  1HKT A;  2KJB A;  5JI6 A;  1Z6T A;  2BGC A;  5IYC J;  3SXY A;  3ROU A;  3TP0 A;  2I10 A;  4Q47 A;  3ZMU A;  2VE8 A;  4FCY A;  5IOZ A;  4BH9 A;  1ZH5 A;  3JRF A;  3FKJ A;  4KIS A;  3G6E I;  3S3M A;  3E6C C;  3I71 A;  3I59 A;  4HZF A;  2K4B A;  2CG4 A;  3PNV A;  2OAZ A;  2DCE A;  3HRS A;  4Y15 A;  2MLK A;  1X2N A;  3F8C A;  1FP1 D;  1TWH J;  3G4S I;  5B1A H;  4XLF A;  1FWZ A;  3PJR A;  2Y48 A;  1GLN A;  2V6C A;  2F4O B;  2M9H A;  5DCM B;  1OKR A;  1W7P B;  5L3F A;  4HPQ A;  2XSJ C;  4HDV A;  1WVR A;  3S1M J;  2P6T A;  2E1M B;  1U5T B;  3S14 J;  2VBX A;  1RRJ A;  2DJI A;  2XAF A;  3R4K A;  2FRH A;  3JTH A;  3BY6 A;  2DK8 A;  4NB5 A;  2XB0 X;  2M45 A;  5D5V B;  2R7Z J;  2V1X A;  1SAU A;  3ABT A;  1GV2 A;  2BW3 B;  1A35 A;  1L0O C;  2H8W A;  1X58 A;  2L54 A;  4HLX A;  5IPA A;  2C6Y A;  2GXA A;  5FRM A;  1TWC J;  2LC2 A;  1KU9 A;  1R22 A;  1LDD A;  1OCO H;  2B7E A;  3K7A J;  3PFI A;  4EGZ A;  4U87 A;  2W24 A;  3T8R A;  1IAW A;  4XRM A;  4NNJ A;  1LQ1 A;  5BS6 A;  3LQR A;  1QHG A;  4CO8 A;  2FF4 A;  1KU3 A;  2Z16 A;  5HOO A;  4C3H J;  2FA5 A;  4HW0 A;  3VB2 A;  3K4K A;  5E8G A;  2ELH A;  2IVM A;  2P7C B;  2ZME A;  1GV5 A;  2QA4 I;  1Z3Y A;  3GO5 A;  5F0C A;  3KYL A;  4D5C A;  5DEQ A;  3AG2 H;  1VQ8 I;  3MKL A;  2JSC A;  2RRE A;  1K4S A;  2ADU A;  2Y0S N;  2XPU A;  3GFM A;  1JT0 A;  1NHA A;  2WV1 A;  3G1L A;  1SMT A;  1A04 A;  1T33 A;  5L3C A;  2Y75 A;  4WXC A;  5IT3 A;  1TW3 A;  3PUF A;  3TOA A;  4XKV A;  1F4K A;  1P4X A;  1P4W A;  3L2R A;  2DMT A;  5DV5 A;  1TNS A;  3GUD A;  4KIT B;  3CMA I;  4M9X A;  2R92 J;  5H20 A;  4OIR F;  5IYB J;  1K6O A;  4K2E A;  2Q0O A;  2QQA A;  2HEO A;  2HKX A;  1F9N A;  3LST A;  2DDB A;  1RPW A;  3C2G A;  2ZJ2 A;  1FC3 A;  4MEY F;  4PCQ A;  5AIP A;  1Y1W J;  4BXF A;  3HBL A;  1KU7 A;  2DTR A;  5D5W B;  1I6H J;  2FBI A;  3ZOB A;  2LG4 A;  3GBG A;  3PSF A;  1LFB A;  4BAC A;  2X9D A;  5CYV A;  3ZPL A;  3G2B A;  3MZ8 A;  1GXQ A;  3QQA A;  3JAM Z;  5LGU A;  1KGS A;  2KQR A;  4EM2 A;  4IPA A;  4BQO A;  5LRS A;  3BQZ A;  4KNY A;  3W6K B;  1JT6 A;  1W36 C;  1G3W A;  2KRH A;  2V9P A;  1JHH A;  3K70 C;  1KQ9 A;  4TV7 A;  2CUZ A;  3KX2 A;  1W36 D;  2AS5 F;  1I1G A;  3CP2 A;  3ZXS A;  3BR3 A;  4II2 A;  4X0G A;  2H6C A;  1R6R A;  2RVC A;  2RV8 A;  3OL4 A;  4FQG A;  2NRA C;  2DA7 A;  4M3F A;  1SVO A;  4XLH A;  1IRG A;  3K9T A;  2AXT C;  3HRU A;  2E7X A;  2QM3 A;  3S3O A;  2EV0 A;  3KYC B;  2M30 A;  2WC2 A;  2WAE A;  3HHG A;  5F64 A;  3HTU A;  5BNG A;  2HOT A;  2O61 A;  4JX6 A;  1DGR M;  1FMV A;  4RGU A;  5FO5 A;  3LL7 A;  3SEZ A;  2JUG A;  1DU6 A;  2BXZ A;  2MBF A;  4LOC A;  1RUN A;  1B6A A;  2LH9 A;  1FZP B;  2IGK A;  2JSP A;  4C9Y A;  4OWR B;  2L9N A;  2DOF A;  3HSF A;  1E3P A;  1D1C A;  2M4K A;  2MLG A;  2KDO A;  4PDK A;  1FBQ A;  2G0E A;  2QEN A;  2W7N A;  4LD5 A;  3M3Y J;  3NAR A;  4OIN F;  3DPT A;  3MFK A;  1S72 I;  3ZN1 A;  1KYZ A;  4BDZ A;  1HW5 A;  4CZZ A;  2DYR H;  2JA2 A;  2LFB A;  2XKP A;  1R5G A;  3F0C A;  1YO5 C;  2XAQ A;  1TT0 A;  3B73 A;  3FMR A;  4FE7 A;  4BQN A;  5D4R A;  4MLO A;  1ZHF A;  4B8X A;  3I0T A;  3COA C;  3DTI A;  3BJ6 A;  1T95 A;  1K78 A;  3BZK A;  2HQN A;  3DKY A;  2VT2 A;  2RAE A;  2HU9 A;  1Y56 A;  3TGN A;  3WTT C;  5E3N A;  1IN7 A;  4O3M A;  3TOB A;  1UJ8 A;  1WCM J;  3CJT B;  2O03 A;  3FXQ A;  3HOY J;  4A3I J;  1YW8 A;  5CQG A;  2FNA A;  1ETW A;  2Y30 A;  1R4M B;  3F8M A;  2R0Q C;  5HDG A;  3FK6 A;  4Z2Y A;  2R7F A;  2QWW A;  4U0Y A;  4FHT A;  1CQT A;  1WJB A;  4CCO A;  3ASO H;  5BMZ A;  4XLA A;  1JJ6 C;  5LHH A;  5JLX A;  1MW7 A;  5F27 A;  2A69 F;  3SZT A;  3PQJ A;  1AHD P;  1P7J A;  2LY9 A;  5CVI A;  2ZKZ A;  4ZDL A;  2QUF A;  4IHW A;  2KLO A;  2QGU A;  2DOE A;  2JRT A;  2LOO A;  3FMS A;  1JUS A;  4PJ0 C;  4RS8 A;  3E1S A;  3HEF A;  1VQK I;  3FX3 A;  4BGD A;  3LAJ A;  3AL0 B;  2E1C A;  2EA2 A;  1LE8 A;  4EMS A;  3HXL A;  4KT6 A;  2MSY A;  3TO9 A;  3OYA A;  3RKX A;  3ZQI A;  1N75 A;  5FLX Z;  4H4K C;  3SQN A;  4UVB A;  2XRL A;  3D0S A;  3ZP5 A;  2R5Z B;  1XS9 A;  3PO3 J;  2L0K A;  1O3Q A;  2HQA A;  4XOP A;  3OYF A;  5JVG F;  1OCP A;  2KFD A;  5FLX K;  4XBF A;  2P4W A;  2XHK A;  2NVQ J;  5IT9 K;  2EZH A;  4MGR A;  3P5J A;  1WZ2 A;  4U0V A;  1XMA A;  2ACJ A;  2CRG A;  2NAZ A;  2OD5 A;  1LKX A;  3I3L A;  3K1N A;  2VKH A;  3ESW B;  4BJT A;  5CPR B;  4DOZ A;  3CCQ I;  2EZL A;  1R71 A;  3RI4 A;  1IV6 A;  4DQ2 A;  3A4C A;  3E97 A;  3V8L A;  4WF2 A;  1W5T A;  1YIO A;  5GPA A;  2A05 A;  2G7H A;  2QLZ A;  3ZMZ A;  4ZTJ A;  3D5R C;  4A93 J;  2ZJR F;  5C4J J;  1QO0 D;  3AL0 C;  1IZ1 A;  3V7S A;  3DBH B;  2IW5 A;  4LJZ F;  1B9M A;  2VOD A;  1JGG A;  1IRF A;  4LGW A;  4CCJ A;  3OIP A;  3BR1 A;  4XM3 A;  2Z3Y A;  2DU9 A;  5A2Q Z;  1QPM A;  4B09 A;  4NQW B;  2F2E A;  2Q2E B;  4EVI A;  4DZJ A;  1G59 A;  4PZJ A;  4FIS A;  1XD7 A;  4G12 A;  4I0A A;  1RKW A;  2GM4 A;  2F5C A;  5HS7 A;  1YYV A;  3MKY B;  1HLV A;  2B63 J;  4UY8 I;  5M5W J;  1WQ2 A;  1Z7U A;  3HGG A;  1YS6 A;  2EH3 A;  4YEL A;  4F52 A;  3L1P A;  1CGP A;  1IN4 A;  4P9U A;  1LVA A;  3F6O A;  1XGM A;  3BTJ A;  4MTE A;  3GZ6 A;  3W6V A;  3GTK J;  1U8R A;  1T39 A;  3QOE A;  2P7V B;  4A0X A;  3ZQL A;  5DCF A;  4EJV A;  5DM6 F;  2OA4 A;  2GIZ A;  5DYM A;  5EGO A;  3T5X A;  2ZB9 A;  3CLQ A;  3FXJ A;  2LYC A;  5E20 A;  3L00 A;  2XGE A;  4PJM A;  1VFC A;  3H9J A;  3ZR8 X;  3CJR B;  1VND A;  4N4N B;  1XCV A;  3CC4 I;  1W5C C;  3B6C A;  4ZYH A;  1WJA A;  2DMN A;  2QSH X;  3ZQH A;  2DW4 A;  1FTT A;  2K85 A;  2OBP A;  2EV6 A;  1MMS A;  4BJ5 C;  2VOP A;  3ISP A;  1T38 A;  1S29 A;  2JJ7 A;  2ZXH A;  1WJE A;  4F93 B;  1RZ4 A;  2WV0 A;  2A5Y B;  1S3J A;  2KRC A;  2M87 A;  4U7D A;  3HG9 A;  3NWT A;  4A3L J;  1WJ5 A;  2M8E A;  2WAD A;  2HGC A;  2EFO A;  3WTX C;  2X1E A;  5HDK A;  2FSW A;  3OS2 A;  3JW4 A;  1SD4 A;  2FBH A;  1IUF A;  3QPT A;  2BW3 A;  5DUK A;  1BBY A;  3FXL A;  4EM0 B;  3ZRG A;  3E3V A;  2X6O A;  2VJJ A;  1R36 A;  3HOX J;  3QRF F;  3S2H J;  1IW7 F;  3SYT A;  4RAY A;  2VE9 A;  1W0U A;  2FOK A;  2KHM A;  1LJ9 A;  1KON A;  5DDG A;  5B3S H;  2B0L A;  5E1W A;  2JVH A;  1LE8 B;  4G6Q A;  5GP9 A;  5J1Y A;  3HPG A;  5LFA A;  1VTN C;  4NC8 A;  3CMM A;  2KRF A;  4KMF A;  2XF7 A;  3ZN0 A;  1BC8 C;  3CDH A;  3J7A Y;  5D8K B;  1T56 A;  3BPV A;  5M5Y J;  2PN6 A;  4BE0 A;  4I76 A;  4XMY A;  2E71 A;  2K9L A;  4MEX F;  2HOA A;  2DT5 A;  1W7P A;  1YLF A;  2K3F A;  2KZG A;  2XB5 A;  4KN7 X;  3SDB A;  1X1P A;  2GLO A;  5FD6 A;  3E6M A;  2E34 A;  2HVQ A;  3KZZ A;  2VKE A;  2MH2 A;  4ZYA A;  1ZLK A;  4ZZL A;  1B9N A;  1ZQ3 P;  2H27 A;  3Q0W A;  1ONV A;  1MMA A;  2PMZ A;  1QGP A;  5FKK A;  3OOP A;  1ZAO A;  4PSX A;  1YI2 I;  2L4A A;  3IWF A;  1P4A A;  2FQ4 A;  3EET A;  4HNT A;  3F21 A;  4OIQ F;  4B47 A;  2LK2 A;  2MG4 A;  5B1B H;  2QQ8 A;  1BR4 A;  1MNE A;  3WTW C;  9ANT A;  2WTE A;  2D1V A;  2MD0 A;  1EKE A;  1NG6 A;  1TQP A;  2VQL A;  3OYG A;  4RA2 A;  4G94 A;  4LLL A;  2V79 A;  3N97 A;  3RPU D;  2F5V A;  2P0W A;  4I99 C;  2JPB A;  4BY7 J;  5DCM A;  1T2K A;  3PM1 A;  4M6V A;  2OPT A;  4HRI A;  2YU3 A;  1KQ0 A;  4OU0 A;  1SMY F;  3A2K A;  4WXH A;  1N77 A;  3OYC A;  4CYC B;  1ETK A;  2HR3 A;  4LG0 B;  1CF7 A;  2FE3 A;  3LSJ A;  3DPL C;  1WH7 A;  2V7F A;  3CLO A;  3L2U A;  1D8K A;  3GLL A;  5FKM A;  4C30 A;  4FAS D;  1ENH A;  1R5I D;  2W57 A;  4IHT A;  1FYK A;  5F04 A;  2HDC A;  5TIS C;  1J7K A;  4CCL A;  1TWG J;  2E1O A;  3WU1 B;  1BC7 C;  2YUS A;  1KQ8 A;  4ZYD A;  2V9K A;  3H5N A;  3GFJ A;  3CDI A;  2HYF A;  2GQQ A;  5FRN A;  3CO6 C;  3CCM I;  4GYI A;  2STT A;  4BE2 A;  1FOK A;  2IBD A;  2CQ7 A;  3IH3 A;  3SFZ A;  1LVK A;  3ERE D;  3TED A;  4LMY A;  1E2X A;  4LIT A;  2H1K A;  3JRE A;  5BQT A;  1FBU A;  4EJU A;  1YJ9 I;  1BI3 A;  5K7H A;  1V5E A;  2PG4 A;  3W2W A;  5EYR A;  1MSE C;  2KIF A;  3KCC A;  1I3A A;  3R0A A;  4KIF A;  4RB0 A;  3ULQ B;  3HDD A;  2R7S A;  4M71 A;  2ZSI B;  3W6J B;  1YG2 A;  3EYI A;  2RDP A;  3GWZ A;  4RAZ A;  3I55 I;  1CF7 B;  3TDU C;  5CJ9 A;  2QVO A;  4DYR A;  5IP9 J;  3A02 A;  3FXK A;  2W84 A;  2KKO A;  2HI3 A;  3TW6 A;  3L2C A;  3G3Z A;  3J81 K;  2EBI A;  2LTP A;  5KAI C;  1PP8 F;  4E7I A;  2W1O A;  5J8C A;  1BIB A;  4O5V A;  3IKV A;  1GVJ A;  1IRX A;  2ZNY A;  1QVU A;  2E19 A;  4I0B A;  5LLQ A;  1XPX A;  2MA3 A;  1HDD C;  4RGX A;  2XPV A;  1XSV A;  2EIM H;  2Y31 A;  3OR1 C;  2HQ5 A;  3HUG A;  3PNY A;  4BQA A;  1ZYR F;  1N25 A;  1T08 B;  1EF4 A;  1B4A A;  3ABU A;  4S0H B;  3FXM A;  3F8N A;  5K5O A;  3VYU B;  4ESF A;  3C1D A;  2E1N A;  2BY3 A;  4G6T B;  1ZG3 A;  2ID6 A;  3LA7 A;  3CZ6 A;  3PFY A;  2FQ3 A;  3RTR A;  1RUO A;  2BBY A;  3CUQ A;  4LK1 F;  4O6J A;  4XSX F;  2HOS A;  5HOD A;  2UUZ A;  3PNT A;  2VJI A;  2M0C A;  3S1Q J;  1SEU A;  3HRT A;  2QKL B;  4E7Z A;  1XGS A;  4MFE A;  2PJR B;  2TCT A;  2HVS A;  1YHQ I;  1SVM A;  4OIP F;  1UST A;  4XLC A;  4IHV A;  2LP0 A;  2XAH A;  4KN4 X;  3M7G A;  4M6X A;  4Y4R A;  5FFZ A;  4D9J A;  2DQR A;  1H89 C;  1WJC A;  2IS2 A;  3BLY A;  4L9N A;  4B3A A;  1A6I A;  1OQY A;  3L9F A;  4IOA F;  1MIJ A;  1RKT A;  3OYI A;  1K78 B;  5KNL A;  5CQE A;  5FGM A;  1QU3 A;  3EPZ A;  4DGW B;  3W2V A;  3CUQ C;  3M8E A;  2F6C A;  2JK3 A;  5J8F A;  1WWX A;  3WOD F;  4OAZ A;  2CW7 A;  1XMX A;  3ECH A;  3MKZ A;  3DEE A;  1VI0 A;  2FNP A;  4HST A;  5FFX A;  2X0L A;  2R5Y B;  5KVR A;  3D5L A;  4NDL A;  1WI9 A;  2JZY A;  1EJ9 A;  1UHM A;  5CVV A;  1LUJ B;  3IC7 A;  2O5R A;  4KDP A;  1RNL A;  3AKZ A;  4F91 B;  3CMY A;  3ZQF A;  2M4G A;  4KYW A;  3H92 A;  3HKZ N;  4Y17 A;  1REP C;  2MC4 A;  4GO1 A;  4IHX A;  4IRG A;  3RQ4 A;  2ISZ A;  2VBY A;  3RPU A;  2CV2 A;  3F6V A;  1SAN A;  4CCK A;  2DAO A;  4CCN A;  1S9H A;  3AFH A;  2BVL A;  3FBN B;  2VUM J;  2K86 A;  2DPD A;  2L4M A;  4EJW A;  1ZN2 A;  5F6F A;  2CWE A;  5JFR A;  3TMO A;  2HYJ A;  1XMK A;  2UWM A;  3OV8 A;  3GME A;  2DMU A;  2CU7 A;  3DU5 A;  1MJB A;  1FIP A;  4ESJ A;  4HLY A;  4ZYG A;  1W7P D;  5GPC A;  4V19 K;  4Q5S F;  1ZKG A;  4IOC F;  2V4J C;  2VAS A;  4BJ6 C;  3K10 A;  2MYS A;  4HX8 A;  1JTY A;  3BTL A;  3DTK A;  1XB4 A;  3C2B A;  1V5G A;  4HA8 A;  4EJO A;  4L5E A;  3R6S A;  1G8X A;  3KLO A;  3O8G A;  1MSF C;  2CQN A;  2XDV A;  3Q9S A;  4BXX J;  2GZW A;  3FXR A;  1FT9 A;  3L09 A;  1OYY A;  1Y1V J;  2WAQ N;  2QZ8 A;  1U0J A;  3ZGK A;  4BY1 J;  3REO A;  5E18 F;  4Y52 J;  5GTI C;  5D6E A;  1FIA A;  3GZN B;  4QPQ A;  5E17 F;  2XIG A;  4BU2 A;  2GOM A;  4DNC A;  4L0Z B;  1MBJ A;  4V2F A;  4BL0 B;  2CW8 A;  2GA1 A;  1J9I A;  2PLY A;  2X6Y A;  1Z77 A;  1JUM A;  2A6E F;  3QP6 A;  1NTC A;  1WRJ A;  2TRT A;  5DD8 A;  4S05 A;  1VF9 A;  3OR2 C;  2ZXW H;  4HAM A;  2H8R A;  2DTZ A;  2X51 A;  3WHB A;  5FB2 A;  2KDZ A;  4AYB N;  4CYD A;  3AG3 H;  3SJM A;  2VI6 A;  5ICE A;  2R7R A;  1U5T A;  1YS7 A;  4I01 A;  3WE2 A;  1MKM A;  2YR2 A;  5LRR A;  4G7O F;  1FMW A;  3JCU C;  2OUM A;  1J0R A;  1HOM A;  3HSE A;  3BZC A;  4QWQ A;  2R93 J;  3CCL I;  3CCV I;  3FIW A;  5ILS A;  1ZLJ A;  2IA0 A;  1JUP A;  1BM9 A;  4M9Z A;  3GTG J;  4RB2 C;  2Z99 A;  4LLG F;  1H8A C;  2CW0 F;  4R1H A;  2HWV A;  3GYH X;  4DW6 A;  2K02 A;  4AWX B;  1PP7 U;  1Y8R B;  1D0Y A;  4W97 A;  4PJN A;  2WWY A;  3KZY A;  1POG A;  3GEZ A;  2F4M B;  1MMG A;  1IRZ A;  4XON A;  3MZH A;  1FPQ A;  3LSI A;  1F1Z A;  3FBI B;  3DEW A;  2A61 A;  5FKN A;  3M9A A;  3V4G A;  5D5U B;  4IHY A;  2ZFU A;  2HFH A;  4ZC3 A;  3ASN H;  5DM7 F;  1K7A A;  2ELK A;  2NOJ B;  3CD6 I;  1BW6 A;  2ISY A;  1B72 B;  1FOW A;  2R3S A;  4ZJZ A;  3OYD A;  3E6B A;  2IP2 A;  1X19 A;  2E5Z A;  4OIO F;  2JRM A;  3CJQ B;  3MMY B;  2VON A;  3A03 A;  2V1N A;  3WGG A;  1MBF A;  1S6L A;  2DT6 A;  1R58 A;  1NK3 P;  4JBA A;  2STW A;  2VPR A;  3V42 A;  2Q2E A;  5J1U A;  1UB9 A;  2Y9Y A;  3LA2 A;  2CGP A;  2UZK A;  1Y39 A;  2BZT A;  4S04 A;  5EEA A;  2IXS A;  1X1A A;  3F22 A;  2DK5 A;  4JX4 A;  3FF5 A;  4Z6Y A;  2DPU A;  1GHC A;  3IUO A;  1JXS A;  3JRI A;  2NVX J;  4I6Z A;  3O8H A;  2OCC H;  1YW7 A;  2PJR A;  3G73 A;  3ZQ7 A;  4FX4 A;  2P81 A;  3DBL B;  3TQN A;  4I09 A;  4UUT A;  3DKW A;  5JR3 A;  1U6G A;  6PAX A;  2FXA A;  2LBF A;  3OSF A;  1V5F A;  1VQ4 I;  1WFX A;  1AKH B;  1BR1 A;  3JRH A;  2DN0 A;  2HTJ A;  2VKD A;  4YFX F;  3DCF A;  1YRN A;  2MD5 A;  2M2E A;  4HYE A;  3QP5 A;  4MQ9 F;  4XR6 A;  3LA3 A;  3DU6 A;  3KET A;  2IA1 A;  4A0Z A;  3BC8 A;  3P9C A;  5K1Y A;  2VC1 A;  3DP7 A;  3M1E A;  4JK1 X;  1TQI A;  3TBI A;  4E6K G;  1XN7 A;  1K6Y A;  1TZL A;  1J09 A;  1Z21 A;  4BHB A;  4AC0 A;  4HX7 A;  2IJL A;  4FET A;  1FOY A;  5E3O A;  1D5Y A;  3X2Q H;  3CF2 A;  1R00 A;  3N05 A;  2ZO4 A;  2KPM A;  1DGW Y;  1VQ9 I;  3RYR A;  5J40 A;  3KP6 A;  4E4H A;  2PX9 A;  2W25 A;  4YG2 F;  5LEJ A;  4P1W A;  5KHD A;  1Q1V A;  1EH7 A;  4NHJ A;  1R49 A;  2EQR A;  3Q5F A;  3KEO A;  3HC7 A;  5FJ8 J;  2IS6 A;  2DMP A;  1ON1 A;  3VSL A;  5F08 A;  4Q4Z F;  4GCV A;  5IOY A;  4UVA A;  2O3F A;  2Z1D A;  1RES A;  1OYW A;  3QYF A;  2ZME B;  4ENM A;  4ASN A;  5DUI A;  1IN5 A;  3LOC A;  3F8F A;  2CQX A;  2AO9 A;  3VPR A;  2WB1 N;  4IRH A;  4II3 A;  4YFK F;  1YW9 A;  3Q0U A;  3DWL E;  2O7O A;  1Q1H A;  3LMM A;  3U1D A;  3NWS A;  3HYI A;  4BQQ A;  2JPC A;  4CH7 A;  1Y6I A;  2DYS H;  4C2U A;  3OMY A;  2JA6 J;  3RZO J;  1OYI A;  3KP3 A;  4BNC A;  4X6A J;  1ETO A;  3T0Y A;  2G7U A;  3Q3S A;  4AD9 A;  4XRS A;  3JRD A;  3CCJ I;  3PSI A;  3WU0 A;  1HXD A;  4IHS A;  1U8B A;  1MBH A;  2FJ1 A;  2DA2 A;  2R7V A;  1IO2 A;  3RZD J;  4RM3 A;  4B4C A;  2H94 A;  2AQF A;  3HOT A;  4D7N A;  3HOW J;  1AA7 A;  5B66 C;  3DLA A;  2VT3 A;  2NXN B;  2X85 A;  5H6R A;  2ME0 A;  3J80 Z;  5HS9 A;  2P8T A;  4L0Y B;  1V3F A;  1EH8 A;  1FX7 A;  3K4B A;  5GAG J;  3WHC A;  1HCR A;  3EQL F;  1YJW I;  3S15 J;  5ED4 A;  3UR3 C;  5CVR A;  4KT5 C;  1P2F A;  2CQQ A;  3OYB A;  2CS3 A;  2E5N A;  2FBK A;  3G1M A;  3RDI A;  4AIJ A;  2H1L A;  2UXN A;  5LBQ A;  3JR9 A;  2VXZ A;  1GDT A;  1I1S A;  3GTL J;  3CP8 A;  3ZQQ A;  2R5Z A;  2KIQ A;  1ACI A;  1KA8 A;  2XC7 A;  1QHH D;  2A07 F;  2Q8K A;  3OYN A;  2HTS A;  5LGN A;  1DP7 P;  3DKX A;  4QPO A;  2R7W A;  3M8J A;  5KCM A;  2MC3 A;  5EG0 B;  2HOE A;  2N8G A;  2QQB A;  1VZ0 A;  1QVT A;  3H0D A;  2D5V A;  1UHS A;  2ZXJ A;  4GGG A;  4B1R A;  4PSW A;  2OZU A;  3B02 A;  1O7L A;  2ZSH B;  3F72 A;  1UG2 A;  4BEH B;  4XL9 A;  3K4J A;  1XGN A;  2RNG A;  5L3E A;  2LRE A;  4F3Q A;  1ZR4 A;  4M3D A;  2YU9 J;  1WJF A;  4P55 A;  1SC7 A;  5F0F A;  4UHT A;  4FTH A;  4AVZ A;  4EQQ A;  1MNM C;  1TWA J;  2CFX A;  2EFP A;  1K61 A;  3W3C A;  3C7J A;  4UB6 C;  2OQG A;  4AUX A;  1TBX A;  3FMQ A;  5L3D A;  1D8J A;  1D0X A;  4EM1 A;  3KP2 A;  3HRM A;  3RKW A;  3V8J A;  3E5U A;  5C3E J;  3OYL A;  4MFD A;  2NS7 A;  1P7I A;  1ZRF A;  1OMI A;  1BOA A;  2RNJ A;  3DEU A;  1MH3 A;  2FUG 2;  3BRO A;  4A69 C;  1STZ A;  1J2X A;  1UMQ A;  1OCR H;  2ZCW A;  3WG9 A;  3DFG A;  2FEZ A;  3ECO A;  1J5Y A;  1RI7 A;  5HLH A;  2DA6 A;  3G71 I;  2XUB A;  4DBR A;  1Z67 A;  4IKF A;  3BG5 A;  3RQI A;  1J75 A;  2DI3 A;  4J19 A;  1SVL A;  2V26 A;  4A3J J;  2H6B A;  2ETH A;  4IJA A;  4A12 A;  2CUJ A;  1APL C;  2R7O A;  4I7H A;  5EJC A;  1HDP A;  2RQP A;  4KIG A;  2DMQ A;  3PIO F;  2F4I A;  2XF5 A;  4G8X A;  3CCU I;  3I59 B;  3FZV A;  5A2Q K;  3DV8 A;  2WAF A;  2IRF G;  3HOS A;  4A3K J;  2AXL A;  3DXJ F;  5E1X A;  4CCM A;  4F55 A;  5HNF A;  1O3S A;  5L3G A;  4CUG A;  4RBO A;  3CTA A;  3MCZ A;  5M3F J;  3S2W A;  5H6Q A;  3CDL A;  1BN5 A;  3OSG A;  1P6R A;  4IEJ A;  4A3B J;  2JVG A;  3GTQ J;  2LNB A;  1FSH A;  3LNQ A;  2OV7 A;  3WG7 H;  3BTC A;  3LSM A;  3S16 J;  1U9O A;  2R5Y A;  3H36 A;  3BJA A;  5M3M J;  3MWM A;  1JE8 A;  1BR2 A;  4M6Y A;  3V8K A;  3F3X A;  1P9Q C;  3GTJ J;  2R4G A;  3OYJ A;  3L7W A;  4UUS A;  1ODD A;  3FXO A;  2CH0 A;  4ZZD A;  3BG9 A;  4MHG A;  1BJA A;  1D1A A;  1LFP A;  1YX3 A;  3WE3 A;  2RN7 A;  4ZH4 F;  2FU4 A;  1PJR A;  1U9N A;  4Q48 A;  5GTH C;  1B59 A;  1SFU A;  2XKO A;  2Y9Z A;  1HC8 A;  3HIF A;  4G6D A;  2DFE A;  1QZY A;  4IQ4 A;  2GA2 A;  2E60 A;  4RDU A;  4A6D A;  3HOZ J;  3H9G A;  4MO7 A;  1SD6 A;  2DDA A;  3KP5 A;  3UKG A;  3P9K A;  4H0E A;  5K7F A;  4M74 A;  3M07 A;  2VIX A;  3CCY A;  2EIL H;  4HX4 A;  3LSP A;  1DQU A;  2BYV E;  4HOB A;  2VQH A;  1TNT A;  3LFK A;  4OMZ A;  2P5L C;  1Z3X A;  2EWN A;  4BE1 A;  3IV5 A;  4RM2 A;  4E70 A;  1IXR C;  1TP4 A;  2LMD A;  5AON A;  3CME I;  3BQY A;  2NYX A;  3ELK A;  3MZY A;  2P5K A;  4A0Y A;  2R7X A;  1EV7 A;  1X1C A;  3LSG A;  4CZC A;  3D1N I;  3QOP A;  2LKS A;  3OS1 A;  4KIC A;  5ERI A;  4RB1 A;  2LR8 A;  4FE4 A;  1TW2 A;  1I39 A;  4A6E A;  3Q9V A;  5EEG A;  2BEO A;  2NNN A;  5D4S A;  1AKH A;  3M8F A;  1FNN A;  3P9I A;  1SFE A;  1Z05 A;  3F8B A;  4C2M J;  3OS0 A;  5ILU A;  4ZYE A;  4LIV A;  1JKP C;  1UG0 A;  1K83 J;  3KFW X;  1N78 A;  3A0B C;  4ANJ A;  4M3G A;  3I54 A;  3EUK L;  1BI0 A;  4IRI A;  1E3H A;  2L9S A;  2RKH A;  5EZG A;  5LHG A;  4DYC A;  1BI1 A;  2DFI A;  3RJP A;  4I98 B;  3E5Q A;  3L2Q A;  3PQK A;  1MD0 A;  3OIQ A;  4ZDO A;  1V55 H;  5F0H A;  1UCR A;  1W0T A;  2F48 A;  5TJJ A;  3I4N J;  1O3R A;  2IGO A;  3U1K A;  2JQ7 A;  3DLL F;  4PK4 A;  3DTE A;  4ESB A;  3KEY A;  3B6A A;  3WGI A;  2XRO A;  2VKV A;  3IH2 A;  4U88 A;  2ZXI A;  5E3L A;  4R8H A;  5GAH J;  1A5J A;  1O57 A;  1YFH A;  4JP0 A;  3QYE A;  1C0W A;  1B1B A;  2IAI A;  3OYK A;  3I56 I;  2DT7 B;  2CSO A;  1ON2 A;  2D2W A;  4EV0 A;  4BHP A;  5M5X J;  1VQN I;  1IG7 A;  3GXO A;  1VQ7 I;  3VSK A;  2X4H A;  3LSR A;  2R7U A;  5TRD A;  4KUM A;  5IY5 H;  2PFB A;  1RIO H;  3T1B A;  2A6T A;  1JJ8 C;  2R7T A;  3K69 A;  2E35 A;  1B72 A;  1NG7 A;  3ML6 A;  2DA4 A;  2EPF A;  2OCE A;  3DQV C;  1VQ6 I;  2A6H F;  3KP4 A;  3FWE A;  3MKW B;  3QPS A;  1X3U A;  3HL2 A;  4Y33 A;  4EGY A;  4IO9 F;  1P92 A;  3OL3 A;  4XKC A;  4PFO A;  3PL8 A;  1MGT A;  4L9J A;  1HSJ A;  1SAX A;  5LGT A;  1ZGA A;  4AVP A;  3RIR A;  2YS9 A;  3LSH A;  1LDK B;  3GF2 A;  4OOI A;  2L7Z A;  2IPQ X;  1T0F C;  2XGC A;  3I53 A;  2GWR A;  1YRN B;  2BOL A;  4A5M A;  3FK7 A;  5KAF C;  2AHQ A;  2G9W A;  1VQM I;  2KZV A;  3KEQ A;  1MH4 A;  2EK5 A;  2ESN A;  5BPI A;  3WGH A;  2CYY A;  3BR0 A;  2MGQ A;  3IAM 2;  4PFP A;  2IS1 A;  3CUQ B;  3GTP J;  2DO7 A;  3A0H C;  2WY8 Q;  4KIB A;  4LG0 A;  1L3L A;  4DBQ A;  2H09 A;  3G1O A;  3TW7 A;  2IGN A;  4A3F J;  3HGY A;  4EJT A;  3BJO A;  1OPC A;  3S93 A;  1VQP I;  4B48 A;  2EA4 A;  4XK4 A;  3BT9 A;  5J4Y A;  1U5T C;  4A3M J;  1E17 A;  4B44 A;  3EUH C;  4RLQ A;  2IA2 A;  2XGX A;  2Z2S B;  1D5V A;  2VOO A;  3VWB A;  2JT1 A;  1BI2 A;  3CJN A;  4LG3 A;  2A3S A;  4HF2 A;  1W4M A;  4XQF A;  2F5E A;  4A2U A;  1JGS A;  3J7Y J;  1MZB A;  1EA3 A;  2GXB A;  1ETQ A;  4L5I A;  2KMU A;  3BP8 A;  1ZTR A;  3QWL A;  2KJC A;  1IN6 A;  4HSR A;  2O8K A;  2I8D A;  3TO6 A;  1UHW A;  3BR6 A;  2V1D A;  3J80 K;  2NOG A;  2WBM A;  3GW2 A;  4HNV A;  3C3W A;  2XAG A;  3MD2 A;  2EB7 A;  2QEX I;  3CC7 I;  2W00 A;  2BHY A;  2EV5 A;  2FX0 A;  2ZJP F;  5FLV A;  2KIU A;  1HA8 A;  1F43 A;  3BG7 A;  3J7Z I;  1X4P A;  3K4C A;  2DFF A;  2OQR A;  5K5R A;  2YX4 A;  4ENN A;  4MIM A;  2ESH A;  4HQM A;  3OY9 A;  1XTA A;  2DXI A;  1MDM B;  1IJW C; 
#chains in the Genus database with same CATH homology
 2DMN A;  2ID3 A;  3ZQH A;  3E7L A;  5FJ8 J;  1FTT A;  1NK2 P;  2LD5 A;  2DMP A;  2CJJ A;  2XPW A;  3HOU J;  5F08 A;  2JJ7 A;  1G2H A;  1JTX A;  5IOY A;  1JKR C;  1RES A;  2HXO A;  1FJL A;  3LOC A;  4A3L J;  2OF7 A;  2CQX A;  3FKI J;  2AO9 A;  3VPR A;  2WB1 N;  1SFO J;  3MN2 A;  1TWF J;  3Q0U A;  2O7O A;  2DA5 A;  1H88 C;  1IUF A;  1X2M A;  2JA6 J;  3JRA A;  3RZO J;  4X6A J;  1S7E A;  2X6O A;  1ETO A;  3HOX J;  3S2H J;  1W0U A;  5EZH A;  3Q3S A;  4XID A;  2CUE A;  1E3O C;  1ITY A;  5EGO B;  4QTR A;  1LE8 B;  4XRS A;  5GP9 A;  5J1Y A;  3JRD A;  4ABZ A;  3JRG A;  1WI3 A;  3MVP A;  5EDN A;  1U8B A;  1T56 A;  5IP7 J;  1MBH A;  5M5Y J;  2FJ1 A;  2JA5 J;  5FKO A;  2DA2 A;  2L7M P;  1QPI A;  4I76 A;  5C4X J;  1IGN A;  2HOA A;  2XB5 A;  3RZD J;  1O4X A;  4B4C A;  2GLO A;  5IYD J;  4BBR J;  1FTZ A;  1WPK A;  3RKQ A;  2VKE A;  4D7N A;  1ZQ3 P;  3Q0W A;  3HOW J;  5FKK A;  1XC5 A;  2ME0 A;  4XIC A;  3HOV J;  1BW5 A;  1IC8 A;  4D5F A;  3M4O J;  2FQ4 A;  1AU7 A;  3OIO A;  3GTM J;  3WHC A;  1HCR A;  3S15 J;  2LK2 A;  2MG4 A;  2COB A;  9ANT A;  2CQQ A;  1WH5 A;  2W48 A;  5FKL A;  3G1M A;  5JLW A;  2ME6 A;  1GT0 C;  2JWT A;  1JKO C;  2E2H J;  3JR9 A;  1GDT A;  4BKX A;  3GTL J;  4BY7 J;  2R5Z A;  1LFU P;  1OJL A;  4M6V A;  1BJZ A;  3PM1 A;  2OPT A;  1ETY A;  2LLK A;  5FLM J;  1MBG A;  2HDD A;  4CYC B;  1ETK A;  4GFB A;  2JA8 J;  4M3B A;  3LSJ A;  4QIW N;  1WH7 A;  2K40 A;  2ECC A;  5FKM A;  3I4M J;  1ENH A;  1Z0X A;  5F04 A;  3S17 J;  2FD5 A;  2E1O A;  1TWG J;  2K9N A;  5EG0 B;  2IEK A;  2N8G A;  1PUF A;  1QVT A;  2D5V A;  2YUS A;  1UHS A;  1OCT C;  5IYC J;  4B1R A;  3HB9 A;  4FCY A;  3TP0 A;  2I10 A;  5IOZ A;  3JRF A;  4UUS B;  2KT0 A;  1UG2 A;  2IBD A;  1ETX A;  1ZR4 A;  4C3J J;  3IH3 A;  4M3D A;  5K7Z A;  2O9L A;  2YU9 J;  3TED A;  5F0F A;  4FTH A;  2H1K A;  3JRE A;  1MNM C;  1TWA J;  1X2N A;  1TWH J;  1K61 A;  4AUX A;  1QRY A;  5K7H A;  3ZQG A;  2M9H A;  5EYR A;  1MSE C;  3HDD A;  3S1M J;  5C3E J;  1ZK8 A;  4MFD A;  2NS7 A;  1P7I A;  3S14 J;  1MH3 A;  2JMW A;  4A69 C;  4DYR A;  5IP9 J;  1UMQ A;  3A02 A;  3BTI A;  2HI3 A;  2XB0 X;  3TW6 A;  2R7Z J;  2EBI A;  2LTP A;  3Q0V A;  3S1N J;  2DA6 A;  1GV2 A;  1X58 A;  5IPA A;  2ECB A;  3BG5 A;  5IP6 A;  3RQI A;  1TWC J;  4J19 A;  4A3J J;  3JRC A;  1QVU A;  2E19 A;  3K7A J;  1APL C;  3GTO J;  1HDD C;  4XRS G;  1JKQ C;  1HDP A;  2XPV A;  2Y31 A;  2DMQ A;  2HQ5 A;  4XRM A;  4C3H J;  4A3K J;  1EF4 A;  4S0H B;  4RBO A;  1GV5 A;  5F0C A;  4CYC A;  1GVD A;  5M3F J;  4D5C A;  1BL0 A;  2NVY J;  3CDL A;  3MKL A;  2ID6 A;  3OSG A;  4A3B J;  4IEJ A;  2E2J J;  2Y2Z A;  3GTQ J;  1JT0 A;  2Y0S N;  2XPU A;  3LNQ A;  2WV1 A;  3G1L A;  1T33 A;  4Y7N J;  2HOS A;  2DA1 A;  2XGD A;  3BTC A;  3TP3 A;  1U9O A;  5HOD A;  2R5Y A;  3S16 J;  2M0C A;  5M3M J;  3S1Q J;  4C3I J;  1B8I A;  4MFE A;  3HM5 A;  2TCT A;  4X1E A;  5E3M A;  3GTJ J;  4IHV A;  2DMT A;  2LP0 A;  4UUS A;  3BG9 A;  2R92 J;  5IYB J;  1H89 C;  1U9N A;  1RPW A;  2DA3 A;  2Y9Z A;  4B3A A;  1A6I A;  4RDU A;  2GBY A;  1RKT A;  1Y1W J;  3HBL A;  3HOZ J;  1I6H J;  3ZOB A;  4MO7 A;  1XG1 A;  3GBG A;  4V2G A;  1LFB A;  2X9D A;  2JK3 A;  3UKG A;  3QQA A;  1VI0 A;  3QPL A;  4A3D J;  5K7F A;  2R5Y B;  3BQZ A;  3CCY A;  4NDL A;  1JT6 A;  3LSP A;  2X48 A;  3OOU A;  2EZI A;  3CMY A;  3SFI A;  3ZQF A;  3HKZ N;  3IV5 A;  1PUF B;  1IDZ A;  4IHX A;  3BG3 A;  3BR3 A;  1B8I B;  3BQY A;  1RET A;  1SAN A;  3LSG A;  3D1N I;  1HF0 A;  2DA7 A;  2VUM J;  4M3F A;  4A3E J;  1U78 A;  4W1U A;  1GUU A;  3K2A A;  2HYJ A;  5C44 J;  2LVS A;  2LR8 A;  4FE4 A;  5BNG A;  2LKX A;  2HOT A;  4JX6 A;  5J1R A;  2DMU A;  1AKH A;  2CU7 A;  3S1R J;  1FIP A;  1DU6 A;  3H3V K;  5GPC A;  4C2M J;  4LOC A;  3H0G J;  1ZKG A;  1JKP C;  4A3G J;  1K83 J;  5EG0 A;  1JTY A;  3BTL A;  4M3G A;  2G0E A;  3C2B A;  3M3Y J;  3NAR A;  4L5E A;  3O8G A;  5EZG A;  1MSF C;  4BXX J;  4DYC A;  1Y1V J;  2WAQ N;  3PO2 J;  2LFB A;  4BY1 J;  3A01 B;  4Y52 J;  3F0C A;  1FIA A;  5F0H A;  2E2I J;  1W0T A;  1MBJ A;  4FE7 A;  4V2F A;  3I4N J;  4MLO A;  1Z77 A;  1JUM A;  1NTC A;  2TRT A;  3B6A A;  2VKV A;  1VF9 A;  3IH2 A;  5E3L A;  2RAE A;  3S2D J;  1A5J A;  5J3L A;  4JP0 A;  2H8R A;  5E3N A;  1BA5 A;  2DTZ A;  3WHB A;  1I50 J;  2IAI A;  2KDZ A;  4AYB N;  1WCM J;  3SJM A;  4JX5 A;  3HOY J;  2VI6 A;  4A3I J;  2L9R A;  5M5X J;  1IG7 A;  1ETW A;  2Y30 A;  2R0Q C;  1HOM A;  3FK6 A;  3LSR A;  2R93 J;  1CQT A;  4A3C J;  3FIW A;  1MBE A;  2L7F P;  5F1J A;  1JJ6 C;  1JJ8 C;  1JUP A;  1B72 A;  3GTG J;  1ETV A;  2DA4 A;  5JLX A;  5F27 A;  2K9S A;  1H8A C;  3QPS A;  1AHD P;  1P7J A;  2LY9 A;  1IDY A;  4DW6 A;  4IHW A;  4M3E A;  1JUS A;  3HEF A;  4W97 A;  3A01 A;  1TC3 C;  1POG A;  1ZGW A;  1IRZ A;  1LE8 A;  2YS9 A;  3DEW A;  5FKN A;  1ORK A;  2MSY A;  2L7Z A;  3ZQI A;  2XGC A;  4IHY A;  1YRN B;  2XRL A;  3FK7 A;  2K9Q A;  2R5Z B;  1XS9 A;  3PO3 J;  2AHQ A;  2ELK A;  1R9T J;  4DZP A;  1BW6 A;  2L0K A;  1MH4 A;  1B72 B;  3IH4 A;  1OCP A;  3BR0 A;  2MGQ A;  2HXI A;  3NAU A;  3GTP J;  2NVQ J;  4EEF G;  2EZH A;  3JRB A;  3A03 A;  3FIS A;  1MBF A;  2CRG A;  1NK3 P;  1FEX A;  3G1O A;  3TW7 A;  2M34 A;  2VPR A;  1DU0 A;  5J1U A;  2Y9Y A;  4A3F J;  3HGY A;  2EZL A;  5EEA A;  2PMZ N;  1IV6 A;  4JX4 A;  1F36 A;  5GPA A;  3JRI A;  4XK4 A;  2NS8 A;  2NVX J;  3BT9 A;  1WGX A;  3O8H A;  4I6Z A;  2NVT J;  4A3M J;  1I3Q J;  3CQZ J;  2P81 A;  4A93 J;  5DS9 A;  5C4J J;  4UUT A;  1OFC X;  4JYK A;  3OSF A;  1JGG A;  1ZR2 A;  1AKH B;  4D7M A;  3BR1 A;  3JRH A;  2DN0 A;  3BR2 A;  3BR5 A;  1ETQ A;  3DCF A;  1YRN A;  2M2E A;  2O8K A;  1ZTR A;  2CUF A;  3BR6 A;  2NOG A;  4DZJ A;  2QF7 A;  4FIS A;  4G12 A;  4HNV A;  1RKW A;  2GM4 A;  5DTD A;  1HLV A;  2B63 J;  2JA7 J;  5M5W J;  3HGG A;  2EH3 A;  4AC0 A;  2EZK A;  2XSD C;  3L1P A;  2FX0 A;  2MW8 A;  3BTJ A;  5FLV A;  4BBS J;  2EQR A;  1D5Y A;  5E3O A;  3W6V A;  3GTK J;  1F43 A;  3ZQL A;  3ZQC A;  4QSH A;  5EGO A;  2ZB9 A;  1MBK A;  5EF6 A;  4DYQ A;  2XGE A;  4MIM A;  1VFC A;  1RR7 A;  2QCO A;  1VND A;  2JN6 A;  3SDG A;  1Q1V A;  3B6C A;  1IJW C;  2DJN A;  2M8G X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...