2NVTJ

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvtJ00
1G2HA 5FKNA 3TP3A 1WH5A 2R5ZA 4IEJA 2LVSA 3A01A 1Z77A 5FKMA 1WPKA 3CQZJ 4BY1J 2ECCA 5K7ZA 1ETWA 3H3VK 2WAQN 5K7FA 3S1QJ 2CU7A 5F1JA 3HOUJ 4BY7J 4MFDA 1PUFA 1JT0A 2R93J 4M3GA 5E3LA 1TC3C 2X6OA 1AU7A 1FIPA 2M9HA 3JRGA 1UG2A 2GM4A 2GBYA 2XPUA 4MFEA 4J19A 2HQ5A 5BNGA 3JRFA 4I76A 1T56A 2M8GX 2XB5A 4JX4A 3ZOBA 3BR5A 4A3GJ 4A3KJ 1BJZA 2DMQA 1WGXA 1FTTA 2E2HJ 2L7FP 3SDGA 1IDZA 4A3JJ 4W97A 5C44J 2Y2ZA 1JTYA 1S7EA 1JKOC 3O8HA 4S0HB 5IYDJ 3S16J 4M3FA 3A03A 3TP0A 2Y31A 1MBEA 3JR9A 1IGNA 4FE4A 2D5VA 1MBJA 2FQ4A 4XICA 2HDDA 5IYBJ 5IOZA 2HXOA 1IJWC 3HOXJ 2VI6A 2W48A 2XB0X 3ZQFA 2B63J 3HM5A 4DYQA 5EEAA 3HB9A 2K9QA 2H1KA 3DEWA 2R5YA 2OF7A 3MKLA 4XRSG 4A3BJ 4C3IJ 2WB1N 1WCMJ 4AC0A 3IH2A 1NK3P 3WHBA 5EGOB 3HGYA 1P7IA 1H88C 2LK2A 2E2JJ 1FEXA 1ZR2A 3WHCA 4G12A 2R92J 4M3EA 1JTXA 3TW7A 2NS8A 2XPVA 2HI3A 1MSEC 1H89C 3C2BA 1AHDP 2FJ1A 2ME6A 2Y9ZA 3S2HJ 5M3MJ 1XS9A 4C2MJ 3IV5A 3PO3J 1X2MA 3BG3A 3HOYJ 4NDLA 2AHQA 5JLWA 3DCFA 3S2DJ 3F0CA 9ANTA 3CCYA 2JN6A 3GTJJ 1ZGWA 4A3CJ 3H0GJ 4GFBA 3BR3A 3S1NJ 5IOYA 3CDLA 4CYCB 4C3JJ 1A5JA 2FD5A 5C3EJ 5EG0B 1IDYA 2DMUA 2DA6A 4JP0A 4XRMA 4X6AJ 5IP9J 1JKPC 2NVTJ 1LE8B 1JJ8C 3SJMA 2LP0A 3IH3A 3QQAA 3BQYA 3Q0UA 3QPSA 3MVPA 4A3FJ 1B72A 2LLKA 5DTDA 1DU6A 1Q1VA 4BBRJ 1JUMA 4FCYA 1D5YA 4B3AA 3G1MA 2TRTA 2ME0A 5F0FA 1RESA 5F04A 2NVYJ 4B1RA 3MN2A 3D1NI 4Y52J 2EZIA 3B6CA 4Y7NJ 3HGGA 1ZKGA 2X48A 2EZHA 1MSFC 5FKOA 1Y1VJ 3I4MJ 1BA5A 3B6AA 1FJLA 1F43A 3FK6A 2IEKA 1ZTRA 4RDUA 3GTQJ 5J1RA 3SFIA 1JKQC 2NOGA 2L7MP 3HOZJ 2R0QC 1AKHA 2MW8A 1TWAJ 3GBGA 4BKXA 4D7MA 4JX5A 2DJNA 2VUMJ 1Y1WJ 2LTPA 4UUSB 3CMYA 3S15J 4QIWN 1JT6A 4MO7A 1W0UA 1RKTA 4DYCA 5IPAA 3JRBA 3K2AA 3JRCA 1IUFA 4A3EJ 1B8IB 3HOVJ 2XGDA 3BQZA 4D7NA 2NVQJ 2X9DA 1HOMA 1MBFA 4EEFG 2R7ZJ 1I6HJ 1MBKA 4ABZA 4D5CA 1GUUA 3JREA 2Y30A 1X2NA 1MBHA 4A3LJ 2DA1A 3BG9A 1A6IA 1VI0A 1TWHJ 1WI3A 2DA3A 1ITYA 3LSJA 1FTZA 2DN0A 1JJ6C 2LY9A 1QVUA 5FKKA 1MH4A 3FIWA 4IHYA 2RAEA 4DW6A 1ETVA 4L5EA 4XK4A 4A3DJ 2DA7A 3ZQCA 1LFBA 1NTCA 1U8BA 2FX0A 3RZDJ 3HKZN 3S17J 1U9OA 2I10A 2COBA 3S14J 3OSFA 1HDPA 2JWTA 3JRDA 1ETKA 2XGEA 3UKGA 2EH3A 2L7ZA 5J1YA 3LOCA 1JGGA 1JUPA 1ZK8A 1HCRA 1FIAA 2CQXA 5F27A 5M5WJ 3GTKJ 3I4NJ 2R5ZB 3A01B 1IG7A 3BR6A 2WV1A 4BXXJ 1MBGA 4IHVA 3OIOA 3HBLA 5J3LA 3BT9A 2AO9A 2L9RA 4IHXA 5IP6A 4A3MJ 1F36A 1EF4A 1OCPA 2JMWA 2NS7A 2LD5A 3TW6A 5F0HA 1PUFB 1Z0XA 3BR2A 3PM1A 2OPTA 3HDDA 2ECBA 3S1MJ 2ID3A 2E2IJ 3GTOJ 1TWFJ 3JRHA 2JK3A 4DZJA 4C3HJ 4V2GA 3BTLA 3M3YJ 1CQTA 1NK2P 1P7JA 3G1LA 3NAUA 2JJ7A 3G1OA 3LSPA 2LKXA 2JA6J 5GPCA 4A93J 2N8GA 1GDTA 3GTGJ 2M34A 2LFBA 4XRSA 2L0KA 2XSDC 1GVDA 2IBDA 4JYKA 1GT0C 1BL0A 1BW6A 2LR8A 2HOSA 5HODA 3OSGA 5JLXA 5E3MA 4A69C 3BTCA 3FISA 1UMQA 2DA2A 4W1UA 2PMZN 4I6ZA 1U9NA 5FLVA 1IV6A 1I50J 2EQRA 1H8AC 3K7AJ 5GPAA 1OFCX 1X58A 5F0CA 1ZR4A 2DMTA 2DMNA 1YRNB 1SANA 3ZQIA 5DS9A 2O9LA 3ZQGA 3S1RJ 2P81A 5EDNA 2EZKA 1RKWA 5C4XJ 1JKRC 3Q3SA 4JX6A 5EF6A 2VKVA 5EGOA 2CJJA 4FISA 5IYCJ 2YUSA 2MGQA 1GV2A 3JRIA 4DZPA 3RKQA 3L1PA 1WH7A 2VKEA 2GLOA 2ID6A 4D5FA 1OCTC 4V2FA 4XIDA 5EZGA 2HYJA 5EZHA 4AYBN 1QRYA 2QF7A 5E3OA 1ORKA 4QSHA 2DMPA 3GTMJ 3RQIA 1RPWA 3VPRA 1K61A 3LSGA 2MSYA 1OJLA 3BR1A 4MLOA 2O7OA 2XRLA 4HNVA 2CUEA 2DTZA 3FK7A 4CYCA 4MIMA 2YS9A 1GV5A 1ETXA 5EG0A 1T33A 1ETQA 5F08A 1DU0A 1VNDA 4IHWA 5J1UA 4M3BA 2JA5J 2O8KA 1O4XA 2XGCA 5GP9A 2CQQA 5C4JJ 1LE8A 1UHSA 2E1OA 1B72B 2QCOA 1APLC 2DA5A 2M0CA 3RZOJ 2K9SA 5FLMJ 4AUXA 3BTJA 1LFUP 2EBIA 1SFOJ 2IAIA 3IH4A 2MG4A 4M3DA 2Y0SN 3W6VA 3JRAA 4A3IJ 2DA4A 2EZLA 3BTIA 1K83J 3HEFA 5K7HA 3M4OJ 5M3FJ 4UUTA 2KDZA 4FTHA 1YRNA 1XG1A 2CUFA 1QPIA 1TWGJ 1AKHB 5E3NA 1E3OC 2VPRA 1R9TJ 2E19A 2KT0A 1HDDC 4FE7A 1QVTA 4BBSJ 1IC8A 3BR0A 2HOAA 4M6VA 1MH3A 2HXIA 2Y9YA 4UUSA 3HOWJ 1ENHA 1RR7A 1U78A 2ELKA 2YU9J 2JA7J 1MNMC 1IRZA 2H8RA 2K40A 1ETYA 1B8IA 3LSRA 3TEDA 3ZQLA 1POGA 3BG5A 3FKIJ 4QTRA 1ZQ3P 2NVXJ 4B4CA 3ZQHA 1BW5A 4DYRA 5FJ8J 1RETA 5EYRA 4RBOA 3QPLA 1VF9A 1JUSA 1HF0A 3GTLJ 3Q0WA 1I3QJ 5IP7J 2M2EA 2R5YB 1HLVA 5M5XJ 3NARA 4LOCA 3LNQA 1ETOA 2XPWA 2K9NA 3Q0VA 2G0EA 1XC5A 1VFCA 3PO2J 2JA8J 3E7LA 4X1EA 2ZB9A 1TWCJ 2CRGA 3GTPJ 2HOTA 2TCTA 3O8GA 1W0TA 5M5YJ 3OOUA 5FKLA 3A02A
chains in the Genus database with same CATH superfamily
5LGTA 3MKZA 3H36A 2VLAA 3I59B 5FKNA 1WH5A 1W7PA 5E8GA 3LSTA 1SVOA 3A01A 5D5UB 4LB5A 3OR2C 1G3SA 4S05A 2GA1A 2ECCA 2LKPA 2VC0A 5K7ZA 4AVZA 2JQ7A 3CC7I 1LFPA 3HRMA 3HOUJ 4BY7J 1UFMA 1YG2A 4M3GA 5E3LA 5D4SA 5IT3A 4Q4ZF 2PI0A 2EINH 4CCOA 4U7BA 4OU0A 2STWA 2UV1A 3DFGA 4HW0A 3W2WA 4BQQA 1VQLI 2R7SA 2GA2A 4DNCA 3JRFA 3LSKA 4I76A 1UHMA 3WGGA 4EJVA 2BY0A 3IL2A 5BOXA 1ZRFA 1DP7P 4P9UA 1BJZA 2R7FA 3HG9A 1J75A 2IW5A 2X4HA 2E2HJ 2X1EA 5D8LB 4XLCA 5FGMA 4A3JJ 2AQEA 2ZMEA 4F91B 2PJRA 5D4RA 5HOOA 2EWNA 5TRDA 1JKOC 3WTZA 3O8HA 4BXFA 4E4HA 3AG1H 4M3FA 2EIMH 3TP0A 2ZC2A 4XR6A 1V5FA 2O5RA 2HDCA 3GO5A 2VONA 4HG2A 3J7YJ 4FE4A 2DPDA 2XGXA 3CUOA 3OOPA 2PMZA 2FQ4A 3LFUA 4XICA 2CW8A 3WTWC 2HDDA 1O7LA 2ELJA 4CZCA 4CZZA 2IGKA 3HOXJ 4HPQA 2VI6A 4JOMA 2A07F 4I7HA 4ESFA 2XB0X 4EM1A 4BH9A 1U5TA 1OMIA 2KIFA 3SFZA 2XROA 4PJJA 2LBFB 3DEWA 1YW9A 3G4SI 2R5YA 2W24A 5GTIC 3MKLA 3QYEA 2LY1A 1WCMJ 2VT2A 1DGRM 4OIOF 4IHTA 1BIBA 1P7IA 2QQ9A 2YX4A 3L2WA 3KIOA 1FEXA 2FE3A 4G12A 4BJ5C 1A31A 1MDMB 4M3EA 2R92J 2OBPA 1WWXA 1H89C 3VOEA 2COMA 5D6FA 2ME6A 4CCMA 3C18A 3F8CA 1Z05A 3BG3A 4CDGA 3HOYJ 3U1DA 3R61A 4NDLA 2G7UA 3DCFA 3E6DA 4NC8A 1S9HA 5CJ9A 4A3CJ 3SZTA 4ANJA 3BR3A 3EYIA 4BNCA 3S1NJ 3KE2A 4FT8A 1YE9A 3C1DA 4CYCB 3CJNA 5DEQA 1GLNA 1A5JA 1WSUA 3CMAI 2ESNA 2FD5A 4CICA 5C3EJ 1YW7A 1IDYA 4YFKF 2YX7A 2LRDA 4UVBA 2XKPA 2XVCA 3IUOA 4XKVA 4E7LA 2IRFG 1AOYA 2CQKA 3ZMZA 4EQQA 2IA0A 4JP0A 3KEQA 3IKTA 2K02A 1KU2A 2NVTJ 1ULYA 1LE8B 2LY2A 4R1HA 1RR8C 1JJ8C 2XRNA 3IH3A 2QENA 3AG4H 2DFEA 3Q0UA 1YTYA 1XN7A 4KDPA 4I2OA 4M71A 5CVVA 2KRFA 4BYYA 1YX3A 3MVPA 4EGYA 3SDBA 4A3FJ 1B72A 2LLKA 4C2TA 2DI3A 1T2KA 4CH7A 1Y6IA 2LC2A 1D5YA 3U9GA 2NOJB 1WZ2A 3G1MA 4AVPA 2ME0A 2DJIA 1OYYA 3MD2A 4KN4X 1Z21A 2E36A 4ZYDA 4BUPA 2E35A 2OJED 4Y52J 2EZIA 2OZ6A 3B6CA 1PP7U 3HGGA 4LIUA 2EZHA 3C2HA 3ESWB 4L9TA 1Y1VJ 3I9V2 4L5JA 1BIAA 2E5NA 1BA5A 1KQ0A 3B6AA 1FJLA 1S6LA 2XF6A 1E2XA 4Q48A 3FZVA 2HGCA 3F8NA 4BS9A 2NVUB 4CHUA 3DBLB 1JKQC 1ON1A 2IVMA 5LRRA 1REPC 1TP4A 2E60A 4Q5SF 4BKXA 3CUQA 4JX5A 2DJNA 2VUMJ 3K70D 4IO9F 2F4OB 4QIWN 5JHUA 1KZHA 2P5VA 1TQPA 2FBKA 2YSRA 1WQ2A 2BYVE 3OS0A 1D0ZA 5K5OA 3BQZA 3K70C 5TISC 3KFWX 4A0ZA 3GZ5A 1NG7A 1W7PD 1X4OA 3ZMSA 1T95A 1I6HJ 2A6EF 3JTHA 5KHDA 2DYSH 1GUUA 1FNNA 4KJZA 2LKSA 1MBHA 4LB6B 2DA1A 3CJTB 1A6IA 3FXKA 1D0YA 2RVCA 5FRNA 1RUNA 1VI0A 3BDDA 3M1EA 3J7ZI 1QVUA 3X2QH 3KEOA 4JQFA 4UV9A 2RAEA 5CVJA 1J59A 2L2OA 1ETVA 4L5EA 4XK4A 4I09A 2KIUA 5DUIA 3PFIA 3ZQCA 4M73A 1U8BA 3HKZN 3S17J 3QYFA 3VYTB 5FRMA 2BHZA 3W2AA 2BGCA 1FLIA 1LJ9A 2HEOA 2XF7A 2COBA 2VE9A 2FF4A 4HF0A 1USTA 3OSFA 3S14J 2R7VA 4EM0B 1PJRA 2XGEA 2EH3A 4PZJA 1RI7A 1E3HA 1OCZH 4PJ0C 1FIAA 3W6KB 3COAC 1W7PB 3A01B 1R71A 2CV1A 2A3SA 2ZMEC 5HNFA 1H9TA 4OWRB 1KU7A 2L9RA 3H5AA 4IHXA 1S5LC 5IP6A 3PUBA 1Y39A 2GXAA 2LD5A 3RIRA 3TW6A 3B73A 1S29A 5F0HA 1OR7A 3BR2A 4H4KC 2OPTA 1VQOI 3S1MJ 2DK8A 1G4DA 3HRSA 1TWFJ 4PFPA 1WJEA 4ZDOA 2M4GA 1U5TC 1SAUA 1XGMA 2LYCA 4CCJA 2E1MC 2RNJA 4M74A 1CQTA 1NK2P 3TKYA 4D1QA 3I0TA 2VJ5A 3SQNA 3LSPA 2JJ7A 5CVUA 1LDDA 1XCBA 4J01A 4A93J 1YO5C 2N8GA 3MZYA 2DBBA 1YLFA 4M6YA 3VSLA 2ZMEB 4AU7A 4XRSA 2PJRB 3WTTC 2HYGD 1GVDA 5TGTA 3DPUA 3CD6I 1GT0C 5ILUA 1RNLA 5HODA 1TQIA 5LEKA 2ICWG 5CKTA 2QM3A 4A69C 1FYKA 3FISA 2BHYA 3ZPLA 1UMQA 2DA2A 3GXOA 4RB0A 3C7JA 4E7JA 1PDNC 1U5TB 2JVHA 2EQRA 2OCCH 2R3SA 2X6XA 6PAXA 1U3EM 4I0AA 1OFCX 2L9VA 4MTEA 1ZR4A 4MGRA 4GYIA 1ZN2A 4NUBA 4A6DA 5D6EA 3FMRA 1SANA 3A0BC 1ONVA 3IKVA 4KIBA 2R7TA 5DS9A 4Q47A 3E5XA 1FT9A 3ZQGA 3S1RJ 4LLGF 1RKWA 2QYOA 2VKVA 4FISA 4RAFA 2HS5A 4DZPA 3DPTA 3V8LA 1OCOH 5FFZA 1W36D 3ML6A 1X19A 4BQOA 3EPZA 5EZGA 1O3RA 3OYKA 2RGVA 2F5EA 1S7AA 4HQEA 1DDNA 4QPOA 2DODA 3IWZA 2F5CA 4AD9A 1W36C 1RPWA 3FXMA 2W1OA 1BC8C 2O8KA 3MKYB 3HIFA 4B8XA 1QZYA 2M3AA 2X85A 1RZ4A 2O7OA 3AL0C 5ICGA 2BVMA 2F5FA 3OYCA 4MIMA 2OAZA 4EJWA 3FM3A 1ZG3A 1IN5A 2H8WA 4II3A 2CQNA 4E6KG 1ZLJA 2P4WA 1T33A 2K9MA 1VQNI 4WXDA 1U2WA 3PNYA 4P55A 1ZGAA 3K9TA 4IHWA 3HTSB 4B44A 5LEJA 2JA5J 2XGCA 2CQQA 1UHSA 1B72B 4IX7A 3PSIA 2WTEA 4I99C 3CUQC 2HKOA 4XBFA 4OOIA 2CWEA 1SFOJ 2QKMB 4XOPA 2XAFA 2CUZA 2WA0A 2Y75A 2PQ8A 1R4NB 1JI8A 3ULQB 1GVJA 1Z6TA 4FQGA 4B43A 2VQHA 3JRAA 4A3IJ 3HPGA 4BHPA 4RAZA 3BTIA 1K83J 3HEFA 4LITA 5AIQA 3CF5F 4BQAA 1ZHFA 4UUTA 3WU2C 4FTHA 2P7CB 1O3TA 1XG1A 2WAQA 2KFDA 2CUFA 4G6QA 1HA8A 4M72A 4V19K 4LJZF 4N0BA 3CUQB 2E34A 4EATA 1I3AA 1MNEA 1QVTA 3NWTA 2ZFWA 4M6VA 4XLNF 4ENJA 4HRIA 3WTYC 2HXIA 2Y9YA 4UUSA 3HOWJ 2HQNA 3CDIA 2ELKA 2JA7J 1MNMC 2H8RA 5B5EC 2KPMA 1MMSA 1B8IA 4J00A 1P4WA 3KEYA 1POGA 2CMPA 1TL8A 1DP3A 1IN7A 3EDPA 2ZO4A 3I54A 2GXBA 2HKXA 1B59A 1ZQ3P 2VT3A 1P6RA 4MQ9F 2EJRA 2HDWA 5FJ8J 3TO6A 2XF5A 5EYRA 3QPLA 2GOXB 1MMNA 1FY7A 3K2ZA 1X1DA 1X1AA 1MJBA 2W85A 3F9KA 3GTLJ 1FBSA 3FKJA 3Q0WA 3OL3A 1OR7C 2H6BA 1E17A 2HQRA 4WX9A 3BZCA 2A69F 2HTJA 2M2EA 4AIDA 4KMUX 3M1CA 3KP4A 3I71A 2VQGA 1ETOA 2XPWA 2K9NA 4ZH4F 1XC5A 1FYMA 3RYPA 2DQRA 5F1RA 3E7LA 4OMYA 1TWCJ 4FX0A 3BJAA 2K3PA 3GTPJ 2HYFA 5KAFC 2H27A 3IRRA 2F2EA 1BI0A 2TCTA 3O8GA 3NRVA 3OOUA 5M5YJ 3LFKA 3N97A 2V6CA 3TP3A 2DYRH 2LVSA 2BOLA 1DPRA 3H9GA 5J4YA 2XSJC 3VDXA 3HTUA 1MMDA 3J81K 3IHUA 2VE8A 3H3VK 2A6TA 3KYLA 2DDAA 2F48A 2VQLA 2VJJA 5K7FA 5BS6A 4MFDA 1JT0A 1O7FA 2R93J 3DKWA 5TJJA 2VL8A 1R5GA 2GBYA 3MKWB 3CZ6A 2XPUA 4HX4A 2MH9A 1IN6A 3KETA 2M8GX 2XB5A 3HSEA 3S8PA 1NHAA 3R6SA 3L9FA 3E1SA 1TW2A 2EK5A 1WGXA 1SMTA 3QP6A 2RNGA 3LWFA 1FBUA 1IDZA 4W97A 1X3WB 2IT0A 4KT5C 2K4JA 4S0HB 3I4PA 2MH2A 3H9QA 3W2VA 3V7SA 1MBEA 1YS7A 1SEUA 2AS5F 1XSXA 3JR9A 5JVTA 4Z6YA 2MD0A 1R7JA 1MBJA 2CGPA 2ZNZA 3K69A 3OR1C 2HXOA 4YG2F 4PJMA 1IJWC 2IGNA 1SAXA 4XRFA 3FX3A 1O3SA 1HW2A 3ZQFA 4DYQA 3WTSC 4L9JA 4RA2A 3DU5A 3UR3C 1YW8A 4OAZA 2Q2EB 4OIRF 5HLGA 3LA7A 4A3BJ 1TNSA 2WB1N 4EVIA 5B3SH 2I5UA 2KQRA 5D8KB 2AQFA 3HGYA 1H88C 1JHFA 4IQ4A 4CSWA 2MD5A 2E2JJ 2DFFA 1P2FA 2H1LA 1XCVA 2O8XA 3GFJA 3HJEA 4ZZDA 2RREA 2HI3A 4XLAA 3ZMDA 1D5VA 3CC4I 1AHDP 2EFWA 1LVAA 2Y9ZA 5M3MJ 3S2HJ 4C2MJ 3IV5A 3FDYA 3M8EA 1PUEE 2AHQA 4HA8A 3CO7C 9ANTA 2FSWA 2JN6A 1C0WA 1R5HA 3SEQA 3SXYA 1VQKI 4GFBA 1XGOA 2JSPA 3I58A 4GO1A 1VQMI 3IC7A 1WJFA 5HDGA 2CW7A 2QWWA 2DW4A 3KLNA 3F3XA 2DMUA 2DA6A 2H09A 1H9GA 3KPHA 3LAPA 4XLEA 2EFQA 5KNLA 1V5GA 3WTUC 3GWZA 1FC3A 1JKPC 4D0PA 1ZRDA 2LP0A 4QLCU 4PFOA 5BQTA 3QQAA 1MGTA 3QPSA 5LBQA 2VJ4A 5DTDA 2D45A 5K5RA 1DU6A 3K4NA 1IXCA 1Q1VA 2J5OA 3OYFA 4B3AA 3BLYA 5JR3A 1N25A 2A61A 5CPRB 3ERED 5JFRA 3V8KA 1RESA 4ZZLA 2JRTA 1J0RA 4LLNA 4WK8F 3I55I 2VOPA 3KLOA 2EPFA 3MN2A 1MMAA 1ZG1A 3L2VA 1S7OA 3MZ8A 1ZKGA 3TL4X 4N4NB 1MSFC 3TOBA 5FKOA 5L3FA 2PLYA 2QVOA 2WAEA 2GXGA 1I27A 3LQQA 3KX2A 2NOGA 3ZN1A 5BPIA 2FOWA 1RIOH 1T39A 3HOZJ 2YR2A 1U0JA 4HV5A 2QQAA 3GBGA 1Y1WJ 1FP2A 1VQ7I 3J81Z 2CH0A 3QYBA 4UUSB 3CCEI 4IRIA 3AKZA 2NS0A 2OQGA 1RKTA 3JRBA 1S3JA 3K2AA 4A3EJ 1B8IB 2PX9A 1WJCA 3RPUA 5HDNA 5DCFA 4D7NA 2X9DA 1BI2A 1MBFA 3P5JA 1J7KA 2LREA 1K78A 2ESHA 1VQ8I 3J7AY 2R7ZJ 5HVQC 3JREA 2Y30A 3P9CA 1J5YA 4A3LJ 3HRUA 2O3FA 3AG2H 1SD6A 5KAIC 2DDBA 3FXRA 1W4MA 5E1XA 1AWCA 3LSJA 1OLTA 2DN0A 5E17F 3VWBA 4E7ZA 2LY9A 3OYDA 5FKKA 4IHYA 1DPUA 1EV7A 3LA3A 5J6XA 4A3DJ 4XORA 1YIJI 4CA0A 1LFBA 1J2XA 3K4MA 3IP4B 4CGZA 1KA8A 3CC2I 2I10A 4ZTFA 3TGNA 5KVRA 4BE0A 4K2EA 2OV7A 2XUBA 4JK1X 1HDPA 1O3QA 1E0EA 3CMMA 2JWTA 4XN0A 3JRDA 3V7CA 2PN6A 1W5TA 5H6QA 1Y0UA 3RCOA 5HLTA 3LOCA 1JGGA 1JUPA 1T08B 2KISA 3GTKJ 4U88A 3OYHA 1G59A 4ZYHA 3OYEA 1OKRA 4RB2C 1IG7A 1WHUA 3HYIA 4BXXJ 1MBGA 2NRAC 2IPQX 5J3LA 4F7ZA 1UCRA 3BY6A 1F36A 1OCPA 2IGOA 1SMYF 2NS7A 3VEPA 1D1CA 3GFLA 1GXQA 2RQPA 2DXIA 2W00A 3H9JA 1Z0XA 4Y3OA 5D5VB 3P9IA 3HDDA 3BPVA 5JVGF 2K7LA 3FM5A 1D0XA 2E2IJ 2LNBA 1SFXA 2GWRA 4KUMA 2DFHA 4CYDA 1IAWA 3QAHA 5CLSA 4RLQA 2GQQA 1P4XA 4C3HJ 1VTNC 3M3YJ 1D3YA 4RLFA 1Z1DA 1P7JA 2V1DA 3G1LA 3G1OA 4L5IA 1MKMA 2LKXA 5ICFA 4IKFA 1HKSA 3GX4X 3GFMA 1YS6A 1G8XA 2OTLI 3MMYB 2W82A 1GDTA 4A5MA 4HZFA 4A2UA 4ETSA 2WADA 2L0KA 3WGIA 4LG0A 3OWTA 2IBDA 1JGSA 1R49A 4JYKA 1EH7A 2A5YB 2Y48A 4G7OF 2Y0SA 1VQPI 3DPLC 4RM2A 2W25A 1WVRA 1Y8RB 4W1UA 4Y15A 3WG9A 1U9NA 2MFZA 4M9ZA 4UB6C 4E7IA 4EJUA 4KMFA 2DMNA 1ERDA 1YRNB 1I39A 4AIKA 1Y8QB 4U7DA 3OS1A 4MTDA 2P6SA 2W7NA 1FX7A 1JKRC 4JX6A 5EGOA 2V9VA 2YUSA 5D5WB 3M7GA 3JRIA 3RKQA 1K7AA 4KT6A 2FMYA 1YHQI 3CP2A 3L1PA 1MJAA 2LMDA 3WGHA 2K86A 2D1VA 2P8TA 5EZHA 4AYBN 1BM9A 3I56I 1NG6A 2MBFA 2DTRA 5EEHA 3PJRA 5FD5A 1I6XA 3RQIA 3HSFA 1B4AA 3KCCA 3VPRA 2GAUA 2MSYA 3LSGA 4IHSA 2DT5A 3BR1A 3WTXC 3F8BA 3F8FA 4ESBA 1XB4A 1Y0NA 2M0MA 1P92A 1GV5A 2QSGX 1TW3A 4OAYA 2Z1DA 1ETQA 1TZLA 2EV5A 2BV6A 4I02A 4HLYA 1YIOA 5DM7F 1KONA 2XHKA 3BCBA 3CJQB 3M07A 2MLKA 5GP9A 5J1UA 5GAGJ 5J4VA 2ISYA 5C4JJ 1QPMA 3OYAA 2W84A 3DU6A 1R22A 2K85A 4RGXA 4YFXF 2M45A 3BZKA 1APLC 4PUSA 2VASA 3T8RA 2DA5A 4HOBA 1N77A 2KLOA 4ZJZA 2M0CA 3RZOJ 3RPUD 4U87A 5FLMJ 4E7KA 5LRSA 4LIVA 5E1WA 4L0ZB 1TNTA 2B7EA 5CVRA 2MG4A 3G2BA 4BACA 2FXAA 5BPDA 5HS9A 2VBZA 3ZRGA 4RM3A 2KDOA 1PVEA 3RSNA 3RTRA 2DA4A 3H1CA 4G9YA 4U0WA 5F6FA 5FB2A 4C9YA 1S72I 4U0VA 5K7HA 4NBQA 4EGZA 2XAJA 3EETA 4GYGA 1YJWI 1R5ID 4H0EA 1ZREA 4KYWA 2KHMA 1QPIA 2FBIA 3VODA 4Y17A 2WY8Q 5E3NA 1RRJA 5HDKA 1E3OC 3A0HC 1G3YA 2KT0A 3LQRA 4XLPF 1R9TJ 1A04A 5CVIA 1BJAA 1KYZA 1QZEA 2F4IA 4OINF 1X4PA 1IC8A 2DOFA 5B1BH 1MH3A 3CCRI 1K6YA 3DTKA 4B3XA 4UHTA 1RR7A 3S3MA 5LD2C 1U78A 4RB3C 2YU9J 1IRZA 1D8JA 2DT7B 2MC3A 2A68F 3CJRB 3HC7A 3A2KA 1ETYA 3E3VA 2KP6A 3RJPA 3LSRA 3TEDA 1FOKA 2NNYA 1ZG5A 4G94A 1TT5B 1KQ9A 4QTRA 3BG6A 4F55A 2A05A 1FP1D 4YRVA 2OUMA 4NC7A 1ZLKA 1IXRC 2NVXJ 3ZQHA 1RETA 2IGMA 4RBOA 2JA2A 1VF9A 5DD8A 1TQMA 2HR3A 1J9IA 2DPUA 1JUSA 3K4JA 3SYTA 4ENMA 2BY1A 2CW0F 4U0YA 1J09A 1IF1A 2BW3A 1IO2A 1XDUA 3QPHA 2E1MB 4DBRA 5IP7J 1VQ6I 3ZXSA 2R5YB 3CO6C 3NARA 4LD5A 3LNQA 3FMQA 1FYLA 3CCVI 3DTIA 1CF7A 2G0EA 4P5OA 3KZIC 2MC4A 3MCZA 3F22A 2VN2A 3PO2J 2HFHA 5J8FA 2JA8J 3UNGC 3ZP5A 2K5CA 1W1WE 1N75A 2VQCA 2OZUA 4X1EA 2KIQA 3WU1B 1O57A 2R7RA 1HBXG 2MA3A 2OA4A 3WODF 1G2HA 4HNTA 2RC4A 2R5ZA 4WWCA 1SFEA 4MNUA 5ILSA 1PYVA 2FUG2 1Z77A 5FKMA 1TLHB 1F1ZA 1WPKA 2IJLA 4BY1J 4BGDA 4CCNA 2ZXJA 3L7WA 4PDKA 1ETWA 2V26A 2PBIA 1ZAOA 4ZC3A 2CU7A 3RI4A 3PIPF 1TC3C 2VBYA 4HSTA 2Z9OA 1QHGA 3JRGA 2IXSA 4UNOA 1UG2A 2GM4A 5E79C 2STTA 2FEZA 2E7WA 3ZOBA 2Z5UA 3ZMVA 3R4KA 1I5ZA 4PSWA 4A3KJ 2QLZA 2DMQA 2FNAA 3QOPA 2L7FP 3SDGA 4UXNA 4LG0B 5C44J 2Y2ZA 4FETA 1JTYA 1ODDA 4HF2A 2F6CA 5IYDJ 3S16J 3A03A 3QODA 3CLOA 3I5UA 4YIRX 3KYDB 3MFKA 3AL0B 4I98B 5IOZA 2WBMA 1H0MA 3OYNA 4D9JA 4S04A 2ZXIA 3HM5A 4OIPF 3C2GA 2LG4A 2L7KA 3NEUA 3QPTA 3QWLA 5EEAA 1X1BA 3HB9A 2H1KA 1G6NA 2AXTC 2CUJA 3DV8A 3J80K 1LUJB 4XRSG 3S3NA 1Y56A 4AC0A 3AFHA 3IH2A 1NK3P 3WHBA 1OCCH 5EGOB 1OYIA 5LHHA 2LK2A 1ZR2A 3WHCA 3V42A 1IN8A 1JTXA 4FHTA 3TW7A 5DM6F 1MSEC 3C3WA 3C2BA 1P9QC 1QBJA 1ZELA 2FJ1A 3B02A 2ZXHA 1BI1A 3ONQA 4I0BA 2HWVA 2R4GA 2QKLB 2O6GE 3PO3J 2EILH 3P7NA 2KZVA 2KKOA 2VKHA 3F0CA 1OISA 3GEZA 3GLLA 1USSA 2CSOA 3GTJJ 2IA2A 1ZGWA 4WF2A 3H0GJ 1QZZA 2X6YA 4IVNA 3GCMA 2LSOA 4Z2YA 2V1UA 1XSVA 3R0AA 3MQ0A 4KA4A 2Z2SB 2X6WA 4XRMA 4X6AJ 2FOKA 2R7DA 1D1BA 3TO9A 2UZKA 3I53A 3BQYA 3HKZA 3FXLA 4UUVA 3HHHA 3OMYA 2L9NA 2BY3A 4UVAA 4ON0A 3JCUC 3KZZA 2EV0A 1JUMA 4WXHA 5DV5A 4BBRJ 4FCYA 4EJOA 3JTGA 3HOSA 4YELA 1R1VA 2ZJQF 5F0FA 2GZWA 2ZJ2A 2NVYJ 3ZMTA 4B1RA 4YIFA 3D1NI 2VBXA 2PFBA 1TT0A 4Y7NJ 2O61A 2X48A 3H3ZA 2L4AA 2LBFA 4XSZF 1YITI 3FK6A 4RDUA 2VC1A 3ABKH 4PCQA 3DBHB 4MEYF 5J1RA 3SFIA 1SVMA 2H94A 3JW4A 4Y4RA 1AKHA 3KP2A 1LPQA 4PGHA 2LTPA 1OYWA 3U21A 1F9NA 3CMYA 3S15J 3OL4A 3OYJA 2DK5A 1MNDA 3HUGA 4XOTA 4BU2A 1W0UA 4DYCA 3WE2A 5IPAA 3JRCA 3VYRB 1IUFA 2IS2A 2E71A 4IZZA 4M6XA 3HOVJ 2XGDA 1HOMA 2NVQJ 3W3CA 2KJCA 3HSRA 3W6JB 5LHGA 3KYCB 4PSXA 1B9MA 2FMLA 3G71I 2XC7A 1X2NA 4DBQA 4BAYA 4UVCA 3N4MA 3EQLF 2Y69H 1U8RA 2M30A 3O2PE 3T8TA 1F4KA 3PUFA 3ASNH 1HKQA 5A2QZ 1Z67A 2EB7A 2DA3A 1T8IA 2F4MB 1BOBA 1ITYA 1FTZA 3F6VA 4UV8A 1JJ6C 3U1KA 2DQLA 5ERIA 2BW3B 1BI3A 3OYIA 1XTAA 4DW6A 4A0YA 4IXAA 1NTCA 4KIGA 4IOCF 1CGPA 1JXSA 3RZDJ 2V4JC 2OTJI 2ACJA 5DD4A 1B9NA 4YEJA 1CF7B 1VQ5I 1U9OA 2X51A 2UXXA 2M7BA 1FWZA 3TDUC 1IZ1A 4EMSA 3VYUB 4ZDLA 5JI6A 4NHJA 2ZKZA 3UKGA 3H35A 2KZGA 4UY8I 1ACIA 3EUAA 2EFPA 3L09A 1HCRA 5CQGA 2ZJPF 5M5WJ 5F27A 4CUGA 3J80Z 1UHWA 2R5ZB 1R1UA 1DQUA 5IT9K 2M7AA 2EV6A 3GZ6A 4L18B 1A6QA 3HPHA 3ZR8X 3HBLA 5HS8A 2EFNA 1BOAA 3K1PA 2H6CA 1OCRH 3ZQ7A 3JAMZ 2UXNA 1BC7C 2K4BA 1YOVB 3PM1A 1B1BA 1V55H 1YQAA 5DYMA 2ID3A 1VZ0A 2W4SA 5HLHA 1K4SA 3GTOJ 1WKMA 2BVLA 3LSMA 1W5CC 2Q0OA 1HXDA 2GOMA 1ZRCA 1V54H 5E20A 4EJTA 3BTLA 2L54A 3OYBA 2PEXA 2WWYA 1HQCA 4O5VA 2QUFA 3EUHA 4ZTJA 2JA6J 1IRGA 5GPCA 1KQ8A 1IW7F 2OC6A 3RPQA 2Z16A 2M34A 1FOWA 3CLQA 3L2UA 1WJAA 2XSDC 4XONA 1R1TA 1YJ9I 4GGGA 3CCLI 2DCEA 1BL0A 2LR8A 2Q8KA 3OSGA 5JLXA 3K4BA 2HQAA 3M9AA 4M9XA 3I3LA 2EA4A 2BY2A 4I6ZA 1EH6A 2KRCA 2Z3YA 3GMEA 4LGWA 5FLVA 2JSCA 1I50J 3ZMUA 5L3GA 3K7AJ 3T0YA 5F0CA 3E6MA 2LF7A 3DBRB 3ZQIA 4QPQA 3SHFA 1AA7A 2Z99A 1U6GA 2V9KA 5EDNA 5C4XJ 1YJNI 3Q3SA 5EF6A 5IYCJ 3L00A 3REOA 2WY7Q 1SFKA 2QSHX 2VKEA 2ID6A 5EJCA 1R4MB 4X0GA 5B1AH 2WV0A 3VB2A 5ILVA 1LEAA 2M8EA 2QF7A 5E3OA 2JPBA 2XKOA 1BBYA 3ABLH 3GF2A 1BR4A 1FMWA 4N9HA 1K61A 4LK0F 1OJLA 2VXDA 2FU4A 3JSOA 4MLOA 4O6JA 2XRLA 2CUEA 2DTZA 1HW5A 3D0SA 3G6EI 2YS9A 3ABTA 4HQMA 3BG7A 2V1XA 1ETXA 5EG0A 1A36A 1FPQA 3RKXA 3OY9A 3TO7A 1DU0A 3LSIA 3FXQA 3FHNA 3FWEA 4HBLA 2K9LA 2O03A 4M3BA 1O4XA 4YFNF 4BDZA 2E1OA 2NYXA 1L0OC 1UZCA 2VIXA 4N4OB 4M9SA 4HNUA 1Z7UA 4G8XA 4BDYA 4AUXA 1F5TA 3TMOA 3BTJA 3FXOA 2ISZA 3CP8A 4YIIA 3IH4A 3FMSA 3ZQQA 1P4AA 4M3DA 2LH9A 3DKYA 1HC8A 3RYRA 5K5QA 2K3FA 1XX5A 2XAUA 1QGPA 1XSDA 1QNTA 3MEXA 4BJ6C 4ENKA 2EZLA 3S2WA 3FXUA 2XV4S 3M4OJ 4P1WA 2ZJRF 2KDZA 2PMHA 5FFXA 1LDJA 3K4CA 4RGSA 3IWFA 2RV8A 4DOZA 4HV6A 3FBNB 4MQVA 3P9KA 2B0LA 3OIPA 2OU2A 3J7AO 4KN7X 1AKHB 2R7XA 5IT9Z 3ASOH 2E19A 3DEUA 5KCMA 3EUKL 1HDDC 2L5QA 2E7XA 3KP3A 4BBSJ 1LQ1A 4R79A 3BR0A 3WE3A 3HUGB 2W57A 3K10A 4GDFA 4IJAA 2XAHA 4BHBA 2MABA 4BEHA 4G7HF 1ENHA 4XNFA 2JPCA 1R36A 2IP2A 3ERMA 4G6TB 4KIFA 3O6BB 3PQJA 4OMZA 2VJIA 3ZQLA 3Q5FA 1Q1HA 2D2WA 1QQIA 1DGWY 1WJ5A 4AIJA 1WJBA 4GCVA 3AAFA 1I1SA 2TDXA 1FZPB 1YX5A 2KMUA 4EM2A 1BW5A 2MLGA 4C30A 2VOOA 1UAAA 1T0FA 3MAJA 4HLXA 2Y0MA 1DUXC 1UJ8A 1OQYA 3QP5A 4LK1F 4ENNA 4ESJA 3ECHA 5FD6A 1HF0A 5E8IA 2HTSA 2FQ3A 4E70A 3ZGKA 1RUOA 3NWSA 4TV7A 3LL7A 1HLVA 2DOAA 4F92B 3DLLF 2FNPA 4XN3A 2WB1A 2X0LA 2HVQA 3Q0VA 4ASNA 4C2UA 2DAOA 2HPMA 4ZDPA 2NNNA 1ON2A 2CRGA 3EUHC 1MD0A 5BMZA 4XLHA 4LFUA 2PMUA 4KISA 3L2QA 3DP7A 2HOTA 1W0TA 3BROA 4RS8A 1UG0A 1R23A 2HVSA 3A02A 2OCEA 1I1GA 1WRJA 2BZTA 4CO8A 4IEJA 3E6CC 1RC9A 2EA2A 2M1BA 3CQZJ 2R7QA 3K4KA 3GUDA 5L3BA 1IUYA 2CV0A 4RAYA 2QGUA 2WAQN 2E1NA 1STZA 2JRMA 3S1QJ 5F1JA 2KL4A 2YU3A 1PUFA 2KRHA 3CCJI 3L2RA 2X6OA 1AU7A 2V79A 1FIPA 2VPLA 2M9HA 2JVGA 2I8DA 1HKTA 3H5NA 4DJAA 3TDZC 4MFEA 1IV8A 4J19A 2HQ5A 5BNGA 4I01A 2L9SA 1T56A 4PK4A 5AONA 4JX4A 2A6HF 2A5WA 1OPCA 3ISPA 3OIQA 3BR5A 4DIQA 2EIJH 4A3GJ 4XLFA 1FTTA 5B66C 2JT1A 3KP5A 5H20A 3PNTA 1GHCA 3F6OA 3R0JA 3BP8A 1S7EA 5IY5H 1KYWA 4B47A 4ITVA 2L01A 5LFAA 3GFIA 3AG3H 3IAS2 2Y31A 3EYYA 1IGNA 3ROUA 3D5LA 2D5VA 5FO5A 1FOYA 1SD7A 5IYBJ 2W48A 5E18F 2B63J 4BJTA 1Z6RA 3V8JA 2K9QA 1PP8F 1YFHA 1XPXA 4F52A 2ELHA 2OF7A 2ZFUA 4KFCA 4C3IJ 4IPAA 5FLXK 2MYSA 1R00A 1SD4A 3F21A 3LMMA 4LLLA 4GRIA 3CCMI 3GVAA 3SEZA 2VXZA 2AXLA 4WXCA 2ADUA 3BJOA 1ZYRF 2NS8A 2XPVA 3A4CA 3D5SC 3H3UA 1TBXA 4O3MA 5GTHC 3K6GA 1SVLA 4PJLA 4R8HA 2BXZA 1FOXA 1XS9A 4P96A 3M8FA 1X2MA 1R58A 4AM3A 1ZARA 5JLWA 3S2DJ 1Z3YA 2P7VB 3BCAA 3CCYA 1K78B 1X3UA 4NB5A 2L4MA 2XAGA 3O3KA 2ZSIB 4BHCA 5IOYA 2QBYA 3CDLA 2GIZA 4KITB 4NQWA 1W5SA 2X1CA 4C3JJ 1EA3A 5HS7A 5EG0B 1XD7A 3BPXA 3HRTA 3DWLE 4CXFA 2KJBA 1QA6A 5IP9J 3QU6A 4LMYA 5J8CA 4HF1A 1FMVA 1LVKA 3OV8A 2HPIA 3SJMA 4NNJA 2UUZA 1XDSA 3T1BA 4XL9A 2PJPA 4G6DA 2JZYA 2FBHA 2IA1A 2X1DA 4HEA2 3TBIA 1D1AA 5DCMA 2TRTA 4BE1A 4Y13A 4PGGA 2VBWA 1FSHA 5F04A 3H5RA 2JTVA 2WC2A 3FF5A 3FXJA 3ECOA 3WTVC 5LLQA 3S93A 1YI2I 3GW2A 1QHHD 4A12A 2RKHA 3A1YA 3CCSI 1YYVA 3KP6A 1MJ9A 5J40A 2HZTA 4KICA 3I4MJ 5DUKA 3PIOF 2NAZA 4PJNA 3DQVC 3KP7A 5CQEA 1F43A 3CTAA 2M87A 2IEKA 1BR1A 1ZTRA 4IOAF 2Q2EA 1M1EB 3WU0A 4DQ2A 3GTQJ 1T0FC 1XGSA 2OQRA 2L7MP 2ZNYA 3ELKA 4IF4A 1QO0D 2QA4I 2R0QC 3MZHA 3N05A 2MW8A 1TWAJ 3BZ6A 4D7MA 1FSEA 2JUGA 1IN4A 3ABUA 3RKWA 4BEHB 4A0XA 3CMEI 2F5VA 3BC8A 1JT6A 4HYEA 4MO7A 4N9IA 4NC6A 3VSKA 4XSXF 3E5QA 4HDVA 2LF8A 3CESA 5A2QK 2M4KA 3I64A 2CYYA 4EEFG 5D5XB 1UB9A 3S3OA 3PSFA 5L3CA 5EEGA 1MBKA 5KK1A 2FRHA 4ABZA 4D5CA 1XMKA 2IS4A 4UB8C 2VKDA 2VODA 3BG9A 3CF2A 3LAJA 3RQ4A 2IS1A 2CFOA 1TWHJ 1WI3A 1X3ZB 4E7SA 2UWMA 4P9FA 2B9SA 3FHZA 1MH4A 3FIWA 3IRQA 3K0LA 1HW1A 2P5LC 2DA7A 4AWXB 2LDUA 5L3DA 3OYLA 2FX0A 3G3ZA 2CS3A 1ZGJA 3OS2A 4RB1A 1VQ9I 3ABMH 3F23A 5H2FC 3DEEA 1ETKA 2C6YA 1WJDA 1VQ4I 2L7ZA 5J1YA 1MIJA 1ZK8A 2Q1ZB 1MW7A 2CQXA 2DU9A 3JAMK 3I4NJ 4RMNA 5GAEJ 5FLXZ 1KU9A 2BEOA 3BR6A 5CYVA 2WV1A 5F64A 4AYBA 5GAHJ 4IHVA 3OIOA 3K4LA 3I59A 3BT9A 1V3FA 2AO9A 2P5KA 4BL0B 4GXOA 4A3MJ 1EF4A 3HL2A 2Z33A 2JMWA 4XKBA 5LGUA 5JHFA 1T38A 2M5WA 2CV2A 4HDUA 1PUFB 1JHHA 1Z7LA 2HOEA 4A5NA 2ECBA 5ICCA 3NQOA 3RDIA 1LKXA 3TOAA 3JRHA 2P6TA 2JK3A 2L02A 4DZJA 3R60A 4V2GA 4F3QA 1X1PA 1Z3XA 3Q9VA 1XMXA 5ICEA 2QZ8A 3HOTA 2XIGA 3CCQI 3NAUA 1JE8A 2RDPA 3ZN0A 1E3PA 1K6OA 1SD5A 3PFYA 1N78A 4XKWA 4IRHA 3GTGJ 2IS6A 2ETHA 4B48A 1ZH5A 2LFBA 3HHGA 3OYMA 2CFXA 3E6BA 2D1HA 2V1NA 2BBYA 2CQ7A 3V7RA 2HVRA 4LG3A 3HZJA 3WG7H 1BW6A 2HOSA 1A35A 4II2A 4F93B 3M8JA 5E3MA 3BTCA 4XKCA 2G9WA 2DFIA 2F5DA 5LHIA 2EIKH 2PMZN 3CDHA 1G3WA 3E97A 1R6RA 3PNVA 1IV6A 1H8AC 4HSRA 1SFUA 2R7UA 1Z9CA 4IRGA 5GPAA 1X58A 2DMTA 5H6RA 3OYGA 3F72A 3PL8A 4HX8A 1KU3A 2R7WA 2DT6A 2V9PA 3FBIB 2O9LA 4XM3A 4FX4A 2P81A 2EZKA 5ED4A 4ZYEA 4WCGA 2CJJA 2MGQA 1GV2A 3LA2A 2OD5A 4L0YB 1WH7A 2L3DA 1MDMA 2GLOA 4D5FA 1OCTC 4V2FA 1D8KA 2QQ8A 4XIDA 3BWGA 2HYJA 2BE5F 2DOEA 1QRYA 2QEXI 1TTYA 2O0YA 1ORKA 3PQKA 4MHGA 4QSHA 2DMPA 2G7HA 3TQNA 3GTMJ 3MWMA 4XMYA 4CCLA 2CO5A 5HNHA 1IXSB 2QBYB 5DDGA 2ZSHB 3DKXA 4NQWB 1T6SA 4E7HA 1L3LA 1LDKB 4HNVA 3FK7A 4CYCA 1MMGA 5J47A 3GLXA 2LOOA 2RQQA 5F08A 4AIHA 1FBQA 1VNDA 1EJ9A 2XASA 1K79A 1LE8A 3E5UA 1GXPA 1IRXA 1LNWA 3L2CA 2HZDA 1BR2A 2QCOA 3ZCOA 2K9SA 5DCMB 2QQBA 1LFUP 2EBIA 2V7FA 2VB6A 2IAIA 3IAM2 2DLLA 1Z91A 5GADJ 1B6AA 2Y0SN 3CCUI 3W6VA 1EKEA 1IRFA 4ZYAA 3GZNB 4DGWB 3E0JB 2ZCWA 2K27A 4KNYA 2NXNB 3KZYA 1LEBA 5K1YA 3QOEA 5LGNA 2HU9A 3F8MA 1X1CA 4EV0A 4RAGA 1T98A 5M3FJ 2RN7A 3LSHA 3S32A 2R7OA 2XAQA 3HXLA 2KIMA 4B09A 1YRNA 4RGUA 4Y33A 3GYHX 2V6EA 1V4RA 2P0WA 3V4GA 3VFZA 4IL6C 1TWGJ 1SC7A 4QWQA 3DF8A 2VPRA 3H92A 1HSJA 4L9VA 4OIQF 5AIPA 5FROA 4FE7A 3SZPA 4MEXF 2PG4A 2HOAA 2J5PA 4RGRA 2JUCA 2QSFX 1MZBA 2E5ZA 1EH8A 2WAFA 3G73A 1LB2A 4ZYGA 3RKYA 3BOQA 2K40A 4G7ZF 3H0DA 3VYSB 3BJ6A 3T5XA 3BG5A 3FKIJ 4FASD 1BN5A 1XMAA 4XQFA 2XDVA 4HAMA 3K1MA 5L3EA 2GIVA 3D5RC 1V5EA 2EFOA 3DTEA 4B4CA 4BXUA 1HSTA 4DYRA 1KGSA 4JBAA 4BE2A 2E1CA 3QU3A 5E1ZB 4IQJA 3JSPA 1QU3A 2DO7A 1I3QJ 2BXYA 3Q9SA 3QRFF 5M5XJ 2ZXWH 4HX7A 4LOCA 2ZBKA 3K1NA 3DLAA 5HLIA 2CG4A 2HNHA 3U2RA 1XGNA 1VFCA 2FA5A 4A6EA 2YPRA 3SZGA 2ZB9A 4BQNA 4CCKA 4L9NA 1WI9A 1K4TA 3DXJF 1WFXA 1G3TA 5FKLA 1NH3A 1S8NA 1UELB
chains in the Genus database with same CATH topology
1G2HA 5FKNA 3TP3A 1WH5A 2R5ZA 4IEJA 2LVSA 3A01A 1Z77A 5FKMA 1WPKA 3CQZJ 4BY1J 2ECCA 5K7ZA 1ETWA 3H3VK 2WAQN 5K7FA 3S1QJ 2CU7A 5F1JA 3HOUJ 4BY7J 4MFDA 1PUFA 1JT0A 2R93J 4M3GA 5E3LA 1TC3C 2X6OA 1AU7A 1FIPA 2M9HA 3JRGA 1UG2A 2GM4A 2GBYA 2XPUA 4MFEA 4J19A 2HQ5A 5BNGA 3JRFA 4I76A 1T56A 2M8GX 2XB5A 4JX4A 3ZOBA 3BR5A 4A3GJ 4A3KJ 1BJZA 2DMQA 1WGXA 1FTTA 2E2HJ 2L7FP 3SDGA 1IDZA 4A3JJ 4W97A 5C44J 2Y2ZA 1JTYA 1S7EA 1JKOC 3O8HA 4S0HB 5IYDJ 3S16J 4M3FA 3A03A 3TP0A 2Y31A 1MBEA 3JR9A 1IGNA 4FE4A 2D5VA 1MBJA 2FQ4A 4XICA 2HDDA 5IYBJ 5IOZA 2HXOA 1IJWC 3HOXJ 2VI6A 2W48A 2XB0X 3ZQFA 2B63J 3HM5A 4DYQA 5EEAA 3HB9A 2K9QA 2H1KA 3DEWA 2R5YA 2OF7A 3MKLA 4XRSG 4A3BJ 4C3IJ 2WB1N 1WCMJ 4AC0A 3IH2A 1NK3P 3WHBA 5EGOB 3HGYA 1P7IA 1H88C 2LK2A 2E2JJ 1FEXA 1ZR2A 3WHCA 4G12A 2R92J 4M3EA 1JTXA 3TW7A 2NS8A 2XPVA 2HI3A 1MSEC 1H89C 3C2BA 1AHDP 2FJ1A 2ME6A 2Y9ZA 3S2HJ 5M3MJ 1XS9A 4C2MJ 3IV5A 3PO3J 1X2MA 3BG3A 3HOYJ 4NDLA 2AHQA 5JLWA 3DCFA 3S2DJ 3F0CA 9ANTA 3CCYA 2JN6A 3GTJJ 1ZGWA 4A3CJ 3H0GJ 4GFBA 3BR3A 3S1NJ 5IOYA 3CDLA 4CYCB 4C3JJ 1A5JA 2FD5A 5C3EJ 5EG0B 1IDYA 2DMUA 2DA6A 4JP0A 4XRMA 4X6AJ 5IP9J 1JKPC 2NVTJ 1LE8B 1JJ8C 3SJMA 2LP0A 3IH3A 3QQAA 3BQYA 3Q0UA 3QPSA 3MVPA 4A3FJ 1B72A 2LLKA 5DTDA 1DU6A 1Q1VA 4BBRJ 1JUMA 4FCYA 1D5YA 4B3AA 3G1MA 2TRTA 2ME0A 5F0FA 1RESA 5F04A 2NVYJ 4B1RA 3MN2A 3D1NI 4Y52J 2EZIA 3B6CA 4Y7NJ 3HGGA 1ZKGA 2X48A 2EZHA 1MSFC 5FKOA 1Y1VJ 3I4MJ 1BA5A 3B6AA 1FJLA 1F43A 3FK6A 2IEKA 1ZTRA 4RDUA 3GTQJ 5J1RA 3SFIA 1JKQC 2NOGA 2L7MP 3HOZJ 2R0QC 1AKHA 2MW8A 1TWAJ 3GBGA 4BKXA 4D7MA 4JX5A 2DJNA 2VUMJ 1Y1WJ 2LTPA 4UUSB 3CMYA 3S15J 4QIWN 1JT6A 4MO7A 1W0UA 1RKTA 4DYCA 5IPAA 3JRBA 3K2AA 3JRCA 1IUFA 4A3EJ 1B8IB 3HOVJ 2XGDA 3BQZA 4D7NA 2NVQJ 2X9DA 1HOMA 1MBFA 4EEFG 2R7ZJ 1I6HJ 1MBKA 4ABZA 4D5CA 1GUUA 3JREA 2Y30A 1X2NA 1MBHA 4A3LJ 2DA1A 3BG9A 1A6IA 1VI0A 1TWHJ 1WI3A 2DA3A 1ITYA 3LSJA 1FTZA 2DN0A 1JJ6C 2LY9A 1QVUA 5FKKA 1MH4A 3FIWA 4IHYA 2RAEA 4DW6A 1ETVA 4L5EA 4XK4A 4A3DJ 2DA7A 3ZQCA 1LFBA 1NTCA 1U8BA 2FX0A 3RZDJ 3HKZN 3S17J 1U9OA 2I10A 2COBA 3S14J 3OSFA 1HDPA 2JWTA 3JRDA 1ETKA 2XGEA 3UKGA 2EH3A 2L7ZA 5J1YA 3LOCA 1JGGA 1JUPA 1ZK8A 1HCRA 1FIAA 2CQXA 5F27A 5M5WJ 3GTKJ 3I4NJ 2R5ZB 3A01B 1IG7A 3BR6A 2WV1A 4BXXJ 1MBGA 4IHVA 3OIOA 3HBLA 5J3LA 3BT9A 2AO9A 2L9RA 4IHXA 5IP6A 4A3MJ 1F36A 1EF4A 1OCPA 2JMWA 2NS7A 2LD5A 3TW6A 5F0HA 1PUFB 1Z0XA 3BR2A 3PM1A 2OPTA 3HDDA 2ECBA 3S1MJ 2ID3A 2E2IJ 3GTOJ 1TWFJ 3JRHA 2JK3A 4DZJA 4C3HJ 4V2GA 3BTLA 3M3YJ 1CQTA 1NK2P 1P7JA 3G1LA 3NAUA 2JJ7A 3G1OA 3LSPA 2LKXA 2JA6J 5GPCA 4A93J 2N8GA 1GDTA 3GTGJ 2M34A 2LFBA 4XRSA 2L0KA 2XSDC 1GVDA 2IBDA 4JYKA 1GT0C 1BL0A 1BW6A 2LR8A 2HOSA 5HODA 3OSGA 5JLXA 5E3MA 4A69C 3BTCA 3FISA 1UMQA 2DA2A 4W1UA 2PMZN 4I6ZA 1U9NA 5FLVA 1IV6A 1I50J 2EQRA 1H8AC 3K7AJ 5GPAA 1OFCX 1X58A 5F0CA 1ZR4A 2DMTA 2DMNA 1YRNB 1SANA 3ZQIA 5DS9A 2O9LA 3ZQGA 3S1RJ 2P81A 5EDNA 2EZKA 1RKWA 5C4XJ 1JKRC 3Q3SA 4JX6A 5EF6A 2VKVA 5EGOA 2CJJA 4FISA 5IYCJ 2YUSA 2MGQA 1GV2A 3JRIA 4DZPA 3RKQA 3L1PA 1WH7A 2VKEA 2GLOA 2ID6A 4D5FA 1OCTC 4V2FA 4XIDA 5EZGA 2HYJA 5EZHA 4AYBN 1QRYA 2QF7A 5E3OA 1ORKA 4QSHA 2DMPA 3GTMJ 3RQIA 1RPWA 3VPRA 1K61A 3LSGA 2MSYA 1OJLA 3BR1A 4MLOA 2O7OA 2XRLA 4HNVA 2CUEA 2DTZA 3FK7A 4CYCA 4MIMA 2YS9A 1GV5A 1ETXA 5EG0A 1T33A 1ETQA 5F08A 1DU0A 1VNDA 4IHWA 5J1UA 4M3BA 2JA5J 2O8KA 1O4XA 2XGCA 5GP9A 2CQQA 5C4JJ 1LE8A 1UHSA 2E1OA 1B72B 2QCOA 1APLC 2DA5A 2M0CA 3RZOJ 2K9SA 5FLMJ 4AUXA 3BTJA 1LFUP 2EBIA 1SFOJ 2IAIA 3IH4A 2MG4A 4M3DA 2Y0SN 3W6VA 3JRAA 4A3IJ 2DA4A 2EZLA 3BTIA 1K83J 3HEFA 5K7HA 3M4OJ 5M3FJ 4UUTA 2KDZA 4FTHA 1YRNA 1XG1A 2CUFA 1QPIA 1TWGJ 1AKHB 5E3NA 1E3OC 2VPRA 1R9TJ 2E19A 2KT0A 1HDDC 4FE7A 1QVTA 4BBSJ 1IC8A 3BR0A 2HOAA 4M6VA 1MH3A 2HXIA 2Y9YA 4UUSA 3HOWJ 1ENHA 1RR7A 1U78A 2ELKA 2YU9J 2JA7J 1MNMC 1IRZA 2H8RA 2K40A 1ETYA 1B8IA 3LSRA 3TEDA 3ZQLA 1POGA 3BG5A 3FKIJ 4QTRA 1ZQ3P 2NVXJ 4B4CA 3ZQHA 1BW5A 4DYRA 5FJ8J 1RETA 5EYRA 4RBOA 3QPLA 1VF9A 1JUSA 1HF0A 3GTLJ 3Q0WA 1I3QJ 5IP7J 2M2EA 2R5YB 1HLVA 5M5XJ 3NARA 4LOCA 3LNQA 1ETOA 2XPWA 2K9NA 3Q0VA 2G0EA 1XC5A 1VFCA 3PO2J 2JA8J 3E7LA 4X1EA 2ZB9A 1TWCJ 2CRGA 3GTPJ 2HOTA 2TCTA 3O8GA 1W0TA 5M5YJ 3OOUA 5FKLA 3A02A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1G2H A;  5FKN A;  3TP3 A;  1WH5 A;  2R5Z A;  4IEJ A;  2LVS A;  3A01 A;  1Z77 A;  5FKM A;  1WPK A;  3CQZ J;  4BY1 J;  2ECC A;  5K7Z A;  1ETW A;  3H3V K;  2WAQ N;  5K7F A;  3S1Q J;  2CU7 A;  5F1J A;  3HOU J;  4BY7 J;  4MFD A;  1PUF A;  1JT0 A;  2R93 J;  4M3G A;  5E3L A;  1TC3 C;  2X6O A;  1AU7 A;  1FIP A;  2M9H A;  3JRG A;  1UG2 A;  2GM4 A;  2GBY A;  2XPU A;  4MFE A;  4J19 A;  2HQ5 A;  5BNG A;  3JRF A;  4I76 A;  1T56 A;  2M8G X;  2XB5 A;  4JX4 A;  3ZOB A;  3BR5 A;  4A3G J;  4A3K J;  1BJZ A;  2DMQ A;  1WGX A;  1FTT A;  2E2H J;  2L7F P;  3SDG A;  1IDZ A;  4A3J J;  4W97 A;  5C44 J;  2Y2Z A;  1JTY A;  1S7E A;  1JKO C;  3O8H A;  4S0H B;  5IYD J;  3S16 J;  4M3F A;  3A03 A;  3TP0 A;  2Y31 A;  1MBE A;  3JR9 A;  1IGN A;  4FE4 A;  2D5V A;  1MBJ A;  2FQ4 A;  4XIC A;  2HDD A;  5IYB J;  5IOZ A;  2HXO A;  1IJW C;  3HOX J;  2VI6 A;  2W48 A;  2XB0 X;  3ZQF A;  2B63 J;  3HM5 A;  4DYQ A;  5EEA A;  3HB9 A;  2K9Q A;  2H1K A;  3DEW A;  2R5Y A;  2OF7 A;  3MKL A;  4XRS G;  4A3B J;  4C3I J;  2WB1 N;  1WCM J;  4AC0 A;  3IH2 A;  1NK3 P;  3WHB A;  5EGO B;  3HGY A;  1P7I A;  1H88 C;  2LK2 A;  2E2J J;  1FEX A;  1ZR2 A;  3WHC A;  4G12 A;  2R92 J;  4M3E A;  1JTX A;  3TW7 A;  2NS8 A;  2XPV A;  2HI3 A;  1MSE C;  1H89 C;  3C2B A;  1AHD P;  2FJ1 A;  2ME6 A;  2Y9Z A;  3S2H J;  5M3M J;  1XS9 A;  4C2M J;  3IV5 A;  3PO3 J;  1X2M A;  3BG3 A;  3HOY J;  4NDL A;  2AHQ A;  5JLW A;  3DCF A;  3S2D J;  3F0C A;  9ANT A;  3CCY A;  2JN6 A;  3GTJ J;  1ZGW A;  4A3C J;  3H0G J;  4GFB A;  3BR3 A;  3S1N J;  5IOY A;  3CDL A;  4CYC B;  4C3J J;  1A5J A;  2FD5 A;  5C3E J;  5EG0 B;  1IDY A;  2DMU A;  2DA6 A;  4JP0 A;  4XRM A;  4X6A J;  5IP9 J;  1JKP C;  2NVT J;  1LE8 B;  1JJ8 C;  3SJM A;  2LP0 A;  3IH3 A;  3QQA A;  3BQY A;  3Q0U A;  3QPS A;  3MVP A;  4A3F J;  1B72 A;  2LLK A;  5DTD A;  1DU6 A;  1Q1V A;  4BBR J;  1JUM A;  4FCY A;  1D5Y A;  4B3A A;  3G1M A;  2TRT A;  2ME0 A;  5F0F A;  1RES A;  5F04 A;  2NVY J;  4B1R A;  3MN2 A;  3D1N I;  4Y52 J;  2EZI A;  3B6C A;  4Y7N J;  3HGG A;  1ZKG A;  2X48 A;  2EZH A;  1MSF C;  5FKO A;  1Y1V J;  3I4M J;  1BA5 A;  3B6A A;  1FJL A;  1F43 A;  3FK6 A;  2IEK A;  1ZTR A;  4RDU A;  3GTQ J;  5J1R A;  3SFI A;  1JKQ C;  2NOG A;  2L7M P;  3HOZ J;  2R0Q C;  1AKH A;  2MW8 A;  1TWA J;  3GBG A;  4BKX A;  4D7M A;  4JX5 A;  2DJN A;  2VUM J;  1Y1W J;  2LTP A;  4UUS B;  3CMY A;  3S15 J;  4QIW N;  1JT6 A;  4MO7 A;  1W0U A;  1RKT A;  4DYC A;  5IPA A;  3JRB A;  3K2A A;  3JRC A;  1IUF A;  4A3E J;  1B8I B;  3HOV J;  2XGD A;  3BQZ A;  4D7N A;  2NVQ J;  2X9D A;  1HOM A;  1MBF A;  4EEF G;  2R7Z J;  1I6H J;  1MBK A;  4ABZ A;  4D5C A;  1GUU A;  3JRE A;  2Y30 A;  1X2N A;  1MBH A;  4A3L J;  2DA1 A;  3BG9 A;  1A6I A;  1VI0 A;  1TWH J;  1WI3 A;  2DA3 A;  1ITY A;  3LSJ A;  1FTZ A;  2DN0 A;  1JJ6 C;  2LY9 A;  1QVU A;  5FKK A;  1MH4 A;  3FIW A;  4IHY A;  2RAE A;  4DW6 A;  1ETV A;  4L5E A;  4XK4 A;  4A3D J;  2DA7 A;  3ZQC A;  1LFB A;  1NTC A;  1U8B A;  2FX0 A;  3RZD J;  3HKZ N;  3S17 J;  1U9O A;  2I10 A;  2COB A;  3S14 J;  3OSF A;  1HDP A;  2JWT A;  3JRD A;  1ETK A;  2XGE A;  3UKG A;  2EH3 A;  2L7Z A;  5J1Y A;  3LOC A;  1JGG A;  1JUP A;  1ZK8 A;  1HCR A;  1FIA A;  2CQX A;  5F27 A;  5M5W J;  3GTK J;  3I4N J;  2R5Z B;  3A01 B;  1IG7 A;  3BR6 A;  2WV1 A;  4BXX J;  1MBG A;  4IHV A;  3OIO A;  3HBL A;  5J3L A;  3BT9 A;  2AO9 A;  2L9R A;  4IHX A;  5IP6 A;  4A3M J;  1F36 A;  1EF4 A;  1OCP A;  2JMW A;  2NS7 A;  2LD5 A;  3TW6 A;  5F0H A;  1PUF B;  1Z0X A;  3BR2 A;  3PM1 A;  2OPT A;  3HDD A;  2ECB A;  3S1M J;  2ID3 A;  2E2I J;  3GTO J;  1TWF J;  3JRH A;  2JK3 A;  4DZJ A;  4C3H J;  4V2G A;  3BTL A;  3M3Y J;  1CQT A;  1NK2 P;  1P7J A;  3G1L A;  3NAU A;  2JJ7 A;  3G1O A;  3LSP A;  2LKX A;  2JA6 J;  5GPC A;  4A93 J;  2N8G A;  1GDT A;  3GTG J;  2M34 A;  2LFB A;  4XRS A;  2L0K A;  2XSD C;  1GVD A;  2IBD A;  4JYK A;  1GT0 C;  1BL0 A;  1BW6 A;  2LR8 A;  2HOS A;  5HOD A;  3OSG A;  5JLX A;  5E3M A;  4A69 C;  3BTC A;  3FIS A;  1UMQ A;  2DA2 A;  4W1U A;  2PMZ N;  4I6Z A;  1U9N A;  5FLV A;  1IV6 A;  1I50 J;  2EQR A;  1H8A C;  3K7A J;  5GPA A;  1OFC X;  1X58 A;  5F0C A;  1ZR4 A;  2DMT A;  2DMN A;  1YRN B;  1SAN A;  3ZQI A;  5DS9 A;  2O9L A;  3ZQG A;  3S1R J;  2P81 A;  5EDN A;  2EZK A;  1RKW A;  5C4X J;  1JKR C;  3Q3S A;  4JX6 A;  5EF6 A;  2VKV A;  5EGO A;  2CJJ A;  4FIS A;  5IYC J;  2YUS A;  2MGQ A;  1GV2 A;  3JRI A;  4DZP A;  3RKQ A;  3L1P A;  1WH7 A;  2VKE A;  2GLO A;  2ID6 A;  4D5F A;  1OCT C;  4V2F A;  4XID A;  5EZG A;  2HYJ A;  5EZH A;  4AYB N;  1QRY A;  2QF7 A;  5E3O A;  1ORK A;  4QSH A;  2DMP A;  3GTM J;  3RQI A;  1RPW A;  3VPR A;  1K61 A;  3LSG A;  2MSY A;  1OJL A;  3BR1 A;  4MLO A;  2O7O A;  2XRL A;  4HNV A;  2CUE A;  2DTZ A;  3FK7 A;  4CYC A;  4MIM A;  2YS9 A;  1GV5 A;  1ETX A;  5EG0 A;  1T33 A;  1ETQ A;  5F08 A;  1DU0 A;  1VND A;  4IHW A;  5J1U A;  4M3B A;  2JA5 J;  2O8K A;  1O4X A;  2XGC A;  5GP9 A;  2CQQ A;  5C4J J;  1LE8 A;  1UHS A;  2E1O A;  1B72 B;  2QCO A;  1APL C;  2DA5 A;  2M0C A;  3RZO J;  2K9S A;  5FLM J;  4AUX A;  3BTJ A;  1LFU P;  2EBI A;  1SFO J;  2IAI A;  3IH4 A;  2MG4 A;  4M3D A;  2Y0S N;  3W6V A;  3JRA A;  4A3I J;  2DA4 A;  2EZL A;  3BTI A;  1K83 J;  3HEF A;  5K7H A;  3M4O J;  5M3F J;  4UUT A;  2KDZ A;  4FTH A;  1YRN A;  1XG1 A;  2CUF A;  1QPI A;  1TWG J;  1AKH B;  5E3N A;  1E3O C;  2VPR A;  1R9T J;  2E19 A;  2KT0 A;  1HDD C;  4FE7 A;  1QVT A;  4BBS J;  1IC8 A;  3BR0 A;  2HOA A;  4M6V A;  1MH3 A;  2HXI A;  2Y9Y A;  4UUS A;  3HOW J;  1ENH A;  1RR7 A;  1U78 A;  2ELK A;  2YU9 J;  2JA7 J;  1MNM C;  1IRZ A;  2H8R A;  2K40 A;  1ETY A;  1B8I A;  3LSR A;  3TED A;  3ZQL A;  1POG A;  3BG5 A;  3FKI J;  4QTR A;  1ZQ3 P;  2NVX J;  4B4C A;  3ZQH A;  1BW5 A;  4DYR A;  5FJ8 J;  1RET A;  5EYR A;  4RBO A;  3QPL A;  1VF9 A;  1JUS A;  1HF0 A;  3GTL J;  3Q0W A;  1I3Q J;  5IP7 J;  2M2E A;  2R5Y B;  1HLV A;  5M5X J;  3NAR A;  4LOC A;  3LNQ A;  1ETO A;  2XPW A;  2K9N A;  3Q0V A;  2G0E A;  1XC5 A;  1VFC A;  3PO2 J;  2JA8 J;  3E7L A;  4X1E A;  2ZB9 A;  1TWC J;  2CRG A;  3GTP J;  2HOT A;  2TCT A;  3O8G A;  1W0T A;  5M5Y J;  3OOU A;  5FKL A;  3A02 A; 
#chains in the Genus database with same CATH topology
 5LGT A;  3MKZ A;  3H36 A;  2VLA A;  3I59 B;  5FKN A;  1WH5 A;  1W7P A;  5E8G A;  3LST A;  1SVO A;  3A01 A;  5D5U B;  4LB5 A;  3OR2 C;  1G3S A;  4S05 A;  2GA1 A;  2ECC A;  2LKP A;  2VC0 A;  5K7Z A;  4AVZ A;  2JQ7 A;  3CC7 I;  1LFP A;  3HRM A;  3HOU J;  4BY7 J;  1UFM A;  1YG2 A;  4M3G A;  5E3L A;  5D4S A;  5IT3 A;  4Q4Z F;  2PI0 A;  2EIN H;  4CCO A;  4U7B A;  4OU0 A;  2STW A;  2UV1 A;  3DFG A;  4HW0 A;  3W2W A;  4BQQ A;  1VQL I;  2R7S A;  2GA2 A;  4DNC A;  3JRF A;  3LSK A;  4I76 A;  1UHM A;  3WGG A;  4EJV A;  2BY0 A;  3IL2 A;  5BOX A;  1ZRF A;  1DP7 P;  4P9U A;  1BJZ A;  2R7F A;  3HG9 A;  1J75 A;  2IW5 A;  2X4H A;  2E2H J;  2X1E A;  5D8L B;  4XLC A;  5FGM A;  4A3J J;  2AQE A;  2ZME A;  4F91 B;  2PJR A;  5D4R A;  5HOO A;  2EWN A;  5TRD A;  1JKO C;  3WTZ A;  3O8H A;  4BXF A;  4E4H A;  3AG1 H;  4M3F A;  2EIM H;  3TP0 A;  2ZC2 A;  4XR6 A;  1V5F A;  2O5R A;  2HDC A;  3GO5 A;  2VON A;  4HG2 A;  3J7Y J;  4FE4 A;  2DPD A;  2XGX A;  3CUO A;  3OOP A;  2PMZ A;  2FQ4 A;  3LFU A;  4XIC A;  2CW8 A;  3WTW C;  2HDD A;  1O7L A;  2ELJ A;  4CZC A;  4CZZ A;  2IGK A;  3HOX J;  4HPQ A;  2VI6 A;  4JOM A;  2A07 F;  4I7H A;  4ESF A;  2XB0 X;  4EM1 A;  4BH9 A;  1U5T A;  1OMI A;  2KIF A;  3SFZ A;  2XRO A;  4PJJ A;  2LBF B;  3DEW A;  1YW9 A;  3G4S I;  2R5Y A;  2W24 A;  5GTI C;  3MKL A;  3QYE A;  2LY1 A;  1WCM J;  2VT2 A;  1DGR M;  4OIO F;  4IHT A;  1BIB A;  1P7I A;  2QQ9 A;  2YX4 A;  3L2W A;  3KIO A;  1FEX A;  2FE3 A;  4G12 A;  4BJ5 C;  1A31 A;  1MDM B;  4M3E A;  2R92 J;  2OBP A;  1WWX A;  1H89 C;  3VOE A;  2COM A;  5D6F A;  2ME6 A;  4CCM A;  3C18 A;  3F8C A;  1Z05 A;  3BG3 A;  4CDG A;  3HOY J;  3U1D A;  3R61 A;  4NDL A;  2G7U A;  3DCF A;  3E6D A;  4NC8 A;  1S9H A;  5CJ9 A;  4A3C J;  3SZT A;  4ANJ A;  3BR3 A;  3EYI A;  4BNC A;  3S1N J;  3KE2 A;  4FT8 A;  1YE9 A;  3C1D A;  4CYC B;  3CJN A;  5DEQ A;  1GLN A;  1A5J A;  1WSU A;  3CMA I;  2ESN A;  2FD5 A;  4CIC A;  5C3E J;  1YW7 A;  1IDY A;  4YFK F;  2YX7 A;  2LRD A;  4UVB A;  2XKP A;  2XVC A;  3IUO A;  4XKV A;  4E7L A;  2IRF G;  1AOY A;  2CQK A;  3ZMZ A;  4EQQ A;  2IA0 A;  4JP0 A;  3KEQ A;  3IKT A;  2K02 A;  1KU2 A;  2NVT J;  1ULY A;  1LE8 B;  2LY2 A;  4R1H A;  1RR8 C;  1JJ8 C;  2XRN A;  3IH3 A;  2QEN A;  3AG4 H;  2DFE A;  3Q0U A;  1YTY A;  1XN7 A;  4KDP A;  4I2O A;  4M71 A;  5CVV A;  2KRF A;  4BYY A;  1YX3 A;  3MVP A;  4EGY A;  3SDB A;  4A3F J;  1B72 A;  2LLK A;  4C2T A;  2DI3 A;  1T2K A;  4CH7 A;  1Y6I A;  2LC2 A;  1D5Y A;  3U9G A;  2NOJ B;  1WZ2 A;  3G1M A;  4AVP A;  2ME0 A;  2DJI A;  1OYY A;  3MD2 A;  4KN4 X;  1Z21 A;  2E36 A;  4ZYD A;  4BUP A;  2E35 A;  2OJE D;  4Y52 J;  2EZI A;  2OZ6 A;  3B6C A;  1PP7 U;  3HGG A;  4LIU A;  2EZH A;  3C2H A;  3ESW B;  4L9T A;  1Y1V J;  3I9V 2;  4L5J A;  1BIA A;  2E5N A;  1BA5 A;  1KQ0 A;  3B6A A;  1FJL A;  1S6L A;  2XF6 A;  1E2X A;  4Q48 A;  3FZV A;  2HGC A;  3F8N A;  4BS9 A;  2NVU B;  4CHU A;  3DBL B;  1JKQ C;  1ON1 A;  2IVM A;  5LRR A;  1REP C;  1TP4 A;  2E60 A;  4Q5S F;  4BKX A;  3CUQ A;  4JX5 A;  2DJN A;  2VUM J;  3K70 D;  4IO9 F;  2F4O B;  4QIW N;  5JHU A;  1KZH A;  2P5V A;  1TQP A;  2FBK A;  2YSR A;  1WQ2 A;  2BYV E;  3OS0 A;  1D0Z A;  5K5O A;  3BQZ A;  3K70 C;  5TIS C;  3KFW X;  4A0Z A;  3GZ5 A;  1NG7 A;  1W7P D;  1X4O A;  3ZMS A;  1T95 A;  1I6H J;  2A6E F;  3JTH A;  5KHD A;  2DYS H;  1GUU A;  1FNN A;  4KJZ A;  2LKS A;  1MBH A;  4LB6 B;  2DA1 A;  3CJT B;  1A6I A;  3FXK A;  1D0Y A;  2RVC A;  5FRN A;  1RUN A;  1VI0 A;  3BDD A;  3M1E A;  3J7Z I;  1QVU A;  3X2Q H;  3KEO A;  4JQF A;  4UV9 A;  2RAE A;  5CVJ A;  1J59 A;  2L2O A;  1ETV A;  4L5E A;  4XK4 A;  4I09 A;  2KIU A;  5DUI A;  3PFI A;  3ZQC A;  4M73 A;  1U8B A;  3HKZ N;  3S17 J;  3QYF A;  3VYT B;  5FRM A;  2BHZ A;  3W2A A;  2BGC A;  1FLI A;  1LJ9 A;  2HEO A;  2XF7 A;  2COB A;  2VE9 A;  2FF4 A;  4HF0 A;  1UST A;  3OSF A;  3S14 J;  2R7V A;  4EM0 B;  1PJR A;  2XGE A;  2EH3 A;  4PZJ A;  1RI7 A;  1E3H A;  1OCZ H;  4PJ0 C;  1FIA A;  3W6K B;  3COA C;  1W7P B;  3A01 B;  1R71 A;  2CV1 A;  2A3S A;  2ZME C;  5HNF A;  1H9T A;  4OWR B;  1KU7 A;  2L9R A;  3H5A A;  4IHX A;  1S5L C;  5IP6 A;  3PUB A;  1Y39 A;  2GXA A;  2LD5 A;  3RIR A;  3TW6 A;  3B73 A;  1S29 A;  5F0H A;  1OR7 A;  3BR2 A;  4H4K C;  2OPT A;  1VQO I;  3S1M J;  2DK8 A;  1G4D A;  3HRS A;  1TWF J;  4PFP A;  1WJE A;  4ZDO A;  2M4G A;  1U5T C;  1SAU A;  1XGM A;  2LYC A;  4CCJ A;  2E1M C;  2RNJ A;  4M74 A;  1CQT A;  1NK2 P;  3TKY A;  4D1Q A;  3I0T A;  2VJ5 A;  3SQN A;  3LSP A;  2JJ7 A;  5CVU A;  1LDD A;  1XCB A;  4J01 A;  4A93 J;  1YO5 C;  2N8G A;  3MZY A;  2DBB A;  1YLF A;  4M6Y A;  3VSL A;  2ZME B;  4AU7 A;  4XRS A;  2PJR B;  3WTT C;  2HYG D;  1GVD A;  5TGT A;  3DPU A;  3CD6 I;  1GT0 C;  5ILU A;  1RNL A;  5HOD A;  1TQI A;  5LEK A;  2ICW G;  5CKT A;  2QM3 A;  4A69 C;  1FYK A;  3FIS A;  2BHY A;  3ZPL A;  1UMQ A;  2DA2 A;  3GXO A;  4RB0 A;  3C7J A;  4E7J A;  1PDN C;  1U5T B;  2JVH A;  2EQR A;  2OCC H;  2R3S A;  2X6X A;  6PAX A;  1U3E M;  4I0A A;  1OFC X;  2L9V A;  4MTE A;  1ZR4 A;  4MGR A;  4GYI A;  1ZN2 A;  4NUB A;  4A6D A;  5D6E A;  3FMR A;  1SAN A;  3A0B C;  1ONV A;  3IKV A;  4KIB A;  2R7T A;  5DS9 A;  4Q47 A;  3E5X A;  1FT9 A;  3ZQG A;  3S1R J;  4LLG F;  1RKW A;  2QYO A;  2VKV A;  4FIS A;  4RAF A;  2HS5 A;  4DZP A;  3DPT A;  3V8L A;  1OCO H;  5FFZ A;  1W36 D;  3ML6 A;  1X19 A;  4BQO A;  3EPZ A;  5EZG A;  1O3R A;  3OYK A;  2RGV A;  2F5E A;  1S7A A;  4HQE A;  1DDN A;  4QPO A;  2DOD A;  3IWZ A;  2F5C A;  4AD9 A;  1W36 C;  1RPW A;  3FXM A;  2W1O A;  1BC8 C;  2O8K A;  3MKY B;  3HIF A;  4B8X A;  1QZY A;  2M3A A;  2X85 A;  1RZ4 A;  2O7O A;  3AL0 C;  5ICG A;  2BVM A;  2F5F A;  3OYC A;  4MIM A;  2OAZ A;  4EJW A;  3FM3 A;  1ZG3 A;  1IN5 A;  2H8W A;  4II3 A;  2CQN A;  4E6K G;  1ZLJ A;  2P4W A;  1T33 A;  2K9M A;  1VQN I;  4WXD A;  1U2W A;  3PNY A;  4P55 A;  1ZGA A;  3K9T A;  4IHW A;  3HTS B;  4B44 A;  5LEJ A;  2JA5 J;  2XGC A;  2CQQ A;  1UHS A;  1B72 B;  4IX7 A;  3PSI A;  2WTE A;  4I99 C;  3CUQ C;  2HKO A;  4XBF A;  4OOI A;  2CWE A;  1SFO J;  2QKM B;  4XOP A;  2XAF A;  2CUZ A;  2WA0 A;  2Y75 A;  2PQ8 A;  1R4N B;  1JI8 A;  3ULQ B;  1GVJ A;  1Z6T A;  4FQG A;  4B43 A;  2VQH A;  3JRA A;  4A3I J;  3HPG A;  4BHP A;  4RAZ A;  3BTI A;  1K83 J;  3HEF A;  4LIT A;  5AIQ A;  3CF5 F;  4BQA A;  1ZHF A;  4UUT A;  3WU2 C;  4FTH A;  2P7C B;  1O3T A;  1XG1 A;  2WAQ A;  2KFD A;  2CUF A;  4G6Q A;  1HA8 A;  4M72 A;  4V19 K;  4LJZ F;  4N0B A;  3CUQ B;  2E34 A;  4EAT A;  1I3A A;  1MNE A;  1QVT A;  3NWT A;  2ZFW A;  4M6V A;  4XLN F;  4ENJ A;  4HRI A;  3WTY C;  2HXI A;  2Y9Y A;  4UUS A;  3HOW J;  2HQN A;  3CDI A;  2ELK A;  2JA7 J;  1MNM C;  2H8R A;  5B5E C;  2KPM A;  1MMS A;  1B8I A;  4J00 A;  1P4W A;  3KEY A;  1POG A;  2CMP A;  1TL8 A;  1DP3 A;  1IN7 A;  3EDP A;  2ZO4 A;  3I54 A;  2GXB A;  2HKX A;  1B59 A;  1ZQ3 P;  2VT3 A;  1P6R A;  4MQ9 F;  2EJR A;  2HDW A;  5FJ8 J;  3TO6 A;  2XF5 A;  5EYR A;  3QPL A;  2GOX B;  1MMN A;  1FY7 A;  3K2Z A;  1X1D A;  1X1A A;  1MJB A;  2W85 A;  3F9K A;  3GTL J;  1FBS A;  3FKJ A;  3Q0W A;  3OL3 A;  1OR7 C;  2H6B A;  1E17 A;  2HQR A;  4WX9 A;  3BZC A;  2A69 F;  2HTJ A;  2M2E A;  4AID A;  4KMU X;  3M1C A;  3KP4 A;  3I71 A;  2VQG A;  1ETO A;  2XPW A;  2K9N A;  4ZH4 F;  1XC5 A;  1FYM A;  3RYP A;  2DQR A;  5F1R A;  3E7L A;  4OMY A;  1TWC J;  4FX0 A;  3BJA A;  2K3P A;  3GTP J;  2HYF A;  5KAF C;  2H27 A;  3IRR A;  2F2E A;  1BI0 A;  2TCT A;  3O8G A;  3NRV A;  3OOU A;  5M5Y J;  3LFK A;  3N97 A;  2V6C A;  3TP3 A;  2DYR H;  2LVS A;  2BOL A;  1DPR A;  3H9G A;  5J4Y A;  2XSJ C;  3VDX A;  3HTU A;  1MMD A;  3J81 K;  3IHU A;  2VE8 A;  3H3V K;  2A6T A;  3KYL A;  2DDA A;  2F48 A;  2VQL A;  2VJJ A;  5K7F A;  5BS6 A;  4MFD A;  1JT0 A;  1O7F A;  2R93 J;  3DKW A;  5TJJ A;  2VL8 A;  1R5G A;  2GBY A;  3MKW B;  3CZ6 A;  2XPU A;  4HX4 A;  2MH9 A;  1IN6 A;  3KET A;  2M8G X;  2XB5 A;  3HSE A;  3S8P A;  1NHA A;  3R6S A;  3L9F A;  3E1S A;  1TW2 A;  2EK5 A;  1WGX A;  1SMT A;  3QP6 A;  2RNG A;  3LWF A;  1FBU A;  1IDZ A;  4W97 A;  1X3W B;  2IT0 A;  4KT5 C;  2K4J A;  4S0H B;  3I4P A;  2MH2 A;  3H9Q A;  3W2V A;  3V7S A;  1MBE A;  1YS7 A;  1SEU A;  2AS5 F;  1XSX A;  3JR9 A;  5JVT A;  4Z6Y A;  2MD0 A;  1R7J A;  1MBJ A;  2CGP A;  2ZNZ A;  3K69 A;  3OR1 C;  2HXO A;  4YG2 F;  4PJM A;  1IJW C;  2IGN A;  1SAX A;  4XRF A;  3FX3 A;  1O3S A;  1HW2 A;  3ZQF A;  4DYQ A;  3WTS C;  4L9J A;  4RA2 A;  3DU5 A;  3UR3 C;  1YW8 A;  4OAZ A;  2Q2E B;  4OIR F;  5HLG A;  3LA7 A;  4A3B J;  1TNS A;  2WB1 N;  4EVI A;  5B3S H;  2I5U A;  2KQR A;  5D8K B;  2AQF A;  3HGY A;  1H88 C;  1JHF A;  4IQ4 A;  4CSW A;  2MD5 A;  2E2J J;  2DFF A;  1P2F A;  2H1L A;  1XCV A;  2O8X A;  3GFJ A;  3HJE A;  4ZZD A;  2RRE A;  2HI3 A;  4XLA A;  3ZMD A;  1D5V A;  3CC4 I;  1AHD P;  2EFW A;  1LVA A;  2Y9Z A;  5M3M J;  3S2H J;  4C2M J;  3IV5 A;  3FDY A;  3M8E A;  1PUE E;  2AHQ A;  4HA8 A;  3CO7 C;  9ANT A;  2FSW A;  2JN6 A;  1C0W A;  1R5H A;  3SEQ A;  3SXY A;  1VQK I;  4GFB A;  1XGO A;  2JSP A;  3I58 A;  4GO1 A;  1VQM I;  3IC7 A;  1WJF A;  5HDG A;  2CW7 A;  2QWW A;  2DW4 A;  3KLN A;  3F3X A;  2DMU A;  2DA6 A;  2H09 A;  1H9G A;  3KPH A;  3LAP A;  4XLE A;  2EFQ A;  5KNL A;  1V5G A;  3WTU C;  3GWZ A;  1FC3 A;  1JKP C;  4D0P A;  1ZRD A;  2LP0 A;  4QLC U;  4PFO A;  5BQT A;  3QQA A;  1MGT A;  3QPS A;  5LBQ A;  2VJ4 A;  5DTD A;  2D45 A;  5K5R A;  1DU6 A;  3K4N A;  1IXC A;  1Q1V A;  2J5O A;  3OYF A;  4B3A A;  3BLY A;  5JR3 A;  1N25 A;  2A61 A;  5CPR B;  3ERE D;  5JFR A;  3V8K A;  1RES A;  4ZZL A;  2JRT A;  1J0R A;  4LLN A;  4WK8 F;  3I55 I;  2VOP A;  3KLO A;  2EPF A;  3MN2 A;  1MMA A;  1ZG1 A;  3L2V A;  1S7O A;  3MZ8 A;  1ZKG A;  3TL4 X;  4N4N B;  1MSF C;  3TOB A;  5FKO A;  5L3F A;  2PLY A;  2QVO A;  2WAE A;  2GXG A;  1I27 A;  3LQQ A;  3KX2 A;  2NOG A;  3ZN1 A;  5BPI A;  2FOW A;  1RIO H;  1T39 A;  3HOZ J;  2YR2 A;  1U0J A;  4HV5 A;  2QQA A;  3GBG A;  1Y1W J;  1FP2 A;  1VQ7 I;  3J81 Z;  2CH0 A;  3QYB A;  4UUS B;  3CCE I;  4IRI A;  3AKZ A;  2NS0 A;  2OQG A;  1RKT A;  3JRB A;  1S3J A;  3K2A A;  4A3E J;  1B8I B;  2PX9 A;  1WJC A;  3RPU A;  5HDN A;  5DCF A;  4D7N A;  2X9D A;  1BI2 A;  1MBF A;  3P5J A;  1J7K A;  2LRE A;  1K78 A;  2ESH A;  1VQ8 I;  3J7A Y;  2R7Z J;  5HVQ C;  3JRE A;  2Y30 A;  3P9C A;  1J5Y A;  4A3L J;  3HRU A;  2O3F A;  3AG2 H;  1SD6 A;  5KAI C;  2DDB A;  3FXR A;  1W4M A;  5E1X A;  1AWC A;  3LSJ A;  1OLT A;  2DN0 A;  5E17 F;  3VWB A;  4E7Z A;  2LY9 A;  3OYD A;  5FKK A;  4IHY A;  1DPU A;  1EV7 A;  3LA3 A;  5J6X A;  4A3D J;  4XOR A;  1YIJ I;  4CA0 A;  1LFB A;  1J2X A;  3K4M A;  3IP4 B;  4CGZ A;  1KA8 A;  3CC2 I;  2I10 A;  4ZTF A;  3TGN A;  5KVR A;  4BE0 A;  4K2E A;  2OV7 A;  2XUB A;  4JK1 X;  1HDP A;  1O3Q A;  1E0E A;  3CMM A;  2JWT A;  4XN0 A;  3JRD A;  3V7C A;  2PN6 A;  1W5T A;  5H6Q A;  1Y0U A;  3RCO A;  5HLT A;  3LOC A;  1JGG A;  1JUP A;  1T08 B;  2KIS A;  3GTK J;  4U88 A;  3OYH A;  1G59 A;  4ZYH A;  3OYE A;  1OKR A;  4RB2 C;  1IG7 A;  1WHU A;  3HYI A;  4BXX J;  1MBG A;  2NRA C;  2IPQ X;  5J3L A;  4F7Z A;  1UCR A;  3BY6 A;  1F36 A;  1OCP A;  2IGO A;  1SMY F;  2NS7 A;  3VEP A;  1D1C A;  3GFL A;  1GXQ A;  2RQP A;  2DXI A;  2W00 A;  3H9J A;  1Z0X A;  4Y3O A;  5D5V B;  3P9I A;  3HDD A;  3BPV A;  5JVG F;  2K7L A;  3FM5 A;  1D0X A;  2E2I J;  2LNB A;  1SFX A;  2GWR A;  4KUM A;  2DFH A;  4CYD A;  1IAW A;  3QAH A;  5CLS A;  4RLQ A;  2GQQ A;  1P4X A;  4C3H J;  1VTN C;  3M3Y J;  1D3Y A;  4RLF A;  1Z1D A;  1P7J A;  2V1D A;  3G1L A;  3G1O A;  4L5I A;  1MKM A;  2LKX A;  5ICF A;  4IKF A;  1HKS A;  3GX4 X;  3GFM A;  1YS6 A;  1G8X A;  2OTL I;  3MMY B;  2W82 A;  1GDT A;  4A5M A;  4HZF A;  4A2U A;  4ETS A;  2WAD A;  2L0K A;  3WGI A;  4LG0 A;  3OWT A;  2IBD A;  1JGS A;  1R49 A;  4JYK A;  1EH7 A;  2A5Y B;  2Y48 A;  4G7O F;  2Y0S A;  1VQP I;  3DPL C;  4RM2 A;  2W25 A;  1WVR A;  1Y8R B;  4W1U A;  4Y15 A;  3WG9 A;  1U9N A;  2MFZ A;  4M9Z A;  4UB6 C;  4E7I A;  4EJU A;  4KMF A;  2DMN A;  1ERD A;  1YRN B;  1I39 A;  4AIK A;  1Y8Q B;  4U7D A;  3OS1 A;  4MTD A;  2P6S A;  2W7N A;  1FX7 A;  1JKR C;  4JX6 A;  5EGO A;  2V9V A;  2YUS A;  5D5W B;  3M7G A;  3JRI A;  3RKQ A;  1K7A A;  4KT6 A;  2FMY A;  1YHQ I;  3CP2 A;  3L1P A;  1MJA A;  2LMD A;  3WGH A;  2K86 A;  2D1V A;  2P8T A;  5EZH A;  4AYB N;  1BM9 A;  3I56 I;  1NG6 A;  2MBF A;  2DTR A;  5EEH A;  3PJR A;  5FD5 A;  1I6X A;  3RQI A;  3HSF A;  1B4A A;  3KCC A;  3VPR A;  2GAU A;  2MSY A;  3LSG A;  4IHS A;  2DT5 A;  3BR1 A;  3WTX C;  3F8B A;  3F8F A;  4ESB A;  1XB4 A;  1Y0N A;  2M0M A;  1P92 A;  1GV5 A;  2QSG X;  1TW3 A;  4OAY A;  2Z1D A;  1ETQ A;  1TZL A;  2EV5 A;  2BV6 A;  4I02 A;  4HLY A;  1YIO A;  5DM7 F;  1KON A;  2XHK A;  3BCB A;  3CJQ B;  3M07 A;  2MLK A;  5GP9 A;  5J1U A;  5GAG J;  5J4V A;  2ISY A;  5C4J J;  1QPM A;  3OYA A;  2W84 A;  3DU6 A;  1R22 A;  2K85 A;  4RGX A;  4YFX F;  2M45 A;  3BZK A;  1APL C;  4PUS A;  2VAS A;  3T8R A;  2DA5 A;  4HOB A;  1N77 A;  2KLO A;  4ZJZ A;  2M0C A;  3RZO J;  3RPU D;  4U87 A;  5FLM J;  4E7K A;  5LRS A;  4LIV A;  5E1W A;  4L0Z B;  1TNT A;  2B7E A;  5CVR A;  2MG4 A;  3G2B A;  4BAC A;  2FXA A;  5BPD A;  5HS9 A;  2VBZ A;  3ZRG A;  4RM3 A;  2KDO A;  1PVE A;  3RSN A;  3RTR A;  2DA4 A;  3H1C A;  4G9Y A;  4U0W A;  5F6F A;  5FB2 A;  4C9Y A;  1S72 I;  4U0V A;  5K7H A;  4NBQ A;  4EGZ A;  2XAJ A;  3EET A;  4GYG A;  1YJW I;  1R5I D;  4H0E A;  1ZRE A;  4KYW A;  2KHM A;  1QPI A;  2FBI A;  3VOD A;  4Y17 A;  2WY8 Q;  5E3N A;  1RRJ A;  5HDK A;  1E3O C;  3A0H C;  1G3Y A;  2KT0 A;  3LQR A;  4XLP F;  1R9T J;  1A04 A;  5CVI A;  1BJA A;  1KYZ A;  1QZE A;  2F4I A;  4OIN F;  1X4P A;  1IC8 A;  2DOF A;  5B1B H;  1MH3 A;  3CCR I;  1K6Y A;  3DTK A;  4B3X A;  4UHT A;  1RR7 A;  3S3M A;  5LD2 C;  1U78 A;  4RB3 C;  2YU9 J;  1IRZ A;  1D8J A;  2DT7 B;  2MC3 A;  2A68 F;  3CJR B;  3HC7 A;  3A2K A;  1ETY A;  3E3V A;  2KP6 A;  3RJP A;  3LSR A;  3TED A;  1FOK A;  2NNY A;  1ZG5 A;  4G94 A;  1TT5 B;  1KQ9 A;  4QTR A;  3BG6 A;  4F55 A;  2A05 A;  1FP1 D;  4YRV A;  2OUM A;  4NC7 A;  1ZLK A;  1IXR C;  2NVX J;  3ZQH A;  1RET A;  2IGM A;  4RBO A;  2JA2 A;  1VF9 A;  5DD8 A;  1TQM A;  2HR3 A;  1J9I A;  2DPU A;  1JUS A;  3K4J A;  3SYT A;  4ENM A;  2BY1 A;  2CW0 F;  4U0Y A;  1J09 A;  1IF1 A;  2BW3 A;  1IO2 A;  1XDU A;  3QPH A;  2E1M B;  4DBR A;  5IP7 J;  1VQ6 I;  3ZXS A;  2R5Y B;  3CO6 C;  3NAR A;  4LD5 A;  3LNQ A;  3FMQ A;  1FYL A;  3CCV I;  3DTI A;  1CF7 A;  2G0E A;  4P5O A;  3KZI C;  2MC4 A;  3MCZ A;  3F22 A;  2VN2 A;  3PO2 J;  2HFH A;  5J8F A;  2JA8 J;  3UNG C;  3ZP5 A;  2K5C A;  1W1W E;  1N75 A;  2VQC A;  2OZU A;  4X1E A;  2KIQ A;  3WU1 B;  1O57 A;  2R7R A;  1HBX G;  2MA3 A;  2OA4 A;  3WOD F;  1G2H A;  4HNT A;  2RC4 A;  2R5Z A;  4WWC A;  1SFE A;  4MNU A;  5ILS A;  1PYV A;  2FUG 2;  1Z77 A;  5FKM A;  1TLH B;  1F1Z A;  1WPK A;  2IJL A;  4BY1 J;  4BGD A;  4CCN A;  2ZXJ A;  3L7W A;  4PDK A;  1ETW A;  2V26 A;  2PBI A;  1ZAO A;  4ZC3 A;  2CU7 A;  3RI4 A;  3PIP F;  1TC3 C;  2VBY A;  4HST A;  2Z9O A;  1QHG A;  3JRG A;  2IXS A;  4UNO A;  1UG2 A;  2GM4 A;  5E79 C;  2STT A;  2FEZ A;  2E7W A;  3ZOB A;  2Z5U A;  3ZMV A;  3R4K A;  1I5Z A;  4PSW A;  4A3K J;  2QLZ A;  2DMQ A;  2FNA A;  3QOP A;  2L7F P;  3SDG A;  4UXN A;  4LG0 B;  5C44 J;  2Y2Z A;  4FET A;  1JTY A;  1ODD A;  4HF2 A;  2F6C A;  5IYD J;  3S16 J;  3A03 A;  3QOD A;  3CLO A;  3I5U A;  4YIR X;  3KYD B;  3MFK A;  3AL0 B;  4I98 B;  5IOZ A;  2WBM A;  1H0M A;  3OYN A;  4D9J A;  4S04 A;  2ZXI A;  3HM5 A;  4OIP F;  3C2G A;  2LG4 A;  2L7K A;  3NEU A;  3QPT A;  3QWL A;  5EEA A;  1X1B A;  3HB9 A;  2H1K A;  1G6N A;  2AXT C;  2CUJ A;  3DV8 A;  3J80 K;  1LUJ B;  4XRS G;  3S3N A;  1Y56 A;  4AC0 A;  3AFH A;  3IH2 A;  1NK3 P;  3WHB A;  1OCC H;  5EGO B;  1OYI A;  5LHH A;  2LK2 A;  1ZR2 A;  3WHC A;  3V42 A;  1IN8 A;  1JTX A;  4FHT A;  3TW7 A;  5DM6 F;  1MSE C;  3C3W A;  3C2B A;  1P9Q C;  1QBJ A;  1ZEL A;  2FJ1 A;  3B02 A;  2ZXH A;  1BI1 A;  3ONQ A;  4I0B A;  2HWV A;  2R4G A;  2QKL B;  2O6G E;  3PO3 J;  2EIL H;  3P7N A;  2KZV A;  2KKO A;  2VKH A;  3F0C A;  1OIS A;  3GEZ A;  3GLL A;  1USS A;  2CSO A;  3GTJ J;  2IA2 A;  1ZGW A;  4WF2 A;  3H0G J;  1QZZ A;  2X6Y A;  4IVN A;  3GCM A;  2LSO A;  4Z2Y A;  2V1U A;  1XSV A;  3R0A A;  3MQ0 A;  4KA4 A;  2Z2S B;  2X6W A;  4XRM A;  4X6A J;  2FOK A;  2R7D A;  1D1B A;  3TO9 A;  2UZK A;  3I53 A;  3BQY A;  3HKZ A;  3FXL A;  4UUV A;  3HHH A;  3OMY A;  2L9N A;  2BY3 A;  4UVA A;  4ON0 A;  3JCU C;  3KZZ A;  2EV0 A;  1JUM A;  4WXH A;  5DV5 A;  4BBR J;  4FCY A;  4EJO A;  3JTG A;  3HOS A;  4YEL A;  1R1V A;  2ZJQ F;  5F0F A;  2GZW A;  2ZJ2 A;  2NVY J;  3ZMT A;  4B1R A;  4YIF A;  3D1N I;  2VBX A;  2PFB A;  1TT0 A;  4Y7N J;  2O61 A;  2X48 A;  3H3Z A;  2L4A A;  2LBF A;  4XSZ F;  1YIT I;  3FK6 A;  4RDU A;  2VC1 A;  3ABK H;  4PCQ A;  3DBH B;  4MEY F;  5J1R A;  3SFI A;  1SVM A;  2H94 A;  3JW4 A;  4Y4R A;  1AKH A;  3KP2 A;  1LPQ A;  4PGH A;  2LTP A;  1OYW A;  3U21 A;  1F9N A;  3CMY A;  3S15 J;  3OL4 A;  3OYJ A;  2DK5 A;  1MND A;  3HUG A;  4XOT A;  4BU2 A;  1W0U A;  4DYC A;  3WE2 A;  5IPA A;  3JRC A;  3VYR B;  1IUF A;  2IS2 A;  2E71 A;  4IZZ A;  4M6X A;  3HOV J;  2XGD A;  1HOM A;  2NVQ J;  3W3C A;  2KJC A;  3HSR A;  3W6J B;  5LHG A;  3KYC B;  4PSX A;  1B9M A;  2FML A;  3G71 I;  2XC7 A;  1X2N A;  4DBQ A;  4BAY A;  4UVC A;  3N4M A;  3EQL F;  2Y69 H;  1U8R A;  2M30 A;  3O2P E;  3T8T A;  1F4K A;  3PUF A;  3ASN H;  1HKQ A;  5A2Q Z;  1Z67 A;  2EB7 A;  2DA3 A;  1T8I A;  2F4M B;  1BOB A;  1ITY A;  1FTZ A;  3F6V A;  4UV8 A;  1JJ6 C;  3U1K A;  2DQL A;  5ERI A;  2BW3 B;  1BI3 A;  3OYI A;  1XTA A;  4DW6 A;  4A0Y A;  4IXA A;  1NTC A;  4KIG A;  4IOC F;  1CGP A;  1JXS A;  3RZD J;  2V4J C;  2OTJ I;  2ACJ A;  5DD4 A;  1B9N A;  4YEJ A;  1CF7 B;  1VQ5 I;  1U9O A;  2X51 A;  2UXX A;  2M7B A;  1FWZ A;  3TDU C;  1IZ1 A;  4EMS A;  3VYU B;  4ZDL A;  5JI6 A;  4NHJ A;  2ZKZ A;  3UKG A;  3H35 A;  2KZG A;  4UY8 I;  1ACI A;  3EUA A;  2EFP A;  3L09 A;  1HCR A;  5CQG A;  2ZJP F;  5M5W J;  5F27 A;  4CUG A;  3J80 Z;  1UHW A;  2R5Z B;  1R1U A;  1DQU A;  5IT9 K;  2M7A A;  2EV6 A;  3GZ6 A;  4L18 B;  1A6Q A;  3HPH A;  3ZR8 X;  3HBL A;  5HS8 A;  2EFN A;  1BOA A;  3K1P A;  2H6C A;  1OCR H;  3ZQ7 A;  3JAM Z;  2UXN A;  1BC7 C;  2K4B A;  1YOV B;  3PM1 A;  1B1B A;  1V55 H;  1YQA A;  5DYM A;  2ID3 A;  1VZ0 A;  2W4S A;  5HLH A;  1K4S A;  3GTO J;  1WKM A;  2BVL A;  3LSM A;  1W5C C;  2Q0O A;  1HXD A;  2GOM A;  1ZRC A;  1V54 H;  5E20 A;  4EJT A;  3BTL A;  2L54 A;  3OYB A;  2PEX A;  2WWY A;  1HQC A;  4O5V A;  2QUF A;  3EUH A;  4ZTJ A;  2JA6 J;  1IRG A;  5GPC A;  1KQ8 A;  1IW7 F;  2OC6 A;  3RPQ A;  2Z16 A;  2M34 A;  1FOW A;  3CLQ A;  3L2U A;  1WJA A;  2XSD C;  4XON A;  1R1T A;  1YJ9 I;  4GGG A;  3CCL I;  2DCE A;  1BL0 A;  2LR8 A;  2Q8K A;  3OSG A;  5JLX A;  3K4B A;  2HQA A;  3M9A A;  4M9X A;  3I3L A;  2EA4 A;  2BY2 A;  4I6Z A;  1EH6 A;  2KRC A;  2Z3Y A;  3GME A;  4LGW A;  5FLV A;  2JSC A;  1I50 J;  3ZMU A;  5L3G A;  3K7A J;  3T0Y A;  5F0C A;  3E6M A;  2LF7 A;  3DBR B;  3ZQI A;  4QPQ A;  3SHF A;  1AA7 A;  2Z99 A;  1U6G A;  2V9K A;  5EDN A;  5C4X J;  1YJN I;  3Q3S A;  5EF6 A;  5IYC J;  3L00 A;  3REO A;  2WY7 Q;  1SFK A;  2QSH X;  2VKE A;  2ID6 A;  5EJC A;  1R4M B;  4X0G A;  5B1A H;  2WV0 A;  3VB2 A;  5ILV A;  1LEA A;  2M8E A;  2QF7 A;  5E3O A;  2JPB A;  2XKO A;  1BBY A;  3ABL H;  3GF2 A;  1BR4 A;  1FMW A;  4N9H A;  1K61 A;  4LK0 F;  1OJL A;  2VXD A;  2FU4 A;  3JSO A;  4MLO A;  4O6J A;  2XRL A;  2CUE A;  2DTZ A;  1HW5 A;  3D0S A;  3G6E I;  2YS9 A;  3ABT A;  4HQM A;  3BG7 A;  2V1X A;  1ETX A;  5EG0 A;  1A36 A;  1FPQ A;  3RKX A;  3OY9 A;  3TO7 A;  1DU0 A;  3LSI A;  3FXQ A;  3FHN A;  3FWE A;  4HBL A;  2K9L A;  2O03 A;  4M3B A;  1O4X A;  4YFN F;  4BDZ A;  2E1O A;  2NYX A;  1L0O C;  1UZC A;  2VIX A;  4N4O B;  4M9S A;  4HNU A;  1Z7U A;  4G8X A;  4BDY A;  4AUX A;  1F5T A;  3TMO A;  3BTJ A;  3FXO A;  2ISZ A;  3CP8 A;  4YII A;  3IH4 A;  3FMS A;  3ZQQ A;  1P4A A;  4M3D A;  2LH9 A;  3DKY A;  1HC8 A;  3RYR A;  5K5Q A;  2K3F A;  1XX5 A;  2XAU A;  1QGP A;  1XSD A;  1QNT A;  3MEX A;  4BJ6 C;  4ENK A;  2EZL A;  3S2W A;  3FXU A;  2XV4 S;  3M4O J;  4P1W A;  2ZJR F;  2KDZ A;  2PMH A;  5FFX A;  1LDJ A;  3K4C A;  4RGS A;  3IWF A;  2RV8 A;  4DOZ A;  4HV6 A;  3FBN B;  4MQV A;  3P9K A;  2B0L A;  3OIP A;  2OU2 A;  3J7A O;  4KN7 X;  1AKH B;  2R7X A;  5IT9 Z;  3ASO H;  2E19 A;  3DEU A;  5KCM A;  3EUK L;  1HDD C;  2L5Q A;  2E7X A;  3KP3 A;  4BBS J;  1LQ1 A;  4R79 A;  3BR0 A;  3WE3 A;  3HUG B;  2W57 A;  3K10 A;  4GDF A;  4IJA A;  2XAH A;  4BHB A;  2MAB A;  4BEH A;  4G7H F;  1ENH A;  4XNF A;  2JPC A;  1R36 A;  2IP2 A;  3ERM A;  4G6T B;  4KIF A;  3O6B B;  3PQJ A;  4OMZ A;  2VJI A;  3ZQL A;  3Q5F A;  1Q1H A;  2D2W A;  1QQI A;  1DGW Y;  1WJ5 A;  4AIJ A;  1WJB A;  4GCV A;  3AAF A;  1I1S A;  2TDX A;  1FZP B;  1YX5 A;  2KMU A;  4EM2 A;  1BW5 A;  2MLG A;  4C30 A;  2VOO A;  1UAA A;  1T0F A;  3MAJ A;  4HLX A;  2Y0M A;  1DUX C;  1UJ8 A;  1OQY A;  3QP5 A;  4LK1 F;  4ENN A;  4ESJ A;  3ECH A;  5FD6 A;  1HF0 A;  5E8I A;  2HTS A;  2FQ3 A;  4E70 A;  3ZGK A;  1RUO A;  3NWS A;  4TV7 A;  3LL7 A;  1HLV A;  2DOA A;  4F92 B;  3DLL F;  2FNP A;  4XN3 A;  2WB1 A;  2X0L A;  2HVQ A;  3Q0V A;  4ASN A;  4C2U A;  2DAO A;  2HPM A;  4ZDP A;  2NNN A;  1ON2 A;  2CRG A;  3EUH C;  1MD0 A;  5BMZ A;  4XLH A;  4LFU A;  2PMU A;  4KIS A;  3L2Q A;  3DP7 A;  2HOT A;  1W0T A;  3BRO A;  4RS8 A;  1UG0 A;  1R23 A;  2HVS A;  3A02 A;  2OCE A;  1I1G A;  1WRJ A;  2BZT A;  4CO8 A;  4IEJ A;  3E6C C;  1RC9 A;  2EA2 A;  2M1B A;  3CQZ J;  2R7Q A;  3K4K A;  3GUD A;  5L3B A;  1IUY A;  2CV0 A;  4RAY A;  2QGU A;  2WAQ N;  2E1N A;  1STZ A;  2JRM A;  3S1Q J;  5F1J A;  2KL4 A;  2YU3 A;  1PUF A;  2KRH A;  3CCJ I;  3L2R A;  2X6O A;  1AU7 A;  2V79 A;  1FIP A;  2VPL A;  2M9H A;  2JVG A;  2I8D A;  1HKT A;  3H5N A;  4DJA A;  3TDZ C;  4MFE A;  1IV8 A;  4J19 A;  2HQ5 A;  5BNG A;  4I01 A;  2L9S A;  1T56 A;  4PK4 A;  5AON A;  4JX4 A;  2A6H F;  2A5W A;  1OPC A;  3ISP A;  3OIQ A;  3BR5 A;  4DIQ A;  2EIJ H;  4A3G J;  4XLF A;  1FTT A;  5B66 C;  2JT1 A;  3KP5 A;  5H20 A;  3PNT A;  1GHC A;  3F6O A;  3R0J A;  3BP8 A;  1S7E A;  5IY5 H;  1KYW A;  4B47 A;  4ITV A;  2L01 A;  5LFA A;  3GFI A;  3AG3 H;  3IAS 2;  2Y31 A;  3EYY A;  1IGN A;  3ROU A;  3D5L A;  2D5V A;  5FO5 A;  1FOY A;  1SD7 A;  5IYB J;  2W48 A;  5E18 F;  2B63 J;  4BJT A;  1Z6R A;  3V8J A;  2K9Q A;  1PP8 F;  1YFH A;  1XPX A;  4F52 A;  2ELH A;  2OF7 A;  2ZFU A;  4KFC A;  4C3I J;  4IPA A;  5FLX K;  2MYS A;  1R00 A;  1SD4 A;  3F21 A;  3LMM A;  4LLL A;  4GRI A;  3CCM I;  3GVA A;  3SEZ A;  2VXZ A;  2AXL A;  4WXC A;  2ADU A;  3BJO A;  1ZYR F;  2NS8 A;  2XPV A;  3A4C A;  3D5S C;  3H3U A;  1TBX A;  4O3M A;  5GTH C;  3K6G A;  1SVL A;  4PJL A;  4R8H A;  2BXZ A;  1FOX A;  1XS9 A;  4P96 A;  3M8F A;  1X2M A;  1R58 A;  4AM3 A;  1ZAR A;  5JLW A;  3S2D J;  1Z3Y A;  2P7V B;  3BCA A;  3CCY A;  1K78 B;  1X3U A;  4NB5 A;  2L4M A;  2XAG A;  3O3K A;  2ZSI B;  4BHC A;  5IOY A;  2QBY A;  3CDL A;  2GIZ A;  4KIT B;  4NQW A;  1W5S A;  2X1C A;  4C3J J;  1EA3 A;  5HS7 A;  5EG0 B;  1XD7 A;  3BPX A;  3HRT A;  3DWL E;  4CXF A;  2KJB A;  1QA6 A;  5IP9 J;  3QU6 A;  4LMY A;  5J8C A;  4HF1 A;  1FMV A;  1LVK A;  3OV8 A;  2HPI A;  3SJM A;  4NNJ A;  2UUZ A;  1XDS A;  3T1B A;  4XL9 A;  2PJP A;  4G6D A;  2JZY A;  2FBH A;  2IA1 A;  2X1D A;  4HEA 2;  3TBI A;  1D1A A;  5DCM A;  2TRT A;  4BE1 A;  4Y13 A;  4PGG A;  2VBW A;  1FSH A;  5F04 A;  3H5R A;  2JTV A;  2WC2 A;  3FF5 A;  3FXJ A;  3ECO A;  3WTV C;  5LLQ A;  3S93 A;  1YI2 I;  3GW2 A;  1QHH D;  4A12 A;  2RKH A;  3A1Y A;  3CCS I;  1YYV A;  3KP6 A;  1MJ9 A;  5J40 A;  2HZT A;  4KIC A;  3I4M J;  5DUK A;  3PIO F;  2NAZ A;  4PJN A;  3DQV C;  3KP7 A;  5CQE A;  1F43 A;  3CTA A;  2M87 A;  2IEK A;  1BR1 A;  1ZTR A;  4IOA F;  2Q2E A;  1M1E B;  3WU0 A;  4DQ2 A;  3GTQ J;  1T0F C;  1XGS A;  2OQR A;  2L7M P;  2ZNY A;  3ELK A;  4IF4 A;  1QO0 D;  2QA4 I;  2R0Q C;  3MZH A;  3N05 A;  2MW8 A;  1TWA J;  3BZ6 A;  4D7M A;  1FSE A;  2JUG A;  1IN4 A;  3ABU A;  3RKW A;  4BEH B;  4A0X A;  3CME I;  2F5V A;  3BC8 A;  1JT6 A;  4HYE A;  4MO7 A;  4N9I A;  4NC6 A;  3VSK A;  4XSX F;  3E5Q A;  4HDV A;  2LF8 A;  3CES A;  5A2Q K;  2M4K A;  3I64 A;  2CYY A;  4EEF G;  5D5X B;  1UB9 A;  3S3O A;  3PSF A;  5L3C A;  5EEG A;  1MBK A;  5KK1 A;  2FRH A;  4ABZ A;  4D5C A;  1XMK A;  2IS4 A;  4UB8 C;  2VKD A;  2VOD A;  3BG9 A;  3CF2 A;  3LAJ A;  3RQ4 A;  2IS1 A;  2CFO A;  1TWH J;  1WI3 A;  1X3Z B;  4E7S A;  2UWM A;  4P9F A;  2B9S A;  3FHZ A;  1MH4 A;  3FIW A;  3IRQ A;  3K0L A;  1HW1 A;  2P5L C;  2DA7 A;  4AWX B;  2LDU A;  5L3D A;  3OYL A;  2FX0 A;  3G3Z A;  2CS3 A;  1ZGJ A;  3OS2 A;  4RB1 A;  1VQ9 I;  3ABM H;  3F23 A;  5H2F C;  3DEE A;  1ETK A;  2C6Y A;  1WJD A;  1VQ4 I;  2L7Z A;  5J1Y A;  1MIJ A;  1ZK8 A;  2Q1Z B;  1MW7 A;  2CQX A;  2DU9 A;  3JAM K;  3I4N J;  4RMN A;  5GAE J;  5FLX Z;  1KU9 A;  2BEO A;  3BR6 A;  5CYV A;  2WV1 A;  5F64 A;  4AYB A;  5GAH J;  4IHV A;  3OIO A;  3K4L A;  3I59 A;  3BT9 A;  1V3F A;  2AO9 A;  2P5K A;  4BL0 B;  4GXO A;  4A3M J;  1EF4 A;  3HL2 A;  2Z33 A;  2JMW A;  4XKB A;  5LGU A;  5JHF A;  1T38 A;  2M5W A;  2CV2 A;  4HDU A;  1PUF B;  1JHH A;  1Z7L A;  2HOE A;  4A5N A;  2ECB A;  5ICC A;  3NQO A;  3RDI A;  1LKX A;  3TOA A;  3JRH A;  2P6T A;  2JK3 A;  2L02 A;  4DZJ A;  3R60 A;  4V2G A;  4F3Q A;  1X1P A;  1Z3X A;  3Q9V A;  1XMX A;  5ICE A;  2QZ8 A;  3HOT A;  2XIG A;  3CCQ I;  3NAU A;  1JE8 A;  2RDP A;  3ZN0 A;  1E3P A;  1K6O A;  1SD5 A;  3PFY A;  1N78 A;  4XKW A;  4IRH A;  3GTG J;  2IS6 A;  2ETH A;  4B48 A;  1ZH5 A;  2LFB A;  3HHG A;  3OYM A;  2CFX A;  3E6B A;  2D1H A;  2V1N A;  2BBY A;  2CQ7 A;  3V7R A;  2HVR A;  4LG3 A;  3HZJ A;  3WG7 H;  1BW6 A;  2HOS A;  1A35 A;  4II2 A;  4F93 B;  3M8J A;  5E3M A;  3BTC A;  4XKC A;  2G9W A;  2DFI A;  2F5D A;  5LHI A;  2EIK H;  2PMZ N;  3CDH A;  1G3W A;  3E97 A;  1R6R A;  3PNV A;  1IV6 A;  1H8A C;  4HSR A;  1SFU A;  2R7U A;  1Z9C A;  4IRG A;  5GPA A;  1X58 A;  2DMT A;  5H6R A;  3OYG A;  3F72 A;  3PL8 A;  4HX8 A;  1KU3 A;  2R7W A;  2DT6 A;  2V9P A;  3FBI B;  2O9L A;  4XM3 A;  4FX4 A;  2P81 A;  2EZK A;  5ED4 A;  4ZYE A;  4WCG A;  2CJJ A;  2MGQ A;  1GV2 A;  3LA2 A;  2OD5 A;  4L0Y B;  1WH7 A;  2L3D A;  1MDM A;  2GLO A;  4D5F A;  1OCT C;  4V2F A;  1D8K A;  2QQ8 A;  4XID A;  3BWG A;  2HYJ A;  2BE5 F;  2DOE A;  1QRY A;  2QEX I;  1TTY A;  2O0Y A;  1ORK A;  3PQK A;  4MHG A;  4QSH A;  2DMP A;  2G7H A;  3TQN A;  3GTM J;  3MWM A;  4XMY A;  4CCL A;  2CO5 A;  5HNH A;  1IXS B;  2QBY B;  5DDG A;  2ZSH B;  3DKX A;  4NQW B;  1T6S A;  4E7H A;  1L3L A;  1LDK B;  4HNV A;  3FK7 A;  4CYC A;  1MMG A;  5J47 A;  3GLX A;  2LOO A;  2RQQ A;  5F08 A;  4AIH A;  1FBQ A;  1VND A;  1EJ9 A;  2XAS A;  1K79 A;  1LE8 A;  3E5U A;  1GXP A;  1IRX A;  1LNW A;  3L2C A;  2HZD A;  1BR2 A;  2QCO A;  3ZCO A;  2K9S A;  5DCM B;  2QQB A;  1LFU P;  2EBI A;  2V7F A;  2VB6 A;  2IAI A;  3IAM 2;  2DLL A;  1Z91 A;  5GAD J;  1B6A A;  2Y0S N;  3CCU I;  3W6V A;  1EKE A;  1IRF A;  4ZYA A;  3GZN B;  4DGW B;  3E0J B;  2ZCW A;  2K27 A;  4KNY A;  2NXN B;  3KZY A;  1LEB A;  5K1Y A;  3QOE A;  5LGN A;  2HU9 A;  3F8M A;  1X1C A;  4EV0 A;  4RAG A;  1T98 A;  5M3F J;  2RN7 A;  3LSH A;  3S32 A;  2R7O A;  2XAQ A;  3HXL A;  2KIM A;  4B09 A;  1YRN A;  4RGU A;  4Y33 A;  3GYH X;  2V6E A;  1V4R A;  2P0W A;  3V4G A;  3VFZ A;  4IL6 C;  1TWG J;  1SC7 A;  4QWQ A;  3DF8 A;  2VPR A;  3H92 A;  1HSJ A;  4L9V A;  4OIQ F;  5AIP A;  5FRO A;  4FE7 A;  3SZP A;  4MEX F;  2PG4 A;  2HOA A;  2J5P A;  4RGR A;  2JUC A;  2QSF X;  1MZB A;  2E5Z A;  1EH8 A;  2WAF A;  3G73 A;  1LB2 A;  4ZYG A;  3RKY A;  3BOQ A;  2K40 A;  4G7Z F;  3H0D A;  3VYS B;  3BJ6 A;  3T5X A;  3BG5 A;  3FKI J;  4FAS D;  1BN5 A;  1XMA A;  4XQF A;  2XDV A;  4HAM A;  3K1M A;  5L3E A;  2GIV A;  3D5R C;  1V5E A;  2EFO A;  3DTE A;  4B4C A;  4BXU A;  1HST A;  4DYR A;  1KGS A;  4JBA A;  4BE2 A;  2E1C A;  3QU3 A;  5E1Z B;  4IQJ A;  3JSP A;  1QU3 A;  2DO7 A;  1I3Q J;  2BXY A;  3Q9S A;  3QRF F;  5M5X J;  2ZXW H;  4HX7 A;  4LOC A;  2ZBK A;  3K1N A;  3DLA A;  5HLI A;  2CG4 A;  2HNH A;  3U2R A;  1XGN A;  1VFC A;  2FA5 A;  4A6E A;  2YPR A;  3SZG A;  2ZB9 A;  4BQN A;  4CCK A;  4L9N A;  1WI9 A;  1K4T A;  3DXJ F;  1WFX A;  1G3T A;  5FKL A;  1NH3 A;  1S8N A;  1UEL B; 
#chains in the Genus database with same CATH homology
 1G2H A;  5FKN A;  3TP3 A;  1WH5 A;  2R5Z A;  4IEJ A;  2LVS A;  3A01 A;  1Z77 A;  5FKM A;  1WPK A;  3CQZ J;  4BY1 J;  2ECC A;  5K7Z A;  1ETW A;  3H3V K;  2WAQ N;  5K7F A;  3S1Q J;  2CU7 A;  5F1J A;  3HOU J;  4BY7 J;  4MFD A;  1PUF A;  1JT0 A;  2R93 J;  4M3G A;  5E3L A;  1TC3 C;  2X6O A;  1AU7 A;  1FIP A;  2M9H A;  3JRG A;  1UG2 A;  2GM4 A;  2GBY A;  2XPU A;  4MFE A;  4J19 A;  2HQ5 A;  5BNG A;  3JRF A;  4I76 A;  1T56 A;  2M8G X;  2XB5 A;  4JX4 A;  3ZOB A;  3BR5 A;  4A3G J;  4A3K J;  1BJZ A;  2DMQ A;  1WGX A;  1FTT A;  2E2H J;  2L7F P;  3SDG A;  1IDZ A;  4A3J J;  4W97 A;  5C44 J;  2Y2Z A;  1JTY A;  1S7E A;  1JKO C;  3O8H A;  4S0H B;  5IYD J;  3S16 J;  4M3F A;  3A03 A;  3TP0 A;  2Y31 A;  1MBE A;  3JR9 A;  1IGN A;  4FE4 A;  2D5V A;  1MBJ A;  2FQ4 A;  4XIC A;  2HDD A;  5IYB J;  5IOZ A;  2HXO A;  1IJW C;  3HOX J;  2VI6 A;  2W48 A;  2XB0 X;  3ZQF A;  2B63 J;  3HM5 A;  4DYQ A;  5EEA A;  3HB9 A;  2K9Q A;  2H1K A;  3DEW A;  2R5Y A;  2OF7 A;  3MKL A;  4XRS G;  4A3B J;  4C3I J;  2WB1 N;  1WCM J;  4AC0 A;  3IH2 A;  1NK3 P;  3WHB A;  5EGO B;  3HGY A;  1P7I A;  1H88 C;  2LK2 A;  2E2J J;  1FEX A;  1ZR2 A;  3WHC A;  4G12 A;  2R92 J;  4M3E A;  1JTX A;  3TW7 A;  2NS8 A;  2XPV A;  2HI3 A;  1MSE C;  1H89 C;  3C2B A;  1AHD P;  2FJ1 A;  2ME6 A;  2Y9Z A;  3S2H J;  5M3M J;  1XS9 A;  4C2M J;  3IV5 A;  3PO3 J;  1X2M A;  3BG3 A;  3HOY J;  4NDL A;  2AHQ A;  5JLW A;  3DCF A;  3S2D J;  3F0C A;  9ANT A;  3CCY A;  2JN6 A;  3GTJ J;  1ZGW A;  4A3C J;  3H0G J;  4GFB A;  3BR3 A;  3S1N J;  5IOY A;  3CDL A;  4CYC B;  4C3J J;  1A5J A;  2FD5 A;  5C3E J;  5EG0 B;  1IDY A;  2DMU A;  2DA6 A;  4JP0 A;  4XRM A;  4X6A J;  5IP9 J;  1JKP C;  2NVT J;  1LE8 B;  1JJ8 C;  3SJM A;  2LP0 A;  3IH3 A;  3QQA A;  3BQY A;  3Q0U A;  3QPS A;  3MVP A;  4A3F J;  1B72 A;  2LLK A;  5DTD A;  1DU6 A;  1Q1V A;  4BBR J;  1JUM A;  4FCY A;  1D5Y A;  4B3A A;  3G1M A;  2TRT A;  2ME0 A;  5F0F A;  1RES A;  5F04 A;  2NVY J;  4B1R A;  3MN2 A;  3D1N I;  4Y52 J;  2EZI A;  3B6C A;  4Y7N J;  3HGG A;  1ZKG A;  2X48 A;  2EZH A;  1MSF C;  5FKO A;  1Y1V J;  3I4M J;  1BA5 A;  3B6A A;  1FJL A;  1F43 A;  3FK6 A;  2IEK A;  1ZTR A;  4RDU A;  3GTQ J;  5J1R A;  3SFI A;  1JKQ C;  2NOG A;  2L7M P;  3HOZ J;  2R0Q C;  1AKH A;  2MW8 A;  1TWA J;  3GBG A;  4BKX A;  4D7M A;  4JX5 A;  2DJN A;  2VUM J;  1Y1W J;  2LTP A;  4UUS B;  3CMY A;  3S15 J;  4QIW N;  1JT6 A;  4MO7 A;  1W0U A;  1RKT A;  4DYC A;  5IPA A;  3JRB A;  3K2A A;  3JRC A;  1IUF A;  4A3E J;  1B8I B;  3HOV J;  2XGD A;  3BQZ A;  4D7N A;  2NVQ J;  2X9D A;  1HOM A;  1MBF A;  4EEF G;  2R7Z J;  1I6H J;  1MBK A;  4ABZ A;  4D5C A;  1GUU A;  3JRE A;  2Y30 A;  1X2N A;  1MBH A;  4A3L J;  2DA1 A;  3BG9 A;  1A6I A;  1VI0 A;  1TWH J;  1WI3 A;  2DA3 A;  1ITY A;  3LSJ A;  1FTZ A;  2DN0 A;  1JJ6 C;  2LY9 A;  1QVU A;  5FKK A;  1MH4 A;  3FIW A;  4IHY A;  2RAE A;  4DW6 A;  1ETV A;  4L5E A;  4XK4 A;  4A3D J;  2DA7 A;  3ZQC A;  1LFB A;  1NTC A;  1U8B A;  2FX0 A;  3RZD J;  3HKZ N;  3S17 J;  1U9O A;  2I10 A;  2COB A;  3S14 J;  3OSF A;  1HDP A;  2JWT A;  3JRD A;  1ETK A;  2XGE A;  3UKG A;  2EH3 A;  2L7Z A;  5J1Y A;  3LOC A;  1JGG A;  1JUP A;  1ZK8 A;  1HCR A;  1FIA A;  2CQX A;  5F27 A;  5M5W J;  3GTK J;  3I4N J;  2R5Z B;  3A01 B;  1IG7 A;  3BR6 A;  2WV1 A;  4BXX J;  1MBG A;  4IHV A;  3OIO A;  3HBL A;  5J3L A;  3BT9 A;  2AO9 A;  2L9R A;  4IHX A;  5IP6 A;  4A3M J;  1F36 A;  1EF4 A;  1OCP A;  2JMW A;  2NS7 A;  2LD5 A;  3TW6 A;  5F0H A;  1PUF B;  1Z0X A;  3BR2 A;  3PM1 A;  2OPT A;  3HDD A;  2ECB A;  3S1M J;  2ID3 A;  2E2I J;  3GTO J;  1TWF J;  3JRH A;  2JK3 A;  4DZJ A;  4C3H J;  4V2G A;  3BTL A;  3M3Y J;  1CQT A;  1NK2 P;  1P7J A;  3G1L A;  3NAU A;  2JJ7 A;  3G1O A;  3LSP A;  2LKX A;  2JA6 J;  5GPC A;  4A93 J;  2N8G A;  1GDT A;  3GTG J;  2M34 A;  2LFB A;  4XRS A;  2L0K A;  2XSD C;  1GVD A;  2IBD A;  4JYK A;  1GT0 C;  1BL0 A;  1BW6 A;  2LR8 A;  2HOS A;  5HOD A;  3OSG A;  5JLX A;  5E3M A;  4A69 C;  3BTC A;  3FIS A;  1UMQ A;  2DA2 A;  4W1U A;  2PMZ N;  4I6Z A;  1U9N A;  5FLV A;  1IV6 A;  1I50 J;  2EQR A;  1H8A C;  3K7A J;  5GPA A;  1OFC X;  1X58 A;  5F0C A;  1ZR4 A;  2DMT A;  2DMN A;  1YRN B;  1SAN A;  3ZQI A;  5DS9 A;  2O9L A;  3ZQG A;  3S1R J;  2P81 A;  5EDN A;  2EZK A;  1RKW A;  5C4X J;  1JKR C;  3Q3S A;  4JX6 A;  5EF6 A;  2VKV A;  5EGO A;  2CJJ A;  4FIS A;  5IYC J;  2YUS A;  2MGQ A;  1GV2 A;  3JRI A;  4DZP A;  3RKQ A;  3L1P A;  1WH7 A;  2VKE A;  2GLO A;  2ID6 A;  4D5F A;  1OCT C;  4V2F A;  4XID A;  5EZG A;  2HYJ A;  5EZH A;  4AYB N;  1QRY A;  2QF7 A;  5E3O A;  1ORK A;  4QSH A;  2DMP A;  3GTM J;  3RQI A;  1RPW A;  3VPR A;  1K61 A;  3LSG A;  2MSY A;  1OJL A;  3BR1 A;  4MLO A;  2O7O A;  2XRL A;  4HNV A;  2CUE A;  2DTZ A;  3FK7 A;  4CYC A;  4MIM A;  2YS9 A;  1GV5 A;  1ETX A;  5EG0 A;  1T33 A;  1ETQ A;  5F08 A;  1DU0 A;  1VND A;  4IHW A;  5J1U A;  4M3B A;  2JA5 J;  2O8K A;  1O4X A;  2XGC A;  5GP9 A;  2CQQ A;  5C4J J;  1LE8 A;  1UHS A;  2E1O A;  1B72 B;  2QCO A;  1APL C;  2DA5 A;  2M0C A;  3RZO J;  2K9S A;  5FLM J;  4AUX A;  3BTJ A;  1LFU P;  2EBI A;  1SFO J;  2IAI A;  3IH4 A;  2MG4 A;  4M3D A;  2Y0S N;  3W6V A;  3JRA A;  4A3I J;  2DA4 A;  2EZL A;  3BTI A;  1K83 J;  3HEF A;  5K7H A;  3M4O J;  5M3F J;  4UUT A;  2KDZ A;  4FTH A;  1YRN A;  1XG1 A;  2CUF A;  1QPI A;  1TWG J;  1AKH B;  5E3N A;  1E3O C;  2VPR A;  1R9T J;  2E19 A;  2KT0 A;  1HDD C;  4FE7 A;  1QVT A;  4BBS J;  1IC8 A;  3BR0 A;  2HOA A;  4M6V A;  1MH3 A;  2HXI A;  2Y9Y A;  4UUS A;  3HOW J;  1ENH A;  1RR7 A;  1U78 A;  2ELK A;  2YU9 J;  2JA7 J;  1MNM C;  1IRZ A;  2H8R A;  2K40 A;  1ETY A;  1B8I A;  3LSR A;  3TED A;  3ZQL A;  1POG A;  3BG5 A;  3FKI J;  4QTR A;  1ZQ3 P;  2NVX J;  4B4C A;  3ZQH A;  1BW5 A;  4DYR A;  5FJ8 J;  1RET A;  5EYR A;  4RBO A;  3QPL A;  1VF9 A;  1JUS A;  1HF0 A;  3GTL J;  3Q0W A;  1I3Q J;  5IP7 J;  2M2E A;  2R5Y B;  1HLV A;  5M5X J;  3NAR A;  4LOC A;  3LNQ A;  1ETO A;  2XPW A;  2K9N A;  3Q0V A;  2G0E A;  1XC5 A;  1VFC A;  3PO2 J;  2JA8 J;  3E7L A;  4X1E A;  2ZB9 A;  1TWC J;  2CRG A;  3GTP J;  2HOT A;  2TCT A;  3O8G A;  1W0T A;  5M5Y J;  3OOU A;  5FKL A;  3A02 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...