2NVTJ

Rna polymerase ii elongation complex in 150 mm mg+2 with gmpcpp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*AP*GP*AP*CP*CP*AP*GP*GP*C)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvtJ00
1XS9A 3HOZJ 3JRFA 3G1MA 1JJ8C 1HF0A 5K7FA 3CDLA 3IH4A 4DYCA 3TP3A 4BY7J 3HBLA 3RZOJ 3S2HJ 4BXXJ 3D1NI 1ITYA 3CQZJ 4IHYA 2EZHA 3K2AA 1LE8A 2HYJA 2FX0A 2HXIA 5E3NA 5K7HA 4DZJA 3DEWA 3JRBA 2JMWA 1BL0A 1QRYA 3TP0A 2LVSA 3LSRA 4LOCA 3FK6A 1A5JA 5IP7J 4D5FA 5EF6A 1U78A 1QVUA 4UUTA 3BT9A 1NK3P 1U9OA 1RR7A 1AKHB 3UKGA 4A3DJ 2KT0A 3LSGA 1ETKA 1VI0A 1ZR2A 3BG9A 3TW7A 1PUFB 3PO2J 4B4CA 2YUSA 3LSJA 1IDYA 1FEXA 4L5EA 5FJ8J 2K40A 3FISA 1GUUA 2DA3A 3QPSA 3S1RJ 4B1RA 1WPKA 3BR5A 5DTDA 2LFBA 1JTYA 2GLOA 2OPTA 2Y0SN 4JP0A 3WHBA 3HOYJ 5J1YA 4A3IJ 4NDLA 3GTOJ 5DS9A 2XGCA 1TC3C 1RETA 4MIMA 5EG0A 2DMUA 4DW6A 4XICA 3CMYA 2IEKA 2NVXJ 2R0QC 3HEFA 1D5YA 3HOWJ 2H8RA 1TWGJ 1HCRA 4RBOA 1OFCX 1IUFA 3HB9A 5E3OA 4IHVA 5FLMJ 2IAIA 1GV5A 2DMNA 2COBA 5J3LA 3A02A 3JRIA 3HDDA 3HOVJ 2FD5A 2R5ZA 3M3YJ 3A01B 2O7OA 3JRCA 4DYQA 1IGNA 1JKOC 3HOXJ 2EZKA 3A03A 2Y31A 3GTLJ 1ENHA 1B72A 2AO9A 2MW8A 1BA5A 5IP9J 1AKHA 1I3QJ 1SANA 2ME6A 1W0UA 2E2IJ 3BQYA 1JKRC 1F43A 5F27A 2QF7A 1CQTA 1X2NA 2WB1N 1PUFA 4JYKA 4B3AA 2DMTA 2GM4A 2R92J 5EDNA 2E19A 4AYBN 5F08A 4XK4A 2FJ1A 2DN0A 4S0HB 1BW5A 1ETWA 4V2GA 1ZQ3P 1JTXA 1ZKGA 5C44J 1XG1A 2Y9ZA 1H8AC 1T33A 2LD5A 4C3HJ 5M3MJ 3H0GJ 3I4MJ 4MLOA 2X6OA 2O9LA 2OF7A 2H1KA 2EBIA 2QCOA 2VPRA 5IPAA 4A3KJ 3BR1A 4EEFG 2XSDC 2DTZA 4M3GA 3Q0VA 3ZOBA 2R7ZJ 5EG0B 3MVPA 3BTCA 4A3MJ 3HGYA 2K9SA 4DYRA 1Q1VA 5FKLA 3LNQA 2HOAA 3RZDJ 1VFCA 4HNVA 2DMQA 5GPAA 4C2MJ 3IH3A 4A3EJ 3W6VA 3HOUJ 3ZQIA 5IOYA 1HLVA 3A01A 1R9TJ 4A3GJ 2JK3A 2R5ZB 5M5WJ 2VKVA 2NVTJ 2M8GX 2EZIA 3FKIJ 1WH5A 1B8IB 1BW6A 2IBDA 1H89C 1B72B 3FIWA 4X6AJ 5IOZA 2LK2A 1P7IA 4X1EA 3S1NJ 1VF9A 1FJLA 5JLWA 1TWHJ 2XB5A 4FE7A 2YS9A 2Y9YA 5IP6A 2ECCA 3G1OA 3IV5A 3DCFA 3GTGJ 2M9HA 1MBGA 3BR0A 3TEDA 3SDGA 2CUFA 3PM1A 5M5YJ 3BR2A 1MBHA 3Q0WA 1I6HJ 2LLKA 2G0EA 4MFEA 1I50J 4RDUA 2NVQJ 4AC0A 1JKQC 1GT0C 2HI3A 3Q0UA 5F04A 3ZQHA 3GBGA 1W0TA 3M4OJ 1IDZA 2B63J 1GVDA 5C4XJ 1G2HA 3HGGA 3SFIA 2EQRA 4A3LJ 2MSYA 1ZK8A 2JWTA 9ANTA 4QIWN 1IC8A 2JA5J 5M3FJ 3S17J 1F36A 2K9NA 2VI6A 4IHXA 2PMZN 3HKZN 1JUPA 2NVYJ 1GDTA 4V2FA 1POGA 1RKTA 1LFBA 1VNDA 2ME0A 1JKPC 1OCPA 2JA7J 4A3JJ 2XGDA 1SFOJ 2JA6J 1U9NA 2DA2A 1B8IA 2NS8A 5IYDJ 3S14J 3BR3A 3F0CA 3ZQCA 2JJ7A 5E3LA 4AUXA 3S1QJ 3S16J 4MO7A 2Y30A 2CQXA 1Z77A 2WV1A 2XPWA 3OSGA 1JJ6C 3MKLA 1WI3A 2DA1A 1FIAA 4FTHA 2DA7A 1HDDC 2L0KA 4FISA 3O8HA 5FKNA 1AHDP 3HM5A 2TCTA 5F1JA 1AU7A 2E2HJ 5J1UA 3BR6A 5EGOB 3GTPJ 1Z0XA 2VKEA 4D7MA 2O8KA 4GFBA 1WGXA 2JN6A 4QTRA 1APLC 3LSPA 1FTZA 1RKWA 3JR9A 1XC5A 1TWFJ 2LR8A 4DZPA 4I6ZA 4IHWA 1JT0A 4UUSB 4XRSG 3BG3A 1MBKA 1K83J 4J19A 1MBFA 3JRAA 2YU9J 1A6IA 5HODA 1QPIA 1FTTA 1Y1VJ 4JX5A 2HQ5A 1MBJA 2CUEA 5IYCJ 3BQZA 5K7ZA 1H88C 1IJWC 4ABZA 3SJMA 2X9DA 2ZB9A 1O4XA 2EZLA 1MBEA 2R5YB 5FKOA 5GP9A 1K61A 2L7FP 3RKQA 1HOMA 3C2BA 2L7MP 1WH7A 2LY9A 3CCYA 4C3IJ 2D5VA 3O8GA 1IV6A 3NAUA 3BTJA 2K9QA 1YRNB 3L1PA 3TW6A 3BTIA 5FKKA 1TWAJ 4W1UA 1ZR4A 1DU0A 3MN2A 2X48A 4G12A 4BY1J 2GBYA 2VUMJ 3PO3J 4FE4A 2XPUA 1ZTRA 1UMQA 1Y1WJ 1JUSA 4D5CA 2I10A 4A69C 3B6AA 3I4NJ 5EGOA 3GTQJ 5F0FA 3BTLA 2HXOA 1MH3A 4XRSA 4CYCA 3G1LA 2M0CA 2CRGA 2EH3A 2XPVA 1ETVA 1TWCJ 5F0CA 2LKXA 2E2JJ 1IRZA 5EZHA 1MSEC 3QPLA 1JUMA 1ETQA 3FK7A 2CU7A 4IEJA 4XIDA 2P81A 1JGGA 5C3EJ 1S7EA 2RAEA 3NARA 5BNGA 4UUSA 1JT6A 5FKMA 4BKXA 5C4JJ 5EYRA 1NK2P 5EEAA 1T56A 2MG4A 4BBRJ 5EZGA 1RPWA 4A3BJ 3VPRA 2M2EA 3QQAA 2E1OA 3ZQGA 2DA6A 3ZQFA 4M6VA 2R5YA 1E3OC 1NTCA 5E3MA 1RESA 2W48A 1FIPA 1IG7A 5IYBJ 4M3EA 2ID3A 5M5XJ 1DU6A 1ZGWA 3GTMJ 1UG2A 4JX6A 2CJJA 3OIOA 3JRDA 1YRNA 2ID6A 2DA5A 2HDDA 2LTPA 3BG5A 4FCYA 2M34A 4M3BA 4QSHA 3GTKJ 3K7AJ 2DMPA 1UHSA 2AHQA 4MFDA 2R93J 2NS7A 3WHCA 2L9RA 2XGEA 4JX4A 1P7JA 2WAQN 4M3FA 1WCMJ 1OJLA 2XB0X 1LFUP 1BJZA 2KDZA 1LE8B 3B6CA 2HOSA 2JA8J 1X2MA 3E7LA 4CYCB 4A3CJ 4C3JJ 3JRGA 5GPCA 2ECBA 5F0HA 2ELKA 2HOTA 2FQ4A 3ZQLA 5J1RA 3LOCA 4I76A 4BBSJ 3IH2A 1QVTA 1ORKA 2LP0A 1ETOA 3H3VK 1ETYA 2Y2ZA 2L7ZA 5FLVA 3Q3SA 3S2DJ 2N8GA 1U8BA 1MSFC 1X58A 5JLXA 3GTJJ 3JRHA 2CQQA 1MH4A 3JREA 2XRLA 4Y52J 1MNMC 3OOUA 1OCTC 1GV2A 4M3DA 3OSFA 4A93J 4Y7NJ 3S15J 4A3FJ 1ETXA 1HDPA 2DA4A 4D7NA 2MGQA 1EF4A 4W97A 4XRMA 3RQIA 3S1MJ 2TRTA 2DJNA 2NOGA
chains in the Genus database with same CATH superfamily
1WHUA 2CGPA 1JE8A 1XS9A 3A0HC 2WADA 3G1MA 2QGUA 5K7FA 4YIIA 1QQIA 1HW2A 3BZKA 4XSZF 3CCVI 2JRTA 5BPIA 4Z6YA 4BAYA 4CCLA 4ZYHA 4IQ4A 1R71A 2OJED 1VQLI 2HYJA 2F4MB 3GZNB 4DZJA 2JMWA 2A3SA 4WK8F 2OBPA 4LOCA 1A5JA 1ZGAA 1RR7A 1FBSA 2KT0A 1DPUA 5DCMB 1YQAA 1FOYA 2WTEA 2ETHA 3KZZA 3L2QA 2HS5A 1AA7A 1UG0A 5DYMA 1G59A 2K9LA 3FM5A 5ICEA 2RKHA 3FISA 1GUUA 2CG4A 3WE2A 2FBHA 4KDPA 2DDAA 4KUMA 5E20A 3WTSC 5CVJA 4BNCA 2OPTA 4NC8A 1LVKA 2DYSH 1W7PD 3S3OA 1QA6A 4A3IJ 5TGTA 2CUJA 1W5CC 2VBZA 4LJZF 2XUBA 4MHGA 5KCMA 4XOTA 1RETA 2ZFUA 4MIMA 4EGYA 2ESNA 3IHUA 3CMYA 1DP7P 4G6QA 4IOAF 2R0QC 1O7FA 3TL4X 3K4JA 1B59A 4RAZA 1TWGJ 1HKSA 1UB9A 2DLLA 2XGXA 5E3OA 3G6EI 1Z6RA 4IHVA 1XDUA 3HZJA 2EV6A 3FMQA 2D45A 2P8TA 3VEPA 2PMZA 2IGNA 3A02A 5BS6A 3BG6A 1TP4A 4EQQA 3M3YJ 2O7OA 5KHDA 2UV1A 1L0OC 2EZKA 1Y56A 3A03A 1N75A 2HOEA 4I09A 2AO9A 2CFOA 1R5ID 1MGTA 3ZQQA 1HBXG 1JXSA 5ILVA 4PJMA 3OYMA 2HU9A 1XX5A 2MLKA 2KJBA 2ME6A 3M7GA 3CJQB 3E6MA 2PFBA 5F27A 1R1TA 1RIOH 2WB1N 2VPLA 4JYKA 2GM4A 3ZMZA 2R92J 1S7AA 2NNYA 2E19A 4AYBN 5F08A 3SEZA 2DOFA 1QHGA 1BJAA 2FJ1A 1XMXA 2DN0A 1BW5A 4UB6C 3C2GA 2IVMA 1G3YA 1ZKGA 2RC4A 1LJ9A 2R7XA 1DDNA 1WZ2A 4AYBA 2OQGA 3H0GJ 1DGRM 5JFRA 3I4MJ 4ZDLA 1X1DA 4P5OA 2F48A 2QQAA 1WJDA 4B09A 1VQ5I 5AIQA 1W7PA 3OL3A 2OUMA 5E8IA 1KYWA 5IPAA 4LITA 3MKYB 1K7AA 4S04A 2Y75A 4EEFG 3OYLA 2KDOA 1BOAA 2LKSA 3BY6A 3ZOBA 5J40A 3BTCA 2H8WA 1LVAA 4A3MJ 3H1CA 3HGYA 3G73A 2BY0A 2K9SA 1LEAA 4KICA 4DYRA 2M87A 2ZMEA 3OYCA 3JSOA 5FD5A 3JAMZ 2Z16A 3RZDJ 2ZJ2A 3MWMA 3KP7A 4HNVA 4ZYAA 3TO7A 4C2MJ 4A3EJ 3E6DA 1IUYA 4IJAA 3WE3A 3BWGA 1KZHA 3I56I 1HLVA 4C2TA 1NG7A 1Z21A 3NEUA 4MQVA 3SHFA 3W2VA 1E17A 3R0JA 2R5ZB 2IGKA 5M5WJ 3G71I 2ZJRF 2H27A 2OTJI 5HNHA 2V9VA 4KN7X 3FKIJ 3S32A 1BW6A 3FHNA 3HPGA 3EETA 3FIWA 4X6AJ 1WJAA 2LK2A 2A6EF 3VB2A 4ZDPA 5ILUA 3GFMA 2Q0OA 3HTUA 3S1NJ 1VF9A 3CCEI 3WGIA 1TWHJ 1E3PA 3QYBA 2RDPA 1MMNA 2Y9YA 5LGNA 3DV8A 3IKTA 5HDGA 2ZJQF 3MZ8A 2X1CA 1HW1A 3IV5A 2IW5A 3I59A 4ZYDA 1HKQA 4B8XA 1J75A 4BE2A 2CUFA 5M5YJ 2R7FA 1XGOA 1O57A 3ONQA 5DV5A 1W1WE 4MFEA 3VOEA 4CCNA 2DPUA 4AC0A 2PBIA 2HI3A 2E5NA 3J7AY 3F3XA 3R60A 3ZQHA 3A2KA 1D0YA 1T38A 4QLCU 1IDZA 1CF7A 1GVDA 1QHHD 1KONA 2VQCA 3SFIA 4A3LJ 2MSYA 1WWXA 9ANTA 4QIWN 2V1UA 2YSRA 3HC7A 4WCGA 4KJZA 4XNFA 2VT2A 3HKZN 2JZYA 1JUPA 3NWSA 2V6EA 4UVBA 4H4KC 1RKTA 4XM3A 1FC3A 3FF5A 4BYYA 3BP8A 3P9CA 2PJRB 1SMYF 1UELB 2ICWG 4CO8A 3E6BA 2XGDA 2R7SA 1C0WA 4F3QA 5LRSA 2M3AA 2K4BA 2D1HA 3ZMUA 1TNSA 5EJCA 3DTIA 1IN6A 2W57A 2FXAA 5E3LA 4AUXA 1OQYA 1R4MB 3VDXA 4BH9A 5L3CA 4ENNA 1Y39A 2PN6A 3V8KA 4OU0A 1IW7F 1Z77A 4WXDA 2OAZA 2K4JA 5L3GA 2F6CA 4PK4A 2DA1A 1FIAA 2VXZA 2DA7A 1HDDC 2L0KA 3O8HA 4BE0A 3DF8A 2HYFA 5J1UA 4LLLA 1R00A 4UVAA 2A07F 2UWMA 3F23A 3BJOA 1GVJA 3CMMA 4NQWA 3M1EA 3ZN0A 4GFBA 2JN6A 4QTRA 2LMDA 3AG4H 1VQ4I 3OR2C 1X1PA 3TKYA 3DBHB 4ITVA 3JR9A 1D8JA 2ZNYA 2VONA 4I6ZA 1JT0A 2VXDA 2FF4A 2OU2A 3H36A 2EV5A 2L3DA 1SD6A 2VC0A 1K83J 3QU6A 4ENJA 4YELA 1X4PA 1QPIA 5H6RA 3OS2A 1IRXA 2PMUA 4JX5A 1JI8A 4M72A 2ZC2A 5IYCJ 1H0MA 3CUQA 4Q4ZF 4OMYA 2IA0A 2EZLA 2IJLA 1FPQA 5GP9A 3CCRI 1SD4A 1K61A 2LNBA 2E1MB 2CW7A 3V8LA 3C2BA 2D5VA 2DTRA 4NBQA 1O3TA 2OA4A 3NAUA 4YFKF 4UXNA 1B9NA 5D4SA 2Z99A 5CVIA 4S05A 1HKTA 2Q2EB 2LF8A 1YRNB 4XLCA 1FWZA 1TWAJ 4IXAA 4NC6A 4W1UA 2DFEA 2X48A 3LMMA 3PO3J 4DOZA 4FASD 2DT5A 4XQFA 3A1YA 2RVCA 1Y1WJ 2I10A 2J5OA 4UVCA 5EGOA 1NHAA 3GTQJ 3DU5A 5GAEJ 2EFNA 1MH3A 3ZMSA 3G1LA 5FGMA 1T08B 2R7DA 2KZGA 4LMYA 3RKYA 2M0CA 2XKOA 2JSPA 1WFXA 4WWCA 1D0ZA 1B9MA 2E2JJ 1IRZA 2W24A 1JUMA 3NRVA 3U21A 1VQPI 2QENA 4ASNA 2E7XA 2XROA 1FNNA 1XGSA 5JHFA 1YI2I 5BNGA 3ZRGA 1U3EM 5FKMA 4G8XA 1UZCA 5EYRA 2DQRA 1W5SA 2IGOA 4XSXF 5E8GA 2BY1A 2MG4A 1TQMA 5EZGA 1RPWA 1ZAOA 1QO0D 1XD7A 1Q1HA 2EILH 4L9TA 2FQ3A 1HA8A 5E3MA 1H9GA 2Y0SA 4HF0A 3MFKA 2ID3A 4FHTA 2VBWA 1ZGWA 1DU6A 4GDFA 2YU3A 5GAGJ 4RB1A 1I6XA 2ID6A 2LY2A 4QSHA 4D9JA 3HHHA 3QWLA 3K7AJ 4IRGA 2L2OA 2XKPA 3MCZA 1X3UA 1YIOA 1LDKB 3KYDB 5KVRA 3OYHA 1XMAA 4L5IA 3NQOA 1ZYRF 2QBYA 1SVOA 3HIFA 2VJ5A 1VQNI 4UY8I 1SEUA 4Y15A 1WCMJ 1OJLA 1Z6TA 3PL8A 1MJAA 1XGMA 2LREA 4IRHA 4BEHA 2KDZA 5IT9K 3B6CA 1J5YA 2EWNA 2XAUA 3WU2C 2JA8J 2OZUA 4A3CJ 1R6RA 3V7CA 1ZRDA 4HDUA 4QPQA 2ECBA 2F4OB 1IXCA 2IPQX 4I76A 3ZQ7A 1ZHFA 5FLXK 2E1MC 3ABLH 4E6KG 5A2QZ 4I99C 3GCMA 3H3VK 2Y2ZA 4HF1A 2L7ZA 1GHCA 2BOLA 5FLVA 1QZYA 1A6QA 2MD5A 5CQEA 4FETA 2PX9A 4GYGA 2Y69H 1T8IA 3WG9A 2KRHA 4BHBA 3RDIA 3GTJJ 3P9IA 4BHCA 4IVNA 3DU6A 2ELJA 4Y52J 3ZCOA 1GV2A 5CVRA 3OSFA 2FRHA 3DTKA 4Q48A 2GXGA 1FOXA 1OLTA 4KMUX 4DQ2A 1XN7A 1HDPA 1G8XA 1FYKA 1VQKI 2QUFA 2GXAA 5IT9Z 3Q9SA 1EF4A 2V6CA 1S7OA 4GXOA 2DJNA 1XSXA 4HG2A 2GXBA 2VIXA 1MMSA 3HOZJ 5H2FC 4KT5C 2P7CB 3K4LA 2OTLI 4DYCA 3TP3A 4BY7J 3S2HJ 3RZOJ 4BXXJ 4C9YA 2CV2A 3I4PA 3F6OA 4HF2A 4PJJA 1NG6A 1YYVA 2JUCA 4M73A 2V1XA 2X4HA 1OCOH 3F6VA 2HXIA 3HSEA 3DEWA 3E3VA 3M8FA 4E7HA 1BL0A 1QRYA 3TP0A 2VE9A 1PVEA 1FP2A 2EINH 3FK6A 2JPCA 5IP7J 4D5FA 5EF6A 3HRSA 4UUTA 3BT9A 1NK3P 1S29A 1YS6A 2NAZA 4IHSA 1ON2A 2P0WA 5CVUA 1RUNA 1W36D 3OYNA 1OPCA 3LSJA 3VYUB 4HOBA 5DD4A 1KYZA 4RB2C 4IZZA 1BBYA 5J4YA 4BACA 4NHJA 2HQNA 5ILSA 5FJ8J 4MEYF 2DA3A 2W82A 2ELHA 3QPSA 4JOMA 4KIFA 3S1RJ 1P9QC 4B1RA 1XGNA 1WPKA 3BR5A 5DTDA 2GLOA 3C2HA 2M30A 4AIDA 4JP0A 3CC4I 3KE2A 4BJ6C 2DI3A 2H94A 2E5ZA 2PI0A 5HS9A 3K4CA 4Q5SF 5J1YA 1W7PB 3PNTA 4V19K 5DS9A 1FP1D 2O5RA 4II3A 2Z9OA 3GUDA 5BQTA 3GO5A 3ZXSA 4LIUA 4XICA 3DQVC 4OIOF 1DP3A 2AQFA 2MFZA 3LA2A 2NVXJ 3CLOA 2VJIA 1D5YA 3HEFA 5H6QA 4O5VA 1U5TA 3L2CA 2OCCH 2ZMEB 1S9HA 1BR1A 2KIUA 5E1WA 4RBOA 1OFCX 1YJ9I 4ZYGA 3HB9A 2YX4A 1Y0UA 3K10A 1ZN2A 2Y0MA 5ERIA 2COBA 5CPRB 3JRIA 1FYLA 2DFHA 3GFJA 1IGNA 1ZLJA 3GXOA 1IN7A 3FXQA 4EVIA 3AG3H 3BC8A 3GTLJ 1PP8F 3ISPA 5AIPA 4QPOA 1B72A 3C3WA 1JHHA 1WKMA 1KU3A 2JPBA 3AKZA 2IS6A 1TT0A 2MW8A 1P2FA 2NVUB 4A2UA 5IP9J 1D1BA 5B1AH 1W0UA 2IS2A 4XONA 3GLLA 2CQKA 3BQYA 4OIQF 1QZZA 1FLIA 2QF7A 3ABTA 1X2NA 2HQRA 1IF1A 2P7VB 4XK4A 2GZWA 3I59B 4V2GA 1JTXA 3FM3A 4XKCA 5J8CA 3T5XA 3G4SI 2IS1A 3O3KA 1FOKA 1H8AC 4A0YA 2LD5A 2QSHX 1VZ0A 1HXDA 3R61A 4BQQA 2X6OA 4L18B 1EV7A 2OF7A 4NUBA 4M74A 4HQEA 2QQ9A 2K85A 4YFXF 4PSXA 5GADJ 3PUBA 5K1YA 1IV8A 2FNPA 4BQOA 2R7ZJ 5EG0B 1CF7B 4M6XA 2DQLA 3DTEA 3W6KB 3PUFA 4KN4X 3LNQA 2MBFA 3CCJI 2HOAA 2FSWA 2DODA 2K3PA 3HUGA 4B43A 4BS9A 4ZDOA 5D6FA 3FXKA 5HNFA 2W85A 1BI3A 3W6VA 3IH3A 1X1AA 3CC7I 4XLHA 5IOYA 2RV8A 2RGVA 4R8HA 3A01A 2KZVA 2JK3A 2UXXA 1OR7A 1W4MA 2VKVA 5CJ9A 2FA5A 4ESFA 2STTA 3RYRA 2E7WA 4O6JA 1FOWA 3G3ZA 4YRVA 1LQ1A 1ODDA 2MLGA 3S8PA 1P7IA 2NOJB 4N9HA 3TQNA 5HS7A 1Z1DA 4XKWA 2EV0A 2XB5A 2YS9A 3H9GA 4FE7A 4HA8A 3ESWB 4XRFA 5IP6A 2EFOA 4RLFA 4ZTFA 3IWZA 1Z3YA 1ZLKA 1JHFA 3M9AA 3FXMA 2ZMEC 3PM1A 1MBHA 1K4TA 1HSTA 3Q0WA 2LLKA 2F5FA 4Y13A 4RA2A 3KP6A 3SEQA 2BGCA 3VYRB 4A6DA 4RDUA 2L9NA 2BW3A 5TISC 2QSGX 2E60A 3TOBA 1GT0C 5L3DA 2XAHA 1LEBA 1YOVB 1W0TA 3AG1H 3CDIA 4IL6C 3JCUC 1G2HA 3H5RA 3HL2A 4PCQA 1X19A 4BJ5C 2X1DA 2AQEA 1U2WA 4N4OB 1M1EB 1QNTA 1WRJA 2K9NA 3CZ6A 2PMZN 3LSMA 1Y8QB 4F55A 1GDTA 4V2FA 2ZXHA 4XKBA 3F8NA 2A5WA 4XR6A 2ZXWH 4AM3A 1MIJA 3I9V2 1JKPC 2ME0A 5LHHA 1ZG5A 3RPQA 4RAFA 4I98B 4IOCF 4A3JJ 4HNTA 3CP2A 4ENKA 1EJ9A 3S93A 2QSFX 2A05A 2OC6A 2MD0A 2YPRA 4XL9A 3KLOA 4F92B 3JAMK 2DW4A 3S1QJ 4KA4A 2ADUA 3BLYA 4L0ZB 3MKLA 3CJNA 3HJEA 4FTHA 2B7EA 4FISA 4IF4A 2X85A 1LPQA 2TCTA 1OKRA 1YIJI 1TLHB 4HQMA 5EGOB 4X0GA 4M71A 1OISA 2KPMA 2XF5A 3LA7A 3S2WA 3ZR8X 5D5WB 2WY7Q 2M8EA 1KU7A 1OCCH 1Z0XA 2LDUA 3H92A 1P92A 1YE9A 4HW0A 5AONA 3IAM2 3QP6A 2DU9A 1D1AA 1FBUA 4TV7A 2O8KA 2A68F 4XLAA 3R0AA 4KYWA 3LSPA 1RKWA 4UV9A 1OMIA 1XC5A 4L9JA 2LR8A 2BXYA 3K0LA 3I54A 4PUSA 3I3LA 1VQ8I 2MH2A 3KP2A 1UFMA 4DBQA 1MBFA 1SVLA 5B5EC 1A6IA 1FTTA 2CQNA 4HX8A 1GLNA 3K6GA 4RGUA 5TJJA 5B66C 2M4GA 1RUOA 3LFUA 1IAWA 1LB2A 2XSJC 2QKLB 2DT6A 2CUEA 5D5UB 3RI4A 1ZELA 4E7LA 1H88C 2X9DA 3M07A 4BDYA 1O3SA 1ZG1A 3LSKA 4HZFA 3W3CA 5CVVA 3GYHX 1SD5A 3ZPLA 1IN5A 2LBFA 3GX4X 2MYSA 2VODA 1HOMA 4C3IJ 3DEEA 3B02A 3KP5A 3WG7H 4DIQA 3WTYC 3CD6I 1Y0NA 2LY1A 1YJWI 2HWVA 3TW6A 3BJ6A 5FKKA 4RS8A 4HX7A 1ZR4A 2XAQA 4BY1J 1Y8RB 5KAIC 2ZO4A 2GBYA 3KEQA 4FE4A 1K6YA 1J2XA 2M4KA 2JRMA 1I3AA 1UMQA 1J0RA 3CMAI 3RPUD 3DEUA 1BI2A 1JUSA 1XB4A 3K2ZA 3NWTA 3B6AA 4XKVA 3MZHA 4HAMA 4BEHB 2K27A 2L9VA 1WSUA 2O0YA 1QPMA 4CYCA 2HDWA 1P4AA 2ZKZA 2CRGA 2F5VA 3GWZA 4CSWA 2BYVE 3X2QH 3J80Z 3CUQC 1Z67A 2EK5A 1TNTA 3L2WA 5F0CA 2LKXA 5LGTA 1SD7A 5EZHA 3F9KA 3W2WA 1R5HA 2CS3A 2R7VA 4U87A 3RTRA 5C3EJ 4UUSA 3SZTA 3OYKA 2E36A 3CCLI 3TO9A 1MZBA 1Z7UA 2C6YA 1I1SA 2JT1A 3WU0A 3RCOA 4EMSA 1B1BA 2V1DA 2KFDA 2NS0A 3QQAA 3E6CC 1B4AA 2BXZA 1TL8A 2CV1A 2R5YA 3RYPA 4A6EA 4BXFA 1E3OC 5GAHJ 4IX7A 1FIPA 3BCAA 1LDJA 2DOEA 2L4MA 1FMVA 4JX6A 2CJJA 3I53A 3OIOA 4CCJA 1ON1A 1KQ8A 4HX4A 5DM7F 2LTPA 3BG5A 4PFOA 3BDDA 2M34A 2D1VA 2GAUA 3I5UA 1ZRFA 3WTZA 2GOXB 2GIZA 1SFUA 2BZTA 2DMPA 2K3FA 3N05A 4M6YA 2P5LC 3FMSA 3WTVC 3CDHA 3CCUI 2L9RA 2XASA 2XGEA 3BZ6A 4E70A 4AIJA 3HSRA 1GXQA 4JX4A 3RPUA 2DO7A 2NRAC 1P7JA 4FT8A 3UR3C 1K79A 4KITB 2KRCA 5EEGA 4R1HA 3VSLA 3KZYA 4G7ZF 2XB0X 2HOSA 1DPRA 2EIJH 4C3JJ 5E79C 4DNCA 3CJRB 1IRFA 5F0HA 3HRTA 3QRFF 2HOTA 2WBMA 2ZNZA 3OV8A 2STWA 4BBSJ 3IH2A 3KCCA 4IPAA 2LP0A 2FOWA 1FZPB 2ISZA 1XMKA 2XV4S 5BMZA 2DFFA 1ETYA 1CGPA 1YW9A 4HSTA 3DKYA 3Q3SA 3S2DJ 1WJEA 2VT3A 1U8BA 4KIBA 1IN4A 1X58A 5JLXA 1TT5B 2VKDA 2CQQA 1MH4A 4B48A 4LK1F 4YFNF 2X1EA 1BIAA 1USSA 2FOKA 1B6AA 2XRLA 3FWEA 2CV0A 2PMHA 1LUJB 5B1BH 4PSWA 2RQQA 2L02A 3DPUA 4NB5A 2DJIA 4M3DA 2H09A 2XHKA 5L3EA 5DUKA 2WWYA 1ETXA 4CZZA 1YHQI 2MGQA 2L4AA 2JQ7A 3E97A 2PG4A 1P6RA 3RQIA 1V5FA 3S1MJ 2CH0A 1TQPA 2TRTA 2VQLA 2EIMH 3K4BA 3DKXA 4BUPA 2E34A 5DDGA 2H6CA 4ESBA 1JJ8C 1R36A 1HF0A 3CDLA 2FU4A 4NC7A 5ICCA 3ABMH 3FBNB 3VWBA 3R4KA 3D1NI 3MQ0A 2KL4A 5K5OA 3CQZJ 1WJFA 1WJCA 2EZHA 3K2AA 3CESA 1WQ2A 3MZYA 2BHYA 2FX0A 4AVPA 5E3NA 1S72I 5K7HA 1N25A 3JRBA 4KMFA 3OS1A 3VFZA 2LVSA 2VJ4A 4E7ZA 2E1NA 3H35A 1REPC 5KNLA 4RM3A 4RGSA 3PJRA 3HHGA 1QVUA 1U9OA 3RQ4A 3U2RA 4A3DJ 4E7SA 1HC8A 4I0AA 4ENMA 1ETKA 1VI0A 3KZIC 1SC7A 4U0VA 2NYXA 2VASA 3OS0A 4PFPA 3SZGA 2XAJA 1IDYA 5LEJA 3OR1C 5BOXA 1FEXA 4L5EA 5K5QA 4HNUA 2KP6A 4I02A 4CUGA 3WTXC 3K70D 1IZ1A 4WXHA 4D1QA 3K1PA 2Y0SN 3TGNA 3IRRA 1K78B 3HOYJ 4AIHA 2R7UA 2GWRA 2QA4I 4M9XA 1UCRA 1TW2A 2E35A 4LFUA 3L9FA 3M8EA 2A5YB 3GTOJ 1J59A 4EJOA 5LHIA 5A2QK 3T8RA 3WGHA 1PJRA 3VSKA 2DMUA 4BGDA 5IY5H 3EDPA 4C2UA 1BR4A 2IGMA 4LK0F 5L3BA 3LSTA 2WAFA 1V5EA 1WJBA 4G9YA 2BVMA 1YO5C 1IUFA 4G6DA 1UAAA 3F8CA 3DLAA 3HUGB 1ZG3A 2EA4A 4MTEA 3L2VA 1GV5A 3CTAA 2DMNA 3H3UA 3CJTB 4Q47A 2HPMA 3AFHA 5J3LA 4ZH4F 1BN5A 3HDDA 2R5ZA 5TRDA 3A01B 4DYQA 2UUZA 1FYMA 4UNOA 3OYJA 2HVQA 4G6TB 3RKXA 2JVGA 2HPIA 5E18F 2O3FA 2QYOA 4O3MA 4FQGA 3M1CA 2OCEA 1AKHA 2BY2A 4EM1A 2UZKA 1F43A 1CQTA 3O2PE 5JHUA 1PUFA 4WF2A 2MA3A 3QU3A 4C30A 5ICGA 1WJ5A 3SFZA 4S0HB 1ETWA 1ZQ3P 1U5TC 4E7KA 4EGZA 1XSDA 1N77A 3FZVA 4BJTA 1YX5A 3HOSA 2VJJA 4MLOA 2HQAA 1HQCA 2R7RA 2XIGA 3CCSI 4MQ9F 5CYVA 1QGPA 4ON0A 4CICA 2BW3B 3A4CA 4PJLA 3DBRB 2F5DA 3BR1A 2XSDC 2DTZA 3GZ6A 2TDXA 4PDKA 5JR3A 5D8LB 4M3GA 2B0LA 3TDZC 3FXRA 3JTHA 3ROUA 2R4GA 2VQGA 4BE1A 3S3MA 4HRIA 1LDDA 1D1CA 1RC9A 4LIVA 1Q1VA 5FKLA 4A0ZA 3CLQA 1R5GA 5GPAA 4F93B 1YG2A 2VN2A 2E1CA 1XSVA 2AS5F 1W36C 2FMLA 2PJRA 3HOUJ 2KIFA 2OD5A 3F22A 5CKTA 1KU9A 2NVTJ 2M8GX 2GA1A 4XLFA 4OAZA 4CA0A 4D0PA 3N4MA 2IBDA 1Z7LA 1KGSA 2DXIA 2IA2A 2LOOA 1H89C 1SAUA 5E17F 5IOZA 1NH3A 4HEA2 2P5VA 1EH8A 2JTVA 2K86A 3D5RC 3KP3A 1FJLA 1V5GA 5JLWA 3MD2A 2HVRA 1F1ZA 4LLGF 2CFXA 2CQ7A 4GYIA 2ZSIB 3DCFA 3GTGJ 2M9HA 1MBGA 3QPHA 5JVGF 3SDGA 3OWTA 4HDVA 4AIKA 5D4RA 1MJ9A 2G7UA 3DLLF 3EPZA 2R7QA 5GTHC 2EJRA 2BV6A 2ZJPF 4ZYEA 4IO9F 1I50J 2M1BA 2R3SA 2NVQJ 1JKQC 4P1WA 2D2WA 2VKHA 3E5UA 3ML6A 5F04A 3RIRA 5HOOA 4E7IA 3ERED 4CZCA 3GBGA 1OR7C 3P9KA 4RGRA 4G7HF 4CDGA 3M4OJ 2B63J 1QZEA 5C4XJ 4DJAA 3HGGA 5HDNA 2HVSA 1ZK8A 2XRNA 3BOQA 2JWTA 4AU7A 1IC8A 2JA5J 3S17J 4BU2A 3KEYA 1F36A 4ESJA 2ISYA 2EFPA 2VI6A 1E3HA 5FROA 2NVYJ 1POGA 2CW0F 4CXFA 3OL4A 2K7LA 3S3NA 2JA7J 1ULYA 2ESHA 1DUXC 2LBFB 1LKXA 2CUZA 1YLFA 4EV0A 1HW5A 3CCQI 2CMPA 2L9SA 1SMTA 1SFOJ 4L9VA 1WI9A 3D5SC 2JA6J 5HS8A 2DA2A 1B8IA 4WX9A 5IYDJ 2EPFA 3BR3A 3L09A 3WGGA 3OYAA 2P4WA 5LHGA 4LG0A 3CMEI 2RNJA 3MMYB 2Q1ZB 2NNNA 2JJ7A 4AWXB 1S5LC 1I39A 3ULQB 4MO7A 1V54H 3S16J 2MC4A 2FMYA 1KQ9A 2Y30A 2CQXA 2F5EA 2KIQA 3OSGA 4GCVA 1L3LA 1JJ6C 1WI3A 5LGUA 3V4GA 4F91B 1AHDP 2X6WA 1G3SA 1Z05A 4IRIA 3H3ZA 1ERDA 2HNHA 3DPTA 2E2HJ 3WTUC 5JVTA 3LQQA 2HDCA 3JW4A 2KJCA 2M45A 3HRMA 3TO6A 4U7BA 2CW8A 4XLNF 2DCEA 4LGWA 2IA1A 2KKOA 2VKEA 3QYFA 4D7MA 1Z9CA 2XDVA 2V9KA 3KEOA 3KYLA 5ED4A 1PUEE 1D3YA 2LKPA 4I2OA 5LFAA 2IRFG 1APLC 3CC2I 4P9UA 4XBFA 2ZSHB 1YS7A 1N78A 1FT9A 1FTZA 5FB2A 3EUHA 1TZLA 1TWFJ 3IAS2 1STZA 4XORA 1VQ6I 4IHWA 1MKMA 2V79A 3KFWX 1R1UA 2H1LA 4UUSB 1U8RA 3ZGKA 3OY9A 1UHMA 5JI6A 4N4NB 1A31A 5HODA 3HG9A 4XLPF 1Y1VJ 2F2EA 1RR8C 3K4NA 3KETA 3MEXA 1MBJA 1Y6IA 2KMUA 4UB8C 4MNUA 3BQZA 1LFPA 1IJWC 4OIPF 3SJMA 1O4XA 2ZB9A 5FD6A 3EYYA 1MBEA 3ZN1A 2R5YB 4Y17A 3GF2A 3V42A 2L7FP 2VBYA 4OAYA 3RKQA 3CCYA 1WH7A 1BI0A 3T0YA 1FX7A 3BTJA 2LG4A 3C1DA 2I5UA 2K9QA 3L1PA 2UXNA 3ASNH 1R23A 2VE8A 2A69F 5F6FA 3BTIA 4UUVA 4G12A 1P4XA 3CCMI 1K4SA 4CHUA 1RZ4A 2H6BA 4P96A 2G9WA 4H0EA 1A04A 2LRDA 2R7WA 3PSFA 3K1MA 4KIGA 4LG3A 4A69C 1MDMA 3W2AA 5F0FA 3BTLA 3ZMVA 1SFXA 4OINF 2WC2A 2HXOA 4XRSA 2M5WA 4B44A 2QWWA 1KU2A 3LA3A 2EFWA 4NQWB 2EH3A 1ETVA 1X3ZB 2Z1DA 2EIKH 2BE5F 2M7BA 3K9TA 4P9FA 5FRMA 3SXYA 1MSEC 3QPLA 2LYCA 2JUGA 4BHPA 2L7KA 3C7JA 3LAPA 3HTSB 3T8TA 4IEJA 4XIDA 1J09A 2Q8KA 2QEXI 1JGGA 4BQNA 1S7EA 5J8FA 3NARA 4RAGA 1JT6A 2JSCA 1NK2P 5EEAA 3J7AO 1T56A 3FXOA 5H20A 3JSPA 2BY3A 2GIVA 4BBRJ 2KRFA 3VPRA 4A0XA 1OYWA 3GEZA 3V8JA 3ZQFA 3B73A 3CUQB 1USTA 3LL7A 1RESA 2W48A 3RJPA 1IG7A 2DK5A 5M5XJ 3OYIA 3HXLA 4OWRB 3SYTA 1T98A 2DA5A 2HDDA 1AWCA 4E4HA 3GTKJ 3BG7A 1BC8C 1UHSA 2AHQA 2IS4A 2R93J 1DGWY 4LB5A 5HLIA 2RNGA 3H5NA 4A12A 1T0FA 3M8JA 1DQUA 3GW2A 4II2A 2HKOA 3TMOA 2WAQN 1LFUP 1BJZA 3TOAA 1FMWA 3G2BA 4RGXA 3L2RA 1X2MA 2WAQA 3ZMTA 1ZH5A 3E7LA 2FBIA 4RLQA 2HFHA 5HDKA 2VBXA 5GPCA 2ELKA 3GFIA 2PLYA 3LOCA 5FO5A 1BM9A 1ORKA 4YG2F 4KT6A 4CGZA 1ETOA 5J6XA 1KA8A 5CLSA 1MMDA 4UV8A 2YR2A 2WB1A 2L5QA 4BL0B 4LLNA 2O61A 1D8KA 3PQJA 3JRHA 5FFZA 1YITI 3J80K 3L7WA 1PYVA 3F8BA 5HLGA 3JREA 3ABKH 1LNWA 3PSIA 4ZZLA 1MNMC 1RI7A 3OOUA 1OCTC 1J7KA 1I1GA 2Z3YA 4Y7NJ 2ZXIA 5IT3A 1Z3XA 1HSJA 3ECOA 1A36A 1A35A 4W97A 4XRMA 1VQ9I 2DK8A 2YX7A 3OYEA 1QU3A 1I5ZA 2QZ8A 2QQ8A 3FHZA 2HZTA 3DWLE 3JRFA 3T1BA 1SFEA 3H0DA 3FKJA 3IH4A 1G3TA 2QKMB 1G6NA 2V26A 3HBLA 4R79A 3OYGA 2QBYB 3TBIA 4KNYA 3AL0B 2FE3A 3J7ZI 3KLNA 3JTGA 1ITYA 2W84A 1XTAA 4IHYA 4HBLA 5LBQA 1ZREA 1LE8A 1MNEA 3AG2H 2A6TA 3AAFA 2KLOA 3I0TA 3LSRA 2HTSA 3CP8A 1U78A 3IUOA 2HGCA 2R7OA 1OCRH 1AKHB 3UKGA 2X51A 3LSGA 5DD8A 1ZR2A 2K02A 4MEXF 2VQHA 4DGWB 3BG9A 4Y3OA 3A0BC 1IO2A 3LSHA 3TW7A 1PUFB 4B4CA 1I27A 2YUSA 3ASOH 2QLZA 3PO2J 1MMGA 3J81K 3EUAA 1XPXA 1VQOI 3KPHA 3FDYA 5LEKA 4PGGA 2K40A 2ZXJA 1FSHA 2WAEA 2HYGD 1BIBA 3H9QA 3PNYA 3QPTA 4ZJZA 1R58A 2W4SA 2LFBA 1JTYA 1YX3A 3WHBA 2EFQA 4AVZA 3F8MA 5F1RA 2PJPA 2ZCWA 2FEZA 1R4NB 2V7FA 4A5MA 4NDLA 2WY8Q 2XGCA 1TC3C 2O6GE 3KYCB 4J00A 2BVLA 5EG0A 3OMYA 4DW6A 3WTTC 1BI1A 2LSOA 3F21A 2IEKA 4GRIA 4HV5A 3HOWJ 4RB3C 2H8RA 4N0BA 1HCRA 2P6SA 4AD9A 1EKEA 3CUOA 1BC7C 5FLMJ 3PFIA 4L5JA 4XOPA 3IL2A 4EM0B 2FNAA 2IAIA 2VL8A 2LH9A 1T39A 3HKZA 3CO7C 3HOVJ 3FXLA 2FD5A 2QVOA 3QODA 3P7NA 4PJ0C 3DXJF 3J81Z 1U6GA 1MMAA 3JRCA 1JKOC 3MKWB 3HOXJ 1T2KA 2G7HA 3DP7A 3PNVA 2Y31A 3ZMDA 1ENHA 3ELKA 1QBJA 4XLEA 1PDNC 5L3FA 1BA5A 4Z2YA 4YEJA 1I3QJ 1SANA 5DCMA 2E2IJ 4HV6A 2HEOA 1JKRC 4IHTA 4EJTA 2PQ8A 4B3AA 2DMTA 2XC7A 1SAXA 5EDNA 2VOOA 3HRUA 3RKWA 5D5VB 4ZTJA 3E0JB 5C44J 1XG1A 2Y9ZA 3PFYA 1T33A 4C3HJ 5M3MJ 3FMRA 1AOYA 5B3SH 2O9LA 3RSNA 3REOA 1ZARA 5D6EA 1X1BA 2H1KA 2P6TA 3AL0C 3IWFA 2EBIA 2QCOA 3QYEA 2VPRA 2XF7A 3IC7A 4A3KJ 4PGHA 5LLQA 4ZZDA 1V4RA 5DUIA 3Q0VA 4M9ZA 2LC2A 3GFLA 4I0BA 3MVPA 4IQJA 1FY7A 2ACJA 3LAJA 4P55A 4U0YA 1OYIA 1KQ0A 1U5TB 1R22A 3U1KA 1VFCA 5HVQC 2DMQA 2V4JC 4CYDA 2CYYA 3CO6C 1SFKA 2V1NA 2IT0A 3E5XA 1TW3A 3ZQIA 4OOIA 3SQNA 3PIOF 3V7RA 3MKZA 4XN3A 1R9TJ 4A3GJ 3O6BB 1R49A 4G7OF 2RREA 2IXSA 4YIFA 1R7JA 1VQMI 3K70C 5ICFA 2EZIA 1B8IB 1WH5A 3Q9VA 2Z33A 3EUKL 3I55I 3E1SA 3KP4A 4LG0B 1B72B 4Y33A 5F64A 3Q5FA 3V7SA 3N97A 2MC3A 4K2EA 1MJBA 4FX4A 4X1EA 2KHMA 2EB7A 4HYEA 1ACIA 3WU1B 2DDBA 1F9NA 1SVMA 3QAHA 3VYSB 2ECCA 2CWEA 4EJVA 2BHZA 3G1OA 3J7YJ 2Y48A 3BR0A 5BPDA 3TEDA 2NXNB 3L00A 3QOEA 3BR2A 3TDUC 3I71A 3U9GA 2HZDA 1I6HJ 1YW7A 4I7HA 2G0EA 2OQRA 2A6HF 2X0LA 3OIQA 1VTNC 3Q0UA 1RNLA 3OYFA 1PP7U 1U0JA 2VC1A 3DBLB 2EQRA 3UNGC 1S3JA 4NNJA 4CCOA 3GLXA 5M3FJ 2L54A 3DKWA 2B9SA 4IHXA 1J9IA 1IRGA 2ZBKA 3R6SA 3IKVA 3KX2A 3PIPF 1LFBA 1WVRA 1VNDA 4L0YB 1OCPA 3I58A 2V9PA 2F5CA 3SZPA 1ONVA 3D0SA 3ZP5A 1U9NA 3BZCA 1O3QA 2NS8A 3S14J 5E1XA 3F0CA 3EYIA 3K4MA 1FSEA 1E2XA 3ZQCA 1MNDA 2XAGA 4EATA 5J4VA 4HLYA 1V3FA 3U1DA 4HLXA 2QQBA 1UHWA 4LD5A 1P4WA 2WV1A 4EJWA 2XPWA 2XVCA 1MW7A 1D5VA 5FRNA 5FKNA 3HM5A 4CCKA 2O03A 2DOAA 5F1JA 2OZ6A 1AU7A 2R7TA 1MDMB 3BR6A 5FFXA 3GTPJ 2A61A 1RRJA 4WXCA 2DFIA 3ABUA 1XCBA 1EH6A 2HKXA 1BOBA 3L2UA 1WGXA 1GXPA 4GO1A 2FUG2 3F72A 4QWQA 3BJAA 5CQGA 4RB0A 2I8DA 4DZPA 4OMZA 2DT7B 3BROA 3BG3A 1MBKA 4XRSG 4J19A 3JRAA 2YU9J 2RQPA 3WODF 2GOMA 2CSOA 1BR2A 2HQ5A 5KAFC 3PQKA 3OIPA 1R1VA 5DEQA 5K7ZA 4LB6B 4ABZA 1FBQA 2J5PA 3LWFA 2VLAA 2X6YA 3HYIA 4L9NA 5FKOA 1VQ7I 4F7ZA 2GA2A 1IN8A 4MTDA 1X4OA 2L7MP 2LY9A 3O8GA 2XF6A 1IV6A 4U0WA 1EA3A 1OYYA 3CF2A 3H5AA 3QP5A 2P5KA 4XMYA 2E71A 1Z91A 2CO5A 2OV7A 3MN2A 5K5RA 1DU0A 4BQAA 5E1ZB 2F4IA 2VUMJ 3EUHC 1ZGJA 3IP4B 6PAXA 3LSIA 5FLXZ 2XPUA 2JVHA 1X3WB 1ZTRA 3KIOA 1TQIA 1X1CA 5LD2C 3FBIB 4D5CA 3LQRA 1UJ8A 2VB6A 4RMNA 3K4KA 4JBAA 2DBBA 1IXRC 3COAC 3I4NJ 5HLHA 2DAOA 1TBXA 2GQQA 2QM3A 3K1NA 5D8KB 1D0XA 3K69A 5DCFA 3DFGA 4ETSA 2COMA 5EEHA 4CCMA 4XN0A 5LRRA 2XPVA 3GMEA 1TWCJ 1K6OA 3OYBA 3ECHA 3FX3A 1ETQA 3FK7A 2CU7A 2W25A 4KISA 2P81A 5GTIC 1YW8A 2KQRA 5DM6F 2VOPA 2RAEA 4BKXA 5C4JJ 1F5TA 4ANJA 2K9MA 1TTYA 2BBYA 2FBKA 4U88A 1OCZH 3I64A 3SDBA 2W7NA 4A3BJ 4IKFA 2M2EA 3CF5F 2E1OA 3GZ5A 3ZQGA 2DA6A 3DPLC 3MAJA 4M6VA 4HSRA 2W1OA 4RM2A 1NTCA 4B47A 4U7DA 5IYBJ 4M9SA 4M3EA 1V55H 4BDZA 3HPHA 4MGRA 4PJNA 1UG2A 3GTMJ 2Q2EA 3OYDA 3JRDA 4DBRA 1YRNA 2PEXA 4FCYA 3W6JB 4M3BA 2BEOA 1S8NA 4OIRF 4EJUA 3BPXA 4MFDA 1T6SA 1G4DA 4YIRX 4KFCA 1H9TA 2NS7A 4CH7A 3WHCA 4GGGA 2Z5UA 1W5TA 5HLTA 3QOPA 4M3FA 2DYRH 4G94A 4BXUA 3FXUA 2RN7A 4B3XA 1LE8B 1E0EA 2K5CA 3FXJA 4CYCB 1EH7A 2KISA 1YJNI 1G3WA 3JRGA 2WV0A 3D5LA 4EM2A 1S6LA 2AXLA 1IXSB 1O3RA 2FQ4A 2L01A 4A5NA 5J1RA 3ZQLA 2LF7A 3BPVA 2DPDA 4ZC3A 3P5JA 1QVTA 5J47A 3WTWC 2O8XA 2M0MA 2XAFA 3OOPA 2IP2A 4JK1X 5D5XB 2WA0A 3VODA 3HSFA 3F8FA 4J01A 2JA2A 2Z2SB 2N8GA 4JQFA 4RAYA 3HOTA 2KIMA 1MSFC 3ERMA 5KK1A 2MH9A 4FX0A 4UHTA 4N9IA 3H9JA 3VYTB 3LFKA 1K78A 2ZFWA 1T0FC 1YFHA 2MABA 2EA2A 3GVAA 1F4KA 1ZRCA 4E7JA 4HPQA 2W00A 4A93J 2HTJA 3S15J 2AXTC 1T95A 1YTYA 4A3FJ 3EQLF 3E5QA 2DA4A 4D7NA 3IRQA 1XCVA 2X6XA 1JGSA 1O7LA 2M7AA 1XDSA 4Y4RA 1MD0A 2HR3A 3BCBA 4PZJA 4F52A 3C18A 4I01A 2NOGA
chains in the Genus database with same CATH topology
1XS9A 3HOZJ 3JRFA 3G1MA 1JJ8C 1HF0A 5K7FA 3CDLA 3IH4A 4DYCA 3TP3A 4BY7J 3HBLA 3RZOJ 3S2HJ 4BXXJ 3D1NI 1ITYA 3CQZJ 4IHYA 2EZHA 3K2AA 1LE8A 2HYJA 2FX0A 2HXIA 5E3NA 5K7HA 4DZJA 3DEWA 3JRBA 2JMWA 1BL0A 1QRYA 3TP0A 2LVSA 3LSRA 4LOCA 3FK6A 1A5JA 5IP7J 4D5FA 5EF6A 1U78A 1QVUA 4UUTA 3BT9A 1NK3P 1U9OA 1RR7A 1AKHB 3UKGA 4A3DJ 2KT0A 3LSGA 1ETKA 1VI0A 1ZR2A 3BG9A 3TW7A 1PUFB 3PO2J 4B4CA 2YUSA 3LSJA 1IDYA 1FEXA 4L5EA 5FJ8J 2K40A 3FISA 1GUUA 2DA3A 3QPSA 3S1RJ 4B1RA 1WPKA 3BR5A 5DTDA 2LFBA 1JTYA 2GLOA 2OPTA 2Y0SN 4JP0A 3WHBA 3HOYJ 5J1YA 4A3IJ 4NDLA 3GTOJ 5DS9A 2XGCA 1TC3C 1RETA 4MIMA 5EG0A 2DMUA 4DW6A 4XICA 3CMYA 2IEKA 2NVXJ 2R0QC 3HEFA 1D5YA 3HOWJ 2H8RA 1TWGJ 1HCRA 4RBOA 1OFCX 1IUFA 3HB9A 5E3OA 4IHVA 5FLMJ 2IAIA 1GV5A 2DMNA 2COBA 5J3LA 3A02A 3JRIA 3HDDA 3HOVJ 2FD5A 2R5ZA 3M3YJ 3A01B 2O7OA 3JRCA 4DYQA 1IGNA 1JKOC 3HOXJ 2EZKA 3A03A 2Y31A 3GTLJ 1ENHA 1B72A 2AO9A 2MW8A 1BA5A 5IP9J 1AKHA 1I3QJ 1SANA 2ME6A 1W0UA 2E2IJ 3BQYA 1JKRC 1F43A 5F27A 2QF7A 1CQTA 1X2NA 2WB1N 1PUFA 4JYKA 4B3AA 2DMTA 2GM4A 2R92J 5EDNA 2E19A 4AYBN 5F08A 4XK4A 2FJ1A 2DN0A 4S0HB 1BW5A 1ETWA 4V2GA 1ZQ3P 1JTXA 1ZKGA 5C44J 1XG1A 2Y9ZA 1H8AC 1T33A 2LD5A 4C3HJ 5M3MJ 3H0GJ 3I4MJ 4MLOA 2X6OA 2O9LA 2OF7A 2H1KA 2EBIA 2QCOA 2VPRA 5IPAA 4A3KJ 3BR1A 4EEFG 2XSDC 2DTZA 4M3GA 3Q0VA 3ZOBA 2R7ZJ 5EG0B 3MVPA 3BTCA 4A3MJ 3HGYA 2K9SA 4DYRA 1Q1VA 5FKLA 3LNQA 2HOAA 3RZDJ 1VFCA 4HNVA 2DMQA 5GPAA 4C2MJ 3IH3A 4A3EJ 3W6VA 3HOUJ 3ZQIA 5IOYA 1HLVA 3A01A 1R9TJ 4A3GJ 2JK3A 2R5ZB 5M5WJ 2VKVA 2NVTJ 2M8GX 2EZIA 3FKIJ 1WH5A 1B8IB 1BW6A 2IBDA 1H89C 1B72B 3FIWA 4X6AJ 5IOZA 2LK2A 1P7IA 4X1EA 3S1NJ 1VF9A 1FJLA 5JLWA 1TWHJ 2XB5A 4FE7A 2YS9A 2Y9YA 5IP6A 2ECCA 3G1OA 3IV5A 3DCFA 3GTGJ 2M9HA 1MBGA 3BR0A 3TEDA 3SDGA 2CUFA 3PM1A 5M5YJ 3BR2A 1MBHA 3Q0WA 1I6HJ 2LLKA 2G0EA 4MFEA 1I50J 4RDUA 2NVQJ 4AC0A 1JKQC 1GT0C 2HI3A 3Q0UA 5F04A 3ZQHA 3GBGA 1W0TA 3M4OJ 1IDZA 2B63J 1GVDA 5C4XJ 1G2HA 3HGGA 3SFIA 2EQRA 4A3LJ 2MSYA 1ZK8A 2JWTA 9ANTA 4QIWN 1IC8A 2JA5J 5M3FJ 3S17J 1F36A 2K9NA 2VI6A 4IHXA 2PMZN 3HKZN 1JUPA 2NVYJ 1GDTA 4V2FA 1POGA 1RKTA 1LFBA 1VNDA 2ME0A 1JKPC 1OCPA 2JA7J 4A3JJ 2XGDA 1SFOJ 2JA6J 1U9NA 2DA2A 1B8IA 2NS8A 5IYDJ 3S14J 3BR3A 3F0CA 3ZQCA 2JJ7A 5E3LA 4AUXA 3S1QJ 3S16J 4MO7A 2Y30A 2CQXA 1Z77A 2WV1A 2XPWA 3OSGA 1JJ6C 3MKLA 1WI3A 2DA1A 1FIAA 4FTHA 2DA7A 1HDDC 2L0KA 4FISA 3O8HA 5FKNA 1AHDP 3HM5A 2TCTA 5F1JA 1AU7A 2E2HJ 5J1UA 3BR6A 5EGOB 3GTPJ 1Z0XA 2VKEA 4D7MA 2O8KA 4GFBA 1WGXA 2JN6A 4QTRA 1APLC 3LSPA 1FTZA 1RKWA 3JR9A 1XC5A 1TWFJ 2LR8A 4DZPA 4I6ZA 4IHWA 1JT0A 4UUSB 4XRSG 3BG3A 1MBKA 1K83J 4J19A 1MBFA 3JRAA 2YU9J 1A6IA 5HODA 1QPIA 1FTTA 1Y1VJ 4JX5A 2HQ5A 1MBJA 2CUEA 5IYCJ 3BQZA 5K7ZA 1H88C 1IJWC 4ABZA 3SJMA 2X9DA 2ZB9A 1O4XA 2EZLA 1MBEA 2R5YB 5FKOA 5GP9A 1K61A 2L7FP 3RKQA 1HOMA 3C2BA 2L7MP 1WH7A 2LY9A 3CCYA 4C3IJ 2D5VA 3O8GA 1IV6A 3NAUA 3BTJA 2K9QA 1YRNB 3L1PA 3TW6A 3BTIA 5FKKA 1TWAJ 4W1UA 1ZR4A 1DU0A 3MN2A 2X48A 4G12A 4BY1J 2GBYA 2VUMJ 3PO3J 4FE4A 2XPUA 1ZTRA 1UMQA 1Y1WJ 1JUSA 4D5CA 2I10A 4A69C 3B6AA 3I4NJ 5EGOA 3GTQJ 5F0FA 3BTLA 2HXOA 1MH3A 4XRSA 4CYCA 3G1LA 2M0CA 2CRGA 2EH3A 2XPVA 1ETVA 1TWCJ 5F0CA 2LKXA 2E2JJ 1IRZA 5EZHA 1MSEC 3QPLA 1JUMA 1ETQA 3FK7A 2CU7A 4IEJA 4XIDA 2P81A 1JGGA 5C3EJ 1S7EA 2RAEA 3NARA 5BNGA 4UUSA 1JT6A 5FKMA 4BKXA 5C4JJ 5EYRA 1NK2P 5EEAA 1T56A 2MG4A 4BBRJ 5EZGA 1RPWA 4A3BJ 3VPRA 2M2EA 3QQAA 2E1OA 3ZQGA 2DA6A 3ZQFA 4M6VA 2R5YA 1E3OC 1NTCA 5E3MA 1RESA 2W48A 1FIPA 1IG7A 5IYBJ 4M3EA 2ID3A 5M5XJ 1DU6A 1ZGWA 3GTMJ 1UG2A 4JX6A 2CJJA 3OIOA 3JRDA 1YRNA 2ID6A 2DA5A 2HDDA 2LTPA 3BG5A 4FCYA 2M34A 4M3BA 4QSHA 3GTKJ 3K7AJ 2DMPA 1UHSA 2AHQA 4MFDA 2R93J 2NS7A 3WHCA 2L9RA 2XGEA 4JX4A 1P7JA 2WAQN 4M3FA 1WCMJ 1OJLA 2XB0X 1LFUP 1BJZA 2KDZA 1LE8B 3B6CA 2HOSA 2JA8J 1X2MA 3E7LA 4CYCB 4A3CJ 4C3JJ 3JRGA 5GPCA 2ECBA 5F0HA 2ELKA 2HOTA 2FQ4A 3ZQLA 5J1RA 3LOCA 4I76A 4BBSJ 3IH2A 1QVTA 1ORKA 2LP0A 1ETOA 3H3VK 1ETYA 2Y2ZA 2L7ZA 5FLVA 3Q3SA 3S2DJ 2N8GA 1U8BA 1MSFC 1X58A 5JLXA 3GTJJ 3JRHA 2CQQA 1MH4A 3JREA 2XRLA 4Y52J 1MNMC 3OOUA 1OCTC 1GV2A 4M3DA 3OSFA 4A93J 4Y7NJ 3S15J 4A3FJ 1ETXA 1HDPA 2DA4A 4D7NA 2MGQA 1EF4A 4W97A 4XRMA 3RQIA 3S1MJ 2TRTA 2DJNA 2NOGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XS9 A;  3HOZ J;  3JRF A;  3G1M A;  1JJ8 C;  1HF0 A;  5K7F A;  3CDL A;  3IH4 A;  4DYC A;  3TP3 A;  4BY7 J;  3HBL A;  3RZO J;  3S2H J;  4BXX J;  3D1N I;  1ITY A;  3CQZ J;  4IHY A;  2EZH A;  3K2A A;  1LE8 A;  2HYJ A;  2FX0 A;  2HXI A;  5E3N A;  5K7H A;  4DZJ A;  3DEW A;  3JRB A;  2JMW A;  1BL0 A;  1QRY A;  3TP0 A;  2LVS A;  3LSR A;  4LOC A;  3FK6 A;  1A5J A;  5IP7 J;  4D5F A;  5EF6 A;  1U78 A;  1QVU A;  4UUT A;  3BT9 A;  1NK3 P;  1U9O A;  1RR7 A;  1AKH B;  3UKG A;  4A3D J;  2KT0 A;  3LSG A;  1ETK A;  1VI0 A;  1ZR2 A;  3BG9 A;  3TW7 A;  1PUF B;  3PO2 J;  4B4C A;  2YUS A;  3LSJ A;  1IDY A;  1FEX A;  4L5E A;  5FJ8 J;  2K40 A;  3FIS A;  1GUU A;  2DA3 A;  3QPS A;  3S1R J;  4B1R A;  1WPK A;  3BR5 A;  5DTD A;  2LFB A;  1JTY A;  2GLO A;  2OPT A;  2Y0S N;  4JP0 A;  3WHB A;  3HOY J;  5J1Y A;  4A3I J;  4NDL A;  3GTO J;  5DS9 A;  2XGC A;  1TC3 C;  1RET A;  4MIM A;  5EG0 A;  2DMU A;  4DW6 A;  4XIC A;  3CMY A;  2IEK A;  2NVX J;  2R0Q C;  3HEF A;  1D5Y A;  3HOW J;  2H8R A;  1TWG J;  1HCR A;  4RBO A;  1OFC X;  1IUF A;  3HB9 A;  5E3O A;  4IHV A;  5FLM J;  2IAI A;  1GV5 A;  2DMN A;  2COB A;  5J3L A;  3A02 A;  3JRI A;  3HDD A;  3HOV J;  2FD5 A;  2R5Z A;  3M3Y J;  3A01 B;  2O7O A;  3JRC A;  4DYQ A;  1IGN A;  1JKO C;  3HOX J;  2EZK A;  3A03 A;  2Y31 A;  3GTL J;  1ENH A;  1B72 A;  2AO9 A;  2MW8 A;  1BA5 A;  5IP9 J;  1AKH A;  1I3Q J;  1SAN A;  2ME6 A;  1W0U A;  2E2I J;  3BQY A;  1JKR C;  1F43 A;  5F27 A;  2QF7 A;  1CQT A;  1X2N A;  2WB1 N;  1PUF A;  4JYK A;  4B3A A;  2DMT A;  2GM4 A;  2R92 J;  5EDN A;  2E19 A;  4AYB N;  5F08 A;  4XK4 A;  2FJ1 A;  2DN0 A;  4S0H B;  1BW5 A;  1ETW A;  4V2G A;  1ZQ3 P;  1JTX A;  1ZKG A;  5C44 J;  1XG1 A;  2Y9Z A;  1H8A C;  1T33 A;  2LD5 A;  4C3H J;  5M3M J;  3H0G J;  3I4M J;  4MLO A;  2X6O A;  2O9L A;  2OF7 A;  2H1K A;  2EBI A;  2QCO A;  2VPR A;  5IPA A;  4A3K J;  3BR1 A;  4EEF G;  2XSD C;  2DTZ A;  4M3G A;  3Q0V A;  3ZOB A;  2R7Z J;  5EG0 B;  3MVP A;  3BTC A;  4A3M J;  3HGY A;  2K9S A;  4DYR A;  1Q1V A;  5FKL A;  3LNQ A;  2HOA A;  3RZD J;  1VFC A;  4HNV A;  2DMQ A;  5GPA A;  4C2M J;  3IH3 A;  4A3E J;  3W6V A;  3HOU J;  3ZQI A;  5IOY A;  1HLV A;  3A01 A;  1R9T J;  4A3G J;  2JK3 A;  2R5Z B;  5M5W J;  2VKV A;  2NVT J;  2M8G X;  2EZI A;  3FKI J;  1WH5 A;  1B8I B;  1BW6 A;  2IBD A;  1H89 C;  1B72 B;  3FIW A;  4X6A J;  5IOZ A;  2LK2 A;  1P7I A;  4X1E A;  3S1N J;  1VF9 A;  1FJL A;  5JLW A;  1TWH J;  2XB5 A;  4FE7 A;  2YS9 A;  2Y9Y A;  5IP6 A;  2ECC A;  3G1O A;  3IV5 A;  3DCF A;  3GTG J;  2M9H A;  1MBG A;  3BR0 A;  3TED A;  3SDG A;  2CUF A;  3PM1 A;  5M5Y J;  3BR2 A;  1MBH A;  3Q0W A;  1I6H J;  2LLK A;  2G0E A;  4MFE A;  1I50 J;  4RDU A;  2NVQ J;  4AC0 A;  1JKQ C;  1GT0 C;  2HI3 A;  3Q0U A;  5F04 A;  3ZQH A;  3GBG A;  1W0T A;  3M4O J;  1IDZ A;  2B63 J;  1GVD A;  5C4X J;  1G2H A;  3HGG A;  3SFI A;  2EQR A;  4A3L J;  2MSY A;  1ZK8 A;  2JWT A;  9ANT A;  4QIW N;  1IC8 A;  2JA5 J;  5M3F J;  3S17 J;  1F36 A;  2K9N A;  2VI6 A;  4IHX A;  2PMZ N;  3HKZ N;  1JUP A;  2NVY J;  1GDT A;  4V2F A;  1POG A;  1RKT A;  1LFB A;  1VND A;  2ME0 A;  1JKP C;  1OCP A;  2JA7 J;  4A3J J;  2XGD A;  1SFO J;  2JA6 J;  1U9N A;  2DA2 A;  1B8I A;  2NS8 A;  5IYD J;  3S14 J;  3BR3 A;  3F0C A;  3ZQC A;  2JJ7 A;  5E3L A;  4AUX A;  3S1Q J;  3S16 J;  4MO7 A;  2Y30 A;  2CQX A;  1Z77 A;  2WV1 A;  2XPW A;  3OSG A;  1JJ6 C;  3MKL A;  1WI3 A;  2DA1 A;  1FIA A;  4FTH A;  2DA7 A;  1HDD C;  2L0K A;  4FIS A;  3O8H A;  5FKN A;  1AHD P;  3HM5 A;  2TCT A;  5F1J A;  1AU7 A;  2E2H J;  5J1U A;  3BR6 A;  5EGO B;  3GTP J;  1Z0X A;  2VKE A;  4D7M A;  2O8K A;  4GFB A;  1WGX A;  2JN6 A;  4QTR A;  1APL C;  3LSP A;  1FTZ A;  1RKW A;  3JR9 A;  1XC5 A;  1TWF J;  2LR8 A;  4DZP A;  4I6Z A;  4IHW A;  1JT0 A;  4UUS B;  4XRS G;  3BG3 A;  1MBK A;  1K83 J;  4J19 A;  1MBF A;  3JRA A;  2YU9 J;  1A6I A;  5HOD A;  1QPI A;  1FTT A;  1Y1V J;  4JX5 A;  2HQ5 A;  1MBJ A;  2CUE A;  5IYC J;  3BQZ A;  5K7Z A;  1H88 C;  1IJW C;  4ABZ A;  3SJM A;  2X9D A;  2ZB9 A;  1O4X A;  2EZL A;  1MBE A;  2R5Y B;  5FKO A;  5GP9 A;  1K61 A;  2L7F P;  3RKQ A;  1HOM A;  3C2B A;  2L7M P;  1WH7 A;  2LY9 A;  3CCY A;  4C3I J;  2D5V A;  3O8G A;  1IV6 A;  3NAU A;  3BTJ A;  2K9Q A;  1YRN B;  3L1P A;  3TW6 A;  3BTI A;  5FKK A;  1TWA J;  4W1U A;  1ZR4 A;  1DU0 A;  3MN2 A;  2X48 A;  4G12 A;  4BY1 J;  2GBY A;  2VUM J;  3PO3 J;  4FE4 A;  2XPU A;  1ZTR A;  1UMQ A;  1Y1W J;  1JUS A;  4D5C A;  2I10 A;  4A69 C;  3B6A A;  3I4N J;  5EGO A;  3GTQ J;  5F0F A;  3BTL A;  2HXO A;  1MH3 A;  4XRS A;  4CYC A;  3G1L A;  2M0C A;  2CRG A;  2EH3 A;  2XPV A;  1ETV A;  1TWC J;  5F0C A;  2LKX A;  2E2J J;  1IRZ A;  5EZH A;  1MSE C;  3QPL A;  1JUM A;  1ETQ A;  3FK7 A;  2CU7 A;  4IEJ A;  4XID A;  2P81 A;  1JGG A;  5C3E J;  1S7E A;  2RAE A;  3NAR A;  5BNG A;  4UUS A;  1JT6 A;  5FKM A;  4BKX A;  5C4J J;  5EYR A;  1NK2 P;  5EEA A;  1T56 A;  2MG4 A;  4BBR J;  5EZG A;  1RPW A;  4A3B J;  3VPR A;  2M2E A;  3QQA A;  2E1O A;  3ZQG A;  2DA6 A;  3ZQF A;  4M6V A;  2R5Y A;  1E3O C;  1NTC A;  5E3M A;  1RES A;  2W48 A;  1FIP A;  1IG7 A;  5IYB J;  4M3E A;  2ID3 A;  5M5X J;  1DU6 A;  1ZGW A;  3GTM J;  1UG2 A;  4JX6 A;  2CJJ A;  3OIO A;  3JRD A;  1YRN A;  2ID6 A;  2DA5 A;  2HDD A;  2LTP A;  3BG5 A;  4FCY A;  2M34 A;  4M3B A;  4QSH A;  3GTK J;  3K7A J;  2DMP A;  1UHS A;  2AHQ A;  4MFD A;  2R93 J;  2NS7 A;  3WHC A;  2L9R A;  2XGE A;  4JX4 A;  1P7J A;  2WAQ N;  4M3F A;  1WCM J;  1OJL A;  2XB0 X;  1LFU P;  1BJZ A;  2KDZ A;  1LE8 B;  3B6C A;  2HOS A;  2JA8 J;  1X2M A;  3E7L A;  4CYC B;  4A3C J;  4C3J J;  3JRG A;  5GPC A;  2ECB A;  5F0H A;  2ELK A;  2HOT A;  2FQ4 A;  3ZQL A;  5J1R A;  3LOC A;  4I76 A;  4BBS J;  3IH2 A;  1QVT A;  1ORK A;  2LP0 A;  1ETO A;  3H3V K;  1ETY A;  2Y2Z A;  2L7Z A;  5FLV A;  3Q3S A;  3S2D J;  2N8G A;  1U8B A;  1MSF C;  1X58 A;  5JLX A;  3GTJ J;  3JRH A;  2CQQ A;  1MH4 A;  3JRE A;  2XRL A;  4Y52 J;  1MNM C;  3OOU A;  1OCT C;  1GV2 A;  4M3D A;  3OSF A;  4A93 J;  4Y7N J;  3S15 J;  4A3F J;  1ETX A;  1HDP A;  2DA4 A;  4D7N A;  2MGQ A;  1EF4 A;  4W97 A;  4XRM A;  3RQI A;  3S1M J;  2TRT A;  2DJN A;  2NOG A; 
#chains in the Genus database with same CATH topology
 1WHU A;  2CGP A;  1JE8 A;  1XS9 A;  3A0H C;  2WAD A;  3G1M A;  2QGU A;  5K7F A;  4YII A;  1QQI A;  1HW2 A;  3BZK A;  4XSZ F;  3CCV I;  2JRT A;  5BPI A;  4Z6Y A;  4BAY A;  4CCL A;  4ZYH A;  4IQ4 A;  1R71 A;  2OJE D;  1VQL I;  2HYJ A;  2F4M B;  3GZN B;  4DZJ A;  2JMW A;  2A3S A;  4WK8 F;  2OBP A;  4LOC A;  1A5J A;  1ZGA A;  1RR7 A;  1FBS A;  2KT0 A;  1DPU A;  5DCM B;  1YQA A;  1FOY A;  2WTE A;  2ETH A;  3KZZ A;  3L2Q A;  2HS5 A;  1AA7 A;  1UG0 A;  5DYM A;  1G59 A;  2K9L A;  3FM5 A;  5ICE A;  2RKH A;  3FIS A;  1GUU A;  2CG4 A;  3WE2 A;  2FBH A;  4KDP A;  2DDA A;  4KUM A;  5E20 A;  3WTS C;  5CVJ A;  4BNC A;  2OPT A;  4NC8 A;  1LVK A;  2DYS H;  1W7P D;  3S3O A;  1QA6 A;  4A3I J;  5TGT A;  2CUJ A;  1W5C C;  2VBZ A;  4LJZ F;  2XUB A;  4MHG A;  5KCM A;  4XOT A;  1RET A;  2ZFU A;  4MIM A;  4EGY A;  2ESN A;  3IHU A;  3CMY A;  1DP7 P;  4G6Q A;  4IOA F;  2R0Q C;  1O7F A;  3TL4 X;  3K4J A;  1B59 A;  4RAZ A;  1TWG J;  1HKS A;  1UB9 A;  2DLL A;  2XGX A;  5E3O A;  3G6E I;  1Z6R A;  4IHV A;  1XDU A;  3HZJ A;  2EV6 A;  3FMQ A;  2D45 A;  2P8T A;  3VEP A;  2PMZ A;  2IGN A;  3A02 A;  5BS6 A;  3BG6 A;  1TP4 A;  4EQQ A;  3M3Y J;  2O7O A;  5KHD A;  2UV1 A;  1L0O C;  2EZK A;  1Y56 A;  3A03 A;  1N75 A;  2HOE A;  4I09 A;  2AO9 A;  2CFO A;  1R5I D;  1MGT A;  3ZQQ A;  1HBX G;  1JXS A;  5ILV A;  4PJM A;  3OYM A;  2HU9 A;  1XX5 A;  2MLK A;  2KJB A;  2ME6 A;  3M7G A;  3CJQ B;  3E6M A;  2PFB A;  5F27 A;  1R1T A;  1RIO H;  2WB1 N;  2VPL A;  4JYK A;  2GM4 A;  3ZMZ A;  2R92 J;  1S7A A;  2NNY A;  2E19 A;  4AYB N;  5F08 A;  3SEZ A;  2DOF A;  1QHG A;  1BJA A;  2FJ1 A;  1XMX A;  2DN0 A;  1BW5 A;  4UB6 C;  3C2G A;  2IVM A;  1G3Y A;  1ZKG A;  2RC4 A;  1LJ9 A;  2R7X A;  1DDN A;  1WZ2 A;  4AYB A;  2OQG A;  3H0G J;  1DGR M;  5JFR A;  3I4M J;  4ZDL A;  1X1D A;  4P5O A;  2F48 A;  2QQA A;  1WJD A;  4B09 A;  1VQ5 I;  5AIQ A;  1W7P A;  3OL3 A;  2OUM A;  5E8I A;  1KYW A;  5IPA A;  4LIT A;  3MKY B;  1K7A A;  4S04 A;  2Y75 A;  4EEF G;  3OYL A;  2KDO A;  1BOA A;  2LKS A;  3BY6 A;  3ZOB A;  5J40 A;  3BTC A;  2H8W A;  1LVA A;  4A3M J;  3H1C A;  3HGY A;  3G73 A;  2BY0 A;  2K9S A;  1LEA A;  4KIC A;  4DYR A;  2M87 A;  2ZME A;  3OYC A;  3JSO A;  5FD5 A;  3JAM Z;  2Z16 A;  3RZD J;  2ZJ2 A;  3MWM A;  3KP7 A;  4HNV A;  4ZYA A;  3TO7 A;  4C2M J;  4A3E J;  3E6D A;  1IUY A;  4IJA A;  3WE3 A;  3BWG A;  1KZH A;  3I56 I;  1HLV A;  4C2T A;  1NG7 A;  1Z21 A;  3NEU A;  4MQV A;  3SHF A;  3W2V A;  1E17 A;  3R0J A;  2R5Z B;  2IGK A;  5M5W J;  3G71 I;  2ZJR F;  2H27 A;  2OTJ I;  5HNH A;  2V9V A;  4KN7 X;  3FKI J;  3S32 A;  1BW6 A;  3FHN A;  3HPG A;  3EET A;  3FIW A;  4X6A J;  1WJA A;  2LK2 A;  2A6E F;  3VB2 A;  4ZDP A;  5ILU A;  3GFM A;  2Q0O A;  3HTU A;  3S1N J;  1VF9 A;  3CCE I;  3WGI A;  1TWH J;  1E3P A;  3QYB A;  2RDP A;  1MMN A;  2Y9Y A;  5LGN A;  3DV8 A;  3IKT A;  5HDG A;  2ZJQ F;  3MZ8 A;  2X1C A;  1HW1 A;  3IV5 A;  2IW5 A;  3I59 A;  4ZYD A;  1HKQ A;  4B8X A;  1J75 A;  4BE2 A;  2CUF A;  5M5Y J;  2R7F A;  1XGO A;  1O57 A;  3ONQ A;  5DV5 A;  1W1W E;  4MFE A;  3VOE A;  4CCN A;  2DPU A;  4AC0 A;  2PBI A;  2HI3 A;  2E5N A;  3J7A Y;  3F3X A;  3R60 A;  3ZQH A;  3A2K A;  1D0Y A;  1T38 A;  4QLC U;  1IDZ A;  1CF7 A;  1GVD A;  1QHH D;  1KON A;  2VQC A;  3SFI A;  4A3L J;  2MSY A;  1WWX A;  9ANT A;  4QIW N;  2V1U A;  2YSR A;  3HC7 A;  4WCG A;  4KJZ A;  4XNF A;  2VT2 A;  3HKZ N;  2JZY A;  1JUP A;  3NWS A;  2V6E A;  4UVB A;  4H4K C;  1RKT A;  4XM3 A;  1FC3 A;  3FF5 A;  4BYY A;  3BP8 A;  3P9C A;  2PJR B;  1SMY F;  1UEL B;  2ICW G;  4CO8 A;  3E6B A;  2XGD A;  2R7S A;  1C0W A;  4F3Q A;  5LRS A;  2M3A A;  2K4B A;  2D1H A;  3ZMU A;  1TNS A;  5EJC A;  3DTI A;  1IN6 A;  2W57 A;  2FXA A;  5E3L A;  4AUX A;  1OQY A;  1R4M B;  3VDX A;  4BH9 A;  5L3C A;  4ENN A;  1Y39 A;  2PN6 A;  3V8K A;  4OU0 A;  1IW7 F;  1Z77 A;  4WXD A;  2OAZ A;  2K4J A;  5L3G A;  2F6C A;  4PK4 A;  2DA1 A;  1FIA A;  2VXZ A;  2DA7 A;  1HDD C;  2L0K A;  3O8H A;  4BE0 A;  3DF8 A;  2HYF A;  5J1U A;  4LLL A;  1R00 A;  4UVA A;  2A07 F;  2UWM A;  3F23 A;  3BJO A;  1GVJ A;  3CMM A;  4NQW A;  3M1E A;  3ZN0 A;  4GFB A;  2JN6 A;  4QTR A;  2LMD A;  3AG4 H;  1VQ4 I;  3OR2 C;  1X1P A;  3TKY A;  3DBH B;  4ITV A;  3JR9 A;  1D8J A;  2ZNY A;  2VON A;  4I6Z A;  1JT0 A;  2VXD A;  2FF4 A;  2OU2 A;  3H36 A;  2EV5 A;  2L3D A;  1SD6 A;  2VC0 A;  1K83 J;  3QU6 A;  4ENJ A;  4YEL A;  1X4P A;  1QPI A;  5H6R A;  3OS2 A;  1IRX A;  2PMU A;  4JX5 A;  1JI8 A;  4M72 A;  2ZC2 A;  5IYC J;  1H0M A;  3CUQ A;  4Q4Z F;  4OMY A;  2IA0 A;  2EZL A;  2IJL A;  1FPQ A;  5GP9 A;  3CCR I;  1SD4 A;  1K61 A;  2LNB A;  2E1M B;  2CW7 A;  3V8L A;  3C2B A;  2D5V A;  2DTR A;  4NBQ A;  1O3T A;  2OA4 A;  3NAU A;  4YFK F;  4UXN A;  1B9N A;  5D4S A;  2Z99 A;  5CVI A;  4S05 A;  1HKT A;  2Q2E B;  2LF8 A;  1YRN B;  4XLC A;  1FWZ A;  1TWA J;  4IXA A;  4NC6 A;  4W1U A;  2DFE A;  2X48 A;  3LMM A;  3PO3 J;  4DOZ A;  4FAS D;  2DT5 A;  4XQF A;  3A1Y A;  2RVC A;  1Y1W J;  2I10 A;  2J5O A;  4UVC A;  5EGO A;  1NHA A;  3GTQ J;  3DU5 A;  5GAE J;  2EFN A;  1MH3 A;  3ZMS A;  3G1L A;  5FGM A;  1T08 B;  2R7D A;  2KZG A;  4LMY A;  3RKY A;  2M0C A;  2XKO A;  2JSP A;  1WFX A;  4WWC A;  1D0Z A;  1B9M A;  2E2J J;  1IRZ A;  2W24 A;  1JUM A;  3NRV A;  3U21 A;  1VQP I;  2QEN A;  4ASN A;  2E7X A;  2XRO A;  1FNN A;  1XGS A;  5JHF A;  1YI2 I;  5BNG A;  3ZRG A;  1U3E M;  5FKM A;  4G8X A;  1UZC A;  5EYR A;  2DQR A;  1W5S A;  2IGO A;  4XSX F;  5E8G A;  2BY1 A;  2MG4 A;  1TQM A;  5EZG A;  1RPW A;  1ZAO A;  1QO0 D;  1XD7 A;  1Q1H A;  2EIL H;  4L9T A;  2FQ3 A;  1HA8 A;  5E3M A;  1H9G A;  2Y0S A;  4HF0 A;  3MFK A;  2ID3 A;  4FHT A;  2VBW A;  1ZGW A;  1DU6 A;  4GDF A;  2YU3 A;  5GAG J;  4RB1 A;  1I6X A;  2ID6 A;  2LY2 A;  4QSH A;  4D9J A;  3HHH A;  3QWL A;  3K7A J;  4IRG A;  2L2O A;  2XKP A;  3MCZ A;  1X3U A;  1YIO A;  1LDK B;  3KYD B;  5KVR A;  3OYH A;  1XMA A;  4L5I A;  3NQO A;  1ZYR F;  2QBY A;  1SVO A;  3HIF A;  2VJ5 A;  1VQN I;  4UY8 I;  1SEU A;  4Y15 A;  1WCM J;  1OJL A;  1Z6T A;  3PL8 A;  1MJA A;  1XGM A;  2LRE A;  4IRH A;  4BEH A;  2KDZ A;  5IT9 K;  3B6C A;  1J5Y A;  2EWN A;  2XAU A;  3WU2 C;  2JA8 J;  2OZU A;  4A3C J;  1R6R A;  3V7C A;  1ZRD A;  4HDU A;  4QPQ A;  2ECB A;  2F4O B;  1IXC A;  2IPQ X;  4I76 A;  3ZQ7 A;  1ZHF A;  5FLX K;  2E1M C;  3ABL H;  4E6K G;  5A2Q Z;  4I99 C;  3GCM A;  3H3V K;  2Y2Z A;  4HF1 A;  2L7Z A;  1GHC A;  2BOL A;  5FLV A;  1QZY A;  1A6Q A;  2MD5 A;  5CQE A;  4FET A;  2PX9 A;  4GYG A;  2Y69 H;  1T8I A;  3WG9 A;  2KRH A;  4BHB A;  3RDI A;  3GTJ J;  3P9I A;  4BHC A;  4IVN A;  3DU6 A;  2ELJ A;  4Y52 J;  3ZCO A;  1GV2 A;  5CVR A;  3OSF A;  2FRH A;  3DTK A;  4Q48 A;  2GXG A;  1FOX A;  1OLT A;  4KMU X;  4DQ2 A;  1XN7 A;  1HDP A;  1G8X A;  1FYK A;  1VQK I;  2QUF A;  2GXA A;  5IT9 Z;  3Q9S A;  1EF4 A;  2V6C A;  1S7O A;  4GXO A;  2DJN A;  1XSX A;  4HG2 A;  2GXB A;  2VIX A;  1MMS A;  3HOZ J;  5H2F C;  4KT5 C;  2P7C B;  3K4L A;  2OTL I;  4DYC A;  3TP3 A;  4BY7 J;  3S2H J;  3RZO J;  4BXX J;  4C9Y A;  2CV2 A;  3I4P A;  3F6O A;  4HF2 A;  4PJJ A;  1NG6 A;  1YYV A;  2JUC A;  4M73 A;  2V1X A;  2X4H A;  1OCO H;  3F6V A;  2HXI A;  3HSE A;  3DEW A;  3E3V A;  3M8F A;  4E7H A;  1BL0 A;  1QRY A;  3TP0 A;  2VE9 A;  1PVE A;  1FP2 A;  2EIN H;  3FK6 A;  2JPC A;  5IP7 J;  4D5F A;  5EF6 A;  3HRS A;  4UUT A;  3BT9 A;  1NK3 P;  1S29 A;  1YS6 A;  2NAZ A;  4IHS A;  1ON2 A;  2P0W A;  5CVU A;  1RUN A;  1W36 D;  3OYN A;  1OPC A;  3LSJ A;  3VYU B;  4HOB A;  5DD4 A;  1KYZ A;  4RB2 C;  4IZZ A;  1BBY A;  5J4Y A;  4BAC A;  4NHJ A;  2HQN A;  5ILS A;  5FJ8 J;  4MEY F;  2DA3 A;  2W82 A;  2ELH A;  3QPS A;  4JOM A;  4KIF A;  3S1R J;  1P9Q C;  4B1R A;  1XGN A;  1WPK A;  3BR5 A;  5DTD A;  2GLO A;  3C2H A;  2M30 A;  4AID A;  4JP0 A;  3CC4 I;  3KE2 A;  4BJ6 C;  2DI3 A;  2H94 A;  2E5Z A;  2PI0 A;  5HS9 A;  3K4C A;  4Q5S F;  5J1Y A;  1W7P B;  3PNT A;  4V19 K;  5DS9 A;  1FP1 D;  2O5R A;  4II3 A;  2Z9O A;  3GUD A;  5BQT A;  3GO5 A;  3ZXS A;  4LIU A;  4XIC A;  3DQV C;  4OIO F;  1DP3 A;  2AQF A;  2MFZ A;  3LA2 A;  2NVX J;  3CLO A;  2VJI A;  1D5Y A;  3HEF A;  5H6Q A;  4O5V A;  1U5T A;  3L2C A;  2OCC H;  2ZME B;  1S9H A;  1BR1 A;  2KIU A;  5E1W A;  4RBO A;  1OFC X;  1YJ9 I;  4ZYG A;  3HB9 A;  2YX4 A;  1Y0U A;  3K10 A;  1ZN2 A;  2Y0M A;  5ERI A;  2COB A;  5CPR B;  3JRI A;  1FYL A;  2DFH A;  3GFJ A;  1IGN A;  1ZLJ A;  3GXO A;  1IN7 A;  3FXQ A;  4EVI A;  3AG3 H;  3BC8 A;  3GTL J;  1PP8 F;  3ISP A;  5AIP A;  4QPO A;  1B72 A;  3C3W A;  1JHH A;  1WKM A;  1KU3 A;  2JPB A;  3AKZ A;  2IS6 A;  1TT0 A;  2MW8 A;  1P2F A;  2NVU B;  4A2U A;  5IP9 J;  1D1B A;  5B1A H;  1W0U A;  2IS2 A;  4XON A;  3GLL A;  2CQK A;  3BQY A;  4OIQ F;  1QZZ A;  1FLI A;  2QF7 A;  3ABT A;  1X2N A;  2HQR A;  1IF1 A;  2P7V B;  4XK4 A;  2GZW A;  3I59 B;  4V2G A;  1JTX A;  3FM3 A;  4XKC A;  5J8C A;  3T5X A;  3G4S I;  2IS1 A;  3O3K A;  1FOK A;  1H8A C;  4A0Y A;  2LD5 A;  2QSH X;  1VZ0 A;  1HXD A;  3R61 A;  4BQQ A;  2X6O A;  4L18 B;  1EV7 A;  2OF7 A;  4NUB A;  4M74 A;  4HQE A;  2QQ9 A;  2K85 A;  4YFX F;  4PSX A;  5GAD J;  3PUB A;  5K1Y A;  1IV8 A;  2FNP A;  4BQO A;  2R7Z J;  5EG0 B;  1CF7 B;  4M6X A;  2DQL A;  3DTE A;  3W6K B;  3PUF A;  4KN4 X;  3LNQ A;  2MBF A;  3CCJ I;  2HOA A;  2FSW A;  2DOD A;  2K3P A;  3HUG A;  4B43 A;  4BS9 A;  4ZDO A;  5D6F A;  3FXK A;  5HNF A;  2W85 A;  1BI3 A;  3W6V A;  3IH3 A;  1X1A A;  3CC7 I;  4XLH A;  5IOY A;  2RV8 A;  2RGV A;  4R8H A;  3A01 A;  2KZV A;  2JK3 A;  2UXX A;  1OR7 A;  1W4M A;  2VKV A;  5CJ9 A;  2FA5 A;  4ESF A;  2STT A;  3RYR A;  2E7W A;  4O6J A;  1FOW A;  3G3Z A;  4YRV A;  1LQ1 A;  1ODD A;  2MLG A;  3S8P A;  1P7I A;  2NOJ B;  4N9H A;  3TQN A;  5HS7 A;  1Z1D A;  4XKW A;  2EV0 A;  2XB5 A;  2YS9 A;  3H9G A;  4FE7 A;  4HA8 A;  3ESW B;  4XRF A;  5IP6 A;  2EFO A;  4RLF A;  4ZTF A;  3IWZ A;  1Z3Y A;  1ZLK A;  1JHF A;  3M9A A;  3FXM A;  2ZME C;  3PM1 A;  1MBH A;  1K4T A;  1HST A;  3Q0W A;  2LLK A;  2F5F A;  4Y13 A;  4RA2 A;  3KP6 A;  3SEQ A;  2BGC A;  3VYR B;  4A6D A;  4RDU A;  2L9N A;  2BW3 A;  5TIS C;  2QSG X;  2E60 A;  3TOB A;  1GT0 C;  5L3D A;  2XAH A;  1LEB A;  1YOV B;  1W0T A;  3AG1 H;  3CDI A;  4IL6 C;  3JCU C;  1G2H A;  3H5R A;  3HL2 A;  4PCQ A;  1X19 A;  4BJ5 C;  2X1D A;  2AQE A;  1U2W A;  4N4O B;  1M1E B;  1QNT A;  1WRJ A;  2K9N A;  3CZ6 A;  2PMZ N;  3LSM A;  1Y8Q B;  4F55 A;  1GDT A;  4V2F A;  2ZXH A;  4XKB A;  3F8N A;  2A5W A;  4XR6 A;  2ZXW H;  4AM3 A;  1MIJ A;  3I9V 2;  1JKP C;  2ME0 A;  5LHH A;  1ZG5 A;  3RPQ A;  4RAF A;  4I98 B;  4IOC F;  4A3J J;  4HNT A;  3CP2 A;  4ENK A;  1EJ9 A;  3S93 A;  2QSF X;  2A05 A;  2OC6 A;  2MD0 A;  2YPR A;  4XL9 A;  3KLO A;  4F92 B;  3JAM K;  2DW4 A;  3S1Q J;  4KA4 A;  2ADU A;  3BLY A;  4L0Z B;  3MKL A;  3CJN A;  3HJE A;  4FTH A;  2B7E A;  4FIS A;  4IF4 A;  2X85 A;  1LPQ A;  2TCT A;  1OKR A;  1YIJ I;  1TLH B;  4HQM A;  5EGO B;  4X0G A;  4M71 A;  1OIS A;  2KPM A;  2XF5 A;  3LA7 A;  3S2W A;  3ZR8 X;  5D5W B;  2WY7 Q;  2M8E A;  1KU7 A;  1OCC H;  1Z0X A;  2LDU A;  3H92 A;  1P92 A;  1YE9 A;  4HW0 A;  5AON A;  3IAM 2;  3QP6 A;  2DU9 A;  1D1A A;  1FBU A;  4TV7 A;  2O8K A;  2A68 F;  4XLA A;  3R0A A;  4KYW A;  3LSP A;  1RKW A;  4UV9 A;  1OMI A;  1XC5 A;  4L9J A;  2LR8 A;  2BXY A;  3K0L A;  3I54 A;  4PUS A;  3I3L A;  1VQ8 I;  2MH2 A;  3KP2 A;  1UFM A;  4DBQ A;  1MBF A;  1SVL A;  5B5E C;  1A6I A;  1FTT A;  2CQN A;  4HX8 A;  1GLN A;  3K6G A;  4RGU A;  5TJJ A;  5B66 C;  2M4G A;  1RUO A;  3LFU A;  1IAW A;  1LB2 A;  2XSJ C;  2QKL B;  2DT6 A;  2CUE A;  5D5U B;  3RI4 A;  1ZEL A;  4E7L A;  1H88 C;  2X9D A;  3M07 A;  4BDY A;  1O3S A;  1ZG1 A;  3LSK A;  4HZF A;  3W3C A;  5CVV A;  3GYH X;  1SD5 A;  3ZPL A;  1IN5 A;  2LBF A;  3GX4 X;  2MYS A;  2VOD A;  1HOM A;  4C3I J;  3DEE A;  3B02 A;  3KP5 A;  3WG7 H;  4DIQ A;  3WTY C;  3CD6 I;  1Y0N A;  2LY1 A;  1YJW I;  2HWV A;  3TW6 A;  3BJ6 A;  5FKK A;  4RS8 A;  4HX7 A;  1ZR4 A;  2XAQ A;  4BY1 J;  1Y8R B;  5KAI C;  2ZO4 A;  2GBY A;  3KEQ A;  4FE4 A;  1K6Y A;  1J2X A;  2M4K A;  2JRM A;  1I3A A;  1UMQ A;  1J0R A;  3CMA I;  3RPU D;  3DEU A;  1BI2 A;  1JUS A;  1XB4 A;  3K2Z A;  3NWT A;  3B6A A;  4XKV A;  3MZH A;  4HAM A;  4BEH B;  2K27 A;  2L9V A;  1WSU A;  2O0Y A;  1QPM A;  4CYC A;  2HDW A;  1P4A A;  2ZKZ A;  2CRG A;  2F5V A;  3GWZ A;  4CSW A;  2BYV E;  3X2Q H;  3J80 Z;  3CUQ C;  1Z67 A;  2EK5 A;  1TNT A;  3L2W A;  5F0C A;  2LKX A;  5LGT A;  1SD7 A;  5EZH A;  3F9K A;  3W2W A;  1R5H A;  2CS3 A;  2R7V A;  4U87 A;  3RTR A;  5C3E J;  4UUS A;  3SZT A;  3OYK A;  2E36 A;  3CCL I;  3TO9 A;  1MZB A;  1Z7U A;  2C6Y A;  1I1S A;  2JT1 A;  3WU0 A;  3RCO A;  4EMS A;  1B1B A;  2V1D A;  2KFD A;  2NS0 A;  3QQA A;  3E6C C;  1B4A A;  2BXZ A;  1TL8 A;  2CV1 A;  2R5Y A;  3RYP A;  4A6E A;  4BXF A;  1E3O C;  5GAH J;  4IX7 A;  1FIP A;  3BCA A;  1LDJ A;  2DOE A;  2L4M A;  1FMV A;  4JX6 A;  2CJJ A;  3I53 A;  3OIO A;  4CCJ A;  1ON1 A;  1KQ8 A;  4HX4 A;  5DM7 F;  2LTP A;  3BG5 A;  4PFO A;  3BDD A;  2M34 A;  2D1V A;  2GAU A;  3I5U A;  1ZRF A;  3WTZ A;  2GOX B;  2GIZ A;  1SFU A;  2BZT A;  2DMP A;  2K3F A;  3N05 A;  4M6Y A;  2P5L C;  3FMS A;  3WTV C;  3CDH A;  3CCU I;  2L9R A;  2XAS A;  2XGE A;  3BZ6 A;  4E70 A;  4AIJ A;  3HSR A;  1GXQ A;  4JX4 A;  3RPU A;  2DO7 A;  2NRA C;  1P7J A;  4FT8 A;  3UR3 C;  1K79 A;  4KIT B;  2KRC A;  5EEG A;  4R1H A;  3VSL A;  3KZY A;  4G7Z F;  2XB0 X;  2HOS A;  1DPR A;  2EIJ H;  4C3J J;  5E79 C;  4DNC A;  3CJR B;  1IRF A;  5F0H A;  3HRT A;  3QRF F;  2HOT A;  2WBM A;  2ZNZ A;  3OV8 A;  2STW A;  4BBS J;  3IH2 A;  3KCC A;  4IPA A;  2LP0 A;  2FOW A;  1FZP B;  2ISZ A;  1XMK A;  2XV4 S;  5BMZ A;  2DFF A;  1ETY A;  1CGP A;  1YW9 A;  4HST A;  3DKY A;  3Q3S A;  3S2D J;  1WJE A;  2VT3 A;  1U8B A;  4KIB A;  1IN4 A;  1X58 A;  5JLX A;  1TT5 B;  2VKD A;  2CQQ A;  1MH4 A;  4B48 A;  4LK1 F;  4YFN F;  2X1E A;  1BIA A;  1USS A;  2FOK A;  1B6A A;  2XRL A;  3FWE A;  2CV0 A;  2PMH A;  1LUJ B;  5B1B H;  4PSW A;  2RQQ A;  2L02 A;  3DPU A;  4NB5 A;  2DJI A;  4M3D A;  2H09 A;  2XHK A;  5L3E A;  5DUK A;  2WWY A;  1ETX A;  4CZZ A;  1YHQ I;  2MGQ A;  2L4A A;  2JQ7 A;  3E97 A;  2PG4 A;  1P6R A;  3RQI A;  1V5F A;  3S1M J;  2CH0 A;  1TQP A;  2TRT A;  2VQL A;  2EIM H;  3K4B A;  3DKX A;  4BUP A;  2E34 A;  5DDG A;  2H6C A;  4ESB A;  1JJ8 C;  1R36 A;  1HF0 A;  3CDL A;  2FU4 A;  4NC7 A;  5ICC A;  3ABM H;  3FBN B;  3VWB A;  3R4K A;  3D1N I;  3MQ0 A;  2KL4 A;  5K5O A;  3CQZ J;  1WJF A;  1WJC A;  2EZH A;  3K2A A;  3CES A;  1WQ2 A;  3MZY A;  2BHY A;  2FX0 A;  4AVP A;  5E3N A;  1S72 I;  5K7H A;  1N25 A;  3JRB A;  4KMF A;  3OS1 A;  3VFZ A;  2LVS A;  2VJ4 A;  4E7Z A;  2E1N A;  3H35 A;  1REP C;  5KNL A;  4RM3 A;  4RGS A;  3PJR A;  3HHG A;  1QVU A;  1U9O A;  3RQ4 A;  3U2R A;  4A3D J;  4E7S A;  1HC8 A;  4I0A A;  4ENM A;  1ETK A;  1VI0 A;  3KZI C;  1SC7 A;  4U0V A;  2NYX A;  2VAS A;  3OS0 A;  4PFP A;  3SZG A;  2XAJ A;  1IDY A;  5LEJ A;  3OR1 C;  5BOX A;  1FEX A;  4L5E A;  5K5Q A;  4HNU A;  2KP6 A;  4I02 A;  4CUG A;  3WTX C;  3K70 D;  1IZ1 A;  4WXH A;  4D1Q A;  3K1P A;  2Y0S N;  3TGN A;  3IRR A;  1K78 B;  3HOY J;  4AIH A;  2R7U A;  2GWR A;  2QA4 I;  4M9X A;  1UCR A;  1TW2 A;  2E35 A;  4LFU A;  3L9F A;  3M8E A;  2A5Y B;  3GTO J;  1J59 A;  4EJO A;  5LHI A;  5A2Q K;  3T8R A;  3WGH A;  1PJR A;  3VSK A;  2DMU A;  4BGD A;  5IY5 H;  3EDP A;  4C2U A;  1BR4 A;  2IGM A;  4LK0 F;  5L3B A;  3LST A;  2WAF A;  1V5E A;  1WJB A;  4G9Y A;  2BVM A;  1YO5 C;  1IUF A;  4G6D A;  1UAA A;  3F8C A;  3DLA A;  3HUG B;  1ZG3 A;  2EA4 A;  4MTE A;  3L2V A;  1GV5 A;  3CTA A;  2DMN A;  3H3U A;  3CJT B;  4Q47 A;  2HPM A;  3AFH A;  5J3L A;  4ZH4 F;  1BN5 A;  3HDD A;  2R5Z A;  5TRD A;  3A01 B;  4DYQ A;  2UUZ A;  1FYM A;  4UNO A;  3OYJ A;  2HVQ A;  4G6T B;  3RKX A;  2JVG A;  2HPI A;  5E18 F;  2O3F A;  2QYO A;  4O3M A;  4FQG A;  3M1C A;  2OCE A;  1AKH A;  2BY2 A;  4EM1 A;  2UZK A;  1F43 A;  1CQT A;  3O2P E;  5JHU A;  1PUF A;  4WF2 A;  2MA3 A;  3QU3 A;  4C30 A;  5ICG A;  1WJ5 A;  3SFZ A;  4S0H B;  1ETW A;  1ZQ3 P;  1U5T C;  4E7K A;  4EGZ A;  1XSD A;  1N77 A;  3FZV A;  4BJT A;  1YX5 A;  3HOS A;  2VJJ A;  4MLO A;  2HQA A;  1HQC A;  2R7R A;  2XIG A;  3CCS I;  4MQ9 F;  5CYV A;  1QGP A;  4ON0 A;  4CIC A;  2BW3 B;  3A4C A;  4PJL A;  3DBR B;  2F5D A;  3BR1 A;  2XSD C;  2DTZ A;  3GZ6 A;  2TDX A;  4PDK A;  5JR3 A;  5D8L B;  4M3G A;  2B0L A;  3TDZ C;  3FXR A;  3JTH A;  3ROU A;  2R4G A;  2VQG A;  4BE1 A;  3S3M A;  4HRI A;  1LDD A;  1D1C A;  1RC9 A;  4LIV A;  1Q1V A;  5FKL A;  4A0Z A;  3CLQ A;  1R5G A;  5GPA A;  4F93 B;  1YG2 A;  2VN2 A;  2E1C A;  1XSV A;  2AS5 F;  1W36 C;  2FML A;  2PJR A;  3HOU J;  2KIF A;  2OD5 A;  3F22 A;  5CKT A;  1KU9 A;  2NVT J;  2M8G X;  2GA1 A;  4XLF A;  4OAZ A;  4CA0 A;  4D0P A;  3N4M A;  2IBD A;  1Z7L A;  1KGS A;  2DXI A;  2IA2 A;  2LOO A;  1H89 C;  1SAU A;  5E17 F;  5IOZ A;  1NH3 A;  4HEA 2;  2P5V A;  1EH8 A;  2JTV A;  2K86 A;  3D5R C;  3KP3 A;  1FJL A;  1V5G A;  5JLW A;  3MD2 A;  2HVR A;  1F1Z A;  4LLG F;  2CFX A;  2CQ7 A;  4GYI A;  2ZSI B;  3DCF A;  3GTG J;  2M9H A;  1MBG A;  3QPH A;  5JVG F;  3SDG A;  3OWT A;  4HDV A;  4AIK A;  5D4R A;  1MJ9 A;  2G7U A;  3DLL F;  3EPZ A;  2R7Q A;  5GTH C;  2EJR A;  2BV6 A;  2ZJP F;  4ZYE A;  4IO9 F;  1I50 J;  2M1B A;  2R3S A;  2NVQ J;  1JKQ C;  4P1W A;  2D2W A;  2VKH A;  3E5U A;  3ML6 A;  5F04 A;  3RIR A;  5HOO A;  4E7I A;  3ERE D;  4CZC A;  3GBG A;  1OR7 C;  3P9K A;  4RGR A;  4G7H F;  4CDG A;  3M4O J;  2B63 J;  1QZE A;  5C4X J;  4DJA A;  3HGG A;  5HDN A;  2HVS A;  1ZK8 A;  2XRN A;  3BOQ A;  2JWT A;  4AU7 A;  1IC8 A;  2JA5 J;  3S17 J;  4BU2 A;  3KEY A;  1F36 A;  4ESJ A;  2ISY A;  2EFP A;  2VI6 A;  1E3H A;  5FRO A;  2NVY J;  1POG A;  2CW0 F;  4CXF A;  3OL4 A;  2K7L A;  3S3N A;  2JA7 J;  1ULY A;  2ESH A;  1DUX C;  2LBF B;  1LKX A;  2CUZ A;  1YLF A;  4EV0 A;  1HW5 A;  3CCQ I;  2CMP A;  2L9S A;  1SMT A;  1SFO J;  4L9V A;  1WI9 A;  3D5S C;  2JA6 J;  5HS8 A;  2DA2 A;  1B8I A;  4WX9 A;  5IYD J;  2EPF A;  3BR3 A;  3L09 A;  3WGG A;  3OYA A;  2P4W A;  5LHG A;  4LG0 A;  3CME I;  2RNJ A;  3MMY B;  2Q1Z B;  2NNN A;  2JJ7 A;  4AWX B;  1S5L C;  1I39 A;  3ULQ B;  4MO7 A;  1V54 H;  3S16 J;  2MC4 A;  2FMY A;  1KQ9 A;  2Y30 A;  2CQX A;  2F5E A;  2KIQ A;  3OSG A;  4GCV A;  1L3L A;  1JJ6 C;  1WI3 A;  5LGU A;  3V4G A;  4F91 B;  1AHD P;  2X6W A;  1G3S A;  1Z05 A;  4IRI A;  3H3Z A;  1ERD A;  2HNH A;  3DPT A;  2E2H J;  3WTU C;  5JVT A;  3LQQ A;  2HDC A;  3JW4 A;  2KJC A;  2M45 A;  3HRM A;  3TO6 A;  4U7B A;  2CW8 A;  4XLN F;  2DCE A;  4LGW A;  2IA1 A;  2KKO A;  2VKE A;  3QYF A;  4D7M A;  1Z9C A;  2XDV A;  2V9K A;  3KEO A;  3KYL A;  5ED4 A;  1PUE E;  1D3Y A;  2LKP A;  4I2O A;  5LFA A;  2IRF G;  1APL C;  3CC2 I;  4P9U A;  4XBF A;  2ZSH B;  1YS7 A;  1N78 A;  1FT9 A;  1FTZ A;  5FB2 A;  3EUH A;  1TZL A;  1TWF J;  3IAS 2;  1STZ A;  4XOR A;  1VQ6 I;  4IHW A;  1MKM A;  2V79 A;  3KFW X;  1R1U A;  2H1L A;  4UUS B;  1U8R A;  3ZGK A;  3OY9 A;  1UHM A;  5JI6 A;  4N4N B;  1A31 A;  5HOD A;  3HG9 A;  4XLP F;  1Y1V J;  2F2E A;  1RR8 C;  3K4N A;  3KET A;  3MEX A;  1MBJ A;  1Y6I A;  2KMU A;  4UB8 C;  4MNU A;  3BQZ A;  1LFP A;  1IJW C;  4OIP F;  3SJM A;  1O4X A;  2ZB9 A;  5FD6 A;  3EYY A;  1MBE A;  3ZN1 A;  2R5Y B;  4Y17 A;  3GF2 A;  3V42 A;  2L7F P;  2VBY A;  4OAY A;  3RKQ A;  3CCY A;  1WH7 A;  1BI0 A;  3T0Y A;  1FX7 A;  3BTJ A;  2LG4 A;  3C1D A;  2I5U A;  2K9Q A;  3L1P A;  2UXN A;  3ASN H;  1R23 A;  2VE8 A;  2A69 F;  5F6F A;  3BTI A;  4UUV A;  4G12 A;  1P4X A;  3CCM I;  1K4S A;  4CHU A;  1RZ4 A;  2H6B A;  4P96 A;  2G9W A;  4H0E A;  1A04 A;  2LRD A;  2R7W A;  3PSF A;  3K1M A;  4KIG A;  4LG3 A;  4A69 C;  1MDM A;  3W2A A;  5F0F A;  3BTL A;  3ZMV A;  1SFX A;  4OIN F;  2WC2 A;  2HXO A;  4XRS A;  2M5W A;  4B44 A;  2QWW A;  1KU2 A;  3LA3 A;  2EFW A;  4NQW B;  2EH3 A;  1ETV A;  1X3Z B;  2Z1D A;  2EIK H;  2BE5 F;  2M7B A;  3K9T A;  4P9F A;  5FRM A;  3SXY A;  1MSE C;  3QPL A;  2LYC A;  2JUG A;  4BHP A;  2L7K A;  3C7J A;  3LAP A;  3HTS B;  3T8T A;  4IEJ A;  4XID A;  1J09 A;  2Q8K A;  2QEX I;  1JGG A;  4BQN A;  1S7E A;  5J8F A;  3NAR A;  4RAG A;  1JT6 A;  2JSC A;  1NK2 P;  5EEA A;  3J7A O;  1T56 A;  3FXO A;  5H20 A;  3JSP A;  2BY3 A;  2GIV A;  4BBR J;  2KRF A;  3VPR A;  4A0X A;  1OYW A;  3GEZ A;  3V8J A;  3ZQF A;  3B73 A;  3CUQ B;  1UST A;  3LL7 A;  1RES A;  2W48 A;  3RJP A;  1IG7 A;  2DK5 A;  5M5X J;  3OYI A;  3HXL A;  4OWR B;  3SYT A;  1T98 A;  2DA5 A;  2HDD A;  1AWC A;  4E4H A;  3GTK J;  3BG7 A;  1BC8 C;  1UHS A;  2AHQ A;  2IS4 A;  2R93 J;  1DGW Y;  4LB5 A;  5HLI A;  2RNG A;  3H5N A;  4A12 A;  1T0F A;  3M8J A;  1DQU A;  3GW2 A;  4II2 A;  2HKO A;  3TMO A;  2WAQ N;  1LFU P;  1BJZ A;  3TOA A;  1FMW A;  3G2B A;  4RGX A;  3L2R A;  1X2M A;  2WAQ A;  3ZMT A;  1ZH5 A;  3E7L A;  2FBI A;  4RLQ A;  2HFH A;  5HDK A;  2VBX A;  5GPC A;  2ELK A;  3GFI A;  2PLY A;  3LOC A;  5FO5 A;  1BM9 A;  1ORK A;  4YG2 F;  4KT6 A;  4CGZ A;  1ETO A;  5J6X A;  1KA8 A;  5CLS A;  1MMD A;  4UV8 A;  2YR2 A;  2WB1 A;  2L5Q A;  4BL0 B;  4LLN A;  2O61 A;  1D8K A;  3PQJ A;  3JRH A;  5FFZ A;  1YIT I;  3J80 K;  3L7W A;  1PYV A;  3F8B A;  5HLG A;  3JRE A;  3ABK H;  1LNW A;  3PSI A;  4ZZL A;  1MNM C;  1RI7 A;  3OOU A;  1OCT C;  1J7K A;  1I1G A;  2Z3Y A;  4Y7N J;  2ZXI A;  5IT3 A;  1Z3X A;  1HSJ A;  3ECO A;  1A36 A;  1A35 A;  4W97 A;  4XRM A;  1VQ9 I;  2DK8 A;  2YX7 A;  3OYE A;  1QU3 A;  1I5Z A;  2QZ8 A;  2QQ8 A;  3FHZ A;  2HZT A;  3DWL E;  3JRF A;  3T1B A;  1SFE A;  3H0D A;  3FKJ A;  3IH4 A;  1G3T A;  2QKM B;  1G6N A;  2V26 A;  3HBL A;  4R79 A;  3OYG A;  2QBY B;  3TBI A;  4KNY A;  3AL0 B;  2FE3 A;  3J7Z I;  3KLN A;  3JTG A;  1ITY A;  2W84 A;  1XTA A;  4IHY A;  4HBL A;  5LBQ A;  1ZRE A;  1LE8 A;  1MNE A;  3AG2 H;  2A6T A;  3AAF A;  2KLO A;  3I0T A;  3LSR A;  2HTS A;  3CP8 A;  1U78 A;  3IUO A;  2HGC A;  2R7O A;  1OCR H;  1AKH B;  3UKG A;  2X51 A;  3LSG A;  5DD8 A;  1ZR2 A;  2K02 A;  4MEX F;  2VQH A;  4DGW B;  3BG9 A;  4Y3O A;  3A0B C;  1IO2 A;  3LSH A;  3TW7 A;  1PUF B;  4B4C A;  1I27 A;  2YUS A;  3ASO H;  2QLZ A;  3PO2 J;  1MMG A;  3J81 K;  3EUA A;  1XPX A;  1VQO I;  3KPH A;  3FDY A;  5LEK A;  4PGG A;  2K40 A;  2ZXJ A;  1FSH A;  2WAE A;  2HYG D;  1BIB A;  3H9Q A;  3PNY A;  3QPT A;  4ZJZ A;  1R58 A;  2W4S A;  2LFB A;  1JTY A;  1YX3 A;  3WHB A;  2EFQ A;  4AVZ A;  3F8M A;  5F1R A;  2PJP A;  2ZCW A;  2FEZ A;  1R4N B;  2V7F A;  4A5M A;  4NDL A;  2WY8 Q;  2XGC A;  1TC3 C;  2O6G E;  3KYC B;  4J00 A;  2BVL A;  5EG0 A;  3OMY A;  4DW6 A;  3WTT C;  1BI1 A;  2LSO A;  3F21 A;  2IEK A;  4GRI A;  4HV5 A;  3HOW J;  4RB3 C;  2H8R A;  4N0B A;  1HCR A;  2P6S A;  4AD9 A;  1EKE A;  3CUO A;  1BC7 C;  5FLM J;  3PFI A;  4L5J A;  4XOP A;  3IL2 A;  4EM0 B;  2FNA A;  2IAI A;  2VL8 A;  2LH9 A;  1T39 A;  3HKZ A;  3CO7 C;  3HOV J;  3FXL A;  2FD5 A;  2QVO A;  3QOD A;  3P7N A;  4PJ0 C;  3DXJ F;  3J81 Z;  1U6G A;  1MMA A;  3JRC A;  1JKO C;  3MKW B;  3HOX J;  1T2K A;  2G7H A;  3DP7 A;  3PNV A;  2Y31 A;  3ZMD A;  1ENH A;  3ELK A;  1QBJ A;  4XLE A;  1PDN C;  5L3F A;  1BA5 A;  4Z2Y A;  4YEJ A;  1I3Q J;  1SAN A;  5DCM A;  2E2I J;  4HV6 A;  2HEO A;  1JKR C;  4IHT A;  4EJT A;  2PQ8 A;  4B3A A;  2DMT A;  2XC7 A;  1SAX A;  5EDN A;  2VOO A;  3HRU A;  3RKW A;  5D5V B;  4ZTJ A;  3E0J B;  5C44 J;  1XG1 A;  2Y9Z A;  3PFY A;  1T33 A;  4C3H J;  5M3M J;  3FMR A;  1AOY A;  5B3S H;  2O9L A;  3RSN A;  3REO A;  1ZAR A;  5D6E A;  1X1B A;  2H1K A;  2P6T A;  3AL0 C;  3IWF A;  2EBI A;  2QCO A;  3QYE A;  2VPR A;  2XF7 A;  3IC7 A;  4A3K J;  4PGH A;  5LLQ A;  4ZZD A;  1V4R A;  5DUI A;  3Q0V A;  4M9Z A;  2LC2 A;  3GFL A;  4I0B A;  3MVP A;  4IQJ A;  1FY7 A;  2ACJ A;  3LAJ A;  4P55 A;  4U0Y A;  1OYI A;  1KQ0 A;  1U5T B;  1R22 A;  3U1K A;  1VFC A;  5HVQ C;  2DMQ A;  2V4J C;  4CYD A;  2CYY A;  3CO6 C;  1SFK A;  2V1N A;  2IT0 A;  3E5X A;  1TW3 A;  3ZQI A;  4OOI A;  3SQN A;  3PIO F;  3V7R A;  3MKZ A;  4XN3 A;  1R9T J;  4A3G J;  3O6B B;  1R49 A;  4G7O F;  2RRE A;  2IXS A;  4YIF A;  1R7J A;  1VQM I;  3K70 C;  5ICF A;  2EZI A;  1B8I B;  1WH5 A;  3Q9V A;  2Z33 A;  3EUK L;  3I55 I;  3E1S A;  3KP4 A;  4LG0 B;  1B72 B;  4Y33 A;  5F64 A;  3Q5F A;  3V7S A;  3N97 A;  2MC3 A;  4K2E A;  1MJB A;  4FX4 A;  4X1E A;  2KHM A;  2EB7 A;  4HYE A;  1ACI A;  3WU1 B;  2DDB A;  1F9N A;  1SVM A;  3QAH A;  3VYS B;  2ECC A;  2CWE A;  4EJV A;  2BHZ A;  3G1O A;  3J7Y J;  2Y48 A;  3BR0 A;  5BPD A;  3TED A;  2NXN B;  3L00 A;  3QOE A;  3BR2 A;  3TDU C;  3I71 A;  3U9G A;  2HZD A;  1I6H J;  1YW7 A;  4I7H A;  2G0E A;  2OQR A;  2A6H F;  2X0L A;  3OIQ A;  1VTN C;  3Q0U A;  1RNL A;  3OYF A;  1PP7 U;  1U0J A;  2VC1 A;  3DBL B;  2EQR A;  3UNG C;  1S3J A;  4NNJ A;  4CCO A;  3GLX A;  5M3F J;  2L54 A;  3DKW A;  2B9S A;  4IHX A;  1J9I A;  1IRG A;  2ZBK A;  3R6S A;  3IKV A;  3KX2 A;  3PIP F;  1LFB A;  1WVR A;  1VND A;  4L0Y B;  1OCP A;  3I58 A;  2V9P A;  2F5C A;  3SZP A;  1ONV A;  3D0S A;  3ZP5 A;  1U9N A;  3BZC A;  1O3Q A;  2NS8 A;  3S14 J;  5E1X A;  3F0C A;  3EYI A;  3K4M A;  1FSE A;  1E2X A;  3ZQC A;  1MND A;  2XAG A;  4EAT A;  5J4V A;  4HLY A;  1V3F A;  3U1D A;  4HLX A;  2QQB A;  1UHW A;  4LD5 A;  1P4W A;  2WV1 A;  4EJW A;  2XPW A;  2XVC A;  1MW7 A;  1D5V A;  5FRN A;  5FKN A;  3HM5 A;  4CCK A;  2O03 A;  2DOA A;  5F1J A;  2OZ6 A;  1AU7 A;  2R7T A;  1MDM B;  3BR6 A;  5FFX A;  3GTP J;  2A61 A;  1RRJ A;  4WXC A;  2DFI A;  3ABU A;  1XCB A;  1EH6 A;  2HKX A;  1BOB A;  3L2U A;  1WGX A;  1GXP A;  4GO1 A;  2FUG 2;  3F72 A;  4QWQ A;  3BJA A;  5CQG A;  4RB0 A;  2I8D A;  4DZP A;  4OMZ A;  2DT7 B;  3BRO A;  3BG3 A;  1MBK A;  4XRS G;  4J19 A;  3JRA A;  2YU9 J;  2RQP A;  3WOD F;  2GOM A;  2CSO A;  1BR2 A;  2HQ5 A;  5KAF C;  3PQK A;  3OIP A;  1R1V A;  5DEQ A;  5K7Z A;  4LB6 B;  4ABZ A;  1FBQ A;  2J5P A;  3LWF A;  2VLA A;  2X6Y A;  3HYI A;  4L9N A;  5FKO A;  1VQ7 I;  4F7Z A;  2GA2 A;  1IN8 A;  4MTD A;  1X4O A;  2L7M P;  2LY9 A;  3O8G A;  2XF6 A;  1IV6 A;  4U0W A;  1EA3 A;  1OYY A;  3CF2 A;  3H5A A;  3QP5 A;  2P5K A;  4XMY A;  2E71 A;  1Z91 A;  2CO5 A;  2OV7 A;  3MN2 A;  5K5R A;  1DU0 A;  4BQA A;  5E1Z B;  2F4I A;  2VUM J;  3EUH C;  1ZGJ A;  3IP4 B;  6PAX A;  3LSI A;  5FLX Z;  2XPU A;  2JVH A;  1X3W B;  1ZTR A;  3KIO A;  1TQI A;  1X1C A;  5LD2 C;  3FBI B;  4D5C A;  3LQR A;  1UJ8 A;  2VB6 A;  4RMN A;  3K4K A;  4JBA A;  2DBB A;  1IXR C;  3COA C;  3I4N J;  5HLH A;  2DAO A;  1TBX A;  2GQQ A;  2QM3 A;  3K1N A;  5D8K B;  1D0X A;  3K69 A;  5DCF A;  3DFG A;  4ETS A;  2COM A;  5EEH A;  4CCM A;  4XN0 A;  5LRR A;  2XPV A;  3GME A;  1TWC J;  1K6O A;  3OYB A;  3ECH A;  3FX3 A;  1ETQ A;  3FK7 A;  2CU7 A;  2W25 A;  4KIS A;  2P81 A;  5GTI C;  1YW8 A;  2KQR A;  5DM6 F;  2VOP A;  2RAE A;  4BKX A;  5C4J J;  1F5T A;  4ANJ A;  2K9M A;  1TTY A;  2BBY A;  2FBK A;  4U88 A;  1OCZ H;  3I64 A;  3SDB A;  2W7N A;  4A3B J;  4IKF A;  2M2E A;  3CF5 F;  2E1O A;  3GZ5 A;  3ZQG A;  2DA6 A;  3DPL C;  3MAJ A;  4M6V A;  4HSR A;  2W1O A;  4RM2 A;  1NTC A;  4B47 A;  4U7D A;  5IYB J;  4M9S A;  4M3E A;  1V55 H;  4BDZ A;  3HPH A;  4MGR A;  4PJN A;  1UG2 A;  3GTM J;  2Q2E A;  3OYD A;  3JRD A;  4DBR A;  1YRN A;  2PEX A;  4FCY A;  3W6J B;  4M3B A;  2BEO A;  1S8N A;  4OIR F;  4EJU A;  3BPX A;  4MFD A;  1T6S A;  1G4D A;  4YIR X;  4KFC A;  1H9T A;  2NS7 A;  4CH7 A;  3WHC A;  4GGG A;  2Z5U A;  1W5T A;  5HLT A;  3QOP A;  4M3F A;  2DYR H;  4G94 A;  4BXU A;  3FXU A;  2RN7 A;  4B3X A;  1LE8 B;  1E0E A;  2K5C A;  3FXJ A;  4CYC B;  1EH7 A;  2KIS A;  1YJN I;  1G3W A;  3JRG A;  2WV0 A;  3D5L A;  4EM2 A;  1S6L A;  2AXL A;  1IXS B;  1O3R A;  2FQ4 A;  2L01 A;  4A5N A;  5J1R A;  3ZQL A;  2LF7 A;  3BPV A;  2DPD A;  4ZC3 A;  3P5J A;  1QVT A;  5J47 A;  3WTW C;  2O8X A;  2M0M A;  2XAF A;  3OOP A;  2IP2 A;  4JK1 X;  5D5X B;  2WA0 A;  3VOD A;  3HSF A;  3F8F A;  4J01 A;  2JA2 A;  2Z2S B;  2N8G A;  4JQF A;  4RAY A;  3HOT A;  2KIM A;  1MSF C;  3ERM A;  5KK1 A;  2MH9 A;  4FX0 A;  4UHT A;  4N9I A;  3H9J A;  3VYT B;  3LFK A;  1K78 A;  2ZFW A;  1T0F C;  1YFH A;  2MAB A;  2EA2 A;  3GVA A;  1F4K A;  1ZRC A;  4E7J A;  4HPQ A;  2W00 A;  4A93 J;  2HTJ A;  3S15 J;  2AXT C;  1T95 A;  1YTY A;  4A3F J;  3EQL F;  3E5Q A;  2DA4 A;  4D7N A;  3IRQ A;  1XCV A;  2X6X A;  1JGS A;  1O7L A;  2M7A A;  1XDS A;  4Y4R A;  1MD0 A;  2HR3 A;  3BCB A;  4PZJ A;  4F52 A;  3C18 A;  4I01 A;  2NOG A; 
#chains in the Genus database with same CATH homology
 1XS9 A;  3HOZ J;  3JRF A;  3G1M A;  1JJ8 C;  1HF0 A;  5K7F A;  3CDL A;  3IH4 A;  4DYC A;  3TP3 A;  4BY7 J;  3HBL A;  3RZO J;  3S2H J;  4BXX J;  3D1N I;  1ITY A;  3CQZ J;  4IHY A;  2EZH A;  3K2A A;  1LE8 A;  2HYJ A;  2FX0 A;  2HXI A;  5E3N A;  5K7H A;  4DZJ A;  3DEW A;  3JRB A;  2JMW A;  1BL0 A;  1QRY A;  3TP0 A;  2LVS A;  3LSR A;  4LOC A;  3FK6 A;  1A5J A;  5IP7 J;  4D5F A;  5EF6 A;  1U78 A;  1QVU A;  4UUT A;  3BT9 A;  1NK3 P;  1U9O A;  1RR7 A;  1AKH B;  3UKG A;  4A3D J;  2KT0 A;  3LSG A;  1ETK A;  1VI0 A;  1ZR2 A;  3BG9 A;  3TW7 A;  1PUF B;  3PO2 J;  4B4C A;  2YUS A;  3LSJ A;  1IDY A;  1FEX A;  4L5E A;  5FJ8 J;  2K40 A;  3FIS A;  1GUU A;  2DA3 A;  3QPS A;  3S1R J;  4B1R A;  1WPK A;  3BR5 A;  5DTD A;  2LFB A;  1JTY A;  2GLO A;  2OPT A;  2Y0S N;  4JP0 A;  3WHB A;  3HOY J;  5J1Y A;  4A3I J;  4NDL A;  3GTO J;  5DS9 A;  2XGC A;  1TC3 C;  1RET A;  4MIM A;  5EG0 A;  2DMU A;  4DW6 A;  4XIC A;  3CMY A;  2IEK A;  2NVX J;  2R0Q C;  3HEF A;  1D5Y A;  3HOW J;  2H8R A;  1TWG J;  1HCR A;  4RBO A;  1OFC X;  1IUF A;  3HB9 A;  5E3O A;  4IHV A;  5FLM J;  2IAI A;  1GV5 A;  2DMN A;  2COB A;  5J3L A;  3A02 A;  3JRI A;  3HDD A;  3HOV J;  2FD5 A;  2R5Z A;  3M3Y J;  3A01 B;  2O7O A;  3JRC A;  4DYQ A;  1IGN A;  1JKO C;  3HOX J;  2EZK A;  3A03 A;  2Y31 A;  3GTL J;  1ENH A;  1B72 A;  2AO9 A;  2MW8 A;  1BA5 A;  5IP9 J;  1AKH A;  1I3Q J;  1SAN A;  2ME6 A;  1W0U A;  2E2I J;  3BQY A;  1JKR C;  1F43 A;  5F27 A;  2QF7 A;  1CQT A;  1X2N A;  2WB1 N;  1PUF A;  4JYK A;  4B3A A;  2DMT A;  2GM4 A;  2R92 J;  5EDN A;  2E19 A;  4AYB N;  5F08 A;  4XK4 A;  2FJ1 A;  2DN0 A;  4S0H B;  1BW5 A;  1ETW A;  4V2G A;  1ZQ3 P;  1JTX A;  1ZKG A;  5C44 J;  1XG1 A;  2Y9Z A;  1H8A C;  1T33 A;  2LD5 A;  4C3H J;  5M3M J;  3H0G J;  3I4M J;  4MLO A;  2X6O A;  2O9L A;  2OF7 A;  2H1K A;  2EBI A;  2QCO A;  2VPR A;  5IPA A;  4A3K J;  3BR1 A;  4EEF G;  2XSD C;  2DTZ A;  4M3G A;  3Q0V A;  3ZOB A;  2R7Z J;  5EG0 B;  3MVP A;  3BTC A;  4A3M J;  3HGY A;  2K9S A;  4DYR A;  1Q1V A;  5FKL A;  3LNQ A;  2HOA A;  3RZD J;  1VFC A;  4HNV A;  2DMQ A;  5GPA A;  4C2M J;  3IH3 A;  4A3E J;  3W6V A;  3HOU J;  3ZQI A;  5IOY A;  1HLV A;  3A01 A;  1R9T J;  4A3G J;  2JK3 A;  2R5Z B;  5M5W J;  2VKV A;  2NVT J;  2M8G X;  2EZI A;  3FKI J;  1WH5 A;  1B8I B;  1BW6 A;  2IBD A;  1H89 C;  1B72 B;  3FIW A;  4X6A J;  5IOZ A;  2LK2 A;  1P7I A;  4X1E A;  3S1N J;  1VF9 A;  1FJL A;  5JLW A;  1TWH J;  2XB5 A;  4FE7 A;  2YS9 A;  2Y9Y A;  5IP6 A;  2ECC A;  3G1O A;  3IV5 A;  3DCF A;  3GTG J;  2M9H A;  1MBG A;  3BR0 A;  3TED A;  3SDG A;  2CUF A;  3PM1 A;  5M5Y J;  3BR2 A;  1MBH A;  3Q0W A;  1I6H J;  2LLK A;  2G0E A;  4MFE A;  1I50 J;  4RDU A;  2NVQ J;  4AC0 A;  1JKQ C;  1GT0 C;  2HI3 A;  3Q0U A;  5F04 A;  3ZQH A;  3GBG A;  1W0T A;  3M4O J;  1IDZ A;  2B63 J;  1GVD A;  5C4X J;  1G2H A;  3HGG A;  3SFI A;  2EQR A;  4A3L J;  2MSY A;  1ZK8 A;  2JWT A;  9ANT A;  4QIW N;  1IC8 A;  2JA5 J;  5M3F J;  3S17 J;  1F36 A;  2K9N A;  2VI6 A;  4IHX A;  2PMZ N;  3HKZ N;  1JUP A;  2NVY J;  1GDT A;  4V2F A;  1POG A;  1RKT A;  1LFB A;  1VND A;  2ME0 A;  1JKP C;  1OCP A;  2JA7 J;  4A3J J;  2XGD A;  1SFO J;  2JA6 J;  1U9N A;  2DA2 A;  1B8I A;  2NS8 A;  5IYD J;  3S14 J;  3BR3 A;  3F0C A;  3ZQC A;  2JJ7 A;  5E3L A;  4AUX A;  3S1Q J;  3S16 J;  4MO7 A;  2Y30 A;  2CQX A;  1Z77 A;  2WV1 A;  2XPW A;  3OSG A;  1JJ6 C;  3MKL A;  1WI3 A;  2DA1 A;  1FIA A;  4FTH A;  2DA7 A;  1HDD C;  2L0K A;  4FIS A;  3O8H A;  5FKN A;  1AHD P;  3HM5 A;  2TCT A;  5F1J A;  1AU7 A;  2E2H J;  5J1U A;  3BR6 A;  5EGO B;  3GTP J;  1Z0X A;  2VKE A;  4D7M A;  2O8K A;  4GFB A;  1WGX A;  2JN6 A;  4QTR A;  1APL C;  3LSP A;  1FTZ A;  1RKW A;  3JR9 A;  1XC5 A;  1TWF J;  2LR8 A;  4DZP A;  4I6Z A;  4IHW A;  1JT0 A;  4UUS B;  4XRS G;  3BG3 A;  1MBK A;  1K83 J;  4J19 A;  1MBF A;  3JRA A;  2YU9 J;  1A6I A;  5HOD A;  1QPI A;  1FTT A;  1Y1V J;  4JX5 A;  2HQ5 A;  1MBJ A;  2CUE A;  5IYC J;  3BQZ A;  5K7Z A;  1H88 C;  1IJW C;  4ABZ A;  3SJM A;  2X9D A;  2ZB9 A;  1O4X A;  2EZL A;  1MBE A;  2R5Y B;  5FKO A;  5GP9 A;  1K61 A;  2L7F P;  3RKQ A;  1HOM A;  3C2B A;  2L7M P;  1WH7 A;  2LY9 A;  3CCY A;  4C3I J;  2D5V A;  3O8G A;  1IV6 A;  3NAU A;  3BTJ A;  2K9Q A;  1YRN B;  3L1P A;  3TW6 A;  3BTI A;  5FKK A;  1TWA J;  4W1U A;  1ZR4 A;  1DU0 A;  3MN2 A;  2X48 A;  4G12 A;  4BY1 J;  2GBY A;  2VUM J;  3PO3 J;  4FE4 A;  2XPU A;  1ZTR A;  1UMQ A;  1Y1W J;  1JUS A;  4D5C A;  2I10 A;  4A69 C;  3B6A A;  3I4N J;  5EGO A;  3GTQ J;  5F0F A;  3BTL A;  2HXO A;  1MH3 A;  4XRS A;  4CYC A;  3G1L A;  2M0C A;  2CRG A;  2EH3 A;  2XPV A;  1ETV A;  1TWC J;  5F0C A;  2LKX A;  2E2J J;  1IRZ A;  5EZH A;  1MSE C;  3QPL A;  1JUM A;  1ETQ A;  3FK7 A;  2CU7 A;  4IEJ A;  4XID A;  2P81 A;  1JGG A;  5C3E J;  1S7E A;  2RAE A;  3NAR A;  5BNG A;  4UUS A;  1JT6 A;  5FKM A;  4BKX A;  5C4J J;  5EYR A;  1NK2 P;  5EEA A;  1T56 A;  2MG4 A;  4BBR J;  5EZG A;  1RPW A;  4A3B J;  3VPR A;  2M2E A;  3QQA A;  2E1O A;  3ZQG A;  2DA6 A;  3ZQF A;  4M6V A;  2R5Y A;  1E3O C;  1NTC A;  5E3M A;  1RES A;  2W48 A;  1FIP A;  1IG7 A;  5IYB J;  4M3E A;  2ID3 A;  5M5X J;  1DU6 A;  1ZGW A;  3GTM J;  1UG2 A;  4JX6 A;  2CJJ A;  3OIO A;  3JRD A;  1YRN A;  2ID6 A;  2DA5 A;  2HDD A;  2LTP A;  3BG5 A;  4FCY A;  2M34 A;  4M3B A;  4QSH A;  3GTK J;  3K7A J;  2DMP A;  1UHS A;  2AHQ A;  4MFD A;  2R93 J;  2NS7 A;  3WHC A;  2L9R A;  2XGE A;  4JX4 A;  1P7J A;  2WAQ N;  4M3F A;  1WCM J;  1OJL A;  2XB0 X;  1LFU P;  1BJZ A;  2KDZ A;  1LE8 B;  3B6C A;  2HOS A;  2JA8 J;  1X2M A;  3E7L A;  4CYC B;  4A3C J;  4C3J J;  3JRG A;  5GPC A;  2ECB A;  5F0H A;  2ELK A;  2HOT A;  2FQ4 A;  3ZQL A;  5J1R A;  3LOC A;  4I76 A;  4BBS J;  3IH2 A;  1QVT A;  1ORK A;  2LP0 A;  1ETO A;  3H3V K;  1ETY A;  2Y2Z A;  2L7Z A;  5FLV A;  3Q3S A;  3S2D J;  2N8G A;  1U8B A;  1MSF C;  1X58 A;  5JLX A;  3GTJ J;  3JRH A;  2CQQ A;  1MH4 A;  3JRE A;  2XRL A;  4Y52 J;  1MNM C;  3OOU A;  1OCT C;  1GV2 A;  4M3D A;  3OSF A;  4A93 J;  4Y7N J;  3S15 J;  4A3F J;  1ETX A;  1HDP A;  2DA4 A;  4D7N A;  2MGQ A;  1EF4 A;  4W97 A;  4XRM A;  3RQI A;  3S1M J;  2TRT A;  2DJN A;  2NOG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...