3GFMA

Crystal structure of the st1710 mutant (k91a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRAILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfmA00
4M9SA 1D8JA 4OMZA 3B02A 4ESJA 2Y0MA 3O3KA 4BHPA 3JW4A 1S8NA 4ZYEA 5FLXZ 2K86A 1Z7UA 3RDIA 4WF2A 2NNYA 2ZXJA 3LAJA 2M1BA 3VEPA 4MEXF 2XASA 2K4BA 2HTSA 2LNBA 2BV6A 2DK8A 2O0YA 1ZG3A 4I01A 1J59A 1O3TA 5AIPA 4AWXB 2CSOA 3WTWC 1HKQA 3ZMDA 4JQFA 3KP5A 3F6VA 1EH8A 1W7PD 4Z2YA 3V8KA 1JHHA 3SZTA 4I09A 2J5OA 2IRFG 4HYEA 3GZ6A 2JT1A 1L3LA 1RUNA 3WTYC 1MDMB 3HHGA 2ZNYA 5CVJA 4Q48A 1TLHB 3RKXA 2DPUA 1KU3A 4G7HF 2H94A 3J81Z 4EJUA 1R1VA 4RGRA 1IRGA 3D5LA 3T1BA 3FWEA 4XBFA 2KJCA 2FBHA 3H3ZA 2P6TA 4EM1A 1VTNC 5D8LB 4U7BA 3SQNA 5EEHA 1XSVA 4IHTA 1OKRA 4B8XA 4YFNF 4KICA 3CUQA 3F3XA 3I0TA 1SD7A 2QQAA 2K7LA 2FSWA 2ELHA 3LQQA 4NQWA 2ZBKA 2CG4A 2A6EF 2IPQX 3P9CA 6PAXA 3M1EA 2ZMEB 3I64A 2K4JA 4HAMA 1Z91A 2FNPA 2FXAA 2D45A 4G7ZF 3WG9A 4M6YA 1L0OC 1RIOH 4A5NA 2A6HF 1LVAA 4HW0A 1F4KA 4LK0F 3KP4A 1JE8A 1IAWA 1K7AA 1ODDA 4OINF 1R5GA 3RPQA 1Z05A 3E6DA 1IXCA 3JSPA 1J7KA 5K1YA 3HUGA 1U2WA 2DBBA 3FXRA 1QO0D 4YFKF 2GQQA 2EA2A 1EH7A 1XGMA 1YTYA 2HKXA 5J8CA 2NAZA 4EJTA 2H27A 3U9GA 3E6MA 1QQIA 3ZMTA 1YIOA 4ZYDA 1KYZA 2Y48A 5E8IA 2PQ8A 2NYXA 1F9NA 1YW8A 3RIRA 3IRRA 1TNSA 3U2RA 4TV7A 4RB3C 4KIGA 4O5VA 4L5JA 3V8LA 1LB2A 4RGUA 2M45A 3RKWA 3HRUA 3DF8A 4RAZA 2STTA 5DCMB 1YYVA 1QNTA 5KK1A 2FQ3A 4P9FA 3V8JA 2VXZA 2HS5A 4AIKA 2KIMA 4HF1A 5F6FA 3MAJA 4BH9A 4G94A 2D2WA 1C0WA 1SFXA 3F8FA 3QPTA 1XGNA 2E7XA 1P4AA 3WTXC 5HLIA 2XAGA 3IKVA 2CW0F 3ECHA 3HIFA 2EK5A 2CYYA 1B9NA 3WTZA 1T0FA 4G9YA 3W6JB 2V79A 2IW5A 3SZPA 3KLNA 4ZYHA 1MJBA 3GYHX 1D5VA 3RI4A 2ZO4A 2HGCA 4CICA 4HQMA 5HDNA 4A12A 2EV0A 1ULYA 1SFUA 1EH6A 1BI2A 2QLZA 4ZZLA 3VB2A 3L09A 3V4GA 1S29A 1YO5C 1WWXA 3WU1B 1BC8C 2H09A 2GXBA 4A0YA 4L0ZB 3QAHA 3CUQB 2OQRA 1IN5A 4FT8A 4ZZDA 1YW7A 4LB5A 3VOEA 1O7LA 4FX0A 2ADUA 2PN6A 2EV5A 1ON2A 1I5ZA 2E1CA 1HSJA 4KNYA 5H6QA 4IHSA 3QPHA 3GW2A 2PJPA 2D1VA 1R22A 3DPTA 3J7AO 2P7CB 4LLLA 3R6SA 1O3RA 2XKOA 4Q5SF 2W85A 4UVBA 4CHUA 3M7GA 3ZMSA 4RGXA 3IC7A 2HFHA 3E5QA 4LLNA 2RGVA 2R7DA 1T38A 2M8EA 4UVCA 2ETHA 4WK8F 5L3CA 4KYWA 3CJNA 1DUXC 2OZUA 4EMSA 2PEXA 3ZN0A 1FYMA 3SHFA 4G6QA 2L4MA 4A6DA 4GGGA 1BI1A 1KQ9A 2VOPA 2LDUA 1GHCA 1XGOA 2QBYA 1D8KA 5E1XA 1XSDA 4UVAA 4R79A 5ILVA 2GZWA 2F5DA 4N9IA 3MZHA 5K5QA 4LMYA 4WXHA 5HOOA 3F8CA 2PLYA 4RB1A 2A69F 3IWZA 4UXNA 4N9HA 3K1MA 4KN7X 3ZPLA 1ZLKA 2HYGD 3BWGA 1MGTA 2Z99A 1MZBA 4HX8A 4BHCA 1P92A 4LFUA 4GYGA 2LKPA 1FNNA 3FMRA 1FP1D 3Q5FA 3KP2A 4EQQA 4L18B 2WV0A 3BJ6A 4XLNF 3MCZA 3MQ0A 2STWA 2ZNZA 3H3UA 3K9TA 1UB9A 1XCBA 4MQVA 1ZARA 1HW1A 3U1DA 3WGGA 4S05A 1F1ZA 5FGMA 1E2XA 3QP5A 1HQCA 4DQ2A 1A04A 2VBWA 5D8KB 4EGYA 2OZ6A 2FE3A 1EV7A 4HDUA 3CUOA 2F5FA 1J9IA 3DKWA 4FX4A 2V6CA 3LAPA 3HTSB 2V1XA 2GAUA 4ESBA 1R23A 2O8XA 4WWCA 3EDPA 2O61A 4XSZF 1CGPA 1T98A 2QWWA 5TJJA 5IT9Z 2LSOA 5BOXA 3BPXA 4UV8A 5CYVA 1TTYA 1ZN2A 5HVQC 5DEQA 1WKMA 4KIFA 1LQ1A 1H9TA 1U78A 2DTRA 2FBKA 2OAZA 2IA2A 3WE2A 1HKSA 1KQ0A 3BDDA 2YX7A 3E6CC 1B4AA 4LB6B 5EEGA 3WTTC 4WX9A 2HZTA 2Z9OA 5DCMA 2JRTA 1Z9CA 4FHTA 1ZRCA 3P7NA 3H92A 5JR3A 1P2FA 1YQAA 2KIFA 4U88A 2UXNA 3TQNA 3TO6A 5E18F 1X3UA 4IXAA 1SD5A 4Q47A 2KIUA 1IN4A 5L3BA 1S3JA 2EFPA 4M74A 1FY7A 2FU4A 2DLLA 1SD6A 1Z6TA 4MHGA 3FXQA 4O6JA 1XSXA 2A3SA 1U6GA 1IRFA 1XMKA 2MBFA 4ON0A 2VC0A 4QWQA 3L00A 2QBYB 1XD7A 2ZCWA 1R5HA 2A07F 3K69A 2GA1A 1U5TC 3GFMA 2O6GE 4B09A 2VN2A 4M72A 3F8MA 1R1TA 3I5UA 1G3SA 4GYIA 5DUKA 2YX4A 1G6NA 3GF2A 4DNCA 2H6BA 3BP8A 1BM9A 4RB0A 4KN4X 3COAC 1OYYA 1UCRA 3REOA 1MJAA 1ZREA 2HQRA 1HXDA 2OBPA 4ENJA 5E1ZB 2M5WA 4P5OA 5BPIA 5FFXA 5IT9K 2DQRA 4I2OA 1MD0A 2BBYA 2JTVA 4CXFA 4KIBA 5DDGA 4ZH4F 4KDPA 4R8HA 4A0XA 2NNNA 1ZGAA 1B59A 2EB7A 3TKYA 3V7RA 4QLCU 2MH9A 3F23A 2XIGA 2VE9A 4NHJA 4KMUX 1S7AA 1BIAA 2ZFWA 2QQ9A 1ZG1A 2RNJA 2LF8A 5FLXK 2DK5A 1R00A 1XGSA 3MWMA 4IRHA 1R1UA 3K1PA 5J6XA 4N0BA 3LQRA 4WXCA 1Y0UA 1F5TA 2PMHA 3IHUA 2DPDA 1TNTA 5D4RA 2AXLA 2MC3A 1P6RA 4M71A 4ETSA 3I59B 3Q9SA 5BS6A 4M9XA 2HEOA 2CWEA 4EM0B 1ONVA 4PGHA 2QQBA 2PFBA 1HBXG 2P5LC 4PDKA 4A5MA 2VT3A 2QZ8A 3D0SA 1NHAA 5ILSA 5H20A 1ZH5A 3FM3A 1OPCA 2GXGA 2M87A 3DEUA 4IF4A 3R4KA 2L4AA 1DP7P 4O3MA 2V9VA 1QGPA 1P4WA 1UFMA 1O3SA 3BZ6A 1QZYA 1W5TA 1YG2A 3ROUA 1GXQA 2QM3A 3I53A 3J81K 2IA1A 4PCQA 3BOQA 3CO6C 3Q9VA 5HDKA 1PDNC 1FSEA 2UXXA 3F21A 1TQMA 3F8NA 1U5TB 3KEOA 1S6LA 1IN7A 1O3QA 4Y15A 3CDHA 1REPC 3N97A 1FWZA 3K0LA 4U0WA 3TO9A 3GXOA 4MTEA 4KUMA 5D6FA 2XAHA 3B73A 1KU7A 3F8BA 2JPCA 1PP7U 1V3FA 5AONA 2ZJ2A 1FYKA 2IP2A 2RC4A 1ON1A 5BMZA 3HSRA 1K78A 5HDGA 2LF7A 4EJVA 4I0BA 1W7PA 3WU0A 3SFZA 5IT3A 3JSOA 4GCVA 2Z5UA 2C6YA 5LHHA 2PBIA 4LLGF 3W6KB 4OIRF 4G6DA 3NQOA 4KMFA 1OMIA 1FC3A 5FD6A 3CLOA 1J2XA 4Y17A 1ZHFA 5J8FA 3F6OA 5DD8A 2BEOA 4PZJA 4G8XA 1LEBA 3R0AA 2YU3A 3QP6A 4IRIA 4EV0A 1BIBA 1ZYRF 4IRGA 4U0YA 2Q8KA 2Y75A 1USTA 4EJOA 1HKTA 2VODA 4A2UA 1XCVA 3GFLA 1B9MA 1FPQA 3L7WA 3LWFA 5DD4A 2B0LA 3JAMZ 3F72A 3ABUA 2YPRA 2EFOA 1ZG5A 3KETA 5ED4A 2GWRA 4MEYF 4ENMA 3ISPA 2H6CA 2HWVA 5K5OA 5CVUA 5L3DA 2X4HA 3PQJA 4HQEA 3I58A 5LHIA 4D0PA 1TQPA 2MLGA 1XDUA 1S7OA 2VE8A 1T6SA 2DO7A 1FBSA 4KA4A 2W25A 5DCFA 1Z1DA 1BOAA 3S2WA 4IVNA 4RAYA 5DYMA 5FD5A 3QOPA 3KZZA 3KFWX 4RGSA 4NB5A 4I98B 2DQLA 4CYDA 4M73A 2VBXA 3GO5A 3EQLF 4CGZA 3R60A 3C3WA 4P96A 2VONA 3DFGA 4MNUA 2EWNA 2FA5A 4HZFA 2WWYA 2F5EA 3P9KA 3L2CA 3WODF 1O57A 2W24A 4OIQF 3IWFA 3G73A 4OOIA 2E7WA 3LSTA 3ML6A 5LBQA 4LGWA 4P55A 1IN6A 1U3EM 2Z3YA 2K02A 2P5VA 4BHBA 1B6AA 3V7CA 1QPMA 3WTUC 2O03A 1IUYA 1IXRC 3GVAA 4LK1F 1K78B 2IJLA 5D6EA 1HW2A 1W7PB 3RPUA 2P8TA 2FMLA 3J80Z 3RKYA 1R36A 4ENNA 1U8RA 1XN7A 1IN8A 3HOTA 1I27A 1JXSA 1XB4A 1ZLJA 1BJAA 2G7UA 3T0YA 2X0LA 2FOKA 1DDNA 5DV5A 5H6RA 1STZA 3ULQB 4UNOA 4OMYA 1QZZA 3I59A 5L3EA 1LJ9A 3NEUA 3ZQ7A 3T5XA 4HA8A 4LG0A 1H0MA 1IXSB 3ELKA 2FEZA 4KFCA 3C7JA 3GX4X 1TW2A 5HS9A 4UV9A 2QYOA 2WC2A 5KVRA 2XHKA 1YS7A 1BC7C 2CGPA 2GIVA 4EGZA 1WI9A 1J5YA 5FO5A 3FMQA 4F7ZA 3FMSA 4EVIA 3QU6A 1SMTA 5CVRA 2E1NA 2K27A 2L54A 2G7HA 2RV8A 3FM5A 3BROA 5ERIA 1MKMA 3TO7A 4XSXF 3RJPA 4A6EA 4RB2C 1U5TA 5F64A 4H0EA 3WTSC 3I4PA 1MJ9A 1TW3A 1G4DA 1LDJA 3SXYA 2FNAA 2V1UA 3I54A 1YLFA 1SD4A 4I7HA 3N4MA 3LFKA 1E17A 1Z6RA 2A61A 1SMYF 1FSHA 3ZMVA 3QU3A 1W4MA 4WCGA 4PGGA 1BI3A 1I6XA 4EJWA 3GFJA 2OA4A 1D3YA 3J80K 3GLXA 5ICGA 2JSCA 2JZYA 3O2PE 4K2EA 3HHHA 2EFNA 3TOBA 4HBLA 4HX4A 1I1SA 1OYWA 4OIOF 1CF7A 5A2QZ 5ICEA 2P7VB 3MFKA 2CQKA 1BBYA 4IJAA 5LGUA 1JHFA 1GXPA 2XAQA 3E6BA 3HRSA 3LA2A 4M6XA 1XMAA 2Z33A 2COMA 2HYFA 3TGNA 1KU2A 5CJ9A 1KU9A 3F22A 1G3TA 2RKHA 5HLHA 2RVCA 3KEQA 5L3FA 3HRMA 2HTJA 5ILUA 1JGSA 1ZRFA 5JI6A 3WGHA 1AOYA 2L3DA 2HQNA 3HTUA 3KCCA 3GFIA 2EA4A 2OQGA 1OYIA 4LD5A 1ZAOA 2TDXA 2UZKA 2KRFA 3FF5A 3BPVA 1V4RA 4ENKA 1T2KA 5E17F 4YIFA 4HDVA 3PFIA 2FRHA 3GZ5A 3RYPA 1YS6A 2RDPA 2GA2A 2O3FA 3KZYA 4ZYGA 2VT2A 3M8EA 1LDKB 3M9AA 3WE3A 5LHGA 5D5XB 2ISZA 5TRDA 1WSUA 1YFHA 3CUQC 1G3WA 2FF4A 3ABTA 1FT9A 2XAJA 3NRVA 2F5CA 5LGTA 1FZPB 5HS8A 4LG0B 4ESFA 3FZVA 4HF2A 2A68F 4YIIA 4L9NA 5L3GA 3DQVC 3HSEA 1RNLA 1KA8A 2CO5A 4XLPF 3K2ZA 1RZ4A 2UWMA 1BN5A 4HLXA 4G7OF 2BGCA 1LNWA 4L0YB 2P5KA 1T39A 4LJZF 5A2QK 1PP8F 2R3SA 3QRFF 4BQAA 3K1NA 1TQIA 5HS7A 2DFIA 5LGNA 5JHUA 2EJRA 2G9WA 3DPLC 5LRSA 3ZP5A 1KQ8A 3HOSA 2QVOA 3PQKA 3LA7A 2YSRA 3E5UA 5AIQA 5ICFA 3R61A 2JPBA 4E70A 1FOKA 4Y13A 1Q1HA 3VFZA 3ERED 4U0VA 5FFZA 3G3ZA 4MTDA 3JTGA 5CLSA 1KGSA 1OR7A 4HOBA 3MZYA 4YG2F 2Q2EA 3BJOA 1K6OA 2PG4A 3EYIA 4I02A 3JTHA 1IF1A 2CFXA 4S04A 3BJAA 3I71A 5LEJA 2NS0A 1CF7B 1QBJA 3L9FA 1LDDA 2ISYA 3T8TA 1G3YA 1TBXA 4MGRA 2XGXA 2XRNA 2V1DA 2J5PA 3V7SA 2VBZA 3M8FA 1R7JA 3BY6A 4HX7A 2D1HA 2DW4A 2XROA 2ESNA 1HW5A 3TOAA 2FBIA 2XV4S 1FYLA 2XAFA 5LRRA 1RI7A 3KE2A 3HSFA 4U7DA 4JBAA 3P9IA 4GO1A 4CO8A 5JFRA 3EETA 3DV8A 4Q4ZF 3C18A 2YR2A 4BNCA 1LEAA 5D5VB 1HSTA 2MA3A 4A0ZA 1IW7F 3KP6A 1PUEE 3ZMZA 3LA3A 1J0RA 1BI0A 1SAXA 5F1RA 3EUHA 5BPDA 1FX7A 1B1BA 4OIPF 4IPAA 4EM2A 2AS5F 4GXOA 2EFWA 5E1WA 1FLIA 1ZGJA 1H9GA 1K79A 3KP7A 4CZZA 2HKOA 1KYWA 4I0AA 5LLQA 5FB2A 2L02A 1ZRDA 2F2EA 3GEZA 3FHZA 2L01A 3VODA 3GWZA 1J75A 1UHWA 4AIJA 2BYVE 5LEKA 1DPUA 2PMUA 3MEXA 2ACJA 4MQ9F 2WTEA 4L9TA 2OU2A 2OD5A 4BYYA 2IT0A 4UHTA 3IKTA 4HLYA 3E97A 5CVIA 3O6BB 4CDGA 3WGIA 1USSA 3E3VA 3GUDA 1MDMA 2KJBA 4UUVA 3KLOA 1WRJA 3T8RA 2W84A 3ZMUA 5D5UB 3IRQA 4WXDA 2P6SA 5ICCA 3HYIA 5E8GA 4KT5C 2RN7A 4HV5A 1FBUA 2A5YB 3DXJF 3WTVC 5D4SA 4M9ZA 2M30A 4HF0A 4L9JA 1GVJA 5K5RA 3ECOA 1IZ1A 2VBYA 4AD9A 2Q0OA 1I1GA 2QUFA 1SFEA 4RS8A 4YFXF 2VOOA 2XUBA 2BE5F 3AAFA 3CTAA 2DI3A 1DPRA 2IVMA 2DT5A 2VC1A 3EYYA 3FX3A 5D5WB 2EFQA 3E5XA 3KP3A 2MD5A 1FBQA 4AIHA 3OOPA 3OV8A 3JAMK 2RQPA 3RTRA 2HDCA 3ZN1A 2ZKZA 2XKPA 2KKOA 2ZMEA 4L9VA 4OU0A 4AVPA 1O7FA 1UHMA 2FMYA 5DUIA 5HLGA 4BAYA 1P4XA 2QENA 4ASNA 5BQTA 2DAOA 3R0JA 2XVCA 3HRTA 2P4WA 2W57A 3FXUA 2NRAC 2ESHA 3IL2A 1RUOA 1R58A 3TDZC 1AWCA 5CVVA 2R7FA 2MLKA 4P9UA 3CO7C 2IA0A 4JK1X 3C1DA 4HV6A 4L5IA 3TDUC 5JVTA 1W5SA 4R1HA 4BXUA 1XDSA 2MH2A 2HOEA 2HR3A 1FP2A 2PI0A 2DU9A 1YW9A 2EV6A 3DP7A 4XRFA 5E20A 3RYRA 1WQ2A
chains in the Genus database with same CATH superfamily
4RMNA 4HSRA 4M9SA 1D8JA 4OMZA 4AIDA 1W5CC 3B02A 4ESJA 2Y0MA 3O3KA 2WA0A 5CPRB 3MVPA 3I4MJ 4BHPA 2O7OA 1S8NA 1LFPA 3JW4A 4ZYEA 5FLXZ 2K3FA 4CUGA 2K86A 2BY0A 1Z7UA 1A36A 3RDIA 3S14J 5CQGA 4WF2A 1BW6A 2NNYA 2ZXJA 3LAJA 2ZJQF 2EIKH 2M1BA 2X6WA 3VEPA 1V55H 4MEXF 2BXYA 2XASA 4XN0A 2K4BA 2HTSA 2LNBA 1FJLA 4AVZA 2VQGA 1T95A 2BV6A 2DK8A 2O0YA 1WGXA 1ZG3A 4I01A 1J59A 1O3TA 5AIPA 4AWXB 3TP3A 2CSOA 1VQPI 2LTPA 3WTWC 1HKQA 3ZMDA 3BT9A 4JQFA 2CQXA 1X58A 3KP5A 3F6VA 2DA3A 1EH8A 3CMYA 1JGGA 1W7PD 2DMTA 4Z2YA 1JHHA 2OCEA 3SZTA 3V8KA 4I09A 2J5OA 2VKEA 3H9GA 4E7ZA 4HYEA 1IJWC 2IRFG 3GZ6A 1IUFA 4IZZA 2XC7A 4MLOA 3M3YJ 1VQ6I 2JT1A 2L9RA 2LOOA 2O9LA 3S2HJ 1QVTA 1Z67A 3D5RC 4D5FA 1L3LA 1RUNA 3WTYC 1MDMB 3F0CA 3KPHA 2BY2A 5IOYA 3HHGA 5J4YA 3PO3J 2ZNYA 4LIVA 5CVJA 4Q48A 1TLHB 3VYSB 3AL0C 5JLXA 2LKXA 2I5UA 1J09A 2GLOA 3RKXA 4BY1J 2DPUA 4BQNA 1KU3A 3VSKA 5E3OA 5DM6F 1S72I 1K61A 4G7HF 2H94A 3S16J 4A3FJ 3J81Z 1T56A 3LSIA 4EJUA 1R1VA 4RGRA 1IRGA 3D5LA 3T1BA 3BTLA 4CCKA 3FWEA 2LY2A 4A3IJ 3K2AA 4XBFA 3WHCA 2KJCA 2M34A 2FBHA 3ZCOA 2E71A 4RDUA 3GCMA 3OYFA 3H3ZA 3MZ8A 1JJ8C 2P6TA 4EM1A 1VTNC 1E3OC 1HLVA 3Q0UA 2CMPA 2KZVA 5D8LB 2E2IJ 4U7BA 3OYJA 2BXZA 3SQNA 4YRVA 5EEHA 1XSVA 2OV7A 4ANJA 1N78A 4IHTA 1OKRA 2FJ1A 2L7MP 2NOGA 4B8XA 2R7RA 1ENHA 3JRGA 4BE1A 2MW8A 2X48A 3L2RA 2QGUA 1FMVA 3FKIJ 1UG2A 4YFNF 1VQMI 2F4IA 4KICA 5GAGJ 3OYBA 3CUQA 3F3XA 3I0TA 1SD7A 3VYRB 1LPQA 2QQAA 3ZQCA 2K7LA 3S17J 2FSWA 1R4MB 2JA2A 2ELHA 2IEKA 2QQ8A 3LQQA 2ZBKA 4NQWA 2CG4A 2EQRA 1X2MA 2A6EF 2IPQX 3P9CA 6PAXA 1V5EA 2JA6J 2V6EA 3M1EA 3C2HA 2ZMEB 3I64A 2K4JA 4HAMA 1Z91A 2FNPA 1FIAA 2FXAA 2D45A 4JX6A 4G7ZF 3WG9A 4M6YA 1DGRM 1L0OC 4NNJA 1RIOH 4A5NA 1BR1A 1G2HA 2A6HF 4C2UA 3BLYA 1LVAA 4HW0A 1F4KA 4LK0F 3KP4A 1G59A 2LYCA 1JE8A 3A0HC 1IAWA 1V54H 2VLAA 1K7AA 1ODDA 4OINF 2WB1N 1R5GA 1RESA 3P5JA 3RPQA 1YOVB 2PMZN 3CCUI 1Z05A 3E6DA 1IXCA 4PSXA 3L2QA 3JSPA 1GV5A 1J7KA 1JJ6C 2XPWA 5K1YA 5KCMA 1YJ9I 1S9HA 3ABMH 3HUGA 1U2WA 2LG4A 1I39A 3OSFA 1X3WB 3HOZJ 3Q0VA 1OFCX 2DBBA 4XKVA 4M6VA 3FXRA 2R5ZB 1QO0D 4YFKF 5IP9J 2GQQA 2EA2A 1EH7A 1XGMA 1YTYA 1VQNI 2HKXA 5J8CA 2NAZA 3TW7A 4EJTA 2H27A 4Y3OA 3U9GA 3E6MA 4GFBA 1QQIA 3S32A 5IYCJ 4PK4A 1XC5A 3ZMTA 2Y30A 1WFXA 1SAUA 1YIOA 1KYZA 2E5ZA 4UB6C 4ZYDA 1RC9A 2Y48A 1YIJI 1FTTA 3DU5A 5E8IA 2PQ8A 2TCTA 1UHSA 2F5VA 2NYXA 3KZIC 3ESWB 1F9NA 4IKFA 1YW8A 2DYSH 4G12A 3E7LA 3RIRA 3IRRA 2O5RA 1TNSA 3U2RA 4TV7A 4RB3C 1OCTC 4KIGA 3UKGA 1A5JA 4O5VA 2CQQA 1WZ2A 4L5JA 3V8LA 1LB2A 1BJZA 3GTJJ 4RGUA 2M45A 3ASOH 3RKWA 3HRUA 5JHFA 3DF8A 3W3CA 4XQFA 1WI3A 2Y9YA 4BBRJ 4RAZA 4PFOA 2STTA 1BW5A 5GAEJ 2QKMB 4ZYAA 5DCMB 2LY1A 1YYVA 3NARA 4B3XA 1QNTA 5KK1A 3MMYB 2FQ3A 5C3EJ 2XF6A 2KZGA 4P9FA 5B5EC 4C3HJ 3V8JA 1U9OA 2WAQA 2MYSA 2AXTC 3HG9A 2VKVA 2QSFX 2VXZA 3I56I 2R7UA 2HS5A 4AIKA 3BR0A 2KIMA 3KIOA 2CJJA 4HF1A 2R7SA 5EF6A 5F6FA 3L2WA 3MAJA 3RPUD 4BH9A 4G94A 2D2WA 1C0WA 1SFXA 1YI2I 3F8FA 3QPTA 1XGNA 2JRMA 2HOAA 4PJLA 2E7XA 1P4AA 3DBRB 1JKPC 3WTXC 5HLIA 3LMMA 3H9QA 2XAGA 2DMQA 3IKVA 5K7FA 3CMAI 2CS3A 2CW0F 1JUSA 3BCAA 1U9NA 3ECHA 2EPFA 2K40A 3HIFA 3PO2J 2EK5A 4D1QA 3OL4A 2K9LA 2CYYA 5TGTA 1B9NA 2G0EA 1HDDC 2HPIA 2DFEA 2LLKA 3KYDB 3WTZA 4UB8C 1T0FA 1OCPA 2K5CA 4G9YA 1JTXA 1WPKA 3LSRA 3W6JB 3SDGA 2V79A 2IW5A 3SZPA 3KLNA 4ZYHA 1N77A 1MJBA 1RETA 3GYHX 3VYUB 1D5VA 2K3PA 2D5VA 2GIZA 2HVRA 3RI4A 2VJ5A 2IGMA 3DKYA 2ZO4A 1YITI 2NS7A 2HGCA 4CICA 4HQMA 2EZHA 5HDNA 4A12A 2EV0A 1ULYA 1SFUA 1AKHA 3CJTB 2DMPA 5EGOB 1RPWA 2K9MA 2X6XA 1EH6A 1BI2A 2QLZA 4ZZLA 3VB2A 3L09A 3TBIA 1R5ID 3V4GA 1CQTA 1S29A 1YO5C 2F6CA 1WWXA 3WU1B 1BC8C 2H09A 4BUPA 4A0YA 2GXBA 2KRHA 4L0ZB 2LVSA 3LSPA 3QAHA 3CUQB 1I6HJ 3ZQFA 4ITVA 2HYJA 2OQRA 1IN5A 4FT8A 4ZZDA 1H89C 1YW7A 3DEEA 4NQWB 1K4SA 2E34A 4NC6A 5JVGF 3S3MA 1H88C 2ECCA 4MO7A 3D5SC 4LB5A 4A69C 3VOEA 3JRBA 1X1BA 1O7LA 2KMUA 4W97A 4FX0A 2NS8A 2ADUA 1GT0C 2M4KA 3X2QH 2PN6A 3CESA 2EV5A 1XG1A 2XB5A 4AC0A 4I76A 1IV6A 2CUZA 3DPUA 1ON2A 1I5ZA 1WJFA 2E1CA 3U21A 2ZC2A 1ETYA 4XRSA 1HSJA 4KNYA 4OWRB 5H6QA 4IHSA 4Y7NJ 3QWLA 3HM5A 1YX5A 3GW2A 2UV1A 3QPHA 4NDLA 2FUG2 2PJPA 2D1VA 5CKTA 1R22A 3DPTA 2MABA 3J7AO 3CMEI 2P7CB 4LLLA 3R6SA 1O3RA 2XKOA 4Q5SF 2W85A 1V5GA 3KX2A 4UVBA 5TISC 2L7ZA 4CHUA 1TWHJ 3M7GA 4Y52J 1MMDA 1MMAA 1I3AA 3CCJI 5KNLA 3ZMSA 4RGXA 3IC7A 3HB9A 2HFHA 3E5QA 4LLNA 1VI0A 3BG7A 1Q1VA 2RGVA 4X1EA 5HNHA 5E3MA 4BQOA 2R7DA 3CJQB 1T38A 1D1AA 2HQAA 5CQEA 4BQQA 4EEFG 2M8EA 4UVCA 1Z77A 3H35A 4D5CA 3LFUA 2ETHA 2H1LA 1ETWA 4D9JA 4WK8F 5L3CA 1E3PA 4KYWA 3CJNA 2RQQA 1DUXC 3H5RA 3BR1A 2OZUA 4EMSA 2PEXA 3ZN0A 1FYMA 1HC8A 3SHFA 4G6QA 4A3LJ 2L4MA 4A6DA 5J47A 4GGGA 1BI1A 1BR4A 1KQ9A 2DMNA 2VOPA 2LDUA 2XPVA 1GHCA 1NG6A 1SVMA 1XGOA 1YE9A 2QBYA 1D8KA 3B6AA 5GADJ 3PL8A 4HNTA 3W2VA 3BG9A 2R7WA 5E1XA 1XSDA 5IY5H 2E1MC 4DBQA 4UVAA 4R79A 1YJNI 5ILVA 1Y56A 2GZWA 2B7EA 1Z7LA 1XMXA 2F5DA 1QA6A 4N9IA 4DW6A 2WADA 2CUFA 2EZKA 3MZHA 2X1EA 5K5QA 4LMYA 2XAUA 5GPAA 2DT7B 4WXHA 5HOOA 3F8CA 2PLYA 4RB1A 2A69F 3IWZA 4UXNA 4N9HA 2LMDA 3K1MA 4KN7X 3ZPLA 3OS1A 1YRNA 1ZLKA 1H8AC 3JRDA 3OSGA 2HYGD 3O8GA 3J7ZI 3BWGA 1MGTA 2Z99A 1MZBA 3OMYA 5EJCA 3RZDJ 3S1NJ 4HX8A 4BHCA 1IGNA 3N05A 1P92A 4LFUA 4HEA2 4JOMA 4GYGA 2LKPA 4Y4RA 1FNNA 3FMRA 1PUFA 2EILH 3LNQA 1TWFJ 4G6TB 3BTJA 3A0BC 1FP1D 3Q5FA 3KP2A 4EQQA 5K7HA 4L18B 2WV0A 2H1KA 3L1PA 3BJ6A 1TT5B 4XLNF 2L2OA 3MCZA 3MQ0A 3UR3C 2STWA 2ZNZA 3H3UA 4FETA 1NTCA 3K9TA 1UB9A 1XCBA 4MQVA 4F93B 1ZARA 1HW1A 3U1DA 3WGGA 3HEFA 3DBLB 1XX5A 4S05A 3CC4I 3LOCA 1F1ZA 5FGMA 1E2XA 3QP5A 1HQCA 5E79C 4DQ2A 1E0EA 3CD6I 1OCZH 3KEYA 5LFAA 1MBGA 1A04A 2VBWA 5D8KB 2W7NA 4EGYA 4DIQA 2VPRA 2X6YA 2XSDC 2OZ6A 2FE3A 1X4PA 5M5WJ 1EV7A 3FIWA 4MFEA 4HDUA 3CUOA 5GPCA 5F0FA 2F5FA 1J9IA 3DKWA 4FX4A 2V6CA 3G1OA 3LAPA 3HTSB 5DM7F 2BY1A 2V1XA 2Y0SN 1P9QC 2MGQA 2GAUA 2RREA 4ESBA 3JRAA 1R23A 2O8XA 1PJRA 3K7AJ 2BHYA 4WWCA 3EDPA 2LRDA 4YELA 2O61A 4XSZF 1CGPA 1T98A 4YIRX 2QWWA 1BOBA 1K6YA 2HXOA 2R7OA 4M3EA 2BHZA 3CDIA 3IP4B 5TJJA 5IT9Z 2LSOA 2W1OA 1GLNA 3IV5A 4E7IA 5BOXA 4F3QA 1XS9A 1QU3A 3BPXA 4KT6A 4UV8A 1DQUA 5CYVA 1TTYA 1ZN2A 5HVQC 2BY3A 4C3JJ 5DEQA 3H5NA 3M1CA 3QYFA 4BY7J 1WKMA 2L7KA 1SEUA 4KIFA 3HOUJ 1OCCH 1R4NB 1LQ1A 1H9TA 1U78A 4XNFA 2DTRA 2FBKA 3H0GJ 1Z3YA 2OAZA 1IG7A 2IA2A 3WE2A 1HKSA 1KQ0A 3BDDA 1FMWA 2W82A 1LE8B 2L5QA 2YX7A 3E6CC 4FCYA 4DYRA 1B4AA 2VXDA 1DU6A 4LB6B 2DXIA 4N4OB 1WCMJ 5EEGA 3G1MA 3WTTC 3OYGA 1MH4A 2JA8J 3OR1C 4OAZA 4WX9A 3W2WA 5B66C 1VQ8I 2HZTA 1R49A 5DCMA 2Z9OA 3S1MJ 1TWGJ 2JRTA 1Z9CA 2HNHA 4FHTA 1ZRCA 3P7NA 3QQAA 3H92A 5JR3A 1P2FA 4XKCA 1YQAA 2KIFA 4U88A 2UXNA 3TQNA 3TO6A 5E18F 3E0JB 1X3UA 4IXAA 1HCRA 1SD5A 4Q47A 2KIUA 1IN4A 5L3BA 3W6VA 1S3JA 3SEQA 2QA4I 2CQ7A 2BVMA 2EFPA 4M74A 1FY7A 2FU4A 2DLLA 3VPRA 3G6EI 3SJMA 2FOWA 4DGWB 4DZPA 5GTIC 1SD6A 1Z6TA 4MHGA 5C4XJ 1SC7A 3FXQA 4FE7A 4CZCA 4O6JA 1XSXA 1D0YA 2A3SA 1U6GA 1OCOH 3HJEA 1IRFA 1XMKA 2MBFA 3EUAA 4ON0A 2GXAA 5FKLA 2VC0A 4QWQA 1X4OA 3L00A 2QBYB 1XD7A 2IS1A 2ZCWA 4M3DA 1R5HA 2A07F 3K69A 2GA1A 2E2JJ 1U5TC 4A3DJ 3AG2H 3HGGA 3QOEA 4A3MJ 3H1CA 3GFMA 2O6GE 4B09A 2Y31A 3GMEA 3RSNA 1FTZA 2VN2A 4M72A 3F8MA 3H9JA 2ID3A 1R1TA 3I5UA 2KQRA 1G3SA 1K83J 2Q1ZB 4GYIA 2YX4A 3F9KA 1G6NA 1NG7A 3GF2A 2K9NA 5DUKA 4DNCA 1AA7A 2M0CA 2H6BA 3BP8A 1BM9A 2DFHA 4FE4A 4RB0A 4KN4X 2E19A 3COAC 2KIQA 2LFBA 1OYYA 1UCRA 4FQGA 3NWTA 3GTLJ 4A3CJ 2FD5A 2LY9A 3REOA 4QPQA 2OJED 5FRNA 1MBEA 1MJAA 2K9SA 5DTDA 1ZREA 5J40A 4L5EA 2HQRA 4II2A 1HXDA 2OBPA 5EGOA 2E1OA 2ZFUA 4ENJA 5E1ZB 1SFOJ 2DDBA 2M5WA 4P5OA 3A1YA 4M3FA 5KAFC 5BPIA 5FFXA 2DCEA 2DA4A 1ZK8A 5IT9K 3FDYA 2XGEA 2EZLA 2DQRA 4I2OA 1MD0A 1M1EB 2BBYA 2JTVA 4CXFA 3BQYA 2QSGX 4KIBA 5DDGA 4ZH4F 4KDPA 1PUFB 4R8HA 4A0XA 3ABLH 1VF9A 2NNNA 4AYBA 1ZGAA 4B4CA 1B59A 2EB7A 3TKYA 3V7RA 1TC3C 4JX5A 4QLCU 2MH9A 1ETVA 3F23A 2XIGA 3SDBA 2M7BA 2VE9A 1HOMA 4NHJA 4KMUX 1S7AA 2BW3B 1TL8A 1QVUA 4PSWA 3Q0WA 1BIAA 4HNVA 3CF5F 5F08A 4BU2A 4B3AA 4BBSJ 3OYMA 2ZFWA 3ZRGA 1N75A 2QQ9A 1T33A 5FLVA 3DWLE 1OQYA 1ZG1A 2RNJA 2LF8A 4E7LA 5FLXK 2KRCA 3K70D 2DDAA 2DK5A 1R00A 4B1RA 1ZTRA 5F27A 1XGSA 3MWMA 3HXLA 4IRHA 1R1UA 2LBFA 2DA7A 2HVSA 2AQEA 2VKDA 1IRZA 4ZC3A 1VFCA 3K1PA 2HZDA 4BJ6C 5J6XA 4N0BA 3MD2A 1FIPA 3FXJA 3LQRA 4WXCA 2WAFA 1D0ZA 1Y0UA 5M3FJ 1F5TA 3JREA 2PMHA 2CV0A 3W2AA 2VUMJ 3IHUA 2DPDA 3A2KA 1TNTA 5D4RA 2OC6A 2AXLA 2MC3A 1P6RA 4M71A 4Z6YA 4ETSA 3I59B 3Q9SA 5BS6A 1T8IA 1JKQC 4M9XA 2HEOA 2JVHA 2CWEA 3TL4X 4EM0B 1MSFC 1ONVA 1VQKI 4HSTA 2ZSIB 4PGHA 2QQBA 2VQHA 2PFBA 4S0HB 3VWBA 1HDPA 3BTIA 1I3QJ 1X1CA 1HBXG 4PDKA 2P5LC 2VT3A 4A5MA 2QZ8A 3D0SA 1NHAA 5ILSA 5H20A 1ZH5A 2R7VA 3FM3A 1OPCA 4I99C 2GXGA 3CF2A 5GP9A 1W0TA 2M87A 3HDDA 3DEUA 4IF4A 3R4KA 1ACIA 2L4AA 1DP7P 1R6RA 4O3MA 2V9VA 3RQIA 1QGPA 1JTYA 3G1LA 1P4WA 3JRIA 3ZQHA 3DTEA 1UFMA 3DCFA 1O3SA 3BZ6A 2JK3A 4IHXA 1QZYA 5M5XJ 3DLAA 3FXLA 1W5TA 1YG2A 4P1WA 3ROUA 5IOZA 1GXQA 2QM3A 3I53A 4IOAF 3OIPA 3J81K 1Y1VJ 4XLFA 3CZ6A 3BQZA 2IA1A 1EJ9A 4PCQA 3BOQA 3CO6C 3Q9VA 5HDKA 1PDNC 2Z1DA 4B44A 1FSEA 2UXXA 3AL0B 3F21A 1X1PA 1RRJA 1GUUA 1TQMA 1U0JA 3FISA 3C2BA 3F8NA 1U5TB 3KEOA 1S6LA 4BACA 1IN7A 1O3QA 4Y15A 3CDHA 1REPC 1X1DA 2CQNA 2M8GX 3N97A 1FWZA 3K0LA 4AUXA 1P7IA 3BCBA 4M3GA 4U0WA 4NBQA 3TO9A 3GXOA 4J19A 4UY8I 4MTEA 4KUMA 4PJ0C 5D6FA 2XAHA 4RAGA 2AQFA 4XIDA 4QTRA 3B73A 1KU7A 3OS0A 3O8HA 3AKZA 3OYDA 2M9HA 3F8BA 2JPCA 1PP7U 1V3FA 5AONA 5HNFA 2ZJ2A 2DJIA 1WH7A 1FYKA 3OYEA 2IP2A 2RC4A 3QPSA 1X3ZB 5F0HA 1ON1A 4X0GA 5BMZA 3DTIA 2X51A 4NC8A 1D1CA 1JUPA 3HSRA 1K78A 2W00A 5HDGA 2LF7A 5B1AH 4EJVA 4I0BA 1W7PA 4XOPA 1MMSA 2VJIA 3WU0A 3U1KA 3SFZA 3JR9A 5IT3A 3JSOA 3K4JA 1YRNB 2E2HJ 4RM2A 4GCVA 2Z5UA 2C6YA 5EYRA 5LHHA 4RM3A 1W0UA 2X1DA 4YEJA 1IRXA 1UZCA 2PBIA 4LLGF 2WAQN 3W6KB 4OIRF 4G6DA 3NQOA 3FXMA 4KMFA 1OMIA 1FC3A 2JUCA 5FD6A 3MKYB 3CLOA 4BKXA 3FXOA 1J2XA 1B72B 4Y17A 1ETXA 5EZGA 1OR7C 4RLFA 1ZHFA 2YU9J 5J8FA 2DOAA 5FKNA 2EBIA 2CV2A 5IYBJ 2HI3A 3F6OA 1MBJA 3GTMJ 5DD8A 3LSMA 3CC2I 1LFBA 2BEOA 4PZJA 3WHBA 3NAUA 2E36A 4G8XA 5LD2C 2XRLA 1LEBA 3R0AA 2R7TA 2YU3A 4FISA 2K9QA 3QP6A 2GOMA 2XGDA 2E35A 2JSPA 4CSWA 1WJEA 3LSGA 5E3LA 4IRIA 3HOWJ 4EV0A 4DJAA 1BIBA 1WJDA 2JMWA 4AM3A 1MNDA 1QHGA 1ZYRF 4IRGA 1MMNA 4U0YA 3S1QJ 2Q8KA 2WAEA 1IDYA 2Y75A 1USTA 4EJOA 1HKTA 3ZQQA 1S7EA 5H2FC 2VODA 1DP3A 2BVLA 4A2UA 1D1BA 3LL7A 1N25A 5J1RA 1XCVA 3GFLA 1B9MA 1FPQA 4KJZA 3HKZA 3L7WA 3LWFA 5DD4A 3Q3SA 2B0LA 4RLQA 3OIOA 4XM3A 2LBFB 3GTQJ 1LE8A 3FXKA 1TP4A 3IUOA 1ORKA 3JAMZ 3LSKA 3F72A 2O8KA 4J00A 3GLLA 3LSJA 3ZQLA 3ABUA 3LSHA 4Y33A 3DBHB 2LR8A 2YPRA 2DA2A 2EFOA 1ZG5A 3KETA 5ED4A 3ASNH 2GWRA 4IEJA 5C44J 4MEYF 4ENMA 2LP0A 3ISPA 4ZTJA 2H6CA 1MBHA 2HWVA 2LKSA 5FROA 1Z21A 2N8GA 2F4OB 5K5OA 5CVUA 5L3DA 2X4HA 3PQJA 2XB0X 4RAFA 4HQEA 5C4JJ 2B9SA 1UG0A 3GZNB 3I58A 5LHIA 2E60A 4D0PA 1TQPA 2MLGA 2VIXA 1XDUA 3CLQA 1FOXA 1S7OA 2VE8A 4BXXJ 3S15J 1T6SA 3CC7I 2DO7A 1BL0A 3CCQI 1FBSA 1UELB 2W4SA 4KA4A 2W25A 3EUHC 5DCFA 4DBRA 1FOYA 2KT0A 1Z1DA 4E7KA 5EG0A 2R7ZJ 2W48A 1BOAA 2V9PA 5F1JA 3S2WA 1T08B 4IVNA 4RAYA 5DYMA 1O4XA 5FD5A 1VQ4I 2NXNB 3QOPA 2DOEA 4IHVA 3TP0A 2MC4A 3KZZA 2M7AA 4JX4A 1RR7A 3HOVJ 4PJNA 3KFWX 3IAS2 4RGSA 2DN0A 4E4HA 3PIPF 3CJRB 4NB5A 4I98B 4U87A 4CH7A 2DQLA 4CYDA 1VQ5I 1TT0A 2EINH 1FOWA 4M73A 2VBXA 3GO5A 2M3AA 3EQLF 3S93A 4BJ5C 1PYVA 4C9YA 4E7HA 2VPLA 4CGZA 3OS2A 3R60A 1IDZA 3C3WA 2ZJRF 4P96A 5HLTA 5GTHC 4BE0A 2VONA 2R7XA 3DFGA 1MH3A 4MNUA 2EWNA 3ZGKA 4CCMA 2FA5A 4HZFA 4MIMA 4H4KC 2WWYA 2F5EA 3P9KA 4MFDA 2DT6A 3L2CA 4XKWA 1O57A 2ICWG 2W24A 3WODF 4OIQF 2CU7A 3IWFA 2EIJH 1G8XA 3G73A 4OOIA 5B1BH 4NUBA 2E7WA 3PUFA 3LSTA 3ML6A 2ECBA 5LBQA 4LGWA 2QF7A 4P55A 4F52A 1IN6A 2XF5A 1U3EM 2Z3YA 2K02A 1A31A 2P5VA 3CMMA 3A4CA 2VASA 4BHBA 4D7NA 1B6AA 3V7CA 1QPMA 3WTUC 2O03A 1IUYA 3PUBA 4BXFA 2JA5J 2OTJI 1IXRC 3GVAA 4LK1F 1K78B 2IJLA 2LH9A 2BW3A 3OL3A 5D6EA 1ERDA 2HVQA 1HW2A 1W7PB 3K4BA 2HPMA 3RPUA 3HC7A 2VB6A 2P8TA 4KITB 3ERMA 2FMLA 2QSHX 1ZELA 3J80Z 2BOLA 3RKYA 1R36A 4ENNA 1U8RA 3FK6A 4C2TA 3GBGA 4IL6C 1XN7A 5KAIC 5FJ8J 1IN8A 1MNMC 4XOTA 3HOTA 3I3LA 1I27A 4I6ZA 3PNTA 2HOTA 1JXSA 1XB4A 3DKXA 1ZLJA 1OJLA 2VL8A 3A01B 4HG2A 1BJAA 4PJMA 2G7UA 3T0YA 4W1UA 2X0LA 2FOKA 5FKOA 5DV5A 1DDNA 5H6RA 4J01A 1STZA 4ZDOA 1VQ7I 3C2GA 3BC8A 2GBYA 3GTKJ 3ULQB 4ZDLA 2LK2A 2OUMA 3CCVI 4UNOA 4OMYA 1QZZA 3I59A 5L3EA 1POGA 2WY7Q 1LJ9A 2CUJA 3NEUA 1RR8C 3ZOBA 3ZQ7A 3T5XA 2XSJC 4HA8A 2ZB9A 1ETQA 4LG0A 1H0MA 1IXSB 3ELKA 2FEZA 3G71I 2IAIA 3EUKL 4A3GJ 2ZMEC 2R0QC 4KFCA 3C7JA 3GX4X 1WVRA 1TW2A 1S5LC 2YUSA 5HS9A 3PJRA 1GVDA 4UV9A 2IXSA 2QYOA 4B48A 2WC2A 4CCNA 3H5AA 5KVRA 3JRHA 2XHKA 1WJ5A 2KISA 1FEXA 1YS7A 1BC7C 2CGPA 2GIVA 3K4CA 2DOFA 4FTHA 4EGZA 1WI9A 1J5YA 5FO5A 3FMQA 3ZR8X 4F7ZA 1QRYA 1B8IA 3FMSA 3S8PA 4EVIA 2HOSA 1KONA 3QU6A 1SMTA 5CVRA 3HBLA 2E1NA 2K27A 4C3IJ 2L54A 2G7HA 2ME0A 4V2FA 2KLOA 2RV8A 4UUSA 3OYHA 3FM5A 3BROA 1A35A 5ERIA 4DZJA 3OYKA 1I50J 1MKMA 3TO7A 2KDZA 3MKWB 4XSXF 3RJPA 4A6EA 4RB2C 1A6IA 3H36A 3K4KA 5M5YJ 3E1SA 3SFIA 1U5TA 1PVEA 5F64A 4H0EA 2E1MB 4XLAA 3WTSC 3I4PA 5J4VA 2R92J 1MJ9A 1TW3A 4LITA 2V26A 2MD0A 4N4NB 2FQ4A 1LDJA 1G4DA 1LUJB 1OCRH 3SXYA 2FNAA 3OYLA 2V1UA 4LG3A 3BR3A 2Y2ZA 2XGCA 3OYNA 4BDZA 3I54A 1YLFA 1SD4A 4I7HA 3N4MA 3LFKA 1E17A 1SMYF 1Z6RA 2A61A 3J7YJ 1FSHA 2V7FA 4XLEA 4BEHA 3OIQA 1ZKGA 3S2DJ 3ZMVA 3K10A 3AG4H 1W4MA 3QU3A 2LD5A 2JUGA 2GM4A 1MIJA 2ELKA 2IGNA 1YHQI 4WCGA 3S1RJ 5EG0B 4PGGA 4A93J 1BI3A 5E3NA 1I6XA 1ZGWA 2A5WA 2ZXIA 4EJWA 1JKRC 4EATA 3GFJA 4E6KG 3OY9A 2OA4A 1D3YA 2I8DA 3J80K 3GLXA 4DOZA 5ICGA 2JSCA 2JZYA 3O2PE 4K2EA 3ZQGA 5FKKA 3HHHA 2TRTA 2EFNA 3TOBA 4HBLA 4A3KJ 4RBOA 4HX4A 1ITYA 3DLLF 1UJ8A 1I1SA 1OYWA 3FKJA 4OIOF 1XTAA 1CF7A 3S3NA 5A2QZ 2E5NA 5ICEA 2P7VB 3MFKA 2CQKA 1BBYA 4ABZA 4XK4A 2X6OA 4IJAA 5LGUA 2ID6A 4CA0A 1YJWI 1JHFA 1GXPA 2V9KA 1B72A 2XAQA 3G2BA 3KYCB 1DU0A 3E6BA 4XL9A 2QKLB 3HRSA 3LA2A 4M6XA 1NK2P 2DA1A 1XMAA 2IBDA 4BGDA 4F91B 2JQ7A 2NVXJ 2Z33A 2COMA 1UAAA 2B63J 2HYFA 2UUZA 1KU2A 3TGNA 2EIMH 2L9SA 5CJ9A 3J7AY 1KU9A 2F4MB 1RKWA 1F43A 3F22A 1G3TA 3GTPJ 2KDOA 1WJAA 2RKHA 5HLHA 2RVCA 2YS9A 2VQCA 3KEQA 1ETKA 5L3FA 3KYLA 3HRMA 2HTJA 2WB1A 4PFPA 5ILUA 1Y39A 1VNDA 2PMZA 1TZLA 2VKHA 2OCCH 1JGSA 3AFHA 2V4JC 2Y9ZA 3CDLA 1ZRFA 5JI6A 3WGHA 1AOYA 2L3DA 2HQNA 4IHWA 4KISA 3HTUA 2DODA 3KCCA 3GFIA 3CP2A 2EA4A 1QHHD 1YX3A 2OQGA 2V1NA 3L2UA 1OYIA 4JYKA 3PNYA 4LD5A 1ZAOA 2EZIA 2TDXA 3HL2A 2KRFA 3FF5A 2UZKA 3BPVA 1V4RA 4ENKA 1LFUP 3TMOA 3EPZA 1T2KA 5E17F 4YIFA 2ELJA 4XN3A 4HDVA 3PFIA 1APLC 2FRHA 3GZ5A 3RYPA 3L2VA 1YS6A 2FX0A 2RDPA 2GA2A 2O3FA 3KZYA 4ZYGA 2VT2A 2RAEA 3M8EA 4XRSG 1E3HA 4X6AJ 1LDKB 3M9AA 4PJJA 3WE3A 2AO9A 3TW6A 3DTKA 2JJ7A 4CCLA 5LHGA 3S3OA 1EA3A 4AYBN 5D5XB 2ISZA 3IH2A 5TRDA 2L7FP 3PSFA 1U8BA 1WSUA 1YFHA 3CCYA 3CUQC 1G3WA 2FF4A 2ZSHB 3ABTA 1QPIA 1FT9A 3V42A 5B3SH 2XAJA 1JI8A 2VQLA 3MN2A 3NRVA 2F5CA 5LGTA 1FZPB 1TWAJ 4CYCA 5HS8A 4LG0B 2MFZA 4HRIA 2R5YA 4ESFA 4QIWN 4IQ4A 4A3JJ 1AHDP 3FZVA 4HF2A 1F36A 2A68F 4YIIA 4L9NA 5L3GA 3DQVC 3HSEA 1JKOC 1RNLA 1EKEA 1KA8A 2R4GA 3BG5A 2NVTJ 2CO5A 4XLPF 3K2ZA 1RZ4A 2XDVA 4XLCA 1SANA 1IV8A 1BN5A 1DGWY 3BG3A 3DEWA 2UWMA 2L0KA 4HLXA 4G7OF 5F0CA 4BS9A 1AU7A 2BGCA 4BE2A 1LNWA 1B8IB 4L0YB 2P5KA 4ZJZA 1T39A 4LJZF 5IP7J 2R7QA 5J3LA 1BR2A 2HXIA 5A2QK 1PP8F 2L9NA 4AU7A 3QYEA 1ZR2A 2R3SA 2PX9A 3QRFF 1NH3A 4BQAA 4UUSB 2Y69H 3K1NA 1TQIA 4GDFA 5HS7A 2P0WA 2DFIA 5LGNA 5JHUA 3IAM2 2EJRA 3RZOJ 2DTZA 3BR2A 2G9WA 3DPLC 1X2NA 5LRSA 3VSLA 2HDWA 3ZP5A 2KFDA 1KQ8A 3HOSA 2QVOA 3PQKA 3WU2C 1RKTA 1W36D 5FKMA 3NWSA 3LA7A 2PJRA 3HOYJ 3FK7A 2YSRA 2QEXI 4XRMA 2XPUA 3E5UA 2Z2SB 5AIQA 1SVLA 2Z16A 5ICFA 4IO9F 3R61A 3PFYA 2JPBA 3FHNA 4E70A 1FOKA 4Y13A 1GDTA 1Q1HA 3VFZA 4BEHB 3ONQA 2OTLI 2DFFA 2X85A 4OAYA 1X1AA 3ERED 4U0VA 5FFZA 3DU6A 9ANTA 3G3ZA 4MTDA 5CLSA 3SZGA 3JTGA 1KGSA 4XONA 1OR7A 4HOBA 3MZYA 4HPQA 2OPTA 4YG2F 1Y0NA 2Q2EA 3BJOA 1K6OA 2PG4A 3EYIA 4I02A 3JTHA 1IF1A 3VYTB 2CFXA 2IGKA 4A3EJ 1X19A 3ZQIA 1TWCJ 4S04A 2JWTA 1W1WE 2GOXB 3BJAA 4C2MJ 3I71A 5LEJA 4NC7A 2NS0A 3HOXJ 2KL4A 4UUTA 2DA6A 2XF7A 4IX7A 1CF7B 1QBJA 4DYQA 1GV2A 2WV1A 4HNUA 3L9FA 1LDDA 2ISYA 3T8TA 3CCLI 1G3YA 1TBXA 5EZHA 4ZTFA 3I9V2 2X1CA 4II3A 4MGRA 1R9TJ 1Y8QB 2XGXA 3CQZJ 2XRNA 2V1DA 3OR2C 3A01A 3H0DA 3QPLA 1OISA 2J5PA 3V7SA 4B47A 1MMGA 2VBZA 3M8FA 1R7JA 3BY6A 2QCOA 4HX7A 5J1UA 2D1HA 3OYIA 2DW4A 3JRCA 2XROA 2ESNA 1IO2A 1MW7A 1HW5A 4C30A 2FBIA 3TOAA 5J1YA 2DA5A 4XLHA 2XV4S 1LKXA 3A02A 1FYLA 2P81A 1ETOA 5F04A 4QPOA 2XAFA 1Y8RB 3PNVA 5LRRA 2CFOA 3CCRI 1RI7A 1Y6IA 2LC2A 3KE2A 2RNGA 3HSFA 4E7JA 4U7DA 4JBAA 3P9IA 1ZR4A 4JP0A 2MSYA 4GO1A 2VJJA 3CCMI 4CO8A 3ABKH 5JFRA 2K85A 1T0FC 3EETA 3DV8A 1P7JA 4M3BA 2L9VA 4F92B 2JVGA 4Q4ZF 3C18A 2YR2A 4BNCA 1LEAA 5D5VB 1HSTA 2MA3A 4ZDPA 4A0ZA 3BG6A 1IW7F 2DJNA 2CV1A 2H8RA 1Y1WJ 3KP6A 2M0MA 1PUEE 1MSEC 3JCUC 3D1NI 3H3VK 3ZMZA 3LA3A 1J0RA 1BI0A 1SAXA 5F1RA 3EUHA 5BPDA 1FX7A 1B1BA 1NK3P 4OIPF 4IPAA 4EM2A 2I10A 2AS5F 3VDXA 4GXOA 2EFWA 5E1WA 4LIUA 4CCOA 2LREA 1FLIA 1ZGJA 3SYTA 4QSHA 1H9GA 1K79A 3KP7A 4CZZA 2HKOA 5K7ZA 4D7MA 1KYWA 2OF7A 4I0AA 2DMUA 2CW7A 5LLQA 5FB2A 2L02A 1ZRDA 2F2EA 2NOJB 5FLMJ 1Z0XA 4CYCB 2NVYJ 2R5YB 4XKBA 3GEZA 3FHZA 2L01A 1JT6A 1MBKA 3VODA 4BDYA 3HUGB 3GWZA 2ZXHA 1J75A 1UHWA 2COBA 2BYVE 4AIJA 5LEKA 2CW8A 1DPUA 2HQ5A 3BZKA 3PIOF 3HKZN 2PMUA 2JA7J 3HPGA 3OYAA 5IYDJ 2KHMA 3MEXA 3WG7H 4BJTA 2IS4A 2ACJA 3K4LA 4F55A 2F48A 4MQ9F 2WTEA 3TEDA 3K70C 4L9TA 4A3BJ 2OU2A 2OD5A 4BYYA 2IT0A 2CH0A 4UHTA 3IKTA 4HLYA 2WBMA 5DS9A 3E97A 5CVIA 3O6BB 3RCOA 3M07A 1R71A 4CDGA 3WGIA 4V19K 5BNGA 2IS2A 1USSA 3E3VA 4E7SA 3GUDA 1WHUA 1K4TA 3B6CA 4FASD 1MDMA 2KJBA 1HA8A 4UUVA 4V2GA 2ZJPF 3KLOA 3M8JA 1WRJA 4RA2A 3T8RA 2W84A 3HGYA 3ZMUA 5D5UB 3OOUA 3M4OJ 2CUEA 4IHYA 4XR6A 1ZQ3P 3IRQA 4WXDA 5KHDA 2P6SA 3HYIA 5ICCA 5E8GA 4KT5C 2RN7A 4HV5A 3FBIB 2PJRB 1SVOA 3MKLA 3QYBA 1FBUA 2A5YB 3DXJF 3WTVC 5D4SA 2KP6A 3BR6A 3OYCA 4M9ZA 2M30A 4HF0A 5EEAA 4L9JA 2CRGA 5HODA 1GVJA 5K5RA 3ECOA 1IZ1A 1JUMA 2JN6A 2VBYA 1XPXA 4AD9A 3CCSI 2Q0OA 5FRMA 4XICA 1QZEA 3G4SI 1I1GA 2EH3A 2A6TA 3RQ4A 1LVKA 2QUFA 3OWTA 1SFEA 4RS8A 3JRFA 3ZXSA 1JT0A 1SFKA 4YFXF 1MNEA 1MBFA 3AG3H 2VOOA 2XUBA 3FBNB 2BE5F 3HPHA 2Q2EB 3AAFA 3CTAA 2DI3A 1WJBA 1DPRA 2IVMA 2VI6A 3GTOJ 3K4NA 4DYCA 2DT5A 1BA5A 2VC1A 2Y0SA 3EYYA 3FX3A 2AHQA 5D5WB 2EFQA 3BR5A 2X9DA 3E5XA 3PM1A 3KP3A 2MD5A 1FBQA 3A03A 4AIHA 3IH4A 1OLTA 3SEZA 3OOPA 3OV8A 3JAMK 2M2EA 2RQPA 1IC8A 3RTRA 2KPMA 2HDCA 2H8WA 3ZN1A 1VQOI 2MG4A 3PSIA 2ZKZA 2XKPA 4LOCA 5IPAA 3CCEI 4IOCF 3MKZA 2IGOA 1UMQA 2KKOA 2ZMEA 4L9VA 4PUSA 4OU0A 1D0XA 4AVPA 1W36C 1O7FA 2WY8Q 1UHMA 2FMYA 2IS6A 2ZXWH 2NVQJ 5DUIA 5HLGA 4BAYA 1P4XA 2QENA 3QODA 5JLWA 4XORA 4ASNA 2DAOA 5BQTA 4GRIA 1VQ9I 3R0JA 2XVCA 1WH5A 1HF0A 5IP6A 5GAHJ 1KZHA 1WJCA 3HRTA 2ME6A 3UNGC 2P4WA 2W57A 3HZJA 3BTCA 2HU9A 4IQJA 4BL0B 3FXUA 3CP8A 2A05A 2NRAC 1A6QA 2ESHA 3IL2A 2M4GA 1AKHB 2R93J 3AG1H 1RUOA 1R58A 3TDZC 1AWCA 5CVVA 2R7FA 4B43A 2MLKA 4XMYA 4P9UA 3CO7C 5EDNA 3BZCA 1Z3XA 2IA0A 2HDDA 2BZTA 4JK1X 3I55I 2R5ZA 3C1DA 3K6GA 1V5FA 4HV6A 4L5IA 3GTGJ 3TDUC 5JVTA 1VQLI 1W5SA 3RKQA 4R1HA 4BXUA 1XDSA 2VJ4A 2MH2A 2HOEA 2HR3A 1FP2A 1D5YA 2PI0A 2DU9A 2NVUB 4CCJA 5M3MJ 1YW9A 3I4NJ 2EV6A 3DP7A 1EF4A 4XRFA 5E20A 3IH3A 3K4MA 3RYRA 1VZ0A 1WQ2A 2DYRH
chains in the Genus database with same CATH topology
4M9SA 1D8JA 4OMZA 3B02A 4ESJA 2Y0MA 3O3KA 4BHPA 3JW4A 1S8NA 4ZYEA 5FLXZ 2K86A 1Z7UA 3RDIA 4WF2A 2NNYA 2ZXJA 3LAJA 2M1BA 3VEPA 4MEXF 2XASA 2K4BA 2HTSA 2LNBA 2BV6A 2DK8A 2O0YA 1ZG3A 4I01A 1J59A 1O3TA 5AIPA 4AWXB 2CSOA 3WTWC 1HKQA 3ZMDA 4JQFA 3KP5A 3F6VA 1EH8A 1W7PD 4Z2YA 3V8KA 1JHHA 3SZTA 4I09A 2J5OA 2IRFG 4HYEA 3GZ6A 2JT1A 1L3LA 1RUNA 3WTYC 1MDMB 3HHGA 2ZNYA 5CVJA 4Q48A 1TLHB 3RKXA 2DPUA 1KU3A 4G7HF 2H94A 3J81Z 4EJUA 1R1VA 4RGRA 1IRGA 3D5LA 3T1BA 3FWEA 4XBFA 2KJCA 2FBHA 3H3ZA 2P6TA 4EM1A 1VTNC 5D8LB 4U7BA 3SQNA 5EEHA 1XSVA 4IHTA 1OKRA 4B8XA 4YFNF 4KICA 3CUQA 3F3XA 3I0TA 1SD7A 2QQAA 2K7LA 2FSWA 2ELHA 3LQQA 4NQWA 2ZBKA 2CG4A 2A6EF 2IPQX 3P9CA 6PAXA 3M1EA 2ZMEB 3I64A 2K4JA 4HAMA 1Z91A 2FNPA 2FXAA 2D45A 4G7ZF 3WG9A 4M6YA 1L0OC 1RIOH 4A5NA 2A6HF 1LVAA 4HW0A 1F4KA 4LK0F 3KP4A 1JE8A 1IAWA 1K7AA 1ODDA 4OINF 1R5GA 3RPQA 1Z05A 3E6DA 1IXCA 3JSPA 1J7KA 5K1YA 3HUGA 1U2WA 2DBBA 3FXRA 1QO0D 4YFKF 2GQQA 2EA2A 1EH7A 1XGMA 1YTYA 2HKXA 5J8CA 2NAZA 4EJTA 2H27A 3U9GA 3E6MA 1QQIA 3ZMTA 1YIOA 4ZYDA 1KYZA 2Y48A 5E8IA 2PQ8A 2NYXA 1F9NA 1YW8A 3RIRA 3IRRA 1TNSA 3U2RA 4TV7A 4RB3C 4KIGA 4O5VA 4L5JA 3V8LA 1LB2A 4RGUA 2M45A 3RKWA 3HRUA 3DF8A 4RAZA 2STTA 5DCMB 1YYVA 1QNTA 5KK1A 2FQ3A 4P9FA 3V8JA 2VXZA 2HS5A 4AIKA 2KIMA 4HF1A 5F6FA 3MAJA 4BH9A 4G94A 2D2WA 1C0WA 1SFXA 3F8FA 3QPTA 1XGNA 2E7XA 1P4AA 3WTXC 5HLIA 2XAGA 3IKVA 2CW0F 3ECHA 3HIFA 2EK5A 2CYYA 1B9NA 3WTZA 1T0FA 4G9YA 3W6JB 2V79A 2IW5A 3SZPA 3KLNA 4ZYHA 1MJBA 3GYHX 1D5VA 3RI4A 2ZO4A 2HGCA 4CICA 4HQMA 5HDNA 4A12A 2EV0A 1ULYA 1SFUA 1EH6A 1BI2A 2QLZA 4ZZLA 3VB2A 3L09A 3V4GA 1S29A 1YO5C 1WWXA 3WU1B 1BC8C 2H09A 2GXBA 4A0YA 4L0ZB 3QAHA 3CUQB 2OQRA 1IN5A 4FT8A 4ZZDA 1YW7A 4LB5A 3VOEA 1O7LA 4FX0A 2ADUA 2PN6A 2EV5A 1ON2A 1I5ZA 2E1CA 1HSJA 4KNYA 5H6QA 4IHSA 3QPHA 3GW2A 2PJPA 2D1VA 1R22A 3DPTA 3J7AO 2P7CB 4LLLA 3R6SA 1O3RA 2XKOA 4Q5SF 2W85A 4UVBA 4CHUA 3M7GA 3ZMSA 4RGXA 3IC7A 2HFHA 3E5QA 4LLNA 2RGVA 2R7DA 1T38A 2M8EA 4UVCA 2ETHA 4WK8F 5L3CA 4KYWA 3CJNA 1DUXC 2OZUA 4EMSA 2PEXA 3ZN0A 1FYMA 3SHFA 4G6QA 2L4MA 4A6DA 4GGGA 1BI1A 1KQ9A 2VOPA 2LDUA 1GHCA 1XGOA 2QBYA 1D8KA 5E1XA 1XSDA 4UVAA 4R79A 5ILVA 2GZWA 2F5DA 4N9IA 3MZHA 5K5QA 4LMYA 4WXHA 5HOOA 3F8CA 2PLYA 4RB1A 2A69F 3IWZA 4UXNA 4N9HA 3K1MA 4KN7X 3ZPLA 1ZLKA 2HYGD 3BWGA 1MGTA 2Z99A 1MZBA 4HX8A 4BHCA 1P92A 4LFUA 4GYGA 2LKPA 1FNNA 3FMRA 1FP1D 3Q5FA 3KP2A 4EQQA 4L18B 2WV0A 3BJ6A 4XLNF 3MCZA 3MQ0A 2STWA 2ZNZA 3H3UA 3K9TA 1UB9A 1XCBA 4MQVA 1ZARA 1HW1A 3U1DA 3WGGA 4S05A 1F1ZA 5FGMA 1E2XA 3QP5A 1HQCA 4DQ2A 1A04A 2VBWA 5D8KB 4EGYA 2OZ6A 2FE3A 1EV7A 4HDUA 3CUOA 2F5FA 1J9IA 3DKWA 4FX4A 2V6CA 3LAPA 3HTSB 2V1XA 2GAUA 4ESBA 1R23A 2O8XA 4WWCA 3EDPA 2O61A 4XSZF 1CGPA 1T98A 2QWWA 5TJJA 5IT9Z 2LSOA 5BOXA 3BPXA 4UV8A 5CYVA 1TTYA 1ZN2A 5HVQC 5DEQA 1WKMA 4KIFA 1LQ1A 1H9TA 1U78A 2DTRA 2FBKA 2OAZA 2IA2A 3WE2A 1HKSA 1KQ0A 3BDDA 2YX7A 3E6CC 1B4AA 4LB6B 5EEGA 3WTTC 4WX9A 2HZTA 2Z9OA 5DCMA 2JRTA 1Z9CA 4FHTA 1ZRCA 3P7NA 3H92A 5JR3A 1P2FA 1YQAA 2KIFA 4U88A 2UXNA 3TQNA 3TO6A 5E18F 1X3UA 4IXAA 1SD5A 4Q47A 2KIUA 1IN4A 5L3BA 1S3JA 2EFPA 4M74A 1FY7A 2FU4A 2DLLA 1SD6A 1Z6TA 4MHGA 3FXQA 4O6JA 1XSXA 2A3SA 1U6GA 1IRFA 1XMKA 2MBFA 4ON0A 2VC0A 4QWQA 3L00A 2QBYB 1XD7A 2ZCWA 1R5HA 2A07F 3K69A 2GA1A 1U5TC 3GFMA 2O6GE 4B09A 2VN2A 4M72A 3F8MA 1R1TA 3I5UA 1G3SA 4GYIA 5DUKA 2YX4A 1G6NA 3GF2A 4DNCA 2H6BA 3BP8A 1BM9A 4RB0A 4KN4X 3COAC 1OYYA 1UCRA 3REOA 1MJAA 1ZREA 2HQRA 1HXDA 2OBPA 4ENJA 5E1ZB 2M5WA 4P5OA 5BPIA 5FFXA 5IT9K 2DQRA 4I2OA 1MD0A 2BBYA 2JTVA 4CXFA 4KIBA 5DDGA 4ZH4F 4KDPA 4R8HA 4A0XA 2NNNA 1ZGAA 1B59A 2EB7A 3TKYA 3V7RA 4QLCU 2MH9A 3F23A 2XIGA 2VE9A 4NHJA 4KMUX 1S7AA 1BIAA 2ZFWA 2QQ9A 1ZG1A 2RNJA 2LF8A 5FLXK 2DK5A 1R00A 1XGSA 3MWMA 4IRHA 1R1UA 3K1PA 5J6XA 4N0BA 3LQRA 4WXCA 1Y0UA 1F5TA 2PMHA 3IHUA 2DPDA 1TNTA 5D4RA 2AXLA 2MC3A 1P6RA 4M71A 4ETSA 3I59B 3Q9SA 5BS6A 4M9XA 2HEOA 2CWEA 4EM0B 1ONVA 4PGHA 2QQBA 2PFBA 1HBXG 2P5LC 4PDKA 4A5MA 2VT3A 2QZ8A 3D0SA 1NHAA 5ILSA 5H20A 1ZH5A 3FM3A 1OPCA 2GXGA 2M87A 3DEUA 4IF4A 3R4KA 2L4AA 1DP7P 4O3MA 2V9VA 1QGPA 1P4WA 1UFMA 1O3SA 3BZ6A 1QZYA 1W5TA 1YG2A 3ROUA 1GXQA 2QM3A 3I53A 3J81K 2IA1A 4PCQA 3BOQA 3CO6C 3Q9VA 5HDKA 1PDNC 1FSEA 2UXXA 3F21A 1TQMA 3F8NA 1U5TB 3KEOA 1S6LA 1IN7A 1O3QA 4Y15A 3CDHA 1REPC 3N97A 1FWZA 3K0LA 4U0WA 3TO9A 3GXOA 4MTEA 4KUMA 5D6FA 2XAHA 3B73A 1KU7A 3F8BA 2JPCA 1PP7U 1V3FA 5AONA 2ZJ2A 1FYKA 2IP2A 2RC4A 1ON1A 5BMZA 3HSRA 1K78A 5HDGA 2LF7A 4EJVA 4I0BA 1W7PA 3WU0A 3SFZA 5IT3A 3JSOA 4GCVA 2Z5UA 2C6YA 5LHHA 2PBIA 4LLGF 3W6KB 4OIRF 4G6DA 3NQOA 4KMFA 1OMIA 1FC3A 5FD6A 3CLOA 1J2XA 4Y17A 1ZHFA 5J8FA 3F6OA 5DD8A 2BEOA 4PZJA 4G8XA 1LEBA 3R0AA 2YU3A 3QP6A 4IRIA 4EV0A 1BIBA 1ZYRF 4IRGA 4U0YA 2Q8KA 2Y75A 1USTA 4EJOA 1HKTA 2VODA 4A2UA 1XCVA 3GFLA 1B9MA 1FPQA 3L7WA 3LWFA 5DD4A 2B0LA 3JAMZ 3F72A 3ABUA 2YPRA 2EFOA 1ZG5A 3KETA 5ED4A 2GWRA 4MEYF 4ENMA 3ISPA 2H6CA 2HWVA 5K5OA 5CVUA 5L3DA 2X4HA 3PQJA 4HQEA 3I58A 5LHIA 4D0PA 1TQPA 2MLGA 1XDUA 1S7OA 2VE8A 1T6SA 2DO7A 1FBSA 4KA4A 2W25A 5DCFA 1Z1DA 1BOAA 3S2WA 4IVNA 4RAYA 5DYMA 5FD5A 3QOPA 3KZZA 3KFWX 4RGSA 4NB5A 4I98B 2DQLA 4CYDA 4M73A 2VBXA 3GO5A 3EQLF 4CGZA 3R60A 3C3WA 4P96A 2VONA 3DFGA 4MNUA 2EWNA 2FA5A 4HZFA 2WWYA 2F5EA 3P9KA 3L2CA 3WODF 1O57A 2W24A 4OIQF 3IWFA 3G73A 4OOIA 2E7WA 3LSTA 3ML6A 5LBQA 4LGWA 4P55A 1IN6A 1U3EM 2Z3YA 2K02A 2P5VA 4BHBA 1B6AA 3V7CA 1QPMA 3WTUC 2O03A 1IUYA 1IXRC 3GVAA 4LK1F 1K78B 2IJLA 5D6EA 1HW2A 1W7PB 3RPUA 2P8TA 2FMLA 3J80Z 3RKYA 1R36A 4ENNA 1U8RA 1XN7A 1IN8A 3HOTA 1I27A 1JXSA 1XB4A 1ZLJA 1BJAA 2G7UA 3T0YA 2X0LA 2FOKA 1DDNA 5DV5A 5H6RA 1STZA 3ULQB 4UNOA 4OMYA 1QZZA 3I59A 5L3EA 1LJ9A 3NEUA 3ZQ7A 3T5XA 4HA8A 4LG0A 1H0MA 1IXSB 3ELKA 2FEZA 4KFCA 3C7JA 3GX4X 1TW2A 5HS9A 4UV9A 2QYOA 2WC2A 5KVRA 2XHKA 1YS7A 1BC7C 2CGPA 2GIVA 4EGZA 1WI9A 1J5YA 5FO5A 3FMQA 4F7ZA 3FMSA 4EVIA 3QU6A 1SMTA 5CVRA 2E1NA 2K27A 2L54A 2G7HA 2RV8A 3FM5A 3BROA 5ERIA 1MKMA 3TO7A 4XSXF 3RJPA 4A6EA 4RB2C 1U5TA 5F64A 4H0EA 3WTSC 3I4PA 1MJ9A 1TW3A 1G4DA 1LDJA 3SXYA 2FNAA 2V1UA 3I54A 1YLFA 1SD4A 4I7HA 3N4MA 3LFKA 1E17A 1Z6RA 2A61A 1SMYF 1FSHA 3ZMVA 3QU3A 1W4MA 4WCGA 4PGGA 1BI3A 1I6XA 4EJWA 3GFJA 2OA4A 1D3YA 3J80K 3GLXA 5ICGA 2JSCA 2JZYA 3O2PE 4K2EA 3HHHA 2EFNA 3TOBA 4HBLA 4HX4A 1I1SA 1OYWA 4OIOF 1CF7A 5A2QZ 5ICEA 2P7VB 3MFKA 2CQKA 1BBYA 4IJAA 5LGUA 1JHFA 1GXPA 2XAQA 3E6BA 3HRSA 3LA2A 4M6XA 1XMAA 2Z33A 2COMA 2HYFA 3TGNA 1KU2A 5CJ9A 1KU9A 3F22A 1G3TA 2RKHA 5HLHA 2RVCA 3KEQA 5L3FA 3HRMA 2HTJA 5ILUA 1JGSA 1ZRFA 5JI6A 3WGHA 1AOYA 2L3DA 2HQNA 3HTUA 3KCCA 3GFIA 2EA4A 2OQGA 1OYIA 4LD5A 1ZAOA 2TDXA 2UZKA 2KRFA 3FF5A 3BPVA 1V4RA 4ENKA 1T2KA 5E17F 4YIFA 4HDVA 3PFIA 2FRHA 3GZ5A 3RYPA 1YS6A 2RDPA 2GA2A 2O3FA 3KZYA 4ZYGA 2VT2A 3M8EA 1LDKB 3M9AA 3WE3A 5LHGA 5D5XB 2ISZA 5TRDA 1WSUA 1YFHA 3CUQC 1G3WA 2FF4A 3ABTA 1FT9A 2XAJA 3NRVA 2F5CA 5LGTA 1FZPB 5HS8A 4LG0B 4ESFA 3FZVA 4HF2A 2A68F 4YIIA 4L9NA 5L3GA 3DQVC 3HSEA 1RNLA 1KA8A 2CO5A 4XLPF 3K2ZA 1RZ4A 2UWMA 1BN5A 4HLXA 4G7OF 2BGCA 1LNWA 4L0YB 2P5KA 1T39A 4LJZF 5A2QK 1PP8F 2R3SA 3QRFF 4BQAA 3K1NA 1TQIA 5HS7A 2DFIA 5LGNA 5JHUA 2EJRA 2G9WA 3DPLC 5LRSA 3ZP5A 1KQ8A 3HOSA 2QVOA 3PQKA 3LA7A 2YSRA 3E5UA 5AIQA 5ICFA 3R61A 2JPBA 4E70A 1FOKA 4Y13A 1Q1HA 3VFZA 3ERED 4U0VA 5FFZA 3G3ZA 4MTDA 3JTGA 5CLSA 1KGSA 1OR7A 4HOBA 3MZYA 4YG2F 2Q2EA 3BJOA 1K6OA 2PG4A 3EYIA 4I02A 3JTHA 1IF1A 2CFXA 4S04A 3BJAA 3I71A 5LEJA 2NS0A 1CF7B 1QBJA 3L9FA 1LDDA 2ISYA 3T8TA 1G3YA 1TBXA 4MGRA 2XGXA 2XRNA 2V1DA 2J5PA 3V7SA 2VBZA 3M8FA 1R7JA 3BY6A 4HX7A 2D1HA 2DW4A 2XROA 2ESNA 1HW5A 3TOAA 2FBIA 2XV4S 1FYLA 2XAFA 5LRRA 1RI7A 3KE2A 3HSFA 4U7DA 4JBAA 3P9IA 4GO1A 4CO8A 5JFRA 3EETA 3DV8A 4Q4ZF 3C18A 2YR2A 4BNCA 1LEAA 5D5VB 1HSTA 2MA3A 4A0ZA 1IW7F 3KP6A 1PUEE 3ZMZA 3LA3A 1J0RA 1BI0A 1SAXA 5F1RA 3EUHA 5BPDA 1FX7A 1B1BA 4OIPF 4IPAA 4EM2A 2AS5F 4GXOA 2EFWA 5E1WA 1FLIA 1ZGJA 1H9GA 1K79A 3KP7A 4CZZA 2HKOA 1KYWA 4I0AA 5LLQA 5FB2A 2L02A 1ZRDA 2F2EA 3GEZA 3FHZA 2L01A 3VODA 3GWZA 1J75A 1UHWA 4AIJA 2BYVE 5LEKA 1DPUA 2PMUA 3MEXA 2ACJA 4MQ9F 2WTEA 4L9TA 2OU2A 2OD5A 4BYYA 2IT0A 4UHTA 3IKTA 4HLYA 3E97A 5CVIA 3O6BB 4CDGA 3WGIA 1USSA 3E3VA 3GUDA 1MDMA 2KJBA 4UUVA 3KLOA 1WRJA 3T8RA 2W84A 3ZMUA 5D5UB 3IRQA 4WXDA 2P6SA 5ICCA 3HYIA 5E8GA 4KT5C 2RN7A 4HV5A 1FBUA 2A5YB 3DXJF 3WTVC 5D4SA 4M9ZA 2M30A 4HF0A 4L9JA 1GVJA 5K5RA 3ECOA 1IZ1A 2VBYA 4AD9A 2Q0OA 1I1GA 2QUFA 1SFEA 4RS8A 4YFXF 2VOOA 2XUBA 2BE5F 3AAFA 3CTAA 2DI3A 1DPRA 2IVMA 2DT5A 2VC1A 3EYYA 3FX3A 5D5WB 2EFQA 3E5XA 3KP3A 2MD5A 1FBQA 4AIHA 3OOPA 3OV8A 3JAMK 2RQPA 3RTRA 2HDCA 3ZN1A 2ZKZA 2XKPA 2KKOA 2ZMEA 4L9VA 4OU0A 4AVPA 1O7FA 1UHMA 2FMYA 5DUIA 5HLGA 4BAYA 1P4XA 2QENA 4ASNA 5BQTA 2DAOA 3R0JA 2XVCA 3HRTA 2P4WA 2W57A 3FXUA 2NRAC 2ESHA 3IL2A 1RUOA 1R58A 3TDZC 1AWCA 5CVVA 2R7FA 2MLKA 4P9UA 3CO7C 2IA0A 4JK1X 3C1DA 4HV6A 4L5IA 3TDUC 5JVTA 1W5SA 4R1HA 4BXUA 1XDSA 2MH2A 2HOEA 2HR3A 1FP2A 2PI0A 2DU9A 1YW9A 2EV6A 3DP7A 4XRFA 5E20A 3RYRA 1WQ2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4M9S A;  1D8J A;  4OMZ A;  3B02 A;  4ESJ A;  2Y0M A;  3O3K A;  4BHP A;  3JW4 A;  1S8N A;  4ZYE A;  5FLX Z;  2K86 A;  1Z7U A;  3RDI A;  4WF2 A;  2NNY A;  2ZXJ A;  3LAJ A;  2M1B A;  3VEP A;  4MEX F;  2XAS A;  2K4B A;  2HTS A;  2LNB A;  2BV6 A;  2DK8 A;  2O0Y A;  1ZG3 A;  4I01 A;  1J59 A;  1O3T A;  5AIP A;  4AWX B;  2CSO A;  3WTW C;  1HKQ A;  3ZMD A;  4JQF A;  3KP5 A;  3F6V A;  1EH8 A;  1W7P D;  4Z2Y A;  3V8K A;  1JHH A;  3SZT A;  4I09 A;  2J5O A;  2IRF G;  4HYE A;  3GZ6 A;  2JT1 A;  1L3L A;  1RUN A;  3WTY C;  1MDM B;  3HHG A;  2ZNY A;  5CVJ A;  4Q48 A;  1TLH B;  3RKX A;  2DPU A;  1KU3 A;  4G7H F;  2H94 A;  3J81 Z;  4EJU A;  1R1V A;  4RGR A;  1IRG A;  3D5L A;  3T1B A;  3FWE A;  4XBF A;  2KJC A;  2FBH A;  3H3Z A;  2P6T A;  4EM1 A;  1VTN C;  5D8L B;  4U7B A;  3SQN A;  5EEH A;  1XSV A;  4IHT A;  1OKR A;  4B8X A;  4YFN F;  4KIC A;  3CUQ A;  3F3X A;  3I0T A;  1SD7 A;  2QQA A;  2K7L A;  2FSW A;  2ELH A;  3LQQ A;  4NQW A;  2ZBK A;  2CG4 A;  2A6E F;  2IPQ X;  3P9C A;  6PAX A;  3M1E A;  2ZME B;  3I64 A;  2K4J A;  4HAM A;  1Z91 A;  2FNP A;  2FXA A;  2D45 A;  4G7Z F;  3WG9 A;  4M6Y A;  1L0O C;  1RIO H;  4A5N A;  2A6H F;  1LVA A;  4HW0 A;  1F4K A;  4LK0 F;  3KP4 A;  1JE8 A;  1IAW A;  1K7A A;  1ODD A;  4OIN F;  1R5G A;  3RPQ A;  1Z05 A;  3E6D A;  1IXC A;  3JSP A;  1J7K A;  5K1Y A;  3HUG A;  1U2W A;  2DBB A;  3FXR A;  1QO0 D;  4YFK F;  2GQQ A;  2EA2 A;  1EH7 A;  1XGM A;  1YTY A;  2HKX A;  5J8C A;  2NAZ A;  4EJT A;  2H27 A;  3U9G A;  3E6M A;  1QQI A;  3ZMT A;  1YIO A;  4ZYD A;  1KYZ A;  2Y48 A;  5E8I A;  2PQ8 A;  2NYX A;  1F9N A;  1YW8 A;  3RIR A;  3IRR A;  1TNS A;  3U2R A;  4TV7 A;  4RB3 C;  4KIG A;  4O5V A;  4L5J A;  3V8L A;  1LB2 A;  4RGU A;  2M45 A;  3RKW A;  3HRU A;  3DF8 A;  4RAZ A;  2STT A;  5DCM B;  1YYV A;  1QNT A;  5KK1 A;  2FQ3 A;  4P9F A;  3V8J A;  2VXZ A;  2HS5 A;  4AIK A;  2KIM A;  4HF1 A;  5F6F A;  3MAJ A;  4BH9 A;  4G94 A;  2D2W A;  1C0W A;  1SFX A;  3F8F A;  3QPT A;  1XGN A;  2E7X A;  1P4A A;  3WTX C;  5HLI A;  2XAG A;  3IKV A;  2CW0 F;  3ECH A;  3HIF A;  2EK5 A;  2CYY A;  1B9N A;  3WTZ A;  1T0F A;  4G9Y A;  3W6J B;  2V79 A;  2IW5 A;  3SZP A;  3KLN A;  4ZYH A;  1MJB A;  3GYH X;  1D5V A;  3RI4 A;  2ZO4 A;  2HGC A;  4CIC A;  4HQM A;  5HDN A;  4A12 A;  2EV0 A;  1ULY A;  1SFU A;  1EH6 A;  1BI2 A;  2QLZ A;  4ZZL A;  3VB2 A;  3L09 A;  3V4G A;  1S29 A;  1YO5 C;  1WWX A;  3WU1 B;  1BC8 C;  2H09 A;  2GXB A;  4A0Y A;  4L0Z B;  3QAH A;  3CUQ B;  2OQR A;  1IN5 A;  4FT8 A;  4ZZD A;  1YW7 A;  4LB5 A;  3VOE A;  1O7L A;  4FX0 A;  2ADU A;  2PN6 A;  2EV5 A;  1ON2 A;  1I5Z A;  2E1C A;  1HSJ A;  4KNY A;  5H6Q A;  4IHS A;  3QPH A;  3GW2 A;  2PJP A;  2D1V A;  1R22 A;  3DPT A;  3J7A O;  2P7C B;  4LLL A;  3R6S A;  1O3R A;  2XKO A;  4Q5S F;  2W85 A;  4UVB A;  4CHU A;  3M7G A;  3ZMS A;  4RGX A;  3IC7 A;  2HFH A;  3E5Q A;  4LLN A;  2RGV A;  2R7D A;  1T38 A;  2M8E A;  4UVC A;  2ETH A;  4WK8 F;  5L3C A;  4KYW A;  3CJN A;  1DUX C;  2OZU A;  4EMS A;  2PEX A;  3ZN0 A;  1FYM A;  3SHF A;  4G6Q A;  2L4M A;  4A6D A;  4GGG A;  1BI1 A;  1KQ9 A;  2VOP A;  2LDU A;  1GHC A;  1XGO A;  2QBY A;  1D8K A;  5E1X A;  1XSD A;  4UVA A;  4R79 A;  5ILV A;  2GZW A;  2F5D A;  4N9I A;  3MZH A;  5K5Q A;  4LMY A;  4WXH A;  5HOO A;  3F8C A;  2PLY A;  4RB1 A;  2A69 F;  3IWZ A;  4UXN A;  4N9H A;  3K1M A;  4KN7 X;  3ZPL A;  1ZLK A;  2HYG D;  3BWG A;  1MGT A;  2Z99 A;  1MZB A;  4HX8 A;  4BHC A;  1P92 A;  4LFU A;  4GYG A;  2LKP A;  1FNN A;  3FMR A;  1FP1 D;  3Q5F A;  3KP2 A;  4EQQ A;  4L18 B;  2WV0 A;  3BJ6 A;  4XLN F;  3MCZ A;  3MQ0 A;  2STW A;  2ZNZ A;  3H3U A;  3K9T A;  1UB9 A;  1XCB A;  4MQV A;  1ZAR A;  1HW1 A;  3U1D A;  3WGG A;  4S05 A;  1F1Z A;  5FGM A;  1E2X A;  3QP5 A;  1HQC A;  4DQ2 A;  1A04 A;  2VBW A;  5D8K B;  4EGY A;  2OZ6 A;  2FE3 A;  1EV7 A;  4HDU A;  3CUO A;  2F5F A;  1J9I A;  3DKW A;  4FX4 A;  2V6C A;  3LAP A;  3HTS B;  2V1X A;  2GAU A;  4ESB A;  1R23 A;  2O8X A;  4WWC A;  3EDP A;  2O61 A;  4XSZ F;  1CGP A;  1T98 A;  2QWW A;  5TJJ A;  5IT9 Z;  2LSO A;  5BOX A;  3BPX A;  4UV8 A;  5CYV A;  1TTY A;  1ZN2 A;  5HVQ C;  5DEQ A;  1WKM A;  4KIF A;  1LQ1 A;  1H9T A;  1U78 A;  2DTR A;  2FBK A;  2OAZ A;  2IA2 A;  3WE2 A;  1HKS A;  1KQ0 A;  3BDD A;  2YX7 A;  3E6C C;  1B4A A;  4LB6 B;  5EEG A;  3WTT C;  4WX9 A;  2HZT A;  2Z9O A;  5DCM A;  2JRT A;  1Z9C A;  4FHT A;  1ZRC A;  3P7N A;  3H92 A;  5JR3 A;  1P2F A;  1YQA A;  2KIF A;  4U88 A;  2UXN A;  3TQN A;  3TO6 A;  5E18 F;  1X3U A;  4IXA A;  1SD5 A;  4Q47 A;  2KIU A;  1IN4 A;  5L3B A;  1S3J A;  2EFP A;  4M74 A;  1FY7 A;  2FU4 A;  2DLL A;  1SD6 A;  1Z6T A;  4MHG A;  3FXQ A;  4O6J A;  1XSX A;  2A3S A;  1U6G A;  1IRF A;  1XMK A;  2MBF A;  4ON0 A;  2VC0 A;  4QWQ A;  3L00 A;  2QBY B;  1XD7 A;  2ZCW A;  1R5H A;  2A07 F;  3K69 A;  2GA1 A;  1U5T C;  3GFM A;  2O6G E;  4B09 A;  2VN2 A;  4M72 A;  3F8M A;  1R1T A;  3I5U A;  1G3S A;  4GYI A;  5DUK A;  2YX4 A;  1G6N A;  3GF2 A;  4DNC A;  2H6B A;  3BP8 A;  1BM9 A;  4RB0 A;  4KN4 X;  3COA C;  1OYY A;  1UCR A;  3REO A;  1MJA A;  1ZRE A;  2HQR A;  1HXD A;  2OBP A;  4ENJ A;  5E1Z B;  2M5W A;  4P5O A;  5BPI A;  5FFX A;  5IT9 K;  2DQR A;  4I2O A;  1MD0 A;  2BBY A;  2JTV A;  4CXF A;  4KIB A;  5DDG A;  4ZH4 F;  4KDP A;  4R8H A;  4A0X A;  2NNN A;  1ZGA A;  1B59 A;  2EB7 A;  3TKY A;  3V7R A;  4QLC U;  2MH9 A;  3F23 A;  2XIG A;  2VE9 A;  4NHJ A;  4KMU X;  1S7A A;  1BIA A;  2ZFW A;  2QQ9 A;  1ZG1 A;  2RNJ A;  2LF8 A;  5FLX K;  2DK5 A;  1R00 A;  1XGS A;  3MWM A;  4IRH A;  1R1U A;  3K1P A;  5J6X A;  4N0B A;  3LQR A;  4WXC A;  1Y0U A;  1F5T A;  2PMH A;  3IHU A;  2DPD A;  1TNT A;  5D4R A;  2AXL A;  2MC3 A;  1P6R A;  4M71 A;  4ETS A;  3I59 B;  3Q9S A;  5BS6 A;  4M9X A;  2HEO A;  2CWE A;  4EM0 B;  1ONV A;  4PGH A;  2QQB A;  2PFB A;  1HBX G;  2P5L C;  4PDK A;  4A5M A;  2VT3 A;  2QZ8 A;  3D0S A;  1NHA A;  5ILS A;  5H20 A;  1ZH5 A;  3FM3 A;  1OPC A;  2GXG A;  2M87 A;  3DEU A;  4IF4 A;  3R4K A;  2L4A A;  1DP7 P;  4O3M A;  2V9V A;  1QGP A;  1P4W A;  1UFM A;  1O3S A;  3BZ6 A;  1QZY A;  1W5T A;  1YG2 A;  3ROU A;  1GXQ A;  2QM3 A;  3I53 A;  3J81 K;  2IA1 A;  4PCQ A;  3BOQ A;  3CO6 C;  3Q9V A;  5HDK A;  1PDN C;  1FSE A;  2UXX A;  3F21 A;  1TQM A;  3F8N A;  1U5T B;  3KEO A;  1S6L A;  1IN7 A;  1O3Q A;  4Y15 A;  3CDH A;  1REP C;  3N97 A;  1FWZ A;  3K0L A;  4U0W A;  3TO9 A;  3GXO A;  4MTE A;  4KUM A;  5D6F A;  2XAH A;  3B73 A;  1KU7 A;  3F8B A;  2JPC A;  1PP7 U;  1V3F A;  5AON A;  2ZJ2 A;  1FYK A;  2IP2 A;  2RC4 A;  1ON1 A;  5BMZ A;  3HSR A;  1K78 A;  5HDG A;  2LF7 A;  4EJV A;  4I0B A;  1W7P A;  3WU0 A;  3SFZ A;  5IT3 A;  3JSO A;  4GCV A;  2Z5U A;  2C6Y A;  5LHH A;  2PBI A;  4LLG F;  3W6K B;  4OIR F;  4G6D A;  3NQO A;  4KMF A;  1OMI A;  1FC3 A;  5FD6 A;  3CLO A;  1J2X A;  4Y17 A;  1ZHF A;  5J8F A;  3F6O A;  5DD8 A;  2BEO A;  4PZJ A;  4G8X A;  1LEB A;  3R0A A;  2YU3 A;  3QP6 A;  4IRI A;  4EV0 A;  1BIB A;  1ZYR F;  4IRG A;  4U0Y A;  2Q8K A;  2Y75 A;  1UST A;  4EJO A;  1HKT A;  2VOD A;  4A2U A;  1XCV A;  3GFL A;  1B9M A;  1FPQ A;  3L7W A;  3LWF A;  5DD4 A;  2B0L A;  3JAM Z;  3F72 A;  3ABU A;  2YPR A;  2EFO A;  1ZG5 A;  3KET A;  5ED4 A;  2GWR A;  4MEY F;  4ENM A;  3ISP A;  2H6C A;  2HWV A;  5K5O A;  5CVU A;  5L3D A;  2X4H A;  3PQJ A;  4HQE A;  3I58 A;  5LHI A;  4D0P A;  1TQP A;  2MLG A;  1XDU A;  1S7O A;  2VE8 A;  1T6S A;  2DO7 A;  1FBS A;  4KA4 A;  2W25 A;  5DCF A;  1Z1D A;  1BOA A;  3S2W A;  4IVN A;  4RAY A;  5DYM A;  5FD5 A;  3QOP A;  3KZZ A;  3KFW X;  4RGS A;  4NB5 A;  4I98 B;  2DQL A;  4CYD A;  4M73 A;  2VBX A;  3GO5 A;  3EQL F;  4CGZ A;  3R60 A;  3C3W A;  4P96 A;  2VON A;  3DFG A;  4MNU A;  2EWN A;  2FA5 A;  4HZF A;  2WWY A;  2F5E A;  3P9K A;  3L2C A;  3WOD F;  1O57 A;  2W24 A;  4OIQ F;  3IWF A;  3G73 A;  4OOI A;  2E7W A;  3LST A;  3ML6 A;  5LBQ A;  4LGW A;  4P55 A;  1IN6 A;  1U3E M;  2Z3Y A;  2K02 A;  2P5V A;  4BHB A;  1B6A A;  3V7C A;  1QPM A;  3WTU C;  2O03 A;  1IUY A;  1IXR C;  3GVA A;  4LK1 F;  1K78 B;  2IJL A;  5D6E A;  1HW2 A;  1W7P B;  3RPU A;  2P8T A;  2FML A;  3J80 Z;  3RKY A;  1R36 A;  4ENN A;  1U8R A;  1XN7 A;  1IN8 A;  3HOT A;  1I27 A;  1JXS A;  1XB4 A;  1ZLJ A;  1BJA A;  2G7U A;  3T0Y A;  2X0L A;  2FOK A;  1DDN A;  5DV5 A;  5H6R A;  1STZ A;  3ULQ B;  4UNO A;  4OMY A;  1QZZ A;  3I59 A;  5L3E A;  1LJ9 A;  3NEU A;  3ZQ7 A;  3T5X A;  4HA8 A;  4LG0 A;  1H0M A;  1IXS B;  3ELK A;  2FEZ A;  4KFC A;  3C7J A;  3GX4 X;  1TW2 A;  5HS9 A;  4UV9 A;  2QYO A;  2WC2 A;  5KVR A;  2XHK A;  1YS7 A;  1BC7 C;  2CGP A;  2GIV A;  4EGZ A;  1WI9 A;  1J5Y A;  5FO5 A;  3FMQ A;  4F7Z A;  3FMS A;  4EVI A;  3QU6 A;  1SMT A;  5CVR A;  2E1N A;  2K27 A;  2L54 A;  2G7H A;  2RV8 A;  3FM5 A;  3BRO A;  5ERI A;  1MKM A;  3TO7 A;  4XSX F;  3RJP A;  4A6E A;  4RB2 C;  1U5T A;  5F64 A;  4H0E A;  3WTS C;  3I4P A;  1MJ9 A;  1TW3 A;  1G4D A;  1LDJ A;  3SXY A;  2FNA A;  2V1U A;  3I54 A;  1YLF A;  1SD4 A;  4I7H A;  3N4M A;  3LFK A;  1E17 A;  1Z6R A;  2A61 A;  1SMY F;  1FSH A;  3ZMV A;  3QU3 A;  1W4M A;  4WCG A;  4PGG A;  1BI3 A;  1I6X A;  4EJW A;  3GFJ A;  2OA4 A;  1D3Y A;  3J80 K;  3GLX A;  5ICG A;  2JSC A;  2JZY A;  3O2P E;  4K2E A;  3HHH A;  2EFN A;  3TOB A;  4HBL A;  4HX4 A;  1I1S A;  1OYW A;  4OIO F;  1CF7 A;  5A2Q Z;  5ICE A;  2P7V B;  3MFK A;  2CQK A;  1BBY A;  4IJA A;  5LGU A;  1JHF A;  1GXP A;  2XAQ A;  3E6B A;  3HRS A;  3LA2 A;  4M6X A;  1XMA A;  2Z33 A;  2COM A;  2HYF A;  3TGN A;  1KU2 A;  5CJ9 A;  1KU9 A;  3F22 A;  1G3T A;  2RKH A;  5HLH A;  2RVC A;  3KEQ A;  5L3F A;  3HRM A;  2HTJ A;  5ILU A;  1JGS A;  1ZRF A;  5JI6 A;  3WGH A;  1AOY A;  2L3D A;  2HQN A;  3HTU A;  3KCC A;  3GFI A;  2EA4 A;  2OQG A;  1OYI A;  4LD5 A;  1ZAO A;  2TDX A;  2UZK A;  2KRF A;  3FF5 A;  3BPV A;  1V4R A;  4ENK A;  1T2K A;  5E17 F;  4YIF A;  4HDV A;  3PFI A;  2FRH A;  3GZ5 A;  3RYP A;  1YS6 A;  2RDP A;  2GA2 A;  2O3F A;  3KZY A;  4ZYG A;  2VT2 A;  3M8E A;  1LDK B;  3M9A A;  3WE3 A;  5LHG A;  5D5X B;  2ISZ A;  5TRD A;  1WSU A;  1YFH A;  3CUQ C;  1G3W A;  2FF4 A;  3ABT A;  1FT9 A;  2XAJ A;  3NRV A;  2F5C A;  5LGT A;  1FZP B;  5HS8 A;  4LG0 B;  4ESF A;  3FZV A;  4HF2 A;  2A68 F;  4YII A;  4L9N A;  5L3G A;  3DQV C;  3HSE A;  1RNL A;  1KA8 A;  2CO5 A;  4XLP F;  3K2Z A;  1RZ4 A;  2UWM A;  1BN5 A;  4HLX A;  4G7O F;  2BGC A;  1LNW A;  4L0Y B;  2P5K A;  1T39 A;  4LJZ F;  5A2Q K;  1PP8 F;  2R3S A;  3QRF F;  4BQA A;  3K1N A;  1TQI A;  5HS7 A;  2DFI A;  5LGN A;  5JHU A;  2EJR A;  2G9W A;  3DPL C;  5LRS A;  3ZP5 A;  1KQ8 A;  3HOS A;  2QVO A;  3PQK A;  3LA7 A;  2YSR A;  3E5U A;  5AIQ A;  5ICF A;  3R61 A;  2JPB A;  4E70 A;  1FOK A;  4Y13 A;  1Q1H A;  3VFZ A;  3ERE D;  4U0V A;  5FFZ A;  3G3Z A;  4MTD A;  3JTG A;  5CLS A;  1KGS A;  1OR7 A;  4HOB A;  3MZY A;  4YG2 F;  2Q2E A;  3BJO A;  1K6O A;  2PG4 A;  3EYI A;  4I02 A;  3JTH A;  1IF1 A;  2CFX A;  4S04 A;  3BJA A;  3I71 A;  5LEJ A;  2NS0 A;  1CF7 B;  1QBJ A;  3L9F A;  1LDD A;  2ISY A;  3T8T A;  1G3Y A;  1TBX A;  4MGR A;  2XGX A;  2XRN A;  2V1D A;  2J5P A;  3V7S A;  2VBZ A;  3M8F A;  1R7J A;  3BY6 A;  4HX7 A;  2D1H A;  2DW4 A;  2XRO A;  2ESN A;  1HW5 A;  3TOA A;  2FBI A;  2XV4 S;  1FYL A;  2XAF A;  5LRR A;  1RI7 A;  3KE2 A;  3HSF A;  4U7D A;  4JBA A;  3P9I A;  4GO1 A;  4CO8 A;  5JFR A;  3EET A;  3DV8 A;  4Q4Z F;  3C18 A;  2YR2 A;  4BNC A;  1LEA A;  5D5V B;  1HST A;  2MA3 A;  4A0Z A;  1IW7 F;  3KP6 A;  1PUE E;  3ZMZ A;  3LA3 A;  1J0R A;  1BI0 A;  1SAX A;  5F1R A;  3EUH A;  5BPD A;  1FX7 A;  1B1B A;  4OIP F;  4IPA A;  4EM2 A;  2AS5 F;  4GXO A;  2EFW A;  5E1W A;  1FLI A;  1ZGJ A;  1H9G A;  1K79 A;  3KP7 A;  4CZZ A;  2HKO A;  1KYW A;  4I0A A;  5LLQ A;  5FB2 A;  2L02 A;  1ZRD A;  2F2E A;  3GEZ A;  3FHZ A;  2L01 A;  3VOD A;  3GWZ A;  1J75 A;  1UHW A;  4AIJ A;  2BYV E;  5LEK A;  1DPU A;  2PMU A;  3MEX A;  2ACJ A;  4MQ9 F;  2WTE A;  4L9T A;  2OU2 A;  2OD5 A;  4BYY A;  2IT0 A;  4UHT A;  3IKT A;  4HLY A;  3E97 A;  5CVI A;  3O6B B;  4CDG A;  3WGI A;  1USS A;  3E3V A;  3GUD A;  1MDM A;  2KJB A;  4UUV A;  3KLO A;  1WRJ A;  3T8R A;  2W84 A;  3ZMU A;  5D5U B;  3IRQ A;  4WXD A;  2P6S A;  5ICC A;  3HYI A;  5E8G A;  4KT5 C;  2RN7 A;  4HV5 A;  1FBU A;  2A5Y B;  3DXJ F;  3WTV C;  5D4S A;  4M9Z A;  2M30 A;  4HF0 A;  4L9J A;  1GVJ A;  5K5R A;  3ECO A;  1IZ1 A;  2VBY A;  4AD9 A;  2Q0O A;  1I1G A;  2QUF A;  1SFE A;  4RS8 A;  4YFX F;  2VOO A;  2XUB A;  2BE5 F;  3AAF A;  3CTA A;  2DI3 A;  1DPR A;  2IVM A;  2DT5 A;  2VC1 A;  3EYY A;  3FX3 A;  5D5W B;  2EFQ A;  3E5X A;  3KP3 A;  2MD5 A;  1FBQ A;  4AIH A;  3OOP A;  3OV8 A;  3JAM K;  2RQP A;  3RTR A;  2HDC A;  3ZN1 A;  2ZKZ A;  2XKP A;  2KKO A;  2ZME A;  4L9V A;  4OU0 A;  4AVP A;  1O7F A;  1UHM A;  2FMY A;  5DUI A;  5HLG A;  4BAY A;  1P4X A;  2QEN A;  4ASN A;  5BQT A;  2DAO A;  3R0J A;  2XVC A;  3HRT A;  2P4W A;  2W57 A;  3FXU A;  2NRA C;  2ESH A;  3IL2 A;  1RUO A;  1R58 A;  3TDZ C;  1AWC A;  5CVV A;  2R7F A;  2MLK A;  4P9U A;  3CO7 C;  2IA0 A;  4JK1 X;  3C1D A;  4HV6 A;  4L5I A;  3TDU C;  5JVT A;  1W5S A;  4R1H A;  4BXU A;  1XDS A;  2MH2 A;  2HOE A;  2HR3 A;  1FP2 A;  2PI0 A;  2DU9 A;  1YW9 A;  2EV6 A;  3DP7 A;  4XRF A;  5E20 A;  3RYR A;  1WQ2 A; 
#chains in the Genus database with same CATH topology
 4RMN A;  4HSR A;  4M9S A;  1D8J A;  4OMZ A;  4AID A;  1W5C C;  3B02 A;  4ESJ A;  2Y0M A;  3O3K A;  2WA0 A;  5CPR B;  3MVP A;  3I4M J;  4BHP A;  2O7O A;  1S8N A;  1LFP A;  3JW4 A;  4ZYE A;  5FLX Z;  2K3F A;  4CUG A;  2K86 A;  2BY0 A;  1Z7U A;  1A36 A;  3RDI A;  3S14 J;  5CQG A;  4WF2 A;  1BW6 A;  2NNY A;  2ZXJ A;  3LAJ A;  2ZJQ F;  2EIK H;  2M1B A;  2X6W A;  3VEP A;  1V55 H;  4MEX F;  2BXY A;  2XAS A;  4XN0 A;  2K4B A;  2HTS A;  2LNB A;  1FJL A;  4AVZ A;  2VQG A;  1T95 A;  2BV6 A;  2DK8 A;  2O0Y A;  1WGX A;  1ZG3 A;  4I01 A;  1J59 A;  1O3T A;  5AIP A;  4AWX B;  3TP3 A;  2CSO A;  1VQP I;  2LTP A;  3WTW C;  1HKQ A;  3ZMD A;  3BT9 A;  4JQF A;  2CQX A;  1X58 A;  3KP5 A;  3F6V A;  2DA3 A;  1EH8 A;  3CMY A;  1JGG A;  1W7P D;  2DMT A;  4Z2Y A;  1JHH A;  2OCE A;  3SZT A;  3V8K A;  4I09 A;  2J5O A;  2VKE A;  3H9G A;  4E7Z A;  4HYE A;  1IJW C;  2IRF G;  3GZ6 A;  1IUF A;  4IZZ A;  2XC7 A;  4MLO A;  3M3Y J;  1VQ6 I;  2JT1 A;  2L9R A;  2LOO A;  2O9L A;  3S2H J;  1QVT A;  1Z67 A;  3D5R C;  4D5F A;  1L3L A;  1RUN A;  3WTY C;  1MDM B;  3F0C A;  3KPH A;  2BY2 A;  5IOY A;  3HHG A;  5J4Y A;  3PO3 J;  2ZNY A;  4LIV A;  5CVJ A;  4Q48 A;  1TLH B;  3VYS B;  3AL0 C;  5JLX A;  2LKX A;  2I5U A;  1J09 A;  2GLO A;  3RKX A;  4BY1 J;  2DPU A;  4BQN A;  1KU3 A;  3VSK A;  5E3O A;  5DM6 F;  1S72 I;  1K61 A;  4G7H F;  2H94 A;  3S16 J;  4A3F J;  3J81 Z;  1T56 A;  3LSI A;  4EJU A;  1R1V A;  4RGR A;  1IRG A;  3D5L A;  3T1B A;  3BTL A;  4CCK A;  3FWE A;  2LY2 A;  4A3I J;  3K2A A;  4XBF A;  3WHC A;  2KJC A;  2M34 A;  2FBH A;  3ZCO A;  2E71 A;  4RDU A;  3GCM A;  3OYF A;  3H3Z A;  3MZ8 A;  1JJ8 C;  2P6T A;  4EM1 A;  1VTN C;  1E3O C;  1HLV A;  3Q0U A;  2CMP A;  2KZV A;  5D8L B;  2E2I J;  4U7B A;  3OYJ A;  2BXZ A;  3SQN A;  4YRV A;  5EEH A;  1XSV A;  2OV7 A;  4ANJ A;  1N78 A;  4IHT A;  1OKR A;  2FJ1 A;  2L7M P;  2NOG A;  4B8X A;  2R7R A;  1ENH A;  3JRG A;  4BE1 A;  2MW8 A;  2X48 A;  3L2R A;  2QGU A;  1FMV A;  3FKI J;  1UG2 A;  4YFN F;  1VQM I;  2F4I A;  4KIC A;  5GAG J;  3OYB A;  3CUQ A;  3F3X A;  3I0T A;  1SD7 A;  3VYR B;  1LPQ A;  2QQA A;  3ZQC A;  2K7L A;  3S17 J;  2FSW A;  1R4M B;  2JA2 A;  2ELH A;  2IEK A;  2QQ8 A;  3LQQ A;  2ZBK A;  4NQW A;  2CG4 A;  2EQR A;  1X2M A;  2A6E F;  2IPQ X;  3P9C A;  6PAX A;  1V5E A;  2JA6 J;  2V6E A;  3M1E A;  3C2H A;  2ZME B;  3I64 A;  2K4J A;  4HAM A;  1Z91 A;  2FNP A;  1FIA A;  2FXA A;  2D45 A;  4JX6 A;  4G7Z F;  3WG9 A;  4M6Y A;  1DGR M;  1L0O C;  4NNJ A;  1RIO H;  4A5N A;  1BR1 A;  1G2H A;  2A6H F;  4C2U A;  3BLY A;  1LVA A;  4HW0 A;  1F4K A;  4LK0 F;  3KP4 A;  1G59 A;  2LYC A;  1JE8 A;  3A0H C;  1IAW A;  1V54 H;  2VLA A;  1K7A A;  1ODD A;  4OIN F;  2WB1 N;  1R5G A;  1RES A;  3P5J A;  3RPQ A;  1YOV B;  2PMZ N;  3CCU I;  1Z05 A;  3E6D A;  1IXC A;  4PSX A;  3L2Q A;  3JSP A;  1GV5 A;  1J7K A;  1JJ6 C;  2XPW A;  5K1Y A;  5KCM A;  1YJ9 I;  1S9H A;  3ABM H;  3HUG A;  1U2W A;  2LG4 A;  1I39 A;  3OSF A;  1X3W B;  3HOZ J;  3Q0V A;  1OFC X;  2DBB A;  4XKV A;  4M6V A;  3FXR A;  2R5Z B;  1QO0 D;  4YFK F;  5IP9 J;  2GQQ A;  2EA2 A;  1EH7 A;  1XGM A;  1YTY A;  1VQN I;  2HKX A;  5J8C A;  2NAZ A;  3TW7 A;  4EJT A;  2H27 A;  4Y3O A;  3U9G A;  3E6M A;  4GFB A;  1QQI A;  3S32 A;  5IYC J;  4PK4 A;  1XC5 A;  3ZMT A;  2Y30 A;  1WFX A;  1SAU A;  1YIO A;  1KYZ A;  2E5Z A;  4UB6 C;  4ZYD A;  1RC9 A;  2Y48 A;  1YIJ I;  1FTT A;  3DU5 A;  5E8I A;  2PQ8 A;  2TCT A;  1UHS A;  2F5V A;  2NYX A;  3KZI C;  3ESW B;  1F9N A;  4IKF A;  1YW8 A;  2DYS H;  4G12 A;  3E7L A;  3RIR A;  3IRR A;  2O5R A;  1TNS A;  3U2R A;  4TV7 A;  4RB3 C;  1OCT C;  4KIG A;  3UKG A;  1A5J A;  4O5V A;  2CQQ A;  1WZ2 A;  4L5J A;  3V8L A;  1LB2 A;  1BJZ A;  3GTJ J;  4RGU A;  2M45 A;  3ASO H;  3RKW A;  3HRU A;  5JHF A;  3DF8 A;  3W3C A;  4XQF A;  1WI3 A;  2Y9Y A;  4BBR J;  4RAZ A;  4PFO A;  2STT A;  1BW5 A;  5GAE J;  2QKM B;  4ZYA A;  5DCM B;  2LY1 A;  1YYV A;  3NAR A;  4B3X A;  1QNT A;  5KK1 A;  3MMY B;  2FQ3 A;  5C3E J;  2XF6 A;  2KZG A;  4P9F A;  5B5E C;  4C3H J;  3V8J A;  1U9O A;  2WAQ A;  2MYS A;  2AXT C;  3HG9 A;  2VKV A;  2QSF X;  2VXZ A;  3I56 I;  2R7U A;  2HS5 A;  4AIK A;  3BR0 A;  2KIM A;  3KIO A;  2CJJ A;  4HF1 A;  2R7S A;  5EF6 A;  5F6F A;  3L2W A;  3MAJ A;  3RPU D;  4BH9 A;  4G94 A;  2D2W A;  1C0W A;  1SFX A;  1YI2 I;  3F8F A;  3QPT A;  1XGN A;  2JRM A;  2HOA A;  4PJL A;  2E7X A;  1P4A A;  3DBR B;  1JKP C;  3WTX C;  5HLI A;  3LMM A;  3H9Q A;  2XAG A;  2DMQ A;  3IKV A;  5K7F A;  3CMA I;  2CS3 A;  2CW0 F;  1JUS A;  3BCA A;  1U9N A;  3ECH A;  2EPF A;  2K40 A;  3HIF A;  3PO2 J;  2EK5 A;  4D1Q A;  3OL4 A;  2K9L A;  2CYY A;  5TGT A;  1B9N A;  2G0E A;  1HDD C;  2HPI A;  2DFE A;  2LLK A;  3KYD B;  3WTZ A;  4UB8 C;  1T0F A;  1OCP A;  2K5C A;  4G9Y A;  1JTX A;  1WPK A;  3LSR A;  3W6J B;  3SDG A;  2V79 A;  2IW5 A;  3SZP A;  3KLN A;  4ZYH A;  1N77 A;  1MJB A;  1RET A;  3GYH X;  3VYU B;  1D5V A;  2K3P A;  2D5V A;  2GIZ A;  2HVR A;  3RI4 A;  2VJ5 A;  2IGM A;  3DKY A;  2ZO4 A;  1YIT I;  2NS7 A;  2HGC A;  4CIC A;  4HQM A;  2EZH A;  5HDN A;  4A12 A;  2EV0 A;  1ULY A;  1SFU A;  1AKH A;  3CJT B;  2DMP A;  5EGO B;  1RPW A;  2K9M A;  2X6X A;  1EH6 A;  1BI2 A;  2QLZ A;  4ZZL A;  3VB2 A;  3L09 A;  3TBI A;  1R5I D;  3V4G A;  1CQT A;  1S29 A;  1YO5 C;  2F6C A;  1WWX A;  3WU1 B;  1BC8 C;  2H09 A;  4BUP A;  4A0Y A;  2GXB A;  2KRH A;  4L0Z B;  2LVS A;  3LSP A;  3QAH A;  3CUQ B;  1I6H J;  3ZQF A;  4ITV A;  2HYJ A;  2OQR A;  1IN5 A;  4FT8 A;  4ZZD A;  1H89 C;  1YW7 A;  3DEE A;  4NQW B;  1K4S A;  2E34 A;  4NC6 A;  5JVG F;  3S3M A;  1H88 C;  2ECC A;  4MO7 A;  3D5S C;  4LB5 A;  4A69 C;  3VOE A;  3JRB A;  1X1B A;  1O7L A;  2KMU A;  4W97 A;  4FX0 A;  2NS8 A;  2ADU A;  1GT0 C;  2M4K A;  3X2Q H;  2PN6 A;  3CES A;  2EV5 A;  1XG1 A;  2XB5 A;  4AC0 A;  4I76 A;  1IV6 A;  2CUZ A;  3DPU A;  1ON2 A;  1I5Z A;  1WJF A;  2E1C A;  3U21 A;  2ZC2 A;  1ETY A;  4XRS A;  1HSJ A;  4KNY A;  4OWR B;  5H6Q A;  4IHS A;  4Y7N J;  3QWL A;  3HM5 A;  1YX5 A;  3GW2 A;  2UV1 A;  3QPH A;  4NDL A;  2FUG 2;  2PJP A;  2D1V A;  5CKT A;  1R22 A;  3DPT A;  2MAB A;  3J7A O;  3CME I;  2P7C B;  4LLL A;  3R6S A;  1O3R A;  2XKO A;  4Q5S F;  2W85 A;  1V5G A;  3KX2 A;  4UVB A;  5TIS C;  2L7Z A;  4CHU A;  1TWH J;  3M7G A;  4Y52 J;  1MMD A;  1MMA A;  1I3A A;  3CCJ I;  5KNL A;  3ZMS A;  4RGX A;  3IC7 A;  3HB9 A;  2HFH A;  3E5Q A;  4LLN A;  1VI0 A;  3BG7 A;  1Q1V A;  2RGV A;  4X1E A;  5HNH A;  5E3M A;  4BQO A;  2R7D A;  3CJQ B;  1T38 A;  1D1A A;  2HQA A;  5CQE A;  4BQQ A;  4EEF G;  2M8E A;  4UVC A;  1Z77 A;  3H35 A;  4D5C A;  3LFU A;  2ETH A;  2H1L A;  1ETW A;  4D9J A;  4WK8 F;  5L3C A;  1E3P A;  4KYW A;  3CJN A;  2RQQ A;  1DUX C;  3H5R A;  3BR1 A;  2OZU A;  4EMS A;  2PEX A;  3ZN0 A;  1FYM A;  1HC8 A;  3SHF A;  4G6Q A;  4A3L J;  2L4M A;  4A6D A;  5J47 A;  4GGG A;  1BI1 A;  1BR4 A;  1KQ9 A;  2DMN A;  2VOP A;  2LDU A;  2XPV A;  1GHC A;  1NG6 A;  1SVM A;  1XGO A;  1YE9 A;  2QBY A;  1D8K A;  3B6A A;  5GAD J;  3PL8 A;  4HNT A;  3W2V A;  3BG9 A;  2R7W A;  5E1X A;  1XSD A;  5IY5 H;  2E1M C;  4DBQ A;  4UVA A;  4R79 A;  1YJN I;  5ILV A;  1Y56 A;  2GZW A;  2B7E A;  1Z7L A;  1XMX A;  2F5D A;  1QA6 A;  4N9I A;  4DW6 A;  2WAD A;  2CUF A;  2EZK A;  3MZH A;  2X1E A;  5K5Q A;  4LMY A;  2XAU A;  5GPA A;  2DT7 B;  4WXH A;  5HOO A;  3F8C A;  2PLY A;  4RB1 A;  2A69 F;  3IWZ A;  4UXN A;  4N9H A;  2LMD A;  3K1M A;  4KN7 X;  3ZPL A;  3OS1 A;  1YRN A;  1ZLK A;  1H8A C;  3JRD A;  3OSG A;  2HYG D;  3O8G A;  3J7Z I;  3BWG A;  1MGT A;  2Z99 A;  1MZB A;  3OMY A;  5EJC A;  3RZD J;  3S1N J;  4HX8 A;  4BHC A;  1IGN A;  3N05 A;  1P92 A;  4LFU A;  4HEA 2;  4JOM A;  4GYG A;  2LKP A;  4Y4R A;  1FNN A;  3FMR A;  1PUF A;  2EIL H;  3LNQ A;  1TWF J;  4G6T B;  3BTJ A;  3A0B C;  1FP1 D;  3Q5F A;  3KP2 A;  4EQQ A;  5K7H A;  4L18 B;  2WV0 A;  2H1K A;  3L1P A;  3BJ6 A;  1TT5 B;  4XLN F;  2L2O A;  3MCZ A;  3MQ0 A;  3UR3 C;  2STW A;  2ZNZ A;  3H3U A;  4FET A;  1NTC A;  3K9T A;  1UB9 A;  1XCB A;  4MQV A;  4F93 B;  1ZAR A;  1HW1 A;  3U1D A;  3WGG A;  3HEF A;  3DBL B;  1XX5 A;  4S05 A;  3CC4 I;  3LOC A;  1F1Z A;  5FGM A;  1E2X A;  3QP5 A;  1HQC A;  5E79 C;  4DQ2 A;  1E0E A;  3CD6 I;  1OCZ H;  3KEY A;  5LFA A;  1MBG A;  1A04 A;  2VBW A;  5D8K B;  2W7N A;  4EGY A;  4DIQ A;  2VPR A;  2X6Y A;  2XSD C;  2OZ6 A;  2FE3 A;  1X4P A;  5M5W J;  1EV7 A;  3FIW A;  4MFE A;  4HDU A;  3CUO A;  5GPC A;  5F0F A;  2F5F A;  1J9I A;  3DKW A;  4FX4 A;  2V6C A;  3G1O A;  3LAP A;  3HTS B;  5DM7 F;  2BY1 A;  2V1X A;  2Y0S N;  1P9Q C;  2MGQ A;  2GAU A;  2RRE A;  4ESB A;  3JRA A;  1R23 A;  2O8X A;  1PJR A;  3K7A J;  2BHY A;  4WWC A;  3EDP A;  2LRD A;  4YEL A;  2O61 A;  4XSZ F;  1CGP A;  1T98 A;  4YIR X;  2QWW A;  1BOB A;  1K6Y A;  2HXO A;  2R7O A;  4M3E A;  2BHZ A;  3CDI A;  3IP4 B;  5TJJ A;  5IT9 Z;  2LSO A;  2W1O A;  1GLN A;  3IV5 A;  4E7I A;  5BOX A;  4F3Q A;  1XS9 A;  1QU3 A;  3BPX A;  4KT6 A;  4UV8 A;  1DQU A;  5CYV A;  1TTY A;  1ZN2 A;  5HVQ C;  2BY3 A;  4C3J J;  5DEQ A;  3H5N A;  3M1C A;  3QYF A;  4BY7 J;  1WKM A;  2L7K A;  1SEU A;  4KIF A;  3HOU J;  1OCC H;  1R4N B;  1LQ1 A;  1H9T A;  1U78 A;  4XNF A;  2DTR A;  2FBK A;  3H0G J;  1Z3Y A;  2OAZ A;  1IG7 A;  2IA2 A;  3WE2 A;  1HKS A;  1KQ0 A;  3BDD A;  1FMW A;  2W82 A;  1LE8 B;  2L5Q A;  2YX7 A;  3E6C C;  4FCY A;  4DYR A;  1B4A A;  2VXD A;  1DU6 A;  4LB6 B;  2DXI A;  4N4O B;  1WCM J;  5EEG A;  3G1M A;  3WTT C;  3OYG A;  1MH4 A;  2JA8 J;  3OR1 C;  4OAZ A;  4WX9 A;  3W2W A;  5B66 C;  1VQ8 I;  2HZT A;  1R49 A;  5DCM A;  2Z9O A;  3S1M J;  1TWG J;  2JRT A;  1Z9C A;  2HNH A;  4FHT A;  1ZRC A;  3P7N A;  3QQA A;  3H92 A;  5JR3 A;  1P2F A;  4XKC A;  1YQA A;  2KIF A;  4U88 A;  2UXN A;  3TQN A;  3TO6 A;  5E18 F;  3E0J B;  1X3U A;  4IXA A;  1HCR A;  1SD5 A;  4Q47 A;  2KIU A;  1IN4 A;  5L3B A;  3W6V A;  1S3J A;  3SEQ A;  2QA4 I;  2CQ7 A;  2BVM A;  2EFP A;  4M74 A;  1FY7 A;  2FU4 A;  2DLL A;  3VPR A;  3G6E I;  3SJM A;  2FOW A;  4DGW B;  4DZP A;  5GTI C;  1SD6 A;  1Z6T A;  4MHG A;  5C4X J;  1SC7 A;  3FXQ A;  4FE7 A;  4CZC A;  4O6J A;  1XSX A;  1D0Y A;  2A3S A;  1U6G A;  1OCO H;  3HJE A;  1IRF A;  1XMK A;  2MBF A;  3EUA A;  4ON0 A;  2GXA A;  5FKL A;  2VC0 A;  4QWQ A;  1X4O A;  3L00 A;  2QBY B;  1XD7 A;  2IS1 A;  2ZCW A;  4M3D A;  1R5H A;  2A07 F;  3K69 A;  2GA1 A;  2E2J J;  1U5T C;  4A3D J;  3AG2 H;  3HGG A;  3QOE A;  4A3M J;  3H1C A;  3GFM A;  2O6G E;  4B09 A;  2Y31 A;  3GME A;  3RSN A;  1FTZ A;  2VN2 A;  4M72 A;  3F8M A;  3H9J A;  2ID3 A;  1R1T A;  3I5U A;  2KQR A;  1G3S A;  1K83 J;  2Q1Z B;  4GYI A;  2YX4 A;  3F9K A;  1G6N A;  1NG7 A;  3GF2 A;  2K9N A;  5DUK A;  4DNC A;  1AA7 A;  2M0C A;  2H6B A;  3BP8 A;  1BM9 A;  2DFH A;  4FE4 A;  4RB0 A;  4KN4 X;  2E19 A;  3COA C;  2KIQ A;  2LFB A;  1OYY A;  1UCR A;  4FQG A;  3NWT A;  3GTL J;  4A3C J;  2FD5 A;  2LY9 A;  3REO A;  4QPQ A;  2OJE D;  5FRN A;  1MBE A;  1MJA A;  2K9S A;  5DTD A;  1ZRE A;  5J40 A;  4L5E A;  2HQR A;  4II2 A;  1HXD A;  2OBP A;  5EGO A;  2E1O A;  2ZFU A;  4ENJ A;  5E1Z B;  1SFO J;  2DDB A;  2M5W A;  4P5O A;  3A1Y A;  4M3F A;  5KAF C;  5BPI A;  5FFX A;  2DCE A;  2DA4 A;  1ZK8 A;  5IT9 K;  3FDY A;  2XGE A;  2EZL A;  2DQR A;  4I2O A;  1MD0 A;  1M1E B;  2BBY A;  2JTV A;  4CXF A;  3BQY A;  2QSG X;  4KIB A;  5DDG A;  4ZH4 F;  4KDP A;  1PUF B;  4R8H A;  4A0X A;  3ABL H;  1VF9 A;  2NNN A;  4AYB A;  1ZGA A;  4B4C A;  1B59 A;  2EB7 A;  3TKY A;  3V7R A;  1TC3 C;  4JX5 A;  4QLC U;  2MH9 A;  1ETV A;  3F23 A;  2XIG A;  3SDB A;  2M7B A;  2VE9 A;  1HOM A;  4NHJ A;  4KMU X;  1S7A A;  2BW3 B;  1TL8 A;  1QVU A;  4PSW A;  3Q0W A;  1BIA A;  4HNV A;  3CF5 F;  5F08 A;  4BU2 A;  4B3A A;  4BBS J;  3OYM A;  2ZFW A;  3ZRG A;  1N75 A;  2QQ9 A;  1T33 A;  5FLV A;  3DWL E;  1OQY A;  1ZG1 A;  2RNJ A;  2LF8 A;  4E7L A;  5FLX K;  2KRC A;  3K70 D;  2DDA A;  2DK5 A;  1R00 A;  4B1R A;  1ZTR A;  5F27 A;  1XGS A;  3MWM A;  3HXL A;  4IRH A;  1R1U A;  2LBF A;  2DA7 A;  2HVS A;  2AQE A;  2VKD A;  1IRZ A;  4ZC3 A;  1VFC A;  3K1P A;  2HZD A;  4BJ6 C;  5J6X A;  4N0B A;  3MD2 A;  1FIP A;  3FXJ A;  3LQR A;  4WXC A;  2WAF A;  1D0Z A;  1Y0U A;  5M3F J;  1F5T A;  3JRE A;  2PMH A;  2CV0 A;  3W2A A;  2VUM J;  3IHU A;  2DPD A;  3A2K A;  1TNT A;  5D4R A;  2OC6 A;  2AXL A;  2MC3 A;  1P6R A;  4M71 A;  4Z6Y A;  4ETS A;  3I59 B;  3Q9S A;  5BS6 A;  1T8I A;  1JKQ C;  4M9X A;  2HEO A;  2JVH A;  2CWE A;  3TL4 X;  4EM0 B;  1MSF C;  1ONV A;  1VQK I;  4HST A;  2ZSI B;  4PGH A;  2QQB A;  2VQH A;  2PFB A;  4S0H B;  3VWB A;  1HDP A;  3BTI A;  1I3Q J;  1X1C A;  1HBX G;  4PDK A;  2P5L C;  2VT3 A;  4A5M A;  2QZ8 A;  3D0S A;  1NHA A;  5ILS A;  5H20 A;  1ZH5 A;  2R7V A;  3FM3 A;  1OPC A;  4I99 C;  2GXG A;  3CF2 A;  5GP9 A;  1W0T A;  2M87 A;  3HDD A;  3DEU A;  4IF4 A;  3R4K A;  1ACI A;  2L4A A;  1DP7 P;  1R6R A;  4O3M A;  2V9V A;  3RQI A;  1QGP A;  1JTY A;  3G1L A;  1P4W A;  3JRI A;  3ZQH A;  3DTE A;  1UFM A;  3DCF A;  1O3S A;  3BZ6 A;  2JK3 A;  4IHX A;  1QZY A;  5M5X J;  3DLA A;  3FXL A;  1W5T A;  1YG2 A;  4P1W A;  3ROU A;  5IOZ A;  1GXQ A;  2QM3 A;  3I53 A;  4IOA F;  3OIP A;  3J81 K;  1Y1V J;  4XLF A;  3CZ6 A;  3BQZ A;  2IA1 A;  1EJ9 A;  4PCQ A;  3BOQ A;  3CO6 C;  3Q9V A;  5HDK A;  1PDN C;  2Z1D A;  4B44 A;  1FSE A;  2UXX A;  3AL0 B;  3F21 A;  1X1P A;  1RRJ A;  1GUU A;  1TQM A;  1U0J A;  3FIS A;  3C2B A;  3F8N A;  1U5T B;  3KEO A;  1S6L A;  4BAC A;  1IN7 A;  1O3Q A;  4Y15 A;  3CDH A;  1REP C;  1X1D A;  2CQN A;  2M8G X;  3N97 A;  1FWZ A;  3K0L A;  4AUX A;  1P7I A;  3BCB A;  4M3G A;  4U0W A;  4NBQ A;  3TO9 A;  3GXO A;  4J19 A;  4UY8 I;  4MTE A;  4KUM A;  4PJ0 C;  5D6F A;  2XAH A;  4RAG A;  2AQF A;  4XID A;  4QTR A;  3B73 A;  1KU7 A;  3OS0 A;  3O8H A;  3AKZ A;  3OYD A;  2M9H A;  3F8B A;  2JPC A;  1PP7 U;  1V3F A;  5AON A;  5HNF A;  2ZJ2 A;  2DJI A;  1WH7 A;  1FYK A;  3OYE A;  2IP2 A;  2RC4 A;  3QPS A;  1X3Z B;  5F0H A;  1ON1 A;  4X0G A;  5BMZ A;  3DTI A;  2X51 A;  4NC8 A;  1D1C A;  1JUP A;  3HSR A;  1K78 A;  2W00 A;  5HDG A;  2LF7 A;  5B1A H;  4EJV A;  4I0B A;  1W7P A;  4XOP A;  1MMS A;  2VJI A;  3WU0 A;  3U1K A;  3SFZ A;  3JR9 A;  5IT3 A;  3JSO A;  3K4J A;  1YRN B;  2E2H J;  4RM2 A;  4GCV A;  2Z5U A;  2C6Y A;  5EYR A;  5LHH A;  4RM3 A;  1W0U A;  2X1D A;  4YEJ A;  1IRX A;  1UZC A;  2PBI A;  4LLG F;  2WAQ N;  3W6K B;  4OIR F;  4G6D A;  3NQO A;  3FXM A;  4KMF A;  1OMI A;  1FC3 A;  2JUC A;  5FD6 A;  3MKY B;  3CLO A;  4BKX A;  3FXO A;  1J2X A;  1B72 B;  4Y17 A;  1ETX A;  5EZG A;  1OR7 C;  4RLF A;  1ZHF A;  2YU9 J;  5J8F A;  2DOA A;  5FKN A;  2EBI A;  2CV2 A;  5IYB J;  2HI3 A;  3F6O A;  1MBJ A;  3GTM J;  5DD8 A;  3LSM A;  3CC2 I;  1LFB A;  2BEO A;  4PZJ A;  3WHB A;  3NAU A;  2E36 A;  4G8X A;  5LD2 C;  2XRL A;  1LEB A;  3R0A A;  2R7T A;  2YU3 A;  4FIS A;  2K9Q A;  3QP6 A;  2GOM A;  2XGD A;  2E35 A;  2JSP A;  4CSW A;  1WJE A;  3LSG A;  5E3L A;  4IRI A;  3HOW J;  4EV0 A;  4DJA A;  1BIB A;  1WJD A;  2JMW A;  4AM3 A;  1MND A;  1QHG A;  1ZYR F;  4IRG A;  1MMN A;  4U0Y A;  3S1Q J;  2Q8K A;  2WAE A;  1IDY A;  2Y75 A;  1UST A;  4EJO A;  1HKT A;  3ZQQ A;  1S7E A;  5H2F C;  2VOD A;  1DP3 A;  2BVL A;  4A2U A;  1D1B A;  3LL7 A;  1N25 A;  5J1R A;  1XCV A;  3GFL A;  1B9M A;  1FPQ A;  4KJZ A;  3HKZ A;  3L7W A;  3LWF A;  5DD4 A;  3Q3S A;  2B0L A;  4RLQ A;  3OIO A;  4XM3 A;  2LBF B;  3GTQ J;  1LE8 A;  3FXK A;  1TP4 A;  3IUO A;  1ORK A;  3JAM Z;  3LSK A;  3F72 A;  2O8K A;  4J00 A;  3GLL A;  3LSJ A;  3ZQL A;  3ABU A;  3LSH A;  4Y33 A;  3DBH B;  2LR8 A;  2YPR A;  2DA2 A;  2EFO A;  1ZG5 A;  3KET A;  5ED4 A;  3ASN H;  2GWR A;  4IEJ A;  5C44 J;  4MEY F;  4ENM A;  2LP0 A;  3ISP A;  4ZTJ A;  2H6C A;  1MBH A;  2HWV A;  2LKS A;  5FRO A;  1Z21 A;  2N8G A;  2F4O B;  5K5O A;  5CVU A;  5L3D A;  2X4H A;  3PQJ A;  2XB0 X;  4RAF A;  4HQE A;  5C4J J;  2B9S A;  1UG0 A;  3GZN B;  3I58 A;  5LHI A;  2E60 A;  4D0P A;  1TQP A;  2MLG A;  2VIX A;  1XDU A;  3CLQ A;  1FOX A;  1S7O A;  2VE8 A;  4BXX J;  3S15 J;  1T6S A;  3CC7 I;  2DO7 A;  1BL0 A;  3CCQ I;  1FBS A;  1UEL B;  2W4S A;  4KA4 A;  2W25 A;  3EUH C;  5DCF A;  4DBR A;  1FOY A;  2KT0 A;  1Z1D A;  4E7K A;  5EG0 A;  2R7Z J;  2W48 A;  1BOA A;  2V9P A;  5F1J A;  3S2W A;  1T08 B;  4IVN A;  4RAY A;  5DYM A;  1O4X A;  5FD5 A;  1VQ4 I;  2NXN B;  3QOP A;  2DOE A;  4IHV A;  3TP0 A;  2MC4 A;  3KZZ A;  2M7A A;  4JX4 A;  1RR7 A;  3HOV J;  4PJN A;  3KFW X;  3IAS 2;  4RGS A;  2DN0 A;  4E4H A;  3PIP F;  3CJR B;  4NB5 A;  4I98 B;  4U87 A;  4CH7 A;  2DQL A;  4CYD A;  1VQ5 I;  1TT0 A;  2EIN H;  1FOW A;  4M73 A;  2VBX A;  3GO5 A;  2M3A A;  3EQL F;  3S93 A;  4BJ5 C;  1PYV A;  4C9Y A;  4E7H A;  2VPL A;  4CGZ A;  3OS2 A;  3R60 A;  1IDZ A;  3C3W A;  2ZJR F;  4P96 A;  5HLT A;  5GTH C;  4BE0 A;  2VON A;  2R7X A;  3DFG A;  1MH3 A;  4MNU A;  2EWN A;  3ZGK A;  4CCM A;  2FA5 A;  4HZF A;  4MIM A;  4H4K C;  2WWY A;  2F5E A;  3P9K A;  4MFD A;  2DT6 A;  3L2C A;  4XKW A;  1O57 A;  2ICW G;  2W24 A;  3WOD F;  4OIQ F;  2CU7 A;  3IWF A;  2EIJ H;  1G8X A;  3G73 A;  4OOI A;  5B1B H;  4NUB A;  2E7W A;  3PUF A;  3LST A;  3ML6 A;  2ECB A;  5LBQ A;  4LGW A;  2QF7 A;  4P55 A;  4F52 A;  1IN6 A;  2XF5 A;  1U3E M;  2Z3Y A;  2K02 A;  1A31 A;  2P5V A;  3CMM A;  3A4C A;  2VAS A;  4BHB A;  4D7N A;  1B6A A;  3V7C A;  1QPM A;  3WTU C;  2O03 A;  1IUY A;  3PUB A;  4BXF A;  2JA5 J;  2OTJ I;  1IXR C;  3GVA A;  4LK1 F;  1K78 B;  2IJL A;  2LH9 A;  2BW3 A;  3OL3 A;  5D6E A;  1ERD A;  2HVQ A;  1HW2 A;  1W7P B;  3K4B A;  2HPM A;  3RPU A;  3HC7 A;  2VB6 A;  2P8T A;  4KIT B;  3ERM A;  2FML A;  2QSH X;  1ZEL A;  3J80 Z;  2BOL A;  3RKY A;  1R36 A;  4ENN A;  1U8R A;  3FK6 A;  4C2T A;  3GBG A;  4IL6 C;  1XN7 A;  5KAI C;  5FJ8 J;  1IN8 A;  1MNM C;  4XOT A;  3HOT A;  3I3L A;  1I27 A;  4I6Z A;  3PNT A;  2HOT A;  1JXS A;  1XB4 A;  3DKX A;  1ZLJ A;  1OJL A;  2VL8 A;  3A01 B;  4HG2 A;  1BJA A;  4PJM A;  2G7U A;  3T0Y A;  4W1U A;  2X0L A;  2FOK A;  5FKO A;  5DV5 A;  1DDN A;  5H6R A;  4J01 A;  1STZ A;  4ZDO A;  1VQ7 I;  3C2G A;  3BC8 A;  2GBY A;  3GTK J;  3ULQ B;  4ZDL A;  2LK2 A;  2OUM A;  3CCV I;  4UNO A;  4OMY A;  1QZZ A;  3I59 A;  5L3E A;  1POG A;  2WY7 Q;  1LJ9 A;  2CUJ A;  3NEU A;  1RR8 C;  3ZOB A;  3ZQ7 A;  3T5X A;  2XSJ C;  4HA8 A;  2ZB9 A;  1ETQ A;  4LG0 A;  1H0M A;  1IXS B;  3ELK A;  2FEZ A;  3G71 I;  2IAI A;  3EUK L;  4A3G J;  2ZME C;  2R0Q C;  4KFC A;  3C7J A;  3GX4 X;  1WVR A;  1TW2 A;  1S5L C;  2YUS A;  5HS9 A;  3PJR A;  1GVD A;  4UV9 A;  2IXS A;  2QYO A;  4B48 A;  2WC2 A;  4CCN A;  3H5A A;  5KVR A;  3JRH A;  2XHK A;  1WJ5 A;  2KIS A;  1FEX A;  1YS7 A;  1BC7 C;  2CGP A;  2GIV A;  3K4C A;  2DOF A;  4FTH A;  4EGZ A;  1WI9 A;  1J5Y A;  5FO5 A;  3FMQ A;  3ZR8 X;  4F7Z A;  1QRY A;  1B8I A;  3FMS A;  3S8P A;  4EVI A;  2HOS A;  1KON A;  3QU6 A;  1SMT A;  5CVR A;  3HBL A;  2E1N A;  2K27 A;  4C3I J;  2L54 A;  2G7H A;  2ME0 A;  4V2F A;  2KLO A;  2RV8 A;  4UUS A;  3OYH A;  3FM5 A;  3BRO A;  1A35 A;  5ERI A;  4DZJ A;  3OYK A;  1I50 J;  1MKM A;  3TO7 A;  2KDZ A;  3MKW B;  4XSX F;  3RJP A;  4A6E A;  4RB2 C;  1A6I A;  3H36 A;  3K4K A;  5M5Y J;  3E1S A;  3SFI A;  1U5T A;  1PVE A;  5F64 A;  4H0E A;  2E1M B;  4XLA A;  3WTS C;  3I4P A;  5J4V A;  2R92 J;  1MJ9 A;  1TW3 A;  4LIT A;  2V26 A;  2MD0 A;  4N4N B;  2FQ4 A;  1LDJ A;  1G4D A;  1LUJ B;  1OCR H;  3SXY A;  2FNA A;  3OYL A;  2V1U A;  4LG3 A;  3BR3 A;  2Y2Z A;  2XGC A;  3OYN A;  4BDZ A;  3I54 A;  1YLF A;  1SD4 A;  4I7H A;  3N4M A;  3LFK A;  1E17 A;  1SMY F;  1Z6R A;  2A61 A;  3J7Y J;  1FSH A;  2V7F A;  4XLE A;  4BEH A;  3OIQ A;  1ZKG A;  3S2D J;  3ZMV A;  3K10 A;  3AG4 H;  1W4M A;  3QU3 A;  2LD5 A;  2JUG A;  2GM4 A;  1MIJ A;  2ELK A;  2IGN A;  1YHQ I;  4WCG A;  3S1R J;  5EG0 B;  4PGG A;  4A93 J;  1BI3 A;  5E3N A;  1I6X A;  1ZGW A;  2A5W A;  2ZXI A;  4EJW A;  1JKR C;  4EAT A;  3GFJ A;  4E6K G;  3OY9 A;  2OA4 A;  1D3Y A;  2I8D A;  3J80 K;  3GLX A;  4DOZ A;  5ICG A;  2JSC A;  2JZY A;  3O2P E;  4K2E A;  3ZQG A;  5FKK A;  3HHH A;  2TRT A;  2EFN A;  3TOB A;  4HBL A;  4A3K J;  4RBO A;  4HX4 A;  1ITY A;  3DLL F;  1UJ8 A;  1I1S A;  1OYW A;  3FKJ A;  4OIO F;  1XTA A;  1CF7 A;  3S3N A;  5A2Q Z;  2E5N A;  5ICE A;  2P7V B;  3MFK A;  2CQK A;  1BBY A;  4ABZ A;  4XK4 A;  2X6O A;  4IJA A;  5LGU A;  2ID6 A;  4CA0 A;  1YJW I;  1JHF A;  1GXP A;  2V9K A;  1B72 A;  2XAQ A;  3G2B A;  3KYC B;  1DU0 A;  3E6B A;  4XL9 A;  2QKL B;  3HRS A;  3LA2 A;  4M6X A;  1NK2 P;  2DA1 A;  1XMA A;  2IBD A;  4BGD A;  4F91 B;  2JQ7 A;  2NVX J;  2Z33 A;  2COM A;  1UAA A;  2B63 J;  2HYF A;  2UUZ A;  1KU2 A;  3TGN A;  2EIM H;  2L9S A;  5CJ9 A;  3J7A Y;  1KU9 A;  2F4M B;  1RKW A;  1F43 A;  3F22 A;  1G3T A;  3GTP J;  2KDO A;  1WJA A;  2RKH A;  5HLH A;  2RVC A;  2YS9 A;  2VQC A;  3KEQ A;  1ETK A;  5L3F A;  3KYL A;  3HRM A;  2HTJ A;  2WB1 A;  4PFP A;  5ILU A;  1Y39 A;  1VND A;  2PMZ A;  1TZL A;  2VKH A;  2OCC H;  1JGS A;  3AFH A;  2V4J C;  2Y9Z A;  3CDL A;  1ZRF A;  5JI6 A;  3WGH A;  1AOY A;  2L3D A;  2HQN A;  4IHW A;  4KIS A;  3HTU A;  2DOD A;  3KCC A;  3GFI A;  3CP2 A;  2EA4 A;  1QHH D;  1YX3 A;  2OQG A;  2V1N A;  3L2U A;  1OYI A;  4JYK A;  3PNY A;  4LD5 A;  1ZAO A;  2EZI A;  2TDX A;  3HL2 A;  2KRF A;  3FF5 A;  2UZK A;  3BPV A;  1V4R A;  4ENK A;  1LFU P;  3TMO A;  3EPZ A;  1T2K A;  5E17 F;  4YIF A;  2ELJ A;  4XN3 A;  4HDV A;  3PFI A;  1APL C;  2FRH A;  3GZ5 A;  3RYP A;  3L2V A;  1YS6 A;  2FX0 A;  2RDP A;  2GA2 A;  2O3F A;  3KZY A;  4ZYG A;  2VT2 A;  2RAE A;  3M8E A;  4XRS G;  1E3H A;  4X6A J;  1LDK B;  3M9A A;  4PJJ A;  3WE3 A;  2AO9 A;  3TW6 A;  3DTK A;  2JJ7 A;  4CCL A;  5LHG A;  3S3O A;  1EA3 A;  4AYB N;  5D5X B;  2ISZ A;  3IH2 A;  5TRD A;  2L7F P;  3PSF A;  1U8B A;  1WSU A;  1YFH A;  3CCY A;  3CUQ C;  1G3W A;  2FF4 A;  2ZSH B;  3ABT A;  1QPI A;  1FT9 A;  3V42 A;  5B3S H;  2XAJ A;  1JI8 A;  2VQL A;  3MN2 A;  3NRV A;  2F5C A;  5LGT A;  1FZP B;  1TWA J;  4CYC A;  5HS8 A;  4LG0 B;  2MFZ A;  4HRI A;  2R5Y A;  4ESF A;  4QIW N;  4IQ4 A;  4A3J J;  1AHD P;  3FZV A;  4HF2 A;  1F36 A;  2A68 F;  4YII A;  4L9N A;  5L3G A;  3DQV C;  3HSE A;  1JKO C;  1RNL A;  1EKE A;  1KA8 A;  2R4G A;  3BG5 A;  2NVT J;  2CO5 A;  4XLP F;  3K2Z A;  1RZ4 A;  2XDV A;  4XLC A;  1SAN A;  1IV8 A;  1BN5 A;  1DGW Y;  3BG3 A;  3DEW A;  2UWM A;  2L0K A;  4HLX A;  4G7O F;  5F0C A;  4BS9 A;  1AU7 A;  2BGC A;  4BE2 A;  1LNW A;  1B8I B;  4L0Y B;  2P5K A;  4ZJZ A;  1T39 A;  4LJZ F;  5IP7 J;  2R7Q A;  5J3L A;  1BR2 A;  2HXI A;  5A2Q K;  1PP8 F;  2L9N A;  4AU7 A;  3QYE A;  1ZR2 A;  2R3S A;  2PX9 A;  3QRF F;  1NH3 A;  4BQA A;  4UUS B;  2Y69 H;  3K1N A;  1TQI A;  4GDF A;  5HS7 A;  2P0W A;  2DFI A;  5LGN A;  5JHU A;  3IAM 2;  2EJR A;  3RZO J;  2DTZ A;  3BR2 A;  2G9W A;  3DPL C;  1X2N A;  5LRS A;  3VSL A;  2HDW A;  3ZP5 A;  2KFD A;  1KQ8 A;  3HOS A;  2QVO A;  3PQK A;  3WU2 C;  1RKT A;  1W36 D;  5FKM A;  3NWS A;  3LA7 A;  2PJR A;  3HOY J;  3FK7 A;  2YSR A;  2QEX I;  4XRM A;  2XPU A;  3E5U A;  2Z2S B;  5AIQ A;  1SVL A;  2Z16 A;  5ICF A;  4IO9 F;  3R61 A;  3PFY A;  2JPB A;  3FHN A;  4E70 A;  1FOK A;  4Y13 A;  1GDT A;  1Q1H A;  3VFZ A;  4BEH B;  3ONQ A;  2OTL I;  2DFF A;  2X85 A;  4OAY A;  1X1A A;  3ERE D;  4U0V A;  5FFZ A;  3DU6 A;  9ANT A;  3G3Z A;  4MTD A;  5CLS A;  3SZG A;  3JTG A;  1KGS A;  4XON A;  1OR7 A;  4HOB A;  3MZY A;  4HPQ A;  2OPT A;  4YG2 F;  1Y0N A;  2Q2E A;  3BJO A;  1K6O A;  2PG4 A;  3EYI A;  4I02 A;  3JTH A;  1IF1 A;  3VYT B;  2CFX A;  2IGK A;  4A3E J;  1X19 A;  3ZQI A;  1TWC J;  4S04 A;  2JWT A;  1W1W E;  2GOX B;  3BJA A;  4C2M J;  3I71 A;  5LEJ A;  4NC7 A;  2NS0 A;  3HOX J;  2KL4 A;  4UUT A;  2DA6 A;  2XF7 A;  4IX7 A;  1CF7 B;  1QBJ A;  4DYQ A;  1GV2 A;  2WV1 A;  4HNU A;  3L9F A;  1LDD A;  2ISY A;  3T8T A;  3CCL I;  1G3Y A;  1TBX A;  5EZH A;  4ZTF A;  3I9V 2;  2X1C A;  4II3 A;  4MGR A;  1R9T J;  1Y8Q B;  2XGX A;  3CQZ J;  2XRN A;  2V1D A;  3OR2 C;  3A01 A;  3H0D A;  3QPL A;  1OIS A;  2J5P A;  3V7S A;  4B47 A;  1MMG A;  2VBZ A;  3M8F A;  1R7J A;  3BY6 A;  2QCO A;  4HX7 A;  5J1U A;  2D1H A;  3OYI A;  2DW4 A;  3JRC A;  2XRO A;  2ESN A;  1IO2 A;  1MW7 A;  1HW5 A;  4C30 A;  2FBI A;  3TOA A;  5J1Y A;  2DA5 A;  4XLH A;  2XV4 S;  1LKX A;  3A02 A;  1FYL A;  2P81 A;  1ETO A;  5F04 A;  4QPO A;  2XAF A;  1Y8R B;  3PNV A;  5LRR A;  2CFO A;  3CCR I;  1RI7 A;  1Y6I A;  2LC2 A;  3KE2 A;  2RNG A;  3HSF A;  4E7J A;  4U7D A;  4JBA A;  3P9I A;  1ZR4 A;  4JP0 A;  2MSY A;  4GO1 A;  2VJJ A;  3CCM I;  4CO8 A;  3ABK H;  5JFR A;  2K85 A;  1T0F C;  3EET A;  3DV8 A;  1P7J A;  4M3B A;  2L9V A;  4F92 B;  2JVG A;  4Q4Z F;  3C18 A;  2YR2 A;  4BNC A;  1LEA A;  5D5V B;  1HST A;  2MA3 A;  4ZDP A;  4A0Z A;  3BG6 A;  1IW7 F;  2DJN A;  2CV1 A;  2H8R A;  1Y1W J;  3KP6 A;  2M0M A;  1PUE E;  1MSE C;  3JCU C;  3D1N I;  3H3V K;  3ZMZ A;  3LA3 A;  1J0R A;  1BI0 A;  1SAX A;  5F1R A;  3EUH A;  5BPD A;  1FX7 A;  1B1B A;  1NK3 P;  4OIP F;  4IPA A;  4EM2 A;  2I10 A;  2AS5 F;  3VDX A;  4GXO A;  2EFW A;  5E1W A;  4LIU A;  4CCO A;  2LRE A;  1FLI A;  1ZGJ A;  3SYT A;  4QSH A;  1H9G A;  1K79 A;  3KP7 A;  4CZZ A;  2HKO A;  5K7Z A;  4D7M A;  1KYW A;  2OF7 A;  4I0A A;  2DMU A;  2CW7 A;  5LLQ A;  5FB2 A;  2L02 A;  1ZRD A;  2F2E A;  2NOJ B;  5FLM J;  1Z0X A;  4CYC B;  2NVY J;  2R5Y B;  4XKB A;  3GEZ A;  3FHZ A;  2L01 A;  1JT6 A;  1MBK A;  3VOD A;  4BDY A;  3HUG B;  3GWZ A;  2ZXH A;  1J75 A;  1UHW A;  2COB A;  2BYV E;  4AIJ A;  5LEK A;  2CW8 A;  1DPU A;  2HQ5 A;  3BZK A;  3PIO F;  3HKZ N;  2PMU A;  2JA7 J;  3HPG A;  3OYA A;  5IYD J;  2KHM A;  3MEX A;  3WG7 H;  4BJT A;  2IS4 A;  2ACJ A;  3K4L A;  4F55 A;  2F48 A;  4MQ9 F;  2WTE A;  3TED A;  3K70 C;  4L9T A;  4A3B J;  2OU2 A;  2OD5 A;  4BYY A;  2IT0 A;  2CH0 A;  4UHT A;  3IKT A;  4HLY A;  2WBM A;  5DS9 A;  3E97 A;  5CVI A;  3O6B B;  3RCO A;  3M07 A;  1R71 A;  4CDG A;  3WGI A;  4V19 K;  5BNG A;  2IS2 A;  1USS A;  3E3V A;  4E7S A;  3GUD A;  1WHU A;  1K4T A;  3B6C A;  4FAS D;  1MDM A;  2KJB A;  1HA8 A;  4UUV A;  4V2G A;  2ZJP F;  3KLO A;  3M8J A;  1WRJ A;  4RA2 A;  3T8R A;  2W84 A;  3HGY A;  3ZMU A;  5D5U B;  3OOU A;  3M4O J;  2CUE A;  4IHY A;  4XR6 A;  1ZQ3 P;  3IRQ A;  4WXD A;  5KHD A;  2P6S A;  3HYI A;  5ICC A;  5E8G A;  4KT5 C;  2RN7 A;  4HV5 A;  3FBI B;  2PJR B;  1SVO A;  3MKL A;  3QYB A;  1FBU A;  2A5Y B;  3DXJ F;  3WTV C;  5D4S A;  2KP6 A;  3BR6 A;  3OYC A;  4M9Z A;  2M30 A;  4HF0 A;  5EEA A;  4L9J A;  2CRG A;  5HOD A;  1GVJ A;  5K5R A;  3ECO A;  1IZ1 A;  1JUM A;  2JN6 A;  2VBY A;  1XPX A;  4AD9 A;  3CCS I;  2Q0O A;  5FRM A;  4XIC A;  1QZE A;  3G4S I;  1I1G A;  2EH3 A;  2A6T A;  3RQ4 A;  1LVK A;  2QUF A;  3OWT A;  1SFE A;  4RS8 A;  3JRF A;  3ZXS A;  1JT0 A;  1SFK A;  4YFX F;  1MNE A;  1MBF A;  3AG3 H;  2VOO A;  2XUB A;  3FBN B;  2BE5 F;  3HPH A;  2Q2E B;  3AAF A;  3CTA A;  2DI3 A;  1WJB A;  1DPR A;  2IVM A;  2VI6 A;  3GTO J;  3K4N A;  4DYC A;  2DT5 A;  1BA5 A;  2VC1 A;  2Y0S A;  3EYY A;  3FX3 A;  2AHQ A;  5D5W B;  2EFQ A;  3BR5 A;  2X9D A;  3E5X A;  3PM1 A;  3KP3 A;  2MD5 A;  1FBQ A;  3A03 A;  4AIH A;  3IH4 A;  1OLT A;  3SEZ A;  3OOP A;  3OV8 A;  3JAM K;  2M2E A;  2RQP A;  1IC8 A;  3RTR A;  2KPM A;  2HDC A;  2H8W A;  3ZN1 A;  1VQO I;  2MG4 A;  3PSI A;  2ZKZ A;  2XKP A;  4LOC A;  5IPA A;  3CCE I;  4IOC F;  3MKZ A;  2IGO A;  1UMQ A;  2KKO A;  2ZME A;  4L9V A;  4PUS A;  4OU0 A;  1D0X A;  4AVP A;  1W36 C;  1O7F A;  2WY8 Q;  1UHM A;  2FMY A;  2IS6 A;  2ZXW H;  2NVQ J;  5DUI A;  5HLG A;  4BAY A;  1P4X A;  2QEN A;  3QOD A;  5JLW A;  4XOR A;  4ASN A;  2DAO A;  5BQT A;  4GRI A;  1VQ9 I;  3R0J A;  2XVC A;  1WH5 A;  1HF0 A;  5IP6 A;  5GAH J;  1KZH A;  1WJC A;  3HRT A;  2ME6 A;  3UNG C;  2P4W A;  2W57 A;  3HZJ A;  3BTC A;  2HU9 A;  4IQJ A;  4BL0 B;  3FXU A;  3CP8 A;  2A05 A;  2NRA C;  1A6Q A;  2ESH A;  3IL2 A;  2M4G A;  1AKH B;  2R93 J;  3AG1 H;  1RUO A;  1R58 A;  3TDZ C;  1AWC A;  5CVV A;  2R7F A;  4B43 A;  2MLK A;  4XMY A;  4P9U A;  3CO7 C;  5EDN A;  3BZC A;  1Z3X A;  2IA0 A;  2HDD A;  2BZT A;  4JK1 X;  3I55 I;  2R5Z A;  3C1D A;  3K6G A;  1V5F A;  4HV6 A;  4L5I A;  3GTG J;  3TDU C;  5JVT A;  1VQL I;  1W5S A;  3RKQ A;  4R1H A;  4BXU A;  1XDS A;  2VJ4 A;  2MH2 A;  2HOE A;  2HR3 A;  1FP2 A;  1D5Y A;  2PI0 A;  2DU9 A;  2NVU B;  4CCJ A;  5M3M J;  1YW9 A;  3I4N J;  2EV6 A;  3DP7 A;  1EF4 A;  4XRF A;  5E20 A;  3IH3 A;  3K4M A;  3RYR A;  1VZ0 A;  1WQ2 A;  2DYR H; 
#chains in the Genus database with same CATH homology
 4M9S A;  1D8J A;  4OMZ A;  3B02 A;  4ESJ A;  2Y0M A;  3O3K A;  4BHP A;  3JW4 A;  1S8N A;  4ZYE A;  5FLX Z;  2K86 A;  1Z7U A;  3RDI A;  4WF2 A;  2NNY A;  2ZXJ A;  3LAJ A;  2M1B A;  3VEP A;  4MEX F;  2XAS A;  2K4B A;  2HTS A;  2LNB A;  2BV6 A;  2DK8 A;  2O0Y A;  1ZG3 A;  4I01 A;  1J59 A;  1O3T A;  5AIP A;  4AWX B;  2CSO A;  3WTW C;  1HKQ A;  3ZMD A;  4JQF A;  3KP5 A;  3F6V A;  1EH8 A;  1W7P D;  4Z2Y A;  3V8K A;  1JHH A;  3SZT A;  4I09 A;  2J5O A;  2IRF G;  4HYE A;  3GZ6 A;  2JT1 A;  1L3L A;  1RUN A;  3WTY C;  1MDM B;  3HHG A;  2ZNY A;  5CVJ A;  4Q48 A;  1TLH B;  3RKX A;  2DPU A;  1KU3 A;  4G7H F;  2H94 A;  3J81 Z;  4EJU A;  1R1V A;  4RGR A;  1IRG A;  3D5L A;  3T1B A;  3FWE A;  4XBF A;  2KJC A;  2FBH A;  3H3Z A;  2P6T A;  4EM1 A;  1VTN C;  5D8L B;  4U7B A;  3SQN A;  5EEH A;  1XSV A;  4IHT A;  1OKR A;  4B8X A;  4YFN F;  4KIC A;  3CUQ A;  3F3X A;  3I0T A;  1SD7 A;  2QQA A;  2K7L A;  2FSW A;  2ELH A;  3LQQ A;  4NQW A;  2ZBK A;  2CG4 A;  2A6E F;  2IPQ X;  3P9C A;  6PAX A;  3M1E A;  2ZME B;  3I64 A;  2K4J A;  4HAM A;  1Z91 A;  2FNP A;  2FXA A;  2D45 A;  4G7Z F;  3WG9 A;  4M6Y A;  1L0O C;  1RIO H;  4A5N A;  2A6H F;  1LVA A;  4HW0 A;  1F4K A;  4LK0 F;  3KP4 A;  1JE8 A;  1IAW A;  1K7A A;  1ODD A;  4OIN F;  1R5G A;  3RPQ A;  1Z05 A;  3E6D A;  1IXC A;  3JSP A;  1J7K A;  5K1Y A;  3HUG A;  1U2W A;  2DBB A;  3FXR A;  1QO0 D;  4YFK F;  2GQQ A;  2EA2 A;  1EH7 A;  1XGM A;  1YTY A;  2HKX A;  5J8C A;  2NAZ A;  4EJT A;  2H27 A;  3U9G A;  3E6M A;  1QQI A;  3ZMT A;  1YIO A;  4ZYD A;  1KYZ A;  2Y48 A;  5E8I A;  2PQ8 A;  2NYX A;  1F9N A;  1YW8 A;  3RIR A;  3IRR A;  1TNS A;  3U2R A;  4TV7 A;  4RB3 C;  4KIG A;  4O5V A;  4L5J A;  3V8L A;  1LB2 A;  4RGU A;  2M45 A;  3RKW A;  3HRU A;  3DF8 A;  4RAZ A;  2STT A;  5DCM B;  1YYV A;  1QNT A;  5KK1 A;  2FQ3 A;  4P9F A;  3V8J A;  2VXZ A;  2HS5 A;  4AIK A;  2KIM A;  4HF1 A;  5F6F A;  3MAJ A;  4BH9 A;  4G94 A;  2D2W A;  1C0W A;  1SFX A;  3F8F A;  3QPT A;  1XGN A;  2E7X A;  1P4A A;  3WTX C;  5HLI A;  2XAG A;  3IKV A;  2CW0 F;  3ECH A;  3HIF A;  2EK5 A;  2CYY A;  1B9N A;  3WTZ A;  1T0F A;  4G9Y A;  3W6J B;  2V79 A;  2IW5 A;  3SZP A;  3KLN A;  4ZYH A;  1MJB A;  3GYH X;  1D5V A;  3RI4 A;  2ZO4 A;  2HGC A;  4CIC A;  4HQM A;  5HDN A;  4A12 A;  2EV0 A;  1ULY A;  1SFU A;  1EH6 A;  1BI2 A;  2QLZ A;  4ZZL A;  3VB2 A;  3L09 A;  3V4G A;  1S29 A;  1YO5 C;  1WWX A;  3WU1 B;  1BC8 C;  2H09 A;  2GXB A;  4A0Y A;  4L0Z B;  3QAH A;  3CUQ B;  2OQR A;  1IN5 A;  4FT8 A;  4ZZD A;  1YW7 A;  4LB5 A;  3VOE A;  1O7L A;  4FX0 A;  2ADU A;  2PN6 A;  2EV5 A;  1ON2 A;  1I5Z A;  2E1C A;  1HSJ A;  4KNY A;  5H6Q A;  4IHS A;  3QPH A;  3GW2 A;  2PJP A;  2D1V A;  1R22 A;  3DPT A;  3J7A O;  2P7C B;  4LLL A;  3R6S A;  1O3R A;  2XKO A;  4Q5S F;  2W85 A;  4UVB A;  4CHU A;  3M7G A;  3ZMS A;  4RGX A;  3IC7 A;  2HFH A;  3E5Q A;  4LLN A;  2RGV A;  2R7D A;  1T38 A;  2M8E A;  4UVC A;  2ETH A;  4WK8 F;  5L3C A;  4KYW A;  3CJN A;  1DUX C;  2OZU A;  4EMS A;  2PEX A;  3ZN0 A;  1FYM A;  3SHF A;  4G6Q A;  2L4M A;  4A6D A;  4GGG A;  1BI1 A;  1KQ9 A;  2VOP A;  2LDU A;  1GHC A;  1XGO A;  2QBY A;  1D8K A;  5E1X A;  1XSD A;  4UVA A;  4R79 A;  5ILV A;  2GZW A;  2F5D A;  4N9I A;  3MZH A;  5K5Q A;  4LMY A;  4WXH A;  5HOO A;  3F8C A;  2PLY A;  4RB1 A;  2A69 F;  3IWZ A;  4UXN A;  4N9H A;  3K1M A;  4KN7 X;  3ZPL A;  1ZLK A;  2HYG D;  3BWG A;  1MGT A;  2Z99 A;  1MZB A;  4HX8 A;  4BHC A;  1P92 A;  4LFU A;  4GYG A;  2LKP A;  1FNN A;  3FMR A;  1FP1 D;  3Q5F A;  3KP2 A;  4EQQ A;  4L18 B;  2WV0 A;  3BJ6 A;  4XLN F;  3MCZ A;  3MQ0 A;  2STW A;  2ZNZ A;  3H3U A;  3K9T A;  1UB9 A;  1XCB A;  4MQV A;  1ZAR A;  1HW1 A;  3U1D A;  3WGG A;  4S05 A;  1F1Z A;  5FGM A;  1E2X A;  3QP5 A;  1HQC A;  4DQ2 A;  1A04 A;  2VBW A;  5D8K B;  4EGY A;  2OZ6 A;  2FE3 A;  1EV7 A;  4HDU A;  3CUO A;  2F5F A;  1J9I A;  3DKW A;  4FX4 A;  2V6C A;  3LAP A;  3HTS B;  2V1X A;  2GAU A;  4ESB A;  1R23 A;  2O8X A;  4WWC A;  3EDP A;  2O61 A;  4XSZ F;  1CGP A;  1T98 A;  2QWW A;  5TJJ A;  5IT9 Z;  2LSO A;  5BOX A;  3BPX A;  4UV8 A;  5CYV A;  1TTY A;  1ZN2 A;  5HVQ C;  5DEQ A;  1WKM A;  4KIF A;  1LQ1 A;  1H9T A;  1U78 A;  2DTR A;  2FBK A;  2OAZ A;  2IA2 A;  3WE2 A;  1HKS A;  1KQ0 A;  3BDD A;  2YX7 A;  3E6C C;  1B4A A;  4LB6 B;  5EEG A;  3WTT C;  4WX9 A;  2HZT A;  2Z9O A;  5DCM A;  2JRT A;  1Z9C A;  4FHT A;  1ZRC A;  3P7N A;  3H92 A;  5JR3 A;  1P2F A;  1YQA A;  2KIF A;  4U88 A;  2UXN A;  3TQN A;  3TO6 A;  5E18 F;  1X3U A;  4IXA A;  1SD5 A;  4Q47 A;  2KIU A;  1IN4 A;  5L3B A;  1S3J A;  2EFP A;  4M74 A;  1FY7 A;  2FU4 A;  2DLL A;  1SD6 A;  1Z6T A;  4MHG A;  3FXQ A;  4O6J A;  1XSX A;  2A3S A;  1U6G A;  1IRF A;  1XMK A;  2MBF A;  4ON0 A;  2VC0 A;  4QWQ A;  3L00 A;  2QBY B;  1XD7 A;  2ZCW A;  1R5H A;  2A07 F;  3K69 A;  2GA1 A;  1U5T C;  3GFM A;  2O6G E;  4B09 A;  2VN2 A;  4M72 A;  3F8M A;  1R1T A;  3I5U A;  1G3S A;  4GYI A;  5DUK A;  2YX4 A;  1G6N A;  3GF2 A;  4DNC A;  2H6B A;  3BP8 A;  1BM9 A;  4RB0 A;  4KN4 X;  3COA C;  1OYY A;  1UCR A;  3REO A;  1MJA A;  1ZRE A;  2HQR A;  1HXD A;  2OBP A;  4ENJ A;  5E1Z B;  2M5W A;  4P5O A;  5BPI A;  5FFX A;  5IT9 K;  2DQR A;  4I2O A;  1MD0 A;  2BBY A;  2JTV A;  4CXF A;  4KIB A;  5DDG A;  4ZH4 F;  4KDP A;  4R8H A;  4A0X A;  2NNN A;  1ZGA A;  1B59 A;  2EB7 A;  3TKY A;  3V7R A;  4QLC U;  2MH9 A;  3F23 A;  2XIG A;  2VE9 A;  4NHJ A;  4KMU X;  1S7A A;  1BIA A;  2ZFW A;  2QQ9 A;  1ZG1 A;  2RNJ A;  2LF8 A;  5FLX K;  2DK5 A;  1R00 A;  1XGS A;  3MWM A;  4IRH A;  1R1U A;  3K1P A;  5J6X A;  4N0B A;  3LQR A;  4WXC A;  1Y0U A;  1F5T A;  2PMH A;  3IHU A;  2DPD A;  1TNT A;  5D4R A;  2AXL A;  2MC3 A;  1P6R A;  4M71 A;  4ETS A;  3I59 B;  3Q9S A;  5BS6 A;  4M9X A;  2HEO A;  2CWE A;  4EM0 B;  1ONV A;  4PGH A;  2QQB A;  2PFB A;  1HBX G;  2P5L C;  4PDK A;  4A5M A;  2VT3 A;  2QZ8 A;  3D0S A;  1NHA A;  5ILS A;  5H20 A;  1ZH5 A;  3FM3 A;  1OPC A;  2GXG A;  2M87 A;  3DEU A;  4IF4 A;  3R4K A;  2L4A A;  1DP7 P;  4O3M A;  2V9V A;  1QGP A;  1P4W A;  1UFM A;  1O3S A;  3BZ6 A;  1QZY A;  1W5T A;  1YG2 A;  3ROU A;  1GXQ A;  2QM3 A;  3I53 A;  3J81 K;  2IA1 A;  4PCQ A;  3BOQ A;  3CO6 C;  3Q9V A;  5HDK A;  1PDN C;  1FSE A;  2UXX A;  3F21 A;  1TQM A;  3F8N A;  1U5T B;  3KEO A;  1S6L A;  1IN7 A;  1O3Q A;  4Y15 A;  3CDH A;  1REP C;  3N97 A;  1FWZ A;  3K0L A;  4U0W A;  3TO9 A;  3GXO A;  4MTE A;  4KUM A;  5D6F A;  2XAH A;  3B73 A;  1KU7 A;  3F8B A;  2JPC A;  1PP7 U;  1V3F A;  5AON A;  2ZJ2 A;  1FYK A;  2IP2 A;  2RC4 A;  1ON1 A;  5BMZ A;  3HSR A;  1K78 A;  5HDG A;  2LF7 A;  4EJV A;  4I0B A;  1W7P A;  3WU0 A;  3SFZ A;  5IT3 A;  3JSO A;  4GCV A;  2Z5U A;  2C6Y A;  5LHH A;  2PBI A;  4LLG F;  3W6K B;  4OIR F;  4G6D A;  3NQO A;  4KMF A;  1OMI A;  1FC3 A;  5FD6 A;  3CLO A;  1J2X A;  4Y17 A;  1ZHF A;  5J8F A;  3F6O A;  5DD8 A;  2BEO A;  4PZJ A;  4G8X A;  1LEB A;  3R0A A;  2YU3 A;  3QP6 A;  4IRI A;  4EV0 A;  1BIB A;  1ZYR F;  4IRG A;  4U0Y A;  2Q8K A;  2Y75 A;  1UST A;  4EJO A;  1HKT A;  2VOD A;  4A2U A;  1XCV A;  3GFL A;  1B9M A;  1FPQ A;  3L7W A;  3LWF A;  5DD4 A;  2B0L A;  3JAM Z;  3F72 A;  3ABU A;  2YPR A;  2EFO A;  1ZG5 A;  3KET A;  5ED4 A;  2GWR A;  4MEY F;  4ENM A;  3ISP A;  2H6C A;  2HWV A;  5K5O A;  5CVU A;  5L3D A;  2X4H A;  3PQJ A;  4HQE A;  3I58 A;  5LHI A;  4D0P A;  1TQP A;  2MLG A;  1XDU A;  1S7O A;  2VE8 A;  1T6S A;  2DO7 A;  1FBS A;  4KA4 A;  2W25 A;  5DCF A;  1Z1D A;  1BOA A;  3S2W A;  4IVN A;  4RAY A;  5DYM A;  5FD5 A;  3QOP A;  3KZZ A;  3KFW X;  4RGS A;  4NB5 A;  4I98 B;  2DQL A;  4CYD A;  4M73 A;  2VBX A;  3GO5 A;  3EQL F;  4CGZ A;  3R60 A;  3C3W A;  4P96 A;  2VON A;  3DFG A;  4MNU A;  2EWN A;  2FA5 A;  4HZF A;  2WWY A;  2F5E A;  3P9K A;  3L2C A;  3WOD F;  1O57 A;  2W24 A;  4OIQ F;  3IWF A;  3G73 A;  4OOI A;  2E7W A;  3LST A;  3ML6 A;  5LBQ A;  4LGW A;  4P55 A;  1IN6 A;  1U3E M;  2Z3Y A;  2K02 A;  2P5V A;  4BHB A;  1B6A A;  3V7C A;  1QPM A;  3WTU C;  2O03 A;  1IUY A;  1IXR C;  3GVA A;  4LK1 F;  1K78 B;  2IJL A;  5D6E A;  1HW2 A;  1W7P B;  3RPU A;  2P8T A;  2FML A;  3J80 Z;  3RKY A;  1R36 A;  4ENN A;  1U8R A;  1XN7 A;  1IN8 A;  3HOT A;  1I27 A;  1JXS A;  1XB4 A;  1ZLJ A;  1BJA A;  2G7U A;  3T0Y A;  2X0L A;  2FOK A;  1DDN A;  5DV5 A;  5H6R A;  1STZ A;  3ULQ B;  4UNO A;  4OMY A;  1QZZ A;  3I59 A;  5L3E A;  1LJ9 A;  3NEU A;  3ZQ7 A;  3T5X A;  4HA8 A;  4LG0 A;  1H0M A;  1IXS B;  3ELK A;  2FEZ A;  4KFC A;  3C7J A;  3GX4 X;  1TW2 A;  5HS9 A;  4UV9 A;  2QYO A;  2WC2 A;  5KVR A;  2XHK A;  1YS7 A;  1BC7 C;  2CGP A;  2GIV A;  4EGZ A;  1WI9 A;  1J5Y A;  5FO5 A;  3FMQ A;  4F7Z A;  3FMS A;  4EVI A;  3QU6 A;  1SMT A;  5CVR A;  2E1N A;  2K27 A;  2L54 A;  2G7H A;  2RV8 A;  3FM5 A;  3BRO A;  5ERI A;  1MKM A;  3TO7 A;  4XSX F;  3RJP A;  4A6E A;  4RB2 C;  1U5T A;  5F64 A;  4H0E A;  3WTS C;  3I4P A;  1MJ9 A;  1TW3 A;  1G4D A;  1LDJ A;  3SXY A;  2FNA A;  2V1U A;  3I54 A;  1YLF A;  1SD4 A;  4I7H A;  3N4M A;  3LFK A;  1E17 A;  1Z6R A;  2A61 A;  1SMY F;  1FSH A;  3ZMV A;  3QU3 A;  1W4M A;  4WCG A;  4PGG A;  1BI3 A;  1I6X A;  4EJW A;  3GFJ A;  2OA4 A;  1D3Y A;  3J80 K;  3GLX A;  5ICG A;  2JSC A;  2JZY A;  3O2P E;  4K2E A;  3HHH A;  2EFN A;  3TOB A;  4HBL A;  4HX4 A;  1I1S A;  1OYW A;  4OIO F;  1CF7 A;  5A2Q Z;  5ICE A;  2P7V B;  3MFK A;  2CQK A;  1BBY A;  4IJA A;  5LGU A;  1JHF A;  1GXP A;  2XAQ A;  3E6B A;  3HRS A;  3LA2 A;  4M6X A;  1XMA A;  2Z33 A;  2COM A;  2HYF A;  3TGN A;  1KU2 A;  5CJ9 A;  1KU9 A;  3F22 A;  1G3T A;  2RKH A;  5HLH A;  2RVC A;  3KEQ A;  5L3F A;  3HRM A;  2HTJ A;  5ILU A;  1JGS A;  1ZRF A;  5JI6 A;  3WGH A;  1AOY A;  2L3D A;  2HQN A;  3HTU A;  3KCC A;  3GFI A;  2EA4 A;  2OQG A;  1OYI A;  4LD5 A;  1ZAO A;  2TDX A;  2UZK A;  2KRF A;  3FF5 A;  3BPV A;  1V4R A;  4ENK A;  1T2K A;  5E17 F;  4YIF A;  4HDV A;  3PFI A;  2FRH A;  3GZ5 A;  3RYP A;  1YS6 A;  2RDP A;  2GA2 A;  2O3F A;  3KZY A;  4ZYG A;  2VT2 A;  3M8E A;  1LDK B;  3M9A A;  3WE3 A;  5LHG A;  5D5X B;  2ISZ A;  5TRD A;  1WSU A;  1YFH A;  3CUQ C;  1G3W A;  2FF4 A;  3ABT A;  1FT9 A;  2XAJ A;  3NRV A;  2F5C A;  5LGT A;  1FZP B;  5HS8 A;  4LG0 B;  4ESF A;  3FZV A;  4HF2 A;  2A68 F;  4YII A;  4L9N A;  5L3G A;  3DQV C;  3HSE A;  1RNL A;  1KA8 A;  2CO5 A;  4XLP F;  3K2Z A;  1RZ4 A;  2UWM A;  1BN5 A;  4HLX A;  4G7O F;  2BGC A;  1LNW A;  4L0Y B;  2P5K A;  1T39 A;  4LJZ F;  5A2Q K;  1PP8 F;  2R3S A;  3QRF F;  4BQA A;  3K1N A;  1TQI A;  5HS7 A;  2DFI A;  5LGN A;  5JHU A;  2EJR A;  2G9W A;  3DPL C;  5LRS A;  3ZP5 A;  1KQ8 A;  3HOS A;  2QVO A;  3PQK A;  3LA7 A;  2YSR A;  3E5U A;  5AIQ A;  5ICF A;  3R61 A;  2JPB A;  4E70 A;  1FOK A;  4Y13 A;  1Q1H A;  3VFZ A;  3ERE D;  4U0V A;  5FFZ A;  3G3Z A;  4MTD A;  3JTG A;  5CLS A;  1KGS A;  1OR7 A;  4HOB A;  3MZY A;  4YG2 F;  2Q2E A;  3BJO A;  1K6O A;  2PG4 A;  3EYI A;  4I02 A;  3JTH A;  1IF1 A;  2CFX A;  4S04 A;  3BJA A;  3I71 A;  5LEJ A;  2NS0 A;  1CF7 B;  1QBJ A;  3L9F A;  1LDD A;  2ISY A;  3T8T A;  1G3Y A;  1TBX A;  4MGR A;  2XGX A;  2XRN A;  2V1D A;  2J5P A;  3V7S A;  2VBZ A;  3M8F A;  1R7J A;  3BY6 A;  4HX7 A;  2D1H A;  2DW4 A;  2XRO A;  2ESN A;  1HW5 A;  3TOA A;  2FBI A;  2XV4 S;  1FYL A;  2XAF A;  5LRR A;  1RI7 A;  3KE2 A;  3HSF A;  4U7D A;  4JBA A;  3P9I A;  4GO1 A;  4CO8 A;  5JFR A;  3EET A;  3DV8 A;  4Q4Z F;  3C18 A;  2YR2 A;  4BNC A;  1LEA A;  5D5V B;  1HST A;  2MA3 A;  4A0Z A;  1IW7 F;  3KP6 A;  1PUE E;  3ZMZ A;  3LA3 A;  1J0R A;  1BI0 A;  1SAX A;  5F1R A;  3EUH A;  5BPD A;  1FX7 A;  1B1B A;  4OIP F;  4IPA A;  4EM2 A;  2AS5 F;  4GXO A;  2EFW A;  5E1W A;  1FLI A;  1ZGJ A;  1H9G A;  1K79 A;  3KP7 A;  4CZZ A;  2HKO A;  1KYW A;  4I0A A;  5LLQ A;  5FB2 A;  2L02 A;  1ZRD A;  2F2E A;  3GEZ A;  3FHZ A;  2L01 A;  3VOD A;  3GWZ A;  1J75 A;  1UHW A;  4AIJ A;  2BYV E;  5LEK A;  1DPU A;  2PMU A;  3MEX A;  2ACJ A;  4MQ9 F;  2WTE A;  4L9T A;  2OU2 A;  2OD5 A;  4BYY A;  2IT0 A;  4UHT A;  3IKT A;  4HLY A;  3E97 A;  5CVI A;  3O6B B;  4CDG A;  3WGI A;  1USS A;  3E3V A;  3GUD A;  1MDM A;  2KJB A;  4UUV A;  3KLO A;  1WRJ A;  3T8R A;  2W84 A;  3ZMU A;  5D5U B;  3IRQ A;  4WXD A;  2P6S A;  5ICC A;  3HYI A;  5E8G A;  4KT5 C;  2RN7 A;  4HV5 A;  1FBU A;  2A5Y B;  3DXJ F;  3WTV C;  5D4S A;  4M9Z A;  2M30 A;  4HF0 A;  4L9J A;  1GVJ A;  5K5R A;  3ECO A;  1IZ1 A;  2VBY A;  4AD9 A;  2Q0O A;  1I1G A;  2QUF A;  1SFE A;  4RS8 A;  4YFX F;  2VOO A;  2XUB A;  2BE5 F;  3AAF A;  3CTA A;  2DI3 A;  1DPR A;  2IVM A;  2DT5 A;  2VC1 A;  3EYY A;  3FX3 A;  5D5W B;  2EFQ A;  3E5X A;  3KP3 A;  2MD5 A;  1FBQ A;  4AIH A;  3OOP A;  3OV8 A;  3JAM K;  2RQP A;  3RTR A;  2HDC A;  3ZN1 A;  2ZKZ A;  2XKP A;  2KKO A;  2ZME A;  4L9V A;  4OU0 A;  4AVP A;  1O7F A;  1UHM A;  2FMY A;  5DUI A;  5HLG A;  4BAY A;  1P4X A;  2QEN A;  4ASN A;  5BQT A;  2DAO A;  3R0J A;  2XVC A;  3HRT A;  2P4W A;  2W57 A;  3FXU A;  2NRA C;  2ESH A;  3IL2 A;  1RUO A;  1R58 A;  3TDZ C;  1AWC A;  5CVV A;  2R7F A;  2MLK A;  4P9U A;  3CO7 C;  2IA0 A;  4JK1 X;  3C1D A;  4HV6 A;  4L5I A;  3TDU C;  5JVT A;  1W5S A;  4R1H A;  4BXU A;  1XDS A;  2MH2 A;  2HOE A;  2HR3 A;  1FP2 A;  2PI0 A;  2DU9 A;  1YW9 A;  2EV6 A;  3DP7 A;  4XRF A;  5E20 A;  3RYR A;  1WQ2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...