3GFMA

Crystal structure of the st1710 mutant (k91a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
b'ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRAILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfmA00
4UVAA 1S7AA 4HYEA 2XV4S 3JTHA 4N0BA 3GZ6A 2M30A 1F4KA 2WV0A 5D6FA 2A6HF 2PMHA 4G6DA 1XSXA 2PEXA 3EETA 1H9TA 2BBYA 4EGYA 1U6GA 3BPXA 4CZZA 2FSWA 2W25A 3CUQA 3I5UA 2E1NA 3FM3A 3I59B 2CWEA 4PDKA 3K1NA 1HKSA 1UCRA 1O7LA 2MBFA 3ECHA 1GXPA 3KP3A 4OINF 4WCGA 1LDDA 5HS7A 2XASA 2L4MA 4G9YA 1XD7A 5LGTA 4L9NA 4GXOA 3RPUA 4LGWA 5HDNA 2JTVA 3KFWX 1TQPA 4RGXA 2QQAA 1WSUA 1LJ9A 1HW1A 2IPQX 1TQIA 3OV8A 4HLXA 5TRDA 3S2WA 3C18A 3T8TA 2YU3A 2MH2A 3M1EA 3P9CA 1BOAA 5D5WB 2OU2A 1ZHFA 3CUQB 3KEOA 2M5WA 2YX7A 4ZYDA 5FB2A 1XB4A 3TQNA 4UXNA 2QQ9A 5HDKA 2XVCA 2P5LC 1G3WA 3I4PA 2RDPA 2PG4A 1J9IA 3FZVA 3TO9A 1K78A 3E5UA 4LJZF 2H09A 2ZBKA 1EH6A 2MLGA 2P7VB 1E17A 4A0XA 2F5EA 2RN7A 3T5XA 1HSTA 3H3UA 1IXCA 4I0AA 4WWCA 5E1WA 3FF5A 4DNCA 3BP8A 4KNYA 2BE5F 3HSFA 4R1HA 3WTUC 1DUXC 4BYYA 2VT3A 3K1MA 3GFJA 3P7NA 5LRSA 5E20A 3V8LA 3Q5FA 3EYIA 4M74A 4U0YA 2D45A 1IN4A 2K4JA 2F5FA 3DEUA 4AVPA 1BI3A 2KKOA 4XSZF 4S04A 3T1BA 3HTSB 4ZZLA 1LDKB 1Q1HA 3F8FA 3B73A 1T0FA 2L3DA 3WU1B 3W6JB 3O3KA 2HYFA 1IN5A 4I2OA 1QGPA 4OOIA 2EFQA 2AS5F 1W5TA 1BM9A 5TJJA 3HTUA 1IXSB 3IL2A 2JPBA 5J6XA 3WODF 3WU0A 3C1DA 3WTWC 3MCZA 2BGCA 4U7BA 3ELKA 5ED4A 1G3YA 4WXDA 2CFXA 4HBLA 1FNNA 2O03A 3V8KA 2DO7A 1ZGJA 2VBZA 3ZP5A 1Z91A 3ZMUA 2HQRA 2QM3A 1K6OA 3HIFA 3JAMZ 2L02A 3U9GA 3W6KB 3QU6A 1XCBA 4OMYA 2Y48A 1KQ9A 2OA4A 3DKWA 1U5TC 3R61A 5BOXA 1TNTA 1HQCA 1GVJA 3M7GA 2VXZA 2V79A 2NNNA 1SFEA 5L3CA 4HX7A 2PI0A 3J7AO 4QLCU 1IW7F 2CSOA 3LA3A 2Y75A 1ZN2A 4HDVA 4NB5A 1ON2A 5H6QA 4HZFA 2LF7A 3HHGA 3IWZA 4OIOF 2JT1A 2PFBA 3P9KA 3JAMK 4BNCA 1MZBA 1G6NA 2LDUA 3COAC 1YG2A 1YW8A 1O7FA 1RI7A 6PAXA 5HOOA 1RNLA 3RI4A 1UFMA 1QO0D 3ZMZA 4ETSA 4EVIA 1SAXA 2WWYA 4RAYA 3E6DA 4MGRA 4N9IA 3R6SA 1XGNA 2FRHA 1E2XA 3WE2A 4JQFA 2PQ8A 5E18F 5CVIA 5LHHA 1FPQA 1EH8A 5CJ9A 1QZYA 4ESFA 3EDPA 5DEQA 1R5GA 4HAMA 3ECOA 1Y0UA 3L00A 1BIAA 3SFZA 3ML6A 2EWNA 5D5VB 1YW7A 2IT0A 3WG9A 3ZQ7A 4FX4A 3KP7A 3LAPA 1I6XA 1LDJA 2P4WA 4AIHA 2XAGA 2DTRA 4Y15A 3K2ZA 2WTEA 3FMSA 2QENA 3F6VA 5D4RA 4PGGA 4U0WA 4A5NA 4BHCA 3Q9VA 2H6CA 3J81Z 2RKHA 3BJOA 4A0YA 3ISPA 2GXGA 4G8XA 4HOBA 4FHTA 2ESNA 4KN7X 2B0LA 4RB2C 2QBYA 2IP2A 2MA3A 2KJCA 4ZYEA 3GVAA 1SD6A 5AIQA 4U88A 3RYPA 2VBYA 2E7XA 5HLIA 1JE8A 4BAYA 1BI0A 2STTA 2VBXA 4U0VA 5F64A 5CVRA 1P4WA 2HKXA 1IN7A 3GLXA 2H6BA 4L9JA 1FC3A 1FX7A 4QWQA 4IJAA 5DYMA 3ZMDA 4MQ9F 4LLLA 5FO5A 2IA0A 2Q2EA 3IWFA 3KEQA 4R79A 3RDIA 3E6MA 1FYMA 2DFIA 2FBHA 2FBKA 2KIUA 1F5TA 2P5VA 2TDXA 1W7PB 3F8NA 1IF1A 2DK8A 5HLHA 1RUOA 1K7AA 3AAFA 3LA7A 3GFIA 4I0BA 2QBYB 1RUNA 3U1DA 2YR2A 2OBPA 3IKTA 5ILVA 3E3VA 1DPRA 4RB0A 2VOPA 1ZRCA 1WRJA 2YPRA 2DU9A 5L3FA 5D8KB 1IAWA 3GFLA 3VODA 3QPTA 5FD5A 4G7OF 3CTAA 4N9HA 4TV7A 2LKPA 1U2WA 2Q8KA 4RGRA 2XAJA 2XAFA 1ZGAA 1PP7U 2FQ3A 5J8CA 2ZMEA 3RIRA 2M87A 5LBQA 3IKVA 1D3YA 3LFKA 5DD8A 1R1VA 3ZN0A 1FP2A 5E17F 4IHSA 1FBUA 1UHMA 2A68F 4IF4A 1FZPB 3MEXA 4ESBA 2GXBA 2GIVA 1HBXG 4FX0A 2YSRA 4Q48A 2XIGA 2STWA 2HDCA 1YTYA 1T38A 2ZCWA 2ZNZA 2BYVE 2IVMA 5DDGA 1C0WA 1CGPA 4KFCA 5KK1A 2FU4A 1GHCA 4XSXF 4CO8A 2DBBA 1DDNA 1PP8F 1ZYRF 4YIFA 4LFUA 2BEOA 1ONVA 5DCFA 2KIFA 1HXDA 4RS8A 5K5QA 2ZMEB 2ISYA 4RB3C 1B1BA 2ACJA 1IXRC 1AWCA 1O3TA 1J2XA 4NHJA 2H94A 3V7RA 3FXUA 5F1RA 3GEZA 4ZYHA 1SD5A 2Z5UA 3BY6A 3QP6A 3DPTA 4HDUA 5BPDA 4EJWA 4ENKA 1L3LA 3LWFA 1G3SA 2GQQA 5LHIA 5JR3A 1JHFA 4KIFA 1O3QA 2EFPA 3BOQA 1B9MA 3FXRA 4EJTA 1HSJA 2K86A 2J5PA 3QPHA 1JHHA 4M72A 2A3SA 1LVAA 3D0SA 5BPIA 3B02A 1USTA 2HS5A 3SZTA 4A2UA 1G4DA 4L0YB 4CDGA 4Q47A 4M73A 2ETHA 3BJ6A 4Y13A 1LQ1A 2W84A 2Y0MA 3TDUC 3TGNA 2R7FA 3KP6A 1PUEE 2FA5A 1I1GA 4UNOA 1YQAA 2F5DA 1KQ8A 1EH7A 1ZAOA 5L3GA 3DP7A 4L5IA 4YG2F 5LEKA 4I98B 4E70A 2NAZA 5FD6A 3C3WA 4DQ2A 2E7WA 1FY7A 2VC1A 1B59A 5DV5A 3CLOA 3WTTC 1T2KA 2O6GE 4HX8A 1IN8A 2W24A 5HS9A 3F72A 2V1UA 3E5XA 3ZMTA 5A2QZ 2EFWA 2W57A 2ISZA 3HRTA 2VODA 4A5MA 1G3TA 3K9TA 1I27A 2XKPA 1FWZA 2V6CA 5FFXA 4CYDA 4Z2YA 5ICEA 2E1CA 2A61A 1BC7C 5D8LB 5ILSA 1K78B 2AXLA 1S7OA 1J7KA 2CGPA 3VEPA 3ZMVA 2VC0A 2EB7A 1X3UA 3WGGA 5EEGA 4YFKF 1D5VA 1WQ2A 4ON0A 1QPMA 4RGUA 1IN6A 1P4AA 1T39A 4WF2A 2G7UA 3DV8A 3VFZA 5A2QK 3CO6C 3JSOA 1S29A 4HQEA 4BXUA 1FYLA 1P4XA 5CVUA 1XSDA 3K1PA 1ZARA 5L3BA 1WKMA 5D5XB 1HW5A 1SMTA 4KMFA 2FNPA 2D1HA 1IZ1A 4K2EA 3IC7A 1QBJA 1XSVA 1IRFA 1FOKA 1KA8A 2RV8A 1MJAA 1D8KA 2JZYA 5K5RA 1XDSA 2QZ8A 2A07F 3FMQA 1R5HA 1OYYA 3GO5A 4P5OA 5IT9Z 3WGHA 2IA2A 2QQBA 2M45A 3PQKA 1IRGA 1I1SA 3BDDA 2LNBA 2DT5A 3LAJA 4Q4ZF 2HZTA 3ERED 3HSEA 4GCVA 2QVOA 3E6CC 3FWEA 1A04A 2COMA 1XCVA 2IW5A 3KZZA 1P92A 1SFXA 2K27A 3KETA 4BQAA 4L18B 4D0PA 2V1DA 1BBYA 1FYKA 1ZLKA 3TOBA 4KA4A 4IPAA 3V8JA 2XRNA 3KCCA 1SD4A 4M71A 3GYHX 1LB2A 3RKWA 1LNWA 2DI3A 5IT9K 2VE9A 3FHZA 5DCMA 1J75A 3LSTA 1OR7A 1AOYA 4EGZA 2WC2A 3U2RA 3O6BB 3SZPA 4HV6A 4M9ZA 3FX3A 1YLFA 3DXJF 2OQGA 3V4GA 5D4SA 5LEJA 4WK8F 2BV6A 4I02A 3J80Z 2KRFA 1L0OC 2OQRA 4I09A 3SHFA 1XMKA 4HF0A 4ZZDA 3L2CA 1YS6A 1FLIA 2EFNA 3DQVC 1O3RA 1S6LA 1WI9A 3EUHA 2HWVA 4H0EA 3F8BA 3HRSA 3ULQB 4G6QA 2GA1A 1V4RA 3ZN1A 3I54A 4IHTA 4G7HF 4UVBA 2A6EF 1XGOA 1R1UA 5AIPA 3VB2A 3TOAA 1ZH5A 4MEXF 2EV6A 3KE2A 3E97A 4R8HA 3QRFF 5DCMB 2OZ6A 2NS0A 1O3SA 2EFOA 2HGCA 3IRQA 4RGSA 4MTDA 1Z7UA 4G7ZF 2P5KA 3KP4A 2D2WA 3J80K 1ZG1A 1J5YA 2D1VA 5D5UB 3FXQA 5CYVA 2ESHA 4A6EA 4P96A 4EJOA 1FBQA 5ERIA 3MFKA 2K4BA 3KLNA 4HW0A 4F7ZA 2R7DA 1IUYA 3KP2A 1KU3A 3GFMA 2PBIA 1YFHA 4M6YA 1GXQA 2VT2A 2FMYA 2IRFG 1STZA 1ZG3A 4RAZA 3NRVA 3CUOA 2P6SA 3RKYA 3I58A 4MNUA 4B09A 3R4KA 2ELHA 3BROA 1PDNC 4EJVA 2L54A 2Z3YA 3O2PE 1XN7A 2ZKZA 3GUDA 3P9IA 2EA2A 4EQQA 2IA1A 2V9VA 4ENMA 1P2FA 4XRFA 3QP5A 2CYYA 1B9NA 1HKTA 1OYIA 4HA8A 2NYXA 3VOEA 4LD5A 5LGNA 3E5QA 3F23A 2P8TA 4BHPA 3N97A 2FNAA 2M8EA 3WE3A 2Z99A 1U5TA 3F8MA 4UV9A 1B4AA 3MZYA 3TO6A 3M8EA 4UHTA 3M8FA 2EV0A 2L4AA 3WTSC 4P9UA 1TQMA 1YS7A 3M9AA 1USSA 4GYGA 4ENJA 2XHKA 2V1XA 5DUIA 2QUFA 2X4HA 1S3JA 2QWWA 2QLZA 2EA4A 1Z9CA 1BJAA 1ULYA 5JI6A 3TO7A 1DP7P 3MQ0A 2Z33A 2DQLA 3LQQA 1REPC 2EJRA 1YYVA 3GZ5A 4HF1A 4AWXB 3JTGA 2P6TA 1TNSA 2YX4A 1SMYF 4PZJA 4OIPF 2XAQA 3V7SA 3QOPA 3SXYA 2L01A 4ZYGA 3E6BA 1KYWA 1U5TB 1K79A 4ESJA 3RJPA 4MTEA 1R22A 4OMZA 2OAZA 2IJLA 3F21A 4EMSA 2UZKA 1U8RA 1ZREA 1TTYA 4CXFA 5L3DA 2GA2A 4KMUX 5JFRA 4O3MA 3K69A 1D8JA 5JVTA 2FEZA 3HSRA 5HLGA 2RQPA 3WTXC 1B6AA 3GWZA 3WTZA 4KYWA 5K1YA 4ASNA 2HOEA 1JXSA 4EM1A 2CO5A 3CDHA 5E1ZB 4OIQF 2GAUA 1FP1D 3IHUA 5J8FA 5H20A 2FXAA 1DPUA 3LA2A 1OYWA 1KYZA 1XMAA 1S8NA 1F1ZA 4L9TA 3T8RA 3V7CA 5E8IA 2MH9A 2OD5A 2O61A 2P7CB 3GXOA 4NQWA 3CO7C 2OZUA 3RKXA 2VE8A 3HRMA 1OKRA 1R1TA 2FOKA 2HKOA 1U3EM 2F5CA 2DAOA 4ENNA 2FMLA 4IRHA 4M9SA 5IT3A 2F2EA 2G7HA 3MZHA 3FMRA 2ZXJA 2RC4A 3QAHA 4UVCA 3OOPA 4L5JA 3ABUA 1J59A 4KICA 1T6SA 1KU7A 3LQRA 2HFHA 5BQTA 1SD7A 1LEAA 3DPLC 1FSHA 3H3ZA 3BWGA 2KIMA 4EJUA 1TBXA 2RNJA 4M9XA 5CVJA 3HRUA 5E1XA 2ADUA 2HQNA 2Q0OA 1F9NA 3DFGA 4G94A 1W7PD 3CJNA 4I01A 5FFZA 1H0MA 1JGSA 5L3EA 3QU3A 1BI2A 3K0LA 2VBWA 4XBFA 1ZRDA 4KIGA 4FT8A 1MGTA 2C6YA 3REOA 4HLYA 2MD5A 4XLNF 4HQMA 5F6FA 3G3ZA 4M6XA 3I64A 4O6JA 4B8XA 5HVQC 3ABTA 2O8XA 2DQRA 3G73A 4IRGA 4A12A 1EV7A 4IXAA 4P55A 3IRRA 1MDMA 4WX9A 1ON1A 2XROA 1R7JA 4LMYA 2PJPA 1HKQA 4PGHA 3RYRA 2J5OA 4Y17A 4MHGA 4CGZA 1BN5A 4GYIA 4JBAA 1R58A 4KIBA 1H9GA 4HF2A 3T0YA 3H92A 5LRRA 1YO5C 5BMZA 2DPDA 3BZ6A 2EV5A 3HYIA 2CQKA 2PN6A 4HV5A 2RVCA 2NRAC 1LEBA 3FM5A 5FGMA 1CF7A 4RB1A 4MQVA 2A69F 4IRIA 4KUMA 4YIIA 3I53A 2PMUA 2CW0F 1T98A 4LK1F 4LK0F 2NNYA 4WXHA 3C7JA 3R0AA 2O3FA 1J0RA 1MDMB 4KN4X 4UUVA 2QYOA 3KP5A 4KT5C 5LHGA 3L09A 3BPVA 2KJBA 1BI1A 1W5SA 1MD0A 3CUQC 3KZYA 3F3XA 2JRTA 3PFIA 1TW3A 1KU9A 1U78A 2PLYA 1O57A 1R00A 4I7HA 1MJBA 2K02A 3SQNA 2ZJ2A 1HW2A 2VONA 2UWMA 4MEYF 4BHBA 3L7WA 4KDPA 3I71A 1Z6TA 4CICA 2HTSA 2M1BA 5EEHA 4LG0A 2DK5A 1P6RA 2DPUA 2A5YB 4LB5A 2MC3A 5D6EA 4AD9A 3KLOA 2R3SA 1CF7B 1FSEA 3ZPLA 3JSPA 3TDZC 1TW2A 2UXXA 2ZO4A 3RTRA 4O5VA 1ZG5A 4GO1A 3HOSA 4A6DA 3MWMA 2HR3A 2LSOA 1V3FA 1Z6RA 1UHWA 3N4MA 1RZ4A 2FF4A 2VN2A 1ZRFA 4Q5SF 1W4MA 2CG4A 4PCQA 1OMIA 2XKOA 5CLSA 1KU2A 1BC8C 1YW9A 5FLXZ 4U7DA 1XDUA 2O0YA 5ICGA 2ZFWA 1NHAA 5JHUA 1W7PA 5LLQA 2UXNA 1BIBA 1QQIA 4UV8A 4A0ZA 4OU0A 1Z05A 1ZLJA 3Q9SA 4LG0B 4AIKA 1I5ZA 3HUGA 4XLPF 2DW4A 5H6RA 3EYYA 5ICFA 3PQJA 3MAJA 1KQ0A 5KVRA 3GW2A 1MJ9A 5ICCA 3WTYC 2EK5A 3GX4X 4YFNF 4LLGF 3BJAA 5E8GA 1TLHB 3TKYA 2RGVA 2JSCA 2FE3A 3RPQA 1XGSA 3F8CA 2Z9OA 5FLXK 4WXCA 1R36A 2GWRA 3NQOA 4YFXF 2ZNYA 3NEUA 3J81K 5K5OA 2G9WA 2FBIA 1ODDA 1XGMA 4S05A 3HOTA 4ZH4F 3WTVC 4P9FA 2MLKA 1QNTA 5HDGA 3R0JA 1KGSA 5DUKA 2W85A 2HYGD 4EM2A 5AONA 2LF8A 1OPCA 1FT9A 4JK1X 1SFUA 2XAHA 3GF2A 4HX4A 5LGUA 1MKMA 4OIRF 3JW4A 1QZZA 5HS8A 3L9FA 4BH9A 4CHUA 2GZWA 1YIOA 4GGGA 2H27A 2HEOA 3I59A 3WGIA 1WWXA 1Z1DA 3D5LA 3HHHA 4EM0B 4LB6B 4L9VA 2HTJA 4AIJA 2K7LA 5ILUA 1UB9A 3F6OA 5BS6A 4IVNA 3I0TA 3R60A 2XUBA 4LLNA 1RIOH 3F22A 3DF8A 5CVVA 1VTNC 3ROUA 3ZMSA 4EV0A 2JPCA 2XGXA 2X0LA 3EQLF 2VOOA 2DLLA 5DD4A 1FBSA 1R23A 4L0ZB
chains in the Genus database with same CATH superfamily
1IDZA 3CMEI 4UVAA 2YU9J 1S7AA 4HYEA 1NH3A 2XV4S 3JTHA 2Z1DA 3L1PA 4N0BA 3GZ6A 2M30A 4A3MJ 1F4KA 1WJFA 4JX4A 1TWCJ 4XLAA 1I3AA 2O9LA 2WV0A 5D6FA 2L7FP 3H9JA 2CFOA 2A6HF 2PMHA 4G6DA 5FKNA 1XSXA 2HU9A 2PEXA 3EETA 1H9TA 4A3LJ 2BBYA 4EGYA 1DP3A 1U6GA 3BPXA 4ITVA 4CZZA 2FSWA 1YITI 2W25A 4BJ5C 3CUQA 4U87A 3I5UA 2E1NA 3CMAI 3FM3A 2VQCA 3CMMA 3BG5A 3I59B 5GPAA 4D1QA 1LE8B 2CWEA 2WY8Q 2LY2A 2R5YB 2E2IJ 3RSNA 4PDKA 5M5WJ 3K1NA 2NVYJ 3IH4A 2OTJI 1HKSA 1UCRA 1O7LA 2MBFA 3ECHA 2W82A 4DZPA 4B43A 1GXPA 3HKZA 3KP3A 1Z67A 4F92B 1ZK8A 4OINF 4UUTA 1BW6A 4RBOA 4WCGA 1LDDA 2IGNA 5HS7A 4M3GA 2XASA 2L4MA 4G9YA 1XD7A 2DCEA 3FBIB 4C3IJ 3S3OA 1T56A 2KZVA 5LGTA 1JTYA 2FOWA 3ERMA 4L9NA 2R7SA 4UB6C 2OJED 2M0MA 4GXOA 4LGWA 3RPUA 5HDNA 2JTVA 3KFWX 2VUMJ 1TQPA 2E1OA 4RGXA 1T95A 2QQAA 1WSUA 1LJ9A 4J00A 1HW1A 2IPQX 2M34A 1TQIA 3OV8A 2DODA 3HJEA 3N05A 2CH0A 2HDDA 4HLXA 5TRDA 3S2WA 2KQRA 3AG1H 4E4HA 3C18A 3T8TA 5GAGJ 3OS2A 4D7NA 2YU3A 3MD2A 3IV5A 2MH2A 3M1EA 5M3MJ 3P9CA 5C4XJ 5CQEA 4I6ZA 3HPHA 1BOAA 5D5WB 2ZXHA 1JTXA 2OU2A 4ZDLA 2JSPA 1FMWA 4A3KJ 5DM7F 1LFPA 2QSHX 1ZHFA 3CUQB 3G1LA 3KEOA 4DYQA 2YS9A 4A69C 2M5WA 2WBMA 2YX7A 3DBRB 5KCMA 5FB2A 4ZYDA 2EILH 3MN2A 1XB4A 3DTIA 3TQNA 4UXNA 1WPKA 2IS1A 5J1YA 2QQ9A 5HDKA 2CS3A 1HA8A 3HL2A 2ZSIB 1WZ2A 2NOGA 2XVCA 4XOPA 2P5LC 4FTHA 2PMZN 1G3WA 2XPVA 4B47A 3I4PA 2KZGA 2RDPA 4BE2A 1FIAA 2PG4A 1J9IA 3A4CA 1IRZA 3FZVA 1GLNA 3TO9A 3EUHC 3EPZA 1K78A 3JR9A 3E5UA 1TT5B 2DMTA 2IGOA 3A03A 4LJZF 4AUXA 2H09A 5IY5H 3CF5F 2ZBKA 1EH6A 2MLGA 3H0GJ 2P7VB 1E17A 4A0XA 2K9NA 2XGDA 2F5EA 2RN7A 3T5XA 4DYRA 3DTEA 1HSTA 2ZXIA 2ZJRF 3H3UA 1IXCA 1R4NB 4AIDA 4II2A 4I0AA 2KMUA 4WWCA 3JRHA 5E1WA 4B44A 3FF5A 4DNCA 3A02A 4XK4A 4V2GA 3BP8A 4IKFA 1VQ6I 4I99C 4KNYA 2BE5F 3HSFA 4R1HA 3RQ4A 4BJ6C 2IGMA 3WTUC 1DUXC 3ZRGA 2COBA 4RMNA 4BYYA 2VT3A 3K1MA 4XRMA 3I3LA 3GFJA 3P7NA 1D5YA 3PUBA 5LRSA 5E20A 3V8LA 2XAUA 3G1OA 3K4CA 5FLMJ 3Q5FA 1NK3P 3EYIA 2WA0A 5EEAA 4M74A 4F3QA 1OJLA 2QEXI 4U0YA 4D5CA 3GCMA 2D45A 1SFOJ 1IN4A 4CCLA 2K4JA 2BW3A 2F5FA 2ECCA 3LNQA 4CUGA 3DEUA 4AVPA 1BI3A 2KKOA 3HC7A 4XSZF 2LH9A 2LC2A 2K9MA 4S04A 3T1BA 3HTSB 1MMAA 2W7NA 3QQAA 1LDKB 1Q1HA 4ZZLA 3F8FA 3B73A 1T0FA 2L3DA 3WU1B 3W6JB 3O3KA 3L2RA 4PJJA 3QPLA 1JUPA 2HYFA 1IN5A 4C2MJ 1QGPA 3KYLA 4I2OA 5EGOA 3MZ8A 1HLVA 4OOIA 2EFQA 2AS5F 1W5TA 2BY0A 1BM9A 5TJJA 3HTUA 1IXSB 2ZJQF 5F27A 3M07A 3BR6A 4G6TB 3IL2A 2JPBA 2L9SA 5J6XA 3FDYA 4IOAF 3WODF 2K9LA 3WU0A 3C1DA 3CMYA 3WTWC 3MCZA 2BGCA 4U7BA 2EZIA 3ELKA 5ED4A 1G3YA 4WXDA 3BR5A 2WAFA 2CFXA 4HBLA 1VQ7I 4FETA 1FNNA 2FQ4A 3H1CA 4CZCA 2O03A 4M6VA 2OCEA 3SEZA 3FXMA 2XGCA 3ABKH 3V8KA 1GV5A 1QHHD 1ZGJA 2DO7A 2VBZA 3ZP5A 1Z91A 2XB0X 3ZMUA 2HQRA 4MFEA 2QM3A 1WFXA 3BZKA 4LITA 1K6OA 3HIFA 3JAMZ 3AG3H 2L02A 1YOVB 3U9GA 3W6KB 3QU6A 3GTGJ 1DGWY 1XCBA 3BG9A 2LYCA 3VYSB 3Q0UA 2MSYA 4XLEA 5FRNA 3U1KA 5E3OA 4OMYA 2Y48A 3K7AJ 2VIXA 1KQ9A 2OA4A 3DKWA 4E7LA 1V5EA 4B48A 4YIRX 1F36A 2CV2A 1U5TC 3R61A 3PSFA 5BOXA 2R93J 1TNTA 1HQCA 3VSKA 2M2EA 1JT0A 2LKSA 2QGUA 1GVJA 3M7GA 3OWTA 1FOXA 5IOYA 2ELKA 1XMXA 2VXZA 4BUPA 1MNEA 2V79A 1JKPC 2NNNA 1SFEA 2DMPA 3HOUJ 2WADA 1A31A 5L3CA 4HX7A 2PI0A 3J7AO 4QLCU 1IW7F 4ZTFA 4KISA 1ETKA 2DMUA 2HDWA 5EGOB 2CSOA 2VJJA 2Y9ZA 3WU2C 1SVLA 3LA3A 2Y75A 1QHGA 3LOCA 1ZN2A 2DDAA 2HPIA 4HDVA 2OCCH 3HOXJ 4LIUA 2W48A 2BVLA 1SANA 4NB5A 4RM3A 3FKIJ 1ON2A 2EBIA 5H6QA 3QYFA 2KL4A 3CJTB 4HZFA 2LF7A 2F4MB 3Q0VA 5IYCJ 3HHGA 3JRGA 2HI3A 3IWZA 3ZQLA 4OIOF 2JT1A 1LUJB 2PFBA 3P9KA 3JAMK 2JA6J 2FUG2 4BNCA 2DJNA 4AVZA 2IS4A 1KZHA 4YELA 1MZBA 1G6NA 1APLC 2FX0A 2LDUA 3COAC 4A3JJ 1UAAA 4X1EA 1YG2A 4FQGA 1YW8A 2L2OA 5F0FA 5EG0B 1O7FA 1RI7A 4BS9A 3LSRA 1SEUA 5GPCA 1Y8QB 1VI0A 6PAXA 5HOOA 1MMNA 1RNLA 1BW5A 1TWGJ 1R71A 3MMYB 2LK2A 1RR7A 3RI4A 2QKMB 1UFMA 2A05A 3LSIA 5F0HA 1QO0D 4A3BJ 3ZMZA 4ETSA 3I4NJ 3ESWB 4EVIA 2CQQA 1SAXA 2XDVA 2WWYA 2ZFUA 4RAYA 3E6DA 1AA7A 1Y8RB 4MGRA 4N9IA 2BVMA 2Y69H 3R6SA 1XGNA 4DJAA 2FRHA 1E2XA 3WE2A 4JQFA 2PQ8A 5E18F 1N75A 3IAM2 3KYCB 2JVGA 2VJ4A 5CVIA 5LHHA 1FPQA 2JRMA 2MABA 1EH8A 5CJ9A 3B6CA 3TEDA 2VKDA 1QZYA 4PK4A 4ESFA 2QQ8A 2HOTA 1EF4A 3EDPA 5DEQA 2LBFB 1JUSA 1R5GA 4HAMA 3ECOA 1Y0UA 3L00A 1AKHA 3IUOA 1IUFA 1BIAA 3SFZA 3H3VK 3ONQA 3ML6A 2EWNA 4AYBA 4F52A 5D5VB 1YW7A 5CKTA 4PJNA 2IT0A 3WG9A 1I39A 3ZQ7A 4HNUA 2R5ZA 2F5VA 4FX4A 3KP7A 4PFPA 3NWTA 3LAPA 1I6XA 1LDJA 2P4WA 4AIHA 4CYCA 2JA5J 2XAGA 1H88C 2M7BA 1X1PA 2DTRA 2CRGA 4Y15A 3K2ZA 3DEEA 2WTEA 5KAIC 3FMSA 2QENA 3F6VA 5D4RA 5K7HA 4PGGA 1MBJA 1XX5A 4U0WA 4A5NA 4BHCA 3Q9VA 4CCNA 5JLXA 2H6CA 1Z77A 3J81Z 2RKHA 2E5ZA 5B1AH 3BJOA 4A0YA 1P9QC 3ISPA 3S1MJ 2GXGA 1QVTA 4G8XA 4HPQA 4HOBA 4FHTA 4A3IJ 3HZJA 4HSTA 4JOMA 2ESNA 4KN7X 4Y7NJ 2B0LA 2V1NA 4RB2C 3OYAA 3RKQA 3FIWA 2QBYA 2IP2A 2MA3A 2M4KA 2KJCA 2VQGA 4ZYEA 4RA2A 3GVAA 3LSPA 1SD6A 5AIQA 1AHDP 4XKCA 2E2HJ 3O8HA 4U88A 3RYPA 2VBYA 4PSWA 2E7XA 1PJRA 5HLIA 1JE8A 4BAYA 3FBNB 1BI0A 2STTA 2VBXA 4U0VA 3PIOF 5F64A 5CVRA 1P4WA 2HKXA 5IOZA 1W36C 1IN7A 3GLXA 2H6BA 4L9JA 3AL0B 1FC3A 1FX7A 2L0KA 1IC8A 3TL4X 4QWQA 2E2JJ 4IJAA 5DYMA 1AKHB 1N78A 3ZMDA 2DA1A 3ZCOA 4MQ9F 2KISA 4LLLA 1Z3YA 1V54H 4RLFA 1EJ9A 1ITYA 5FO5A 2IA0A 2Q2EA 3IWFA 3KEQA 4R79A 3RDIA 1OLTA 3E6MA 1FYMA 2DFIA 1MBFA 2FBHA 3M8JA 1JKRC 3ASOH 2FBKA 5CPRB 2KIUA 1F5TA 2P5VA 3C2GA 4KITB 4ZYAA 2TDXA 2OUMA 2ZXWH 3DBHB 3AKZA 4UB8C 1W7PB 1UJ8A 2BXYA 2R7UA 3F8NA 2WB1A 1IF1A 1IDYA 5M3FJ 2OTLI 1I50J 2BOLA 2DK8A 3FXOA 3SDGA 1BR2A 2KIQA 3QOEA 4MIMA 1V55H 5HLHA 3S8PA 1S72I 1RUOA 1RC9A 1K7AA 3AAFA 2V9PA 3HPGA 3MKYB 4DYCA 3LA7A 2YUSA 3GFIA 3K4JA 3EUKL 4I0BA 2HXIA 3HUGB 2QSFX 2QBYB 1J09A 1QZEA 2VI6A 1RUNA 3U1DA 2YR2A 4M3FA 3LSHA 2OBPA 3IKTA 1VQ5I 5ILVA 3ZXSA 3E3VA 1DPRA 2DTZA 3CLQA 4RB0A 1MSFC 2VOPA 1ZRCA 1W36D 1WRJA 2K85A 2YPRA 2DU9A 5L3FA 5D8KB 1LPQA 3BCAA 3BC8A 1IAWA 3IAS2 3GFLA 1A6IA 3VODA 3QPTA 5FD5A 4XN0A 3A2KA 3CTAA 4G7OF 4N9HA 3D1NI 2H8RA 2E71A 4TV7A 2LKPA 3JRAA 1U2WA 2Q8KA 1XS9A 4RGRA 2XAJA 2XAFA 4A3CJ 1ZGAA 1PP7U 2FQ3A 5J8CA 2NS7A 2ZMEA 3RIRA 2M87A 5LBQA 3IKVA 5B3SH 1D3YA 1BJZA 1ORKA 1GV2A 3LFKA 5DD8A 1R1VA 2HNHA 1T33A 3ZN0A 1FP2A 2X6YA 3LFUA 2ZB9A 5HNFA 5E17F 5E3LA 3A01B 2X6OA 4IHSA 2TCTA 1FBUA 1UHMA 4C2UA 1BR4A 2A68F 4IF4A 1FZPB 3MEXA 4ESBA 1N77A 5KAFC 2GXBA 2GIVA 3BG7A 1HBXG 1ENHA 2YSRA 2CMPA 4FX0A 3ZQIA 1E0EA 4HNTA 3I4MJ 2QKLB 2HZDA 4Q48A 3C2HA 2XIGA 2R0QC 2XF7A 2HDCA 4S0HB 2STWA 2BHYA 2MC4A 1YTYA 4XKVA 1T38A 2ZCWA 3DLLF 3BTLA 2ZNZA 1ETXA 2BYVE 2X1CA 2IVMA 5DDGA 3I55I 3GTQJ 1C0WA 1CGPA 4KFCA 5KK1A 2FU4A 1GHCA 4XN3A 2Z16A 4XSXF 4CO8A 2DBBA 1DDNA 2JN6A 2AO9A 1PP8F 1SVOA 1ZYRF 3CJQB 4LFUA 4YIFA 3OMYA 3W2VA 4BBRJ 2BEOA 1G59A 1ONVA 2QCOA 5DCFA 2KIFA 1HXDA 2LTPA 1WJBA 1UG0A 2E1MC 1DGRM 4RS8A 5K5QA 2ZMEB 2ISYA 5F04A 4RB3C 1B1BA 1VQ9I 3FKJA 1G8XA 1IXRC 2ACJA 1AWCA 3LSGA 4HNVA 1O3TA 1J2XA 4NHJA 2H94A 2V6EA 3V7RA 3FXUA 3O8GA 5F1RA 3GEZA 4JX5A 3J7ZI 4ZYHA 2EZHA 1SD5A 2Z5UA 3BY6A 3QP6A 3DPTA 4HDUA 5BPDA 3ZQHA 4EJWA 2M9HA 4ENKA 1L3LA 5JLWA 5J3LA 3TW6A 3LWFA 1G3SA 2EINH 2GQQA 4BY7J 3VSLA 5LHIA 1DU6A 4ZC3A 5JR3A 3S3NA 1JHFA 4KIFA 3DPUA 1O3QA 4AM3A 3NAUA 2EFPA 3CP8A 3BOQA 2UV1A 1D1AA 1B9MA 4E6KG 4PUSA 3CCVI 3FXRA 2DA6A 1HSJA 2K86A 2J5PA 1X2NA 4BE0A 4EJTA 3QPHA 2A6TA 1K61A 2DFHA 1JHHA 1K6YA 3OS0A 3HDDA 2DXIA 2OC6A 3DCFA 4M72A 1OR7C 2A3SA 2F48A 4OAZA 1LVAA 3D0SA 3OYEA 2VPRA 1V5FA 5BPIA 3LL7A 3B02A 4IQ4A 1USTA 1YIJI 2AQEA 3CESA 2HS5A 3SZTA 1MH4A 4A2UA 1G4DA 4L0YB 3BLYA 5GAHJ 2E36A 1GVDA 4CDGA 4Q47A 3ABMH 3BR2A 1B72A 3DLAA 5EZGA 4M73A 2ETHA 3BJ6A 3JRDA 4Y13A 1FOWA 1LQ1A 2W84A 2Y0MA 3IH3A 5J40A 3TDUC 3TGNA 3OYKA 2R7FA 1IGNA 5F08A 3KP6A 1ZR4A 4BQNA 1NG6A 2BHZA 1PUEE 3F9KA 1JKOC 1MNDA 2H8WA 2FA5A 1PYVA 1Y39A 4UUSA 4BQOA 1B8IA 1A5JA 1I1GA 3G2BA 4UNOA 1YQAA 4JX6A 2W00A 2F5DA 3SJMA 1KQ8A 5DTDA 2K3PA 4OWRB 1EH7A 3L2QA 1ZAOA 2GM4A 4FE7A 5L3GA 2GIZA 3DP7A 4II3A 3M3YJ 2XPWA 1VNDA 3EUAA 4L5IA 4DZJA 4YG2F 5LEKA 1YX5A 4I98B 4BKXA 2HQ5A 1PVEA 3WG7H 1GUUA 4E70A 4PSXA 2NAZA 1T8IA 5FD6A 3C3WA 4DQ2A 2EIMH 2ME6A 3H9QA 1RETA 4IEJA 1VQPI 2E35A 1X4OA 2E7WA 2PMZA 1FY7A 1PUFA 3G1MA 2VC1A 1B59A 5DV5A 2ID3A 3CLOA 3WTTC 3DBLB 2DYSH 1T2KA 4C3HJ 2O6GE 4HX8A 1IN8A 2W24A 5HS9A 4XKWA 3F72A 1RPWA 4XORA 2XSDC 2V1UA 1RKWA 2RQQA 2OF7A 3E5XA 2XF6A 1HF0A 1GT0C 3ZMTA 2VJIA 5A2QZ 1OCPA 2EFWA 2W57A 2ISZA 3HRTA 1ETWA 2VODA 4DBQA 1UELB 4A5MA 3OYMA 1FIPA 1G3TA 2DFFA 4GFBA 3K9TA 1I27A 2XKPA 4XQFA 1FWZA 4F93B 2BY1A 2V6CA 5FFXA 4CYDA 5EZHA 1LKXA 3H9GA 4Z2YA 5ICEA 2JUGA 4CSWA 1B72B 2E1CA 3OYFA 2A61A 1YJWI 2EZLA 1BC7C 1MW7A 2HQAA 3HM5A 5EDNA 1VZ0A 1ACIA 3HOWJ 3BTCA 5D8LB 1TWHJ 5ILSA 1A36A 1K78B 1E3OC 2AXLA 3HXLA 1SC7A 2CU7A 1T08B 2MW8A 3FK6A 1E3PA 2NVQJ 1HC8A 1S7OA 1WHUA 1J7KA 2R7WA 3PFYA 2CGPA 3D5RC 3VEPA 3ZMVA 4IO9F 2VC0A 2EB7A 1X3UA 2BZTA 1ETVA 4DW6A 1OCRH 3WGGA 3A0HC 4B4CA 5EEGA 4YFKF 1JKQC 2IXSA 2K3FA 1D5VA 1WQ2A 4ON0A 1QPMA 1PUFB 4RGUA 1IN6A 1P4AA 1T39A 4WF2A 2G7UA 3DV8A 3VFZA 5A2QK 3CO6C 5GTHC 2R7OA 3JSOA 3L2UA 1S29A 4C3JJ 4HQEA 1O4XA 4BXUA 1EA3A 3BT9A 1P4XA 3CQZJ 1JJ8C 1FYLA 5CVUA 2LOOA 3K1PA 1XSDA 3BTIA 1ZARA 5L3BA 4ABZA 1WKMA 3W3CA 2CQ7A 1W0TA 3H5RA 3CCYA 5D5XB 1HW5A 5DM6F 2D5VA 1MMSA 1SMTA 5BNGA 1WGXA 4BY1J 4MLOA 3FXJA 1IG7A 2BW3B 5GADJ 4ZJZA 1QPIA 3HG9A 5K7FA 1ETOA 2KP6A 4AU7A 4KMFA 2FNPA 2D1HA 2AXTC 1IZ1A 2ZC2A 4K2EA 1X58A 2O8KA 3IC7A 1QBJA 1XSVA 2V9KA 1IRFA 1FOKA 1KA8A 2MFZA 2RV8A 1MJAA 3H0DA 1D8KA 5GP9A 3PUFA 3ZQGA 2KFDA 1K83J 2JZYA 5K5RA 1VF9A 1XDSA 3BR1A 2QZ8A 4EATA 4Y3OA 2FJ1A 4IHWA 2ZSHB 2A07F 2L9RA 3FMQA 1R5HA 1OYYA 3GO5A 1TC3C 4P5OA 5IT9Z 3MVPA 3WGHA 3G6EI 1DU0A 3TP3A 2IA2A 2EQRA 1MBHA 2LREA 2QQBA 4NC7A 2LP0A 2M45A 2L7MP 3PQKA 5IPAA 1U8BA 1IRGA 1ERDA 2DOEA 3BDDA 1I1SA 1WJEA 2FD5A 3PNTA 2X6XA 2R92J 2CJJA 2ELJA 2LNBA 3UR3C 4N4NB 3HBLA 2DT5A 2EIJH 3LSKA 3LAJA 4RLQA 4IHYA 2VASA 2DA3A 4Q4ZF 2KDOA 2HZTA 3ERED 3QWLA 3HSEA 3KYDB 3S15J 4GCVA 2QVOA 3E6CC 1NG7A 3FWEA 4FISA 1FOYA 2WAQN 1A04A 1S5LC 3K4NA 2QA4I 3H36A 1OCCH 2COMA 2W4SA 1XCVA 2IW5A 3KZZA 3QYEA 3ZR8X 1JUMA 1P92A 1SFXA 1X3WB 2K27A 2P0WA 3KETA 4BQAA 3H5AA 5J4YA 1LVKA 4L18B 4D0PA 3E1SA 1XPXA 3PL8A 1Y1VJ 3OYNA 2V1DA 4F91B 1BBYA 1FYKA 1ZLKA 1NK2P 1ZTRA 2MYSA 3CCQI 3TOBA 3AFHA 4QIWN 4IPAA 3V8JA 2XRNA 4KA4A 4XNFA 1M1EB 2EPFA 2W1OA 3KCCA 4AC0A 3CC7I 1SD4A 4M71A 3GYHX 1LB2A 2MG4A 1I3QJ 1OFCX 3RKWA 1LNWA 2DI3A 2WAQA 1A35A 5IT9K 2VE9A 1SAUA 1MBGA 4CCOA 2F4IA 3FHZA 2PX9A 5DCMA 1J75A 5C3EJ 2LD5A 1TL8A 3L2VA 4X6AJ 2ID6A 1JI8A 3LSTA 1OR7A 2DOFA 1AOYA 4EGZA 2WC2A 3U2RA 3O6BB 3SZPA 4E7SA 4E7HA 4HV6A 1MIJA 3FX3A 4M9ZA 3L2WA 1YLFA 4OAYA 3JCUC 1RKTA 3HB9A 3DXJF 2E34A 2OQGA 3TMOA 3V4GA 5D4SA 4DGWB 5M5YJ 5LEJA 4GDFA 4WK8F 1ZKGA 2BV6A 4I02A 3J80Z 3KEYA 2KRFA 4NUBA 1R5ID 1P7JA 3ABLH 1L0OC 2OQRA 5K7ZA 4XONA 2EIKH 1R6RA 4I09A 3NWSA 4Y33A 3SHFA 2E1MB 2X48A 1XMKA 4HF0A 3S1QJ 3A1YA 3FXKA 4ZZDA 3L2CA 1YS6A 1FLIA 2EFNA 3CDIA 3DQVC 1MSEC 1O3RA 3CCSI 1S6LA 1WI9A 3CD6I 3EUHA 2HWVA 4H0EA 1MMGA 2X9DA 3F8BA 3HRSA 1XC5A 3ULQB 4BACA 4G6QA 2GA1A 2DA5A 1V4RA 2VKVA 3ZN1A 3K70C 1NTCA 1QU3A 3I54A 4IHTA 3BR3A 1X1CA 2DA4A 4UVBA 4G7HF 4YEJA 2I5UA 2A6EF 2M8GX 1XGOA 3OYHA 1R1UA 4JP0A 2L7KA 2VQLA 1D0ZA 2IEKA 5AIPA 4CCKA 3VB2A 4IQJA 3TOAA 1ZH5A 4MEXF 2EV6A 5LFAA 3HGGA 3KE2A 1D1BA 3E97A 2JK3A 2CQNA 1WH5A 4R8HA 3QRFF 4W1UA 5DCMB 2IAIA 2OZ6A 2NS0A 1H8AC 1O3SA 2EFOA 2HGCA 1E3HA 3BQYA 2GBYA 3IRQA 2IS2A 3CDLA 3ZOBA 1WCMJ 4XMYA 4PJ0C 4RGSA 3SFIA 2O5RA 3QPSA 2PJRA 4MTDA 1Z7UA 4G7ZF 3RPUD 2R5ZB 4A93J 2LG4A 2P5KA 2D2WA 3KP4A 3J80K 1ZG1A 1J5YA 2D1VA 5D5UB 3LMMA 4LG3A 3FXQA 2HYJA 2ESHA 5CYVA 4A6EA 1X19A 4P96A 3MKZA 4EJOA 4CYCB 1W0UA 1FBQA 5ERIA 3MFKA 2K4BA 3KLNA 4CA0A 4HW0A 1ZGWA 4F7ZA 2R7DA 2R4GA 1IUYA 3KP2A 1KU3A 1Y1WJ 1BA5A 3GFMA 2PBIA 1YFHA 4M6YA 2JMWA 1GXQA 4N4OB 5IP7J 2VT2A 2FMYA 3ZQFA 2ZJPF 1STZA 1ZG3A 2IRFG 4RAZA 5FKMA 4E7ZA 2DOAA 2VQHA 2CW8A 3K10A 3CUOA 3NRVA 4IOCF 2P6SA 2GOMA 1MH3A 3RKYA 2NVTJ 2XF5A 3I58A 1MMDA 4MNUA 4B09A 2RREA 5E3NA 3R4KA 2DA2A 2ELHA 3BROA 1YJ9I 2M7AA 1PDNC 4EJVA 4BL0B 5HLTA 3K70D 1Y0NA 2L54A 4IZZA 2Z3YA 3O2PE 1XN7A 2ZKZA 1YX3A 4DIQA 3GUDA 1OCZH 1T0FC 1N25A 3P9IA 3Q0WA 2OV7A 3BQZA 2JQ7A 2DMQA 3OSGA 3IP4B 2EA2A 4EQQA 2IA1A 4KJZA 2V9VA 3FK7A 4ENMA 4BXXJ 4DBRA 1P2FA 4XRFA 3QP5A 4Y52J 2CYYA 1B9NA 1HKTA 3RQIA 2V26A 1OYIA 5LD2C 1FJLA 4HA8A 2NYXA 5FKLA 4L5EA 4ZDOA 3VOEA 1D1CA 4J19A 4LD5A 5LGNA 3E5QA 9ANTA 3F23A 4H4KC 3TP0A 2P8TA 4BHPA 2V4JC 3N97A 4IHXA 2OPTA 3SYTA 1RESA 1HDPA 2K9QA 4BE1A 2IS6A 2FNAA 2M8EA 3WE3A 2KHMA 2MD0A 2Z99A 2K9SA 3OYLA 1U5TA 2Q2EB 3F8MA 4UV9A 1B4AA 1ZELA 5M5XJ 3ZQCA 4IHVA 3MZYA 3TO6A 4NBQA 1G2HA 3M8EA 4UHTA 2DYRH 3M8FA 2EV0A 2L4AA 3WTSC 4ZTJA 2R5YA 4P9UA 3BG6A 4D7MA 1TQMA 3RZOJ 1YS7A 3M9AA 1USSA 4J01A 4GYGA 4ENJA 1JJ6C 2XHKA 4M3EA 2V1XA 5DUIA 2QUFA 2Y9YA 3B6AA 2RNGA 2X85A 1VQ8I 1HOMA 3M1CA 2VB6A 3PO3J 2X4HA 2Y30A 1S3JA 2QWWA 2H1KA 2ECBA 2XRLA 2XPUA 2QLZA 2QF7A 3OYJA 2EA4A 2EZKA 4FCYA 1Z9CA 2WV1A 4KT6A 1BJAA 1ULYA 1QRYA 5JI6A 3CZ6A 3TO7A 1DP7P 1WJ5A 3MQ0A 2DT7B 2Z33A 2DQLA 1WVRA 3LQQA 1REPC 3VYTB 2EJRA 3FXLA 3MKLA 3Q3SA 4NC8A 1YYVA 3GZ5A 3S32A 4HF1A 5HNHA 4AWXB 2VXDA 3JTGA 4HRIA 1Y6IA 2H1LA 2P6TA 1TNSA 3CJRB 2HOAA 1TWAJ 4BBSJ 2X51A 2YX4A 1WJAA 3S93A 1SMYF 3J7YJ 3HKZN 4PZJA 3CCEI 4OIPF 2XAQA 2DT6A 2R7TA 4HG2A 3V7SA 3OYIA 3QOPA 1X4PA 3SXYA 3OIOA 3V42A 2L01A 4ZYGA 3E6BA 3S2HJ 3KPHA 2KDZA 1KYWA 1U5TB 1HDDC 1K79A 1BOBA 4LOCA 4ESJA 3RJPA 2TRTA 4MTEA 1R22A 2DFEA 4OMZA 2OAZA 2IJLA 2F4OB 3F21A 4EMSA 3M4OJ 2UZKA 4A3FJ 1UHSA 4Y4RA 1U8RA 1IRXA 3GTKJ 1ZREA 2VPLA 2L7ZA 1TTYA 4CXFA 5L3DA 2I10A 1R49A 2E5NA 3GTOJ 2GA2A 3JRIA 4KMUX 3SEQA 5JFRA 4O3MA 3K69A 3K4MA 1D8JA 4NC6A 5JVTA 2NXNB 2FEZA 1QVUA 3OYCA 5F1JA 1IJWC 3PM1A 3HSRA 5HLGA 2RQPA 3F0CA 3HOZJ 3WTXC 2VL8A 5B1BH 1B6AA 3GWZA 1XTAA 3WTZA 2HVQA 4XR6A 4KYWA 5K1YA 4ASNA 5JHFA 2HOEA 2L9NA 3GTLJ 1JXSA 1WJDA 4EM1A 3K6GA 1OCTC 2CO5A 2NVXJ 3BR0A 3CDHA 5E1ZB 4OIQF 3AL0C 3S2DJ 2GAUA 4QSHA 1FP1D 4IL6C 2O7OA 4BDYA 3QODA 3TW7A 1HCRA 3CP2A 3CCJI 2WY7Q 5TGTA 3IHUA 3IH2A 4B3XA 5J8FA 5H20A 4XL9A 2IBDA 4B3AA 2FXAA 1DPUA 2KRCA 1R4MB 1OYWA 3LA2A 1KYZA 1XMAA 1S8NA 1F1ZA 4L9TA 1MNMC 3T8RA 3V7CA 4XM3A 5E8IA 2MH9A 2OD5A 2ICWG 2O61A 2P7CB 1IV6A 3GXOA 5EYRA 2LY1A 4NQWA 3I56I 3CO7C 2OZUA 3RKXA 1EKEA 2VE8A 4RDUA 3HRMA 1OKRA 1R1TA 2Y31A 2M3AA 3GZNB 2KPMA 4V19K 2FOKA 5EF6A 4Z6YA 2HKOA 1U3EM 2F5CA 1D0XA 2DAOA 2M4GA 1WI3A 3K4BA 4ENNA 2FMLA 1F43A 1ETQA 4IRHA 4M9SA 2R7QA 1XG1A 4CCMA 3S16J 5IT3A 3OR1C 2F2EA 2G7HA 2JA2A 3MZHA 5FLVA 3K2AA 2Z2SB 4JYKA 3FMRA 4UY8I 2ZXJA 1UG2A 1Z21A 4PJMA 2RC4A 3QAHA 1D0YA 2LVSA 4UVCA 3OOPA 4L5JA 3ABUA 3PO2J 1J59A 4KICA 2R7ZJ 1Z0XA 1T6SA 2N8GA 1KU7A 3LQRA 4XKBA 3GLLA 3AG4H 4ANJA 2HFHA 5BQTA 1SD7A 1LEAA 3DPLC 4FE4A 5IP9J 2HVSA 3GBGA 1FSHA 3H3ZA 5B5EC 1R9TJ 3AG2H 3BWGA 3GTPJ 3JRBA 2KIMA 3CCMI 2K40A 1TBXA 2RNJA 4I76A 4M9XA 4EJUA 1POGA 5CVJA 1TWFJ 4XLCA 4UUSB 1B8IB 2WAEA 1W1WE 3G4SI 1BR1A 3HRUA 5E1XA 2ADUA 2JA7J 4EEFG 3S3MA 1U9OA 4NQWB 2DMNA 2HQNA 2Q0OA 4C2TA 1F9NA 3DFGA 4G94A 3HEFA 1W7PD 3CJNA 4I01A 4E7IA 1YRNA 3ZGKA 5IP6A 2CUZA 5FFZA 5J47A 1H0MA 1JGSA 5L3EA 3W2AA 3QU3A 3CCLI 1BI2A 2LY9A 3K0LA 2F6CA 2DA7A 2VBWA 4P1WA 4XBFA 2NOJB 3LSJA 4KIGA 1A6QA 4FT8A 3OYDA 5FROA 1ZRDA 1MGTA 2C6YA 2DDBA 3REOA 3E0JB 4HLYA 2MD5A 4XLNF 4HQMA 2HVRA 3OL4A 3DU6A 5F6FA 3G3ZA 4M6XA 3I64A 4O6JA 4B8XA 5HVQC 3ABTA 2O8XA 3A0BC 2DQRA 2CUEA 3PNVA 3G73A 1YE9A 4IRGA 4A12A 1EV7A 5E3MA 4IXAA 4P55A 3IRRA 1MDMA 2JUCA 4WX9A 1JGGA 5J4VA 1ON1A 2K5CA 3K4LA 2XROA 4IX7A 1X3ZB 1R7JA 2XSJC 2DJIA 4LMYA 3ZQQA 4B1RA 2PJPA 1ETYA 2BXZA 1HKQA 4PGHA 5EG0A 2X1DA 1YJNI 2CW7A 3RYRA 5IYDJ 2X1EA 1TP4A 2J5OA 4Y17A 4BEHA 1LFUP 4M3BA 3OYBA 1SFKA 2JA8J 4MHGA 3KZIC 4CGZA 1BN5A 2ZMEC 4GYIA 4JBAA 3OR2C 1R58A 4KIBA 1H9GA 2NVUB 1RR8C 4HF2A 3T0YA 3H92A 3OIQA 4G12A 5LRRA 1MBKA 1UZCA 1YO5C 5BMZA 2DPDA 1K4SA 2ME0A 3BZ6A 2EV5A 3HYIA 3UNGC 2CQKA 4M3DA 2GXAA 3KX2A 1Z7LA 1YRNB 2PN6A 4HV5A 3RZDJ 3JREA 2RVCA 4LIVA 2NRAC 1LEBA 3FM5A 5FGMA 4ZDPA 1CF7A 2XB5A 4RB1A 3LSMA 4MQVA 2A69F 2EH3A 4IRIA 4CH7A 1U0JA 4KUMA 5E79C 5KHDA 3DKYA 4YIIA 5EJCA 1X2MA 2BY2A 2LBFA 2B7EA 3I53A 2PMUA 1FEXA 2CW0F 3W2WA 1T98A 2L5QA 3I9V2 4LK1F 4BJTA 1VQNI 2VKHA 4L0ZB 3GTMJ 4LK0F 2NNYA 4WXHA 3C7JA 3R0AA 2LFBA 2O3FA 1J0RA 3CF2A 2IGKA 2QSGX 1MDMB 4KN4X 4UUVA 5CQGA 3G71I 2JWTA 3OL3A 2QYOA 3KP5A 4KT5C 4V2FA 5LHGA 3L09A 3DU5A 3BPVA 2KJBA 2AHQA 4HSRA 3PSIA 1BI1A 4RAFA 1W5SA 1MD0A 3CUQC 3KZYA 3F3XA 2JRTA 3PFIA 1TW3A 1KU9A 1U78A 1VQ4I 2JJ7A 2PLYA 1O57A 1R00A 2R7VA 4I7HA 1MJBA 4BEHB 2K02A 3SQNA 3HOVJ 1Q1VA 2ZJ2A 4C30A 1HW2A 2R7XA 2VONA 3SDBA 2UWMA 3OS1A 3CC4I 4MEYF 4RAGA 3ASNH 4BHBA 3L7WA 4E7KA 1VFCA 4KDPA 3I71A 3S17J 3X2QH 1Z6TA 4CICA 2HTSA 2M1BA 5EEHA 3DTKA 4LG0A 2DK5A 4AYBN 1P6RA 2DPUA 2A5YB 2BY3A 2GOXB 3PNYA 1Z3XA 3DWLE 5IYBJ 1VQKI 4LB5A 2MC3A 3WHBA 5D6EA 4AD9A 3KLOA 3GMEA 2VJ5A 3S1NJ 3JRCA 1WJCA 2R3SA 1CF7B 1FSEA 3ZPLA 3JSPA 3TDZC 1TW2A 2UXXA 3VYRB 4CCJA 2ZO4A 3RTRA 4PFOA 4O5VA 2HXOA 4HEA2 4XIDA 3OSFA 4W97A 3W6VA 5C4JJ 1ZG5A 2HOSA 4GO1A 3HOSA 3VYUB 3DEWA 4A6DA 3MWMA 2LLKA 1YHQI 2HR3A 2LSOA 1TZLA 1LFBA 1V3FA 1Z6RA 3HOYJ 3RCOA 1UHWA 5DS9A 3N4MA 3J7AY 1OCOH 1RZ4A 2FF4A 1KONA 4YRVA 1FTTA 2VN2A 1ZRFA 4Q5SF 1W4MA 2CG4A 1X1BA 4PCQA 4A3EJ 1OMIA 1YI2I 3HGYA 2XKOA 4RM2A 5CLSA 1KU2A 3WHCA 1BC8C 1VQLI 1IO2A 2LKXA 3K4KA 1YW9A 1TT0A 5FLXZ 2LMDA 5GAEJ 4U7DA 3DKXA 1XDUA 2O0YA 5ICGA 2ZFWA 1NHAA 5JHUA 4X0GA 1W7PA 2VKEA 5LLQA 3QYBA 5B66C 2UXNA 1BIBA 1QQIA 4UV8A 4BXFA 2A5WA 3OIPA 2L9VA 4XICA 3OY9A 1QA6A 4A0ZA 1AU7A 3VWBA 3SZGA 1S7EA 4OU0A 3D5SC 1I6HJ 1Z05A 1ZLJA 3Q9SA 4PJLA 1OQYA 4LG0B 4AIKA 1I5ZA 2RAEA 3BCBA 3HUGA 2B9SA 4XLPF 2DW4A 1DQUA 3BG3A 2XC7A 5H6RA 3U21A 3EYYA 2R7RA 5ICFA 4NDLA 3PQJA 3MAJA 1KQ0A 3MKWB 3NARA 5KVRA 2CUJA 1MJ9A 3GW2A 1IV8A 2NS8A 2XGEA 5ICCA 4F55A 3WTYC 2EK5A 5H2FC 3GX4X 4E7JA 4YFNF 2CUFA 4LLGF 5GTIC 3BJAA 2P81A 4MO7A 4NNJA 5E8GA 4XRSG 1ZR2A 1TLHB 2DN0A 3OOUA 5J1RA 3CCUI 2WB1N 3TKYA 3H5NA 1CQTA 2B63J 1SVMA 2RGVA 2JSCA 2M0CA 1VQOI 2FE3A 5KNLA 3RPQA 2CQXA 1XGSA 3F8CA 2Z9OA 5FLXK 1Y56A 4WXCA 1R36A 2GWRA 3NQOA 4YFXF 2GLOA 2Y0SN 2ZNYA 3TBIA 1X1AA 3NEUA 3J81K 2LRDA 5K5OA 2G9WA 3BTJA 2FBIA 2G0EA 1RRJA 1ODDA 2Q1ZB 4BGDA 3A01A 1XGMA 4GRIA 4S05A 3HOTA 2I8DA 4ZH4F 3WTVC 4C9YA 5HODA 2CV1A 1S9HA 4P9FA 4QPQA 2VLAA 2MLKA 3PJRA 3KIOA 4XOTA 1ZQ3P 1QNTA 1P7IA 4MFDA 5HDGA 3R0JA 2LR8A 1KGSA 2E19A 5DUKA 4XRSA 3CC2I 2KLOA 2W85A 2HYGD 4EM2A 2KRHA 5AONA 2Y0SA 2LF8A 1K4TA 2E60A 1OPCA 1FT9A 4D5FA 4JK1X 1JT6A 3FHNA 3VDXA 2PJRB 2JVHA 1SFUA 2CV0A 2XAHA 3GF2A 4HX4A 2HPMA 1FTZA 5LGUA 1MKMA 5C44J 3CCRI 4OIRF 1WH7A 3JW4A 3JRFA 1QZZA 4BQQA 1FMVA 5HS8A 1X1DA 3L9FA 4BH9A 4A3DJ 4CHUA 2GZWA 3VPRA 4BU2A 4BDZA 1YIOA 4GGGA 2H27A 3UKGA 3S14J 2HEOA 3I59A 3PIPF 3WGIA 1LE8A 1WWXA 1Z1DA 3BZCA 3D5LA 3HHHA 1H89C 4EM0B 1W5CC 4LB6B 2KT0A 3E7LA 4XLFA 4L9VA 2HTJA 4AIJA 3P5JA 2X6WA 2K7LA 5ILUA 5JVGF 2MGQA 1UB9A 5TISC 4A3GJ 3F6OA 5BS6A 5FRMA 2UUZA 4IVNA 3C2BA 3I0TA 3R60A 2Y2ZA 4D9JA 3S1RJ 2XUBA 4LLNA 5J1UA 3GTJJ 5FKOA 2AQFA 3DF8A 5FJ8J 1UMQA 3F22A 1RIOH 3H35A 5CVVA 1MBEA 1GDTA 4QTRA 1VTNC 3ROUA 3ZMSA 4EV0A 3FISA 2JPCA 4XLHA 2XGXA 3OYGA 1OISA 4QPOA 2X0LA 3EQLF 2V7FA 1V5GA 5FKKA 2VOOA 2DLLA 1VQMI 5DD4A 1U9NA 1FBSA 4DOZA 1R23A 5F0CA 1BL0A 4FASD
chains in the Genus database with same CATH topology
4UVAA 1S7AA 4HYEA 2XV4S 3JTHA 4N0BA 3GZ6A 2M30A 1F4KA 2WV0A 5D6FA 2A6HF 2PMHA 4G6DA 1XSXA 2PEXA 3EETA 1H9TA 2BBYA 4EGYA 1U6GA 3BPXA 4CZZA 2FSWA 2W25A 3CUQA 3I5UA 2E1NA 3FM3A 3I59B 2CWEA 4PDKA 3K1NA 1HKSA 1UCRA 1O7LA 2MBFA 3ECHA 1GXPA 3KP3A 4OINF 4WCGA 1LDDA 5HS7A 2XASA 2L4MA 4G9YA 1XD7A 5LGTA 4L9NA 4GXOA 3RPUA 4LGWA 5HDNA 2JTVA 3KFWX 1TQPA 4RGXA 2QQAA 1WSUA 1LJ9A 1HW1A 2IPQX 1TQIA 3OV8A 4HLXA 5TRDA 3S2WA 3C18A 3T8TA 2YU3A 2MH2A 3M1EA 3P9CA 1BOAA 5D5WB 2OU2A 1ZHFA 3CUQB 3KEOA 2M5WA 2YX7A 4ZYDA 5FB2A 1XB4A 3TQNA 4UXNA 2QQ9A 5HDKA 2XVCA 2P5LC 1G3WA 3I4PA 2RDPA 2PG4A 1J9IA 3FZVA 3TO9A 1K78A 3E5UA 4LJZF 2H09A 2ZBKA 1EH6A 2MLGA 2P7VB 1E17A 4A0XA 2F5EA 2RN7A 3T5XA 1HSTA 3H3UA 1IXCA 4I0AA 4WWCA 5E1WA 3FF5A 4DNCA 3BP8A 4KNYA 2BE5F 3HSFA 4R1HA 3WTUC 1DUXC 4BYYA 2VT3A 3K1MA 3GFJA 3P7NA 5LRSA 5E20A 3V8LA 3Q5FA 3EYIA 4M74A 4U0YA 2D45A 1IN4A 2K4JA 2F5FA 3DEUA 4AVPA 1BI3A 2KKOA 4XSZF 4S04A 3T1BA 3HTSB 4ZZLA 1LDKB 1Q1HA 3F8FA 3B73A 1T0FA 2L3DA 3WU1B 3W6JB 3O3KA 2HYFA 1IN5A 4I2OA 1QGPA 4OOIA 2EFQA 2AS5F 1W5TA 1BM9A 5TJJA 3HTUA 1IXSB 3IL2A 2JPBA 5J6XA 3WODF 3WU0A 3C1DA 3WTWC 3MCZA 2BGCA 4U7BA 3ELKA 5ED4A 1G3YA 4WXDA 2CFXA 4HBLA 1FNNA 2O03A 3V8KA 2DO7A 1ZGJA 2VBZA 3ZP5A 1Z91A 3ZMUA 2HQRA 2QM3A 1K6OA 3HIFA 3JAMZ 2L02A 3U9GA 3W6KB 3QU6A 1XCBA 4OMYA 2Y48A 1KQ9A 2OA4A 3DKWA 1U5TC 3R61A 5BOXA 1TNTA 1HQCA 1GVJA 3M7GA 2VXZA 2V79A 2NNNA 1SFEA 5L3CA 4HX7A 2PI0A 3J7AO 4QLCU 1IW7F 2CSOA 3LA3A 2Y75A 1ZN2A 4HDVA 4NB5A 1ON2A 5H6QA 4HZFA 2LF7A 3HHGA 3IWZA 4OIOF 2JT1A 2PFBA 3P9KA 3JAMK 4BNCA 1MZBA 1G6NA 2LDUA 3COAC 1YG2A 1YW8A 1O7FA 1RI7A 6PAXA 5HOOA 1RNLA 3RI4A 1UFMA 1QO0D 3ZMZA 4ETSA 4EVIA 1SAXA 2WWYA 4RAYA 3E6DA 4MGRA 4N9IA 3R6SA 1XGNA 2FRHA 1E2XA 3WE2A 4JQFA 2PQ8A 5E18F 5CVIA 5LHHA 1FPQA 1EH8A 5CJ9A 1QZYA 4ESFA 3EDPA 5DEQA 1R5GA 4HAMA 3ECOA 1Y0UA 3L00A 1BIAA 3SFZA 3ML6A 2EWNA 5D5VB 1YW7A 2IT0A 3WG9A 3ZQ7A 4FX4A 3KP7A 3LAPA 1I6XA 1LDJA 2P4WA 4AIHA 2XAGA 2DTRA 4Y15A 3K2ZA 2WTEA 3FMSA 2QENA 3F6VA 5D4RA 4PGGA 4U0WA 4A5NA 4BHCA 3Q9VA 2H6CA 3J81Z 2RKHA 3BJOA 4A0YA 3ISPA 2GXGA 4G8XA 4HOBA 4FHTA 2ESNA 4KN7X 2B0LA 4RB2C 2QBYA 2IP2A 2MA3A 2KJCA 4ZYEA 3GVAA 1SD6A 5AIQA 4U88A 3RYPA 2VBYA 2E7XA 5HLIA 1JE8A 4BAYA 1BI0A 2STTA 2VBXA 4U0VA 5F64A 5CVRA 1P4WA 2HKXA 1IN7A 3GLXA 2H6BA 4L9JA 1FC3A 1FX7A 4QWQA 4IJAA 5DYMA 3ZMDA 4MQ9F 4LLLA 5FO5A 2IA0A 2Q2EA 3IWFA 3KEQA 4R79A 3RDIA 3E6MA 1FYMA 2DFIA 2FBHA 2FBKA 2KIUA 1F5TA 2P5VA 2TDXA 1W7PB 3F8NA 1IF1A 2DK8A 5HLHA 1RUOA 1K7AA 3AAFA 3LA7A 3GFIA 4I0BA 2QBYB 1RUNA 3U1DA 2YR2A 2OBPA 3IKTA 5ILVA 3E3VA 1DPRA 4RB0A 2VOPA 1ZRCA 1WRJA 2YPRA 2DU9A 5L3FA 5D8KB 1IAWA 3GFLA 3VODA 3QPTA 5FD5A 4G7OF 3CTAA 4N9HA 4TV7A 2LKPA 1U2WA 2Q8KA 4RGRA 2XAJA 2XAFA 1ZGAA 1PP7U 2FQ3A 5J8CA 2ZMEA 3RIRA 2M87A 5LBQA 3IKVA 1D3YA 3LFKA 5DD8A 1R1VA 3ZN0A 1FP2A 5E17F 4IHSA 1FBUA 1UHMA 2A68F 4IF4A 1FZPB 3MEXA 4ESBA 2GXBA 2GIVA 1HBXG 4FX0A 2YSRA 4Q48A 2XIGA 2STWA 2HDCA 1YTYA 1T38A 2ZCWA 2ZNZA 2BYVE 2IVMA 5DDGA 1C0WA 1CGPA 4KFCA 5KK1A 2FU4A 1GHCA 4XSXF 4CO8A 2DBBA 1DDNA 1PP8F 1ZYRF 4YIFA 4LFUA 2BEOA 1ONVA 5DCFA 2KIFA 1HXDA 4RS8A 5K5QA 2ZMEB 2ISYA 4RB3C 1B1BA 2ACJA 1IXRC 1AWCA 1O3TA 1J2XA 4NHJA 2H94A 3V7RA 3FXUA 5F1RA 3GEZA 4ZYHA 1SD5A 2Z5UA 3BY6A 3QP6A 3DPTA 4HDUA 5BPDA 4EJWA 4ENKA 1L3LA 3LWFA 1G3SA 2GQQA 5LHIA 5JR3A 1JHFA 4KIFA 1O3QA 2EFPA 3BOQA 1B9MA 3FXRA 4EJTA 1HSJA 2K86A 2J5PA 3QPHA 1JHHA 4M72A 2A3SA 1LVAA 3D0SA 5BPIA 3B02A 1USTA 2HS5A 3SZTA 4A2UA 1G4DA 4L0YB 4CDGA 4Q47A 4M73A 2ETHA 3BJ6A 4Y13A 1LQ1A 2W84A 2Y0MA 3TDUC 3TGNA 2R7FA 3KP6A 1PUEE 2FA5A 1I1GA 4UNOA 1YQAA 2F5DA 1KQ8A 1EH7A 1ZAOA 5L3GA 3DP7A 4L5IA 4YG2F 5LEKA 4I98B 4E70A 2NAZA 5FD6A 3C3WA 4DQ2A 2E7WA 1FY7A 2VC1A 1B59A 5DV5A 3CLOA 3WTTC 1T2KA 2O6GE 4HX8A 1IN8A 2W24A 5HS9A 3F72A 2V1UA 3E5XA 3ZMTA 5A2QZ 2EFWA 2W57A 2ISZA 3HRTA 2VODA 4A5MA 1G3TA 3K9TA 1I27A 2XKPA 1FWZA 2V6CA 5FFXA 4CYDA 4Z2YA 5ICEA 2E1CA 2A61A 1BC7C 5D8LB 5ILSA 1K78B 2AXLA 1S7OA 1J7KA 2CGPA 3VEPA 3ZMVA 2VC0A 2EB7A 1X3UA 3WGGA 5EEGA 4YFKF 1D5VA 1WQ2A 4ON0A 1QPMA 4RGUA 1IN6A 1P4AA 1T39A 4WF2A 2G7UA 3DV8A 3VFZA 5A2QK 3CO6C 3JSOA 1S29A 4HQEA 4BXUA 1FYLA 1P4XA 5CVUA 1XSDA 3K1PA 1ZARA 5L3BA 1WKMA 5D5XB 1HW5A 1SMTA 4KMFA 2FNPA 2D1HA 1IZ1A 4K2EA 3IC7A 1QBJA 1XSVA 1IRFA 1FOKA 1KA8A 2RV8A 1MJAA 1D8KA 2JZYA 5K5RA 1XDSA 2QZ8A 2A07F 3FMQA 1R5HA 1OYYA 3GO5A 4P5OA 5IT9Z 3WGHA 2IA2A 2QQBA 2M45A 3PQKA 1IRGA 1I1SA 3BDDA 2LNBA 2DT5A 3LAJA 4Q4ZF 2HZTA 3ERED 3HSEA 4GCVA 2QVOA 3E6CC 3FWEA 1A04A 2COMA 1XCVA 2IW5A 3KZZA 1P92A 1SFXA 2K27A 3KETA 4BQAA 4L18B 4D0PA 2V1DA 1BBYA 1FYKA 1ZLKA 3TOBA 4KA4A 4IPAA 3V8JA 2XRNA 3KCCA 1SD4A 4M71A 3GYHX 1LB2A 3RKWA 1LNWA 2DI3A 5IT9K 2VE9A 3FHZA 5DCMA 1J75A 3LSTA 1OR7A 1AOYA 4EGZA 2WC2A 3U2RA 3O6BB 3SZPA 4HV6A 4M9ZA 3FX3A 1YLFA 3DXJF 2OQGA 3V4GA 5D4SA 5LEJA 4WK8F 2BV6A 4I02A 3J80Z 2KRFA 1L0OC 2OQRA 4I09A 3SHFA 1XMKA 4HF0A 4ZZDA 3L2CA 1YS6A 1FLIA 2EFNA 3DQVC 1O3RA 1S6LA 1WI9A 3EUHA 2HWVA 4H0EA 3F8BA 3HRSA 3ULQB 4G6QA 2GA1A 1V4RA 3ZN1A 3I54A 4IHTA 4G7HF 4UVBA 2A6EF 1XGOA 1R1UA 5AIPA 3VB2A 3TOAA 1ZH5A 4MEXF 2EV6A 3KE2A 3E97A 4R8HA 3QRFF 5DCMB 2OZ6A 2NS0A 1O3SA 2EFOA 2HGCA 3IRQA 4RGSA 4MTDA 1Z7UA 4G7ZF 2P5KA 3KP4A 2D2WA 3J80K 1ZG1A 1J5YA 2D1VA 5D5UB 3FXQA 5CYVA 2ESHA 4A6EA 4P96A 4EJOA 1FBQA 5ERIA 3MFKA 2K4BA 3KLNA 4HW0A 4F7ZA 2R7DA 1IUYA 3KP2A 1KU3A 3GFMA 2PBIA 1YFHA 4M6YA 1GXQA 2VT2A 2FMYA 2IRFG 1STZA 1ZG3A 4RAZA 3NRVA 3CUOA 2P6SA 3RKYA 3I58A 4MNUA 4B09A 3R4KA 2ELHA 3BROA 1PDNC 4EJVA 2L54A 2Z3YA 3O2PE 1XN7A 2ZKZA 3GUDA 3P9IA 2EA2A 4EQQA 2IA1A 2V9VA 4ENMA 1P2FA 4XRFA 3QP5A 2CYYA 1B9NA 1HKTA 1OYIA 4HA8A 2NYXA 3VOEA 4LD5A 5LGNA 3E5QA 3F23A 2P8TA 4BHPA 3N97A 2FNAA 2M8EA 3WE3A 2Z99A 1U5TA 3F8MA 4UV9A 1B4AA 3MZYA 3TO6A 3M8EA 4UHTA 3M8FA 2EV0A 2L4AA 3WTSC 4P9UA 1TQMA 1YS7A 3M9AA 1USSA 4GYGA 4ENJA 2XHKA 2V1XA 5DUIA 2QUFA 2X4HA 1S3JA 2QWWA 2QLZA 2EA4A 1Z9CA 1BJAA 1ULYA 5JI6A 3TO7A 1DP7P 3MQ0A 2Z33A 2DQLA 3LQQA 1REPC 2EJRA 1YYVA 3GZ5A 4HF1A 4AWXB 3JTGA 2P6TA 1TNSA 2YX4A 1SMYF 4PZJA 4OIPF 2XAQA 3V7SA 3QOPA 3SXYA 2L01A 4ZYGA 3E6BA 1KYWA 1U5TB 1K79A 4ESJA 3RJPA 4MTEA 1R22A 4OMZA 2OAZA 2IJLA 3F21A 4EMSA 2UZKA 1U8RA 1ZREA 1TTYA 4CXFA 5L3DA 2GA2A 4KMUX 5JFRA 4O3MA 3K69A 1D8JA 5JVTA 2FEZA 3HSRA 5HLGA 2RQPA 3WTXC 1B6AA 3GWZA 3WTZA 4KYWA 5K1YA 4ASNA 2HOEA 1JXSA 4EM1A 2CO5A 3CDHA 5E1ZB 4OIQF 2GAUA 1FP1D 3IHUA 5J8FA 5H20A 2FXAA 1DPUA 3LA2A 1OYWA 1KYZA 1XMAA 1S8NA 1F1ZA 4L9TA 3T8RA 3V7CA 5E8IA 2MH9A 2OD5A 2O61A 2P7CB 3GXOA 4NQWA 3CO7C 2OZUA 3RKXA 2VE8A 3HRMA 1OKRA 1R1TA 2FOKA 2HKOA 1U3EM 2F5CA 2DAOA 4ENNA 2FMLA 4IRHA 4M9SA 5IT3A 2F2EA 2G7HA 3MZHA 3FMRA 2ZXJA 2RC4A 3QAHA 4UVCA 3OOPA 4L5JA 3ABUA 1J59A 4KICA 1T6SA 1KU7A 3LQRA 2HFHA 5BQTA 1SD7A 1LEAA 3DPLC 1FSHA 3H3ZA 3BWGA 2KIMA 4EJUA 1TBXA 2RNJA 4M9XA 5CVJA 3HRUA 5E1XA 2ADUA 2HQNA 2Q0OA 1F9NA 3DFGA 4G94A 1W7PD 3CJNA 4I01A 5FFZA 1H0MA 1JGSA 5L3EA 3QU3A 1BI2A 3K0LA 2VBWA 4XBFA 1ZRDA 4KIGA 4FT8A 1MGTA 2C6YA 3REOA 4HLYA 2MD5A 4XLNF 4HQMA 5F6FA 3G3ZA 4M6XA 3I64A 4O6JA 4B8XA 5HVQC 3ABTA 2O8XA 2DQRA 3G73A 4IRGA 4A12A 1EV7A 4IXAA 4P55A 3IRRA 1MDMA 4WX9A 1ON1A 2XROA 1R7JA 4LMYA 2PJPA 1HKQA 4PGHA 3RYRA 2J5OA 4Y17A 4MHGA 4CGZA 1BN5A 4GYIA 4JBAA 1R58A 4KIBA 1H9GA 4HF2A 3T0YA 3H92A 5LRRA 1YO5C 5BMZA 2DPDA 3BZ6A 2EV5A 3HYIA 2CQKA 2PN6A 4HV5A 2RVCA 2NRAC 1LEBA 3FM5A 5FGMA 1CF7A 4RB1A 4MQVA 2A69F 4IRIA 4KUMA 4YIIA 3I53A 2PMUA 2CW0F 1T98A 4LK1F 4LK0F 2NNYA 4WXHA 3C7JA 3R0AA 2O3FA 1J0RA 1MDMB 4KN4X 4UUVA 2QYOA 3KP5A 4KT5C 5LHGA 3L09A 3BPVA 2KJBA 1BI1A 1W5SA 1MD0A 3CUQC 3KZYA 3F3XA 2JRTA 3PFIA 1TW3A 1KU9A 1U78A 2PLYA 1O57A 1R00A 4I7HA 1MJBA 2K02A 3SQNA 2ZJ2A 1HW2A 2VONA 2UWMA 4MEYF 4BHBA 3L7WA 4KDPA 3I71A 1Z6TA 4CICA 2HTSA 2M1BA 5EEHA 4LG0A 2DK5A 1P6RA 2DPUA 2A5YB 4LB5A 2MC3A 5D6EA 4AD9A 3KLOA 2R3SA 1CF7B 1FSEA 3ZPLA 3JSPA 3TDZC 1TW2A 2UXXA 2ZO4A 3RTRA 4O5VA 1ZG5A 4GO1A 3HOSA 4A6DA 3MWMA 2HR3A 2LSOA 1V3FA 1Z6RA 1UHWA 3N4MA 1RZ4A 2FF4A 2VN2A 1ZRFA 4Q5SF 1W4MA 2CG4A 4PCQA 1OMIA 2XKOA 5CLSA 1KU2A 1BC8C 1YW9A 5FLXZ 4U7DA 1XDUA 2O0YA 5ICGA 2ZFWA 1NHAA 5JHUA 1W7PA 5LLQA 2UXNA 1BIBA 1QQIA 4UV8A 4A0ZA 4OU0A 1Z05A 1ZLJA 3Q9SA 4LG0B 4AIKA 1I5ZA 3HUGA 4XLPF 2DW4A 5H6RA 3EYYA 5ICFA 3PQJA 3MAJA 1KQ0A 5KVRA 3GW2A 1MJ9A 5ICCA 3WTYC 2EK5A 3GX4X 4YFNF 4LLGF 3BJAA 5E8GA 1TLHB 3TKYA 2RGVA 2JSCA 2FE3A 3RPQA 1XGSA 3F8CA 2Z9OA 5FLXK 4WXCA 1R36A 2GWRA 3NQOA 4YFXF 2ZNYA 3NEUA 3J81K 5K5OA 2G9WA 2FBIA 1ODDA 1XGMA 4S05A 3HOTA 4ZH4F 3WTVC 4P9FA 2MLKA 1QNTA 5HDGA 3R0JA 1KGSA 5DUKA 2W85A 2HYGD 4EM2A 5AONA 2LF8A 1OPCA 1FT9A 4JK1X 1SFUA 2XAHA 3GF2A 4HX4A 5LGUA 1MKMA 4OIRF 3JW4A 1QZZA 5HS8A 3L9FA 4BH9A 4CHUA 2GZWA 1YIOA 4GGGA 2H27A 2HEOA 3I59A 3WGIA 1WWXA 1Z1DA 3D5LA 3HHHA 4EM0B 4LB6B 4L9VA 2HTJA 4AIJA 2K7LA 5ILUA 1UB9A 3F6OA 5BS6A 4IVNA 3I0TA 3R60A 2XUBA 4LLNA 1RIOH 3F22A 3DF8A 5CVVA 1VTNC 3ROUA 3ZMSA 4EV0A 2JPCA 2XGXA 2X0LA 3EQLF 2VOOA 2DLLA 5DD4A 1FBSA 1R23A 4L0ZB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UVA A;  1S7A A;  4HYE A;  2XV4 S;  3JTH A;  4N0B A;  3GZ6 A;  2M30 A;  1F4K A;  2WV0 A;  5D6F A;  2A6H F;  2PMH A;  4G6D A;  1XSX A;  2PEX A;  3EET A;  1H9T A;  2BBY A;  4EGY A;  1U6G A;  3BPX A;  4CZZ A;  2FSW A;  2W25 A;  3CUQ A;  3I5U A;  2E1N A;  3FM3 A;  3I59 B;  2CWE A;  4PDK A;  3K1N A;  1HKS A;  1UCR A;  1O7L A;  2MBF A;  3ECH A;  1GXP A;  3KP3 A;  4OIN F;  4WCG A;  1LDD A;  5HS7 A;  2XAS A;  2L4M A;  4G9Y A;  1XD7 A;  5LGT A;  4L9N A;  4GXO A;  3RPU A;  4LGW A;  5HDN A;  2JTV A;  3KFW X;  1TQP A;  4RGX A;  2QQA A;  1WSU A;  1LJ9 A;  1HW1 A;  2IPQ X;  1TQI A;  3OV8 A;  4HLX A;  5TRD A;  3S2W A;  3C18 A;  3T8T A;  2YU3 A;  2MH2 A;  3M1E A;  3P9C A;  1BOA A;  5D5W B;  2OU2 A;  1ZHF A;  3CUQ B;  3KEO A;  2M5W A;  2YX7 A;  4ZYD A;  5FB2 A;  1XB4 A;  3TQN A;  4UXN A;  2QQ9 A;  5HDK A;  2XVC A;  2P5L C;  1G3W A;  3I4P A;  2RDP A;  2PG4 A;  1J9I A;  3FZV A;  3TO9 A;  1K78 A;  3E5U A;  4LJZ F;  2H09 A;  2ZBK A;  1EH6 A;  2MLG A;  2P7V B;  1E17 A;  4A0X A;  2F5E A;  2RN7 A;  3T5X A;  1HST A;  3H3U A;  1IXC A;  4I0A A;  4WWC A;  5E1W A;  3FF5 A;  4DNC A;  3BP8 A;  4KNY A;  2BE5 F;  3HSF A;  4R1H A;  3WTU C;  1DUX C;  4BYY A;  2VT3 A;  3K1M A;  3GFJ A;  3P7N A;  5LRS A;  5E20 A;  3V8L A;  3Q5F A;  3EYI A;  4M74 A;  4U0Y A;  2D45 A;  1IN4 A;  2K4J A;  2F5F A;  3DEU A;  4AVP A;  1BI3 A;  2KKO A;  4XSZ F;  4S04 A;  3T1B A;  3HTS B;  4ZZL A;  1LDK B;  1Q1H A;  3F8F A;  3B73 A;  1T0F A;  2L3D A;  3WU1 B;  3W6J B;  3O3K A;  2HYF A;  1IN5 A;  4I2O A;  1QGP A;  4OOI A;  2EFQ A;  2AS5 F;  1W5T A;  1BM9 A;  5TJJ A;  3HTU A;  1IXS B;  3IL2 A;  2JPB A;  5J6X A;  3WOD F;  3WU0 A;  3C1D A;  3WTW C;  3MCZ A;  2BGC A;  4U7B A;  3ELK A;  5ED4 A;  1G3Y A;  4WXD A;  2CFX A;  4HBL A;  1FNN A;  2O03 A;  3V8K A;  2DO7 A;  1ZGJ A;  2VBZ A;  3ZP5 A;  1Z91 A;  3ZMU A;  2HQR A;  2QM3 A;  1K6O A;  3HIF A;  3JAM Z;  2L02 A;  3U9G A;  3W6K B;  3QU6 A;  1XCB A;  4OMY A;  2Y48 A;  1KQ9 A;  2OA4 A;  3DKW A;  1U5T C;  3R61 A;  5BOX A;  1TNT A;  1HQC A;  1GVJ A;  3M7G A;  2VXZ A;  2V79 A;  2NNN A;  1SFE A;  5L3C A;  4HX7 A;  2PI0 A;  3J7A O;  4QLC U;  1IW7 F;  2CSO A;  3LA3 A;  2Y75 A;  1ZN2 A;  4HDV A;  4NB5 A;  1ON2 A;  5H6Q A;  4HZF A;  2LF7 A;  3HHG A;  3IWZ A;  4OIO F;  2JT1 A;  2PFB A;  3P9K A;  3JAM K;  4BNC A;  1MZB A;  1G6N A;  2LDU A;  3COA C;  1YG2 A;  1YW8 A;  1O7F A;  1RI7 A;  6PAX A;  5HOO A;  1RNL A;  3RI4 A;  1UFM A;  1QO0 D;  3ZMZ A;  4ETS A;  4EVI A;  1SAX A;  2WWY A;  4RAY A;  3E6D A;  4MGR A;  4N9I A;  3R6S A;  1XGN A;  2FRH A;  1E2X A;  3WE2 A;  4JQF A;  2PQ8 A;  5E18 F;  5CVI A;  5LHH A;  1FPQ A;  1EH8 A;  5CJ9 A;  1QZY A;  4ESF A;  3EDP A;  5DEQ A;  1R5G A;  4HAM A;  3ECO A;  1Y0U A;  3L00 A;  1BIA A;  3SFZ A;  3ML6 A;  2EWN A;  5D5V B;  1YW7 A;  2IT0 A;  3WG9 A;  3ZQ7 A;  4FX4 A;  3KP7 A;  3LAP A;  1I6X A;  1LDJ A;  2P4W A;  4AIH A;  2XAG A;  2DTR A;  4Y15 A;  3K2Z A;  2WTE A;  3FMS A;  2QEN A;  3F6V A;  5D4R A;  4PGG A;  4U0W A;  4A5N A;  4BHC A;  3Q9V A;  2H6C A;  3J81 Z;  2RKH A;  3BJO A;  4A0Y A;  3ISP A;  2GXG A;  4G8X A;  4HOB A;  4FHT A;  2ESN A;  4KN7 X;  2B0L A;  4RB2 C;  2QBY A;  2IP2 A;  2MA3 A;  2KJC A;  4ZYE A;  3GVA A;  1SD6 A;  5AIQ A;  4U88 A;  3RYP A;  2VBY A;  2E7X A;  5HLI A;  1JE8 A;  4BAY A;  1BI0 A;  2STT A;  2VBX A;  4U0V A;  5F64 A;  5CVR A;  1P4W A;  2HKX A;  1IN7 A;  3GLX A;  2H6B A;  4L9J A;  1FC3 A;  1FX7 A;  4QWQ A;  4IJA A;  5DYM A;  3ZMD A;  4MQ9 F;  4LLL A;  5FO5 A;  2IA0 A;  2Q2E A;  3IWF A;  3KEQ A;  4R79 A;  3RDI A;  3E6M A;  1FYM A;  2DFI A;  2FBH A;  2FBK A;  2KIU A;  1F5T A;  2P5V A;  2TDX A;  1W7P B;  3F8N A;  1IF1 A;  2DK8 A;  5HLH A;  1RUO A;  1K7A A;  3AAF A;  3LA7 A;  3GFI A;  4I0B A;  2QBY B;  1RUN A;  3U1D A;  2YR2 A;  2OBP A;  3IKT A;  5ILV A;  3E3V A;  1DPR A;  4RB0 A;  2VOP A;  1ZRC A;  1WRJ A;  2YPR A;  2DU9 A;  5L3F A;  5D8K B;  1IAW A;  3GFL A;  3VOD A;  3QPT A;  5FD5 A;  4G7O F;  3CTA A;  4N9H A;  4TV7 A;  2LKP A;  1U2W A;  2Q8K A;  4RGR A;  2XAJ A;  2XAF A;  1ZGA A;  1PP7 U;  2FQ3 A;  5J8C A;  2ZME A;  3RIR A;  2M87 A;  5LBQ A;  3IKV A;  1D3Y A;  3LFK A;  5DD8 A;  1R1V A;  3ZN0 A;  1FP2 A;  5E17 F;  4IHS A;  1FBU A;  1UHM A;  2A68 F;  4IF4 A;  1FZP B;  3MEX A;  4ESB A;  2GXB A;  2GIV A;  1HBX G;  4FX0 A;  2YSR A;  4Q48 A;  2XIG A;  2STW A;  2HDC A;  1YTY A;  1T38 A;  2ZCW A;  2ZNZ A;  2BYV E;  2IVM A;  5DDG A;  1C0W A;  1CGP A;  4KFC A;  5KK1 A;  2FU4 A;  1GHC A;  4XSX F;  4CO8 A;  2DBB A;  1DDN A;  1PP8 F;  1ZYR F;  4YIF A;  4LFU A;  2BEO A;  1ONV A;  5DCF A;  2KIF A;  1HXD A;  4RS8 A;  5K5Q A;  2ZME B;  2ISY A;  4RB3 C;  1B1B A;  2ACJ A;  1IXR C;  1AWC A;  1O3T A;  1J2X A;  4NHJ A;  2H94 A;  3V7R A;  3FXU A;  5F1R A;  3GEZ A;  4ZYH A;  1SD5 A;  2Z5U A;  3BY6 A;  3QP6 A;  3DPT A;  4HDU A;  5BPD A;  4EJW A;  4ENK A;  1L3L A;  3LWF A;  1G3S A;  2GQQ A;  5LHI A;  5JR3 A;  1JHF A;  4KIF A;  1O3Q A;  2EFP A;  3BOQ A;  1B9M A;  3FXR A;  4EJT A;  1HSJ A;  2K86 A;  2J5P A;  3QPH A;  1JHH A;  4M72 A;  2A3S A;  1LVA A;  3D0S A;  5BPI A;  3B02 A;  1UST A;  2HS5 A;  3SZT A;  4A2U A;  1G4D A;  4L0Y B;  4CDG A;  4Q47 A;  4M73 A;  2ETH A;  3BJ6 A;  4Y13 A;  1LQ1 A;  2W84 A;  2Y0M A;  3TDU C;  3TGN A;  2R7F A;  3KP6 A;  1PUE E;  2FA5 A;  1I1G A;  4UNO A;  1YQA A;  2F5D A;  1KQ8 A;  1EH7 A;  1ZAO A;  5L3G A;  3DP7 A;  4L5I A;  4YG2 F;  5LEK A;  4I98 B;  4E70 A;  2NAZ A;  5FD6 A;  3C3W A;  4DQ2 A;  2E7W A;  1FY7 A;  2VC1 A;  1B59 A;  5DV5 A;  3CLO A;  3WTT C;  1T2K A;  2O6G E;  4HX8 A;  1IN8 A;  2W24 A;  5HS9 A;  3F72 A;  2V1U A;  3E5X A;  3ZMT A;  5A2Q Z;  2EFW A;  2W57 A;  2ISZ A;  3HRT A;  2VOD A;  4A5M A;  1G3T A;  3K9T A;  1I27 A;  2XKP A;  1FWZ A;  2V6C A;  5FFX A;  4CYD A;  4Z2Y A;  5ICE A;  2E1C A;  2A61 A;  1BC7 C;  5D8L B;  5ILS A;  1K78 B;  2AXL A;  1S7O A;  1J7K A;  2CGP A;  3VEP A;  3ZMV A;  2VC0 A;  2EB7 A;  1X3U A;  3WGG A;  5EEG A;  4YFK F;  1D5V A;  1WQ2 A;  4ON0 A;  1QPM A;  4RGU A;  1IN6 A;  1P4A A;  1T39 A;  4WF2 A;  2G7U A;  3DV8 A;  3VFZ A;  5A2Q K;  3CO6 C;  3JSO A;  1S29 A;  4HQE A;  4BXU A;  1FYL A;  1P4X A;  5CVU A;  1XSD A;  3K1P A;  1ZAR A;  5L3B A;  1WKM A;  5D5X B;  1HW5 A;  1SMT A;  4KMF A;  2FNP A;  2D1H A;  1IZ1 A;  4K2E A;  3IC7 A;  1QBJ A;  1XSV A;  1IRF A;  1FOK A;  1KA8 A;  2RV8 A;  1MJA A;  1D8K A;  2JZY A;  5K5R A;  1XDS A;  2QZ8 A;  2A07 F;  3FMQ A;  1R5H A;  1OYY A;  3GO5 A;  4P5O A;  5IT9 Z;  3WGH A;  2IA2 A;  2QQB A;  2M45 A;  3PQK A;  1IRG A;  1I1S A;  3BDD A;  2LNB A;  2DT5 A;  3LAJ A;  4Q4Z F;  2HZT A;  3ERE D;  3HSE A;  4GCV A;  2QVO A;  3E6C C;  3FWE A;  1A04 A;  2COM A;  1XCV A;  2IW5 A;  3KZZ A;  1P92 A;  1SFX A;  2K27 A;  3KET A;  4BQA A;  4L18 B;  4D0P A;  2V1D A;  1BBY A;  1FYK A;  1ZLK A;  3TOB A;  4KA4 A;  4IPA A;  3V8J A;  2XRN A;  3KCC A;  1SD4 A;  4M71 A;  3GYH X;  1LB2 A;  3RKW A;  1LNW A;  2DI3 A;  5IT9 K;  2VE9 A;  3FHZ A;  5DCM A;  1J75 A;  3LST A;  1OR7 A;  1AOY A;  4EGZ A;  2WC2 A;  3U2R A;  3O6B B;  3SZP A;  4HV6 A;  4M9Z A;  3FX3 A;  1YLF A;  3DXJ F;  2OQG A;  3V4G A;  5D4S A;  5LEJ A;  4WK8 F;  2BV6 A;  4I02 A;  3J80 Z;  2KRF A;  1L0O C;  2OQR A;  4I09 A;  3SHF A;  1XMK A;  4HF0 A;  4ZZD A;  3L2C A;  1YS6 A;  1FLI A;  2EFN A;  3DQV C;  1O3R A;  1S6L A;  1WI9 A;  3EUH A;  2HWV A;  4H0E A;  3F8B A;  3HRS A;  3ULQ B;  4G6Q A;  2GA1 A;  1V4R A;  3ZN1 A;  3I54 A;  4IHT A;  4G7H F;  4UVB A;  2A6E F;  1XGO A;  1R1U A;  5AIP A;  3VB2 A;  3TOA A;  1ZH5 A;  4MEX F;  2EV6 A;  3KE2 A;  3E97 A;  4R8H A;  3QRF F;  5DCM B;  2OZ6 A;  2NS0 A;  1O3S A;  2EFO A;  2HGC A;  3IRQ A;  4RGS A;  4MTD A;  1Z7U A;  4G7Z F;  2P5K A;  3KP4 A;  2D2W A;  3J80 K;  1ZG1 A;  1J5Y A;  2D1V A;  5D5U B;  3FXQ A;  5CYV A;  2ESH A;  4A6E A;  4P96 A;  4EJO A;  1FBQ A;  5ERI A;  3MFK A;  2K4B A;  3KLN A;  4HW0 A;  4F7Z A;  2R7D A;  1IUY A;  3KP2 A;  1KU3 A;  3GFM A;  2PBI A;  1YFH A;  4M6Y A;  1GXQ A;  2VT2 A;  2FMY A;  2IRF G;  1STZ A;  1ZG3 A;  4RAZ A;  3NRV A;  3CUO A;  2P6S A;  3RKY A;  3I58 A;  4MNU A;  4B09 A;  3R4K A;  2ELH A;  3BRO A;  1PDN C;  4EJV A;  2L54 A;  2Z3Y A;  3O2P E;  1XN7 A;  2ZKZ A;  3GUD A;  3P9I A;  2EA2 A;  4EQQ A;  2IA1 A;  2V9V A;  4ENM A;  1P2F A;  4XRF A;  3QP5 A;  2CYY A;  1B9N A;  1HKT A;  1OYI A;  4HA8 A;  2NYX A;  3VOE A;  4LD5 A;  5LGN A;  3E5Q A;  3F23 A;  2P8T A;  4BHP A;  3N97 A;  2FNA A;  2M8E A;  3WE3 A;  2Z99 A;  1U5T A;  3F8M A;  4UV9 A;  1B4A A;  3MZY A;  3TO6 A;  3M8E A;  4UHT A;  3M8F A;  2EV0 A;  2L4A A;  3WTS C;  4P9U A;  1TQM A;  1YS7 A;  3M9A A;  1USS A;  4GYG A;  4ENJ A;  2XHK A;  2V1X A;  5DUI A;  2QUF A;  2X4H A;  1S3J A;  2QWW A;  2QLZ A;  2EA4 A;  1Z9C A;  1BJA A;  1ULY A;  5JI6 A;  3TO7 A;  1DP7 P;  3MQ0 A;  2Z33 A;  2DQL A;  3LQQ A;  1REP C;  2EJR A;  1YYV A;  3GZ5 A;  4HF1 A;  4AWX B;  3JTG A;  2P6T A;  1TNS A;  2YX4 A;  1SMY F;  4PZJ A;  4OIP F;  2XAQ A;  3V7S A;  3QOP A;  3SXY A;  2L01 A;  4ZYG A;  3E6B A;  1KYW A;  1U5T B;  1K79 A;  4ESJ A;  3RJP A;  4MTE A;  1R22 A;  4OMZ A;  2OAZ A;  2IJL A;  3F21 A;  4EMS A;  2UZK A;  1U8R A;  1ZRE A;  1TTY A;  4CXF A;  5L3D A;  2GA2 A;  4KMU X;  5JFR A;  4O3M A;  3K69 A;  1D8J A;  5JVT A;  2FEZ A;  3HSR A;  5HLG A;  2RQP A;  3WTX C;  1B6A A;  3GWZ A;  3WTZ A;  4KYW A;  5K1Y A;  4ASN A;  2HOE A;  1JXS A;  4EM1 A;  2CO5 A;  3CDH A;  5E1Z B;  4OIQ F;  2GAU A;  1FP1 D;  3IHU A;  5J8F A;  5H20 A;  2FXA A;  1DPU A;  3LA2 A;  1OYW A;  1KYZ A;  1XMA A;  1S8N A;  1F1Z A;  4L9T A;  3T8R A;  3V7C A;  5E8I A;  2MH9 A;  2OD5 A;  2O61 A;  2P7C B;  3GXO A;  4NQW A;  3CO7 C;  2OZU A;  3RKX A;  2VE8 A;  3HRM A;  1OKR A;  1R1T A;  2FOK A;  2HKO A;  1U3E M;  2F5C A;  2DAO A;  4ENN A;  2FML A;  4IRH A;  4M9S A;  5IT3 A;  2F2E A;  2G7H A;  3MZH A;  3FMR A;  2ZXJ A;  2RC4 A;  3QAH A;  4UVC A;  3OOP A;  4L5J A;  3ABU A;  1J59 A;  4KIC A;  1T6S A;  1KU7 A;  3LQR A;  2HFH A;  5BQT A;  1SD7 A;  1LEA A;  3DPL C;  1FSH A;  3H3Z A;  3BWG A;  2KIM A;  4EJU A;  1TBX A;  2RNJ A;  4M9X A;  5CVJ A;  3HRU A;  5E1X A;  2ADU A;  2HQN A;  2Q0O A;  1F9N A;  3DFG A;  4G94 A;  1W7P D;  3CJN A;  4I01 A;  5FFZ A;  1H0M A;  1JGS A;  5L3E A;  3QU3 A;  1BI2 A;  3K0L A;  2VBW A;  4XBF A;  1ZRD A;  4KIG A;  4FT8 A;  1MGT A;  2C6Y A;  3REO A;  4HLY A;  2MD5 A;  4XLN F;  4HQM A;  5F6F A;  3G3Z A;  4M6X A;  3I64 A;  4O6J A;  4B8X A;  5HVQ C;  3ABT A;  2O8X A;  2DQR A;  3G73 A;  4IRG A;  4A12 A;  1EV7 A;  4IXA A;  4P55 A;  3IRR A;  1MDM A;  4WX9 A;  1ON1 A;  2XRO A;  1R7J A;  4LMY A;  2PJP A;  1HKQ A;  4PGH A;  3RYR A;  2J5O A;  4Y17 A;  4MHG A;  4CGZ A;  1BN5 A;  4GYI A;  4JBA A;  1R58 A;  4KIB A;  1H9G A;  4HF2 A;  3T0Y A;  3H92 A;  5LRR A;  1YO5 C;  5BMZ A;  2DPD A;  3BZ6 A;  2EV5 A;  3HYI A;  2CQK A;  2PN6 A;  4HV5 A;  2RVC A;  2NRA C;  1LEB A;  3FM5 A;  5FGM A;  1CF7 A;  4RB1 A;  4MQV A;  2A69 F;  4IRI A;  4KUM A;  4YII A;  3I53 A;  2PMU A;  2CW0 F;  1T98 A;  4LK1 F;  4LK0 F;  2NNY A;  4WXH A;  3C7J A;  3R0A A;  2O3F A;  1J0R A;  1MDM B;  4KN4 X;  4UUV A;  2QYO A;  3KP5 A;  4KT5 C;  5LHG A;  3L09 A;  3BPV A;  2KJB A;  1BI1 A;  1W5S A;  1MD0 A;  3CUQ C;  3KZY A;  3F3X A;  2JRT A;  3PFI A;  1TW3 A;  1KU9 A;  1U78 A;  2PLY A;  1O57 A;  1R00 A;  4I7H A;  1MJB A;  2K02 A;  3SQN A;  2ZJ2 A;  1HW2 A;  2VON A;  2UWM A;  4MEY F;  4BHB A;  3L7W A;  4KDP A;  3I71 A;  1Z6T A;  4CIC A;  2HTS A;  2M1B A;  5EEH A;  4LG0 A;  2DK5 A;  1P6R A;  2DPU A;  2A5Y B;  4LB5 A;  2MC3 A;  5D6E A;  4AD9 A;  3KLO A;  2R3S A;  1CF7 B;  1FSE A;  3ZPL A;  3JSP A;  3TDZ C;  1TW2 A;  2UXX A;  2ZO4 A;  3RTR A;  4O5V A;  1ZG5 A;  4GO1 A;  3HOS A;  4A6D A;  3MWM A;  2HR3 A;  2LSO A;  1V3F A;  1Z6R A;  1UHW A;  3N4M A;  1RZ4 A;  2FF4 A;  2VN2 A;  1ZRF A;  4Q5S F;  1W4M A;  2CG4 A;  4PCQ A;  1OMI A;  2XKO A;  5CLS A;  1KU2 A;  1BC8 C;  1YW9 A;  5FLX Z;  4U7D A;  1XDU A;  2O0Y A;  5ICG A;  2ZFW A;  1NHA A;  5JHU A;  1W7P A;  5LLQ A;  2UXN A;  1BIB A;  1QQI A;  4UV8 A;  4A0Z A;  4OU0 A;  1Z05 A;  1ZLJ A;  3Q9S A;  4LG0 B;  4AIK A;  1I5Z A;  3HUG A;  4XLP F;  2DW4 A;  5H6R A;  3EYY A;  5ICF A;  3PQJ A;  3MAJ A;  1KQ0 A;  5KVR A;  3GW2 A;  1MJ9 A;  5ICC A;  3WTY C;  2EK5 A;  3GX4 X;  4YFN F;  4LLG F;  3BJA A;  5E8G A;  1TLH B;  3TKY A;  2RGV A;  2JSC A;  2FE3 A;  3RPQ A;  1XGS A;  3F8C A;  2Z9O A;  5FLX K;  4WXC A;  1R36 A;  2GWR A;  3NQO A;  4YFX F;  2ZNY A;  3NEU A;  3J81 K;  5K5O A;  2G9W A;  2FBI A;  1ODD A;  1XGM A;  4S05 A;  3HOT A;  4ZH4 F;  3WTV C;  4P9F A;  2MLK A;  1QNT A;  5HDG A;  3R0J A;  1KGS A;  5DUK A;  2W85 A;  2HYG D;  4EM2 A;  5AON A;  2LF8 A;  1OPC A;  1FT9 A;  4JK1 X;  1SFU A;  2XAH A;  3GF2 A;  4HX4 A;  5LGU A;  1MKM A;  4OIR F;  3JW4 A;  1QZZ A;  5HS8 A;  3L9F A;  4BH9 A;  4CHU A;  2GZW A;  1YIO A;  4GGG A;  2H27 A;  2HEO A;  3I59 A;  3WGI A;  1WWX A;  1Z1D A;  3D5L A;  3HHH A;  4EM0 B;  4LB6 B;  4L9V A;  2HTJ A;  4AIJ A;  2K7L A;  5ILU A;  1UB9 A;  3F6O A;  5BS6 A;  4IVN A;  3I0T A;  3R60 A;  2XUB A;  4LLN A;  1RIO H;  3F22 A;  3DF8 A;  5CVV A;  1VTN C;  3ROU A;  3ZMS A;  4EV0 A;  2JPC A;  2XGX A;  2X0L A;  3EQL F;  2VOO A;  2DLL A;  5DD4 A;  1FBS A;  1R23 A;  4L0Z B; 
#chains in the Genus database with same CATH topology
 1IDZ A;  3CME I;  4UVA A;  2YU9 J;  1S7A A;  4HYE A;  1NH3 A;  2XV4 S;  3JTH A;  2Z1D A;  3L1P A;  4N0B A;  3GZ6 A;  2M30 A;  4A3M J;  1F4K A;  1WJF A;  4JX4 A;  1TWC J;  4XLA A;  1I3A A;  2O9L A;  2WV0 A;  5D6F A;  2L7F P;  3H9J A;  2CFO A;  2A6H F;  2PMH A;  4G6D A;  5FKN A;  1XSX A;  2HU9 A;  2PEX A;  3EET A;  1H9T A;  4A3L J;  2BBY A;  4EGY A;  1DP3 A;  1U6G A;  3BPX A;  4ITV A;  4CZZ A;  2FSW A;  1YIT I;  2W25 A;  4BJ5 C;  3CUQ A;  4U87 A;  3I5U A;  2E1N A;  3CMA I;  3FM3 A;  2VQC A;  3CMM A;  3BG5 A;  3I59 B;  5GPA A;  4D1Q A;  1LE8 B;  2CWE A;  2WY8 Q;  2LY2 A;  2R5Y B;  2E2I J;  3RSN A;  4PDK A;  5M5W J;  3K1N A;  2NVY J;  3IH4 A;  2OTJ I;  1HKS A;  1UCR A;  1O7L A;  2MBF A;  3ECH A;  2W82 A;  4DZP A;  4B43 A;  1GXP A;  3HKZ A;  3KP3 A;  1Z67 A;  4F92 B;  1ZK8 A;  4OIN F;  4UUT A;  1BW6 A;  4RBO A;  4WCG A;  1LDD A;  2IGN A;  5HS7 A;  4M3G A;  2XAS A;  2L4M A;  4G9Y A;  1XD7 A;  2DCE A;  3FBI B;  4C3I J;  3S3O A;  1T56 A;  2KZV A;  5LGT A;  1JTY A;  2FOW A;  3ERM A;  4L9N A;  2R7S A;  4UB6 C;  2OJE D;  2M0M A;  4GXO A;  4LGW A;  3RPU A;  5HDN A;  2JTV A;  3KFW X;  2VUM J;  1TQP A;  2E1O A;  4RGX A;  1T95 A;  2QQA A;  1WSU A;  1LJ9 A;  4J00 A;  1HW1 A;  2IPQ X;  2M34 A;  1TQI A;  3OV8 A;  2DOD A;  3HJE A;  3N05 A;  2CH0 A;  2HDD A;  4HLX A;  5TRD A;  3S2W A;  2KQR A;  3AG1 H;  4E4H A;  3C18 A;  3T8T A;  5GAG J;  3OS2 A;  4D7N A;  2YU3 A;  3MD2 A;  3IV5 A;  2MH2 A;  3M1E A;  5M3M J;  3P9C A;  5C4X J;  5CQE A;  4I6Z A;  3HPH A;  1BOA A;  5D5W B;  2ZXH A;  1JTX A;  2OU2 A;  4ZDL A;  2JSP A;  1FMW A;  4A3K J;  5DM7 F;  1LFP A;  2QSH X;  1ZHF A;  3CUQ B;  3G1L A;  3KEO A;  4DYQ A;  2YS9 A;  4A69 C;  2M5W A;  2WBM A;  2YX7 A;  3DBR B;  5KCM A;  5FB2 A;  4ZYD A;  2EIL H;  3MN2 A;  1XB4 A;  3DTI A;  3TQN A;  4UXN A;  1WPK A;  2IS1 A;  5J1Y A;  2QQ9 A;  5HDK A;  2CS3 A;  1HA8 A;  3HL2 A;  2ZSI B;  1WZ2 A;  2NOG A;  2XVC A;  4XOP A;  2P5L C;  4FTH A;  2PMZ N;  1G3W A;  2XPV A;  4B47 A;  3I4P A;  2KZG A;  2RDP A;  4BE2 A;  1FIA A;  2PG4 A;  1J9I A;  3A4C A;  1IRZ A;  3FZV A;  1GLN A;  3TO9 A;  3EUH C;  3EPZ A;  1K78 A;  3JR9 A;  3E5U A;  1TT5 B;  2DMT A;  2IGO A;  3A03 A;  4LJZ F;  4AUX A;  2H09 A;  5IY5 H;  3CF5 F;  2ZBK A;  1EH6 A;  2MLG A;  3H0G J;  2P7V B;  1E17 A;  4A0X A;  2K9N A;  2XGD A;  2F5E A;  2RN7 A;  3T5X A;  4DYR A;  3DTE A;  1HST A;  2ZXI A;  2ZJR F;  3H3U A;  1IXC A;  1R4N B;  4AID A;  4II2 A;  4I0A A;  2KMU A;  4WWC A;  3JRH A;  5E1W A;  4B44 A;  3FF5 A;  4DNC A;  3A02 A;  4XK4 A;  4V2G A;  3BP8 A;  4IKF A;  1VQ6 I;  4I99 C;  4KNY A;  2BE5 F;  3HSF A;  4R1H A;  3RQ4 A;  4BJ6 C;  2IGM A;  3WTU C;  1DUX C;  3ZRG A;  2COB A;  4RMN A;  4BYY A;  2VT3 A;  3K1M A;  4XRM A;  3I3L A;  3GFJ A;  3P7N A;  1D5Y A;  3PUB A;  5LRS A;  5E20 A;  3V8L A;  2XAU A;  3G1O A;  3K4C A;  5FLM J;  3Q5F A;  1NK3 P;  3EYI A;  2WA0 A;  5EEA A;  4M74 A;  4F3Q A;  1OJL A;  2QEX I;  4U0Y A;  4D5C A;  3GCM A;  2D45 A;  1SFO J;  1IN4 A;  4CCL A;  2K4J A;  2BW3 A;  2F5F A;  2ECC A;  3LNQ A;  4CUG A;  3DEU A;  4AVP A;  1BI3 A;  2KKO A;  3HC7 A;  4XSZ F;  2LH9 A;  2LC2 A;  2K9M A;  4S04 A;  3T1B A;  3HTS B;  1MMA A;  2W7N A;  3QQA A;  1LDK B;  1Q1H A;  4ZZL A;  3F8F A;  3B73 A;  1T0F A;  2L3D A;  3WU1 B;  3W6J B;  3O3K A;  3L2R A;  4PJJ A;  3QPL A;  1JUP A;  2HYF A;  1IN5 A;  4C2M J;  1QGP A;  3KYL A;  4I2O A;  5EGO A;  3MZ8 A;  1HLV A;  4OOI A;  2EFQ A;  2AS5 F;  1W5T A;  2BY0 A;  1BM9 A;  5TJJ A;  3HTU A;  1IXS B;  2ZJQ F;  5F27 A;  3M07 A;  3BR6 A;  4G6T B;  3IL2 A;  2JPB A;  2L9S A;  5J6X A;  3FDY A;  4IOA F;  3WOD F;  2K9L A;  3WU0 A;  3C1D A;  3CMY A;  3WTW C;  3MCZ A;  2BGC A;  4U7B A;  2EZI A;  3ELK A;  5ED4 A;  1G3Y A;  4WXD A;  3BR5 A;  2WAF A;  2CFX A;  4HBL A;  1VQ7 I;  4FET A;  1FNN A;  2FQ4 A;  3H1C A;  4CZC A;  2O03 A;  4M6V A;  2OCE A;  3SEZ A;  3FXM A;  2XGC A;  3ABK H;  3V8K A;  1GV5 A;  1QHH D;  1ZGJ A;  2DO7 A;  2VBZ A;  3ZP5 A;  1Z91 A;  2XB0 X;  3ZMU A;  2HQR A;  4MFE A;  2QM3 A;  1WFX A;  3BZK A;  4LIT A;  1K6O A;  3HIF A;  3JAM Z;  3AG3 H;  2L02 A;  1YOV B;  3U9G A;  3W6K B;  3QU6 A;  3GTG J;  1DGW Y;  1XCB A;  3BG9 A;  2LYC A;  3VYS B;  3Q0U A;  2MSY A;  4XLE A;  5FRN A;  3U1K A;  5E3O A;  4OMY A;  2Y48 A;  3K7A J;  2VIX A;  1KQ9 A;  2OA4 A;  3DKW A;  4E7L A;  1V5E A;  4B48 A;  4YIR X;  1F36 A;  2CV2 A;  1U5T C;  3R61 A;  3PSF A;  5BOX A;  2R93 J;  1TNT A;  1HQC A;  3VSK A;  2M2E A;  1JT0 A;  2LKS A;  2QGU A;  1GVJ A;  3M7G A;  3OWT A;  1FOX A;  5IOY A;  2ELK A;  1XMX A;  2VXZ A;  4BUP A;  1MNE A;  2V79 A;  1JKP C;  2NNN A;  1SFE A;  2DMP A;  3HOU J;  2WAD A;  1A31 A;  5L3C A;  4HX7 A;  2PI0 A;  3J7A O;  4QLC U;  1IW7 F;  4ZTF A;  4KIS A;  1ETK A;  2DMU A;  2HDW A;  5EGO B;  2CSO A;  2VJJ A;  2Y9Z A;  3WU2 C;  1SVL A;  3LA3 A;  2Y75 A;  1QHG A;  3LOC A;  1ZN2 A;  2DDA A;  2HPI A;  4HDV A;  2OCC H;  3HOX J;  4LIU A;  2W48 A;  2BVL A;  1SAN A;  4NB5 A;  4RM3 A;  3FKI J;  1ON2 A;  2EBI A;  5H6Q A;  3QYF A;  2KL4 A;  3CJT B;  4HZF A;  2LF7 A;  2F4M B;  3Q0V A;  5IYC J;  3HHG A;  3JRG A;  2HI3 A;  3IWZ A;  3ZQL A;  4OIO F;  2JT1 A;  1LUJ B;  2PFB A;  3P9K A;  3JAM K;  2JA6 J;  2FUG 2;  4BNC A;  2DJN A;  4AVZ A;  2IS4 A;  1KZH A;  4YEL A;  1MZB A;  1G6N A;  1APL C;  2FX0 A;  2LDU A;  3COA C;  4A3J J;  1UAA A;  4X1E A;  1YG2 A;  4FQG A;  1YW8 A;  2L2O A;  5F0F A;  5EG0 B;  1O7F A;  1RI7 A;  4BS9 A;  3LSR A;  1SEU A;  5GPC A;  1Y8Q B;  1VI0 A;  6PAX A;  5HOO A;  1MMN A;  1RNL A;  1BW5 A;  1TWG J;  1R71 A;  3MMY B;  2LK2 A;  1RR7 A;  3RI4 A;  2QKM B;  1UFM A;  2A05 A;  3LSI A;  5F0H A;  1QO0 D;  4A3B J;  3ZMZ A;  4ETS A;  3I4N J;  3ESW B;  4EVI A;  2CQQ A;  1SAX A;  2XDV A;  2WWY A;  2ZFU A;  4RAY A;  3E6D A;  1AA7 A;  1Y8R B;  4MGR A;  4N9I A;  2BVM A;  2Y69 H;  3R6S A;  1XGN A;  4DJA A;  2FRH A;  1E2X A;  3WE2 A;  4JQF A;  2PQ8 A;  5E18 F;  1N75 A;  3IAM 2;  3KYC B;  2JVG A;  2VJ4 A;  5CVI A;  5LHH A;  1FPQ A;  2JRM A;  2MAB A;  1EH8 A;  5CJ9 A;  3B6C A;  3TED A;  2VKD A;  1QZY A;  4PK4 A;  4ESF A;  2QQ8 A;  2HOT A;  1EF4 A;  3EDP A;  5DEQ A;  2LBF B;  1JUS A;  1R5G A;  4HAM A;  3ECO A;  1Y0U A;  3L00 A;  1AKH A;  3IUO A;  1IUF A;  1BIA A;  3SFZ A;  3H3V K;  3ONQ A;  3ML6 A;  2EWN A;  4AYB A;  4F52 A;  5D5V B;  1YW7 A;  5CKT A;  4PJN A;  2IT0 A;  3WG9 A;  1I39 A;  3ZQ7 A;  4HNU A;  2R5Z A;  2F5V A;  4FX4 A;  3KP7 A;  4PFP A;  3NWT A;  3LAP A;  1I6X A;  1LDJ A;  2P4W A;  4AIH A;  4CYC A;  2JA5 J;  2XAG A;  1H88 C;  2M7B A;  1X1P A;  2DTR A;  2CRG A;  4Y15 A;  3K2Z A;  3DEE A;  2WTE A;  5KAI C;  3FMS A;  2QEN A;  3F6V A;  5D4R A;  5K7H A;  4PGG A;  1MBJ A;  1XX5 A;  4U0W A;  4A5N A;  4BHC A;  3Q9V A;  4CCN A;  5JLX A;  2H6C A;  1Z77 A;  3J81 Z;  2RKH A;  2E5Z A;  5B1A H;  3BJO A;  4A0Y A;  1P9Q C;  3ISP A;  3S1M J;  2GXG A;  1QVT A;  4G8X A;  4HPQ A;  4HOB A;  4FHT A;  4A3I J;  3HZJ A;  4HST A;  4JOM A;  2ESN A;  4KN7 X;  4Y7N J;  2B0L A;  2V1N A;  4RB2 C;  3OYA A;  3RKQ A;  3FIW A;  2QBY A;  2IP2 A;  2MA3 A;  2M4K A;  2KJC A;  2VQG A;  4ZYE A;  4RA2 A;  3GVA A;  3LSP A;  1SD6 A;  5AIQ A;  1AHD P;  4XKC A;  2E2H J;  3O8H A;  4U88 A;  3RYP A;  2VBY A;  4PSW A;  2E7X A;  1PJR A;  5HLI A;  1JE8 A;  4BAY A;  3FBN B;  1BI0 A;  2STT A;  2VBX A;  4U0V A;  3PIO F;  5F64 A;  5CVR A;  1P4W A;  2HKX A;  5IOZ A;  1W36 C;  1IN7 A;  3GLX A;  2H6B A;  4L9J A;  3AL0 B;  1FC3 A;  1FX7 A;  2L0K A;  1IC8 A;  3TL4 X;  4QWQ A;  2E2J J;  4IJA A;  5DYM A;  1AKH B;  1N78 A;  3ZMD A;  2DA1 A;  3ZCO A;  4MQ9 F;  2KIS A;  4LLL A;  1Z3Y A;  1V54 H;  4RLF A;  1EJ9 A;  1ITY A;  5FO5 A;  2IA0 A;  2Q2E A;  3IWF A;  3KEQ A;  4R79 A;  3RDI A;  1OLT A;  3E6M A;  1FYM A;  2DFI A;  1MBF A;  2FBH A;  3M8J A;  1JKR C;  3ASO H;  2FBK A;  5CPR B;  2KIU A;  1F5T A;  2P5V A;  3C2G A;  4KIT B;  4ZYA A;  2TDX A;  2OUM A;  2ZXW H;  3DBH B;  3AKZ A;  4UB8 C;  1W7P B;  1UJ8 A;  2BXY A;  2R7U A;  3F8N A;  2WB1 A;  1IF1 A;  1IDY A;  5M3F J;  2OTL I;  1I50 J;  2BOL A;  2DK8 A;  3FXO A;  3SDG A;  1BR2 A;  2KIQ A;  3QOE A;  4MIM A;  1V55 H;  5HLH A;  3S8P A;  1S72 I;  1RUO A;  1RC9 A;  1K7A A;  3AAF A;  2V9P A;  3HPG A;  3MKY B;  4DYC A;  3LA7 A;  2YUS A;  3GFI A;  3K4J A;  3EUK L;  4I0B A;  2HXI A;  3HUG B;  2QSF X;  2QBY B;  1J09 A;  1QZE A;  2VI6 A;  1RUN A;  3U1D A;  2YR2 A;  4M3F A;  3LSH A;  2OBP A;  3IKT A;  1VQ5 I;  5ILV A;  3ZXS A;  3E3V A;  1DPR A;  2DTZ A;  3CLQ A;  4RB0 A;  1MSF C;  2VOP A;  1ZRC A;  1W36 D;  1WRJ A;  2K85 A;  2YPR A;  2DU9 A;  5L3F A;  5D8K B;  1LPQ A;  3BCA A;  3BC8 A;  1IAW A;  3IAS 2;  3GFL A;  1A6I A;  3VOD A;  3QPT A;  5FD5 A;  4XN0 A;  3A2K A;  3CTA A;  4G7O F;  4N9H A;  3D1N I;  2H8R A;  2E71 A;  4TV7 A;  2LKP A;  3JRA A;  1U2W A;  2Q8K A;  1XS9 A;  4RGR A;  2XAJ A;  2XAF A;  4A3C J;  1ZGA A;  1PP7 U;  2FQ3 A;  5J8C A;  2NS7 A;  2ZME A;  3RIR A;  2M87 A;  5LBQ A;  3IKV A;  5B3S H;  1D3Y A;  1BJZ A;  1ORK A;  1GV2 A;  3LFK A;  5DD8 A;  1R1V A;  2HNH A;  1T33 A;  3ZN0 A;  1FP2 A;  2X6Y A;  3LFU A;  2ZB9 A;  5HNF A;  5E17 F;  5E3L A;  3A01 B;  2X6O A;  4IHS A;  2TCT A;  1FBU A;  1UHM A;  4C2U A;  1BR4 A;  2A68 F;  4IF4 A;  1FZP B;  3MEX A;  4ESB A;  1N77 A;  5KAF C;  2GXB A;  2GIV A;  3BG7 A;  1HBX G;  1ENH A;  2YSR A;  2CMP A;  4FX0 A;  3ZQI A;  1E0E A;  4HNT A;  3I4M J;  2QKL B;  2HZD A;  4Q48 A;  3C2H A;  2XIG A;  2R0Q C;  2XF7 A;  2HDC A;  4S0H B;  2STW A;  2BHY A;  2MC4 A;  1YTY A;  4XKV A;  1T38 A;  2ZCW A;  3DLL F;  3BTL A;  2ZNZ A;  1ETX A;  2BYV E;  2X1C A;  2IVM A;  5DDG A;  3I55 I;  3GTQ J;  1C0W A;  1CGP A;  4KFC A;  5KK1 A;  2FU4 A;  1GHC A;  4XN3 A;  2Z16 A;  4XSX F;  4CO8 A;  2DBB A;  1DDN A;  2JN6 A;  2AO9 A;  1PP8 F;  1SVO A;  1ZYR F;  3CJQ B;  4LFU A;  4YIF A;  3OMY A;  3W2V A;  4BBR J;  2BEO A;  1G59 A;  1ONV A;  2QCO A;  5DCF A;  2KIF A;  1HXD A;  2LTP A;  1WJB A;  1UG0 A;  2E1M C;  1DGR M;  4RS8 A;  5K5Q A;  2ZME B;  2ISY A;  5F04 A;  4RB3 C;  1B1B A;  1VQ9 I;  3FKJ A;  1G8X A;  1IXR C;  2ACJ A;  1AWC A;  3LSG A;  4HNV A;  1O3T A;  1J2X A;  4NHJ A;  2H94 A;  2V6E A;  3V7R A;  3FXU A;  3O8G A;  5F1R A;  3GEZ A;  4JX5 A;  3J7Z I;  4ZYH A;  2EZH A;  1SD5 A;  2Z5U A;  3BY6 A;  3QP6 A;  3DPT A;  4HDU A;  5BPD A;  3ZQH A;  4EJW A;  2M9H A;  4ENK A;  1L3L A;  5JLW A;  5J3L A;  3TW6 A;  3LWF A;  1G3S A;  2EIN H;  2GQQ A;  4BY7 J;  3VSL A;  5LHI A;  1DU6 A;  4ZC3 A;  5JR3 A;  3S3N A;  1JHF A;  4KIF A;  3DPU A;  1O3Q A;  4AM3 A;  3NAU A;  2EFP A;  3CP8 A;  3BOQ A;  2UV1 A;  1D1A A;  1B9M A;  4E6K G;  4PUS A;  3CCV I;  3FXR A;  2DA6 A;  1HSJ A;  2K86 A;  2J5P A;  1X2N A;  4BE0 A;  4EJT A;  3QPH A;  2A6T A;  1K61 A;  2DFH A;  1JHH A;  1K6Y A;  3OS0 A;  3HDD A;  2DXI A;  2OC6 A;  3DCF A;  4M72 A;  1OR7 C;  2A3S A;  2F48 A;  4OAZ A;  1LVA A;  3D0S A;  3OYE A;  2VPR A;  1V5F A;  5BPI A;  3LL7 A;  3B02 A;  4IQ4 A;  1UST A;  1YIJ I;  2AQE A;  3CES A;  2HS5 A;  3SZT A;  1MH4 A;  4A2U A;  1G4D A;  4L0Y B;  3BLY A;  5GAH J;  2E36 A;  1GVD A;  4CDG A;  4Q47 A;  3ABM H;  3BR2 A;  1B72 A;  3DLA A;  5EZG A;  4M73 A;  2ETH A;  3BJ6 A;  3JRD A;  4Y13 A;  1FOW A;  1LQ1 A;  2W84 A;  2Y0M A;  3IH3 A;  5J40 A;  3TDU C;  3TGN A;  3OYK A;  2R7F A;  1IGN A;  5F08 A;  3KP6 A;  1ZR4 A;  4BQN A;  1NG6 A;  2BHZ A;  1PUE E;  3F9K A;  1JKO C;  1MND A;  2H8W A;  2FA5 A;  1PYV A;  1Y39 A;  4UUS A;  4BQO A;  1B8I A;  1A5J A;  1I1G A;  3G2B A;  4UNO A;  1YQA A;  4JX6 A;  2W00 A;  2F5D A;  3SJM A;  1KQ8 A;  5DTD A;  2K3P A;  4OWR B;  1EH7 A;  3L2Q A;  1ZAO A;  2GM4 A;  4FE7 A;  5L3G A;  2GIZ A;  3DP7 A;  4II3 A;  3M3Y J;  2XPW A;  1VND A;  3EUA A;  4L5I A;  4DZJ A;  4YG2 F;  5LEK A;  1YX5 A;  4I98 B;  4BKX A;  2HQ5 A;  1PVE A;  3WG7 H;  1GUU A;  4E70 A;  4PSX A;  2NAZ A;  1T8I A;  5FD6 A;  3C3W A;  4DQ2 A;  2EIM H;  2ME6 A;  3H9Q A;  1RET A;  4IEJ A;  1VQP I;  2E35 A;  1X4O A;  2E7W A;  2PMZ A;  1FY7 A;  1PUF A;  3G1M A;  2VC1 A;  1B59 A;  5DV5 A;  2ID3 A;  3CLO A;  3WTT C;  3DBL B;  2DYS H;  1T2K A;  4C3H J;  2O6G E;  4HX8 A;  1IN8 A;  2W24 A;  5HS9 A;  4XKW A;  3F72 A;  1RPW A;  4XOR A;  2XSD C;  2V1U A;  1RKW A;  2RQQ A;  2OF7 A;  3E5X A;  2XF6 A;  1HF0 A;  1GT0 C;  3ZMT A;  2VJI A;  5A2Q Z;  1OCP A;  2EFW A;  2W57 A;  2ISZ A;  3HRT A;  1ETW A;  2VOD A;  4DBQ A;  1UEL B;  4A5M A;  3OYM A;  1FIP A;  1G3T A;  2DFF A;  4GFB A;  3K9T A;  1I27 A;  2XKP A;  4XQF A;  1FWZ A;  4F93 B;  2BY1 A;  2V6C A;  5FFX A;  4CYD A;  5EZH A;  1LKX A;  3H9G A;  4Z2Y A;  5ICE A;  2JUG A;  4CSW A;  1B72 B;  2E1C A;  3OYF A;  2A61 A;  1YJW I;  2EZL A;  1BC7 C;  1MW7 A;  2HQA A;  3HM5 A;  5EDN A;  1VZ0 A;  1ACI A;  3HOW J;  3BTC A;  5D8L B;  1TWH J;  5ILS A;  1A36 A;  1K78 B;  1E3O C;  2AXL A;  3HXL A;  1SC7 A;  2CU7 A;  1T08 B;  2MW8 A;  3FK6 A;  1E3P A;  2NVQ J;  1HC8 A;  1S7O A;  1WHU A;  1J7K A;  2R7W A;  3PFY A;  2CGP A;  3D5R C;  3VEP A;  3ZMV A;  4IO9 F;  2VC0 A;  2EB7 A;  1X3U A;  2BZT A;  1ETV A;  4DW6 A;  1OCR H;  3WGG A;  3A0H C;  4B4C A;  5EEG A;  4YFK F;  1JKQ C;  2IXS A;  2K3F A;  1D5V A;  1WQ2 A;  4ON0 A;  1QPM A;  1PUF B;  4RGU A;  1IN6 A;  1P4A A;  1T39 A;  4WF2 A;  2G7U A;  3DV8 A;  3VFZ A;  5A2Q K;  3CO6 C;  5GTH C;  2R7O A;  3JSO A;  3L2U A;  1S29 A;  4C3J J;  4HQE A;  1O4X A;  4BXU A;  1EA3 A;  3BT9 A;  1P4X A;  3CQZ J;  1JJ8 C;  1FYL A;  5CVU A;  2LOO A;  3K1P A;  1XSD A;  3BTI A;  1ZAR A;  5L3B A;  4ABZ A;  1WKM A;  3W3C A;  2CQ7 A;  1W0T A;  3H5R A;  3CCY A;  5D5X B;  1HW5 A;  5DM6 F;  2D5V A;  1MMS A;  1SMT A;  5BNG A;  1WGX A;  4BY1 J;  4MLO A;  3FXJ A;  1IG7 A;  2BW3 B;  5GAD J;  4ZJZ A;  1QPI A;  3HG9 A;  5K7F A;  1ETO A;  2KP6 A;  4AU7 A;  4KMF A;  2FNP A;  2D1H A;  2AXT C;  1IZ1 A;  2ZC2 A;  4K2E A;  1X58 A;  2O8K A;  3IC7 A;  1QBJ A;  1XSV A;  2V9K A;  1IRF A;  1FOK A;  1KA8 A;  2MFZ A;  2RV8 A;  1MJA A;  3H0D A;  1D8K A;  5GP9 A;  3PUF A;  3ZQG A;  2KFD A;  1K83 J;  2JZY A;  5K5R A;  1VF9 A;  1XDS A;  3BR1 A;  2QZ8 A;  4EAT A;  4Y3O A;  2FJ1 A;  4IHW A;  2ZSH B;  2A07 F;  2L9R A;  3FMQ A;  1R5H A;  1OYY A;  3GO5 A;  1TC3 C;  4P5O A;  5IT9 Z;  3MVP A;  3WGH A;  3G6E I;  1DU0 A;  3TP3 A;  2IA2 A;  2EQR A;  1MBH A;  2LRE A;  2QQB A;  4NC7 A;  2LP0 A;  2M45 A;  2L7M P;  3PQK A;  5IPA A;  1U8B A;  1IRG A;  1ERD A;  2DOE A;  3BDD A;  1I1S A;  1WJE A;  2FD5 A;  3PNT A;  2X6X A;  2R92 J;  2CJJ A;  2ELJ A;  2LNB A;  3UR3 C;  4N4N B;  3HBL A;  2DT5 A;  2EIJ H;  3LSK A;  3LAJ A;  4RLQ A;  4IHY A;  2VAS A;  2DA3 A;  4Q4Z F;  2KDO A;  2HZT A;  3ERE D;  3QWL A;  3HSE A;  3KYD B;  3S15 J;  4GCV A;  2QVO A;  3E6C C;  1NG7 A;  3FWE A;  4FIS A;  1FOY A;  2WAQ N;  1A04 A;  1S5L C;  3K4N A;  2QA4 I;  3H36 A;  1OCC H;  2COM A;  2W4S A;  1XCV A;  2IW5 A;  3KZZ A;  3QYE A;  3ZR8 X;  1JUM A;  1P92 A;  1SFX A;  1X3W B;  2K27 A;  2P0W A;  3KET A;  4BQA A;  3H5A A;  5J4Y A;  1LVK A;  4L18 B;  4D0P A;  3E1S A;  1XPX A;  3PL8 A;  1Y1V J;  3OYN A;  2V1D A;  4F91 B;  1BBY A;  1FYK A;  1ZLK A;  1NK2 P;  1ZTR A;  2MYS A;  3CCQ I;  3TOB A;  3AFH A;  4QIW N;  4IPA A;  3V8J A;  2XRN A;  4KA4 A;  4XNF A;  1M1E B;  2EPF A;  2W1O A;  3KCC A;  4AC0 A;  3CC7 I;  1SD4 A;  4M71 A;  3GYH X;  1LB2 A;  2MG4 A;  1I3Q J;  1OFC X;  3RKW A;  1LNW A;  2DI3 A;  2WAQ A;  1A35 A;  5IT9 K;  2VE9 A;  1SAU A;  1MBG A;  4CCO A;  2F4I A;  3FHZ A;  2PX9 A;  5DCM A;  1J75 A;  5C3E J;  2LD5 A;  1TL8 A;  3L2V A;  4X6A J;  2ID6 A;  1JI8 A;  3LST A;  1OR7 A;  2DOF A;  1AOY A;  4EGZ A;  2WC2 A;  3U2R A;  3O6B B;  3SZP A;  4E7S A;  4E7H A;  4HV6 A;  1MIJ A;  3FX3 A;  4M9Z A;  3L2W A;  1YLF A;  4OAY A;  3JCU C;  1RKT A;  3HB9 A;  3DXJ F;  2E34 A;  2OQG A;  3TMO A;  3V4G A;  5D4S A;  4DGW B;  5M5Y J;  5LEJ A;  4GDF A;  4WK8 F;  1ZKG A;  2BV6 A;  4I02 A;  3J80 Z;  3KEY A;  2KRF A;  4NUB A;  1R5I D;  1P7J A;  3ABL H;  1L0O C;  2OQR A;  5K7Z A;  4XON A;  2EIK H;  1R6R A;  4I09 A;  3NWS A;  4Y33 A;  3SHF A;  2E1M B;  2X48 A;  1XMK A;  4HF0 A;  3S1Q J;  3A1Y A;  3FXK A;  4ZZD A;  3L2C A;  1YS6 A;  1FLI A;  2EFN A;  3CDI A;  3DQV C;  1MSE C;  1O3R A;  3CCS I;  1S6L A;  1WI9 A;  3CD6 I;  3EUH A;  2HWV A;  4H0E A;  1MMG A;  2X9D A;  3F8B A;  3HRS A;  1XC5 A;  3ULQ B;  4BAC A;  4G6Q A;  2GA1 A;  2DA5 A;  1V4R A;  2VKV A;  3ZN1 A;  3K70 C;  1NTC A;  1QU3 A;  3I54 A;  4IHT A;  3BR3 A;  1X1C A;  2DA4 A;  4UVB A;  4G7H F;  4YEJ A;  2I5U A;  2A6E F;  2M8G X;  1XGO A;  3OYH A;  1R1U A;  4JP0 A;  2L7K A;  2VQL A;  1D0Z A;  2IEK A;  5AIP A;  4CCK A;  3VB2 A;  4IQJ A;  3TOA A;  1ZH5 A;  4MEX F;  2EV6 A;  5LFA A;  3HGG A;  3KE2 A;  1D1B A;  3E97 A;  2JK3 A;  2CQN A;  1WH5 A;  4R8H A;  3QRF F;  4W1U A;  5DCM B;  2IAI A;  2OZ6 A;  2NS0 A;  1H8A C;  1O3S A;  2EFO A;  2HGC A;  1E3H A;  3BQY A;  2GBY A;  3IRQ A;  2IS2 A;  3CDL A;  3ZOB A;  1WCM J;  4XMY A;  4PJ0 C;  4RGS A;  3SFI A;  2O5R A;  3QPS A;  2PJR A;  4MTD A;  1Z7U A;  4G7Z F;  3RPU D;  2R5Z B;  4A93 J;  2LG4 A;  2P5K A;  2D2W A;  3KP4 A;  3J80 K;  1ZG1 A;  1J5Y A;  2D1V A;  5D5U B;  3LMM A;  4LG3 A;  3FXQ A;  2HYJ A;  2ESH A;  5CYV A;  4A6E A;  1X19 A;  4P96 A;  3MKZ A;  4EJO A;  4CYC B;  1W0U A;  1FBQ A;  5ERI A;  3MFK A;  2K4B A;  3KLN A;  4CA0 A;  4HW0 A;  1ZGW A;  4F7Z A;  2R7D A;  2R4G A;  1IUY A;  3KP2 A;  1KU3 A;  1Y1W J;  1BA5 A;  3GFM A;  2PBI A;  1YFH A;  4M6Y A;  2JMW A;  1GXQ A;  4N4O B;  5IP7 J;  2VT2 A;  2FMY A;  3ZQF A;  2ZJP F;  1STZ A;  1ZG3 A;  2IRF G;  4RAZ A;  5FKM A;  4E7Z A;  2DOA A;  2VQH A;  2CW8 A;  3K10 A;  3CUO A;  3NRV A;  4IOC F;  2P6S A;  2GOM A;  1MH3 A;  3RKY A;  2NVT J;  2XF5 A;  3I58 A;  1MMD A;  4MNU A;  4B09 A;  2RRE A;  5E3N A;  3R4K A;  2DA2 A;  2ELH A;  3BRO A;  1YJ9 I;  2M7A A;  1PDN C;  4EJV A;  4BL0 B;  5HLT A;  3K70 D;  1Y0N A;  2L54 A;  4IZZ A;  2Z3Y A;  3O2P E;  1XN7 A;  2ZKZ A;  1YX3 A;  4DIQ A;  3GUD A;  1OCZ H;  1T0F C;  1N25 A;  3P9I A;  3Q0W A;  2OV7 A;  3BQZ A;  2JQ7 A;  2DMQ A;  3OSG A;  3IP4 B;  2EA2 A;  4EQQ A;  2IA1 A;  4KJZ A;  2V9V A;  3FK7 A;  4ENM A;  4BXX J;  4DBR A;  1P2F A;  4XRF A;  3QP5 A;  4Y52 J;  2CYY A;  1B9N A;  1HKT A;  3RQI A;  2V26 A;  1OYI A;  5LD2 C;  1FJL A;  4HA8 A;  2NYX A;  5FKL A;  4L5E A;  4ZDO A;  3VOE A;  1D1C A;  4J19 A;  4LD5 A;  5LGN A;  3E5Q A;  9ANT A;  3F23 A;  4H4K C;  3TP0 A;  2P8T A;  4BHP A;  2V4J C;  3N97 A;  4IHX A;  2OPT A;  3SYT A;  1RES A;  1HDP A;  2K9Q A;  4BE1 A;  2IS6 A;  2FNA A;  2M8E A;  3WE3 A;  2KHM A;  2MD0 A;  2Z99 A;  2K9S A;  3OYL A;  1U5T A;  2Q2E B;  3F8M A;  4UV9 A;  1B4A A;  1ZEL A;  5M5X J;  3ZQC A;  4IHV A;  3MZY A;  3TO6 A;  4NBQ A;  1G2H A;  3M8E A;  4UHT A;  2DYR H;  3M8F A;  2EV0 A;  2L4A A;  3WTS C;  4ZTJ A;  2R5Y A;  4P9U A;  3BG6 A;  4D7M A;  1TQM A;  3RZO J;  1YS7 A;  3M9A A;  1USS A;  4J01 A;  4GYG A;  4ENJ A;  1JJ6 C;  2XHK A;  4M3E A;  2V1X A;  5DUI A;  2QUF A;  2Y9Y A;  3B6A A;  2RNG A;  2X85 A;  1VQ8 I;  1HOM A;  3M1C A;  2VB6 A;  3PO3 J;  2X4H A;  2Y30 A;  1S3J A;  2QWW A;  2H1K A;  2ECB A;  2XRL A;  2XPU A;  2QLZ A;  2QF7 A;  3OYJ A;  2EA4 A;  2EZK A;  4FCY A;  1Z9C A;  2WV1 A;  4KT6 A;  1BJA A;  1ULY A;  1QRY A;  5JI6 A;  3CZ6 A;  3TO7 A;  1DP7 P;  1WJ5 A;  3MQ0 A;  2DT7 B;  2Z33 A;  2DQL A;  1WVR A;  3LQQ A;  1REP C;  3VYT B;  2EJR A;  3FXL A;  3MKL A;  3Q3S A;  4NC8 A;  1YYV A;  3GZ5 A;  3S32 A;  4HF1 A;  5HNH A;  4AWX B;  2VXD A;  3JTG A;  4HRI A;  1Y6I A;  2H1L A;  2P6T A;  1TNS A;  3CJR B;  2HOA A;  1TWA J;  4BBS J;  2X51 A;  2YX4 A;  1WJA A;  3S93 A;  1SMY F;  3J7Y J;  3HKZ N;  4PZJ A;  3CCE I;  4OIP F;  2XAQ A;  2DT6 A;  2R7T A;  4HG2 A;  3V7S A;  3OYI A;  3QOP A;  1X4P A;  3SXY A;  3OIO A;  3V42 A;  2L01 A;  4ZYG A;  3E6B A;  3S2H J;  3KPH A;  2KDZ A;  1KYW A;  1U5T B;  1HDD C;  1K79 A;  1BOB A;  4LOC A;  4ESJ A;  3RJP A;  2TRT A;  4MTE A;  1R22 A;  2DFE A;  4OMZ A;  2OAZ A;  2IJL A;  2F4O B;  3F21 A;  4EMS A;  3M4O J;  2UZK A;  4A3F J;  1UHS A;  4Y4R A;  1U8R A;  1IRX A;  3GTK J;  1ZRE A;  2VPL A;  2L7Z A;  1TTY A;  4CXF A;  5L3D A;  2I10 A;  1R49 A;  2E5N A;  3GTO J;  2GA2 A;  3JRI A;  4KMU X;  3SEQ A;  5JFR A;  4O3M A;  3K69 A;  3K4M A;  1D8J A;  4NC6 A;  5JVT A;  2NXN B;  2FEZ A;  1QVU A;  3OYC A;  5F1J A;  1IJW C;  3PM1 A;  3HSR A;  5HLG A;  2RQP A;  3F0C A;  3HOZ J;  3WTX C;  2VL8 A;  5B1B H;  1B6A A;  3GWZ A;  1XTA A;  3WTZ A;  2HVQ A;  4XR6 A;  4KYW A;  5K1Y A;  4ASN A;  5JHF A;  2HOE A;  2L9N A;  3GTL J;  1JXS A;  1WJD A;  4EM1 A;  3K6G A;  1OCT C;  2CO5 A;  2NVX J;  3BR0 A;  3CDH A;  5E1Z B;  4OIQ F;  3AL0 C;  3S2D J;  2GAU A;  4QSH A;  1FP1 D;  4IL6 C;  2O7O A;  4BDY A;  3QOD A;  3TW7 A;  1HCR A;  3CP2 A;  3CCJ I;  2WY7 Q;  5TGT A;  3IHU A;  3IH2 A;  4B3X A;  5J8F A;  5H20 A;  4XL9 A;  2IBD A;  4B3A A;  2FXA A;  1DPU A;  2KRC A;  1R4M B;  1OYW A;  3LA2 A;  1KYZ A;  1XMA A;  1S8N A;  1F1Z A;  4L9T A;  1MNM C;  3T8R A;  3V7C A;  4XM3 A;  5E8I A;  2MH9 A;  2OD5 A;  2ICW G;  2O61 A;  2P7C B;  1IV6 A;  3GXO A;  5EYR A;  2LY1 A;  4NQW A;  3I56 I;  3CO7 C;  2OZU A;  3RKX A;  1EKE A;  2VE8 A;  4RDU A;  3HRM A;  1OKR A;  1R1T A;  2Y31 A;  2M3A A;  3GZN B;  2KPM A;  4V19 K;  2FOK A;  5EF6 A;  4Z6Y A;  2HKO A;  1U3E M;  2F5C A;  1D0X A;  2DAO A;  2M4G A;  1WI3 A;  3K4B A;  4ENN A;  2FML A;  1F43 A;  1ETQ A;  4IRH A;  4M9S A;  2R7Q A;  1XG1 A;  4CCM A;  3S16 J;  5IT3 A;  3OR1 C;  2F2E A;  2G7H A;  2JA2 A;  3MZH A;  5FLV A;  3K2A A;  2Z2S B;  4JYK A;  3FMR A;  4UY8 I;  2ZXJ A;  1UG2 A;  1Z21 A;  4PJM A;  2RC4 A;  3QAH A;  1D0Y A;  2LVS A;  4UVC A;  3OOP A;  4L5J A;  3ABU A;  3PO2 J;  1J59 A;  4KIC A;  2R7Z J;  1Z0X A;  1T6S A;  2N8G A;  1KU7 A;  3LQR A;  4XKB A;  3GLL A;  3AG4 H;  4ANJ A;  2HFH A;  5BQT A;  1SD7 A;  1LEA A;  3DPL C;  4FE4 A;  5IP9 J;  2HVS A;  3GBG A;  1FSH A;  3H3Z A;  5B5E C;  1R9T J;  3AG2 H;  3BWG A;  3GTP J;  3JRB A;  2KIM A;  3CCM I;  2K40 A;  1TBX A;  2RNJ A;  4I76 A;  4M9X A;  4EJU A;  1POG A;  5CVJ A;  1TWF J;  4XLC A;  4UUS B;  1B8I B;  2WAE A;  1W1W E;  3G4S I;  1BR1 A;  3HRU A;  5E1X A;  2ADU A;  2JA7 J;  4EEF G;  3S3M A;  1U9O A;  4NQW B;  2DMN A;  2HQN A;  2Q0O A;  4C2T A;  1F9N A;  3DFG A;  4G94 A;  3HEF A;  1W7P D;  3CJN A;  4I01 A;  4E7I A;  1YRN A;  3ZGK A;  5IP6 A;  2CUZ A;  5FFZ A;  5J47 A;  1H0M A;  1JGS A;  5L3E A;  3W2A A;  3QU3 A;  3CCL I;  1BI2 A;  2LY9 A;  3K0L A;  2F6C A;  2DA7 A;  2VBW A;  4P1W A;  4XBF A;  2NOJ B;  3LSJ A;  4KIG A;  1A6Q A;  4FT8 A;  3OYD A;  5FRO A;  1ZRD A;  1MGT A;  2C6Y A;  2DDB A;  3REO A;  3E0J B;  4HLY A;  2MD5 A;  4XLN F;  4HQM A;  2HVR A;  3OL4 A;  3DU6 A;  5F6F A;  3G3Z A;  4M6X A;  3I64 A;  4O6J A;  4B8X A;  5HVQ C;  3ABT A;  2O8X A;  3A0B C;  2DQR A;  2CUE A;  3PNV A;  3G73 A;  1YE9 A;  4IRG A;  4A12 A;  1EV7 A;  5E3M A;  4IXA A;  4P55 A;  3IRR A;  1MDM A;  2JUC A;  4WX9 A;  1JGG A;  5J4V A;  1ON1 A;  2K5C A;  3K4L A;  2XRO A;  4IX7 A;  1X3Z B;  1R7J A;  2XSJ C;  2DJI A;  4LMY A;  3ZQQ A;  4B1R A;  2PJP A;  1ETY A;  2BXZ A;  1HKQ A;  4PGH A;  5EG0 A;  2X1D A;  1YJN I;  2CW7 A;  3RYR A;  5IYD J;  2X1E A;  1TP4 A;  2J5O A;  4Y17 A;  4BEH A;  1LFU P;  4M3B A;  3OYB A;  1SFK A;  2JA8 J;  4MHG A;  3KZI C;  4CGZ A;  1BN5 A;  2ZME C;  4GYI A;  4JBA A;  3OR2 C;  1R58 A;  4KIB A;  1H9G A;  2NVU B;  1RR8 C;  4HF2 A;  3T0Y A;  3H92 A;  3OIQ A;  4G12 A;  5LRR A;  1MBK A;  1UZC A;  1YO5 C;  5BMZ A;  2DPD A;  1K4S A;  2ME0 A;  3BZ6 A;  2EV5 A;  3HYI A;  3UNG C;  2CQK A;  4M3D A;  2GXA A;  3KX2 A;  1Z7L A;  1YRN B;  2PN6 A;  4HV5 A;  3RZD J;  3JRE A;  2RVC A;  4LIV A;  2NRA C;  1LEB A;  3FM5 A;  5FGM A;  4ZDP A;  1CF7 A;  2XB5 A;  4RB1 A;  3LSM A;  4MQV A;  2A69 F;  2EH3 A;  4IRI A;  4CH7 A;  1U0J A;  4KUM A;  5E79 C;  5KHD A;  3DKY A;  4YII A;  5EJC A;  1X2M A;  2BY2 A;  2LBF A;  2B7E A;  3I53 A;  2PMU A;  1FEX A;  2CW0 F;  3W2W A;  1T98 A;  2L5Q A;  3I9V 2;  4LK1 F;  4BJT A;  1VQN I;  2VKH A;  4L0Z B;  3GTM J;  4LK0 F;  2NNY A;  4WXH A;  3C7J A;  3R0A A;  2LFB A;  2O3F A;  1J0R A;  3CF2 A;  2IGK A;  2QSG X;  1MDM B;  4KN4 X;  4UUV A;  5CQG A;  3G71 I;  2JWT A;  3OL3 A;  2QYO A;  3KP5 A;  4KT5 C;  4V2F A;  5LHG A;  3L09 A;  3DU5 A;  3BPV A;  2KJB A;  2AHQ A;  4HSR A;  3PSI A;  1BI1 A;  4RAF A;  1W5S A;  1MD0 A;  3CUQ C;  3KZY A;  3F3X A;  2JRT A;  3PFI A;  1TW3 A;  1KU9 A;  1U78 A;  1VQ4 I;  2JJ7 A;  2PLY A;  1O57 A;  1R00 A;  2R7V A;  4I7H A;  1MJB A;  4BEH B;  2K02 A;  3SQN A;  3HOV J;  1Q1V A;  2ZJ2 A;  4C30 A;  1HW2 A;  2R7X A;  2VON A;  3SDB A;  2UWM A;  3OS1 A;  3CC4 I;  4MEY F;  4RAG A;  3ASN H;  4BHB A;  3L7W A;  4E7K A;  1VFC A;  4KDP A;  3I71 A;  3S17 J;  3X2Q H;  1Z6T A;  4CIC A;  2HTS A;  2M1B A;  5EEH A;  3DTK A;  4LG0 A;  2DK5 A;  4AYB N;  1P6R A;  2DPU A;  2A5Y B;  2BY3 A;  2GOX B;  3PNY A;  1Z3X A;  3DWL E;  5IYB J;  1VQK I;  4LB5 A;  2MC3 A;  3WHB A;  5D6E A;  4AD9 A;  3KLO A;  3GME A;  2VJ5 A;  3S1N J;  3JRC A;  1WJC A;  2R3S A;  1CF7 B;  1FSE A;  3ZPL A;  3JSP A;  3TDZ C;  1TW2 A;  2UXX A;  3VYR B;  4CCJ A;  2ZO4 A;  3RTR A;  4PFO A;  4O5V A;  2HXO A;  4HEA 2;  4XID A;  3OSF A;  4W97 A;  3W6V A;  5C4J J;  1ZG5 A;  2HOS A;  4GO1 A;  3HOS A;  3VYU B;  3DEW A;  4A6D A;  3MWM A;  2LLK A;  1YHQ I;  2HR3 A;  2LSO A;  1TZL A;  1LFB A;  1V3F A;  1Z6R A;  3HOY J;  3RCO A;  1UHW A;  5DS9 A;  3N4M A;  3J7A Y;  1OCO H;  1RZ4 A;  2FF4 A;  1KON A;  4YRV A;  1FTT A;  2VN2 A;  1ZRF A;  4Q5S F;  1W4M A;  2CG4 A;  1X1B A;  4PCQ A;  4A3E J;  1OMI A;  1YI2 I;  3HGY A;  2XKO A;  4RM2 A;  5CLS A;  1KU2 A;  3WHC A;  1BC8 C;  1VQL I;  1IO2 A;  2LKX A;  3K4K A;  1YW9 A;  1TT0 A;  5FLX Z;  2LMD A;  5GAE J;  4U7D A;  3DKX A;  1XDU A;  2O0Y A;  5ICG A;  2ZFW A;  1NHA A;  5JHU A;  4X0G A;  1W7P A;  2VKE A;  5LLQ A;  3QYB A;  5B66 C;  2UXN A;  1BIB A;  1QQI A;  4UV8 A;  4BXF A;  2A5W A;  3OIP A;  2L9V A;  4XIC A;  3OY9 A;  1QA6 A;  4A0Z A;  1AU7 A;  3VWB A;  3SZG A;  1S7E A;  4OU0 A;  3D5S C;  1I6H J;  1Z05 A;  1ZLJ A;  3Q9S A;  4PJL A;  1OQY A;  4LG0 B;  4AIK A;  1I5Z A;  2RAE A;  3BCB A;  3HUG A;  2B9S A;  4XLP F;  2DW4 A;  1DQU A;  3BG3 A;  2XC7 A;  5H6R A;  3U21 A;  3EYY A;  2R7R A;  5ICF A;  4NDL A;  3PQJ A;  3MAJ A;  1KQ0 A;  3MKW B;  3NAR A;  5KVR A;  2CUJ A;  1MJ9 A;  3GW2 A;  1IV8 A;  2NS8 A;  2XGE A;  5ICC A;  4F55 A;  3WTY C;  2EK5 A;  5H2F C;  3GX4 X;  4E7J A;  4YFN F;  2CUF A;  4LLG F;  5GTI C;  3BJA A;  2P81 A;  4MO7 A;  4NNJ A;  5E8G A;  4XRS G;  1ZR2 A;  1TLH B;  2DN0 A;  3OOU A;  5J1R A;  3CCU I;  2WB1 N;  3TKY A;  3H5N A;  1CQT A;  2B63 J;  1SVM A;  2RGV A;  2JSC A;  2M0C A;  1VQO I;  2FE3 A;  5KNL A;  3RPQ A;  2CQX A;  1XGS A;  3F8C A;  2Z9O A;  5FLX K;  1Y56 A;  4WXC A;  1R36 A;  2GWR A;  3NQO A;  4YFX F;  2GLO A;  2Y0S N;  2ZNY A;  3TBI A;  1X1A A;  3NEU A;  3J81 K;  2LRD A;  5K5O A;  2G9W A;  3BTJ A;  2FBI A;  2G0E A;  1RRJ A;  1ODD A;  2Q1Z B;  4BGD A;  3A01 A;  1XGM A;  4GRI A;  4S05 A;  3HOT A;  2I8D A;  4ZH4 F;  3WTV C;  4C9Y A;  5HOD A;  2CV1 A;  1S9H A;  4P9F A;  4QPQ A;  2VLA A;  2MLK A;  3PJR A;  3KIO A;  4XOT A;  1ZQ3 P;  1QNT A;  1P7I A;  4MFD A;  5HDG A;  3R0J A;  2LR8 A;  1KGS A;  2E19 A;  5DUK A;  4XRS A;  3CC2 I;  2KLO A;  2W85 A;  2HYG D;  4EM2 A;  2KRH A;  5AON A;  2Y0S A;  2LF8 A;  1K4T A;  2E60 A;  1OPC A;  1FT9 A;  4D5F A;  4JK1 X;  1JT6 A;  3FHN A;  3VDX A;  2PJR B;  2JVH A;  1SFU A;  2CV0 A;  2XAH A;  3GF2 A;  4HX4 A;  2HPM A;  1FTZ A;  5LGU A;  1MKM A;  5C44 J;  3CCR I;  4OIR F;  1WH7 A;  3JW4 A;  3JRF A;  1QZZ A;  4BQQ A;  1FMV A;  5HS8 A;  1X1D A;  3L9F A;  4BH9 A;  4A3D J;  4CHU A;  2GZW A;  3VPR A;  4BU2 A;  4BDZ A;  1YIO A;  4GGG A;  2H27 A;  3UKG A;  3S14 J;  2HEO A;  3I59 A;  3PIP F;  3WGI A;  1LE8 A;  1WWX A;  1Z1D A;  3BZC A;  3D5L A;  3HHH A;  1H89 C;  4EM0 B;  1W5C C;  4LB6 B;  2KT0 A;  3E7L A;  4XLF A;  4L9V A;  2HTJ A;  4AIJ A;  3P5J A;  2X6W A;  2K7L A;  5ILU A;  5JVG F;  2MGQ A;  1UB9 A;  5TIS C;  4A3G J;  3F6O A;  5BS6 A;  5FRM A;  2UUZ A;  4IVN A;  3C2B A;  3I0T A;  3R60 A;  2Y2Z A;  4D9J A;  3S1R J;  2XUB A;  4LLN A;  5J1U A;  3GTJ J;  5FKO A;  2AQF A;  3DF8 A;  5FJ8 J;  1UMQ A;  3F22 A;  1RIO H;  3H35 A;  5CVV A;  1MBE A;  1GDT A;  4QTR A;  1VTN C;  3ROU A;  3ZMS A;  4EV0 A;  3FIS A;  2JPC A;  4XLH A;  2XGX A;  3OYG A;  1OIS A;  4QPO A;  2X0L A;  3EQL F;  2V7F A;  1V5G A;  5FKK A;  2VOO A;  2DLL A;  1VQM I;  5DD4 A;  1U9N A;  1FBS A;  4DOZ A;  1R23 A;  5F0C A;  1BL0 A;  4FAS D; 
#chains in the Genus database with same CATH homology
 4UVA A;  1S7A A;  4HYE A;  2XV4 S;  3JTH A;  4N0B A;  3GZ6 A;  2M30 A;  1F4K A;  2WV0 A;  5D6F A;  2A6H F;  2PMH A;  4G6D A;  1XSX A;  2PEX A;  3EET A;  1H9T A;  2BBY A;  4EGY A;  1U6G A;  3BPX A;  4CZZ A;  2FSW A;  2W25 A;  3CUQ A;  3I5U A;  2E1N A;  3FM3 A;  3I59 B;  2CWE A;  4PDK A;  3K1N A;  1HKS A;  1UCR A;  1O7L A;  2MBF A;  3ECH A;  1GXP A;  3KP3 A;  4OIN F;  4WCG A;  1LDD A;  5HS7 A;  2XAS A;  2L4M A;  4G9Y A;  1XD7 A;  5LGT A;  4L9N A;  4GXO A;  3RPU A;  4LGW A;  5HDN A;  2JTV A;  3KFW X;  1TQP A;  4RGX A;  2QQA A;  1WSU A;  1LJ9 A;  1HW1 A;  2IPQ X;  1TQI A;  3OV8 A;  4HLX A;  5TRD A;  3S2W A;  3C18 A;  3T8T A;  2YU3 A;  2MH2 A;  3M1E A;  3P9C A;  1BOA A;  5D5W B;  2OU2 A;  1ZHF A;  3CUQ B;  3KEO A;  2M5W A;  2YX7 A;  4ZYD A;  5FB2 A;  1XB4 A;  3TQN A;  4UXN A;  2QQ9 A;  5HDK A;  2XVC A;  2P5L C;  1G3W A;  3I4P A;  2RDP A;  2PG4 A;  1J9I A;  3FZV A;  3TO9 A;  1K78 A;  3E5U A;  4LJZ F;  2H09 A;  2ZBK A;  1EH6 A;  2MLG A;  2P7V B;  1E17 A;  4A0X A;  2F5E A;  2RN7 A;  3T5X A;  1HST A;  3H3U A;  1IXC A;  4I0A A;  4WWC A;  5E1W A;  3FF5 A;  4DNC A;  3BP8 A;  4KNY A;  2BE5 F;  3HSF A;  4R1H A;  3WTU C;  1DUX C;  4BYY A;  2VT3 A;  3K1M A;  3GFJ A;  3P7N A;  5LRS A;  5E20 A;  3V8L A;  3Q5F A;  3EYI A;  4M74 A;  4U0Y A;  2D45 A;  1IN4 A;  2K4J A;  2F5F A;  3DEU A;  4AVP A;  1BI3 A;  2KKO A;  4XSZ F;  4S04 A;  3T1B A;  3HTS B;  4ZZL A;  1LDK B;  1Q1H A;  3F8F A;  3B73 A;  1T0F A;  2L3D A;  3WU1 B;  3W6J B;  3O3K A;  2HYF A;  1IN5 A;  4I2O A;  1QGP A;  4OOI A;  2EFQ A;  2AS5 F;  1W5T A;  1BM9 A;  5TJJ A;  3HTU A;  1IXS B;  3IL2 A;  2JPB A;  5J6X A;  3WOD F;  3WU0 A;  3C1D A;  3WTW C;  3MCZ A;  2BGC A;  4U7B A;  3ELK A;  5ED4 A;  1G3Y A;  4WXD A;  2CFX A;  4HBL A;  1FNN A;  2O03 A;  3V8K A;  2DO7 A;  1ZGJ A;  2VBZ A;  3ZP5 A;  1Z91 A;  3ZMU A;  2HQR A;  2QM3 A;  1K6O A;  3HIF A;  3JAM Z;  2L02 A;  3U9G A;  3W6K B;  3QU6 A;  1XCB A;  4OMY A;  2Y48 A;  1KQ9 A;  2OA4 A;  3DKW A;  1U5T C;  3R61 A;  5BOX A;  1TNT A;  1HQC A;  1GVJ A;  3M7G A;  2VXZ A;  2V79 A;  2NNN A;  1SFE A;  5L3C A;  4HX7 A;  2PI0 A;  3J7A O;  4QLC U;  1IW7 F;  2CSO A;  3LA3 A;  2Y75 A;  1ZN2 A;  4HDV A;  4NB5 A;  1ON2 A;  5H6Q A;  4HZF A;  2LF7 A;  3HHG A;  3IWZ A;  4OIO F;  2JT1 A;  2PFB A;  3P9K A;  3JAM K;  4BNC A;  1MZB A;  1G6N A;  2LDU A;  3COA C;  1YG2 A;  1YW8 A;  1O7F A;  1RI7 A;  6PAX A;  5HOO A;  1RNL A;  3RI4 A;  1UFM A;  1QO0 D;  3ZMZ A;  4ETS A;  4EVI A;  1SAX A;  2WWY A;  4RAY A;  3E6D A;  4MGR A;  4N9I A;  3R6S A;  1XGN A;  2FRH A;  1E2X A;  3WE2 A;  4JQF A;  2PQ8 A;  5E18 F;  5CVI A;  5LHH A;  1FPQ A;  1EH8 A;  5CJ9 A;  1QZY A;  4ESF A;  3EDP A;  5DEQ A;  1R5G A;  4HAM A;  3ECO A;  1Y0U A;  3L00 A;  1BIA A;  3SFZ A;  3ML6 A;  2EWN A;  5D5V B;  1YW7 A;  2IT0 A;  3WG9 A;  3ZQ7 A;  4FX4 A;  3KP7 A;  3LAP A;  1I6X A;  1LDJ A;  2P4W A;  4AIH A;  2XAG A;  2DTR A;  4Y15 A;  3K2Z A;  2WTE A;  3FMS A;  2QEN A;  3F6V A;  5D4R A;  4PGG A;  4U0W A;  4A5N A;  4BHC A;  3Q9V A;  2H6C A;  3J81 Z;  2RKH A;  3BJO A;  4A0Y A;  3ISP A;  2GXG A;  4G8X A;  4HOB A;  4FHT A;  2ESN A;  4KN7 X;  2B0L A;  4RB2 C;  2QBY A;  2IP2 A;  2MA3 A;  2KJC A;  4ZYE A;  3GVA A;  1SD6 A;  5AIQ A;  4U88 A;  3RYP A;  2VBY A;  2E7X A;  5HLI A;  1JE8 A;  4BAY A;  1BI0 A;  2STT A;  2VBX A;  4U0V A;  5F64 A;  5CVR A;  1P4W A;  2HKX A;  1IN7 A;  3GLX A;  2H6B A;  4L9J A;  1FC3 A;  1FX7 A;  4QWQ A;  4IJA A;  5DYM A;  3ZMD A;  4MQ9 F;  4LLL A;  5FO5 A;  2IA0 A;  2Q2E A;  3IWF A;  3KEQ A;  4R79 A;  3RDI A;  3E6M A;  1FYM A;  2DFI A;  2FBH A;  2FBK A;  2KIU A;  1F5T A;  2P5V A;  2TDX A;  1W7P B;  3F8N A;  1IF1 A;  2DK8 A;  5HLH A;  1RUO A;  1K7A A;  3AAF A;  3LA7 A;  3GFI A;  4I0B A;  2QBY B;  1RUN A;  3U1D A;  2YR2 A;  2OBP A;  3IKT A;  5ILV A;  3E3V A;  1DPR A;  4RB0 A;  2VOP A;  1ZRC A;  1WRJ A;  2YPR A;  2DU9 A;  5L3F A;  5D8K B;  1IAW A;  3GFL A;  3VOD A;  3QPT A;  5FD5 A;  4G7O F;  3CTA A;  4N9H A;  4TV7 A;  2LKP A;  1U2W A;  2Q8K A;  4RGR A;  2XAJ A;  2XAF A;  1ZGA A;  1PP7 U;  2FQ3 A;  5J8C A;  2ZME A;  3RIR A;  2M87 A;  5LBQ A;  3IKV A;  1D3Y A;  3LFK A;  5DD8 A;  1R1V A;  3ZN0 A;  1FP2 A;  5E17 F;  4IHS A;  1FBU A;  1UHM A;  2A68 F;  4IF4 A;  1FZP B;  3MEX A;  4ESB A;  2GXB A;  2GIV A;  1HBX G;  4FX0 A;  2YSR A;  4Q48 A;  2XIG A;  2STW A;  2HDC A;  1YTY A;  1T38 A;  2ZCW A;  2ZNZ A;  2BYV E;  2IVM A;  5DDG A;  1C0W A;  1CGP A;  4KFC A;  5KK1 A;  2FU4 A;  1GHC A;  4XSX F;  4CO8 A;  2DBB A;  1DDN A;  1PP8 F;  1ZYR F;  4YIF A;  4LFU A;  2BEO A;  1ONV A;  5DCF A;  2KIF A;  1HXD A;  4RS8 A;  5K5Q A;  2ZME B;  2ISY A;  4RB3 C;  1B1B A;  2ACJ A;  1IXR C;  1AWC A;  1O3T A;  1J2X A;  4NHJ A;  2H94 A;  3V7R A;  3FXU A;  5F1R A;  3GEZ A;  4ZYH A;  1SD5 A;  2Z5U A;  3BY6 A;  3QP6 A;  3DPT A;  4HDU A;  5BPD A;  4EJW A;  4ENK A;  1L3L A;  3LWF A;  1G3S A;  2GQQ A;  5LHI A;  5JR3 A;  1JHF A;  4KIF A;  1O3Q A;  2EFP A;  3BOQ A;  1B9M A;  3FXR A;  4EJT A;  1HSJ A;  2K86 A;  2J5P A;  3QPH A;  1JHH A;  4M72 A;  2A3S A;  1LVA A;  3D0S A;  5BPI A;  3B02 A;  1UST A;  2HS5 A;  3SZT A;  4A2U A;  1G4D A;  4L0Y B;  4CDG A;  4Q47 A;  4M73 A;  2ETH A;  3BJ6 A;  4Y13 A;  1LQ1 A;  2W84 A;  2Y0M A;  3TDU C;  3TGN A;  2R7F A;  3KP6 A;  1PUE E;  2FA5 A;  1I1G A;  4UNO A;  1YQA A;  2F5D A;  1KQ8 A;  1EH7 A;  1ZAO A;  5L3G A;  3DP7 A;  4L5I A;  4YG2 F;  5LEK A;  4I98 B;  4E70 A;  2NAZ A;  5FD6 A;  3C3W A;  4DQ2 A;  2E7W A;  1FY7 A;  2VC1 A;  1B59 A;  5DV5 A;  3CLO A;  3WTT C;  1T2K A;  2O6G E;  4HX8 A;  1IN8 A;  2W24 A;  5HS9 A;  3F72 A;  2V1U A;  3E5X A;  3ZMT A;  5A2Q Z;  2EFW A;  2W57 A;  2ISZ A;  3HRT A;  2VOD A;  4A5M A;  1G3T A;  3K9T A;  1I27 A;  2XKP A;  1FWZ A;  2V6C A;  5FFX A;  4CYD A;  4Z2Y A;  5ICE A;  2E1C A;  2A61 A;  1BC7 C;  5D8L B;  5ILS A;  1K78 B;  2AXL A;  1S7O A;  1J7K A;  2CGP A;  3VEP A;  3ZMV A;  2VC0 A;  2EB7 A;  1X3U A;  3WGG A;  5EEG A;  4YFK F;  1D5V A;  1WQ2 A;  4ON0 A;  1QPM A;  4RGU A;  1IN6 A;  1P4A A;  1T39 A;  4WF2 A;  2G7U A;  3DV8 A;  3VFZ A;  5A2Q K;  3CO6 C;  3JSO A;  1S29 A;  4HQE A;  4BXU A;  1FYL A;  1P4X A;  5CVU A;  1XSD A;  3K1P A;  1ZAR A;  5L3B A;  1WKM A;  5D5X B;  1HW5 A;  1SMT A;  4KMF A;  2FNP A;  2D1H A;  1IZ1 A;  4K2E A;  3IC7 A;  1QBJ A;  1XSV A;  1IRF A;  1FOK A;  1KA8 A;  2RV8 A;  1MJA A;  1D8K A;  2JZY A;  5K5R A;  1XDS A;  2QZ8 A;  2A07 F;  3FMQ A;  1R5H A;  1OYY A;  3GO5 A;  4P5O A;  5IT9 Z;  3WGH A;  2IA2 A;  2QQB A;  2M45 A;  3PQK A;  1IRG A;  1I1S A;  3BDD A;  2LNB A;  2DT5 A;  3LAJ A;  4Q4Z F;  2HZT A;  3ERE D;  3HSE A;  4GCV A;  2QVO A;  3E6C C;  3FWE A;  1A04 A;  2COM A;  1XCV A;  2IW5 A;  3KZZ A;  1P92 A;  1SFX A;  2K27 A;  3KET A;  4BQA A;  4L18 B;  4D0P A;  2V1D A;  1BBY A;  1FYK A;  1ZLK A;  3TOB A;  4KA4 A;  4IPA A;  3V8J A;  2XRN A;  3KCC A;  1SD4 A;  4M71 A;  3GYH X;  1LB2 A;  3RKW A;  1LNW A;  2DI3 A;  5IT9 K;  2VE9 A;  3FHZ A;  5DCM A;  1J75 A;  3LST A;  1OR7 A;  1AOY A;  4EGZ A;  2WC2 A;  3U2R A;  3O6B B;  3SZP A;  4HV6 A;  4M9Z A;  3FX3 A;  1YLF A;  3DXJ F;  2OQG A;  3V4G A;  5D4S A;  5LEJ A;  4WK8 F;  2BV6 A;  4I02 A;  3J80 Z;  2KRF A;  1L0O C;  2OQR A;  4I09 A;  3SHF A;  1XMK A;  4HF0 A;  4ZZD A;  3L2C A;  1YS6 A;  1FLI A;  2EFN A;  3DQV C;  1O3R A;  1S6L A;  1WI9 A;  3EUH A;  2HWV A;  4H0E A;  3F8B A;  3HRS A;  3ULQ B;  4G6Q A;  2GA1 A;  1V4R A;  3ZN1 A;  3I54 A;  4IHT A;  4G7H F;  4UVB A;  2A6E F;  1XGO A;  1R1U A;  5AIP A;  3VB2 A;  3TOA A;  1ZH5 A;  4MEX F;  2EV6 A;  3KE2 A;  3E97 A;  4R8H A;  3QRF F;  5DCM B;  2OZ6 A;  2NS0 A;  1O3S A;  2EFO A;  2HGC A;  3IRQ A;  4RGS A;  4MTD A;  1Z7U A;  4G7Z F;  2P5K A;  3KP4 A;  2D2W A;  3J80 K;  1ZG1 A;  1J5Y A;  2D1V A;  5D5U B;  3FXQ A;  5CYV A;  2ESH A;  4A6E A;  4P96 A;  4EJO A;  1FBQ A;  5ERI A;  3MFK A;  2K4B A;  3KLN A;  4HW0 A;  4F7Z A;  2R7D A;  1IUY A;  3KP2 A;  1KU3 A;  3GFM A;  2PBI A;  1YFH A;  4M6Y A;  1GXQ A;  2VT2 A;  2FMY A;  2IRF G;  1STZ A;  1ZG3 A;  4RAZ A;  3NRV A;  3CUO A;  2P6S A;  3RKY A;  3I58 A;  4MNU A;  4B09 A;  3R4K A;  2ELH A;  3BRO A;  1PDN C;  4EJV A;  2L54 A;  2Z3Y A;  3O2P E;  1XN7 A;  2ZKZ A;  3GUD A;  3P9I A;  2EA2 A;  4EQQ A;  2IA1 A;  2V9V A;  4ENM A;  1P2F A;  4XRF A;  3QP5 A;  2CYY A;  1B9N A;  1HKT A;  1OYI A;  4HA8 A;  2NYX A;  3VOE A;  4LD5 A;  5LGN A;  3E5Q A;  3F23 A;  2P8T A;  4BHP A;  3N97 A;  2FNA A;  2M8E A;  3WE3 A;  2Z99 A;  1U5T A;  3F8M A;  4UV9 A;  1B4A A;  3MZY A;  3TO6 A;  3M8E A;  4UHT A;  3M8F A;  2EV0 A;  2L4A A;  3WTS C;  4P9U A;  1TQM A;  1YS7 A;  3M9A A;  1USS A;  4GYG A;  4ENJ A;  2XHK A;  2V1X A;  5DUI A;  2QUF A;  2X4H A;  1S3J A;  2QWW A;  2QLZ A;  2EA4 A;  1Z9C A;  1BJA A;  1ULY A;  5JI6 A;  3TO7 A;  1DP7 P;  3MQ0 A;  2Z33 A;  2DQL A;  3LQQ A;  1REP C;  2EJR A;  1YYV A;  3GZ5 A;  4HF1 A;  4AWX B;  3JTG A;  2P6T A;  1TNS A;  2YX4 A;  1SMY F;  4PZJ A;  4OIP F;  2XAQ A;  3V7S A;  3QOP A;  3SXY A;  2L01 A;  4ZYG A;  3E6B A;  1KYW A;  1U5T B;  1K79 A;  4ESJ A;  3RJP A;  4MTE A;  1R22 A;  4OMZ A;  2OAZ A;  2IJL A;  3F21 A;  4EMS A;  2UZK A;  1U8R A;  1ZRE A;  1TTY A;  4CXF A;  5L3D A;  2GA2 A;  4KMU X;  5JFR A;  4O3M A;  3K69 A;  1D8J A;  5JVT A;  2FEZ A;  3HSR A;  5HLG A;  2RQP A;  3WTX C;  1B6A A;  3GWZ A;  3WTZ A;  4KYW A;  5K1Y A;  4ASN A;  2HOE A;  1JXS A;  4EM1 A;  2CO5 A;  3CDH A;  5E1Z B;  4OIQ F;  2GAU A;  1FP1 D;  3IHU A;  5J8F A;  5H20 A;  2FXA A;  1DPU A;  3LA2 A;  1OYW A;  1KYZ A;  1XMA A;  1S8N A;  1F1Z A;  4L9T A;  3T8R A;  3V7C A;  5E8I A;  2MH9 A;  2OD5 A;  2O61 A;  2P7C B;  3GXO A;  4NQW A;  3CO7 C;  2OZU A;  3RKX A;  2VE8 A;  3HRM A;  1OKR A;  1R1T A;  2FOK A;  2HKO A;  1U3E M;  2F5C A;  2DAO A;  4ENN A;  2FML A;  4IRH A;  4M9S A;  5IT3 A;  2F2E A;  2G7H A;  3MZH A;  3FMR A;  2ZXJ A;  2RC4 A;  3QAH A;  4UVC A;  3OOP A;  4L5J A;  3ABU A;  1J59 A;  4KIC A;  1T6S A;  1KU7 A;  3LQR A;  2HFH A;  5BQT A;  1SD7 A;  1LEA A;  3DPL C;  1FSH A;  3H3Z A;  3BWG A;  2KIM A;  4EJU A;  1TBX A;  2RNJ A;  4M9X A;  5CVJ A;  3HRU A;  5E1X A;  2ADU A;  2HQN A;  2Q0O A;  1F9N A;  3DFG A;  4G94 A;  1W7P D;  3CJN A;  4I01 A;  5FFZ A;  1H0M A;  1JGS A;  5L3E A;  3QU3 A;  1BI2 A;  3K0L A;  2VBW A;  4XBF A;  1ZRD A;  4KIG A;  4FT8 A;  1MGT A;  2C6Y A;  3REO A;  4HLY A;  2MD5 A;  4XLN F;  4HQM A;  5F6F A;  3G3Z A;  4M6X A;  3I64 A;  4O6J A;  4B8X A;  5HVQ C;  3ABT A;  2O8X A;  2DQR A;  3G73 A;  4IRG A;  4A12 A;  1EV7 A;  4IXA A;  4P55 A;  3IRR A;  1MDM A;  4WX9 A;  1ON1 A;  2XRO A;  1R7J A;  4LMY A;  2PJP A;  1HKQ A;  4PGH A;  3RYR A;  2J5O A;  4Y17 A;  4MHG A;  4CGZ A;  1BN5 A;  4GYI A;  4JBA A;  1R58 A;  4KIB A;  1H9G A;  4HF2 A;  3T0Y A;  3H92 A;  5LRR A;  1YO5 C;  5BMZ A;  2DPD A;  3BZ6 A;  2EV5 A;  3HYI A;  2CQK A;  2PN6 A;  4HV5 A;  2RVC A;  2NRA C;  1LEB A;  3FM5 A;  5FGM A;  1CF7 A;  4RB1 A;  4MQV A;  2A69 F;  4IRI A;  4KUM A;  4YII A;  3I53 A;  2PMU A;  2CW0 F;  1T98 A;  4LK1 F;  4LK0 F;  2NNY A;  4WXH A;  3C7J A;  3R0A A;  2O3F A;  1J0R A;  1MDM B;  4KN4 X;  4UUV A;  2QYO A;  3KP5 A;  4KT5 C;  5LHG A;  3L09 A;  3BPV A;  2KJB A;  1BI1 A;  1W5S A;  1MD0 A;  3CUQ C;  3KZY A;  3F3X A;  2JRT A;  3PFI A;  1TW3 A;  1KU9 A;  1U78 A;  2PLY A;  1O57 A;  1R00 A;  4I7H A;  1MJB A;  2K02 A;  3SQN A;  2ZJ2 A;  1HW2 A;  2VON A;  2UWM A;  4MEY F;  4BHB A;  3L7W A;  4KDP A;  3I71 A;  1Z6T A;  4CIC A;  2HTS A;  2M1B A;  5EEH A;  4LG0 A;  2DK5 A;  1P6R A;  2DPU A;  2A5Y B;  4LB5 A;  2MC3 A;  5D6E A;  4AD9 A;  3KLO A;  2R3S A;  1CF7 B;  1FSE A;  3ZPL A;  3JSP A;  3TDZ C;  1TW2 A;  2UXX A;  2ZO4 A;  3RTR A;  4O5V A;  1ZG5 A;  4GO1 A;  3HOS A;  4A6D A;  3MWM A;  2HR3 A;  2LSO A;  1V3F A;  1Z6R A;  1UHW A;  3N4M A;  1RZ4 A;  2FF4 A;  2VN2 A;  1ZRF A;  4Q5S F;  1W4M A;  2CG4 A;  4PCQ A;  1OMI A;  2XKO A;  5CLS A;  1KU2 A;  1BC8 C;  1YW9 A;  5FLX Z;  4U7D A;  1XDU A;  2O0Y A;  5ICG A;  2ZFW A;  1NHA A;  5JHU A;  1W7P A;  5LLQ A;  2UXN A;  1BIB A;  1QQI A;  4UV8 A;  4A0Z A;  4OU0 A;  1Z05 A;  1ZLJ A;  3Q9S A;  4LG0 B;  4AIK A;  1I5Z A;  3HUG A;  4XLP F;  2DW4 A;  5H6R A;  3EYY A;  5ICF A;  3PQJ A;  3MAJ A;  1KQ0 A;  5KVR A;  3GW2 A;  1MJ9 A;  5ICC A;  3WTY C;  2EK5 A;  3GX4 X;  4YFN F;  4LLG F;  3BJA A;  5E8G A;  1TLH B;  3TKY A;  2RGV A;  2JSC A;  2FE3 A;  3RPQ A;  1XGS A;  3F8C A;  2Z9O A;  5FLX K;  4WXC A;  1R36 A;  2GWR A;  3NQO A;  4YFX F;  2ZNY A;  3NEU A;  3J81 K;  5K5O A;  2G9W A;  2FBI A;  1ODD A;  1XGM A;  4S05 A;  3HOT A;  4ZH4 F;  3WTV C;  4P9F A;  2MLK A;  1QNT A;  5HDG A;  3R0J A;  1KGS A;  5DUK A;  2W85 A;  2HYG D;  4EM2 A;  5AON A;  2LF8 A;  1OPC A;  1FT9 A;  4JK1 X;  1SFU A;  2XAH A;  3GF2 A;  4HX4 A;  5LGU A;  1MKM A;  4OIR F;  3JW4 A;  1QZZ A;  5HS8 A;  3L9F A;  4BH9 A;  4CHU A;  2GZW A;  1YIO A;  4GGG A;  2H27 A;  2HEO A;  3I59 A;  3WGI A;  1WWX A;  1Z1D A;  3D5L A;  3HHH A;  4EM0 B;  4LB6 B;  4L9V A;  2HTJ A;  4AIJ A;  2K7L A;  5ILU A;  1UB9 A;  3F6O A;  5BS6 A;  4IVN A;  3I0T A;  3R60 A;  2XUB A;  4LLN A;  1RIO H;  3F22 A;  3DF8 A;  5CVV A;  1VTN C;  3ROU A;  3ZMS A;  4EV0 A;  2JPC A;  2XGX A;  2X0L A;  3EQL F;  2VOO A;  2DLL A;  5DD4 A;  1FBS A;  1R23 A;  4L0Z B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...