3GFMA

Crystal structure of the st1710 mutant (k91a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRAILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfmA00
1U5TC 3HSRA 2YU3A 3ZPLA 3Q5FA 1TQIA 1Q1HA 1BC8C 2LSOA 3KFWX 3V4GA 2LF8A 1BI1A 2UXXA 3QP6A 4HX4A 5BMZA 3KZZA 3CTAA 1L3LA 4DNCA 1IN7A 2F2EA 2EFQA 4WCGA 2HYFA 2C6YA 2BE5F 3WTUC 4U7BA 1TW3A 1WWXA 2ZMEB 2PQ8A 1DPRA 3HUGA 4HZFA 1QZYA 3RPUA 2FBIA 2IA1A 1KQ9A 1QBJA 2OZUA 4A6DA 1WI9A 2QVOA 4KIFA 4BAYA 4P5OA 3FM5A 3COAC 5DYMA 1LDDA 3N4MA 1HQCA 4L5IA 5DUKA 4OINF 1ZG3A 1TLHB 5LBQA 4U0WA 3PQJA 4FHTA 1P92A 2BBYA 2O61A 4DQ2A 4HF2A 2LKPA 4U0VA 3T0YA 5E20A 4WXDA 2PI0A 1SFUA 1G3TA 3CUQA 2O3FA 5K5RA 4XSZF 2YX7A 4HLYA 3DKWA 3MWMA 1T0FA 2KRFA 3BP8A 3LAJA 4QWQA 2MH9A 3C3WA 1T38A 5H20A 5HOOA 2CGPA 2EJRA 1BOAA 3SZPA 3TOBA 1J9IA 2PMUA 1P4XA 5LGUA 2VT3A 2KIFA 5CYVA 5HS9A 2M87A 3KP4A 2QBYA 4IJAA 3HRSA 1S8NA 4G7HF 5K5OA 4I2OA 1XSXA 4EV0A 5LEJA 5E18F 3QOPA 2LF7A 4A12A 2DK5A 2EA2A 1IN4A 2HQNA 3KZYA 3W6JB 3E5QA 2GIVA 1C0WA 2FOKA 2ZXJA 1IRFA 3ZN1A 1ZLJA 2OQRA 1K79A 4AIJA 2HS5A 3LA2A 4U7DA 4L5JA 1CF7B 1O3QA 2QQBA 4ZYHA 1XDSA 3RYPA 2JPCA 1MD0A 3T8RA 3K0LA 4A2UA 1IXSB 1LJ9A 3SHFA 1MDMA 1V4RA 4E70A 4KN7X 1FP2A 4RB2C 1X3UA 1ONVA 1TW2A 2XAHA 2CYYA 4ESBA 2IJLA 2QZ8A 1SFEA 3K1PA 2RQPA 3KLNA 2EB7A 3J81Z 2ZNYA 3FZVA 2BGCA 4B8XA 2Y0MA 2K4BA 3NQOA 5LGTA 1XSDA 1OR7A 1FZPB 3EQLF 1G3SA 1BN5A 4RS8A 4MHGA 4KA4A 2P8TA 4AWXB 3FWEA 3I54A 4AVPA 4HX7A 3LA3A 1D5VA 4OIOF 5JVTA 2ZO4A 1TQMA 2GXGA 2FMYA 3QAHA 4RGUA 2ESHA 1XMAA 4AIHA 1BIBA 2UWMA 4U0YA 3P9KA 2E1NA 5A2QZ 4XLNF 5HS7A 1KU2A 1GXQA 2XROA 1OMIA 1F9NA 2W85A 4M73A 2PFBA 4WF2A 3NEUA 4Q48A 4BNCA 3H92A 4CXFA 3P9CA 2A69F 4IRGA 2A3SA 1JGSA 1J5YA 1W4MA 2KJBA 3BROA 5JHUA 4XRFA 2YPRA 2HDCA 1JE8A 4L9TA 3ECOA 2G7UA 2VBYA 5BPDA 2L4MA 1RIOH 3BZ6A 4I0BA 2QYOA 1OYWA 1LVAA 3CLOA 4N9IA 3H3UA 1K7AA 3HHGA 1OYYA 3WTXC 3Q9SA 2A5YB 1UHMA 3L9FA 1FC3A 2DO7A 2HKXA 3DQVC 5K5QA 4ENJA 1IAWA 2VXZA 3J7AO 4KIBA 4I09A 1EH8A 4RGXA 2DAOA 5L3FA 1ZG5A 3GFIA 3KCCA 3WE3A 1PUEE 2R3SA 2EA4A 2L54A 2Y75A 4LGWA 4IPAA 3ABUA 1H9GA 3WGHA 3GXOA 3TDUC 1T39A 3GZ6A 1W5SA 5L3DA 1WKMA 3CO7C 2ELHA 1HSTA 4ENKA 3DXJF 4YFXF 3N97A 2XAQA 3E6MA 2DFIA 1KU3A 1ODDA 5KK1A 2JT1A 3B02A 3C1DA 2QUFA 3FX3A 1Z1DA 1FOKA 3L00A 3F6VA 4G7OF 4OMYA 3HHHA 3WTTC 2QWWA 3M9AA 3WTZA 4CO8A 4EJUA 4A0ZA 2PBIA 4BHBA 5CVIA 3RKWA 1IN5A 1GXPA 2IW5A 3EYIA 2QQ9A 2QM3A 4LLLA 2DPDA 1FX7A 4LMYA 5CVJA 1F1ZA 2GQQA 5LRSA 2HR3A 1ZREA 2DI3A 2XVCA 5J8FA 1A04A 2K4JA 2VOPA 3BY6A 3VEPA 5D4RA 1FLIA 4Q5SF 3I0TA 2PG4A 3B73A 3PQKA 1K78A 1GVJA 2Q0OA 3JW4A 2VODA 2CO5A 4LK0F 2GXBA 5BS6A 4M9SA 2BYVE 3ISPA 5FFXA 3IC7A 2H94A 3DP7A 3I53A 3HTSB 3IWZA 3F8MA 2VBZA 1IN6A 3LFKA 2IPQX 2V9VA 1TBXA 2YX4A 4UXNA 2VE9A 1XGNA 4ZYGA 4PCQA 3QU3A 4LG0B 1TTYA 2HTJA 2JZYA 1IF1A 2L01A 1KYWA 2HOEA 2P5LC 4Y17A 5TRDA 3KP7A 1R58A 1U5TA 5AIQA 2RC4A 1ON2A 3TKYA 2QENA 4ZZDA 4UV9A 1LDJA 5LHHA 1R1UA 5KVRA 3I58A 1J7KA 2F5DA 5JFRA 1F4KA 4UVBA 3F8FA 5D5UB 2D2WA 2CWEA 1IZ1A 5ILVA 3U9GA 4LK1F 2VONA 1FYKA 1MJ9A 4LLGF 4S04A 4ZZLA 4OOIA 4MTDA 2EV0A 2HQRA 2VC0A 3ERED 1YW9A 4IF4A 2HEOA 3I64A 3V7CA 4KYWA 2DTRA 4HLXA 2LDUA 1IXCA 3J80K 1R5HA 1TNSA 2FEZA 2ADUA 1HW5A 2D1HA 3WTVC 1E17A 5J8CA 1NHAA 4XBFA 2BEOA 1XSVA 4S05A 2W84A 3JTHA 4EGYA 2OQGA 5FD5A 4UHTA 3HRUA 2O8XA 1PP8F 1FSHA 1W5TA 2HKOA 2M30A 4M74A 3ZQ7A 1QQIA 1R22A 4RGRA 3TGNA 4PGHA 2IA0A 4HAMA 2J5PA 1ZRFA 4KUMA 4R79A 4IHSA 1HKTA 1VTNC 3F8NA 1HW1A 4G6QA 1BJAA 3FMSA 2JRTA 2OU2A 4NQWA 1K6OA 3GF2A 5LRRA 5LGNA 4GYGA 1MJBA 1RNLA 3F22A 5AIPA 3T1BA 4PGGA 2VT2A 1Y0UA 3ZMSA 2NS0A 2DQLA 4HA8A 2JPBA 1J75A 3V8LA 5E1ZB 1W7PB 4LD5A 4HOBA 2ZFWA 5H6QA 1D3YA 1ON1A 1Z6TA 3K2ZA 4U88A 1XN7A 2NNNA 1LB2A 1S7AA 3GLXA 4XSXF 2O03A 2KIMA 2ACJA 2K86A 3JTGA 2KKOA 2JTVA 2P7VB 3RIRA 3E6DA 5LEKA 3HTUA 4HV6A 4KIGA 2COMA 3RPQA 4P96A 4WXHA 3JAMK 3W6KB 1ZARA 3FHZA 1TQPA 1ULYA 2Z99A 3JAMZ 2ZCWA 3E3VA 4O3MA 1IUYA 2XUBA 1T6SA 1ZN2A 4F7ZA 1DP7P 5ICEA 5D4SA 3DPLC 4YIIA 3CUQC 5ED4A 1SD4A 4HDUA 3REOA 5FB2A 5ICFA 4WWCA 3R6SA 2W57A 2GAUA 1BC7C 2HTSA 4LLNA 1HKSA 1OKRA 4P9FA 3I71A 5JR3A 1YS7A 2IT0A 2H6CA 1FWZA 1JXSA 1YIOA 3GFJA 4UUVA 3FXUA 2P5VA 3WU1B 4JQFA 2FXAA 1FNNA 4HF1A 2XAJA 1S7OA 5F1RA 3D0SA 3ELKA 2AS5F 4GXOA 5L3BA 2FNAA 2ZBKA 1AWCA 3HOTA 3TO7A 3ULQB 4UNOA 4D0PA 2V1DA 1BBYA 3VB2A 2PLYA 2OBPA 1KQ8A 4G9YA 2NNYA 3E5XA 2G9WA 3FM3A 3ZP5A 1FYLA 4ENMA 5IT9K 4EJVA 2WTEA 5DCFA 1QO0D 1MKMA 2Z9OA 1USSA 4TV7A 2V79A 1BIAA 2WWYA 1ZRDA 1MGTA 3TDZC 3HSFA 4I0AA 1YYVA 2STTA 2CFXA 1FP1D 1WRJA 3M8FA 1O57A 4CYDA 1FPQA 1O3TA 2EV6A 1BM9A 3F8CA 2QLZA 4IRIA 5L3GA 3F23A 2AXLA 1UHWA 2F5FA 1Z7UA 2FRHA 1EV7A 2V6CA 2D1VA 5DCMA 2LNBA 1O3RA 4NB5A 3WGGA 3AAFA 4MNUA 5FFZA 3V8KA 2MLGA 4HQEA 3ROUA 1SFXA 5ERIA 3IRRA 4XLPF 3GO5A 1E2XA 3LWFA 4CICA 4L9NA 3ZN0A 3R0AA 4RB1A 1FBUA 4IRHA 3DF8A 1KGSA 3G73A 2FMLA 3WE2A 3LQRA 1IXRC 3F72A 3V7RA 3WG9A 2XRNA 3RKYA 1R1VA 4G6DA 3GVAA 3I5UA 3FMQA 2EFNA 4MEYF 2WV0A 4A6EA 2NYXA 2O6GE 3E97A 2KIUA 3K1MA 1B59A 2A61A 2O0YA 5L3CA 1D8KA 2TDXA 3EDPA 5HS8A 4K2EA 1B6AA 4LFUA 4EGZA 5DV5A 5EEHA 2ESNA 4G8XA 3WGIA 4ESJA 4KMUX 3QPHA 3CUQB 1FBSA 2XKOA 3EYYA 2RN7A 4I01A 3GX4X 2DW4A 1J0RA 2P5KA 1XGMA 2ZNZA 3MQ0A 2ZMEA 2M8EA 3R60A 3GEZA 3ZMZA 3DFGA 2OAZA 4PDKA 4ASNA 4OMZA 2Q2EA 3RYRA 3IKTA 2A6EF 1KU9A 3FF5A 3FXRA 1FY7A 4ENNA 3TO9A 4EJOA 5HDKA 3TOAA 2FU4A 3SQNA 3ECHA 4M6XA 2NRAC 2H6BA 2CQKA 3WU0A 2QBYB 5HLIA 1LDKB 2CSOA 4LB6B 3MEXA 3PFIA 4ZYDA 1XCVA 4JBAA 3I59A 1G6NA 1ZHFA 1SD7A 4OU0A 3K9TA 3MAJA 4RAYA 4EJTA 3E6BA 1SMTA 1I1SA 3QP5A 3LA7A 2CW0F 3I4PA 3M7GA 5LLQA 4HQMA 1SD5A 5HVQC 5LHIA 4IHTA 4UVAA 3LSTA 1JHFA 2M45A 4N0BA 3F8BA 4H0EA 2OD5A 4GO1A 1RI7A 3VODA 4BYYA 1MDMB 3DEUA 1O7LA 2FA5A 3RDIA 3HRMA 1V3FA 6PAXA 2DK8A 2P6SA 4I02A 2J5OA 1CGPA 2MLKA 4ETSA 2VC1A 1YW7A 2PEXA 2V1UA 1B4AA 3KP2A 2UZKA 4QLCU 4P55A 1EH6A 3HSEA 2FSWA 5CVUA 4GYIA 4YG2F 1FBQA 1R5GA 4L9JA 2DLLA 1J59A 4L9VA 4OIQF 5E1XA 2XAGA 1XGOA 2H27A 4ZH4F 5HLHA 3R61A 5JI6A 3O3KA 3GFMA 3F21A 1S29A 1O3SA 1P4WA 2XIGA 1CF7A 2G7HA 3KP6A 1EH7A 4EM2A 3FMRA 2JSCA 1LQ1A 2GA1A 1UCRA 2VBWA 2XGXA 2HYGD 2K27A 3KEOA 5DEQA 1KYZA 1OPCA 2OZ6A 3C18A 4A0XA 4HYEA 1TNTA 4G7ZF 4YFNF 4Y15A 2M5WA 4Z2YA 2GZWA 1BI3A 4M9XA 1P2FA 2Z3YA 4YFKF 3KEQA 1RZ4A 2V1XA 3OOPA 3TQNA 2PJPA 5HDNA 5L3EA 1O7FA 4I7HA 5HLGA 3P7NA 2L3DA 3CUOA 1FYMA 4UV8A 3J80Z 2X0LA 1P4AA 2OA4A 5BPIA 4I98B 1R23A 3IHUA 3WODF 4FX4A 2GA2A 4LB5A 1GHCA 2XASA 1DPUA 3WTWC 4A5MA 2PN6A 1Z6RA 1XCBA 2EWNA 2ETHA 3U2RA 1I27A 3VFZA 3HYIA 3IWFA 1XD7A 1YQAA 2XKPA 4JK1X 1D8JA 3SFZA 1W7PD 3KP5A 1SMYF 4B09A 2D45A 2VE8A 5FO5A 2FBKA 1Z91A 3LQQA 1ZGJA 4CDGA 1BI0A 2FE3A 4A0YA 4IXAA 4FT8A 5D8LB 3S2WA 1G3YA 3ZMTA 2A68F 4HX8A 3WTYC 2P7CB 4CHUA 3M1EA 1ZLKA 3QPTA 1R7JA 1AOYA 5H6RA 4RAZA 3EUHA 4BHCA 4M9ZA 1U6GA 5E1WA 3I59B 1I6XA 4KT5C 3GZ5A 3KLOA 1JHHA 3D5LA 4PZJA 2F5EA 3JSPA 4ESFA 2P6TA 3RKXA 1J2XA 4L0YB 1PDNC 2MD5A 2ISZA 3MCZA 3QU6A 1I1GA 3E6CC 3O2PE 4MTEA 4AD9A 1LEAA 5FGMA 5EEGA 3F6OA 2E7WA 1U3EM 3L7WA 1ZGAA 1U2WA 4HDVA 3FXQA 2W25A 4L0ZB 2A6HF 1QZZA 3DV8A 3L2CA 2DU9A 1K78B 2HGCA 2M1BA 3GWZA 5BQTA 1P6RA 2ISYA 2X4HA 3KP3A 2RVCA 1YO5C 3F3XA 2HWVA 1KU7A 1STZA 1I5ZA 3CO6C 5D6EA 2L02A 1HXDA 2STWA 1Z05A 2BV6A 1XB4A 2R7DA 2B0LA 2DQRA 4N9HA 4EVIA 4LJZF 5FD6A 4R1HA 5F64A 2FQ3A 4M6YA 3TO6A 3M8EA 4MGRA 3H3ZA 3U1DA 4Q4ZF 4BH9A 4KFCA 5D6FA 4GCVA 5DUIA 4M71A 2Y48A 4RB0A 2E1CA 1SAXA 1U5TB 2H09A 3GUDA 2EFPA 2FNPA 5D5WB 2P4WA 5ICCA 5E17F 4WX9A 3IKVA 4EQQA 4M72A 4BQAA 4KN4X 1LEBA 3J81K 1ZAOA 5IT9Z 3ABTA 1ZYRF 4O6JA 1S6LA 3GYHX 1U78A 2Q8KA 1R00A 3Q9VA 4AIKA 2A07F 2YSRA 4EM1A 2HFHA 2EFWA 3HIFA 1MZBA 3RTRA 2W24A 4LG0A 1T2KA 3QRFF 2XV4S 3P9IA 3E5UA 1REPC 3MZYA 4R8HA 3ML6A 3R0JA 2ZKZA 2L4AA 5A2QK 4YIFA 4EMSA 1XGSA 2IVMA 4WK8F 3OV8A 2E7XA 3CJNA 3HOSA 5E8GA 3RI4A 4Q47A 2IP2A 4KNYA 5DD8A 3DPTA 2EFOA 1B9NA 3GFLA 4A5NA 2FF4A 5J6XA 1ZG1A 1DDNA 3JSOA 2K7LA 3CDHA 5E8IA 3BPVA 2DPUA 3MZHA 4P9UA 1BI2A 1MJAA 1WSUA 2PMHA 1HSJA 2RDPA 3MFKA 5TJJA 3T8TA 2DBBA 4HW0A 3R4KA 1FSEA 3BPXA 4HV5A 1IRGA 5DD4A 2KJCA 4ON0A 3KE2A 2CG4A 3NRVA 1G3WA 1IW7F 1LNWA 1RUNA 2RNJA 3EETA 1YS6A 2R7FA 3T5XA 4MQ9F 3ZMVA 1RUOA 3WTSC 3O6BB 4HF0A 3K69A 1G4DA 2K02A 4KMFA 5AONA 3BJAA 3SXYA 3K1NA 2DT5A 2VN2A 2MA3A 4EM0B 4ZYEA 1T98A 1UFMA 5CLSA 5D5VB 4OIRF 2XAFA 5K1YA 4L18B 2UXNA 1USTA 1YLFA 3LAPA 2GWRA 1QNTA 5LHGA 4O5VA 5DDGA 4RB3C 2MC3A 1L0OC 2YR2A 5HDGA 4CZZA 5CVVA 4Y13A 1XMKA 3C7JA 4KICA 5ICGA 5CJ9A 3BDDA 1ZRCA 1W7PA 1QPMA 1DUXC 2Z5UA 3HRTA 1KA8A 1YG2A 3L09A 2RKHA 4CGZA 2MBFA 1YW8A 5F6FA 3V8JA 1R1TA 3RJPA 3ZMUA 2WC2A 4OIPF 2HZTA 4WXCA 1Z9CA 2EV5A 5ILSA 1FT9A 4HBLA 3G3ZA 1HKQA 4IVNA 4FX0A 1U8RA 4EJWA 1H0MA 2IA2A 2VBXA 3V7SA 1YTYA 5D8KB 3ZMDA 1HBXG 4MQVA 1YFHA 2RGVA 4NHJA 1H9TA 1HW2A 3BJ6A 4RGSA 4BHPA 2IRFG 5FLXK 1B1BA 2F5CA 3SZTA 4UVCA 3BWGA 1F5TA 5ILUA 2XHKA 4KDPA 2NAZA 2VOOA 5FLXZ 2RV8A 4GGGA 1IN8A 1OYIA 3BJOA 1PP7U 1KQ0A 1XDUA 2EK5A 3VOEA 2FBHA 4BXUA 5DCMB 1B9MA 1S3JA 3IL2A 1SD6A 1R36A 3GW2A 3IRQA 1UB9A 5CVRA 2MH2A 5D5XB 3KETA 5IT3A 2QQAA 1WQ2A 2Z33A 1QGPA 3BOQA 5BOXA 2ZJ2A 1ZH5A 4G94A 4MEXF
chains in the Genus database with same CATH superfamily
1U5TC 2MGQA 2AQFA 3HSRA 4FQGA 2YU3A 3MKLA 3ZPLA 1AKHB 3Q5FA 1TQIA 1BR1A 1GLNA 1Q1HA 1BC8C 2LSOA 3A0HC 3KFWX 3DTKA 5M5XJ 3V4GA 4M3EA 3S8PA 2LF8A 1S5LC 4CCOA 1BI1A 5HNFA 2UXXA 1VQ9I 4PJLA 1U8BA 3QP6A 4HX4A 1U9OA 3ZGKA 1Q1VA 5BMZA 3H3VK 5K7ZA 4Y52J 3KZZA 3VSKA 3VDXA 3CTAA 3A1YA 1L3LA 3PO2J 3M8JA 3GTKJ 3OS1A 3G1LA 1R49A 4DNCA 1IN7A 2F2EA 2EFQA 3LNQA 4WCGA 2HYFA 2R7XA 4C30A 2XSJC 2IS1A 2C6YA 5F27A 2BE5F 1TWCJ 3G71I 1FOWA 4BL0B 2DMQA 2L0KA 2VPRA 3WTUC 4FASD 3PNVA 1R9TJ 3QPLA 1YJNI 1IG7A 4U7BA 1TW3A 2JA7J 5B1AH 1HDPA 1WWXA 2ZMEB 2PQ8A 1DPRA 3I56I 3HUGA 1ZTRA 1IRXA 4HZFA 1IC8A 1LFUP 1QZYA 4HNUA 3H35A 1P7IA 3RPUA 2Q2EB 2FBIA 2JMWA 1YX3A 2IA1A 3OYFA 2COBA 1RRJA 1KQ9A 1QBJA 2AQEA 2OZUA 4A6DA 4A3DJ 1WI9A 2QVOA 4IHVA 3GTQJ 4KIFA 4Y4RA 2IS6A 4BAYA 4P5OA 3FM5A 3ZXSA 5DYMA 3COAC 1LDDA 3N4MA 1HQCA 4L5IA 3FDYA 5DUKA 5GPAA 1D1CA 4OINF 2R7WA 1ZG3A 4YIRX 1TLHB 5LBQA 2EILH 4U0WA 2CRGA 4BBRJ 3PQJA 4FHTA 4A69C 1P92A 2K3FA 2BBYA 2XF7A 3JRAA 2O61A 4DQ2A 2R0QC 4XOTA 4HF2A 5FRMA 3PL8A 2LKPA 3IP4B 2Z1DA 1TWFJ 4XLCA 2BOLA 4U0VA 4XLFA 3T0YA 5E20A 4WXDA 2PI0A 3S16J 2XPUA 1VFCA 1SFUA 4FTHA 3MKZA 1VZ0A 1G3TA 4BACA 3DKXA 3CUQA 3LSPA 2QF7A 1DGWY 1MH4A 2O3FA 5K5RA 3EPZA 4XSZF 3CCQI 1X2MA 2YX7A 5F08A 4Z6YA 4HLYA 3DKWA 3MWMA 1T0FA 2KRFA 3BP8A 3PFYA 4QWQA 2W48A 3LAJA 3ASNH 2MH9A 4UB8C 3FKIJ 3C3WA 3FISA 1T38A 2R5ZB 5H20A 5EEAA 3JRIA 1EJ9A 4DZPA 3HOYJ 3ERMA 2BXZA 5HOOA 3A4CA 2CGPA 2AHQA 2EJRA 1E3PA 1BOAA 2BXYA 3SZPA 1Y1VJ 3TOBA 4OAZA 3FHNA 5E3MA 1W36D 2PMUA 1E0EA 1J9IA 3BQZA 1WCMJ 5EJCA 4F92B 1P4XA 2RAEA 2W82A 5LGUA 2VT3A 2KIFA 5CYVA 5HS9A 3M4OJ 5FLVA 3CMAI 1AA7A 2HYJA 2M87A 2XRLA 3KP4A 3F0CA 3BTIA 2L7ZA 2QBYA 2V4JC 2WADA 4RBOA 2NXNB 1MBFA 4IJAA 3KZIC 3HRSA 1S8NA 4G7HF 3HPHA 5K5OA 4I2OA 3S1NJ 3PNYA 1XSXA 1UHSA 4EV0A 2Y30A 5LEJA 5E18F 5J47A 3QOPA 2LF7A 4A12A 2LBFB 2DK5A 2EA2A 1IN4A 2HQNA 3KZYA 3H9QA 3W6JB 1K4SA 3E5QA 5EG0B 3JRHA 3KPHA 2OTLI 2HXOA 2GIVA 1C0WA 4XKCA 2FOKA 2ZXJA 5EF6A 1IRFA 4V2GA 3ZN1A 3RQIA 3GTPJ 1ZLJA 3DCFA 2OQRA 5B66C 2X85A 1K79A 5M5WJ 1DP3A 5J1UA 4AIJA 2HS5A 2Z2SB 3LA2A 2HVSA 4U7DA 4L5JA 4RA2A 3ZQGA 4BJ5C 3HC7A 5IYCJ 1CF7B 1O3QA 3PUFA 2QQBA 4NUBA 3BR5A 4ZYHA 1XDSA 3RYPA 2JPCA 1VQ7I 1MD0A 1ACIA 3T8RA 5M5YJ 2VKVA 2F4MB 5E3OA 4QTRA 3K0LA 4A2UA 1IXSB 5C4XJ 3E7LA 1WH5A 1LJ9A 4B48A 2HPIA 2PJRB 3MMYB 3SHFA 1MDMA 1YRNA 3WHCA 2Y31A 1V4RA 4E70A 4KN7X 1FP2A 4RB2C 2HOTA 1X3UA 4DIQA 1ONVA 1TW2A 2XAHA 4H4KC 2CYYA 2NS8A 2HXIA 2DA4A 4ESBA 2IJLA 4HSRA 1K83J 2JA8J 2QZ8A 1SFEA 3K1PA 5DM7F 2XGEA 2CMPA 2RQPA 3KLNA 2EB7A 4M6VA 3J81Z 3W2AA 4HEA2 5LFAA 2ZNYA 3FZVA 2BGCA 4PJJA 4XQFA 3DPUA 3QOEA 4B8XA 4LIVA 2Y0MA 2K4BA 3NQOA 5LGTA 1XSDA 1OR7A 2ID6A 3DKYA 1FZPB 3EQLF 3FBIB 3BR1A 1G3SA 4C3HJ 1BN5A 3HGGA 4RS8A 2DOAA 1EKEA 3AFHA 4MHGA 3HOZJ 2ECCA 4KA4A 2P8TA 2BY3A 4AWXB 4IO9F 5J3LA 1FIAA 2ELJA 3FWEA 3I54A 4AVPA 4HX7A 3LA3A 5JVGF 4XR6A 1D5VA 4OIOF 5JVTA 4CYCA 2XDVA 2ZO4A 1TQMA 2GXGA 2P81A 3C2GA 4UB6C 3TL4X 4ZDOA 2FMYA 2L9SA 3QAHA 3GTGJ 4RGUA 2ESHA 1XMAA 4AIHA 1BIBA 2UWMA 4U0YA 5IYBJ 3P9KA 2E1NA 3OOUA 5A2QZ 4XLNF 5HS7A 1KU2A 1UJ8A 4AYBA 5M3MJ 1GXQA 2XROA 2MD0A 1SANA 1N77A 4JP0A 1OMIA 1HC8A 1F9NA 4ITVA 3QWLA 2W85A 2JA6J 2DFEA 4M73A 3HGYA 2PFBA 4WF2A 3NEUA 4OAYA 2H8WA 5IOZA 4NBQA 4Q48A 4ZC3A 2M2EA 4BNCA 1MBHA 2DODA 3CCJI 4II2A 2EIJH 4JYKA 3H92A 4CXFA 2ZXIA 3E0JB 2JUGA 2LTPA 3P9CA 1LE8B 2A69F 1ORKA 3IH3A 1HCRA 4IRGA 2A3SA 1JGSA 2A5WA 3GZNB 1J5YA 1W4MA 2KJBA 3BROA 1PYVA 5JHUA 4M3DA 4XRFA 2YPRA 5CKTA 3JRBA 4BE1A 2HDCA 1RR8C 1JE8A 4L9TA 3ECOA 2G7UA 2DT6A 2VBYA 2ECBA 2L4MA 4DYCA 1X2NA 5BPDA 5E3LA 3HM5A 1B72A 4DBQA 1RIOH 1X3ZB 4XNFA 3BZ6A 2Q1ZB 2JK3A 4I0BA 4DGWB 4CSWA 2QYOA 3IAS2 1OYWA 1LVAA 3CLOA 4N9IA 1V54H 1D5YA 3HL2A 2X1EA 3H3UA 2E2HJ 4NC6A 1K7AA 3HHGA 1OYYA 3WTXC 3Q9SA 2G0EA 2A5YB 1UHMA 3L9FA 4IKFA 1FC3A 2X1CA 3ABMH 2DO7A 2HKXA 3DQVC 1ETKA 5K5QA 4ENJA 2VXZA 1IAWA 3J7AO 4KIBA 1WI3A 2CH0A 4I09A 1EH8A 3RSNA 2E2JJ 3HOWJ 4RGXA 3PIOF 2NVTJ 1QHGA 1Z67A 2DAOA 5L3FA 1ZG5A 2I5UA 3GFIA 3KCCA 3C2BA 3A2KA 1NH3A 3WE3A 1PUEE 2M0CA 2R3SA 2EA4A 4D1QA 5IP6A 2ZJQF 2L54A 1JJ6C 3CD6I 2Y75A 4LGWA 4IPAA 3ABUA 3BG6A 2HPMA 2W1OA 1H9GA 2X1DA 1JGGA 3WGHA 1VQLI 2LVSA 1WJCA 1WVRA 3GXOA 4HPQA 2BHZA 4RLQA 1T56A 3K4NA 3TDUC 4C9YA 2DYSH 3HDDA 4F52A 4HNVA 1H89C 1T39A 3GZ6A 3TBIA 1W5SA 2EH3A 1WKMA 5L3DA 1OCOH 4P1WA 4KITB 2WAQN 3OR2C 3OL4A 3CO7C 2I8DA 2F4OB 4D7NA 1U0JA 2MC4A 2ELHA 1HSTA 2CUFA 4OWRB 2LKSA 3CMMA 4ENKA 3DXJF 1BW5A 2E71A 1UG2A 4YFXF 3N97A 2XAQA 3E6MA 2DFIA 1KU3A 3OSGA 1HOMA 3QODA 1X4PA 1ODDA 2CUZA 2LY1A 5KK1A 2K9SA 2JT1A 5EZHA 3B02A 3C1DA 2QUFA 2DA6A 2VB6A 3FX3A 1Z1DA 1FOKA 3ZCOA 3L00A 3F6VA 4G7OF 2VPLA 4OMYA 3HHHA 3WTTC 3CJQB 1IDZA 2Y0SN 2KQRA 2QWWA 4RMNA 3DLLF 2EZKA 1SAUA 3M9AA 1VQKI 3WTZA 4CO8A 3K4MA 4EJUA 4XICA 4A0ZA 2PBIA 2KMUA 1N75A 4BHBA 1G59A 5CVIA 3RKWA 2JRMA 4JX6A 1IN5A 5F0HA 4II3A 2XC7A 1GXPA 2CW8A 4XMYA 4IQ4A 1MMNA 2IW5A 3TW6A 4BQOA 3EYIA 2EZHA 2QQ9A 2LH9A 2QM3A 3CDLA 3D5RC 4PJNA 3SZGA 4LLLA 3HOXJ 4AVZA 2DPDA 2R92J 1FX7A 4LMYA 1VQOI 5CVJA 1WJBA 1G2HA 4QPOA 5KAFC 2LK2A 4G12A 1F1ZA 2GQQA 5LRSA 2F5VA 1S7EA 2HR3A 3M1CA 2MW8A 4Y7NJ 1ZREA 3PIPF 2DI3A 4JOMA 2XVCA 5J8FA 2WAEA 1A04A 1FMVA 2K4JA 2VOPA 1ETOA 3BY6A 3VEPA 3FIWA 5D4RA 1AHDP 2ME6A 1ETQA 1NG6A 2DFHA 2OUMA 3MD2A 4BUPA 1FLIA 4Q5SF 1Y6IA 1X1BA 2MFZA 3LMMA 4DYRA 2DMPA 3I0TA 2QA4I 3S1MJ 3Q0UA 2PG4A 1ZQ3P 3B73A 4W97A 3PQKA 1K78A 1GVJA 2R5YA 3BTLA 2O7OA 2Q0OA 3JW4A 3CC2I 4EEFG 2EBIA 2VODA 2CO5A 4LK0F 2GXBA 3OYBA 3L2VA 5BS6A 4QPQA 1VQ6I 4M9SA 3LSHA 5BNGA 2BYVE 3S32A 3ISPA 3FK6A 4A3FJ 5FFXA 4HNTA 2KFDA 3IC7A 1JKRC 5EDNA 4XIDA 2H94A 3DP7A 5FJ8J 5K7FA 3I53A 3CCLI 2WY8Q 3HTSB 3IWZA 2XB5A 2X6WA 3F8MA 3NWTA 2VBZA 4PUSA 1IN6A 3LFKA 2WB1A 2IPQX 3A0BC 2V9VA 3SEQA 2ICWG 1TBXA 2HQAA 2YX4A 4UXNA 2VE9A 3CCRI 2XPVA 3N05A 2XF6A 1XGNA 4ZYGA 4PCQA 2VUMJ 3QU3A 1TZLA 4LG0B 1TTYA 3CJTB 2HTJA 5HLTA 5LD2C 1I6HJ 1I3QJ 2JZYA 4CYCB 3CLQA 1IF1A 2L01A 2R7ZJ 2QEXI 1KYWA 2HOEA 2JJ7A 1UG0A 3J7ZI 2P5LC 2R7TA 4Y17A 5TRDA 2KLOA 3KP7A 1TT5B 5EZGA 3PNTA 4XRSA 1R58A 1U5TA 4BJTA 5AIQA 2RC4A 2X48A 1ON2A 1QHHD 2VQGA 3J7YJ 3TKYA 4A3JJ 2QENA 3UNGC 4ZZDA 2L2OA 1VQ4I 2M4KA 4UV9A 4XOPA 1LDJA 5LHHA 2HI3A 3DBHB 1R1UA 5KVRA 1BL0A 1V55H 3I58A 4IX7A 5CQEA 1J7KA 2F5DA 5JFRA 1F4KA 4LIUA 4UVBA 3F8FA 5D5UB 1PJRA 2D2WA 3JRCA 1W0TA 2CWEA 4UY8I 1IZ1A 5ILVA 5GPCA 4E7LA 1T33A 3LOCA 3U9GA 4LK1F 3HPGA 2LD5A 4QIWN 2VONA 2QQ8A 4EATA 1FYKA 1MJ9A 4LLGF 2CV2A 4S04A 2Y9ZA 2NOGA 4ZZLA 4OOIA 4MTDA 2EV0A 2HQRA 3JRDA 1MMGA 2VC0A 3ERED 2A05A 1V5EA 3LL7A 4E7IA 1YW9A 4IF4A 1A6QA 2HDWA 3I64A 4RM2A 2HEOA 4BEHB 3V7CA 4XORA 1Y8RB 1B72B 4KYWA 2DTRA 5EGOA 4HLXA 2LDUA 1IXCA 1VQPI 3ONQA 5C44J 3J80K 3RZDJ 4CCKA 3E1SA 1Z21A 2KISA 1R5HA 1ZR2A 1X3WB 1TNSA 5EYRA 2FEZA 2ADUA 1HW5A 2D1HA 3WTVC 2VJ5A 2D5VA 1E17A 5J8CA 1NHAA 4XBFA 3G4SI 2BEOA 1XSVA 1ETVA 4S05A 3CF2A 3S2DJ 2W84A 3JTHA 3JREA 4EGYA 2R7UA 3H1CA 2OQGA 4E7KA 1DU0A 4M3GA 5FD5A 4UHTA 1T8IA 3HRUA 2O8XA 1PP8F 2M7AA 2PMZN 1FSHA 1W5TA 2HKOA 2M30A 4M74A 1VQNI 4AC0A 4N4OB 5FKOA 3ZQ7A 1QQIA 1R71A 1R22A 2BVMA 4RGRA 3TGNA 3W2VA 3O8HA 3K4KA 4PGHA 2IA0A 3K70D 5J4YA 3W6VA 4HAMA 2J5PA 3PM1A 1ZRFA 1OISA 2GLOA 2L7KA 4S0HB 1ZELA 4A3CJ 4KUMA 4R79A 4IHSA 1HKTA 3ZQIA 5KNLA 1VTNC 3F8NA 4C2TA 2DJIA 4F55A 1HW1A 4G6QA 1BJAA 3BC8A 2IGMA 1OJLA 2GBYA 3FMSA 2JRTA 1JT6A 2OU2A 2R7OA 4PFPA 2H1LA 4NQWA 3QYBA 3S15J 1K6OA 3CP8A 3GF2A 5LRRA 5LGNA 2LG4A 1LFPA 4GYGA 2FJ1A 1A31A 1MJBA 3GTOJ 2DA5A 4DJAA 2M34A 1RNLA 2HZDA 3F22A 2XSDC 4XK4A 5AIPA 3T1BA 4PGGA 3HKZN 3L2UA 2R7SA 2VT2A 1Y0UA 3ASOH 5E79C 3A01A 1JKOC 3ZMSA 2NS0A 4CCNA 3GTLJ 2DQLA 2V26A 3HZJA 4B1RA 4HA8A 4JX4A 2JPBA 2KIQA 1J75A 3CCMI 3V8LA 5E1ZB 1W7PB 4LD5A 4HOBA 3I4MJ 5J4VA 2ZFWA 5H6QA 1D3YA 1ON1A 1Z6TA 2AXTC 3K2ZA 4U88A 1XN7A 2NNNA 1LB2A 1S7AA 2Y9YA 3H5RA 3GLXA 3MKWB 2R4GA 4XSXF 2O03A 2KIMA 3OYNA 2ACJA 2K86A 1YJWI 2KKOA 3KYLA 2JTVA 2P7VB 3JTGA 3K10A 4D9JA 3HG9A 3RIRA 4B3XA 3EUHC 3E6DA 5LEKA 3DTIA 3HTUA 4HV6A 3EUAA 4KIGA 3CCVI 2COMA 1MBGA 4P96A 3EUKL 4WXHA 2FD5A 3RPQA 3JAMK 5IY5H 1WJEA 2E19A 3HOVJ 4F93B 3LSMA 3W6KB 1ZARA 1Z3YA 3FHZA 2F4IA 1TQPA 4C3JJ 2W4SA 5FKLA 1ULYA 4D7MA 2Z99A 1FMWA 4YELA 3JAMZ 1ITYA 2ZCWA 3E3VA 4O3MA 1IUYA 2CV0A 4AM3A 2XUBA 1T6SA 2BZTA 1ZN2A 1MBKA 4F7ZA 1DP7P 5ICEA 5D4SA 4CH7A 4N4NB 4BXFA 5JLXA 3DPLC 4YIIA 3CUQC 4XLEA 5ED4A 2GOMA 1SD4A 4HDUA 2F48A 3REOA 5FB2A 5ICFA 4WWCA 4AU7A 3R6SA 3OIPA 2W57A 2R5YB 2GAUA 2LOOA 4LG3A 3CCUI 1VI0A 1BC7C 2HTSA 2DT7B 4LLNA 2OTJI 1TT0A 2O5RA 1MNEA 1HKSA 3OIOA 1OKRA 1PUFA 2TRTA 4P9FA 3AL0C 3I71A 1H88C 3SYTA 5JR3A 2IGKA 3JRGA 1YS7A 1LFBA 3S14J 2HDDA 2LY2A 2IT0A 2DDBA 2LP0A 3LSKA 2H6CA 1FWZA 1JXSA 2KDZA 1YIOA 3GFJA 5KCMA 3S3OA 1IGNA 4UUVA 1VQMI 3DU5A 3FXUA 1OCPA 3VYSB 2P5VA 3WU1B 1X19A 2FXAA 4JQFA 3RKQA 5F04A 1FNNA 4IQJA 4HF1A 2XAJA 1S7OA 5F1RA 3D0SA 2BVLA 3ELKA 2AS5F 4GXOA 5L3BA 2FNAA 2ZBKA 3IH2A 2ZJRF 1AWCA 4XRSG 3HOTA 1Y0NA 2FOWA 1OCRH 4LOCA 2L9NA 3TO7A 4CA0A 3ULQB 4UNOA 2DTZA 2DOEA 4D0PA 3S93A 2V1DA 1BBYA 2LLKA 4BY7J 3VB2A 2EIMH 2PLYA 2OBPA 1BOBA 1KQ8A 4G9YA 3PSIA 1R4MB 2JVGA 2NNYA 4HRIA 3E5XA 2G9WA 2L7FP 2NS7A 4ZTFA 3FM3A 3ZP5A 1FYLA 4ENMA 5IT9K 4EJVA 4Y33A 2WTEA 5DCFA 2KRCA 1LPQA 2QSFX 1QO0D 2W00A 1MKMA 2Z9OA 1NK2P 1USSA 4TV7A 4A3MJ 2V9PA 2V79A 1BIAA 2LY9A 2WWYA 1MGTA 3TDZC 1ZRDA 5FRNA 2WV1A 3HSFA 2L7MP 4I0AA 1YYVA 2STTA 2M0MA 4IL6C 2CFXA 2O8KA 3LSGA 1FP1D 1WRJA 3M8FA 1O57A 4CYDA 1FPQA 1IV8A 2CFOA 3W2WA 3CCSI 1TWHJ 1O3TA 2ZXWH 1MSEC 1D0XA 2EV6A 1BM9A 3F8CA 3OYEA 3VYRB 2XB0X 1JTYA 3CC4I 1N78A 5EGOB 2QLZA 4D5CA 4IRIA 5L3GA 2CUEA 1B8IA 3VWBA 3F23A 2AXLA 1UHWA 2F5FA 1Z7UA 3BZCA 2FRHA 2XGDA 1EV7A 4IHXA 4XKWA 5DS9A 2V6CA 2D1VA 1TC3C 3I55I 5DCMA 2LNBA 1APLC 1O3RA 3OYIA 4NB5A 1T08B 2DDAA 1RETA 3WGGA 3AAFA 1LKXA 3K7AJ 2E34A 1OR7C 2Y69H 4MNUA 1JKQC 3WG7H 5FFZA 1MSFC 3V8KA 2MLGA 4HQEA 3DWLE 2BHYA 3ROUA 1SFXA 5ERIA 3HUGB 3IRRA 4XLPF 2EZLA 3GO5A 4ANJA 1E2XA 4A3LJ 3LWFA 4CICA 4L9NA 3Q0VA 3ZN0A 3R0AA 4IEJA 3X2QH 4RB1A 1FBUA 4IRHA 3DF8A 2R7QA 1KGSA 3G73A 2LREA 2FMLA 4PK4A 3WE2A 3LQRA 4ABZA 1IXRC 1VQ8I 3F72A 2BW3A 2IS4A 3V7RA 3WG9A 1X58A 4C2UA 2XRNA 2EINH 4KT6A 3FKJA 3RKYA 1R1VA 4G6DA 3GVAA 1V5GA 3H5AA 1AKHA 2QSHX 2GXAA 2V6EA 3I5UA 5TISC 3FMQA 4BU2A 2EFNA 4MEYF 2WV0A 4NQWB 4A6EA 4CCMA 2NYXA 2O6GE 3E97A 5FKNA 2WA0A 3BZKA 2KIUA 3ZQQA 4X6AJ 3K1MA 1B59A 3TMOA 2A61A 2O0YA 5L3CA 4KISA 1D8KA 2TDXA 2V7FA 1SVLA 3DEWA 3EDPA 5HS8A 1X1CA 3NWSA 4K2EA 1B6AA 4LFUA 4EGZA 1QA6A 1F43A 5DV5A 1OCCH 2K40A 4XKBA 5EEHA 2ESNA 4G8XA 3WGIA 4ESJA 5E3NA 2LFBA 2HNHA 4KMUX 3QPHA 3CUQB 1FBSA 2XKOA 2XGCA 4BQQA 3EYYA 2RN7A 4I01A 1S72I 3S17J 1X1AA 1VF9A 2FX0A 3O8GA 4UUSA 3GX4X 2DW4A 2PX9A 2KZVA 1J0RA 1I50J 1WGXA 2P5KA 1XGMA 2DCEA 2VQHA 3I4NJ 3KYCB 2ZNZA 3MQ0A 3AL0B 2P0WA 2ZMEA 1W5CC 2M8EA 3R60A 1WH7A 2OPTA 2IGOA 1LVKA 3LSIA 3GEZA 1JUSA 1Y8QB 3ZMZA 2VASA 1OFCX 3DFGA 1Y56A 1UELB 2OAZA 3MN2A 4PDKA 1MBEA 2Q2EA 4OMZA 3RYRA 4ASNA 3IKTA 2R7VA 2A6EF 1KU9A 3FF5A 3FXRA 1NK3P 5GP9A 1FY7A 4ENNA 3TO9A 4EJOA 2VJJA 5HDKA 3TOAA 4C3IJ 1YJ9I 3BG7A 2FU4A 3SQNA 1PVEA 3S1RJ 4IHYA 1D1BA 1P7JA 3ECHA 4M6XA 2NRAC 2H6BA 4DBRA 2CQKA 2OF7A 3WU0A 2QBYB 5HLIA 5IPAA 1LDKB 2CSOA 4LB6B 3L1PA 2DYRH 3MEXA 3PFIA 4ZYDA 4A3GJ 1XCVA 3H0GJ 3FK7A 2M8GX 4JBAA 3I59A 1G6NA 1ZHFA 2WY7Q 1SD7A 2L9RA 1QVTA 3F9KA 3H9GA 4OU0A 4ZYAA 3K9TA 3MAJA 4RAYA 4EJTA 2PMZA 3OSFA 1PUFB 3SDGA 2VQCA 3E6BA 1SMTA 3IAM2 3MVPA 3Q0WA 4U87A 1I1SA 2HU9A 3A02A 3QP5A 5DM6F 1XPXA 3LA7A 2CW0F 4ZDPA 3BCAA 1XX5A 5CPRB 1TP4A 3I4PA 2CV1A 3M7GA 1S9HA 5LLQA 1DU6A 2ME0A 4HQMA 3DBRB 5K7HA 3CDIA 1SD5A 5HVQC 1LUJB 1XS9A 5LHIA 4IHTA 4UVAA 3LSTA 1JHFA 1NG7A 2M45A 3BLYA 3NARA 4N0BA 3F8BA 3QYFA 2K9NA 1X1DA 2RNGA 4FISA 4H0EA 3KIOA 2R7RA 2OD5A 2B63J 3CCYA 4GO1A 1RI7A 2ELKA 2F6CA 4F91B 3S3MA 3ZQHA 3VODA 2R5ZA 4BYYA 3OWTA 2QKMB 3DEUA 1MDMB 3CESA 1YRNB 1O7LA 2FA5A 3RDIA 3HRMA 1V3FA 6PAXA 2DK8A 2DA3A 2P6SA 4I02A 3ABKH 4BQNA 2HOSA 2OJED 2J5OA 2XAUA 1CGPA 1ZK8A 4A3IJ 1E3OC 2MLKA 1UAAA 4XONA 3S3NA 2DFFA 4ETSA 2VC1A 3BG5A 2AO9A 4BKXA 1UMQA 1YW7A 2PEXA 1E3HA 5M3FJ 3J7AY 2V1UA 1B4AA 3KP2A 3OYLA 3K4CA 1A5JA 2UZKA 3SEZA 4QLCU 3PUBA 4P55A 1EH6A 3HSEA 2ZSHB 5J1YA 2FSWA 5CVUA 4GYIA 2E1MC 4MIMA 2OCEA 4E7HA 5CQGA 3I9V2 4YG2F 2LYCA 4X0GA 1FBQA 1R5GA 2LBFA 1R5ID 4NNJA 1BR4A 4L9JA 2DLLA 1J59A 2Z16A 4L9VA 5EG0A 2X6XA 3WU2C 4OIQF 5E1XA 2KT0A 2XAGA 1XGOA 3JRFA 2H27A 2E36A 4ZH4F 5HLHA 3M3YJ 3R61A 3HBLA 5JI6A 1VNDA 3O3KA 4HSTA 1YOVB 3Q3SA 2L5QA 1B8IB 3GFMA 3F21A 2VXDA 1S29A 1O3SA 4CCJA 1P4WA 2X51A 2XIGA 1CF7A 2G7HA 3OYAA 1OCTC 3KP6A 3BR0A 1EH7A 4EM2A 3FMRA 2JSCA 1LQ1A 3A03A 2CQXA 2DOFA 2GA1A 4XM3A 1UCRA 2VBWA 4DZJA 2XGXA 3B6AA 1RC9A 2HYGD 3GLLA 4BGDA 2K27A 3KEOA 5F0CA 3OYMA 2QSGX 2PJRA 5DEQA 1YE9A 5FKMA 1XC5A 1KYZA 4BS9A 4A93J 1OPCA 2OZ6A 3C18A 4A0XA 4HYEA 1TNTA 3GMEA 4G7ZF 4FETA 2DJNA 3NAUA 4YFNF 4Y15A 2M5WA 4Z2YA 4AUXA 1IO2A 2GZWA 2JSPA 1BI3A 2E1OA 4M9XA 1P2FA 3JCUC 1WJAA 2Z3YA 4YFKF 4V2FA 3KEQA 1RZ4A 1W36C 2V1XA 2VIXA 3OOPA 2K9MA 3TQNA 4YRVA 1YX5A 2R93J 1H8AC 2PJPA 2GIZA 1YITI 5HDNA 5L3EA 1MMSA 1O7FA 4ZTJA 2ZB9A 4I7HA 5HLGA 3FXLA 4HG2A 2L9VA 1RKWA 1RKTA 1FOYA 3P7NA 2L3DA 3CUOA 4NC7A 1FYMA 3OYCA 2GOXB 3ZQFA 2VJIA 4IOAF 1GDTA 1MW7A 4UV8A 3J80Z 2X0LA 4I99C 1P4AA 2OA4A 4M3FA 5DTDA 1ETYA 5BPIA 1IRZA 4I98B 1R23A 3IHUA 3WODF 4FX4A 2GA2A 2HVRA 4LB5A 4G6TB 3CC7I 1GHCA 2XASA 2WAFA 3OMYA 1HDDC 3WTWC 4IOCF 4A5MA 3BQYA 1DPUA 1XTAA 2PN6A 1W1WE 1Z6RA 1XCBA 2EWNA 2ETHA 3U2RA 1I27A 2VKHA 3BT9A 3VFZA 3HYIA 2K85A 3ZQLA 3IWFA 1ZKGA 1XD7A 2IS2A 1YQAA 2RQQA 2XKPA 4JK1X 5JHFA 4UUSB 3SFZA 1D8JA 1W7PD 4XN3A 3KP5A 1SMYF 3BR3A 4B09A 2TCTA 2D45A 2VE8A 2NVXJ 4L5EA 5FO5A 2JN6A 2FBKA 5KHDA 4RLFA 1Z91A 3LQQA 3SFIA 1Y39A 4NDLA 3VYUB 1POGA 1LE8A 1ZGJA 4CDGA 4RDUA 3ABLH 1BI0A 2FE3A 1K6YA 4A0YA 3S1QJ 4IXAA 4FT8A 3OYGA 5D8LB 3S2WA 1G3YA 3ZMTA 3PO3J 2A68F 4HX8A 3WTYC 2P7CB 4CHUA 3IH4A 3CZ6A 3M1EA 1ZLKA 1BR2A 1MMAA 3QPTA 1EA3A 2ZSIB 3TP0A 1R7JA 1M1EB 1U9NA 3BG9A 1AOYA 4I76A 5H6RA 4RAZA 3DEEA 3EUHA 4YEJA 4BHCA 2GM4A 4M9ZA 3FBNB 1FOXA 1U6GA 5E1WA 5GAGJ 1G8XA 3I59B 1I6XA 2JUCA 4J19A 2NVQJ 4KT5C 1EF4A 3RZOJ 3GZ5A 2M7BA 3KLOA 1JHHA 2V1NA 2H1KA 4E6KG 4UUTA 2I10A 2DMNA 3D5LA 4PZJA 5FKKA 2F5EA 3JSPA 4ESFA 1A35A 4IHWA 1ZGWA 2P6TA 2W7NA 1JUMA 4F3QA 3RKXA 1J2XA 4L0YB 1PDNC 2MD5A 2ISZA 3MCZA 3QU6A 1D0YA 2LMDA 4NC8A 3K4JA 1I1GA 2E1MB 3E6CC 3OIQA 3OYHA 5KAIC 2HQ5A 3O2PE 4PFOA 4MTEA 1SFOJ 4AD9A 2WB1N 5C4JJ 1LEAA 5FGMA 1WPKA 3H9JA 3F6OA 5EEGA 2E7WA 3BR6A 1U3EM 1MNMC 3L7WA 2A6TA 2VKEA 1ZGAA 1U2WA 4HDVA 3FXQA 2VJ4A 1NTCA 4BDYA 2OCCH 2W25A 1YIJI 3DLAA 4L0ZB 1X1PA 2A6HF 4QSHA 1QZZA 4DYQA 1QU3A 3DV8A 3ZRGA 3L2CA 2DU9A 1K78B 1T0FC 2HGCA 2M1BA 2E5NA 3GWZA 3QYEA 2IAIA 4MLOA 5BQTA 2CQNA 1P6RA 2ISYA 5IP9J 4XLAA 4B44A 2X4HA 1A36A 1KZHA 1N25A 3KP3A 4B3AA 2RVCA 1YO5C 1AU7A 2X9DA 2EPFA 3F3XA 2HWVA 2OC6A 1KU7A 1STZA 1I5ZA 1FEXA 3CO6C 2KPMA 3D5SC 4RAFA 1HLVA 1MIJA 1ZR4A 5D6EA 4E7SA 3L2RA 1JUPA 4MO7A 2L02A 4BDZA 2JWTA 1HXDA 2STWA 1A6IA 1T95A 1Z05A 2BV6A 1XB4A 2R7DA 4GRIA 2B0LA 2DQRA 4N9HA 2DN0A 2M9HA 3BTCA 4LJZF 4EVIA 3AG1H 2WAQA 5FD6A 3C2HA 4R1HA 5F64A 5B1BH 1ETXA 2FQ3A 3H5NA 4M6YA 4XKVA 3TO6A 3G6EI 3M8EA 3OYDA 4IZZA 4MGRA 3H3ZA 1R4NB 2NVYJ 1OLTA 3U1DA 3AG2H 1Y1WJ 4E4HA 4Q4ZF 4BH9A 2V9KA 1D1AA 1R6RA 1GV5A 1FTZA 4KFCA 5D6FA 4GCVA 5GADJ 5DUIA 1JI8A 4M71A 1W0UA 2Y48A 4RB0A 4DOZA 3IUOA 2M4GA 2EQRA 2E1CA 2XPWA 1SAXA 1RPWA 1U5TB 2FQ4A 2H09A 3GUDA 4AIDA 3U1KA 5GTIC 1FIPA 2HOAA 2WBMA 3AG3H 3CP2A 2EFPA 2FNPA 5D5WB 2P4WA 3DU6A 5ICCA 5E17F 4WX9A 2KP6A 3IKVA 2O9LA 4EQQA 1YHQI 4M72A 2Y0SA 4BQAA 4KN4X 1LEBA 3J81K 1ZAOA 4FE7A 3MZ8A 3CMEI 5IT9Z 1Z0XA 3ABTA 1ZYRF 3G1MA 4O6JA 3HJEA 1S6LA 2DMUA 3GYHX 4RAGA 1U78A 2Q8KA 2X6OA 1R00A 3Q9VA 2DA1A 4AIKA 3S2HJ 2A07F 4BE2A 2FUG2 3DTEA 3VSLA 3RPUD 2YU9J 5IYDJ 9ANTA 2YSRA 4EM1A 5GAHJ 1OCZH 2HFHA 4M3BA 2EFWA 3HIFA 1RR7A 2MYSA 3K4BA 1IJWC 2LR8A 2QKLB 3GBGA 1MZBA 1QZEA 3RTRA 2W24A 4A3EJ 1WZ2A 1MH3A 3KX2A 4LG0A 5IOYA 2B9SA 1T2KA 3QRFF 2XV4S 3P9IA 5FLMJ 3FXMA 3E5UA 1REPC 1X4OA 2E60A 3MZYA 4R8HA 3ML6A 3R0JA 2N8GA 5JLWA 2ZKZA 1I3AA 2L4AA 5A2QK 4YIFA 4PSWA 1BW6A 4XLHA 4EMSA 4BBSJ 1XGSA 5F1JA 2IVMA 4BJ6C 3G2BA 4WK8F 3OV8A 1UZCA 2E7XA 3CJNA 3GCMA 2ZJPF 3HOSA 4ZJZA 5E8GA 3RI4A 2KRHA 5IP7J 3TW7A 3BTJA 1CQTA 3VYTB 4B4CA 2VI6A 2UUZA 1ERDA 1Z3XA 1IUFA 4Q47A 4PSXA 2IP2A 4KNYA 3LSJA 5B5EC 5DD8A 1QVUA 3DPTA 3FXJA 3D1NI 2EFOA 1B9NA 3IV5A 4BE0A 3GFLA 4A5NA 2FF4A 5J6XA 1ZG1A 1DDNA 3JSOA 4DW6A 2K7LA 3CDHA 4XRMA 5E8IA 3BPVA 4KJZA 3DBLB 3OL3A 2DPUA 4J01A 3MZHA 1MMDA 4CZCA 4JX5A 4P9UA 1BI2A 1MJAA 1YI2I 1WSUA 2PMHA 1HSJA 2RDPA 2DXIA 1DQUA 2NVUB 4RM3A 3MFKA 4BEHA 4J00A 5TJJA 3T8TA 4BXXJ 2DBBA 4HW0A 1DGRM 3A01B 2H8RA 1O4XA 3R4KA 1FSEA 1BJZA 4D5FA 3L2QA 3QQAA 3BPXA 4HV5A 1IRGA 3RQ4A 5DD4A 3WHBA 2KJCA 4ON0A 3KE2A 2CG4A 3NRVA 2MABA 2LRDA 3UKGA 2EIKH 1G3WA 3OYJA 1IW7F 5B3SH 2OV7A 3I3LA 1LNWA 1RUNA 2RNJA 1Z77A 2Y2ZA 3EETA 3RCOA 2K5CA 1YS6A 2M3AA 2R7FA 1SFKA 2E35A 3T5XA 2MG4A 2E2IJ 4MQ9F 2VKDA 4GFBA 3ZMVA 1RUOA 3CJRB 3BCBA 3WTSC 3O6BB 1RESA 5J40A 4HF0A 3K69A 1G4DA 2IBDA 2RREA 2K02A 1WJ5A 4KMFA 3ZQCA 3GTMJ 2VL8A 4Y3OA 3G1OA 1XG1A 5AONA 1WFXA 2LKXA 1QPIA 3BJAA 1OQYA 2JA2A 3SXYA 3K1NA 1JTXA 4V19K 2DT5A 2VN2A 2MA3A 4E7ZA 2BY2A 4EM0B 4E7JA 3CQZJ 1WJFA 3HEFA 4ZYEA 3BR2A 1T98A 1UFMA 5CLSA 1QRYA 3M07A 3OY9A 5D5VB 3CF5F 2MSYA 4OIRF 1JT0A 2ZC2A 3MKYB 2XAFA 2K9LA 3UR3C 5K1YA 3BG3A 4L18B 2UXNA 3W3CA 3AKZA 1TWAJ 1USTA 1YLFA 2KZGA 2LC2A 3LAPA 2GWRA 1QNTA 5LHGA 4BY1J 4O5VA 5DDGA 4RB3C 2MC3A 4PJ0C 1L0OC 2YR2A 3K2AA 1WJDA 2JA5J 5HDGA 2KDOA 5C3EJ 4CZZA 3PSFA 5CVVA 2CS3A 4Y13A 1XMKA 2ZMEC 2BY1A 1J09A 2CU7A 2KL4A 2CW7A 3C7JA 4KICA 5ICGA 1SEUA 5CJ9A 1FTTA 2IGNA 3BDDA 2EZIA 1FJLA 1ZRCA 1IDYA 3HXLA 2K3PA 1W7PA 5HODA 3QPSA 1QPMA 3FXOA 5HNHA 1DUXC 2Z5UA 3HRTA 1KA8A 1YG2A 4A3KJ 3L09A 2RKHA 4CGZA 2MBFA 2QCOA 1YW8A 1BA5A 5F6FA 3V8JA 4MFEA 3K6GA 1R1TA 3U21A 3RJPA 3ZMUA 1K61A 2WC2A 4OIPF 2HZTA 4WXCA 1Z9CA 2EV5A 3HKZA 4GDFA 5ILSA 1TL8A 1D0ZA 1FT9A 4HBLA 3G3ZA 2CQ7A 3CCEI 1HKQA 3LFUA 3OYKA 1SC7A 4IVNA 2CJJA 4FX0A 3H0DA 1F36A 3K70C 1U8RA 4EJWA 1JJ8C 2BY0A 1Z7LA 3TP3A 1H0MA 1HF0A 2IA2A 2VBXA 3P5JA 3V7SA 3FXKA 1YTYA 3H36A 5D8KB 3GTJJ 4AYBN 3ZMDA 4I6ZA 1MNDA 1HBXG 4MQVA 1YFHA 3KYDB 2RGVA 4CUGA 2UV1A 3OS0A 4NHJA 3AG4H 4B47A 1H9TA 1HW2A 3BJ6A 4RGSA 3ESWB 4BHPA 1GVDA 2E5ZA 2QGUA 1GUUA 2IRFG 1TWGJ 3TEDA 2DMTA 5FLXK 1ENHA 3HB9A 1B1BA 2F5CA 1ETWA 2CUJA 3SZTA 2X6YA 2ZFUA 2KHMA 4UVCA 3BWGA 5H2FC 4FCYA 1F5TA 1VQ5I 4X1EA 5ILUA 3OS2A 2XHKA 4KDPA 2K9QA 2NAZA 4XN0A 5TGTA 3KEYA 2ID3A 3LSRA 1HA8A 4LITA 1SVOA 2VOOA 5FLXZ 2RV8A 4GGGA 3L2WA 1IN8A 1OYIA 3BJOA 3B6CA 1PP7U 1KQ0A 3SJMA 4FE4A 1XDUA 2EK5A 3VOEA 3HOUJ 3ZOBA 5F0FA 1XMXA 2CQQA 5GTHC 2FBHA 3ZR8X 5J1RA 4BXUA 3VPRA 2DA7A 5DCMB 1B9MA 1K4TA 4C2MJ 3V42A 2VLAA 4A3BJ 1S3JA 1V5FA 1KONA 2JVHA 3K4LA 1WHUA 5FROA 3IL2A 2IXSA 1SD6A 4MFDA 2B7EA 1R36A 3OR1C 3GW2A 4CCLA 3IRQA 2NOJB 4XL9A 1GV2A 1SVMA 2IEKA 2YUSA 1UB9A 4ZDLA 5CVRA 2MH2A 3SDBA 1GT0C 5D5XB 1MBJA 5IT3A 3KETA 2YS9A 2XF5A 2QQAA 1IV6A 1JKPC 2DA2A 1WQ2A 2Z33A 5GAEJ 2HVQA 1QGPA 3BOQA 3CMYA 4B43A 5BOXA 3JR9A 3PJRA 1P9QC 2ZJ2A 4W1UA 2ZXHA 2VQLA 1ZH5A 4G94A 2BW3B 2JQ7A 1I39A 4PJMA 4MEXF
chains in the Genus database with same CATH topology
1U5TC 3HSRA 2YU3A 3ZPLA 3Q5FA 1TQIA 1Q1HA 1BC8C 2LSOA 3KFWX 3V4GA 2LF8A 1BI1A 2UXXA 3QP6A 4HX4A 5BMZA 3KZZA 3CTAA 1L3LA 4DNCA 1IN7A 2F2EA 2EFQA 4WCGA 2HYFA 2C6YA 2BE5F 3WTUC 4U7BA 1TW3A 1WWXA 2ZMEB 2PQ8A 1DPRA 3HUGA 4HZFA 1QZYA 3RPUA 2FBIA 2IA1A 1KQ9A 1QBJA 2OZUA 4A6DA 1WI9A 2QVOA 4KIFA 4BAYA 4P5OA 3FM5A 3COAC 5DYMA 1LDDA 3N4MA 1HQCA 4L5IA 5DUKA 4OINF 1ZG3A 1TLHB 5LBQA 4U0WA 3PQJA 4FHTA 1P92A 2BBYA 2O61A 4DQ2A 4HF2A 2LKPA 4U0VA 3T0YA 5E20A 4WXDA 2PI0A 1SFUA 1G3TA 3CUQA 2O3FA 5K5RA 4XSZF 2YX7A 4HLYA 3DKWA 3MWMA 1T0FA 2KRFA 3BP8A 3LAJA 4QWQA 2MH9A 3C3WA 1T38A 5H20A 5HOOA 2CGPA 2EJRA 1BOAA 3SZPA 3TOBA 1J9IA 2PMUA 1P4XA 5LGUA 2VT3A 2KIFA 5CYVA 5HS9A 2M87A 3KP4A 2QBYA 4IJAA 3HRSA 1S8NA 4G7HF 5K5OA 4I2OA 1XSXA 4EV0A 5LEJA 5E18F 3QOPA 2LF7A 4A12A 2DK5A 2EA2A 1IN4A 2HQNA 3KZYA 3W6JB 3E5QA 2GIVA 1C0WA 2FOKA 2ZXJA 1IRFA 3ZN1A 1ZLJA 2OQRA 1K79A 4AIJA 2HS5A 3LA2A 4U7DA 4L5JA 1CF7B 1O3QA 2QQBA 4ZYHA 1XDSA 3RYPA 2JPCA 1MD0A 3T8RA 3K0LA 4A2UA 1IXSB 1LJ9A 3SHFA 1MDMA 1V4RA 4E70A 4KN7X 1FP2A 4RB2C 1X3UA 1ONVA 1TW2A 2XAHA 2CYYA 4ESBA 2IJLA 2QZ8A 1SFEA 3K1PA 2RQPA 3KLNA 2EB7A 3J81Z 2ZNYA 3FZVA 2BGCA 4B8XA 2Y0MA 2K4BA 3NQOA 5LGTA 1XSDA 1OR7A 1FZPB 3EQLF 1G3SA 1BN5A 4RS8A 4MHGA 4KA4A 2P8TA 4AWXB 3FWEA 3I54A 4AVPA 4HX7A 3LA3A 1D5VA 4OIOF 5JVTA 2ZO4A 1TQMA 2GXGA 2FMYA 3QAHA 4RGUA 2ESHA 1XMAA 4AIHA 1BIBA 2UWMA 4U0YA 3P9KA 2E1NA 5A2QZ 4XLNF 5HS7A 1KU2A 1GXQA 2XROA 1OMIA 1F9NA 2W85A 4M73A 2PFBA 4WF2A 3NEUA 4Q48A 4BNCA 3H92A 4CXFA 3P9CA 2A69F 4IRGA 2A3SA 1JGSA 1J5YA 1W4MA 2KJBA 3BROA 5JHUA 4XRFA 2YPRA 2HDCA 1JE8A 4L9TA 3ECOA 2G7UA 2VBYA 5BPDA 2L4MA 1RIOH 3BZ6A 4I0BA 2QYOA 1OYWA 1LVAA 3CLOA 4N9IA 3H3UA 1K7AA 3HHGA 1OYYA 3WTXC 3Q9SA 2A5YB 1UHMA 3L9FA 1FC3A 2DO7A 2HKXA 3DQVC 5K5QA 4ENJA 1IAWA 2VXZA 3J7AO 4KIBA 4I09A 1EH8A 4RGXA 2DAOA 5L3FA 1ZG5A 3GFIA 3KCCA 3WE3A 1PUEE 2R3SA 2EA4A 2L54A 2Y75A 4LGWA 4IPAA 3ABUA 1H9GA 3WGHA 3GXOA 3TDUC 1T39A 3GZ6A 1W5SA 5L3DA 1WKMA 3CO7C 2ELHA 1HSTA 4ENKA 3DXJF 4YFXF 3N97A 2XAQA 3E6MA 2DFIA 1KU3A 1ODDA 5KK1A 2JT1A 3B02A 3C1DA 2QUFA 3FX3A 1Z1DA 1FOKA 3L00A 3F6VA 4G7OF 4OMYA 3HHHA 3WTTC 2QWWA 3M9AA 3WTZA 4CO8A 4EJUA 4A0ZA 2PBIA 4BHBA 5CVIA 3RKWA 1IN5A 1GXPA 2IW5A 3EYIA 2QQ9A 2QM3A 4LLLA 2DPDA 1FX7A 4LMYA 5CVJA 1F1ZA 2GQQA 5LRSA 2HR3A 1ZREA 2DI3A 2XVCA 5J8FA 1A04A 2K4JA 2VOPA 3BY6A 3VEPA 5D4RA 1FLIA 4Q5SF 3I0TA 2PG4A 3B73A 3PQKA 1K78A 1GVJA 2Q0OA 3JW4A 2VODA 2CO5A 4LK0F 2GXBA 5BS6A 4M9SA 2BYVE 3ISPA 5FFXA 3IC7A 2H94A 3DP7A 3I53A 3HTSB 3IWZA 3F8MA 2VBZA 1IN6A 3LFKA 2IPQX 2V9VA 1TBXA 2YX4A 4UXNA 2VE9A 1XGNA 4ZYGA 4PCQA 3QU3A 4LG0B 1TTYA 2HTJA 2JZYA 1IF1A 2L01A 1KYWA 2HOEA 2P5LC 4Y17A 5TRDA 3KP7A 1R58A 1U5TA 5AIQA 2RC4A 1ON2A 3TKYA 2QENA 4ZZDA 4UV9A 1LDJA 5LHHA 1R1UA 5KVRA 3I58A 1J7KA 2F5DA 5JFRA 1F4KA 4UVBA 3F8FA 5D5UB 2D2WA 2CWEA 1IZ1A 5ILVA 3U9GA 4LK1F 2VONA 1FYKA 1MJ9A 4LLGF 4S04A 4ZZLA 4OOIA 4MTDA 2EV0A 2HQRA 2VC0A 3ERED 1YW9A 4IF4A 2HEOA 3I64A 3V7CA 4KYWA 2DTRA 4HLXA 2LDUA 1IXCA 3J80K 1R5HA 1TNSA 2FEZA 2ADUA 1HW5A 2D1HA 3WTVC 1E17A 5J8CA 1NHAA 4XBFA 2BEOA 1XSVA 4S05A 2W84A 3JTHA 4EGYA 2OQGA 5FD5A 4UHTA 3HRUA 2O8XA 1PP8F 1FSHA 1W5TA 2HKOA 2M30A 4M74A 3ZQ7A 1QQIA 1R22A 4RGRA 3TGNA 4PGHA 2IA0A 4HAMA 2J5PA 1ZRFA 4KUMA 4R79A 4IHSA 1HKTA 1VTNC 3F8NA 1HW1A 4G6QA 1BJAA 3FMSA 2JRTA 2OU2A 4NQWA 1K6OA 3GF2A 5LRRA 5LGNA 4GYGA 1MJBA 1RNLA 3F22A 5AIPA 3T1BA 4PGGA 2VT2A 1Y0UA 3ZMSA 2NS0A 2DQLA 4HA8A 2JPBA 1J75A 3V8LA 5E1ZB 1W7PB 4LD5A 4HOBA 2ZFWA 5H6QA 1D3YA 1ON1A 1Z6TA 3K2ZA 4U88A 1XN7A 2NNNA 1LB2A 1S7AA 3GLXA 4XSXF 2O03A 2KIMA 2ACJA 2K86A 3JTGA 2KKOA 2JTVA 2P7VB 3RIRA 3E6DA 5LEKA 3HTUA 4HV6A 4KIGA 2COMA 3RPQA 4P96A 4WXHA 3JAMK 3W6KB 1ZARA 3FHZA 1TQPA 1ULYA 2Z99A 3JAMZ 2ZCWA 3E3VA 4O3MA 1IUYA 2XUBA 1T6SA 1ZN2A 4F7ZA 1DP7P 5ICEA 5D4SA 3DPLC 4YIIA 3CUQC 5ED4A 1SD4A 4HDUA 3REOA 5FB2A 5ICFA 4WWCA 3R6SA 2W57A 2GAUA 1BC7C 2HTSA 4LLNA 1HKSA 1OKRA 4P9FA 3I71A 5JR3A 1YS7A 2IT0A 2H6CA 1FWZA 1JXSA 1YIOA 3GFJA 4UUVA 3FXUA 2P5VA 3WU1B 4JQFA 2FXAA 1FNNA 4HF1A 2XAJA 1S7OA 5F1RA 3D0SA 3ELKA 2AS5F 4GXOA 5L3BA 2FNAA 2ZBKA 1AWCA 3HOTA 3TO7A 3ULQB 4UNOA 4D0PA 2V1DA 1BBYA 3VB2A 2PLYA 2OBPA 1KQ8A 4G9YA 2NNYA 3E5XA 2G9WA 3FM3A 3ZP5A 1FYLA 4ENMA 5IT9K 4EJVA 2WTEA 5DCFA 1QO0D 1MKMA 2Z9OA 1USSA 4TV7A 2V79A 1BIAA 2WWYA 1ZRDA 1MGTA 3TDZC 3HSFA 4I0AA 1YYVA 2STTA 2CFXA 1FP1D 1WRJA 3M8FA 1O57A 4CYDA 1FPQA 1O3TA 2EV6A 1BM9A 3F8CA 2QLZA 4IRIA 5L3GA 3F23A 2AXLA 1UHWA 2F5FA 1Z7UA 2FRHA 1EV7A 2V6CA 2D1VA 5DCMA 2LNBA 1O3RA 4NB5A 3WGGA 3AAFA 4MNUA 5FFZA 3V8KA 2MLGA 4HQEA 3ROUA 1SFXA 5ERIA 3IRRA 4XLPF 3GO5A 1E2XA 3LWFA 4CICA 4L9NA 3ZN0A 3R0AA 4RB1A 1FBUA 4IRHA 3DF8A 1KGSA 3G73A 2FMLA 3WE2A 3LQRA 1IXRC 3F72A 3V7RA 3WG9A 2XRNA 3RKYA 1R1VA 4G6DA 3GVAA 3I5UA 3FMQA 2EFNA 4MEYF 2WV0A 4A6EA 2NYXA 2O6GE 3E97A 2KIUA 3K1MA 1B59A 2A61A 2O0YA 5L3CA 1D8KA 2TDXA 3EDPA 5HS8A 4K2EA 1B6AA 4LFUA 4EGZA 5DV5A 5EEHA 2ESNA 4G8XA 3WGIA 4ESJA 4KMUX 3QPHA 3CUQB 1FBSA 2XKOA 3EYYA 2RN7A 4I01A 3GX4X 2DW4A 1J0RA 2P5KA 1XGMA 2ZNZA 3MQ0A 2ZMEA 2M8EA 3R60A 3GEZA 3ZMZA 3DFGA 2OAZA 4PDKA 4ASNA 4OMZA 2Q2EA 3RYRA 3IKTA 2A6EF 1KU9A 3FF5A 3FXRA 1FY7A 4ENNA 3TO9A 4EJOA 5HDKA 3TOAA 2FU4A 3SQNA 3ECHA 4M6XA 2NRAC 2H6BA 2CQKA 3WU0A 2QBYB 5HLIA 1LDKB 2CSOA 4LB6B 3MEXA 3PFIA 4ZYDA 1XCVA 4JBAA 3I59A 1G6NA 1ZHFA 1SD7A 4OU0A 3K9TA 3MAJA 4RAYA 4EJTA 3E6BA 1SMTA 1I1SA 3QP5A 3LA7A 2CW0F 3I4PA 3M7GA 5LLQA 4HQMA 1SD5A 5HVQC 5LHIA 4IHTA 4UVAA 3LSTA 1JHFA 2M45A 4N0BA 3F8BA 4H0EA 2OD5A 4GO1A 1RI7A 3VODA 4BYYA 1MDMB 3DEUA 1O7LA 2FA5A 3RDIA 3HRMA 1V3FA 6PAXA 2DK8A 2P6SA 4I02A 2J5OA 1CGPA 2MLKA 4ETSA 2VC1A 1YW7A 2PEXA 2V1UA 1B4AA 3KP2A 2UZKA 4QLCU 4P55A 1EH6A 3HSEA 2FSWA 5CVUA 4GYIA 4YG2F 1FBQA 1R5GA 4L9JA 2DLLA 1J59A 4L9VA 4OIQF 5E1XA 2XAGA 1XGOA 2H27A 4ZH4F 5HLHA 3R61A 5JI6A 3O3KA 3GFMA 3F21A 1S29A 1O3SA 1P4WA 2XIGA 1CF7A 2G7HA 3KP6A 1EH7A 4EM2A 3FMRA 2JSCA 1LQ1A 2GA1A 1UCRA 2VBWA 2XGXA 2HYGD 2K27A 3KEOA 5DEQA 1KYZA 1OPCA 2OZ6A 3C18A 4A0XA 4HYEA 1TNTA 4G7ZF 4YFNF 4Y15A 2M5WA 4Z2YA 2GZWA 1BI3A 4M9XA 1P2FA 2Z3YA 4YFKF 3KEQA 1RZ4A 2V1XA 3OOPA 3TQNA 2PJPA 5HDNA 5L3EA 1O7FA 4I7HA 5HLGA 3P7NA 2L3DA 3CUOA 1FYMA 4UV8A 3J80Z 2X0LA 1P4AA 2OA4A 5BPIA 4I98B 1R23A 3IHUA 3WODF 4FX4A 2GA2A 4LB5A 1GHCA 2XASA 1DPUA 3WTWC 4A5MA 2PN6A 1Z6RA 1XCBA 2EWNA 2ETHA 3U2RA 1I27A 3VFZA 3HYIA 3IWFA 1XD7A 1YQAA 2XKPA 4JK1X 1D8JA 3SFZA 1W7PD 3KP5A 1SMYF 4B09A 2D45A 2VE8A 5FO5A 2FBKA 1Z91A 3LQQA 1ZGJA 4CDGA 1BI0A 2FE3A 4A0YA 4IXAA 4FT8A 5D8LB 3S2WA 1G3YA 3ZMTA 2A68F 4HX8A 3WTYC 2P7CB 4CHUA 3M1EA 1ZLKA 3QPTA 1R7JA 1AOYA 5H6RA 4RAZA 3EUHA 4BHCA 4M9ZA 1U6GA 5E1WA 3I59B 1I6XA 4KT5C 3GZ5A 3KLOA 1JHHA 3D5LA 4PZJA 2F5EA 3JSPA 4ESFA 2P6TA 3RKXA 1J2XA 4L0YB 1PDNC 2MD5A 2ISZA 3MCZA 3QU6A 1I1GA 3E6CC 3O2PE 4MTEA 4AD9A 1LEAA 5FGMA 5EEGA 3F6OA 2E7WA 1U3EM 3L7WA 1ZGAA 1U2WA 4HDVA 3FXQA 2W25A 4L0ZB 2A6HF 1QZZA 3DV8A 3L2CA 2DU9A 1K78B 2HGCA 2M1BA 3GWZA 5BQTA 1P6RA 2ISYA 2X4HA 3KP3A 2RVCA 1YO5C 3F3XA 2HWVA 1KU7A 1STZA 1I5ZA 3CO6C 5D6EA 2L02A 1HXDA 2STWA 1Z05A 2BV6A 1XB4A 2R7DA 2B0LA 2DQRA 4N9HA 4EVIA 4LJZF 5FD6A 4R1HA 5F64A 2FQ3A 4M6YA 3TO6A 3M8EA 4MGRA 3H3ZA 3U1DA 4Q4ZF 4BH9A 4KFCA 5D6FA 4GCVA 5DUIA 4M71A 2Y48A 4RB0A 2E1CA 1SAXA 1U5TB 2H09A 3GUDA 2EFPA 2FNPA 5D5WB 2P4WA 5ICCA 5E17F 4WX9A 3IKVA 4EQQA 4M72A 4BQAA 4KN4X 1LEBA 3J81K 1ZAOA 5IT9Z 3ABTA 1ZYRF 4O6JA 1S6LA 3GYHX 1U78A 2Q8KA 1R00A 3Q9VA 4AIKA 2A07F 2YSRA 4EM1A 2HFHA 2EFWA 3HIFA 1MZBA 3RTRA 2W24A 4LG0A 1T2KA 3QRFF 2XV4S 3P9IA 3E5UA 1REPC 3MZYA 4R8HA 3ML6A 3R0JA 2ZKZA 2L4AA 5A2QK 4YIFA 4EMSA 1XGSA 2IVMA 4WK8F 3OV8A 2E7XA 3CJNA 3HOSA 5E8GA 3RI4A 4Q47A 2IP2A 4KNYA 5DD8A 3DPTA 2EFOA 1B9NA 3GFLA 4A5NA 2FF4A 5J6XA 1ZG1A 1DDNA 3JSOA 2K7LA 3CDHA 5E8IA 3BPVA 2DPUA 3MZHA 4P9UA 1BI2A 1MJAA 1WSUA 2PMHA 1HSJA 2RDPA 3MFKA 5TJJA 3T8TA 2DBBA 4HW0A 3R4KA 1FSEA 3BPXA 4HV5A 1IRGA 5DD4A 2KJCA 4ON0A 3KE2A 2CG4A 3NRVA 1G3WA 1IW7F 1LNWA 1RUNA 2RNJA 3EETA 1YS6A 2R7FA 3T5XA 4MQ9F 3ZMVA 1RUOA 3WTSC 3O6BB 4HF0A 3K69A 1G4DA 2K02A 4KMFA 5AONA 3BJAA 3SXYA 3K1NA 2DT5A 2VN2A 2MA3A 4EM0B 4ZYEA 1T98A 1UFMA 5CLSA 5D5VB 4OIRF 2XAFA 5K1YA 4L18B 2UXNA 1USTA 1YLFA 3LAPA 2GWRA 1QNTA 5LHGA 4O5VA 5DDGA 4RB3C 2MC3A 1L0OC 2YR2A 5HDGA 4CZZA 5CVVA 4Y13A 1XMKA 3C7JA 4KICA 5ICGA 5CJ9A 3BDDA 1ZRCA 1W7PA 1QPMA 1DUXC 2Z5UA 3HRTA 1KA8A 1YG2A 3L09A 2RKHA 4CGZA 2MBFA 1YW8A 5F6FA 3V8JA 1R1TA 3RJPA 3ZMUA 2WC2A 4OIPF 2HZTA 4WXCA 1Z9CA 2EV5A 5ILSA 1FT9A 4HBLA 3G3ZA 1HKQA 4IVNA 4FX0A 1U8RA 4EJWA 1H0MA 2IA2A 2VBXA 3V7SA 1YTYA 5D8KB 3ZMDA 1HBXG 4MQVA 1YFHA 2RGVA 4NHJA 1H9TA 1HW2A 3BJ6A 4RGSA 4BHPA 2IRFG 5FLXK 1B1BA 2F5CA 3SZTA 4UVCA 3BWGA 1F5TA 5ILUA 2XHKA 4KDPA 2NAZA 2VOOA 5FLXZ 2RV8A 4GGGA 1IN8A 1OYIA 3BJOA 1PP7U 1KQ0A 1XDUA 2EK5A 3VOEA 2FBHA 4BXUA 5DCMB 1B9MA 1S3JA 3IL2A 1SD6A 1R36A 3GW2A 3IRQA 1UB9A 5CVRA 2MH2A 5D5XB 3KETA 5IT3A 2QQAA 1WQ2A 2Z33A 1QGPA 3BOQA 5BOXA 2ZJ2A 1ZH5A 4G94A 4MEXF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1U5T C;  3HSR A;  2YU3 A;  3ZPL A;  3Q5F A;  1TQI A;  1Q1H A;  1BC8 C;  2LSO A;  3KFW X;  3V4G A;  2LF8 A;  1BI1 A;  2UXX A;  3QP6 A;  4HX4 A;  5BMZ A;  3KZZ A;  3CTA A;  1L3L A;  4DNC A;  1IN7 A;  2F2E A;  2EFQ A;  4WCG A;  2HYF A;  2C6Y A;  2BE5 F;  3WTU C;  4U7B A;  1TW3 A;  1WWX A;  2ZME B;  2PQ8 A;  1DPR A;  3HUG A;  4HZF A;  1QZY A;  3RPU A;  2FBI A;  2IA1 A;  1KQ9 A;  1QBJ A;  2OZU A;  4A6D A;  1WI9 A;  2QVO A;  4KIF A;  4BAY A;  4P5O A;  3FM5 A;  3COA C;  5DYM A;  1LDD A;  3N4M A;  1HQC A;  4L5I A;  5DUK A;  4OIN F;  1ZG3 A;  1TLH B;  5LBQ A;  4U0W A;  3PQJ A;  4FHT A;  1P92 A;  2BBY A;  2O61 A;  4DQ2 A;  4HF2 A;  2LKP A;  4U0V A;  3T0Y A;  5E20 A;  4WXD A;  2PI0 A;  1SFU A;  1G3T A;  3CUQ A;  2O3F A;  5K5R A;  4XSZ F;  2YX7 A;  4HLY A;  3DKW A;  3MWM A;  1T0F A;  2KRF A;  3BP8 A;  3LAJ A;  4QWQ A;  2MH9 A;  3C3W A;  1T38 A;  5H20 A;  5HOO A;  2CGP A;  2EJR A;  1BOA A;  3SZP A;  3TOB A;  1J9I A;  2PMU A;  1P4X A;  5LGU A;  2VT3 A;  2KIF A;  5CYV A;  5HS9 A;  2M87 A;  3KP4 A;  2QBY A;  4IJA A;  3HRS A;  1S8N A;  4G7H F;  5K5O A;  4I2O A;  1XSX A;  4EV0 A;  5LEJ A;  5E18 F;  3QOP A;  2LF7 A;  4A12 A;  2DK5 A;  2EA2 A;  1IN4 A;  2HQN A;  3KZY A;  3W6J B;  3E5Q A;  2GIV A;  1C0W A;  2FOK A;  2ZXJ A;  1IRF A;  3ZN1 A;  1ZLJ A;  2OQR A;  1K79 A;  4AIJ A;  2HS5 A;  3LA2 A;  4U7D A;  4L5J A;  1CF7 B;  1O3Q A;  2QQB A;  4ZYH A;  1XDS A;  3RYP A;  2JPC A;  1MD0 A;  3T8R A;  3K0L A;  4A2U A;  1IXS B;  1LJ9 A;  3SHF A;  1MDM A;  1V4R A;  4E70 A;  4KN7 X;  1FP2 A;  4RB2 C;  1X3U A;  1ONV A;  1TW2 A;  2XAH A;  2CYY A;  4ESB A;  2IJL A;  2QZ8 A;  1SFE A;  3K1P A;  2RQP A;  3KLN A;  2EB7 A;  3J81 Z;  2ZNY A;  3FZV A;  2BGC A;  4B8X A;  2Y0M A;  2K4B A;  3NQO A;  5LGT A;  1XSD A;  1OR7 A;  1FZP B;  3EQL F;  1G3S A;  1BN5 A;  4RS8 A;  4MHG A;  4KA4 A;  2P8T A;  4AWX B;  3FWE A;  3I54 A;  4AVP A;  4HX7 A;  3LA3 A;  1D5V A;  4OIO F;  5JVT A;  2ZO4 A;  1TQM A;  2GXG A;  2FMY A;  3QAH A;  4RGU A;  2ESH A;  1XMA A;  4AIH A;  1BIB A;  2UWM A;  4U0Y A;  3P9K A;  2E1N A;  5A2Q Z;  4XLN F;  5HS7 A;  1KU2 A;  1GXQ A;  2XRO A;  1OMI A;  1F9N A;  2W85 A;  4M73 A;  2PFB A;  4WF2 A;  3NEU A;  4Q48 A;  4BNC A;  3H92 A;  4CXF A;  3P9C A;  2A69 F;  4IRG A;  2A3S A;  1JGS A;  1J5Y A;  1W4M A;  2KJB A;  3BRO A;  5JHU A;  4XRF A;  2YPR A;  2HDC A;  1JE8 A;  4L9T A;  3ECO A;  2G7U A;  2VBY A;  5BPD A;  2L4M A;  1RIO H;  3BZ6 A;  4I0B A;  2QYO A;  1OYW A;  1LVA A;  3CLO A;  4N9I A;  3H3U A;  1K7A A;  3HHG A;  1OYY A;  3WTX C;  3Q9S A;  2A5Y B;  1UHM A;  3L9F A;  1FC3 A;  2DO7 A;  2HKX A;  3DQV C;  5K5Q A;  4ENJ A;  1IAW A;  2VXZ A;  3J7A O;  4KIB A;  4I09 A;  1EH8 A;  4RGX A;  2DAO A;  5L3F A;  1ZG5 A;  3GFI A;  3KCC A;  3WE3 A;  1PUE E;  2R3S A;  2EA4 A;  2L54 A;  2Y75 A;  4LGW A;  4IPA A;  3ABU A;  1H9G A;  3WGH A;  3GXO A;  3TDU C;  1T39 A;  3GZ6 A;  1W5S A;  5L3D A;  1WKM A;  3CO7 C;  2ELH A;  1HST A;  4ENK A;  3DXJ F;  4YFX F;  3N97 A;  2XAQ A;  3E6M A;  2DFI A;  1KU3 A;  1ODD A;  5KK1 A;  2JT1 A;  3B02 A;  3C1D A;  2QUF A;  3FX3 A;  1Z1D A;  1FOK A;  3L00 A;  3F6V A;  4G7O F;  4OMY A;  3HHH A;  3WTT C;  2QWW A;  3M9A A;  3WTZ A;  4CO8 A;  4EJU A;  4A0Z A;  2PBI A;  4BHB A;  5CVI A;  3RKW A;  1IN5 A;  1GXP A;  2IW5 A;  3EYI A;  2QQ9 A;  2QM3 A;  4LLL A;  2DPD A;  1FX7 A;  4LMY A;  5CVJ A;  1F1Z A;  2GQQ A;  5LRS A;  2HR3 A;  1ZRE A;  2DI3 A;  2XVC A;  5J8F A;  1A04 A;  2K4J A;  2VOP A;  3BY6 A;  3VEP A;  5D4R A;  1FLI A;  4Q5S F;  3I0T A;  2PG4 A;  3B73 A;  3PQK A;  1K78 A;  1GVJ A;  2Q0O A;  3JW4 A;  2VOD A;  2CO5 A;  4LK0 F;  2GXB A;  5BS6 A;  4M9S A;  2BYV E;  3ISP A;  5FFX A;  3IC7 A;  2H94 A;  3DP7 A;  3I53 A;  3HTS B;  3IWZ A;  3F8M A;  2VBZ A;  1IN6 A;  3LFK A;  2IPQ X;  2V9V A;  1TBX A;  2YX4 A;  4UXN A;  2VE9 A;  1XGN A;  4ZYG A;  4PCQ A;  3QU3 A;  4LG0 B;  1TTY A;  2HTJ A;  2JZY A;  1IF1 A;  2L01 A;  1KYW A;  2HOE A;  2P5L C;  4Y17 A;  5TRD A;  3KP7 A;  1R58 A;  1U5T A;  5AIQ A;  2RC4 A;  1ON2 A;  3TKY A;  2QEN A;  4ZZD A;  4UV9 A;  1LDJ A;  5LHH A;  1R1U A;  5KVR A;  3I58 A;  1J7K A;  2F5D A;  5JFR A;  1F4K A;  4UVB A;  3F8F A;  5D5U B;  2D2W A;  2CWE A;  1IZ1 A;  5ILV A;  3U9G A;  4LK1 F;  2VON A;  1FYK A;  1MJ9 A;  4LLG F;  4S04 A;  4ZZL A;  4OOI A;  4MTD A;  2EV0 A;  2HQR A;  2VC0 A;  3ERE D;  1YW9 A;  4IF4 A;  2HEO A;  3I64 A;  3V7C A;  4KYW A;  2DTR A;  4HLX A;  2LDU A;  1IXC A;  3J80 K;  1R5H A;  1TNS A;  2FEZ A;  2ADU A;  1HW5 A;  2D1H A;  3WTV C;  1E17 A;  5J8C A;  1NHA A;  4XBF A;  2BEO A;  1XSV A;  4S05 A;  2W84 A;  3JTH A;  4EGY A;  2OQG A;  5FD5 A;  4UHT A;  3HRU A;  2O8X A;  1PP8 F;  1FSH A;  1W5T A;  2HKO A;  2M30 A;  4M74 A;  3ZQ7 A;  1QQI A;  1R22 A;  4RGR A;  3TGN A;  4PGH A;  2IA0 A;  4HAM A;  2J5P A;  1ZRF A;  4KUM A;  4R79 A;  4IHS A;  1HKT A;  1VTN C;  3F8N A;  1HW1 A;  4G6Q A;  1BJA A;  3FMS A;  2JRT A;  2OU2 A;  4NQW A;  1K6O A;  3GF2 A;  5LRR A;  5LGN A;  4GYG A;  1MJB A;  1RNL A;  3F22 A;  5AIP A;  3T1B A;  4PGG A;  2VT2 A;  1Y0U A;  3ZMS A;  2NS0 A;  2DQL A;  4HA8 A;  2JPB A;  1J75 A;  3V8L A;  5E1Z B;  1W7P B;  4LD5 A;  4HOB A;  2ZFW A;  5H6Q A;  1D3Y A;  1ON1 A;  1Z6T A;  3K2Z A;  4U88 A;  1XN7 A;  2NNN A;  1LB2 A;  1S7A A;  3GLX A;  4XSX F;  2O03 A;  2KIM A;  2ACJ A;  2K86 A;  3JTG A;  2KKO A;  2JTV A;  2P7V B;  3RIR A;  3E6D A;  5LEK A;  3HTU A;  4HV6 A;  4KIG A;  2COM A;  3RPQ A;  4P96 A;  4WXH A;  3JAM K;  3W6K B;  1ZAR A;  3FHZ A;  1TQP A;  1ULY A;  2Z99 A;  3JAM Z;  2ZCW A;  3E3V A;  4O3M A;  1IUY A;  2XUB A;  1T6S A;  1ZN2 A;  4F7Z A;  1DP7 P;  5ICE A;  5D4S A;  3DPL C;  4YII A;  3CUQ C;  5ED4 A;  1SD4 A;  4HDU A;  3REO A;  5FB2 A;  5ICF A;  4WWC A;  3R6S A;  2W57 A;  2GAU A;  1BC7 C;  2HTS A;  4LLN A;  1HKS A;  1OKR A;  4P9F A;  3I71 A;  5JR3 A;  1YS7 A;  2IT0 A;  2H6C A;  1FWZ A;  1JXS A;  1YIO A;  3GFJ A;  4UUV A;  3FXU A;  2P5V A;  3WU1 B;  4JQF A;  2FXA A;  1FNN A;  4HF1 A;  2XAJ A;  1S7O A;  5F1R A;  3D0S A;  3ELK A;  2AS5 F;  4GXO A;  5L3B A;  2FNA A;  2ZBK A;  1AWC A;  3HOT A;  3TO7 A;  3ULQ B;  4UNO A;  4D0P A;  2V1D A;  1BBY A;  3VB2 A;  2PLY A;  2OBP A;  1KQ8 A;  4G9Y A;  2NNY A;  3E5X A;  2G9W A;  3FM3 A;  3ZP5 A;  1FYL A;  4ENM A;  5IT9 K;  4EJV A;  2WTE A;  5DCF A;  1QO0 D;  1MKM A;  2Z9O A;  1USS A;  4TV7 A;  2V79 A;  1BIA A;  2WWY A;  1ZRD A;  1MGT A;  3TDZ C;  3HSF A;  4I0A A;  1YYV A;  2STT A;  2CFX A;  1FP1 D;  1WRJ A;  3M8F A;  1O57 A;  4CYD A;  1FPQ A;  1O3T A;  2EV6 A;  1BM9 A;  3F8C A;  2QLZ A;  4IRI A;  5L3G A;  3F23 A;  2AXL A;  1UHW A;  2F5F A;  1Z7U A;  2FRH A;  1EV7 A;  2V6C A;  2D1V A;  5DCM A;  2LNB A;  1O3R A;  4NB5 A;  3WGG A;  3AAF A;  4MNU A;  5FFZ A;  3V8K A;  2MLG A;  4HQE A;  3ROU A;  1SFX A;  5ERI A;  3IRR A;  4XLP F;  3GO5 A;  1E2X A;  3LWF A;  4CIC A;  4L9N A;  3ZN0 A;  3R0A A;  4RB1 A;  1FBU A;  4IRH A;  3DF8 A;  1KGS A;  3G73 A;  2FML A;  3WE2 A;  3LQR A;  1IXR C;  3F72 A;  3V7R A;  3WG9 A;  2XRN A;  3RKY A;  1R1V A;  4G6D A;  3GVA A;  3I5U A;  3FMQ A;  2EFN A;  4MEY F;  2WV0 A;  4A6E A;  2NYX A;  2O6G E;  3E97 A;  2KIU A;  3K1M A;  1B59 A;  2A61 A;  2O0Y A;  5L3C A;  1D8K A;  2TDX A;  3EDP A;  5HS8 A;  4K2E A;  1B6A A;  4LFU A;  4EGZ A;  5DV5 A;  5EEH A;  2ESN A;  4G8X A;  3WGI A;  4ESJ A;  4KMU X;  3QPH A;  3CUQ B;  1FBS A;  2XKO A;  3EYY A;  2RN7 A;  4I01 A;  3GX4 X;  2DW4 A;  1J0R A;  2P5K A;  1XGM A;  2ZNZ A;  3MQ0 A;  2ZME A;  2M8E A;  3R60 A;  3GEZ A;  3ZMZ A;  3DFG A;  2OAZ A;  4PDK A;  4ASN A;  4OMZ A;  2Q2E A;  3RYR A;  3IKT A;  2A6E F;  1KU9 A;  3FF5 A;  3FXR A;  1FY7 A;  4ENN A;  3TO9 A;  4EJO A;  5HDK A;  3TOA A;  2FU4 A;  3SQN A;  3ECH A;  4M6X A;  2NRA C;  2H6B A;  2CQK A;  3WU0 A;  2QBY B;  5HLI A;  1LDK B;  2CSO A;  4LB6 B;  3MEX A;  3PFI A;  4ZYD A;  1XCV A;  4JBA A;  3I59 A;  1G6N A;  1ZHF A;  1SD7 A;  4OU0 A;  3K9T A;  3MAJ A;  4RAY A;  4EJT A;  3E6B A;  1SMT A;  1I1S A;  3QP5 A;  3LA7 A;  2CW0 F;  3I4P A;  3M7G A;  5LLQ A;  4HQM A;  1SD5 A;  5HVQ C;  5LHI A;  4IHT A;  4UVA A;  3LST A;  1JHF A;  2M45 A;  4N0B A;  3F8B A;  4H0E A;  2OD5 A;  4GO1 A;  1RI7 A;  3VOD A;  4BYY A;  1MDM B;  3DEU A;  1O7L A;  2FA5 A;  3RDI A;  3HRM A;  1V3F A;  6PAX A;  2DK8 A;  2P6S A;  4I02 A;  2J5O A;  1CGP A;  2MLK A;  4ETS A;  2VC1 A;  1YW7 A;  2PEX A;  2V1U A;  1B4A A;  3KP2 A;  2UZK A;  4QLC U;  4P55 A;  1EH6 A;  3HSE A;  2FSW A;  5CVU A;  4GYI A;  4YG2 F;  1FBQ A;  1R5G A;  4L9J A;  2DLL A;  1J59 A;  4L9V A;  4OIQ F;  5E1X A;  2XAG A;  1XGO A;  2H27 A;  4ZH4 F;  5HLH A;  3R61 A;  5JI6 A;  3O3K A;  3GFM A;  3F21 A;  1S29 A;  1O3S A;  1P4W A;  2XIG A;  1CF7 A;  2G7H A;  3KP6 A;  1EH7 A;  4EM2 A;  3FMR A;  2JSC A;  1LQ1 A;  2GA1 A;  1UCR A;  2VBW A;  2XGX A;  2HYG D;  2K27 A;  3KEO A;  5DEQ A;  1KYZ A;  1OPC A;  2OZ6 A;  3C18 A;  4A0X A;  4HYE A;  1TNT A;  4G7Z F;  4YFN F;  4Y15 A;  2M5W A;  4Z2Y A;  2GZW A;  1BI3 A;  4M9X A;  1P2F A;  2Z3Y A;  4YFK F;  3KEQ A;  1RZ4 A;  2V1X A;  3OOP A;  3TQN A;  2PJP A;  5HDN A;  5L3E A;  1O7F A;  4I7H A;  5HLG A;  3P7N A;  2L3D A;  3CUO A;  1FYM A;  4UV8 A;  3J80 Z;  2X0L A;  1P4A A;  2OA4 A;  5BPI A;  4I98 B;  1R23 A;  3IHU A;  3WOD F;  4FX4 A;  2GA2 A;  4LB5 A;  1GHC A;  2XAS A;  1DPU A;  3WTW C;  4A5M A;  2PN6 A;  1Z6R A;  1XCB A;  2EWN A;  2ETH A;  3U2R A;  1I27 A;  3VFZ A;  3HYI A;  3IWF A;  1XD7 A;  1YQA A;  2XKP A;  4JK1 X;  1D8J A;  3SFZ A;  1W7P D;  3KP5 A;  1SMY F;  4B09 A;  2D45 A;  2VE8 A;  5FO5 A;  2FBK A;  1Z91 A;  3LQQ A;  1ZGJ A;  4CDG A;  1BI0 A;  2FE3 A;  4A0Y A;  4IXA A;  4FT8 A;  5D8L B;  3S2W A;  1G3Y A;  3ZMT A;  2A68 F;  4HX8 A;  3WTY C;  2P7C B;  4CHU A;  3M1E A;  1ZLK A;  3QPT A;  1R7J A;  1AOY A;  5H6R A;  4RAZ A;  3EUH A;  4BHC A;  4M9Z A;  1U6G A;  5E1W A;  3I59 B;  1I6X A;  4KT5 C;  3GZ5 A;  3KLO A;  1JHH A;  3D5L A;  4PZJ A;  2F5E A;  3JSP A;  4ESF A;  2P6T A;  3RKX A;  1J2X A;  4L0Y B;  1PDN C;  2MD5 A;  2ISZ A;  3MCZ A;  3QU6 A;  1I1G A;  3E6C C;  3O2P E;  4MTE A;  4AD9 A;  1LEA A;  5FGM A;  5EEG A;  3F6O A;  2E7W A;  1U3E M;  3L7W A;  1ZGA A;  1U2W A;  4HDV A;  3FXQ A;  2W25 A;  4L0Z B;  2A6H F;  1QZZ A;  3DV8 A;  3L2C A;  2DU9 A;  1K78 B;  2HGC A;  2M1B A;  3GWZ A;  5BQT A;  1P6R A;  2ISY A;  2X4H A;  3KP3 A;  2RVC A;  1YO5 C;  3F3X A;  2HWV A;  1KU7 A;  1STZ A;  1I5Z A;  3CO6 C;  5D6E A;  2L02 A;  1HXD A;  2STW A;  1Z05 A;  2BV6 A;  1XB4 A;  2R7D A;  2B0L A;  2DQR A;  4N9H A;  4EVI A;  4LJZ F;  5FD6 A;  4R1H A;  5F64 A;  2FQ3 A;  4M6Y A;  3TO6 A;  3M8E A;  4MGR A;  3H3Z A;  3U1D A;  4Q4Z F;  4BH9 A;  4KFC A;  5D6F A;  4GCV A;  5DUI A;  4M71 A;  2Y48 A;  4RB0 A;  2E1C A;  1SAX A;  1U5T B;  2H09 A;  3GUD A;  2EFP A;  2FNP A;  5D5W B;  2P4W A;  5ICC A;  5E17 F;  4WX9 A;  3IKV A;  4EQQ A;  4M72 A;  4BQA A;  4KN4 X;  1LEB A;  3J81 K;  1ZAO A;  5IT9 Z;  3ABT A;  1ZYR F;  4O6J A;  1S6L A;  3GYH X;  1U78 A;  2Q8K A;  1R00 A;  3Q9V A;  4AIK A;  2A07 F;  2YSR A;  4EM1 A;  2HFH A;  2EFW A;  3HIF A;  1MZB A;  3RTR A;  2W24 A;  4LG0 A;  1T2K A;  3QRF F;  2XV4 S;  3P9I A;  3E5U A;  1REP C;  3MZY A;  4R8H A;  3ML6 A;  3R0J A;  2ZKZ A;  2L4A A;  5A2Q K;  4YIF A;  4EMS A;  1XGS A;  2IVM A;  4WK8 F;  3OV8 A;  2E7X A;  3CJN A;  3HOS A;  5E8G A;  3RI4 A;  4Q47 A;  2IP2 A;  4KNY A;  5DD8 A;  3DPT A;  2EFO A;  1B9N A;  3GFL A;  4A5N A;  2FF4 A;  5J6X A;  1ZG1 A;  1DDN A;  3JSO A;  2K7L A;  3CDH A;  5E8I A;  3BPV A;  2DPU A;  3MZH A;  4P9U A;  1BI2 A;  1MJA A;  1WSU A;  2PMH A;  1HSJ A;  2RDP A;  3MFK A;  5TJJ A;  3T8T A;  2DBB A;  4HW0 A;  3R4K A;  1FSE A;  3BPX A;  4HV5 A;  1IRG A;  5DD4 A;  2KJC A;  4ON0 A;  3KE2 A;  2CG4 A;  3NRV A;  1G3W A;  1IW7 F;  1LNW A;  1RUN A;  2RNJ A;  3EET A;  1YS6 A;  2R7F A;  3T5X A;  4MQ9 F;  3ZMV A;  1RUO A;  3WTS C;  3O6B B;  4HF0 A;  3K69 A;  1G4D A;  2K02 A;  4KMF A;  5AON A;  3BJA A;  3SXY A;  3K1N A;  2DT5 A;  2VN2 A;  2MA3 A;  4EM0 B;  4ZYE A;  1T98 A;  1UFM A;  5CLS A;  5D5V B;  4OIR F;  2XAF A;  5K1Y A;  4L18 B;  2UXN A;  1UST A;  1YLF A;  3LAP A;  2GWR A;  1QNT A;  5LHG A;  4O5V A;  5DDG A;  4RB3 C;  2MC3 A;  1L0O C;  2YR2 A;  5HDG A;  4CZZ A;  5CVV A;  4Y13 A;  1XMK A;  3C7J A;  4KIC A;  5ICG A;  5CJ9 A;  3BDD A;  1ZRC A;  1W7P A;  1QPM A;  1DUX C;  2Z5U A;  3HRT A;  1KA8 A;  1YG2 A;  3L09 A;  2RKH A;  4CGZ A;  2MBF A;  1YW8 A;  5F6F A;  3V8J A;  1R1T A;  3RJP A;  3ZMU A;  2WC2 A;  4OIP F;  2HZT A;  4WXC A;  1Z9C A;  2EV5 A;  5ILS A;  1FT9 A;  4HBL A;  3G3Z A;  1HKQ A;  4IVN A;  4FX0 A;  1U8R A;  4EJW A;  1H0M A;  2IA2 A;  2VBX A;  3V7S A;  1YTY A;  5D8K B;  3ZMD A;  1HBX G;  4MQV A;  1YFH A;  2RGV A;  4NHJ A;  1H9T A;  1HW2 A;  3BJ6 A;  4RGS A;  4BHP A;  2IRF G;  5FLX K;  1B1B A;  2F5C A;  3SZT A;  4UVC A;  3BWG A;  1F5T A;  5ILU A;  2XHK A;  4KDP A;  2NAZ A;  2VOO A;  5FLX Z;  2RV8 A;  4GGG A;  1IN8 A;  1OYI A;  3BJO A;  1PP7 U;  1KQ0 A;  1XDU A;  2EK5 A;  3VOE A;  2FBH A;  4BXU A;  5DCM B;  1B9M A;  1S3J A;  3IL2 A;  1SD6 A;  1R36 A;  3GW2 A;  3IRQ A;  1UB9 A;  5CVR A;  2MH2 A;  5D5X B;  3KET A;  5IT3 A;  2QQA A;  1WQ2 A;  2Z33 A;  1QGP A;  3BOQ A;  5BOX A;  2ZJ2 A;  1ZH5 A;  4G94 A;  4MEX F; 
#chains in the Genus database with same CATH topology
 1U5T C;  2MGQ A;  2AQF A;  3HSR A;  4FQG A;  2YU3 A;  3MKL A;  3ZPL A;  1AKH B;  3Q5F A;  1TQI A;  1BR1 A;  1GLN A;  1Q1H A;  1BC8 C;  2LSO A;  3A0H C;  3KFW X;  3DTK A;  5M5X J;  3V4G A;  4M3E A;  3S8P A;  2LF8 A;  1S5L C;  4CCO A;  1BI1 A;  5HNF A;  2UXX A;  1VQ9 I;  4PJL A;  1U8B A;  3QP6 A;  4HX4 A;  1U9O A;  3ZGK A;  1Q1V A;  5BMZ A;  3H3V K;  5K7Z A;  4Y52 J;  3KZZ A;  3VSK A;  3VDX A;  3CTA A;  3A1Y A;  1L3L A;  3PO2 J;  3M8J A;  3GTK J;  3OS1 A;  3G1L A;  1R49 A;  4DNC A;  1IN7 A;  2F2E A;  2EFQ A;  3LNQ A;  4WCG A;  2HYF A;  2R7X A;  4C30 A;  2XSJ C;  2IS1 A;  2C6Y A;  5F27 A;  2BE5 F;  1TWC J;  3G71 I;  1FOW A;  4BL0 B;  2DMQ A;  2L0K A;  2VPR A;  3WTU C;  4FAS D;  3PNV A;  1R9T J;  3QPL A;  1YJN I;  1IG7 A;  4U7B A;  1TW3 A;  2JA7 J;  5B1A H;  1HDP A;  1WWX A;  2ZME B;  2PQ8 A;  1DPR A;  3I56 I;  3HUG A;  1ZTR A;  1IRX A;  4HZF A;  1IC8 A;  1LFU P;  1QZY A;  4HNU A;  3H35 A;  1P7I A;  3RPU A;  2Q2E B;  2FBI A;  2JMW A;  1YX3 A;  2IA1 A;  3OYF A;  2COB A;  1RRJ A;  1KQ9 A;  1QBJ A;  2AQE A;  2OZU A;  4A6D A;  4A3D J;  1WI9 A;  2QVO A;  4IHV A;  3GTQ J;  4KIF A;  4Y4R A;  2IS6 A;  4BAY A;  4P5O A;  3FM5 A;  3ZXS A;  5DYM A;  3COA C;  1LDD A;  3N4M A;  1HQC A;  4L5I A;  3FDY A;  5DUK A;  5GPA A;  1D1C A;  4OIN F;  2R7W A;  1ZG3 A;  4YIR X;  1TLH B;  5LBQ A;  2EIL H;  4U0W A;  2CRG A;  4BBR J;  3PQJ A;  4FHT A;  4A69 C;  1P92 A;  2K3F A;  2BBY A;  2XF7 A;  3JRA A;  2O61 A;  4DQ2 A;  2R0Q C;  4XOT A;  4HF2 A;  5FRM A;  3PL8 A;  2LKP A;  3IP4 B;  2Z1D A;  1TWF J;  4XLC A;  2BOL A;  4U0V A;  4XLF A;  3T0Y A;  5E20 A;  4WXD A;  2PI0 A;  3S16 J;  2XPU A;  1VFC A;  1SFU A;  4FTH A;  3MKZ A;  1VZ0 A;  1G3T A;  4BAC A;  3DKX A;  3CUQ A;  3LSP A;  2QF7 A;  1DGW Y;  1MH4 A;  2O3F A;  5K5R A;  3EPZ A;  4XSZ F;  3CCQ I;  1X2M A;  2YX7 A;  5F08 A;  4Z6Y A;  4HLY A;  3DKW A;  3MWM A;  1T0F A;  2KRF A;  3BP8 A;  3PFY A;  4QWQ A;  2W48 A;  3LAJ A;  3ASN H;  2MH9 A;  4UB8 C;  3FKI J;  3C3W A;  3FIS A;  1T38 A;  2R5Z B;  5H20 A;  5EEA A;  3JRI A;  1EJ9 A;  4DZP A;  3HOY J;  3ERM A;  2BXZ A;  5HOO A;  3A4C A;  2CGP A;  2AHQ A;  2EJR A;  1E3P A;  1BOA A;  2BXY A;  3SZP A;  1Y1V J;  3TOB A;  4OAZ A;  3FHN A;  5E3M A;  1W36 D;  2PMU A;  1E0E A;  1J9I A;  3BQZ A;  1WCM J;  5EJC A;  4F92 B;  1P4X A;  2RAE A;  2W82 A;  5LGU A;  2VT3 A;  2KIF A;  5CYV A;  5HS9 A;  3M4O J;  5FLV A;  3CMA I;  1AA7 A;  2HYJ A;  2M87 A;  2XRL A;  3KP4 A;  3F0C A;  3BTI A;  2L7Z A;  2QBY A;  2V4J C;  2WAD A;  4RBO A;  2NXN B;  1MBF A;  4IJA A;  3KZI C;  3HRS A;  1S8N A;  4G7H F;  3HPH A;  5K5O A;  4I2O A;  3S1N J;  3PNY A;  1XSX A;  1UHS A;  4EV0 A;  2Y30 A;  5LEJ A;  5E18 F;  5J47 A;  3QOP A;  2LF7 A;  4A12 A;  2LBF B;  2DK5 A;  2EA2 A;  1IN4 A;  2HQN A;  3KZY A;  3H9Q A;  3W6J B;  1K4S A;  3E5Q A;  5EG0 B;  3JRH A;  3KPH A;  2OTL I;  2HXO A;  2GIV A;  1C0W A;  4XKC A;  2FOK A;  2ZXJ A;  5EF6 A;  1IRF A;  4V2G A;  3ZN1 A;  3RQI A;  3GTP J;  1ZLJ A;  3DCF A;  2OQR A;  5B66 C;  2X85 A;  1K79 A;  5M5W J;  1DP3 A;  5J1U A;  4AIJ A;  2HS5 A;  2Z2S B;  3LA2 A;  2HVS A;  4U7D A;  4L5J A;  4RA2 A;  3ZQG A;  4BJ5 C;  3HC7 A;  5IYC J;  1CF7 B;  1O3Q A;  3PUF A;  2QQB A;  4NUB A;  3BR5 A;  4ZYH A;  1XDS A;  3RYP A;  2JPC A;  1VQ7 I;  1MD0 A;  1ACI A;  3T8R A;  5M5Y J;  2VKV A;  2F4M B;  5E3O A;  4QTR A;  3K0L A;  4A2U A;  1IXS B;  5C4X J;  3E7L A;  1WH5 A;  1LJ9 A;  4B48 A;  2HPI A;  2PJR B;  3MMY B;  3SHF A;  1MDM A;  1YRN A;  3WHC A;  2Y31 A;  1V4R A;  4E70 A;  4KN7 X;  1FP2 A;  4RB2 C;  2HOT A;  1X3U A;  4DIQ A;  1ONV A;  1TW2 A;  2XAH A;  4H4K C;  2CYY A;  2NS8 A;  2HXI A;  2DA4 A;  4ESB A;  2IJL A;  4HSR A;  1K83 J;  2JA8 J;  2QZ8 A;  1SFE A;  3K1P A;  5DM7 F;  2XGE A;  2CMP A;  2RQP A;  3KLN A;  2EB7 A;  4M6V A;  3J81 Z;  3W2A A;  4HEA 2;  5LFA A;  2ZNY A;  3FZV A;  2BGC A;  4PJJ A;  4XQF A;  3DPU A;  3QOE A;  4B8X A;  4LIV A;  2Y0M A;  2K4B A;  3NQO A;  5LGT A;  1XSD A;  1OR7 A;  2ID6 A;  3DKY A;  1FZP B;  3EQL F;  3FBI B;  3BR1 A;  1G3S A;  4C3H J;  1BN5 A;  3HGG A;  4RS8 A;  2DOA A;  1EKE A;  3AFH A;  4MHG A;  3HOZ J;  2ECC A;  4KA4 A;  2P8T A;  2BY3 A;  4AWX B;  4IO9 F;  5J3L A;  1FIA A;  2ELJ A;  3FWE A;  3I54 A;  4AVP A;  4HX7 A;  3LA3 A;  5JVG F;  4XR6 A;  1D5V A;  4OIO F;  5JVT A;  4CYC A;  2XDV A;  2ZO4 A;  1TQM A;  2GXG A;  2P81 A;  3C2G A;  4UB6 C;  3TL4 X;  4ZDO A;  2FMY A;  2L9S A;  3QAH A;  3GTG J;  4RGU A;  2ESH A;  1XMA A;  4AIH A;  1BIB A;  2UWM A;  4U0Y A;  5IYB J;  3P9K A;  2E1N A;  3OOU A;  5A2Q Z;  4XLN F;  5HS7 A;  1KU2 A;  1UJ8 A;  4AYB A;  5M3M J;  1GXQ A;  2XRO A;  2MD0 A;  1SAN A;  1N77 A;  4JP0 A;  1OMI A;  1HC8 A;  1F9N A;  4ITV A;  3QWL A;  2W85 A;  2JA6 J;  2DFE A;  4M73 A;  3HGY A;  2PFB A;  4WF2 A;  3NEU A;  4OAY A;  2H8W A;  5IOZ A;  4NBQ A;  4Q48 A;  4ZC3 A;  2M2E A;  4BNC A;  1MBH A;  2DOD A;  3CCJ I;  4II2 A;  2EIJ H;  4JYK A;  3H92 A;  4CXF A;  2ZXI A;  3E0J B;  2JUG A;  2LTP A;  3P9C A;  1LE8 B;  2A69 F;  1ORK A;  3IH3 A;  1HCR A;  4IRG A;  2A3S A;  1JGS A;  2A5W A;  3GZN B;  1J5Y A;  1W4M A;  2KJB A;  3BRO A;  1PYV A;  5JHU A;  4M3D A;  4XRF A;  2YPR A;  5CKT A;  3JRB A;  4BE1 A;  2HDC A;  1RR8 C;  1JE8 A;  4L9T A;  3ECO A;  2G7U A;  2DT6 A;  2VBY A;  2ECB A;  2L4M A;  4DYC A;  1X2N A;  5BPD A;  5E3L A;  3HM5 A;  1B72 A;  4DBQ A;  1RIO H;  1X3Z B;  4XNF A;  3BZ6 A;  2Q1Z B;  2JK3 A;  4I0B A;  4DGW B;  4CSW A;  2QYO A;  3IAS 2;  1OYW A;  1LVA A;  3CLO A;  4N9I A;  1V54 H;  1D5Y A;  3HL2 A;  2X1E A;  3H3U A;  2E2H J;  4NC6 A;  1K7A A;  3HHG A;  1OYY A;  3WTX C;  3Q9S A;  2G0E A;  2A5Y B;  1UHM A;  3L9F A;  4IKF A;  1FC3 A;  2X1C A;  3ABM H;  2DO7 A;  2HKX A;  3DQV C;  1ETK A;  5K5Q A;  4ENJ A;  2VXZ A;  1IAW A;  3J7A O;  4KIB A;  1WI3 A;  2CH0 A;  4I09 A;  1EH8 A;  3RSN A;  2E2J J;  3HOW J;  4RGX A;  3PIO F;  2NVT J;  1QHG A;  1Z67 A;  2DAO A;  5L3F A;  1ZG5 A;  2I5U A;  3GFI A;  3KCC A;  3C2B A;  3A2K A;  1NH3 A;  3WE3 A;  1PUE E;  2M0C A;  2R3S A;  2EA4 A;  4D1Q A;  5IP6 A;  2ZJQ F;  2L54 A;  1JJ6 C;  3CD6 I;  2Y75 A;  4LGW A;  4IPA A;  3ABU A;  3BG6 A;  2HPM A;  2W1O A;  1H9G A;  2X1D A;  1JGG A;  3WGH A;  1VQL I;  2LVS A;  1WJC A;  1WVR A;  3GXO A;  4HPQ A;  2BHZ A;  4RLQ A;  1T56 A;  3K4N A;  3TDU C;  4C9Y A;  2DYS H;  3HDD A;  4F52 A;  4HNV A;  1H89 C;  1T39 A;  3GZ6 A;  3TBI A;  1W5S A;  2EH3 A;  1WKM A;  5L3D A;  1OCO H;  4P1W A;  4KIT B;  2WAQ N;  3OR2 C;  3OL4 A;  3CO7 C;  2I8D A;  2F4O B;  4D7N A;  1U0J A;  2MC4 A;  2ELH A;  1HST A;  2CUF A;  4OWR B;  2LKS A;  3CMM A;  4ENK A;  3DXJ F;  1BW5 A;  2E71 A;  1UG2 A;  4YFX F;  3N97 A;  2XAQ A;  3E6M A;  2DFI A;  1KU3 A;  3OSG A;  1HOM A;  3QOD A;  1X4P A;  1ODD A;  2CUZ A;  2LY1 A;  5KK1 A;  2K9S A;  2JT1 A;  5EZH A;  3B02 A;  3C1D A;  2QUF A;  2DA6 A;  2VB6 A;  3FX3 A;  1Z1D A;  1FOK A;  3ZCO A;  3L00 A;  3F6V A;  4G7O F;  2VPL A;  4OMY A;  3HHH A;  3WTT C;  3CJQ B;  1IDZ A;  2Y0S N;  2KQR A;  2QWW A;  4RMN A;  3DLL F;  2EZK A;  1SAU A;  3M9A A;  1VQK I;  3WTZ A;  4CO8 A;  3K4M A;  4EJU A;  4XIC A;  4A0Z A;  2PBI A;  2KMU A;  1N75 A;  4BHB A;  1G59 A;  5CVI A;  3RKW A;  2JRM A;  4JX6 A;  1IN5 A;  5F0H A;  4II3 A;  2XC7 A;  1GXP A;  2CW8 A;  4XMY A;  4IQ4 A;  1MMN A;  2IW5 A;  3TW6 A;  4BQO A;  3EYI A;  2EZH A;  2QQ9 A;  2LH9 A;  2QM3 A;  3CDL A;  3D5R C;  4PJN A;  3SZG A;  4LLL A;  3HOX J;  4AVZ A;  2DPD A;  2R92 J;  1FX7 A;  4LMY A;  1VQO I;  5CVJ A;  1WJB A;  1G2H A;  4QPO A;  5KAF C;  2LK2 A;  4G12 A;  1F1Z A;  2GQQ A;  5LRS A;  2F5V A;  1S7E A;  2HR3 A;  3M1C A;  2MW8 A;  4Y7N J;  1ZRE A;  3PIP F;  2DI3 A;  4JOM A;  2XVC A;  5J8F A;  2WAE A;  1A04 A;  1FMV A;  2K4J A;  2VOP A;  1ETO A;  3BY6 A;  3VEP A;  3FIW A;  5D4R A;  1AHD P;  2ME6 A;  1ETQ A;  1NG6 A;  2DFH A;  2OUM A;  3MD2 A;  4BUP A;  1FLI A;  4Q5S F;  1Y6I A;  1X1B A;  2MFZ A;  3LMM A;  4DYR A;  2DMP A;  3I0T A;  2QA4 I;  3S1M J;  3Q0U A;  2PG4 A;  1ZQ3 P;  3B73 A;  4W97 A;  3PQK A;  1K78 A;  1GVJ A;  2R5Y A;  3BTL A;  2O7O A;  2Q0O A;  3JW4 A;  3CC2 I;  4EEF G;  2EBI A;  2VOD A;  2CO5 A;  4LK0 F;  2GXB A;  3OYB A;  3L2V A;  5BS6 A;  4QPQ A;  1VQ6 I;  4M9S A;  3LSH A;  5BNG A;  2BYV E;  3S32 A;  3ISP A;  3FK6 A;  4A3F J;  5FFX A;  4HNT A;  2KFD A;  3IC7 A;  1JKR C;  5EDN A;  4XID A;  2H94 A;  3DP7 A;  5FJ8 J;  5K7F A;  3I53 A;  3CCL I;  2WY8 Q;  3HTS B;  3IWZ A;  2XB5 A;  2X6W A;  3F8M A;  3NWT A;  2VBZ A;  4PUS A;  1IN6 A;  3LFK A;  2WB1 A;  2IPQ X;  3A0B C;  2V9V A;  3SEQ A;  2ICW G;  1TBX A;  2HQA A;  2YX4 A;  4UXN A;  2VE9 A;  3CCR I;  2XPV A;  3N05 A;  2XF6 A;  1XGN A;  4ZYG A;  4PCQ A;  2VUM J;  3QU3 A;  1TZL A;  4LG0 B;  1TTY A;  3CJT B;  2HTJ A;  5HLT A;  5LD2 C;  1I6H J;  1I3Q J;  2JZY A;  4CYC B;  3CLQ A;  1IF1 A;  2L01 A;  2R7Z J;  2QEX I;  1KYW A;  2HOE A;  2JJ7 A;  1UG0 A;  3J7Z I;  2P5L C;  2R7T A;  4Y17 A;  5TRD A;  2KLO A;  3KP7 A;  1TT5 B;  5EZG A;  3PNT A;  4XRS A;  1R58 A;  1U5T A;  4BJT A;  5AIQ A;  2RC4 A;  2X48 A;  1ON2 A;  1QHH D;  2VQG A;  3J7Y J;  3TKY A;  4A3J J;  2QEN A;  3UNG C;  4ZZD A;  2L2O A;  1VQ4 I;  2M4K A;  4UV9 A;  4XOP A;  1LDJ A;  5LHH A;  2HI3 A;  3DBH B;  1R1U A;  5KVR A;  1BL0 A;  1V55 H;  3I58 A;  4IX7 A;  5CQE A;  1J7K A;  2F5D A;  5JFR A;  1F4K A;  4LIU A;  4UVB A;  3F8F A;  5D5U B;  1PJR A;  2D2W A;  3JRC A;  1W0T A;  2CWE A;  4UY8 I;  1IZ1 A;  5ILV A;  5GPC A;  4E7L A;  1T33 A;  3LOC A;  3U9G A;  4LK1 F;  3HPG A;  2LD5 A;  4QIW N;  2VON A;  2QQ8 A;  4EAT A;  1FYK A;  1MJ9 A;  4LLG F;  2CV2 A;  4S04 A;  2Y9Z A;  2NOG A;  4ZZL A;  4OOI A;  4MTD A;  2EV0 A;  2HQR A;  3JRD A;  1MMG A;  2VC0 A;  3ERE D;  2A05 A;  1V5E A;  3LL7 A;  4E7I A;  1YW9 A;  4IF4 A;  1A6Q A;  2HDW A;  3I64 A;  4RM2 A;  2HEO A;  4BEH B;  3V7C A;  4XOR A;  1Y8R B;  1B72 B;  4KYW A;  2DTR A;  5EGO A;  4HLX A;  2LDU A;  1IXC A;  1VQP I;  3ONQ A;  5C44 J;  3J80 K;  3RZD J;  4CCK A;  3E1S A;  1Z21 A;  2KIS A;  1R5H A;  1ZR2 A;  1X3W B;  1TNS A;  5EYR A;  2FEZ A;  2ADU A;  1HW5 A;  2D1H A;  3WTV C;  2VJ5 A;  2D5V A;  1E17 A;  5J8C A;  1NHA A;  4XBF A;  3G4S I;  2BEO A;  1XSV A;  1ETV A;  4S05 A;  3CF2 A;  3S2D J;  2W84 A;  3JTH A;  3JRE A;  4EGY A;  2R7U A;  3H1C A;  2OQG A;  4E7K A;  1DU0 A;  4M3G A;  5FD5 A;  4UHT A;  1T8I A;  3HRU A;  2O8X A;  1PP8 F;  2M7A A;  2PMZ N;  1FSH A;  1W5T A;  2HKO A;  2M30 A;  4M74 A;  1VQN I;  4AC0 A;  4N4O B;  5FKO A;  3ZQ7 A;  1QQI A;  1R71 A;  1R22 A;  2BVM A;  4RGR A;  3TGN A;  3W2V A;  3O8H A;  3K4K A;  4PGH A;  2IA0 A;  3K70 D;  5J4Y A;  3W6V A;  4HAM A;  2J5P A;  3PM1 A;  1ZRF A;  1OIS A;  2GLO A;  2L7K A;  4S0H B;  1ZEL A;  4A3C J;  4KUM A;  4R79 A;  4IHS A;  1HKT A;  3ZQI A;  5KNL A;  1VTN C;  3F8N A;  4C2T A;  2DJI A;  4F55 A;  1HW1 A;  4G6Q A;  1BJA A;  3BC8 A;  2IGM A;  1OJL A;  2GBY A;  3FMS A;  2JRT A;  1JT6 A;  2OU2 A;  2R7O A;  4PFP A;  2H1L A;  4NQW A;  3QYB A;  3S15 J;  1K6O A;  3CP8 A;  3GF2 A;  5LRR A;  5LGN A;  2LG4 A;  1LFP A;  4GYG A;  2FJ1 A;  1A31 A;  1MJB A;  3GTO J;  2DA5 A;  4DJA A;  2M34 A;  1RNL A;  2HZD A;  3F22 A;  2XSD C;  4XK4 A;  5AIP A;  3T1B A;  4PGG A;  3HKZ N;  3L2U A;  2R7S A;  2VT2 A;  1Y0U A;  3ASO H;  5E79 C;  3A01 A;  1JKO C;  3ZMS A;  2NS0 A;  4CCN A;  3GTL J;  2DQL A;  2V26 A;  3HZJ A;  4B1R A;  4HA8 A;  4JX4 A;  2JPB A;  2KIQ A;  1J75 A;  3CCM I;  3V8L A;  5E1Z B;  1W7P B;  4LD5 A;  4HOB A;  3I4M J;  5J4V A;  2ZFW A;  5H6Q A;  1D3Y A;  1ON1 A;  1Z6T A;  2AXT C;  3K2Z A;  4U88 A;  1XN7 A;  2NNN A;  1LB2 A;  1S7A A;  2Y9Y A;  3H5R A;  3GLX A;  3MKW B;  2R4G A;  4XSX F;  2O03 A;  2KIM A;  3OYN A;  2ACJ A;  2K86 A;  1YJW I;  2KKO A;  3KYL A;  2JTV A;  2P7V B;  3JTG A;  3K10 A;  4D9J A;  3HG9 A;  3RIR A;  4B3X A;  3EUH C;  3E6D A;  5LEK A;  3DTI A;  3HTU A;  4HV6 A;  3EUA A;  4KIG A;  3CCV I;  2COM A;  1MBG A;  4P96 A;  3EUK L;  4WXH A;  2FD5 A;  3RPQ A;  3JAM K;  5IY5 H;  1WJE A;  2E19 A;  3HOV J;  4F93 B;  3LSM A;  3W6K B;  1ZAR A;  1Z3Y A;  3FHZ A;  2F4I A;  1TQP A;  4C3J J;  2W4S A;  5FKL A;  1ULY A;  4D7M A;  2Z99 A;  1FMW A;  4YEL A;  3JAM Z;  1ITY A;  2ZCW A;  3E3V A;  4O3M A;  1IUY A;  2CV0 A;  4AM3 A;  2XUB A;  1T6S A;  2BZT A;  1ZN2 A;  1MBK A;  4F7Z A;  1DP7 P;  5ICE A;  5D4S A;  4CH7 A;  4N4N B;  4BXF A;  5JLX A;  3DPL C;  4YII A;  3CUQ C;  4XLE A;  5ED4 A;  2GOM A;  1SD4 A;  4HDU A;  2F48 A;  3REO A;  5FB2 A;  5ICF A;  4WWC A;  4AU7 A;  3R6S A;  3OIP A;  2W57 A;  2R5Y B;  2GAU A;  2LOO A;  4LG3 A;  3CCU I;  1VI0 A;  1BC7 C;  2HTS A;  2DT7 B;  4LLN A;  2OTJ I;  1TT0 A;  2O5R A;  1MNE A;  1HKS A;  3OIO A;  1OKR A;  1PUF A;  2TRT A;  4P9F A;  3AL0 C;  3I71 A;  1H88 C;  3SYT A;  5JR3 A;  2IGK A;  3JRG A;  1YS7 A;  1LFB A;  3S14 J;  2HDD A;  2LY2 A;  2IT0 A;  2DDB A;  2LP0 A;  3LSK A;  2H6C A;  1FWZ A;  1JXS A;  2KDZ A;  1YIO A;  3GFJ A;  5KCM A;  3S3O A;  1IGN A;  4UUV A;  1VQM I;  3DU5 A;  3FXU A;  1OCP A;  3VYS B;  2P5V A;  3WU1 B;  1X19 A;  2FXA A;  4JQF A;  3RKQ A;  5F04 A;  1FNN A;  4IQJ A;  4HF1 A;  2XAJ A;  1S7O A;  5F1R A;  3D0S A;  2BVL A;  3ELK A;  2AS5 F;  4GXO A;  5L3B A;  2FNA A;  2ZBK A;  3IH2 A;  2ZJR F;  1AWC A;  4XRS G;  3HOT A;  1Y0N A;  2FOW A;  1OCR H;  4LOC A;  2L9N A;  3TO7 A;  4CA0 A;  3ULQ B;  4UNO A;  2DTZ A;  2DOE A;  4D0P A;  3S93 A;  2V1D A;  1BBY A;  2LLK A;  4BY7 J;  3VB2 A;  2EIM H;  2PLY A;  2OBP A;  1BOB A;  1KQ8 A;  4G9Y A;  3PSI A;  1R4M B;  2JVG A;  2NNY A;  4HRI A;  3E5X A;  2G9W A;  2L7F P;  2NS7 A;  4ZTF A;  3FM3 A;  3ZP5 A;  1FYL A;  4ENM A;  5IT9 K;  4EJV A;  4Y33 A;  2WTE A;  5DCF A;  2KRC A;  1LPQ A;  2QSF X;  1QO0 D;  2W00 A;  1MKM A;  2Z9O A;  1NK2 P;  1USS A;  4TV7 A;  4A3M J;  2V9P A;  2V79 A;  1BIA A;  2LY9 A;  2WWY A;  1MGT A;  3TDZ C;  1ZRD A;  5FRN A;  2WV1 A;  3HSF A;  2L7M P;  4I0A A;  1YYV A;  2STT A;  2M0M A;  4IL6 C;  2CFX A;  2O8K A;  3LSG A;  1FP1 D;  1WRJ A;  3M8F A;  1O57 A;  4CYD A;  1FPQ A;  1IV8 A;  2CFO A;  3W2W A;  3CCS I;  1TWH J;  1O3T A;  2ZXW H;  1MSE C;  1D0X A;  2EV6 A;  1BM9 A;  3F8C A;  3OYE A;  3VYR B;  2XB0 X;  1JTY A;  3CC4 I;  1N78 A;  5EGO B;  2QLZ A;  4D5C A;  4IRI A;  5L3G A;  2CUE A;  1B8I A;  3VWB A;  3F23 A;  2AXL A;  1UHW A;  2F5F A;  1Z7U A;  3BZC A;  2FRH A;  2XGD A;  1EV7 A;  4IHX A;  4XKW A;  5DS9 A;  2V6C A;  2D1V A;  1TC3 C;  3I55 I;  5DCM A;  2LNB A;  1APL C;  1O3R A;  3OYI A;  4NB5 A;  1T08 B;  2DDA A;  1RET A;  3WGG A;  3AAF A;  1LKX A;  3K7A J;  2E34 A;  1OR7 C;  2Y69 H;  4MNU A;  1JKQ C;  3WG7 H;  5FFZ A;  1MSF C;  3V8K A;  2MLG A;  4HQE A;  3DWL E;  2BHY A;  3ROU A;  1SFX A;  5ERI A;  3HUG B;  3IRR A;  4XLP F;  2EZL A;  3GO5 A;  4ANJ A;  1E2X A;  4A3L J;  3LWF A;  4CIC A;  4L9N A;  3Q0V A;  3ZN0 A;  3R0A A;  4IEJ A;  3X2Q H;  4RB1 A;  1FBU A;  4IRH A;  3DF8 A;  2R7Q A;  1KGS A;  3G73 A;  2LRE A;  2FML A;  4PK4 A;  3WE2 A;  3LQR A;  4ABZ A;  1IXR C;  1VQ8 I;  3F72 A;  2BW3 A;  2IS4 A;  3V7R A;  3WG9 A;  1X58 A;  4C2U A;  2XRN A;  2EIN H;  4KT6 A;  3FKJ A;  3RKY A;  1R1V A;  4G6D A;  3GVA A;  1V5G A;  3H5A A;  1AKH A;  2QSH X;  2GXA A;  2V6E A;  3I5U A;  5TIS C;  3FMQ A;  4BU2 A;  2EFN A;  4MEY F;  2WV0 A;  4NQW B;  4A6E A;  4CCM A;  2NYX A;  2O6G E;  3E97 A;  5FKN A;  2WA0 A;  3BZK A;  2KIU A;  3ZQQ A;  4X6A J;  3K1M A;  1B59 A;  3TMO A;  2A61 A;  2O0Y A;  5L3C A;  4KIS A;  1D8K A;  2TDX A;  2V7F A;  1SVL A;  3DEW A;  3EDP A;  5HS8 A;  1X1C A;  3NWS A;  4K2E A;  1B6A A;  4LFU A;  4EGZ A;  1QA6 A;  1F43 A;  5DV5 A;  1OCC H;  2K40 A;  4XKB A;  5EEH A;  2ESN A;  4G8X A;  3WGI A;  4ESJ A;  5E3N A;  2LFB A;  2HNH A;  4KMU X;  3QPH A;  3CUQ B;  1FBS A;  2XKO A;  2XGC A;  4BQQ A;  3EYY A;  2RN7 A;  4I01 A;  1S72 I;  3S17 J;  1X1A A;  1VF9 A;  2FX0 A;  3O8G A;  4UUS A;  3GX4 X;  2DW4 A;  2PX9 A;  2KZV A;  1J0R A;  1I50 J;  1WGX A;  2P5K A;  1XGM A;  2DCE A;  2VQH A;  3I4N J;  3KYC B;  2ZNZ A;  3MQ0 A;  3AL0 B;  2P0W A;  2ZME A;  1W5C C;  2M8E A;  3R60 A;  1WH7 A;  2OPT A;  2IGO A;  1LVK A;  3LSI A;  3GEZ A;  1JUS A;  1Y8Q B;  3ZMZ A;  2VAS A;  1OFC X;  3DFG A;  1Y56 A;  1UEL B;  2OAZ A;  3MN2 A;  4PDK A;  1MBE A;  2Q2E A;  4OMZ A;  3RYR A;  4ASN A;  3IKT A;  2R7V A;  2A6E F;  1KU9 A;  3FF5 A;  3FXR A;  1NK3 P;  5GP9 A;  1FY7 A;  4ENN A;  3TO9 A;  4EJO A;  2VJJ A;  5HDK A;  3TOA A;  4C3I J;  1YJ9 I;  3BG7 A;  2FU4 A;  3SQN A;  1PVE A;  3S1R J;  4IHY A;  1D1B A;  1P7J A;  3ECH A;  4M6X A;  2NRA C;  2H6B A;  4DBR A;  2CQK A;  2OF7 A;  3WU0 A;  2QBY B;  5HLI A;  5IPA A;  1LDK B;  2CSO A;  4LB6 B;  3L1P A;  2DYR H;  3MEX A;  3PFI A;  4ZYD A;  4A3G J;  1XCV A;  3H0G J;  3FK7 A;  2M8G X;  4JBA A;  3I59 A;  1G6N A;  1ZHF A;  2WY7 Q;  1SD7 A;  2L9R A;  1QVT A;  3F9K A;  3H9G A;  4OU0 A;  4ZYA A;  3K9T A;  3MAJ A;  4RAY A;  4EJT A;  2PMZ A;  3OSF A;  1PUF B;  3SDG A;  2VQC A;  3E6B A;  1SMT A;  3IAM 2;  3MVP A;  3Q0W A;  4U87 A;  1I1S A;  2HU9 A;  3A02 A;  3QP5 A;  5DM6 F;  1XPX A;  3LA7 A;  2CW0 F;  4ZDP A;  3BCA A;  1XX5 A;  5CPR B;  1TP4 A;  3I4P A;  2CV1 A;  3M7G A;  1S9H A;  5LLQ A;  1DU6 A;  2ME0 A;  4HQM A;  3DBR B;  5K7H A;  3CDI A;  1SD5 A;  5HVQ C;  1LUJ B;  1XS9 A;  5LHI A;  4IHT A;  4UVA A;  3LST A;  1JHF A;  1NG7 A;  2M45 A;  3BLY A;  3NAR A;  4N0B A;  3F8B A;  3QYF A;  2K9N A;  1X1D A;  2RNG A;  4FIS A;  4H0E A;  3KIO A;  2R7R A;  2OD5 A;  2B63 J;  3CCY A;  4GO1 A;  1RI7 A;  2ELK A;  2F6C A;  4F91 B;  3S3M A;  3ZQH A;  3VOD A;  2R5Z A;  4BYY A;  3OWT A;  2QKM B;  3DEU A;  1MDM B;  3CES A;  1YRN B;  1O7L A;  2FA5 A;  3RDI A;  3HRM A;  1V3F A;  6PAX A;  2DK8 A;  2DA3 A;  2P6S A;  4I02 A;  3ABK H;  4BQN A;  2HOS A;  2OJE D;  2J5O A;  2XAU A;  1CGP A;  1ZK8 A;  4A3I J;  1E3O C;  2MLK A;  1UAA A;  4XON A;  3S3N A;  2DFF A;  4ETS A;  2VC1 A;  3BG5 A;  2AO9 A;  4BKX A;  1UMQ A;  1YW7 A;  2PEX A;  1E3H A;  5M3F J;  3J7A Y;  2V1U A;  1B4A A;  3KP2 A;  3OYL A;  3K4C A;  1A5J A;  2UZK A;  3SEZ A;  4QLC U;  3PUB A;  4P55 A;  1EH6 A;  3HSE A;  2ZSH B;  5J1Y A;  2FSW A;  5CVU A;  4GYI A;  2E1M C;  4MIM A;  2OCE A;  4E7H A;  5CQG A;  3I9V 2;  4YG2 F;  2LYC A;  4X0G A;  1FBQ A;  1R5G A;  2LBF A;  1R5I D;  4NNJ A;  1BR4 A;  4L9J A;  2DLL A;  1J59 A;  2Z16 A;  4L9V A;  5EG0 A;  2X6X A;  3WU2 C;  4OIQ F;  5E1X A;  2KT0 A;  2XAG A;  1XGO A;  3JRF A;  2H27 A;  2E36 A;  4ZH4 F;  5HLH A;  3M3Y J;  3R61 A;  3HBL A;  5JI6 A;  1VND A;  3O3K A;  4HST A;  1YOV B;  3Q3S A;  2L5Q A;  1B8I B;  3GFM A;  3F21 A;  2VXD A;  1S29 A;  1O3S A;  4CCJ A;  1P4W A;  2X51 A;  2XIG A;  1CF7 A;  2G7H A;  3OYA A;  1OCT C;  3KP6 A;  3BR0 A;  1EH7 A;  4EM2 A;  3FMR A;  2JSC A;  1LQ1 A;  3A03 A;  2CQX A;  2DOF A;  2GA1 A;  4XM3 A;  1UCR A;  2VBW A;  4DZJ A;  2XGX A;  3B6A A;  1RC9 A;  2HYG D;  3GLL A;  4BGD A;  2K27 A;  3KEO A;  5F0C A;  3OYM A;  2QSG X;  2PJR A;  5DEQ A;  1YE9 A;  5FKM A;  1XC5 A;  1KYZ A;  4BS9 A;  4A93 J;  1OPC A;  2OZ6 A;  3C18 A;  4A0X A;  4HYE A;  1TNT A;  3GME A;  4G7Z F;  4FET A;  2DJN A;  3NAU A;  4YFN F;  4Y15 A;  2M5W A;  4Z2Y A;  4AUX A;  1IO2 A;  2GZW A;  2JSP A;  1BI3 A;  2E1O A;  4M9X A;  1P2F A;  3JCU C;  1WJA A;  2Z3Y A;  4YFK F;  4V2F A;  3KEQ A;  1RZ4 A;  1W36 C;  2V1X A;  2VIX A;  3OOP A;  2K9M A;  3TQN A;  4YRV A;  1YX5 A;  2R93 J;  1H8A C;  2PJP A;  2GIZ A;  1YIT I;  5HDN A;  5L3E A;  1MMS A;  1O7F A;  4ZTJ A;  2ZB9 A;  4I7H A;  5HLG A;  3FXL A;  4HG2 A;  2L9V A;  1RKW A;  1RKT A;  1FOY A;  3P7N A;  2L3D A;  3CUO A;  4NC7 A;  1FYM A;  3OYC A;  2GOX B;  3ZQF A;  2VJI A;  4IOA F;  1GDT A;  1MW7 A;  4UV8 A;  3J80 Z;  2X0L A;  4I99 C;  1P4A A;  2OA4 A;  4M3F A;  5DTD A;  1ETY A;  5BPI A;  1IRZ A;  4I98 B;  1R23 A;  3IHU A;  3WOD F;  4FX4 A;  2GA2 A;  2HVR A;  4LB5 A;  4G6T B;  3CC7 I;  1GHC A;  2XAS A;  2WAF A;  3OMY A;  1HDD C;  3WTW C;  4IOC F;  4A5M A;  3BQY A;  1DPU A;  1XTA A;  2PN6 A;  1W1W E;  1Z6R A;  1XCB A;  2EWN A;  2ETH A;  3U2R A;  1I27 A;  2VKH A;  3BT9 A;  3VFZ A;  3HYI A;  2K85 A;  3ZQL A;  3IWF A;  1ZKG A;  1XD7 A;  2IS2 A;  1YQA A;  2RQQ A;  2XKP A;  4JK1 X;  5JHF A;  4UUS B;  3SFZ A;  1D8J A;  1W7P D;  4XN3 A;  3KP5 A;  1SMY F;  3BR3 A;  4B09 A;  2TCT A;  2D45 A;  2VE8 A;  2NVX J;  4L5E A;  5FO5 A;  2JN6 A;  2FBK A;  5KHD A;  4RLF A;  1Z91 A;  3LQQ A;  3SFI A;  1Y39 A;  4NDL A;  3VYU B;  1POG A;  1LE8 A;  1ZGJ A;  4CDG A;  4RDU A;  3ABL H;  1BI0 A;  2FE3 A;  1K6Y A;  4A0Y A;  3S1Q J;  4IXA A;  4FT8 A;  3OYG A;  5D8L B;  3S2W A;  1G3Y A;  3ZMT A;  3PO3 J;  2A68 F;  4HX8 A;  3WTY C;  2P7C B;  4CHU A;  3IH4 A;  3CZ6 A;  3M1E A;  1ZLK A;  1BR2 A;  1MMA A;  3QPT A;  1EA3 A;  2ZSI B;  3TP0 A;  1R7J A;  1M1E B;  1U9N A;  3BG9 A;  1AOY A;  4I76 A;  5H6R A;  4RAZ A;  3DEE A;  3EUH A;  4YEJ A;  4BHC A;  2GM4 A;  4M9Z A;  3FBN B;  1FOX A;  1U6G A;  5E1W A;  5GAG J;  1G8X A;  3I59 B;  1I6X A;  2JUC A;  4J19 A;  2NVQ J;  4KT5 C;  1EF4 A;  3RZO J;  3GZ5 A;  2M7B A;  3KLO A;  1JHH A;  2V1N A;  2H1K A;  4E6K G;  4UUT A;  2I10 A;  2DMN A;  3D5L A;  4PZJ A;  5FKK A;  2F5E A;  3JSP A;  4ESF A;  1A35 A;  4IHW A;  1ZGW A;  2P6T A;  2W7N A;  1JUM A;  4F3Q A;  3RKX A;  1J2X A;  4L0Y B;  1PDN C;  2MD5 A;  2ISZ A;  3MCZ A;  3QU6 A;  1D0Y A;  2LMD A;  4NC8 A;  3K4J A;  1I1G A;  2E1M B;  3E6C C;  3OIQ A;  3OYH A;  5KAI C;  2HQ5 A;  3O2P E;  4PFO A;  4MTE A;  1SFO J;  4AD9 A;  2WB1 N;  5C4J J;  1LEA A;  5FGM A;  1WPK A;  3H9J A;  3F6O A;  5EEG A;  2E7W A;  3BR6 A;  1U3E M;  1MNM C;  3L7W A;  2A6T A;  2VKE A;  1ZGA A;  1U2W A;  4HDV A;  3FXQ A;  2VJ4 A;  1NTC A;  4BDY A;  2OCC H;  2W25 A;  1YIJ I;  3DLA A;  4L0Z B;  1X1P A;  2A6H F;  4QSH A;  1QZZ A;  4DYQ A;  1QU3 A;  3DV8 A;  3ZRG A;  3L2C A;  2DU9 A;  1K78 B;  1T0F C;  2HGC A;  2M1B A;  2E5N A;  3GWZ A;  3QYE A;  2IAI A;  4MLO A;  5BQT A;  2CQN A;  1P6R A;  2ISY A;  5IP9 J;  4XLA A;  4B44 A;  2X4H A;  1A36 A;  1KZH A;  1N25 A;  3KP3 A;  4B3A A;  2RVC A;  1YO5 C;  1AU7 A;  2X9D A;  2EPF A;  3F3X A;  2HWV A;  2OC6 A;  1KU7 A;  1STZ A;  1I5Z A;  1FEX A;  3CO6 C;  2KPM A;  3D5S C;  4RAF A;  1HLV A;  1MIJ A;  1ZR4 A;  5D6E A;  4E7S A;  3L2R A;  1JUP A;  4MO7 A;  2L02 A;  4BDZ A;  2JWT A;  1HXD A;  2STW A;  1A6I A;  1T95 A;  1Z05 A;  2BV6 A;  1XB4 A;  2R7D A;  4GRI A;  2B0L A;  2DQR A;  4N9H A;  2DN0 A;  2M9H A;  3BTC A;  4LJZ F;  4EVI A;  3AG1 H;  2WAQ A;  5FD6 A;  3C2H A;  4R1H A;  5F64 A;  5B1B H;  1ETX A;  2FQ3 A;  3H5N A;  4M6Y A;  4XKV A;  3TO6 A;  3G6E I;  3M8E A;  3OYD A;  4IZZ A;  4MGR A;  3H3Z A;  1R4N B;  2NVY J;  1OLT A;  3U1D A;  3AG2 H;  1Y1W J;  4E4H A;  4Q4Z F;  4BH9 A;  2V9K A;  1D1A A;  1R6R A;  1GV5 A;  1FTZ A;  4KFC A;  5D6F A;  4GCV A;  5GAD J;  5DUI A;  1JI8 A;  4M71 A;  1W0U A;  2Y48 A;  4RB0 A;  4DOZ A;  3IUO A;  2M4G A;  2EQR A;  2E1C A;  2XPW A;  1SAX A;  1RPW A;  1U5T B;  2FQ4 A;  2H09 A;  3GUD A;  4AID A;  3U1K A;  5GTI C;  1FIP A;  2HOA A;  2WBM A;  3AG3 H;  3CP2 A;  2EFP A;  2FNP A;  5D5W B;  2P4W A;  3DU6 A;  5ICC A;  5E17 F;  4WX9 A;  2KP6 A;  3IKV A;  2O9L A;  4EQQ A;  1YHQ I;  4M72 A;  2Y0S A;  4BQA A;  4KN4 X;  1LEB A;  3J81 K;  1ZAO A;  4FE7 A;  3MZ8 A;  3CME I;  5IT9 Z;  1Z0X A;  3ABT A;  1ZYR F;  3G1M A;  4O6J A;  3HJE A;  1S6L A;  2DMU A;  3GYH X;  4RAG A;  1U78 A;  2Q8K A;  2X6O A;  1R00 A;  3Q9V A;  2DA1 A;  4AIK A;  3S2H J;  2A07 F;  4BE2 A;  2FUG 2;  3DTE A;  3VSL A;  3RPU D;  2YU9 J;  5IYD J;  9ANT A;  2YSR A;  4EM1 A;  5GAH J;  1OCZ H;  2HFH A;  4M3B A;  2EFW A;  3HIF A;  1RR7 A;  2MYS A;  3K4B A;  1IJW C;  2LR8 A;  2QKL B;  3GBG A;  1MZB A;  1QZE A;  3RTR A;  2W24 A;  4A3E J;  1WZ2 A;  1MH3 A;  3KX2 A;  4LG0 A;  5IOY A;  2B9S A;  1T2K A;  3QRF F;  2XV4 S;  3P9I A;  5FLM J;  3FXM A;  3E5U A;  1REP C;  1X4O A;  2E60 A;  3MZY A;  4R8H A;  3ML6 A;  3R0J A;  2N8G A;  5JLW A;  2ZKZ A;  1I3A A;  2L4A A;  5A2Q K;  4YIF A;  4PSW A;  1BW6 A;  4XLH A;  4EMS A;  4BBS J;  1XGS A;  5F1J A;  2IVM A;  4BJ6 C;  3G2B A;  4WK8 F;  3OV8 A;  1UZC A;  2E7X A;  3CJN A;  3GCM A;  2ZJP F;  3HOS A;  4ZJZ A;  5E8G A;  3RI4 A;  2KRH A;  5IP7 J;  3TW7 A;  3BTJ A;  1CQT A;  3VYT B;  4B4C A;  2VI6 A;  2UUZ A;  1ERD A;  1Z3X A;  1IUF A;  4Q47 A;  4PSX A;  2IP2 A;  4KNY A;  3LSJ A;  5B5E C;  5DD8 A;  1QVU A;  3DPT A;  3FXJ A;  3D1N I;  2EFO A;  1B9N A;  3IV5 A;  4BE0 A;  3GFL A;  4A5N A;  2FF4 A;  5J6X A;  1ZG1 A;  1DDN A;  3JSO A;  4DW6 A;  2K7L A;  3CDH A;  4XRM A;  5E8I A;  3BPV A;  4KJZ A;  3DBL B;  3OL3 A;  2DPU A;  4J01 A;  3MZH A;  1MMD A;  4CZC A;  4JX5 A;  4P9U A;  1BI2 A;  1MJA A;  1YI2 I;  1WSU A;  2PMH A;  1HSJ A;  2RDP A;  2DXI A;  1DQU A;  2NVU B;  4RM3 A;  3MFK A;  4BEH A;  4J00 A;  5TJJ A;  3T8T A;  4BXX J;  2DBB A;  4HW0 A;  1DGR M;  3A01 B;  2H8R A;  1O4X A;  3R4K A;  1FSE A;  1BJZ A;  4D5F A;  3L2Q A;  3QQA A;  3BPX A;  4HV5 A;  1IRG A;  3RQ4 A;  5DD4 A;  3WHB A;  2KJC A;  4ON0 A;  3KE2 A;  2CG4 A;  3NRV A;  2MAB A;  2LRD A;  3UKG A;  2EIK H;  1G3W A;  3OYJ A;  1IW7 F;  5B3S H;  2OV7 A;  3I3L A;  1LNW A;  1RUN A;  2RNJ A;  1Z77 A;  2Y2Z A;  3EET A;  3RCO A;  2K5C A;  1YS6 A;  2M3A A;  2R7F A;  1SFK A;  2E35 A;  3T5X A;  2MG4 A;  2E2I J;  4MQ9 F;  2VKD A;  4GFB A;  3ZMV A;  1RUO A;  3CJR B;  3BCB A;  3WTS C;  3O6B B;  1RES A;  5J40 A;  4HF0 A;  3K69 A;  1G4D A;  2IBD A;  2RRE A;  2K02 A;  1WJ5 A;  4KMF A;  3ZQC A;  3GTM J;  2VL8 A;  4Y3O A;  3G1O A;  1XG1 A;  5AON A;  1WFX A;  2LKX A;  1QPI A;  3BJA A;  1OQY A;  2JA2 A;  3SXY A;  3K1N A;  1JTX A;  4V19 K;  2DT5 A;  2VN2 A;  2MA3 A;  4E7Z A;  2BY2 A;  4EM0 B;  4E7J A;  3CQZ J;  1WJF A;  3HEF A;  4ZYE A;  3BR2 A;  1T98 A;  1UFM A;  5CLS A;  1QRY A;  3M07 A;  3OY9 A;  5D5V B;  3CF5 F;  2MSY A;  4OIR F;  1JT0 A;  2ZC2 A;  3MKY B;  2XAF A;  2K9L A;  3UR3 C;  5K1Y A;  3BG3 A;  4L18 B;  2UXN A;  3W3C A;  3AKZ A;  1TWA J;  1UST A;  1YLF A;  2KZG A;  2LC2 A;  3LAP A;  2GWR A;  1QNT A;  5LHG A;  4BY1 J;  4O5V A;  5DDG A;  4RB3 C;  2MC3 A;  4PJ0 C;  1L0O C;  2YR2 A;  3K2A A;  1WJD A;  2JA5 J;  5HDG A;  2KDO A;  5C3E J;  4CZZ A;  3PSF A;  5CVV A;  2CS3 A;  4Y13 A;  1XMK A;  2ZME C;  2BY1 A;  1J09 A;  2CU7 A;  2KL4 A;  2CW7 A;  3C7J A;  4KIC A;  5ICG A;  1SEU A;  5CJ9 A;  1FTT A;  2IGN A;  3BDD A;  2EZI A;  1FJL A;  1ZRC A;  1IDY A;  3HXL A;  2K3P A;  1W7P A;  5HOD A;  3QPS A;  1QPM A;  3FXO A;  5HNH A;  1DUX C;  2Z5U A;  3HRT A;  1KA8 A;  1YG2 A;  4A3K J;  3L09 A;  2RKH A;  4CGZ A;  2MBF A;  2QCO A;  1YW8 A;  1BA5 A;  5F6F A;  3V8J A;  4MFE A;  3K6G A;  1R1T A;  3U21 A;  3RJP A;  3ZMU A;  1K61 A;  2WC2 A;  4OIP F;  2HZT A;  4WXC A;  1Z9C A;  2EV5 A;  3HKZ A;  4GDF A;  5ILS A;  1TL8 A;  1D0Z A;  1FT9 A;  4HBL A;  3G3Z A;  2CQ7 A;  3CCE I;  1HKQ A;  3LFU A;  3OYK A;  1SC7 A;  4IVN A;  2CJJ A;  4FX0 A;  3H0D A;  1F36 A;  3K70 C;  1U8R A;  4EJW A;  1JJ8 C;  2BY0 A;  1Z7L A;  3TP3 A;  1H0M A;  1HF0 A;  2IA2 A;  2VBX A;  3P5J A;  3V7S A;  3FXK A;  1YTY A;  3H36 A;  5D8K B;  3GTJ J;  4AYB N;  3ZMD A;  4I6Z A;  1MND A;  1HBX G;  4MQV A;  1YFH A;  3KYD B;  2RGV A;  4CUG A;  2UV1 A;  3OS0 A;  4NHJ A;  3AG4 H;  4B47 A;  1H9T A;  1HW2 A;  3BJ6 A;  4RGS A;  3ESW B;  4BHP A;  1GVD A;  2E5Z A;  2QGU A;  1GUU A;  2IRF G;  1TWG J;  3TED A;  2DMT A;  5FLX K;  1ENH A;  3HB9 A;  1B1B A;  2F5C A;  1ETW A;  2CUJ A;  3SZT A;  2X6Y A;  2ZFU A;  2KHM A;  4UVC A;  3BWG A;  5H2F C;  4FCY A;  1F5T A;  1VQ5 I;  4X1E A;  5ILU A;  3OS2 A;  2XHK A;  4KDP A;  2K9Q A;  2NAZ A;  4XN0 A;  5TGT A;  3KEY A;  2ID3 A;  3LSR A;  1HA8 A;  4LIT A;  1SVO A;  2VOO A;  5FLX Z;  2RV8 A;  4GGG A;  3L2W A;  1IN8 A;  1OYI A;  3BJO A;  3B6C A;  1PP7 U;  1KQ0 A;  3SJM A;  4FE4 A;  1XDU A;  2EK5 A;  3VOE A;  3HOU J;  3ZOB A;  5F0F A;  1XMX A;  2CQQ A;  5GTH C;  2FBH A;  3ZR8 X;  5J1R A;  4BXU A;  3VPR A;  2DA7 A;  5DCM B;  1B9M A;  1K4T A;  4C2M J;  3V42 A;  2VLA A;  4A3B J;  1S3J A;  1V5F A;  1KON A;  2JVH A;  3K4L A;  1WHU A;  5FRO A;  3IL2 A;  2IXS A;  1SD6 A;  4MFD A;  2B7E A;  1R36 A;  3OR1 C;  3GW2 A;  4CCL A;  3IRQ A;  2NOJ B;  4XL9 A;  1GV2 A;  1SVM A;  2IEK A;  2YUS A;  1UB9 A;  4ZDL A;  5CVR A;  2MH2 A;  3SDB A;  1GT0 C;  5D5X B;  1MBJ A;  5IT3 A;  3KET A;  2YS9 A;  2XF5 A;  2QQA A;  1IV6 A;  1JKP C;  2DA2 A;  1WQ2 A;  2Z33 A;  5GAE J;  2HVQ A;  1QGP A;  3BOQ A;  3CMY A;  4B43 A;  5BOX A;  3JR9 A;  3PJR A;  1P9Q C;  2ZJ2 A;  4W1U A;  2ZXH A;  2VQL A;  1ZH5 A;  4G94 A;  2BW3 B;  2JQ7 A;  1I39 A;  4PJM A;  4MEX F; 
#chains in the Genus database with same CATH homology
 1U5T C;  3HSR A;  2YU3 A;  3ZPL A;  3Q5F A;  1TQI A;  1Q1H A;  1BC8 C;  2LSO A;  3KFW X;  3V4G A;  2LF8 A;  1BI1 A;  2UXX A;  3QP6 A;  4HX4 A;  5BMZ A;  3KZZ A;  3CTA A;  1L3L A;  4DNC A;  1IN7 A;  2F2E A;  2EFQ A;  4WCG A;  2HYF A;  2C6Y A;  2BE5 F;  3WTU C;  4U7B A;  1TW3 A;  1WWX A;  2ZME B;  2PQ8 A;  1DPR A;  3HUG A;  4HZF A;  1QZY A;  3RPU A;  2FBI A;  2IA1 A;  1KQ9 A;  1QBJ A;  2OZU A;  4A6D A;  1WI9 A;  2QVO A;  4KIF A;  4BAY A;  4P5O A;  3FM5 A;  3COA C;  5DYM A;  1LDD A;  3N4M A;  1HQC A;  4L5I A;  5DUK A;  4OIN F;  1ZG3 A;  1TLH B;  5LBQ A;  4U0W A;  3PQJ A;  4FHT A;  1P92 A;  2BBY A;  2O61 A;  4DQ2 A;  4HF2 A;  2LKP A;  4U0V A;  3T0Y A;  5E20 A;  4WXD A;  2PI0 A;  1SFU A;  1G3T A;  3CUQ A;  2O3F A;  5K5R A;  4XSZ F;  2YX7 A;  4HLY A;  3DKW A;  3MWM A;  1T0F A;  2KRF A;  3BP8 A;  3LAJ A;  4QWQ A;  2MH9 A;  3C3W A;  1T38 A;  5H20 A;  5HOO A;  2CGP A;  2EJR A;  1BOA A;  3SZP A;  3TOB A;  1J9I A;  2PMU A;  1P4X A;  5LGU A;  2VT3 A;  2KIF A;  5CYV A;  5HS9 A;  2M87 A;  3KP4 A;  2QBY A;  4IJA A;  3HRS A;  1S8N A;  4G7H F;  5K5O A;  4I2O A;  1XSX A;  4EV0 A;  5LEJ A;  5E18 F;  3QOP A;  2LF7 A;  4A12 A;  2DK5 A;  2EA2 A;  1IN4 A;  2HQN A;  3KZY A;  3W6J B;  3E5Q A;  2GIV A;  1C0W A;  2FOK A;  2ZXJ A;  1IRF A;  3ZN1 A;  1ZLJ A;  2OQR A;  1K79 A;  4AIJ A;  2HS5 A;  3LA2 A;  4U7D A;  4L5J A;  1CF7 B;  1O3Q A;  2QQB A;  4ZYH A;  1XDS A;  3RYP A;  2JPC A;  1MD0 A;  3T8R A;  3K0L A;  4A2U A;  1IXS B;  1LJ9 A;  3SHF A;  1MDM A;  1V4R A;  4E70 A;  4KN7 X;  1FP2 A;  4RB2 C;  1X3U A;  1ONV A;  1TW2 A;  2XAH A;  2CYY A;  4ESB A;  2IJL A;  2QZ8 A;  1SFE A;  3K1P A;  2RQP A;  3KLN A;  2EB7 A;  3J81 Z;  2ZNY A;  3FZV A;  2BGC A;  4B8X A;  2Y0M A;  2K4B A;  3NQO A;  5LGT A;  1XSD A;  1OR7 A;  1FZP B;  3EQL F;  1G3S A;  1BN5 A;  4RS8 A;  4MHG A;  4KA4 A;  2P8T A;  4AWX B;  3FWE A;  3I54 A;  4AVP A;  4HX7 A;  3LA3 A;  1D5V A;  4OIO F;  5JVT A;  2ZO4 A;  1TQM A;  2GXG A;  2FMY A;  3QAH A;  4RGU A;  2ESH A;  1XMA A;  4AIH A;  1BIB A;  2UWM A;  4U0Y A;  3P9K A;  2E1N A;  5A2Q Z;  4XLN F;  5HS7 A;  1KU2 A;  1GXQ A;  2XRO A;  1OMI A;  1F9N A;  2W85 A;  4M73 A;  2PFB A;  4WF2 A;  3NEU A;  4Q48 A;  4BNC A;  3H92 A;  4CXF A;  3P9C A;  2A69 F;  4IRG A;  2A3S A;  1JGS A;  1J5Y A;  1W4M A;  2KJB A;  3BRO A;  5JHU A;  4XRF A;  2YPR A;  2HDC A;  1JE8 A;  4L9T A;  3ECO A;  2G7U A;  2VBY A;  5BPD A;  2L4M A;  1RIO H;  3BZ6 A;  4I0B A;  2QYO A;  1OYW A;  1LVA A;  3CLO A;  4N9I A;  3H3U A;  1K7A A;  3HHG A;  1OYY A;  3WTX C;  3Q9S A;  2A5Y B;  1UHM A;  3L9F A;  1FC3 A;  2DO7 A;  2HKX A;  3DQV C;  5K5Q A;  4ENJ A;  1IAW A;  2VXZ A;  3J7A O;  4KIB A;  4I09 A;  1EH8 A;  4RGX A;  2DAO A;  5L3F A;  1ZG5 A;  3GFI A;  3KCC A;  3WE3 A;  1PUE E;  2R3S A;  2EA4 A;  2L54 A;  2Y75 A;  4LGW A;  4IPA A;  3ABU A;  1H9G A;  3WGH A;  3GXO A;  3TDU C;  1T39 A;  3GZ6 A;  1W5S A;  5L3D A;  1WKM A;  3CO7 C;  2ELH A;  1HST A;  4ENK A;  3DXJ F;  4YFX F;  3N97 A;  2XAQ A;  3E6M A;  2DFI A;  1KU3 A;  1ODD A;  5KK1 A;  2JT1 A;  3B02 A;  3C1D A;  2QUF A;  3FX3 A;  1Z1D A;  1FOK A;  3L00 A;  3F6V A;  4G7O F;  4OMY A;  3HHH A;  3WTT C;  2QWW A;  3M9A A;  3WTZ A;  4CO8 A;  4EJU A;  4A0Z A;  2PBI A;  4BHB A;  5CVI A;  3RKW A;  1IN5 A;  1GXP A;  2IW5 A;  3EYI A;  2QQ9 A;  2QM3 A;  4LLL A;  2DPD A;  1FX7 A;  4LMY A;  5CVJ A;  1F1Z A;  2GQQ A;  5LRS A;  2HR3 A;  1ZRE A;  2DI3 A;  2XVC A;  5J8F A;  1A04 A;  2K4J A;  2VOP A;  3BY6 A;  3VEP A;  5D4R A;  1FLI A;  4Q5S F;  3I0T A;  2PG4 A;  3B73 A;  3PQK A;  1K78 A;  1GVJ A;  2Q0O A;  3JW4 A;  2VOD A;  2CO5 A;  4LK0 F;  2GXB A;  5BS6 A;  4M9S A;  2BYV E;  3ISP A;  5FFX A;  3IC7 A;  2H94 A;  3DP7 A;  3I53 A;  3HTS B;  3IWZ A;  3F8M A;  2VBZ A;  1IN6 A;  3LFK A;  2IPQ X;  2V9V A;  1TBX A;  2YX4 A;  4UXN A;  2VE9 A;  1XGN A;  4ZYG A;  4PCQ A;  3QU3 A;  4LG0 B;  1TTY A;  2HTJ A;  2JZY A;  1IF1 A;  2L01 A;  1KYW A;  2HOE A;  2P5L C;  4Y17 A;  5TRD A;  3KP7 A;  1R58 A;  1U5T A;  5AIQ A;  2RC4 A;  1ON2 A;  3TKY A;  2QEN A;  4ZZD A;  4UV9 A;  1LDJ A;  5LHH A;  1R1U A;  5KVR A;  3I58 A;  1J7K A;  2F5D A;  5JFR A;  1F4K A;  4UVB A;  3F8F A;  5D5U B;  2D2W A;  2CWE A;  1IZ1 A;  5ILV A;  3U9G A;  4LK1 F;  2VON A;  1FYK A;  1MJ9 A;  4LLG F;  4S04 A;  4ZZL A;  4OOI A;  4MTD A;  2EV0 A;  2HQR A;  2VC0 A;  3ERE D;  1YW9 A;  4IF4 A;  2HEO A;  3I64 A;  3V7C A;  4KYW A;  2DTR A;  4HLX A;  2LDU A;  1IXC A;  3J80 K;  1R5H A;  1TNS A;  2FEZ A;  2ADU A;  1HW5 A;  2D1H A;  3WTV C;  1E17 A;  5J8C A;  1NHA A;  4XBF A;  2BEO A;  1XSV A;  4S05 A;  2W84 A;  3JTH A;  4EGY A;  2OQG A;  5FD5 A;  4UHT A;  3HRU A;  2O8X A;  1PP8 F;  1FSH A;  1W5T A;  2HKO A;  2M30 A;  4M74 A;  3ZQ7 A;  1QQI A;  1R22 A;  4RGR A;  3TGN A;  4PGH A;  2IA0 A;  4HAM A;  2J5P A;  1ZRF A;  4KUM A;  4R79 A;  4IHS A;  1HKT A;  1VTN C;  3F8N A;  1HW1 A;  4G6Q A;  1BJA A;  3FMS A;  2JRT A;  2OU2 A;  4NQW A;  1K6O A;  3GF2 A;  5LRR A;  5LGN A;  4GYG A;  1MJB A;  1RNL A;  3F22 A;  5AIP A;  3T1B A;  4PGG A;  2VT2 A;  1Y0U A;  3ZMS A;  2NS0 A;  2DQL A;  4HA8 A;  2JPB A;  1J75 A;  3V8L A;  5E1Z B;  1W7P B;  4LD5 A;  4HOB A;  2ZFW A;  5H6Q A;  1D3Y A;  1ON1 A;  1Z6T A;  3K2Z A;  4U88 A;  1XN7 A;  2NNN A;  1LB2 A;  1S7A A;  3GLX A;  4XSX F;  2O03 A;  2KIM A;  2ACJ A;  2K86 A;  3JTG A;  2KKO A;  2JTV A;  2P7V B;  3RIR A;  3E6D A;  5LEK A;  3HTU A;  4HV6 A;  4KIG A;  2COM A;  3RPQ A;  4P96 A;  4WXH A;  3JAM K;  3W6K B;  1ZAR A;  3FHZ A;  1TQP A;  1ULY A;  2Z99 A;  3JAM Z;  2ZCW A;  3E3V A;  4O3M A;  1IUY A;  2XUB A;  1T6S A;  1ZN2 A;  4F7Z A;  1DP7 P;  5ICE A;  5D4S A;  3DPL C;  4YII A;  3CUQ C;  5ED4 A;  1SD4 A;  4HDU A;  3REO A;  5FB2 A;  5ICF A;  4WWC A;  3R6S A;  2W57 A;  2GAU A;  1BC7 C;  2HTS A;  4LLN A;  1HKS A;  1OKR A;  4P9F A;  3I71 A;  5JR3 A;  1YS7 A;  2IT0 A;  2H6C A;  1FWZ A;  1JXS A;  1YIO A;  3GFJ A;  4UUV A;  3FXU A;  2P5V A;  3WU1 B;  4JQF A;  2FXA A;  1FNN A;  4HF1 A;  2XAJ A;  1S7O A;  5F1R A;  3D0S A;  3ELK A;  2AS5 F;  4GXO A;  5L3B A;  2FNA A;  2ZBK A;  1AWC A;  3HOT A;  3TO7 A;  3ULQ B;  4UNO A;  4D0P A;  2V1D A;  1BBY A;  3VB2 A;  2PLY A;  2OBP A;  1KQ8 A;  4G9Y A;  2NNY A;  3E5X A;  2G9W A;  3FM3 A;  3ZP5 A;  1FYL A;  4ENM A;  5IT9 K;  4EJV A;  2WTE A;  5DCF A;  1QO0 D;  1MKM A;  2Z9O A;  1USS A;  4TV7 A;  2V79 A;  1BIA A;  2WWY A;  1ZRD A;  1MGT A;  3TDZ C;  3HSF A;  4I0A A;  1YYV A;  2STT A;  2CFX A;  1FP1 D;  1WRJ A;  3M8F A;  1O57 A;  4CYD A;  1FPQ A;  1O3T A;  2EV6 A;  1BM9 A;  3F8C A;  2QLZ A;  4IRI A;  5L3G A;  3F23 A;  2AXL A;  1UHW A;  2F5F A;  1Z7U A;  2FRH A;  1EV7 A;  2V6C A;  2D1V A;  5DCM A;  2LNB A;  1O3R A;  4NB5 A;  3WGG A;  3AAF A;  4MNU A;  5FFZ A;  3V8K A;  2MLG A;  4HQE A;  3ROU A;  1SFX A;  5ERI A;  3IRR A;  4XLP F;  3GO5 A;  1E2X A;  3LWF A;  4CIC A;  4L9N A;  3ZN0 A;  3R0A A;  4RB1 A;  1FBU A;  4IRH A;  3DF8 A;  1KGS A;  3G73 A;  2FML A;  3WE2 A;  3LQR A;  1IXR C;  3F72 A;  3V7R A;  3WG9 A;  2XRN A;  3RKY A;  1R1V A;  4G6D A;  3GVA A;  3I5U A;  3FMQ A;  2EFN A;  4MEY F;  2WV0 A;  4A6E A;  2NYX A;  2O6G E;  3E97 A;  2KIU A;  3K1M A;  1B59 A;  2A61 A;  2O0Y A;  5L3C A;  1D8K A;  2TDX A;  3EDP A;  5HS8 A;  4K2E A;  1B6A A;  4LFU A;  4EGZ A;  5DV5 A;  5EEH A;  2ESN A;  4G8X A;  3WGI A;  4ESJ A;  4KMU X;  3QPH A;  3CUQ B;  1FBS A;  2XKO A;  3EYY A;  2RN7 A;  4I01 A;  3GX4 X;  2DW4 A;  1J0R A;  2P5K A;  1XGM A;  2ZNZ A;  3MQ0 A;  2ZME A;  2M8E A;  3R60 A;  3GEZ A;  3ZMZ A;  3DFG A;  2OAZ A;  4PDK A;  4ASN A;  4OMZ A;  2Q2E A;  3RYR A;  3IKT A;  2A6E F;  1KU9 A;  3FF5 A;  3FXR A;  1FY7 A;  4ENN A;  3TO9 A;  4EJO A;  5HDK A;  3TOA A;  2FU4 A;  3SQN A;  3ECH A;  4M6X A;  2NRA C;  2H6B A;  2CQK A;  3WU0 A;  2QBY B;  5HLI A;  1LDK B;  2CSO A;  4LB6 B;  3MEX A;  3PFI A;  4ZYD A;  1XCV A;  4JBA A;  3I59 A;  1G6N A;  1ZHF A;  1SD7 A;  4OU0 A;  3K9T A;  3MAJ A;  4RAY A;  4EJT A;  3E6B A;  1SMT A;  1I1S A;  3QP5 A;  3LA7 A;  2CW0 F;  3I4P A;  3M7G A;  5LLQ A;  4HQM A;  1SD5 A;  5HVQ C;  5LHI A;  4IHT A;  4UVA A;  3LST A;  1JHF A;  2M45 A;  4N0B A;  3F8B A;  4H0E A;  2OD5 A;  4GO1 A;  1RI7 A;  3VOD A;  4BYY A;  1MDM B;  3DEU A;  1O7L A;  2FA5 A;  3RDI A;  3HRM A;  1V3F A;  6PAX A;  2DK8 A;  2P6S A;  4I02 A;  2J5O A;  1CGP A;  2MLK A;  4ETS A;  2VC1 A;  1YW7 A;  2PEX A;  2V1U A;  1B4A A;  3KP2 A;  2UZK A;  4QLC U;  4P55 A;  1EH6 A;  3HSE A;  2FSW A;  5CVU A;  4GYI A;  4YG2 F;  1FBQ A;  1R5G A;  4L9J A;  2DLL A;  1J59 A;  4L9V A;  4OIQ F;  5E1X A;  2XAG A;  1XGO A;  2H27 A;  4ZH4 F;  5HLH A;  3R61 A;  5JI6 A;  3O3K A;  3GFM A;  3F21 A;  1S29 A;  1O3S A;  1P4W A;  2XIG A;  1CF7 A;  2G7H A;  3KP6 A;  1EH7 A;  4EM2 A;  3FMR A;  2JSC A;  1LQ1 A;  2GA1 A;  1UCR A;  2VBW A;  2XGX A;  2HYG D;  2K27 A;  3KEO A;  5DEQ A;  1KYZ A;  1OPC A;  2OZ6 A;  3C18 A;  4A0X A;  4HYE A;  1TNT A;  4G7Z F;  4YFN F;  4Y15 A;  2M5W A;  4Z2Y A;  2GZW A;  1BI3 A;  4M9X A;  1P2F A;  2Z3Y A;  4YFK F;  3KEQ A;  1RZ4 A;  2V1X A;  3OOP A;  3TQN A;  2PJP A;  5HDN A;  5L3E A;  1O7F A;  4I7H A;  5HLG A;  3P7N A;  2L3D A;  3CUO A;  1FYM A;  4UV8 A;  3J80 Z;  2X0L A;  1P4A A;  2OA4 A;  5BPI A;  4I98 B;  1R23 A;  3IHU A;  3WOD F;  4FX4 A;  2GA2 A;  4LB5 A;  1GHC A;  2XAS A;  1DPU A;  3WTW C;  4A5M A;  2PN6 A;  1Z6R A;  1XCB A;  2EWN A;  2ETH A;  3U2R A;  1I27 A;  3VFZ A;  3HYI A;  3IWF A;  1XD7 A;  1YQA A;  2XKP A;  4JK1 X;  1D8J A;  3SFZ A;  1W7P D;  3KP5 A;  1SMY F;  4B09 A;  2D45 A;  2VE8 A;  5FO5 A;  2FBK A;  1Z91 A;  3LQQ A;  1ZGJ A;  4CDG A;  1BI0 A;  2FE3 A;  4A0Y A;  4IXA A;  4FT8 A;  5D8L B;  3S2W A;  1G3Y A;  3ZMT A;  2A68 F;  4HX8 A;  3WTY C;  2P7C B;  4CHU A;  3M1E A;  1ZLK A;  3QPT A;  1R7J A;  1AOY A;  5H6R A;  4RAZ A;  3EUH A;  4BHC A;  4M9Z A;  1U6G A;  5E1W A;  3I59 B;  1I6X A;  4KT5 C;  3GZ5 A;  3KLO A;  1JHH A;  3D5L A;  4PZJ A;  2F5E A;  3JSP A;  4ESF A;  2P6T A;  3RKX A;  1J2X A;  4L0Y B;  1PDN C;  2MD5 A;  2ISZ A;  3MCZ A;  3QU6 A;  1I1G A;  3E6C C;  3O2P E;  4MTE A;  4AD9 A;  1LEA A;  5FGM A;  5EEG A;  3F6O A;  2E7W A;  1U3E M;  3L7W A;  1ZGA A;  1U2W A;  4HDV A;  3FXQ A;  2W25 A;  4L0Z B;  2A6H F;  1QZZ A;  3DV8 A;  3L2C A;  2DU9 A;  1K78 B;  2HGC A;  2M1B A;  3GWZ A;  5BQT A;  1P6R A;  2ISY A;  2X4H A;  3KP3 A;  2RVC A;  1YO5 C;  3F3X A;  2HWV A;  1KU7 A;  1STZ A;  1I5Z A;  3CO6 C;  5D6E A;  2L02 A;  1HXD A;  2STW A;  1Z05 A;  2BV6 A;  1XB4 A;  2R7D A;  2B0L A;  2DQR A;  4N9H A;  4EVI A;  4LJZ F;  5FD6 A;  4R1H A;  5F64 A;  2FQ3 A;  4M6Y A;  3TO6 A;  3M8E A;  4MGR A;  3H3Z A;  3U1D A;  4Q4Z F;  4BH9 A;  4KFC A;  5D6F A;  4GCV A;  5DUI A;  4M71 A;  2Y48 A;  4RB0 A;  2E1C A;  1SAX A;  1U5T B;  2H09 A;  3GUD A;  2EFP A;  2FNP A;  5D5W B;  2P4W A;  5ICC A;  5E17 F;  4WX9 A;  3IKV A;  4EQQ A;  4M72 A;  4BQA A;  4KN4 X;  1LEB A;  3J81 K;  1ZAO A;  5IT9 Z;  3ABT A;  1ZYR F;  4O6J A;  1S6L A;  3GYH X;  1U78 A;  2Q8K A;  1R00 A;  3Q9V A;  4AIK A;  2A07 F;  2YSR A;  4EM1 A;  2HFH A;  2EFW A;  3HIF A;  1MZB A;  3RTR A;  2W24 A;  4LG0 A;  1T2K A;  3QRF F;  2XV4 S;  3P9I A;  3E5U A;  1REP C;  3MZY A;  4R8H A;  3ML6 A;  3R0J A;  2ZKZ A;  2L4A A;  5A2Q K;  4YIF A;  4EMS A;  1XGS A;  2IVM A;  4WK8 F;  3OV8 A;  2E7X A;  3CJN A;  3HOS A;  5E8G A;  3RI4 A;  4Q47 A;  2IP2 A;  4KNY A;  5DD8 A;  3DPT A;  2EFO A;  1B9N A;  3GFL A;  4A5N A;  2FF4 A;  5J6X A;  1ZG1 A;  1DDN A;  3JSO A;  2K7L A;  3CDH A;  5E8I A;  3BPV A;  2DPU A;  3MZH A;  4P9U A;  1BI2 A;  1MJA A;  1WSU A;  2PMH A;  1HSJ A;  2RDP A;  3MFK A;  5TJJ A;  3T8T A;  2DBB A;  4HW0 A;  3R4K A;  1FSE A;  3BPX A;  4HV5 A;  1IRG A;  5DD4 A;  2KJC A;  4ON0 A;  3KE2 A;  2CG4 A;  3NRV A;  1G3W A;  1IW7 F;  1LNW A;  1RUN A;  2RNJ A;  3EET A;  1YS6 A;  2R7F A;  3T5X A;  4MQ9 F;  3ZMV A;  1RUO A;  3WTS C;  3O6B B;  4HF0 A;  3K69 A;  1G4D A;  2K02 A;  4KMF A;  5AON A;  3BJA A;  3SXY A;  3K1N A;  2DT5 A;  2VN2 A;  2MA3 A;  4EM0 B;  4ZYE A;  1T98 A;  1UFM A;  5CLS A;  5D5V B;  4OIR F;  2XAF A;  5K1Y A;  4L18 B;  2UXN A;  1UST A;  1YLF A;  3LAP A;  2GWR A;  1QNT A;  5LHG A;  4O5V A;  5DDG A;  4RB3 C;  2MC3 A;  1L0O C;  2YR2 A;  5HDG A;  4CZZ A;  5CVV A;  4Y13 A;  1XMK A;  3C7J A;  4KIC A;  5ICG A;  5CJ9 A;  3BDD A;  1ZRC A;  1W7P A;  1QPM A;  1DUX C;  2Z5U A;  3HRT A;  1KA8 A;  1YG2 A;  3L09 A;  2RKH A;  4CGZ A;  2MBF A;  1YW8 A;  5F6F A;  3V8J A;  1R1T A;  3RJP A;  3ZMU A;  2WC2 A;  4OIP F;  2HZT A;  4WXC A;  1Z9C A;  2EV5 A;  5ILS A;  1FT9 A;  4HBL A;  3G3Z A;  1HKQ A;  4IVN A;  4FX0 A;  1U8R A;  4EJW A;  1H0M A;  2IA2 A;  2VBX A;  3V7S A;  1YTY A;  5D8K B;  3ZMD A;  1HBX G;  4MQV A;  1YFH A;  2RGV A;  4NHJ A;  1H9T A;  1HW2 A;  3BJ6 A;  4RGS A;  4BHP A;  2IRF G;  5FLX K;  1B1B A;  2F5C A;  3SZT A;  4UVC A;  3BWG A;  1F5T A;  5ILU A;  2XHK A;  4KDP A;  2NAZ A;  2VOO A;  5FLX Z;  2RV8 A;  4GGG A;  1IN8 A;  1OYI A;  3BJO A;  1PP7 U;  1KQ0 A;  1XDU A;  2EK5 A;  3VOE A;  2FBH A;  4BXU A;  5DCM B;  1B9M A;  1S3J A;  3IL2 A;  1SD6 A;  1R36 A;  3GW2 A;  3IRQ A;  1UB9 A;  5CVR A;  2MH2 A;  5D5X B;  3KET A;  5IT3 A;  2QQA A;  1WQ2 A;  2Z33 A;  1QGP A;  3BOQ A;  5BOX A;  2ZJ2 A;  1ZH5 A;  4G94 A;  4MEX F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...