3GFMA

Crystal structure of the st1710 mutant (k91a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRAILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 146aa long hypothetical transcriptional regulator
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfmA00
1ZYRF 5JR3A 2MD5A 3ZMTA 2NRAC 1IW7F 3GVAA 1NHAA 3U1DA 2Q2EA 1AOYA 1L0OC 2Q0OA 1OKRA 2OA4A 2W24A 4KIFA 3ZN0A 1WI9A 4OU0A 2K4JA 4L0YB 4ZYHA 1ZLJA 2EV0A 1DUXC 4PGHA 1YIOA 1OR7A 3PQJA 2RN7A 4MQ9F 1U2WA 3GFIA 1BI2A 2QZ8A 3R6SA 4BQAA 3LAJA 1MZBA 1CF7A 1JXSA 2K7LA 1TNSA 4HQMA 1ZHFA 3QU6A 4G6DA 4PZJA 4MTDA 2KIMA 3K69A 1ZH5A 3KLNA 3EYIA 1LDKB 4L5IA 1IRFA 3TO6A 5HLHA 4KMUX 3J80Z 4U0VA 1B59A 3HYIA 3F8BA 4L9VA 2KRFA 3LQQA 2M30A 4A0XA 2PBIA 5KK1A 4RB0A 1S6LA 1MGTA 3L09A 4A5MA 2COMA 2D45A 4RGXA 3WG9A 3P9CA 3EDPA 4M71A 5ICFA 4EJVA 3TKYA 3U2RA 3COAC 2ZO4A 4ENNA 1FSHA 2E7XA 3V8KA 3WU1B 4OIOF 5E18F 4EJTA 1KU9A 2WC2A 2XAQA 4KYWA 3CUOA 3LQRA 2WWYA 1ZRDA 2D1HA 2TDXA 1HW2A 2A5YB 3E5QA 5CVIA 5FD6A 2PQ8A 3WTWC 3LA3A 5ILUA 4Z2YA 3SQNA 4L9JA 5HDGA 4ZYEA 1HQCA 4A0YA 4AIJA 2DT5A 1E17A 4BHBA 3IWZA 3RTRA 5HVQC 1B9NA 2V6CA 1PDNC 2XGXA 5FGMA 2Z3YA 5LGNA 4RAYA 3V7RA 1RNLA 3HUGA 5HDNA 2HKOA 3IC7A 2OZ6A 2O0YA 1LB2A 1TTYA 4Y15A 4M9SA 1DPUA 5IT9K 3VODA 5A2QZ 1V4RA 3NQOA 1ZREA 4GYGA 1MJ9A 1LDJA 3REOA 3RI4A 2VT3A 4U7DA 4ASNA 2BYVE 4KIGA 2K4BA 2HYFA 1OYIA 2PMHA 2EFQA 2DK8A 2OBPA 1SD4A 2P7CB 1YQAA 5CJ9A 1QQIA 4UV9A 2PG4A 1IN5A 4LGWA 2RC4A 2HZTA 1ZG5A 2H6CA 4ENKA 1KGSA 2O61A 2H09A 2H6BA 4YG2F 5J8CA 1I1GA 2P7VB 3LFKA 1FWZA 4U0WA 3DQVC 2VOOA 2VE9A 1KYWA 1SMTA 2NS0A 1GXPA 2O8XA 2IW5A 5JHUA 2D2WA 1XN7A 3P9IA 2EA2A 3ZN1A 4LG0B 2ISYA 2LSOA 4BAYA 2L54A 2GWRA 2X0LA 5F64A 5DCMA 4KFCA 2A6HF 3AAFA 1S29A 2CG4A 2JPCA 5D8KB 4HDVA 2HYGD 4CGZA 2FEZA 1EH7A 3WTUC 2FU4A 2FNPA 5FFXA 5HOOA 3TDZC 1B9MA 1IXCA 2W57A 4LD5A 1FP2A 1CF7B 2P5LC 1FBUA 1GVJA 1SD6A 1X3UA 4EJOA 1J0RA 1BJAA 3E6CC 5LEJA 3KE2A 4KIBA 2H94A 4EM1A 3I59B 2XV4S 2UXXA 3T8RA 2KIUA 2NNYA 4EGZA 3GO5A 2LNBA 5JI6A 5LGUA 1QZYA 5F6FA 3R61A 3J7AO 1UB9A 2FE3A 1EH6A 4XLNF 2FMLA 4YIFA 1T0FA 1TLHB 2MH9A 2CWEA 3F3XA 1WWXA 1DP7P 1F9NA 1FP1D 3FHZA 3FM5A 1L3LA 2Q8KA 4KT5C 3K1PA 5KVRA 3CO7C 3HOTA 2JT1A 2GIVA 1U5TC 4H0EA 2W25A 2VXZA 3E3VA 2ESHA 5LRRA 2XASA 1I27A 4LK1F 4HQEA 1U3EM 1ZG1A 5D5VB 3JTHA 3TQNA 2VOPA 2RVCA 1J2XA 2V1XA 4KN7X 4WX9A 3IRRA 1JE8A 5E8GA 1OMIA 2DPUA 5IT9Z 4GXOA 1FSEA 4HF2A 4BNCA 5DYMA 5HS8A 1P92A 2KIFA 2MH2A 1USSA 2M5WA 1D3YA 3WODF 3ABTA 1ONVA 2CW0F 2HFHA 3O3KA 2DLLA 1J5YA 2FXAA 3QP6A 4HF0A 3KZYA 4P9UA 4OIPF 3Q9SA 2OD5A 3K9TA 4HX7A 4NB5A 2P6SA 3E5XA 2L4MA 2XKPA 2ZXJA 2DW4A 2O03A 1T6SA 3F6OA 3FMSA 5ICEA 1RZ4A 1RUOA 3JAMK 1RIOH 1Q1HA 1O3TA 3M1EA 3DP7A 3HIFA 3IHUA 2FA5A 3WE2A 2IJLA 1ON1A 3DFGA 2EFPA 1XSVA 2MLKA 4I01A 4BYYA 2Z99A 2V9VA 5D5UB 3L9FA 1SFUA 4U0YA 1EV7A 4L9NA 1U8RA 3BDDA 1IF1A 3SZPA 4UNOA 4LMYA 4ENJA 1IAWA 1C0WA 2A07F 2B0LA 3KP5A 2E7WA 1P4AA 4AIHA 3IL2A 4M6YA 2QENA 1TNTA 1Z6TA 3GWZA 1LEAA 2ZMEA 2FNAA 1HSJA 4B8XA 2XHKA 4HOBA 3ECHA 5JFRA 1FYKA 5DUIA 4M6XA 4R8HA 3N4MA 1IUYA 4MQVA 2FBIA 4A0ZA 1BIAA 1YFHA 4BHCA 1IN4A 4O3MA 4BXUA 1GXQA 4I09A 3ELKA 4B09A 2RGVA 3F8FA 3BPVA 2RNJA 4YIIA 1FBQA 2HTJA 2M8EA 3HTUA 3HRUA 2DI3A 4U88A 4GYIA 5BOXA 2HKXA 1G3SA 4UVBA 3RKYA 4A6EA 3OV8A 3GFLA 3J81Z 3N97A 3ZMVA 5J6XA 3GZ5A 1T98A 1I6XA 2M45A 2YX7A 2GZWA 2VBZA 4EV0A 2QYOA 1XB4A 4FT8A 4G9YA 2XAFA 4KA4A 5IT3A 3LA2A 3L7WA 3C1DA 4KICA 3M7GA 3ZPLA 4HYEA 3GW2A 2YR2A 5BS6A 4L5JA 2F2EA 4A2UA 4IRHA 2CSOA 2MC3A 4DNCA 3CUQA 3IKTA 2UXNA 2VT2A 2QQAA 5FD5A 4MHGA 4LG0A 4ZZLA 1D8KA 3GZ6A 1FLIA 3DKWA 1XDSA 3M8FA 3W6KB 4ESBA 2ZCWA 3LSTA 3GLXA 2IA2A 3KP6A 2Y48A 4HX4A 3BROA 2EV5A 4KNYA 5EEGA 3GX4X 1P6RA 2OU2A 2DAOA 1QBJA 2F5FA 2H27A 3JAMZ 4XRFA 5E8IA 2EA4A 1HW1A 3MEXA 4P55A 3QRFF 4IXAA 1JHHA 2ETHA 1IXRC 1XGMA 4I0BA 3F21A 4M74A 2EFWA 2A68F 1QGPA 2V1DA 3RPUA 3I59A 1G6NA 1WKMA 1K78B 1O7FA 1P4WA 4CHUA 1KYZA 1UFMA 3ZMZA 1KU2A 1O57A 2HQRA 2ZMEB 1BC8C 3QPTA 4YFKF 1XGOA 1W5SA 2QM3A 1T39A 3F8MA 4HF1A 4RGSA 3C7JA 3FMRA 4HW0A 1FYLA 2K86A 1PP8F 5AIPA 1K6OA 4I7HA 1W7PB 2MLGA 2J5PA 2ZKZA 1B4AA 2K27A 4JBAA 2V1UA 1LQ1A 4RB1A 4KN4X 3KP3A 4RGUA 1LEBA 3FX3A 1R23A 5DD8A 3BPXA 2NNNA 4EM0B 4GO1A 4M72A 5L3BA 5ICCA 3D5LA 3ECOA 1G4DA 2O6GE 3BJ6A 1FPQA 3KEOA 5BPIA 3FXRA 3F8NA 2PMUA 4AD9A 1J75A 2P5KA 1MJAA 2NYXA 4ON0A 4Q4ZF 4MEXF 3GUDA 1UCRA 3GFMA 2IPQX 4CXFA 4EGYA 4CO8A 5DDGA 5D4SA 4WWCA 1FT9A 3HSRA 3T0YA 5AONA 3DXJF 3ABUA 2VC0A 3TOBA 1A04A 3BWGA 2GXGA 3RYRA 3I64A 2FBHA 2DPDA 1KQ9A 2IA1A 1YS6A 1LVAA 1KU3A 3CUQB 4LLGF 1ZGAA 1XCBA 2J5OA 4HV5A 4UV8A 3VEPA 4WF2A 4R1HA 5D8LB 3DPLC 3O6BB 5LHIA 2NAZA 2W85A 2DQRA 2R7DA 2ZNYA 3I4PA 1J59A 3EYYA 4G94A 4IHTA 4IF4A 3G3ZA 1F5TA 1ULYA 1QO0D 1DDNA 4NQWA 2G9WA 3GYHX 2PJPA 2DFIA 2JTVA 1YW8A 2ESNA 1Z05A 5LHGA 3BOQA 1LDDA 1XMKA 1G3TA 2ZJ2A 4O5VA 3E5UA 3T1BA 1YTYA 2GAUA 2FQ3A 2MA3A 5D6FA 1FZPB 2OQGA 1SFEA 1AWCA 2RKHA 2PLYA 5FFZA 1SD5A 1BM9A 3WTZA 3ISPA 5E1XA 3H3UA 2WTEA 2AS5F 4G7ZF 1SMYF 2ISZA 4N9HA 1B1BA 1R1VA 1W4MA 2L3DA 4P9FA 3W6JB 3GEZA 3M8EA 1HKTA 1IN8A 3FWEA 2HTSA 4EJUA 2ZFWA 2P6TA 1VTNC 5H20A 4Y17A 4G7HF 5DUKA 1HKSA 4ZH4F 3ZMSA 2LKPA 3R4KA 1FNNA 3HSFA 2VONA 1PUEE 1W7PD 1KQ8A 3K2ZA 2OQRA 1RI7A 3I53A 2EV6A 4HZFA 1HBXG 1T2KA 3BJOA 3CJNA 3H3ZA 4UHTA 2KJBA 4LB5A 2DO7A 3LAPA 4P5OA 1D8JA 4CYDA 2LDUA 4QLCU 4MNUA 3ZMUA 3PFIA 3MCZA 4G8XA 2KKOA 4XLPF 2WV0A 2OAZA 1BOAA 4S04A 4PGGA 4JQFA 3CO6C 4Q5SF 2HS5A 3I58A 3V8LA 2UZKA 3P9KA 4QWQA 5D5XB 4FHTA 1TW3A 2QQ9A 1YW7A 3D0SA 5LHHA 1S7OA 2IT0A 4MGRA 1WQ2A 2ZNZA 1I5ZA 2FBKA 3C3WA 1IXSB 5K5OA 3R0JA 3V4GA 3HHHA 4KMFA 3JSOA 1B6AA 3TO9A 3L2CA 3U9GA 3ZMDA 3RJPA 3MWMA 1K79A 3I54A 5K1YA 1R58A 3G73A 1K78A 2K02A 4HX8A 3ZP5A 2O3FA 1BIBA 4L18B 3BZ6A 4CDGA 4OMZA 2BE5F 4G6QA 1O3QA 2XKOA 2HQNA 2L02A 5E17F 5L3EA 4U7BA 1TBXA 3VB2A 3KFWX 5HLGA 5CYVA 1LNWA 5LEKA 1YS7A 3Q9VA 3HTSB 4L9TA 1HSTA 1W7PA 5TJJA 1STZA 3EUHA 3JSPA 3LWFA 5TRDA 4A6DA 4P96A 3HRTA 3FXQA 2EWNA 4WXCA 2E1CA 2CFXA 1BI0A 2G7HA 4AVPA 2QQBA 1FBSA 4XSXF 2DU9A 4D0PA 4KUMA 5L3CA 4M9ZA 4HV6A 3IRQA 3KP7A 4M73A 4ETSA 3C18A 1TQIA 5K5RA 5LBQA 3BJAA 3T8TA 2P4WA 1Y0UA 1TQPA 5ILSA 3KP4A 2RDPA 3E6BA 3DEUA 1OPCA 4HA8A 5CVRA 2C6YA 2DTRA 5CVUA 4JK1X 1IN7A 1YO5C 2EB7A 4FX4A 1MJBA 4BH9A 5JVTA 2X4HA 1H9GA 1RUNA 2HGCA 1USTA 3WGHA 1H9TA 2A61A 3FXUA 1SFXA 3R0AA 4XSZF 4EJWA 3HRMA 2D1VA 4LB6B 4Q47A 1J9IA 3NEUA 1YYVA 3MQ0A 5ERIA 4WCGA 3TDUC 4CICA 5FLXK 4I0AA 1UHMA 3VOEA 1MDMB 5HS7A 4Y13A 3NRVA 4GCVA 3K1MA 1Z6RA 5CLSA 5L3FA 1R00A 1ZAOA 4IRIA 1R1TA 3ULQB 1HXDA 2BV6A 1ON2A 4L0ZB 2IVMA 3WTSC 2FSWA 2BGCA 3TGNA 3JTGA 2R3SA 4RB3C 3GFJA 2EJRA 3F8CA 3SFZA 2JSCA 2Z5UA 2W84A 5D4RA 1QPMA 4RGRA 3SHFA 1IZ1A 2Y75A 1FC3A 4MEYF 5HLIA 2GA1A 1ZG3A 2STTA 3B02A 4I98B 3WGGA 1YLFA 1XDUA 3ML6A 5K5QA 2PN6A 1P2FA 3RIRA 3BP8A 2PFBA 4GGGA 5ICGA 2CYYA 2XROA 4XBFA 1O3SA 5L3GA 3WE3A 2UWMA 1V3FA 3E6DA 3WTXC 1ODDA 1LJ9A 2YX4A 5LRSA 4G7OF 2HWVA 2EFNA 1XGSA 1BN5A 2CQKA 3KLOA 4EM2A 1S7AA 2CO5A 2F5DA 3H92A 4FX0A 1JGSA 3GF2A 1FY7A 4S05A 1OYYA 2AXLA 1T38A 2VN2A 3QAHA 3V7CA 4OOIA 1O7LA 2JRTA 4A5NA 2HEOA 3HSEA 1REPC 1U6GA 3QU3A 3F72A 1FYMA 4IVNA 1JHFA 2XAGA 2A3SA 3V8JA 4CZZA 4IPAA 1H0MA 1R5HA 1UHWA 1TQMA 3IWFA 1PP7U 1U78A 3CTAA 1XSDA 5DD4A 4DQ2A 2IP2A 4N9IA 4AIKA 5CVVA 3K1NA 4OIRF 3T5XA 2QLZA 1DPRA 5ED4A 5DCFA 4EVIA 2E1NA 1I1SA 3LA7A 4PCQA 2BBYA 3HHGA 3F6VA 1J7KA 3ERED 2VBWA 3RKWA 2LF7A 4Q48A 3ROUA 5D6EA 5AIQA 5E1ZB 1BI1A 4HLYA 2FOKA 3FM3A 2FF4A 2VODA 4LK0F 3F22A 2M87A 2GA2A 5FLXZ 4RB2C 4A12A 4AWXB 5LLQA 1MD0A 2EK5A 1HW5A 2IRFG 2L4AA 4UVAA 4K2EA 3K0LA 2G7UA 2HOEA 1KQ0A 3HRSA 4TV7A 4I2OA 1WRJA 3SZTA 1F1ZA 5DEQA 2PI0A 4HAMA 5F1RA 4EQQA 1MKMA 3MFKA 1ZLKA 1W5TA 2XUBA 2M1BA 4OINF 1P4XA 5HDKA 1Z7UA 3EQLF 6PAXA 1O3RA 1ZGJA 1G3WA 1F4KA 4ZYGA 3JW4A 2QVOA 3BY6A 4O6JA 4UVCA 1YG2A 2P5VA 1YW9A 1ZN2A 1BBYA 1E2XA 3FF5A 4RS8A 2XAJA 1FX7A 1Z1DA 2DK5A 4OIQF 5HS9A 5BQTA 1XMAA 3V7SA 5CVJA 2OZUA 4UXNA 1FOKA 4F7ZA 1XSXA 2GXBA 2YPRA 4WXDA 3F23A 5D5WB 2IA0A 3KP2A 3HOSA 5H6RA 5DV5A 3KCCA 2RV8A 1Z91A 3WTTC 2Z33A 4LLLA 2QUFA 3J81K 2MBFA 2F5EA 2BEOA 3RPQA 2VBXA 2GQQA 2HDCA 3IKVA 3KEQA 4ZZDA 4NHJA 1U5TA 4YFXF 2DQLA 4HLXA 2ADUA 1EH8A 1XGNA 4ENMA 2QBYA 1CGPA 1XCVA 5FO5A 4OMYA 1HKQA 2XAHA 3CLOA 4EMSA 3VFZA 1GHCA 3TO7A 4ESFA 1R1UA 2ZBKA 1QZZA 3I0TA 3P7NA 1MDMA 4BHPA 2VBYA 2V79A 4E70A 3KZZA 4M9XA 2Z9OA 2CGPA 5J8FA 3SXYA 2STWA 1Z9CA 3WTVC 1K7AA 5E20A 2ACJA 4ESJA 1ZRFA 4UUVA 3OOPA 3DV8A 4N0BA 2VC1A 5BPDA 1IRGA 3RYPA 2XVCA 1SAXA 1BI3A 4LLNA 3DPTA 3L00A 3WTYC 4R79A 5H6QA 2KJCA 3MZHA 1R5GA 4HDUA 5DCMB 2VE8A 1ZRCA 4IJAA 1KA8A 1XD7A 1G3YA 3J80K 3MAJA 3FZVA 3KETA 1SD7A 3GXOA 2FMYA 3DF8A 3B73A 2Y0MA 1KU7A 5LGTA 5ILVA 3WU0A 3QOPA 4I02A 2ELHA 5EEHA 4MTEA 3M9AA 2RQPA 2EFOA 2QWWA 1BC7C 4ZYDA 2YU3A 3MZYA 4YFNF 4LFUA 4WK8F 2DBBA 2HR3A 5E1WA 5BMZA 2LF8A 1S8NA 2XRNA 3TOAA 3O2PE 2FRHA 4LJZF 3PQKA 2XIGA 3S2WA 3E6MA 3RDIA 1R36A 1TW2A 3R60A 1WSUA 3CDHA 3E97A 1ZARA 4KDPA 3EETA 2R7FA 3QP5A 3Q5FA 5FB2A 5L3DA 3RKXA 5A2QK 2JPBA 4PDKA 1IN6A 2A6EF 4IRGA 1S3JA 2A69F 3ZQ7A 4IHSA 3I5UA 3FMQA 1U5TB 1D5VA 2P8TA 2L01A 4HBLA 2QBYB 3WGIA 2PEXA 3CUQC 1QNTA 3I71A 3QPHA 1R22A 1R7JA 4RAZA 2JZYA 2F5CA 2YSRA 4WXHA 1OYWA
chains in the Genus database with same CATH superfamily
1ZK8A 1ZYRF 5JR3A 4NDLA 1DU6A 2ME0A 2MD5A 2LR8A 3ZMTA 2A6TA 2NRAC 3OL4A 4I76A 1IW7F 2VIXA 3PNYA 3ZQHA 3ASNH 2R5YB 3GVAA 3GTMJ 1NHAA 3U1DA 2Q2EA 2WB1N 1LE8B 1AOYA 2BHZA 3OYFA 2VQHA 1QA6A 1OFCX 2VXDA 1L0OC 2Q0OA 4A93J 3BZCA 4AUXA 1OKRA 1JTXA 2DMTA 2OA4A 2W24A 2I5UA 4KIFA 3ZN0A 1WI9A 2ZC2A 4OU0A 2K4JA 5FLVA 4L0YB 4ZYHA 1UG2A 3CLQA 1ZLJA 2EV0A 3GZNB 3VYTB 2M4KA 2VASA 2FX0A 1DUXC 3FDYA 3OYNA 2DA7A 4PGHA 4XOPA 1YIOA 1OR7A 3S2HJ 3PQJA 2RN7A 4MQ9F 3QPSA 1U2WA 1X1PA 3GFIA 4IQ4A 1BI2A 1Q1VA 3K4KA 2QZ8A 1WJCA 3R6SA 1YI2I 4BQAA 3LAJA 1MZBA 4UY8I 1CF7A 1JXSA 2K7LA 1TNSA 2QSFX 1ZHFA 4HQMA 2K9NA 3G6EI 2KLOA 3QU6A 4G6DA 4PZJA 4MTDA 2KIMA 3K69A 1ZH5A 3KLNA 3EYIA 2KPMA 1LDKB 4L5IA 1IRFA 3TO6A 1JKRC 5HLHA 3DPUA 4KMUX 1BOBA 1D1BA 3ZQQA 1GLNA 3J80Z 3HM5A 4U0VA 3GTJJ 1YX5A 1B59A 3DWLE 3FISA 3HYIA 3F8BA 4FE4A 4IKFA 1YOVB 4L9VA 2KRFA 3LQQA 3PUBA 4AIDA 2M30A 4A0XA 2Z2SB 4FASD 2PBIA 2GBYA 2DMUA 5KK1A 1VQPI 1VZ0A 4RB0A 2P81A 1RKWA 1S6LA 2COBA 4IQJA 2CUFA 1MGTA 3PM1A 3L09A 4A5MA 4B43A 4AVZA 5GPAA 2COMA 2D45A 4RGXA 3WG9A 3P9CA 2HPIA 2XF6A 3EDPA 4M71A 3H0DA 2PMZA 5ICFA 2M0MA 3I9V2 3JRBA 4EJVA 3TKYA 3U2RA 3A2KA 3COAC 2ZO4A 4ENNA 1FSHA 4DYRA 4IZZA 1AA7A 2E7XA 3V8KA 3LSKA 3WU1B 2JA7J 4OIOF 5E18F 4EJTA 1KU9A 2WC2A 5EGOB 2XAQA 3AL0C 4KYWA 3CUOA 3QYFA 3LQRA 2WWYA 5DM6F 1ZRDA 2D1HA 2GXAA 2TDXA 4LG3A 1WH5A 2KP6A 2A5YB 1R6RA 5FKOA 3OSFA 1HW2A 3E5QA 4NC6A 5CVIA 2E2JJ 4M3FA 5FD6A 2PQ8A 3WTWC 3LA3A 5ILUA 2QQ8A 4Z2YA 2LLKA 3SQNA 1X58A 4L9JA 5HDGA 1HQCA 4A0YA 4ZYEA 4AIJA 2NXNB 2DT5A 3QPLA 1E17A 4HNVA 2M4GA 4BHBA 5EDNA 3IWZA 3RTRA 5HVQC 1B9NA 5GPCA 2V6CA 3OS1A 1PDNC 2XGXA 2W00A 2IGOA 5FGMA 2Z3YA 5LGNA 4RAYA 3V7RA 1V55H 1RNLA 1EF4A 1E3OC 3HUGA 5HDNA 2HKOA 4ZDLA 2R92J 4NC8A 4JOMA 2JK3A 3IC7A 2OZ6A 2O0YA 1LB2A 2XPVA 1TTYA 1XMXA 4Y15A 5B1AH 1MNDA 4M9SA 4OAYA 4XLCA 2H1KA 1DPUA 2DT6A 2L2OA 5IT9K 2VKDA 5GP9A 1NG6A 3VODA 1QVUA 5A2QZ 1V4RA 3NQOA 1ZREA 3BG7A 3HBLA 4GYGA 1MJ9A 1LDJA 3B6CA 3K2AA 3MD2A 5FJ8J 1T33A 3REOA 3RI4A 2AO9A 3RKQA 2VT3A 4U7DA 4XLEA 3CCYA 4ASNA 1RR7A 2R5ZA 3ZQGA 2JA2A 3OS0A 2BYVE 4KIGA 2K4BA 3VYSB 3PSIA 3OYHA 2HYFA 4BDZA 1OYIA 2PMHA 2EFQA 2DK8A 2OBPA 3PNVA 2V4JC 2XC7A 1SD4A 2P7CB 1YQAA 1JJ8C 5CJ9A 1QQIA 4CYCA 3JRAA 4PSWA 2HXOA 2IAIA 2K9LA 2B7EA 4UV9A 2AQFA 2ZB9A 1X4PA 2PG4A 4BKXA 1IN5A 4LGWA 3A01B 2RC4A 2WBMA 2BXYA 2HZTA 3OYBA 1ZG5A 2H6CA 4ENKA 3BT9A 1KGSA 2O61A 1YJ9I 2H09A 2H6BA 4Y7NJ 4YG2F 2KRHA 5J8CA 1I1GA 4D5FA 2P7VB 3LFKA 1FWZA 4U0WA 1HA8A 4QPOA 4F92B 2DJNA 3DQVC 2VOOA 2VE9A 1TL8A 2KL4A 1KYWA 1SMTA 2NS0A 1GXPA 2O8XA 2IW5A 3HJEA 5JHUA 3KYCB 2D2WA 1XN7A 3CC7I 1N75A 3P9IA 2EA2A 3ZN1A 4LG0B 2ISYA 5DS9A 3FK6A 2LSOA 3HKZA 4BAYA 1W0TA 2L54A 4B3AA 2GWRA 2X0LA 5F64A 4D5CA 5DCMA 4DIQA 2V6EA 4KFCA 1QHGA 2HU9A 2A6HF 3AAFA 1S29A 2CG4A 2JPCA 1I50J 5D8KB 4HDVA 4IHXA 1WHUA 2HYGD 4CGZA 3S8PA 2DYSH 2FEZA 2HXIA 5JVGF 1EH7A 3WTUC 2FU4A 1UZCA 2FNPA 2BY0A 3EUAA 4XLFA 5FFXA 5HOOA 2DOAA 3TDZC 1B9MA 4D9JA 2QF7A 4PK4A 2XDVA 1IXCA 2W57A 3W3CA 3S1QJ 3DU6A 4LD5A 1FP2A 4KJZA 1CF7B 3CJTB 3K4CA 2P5LC 4DGWB 1FBUA 1GVJA 1CQTA 2DMPA 1SD6A 1X3UA 2HOTA 2VQLA 2B9SA 3P5JA 2EINH 2X9DA 4B48A 4EJOA 3GTGJ 3DKYA 2GOXB 4BBSJ 4B3XA 1J0RA 1BJAA 3MMYB 4XN0A 3E6CC 5IY5H 4XOTA 5LEJA 3KE2A 4KIBA 3Q0VA 2H94A 4EM1A 4C9YA 3I59B 1WJBA 2LK2A 2UXXA 2XV4S 4GDFA 1APLC 3T8RA 1ETKA 2KIUA 2LVSA 2NNYA 4XKCA 4EGZA 1RRJA 3JRIA 3BCAA 3GO5A 1D1AA 2LNBA 5JI6A 5LGUA 1MIJA 3ZGKA 1QZYA 5F6FA 4XRSG 3J7ZI 3R61A 1Z3XA 3J7AO 1UB9A 2FE3A 1EH6A 4XLNF 3AFHA 1X19A 2FMLA 4YIFA 3ERMA 1T0FA 5GTHC 1TLHB 2MH9A 2CWEA 3F3XA 3CDIA 1WWXA 1DP7P 2E60A 2F48A 4A69C 1F9NA 1FP1D 3CMEI 2VPRA 2YS9A 3FHZA 4XKVA 4NNJA 3I56I 3FM5A 1PJRA 1L3LA 2Q8KA 1WFXA 1B72B 4KT5C 3K1PA 5KVRA 3CO7C 4LITA 3TP3A 2VKEA 3HOTA 2JT1A 2GIVA 1OJLA 3ZQCA 4CCMA 3DEEA 3HDDA 2DDAA 3DBLB 2CUJA 4IHVA 1U5TC 1Y0NA 1JUMA 2KRCA 3I4MJ 5J40A 4H0EA 2W25A 2VXZA 3U1KA 3E3VA 3SJMA 2ESHA 5LRRA 2XASA 1V54H 1I27A 4BBRJ 2IGKA 4LK1F 2OPTA 4HQEA 1U3EM 4QIWN 5E3OA 2E71A 1ZG1A 5D5VB 3JTHA 3MKYB 3TQNA 2VOPA 2RVCA 4II2A 1J2XA 3KYLA 2V1XA 2OTLI 4KN7X 4WX9A 2K40A 3DTKA 3IRRA 1WJEA 1SAUA 3PIPF 1JE8A 5E8GA 4C3IJ 2Y9ZA 1OMIA 3OOUA 4XKBA 4GXOA 2DPUA 5IT9Z 1QHHD 1FSEA 4HF2A 5FKKA 4BNCA 5DYMA 5HS8A 1P92A 2KIFA 2K5CA 3H5AA 3V42A 2MH2A 1USSA 2XSJC 5F04A 3S15J 2VLAA 2M5WA 3PSFA 1D3YA 3WODF 3ABTA 1ONVA 2CW0F 3G2BA 1ETYA 2HFHA 3O3KA 2DLLA 1J5YA 2FXAA 3QP6A 4X0GA 4HF0A 3KZYA 4RLFA 4P9UA 4OIPF 2EIJH 1LE8A 3Q9SA 2KHMA 2OD5A 1Y56A 3K9TA 3O8HA 2HVQA 4HX7A 3DU5A 2EZLA 4NB5A 2P6SA 3E5XA 2L4MA 3HOWJ 2XKPA 5F1JA 2NVQJ 2ZXJA 2V9KA 2DW4A 2BXZA 2O03A 1OCTC 3CD6I 5F0CA 2JUCA 1T6SA 3L2UA 1VQNI 2TRTA 1SANA 2ZXHA 1YE9A 3F6OA 3FMSA 5ICEA 3IV5A 2M8GX 1SFOJ 2BY2A 4XICA 1ACIA 2E1MC 3S3MA 1RZ4A 1RUOA 1P7JA 1TWHJ 3JAMK 1RIOH 1PYVA 1Q1HA 2EBIA 1O3TA 2HDWA 1U8BA 3M1EA 3DP7A 3HIFA 2ID3A 3IHUA 1VQ5I 2FA5A 4BY1J 3WE2A 3H9GA 4V19K 2E5ZA 2IJLA 3K4BA 1ON1A 3DFGA 2EFPA 3HZJA 1XSVA 2WY8Q 1U9OA 2MLKA 4I01A 3HOZJ 1S9HA 3SDBA 4BYYA 2Z99A 4KISA 2V9VA 2FJ1A 1JUSA 2VL8A 2EIKH 4XORA 5D5UB 3L9FA 1SFUA 4U0YA 2TCTA 1EV7A 4L9NA 4NQWB 1U8RA 3BDDA 1IF1A 3SZPA 1XTAA 4LMYA 4UNOA 4ENJA 3FKIJ 1IAWA 4XRSA 4E7IA 1C0WA 2O7OA 2A07F 1ZELA 2B0LA 2KMUA 4PFPA 1QPIA 2L9RA 3KP5A 2E7WA 1R49A 4NUBA 1P4AA 1R71A 2CQ7A 4AIHA 3IL2A 4C2UA 4IL6C 3LL7A 2XGDA 4Y3OA 3M1CA 3GTQJ 4JP0A 4M6YA 2PX9A 2QENA 1TNTA 1Z6TA 3GWZA 2CQXA 1LEAA 2XGCA 1F36A 2ZMEA 2FNAA 5BNGA 1HSJA 4B8XA 2XHKA 4HOBA 2VJ4A 3ASOH 3MKLA 3ECHA 5JFRA 3BR3A 1FYKA 3RZDJ 5DUIA 4M6XA 5EGOA 2I8DA 2LY1A 1POGA 3OMYA 4R8HA 3N4MA 2N8GA 1IUYA 1TC3C 3TW6A 1NH3A 4BJTA 2EH3A 4MQVA 2FBIA 1LPQA 4A0ZA 3G71I 1BIAA 1YFHA 4BHCA 3OL3A 4BJ6C 1IN4A 1H8AC 1Y8QB 3Q0UA 3RPUD 1N78A 4O3MA 4M3BA 4BXUA 1HC8A 3WHCA 1GXQA 1MMAA 1K61A 4I09A 3ELKA 4B09A 3QYEA 1RKTA 2RGVA 3F8FA 1IV6A 1X2NA 3BPVA 2RNJA 2WA0A 4YIIA 1GDTA 3W2WA 5EJCA 1FBQA 2E1OA 3PIOF 2HTJA 2M8EA 3HTUA 2BVLA 3J7AY 3HRUA 2DI3A 3CCJI 4X6AJ 4U88A 4GYIA 5BOXA 2HKXA 1G3SA 4UVBA 2L5QA 3RKYA 2XPWA 4A6EA 3OV8A 4ZC3A 3GFLA 3BG6A 3S3OA 3F9KA 3J81Z 3N97A 1BL0A 3ZMVA 5J6XA 3GZ5A 4XNFA 5KAIC 1T98A 3LSRA 5J1YA 2R7RA 2V26A 1I6XA 2M45A 2YX7A 2GZWA 2VBZA 4IEJA 4EV0A 2CQNA 2QYOA 1XB4A 2EQRA 2NVYJ 3S3NA 3ABLH 3HGYA 4FT8A 4G9YA 3DBHB 3H3VK 2XAFA 1IJWC 4KA4A 1ZR2A 5C4JJ 1Z67A 3HOUJ 3UKGA 5IT3A 3LA2A 2HNHA 5KHDA 3L7WA 3C1DA 1N25A 2JMWA 2VJIA 1O4XA 4KICA 2RNGA 3M7GA 1DQUA 1QZEA 2Y9YA 1SFKA 3ZPLA 4HYEA 3GW2A 2YR2A 2KIQA 1K4TA 4OWRB 4C2MJ 5BS6A 1H89C 3A01A 1JGGA 3OYGA 4PJJA 4L5JA 2WY7Q 4L5EA 2F2EA 4A2UA 2A5WA 2QSGX 4IRHA 3L1PA 2CSOA 2HQAA 1T95A 2MC3A 4DNCA 3CUQA 3IKTA 2UXNA 1ZR4A 2VT2A 2QQAA 5M3MJ 4RM3A 5FD5A 4MHGA 5EZHA 3ZCOA 1IG7A 4DW6A 4LG0A 4AM3A 4ZZLA 1D8KA 3GZ6A 4JX6A 3HOVJ 1FLIA 4HPQA 3DKWA 1TZLA 5IYCJ 2Y0SA 2OC6A 5F0FA 1XDSA 2LYCA 3M8FA 3W6KB 4ESBA 2ZCWA 2H8WA 3L2WA 2QEXI 3LSTA 1WCMJ 2IEKA 3GLXA 2IA2A 4LIVA 3KP6A 1OR7C 2Y48A 4HX4A 4J01A 3BROA 1IC8A 2EV5A 3FXKA 4KNYA 4CH7A 1SVOA 5EEGA 3GX4X 1P6RA 2HPMA 2OU2A 2DAOA 1QBJA 2F5FA 2F4MB 2CW8A 2H27A 1WH7A 1BW6A 5CKTA 3Q0WA 3JAMZ 1K83J 4XRFA 5TGTA 2R7SA 5E8IA 2ZJRF 2MYSA 1Z0XA 1OCCH 1HLVA 2EA4A 1HW1A 3MEXA 4P55A 1MW7A 3QRFF 4IXAA 4B4CA 5H2FC 2OJED 1SVMA 1U0JA 3ZQLA 2JA6J 1JHHA 2ETHA 1IXRC 1XGMA 4I0BA 5FKMA 5IOYA 3F21A 1HDPA 1OLTA 4M74A 2EFWA 1IGNA 2A68F 1QGPA 2V1DA 3RPUA 3I59A 2V9PA 1G6NA 3FK7A 1WKMA 4C3HJ 1K78B 1T56A 3G4SI 1O7FA 4E7HA 1UELB 5JHFA 1P4WA 3E7LA 4CHUA 2E35A 5GADJ 3IH2A 1KYZA 5FLMJ 4B1RA 3SFIA 1UFMA 5IYBJ 3L2VA 3ZMZA 2KQRA 2K3FA 1MBFA 2MABA 3BZKA 2DFHA 1KU2A 1W36D 4BE0A 1AKHB 1O57A 2HQRA 1WPKA 2ZMEB 1BC8C 2HOSA 2LD5A 3QPTA 3DBRB 4YFKF 4HSTA 4OAZA 5J4YA 2LFBA 3H9QA 4E7SA 1XGOA 2DMQA 2MW8A 1W5SA 2QM3A 1T39A 3F8MA 4HF1A 4RGSA 4IOCF 3C7JA 3OYEA 2ZSHB 2DOEA 3FMRA 3KPHA 2IS4A 3IUOA 3GMEA 1XC5A 1MBEA 1MSFC 4HW0A 1OCPA 1B72A 3VDXA 4XLAA 1FYLA 4E7KA 2DA2A 2K86A 9ANTA 1PP8F 3HPGA 5AIPA 2ZXWH 1K6OA 4I7HA 1IRZA 1W7PB 2MLGA 2J5PA 3CCUI 2ZKZA 4YIRX 5JLWA 1B4AA 2K27A 4JBAA 2V1UA 1LQ1A 4RB1A 2HZDA 4KN4X 3KP3A 1OCZH 1OQYA 4RGUA 3KX2A 1LEBA 3FX3A 2DDBA 1R23A 3GCMA 5DD8A 3BPXA 1JUPA 3Q3SA 3E1SA 1TWAJ 3SDGA 1Z77A 4ZJZA 2ID6A 4F55A 2NNNA 4EM0B 1VNDA 4GO1A 4M72A 2X1CA 5B3SH 5L3BA 1LFUP 4ZDPA 5ICCA 1MNMC 4UB8C 3D5LA 3ECOA 1G4DA 2O6GE 3RCOA 3BJ6A 3VYRB 1FPQA 2R7UA 3KEOA 1KZHA 5BPIA 3OYMA 2BHYA 3FXRA 3F8NA 2PMUA 4AD9A 3J7YJ 1J75A 2P5KA 3OYLA 4X1EA 1MJAA 5C3EJ 2WV1A 1JKQC 3ABKH 2W48A 4CUGA 4ZTJA 2R4GA 2NYXA 3FXLA 1XPXA 4ON0A 4Q4ZF 2M7AA 4MEXF 2IS1A 4MO7A 3IH3A 3GUDA 2VKVA 2ECBA 2OCCH 1XS9A 3BQYA 3S2DJ 3OIOA 3M07A 4JYKA 1UCRA 3GFMA 5M5YJ 2IPQX 1OCOH 4CXFA 1DU0A 4EGYA 4CO8A 5DDGA 5D4SA 4WWCA 2VJ5A 4BXXJ 1VQOI 1FT9A 1DGWY 3HSRA 3TL4X 4DOZA 3T0YA 1DP3A 5AONA 3VWBA 3DXJF 3ABUA 2VC0A 3TOBA 1A04A 5FRNA 3BWGA 2GXGA 1TWGJ 3RYRA 4M3DA 3M4OJ 3I64A 1LKXA 2FBHA 1OCRH 3OY9A 2DPDA 1KQ9A 5EZGA 2IA1A 1WJ5A 1YS6A 1LVAA 1WZ2A 1YJNI 1KU3A 4FE7A 3CUQB 1B8IA 4LLGF 1ZGAA 1XCBA 2J5OA 4HV5A 4UV8A 2F4OB 4WF2A 3VEPA 2JRMA 4R1HA 5D8LB 4BY7J 1Y1WJ 5EYRA 2QKLB 2GIZA 3DPLC 3O6BB 3S32A 5LHIA 4ZTFA 3LSPA 2NAZA 3SEZA 2W85A 3CP2A 2DQRA 4EEFG 2R7DA 2VQCA 2ZNYA 3I4PA 3S93A 3CCEI 1H88C 4G6TB 1J59A 3EYYA 4G94A 5B1BH 3ZXSA 4IHTA 4IF4A 4BDYA 3G3ZA 1F5TA 1ULYA 1QO0D 3CCRI 2OCEA 1DDNA 4NQWA 4CCNA 3FHNA 2G9WA 2H1LA 3GYHX 1IRXA 2PJPA 1VQ8I 2XRLA 2DFIA 2JTVA 1YW8A 4BGDA 3CCLI 4XQFA 2ESNA 4HSRA 2CFOA 1Z05A 5LHGA 1YX3A 3BOQA 2YUSA 2MGQA 1HDDC 1LDDA 1XMKA 1MBHA 2OTJI 1NK2P 1G3TA 2ZJ2A 4O5VA 3E5UA 5J1UA 3T1BA 4AYBN 2LREA 1JKOC 2HDDA 1YTYA 2GAUA 1MNEA 2FQ3A 2MA3A 2WADA 2W4SA 2NVXJ 4E7JA 1FTZA 2DA3A 3FIWA 3QWLA 5D6FA 2OQGA 4RM2A 1FZPB 4PUSA 1SFEA 1AWCA 2RKHA 2FD5A 2PLYA 2M0CA 3ONQA 5FFZA 1SD5A 1BM9A 5C44J 3WTZA 1T0FC 3ISPA 2O9LA 5E1XA 5DTDA 3H3UA 2NS8A 2WTEA 1MBKA 1JJ6C 4G7ZF 2AS5F 3MVPA 1SMYF 2K9MA 4DYCA 2E19A 5EF6A 2XSDC 5F27A 2CRGA 4IO9F 2ISZA 1S72I 4N9HA 2G0EA 4PFOA 1B1BA 1X3ZB 2MFZA 1HOMA 4CCKA 3FBIB 2KZGA 1R1VA 4ANJA 1W4MA 2L3DA 4P9FA 3W6JB 1VFCA 3GEZA 4C2TA 3M8EA 1HKTA 1IN8A 3FWEA 2WB1A 2HTSA 4JX4A 4EJUA 2W7NA 3JRGA 4HG2A 2ZFWA 2P6TA 2JVHA 2AQEA 1VTNC 3K10A 3K70D 3JRCA 5H20A 4Y17A 4G7HF 3AG1H 5DM7F 3A0HC 5DUKA 1HKSA 4ZH4F 3ZMSA 2ZJQF 3K4LA 2LKPA 3BTCA 3R4KA 1FNNA 3AL0B 1M1EB 3HSFA 2VONA 2L9VA 1PUEE 4DZPA 3LSMA 1V5EA 1W7PD 4H4KC 1KQ8A 1A36A 4ZDOA 3K2ZA 2LY9A 4D7NA 1I3AA 2OQRA 1RI7A 2L0KA 3I53A 2EV6A 1S7EA 1YIJI 2PJRB 4HZFA 1HBXG 2XB5A 1T2KA 4E6KG 2CV0A 3BJOA 1RETA 5HNHA 4J00A 3CJNA 3H3ZA 4UHTA 5LFAA 1EKEA 2HQ5A 2KJBA 2LTPA 1WJDA 5IP7J 1VQMI 2DO7A 4LB5A 3LAPA 4P5OA 1D8JA 4CYDA 2DTZA 5K7HA 3CESA 3JR9A 3CJQB 2LDUA 4QLCU 1MMSA 4MNUA 3ZMUA 3PFIA 1W1WE 1Z3YA 3MCZA 2DCEA 4G8XA 3OR2C 1TT5B 2KKOA 2R7TA 4ABZA 4XLPF 2WV0A 2OAZA 2CUEA 2DXIA 1BOAA 4AU7A 2Z1DA 4S04A 3FXMA 1X1CA 2PMZN 4PGGA 2IS2A 3JREA 4JQFA 1V5FA 3CO6C 2BY3A 4Q5SF 4FQGA 2HS5A 3PUFA 4PJNA 1AU7A 4XL9A 3I58A 3V8LA 3BTLA 1FMWA 3DTEA 2UZKA 3GBGA 3P9KA 4QWQA 2ICWG 5D5XB 4BL0B 1R4NB 4FHTA 1B8IB 1TW3A 4F3QA 3A4CA 2QQ9A 1YW7A 3D0SA 5LHHA 1S7OA 3HPHA 3DTIA 2IT0A 1KONA 1TWFJ 4MGRA 3PO3J 1U9NA 1WQ2A 2ZNZA 1I5ZA 2ZXIA 4XN3A 1LFPA 2FBKA 3C3WA 1IXSB 5J3LA 4DBRA 5K5OA 4BQNA 3R0JA 3G1LA 2W82A 3RQ4A 3V4GA 3H1CA 3HHHA 4KMFA 1SVLA 3W6VA 1MH3A 4UUTA 4ZYAA 3JSOA 3SEQA 1B6AA 3TO9A 4A3DJ 3L2CA 3U9GA 3ZMDA 1I39A 3MWMA 3RJPA 1K79A 3I54A 5K1YA 1R58A 3G73A 3K4MA 2QKMB 1K78A 1UG0A 4A3FJ 1F43A 1AHDP 2K02A 4HX8A 1VF9A 1G59A 1X4OA 3ZP5A 1IDYA 2O3FA 1BIBA 2ZMEC 4I99C 4A3BJ 2M7BA 5LD2C 2L7KA 4L18B 3LSGA 2LMDA 1AKHA 2WAEA 3BZ6A 4P1WA 4CDGA 4CCOA 5K7ZA 4OMZA 2BE5F 4G6QA 1MMGA 1O3QA 2XKOA 2HQNA 2L02A 2ECCA 5L3EA 3LMMA 1TBXA 3VB2A 4U7BA 5E17F 3HL2A 3OYKA 3KFWX 5FKNA 5JLXA 1X1AA 5HLGA 2LOOA 5CYVA 4XRMA 2CUZA 1LNWA 5LEKA 3CMAI 1YS7A 2X85A 3Q9VA 3HTSB 1HCRA 3NAUA 2X6XA 4L9TA 1HSTA 3I4NJ 1W7PA 1YRNB 4C30A 1A31A 3GTKJ 5TJJA 2JJ7A 4BJ5C 1STZA 3EUHA 5HNFA 3JSPA 3CCVI 3QOEA 3LFUA 3LWFA 5TRDA 4A6DA 4P96A 3HRTA 1A6QA 3FXQA 1K6YA 1JTYA 2EWNA 3C2BA 4WXCA 2E1CA 1BW5A 2CFXA 1BI0A 2G7HA 4AVPA 2ZSIB 2JWTA 2QQBA 5E3LA 1FBSA 5GTIC 4XSXF 2DU9A 4D0PA 4KUMA 2X6OA 5L3CA 2ZJPF 4M9ZA 4HNTA 4UUSA 4HV6A 2E34A 1YJWI 3IRQA 3KP7A 2ME6A 2L9NA 4M73A 4ETSA 3C18A 4BU2A 2JSPA 1TQIA 5K5RA 5LBQA 2GOMA 2X1EA 3BJAA 3ZR8X 3T8TA 3H36A 1Y8RB 4LIUA 2JA5J 3OYJA 2P4WA 1Y0UA 3DEWA 1LUJB 1TQPA 1MBJA 2I10A 5ILSA 1TWCJ 3KP4A 2R93J 1UJ8A 2QA4I 4M6VA 4RA2A 3UR3C 2M34A 3JRDA 3D1NI 2RDPA 1FIAA 3E6BA 3RSNA 2Q1ZB 3DEUA 1OPCA 1EA3A 3IAM2 4HA8A 5CVRA 3QQAA 3U21A 1NTCA 4N4OB 4AC0A 2C6YA 2DTRA 5CVUA 2X48A 3ABMH 4JK1X 1IN7A 4A3GJ 4BEHB 1LVKA 2BY1A 1YO5C 2DA5A 2EB7A 2UUZA 4FX4A 2DT7B 1A5JA 1MJBA 2CJJA 4BH9A 3MKZA 2F5VA 1SC7A 5JVTA 2X4HA 3L2RA 3FBNB 1H9GA 3E0JB 1RUNA 1XX5A 3A0BC 3CC4I 2HGCA 1USTA 3WGHA 1H9TA 1LFBA 2A61A 3FXUA 2BW3B 1SFXA 3R0AA 4J19A 2O8KA 1VI0A 1R9TJ 1K4SA 4XSZF 2M9HA 4EJWA 3HRMA 2M3AA 2D1VA 2L7MP 2CQQA 4LB6B 4Q47A 2R0QC 4A3CJ 2DFFA 1XG1A 4G12A 4HNUA 3OYAA 1GT0C 1QU3A 1J9IA 3NEUA 1YYVA 3MQ0A 5ERIA 4WCGA 3TDUC 4CICA 3LSIA 5FLXK 4I0AA 1UHMA 1X1DA 3VOEA 1MDMB 4XLHA 5HS7A 4Y13A 1X3WB 5IP6A 3NRVA 4GCVA 3K1MA 5F0HA 3HEFA 1Z6RA 5CLSA 5L3FA 1R00A 5GAGJ 1ZAOA 4IRIA 3CMMA 3IP4B 2XPUA 3W2AA 1R1TA 3ULQB 1HXDA 2BV6A 2DA4A 1ON2A 3TMOA 1YHQI 3BG3A 4U87A 3CQZJ 3GLLA 4L0ZB 2IVMA 1Z7LA 3WTSC 2CS3A 2FSWA 2BGCA 3S14J 3TGNA 2LKXA 3JTGA 3CC2I 2R3SA 3DLLF 1WI3A 2LP0A 4NBQA 4RB3C 3GFJA 4C3JJ 3PFYA 4KT6A 2UV1A 2EJRA 1BJZA 2LKSA 4CCJA 2LRDA 3CP8A 3F8CA 3SFZA 2JSCA 1J09A 2VQGA 4FETA 2Z5UA 2X6WA 3VSLA 2W84A 2E1MB 4M3GA 3X2QH 5D4RA 1QPMA 4RGRA 3SHFA 4GRIA 1IZ1A 2Y75A 1FC3A 4MEYF 1PUFB 2CMPA 2GA1A 5HLIA 1ZG3A 2STTA 3B02A 3LSHA 3EUKL 4I98B 3WGGA 1YLFA 1XDUA 3ML6A 5K5QA 2PN6A 3OYIA 3K4JA 2KFDA 1P2FA 3RIRA 3BP8A 2PFBA 3S17J 4GGGA 1JKPC 2L9SA 3IH4A 2GM4A 5ICGA 2CYYA 2XROA 4XBFA 1E3PA 1O3SA 2KISA 2HVRA 3JRFA 4Y52J 2JVGA 5L3GA 3CZ6A 3AG4H 4GFBA 2VUMJ 1ETWA 3WE3A 2R7VA 3H5RA 2UWMA 1V3FA 3E6DA 3WTXC 2K3PA 3S1NJ 3FXJA 1MMDA 1ODDA 1LJ9A 1BA5A 2YX4A 3JCUC 3BR0A 2Y69H 5LRSA 3HB9A 4G7OF 4B44A 4BE2A 2HWVA 3HG9A 3OYDA 1IDZA 2EFNA 5KCMA 2MD0A 1XGSA 1BN5A 2F4IA 2F6CA 2CQKA 1FEXA 3KLOA 3FKJA 4XR6A 1S7AA 2CO5A 2F5DA 3H92A 4FX0A 4RLQA 3WG7H 4EM2A 3HC7A 3TP0A 1JGSA 2MC4A 3KIOA 3GF2A 1FY7A 5IP9J 5B5EC 3SZGA 4S05A 3B6AA 5M3FJ 1JT0A 4JX5A 1OYYA 2BZTA 2RAEA 2AXLA 2DODA 5EG0B 2JUGA 2MSYA 1WJFA 2LBFA 3S1MJ 2BOLA 2DA6A 3HGGA 1RC9A 1T38A 3BTIA 2VN2A 3G1OA 3QAHA 2PJRA 3V7CA 4OOIA 4UUSB 1O7LA 2JRTA 4A5NA 2HEOA 2ELKA 1E3HA 3HSEA 1BR2A 1MSEC 1REPC 4II3A 2LC2A 4BACA 1U6GA 2K85A 4MFEA 3QU3A 4ITVA 3F72A 4A3KJ 1FYMA 4IVNA 1JHFA 1TP4A 1V5GA 2XAGA 2M2EA 3M8JA 3PNTA 4IHWA 2A3SA 3I55I 1X2MA 5E79C 3V8JA 4QTRA 3VPRA 2DOFA 4CZZA 3HXLA 2HI3A 2CH0A 4IPAA 4XM3A 1H0MA 4V2FA 1RR8C 3ESWB 1R5HA 2XGEA 1ENHA 1I6HJ 4RAFA 1UHWA 1TQMA 3IWFA 1PP7U 2ELJA 2OUMA 1U78A 3KEYA 4DJAA 4IHYA 3CTAA 1XSDA 5DD4A 5F08A 4DQ2A 2IP2A 4N9IA 4AIKA 3WHBA 1FOWA 5CVVA 3K1NA 4OIRF 3K7AJ 3T5XA 1ETOA 1FIPA 2HYJA 2QLZA 2AHQA 1DPRA 2VPLA 5ED4A 5DCFA 2ZFUA 4EVIA 2E1NA 1I1SA 4RDUA 5E3MA 3LA7A 4PCQA 2BBYA 4DBQA 3HHGA 1BR4A 2FOWA 4RBOA 4A3IJ 3F6VA 4XK4A 2X51A 2JQ7A 1HF0A 1J7KA 3F0CA 3MN2A 3ERED 2VBWA 3RKWA 3VSKA 4LOCA 1Y1VJ 4XKWA 2LF7A 4Q48A 3ROUA 1I3QJ 4E4HA 5D6EA 1JI8A 5AIQA 3BG5A 4BUPA 5E1ZB 1BI1A 4HLYA 2FOKA 3HOYJ 3BQZA 3FM3A 5M5XJ 2WAQN 2FF4A 2VODA 4LK0F 3F22A 4A3MJ 1D1CA 2NVTJ 2M87A 2GA2A 5FLXZ 2LY2A 4RB2C 2EZHA 2Q2EB 4A12A 1W36C 2X6YA 4AWXB 5LLQA 1MD0A 2EK5A 1HW5A 2IRFG 2L4AA 1PVEA 4UVAA 4K2EA 4S0HB 4E7ZA 2Y2ZA 1GUUA 1MH4A 1ZTRA 1VQKI 2JN6A 3K0LA 3LSJA 4YEJA 2G7UA 2HOEA 1KQ0A 3HRSA 3D5SC 3A03A 3MZ8A 4TV7A 5J4VA 2KT0A 4I2OA 1WRJA 4RMNA 3SZTA 1F1ZA 1VQ6I 2L7ZA 5DEQA 3W2VA 2PI0A 4HAMA 4XMYA 4Y33A 5F1RA 1FTTA 2DMNA 4EQQA 1MKMA 3MFKA 3GTPJ 1ZLKA 3C2GA 1W5TA 5GAEJ 2XUBA 4BQOA 2M1BA 3K4NA 4OINF 1P4XA 1UHSA 5HDKA 1RPWA 2R7WA 4MIMA 4CCLA 1Z7UA 4HEA2 2BVMA 3EQLF 6PAXA 5FROA 1A6IA 5CQEA 1ZGJA 1G3WA 3QYBA 1O3RA 2IGMA 3S1RJ 1F4KA 2VKHA 4PJLA 1Y39A 2NVUB 4ZYGA 3PJRA 3JW4A 3LNQA 1YRNA 2QVOA 3H9JA 3BY6A 4O6JA 4UVCA 3OSGA 2DFEA 4W97A 1YG2A 3KYDB 5CQGA 4DZJA 2V1NA 4YRVA 2P5VA 1YW9A 1ZN2A 1BBYA 1E2XA 3FF5A 3I3LA 3CCMI 4RS8A 5J47A 2H8RA 2XAJA 1FX7A 2NOGA 4XIDA 1Z1DA 2DK5A 4OIQF 3NWTA 5HS9A 5BQTA 1ZKGA 2R7ZJ 1XMAA 3TW7A 4BQQA 1ETQA 3V7SA 5CVJA 2MG4A 2OZUA 4UXNA 1D0ZA 1MBGA 2EILH 3ZRGA 4DYQA 4FCYA 3IAS2 2Y0SN 1FOKA 4D7MA 5K7FA 4F7ZA 1XSXA 3G1MA 3OS2A 2RREA 2GXBA 5GAHJ 2HVSA 2YPRA 4WXDA 3F23A 3CF5F 2IXSA 2IA0A 5KAFC 5D5WB 2E2HJ 3KP2A 4F91B 3HOSA 3BCBA 5H6RA 1FOYA 2L7FP 5DV5A 2JA8J 3WU2C 2CV2A 2W1OA 4Y4RA 2XF5A 4B47A 3KCCA 2RV8A 1Z91A 3WTTC 2Z33A 1WJAA 1R5ID 2LBFB 1N77A 3BR1A 4LLLA 2QUFA 5IOZA 3DKXA 3J81K 2MBFA 3O8GA 2F5EA 2R7XA 3DLAA 2IS6A 2XF7A 3AG3H 4CSWA 2KDOA 2BEOA 3RPQA 2VBXA 2GQQA 2HDCA 2D5VA 5KNLA 3IKVA 3KEQA 1FOXA 4ZZDA 4BE1A 4NHJA 2DJIA 2NS7A 1U5TA 1IO2A 4YFXF 1S5LC 3HUGB 3BR6A 1ERDA 2DQLA 2IGNA 4HLXA 3NARA 4CZCA 2ADUA 1EH8A 3ZOBA 1ZGWA 3A1YA 3MKWB 4BEHA 1XGNA 4PSXA 4I6ZA 1D0YA 4BS9A 4ENMA 1YITI 2QBYA 4D1QA 2OF7A 1ITYA 3UNGC 5HODA 2NOJB 4UB6C 4N4NB 2HOAA 1QRYA 3CCQI 1IV8A 2BW3A 3SYTA 1CGPA 1UMQA 1XCVA 5FO5A 4OMYA 1HKQA 2XAHA 3CLOA 3N05A 3RQIA 4EMSA 3VFZA 3GTLJ 1GHCA 1EJ9A 3TO7A 2R5ZB 5FKLA 3BR5A 4ESFA 1R1UA 1IUFA 3NWSA 2ZBKA 1QZZA 3I0TA 3P7NA 1MDMA 1D0XA 4BHPA 2VBYA 1Z21A 2RQQA 5EEAA 2V79A 2R5YA 2X1DA 4E70A 3KZZA 4M9XA 4CYCB 2Z9OA 5J1RA 2CGPA 4QPQA 5J8FA 3CDLA 3SXYA 4FTHA 2STWA 4A3JJ 1Z9CA 3WTVC 2FQ4A 1K7AA 1BR1A 1G2HA 5E20A 2P0WA 2ACJA 1NG7A 1FJLA 4ESJA 1ZRFA 3K6GA 4XONA 4UUVA 3CF2A 4RAGA 4F93B 4A3LJ 3OOPA 2DA1A 2VJJA 3DV8A 4N0BA 2EIMH 2VC1A 1VQ9I 4FISA 2QCOA 5BPDA 1ZQ3P 2B63J 3OIQA 1IRGA 3RYPA 2XVCA 1SAXA 1BI3A 2Z16A 2EZIA 4MLOA 4LLNA 2CW7A 3TBIA 2LG4A 3DPTA 1E0EA 1ETVA 1D5YA 5IYDJ 3L00A 3WTYC 4E7LA 1Y6IA 2YU9J 1QVTA 4R79A 5H6QA 2KJCA 3MZHA 1R5GA 1PUFA 4HDUA 5DCMB 3BG9A 3BTJA 2VE8A 1RESA 1T08B 1ZRCA 4IJAA 3KZIC 1KA8A 1XD7A 1G3YA 3J80K 3MAJA 3OYCA 3PL8A 2VB6A 3FZVA 1GV5A 3K70C 1SEUA 3KETA 3CCSI 2E36A 4IOAF 1SD7A 3GXOA 2FMYA 3DF8A 3OR1C 2CV1A 3B73A 2WAFA 5IPAA 2Y0MA 3HOXJ 3BR2A 1MMNA 1KU7A 1OISA 5E3NA 1WVRA 4BXFA 1JT6A 1G8XA 5LGTA 5ILVA 3LOCA 4HRIA 3WU0A 3QOPA 4Z6YA 3TEDA 1ETXA 3M3YJ 4CA0A 3L2QA 2KDZA 1P9QC 4I02A 1VQLI 2K9SA 2ELHA 2FUG2 4QSHA 4PJ0C 5CPRB 5EEHA 4MTEA 3EUHC 5C4XJ 3M9AA 5TISC 5FRMA 2RQPA 2Y30A 5M5WJ 2A05A 4W1UA 2EFOA 3AG2H 1WGXA 3CMYA 1X1BA 2QWWA 3AKZA 1BC7C 3JRHA 4ZYDA 3GTOJ 2YU3A 3MZYA 4KITB 4YFNF 4LFUA 4WK8F 2DBBA 2HR3A 2AXTC 2OV7A 5E1WA 5B66C 5BMZA 2LF8A 1S8NA 2EZKA 1GVDA 2XRNA 3TOAA 3O2PE 4YELA 2FRHA 5EG0A 4A3EJ 3S16J 2K9QA 2CU7A 3HKZN 4LJZF 3OWTA 3PQKA 1A35A 2XIGA 2DN0A 2WAQA 3FXOA 3S2WA 3E6MA 2XAUA 3RDIA 1VQ4I 2E2IJ 3A02A 3QODA 2LH9A 1R36A 1NK3P 1TW2A 3R60A 4MFDA 4PJMA 1WSUA 2QGUA 3CJRB 3H0GJ 4NC7A 2DYRH 3CDHA 3E97A 1ZARA 4KDPA 3EETA 2R7FA 3EPZA 3H5NA 3QP5A 3Q5FA 2E5NA 5FB2A 5L3DA 1UAAA 3RKXA 1R4MB 5A2QK 4V2GA 1P7IA 2GLOA 2JPBA 1DGRM 4PDKA 2KZVA 4M3EA 1IN6A 1GV2A 1ORKA 2A6EF 4F52A 4IRGA 1S3JA 2A69F 3PO2J 3ZQ7A 1VQ7I 4IHSA 3I5UA 3D5RC 3FMQA 2QSHX 4EATA 2Y31A 3BLYA 1W0UA 1U5TB 1D5VA 3OIPA 3RZOJ 1FMVA 2EPFA 2O5RA 3H35A 4IX7A 1T8IA 2R7QA 2VI6A 3DCFA 2P8TA 3C2HA 2L01A 3VYUB 4AYBA 4HBLA 2QBYB 3WGIA 1W5CC 3ZQIA 2PEXA 3CUQC 1TT0A 1QNTA 3ZQFA 2XB0X 2IBDA 3I71A 3QPHA 1R22A 1R7JA 5HLTA 4RAZA 2JZYA 2R7OA 2V7FA 2F5CA 3BC8A 2YSRA 4WXHA 1OYWA
chains in the Genus database with same CATH topology
1ZYRF 5JR3A 2MD5A 3ZMTA 2NRAC 1IW7F 3GVAA 1NHAA 3U1DA 2Q2EA 1AOYA 1L0OC 2Q0OA 1OKRA 2OA4A 2W24A 4KIFA 3ZN0A 1WI9A 4OU0A 2K4JA 4L0YB 4ZYHA 1ZLJA 2EV0A 1DUXC 4PGHA 1YIOA 1OR7A 3PQJA 2RN7A 4MQ9F 1U2WA 3GFIA 1BI2A 2QZ8A 3R6SA 4BQAA 3LAJA 1MZBA 1CF7A 1JXSA 2K7LA 1TNSA 4HQMA 1ZHFA 3QU6A 4G6DA 4PZJA 4MTDA 2KIMA 3K69A 1ZH5A 3KLNA 3EYIA 1LDKB 4L5IA 1IRFA 3TO6A 5HLHA 4KMUX 3J80Z 4U0VA 1B59A 3HYIA 3F8BA 4L9VA 2KRFA 3LQQA 2M30A 4A0XA 2PBIA 5KK1A 4RB0A 1S6LA 1MGTA 3L09A 4A5MA 2COMA 2D45A 4RGXA 3WG9A 3P9CA 3EDPA 4M71A 5ICFA 4EJVA 3TKYA 3U2RA 3COAC 2ZO4A 4ENNA 1FSHA 2E7XA 3V8KA 3WU1B 4OIOF 5E18F 4EJTA 1KU9A 2WC2A 2XAQA 4KYWA 3CUOA 3LQRA 2WWYA 1ZRDA 2D1HA 2TDXA 1HW2A 2A5YB 3E5QA 5CVIA 5FD6A 2PQ8A 3WTWC 3LA3A 5ILUA 4Z2YA 3SQNA 4L9JA 5HDGA 4ZYEA 1HQCA 4A0YA 4AIJA 2DT5A 1E17A 4BHBA 3IWZA 3RTRA 5HVQC 1B9NA 2V6CA 1PDNC 2XGXA 5FGMA 2Z3YA 5LGNA 4RAYA 3V7RA 1RNLA 3HUGA 5HDNA 2HKOA 3IC7A 2OZ6A 2O0YA 1LB2A 1TTYA 4Y15A 4M9SA 1DPUA 5IT9K 3VODA 5A2QZ 1V4RA 3NQOA 1ZREA 4GYGA 1MJ9A 1LDJA 3REOA 3RI4A 2VT3A 4U7DA 4ASNA 2BYVE 4KIGA 2K4BA 2HYFA 1OYIA 2PMHA 2EFQA 2DK8A 2OBPA 1SD4A 2P7CB 1YQAA 5CJ9A 1QQIA 4UV9A 2PG4A 1IN5A 4LGWA 2RC4A 2HZTA 1ZG5A 2H6CA 4ENKA 1KGSA 2O61A 2H09A 2H6BA 4YG2F 5J8CA 1I1GA 2P7VB 3LFKA 1FWZA 4U0WA 3DQVC 2VOOA 2VE9A 1KYWA 1SMTA 2NS0A 1GXPA 2O8XA 2IW5A 5JHUA 2D2WA 1XN7A 3P9IA 2EA2A 3ZN1A 4LG0B 2ISYA 2LSOA 4BAYA 2L54A 2GWRA 2X0LA 5F64A 5DCMA 4KFCA 2A6HF 3AAFA 1S29A 2CG4A 2JPCA 5D8KB 4HDVA 2HYGD 4CGZA 2FEZA 1EH7A 3WTUC 2FU4A 2FNPA 5FFXA 5HOOA 3TDZC 1B9MA 1IXCA 2W57A 4LD5A 1FP2A 1CF7B 2P5LC 1FBUA 1GVJA 1SD6A 1X3UA 4EJOA 1J0RA 1BJAA 3E6CC 5LEJA 3KE2A 4KIBA 2H94A 4EM1A 3I59B 2XV4S 2UXXA 3T8RA 2KIUA 2NNYA 4EGZA 3GO5A 2LNBA 5JI6A 5LGUA 1QZYA 5F6FA 3R61A 3J7AO 1UB9A 2FE3A 1EH6A 4XLNF 2FMLA 4YIFA 1T0FA 1TLHB 2MH9A 2CWEA 3F3XA 1WWXA 1DP7P 1F9NA 1FP1D 3FHZA 3FM5A 1L3LA 2Q8KA 4KT5C 3K1PA 5KVRA 3CO7C 3HOTA 2JT1A 2GIVA 1U5TC 4H0EA 2W25A 2VXZA 3E3VA 2ESHA 5LRRA 2XASA 1I27A 4LK1F 4HQEA 1U3EM 1ZG1A 5D5VB 3JTHA 3TQNA 2VOPA 2RVCA 1J2XA 2V1XA 4KN7X 4WX9A 3IRRA 1JE8A 5E8GA 1OMIA 2DPUA 5IT9Z 4GXOA 1FSEA 4HF2A 4BNCA 5DYMA 5HS8A 1P92A 2KIFA 2MH2A 1USSA 2M5WA 1D3YA 3WODF 3ABTA 1ONVA 2CW0F 2HFHA 3O3KA 2DLLA 1J5YA 2FXAA 3QP6A 4HF0A 3KZYA 4P9UA 4OIPF 3Q9SA 2OD5A 3K9TA 4HX7A 4NB5A 2P6SA 3E5XA 2L4MA 2XKPA 2ZXJA 2DW4A 2O03A 1T6SA 3F6OA 3FMSA 5ICEA 1RZ4A 1RUOA 3JAMK 1RIOH 1Q1HA 1O3TA 3M1EA 3DP7A 3HIFA 3IHUA 2FA5A 3WE2A 2IJLA 1ON1A 3DFGA 2EFPA 1XSVA 2MLKA 4I01A 4BYYA 2Z99A 2V9VA 5D5UB 3L9FA 1SFUA 4U0YA 1EV7A 4L9NA 1U8RA 3BDDA 1IF1A 3SZPA 4UNOA 4LMYA 4ENJA 1IAWA 1C0WA 2A07F 2B0LA 3KP5A 2E7WA 1P4AA 4AIHA 3IL2A 4M6YA 2QENA 1TNTA 1Z6TA 3GWZA 1LEAA 2ZMEA 2FNAA 1HSJA 4B8XA 2XHKA 4HOBA 3ECHA 5JFRA 1FYKA 5DUIA 4M6XA 4R8HA 3N4MA 1IUYA 4MQVA 2FBIA 4A0ZA 1BIAA 1YFHA 4BHCA 1IN4A 4O3MA 4BXUA 1GXQA 4I09A 3ELKA 4B09A 2RGVA 3F8FA 3BPVA 2RNJA 4YIIA 1FBQA 2HTJA 2M8EA 3HTUA 3HRUA 2DI3A 4U88A 4GYIA 5BOXA 2HKXA 1G3SA 4UVBA 3RKYA 4A6EA 3OV8A 3GFLA 3J81Z 3N97A 3ZMVA 5J6XA 3GZ5A 1T98A 1I6XA 2M45A 2YX7A 2GZWA 2VBZA 4EV0A 2QYOA 1XB4A 4FT8A 4G9YA 2XAFA 4KA4A 5IT3A 3LA2A 3L7WA 3C1DA 4KICA 3M7GA 3ZPLA 4HYEA 3GW2A 2YR2A 5BS6A 4L5JA 2F2EA 4A2UA 4IRHA 2CSOA 2MC3A 4DNCA 3CUQA 3IKTA 2UXNA 2VT2A 2QQAA 5FD5A 4MHGA 4LG0A 4ZZLA 1D8KA 3GZ6A 1FLIA 3DKWA 1XDSA 3M8FA 3W6KB 4ESBA 2ZCWA 3LSTA 3GLXA 2IA2A 3KP6A 2Y48A 4HX4A 3BROA 2EV5A 4KNYA 5EEGA 3GX4X 1P6RA 2OU2A 2DAOA 1QBJA 2F5FA 2H27A 3JAMZ 4XRFA 5E8IA 2EA4A 1HW1A 3MEXA 4P55A 3QRFF 4IXAA 1JHHA 2ETHA 1IXRC 1XGMA 4I0BA 3F21A 4M74A 2EFWA 2A68F 1QGPA 2V1DA 3RPUA 3I59A 1G6NA 1WKMA 1K78B 1O7FA 1P4WA 4CHUA 1KYZA 1UFMA 3ZMZA 1KU2A 1O57A 2HQRA 2ZMEB 1BC8C 3QPTA 4YFKF 1XGOA 1W5SA 2QM3A 1T39A 3F8MA 4HF1A 4RGSA 3C7JA 3FMRA 4HW0A 1FYLA 2K86A 1PP8F 5AIPA 1K6OA 4I7HA 1W7PB 2MLGA 2J5PA 2ZKZA 1B4AA 2K27A 4JBAA 2V1UA 1LQ1A 4RB1A 4KN4X 3KP3A 4RGUA 1LEBA 3FX3A 1R23A 5DD8A 3BPXA 2NNNA 4EM0B 4GO1A 4M72A 5L3BA 5ICCA 3D5LA 3ECOA 1G4DA 2O6GE 3BJ6A 1FPQA 3KEOA 5BPIA 3FXRA 3F8NA 2PMUA 4AD9A 1J75A 2P5KA 1MJAA 2NYXA 4ON0A 4Q4ZF 4MEXF 3GUDA 1UCRA 3GFMA 2IPQX 4CXFA 4EGYA 4CO8A 5DDGA 5D4SA 4WWCA 1FT9A 3HSRA 3T0YA 5AONA 3DXJF 3ABUA 2VC0A 3TOBA 1A04A 3BWGA 2GXGA 3RYRA 3I64A 2FBHA 2DPDA 1KQ9A 2IA1A 1YS6A 1LVAA 1KU3A 3CUQB 4LLGF 1ZGAA 1XCBA 2J5OA 4HV5A 4UV8A 3VEPA 4WF2A 4R1HA 5D8LB 3DPLC 3O6BB 5LHIA 2NAZA 2W85A 2DQRA 2R7DA 2ZNYA 3I4PA 1J59A 3EYYA 4G94A 4IHTA 4IF4A 3G3ZA 1F5TA 1ULYA 1QO0D 1DDNA 4NQWA 2G9WA 3GYHX 2PJPA 2DFIA 2JTVA 1YW8A 2ESNA 1Z05A 5LHGA 3BOQA 1LDDA 1XMKA 1G3TA 2ZJ2A 4O5VA 3E5UA 3T1BA 1YTYA 2GAUA 2FQ3A 2MA3A 5D6FA 1FZPB 2OQGA 1SFEA 1AWCA 2RKHA 2PLYA 5FFZA 1SD5A 1BM9A 3WTZA 3ISPA 5E1XA 3H3UA 2WTEA 2AS5F 4G7ZF 1SMYF 2ISZA 4N9HA 1B1BA 1R1VA 1W4MA 2L3DA 4P9FA 3W6JB 3GEZA 3M8EA 1HKTA 1IN8A 3FWEA 2HTSA 4EJUA 2ZFWA 2P6TA 1VTNC 5H20A 4Y17A 4G7HF 5DUKA 1HKSA 4ZH4F 3ZMSA 2LKPA 3R4KA 1FNNA 3HSFA 2VONA 1PUEE 1W7PD 1KQ8A 3K2ZA 2OQRA 1RI7A 3I53A 2EV6A 4HZFA 1HBXG 1T2KA 3BJOA 3CJNA 3H3ZA 4UHTA 2KJBA 4LB5A 2DO7A 3LAPA 4P5OA 1D8JA 4CYDA 2LDUA 4QLCU 4MNUA 3ZMUA 3PFIA 3MCZA 4G8XA 2KKOA 4XLPF 2WV0A 2OAZA 1BOAA 4S04A 4PGGA 4JQFA 3CO6C 4Q5SF 2HS5A 3I58A 3V8LA 2UZKA 3P9KA 4QWQA 5D5XB 4FHTA 1TW3A 2QQ9A 1YW7A 3D0SA 5LHHA 1S7OA 2IT0A 4MGRA 1WQ2A 2ZNZA 1I5ZA 2FBKA 3C3WA 1IXSB 5K5OA 3R0JA 3V4GA 3HHHA 4KMFA 3JSOA 1B6AA 3TO9A 3L2CA 3U9GA 3ZMDA 3RJPA 3MWMA 1K79A 3I54A 5K1YA 1R58A 3G73A 1K78A 2K02A 4HX8A 3ZP5A 2O3FA 1BIBA 4L18B 3BZ6A 4CDGA 4OMZA 2BE5F 4G6QA 1O3QA 2XKOA 2HQNA 2L02A 5E17F 5L3EA 4U7BA 1TBXA 3VB2A 3KFWX 5HLGA 5CYVA 1LNWA 5LEKA 1YS7A 3Q9VA 3HTSB 4L9TA 1HSTA 1W7PA 5TJJA 1STZA 3EUHA 3JSPA 3LWFA 5TRDA 4A6DA 4P96A 3HRTA 3FXQA 2EWNA 4WXCA 2E1CA 2CFXA 1BI0A 2G7HA 4AVPA 2QQBA 1FBSA 4XSXF 2DU9A 4D0PA 4KUMA 5L3CA 4M9ZA 4HV6A 3IRQA 3KP7A 4M73A 4ETSA 3C18A 1TQIA 5K5RA 5LBQA 3BJAA 3T8TA 2P4WA 1Y0UA 1TQPA 5ILSA 3KP4A 2RDPA 3E6BA 3DEUA 1OPCA 4HA8A 5CVRA 2C6YA 2DTRA 5CVUA 4JK1X 1IN7A 1YO5C 2EB7A 4FX4A 1MJBA 4BH9A 5JVTA 2X4HA 1H9GA 1RUNA 2HGCA 1USTA 3WGHA 1H9TA 2A61A 3FXUA 1SFXA 3R0AA 4XSZF 4EJWA 3HRMA 2D1VA 4LB6B 4Q47A 1J9IA 3NEUA 1YYVA 3MQ0A 5ERIA 4WCGA 3TDUC 4CICA 5FLXK 4I0AA 1UHMA 3VOEA 1MDMB 5HS7A 4Y13A 3NRVA 4GCVA 3K1MA 1Z6RA 5CLSA 5L3FA 1R00A 1ZAOA 4IRIA 1R1TA 3ULQB 1HXDA 2BV6A 1ON2A 4L0ZB 2IVMA 3WTSC 2FSWA 2BGCA 3TGNA 3JTGA 2R3SA 4RB3C 3GFJA 2EJRA 3F8CA 3SFZA 2JSCA 2Z5UA 2W84A 5D4RA 1QPMA 4RGRA 3SHFA 1IZ1A 2Y75A 1FC3A 4MEYF 5HLIA 2GA1A 1ZG3A 2STTA 3B02A 4I98B 3WGGA 1YLFA 1XDUA 3ML6A 5K5QA 2PN6A 1P2FA 3RIRA 3BP8A 2PFBA 4GGGA 5ICGA 2CYYA 2XROA 4XBFA 1O3SA 5L3GA 3WE3A 2UWMA 1V3FA 3E6DA 3WTXC 1ODDA 1LJ9A 2YX4A 5LRSA 4G7OF 2HWVA 2EFNA 1XGSA 1BN5A 2CQKA 3KLOA 4EM2A 1S7AA 2CO5A 2F5DA 3H92A 4FX0A 1JGSA 3GF2A 1FY7A 4S05A 1OYYA 2AXLA 1T38A 2VN2A 3QAHA 3V7CA 4OOIA 1O7LA 2JRTA 4A5NA 2HEOA 3HSEA 1REPC 1U6GA 3QU3A 3F72A 1FYMA 4IVNA 1JHFA 2XAGA 2A3SA 3V8JA 4CZZA 4IPAA 1H0MA 1R5HA 1UHWA 1TQMA 3IWFA 1PP7U 1U78A 3CTAA 1XSDA 5DD4A 4DQ2A 2IP2A 4N9IA 4AIKA 5CVVA 3K1NA 4OIRF 3T5XA 2QLZA 1DPRA 5ED4A 5DCFA 4EVIA 2E1NA 1I1SA 3LA7A 4PCQA 2BBYA 3HHGA 3F6VA 1J7KA 3ERED 2VBWA 3RKWA 2LF7A 4Q48A 3ROUA 5D6EA 5AIQA 5E1ZB 1BI1A 4HLYA 2FOKA 3FM3A 2FF4A 2VODA 4LK0F 3F22A 2M87A 2GA2A 5FLXZ 4RB2C 4A12A 4AWXB 5LLQA 1MD0A 2EK5A 1HW5A 2IRFG 2L4AA 4UVAA 4K2EA 3K0LA 2G7UA 2HOEA 1KQ0A 3HRSA 4TV7A 4I2OA 1WRJA 3SZTA 1F1ZA 5DEQA 2PI0A 4HAMA 5F1RA 4EQQA 1MKMA 3MFKA 1ZLKA 1W5TA 2XUBA 2M1BA 4OINF 1P4XA 5HDKA 1Z7UA 3EQLF 6PAXA 1O3RA 1ZGJA 1G3WA 1F4KA 4ZYGA 3JW4A 2QVOA 3BY6A 4O6JA 4UVCA 1YG2A 2P5VA 1YW9A 1ZN2A 1BBYA 1E2XA 3FF5A 4RS8A 2XAJA 1FX7A 1Z1DA 2DK5A 4OIQF 5HS9A 5BQTA 1XMAA 3V7SA 5CVJA 2OZUA 4UXNA 1FOKA 4F7ZA 1XSXA 2GXBA 2YPRA 4WXDA 3F23A 5D5WB 2IA0A 3KP2A 3HOSA 5H6RA 5DV5A 3KCCA 2RV8A 1Z91A 3WTTC 2Z33A 4LLLA 2QUFA 3J81K 2MBFA 2F5EA 2BEOA 3RPQA 2VBXA 2GQQA 2HDCA 3IKVA 3KEQA 4ZZDA 4NHJA 1U5TA 4YFXF 2DQLA 4HLXA 2ADUA 1EH8A 1XGNA 4ENMA 2QBYA 1CGPA 1XCVA 5FO5A 4OMYA 1HKQA 2XAHA 3CLOA 4EMSA 3VFZA 1GHCA 3TO7A 4ESFA 1R1UA 2ZBKA 1QZZA 3I0TA 3P7NA 1MDMA 4BHPA 2VBYA 2V79A 4E70A 3KZZA 4M9XA 2Z9OA 2CGPA 5J8FA 3SXYA 2STWA 1Z9CA 3WTVC 1K7AA 5E20A 2ACJA 4ESJA 1ZRFA 4UUVA 3OOPA 3DV8A 4N0BA 2VC1A 5BPDA 1IRGA 3RYPA 2XVCA 1SAXA 1BI3A 4LLNA 3DPTA 3L00A 3WTYC 4R79A 5H6QA 2KJCA 3MZHA 1R5GA 4HDUA 5DCMB 2VE8A 1ZRCA 4IJAA 1KA8A 1XD7A 1G3YA 3J80K 3MAJA 3FZVA 3KETA 1SD7A 3GXOA 2FMYA 3DF8A 3B73A 2Y0MA 1KU7A 5LGTA 5ILVA 3WU0A 3QOPA 4I02A 2ELHA 5EEHA 4MTEA 3M9AA 2RQPA 2EFOA 2QWWA 1BC7C 4ZYDA 2YU3A 3MZYA 4YFNF 4LFUA 4WK8F 2DBBA 2HR3A 5E1WA 5BMZA 2LF8A 1S8NA 2XRNA 3TOAA 3O2PE 2FRHA 4LJZF 3PQKA 2XIGA 3S2WA 3E6MA 3RDIA 1R36A 1TW2A 3R60A 1WSUA 3CDHA 3E97A 1ZARA 4KDPA 3EETA 2R7FA 3QP5A 3Q5FA 5FB2A 5L3DA 3RKXA 5A2QK 2JPBA 4PDKA 1IN6A 2A6EF 4IRGA 1S3JA 2A69F 3ZQ7A 4IHSA 3I5UA 3FMQA 1U5TB 1D5VA 2P8TA 2L01A 4HBLA 2QBYB 3WGIA 2PEXA 3CUQC 1QNTA 3I71A 3QPHA 1R22A 1R7JA 4RAZA 2JZYA 2F5CA 2YSRA 4WXHA 1OYWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZYR F;  5JR3 A;  2MD5 A;  3ZMT A;  2NRA C;  1IW7 F;  3GVA A;  1NHA A;  3U1D A;  2Q2E A;  1AOY A;  1L0O C;  2Q0O A;  1OKR A;  2OA4 A;  2W24 A;  4KIF A;  3ZN0 A;  1WI9 A;  4OU0 A;  2K4J A;  4L0Y B;  4ZYH A;  1ZLJ A;  2EV0 A;  1DUX C;  4PGH A;  1YIO A;  1OR7 A;  3PQJ A;  2RN7 A;  4MQ9 F;  1U2W A;  3GFI A;  1BI2 A;  2QZ8 A;  3R6S A;  4BQA A;  3LAJ A;  1MZB A;  1CF7 A;  1JXS A;  2K7L A;  1TNS A;  4HQM A;  1ZHF A;  3QU6 A;  4G6D A;  4PZJ A;  4MTD A;  2KIM A;  3K69 A;  1ZH5 A;  3KLN A;  3EYI A;  1LDK B;  4L5I A;  1IRF A;  3TO6 A;  5HLH A;  4KMU X;  3J80 Z;  4U0V A;  1B59 A;  3HYI A;  3F8B A;  4L9V A;  2KRF A;  3LQQ A;  2M30 A;  4A0X A;  2PBI A;  5KK1 A;  4RB0 A;  1S6L A;  1MGT A;  3L09 A;  4A5M A;  2COM A;  2D45 A;  4RGX A;  3WG9 A;  3P9C A;  3EDP A;  4M71 A;  5ICF A;  4EJV A;  3TKY A;  3U2R A;  3COA C;  2ZO4 A;  4ENN A;  1FSH A;  2E7X A;  3V8K A;  3WU1 B;  4OIO F;  5E18 F;  4EJT A;  1KU9 A;  2WC2 A;  2XAQ A;  4KYW A;  3CUO A;  3LQR A;  2WWY A;  1ZRD A;  2D1H A;  2TDX A;  1HW2 A;  2A5Y B;  3E5Q A;  5CVI A;  5FD6 A;  2PQ8 A;  3WTW C;  3LA3 A;  5ILU A;  4Z2Y A;  3SQN A;  4L9J A;  5HDG A;  4ZYE A;  1HQC A;  4A0Y A;  4AIJ A;  2DT5 A;  1E17 A;  4BHB A;  3IWZ A;  3RTR A;  5HVQ C;  1B9N A;  2V6C A;  1PDN C;  2XGX A;  5FGM A;  2Z3Y A;  5LGN A;  4RAY A;  3V7R A;  1RNL A;  3HUG A;  5HDN A;  2HKO A;  3IC7 A;  2OZ6 A;  2O0Y A;  1LB2 A;  1TTY A;  4Y15 A;  4M9S A;  1DPU A;  5IT9 K;  3VOD A;  5A2Q Z;  1V4R A;  3NQO A;  1ZRE A;  4GYG A;  1MJ9 A;  1LDJ A;  3REO A;  3RI4 A;  2VT3 A;  4U7D A;  4ASN A;  2BYV E;  4KIG A;  2K4B A;  2HYF A;  1OYI A;  2PMH A;  2EFQ A;  2DK8 A;  2OBP A;  1SD4 A;  2P7C B;  1YQA A;  5CJ9 A;  1QQI A;  4UV9 A;  2PG4 A;  1IN5 A;  4LGW A;  2RC4 A;  2HZT A;  1ZG5 A;  2H6C A;  4ENK A;  1KGS A;  2O61 A;  2H09 A;  2H6B A;  4YG2 F;  5J8C A;  1I1G A;  2P7V B;  3LFK A;  1FWZ A;  4U0W A;  3DQV C;  2VOO A;  2VE9 A;  1KYW A;  1SMT A;  2NS0 A;  1GXP A;  2O8X A;  2IW5 A;  5JHU A;  2D2W A;  1XN7 A;  3P9I A;  2EA2 A;  3ZN1 A;  4LG0 B;  2ISY A;  2LSO A;  4BAY A;  2L54 A;  2GWR A;  2X0L A;  5F64 A;  5DCM A;  4KFC A;  2A6H F;  3AAF A;  1S29 A;  2CG4 A;  2JPC A;  5D8K B;  4HDV A;  2HYG D;  4CGZ A;  2FEZ A;  1EH7 A;  3WTU C;  2FU4 A;  2FNP A;  5FFX A;  5HOO A;  3TDZ C;  1B9M A;  1IXC A;  2W57 A;  4LD5 A;  1FP2 A;  1CF7 B;  2P5L C;  1FBU A;  1GVJ A;  1SD6 A;  1X3U A;  4EJO A;  1J0R A;  1BJA A;  3E6C C;  5LEJ A;  3KE2 A;  4KIB A;  2H94 A;  4EM1 A;  3I59 B;  2XV4 S;  2UXX A;  3T8R A;  2KIU A;  2NNY A;  4EGZ A;  3GO5 A;  2LNB A;  5JI6 A;  5LGU A;  1QZY A;  5F6F A;  3R61 A;  3J7A O;  1UB9 A;  2FE3 A;  1EH6 A;  4XLN F;  2FML A;  4YIF A;  1T0F A;  1TLH B;  2MH9 A;  2CWE A;  3F3X A;  1WWX A;  1DP7 P;  1F9N A;  1FP1 D;  3FHZ A;  3FM5 A;  1L3L A;  2Q8K A;  4KT5 C;  3K1P A;  5KVR A;  3CO7 C;  3HOT A;  2JT1 A;  2GIV A;  1U5T C;  4H0E A;  2W25 A;  2VXZ A;  3E3V A;  2ESH A;  5LRR A;  2XAS A;  1I27 A;  4LK1 F;  4HQE A;  1U3E M;  1ZG1 A;  5D5V B;  3JTH A;  3TQN A;  2VOP A;  2RVC A;  1J2X A;  2V1X A;  4KN7 X;  4WX9 A;  3IRR A;  1JE8 A;  5E8G A;  1OMI A;  2DPU A;  5IT9 Z;  4GXO A;  1FSE A;  4HF2 A;  4BNC A;  5DYM A;  5HS8 A;  1P92 A;  2KIF A;  2MH2 A;  1USS A;  2M5W A;  1D3Y A;  3WOD F;  3ABT A;  1ONV A;  2CW0 F;  2HFH A;  3O3K A;  2DLL A;  1J5Y A;  2FXA A;  3QP6 A;  4HF0 A;  3KZY A;  4P9U A;  4OIP F;  3Q9S A;  2OD5 A;  3K9T A;  4HX7 A;  4NB5 A;  2P6S A;  3E5X A;  2L4M A;  2XKP A;  2ZXJ A;  2DW4 A;  2O03 A;  1T6S A;  3F6O A;  3FMS A;  5ICE A;  1RZ4 A;  1RUO A;  3JAM K;  1RIO H;  1Q1H A;  1O3T A;  3M1E A;  3DP7 A;  3HIF A;  3IHU A;  2FA5 A;  3WE2 A;  2IJL A;  1ON1 A;  3DFG A;  2EFP A;  1XSV A;  2MLK A;  4I01 A;  4BYY A;  2Z99 A;  2V9V A;  5D5U B;  3L9F A;  1SFU A;  4U0Y A;  1EV7 A;  4L9N A;  1U8R A;  3BDD A;  1IF1 A;  3SZP A;  4UNO A;  4LMY A;  4ENJ A;  1IAW A;  1C0W A;  2A07 F;  2B0L A;  3KP5 A;  2E7W A;  1P4A A;  4AIH A;  3IL2 A;  4M6Y A;  2QEN A;  1TNT A;  1Z6T A;  3GWZ A;  1LEA A;  2ZME A;  2FNA A;  1HSJ A;  4B8X A;  2XHK A;  4HOB A;  3ECH A;  5JFR A;  1FYK A;  5DUI A;  4M6X A;  4R8H A;  3N4M A;  1IUY A;  4MQV A;  2FBI A;  4A0Z A;  1BIA A;  1YFH A;  4BHC A;  1IN4 A;  4O3M A;  4BXU A;  1GXQ A;  4I09 A;  3ELK A;  4B09 A;  2RGV A;  3F8F A;  3BPV A;  2RNJ A;  4YII A;  1FBQ A;  2HTJ A;  2M8E A;  3HTU A;  3HRU A;  2DI3 A;  4U88 A;  4GYI A;  5BOX A;  2HKX A;  1G3S A;  4UVB A;  3RKY A;  4A6E A;  3OV8 A;  3GFL A;  3J81 Z;  3N97 A;  3ZMV A;  5J6X A;  3GZ5 A;  1T98 A;  1I6X A;  2M45 A;  2YX7 A;  2GZW A;  2VBZ A;  4EV0 A;  2QYO A;  1XB4 A;  4FT8 A;  4G9Y A;  2XAF A;  4KA4 A;  5IT3 A;  3LA2 A;  3L7W A;  3C1D A;  4KIC A;  3M7G A;  3ZPL A;  4HYE A;  3GW2 A;  2YR2 A;  5BS6 A;  4L5J A;  2F2E A;  4A2U A;  4IRH A;  2CSO A;  2MC3 A;  4DNC A;  3CUQ A;  3IKT A;  2UXN A;  2VT2 A;  2QQA A;  5FD5 A;  4MHG A;  4LG0 A;  4ZZL A;  1D8K A;  3GZ6 A;  1FLI A;  3DKW A;  1XDS A;  3M8F A;  3W6K B;  4ESB A;  2ZCW A;  3LST A;  3GLX A;  2IA2 A;  3KP6 A;  2Y48 A;  4HX4 A;  3BRO A;  2EV5 A;  4KNY A;  5EEG A;  3GX4 X;  1P6R A;  2OU2 A;  2DAO A;  1QBJ A;  2F5F A;  2H27 A;  3JAM Z;  4XRF A;  5E8I A;  2EA4 A;  1HW1 A;  3MEX A;  4P55 A;  3QRF F;  4IXA A;  1JHH A;  2ETH A;  1IXR C;  1XGM A;  4I0B A;  3F21 A;  4M74 A;  2EFW A;  2A68 F;  1QGP A;  2V1D A;  3RPU A;  3I59 A;  1G6N A;  1WKM A;  1K78 B;  1O7F A;  1P4W A;  4CHU A;  1KYZ A;  1UFM A;  3ZMZ A;  1KU2 A;  1O57 A;  2HQR A;  2ZME B;  1BC8 C;  3QPT A;  4YFK F;  1XGO A;  1W5S A;  2QM3 A;  1T39 A;  3F8M A;  4HF1 A;  4RGS A;  3C7J A;  3FMR A;  4HW0 A;  1FYL A;  2K86 A;  1PP8 F;  5AIP A;  1K6O A;  4I7H A;  1W7P B;  2MLG A;  2J5P A;  2ZKZ A;  1B4A A;  2K27 A;  4JBA A;  2V1U A;  1LQ1 A;  4RB1 A;  4KN4 X;  3KP3 A;  4RGU A;  1LEB A;  3FX3 A;  1R23 A;  5DD8 A;  3BPX A;  2NNN A;  4EM0 B;  4GO1 A;  4M72 A;  5L3B A;  5ICC A;  3D5L A;  3ECO A;  1G4D A;  2O6G E;  3BJ6 A;  1FPQ A;  3KEO A;  5BPI A;  3FXR A;  3F8N A;  2PMU A;  4AD9 A;  1J75 A;  2P5K A;  1MJA A;  2NYX A;  4ON0 A;  4Q4Z F;  4MEX F;  3GUD A;  1UCR A;  3GFM A;  2IPQ X;  4CXF A;  4EGY A;  4CO8 A;  5DDG A;  5D4S A;  4WWC A;  1FT9 A;  3HSR A;  3T0Y A;  5AON A;  3DXJ F;  3ABU A;  2VC0 A;  3TOB A;  1A04 A;  3BWG A;  2GXG A;  3RYR A;  3I64 A;  2FBH A;  2DPD A;  1KQ9 A;  2IA1 A;  1YS6 A;  1LVA A;  1KU3 A;  3CUQ B;  4LLG F;  1ZGA A;  1XCB A;  2J5O A;  4HV5 A;  4UV8 A;  3VEP A;  4WF2 A;  4R1H A;  5D8L B;  3DPL C;  3O6B B;  5LHI A;  2NAZ A;  2W85 A;  2DQR A;  2R7D A;  2ZNY A;  3I4P A;  1J59 A;  3EYY A;  4G94 A;  4IHT A;  4IF4 A;  3G3Z A;  1F5T A;  1ULY A;  1QO0 D;  1DDN A;  4NQW A;  2G9W A;  3GYH X;  2PJP A;  2DFI A;  2JTV A;  1YW8 A;  2ESN A;  1Z05 A;  5LHG A;  3BOQ A;  1LDD A;  1XMK A;  1G3T A;  2ZJ2 A;  4O5V A;  3E5U A;  3T1B A;  1YTY A;  2GAU A;  2FQ3 A;  2MA3 A;  5D6F A;  1FZP B;  2OQG A;  1SFE A;  1AWC A;  2RKH A;  2PLY A;  5FFZ A;  1SD5 A;  1BM9 A;  3WTZ A;  3ISP A;  5E1X A;  3H3U A;  2WTE A;  2AS5 F;  4G7Z F;  1SMY F;  2ISZ A;  4N9H A;  1B1B A;  1R1V A;  1W4M A;  2L3D A;  4P9F A;  3W6J B;  3GEZ A;  3M8E A;  1HKT A;  1IN8 A;  3FWE A;  2HTS A;  4EJU A;  2ZFW A;  2P6T A;  1VTN C;  5H20 A;  4Y17 A;  4G7H F;  5DUK A;  1HKS A;  4ZH4 F;  3ZMS A;  2LKP A;  3R4K A;  1FNN A;  3HSF A;  2VON A;  1PUE E;  1W7P D;  1KQ8 A;  3K2Z A;  2OQR A;  1RI7 A;  3I53 A;  2EV6 A;  4HZF A;  1HBX G;  1T2K A;  3BJO A;  3CJN A;  3H3Z A;  4UHT A;  2KJB A;  4LB5 A;  2DO7 A;  3LAP A;  4P5O A;  1D8J A;  4CYD A;  2LDU A;  4QLC U;  4MNU A;  3ZMU A;  3PFI A;  3MCZ A;  4G8X A;  2KKO A;  4XLP F;  2WV0 A;  2OAZ A;  1BOA A;  4S04 A;  4PGG A;  4JQF A;  3CO6 C;  4Q5S F;  2HS5 A;  3I58 A;  3V8L A;  2UZK A;  3P9K A;  4QWQ A;  5D5X B;  4FHT A;  1TW3 A;  2QQ9 A;  1YW7 A;  3D0S A;  5LHH A;  1S7O A;  2IT0 A;  4MGR A;  1WQ2 A;  2ZNZ A;  1I5Z A;  2FBK A;  3C3W A;  1IXS B;  5K5O A;  3R0J A;  3V4G A;  3HHH A;  4KMF A;  3JSO A;  1B6A A;  3TO9 A;  3L2C A;  3U9G A;  3ZMD A;  3RJP A;  3MWM A;  1K79 A;  3I54 A;  5K1Y A;  1R58 A;  3G73 A;  1K78 A;  2K02 A;  4HX8 A;  3ZP5 A;  2O3F A;  1BIB A;  4L18 B;  3BZ6 A;  4CDG A;  4OMZ A;  2BE5 F;  4G6Q A;  1O3Q A;  2XKO A;  2HQN A;  2L02 A;  5E17 F;  5L3E A;  4U7B A;  1TBX A;  3VB2 A;  3KFW X;  5HLG A;  5CYV A;  1LNW A;  5LEK A;  1YS7 A;  3Q9V A;  3HTS B;  4L9T A;  1HST A;  1W7P A;  5TJJ A;  1STZ A;  3EUH A;  3JSP A;  3LWF A;  5TRD A;  4A6D A;  4P96 A;  3HRT A;  3FXQ A;  2EWN A;  4WXC A;  2E1C A;  2CFX A;  1BI0 A;  2G7H A;  4AVP A;  2QQB A;  1FBS A;  4XSX F;  2DU9 A;  4D0P A;  4KUM A;  5L3C A;  4M9Z A;  4HV6 A;  3IRQ A;  3KP7 A;  4M73 A;  4ETS A;  3C18 A;  1TQI A;  5K5R A;  5LBQ A;  3BJA A;  3T8T A;  2P4W A;  1Y0U A;  1TQP A;  5ILS A;  3KP4 A;  2RDP A;  3E6B A;  3DEU A;  1OPC A;  4HA8 A;  5CVR A;  2C6Y A;  2DTR A;  5CVU A;  4JK1 X;  1IN7 A;  1YO5 C;  2EB7 A;  4FX4 A;  1MJB A;  4BH9 A;  5JVT A;  2X4H A;  1H9G A;  1RUN A;  2HGC A;  1UST A;  3WGH A;  1H9T A;  2A61 A;  3FXU A;  1SFX A;  3R0A A;  4XSZ F;  4EJW A;  3HRM A;  2D1V A;  4LB6 B;  4Q47 A;  1J9I A;  3NEU A;  1YYV A;  3MQ0 A;  5ERI A;  4WCG A;  3TDU C;  4CIC A;  5FLX K;  4I0A A;  1UHM A;  3VOE A;  1MDM B;  5HS7 A;  4Y13 A;  3NRV A;  4GCV A;  3K1M A;  1Z6R A;  5CLS A;  5L3F A;  1R00 A;  1ZAO A;  4IRI A;  1R1T A;  3ULQ B;  1HXD A;  2BV6 A;  1ON2 A;  4L0Z B;  2IVM A;  3WTS C;  2FSW A;  2BGC A;  3TGN A;  3JTG A;  2R3S A;  4RB3 C;  3GFJ A;  2EJR A;  3F8C A;  3SFZ A;  2JSC A;  2Z5U A;  2W84 A;  5D4R A;  1QPM A;  4RGR A;  3SHF A;  1IZ1 A;  2Y75 A;  1FC3 A;  4MEY F;  5HLI A;  2GA1 A;  1ZG3 A;  2STT A;  3B02 A;  4I98 B;  3WGG A;  1YLF A;  1XDU A;  3ML6 A;  5K5Q A;  2PN6 A;  1P2F A;  3RIR A;  3BP8 A;  2PFB A;  4GGG A;  5ICG A;  2CYY A;  2XRO A;  4XBF A;  1O3S A;  5L3G A;  3WE3 A;  2UWM A;  1V3F A;  3E6D A;  3WTX C;  1ODD A;  1LJ9 A;  2YX4 A;  5LRS A;  4G7O F;  2HWV A;  2EFN A;  1XGS A;  1BN5 A;  2CQK A;  3KLO A;  4EM2 A;  1S7A A;  2CO5 A;  2F5D A;  3H92 A;  4FX0 A;  1JGS A;  3GF2 A;  1FY7 A;  4S05 A;  1OYY A;  2AXL A;  1T38 A;  2VN2 A;  3QAH A;  3V7C A;  4OOI A;  1O7L A;  2JRT A;  4A5N A;  2HEO A;  3HSE A;  1REP C;  1U6G A;  3QU3 A;  3F72 A;  1FYM A;  4IVN A;  1JHF A;  2XAG A;  2A3S A;  3V8J A;  4CZZ A;  4IPA A;  1H0M A;  1R5H A;  1UHW A;  1TQM A;  3IWF A;  1PP7 U;  1U78 A;  3CTA A;  1XSD A;  5DD4 A;  4DQ2 A;  2IP2 A;  4N9I A;  4AIK A;  5CVV A;  3K1N A;  4OIR F;  3T5X A;  2QLZ A;  1DPR A;  5ED4 A;  5DCF A;  4EVI A;  2E1N A;  1I1S A;  3LA7 A;  4PCQ A;  2BBY A;  3HHG A;  3F6V A;  1J7K A;  3ERE D;  2VBW A;  3RKW A;  2LF7 A;  4Q48 A;  3ROU A;  5D6E A;  5AIQ A;  5E1Z B;  1BI1 A;  4HLY A;  2FOK A;  3FM3 A;  2FF4 A;  2VOD A;  4LK0 F;  3F22 A;  2M87 A;  2GA2 A;  5FLX Z;  4RB2 C;  4A12 A;  4AWX B;  5LLQ A;  1MD0 A;  2EK5 A;  1HW5 A;  2IRF G;  2L4A A;  4UVA A;  4K2E A;  3K0L A;  2G7U A;  2HOE A;  1KQ0 A;  3HRS A;  4TV7 A;  4I2O A;  1WRJ A;  3SZT A;  1F1Z A;  5DEQ A;  2PI0 A;  4HAM A;  5F1R A;  4EQQ A;  1MKM A;  3MFK A;  1ZLK A;  1W5T A;  2XUB A;  2M1B A;  4OIN F;  1P4X A;  5HDK A;  1Z7U A;  3EQL F;  6PAX A;  1O3R A;  1ZGJ A;  1G3W A;  1F4K A;  4ZYG A;  3JW4 A;  2QVO A;  3BY6 A;  4O6J A;  4UVC A;  1YG2 A;  2P5V A;  1YW9 A;  1ZN2 A;  1BBY A;  1E2X A;  3FF5 A;  4RS8 A;  2XAJ A;  1FX7 A;  1Z1D A;  2DK5 A;  4OIQ F;  5HS9 A;  5BQT A;  1XMA A;  3V7S A;  5CVJ A;  2OZU A;  4UXN A;  1FOK A;  4F7Z A;  1XSX A;  2GXB A;  2YPR A;  4WXD A;  3F23 A;  5D5W B;  2IA0 A;  3KP2 A;  3HOS A;  5H6R A;  5DV5 A;  3KCC A;  2RV8 A;  1Z91 A;  3WTT C;  2Z33 A;  4LLL A;  2QUF A;  3J81 K;  2MBF A;  2F5E A;  2BEO A;  3RPQ A;  2VBX A;  2GQQ A;  2HDC A;  3IKV A;  3KEQ A;  4ZZD A;  4NHJ A;  1U5T A;  4YFX F;  2DQL A;  4HLX A;  2ADU A;  1EH8 A;  1XGN A;  4ENM A;  2QBY A;  1CGP A;  1XCV A;  5FO5 A;  4OMY A;  1HKQ A;  2XAH A;  3CLO A;  4EMS A;  3VFZ A;  1GHC A;  3TO7 A;  4ESF A;  1R1U A;  2ZBK A;  1QZZ A;  3I0T A;  3P7N A;  1MDM A;  4BHP A;  2VBY A;  2V79 A;  4E70 A;  3KZZ A;  4M9X A;  2Z9O A;  2CGP A;  5J8F A;  3SXY A;  2STW A;  1Z9C A;  3WTV C;  1K7A A;  5E20 A;  2ACJ A;  4ESJ A;  1ZRF A;  4UUV A;  3OOP A;  3DV8 A;  4N0B A;  2VC1 A;  5BPD A;  1IRG A;  3RYP A;  2XVC A;  1SAX A;  1BI3 A;  4LLN A;  3DPT A;  3L00 A;  3WTY C;  4R79 A;  5H6Q A;  2KJC A;  3MZH A;  1R5G A;  4HDU A;  5DCM B;  2VE8 A;  1ZRC A;  4IJA A;  1KA8 A;  1XD7 A;  1G3Y A;  3J80 K;  3MAJ A;  3FZV A;  3KET A;  1SD7 A;  3GXO A;  2FMY A;  3DF8 A;  3B73 A;  2Y0M A;  1KU7 A;  5LGT A;  5ILV A;  3WU0 A;  3QOP A;  4I02 A;  2ELH A;  5EEH A;  4MTE A;  3M9A A;  2RQP A;  2EFO A;  2QWW A;  1BC7 C;  4ZYD A;  2YU3 A;  3MZY A;  4YFN F;  4LFU A;  4WK8 F;  2DBB A;  2HR3 A;  5E1W A;  5BMZ A;  2LF8 A;  1S8N A;  2XRN A;  3TOA A;  3O2P E;  2FRH A;  4LJZ F;  3PQK A;  2XIG A;  3S2W A;  3E6M A;  3RDI A;  1R36 A;  1TW2 A;  3R60 A;  1WSU A;  3CDH A;  3E97 A;  1ZAR A;  4KDP A;  3EET A;  2R7F A;  3QP5 A;  3Q5F A;  5FB2 A;  5L3D A;  3RKX A;  5A2Q K;  2JPB A;  4PDK A;  1IN6 A;  2A6E F;  4IRG A;  1S3J A;  2A69 F;  3ZQ7 A;  4IHS A;  3I5U A;  3FMQ A;  1U5T B;  1D5V A;  2P8T A;  2L01 A;  4HBL A;  2QBY B;  3WGI A;  2PEX A;  3CUQ C;  1QNT A;  3I71 A;  3QPH A;  1R22 A;  1R7J A;  4RAZ A;  2JZY A;  2F5C A;  2YSR A;  4WXH A;  1OYW A; 
#chains in the Genus database with same CATH topology
 1ZK8 A;  1ZYR F;  5JR3 A;  4NDL A;  1DU6 A;  2ME0 A;  2MD5 A;  2LR8 A;  3ZMT A;  2A6T A;  2NRA C;  3OL4 A;  4I76 A;  1IW7 F;  2VIX A;  3PNY A;  3ZQH A;  3ASN H;  2R5Y B;  3GVA A;  3GTM J;  1NHA A;  3U1D A;  2Q2E A;  2WB1 N;  1LE8 B;  1AOY A;  2BHZ A;  3OYF A;  2VQH A;  1QA6 A;  1OFC X;  2VXD A;  1L0O C;  2Q0O A;  4A93 J;  3BZC A;  4AUX A;  1OKR A;  1JTX A;  2DMT A;  2OA4 A;  2W24 A;  2I5U A;  4KIF A;  3ZN0 A;  1WI9 A;  2ZC2 A;  4OU0 A;  2K4J A;  5FLV A;  4L0Y B;  4ZYH A;  1UG2 A;  3CLQ A;  1ZLJ A;  2EV0 A;  3GZN B;  3VYT B;  2M4K A;  2VAS A;  2FX0 A;  1DUX C;  3FDY A;  3OYN A;  2DA7 A;  4PGH A;  4XOP A;  1YIO A;  1OR7 A;  3S2H J;  3PQJ A;  2RN7 A;  4MQ9 F;  3QPS A;  1U2W A;  1X1P A;  3GFI A;  4IQ4 A;  1BI2 A;  1Q1V A;  3K4K A;  2QZ8 A;  1WJC A;  3R6S A;  1YI2 I;  4BQA A;  3LAJ A;  1MZB A;  4UY8 I;  1CF7 A;  1JXS A;  2K7L A;  1TNS A;  2QSF X;  1ZHF A;  4HQM A;  2K9N A;  3G6E I;  2KLO A;  3QU6 A;  4G6D A;  4PZJ A;  4MTD A;  2KIM A;  3K69 A;  1ZH5 A;  3KLN A;  3EYI A;  2KPM A;  1LDK B;  4L5I A;  1IRF A;  3TO6 A;  1JKR C;  5HLH A;  3DPU A;  4KMU X;  1BOB A;  1D1B A;  3ZQQ A;  1GLN A;  3J80 Z;  3HM5 A;  4U0V A;  3GTJ J;  1YX5 A;  1B59 A;  3DWL E;  3FIS A;  3HYI A;  3F8B A;  4FE4 A;  4IKF A;  1YOV B;  4L9V A;  2KRF A;  3LQQ A;  3PUB A;  4AID A;  2M30 A;  4A0X A;  2Z2S B;  4FAS D;  2PBI A;  2GBY A;  2DMU A;  5KK1 A;  1VQP I;  1VZ0 A;  4RB0 A;  2P81 A;  1RKW A;  1S6L A;  2COB A;  4IQJ A;  2CUF A;  1MGT A;  3PM1 A;  3L09 A;  4A5M A;  4B43 A;  4AVZ A;  5GPA A;  2COM A;  2D45 A;  4RGX A;  3WG9 A;  3P9C A;  2HPI A;  2XF6 A;  3EDP A;  4M71 A;  3H0D A;  2PMZ A;  5ICF A;  2M0M A;  3I9V 2;  3JRB A;  4EJV A;  3TKY A;  3U2R A;  3A2K A;  3COA C;  2ZO4 A;  4ENN A;  1FSH A;  4DYR A;  4IZZ A;  1AA7 A;  2E7X A;  3V8K A;  3LSK A;  3WU1 B;  2JA7 J;  4OIO F;  5E18 F;  4EJT A;  1KU9 A;  2WC2 A;  5EGO B;  2XAQ A;  3AL0 C;  4KYW A;  3CUO A;  3QYF A;  3LQR A;  2WWY A;  5DM6 F;  1ZRD A;  2D1H A;  2GXA A;  2TDX A;  4LG3 A;  1WH5 A;  2KP6 A;  2A5Y B;  1R6R A;  5FKO A;  3OSF A;  1HW2 A;  3E5Q A;  4NC6 A;  5CVI A;  2E2J J;  4M3F A;  5FD6 A;  2PQ8 A;  3WTW C;  3LA3 A;  5ILU A;  2QQ8 A;  4Z2Y A;  2LLK A;  3SQN A;  1X58 A;  4L9J A;  5HDG A;  1HQC A;  4A0Y A;  4ZYE A;  4AIJ A;  2NXN B;  2DT5 A;  3QPL A;  1E17 A;  4HNV A;  2M4G A;  4BHB A;  5EDN A;  3IWZ A;  3RTR A;  5HVQ C;  1B9N A;  5GPC A;  2V6C A;  3OS1 A;  1PDN C;  2XGX A;  2W00 A;  2IGO A;  5FGM A;  2Z3Y A;  5LGN A;  4RAY A;  3V7R A;  1V55 H;  1RNL A;  1EF4 A;  1E3O C;  3HUG A;  5HDN A;  2HKO A;  4ZDL A;  2R92 J;  4NC8 A;  4JOM A;  2JK3 A;  3IC7 A;  2OZ6 A;  2O0Y A;  1LB2 A;  2XPV A;  1TTY A;  1XMX A;  4Y15 A;  5B1A H;  1MND A;  4M9S A;  4OAY A;  4XLC A;  2H1K A;  1DPU A;  2DT6 A;  2L2O A;  5IT9 K;  2VKD A;  5GP9 A;  1NG6 A;  3VOD A;  1QVU A;  5A2Q Z;  1V4R A;  3NQO A;  1ZRE A;  3BG7 A;  3HBL A;  4GYG A;  1MJ9 A;  1LDJ A;  3B6C A;  3K2A A;  3MD2 A;  5FJ8 J;  1T33 A;  3REO A;  3RI4 A;  2AO9 A;  3RKQ A;  2VT3 A;  4U7D A;  4XLE A;  3CCY A;  4ASN A;  1RR7 A;  2R5Z A;  3ZQG A;  2JA2 A;  3OS0 A;  2BYV E;  4KIG A;  2K4B A;  3VYS B;  3PSI A;  3OYH A;  2HYF A;  4BDZ A;  1OYI A;  2PMH A;  2EFQ A;  2DK8 A;  2OBP A;  3PNV A;  2V4J C;  2XC7 A;  1SD4 A;  2P7C B;  1YQA A;  1JJ8 C;  5CJ9 A;  1QQI A;  4CYC A;  3JRA A;  4PSW A;  2HXO A;  2IAI A;  2K9L A;  2B7E A;  4UV9 A;  2AQF A;  2ZB9 A;  1X4P A;  2PG4 A;  4BKX A;  1IN5 A;  4LGW A;  3A01 B;  2RC4 A;  2WBM A;  2BXY A;  2HZT A;  3OYB A;  1ZG5 A;  2H6C A;  4ENK A;  3BT9 A;  1KGS A;  2O61 A;  1YJ9 I;  2H09 A;  2H6B A;  4Y7N J;  4YG2 F;  2KRH A;  5J8C A;  1I1G A;  4D5F A;  2P7V B;  3LFK A;  1FWZ A;  4U0W A;  1HA8 A;  4QPO A;  4F92 B;  2DJN A;  3DQV C;  2VOO A;  2VE9 A;  1TL8 A;  2KL4 A;  1KYW A;  1SMT A;  2NS0 A;  1GXP A;  2O8X A;  2IW5 A;  3HJE A;  5JHU A;  3KYC B;  2D2W A;  1XN7 A;  3CC7 I;  1N75 A;  3P9I A;  2EA2 A;  3ZN1 A;  4LG0 B;  2ISY A;  5DS9 A;  3FK6 A;  2LSO A;  3HKZ A;  4BAY A;  1W0T A;  2L54 A;  4B3A A;  2GWR A;  2X0L A;  5F64 A;  4D5C A;  5DCM A;  4DIQ A;  2V6E A;  4KFC A;  1QHG A;  2HU9 A;  2A6H F;  3AAF A;  1S29 A;  2CG4 A;  2JPC A;  1I50 J;  5D8K B;  4HDV A;  4IHX A;  1WHU A;  2HYG D;  4CGZ A;  3S8P A;  2DYS H;  2FEZ A;  2HXI A;  5JVG F;  1EH7 A;  3WTU C;  2FU4 A;  1UZC A;  2FNP A;  2BY0 A;  3EUA A;  4XLF A;  5FFX A;  5HOO A;  2DOA A;  3TDZ C;  1B9M A;  4D9J A;  2QF7 A;  4PK4 A;  2XDV A;  1IXC A;  2W57 A;  3W3C A;  3S1Q J;  3DU6 A;  4LD5 A;  1FP2 A;  4KJZ A;  1CF7 B;  3CJT B;  3K4C A;  2P5L C;  4DGW B;  1FBU A;  1GVJ A;  1CQT A;  2DMP A;  1SD6 A;  1X3U A;  2HOT A;  2VQL A;  2B9S A;  3P5J A;  2EIN H;  2X9D A;  4B48 A;  4EJO A;  3GTG J;  3DKY A;  2GOX B;  4BBS J;  4B3X A;  1J0R A;  1BJA A;  3MMY B;  4XN0 A;  3E6C C;  5IY5 H;  4XOT A;  5LEJ A;  3KE2 A;  4KIB A;  3Q0V A;  2H94 A;  4EM1 A;  4C9Y A;  3I59 B;  1WJB A;  2LK2 A;  2UXX A;  2XV4 S;  4GDF A;  1APL C;  3T8R A;  1ETK A;  2KIU A;  2LVS A;  2NNY A;  4XKC A;  4EGZ A;  1RRJ A;  3JRI A;  3BCA A;  3GO5 A;  1D1A A;  2LNB A;  5JI6 A;  5LGU A;  1MIJ A;  3ZGK A;  1QZY A;  5F6F A;  4XRS G;  3J7Z I;  3R61 A;  1Z3X A;  3J7A O;  1UB9 A;  2FE3 A;  1EH6 A;  4XLN F;  3AFH A;  1X19 A;  2FML A;  4YIF A;  3ERM A;  1T0F A;  5GTH C;  1TLH B;  2MH9 A;  2CWE A;  3F3X A;  3CDI A;  1WWX A;  1DP7 P;  2E60 A;  2F48 A;  4A69 C;  1F9N A;  1FP1 D;  3CME I;  2VPR A;  2YS9 A;  3FHZ A;  4XKV A;  4NNJ A;  3I56 I;  3FM5 A;  1PJR A;  1L3L A;  2Q8K A;  1WFX A;  1B72 B;  4KT5 C;  3K1P A;  5KVR A;  3CO7 C;  4LIT A;  3TP3 A;  2VKE A;  3HOT A;  2JT1 A;  2GIV A;  1OJL A;  3ZQC A;  4CCM A;  3DEE A;  3HDD A;  2DDA A;  3DBL B;  2CUJ A;  4IHV A;  1U5T C;  1Y0N A;  1JUM A;  2KRC A;  3I4M J;  5J40 A;  4H0E A;  2W25 A;  2VXZ A;  3U1K A;  3E3V A;  3SJM A;  2ESH A;  5LRR A;  2XAS A;  1V54 H;  1I27 A;  4BBR J;  2IGK A;  4LK1 F;  2OPT A;  4HQE A;  1U3E M;  4QIW N;  5E3O A;  2E71 A;  1ZG1 A;  5D5V B;  3JTH A;  3MKY B;  3TQN A;  2VOP A;  2RVC A;  4II2 A;  1J2X A;  3KYL A;  2V1X A;  2OTL I;  4KN7 X;  4WX9 A;  2K40 A;  3DTK A;  3IRR A;  1WJE A;  1SAU A;  3PIP F;  1JE8 A;  5E8G A;  4C3I J;  2Y9Z A;  1OMI A;  3OOU A;  4XKB A;  4GXO A;  2DPU A;  5IT9 Z;  1QHH D;  1FSE A;  4HF2 A;  5FKK A;  4BNC A;  5DYM A;  5HS8 A;  1P92 A;  2KIF A;  2K5C A;  3H5A A;  3V42 A;  2MH2 A;  1USS A;  2XSJ C;  5F04 A;  3S15 J;  2VLA A;  2M5W A;  3PSF A;  1D3Y A;  3WOD F;  3ABT A;  1ONV A;  2CW0 F;  3G2B A;  1ETY A;  2HFH A;  3O3K A;  2DLL A;  1J5Y A;  2FXA A;  3QP6 A;  4X0G A;  4HF0 A;  3KZY A;  4RLF A;  4P9U A;  4OIP F;  2EIJ H;  1LE8 A;  3Q9S A;  2KHM A;  2OD5 A;  1Y56 A;  3K9T A;  3O8H A;  2HVQ A;  4HX7 A;  3DU5 A;  2EZL A;  4NB5 A;  2P6S A;  3E5X A;  2L4M A;  3HOW J;  2XKP A;  5F1J A;  2NVQ J;  2ZXJ A;  2V9K A;  2DW4 A;  2BXZ A;  2O03 A;  1OCT C;  3CD6 I;  5F0C A;  2JUC A;  1T6S A;  3L2U A;  1VQN I;  2TRT A;  1SAN A;  2ZXH A;  1YE9 A;  3F6O A;  3FMS A;  5ICE A;  3IV5 A;  2M8G X;  1SFO J;  2BY2 A;  4XIC A;  1ACI A;  2E1M C;  3S3M A;  1RZ4 A;  1RUO A;  1P7J A;  1TWH J;  3JAM K;  1RIO H;  1PYV A;  1Q1H A;  2EBI A;  1O3T A;  2HDW A;  1U8B A;  3M1E A;  3DP7 A;  3HIF A;  2ID3 A;  3IHU A;  1VQ5 I;  2FA5 A;  4BY1 J;  3WE2 A;  3H9G A;  4V19 K;  2E5Z A;  2IJL A;  3K4B A;  1ON1 A;  3DFG A;  2EFP A;  3HZJ A;  1XSV A;  2WY8 Q;  1U9O A;  2MLK A;  4I01 A;  3HOZ J;  1S9H A;  3SDB A;  4BYY A;  2Z99 A;  4KIS A;  2V9V A;  2FJ1 A;  1JUS A;  2VL8 A;  2EIK H;  4XOR A;  5D5U B;  3L9F A;  1SFU A;  4U0Y A;  2TCT A;  1EV7 A;  4L9N A;  4NQW B;  1U8R A;  3BDD A;  1IF1 A;  3SZP A;  1XTA A;  4LMY A;  4UNO A;  4ENJ A;  3FKI J;  1IAW A;  4XRS A;  4E7I A;  1C0W A;  2O7O A;  2A07 F;  1ZEL A;  2B0L A;  2KMU A;  4PFP A;  1QPI A;  2L9R A;  3KP5 A;  2E7W A;  1R49 A;  4NUB A;  1P4A A;  1R71 A;  2CQ7 A;  4AIH A;  3IL2 A;  4C2U A;  4IL6 C;  3LL7 A;  2XGD A;  4Y3O A;  3M1C A;  3GTQ J;  4JP0 A;  4M6Y A;  2PX9 A;  2QEN A;  1TNT A;  1Z6T A;  3GWZ A;  2CQX A;  1LEA A;  2XGC A;  1F36 A;  2ZME A;  2FNA A;  5BNG A;  1HSJ A;  4B8X A;  2XHK A;  4HOB A;  2VJ4 A;  3ASO H;  3MKL A;  3ECH A;  5JFR A;  3BR3 A;  1FYK A;  3RZD J;  5DUI A;  4M6X A;  5EGO A;  2I8D A;  2LY1 A;  1POG A;  3OMY A;  4R8H A;  3N4M A;  2N8G A;  1IUY A;  1TC3 C;  3TW6 A;  1NH3 A;  4BJT A;  2EH3 A;  4MQV A;  2FBI A;  1LPQ A;  4A0Z A;  3G71 I;  1BIA A;  1YFH A;  4BHC A;  3OL3 A;  4BJ6 C;  1IN4 A;  1H8A C;  1Y8Q B;  3Q0U A;  3RPU D;  1N78 A;  4O3M A;  4M3B A;  4BXU A;  1HC8 A;  3WHC A;  1GXQ A;  1MMA A;  1K61 A;  4I09 A;  3ELK A;  4B09 A;  3QYE A;  1RKT A;  2RGV A;  3F8F A;  1IV6 A;  1X2N A;  3BPV A;  2RNJ A;  2WA0 A;  4YII A;  1GDT A;  3W2W A;  5EJC A;  1FBQ A;  2E1O A;  3PIO F;  2HTJ A;  2M8E A;  3HTU A;  2BVL A;  3J7A Y;  3HRU A;  2DI3 A;  3CCJ I;  4X6A J;  4U88 A;  4GYI A;  5BOX A;  2HKX A;  1G3S A;  4UVB A;  2L5Q A;  3RKY A;  2XPW A;  4A6E A;  3OV8 A;  4ZC3 A;  3GFL A;  3BG6 A;  3S3O A;  3F9K A;  3J81 Z;  3N97 A;  1BL0 A;  3ZMV A;  5J6X A;  3GZ5 A;  4XNF A;  5KAI C;  1T98 A;  3LSR A;  5J1Y A;  2R7R A;  2V26 A;  1I6X A;  2M45 A;  2YX7 A;  2GZW A;  2VBZ A;  4IEJ A;  4EV0 A;  2CQN A;  2QYO A;  1XB4 A;  2EQR A;  2NVY J;  3S3N A;  3ABL H;  3HGY A;  4FT8 A;  4G9Y A;  3DBH B;  3H3V K;  2XAF A;  1IJW C;  4KA4 A;  1ZR2 A;  5C4J J;  1Z67 A;  3HOU J;  3UKG A;  5IT3 A;  3LA2 A;  2HNH A;  5KHD A;  3L7W A;  3C1D A;  1N25 A;  2JMW A;  2VJI A;  1O4X A;  4KIC A;  2RNG A;  3M7G A;  1DQU A;  1QZE A;  2Y9Y A;  1SFK A;  3ZPL A;  4HYE A;  3GW2 A;  2YR2 A;  2KIQ A;  1K4T A;  4OWR B;  4C2M J;  5BS6 A;  1H89 C;  3A01 A;  1JGG A;  3OYG A;  4PJJ A;  4L5J A;  2WY7 Q;  4L5E A;  2F2E A;  4A2U A;  2A5W A;  2QSG X;  4IRH A;  3L1P A;  2CSO A;  2HQA A;  1T95 A;  2MC3 A;  4DNC A;  3CUQ A;  3IKT A;  2UXN A;  1ZR4 A;  2VT2 A;  2QQA A;  5M3M J;  4RM3 A;  5FD5 A;  4MHG A;  5EZH A;  3ZCO A;  1IG7 A;  4DW6 A;  4LG0 A;  4AM3 A;  4ZZL A;  1D8K A;  3GZ6 A;  4JX6 A;  3HOV J;  1FLI A;  4HPQ A;  3DKW A;  1TZL A;  5IYC J;  2Y0S A;  2OC6 A;  5F0F A;  1XDS A;  2LYC A;  3M8F A;  3W6K B;  4ESB A;  2ZCW A;  2H8W A;  3L2W A;  2QEX I;  3LST A;  1WCM J;  2IEK A;  3GLX A;  2IA2 A;  4LIV A;  3KP6 A;  1OR7 C;  2Y48 A;  4HX4 A;  4J01 A;  3BRO A;  1IC8 A;  2EV5 A;  3FXK A;  4KNY A;  4CH7 A;  1SVO A;  5EEG A;  3GX4 X;  1P6R A;  2HPM A;  2OU2 A;  2DAO A;  1QBJ A;  2F5F A;  2F4M B;  2CW8 A;  2H27 A;  1WH7 A;  1BW6 A;  5CKT A;  3Q0W A;  3JAM Z;  1K83 J;  4XRF A;  5TGT A;  2R7S A;  5E8I A;  2ZJR F;  2MYS A;  1Z0X A;  1OCC H;  1HLV A;  2EA4 A;  1HW1 A;  3MEX A;  4P55 A;  1MW7 A;  3QRF F;  4IXA A;  4B4C A;  5H2F C;  2OJE D;  1SVM A;  1U0J A;  3ZQL A;  2JA6 J;  1JHH A;  2ETH A;  1IXR C;  1XGM A;  4I0B A;  5FKM A;  5IOY A;  3F21 A;  1HDP A;  1OLT A;  4M74 A;  2EFW A;  1IGN A;  2A68 F;  1QGP A;  2V1D A;  3RPU A;  3I59 A;  2V9P A;  1G6N A;  3FK7 A;  1WKM A;  4C3H J;  1K78 B;  1T56 A;  3G4S I;  1O7F A;  4E7H A;  1UEL B;  5JHF A;  1P4W A;  3E7L A;  4CHU A;  2E35 A;  5GAD J;  3IH2 A;  1KYZ A;  5FLM J;  4B1R A;  3SFI A;  1UFM A;  5IYB J;  3L2V A;  3ZMZ A;  2KQR A;  2K3F A;  1MBF A;  2MAB A;  3BZK A;  2DFH A;  1KU2 A;  1W36 D;  4BE0 A;  1AKH B;  1O57 A;  2HQR A;  1WPK A;  2ZME B;  1BC8 C;  2HOS A;  2LD5 A;  3QPT A;  3DBR B;  4YFK F;  4HST A;  4OAZ A;  5J4Y A;  2LFB A;  3H9Q A;  4E7S A;  1XGO A;  2DMQ A;  2MW8 A;  1W5S A;  2QM3 A;  1T39 A;  3F8M A;  4HF1 A;  4RGS A;  4IOC F;  3C7J A;  3OYE A;  2ZSH B;  2DOE A;  3FMR A;  3KPH A;  2IS4 A;  3IUO A;  3GME A;  1XC5 A;  1MBE A;  1MSF C;  4HW0 A;  1OCP A;  1B72 A;  3VDX A;  4XLA A;  1FYL A;  4E7K A;  2DA2 A;  2K86 A;  9ANT A;  1PP8 F;  3HPG A;  5AIP A;  2ZXW H;  1K6O A;  4I7H A;  1IRZ A;  1W7P B;  2MLG A;  2J5P A;  3CCU I;  2ZKZ A;  4YIR X;  5JLW A;  1B4A A;  2K27 A;  4JBA A;  2V1U A;  1LQ1 A;  4RB1 A;  2HZD A;  4KN4 X;  3KP3 A;  1OCZ H;  1OQY A;  4RGU A;  3KX2 A;  1LEB A;  3FX3 A;  2DDB A;  1R23 A;  3GCM A;  5DD8 A;  3BPX A;  1JUP A;  3Q3S A;  3E1S A;  1TWA J;  3SDG A;  1Z77 A;  4ZJZ A;  2ID6 A;  4F55 A;  2NNN A;  4EM0 B;  1VND A;  4GO1 A;  4M72 A;  2X1C A;  5B3S H;  5L3B A;  1LFU P;  4ZDP A;  5ICC A;  1MNM C;  4UB8 C;  3D5L A;  3ECO A;  1G4D A;  2O6G E;  3RCO A;  3BJ6 A;  3VYR B;  1FPQ A;  2R7U A;  3KEO A;  1KZH A;  5BPI A;  3OYM A;  2BHY A;  3FXR A;  3F8N A;  2PMU A;  4AD9 A;  3J7Y J;  1J75 A;  2P5K A;  3OYL A;  4X1E A;  1MJA A;  5C3E J;  2WV1 A;  1JKQ C;  3ABK H;  2W48 A;  4CUG A;  4ZTJ A;  2R4G A;  2NYX A;  3FXL A;  1XPX A;  4ON0 A;  4Q4Z F;  2M7A A;  4MEX F;  2IS1 A;  4MO7 A;  3IH3 A;  3GUD A;  2VKV A;  2ECB A;  2OCC H;  1XS9 A;  3BQY A;  3S2D J;  3OIO A;  3M07 A;  4JYK A;  1UCR A;  3GFM A;  5M5Y J;  2IPQ X;  1OCO H;  4CXF A;  1DU0 A;  4EGY A;  4CO8 A;  5DDG A;  5D4S A;  4WWC A;  2VJ5 A;  4BXX J;  1VQO I;  1FT9 A;  1DGW Y;  3HSR A;  3TL4 X;  4DOZ A;  3T0Y A;  1DP3 A;  5AON A;  3VWB A;  3DXJ F;  3ABU A;  2VC0 A;  3TOB A;  1A04 A;  5FRN A;  3BWG A;  2GXG A;  1TWG J;  3RYR A;  4M3D A;  3M4O J;  3I64 A;  1LKX A;  2FBH A;  1OCR H;  3OY9 A;  2DPD A;  1KQ9 A;  5EZG A;  2IA1 A;  1WJ5 A;  1YS6 A;  1LVA A;  1WZ2 A;  1YJN I;  1KU3 A;  4FE7 A;  3CUQ B;  1B8I A;  4LLG F;  1ZGA A;  1XCB A;  2J5O A;  4HV5 A;  4UV8 A;  2F4O B;  4WF2 A;  3VEP A;  2JRM A;  4R1H A;  5D8L B;  4BY7 J;  1Y1W J;  5EYR A;  2QKL B;  2GIZ A;  3DPL C;  3O6B B;  3S32 A;  5LHI A;  4ZTF A;  3LSP A;  2NAZ A;  3SEZ A;  2W85 A;  3CP2 A;  2DQR A;  4EEF G;  2R7D A;  2VQC A;  2ZNY A;  3I4P A;  3S93 A;  3CCE I;  1H88 C;  4G6T B;  1J59 A;  3EYY A;  4G94 A;  5B1B H;  3ZXS A;  4IHT A;  4IF4 A;  4BDY A;  3G3Z A;  1F5T A;  1ULY A;  1QO0 D;  3CCR I;  2OCE A;  1DDN A;  4NQW A;  4CCN A;  3FHN A;  2G9W A;  2H1L A;  3GYH X;  1IRX A;  2PJP A;  1VQ8 I;  2XRL A;  2DFI A;  2JTV A;  1YW8 A;  4BGD A;  3CCL I;  4XQF A;  2ESN A;  4HSR A;  2CFO A;  1Z05 A;  5LHG A;  1YX3 A;  3BOQ A;  2YUS A;  2MGQ A;  1HDD C;  1LDD A;  1XMK A;  1MBH A;  2OTJ I;  1NK2 P;  1G3T A;  2ZJ2 A;  4O5V A;  3E5U A;  5J1U A;  3T1B A;  4AYB N;  2LRE A;  1JKO C;  2HDD A;  1YTY A;  2GAU A;  1MNE A;  2FQ3 A;  2MA3 A;  2WAD A;  2W4S A;  2NVX J;  4E7J A;  1FTZ A;  2DA3 A;  3FIW A;  3QWL A;  5D6F A;  2OQG A;  4RM2 A;  1FZP B;  4PUS A;  1SFE A;  1AWC A;  2RKH A;  2FD5 A;  2PLY A;  2M0C A;  3ONQ A;  5FFZ A;  1SD5 A;  1BM9 A;  5C44 J;  3WTZ A;  1T0F C;  3ISP A;  2O9L A;  5E1X A;  5DTD A;  3H3U A;  2NS8 A;  2WTE A;  1MBK A;  1JJ6 C;  4G7Z F;  2AS5 F;  3MVP A;  1SMY F;  2K9M A;  4DYC A;  2E19 A;  5EF6 A;  2XSD C;  5F27 A;  2CRG A;  4IO9 F;  2ISZ A;  1S72 I;  4N9H A;  2G0E A;  4PFO A;  1B1B A;  1X3Z B;  2MFZ A;  1HOM A;  4CCK A;  3FBI B;  2KZG A;  1R1V A;  4ANJ A;  1W4M A;  2L3D A;  4P9F A;  3W6J B;  1VFC A;  3GEZ A;  4C2T A;  3M8E A;  1HKT A;  1IN8 A;  3FWE A;  2WB1 A;  2HTS A;  4JX4 A;  4EJU A;  2W7N A;  3JRG A;  4HG2 A;  2ZFW A;  2P6T A;  2JVH A;  2AQE A;  1VTN C;  3K10 A;  3K70 D;  3JRC A;  5H20 A;  4Y17 A;  4G7H F;  3AG1 H;  5DM7 F;  3A0H C;  5DUK A;  1HKS A;  4ZH4 F;  3ZMS A;  2ZJQ F;  3K4L A;  2LKP A;  3BTC A;  3R4K A;  1FNN A;  3AL0 B;  1M1E B;  3HSF A;  2VON A;  2L9V A;  1PUE E;  4DZP A;  3LSM A;  1V5E A;  1W7P D;  4H4K C;  1KQ8 A;  1A36 A;  4ZDO A;  3K2Z A;  2LY9 A;  4D7N A;  1I3A A;  2OQR A;  1RI7 A;  2L0K A;  3I53 A;  2EV6 A;  1S7E A;  1YIJ I;  2PJR B;  4HZF A;  1HBX G;  2XB5 A;  1T2K A;  4E6K G;  2CV0 A;  3BJO A;  1RET A;  5HNH A;  4J00 A;  3CJN A;  3H3Z A;  4UHT A;  5LFA A;  1EKE A;  2HQ5 A;  2KJB A;  2LTP A;  1WJD A;  5IP7 J;  1VQM I;  2DO7 A;  4LB5 A;  3LAP A;  4P5O A;  1D8J A;  4CYD A;  2DTZ A;  5K7H A;  3CES A;  3JR9 A;  3CJQ B;  2LDU A;  4QLC U;  1MMS A;  4MNU A;  3ZMU A;  3PFI A;  1W1W E;  1Z3Y A;  3MCZ A;  2DCE A;  4G8X A;  3OR2 C;  1TT5 B;  2KKO A;  2R7T A;  4ABZ A;  4XLP F;  2WV0 A;  2OAZ A;  2CUE A;  2DXI A;  1BOA A;  4AU7 A;  2Z1D A;  4S04 A;  3FXM A;  1X1C A;  2PMZ N;  4PGG A;  2IS2 A;  3JRE A;  4JQF A;  1V5F A;  3CO6 C;  2BY3 A;  4Q5S F;  4FQG A;  2HS5 A;  3PUF A;  4PJN A;  1AU7 A;  4XL9 A;  3I58 A;  3V8L A;  3BTL A;  1FMW A;  3DTE A;  2UZK A;  3GBG A;  3P9K A;  4QWQ A;  2ICW G;  5D5X B;  4BL0 B;  1R4N B;  4FHT A;  1B8I B;  1TW3 A;  4F3Q A;  3A4C A;  2QQ9 A;  1YW7 A;  3D0S A;  5LHH A;  1S7O A;  3HPH A;  3DTI A;  2IT0 A;  1KON A;  1TWF J;  4MGR A;  3PO3 J;  1U9N A;  1WQ2 A;  2ZNZ A;  1I5Z A;  2ZXI A;  4XN3 A;  1LFP A;  2FBK A;  3C3W A;  1IXS B;  5J3L A;  4DBR A;  5K5O A;  4BQN A;  3R0J A;  3G1L A;  2W82 A;  3RQ4 A;  3V4G A;  3H1C A;  3HHH A;  4KMF A;  1SVL A;  3W6V A;  1MH3 A;  4UUT A;  4ZYA A;  3JSO A;  3SEQ A;  1B6A A;  3TO9 A;  4A3D J;  3L2C A;  3U9G A;  3ZMD A;  1I39 A;  3MWM A;  3RJP A;  1K79 A;  3I54 A;  5K1Y A;  1R58 A;  3G73 A;  3K4M A;  2QKM B;  1K78 A;  1UG0 A;  4A3F J;  1F43 A;  1AHD P;  2K02 A;  4HX8 A;  1VF9 A;  1G59 A;  1X4O A;  3ZP5 A;  1IDY A;  2O3F A;  1BIB A;  2ZME C;  4I99 C;  4A3B J;  2M7B A;  5LD2 C;  2L7K A;  4L18 B;  3LSG A;  2LMD A;  1AKH A;  2WAE A;  3BZ6 A;  4P1W A;  4CDG A;  4CCO A;  5K7Z A;  4OMZ A;  2BE5 F;  4G6Q A;  1MMG A;  1O3Q A;  2XKO A;  2HQN A;  2L02 A;  2ECC A;  5L3E A;  3LMM A;  1TBX A;  3VB2 A;  4U7B A;  5E17 F;  3HL2 A;  3OYK A;  3KFW X;  5FKN A;  5JLX A;  1X1A A;  5HLG A;  2LOO A;  5CYV A;  4XRM A;  2CUZ A;  1LNW A;  5LEK A;  3CMA I;  1YS7 A;  2X85 A;  3Q9V A;  3HTS B;  1HCR A;  3NAU A;  2X6X A;  4L9T A;  1HST A;  3I4N J;  1W7P A;  1YRN B;  4C30 A;  1A31 A;  3GTK J;  5TJJ A;  2JJ7 A;  4BJ5 C;  1STZ A;  3EUH A;  5HNF A;  3JSP A;  3CCV I;  3QOE A;  3LFU A;  3LWF A;  5TRD A;  4A6D A;  4P96 A;  3HRT A;  1A6Q A;  3FXQ A;  1K6Y A;  1JTY A;  2EWN A;  3C2B A;  4WXC A;  2E1C A;  1BW5 A;  2CFX A;  1BI0 A;  2G7H A;  4AVP A;  2ZSI B;  2JWT A;  2QQB A;  5E3L A;  1FBS A;  5GTI C;  4XSX F;  2DU9 A;  4D0P A;  4KUM A;  2X6O A;  5L3C A;  2ZJP F;  4M9Z A;  4HNT A;  4UUS A;  4HV6 A;  2E34 A;  1YJW I;  3IRQ A;  3KP7 A;  2ME6 A;  2L9N A;  4M73 A;  4ETS A;  3C18 A;  4BU2 A;  2JSP A;  1TQI A;  5K5R A;  5LBQ A;  2GOM A;  2X1E A;  3BJA A;  3ZR8 X;  3T8T A;  3H36 A;  1Y8R B;  4LIU A;  2JA5 J;  3OYJ A;  2P4W A;  1Y0U A;  3DEW A;  1LUJ B;  1TQP A;  1MBJ A;  2I10 A;  5ILS A;  1TWC J;  3KP4 A;  2R93 J;  1UJ8 A;  2QA4 I;  4M6V A;  4RA2 A;  3UR3 C;  2M34 A;  3JRD A;  3D1N I;  2RDP A;  1FIA A;  3E6B A;  3RSN A;  2Q1Z B;  3DEU A;  1OPC A;  1EA3 A;  3IAM 2;  4HA8 A;  5CVR A;  3QQA A;  3U21 A;  1NTC A;  4N4O B;  4AC0 A;  2C6Y A;  2DTR A;  5CVU A;  2X48 A;  3ABM H;  4JK1 X;  1IN7 A;  4A3G J;  4BEH B;  1LVK A;  2BY1 A;  1YO5 C;  2DA5 A;  2EB7 A;  2UUZ A;  4FX4 A;  2DT7 B;  1A5J A;  1MJB A;  2CJJ A;  4BH9 A;  3MKZ A;  2F5V A;  1SC7 A;  5JVT A;  2X4H A;  3L2R A;  3FBN B;  1H9G A;  3E0J B;  1RUN A;  1XX5 A;  3A0B C;  3CC4 I;  2HGC A;  1UST A;  3WGH A;  1H9T A;  1LFB A;  2A61 A;  3FXU A;  2BW3 B;  1SFX A;  3R0A A;  4J19 A;  2O8K A;  1VI0 A;  1R9T J;  1K4S A;  4XSZ F;  2M9H A;  4EJW A;  3HRM A;  2M3A A;  2D1V A;  2L7M P;  2CQQ A;  4LB6 B;  4Q47 A;  2R0Q C;  4A3C J;  2DFF A;  1XG1 A;  4G12 A;  4HNU A;  3OYA A;  1GT0 C;  1QU3 A;  1J9I A;  3NEU A;  1YYV A;  3MQ0 A;  5ERI A;  4WCG A;  3TDU C;  4CIC A;  3LSI A;  5FLX K;  4I0A A;  1UHM A;  1X1D A;  3VOE A;  1MDM B;  4XLH A;  5HS7 A;  4Y13 A;  1X3W B;  5IP6 A;  3NRV A;  4GCV A;  3K1M A;  5F0H A;  3HEF A;  1Z6R A;  5CLS A;  5L3F A;  1R00 A;  5GAG J;  1ZAO A;  4IRI A;  3CMM A;  3IP4 B;  2XPU A;  3W2A A;  1R1T A;  3ULQ B;  1HXD A;  2BV6 A;  2DA4 A;  1ON2 A;  3TMO A;  1YHQ I;  3BG3 A;  4U87 A;  3CQZ J;  3GLL A;  4L0Z B;  2IVM A;  1Z7L A;  3WTS C;  2CS3 A;  2FSW A;  2BGC A;  3S14 J;  3TGN A;  2LKX A;  3JTG A;  3CC2 I;  2R3S A;  3DLL F;  1WI3 A;  2LP0 A;  4NBQ A;  4RB3 C;  3GFJ A;  4C3J J;  3PFY A;  4KT6 A;  2UV1 A;  2EJR A;  1BJZ A;  2LKS A;  4CCJ A;  2LRD A;  3CP8 A;  3F8C A;  3SFZ A;  2JSC A;  1J09 A;  2VQG A;  4FET A;  2Z5U A;  2X6W A;  3VSL A;  2W84 A;  2E1M B;  4M3G A;  3X2Q H;  5D4R A;  1QPM A;  4RGR A;  3SHF A;  4GRI A;  1IZ1 A;  2Y75 A;  1FC3 A;  4MEY F;  1PUF B;  2CMP A;  2GA1 A;  5HLI A;  1ZG3 A;  2STT A;  3B02 A;  3LSH A;  3EUK L;  4I98 B;  3WGG A;  1YLF A;  1XDU A;  3ML6 A;  5K5Q A;  2PN6 A;  3OYI A;  3K4J A;  2KFD A;  1P2F A;  3RIR A;  3BP8 A;  2PFB A;  3S17 J;  4GGG A;  1JKP C;  2L9S A;  3IH4 A;  2GM4 A;  5ICG A;  2CYY A;  2XRO A;  4XBF A;  1E3P A;  1O3S A;  2KIS A;  2HVR A;  3JRF A;  4Y52 J;  2JVG A;  5L3G A;  3CZ6 A;  3AG4 H;  4GFB A;  2VUM J;  1ETW A;  3WE3 A;  2R7V A;  3H5R A;  2UWM A;  1V3F A;  3E6D A;  3WTX C;  2K3P A;  3S1N J;  3FXJ A;  1MMD A;  1ODD A;  1LJ9 A;  1BA5 A;  2YX4 A;  3JCU C;  3BR0 A;  2Y69 H;  5LRS A;  3HB9 A;  4G7O F;  4B44 A;  4BE2 A;  2HWV A;  3HG9 A;  3OYD A;  1IDZ A;  2EFN A;  5KCM A;  2MD0 A;  1XGS A;  1BN5 A;  2F4I A;  2F6C A;  2CQK A;  1FEX A;  3KLO A;  3FKJ A;  4XR6 A;  1S7A A;  2CO5 A;  2F5D A;  3H92 A;  4FX0 A;  4RLQ A;  3WG7 H;  4EM2 A;  3HC7 A;  3TP0 A;  1JGS A;  2MC4 A;  3KIO A;  3GF2 A;  1FY7 A;  5IP9 J;  5B5E C;  3SZG A;  4S05 A;  3B6A A;  5M3F J;  1JT0 A;  4JX5 A;  1OYY A;  2BZT A;  2RAE A;  2AXL A;  2DOD A;  5EG0 B;  2JUG A;  2MSY A;  1WJF A;  2LBF A;  3S1M J;  2BOL A;  2DA6 A;  3HGG A;  1RC9 A;  1T38 A;  3BTI A;  2VN2 A;  3G1O A;  3QAH A;  2PJR A;  3V7C A;  4OOI A;  4UUS B;  1O7L A;  2JRT A;  4A5N A;  2HEO A;  2ELK A;  1E3H A;  3HSE A;  1BR2 A;  1MSE C;  1REP C;  4II3 A;  2LC2 A;  4BAC A;  1U6G A;  2K85 A;  4MFE A;  3QU3 A;  4ITV A;  3F72 A;  4A3K J;  1FYM A;  4IVN A;  1JHF A;  1TP4 A;  1V5G A;  2XAG A;  2M2E A;  3M8J A;  3PNT A;  4IHW A;  2A3S A;  3I55 I;  1X2M A;  5E79 C;  3V8J A;  4QTR A;  3VPR A;  2DOF A;  4CZZ A;  3HXL A;  2HI3 A;  2CH0 A;  4IPA A;  4XM3 A;  1H0M A;  4V2F A;  1RR8 C;  3ESW B;  1R5H A;  2XGE A;  1ENH A;  1I6H J;  4RAF A;  1UHW A;  1TQM A;  3IWF A;  1PP7 U;  2ELJ A;  2OUM A;  1U78 A;  3KEY A;  4DJA A;  4IHY A;  3CTA A;  1XSD A;  5DD4 A;  5F08 A;  4DQ2 A;  2IP2 A;  4N9I A;  4AIK A;  3WHB A;  1FOW A;  5CVV A;  3K1N A;  4OIR F;  3K7A J;  3T5X A;  1ETO A;  1FIP A;  2HYJ A;  2QLZ A;  2AHQ A;  1DPR A;  2VPL A;  5ED4 A;  5DCF A;  2ZFU A;  4EVI A;  2E1N A;  1I1S A;  4RDU A;  5E3M A;  3LA7 A;  4PCQ A;  2BBY A;  4DBQ A;  3HHG A;  1BR4 A;  2FOW A;  4RBO A;  4A3I J;  3F6V A;  4XK4 A;  2X51 A;  2JQ7 A;  1HF0 A;  1J7K A;  3F0C A;  3MN2 A;  3ERE D;  2VBW A;  3RKW A;  3VSK A;  4LOC A;  1Y1V J;  4XKW A;  2LF7 A;  4Q48 A;  3ROU A;  1I3Q J;  4E4H A;  5D6E A;  1JI8 A;  5AIQ A;  3BG5 A;  4BUP A;  5E1Z B;  1BI1 A;  4HLY A;  2FOK A;  3HOY J;  3BQZ A;  3FM3 A;  5M5X J;  2WAQ N;  2FF4 A;  2VOD A;  4LK0 F;  3F22 A;  4A3M J;  1D1C A;  2NVT J;  2M87 A;  2GA2 A;  5FLX Z;  2LY2 A;  4RB2 C;  2EZH A;  2Q2E B;  4A12 A;  1W36 C;  2X6Y A;  4AWX B;  5LLQ A;  1MD0 A;  2EK5 A;  1HW5 A;  2IRF G;  2L4A A;  1PVE A;  4UVA A;  4K2E A;  4S0H B;  4E7Z A;  2Y2Z A;  1GUU A;  1MH4 A;  1ZTR A;  1VQK I;  2JN6 A;  3K0L A;  3LSJ A;  4YEJ A;  2G7U A;  2HOE A;  1KQ0 A;  3HRS A;  3D5S C;  3A03 A;  3MZ8 A;  4TV7 A;  5J4V A;  2KT0 A;  4I2O A;  1WRJ A;  4RMN A;  3SZT A;  1F1Z A;  1VQ6 I;  2L7Z A;  5DEQ A;  3W2V A;  2PI0 A;  4HAM A;  4XMY A;  4Y33 A;  5F1R A;  1FTT A;  2DMN A;  4EQQ A;  1MKM A;  3MFK A;  3GTP J;  1ZLK A;  3C2G A;  1W5T A;  5GAE J;  2XUB A;  4BQO A;  2M1B A;  3K4N A;  4OIN F;  1P4X A;  1UHS A;  5HDK A;  1RPW A;  2R7W A;  4MIM A;  4CCL A;  1Z7U A;  4HEA 2;  2BVM A;  3EQL F;  6PAX A;  5FRO A;  1A6I A;  5CQE A;  1ZGJ A;  1G3W A;  3QYB A;  1O3R A;  2IGM A;  3S1R J;  1F4K A;  2VKH A;  4PJL A;  1Y39 A;  2NVU B;  4ZYG A;  3PJR A;  3JW4 A;  3LNQ A;  1YRN A;  2QVO A;  3H9J A;  3BY6 A;  4O6J A;  4UVC A;  3OSG A;  2DFE A;  4W97 A;  1YG2 A;  3KYD B;  5CQG A;  4DZJ A;  2V1N A;  4YRV A;  2P5V A;  1YW9 A;  1ZN2 A;  1BBY A;  1E2X A;  3FF5 A;  3I3L A;  3CCM I;  4RS8 A;  5J47 A;  2H8R A;  2XAJ A;  1FX7 A;  2NOG A;  4XID A;  1Z1D A;  2DK5 A;  4OIQ F;  3NWT A;  5HS9 A;  5BQT A;  1ZKG A;  2R7Z J;  1XMA A;  3TW7 A;  4BQQ A;  1ETQ A;  3V7S A;  5CVJ A;  2MG4 A;  2OZU A;  4UXN A;  1D0Z A;  1MBG A;  2EIL H;  3ZRG A;  4DYQ A;  4FCY A;  3IAS 2;  2Y0S N;  1FOK A;  4D7M A;  5K7F A;  4F7Z A;  1XSX A;  3G1M A;  3OS2 A;  2RRE A;  2GXB A;  5GAH J;  2HVS A;  2YPR A;  4WXD A;  3F23 A;  3CF5 F;  2IXS A;  2IA0 A;  5KAF C;  5D5W B;  2E2H J;  3KP2 A;  4F91 B;  3HOS A;  3BCB A;  5H6R A;  1FOY A;  2L7F P;  5DV5 A;  2JA8 J;  3WU2 C;  2CV2 A;  2W1O A;  4Y4R A;  2XF5 A;  4B47 A;  3KCC A;  2RV8 A;  1Z91 A;  3WTT C;  2Z33 A;  1WJA A;  1R5I D;  2LBF B;  1N77 A;  3BR1 A;  4LLL A;  2QUF A;  5IOZ A;  3DKX A;  3J81 K;  2MBF A;  3O8G A;  2F5E A;  2R7X A;  3DLA A;  2IS6 A;  2XF7 A;  3AG3 H;  4CSW A;  2KDO A;  2BEO A;  3RPQ A;  2VBX A;  2GQQ A;  2HDC A;  2D5V A;  5KNL A;  3IKV A;  3KEQ A;  1FOX A;  4ZZD A;  4BE1 A;  4NHJ A;  2DJI A;  2NS7 A;  1U5T A;  1IO2 A;  4YFX F;  1S5L C;  3HUG B;  3BR6 A;  1ERD A;  2DQL A;  2IGN A;  4HLX A;  3NAR A;  4CZC A;  2ADU A;  1EH8 A;  3ZOB A;  1ZGW A;  3A1Y A;  3MKW B;  4BEH A;  1XGN A;  4PSX A;  4I6Z A;  1D0Y A;  4BS9 A;  4ENM A;  1YIT I;  2QBY A;  4D1Q A;  2OF7 A;  1ITY A;  3UNG C;  5HOD A;  2NOJ B;  4UB6 C;  4N4N B;  2HOA A;  1QRY A;  3CCQ I;  1IV8 A;  2BW3 A;  3SYT A;  1CGP A;  1UMQ A;  1XCV A;  5FO5 A;  4OMY A;  1HKQ A;  2XAH A;  3CLO A;  3N05 A;  3RQI A;  4EMS A;  3VFZ A;  3GTL J;  1GHC A;  1EJ9 A;  3TO7 A;  2R5Z B;  5FKL A;  3BR5 A;  4ESF A;  1R1U A;  1IUF A;  3NWS A;  2ZBK A;  1QZZ A;  3I0T A;  3P7N A;  1MDM A;  1D0X A;  4BHP A;  2VBY A;  1Z21 A;  2RQQ A;  5EEA A;  2V79 A;  2R5Y A;  2X1D A;  4E70 A;  3KZZ A;  4M9X A;  4CYC B;  2Z9O A;  5J1R A;  2CGP A;  4QPQ A;  5J8F A;  3CDL A;  3SXY A;  4FTH A;  2STW A;  4A3J J;  1Z9C A;  3WTV C;  2FQ4 A;  1K7A A;  1BR1 A;  1G2H A;  5E20 A;  2P0W A;  2ACJ A;  1NG7 A;  1FJL A;  4ESJ A;  1ZRF A;  3K6G A;  4XON A;  4UUV A;  3CF2 A;  4RAG A;  4F93 B;  4A3L J;  3OOP A;  2DA1 A;  2VJJ A;  3DV8 A;  4N0B A;  2EIM H;  2VC1 A;  1VQ9 I;  4FIS A;  2QCO A;  5BPD A;  1ZQ3 P;  2B63 J;  3OIQ A;  1IRG A;  3RYP A;  2XVC A;  1SAX A;  1BI3 A;  2Z16 A;  2EZI A;  4MLO A;  4LLN A;  2CW7 A;  3TBI A;  2LG4 A;  3DPT A;  1E0E A;  1ETV A;  1D5Y A;  5IYD J;  3L00 A;  3WTY C;  4E7L A;  1Y6I A;  2YU9 J;  1QVT A;  4R79 A;  5H6Q A;  2KJC A;  3MZH A;  1R5G A;  1PUF A;  4HDU A;  5DCM B;  3BG9 A;  3BTJ A;  2VE8 A;  1RES A;  1T08 B;  1ZRC A;  4IJA A;  3KZI C;  1KA8 A;  1XD7 A;  1G3Y A;  3J80 K;  3MAJ A;  3OYC A;  3PL8 A;  2VB6 A;  3FZV A;  1GV5 A;  3K70 C;  1SEU A;  3KET A;  3CCS I;  2E36 A;  4IOA F;  1SD7 A;  3GXO A;  2FMY A;  3DF8 A;  3OR1 C;  2CV1 A;  3B73 A;  2WAF A;  5IPA A;  2Y0M A;  3HOX J;  3BR2 A;  1MMN A;  1KU7 A;  1OIS A;  5E3N A;  1WVR A;  4BXF A;  1JT6 A;  1G8X A;  5LGT A;  5ILV A;  3LOC A;  4HRI A;  3WU0 A;  3QOP A;  4Z6Y A;  3TED A;  1ETX A;  3M3Y J;  4CA0 A;  3L2Q A;  2KDZ A;  1P9Q C;  4I02 A;  1VQL I;  2K9S A;  2ELH A;  2FUG 2;  4QSH A;  4PJ0 C;  5CPR B;  5EEH A;  4MTE A;  3EUH C;  5C4X J;  3M9A A;  5TIS C;  5FRM A;  2RQP A;  2Y30 A;  5M5W J;  2A05 A;  4W1U A;  2EFO A;  3AG2 H;  1WGX A;  3CMY A;  1X1B A;  2QWW A;  3AKZ A;  1BC7 C;  3JRH A;  4ZYD A;  3GTO J;  2YU3 A;  3MZY A;  4KIT B;  4YFN F;  4LFU A;  4WK8 F;  2DBB A;  2HR3 A;  2AXT C;  2OV7 A;  5E1W A;  5B66 C;  5BMZ A;  2LF8 A;  1S8N A;  2EZK A;  1GVD A;  2XRN A;  3TOA A;  3O2P E;  4YEL A;  2FRH A;  5EG0 A;  4A3E J;  3S16 J;  2K9Q A;  2CU7 A;  3HKZ N;  4LJZ F;  3OWT A;  3PQK A;  1A35 A;  2XIG A;  2DN0 A;  2WAQ A;  3FXO A;  3S2W A;  3E6M A;  2XAU A;  3RDI A;  1VQ4 I;  2E2I J;  3A02 A;  3QOD A;  2LH9 A;  1R36 A;  1NK3 P;  1TW2 A;  3R60 A;  4MFD A;  4PJM A;  1WSU A;  2QGU A;  3CJR B;  3H0G J;  4NC7 A;  2DYR H;  3CDH A;  3E97 A;  1ZAR A;  4KDP A;  3EET A;  2R7F A;  3EPZ A;  3H5N A;  3QP5 A;  3Q5F A;  2E5N A;  5FB2 A;  5L3D A;  1UAA A;  3RKX A;  1R4M B;  5A2Q K;  4V2G A;  1P7I A;  2GLO A;  2JPB A;  1DGR M;  4PDK A;  2KZV A;  4M3E A;  1IN6 A;  1GV2 A;  1ORK A;  2A6E F;  4F52 A;  4IRG A;  1S3J A;  2A69 F;  3PO2 J;  3ZQ7 A;  1VQ7 I;  4IHS A;  3I5U A;  3D5R C;  3FMQ A;  2QSH X;  4EAT A;  2Y31 A;  3BLY A;  1W0U A;  1U5T B;  1D5V A;  3OIP A;  3RZO J;  1FMV A;  2EPF A;  2O5R A;  3H35 A;  4IX7 A;  1T8I A;  2R7Q A;  2VI6 A;  3DCF A;  2P8T A;  3C2H A;  2L01 A;  3VYU B;  4AYB A;  4HBL A;  2QBY B;  3WGI A;  1W5C C;  3ZQI A;  2PEX A;  3CUQ C;  1TT0 A;  1QNT A;  3ZQF A;  2XB0 X;  2IBD A;  3I71 A;  3QPH A;  1R22 A;  1R7J A;  5HLT A;  4RAZ A;  2JZY A;  2R7O A;  2V7F A;  2F5C A;  3BC8 A;  2YSR A;  4WXH A;  1OYW A; 
#chains in the Genus database with same CATH homology
 1ZYR F;  5JR3 A;  2MD5 A;  3ZMT A;  2NRA C;  1IW7 F;  3GVA A;  1NHA A;  3U1D A;  2Q2E A;  1AOY A;  1L0O C;  2Q0O A;  1OKR A;  2OA4 A;  2W24 A;  4KIF A;  3ZN0 A;  1WI9 A;  4OU0 A;  2K4J A;  4L0Y B;  4ZYH A;  1ZLJ A;  2EV0 A;  1DUX C;  4PGH A;  1YIO A;  1OR7 A;  3PQJ A;  2RN7 A;  4MQ9 F;  1U2W A;  3GFI A;  1BI2 A;  2QZ8 A;  3R6S A;  4BQA A;  3LAJ A;  1MZB A;  1CF7 A;  1JXS A;  2K7L A;  1TNS A;  4HQM A;  1ZHF A;  3QU6 A;  4G6D A;  4PZJ A;  4MTD A;  2KIM A;  3K69 A;  1ZH5 A;  3KLN A;  3EYI A;  1LDK B;  4L5I A;  1IRF A;  3TO6 A;  5HLH A;  4KMU X;  3J80 Z;  4U0V A;  1B59 A;  3HYI A;  3F8B A;  4L9V A;  2KRF A;  3LQQ A;  2M30 A;  4A0X A;  2PBI A;  5KK1 A;  4RB0 A;  1S6L A;  1MGT A;  3L09 A;  4A5M A;  2COM A;  2D45 A;  4RGX A;  3WG9 A;  3P9C A;  3EDP A;  4M71 A;  5ICF A;  4EJV A;  3TKY A;  3U2R A;  3COA C;  2ZO4 A;  4ENN A;  1FSH A;  2E7X A;  3V8K A;  3WU1 B;  4OIO F;  5E18 F;  4EJT A;  1KU9 A;  2WC2 A;  2XAQ A;  4KYW A;  3CUO A;  3LQR A;  2WWY A;  1ZRD A;  2D1H A;  2TDX A;  1HW2 A;  2A5Y B;  3E5Q A;  5CVI A;  5FD6 A;  2PQ8 A;  3WTW C;  3LA3 A;  5ILU A;  4Z2Y A;  3SQN A;  4L9J A;  5HDG A;  4ZYE A;  1HQC A;  4A0Y A;  4AIJ A;  2DT5 A;  1E17 A;  4BHB A;  3IWZ A;  3RTR A;  5HVQ C;  1B9N A;  2V6C A;  1PDN C;  2XGX A;  5FGM A;  2Z3Y A;  5LGN A;  4RAY A;  3V7R A;  1RNL A;  3HUG A;  5HDN A;  2HKO A;  3IC7 A;  2OZ6 A;  2O0Y A;  1LB2 A;  1TTY A;  4Y15 A;  4M9S A;  1DPU A;  5IT9 K;  3VOD A;  5A2Q Z;  1V4R A;  3NQO A;  1ZRE A;  4GYG A;  1MJ9 A;  1LDJ A;  3REO A;  3RI4 A;  2VT3 A;  4U7D A;  4ASN A;  2BYV E;  4KIG A;  2K4B A;  2HYF A;  1OYI A;  2PMH A;  2EFQ A;  2DK8 A;  2OBP A;  1SD4 A;  2P7C B;  1YQA A;  5CJ9 A;  1QQI A;  4UV9 A;  2PG4 A;  1IN5 A;  4LGW A;  2RC4 A;  2HZT A;  1ZG5 A;  2H6C A;  4ENK A;  1KGS A;  2O61 A;  2H09 A;  2H6B A;  4YG2 F;  5J8C A;  1I1G A;  2P7V B;  3LFK A;  1FWZ A;  4U0W A;  3DQV C;  2VOO A;  2VE9 A;  1KYW A;  1SMT A;  2NS0 A;  1GXP A;  2O8X A;  2IW5 A;  5JHU A;  2D2W A;  1XN7 A;  3P9I A;  2EA2 A;  3ZN1 A;  4LG0 B;  2ISY A;  2LSO A;  4BAY A;  2L54 A;  2GWR A;  2X0L A;  5F64 A;  5DCM A;  4KFC A;  2A6H F;  3AAF A;  1S29 A;  2CG4 A;  2JPC A;  5D8K B;  4HDV A;  2HYG D;  4CGZ A;  2FEZ A;  1EH7 A;  3WTU C;  2FU4 A;  2FNP A;  5FFX A;  5HOO A;  3TDZ C;  1B9M A;  1IXC A;  2W57 A;  4LD5 A;  1FP2 A;  1CF7 B;  2P5L C;  1FBU A;  1GVJ A;  1SD6 A;  1X3U A;  4EJO A;  1J0R A;  1BJA A;  3E6C C;  5LEJ A;  3KE2 A;  4KIB A;  2H94 A;  4EM1 A;  3I59 B;  2XV4 S;  2UXX A;  3T8R A;  2KIU A;  2NNY A;  4EGZ A;  3GO5 A;  2LNB A;  5JI6 A;  5LGU A;  1QZY A;  5F6F A;  3R61 A;  3J7A O;  1UB9 A;  2FE3 A;  1EH6 A;  4XLN F;  2FML A;  4YIF A;  1T0F A;  1TLH B;  2MH9 A;  2CWE A;  3F3X A;  1WWX A;  1DP7 P;  1F9N A;  1FP1 D;  3FHZ A;  3FM5 A;  1L3L A;  2Q8K A;  4KT5 C;  3K1P A;  5KVR A;  3CO7 C;  3HOT A;  2JT1 A;  2GIV A;  1U5T C;  4H0E A;  2W25 A;  2VXZ A;  3E3V A;  2ESH A;  5LRR A;  2XAS A;  1I27 A;  4LK1 F;  4HQE A;  1U3E M;  1ZG1 A;  5D5V B;  3JTH A;  3TQN A;  2VOP A;  2RVC A;  1J2X A;  2V1X A;  4KN7 X;  4WX9 A;  3IRR A;  1JE8 A;  5E8G A;  1OMI A;  2DPU A;  5IT9 Z;  4GXO A;  1FSE A;  4HF2 A;  4BNC A;  5DYM A;  5HS8 A;  1P92 A;  2KIF A;  2MH2 A;  1USS A;  2M5W A;  1D3Y A;  3WOD F;  3ABT A;  1ONV A;  2CW0 F;  2HFH A;  3O3K A;  2DLL A;  1J5Y A;  2FXA A;  3QP6 A;  4HF0 A;  3KZY A;  4P9U A;  4OIP F;  3Q9S A;  2OD5 A;  3K9T A;  4HX7 A;  4NB5 A;  2P6S A;  3E5X A;  2L4M A;  2XKP A;  2ZXJ A;  2DW4 A;  2O03 A;  1T6S A;  3F6O A;  3FMS A;  5ICE A;  1RZ4 A;  1RUO A;  3JAM K;  1RIO H;  1Q1H A;  1O3T A;  3M1E A;  3DP7 A;  3HIF A;  3IHU A;  2FA5 A;  3WE2 A;  2IJL A;  1ON1 A;  3DFG A;  2EFP A;  1XSV A;  2MLK A;  4I01 A;  4BYY A;  2Z99 A;  2V9V A;  5D5U B;  3L9F A;  1SFU A;  4U0Y A;  1EV7 A;  4L9N A;  1U8R A;  3BDD A;  1IF1 A;  3SZP A;  4UNO A;  4LMY A;  4ENJ A;  1IAW A;  1C0W A;  2A07 F;  2B0L A;  3KP5 A;  2E7W A;  1P4A A;  4AIH A;  3IL2 A;  4M6Y A;  2QEN A;  1TNT A;  1Z6T A;  3GWZ A;  1LEA A;  2ZME A;  2FNA A;  1HSJ A;  4B8X A;  2XHK A;  4HOB A;  3ECH A;  5JFR A;  1FYK A;  5DUI A;  4M6X A;  4R8H A;  3N4M A;  1IUY A;  4MQV A;  2FBI A;  4A0Z A;  1BIA A;  1YFH A;  4BHC A;  1IN4 A;  4O3M A;  4BXU A;  1GXQ A;  4I09 A;  3ELK A;  4B09 A;  2RGV A;  3F8F A;  3BPV A;  2RNJ A;  4YII A;  1FBQ A;  2HTJ A;  2M8E A;  3HTU A;  3HRU A;  2DI3 A;  4U88 A;  4GYI A;  5BOX A;  2HKX A;  1G3S A;  4UVB A;  3RKY A;  4A6E A;  3OV8 A;  3GFL A;  3J81 Z;  3N97 A;  3ZMV A;  5J6X A;  3GZ5 A;  1T98 A;  1I6X A;  2M45 A;  2YX7 A;  2GZW A;  2VBZ A;  4EV0 A;  2QYO A;  1XB4 A;  4FT8 A;  4G9Y A;  2XAF A;  4KA4 A;  5IT3 A;  3LA2 A;  3L7W A;  3C1D A;  4KIC A;  3M7G A;  3ZPL A;  4HYE A;  3GW2 A;  2YR2 A;  5BS6 A;  4L5J A;  2F2E A;  4A2U A;  4IRH A;  2CSO A;  2MC3 A;  4DNC A;  3CUQ A;  3IKT A;  2UXN A;  2VT2 A;  2QQA A;  5FD5 A;  4MHG A;  4LG0 A;  4ZZL A;  1D8K A;  3GZ6 A;  1FLI A;  3DKW A;  1XDS A;  3M8F A;  3W6K B;  4ESB A;  2ZCW A;  3LST A;  3GLX A;  2IA2 A;  3KP6 A;  2Y48 A;  4HX4 A;  3BRO A;  2EV5 A;  4KNY A;  5EEG A;  3GX4 X;  1P6R A;  2OU2 A;  2DAO A;  1QBJ A;  2F5F A;  2H27 A;  3JAM Z;  4XRF A;  5E8I A;  2EA4 A;  1HW1 A;  3MEX A;  4P55 A;  3QRF F;  4IXA A;  1JHH A;  2ETH A;  1IXR C;  1XGM A;  4I0B A;  3F21 A;  4M74 A;  2EFW A;  2A68 F;  1QGP A;  2V1D A;  3RPU A;  3I59 A;  1G6N A;  1WKM A;  1K78 B;  1O7F A;  1P4W A;  4CHU A;  1KYZ A;  1UFM A;  3ZMZ A;  1KU2 A;  1O57 A;  2HQR A;  2ZME B;  1BC8 C;  3QPT A;  4YFK F;  1XGO A;  1W5S A;  2QM3 A;  1T39 A;  3F8M A;  4HF1 A;  4RGS A;  3C7J A;  3FMR A;  4HW0 A;  1FYL A;  2K86 A;  1PP8 F;  5AIP A;  1K6O A;  4I7H A;  1W7P B;  2MLG A;  2J5P A;  2ZKZ A;  1B4A A;  2K27 A;  4JBA A;  2V1U A;  1LQ1 A;  4RB1 A;  4KN4 X;  3KP3 A;  4RGU A;  1LEB A;  3FX3 A;  1R23 A;  5DD8 A;  3BPX A;  2NNN A;  4EM0 B;  4GO1 A;  4M72 A;  5L3B A;  5ICC A;  3D5L A;  3ECO A;  1G4D A;  2O6G E;  3BJ6 A;  1FPQ A;  3KEO A;  5BPI A;  3FXR A;  3F8N A;  2PMU A;  4AD9 A;  1J75 A;  2P5K A;  1MJA A;  2NYX A;  4ON0 A;  4Q4Z F;  4MEX F;  3GUD A;  1UCR A;  3GFM A;  2IPQ X;  4CXF A;  4EGY A;  4CO8 A;  5DDG A;  5D4S A;  4WWC A;  1FT9 A;  3HSR A;  3T0Y A;  5AON A;  3DXJ F;  3ABU A;  2VC0 A;  3TOB A;  1A04 A;  3BWG A;  2GXG A;  3RYR A;  3I64 A;  2FBH A;  2DPD A;  1KQ9 A;  2IA1 A;  1YS6 A;  1LVA A;  1KU3 A;  3CUQ B;  4LLG F;  1ZGA A;  1XCB A;  2J5O A;  4HV5 A;  4UV8 A;  3VEP A;  4WF2 A;  4R1H A;  5D8L B;  3DPL C;  3O6B B;  5LHI A;  2NAZ A;  2W85 A;  2DQR A;  2R7D A;  2ZNY A;  3I4P A;  1J59 A;  3EYY A;  4G94 A;  4IHT A;  4IF4 A;  3G3Z A;  1F5T A;  1ULY A;  1QO0 D;  1DDN A;  4NQW A;  2G9W A;  3GYH X;  2PJP A;  2DFI A;  2JTV A;  1YW8 A;  2ESN A;  1Z05 A;  5LHG A;  3BOQ A;  1LDD A;  1XMK A;  1G3T A;  2ZJ2 A;  4O5V A;  3E5U A;  3T1B A;  1YTY A;  2GAU A;  2FQ3 A;  2MA3 A;  5D6F A;  1FZP B;  2OQG A;  1SFE A;  1AWC A;  2RKH A;  2PLY A;  5FFZ A;  1SD5 A;  1BM9 A;  3WTZ A;  3ISP A;  5E1X A;  3H3U A;  2WTE A;  2AS5 F;  4G7Z F;  1SMY F;  2ISZ A;  4N9H A;  1B1B A;  1R1V A;  1W4M A;  2L3D A;  4P9F A;  3W6J B;  3GEZ A;  3M8E A;  1HKT A;  1IN8 A;  3FWE A;  2HTS A;  4EJU A;  2ZFW A;  2P6T A;  1VTN C;  5H20 A;  4Y17 A;  4G7H F;  5DUK A;  1HKS A;  4ZH4 F;  3ZMS A;  2LKP A;  3R4K A;  1FNN A;  3HSF A;  2VON A;  1PUE E;  1W7P D;  1KQ8 A;  3K2Z A;  2OQR A;  1RI7 A;  3I53 A;  2EV6 A;  4HZF A;  1HBX G;  1T2K A;  3BJO A;  3CJN A;  3H3Z A;  4UHT A;  2KJB A;  4LB5 A;  2DO7 A;  3LAP A;  4P5O A;  1D8J A;  4CYD A;  2LDU A;  4QLC U;  4MNU A;  3ZMU A;  3PFI A;  3MCZ A;  4G8X A;  2KKO A;  4XLP F;  2WV0 A;  2OAZ A;  1BOA A;  4S04 A;  4PGG A;  4JQF A;  3CO6 C;  4Q5S F;  2HS5 A;  3I58 A;  3V8L A;  2UZK A;  3P9K A;  4QWQ A;  5D5X B;  4FHT A;  1TW3 A;  2QQ9 A;  1YW7 A;  3D0S A;  5LHH A;  1S7O A;  2IT0 A;  4MGR A;  1WQ2 A;  2ZNZ A;  1I5Z A;  2FBK A;  3C3W A;  1IXS B;  5K5O A;  3R0J A;  3V4G A;  3HHH A;  4KMF A;  3JSO A;  1B6A A;  3TO9 A;  3L2C A;  3U9G A;  3ZMD A;  3RJP A;  3MWM A;  1K79 A;  3I54 A;  5K1Y A;  1R58 A;  3G73 A;  1K78 A;  2K02 A;  4HX8 A;  3ZP5 A;  2O3F A;  1BIB A;  4L18 B;  3BZ6 A;  4CDG A;  4OMZ A;  2BE5 F;  4G6Q A;  1O3Q A;  2XKO A;  2HQN A;  2L02 A;  5E17 F;  5L3E A;  4U7B A;  1TBX A;  3VB2 A;  3KFW X;  5HLG A;  5CYV A;  1LNW A;  5LEK A;  1YS7 A;  3Q9V A;  3HTS B;  4L9T A;  1HST A;  1W7P A;  5TJJ A;  1STZ A;  3EUH A;  3JSP A;  3LWF A;  5TRD A;  4A6D A;  4P96 A;  3HRT A;  3FXQ A;  2EWN A;  4WXC A;  2E1C A;  2CFX A;  1BI0 A;  2G7H A;  4AVP A;  2QQB A;  1FBS A;  4XSX F;  2DU9 A;  4D0P A;  4KUM A;  5L3C A;  4M9Z A;  4HV6 A;  3IRQ A;  3KP7 A;  4M73 A;  4ETS A;  3C18 A;  1TQI A;  5K5R A;  5LBQ A;  3BJA A;  3T8T A;  2P4W A;  1Y0U A;  1TQP A;  5ILS A;  3KP4 A;  2RDP A;  3E6B A;  3DEU A;  1OPC A;  4HA8 A;  5CVR A;  2C6Y A;  2DTR A;  5CVU A;  4JK1 X;  1IN7 A;  1YO5 C;  2EB7 A;  4FX4 A;  1MJB A;  4BH9 A;  5JVT A;  2X4H A;  1H9G A;  1RUN A;  2HGC A;  1UST A;  3WGH A;  1H9T A;  2A61 A;  3FXU A;  1SFX A;  3R0A A;  4XSZ F;  4EJW A;  3HRM A;  2D1V A;  4LB6 B;  4Q47 A;  1J9I A;  3NEU A;  1YYV A;  3MQ0 A;  5ERI A;  4WCG A;  3TDU C;  4CIC A;  5FLX K;  4I0A A;  1UHM A;  3VOE A;  1MDM B;  5HS7 A;  4Y13 A;  3NRV A;  4GCV A;  3K1M A;  1Z6R A;  5CLS A;  5L3F A;  1R00 A;  1ZAO A;  4IRI A;  1R1T A;  3ULQ B;  1HXD A;  2BV6 A;  1ON2 A;  4L0Z B;  2IVM A;  3WTS C;  2FSW A;  2BGC A;  3TGN A;  3JTG A;  2R3S A;  4RB3 C;  3GFJ A;  2EJR A;  3F8C A;  3SFZ A;  2JSC A;  2Z5U A;  2W84 A;  5D4R A;  1QPM A;  4RGR A;  3SHF A;  1IZ1 A;  2Y75 A;  1FC3 A;  4MEY F;  5HLI A;  2GA1 A;  1ZG3 A;  2STT A;  3B02 A;  4I98 B;  3WGG A;  1YLF A;  1XDU A;  3ML6 A;  5K5Q A;  2PN6 A;  1P2F A;  3RIR A;  3BP8 A;  2PFB A;  4GGG A;  5ICG A;  2CYY A;  2XRO A;  4XBF A;  1O3S A;  5L3G A;  3WE3 A;  2UWM A;  1V3F A;  3E6D A;  3WTX C;  1ODD A;  1LJ9 A;  2YX4 A;  5LRS A;  4G7O F;  2HWV A;  2EFN A;  1XGS A;  1BN5 A;  2CQK A;  3KLO A;  4EM2 A;  1S7A A;  2CO5 A;  2F5D A;  3H92 A;  4FX0 A;  1JGS A;  3GF2 A;  1FY7 A;  4S05 A;  1OYY A;  2AXL A;  1T38 A;  2VN2 A;  3QAH A;  3V7C A;  4OOI A;  1O7L A;  2JRT A;  4A5N A;  2HEO A;  3HSE A;  1REP C;  1U6G A;  3QU3 A;  3F72 A;  1FYM A;  4IVN A;  1JHF A;  2XAG A;  2A3S A;  3V8J A;  4CZZ A;  4IPA A;  1H0M A;  1R5H A;  1UHW A;  1TQM A;  3IWF A;  1PP7 U;  1U78 A;  3CTA A;  1XSD A;  5DD4 A;  4DQ2 A;  2IP2 A;  4N9I A;  4AIK A;  5CVV A;  3K1N A;  4OIR F;  3T5X A;  2QLZ A;  1DPR A;  5ED4 A;  5DCF A;  4EVI A;  2E1N A;  1I1S A;  3LA7 A;  4PCQ A;  2BBY A;  3HHG A;  3F6V A;  1J7K A;  3ERE D;  2VBW A;  3RKW A;  2LF7 A;  4Q48 A;  3ROU A;  5D6E A;  5AIQ A;  5E1Z B;  1BI1 A;  4HLY A;  2FOK A;  3FM3 A;  2FF4 A;  2VOD A;  4LK0 F;  3F22 A;  2M87 A;  2GA2 A;  5FLX Z;  4RB2 C;  4A12 A;  4AWX B;  5LLQ A;  1MD0 A;  2EK5 A;  1HW5 A;  2IRF G;  2L4A A;  4UVA A;  4K2E A;  3K0L A;  2G7U A;  2HOE A;  1KQ0 A;  3HRS A;  4TV7 A;  4I2O A;  1WRJ A;  3SZT A;  1F1Z A;  5DEQ A;  2PI0 A;  4HAM A;  5F1R A;  4EQQ A;  1MKM A;  3MFK A;  1ZLK A;  1W5T A;  2XUB A;  2M1B A;  4OIN F;  1P4X A;  5HDK A;  1Z7U A;  3EQL F;  6PAX A;  1O3R A;  1ZGJ A;  1G3W A;  1F4K A;  4ZYG A;  3JW4 A;  2QVO A;  3BY6 A;  4O6J A;  4UVC A;  1YG2 A;  2P5V A;  1YW9 A;  1ZN2 A;  1BBY A;  1E2X A;  3FF5 A;  4RS8 A;  2XAJ A;  1FX7 A;  1Z1D A;  2DK5 A;  4OIQ F;  5HS9 A;  5BQT A;  1XMA A;  3V7S A;  5CVJ A;  2OZU A;  4UXN A;  1FOK A;  4F7Z A;  1XSX A;  2GXB A;  2YPR A;  4WXD A;  3F23 A;  5D5W B;  2IA0 A;  3KP2 A;  3HOS A;  5H6R A;  5DV5 A;  3KCC A;  2RV8 A;  1Z91 A;  3WTT C;  2Z33 A;  4LLL A;  2QUF A;  3J81 K;  2MBF A;  2F5E A;  2BEO A;  3RPQ A;  2VBX A;  2GQQ A;  2HDC A;  3IKV A;  3KEQ A;  4ZZD A;  4NHJ A;  1U5T A;  4YFX F;  2DQL A;  4HLX A;  2ADU A;  1EH8 A;  1XGN A;  4ENM A;  2QBY A;  1CGP A;  1XCV A;  5FO5 A;  4OMY A;  1HKQ A;  2XAH A;  3CLO A;  4EMS A;  3VFZ A;  1GHC A;  3TO7 A;  4ESF A;  1R1U A;  2ZBK A;  1QZZ A;  3I0T A;  3P7N A;  1MDM A;  4BHP A;  2VBY A;  2V79 A;  4E70 A;  3KZZ A;  4M9X A;  2Z9O A;  2CGP A;  5J8F A;  3SXY A;  2STW A;  1Z9C A;  3WTV C;  1K7A A;  5E20 A;  2ACJ A;  4ESJ A;  1ZRF A;  4UUV A;  3OOP A;  3DV8 A;  4N0B A;  2VC1 A;  5BPD A;  1IRG A;  3RYP A;  2XVC A;  1SAX A;  1BI3 A;  4LLN A;  3DPT A;  3L00 A;  3WTY C;  4R79 A;  5H6Q A;  2KJC A;  3MZH A;  1R5G A;  4HDU A;  5DCM B;  2VE8 A;  1ZRC A;  4IJA A;  1KA8 A;  1XD7 A;  1G3Y A;  3J80 K;  3MAJ A;  3FZV A;  3KET A;  1SD7 A;  3GXO A;  2FMY A;  3DF8 A;  3B73 A;  2Y0M A;  1KU7 A;  5LGT A;  5ILV A;  3WU0 A;  3QOP A;  4I02 A;  2ELH A;  5EEH A;  4MTE A;  3M9A A;  2RQP A;  2EFO A;  2QWW A;  1BC7 C;  4ZYD A;  2YU3 A;  3MZY A;  4YFN F;  4LFU A;  4WK8 F;  2DBB A;  2HR3 A;  5E1W A;  5BMZ A;  2LF8 A;  1S8N A;  2XRN A;  3TOA A;  3O2P E;  2FRH A;  4LJZ F;  3PQK A;  2XIG A;  3S2W A;  3E6M A;  3RDI A;  1R36 A;  1TW2 A;  3R60 A;  1WSU A;  3CDH A;  3E97 A;  1ZAR A;  4KDP A;  3EET A;  2R7F A;  3QP5 A;  3Q5F A;  5FB2 A;  5L3D A;  3RKX A;  5A2Q K;  2JPB A;  4PDK A;  1IN6 A;  2A6E F;  4IRG A;  1S3J A;  2A69 F;  3ZQ7 A;  4IHS A;  3I5U A;  3FMQ A;  1U5T B;  1D5V A;  2P8T A;  2L01 A;  4HBL A;  2QBY B;  3WGI A;  2PEX A;  3CUQ C;  1QNT A;  3I71 A;  3QPH A;  1R22 A;  1R7J A;  4RAZ A;  2JZY A;  2F5C A;  2YSR A;  4WXH A;  1OYW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...