3GFMA

Crystal structure of the st1710 mutant (k91a) protein
Total Genus 57
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
57
sequence length
141
structure length
141
Chain Sequence
ENRIQIMSTIAKIYRAMSRELNRRLGELNLSYLDFLVLRATSDGPKTMAYLANRYFVTQSAITASVDKLEEMGLVVRVRDREDRRAILIEITEKGLETFNKGIEIYKKLANEVTGDLSEDEVILVLDKISKILKRIEEISQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title ST1710-DNA complex crystal structure reveals the DNA binding mechanism of the MarR family of regulators.
pubmed doi rcsb
source organism Sulfolobus tokodaii
molecule tags Transcription
molecule keywords 146aa long hypothetical transcriptional regulator
total genus 57
structure length 141
sequence length 141
ec nomenclature
pdb deposition date 2009-02-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF13463 HTH_27 Winged helix DNA-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3gfmA00
2P8TA 4M9SA 3M8FA 2MD5A 2ELHA 4O3MA 1D8JA 2NNNA 5D5WB 5LEJA 2FOKA 3MQ0A 4L18B 1BC7C 1KU9A 3M7GA 3F22A 1KYZA 1TTYA 5HVQC 3ZMDA 3L00A 3F8MA 3ULQB 2RV8A 3F72A 4M74A 4G7HF 2HYGD 3EYIA 4UXNA 3V4GA 1K6OA 3EUHA 2NAZA 2E1CA 3LFKA 4Z2YA 3D0SA 3IHUA 1ONVA 3BJAA 3EQLF 3V8LA 3F23A 4U7BA 4FHTA 3N4MA 1I1SA 2VOPA 5A2QK 2IRFG 4ZYEA 5E1WA 1ZGAA 2L4AA 3T5XA 4CGZA 2FNPA 3CUQC 5DD4A 4MEXF 2O3FA 4A6EA 2OZ6A 4KDPA 2JPCA 2J5OA 1HW2A 3LA3A 1G3YA 3QPTA 5D5VB 1USSA 4IXAA 3F8NA 4M9XA 3LSTA 1YFHA 4H0EA 3HUGA 2VOOA 5IT9K 4LLGF 4ENMA 2G7UA 3FMSA 4M72A 3WODF 1BI2A 5AONA 3VFZA 4K2EA 2DK8A 2ZO4A 2R7DA 4LG0B 1IF1A 3RKYA 3HYIA 2EJRA 3R60A 3K0LA 5E8IA 2FMLA 2WWYA 3V7SA 4Y13A 2Y48A 1XDUA 4EJTA 3NQOA 4FX0A 2RQPA 1XMKA 4A0YA 1FY7A 2HTJA 2H27A 2XAJA 2F2EA 4ETSA 5D4SA 4A12A 1QBJA 3RDIA 3RPUA 1LEBA 2FU4A 1KU2A 1XCBA 3CLOA 4AIKA 1SD5A 4DQ2A 4UNOA 1KU7A 2FBKA 4JQFA 2P7CB 1R58A 5FD6A 4P55A 2D2WA 1FSHA 1KQ0A 1V4RA 3D5LA 2P5KA 3R61A 4HA8A 4JK1X 1IXSB 3U1DA 5ERIA 3H3ZA 3W6JB 6PAXA 4ESBA 3VODA 1W5SA 4MTDA 3I4PA 1ZN2A 4CO8A 1F1ZA 2VBWA 3P9KA 3H3UA 5H20A 2FMYA 3QP6A 4M71A 1BI0A 3IKTA 2GZWA 2QQBA 4O6JA 5FGMA 5F6FA 4BQAA 1FNNA 2ZFWA 3TOBA 2W57A 4NHJA 1QO0D 3EDPA 4EM2A 4ZZDA 1K78A 3FXRA 3GFMA 4HQMA 1KQ8A 2L54A 1J9IA 1R1TA 3KCCA 3KP5A 3JSPA 4EM1A 4MGRA 2BYVE 5KK1A 1ZRDA 1KYWA 1XSDA 2YSRA 3WTXC 3J81Z 2J5PA 1U5TB 5H6RA 3E97A 3PFIA 1B9NA 1BIBA 2QYOA 1ZHFA 2A3SA 5ICFA 2ESNA 4YFXF 4EM0B 1HW1A 2E7WA 4GXOA 1HKSA 2DU9A 4WXDA 5FB2A 1OR7A 2PFBA 4G9YA 3J80K 3DQVC 1TLHB 3HTSB 1SD6A 5J8FA 2IT0A 4RB0A 1TW2A 1Z7UA 2XAQA 4PDKA 3N97A 1IUYA 2LF8A 2YR2A 1SMTA 2IA1A 1BBYA 1KQ9A 1IN7A 1I27A 2DO7A 2RKHA 4RAYA 2STWA 4WXHA 1FP2A 4G6QA 4KMUX 2IP2A 1FYLA 4KFCA 1MDMB 1IZ1A 1XSVA 4KMFA 3GLXA 3DPTA 3AAFA 2OQRA 3WTVC 3QAHA 1RUNA 5CVRA 4OMZA 2H6BA 1HKTA 1MDMA 1G3TA 3F21A 4GYGA 1I1GA 1I6XA 2FEZA 1OYWA 3LA2A 4I02A 4YFKF 5HDNA 4HQEA 4FT8A 1R5HA 3WE3A 3W6KB 3CDHA 3HSFA 2P5LC 3GZ5A 1LNWA 3KEQA 4LMYA 3GFLA 3WTYC 5CVVA 1R23A 1JHFA 2XAFA 4HBLA 1HSTA 1KU3A 3FM3A 2F5DA 1ODDA 4BXUA 2DW4A 4I0AA 5L3FA 5LBQA 3DPLC 1BM9A 2Z99A 2Z5UA 1IRGA 4MNUA 1DPUA 3I59A 2CYYA 2FNAA 3GWZA 1P92A 2VC1A 2K4JA 1TQMA 1T0FA 3LA7A 4L0YB 1XMAA 2M8EA 2ZMEA 4LK0F 1LJ9A 5J8CA 2K7LA 2ZXJA 5H6QA 2ZNZA 2ADUA 2EFNA 1PDNC 3M9AA 3WGHA 3NEUA 4P5OA 4AIJA 2CW0F 4EMSA 1TW3A 4YIFA 4MEYF 3WU0A 4UVBA 1S7OA 3LAPA 4KT5C 4B8XA 4N9HA 3G73A 2YX4A 4CYDA 3L9FA 3V8JA 4EQQA 2EA2A 3B02A 1ZARA 2HKXA 3SXYA 4WWCA 2QBYA 1FBUA 3OOPA 4HDUA 3BOQA 5IT3A 2HQRA 4OIOF 4AIHA 4ENNA 3HHHA 3K69A 2FBHA 2DQRA 3BPXA 3K9TA 3IKVA 3KP2A 1BC8C 3COAC 2UWMA 1BJAA 1OKRA 2ZCWA 3T8TA 3ZMVA 4EJWA 4IHTA 1XGNA 2GA1A 2P5VA 2HS5A 2HDCA 2QLZA 4HF0A 2OZUA 2QQAA 2JSCA 4ZH4F 5L3GA 4G6DA 4G8XA 2P4WA 4WF2A 2UXNA 4LG0A 3IL2A 2VN2A 2DTRA 2P6TA 2KJBA 4LK1F 5KVRA 2M1BA 3MWMA 2KIMA 4XLPF 2EV5A 3QU6A 2VT2A 4OU0A 2D1VA 4Y15A 3ZQ7A 2E1NA 3BJOA 1S3JA 2IJLA 1XD7A 4LD5A 4L0ZB 2MA3A 1XSXA 2HKOA 2MBFA 3J7AO 3ELKA 3CUQA 3P9CA 4KIFA 1E17A 4MQ9F 5JI6A 1FBQA 1B6AA 2CGPA 2CQKA 1HSJA 5L3BA 3WGIA 2HFHA 3FHZA 5CJ9A 5EEGA 4U7DA 1IN6A 3C18A 1RZ4A 1R5GA 4ASNA 3P9IA 4KYWA 4HF2A 4L5JA 3TO7A 3GVAA 2IA2A 2QM3A 2VE9A 1IXRC 3IRQA 1F4KA 5LHHA 2BV6A 3L09A 3ROUA 1H9TA 3GEZA 3M1EA 1T98A 5ILVA 3JTGA 1W5TA 1WI9A 4U0VA 1RUOA 2A69F 3DXJF 3CUOA 3F6OA 3S2WA 3MFKA 2XAGA 1B59A 1U8RA 2L01A 5BPIA 1ZLKA 1D5VA 5DUIA 3ZN1A 1FYKA 4CDGA 3I0TA 4M6XA 4OMYA 1DPRA 4DNCA 5LGTA 2K27A 3HRSA 1J75A 3KP3A 1OYIA 2Q8KA 3G3ZA 2QQ9A 2PN6A 1J59A 3SHFA 4F7ZA 1FT9A 3F8FA 1SFUA 1WKMA 1Z91A 3HRTA 3HRMA 5J6XA 4A2UA 4A6DA 1SD4A 3FZVA 1ZRCA 1GVJA 2XKOA 3CO7C 2NRAC 4ENKA 2F5CA 5ICGA 2M87A 1FSEA 1Z6TA 2HGCA 1XGSA 2K4BA 2BGCA 4M9ZA 1LDKB 4Q5SF 5HDKA 2OAZA 2ETHA 1ZAOA 3R6SA 4QWQA 2JPBA 5FLXZ 4XBFA 4OIQF 1BIAA 1LDDA 5HOOA 3REOA 2Q2EA 5F64A 2VONA 4XSZF 2EB7A 4LJZF 2VXZA 3DF8A 2MLKA 2L02A 3DFGA 2HOEA 3JAMZ 3WTSC 3GO5A 1T6SA 2GXBA 2KKOA 2QWWA 1SFXA 3IWFA 4HV5A 3GUDA 1FWZA 1IN4A 1B4AA 2XGXA 4IHSA 4IRHA 2V79A 3KLOA 2HQNA 1J2XA 1S7AA 2RN7A 2IA0A 1XCVA 5FFXA 3MZHA 4IJAA 4QLCU 2QENA 5JHUA 1MJBA 1W4MA 1CF7A 1ULYA 1G3WA 1T2KA 4WXCA 4I98B 3JW4A 4P96A 2X0LA 2GWRA 3O6BB 1YQAA 5HS7A 4ZYHA 3ZN0A 2DBBA 1SMYF 3WTZA 4HX4A 5DDGA 3J81K 3E5UA 3GXOA 3KP7A 4WX9A 3HRUA 2DFIA 4PZJA 4YIIA 2R7FA 1Z9CA 3FMRA 2PJPA 2PI0A 2KIFA 1C0WA 1TNSA 3BPVA 4WK8F 5E17F 2LDUA 3F6VA 3Q5FA 3CTAA 4P9UA 2CG4A 4UV9A 1R7JA 2P7VB 4GYIA 2QVOA 2XRNA 2KRFA 3KZYA 4S05A 3I5UA 5ICCA 3ABUA 1Q1HA 2VBYA 2A6HF 1O3QA 2ISYA 2WTEA 4EV0A 3FWEA 4U0YA 4EGYA 3F3XA 3ECHA 3LQQA 5ILUA 5HLHA 1D8KA 1YTYA 3MZYA 1R1VA 4OIPF 5JR3A 2GAUA 1W7PA 5LGUA 4RGSA 3E6DA 3DKWA 1W7PB 3E5QA 1WWXA 4KN7X 4G7ZF 1LVAA 5LRRA 4UVAA 5E18F 1CF7B 1ZH5A 1ZREA 2FSWA 3QOPA 4HLYA 5EEHA 1FLIA 2G9WA 1BI1A 2G7HA 4PGHA 3LAJA 5HLIA 1XB4A 3TO6A 3BP8A 4GGGA 2L4MA 1WQ2A 3V8KA 2K86A 4HZFA 4BNCA 3WTWC 3JTHA 3FXUA 4M73A 2GQQA 4PGGA 3EYYA 4OINF 1MZBA 3F8CA 2Z9OA 2M30A 3ZMUA 4ENJA 3GW2A 1IN8A 3M8EA 1WRJA 3C3WA 3R4KA 1E2XA 5DCFA 2TDXA 5LGNA 2A5YB 4MTEA 4NQWA 4O5VA 3VOEA 2XKPA 5E1ZB 3TOAA 4A5NA 3GZ6A 3E6MA 3BJ6A 2V6CA 4KNYA 3RI4A 1OYYA 1YS7A 2LSOA 5HS9A 4U0WA 3RIRA 3GX4X 1S29A 2XAHA 4KICA 4ON0A 1A04A 1STZA 1LQ1A 3O3KA 2Y75A 1MKMA 2IW5A 2OU2A 2BE5F 3IC7A 5DV5A 2Z33A 1LEAA 1U6GA 5CVUA 1I5ZA 1YW8A 4JBAA 2GXGA 1TNTA 2OD5A 5K5RA 3QRFF 4PCQA 4RB3C 2BEOA 4XLNF 2HR3A 4UV8A 4KIBA 4IPAA 5LHIA 4ESJA 2M5WA 2A6EF 3RKXA 3KP4A 4UUVA 4R79A 1PP8F 1IW7F 2VE8A 2CO5A 1TBXA 2LKPA 1DP7P 1R22A 4R8HA 5K1YA 3T8RA 3R0AA 1UB9A 3GYHX 4LB6B 2Q0OA 3QP5A 4ZZLA 2UZKA 5DCMA 1P4WA 2UXXA 2JTVA 2X4HA 1HBXG 4KIGA 1EH8A 3IRRA 2W24A 5L3DA 1IRFA 2JT1A 1OMIA 3ECOA 3I53A 5D8LB 1MD0A 5CVIA 4MHGA 2PQ8A 3PQJA 1FPQA 2XROA 2DT5A 2D45A 5CYVA 2AXLA 4CICA 3GFIA 4HX8A 1F5TA 2KIUA 3JAMK 1P2FA 3VEPA 1H9GA 3K1PA 3E3VA 2HTSA 2O8XA 3HIFA 1QZYA 1UFMA 1JGSA 3V7CA 4HF1A 4S04A 2DPDA 1GXQA 3BDDA 3HHGA 4LLNA 1EH7A 3F8BA 1ON2A 5FLXK 1UHWA 3U9GA 4NB5A 1T39A 5FD5A 2FF4A 3Q9SA 4OOIA 4G94A 3ZP5A 4Q47A 2F5FA 1QQIA 1O7FA 5ICEA 5FFZA 3BROA 4TV7A 2DLLA 2QBYB 2QZ8A 4BH9A 1ZLJA 3ZMSA 4LFUA 4IRGA 3SZTA 3SFZA 1FZPB 3CJNA 3R0JA 2COMA 2RC4A 5F1RA 1ZRFA 3I64A 1REPC 1O3SA 5LHGA 4CZZA 1LB2A 2H94A 3WE2A 3O2PE 1K7AA 2ESHA 3RKWA 1HXDA 1S8NA 1XGMA 1IAWA 1J7KA 2QUFA 1F9NA 2BBYA 3MEXA 2NNYA 5HDGA 3RYRA 1RIOH 1JE8A 5BQTA 1U78A 4L9TA 1SD7A 2B0LA 3FXQA 2O61A 5E20A 2XASA 2HEOA 1ZYRF 5AIQA 4A0ZA 4BHBA 4KN4X 3RPQA 4I7HA 3KEOA 4RB1A 4IRIA 1J5YA 5BPDA 3E5XA 4A0XA 4HDVA 4L9VA 5CLSA 5K5QA 5E1XA 4P9FA 2XVCA 2OQGA 4E70A 2FXAA 1YIOA 1YLFA 2PLYA 4UHTA 2Z3YA 1U5TC 2VODA 2EFOA 4EJVA 3ZMZA 1J0RA 3WTUC 1G3SA 3BY6A 2RDPA 4N9IA 1ZGJA 2OBPA 2PBIA 2DPUA 4WCGA 2O6GE 1QGPA 3KP6A 1XN7A 3C7JA 2OA4A 3MAJA 3K1NA 1G4DA 1L3LA 1X3UA 3C1DA 2EK5A 4RGUA 5HS8A 4RS8A 3TGNA 2JRTA 2FQ3A 1Z05A 4KUMA 3CO6C 2VBZA 2ACJA 2DQLA 4FX4A 2FBIA 3KETA 4R1HA 1IN5A 2D1HA 1P4AA 2RVCA 1H0MA 4I0BA 1Z6RA 2A68F 4ESFA 5DCMB 2NYXA 4L9NA 2H09A 3K2ZA 2O03A 4IVNA 3IWZA 3CUQB 4EJOA 2DI3A 1GXPA 2EV6A 3LQRA 3K1MA 1YW9A 5D4RA 5K5OA 3ZPLA 2M45A 5D6EA 1LDJA 4OIRF 2E7XA 5BOXA 1XDSA 3FX3A 3WGGA 3QPHA 1OPCA 4XSXF 1R00A 3BZ6A 2ISZA 1Z1DA 2GIVA 1SAXA 2ZBKA 5LEKA 4KA4A 4G7OF 5FO5A 3L7WA 2V1DA 3V7RA 1S6LA 1ZG1A 2IPQX 2YPRA 2H6CA 3HSRA 3ERED 3FMQA 1U2WA 3KZZA 3B73A 3KE2A 2PG4A 2WC2A 2XHKA 3DEUA 1UHMA 4UVCA 3T1BA 1O57A 2EFWA 3ZMTA 4BAYA 5LRSA 5ED4A 3GF2A 1EH6A 3ML6A 1HQCA 3FM5A 4ZYDA 4EVIA 1CGPA 2VBXA 2KJCA 5A2QZ 4HLXA 5JVTA 1JHHA 1U3EM 1K78B 3I54A 4Q4ZF 3TQNA 5DD8A 2JZYA 3LWFA 2XV4S 3JSOA 2RGVA 5AIPA 3PQKA 1K79A 4HAMA 4AD9A 1EV7A 2LF7A 5JFRA 2MLGA 5IT9Z 1FX7A 2L3DA 3HSEA 5DUKA 4LLLA 1XGOA 2F5EA 4CXFA 4L9JA 4IF4A 3DP7A 5E8GA 3SZPA 4YFNF 4U88A 3HTUA 1ZG5A 2EFPA 2ZNYA 1U5TA 4HYEA 5BMZA 2FE3A 1KA8A 2EWNA 5BS6A 2ZKZA 4CHUA 1TQIA 5D5UB 1R36A 1MGTA 3EETA 4GO1A 1D3YA 2R3SA 4I2OA 2O0YA 4M6YA 3SQNA 4EJUA 3KFWX 5D6FA 4Y17A 1TQPA 4RGXA 2V9VA 2EV0A 3TO9A 1SFEA 2C6YA 2IVMA 3E6BA 1BI3A 2W85A 1KGSA 1T38A 1O3TA 1MJ9A 2YU3A 2FRHA 3E6CC 1HKQA 2WV0A 1L0OC 1RNLA 1PUEE 3OV8A 5D5XB 3P7NA 2FA5A 4LB5A 1FP1D 2Y0MA 2GA2A 5HLGA 1ZG3A 4GCVA 4B09A 4BYYA 1V3FA 3VB2A 3WTTC 1P4XA 1QZZA 2STTA 1HW5A 1FBSA 1USTA 1W7PD 4BHCA 5L3EA 3BWGA 1IXCA 1PP7U 1UCRA 1NHAA 3RTRA 3HOTA 3J80Z 2HWVA 2V1XA 3KLNA 2HZTA 1YW7A 2VT3A 3HOSA 5TRDA 2A61A 2CFXA 2EA4A 1O3RA 3TDZC 2MH2A 1YG2A 4EGZA 1BN5A 4I09A 1GHCA 2LNBA 2HYFA 4MQVA 3RJPA 4Q48A 1JXSA 2W25A 2DK5A 1P6RA 4BHPA 4A5MA 4ZYGA 4YG2F 1AOYA 4RAZA 3ISPA 2P6SA 3I71A 2CWEA 5TJJA 4XRFA 3NRVA 3DV8A 1DDNA 2W84A 3WU1B 3Q9VA 2XIGA 1O7LA 2RNJA 2ZMEB 1FC3A 2K02A 4HX7A 5ILSA 2CSOA 2YX7A 2A07F 4N0BA 1QPMA 3I59B 1AWCA 3U2RA 5D8KB 2PMHA 1FYMA 1YO5C 5L3CA 4HV6A 5DEQA 2VC0A 2MC3A 1QNTA 5CVJA 3I58A 2NS0A 1B1BA 2ZJ2A 1YS6A 4AVPA 4D0PA 5LLQA 1RI7A 1FOKA 1DUXC 3WG9A 3RYPA 3H92A 4HW0A 4I01A 3L2CA 4L5IA 1B9MA 1BOAA 3FF5A 4RB2C 3QU3A 2V1UA 1Y0UA 2MH9A 1VTNC 3MCZA 1MJAA 1ON1A 2XUBA 2PEXA 2DAOA 2EFQA 2PMUA 3TDUC 4RGRA 3T0YA 1WSUA 2AS5F 3TKYA 1R1UA 3ABTA 4LGWA 1G6NA 3GFJA 4AWXB 5DYMA 4HOBA 1YYVA
chains in the Genus database with same CATH superfamily
2P8TA 4M9SA 1VF9A 4Y7NJ 3M8FA 4AIDA 2MD5A 2ELHA 5FRMA 4O3MA 1RRJA 2PMZN 1D8JA 1BA5A 2NNNA 5D5WB 5LEJA 2FOKA 3MQ0A 4L18B 1BC7C 1KU9A 2BVMA 3CP2A 3M7GA 4W97A 1T8IA 1ETOA 3F22A 1KYZA 1TTYA 5HVQC 3ZMDA 2JRMA 5KAIC 5KCMA 5C44J 1JI8A 3L00A 3F8MA 2N8GA 4OWRB 3CF5F 3ULQB 2RV8A 3D5SC 3HDDA 3F72A 4M74A 4G7HF 1VZ0A 3HXLA 4IQ4A 1ETWA 3OL4A 2V9KA 2HYGD 2ECCA 2IS2A 1U8BA 1AA7A 3EYIA 4UXNA 3V4GA 3OYMA 1K6OA 1YX3A 3EUHA 2NAZA 2R5ZB 2AQFA 5IP6A 2KMUA 2E1CA 3LFKA 3S14J 2WAFA 1VQPI 4A93J 2LC2A 4Z2YA 3C2GA 3S1QJ 3D0SA 3IHUA 1ONVA 2CMPA 3BJAA 3EQLF 3V8LA 3F23A 4U7BA 2V6EA 4FHTA 2EIJH 5IYCJ 1BR1A 3N4MA 1D1CA 5K7FA 3HL2A 4E7HA 2LREA 2VOPA 1I1SA 2HQAA 5A2QK 2IRFG 2FQ4A 2V9PA 2H1LA 4ZYEA 2X1EA 5E1WA 4BEHA 1UG2A 1ZGAA 4XR6A 2L4AA 3AG1H 4Y4RA 5HNHA 2HVSA 3T5XA 4XRSA 1Y1WJ 4CGZA 3CMAI 2FNPA 3CUQC 1NK3P 5DD4A 3HUGB 4MEXF 2O8KA 2O3FA 4A6EA 2WADA 2OZ6A 4ITVA 2BY3A 4RM3A 1ZQ3P 2DA3A 2E1MC 2JPCA 2E5ZA 3SZGA 4KDPA 2J5OA 4BJTA 1HW2A 1ZELA 3LA3A 1G3YA 2BY2A 3QPTA 4XLCA 1USSA 5D5VB 4IXAA 5JHFA 3F8NA 4M9XA 3LSTA 1YFHA 4H0EA 1S5LC 3HUGA 2VOOA 5IT9K 4LLGF 3CP8A 4ENMA 2WB1A 3JRCA 4PFPA 2G7UA 3FMSA 4M72A 3WODF 1Y39A 1BI2A 5AONA 3OIPA 2F4IA 3VFZA 3VYUB 4K2EA 2DK8A 2ZO4A 2R7DA 4LG0B 3DKYA 1NH3A 2BXYA 1IF1A 2E2IJ 3RKYA 3HYIA 2EJRA 3R60A 3K0LA 3IH4A 2LY9A 5E8IA 3OYBA 2FMLA 2WWYA 1F43A 3V7SA 4ANJA 4Y13A 2VB6A 2Y48A 1XDUA 5FKLA 4EJTA 1WFXA 3NQOA 2HI3A 1ZK8A 2IGNA 3CMYA 2DOEA 2Y9YA 2RQPA 4FX0A 5FKOA 1LKXA 1XMKA 1Y1VJ 3C2HA 4A0YA 1Q1VA 1FY7A 3H0DA 2XSJC 2LH9A 2ZXHA 2HTJA 2ZFUA 5HLTA 2H27A 2MD0A 2XAJA 2F2EA 4ETSA 5D4SA 3SYTA 2EZIA 4A12A 1QBJA 2W00A 3AG4H 4FISA 1VQKI 2LYCA 1Z67A 3RDIA 1HDDC 3RPUA 2JN6A 2DA5A 3GLLA 1R6RA 1LEBA 2FU4A 1KU2A 1XCBA 2XF6A 3CLOA 2DYSH 3HGGA 4AIKA 4A3MJ 2VKVA 4X6AJ 1SD5A 3OIQA 4DQ2A 3KYLA 1BL0A 3OS2A 1KU7A 5IYBJ 4UNOA 2FBKA 2OC6A 4JQFA 2P7CB 3IAS2 1V5FA 1R58A 5CPRB 5FD6A 4P55A 1YRNB 3CZ6A 2D2WA 3WHBA 1FSHA 1A35A 4Z6YA 4RLFA 1KQ0A 1V4RA 3D5LA 1K83J 1MIJA 2P5KA 1YJ9I 3R61A 4HA8A 4JK1X 3E7LA 3OL3A 2NVUB 1IXSB 2R5YA 1MBJA 2OF7A 3U1DA 1N75A 5ERIA 4HNVA 2XC7A 1XPXA 3H3ZA 4C9YA 3W6JB 6PAXA 3RPUD 4ESBA 4BEHB 3VODA 1W5SA 4MTDA 1W0TA 1GV5A 3K7AJ 3RSNA 3I4PA 4F93B 1ZN2A 4CO8A 3K4MA 3ZXSA 1F1ZA 4UY8I 2VBWA 3P9KA 3KIOA 4HNTA 3H3UA 4X0GA 2HVQA 5H20A 3VYSB 1TL8A 2LR8A 2FMYA 3QP6A 4M71A 1G59A 1BI0A 2M9HA 1Z21A 2LG4A 1PUFB 3IKTA 1XG1A 4XKWA 1FJLA 2NVTJ 4A3LJ 2GZWA 2QQBA 1I3AA 4O6JA 3LFUA 5F6FA 5FGMA 1FNNA 4BQAA 2GIZA 2ZFWA 1FIAA 3TOBA 4ZYAA 2LY1A 2W57A 2EZHA 4FE4A 4NHJA 1QO0D 1PVEA 3EDPA 4EM2A 4ZZDA 1IDZA 1T0FC 1K78A 4LOCA 3FXRA 4CCMA 3GFMA 4HQMA 1KQ8A 3BG3A 2L54A 1APLC 1J9IA 1RETA 2DMNA 1V54H 3I9V2 2JA6J 1R1TA 3KCCA 1ETKA 2A5WA 3KP5A 2Y2ZA 3JSPA 1G2HA 4M3DA 3FK7A 4EM1A 4MGRA 2BYVE 5KHDA 3HBLA 2MABA 2XB5A 2E35A 5KK1A 1ZRDA 5E3LA 1ETVA 2K85A 1KYWA 1XSDA 4RM2A 5DS9A 5FJ8J 3PO2J 2V4JC 2YSRA 2M34A 1JTXA 3WTXC 1TT5B 3J81Z 2J5PA 1U5TB 5H6RA 3L2UA 3E97A 5F0CA 2EQRA 3CCSI 1LVKA 4JX6A 1BW6A 4DZPA 1K61A 3PFIA 4HNUA 1B9NA 4DZJA 1BIBA 2QYOA 4NC6A 1RESA 1ZHFA 2WA0A 2IGKA 2A3SA 3DPUA 5ICFA 2ESNA 4YFXF 4EM0B 1HW1A 3JRFA 2FUG2 2OCEA 2E7WA 4CCNA 4GXOA 2GOXB 1HKSA 2VPLA 2DU9A 3H5NA 4WXDA 4C3HJ 1Y56A 4IOAF 5FB2A 1OR7A 3W2WA 2PFBA 3DEWA 4G9YA 3J80K 2LKXA 3DQVC 1Z3XA 1TC3C 1TLHB 3HTSB 1SD6A 2HU9A 1D0YA 5J8FA 2IT0A 4B1RA 2AXTC 4RB0A 1VNDA 1TW2A 1Z7UA 3BR2A 4W1UA 3OYDA 4UB8C 3GTOJ 2XAQA 3H36A 2VQGA 4PDKA 3AL0C 3N97A 3ONQA 1UAAA 1IUYA 2LF8A 2VKEA 2YR2A 1SMTA 2IA1A 5KAFC 1BBYA 3CDIA 1KQ9A 1IN7A 1I27A 3F0CA 2DO7A 1U9OA 3BG9A 2RKHA 4RAYA 3OYFA 3ABKH 4WXHA 2STWA 1FP2A 4G6QA 4KMUX 4A3BJ 3J7YJ 2IP2A 1JKPC 2R4GA 1FYLA 4OAYA 4KFCA 1MDMB 1IZ1A 1XSVA 4XKCA 4KMFA 3GLXA 4NC7A 1X1PA 3DPTA 3ZQLA 2R7UA 5EDNA 3H9JA 2OQRA 4BJ5C 3AAFA 2GLOA 1IC8A 2KP6A 3S17J 4HSTA 2KRHA 2R7WA 3WTVC 3OY9A 3HZJA 3QAHA 1IO2A 3LSKA 1RUNA 5CVRA 2COBA 2JA2A 4OMZA 2H6BA 1HKTA 1DGRM 1B72A 1MDMA 2IXSA 1G3TA 3F21A 5J3LA 4FTHA 4GYGA 1I1GA 1I6XA 1A5JA 2FEZA 1OYWA 3LA2A 3OYLA 4I02A 4YFKF 2QQ8A 5J40A 1W36D 1SANA 2VI6A 5HDNA 4HQEA 4FT8A 1R5HA 2O5RA 2XPVA 1UMQA 3HKZA 2DJIA 3WE3A 1BR4A 1WPKA 2LBFA 3W6KB 3CDHA 4M3EA 5TISC 3K4CA 3HSFA 1X1BA 2P5LC 3GZ5A 5GTHC 4RBOA 1LNWA 2KRCA 3KEQA 2VXDA 3K4JA 4LMYA 4AWXB 2E2JJ 5K7HA 5FROA 3GFLA 3WTYC 1IRZA 5CVVA 1R23A 1DP3A 1JHFA 2XAFA 4HBLA 3FHNA 1HSTA 3C2BA 1KU3A 1X2MA 4UUSA 3FM3A 2F5DA 1ODDA 4JX4A 3SEQA 3OYKA 2ZJRF 4BXUA 1QHHD 2DW4A 1LUJB 4I0AA 3TMOA 5L3FA 2ID6A 1HLVA 5LBQA 3DPLC 1JUPA 1BM9A 2K9NA 2KISA 2Z99A 1X1AA 2B9SA 1JUMA 2Z5UA 1MBFA 1IRGA 2OPTA 4MNUA 3S32A 3CLQA 3HM5A 1DPUA 4CCKA 3I59A 1D0ZA 2CYYA 4BKXA 3UR3C 4E7IA 2VJ5A 2MYSA 3QPLA 4D5CA 4B3XA 3A01A 2FNAA 3GWZA 1S9HA 1P92A 2VC1A 1XX5A 2K4JA 1TQMA 5E3OA 1T0FA 3LA7A 4RAFA 1XMAA 2KDOA 4L0YB 3HOXJ 2M8EA 2JK3A 1N77A 2ZMEA 4LK0F 2DFEA 5EEAA 3OYEA 1LJ9A 3QYBA 3PSIA 2MG4A 5J8CA 2K7LA 3A01B 2ZXJA 5H6QA 2ZNZA 2ADUA 2EFNA 1PDNC 1E3HA 2R7VA 3M9AA 3WGHA 1WI3A 3NEUA 4P5OA 2F5VA 4PUSA 4AIJA 2CW0F 4EMSA 1TW3A 1E0EA 2DOFA 4YIFA 2QF7A 4MEYF 1OLTA 3WU0A 4UVBA 5GTIC 1S7OA 4D9JA 3LAPA 4KT5C 4B8XA 4N9HA 3I56I 3G73A 3CC2I 2YX4A 4CYDA 1OCZH 2KIQA 3L9FA 3V8JA 3G1OA 4EQQA 2EA2A 1W36C 3B02A 1ZARA 2HKXA 2V1NA 3Q0VA 3SXYA 2IEKA 1FIPA 1JKQC 4WWCA 1TT0A 1FBUA 2QBYA 3OOPA 3FXJA 4HDUA 3BOQA 5IT3A 2HQRA 4ENNA 4AIHA 4OIOF 3HHHA 3K69A 3K4KA 2FBHA 2DQRA 3BPXA 4N4NB 3U1KA 3K9TA 3M4OJ 3IKVA 3KP2A 1BC8C 4B44A 3COAC 2UWMA 4QPOA 1BJAA 1FEXA 1OKRA 5EF6A 3BTJA 2ZCWA 3T8TA 3ZMVA 4EJWA 4IHTA 1XGNA 2GA1A 4CYCB 2P5VA 4J01A 2DJNA 2HS5A 4FASD 2HDCA 3P5JA 2QLZA 4I6ZA 1YJNI 4HF0A 2OZUA 2QQAA 4FCYA 1WGXA 2JSCA 4ZH4F 3OMYA 5L3GA 4AYBA 4G6DA 3FK6A 2L7FP 4G8XA 2P4WA 2CW8A 4ZDPA 4WF2A 2UXNA 4LG0A 3IL2A 2VN2A 2DTRA 2BOLA 2P6TA 1YITI 2FOWA 2KJBA 4LK1F 5KVRA 3JRHA 2X1CA 2M1BA 2OCCH 3MWMA 2AHQA 2KIMA 4XLPF 2EV5A 3QU6A 2VT2A 4OU0A 2D1VA 2OV7A 1E3PA 4Y15A 4ZJZA 3ZQ7A 2E1NA 3BJOA 1S3JA 2IJLA 2Y0SN 1XD7A 4IQJA 4LD5A 4L0ZB 3QYFA 1YE9A 2MA3A 2NVQJ 1XSXA 2HKOA 2XPWA 1PUFA 3ZQFA 4JP0A 4Y52J 2MBFA 4A3EJ 3FKIJ 5EZHA 4FE7A 3LSRA 3BR3A 5JVGF 1T56A 3J7AO 2KHMA 1H89C 3S1NJ 2L0KA 3ELKA 3CUQA 3I4NJ 3PUFA 3P9CA 2DT7B 4M3BA 3M07A 2X6OA 1AU7A 4RAGA 4A3GJ 4KIFA 1QRYA 1E17A 2DCEA 4MQ9F 1WJEA 4UUTA 5JI6A 3OYGA 1FBQA 1B6AA 2CGPA 5C4XJ 2CQKA 4XKBA 1HSJA 5L3BA 3EUKL 3WGIA 2HFHA 3FHZA 4Y33A 1LFBA 3BZKA 5CJ9A 1VQMI 5EEGA 4B47A 1VQ4I 3K6GA 4U7DA 1IN6A 4XORA 3C18A 1RZ4A 1R5GA 4PJLA 2PMZA 4ASNA 2V26A 3P9IA 5LFAA 4KYWA 3F9KA 4L5JA 4HF2A 3TO7A 3IH3A 3BTLA 3MMYB 1T33A 4M3FA 3OSFA 3BZCA 3GVAA 2IA2A 3BQZA 2O7OA 3DU5A 1MMGA 2K40A 3A0HC 1SC7A 2QM3A 2VE9A 4C3JJ 3LL7A 2M8GX 4QPQA 1IXRC 2HVRA 3H3VK 3IRQA 2DDBA 5GPAA 1F4KA 5LHHA 2XAUA 2BV6A 3L09A 5EJCA 4NQWB 3ROUA 3BR1A 4RMNA 4F55A 5C3EJ 1GUUA 2RAEA 3KEYA 3LSMA 2VL8A 1H88C 1H9TA 3GEZA 1JKRC 2JA5J 2HOAA 3M1EA 1T98A 2Y9ZA 5ILVA 2XB0X 5CKTA 5J1UA 3GTMJ 3JTGA 2FD5A 1W5TA 1WI9A 2JVGA 2WAEA 4U0VA 2VJ4A 1RUOA 1V55H 1UELB 1MBGA 4XNFA 5GADJ 4H4KC 2A69F 3DXJF 3CUOA 3F6OA 4ABZA 4BE1A 2DA4A 3S2WA 2R92J 3MFKA 3ASNH 1R4NB 2XAGA 4XM3A 1B59A 2E34A 1U8RA 4DOZA 2EBIA 1AKHB 2BXZA 2L01A 5BPIA 4XLHA 2F48A 1ZLKA 1D5VA 5DUIA 2HOSA 3ZN1A 4FETA 3OYNA 1FYKA 1E3OC 4EEFG 1FOYA 2IGMA 4CDGA 2OUMA 3I0TA 4M6XA 2CQQA 4OMYA 1OCCH 1DPRA 5F04A 4DNCA 5EG0A 1WJDA 5LGTA 2KZGA 2DTZA 2K27A 1VQNI 3H5RA 3HRSA 1J75A 4BE0A 3KP3A 1OYIA 1M1EB 4XMYA 2Q8KA 3G3ZA 1FOWA 2QQ9A 2PN6A 3ZQHA 1YIJI 3SHFA 1J59A 4F7ZA 1FT9A 3JRIA 9ANTA 3E0JB 3F8FA 1SFUA 1WKMA 3K70D 1VFCA 1Z91A 3HRTA 2JMWA 1U0JA 3HRMA 4KT6A 2QKMB 5J6XA 3DWLE 3W3CA 4BU2A 3BC8A 4A2UA 4A6DA 1D0XA 3CCUI 1SD4A 4IL6C 2NS7A 2H8WA 2LVSA 3FZVA 3K10A 3OSGA 1ZRCA 1GDTA 1GVJA 5F08A 2XKOA 1P9QC 3GTJJ 1FTZA 3CO7C 2OJED 2NRAC 4ENKA 2F5CA 3H9GA 5ICGA 3NARA 3A02A 3JRGA 1IV6A 2M87A 3HOWJ 3S16J 3KZIC 2ICWG 2EPFA 2KFDA 2XGDA 1FSEA 1WCMJ 3PL8A 1Z6TA 2HGCA 2M2EA 1XGSA 2K4BA 2BGCA 4N4OB 4M9ZA 3S3OA 3FKJA 1LDKB 3G1LA 5EG0B 4Q5SF 4YIRX 5HDKA 1LE8B 5LD2C 2OAZA 2ETHA 3OYIA 3G6EI 1ZAOA 2XF7A 4CSWA 3R6SA 4NDLA 3LSPA 1MH4A 4QWQA 2JPBA 2ELJA 3OS0A 5FLXZ 4XBFA 3CJTB 4OIQF 1BIAA 1LDDA 2IS6A 3S8PA 5HOOA 4MIMA 4BQOA 4BACA 1WH5A 4PFOA 4DYRA 3REOA 2Q2EA 3H35A 1KONA 4I76A 3M8JA 2VQCA 3BR6A 5F64A 2CH0A 2W1OA 2GBYA 4XSZF 2VONA 2EB7A 4HEA2 5FKKA 4LJZF 1NG6A 3ERMA 2I8DA 3Q0WA 3CCMI 2VXZA 4LIVA 3DF8A 2MLKA 2L02A 3A1YA 2K9LA 4RDUA 4D7NA 3DFGA 1RR7A 1X2NA 2HOEA 3JAMZ 3WTSC 3LSGA 1WJ5A 3GO5A 1T6SA 5EZGA 1N25A 2GXBA 2LBFB 2KKOA 2P81A 4IZZA 4E7JA 2QWWA 1SFXA 2RNGA 1RKWA 1OR7C 3IWFA 4L5EA 4HV5A 1JT6A 3TW6A 2K5CA 3GUDA 3ZR8X 4PJ0C 3FBNB 2R5ZA 1FWZA 1IN4A 1B4AA 2XGXA 3CCJI 4IHSA 2KL4A 1EA3A 2V79A 4IRHA 2G0EA 3UNGC 4IHYA 3KLOA 2HQNA 1J2XA 1S7AA 2I5UA 2R7OA 2RN7A 2IA0A 1XCVA 5FFXA 3MZHA 5HNFA 3M3YJ 4IJAA 3EUHC 4QLCU 2QENA 3ZQGA 5JHUA 1MJBA 3SDBA 1W4MA 1CF7A 1ULYA 1ZR4A 1G3WA 2IGOA 3LSHA 1T2KA 4WXCA 4I98B 3JW4A 4P96A 2CQ7A 3I55I 2X0LA 4MFEA 2GWRA 3O6BB 1YQAA 5HS7A 2CUJA 4ZYHA 3ZN0A 1D1AA 2DBBA 4MLOA 1SMYF 3L2QA 2FJ1A 3K4NA 2DFFA 3WTZA 3BR0A 4CYCA 4HX4A 2ZJPF 5DDGA 4C2TA 1MMNA 3J81K 3HOZJ 3E5UA 3ESWB 1GT0C 4NC8A 3GXOA 3PIOF 2X6WA 2Z16A 3KP7A 3WHCA 3OOUA 2KZVA 3TEDA 4E7SA 2Y0SA 4WX9A 1EJ9A 2DA1A 3RCOA 3HRUA 2DFIA 4PZJA 4YIIA 1OCOH 2R7FA 1Z9CA 3FMRA 4BXFA 1I39A 3O8HA 1G8XA 2PJPA 2P0WA 2PI0A 3BTCA 2KIFA 1C0WA 1WVRA 1VQOI 1TNSA 3BPVA 4WK8F 2R7XA 5E17F 2LDUA 2DFHA 1OFCX 3MD2A 3F6VA 3Q5FA 3CTAA 4P9UA 4ZDOA 2GOMA 2DMTA 4UUSB 3V42A 2CG4A 4UV9A 4IX7A 1R7JA 2P7VB 1IV8A 4GYIA 2DMPA 2QVOA 2XRNA 2KRFA 3KZYA 2K3FA 4S05A 3I5UA 3HOYJ 5ICCA 3ABUA 3U21A 1Q1HA 4V2GA 2VBYA 2A6HF 2M4KA 1O3QA 2ISYA 2BZTA 2WTEA 2AO9A 4EV0A 3Q0UA 2CFOA 3FWEA 4U0YA 5CQGA 2B63J 4EGYA 1VQ9I 4IHWA 2Z1DA 3F3XA 4RA2A 3S3MA 3ECHA 3LQQA 5ILUA 5HLHA 1D8KA 1YTYA 2W48A 2F4MB 3MZYA 1R1VA 4OIPF 5JR3A 1BR2A 1HC8A 3QWLA 1GLNA 1V5EA 1OJLA 2GAUA 2R7RA 1W7PA 3CMEI 1WHUA 5LGUA 4XOPA 2X51A 4YEJA 1VQ5I 3A2KA 4RGSA 1NTCA 3BTIA 3CJRB 2PJRA 3E6DA 2E36A 3DKWA 1W7PB 3E5QA 3HJEA 3PNTA 3HG9A 5BNGA 2E19A 1WWXA 2VKDA 1MSFC 4KN7X 3G4SI 2IS1A 4G7ZF 1LVAA 4UVAA 5LRRA 3VWBA 5E18F 1CF7B 1ZH5A 3QYEA 2VUMJ 1ZREA 3B6CA 2V7FA 2MC4A 2FSWA 4LITA 3QOPA 3IV5A 4HLYA 5EEHA 4PSWA 2G9WA 3RQ4A 1FLIA 1BI1A 2G7HA 4XL9A 5FLMJ 1I6HJ 4PGHA 5GAHJ 3LAJA 2F6CA 5HLIA 1XB4A 3TO6A 3BP8A 3L1PA 1OCTC 4A3DJ 4GGGA 4DGWB 2L4MA 2HQ5A 3QOEA 3VSLA 3HPGA 1WQ2A 3V8KA 4ZTFA 2K86A 4HZFA 1NK2P 2K9QA 3WTWC 2E71A 3IP4B 4BNCA 4BGDA 3JTHA 3FXUA 4M73A 5TGTA 2GQQA 4CH7A 4PGGA 3EYYA 4OINF 1MZBA 3F8CA 2Z9OA 2M30A 3ZMUA 4ENJA 1SVLA 3GW2A 2LP0A 5FKMA 2UUZA 3FXMA 1IN8A 3TP0A 4AUXA 2VIXA 3M8EA 1WRJA 5E3NA 1LPQA 3C3WA 3D1NI 1UHSA 4G12A 3MZ8A 3R4KA 1E2XA 5DCFA 2NOGA 2TDXA 5LGNA 2A5YB 3DEEA 1ACIA 4MTEA 3DLAA 3PIPF 4NQWA 4HSRA 4O5VA 3CD6I 3BG6A 3H1CA 3VOEA 2XKPA 3DLLF 5E1ZB 3TOAA 2GXAA 4A5NA 3GZ6A 4OAZA 3E6MA 3BJ6A 2BY0A 2V6CA 4KNYA 4IOCF 3RI4A 1OYYA 2JJ7A 1YS7A 2CRGA 2LSOA 4U0WA 5HS9A 3RIRA 3GX4X 1OISA 3S1MJ 1S29A 2XAHA 1MBHA 1VQ7I 1NG7A 2VKHA 4F91B 2CQNA 4KICA 4ON0A 1A04A 1STZA 1YX5A 2CU7A 2LRDA 2R7ZJ 1LQ1A 3O3KA 2E1OA 2Y75A 2CUFA 3HGYA 3H5AA 2DMQA 1MKMA 3HOVJ 2IW5A 2OU2A 2BE5F 1RC9A 1S7EA 4BE2A 3IC7A 5DV5A 2Z33A 3GTPJ 1LEAA 1XC5A 1MMAA 4IO9F 1UJ8A 1U6GA 5CVUA 4DW6A 1I5ZA 1X58A 5FRNA 1YW8A 2EINH 4JBAA 1MBKA 2GXGA 3DKXA 1TNTA 2OD5A 4XKVA 5K5RA 3QRFF 5IY5H 4PCQA 5KNLA 4NUBA 4RB3C 2KPMA 3OYHA 2BEOA 4XLNF 4X1EA 2HR3A 3PUBA 3DBRB 4IHXA 2L9RA 3FDYA 4UV8A 1TP4A 4BY7J 3G2BA 4KIBA 4IPAA 4A3FJ 5LHIA 1HA8A 5M5YJ 3CCLI 4ESJA 2M5WA 3OR2C 1R4MB 3NWSA 3UKGA 5FLVA 4PJNA 2A6EF 3RKXA 3IH2A 3KP4A 1RPWA 4CCJA 2QGUA 4UUVA 4R79A 1PP8F 4PJMA 5M3MJ 3FISA 1IW7F 2VE8A 2CO5A 3VDXA 1SAUA 3LSIA 1TBXA 2LKPA 1DP7P 3J7AY 1QVTA 3ASOH 2Z2SB 4QIWN 1R22A 4R8HA 5K1YA 3T8RA 3R0AA 1UB9A 4A3JJ 3Q3SA 2QEXI 2RREA 2HNHA 5M3FJ 2R7SA 5J4VA 3GYHX 4JX5A 4LB6B 2Q0OA 3QP5A 3TL4X 4ZZLA 2UZKA 5DCMA 4JYKA 1V5GA 1P4WA 3CC7I 3B6AA 2UXXA 3CQZJ 2ELKA 2A05A 2JTVA 2X4HA 1HBXG 2LKSA 1QPIA 4KIGA 1H8AC 1EH8A 3PSFA 3IRRA 3MVPA 1MW7A 1KZHA 2X9DA 5CQEA 2W24A 4B48A 5L3DA 3FXLA 3OYAA 1IDYA 2CUEA 5M5WJ 2XDVA 1QVUA 1IRFA 2JT1A 2VASA 4BBRJ 1OMIA 3BQYA 4XK4A 3ECOA 4ZC3A 3I53A 5D8LB 1MD0A 5CVIA 1VQ8I 3W2VA 4CUGA 4MHGA 2PQ8A 3PQJA 2JA8J 1FPQA 3PNVA 2XROA 2YUSA 2DT5A 2L5QA 2D45A 5CYVA 2AXLA 1VQ6I 4CICA 3CESA 3GFIA 3X2QH 4HX8A 1QHGA 3AFHA 2WBMA 4E7LA 1K6YA 1F5TA 2KIUA 2R7TA 4XRMA 1JT0A 3ZOBA 3JAMK 1P2FA 1XS9A 3VEPA 1H9GA 3M1CA 4CZCA 3K1PA 3E3VA 2HOTA 2HTSA 2LY2A 2O8XA 3HIFA 4DBRA 1QZYA 1UFMA 1JGSA 1ORKA 3K2AA 3V7CA 2HYJA 2BW3B 3VYTB 1GVDA 1IUFA 3A4CA 3VYRB 1HDPA 2BHZA 4HF1A 5EGOB 4S04A 2DPDA 2BVLA 3CCEI 1A6QA 1LFPA 1PJRA 3H0GJ 1GXQA 4KITB 3BDDA 4DBQA 3HHGA 1B8IB 4LLNA 2JSPA 1EH7A 2R0QC 2IAIA 2QKLB 2M4GA 2ZB9A 2ZMEC 3F8BA 1ON2A 5FLXK 4XN3A 2M7BA 1UHWA 2EIKH 3U9GA 4NB5A 1T39A 5FD5A 2FF4A 3Q9SA 4QSHA 2E2HJ 3MN2A 4OOIA 4G94A 4LIUA 3ZP5A 4Q47A 2JUCA 2F5FA 3S2DJ 4Y3OA 1QQIA 3CJQB 1O7FA 5ICEA 5FFZA 3QPSA 3BROA 3DBLB 1X1DA 5FKNA 3CCQI 4D5FA 2M7AA 1ERDA 4TV7A 2HDDA 2DLLA 2QBYB 2QZ8A 1SFOJ 3SEZA 4BH9A 1ZLJA 3RZOJ 3ZMSA 3HC7A 4IRGA 4LFUA 3SZTA 3SFZA 1FZPB 3CJNA 3R0JA 2COMA 3KYCB 2RC4A 1ZTRA 5F1RA 3TP3A 5J4YA 1ZRFA 1R71A 1DU0A 1X3ZB 4BQQA 3I64A 1REPC 3CF2A 3CMMA 4A3KJ 1UZCA 1WJFA 4NNJA 1O3SA 3HOUJ 1W5CC 3LNQA 3K70C 3AL0B 5LHGA 4CZZA 2H94A 1LB2A 2WY8Q 1ENHA 3WE2A 3O2PE 1K7AA 2ESHA 2CUZA 4AC0A 1B8IA 3RKWA 4J19A 1HXDA 1S8NA 3GCMA 1PYVA 2IBDA 1X4PA 2OTLI 1XGMA 5B1AH 1IAWA 1J7KA 1OCRH 1MBEA 3CCYA 2ZSIB 2QUFA 5C4JJ 1F9NA 2BBYA 3ABLH 2VPRA 1MNMC 5IOYA 1YJWI 4GDFA 3MEXA 2NNYA 4XLAA 1JKOC 5HDGA 3RYRA 1RIOH 1JE8A 1Y6IA 2PX9A 5BQTA 1U78A 4L9TA 1SD7A 2LMDA 1BW5A 2ZC2A 2LFBA 4E6KG 5IP9J 2B0LA 2FX0A 3FXQA 2R5YB 2O61A 5E20A 1EKEA 2M3AA 2L7MP 3S93A 2XASA 2HEOA 1ZYRF 2BY1A 4PSXA 4BDYA 3W2AA 2Y31A 3A03A 3IUOA 5AIQA 4M3GA 3J7ZI 4A0ZA 4BHBA 1YOVB 2HZDA 3GMEA 4KN4X 1IRXA 4II3A 3RPQA 4I7HA 5H2FC 4AYBN 3KEOA 4RB1A 3JCUC 4IRIA 4IHVA 3I4MJ 1J5YA 2EH3A 4M6VA 1P7JA 5BPDA 2ZSHB 2CV0A 4F3QA 4QTRA 3AG3H 3E5XA 4A0XA 3VSKA 4HDVA 2KQRA 4DJAA 2PJRB 4L9VA 4XLFA 5CLSA 5K5QA 1N78A 5E1XA 1LFUP 4P9FA 2F4OB 2XVCA 1T95A 3WG7H 2OQGA 4E70A 4EATA 4AVZA 2FXAA 1YIOA 1YLFA 2L7ZA 2PLYA 3GTLJ 2RQQA 4UHTA 2Z3YA 1U5TC 2VODA 2EFOA 4EJVA 5JLXA 3ZMZA 3BLYA 1J0RA 2Y30A 1B72B 3SFIA 1WJCA 3WTUC 1G3SA 3BY6A 3L2WA 2RDPA 4N9IA 4B43A 1ZGJA 5F0FA 2OBPA 2PBIA 2DPUA 4WCGA 4V2FA 2O6GE 1QGPA 1MMSA 1K4SA 1S72I 1POGA 3KP6A 1F36A 1JUSA 2L9NA 4NBQA 1XN7A 4UB6C 3BG7A 1TZLA 3A0BC 3ZRGA 2MFZA 3C7JA 2OA4A 1JTYA 2WY7Q 1ETQA 2LK2A 2ME6A 3ZQCA 3MAJA 3K1NA 1G4DA 1L3LA 1X3UA 3C1DA 2EK5A 4RGUA 5HS8A 4CCOA 5J1RA 4RS8A 3TGNA 2JRTA 4E4HA 5DM6F 4I99C 3ZQIA 2FQ3A 3HKZN 1Z05A 4KUMA 1Z77A 3NAUA 3CO6C 2VBZA 2ACJA 4JOMA 2DQLA 4FX4A 2FBIA 3OYCA 3KETA 2YS9A 4R1HA 4RLQA 1IN5A 2D1HA 1P4AA 1X3WB 2RVCA 1H0MA 1HCRA 4I0BA 1Z6RA 2A68F 4ESFA 5DCMB 2NYXA 4L9NA 2H09A 3K2ZA 3MKLA 3OYJA 2O03A 4IVNA 2DA7A 2XSDC 3WU2C 3IWZA 1QA6A 3CUQB 2HDWA 4EJOA 2DI3A 4AU7A 2H8RA 1GXPA 2K9SA 2QSHX 2EV6A 3LQRA 3MKWB 3K1MA 1YW9A 5D4RA 4C2MJ 2EIMH 2I10A 5K5OA 3ZPLA 1D5YA 2M45A 4IEJA 1LDJA 5D6EA 4OIRF 3L2VA 3S1RJ 1WZ2A 2M0MA 2E7XA 3G71I 2XF5A 1GV2A 3LOCA 1TWAJ 4B4CA 5BOXA 1FMWA 2LTPA 4FQGA 3DCFA 3FIWA 1XDSA 3FX3A 3WGGA 3QPHA 3I3LA 1OPCA 4XSXF 1R00A 1YHQI 3CC4I 3QQAA 1IJWC 3BZ6A 1JJ8C 2O9LA 2KDZA 2ISZA 1MSEC 4MFDA 1Z1DA 4II2A 4GFBA 3PO3J 2TCTA 2GIVA 1SAXA 2X1DA 2ZBKA 5LEKA 2DOAA 1X19A 4KA4A 4G7OF 5FO5A 5M5XJ 3L7WA 3OR1C 2V1DA 3NWTA 3CCVI 3V7RA 4C2UA 1S6LA 1ZG1A 1Z3YA 2IPQX 2YPRA 2H6CA 2ME0A 2CV2A 1RR8C 3HSRA 1YI2I 3ERED 3FMQA 4J00A 3KYDB 1U2WA 3KZZA 3B73A 3O8GA 1K4TA 3GZNB 3KE2A 2PG4A 2CJJA 2X6XA 1D1BA 2WC2A 2XHKA 1ZR2A 4XQFA 3DEUA 2ZXIA 3HB9A 1UHMA 1A6IA 4UVCA 1SFKA 2KT0A 3RZDJ 3T1BA 1Y0NA 3JRBA 1O57A 2EFWA 2WB1N 3JR9A 3ZMTA 3FBIB 3KPHA 3BG5A 4BAYA 3TBIA 5LRSA 5ED4A 2QSFX 3K4LA 3GF2A 4U87A 5GPCA 1EH6A 3ML6A 1MMDA 3LMMA 4PJJA 1HQCA 4LG3A 4BL0B 2DN0A 2DODA 3FM5A 5GAEJ 2ID3A 2X6YA 4ZYDA 4EVIA 2NVXJ 1CGPA 2VBXA 4KJZA 3ZQQA 1TWHJ 2KJCA 4XONA 5EGOA 1U9NA 5A2QZ 4HLXA 5JVTA 4BDZA 2HXOA 1JHHA 4B3AA 5GAGJ 1U3EM 1EF4A 1K78B 5F27A 3GBGA 5F1JA 1ZKGA 1P7IA 2LLKA 2WAQN 3I54A 4XOTA 3JRDA 3CCRI 2VJIA 3PJRA 4ZDLA 4Q4ZF 4F52A 3TQNA 5DD8A 2JZYA 2JUGA 3LWFA 2XV4S 1O4XA 3JSOA 2RGVA 5AIPA 2NXNB 3PQKA 1K79A 4HAMA 3DTEA 1JGGA 4AD9A 1EV7A 5J47A 2LF7A 2DT6A 5B5EC 4DIQA 5F0HA 4MO7A 5JFRA 1DU6A 2MLGA 5IT9Z 1FX7A 1SVMA 2L3DA 3HSEA 4BQNA 5DUKA 2A6TA 4LLLA 1XGOA 5B66C 2F5EA 4CXFA 4L9JA 1TWCJ 4IF4A 3DP7A 5E8GA 2W82A 3SZPA 4YFNF 4U88A 1ETYA 2IS4A 2XPUA 2K9MA 3HTUA 2QSGX 1CQTA 1TWGJ 1ZG5A 2JA7J 2EFPA 3DU6A 3BCBA 2QCOA 2ZNYA 4P1WA 2R93J 2MGQA 1U5TA 2Y69H 3JREA 4HYEA 2DDAA 2HXIA 2JVHA 3EPZA 2VLAA 2ZJQF 1VQLI 3DBHB 5BMZA 3JRAA 2FE3A 1KA8A 2EWNA 3EUAA 5BS6A 3H9QA 3CDLA 2ZKZA 4YELA 2AQEA 4CHUA 1TQIA 2WV1A 2X85A 5D5UB 2Q1ZB 2HPIA 1R36A 1MGTA 1WJAA 3EETA 4GO1A 2L7KA 1D3YA 2R3SA 3KX2A 4I2OA 2O0YA 4M6YA 1XTAA 3SQNA 4V19K 1MNEA 4EJUA 3KFWX 2DA6A 1LE8A 5D6FA 4YRVA 3HEFA 4Y17A 2BW3A 5GP9A 1TQPA 2JWTA 3PM1A 4RGXA 2V9VA 1WH7A 2EV0A 3TO9A 1SFEA 2C6YA 2IVMA 3GTKJ 2K3PA 3E6BA 1XMXA 1BI3A 1R9TJ 2W85A 3GTGJ 1Z7LA 1KGSA 4F92B 1Z0XA 2E60A 1T38A 3LSJA 3E1SA 3K4BA 1O3TA 1MJ9A 2YU3A 2FRHA 1SEUA 3E6CC 1FMVA 5B3SH 1HKQA 3SJMA 4BY1J 2DMUA 2WV0A 1L0OC 3DTKA 1ZGWA 4BXXJ 1RNLA 4BS9A 1PUEE 3OV8A 2W7NA 3D5RC 1AKHA 5D5XB 1X4OA 4HG2A 2MW8A 5JLWA 3P7NA 2VQHA 4PK4A 3RKQA 2H1KA 2Q2EB 2FA5A 4S0HB 3S15J 3TW7A 1UG0A 4LB5A 1FP1D 2NOJB 2GA2A 2Y0MA 5HLGA 1ZG3A 2DA2A 4E7KA 4GCVA 4B09A 1OCPA 4BYYA 1HF0A 1V3FA 3VB2A 3WTTC 1P4XA 1QZZA 2XGEA 2STTA 1HW5A 1FBSA 4XICA 1USTA 3ZGKA 1ITYA 1IG7A 1R5ID 1W7PD 4BHCA 3L2RA 2EZKA 4ZTJA 3OWTA 2M0CA 5L3EA 3BWGA 3VPRA 2CV1A 1IXCA 4BJ6C 3W6VA 1PP7U 1UCRA 1NHAA 3RQIA 2W4SA 2XRLA 4BBSJ 3RTRA 4CA0A 2VJJA 3HOTA 3PFYA 4XRSG 3J80Z 4KISA 2HWVA 4BUPA 2V1XA 4A3IJ 2LD5A 3KLNA 2HZTA 1YW7A 2VT3A 4D1QA 4E7ZA 1YRNA 3HOSA 5TRDA 2A61A 2CFXA 2QA4I 2EZLA 2EA4A 1W0UA 1ETXA 3PNYA 4D7MA 2WAQA 1FTTA 1W1WE 4HPQA 3DTIA 1RKTA 3FXOA 2XGCA 1O3RA 1T08B 1IGNA 5K7ZA 2OTJI 3AKZA 4A3CJ 3TDZC 2MH2A 2ECBA 4XN0A 2L9VA 1YG2A 4EGZA 4HRIA 1BN5A 4I09A 4DYCA 1GHCA 2LNBA 2HYFA 2NS8A 4MQVA 3RJPA 4Q48A 5E79C 1JXSA 2CS3A 2W25A 1AHDP 2DK5A 2L9SA 1I3QJ 1P6RA 4BHPA 4A5MA 4ZYGA 3ZCOA 4YG2F 1AOYA 5EYRA 4RAZA 3ISPA 2P6SA 3IAM2 3I71A 2NVYJ 3FXKA 3OS1A 2CWEA 5J1YA 5TJJA 4XRFA 2DXIA 3NRVA 3DV8A 1DDNA 1MNDA 2W84A 3WU1B 2UV1A 3SDGA 2CW7A 3Q9VA 2XIGA 3AG2H 1O7LA 5IYDJ 2VQLA 1QU3A 2RNJA 2ZMEB 4A69C 1DGWY 1JJ6C 1FC3A 1BJZA 1HOMA 2K02A 4HX7A 5ILSA 2CSOA 2YX7A 2DYRH 3HPHA 2A07F 4N0BA 1OQYA 1BOBA 1QPMA 4XLEA 1A36A 2X48A 5HODA 3G1MA 3I59B 3U2RA 1AWCA 5D8KB 2PMHA 1MH3A 1FYMA 2HPMA 4G6TB 1YO5C 2ZXWH 3N05A 4C3IJ 2E5NA 5L3CA 1X1CA 4HV6A 5DEQA 2VC0A 5B1BH 4AM3A 2MC3A 1QNTA 5CVJA 3I58A 2NS0A 1B1BA 3GTQJ 2ZJ2A 2LOOA 1FOXA 1YS6A 4AVPA 3OIOA 4D0PA 3BT9A 2R7QA 5LLQA 2MSYA 1R49A 1RI7A 3BR5A 1FOKA 2JQ7A 5DM7F 1DUXC 3WG9A 3RYPA 3H92A 4C30A 2GM4A 1I50J 1Y8QB 4GRIA 2YU9J 4DYQA 3S3NA 5E3MA 1Y8RB 5IPAA 5IOZA 3BCAA 4HW0A 4I01A 3L2CA 1J09A 4L5IA 1B9MA 1BOAA 1QZEA 3FF5A 4RB2C 2E1MB 3QU3A 3QODA 2V1UA 1Y0UA 4IKFA 2KLOA 2MH9A 5IP7J 3MKZA 1VTNC 1ON1A 3ABMH 1MJAA 3MCZA 2XUBA 2PEXA 5DTDA 2L2OA 2B7EA 2DAOA 2EFQA 1VI0A 2PMUA 3TDUC 4RGRA 3T0YA 2EILH 1WSUA 1A31A 3MKYB 2AS5F 1TWFJ 4XIDA 1WJBA 2D5VA 2CQXA 3TKYA 4CCLA 1R1UA 3S2HJ 2TRTA 1DQUA 3ABTA 1SVOA 4LGWA 1G6NA 3GFJA 2BHYA 5DYMA 4HOBA 1YYVA
chains in the Genus database with same CATH topology
2P8TA 4M9SA 3M8FA 2MD5A 2ELHA 4O3MA 1D8JA 2NNNA 5D5WB 5LEJA 2FOKA 3MQ0A 4L18B 1BC7C 1KU9A 3M7GA 3F22A 1KYZA 1TTYA 5HVQC 3ZMDA 3L00A 3F8MA 3ULQB 2RV8A 3F72A 4M74A 4G7HF 2HYGD 3EYIA 4UXNA 3V4GA 1K6OA 3EUHA 2NAZA 2E1CA 3LFKA 4Z2YA 3D0SA 3IHUA 1ONVA 3BJAA 3EQLF 3V8LA 3F23A 4U7BA 4FHTA 3N4MA 1I1SA 2VOPA 5A2QK 2IRFG 4ZYEA 5E1WA 1ZGAA 2L4AA 3T5XA 4CGZA 2FNPA 3CUQC 5DD4A 4MEXF 2O3FA 4A6EA 2OZ6A 4KDPA 2JPCA 2J5OA 1HW2A 3LA3A 1G3YA 3QPTA 5D5VB 1USSA 4IXAA 3F8NA 4M9XA 3LSTA 1YFHA 4H0EA 3HUGA 2VOOA 5IT9K 4LLGF 4ENMA 2G7UA 3FMSA 4M72A 3WODF 1BI2A 5AONA 3VFZA 4K2EA 2DK8A 2ZO4A 2R7DA 4LG0B 1IF1A 3RKYA 3HYIA 2EJRA 3R60A 3K0LA 5E8IA 2FMLA 2WWYA 3V7SA 4Y13A 2Y48A 1XDUA 4EJTA 3NQOA 4FX0A 2RQPA 1XMKA 4A0YA 1FY7A 2HTJA 2H27A 2XAJA 2F2EA 4ETSA 5D4SA 4A12A 1QBJA 3RDIA 3RPUA 1LEBA 2FU4A 1KU2A 1XCBA 3CLOA 4AIKA 1SD5A 4DQ2A 4UNOA 1KU7A 2FBKA 4JQFA 2P7CB 1R58A 5FD6A 4P55A 2D2WA 1FSHA 1KQ0A 1V4RA 3D5LA 2P5KA 3R61A 4HA8A 4JK1X 1IXSB 3U1DA 5ERIA 3H3ZA 3W6JB 6PAXA 4ESBA 3VODA 1W5SA 4MTDA 3I4PA 1ZN2A 4CO8A 1F1ZA 2VBWA 3P9KA 3H3UA 5H20A 2FMYA 3QP6A 4M71A 1BI0A 3IKTA 2GZWA 2QQBA 4O6JA 5FGMA 5F6FA 4BQAA 1FNNA 2ZFWA 3TOBA 2W57A 4NHJA 1QO0D 3EDPA 4EM2A 4ZZDA 1K78A 3FXRA 3GFMA 4HQMA 1KQ8A 2L54A 1J9IA 1R1TA 3KCCA 3KP5A 3JSPA 4EM1A 4MGRA 2BYVE 5KK1A 1ZRDA 1KYWA 1XSDA 2YSRA 3WTXC 3J81Z 2J5PA 1U5TB 5H6RA 3E97A 3PFIA 1B9NA 1BIBA 2QYOA 1ZHFA 2A3SA 5ICFA 2ESNA 4YFXF 4EM0B 1HW1A 2E7WA 4GXOA 1HKSA 2DU9A 4WXDA 5FB2A 1OR7A 2PFBA 4G9YA 3J80K 3DQVC 1TLHB 3HTSB 1SD6A 5J8FA 2IT0A 4RB0A 1TW2A 1Z7UA 2XAQA 4PDKA 3N97A 1IUYA 2LF8A 2YR2A 1SMTA 2IA1A 1BBYA 1KQ9A 1IN7A 1I27A 2DO7A 2RKHA 4RAYA 2STWA 4WXHA 1FP2A 4G6QA 4KMUX 2IP2A 1FYLA 4KFCA 1MDMB 1IZ1A 1XSVA 4KMFA 3GLXA 3DPTA 3AAFA 2OQRA 3WTVC 3QAHA 1RUNA 5CVRA 4OMZA 2H6BA 1HKTA 1MDMA 1G3TA 3F21A 4GYGA 1I1GA 1I6XA 2FEZA 1OYWA 3LA2A 4I02A 4YFKF 5HDNA 4HQEA 4FT8A 1R5HA 3WE3A 3W6KB 3CDHA 3HSFA 2P5LC 3GZ5A 1LNWA 3KEQA 4LMYA 3GFLA 3WTYC 5CVVA 1R23A 1JHFA 2XAFA 4HBLA 1HSTA 1KU3A 3FM3A 2F5DA 1ODDA 4BXUA 2DW4A 4I0AA 5L3FA 5LBQA 3DPLC 1BM9A 2Z99A 2Z5UA 1IRGA 4MNUA 1DPUA 3I59A 2CYYA 2FNAA 3GWZA 1P92A 2VC1A 2K4JA 1TQMA 1T0FA 3LA7A 4L0YB 1XMAA 2M8EA 2ZMEA 4LK0F 1LJ9A 5J8CA 2K7LA 2ZXJA 5H6QA 2ZNZA 2ADUA 2EFNA 1PDNC 3M9AA 3WGHA 3NEUA 4P5OA 4AIJA 2CW0F 4EMSA 1TW3A 4YIFA 4MEYF 3WU0A 4UVBA 1S7OA 3LAPA 4KT5C 4B8XA 4N9HA 3G73A 2YX4A 4CYDA 3L9FA 3V8JA 4EQQA 2EA2A 3B02A 1ZARA 2HKXA 3SXYA 4WWCA 2QBYA 1FBUA 3OOPA 4HDUA 3BOQA 5IT3A 2HQRA 4OIOF 4AIHA 4ENNA 3HHHA 3K69A 2FBHA 2DQRA 3BPXA 3K9TA 3IKVA 3KP2A 1BC8C 3COAC 2UWMA 1BJAA 1OKRA 2ZCWA 3T8TA 3ZMVA 4EJWA 4IHTA 1XGNA 2GA1A 2P5VA 2HS5A 2HDCA 2QLZA 4HF0A 2OZUA 2QQAA 2JSCA 4ZH4F 5L3GA 4G6DA 4G8XA 2P4WA 4WF2A 2UXNA 4LG0A 3IL2A 2VN2A 2DTRA 2P6TA 2KJBA 4LK1F 5KVRA 2M1BA 3MWMA 2KIMA 4XLPF 2EV5A 3QU6A 2VT2A 4OU0A 2D1VA 4Y15A 3ZQ7A 2E1NA 3BJOA 1S3JA 2IJLA 1XD7A 4LD5A 4L0ZB 2MA3A 1XSXA 2HKOA 2MBFA 3J7AO 3ELKA 3CUQA 3P9CA 4KIFA 1E17A 4MQ9F 5JI6A 1FBQA 1B6AA 2CGPA 2CQKA 1HSJA 5L3BA 3WGIA 2HFHA 3FHZA 5CJ9A 5EEGA 4U7DA 1IN6A 3C18A 1RZ4A 1R5GA 4ASNA 3P9IA 4KYWA 4HF2A 4L5JA 3TO7A 3GVAA 2IA2A 2QM3A 2VE9A 1IXRC 3IRQA 1F4KA 5LHHA 2BV6A 3L09A 3ROUA 1H9TA 3GEZA 3M1EA 1T98A 5ILVA 3JTGA 1W5TA 1WI9A 4U0VA 1RUOA 2A69F 3DXJF 3CUOA 3F6OA 3S2WA 3MFKA 2XAGA 1B59A 1U8RA 2L01A 5BPIA 1ZLKA 1D5VA 5DUIA 3ZN1A 1FYKA 4CDGA 3I0TA 4M6XA 4OMYA 1DPRA 4DNCA 5LGTA 2K27A 3HRSA 1J75A 3KP3A 1OYIA 2Q8KA 3G3ZA 2QQ9A 2PN6A 1J59A 3SHFA 4F7ZA 1FT9A 3F8FA 1SFUA 1WKMA 1Z91A 3HRTA 3HRMA 5J6XA 4A2UA 4A6DA 1SD4A 3FZVA 1ZRCA 1GVJA 2XKOA 3CO7C 2NRAC 4ENKA 2F5CA 5ICGA 2M87A 1FSEA 1Z6TA 2HGCA 1XGSA 2K4BA 2BGCA 4M9ZA 1LDKB 4Q5SF 5HDKA 2OAZA 2ETHA 1ZAOA 3R6SA 4QWQA 2JPBA 5FLXZ 4XBFA 4OIQF 1BIAA 1LDDA 5HOOA 3REOA 2Q2EA 5F64A 2VONA 4XSZF 2EB7A 4LJZF 2VXZA 3DF8A 2MLKA 2L02A 3DFGA 2HOEA 3JAMZ 3WTSC 3GO5A 1T6SA 2GXBA 2KKOA 2QWWA 1SFXA 3IWFA 4HV5A 3GUDA 1FWZA 1IN4A 1B4AA 2XGXA 4IHSA 4IRHA 2V79A 3KLOA 2HQNA 1J2XA 1S7AA 2RN7A 2IA0A 1XCVA 5FFXA 3MZHA 4IJAA 4QLCU 2QENA 5JHUA 1MJBA 1W4MA 1CF7A 1ULYA 1G3WA 1T2KA 4WXCA 4I98B 3JW4A 4P96A 2X0LA 2GWRA 3O6BB 1YQAA 5HS7A 4ZYHA 3ZN0A 2DBBA 1SMYF 3WTZA 4HX4A 5DDGA 3J81K 3E5UA 3GXOA 3KP7A 4WX9A 3HRUA 2DFIA 4PZJA 4YIIA 2R7FA 1Z9CA 3FMRA 2PJPA 2PI0A 2KIFA 1C0WA 1TNSA 3BPVA 4WK8F 5E17F 2LDUA 3F6VA 3Q5FA 3CTAA 4P9UA 2CG4A 4UV9A 1R7JA 2P7VB 4GYIA 2QVOA 2XRNA 2KRFA 3KZYA 4S05A 3I5UA 5ICCA 3ABUA 1Q1HA 2VBYA 2A6HF 1O3QA 2ISYA 2WTEA 4EV0A 3FWEA 4U0YA 4EGYA 3F3XA 3ECHA 3LQQA 5ILUA 5HLHA 1D8KA 1YTYA 3MZYA 1R1VA 4OIPF 5JR3A 2GAUA 1W7PA 5LGUA 4RGSA 3E6DA 3DKWA 1W7PB 3E5QA 1WWXA 4KN7X 4G7ZF 1LVAA 5LRRA 4UVAA 5E18F 1CF7B 1ZH5A 1ZREA 2FSWA 3QOPA 4HLYA 5EEHA 1FLIA 2G9WA 1BI1A 2G7HA 4PGHA 3LAJA 5HLIA 1XB4A 3TO6A 3BP8A 4GGGA 2L4MA 1WQ2A 3V8KA 2K86A 4HZFA 4BNCA 3WTWC 3JTHA 3FXUA 4M73A 2GQQA 4PGGA 3EYYA 4OINF 1MZBA 3F8CA 2Z9OA 2M30A 3ZMUA 4ENJA 3GW2A 1IN8A 3M8EA 1WRJA 3C3WA 3R4KA 1E2XA 5DCFA 2TDXA 5LGNA 2A5YB 4MTEA 4NQWA 4O5VA 3VOEA 2XKPA 5E1ZB 3TOAA 4A5NA 3GZ6A 3E6MA 3BJ6A 2V6CA 4KNYA 3RI4A 1OYYA 1YS7A 2LSOA 5HS9A 4U0WA 3RIRA 3GX4X 1S29A 2XAHA 4KICA 4ON0A 1A04A 1STZA 1LQ1A 3O3KA 2Y75A 1MKMA 2IW5A 2OU2A 2BE5F 3IC7A 5DV5A 2Z33A 1LEAA 1U6GA 5CVUA 1I5ZA 1YW8A 4JBAA 2GXGA 1TNTA 2OD5A 5K5RA 3QRFF 4PCQA 4RB3C 2BEOA 4XLNF 2HR3A 4UV8A 4KIBA 4IPAA 5LHIA 4ESJA 2M5WA 2A6EF 3RKXA 3KP4A 4UUVA 4R79A 1PP8F 1IW7F 2VE8A 2CO5A 1TBXA 2LKPA 1DP7P 1R22A 4R8HA 5K1YA 3T8RA 3R0AA 1UB9A 3GYHX 4LB6B 2Q0OA 3QP5A 4ZZLA 2UZKA 5DCMA 1P4WA 2UXXA 2JTVA 2X4HA 1HBXG 4KIGA 1EH8A 3IRRA 2W24A 5L3DA 1IRFA 2JT1A 1OMIA 3ECOA 3I53A 5D8LB 1MD0A 5CVIA 4MHGA 2PQ8A 3PQJA 1FPQA 2XROA 2DT5A 2D45A 5CYVA 2AXLA 4CICA 3GFIA 4HX8A 1F5TA 2KIUA 3JAMK 1P2FA 3VEPA 1H9GA 3K1PA 3E3VA 2HTSA 2O8XA 3HIFA 1QZYA 1UFMA 1JGSA 3V7CA 4HF1A 4S04A 2DPDA 1GXQA 3BDDA 3HHGA 4LLNA 1EH7A 3F8BA 1ON2A 5FLXK 1UHWA 3U9GA 4NB5A 1T39A 5FD5A 2FF4A 3Q9SA 4OOIA 4G94A 3ZP5A 4Q47A 2F5FA 1QQIA 1O7FA 5ICEA 5FFZA 3BROA 4TV7A 2DLLA 2QBYB 2QZ8A 4BH9A 1ZLJA 3ZMSA 4LFUA 4IRGA 3SZTA 3SFZA 1FZPB 3CJNA 3R0JA 2COMA 2RC4A 5F1RA 1ZRFA 3I64A 1REPC 1O3SA 5LHGA 4CZZA 1LB2A 2H94A 3WE2A 3O2PE 1K7AA 2ESHA 3RKWA 1HXDA 1S8NA 1XGMA 1IAWA 1J7KA 2QUFA 1F9NA 2BBYA 3MEXA 2NNYA 5HDGA 3RYRA 1RIOH 1JE8A 5BQTA 1U78A 4L9TA 1SD7A 2B0LA 3FXQA 2O61A 5E20A 2XASA 2HEOA 1ZYRF 5AIQA 4A0ZA 4BHBA 4KN4X 3RPQA 4I7HA 3KEOA 4RB1A 4IRIA 1J5YA 5BPDA 3E5XA 4A0XA 4HDVA 4L9VA 5CLSA 5K5QA 5E1XA 4P9FA 2XVCA 2OQGA 4E70A 2FXAA 1YIOA 1YLFA 2PLYA 4UHTA 2Z3YA 1U5TC 2VODA 2EFOA 4EJVA 3ZMZA 1J0RA 3WTUC 1G3SA 3BY6A 2RDPA 4N9IA 1ZGJA 2OBPA 2PBIA 2DPUA 4WCGA 2O6GE 1QGPA 3KP6A 1XN7A 3C7JA 2OA4A 3MAJA 3K1NA 1G4DA 1L3LA 1X3UA 3C1DA 2EK5A 4RGUA 5HS8A 4RS8A 3TGNA 2JRTA 2FQ3A 1Z05A 4KUMA 3CO6C 2VBZA 2ACJA 2DQLA 4FX4A 2FBIA 3KETA 4R1HA 1IN5A 2D1HA 1P4AA 2RVCA 1H0MA 4I0BA 1Z6RA 2A68F 4ESFA 5DCMB 2NYXA 4L9NA 2H09A 3K2ZA 2O03A 4IVNA 3IWZA 3CUQB 4EJOA 2DI3A 1GXPA 2EV6A 3LQRA 3K1MA 1YW9A 5D4RA 5K5OA 3ZPLA 2M45A 5D6EA 1LDJA 4OIRF 2E7XA 5BOXA 1XDSA 3FX3A 3WGGA 3QPHA 1OPCA 4XSXF 1R00A 3BZ6A 2ISZA 1Z1DA 2GIVA 1SAXA 2ZBKA 5LEKA 4KA4A 4G7OF 5FO5A 3L7WA 2V1DA 3V7RA 1S6LA 1ZG1A 2IPQX 2YPRA 2H6CA 3HSRA 3ERED 3FMQA 1U2WA 3KZZA 3B73A 3KE2A 2PG4A 2WC2A 2XHKA 3DEUA 1UHMA 4UVCA 3T1BA 1O57A 2EFWA 3ZMTA 4BAYA 5LRSA 5ED4A 3GF2A 1EH6A 3ML6A 1HQCA 3FM5A 4ZYDA 4EVIA 1CGPA 2VBXA 2KJCA 5A2QZ 4HLXA 5JVTA 1JHHA 1U3EM 1K78B 3I54A 4Q4ZF 3TQNA 5DD8A 2JZYA 3LWFA 2XV4S 3JSOA 2RGVA 5AIPA 3PQKA 1K79A 4HAMA 4AD9A 1EV7A 2LF7A 5JFRA 2MLGA 5IT9Z 1FX7A 2L3DA 3HSEA 5DUKA 4LLLA 1XGOA 2F5EA 4CXFA 4L9JA 4IF4A 3DP7A 5E8GA 3SZPA 4YFNF 4U88A 3HTUA 1ZG5A 2EFPA 2ZNYA 1U5TA 4HYEA 5BMZA 2FE3A 1KA8A 2EWNA 5BS6A 2ZKZA 4CHUA 1TQIA 5D5UB 1R36A 1MGTA 3EETA 4GO1A 1D3YA 2R3SA 4I2OA 2O0YA 4M6YA 3SQNA 4EJUA 3KFWX 5D6FA 4Y17A 1TQPA 4RGXA 2V9VA 2EV0A 3TO9A 1SFEA 2C6YA 2IVMA 3E6BA 1BI3A 2W85A 1KGSA 1T38A 1O3TA 1MJ9A 2YU3A 2FRHA 3E6CC 1HKQA 2WV0A 1L0OC 1RNLA 1PUEE 3OV8A 5D5XB 3P7NA 2FA5A 4LB5A 1FP1D 2Y0MA 2GA2A 5HLGA 1ZG3A 4GCVA 4B09A 4BYYA 1V3FA 3VB2A 3WTTC 1P4XA 1QZZA 2STTA 1HW5A 1FBSA 1USTA 1W7PD 4BHCA 5L3EA 3BWGA 1IXCA 1PP7U 1UCRA 1NHAA 3RTRA 3HOTA 3J80Z 2HWVA 2V1XA 3KLNA 2HZTA 1YW7A 2VT3A 3HOSA 5TRDA 2A61A 2CFXA 2EA4A 1O3RA 3TDZC 2MH2A 1YG2A 4EGZA 1BN5A 4I09A 1GHCA 2LNBA 2HYFA 4MQVA 3RJPA 4Q48A 1JXSA 2W25A 2DK5A 1P6RA 4BHPA 4A5MA 4ZYGA 4YG2F 1AOYA 4RAZA 3ISPA 2P6SA 3I71A 2CWEA 5TJJA 4XRFA 3NRVA 3DV8A 1DDNA 2W84A 3WU1B 3Q9VA 2XIGA 1O7LA 2RNJA 2ZMEB 1FC3A 2K02A 4HX7A 5ILSA 2CSOA 2YX7A 2A07F 4N0BA 1QPMA 3I59B 1AWCA 3U2RA 5D8KB 2PMHA 1FYMA 1YO5C 5L3CA 4HV6A 5DEQA 2VC0A 2MC3A 1QNTA 5CVJA 3I58A 2NS0A 1B1BA 2ZJ2A 1YS6A 4AVPA 4D0PA 5LLQA 1RI7A 1FOKA 1DUXC 3WG9A 3RYPA 3H92A 4HW0A 4I01A 3L2CA 4L5IA 1B9MA 1BOAA 3FF5A 4RB2C 3QU3A 2V1UA 1Y0UA 2MH9A 1VTNC 3MCZA 1MJAA 1ON1A 2XUBA 2PEXA 2DAOA 2EFQA 2PMUA 3TDUC 4RGRA 3T0YA 1WSUA 2AS5F 3TKYA 1R1UA 3ABTA 4LGWA 1G6NA 3GFJA 4AWXB 5DYMA 4HOBA 1YYVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2P8T A;  4M9S A;  3M8F A;  2MD5 A;  2ELH A;  4O3M A;  1D8J A;  2NNN A;  5D5W B;  5LEJ A;  2FOK A;  3MQ0 A;  4L18 B;  1BC7 C;  1KU9 A;  3M7G A;  3F22 A;  1KYZ A;  1TTY A;  5HVQ C;  3ZMD A;  3L00 A;  3F8M A;  3ULQ B;  2RV8 A;  3F72 A;  4M74 A;  4G7H F;  2HYG D;  3EYI A;  4UXN A;  3V4G A;  1K6O A;  3EUH A;  2NAZ A;  2E1C A;  3LFK A;  4Z2Y A;  3D0S A;  3IHU A;  1ONV A;  3BJA A;  3EQL F;  3V8L A;  3F23 A;  4U7B A;  4FHT A;  3N4M A;  1I1S A;  2VOP A;  5A2Q K;  2IRF G;  4ZYE A;  5E1W A;  1ZGA A;  2L4A A;  3T5X A;  4CGZ A;  2FNP A;  3CUQ C;  5DD4 A;  4MEX F;  2O3F A;  4A6E A;  2OZ6 A;  4KDP A;  2JPC A;  2J5O A;  1HW2 A;  3LA3 A;  1G3Y A;  3QPT A;  5D5V B;  1USS A;  4IXA A;  3F8N A;  4M9X A;  3LST A;  1YFH A;  4H0E A;  3HUG A;  2VOO A;  5IT9 K;  4LLG F;  4ENM A;  2G7U A;  3FMS A;  4M72 A;  3WOD F;  1BI2 A;  5AON A;  3VFZ A;  4K2E A;  2DK8 A;  2ZO4 A;  2R7D A;  4LG0 B;  1IF1 A;  3RKY A;  3HYI A;  2EJR A;  3R60 A;  3K0L A;  5E8I A;  2FML A;  2WWY A;  3V7S A;  4Y13 A;  2Y48 A;  1XDU A;  4EJT A;  3NQO A;  4FX0 A;  2RQP A;  1XMK A;  4A0Y A;  1FY7 A;  2HTJ A;  2H27 A;  2XAJ A;  2F2E A;  4ETS A;  5D4S A;  4A12 A;  1QBJ A;  3RDI A;  3RPU A;  1LEB A;  2FU4 A;  1KU2 A;  1XCB A;  3CLO A;  4AIK A;  1SD5 A;  4DQ2 A;  4UNO A;  1KU7 A;  2FBK A;  4JQF A;  2P7C B;  1R58 A;  5FD6 A;  4P55 A;  2D2W A;  1FSH A;  1KQ0 A;  1V4R A;  3D5L A;  2P5K A;  3R61 A;  4HA8 A;  4JK1 X;  1IXS B;  3U1D A;  5ERI A;  3H3Z A;  3W6J B;  6PAX A;  4ESB A;  3VOD A;  1W5S A;  4MTD A;  3I4P A;  1ZN2 A;  4CO8 A;  1F1Z A;  2VBW A;  3P9K A;  3H3U A;  5H20 A;  2FMY A;  3QP6 A;  4M71 A;  1BI0 A;  3IKT A;  2GZW A;  2QQB A;  4O6J A;  5FGM A;  5F6F A;  4BQA A;  1FNN A;  2ZFW A;  3TOB A;  2W57 A;  4NHJ A;  1QO0 D;  3EDP A;  4EM2 A;  4ZZD A;  1K78 A;  3FXR A;  3GFM A;  4HQM A;  1KQ8 A;  2L54 A;  1J9I A;  1R1T A;  3KCC A;  3KP5 A;  3JSP A;  4EM1 A;  4MGR A;  2BYV E;  5KK1 A;  1ZRD A;  1KYW A;  1XSD A;  2YSR A;  3WTX C;  3J81 Z;  2J5P A;  1U5T B;  5H6R A;  3E97 A;  3PFI A;  1B9N A;  1BIB A;  2QYO A;  1ZHF A;  2A3S A;  5ICF A;  2ESN A;  4YFX F;  4EM0 B;  1HW1 A;  2E7W A;  4GXO A;  1HKS A;  2DU9 A;  4WXD A;  5FB2 A;  1OR7 A;  2PFB A;  4G9Y A;  3J80 K;  3DQV C;  1TLH B;  3HTS B;  1SD6 A;  5J8F A;  2IT0 A;  4RB0 A;  1TW2 A;  1Z7U A;  2XAQ A;  4PDK A;  3N97 A;  1IUY A;  2LF8 A;  2YR2 A;  1SMT A;  2IA1 A;  1BBY A;  1KQ9 A;  1IN7 A;  1I27 A;  2DO7 A;  2RKH A;  4RAY A;  2STW A;  4WXH A;  1FP2 A;  4G6Q A;  4KMU X;  2IP2 A;  1FYL A;  4KFC A;  1MDM B;  1IZ1 A;  1XSV A;  4KMF A;  3GLX A;  3DPT A;  3AAF A;  2OQR A;  3WTV C;  3QAH A;  1RUN A;  5CVR A;  4OMZ A;  2H6B A;  1HKT A;  1MDM A;  1G3T A;  3F21 A;  4GYG A;  1I1G A;  1I6X A;  2FEZ A;  1OYW A;  3LA2 A;  4I02 A;  4YFK F;  5HDN A;  4HQE A;  4FT8 A;  1R5H A;  3WE3 A;  3W6K B;  3CDH A;  3HSF A;  2P5L C;  3GZ5 A;  1LNW A;  3KEQ A;  4LMY A;  3GFL A;  3WTY C;  5CVV A;  1R23 A;  1JHF A;  2XAF A;  4HBL A;  1HST A;  1KU3 A;  3FM3 A;  2F5D A;  1ODD A;  4BXU A;  2DW4 A;  4I0A A;  5L3F A;  5LBQ A;  3DPL C;  1BM9 A;  2Z99 A;  2Z5U A;  1IRG A;  4MNU A;  1DPU A;  3I59 A;  2CYY A;  2FNA A;  3GWZ A;  1P92 A;  2VC1 A;  2K4J A;  1TQM A;  1T0F A;  3LA7 A;  4L0Y B;  1XMA A;  2M8E A;  2ZME A;  4LK0 F;  1LJ9 A;  5J8C A;  2K7L A;  2ZXJ A;  5H6Q A;  2ZNZ A;  2ADU A;  2EFN A;  1PDN C;  3M9A A;  3WGH A;  3NEU A;  4P5O A;  4AIJ A;  2CW0 F;  4EMS A;  1TW3 A;  4YIF A;  4MEY F;  3WU0 A;  4UVB A;  1S7O A;  3LAP A;  4KT5 C;  4B8X A;  4N9H A;  3G73 A;  2YX4 A;  4CYD A;  3L9F A;  3V8J A;  4EQQ A;  2EA2 A;  3B02 A;  1ZAR A;  2HKX A;  3SXY A;  4WWC A;  2QBY A;  1FBU A;  3OOP A;  4HDU A;  3BOQ A;  5IT3 A;  2HQR A;  4OIO F;  4AIH A;  4ENN A;  3HHH A;  3K69 A;  2FBH A;  2DQR A;  3BPX A;  3K9T A;  3IKV A;  3KP2 A;  1BC8 C;  3COA C;  2UWM A;  1BJA A;  1OKR A;  2ZCW A;  3T8T A;  3ZMV A;  4EJW A;  4IHT A;  1XGN A;  2GA1 A;  2P5V A;  2HS5 A;  2HDC A;  2QLZ A;  4HF0 A;  2OZU A;  2QQA A;  2JSC A;  4ZH4 F;  5L3G A;  4G6D A;  4G8X A;  2P4W A;  4WF2 A;  2UXN A;  4LG0 A;  3IL2 A;  2VN2 A;  2DTR A;  2P6T A;  2KJB A;  4LK1 F;  5KVR A;  2M1B A;  3MWM A;  2KIM A;  4XLP F;  2EV5 A;  3QU6 A;  2VT2 A;  4OU0 A;  2D1V A;  4Y15 A;  3ZQ7 A;  2E1N A;  3BJO A;  1S3J A;  2IJL A;  1XD7 A;  4LD5 A;  4L0Z B;  2MA3 A;  1XSX A;  2HKO A;  2MBF A;  3J7A O;  3ELK A;  3CUQ A;  3P9C A;  4KIF A;  1E17 A;  4MQ9 F;  5JI6 A;  1FBQ A;  1B6A A;  2CGP A;  2CQK A;  1HSJ A;  5L3B A;  3WGI A;  2HFH A;  3FHZ A;  5CJ9 A;  5EEG A;  4U7D A;  1IN6 A;  3C18 A;  1RZ4 A;  1R5G A;  4ASN A;  3P9I A;  4KYW A;  4HF2 A;  4L5J A;  3TO7 A;  3GVA A;  2IA2 A;  2QM3 A;  2VE9 A;  1IXR C;  3IRQ A;  1F4K A;  5LHH A;  2BV6 A;  3L09 A;  3ROU A;  1H9T A;  3GEZ A;  3M1E A;  1T98 A;  5ILV A;  3JTG A;  1W5T A;  1WI9 A;  4U0V A;  1RUO A;  2A69 F;  3DXJ F;  3CUO A;  3F6O A;  3S2W A;  3MFK A;  2XAG A;  1B59 A;  1U8R A;  2L01 A;  5BPI A;  1ZLK A;  1D5V A;  5DUI A;  3ZN1 A;  1FYK A;  4CDG A;  3I0T A;  4M6X A;  4OMY A;  1DPR A;  4DNC A;  5LGT A;  2K27 A;  3HRS A;  1J75 A;  3KP3 A;  1OYI A;  2Q8K A;  3G3Z A;  2QQ9 A;  2PN6 A;  1J59 A;  3SHF A;  4F7Z A;  1FT9 A;  3F8F A;  1SFU A;  1WKM A;  1Z91 A;  3HRT A;  3HRM A;  5J6X A;  4A2U A;  4A6D A;  1SD4 A;  3FZV A;  1ZRC A;  1GVJ A;  2XKO A;  3CO7 C;  2NRA C;  4ENK A;  2F5C A;  5ICG A;  2M87 A;  1FSE A;  1Z6T A;  2HGC A;  1XGS A;  2K4B A;  2BGC A;  4M9Z A;  1LDK B;  4Q5S F;  5HDK A;  2OAZ A;  2ETH A;  1ZAO A;  3R6S A;  4QWQ A;  2JPB A;  5FLX Z;  4XBF A;  4OIQ F;  1BIA A;  1LDD A;  5HOO A;  3REO A;  2Q2E A;  5F64 A;  2VON A;  4XSZ F;  2EB7 A;  4LJZ F;  2VXZ A;  3DF8 A;  2MLK A;  2L02 A;  3DFG A;  2HOE A;  3JAM Z;  3WTS C;  3GO5 A;  1T6S A;  2GXB A;  2KKO A;  2QWW A;  1SFX A;  3IWF A;  4HV5 A;  3GUD A;  1FWZ A;  1IN4 A;  1B4A A;  2XGX A;  4IHS A;  4IRH A;  2V79 A;  3KLO A;  2HQN A;  1J2X A;  1S7A A;  2RN7 A;  2IA0 A;  1XCV A;  5FFX A;  3MZH A;  4IJA A;  4QLC U;  2QEN A;  5JHU A;  1MJB A;  1W4M A;  1CF7 A;  1ULY A;  1G3W A;  1T2K A;  4WXC A;  4I98 B;  3JW4 A;  4P96 A;  2X0L A;  2GWR A;  3O6B B;  1YQA A;  5HS7 A;  4ZYH A;  3ZN0 A;  2DBB A;  1SMY F;  3WTZ A;  4HX4 A;  5DDG A;  3J81 K;  3E5U A;  3GXO A;  3KP7 A;  4WX9 A;  3HRU A;  2DFI A;  4PZJ A;  4YII A;  2R7F A;  1Z9C A;  3FMR A;  2PJP A;  2PI0 A;  2KIF A;  1C0W A;  1TNS A;  3BPV A;  4WK8 F;  5E17 F;  2LDU A;  3F6V A;  3Q5F A;  3CTA A;  4P9U A;  2CG4 A;  4UV9 A;  1R7J A;  2P7V B;  4GYI A;  2QVO A;  2XRN A;  2KRF A;  3KZY A;  4S05 A;  3I5U A;  5ICC A;  3ABU A;  1Q1H A;  2VBY A;  2A6H F;  1O3Q A;  2ISY A;  2WTE A;  4EV0 A;  3FWE A;  4U0Y A;  4EGY A;  3F3X A;  3ECH A;  3LQQ A;  5ILU A;  5HLH A;  1D8K A;  1YTY A;  3MZY A;  1R1V A;  4OIP F;  5JR3 A;  2GAU A;  1W7P A;  5LGU A;  4RGS A;  3E6D A;  3DKW A;  1W7P B;  3E5Q A;  1WWX A;  4KN7 X;  4G7Z F;  1LVA A;  5LRR A;  4UVA A;  5E18 F;  1CF7 B;  1ZH5 A;  1ZRE A;  2FSW A;  3QOP A;  4HLY A;  5EEH A;  1FLI A;  2G9W A;  1BI1 A;  2G7H A;  4PGH A;  3LAJ A;  5HLI A;  1XB4 A;  3TO6 A;  3BP8 A;  4GGG A;  2L4M A;  1WQ2 A;  3V8K A;  2K86 A;  4HZF A;  4BNC A;  3WTW C;  3JTH A;  3FXU A;  4M73 A;  2GQQ A;  4PGG A;  3EYY A;  4OIN F;  1MZB A;  3F8C A;  2Z9O A;  2M30 A;  3ZMU A;  4ENJ A;  3GW2 A;  1IN8 A;  3M8E A;  1WRJ A;  3C3W A;  3R4K A;  1E2X A;  5DCF A;  2TDX A;  5LGN A;  2A5Y B;  4MTE A;  4NQW A;  4O5V A;  3VOE A;  2XKP A;  5E1Z B;  3TOA A;  4A5N A;  3GZ6 A;  3E6M A;  3BJ6 A;  2V6C A;  4KNY A;  3RI4 A;  1OYY A;  1YS7 A;  2LSO A;  5HS9 A;  4U0W A;  3RIR A;  3GX4 X;  1S29 A;  2XAH A;  4KIC A;  4ON0 A;  1A04 A;  1STZ A;  1LQ1 A;  3O3K A;  2Y75 A;  1MKM A;  2IW5 A;  2OU2 A;  2BE5 F;  3IC7 A;  5DV5 A;  2Z33 A;  1LEA A;  1U6G A;  5CVU A;  1I5Z A;  1YW8 A;  4JBA A;  2GXG A;  1TNT A;  2OD5 A;  5K5R A;  3QRF F;  4PCQ A;  4RB3 C;  2BEO A;  4XLN F;  2HR3 A;  4UV8 A;  4KIB A;  4IPA A;  5LHI A;  4ESJ A;  2M5W A;  2A6E F;  3RKX A;  3KP4 A;  4UUV A;  4R79 A;  1PP8 F;  1IW7 F;  2VE8 A;  2CO5 A;  1TBX A;  2LKP A;  1DP7 P;  1R22 A;  4R8H A;  5K1Y A;  3T8R A;  3R0A A;  1UB9 A;  3GYH X;  4LB6 B;  2Q0O A;  3QP5 A;  4ZZL A;  2UZK A;  5DCM A;  1P4W A;  2UXX A;  2JTV A;  2X4H A;  1HBX G;  4KIG A;  1EH8 A;  3IRR A;  2W24 A;  5L3D A;  1IRF A;  2JT1 A;  1OMI A;  3ECO A;  3I53 A;  5D8L B;  1MD0 A;  5CVI A;  4MHG A;  2PQ8 A;  3PQJ A;  1FPQ A;  2XRO A;  2DT5 A;  2D45 A;  5CYV A;  2AXL A;  4CIC A;  3GFI A;  4HX8 A;  1F5T A;  2KIU A;  3JAM K;  1P2F A;  3VEP A;  1H9G A;  3K1P A;  3E3V A;  2HTS A;  2O8X A;  3HIF A;  1QZY A;  1UFM A;  1JGS A;  3V7C A;  4HF1 A;  4S04 A;  2DPD A;  1GXQ A;  3BDD A;  3HHG A;  4LLN A;  1EH7 A;  3F8B A;  1ON2 A;  5FLX K;  1UHW A;  3U9G A;  4NB5 A;  1T39 A;  5FD5 A;  2FF4 A;  3Q9S A;  4OOI A;  4G94 A;  3ZP5 A;  4Q47 A;  2F5F A;  1QQI A;  1O7F A;  5ICE A;  5FFZ A;  3BRO A;  4TV7 A;  2DLL A;  2QBY B;  2QZ8 A;  4BH9 A;  1ZLJ A;  3ZMS A;  4LFU A;  4IRG A;  3SZT A;  3SFZ A;  1FZP B;  3CJN A;  3R0J A;  2COM A;  2RC4 A;  5F1R A;  1ZRF A;  3I64 A;  1REP C;  1O3S A;  5LHG A;  4CZZ A;  1LB2 A;  2H94 A;  3WE2 A;  3O2P E;  1K7A A;  2ESH A;  3RKW A;  1HXD A;  1S8N A;  1XGM A;  1IAW A;  1J7K A;  2QUF A;  1F9N A;  2BBY A;  3MEX A;  2NNY A;  5HDG A;  3RYR A;  1RIO H;  1JE8 A;  5BQT A;  1U78 A;  4L9T A;  1SD7 A;  2B0L A;  3FXQ A;  2O61 A;  5E20 A;  2XAS A;  2HEO A;  1ZYR F;  5AIQ A;  4A0Z A;  4BHB A;  4KN4 X;  3RPQ A;  4I7H A;  3KEO A;  4RB1 A;  4IRI A;  1J5Y A;  5BPD A;  3E5X A;  4A0X A;  4HDV A;  4L9V A;  5CLS A;  5K5Q A;  5E1X A;  4P9F A;  2XVC A;  2OQG A;  4E70 A;  2FXA A;  1YIO A;  1YLF A;  2PLY A;  4UHT A;  2Z3Y A;  1U5T C;  2VOD A;  2EFO A;  4EJV A;  3ZMZ A;  1J0R A;  3WTU C;  1G3S A;  3BY6 A;  2RDP A;  4N9I A;  1ZGJ A;  2OBP A;  2PBI A;  2DPU A;  4WCG A;  2O6G E;  1QGP A;  3KP6 A;  1XN7 A;  3C7J A;  2OA4 A;  3MAJ A;  3K1N A;  1G4D A;  1L3L A;  1X3U A;  3C1D A;  2EK5 A;  4RGU A;  5HS8 A;  4RS8 A;  3TGN A;  2JRT A;  2FQ3 A;  1Z05 A;  4KUM A;  3CO6 C;  2VBZ A;  2ACJ A;  2DQL A;  4FX4 A;  2FBI A;  3KET A;  4R1H A;  1IN5 A;  2D1H A;  1P4A A;  2RVC A;  1H0M A;  4I0B A;  1Z6R A;  2A68 F;  4ESF A;  5DCM B;  2NYX A;  4L9N A;  2H09 A;  3K2Z A;  2O03 A;  4IVN A;  3IWZ A;  3CUQ B;  4EJO A;  2DI3 A;  1GXP A;  2EV6 A;  3LQR A;  3K1M A;  1YW9 A;  5D4R A;  5K5O A;  3ZPL A;  2M45 A;  5D6E A;  1LDJ A;  4OIR F;  2E7X A;  5BOX A;  1XDS A;  3FX3 A;  3WGG A;  3QPH A;  1OPC A;  4XSX F;  1R00 A;  3BZ6 A;  2ISZ A;  1Z1D A;  2GIV A;  1SAX A;  2ZBK A;  5LEK A;  4KA4 A;  4G7O F;  5FO5 A;  3L7W A;  2V1D A;  3V7R A;  1S6L A;  1ZG1 A;  2IPQ X;  2YPR A;  2H6C A;  3HSR A;  3ERE D;  3FMQ A;  1U2W A;  3KZZ A;  3B73 A;  3KE2 A;  2PG4 A;  2WC2 A;  2XHK A;  3DEU A;  1UHM A;  4UVC A;  3T1B A;  1O57 A;  2EFW A;  3ZMT A;  4BAY A;  5LRS A;  5ED4 A;  3GF2 A;  1EH6 A;  3ML6 A;  1HQC A;  3FM5 A;  4ZYD A;  4EVI A;  1CGP A;  2VBX A;  2KJC A;  5A2Q Z;  4HLX A;  5JVT A;  1JHH A;  1U3E M;  1K78 B;  3I54 A;  4Q4Z F;  3TQN A;  5DD8 A;  2JZY A;  3LWF A;  2XV4 S;  3JSO A;  2RGV A;  5AIP A;  3PQK A;  1K79 A;  4HAM A;  4AD9 A;  1EV7 A;  2LF7 A;  5JFR A;  2MLG A;  5IT9 Z;  1FX7 A;  2L3D A;  3HSE A;  5DUK A;  4LLL A;  1XGO A;  2F5E A;  4CXF A;  4L9J A;  4IF4 A;  3DP7 A;  5E8G A;  3SZP A;  4YFN F;  4U88 A;  3HTU A;  1ZG5 A;  2EFP A;  2ZNY A;  1U5T A;  4HYE A;  5BMZ A;  2FE3 A;  1KA8 A;  2EWN A;  5BS6 A;  2ZKZ A;  4CHU A;  1TQI A;  5D5U B;  1R36 A;  1MGT A;  3EET A;  4GO1 A;  1D3Y A;  2R3S A;  4I2O A;  2O0Y A;  4M6Y A;  3SQN A;  4EJU A;  3KFW X;  5D6F A;  4Y17 A;  1TQP A;  4RGX A;  2V9V A;  2EV0 A;  3TO9 A;  1SFE A;  2C6Y A;  2IVM A;  3E6B A;  1BI3 A;  2W85 A;  1KGS A;  1T38 A;  1O3T A;  1MJ9 A;  2YU3 A;  2FRH A;  3E6C C;  1HKQ A;  2WV0 A;  1L0O C;  1RNL A;  1PUE E;  3OV8 A;  5D5X B;  3P7N A;  2FA5 A;  4LB5 A;  1FP1 D;  2Y0M A;  2GA2 A;  5HLG A;  1ZG3 A;  4GCV A;  4B09 A;  4BYY A;  1V3F A;  3VB2 A;  3WTT C;  1P4X A;  1QZZ A;  2STT A;  1HW5 A;  1FBS A;  1UST A;  1W7P D;  4BHC A;  5L3E A;  3BWG A;  1IXC A;  1PP7 U;  1UCR A;  1NHA A;  3RTR A;  3HOT A;  3J80 Z;  2HWV A;  2V1X A;  3KLN A;  2HZT A;  1YW7 A;  2VT3 A;  3HOS A;  5TRD A;  2A61 A;  2CFX A;  2EA4 A;  1O3R A;  3TDZ C;  2MH2 A;  1YG2 A;  4EGZ A;  1BN5 A;  4I09 A;  1GHC A;  2LNB A;  2HYF A;  4MQV A;  3RJP A;  4Q48 A;  1JXS A;  2W25 A;  2DK5 A;  1P6R A;  4BHP A;  4A5M A;  4ZYG A;  4YG2 F;  1AOY A;  4RAZ A;  3ISP A;  2P6S A;  3I71 A;  2CWE A;  5TJJ A;  4XRF A;  3NRV A;  3DV8 A;  1DDN A;  2W84 A;  3WU1 B;  3Q9V A;  2XIG A;  1O7L A;  2RNJ A;  2ZME B;  1FC3 A;  2K02 A;  4HX7 A;  5ILS A;  2CSO A;  2YX7 A;  2A07 F;  4N0B A;  1QPM A;  3I59 B;  1AWC A;  3U2R A;  5D8K B;  2PMH A;  1FYM A;  1YO5 C;  5L3C A;  4HV6 A;  5DEQ A;  2VC0 A;  2MC3 A;  1QNT A;  5CVJ A;  3I58 A;  2NS0 A;  1B1B A;  2ZJ2 A;  1YS6 A;  4AVP A;  4D0P A;  5LLQ A;  1RI7 A;  1FOK A;  1DUX C;  3WG9 A;  3RYP A;  3H92 A;  4HW0 A;  4I01 A;  3L2C A;  4L5I A;  1B9M A;  1BOA A;  3FF5 A;  4RB2 C;  3QU3 A;  2V1U A;  1Y0U A;  2MH9 A;  1VTN C;  3MCZ A;  1MJA A;  1ON1 A;  2XUB A;  2PEX A;  2DAO A;  2EFQ A;  2PMU A;  3TDU C;  4RGR A;  3T0Y A;  1WSU A;  2AS5 F;  3TKY A;  1R1U A;  3ABT A;  4LGW A;  1G6N A;  3GFJ A;  4AWX B;  5DYM A;  4HOB A;  1YYV A; 
#chains in the Genus database with same CATH topology
 2P8T A;  4M9S A;  1VF9 A;  4Y7N J;  3M8F A;  4AID A;  2MD5 A;  2ELH A;  5FRM A;  4O3M A;  1RRJ A;  2PMZ N;  1D8J A;  1BA5 A;  2NNN A;  5D5W B;  5LEJ A;  2FOK A;  3MQ0 A;  4L18 B;  1BC7 C;  1KU9 A;  2BVM A;  3CP2 A;  3M7G A;  4W97 A;  1T8I A;  1ETO A;  3F22 A;  1KYZ A;  1TTY A;  5HVQ C;  3ZMD A;  2JRM A;  5KAI C;  5KCM A;  5C44 J;  1JI8 A;  3L00 A;  3F8M A;  2N8G A;  4OWR B;  3CF5 F;  3ULQ B;  2RV8 A;  3D5S C;  3HDD A;  3F72 A;  4M74 A;  4G7H F;  1VZ0 A;  3HXL A;  4IQ4 A;  1ETW A;  3OL4 A;  2V9K A;  2HYG D;  2ECC A;  2IS2 A;  1U8B A;  1AA7 A;  3EYI A;  4UXN A;  3V4G A;  3OYM A;  1K6O A;  1YX3 A;  3EUH A;  2NAZ A;  2R5Z B;  2AQF A;  5IP6 A;  2KMU A;  2E1C A;  3LFK A;  3S14 J;  2WAF A;  1VQP I;  4A93 J;  2LC2 A;  4Z2Y A;  3C2G A;  3S1Q J;  3D0S A;  3IHU A;  1ONV A;  2CMP A;  3BJA A;  3EQL F;  3V8L A;  3F23 A;  4U7B A;  2V6E A;  4FHT A;  2EIJ H;  5IYC J;  1BR1 A;  3N4M A;  1D1C A;  5K7F A;  3HL2 A;  4E7H A;  2LRE A;  2VOP A;  1I1S A;  2HQA A;  5A2Q K;  2IRF G;  2FQ4 A;  2V9P A;  2H1L A;  4ZYE A;  2X1E A;  5E1W A;  4BEH A;  1UG2 A;  1ZGA A;  4XR6 A;  2L4A A;  3AG1 H;  4Y4R A;  5HNH A;  2HVS A;  3T5X A;  4XRS A;  1Y1W J;  4CGZ A;  3CMA I;  2FNP A;  3CUQ C;  1NK3 P;  5DD4 A;  3HUG B;  4MEX F;  2O8K A;  2O3F A;  4A6E A;  2WAD A;  2OZ6 A;  4ITV A;  2BY3 A;  4RM3 A;  1ZQ3 P;  2DA3 A;  2E1M C;  2JPC A;  2E5Z A;  3SZG A;  4KDP A;  2J5O A;  4BJT A;  1HW2 A;  1ZEL A;  3LA3 A;  1G3Y A;  2BY2 A;  3QPT A;  4XLC A;  1USS A;  5D5V B;  4IXA A;  5JHF A;  3F8N A;  4M9X A;  3LST A;  1YFH A;  4H0E A;  1S5L C;  3HUG A;  2VOO A;  5IT9 K;  4LLG F;  3CP8 A;  4ENM A;  2WB1 A;  3JRC A;  4PFP A;  2G7U A;  3FMS A;  4M72 A;  3WOD F;  1Y39 A;  1BI2 A;  5AON A;  3OIP A;  2F4I A;  3VFZ A;  3VYU B;  4K2E A;  2DK8 A;  2ZO4 A;  2R7D A;  4LG0 B;  3DKY A;  1NH3 A;  2BXY A;  1IF1 A;  2E2I J;  3RKY A;  3HYI A;  2EJR A;  3R60 A;  3K0L A;  3IH4 A;  2LY9 A;  5E8I A;  3OYB A;  2FML A;  2WWY A;  1F43 A;  3V7S A;  4ANJ A;  4Y13 A;  2VB6 A;  2Y48 A;  1XDU A;  5FKL A;  4EJT A;  1WFX A;  3NQO A;  2HI3 A;  1ZK8 A;  2IGN A;  3CMY A;  2DOE A;  2Y9Y A;  2RQP A;  4FX0 A;  5FKO A;  1LKX A;  1XMK A;  1Y1V J;  3C2H A;  4A0Y A;  1Q1V A;  1FY7 A;  3H0D A;  2XSJ C;  2LH9 A;  2ZXH A;  2HTJ A;  2ZFU A;  5HLT A;  2H27 A;  2MD0 A;  2XAJ A;  2F2E A;  4ETS A;  5D4S A;  3SYT A;  2EZI A;  4A12 A;  1QBJ A;  2W00 A;  3AG4 H;  4FIS A;  1VQK I;  2LYC A;  1Z67 A;  3RDI A;  1HDD C;  3RPU A;  2JN6 A;  2DA5 A;  3GLL A;  1R6R A;  1LEB A;  2FU4 A;  1KU2 A;  1XCB A;  2XF6 A;  3CLO A;  2DYS H;  3HGG A;  4AIK A;  4A3M J;  2VKV A;  4X6A J;  1SD5 A;  3OIQ A;  4DQ2 A;  3KYL A;  1BL0 A;  3OS2 A;  1KU7 A;  5IYB J;  4UNO A;  2FBK A;  2OC6 A;  4JQF A;  2P7C B;  3IAS 2;  1V5F A;  1R58 A;  5CPR B;  5FD6 A;  4P55 A;  1YRN B;  3CZ6 A;  2D2W A;  3WHB A;  1FSH A;  1A35 A;  4Z6Y A;  4RLF A;  1KQ0 A;  1V4R A;  3D5L A;  1K83 J;  1MIJ A;  2P5K A;  1YJ9 I;  3R61 A;  4HA8 A;  4JK1 X;  3E7L A;  3OL3 A;  2NVU B;  1IXS B;  2R5Y A;  1MBJ A;  2OF7 A;  3U1D A;  1N75 A;  5ERI A;  4HNV A;  2XC7 A;  1XPX A;  3H3Z A;  4C9Y A;  3W6J B;  6PAX A;  3RPU D;  4ESB A;  4BEH B;  3VOD A;  1W5S A;  4MTD A;  1W0T A;  1GV5 A;  3K7A J;  3RSN A;  3I4P A;  4F93 B;  1ZN2 A;  4CO8 A;  3K4M A;  3ZXS A;  1F1Z A;  4UY8 I;  2VBW A;  3P9K A;  3KIO A;  4HNT A;  3H3U A;  4X0G A;  2HVQ A;  5H20 A;  3VYS B;  1TL8 A;  2LR8 A;  2FMY A;  3QP6 A;  4M71 A;  1G59 A;  1BI0 A;  2M9H A;  1Z21 A;  2LG4 A;  1PUF B;  3IKT A;  1XG1 A;  4XKW A;  1FJL A;  2NVT J;  4A3L J;  2GZW A;  2QQB A;  1I3A A;  4O6J A;  3LFU A;  5F6F A;  5FGM A;  1FNN A;  4BQA A;  2GIZ A;  2ZFW A;  1FIA A;  3TOB A;  4ZYA A;  2LY1 A;  2W57 A;  2EZH A;  4FE4 A;  4NHJ A;  1QO0 D;  1PVE A;  3EDP A;  4EM2 A;  4ZZD A;  1IDZ A;  1T0F C;  1K78 A;  4LOC A;  3FXR A;  4CCM A;  3GFM A;  4HQM A;  1KQ8 A;  3BG3 A;  2L54 A;  1APL C;  1J9I A;  1RET A;  2DMN A;  1V54 H;  3I9V 2;  2JA6 J;  1R1T A;  3KCC A;  1ETK A;  2A5W A;  3KP5 A;  2Y2Z A;  3JSP A;  1G2H A;  4M3D A;  3FK7 A;  4EM1 A;  4MGR A;  2BYV E;  5KHD A;  3HBL A;  2MAB A;  2XB5 A;  2E35 A;  5KK1 A;  1ZRD A;  5E3L A;  1ETV A;  2K85 A;  1KYW A;  1XSD A;  4RM2 A;  5DS9 A;  5FJ8 J;  3PO2 J;  2V4J C;  2YSR A;  2M34 A;  1JTX A;  3WTX C;  1TT5 B;  3J81 Z;  2J5P A;  1U5T B;  5H6R A;  3L2U A;  3E97 A;  5F0C A;  2EQR A;  3CCS I;  1LVK A;  4JX6 A;  1BW6 A;  4DZP A;  1K61 A;  3PFI A;  4HNU A;  1B9N A;  4DZJ A;  1BIB A;  2QYO A;  4NC6 A;  1RES A;  1ZHF A;  2WA0 A;  2IGK A;  2A3S A;  3DPU A;  5ICF A;  2ESN A;  4YFX F;  4EM0 B;  1HW1 A;  3JRF A;  2FUG 2;  2OCE A;  2E7W A;  4CCN A;  4GXO A;  2GOX B;  1HKS A;  2VPL A;  2DU9 A;  3H5N A;  4WXD A;  4C3H J;  1Y56 A;  4IOA F;  5FB2 A;  1OR7 A;  3W2W A;  2PFB A;  3DEW A;  4G9Y A;  3J80 K;  2LKX A;  3DQV C;  1Z3X A;  1TC3 C;  1TLH B;  3HTS B;  1SD6 A;  2HU9 A;  1D0Y A;  5J8F A;  2IT0 A;  4B1R A;  2AXT C;  4RB0 A;  1VND A;  1TW2 A;  1Z7U A;  3BR2 A;  4W1U A;  3OYD A;  4UB8 C;  3GTO J;  2XAQ A;  3H36 A;  2VQG A;  4PDK A;  3AL0 C;  3N97 A;  3ONQ A;  1UAA A;  1IUY A;  2LF8 A;  2VKE A;  2YR2 A;  1SMT A;  2IA1 A;  5KAF C;  1BBY A;  3CDI A;  1KQ9 A;  1IN7 A;  1I27 A;  3F0C A;  2DO7 A;  1U9O A;  3BG9 A;  2RKH A;  4RAY A;  3OYF A;  3ABK H;  4WXH A;  2STW A;  1FP2 A;  4G6Q A;  4KMU X;  4A3B J;  3J7Y J;  2IP2 A;  1JKP C;  2R4G A;  1FYL A;  4OAY A;  4KFC A;  1MDM B;  1IZ1 A;  1XSV A;  4XKC A;  4KMF A;  3GLX A;  4NC7 A;  1X1P A;  3DPT A;  3ZQL A;  2R7U A;  5EDN A;  3H9J A;  2OQR A;  4BJ5 C;  3AAF A;  2GLO A;  1IC8 A;  2KP6 A;  3S17 J;  4HST A;  2KRH A;  2R7W A;  3WTV C;  3OY9 A;  3HZJ A;  3QAH A;  1IO2 A;  3LSK A;  1RUN A;  5CVR A;  2COB A;  2JA2 A;  4OMZ A;  2H6B A;  1HKT A;  1DGR M;  1B72 A;  1MDM A;  2IXS A;  1G3T A;  3F21 A;  5J3L A;  4FTH A;  4GYG A;  1I1G A;  1I6X A;  1A5J A;  2FEZ A;  1OYW A;  3LA2 A;  3OYL A;  4I02 A;  4YFK F;  2QQ8 A;  5J40 A;  1W36 D;  1SAN A;  2VI6 A;  5HDN A;  4HQE A;  4FT8 A;  1R5H A;  2O5R A;  2XPV A;  1UMQ A;  3HKZ A;  2DJI A;  3WE3 A;  1BR4 A;  1WPK A;  2LBF A;  3W6K B;  3CDH A;  4M3E A;  5TIS C;  3K4C A;  3HSF A;  1X1B A;  2P5L C;  3GZ5 A;  5GTH C;  4RBO A;  1LNW A;  2KRC A;  3KEQ A;  2VXD A;  3K4J A;  4LMY A;  4AWX B;  2E2J J;  5K7H A;  5FRO A;  3GFL A;  3WTY C;  1IRZ A;  5CVV A;  1R23 A;  1DP3 A;  1JHF A;  2XAF A;  4HBL A;  3FHN A;  1HST A;  3C2B A;  1KU3 A;  1X2M A;  4UUS A;  3FM3 A;  2F5D A;  1ODD A;  4JX4 A;  3SEQ A;  3OYK A;  2ZJR F;  4BXU A;  1QHH D;  2DW4 A;  1LUJ B;  4I0A A;  3TMO A;  5L3F A;  2ID6 A;  1HLV A;  5LBQ A;  3DPL C;  1JUP A;  1BM9 A;  2K9N A;  2KIS A;  2Z99 A;  1X1A A;  2B9S A;  1JUM A;  2Z5U A;  1MBF A;  1IRG A;  2OPT A;  4MNU A;  3S32 A;  3CLQ A;  3HM5 A;  1DPU A;  4CCK A;  3I59 A;  1D0Z A;  2CYY A;  4BKX A;  3UR3 C;  4E7I A;  2VJ5 A;  2MYS A;  3QPL A;  4D5C A;  4B3X A;  3A01 A;  2FNA A;  3GWZ A;  1S9H A;  1P92 A;  2VC1 A;  1XX5 A;  2K4J A;  1TQM A;  5E3O A;  1T0F A;  3LA7 A;  4RAF A;  1XMA A;  2KDO A;  4L0Y B;  3HOX J;  2M8E A;  2JK3 A;  1N77 A;  2ZME A;  4LK0 F;  2DFE A;  5EEA A;  3OYE A;  1LJ9 A;  3QYB A;  3PSI A;  2MG4 A;  5J8C A;  2K7L A;  3A01 B;  2ZXJ A;  5H6Q A;  2ZNZ A;  2ADU A;  2EFN A;  1PDN C;  1E3H A;  2R7V A;  3M9A A;  3WGH A;  1WI3 A;  3NEU A;  4P5O A;  2F5V A;  4PUS A;  4AIJ A;  2CW0 F;  4EMS A;  1TW3 A;  1E0E A;  2DOF A;  4YIF A;  2QF7 A;  4MEY F;  1OLT A;  3WU0 A;  4UVB A;  5GTI C;  1S7O A;  4D9J A;  3LAP A;  4KT5 C;  4B8X A;  4N9H A;  3I56 I;  3G73 A;  3CC2 I;  2YX4 A;  4CYD A;  1OCZ H;  2KIQ A;  3L9F A;  3V8J A;  3G1O A;  4EQQ A;  2EA2 A;  1W36 C;  3B02 A;  1ZAR A;  2HKX A;  2V1N A;  3Q0V A;  3SXY A;  2IEK A;  1FIP A;  1JKQ C;  4WWC A;  1TT0 A;  1FBU A;  2QBY A;  3OOP A;  3FXJ A;  4HDU A;  3BOQ A;  5IT3 A;  2HQR A;  4ENN A;  4AIH A;  4OIO F;  3HHH A;  3K69 A;  3K4K A;  2FBH A;  2DQR A;  3BPX A;  4N4N B;  3U1K A;  3K9T A;  3M4O J;  3IKV A;  3KP2 A;  1BC8 C;  4B44 A;  3COA C;  2UWM A;  4QPO A;  1BJA A;  1FEX A;  1OKR A;  5EF6 A;  3BTJ A;  2ZCW A;  3T8T A;  3ZMV A;  4EJW A;  4IHT A;  1XGN A;  2GA1 A;  4CYC B;  2P5V A;  4J01 A;  2DJN A;  2HS5 A;  4FAS D;  2HDC A;  3P5J A;  2QLZ A;  4I6Z A;  1YJN I;  4HF0 A;  2OZU A;  2QQA A;  4FCY A;  1WGX A;  2JSC A;  4ZH4 F;  3OMY A;  5L3G A;  4AYB A;  4G6D A;  3FK6 A;  2L7F P;  4G8X A;  2P4W A;  2CW8 A;  4ZDP A;  4WF2 A;  2UXN A;  4LG0 A;  3IL2 A;  2VN2 A;  2DTR A;  2BOL A;  2P6T A;  1YIT I;  2FOW A;  2KJB A;  4LK1 F;  5KVR A;  3JRH A;  2X1C A;  2M1B A;  2OCC H;  3MWM A;  2AHQ A;  2KIM A;  4XLP F;  2EV5 A;  3QU6 A;  2VT2 A;  4OU0 A;  2D1V A;  2OV7 A;  1E3P A;  4Y15 A;  4ZJZ A;  3ZQ7 A;  2E1N A;  3BJO A;  1S3J A;  2IJL A;  2Y0S N;  1XD7 A;  4IQJ A;  4LD5 A;  4L0Z B;  3QYF A;  1YE9 A;  2MA3 A;  2NVQ J;  1XSX A;  2HKO A;  2XPW A;  1PUF A;  3ZQF A;  4JP0 A;  4Y52 J;  2MBF A;  4A3E J;  3FKI J;  5EZH A;  4FE7 A;  3LSR A;  3BR3 A;  5JVG F;  1T56 A;  3J7A O;  2KHM A;  1H89 C;  3S1N J;  2L0K A;  3ELK A;  3CUQ A;  3I4N J;  3PUF A;  3P9C A;  2DT7 B;  4M3B A;  3M07 A;  2X6O A;  1AU7 A;  4RAG A;  4A3G J;  4KIF A;  1QRY A;  1E17 A;  2DCE A;  4MQ9 F;  1WJE A;  4UUT A;  5JI6 A;  3OYG A;  1FBQ A;  1B6A A;  2CGP A;  5C4X J;  2CQK A;  4XKB A;  1HSJ A;  5L3B A;  3EUK L;  3WGI A;  2HFH A;  3FHZ A;  4Y33 A;  1LFB A;  3BZK A;  5CJ9 A;  1VQM I;  5EEG A;  4B47 A;  1VQ4 I;  3K6G A;  4U7D A;  1IN6 A;  4XOR A;  3C18 A;  1RZ4 A;  1R5G A;  4PJL A;  2PMZ A;  4ASN A;  2V26 A;  3P9I A;  5LFA A;  4KYW A;  3F9K A;  4L5J A;  4HF2 A;  3TO7 A;  3IH3 A;  3BTL A;  3MMY B;  1T33 A;  4M3F A;  3OSF A;  3BZC A;  3GVA A;  2IA2 A;  3BQZ A;  2O7O A;  3DU5 A;  1MMG A;  2K40 A;  3A0H C;  1SC7 A;  2QM3 A;  2VE9 A;  4C3J J;  3LL7 A;  2M8G X;  4QPQ A;  1IXR C;  2HVR A;  3H3V K;  3IRQ A;  2DDB A;  5GPA A;  1F4K A;  5LHH A;  2XAU A;  2BV6 A;  3L09 A;  5EJC A;  4NQW B;  3ROU A;  3BR1 A;  4RMN A;  4F55 A;  5C3E J;  1GUU A;  2RAE A;  3KEY A;  3LSM A;  2VL8 A;  1H88 C;  1H9T A;  3GEZ A;  1JKR C;  2JA5 J;  2HOA A;  3M1E A;  1T98 A;  2Y9Z A;  5ILV A;  2XB0 X;  5CKT A;  5J1U A;  3GTM J;  3JTG A;  2FD5 A;  1W5T A;  1WI9 A;  2JVG A;  2WAE A;  4U0V A;  2VJ4 A;  1RUO A;  1V55 H;  1UEL B;  1MBG A;  4XNF A;  5GAD J;  4H4K C;  2A69 F;  3DXJ F;  3CUO A;  3F6O A;  4ABZ A;  4BE1 A;  2DA4 A;  3S2W A;  2R92 J;  3MFK A;  3ASN H;  1R4N B;  2XAG A;  4XM3 A;  1B59 A;  2E34 A;  1U8R A;  4DOZ A;  2EBI A;  1AKH B;  2BXZ A;  2L01 A;  5BPI A;  4XLH A;  2F48 A;  1ZLK A;  1D5V A;  5DUI A;  2HOS A;  3ZN1 A;  4FET A;  3OYN A;  1FYK A;  1E3O C;  4EEF G;  1FOY A;  2IGM A;  4CDG A;  2OUM A;  3I0T A;  4M6X A;  2CQQ A;  4OMY A;  1OCC H;  1DPR A;  5F04 A;  4DNC A;  5EG0 A;  1WJD A;  5LGT A;  2KZG A;  2DTZ A;  2K27 A;  1VQN I;  3H5R A;  3HRS A;  1J75 A;  4BE0 A;  3KP3 A;  1OYI A;  1M1E B;  4XMY A;  2Q8K A;  3G3Z A;  1FOW A;  2QQ9 A;  2PN6 A;  3ZQH A;  1YIJ I;  3SHF A;  1J59 A;  4F7Z A;  1FT9 A;  3JRI A;  9ANT A;  3E0J B;  3F8F A;  1SFU A;  1WKM A;  3K70 D;  1VFC A;  1Z91 A;  3HRT A;  2JMW A;  1U0J A;  3HRM A;  4KT6 A;  2QKM B;  5J6X A;  3DWL E;  3W3C A;  4BU2 A;  3BC8 A;  4A2U A;  4A6D A;  1D0X A;  3CCU I;  1SD4 A;  4IL6 C;  2NS7 A;  2H8W A;  2LVS A;  3FZV A;  3K10 A;  3OSG A;  1ZRC A;  1GDT A;  1GVJ A;  5F08 A;  2XKO A;  1P9Q C;  3GTJ J;  1FTZ A;  3CO7 C;  2OJE D;  2NRA C;  4ENK A;  2F5C A;  3H9G A;  5ICG A;  3NAR A;  3A02 A;  3JRG A;  1IV6 A;  2M87 A;  3HOW J;  3S16 J;  3KZI C;  2ICW G;  2EPF A;  2KFD A;  2XGD A;  1FSE A;  1WCM J;  3PL8 A;  1Z6T A;  2HGC A;  2M2E A;  1XGS A;  2K4B A;  2BGC A;  4N4O B;  4M9Z A;  3S3O A;  3FKJ A;  1LDK B;  3G1L A;  5EG0 B;  4Q5S F;  4YIR X;  5HDK A;  1LE8 B;  5LD2 C;  2OAZ A;  2ETH A;  3OYI A;  3G6E I;  1ZAO A;  2XF7 A;  4CSW A;  3R6S A;  4NDL A;  3LSP A;  1MH4 A;  4QWQ A;  2JPB A;  2ELJ A;  3OS0 A;  5FLX Z;  4XBF A;  3CJT B;  4OIQ F;  1BIA A;  1LDD A;  2IS6 A;  3S8P A;  5HOO A;  4MIM A;  4BQO A;  4BAC A;  1WH5 A;  4PFO A;  4DYR A;  3REO A;  2Q2E A;  3H35 A;  1KON A;  4I76 A;  3M8J A;  2VQC A;  3BR6 A;  5F64 A;  2CH0 A;  2W1O A;  2GBY A;  4XSZ F;  2VON A;  2EB7 A;  4HEA 2;  5FKK A;  4LJZ F;  1NG6 A;  3ERM A;  2I8D A;  3Q0W A;  3CCM I;  2VXZ A;  4LIV A;  3DF8 A;  2MLK A;  2L02 A;  3A1Y A;  2K9L A;  4RDU A;  4D7N A;  3DFG A;  1RR7 A;  1X2N A;  2HOE A;  3JAM Z;  3WTS C;  3LSG A;  1WJ5 A;  3GO5 A;  1T6S A;  5EZG A;  1N25 A;  2GXB A;  2LBF B;  2KKO A;  2P81 A;  4IZZ A;  4E7J A;  2QWW A;  1SFX A;  2RNG A;  1RKW A;  1OR7 C;  3IWF A;  4L5E A;  4HV5 A;  1JT6 A;  3TW6 A;  2K5C A;  3GUD A;  3ZR8 X;  4PJ0 C;  3FBN B;  2R5Z A;  1FWZ A;  1IN4 A;  1B4A A;  2XGX A;  3CCJ I;  4IHS A;  2KL4 A;  1EA3 A;  2V79 A;  4IRH A;  2G0E A;  3UNG C;  4IHY A;  3KLO A;  2HQN A;  1J2X A;  1S7A A;  2I5U A;  2R7O A;  2RN7 A;  2IA0 A;  1XCV A;  5FFX A;  3MZH A;  5HNF A;  3M3Y J;  4IJA A;  3EUH C;  4QLC U;  2QEN A;  3ZQG A;  5JHU A;  1MJB A;  3SDB A;  1W4M A;  1CF7 A;  1ULY A;  1ZR4 A;  1G3W A;  2IGO A;  3LSH A;  1T2K A;  4WXC A;  4I98 B;  3JW4 A;  4P96 A;  2CQ7 A;  3I55 I;  2X0L A;  4MFE A;  2GWR A;  3O6B B;  1YQA A;  5HS7 A;  2CUJ A;  4ZYH A;  3ZN0 A;  1D1A A;  2DBB A;  4MLO A;  1SMY F;  3L2Q A;  2FJ1 A;  3K4N A;  2DFF A;  3WTZ A;  3BR0 A;  4CYC A;  4HX4 A;  2ZJP F;  5DDG A;  4C2T A;  1MMN A;  3J81 K;  3HOZ J;  3E5U A;  3ESW B;  1GT0 C;  4NC8 A;  3GXO A;  3PIO F;  2X6W A;  2Z16 A;  3KP7 A;  3WHC A;  3OOU A;  2KZV A;  3TED A;  4E7S A;  2Y0S A;  4WX9 A;  1EJ9 A;  2DA1 A;  3RCO A;  3HRU A;  2DFI A;  4PZJ A;  4YII A;  1OCO H;  2R7F A;  1Z9C A;  3FMR A;  4BXF A;  1I39 A;  3O8H A;  1G8X A;  2PJP A;  2P0W A;  2PI0 A;  3BTC A;  2KIF A;  1C0W A;  1WVR A;  1VQO I;  1TNS A;  3BPV A;  4WK8 F;  2R7X A;  5E17 F;  2LDU A;  2DFH A;  1OFC X;  3MD2 A;  3F6V A;  3Q5F A;  3CTA A;  4P9U A;  4ZDO A;  2GOM A;  2DMT A;  4UUS B;  3V42 A;  2CG4 A;  4UV9 A;  4IX7 A;  1R7J A;  2P7V B;  1IV8 A;  4GYI A;  2DMP A;  2QVO A;  2XRN A;  2KRF A;  3KZY A;  2K3F A;  4S05 A;  3I5U A;  3HOY J;  5ICC A;  3ABU A;  3U21 A;  1Q1H A;  4V2G A;  2VBY A;  2A6H F;  2M4K A;  1O3Q A;  2ISY A;  2BZT A;  2WTE A;  2AO9 A;  4EV0 A;  3Q0U A;  2CFO A;  3FWE A;  4U0Y A;  5CQG A;  2B63 J;  4EGY A;  1VQ9 I;  4IHW A;  2Z1D A;  3F3X A;  4RA2 A;  3S3M A;  3ECH A;  3LQQ A;  5ILU A;  5HLH A;  1D8K A;  1YTY A;  2W48 A;  2F4M B;  3MZY A;  1R1V A;  4OIP F;  5JR3 A;  1BR2 A;  1HC8 A;  3QWL A;  1GLN A;  1V5E A;  1OJL A;  2GAU A;  2R7R A;  1W7P A;  3CME I;  1WHU A;  5LGU A;  4XOP A;  2X51 A;  4YEJ A;  1VQ5 I;  3A2K A;  4RGS A;  1NTC A;  3BTI A;  3CJR B;  2PJR A;  3E6D A;  2E36 A;  3DKW A;  1W7P B;  3E5Q A;  3HJE A;  3PNT A;  3HG9 A;  5BNG A;  2E19 A;  1WWX A;  2VKD A;  1MSF C;  4KN7 X;  3G4S I;  2IS1 A;  4G7Z F;  1LVA A;  4UVA A;  5LRR A;  3VWB A;  5E18 F;  1CF7 B;  1ZH5 A;  3QYE A;  2VUM J;  1ZRE A;  3B6C A;  2V7F A;  2MC4 A;  2FSW A;  4LIT A;  3QOP A;  3IV5 A;  4HLY A;  5EEH A;  4PSW A;  2G9W A;  3RQ4 A;  1FLI A;  1BI1 A;  2G7H A;  4XL9 A;  5FLM J;  1I6H J;  4PGH A;  5GAH J;  3LAJ A;  2F6C A;  5HLI A;  1XB4 A;  3TO6 A;  3BP8 A;  3L1P A;  1OCT C;  4A3D J;  4GGG A;  4DGW B;  2L4M A;  2HQ5 A;  3QOE A;  3VSL A;  3HPG A;  1WQ2 A;  3V8K A;  4ZTF A;  2K86 A;  4HZF A;  1NK2 P;  2K9Q A;  3WTW C;  2E71 A;  3IP4 B;  4BNC A;  4BGD A;  3JTH A;  3FXU A;  4M73 A;  5TGT A;  2GQQ A;  4CH7 A;  4PGG A;  3EYY A;  4OIN F;  1MZB A;  3F8C A;  2Z9O A;  2M30 A;  3ZMU A;  4ENJ A;  1SVL A;  3GW2 A;  2LP0 A;  5FKM A;  2UUZ A;  3FXM A;  1IN8 A;  3TP0 A;  4AUX A;  2VIX A;  3M8E A;  1WRJ A;  5E3N A;  1LPQ A;  3C3W A;  3D1N I;  1UHS A;  4G12 A;  3MZ8 A;  3R4K A;  1E2X A;  5DCF A;  2NOG A;  2TDX A;  5LGN A;  2A5Y B;  3DEE A;  1ACI A;  4MTE A;  3DLA A;  3PIP F;  4NQW A;  4HSR A;  4O5V A;  3CD6 I;  3BG6 A;  3H1C A;  3VOE A;  2XKP A;  3DLL F;  5E1Z B;  3TOA A;  2GXA A;  4A5N A;  3GZ6 A;  4OAZ A;  3E6M A;  3BJ6 A;  2BY0 A;  2V6C A;  4KNY A;  4IOC F;  3RI4 A;  1OYY A;  2JJ7 A;  1YS7 A;  2CRG A;  2LSO A;  4U0W A;  5HS9 A;  3RIR A;  3GX4 X;  1OIS A;  3S1M J;  1S29 A;  2XAH A;  1MBH A;  1VQ7 I;  1NG7 A;  2VKH A;  4F91 B;  2CQN A;  4KIC A;  4ON0 A;  1A04 A;  1STZ A;  1YX5 A;  2CU7 A;  2LRD A;  2R7Z J;  1LQ1 A;  3O3K A;  2E1O A;  2Y75 A;  2CUF A;  3HGY A;  3H5A A;  2DMQ A;  1MKM A;  3HOV J;  2IW5 A;  2OU2 A;  2BE5 F;  1RC9 A;  1S7E A;  4BE2 A;  3IC7 A;  5DV5 A;  2Z33 A;  3GTP J;  1LEA A;  1XC5 A;  1MMA A;  4IO9 F;  1UJ8 A;  1U6G A;  5CVU A;  4DW6 A;  1I5Z A;  1X58 A;  5FRN A;  1YW8 A;  2EIN H;  4JBA A;  1MBK A;  2GXG A;  3DKX A;  1TNT A;  2OD5 A;  4XKV A;  5K5R A;  3QRF F;  5IY5 H;  4PCQ A;  5KNL A;  4NUB A;  4RB3 C;  2KPM A;  3OYH A;  2BEO A;  4XLN F;  4X1E A;  2HR3 A;  3PUB A;  3DBR B;  4IHX A;  2L9R A;  3FDY A;  4UV8 A;  1TP4 A;  4BY7 J;  3G2B A;  4KIB A;  4IPA A;  4A3F J;  5LHI A;  1HA8 A;  5M5Y J;  3CCL I;  4ESJ A;  2M5W A;  3OR2 C;  1R4M B;  3NWS A;  3UKG A;  5FLV A;  4PJN A;  2A6E F;  3RKX A;  3IH2 A;  3KP4 A;  1RPW A;  4CCJ A;  2QGU A;  4UUV A;  4R79 A;  1PP8 F;  4PJM A;  5M3M J;  3FIS A;  1IW7 F;  2VE8 A;  2CO5 A;  3VDX A;  1SAU A;  3LSI A;  1TBX A;  2LKP A;  1DP7 P;  3J7A Y;  1QVT A;  3ASO H;  2Z2S B;  4QIW N;  1R22 A;  4R8H A;  5K1Y A;  3T8R A;  3R0A A;  1UB9 A;  4A3J J;  3Q3S A;  2QEX I;  2RRE A;  2HNH A;  5M3F J;  2R7S A;  5J4V A;  3GYH X;  4JX5 A;  4LB6 B;  2Q0O A;  3QP5 A;  3TL4 X;  4ZZL A;  2UZK A;  5DCM A;  4JYK A;  1V5G A;  1P4W A;  3CC7 I;  3B6A A;  2UXX A;  3CQZ J;  2ELK A;  2A05 A;  2JTV A;  2X4H A;  1HBX G;  2LKS A;  1QPI A;  4KIG A;  1H8A C;  1EH8 A;  3PSF A;  3IRR A;  3MVP A;  1MW7 A;  1KZH A;  2X9D A;  5CQE A;  2W24 A;  4B48 A;  5L3D A;  3FXL A;  3OYA A;  1IDY A;  2CUE A;  5M5W J;  2XDV A;  1QVU A;  1IRF A;  2JT1 A;  2VAS A;  4BBR J;  1OMI A;  3BQY A;  4XK4 A;  3ECO A;  4ZC3 A;  3I53 A;  5D8L B;  1MD0 A;  5CVI A;  1VQ8 I;  3W2V A;  4CUG A;  4MHG A;  2PQ8 A;  3PQJ A;  2JA8 J;  1FPQ A;  3PNV A;  2XRO A;  2YUS A;  2DT5 A;  2L5Q A;  2D45 A;  5CYV A;  2AXL A;  1VQ6 I;  4CIC A;  3CES A;  3GFI A;  3X2Q H;  4HX8 A;  1QHG A;  3AFH A;  2WBM A;  4E7L A;  1K6Y A;  1F5T A;  2KIU A;  2R7T A;  4XRM A;  1JT0 A;  3ZOB A;  3JAM K;  1P2F A;  1XS9 A;  3VEP A;  1H9G A;  3M1C A;  4CZC A;  3K1P A;  3E3V A;  2HOT A;  2HTS A;  2LY2 A;  2O8X A;  3HIF A;  4DBR A;  1QZY A;  1UFM A;  1JGS A;  1ORK A;  3K2A A;  3V7C A;  2HYJ A;  2BW3 B;  3VYT B;  1GVD A;  1IUF A;  3A4C A;  3VYR B;  1HDP A;  2BHZ A;  4HF1 A;  5EGO B;  4S04 A;  2DPD A;  2BVL A;  3CCE I;  1A6Q A;  1LFP A;  1PJR A;  3H0G J;  1GXQ A;  4KIT B;  3BDD A;  4DBQ A;  3HHG A;  1B8I B;  4LLN A;  2JSP A;  1EH7 A;  2R0Q C;  2IAI A;  2QKL B;  2M4G A;  2ZB9 A;  2ZME C;  3F8B A;  1ON2 A;  5FLX K;  4XN3 A;  2M7B A;  1UHW A;  2EIK H;  3U9G A;  4NB5 A;  1T39 A;  5FD5 A;  2FF4 A;  3Q9S A;  4QSH A;  2E2H J;  3MN2 A;  4OOI A;  4G94 A;  4LIU A;  3ZP5 A;  4Q47 A;  2JUC A;  2F5F A;  3S2D J;  4Y3O A;  1QQI A;  3CJQ B;  1O7F A;  5ICE A;  5FFZ A;  3QPS A;  3BRO A;  3DBL B;  1X1D A;  5FKN A;  3CCQ I;  4D5F A;  2M7A A;  1ERD A;  4TV7 A;  2HDD A;  2DLL A;  2QBY B;  2QZ8 A;  1SFO J;  3SEZ A;  4BH9 A;  1ZLJ A;  3RZO J;  3ZMS A;  3HC7 A;  4IRG A;  4LFU A;  3SZT A;  3SFZ A;  1FZP B;  3CJN A;  3R0J A;  2COM A;  3KYC B;  2RC4 A;  1ZTR A;  5F1R A;  3TP3 A;  5J4Y A;  1ZRF A;  1R71 A;  1DU0 A;  1X3Z B;  4BQQ A;  3I64 A;  1REP C;  3CF2 A;  3CMM A;  4A3K J;  1UZC A;  1WJF A;  4NNJ A;  1O3S A;  3HOU J;  1W5C C;  3LNQ A;  3K70 C;  3AL0 B;  5LHG A;  4CZZ A;  2H94 A;  1LB2 A;  2WY8 Q;  1ENH A;  3WE2 A;  3O2P E;  1K7A A;  2ESH A;  2CUZ A;  4AC0 A;  1B8I A;  3RKW A;  4J19 A;  1HXD A;  1S8N A;  3GCM A;  1PYV A;  2IBD A;  1X4P A;  2OTL I;  1XGM A;  5B1A H;  1IAW A;  1J7K A;  1OCR H;  1MBE A;  3CCY A;  2ZSI B;  2QUF A;  5C4J J;  1F9N A;  2BBY A;  3ABL H;  2VPR A;  1MNM C;  5IOY A;  1YJW I;  4GDF A;  3MEX A;  2NNY A;  4XLA A;  1JKO C;  5HDG A;  3RYR A;  1RIO H;  1JE8 A;  1Y6I A;  2PX9 A;  5BQT A;  1U78 A;  4L9T A;  1SD7 A;  2LMD A;  1BW5 A;  2ZC2 A;  2LFB A;  4E6K G;  5IP9 J;  2B0L A;  2FX0 A;  3FXQ A;  2R5Y B;  2O61 A;  5E20 A;  1EKE A;  2M3A A;  2L7M P;  3S93 A;  2XAS A;  2HEO A;  1ZYR F;  2BY1 A;  4PSX A;  4BDY A;  3W2A A;  2Y31 A;  3A03 A;  3IUO A;  5AIQ A;  4M3G A;  3J7Z I;  4A0Z A;  4BHB A;  1YOV B;  2HZD A;  3GME A;  4KN4 X;  1IRX A;  4II3 A;  3RPQ A;  4I7H A;  5H2F C;  4AYB N;  3KEO A;  4RB1 A;  3JCU C;  4IRI A;  4IHV A;  3I4M J;  1J5Y A;  2EH3 A;  4M6V A;  1P7J A;  5BPD A;  2ZSH B;  2CV0 A;  4F3Q A;  4QTR A;  3AG3 H;  3E5X A;  4A0X A;  3VSK A;  4HDV A;  2KQR A;  4DJA A;  2PJR B;  4L9V A;  4XLF A;  5CLS A;  5K5Q A;  1N78 A;  5E1X A;  1LFU P;  4P9F A;  2F4O B;  2XVC A;  1T95 A;  3WG7 H;  2OQG A;  4E70 A;  4EAT A;  4AVZ A;  2FXA A;  1YIO A;  1YLF A;  2L7Z A;  2PLY A;  3GTL J;  2RQQ A;  4UHT A;  2Z3Y A;  1U5T C;  2VOD A;  2EFO A;  4EJV A;  5JLX A;  3ZMZ A;  3BLY A;  1J0R A;  2Y30 A;  1B72 B;  3SFI A;  1WJC A;  3WTU C;  1G3S A;  3BY6 A;  3L2W A;  2RDP A;  4N9I A;  4B43 A;  1ZGJ A;  5F0F A;  2OBP A;  2PBI A;  2DPU A;  4WCG A;  4V2F A;  2O6G E;  1QGP A;  1MMS A;  1K4S A;  1S72 I;  1POG A;  3KP6 A;  1F36 A;  1JUS A;  2L9N A;  4NBQ A;  1XN7 A;  4UB6 C;  3BG7 A;  1TZL A;  3A0B C;  3ZRG A;  2MFZ A;  3C7J A;  2OA4 A;  1JTY A;  2WY7 Q;  1ETQ A;  2LK2 A;  2ME6 A;  3ZQC A;  3MAJ A;  3K1N A;  1G4D A;  1L3L A;  1X3U A;  3C1D A;  2EK5 A;  4RGU A;  5HS8 A;  4CCO A;  5J1R A;  4RS8 A;  3TGN A;  2JRT A;  4E4H A;  5DM6 F;  4I99 C;  3ZQI A;  2FQ3 A;  3HKZ N;  1Z05 A;  4KUM A;  1Z77 A;  3NAU A;  3CO6 C;  2VBZ A;  2ACJ A;  4JOM A;  2DQL A;  4FX4 A;  2FBI A;  3OYC A;  3KET A;  2YS9 A;  4R1H A;  4RLQ A;  1IN5 A;  2D1H A;  1P4A A;  1X3W B;  2RVC A;  1H0M A;  1HCR A;  4I0B A;  1Z6R A;  2A68 F;  4ESF A;  5DCM B;  2NYX A;  4L9N A;  2H09 A;  3K2Z A;  3MKL A;  3OYJ A;  2O03 A;  4IVN A;  2DA7 A;  2XSD C;  3WU2 C;  3IWZ A;  1QA6 A;  3CUQ B;  2HDW A;  4EJO A;  2DI3 A;  4AU7 A;  2H8R A;  1GXP A;  2K9S A;  2QSH X;  2EV6 A;  3LQR A;  3MKW B;  3K1M A;  1YW9 A;  5D4R A;  4C2M J;  2EIM H;  2I10 A;  5K5O A;  3ZPL A;  1D5Y A;  2M45 A;  4IEJ A;  1LDJ A;  5D6E A;  4OIR F;  3L2V A;  3S1R J;  1WZ2 A;  2M0M A;  2E7X A;  3G71 I;  2XF5 A;  1GV2 A;  3LOC A;  1TWA J;  4B4C A;  5BOX A;  1FMW A;  2LTP A;  4FQG A;  3DCF A;  3FIW A;  1XDS A;  3FX3 A;  3WGG A;  3QPH A;  3I3L A;  1OPC A;  4XSX F;  1R00 A;  1YHQ I;  3CC4 I;  3QQA A;  1IJW C;  3BZ6 A;  1JJ8 C;  2O9L A;  2KDZ A;  2ISZ A;  1MSE C;  4MFD A;  1Z1D A;  4II2 A;  4GFB A;  3PO3 J;  2TCT A;  2GIV A;  1SAX A;  2X1D A;  2ZBK A;  5LEK A;  2DOA A;  1X19 A;  4KA4 A;  4G7O F;  5FO5 A;  5M5X J;  3L7W A;  3OR1 C;  2V1D A;  3NWT A;  3CCV I;  3V7R A;  4C2U A;  1S6L A;  1ZG1 A;  1Z3Y A;  2IPQ X;  2YPR A;  2H6C A;  2ME0 A;  2CV2 A;  1RR8 C;  3HSR A;  1YI2 I;  3ERE D;  3FMQ A;  4J00 A;  3KYD B;  1U2W A;  3KZZ A;  3B73 A;  3O8G A;  1K4T A;  3GZN B;  3KE2 A;  2PG4 A;  2CJJ A;  2X6X A;  1D1B A;  2WC2 A;  2XHK A;  1ZR2 A;  4XQF A;  3DEU A;  2ZXI A;  3HB9 A;  1UHM A;  1A6I A;  4UVC A;  1SFK A;  2KT0 A;  3RZD J;  3T1B A;  1Y0N A;  3JRB A;  1O57 A;  2EFW A;  2WB1 N;  3JR9 A;  3ZMT A;  3FBI B;  3KPH A;  3BG5 A;  4BAY A;  3TBI A;  5LRS A;  5ED4 A;  2QSF X;  3K4L A;  3GF2 A;  4U87 A;  5GPC A;  1EH6 A;  3ML6 A;  1MMD A;  3LMM A;  4PJJ A;  1HQC A;  4LG3 A;  4BL0 B;  2DN0 A;  2DOD A;  3FM5 A;  5GAE J;  2ID3 A;  2X6Y A;  4ZYD A;  4EVI A;  2NVX J;  1CGP A;  2VBX A;  4KJZ A;  3ZQQ A;  1TWH J;  2KJC A;  4XON A;  5EGO A;  1U9N A;  5A2Q Z;  4HLX A;  5JVT A;  4BDZ A;  2HXO A;  1JHH A;  4B3A A;  5GAG J;  1U3E M;  1EF4 A;  1K78 B;  5F27 A;  3GBG A;  5F1J A;  1ZKG A;  1P7I A;  2LLK A;  2WAQ N;  3I54 A;  4XOT A;  3JRD A;  3CCR I;  2VJI A;  3PJR A;  4ZDL A;  4Q4Z F;  4F52 A;  3TQN A;  5DD8 A;  2JZY A;  2JUG A;  3LWF A;  2XV4 S;  1O4X A;  3JSO A;  2RGV A;  5AIP A;  2NXN B;  3PQK A;  1K79 A;  4HAM A;  3DTE A;  1JGG A;  4AD9 A;  1EV7 A;  5J47 A;  2LF7 A;  2DT6 A;  5B5E C;  4DIQ A;  5F0H A;  4MO7 A;  5JFR A;  1DU6 A;  2MLG A;  5IT9 Z;  1FX7 A;  1SVM A;  2L3D A;  3HSE A;  4BQN A;  5DUK A;  2A6T A;  4LLL A;  1XGO A;  5B66 C;  2F5E A;  4CXF A;  4L9J A;  1TWC J;  4IF4 A;  3DP7 A;  5E8G A;  2W82 A;  3SZP A;  4YFN F;  4U88 A;  1ETY A;  2IS4 A;  2XPU A;  2K9M A;  3HTU A;  2QSG X;  1CQT A;  1TWG J;  1ZG5 A;  2JA7 J;  2EFP A;  3DU6 A;  3BCB A;  2QCO A;  2ZNY A;  4P1W A;  2R93 J;  2MGQ A;  1U5T A;  2Y69 H;  3JRE A;  4HYE A;  2DDA A;  2HXI A;  2JVH A;  3EPZ A;  2VLA A;  2ZJQ F;  1VQL I;  3DBH B;  5BMZ A;  3JRA A;  2FE3 A;  1KA8 A;  2EWN A;  3EUA A;  5BS6 A;  3H9Q A;  3CDL A;  2ZKZ A;  4YEL A;  2AQE A;  4CHU A;  1TQI A;  2WV1 A;  2X85 A;  5D5U B;  2Q1Z B;  2HPI A;  1R36 A;  1MGT A;  1WJA A;  3EET A;  4GO1 A;  2L7K A;  1D3Y A;  2R3S A;  3KX2 A;  4I2O A;  2O0Y A;  4M6Y A;  1XTA A;  3SQN A;  4V19 K;  1MNE A;  4EJU A;  3KFW X;  2DA6 A;  1LE8 A;  5D6F A;  4YRV A;  3HEF A;  4Y17 A;  2BW3 A;  5GP9 A;  1TQP A;  2JWT A;  3PM1 A;  4RGX A;  2V9V A;  1WH7 A;  2EV0 A;  3TO9 A;  1SFE A;  2C6Y A;  2IVM A;  3GTK J;  2K3P A;  3E6B A;  1XMX A;  1BI3 A;  1R9T J;  2W85 A;  3GTG J;  1Z7L A;  1KGS A;  4F92 B;  1Z0X A;  2E60 A;  1T38 A;  3LSJ A;  3E1S A;  3K4B A;  1O3T A;  1MJ9 A;  2YU3 A;  2FRH A;  1SEU A;  3E6C C;  1FMV A;  5B3S H;  1HKQ A;  3SJM A;  4BY1 J;  2DMU A;  2WV0 A;  1L0O C;  3DTK A;  1ZGW A;  4BXX J;  1RNL A;  4BS9 A;  1PUE E;  3OV8 A;  2W7N A;  3D5R C;  1AKH A;  5D5X B;  1X4O A;  4HG2 A;  2MW8 A;  5JLW A;  3P7N A;  2VQH A;  4PK4 A;  3RKQ A;  2H1K A;  2Q2E B;  2FA5 A;  4S0H B;  3S15 J;  3TW7 A;  1UG0 A;  4LB5 A;  1FP1 D;  2NOJ B;  2GA2 A;  2Y0M A;  5HLG A;  1ZG3 A;  2DA2 A;  4E7K A;  4GCV A;  4B09 A;  1OCP A;  4BYY A;  1HF0 A;  1V3F A;  3VB2 A;  3WTT C;  1P4X A;  1QZZ A;  2XGE A;  2STT A;  1HW5 A;  1FBS A;  4XIC A;  1UST A;  3ZGK A;  1ITY A;  1IG7 A;  1R5I D;  1W7P D;  4BHC A;  3L2R A;  2EZK A;  4ZTJ A;  3OWT A;  2M0C A;  5L3E A;  3BWG A;  3VPR A;  2CV1 A;  1IXC A;  4BJ6 C;  3W6V A;  1PP7 U;  1UCR A;  1NHA A;  3RQI A;  2W4S A;  2XRL A;  4BBS J;  3RTR A;  4CA0 A;  2VJJ A;  3HOT A;  3PFY A;  4XRS G;  3J80 Z;  4KIS A;  2HWV A;  4BUP A;  2V1X A;  4A3I J;  2LD5 A;  3KLN A;  2HZT A;  1YW7 A;  2VT3 A;  4D1Q A;  4E7Z A;  1YRN A;  3HOS A;  5TRD A;  2A61 A;  2CFX A;  2QA4 I;  2EZL A;  2EA4 A;  1W0U A;  1ETX A;  3PNY A;  4D7M A;  2WAQ A;  1FTT A;  1W1W E;  4HPQ A;  3DTI A;  1RKT A;  3FXO A;  2XGC A;  1O3R A;  1T08 B;  1IGN A;  5K7Z A;  2OTJ I;  3AKZ A;  4A3C J;  3TDZ C;  2MH2 A;  2ECB A;  4XN0 A;  2L9V A;  1YG2 A;  4EGZ A;  4HRI A;  1BN5 A;  4I09 A;  4DYC A;  1GHC A;  2LNB A;  2HYF A;  2NS8 A;  4MQV A;  3RJP A;  4Q48 A;  5E79 C;  1JXS A;  2CS3 A;  2W25 A;  1AHD P;  2DK5 A;  2L9S A;  1I3Q J;  1P6R A;  4BHP A;  4A5M A;  4ZYG A;  3ZCO A;  4YG2 F;  1AOY A;  5EYR A;  4RAZ A;  3ISP A;  2P6S A;  3IAM 2;  3I71 A;  2NVY J;  3FXK A;  3OS1 A;  2CWE A;  5J1Y A;  5TJJ A;  4XRF A;  2DXI A;  3NRV A;  3DV8 A;  1DDN A;  1MND A;  2W84 A;  3WU1 B;  2UV1 A;  3SDG A;  2CW7 A;  3Q9V A;  2XIG A;  3AG2 H;  1O7L A;  5IYD J;  2VQL A;  1QU3 A;  2RNJ A;  2ZME B;  4A69 C;  1DGW Y;  1JJ6 C;  1FC3 A;  1BJZ A;  1HOM A;  2K02 A;  4HX7 A;  5ILS A;  2CSO A;  2YX7 A;  2DYR H;  3HPH A;  2A07 F;  4N0B A;  1OQY A;  1BOB A;  1QPM A;  4XLE A;  1A36 A;  2X48 A;  5HOD A;  3G1M A;  3I59 B;  3U2R A;  1AWC A;  5D8K B;  2PMH A;  1MH3 A;  1FYM A;  2HPM A;  4G6T B;  1YO5 C;  2ZXW H;  3N05 A;  4C3I J;  2E5N A;  5L3C A;  1X1C A;  4HV6 A;  5DEQ A;  2VC0 A;  5B1B H;  4AM3 A;  2MC3 A;  1QNT A;  5CVJ A;  3I58 A;  2NS0 A;  1B1B A;  3GTQ J;  2ZJ2 A;  2LOO A;  1FOX A;  1YS6 A;  4AVP A;  3OIO A;  4D0P A;  3BT9 A;  2R7Q A;  5LLQ A;  2MSY A;  1R49 A;  1RI7 A;  3BR5 A;  1FOK A;  2JQ7 A;  5DM7 F;  1DUX C;  3WG9 A;  3RYP A;  3H92 A;  4C30 A;  2GM4 A;  1I50 J;  1Y8Q B;  4GRI A;  2YU9 J;  4DYQ A;  3S3N A;  5E3M A;  1Y8R B;  5IPA A;  5IOZ A;  3BCA A;  4HW0 A;  4I01 A;  3L2C A;  1J09 A;  4L5I A;  1B9M A;  1BOA A;  1QZE A;  3FF5 A;  4RB2 C;  2E1M B;  3QU3 A;  3QOD A;  2V1U A;  1Y0U A;  4IKF A;  2KLO A;  2MH9 A;  5IP7 J;  3MKZ A;  1VTN C;  1ON1 A;  3ABM H;  1MJA A;  3MCZ A;  2XUB A;  2PEX A;  5DTD A;  2L2O A;  2B7E A;  2DAO A;  2EFQ A;  1VI0 A;  2PMU A;  3TDU C;  4RGR A;  3T0Y A;  2EIL H;  1WSU A;  1A31 A;  3MKY B;  2AS5 F;  1TWF J;  4XID A;  1WJB A;  2D5V A;  2CQX A;  3TKY A;  4CCL A;  1R1U A;  3S2H J;  2TRT A;  1DQU A;  3ABT A;  1SVO A;  4LGW A;  1G6N A;  3GFJ A;  2BHY A;  5DYM A;  4HOB A;  1YYV A; 
#chains in the Genus database with same CATH homology
 2P8T A;  4M9S A;  3M8F A;  2MD5 A;  2ELH A;  4O3M A;  1D8J A;  2NNN A;  5D5W B;  5LEJ A;  2FOK A;  3MQ0 A;  4L18 B;  1BC7 C;  1KU9 A;  3M7G A;  3F22 A;  1KYZ A;  1TTY A;  5HVQ C;  3ZMD A;  3L00 A;  3F8M A;  3ULQ B;  2RV8 A;  3F72 A;  4M74 A;  4G7H F;  2HYG D;  3EYI A;  4UXN A;  3V4G A;  1K6O A;  3EUH A;  2NAZ A;  2E1C A;  3LFK A;  4Z2Y A;  3D0S A;  3IHU A;  1ONV A;  3BJA A;  3EQL F;  3V8L A;  3F23 A;  4U7B A;  4FHT A;  3N4M A;  1I1S A;  2VOP A;  5A2Q K;  2IRF G;  4ZYE A;  5E1W A;  1ZGA A;  2L4A A;  3T5X A;  4CGZ A;  2FNP A;  3CUQ C;  5DD4 A;  4MEX F;  2O3F A;  4A6E A;  2OZ6 A;  4KDP A;  2JPC A;  2J5O A;  1HW2 A;  3LA3 A;  1G3Y A;  3QPT A;  5D5V B;  1USS A;  4IXA A;  3F8N A;  4M9X A;  3LST A;  1YFH A;  4H0E A;  3HUG A;  2VOO A;  5IT9 K;  4LLG F;  4ENM A;  2G7U A;  3FMS A;  4M72 A;  3WOD F;  1BI2 A;  5AON A;  3VFZ A;  4K2E A;  2DK8 A;  2ZO4 A;  2R7D A;  4LG0 B;  1IF1 A;  3RKY A;  3HYI A;  2EJR A;  3R60 A;  3K0L A;  5E8I A;  2FML A;  2WWY A;  3V7S A;  4Y13 A;  2Y48 A;  1XDU A;  4EJT A;  3NQO A;  4FX0 A;  2RQP A;  1XMK A;  4A0Y A;  1FY7 A;  2HTJ A;  2H27 A;  2XAJ A;  2F2E A;  4ETS A;  5D4S A;  4A12 A;  1QBJ A;  3RDI A;  3RPU A;  1LEB A;  2FU4 A;  1KU2 A;  1XCB A;  3CLO A;  4AIK A;  1SD5 A;  4DQ2 A;  4UNO A;  1KU7 A;  2FBK A;  4JQF A;  2P7C B;  1R58 A;  5FD6 A;  4P55 A;  2D2W A;  1FSH A;  1KQ0 A;  1V4R A;  3D5L A;  2P5K A;  3R61 A;  4HA8 A;  4JK1 X;  1IXS B;  3U1D A;  5ERI A;  3H3Z A;  3W6J B;  6PAX A;  4ESB A;  3VOD A;  1W5S A;  4MTD A;  3I4P A;  1ZN2 A;  4CO8 A;  1F1Z A;  2VBW A;  3P9K A;  3H3U A;  5H20 A;  2FMY A;  3QP6 A;  4M71 A;  1BI0 A;  3IKT A;  2GZW A;  2QQB A;  4O6J A;  5FGM A;  5F6F A;  4BQA A;  1FNN A;  2ZFW A;  3TOB A;  2W57 A;  4NHJ A;  1QO0 D;  3EDP A;  4EM2 A;  4ZZD A;  1K78 A;  3FXR A;  3GFM A;  4HQM A;  1KQ8 A;  2L54 A;  1J9I A;  1R1T A;  3KCC A;  3KP5 A;  3JSP A;  4EM1 A;  4MGR A;  2BYV E;  5KK1 A;  1ZRD A;  1KYW A;  1XSD A;  2YSR A;  3WTX C;  3J81 Z;  2J5P A;  1U5T B;  5H6R A;  3E97 A;  3PFI A;  1B9N A;  1BIB A;  2QYO A;  1ZHF A;  2A3S A;  5ICF A;  2ESN A;  4YFX F;  4EM0 B;  1HW1 A;  2E7W A;  4GXO A;  1HKS A;  2DU9 A;  4WXD A;  5FB2 A;  1OR7 A;  2PFB A;  4G9Y A;  3J80 K;  3DQV C;  1TLH B;  3HTS B;  1SD6 A;  5J8F A;  2IT0 A;  4RB0 A;  1TW2 A;  1Z7U A;  2XAQ A;  4PDK A;  3N97 A;  1IUY A;  2LF8 A;  2YR2 A;  1SMT A;  2IA1 A;  1BBY A;  1KQ9 A;  1IN7 A;  1I27 A;  2DO7 A;  2RKH A;  4RAY A;  2STW A;  4WXH A;  1FP2 A;  4G6Q A;  4KMU X;  2IP2 A;  1FYL A;  4KFC A;  1MDM B;  1IZ1 A;  1XSV A;  4KMF A;  3GLX A;  3DPT A;  3AAF A;  2OQR A;  3WTV C;  3QAH A;  1RUN A;  5CVR A;  4OMZ A;  2H6B A;  1HKT A;  1MDM A;  1G3T A;  3F21 A;  4GYG A;  1I1G A;  1I6X A;  2FEZ A;  1OYW A;  3LA2 A;  4I02 A;  4YFK F;  5HDN A;  4HQE A;  4FT8 A;  1R5H A;  3WE3 A;  3W6K B;  3CDH A;  3HSF A;  2P5L C;  3GZ5 A;  1LNW A;  3KEQ A;  4LMY A;  3GFL A;  3WTY C;  5CVV A;  1R23 A;  1JHF A;  2XAF A;  4HBL A;  1HST A;  1KU3 A;  3FM3 A;  2F5D A;  1ODD A;  4BXU A;  2DW4 A;  4I0A A;  5L3F A;  5LBQ A;  3DPL C;  1BM9 A;  2Z99 A;  2Z5U A;  1IRG A;  4MNU A;  1DPU A;  3I59 A;  2CYY A;  2FNA A;  3GWZ A;  1P92 A;  2VC1 A;  2K4J A;  1TQM A;  1T0F A;  3LA7 A;  4L0Y B;  1XMA A;  2M8E A;  2ZME A;  4LK0 F;  1LJ9 A;  5J8C A;  2K7L A;  2ZXJ A;  5H6Q A;  2ZNZ A;  2ADU A;  2EFN A;  1PDN C;  3M9A A;  3WGH A;  3NEU A;  4P5O A;  4AIJ A;  2CW0 F;  4EMS A;  1TW3 A;  4YIF A;  4MEY F;  3WU0 A;  4UVB A;  1S7O A;  3LAP A;  4KT5 C;  4B8X A;  4N9H A;  3G73 A;  2YX4 A;  4CYD A;  3L9F A;  3V8J A;  4EQQ A;  2EA2 A;  3B02 A;  1ZAR A;  2HKX A;  3SXY A;  4WWC A;  2QBY A;  1FBU A;  3OOP A;  4HDU A;  3BOQ A;  5IT3 A;  2HQR A;  4OIO F;  4AIH A;  4ENN A;  3HHH A;  3K69 A;  2FBH A;  2DQR A;  3BPX A;  3K9T A;  3IKV A;  3KP2 A;  1BC8 C;  3COA C;  2UWM A;  1BJA A;  1OKR A;  2ZCW A;  3T8T A;  3ZMV A;  4EJW A;  4IHT A;  1XGN A;  2GA1 A;  2P5V A;  2HS5 A;  2HDC A;  2QLZ A;  4HF0 A;  2OZU A;  2QQA A;  2JSC A;  4ZH4 F;  5L3G A;  4G6D A;  4G8X A;  2P4W A;  4WF2 A;  2UXN A;  4LG0 A;  3IL2 A;  2VN2 A;  2DTR A;  2P6T A;  2KJB A;  4LK1 F;  5KVR A;  2M1B A;  3MWM A;  2KIM A;  4XLP F;  2EV5 A;  3QU6 A;  2VT2 A;  4OU0 A;  2D1V A;  4Y15 A;  3ZQ7 A;  2E1N A;  3BJO A;  1S3J A;  2IJL A;  1XD7 A;  4LD5 A;  4L0Z B;  2MA3 A;  1XSX A;  2HKO A;  2MBF A;  3J7A O;  3ELK A;  3CUQ A;  3P9C A;  4KIF A;  1E17 A;  4MQ9 F;  5JI6 A;  1FBQ A;  1B6A A;  2CGP A;  2CQK A;  1HSJ A;  5L3B A;  3WGI A;  2HFH A;  3FHZ A;  5CJ9 A;  5EEG A;  4U7D A;  1IN6 A;  3C18 A;  1RZ4 A;  1R5G A;  4ASN A;  3P9I A;  4KYW A;  4HF2 A;  4L5J A;  3TO7 A;  3GVA A;  2IA2 A;  2QM3 A;  2VE9 A;  1IXR C;  3IRQ A;  1F4K A;  5LHH A;  2BV6 A;  3L09 A;  3ROU A;  1H9T A;  3GEZ A;  3M1E A;  1T98 A;  5ILV A;  3JTG A;  1W5T A;  1WI9 A;  4U0V A;  1RUO A;  2A69 F;  3DXJ F;  3CUO A;  3F6O A;  3S2W A;  3MFK A;  2XAG A;  1B59 A;  1U8R A;  2L01 A;  5BPI A;  1ZLK A;  1D5V A;  5DUI A;  3ZN1 A;  1FYK A;  4CDG A;  3I0T A;  4M6X A;  4OMY A;  1DPR A;  4DNC A;  5LGT A;  2K27 A;  3HRS A;  1J75 A;  3KP3 A;  1OYI A;  2Q8K A;  3G3Z A;  2QQ9 A;  2PN6 A;  1J59 A;  3SHF A;  4F7Z A;  1FT9 A;  3F8F A;  1SFU A;  1WKM A;  1Z91 A;  3HRT A;  3HRM A;  5J6X A;  4A2U A;  4A6D A;  1SD4 A;  3FZV A;  1ZRC A;  1GVJ A;  2XKO A;  3CO7 C;  2NRA C;  4ENK A;  2F5C A;  5ICG A;  2M87 A;  1FSE A;  1Z6T A;  2HGC A;  1XGS A;  2K4B A;  2BGC A;  4M9Z A;  1LDK B;  4Q5S F;  5HDK A;  2OAZ A;  2ETH A;  1ZAO A;  3R6S A;  4QWQ A;  2JPB A;  5FLX Z;  4XBF A;  4OIQ F;  1BIA A;  1LDD A;  5HOO A;  3REO A;  2Q2E A;  5F64 A;  2VON A;  4XSZ F;  2EB7 A;  4LJZ F;  2VXZ A;  3DF8 A;  2MLK A;  2L02 A;  3DFG A;  2HOE A;  3JAM Z;  3WTS C;  3GO5 A;  1T6S A;  2GXB A;  2KKO A;  2QWW A;  1SFX A;  3IWF A;  4HV5 A;  3GUD A;  1FWZ A;  1IN4 A;  1B4A A;  2XGX A;  4IHS A;  4IRH A;  2V79 A;  3KLO A;  2HQN A;  1J2X A;  1S7A A;  2RN7 A;  2IA0 A;  1XCV A;  5FFX A;  3MZH A;  4IJA A;  4QLC U;  2QEN A;  5JHU A;  1MJB A;  1W4M A;  1CF7 A;  1ULY A;  1G3W A;  1T2K A;  4WXC A;  4I98 B;  3JW4 A;  4P96 A;  2X0L A;  2GWR A;  3O6B B;  1YQA A;  5HS7 A;  4ZYH A;  3ZN0 A;  2DBB A;  1SMY F;  3WTZ A;  4HX4 A;  5DDG A;  3J81 K;  3E5U A;  3GXO A;  3KP7 A;  4WX9 A;  3HRU A;  2DFI A;  4PZJ A;  4YII A;  2R7F A;  1Z9C A;  3FMR A;  2PJP A;  2PI0 A;  2KIF A;  1C0W A;  1TNS A;  3BPV A;  4WK8 F;  5E17 F;  2LDU A;  3F6V A;  3Q5F A;  3CTA A;  4P9U A;  2CG4 A;  4UV9 A;  1R7J A;  2P7V B;  4GYI A;  2QVO A;  2XRN A;  2KRF A;  3KZY A;  4S05 A;  3I5U A;  5ICC A;  3ABU A;  1Q1H A;  2VBY A;  2A6H F;  1O3Q A;  2ISY A;  2WTE A;  4EV0 A;  3FWE A;  4U0Y A;  4EGY A;  3F3X A;  3ECH A;  3LQQ A;  5ILU A;  5HLH A;  1D8K A;  1YTY A;  3MZY A;  1R1V A;  4OIP F;  5JR3 A;  2GAU A;  1W7P A;  5LGU A;  4RGS A;  3E6D A;  3DKW A;  1W7P B;  3E5Q A;  1WWX A;  4KN7 X;  4G7Z F;  1LVA A;  5LRR A;  4UVA A;  5E18 F;  1CF7 B;  1ZH5 A;  1ZRE A;  2FSW A;  3QOP A;  4HLY A;  5EEH A;  1FLI A;  2G9W A;  1BI1 A;  2G7H A;  4PGH A;  3LAJ A;  5HLI A;  1XB4 A;  3TO6 A;  3BP8 A;  4GGG A;  2L4M A;  1WQ2 A;  3V8K A;  2K86 A;  4HZF A;  4BNC A;  3WTW C;  3JTH A;  3FXU A;  4M73 A;  2GQQ A;  4PGG A;  3EYY A;  4OIN F;  1MZB A;  3F8C A;  2Z9O A;  2M30 A;  3ZMU A;  4ENJ A;  3GW2 A;  1IN8 A;  3M8E A;  1WRJ A;  3C3W A;  3R4K A;  1E2X A;  5DCF A;  2TDX A;  5LGN A;  2A5Y B;  4MTE A;  4NQW A;  4O5V A;  3VOE A;  2XKP A;  5E1Z B;  3TOA A;  4A5N A;  3GZ6 A;  3E6M A;  3BJ6 A;  2V6C A;  4KNY A;  3RI4 A;  1OYY A;  1YS7 A;  2LSO A;  5HS9 A;  4U0W A;  3RIR A;  3GX4 X;  1S29 A;  2XAH A;  4KIC A;  4ON0 A;  1A04 A;  1STZ A;  1LQ1 A;  3O3K A;  2Y75 A;  1MKM A;  2IW5 A;  2OU2 A;  2BE5 F;  3IC7 A;  5DV5 A;  2Z33 A;  1LEA A;  1U6G A;  5CVU A;  1I5Z A;  1YW8 A;  4JBA A;  2GXG A;  1TNT A;  2OD5 A;  5K5R A;  3QRF F;  4PCQ A;  4RB3 C;  2BEO A;  4XLN F;  2HR3 A;  4UV8 A;  4KIB A;  4IPA A;  5LHI A;  4ESJ A;  2M5W A;  2A6E F;  3RKX A;  3KP4 A;  4UUV A;  4R79 A;  1PP8 F;  1IW7 F;  2VE8 A;  2CO5 A;  1TBX A;  2LKP A;  1DP7 P;  1R22 A;  4R8H A;  5K1Y A;  3T8R A;  3R0A A;  1UB9 A;  3GYH X;  4LB6 B;  2Q0O A;  3QP5 A;  4ZZL A;  2UZK A;  5DCM A;  1P4W A;  2UXX A;  2JTV A;  2X4H A;  1HBX G;  4KIG A;  1EH8 A;  3IRR A;  2W24 A;  5L3D A;  1IRF A;  2JT1 A;  1OMI A;  3ECO A;  3I53 A;  5D8L B;  1MD0 A;  5CVI A;  4MHG A;  2PQ8 A;  3PQJ A;  1FPQ A;  2XRO A;  2DT5 A;  2D45 A;  5CYV A;  2AXL A;  4CIC A;  3GFI A;  4HX8 A;  1F5T A;  2KIU A;  3JAM K;  1P2F A;  3VEP A;  1H9G A;  3K1P A;  3E3V A;  2HTS A;  2O8X A;  3HIF A;  1QZY A;  1UFM A;  1JGS A;  3V7C A;  4HF1 A;  4S04 A;  2DPD A;  1GXQ A;  3BDD A;  3HHG A;  4LLN A;  1EH7 A;  3F8B A;  1ON2 A;  5FLX K;  1UHW A;  3U9G A;  4NB5 A;  1T39 A;  5FD5 A;  2FF4 A;  3Q9S A;  4OOI A;  4G94 A;  3ZP5 A;  4Q47 A;  2F5F A;  1QQI A;  1O7F A;  5ICE A;  5FFZ A;  3BRO A;  4TV7 A;  2DLL A;  2QBY B;  2QZ8 A;  4BH9 A;  1ZLJ A;  3ZMS A;  4LFU A;  4IRG A;  3SZT A;  3SFZ A;  1FZP B;  3CJN A;  3R0J A;  2COM A;  2RC4 A;  5F1R A;  1ZRF A;  3I64 A;  1REP C;  1O3S A;  5LHG A;  4CZZ A;  1LB2 A;  2H94 A;  3WE2 A;  3O2P E;  1K7A A;  2ESH A;  3RKW A;  1HXD A;  1S8N A;  1XGM A;  1IAW A;  1J7K A;  2QUF A;  1F9N A;  2BBY A;  3MEX A;  2NNY A;  5HDG A;  3RYR A;  1RIO H;  1JE8 A;  5BQT A;  1U78 A;  4L9T A;  1SD7 A;  2B0L A;  3FXQ A;  2O61 A;  5E20 A;  2XAS A;  2HEO A;  1ZYR F;  5AIQ A;  4A0Z A;  4BHB A;  4KN4 X;  3RPQ A;  4I7H A;  3KEO A;  4RB1 A;  4IRI A;  1J5Y A;  5BPD A;  3E5X A;  4A0X A;  4HDV A;  4L9V A;  5CLS A;  5K5Q A;  5E1X A;  4P9F A;  2XVC A;  2OQG A;  4E70 A;  2FXA A;  1YIO A;  1YLF A;  2PLY A;  4UHT A;  2Z3Y A;  1U5T C;  2VOD A;  2EFO A;  4EJV A;  3ZMZ A;  1J0R A;  3WTU C;  1G3S A;  3BY6 A;  2RDP A;  4N9I A;  1ZGJ A;  2OBP A;  2PBI A;  2DPU A;  4WCG A;  2O6G E;  1QGP A;  3KP6 A;  1XN7 A;  3C7J A;  2OA4 A;  3MAJ A;  3K1N A;  1G4D A;  1L3L A;  1X3U A;  3C1D A;  2EK5 A;  4RGU A;  5HS8 A;  4RS8 A;  3TGN A;  2JRT A;  2FQ3 A;  1Z05 A;  4KUM A;  3CO6 C;  2VBZ A;  2ACJ A;  2DQL A;  4FX4 A;  2FBI A;  3KET A;  4R1H A;  1IN5 A;  2D1H A;  1P4A A;  2RVC A;  1H0M A;  4I0B A;  1Z6R A;  2A68 F;  4ESF A;  5DCM B;  2NYX A;  4L9N A;  2H09 A;  3K2Z A;  2O03 A;  4IVN A;  3IWZ A;  3CUQ B;  4EJO A;  2DI3 A;  1GXP A;  2EV6 A;  3LQR A;  3K1M A;  1YW9 A;  5D4R A;  5K5O A;  3ZPL A;  2M45 A;  5D6E A;  1LDJ A;  4OIR F;  2E7X A;  5BOX A;  1XDS A;  3FX3 A;  3WGG A;  3QPH A;  1OPC A;  4XSX F;  1R00 A;  3BZ6 A;  2ISZ A;  1Z1D A;  2GIV A;  1SAX A;  2ZBK A;  5LEK A;  4KA4 A;  4G7O F;  5FO5 A;  3L7W A;  2V1D A;  3V7R A;  1S6L A;  1ZG1 A;  2IPQ X;  2YPR A;  2H6C A;  3HSR A;  3ERE D;  3FMQ A;  1U2W A;  3KZZ A;  3B73 A;  3KE2 A;  2PG4 A;  2WC2 A;  2XHK A;  3DEU A;  1UHM A;  4UVC A;  3T1B A;  1O57 A;  2EFW A;  3ZMT A;  4BAY A;  5LRS A;  5ED4 A;  3GF2 A;  1EH6 A;  3ML6 A;  1HQC A;  3FM5 A;  4ZYD A;  4EVI A;  1CGP A;  2VBX A;  2KJC A;  5A2Q Z;  4HLX A;  5JVT A;  1JHH A;  1U3E M;  1K78 B;  3I54 A;  4Q4Z F;  3TQN A;  5DD8 A;  2JZY A;  3LWF A;  2XV4 S;  3JSO A;  2RGV A;  5AIP A;  3PQK A;  1K79 A;  4HAM A;  4AD9 A;  1EV7 A;  2LF7 A;  5JFR A;  2MLG A;  5IT9 Z;  1FX7 A;  2L3D A;  3HSE A;  5DUK A;  4LLL A;  1XGO A;  2F5E A;  4CXF A;  4L9J A;  4IF4 A;  3DP7 A;  5E8G A;  3SZP A;  4YFN F;  4U88 A;  3HTU A;  1ZG5 A;  2EFP A;  2ZNY A;  1U5T A;  4HYE A;  5BMZ A;  2FE3 A;  1KA8 A;  2EWN A;  5BS6 A;  2ZKZ A;  4CHU A;  1TQI A;  5D5U B;  1R36 A;  1MGT A;  3EET A;  4GO1 A;  1D3Y A;  2R3S A;  4I2O A;  2O0Y A;  4M6Y A;  3SQN A;  4EJU A;  3KFW X;  5D6F A;  4Y17 A;  1TQP A;  4RGX A;  2V9V A;  2EV0 A;  3TO9 A;  1SFE A;  2C6Y A;  2IVM A;  3E6B A;  1BI3 A;  2W85 A;  1KGS A;  1T38 A;  1O3T A;  1MJ9 A;  2YU3 A;  2FRH A;  3E6C C;  1HKQ A;  2WV0 A;  1L0O C;  1RNL A;  1PUE E;  3OV8 A;  5D5X B;  3P7N A;  2FA5 A;  4LB5 A;  1FP1 D;  2Y0M A;  2GA2 A;  5HLG A;  1ZG3 A;  4GCV A;  4B09 A;  4BYY A;  1V3F A;  3VB2 A;  3WTT C;  1P4X A;  1QZZ A;  2STT A;  1HW5 A;  1FBS A;  1UST A;  1W7P D;  4BHC A;  5L3E A;  3BWG A;  1IXC A;  1PP7 U;  1UCR A;  1NHA A;  3RTR A;  3HOT A;  3J80 Z;  2HWV A;  2V1X A;  3KLN A;  2HZT A;  1YW7 A;  2VT3 A;  3HOS A;  5TRD A;  2A61 A;  2CFX A;  2EA4 A;  1O3R A;  3TDZ C;  2MH2 A;  1YG2 A;  4EGZ A;  1BN5 A;  4I09 A;  1GHC A;  2LNB A;  2HYF A;  4MQV A;  3RJP A;  4Q48 A;  1JXS A;  2W25 A;  2DK5 A;  1P6R A;  4BHP A;  4A5M A;  4ZYG A;  4YG2 F;  1AOY A;  4RAZ A;  3ISP A;  2P6S A;  3I71 A;  2CWE A;  5TJJ A;  4XRF A;  3NRV A;  3DV8 A;  1DDN A;  2W84 A;  3WU1 B;  3Q9V A;  2XIG A;  1O7L A;  2RNJ A;  2ZME B;  1FC3 A;  2K02 A;  4HX7 A;  5ILS A;  2CSO A;  2YX7 A;  2A07 F;  4N0B A;  1QPM A;  3I59 B;  1AWC A;  3U2R A;  5D8K B;  2PMH A;  1FYM A;  1YO5 C;  5L3C A;  4HV6 A;  5DEQ A;  2VC0 A;  2MC3 A;  1QNT A;  5CVJ A;  3I58 A;  2NS0 A;  1B1B A;  2ZJ2 A;  1YS6 A;  4AVP A;  4D0P A;  5LLQ A;  1RI7 A;  1FOK A;  1DUX C;  3WG9 A;  3RYP A;  3H92 A;  4HW0 A;  4I01 A;  3L2C A;  4L5I A;  1B9M A;  1BOA A;  3FF5 A;  4RB2 C;  3QU3 A;  2V1U A;  1Y0U A;  2MH9 A;  1VTN C;  3MCZ A;  1MJA A;  1ON1 A;  2XUB A;  2PEX A;  2DAO A;  2EFQ A;  2PMU A;  3TDU C;  4RGR A;  3T0Y A;  1WSU A;  2AS5 F;  3TKY A;  1R1U A;  3ABT A;  4LGW A;  1G6N A;  3GFJ A;  4AWX B;  5DYM A;  4HOB A;  1YYV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...