2BV6A

Crystal structure of mgra, a global regulator and major virulence determinant in staphylococcus aureus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
MNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA
publication title An Oxidation-Sensing Mechanism is Used by the Global Regulator Mgra in Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
molecule tags Transcriptional regulator
total genus 49
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bv6A00
1PP7U 3D0SA 1MGTA 5DDGA 4HX7A 4LLGF 2Y75A 2IA2A 2W57A 3WE2A 1XMKA 1FP2A 3KCCA 2A6HF 3P7NA 3AAFA 3KLOA 1LEBA 4IHSA 1CF7B 3HOSA 5FO5A 1F4KA 2ETHA 5HDGA 2H6BA 2FOKA 1FBSA 1Z91A 2F5CA 2IPQX 1TQMA 3GO5A 2EA2A 3F21A 2QWWA 4IHTA 2NNNA 3I5UA 1T98A 1BN5A 4QLCU 1G3WA 3M1EA 1L3LA 5L3EA 1KU7A 5ILSA 4GXOA 3FMSA 2XAJA 2OQRA 5DCMB 2UXNA 4FHTA 3J81K 4EVIA 3WE3A 1T38A 4PCQA 4ZZDA 3IHUA 4K2EA 3FHZA 5L3DA 4HF1A 1B4AA 2EK5A 4GYGA 2CSOA 5CVUA 1YYVA 1WI9A 5CVVA 4A2UA 1ULYA 2VN2A 2WC2A 4G7OF 1B9MA 1HW2A 1IN4A 2BEOA 1O7FA 2EFQA 3H3UA 1USTA 3RIRA 2NRAC 1FWZA 3JTGA 3RKYA 4MTDA 4ZYDA 1FPQA 4UV8A 1AOYA 4HLYA 1RI7A 1IN7A 1O3TA 1J2XA 5HLHA 5K5RA 3I53A 1Z7UA 3BJ6A 3TO6A 3PQJA 2P7VB 3U2RA 3V8KA 2LKPA 5DCFA 2ZJ2A 3LQQA 4HDVA 5DUKA 4MQVA 2RC4A 4LB5A 3GUDA 5LHHA 4Y17A 4LK0F 1W4MA 4G94A 4BXUA 2W84A 5FD5A 2R7DA 1RIOH 2PQ8A 4BHPA 2XROA 1DPUA 4RB3C 5CLSA 1Z9CA 3I64A 1ZRFA 3ZMZA 2HKOA 2Y48A 3J81Z 3SQNA 2JT1A 2V1XA 2WV0A 2L3DA 4KA4A 2D2WA 5D5WB 4JK1X 1T39A 2ESNA 2ISYA 4M9SA 1YG2A 2G7HA 4AIKA 1E17A 1X3UA 4P5OA 2A61A 3J80K 2JPBA 3F8MA 2B0LA 4IJAA 2NYXA 2A68F 2OZUA 5JHUA 4RGUA 2HEOA 3RJPA 1NHAA 3CUQC 1JHHA 4HV5A 3F22A 1ZG3A 2IA0A 2LNBA 3DPTA 3T0YA 1EH7A 2DI3A 3HYIA 3ERED 4BHCA 4NB5A 1F5TA 1K79A 4IRHA 1ZRDA 1J75A 3WU0A 5FFZA 4IXAA 5F1RA 1UHWA 2MH9A 4P9UA 2FEZA 1I5ZA 4G6DA 4HF0A 1T6SA 3C3WA 4XRFA 4WWCA 4AWXB 2XAFA 2QLZA 1FOKA 2F5EA 2TDXA 3ZPLA 1XMAA 4A5MA 3CDHA 1K78B 2MLGA 3BY6A 3FF5A 2P5LC 3F6VA 4UXNA 2QYOA 1YW8A 5HDKA 2PFBA 2DPUA 2O0YA 4S05A 2DW4A 1LDJA 2DO7A 2K4JA 3EYYA 3Q9VA 3ABTA 5HLIA 3WTTC 3WGHA 3SZTA 3HRTA 3WODF 4G7HF 1G6NA 4MGRA 3J80Z 2YU3A 3K9TA 1JXSA 4HYEA 3TOAA 1KQ9A 2NS0A 1ZH5A 1IN6A 2O8XA 1CGPA 2OZ6A 3HUGA 4Y15A 3BDDA 3J7AO 4CICA 4Z2YA 4ESBA 4OIOF 1ZAOA 4N9HA 1YW7A 5E17F 2IA1A 5E1WA 3WTSC 1USSA 1ONVA 3BPVA 2P6TA 2ZNZA 4M9XA 2XIGA 5LEJA 3GZ6A 4CXFA 2R3SA 1XSDA 3RKXA 2IVMA 3FXUA 4HBLA 4LLNA 1SAXA 1O57A 3CUOA 5HDNA 3SZPA 2FBKA 3E97A 2R7FA 2VC0A 1S6LA 2NNYA 1BJAA 4KIGA 3WTVC 4KUMA 3ZMVA 2D45A 2YPRA 4KMFA 3GLXA 1XCBA 5TRDA 5F6FA 2EFWA 3LA2A 4MNUA 4L0ZB 1IN8A 2DLLA 4TV7A 4MQ9F 2IRFG 3HHHA 2VBZA 3TGNA 4BNCA 2HDCA 2QQAA 1QO0D 1B6AA 3KP2A 3R4KA 1TBXA 4HF2A 1FZPB 1Z6RA 4OU0A 3IWZA 3HOTA 5LLQA 4XLPF 1HW1A 3CO7C 3K1NA 5BPIA 4I98B 2GZWA 2J5PA 4AD9A 5DD8A 4HLXA 1SD4A 1QBJA 2GA1A 3RTRA 1MKMA 1HKQA 3FMRA 3TDZC 2QM3A 1FT9A 4RB2C 3CUQA 1FYMA 4EGZA 4OMYA 1KQ0A 5E1XA 2Z5UA 4A0XA 4L0YB 4KYWA 4EQQA 3GXOA 1FSEA 2JSCA 4UVCA 2D1HA 3EYIA 4AIJA 3GX4X 3ZMSA 4I01A 1LQ1A 3IWFA 3FX3A 1B9NA 2GA2A 1SFEA 5FGMA 1IW7F 1A04A 1KYWA 3MQ0A 5CJ9A 1FLIA 5D5VB 1T2KA 3N97A 1W7PA 4ZZLA 3DFGA 4YFXF 1TNTA 5FLXK 3VB2A 3WTZA 4IVNA 2QBYB 3I59A 2CWEA 2KJBA 4LJZF 3NRVA 5JFRA 1LDKB 3L09A 1MDMA 3I58A 4LLLA 1ZRCA 2IW5A 1HSJA 3L2CA 4NQWA 3ZN0A 4S04A 3JTHA 1ZLJA 4I02A 2YSRA 1KQ8A 4B09A 2E1NA 1YW9A 2ELHA 3BJAA 1Y0UA 2HTJA 1Z1DA 4OIPF 1J0RA 1ODDA 2FU4A 2P4WA 2DBBA 4M74A 3CTAA 5LEKA 5HS7A 3C7JA 3CO6C 2ESHA 2FRHA 1D8KA 3IRRA 3C1DA 1XN7A 3HTUA 3KP5A 2CW0F 4WF2A 3TQNA 2VOOA 1TW3A 2VXZA 2FE3A 2P5KA 3P9CA 5E20A 5LGUA 1OPCA 5D8LB 1SFXA 1ZLKA 4HZFA 5FLXZ 1P2FA 5H6RA 2P7CB 1FY7A 2A6EF 5D4SA 2COMA 5BS6A 3V7CA 3T1BA 1GVJA 4KN4X 5D5UB 2DQLA 1QZZA 3KETA 5LGTA 2Z33A 1YIOA 5IT9K 1XGMA 1OKRA 2JTVA 3B73A 3U1DA 5HS8A 3GEZA 4O6JA 4U0WA 5IT3A 2KIUA 3T8RA 4N0BA 4H0EA 5H6QA 4RAYA 1PUEE 1DP7P 2STTA 3FWEA 3RYPA 2VODA 5J8CA 3ZMTA 1LJ9A 3HIFA 4U88A 4U0VA 2JPCA 2ZMEA 5D6FA 2FMYA 4Y13A 4R79A 4EJWA 1HW5A 1B59A 2EJRA 4I0BA 4IRGA 3FM3A 3ULQB 1R23A 4G9YA 2V79A 4E70A 4XSXF 3BWGA 2QENA 4RGSA 4MEYF 1OYWA 1P4WA 3MAJA 1DPRA 5HS9A 4BQAA 5ICGA 5A2QK 4HX8A 1KU3A 1PP8F 2GIVA 2IP2A 1AWCA 2HQRA 2QVOA 4M71A 5KK1A 1BI0A 1R5HA 2HYGD 1FP1D 3DEUA 4RGRA 2DK5A 2QQ9A 1O7LA 1R1TA 1PDNC 2ZKZA 3ML6A 2MD5A 4I09A 2HGCA 3HSRA 3GFIA 4ZYEA 5J8FA 4LGWA 2V1UA 3E5UA 4EJVA 3FMQA 2P8TA 1XGOA 1STZA 1YO5C 2EWNA 3M8EA 1Z6TA 2G9WA 5E8IA 5L3GA 1G3SA 1B1BA 5LHGA 1S3JA 4LK1F 4OIQF 5IT9Z 4OMZA 2ACJA 3F8NA 3KLNA 2L01A 2FMLA 3BROA 4OIRF 2M87A 1R58A 1SFUA 3TO7A 3MZHA 4A0YA 1XSVA 1BM9A 2ZCWA 2FF4A 3LFKA 3MEXA 3E5QA 2PN6A 5DD4A 3PFIA 2UWMA 1WRJA 5ICEA 2C6YA 4FX4A 3W6KB 3HHGA 4ENJA 2O61A 3HSFA 1QZYA 1TNSA 4ENNA 5HOOA 1OMIA 4N9IA 4LG0A 1U2WA 1J5YA 5DV5A 1FC3A 1IZ1A 4IPAA 1KA8A 3IL2A 2H94A 2O6GE 4RB1A 4UV9A 5A2QZ 2LDUA 3I4PA 2HQNA 3E3VA 5BQTA 4IRIA 1YS6A 1OR7A 1RZ4A 2MC3A 2EV5A 2E1CA 1EH6A 4YIIA 1LVAA 3DPLC 3ZQ7A 1IF1A 1U5TB 2P5VA 3I71A 3NEUA 4ON0A 3JW4A 3KEOA 2DFIA 1TTYA 2F5DA 1HQCA 2NAZA 1W7PD 5AIPA 1BIAA 5E18F 1U8RA 3GW2A 3MFKA 4EM0B 3ISPA 3F8CA 2WWYA 3QP5A 1YS7A 4UNOA 3IKVA 3WGGA 1IXRC 2YX7A 4LMYA 3COAC 1O3QA 1F1ZA 1ON2A 1XCVA 2BYVE 5ICFA 2IJLA 1CF7A 1J59A 5F64A 3QAHA 4O3MA 2Q0OA 1R36A 1BC8C 3ZMUA 4M72A 1SD7A 3KFWX 4WXDA 3WTXC 4MTEA 3I0TA 3GFMA 1J9IA 3E5XA 2K02A 1LB2A 4AIHA 3MCZA 4EM2A 2XAGA 1V3FA 5BMZA 2HOEA 3B02A 1ZYRF 2XVCA 2E7XA 4ETSA 2Z3YA 4U7BA 3BP8A 1WWXA 5TJJA 2AS5F 4PGGA 5DCMA 4Q47A 4KMUX 2HZTA 4BAYA 1T0FA 5J6XA 2FSWA 4YFKF 3GVAA 1MD0A 3D5LA 4YIFA 2XASA 4M6XA 1H9TA 4CDGA 3VOEA 4HQMA 2VBWA 3W6JB 5DEQA 3F6OA 1HKSA 1XGSA 3KEQA 4GO1A 2W85A 3F8BA 2L4AA 4JQFA 5CVIA 4KFCA 2LF8A 1I1SA 2J5OA 1ZG1A 3DP7A 4CGZA 2MLKA 1UCRA 1WKMA 1JGSA 3R60A 2O3FA 4CZZA 2V6CA 3RI4A 2ADUA 2XKPA 2QZ8A 2Y0MA 1VTNC 1Z05A 2K86A 3KP3A 4WCGA 4ENKA 4ZYHA 5JVTA 3E6CC 4EJOA 5HLGA 2WTEA 3DXJF 3KZYA 2FBIA 2XV4S 5ED4A 3QP6A 3VODA 2HS5A 3SXYA 2EV6A 3V8JA 2XAQA 3O2PE 4RS8A 1P6RA 4LFUA 3GFLA 2L4MA 3JSPA 5KVRA 4BHBA 2RKHA 5EEHA 2PMHA 4ESJA 2BE5F 3BOQA 3M8FA 5DYMA 1FBUA 1IAWA 3HSEA 2HYFA 1IN5A 3GWZA 4YFNF 2A3SA 1R00A 4EM1A 2VONA 4A6EA 5AONA 2QQBA 2JRTA 1RNLA 5DUIA 3ELKA 3FM5A 3PQKA 1D5VA 4WXCA 2ZBKA 4B8XA 2VT3A 1REPC 1OYYA 2HFHA 2PLYA 4A5NA 4EJTA 5K5OA 4G8XA 5LRRA 3RPUA 3WU1B 2LF7A 3HTSB 5BOXA 2ZO4A 1XGNA 2VT2A 3L00A 4ENMA 1I27A 3M7GA 4HQEA 2IT0A 2K7LA 2DTRA 3O6BB 2P6SA 1BBYA 1P4AA 2RQPA 4HDUA 3TOBA 1HBXG 1YFHA 2A07F 1IXSB 3K1PA 4WK8F 2D1VA 2FNPA 2GQQA 1WSUA 4OINF 2W24A 2BBYA 2KRFA 1ZHFA 3ABUA 3DF8A 4WXHA 2MH2A 4KIBA 2Q8KA 3LSTA 1LDDA 4RAZA 1MJBA 3V7SA 5JR3A 3GZ5A 1K78A 1FNNA 1BC7C 1QPMA 2RDPA 5AIQA 3K69A 4OOIA 1H9GA 3WTWC 5H20A 2PG4A 4D0PA 1RUOA 4NHJA 1G3YA 4RB0A 1W5TA 4KN7X 1IUYA 5FB2A 4L9JA 2X4HA 1GHCA 3CJNA 4A0ZA 3K1MA 2E7WA 2HWVA 5FD6A 3RPQA 2CG4A 1OYIA 5ICCA 5E8GA 2K4BA 5LGNA 3MZYA 2RN7A 2Z9OA 1SMYF 1BIBA 4G6QA 3WG9A 5L3FA 5CVJA 1HSTA 3G3ZA 1BI1A 2CO5A 4PZJA 2ZFWA 3ZP5A 1BI3A 4U0YA 2EFOA 4EJUA 3E6DA 3E6BA 3LAPA 1BI2A 4GYIA 3IKTA 1EH8A 1FBQA 2F2EA 4G7ZF 1JE8A 2XHKA 2GXBA 1SD6A 2H6CA 5CYVA 3WGIA 1I1GA 3ECOA 4MEXF 2DT5A 1QGPA 3QU3A 2V1DA 3Q9SA 4P96A 2M8EA 1R1VA 5D5XB 2O03A 1GXQA 2DK8A 2JZYA 2Z99A 4LD5A 1DUXC 3L9FA 1S7AA 3ZMDA 2FBHA 3T5XA 4LB6B 2AXLA 3F72A 2HR3A 3V8LA 1KU2A 4KDPA 3R0AA 2F5FA 3KP7A 2M1BA 4L5JA 3F23A 1IXCA 4P9FA 3VFZA 3QPTA 3LA3A 2YX4A 2OD5A 3N4MA 1XSXA 3RKWA 3DKWA 3F3XA 3CLOA 5LRSA 3V7RA 4ZYGA 4YG2F 4UUVA 1SMTA 3HRMA 4M6YA 2GWRA 3SHFA 2PI0A 4PGHA 2RV8A 3QPHA 3GYHX 3SFZA 3QRFF 2ISZA 3CUQB 2VBYA 3U9GA 1UFMA 2H09A 1SD5A 2UXXA 4XLNF 4AVPA 4KIFA 4L9NA 4BYYA 1I6XA 3V4GA 3LAJA 1P92A 1V4RA 4JBAA 3I54A 5LHIA 5K1YA 2EB7A 2VBXA 2CYYA 1K6OA 3ROUA 4KT5C 2ZXJA 1W7PB 4HAMA 2DU9A 1G3TA 2QBYA 1HXDA 3LQRA 3ECHA 2CGPA 2HKXA 4DQ2A 5L3CA 5LBQA 3I59B 5CVRA 1TQPA 3KE2A 1MDMB 3VEPA 2PMUA 2XKOA 3WTYC 3IRQA 2DPDA 4EGYA 3LWFA 3M9AA 5BPDA 1KYZA 3GFJA 2QUFA 3O3KA 1G4DA 1FX7A 1ZN2A 3Q5FA 1P4XA 4GCVA 3H3ZA 2GXGA 4CHUA 2LSOA 1R22A 3RYRA 4O5VA 1JHFA 5ERIA 2FQ3A 1LEAA 1Q1HA 3L7WA 3P9KA 1H0MA 1TQIA 2KJCA 1F9NA 3R61A 3GF2A 2H27A 3KP6A 4MHGA 3H92A 2M45A 4FT8A 3QU6A 3C18A 4I7HA 1YLFA 1UB9A 1L0OC 1R5GA 1IRFA 2EA4A 1XDUA 4L9TA 1WQ2A 4A6DA 1U5TC 4HA8A 2G7UA 1YQAA 3JAMK 2XUBA 3HRSA 3REOA 1D3YA 3BPXA 2OA4A 3IC7A 2OBPA 2XAHA 5D8KB 2FA5A 1RUNA 2PBIA 3KZZA 4EV0A 4CYDA 1MJ9A 2PEXA 2FNAA 3K0LA 3TO9A 3EUHA 1IRGA 1LNWA 1O3SA 1FYKA 4QWQA 3KP4A 6PAXA 4UVBA 1TW2A 4I2OA 5JI6A 2CQKA 1U3EM 2VE8A 2K27A 4HW0A 3DV8A 3OOPA 4M9ZA 5ILUA 1U6GA 4A12A 5ILVA 3FXQA 3HRUA 1EV7A 1KGSA 1S8NA 1ZARA 2FXAA 3TKYA 2EV0A 2DAOA 5D6EA 3OV8A 4DNCA 3F8FA 1UHMA 4I0AA 2ZMEB 4R8HA 2V9VA 2OAZA 2CFXA 4KICA 4KNYA 1S7OA 1ZGJA 2HTSA 4PDKA 2RGVA 2BV6A 5EEGA 2XRNA 2MA3A 1DDNA 4U7DA 1E2XA 2Q2EA 2VC1A 2X0LA 2YR2A 4UVAA 1KU9A 4Q48A 3S2WA 3TDUC 3EETA 1R7JA 3JAMZ 1ZGAA 3QOPA 3FZVA 4HV6A 2MBFA 2GAUA 3T8TA 4L18B 4XBFA 2ZNYA 4L9VA 3NQOA 4Q4ZF 1TLHB 2BGCA 3BJOA 2PJPA 1ZG5A 1QNTA 4UHTA 1FYLA 5E1ZB 1D8JA 4RGXA 3R0JA 1MZBA 3K2ZA 3LA7A 2RVCA 5HVQC 1U78A 4ASNA 4L5IA 2XGXA 1XD7A 1C0WA 3P9IA 4F7ZA 2KIMA 2OU2A 1HKTA 1O3RA 4XSZF 1FSHA 4WX9A 5K5QA 5L3BA 4ESFA 2KKOA 4HX4A 5D4RA 4FX0A 2EFNA 3DQVC 2UZKA 1R1UA 2A69F 3EQLF 3WTUC 2STWA 4IF4A 2RNJA 1J7KA 1W5SA 1XDSA 4ZH4F 3R6SA 3E6MA 4LG0B 4P55A 1BOAA 3RDIA 3EDPA 1K7AA 4CO8A 1ZREA 4R1HA 1MJAA 2M30A 4Q5SF 1ON1A 2KIFA 1S29A 4BH9A 2M5WA 2A5YB 3FXRA 1U5TA 1QQIA 3BZ6A 2L54A 5FFXA 2W25A 2DQRA 2L02A 2EFPA 1GXPA 2VE9A 4M73A 3ZN1A 3G73A 2VOPA 4GGGA 3MWMA 3JSOA 1XB4A 1YTYA 2OQGA 4EMSA 4HOBA
chains in the Genus database with same CATH superfamily
1PP7U 3D0SA 1MGTA 5DDGA 4HX7A 2LREA 5CKTA 3MKWB 2VKHA 3A01A 4LLGF 5GPAA 2R4GA 1EA3A 1FIPA 2Y75A 2IA2A 1AKHB 3TL4X 2VPLA 3GCMA 2W57A 1WH5A 2IGNA 3WE2A 1XMKA 2OF7A 3CCRI 1FP2A 3KCCA 1MMNA 2A6HF 3P7NA 3AAFA 3S3OA 3KLOA 1LEBA 4IHSA 2AQEA 2ZXWH 1CF7B 3S16J 2L7MP 4XRMA 3HOSA 3H5RA 5EJCA 2FD5A 5HLTA 5FO5A 1YOVB 1F4KA 2ETHA 5HDGA 2H6BA 4N4OB 1OR7C 2FOKA 1FBSA 1D0YA 1Z91A 3CCQI 4RLQA 1K4SA 2R7RA 2F5CA 2HXIA 1TQMA 2IPQX 3GO5A 2EA2A 3TP3A 3L2QA 4A3DJ 2CQNA 3F21A 1I3QJ 1LFUP 1MNMC 2QWWA 1HCRA 1VI0A 3IH2A 4RMNA 2HQAA 2X6WA 5EGOA 1TL8A 1JKRC 4IHTA 2CMPA 3A03A 2NNNA 3I5UA 1WPKA 5F0FA 1T98A 1BN5A 4QLCU 1G3WA 1Y8RB 3M1EA 5E3MA 3J7AY 2K9MA 1L3LA 5L3EA 1KU7A 5ILSA 4PK4A 4GXOA 3FMSA 2XAJA 2OQRA 4BXXJ 1FOXA 2M7BA 5DCMB 2UXNA 3VYUB 4AYBN 4FHTA 3OYNA 2EIMH 3J81K 2WY8Q 3H5AA 2R92J 1HF0A 3PIPF 4EVIA 2XB0X 3CJTB 2V26A 3PSIA 3G1LA 2DT7B 4PCQA 3WE3A 4ZZDA 1T38A 4IL6C 3IHUA 3ZGKA 3OR1C 2E2HJ 1D1CA 2I10A 4K2EA 3FHZA 1DP3A 3DBHB 5L3DA 2DYRH 4HF1A 1B4AA 2EK5A 1JJ6C 4GYGA 1H8AC 2CSOA 1XMXA 5CVUA 1YYVA 1WI9A 2WAFA 2R7UA 5CVVA 4D9JA 4A2UA 1ULYA 2CW8A 2VN2A 2DA5A 3HOUJ 2HOSA 4B48A 1T95A 2WC2A 4G7OF 1B9MA 4XNFA 3PIOF 1HW2A 2DA7A 2KT0A 1IN4A 2BEOA 3OY9A 1O7FA 2EFQA 3H3UA 1USTA 3RIRA 2NRAC 1FWZA 3JTGA 1Y6IA 3RKYA 5C4XJ 5IOZA 2EZLA 5DTDA 1SVOA 4MTDA 4ZYDA 1QU3A 1FPQA 3EUAA 3OYHA 3ZXSA 4UV8A 1AOYA 1B72A 4BDZA 4NC8A 2CFOA 4HLYA 1B8IB 1RI7A 3MKLA 1IN7A 1O3TA 1SFKA 3E7LA 1J2XA 3F9KA 5HLHA 5K5RA 3I53A 1Z7UA 2XGCA 3BJ6A 1ZGWA 3G2BA 2L0KA 1HA8A 1LE8B 4BEHA 3TO6A 1BA5A 3K4LA 3QPLA 3DKXA 2W48A 3PQJA 2P7VB 1ORKA 3U2RA 3V8KA 2LKPA 5DCFA 1RR8C 2F5VA 4KISA 2QQ8A 2ZJ2A 3GTMJ 3LQQA 4HDVA 4NBQA 1IDZA 5DUKA 4MQVA 3LSKA 2HZDA 2RC4A 2EIJH 4LB5A 3GUDA 5LHHA 4XKVA 2NS7A 4Y17A 3LSHA 4LK0F 3DWLE 4AC0A 4C3HJ 1FTZA 1W4MA 1BJZA 4G94A 1VQLI 3S32A 5FKNA 4BXUA 2W84A 5FD5A 2R7DA 3AG2H 3OYMA 1RIOH 2EIKH 2M0CA 3OYAA 1WI3A 2PQ8A 4DOZA 4BHPA 2XROA 1DPUA 1K6YA 4RB3C 5CLSA 1Z9CA 3JRAA 2AQFA 5K7ZA 3I64A 3D5RC 2XC7A 2HVQA 3GBGA 2QEXI 1ZRFA 4IOCF 4YIRX 3W6VA 3ZMZA 1U0JA 4IQ4A 4CUGA 4NDLA 2HKOA 2Y48A 1N75A 3J81Z 2HVSA 3DKYA 3I3LA 3HGYA 5J40A 3OMYA 3SQNA 2JT1A 3SFIA 5IYBJ 1IV8A 2V1XA 1SC7A 2WV0A 2L3DA 1NH3A 2FUG2 3CCJI 4KA4A 2D2WA 5D5WB 4JK1X 1T39A 1MSEC 2ESNA 3S8PA 2ISYA 4M9SA 1YG2A 2G7HA 4AIKA 1E17A 4XN0A 4I6ZA 1X3UA 2YUSA 4KT6A 4P5OA 3JR9A 2A61A 2VQLA 1ETYA 3J80K 4F52A 2JPBA 3F8MA 5FROA 1TP4A 2B0LA 2MSYA 4IJAA 4CCMA 3WHCA 2NYXA 3HEFA 2A68F 2XDVA 2OZUA 5JHUA 4RGUA 3O8GA 2HEOA 3PNTA 3RJPA 1NHAA 2E1MB 3CUQC 1JHHA 4HV5A 3F22A 4BGDA 1ZG3A 2JJ7A 3OYFA 3OYIA 1VQNI 3S93A 2LVSA 2L9VA 3HPHA 3DCFA 2JK3A 2L7FP 2DCEA 2UV1A 2IA0A 2LNBA 3DPTA 4P1WA 1WHUA 3T0YA 3C2BA 5C4JJ 4FTHA 1EH7A 2DI3A 3HYIA 2DN0A 3JRFA 4B44A 3ERED 4AYBA 1QRYA 4BHCA 5HODA 2XSDC 1MMSA 5GTIC 1U9NA 4NB5A 1F5TA 1K79A 2XPVA 4IRHA 3DEWA 4E6KG 3BTCA 1ZRDA 2KDOA 1VZ0A 4V2GA 2Z2SB 3BG3A 1J75A 3WU0A 5E3LA 5FFZA 4IXAA 4F3QA 1PYVA 5F1RA 1UHWA 2MH9A 4P9UA 4IHWA 2FEZA 2NOJB 1W1WE 1I5ZA 4G6DA 4HF0A 1UZCA 1T6SA 3RPUD 2UUZA 4F91B 2M0MA 2B7EA 3C3WA 4XRFA 4C9YA 4DYRA 4AWXB 2XAFA 2QLZA 4WWCA 2F5EA 1FOKA 4QTRA 2TDXA 3G71I 1ZQ3P 3ZPLA 4E7ZA 1XMAA 4A5MA 3CDHA 4PJNA 3RSNA 5GAGJ 3FBNB 1K78B 2MLGA 3BY6A 3FF5A 1VQPI 2NVTJ 2P5LC 3F6VA 4UXNA 3K70C 4XKCA 2QYOA 1N77A 3CCVI 4CCNA 1X4OA 1YW8A 3CCYA 5HDKA 4CYCA 1JGGA 2PFBA 3ESWB 2DPUA 2O0YA 3ASOH 2DW4A 4S05A 5GAHJ 3I4NJ 4M3BA 2Y9ZA 1LDJA 5GTHC 2DO7A 2K4JA 2HNHA 3EYYA 3Q9VA 3ABTA 5HLIA 2EQRA 3WTTC 1NTCA 4JX4A 3WGHA 3A02A 4PFPA 3SZTA 2K9QA 3HRTA 3WODF 2WA0A 4G7HF 1G6NA 2LYCA 3BTIA 2R5ZA 1MBJA 4IOAF 4MGRA 4XQFA 3J80Z 2YU3A 3FKIJ 3K9TA 2W00A 1JXSA 4HYEA 3TOAA 1KQ9A 2NS0A 1ZH5A 3I9V2 1IN6A 4D7NA 4Y3OA 1X3ZB 5K7HA 1JTYA 3HC7A 2O8XA 5KNLA 1CGPA 2OZ6A 3HUGA 3FXKA 4Y15A 3S1MJ 3BDDA 4RLFA 2QSGX 2X85A 3J7AO 3AG3H 4CICA 4PSXA 4Z2YA 4ESBA 3GTGJ 4OIOF 1ZAOA 3GMEA 4N9HA 2ZXIA 1YW7A 3HL2A 4XKBA 1J09A 4CCLA 2OCCH 5E17F 2IA1A 5E1WA 5CPRB 4GDFA 5EDNA 2WB1N 3WTSC 4IHVA 1USSA 2R5YB 1ONVA 2JA2A 3BPVA 2P6TA 3VSLA 2ZNZA 1FJLA 4M9XA 2XIGA 5LEJA 3GZ6A 4CXFA 2R3SA 1XSDA 1VQKI 3J7ZI 2R93J 2BOLA 3RKXA 2IVMA 3FXUA 4HBLA 2WAEA 4LLNA 5CQEA 1SAXA 1O57A 1OJLA 3SEZA 4A3GJ 3CUOA 3SDGA 5HDNA 1UG0A 3SZPA 2FBKA 3E97A 4LIVA 2R7FA 2VC0A 1S6LA 3BG9A 2NNYA 1HDDC 1BJAA 3Q0WA 4KIGA 3WTVC 4KUMA 3ZMVA 4M3EA 3BR3A 2YPRA 2D45A 4KMFA 3GLXA 1XCBA 5TRDA 5F6FA 2KQRA 4BACA 1Z0XA 3PFYA 4HNUA 4BUPA 2EFWA 3LA2A 1F36A 3QOEA 4LIUA 3CMMA 4MNUA 4L0ZB 2LLKA 4CSWA 1IN8A 2DLLA 4TV7A 4MQ9F 2IRFG 3HHHA 4ZTJA 2VBZA 3TGNA 1LPQA 4BNCA 2HDCA 2M7AA 2QQAA 5EZGA 1HOMA 1QO0D 1Y39A 1A31A 1B6AA 3KP2A 2TRTA 2CV0A 3VYTB 1QA6A 1GUUA 3R4KA 4XRSG 3A0HC 1TBXA 2VKDA 4HF2A 2JVHA 2H1LA 2OC6A 5FKKA 3UNGC 1V55H 2K9LA 2KL4A 4UY8I 4M3DA 1FZPB 1Z6RA 3IWZA 4OU0A 3CDIA 3HOTA 3S2HJ 5LLQA 2E5ZA 4XLPF 2MW8A 1H89C 1HW1A 3BG5A 3CO7C 3K1NA 5BPIA 3N05A 4I98B 2GZWA 4NC7A 4PJMA 1X1AA 3H9GA 4C2MJ 3CESA 2J5PA 1WJ5A 3S3NA 2IS1A 4AD9A 5DD8A 5B1BH 3IV5A 4HLXA 3MKYB 2R7TA 1SD4A 1QBJA 3RQ4A 2GA1A 3RTRA 1MKMA 3FDYA 1HKQA 3FMRA 2IGOA 1ZR4A 2DMPA 3TDZC 5F27A 2QM3A 1FT9A 4RB2C 3CUQA 4HPQA 2ZJRF 1A6QA 4OAZA 1FYMA 4EGZA 2V7FA 1KQ0A 4OMYA 5E1XA 1X1BA 5GAEJ 9ANTA 2Z5UA 4A0XA 4IKFA 4L0YB 1W5CC 3VSKA 4KYWA 4EQQA 3GXOA 1SVLA 1HLVA 3PO2J 1FSEA 2JSCA 1D0XA 2VQGA 3BTJA 4UVCA 2D1HA 3EYIA 1OFCX 2DDAA 4AIJA 3GX4X 3ZMSA 1FOWA 4I01A 2XF5A 1LQ1A 3IWFA 1NG7A 3FX3A 1ZELA 2KHMA 1B9NA 2YU9J 2GA2A 3EPZA 1OCCH 4EATA 1SFEA 3D5SC 4B4CA 3CDLA 5FGMA 5M3FJ 1IW7F 1A04A 2GLOA 3L2UA 1KYWA 3MQ0A 5CJ9A 2VUMJ 1I6HJ 5D5VB 1T2KA 1FLIA 3AL0B 4DZJA 3RZDJ 3N97A 1ETXA 2V9KA 1W7PA 4ZZLA 2LKSA 3DFGA 4PUSA 2E71A 4ZDPA 2NS8A 4YFXF 4AVZA 1TNTA 1RRJA 5FLXK 3VB2A 3WTZA 2O8KA 5KAIC 2Q1ZB 4IVNA 2QBYB 3I59A 2CWEA 2KJBA 1MMAA 2E5NA 4KITB 4LJZF 3NRVA 5JFRA 2I5UA 4RM3A 1LDKB 1NG6A 3L09A 1LUJB 4C3IJ 2DT6A 3I58A 4LLLA 1K83J 1MDMA 3FXLA 2IW5A 4ZDLA 1ZRCA 2NVUB 5J4VA 1HSJA 4HSTA 2L7KA 3L2CA 4NQWA 4FISA 3ZN0A 3RZOJ 4S04A 4J01A 3JTHA 3BT9A 1ZLJA 1N25A 4I02A 2YSRA 1KQ8A 4B09A 2E1NA 1YW9A 4LOCA 1LFBA 4PJJA 1SVMA 2ZFUA 5GPCA 2ELHA 2WB1A 2BW3A 3BJAA 4F93B 1Y0UA 1WCMJ 2WADA 2HTJA 2QKLB 2JN6A 4NC6A 1Z1DA 1D1BA 2LP0A 2XGEA 4OIPF 4C2UA 2P0WA 3OWTA 1J0RA 1ODDA 3OOUA 1YJ9I 2FU4A 3CF2A 4BS9A 2P4WA 2DBBA 1SANA 2COBA 4M74A 3CTAA 5LEKA 3F0CA 5HS7A 3M4OJ 1VQMI 5HNHA 3C7JA 3CO6C 4II3A 4BBRJ 2ESHA 3HB9A 3PUBA 2FRHA 2VB6A 1D8KA 3IRRA 3CC2I 2IS2A 2F48A 2F4IA 3C1DA 1XN7A 2JSPA 2VXDA 3HTUA 3KP5A 3CC7I 2HI3A 2CW0F 3BLYA 2PX9A 4WF2A 3TQNA 2LBFA 5JLXA 2VI6A 5DM6F 2VOOA 3HXLA 1WJBA 5F04A 1VQ9I 1LKXA 2NVQJ 1TW3A 2VXZA 1WZ2A 2V9PA 3H3VK 4X1EA 2ZJQF 2FE3A 4RAFA 2P5KA 1IUFA 3BR1A 2PJRA 3W2VA 4XRSA 3P9CA 1N78A 5E20A 5LGUA 1OPCA 5D8LB 1SFXA 1ZLKA 2BVMA 2W1OA 3BQZA 2Y30A 4HZFA 5FLXZ 1P2FA 2LMDA 1BW6A 2RAEA 5H6RA 2P7CB 3OYJA 4A3MJ 2BZTA 1FY7A 4ZYAA 4U87A 2A6EF 5D4SA 2COMA 2ZXHA 3NAUA 5B1AH 5BS6A 3V7CA 3T1BA 2Y0SA 4DYQA 1GVJA 3LSGA 2KZVA 3G6EI 4KN4X 5D5UB 2DQLA 1QZZA 3KETA 5LGTA 3DTIA 1PUFB 4XLAA 3TP0A 2Z33A 1Y56A 2DOFA 1YIOA 5IT9K 1XGMA 4XM3A 2HOAA 1OKRA 2JTVA 3B73A 3U1DA 3OSFA 4E7IA 5HS8A 3MN2A 3ZR8X 3GEZA 4O6JA 4UB6C 4BBSJ 4U0WA 2LR8A 3AFHA 3V42A 5IT3A 1TWAJ 3H9QA 2KIUA 3T8RA 4N0BA 1BR2A 1Z7LA 3LSPA 4H0EA 5M5YJ 5H6QA 4ABZA 3BR6A 4RAYA 1YRNA 1PUEE 1YX3A 3BTLA 1DP7P 2DOAA 3C2HA 3FWEA 2STTA 3RYPA 2VODA 2OPTA 5J8CA 1BW5A 3ZMTA 1LJ9A 3HIFA 1RETA 4U0VA 1OISA 2JPCA 4U88A 1JJ8C 2ZMEA 5D6FA 4D5CA 2FMYA 5C44J 4Y13A 4R79A 4JX5A 4EJWA 1HW5A 1OQYA 1B59A 2K40A 2EJRA 4I0BA 4IRGA 3S1RJ 1V5FA 1ZTRA 2E19A 2R7QA 3FM3A 3ULQB 4DYCA 1R23A 2CRGA 4G9YA 4XN3A 2M2EA 2V79A 4E70A 3E1SA 2X48A 4F92B 4XSXF 3BWGA 2QENA 4OAYA 4RGSA 4MEYF 1OYWA 1P4WA 3MAJA 1DPRA 5HS9A 2ZSHB 5J47A 3BQYA 1BR1A 2DMQA 2LC2A 5ICGA 4BQAA 2OJED 5A2QK 3H9JA 2FQ4A 1ETOA 4HX8A 1KU3A 1PP8F 2GIVA 2IP2A 1Z3YA 3SEQA 2LY2A 1AWCA 2HQRA 4UB8C 2Q2EB 2QVOA 4M71A 3SDBA 1BI0A 5KK1A 1R5HA 2HYGD 4XONA 4IO9F 1T0FC 4IX7A 2IS4A 3K7AJ 1WJFA 3LFUA 1FP1D 3DEUA 4RGRA 2DK5A 2QQ9A 1O7LA 1R1TA 1X1CA 3OIQA 1PDNC 4BDYA 2X51A 2ZKZA 3ML6A 1BOBA 1V54H 2MD5A 3PNYA 4I09A 2HGCA 3X2QH 3HSRA 2I8DA 1AU7A 3GFIA 3KZIC 4ZYEA 5J8FA 3CC4I 4LGWA 2V1UA 3E5UA 4EJVA 5IY5H 5J1YA 3FMQA 3NWTA 2P8TA 1XGOA 1JTXA 1SFOJ 2DMNA 1STZA 2ID3A 3HOVJ 1YO5C 2EWNA 2HPIA 4XOPA 3M8EA 1Z6TA 2KISA 2G9WA 5E8IA 1YHQI 5L3GA 1G3SA 4XOTA 4HRIA 1B1BA 5LHGA 1S3JA 4Z6YA 2IGKA 2F4MB 4BJTA 3C2GA 4LK1F 1AA7A 1R4NB 4OIQF 5IT9Z 4XLFA 4OMZA 3LSJA 1NK2P 1WJCA 4A93J 2ACJA 3F8NA 3DBRB 3KLNA 2L01A 2FMLA 3BROA 4OIRF 3GTPJ 3A4CA 2M87A 1R58A 4C2TA 1SFUA 3TO7A 3MZHA 4A0YA 5F0HA 1XSVA 4D1QA 1JUMA 3VYRB 1BM9A 1Y0NA 2DYSH 2OCEA 1MMGA 2FF4A 2GOXB 2ZCWA 3GTOJ 3LFKA 2DFHA 3MEXA 3E5QA 2PN6A 2WV1A 5DD4A 2L9SA 2MFZA 3PFIA 2UWMA 1WRJA 4FETA 3HDDA 5ICEA 2L5QA 1GVDA 3UKGA 2C6YA 4FX4A 3W6KB 1IJWC 3HHGA 3OYCA 4ENJA 1XX5A 2O61A 4E7SA 2VQHA 2BY2A 3HSFA 1QZYA 1TNSA 2K9NA 4ENNA 2H8WA 2XF6A 4XL9A 2L2OA 2QSFX 3PNVA 2K3PA 1ITYA 5HOOA 4MLOA 5J1UA 3CQZJ 1OMIA 3LSMA 4N9IA 4MIMA 4E4HA 4LG0A 5GP9A 1ZKGA 1U2WA 1J5YA 5DV5A 1FC3A 2DOEA 1IZ1A 4A3BJ 4IPAA 5EG0B 1XS9A 1X2MA 2EPFA 3RKQA 2BHYA 5M5XJ 1KA8A 3IL2A 2H94A 3OL4A 2O6GE 4RB1A 3CCMI 3DBLB 4UV9A 5A2QZ 2LDUA 4DJAA 3I4PA 1G59A 3QYBA 2JQ7A 4CCKA 2HQNA 3HGGA 3E3VA 5BQTA 4IRIA 2LFBA 1Y1WJ 1YS6A 1OR7A 1I39A 1RZ4A 2MC3A 4RAGA 2EV5A 2E1CA 3FHNA 1X3WB 1VNDA 3LL7A 3Q0UA 1VQOI 1EH6A 4YIIA 1LVAA 1OLTA 3DPLC 3ZQ7A 1IF1A 1U5TB 2P5VA 3VPRA 2KIQA 3I71A 3NEUA 4ON0A 1W0UA 1Q1VA 1V5EA 4C3JJ 2ID6A 3JW4A 4DBRA 4HNVA 3KEOA 2H1KA 2DFIA 1TTYA 3P5JA 2F5DA 1HQCA 2NAZA 1IG7A 1W7PD 3GTJJ 4CCOA 2NXNB 5AIPA 4GFBA 1BIAA 5E18F 4ZTFA 1YE9A 1ERDA 1U8RA 4UUSA 1NK3P 2IGMA 3ONQA 2CQXA 3PUFA 3GW2A 2XPWA 3MFKA 4EM0B 3DU5A 3ISPA 1T56A 4MO7A 3CCEI 3FK6A 3ABLH 3F8CA 2E1MC 3QP5A 2MC4A 5E3NA 2WWYA 2IAIA 3MD2A 3I55I 1YS7A 2V1NA 4JX6A 3M8JA 1I50J 2ZC2A 4UNOA 3IKVA 1DU6A 1AKHA 1U8BA 2FJ1A 3CP2A 3WGGA 1IXRC 1JKPC 2VASA 2YX7A 4LMYA 4IQJA 1MSFC 2DJIA 2IS6A 1W0TA 3CF5F 3COAC 1O3QA 1F1ZA 2RQQA 3A01B 1ON2A 3RQIA 1XCVA 2BYVE 5ICFA 4DW6A 3ZQLA 2IJLA 4ZJZA 5FKOA 2OTJI 2HPMA 1CF7A 1J59A 5LFAA 2R7VA 5F64A 2E60A 3QAHA 2Q0OA 1R36A 3HJEA 4II2A 1DU0A 4O3MA 1BC8C 3ZMUA 4M72A 4XK4A 1SD7A 2X6OA 4W1UA 1MMDA 3KFWX 4BQQA 4WXDA 4PJLA 3WTXC 3SZGA 4MTEA 3I0TA 3GFMA 1J9IA 3E5XA 2H8RA 2K02A 1X19A 1LB2A 1X1PA 3QODA 5E3OA 4AIHA 3MCZA 4EM2A 1TWHJ 2XAGA 1V3FA 2DJNA 5F08A 2HOEA 5BMZA 3H1CA 3B02A 1ZYRF 4IZZA 2XVCA 4YELA 2X1CA 1DGWY 2GOMA 2E7XA 4ETSA 2Z3YA 4U7BA 5EGOB 1P7IA 3BP8A 1WWXA 3LOCA 1ENHA 5TJJA 4A3LJ 3KPHA 2X1DA 3FBIB 2AS5F 1FIAA 3H0GJ 3JRGA 4PGGA 3MVPA 3H0DA 2MYSA 3W2AA 5DCMA 4Q47A 3JREA 3L2VA 4G6TB 4XR6A 4KMUX 2HZTA 1WVRA 2XGDA 2KRCA 1PJRA 4LG3A 4BAYA 2O7OA 4H4KC 1QPIA 1T0FA 3CZ6A 5J6XA 3WU2C 1R49A 2R7WA 2FSWA 4YFKF 3GVAA 1MD0A 3D5LA 1XG1A 3I4MJ 2VJ4A 4YIFA 2ECBA 3M07A 4BU2A 3K6GA 2XASA 3A0BC 4M6XA 1H9TA 3IH4A 4CDGA 3VOEA 4HQMA 2VKVA 1FMVA 2VBWA 1R5ID 3W6JB 1E0EA 5DEQA 3F6OA 4BJ5C 1HKSA 2CUJA 2DMUA 1XGSA 3KEQA 4GO1A 2W85A 3F8BA 2L4AA 4JQFA 5CVIA 4KFCA 1E3HA 3M1CA 2LF8A 2KZGA 3GTQJ 1I1SA 2J5OA 4I76A 2M4GA 1ZG1A 3G1MA 5KHDA 3DP7A 1R9TJ 2DODA 2QF7A 4CGZA 2XB5A 3MKZA 2MLKA 4V19K 1UCRA 1WKMA 3DPUA 1JGSA 3R60A 3K4JA 3QYFA 1FEXA 2LY9A 2BVLA 2O3FA 4JP0A 2KFDA 4CZZA 3JRDA 2V6CA 3RI4A 2ADUA 2XKPA 2QZ8A 1B8IA 2Y0MA 3LSIA 4RBOA 2W7NA 1VTNC 4XLCA 2XAUA 5DS9A 1FOYA 3FXMA 1Z05A 2K86A 1O4XA 3KP3A 4WCGA 4RM2A 3G1OA 4ENKA 4C30A 1LE8A 4ZYHA 5JVTA 1B72B 3E6CC 4EJOA 5HLGA 2WTEA 3DXJF 3KZYA 2FBIA 2XV4S 3LMMA 4J19A 2QGUA 5ED4A 3K4MA 3ZQIA 3QP6A 2RNGA 4HG2A 3VODA 4BEHB 1A6IA 2HS5A 3SXYA 2Y0SN 2EV6A 3V8JA 2JA7J 2XAQA 3O2PE 4RS8A 2DTZA 2G0EA 4BXFA 1P6RA 4QPQA 4LFUA 3GFLA 2L4MA 1KZHA 2R7OA 3JSPA 5FRNA 2BY3A 1QHGA 5KVRA 4BHBA 3VWBA 2ELJA 1VQ5I 2RKHA 3OYKA 1YX5A 1MBGA 5EEHA 2GIZA 2PMHA 3BR2A 2VJ5A 4ESJA 2BE5F 4BJ6C 1X4PA 1HC8A 1TWCJ 3BOQA 3M8FA 1IRXA 5DYMA 3IH3A 3K10A 1FBUA 3S15J 4PFOA 1IAWA 3HSEA 2HYFA 1IN5A 3GWZA 1T33A 4DBQA 2WY7Q 4YFNF 2A3SA 1G8XA 2WBMA 5FKMA 1R00A 3DU6A 4EM1A 2VONA 4A6EA 4JYKA 3DLLF 1Z21A 5AONA 2QQBA 1YI2I 2ZSIB 2JRTA 1RNLA 1LFPA 1QVUA 1EJ9A 4CA0A 3HOWJ 5DUIA 3ELKA 3FM5A 2DA1A 2HU9A 5FLVA 3PQKA 1X1DA 3K4KA 4XKWA 3U1KA 1ETKA 1D5VA 4M6VA 4WXCA 1UELB 1WJEA 2ZBKA 1MNDA 4B8XA 3IAS2 1W36C 4G12A 2VT3A 3OL3A 2JVGA 2EZIA 4DGWB 1REPC 1OYYA 2HFHA 2PLYA 4A5NA 3BCBA 5FKLA 4EJTA 3FXOA 5K5OA 2F6CA 4G8XA 5LRRA 1ETQA 3RPUA 3HOYJ 5CQGA 3WU1B 2LF7A 1UAAA 3HTSB 3PM1A 2DDBA 5BOXA 2ZO4A 1XGNA 2EZKA 2VT2A 3OIPA 3L00A 4A69C 4ENMA 1I27A 3M7GA 3AKZA 4HQEA 2IT0A 2WAQN 2K7LA 2DTRA 3O6BB 2P6SA 3DTKA 1BBYA 4AUXA 1P4AA 2RQPA 4HDUA 3I56I 2JA8J 4M3FA 1POGA 4ANJA 2BY0A 2R7ZJ 3ZQQA 2EZHA 1SAUA 3TOBA 4LITA 1HBXG 1YFHA 4M3GA 1IXSB 3K1PA 2A07F 3DTEA 5FJ8J 1TWGJ 4WK8F 2D1VA 2IBDA 3AL0C 2FNPA 2GQQA 1WSUA 4OINF 2W24A 5IOYA 2BBYA 4QSHA 3MMYB 2E2JJ 2KRFA 1ZHFA 3ABUA 4CCJA 3PJRA 5J4YA 2OV7A 2CH0A 3DF8A 4WXHA 3K4NA 2MH2A 2JWTA 3HOZJ 4KIBA 1ZK8A 5H2FC 2Q8KA 3LSTA 1LDDA 1Y1VJ 2LRDA 1WH7A 4RAZA 3ZCOA 3HPGA 1MJBA 3V7SA 5JR3A 2O9LA 5J1RA 1EF4A 1K4TA 3GZ5A 1K78A 2CW7A 1FNNA 1YJWI 1MH3A 1BC7C 1QPMA 2RDPA 5AIQA 3K69A 4OOIA 1H9GA 2QKMB 3GZNB 3WTWC 5H20A 2PG4A 4D0PA 3OS2A 1RUOA 1TZLA 4E7HA 4NHJA 1G3YA 2CJJA 4RB0A 1W5TA 1E3PA 3Q0VA 3ABMH 2LY1A 4KN7X 4A3FJ 2VKEA 1IUYA 5FB2A 4CYCB 4L9JA 2X4HA 5E79C 4YRVA 1GHCA 3CJNA 4A0ZA 2HOTA 2A6TA 3K1MA 2DA4A 2E7WA 3CJQB 4A3IJ 3HKZN 2R7XA 1H88C 2HWVA 3ZRGA 1IC8A 2Y69H 5FD6A 1ZR2A 3RPQA 1D5YA 3A1YA 3ZOBA 3OYLA 3CMAI 1X2NA 2CG4A 1OYIA 2Z1DA 5HNFA 3W3CA 5ICCA 5E8GA 2K4BA 4RDUA 5LGNA 2R5ZB 4A3EJ 3MZYA 2RN7A 2Z9OA 2X6YA 3DEEA 3IUOA 1SMYF 1BIBA 4Y33A 4G6QA 3WG9A 2E34A 2VL8A 5L3FA 3IP4B 1KONA 5CVJA 3CCSI 4IEJA 5IP9J 3HUGB 2BXYA 4W97A 3KX2A 3ASNH 1HSTA 2DMTA 3G3ZA 2P81A 2CS3A 1DQUA 1R4MB 1BI1A 3TEDA 2R5YA 2CO5A 4PZJA 2DA2A 1TWFJ 1QHHD 2ZFWA 3ZP5A 1BI3A 4U0YA 3EUKL 2K9SA 5F0CA 2EFOA 4EJUA 1S72I 2F4OB 3E6DA 3E6BA 5KAFC 3LAPA 1A35A 3S17J 1BI2A 3O8HA 4GYIA 2KDZA 3CD6I 3IKTA 1EH8A 4BY7J 1FBQA 2F2EA 4G7ZF 1MBFA 1JE8A 3PO3J 2XHKA 5M5WJ 2GXBA 3BG7A 1SD6A 2BXZA 2H6CA 5CYVA 3WGIA 1JKOC 1I1GA 3ECOA 1A36A 2LKXA 2X6XA 4MEXF 2DT5A 3E0JB 3JRHA 1QGPA 3QU3A 2V1DA 3OR2C 4HEA2 2CV2A 3Q9SA 4P96A 2M8EA 1R1VA 1TC3C 5D5XB 4PSWA 2LG4A 4AU7A 2O03A 1GXQA 2DK8A 2JZYA 1OCOH 2V4JC 1APLC 2NVYJ 2Z99A 3H36A 3ZQHA 4LD5A 2GBYA 2ZJPF 1DUXC 3L9FA 1S7AA 3KYLA 3ZMDA 3K4BA 2FBHA 1EKEA 1QZEA 3T5XA 4B47A 3JRCA 2ZB9A 5JLWA 5B5EC 2R7SA 1IRZA 4LB6B 2AXLA 3F72A 2HR3A 3V8LA 2ME6A 3EUHC 4I99C 3BG6A 3WHBA 2E36A 1KU2A 1VFCA 2WAQA 2W82A 1JT6A 3VYSB 4KDPA 2ME0A 3OYDA 4IHXA 1GV2A 3R0AA 2F5FA 3LSRA 2VLAA 3KP7A 2DXIA 2M1BA 4L5JA 3G4SI 1IXCA 4P9FA 3F23A 2MG4A 1VF9A 3ERMA 3VFZA 3QPTA 2X9DA 3LA3A 3S1NJ 2YX4A 2OD5A 3N4MA 1XSXA 3FK7A 3RKWA 2FX0A 4NUBA 1BR4A 2JUGA 3DKWA 3F3XA 3CLOA 1MBKA 3S2DJ 5LRSA 3V7RA 2OTLI 4ZYGA 4YG2F 4UUVA 1SMTA 3HRMA 4M6YA 2DFFA 3H35A 5F1JA 5IPAA 2GWRA 3SHFA 4L5EA 2W4SA 3BC8A 4PGHA 2JUCA 3OIOA 2PI0A 2Y2ZA 3KEYA 2RV8A 3QPHA 3GYHX 3SFZA 3QRFF 1GV5A 2ISZA 1VQ7I 1RESA 3SJMA 3CUQB 1T08B 2VBYA 1U9OA 3U9GA 1OCPA 1UFMA 1Z3XA 2H09A 2HQ5A 4Y52J 1D1AA 1SD5A 2UXXA 4XLNF 4AVPA 4KIFA 3K2AA 4X6AJ 1ACIA 4L9NA 3B6CA 5TGTA 2BY1A 1MBEA 2Y31A 5B3SH 4OWRB 3L2RA 3KYDB 4BYYA 1I6XA 3V4GA 1R71A 3JCUC 1ETVA 3LAJA 2TCTA 1P92A 1V4RA 3FISA 4JBAA 3I54A 4CH7A 4BE0A 5BNGA 5LHIA 5K1YA 2EB7A 1GLNA 4Y4RA 2VBXA 1LVKA 3SYTA 3CJRB 3M3YJ 2CYYA 4MFDA 1K6OA 3ROUA 3OS1A 1UHSA 4DIQA 2EH3A 4KT5C 3CLQA 2CUEA 2ZXJA 5C3EJ 2VIXA 1S7EA 1W7PB 3HKZA 4HAMA 2DU9A 1G3TA 1TT5B 2QBYA 1HXDA 3LQRA 3ECHA 1R6RA 4D5FA 2BHZA 3W2WA 1SEUA 1E3OC 2CGPA 4FCYA 1JT0A 4XORA 4N4NB 4B1RA 2HKXA 4DQ2A 3HZJA 5L3CA 5LBQA 2KPMA 3I59B 1TT0A 5CVRA 2CV1A 1I3AA 3QPSA 4AM3A 1OCRH 2RREA 3KIOA 1TQPA 1RKWA 2M4KA 3KE2A 1Z67A 3AG1H 1YJNI 1MDMB 3VEPA 2PMUA 1BL0A 2XKOA 3ABKH 3WTYC 3IAM2 3IRQA 3LNQA 2DPDA 4BL0B 4EGYA 4QIWN 4S0HB 4NQWB 4XLHA 3LWFA 3M9AA 5BPDA 2JRMA 4B3AA 1KYZA 3GFJA 2QUFA 3O3KA 1G4DA 5IYCJ 3CMYA 1FX7A 1DGRM 1ZN2A 3Q5FA 5TISC 2FOWA 3OYEA 1P4XA 4GCVA 2MD0A 3H3ZA 3D1NI 4CZCA 2GXGA 4CHUA 4QPOA 2BW3B 2VPRA 2VJJA 1YIJI 2LSOA 1R22A 3RYRA 4O5VA 1JHFA 5ERIA 2FQ3A 4ZDOA 2LTPA 1LEAA 1Q1HA 3L7WA 3P9KA 1JI8A 1RC9A 1XC5A 1H0MA 1ETWA 1TQIA 3ZQGA 2KJCA 2Z16A 1F9NA 2ICWG 3R61A 1RR7A 3GF2A 2H27A 2YS9A 4MFEA 3KP6A 3TW6A 2E2IJ 3BR0A 4MHGA 1VQ4I 3H92A 2EINH 3K70D 2M45A 4FT8A 1WFXA 2HXOA 3QU6A 1JKQC 2LH9A 3CCUI 2HVRA 4AIDA 1G2HA 3C18A 4I7HA 1OCTC 1YLFA 5M3MJ 1UB9A 4V2FA 3B6AA 1L0OC 1FTTA 1P7JA 1T8IA 1MH4A 1R5GA 1GT0C 1IRFA 3BCAA 3ZQFA 2AXTC 2LBFB 4FE7A 3S14J 3A2KA 3QWLA 2QCOA 2EA4A 4XLEA 2ELKA 1XDUA 4L9TA 3L1PA 1WQ2A 4A6DA 1U5TC 4E7JA 4J00A 4HA8A 2G7UA 2N8GA 1YQAA 3JAMK 2PJRB 1WGXA 2L9NA 3CCLI 2XUBA 3CMEI 4IHYA 2A05A 4FE4A 3HRSA 3REOA 4BE1A 1D3YA 5EEAA 3GTKJ 1Z77A 3BPXA 4E7KA 2O5RA 2VJIA 5EF6A 2OA4A 3BR5A 2OBPA 3IC7A 2XAHA 5D8KB 2E1OA 2FA5A 3TMOA 3PSFA 1RUNA 2PBIA 2GM4A 3KZZA 4EV0A 4CYDA 1MJ9A 2PEXA 3H5NA 2FNAA 1PUFA 5K7FA 3BZKA 3K0LA 3TO9A 3EUHA 2MABA 2CQ7A 4B3XA 1IRGA 3MZ8A 3FKJA 2CQQA 1LNWA 1O3SA 3HG9A 4BQOA 1FYKA 4QWQA 3KP4A 3OSGA 4KJZA 6PAXA 2PMZN 1HDPA 3UR3C 4A3KJ 4UVBA 1TW2A 4I2OA 5JI6A 2CQKA 2K3FA 2VE8A 1U3EM 2XF7A 3HBLA 2K27A 4HW0A 3DV8A 3OOPA 4PJ0C 4YEJA 4XMYA 4M9ZA 3OYGA 5ILUA 1RKTA 3NWSA 2EBIA 2B9SA 1U6GA 3JRBA 3QYEA 5DM7F 2MGQA 3L2WA 4A12A 5ILVA 4ITVA 2B63J 3FXQA 3HRUA 1EV7A 2QSHX 1KGSA 2M9HA 5EYRA 1UJ8A 1S8NA 2QA4I 1ZARA 2FXAA 1YRNB 4UUTA 2IXSA 2DA3A 2EV0A 3TKYA 1AHDP 2DAOA 3DLAA 5D6EA 3OV8A 4DNCA 4FASD 3F8FA 5J3LA 1UHMA 3HM5A 4I0AA 2ZMEB 5IP7J 4NNJA 3CP8A 1F43A 4R8HA 2V9VA 4RA2A 2OAZA 5FLMJ 2K5CA 4D7MA 5JHFA 5JVGF 1D0ZA 2CFXA 1MBHA 4KICA 3S3MA 4KNYA 1S7OA 2R0QC 1V5GA 1ZGJA 2HTSA 4PDKA 4X0GA 2CU7A 2KRHA 2NVXJ 2RGVA 2BV6A 5EEGA 2XRNA 2ECCA 2DFEA 2HDWA 2MA3A 1DDNA 4U7DA 1E2XA 2Q2EA 3WG7H 2VC1A 1VQ6I 1WJAA 2X0LA 1JUPA 2YR2A 2XRLA 4UVAA 1KU9A 3TW7A 4Q48A 5LD2C 3S2WA 2GXAA 3TDUC 5IYDJ 4Y7NJ 3EETA 2KLOA 1WJDA 1R7JA 3K4CA 3JAMZ 4DZPA 1IDYA 1ZGAA 3QOPA 3FZVA 4HV6A 2MBFA 2GAUA 2LK2A 3T8TA 5GADJ 1M1EB 1IGNA 4L18B 1P9QC 5KCMA 3QQAA 4XBFA 3PL8A 3ZQCA 1MIJA 3RCOA 2ZNYA 2CUFA 4L9VA 3NQOA 4Q4ZF 1TLHB 2L7ZA 2BGCA 2L9RA 3BJOA 2JA6J 2PJPA 1ZG5A 5IP6A 1QNTA 4UHTA 1FYLA 5E1ZB 1D8JA 2M34A 1Y8QB 4RGXA 3NARA 2ZMEC 1S9HA 3R0JA 4BE2A 1X58A 3Q3SA 4B43A 3OYBA 1MZBA 2AHQA 3K2ZA 3LA7A 2XSJC 1FMWA 2RVCA 5HVQC 1U78A 3VDXA 4BY1J 4ASNA 4L5IA 4E7LA 2HDDA 1PVEA 2XGXA 1XD7A 4HSRA 2KMUA 2VQCA 1K61A 1C0WA 3BZCA 1UG2A 1CQTA 3P9IA 4F7ZA 2KIMA 1OCZH 2OUMA 2OU2A 4HNTA 4EEFG 1HKTA 1O3RA 4XSZF 2LD5A 1FSHA 1MW7A 4WX9A 5K5QA 5L3BA 4ESFA 2KKOA 4A3CJ 4JOMA 2JA5J 1QVTA 4HX4A 5D4RA 4BKXA 1YITI 4FX0A 5EZHA 2EFNA 2NOGA 2X1EA 4ZC3A 1W36D 3DQVC 1GDTA 2UZKA 2M3AA 4BQNA 1R1UA 1XPXA 2KP6A 2A69F 3EQLF 5EG0A 3FIWA 3WTUC 2STWA 2DA6A 4IF4A 2RNJA 1J7KA 1W5SA 1XDSA 3R6SA 4ZH4F 2HYJA 1RPWA 3E6MA 4LG0B 4P55A 1BOAA 2CUZA 3RDIA 3EDPA 1K7AA 4CO8A 3U21A 3OS0A 4XICA 1ZREA 1MNEA 2E35A 4R1HA 5B66C 3JRIA 2IEKA 2D5VA 5FRMA 1VQ8I 1MJAA 1UMQA 3FXJA 2M8GX 3AG4H 4GRIA 2M30A 4XIDA 3GTLJ 2A5WA 2JMWA 4Q5SF 1ON1A 2KIFA 1S29A 2K85A 4BH9A 3HOXJ 2M5WA 1IV6A 2A5YB 3FXRA 1U5TA 1JUSA 4FQGA 3TBIA 2Y9YA 2XPUA 1QQIA 3BZ6A 1IO2A 2LOOA 2PMZA 3KYCB 4A3JJ 1A5JA 2L54A 5FFXA 1XTAA 3GLLA 2W25A 2DQRA 2L02A 2EFPA 2EILH 1GXPA 3J7YJ 2VE9A 4M73A 3ZN1A 3G73A 3S1QJ 2VOPA 2AO9A 4GGGA 3MWMA 3JSOA 1XB4A 1YTYA 2V6EA 2OQGA 4F55A 4EMSA 4HOBA 4UUSB 1S5LC
chains in the Genus database with same CATH topology
1PP7U 3D0SA 1MGTA 5DDGA 4HX7A 4LLGF 2Y75A 2IA2A 2W57A 3WE2A 1XMKA 1FP2A 3KCCA 2A6HF 3P7NA 3AAFA 3KLOA 1LEBA 4IHSA 1CF7B 3HOSA 5FO5A 1F4KA 2ETHA 5HDGA 2H6BA 2FOKA 1FBSA 1Z91A 2F5CA 2IPQX 1TQMA 3GO5A 2EA2A 3F21A 2QWWA 4IHTA 2NNNA 3I5UA 1T98A 1BN5A 4QLCU 1G3WA 3M1EA 1L3LA 5L3EA 1KU7A 5ILSA 4GXOA 3FMSA 2XAJA 2OQRA 5DCMB 2UXNA 4FHTA 3J81K 4EVIA 3WE3A 1T38A 4PCQA 4ZZDA 3IHUA 4K2EA 3FHZA 5L3DA 4HF1A 1B4AA 2EK5A 4GYGA 2CSOA 5CVUA 1YYVA 1WI9A 5CVVA 4A2UA 1ULYA 2VN2A 2WC2A 4G7OF 1B9MA 1HW2A 1IN4A 2BEOA 1O7FA 2EFQA 3H3UA 1USTA 3RIRA 2NRAC 1FWZA 3JTGA 3RKYA 4MTDA 4ZYDA 1FPQA 4UV8A 1AOYA 4HLYA 1RI7A 1IN7A 1O3TA 1J2XA 5HLHA 5K5RA 3I53A 1Z7UA 3BJ6A 3TO6A 3PQJA 2P7VB 3U2RA 3V8KA 2LKPA 5DCFA 2ZJ2A 3LQQA 4HDVA 5DUKA 4MQVA 2RC4A 4LB5A 3GUDA 5LHHA 4Y17A 4LK0F 1W4MA 4G94A 4BXUA 2W84A 5FD5A 2R7DA 1RIOH 2PQ8A 4BHPA 2XROA 1DPUA 4RB3C 5CLSA 1Z9CA 3I64A 1ZRFA 3ZMZA 2HKOA 2Y48A 3J81Z 3SQNA 2JT1A 2V1XA 2WV0A 2L3DA 4KA4A 2D2WA 5D5WB 4JK1X 1T39A 2ESNA 2ISYA 4M9SA 1YG2A 2G7HA 4AIKA 1E17A 1X3UA 4P5OA 2A61A 3J80K 2JPBA 3F8MA 2B0LA 4IJAA 2NYXA 2A68F 2OZUA 5JHUA 4RGUA 2HEOA 3RJPA 1NHAA 3CUQC 1JHHA 4HV5A 3F22A 1ZG3A 2IA0A 2LNBA 3DPTA 3T0YA 1EH7A 2DI3A 3HYIA 3ERED 4BHCA 4NB5A 1F5TA 1K79A 4IRHA 1ZRDA 1J75A 3WU0A 5FFZA 4IXAA 5F1RA 1UHWA 2MH9A 4P9UA 2FEZA 1I5ZA 4G6DA 4HF0A 1T6SA 3C3WA 4XRFA 4WWCA 4AWXB 2XAFA 2QLZA 1FOKA 2F5EA 2TDXA 3ZPLA 1XMAA 4A5MA 3CDHA 1K78B 2MLGA 3BY6A 3FF5A 2P5LC 3F6VA 4UXNA 2QYOA 1YW8A 5HDKA 2PFBA 2DPUA 2O0YA 4S05A 2DW4A 1LDJA 2DO7A 2K4JA 3EYYA 3Q9VA 3ABTA 5HLIA 3WTTC 3WGHA 3SZTA 3HRTA 3WODF 4G7HF 1G6NA 4MGRA 3J80Z 2YU3A 3K9TA 1JXSA 4HYEA 3TOAA 1KQ9A 2NS0A 1ZH5A 1IN6A 2O8XA 1CGPA 2OZ6A 3HUGA 4Y15A 3BDDA 3J7AO 4CICA 4Z2YA 4ESBA 4OIOF 1ZAOA 4N9HA 1YW7A 5E17F 2IA1A 5E1WA 3WTSC 1USSA 1ONVA 3BPVA 2P6TA 2ZNZA 4M9XA 2XIGA 5LEJA 3GZ6A 4CXFA 2R3SA 1XSDA 3RKXA 2IVMA 3FXUA 4HBLA 4LLNA 1SAXA 1O57A 3CUOA 5HDNA 3SZPA 2FBKA 3E97A 2R7FA 2VC0A 1S6LA 2NNYA 1BJAA 4KIGA 3WTVC 4KUMA 3ZMVA 2D45A 2YPRA 4KMFA 3GLXA 1XCBA 5TRDA 5F6FA 2EFWA 3LA2A 4MNUA 4L0ZB 1IN8A 2DLLA 4TV7A 4MQ9F 2IRFG 3HHHA 2VBZA 3TGNA 4BNCA 2HDCA 2QQAA 1QO0D 1B6AA 3KP2A 3R4KA 1TBXA 4HF2A 1FZPB 1Z6RA 4OU0A 3IWZA 3HOTA 5LLQA 4XLPF 1HW1A 3CO7C 3K1NA 5BPIA 4I98B 2GZWA 2J5PA 4AD9A 5DD8A 4HLXA 1SD4A 1QBJA 2GA1A 3RTRA 1MKMA 1HKQA 3FMRA 3TDZC 2QM3A 1FT9A 4RB2C 3CUQA 1FYMA 4EGZA 4OMYA 1KQ0A 5E1XA 2Z5UA 4A0XA 4L0YB 4KYWA 4EQQA 3GXOA 1FSEA 2JSCA 4UVCA 2D1HA 3EYIA 4AIJA 3GX4X 3ZMSA 4I01A 1LQ1A 3IWFA 3FX3A 1B9NA 2GA2A 1SFEA 5FGMA 1IW7F 1A04A 1KYWA 3MQ0A 5CJ9A 1FLIA 5D5VB 1T2KA 3N97A 1W7PA 4ZZLA 3DFGA 4YFXF 1TNTA 5FLXK 3VB2A 3WTZA 4IVNA 2QBYB 3I59A 2CWEA 2KJBA 4LJZF 3NRVA 5JFRA 1LDKB 3L09A 1MDMA 3I58A 4LLLA 1ZRCA 2IW5A 1HSJA 3L2CA 4NQWA 3ZN0A 4S04A 3JTHA 1ZLJA 4I02A 2YSRA 1KQ8A 4B09A 2E1NA 1YW9A 2ELHA 3BJAA 1Y0UA 2HTJA 1Z1DA 4OIPF 1J0RA 1ODDA 2FU4A 2P4WA 2DBBA 4M74A 3CTAA 5LEKA 5HS7A 3C7JA 3CO6C 2ESHA 2FRHA 1D8KA 3IRRA 3C1DA 1XN7A 3HTUA 3KP5A 2CW0F 4WF2A 3TQNA 2VOOA 1TW3A 2VXZA 2FE3A 2P5KA 3P9CA 5E20A 5LGUA 1OPCA 5D8LB 1SFXA 1ZLKA 4HZFA 5FLXZ 1P2FA 5H6RA 2P7CB 1FY7A 2A6EF 5D4SA 2COMA 5BS6A 3V7CA 3T1BA 1GVJA 4KN4X 5D5UB 2DQLA 1QZZA 3KETA 5LGTA 2Z33A 1YIOA 5IT9K 1XGMA 1OKRA 2JTVA 3B73A 3U1DA 5HS8A 3GEZA 4O6JA 4U0WA 5IT3A 2KIUA 3T8RA 4N0BA 4H0EA 5H6QA 4RAYA 1PUEE 1DP7P 2STTA 3FWEA 3RYPA 2VODA 5J8CA 3ZMTA 1LJ9A 3HIFA 4U88A 4U0VA 2JPCA 2ZMEA 5D6FA 2FMYA 4Y13A 4R79A 4EJWA 1HW5A 1B59A 2EJRA 4I0BA 4IRGA 3FM3A 3ULQB 1R23A 4G9YA 2V79A 4E70A 4XSXF 3BWGA 2QENA 4RGSA 4MEYF 1OYWA 1P4WA 3MAJA 1DPRA 5HS9A 4BQAA 5ICGA 5A2QK 4HX8A 1KU3A 1PP8F 2GIVA 2IP2A 1AWCA 2HQRA 2QVOA 4M71A 5KK1A 1BI0A 1R5HA 2HYGD 1FP1D 3DEUA 4RGRA 2DK5A 2QQ9A 1O7LA 1R1TA 1PDNC 2ZKZA 3ML6A 2MD5A 4I09A 2HGCA 3HSRA 3GFIA 4ZYEA 5J8FA 4LGWA 2V1UA 3E5UA 4EJVA 3FMQA 2P8TA 1XGOA 1STZA 1YO5C 2EWNA 3M8EA 1Z6TA 2G9WA 5E8IA 5L3GA 1G3SA 1B1BA 5LHGA 1S3JA 4LK1F 4OIQF 5IT9Z 4OMZA 2ACJA 3F8NA 3KLNA 2L01A 2FMLA 3BROA 4OIRF 2M87A 1R58A 1SFUA 3TO7A 3MZHA 4A0YA 1XSVA 1BM9A 2ZCWA 2FF4A 3LFKA 3MEXA 3E5QA 2PN6A 5DD4A 3PFIA 2UWMA 1WRJA 5ICEA 2C6YA 4FX4A 3W6KB 3HHGA 4ENJA 2O61A 3HSFA 1QZYA 1TNSA 4ENNA 5HOOA 1OMIA 4N9IA 4LG0A 1U2WA 1J5YA 5DV5A 1FC3A 1IZ1A 4IPAA 1KA8A 3IL2A 2H94A 2O6GE 4RB1A 4UV9A 5A2QZ 2LDUA 3I4PA 2HQNA 3E3VA 5BQTA 4IRIA 1YS6A 1OR7A 1RZ4A 2MC3A 2EV5A 2E1CA 1EH6A 4YIIA 1LVAA 3DPLC 3ZQ7A 1IF1A 1U5TB 2P5VA 3I71A 3NEUA 4ON0A 3JW4A 3KEOA 2DFIA 1TTYA 2F5DA 1HQCA 2NAZA 1W7PD 5AIPA 1BIAA 5E18F 1U8RA 3GW2A 3MFKA 4EM0B 3ISPA 3F8CA 2WWYA 3QP5A 1YS7A 4UNOA 3IKVA 3WGGA 1IXRC 2YX7A 4LMYA 3COAC 1O3QA 1F1ZA 1ON2A 1XCVA 2BYVE 5ICFA 2IJLA 1CF7A 1J59A 5F64A 3QAHA 4O3MA 2Q0OA 1R36A 1BC8C 3ZMUA 4M72A 1SD7A 3KFWX 4WXDA 3WTXC 4MTEA 3I0TA 3GFMA 1J9IA 3E5XA 2K02A 1LB2A 4AIHA 3MCZA 4EM2A 2XAGA 1V3FA 5BMZA 2HOEA 3B02A 1ZYRF 2XVCA 2E7XA 4ETSA 2Z3YA 4U7BA 3BP8A 1WWXA 5TJJA 2AS5F 4PGGA 5DCMA 4Q47A 4KMUX 2HZTA 4BAYA 1T0FA 5J6XA 2FSWA 4YFKF 3GVAA 1MD0A 3D5LA 4YIFA 2XASA 4M6XA 1H9TA 4CDGA 3VOEA 4HQMA 2VBWA 3W6JB 5DEQA 3F6OA 1HKSA 1XGSA 3KEQA 4GO1A 2W85A 3F8BA 2L4AA 4JQFA 5CVIA 4KFCA 2LF8A 1I1SA 2J5OA 1ZG1A 3DP7A 4CGZA 2MLKA 1UCRA 1WKMA 1JGSA 3R60A 2O3FA 4CZZA 2V6CA 3RI4A 2ADUA 2XKPA 2QZ8A 2Y0MA 1VTNC 1Z05A 2K86A 3KP3A 4WCGA 4ENKA 4ZYHA 5JVTA 3E6CC 4EJOA 5HLGA 2WTEA 3DXJF 3KZYA 2FBIA 2XV4S 5ED4A 3QP6A 3VODA 2HS5A 3SXYA 2EV6A 3V8JA 2XAQA 3O2PE 4RS8A 1P6RA 4LFUA 3GFLA 2L4MA 3JSPA 5KVRA 4BHBA 2RKHA 5EEHA 2PMHA 4ESJA 2BE5F 3BOQA 3M8FA 5DYMA 1FBUA 1IAWA 3HSEA 2HYFA 1IN5A 3GWZA 4YFNF 2A3SA 1R00A 4EM1A 2VONA 4A6EA 5AONA 2QQBA 2JRTA 1RNLA 5DUIA 3ELKA 3FM5A 3PQKA 1D5VA 4WXCA 2ZBKA 4B8XA 2VT3A 1REPC 1OYYA 2HFHA 2PLYA 4A5NA 4EJTA 5K5OA 4G8XA 5LRRA 3RPUA 3WU1B 2LF7A 3HTSB 5BOXA 2ZO4A 1XGNA 2VT2A 3L00A 4ENMA 1I27A 3M7GA 4HQEA 2IT0A 2K7LA 2DTRA 3O6BB 2P6SA 1BBYA 1P4AA 2RQPA 4HDUA 3TOBA 1HBXG 1YFHA 2A07F 1IXSB 3K1PA 4WK8F 2D1VA 2FNPA 2GQQA 1WSUA 4OINF 2W24A 2BBYA 2KRFA 1ZHFA 3ABUA 3DF8A 4WXHA 2MH2A 4KIBA 2Q8KA 3LSTA 1LDDA 4RAZA 1MJBA 3V7SA 5JR3A 3GZ5A 1K78A 1FNNA 1BC7C 1QPMA 2RDPA 5AIQA 3K69A 4OOIA 1H9GA 3WTWC 5H20A 2PG4A 4D0PA 1RUOA 4NHJA 1G3YA 4RB0A 1W5TA 4KN7X 1IUYA 5FB2A 4L9JA 2X4HA 1GHCA 3CJNA 4A0ZA 3K1MA 2E7WA 2HWVA 5FD6A 3RPQA 2CG4A 1OYIA 5ICCA 5E8GA 2K4BA 5LGNA 3MZYA 2RN7A 2Z9OA 1SMYF 1BIBA 4G6QA 3WG9A 5L3FA 5CVJA 1HSTA 3G3ZA 1BI1A 2CO5A 4PZJA 2ZFWA 3ZP5A 1BI3A 4U0YA 2EFOA 4EJUA 3E6DA 3E6BA 3LAPA 1BI2A 4GYIA 3IKTA 1EH8A 1FBQA 2F2EA 4G7ZF 1JE8A 2XHKA 2GXBA 1SD6A 2H6CA 5CYVA 3WGIA 1I1GA 3ECOA 4MEXF 2DT5A 1QGPA 3QU3A 2V1DA 3Q9SA 4P96A 2M8EA 1R1VA 5D5XB 2O03A 1GXQA 2DK8A 2JZYA 2Z99A 4LD5A 1DUXC 3L9FA 1S7AA 3ZMDA 2FBHA 3T5XA 4LB6B 2AXLA 3F72A 2HR3A 3V8LA 1KU2A 4KDPA 3R0AA 2F5FA 3KP7A 2M1BA 4L5JA 3F23A 1IXCA 4P9FA 3VFZA 3QPTA 3LA3A 2YX4A 2OD5A 3N4MA 1XSXA 3RKWA 3DKWA 3F3XA 3CLOA 5LRSA 3V7RA 4ZYGA 4YG2F 4UUVA 1SMTA 3HRMA 4M6YA 2GWRA 3SHFA 2PI0A 4PGHA 2RV8A 3QPHA 3GYHX 3SFZA 3QRFF 2ISZA 3CUQB 2VBYA 3U9GA 1UFMA 2H09A 1SD5A 2UXXA 4XLNF 4AVPA 4KIFA 4L9NA 4BYYA 1I6XA 3V4GA 3LAJA 1P92A 1V4RA 4JBAA 3I54A 5LHIA 5K1YA 2EB7A 2VBXA 2CYYA 1K6OA 3ROUA 4KT5C 2ZXJA 1W7PB 4HAMA 2DU9A 1G3TA 2QBYA 1HXDA 3LQRA 3ECHA 2CGPA 2HKXA 4DQ2A 5L3CA 5LBQA 3I59B 5CVRA 1TQPA 3KE2A 1MDMB 3VEPA 2PMUA 2XKOA 3WTYC 3IRQA 2DPDA 4EGYA 3LWFA 3M9AA 5BPDA 1KYZA 3GFJA 2QUFA 3O3KA 1G4DA 1FX7A 1ZN2A 3Q5FA 1P4XA 4GCVA 3H3ZA 2GXGA 4CHUA 2LSOA 1R22A 3RYRA 4O5VA 1JHFA 5ERIA 2FQ3A 1LEAA 1Q1HA 3L7WA 3P9KA 1H0MA 1TQIA 2KJCA 1F9NA 3R61A 3GF2A 2H27A 3KP6A 4MHGA 3H92A 2M45A 4FT8A 3QU6A 3C18A 4I7HA 1YLFA 1UB9A 1L0OC 1R5GA 1IRFA 2EA4A 1XDUA 4L9TA 1WQ2A 4A6DA 1U5TC 4HA8A 2G7UA 1YQAA 3JAMK 2XUBA 3HRSA 3REOA 1D3YA 3BPXA 2OA4A 3IC7A 2OBPA 2XAHA 5D8KB 2FA5A 1RUNA 2PBIA 3KZZA 4EV0A 4CYDA 1MJ9A 2PEXA 2FNAA 3K0LA 3TO9A 3EUHA 1IRGA 1LNWA 1O3SA 1FYKA 4QWQA 3KP4A 6PAXA 4UVBA 1TW2A 4I2OA 5JI6A 2CQKA 1U3EM 2VE8A 2K27A 4HW0A 3DV8A 3OOPA 4M9ZA 5ILUA 1U6GA 4A12A 5ILVA 3FXQA 3HRUA 1EV7A 1KGSA 1S8NA 1ZARA 2FXAA 3TKYA 2EV0A 2DAOA 5D6EA 3OV8A 4DNCA 3F8FA 1UHMA 4I0AA 2ZMEB 4R8HA 2V9VA 2OAZA 2CFXA 4KICA 4KNYA 1S7OA 1ZGJA 2HTSA 4PDKA 2RGVA 2BV6A 5EEGA 2XRNA 2MA3A 1DDNA 4U7DA 1E2XA 2Q2EA 2VC1A 2X0LA 2YR2A 4UVAA 1KU9A 4Q48A 3S2WA 3TDUC 3EETA 1R7JA 3JAMZ 1ZGAA 3QOPA 3FZVA 4HV6A 2MBFA 2GAUA 3T8TA 4L18B 4XBFA 2ZNYA 4L9VA 3NQOA 4Q4ZF 1TLHB 2BGCA 3BJOA 2PJPA 1ZG5A 1QNTA 4UHTA 1FYLA 5E1ZB 1D8JA 4RGXA 3R0JA 1MZBA 3K2ZA 3LA7A 2RVCA 5HVQC 1U78A 4ASNA 4L5IA 2XGXA 1XD7A 1C0WA 3P9IA 4F7ZA 2KIMA 2OU2A 1HKTA 1O3RA 4XSZF 1FSHA 4WX9A 5K5QA 5L3BA 4ESFA 2KKOA 4HX4A 5D4RA 4FX0A 2EFNA 3DQVC 2UZKA 1R1UA 2A69F 3EQLF 3WTUC 2STWA 4IF4A 2RNJA 1J7KA 1W5SA 1XDSA 4ZH4F 3R6SA 3E6MA 4LG0B 4P55A 1BOAA 3RDIA 3EDPA 1K7AA 4CO8A 1ZREA 4R1HA 1MJAA 2M30A 4Q5SF 1ON1A 2KIFA 1S29A 4BH9A 2M5WA 2A5YB 3FXRA 1U5TA 1QQIA 3BZ6A 2L54A 5FFXA 2W25A 2DQRA 2L02A 2EFPA 1GXPA 2VE9A 4M73A 3ZN1A 3G73A 2VOPA 4GGGA 3MWMA 3JSOA 1XB4A 1YTYA 2OQGA 4EMSA 4HOBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1PP7 U;  3D0S A;  1MGT A;  5DDG A;  4HX7 A;  4LLG F;  2Y75 A;  2IA2 A;  2W57 A;  3WE2 A;  1XMK A;  1FP2 A;  3KCC A;  2A6H F;  3P7N A;  3AAF A;  3KLO A;  1LEB A;  4IHS A;  1CF7 B;  3HOS A;  5FO5 A;  1F4K A;  2ETH A;  5HDG A;  2H6B A;  2FOK A;  1FBS A;  1Z91 A;  2F5C A;  2IPQ X;  1TQM A;  3GO5 A;  2EA2 A;  3F21 A;  2QWW A;  4IHT A;  2NNN A;  3I5U A;  1T98 A;  1BN5 A;  4QLC U;  1G3W A;  3M1E A;  1L3L A;  5L3E A;  1KU7 A;  5ILS A;  4GXO A;  3FMS A;  2XAJ A;  2OQR A;  5DCM B;  2UXN A;  4FHT A;  3J81 K;  4EVI A;  3WE3 A;  1T38 A;  4PCQ A;  4ZZD A;  3IHU A;  4K2E A;  3FHZ A;  5L3D A;  4HF1 A;  1B4A A;  2EK5 A;  4GYG A;  2CSO A;  5CVU A;  1YYV A;  1WI9 A;  5CVV A;  4A2U A;  1ULY A;  2VN2 A;  2WC2 A;  4G7O F;  1B9M A;  1HW2 A;  1IN4 A;  2BEO A;  1O7F A;  2EFQ A;  3H3U A;  1UST A;  3RIR A;  2NRA C;  1FWZ A;  3JTG A;  3RKY A;  4MTD A;  4ZYD A;  1FPQ A;  4UV8 A;  1AOY A;  4HLY A;  1RI7 A;  1IN7 A;  1O3T A;  1J2X A;  5HLH A;  5K5R A;  3I53 A;  1Z7U A;  3BJ6 A;  3TO6 A;  3PQJ A;  2P7V B;  3U2R A;  3V8K A;  2LKP A;  5DCF A;  2ZJ2 A;  3LQQ A;  4HDV A;  5DUK A;  4MQV A;  2RC4 A;  4LB5 A;  3GUD A;  5LHH A;  4Y17 A;  4LK0 F;  1W4M A;  4G94 A;  4BXU A;  2W84 A;  5FD5 A;  2R7D A;  1RIO H;  2PQ8 A;  4BHP A;  2XRO A;  1DPU A;  4RB3 C;  5CLS A;  1Z9C A;  3I64 A;  1ZRF A;  3ZMZ A;  2HKO A;  2Y48 A;  3J81 Z;  3SQN A;  2JT1 A;  2V1X A;  2WV0 A;  2L3D A;  4KA4 A;  2D2W A;  5D5W B;  4JK1 X;  1T39 A;  2ESN A;  2ISY A;  4M9S A;  1YG2 A;  2G7H A;  4AIK A;  1E17 A;  1X3U A;  4P5O A;  2A61 A;  3J80 K;  2JPB A;  3F8M A;  2B0L A;  4IJA A;  2NYX A;  2A68 F;  2OZU A;  5JHU A;  4RGU A;  2HEO A;  3RJP A;  1NHA A;  3CUQ C;  1JHH A;  4HV5 A;  3F22 A;  1ZG3 A;  2IA0 A;  2LNB A;  3DPT A;  3T0Y A;  1EH7 A;  2DI3 A;  3HYI A;  3ERE D;  4BHC A;  4NB5 A;  1F5T A;  1K79 A;  4IRH A;  1ZRD A;  1J75 A;  3WU0 A;  5FFZ A;  4IXA A;  5F1R A;  1UHW A;  2MH9 A;  4P9U A;  2FEZ A;  1I5Z A;  4G6D A;  4HF0 A;  1T6S A;  3C3W A;  4XRF A;  4WWC A;  4AWX B;  2XAF A;  2QLZ A;  1FOK A;  2F5E A;  2TDX A;  3ZPL A;  1XMA A;  4A5M A;  3CDH A;  1K78 B;  2MLG A;  3BY6 A;  3FF5 A;  2P5L C;  3F6V A;  4UXN A;  2QYO A;  1YW8 A;  5HDK A;  2PFB A;  2DPU A;  2O0Y A;  4S05 A;  2DW4 A;  1LDJ A;  2DO7 A;  2K4J A;  3EYY A;  3Q9V A;  3ABT A;  5HLI A;  3WTT C;  3WGH A;  3SZT A;  3HRT A;  3WOD F;  4G7H F;  1G6N A;  4MGR A;  3J80 Z;  2YU3 A;  3K9T A;  1JXS A;  4HYE A;  3TOA A;  1KQ9 A;  2NS0 A;  1ZH5 A;  1IN6 A;  2O8X A;  1CGP A;  2OZ6 A;  3HUG A;  4Y15 A;  3BDD A;  3J7A O;  4CIC A;  4Z2Y A;  4ESB A;  4OIO F;  1ZAO A;  4N9H A;  1YW7 A;  5E17 F;  2IA1 A;  5E1W A;  3WTS C;  1USS A;  1ONV A;  3BPV A;  2P6T A;  2ZNZ A;  4M9X A;  2XIG A;  5LEJ A;  3GZ6 A;  4CXF A;  2R3S A;  1XSD A;  3RKX A;  2IVM A;  3FXU A;  4HBL A;  4LLN A;  1SAX A;  1O57 A;  3CUO A;  5HDN A;  3SZP A;  2FBK A;  3E97 A;  2R7F A;  2VC0 A;  1S6L A;  2NNY A;  1BJA A;  4KIG A;  3WTV C;  4KUM A;  3ZMV A;  2D45 A;  2YPR A;  4KMF A;  3GLX A;  1XCB A;  5TRD A;  5F6F A;  2EFW A;  3LA2 A;  4MNU A;  4L0Z B;  1IN8 A;  2DLL A;  4TV7 A;  4MQ9 F;  2IRF G;  3HHH A;  2VBZ A;  3TGN A;  4BNC A;  2HDC A;  2QQA A;  1QO0 D;  1B6A A;  3KP2 A;  3R4K A;  1TBX A;  4HF2 A;  1FZP B;  1Z6R A;  4OU0 A;  3IWZ A;  3HOT A;  5LLQ A;  4XLP F;  1HW1 A;  3CO7 C;  3K1N A;  5BPI A;  4I98 B;  2GZW A;  2J5P A;  4AD9 A;  5DD8 A;  4HLX A;  1SD4 A;  1QBJ A;  2GA1 A;  3RTR A;  1MKM A;  1HKQ A;  3FMR A;  3TDZ C;  2QM3 A;  1FT9 A;  4RB2 C;  3CUQ A;  1FYM A;  4EGZ A;  4OMY A;  1KQ0 A;  5E1X A;  2Z5U A;  4A0X A;  4L0Y B;  4KYW A;  4EQQ A;  3GXO A;  1FSE A;  2JSC A;  4UVC A;  2D1H A;  3EYI A;  4AIJ A;  3GX4 X;  3ZMS A;  4I01 A;  1LQ1 A;  3IWF A;  3FX3 A;  1B9N A;  2GA2 A;  1SFE A;  5FGM A;  1IW7 F;  1A04 A;  1KYW A;  3MQ0 A;  5CJ9 A;  1FLI A;  5D5V B;  1T2K A;  3N97 A;  1W7P A;  4ZZL A;  3DFG A;  4YFX F;  1TNT A;  5FLX K;  3VB2 A;  3WTZ A;  4IVN A;  2QBY B;  3I59 A;  2CWE A;  2KJB A;  4LJZ F;  3NRV A;  5JFR A;  1LDK B;  3L09 A;  1MDM A;  3I58 A;  4LLL A;  1ZRC A;  2IW5 A;  1HSJ A;  3L2C A;  4NQW A;  3ZN0 A;  4S04 A;  3JTH A;  1ZLJ A;  4I02 A;  2YSR A;  1KQ8 A;  4B09 A;  2E1N A;  1YW9 A;  2ELH A;  3BJA A;  1Y0U A;  2HTJ A;  1Z1D A;  4OIP F;  1J0R A;  1ODD A;  2FU4 A;  2P4W A;  2DBB A;  4M74 A;  3CTA A;  5LEK A;  5HS7 A;  3C7J A;  3CO6 C;  2ESH A;  2FRH A;  1D8K A;  3IRR A;  3C1D A;  1XN7 A;  3HTU A;  3KP5 A;  2CW0 F;  4WF2 A;  3TQN A;  2VOO A;  1TW3 A;  2VXZ A;  2FE3 A;  2P5K A;  3P9C A;  5E20 A;  5LGU A;  1OPC A;  5D8L B;  1SFX A;  1ZLK A;  4HZF A;  5FLX Z;  1P2F A;  5H6R A;  2P7C B;  1FY7 A;  2A6E F;  5D4S A;  2COM A;  5BS6 A;  3V7C A;  3T1B A;  1GVJ A;  4KN4 X;  5D5U B;  2DQL A;  1QZZ A;  3KET A;  5LGT A;  2Z33 A;  1YIO A;  5IT9 K;  1XGM A;  1OKR A;  2JTV A;  3B73 A;  3U1D A;  5HS8 A;  3GEZ A;  4O6J A;  4U0W A;  5IT3 A;  2KIU A;  3T8R A;  4N0B A;  4H0E A;  5H6Q A;  4RAY A;  1PUE E;  1DP7 P;  2STT A;  3FWE A;  3RYP A;  2VOD A;  5J8C A;  3ZMT A;  1LJ9 A;  3HIF A;  4U88 A;  4U0V A;  2JPC A;  2ZME A;  5D6F A;  2FMY A;  4Y13 A;  4R79 A;  4EJW A;  1HW5 A;  1B59 A;  2EJR A;  4I0B A;  4IRG A;  3FM3 A;  3ULQ B;  1R23 A;  4G9Y A;  2V79 A;  4E70 A;  4XSX F;  3BWG A;  2QEN A;  4RGS A;  4MEY F;  1OYW A;  1P4W A;  3MAJ A;  1DPR A;  5HS9 A;  4BQA A;  5ICG A;  5A2Q K;  4HX8 A;  1KU3 A;  1PP8 F;  2GIV A;  2IP2 A;  1AWC A;  2HQR A;  2QVO A;  4M71 A;  5KK1 A;  1BI0 A;  1R5H A;  2HYG D;  1FP1 D;  3DEU A;  4RGR A;  2DK5 A;  2QQ9 A;  1O7L A;  1R1T A;  1PDN C;  2ZKZ A;  3ML6 A;  2MD5 A;  4I09 A;  2HGC A;  3HSR A;  3GFI A;  4ZYE A;  5J8F A;  4LGW A;  2V1U A;  3E5U A;  4EJV A;  3FMQ A;  2P8T A;  1XGO A;  1STZ A;  1YO5 C;  2EWN A;  3M8E A;  1Z6T A;  2G9W A;  5E8I A;  5L3G A;  1G3S A;  1B1B A;  5LHG A;  1S3J A;  4LK1 F;  4OIQ F;  5IT9 Z;  4OMZ A;  2ACJ A;  3F8N A;  3KLN A;  2L01 A;  2FML A;  3BRO A;  4OIR F;  2M87 A;  1R58 A;  1SFU A;  3TO7 A;  3MZH A;  4A0Y A;  1XSV A;  1BM9 A;  2ZCW A;  2FF4 A;  3LFK A;  3MEX A;  3E5Q A;  2PN6 A;  5DD4 A;  3PFI A;  2UWM A;  1WRJ A;  5ICE A;  2C6Y A;  4FX4 A;  3W6K B;  3HHG A;  4ENJ A;  2O61 A;  3HSF A;  1QZY A;  1TNS A;  4ENN A;  5HOO A;  1OMI A;  4N9I A;  4LG0 A;  1U2W A;  1J5Y A;  5DV5 A;  1FC3 A;  1IZ1 A;  4IPA A;  1KA8 A;  3IL2 A;  2H94 A;  2O6G E;  4RB1 A;  4UV9 A;  5A2Q Z;  2LDU A;  3I4P A;  2HQN A;  3E3V A;  5BQT A;  4IRI A;  1YS6 A;  1OR7 A;  1RZ4 A;  2MC3 A;  2EV5 A;  2E1C A;  1EH6 A;  4YII A;  1LVA A;  3DPL C;  3ZQ7 A;  1IF1 A;  1U5T B;  2P5V A;  3I71 A;  3NEU A;  4ON0 A;  3JW4 A;  3KEO A;  2DFI A;  1TTY A;  2F5D A;  1HQC A;  2NAZ A;  1W7P D;  5AIP A;  1BIA A;  5E18 F;  1U8R A;  3GW2 A;  3MFK A;  4EM0 B;  3ISP A;  3F8C A;  2WWY A;  3QP5 A;  1YS7 A;  4UNO A;  3IKV A;  3WGG A;  1IXR C;  2YX7 A;  4LMY A;  3COA C;  1O3Q A;  1F1Z A;  1ON2 A;  1XCV A;  2BYV E;  5ICF A;  2IJL A;  1CF7 A;  1J59 A;  5F64 A;  3QAH A;  4O3M A;  2Q0O A;  1R36 A;  1BC8 C;  3ZMU A;  4M72 A;  1SD7 A;  3KFW X;  4WXD A;  3WTX C;  4MTE A;  3I0T A;  3GFM A;  1J9I A;  3E5X A;  2K02 A;  1LB2 A;  4AIH A;  3MCZ A;  4EM2 A;  2XAG A;  1V3F A;  5BMZ A;  2HOE A;  3B02 A;  1ZYR F;  2XVC A;  2E7X A;  4ETS A;  2Z3Y A;  4U7B A;  3BP8 A;  1WWX A;  5TJJ A;  2AS5 F;  4PGG A;  5DCM A;  4Q47 A;  4KMU X;  2HZT A;  4BAY A;  1T0F A;  5J6X A;  2FSW A;  4YFK F;  3GVA A;  1MD0 A;  3D5L A;  4YIF A;  2XAS A;  4M6X A;  1H9T A;  4CDG A;  3VOE A;  4HQM A;  2VBW A;  3W6J B;  5DEQ A;  3F6O A;  1HKS A;  1XGS A;  3KEQ A;  4GO1 A;  2W85 A;  3F8B A;  2L4A A;  4JQF A;  5CVI A;  4KFC A;  2LF8 A;  1I1S A;  2J5O A;  1ZG1 A;  3DP7 A;  4CGZ A;  2MLK A;  1UCR A;  1WKM A;  1JGS A;  3R60 A;  2O3F A;  4CZZ A;  2V6C A;  3RI4 A;  2ADU A;  2XKP A;  2QZ8 A;  2Y0M A;  1VTN C;  1Z05 A;  2K86 A;  3KP3 A;  4WCG A;  4ENK A;  4ZYH A;  5JVT A;  3E6C C;  4EJO A;  5HLG A;  2WTE A;  3DXJ F;  3KZY A;  2FBI A;  2XV4 S;  5ED4 A;  3QP6 A;  3VOD A;  2HS5 A;  3SXY A;  2EV6 A;  3V8J A;  2XAQ A;  3O2P E;  4RS8 A;  1P6R A;  4LFU A;  3GFL A;  2L4M A;  3JSP A;  5KVR A;  4BHB A;  2RKH A;  5EEH A;  2PMH A;  4ESJ A;  2BE5 F;  3BOQ A;  3M8F A;  5DYM A;  1FBU A;  1IAW A;  3HSE A;  2HYF A;  1IN5 A;  3GWZ A;  4YFN F;  2A3S A;  1R00 A;  4EM1 A;  2VON A;  4A6E A;  5AON A;  2QQB A;  2JRT A;  1RNL A;  5DUI A;  3ELK A;  3FM5 A;  3PQK A;  1D5V A;  4WXC A;  2ZBK A;  4B8X A;  2VT3 A;  1REP C;  1OYY A;  2HFH A;  2PLY A;  4A5N A;  4EJT A;  5K5O A;  4G8X A;  5LRR A;  3RPU A;  3WU1 B;  2LF7 A;  3HTS B;  5BOX A;  2ZO4 A;  1XGN A;  2VT2 A;  3L00 A;  4ENM A;  1I27 A;  3M7G A;  4HQE A;  2IT0 A;  2K7L A;  2DTR A;  3O6B B;  2P6S A;  1BBY A;  1P4A A;  2RQP A;  4HDU A;  3TOB A;  1HBX G;  1YFH A;  2A07 F;  1IXS B;  3K1P A;  4WK8 F;  2D1V A;  2FNP A;  2GQQ A;  1WSU A;  4OIN F;  2W24 A;  2BBY A;  2KRF A;  1ZHF A;  3ABU A;  3DF8 A;  4WXH A;  2MH2 A;  4KIB A;  2Q8K A;  3LST A;  1LDD A;  4RAZ A;  1MJB A;  3V7S A;  5JR3 A;  3GZ5 A;  1K78 A;  1FNN A;  1BC7 C;  1QPM A;  2RDP A;  5AIQ A;  3K69 A;  4OOI A;  1H9G A;  3WTW C;  5H20 A;  2PG4 A;  4D0P A;  1RUO A;  4NHJ A;  1G3Y A;  4RB0 A;  1W5T A;  4KN7 X;  1IUY A;  5FB2 A;  4L9J A;  2X4H A;  1GHC A;  3CJN A;  4A0Z A;  3K1M A;  2E7W A;  2HWV A;  5FD6 A;  3RPQ A;  2CG4 A;  1OYI A;  5ICC A;  5E8G A;  2K4B A;  5LGN A;  3MZY A;  2RN7 A;  2Z9O A;  1SMY F;  1BIB A;  4G6Q A;  3WG9 A;  5L3F A;  5CVJ A;  1HST A;  3G3Z A;  1BI1 A;  2CO5 A;  4PZJ A;  2ZFW A;  3ZP5 A;  1BI3 A;  4U0Y A;  2EFO A;  4EJU A;  3E6D A;  3E6B A;  3LAP A;  1BI2 A;  4GYI A;  3IKT A;  1EH8 A;  1FBQ A;  2F2E A;  4G7Z F;  1JE8 A;  2XHK A;  2GXB A;  1SD6 A;  2H6C A;  5CYV A;  3WGI A;  1I1G A;  3ECO A;  4MEX F;  2DT5 A;  1QGP A;  3QU3 A;  2V1D A;  3Q9S A;  4P96 A;  2M8E A;  1R1V A;  5D5X B;  2O03 A;  1GXQ A;  2DK8 A;  2JZY A;  2Z99 A;  4LD5 A;  1DUX C;  3L9F A;  1S7A A;  3ZMD A;  2FBH A;  3T5X A;  4LB6 B;  2AXL A;  3F72 A;  2HR3 A;  3V8L A;  1KU2 A;  4KDP A;  3R0A A;  2F5F A;  3KP7 A;  2M1B A;  4L5J A;  3F23 A;  1IXC A;  4P9F A;  3VFZ A;  3QPT A;  3LA3 A;  2YX4 A;  2OD5 A;  3N4M A;  1XSX A;  3RKW A;  3DKW A;  3F3X A;  3CLO A;  5LRS A;  3V7R A;  4ZYG A;  4YG2 F;  4UUV A;  1SMT A;  3HRM A;  4M6Y A;  2GWR A;  3SHF A;  2PI0 A;  4PGH A;  2RV8 A;  3QPH A;  3GYH X;  3SFZ A;  3QRF F;  2ISZ A;  3CUQ B;  2VBY A;  3U9G A;  1UFM A;  2H09 A;  1SD5 A;  2UXX A;  4XLN F;  4AVP A;  4KIF A;  4L9N A;  4BYY A;  1I6X A;  3V4G A;  3LAJ A;  1P92 A;  1V4R A;  4JBA A;  3I54 A;  5LHI A;  5K1Y A;  2EB7 A;  2VBX A;  2CYY A;  1K6O A;  3ROU A;  4KT5 C;  2ZXJ A;  1W7P B;  4HAM A;  2DU9 A;  1G3T A;  2QBY A;  1HXD A;  3LQR A;  3ECH A;  2CGP A;  2HKX A;  4DQ2 A;  5L3C A;  5LBQ A;  3I59 B;  5CVR A;  1TQP A;  3KE2 A;  1MDM B;  3VEP A;  2PMU A;  2XKO A;  3WTY C;  3IRQ A;  2DPD A;  4EGY A;  3LWF A;  3M9A A;  5BPD A;  1KYZ A;  3GFJ A;  2QUF A;  3O3K A;  1G4D A;  1FX7 A;  1ZN2 A;  3Q5F A;  1P4X A;  4GCV A;  3H3Z A;  2GXG A;  4CHU A;  2LSO A;  1R22 A;  3RYR A;  4O5V A;  1JHF A;  5ERI A;  2FQ3 A;  1LEA A;  1Q1H A;  3L7W A;  3P9K A;  1H0M A;  1TQI A;  2KJC A;  1F9N A;  3R61 A;  3GF2 A;  2H27 A;  3KP6 A;  4MHG A;  3H92 A;  2M45 A;  4FT8 A;  3QU6 A;  3C18 A;  4I7H A;  1YLF A;  1UB9 A;  1L0O C;  1R5G A;  1IRF A;  2EA4 A;  1XDU A;  4L9T A;  1WQ2 A;  4A6D A;  1U5T C;  4HA8 A;  2G7U A;  1YQA A;  3JAM K;  2XUB A;  3HRS A;  3REO A;  1D3Y A;  3BPX A;  2OA4 A;  3IC7 A;  2OBP A;  2XAH A;  5D8K B;  2FA5 A;  1RUN A;  2PBI A;  3KZZ A;  4EV0 A;  4CYD A;  1MJ9 A;  2PEX A;  2FNA A;  3K0L A;  3TO9 A;  3EUH A;  1IRG A;  1LNW A;  1O3S A;  1FYK A;  4QWQ A;  3KP4 A;  6PAX A;  4UVB A;  1TW2 A;  4I2O A;  5JI6 A;  2CQK A;  1U3E M;  2VE8 A;  2K27 A;  4HW0 A;  3DV8 A;  3OOP A;  4M9Z A;  5ILU A;  1U6G A;  4A12 A;  5ILV A;  3FXQ A;  3HRU A;  1EV7 A;  1KGS A;  1S8N A;  1ZAR A;  2FXA A;  3TKY A;  2EV0 A;  2DAO A;  5D6E A;  3OV8 A;  4DNC A;  3F8F A;  1UHM A;  4I0A A;  2ZME B;  4R8H A;  2V9V A;  2OAZ A;  2CFX A;  4KIC A;  4KNY A;  1S7O A;  1ZGJ A;  2HTS A;  4PDK A;  2RGV A;  2BV6 A;  5EEG A;  2XRN A;  2MA3 A;  1DDN A;  4U7D A;  1E2X A;  2Q2E A;  2VC1 A;  2X0L A;  2YR2 A;  4UVA A;  1KU9 A;  4Q48 A;  3S2W A;  3TDU C;  3EET A;  1R7J A;  3JAM Z;  1ZGA A;  3QOP A;  3FZV A;  4HV6 A;  2MBF A;  2GAU A;  3T8T A;  4L18 B;  4XBF A;  2ZNY A;  4L9V A;  3NQO A;  4Q4Z F;  1TLH B;  2BGC A;  3BJO A;  2PJP A;  1ZG5 A;  1QNT A;  4UHT A;  1FYL A;  5E1Z B;  1D8J A;  4RGX A;  3R0J A;  1MZB A;  3K2Z A;  3LA7 A;  2RVC A;  5HVQ C;  1U78 A;  4ASN A;  4L5I A;  2XGX A;  1XD7 A;  1C0W A;  3P9I A;  4F7Z A;  2KIM A;  2OU2 A;  1HKT A;  1O3R A;  4XSZ F;  1FSH A;  4WX9 A;  5K5Q A;  5L3B A;  4ESF A;  2KKO A;  4HX4 A;  5D4R A;  4FX0 A;  2EFN A;  3DQV C;  2UZK A;  1R1U A;  2A69 F;  3EQL F;  3WTU C;  2STW A;  4IF4 A;  2RNJ A;  1J7K A;  1W5S A;  1XDS A;  4ZH4 F;  3R6S A;  3E6M A;  4LG0 B;  4P55 A;  1BOA A;  3RDI A;  3EDP A;  1K7A A;  4CO8 A;  1ZRE A;  4R1H A;  1MJA A;  2M30 A;  4Q5S F;  1ON1 A;  2KIF A;  1S29 A;  4BH9 A;  2M5W A;  2A5Y B;  3FXR A;  1U5T A;  1QQI A;  3BZ6 A;  2L54 A;  5FFX A;  2W25 A;  2DQR A;  2L02 A;  2EFP A;  1GXP A;  2VE9 A;  4M73 A;  3ZN1 A;  3G73 A;  2VOP A;  4GGG A;  3MWM A;  3JSO A;  1XB4 A;  1YTY A;  2OQG A;  4EMS A;  4HOB A; 
#chains in the Genus database with same CATH topology
 1PP7 U;  3D0S A;  1MGT A;  5DDG A;  4HX7 A;  2LRE A;  5CKT A;  3MKW B;  2VKH A;  3A01 A;  4LLG F;  5GPA A;  2R4G A;  1EA3 A;  1FIP A;  2Y75 A;  2IA2 A;  1AKH B;  3TL4 X;  2VPL A;  3GCM A;  2W57 A;  1WH5 A;  2IGN A;  3WE2 A;  1XMK A;  2OF7 A;  3CCR I;  1FP2 A;  3KCC A;  1MMN A;  2A6H F;  3P7N A;  3AAF A;  3S3O A;  3KLO A;  1LEB A;  4IHS A;  2AQE A;  2ZXW H;  1CF7 B;  3S16 J;  2L7M P;  4XRM A;  3HOS A;  3H5R A;  5EJC A;  2FD5 A;  5HLT A;  5FO5 A;  1YOV B;  1F4K A;  2ETH A;  5HDG A;  2H6B A;  4N4O B;  1OR7 C;  2FOK A;  1FBS A;  1D0Y A;  1Z91 A;  3CCQ I;  4RLQ A;  1K4S A;  2R7R A;  2F5C A;  2HXI A;  1TQM A;  2IPQ X;  3GO5 A;  2EA2 A;  3TP3 A;  3L2Q A;  4A3D J;  2CQN A;  3F21 A;  1I3Q J;  1LFU P;  1MNM C;  2QWW A;  1HCR A;  1VI0 A;  3IH2 A;  4RMN A;  2HQA A;  2X6W A;  5EGO A;  1TL8 A;  1JKR C;  4IHT A;  2CMP A;  3A03 A;  2NNN A;  3I5U A;  1WPK A;  5F0F A;  1T98 A;  1BN5 A;  4QLC U;  1G3W A;  1Y8R B;  3M1E A;  5E3M A;  3J7A Y;  2K9M A;  1L3L A;  5L3E A;  1KU7 A;  5ILS A;  4PK4 A;  4GXO A;  3FMS A;  2XAJ A;  2OQR A;  4BXX J;  1FOX A;  2M7B A;  5DCM B;  2UXN A;  3VYU B;  4AYB N;  4FHT A;  3OYN A;  2EIM H;  3J81 K;  2WY8 Q;  3H5A A;  2R92 J;  1HF0 A;  3PIP F;  4EVI A;  2XB0 X;  3CJT B;  2V26 A;  3PSI A;  3G1L A;  2DT7 B;  4PCQ A;  3WE3 A;  4ZZD A;  1T38 A;  4IL6 C;  3IHU A;  3ZGK A;  3OR1 C;  2E2H J;  1D1C A;  2I10 A;  4K2E A;  3FHZ A;  1DP3 A;  3DBH B;  5L3D A;  2DYR H;  4HF1 A;  1B4A A;  2EK5 A;  1JJ6 C;  4GYG A;  1H8A C;  2CSO A;  1XMX A;  5CVU A;  1YYV A;  1WI9 A;  2WAF A;  2R7U A;  5CVV A;  4D9J A;  4A2U A;  1ULY A;  2CW8 A;  2VN2 A;  2DA5 A;  3HOU J;  2HOS A;  4B48 A;  1T95 A;  2WC2 A;  4G7O F;  1B9M A;  4XNF A;  3PIO F;  1HW2 A;  2DA7 A;  2KT0 A;  1IN4 A;  2BEO A;  3OY9 A;  1O7F A;  2EFQ A;  3H3U A;  1UST A;  3RIR A;  2NRA C;  1FWZ A;  3JTG A;  1Y6I A;  3RKY A;  5C4X J;  5IOZ A;  2EZL A;  5DTD A;  1SVO A;  4MTD A;  4ZYD A;  1QU3 A;  1FPQ A;  3EUA A;  3OYH A;  3ZXS A;  4UV8 A;  1AOY A;  1B72 A;  4BDZ A;  4NC8 A;  2CFO A;  4HLY A;  1B8I B;  1RI7 A;  3MKL A;  1IN7 A;  1O3T A;  1SFK A;  3E7L A;  1J2X A;  3F9K A;  5HLH A;  5K5R A;  3I53 A;  1Z7U A;  2XGC A;  3BJ6 A;  1ZGW A;  3G2B A;  2L0K A;  1HA8 A;  1LE8 B;  4BEH A;  3TO6 A;  1BA5 A;  3K4L A;  3QPL A;  3DKX A;  2W48 A;  3PQJ A;  2P7V B;  1ORK A;  3U2R A;  3V8K A;  2LKP A;  5DCF A;  1RR8 C;  2F5V A;  4KIS A;  2QQ8 A;  2ZJ2 A;  3GTM J;  3LQQ A;  4HDV A;  4NBQ A;  1IDZ A;  5DUK A;  4MQV A;  3LSK A;  2HZD A;  2RC4 A;  2EIJ H;  4LB5 A;  3GUD A;  5LHH A;  4XKV A;  2NS7 A;  4Y17 A;  3LSH A;  4LK0 F;  3DWL E;  4AC0 A;  4C3H J;  1FTZ A;  1W4M A;  1BJZ A;  4G94 A;  1VQL I;  3S32 A;  5FKN A;  4BXU A;  2W84 A;  5FD5 A;  2R7D A;  3AG2 H;  3OYM A;  1RIO H;  2EIK H;  2M0C A;  3OYA A;  1WI3 A;  2PQ8 A;  4DOZ A;  4BHP A;  2XRO A;  1DPU A;  1K6Y A;  4RB3 C;  5CLS A;  1Z9C A;  3JRA A;  2AQF A;  5K7Z A;  3I64 A;  3D5R C;  2XC7 A;  2HVQ A;  3GBG A;  2QEX I;  1ZRF A;  4IOC F;  4YIR X;  3W6V A;  3ZMZ A;  1U0J A;  4IQ4 A;  4CUG A;  4NDL A;  2HKO A;  2Y48 A;  1N75 A;  3J81 Z;  2HVS A;  3DKY A;  3I3L A;  3HGY A;  5J40 A;  3OMY A;  3SQN A;  2JT1 A;  3SFI A;  5IYB J;  1IV8 A;  2V1X A;  1SC7 A;  2WV0 A;  2L3D A;  1NH3 A;  2FUG 2;  3CCJ I;  4KA4 A;  2D2W A;  5D5W B;  4JK1 X;  1T39 A;  1MSE C;  2ESN A;  3S8P A;  2ISY A;  4M9S A;  1YG2 A;  2G7H A;  4AIK A;  1E17 A;  4XN0 A;  4I6Z A;  1X3U A;  2YUS A;  4KT6 A;  4P5O A;  3JR9 A;  2A61 A;  2VQL A;  1ETY A;  3J80 K;  4F52 A;  2JPB A;  3F8M A;  5FRO A;  1TP4 A;  2B0L A;  2MSY A;  4IJA A;  4CCM A;  3WHC A;  2NYX A;  3HEF A;  2A68 F;  2XDV A;  2OZU A;  5JHU A;  4RGU A;  3O8G A;  2HEO A;  3PNT A;  3RJP A;  1NHA A;  2E1M B;  3CUQ C;  1JHH A;  4HV5 A;  3F22 A;  4BGD A;  1ZG3 A;  2JJ7 A;  3OYF A;  3OYI A;  1VQN I;  3S93 A;  2LVS A;  2L9V A;  3HPH A;  3DCF A;  2JK3 A;  2L7F P;  2DCE A;  2UV1 A;  2IA0 A;  2LNB A;  3DPT A;  4P1W A;  1WHU A;  3T0Y A;  3C2B A;  5C4J J;  4FTH A;  1EH7 A;  2DI3 A;  3HYI A;  2DN0 A;  3JRF A;  4B44 A;  3ERE D;  4AYB A;  1QRY A;  4BHC A;  5HOD A;  2XSD C;  1MMS A;  5GTI C;  1U9N A;  4NB5 A;  1F5T A;  1K79 A;  2XPV A;  4IRH A;  3DEW A;  4E6K G;  3BTC A;  1ZRD A;  2KDO A;  1VZ0 A;  4V2G A;  2Z2S B;  3BG3 A;  1J75 A;  3WU0 A;  5E3L A;  5FFZ A;  4IXA A;  4F3Q A;  1PYV A;  5F1R A;  1UHW A;  2MH9 A;  4P9U A;  4IHW A;  2FEZ A;  2NOJ B;  1W1W E;  1I5Z A;  4G6D A;  4HF0 A;  1UZC A;  1T6S A;  3RPU D;  2UUZ A;  4F91 B;  2M0M A;  2B7E A;  3C3W A;  4XRF A;  4C9Y A;  4DYR A;  4AWX B;  2XAF A;  2QLZ A;  4WWC A;  2F5E A;  1FOK A;  4QTR A;  2TDX A;  3G71 I;  1ZQ3 P;  3ZPL A;  4E7Z A;  1XMA A;  4A5M A;  3CDH A;  4PJN A;  3RSN A;  5GAG J;  3FBN B;  1K78 B;  2MLG A;  3BY6 A;  3FF5 A;  1VQP I;  2NVT J;  2P5L C;  3F6V A;  4UXN A;  3K70 C;  4XKC A;  2QYO A;  1N77 A;  3CCV I;  4CCN A;  1X4O A;  1YW8 A;  3CCY A;  5HDK A;  4CYC A;  1JGG A;  2PFB A;  3ESW B;  2DPU A;  2O0Y A;  3ASO H;  2DW4 A;  4S05 A;  5GAH J;  3I4N J;  4M3B A;  2Y9Z A;  1LDJ A;  5GTH C;  2DO7 A;  2K4J A;  2HNH A;  3EYY A;  3Q9V A;  3ABT A;  5HLI A;  2EQR A;  3WTT C;  1NTC A;  4JX4 A;  3WGH A;  3A02 A;  4PFP A;  3SZT A;  2K9Q A;  3HRT A;  3WOD F;  2WA0 A;  4G7H F;  1G6N A;  2LYC A;  3BTI A;  2R5Z A;  1MBJ A;  4IOA F;  4MGR A;  4XQF A;  3J80 Z;  2YU3 A;  3FKI J;  3K9T A;  2W00 A;  1JXS A;  4HYE A;  3TOA A;  1KQ9 A;  2NS0 A;  1ZH5 A;  3I9V 2;  1IN6 A;  4D7N A;  4Y3O A;  1X3Z B;  5K7H A;  1JTY A;  3HC7 A;  2O8X A;  5KNL A;  1CGP A;  2OZ6 A;  3HUG A;  3FXK A;  4Y15 A;  3S1M J;  3BDD A;  4RLF A;  2QSG X;  2X85 A;  3J7A O;  3AG3 H;  4CIC A;  4PSX A;  4Z2Y A;  4ESB A;  3GTG J;  4OIO F;  1ZAO A;  3GME A;  4N9H A;  2ZXI A;  1YW7 A;  3HL2 A;  4XKB A;  1J09 A;  4CCL A;  2OCC H;  5E17 F;  2IA1 A;  5E1W A;  5CPR B;  4GDF A;  5EDN A;  2WB1 N;  3WTS C;  4IHV A;  1USS A;  2R5Y B;  1ONV A;  2JA2 A;  3BPV A;  2P6T A;  3VSL A;  2ZNZ A;  1FJL A;  4M9X A;  2XIG A;  5LEJ A;  3GZ6 A;  4CXF A;  2R3S A;  1XSD A;  1VQK I;  3J7Z I;  2R93 J;  2BOL A;  3RKX A;  2IVM A;  3FXU A;  4HBL A;  2WAE A;  4LLN A;  5CQE A;  1SAX A;  1O57 A;  1OJL A;  3SEZ A;  4A3G J;  3CUO A;  3SDG A;  5HDN A;  1UG0 A;  3SZP A;  2FBK A;  3E97 A;  4LIV A;  2R7F A;  2VC0 A;  1S6L A;  3BG9 A;  2NNY A;  1HDD C;  1BJA A;  3Q0W A;  4KIG A;  3WTV C;  4KUM A;  3ZMV A;  4M3E A;  3BR3 A;  2YPR A;  2D45 A;  4KMF A;  3GLX A;  1XCB A;  5TRD A;  5F6F A;  2KQR A;  4BAC A;  1Z0X A;  3PFY A;  4HNU A;  4BUP A;  2EFW A;  3LA2 A;  1F36 A;  3QOE A;  4LIU A;  3CMM A;  4MNU A;  4L0Z B;  2LLK A;  4CSW A;  1IN8 A;  2DLL A;  4TV7 A;  4MQ9 F;  2IRF G;  3HHH A;  4ZTJ A;  2VBZ A;  3TGN A;  1LPQ A;  4BNC A;  2HDC A;  2M7A A;  2QQA A;  5EZG A;  1HOM A;  1QO0 D;  1Y39 A;  1A31 A;  1B6A A;  3KP2 A;  2TRT A;  2CV0 A;  3VYT B;  1QA6 A;  1GUU A;  3R4K A;  4XRS G;  3A0H C;  1TBX A;  2VKD A;  4HF2 A;  2JVH A;  2H1L A;  2OC6 A;  5FKK A;  3UNG C;  1V55 H;  2K9L A;  2KL4 A;  4UY8 I;  4M3D A;  1FZP B;  1Z6R A;  3IWZ A;  4OU0 A;  3CDI A;  3HOT A;  3S2H J;  5LLQ A;  2E5Z A;  4XLP F;  2MW8 A;  1H89 C;  1HW1 A;  3BG5 A;  3CO7 C;  3K1N A;  5BPI A;  3N05 A;  4I98 B;  2GZW A;  4NC7 A;  4PJM A;  1X1A A;  3H9G A;  4C2M J;  3CES A;  2J5P A;  1WJ5 A;  3S3N A;  2IS1 A;  4AD9 A;  5DD8 A;  5B1B H;  3IV5 A;  4HLX A;  3MKY B;  2R7T A;  1SD4 A;  1QBJ A;  3RQ4 A;  2GA1 A;  3RTR A;  1MKM A;  3FDY A;  1HKQ A;  3FMR A;  2IGO A;  1ZR4 A;  2DMP A;  3TDZ C;  5F27 A;  2QM3 A;  1FT9 A;  4RB2 C;  3CUQ A;  4HPQ A;  2ZJR F;  1A6Q A;  4OAZ A;  1FYM A;  4EGZ A;  2V7F A;  1KQ0 A;  4OMY A;  5E1X A;  1X1B A;  5GAE J;  9ANT A;  2Z5U A;  4A0X A;  4IKF A;  4L0Y B;  1W5C C;  3VSK A;  4KYW A;  4EQQ A;  3GXO A;  1SVL A;  1HLV A;  3PO2 J;  1FSE A;  2JSC A;  1D0X A;  2VQG A;  3BTJ A;  4UVC A;  2D1H A;  3EYI A;  1OFC X;  2DDA A;  4AIJ A;  3GX4 X;  3ZMS A;  1FOW A;  4I01 A;  2XF5 A;  1LQ1 A;  3IWF A;  1NG7 A;  3FX3 A;  1ZEL A;  2KHM A;  1B9N A;  2YU9 J;  2GA2 A;  3EPZ A;  1OCC H;  4EAT A;  1SFE A;  3D5S C;  4B4C A;  3CDL A;  5FGM A;  5M3F J;  1IW7 F;  1A04 A;  2GLO A;  3L2U A;  1KYW A;  3MQ0 A;  5CJ9 A;  2VUM J;  1I6H J;  5D5V B;  1T2K A;  1FLI A;  3AL0 B;  4DZJ A;  3RZD J;  3N97 A;  1ETX A;  2V9K A;  1W7P A;  4ZZL A;  2LKS A;  3DFG A;  4PUS A;  2E71 A;  4ZDP A;  2NS8 A;  4YFX F;  4AVZ A;  1TNT A;  1RRJ A;  5FLX K;  3VB2 A;  3WTZ A;  2O8K A;  5KAI C;  2Q1Z B;  4IVN A;  2QBY B;  3I59 A;  2CWE A;  2KJB A;  1MMA A;  2E5N A;  4KIT B;  4LJZ F;  3NRV A;  5JFR A;  2I5U A;  4RM3 A;  1LDK B;  1NG6 A;  3L09 A;  1LUJ B;  4C3I J;  2DT6 A;  3I58 A;  4LLL A;  1K83 J;  1MDM A;  3FXL A;  2IW5 A;  4ZDL A;  1ZRC A;  2NVU B;  5J4V A;  1HSJ A;  4HST A;  2L7K A;  3L2C A;  4NQW A;  4FIS A;  3ZN0 A;  3RZO J;  4S04 A;  4J01 A;  3JTH A;  3BT9 A;  1ZLJ A;  1N25 A;  4I02 A;  2YSR A;  1KQ8 A;  4B09 A;  2E1N A;  1YW9 A;  4LOC A;  1LFB A;  4PJJ A;  1SVM A;  2ZFU A;  5GPC A;  2ELH A;  2WB1 A;  2BW3 A;  3BJA A;  4F93 B;  1Y0U A;  1WCM J;  2WAD A;  2HTJ A;  2QKL B;  2JN6 A;  4NC6 A;  1Z1D A;  1D1B A;  2LP0 A;  2XGE A;  4OIP F;  4C2U A;  2P0W A;  3OWT A;  1J0R A;  1ODD A;  3OOU A;  1YJ9 I;  2FU4 A;  3CF2 A;  4BS9 A;  2P4W A;  2DBB A;  1SAN A;  2COB A;  4M74 A;  3CTA A;  5LEK A;  3F0C A;  5HS7 A;  3M4O J;  1VQM I;  5HNH A;  3C7J A;  3CO6 C;  4II3 A;  4BBR J;  2ESH A;  3HB9 A;  3PUB A;  2FRH A;  2VB6 A;  1D8K A;  3IRR A;  3CC2 I;  2IS2 A;  2F48 A;  2F4I A;  3C1D A;  1XN7 A;  2JSP A;  2VXD A;  3HTU A;  3KP5 A;  3CC7 I;  2HI3 A;  2CW0 F;  3BLY A;  2PX9 A;  4WF2 A;  3TQN A;  2LBF A;  5JLX A;  2VI6 A;  5DM6 F;  2VOO A;  3HXL A;  1WJB A;  5F04 A;  1VQ9 I;  1LKX A;  2NVQ J;  1TW3 A;  2VXZ A;  1WZ2 A;  2V9P A;  3H3V K;  4X1E A;  2ZJQ F;  2FE3 A;  4RAF A;  2P5K A;  1IUF A;  3BR1 A;  2PJR A;  3W2V A;  4XRS A;  3P9C A;  1N78 A;  5E20 A;  5LGU A;  1OPC A;  5D8L B;  1SFX A;  1ZLK A;  2BVM A;  2W1O A;  3BQZ A;  2Y30 A;  4HZF A;  5FLX Z;  1P2F A;  2LMD A;  1BW6 A;  2RAE A;  5H6R A;  2P7C B;  3OYJ A;  4A3M J;  2BZT A;  1FY7 A;  4ZYA A;  4U87 A;  2A6E F;  5D4S A;  2COM A;  2ZXH A;  3NAU A;  5B1A H;  5BS6 A;  3V7C A;  3T1B A;  2Y0S A;  4DYQ A;  1GVJ A;  3LSG A;  2KZV A;  3G6E I;  4KN4 X;  5D5U B;  2DQL A;  1QZZ A;  3KET A;  5LGT A;  3DTI A;  1PUF B;  4XLA A;  3TP0 A;  2Z33 A;  1Y56 A;  2DOF A;  1YIO A;  5IT9 K;  1XGM A;  4XM3 A;  2HOA A;  1OKR A;  2JTV A;  3B73 A;  3U1D A;  3OSF A;  4E7I A;  5HS8 A;  3MN2 A;  3ZR8 X;  3GEZ A;  4O6J A;  4UB6 C;  4BBS J;  4U0W A;  2LR8 A;  3AFH A;  3V42 A;  5IT3 A;  1TWA J;  3H9Q A;  2KIU A;  3T8R A;  4N0B A;  1BR2 A;  1Z7L A;  3LSP A;  4H0E A;  5M5Y J;  5H6Q A;  4ABZ A;  3BR6 A;  4RAY A;  1YRN A;  1PUE E;  1YX3 A;  3BTL A;  1DP7 P;  2DOA A;  3C2H A;  3FWE A;  2STT A;  3RYP A;  2VOD A;  2OPT A;  5J8C A;  1BW5 A;  3ZMT A;  1LJ9 A;  3HIF A;  1RET A;  4U0V A;  1OIS A;  2JPC A;  4U88 A;  1JJ8 C;  2ZME A;  5D6F A;  4D5C A;  2FMY A;  5C44 J;  4Y13 A;  4R79 A;  4JX5 A;  4EJW A;  1HW5 A;  1OQY A;  1B59 A;  2K40 A;  2EJR A;  4I0B A;  4IRG A;  3S1R J;  1V5F A;  1ZTR A;  2E19 A;  2R7Q A;  3FM3 A;  3ULQ B;  4DYC A;  1R23 A;  2CRG A;  4G9Y A;  4XN3 A;  2M2E A;  2V79 A;  4E70 A;  3E1S A;  2X48 A;  4F92 B;  4XSX F;  3BWG A;  2QEN A;  4OAY A;  4RGS A;  4MEY F;  1OYW A;  1P4W A;  3MAJ A;  1DPR A;  5HS9 A;  2ZSH B;  5J47 A;  3BQY A;  1BR1 A;  2DMQ A;  2LC2 A;  5ICG A;  4BQA A;  2OJE D;  5A2Q K;  3H9J A;  2FQ4 A;  1ETO A;  4HX8 A;  1KU3 A;  1PP8 F;  2GIV A;  2IP2 A;  1Z3Y A;  3SEQ A;  2LY2 A;  1AWC A;  2HQR A;  4UB8 C;  2Q2E B;  2QVO A;  4M71 A;  3SDB A;  1BI0 A;  5KK1 A;  1R5H A;  2HYG D;  4XON A;  4IO9 F;  1T0F C;  4IX7 A;  2IS4 A;  3K7A J;  1WJF A;  3LFU A;  1FP1 D;  3DEU A;  4RGR A;  2DK5 A;  2QQ9 A;  1O7L A;  1R1T A;  1X1C A;  3OIQ A;  1PDN C;  4BDY A;  2X51 A;  2ZKZ A;  3ML6 A;  1BOB A;  1V54 H;  2MD5 A;  3PNY A;  4I09 A;  2HGC A;  3X2Q H;  3HSR A;  2I8D A;  1AU7 A;  3GFI A;  3KZI C;  4ZYE A;  5J8F A;  3CC4 I;  4LGW A;  2V1U A;  3E5U A;  4EJV A;  5IY5 H;  5J1Y A;  3FMQ A;  3NWT A;  2P8T A;  1XGO A;  1JTX A;  1SFO J;  2DMN A;  1STZ A;  2ID3 A;  3HOV J;  1YO5 C;  2EWN A;  2HPI A;  4XOP A;  3M8E A;  1Z6T A;  2KIS A;  2G9W A;  5E8I A;  1YHQ I;  5L3G A;  1G3S A;  4XOT A;  4HRI A;  1B1B A;  5LHG A;  1S3J A;  4Z6Y A;  2IGK A;  2F4M B;  4BJT A;  3C2G A;  4LK1 F;  1AA7 A;  1R4N B;  4OIQ F;  5IT9 Z;  4XLF A;  4OMZ A;  3LSJ A;  1NK2 P;  1WJC A;  4A93 J;  2ACJ A;  3F8N A;  3DBR B;  3KLN A;  2L01 A;  2FML A;  3BRO A;  4OIR F;  3GTP J;  3A4C A;  2M87 A;  1R58 A;  4C2T A;  1SFU A;  3TO7 A;  3MZH A;  4A0Y A;  5F0H A;  1XSV A;  4D1Q A;  1JUM A;  3VYR B;  1BM9 A;  1Y0N A;  2DYS H;  2OCE A;  1MMG A;  2FF4 A;  2GOX B;  2ZCW A;  3GTO J;  3LFK A;  2DFH A;  3MEX A;  3E5Q A;  2PN6 A;  2WV1 A;  5DD4 A;  2L9S A;  2MFZ A;  3PFI A;  2UWM A;  1WRJ A;  4FET A;  3HDD A;  5ICE A;  2L5Q A;  1GVD A;  3UKG A;  2C6Y A;  4FX4 A;  3W6K B;  1IJW C;  3HHG A;  3OYC A;  4ENJ A;  1XX5 A;  2O61 A;  4E7S A;  2VQH A;  2BY2 A;  3HSF A;  1QZY A;  1TNS A;  2K9N A;  4ENN A;  2H8W A;  2XF6 A;  4XL9 A;  2L2O A;  2QSF X;  3PNV A;  2K3P A;  1ITY A;  5HOO A;  4MLO A;  5J1U A;  3CQZ J;  1OMI A;  3LSM A;  4N9I A;  4MIM A;  4E4H A;  4LG0 A;  5GP9 A;  1ZKG A;  1U2W A;  1J5Y A;  5DV5 A;  1FC3 A;  2DOE A;  1IZ1 A;  4A3B J;  4IPA A;  5EG0 B;  1XS9 A;  1X2M A;  2EPF A;  3RKQ A;  2BHY A;  5M5X J;  1KA8 A;  3IL2 A;  2H94 A;  3OL4 A;  2O6G E;  4RB1 A;  3CCM I;  3DBL B;  4UV9 A;  5A2Q Z;  2LDU A;  4DJA A;  3I4P A;  1G59 A;  3QYB A;  2JQ7 A;  4CCK A;  2HQN A;  3HGG A;  3E3V A;  5BQT A;  4IRI A;  2LFB A;  1Y1W J;  1YS6 A;  1OR7 A;  1I39 A;  1RZ4 A;  2MC3 A;  4RAG A;  2EV5 A;  2E1C A;  3FHN A;  1X3W B;  1VND A;  3LL7 A;  3Q0U A;  1VQO I;  1EH6 A;  4YII A;  1LVA A;  1OLT A;  3DPL C;  3ZQ7 A;  1IF1 A;  1U5T B;  2P5V A;  3VPR A;  2KIQ A;  3I71 A;  3NEU A;  4ON0 A;  1W0U A;  1Q1V A;  1V5E A;  4C3J J;  2ID6 A;  3JW4 A;  4DBR A;  4HNV A;  3KEO A;  2H1K A;  2DFI A;  1TTY A;  3P5J A;  2F5D A;  1HQC A;  2NAZ A;  1IG7 A;  1W7P D;  3GTJ J;  4CCO A;  2NXN B;  5AIP A;  4GFB A;  1BIA A;  5E18 F;  4ZTF A;  1YE9 A;  1ERD A;  1U8R A;  4UUS A;  1NK3 P;  2IGM A;  3ONQ A;  2CQX A;  3PUF A;  3GW2 A;  2XPW A;  3MFK A;  4EM0 B;  3DU5 A;  3ISP A;  1T56 A;  4MO7 A;  3CCE I;  3FK6 A;  3ABL H;  3F8C A;  2E1M C;  3QP5 A;  2MC4 A;  5E3N A;  2WWY A;  2IAI A;  3MD2 A;  3I55 I;  1YS7 A;  2V1N A;  4JX6 A;  3M8J A;  1I50 J;  2ZC2 A;  4UNO A;  3IKV A;  1DU6 A;  1AKH A;  1U8B A;  2FJ1 A;  3CP2 A;  3WGG A;  1IXR C;  1JKP C;  2VAS A;  2YX7 A;  4LMY A;  4IQJ A;  1MSF C;  2DJI A;  2IS6 A;  1W0T A;  3CF5 F;  3COA C;  1O3Q A;  1F1Z A;  2RQQ A;  3A01 B;  1ON2 A;  3RQI A;  1XCV A;  2BYV E;  5ICF A;  4DW6 A;  3ZQL A;  2IJL A;  4ZJZ A;  5FKO A;  2OTJ I;  2HPM A;  1CF7 A;  1J59 A;  5LFA A;  2R7V A;  5F64 A;  2E60 A;  3QAH A;  2Q0O A;  1R36 A;  3HJE A;  4II2 A;  1DU0 A;  4O3M A;  1BC8 C;  3ZMU A;  4M72 A;  4XK4 A;  1SD7 A;  2X6O A;  4W1U A;  1MMD A;  3KFW X;  4BQQ A;  4WXD A;  4PJL A;  3WTX C;  3SZG A;  4MTE A;  3I0T A;  3GFM A;  1J9I A;  3E5X A;  2H8R A;  2K02 A;  1X19 A;  1LB2 A;  1X1P A;  3QOD A;  5E3O A;  4AIH A;  3MCZ A;  4EM2 A;  1TWH J;  2XAG A;  1V3F A;  2DJN A;  5F08 A;  2HOE A;  5BMZ A;  3H1C A;  3B02 A;  1ZYR F;  4IZZ A;  2XVC A;  4YEL A;  2X1C A;  1DGW Y;  2GOM A;  2E7X A;  4ETS A;  2Z3Y A;  4U7B A;  5EGO B;  1P7I A;  3BP8 A;  1WWX A;  3LOC A;  1ENH A;  5TJJ A;  4A3L J;  3KPH A;  2X1D A;  3FBI B;  2AS5 F;  1FIA A;  3H0G J;  3JRG A;  4PGG A;  3MVP A;  3H0D A;  2MYS A;  3W2A A;  5DCM A;  4Q47 A;  3JRE A;  3L2V A;  4G6T B;  4XR6 A;  4KMU X;  2HZT A;  1WVR A;  2XGD A;  2KRC A;  1PJR A;  4LG3 A;  4BAY A;  2O7O A;  4H4K C;  1QPI A;  1T0F A;  3CZ6 A;  5J6X A;  3WU2 C;  1R49 A;  2R7W A;  2FSW A;  4YFK F;  3GVA A;  1MD0 A;  3D5L A;  1XG1 A;  3I4M J;  2VJ4 A;  4YIF A;  2ECB A;  3M07 A;  4BU2 A;  3K6G A;  2XAS A;  3A0B C;  4M6X A;  1H9T A;  3IH4 A;  4CDG A;  3VOE A;  4HQM A;  2VKV A;  1FMV A;  2VBW A;  1R5I D;  3W6J B;  1E0E A;  5DEQ A;  3F6O A;  4BJ5 C;  1HKS A;  2CUJ A;  2DMU A;  1XGS A;  3KEQ A;  4GO1 A;  2W85 A;  3F8B A;  2L4A A;  4JQF A;  5CVI A;  4KFC A;  1E3H A;  3M1C A;  2LF8 A;  2KZG A;  3GTQ J;  1I1S A;  2J5O A;  4I76 A;  2M4G A;  1ZG1 A;  3G1M A;  5KHD A;  3DP7 A;  1R9T J;  2DOD A;  2QF7 A;  4CGZ A;  2XB5 A;  3MKZ A;  2MLK A;  4V19 K;  1UCR A;  1WKM A;  3DPU A;  1JGS A;  3R60 A;  3K4J A;  3QYF A;  1FEX A;  2LY9 A;  2BVL A;  2O3F A;  4JP0 A;  2KFD A;  4CZZ A;  3JRD A;  2V6C A;  3RI4 A;  2ADU A;  2XKP A;  2QZ8 A;  1B8I A;  2Y0M A;  3LSI A;  4RBO A;  2W7N A;  1VTN C;  4XLC A;  2XAU A;  5DS9 A;  1FOY A;  3FXM A;  1Z05 A;  2K86 A;  1O4X A;  3KP3 A;  4WCG A;  4RM2 A;  3G1O A;  4ENK A;  4C30 A;  1LE8 A;  4ZYH A;  5JVT A;  1B72 B;  3E6C C;  4EJO A;  5HLG A;  2WTE A;  3DXJ F;  3KZY A;  2FBI A;  2XV4 S;  3LMM A;  4J19 A;  2QGU A;  5ED4 A;  3K4M A;  3ZQI A;  3QP6 A;  2RNG A;  4HG2 A;  3VOD A;  4BEH B;  1A6I A;  2HS5 A;  3SXY A;  2Y0S N;  2EV6 A;  3V8J A;  2JA7 J;  2XAQ A;  3O2P E;  4RS8 A;  2DTZ A;  2G0E A;  4BXF A;  1P6R A;  4QPQ A;  4LFU A;  3GFL A;  2L4M A;  1KZH A;  2R7O A;  3JSP A;  5FRN A;  2BY3 A;  1QHG A;  5KVR A;  4BHB A;  3VWB A;  2ELJ A;  1VQ5 I;  2RKH A;  3OYK A;  1YX5 A;  1MBG A;  5EEH A;  2GIZ A;  2PMH A;  3BR2 A;  2VJ5 A;  4ESJ A;  2BE5 F;  4BJ6 C;  1X4P A;  1HC8 A;  1TWC J;  3BOQ A;  3M8F A;  1IRX A;  5DYM A;  3IH3 A;  3K10 A;  1FBU A;  3S15 J;  4PFO A;  1IAW A;  3HSE A;  2HYF A;  1IN5 A;  3GWZ A;  1T33 A;  4DBQ A;  2WY7 Q;  4YFN F;  2A3S A;  1G8X A;  2WBM A;  5FKM A;  1R00 A;  3DU6 A;  4EM1 A;  2VON A;  4A6E A;  4JYK A;  3DLL F;  1Z21 A;  5AON A;  2QQB A;  1YI2 I;  2ZSI B;  2JRT A;  1RNL A;  1LFP A;  1QVU A;  1EJ9 A;  4CA0 A;  3HOW J;  5DUI A;  3ELK A;  3FM5 A;  2DA1 A;  2HU9 A;  5FLV A;  3PQK A;  1X1D A;  3K4K A;  4XKW A;  3U1K A;  1ETK A;  1D5V A;  4M6V A;  4WXC A;  1UEL B;  1WJE A;  2ZBK A;  1MND A;  4B8X A;  3IAS 2;  1W36 C;  4G12 A;  2VT3 A;  3OL3 A;  2JVG A;  2EZI A;  4DGW B;  1REP C;  1OYY A;  2HFH A;  2PLY A;  4A5N A;  3BCB A;  5FKL A;  4EJT A;  3FXO A;  5K5O A;  2F6C A;  4G8X A;  5LRR A;  1ETQ A;  3RPU A;  3HOY J;  5CQG A;  3WU1 B;  2LF7 A;  1UAA A;  3HTS B;  3PM1 A;  2DDB A;  5BOX A;  2ZO4 A;  1XGN A;  2EZK A;  2VT2 A;  3OIP A;  3L00 A;  4A69 C;  4ENM A;  1I27 A;  3M7G A;  3AKZ A;  4HQE A;  2IT0 A;  2WAQ N;  2K7L A;  2DTR A;  3O6B B;  2P6S A;  3DTK A;  1BBY A;  4AUX A;  1P4A A;  2RQP A;  4HDU A;  3I56 I;  2JA8 J;  4M3F A;  1POG A;  4ANJ A;  2BY0 A;  2R7Z J;  3ZQQ A;  2EZH A;  1SAU A;  3TOB A;  4LIT A;  1HBX G;  1YFH A;  4M3G A;  1IXS B;  3K1P A;  2A07 F;  3DTE A;  5FJ8 J;  1TWG J;  4WK8 F;  2D1V A;  2IBD A;  3AL0 C;  2FNP A;  2GQQ A;  1WSU A;  4OIN F;  2W24 A;  5IOY A;  2BBY A;  4QSH A;  3MMY B;  2E2J J;  2KRF A;  1ZHF A;  3ABU A;  4CCJ A;  3PJR A;  5J4Y A;  2OV7 A;  2CH0 A;  3DF8 A;  4WXH A;  3K4N A;  2MH2 A;  2JWT A;  3HOZ J;  4KIB A;  1ZK8 A;  5H2F C;  2Q8K A;  3LST A;  1LDD A;  1Y1V J;  2LRD A;  1WH7 A;  4RAZ A;  3ZCO A;  3HPG A;  1MJB A;  3V7S A;  5JR3 A;  2O9L A;  5J1R A;  1EF4 A;  1K4T A;  3GZ5 A;  1K78 A;  2CW7 A;  1FNN A;  1YJW I;  1MH3 A;  1BC7 C;  1QPM A;  2RDP A;  5AIQ A;  3K69 A;  4OOI A;  1H9G A;  2QKM B;  3GZN B;  3WTW C;  5H20 A;  2PG4 A;  4D0P A;  3OS2 A;  1RUO A;  1TZL A;  4E7H A;  4NHJ A;  1G3Y A;  2CJJ A;  4RB0 A;  1W5T A;  1E3P A;  3Q0V A;  3ABM H;  2LY1 A;  4KN7 X;  4A3F J;  2VKE A;  1IUY A;  5FB2 A;  4CYC B;  4L9J A;  2X4H A;  5E79 C;  4YRV A;  1GHC A;  3CJN A;  4A0Z A;  2HOT A;  2A6T A;  3K1M A;  2DA4 A;  2E7W A;  3CJQ B;  4A3I J;  3HKZ N;  2R7X A;  1H88 C;  2HWV A;  3ZRG A;  1IC8 A;  2Y69 H;  5FD6 A;  1ZR2 A;  3RPQ A;  1D5Y A;  3A1Y A;  3ZOB A;  3OYL A;  3CMA I;  1X2N A;  2CG4 A;  1OYI A;  2Z1D A;  5HNF A;  3W3C A;  5ICC A;  5E8G A;  2K4B A;  4RDU A;  5LGN A;  2R5Z B;  4A3E J;  3MZY A;  2RN7 A;  2Z9O A;  2X6Y A;  3DEE A;  3IUO A;  1SMY F;  1BIB A;  4Y33 A;  4G6Q A;  3WG9 A;  2E34 A;  2VL8 A;  5L3F A;  3IP4 B;  1KON A;  5CVJ A;  3CCS I;  4IEJ A;  5IP9 J;  3HUG B;  2BXY A;  4W97 A;  3KX2 A;  3ASN H;  1HST A;  2DMT A;  3G3Z A;  2P81 A;  2CS3 A;  1DQU A;  1R4M B;  1BI1 A;  3TED A;  2R5Y A;  2CO5 A;  4PZJ A;  2DA2 A;  1TWF J;  1QHH D;  2ZFW A;  3ZP5 A;  1BI3 A;  4U0Y A;  3EUK L;  2K9S A;  5F0C A;  2EFO A;  4EJU A;  1S72 I;  2F4O B;  3E6D A;  3E6B A;  5KAF C;  3LAP A;  1A35 A;  3S17 J;  1BI2 A;  3O8H A;  4GYI A;  2KDZ A;  3CD6 I;  3IKT A;  1EH8 A;  4BY7 J;  1FBQ A;  2F2E A;  4G7Z F;  1MBF A;  1JE8 A;  3PO3 J;  2XHK A;  5M5W J;  2GXB A;  3BG7 A;  1SD6 A;  2BXZ A;  2H6C A;  5CYV A;  3WGI A;  1JKO C;  1I1G A;  3ECO A;  1A36 A;  2LKX A;  2X6X A;  4MEX F;  2DT5 A;  3E0J B;  3JRH A;  1QGP A;  3QU3 A;  2V1D A;  3OR2 C;  4HEA 2;  2CV2 A;  3Q9S A;  4P96 A;  2M8E A;  1R1V A;  1TC3 C;  5D5X B;  4PSW A;  2LG4 A;  4AU7 A;  2O03 A;  1GXQ A;  2DK8 A;  2JZY A;  1OCO H;  2V4J C;  1APL C;  2NVY J;  2Z99 A;  3H36 A;  3ZQH A;  4LD5 A;  2GBY A;  2ZJP F;  1DUX C;  3L9F A;  1S7A A;  3KYL A;  3ZMD A;  3K4B A;  2FBH A;  1EKE A;  1QZE A;  3T5X A;  4B47 A;  3JRC A;  2ZB9 A;  5JLW A;  5B5E C;  2R7S A;  1IRZ A;  4LB6 B;  2AXL A;  3F72 A;  2HR3 A;  3V8L A;  2ME6 A;  3EUH C;  4I99 C;  3BG6 A;  3WHB A;  2E36 A;  1KU2 A;  1VFC A;  2WAQ A;  2W82 A;  1JT6 A;  3VYS B;  4KDP A;  2ME0 A;  3OYD A;  4IHX A;  1GV2 A;  3R0A A;  2F5F A;  3LSR A;  2VLA A;  3KP7 A;  2DXI A;  2M1B A;  4L5J A;  3G4S I;  1IXC A;  4P9F A;  3F23 A;  2MG4 A;  1VF9 A;  3ERM A;  3VFZ A;  3QPT A;  2X9D A;  3LA3 A;  3S1N J;  2YX4 A;  2OD5 A;  3N4M A;  1XSX A;  3FK7 A;  3RKW A;  2FX0 A;  4NUB A;  1BR4 A;  2JUG A;  3DKW A;  3F3X A;  3CLO A;  1MBK A;  3S2D J;  5LRS A;  3V7R A;  2OTL I;  4ZYG A;  4YG2 F;  4UUV A;  1SMT A;  3HRM A;  4M6Y A;  2DFF A;  3H35 A;  5F1J A;  5IPA A;  2GWR A;  3SHF A;  4L5E A;  2W4S A;  3BC8 A;  4PGH A;  2JUC A;  3OIO A;  2PI0 A;  2Y2Z A;  3KEY A;  2RV8 A;  3QPH A;  3GYH X;  3SFZ A;  3QRF F;  1GV5 A;  2ISZ A;  1VQ7 I;  1RES A;  3SJM A;  3CUQ B;  1T08 B;  2VBY A;  1U9O A;  3U9G A;  1OCP A;  1UFM A;  1Z3X A;  2H09 A;  2HQ5 A;  4Y52 J;  1D1A A;  1SD5 A;  2UXX A;  4XLN F;  4AVP A;  4KIF A;  3K2A A;  4X6A J;  1ACI A;  4L9N A;  3B6C A;  5TGT A;  2BY1 A;  1MBE A;  2Y31 A;  5B3S H;  4OWR B;  3L2R A;  3KYD B;  4BYY A;  1I6X A;  3V4G A;  1R71 A;  3JCU C;  1ETV A;  3LAJ A;  2TCT A;  1P92 A;  1V4R A;  3FIS A;  4JBA A;  3I54 A;  4CH7 A;  4BE0 A;  5BNG A;  5LHI A;  5K1Y A;  2EB7 A;  1GLN A;  4Y4R A;  2VBX A;  1LVK A;  3SYT A;  3CJR B;  3M3Y J;  2CYY A;  4MFD A;  1K6O A;  3ROU A;  3OS1 A;  1UHS A;  4DIQ A;  2EH3 A;  4KT5 C;  3CLQ A;  2CUE A;  2ZXJ A;  5C3E J;  2VIX A;  1S7E A;  1W7P B;  3HKZ A;  4HAM A;  2DU9 A;  1G3T A;  1TT5 B;  2QBY A;  1HXD A;  3LQR A;  3ECH A;  1R6R A;  4D5F A;  2BHZ A;  3W2W A;  1SEU A;  1E3O C;  2CGP A;  4FCY A;  1JT0 A;  4XOR A;  4N4N B;  4B1R A;  2HKX A;  4DQ2 A;  3HZJ A;  5L3C A;  5LBQ A;  2KPM A;  3I59 B;  1TT0 A;  5CVR A;  2CV1 A;  1I3A A;  3QPS A;  4AM3 A;  1OCR H;  2RRE A;  3KIO A;  1TQP A;  1RKW A;  2M4K A;  3KE2 A;  1Z67 A;  3AG1 H;  1YJN I;  1MDM B;  3VEP A;  2PMU A;  1BL0 A;  2XKO A;  3ABK H;  3WTY C;  3IAM 2;  3IRQ A;  3LNQ A;  2DPD A;  4BL0 B;  4EGY A;  4QIW N;  4S0H B;  4NQW B;  4XLH A;  3LWF A;  3M9A A;  5BPD A;  2JRM A;  4B3A A;  1KYZ A;  3GFJ A;  2QUF A;  3O3K A;  1G4D A;  5IYC J;  3CMY A;  1FX7 A;  1DGR M;  1ZN2 A;  3Q5F A;  5TIS C;  2FOW A;  3OYE A;  1P4X A;  4GCV A;  2MD0 A;  3H3Z A;  3D1N I;  4CZC A;  2GXG A;  4CHU A;  4QPO A;  2BW3 B;  2VPR A;  2VJJ A;  1YIJ I;  2LSO A;  1R22 A;  3RYR A;  4O5V A;  1JHF A;  5ERI A;  2FQ3 A;  4ZDO A;  2LTP A;  1LEA A;  1Q1H A;  3L7W A;  3P9K A;  1JI8 A;  1RC9 A;  1XC5 A;  1H0M A;  1ETW A;  1TQI A;  3ZQG A;  2KJC A;  2Z16 A;  1F9N A;  2ICW G;  3R61 A;  1RR7 A;  3GF2 A;  2H27 A;  2YS9 A;  4MFE A;  3KP6 A;  3TW6 A;  2E2I J;  3BR0 A;  4MHG A;  1VQ4 I;  3H92 A;  2EIN H;  3K70 D;  2M45 A;  4FT8 A;  1WFX A;  2HXO A;  3QU6 A;  1JKQ C;  2LH9 A;  3CCU I;  2HVR A;  4AID A;  1G2H A;  3C18 A;  4I7H A;  1OCT C;  1YLF A;  5M3M J;  1UB9 A;  4V2F A;  3B6A A;  1L0O C;  1FTT A;  1P7J A;  1T8I A;  1MH4 A;  1R5G A;  1GT0 C;  1IRF A;  3BCA A;  3ZQF A;  2AXT C;  2LBF B;  4FE7 A;  3S14 J;  3A2K A;  3QWL A;  2QCO A;  2EA4 A;  4XLE A;  2ELK A;  1XDU A;  4L9T A;  3L1P A;  1WQ2 A;  4A6D A;  1U5T C;  4E7J A;  4J00 A;  4HA8 A;  2G7U A;  2N8G A;  1YQA A;  3JAM K;  2PJR B;  1WGX A;  2L9N A;  3CCL I;  2XUB A;  3CME I;  4IHY A;  2A05 A;  4FE4 A;  3HRS A;  3REO A;  4BE1 A;  1D3Y A;  5EEA A;  3GTK J;  1Z77 A;  3BPX A;  4E7K A;  2O5R A;  2VJI A;  5EF6 A;  2OA4 A;  3BR5 A;  2OBP A;  3IC7 A;  2XAH A;  5D8K B;  2E1O A;  2FA5 A;  3TMO A;  3PSF A;  1RUN A;  2PBI A;  2GM4 A;  3KZZ A;  4EV0 A;  4CYD A;  1MJ9 A;  2PEX A;  3H5N A;  2FNA A;  1PUF A;  5K7F A;  3BZK A;  3K0L A;  3TO9 A;  3EUH A;  2MAB A;  2CQ7 A;  4B3X A;  1IRG A;  3MZ8 A;  3FKJ A;  2CQQ A;  1LNW A;  1O3S A;  3HG9 A;  4BQO A;  1FYK A;  4QWQ A;  3KP4 A;  3OSG A;  4KJZ A;  6PAX A;  2PMZ N;  1HDP A;  3UR3 C;  4A3K J;  4UVB A;  1TW2 A;  4I2O A;  5JI6 A;  2CQK A;  2K3F A;  2VE8 A;  1U3E M;  2XF7 A;  3HBL A;  2K27 A;  4HW0 A;  3DV8 A;  3OOP A;  4PJ0 C;  4YEJ A;  4XMY A;  4M9Z A;  3OYG A;  5ILU A;  1RKT A;  3NWS A;  2EBI A;  2B9S A;  1U6G A;  3JRB A;  3QYE A;  5DM7 F;  2MGQ A;  3L2W A;  4A12 A;  5ILV A;  4ITV A;  2B63 J;  3FXQ A;  3HRU A;  1EV7 A;  2QSH X;  1KGS A;  2M9H A;  5EYR A;  1UJ8 A;  1S8N A;  2QA4 I;  1ZAR A;  2FXA A;  1YRN B;  4UUT A;  2IXS A;  2DA3 A;  2EV0 A;  3TKY A;  1AHD P;  2DAO A;  3DLA A;  5D6E A;  3OV8 A;  4DNC A;  4FAS D;  3F8F A;  5J3L A;  1UHM A;  3HM5 A;  4I0A A;  2ZME B;  5IP7 J;  4NNJ A;  3CP8 A;  1F43 A;  4R8H A;  2V9V A;  4RA2 A;  2OAZ A;  5FLM J;  2K5C A;  4D7M A;  5JHF A;  5JVG F;  1D0Z A;  2CFX A;  1MBH A;  4KIC A;  3S3M A;  4KNY A;  1S7O A;  2R0Q C;  1V5G A;  1ZGJ A;  2HTS A;  4PDK A;  4X0G A;  2CU7 A;  2KRH A;  2NVX J;  2RGV A;  2BV6 A;  5EEG A;  2XRN A;  2ECC A;  2DFE A;  2HDW A;  2MA3 A;  1DDN A;  4U7D A;  1E2X A;  2Q2E A;  3WG7 H;  2VC1 A;  1VQ6 I;  1WJA A;  2X0L A;  1JUP A;  2YR2 A;  2XRL A;  4UVA A;  1KU9 A;  3TW7 A;  4Q48 A;  5LD2 C;  3S2W A;  2GXA A;  3TDU C;  5IYD J;  4Y7N J;  3EET A;  2KLO A;  1WJD A;  1R7J A;  3K4C A;  3JAM Z;  4DZP A;  1IDY A;  1ZGA A;  3QOP A;  3FZV A;  4HV6 A;  2MBF A;  2GAU A;  2LK2 A;  3T8T A;  5GAD J;  1M1E B;  1IGN A;  4L18 B;  1P9Q C;  5KCM A;  3QQA A;  4XBF A;  3PL8 A;  3ZQC A;  1MIJ A;  3RCO A;  2ZNY A;  2CUF A;  4L9V A;  3NQO A;  4Q4Z F;  1TLH B;  2L7Z A;  2BGC A;  2L9R A;  3BJO A;  2JA6 J;  2PJP A;  1ZG5 A;  5IP6 A;  1QNT A;  4UHT A;  1FYL A;  5E1Z B;  1D8J A;  2M34 A;  1Y8Q B;  4RGX A;  3NAR A;  2ZME C;  1S9H A;  3R0J A;  4BE2 A;  1X58 A;  3Q3S A;  4B43 A;  3OYB A;  1MZB A;  2AHQ A;  3K2Z A;  3LA7 A;  2XSJ C;  1FMW A;  2RVC A;  5HVQ C;  1U78 A;  3VDX A;  4BY1 J;  4ASN A;  4L5I A;  4E7L A;  2HDD A;  1PVE A;  2XGX A;  1XD7 A;  4HSR A;  2KMU A;  2VQC A;  1K61 A;  1C0W A;  3BZC A;  1UG2 A;  1CQT A;  3P9I A;  4F7Z A;  2KIM A;  1OCZ H;  2OUM A;  2OU2 A;  4HNT A;  4EEF G;  1HKT A;  1O3R A;  4XSZ F;  2LD5 A;  1FSH A;  1MW7 A;  4WX9 A;  5K5Q A;  5L3B A;  4ESF A;  2KKO A;  4A3C J;  4JOM A;  2JA5 J;  1QVT A;  4HX4 A;  5D4R A;  4BKX A;  1YIT I;  4FX0 A;  5EZH A;  2EFN A;  2NOG A;  2X1E A;  4ZC3 A;  1W36 D;  3DQV C;  1GDT A;  2UZK A;  2M3A A;  4BQN A;  1R1U A;  1XPX A;  2KP6 A;  2A69 F;  3EQL F;  5EG0 A;  3FIW A;  3WTU C;  2STW A;  2DA6 A;  4IF4 A;  2RNJ A;  1J7K A;  1W5S A;  1XDS A;  3R6S A;  4ZH4 F;  2HYJ A;  1RPW A;  3E6M A;  4LG0 B;  4P55 A;  1BOA A;  2CUZ A;  3RDI A;  3EDP A;  1K7A A;  4CO8 A;  3U21 A;  3OS0 A;  4XIC A;  1ZRE A;  1MNE A;  2E35 A;  4R1H A;  5B66 C;  3JRI A;  2IEK A;  2D5V A;  5FRM A;  1VQ8 I;  1MJA A;  1UMQ A;  3FXJ A;  2M8G X;  3AG4 H;  4GRI A;  2M30 A;  4XID A;  3GTL J;  2A5W A;  2JMW A;  4Q5S F;  1ON1 A;  2KIF A;  1S29 A;  2K85 A;  4BH9 A;  3HOX J;  2M5W A;  1IV6 A;  2A5Y B;  3FXR A;  1U5T A;  1JUS A;  4FQG A;  3TBI A;  2Y9Y A;  2XPU A;  1QQI A;  3BZ6 A;  1IO2 A;  2LOO A;  2PMZ A;  3KYC B;  4A3J J;  1A5J A;  2L54 A;  5FFX A;  1XTA A;  3GLL A;  2W25 A;  2DQR A;  2L02 A;  2EFP A;  2EIL H;  1GXP A;  3J7Y J;  2VE9 A;  4M73 A;  3ZN1 A;  3G73 A;  3S1Q J;  2VOP A;  2AO9 A;  4GGG A;  3MWM A;  3JSO A;  1XB4 A;  1YTY A;  2V6E A;  2OQG A;  4F55 A;  4EMS A;  4HOB A;  4UUS B;  1S5L C; 
#chains in the Genus database with same CATH homology
 1PP7 U;  3D0S A;  1MGT A;  5DDG A;  4HX7 A;  4LLG F;  2Y75 A;  2IA2 A;  2W57 A;  3WE2 A;  1XMK A;  1FP2 A;  3KCC A;  2A6H F;  3P7N A;  3AAF A;  3KLO A;  1LEB A;  4IHS A;  1CF7 B;  3HOS A;  5FO5 A;  1F4K A;  2ETH A;  5HDG A;  2H6B A;  2FOK A;  1FBS A;  1Z91 A;  2F5C A;  2IPQ X;  1TQM A;  3GO5 A;  2EA2 A;  3F21 A;  2QWW A;  4IHT A;  2NNN A;  3I5U A;  1T98 A;  1BN5 A;  4QLC U;  1G3W A;  3M1E A;  1L3L A;  5L3E A;  1KU7 A;  5ILS A;  4GXO A;  3FMS A;  2XAJ A;  2OQR A;  5DCM B;  2UXN A;  4FHT A;  3J81 K;  4EVI A;  3WE3 A;  1T38 A;  4PCQ A;  4ZZD A;  3IHU A;  4K2E A;  3FHZ A;  5L3D A;  4HF1 A;  1B4A A;  2EK5 A;  4GYG A;  2CSO A;  5CVU A;  1YYV A;  1WI9 A;  5CVV A;  4A2U A;  1ULY A;  2VN2 A;  2WC2 A;  4G7O F;  1B9M A;  1HW2 A;  1IN4 A;  2BEO A;  1O7F A;  2EFQ A;  3H3U A;  1UST A;  3RIR A;  2NRA C;  1FWZ A;  3JTG A;  3RKY A;  4MTD A;  4ZYD A;  1FPQ A;  4UV8 A;  1AOY A;  4HLY A;  1RI7 A;  1IN7 A;  1O3T A;  1J2X A;  5HLH A;  5K5R A;  3I53 A;  1Z7U A;  3BJ6 A;  3TO6 A;  3PQJ A;  2P7V B;  3U2R A;  3V8K A;  2LKP A;  5DCF A;  2ZJ2 A;  3LQQ A;  4HDV A;  5DUK A;  4MQV A;  2RC4 A;  4LB5 A;  3GUD A;  5LHH A;  4Y17 A;  4LK0 F;  1W4M A;  4G94 A;  4BXU A;  2W84 A;  5FD5 A;  2R7D A;  1RIO H;  2PQ8 A;  4BHP A;  2XRO A;  1DPU A;  4RB3 C;  5CLS A;  1Z9C A;  3I64 A;  1ZRF A;  3ZMZ A;  2HKO A;  2Y48 A;  3J81 Z;  3SQN A;  2JT1 A;  2V1X A;  2WV0 A;  2L3D A;  4KA4 A;  2D2W A;  5D5W B;  4JK1 X;  1T39 A;  2ESN A;  2ISY A;  4M9S A;  1YG2 A;  2G7H A;  4AIK A;  1E17 A;  1X3U A;  4P5O A;  2A61 A;  3J80 K;  2JPB A;  3F8M A;  2B0L A;  4IJA A;  2NYX A;  2A68 F;  2OZU A;  5JHU A;  4RGU A;  2HEO A;  3RJP A;  1NHA A;  3CUQ C;  1JHH A;  4HV5 A;  3F22 A;  1ZG3 A;  2IA0 A;  2LNB A;  3DPT A;  3T0Y A;  1EH7 A;  2DI3 A;  3HYI A;  3ERE D;  4BHC A;  4NB5 A;  1F5T A;  1K79 A;  4IRH A;  1ZRD A;  1J75 A;  3WU0 A;  5FFZ A;  4IXA A;  5F1R A;  1UHW A;  2MH9 A;  4P9U A;  2FEZ A;  1I5Z A;  4G6D A;  4HF0 A;  1T6S A;  3C3W A;  4XRF A;  4WWC A;  4AWX B;  2XAF A;  2QLZ A;  1FOK A;  2F5E A;  2TDX A;  3ZPL A;  1XMA A;  4A5M A;  3CDH A;  1K78 B;  2MLG A;  3BY6 A;  3FF5 A;  2P5L C;  3F6V A;  4UXN A;  2QYO A;  1YW8 A;  5HDK A;  2PFB A;  2DPU A;  2O0Y A;  4S05 A;  2DW4 A;  1LDJ A;  2DO7 A;  2K4J A;  3EYY A;  3Q9V A;  3ABT A;  5HLI A;  3WTT C;  3WGH A;  3SZT A;  3HRT A;  3WOD F;  4G7H F;  1G6N A;  4MGR A;  3J80 Z;  2YU3 A;  3K9T A;  1JXS A;  4HYE A;  3TOA A;  1KQ9 A;  2NS0 A;  1ZH5 A;  1IN6 A;  2O8X A;  1CGP A;  2OZ6 A;  3HUG A;  4Y15 A;  3BDD A;  3J7A O;  4CIC A;  4Z2Y A;  4ESB A;  4OIO F;  1ZAO A;  4N9H A;  1YW7 A;  5E17 F;  2IA1 A;  5E1W A;  3WTS C;  1USS A;  1ONV A;  3BPV A;  2P6T A;  2ZNZ A;  4M9X A;  2XIG A;  5LEJ A;  3GZ6 A;  4CXF A;  2R3S A;  1XSD A;  3RKX A;  2IVM A;  3FXU A;  4HBL A;  4LLN A;  1SAX A;  1O57 A;  3CUO A;  5HDN A;  3SZP A;  2FBK A;  3E97 A;  2R7F A;  2VC0 A;  1S6L A;  2NNY A;  1BJA A;  4KIG A;  3WTV C;  4KUM A;  3ZMV A;  2D45 A;  2YPR A;  4KMF A;  3GLX A;  1XCB A;  5TRD A;  5F6F A;  2EFW A;  3LA2 A;  4MNU A;  4L0Z B;  1IN8 A;  2DLL A;  4TV7 A;  4MQ9 F;  2IRF G;  3HHH A;  2VBZ A;  3TGN A;  4BNC A;  2HDC A;  2QQA A;  1QO0 D;  1B6A A;  3KP2 A;  3R4K A;  1TBX A;  4HF2 A;  1FZP B;  1Z6R A;  4OU0 A;  3IWZ A;  3HOT A;  5LLQ A;  4XLP F;  1HW1 A;  3CO7 C;  3K1N A;  5BPI A;  4I98 B;  2GZW A;  2J5P A;  4AD9 A;  5DD8 A;  4HLX A;  1SD4 A;  1QBJ A;  2GA1 A;  3RTR A;  1MKM A;  1HKQ A;  3FMR A;  3TDZ C;  2QM3 A;  1FT9 A;  4RB2 C;  3CUQ A;  1FYM A;  4EGZ A;  4OMY A;  1KQ0 A;  5E1X A;  2Z5U A;  4A0X A;  4L0Y B;  4KYW A;  4EQQ A;  3GXO A;  1FSE A;  2JSC A;  4UVC A;  2D1H A;  3EYI A;  4AIJ A;  3GX4 X;  3ZMS A;  4I01 A;  1LQ1 A;  3IWF A;  3FX3 A;  1B9N A;  2GA2 A;  1SFE A;  5FGM A;  1IW7 F;  1A04 A;  1KYW A;  3MQ0 A;  5CJ9 A;  1FLI A;  5D5V B;  1T2K A;  3N97 A;  1W7P A;  4ZZL A;  3DFG A;  4YFX F;  1TNT A;  5FLX K;  3VB2 A;  3WTZ A;  4IVN A;  2QBY B;  3I59 A;  2CWE A;  2KJB A;  4LJZ F;  3NRV A;  5JFR A;  1LDK B;  3L09 A;  1MDM A;  3I58 A;  4LLL A;  1ZRC A;  2IW5 A;  1HSJ A;  3L2C A;  4NQW A;  3ZN0 A;  4S04 A;  3JTH A;  1ZLJ A;  4I02 A;  2YSR A;  1KQ8 A;  4B09 A;  2E1N A;  1YW9 A;  2ELH A;  3BJA A;  1Y0U A;  2HTJ A;  1Z1D A;  4OIP F;  1J0R A;  1ODD A;  2FU4 A;  2P4W A;  2DBB A;  4M74 A;  3CTA A;  5LEK A;  5HS7 A;  3C7J A;  3CO6 C;  2ESH A;  2FRH A;  1D8K A;  3IRR A;  3C1D A;  1XN7 A;  3HTU A;  3KP5 A;  2CW0 F;  4WF2 A;  3TQN A;  2VOO A;  1TW3 A;  2VXZ A;  2FE3 A;  2P5K A;  3P9C A;  5E20 A;  5LGU A;  1OPC A;  5D8L B;  1SFX A;  1ZLK A;  4HZF A;  5FLX Z;  1P2F A;  5H6R A;  2P7C B;  1FY7 A;  2A6E F;  5D4S A;  2COM A;  5BS6 A;  3V7C A;  3T1B A;  1GVJ A;  4KN4 X;  5D5U B;  2DQL A;  1QZZ A;  3KET A;  5LGT A;  2Z33 A;  1YIO A;  5IT9 K;  1XGM A;  1OKR A;  2JTV A;  3B73 A;  3U1D A;  5HS8 A;  3GEZ A;  4O6J A;  4U0W A;  5IT3 A;  2KIU A;  3T8R A;  4N0B A;  4H0E A;  5H6Q A;  4RAY A;  1PUE E;  1DP7 P;  2STT A;  3FWE A;  3RYP A;  2VOD A;  5J8C A;  3ZMT A;  1LJ9 A;  3HIF A;  4U88 A;  4U0V A;  2JPC A;  2ZME A;  5D6F A;  2FMY A;  4Y13 A;  4R79 A;  4EJW A;  1HW5 A;  1B59 A;  2EJR A;  4I0B A;  4IRG A;  3FM3 A;  3ULQ B;  1R23 A;  4G9Y A;  2V79 A;  4E70 A;  4XSX F;  3BWG A;  2QEN A;  4RGS A;  4MEY F;  1OYW A;  1P4W A;  3MAJ A;  1DPR A;  5HS9 A;  4BQA A;  5ICG A;  5A2Q K;  4HX8 A;  1KU3 A;  1PP8 F;  2GIV A;  2IP2 A;  1AWC A;  2HQR A;  2QVO A;  4M71 A;  5KK1 A;  1BI0 A;  1R5H A;  2HYG D;  1FP1 D;  3DEU A;  4RGR A;  2DK5 A;  2QQ9 A;  1O7L A;  1R1T A;  1PDN C;  2ZKZ A;  3ML6 A;  2MD5 A;  4I09 A;  2HGC A;  3HSR A;  3GFI A;  4ZYE A;  5J8F A;  4LGW A;  2V1U A;  3E5U A;  4EJV A;  3FMQ A;  2P8T A;  1XGO A;  1STZ A;  1YO5 C;  2EWN A;  3M8E A;  1Z6T A;  2G9W A;  5E8I A;  5L3G A;  1G3S A;  1B1B A;  5LHG A;  1S3J A;  4LK1 F;  4OIQ F;  5IT9 Z;  4OMZ A;  2ACJ A;  3F8N A;  3KLN A;  2L01 A;  2FML A;  3BRO A;  4OIR F;  2M87 A;  1R58 A;  1SFU A;  3TO7 A;  3MZH A;  4A0Y A;  1XSV A;  1BM9 A;  2ZCW A;  2FF4 A;  3LFK A;  3MEX A;  3E5Q A;  2PN6 A;  5DD4 A;  3PFI A;  2UWM A;  1WRJ A;  5ICE A;  2C6Y A;  4FX4 A;  3W6K B;  3HHG A;  4ENJ A;  2O61 A;  3HSF A;  1QZY A;  1TNS A;  4ENN A;  5HOO A;  1OMI A;  4N9I A;  4LG0 A;  1U2W A;  1J5Y A;  5DV5 A;  1FC3 A;  1IZ1 A;  4IPA A;  1KA8 A;  3IL2 A;  2H94 A;  2O6G E;  4RB1 A;  4UV9 A;  5A2Q Z;  2LDU A;  3I4P A;  2HQN A;  3E3V A;  5BQT A;  4IRI A;  1YS6 A;  1OR7 A;  1RZ4 A;  2MC3 A;  2EV5 A;  2E1C A;  1EH6 A;  4YII A;  1LVA A;  3DPL C;  3ZQ7 A;  1IF1 A;  1U5T B;  2P5V A;  3I71 A;  3NEU A;  4ON0 A;  3JW4 A;  3KEO A;  2DFI A;  1TTY A;  2F5D A;  1HQC A;  2NAZ A;  1W7P D;  5AIP A;  1BIA A;  5E18 F;  1U8R A;  3GW2 A;  3MFK A;  4EM0 B;  3ISP A;  3F8C A;  2WWY A;  3QP5 A;  1YS7 A;  4UNO A;  3IKV A;  3WGG A;  1IXR C;  2YX7 A;  4LMY A;  3COA C;  1O3Q A;  1F1Z A;  1ON2 A;  1XCV A;  2BYV E;  5ICF A;  2IJL A;  1CF7 A;  1J59 A;  5F64 A;  3QAH A;  4O3M A;  2Q0O A;  1R36 A;  1BC8 C;  3ZMU A;  4M72 A;  1SD7 A;  3KFW X;  4WXD A;  3WTX C;  4MTE A;  3I0T A;  3GFM A;  1J9I A;  3E5X A;  2K02 A;  1LB2 A;  4AIH A;  3MCZ A;  4EM2 A;  2XAG A;  1V3F A;  5BMZ A;  2HOE A;  3B02 A;  1ZYR F;  2XVC A;  2E7X A;  4ETS A;  2Z3Y A;  4U7B A;  3BP8 A;  1WWX A;  5TJJ A;  2AS5 F;  4PGG A;  5DCM A;  4Q47 A;  4KMU X;  2HZT A;  4BAY A;  1T0F A;  5J6X A;  2FSW A;  4YFK F;  3GVA A;  1MD0 A;  3D5L A;  4YIF A;  2XAS A;  4M6X A;  1H9T A;  4CDG A;  3VOE A;  4HQM A;  2VBW A;  3W6J B;  5DEQ A;  3F6O A;  1HKS A;  1XGS A;  3KEQ A;  4GO1 A;  2W85 A;  3F8B A;  2L4A A;  4JQF A;  5CVI A;  4KFC A;  2LF8 A;  1I1S A;  2J5O A;  1ZG1 A;  3DP7 A;  4CGZ A;  2MLK A;  1UCR A;  1WKM A;  1JGS A;  3R60 A;  2O3F A;  4CZZ A;  2V6C A;  3RI4 A;  2ADU A;  2XKP A;  2QZ8 A;  2Y0M A;  1VTN C;  1Z05 A;  2K86 A;  3KP3 A;  4WCG A;  4ENK A;  4ZYH A;  5JVT A;  3E6C C;  4EJO A;  5HLG A;  2WTE A;  3DXJ F;  3KZY A;  2FBI A;  2XV4 S;  5ED4 A;  3QP6 A;  3VOD A;  2HS5 A;  3SXY A;  2EV6 A;  3V8J A;  2XAQ A;  3O2P E;  4RS8 A;  1P6R A;  4LFU A;  3GFL A;  2L4M A;  3JSP A;  5KVR A;  4BHB A;  2RKH A;  5EEH A;  2PMH A;  4ESJ A;  2BE5 F;  3BOQ A;  3M8F A;  5DYM A;  1FBU A;  1IAW A;  3HSE A;  2HYF A;  1IN5 A;  3GWZ A;  4YFN F;  2A3S A;  1R00 A;  4EM1 A;  2VON A;  4A6E A;  5AON A;  2QQB A;  2JRT A;  1RNL A;  5DUI A;  3ELK A;  3FM5 A;  3PQK A;  1D5V A;  4WXC A;  2ZBK A;  4B8X A;  2VT3 A;  1REP C;  1OYY A;  2HFH A;  2PLY A;  4A5N A;  4EJT A;  5K5O A;  4G8X A;  5LRR A;  3RPU A;  3WU1 B;  2LF7 A;  3HTS B;  5BOX A;  2ZO4 A;  1XGN A;  2VT2 A;  3L00 A;  4ENM A;  1I27 A;  3M7G A;  4HQE A;  2IT0 A;  2K7L A;  2DTR A;  3O6B B;  2P6S A;  1BBY A;  1P4A A;  2RQP A;  4HDU A;  3TOB A;  1HBX G;  1YFH A;  2A07 F;  1IXS B;  3K1P A;  4WK8 F;  2D1V A;  2FNP A;  2GQQ A;  1WSU A;  4OIN F;  2W24 A;  2BBY A;  2KRF A;  1ZHF A;  3ABU A;  3DF8 A;  4WXH A;  2MH2 A;  4KIB A;  2Q8K A;  3LST A;  1LDD A;  4RAZ A;  1MJB A;  3V7S A;  5JR3 A;  3GZ5 A;  1K78 A;  1FNN A;  1BC7 C;  1QPM A;  2RDP A;  5AIQ A;  3K69 A;  4OOI A;  1H9G A;  3WTW C;  5H20 A;  2PG4 A;  4D0P A;  1RUO A;  4NHJ A;  1G3Y A;  4RB0 A;  1W5T A;  4KN7 X;  1IUY A;  5FB2 A;  4L9J A;  2X4H A;  1GHC A;  3CJN A;  4A0Z A;  3K1M A;  2E7W A;  2HWV A;  5FD6 A;  3RPQ A;  2CG4 A;  1OYI A;  5ICC A;  5E8G A;  2K4B A;  5LGN A;  3MZY A;  2RN7 A;  2Z9O A;  1SMY F;  1BIB A;  4G6Q A;  3WG9 A;  5L3F A;  5CVJ A;  1HST A;  3G3Z A;  1BI1 A;  2CO5 A;  4PZJ A;  2ZFW A;  3ZP5 A;  1BI3 A;  4U0Y A;  2EFO A;  4EJU A;  3E6D A;  3E6B A;  3LAP A;  1BI2 A;  4GYI A;  3IKT A;  1EH8 A;  1FBQ A;  2F2E A;  4G7Z F;  1JE8 A;  2XHK A;  2GXB A;  1SD6 A;  2H6C A;  5CYV A;  3WGI A;  1I1G A;  3ECO A;  4MEX F;  2DT5 A;  1QGP A;  3QU3 A;  2V1D A;  3Q9S A;  4P96 A;  2M8E A;  1R1V A;  5D5X B;  2O03 A;  1GXQ A;  2DK8 A;  2JZY A;  2Z99 A;  4LD5 A;  1DUX C;  3L9F A;  1S7A A;  3ZMD A;  2FBH A;  3T5X A;  4LB6 B;  2AXL A;  3F72 A;  2HR3 A;  3V8L A;  1KU2 A;  4KDP A;  3R0A A;  2F5F A;  3KP7 A;  2M1B A;  4L5J A;  3F23 A;  1IXC A;  4P9F A;  3VFZ A;  3QPT A;  3LA3 A;  2YX4 A;  2OD5 A;  3N4M A;  1XSX A;  3RKW A;  3DKW A;  3F3X A;  3CLO A;  5LRS A;  3V7R A;  4ZYG A;  4YG2 F;  4UUV A;  1SMT A;  3HRM A;  4M6Y A;  2GWR A;  3SHF A;  2PI0 A;  4PGH A;  2RV8 A;  3QPH A;  3GYH X;  3SFZ A;  3QRF F;  2ISZ A;  3CUQ B;  2VBY A;  3U9G A;  1UFM A;  2H09 A;  1SD5 A;  2UXX A;  4XLN F;  4AVP A;  4KIF A;  4L9N A;  4BYY A;  1I6X A;  3V4G A;  3LAJ A;  1P92 A;  1V4R A;  4JBA A;  3I54 A;  5LHI A;  5K1Y A;  2EB7 A;  2VBX A;  2CYY A;  1K6O A;  3ROU A;  4KT5 C;  2ZXJ A;  1W7P B;  4HAM A;  2DU9 A;  1G3T A;  2QBY A;  1HXD A;  3LQR A;  3ECH A;  2CGP A;  2HKX A;  4DQ2 A;  5L3C A;  5LBQ A;  3I59 B;  5CVR A;  1TQP A;  3KE2 A;  1MDM B;  3VEP A;  2PMU A;  2XKO A;  3WTY C;  3IRQ A;  2DPD A;  4EGY A;  3LWF A;  3M9A A;  5BPD A;  1KYZ A;  3GFJ A;  2QUF A;  3O3K A;  1G4D A;  1FX7 A;  1ZN2 A;  3Q5F A;  1P4X A;  4GCV A;  3H3Z A;  2GXG A;  4CHU A;  2LSO A;  1R22 A;  3RYR A;  4O5V A;  1JHF A;  5ERI A;  2FQ3 A;  1LEA A;  1Q1H A;  3L7W A;  3P9K A;  1H0M A;  1TQI A;  2KJC A;  1F9N A;  3R61 A;  3GF2 A;  2H27 A;  3KP6 A;  4MHG A;  3H92 A;  2M45 A;  4FT8 A;  3QU6 A;  3C18 A;  4I7H A;  1YLF A;  1UB9 A;  1L0O C;  1R5G A;  1IRF A;  2EA4 A;  1XDU A;  4L9T A;  1WQ2 A;  4A6D A;  1U5T C;  4HA8 A;  2G7U A;  1YQA A;  3JAM K;  2XUB A;  3HRS A;  3REO A;  1D3Y A;  3BPX A;  2OA4 A;  3IC7 A;  2OBP A;  2XAH A;  5D8K B;  2FA5 A;  1RUN A;  2PBI A;  3KZZ A;  4EV0 A;  4CYD A;  1MJ9 A;  2PEX A;  2FNA A;  3K0L A;  3TO9 A;  3EUH A;  1IRG A;  1LNW A;  1O3S A;  1FYK A;  4QWQ A;  3KP4 A;  6PAX A;  4UVB A;  1TW2 A;  4I2O A;  5JI6 A;  2CQK A;  1U3E M;  2VE8 A;  2K27 A;  4HW0 A;  3DV8 A;  3OOP A;  4M9Z A;  5ILU A;  1U6G A;  4A12 A;  5ILV A;  3FXQ A;  3HRU A;  1EV7 A;  1KGS A;  1S8N A;  1ZAR A;  2FXA A;  3TKY A;  2EV0 A;  2DAO A;  5D6E A;  3OV8 A;  4DNC A;  3F8F A;  1UHM A;  4I0A A;  2ZME B;  4R8H A;  2V9V A;  2OAZ A;  2CFX A;  4KIC A;  4KNY A;  1S7O A;  1ZGJ A;  2HTS A;  4PDK A;  2RGV A;  2BV6 A;  5EEG A;  2XRN A;  2MA3 A;  1DDN A;  4U7D A;  1E2X A;  2Q2E A;  2VC1 A;  2X0L A;  2YR2 A;  4UVA A;  1KU9 A;  4Q48 A;  3S2W A;  3TDU C;  3EET A;  1R7J A;  3JAM Z;  1ZGA A;  3QOP A;  3FZV A;  4HV6 A;  2MBF A;  2GAU A;  3T8T A;  4L18 B;  4XBF A;  2ZNY A;  4L9V A;  3NQO A;  4Q4Z F;  1TLH B;  2BGC A;  3BJO A;  2PJP A;  1ZG5 A;  1QNT A;  4UHT A;  1FYL A;  5E1Z B;  1D8J A;  4RGX A;  3R0J A;  1MZB A;  3K2Z A;  3LA7 A;  2RVC A;  5HVQ C;  1U78 A;  4ASN A;  4L5I A;  2XGX A;  1XD7 A;  1C0W A;  3P9I A;  4F7Z A;  2KIM A;  2OU2 A;  1HKT A;  1O3R A;  4XSZ F;  1FSH A;  4WX9 A;  5K5Q A;  5L3B A;  4ESF A;  2KKO A;  4HX4 A;  5D4R A;  4FX0 A;  2EFN A;  3DQV C;  2UZK A;  1R1U A;  2A69 F;  3EQL F;  3WTU C;  2STW A;  4IF4 A;  2RNJ A;  1J7K A;  1W5S A;  1XDS A;  4ZH4 F;  3R6S A;  3E6M A;  4LG0 B;  4P55 A;  1BOA A;  3RDI A;  3EDP A;  1K7A A;  4CO8 A;  1ZRE A;  4R1H A;  1MJA A;  2M30 A;  4Q5S F;  1ON1 A;  2KIF A;  1S29 A;  4BH9 A;  2M5W A;  2A5Y B;  3FXR A;  1U5T A;  1QQI A;  3BZ6 A;  2L54 A;  5FFX A;  2W25 A;  2DQR A;  2L02 A;  2EFP A;  1GXP A;  2VE9 A;  4M73 A;  3ZN1 A;  3G73 A;  2VOP A;  4GGG A;  3MWM A;  3JSO A;  1XB4 A;  1YTY A;  2OQG A;  4EMS A;  4HOB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...