2BV6A

Crystal structure of mgra, a global regulator and major virulence determinant in staphylococcus aureus
Total Genus 49
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
49
sequence length
137
structure length
137
Chain Sequence
MNLKEQLCFSLYNAQRQVNRYYSNKVFKKYNLTYPQFLVLTILWDESPVNVKKVVTELALDTGTVSPLLKRMEQVDLIKRERSEVDQREVFIHLTDKSETIRPELSNASDKVASASSLSQDEVKELNRLLGKVIHAF
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcriptional regulator
molecule keywords HTH-TYPE TRANSCRIPTIONAL REGULATOR MGRA
publication title An Oxidation-Sensing Mechanism is Used by the Global Regulator Mgra in Staphylococcus Aureus.
pubmed doi rcsb
source organism Staphylococcus aureus
total genus 49
structure length 137
sequence length 137
ec nomenclature
pdb deposition date 2005-06-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01047 MarR MarR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2bv6A00
3LA3A 1QPMA 2QZ8A 2K4JA 2ESHA 4KMUX 1FBQA 4UHTA 2O6GE 3L00A 1Z91A 4EM0B 5F6FA 4ZYEA 3ZPLA 2XAJA 4UVAA 3BJ6A 1RZ4A 5LLQA 5FFZA 3V7CA 5K5QA 1B1BA 3RYRA 2F5EA 1YFHA 1TLHB 1BI0A 3ZN1A 3GXOA 1FC3A 1KGSA 3LAPA 1KYZA 2F5CA 4HF2A 1W4MA 4BQAA 2LF8A 1SFEA 2BEOA 3E97A 1V4RA 3EUHA 2LNBA 2LSOA 1S6LA 1BC7C 4HF0A 1U8RA 1FT9A 3K0LA 2X4HA 2XAQA 4Q5SF 4HQEA 1ZREA 3F8CA 2A68F 3PQKA 1W7PD 1BIAA 1BN5A 5D6EA 4A5MA 4M6XA 1FYLA 3FWEA 2X0LA 2DT5A 4PGHA 3RKYA 4FX4A 2Q2EA 4A12A 3I0TA 4PZJA 1QO0D 3RDIA 4EM1A 2ZMEA 5E1ZB 3TKYA 1IXCA 3RI4A 3TDUC 4EJOA 4NQWA 3T5XA 3CUOA 1MJBA 2PMUA 1S7OA 2XVCA 3DQVC 2QUFA 1U2WA 2RN7A 4DNCA 2XROA 2MH9A 2MC3A 2NYXA 1XN7A 1ZGAA 4M72A 4DQ2A 1H0MA 2IVMA 1CF7A 2O8XA 2FEZA 1YO5C 5BPIA 2G7UA 2A6HF 1TNSA 3F72A 1XSVA 3FXUA 1IUYA 5D5XB 3ZMVA 3C7JA 2JPCA 2ADUA 3TO7A 1IN7A 2EA4A 1LJ9A 1SD5A 3R4KA 4P5OA 1XSXA 2QQ9A 2Z33A 3J81Z 4WXCA 2XRNA 2FBIA 3DP7A 4A0YA 1D8JA 4L18B 1WQ2A 1TQMA 2DQRA 2D2WA 2ZNZA 2P6TA 4ZYHA 2M45A 3ROUA 3ZN0A 3RPUA 4BYYA 1PDNC 4M6YA 2W24A 1LEAA 1O7FA 2QLZA 3V8JA 2IPQX 4I98B 3GWZA 2NRAC 3DPTA 3SZPA 1TW2A 1REPC 3O2PE 2GAUA 5J8FA 3O3KA 3NRVA 3I54A 3K1PA 2W57A 3CUQA 1R1VA 2HGCA 2YPRA 4L9JA 1L0OC 1QZYA 4BXUA 2DPDA 1O3TA 1W7PB 4U7BA 3TO9A 4M9XA 2WWYA 2PLYA 2FXAA 3JTHA 1EH6A 4I0AA 1ONVA 2M5WA 1TBXA 1DPUA 4RAZA 1B4AA 1ULYA 1RUOA 3E5UA 3BDDA 1LQ1A 2QQBA 1YS6A 2V1DA 3P9IA 5FD6A 2VBWA 5LGUA 2VT3A 5D5WB 1Z9CA 2WC2A 3GLXA 1YW7A 2YR2A 4EGZA 4MEXF 3WGIA 2M87A 1KU3A 2GA2A 5L3DA 2BBYA 3MZYA 1P6RA 4UNOA 5FLXK 3VB2A 1FZPB 4BHCA 4KIBA 3I58A 3ZP5A 1DP7P 5ERIA 3IKVA 5HLGA 3DV8A 2EJRA 3F21A 4HLXA 4EV0A 1Z6TA 5JI6A 4CDGA 1Q1HA 5D8LB 1D5VA 4HYEA 4IPAA 4HAMA 2E7XA 4RGXA 4UVBA 1UHMA 2XIGA 4PDKA 4AIKA 5DCMA 2QWWA 5HVQC 4G6QA 2QVOA 3JW4A 2EK5A 3M8FA 3BY6A 4LK0F 1JXSA 4R8HA 1I27A 1MJAA 1XCVA 4ON0A 4RGSA 2A61A 5L3CA 3I59A 3DPLC 1EH7A 4ZYGA 1SMTA 2VE8A 4KFCA 4F7ZA 5EEHA 4CXFA 1V3FA 3QPHA 1YW9A 1G3YA 2HTSA 2XAFA 5FFXA 1AOYA 1XGMA 3ERED 5FLXZ 3AAFA 3CO6C 1YS7A 4GYGA 1LDKB 4O5VA 1BJAA 2HOEA 1LEBA 6PAXA 1FPQA 1J59A 4L0YB 3JTGA 5ICGA 4IXAA 5A2QZ 2L4MA 3GZ6A 1ZG3A 2FF4A 1ZRFA 4XBFA 4CGZA 3JAMK 2XAGA 3ABTA 3F8FA 2O61A 4L9TA 3GVAA 1PP8F 1H9TA 1R36A 4H0EA 1XSDA 1ZLKA 4K2EA 1P4WA 5LHIA 2PBIA 3O6BB 4KIGA 1LNWA 1G3SA 1P2FA 1BC8C 1DDNA 2CG4A 3E5XA 3EYIA 1Z7UA 3F8BA 1R22A 1F1ZA 2RQPA 4HV6A 4KNYA 3R60A 3L9FA 5H6QA 2LKPA 5E8GA 3E3VA 3EYYA 5FD5A 3GFLA 2OQRA 5KK1A 3R6SA 4IF4A 1OKRA 4U0WA 2Y75A 3KFWX 3F3XA 1XMAA 2FA5A 1XDUA 4I2OA 1U78A 2STTA 2XGXA 1WWXA 4XLNF 3GX4X 2EV0A 2R7FA 3JAMZ 4KICA 2RVCA 5IT9K 3G73A 4A5NA 4BNCA 1LVAA 3BJOA 2RDPA 1JE8A 5FO5A 4HV5A 2JPBA 5FGMA 2M1BA 4WXDA 5ILSA 2FE3A 1QZZA 4ZH4F 1FYKA 3ELKA 2P7VB 2LDUA 4OOIA 5ICEA 1TW3A 3WTZA 5LHGA 1ZG1A 1MDMB 1O7LA 3J80K 1ZARA 5J8CA 3TQNA 1WRJA 4CICA 1B59A 3DXJF 4FX0A 2ZJ2A 1K78B 5CVUA 3FMQA 1I6XA 1FX7A 2J5OA 3Q5FA 5KVRA 2CFXA 2PQ8A 2OBPA 4U0VA 2EB7A 3KLOA 2DK8A 1PUEE 5ILUA 4Z2YA 1FBSA 1XGOA 2EWNA 4MTEA 2F5FA 3HHHA 5LEJA 3M8EA 4UXNA 2CSOA 2ZO4A 1IZ1A 1UB9A 2HKOA 4PCQA 3COAC 2R3SA 1FWZA 5ILVA 4A6DA 2NNYA 5FB2A 1J5YA 1U5TC 3C18A 5LRSA 3WTTC 4RS8A 4LD5A 1XGNA 2DTRA 3J80Z 4ENNA 1E2XA 4I02A 3HRUA 3VFZA 2C6YA 2IP2A 3BJAA 5DYMA 3WTVC 1HQCA 2B0LA 5E20A 2CW0F 3P7NA 4G8XA 3MZHA 4IHSA 5L3FA 4OIQF 3MAJA 4EJUA 2KKOA 3EDPA 2XASA 2P4WA 5JVTA 5K5OA 2QBYB 1QNTA 1JHHA 1XMKA 4XLPF 1U5TB 4E70A 4OMZA 4UV8A 3T0YA 4Y17A 4KUMA 4D0PA 2H09A 5IT3A 1BM9A 3ABUA 3BWGA 3KP5A 1UFMA 2LF7A 4M9ZA 4KA4A 1R00A 3W6KB 3HRSA 1I1GA 3WTSC 4HBLA 4WF2A 2OD5A 2GZWA 1KA8A 4U0YA 2BE5F 3HSRA 2Z3YA 3IWZA 4WWCA 1G6NA 5AONA 3KZZA 1EV7A 2CWEA 1OYWA 4N9HA 2OAZA 4CZZA 4Q4ZF 5L3BA 3FM3A 2VXZA 1WI9A 3HOSA 2QM3A 3KLNA 4UVCA 4MGRA 2HYGD 2P5VA 4M74A 3WGHA 2IW5A 2OZ6A 3RJPA 4WX9A 5BMZA 2BV6A 4A2UA 4IJAA 5HOOA 4RGUA 4LG0A 1KU9A 2K7LA 2KRFA 1EH8A 4P55A 2D45A 1SD4A 3FXQA 3TOAA 1DUXC 5HDNA 5CVRA 2E1CA 4G6DA 4AWXB 3DEUA 3LQQA 4RGRA 3LQRA 4P9UA 1ON2A 3C3WA 1AWCA 3H3UA 4LB5A 1B6AA 1KU2A 3FHZA 4GO1A 4LFUA 4G7ZF 4U88A 3Q9VA 3FF5A 4TV7A 3H92A 4LJZF 4KMFA 4RB2C 3M9AA 1P92A 4XRFA 3E6MA 2HYFA 2P5LC 3BZ6A 4GXOA 3ZMTA 1WKMA 3WTXC 5K1YA 2UWMA 3EQLF 4A0ZA 3SHFA 1ON1A 4G7OF 3JSOA 2UXNA 5D8KB 1S8NA 3V7RA 2P8TA 1F4KA 3QAHA 3LA7A 1I1SA 4AIJA 3FMSA 3IWFA 5H6RA 4HW0A 4AIHA 5LRRA 2EV6A 2WV0A 4HQMA 1T2KA 2TDXA 3GEZA 4L9NA 1J9IA 3IRRA 1YYVA 5DD8A 1H9GA 4G7HF 1BI2A 3KEOA 1BI3A 4CYDA 2V1UA 1J7KA 2OQGA 2VE9A 3KP4A 2FRHA 2L3DA 3G3ZA 3HSFA 4HZFA 4EGYA 4ESFA 4NHJA 2OA4A 2ACJA 2ZCWA 3ZQ7A 1K7AA 2VODA 3TDZC 1RNLA 2M8EA 1J2XA 2KJCA 2XV4S 1IRFA 2FBKA 3F23A 2DU9A 2STWA 2V79A 3WGGA 1UHWA 1ZN2A 1I5ZA 3CJNA 2HEOA 2ZBKA 1E17A 5DEQA 1ODDA 4O6JA 3KEQA 3KP3A 2KJBA 3RPQA 2IA2A 1DPRA 3GZ5A 1HBXG 4MQVA 3KETA 2KIMA 4GYIA 1O3RA 3QRFF 4A0XA 1W5TA 3Q9SA 3E6CC 3ZMDA 3CLOA 1TNTA 1J0RA 4JQFA 1YTYA 1A04A 2ZMEB 1HXDA 3U1DA 4ESJA 4S05A 2HKXA 5E1XA 1FLIA 4ZYDA 5ICCA 2H6BA 1R7JA 2CO5A 5K5RA 4HF1A 1QBJA 4WXHA 3F6VA 4YIFA 3FXRA 2DW4A 5D4RA 1TQPA 1CF7B 4JBAA 4BH9A 5LHHA 1GVJA 1SFXA 4IHTA 2PMHA 3B73A 2FMLA 4I01A 2XKOA 5DUKA 4ESBA 5L3GA 2UXXA 5CJ9A 3HTUA 3S2WA 3GFJA 4MNUA 2E7WA 2RV8A 2Z5UA 3HSEA 4ETSA 1ZRDA 3DKWA 3QP6A 4UUVA 2ZXJA 5CVIA 4HX7A 4BHBA 2FU4A 3HOTA 2VT2A 1STZA 1IAWA 3P9KA 1MGTA 3OOPA 4KDPA 4YG2F 5CVVA 3CUQC 2IA0A 3P9CA 1S3JA 4Q48A 3SZTA 4RB0A 4N9IA 2CYYA 2FOKA 3IC7A 3LSTA 2XUBA 2JSCA 3GFMA 2P7CB 3HIFA 3N97A 1SD6A 3HYIA 1W7PA 5LEKA 3K69A 3I5UA 2DK5A 2O3FA 4HX4A 1IN4A 5J6XA 1SD7A 3IHUA 1HW5A 3WE2A 2XKPA 2VN2A 2MLGA 3WE3A 3T8TA 4HLYA 4M73A 3QPTA 4BHPA 2BGCA 4ENMA 4KYWA 1D8KA 3CUQB 1SFUA 1R5HA 2OZUA 2ZKZA 3I64A 1O3QA 1HKQA 1K79A 2L54A 2Q0OA 3ECHA 4LLGF 5CYVA 2FSWA 1BOAA 4MTDA 2FMYA 3ECOA 3RIRA 1HKSA 3ZMUA 4M71A 5EEGA 1QGPA 2O0YA 4ASNA 4LB6B 1R1UA 1FSEA 1GXQA 1LDJA 2W85A 3QOPA 5DUIA 1IF1A 4HDVA 4IRIA 3BPXA 2GIVA 2IRFG 5BS6A 3BP8A 1LDDA 5IT9Z 4L5JA 4OIRF 1MJ9A 2VBZA 5HS8A 2ELHA 2RGVA 1B9MA 4XSZF 3J7AO 2UZKA 4B8XA 1MZBA 2JZYA 2FNAA 5F1RA 5ED4A 2EFWA 4LMYA 2K86A 4A6EA 2DO7A 3U2RA 2KIFA 3V8LA 1QQIA 1IN6A 2HS5A 2F2EA 2F5DA 3F8NA 5E8IA 3CTAA 3VEPA 3LA2A 5JHUA 3K9TA 2XHKA 2VC0A 1MKMA 5ICFA 1SAXA 3WTYC 3GW2A 3R61A 3DF8A 3F8MA 5E1WA 5D5VB 4LK1F 4GGGA 5CVJA 1TTYA 3KCCA 1KQ9A 3BPVA 1FP2A 3T8RA 5JR3A 3J81K 4EM2A 1RI7A 3QP5A 5JFRA 2DBBA 2NNNA 5DCMB 1FOKA 3E5QA 3SFZA 2HQNA 2ZFWA 1G3WA 1OPCA 1R23A 4I09A 3L2CA 1XGSA 3IL2A 3NEUA 1UCRA 4U7DA 1KU7A 3I59B 1BI1A 3QU6A 1IXSB 3RKXA 1YLFA 3PQJA 3E6BA 2ESNA 2EV5A 2PG4A 5HLIA 2BYVE 4Q47A 2K27A 4OU0A 2FNPA 3OV8A 2RKHA 3IRQA 1K6OA 1RIOH 2A5YB 4B09A 5DDGA 4HOBA 1HKTA 2P6SA 3R0AA 2VBYA 4LLLA 1S7AA 2E1NA 1HSJA 2VBXA 3E6DA 2EFOA 2COMA 5DD4A 1R5GA 1HSTA 3LAJA 2VC1A 2Y0MA 4UV9A 1ZRCA 1D3YA 2GA1A 3MFKA 1S29A 3C1DA 1GXPA 3RKWA 1JHFA 1T98A 3M7GA 5BPDA 4P9FA 2O03A 3BOQA 2CGPA 2V6CA 2XAHA 4P96A 2VOPA 3GO5A 2W84A 4L9VA 1OMIA 4ZZLA 3IKTA 4RAYA 5E17F 1O57A 2GXGA 2EA2A 5AIPA 3VODA 1R58A 4OMYA 3K1NA 1F9NA 3MQ0A 3MEXA 4N0BA 5H20A 2PEXA 1ZH5A 1U3EM 2QQAA 1ZLJA 3QU3A 3MWMA 3FM5A 1Z6RA 2G7HA 1XD7A 3HRMA 1IW7F 4G94A 1MDMA 4OIOF 1ZHFA 3HTSB 3I53A 4ZZDA 2HTJA 4G9YA 4WK8F 3SXYA 3PFIA 1K78A 4M9SA 3T1BA 1JGSA 4IVNA 4EMSA 3HHGA 1YW8A 3HRTA 2G9WA 3ZMSA 4CHUA 2W25A 4S04A 4MHGA 4RB1A 2YX4A 1GHCA 1J75A 2MA3A 2JRTA 5HDKA 2IT0A 3ZMZA 2MH2A 4R79A 4R1HA 1G3TA 2HR3A 2FBHA 2Z9OA 4OINF 4AVPA 4EJTA 3F6OA 3I4PA 4KIFA 2CQKA 2MD5A 1P4XA 2KIUA 1W5SA 1C0WA 2VOOA 2DQLA 3ML6A 2H27A 1ZAOA 5TJJA 1T39A 2IA1A 1Z05A 3JSPA 5BQTA 4KN4X 2FQ3A 2K02A 2RNJA 1ZGJA 3KE2A 2MLKA 1NHAA 2HQRA 1XDSA 2J5PA 1T38A 1Z1DA 4NB5A 4IRGA 5BOXA 3H3ZA 3NQOA 2ISYA 2L01A 3WG9A 4RB3C 5DV5A 3D0SA 3TOBA 1R1TA 2ISZA 3W6JB 1FBUA 5DCFA 5HS9A 5LBQA 4HDUA 1RUNA 4HA8A 5D4SA 5E18F 3KP6A 3KP7A 2HFHA 5A2QK 3FMRA 4KT5C 1IN8A 3BROA 2QBYA 2PFBA 1U6GA 2A69F 1T6SA 1U5TA 4MQ9F 1YG2A 4LGWA 5TRDA 4I0BA 3WTWC 2D1HA 3FX3A 4LLNA 3ULQB 3REOA 3GUDA 3L09A 1P4AA 4L0ZB 2RC4A 2JT1A 1BIBA 4YFNF 4FT8A 2HZTA 4JK1X 5HLHA 3CO7C 4OIPF 3EETA 2QENA 3R0JA 4QWQA 3RTRA 2EFNA 2DI3A 5D6FA 3CDHA 1KQ8A 1L3LA 3I71A 4WCGA 5L3EA 2DFIA 4QLCU 3WODF 2PN6A 2EFPA 2PI0A 1XB4A 1ZG5A 1FSHA 3D5LA 1HW2A 3ISPA 3GFIA 1IRGA 3GYHX 3LWFA 3MCZA 1OYIA 4I7HA 1OR7A 2A3SA 2AXLA 3SQNA 2IJLA 4AD9A 2GQQA 3L7WA 5F64A 1KQ0A 2OU2A 2Z99A 3V7SA 1Y0UA 3KZYA 2VONA 1FP1D 2WTEA 1F5TA 1MD0A 2YU3A 2L4AA 2ETHA 4L5IA 4O3MA 2GXBA 1WSUA 5AIQA 4GCVA 2PJPA 1OYYA 4XSXF 5CLSA 2HWVA 3WU0A 3V8KA 3RYPA 3N4MA 3HUGA 2AS5F 4FHTA 4PGGA 1FY7A 1TQIA 2H6CA 2QYOA 4BAYA 3WU1B 1XCBA 4Y15A 2NS0A 1G4DA 2ZNYA 3GF2A 5HS7A 2V1XA 3TO6A 2NAZA 5LGTA 1FNNA 2L02A 3F22A 3KP2A 3FZVA 1HW1A 4LG0B 1ZYRF 4MEYF 1USSA 1YQAA 2P5KA 5D5UB 3U9GA 4ENJA 1USTA 3LFKA 4HX8A 4KN7X 2K4BA 3DFGA 2YX7A 3B02A 3M1EA 4IRHA 4EVIA 2R7DA 1BBYA 4ENKA 3VOEA 1FYMA 1VTNC 1IN5A 2A07F 3TGNA 1CGPA 1X3UA 2DLLA 2A6EF 4EJWA 2YSRA 3K2ZA 2H94A 1B9NA 1KYWA 2DAOA 4Y13A 2M30A 4EQQA 2HDCA 1PP7U 5LGNA 2DPUA 1IXRC 1T0FA 2V9VA 2EFQA 2GWRA 1LB2A 1SMYF 2D1VA 5HDGA 4CO8A 1YIOA 2Y48A 4YFKF 2MBFA 2Q8KA 4YIIA 3V4GA 3WTUC 4YFXF 1O3SA 3K1MA 2JTVA 4EJVA
chains in the Genus database with same CATH superfamily
2OJED 1OISA 3A4CA 3LA3A 1QPMA 1V5GA 2CQXA 2DDAA 2K4JA 2QZ8A 1UG2A 2ESHA 1TL8A 4KMUX 1FBQA 4JX5A 4UHTA 3L00A 2O6GE 1Z91A 2NVTJ 2X6WA 2R5YB 4EM0B 5F6FA 4ZYEA 2VKHA 5E3NA 3ZPLA 2XAJA 4ZTJA 4UVAA 1XMXA 2DA1A 2F48A 3BJ6A 1RZ4A 2DODA 5FFZA 5LLQA 5F0FA 2V6EA 3V7CA 5K5QA 2IBDA 3NWTA 1B1BA 3RYRA 2F5EA 1D1AA 1YFHA 1TLHB 1BI0A 3ZN1A 2IEKA 4A3DJ 3GXOA 3HPGA 2WB1A 1R71A 1FC3A 1KGSA 3LAPA 1KYZA 2F5CA 4BBSJ 4HF2A 1W4MA 4BQAA 2LF8A 1SFEA 1X1CA 3DTKA 3TP3A 2BEOA 3E97A 3MMYB 3CCYA 3MD2A 1V4RA 3EUHA 5JHFA 1VQ4I 2LNBA 2LSOA 3OIOA 3A01B 1S6LA 3BR6A 1BC7C 2O5RA 2DOFA 4HF0A 4PJNA 3DKXA 1MSEC 1U8RA 1MMSA 1FT9A 3TMOA 3K0LA 1QA6A 2X4HA 3RZDJ 2XAQA 2DT7B 4Q5SF 2L7KA 4HQEA 1ZREA 3F8CA 3L1PA 2A68F 2WAQA 3EUKL 3PQKA 1W7PD 1BIAA 1BN5A 2E1MC 4J00A 2DOAA 1X2NA 1OCPA 5D6EA 4A5MA 1Y56A 3BCBA 4M6XA 4IHVA 5EGOB 1FYLA 1Z77A 2KL4A 3FWEA 2X0LA 2DT5A 4PGHA 3RKYA 4FX4A 1WGXA 2Q2EA 3D1NI 4A12A 3W2AA 1IJWC 3I0TA 3M4OJ 3S1NJ 2LR8A 4PZJA 1QO0D 3PNVA 4LG3A 3RDIA 5IPAA 1V5EA 4XRMA 4EM1A 2ZMEA 4RBOA 4PUSA 2KFDA 1Y1WJ 5E1ZB 3TKYA 1IXCA 3RI4A 3TDUC 3PSFA 4EJOA 1A31A 3M07A 4NQWA 5M5YJ 3T5XA 1QHGA 3CCSI 3CUOA 1MJBA 2PMUA 1S7OA 2XVCA 3W2VA 3DQVC 2DMPA 3HOUJ 2QUFA 1U2WA 3WU2C 3NAUA 4C2MJ 2RN7A 4XIDA 4DNCA 1HA8A 1SAUA 2XROA 3GTLJ 2MH9A 2MC3A 2NYXA 5IOYA 1XN7A 5CQGA 1ZGAA 4M72A 5M3FJ 2M4KA 5GAEJ 4DQ2A 3OYKA 1H0MA 5IY5H 1RC9A 3OMYA 3C2HA 2IVMA 4D1QA 2O8XA 2FEZA 1YO5C 1CF7A 3KIOA 2E1MB 2QF7A 4XORA 2YU9J 5BPIA 2G7UA 5C4JJ 3OWTA 1BL0A 1VNDA 3DTEA 1D5YA 4AUXA 2A6HF 2NVXJ 4XOTA 2EPFA 1TNSA 3F72A 3IP4B 1XSVA 3JRAA 3S1QJ 4S0HB 3FXUA 1IUYA 5D5XB 2B63J 3ZMVA 3C7JA 2JPCA 2ADUA 1UZCA 3DBRB 4BL0B 4CZCA 5DM7F 3TO7A 1IN7A 3CC7I 1SEUA 2E35A 1LJ9A 1SD5A 2EA4A 3BR5A 3R4KA 4P5OA 4UUSA 4A3FJ 4HEA2 4CYCA 1XSXA 2QQ9A 4DOZA 2Z33A 3J81Z 4WXCA 2XRNA 2FBIA 3A03A 3DP7A 4A0YA 1D8JA 2M3AA 4L18B 4BQNA 2K85A 3MN2A 3CESA 1WQ2A 2DA2A 1H89C 1TQMA 1N78A 2BZTA 2IXSA 4ZJZA 4HSTA 2DQRA 3U21A 3V42A 2PJRA 2D2WA 2ZNZA 2P6TA 4ZYHA 2DA5A 2M45A 3ROUA 3FXOA 3CDIA 5JVGF 3ZN0A 3RPUA 1V5FA 2EIKH 3LNQA 1H8AC 4IL6C 4BYYA 3RQ4A 1PDNC 4M6YA 2W24A 1LEAA 1TZLA 5GAHJ 4F93B 1O7FA 2QLZA 4DZPA 3G6EI 3TW7A 2MG4A 2WAQN 4PSXA 3V8JA 2IPQX 4I98B 1MBGA 4AU7A 1WFXA 3GWZA 5HLTA 2JQ7A 2NRAC 3DPTA 1LKXA 4XM3A 2XPVA 3SZPA 4E7SA 3S3NA 2KMUA 2OCCH 4UUTA 1MBJA 2EZKA 4BGDA 1TW2A 3ZRGA 4XL9A 1REPC 1PUFA 2HI3A 2OPTA 3OYFA 3O2PE 4G12A 2V9KA 2GAUA 5J8FA 1MNDA 2V26A 3TEDA 1R4MB 1G2HA 3H1CA 4DYCA 3O3KA 3NRVA 2UUZA 1YJ9I 3I54A 1VF9A 3K1PA 2KT0A 2DFFA 2W57A 1APLC 4DBQA 3KYDB 5EEAA 3VPRA 3CUQA 2LP0A 5J4YA 1R1VA 4A3JJ 2HGCA 2YPRA 4L9JA 1L0OC 1QZYA 3ZQGA 3ZXSA 4BXUA 5IP9J 2DPDA 4BY7J 1O3TA 1W7PB 2JSPA 4U7BA 1RR7A 3TO9A 5E79C 4M9XA 2LY2A 2WWYA 4RDUA 2PLYA 2QQ8A 2FXAA 2X1EA 3JTHA 2QSFX 1MMAA 1EH6A 5K7HA 4JOMA 4I0AA 1JTYA 2L5QA 3BZCA 1ONVA 1CQTA 2M5WA 2VJ4A 2Y0SN 1TBXA 2IGNA 3WG7H 1DPUA 3OL4A 4RAZA 1B4AA 4HRIA 1ULYA 3FIWA 2BY3A 1RUOA 1ETKA 1YX3A 3E5UA 4ANJA 3BDDA 2P0WA 3FDYA 4IEJA 2NVYJ 3HPHA 1LQ1A 3F9KA 2QQBA 4LITA 4XN0A 2FX0A 3GTPJ 2NOGA 1EF4A 4NC6A 1IGNA 2V9PA 5GADJ 1YS6A 2P81A 2V1DA 2XPUA 3P9IA 2LH9A 4Y7NJ 3LSKA 4W97A 5FD6A 2LMDA 2VBWA 5LGUA 2VT3A 5D5WB 1Z9CA 2WC2A 4E6KG 1OCCH 1YW7A 3GLXA 2YR2A 4EGZA 2HPIA 5J3LA 4MEXF 2EZIA 3OYEA 1N25A 4E7LA 3WGIA 2M87A 4MIMA 1KU3A 5K7FA 2GA2A 5B1BH 1UAAA 2MC4A 2BHZA 4RM3A 5L3DA 1DQUA 2E1OA 2BBYA 3BTLA 3MZYA 4I76A 1P6RA 3HOXJ 1I3AA 2ZB9A 5KHDA 4RLQA 4UNOA 3FXJA 2EIJH 5FLXK 4BEHA 3VB2A 2E2JJ 2BW3B 1FZPB 4BHCA 3EUHC 4KIBA 3I58A 3ZP5A 1GV5A 2NOJB 1DP7P 5ERIA 4IHYA 3IKVA 5HLGA 1JT6A 3DV8A 1VQNI 2EJRA 5J1RA 2DXIA 3F21A 3J7ZI 2LC2A 1MMGA 4HLXA 3G1MA 3ZCOA 4EV0A 1Z6TA 3CCJI 1K83J 5JI6A 1Q1HA 2WY7Q 3FKIJ 5D8LB 4CDGA 1LFUP 4HYEA 1D5VA 2LG4A 4IPAA 1FMWA 1NG7A 3OYAA 4HAMA 2RAEA 2ZXHA 2E7XA 2CQ7A 3H35A 5C3EJ 4RGXA 4UVBA 2LLKA 3PFYA 4CCJA 1WPKA 3PO3J 1UHMA 2XIGA 2QCOA 4PDKA 4AIKA 1HOMA 5DCMA 2QWWA 4XKWA 4G6QA 5HVQC 2QVOA 3JW4A 2EK5A 3M8FA 1U0JA 3BY6A 2ZMEC 1P9QC 5EF6A 3MKWB 4LK0F 3OS1A 1JXSA 1YHQI 4R8HA 1I27A 1MJAA 1XCVA 1YE9A 2BXZA 4A3IJ 2BOLA 4RM2A 4ON0A 4RGSA 1TWCJ 4PJMA 4A3EJ 2A61A 5L3CA 3I4MJ 3I59A 3H9JA 1W1WE 1HC8A 2F4MB 2KHMA 3DPLC 4NDLA 1EH7A 4ZYGA 3ZQLA 1SMTA 2VE8A 4KFCA 5FKLA 4F7ZA 5FJ8J 1B8IA 5EEHA 4CXFA 1V3FA 3QPHA 1YW9A 4W1UA 4YRVA 2TCTA 1G3YA 2HTSA 2XAFA 4B3XA 5FFXA 1AOYA 1DP3A 1A36A 1XGMA 3ERED 3VYRB 5FLXZ 1X2MA 3AAFA 5B1AH 4RA2A 3CO6C 1YS7A 4GYGA 2Q2EB 3FKJA 4B1RA 1LDKB 4O5VA 1WJBA 2X6OA 3OY9A 1BOBA 1BJAA 3E0JB 4XLCA 3HEFA 2HOEA 3K4BA 1LEBA 5CKTA 4DZJA 1ZELA 6PAXA 1FPQA 1J59A 4ZDLA 1GUUA 4L0YB 1YRNB 3PUBA 3JTGA 3ABMH 5ICGA 1V54H 4IXAA 2XGDA 2W7NA 4UB6C 5F0HA 5A2QZ 2L4MA 3GZ6A 3LSHA 3H3VK 2VKDA 1ZG3A 1GDTA 2FF4A 1ZRFA 2R7VA 4XBFA 5FRMA 4CGZA 2R7UA 3JAMK 4HNUA 4X6AJ 2XAGA 3ABTA 3HOYJ 3F8FA 2O61A 3KZIC 1IO2A 3GVAA 4L9TA 2DCEA 1PP8F 3GTGJ 1Y8RB 3MKLA 5J40A 2NS7A 1H9TA 1AU7A 3H5AA 1S9HA 3S1RJ 1R36A 4H0EA 1XSDA 1ZLKA 4K2EA 1P4WA 3CC2I 1MW7A 2HXIA 5LHIA 2PBIA 3O6BB 1J09A 4KIGA 1RPWA 1G8XA 1LNWA 3N05A 2FUG2 1G3SA 1P2FA 3OOUA 2HDDA 1BC8C 3LSJA 1DDNA 1Z67A 1VQMI 2R7SA 2CG4A 2M4GA 1GVDA 3E5XA 4NC8A 3S2HJ 4XNFA 1FTZA 1T95A 3EYIA 1Z7UA 3F8BA 3GBGA 3ZOBA 1R22A 1A6IA 3G2BA 1F1ZA 2AO9A 2KPMA 2RQPA 4XICA 4HV6A 4KNYA 4E7HA 3R60A 3L9FA 5H6QA 3UKGA 2LKPA 5KAFC 2B9SA 5E8GA 3FXKA 2VUMJ 2L9NA 2JUCA 3E3VA 1FTTA 3EYYA 1U9OA 3C2BA 3GFLA 5FD5A 1IV8A 2OQRA 3QYEA 4M3BA 5KK1A 2DT6A 4IF4A 3R6SA 5FROA 3PSIA 1OKRA 4U0WA 2Y75A 3KFWX 4P1WA 3F3XA 1D0YA 1WJ5A 4BU2A 3ABLH 4GRIA 1XMAA 3CCMI 4E7JA 3K4LA 4MO7A 2FA5A 2M8GX 1XDUA 4I2OA 2CW7A 2IS6A 5IYCJ 4C3JJ 3OYGA 1U78A 2K9SA 2STTA 2XGXA 3DPUA 1WWXA 3VYSB 4M3DA 4XLNF 1RR8C 4XRSG 3GX4X 2W4SA 1OFCX 5J4VA 2EV0A 2R7FA 3SFIA 3JAMZ 4KICA 2RVCA 5IT9K 1M1EB 5EG0B 3G73A 4A5NA 4BNCA 2ID6A 1LVAA 3BJOA 2RDPA 1JE8A 1QU3A 5FO5A 4HV5A 1X1DA 2JPBA 2CW8A 5FGMA 2M1BA 4WXDA 5ILSA 1PUFB 1QZEA 3BTCA 2E5ZA 1QZZA 2FE3A 4ZH4F 1FYKA 3ELKA 2P7VB 4FCYA 4PJJA 1WI3A 2XF5A 2LDUA 4OOIA 5ICEA 2KDOA 2H1LA 1TW3A 4II2A 3WTZA 5LHGA 1ZG1A 5GPAA 1MDMB 1O7LA 3J80K 1TWGJ 1WJFA 2CUZA 2W48A 2JVGA 1ZARA 1X3ZB 5J8CA 3GTMJ 2M34A 2XAUA 3S8PA 3TQNA 1ERDA 1WRJA 4CICA 1B59A 3DXJF 4FX0A 2ZJ2A 1K78B 1U9NA 3BG7A 5CVUA 3FMQA 1I6XA 1FX7A 2J5OA 4Y3OA 3Q5FA 1B72A 2R5ZB 4IQ4A 5KVRA 2CFXA 5K7ZA 2PQ8A 2OBPA 3BR0A 3HKZN 4U0VA 2VPLA 1S5LC 3NARA 2CQQA 1TWAJ 1WJDA 1MMNA 2EB7A 2DN0A 4XKBA 2ZJRF 4Y4RA 1D1BA 3KLOA 4PFOA 4IOCF 4C9YA 1LUJB 2DK8A 1XPXA 4A69C 4MFEA 1JTXA 4DYQA 1PUEE 5ILUA 3BG9A 2L7ZA 3OYMA 4Z2YA 4F92B 2OC6A 1FBSA 2XSDC 4IZZA 1XGOA 1JJ6C 4RAFA 2EWNA 4MTEA 3G4SI 3S32A 2F5FA 2HQAA 3HHHA 2E60A 5LEJA 3M8EA 4UXNA 2Y69H 2CSOA 2ZO4A 1IZ1A 1UB9A 2R0QC 3A2KA 2HKOA 4PCQA 3ERMA 3COAC 2GXAA 3RCOA 3DU6A 2DOEA 2CQNA 3LSMA 1ZQ3P 5JLXA 2R3SA 4MFDA 3OS2A 1FWZA 5ILVA 3LSPA 3QWLA 5E3OA 2IGOA 4A6DA 2NNYA 5FB2A 5CPRB 2EINH 1J5YA 3LFUA 1U5TC 3C18A 3HJEA 5LRSA 3WTTC 4RS8A 2VQLA 2XGCA 3BC8A 4LD5A 3DLAA 1XGNA 2DTRA 5EZGA 3I4NJ 2JA6J 4BBRJ 3J80Z 2RREA 4ENNA 1E2XA 2F4OB 4I02A 2CMPA 3HRUA 2KZGA 3VFZA 2VLAA 3A02A 2C6YA 3JRFA 3PIPF 2IP2A 3VSKA 2L7MP 3BJAA 3I9V2 5DYMA 4BJTA 3WTVC 1KZHA 1HQCA 4M3GA 2B0LA 5E20A 2CW0F 3P7NA 4G8XA 3MZHA 2LKSA 5L3FA 4IHSA 4OIQF 3MAJA 4EJUA 2IAIA 2KKOA 4FTHA 1VQPI 1W0UA 2R93J 3EDPA 4PFPA 2XASA 4ITVA 4BY1J 1YJNI 2LY9A 2JVHA 4IHXA 2P4WA 5E3LA 2BY1A 5JVTA 5K5OA 2R7OA 3L2VA 3I56I 2QBYB 1VQOI 1JT0A 1Z3YA 1RRJA 2LBFB 1QNTA 1JHHA 2CUJA 1JI8A 1XMKA 4V2GA 4XLPF 1U5TB 4E70A 4D7MA 2ID3A 4A93J 2L7FP 3BCAA 2VKEA 4OMZA 4UV8A 1R5ID 3T0YA 1MIJA 4Y17A 1AKHA 3HGGA 4KUMA 1WH5A 3OR2C 4D0PA 2H09A 3FBNB 3E1SA 5IT3A 1BM9A 5EZHA 1OR7C 3ABUA 2VQGA 1K4TA 3NWSA 2ECBA 3S93A 3BWGA 2Y31A 3KP5A 1UFMA 2DMTA 2LF7A 4MLOA 3LL7A 1TWFJ 3DKYA 2Y0SA 4M9ZA 4KT6A 1WCMJ 4KA4A 1R00A 4FE4A 1VQ5I 3W6KB 2R7QA 3HRSA 1I1GA 3WTSC 2CUFA 4HBLA 4WF2A 3W2WA 1UELB 2GLOA 2OD5A 2GZWA 2M0MA 2HVQA 1KA8A 2HYJA 2BE5F 4U0YA 1BW5A 2ELJA 3HSRA 2Z3YA 3IWZA 4WWCA 1G6NA 5AONA 3K4KA 2JA7J 3KZZA 1EV7A 5LFAA 2CWEA 1OYWA 3QYBA 4N9HA 5KCMA 2OAZA 4XLEA 4CZZA 4Q4ZF 5L3BA 2JA2A 3FM3A 5LD2C 5B5EC 5M3MJ 2VXZA 1WI9A 3IH3A 1DGRM 2X1DA 1LE8B 3HOSA 2L9SA 2QM3A 3KLNA 4UVCA 2L0KA 2UV1A 4MGRA 1P7JA 2HYGD 2P5VA 4PJ0C 4M74A 1UJ8A 1JKPC 2VB6A 1F43A 1NG6A 3WGHA 2IW5A 2OZ6A 3RJPA 4WX9A 5BMZA 3ESWB 2BV6A 2XDVA 1U8BA 4A2UA 1DU6A 3M8JA 4IJAA 5HOOA 4ZC3A 4FETA 5GTIC 4BE2A 1TT0A 2HDWA 2LY1A 4RGUA 4D5CA 4LG0A 1KU9A 2K7LA 2FOWA 2KRFA 2X48A 4BQOA 1SFOJ 1EH8A 3EPZA 4P55A 2D45A 1SD4A 3FXQA 3DLLF 3TOAA 3DEWA 3H9QA 1DUXC 5HDNA 2DFHA 4XQFA 5CVRA 5FKOA 3HUGB 1MH3A 2HVRA 2K9LA 2LVSA 2E1CA 2ZJPF 4G6DA 4AWXB 3DEUA 2WAEA 3LQQA 4RGRA 3LQRA 1R4NB 2I10A 4P9UA 1ON2A 3C3WA 1OCTC 4AC0A 1AWCA 2K3PA 3SDBA 3H3UA 4LB5A 1B6AA 1KU2A 3FHZA 3A1YA 1Z3XA 4GO1A 4UY8I 2ZC2A 3HM5A 4LFUA 2CUEA 4G7ZF 2ZSIB 4U88A 3Q9VA 3FF5A 4II3A 1HLVA 4TV7A 3BR1A 3H92A 2I8DA 1T0FC 3OYCA 4E7KA 2VJ5A 4LJZF 4B48A 2Z1DA 4KMFA 3TW6A 1IRZA 4RB2C 3M9AA 4NNJA 1WHUA 1P92A 2QEXI 2HZDA 4BKXA 3JREA 2QSGX 3UNGC 1XTAA 2O9LA 1ZKGA 2K9NA 1IRXA 2CS3A 1QPIA 4XRFA 3FXLA 3E6MA 2HYFA 2P5LC 4GDFA 3BZ6A 4GXOA 3ZMTA 1WKMA 3WTXC 4XKVA 5K1YA 2A6TA 3S17J 3OYBA 2UWMA 3EQLF 2KLOA 2IGMA 4BDYA 1EKEA 3BG6A 4A0ZA 3SHFA 4IKFA 1I3QJ 1ON1A 3JSOA 2UXNA 4G7OF 2K9MA 3S1MJ 3E7LA 5D8KB 1S8NA 3V7RA 2R5YA 2P8TA 1F4KA 1KONA 3QAHA 3LA7A 1I1SA 2XF6A 2CU7A 4AIJA 2G0EA 2AHQA 4M6VA 2JMWA 5F08A 3FMSA 3IWFA 1ORKA 2EBIA 5H6RA 2H8RA 4HW0A 5LRRA 4AIHA 2EV6A 4C2TA 3HGYA 2WV0A 4HQMA 2VI6A 4V2FA 1T2KA 2TDXA 3GEZA 4L9NA 5FKKA 2I5UA 1J9IA 1MMDA 1FEXA 3IRRA 1YYVA 1FOXA 5DD8A 1H9GA 4G7HF 1BI2A 1XG1A 3KEOA 2WY8Q 1PVEA 1BI3A 4CYDA 2V1UA 1J7KA 2OQGA 2XC7A 2VE9A 3KP4A 2FRHA 2L3DA 4XOPA 3PM1A 4KITB 1UHSA 3G3ZA 1G59A 3A01A 3HSFA 4HZFA 2PX9A 4EGYA 3PO2J 3RPUD 3J7AY 1ZTRA 1QRYA 4AYBN 4ESFA 1JKOC 3I3LA 1I39A 3CMAI 4NHJA 2OA4A 2E71A 2ACJA 3ONQA 2M7AA 5GAGJ 4XLFA 2ZJQF 2ZCWA 3ZQ7A 1K7AA 1S7EA 2VODA 2IS2A 2LRDA 3TDZC 1RNLA 2M8EA 1J2XA 2KJCA 1Q1VA 2XV4S 2LKXA 1IRFA 1X19A 1F36A 3HXLA 5EGOA 4U87A 1FMVA 4BE0A 4ZTFA 1MNEA 1ACIA 2FBKA 3CJRB 3F23A 3CCEI 2DU9A 2STWA 2V79A 4BJ6C 3WGGA 5J1YA 1UHWA 2AQEA 1ZN2A 3GTJJ 1I5ZA 3CJNA 2HEOA 4F3QA 1FIAA 2ZBKA 4XONA 5CQEA 5DEQA 1E17A 1VI0A 1YIJI 2F5VA 3EUAA 4C3HJ 2XF7A 1K6YA 1ODDA 3BQZA 3K4CA 1OCOH 4O6JA 3S14J 2YUSA 1IV6A 3KEQA 2MW8A 3KP3A 2KJBA 3RPQA 2IA2A 4FASD 4DBRA 1DPRA 3GZ5A 3K4JA 1HBXG 2E5NA 4NBQA 2HPMA 3PUFA 4MQVA 1YI2I 3KETA 3BQYA 2R4GA 4OAZA 1T08B 3QQAA 3HOZJ 2KIMA 1Y39A 4GYIA 3FK7A 1O3RA 2XB0X 3QRFF 4A0XA 2EH3A 1W5TA 2LTPA 3Q9SA 4BXXJ 3S3MA 3E6CC 3AG2H 3ZMDA 1W36C 3GTOJ 3CLOA 2L9RA 1TNTA 1J0RA 4JQFA 1YTYA 1A04A 2DDBA 2ZMEB 4B43A 1HXDA 3U1DA 1LPQA 4QPQA 4ESJA 2LFBA 4YELA 3ZQFA 4NQWB 2ME0A 4S05A 2HKXA 3BTJA 5E1XA 2DMUA 1FLIA 2JUGA 1WJCA 2OCEA 4XLAA 1A35A 4JX6A 2R7TA 4ZYDA 5ICCA 2H6BA 1R7JA 1SANA 2CO5A 4RLFA 2JA8J 1QHHD 1YJWI 3JRIA 3RZOJ 3LSIA 5K5RA 4HF1A 1QBJA 1S72I 4WXHA 3F6VA 1V55H 3HKZA 4YIFA 3FXRA 2AXTC 2DW4A 1TQPA 5D4RA 1CF7B 4IQJA 2EQRA 4JBAA 4BH9A 5LHHA 3K70D 3QPLA 3RKQA 3SZGA 1E3PA 1GVJA 3OYNA 1SFXA 3SDGA 4IHTA 1UMQA 2PMHA 3B73A 2FMLA 4I01A 2XKOA 3AG1H 5DUKA 3J7YJ 5FLMJ 3DBLB 4B44A 4YEJA 4ESBA 2CV2A 1Z7LA 5L3GA 3SJMA 4N4NB 3CJQB 2UXXA 3CF5F 3HB9A 5CJ9A 3AKZA 2VIXA 1BJZA 2MYSA 3HTUA 3B6CA 3S2WA 4UUSB 3GFJA 4MNUA 2E7WA 2RV8A 4CYCB 5GTHC 2Z5UA 3HSEA 3AG3H 5BNGA 2E34A 4ETSA 3ASOH 4IX7A 1ZRDA 3DKWA 3QP6A 4UUVA 2ZXJA 2OTJI 5CVIA 4HX7A 1IC8A 4UB8C 4BHBA 2BY0A 2FU4A 2CV1A 3HOTA 2VT2A 1STZA 4EATA 5F1JA 1IAWA 3P9KA 2BHYA 1R9TJ 1MGTA 3OOPA 2V1NA 4KDPA 3JCUC 5CVVA 4YG2F 3CUQC 2IA0A 2PJRB 1JUMA 1RESA 1R6RA 3P9CA 1MBKA 1S3JA 3W6VA 4Q48A 3SZTA 4RB0A 3HOWJ 4N9IA 2CYYA 2FOKA 3IC7A 3LSTA 2MFZA 2XUBA 2JSCA 4BUPA 3GFMA 2P7CB 3GTKJ 3HIFA 1Y6IA 3N97A 3BR3A 1SVOA 4D7NA 1SD6A 1OJLA 3HYIA 3IAS2 2DA6A 1W7PA 5LEKA 1H88C 3K69A 3I5UA 1QVTA 1SFKA 1K61A 3Q0UA 3M3YJ 2DK5A 2O3FA 4HX4A 2KRHA 2JJ7A 1IN4A 5J6XA 1SD7A 1MH4A 3IHUA 3QODA 2LD5A 5EYRA 3BR2A 1HW5A 4FE7A 3L2WA 3WE2A 2XKPA 5FKNA 2VN2A 2VPRA 3JRCA 5JLWA 3S16J 2MSYA 5C44J 2MLGA 3WE3A 3WHCA 2EZHA 4DIQA 3T8TA 4HLYA 1UG0A 2XSJC 3VWBA 4M73A 3QPTA 4BHPA 3CD6I 1EA3A 2BGCA 4ENMA 4KYWA 1D8KA 3CUQB 1Y1VJ 1T33A 1SFUA 5C4XJ 1R5HA 2V4JC 1WJEA 3H9GA 2BVLA 3O8HA 2OZUA 2ZKZA 3JRBA 4XMYA 2MGQA 3I64A 1O3QA 3K70C 1HKQA 1K79A 2L54A 2DA7A 2AQFA 3MKZA 2Q0OA 3ECHA 4LLGF 1D1CA 2VQCA 1IUFA 4F91B 5KNLA 5CYVA 2FSWA 1BOAA 4MTDA 1YX5A 2HOAA 3K4NA 2ZXIA 2FMYA 3ECOA 3ZR8X 3RIRA 3FXMA 4F52A 1HKSA 3ZMUA 4BACA 1K4SA 4M71A 5EEGA 1QGPA 4QTRA 3OIPA 2O0YA 4ASNA 5J47A 4LB6B 1R1UA 4CCMA 1FSEA 1GXQA 2R7ZJ 3WHBA 3SEZA 3QPSA 1LDJA 2EILH 2BW3A 2W85A 3QOPA 4X0GA 2KZVA 5DUIA 1IF1A 2ECCA 3CJTB 4HDVA 4IRIA 3BPXA 2GIVA 4ZDPA 3IV5A 2IRFG 5BS6A 3BP8A 1LDDA 5IYDJ 3D5SC 1YOVB 5IT9Z 4L5JA 4OIRF 2HQ5A 1ITYA 2QSHX 1MJ9A 2VBZA 5HS8A 4LOCA 3CCVI 4Y52J 1FOWA 2ELHA 2RGVA 1B9MA 2DMNA 4XSZF 3J7AO 2VJIA 2R7WA 2UZKA 4B8XA 1MZBA 2LYCA 3QOEA 1ETYA 2O7OA 2JZYA 3KPHA 2FNAA 3GZNB 5F1RA 1JKRC 5ED4A 1FIPA 2EFWA 3TL4X 2M2EA 4LMYA 2K86A 5GPCA 2JK3A 4A6EA 2DO7A 3FBIB 3U2RA 2WBMA 1WZ2A 2X6YA 2KIFA 4C30A 3V8LA 4PSWA 1P7IA 1IN6A 1QQIA 2HS5A 2F2EA 2F5DA 3F8NA 2PMZN 5E8IA 4BDZA 1BR4A 5M5WJ 2E2IJ 1VQKI 5J1UA 1I6HJ 1BW6A 3DWLE 2ZFUA 3CTAA 4BEHB 3VEPA 3LA2A 5JHUA 3HZJA 3K9TA 1FJLA 4A3GJ 5TGTA 2XHKA 3O8GA 2VC0A 1MKMA 5ICFA 5DM6F 1SAXA 2WA0A 2XRLA 3WTYC 3H5RA 3GW2A 3R61A 2CJJA 1NH3A 2K40A 3DF8A 3F8MA 5E1WA 5D5VB 1W5CC 1X4OA 3HG9A 4LK1F 4HG2A 5F0CA 1TWHJ 4GGGA 3AL0C 3DEEA 4Y33A 4DW6A 3OYHA 5CVJA 1TTYA 3Q0WA 4CCNA 1NK2P 1ETXA 3KCCA 5IOZA 2K5CA 1E3OC 4A3LJ 1KQ9A 2VJJA 3BPVA 1FP2A 3T8RA 4BE1A 2VL8A 5TISC 5JR3A 1ZK8A 2TRTA 4EM2A 2K9QA 3J81K 1RKTA 1RI7A 2JN6A 3QP5A 2KISA 5JFRA 4ABZA 2DBBA 1XS9A 2NNNA 5DCMB 1OQYA 2FJ1A 1FOKA 3E5QA 2F4IA 3LSGA 3X2QH 2IGKA 2X6XA 1VQ6I 3SFZA 2HQNA 2ZFWA 1G3WA 1OPCA 1R23A 1WH7A 3DU5A 4I09A 3OYIA 1YRNA 1VQ7I 3L2CA 1XGSA 3HBLA 3IL2A 2KIQA 3NEUA 1UCRA 1Y8QB 4U7DA 2F6CA 1KU7A 3I59B 1BI1A 3HOVJ 3QU6A 2E2HJ 3LOCA 4L5EA 1IXSB 3BG3A 3RKXA 1YLFA 2EZLA 3PQJA 3E6BA 4E4HA 2KP6A 2YS9A 1B8IB 2ESNA 2EV5A 2PG4A 5HLIA 3PJRA 3AL0B 1YITI 2BYVE 4QPOA 3BTIA 4XKCA 2H1KA 2NS8A 4Q47A 2K27A 1LFPA 2JWTA 4OU0A 1JKQC 2FNPA 4IOAF 2E36A 3K7AJ 2X9DA 3OV8A 2RKHA 2M9HA 4IHWA 3IRQA 1K6OA 3D5RC 1BR1A 2WAFA 4E7ZA 1RIOH 2A5YB 1OCZH 3KX2A 4B09A 5DDGA 4HOBA 1HKTA 2ZSHB 2WV1A 2QKLB 2P6SA 5FKMA 3R0AA 5IYBJ 2VBYA 1JJ8C 4LLLA 3S3OA 4OWRB 1S7AA 2E1NA 1HSJA 2VBXA 3E6DA 2VQHA 3H36A 2EFOA 1VZ0A 3MVPA 3CZ6A 5DD4A 1R5GA 1XC5A 1HSTA 3LAJA 1I50J 2OV7A 2VC1A 2B7EA 2Y0MA 1TP4A 4UV9A 1ZRCA 4V19K 1D3YA 2GA1A 3MFKA 2Y2ZA 1S29A 3C1DA 3IH2A 2HU9A 3KYLA 2WB1N 2L2OA 3RKWA 2WADA 4CCLA 1JHFA 3KYCB 4JP0A 3U1KA 4D5FA 1GXPA 1T98A 3M7GA 5DTDA 5BPDA 4P9FA 3OSGA 2O03A 3BOQA 2CGPA 3F0CA 2V6CA 2XAHA 2BY2A 4P96A 2VOPA 3GO5A 2DA3A 2W84A 4L9VA 4M3FA 3FK6A 1OMIA 2A05A 5E3MA 5H2FC 4ZZLA 3IKTA 4LIUA 3ABKH 1GLNA 4RAYA 5E17F 4J19A 2OTLI 1SC7A 1O57A 2GXGA 2EA2A 3CF2A 3CP2A 5AIPA 1ENHA 3VODA 4HNTA 3GMEA 2DMQA 4HSRA 4AYBA 4RAGA 2CRGA 1R58A 3ZQCA 4OMYA 3BZKA 3K1NA 5EG0A 1JGGA 2ZXWH 2W1OA 4J01A 2NXNB 3MZ8A 1F9NA 3MQ0A 2VASA 1WVRA 3MEXA 4N0BA 1IDYA 2Z16A 4XRSA 1HDPA 5H20A 1JUSA 2PEXA 1ZH5A 1U3EM 2QQAA 1ZLJA 3QU3A 3MWMA 3FM5A 1Z6RA 2DA4A 2ME6A 4A3KJ 1A6QA 2G7HA 2XB5A 1XD7A 2FD5A 3HRMA 1ETQA 1IW7F 4G94A 1MDMA 5F04A 1ZHFA 4XN3A 4OIOF 1HCRA 3PNTA 3HTSB 3ZQIA 3I53A 1Z21A 2MABA 1FOYA 3C2GA 4ZZDA 2HTJA 4DGWB 4G9YA 1TC3C 4WK8F 3SXYA 3PFIA 1K78A 4M9SA 3T1BA 2N8GA 1JGSA 4IVNA 3GCMA 3ASNH 3OYLA 4EMSA 2R5ZA 3HHGA 1YW8A 1VQ9I 3HRTA 2L9VA 3BLYA 2G9WA 3ZMSA 2GM4A 4CHUA 2W25A 3DTIA 4MHGA 4S04A 4KISA 4XK4A 4RB1A 2YX4A 3PL8A 2LOOA 2Z2SB 1GHCA 1J75A 2MA3A 4A3BJ 2JRTA 5HDKA 4QIWN 3S15J 2IT0A 3CC4I 4X1EA 3ZMZA 2MH2A 3H5NA 4R79A 4R1HA 1G3TA 2HR3A 1X58A 2FBHA 3DBHB 3CCRI 2Z9OA 4OINF 4AVPA 4EJTA 3F6OA 3I4PA 3CMEI 1MNMC 4KIFA 2NVUB 1WJAA 2CQKA 2MD5A 1D0XA 1W36D 1P4XA 2V7FA 3PNYA 2KIUA 1R49A 4M3EA 2XGEA 1W5SA 1C0WA 2W00A 2VOOA 3LMMA 3VSLA 4GFBA 3G1LA 2DQLA 4PJLA 3ML6A 3H0DA 2H27A 3QYFA 1B72B 2KDZA 4AVZA 1ZAOA 5TJJA 2X85A 1AA7A 1T39A 2IA1A 1Z05A 3JSPA 1MBHA 5BQTA 3MKYB 4DYRA 4KN4X 1OCRH 2FQ3A 2QGUA 1POGA 2K02A 2RNJA 1ZGJA 4BQQA 3KE2A 4ZDOA 2MLKA 1NHAA 2HQRA 1XDSA 2J5PA 1T38A 1Z1DA 4NB5A 4IRGA 3UR3C 5BOXA 3H3ZA 3NQOA 1T56A 2Y30A 2Q1ZB 2ISYA 2L01A 3WG9A 4RB3C 5DV5A 3D0SA 3TOBA 1R1TA 2ISZA 4NUBA 3W6JB 4I6ZA 1ZR2A 1FBUA 5DCFA 3PIOF 5HS9A 5LBQA 3I55I 1RKWA 2R92J 4HDUA 1ZGWA 1RUNA 2DYSH 3TP0A 3A0BC 1TT5B 4HA8A 4G6TB 3TBIA 2HOSA 3K2AA 1X1PA 5D4SA 4DJAA 5E18F 3KP6A 3KP7A 2HFHA 3ZQHA 5DS9A 2DFEA 3IH4A 3CP8A 5A2QK 3OS0A 3FMRA 4F55A 4Z6YA 4KT5C 2OUMA 4IO9F 1IN8A 3BROA 4NC7A 2FQ4A 3K4MA 2QBYA 1N75A 2PFBA 1E0EA 2LBFA 1U6GA 2A69F 3JR9A 2EIMH 3HL2A 1T6SA 2CV0A 1U5TA 2KQRA 4MQ9F 1YG2A 4LGWA 1A5JA 3P5JA 5TRDA 3OYDA 3K6GA 4I0BA 3WTWC 4BS9A 2D1HA 3FHNA 3FX3A 4LLNA 2HOTA 4JX4A 3ULQB 4HNVA 3HDDA 3REOA 3GUDA 1O4XA 3L09A 1LFBA 1P4AA 2GBYA 1SVLA 3SEQA 1PYVA 2RC4A 2RNGA 4L0ZB 3M1CA 2DTZA 2JT1A 1IG7A 1BIBA 1X3WB 4YFNF 1HF0A 4FT8A 5B66C 2HZTA 4JK1X 3CCUI 5HLHA 2HXOA 3CO7C 4OIPF 3EETA 2QENA 3K10A 3KEYA 3Q3SA 3HC7A 3R0JA 2HVSA 4QWQA 3RTRA 3L2UA 2EFNA 2DI3A 5D6FA 3CDHA 3BT9A 2ELKA 2GOMA 4OAYA 1KQ8A 1L3LA 3I71A 4WCGA 5HODA 3G1OA 3OL3A 5L3EA 2DFIA 2E19A 4QLCU 3WODF 2CH0A 5IP6A 1OLTA 2DYRH 2PN6A 3OR1C 2EFPA 1AKHB 3VYTB 2DJIA 2PI0A 1DU0A 2COBA 2Y9YA 4CCKA 1E3HA 1PJRA 3AG4H 3VDXA 3GLLA 1XB4A 1ZG5A 4CA0A 4KJZA 1X4PA 1LE8A 1FSHA 1W0TA 3D5LA 4CH7A 1HW2A 3ISPA 4A3CJ 3GFIA 1IRGA 3Q0VA 2IS4A 5FRNA 3GYHX 2QA4I 3LWFA 3MCZA 1OYIA 4I7HA 1OR7A 1QVUA 2GIZA 2MD0A 5KAIC 2A3SA 2AXLA 1DGWY 3SQNA 2IJLA 4AD9A 2GQQA 3BG5A 3L7WA 5F64A 1KQ0A 4B47A 2OU2A 2Z99A 1HDDC 4C2UA 3V7SA 1Y0UA 3RQIA 3KZYA 3JRDA 1MSFC 2VONA 1FP1D 4HPQA 2WTEA 1F5TA 2R7XA 4E7IA 1MD0A 2K3FA 2YU3A 1N77A 2L4AA 2ETHA 4L5IA 4O3MA 2GXBA 2VXDA 3LSRA 3ZQQA 4JYKA 3IAM2 4BXFA 1WSUA 5AIQA 1GT0C 4GCVA 2PJPA 1OYYA 4XSXF 5CLSA 2HWVA 3WU0A 3V8KA 3RYPA 3N4MA 3HUGA 1IDZA 2KRCA 2X1CA 4CUGA 2AS5F 4PK4A 4FHTA 4PGGA 1VFCA 1NTCA 1FY7A 2GOXB 5M5XJ 1TQIA 2BVMA 1ETVA 2H6CA 2M0CA 2QYOA 3W3CA 3SYTA 4BAYA 1X1AA 1XCBA 3WU1B 4Y15A 3FISA 2NS0A 1G4DA 2ZNYA 4FQGA 1EJ9A 3GF2A 3CCQI 2X51A 4LIVA 5HS7A 2V1XA 4H4KC 3TO6A 4B3AA 3OYJA 1JUPA 2PMZA 3CQZJ 5HNFA 2NAZA 5LGTA 1FNNA 2L02A 2LK2A 5F27A 3F22A 3GTQJ 3CMMA 3KP2A 3FZVA 1HW1A 4LG0B 3DCFA 1MBFA 1MBEA 1ZYRF 4C3IJ 4MEYF 4RMNA 1GV2A 2RQQA 5HNHA 1USSA 1ETOA 2BXYA 3IUOA 1NK3P 1YQAA 2P5KA 5D5UB 4ZYAA 3U9GA 4ENJA 1USTA 2HNHA 3LFKA 4HX8A 4KN7X 2K4BA 1X1BA 3DFGA 2YX7A 3B02A 3M1EA 4B4CA 1ETWA 4IRHA 4EVIA 2CFOA 2R7DA 2VKVA 4AIDA 3AFHA 1BBYA 1LVKA 4I99C 2Y9ZA 3S2DJ 5FLVA 4CCOA 4ENKA 5EJCA 3VOEA 4QSHA 4EJVA 1FYMA 2QKMB 2IS1A 4N4OB 2M7BA 1SVMA 4CSWA 3L2QA 3JRGA 3A0HC 2R7RA 2W82A 2LREA 2NVQJ 1VTNC 2JA5J 1IN5A 3ZGKA 2A07F 9ANTA 5GP9A 3TGNA 4YIRX 1CGPA 1X3UA 2DLLA 2A6EF 2OF7A 1RETA 4EJWA 2YSRA 3L2RA 3K2ZA 2H94A 1B9NA 1KYWA 3CLQA 5B3SH 1VQ8I 1VQLI 2DJNA 2A5WA 2DAOA 3RSNA 4Y13A 3CCLI 2M30A 4BJ5C 4XLHA 4EQQA 1Z0XA 1PP7U 2HDCA 2O8KA 5LGNA 3G71I 2XPWA 2DPUA 3VYUB 4D9JA 3OSFA 1IXRC 3OIQA 1D0ZA 1T0FA 4A3MJ 4XR6A 1T8IA 2V9VA 4AM3A 1XX5A 2D5VA 2EFQA 1BA5A 2GWRA 3B6AA 1LB2A 1SMYF 1BR2A 2D1VA 5HDGA 1YIOA 4CO8A 2Y48A 2ICWG 4YFKF 2MBFA 2Q8KA 2H8WA 4YIIA 3V4GA 3WTUC 3JRHA 3CDLA 5EDNA 4YFXF 4EEFG 1O3SA 5IP7J 1Y0NA 3K1MA 3CMYA 4FISA 2JRMA 3H0GJ 2JTVA 1AHDP 1ZR4A 2COMA
chains in the Genus database with same CATH topology
3LA3A 1QPMA 2QZ8A 2K4JA 2ESHA 4KMUX 1FBQA 4UHTA 2O6GE 3L00A 1Z91A 4EM0B 5F6FA 4ZYEA 3ZPLA 2XAJA 4UVAA 3BJ6A 1RZ4A 5LLQA 5FFZA 3V7CA 5K5QA 1B1BA 3RYRA 2F5EA 1YFHA 1TLHB 1BI0A 3ZN1A 3GXOA 1FC3A 1KGSA 3LAPA 1KYZA 2F5CA 4HF2A 1W4MA 4BQAA 2LF8A 1SFEA 2BEOA 3E97A 1V4RA 3EUHA 2LNBA 2LSOA 1S6LA 1BC7C 4HF0A 1U8RA 1FT9A 3K0LA 2X4HA 2XAQA 4Q5SF 4HQEA 1ZREA 3F8CA 2A68F 3PQKA 1W7PD 1BIAA 1BN5A 5D6EA 4A5MA 4M6XA 1FYLA 3FWEA 2X0LA 2DT5A 4PGHA 3RKYA 4FX4A 2Q2EA 4A12A 3I0TA 4PZJA 1QO0D 3RDIA 4EM1A 2ZMEA 5E1ZB 3TKYA 1IXCA 3RI4A 3TDUC 4EJOA 4NQWA 3T5XA 3CUOA 1MJBA 2PMUA 1S7OA 2XVCA 3DQVC 2QUFA 1U2WA 2RN7A 4DNCA 2XROA 2MH9A 2MC3A 2NYXA 1XN7A 1ZGAA 4M72A 4DQ2A 1H0MA 2IVMA 1CF7A 2O8XA 2FEZA 1YO5C 5BPIA 2G7UA 2A6HF 1TNSA 3F72A 1XSVA 3FXUA 1IUYA 5D5XB 3ZMVA 3C7JA 2JPCA 2ADUA 3TO7A 1IN7A 2EA4A 1LJ9A 1SD5A 3R4KA 4P5OA 1XSXA 2QQ9A 2Z33A 3J81Z 4WXCA 2XRNA 2FBIA 3DP7A 4A0YA 1D8JA 4L18B 1WQ2A 1TQMA 2DQRA 2D2WA 2ZNZA 2P6TA 4ZYHA 2M45A 3ROUA 3ZN0A 3RPUA 4BYYA 1PDNC 4M6YA 2W24A 1LEAA 1O7FA 2QLZA 3V8JA 2IPQX 4I98B 3GWZA 2NRAC 3DPTA 3SZPA 1TW2A 1REPC 3O2PE 2GAUA 5J8FA 3O3KA 3NRVA 3I54A 3K1PA 2W57A 3CUQA 1R1VA 2HGCA 2YPRA 4L9JA 1L0OC 1QZYA 4BXUA 2DPDA 1O3TA 1W7PB 4U7BA 3TO9A 4M9XA 2WWYA 2PLYA 2FXAA 3JTHA 1EH6A 4I0AA 1ONVA 2M5WA 1TBXA 1DPUA 4RAZA 1B4AA 1ULYA 1RUOA 3E5UA 3BDDA 1LQ1A 2QQBA 1YS6A 2V1DA 3P9IA 5FD6A 2VBWA 5LGUA 2VT3A 5D5WB 1Z9CA 2WC2A 3GLXA 1YW7A 2YR2A 4EGZA 4MEXF 3WGIA 2M87A 1KU3A 2GA2A 5L3DA 2BBYA 3MZYA 1P6RA 4UNOA 5FLXK 3VB2A 1FZPB 4BHCA 4KIBA 3I58A 3ZP5A 1DP7P 5ERIA 3IKVA 5HLGA 3DV8A 2EJRA 3F21A 4HLXA 4EV0A 1Z6TA 5JI6A 4CDGA 1Q1HA 5D8LB 1D5VA 4HYEA 4IPAA 4HAMA 2E7XA 4RGXA 4UVBA 1UHMA 2XIGA 4PDKA 4AIKA 5DCMA 2QWWA 5HVQC 4G6QA 2QVOA 3JW4A 2EK5A 3M8FA 3BY6A 4LK0F 1JXSA 4R8HA 1I27A 1MJAA 1XCVA 4ON0A 4RGSA 2A61A 5L3CA 3I59A 3DPLC 1EH7A 4ZYGA 1SMTA 2VE8A 4KFCA 4F7ZA 5EEHA 4CXFA 1V3FA 3QPHA 1YW9A 1G3YA 2HTSA 2XAFA 5FFXA 1AOYA 1XGMA 3ERED 5FLXZ 3AAFA 3CO6C 1YS7A 4GYGA 1LDKB 4O5VA 1BJAA 2HOEA 1LEBA 6PAXA 1FPQA 1J59A 4L0YB 3JTGA 5ICGA 4IXAA 5A2QZ 2L4MA 3GZ6A 1ZG3A 2FF4A 1ZRFA 4XBFA 4CGZA 3JAMK 2XAGA 3ABTA 3F8FA 2O61A 4L9TA 3GVAA 1PP8F 1H9TA 1R36A 4H0EA 1XSDA 1ZLKA 4K2EA 1P4WA 5LHIA 2PBIA 3O6BB 4KIGA 1LNWA 1G3SA 1P2FA 1BC8C 1DDNA 2CG4A 3E5XA 3EYIA 1Z7UA 3F8BA 1R22A 1F1ZA 2RQPA 4HV6A 4KNYA 3R60A 3L9FA 5H6QA 2LKPA 5E8GA 3E3VA 3EYYA 5FD5A 3GFLA 2OQRA 5KK1A 3R6SA 4IF4A 1OKRA 4U0WA 2Y75A 3KFWX 3F3XA 1XMAA 2FA5A 1XDUA 4I2OA 1U78A 2STTA 2XGXA 1WWXA 4XLNF 3GX4X 2EV0A 2R7FA 3JAMZ 4KICA 2RVCA 5IT9K 3G73A 4A5NA 4BNCA 1LVAA 3BJOA 2RDPA 1JE8A 5FO5A 4HV5A 2JPBA 5FGMA 2M1BA 4WXDA 5ILSA 2FE3A 1QZZA 4ZH4F 1FYKA 3ELKA 2P7VB 2LDUA 4OOIA 5ICEA 1TW3A 3WTZA 5LHGA 1ZG1A 1MDMB 1O7LA 3J80K 1ZARA 5J8CA 3TQNA 1WRJA 4CICA 1B59A 3DXJF 4FX0A 2ZJ2A 1K78B 5CVUA 3FMQA 1I6XA 1FX7A 2J5OA 3Q5FA 5KVRA 2CFXA 2PQ8A 2OBPA 4U0VA 2EB7A 3KLOA 2DK8A 1PUEE 5ILUA 4Z2YA 1FBSA 1XGOA 2EWNA 4MTEA 2F5FA 3HHHA 5LEJA 3M8EA 4UXNA 2CSOA 2ZO4A 1IZ1A 1UB9A 2HKOA 4PCQA 3COAC 2R3SA 1FWZA 5ILVA 4A6DA 2NNYA 5FB2A 1J5YA 1U5TC 3C18A 5LRSA 3WTTC 4RS8A 4LD5A 1XGNA 2DTRA 3J80Z 4ENNA 1E2XA 4I02A 3HRUA 3VFZA 2C6YA 2IP2A 3BJAA 5DYMA 3WTVC 1HQCA 2B0LA 5E20A 2CW0F 3P7NA 4G8XA 3MZHA 4IHSA 5L3FA 4OIQF 3MAJA 4EJUA 2KKOA 3EDPA 2XASA 2P4WA 5JVTA 5K5OA 2QBYB 1QNTA 1JHHA 1XMKA 4XLPF 1U5TB 4E70A 4OMZA 4UV8A 3T0YA 4Y17A 4KUMA 4D0PA 2H09A 5IT3A 1BM9A 3ABUA 3BWGA 3KP5A 1UFMA 2LF7A 4M9ZA 4KA4A 1R00A 3W6KB 3HRSA 1I1GA 3WTSC 4HBLA 4WF2A 2OD5A 2GZWA 1KA8A 4U0YA 2BE5F 3HSRA 2Z3YA 3IWZA 4WWCA 1G6NA 5AONA 3KZZA 1EV7A 2CWEA 1OYWA 4N9HA 2OAZA 4CZZA 4Q4ZF 5L3BA 3FM3A 2VXZA 1WI9A 3HOSA 2QM3A 3KLNA 4UVCA 4MGRA 2HYGD 2P5VA 4M74A 3WGHA 2IW5A 2OZ6A 3RJPA 4WX9A 5BMZA 2BV6A 4A2UA 4IJAA 5HOOA 4RGUA 4LG0A 1KU9A 2K7LA 2KRFA 1EH8A 4P55A 2D45A 1SD4A 3FXQA 3TOAA 1DUXC 5HDNA 5CVRA 2E1CA 4G6DA 4AWXB 3DEUA 3LQQA 4RGRA 3LQRA 4P9UA 1ON2A 3C3WA 1AWCA 3H3UA 4LB5A 1B6AA 1KU2A 3FHZA 4GO1A 4LFUA 4G7ZF 4U88A 3Q9VA 3FF5A 4TV7A 3H92A 4LJZF 4KMFA 4RB2C 3M9AA 1P92A 4XRFA 3E6MA 2HYFA 2P5LC 3BZ6A 4GXOA 3ZMTA 1WKMA 3WTXC 5K1YA 2UWMA 3EQLF 4A0ZA 3SHFA 1ON1A 4G7OF 3JSOA 2UXNA 5D8KB 1S8NA 3V7RA 2P8TA 1F4KA 3QAHA 3LA7A 1I1SA 4AIJA 3FMSA 3IWFA 5H6RA 4HW0A 4AIHA 5LRRA 2EV6A 2WV0A 4HQMA 1T2KA 2TDXA 3GEZA 4L9NA 1J9IA 3IRRA 1YYVA 5DD8A 1H9GA 4G7HF 1BI2A 3KEOA 1BI3A 4CYDA 2V1UA 1J7KA 2OQGA 2VE9A 3KP4A 2FRHA 2L3DA 3G3ZA 3HSFA 4HZFA 4EGYA 4ESFA 4NHJA 2OA4A 2ACJA 2ZCWA 3ZQ7A 1K7AA 2VODA 3TDZC 1RNLA 2M8EA 1J2XA 2KJCA 2XV4S 1IRFA 2FBKA 3F23A 2DU9A 2STWA 2V79A 3WGGA 1UHWA 1ZN2A 1I5ZA 3CJNA 2HEOA 2ZBKA 1E17A 5DEQA 1ODDA 4O6JA 3KEQA 3KP3A 2KJBA 3RPQA 2IA2A 1DPRA 3GZ5A 1HBXG 4MQVA 3KETA 2KIMA 4GYIA 1O3RA 3QRFF 4A0XA 1W5TA 3Q9SA 3E6CC 3ZMDA 3CLOA 1TNTA 1J0RA 4JQFA 1YTYA 1A04A 2ZMEB 1HXDA 3U1DA 4ESJA 4S05A 2HKXA 5E1XA 1FLIA 4ZYDA 5ICCA 2H6BA 1R7JA 2CO5A 5K5RA 4HF1A 1QBJA 4WXHA 3F6VA 4YIFA 3FXRA 2DW4A 5D4RA 1TQPA 1CF7B 4JBAA 4BH9A 5LHHA 1GVJA 1SFXA 4IHTA 2PMHA 3B73A 2FMLA 4I01A 2XKOA 5DUKA 4ESBA 5L3GA 2UXXA 5CJ9A 3HTUA 3S2WA 3GFJA 4MNUA 2E7WA 2RV8A 2Z5UA 3HSEA 4ETSA 1ZRDA 3DKWA 3QP6A 4UUVA 2ZXJA 5CVIA 4HX7A 4BHBA 2FU4A 3HOTA 2VT2A 1STZA 1IAWA 3P9KA 1MGTA 3OOPA 4KDPA 4YG2F 5CVVA 3CUQC 2IA0A 3P9CA 1S3JA 4Q48A 3SZTA 4RB0A 4N9IA 2CYYA 2FOKA 3IC7A 3LSTA 2XUBA 2JSCA 3GFMA 2P7CB 3HIFA 3N97A 1SD6A 3HYIA 1W7PA 5LEKA 3K69A 3I5UA 2DK5A 2O3FA 4HX4A 1IN4A 5J6XA 1SD7A 3IHUA 1HW5A 3WE2A 2XKPA 2VN2A 2MLGA 3WE3A 3T8TA 4HLYA 4M73A 3QPTA 4BHPA 2BGCA 4ENMA 4KYWA 1D8KA 3CUQB 1SFUA 1R5HA 2OZUA 2ZKZA 3I64A 1O3QA 1HKQA 1K79A 2L54A 2Q0OA 3ECHA 4LLGF 5CYVA 2FSWA 1BOAA 4MTDA 2FMYA 3ECOA 3RIRA 1HKSA 3ZMUA 4M71A 5EEGA 1QGPA 2O0YA 4ASNA 4LB6B 1R1UA 1FSEA 1GXQA 1LDJA 2W85A 3QOPA 5DUIA 1IF1A 4HDVA 4IRIA 3BPXA 2GIVA 2IRFG 5BS6A 3BP8A 1LDDA 5IT9Z 4L5JA 4OIRF 1MJ9A 2VBZA 5HS8A 2ELHA 2RGVA 1B9MA 4XSZF 3J7AO 2UZKA 4B8XA 1MZBA 2JZYA 2FNAA 5F1RA 5ED4A 2EFWA 4LMYA 2K86A 4A6EA 2DO7A 3U2RA 2KIFA 3V8LA 1QQIA 1IN6A 2HS5A 2F2EA 2F5DA 3F8NA 5E8IA 3CTAA 3VEPA 3LA2A 5JHUA 3K9TA 2XHKA 2VC0A 1MKMA 5ICFA 1SAXA 3WTYC 3GW2A 3R61A 3DF8A 3F8MA 5E1WA 5D5VB 4LK1F 4GGGA 5CVJA 1TTYA 3KCCA 1KQ9A 3BPVA 1FP2A 3T8RA 5JR3A 3J81K 4EM2A 1RI7A 3QP5A 5JFRA 2DBBA 2NNNA 5DCMB 1FOKA 3E5QA 3SFZA 2HQNA 2ZFWA 1G3WA 1OPCA 1R23A 4I09A 3L2CA 1XGSA 3IL2A 3NEUA 1UCRA 4U7DA 1KU7A 3I59B 1BI1A 3QU6A 1IXSB 3RKXA 1YLFA 3PQJA 3E6BA 2ESNA 2EV5A 2PG4A 5HLIA 2BYVE 4Q47A 2K27A 4OU0A 2FNPA 3OV8A 2RKHA 3IRQA 1K6OA 1RIOH 2A5YB 4B09A 5DDGA 4HOBA 1HKTA 2P6SA 3R0AA 2VBYA 4LLLA 1S7AA 2E1NA 1HSJA 2VBXA 3E6DA 2EFOA 2COMA 5DD4A 1R5GA 1HSTA 3LAJA 2VC1A 2Y0MA 4UV9A 1ZRCA 1D3YA 2GA1A 3MFKA 1S29A 3C1DA 1GXPA 3RKWA 1JHFA 1T98A 3M7GA 5BPDA 4P9FA 2O03A 3BOQA 2CGPA 2V6CA 2XAHA 4P96A 2VOPA 3GO5A 2W84A 4L9VA 1OMIA 4ZZLA 3IKTA 4RAYA 5E17F 1O57A 2GXGA 2EA2A 5AIPA 3VODA 1R58A 4OMYA 3K1NA 1F9NA 3MQ0A 3MEXA 4N0BA 5H20A 2PEXA 1ZH5A 1U3EM 2QQAA 1ZLJA 3QU3A 3MWMA 3FM5A 1Z6RA 2G7HA 1XD7A 3HRMA 1IW7F 4G94A 1MDMA 4OIOF 1ZHFA 3HTSB 3I53A 4ZZDA 2HTJA 4G9YA 4WK8F 3SXYA 3PFIA 1K78A 4M9SA 3T1BA 1JGSA 4IVNA 4EMSA 3HHGA 1YW8A 3HRTA 2G9WA 3ZMSA 4CHUA 2W25A 4S04A 4MHGA 4RB1A 2YX4A 1GHCA 1J75A 2MA3A 2JRTA 5HDKA 2IT0A 3ZMZA 2MH2A 4R79A 4R1HA 1G3TA 2HR3A 2FBHA 2Z9OA 4OINF 4AVPA 4EJTA 3F6OA 3I4PA 4KIFA 2CQKA 2MD5A 1P4XA 2KIUA 1W5SA 1C0WA 2VOOA 2DQLA 3ML6A 2H27A 1ZAOA 5TJJA 1T39A 2IA1A 1Z05A 3JSPA 5BQTA 4KN4X 2FQ3A 2K02A 2RNJA 1ZGJA 3KE2A 2MLKA 1NHAA 2HQRA 1XDSA 2J5PA 1T38A 1Z1DA 4NB5A 4IRGA 5BOXA 3H3ZA 3NQOA 2ISYA 2L01A 3WG9A 4RB3C 5DV5A 3D0SA 3TOBA 1R1TA 2ISZA 3W6JB 1FBUA 5DCFA 5HS9A 5LBQA 4HDUA 1RUNA 4HA8A 5D4SA 5E18F 3KP6A 3KP7A 2HFHA 5A2QK 3FMRA 4KT5C 1IN8A 3BROA 2QBYA 2PFBA 1U6GA 2A69F 1T6SA 1U5TA 4MQ9F 1YG2A 4LGWA 5TRDA 4I0BA 3WTWC 2D1HA 3FX3A 4LLNA 3ULQB 3REOA 3GUDA 3L09A 1P4AA 4L0ZB 2RC4A 2JT1A 1BIBA 4YFNF 4FT8A 2HZTA 4JK1X 5HLHA 3CO7C 4OIPF 3EETA 2QENA 3R0JA 4QWQA 3RTRA 2EFNA 2DI3A 5D6FA 3CDHA 1KQ8A 1L3LA 3I71A 4WCGA 5L3EA 2DFIA 4QLCU 3WODF 2PN6A 2EFPA 2PI0A 1XB4A 1ZG5A 1FSHA 3D5LA 1HW2A 3ISPA 3GFIA 1IRGA 3GYHX 3LWFA 3MCZA 1OYIA 4I7HA 1OR7A 2A3SA 2AXLA 3SQNA 2IJLA 4AD9A 2GQQA 3L7WA 5F64A 1KQ0A 2OU2A 2Z99A 3V7SA 1Y0UA 3KZYA 2VONA 1FP1D 2WTEA 1F5TA 1MD0A 2YU3A 2L4AA 2ETHA 4L5IA 4O3MA 2GXBA 1WSUA 5AIQA 4GCVA 2PJPA 1OYYA 4XSXF 5CLSA 2HWVA 3WU0A 3V8KA 3RYPA 3N4MA 3HUGA 2AS5F 4FHTA 4PGGA 1FY7A 1TQIA 2H6CA 2QYOA 4BAYA 3WU1B 1XCBA 4Y15A 2NS0A 1G4DA 2ZNYA 3GF2A 5HS7A 2V1XA 3TO6A 2NAZA 5LGTA 1FNNA 2L02A 3F22A 3KP2A 3FZVA 1HW1A 4LG0B 1ZYRF 4MEYF 1USSA 1YQAA 2P5KA 5D5UB 3U9GA 4ENJA 1USTA 3LFKA 4HX8A 4KN7X 2K4BA 3DFGA 2YX7A 3B02A 3M1EA 4IRHA 4EVIA 2R7DA 1BBYA 4ENKA 3VOEA 1FYMA 1VTNC 1IN5A 2A07F 3TGNA 1CGPA 1X3UA 2DLLA 2A6EF 4EJWA 2YSRA 3K2ZA 2H94A 1B9NA 1KYWA 2DAOA 4Y13A 2M30A 4EQQA 2HDCA 1PP7U 5LGNA 2DPUA 1IXRC 1T0FA 2V9VA 2EFQA 2GWRA 1LB2A 1SMYF 2D1VA 5HDGA 4CO8A 1YIOA 2Y48A 4YFKF 2MBFA 2Q8KA 4YIIA 3V4GA 3WTUC 4YFXF 1O3SA 3K1MA 2JTVA 4EJVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3LA3 A;  1QPM A;  2QZ8 A;  2K4J A;  2ESH A;  4KMU X;  1FBQ A;  4UHT A;  2O6G E;  3L00 A;  1Z91 A;  4EM0 B;  5F6F A;  4ZYE A;  3ZPL A;  2XAJ A;  4UVA A;  3BJ6 A;  1RZ4 A;  5LLQ A;  5FFZ A;  3V7C A;  5K5Q A;  1B1B A;  3RYR A;  2F5E A;  1YFH A;  1TLH B;  1BI0 A;  3ZN1 A;  3GXO A;  1FC3 A;  1KGS A;  3LAP A;  1KYZ A;  2F5C A;  4HF2 A;  1W4M A;  4BQA A;  2LF8 A;  1SFE A;  2BEO A;  3E97 A;  1V4R A;  3EUH A;  2LNB A;  2LSO A;  1S6L A;  1BC7 C;  4HF0 A;  1U8R A;  1FT9 A;  3K0L A;  2X4H A;  2XAQ A;  4Q5S F;  4HQE A;  1ZRE A;  3F8C A;  2A68 F;  3PQK A;  1W7P D;  1BIA A;  1BN5 A;  5D6E A;  4A5M A;  4M6X A;  1FYL A;  3FWE A;  2X0L A;  2DT5 A;  4PGH A;  3RKY A;  4FX4 A;  2Q2E A;  4A12 A;  3I0T A;  4PZJ A;  1QO0 D;  3RDI A;  4EM1 A;  2ZME A;  5E1Z B;  3TKY A;  1IXC A;  3RI4 A;  3TDU C;  4EJO A;  4NQW A;  3T5X A;  3CUO A;  1MJB A;  2PMU A;  1S7O A;  2XVC A;  3DQV C;  2QUF A;  1U2W A;  2RN7 A;  4DNC A;  2XRO A;  2MH9 A;  2MC3 A;  2NYX A;  1XN7 A;  1ZGA A;  4M72 A;  4DQ2 A;  1H0M A;  2IVM A;  1CF7 A;  2O8X A;  2FEZ A;  1YO5 C;  5BPI A;  2G7U A;  2A6H F;  1TNS A;  3F72 A;  1XSV A;  3FXU A;  1IUY A;  5D5X B;  3ZMV A;  3C7J A;  2JPC A;  2ADU A;  3TO7 A;  1IN7 A;  2EA4 A;  1LJ9 A;  1SD5 A;  3R4K A;  4P5O A;  1XSX A;  2QQ9 A;  2Z33 A;  3J81 Z;  4WXC A;  2XRN A;  2FBI A;  3DP7 A;  4A0Y A;  1D8J A;  4L18 B;  1WQ2 A;  1TQM A;  2DQR A;  2D2W A;  2ZNZ A;  2P6T A;  4ZYH A;  2M45 A;  3ROU A;  3ZN0 A;  3RPU A;  4BYY A;  1PDN C;  4M6Y A;  2W24 A;  1LEA A;  1O7F A;  2QLZ A;  3V8J A;  2IPQ X;  4I98 B;  3GWZ A;  2NRA C;  3DPT A;  3SZP A;  1TW2 A;  1REP C;  3O2P E;  2GAU A;  5J8F A;  3O3K A;  3NRV A;  3I54 A;  3K1P A;  2W57 A;  3CUQ A;  1R1V A;  2HGC A;  2YPR A;  4L9J A;  1L0O C;  1QZY A;  4BXU A;  2DPD A;  1O3T A;  1W7P B;  4U7B A;  3TO9 A;  4M9X A;  2WWY A;  2PLY A;  2FXA A;  3JTH A;  1EH6 A;  4I0A A;  1ONV A;  2M5W A;  1TBX A;  1DPU A;  4RAZ A;  1B4A A;  1ULY A;  1RUO A;  3E5U A;  3BDD A;  1LQ1 A;  2QQB A;  1YS6 A;  2V1D A;  3P9I A;  5FD6 A;  2VBW A;  5LGU A;  2VT3 A;  5D5W B;  1Z9C A;  2WC2 A;  3GLX A;  1YW7 A;  2YR2 A;  4EGZ A;  4MEX F;  3WGI A;  2M87 A;  1KU3 A;  2GA2 A;  5L3D A;  2BBY A;  3MZY A;  1P6R A;  4UNO A;  5FLX K;  3VB2 A;  1FZP B;  4BHC A;  4KIB A;  3I58 A;  3ZP5 A;  1DP7 P;  5ERI A;  3IKV A;  5HLG A;  3DV8 A;  2EJR A;  3F21 A;  4HLX A;  4EV0 A;  1Z6T A;  5JI6 A;  4CDG A;  1Q1H A;  5D8L B;  1D5V A;  4HYE A;  4IPA A;  4HAM A;  2E7X A;  4RGX A;  4UVB A;  1UHM A;  2XIG A;  4PDK A;  4AIK A;  5DCM A;  2QWW A;  5HVQ C;  4G6Q A;  2QVO A;  3JW4 A;  2EK5 A;  3M8F A;  3BY6 A;  4LK0 F;  1JXS A;  4R8H A;  1I27 A;  1MJA A;  1XCV A;  4ON0 A;  4RGS A;  2A61 A;  5L3C A;  3I59 A;  3DPL C;  1EH7 A;  4ZYG A;  1SMT A;  2VE8 A;  4KFC A;  4F7Z A;  5EEH A;  4CXF A;  1V3F A;  3QPH A;  1YW9 A;  1G3Y A;  2HTS A;  2XAF A;  5FFX A;  1AOY A;  1XGM A;  3ERE D;  5FLX Z;  3AAF A;  3CO6 C;  1YS7 A;  4GYG A;  1LDK B;  4O5V A;  1BJA A;  2HOE A;  1LEB A;  6PAX A;  1FPQ A;  1J59 A;  4L0Y B;  3JTG A;  5ICG A;  4IXA A;  5A2Q Z;  2L4M A;  3GZ6 A;  1ZG3 A;  2FF4 A;  1ZRF A;  4XBF A;  4CGZ A;  3JAM K;  2XAG A;  3ABT A;  3F8F A;  2O61 A;  4L9T A;  3GVA A;  1PP8 F;  1H9T A;  1R36 A;  4H0E A;  1XSD A;  1ZLK A;  4K2E A;  1P4W A;  5LHI A;  2PBI A;  3O6B B;  4KIG A;  1LNW A;  1G3S A;  1P2F A;  1BC8 C;  1DDN A;  2CG4 A;  3E5X A;  3EYI A;  1Z7U A;  3F8B A;  1R22 A;  1F1Z A;  2RQP A;  4HV6 A;  4KNY A;  3R60 A;  3L9F A;  5H6Q A;  2LKP A;  5E8G A;  3E3V A;  3EYY A;  5FD5 A;  3GFL A;  2OQR A;  5KK1 A;  3R6S A;  4IF4 A;  1OKR A;  4U0W A;  2Y75 A;  3KFW X;  3F3X A;  1XMA A;  2FA5 A;  1XDU A;  4I2O A;  1U78 A;  2STT A;  2XGX A;  1WWX A;  4XLN F;  3GX4 X;  2EV0 A;  2R7F A;  3JAM Z;  4KIC A;  2RVC A;  5IT9 K;  3G73 A;  4A5N A;  4BNC A;  1LVA A;  3BJO A;  2RDP A;  1JE8 A;  5FO5 A;  4HV5 A;  2JPB A;  5FGM A;  2M1B A;  4WXD A;  5ILS A;  2FE3 A;  1QZZ A;  4ZH4 F;  1FYK A;  3ELK A;  2P7V B;  2LDU A;  4OOI A;  5ICE A;  1TW3 A;  3WTZ A;  5LHG A;  1ZG1 A;  1MDM B;  1O7L A;  3J80 K;  1ZAR A;  5J8C A;  3TQN A;  1WRJ A;  4CIC A;  1B59 A;  3DXJ F;  4FX0 A;  2ZJ2 A;  1K78 B;  5CVU A;  3FMQ A;  1I6X A;  1FX7 A;  2J5O A;  3Q5F A;  5KVR A;  2CFX A;  2PQ8 A;  2OBP A;  4U0V A;  2EB7 A;  3KLO A;  2DK8 A;  1PUE E;  5ILU A;  4Z2Y A;  1FBS A;  1XGO A;  2EWN A;  4MTE A;  2F5F A;  3HHH A;  5LEJ A;  3M8E A;  4UXN A;  2CSO A;  2ZO4 A;  1IZ1 A;  1UB9 A;  2HKO A;  4PCQ A;  3COA C;  2R3S A;  1FWZ A;  5ILV A;  4A6D A;  2NNY A;  5FB2 A;  1J5Y A;  1U5T C;  3C18 A;  5LRS A;  3WTT C;  4RS8 A;  4LD5 A;  1XGN A;  2DTR A;  3J80 Z;  4ENN A;  1E2X A;  4I02 A;  3HRU A;  3VFZ A;  2C6Y A;  2IP2 A;  3BJA A;  5DYM A;  3WTV C;  1HQC A;  2B0L A;  5E20 A;  2CW0 F;  3P7N A;  4G8X A;  3MZH A;  4IHS A;  5L3F A;  4OIQ F;  3MAJ A;  4EJU A;  2KKO A;  3EDP A;  2XAS A;  2P4W A;  5JVT A;  5K5O A;  2QBY B;  1QNT A;  1JHH A;  1XMK A;  4XLP F;  1U5T B;  4E70 A;  4OMZ A;  4UV8 A;  3T0Y A;  4Y17 A;  4KUM A;  4D0P A;  2H09 A;  5IT3 A;  1BM9 A;  3ABU A;  3BWG A;  3KP5 A;  1UFM A;  2LF7 A;  4M9Z A;  4KA4 A;  1R00 A;  3W6K B;  3HRS A;  1I1G A;  3WTS C;  4HBL A;  4WF2 A;  2OD5 A;  2GZW A;  1KA8 A;  4U0Y A;  2BE5 F;  3HSR A;  2Z3Y A;  3IWZ A;  4WWC A;  1G6N A;  5AON A;  3KZZ A;  1EV7 A;  2CWE A;  1OYW A;  4N9H A;  2OAZ A;  4CZZ A;  4Q4Z F;  5L3B A;  3FM3 A;  2VXZ A;  1WI9 A;  3HOS A;  2QM3 A;  3KLN A;  4UVC A;  4MGR A;  2HYG D;  2P5V A;  4M74 A;  3WGH A;  2IW5 A;  2OZ6 A;  3RJP A;  4WX9 A;  5BMZ A;  2BV6 A;  4A2U A;  4IJA A;  5HOO A;  4RGU A;  4LG0 A;  1KU9 A;  2K7L A;  2KRF A;  1EH8 A;  4P55 A;  2D45 A;  1SD4 A;  3FXQ A;  3TOA A;  1DUX C;  5HDN A;  5CVR A;  2E1C A;  4G6D A;  4AWX B;  3DEU A;  3LQQ A;  4RGR A;  3LQR A;  4P9U A;  1ON2 A;  3C3W A;  1AWC A;  3H3U A;  4LB5 A;  1B6A A;  1KU2 A;  3FHZ A;  4GO1 A;  4LFU A;  4G7Z F;  4U88 A;  3Q9V A;  3FF5 A;  4TV7 A;  3H92 A;  4LJZ F;  4KMF A;  4RB2 C;  3M9A A;  1P92 A;  4XRF A;  3E6M A;  2HYF A;  2P5L C;  3BZ6 A;  4GXO A;  3ZMT A;  1WKM A;  3WTX C;  5K1Y A;  2UWM A;  3EQL F;  4A0Z A;  3SHF A;  1ON1 A;  4G7O F;  3JSO A;  2UXN A;  5D8K B;  1S8N A;  3V7R A;  2P8T A;  1F4K A;  3QAH A;  3LA7 A;  1I1S A;  4AIJ A;  3FMS A;  3IWF A;  5H6R A;  4HW0 A;  4AIH A;  5LRR A;  2EV6 A;  2WV0 A;  4HQM A;  1T2K A;  2TDX A;  3GEZ A;  4L9N A;  1J9I A;  3IRR A;  1YYV A;  5DD8 A;  1H9G A;  4G7H F;  1BI2 A;  3KEO A;  1BI3 A;  4CYD A;  2V1U A;  1J7K A;  2OQG A;  2VE9 A;  3KP4 A;  2FRH A;  2L3D A;  3G3Z A;  3HSF A;  4HZF A;  4EGY A;  4ESF A;  4NHJ A;  2OA4 A;  2ACJ A;  2ZCW A;  3ZQ7 A;  1K7A A;  2VOD A;  3TDZ C;  1RNL A;  2M8E A;  1J2X A;  2KJC A;  2XV4 S;  1IRF A;  2FBK A;  3F23 A;  2DU9 A;  2STW A;  2V79 A;  3WGG A;  1UHW A;  1ZN2 A;  1I5Z A;  3CJN A;  2HEO A;  2ZBK A;  1E17 A;  5DEQ A;  1ODD A;  4O6J A;  3KEQ A;  3KP3 A;  2KJB A;  3RPQ A;  2IA2 A;  1DPR A;  3GZ5 A;  1HBX G;  4MQV A;  3KET A;  2KIM A;  4GYI A;  1O3R A;  3QRF F;  4A0X A;  1W5T A;  3Q9S A;  3E6C C;  3ZMD A;  3CLO A;  1TNT A;  1J0R A;  4JQF A;  1YTY A;  1A04 A;  2ZME B;  1HXD A;  3U1D A;  4ESJ A;  4S05 A;  2HKX A;  5E1X A;  1FLI A;  4ZYD A;  5ICC A;  2H6B A;  1R7J A;  2CO5 A;  5K5R A;  4HF1 A;  1QBJ A;  4WXH A;  3F6V A;  4YIF A;  3FXR A;  2DW4 A;  5D4R A;  1TQP A;  1CF7 B;  4JBA A;  4BH9 A;  5LHH A;  1GVJ A;  1SFX A;  4IHT A;  2PMH A;  3B73 A;  2FML A;  4I01 A;  2XKO A;  5DUK A;  4ESB A;  5L3G A;  2UXX A;  5CJ9 A;  3HTU A;  3S2W A;  3GFJ A;  4MNU A;  2E7W A;  2RV8 A;  2Z5U A;  3HSE A;  4ETS A;  1ZRD A;  3DKW A;  3QP6 A;  4UUV A;  2ZXJ A;  5CVI A;  4HX7 A;  4BHB A;  2FU4 A;  3HOT A;  2VT2 A;  1STZ A;  1IAW A;  3P9K A;  1MGT A;  3OOP A;  4KDP A;  4YG2 F;  5CVV A;  3CUQ C;  2IA0 A;  3P9C A;  1S3J A;  4Q48 A;  3SZT A;  4RB0 A;  4N9I A;  2CYY A;  2FOK A;  3IC7 A;  3LST A;  2XUB A;  2JSC A;  3GFM A;  2P7C B;  3HIF A;  3N97 A;  1SD6 A;  3HYI A;  1W7P A;  5LEK A;  3K69 A;  3I5U A;  2DK5 A;  2O3F A;  4HX4 A;  1IN4 A;  5J6X A;  1SD7 A;  3IHU A;  1HW5 A;  3WE2 A;  2XKP A;  2VN2 A;  2MLG A;  3WE3 A;  3T8T A;  4HLY A;  4M73 A;  3QPT A;  4BHP A;  2BGC A;  4ENM A;  4KYW A;  1D8K A;  3CUQ B;  1SFU A;  1R5H A;  2OZU A;  2ZKZ A;  3I64 A;  1O3Q A;  1HKQ A;  1K79 A;  2L54 A;  2Q0O A;  3ECH A;  4LLG F;  5CYV A;  2FSW A;  1BOA A;  4MTD A;  2FMY A;  3ECO A;  3RIR A;  1HKS A;  3ZMU A;  4M71 A;  5EEG A;  1QGP A;  2O0Y A;  4ASN A;  4LB6 B;  1R1U A;  1FSE A;  1GXQ A;  1LDJ A;  2W85 A;  3QOP A;  5DUI A;  1IF1 A;  4HDV A;  4IRI A;  3BPX A;  2GIV A;  2IRF G;  5BS6 A;  3BP8 A;  1LDD A;  5IT9 Z;  4L5J A;  4OIR F;  1MJ9 A;  2VBZ A;  5HS8 A;  2ELH A;  2RGV A;  1B9M A;  4XSZ F;  3J7A O;  2UZK A;  4B8X A;  1MZB A;  2JZY A;  2FNA A;  5F1R A;  5ED4 A;  2EFW A;  4LMY A;  2K86 A;  4A6E A;  2DO7 A;  3U2R A;  2KIF A;  3V8L A;  1QQI A;  1IN6 A;  2HS5 A;  2F2E A;  2F5D A;  3F8N A;  5E8I A;  3CTA A;  3VEP A;  3LA2 A;  5JHU A;  3K9T A;  2XHK A;  2VC0 A;  1MKM A;  5ICF A;  1SAX A;  3WTY C;  3GW2 A;  3R61 A;  3DF8 A;  3F8M A;  5E1W A;  5D5V B;  4LK1 F;  4GGG A;  5CVJ A;  1TTY A;  3KCC A;  1KQ9 A;  3BPV A;  1FP2 A;  3T8R A;  5JR3 A;  3J81 K;  4EM2 A;  1RI7 A;  3QP5 A;  5JFR A;  2DBB A;  2NNN A;  5DCM B;  1FOK A;  3E5Q A;  3SFZ A;  2HQN A;  2ZFW A;  1G3W A;  1OPC A;  1R23 A;  4I09 A;  3L2C A;  1XGS A;  3IL2 A;  3NEU A;  1UCR A;  4U7D A;  1KU7 A;  3I59 B;  1BI1 A;  3QU6 A;  1IXS B;  3RKX A;  1YLF A;  3PQJ A;  3E6B A;  2ESN A;  2EV5 A;  2PG4 A;  5HLI A;  2BYV E;  4Q47 A;  2K27 A;  4OU0 A;  2FNP A;  3OV8 A;  2RKH A;  3IRQ A;  1K6O A;  1RIO H;  2A5Y B;  4B09 A;  5DDG A;  4HOB A;  1HKT A;  2P6S A;  3R0A A;  2VBY A;  4LLL A;  1S7A A;  2E1N A;  1HSJ A;  2VBX A;  3E6D A;  2EFO A;  2COM A;  5DD4 A;  1R5G A;  1HST A;  3LAJ A;  2VC1 A;  2Y0M A;  4UV9 A;  1ZRC A;  1D3Y A;  2GA1 A;  3MFK A;  1S29 A;  3C1D A;  1GXP A;  3RKW A;  1JHF A;  1T98 A;  3M7G A;  5BPD A;  4P9F A;  2O03 A;  3BOQ A;  2CGP A;  2V6C A;  2XAH A;  4P96 A;  2VOP A;  3GO5 A;  2W84 A;  4L9V A;  1OMI A;  4ZZL A;  3IKT A;  4RAY A;  5E17 F;  1O57 A;  2GXG A;  2EA2 A;  5AIP A;  3VOD A;  1R58 A;  4OMY A;  3K1N A;  1F9N A;  3MQ0 A;  3MEX A;  4N0B A;  5H20 A;  2PEX A;  1ZH5 A;  1U3E M;  2QQA A;  1ZLJ A;  3QU3 A;  3MWM A;  3FM5 A;  1Z6R A;  2G7H A;  1XD7 A;  3HRM A;  1IW7 F;  4G94 A;  1MDM A;  4OIO F;  1ZHF A;  3HTS B;  3I53 A;  4ZZD A;  2HTJ A;  4G9Y A;  4WK8 F;  3SXY A;  3PFI A;  1K78 A;  4M9S A;  3T1B A;  1JGS A;  4IVN A;  4EMS A;  3HHG A;  1YW8 A;  3HRT A;  2G9W A;  3ZMS A;  4CHU A;  2W25 A;  4S04 A;  4MHG A;  4RB1 A;  2YX4 A;  1GHC A;  1J75 A;  2MA3 A;  2JRT A;  5HDK A;  2IT0 A;  3ZMZ A;  2MH2 A;  4R79 A;  4R1H A;  1G3T A;  2HR3 A;  2FBH A;  2Z9O A;  4OIN F;  4AVP A;  4EJT A;  3F6O A;  3I4P A;  4KIF A;  2CQK A;  2MD5 A;  1P4X A;  2KIU A;  1W5S A;  1C0W A;  2VOO A;  2DQL A;  3ML6 A;  2H27 A;  1ZAO A;  5TJJ A;  1T39 A;  2IA1 A;  1Z05 A;  3JSP A;  5BQT A;  4KN4 X;  2FQ3 A;  2K02 A;  2RNJ A;  1ZGJ A;  3KE2 A;  2MLK A;  1NHA A;  2HQR A;  1XDS A;  2J5P A;  1T38 A;  1Z1D A;  4NB5 A;  4IRG A;  5BOX A;  3H3Z A;  3NQO A;  2ISY A;  2L01 A;  3WG9 A;  4RB3 C;  5DV5 A;  3D0S A;  3TOB A;  1R1T A;  2ISZ A;  3W6J B;  1FBU A;  5DCF A;  5HS9 A;  5LBQ A;  4HDU A;  1RUN A;  4HA8 A;  5D4S A;  5E18 F;  3KP6 A;  3KP7 A;  2HFH A;  5A2Q K;  3FMR A;  4KT5 C;  1IN8 A;  3BRO A;  2QBY A;  2PFB A;  1U6G A;  2A69 F;  1T6S A;  1U5T A;  4MQ9 F;  1YG2 A;  4LGW A;  5TRD A;  4I0B A;  3WTW C;  2D1H A;  3FX3 A;  4LLN A;  3ULQ B;  3REO A;  3GUD A;  3L09 A;  1P4A A;  4L0Z B;  2RC4 A;  2JT1 A;  1BIB A;  4YFN F;  4FT8 A;  2HZT A;  4JK1 X;  5HLH A;  3CO7 C;  4OIP F;  3EET A;  2QEN A;  3R0J A;  4QWQ A;  3RTR A;  2EFN A;  2DI3 A;  5D6F A;  3CDH A;  1KQ8 A;  1L3L A;  3I71 A;  4WCG A;  5L3E A;  2DFI A;  4QLC U;  3WOD F;  2PN6 A;  2EFP A;  2PI0 A;  1XB4 A;  1ZG5 A;  1FSH A;  3D5L A;  1HW2 A;  3ISP A;  3GFI A;  1IRG A;  3GYH X;  3LWF A;  3MCZ A;  1OYI A;  4I7H A;  1OR7 A;  2A3S A;  2AXL A;  3SQN A;  2IJL A;  4AD9 A;  2GQQ A;  3L7W A;  5F64 A;  1KQ0 A;  2OU2 A;  2Z99 A;  3V7S A;  1Y0U A;  3KZY A;  2VON A;  1FP1 D;  2WTE A;  1F5T A;  1MD0 A;  2YU3 A;  2L4A A;  2ETH A;  4L5I A;  4O3M A;  2GXB A;  1WSU A;  5AIQ A;  4GCV A;  2PJP A;  1OYY A;  4XSX F;  5CLS A;  2HWV A;  3WU0 A;  3V8K A;  3RYP A;  3N4M A;  3HUG A;  2AS5 F;  4FHT A;  4PGG A;  1FY7 A;  1TQI A;  2H6C A;  2QYO A;  4BAY A;  3WU1 B;  1XCB A;  4Y15 A;  2NS0 A;  1G4D A;  2ZNY A;  3GF2 A;  5HS7 A;  2V1X A;  3TO6 A;  2NAZ A;  5LGT A;  1FNN A;  2L02 A;  3F22 A;  3KP2 A;  3FZV A;  1HW1 A;  4LG0 B;  1ZYR F;  4MEY F;  1USS A;  1YQA A;  2P5K A;  5D5U B;  3U9G A;  4ENJ A;  1UST A;  3LFK A;  4HX8 A;  4KN7 X;  2K4B A;  3DFG A;  2YX7 A;  3B02 A;  3M1E A;  4IRH A;  4EVI A;  2R7D A;  1BBY A;  4ENK A;  3VOE A;  1FYM A;  1VTN C;  1IN5 A;  2A07 F;  3TGN A;  1CGP A;  1X3U A;  2DLL A;  2A6E F;  4EJW A;  2YSR A;  3K2Z A;  2H94 A;  1B9N A;  1KYW A;  2DAO A;  4Y13 A;  2M30 A;  4EQQ A;  2HDC A;  1PP7 U;  5LGN A;  2DPU A;  1IXR C;  1T0F A;  2V9V A;  2EFQ A;  2GWR A;  1LB2 A;  1SMY F;  2D1V A;  5HDG A;  4CO8 A;  1YIO A;  2Y48 A;  4YFK F;  2MBF A;  2Q8K A;  4YII A;  3V4G A;  3WTU C;  4YFX F;  1O3S A;  3K1M A;  2JTV A;  4EJV A; 
#chains in the Genus database with same CATH topology
 2OJE D;  1OIS A;  3A4C A;  3LA3 A;  1QPM A;  1V5G A;  2CQX A;  2DDA A;  2K4J A;  2QZ8 A;  1UG2 A;  2ESH A;  1TL8 A;  4KMU X;  1FBQ A;  4JX5 A;  4UHT A;  3L00 A;  2O6G E;  1Z91 A;  2NVT J;  2X6W A;  2R5Y B;  4EM0 B;  5F6F A;  4ZYE A;  2VKH A;  5E3N A;  3ZPL A;  2XAJ A;  4ZTJ A;  4UVA A;  1XMX A;  2DA1 A;  2F48 A;  3BJ6 A;  1RZ4 A;  2DOD A;  5FFZ A;  5LLQ A;  5F0F A;  2V6E A;  3V7C A;  5K5Q A;  2IBD A;  3NWT A;  1B1B A;  3RYR A;  2F5E A;  1D1A A;  1YFH A;  1TLH B;  1BI0 A;  3ZN1 A;  2IEK A;  4A3D J;  3GXO A;  3HPG A;  2WB1 A;  1R71 A;  1FC3 A;  1KGS A;  3LAP A;  1KYZ A;  2F5C A;  4BBS J;  4HF2 A;  1W4M A;  4BQA A;  2LF8 A;  1SFE A;  1X1C A;  3DTK A;  3TP3 A;  2BEO A;  3E97 A;  3MMY B;  3CCY A;  3MD2 A;  1V4R A;  3EUH A;  5JHF A;  1VQ4 I;  2LNB A;  2LSO A;  3OIO A;  3A01 B;  1S6L A;  3BR6 A;  1BC7 C;  2O5R A;  2DOF A;  4HF0 A;  4PJN A;  3DKX A;  1MSE C;  1U8R A;  1MMS A;  1FT9 A;  3TMO A;  3K0L A;  1QA6 A;  2X4H A;  3RZD J;  2XAQ A;  2DT7 B;  4Q5S F;  2L7K A;  4HQE A;  1ZRE A;  3F8C A;  3L1P A;  2A68 F;  2WAQ A;  3EUK L;  3PQK A;  1W7P D;  1BIA A;  1BN5 A;  2E1M C;  4J00 A;  2DOA A;  1X2N A;  1OCP A;  5D6E A;  4A5M A;  1Y56 A;  3BCB A;  4M6X A;  4IHV A;  5EGO B;  1FYL A;  1Z77 A;  2KL4 A;  3FWE A;  2X0L A;  2DT5 A;  4PGH A;  3RKY A;  4FX4 A;  1WGX A;  2Q2E A;  3D1N I;  4A12 A;  3W2A A;  1IJW C;  3I0T A;  3M4O J;  3S1N J;  2LR8 A;  4PZJ A;  1QO0 D;  3PNV A;  4LG3 A;  3RDI A;  5IPA A;  1V5E A;  4XRM A;  4EM1 A;  2ZME A;  4RBO A;  4PUS A;  2KFD A;  1Y1W J;  5E1Z B;  3TKY A;  1IXC A;  3RI4 A;  3TDU C;  3PSF A;  4EJO A;  1A31 A;  3M07 A;  4NQW A;  5M5Y J;  3T5X A;  1QHG A;  3CCS I;  3CUO A;  1MJB A;  2PMU A;  1S7O A;  2XVC A;  3W2V A;  3DQV C;  2DMP A;  3HOU J;  2QUF A;  1U2W A;  3WU2 C;  3NAU A;  4C2M J;  2RN7 A;  4XID A;  4DNC A;  1HA8 A;  1SAU A;  2XRO A;  3GTL J;  2MH9 A;  2MC3 A;  2NYX A;  5IOY A;  1XN7 A;  5CQG A;  1ZGA A;  4M72 A;  5M3F J;  2M4K A;  5GAE J;  4DQ2 A;  3OYK A;  1H0M A;  5IY5 H;  1RC9 A;  3OMY A;  3C2H A;  2IVM A;  4D1Q A;  2O8X A;  2FEZ A;  1YO5 C;  1CF7 A;  3KIO A;  2E1M B;  2QF7 A;  4XOR A;  2YU9 J;  5BPI A;  2G7U A;  5C4J J;  3OWT A;  1BL0 A;  1VND A;  3DTE A;  1D5Y A;  4AUX A;  2A6H F;  2NVX J;  4XOT A;  2EPF A;  1TNS A;  3F72 A;  3IP4 B;  1XSV A;  3JRA A;  3S1Q J;  4S0H B;  3FXU A;  1IUY A;  5D5X B;  2B63 J;  3ZMV A;  3C7J A;  2JPC A;  2ADU A;  1UZC A;  3DBR B;  4BL0 B;  4CZC A;  5DM7 F;  3TO7 A;  1IN7 A;  3CC7 I;  1SEU A;  2E35 A;  1LJ9 A;  1SD5 A;  2EA4 A;  3BR5 A;  3R4K A;  4P5O A;  4UUS A;  4A3F J;  4HEA 2;  4CYC A;  1XSX A;  2QQ9 A;  4DOZ A;  2Z33 A;  3J81 Z;  4WXC A;  2XRN A;  2FBI A;  3A03 A;  3DP7 A;  4A0Y A;  1D8J A;  2M3A A;  4L18 B;  4BQN A;  2K85 A;  3MN2 A;  3CES A;  1WQ2 A;  2DA2 A;  1H89 C;  1TQM A;  1N78 A;  2BZT A;  2IXS A;  4ZJZ A;  4HST A;  2DQR A;  3U21 A;  3V42 A;  2PJR A;  2D2W A;  2ZNZ A;  2P6T A;  4ZYH A;  2DA5 A;  2M45 A;  3ROU A;  3FXO A;  3CDI A;  5JVG F;  3ZN0 A;  3RPU A;  1V5F A;  2EIK H;  3LNQ A;  1H8A C;  4IL6 C;  4BYY A;  3RQ4 A;  1PDN C;  4M6Y A;  2W24 A;  1LEA A;  1TZL A;  5GAH J;  4F93 B;  1O7F A;  2QLZ A;  4DZP A;  3G6E I;  3TW7 A;  2MG4 A;  2WAQ N;  4PSX A;  3V8J A;  2IPQ X;  4I98 B;  1MBG A;  4AU7 A;  1WFX A;  3GWZ A;  5HLT A;  2JQ7 A;  2NRA C;  3DPT A;  1LKX A;  4XM3 A;  2XPV A;  3SZP A;  4E7S A;  3S3N A;  2KMU A;  2OCC H;  4UUT A;  1MBJ A;  2EZK A;  4BGD A;  1TW2 A;  3ZRG A;  4XL9 A;  1REP C;  1PUF A;  2HI3 A;  2OPT A;  3OYF A;  3O2P E;  4G12 A;  2V9K A;  2GAU A;  5J8F A;  1MND A;  2V26 A;  3TED A;  1R4M B;  1G2H A;  3H1C A;  4DYC A;  3O3K A;  3NRV A;  2UUZ A;  1YJ9 I;  3I54 A;  1VF9 A;  3K1P A;  2KT0 A;  2DFF A;  2W57 A;  1APL C;  4DBQ A;  3KYD B;  5EEA A;  3VPR A;  3CUQ A;  2LP0 A;  5J4Y A;  1R1V A;  4A3J J;  2HGC A;  2YPR A;  4L9J A;  1L0O C;  1QZY A;  3ZQG A;  3ZXS A;  4BXU A;  5IP9 J;  2DPD A;  4BY7 J;  1O3T A;  1W7P B;  2JSP A;  4U7B A;  1RR7 A;  3TO9 A;  5E79 C;  4M9X A;  2LY2 A;  2WWY A;  4RDU A;  2PLY A;  2QQ8 A;  2FXA A;  2X1E A;  3JTH A;  2QSF X;  1MMA A;  1EH6 A;  5K7H A;  4JOM A;  4I0A A;  1JTY A;  2L5Q A;  3BZC A;  1ONV A;  1CQT A;  2M5W A;  2VJ4 A;  2Y0S N;  1TBX A;  2IGN A;  3WG7 H;  1DPU A;  3OL4 A;  4RAZ A;  1B4A A;  4HRI A;  1ULY A;  3FIW A;  2BY3 A;  1RUO A;  1ETK A;  1YX3 A;  3E5U A;  4ANJ A;  3BDD A;  2P0W A;  3FDY A;  4IEJ A;  2NVY J;  3HPH A;  1LQ1 A;  3F9K A;  2QQB A;  4LIT A;  4XN0 A;  2FX0 A;  3GTP J;  2NOG A;  1EF4 A;  4NC6 A;  1IGN A;  2V9P A;  5GAD J;  1YS6 A;  2P81 A;  2V1D A;  2XPU A;  3P9I A;  2LH9 A;  4Y7N J;  3LSK A;  4W97 A;  5FD6 A;  2LMD A;  2VBW A;  5LGU A;  2VT3 A;  5D5W B;  1Z9C A;  2WC2 A;  4E6K G;  1OCC H;  1YW7 A;  3GLX A;  2YR2 A;  4EGZ A;  2HPI A;  5J3L A;  4MEX F;  2EZI A;  3OYE A;  1N25 A;  4E7L A;  3WGI A;  2M87 A;  4MIM A;  1KU3 A;  5K7F A;  2GA2 A;  5B1B H;  1UAA A;  2MC4 A;  2BHZ A;  4RM3 A;  5L3D A;  1DQU A;  2E1O A;  2BBY A;  3BTL A;  3MZY A;  4I76 A;  1P6R A;  3HOX J;  1I3A A;  2ZB9 A;  5KHD A;  4RLQ A;  4UNO A;  3FXJ A;  2EIJ H;  5FLX K;  4BEH A;  3VB2 A;  2E2J J;  2BW3 B;  1FZP B;  4BHC A;  3EUH C;  4KIB A;  3I58 A;  3ZP5 A;  1GV5 A;  2NOJ B;  1DP7 P;  5ERI A;  4IHY A;  3IKV A;  5HLG A;  1JT6 A;  3DV8 A;  1VQN I;  2EJR A;  5J1R A;  2DXI A;  3F21 A;  3J7Z I;  2LC2 A;  1MMG A;  4HLX A;  3G1M A;  3ZCO A;  4EV0 A;  1Z6T A;  3CCJ I;  1K83 J;  5JI6 A;  1Q1H A;  2WY7 Q;  3FKI J;  5D8L B;  4CDG A;  1LFU P;  4HYE A;  1D5V A;  2LG4 A;  4IPA A;  1FMW A;  1NG7 A;  3OYA A;  4HAM A;  2RAE A;  2ZXH A;  2E7X A;  2CQ7 A;  3H35 A;  5C3E J;  4RGX A;  4UVB A;  2LLK A;  3PFY A;  4CCJ A;  1WPK A;  3PO3 J;  1UHM A;  2XIG A;  2QCO A;  4PDK A;  4AIK A;  1HOM A;  5DCM A;  2QWW A;  4XKW A;  4G6Q A;  5HVQ C;  2QVO A;  3JW4 A;  2EK5 A;  3M8F A;  1U0J A;  3BY6 A;  2ZME C;  1P9Q C;  5EF6 A;  3MKW B;  4LK0 F;  3OS1 A;  1JXS A;  1YHQ I;  4R8H A;  1I27 A;  1MJA A;  1XCV A;  1YE9 A;  2BXZ A;  4A3I J;  2BOL A;  4RM2 A;  4ON0 A;  4RGS A;  1TWC J;  4PJM A;  4A3E J;  2A61 A;  5L3C A;  3I4M J;  3I59 A;  3H9J A;  1W1W E;  1HC8 A;  2F4M B;  2KHM A;  3DPL C;  4NDL A;  1EH7 A;  4ZYG A;  3ZQL A;  1SMT A;  2VE8 A;  4KFC A;  5FKL A;  4F7Z A;  5FJ8 J;  1B8I A;  5EEH A;  4CXF A;  1V3F A;  3QPH A;  1YW9 A;  4W1U A;  4YRV A;  2TCT A;  1G3Y A;  2HTS A;  2XAF A;  4B3X A;  5FFX A;  1AOY A;  1DP3 A;  1A36 A;  1XGM A;  3ERE D;  3VYR B;  5FLX Z;  1X2M A;  3AAF A;  5B1A H;  4RA2 A;  3CO6 C;  1YS7 A;  4GYG A;  2Q2E B;  3FKJ A;  4B1R A;  1LDK B;  4O5V A;  1WJB A;  2X6O A;  3OY9 A;  1BOB A;  1BJA A;  3E0J B;  4XLC A;  3HEF A;  2HOE A;  3K4B A;  1LEB A;  5CKT A;  4DZJ A;  1ZEL A;  6PAX A;  1FPQ A;  1J59 A;  4ZDL A;  1GUU A;  4L0Y B;  1YRN B;  3PUB A;  3JTG A;  3ABM H;  5ICG A;  1V54 H;  4IXA A;  2XGD A;  2W7N A;  4UB6 C;  5F0H A;  5A2Q Z;  2L4M A;  3GZ6 A;  3LSH A;  3H3V K;  2VKD A;  1ZG3 A;  1GDT A;  2FF4 A;  1ZRF A;  2R7V A;  4XBF A;  5FRM A;  4CGZ A;  2R7U A;  3JAM K;  4HNU A;  4X6A J;  2XAG A;  3ABT A;  3HOY J;  3F8F A;  2O61 A;  3KZI C;  1IO2 A;  3GVA A;  4L9T A;  2DCE A;  1PP8 F;  3GTG J;  1Y8R B;  3MKL A;  5J40 A;  2NS7 A;  1H9T A;  1AU7 A;  3H5A A;  1S9H A;  3S1R J;  1R36 A;  4H0E A;  1XSD A;  1ZLK A;  4K2E A;  1P4W A;  3CC2 I;  1MW7 A;  2HXI A;  5LHI A;  2PBI A;  3O6B B;  1J09 A;  4KIG A;  1RPW A;  1G8X A;  1LNW A;  3N05 A;  2FUG 2;  1G3S A;  1P2F A;  3OOU A;  2HDD A;  1BC8 C;  3LSJ A;  1DDN A;  1Z67 A;  1VQM I;  2R7S A;  2CG4 A;  2M4G A;  1GVD A;  3E5X A;  4NC8 A;  3S2H J;  4XNF A;  1FTZ A;  1T95 A;  3EYI A;  1Z7U A;  3F8B A;  3GBG A;  3ZOB A;  1R22 A;  1A6I A;  3G2B A;  1F1Z A;  2AO9 A;  2KPM A;  2RQP A;  4XIC A;  4HV6 A;  4KNY A;  4E7H A;  3R60 A;  3L9F A;  5H6Q A;  3UKG A;  2LKP A;  5KAF C;  2B9S A;  5E8G A;  3FXK A;  2VUM J;  2L9N A;  2JUC A;  3E3V A;  1FTT A;  3EYY A;  1U9O A;  3C2B A;  3GFL A;  5FD5 A;  1IV8 A;  2OQR A;  3QYE A;  4M3B A;  5KK1 A;  2DT6 A;  4IF4 A;  3R6S A;  5FRO A;  3PSI A;  1OKR A;  4U0W A;  2Y75 A;  3KFW X;  4P1W A;  3F3X A;  1D0Y A;  1WJ5 A;  4BU2 A;  3ABL H;  4GRI A;  1XMA A;  3CCM I;  4E7J A;  3K4L A;  4MO7 A;  2FA5 A;  2M8G X;  1XDU A;  4I2O A;  2CW7 A;  2IS6 A;  5IYC J;  4C3J J;  3OYG A;  1U78 A;  2K9S A;  2STT A;  2XGX A;  3DPU A;  1WWX A;  3VYS B;  4M3D A;  4XLN F;  1RR8 C;  4XRS G;  3GX4 X;  2W4S A;  1OFC X;  5J4V A;  2EV0 A;  2R7F A;  3SFI A;  3JAM Z;  4KIC A;  2RVC A;  5IT9 K;  1M1E B;  5EG0 B;  3G73 A;  4A5N A;  4BNC A;  2ID6 A;  1LVA A;  3BJO A;  2RDP A;  1JE8 A;  1QU3 A;  5FO5 A;  4HV5 A;  1X1D A;  2JPB A;  2CW8 A;  5FGM A;  2M1B A;  4WXD A;  5ILS A;  1PUF B;  1QZE A;  3BTC A;  2E5Z A;  1QZZ A;  2FE3 A;  4ZH4 F;  1FYK A;  3ELK A;  2P7V B;  4FCY A;  4PJJ A;  1WI3 A;  2XF5 A;  2LDU A;  4OOI A;  5ICE A;  2KDO A;  2H1L A;  1TW3 A;  4II2 A;  3WTZ A;  5LHG A;  1ZG1 A;  5GPA A;  1MDM B;  1O7L A;  3J80 K;  1TWG J;  1WJF A;  2CUZ A;  2W48 A;  2JVG A;  1ZAR A;  1X3Z B;  5J8C A;  3GTM J;  2M34 A;  2XAU A;  3S8P A;  3TQN A;  1ERD A;  1WRJ A;  4CIC A;  1B59 A;  3DXJ F;  4FX0 A;  2ZJ2 A;  1K78 B;  1U9N A;  3BG7 A;  5CVU A;  3FMQ A;  1I6X A;  1FX7 A;  2J5O A;  4Y3O A;  3Q5F A;  1B72 A;  2R5Z B;  4IQ4 A;  5KVR A;  2CFX A;  5K7Z A;  2PQ8 A;  2OBP A;  3BR0 A;  3HKZ N;  4U0V A;  2VPL A;  1S5L C;  3NAR A;  2CQQ A;  1TWA J;  1WJD A;  1MMN A;  2EB7 A;  2DN0 A;  4XKB A;  2ZJR F;  4Y4R A;  1D1B A;  3KLO A;  4PFO A;  4IOC F;  4C9Y A;  1LUJ B;  2DK8 A;  1XPX A;  4A69 C;  4MFE A;  1JTX A;  4DYQ A;  1PUE E;  5ILU A;  3BG9 A;  2L7Z A;  3OYM A;  4Z2Y A;  4F92 B;  2OC6 A;  1FBS A;  2XSD C;  4IZZ A;  1XGO A;  1JJ6 C;  4RAF A;  2EWN A;  4MTE A;  3G4S I;  3S32 A;  2F5F A;  2HQA A;  3HHH A;  2E60 A;  5LEJ A;  3M8E A;  4UXN A;  2Y69 H;  2CSO A;  2ZO4 A;  1IZ1 A;  1UB9 A;  2R0Q C;  3A2K A;  2HKO A;  4PCQ A;  3ERM A;  3COA C;  2GXA A;  3RCO A;  3DU6 A;  2DOE A;  2CQN A;  3LSM A;  1ZQ3 P;  5JLX A;  2R3S A;  4MFD A;  3OS2 A;  1FWZ A;  5ILV A;  3LSP A;  3QWL A;  5E3O A;  2IGO A;  4A6D A;  2NNY A;  5FB2 A;  5CPR B;  2EIN H;  1J5Y A;  3LFU A;  1U5T C;  3C18 A;  3HJE A;  5LRS A;  3WTT C;  4RS8 A;  2VQL A;  2XGC A;  3BC8 A;  4LD5 A;  3DLA A;  1XGN A;  2DTR A;  5EZG A;  3I4N J;  2JA6 J;  4BBR J;  3J80 Z;  2RRE A;  4ENN A;  1E2X A;  2F4O B;  4I02 A;  2CMP A;  3HRU A;  2KZG A;  3VFZ A;  2VLA A;  3A02 A;  2C6Y A;  3JRF A;  3PIP F;  2IP2 A;  3VSK A;  2L7M P;  3BJA A;  3I9V 2;  5DYM A;  4BJT A;  3WTV C;  1KZH A;  1HQC A;  4M3G A;  2B0L A;  5E20 A;  2CW0 F;  3P7N A;  4G8X A;  3MZH A;  2LKS A;  5L3F A;  4IHS A;  4OIQ F;  3MAJ A;  4EJU A;  2IAI A;  2KKO A;  4FTH A;  1VQP I;  1W0U A;  2R93 J;  3EDP A;  4PFP A;  2XAS A;  4ITV A;  4BY1 J;  1YJN I;  2LY9 A;  2JVH A;  4IHX A;  2P4W A;  5E3L A;  2BY1 A;  5JVT A;  5K5O A;  2R7O A;  3L2V A;  3I56 I;  2QBY B;  1VQO I;  1JT0 A;  1Z3Y A;  1RRJ A;  2LBF B;  1QNT A;  1JHH A;  2CUJ A;  1JI8 A;  1XMK A;  4V2G A;  4XLP F;  1U5T B;  4E70 A;  4D7M A;  2ID3 A;  4A93 J;  2L7F P;  3BCA A;  2VKE A;  4OMZ A;  4UV8 A;  1R5I D;  3T0Y A;  1MIJ A;  4Y17 A;  1AKH A;  3HGG A;  4KUM A;  1WH5 A;  3OR2 C;  4D0P A;  2H09 A;  3FBN B;  3E1S A;  5IT3 A;  1BM9 A;  5EZH A;  1OR7 C;  3ABU A;  2VQG A;  1K4T A;  3NWS A;  2ECB A;  3S93 A;  3BWG A;  2Y31 A;  3KP5 A;  1UFM A;  2DMT A;  2LF7 A;  4MLO A;  3LL7 A;  1TWF J;  3DKY A;  2Y0S A;  4M9Z A;  4KT6 A;  1WCM J;  4KA4 A;  1R00 A;  4FE4 A;  1VQ5 I;  3W6K B;  2R7Q A;  3HRS A;  1I1G A;  3WTS C;  2CUF A;  4HBL A;  4WF2 A;  3W2W A;  1UEL B;  2GLO A;  2OD5 A;  2GZW A;  2M0M A;  2HVQ A;  1KA8 A;  2HYJ A;  2BE5 F;  4U0Y A;  1BW5 A;  2ELJ A;  3HSR A;  2Z3Y A;  3IWZ A;  4WWC A;  1G6N A;  5AON A;  3K4K A;  2JA7 J;  3KZZ A;  1EV7 A;  5LFA A;  2CWE A;  1OYW A;  3QYB A;  4N9H A;  5KCM A;  2OAZ A;  4XLE A;  4CZZ A;  4Q4Z F;  5L3B A;  2JA2 A;  3FM3 A;  5LD2 C;  5B5E C;  5M3M J;  2VXZ A;  1WI9 A;  3IH3 A;  1DGR M;  2X1D A;  1LE8 B;  3HOS A;  2L9S A;  2QM3 A;  3KLN A;  4UVC A;  2L0K A;  2UV1 A;  4MGR A;  1P7J A;  2HYG D;  2P5V A;  4PJ0 C;  4M74 A;  1UJ8 A;  1JKP C;  2VB6 A;  1F43 A;  1NG6 A;  3WGH A;  2IW5 A;  2OZ6 A;  3RJP A;  4WX9 A;  5BMZ A;  3ESW B;  2BV6 A;  2XDV A;  1U8B A;  4A2U A;  1DU6 A;  3M8J A;  4IJA A;  5HOO A;  4ZC3 A;  4FET A;  5GTI C;  4BE2 A;  1TT0 A;  2HDW A;  2LY1 A;  4RGU A;  4D5C A;  4LG0 A;  1KU9 A;  2K7L A;  2FOW A;  2KRF A;  2X48 A;  4BQO A;  1SFO J;  1EH8 A;  3EPZ A;  4P55 A;  2D45 A;  1SD4 A;  3FXQ A;  3DLL F;  3TOA A;  3DEW A;  3H9Q A;  1DUX C;  5HDN A;  2DFH A;  4XQF A;  5CVR A;  5FKO A;  3HUG B;  1MH3 A;  2HVR A;  2K9L A;  2LVS A;  2E1C A;  2ZJP F;  4G6D A;  4AWX B;  3DEU A;  2WAE A;  3LQQ A;  4RGR A;  3LQR A;  1R4N B;  2I10 A;  4P9U A;  1ON2 A;  3C3W A;  1OCT C;  4AC0 A;  1AWC A;  2K3P A;  3SDB A;  3H3U A;  4LB5 A;  1B6A A;  1KU2 A;  3FHZ A;  3A1Y A;  1Z3X A;  4GO1 A;  4UY8 I;  2ZC2 A;  3HM5 A;  4LFU A;  2CUE A;  4G7Z F;  2ZSI B;  4U88 A;  3Q9V A;  3FF5 A;  4II3 A;  1HLV A;  4TV7 A;  3BR1 A;  3H92 A;  2I8D A;  1T0F C;  3OYC A;  4E7K A;  2VJ5 A;  4LJZ F;  4B48 A;  2Z1D A;  4KMF A;  3TW6 A;  1IRZ A;  4RB2 C;  3M9A A;  4NNJ A;  1WHU A;  1P92 A;  2QEX I;  2HZD A;  4BKX A;  3JRE A;  2QSG X;  3UNG C;  1XTA A;  2O9L A;  1ZKG A;  2K9N A;  1IRX A;  2CS3 A;  1QPI A;  4XRF A;  3FXL A;  3E6M A;  2HYF A;  2P5L C;  4GDF A;  3BZ6 A;  4GXO A;  3ZMT A;  1WKM A;  3WTX C;  4XKV A;  5K1Y A;  2A6T A;  3S17 J;  3OYB A;  2UWM A;  3EQL F;  2KLO A;  2IGM A;  4BDY A;  1EKE A;  3BG6 A;  4A0Z A;  3SHF A;  4IKF A;  1I3Q J;  1ON1 A;  3JSO A;  2UXN A;  4G7O F;  2K9M A;  3S1M J;  3E7L A;  5D8K B;  1S8N A;  3V7R A;  2R5Y A;  2P8T A;  1F4K A;  1KON A;  3QAH A;  3LA7 A;  1I1S A;  2XF6 A;  2CU7 A;  4AIJ A;  2G0E A;  2AHQ A;  4M6V A;  2JMW A;  5F08 A;  3FMS A;  3IWF A;  1ORK A;  2EBI A;  5H6R A;  2H8R A;  4HW0 A;  5LRR A;  4AIH A;  2EV6 A;  4C2T A;  3HGY A;  2WV0 A;  4HQM A;  2VI6 A;  4V2F A;  1T2K A;  2TDX A;  3GEZ A;  4L9N A;  5FKK A;  2I5U A;  1J9I A;  1MMD A;  1FEX A;  3IRR A;  1YYV A;  1FOX A;  5DD8 A;  1H9G A;  4G7H F;  1BI2 A;  1XG1 A;  3KEO A;  2WY8 Q;  1PVE A;  1BI3 A;  4CYD A;  2V1U A;  1J7K A;  2OQG A;  2XC7 A;  2VE9 A;  3KP4 A;  2FRH A;  2L3D A;  4XOP A;  3PM1 A;  4KIT B;  1UHS A;  3G3Z A;  1G59 A;  3A01 A;  3HSF A;  4HZF A;  2PX9 A;  4EGY A;  3PO2 J;  3RPU D;  3J7A Y;  1ZTR A;  1QRY A;  4AYB N;  4ESF A;  1JKO C;  3I3L A;  1I39 A;  3CMA I;  4NHJ A;  2OA4 A;  2E71 A;  2ACJ A;  3ONQ A;  2M7A A;  5GAG J;  4XLF A;  2ZJQ F;  2ZCW A;  3ZQ7 A;  1K7A A;  1S7E A;  2VOD A;  2IS2 A;  2LRD A;  3TDZ C;  1RNL A;  2M8E A;  1J2X A;  2KJC A;  1Q1V A;  2XV4 S;  2LKX A;  1IRF A;  1X19 A;  1F36 A;  3HXL A;  5EGO A;  4U87 A;  1FMV A;  4BE0 A;  4ZTF A;  1MNE A;  1ACI A;  2FBK A;  3CJR B;  3F23 A;  3CCE I;  2DU9 A;  2STW A;  2V79 A;  4BJ6 C;  3WGG A;  5J1Y A;  1UHW A;  2AQE A;  1ZN2 A;  3GTJ J;  1I5Z A;  3CJN A;  2HEO A;  4F3Q A;  1FIA A;  2ZBK A;  4XON A;  5CQE A;  5DEQ A;  1E17 A;  1VI0 A;  1YIJ I;  2F5V A;  3EUA A;  4C3H J;  2XF7 A;  1K6Y A;  1ODD A;  3BQZ A;  3K4C A;  1OCO H;  4O6J A;  3S14 J;  2YUS A;  1IV6 A;  3KEQ A;  2MW8 A;  3KP3 A;  2KJB A;  3RPQ A;  2IA2 A;  4FAS D;  4DBR A;  1DPR A;  3GZ5 A;  3K4J A;  1HBX G;  2E5N A;  4NBQ A;  2HPM A;  3PUF A;  4MQV A;  1YI2 I;  3KET A;  3BQY A;  2R4G A;  4OAZ A;  1T08 B;  3QQA A;  3HOZ J;  2KIM A;  1Y39 A;  4GYI A;  3FK7 A;  1O3R A;  2XB0 X;  3QRF F;  4A0X A;  2EH3 A;  1W5T A;  2LTP A;  3Q9S A;  4BXX J;  3S3M A;  3E6C C;  3AG2 H;  3ZMD A;  1W36 C;  3GTO J;  3CLO A;  2L9R A;  1TNT A;  1J0R A;  4JQF A;  1YTY A;  1A04 A;  2DDB A;  2ZME B;  4B43 A;  1HXD A;  3U1D A;  1LPQ A;  4QPQ A;  4ESJ A;  2LFB A;  4YEL A;  3ZQF A;  4NQW B;  2ME0 A;  4S05 A;  2HKX A;  3BTJ A;  5E1X A;  2DMU A;  1FLI A;  2JUG A;  1WJC A;  2OCE A;  4XLA A;  1A35 A;  4JX6 A;  2R7T A;  4ZYD A;  5ICC A;  2H6B A;  1R7J A;  1SAN A;  2CO5 A;  4RLF A;  2JA8 J;  1QHH D;  1YJW I;  3JRI A;  3RZO J;  3LSI A;  5K5R A;  4HF1 A;  1QBJ A;  1S72 I;  4WXH A;  3F6V A;  1V55 H;  3HKZ A;  4YIF A;  3FXR A;  2AXT C;  2DW4 A;  1TQP A;  5D4R A;  1CF7 B;  4IQJ A;  2EQR A;  4JBA A;  4BH9 A;  5LHH A;  3K70 D;  3QPL A;  3RKQ A;  3SZG A;  1E3P A;  1GVJ A;  3OYN A;  1SFX A;  3SDG A;  4IHT A;  1UMQ A;  2PMH A;  3B73 A;  2FML A;  4I01 A;  2XKO A;  3AG1 H;  5DUK A;  3J7Y J;  5FLM J;  3DBL B;  4B44 A;  4YEJ A;  4ESB A;  2CV2 A;  1Z7L A;  5L3G A;  3SJM A;  4N4N B;  3CJQ B;  2UXX A;  3CF5 F;  3HB9 A;  5CJ9 A;  3AKZ A;  2VIX A;  1BJZ A;  2MYS A;  3HTU A;  3B6C A;  3S2W A;  4UUS B;  3GFJ A;  4MNU A;  2E7W A;  2RV8 A;  4CYC B;  5GTH C;  2Z5U A;  3HSE A;  3AG3 H;  5BNG A;  2E34 A;  4ETS A;  3ASO H;  4IX7 A;  1ZRD A;  3DKW A;  3QP6 A;  4UUV A;  2ZXJ A;  2OTJ I;  5CVI A;  4HX7 A;  1IC8 A;  4UB8 C;  4BHB A;  2BY0 A;  2FU4 A;  2CV1 A;  3HOT A;  2VT2 A;  1STZ A;  4EAT A;  5F1J A;  1IAW A;  3P9K A;  2BHY A;  1R9T J;  1MGT A;  3OOP A;  2V1N A;  4KDP A;  3JCU C;  5CVV A;  4YG2 F;  3CUQ C;  2IA0 A;  2PJR B;  1JUM A;  1RES A;  1R6R A;  3P9C A;  1MBK A;  1S3J A;  3W6V A;  4Q48 A;  3SZT A;  4RB0 A;  3HOW J;  4N9I A;  2CYY A;  2FOK A;  3IC7 A;  3LST A;  2MFZ A;  2XUB A;  2JSC A;  4BUP A;  3GFM A;  2P7C B;  3GTK J;  3HIF A;  1Y6I A;  3N97 A;  3BR3 A;  1SVO A;  4D7N A;  1SD6 A;  1OJL A;  3HYI A;  3IAS 2;  2DA6 A;  1W7P A;  5LEK A;  1H88 C;  3K69 A;  3I5U A;  1QVT A;  1SFK A;  1K61 A;  3Q0U A;  3M3Y J;  2DK5 A;  2O3F A;  4HX4 A;  2KRH A;  2JJ7 A;  1IN4 A;  5J6X A;  1SD7 A;  1MH4 A;  3IHU A;  3QOD A;  2LD5 A;  5EYR A;  3BR2 A;  1HW5 A;  4FE7 A;  3L2W A;  3WE2 A;  2XKP A;  5FKN A;  2VN2 A;  2VPR A;  3JRC A;  5JLW A;  3S16 J;  2MSY A;  5C44 J;  2MLG A;  3WE3 A;  3WHC A;  2EZH A;  4DIQ A;  3T8T A;  4HLY A;  1UG0 A;  2XSJ C;  3VWB A;  4M73 A;  3QPT A;  4BHP A;  3CD6 I;  1EA3 A;  2BGC A;  4ENM A;  4KYW A;  1D8K A;  3CUQ B;  1Y1V J;  1T33 A;  1SFU A;  5C4X J;  1R5H A;  2V4J C;  1WJE A;  3H9G A;  2BVL A;  3O8H A;  2OZU A;  2ZKZ A;  3JRB A;  4XMY A;  2MGQ A;  3I64 A;  1O3Q A;  3K70 C;  1HKQ A;  1K79 A;  2L54 A;  2DA7 A;  2AQF A;  3MKZ A;  2Q0O A;  3ECH A;  4LLG F;  1D1C A;  2VQC A;  1IUF A;  4F91 B;  5KNL A;  5CYV A;  2FSW A;  1BOA A;  4MTD A;  1YX5 A;  2HOA A;  3K4N A;  2ZXI A;  2FMY A;  3ECO A;  3ZR8 X;  3RIR A;  3FXM A;  4F52 A;  1HKS A;  3ZMU A;  4BAC A;  1K4S A;  4M71 A;  5EEG A;  1QGP A;  4QTR A;  3OIP A;  2O0Y A;  4ASN A;  5J47 A;  4LB6 B;  1R1U A;  4CCM A;  1FSE A;  1GXQ A;  2R7Z J;  3WHB A;  3SEZ A;  3QPS A;  1LDJ A;  2EIL H;  2BW3 A;  2W85 A;  3QOP A;  4X0G A;  2KZV A;  5DUI A;  1IF1 A;  2ECC A;  3CJT B;  4HDV A;  4IRI A;  3BPX A;  2GIV A;  4ZDP A;  3IV5 A;  2IRF G;  5BS6 A;  3BP8 A;  1LDD A;  5IYD J;  3D5S C;  1YOV B;  5IT9 Z;  4L5J A;  4OIR F;  2HQ5 A;  1ITY A;  2QSH X;  1MJ9 A;  2VBZ A;  5HS8 A;  4LOC A;  3CCV I;  4Y52 J;  1FOW A;  2ELH A;  2RGV A;  1B9M A;  2DMN A;  4XSZ F;  3J7A O;  2VJI A;  2R7W A;  2UZK A;  4B8X A;  1MZB A;  2LYC A;  3QOE A;  1ETY A;  2O7O A;  2JZY A;  3KPH A;  2FNA A;  3GZN B;  5F1R A;  1JKR C;  5ED4 A;  1FIP A;  2EFW A;  3TL4 X;  2M2E A;  4LMY A;  2K86 A;  5GPC A;  2JK3 A;  4A6E A;  2DO7 A;  3FBI B;  3U2R A;  2WBM A;  1WZ2 A;  2X6Y A;  2KIF A;  4C30 A;  3V8L A;  4PSW A;  1P7I A;  1IN6 A;  1QQI A;  2HS5 A;  2F2E A;  2F5D A;  3F8N A;  2PMZ N;  5E8I A;  4BDZ A;  1BR4 A;  5M5W J;  2E2I J;  1VQK I;  5J1U A;  1I6H J;  1BW6 A;  3DWL E;  2ZFU A;  3CTA A;  4BEH B;  3VEP A;  3LA2 A;  5JHU A;  3HZJ A;  3K9T A;  1FJL A;  4A3G J;  5TGT A;  2XHK A;  3O8G A;  2VC0 A;  1MKM A;  5ICF A;  5DM6 F;  1SAX A;  2WA0 A;  2XRL A;  3WTY C;  3H5R A;  3GW2 A;  3R61 A;  2CJJ A;  1NH3 A;  2K40 A;  3DF8 A;  3F8M A;  5E1W A;  5D5V B;  1W5C C;  1X4O A;  3HG9 A;  4LK1 F;  4HG2 A;  5F0C A;  1TWH J;  4GGG A;  3AL0 C;  3DEE A;  4Y33 A;  4DW6 A;  3OYH A;  5CVJ A;  1TTY A;  3Q0W A;  4CCN A;  1NK2 P;  1ETX A;  3KCC A;  5IOZ A;  2K5C A;  1E3O C;  4A3L J;  1KQ9 A;  2VJJ A;  3BPV A;  1FP2 A;  3T8R A;  4BE1 A;  2VL8 A;  5TIS C;  5JR3 A;  1ZK8 A;  2TRT A;  4EM2 A;  2K9Q A;  3J81 K;  1RKT A;  1RI7 A;  2JN6 A;  3QP5 A;  2KIS A;  5JFR A;  4ABZ A;  2DBB A;  1XS9 A;  2NNN A;  5DCM B;  1OQY A;  2FJ1 A;  1FOK A;  3E5Q A;  2F4I A;  3LSG A;  3X2Q H;  2IGK A;  2X6X A;  1VQ6 I;  3SFZ A;  2HQN A;  2ZFW A;  1G3W A;  1OPC A;  1R23 A;  1WH7 A;  3DU5 A;  4I09 A;  3OYI A;  1YRN A;  1VQ7 I;  3L2C A;  1XGS A;  3HBL A;  3IL2 A;  2KIQ A;  3NEU A;  1UCR A;  1Y8Q B;  4U7D A;  2F6C A;  1KU7 A;  3I59 B;  1BI1 A;  3HOV J;  3QU6 A;  2E2H J;  3LOC A;  4L5E A;  1IXS B;  3BG3 A;  3RKX A;  1YLF A;  2EZL A;  3PQJ A;  3E6B A;  4E4H A;  2KP6 A;  2YS9 A;  1B8I B;  2ESN A;  2EV5 A;  2PG4 A;  5HLI A;  3PJR A;  3AL0 B;  1YIT I;  2BYV E;  4QPO A;  3BTI A;  4XKC A;  2H1K A;  2NS8 A;  4Q47 A;  2K27 A;  1LFP A;  2JWT A;  4OU0 A;  1JKQ C;  2FNP A;  4IOA F;  2E36 A;  3K7A J;  2X9D A;  3OV8 A;  2RKH A;  2M9H A;  4IHW A;  3IRQ A;  1K6O A;  3D5R C;  1BR1 A;  2WAF A;  4E7Z A;  1RIO H;  2A5Y B;  1OCZ H;  3KX2 A;  4B09 A;  5DDG A;  4HOB A;  1HKT A;  2ZSH B;  2WV1 A;  2QKL B;  2P6S A;  5FKM A;  3R0A A;  5IYB J;  2VBY A;  1JJ8 C;  4LLL A;  3S3O A;  4OWR B;  1S7A A;  2E1N A;  1HSJ A;  2VBX A;  3E6D A;  2VQH A;  3H36 A;  2EFO A;  1VZ0 A;  3MVP A;  3CZ6 A;  5DD4 A;  1R5G A;  1XC5 A;  1HST A;  3LAJ A;  1I50 J;  2OV7 A;  2VC1 A;  2B7E A;  2Y0M A;  1TP4 A;  4UV9 A;  1ZRC A;  4V19 K;  1D3Y A;  2GA1 A;  3MFK A;  2Y2Z A;  1S29 A;  3C1D A;  3IH2 A;  2HU9 A;  3KYL A;  2WB1 N;  2L2O A;  3RKW A;  2WAD A;  4CCL A;  1JHF A;  3KYC B;  4JP0 A;  3U1K A;  4D5F A;  1GXP A;  1T98 A;  3M7G A;  5DTD A;  5BPD A;  4P9F A;  3OSG A;  2O03 A;  3BOQ A;  2CGP A;  3F0C A;  2V6C A;  2XAH A;  2BY2 A;  4P96 A;  2VOP A;  3GO5 A;  2DA3 A;  2W84 A;  4L9V A;  4M3F A;  3FK6 A;  1OMI A;  2A05 A;  5E3M A;  5H2F C;  4ZZL A;  3IKT A;  4LIU A;  3ABK H;  1GLN A;  4RAY A;  5E17 F;  4J19 A;  2OTL I;  1SC7 A;  1O57 A;  2GXG A;  2EA2 A;  3CF2 A;  3CP2 A;  5AIP A;  1ENH A;  3VOD A;  4HNT A;  3GME A;  2DMQ A;  4HSR A;  4AYB A;  4RAG A;  2CRG A;  1R58 A;  3ZQC A;  4OMY A;  3BZK A;  3K1N A;  5EG0 A;  1JGG A;  2ZXW H;  2W1O A;  4J01 A;  2NXN B;  3MZ8 A;  1F9N A;  3MQ0 A;  2VAS A;  1WVR A;  3MEX A;  4N0B A;  1IDY A;  2Z16 A;  4XRS A;  1HDP A;  5H20 A;  1JUS A;  2PEX A;  1ZH5 A;  1U3E M;  2QQA A;  1ZLJ A;  3QU3 A;  3MWM A;  3FM5 A;  1Z6R A;  2DA4 A;  2ME6 A;  4A3K J;  1A6Q A;  2G7H A;  2XB5 A;  1XD7 A;  2FD5 A;  3HRM A;  1ETQ A;  1IW7 F;  4G94 A;  1MDM A;  5F04 A;  1ZHF A;  4XN3 A;  4OIO F;  1HCR A;  3PNT A;  3HTS B;  3ZQI A;  3I53 A;  1Z21 A;  2MAB A;  1FOY A;  3C2G A;  4ZZD A;  2HTJ A;  4DGW B;  4G9Y A;  1TC3 C;  4WK8 F;  3SXY A;  3PFI A;  1K78 A;  4M9S A;  3T1B A;  2N8G A;  1JGS A;  4IVN A;  3GCM A;  3ASN H;  3OYL A;  4EMS A;  2R5Z A;  3HHG A;  1YW8 A;  1VQ9 I;  3HRT A;  2L9V A;  3BLY A;  2G9W A;  3ZMS A;  2GM4 A;  4CHU A;  2W25 A;  3DTI A;  4MHG A;  4S04 A;  4KIS A;  4XK4 A;  4RB1 A;  2YX4 A;  3PL8 A;  2LOO A;  2Z2S B;  1GHC A;  1J75 A;  2MA3 A;  4A3B J;  2JRT A;  5HDK A;  4QIW N;  3S15 J;  2IT0 A;  3CC4 I;  4X1E A;  3ZMZ A;  2MH2 A;  3H5N A;  4R79 A;  4R1H A;  1G3T A;  2HR3 A;  1X58 A;  2FBH A;  3DBH B;  3CCR I;  2Z9O A;  4OIN F;  4AVP A;  4EJT A;  3F6O A;  3I4P A;  3CME I;  1MNM C;  4KIF A;  2NVU B;  1WJA A;  2CQK A;  2MD5 A;  1D0X A;  1W36 D;  1P4X A;  2V7F A;  3PNY A;  2KIU A;  1R49 A;  4M3E A;  2XGE A;  1W5S A;  1C0W A;  2W00 A;  2VOO A;  3LMM A;  3VSL A;  4GFB A;  3G1L A;  2DQL A;  4PJL A;  3ML6 A;  3H0D A;  2H27 A;  3QYF A;  1B72 B;  2KDZ A;  4AVZ A;  1ZAO A;  5TJJ A;  2X85 A;  1AA7 A;  1T39 A;  2IA1 A;  1Z05 A;  3JSP A;  1MBH A;  5BQT A;  3MKY B;  4DYR A;  4KN4 X;  1OCR H;  2FQ3 A;  2QGU A;  1POG A;  2K02 A;  2RNJ A;  1ZGJ A;  4BQQ A;  3KE2 A;  4ZDO A;  2MLK A;  1NHA A;  2HQR A;  1XDS A;  2J5P A;  1T38 A;  1Z1D A;  4NB5 A;  4IRG A;  3UR3 C;  5BOX A;  3H3Z A;  3NQO A;  1T56 A;  2Y30 A;  2Q1Z B;  2ISY A;  2L01 A;  3WG9 A;  4RB3 C;  5DV5 A;  3D0S A;  3TOB A;  1R1T A;  2ISZ A;  4NUB A;  3W6J B;  4I6Z A;  1ZR2 A;  1FBU A;  5DCF A;  3PIO F;  5HS9 A;  5LBQ A;  3I55 I;  1RKW A;  2R92 J;  4HDU A;  1ZGW A;  1RUN A;  2DYS H;  3TP0 A;  3A0B C;  1TT5 B;  4HA8 A;  4G6T B;  3TBI A;  2HOS A;  3K2A A;  1X1P A;  5D4S A;  4DJA A;  5E18 F;  3KP6 A;  3KP7 A;  2HFH A;  3ZQH A;  5DS9 A;  2DFE A;  3IH4 A;  3CP8 A;  5A2Q K;  3OS0 A;  3FMR A;  4F55 A;  4Z6Y A;  4KT5 C;  2OUM A;  4IO9 F;  1IN8 A;  3BRO A;  4NC7 A;  2FQ4 A;  3K4M A;  2QBY A;  1N75 A;  2PFB A;  1E0E A;  2LBF A;  1U6G A;  2A69 F;  3JR9 A;  2EIM H;  3HL2 A;  1T6S A;  2CV0 A;  1U5T A;  2KQR A;  4MQ9 F;  1YG2 A;  4LGW A;  1A5J A;  3P5J A;  5TRD A;  3OYD A;  3K6G A;  4I0B A;  3WTW C;  4BS9 A;  2D1H A;  3FHN A;  3FX3 A;  4LLN A;  2HOT A;  4JX4 A;  3ULQ B;  4HNV A;  3HDD A;  3REO A;  3GUD A;  1O4X A;  3L09 A;  1LFB A;  1P4A A;  2GBY A;  1SVL A;  3SEQ A;  1PYV A;  2RC4 A;  2RNG A;  4L0Z B;  3M1C A;  2DTZ A;  2JT1 A;  1IG7 A;  1BIB A;  1X3W B;  4YFN F;  1HF0 A;  4FT8 A;  5B66 C;  2HZT A;  4JK1 X;  3CCU I;  5HLH A;  2HXO A;  3CO7 C;  4OIP F;  3EET A;  2QEN A;  3K10 A;  3KEY A;  3Q3S A;  3HC7 A;  3R0J A;  2HVS A;  4QWQ A;  3RTR A;  3L2U A;  2EFN A;  2DI3 A;  5D6F A;  3CDH A;  3BT9 A;  2ELK A;  2GOM A;  4OAY A;  1KQ8 A;  1L3L A;  3I71 A;  4WCG A;  5HOD A;  3G1O A;  3OL3 A;  5L3E A;  2DFI A;  2E19 A;  4QLC U;  3WOD F;  2CH0 A;  5IP6 A;  1OLT A;  2DYR H;  2PN6 A;  3OR1 C;  2EFP A;  1AKH B;  3VYT B;  2DJI A;  2PI0 A;  1DU0 A;  2COB A;  2Y9Y A;  4CCK A;  1E3H A;  1PJR A;  3AG4 H;  3VDX A;  3GLL A;  1XB4 A;  1ZG5 A;  4CA0 A;  4KJZ A;  1X4P A;  1LE8 A;  1FSH A;  1W0T A;  3D5L A;  4CH7 A;  1HW2 A;  3ISP A;  4A3C J;  3GFI A;  1IRG A;  3Q0V A;  2IS4 A;  5FRN A;  3GYH X;  2QA4 I;  3LWF A;  3MCZ A;  1OYI A;  4I7H A;  1OR7 A;  1QVU A;  2GIZ A;  2MD0 A;  5KAI C;  2A3S A;  2AXL A;  1DGW Y;  3SQN A;  2IJL A;  4AD9 A;  2GQQ A;  3BG5 A;  3L7W A;  5F64 A;  1KQ0 A;  4B47 A;  2OU2 A;  2Z99 A;  1HDD C;  4C2U A;  3V7S A;  1Y0U A;  3RQI A;  3KZY A;  3JRD A;  1MSF C;  2VON A;  1FP1 D;  4HPQ A;  2WTE A;  1F5T A;  2R7X A;  4E7I A;  1MD0 A;  2K3F A;  2YU3 A;  1N77 A;  2L4A A;  2ETH A;  4L5I A;  4O3M A;  2GXB A;  2VXD A;  3LSR A;  3ZQQ A;  4JYK A;  3IAM 2;  4BXF A;  1WSU A;  5AIQ A;  1GT0 C;  4GCV A;  2PJP A;  1OYY A;  4XSX F;  5CLS A;  2HWV A;  3WU0 A;  3V8K A;  3RYP A;  3N4M A;  3HUG A;  1IDZ A;  2KRC A;  2X1C A;  4CUG A;  2AS5 F;  4PK4 A;  4FHT A;  4PGG A;  1VFC A;  1NTC A;  1FY7 A;  2GOX B;  5M5X J;  1TQI A;  2BVM A;  1ETV A;  2H6C A;  2M0C A;  2QYO A;  3W3C A;  3SYT A;  4BAY A;  1X1A A;  1XCB A;  3WU1 B;  4Y15 A;  3FIS A;  2NS0 A;  1G4D A;  2ZNY A;  4FQG A;  1EJ9 A;  3GF2 A;  3CCQ I;  2X51 A;  4LIV A;  5HS7 A;  2V1X A;  4H4K C;  3TO6 A;  4B3A A;  3OYJ A;  1JUP A;  2PMZ A;  3CQZ J;  5HNF A;  2NAZ A;  5LGT A;  1FNN A;  2L02 A;  2LK2 A;  5F27 A;  3F22 A;  3GTQ J;  3CMM A;  3KP2 A;  3FZV A;  1HW1 A;  4LG0 B;  3DCF A;  1MBF A;  1MBE A;  1ZYR F;  4C3I J;  4MEY F;  4RMN A;  1GV2 A;  2RQQ A;  5HNH A;  1USS A;  1ETO A;  2BXY A;  3IUO A;  1NK3 P;  1YQA A;  2P5K A;  5D5U B;  4ZYA A;  3U9G A;  4ENJ A;  1UST A;  2HNH A;  3LFK A;  4HX8 A;  4KN7 X;  2K4B A;  1X1B A;  3DFG A;  2YX7 A;  3B02 A;  3M1E A;  4B4C A;  1ETW A;  4IRH A;  4EVI A;  2CFO A;  2R7D A;  2VKV A;  4AID A;  3AFH A;  1BBY A;  1LVK A;  4I99 C;  2Y9Z A;  3S2D J;  5FLV A;  4CCO A;  4ENK A;  5EJC A;  3VOE A;  4QSH A;  4EJV A;  1FYM A;  2QKM B;  2IS1 A;  4N4O B;  2M7B A;  1SVM A;  4CSW A;  3L2Q A;  3JRG A;  3A0H C;  2R7R A;  2W82 A;  2LRE A;  2NVQ J;  1VTN C;  2JA5 J;  1IN5 A;  3ZGK A;  2A07 F;  9ANT A;  5GP9 A;  3TGN A;  4YIR X;  1CGP A;  1X3U A;  2DLL A;  2A6E F;  2OF7 A;  1RET A;  4EJW A;  2YSR A;  3L2R A;  3K2Z A;  2H94 A;  1B9N A;  1KYW A;  3CLQ A;  5B3S H;  1VQ8 I;  1VQL I;  2DJN A;  2A5W A;  2DAO A;  3RSN A;  4Y13 A;  3CCL I;  2M30 A;  4BJ5 C;  4XLH A;  4EQQ A;  1Z0X A;  1PP7 U;  2HDC A;  2O8K A;  5LGN A;  3G71 I;  2XPW A;  2DPU A;  3VYU B;  4D9J A;  3OSF A;  1IXR C;  3OIQ A;  1D0Z A;  1T0F A;  4A3M J;  4XR6 A;  1T8I A;  2V9V A;  4AM3 A;  1XX5 A;  2D5V A;  2EFQ A;  1BA5 A;  2GWR A;  3B6A A;  1LB2 A;  1SMY F;  1BR2 A;  2D1V A;  5HDG A;  1YIO A;  4CO8 A;  2Y48 A;  2ICW G;  4YFK F;  2MBF A;  2Q8K A;  2H8W A;  4YII A;  3V4G A;  3WTU C;  3JRH A;  3CDL A;  5EDN A;  4YFX F;  4EEF G;  1O3S A;  5IP7 J;  1Y0N A;  3K1M A;  3CMY A;  4FIS A;  2JRM A;  3H0G J;  2JTV A;  1AHD P;  1ZR4 A;  2COM A; 
#chains in the Genus database with same CATH homology
 3LA3 A;  1QPM A;  2QZ8 A;  2K4J A;  2ESH A;  4KMU X;  1FBQ A;  4UHT A;  2O6G E;  3L00 A;  1Z91 A;  4EM0 B;  5F6F A;  4ZYE A;  3ZPL A;  2XAJ A;  4UVA A;  3BJ6 A;  1RZ4 A;  5LLQ A;  5FFZ A;  3V7C A;  5K5Q A;  1B1B A;  3RYR A;  2F5E A;  1YFH A;  1TLH B;  1BI0 A;  3ZN1 A;  3GXO A;  1FC3 A;  1KGS A;  3LAP A;  1KYZ A;  2F5C A;  4HF2 A;  1W4M A;  4BQA A;  2LF8 A;  1SFE A;  2BEO A;  3E97 A;  1V4R A;  3EUH A;  2LNB A;  2LSO A;  1S6L A;  1BC7 C;  4HF0 A;  1U8R A;  1FT9 A;  3K0L A;  2X4H A;  2XAQ A;  4Q5S F;  4HQE A;  1ZRE A;  3F8C A;  2A68 F;  3PQK A;  1W7P D;  1BIA A;  1BN5 A;  5D6E A;  4A5M A;  4M6X A;  1FYL A;  3FWE A;  2X0L A;  2DT5 A;  4PGH A;  3RKY A;  4FX4 A;  2Q2E A;  4A12 A;  3I0T A;  4PZJ A;  1QO0 D;  3RDI A;  4EM1 A;  2ZME A;  5E1Z B;  3TKY A;  1IXC A;  3RI4 A;  3TDU C;  4EJO A;  4NQW A;  3T5X A;  3CUO A;  1MJB A;  2PMU A;  1S7O A;  2XVC A;  3DQV C;  2QUF A;  1U2W A;  2RN7 A;  4DNC A;  2XRO A;  2MH9 A;  2MC3 A;  2NYX A;  1XN7 A;  1ZGA A;  4M72 A;  4DQ2 A;  1H0M A;  2IVM A;  1CF7 A;  2O8X A;  2FEZ A;  1YO5 C;  5BPI A;  2G7U A;  2A6H F;  1TNS A;  3F72 A;  1XSV A;  3FXU A;  1IUY A;  5D5X B;  3ZMV A;  3C7J A;  2JPC A;  2ADU A;  3TO7 A;  1IN7 A;  2EA4 A;  1LJ9 A;  1SD5 A;  3R4K A;  4P5O A;  1XSX A;  2QQ9 A;  2Z33 A;  3J81 Z;  4WXC A;  2XRN A;  2FBI A;  3DP7 A;  4A0Y A;  1D8J A;  4L18 B;  1WQ2 A;  1TQM A;  2DQR A;  2D2W A;  2ZNZ A;  2P6T A;  4ZYH A;  2M45 A;  3ROU A;  3ZN0 A;  3RPU A;  4BYY A;  1PDN C;  4M6Y A;  2W24 A;  1LEA A;  1O7F A;  2QLZ A;  3V8J A;  2IPQ X;  4I98 B;  3GWZ A;  2NRA C;  3DPT A;  3SZP A;  1TW2 A;  1REP C;  3O2P E;  2GAU A;  5J8F A;  3O3K A;  3NRV A;  3I54 A;  3K1P A;  2W57 A;  3CUQ A;  1R1V A;  2HGC A;  2YPR A;  4L9J A;  1L0O C;  1QZY A;  4BXU A;  2DPD A;  1O3T A;  1W7P B;  4U7B A;  3TO9 A;  4M9X A;  2WWY A;  2PLY A;  2FXA A;  3JTH A;  1EH6 A;  4I0A A;  1ONV A;  2M5W A;  1TBX A;  1DPU A;  4RAZ A;  1B4A A;  1ULY A;  1RUO A;  3E5U A;  3BDD A;  1LQ1 A;  2QQB A;  1YS6 A;  2V1D A;  3P9I A;  5FD6 A;  2VBW A;  5LGU A;  2VT3 A;  5D5W B;  1Z9C A;  2WC2 A;  3GLX A;  1YW7 A;  2YR2 A;  4EGZ A;  4MEX F;  3WGI A;  2M87 A;  1KU3 A;  2GA2 A;  5L3D A;  2BBY A;  3MZY A;  1P6R A;  4UNO A;  5FLX K;  3VB2 A;  1FZP B;  4BHC A;  4KIB A;  3I58 A;  3ZP5 A;  1DP7 P;  5ERI A;  3IKV A;  5HLG A;  3DV8 A;  2EJR A;  3F21 A;  4HLX A;  4EV0 A;  1Z6T A;  5JI6 A;  4CDG A;  1Q1H A;  5D8L B;  1D5V A;  4HYE A;  4IPA A;  4HAM A;  2E7X A;  4RGX A;  4UVB A;  1UHM A;  2XIG A;  4PDK A;  4AIK A;  5DCM A;  2QWW A;  5HVQ C;  4G6Q A;  2QVO A;  3JW4 A;  2EK5 A;  3M8F A;  3BY6 A;  4LK0 F;  1JXS A;  4R8H A;  1I27 A;  1MJA A;  1XCV A;  4ON0 A;  4RGS A;  2A61 A;  5L3C A;  3I59 A;  3DPL C;  1EH7 A;  4ZYG A;  1SMT A;  2VE8 A;  4KFC A;  4F7Z A;  5EEH A;  4CXF A;  1V3F A;  3QPH A;  1YW9 A;  1G3Y A;  2HTS A;  2XAF A;  5FFX A;  1AOY A;  1XGM A;  3ERE D;  5FLX Z;  3AAF A;  3CO6 C;  1YS7 A;  4GYG A;  1LDK B;  4O5V A;  1BJA A;  2HOE A;  1LEB A;  6PAX A;  1FPQ A;  1J59 A;  4L0Y B;  3JTG A;  5ICG A;  4IXA A;  5A2Q Z;  2L4M A;  3GZ6 A;  1ZG3 A;  2FF4 A;  1ZRF A;  4XBF A;  4CGZ A;  3JAM K;  2XAG A;  3ABT A;  3F8F A;  2O61 A;  4L9T A;  3GVA A;  1PP8 F;  1H9T A;  1R36 A;  4H0E A;  1XSD A;  1ZLK A;  4K2E A;  1P4W A;  5LHI A;  2PBI A;  3O6B B;  4KIG A;  1LNW A;  1G3S A;  1P2F A;  1BC8 C;  1DDN A;  2CG4 A;  3E5X A;  3EYI A;  1Z7U A;  3F8B A;  1R22 A;  1F1Z A;  2RQP A;  4HV6 A;  4KNY A;  3R60 A;  3L9F A;  5H6Q A;  2LKP A;  5E8G A;  3E3V A;  3EYY A;  5FD5 A;  3GFL A;  2OQR A;  5KK1 A;  3R6S A;  4IF4 A;  1OKR A;  4U0W A;  2Y75 A;  3KFW X;  3F3X A;  1XMA A;  2FA5 A;  1XDU A;  4I2O A;  1U78 A;  2STT A;  2XGX A;  1WWX A;  4XLN F;  3GX4 X;  2EV0 A;  2R7F A;  3JAM Z;  4KIC A;  2RVC A;  5IT9 K;  3G73 A;  4A5N A;  4BNC A;  1LVA A;  3BJO A;  2RDP A;  1JE8 A;  5FO5 A;  4HV5 A;  2JPB A;  5FGM A;  2M1B A;  4WXD A;  5ILS A;  2FE3 A;  1QZZ A;  4ZH4 F;  1FYK A;  3ELK A;  2P7V B;  2LDU A;  4OOI A;  5ICE A;  1TW3 A;  3WTZ A;  5LHG A;  1ZG1 A;  1MDM B;  1O7L A;  3J80 K;  1ZAR A;  5J8C A;  3TQN A;  1WRJ A;  4CIC A;  1B59 A;  3DXJ F;  4FX0 A;  2ZJ2 A;  1K78 B;  5CVU A;  3FMQ A;  1I6X A;  1FX7 A;  2J5O A;  3Q5F A;  5KVR A;  2CFX A;  2PQ8 A;  2OBP A;  4U0V A;  2EB7 A;  3KLO A;  2DK8 A;  1PUE E;  5ILU A;  4Z2Y A;  1FBS A;  1XGO A;  2EWN A;  4MTE A;  2F5F A;  3HHH A;  5LEJ A;  3M8E A;  4UXN A;  2CSO A;  2ZO4 A;  1IZ1 A;  1UB9 A;  2HKO A;  4PCQ A;  3COA C;  2R3S A;  1FWZ A;  5ILV A;  4A6D A;  2NNY A;  5FB2 A;  1J5Y A;  1U5T C;  3C18 A;  5LRS A;  3WTT C;  4RS8 A;  4LD5 A;  1XGN A;  2DTR A;  3J80 Z;  4ENN A;  1E2X A;  4I02 A;  3HRU A;  3VFZ A;  2C6Y A;  2IP2 A;  3BJA A;  5DYM A;  3WTV C;  1HQC A;  2B0L A;  5E20 A;  2CW0 F;  3P7N A;  4G8X A;  3MZH A;  4IHS A;  5L3F A;  4OIQ F;  3MAJ A;  4EJU A;  2KKO A;  3EDP A;  2XAS A;  2P4W A;  5JVT A;  5K5O A;  2QBY B;  1QNT A;  1JHH A;  1XMK A;  4XLP F;  1U5T B;  4E70 A;  4OMZ A;  4UV8 A;  3T0Y A;  4Y17 A;  4KUM A;  4D0P A;  2H09 A;  5IT3 A;  1BM9 A;  3ABU A;  3BWG A;  3KP5 A;  1UFM A;  2LF7 A;  4M9Z A;  4KA4 A;  1R00 A;  3W6K B;  3HRS A;  1I1G A;  3WTS C;  4HBL A;  4WF2 A;  2OD5 A;  2GZW A;  1KA8 A;  4U0Y A;  2BE5 F;  3HSR A;  2Z3Y A;  3IWZ A;  4WWC A;  1G6N A;  5AON A;  3KZZ A;  1EV7 A;  2CWE A;  1OYW A;  4N9H A;  2OAZ A;  4CZZ A;  4Q4Z F;  5L3B A;  3FM3 A;  2VXZ A;  1WI9 A;  3HOS A;  2QM3 A;  3KLN A;  4UVC A;  4MGR A;  2HYG D;  2P5V A;  4M74 A;  3WGH A;  2IW5 A;  2OZ6 A;  3RJP A;  4WX9 A;  5BMZ A;  2BV6 A;  4A2U A;  4IJA A;  5HOO A;  4RGU A;  4LG0 A;  1KU9 A;  2K7L A;  2KRF A;  1EH8 A;  4P55 A;  2D45 A;  1SD4 A;  3FXQ A;  3TOA A;  1DUX C;  5HDN A;  5CVR A;  2E1C A;  4G6D A;  4AWX B;  3DEU A;  3LQQ A;  4RGR A;  3LQR A;  4P9U A;  1ON2 A;  3C3W A;  1AWC A;  3H3U A;  4LB5 A;  1B6A A;  1KU2 A;  3FHZ A;  4GO1 A;  4LFU A;  4G7Z F;  4U88 A;  3Q9V A;  3FF5 A;  4TV7 A;  3H92 A;  4LJZ F;  4KMF A;  4RB2 C;  3M9A A;  1P92 A;  4XRF A;  3E6M A;  2HYF A;  2P5L C;  3BZ6 A;  4GXO A;  3ZMT A;  1WKM A;  3WTX C;  5K1Y A;  2UWM A;  3EQL F;  4A0Z A;  3SHF A;  1ON1 A;  4G7O F;  3JSO A;  2UXN A;  5D8K B;  1S8N A;  3V7R A;  2P8T A;  1F4K A;  3QAH A;  3LA7 A;  1I1S A;  4AIJ A;  3FMS A;  3IWF A;  5H6R A;  4HW0 A;  4AIH A;  5LRR A;  2EV6 A;  2WV0 A;  4HQM A;  1T2K A;  2TDX A;  3GEZ A;  4L9N A;  1J9I A;  3IRR A;  1YYV A;  5DD8 A;  1H9G A;  4G7H F;  1BI2 A;  3KEO A;  1BI3 A;  4CYD A;  2V1U A;  1J7K A;  2OQG A;  2VE9 A;  3KP4 A;  2FRH A;  2L3D A;  3G3Z A;  3HSF A;  4HZF A;  4EGY A;  4ESF A;  4NHJ A;  2OA4 A;  2ACJ A;  2ZCW A;  3ZQ7 A;  1K7A A;  2VOD A;  3TDZ C;  1RNL A;  2M8E A;  1J2X A;  2KJC A;  2XV4 S;  1IRF A;  2FBK A;  3F23 A;  2DU9 A;  2STW A;  2V79 A;  3WGG A;  1UHW A;  1ZN2 A;  1I5Z A;  3CJN A;  2HEO A;  2ZBK A;  1E17 A;  5DEQ A;  1ODD A;  4O6J A;  3KEQ A;  3KP3 A;  2KJB A;  3RPQ A;  2IA2 A;  1DPR A;  3GZ5 A;  1HBX G;  4MQV A;  3KET A;  2KIM A;  4GYI A;  1O3R A;  3QRF F;  4A0X A;  1W5T A;  3Q9S A;  3E6C C;  3ZMD A;  3CLO A;  1TNT A;  1J0R A;  4JQF A;  1YTY A;  1A04 A;  2ZME B;  1HXD A;  3U1D A;  4ESJ A;  4S05 A;  2HKX A;  5E1X A;  1FLI A;  4ZYD A;  5ICC A;  2H6B A;  1R7J A;  2CO5 A;  5K5R A;  4HF1 A;  1QBJ A;  4WXH A;  3F6V A;  4YIF A;  3FXR A;  2DW4 A;  5D4R A;  1TQP A;  1CF7 B;  4JBA A;  4BH9 A;  5LHH A;  1GVJ A;  1SFX A;  4IHT A;  2PMH A;  3B73 A;  2FML A;  4I01 A;  2XKO A;  5DUK A;  4ESB A;  5L3G A;  2UXX A;  5CJ9 A;  3HTU A;  3S2W A;  3GFJ A;  4MNU A;  2E7W A;  2RV8 A;  2Z5U A;  3HSE A;  4ETS A;  1ZRD A;  3DKW A;  3QP6 A;  4UUV A;  2ZXJ A;  5CVI A;  4HX7 A;  4BHB A;  2FU4 A;  3HOT A;  2VT2 A;  1STZ A;  1IAW A;  3P9K A;  1MGT A;  3OOP A;  4KDP A;  4YG2 F;  5CVV A;  3CUQ C;  2IA0 A;  3P9C A;  1S3J A;  4Q48 A;  3SZT A;  4RB0 A;  4N9I A;  2CYY A;  2FOK A;  3IC7 A;  3LST A;  2XUB A;  2JSC A;  3GFM A;  2P7C B;  3HIF A;  3N97 A;  1SD6 A;  3HYI A;  1W7P A;  5LEK A;  3K69 A;  3I5U A;  2DK5 A;  2O3F A;  4HX4 A;  1IN4 A;  5J6X A;  1SD7 A;  3IHU A;  1HW5 A;  3WE2 A;  2XKP A;  2VN2 A;  2MLG A;  3WE3 A;  3T8T A;  4HLY A;  4M73 A;  3QPT A;  4BHP A;  2BGC A;  4ENM A;  4KYW A;  1D8K A;  3CUQ B;  1SFU A;  1R5H A;  2OZU A;  2ZKZ A;  3I64 A;  1O3Q A;  1HKQ A;  1K79 A;  2L54 A;  2Q0O A;  3ECH A;  4LLG F;  5CYV A;  2FSW A;  1BOA A;  4MTD A;  2FMY A;  3ECO A;  3RIR A;  1HKS A;  3ZMU A;  4M71 A;  5EEG A;  1QGP A;  2O0Y A;  4ASN A;  4LB6 B;  1R1U A;  1FSE A;  1GXQ A;  1LDJ A;  2W85 A;  3QOP A;  5DUI A;  1IF1 A;  4HDV A;  4IRI A;  3BPX A;  2GIV A;  2IRF G;  5BS6 A;  3BP8 A;  1LDD A;  5IT9 Z;  4L5J A;  4OIR F;  1MJ9 A;  2VBZ A;  5HS8 A;  2ELH A;  2RGV A;  1B9M A;  4XSZ F;  3J7A O;  2UZK A;  4B8X A;  1MZB A;  2JZY A;  2FNA A;  5F1R A;  5ED4 A;  2EFW A;  4LMY A;  2K86 A;  4A6E A;  2DO7 A;  3U2R A;  2KIF A;  3V8L A;  1QQI A;  1IN6 A;  2HS5 A;  2F2E A;  2F5D A;  3F8N A;  5E8I A;  3CTA A;  3VEP A;  3LA2 A;  5JHU A;  3K9T A;  2XHK A;  2VC0 A;  1MKM A;  5ICF A;  1SAX A;  3WTY C;  3GW2 A;  3R61 A;  3DF8 A;  3F8M A;  5E1W A;  5D5V B;  4LK1 F;  4GGG A;  5CVJ A;  1TTY A;  3KCC A;  1KQ9 A;  3BPV A;  1FP2 A;  3T8R A;  5JR3 A;  3J81 K;  4EM2 A;  1RI7 A;  3QP5 A;  5JFR A;  2DBB A;  2NNN A;  5DCM B;  1FOK A;  3E5Q A;  3SFZ A;  2HQN A;  2ZFW A;  1G3W A;  1OPC A;  1R23 A;  4I09 A;  3L2C A;  1XGS A;  3IL2 A;  3NEU A;  1UCR A;  4U7D A;  1KU7 A;  3I59 B;  1BI1 A;  3QU6 A;  1IXS B;  3RKX A;  1YLF A;  3PQJ A;  3E6B A;  2ESN A;  2EV5 A;  2PG4 A;  5HLI A;  2BYV E;  4Q47 A;  2K27 A;  4OU0 A;  2FNP A;  3OV8 A;  2RKH A;  3IRQ A;  1K6O A;  1RIO H;  2A5Y B;  4B09 A;  5DDG A;  4HOB A;  1HKT A;  2P6S A;  3R0A A;  2VBY A;  4LLL A;  1S7A A;  2E1N A;  1HSJ A;  2VBX A;  3E6D A;  2EFO A;  2COM A;  5DD4 A;  1R5G A;  1HST A;  3LAJ A;  2VC1 A;  2Y0M A;  4UV9 A;  1ZRC A;  1D3Y A;  2GA1 A;  3MFK A;  1S29 A;  3C1D A;  1GXP A;  3RKW A;  1JHF A;  1T98 A;  3M7G A;  5BPD A;  4P9F A;  2O03 A;  3BOQ A;  2CGP A;  2V6C A;  2XAH A;  4P96 A;  2VOP A;  3GO5 A;  2W84 A;  4L9V A;  1OMI A;  4ZZL A;  3IKT A;  4RAY A;  5E17 F;  1O57 A;  2GXG A;  2EA2 A;  5AIP A;  3VOD A;  1R58 A;  4OMY A;  3K1N A;  1F9N A;  3MQ0 A;  3MEX A;  4N0B A;  5H20 A;  2PEX A;  1ZH5 A;  1U3E M;  2QQA A;  1ZLJ A;  3QU3 A;  3MWM A;  3FM5 A;  1Z6R A;  2G7H A;  1XD7 A;  3HRM A;  1IW7 F;  4G94 A;  1MDM A;  4OIO F;  1ZHF A;  3HTS B;  3I53 A;  4ZZD A;  2HTJ A;  4G9Y A;  4WK8 F;  3SXY A;  3PFI A;  1K78 A;  4M9S A;  3T1B A;  1JGS A;  4IVN A;  4EMS A;  3HHG A;  1YW8 A;  3HRT A;  2G9W A;  3ZMS A;  4CHU A;  2W25 A;  4S04 A;  4MHG A;  4RB1 A;  2YX4 A;  1GHC A;  1J75 A;  2MA3 A;  2JRT A;  5HDK A;  2IT0 A;  3ZMZ A;  2MH2 A;  4R79 A;  4R1H A;  1G3T A;  2HR3 A;  2FBH A;  2Z9O A;  4OIN F;  4AVP A;  4EJT A;  3F6O A;  3I4P A;  4KIF A;  2CQK A;  2MD5 A;  1P4X A;  2KIU A;  1W5S A;  1C0W A;  2VOO A;  2DQL A;  3ML6 A;  2H27 A;  1ZAO A;  5TJJ A;  1T39 A;  2IA1 A;  1Z05 A;  3JSP A;  5BQT A;  4KN4 X;  2FQ3 A;  2K02 A;  2RNJ A;  1ZGJ A;  3KE2 A;  2MLK A;  1NHA A;  2HQR A;  1XDS A;  2J5P A;  1T38 A;  1Z1D A;  4NB5 A;  4IRG A;  5BOX A;  3H3Z A;  3NQO A;  2ISY A;  2L01 A;  3WG9 A;  4RB3 C;  5DV5 A;  3D0S A;  3TOB A;  1R1T A;  2ISZ A;  3W6J B;  1FBU A;  5DCF A;  5HS9 A;  5LBQ A;  4HDU A;  1RUN A;  4HA8 A;  5D4S A;  5E18 F;  3KP6 A;  3KP7 A;  2HFH A;  5A2Q K;  3FMR A;  4KT5 C;  1IN8 A;  3BRO A;  2QBY A;  2PFB A;  1U6G A;  2A69 F;  1T6S A;  1U5T A;  4MQ9 F;  1YG2 A;  4LGW A;  5TRD A;  4I0B A;  3WTW C;  2D1H A;  3FX3 A;  4LLN A;  3ULQ B;  3REO A;  3GUD A;  3L09 A;  1P4A A;  4L0Z B;  2RC4 A;  2JT1 A;  1BIB A;  4YFN F;  4FT8 A;  2HZT A;  4JK1 X;  5HLH A;  3CO7 C;  4OIP F;  3EET A;  2QEN A;  3R0J A;  4QWQ A;  3RTR A;  2EFN A;  2DI3 A;  5D6F A;  3CDH A;  1KQ8 A;  1L3L A;  3I71 A;  4WCG A;  5L3E A;  2DFI A;  4QLC U;  3WOD F;  2PN6 A;  2EFP A;  2PI0 A;  1XB4 A;  1ZG5 A;  1FSH A;  3D5L A;  1HW2 A;  3ISP A;  3GFI A;  1IRG A;  3GYH X;  3LWF A;  3MCZ A;  1OYI A;  4I7H A;  1OR7 A;  2A3S A;  2AXL A;  3SQN A;  2IJL A;  4AD9 A;  2GQQ A;  3L7W A;  5F64 A;  1KQ0 A;  2OU2 A;  2Z99 A;  3V7S A;  1Y0U A;  3KZY A;  2VON A;  1FP1 D;  2WTE A;  1F5T A;  1MD0 A;  2YU3 A;  2L4A A;  2ETH A;  4L5I A;  4O3M A;  2GXB A;  1WSU A;  5AIQ A;  4GCV A;  2PJP A;  1OYY A;  4XSX F;  5CLS A;  2HWV A;  3WU0 A;  3V8K A;  3RYP A;  3N4M A;  3HUG A;  2AS5 F;  4FHT A;  4PGG A;  1FY7 A;  1TQI A;  2H6C A;  2QYO A;  4BAY A;  3WU1 B;  1XCB A;  4Y15 A;  2NS0 A;  1G4D A;  2ZNY A;  3GF2 A;  5HS7 A;  2V1X A;  3TO6 A;  2NAZ A;  5LGT A;  1FNN A;  2L02 A;  3F22 A;  3KP2 A;  3FZV A;  1HW1 A;  4LG0 B;  1ZYR F;  4MEY F;  1USS A;  1YQA A;  2P5K A;  5D5U B;  3U9G A;  4ENJ A;  1UST A;  3LFK A;  4HX8 A;  4KN7 X;  2K4B A;  3DFG A;  2YX7 A;  3B02 A;  3M1E A;  4IRH A;  4EVI A;  2R7D A;  1BBY A;  4ENK A;  3VOE A;  1FYM A;  1VTN C;  1IN5 A;  2A07 F;  3TGN A;  1CGP A;  1X3U A;  2DLL A;  2A6E F;  4EJW A;  2YSR A;  3K2Z A;  2H94 A;  1B9N A;  1KYW A;  2DAO A;  4Y13 A;  2M30 A;  4EQQ A;  2HDC A;  1PP7 U;  5LGN A;  2DPU A;  1IXR C;  1T0F A;  2V9V A;  2EFQ A;  2GWR A;  1LB2 A;  1SMY F;  2D1V A;  5HDG A;  4CO8 A;  1YIO A;  2Y48 A;  4YFK F;  2MBF A;  2Q8K A;  4YII A;  3V4G A;  3WTU C;  4YFX F;  1O3S A;  3K1M A;  2JTV A;  4EJV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...