3ULQB

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
VLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/transcription activator
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ulqB00
4HX7A 2E1CA 1LNWA 3DFGA 5F1RA 1SMYF 3GXOA 2OA4A 1SMTA 3R6SA 4WF2A 2CYYA 4HDVA 4IRHA 3D5LA 1FC3A 1P2FA 2Z5UA 1HSJA 2Q2EA 1HW1A 5BMZA 3ZMTA 1LEBA 2F5EA 5IT9Z 2PQ8A 2PEXA 3L00A 4HF0A 2EB7A 4ESJA 3FM5A 2RVCA 4R79A 3I0TA 4A6DA 1IRGA 4OIQF 4XSXF 3HYIA 3HSFA 2K27A 1TTYA 4LB6B 1G4DA 3M9AA 2KIUA 2RKHA 4IVNA 3V7RA 2OQGA 5E8IA 3PQJA 4AIHA 1U2WA 3J80K 5K5OA 2Q8KA 3F8NA 3QP5A 1R23A 1CGPA 1D8KA 1DPRA 1FZPB 3LAPA 3I58A 2EFPA 3WU0A 2M87A 3FZVA 3EUHA 3BZ6A 1K79A 5ICEA 3DQVC 2O03A 1C0WA 2HTJA 1HW5A 4EJTA 4L18B 4UXNA 3WTWC 3J7AO 5CVVA 1YW7A 4NQWA 2R7FA 2IW5A 2DK5A 4P55A 1LQ1A 1K6OA 1FSHA 5D4RA 2B0LA 4IHSA 1F4KA 5K5QA 5D5XB 5E17F 1BI2A 1XSXA 2YX7A 2MC3A 5ILUA 3LA2A 1H9TA 2VONA 1WWXA 3U1DA 3KP5A 1UHMA 3O2PE 5ICFA 5BQTA 3IRQA 2P5KA 3ERED 1YW9A 4M72A 3GUDA 1B9NA 5IT3A 4I0BA 5DD4A 4A0YA 1S29A 5HLGA 1ZLKA 2X4HA 2QBYB 5HLIA 2GZWA 5LHGA 2FMLA 1XD7A 1J9IA 4M73A 3TO7A 3WTXC 5E20A 4HLXA 2Z9OA 2V9VA 1KU7A 1STZA 2DT5A 1XB4A 3GX4X 1JE8A 1FBSA 2O3FA 3NRVA 4YFKF 4EGZA 4BHCA 2L4AA 1U5TB 2HQNA 4BQAA 5ILVA 1MDMB 2A68F 5D8LB 2EA4A 4OIOF 4PZJA 2JSCA 4LK1F 4UV9A 2HKOA 2EFNA 4PDKA 4HX4A 3ZMVA 3N4MA 3WU1B 2GQQA 3HRTA 4L9NA 2ZFWA 3KZZA 2V1DA 1FYLA 3WTTC 3I59B 3ABTA 2QBYA 4Y13A 3KETA 4CDGA 3H3ZA 3O6BB 4JQFA 1ZRFA 1R1TA 5E1ZB 4DNCA 2UWMA 1BC8C 4R8HA 3WTZA 1MZBA 1USSA 1XSDA 1XGOA 1SD6A 2CWEA 1USTA 3EYYA 1BIAA 5HOOA 1MDMA 5A2QZ 1R5HA 5E1WA 4UVCA 2A61A 2VC0A 5FO5A 3HIFA 2E7XA 4O3MA 2D2WA 2CGPA 3KP3A 2RNJA 3WGHA 1D5VA 5DCMB 1KGSA 2OAZA 2AS5F 4G9YA 1XDUA 2Y48A 2J5OA 4L9VA 3VODA 4HV5A 3KLOA 5DUKA 2LF8A 2XAFA 1TNTA 4I01A 4OINF 4GYIA 5L3CA 1FSEA 3VB2A 2EFQA 5JVTA 4EJUA 3L9FA 2CO5A 2TDXA 3BWGA 3GF2A 4G94A 3ML6A 4RAYA 4LLLA 5EEHA 2DLLA 3C1DA 2L54A 2R3SA 1XMAA 2FBIA 4CHUA 4M6YA 1OKRA 3M8FA 1FP1D 1KU3A 3DV8A 2P6TA 3RKYA 5LHHA 2E7WA 4RB0A 5K5RA 1FLIA 5DCMA 3JSOA 4ENNA 1B1BA 3BJ6A 2IA0A 2R7DA 1REPC 1IXRC 2HR3A 4EVIA 4BHPA 5ERIA 1ULYA 4LK0F 4AIJA 3E6MA 3H3UA 3F23A 4KN7X 1ZG5A 3ZMSA 3IKVA 2H27A 2F2EA 2PJPA 3FXRA 4AD9A 1KYWA 1Z91A 4M71A 4ZYDA 3TDUC 1KQ8A 4KA4A 1CF7B 2VE9A 5LHIA 3I54A 1BI0A 5HDKA 1TLHB 1W7PD 4UNOA 1Z6RA 3I53A 2OZ6A 1IAWA 1MGTA 2HQRA 3QPTA 4BHBA 4O5VA 1TNSA 1FPQA 1AWCA 1W4MA 2JTVA 2FRHA 1IN4A 4LJZF 5HS8A 1EH8A 4GYGA 1R58A 2CFXA 2PMUA 4I98B 2ESNA 2HFHA 2L3DA 3HTSB 3KP2A 1F9NA 2KIFA 1TQIA 2GXBA 1YYVA 2P7CB 3GO5A 1FBQA 1YS7A 2FMYA 5LGTA 5HVQC 4BAYA 5LRSA 3MAJA 4RB1A 1OPCA 1CF7A 2NNNA 3REOA 1Z05A 1V3FA 4ENJA 1B9MA 1WRJA 4OMYA 2PBIA 3KP6A 2D1VA 3WGGA 4A5NA 1BOAA 5DD8A 4LD5A 3RYPA 2VOOA 3RJPA 1I27A 4NHJA 5E1XA 1G3SA 2NYXA 2F5DA 1HQCA 4L9JA 4HF1A 2FQ3A 1ZH5A 1FT9A 4A0ZA 3F3XA 4G8XA 3QOPA 4RB2C 4L0YB 3T5XA 2UXXA 4YIFA 1FNNA 2HKXA 1NHAA 2HOEA 4ESBA 4BXUA 1ZRDA 4R1HA 4RGSA 3ZP5A 2MLKA 4IPAA 2H09A 1FWZA 2P8TA 1J5YA 3BPVA 5E18F 4HOBA 2E1NA 5DCFA 4XLPF 1FYKA 1JGSA 3BPXA 5L3EA 3DPLC 2EJRA 4ZH4F 2LSOA 5CVUA 4G7ZF 3ZMDA 3GYHX 5LGUA 5FFXA 3LQRA 2G7HA 5FLXK 2EFWA 3ELKA 3ROUA 1R1UA 2HDCA 3GFJA 1MD0A 1ON1A 2RN7A 3CUQB 3HUGA 2W24A 2FU4A 2MBFA 3TGNA 3BOQA 2QQAA 4D0PA 5DEQA 3RPQA 1J2XA 4FX0A 5FFZA 4PCQA 3IKTA 1QBJA 1ZGJA 4WX9A 1UFMA 2XV4S 2JT1A 2EV0A 3J80Z 1ZARA 2A3SA 1HW2A 2VBZA 4N9IA 2FEZA 4I0AA 1HBXG 2GA1A 5KVRA 2EV6A 2MLGA 1P4XA 4U88A 2O0YA 4GCVA 2P6SA 1IXCA 1HKSA 5DDGA 1OR7A 3HHGA 4OOIA 3CLOA 4P9UA 3RIRA 2GWRA 5CVJA 2FNAA 4MNUA 4JK1X 1E17A 2MD5A 3CO7C 2PI0A 3GFMA 3CUQA 1DDNA 4HBLA 1XGMA 3MZYA 3QP6A 1T39A 1IRFA 2BE5F 4XLNF 2P7VB 1ZN2A 3WTSC 1OYIA 2DAOA 5D6FA 1K78B 4OIRF 1U5TC 4CXFA 1U6GA 3SFZA 1OYYA 4OU0A 2DO7A 3DF8A 3JSPA 3WTUC 2RDPA 2L4MA 2XUBA 2Y0MA 3DKWA 4IXAA 3P9KA 1XGNA 1XDSA 2K02A 4AWXB 4MQVA 1R00A 3E6DA 3HSEA 2QQBA 1HSTA 1S8NA 3FHZA 3FXUA 4FT8A 4HA8A 1YFHA 4MTEA 3RI4A 3ECOA 2D45A 2LKPA 1O7FA 3HRMA 4MEYF 4Q4ZF 4IHTA 4UUVA 2HYFA 1PP8F 2IA2A 4UVBA 3MQ0A 2FA5A 3T1BA 3K2ZA 5J8CA 1EH6A 1Z7UA 5JI6A 4RGUA 4IRIA 2FBHA 4RAZA 5E8GA 1L3LA 4KMUX 3NEUA 3VOEA 3KLNA 4ESFA 2FE3A 2YPRA 2W25A 2ZMEB 3ZN1A 3L2CA 3LAJA 3Q9SA 4B8XA 2XAJA 5LEJA 1ZG3A 4PGGA 1B59A 1TW2A 4EQQA 1JXSA 2IP2A 5CJ9A 4A5MA 3V8KA 2FSWA 5BS6A 2FF4A 4ZYGA 1F5TA 2WV0A 2VE8A 2XVCA 1SD5A 3ZQ7A 5FD5A 4XSZF 5D8KB 4UHTA 1D3YA 3ECHA 3QAHA 3KP4A 1LB2A 1SFUA 5CYVA 3JAMZ 2GA2A 1BN5A 4WXHA 2STWA 3KFWX 4LG0B 3JW4A 1RUNA 1ZYRF 3MFKA 1LJ9A 1WKMA 5L3FA 3F21A 1QZYA 1J75A 4CGZA 1HKTA 2Q0OA 3KP7A 1LDJA 4LMYA 1EH7A 3SQNA 1O7LA 3FF5A 4HQMA 1Q1HA 4JBAA 4LFUA 1TQMA 2HS5A 4EM2A 1SFEA 2NNYA 5LEKA 1YLFA 2F5CA 4G6QA 1U5TA 3FX3A 2HZTA 2WC2A 2W57A 2KJCA 2BBYA 3JTHA 3HTUA 2ETHA 1UB9A 2LF7A 2DU9A 4Q47A 2BYVE 1U8RA 2MH2A 3C18A 3EDPA 5AIQA 5ICCA 3LA3A 4Q5SF 1VTNC 3SZTA 4QLCU 1PDNC 2CG4A 4A2UA 1DPUA 1ZGAA 2HEOA 4I2OA 1K7AA 3EQLF 2KIMA 4LG0A 1ZLJA 3I59A 4GGGA 2V1UA 3E5XA 4CO8A 4MEXF 3AAFA 2UZKA 1ZREA 1FBUA 2L02A 3S2WA 3OOPA 1Y0UA 3COAC 1RUOA 4MTDA 2QVOA 3MWMA 4HV6A 1J7KA 1IZ1A 4IF4A 3WG9A 2XAQA 1T2KA 3L7WA 3P9IA 2P5VA 1YG2A 1S7OA 2VXZA 4YFXF 4P5OA 1KU2A 3QPHA 5AONA 4ASNA 4WCGA 1LDKB 1QQIA 2D1HA 1RIOH 2VBXA 4O6JA 1TQPA 1BI3A 2ISYA 1XN7A 3KEOA 5F6FA 4G7OF 5ICGA 1R22A 3G3ZA 3ABUA 5JR3A 2OD5A 2XRNA 5JFRA 4EJVA 1BJAA 1KYZA 3CO6C 2UXNA 2EA2A 2ELHA 2K4BA 1XSVA 4MQ9F 1O57A 1SD7A 4RB3C 5D5WB 2Y75A 1YTYA 4A0XA 2XKOA 3O3KA 1BI1A 3BP8A 3RKWA 2QWWA 4ZZDA 3KZYA 3E6CC 3GZ6A 4KFCA 1Z9CA 1YS6A 4HYEA 1S6LA 2XASA 2DQRA 1J59A 4BNCA 4OIPF 4A12A 3M7GA 2COMA 1MJAA 1MJ9A 5CVRA 2W84A 1XCVA 4AVPA 1IN5A 5D6EA 2FXAA 5HDGA 2YU3A 3F72A 2ESHA 5J8FA 3F6VA 3R61A 4HF2A 3GFIA 3BJOA 3VFZA 3TO9A 2WWYA 5HLHA 4CICA 1RZ4A 2X0LA 2BGCA 5HS7A 1BM9A 1R5GA 4CZZA 4PGHA 4ETSA 4M6XA 2IRFG 4KIBA 2RV8A 2OBPA 4LGWA 1W7PB 2XKPA 2RQPA 3J81K 4WXCA 3LQQA 1RNLA 4LB5A 1I5ZA 1P6RA 1GXQA 4CYDA 5EEGA 2CQKA 3IC7A 1MKMA 2DFIA 3CUQC 5CVIA 3SZPA 1ZG1A 2JPBA 1T6SA 3R0AA 4HDUA 5H6RA 2G9WA 1B6AA 1S7AA 2XROA 4HAMA 2ZCWA 2Z33A 3BJAA 3LA7A 3H92A 5FLXZ 2K7LA 2VBYA 2ACJA 1WSUA 1QO0D 2WTEA 2VT3A 4EJOA 3V7SA 1FYMA 3HSRA 4Y15A 5LGNA 3RKXA 3IWFA 2DPDA 5FB2A 1W7PA 4M9ZA 4UV8A 5CLSA 4EJWA 2NRAC 2O61A 2YX4A 5TRDA 2VBWA 3ZMZA 3HRUA 1R7JA 5J6XA 1GHCA 3U9GA 1OYWA 1IXSB 1B4AA 1ONVA 2HTSA 2CSOA 4K2EA 4YIIA 2P4WA 1O3RA 1YW8A 1G3TA 2A5YB 3C3WA 1P4AA 2DQLA 3W6JB 1LDDA 2FOKA 2Z99A 1I1SA 3B02A 3HHHA 4P96A 1ON2A 4BH9A 4M9SA 1WI9A 3LWFA 3IL2A 4U7BA 3BDDA 1BBYA 1GVJA 5AIPA 3K69A 3MCZA 3RTRA 3BY6A 2P5LC 2J5PA 3ZMUA 3CJNA 2IJLA 3GVAA 2ISZA 1BC7C 2EV5A 4KN4X 5D5UB 1FY7A 2RGVA 4LLNA 2VT2A 3P7NA 3V4GA 3GLXA 2DTRA 4Y17A 4UVAA 1DUXC 2M1BA 3QRFF 4XRFA 1HKQA 3E5QA 4ZYEA 3U2RA 2QUFA 3E6BA 4N0BA 3M1EA 1EV7A 5H6QA 4KT5C 1KA8A 1F1ZA 5FGMA 3FM3A 2DK8A 2PG4A 3ZN0A 4ENMA 2W85A 4QWQA 4ZZLA 2BV6A 1J0RA 1A04A 1Z6TA 1SFXA 3MEXA 3N97A 2G7UA 3DP7A 5IT9K 4MGRA 1L0OC 2ZO4A 3QU3A 4HZFA 1S3JA 3F8FA 1XMKA 4RGXA 3PQKA 5KK1A 1IW7F 1SAXA 3W6KB 3LFKA 2A07F 1YO5C 2XIGA 5LRRA 4G7HF 1QZZA 3LSTA 3TOAA 3OV8A 2EFOA 2GIVA 2ZJ2A 2QM3A 4U7DA 1HXDA 3K0LA 4KMFA 3KCCA 1QNTA 1WQ2A 2NS0A 5FD6A 3L09A 2DI3A 4U0VA 2VOPA 3I64A 3F8CA 5BOXA 2QQ9A 3Q9VA 1W5TA 1P92A 2AXLA 3K1NA 4ON0A 3K1PA 1R1VA 3R4KA 2LNBA 3RYRA 3E3VA 1K78A 2M8EA 1QPMA 3ISPA 2FNPA 2ZNYA 4L0ZB 4P9FA 1FP2A 2DW4A 4IJAA 2K86A 2ZXJA 4KIFA 1T38A 1O3SA 3B73A 3WTVC 3CUOA 2EWNA 4WXDA 4ZYHA 2ZBKA 3ULQB 1BIBA 2OZUA 2Z3YA 2FBKA 3WGIA 4YFNF 3BROA 3FMRA 2VODA 1KQ9A 2OQRA 3CDHA 3MZHA 2NAZA 2ZKZA 1H0MA 1TW3A 2XAHA 4FHTA 3HOSA 2O8XA 2CW0F 1I6XA 1SD4A 3HOTA 2QZ8A 5L3BA 4IRGA 3I4PA 1Z1DA 2ZMEA 2VC1A 3WE2A 4B09A 3KE2A 4Z2YA 4EM0B 2PMHA 4NB5A 3WTYC 5HS9A 2DBBA 4E70A 3FXQA 4RGRA 3EETA 5D4SA 2V1XA 5K1YA 3K1MA 5HDNA 3JAMK 3FMSA 2GXGA 2H94A 3D0SA 3V8LA 5LLQA 4HW0A 4EMSA 4I09A 3IWZA 2YSRA 3GFLA 4H0EA 2PFBA 2HWVA 1X3UA 2M5WA 4U0YA 1ZRCA 1GXPA 2BEOA 4AIKA 4EM1A 3RDIA 4I02A 2GAUA 4N9HA 2OU2A 2H6BA 1O3QA 3TO6A 3T8TA 1U3EM 2H6CA 2QLZA 6PAXA 2XAGA 3ZPLA 3FWEA 3I5UA 5A2QK 4ENKA 3QU6A 4WWCA 1KU9A 2M45A 3GW2A 1T98A 4M74A 3P9CA 2A6EF 1ZHFA 3CTAA 3F8BA 1YIOA 1R36A 3RPUA 3EYIA 2STTA 2IA1A 2JRTA 1G3YA 4I7HA 1D8JA 1ZAOA 1UHWA 1E2XA 4KYWA 1JHFA 2JZYA 3WODF 1U78A 2C6YA 4KIGA 3E97A 4OMZA 3DPTA 2HYGD 1T0FA 1W5SA 3C7JA 2A69F 3F6OA 2F5FA 3HRSA 3PFIA 4M9XA 3VEPA 2V79A 4EV0A 4YG2F 5H20A 2PLYA 3R0JA 4HLYA 2K4JA 3F22A 3V7CA 4L5IA 4KDPA 4F7ZA 4BYYA 2IVMA 1UCRA 5D5VB 3DEUA 1G3WA 1H9GA 2KJBA 3K9TA 4DQ2A 4A6EA 1G6NA 2M30A 3KEQA 2KKOA 3Q5FA 3J81Z 3I71A 2QENA 2XHKA 2IPQX 2PN6A 1MJBA 4HQEA 4U0WA 4WK8F 5ED4A 3SXYA 1RI7A 4TV7A 5TJJA 5L3GA 4GXOA 2L01A 3TOBA 3IRRA 1IF1A 4L5JA 5BPIA 1V4RA 1QGPA 1IN8A 4KICA 4MHGA 2LDUA 2QYOA 2HGCA 1LEAA 4XBFA 5DV5A 1ODDA 2VN2A 1I1GA 4GO1A 1O3TA 2IT0A 2ZNZA 1XCBA 5F64A 3GEZA 1DP7P 2ADUA 2O6GE 4RS8A 3M8EA 2V6CA 5DUIA 2MA3A 3DXJF 1PUEE 5L3DA 4S04A 3T0YA 4G6DA 1LVAA 1P4WA 5JHUA 4FX4A 5BPDA 1KQ0A 4KUMA 3G73A 5LBQA 2A6HF 1OMIA 4S05A 1IN6A 3WE3A 1PP7U 1JHHA 3IHUA 1TBXA 3SHFA 2EK5A 1AOYA 4HX8A 2DPUA 1YQAA 1IUYA 4L9TA 2XGXA 3R60A 3TQNA 1IN7A 3TDZC 3GZ5A 2YR2A 2RC4A 3E5UA 4Q48A 5ILSA 3GWZA 3JTGA 3FMQA 2KRFA 3NQOA 5DYMA 3TKYA 1FX7A 3F8MA 3T8RA 2JPCA 1FOKA 4LLGF 4KNYA 1XGSA 4EGYA 2MH9A 3V8JA
chains in the Genus database with same CATH superfamily
2L2OA 4HX7A 2OJED 2E1CA 2JVGA 1LNWA 3DFGA 2V9PA 3TBIA 5F1RA 1SMYF 3VSLA 9ANTA 4PSXA 2FJ1A 3GXOA 3GTLJ 2OA4A 1SMTA 1MNDA 1NH3A 2LY9A 3R6SA 4WF2A 2NOGA 2CYYA 2VQCA 1Y39A 1DP3A 4HDVA 2L7ZA 4CSWA 4IHYA 4IRHA 3D5LA 2R4GA 1FC3A 4RDUA 1P2FA 2Z5UA 3W2AA 2K9SA 1HSJA 3MKWB 4G6TB 3A01A 2IBDA 2Q2EA 3CJTB 1YHQI 1HW1A 3F9KA 4UB6C 5BMZA 1YOVB 3F0CA 2LP0A 1V54H 1XG1A 2PMZN 3ZMTA 2V6EA 3ZQHA 1Y8QB 2X51A 1LEBA 2PJRB 4UUSB 5JLXA 2F5EA 4NQWB 5IT9Z 2EZKA 2PQ8A 2PEXA 4HRIA 3L00A 4HF0A 2EB7A 2VXDA 4ESJA 3DTIA 3FM5A 2RVCA 1MMAA 3LSRA 4R79A 2BHYA 1OCCH 2CQXA 4FTHA 3I0TA 4A6DA 5F1JA 2MYSA 3ASNH 1IRGA 4BGDA 4OIQF 4M3GA 4XSXF 2E2HJ 3FDYA 3HYIA 2CQQA 3OYAA 3HSFA 4HSTA 1BR4A 3HPGA 2K27A 2KRCA 1TTYA 1LE8A 3CD6I 4V2FA 4A3BJ 2NVUB 4LB6B 2ME0A 2WAQA 1G4DA 3M9AA 5LFAA 4ITVA 2KIUA 2RKHA 2DCEA 4IVNA 3V7RA 1WJEA 2OQGA 3PQJA 5E8IA 3AKZA 1MBGA 4AIHA 1A31A 1U2WA 1T08B 4Y33A 1Z0XA 2EBIA 5K5OA 2Q8KA 3J80K 3F8NA 5C3EJ 2EPFA 4PJMA 3QP5A 1X1CA 2ZMEC 1MBHA 4DYCA 1R23A 4XK4A 1CGPA 1D8KA 1DPRA 1FZPB 5HODA 3LAPA 3I58A 1WJ5A 1TT5B 2BXZA 2DN0A 2EFPA 4RLQA 3WU0A 1T95A 3BZCA 2M87A 2YS9A 3FZVA 5J40A 3JRCA 3EUHA 5EZGA 5GADJ 3BZ6A 4IHWA 1K61A 2M34A 1K79A 5ICEA 3DQVC 2O03A 1EJ9A 1JT0A 1C0WA 1MBJA 2HTJA 2V4JC 1ENHA 3OYMA 2KHMA 3W2WA 1HW5A 4EJTA 2MGQA 4L18B 1W36C 4UXNA 3WTWC 3PNYA 3J7AO 5CVVA 2EILH 2PJRA 4UUSA 1YW7A 4NQWA 2R7FA 2IW5A 2DK5A 4XL9A 1MMDA 4P55A 1LQ1A 1K6OA 5FKMA 5D4RA 1FSHA 2B0LA 1KZHA 2OUMA 4IHSA 1F4KA 5K5QA 5D5XB 3CLQA 3VYRB 5E17F 1BI2A 1XSXA 2Q1ZB 2YX7A 2MC3A 4XLAA 5C4XJ 1F43A 5ILUA 1TWFJ 3LA2A 1H9TA 2VONA 1WWXA 3U1DA 2WBMA 3KP5A 1UHMA 3O2PE 5ICFA 1LUJB 5BQTA 3IRQA 3HOUJ 2P5KA 2ZSHB 3BLYA 3ERED 1YW9A 4M72A 3GUDA 2CV1A 2K40A 3Q0VA 5E3OA 2X9DA 2FQ4A 4BJ6C 2VLAA 1B9NA 1N77A 2R5YA 5IT3A 3S2HJ 4I0BA 5DD4A 4A0YA 3D1NI 1S29A 5HLGA 1ZLKA 2W48A 2X4HA 5J1RA 2QBYB 3FXLA 1W36D 2KQRA 2GZWA 5HLIA 5LHGA 2FMLA 1XD7A 1YI2I 1VQ7I 1J9IA 2GOMA 4V2GA 2E5NA 4M73A 2VJJA 2CUJA 3TO7A 3S8PA 3WTXC 5E20A 4II3A 4HLXA 3HKZA 2WV1A 2Z9OA 2V9VA 4RM2A 1KU7A 1STZA 2DT5A 1WCMJ 4NC8A 1XB4A 3GX4X 1JE8A 1FBSA 4DYQA 2O3FA 1H89C 3NRVA 1WI3A 3FXOA 4YFKF 3OIOA 5FKNA 4EGZA 1VI0A 4BHCA 3L2UA 2L4AA 1U5TB 2HQNA 4BQAA 5ILVA 3JRDA 1R6RA 3ASOH 3RQ4A 1A35A 2XGDA 1MDMB 1MW7A 2A68F 3S15J 2XC7A 5D8LB 2EA4A 3I4MJ 4RAFA 3CCQI 3CZ6A 4CZCA 4OIOF 4PZJA 2JSCA 4LK1F 4UV9A 2HKOA 2JN6A 2KL4A 1QU3A 1T0FC 4MIMA 2EFNA 1OFCX 4HX4A 1D0ZA 4PDKA 3ZMVA 3OS2A 2IS2A 3M8JA 5EZHA 1YRNA 1ETOA 3N4MA 2E35A 3WU1B 2GQQA 3HRTA 4L9NA 2ZFWA 3KZZA 5K7FA 1PJRA 4PFPA 2V1DA 3MKZA 3C2HA 1FYLA 5EDNA 3K4LA 3WTTC 3I59B 3ABTA 1W0TA 1BJZA 3CDLA 4BU2A 2QBYA 4Y13A 2DT7B 4L5EA 2W7NA 2M8GX 4M3DA 3KETA 1FTTA 5F0CA 3PUBA 5KHDA 2DMTA 2CFOA 1A5JA 3CC2I 4CDGA 3H3ZA 2BY3A 2CS3A 3O6BB 1JT6A 1FMWA 4JQFA 1ZRFA 1R1TA 5E1ZB 5F08A 4DNCA 2UWMA 3JREA 2R7WA 1BC8C 4R8HA 5JVGF 3WTZA 1JKOC 2CW8A 1MZBA 3PUFA 1USSA 1XSDA 1XGOA 1MMNA 4BEHB 4E7ZA 1SD6A 4BQNA 1Y6IA 2CWEA 3PIPF 4B44A 1USTA 3CDIA 3HOVJ 1EF4A 5C44J 2L9VA 4UUTA 3EYYA 1BIAA 5HOOA 1MDMA 4M3FA 3RSNA 4D5CA 5A2QZ 3BG9A 1R5HA 4M6VA 1FIPA 2F48A 3PSFA 5E1WA 4UVCA 2A61A 4QPQA 5IYCJ 3G6EI 2VC0A 5FO5A 3OSGA 1G2HA 3HIFA 2BXYA 1ETXA 2E7XA 4O3MA 1AKHB 5HLTA 2D2WA 1Y1VJ 2CGPA 3KP3A 1ACIA 3QYBA 2OCCH 2RNJA 3WGHA 4D9JA 1D5VA 1MNMC 2CH0A 3MZ8A 1KGSA 5DCMB 2OAZA 4YELA 2AS5F 4G9YA 3CCMI 1XDUA 5JLWA 2Y48A 1POGA 4B47A 2J5OA 4L9VA 1I3AA 3VODA 4HV5A 5HNHA 3KLOA 5DUKA 4J01A 2LY2A 2LF8A 4C3HJ 2XAFA 3MN2A 3AL0B 3ZRGA 2XSDC 1BW6A 1TNTA 2R7OA 2XGEA 3WG7H 2LY1A 4IHXA 2R7ZJ 4I01A 3ZQIA 2Y9ZA 2L9NA 3H0DA 3FXMA 4OINF 4GYIA 5L3CA 5J47A 1FSEA 3OYCA 3VB2A 4DZJA 3LSIA 2EFQA 3OIQA 2R92J 2A05A 5JVTA 4EJUA 1BL0A 2H1KA 3FK6A 1R4MB 3L9FA 4DGWB 2CO5A 2HQ5A 2TDXA 5GTHC 3BWGA 3PL8A 2QKMB 3GF2A 4KT6A 1QVUA 4CCKA 3JCUC 4G94A 3I56I 5IY5H 1I39A 3ML6A 4RAYA 4LLLA 1XX5A 5EEHA 1E3HA 1SFKA 2DLLA 3C1DA 1VFCA 4XKBA 2L54A 2R3SA 3BR6A 1XMAA 2FBIA 3SEQA 3FKIJ 4CHUA 3A03A 4M6YA 1MNEA 4EATA 1OKRA 4CA0A 2L7KA 3M8FA 2EINH 1FP1D 3I9V2 4FASD 1KU3A 3DV8A 1H88C 4HSRA 2P6TA 1VQKI 3RKYA 4LIVA 4A69C 5LHHA 4G12A 3HOZJ 3I55I 2E7WA 2VQLA 4RB0A 3C2GA 5K5RA 1FLIA 5DCMA 2QF7A 3JSOA 4PJLA 2E5ZA 4ENNA 3ONQA 3GTMJ 3BCAA 1B1BA 3BJ6A 2IA0A 2R7DA 5CKTA 4CH7A 1REPC 2R7VA 2IGOA 4ZTJA 4B1RA 3FISA 1IXRC 1X1PA 2HR3A 3W6VA 2F4OB 3VYUB 4EVIA 4BHPA 3CCJI 5ERIA 1ULYA 4LK0F 4AIJA 3J7YJ 3S2DJ 2YUSA 3OYLA 3E6MA 3H3UA 3MVPA 1PUFA 4XIDA 3F23A 1GLNA 4KN7X 1ZG5A 3ZMSA 2MFZA 2Y0SN 5J1UA 1WVRA 1AHDP 3IKVA 2DMPA 3OIPA 4FCYA 2H27A 2F2EA 2PJPA 1HCRA 2R7QA 3FXRA 4AD9A 1KYWA 1Z91A 4M71A 4ZYDA 3TDUC 2VL8A 2O7OA 3IAS2 2BVLA 1KQ8A 4KA4A 4C30A 1CF7B 2Z2SB 1D0YA 2IGMA 1DU6A 2VE9A 4M3BA 5LHIA 2BOLA 3I54A 1Z3YA 1OJLA 1BI0A 1O4XA 1MMSA 3S16J 5HDKA 1TLHB 3I4NJ 3GBGA 1M1EB 1W7PD 4UNOA 2AO9A 1Z6RA 1IV8A 2OZ6A 3I53A 1IAWA 2RREA 1MGTA 4EEFG 2E1OA 2QQ8A 1X1BA 2HQRA 3QPTA 2WB1A 3GLLA 2XRLA 3HBLA 2DXIA 4BHBA 4NC6A 1LFPA 2VQGA 4O5VA 1VNDA 1WH7A 1ERDA 3OY9A 1TNSA 1FPQA 3TMOA 1AWCA 2QSHX 1TWGJ 3RQIA 1WJDA 1P7IA 1W4MA 2LG4A 3SYTA 5M3FJ 2JTVA 2W4SA 2FRHA 1V5EA 1IN4A 4LJZF 1IRZA 5HS8A 3K10A 1EH8A 2ECBA 4GYGA 1R58A 3CMMA 2CFXA 2PMUA 3VSKA 4A3JJ 4I98B 2ESNA 2HFHA 2L3DA 1HDPA 3HTSB 1E3PA 3KP2A 3HPHA 2M4GA 2ID6A 1F9NA 2KIFA 1TQIA 2GXBA 1YYVA 4E6KG 2P7CB 3N05A 2IGNA 3GO5A 2R5ZA 1FBQA 2B7EA 1YS7A 2QCOA 2FMYA 5LGTA 4AYBN 5HVQC 1B8IB 3IH3A 1MBKA 4BAYA 5LRSA 3KYLA 3MAJA 3DBLB 4RB1A 1OPCA 4IOCF 1CF7A 4E7LA 3K70C 2NNNA 3REOA 1Z05A 3CCRI 2QA4I 1V3FA 4ENJA 3FBNB 1B9MA 1W1WE 1WRJA 4OMYA 3UKGA 2PBIA 1WFXA 1IO2A 2WAEA 3KP6A 2D1VA 3WGGA 2OTLI 4BQOA 2I5UA 4A5NA 5IYDJ 1BOAA 5DD8A 4LD5A 3RYPA 2VOOA 2IS4A 3RJPA 2K9MA 1I27A 4BACA 4NHJA 3EUHC 5E1XA 3ABKH 1G3SA 1V5FA 2NYXA 3HUGB 4J00A 5EGOB 1XTAA 3FBIB 2F5DA 1HQCA 4MLOA 2VB6A 4L9JA 1UG0A 2FQ3A 4BJTA 4HF1A 1ZH5A 1FT9A 4A0ZA 3F3XA 2F6CA 3DKYA 4G8XA 3QOPA 4RB2C 1WJCA 3ZQCA 1I3QJ 4L0YB 1WJBA 4XLEA 1K4TA 3T5XA 2UXXA 4YIFA 1FNNA 2HKXA 3ZXSA 4RMNA 1NHAA 2HOEA 4ESBA 1R9TJ 4BXUA 4NC7A 1ZRDA 4B4CA 4R1HA 1SVLA 4RGSA 4JOMA 3ZP5A 2MLKA 4IPAA 2H09A 1ETQA 1FWZA 2P8TA 1U9OA 2A6TA 2LREA 1J5YA 1R71A 3ERMA 3H9QA 3K70D 3BPVA 5E18F 4XKVA 4HOBA 2E1NA 5DCFA 1WZ2A 3BTCA 4XLPF 2CW7A 1FYKA 1JGSA 1T33A 1GT0C 5GPAA 2LFBA 2M7AA 3BPXA 2DOEA 4PJJA 5L3EA 3DPLC 2JA7J 2EJRA 1B8IA 4ZH4F 3K4JA 3H5AA 4H4KC 2BW3A 2LSOA 5CVUA 4G7ZF 3ZMDA 3CP2A 4NUBA 4F91B 3GYHX 5LGUA 5FFXA 1BW5A 3LQRA 3DBHB 2G7HA 5FLXK 2XSJC 1X3WB 1B72A 2CUZA 4HEA2 1PVEA 2EFWA 3ZR8X 3ELKA 3ROUA 3OYDA 3E1SA 1R1UA 2HDCA 2H1LA 3GFJA 2ZC2A 4XN3A 1MMGA 3LNQA 1MD0A 1ON1A 2RN7A 3CUQB 1VQMI 3HUGA 2W24A 3PO3J 5EGOA 1ORKA 2FU4A 2MBFA 3S1NJ 4HNVA 3TGNA 3BOQA 2QQAA 4D0PA 5DEQA 3RPQA 2X1CA 4A3EJ 1J2XA 5J3LA 4DIQA 4FX0A 4C3JJ 2DJNA 5FFZA 1UG2A 2BZTA 2XB5A 1YIJI 1DGWY 4PCQA 4CYCB 3CCLI 3IKTA 4U87A 2B9SA 1QBJA 1ZGJA 3CC4I 2Y2ZA 4WX9A 2CJJA 2I10A 1UFMA 2XV4S 2IXSA 2JT1A 2EV0A 3SFIA 2K9QA 3J80Z 1ZARA 2D5VA 2LRDA 2LMDA 2A3SA 5IOYA 3SDBA 4Y7NJ 4FE7A 5J4VA 3OL4A 2VBZA 1HW2A 4N9IA 2FEZA 4I0AA 1HBXG 1W0UA 4DBRA 2P81A 2GA1A 2LVSA 5KVRA 2EV6A 1P7JA 4X1EA 4GFBA 2MLGA 1P4XA 4U88A 3K7AJ 2O0YA 4GCVA 2NS7A 3EUAA 2R7XA 2P6SA 1LPQA 2VIXA 2MC4A 1IXCA 1HKSA 5B3SH 1VQNI 5DDGA 1OR7A 3A1YA 3HHGA 1FTZA 2M4KA 2W00A 2K9LA 4OOIA 1Z21A 3CLOA 4P9UA 3RIRA 1TT0A 2GWRA 2JUGA 5CVJA 2FNAA 2KFDA 2LH9A 5F04A 3JRAA 3JRGA 1X4OA 4BY7J 5M5XJ 4MNUA 2UV1A 3DTKA 4JK1X 1E0EA 3HXLA 1E17A 2MD5A 4KITB 4BDYA 3BT9A 3CO7C 2PI0A 2IS6A 2R7SA 1TC3C 3GFMA 3CUQA 1DDNA 2DODA 4HBLA 3PSIA 4XRSA 1XGMA 2OF7A 3BCBA 3MZYA 3QP6A 3S93A 1K6YA 1T39A 1IRFA 2BE5F 4XLNF 2P7VB 2LR8A 3WHBA 1ZN2A 3WTSC 2FUG2 1OYIA 4RA2A 2DAOA 5D6FA 5EJCA 5J4YA 3G71I 1K78B 4OIRF 4XICA 1U5TC 4CXFA 1GUUA 3KZIC 4Z6YA 1U6GA 3SFZA 5FJ8J 1JGGA 1OYYA 2HI3A 2M3AA 4OU0A 2DO7A 2E36A 2PMZA 3DF8A 3JSPA 3WTUC 2RDPA 4ZTFA 1HF0A 3DCFA 2L4MA 2XUBA 4DOZA 2Y0MA 3DKWA 5F0FA 3MKLA 3MKYB 2KDZA 2L7MP 4B43A 3CMAI 3HC7A 1D1AA 4DZPA 3IUOA 1SAUA 2M7BA 4IXAA 1EKEA 3P9KA 3IP4B 3OSFA 1XGNA 2HOTA 4XOPA 3CCSI 1XDSA 2K02A 3MD2A 4W97A 4AWXB 3J7ZI 3H35A 1ZGWA 2F5VA 3GMEA 4MQVA 2DYSH 4D7MA 1R00A 3E6DA 4KJZA 2DOAA 1U9NA 3HSEA 2QQBA 1HSTA 5TISC 1S8NA 3GCMA 1SEUA 4BQQA 4Y52J 3FHZA 5HNFA 3FXUA 4FT8A 3H5NA 4HA8A 3DTEA 1YFHA 3BTJA 4MTEA 3RI4A 3ECOA 2D45A 2LKPA 1O7FA 3HRMA 4MEYF 3PM1A 4XOTA 4F3QA 4Q4ZF 4IHTA 2DT6A 4UUVA 3S1RJ 2HYFA 1PP8F 2IA2A 4UVBA 2WADA 4A3IJ 4NBQA 3MQ0A 3A2KA 2E1MC 2FA5A 4IX7A 5IP6A 3SEZA 3T1BA 1SVMA 4FISA 2A5WA 3K2ZA 5J8CA 1EH6A 1Z7UA 2K5CA 5GAHJ 5JI6A 1R4NB 4RGUA 4IRIA 2FBHA 4UY8I 4RAZA 2HYJA 5E8GA 3OYGA 2EIMH 3OYFA 1IV6A 1L3LA 3ZQGA 4KMUX 4AU7A 3NEUA 3VOEA 3KLNA 1JKRC 2JK3A 2FE3A 4ESFA 2ZMEB 2W25A 2YPRA 1D0XA 3O8HA 3ZN1A 3L2CA 3LAJA 2WY8Q 5GAEJ 3Q9SA 3JR9A 4B8XA 2XAJA 5LEJA 1ZG3A 3K4CA 4PGGA 1B59A 1TW2A 4EQQA 1JXSA 2IP2A 5CJ9A 4A5MA 3V8KA 1BA5A 2FSWA 4OAYA 5BS6A 2FF4A 5FKLA 4ZYGA 2WV0A 1F5TA 2VE8A 1V5GA 2XVCA 4QPOA 1SD5A 1I6HJ 1OLTA 3ZQ7A 4XNFA 5FD5A 4XSZF 5D8KB 4UHTA 1D3YA 3ECHA 3QAHA 5EYRA 4E4HA 1IJWC 3KP4A 1LB2A 2O5RA 3FK7A 2QKLB 2O9LA 1SFUA 5CYVA 3JAMZ 5EG0B 2GA2A 1BN5A 3OOUA 3ZCOA 4WXHA 2STWA 3KFWX 4XMYA 3LMMA 3AL0C 2BY0A 4LG0B 3VPRA 2EZIA 3JW4A 1RUNA 1ZYRF 2DJIA 3MFKA 1LJ9A 2JRMA 4XLFA 1WKMA 5L3FA 3ABLH 2VKEA 2R7RA 4XONA 3K4MA 1VQ6I 2E19A 3F21A 4XORA 1QZYA 5FROA 1J75A 3RPUD 4CGZA 4ZC3A 1HKTA 2Q0OA 3KP7A 1UJ8A 5LD2C 1LDJA 4LMYA 1APLC 2HOSA 1EH7A 3SQNA 1A36A 3OR2C 1O7LA 3JRIA 3FF5A 1FOYA 4HQMA 1Q1HA 4JBAA 4LFUA 3S3NA 1TQMA 4QIWN 2F4MB 2HS5A 2L5QA 4EM2A 1SFEA 4KISA 2NNYA 5LEKA 1YLFA 2F5CA 4G6QA 1D1BA 2FD5A 1NG7A 1U5TA 3FX3A 1WGXA 2HZTA 2WC2A 4DYRA 2W57A 1S72I 2KJCA 3Q0WA 2BBYA 4JYKA 4MFDA 3JTHA 3HTUA 4A3DJ 2ETHA 1UB9A 2LF7A 2DU9A 4BS9A 4Q47A 2LLKA 2BYVE 2JMWA 1U8RA 3LSMA 5KAIC 2MH2A 3C18A 3EDPA 5AIQA 5ICCA 2HZDA 1HA8A 3LA3A 3HM5A 1VTNC 4Q5SF 1ETYA 3SZTA 1YITI 3AG3H 2DYRH 4QLCU 3CMYA 4E7JA 3PO2J 1PDNC 2CG4A 4A2UA 1FJLA 2X6YA 5EG0A 1U8BA 1DPUA 4RM3A 1ZGAA 2HEOA 3M1CA 4I2OA 4BE1A 1K7AA 1R49A 3EQLF 1OCPA 2KIMA 3K6GA 4LG0A 3VDXA 2DMNA 2EZLA 3RZOJ 1VQ5I 1OCOH 1ZLJA 3I59A 4GGGA 2IEKA 2V1UA 4A3CJ 3E5XA 4CO8A 4BL0B 4MEXF 5KNLA 3BQYA 1Y0NA 3AAFA 2UZKA 2X6XA 1ZREA 1FBUA 4XRMA 2L02A 3S2WA 4AVZA 5DTDA 4DJAA 1LFBA 5IP7J 2HPIA 3M3YJ 4ZDOA 2DA4A 3OOPA 1LVKA 1Y0UA 4M3EA 3BQZA 4C2UA 3X2QH 3K4BA 2HVRA 2GBYA 4BEHA 4BBSJ 2EH3A 4PK4A 2ID3A 1WJAA 3COAC 2H8RA 1RUOA 2CUEA 1H8AC 4MTDA 3Q3SA 2QVOA 3MWMA 4HV6A 1J7KA 3TL4X 3CF2A 1IZ1A 4IF4A 3WG9A 2XAQA 2DMUA 3CCVI 1MH4A 4OAZA 3S3OA 3W2VA 4IKFA 2L0KA 3FKJA 4CCOA 5IP9J 1T2KA 3L7WA 4V19K 1T56A 1JTYA 4C3IJ 3P9IA 3E0JB 2P5VA 1YG2A 1S7OA 2VXZA 3HDDA 4BUPA 4YFXF 1AKHA 2HNHA 4ZDLA 3SZGA 4P5OA 3AFHA 2ZFUA 2HXOA 2LKXA 1KU2A 3QPHA 5AONA 4ASNA 3BC8A 1ZTRA 3BR5A 2EZHA 4WCGA 4J19A 1LDKB 4IO9F 5TGTA 2DFEA 1QQIA 2D1HA 1RIOH 3HEFA 2VKHA 2LKSA 2L7FP 2VBXA 4O6JA 2QSGX 3S1QJ 1ZKGA 2JQ7A 5B1BH 1TQPA 1BI3A 2ISYA 2M0CA 2MG4A 2V26A 2OC6A 2CV2A 1XN7A 2JA6J 3ABMH 3KEOA 2NVQJ 3S3MA 1SFOJ 4MO7A 5F6FA 4G7OF 3VWBA 2CV0A 1KONA 2XPUA 4QSHA 5ICGA 1R22A 3G3ZA 4IQ4A 1D5YA 3ABUA 2ZSIB 2V9KA 3GTQJ 2XGCA 5JR3A 1MBEA 2NOJB 2OD5A 2XRNA 4YRVA 5JFRA 1VQLI 4EJVA 1BJAA 1KYZA 3HOYJ 1BR2A 3CO6C 1OISA 3KIOA 3J7AY 2UXNA 2EA2A 4PJNA 3HGYA 3HL2A 2ELHA 2K4BA 4F52A 3JRHA 1XSVA 5B66C 2HVQA 2VI6A 4MQ9F 1VQOI 1O57A 1SD7A 3HOXJ 5C4JJ 1HDDC 4RB3C 1RKWA 5D5WB 2Y75A 4D1QA 4A0XA 2M9HA 1YTYA 2XKOA 3O3KA 1BI1A 3KYDB 2HDDA 3BP8A 3RKWA 2QWWA 4ZZDA 3KZYA 1QPIA 3E6CC 3GZ6A 4BBRJ 4KFCA 3MMYB 1Z9CA 1YS6A 4HYEA 1S6LA 2XASA 3L2QA 2XPWA 2DQRA 1J59A 4E7KA 3G1MA 4BNCA 4OIPF 2LK2A 4A12A 3QPSA 3M7GA 2COMA 1MJAA 1MJ9A 5CVRA 2KRHA 2W84A 2E34A 3HGGA 1XCVA 4AVPA 1IN5A 5D6EA 2FXAA 3K2AA 1HLVA 4XM3A 5HDGA 3TW6A 1RC9A 2H8WA 2YU3A 1Z3XA 3F72A 2ESHA 5J8FA 4X6AJ 3F6VA 4PJ0C 3R61A 2RQQA 1K4SA 4HF2A 3GFIA 3BJOA 3VFZA 3TO9A 3HB9A 2WWYA 4E7HA 5HLHA 4CICA 1RZ4A 2VUMJ 2X0LA 4N4OB 2BGCA 5HS7A 1BM9A 1UZCA 2JA5J 2COBA 1R5GA 3LOCA 3QOEA 5FKOA 4PGHA 4CZZA 4II2A 4ETSA 5DS9A 4M6XA 2IRFG 4KIBA 2RV8A 2CMPA 2XF5A 5BNGA 3RZDJ 1GVDA 2OBPA 1OR7C 4XRSG 5KAFC 2NVYJ 4A3LJ 1JKPC 3OYBA 2AQEA 1Q1VA 4NNJA 4W1UA 4JX6A 4ANJA 3FXKA 4LGWA 1W7PB 2Y0SA 3DPUA 3TEDA 2XKPA 5M5WJ 1VQ4I 1GV2A 3BG5A 2RQPA 5K7ZA 3J81K 4ZDPA 1SANA 2KZGA 3LQQA 3LSKA 4WXCA 1RNLA 2JUCA 4LB5A 1I5ZA 1P6RA 3P5JA 1GXQA 4CYDA 5B1AH 5EEGA 1N25A 2CQKA 3IC7A 1MKMA 2AXTC 2DFIA 3CUQC 5CVIA 3SZPA 2YU9J 1NG6A 1ZG1A 2GIZA 2VASA 2JPBA 1TZLA 1T6SA 2HDWA 2OCEA 3QYFA 3R0AA 2VQHA 3OYKA 5M3MJ 4IQJA 1K83J 4IOAF 1XMXA 3BR1A 4HDUA 5H6RA 4AM3A 2XDVA 1SVOA 2G9WA 2E60A 4I99C 4AUXA 1B6AA 1S7AA 3LL7A 1YJ9I 4DBQA 3CCUI 2XROA 4HAMA 2ZCWA 4YIRX 3Q0UA 2Z33A 2EIJH 3BJAA 4D5FA 3LA7A 3H92A 5FLXZ 2Y30A 2K7LA 2VBYA 2NXNB 3KX2A 3BG7A 2ACJA 4A3GJ 1R5ID 2EQRA 3QODA 1S7EA 3TP3A 5KCMA 2HVSA 1IRXA 3NAUA 3A01B 1WSUA 2KT0A 1QHGA 1Z7LA 1QO0D 2Q2EB 2WTEA 2VT3A 3BTLA 4EJOA 3V7SA 1FYMA 4UB8C 3PIOF 1ZELA 3HSRA 2HXIA 4Y15A 5LGNA 3RKXA 3IWFA 3BR2A 3I3LA 3ZQFA 1NK3P 2DPDA 4BJ5C 5FB2A 1UELB 1W7PA 2G0EA 2R93J 4M9ZA 4UV8A 5CLSA 2CRGA 4YEJA 4EJWA 2NRAC 2KMUA 2KPMA 4XLCA 2ICWG 2O61A 2YX4A 5TRDA 2VBWA 5E3MA 4A93J 3ZMZA 4AYBA 3CCEI 3HRUA 5FLMJ 2WAQN 3S17J 2VJ4A 1R7JA 5J6XA 4AC0A 1GHCA 3U9GA 2X1EA 2FOWA 1OYWA 1IXSB 3OYIA 1B4AA 3LSPA 1ONVA 2XAUA 2X85A 2HTSA 1RRJA 1LE8B 2CSOA 4K2EA 1OCTC 2K3PA 4YIIA 1JJ6C 2P4WA 3EPZA 1O3RA 2GOXB 1YW8A 2AHQA 1G3TA 1QRYA 1IDYA 1WH5A 2A5YB 1P4AA 3C3WA 2DQLA 3W6JB 3SDGA 1LDDA 2FOKA 4Y4RA 2Z99A 4E7IA 1I1SA 3B02A 3BR0A 3HHHA 5GTIC 3IH2A 4P96A 1ON2A 1VQPI 3KPHA 2KZVA 2VPLA 4BH9A 4M9SA 3V42A 1WI9A 2EIKH 3LWFA 3IL2A 1JUMA 4U7BA 3BDDA 1BBYA 1X58A 1GVJA 5GP9A 5AIPA 3K69A 1ZR4A 2BHZA 3MCZA 3BY6A 3RTRA 2P5LC 2J5PA 3ZMUA 3CJNA 2IJLA 4HNTA 4XN0A 2ECCA 2XB0X 3GVAA 4IZZA 1T8IA 3S14J 2ISZA 3CJRB 1BC7C 3B6AA 4BE2A 2EV5A 3G4SI 4KN4X 1FY7A 5D5UB 2RGVA 3JRBA 4LLNA 2VT2A 3HOWJ 2DA2A 2FX0A 3P7NA 3G1OA 3GLXA 2DTRA 3V4GA 4Y17A 4UVAA 1DUXC 2M1BA 3KYCB 4XRFA 3QRFF 1HKQA 3E5QA 4ZYEA 2PX9A 4RLFA 1J09A 4IL6C 3U2RA 3W3CA 2QUFA 3E6BA 3H3VK 2QGUA 1RR8C 4N0BA 2KLOA 3M1EA 1EA3A 1EV7A 2KDOA 4KT5C 1KA8A 5H6QA 3OS0A 2DDAA 2MD0A 4Y3OA 1F1ZA 5FGMA 3FM3A 2V7FA 3HG9A 2IS1A 2DK8A 2PG4A 5GAGJ 4B3AA 1I50J 4XKCA 3ZN0A 4C2MJ 4ENMA 5J1YA 3CQZJ 2DA1A 1X19A 2W85A 1X1AA 4QWQA 2M0MA 4ZZLA 2BV6A 1J0RA 2N8GA 1A04A 3ZGKA 4ZJZA 2R5YB 1ZR2A 1Z6TA 1SFXA 1P9QC 1ZK8A 3MEXA 4CYCA 2QEXI 3N97A 2G7UA 3DP7A 5IT9K 1JUPA 1MSEC 4MGRA 2IAIA 4F55A 2LC2A 1L0OC 1MH3A 2ZO4A 3QU3A 3HKZN 3BR3A 1RPWA 4GRIA 3PNTA 1Y56A 4HZFA 2HU9A 1S3JA 3F8FA 4A3FJ 2VJ5A 3PJRA 1XMKA 4RGXA 3PQKA 2E71A 5KK1A 1IW7F 1V55H 1SAXA 3W6KB 3DWLE 2KP6A 2CUFA 2NVXJ 3LFKA 3GTOJ 3JRFA 2A07F 2LBFB 1X2NA 1HOMA 2JVHA 1YO5C 2XIGA 2Z1DA 4PFOA 3L2WA 4QTRA 5LRRA 1BOBA 2ZXHA 4G7HF 2XF6A 3G2BA 1QZZA 4XKWA 3LSTA 3TOAA 2F4IA 3OV8A 2EFOA 2GIVA 3GZNB 3H1CA 2ZJ2A 2QM3A 4U7DA 3QWLA 2HQAA 3L1PA 1LFUP 1HXDA 3K0LA 4KMFA 3KCCA 1QNTA 3ZQLA 1WQ2A 2NS0A 2DA6A 3BTIA 5FD6A 3L09A 1VF9A 2DI3A 2DA7A 2WAFA 5IOZA 4U0VA 1OQYA 3G1LA 3U21A 5DM6F 3I64A 2VOPA 4A3MJ 2KISA 3F8CA 5BOXA 1IC8A 3PNVA 1YRNB 2QQ9A 3Q9VA 2DFFA 1FOXA 3CP8A 1PYVA 1W5TA 1P92A 2O8KA 2AXLA 1RETA 3CC7I 3K1NA 4ON0A 3K1PA 1R1VA 2GXAA 3R4KA 2LNBA 1RESA 1WPKA 2VJIA 3D5SC 3RYRA 3E3VA 1K78A 5FLVA 2P0WA 5B5EC 2JA8J 2M8EA 1IG7A 1QPMA 3ISPA 2UUZA 3D5RC 1QA6A 4PUSA 2FNPA 1N75A 5JHFA 2ZNYA 4L0ZB 4P9FA 1FP2A 2DW4A 4IJAA 3RKQA 2K86A 2ZXJA 4KIFA 2LBFA 1T38A 4JP0A 1VZ0A 1O3SA 3B73A 3WTVC 4CCJA 3CUOA 3UR3C 1ZQ3P 4HPQA 1Y8RB 3OR1C 4MFEA 2EWNA 2Y69H 3WHCA 2XF7A 4HNUA 4WXDA 4ZYHA 1CQTA 2ZBKA 3ULQB 4D7NA 1BIBA 1NK2P 4JX4A 2OZUA 2Z3YA 2FBKA 4YFNF 4E7SA 3WGIA 5E3NA 3BROA 3FMRA 2VPRA 4PSWA 2VODA 1KQ9A 2JWTA 2OQRA 4AIDA 3OMYA 3CDHA 3MZHA 2NAZA 2ZKZA 3A0HC 3LFUA 2ZXIA 1H0MA 2JA2A 1MSFC 1TW3A 3A4CA 1ETWA 2XAHA 4FHTA 3ZOBA 2ELJA 1A6QA 2DMQA 3L2RA 1F36A 3HOSA 2O8XA 1GV5A 3K4KA 2CW0F 3DLLF 1I6XA 1BR1A 4LIUA 1SD4A 3H0GJ 5IYBJ 3HOTA 3QYEA 3LSGA 2M2EA 2ZJPF 3BG6A 3BG3A 2QZ8A 1TWHJ 5L3BA 4IRGA 1WJFA 4IHVA 3VYSB 2QSFX 1RKTA 3I4PA 5F27A 1Z1DA 1IGNA 2ZMEA 2VC1A 3WE2A 5CQGA 4B09A 3KE2A 4Z2YA 5E79C 4EM0B 1MIJA 5DM7F 2PMHA 2R0QC 1NTCA 4BXXJ 1DGRM 1RR7A 3H5RA 2VKVA 2W82A 4NB5A 3WTYC 2E1MB 5HS9A 3M4OJ 2DBBA 1YE9A 4E70A 3OS1A 3NWTA 1OCRH 3FXQA 3CCYA 3EETA 4RGRA 5D4SA 2L9RA 2V1XA 5EEAA 4CCLA 5K1YA 3K1MA 5HDNA 2R7UA 3JAMK 4A3KJ 1TL8A 3FMSA 2GXGA 2H94A 3D0SA 1UMQA 3V8LA 3M07A 2MABA 5LLQA 3GTGJ 1XPXA 3WU2C 4HW0A 5E3LA 1N78A 4EMSA 3AG2H 2GM4A 4JX5A 4GDFA 2ELKA 4I09A 2BY1A 3IWZA 3LSHA 2OPTA 2TRTA 3OYEA 2YSRA 3GFLA 3E7LA 1S5LC 2NS8A 1JI8A 4H0EA 2PFBA 1X3ZB 2HWVA 1X3UA 4HG2A 1VQ9I 2M5WA 4U0YA 1ZRCA 1GXPA 2BEOA 4AIKA 4RAGA 1ETVA 4EM1A 3RDIA 2W1OA 4I02A 4BDZA 1FIAA 2MW8A 2GAUA 3QQAA 2OU2A 4N9HA 2H6BA 1A6IA 1UAAA 2K3FA 5H2FC 2DA5A 3OYNA 1TP4A 3TO6A 3L2VA 1O3QA 3T8TA 1U3EM 1Y1WJ 1YJNI 3H9JA 3H9GA 4LOCA 2H6CA 2LTPA 2QLZA 6PAXA 2XAGA 4BE0A 4S0HB 2TCTA 1PUFB 3ZPLA 3FWEA 3I5UA 2BVMA 1Z77A 5A2QK 3S1MJ 1FOWA 5K7HA 4ENKA 3IAM2 2VKDA 3QU6A 2CQ7A 4WWCA 1KU9A 4I76A 2M45A 2RAEA 4RBOA 1XS9A 3K4NA 3GW2A 1T98A 4M74A 3P9CA 4N4NB 1SC7A 2A6EF 2AQFA 1ZHFA 1FEXA 4OWRB 3CTAA 1JTXA 4BXFA 1IUFA 3H36A 3F8BA 1YIOA 4I6ZA 1R36A 3RPUA 3EYIA 2STTA 2IA1A 4NDLA 2JRTA 1G3YA 4I7HA 3LSJA 1D8JA 1ZAOA 4B3XA 1UHWA 2WA0A 2WB1N 3C2BA 1OCZH 1E2XA 4XQFA 2X6OA 5GPCA 4KYWA 1JHFA 2HOAA 3HJEA 5FKKA 1X4PA 2JZYA 1QHHD 3WODF 1U78A 2C6YA 3DLAA 4KIGA 3E97A 4OMZA 1HC8A 3DPTA 2HYGD 3TW7A 1T0FA 1W5SA 3C7JA 2A69F 1LKXA 3F6OA 2V1NA 2F5FA 3HRSA 3PFIA 2L9SA 4M9XA 1YX3A 4LITA 3VEPA 3DEWA 2V79A 4EV0A 4DW6A 1D1CA 1DQUA 4YG2F 5CQEA 5H20A 3QPLA 1G59A 3GTPJ 2PLYA 1Z67A 5M5YJ 3R0JA 2DOFA 1ITYA 2KIQA 5IPAA 3A0BC 3ESWB 4HLYA 2K4JA 3F22A 2DDBA 1E3OC 3V7CA 4F93B 2I8DA 2ZJRF 2Z16A 2X6WA 3PFYA 2R5ZB 4L5IA 4KDPA 1S9HA 4C2TA 4F7ZA 3VYTB 4BYYA 1X2MA 3AG4H 2IVMA 1UCRA 3FHNA 3IH4A 5D5VB 1W5CC 3DEUA 2DFHA 1G3WA 2NVTJ 1H9GA 2KJBA 2ME6A 4CCNA 3OYJA 4XLHA 4P1WA 3K9TA 4DQ2A 2LYCA 4A6EA 1G6NA 3SJMA 2M30A 5F0HA 3KEQA 2KKOA 4X0GA 5EF6A 3Q5FA 1JJ8C 3J81Z 3I71A 3KEYA 2QENA 4LG3A 2XHKA 2IPQX 3DEEA 2R7TA 2PN6A 1MJBA 2Y9YA 4HQEA 4BY1J 4U0WA 4WK8F 3FIWA 2ZB9A 5ED4A 3SXYA 2HPMA 3DU6A 1RI7A 4XR6A 4C9YA 3DBRB 4TV7A 2ZXWH 5TJJA 5L3GA 1AA7A 4GXOA 1ETKA 2L01A 3TOBA 3CJQB 3EUKL 4FETA 3IRRA 3U1KA 1IF1A 2ZJQF 4L5JA 1JKQC 2OTJI 3A02A 5BPIA 1V4RA 1QGPA 1IN8A 4KICA 3CESA 4MHGA 3DU5A 3HZJA 2LDUA 3CF5F 2QYOA 2HGCA 1LEAA 4FQGA 4FE4A 2B63J 2X1DA 4XBFA 2E2JJ 5DV5A 1ODDA 3S32A 4ZYAA 1QZEA 2OV7A 2VN2A 1I1GA 4GO1A 1O3TA 2IT0A 2Y31A 4IEJA 2ZNZA 3IV5A 1XCBA 5F64A 3GEZA 3DKXA 1DP7P 1TWCJ 3ZQQA 2BW3B 3RCOA 1IDZA 3OWTA 2ADUA 2O6GE 4RS8A 3GTJJ 1FMVA 2JJ7A 3M8EA 2V6CA 2IGKA 1YJWI 5DUIA 2MA3A 3DXJF 1PUEE 1JUSA 3BZKA 5L3DA 4S04A 3T0YA 2LD5A 1XC5A 2CQNA 1DU0A 2XPVA 4G6DA 1LVAA 1P4WA 5JHUA 4FX4A 5BPDA 1B72B 1KQ0A 3UNGC 2WY7Q 4KUMA 3OL3A 2X48A 3G73A 5LBQA 2A6HF 1OMIA 1WHUA 3NWSA 1G8XA 4S05A 1UHSA 5FRNA 1IN6A 3B6CA 3WE3A 3AG1H 2CU7A 2RNGA 2DTZA 3TP0A 1PP7U 1JHHA 3IHUA 3CMEI 2GLOA 1TBXA 5FRMA 3SHFA 2EK5A 1AOYA 4HX8A 1X1DA 2BY2A 2DPUA 4F92B 1YQAA 1MBFA 1IUYA 1U0JA 4B48A 4L9TA 2XGXA 3R60A 3TQNA 1IN7A 2K85A 3TDZC 3GZ5A 1YX5A 2YR2A 3FXJA 3NARA 2RC4A 3E5UA 3OYHA 1VQ8I 4CUGA 4Q48A 1QVTA 5ILSA 4BKXA 3GWZA 4CCMA 3JTGA 3FMQA 3GTKJ 2KRFA 2JSPA 3NQOA 5DYMA 3TKYA 1FX7A 2LOOA 1AU7A 3O8GA 1GDTA 3F8MA 3T8RA 2JPCA 1FOKA 4LLGF 1TWAJ 4KNYA 1XGSA 4EGYA 2MSYA 2DA3A 2MH9A 2E2IJ 5CPRB 3V8JA 4ABZA 2K9NA
chains in the Genus database with same CATH topology
4HX7A 2E1CA 1LNWA 3DFGA 5F1RA 1SMYF 3GXOA 2OA4A 1SMTA 3R6SA 4WF2A 2CYYA 4HDVA 4IRHA 3D5LA 1FC3A 1P2FA 2Z5UA 1HSJA 2Q2EA 1HW1A 5BMZA 3ZMTA 1LEBA 2F5EA 5IT9Z 2PQ8A 2PEXA 3L00A 4HF0A 2EB7A 4ESJA 3FM5A 2RVCA 4R79A 3I0TA 4A6DA 1IRGA 4OIQF 4XSXF 3HYIA 3HSFA 2K27A 1TTYA 4LB6B 1G4DA 3M9AA 2KIUA 2RKHA 4IVNA 3V7RA 2OQGA 5E8IA 3PQJA 4AIHA 1U2WA 3J80K 5K5OA 2Q8KA 3F8NA 3QP5A 1R23A 1CGPA 1D8KA 1DPRA 1FZPB 3LAPA 3I58A 2EFPA 3WU0A 2M87A 3FZVA 3EUHA 3BZ6A 1K79A 5ICEA 3DQVC 2O03A 1C0WA 2HTJA 1HW5A 4EJTA 4L18B 4UXNA 3WTWC 3J7AO 5CVVA 1YW7A 4NQWA 2R7FA 2IW5A 2DK5A 4P55A 1LQ1A 1K6OA 1FSHA 5D4RA 2B0LA 4IHSA 1F4KA 5K5QA 5D5XB 5E17F 1BI2A 1XSXA 2YX7A 2MC3A 5ILUA 3LA2A 1H9TA 2VONA 1WWXA 3U1DA 3KP5A 1UHMA 3O2PE 5ICFA 5BQTA 3IRQA 2P5KA 3ERED 1YW9A 4M72A 3GUDA 1B9NA 5IT3A 4I0BA 5DD4A 4A0YA 1S29A 5HLGA 1ZLKA 2X4HA 2QBYB 5HLIA 2GZWA 5LHGA 2FMLA 1XD7A 1J9IA 4M73A 3TO7A 3WTXC 5E20A 4HLXA 2Z9OA 2V9VA 1KU7A 1STZA 2DT5A 1XB4A 3GX4X 1JE8A 1FBSA 2O3FA 3NRVA 4YFKF 4EGZA 4BHCA 2L4AA 1U5TB 2HQNA 4BQAA 5ILVA 1MDMB 2A68F 5D8LB 2EA4A 4OIOF 4PZJA 2JSCA 4LK1F 4UV9A 2HKOA 2EFNA 4PDKA 4HX4A 3ZMVA 3N4MA 3WU1B 2GQQA 3HRTA 4L9NA 2ZFWA 3KZZA 2V1DA 1FYLA 3WTTC 3I59B 3ABTA 2QBYA 4Y13A 3KETA 4CDGA 3H3ZA 3O6BB 4JQFA 1ZRFA 1R1TA 5E1ZB 4DNCA 2UWMA 1BC8C 4R8HA 3WTZA 1MZBA 1USSA 1XSDA 1XGOA 1SD6A 2CWEA 1USTA 3EYYA 1BIAA 5HOOA 1MDMA 5A2QZ 1R5HA 5E1WA 4UVCA 2A61A 2VC0A 5FO5A 3HIFA 2E7XA 4O3MA 2D2WA 2CGPA 3KP3A 2RNJA 3WGHA 1D5VA 5DCMB 1KGSA 2OAZA 2AS5F 4G9YA 1XDUA 2Y48A 2J5OA 4L9VA 3VODA 4HV5A 3KLOA 5DUKA 2LF8A 2XAFA 1TNTA 4I01A 4OINF 4GYIA 5L3CA 1FSEA 3VB2A 2EFQA 5JVTA 4EJUA 3L9FA 2CO5A 2TDXA 3BWGA 3GF2A 4G94A 3ML6A 4RAYA 4LLLA 5EEHA 2DLLA 3C1DA 2L54A 2R3SA 1XMAA 2FBIA 4CHUA 4M6YA 1OKRA 3M8FA 1FP1D 1KU3A 3DV8A 2P6TA 3RKYA 5LHHA 2E7WA 4RB0A 5K5RA 1FLIA 5DCMA 3JSOA 4ENNA 1B1BA 3BJ6A 2IA0A 2R7DA 1REPC 1IXRC 2HR3A 4EVIA 4BHPA 5ERIA 1ULYA 4LK0F 4AIJA 3E6MA 3H3UA 3F23A 4KN7X 1ZG5A 3ZMSA 3IKVA 2H27A 2F2EA 2PJPA 3FXRA 4AD9A 1KYWA 1Z91A 4M71A 4ZYDA 3TDUC 1KQ8A 4KA4A 1CF7B 2VE9A 5LHIA 3I54A 1BI0A 5HDKA 1TLHB 1W7PD 4UNOA 1Z6RA 3I53A 2OZ6A 1IAWA 1MGTA 2HQRA 3QPTA 4BHBA 4O5VA 1TNSA 1FPQA 1AWCA 1W4MA 2JTVA 2FRHA 1IN4A 4LJZF 5HS8A 1EH8A 4GYGA 1R58A 2CFXA 2PMUA 4I98B 2ESNA 2HFHA 2L3DA 3HTSB 3KP2A 1F9NA 2KIFA 1TQIA 2GXBA 1YYVA 2P7CB 3GO5A 1FBQA 1YS7A 2FMYA 5LGTA 5HVQC 4BAYA 5LRSA 3MAJA 4RB1A 1OPCA 1CF7A 2NNNA 3REOA 1Z05A 1V3FA 4ENJA 1B9MA 1WRJA 4OMYA 2PBIA 3KP6A 2D1VA 3WGGA 4A5NA 1BOAA 5DD8A 4LD5A 3RYPA 2VOOA 3RJPA 1I27A 4NHJA 5E1XA 1G3SA 2NYXA 2F5DA 1HQCA 4L9JA 4HF1A 2FQ3A 1ZH5A 1FT9A 4A0ZA 3F3XA 4G8XA 3QOPA 4RB2C 4L0YB 3T5XA 2UXXA 4YIFA 1FNNA 2HKXA 1NHAA 2HOEA 4ESBA 4BXUA 1ZRDA 4R1HA 4RGSA 3ZP5A 2MLKA 4IPAA 2H09A 1FWZA 2P8TA 1J5YA 3BPVA 5E18F 4HOBA 2E1NA 5DCFA 4XLPF 1FYKA 1JGSA 3BPXA 5L3EA 3DPLC 2EJRA 4ZH4F 2LSOA 5CVUA 4G7ZF 3ZMDA 3GYHX 5LGUA 5FFXA 3LQRA 2G7HA 5FLXK 2EFWA 3ELKA 3ROUA 1R1UA 2HDCA 3GFJA 1MD0A 1ON1A 2RN7A 3CUQB 3HUGA 2W24A 2FU4A 2MBFA 3TGNA 3BOQA 2QQAA 4D0PA 5DEQA 3RPQA 1J2XA 4FX0A 5FFZA 4PCQA 3IKTA 1QBJA 1ZGJA 4WX9A 1UFMA 2XV4S 2JT1A 2EV0A 3J80Z 1ZARA 2A3SA 1HW2A 2VBZA 4N9IA 2FEZA 4I0AA 1HBXG 2GA1A 5KVRA 2EV6A 2MLGA 1P4XA 4U88A 2O0YA 4GCVA 2P6SA 1IXCA 1HKSA 5DDGA 1OR7A 3HHGA 4OOIA 3CLOA 4P9UA 3RIRA 2GWRA 5CVJA 2FNAA 4MNUA 4JK1X 1E17A 2MD5A 3CO7C 2PI0A 3GFMA 3CUQA 1DDNA 4HBLA 1XGMA 3MZYA 3QP6A 1T39A 1IRFA 2BE5F 4XLNF 2P7VB 1ZN2A 3WTSC 1OYIA 2DAOA 5D6FA 1K78B 4OIRF 1U5TC 4CXFA 1U6GA 3SFZA 1OYYA 4OU0A 2DO7A 3DF8A 3JSPA 3WTUC 2RDPA 2L4MA 2XUBA 2Y0MA 3DKWA 4IXAA 3P9KA 1XGNA 1XDSA 2K02A 4AWXB 4MQVA 1R00A 3E6DA 3HSEA 2QQBA 1HSTA 1S8NA 3FHZA 3FXUA 4FT8A 4HA8A 1YFHA 4MTEA 3RI4A 3ECOA 2D45A 2LKPA 1O7FA 3HRMA 4MEYF 4Q4ZF 4IHTA 4UUVA 2HYFA 1PP8F 2IA2A 4UVBA 3MQ0A 2FA5A 3T1BA 3K2ZA 5J8CA 1EH6A 1Z7UA 5JI6A 4RGUA 4IRIA 2FBHA 4RAZA 5E8GA 1L3LA 4KMUX 3NEUA 3VOEA 3KLNA 4ESFA 2FE3A 2YPRA 2W25A 2ZMEB 3ZN1A 3L2CA 3LAJA 3Q9SA 4B8XA 2XAJA 5LEJA 1ZG3A 4PGGA 1B59A 1TW2A 4EQQA 1JXSA 2IP2A 5CJ9A 4A5MA 3V8KA 2FSWA 5BS6A 2FF4A 4ZYGA 1F5TA 2WV0A 2VE8A 2XVCA 1SD5A 3ZQ7A 5FD5A 4XSZF 5D8KB 4UHTA 1D3YA 3ECHA 3QAHA 3KP4A 1LB2A 1SFUA 5CYVA 3JAMZ 2GA2A 1BN5A 4WXHA 2STWA 3KFWX 4LG0B 3JW4A 1RUNA 1ZYRF 3MFKA 1LJ9A 1WKMA 5L3FA 3F21A 1QZYA 1J75A 4CGZA 1HKTA 2Q0OA 3KP7A 1LDJA 4LMYA 1EH7A 3SQNA 1O7LA 3FF5A 4HQMA 1Q1HA 4JBAA 4LFUA 1TQMA 2HS5A 4EM2A 1SFEA 2NNYA 5LEKA 1YLFA 2F5CA 4G6QA 1U5TA 3FX3A 2HZTA 2WC2A 2W57A 2KJCA 2BBYA 3JTHA 3HTUA 2ETHA 1UB9A 2LF7A 2DU9A 4Q47A 2BYVE 1U8RA 2MH2A 3C18A 3EDPA 5AIQA 5ICCA 3LA3A 4Q5SF 1VTNC 3SZTA 4QLCU 1PDNC 2CG4A 4A2UA 1DPUA 1ZGAA 2HEOA 4I2OA 1K7AA 3EQLF 2KIMA 4LG0A 1ZLJA 3I59A 4GGGA 2V1UA 3E5XA 4CO8A 4MEXF 3AAFA 2UZKA 1ZREA 1FBUA 2L02A 3S2WA 3OOPA 1Y0UA 3COAC 1RUOA 4MTDA 2QVOA 3MWMA 4HV6A 1J7KA 1IZ1A 4IF4A 3WG9A 2XAQA 1T2KA 3L7WA 3P9IA 2P5VA 1YG2A 1S7OA 2VXZA 4YFXF 4P5OA 1KU2A 3QPHA 5AONA 4ASNA 4WCGA 1LDKB 1QQIA 2D1HA 1RIOH 2VBXA 4O6JA 1TQPA 1BI3A 2ISYA 1XN7A 3KEOA 5F6FA 4G7OF 5ICGA 1R22A 3G3ZA 3ABUA 5JR3A 2OD5A 2XRNA 5JFRA 4EJVA 1BJAA 1KYZA 3CO6C 2UXNA 2EA2A 2ELHA 2K4BA 1XSVA 4MQ9F 1O57A 1SD7A 4RB3C 5D5WB 2Y75A 1YTYA 4A0XA 2XKOA 3O3KA 1BI1A 3BP8A 3RKWA 2QWWA 4ZZDA 3KZYA 3E6CC 3GZ6A 4KFCA 1Z9CA 1YS6A 4HYEA 1S6LA 2XASA 2DQRA 1J59A 4BNCA 4OIPF 4A12A 3M7GA 2COMA 1MJAA 1MJ9A 5CVRA 2W84A 1XCVA 4AVPA 1IN5A 5D6EA 2FXAA 5HDGA 2YU3A 3F72A 2ESHA 5J8FA 3F6VA 3R61A 4HF2A 3GFIA 3BJOA 3VFZA 3TO9A 2WWYA 5HLHA 4CICA 1RZ4A 2X0LA 2BGCA 5HS7A 1BM9A 1R5GA 4CZZA 4PGHA 4ETSA 4M6XA 2IRFG 4KIBA 2RV8A 2OBPA 4LGWA 1W7PB 2XKPA 2RQPA 3J81K 4WXCA 3LQQA 1RNLA 4LB5A 1I5ZA 1P6RA 1GXQA 4CYDA 5EEGA 2CQKA 3IC7A 1MKMA 2DFIA 3CUQC 5CVIA 3SZPA 1ZG1A 2JPBA 1T6SA 3R0AA 4HDUA 5H6RA 2G9WA 1B6AA 1S7AA 2XROA 4HAMA 2ZCWA 2Z33A 3BJAA 3LA7A 3H92A 5FLXZ 2K7LA 2VBYA 2ACJA 1WSUA 1QO0D 2WTEA 2VT3A 4EJOA 3V7SA 1FYMA 3HSRA 4Y15A 5LGNA 3RKXA 3IWFA 2DPDA 5FB2A 1W7PA 4M9ZA 4UV8A 5CLSA 4EJWA 2NRAC 2O61A 2YX4A 5TRDA 2VBWA 3ZMZA 3HRUA 1R7JA 5J6XA 1GHCA 3U9GA 1OYWA 1IXSB 1B4AA 1ONVA 2HTSA 2CSOA 4K2EA 4YIIA 2P4WA 1O3RA 1YW8A 1G3TA 2A5YB 3C3WA 1P4AA 2DQLA 3W6JB 1LDDA 2FOKA 2Z99A 1I1SA 3B02A 3HHHA 4P96A 1ON2A 4BH9A 4M9SA 1WI9A 3LWFA 3IL2A 4U7BA 3BDDA 1BBYA 1GVJA 5AIPA 3K69A 3MCZA 3RTRA 3BY6A 2P5LC 2J5PA 3ZMUA 3CJNA 2IJLA 3GVAA 2ISZA 1BC7C 2EV5A 4KN4X 5D5UB 1FY7A 2RGVA 4LLNA 2VT2A 3P7NA 3V4GA 3GLXA 2DTRA 4Y17A 4UVAA 1DUXC 2M1BA 3QRFF 4XRFA 1HKQA 3E5QA 4ZYEA 3U2RA 2QUFA 3E6BA 4N0BA 3M1EA 1EV7A 5H6QA 4KT5C 1KA8A 1F1ZA 5FGMA 3FM3A 2DK8A 2PG4A 3ZN0A 4ENMA 2W85A 4QWQA 4ZZLA 2BV6A 1J0RA 1A04A 1Z6TA 1SFXA 3MEXA 3N97A 2G7UA 3DP7A 5IT9K 4MGRA 1L0OC 2ZO4A 3QU3A 4HZFA 1S3JA 3F8FA 1XMKA 4RGXA 3PQKA 5KK1A 1IW7F 1SAXA 3W6KB 3LFKA 2A07F 1YO5C 2XIGA 5LRRA 4G7HF 1QZZA 3LSTA 3TOAA 3OV8A 2EFOA 2GIVA 2ZJ2A 2QM3A 4U7DA 1HXDA 3K0LA 4KMFA 3KCCA 1QNTA 1WQ2A 2NS0A 5FD6A 3L09A 2DI3A 4U0VA 2VOPA 3I64A 3F8CA 5BOXA 2QQ9A 3Q9VA 1W5TA 1P92A 2AXLA 3K1NA 4ON0A 3K1PA 1R1VA 3R4KA 2LNBA 3RYRA 3E3VA 1K78A 2M8EA 1QPMA 3ISPA 2FNPA 2ZNYA 4L0ZB 4P9FA 1FP2A 2DW4A 4IJAA 2K86A 2ZXJA 4KIFA 1T38A 1O3SA 3B73A 3WTVC 3CUOA 2EWNA 4WXDA 4ZYHA 2ZBKA 3ULQB 1BIBA 2OZUA 2Z3YA 2FBKA 3WGIA 4YFNF 3BROA 3FMRA 2VODA 1KQ9A 2OQRA 3CDHA 3MZHA 2NAZA 2ZKZA 1H0MA 1TW3A 2XAHA 4FHTA 3HOSA 2O8XA 2CW0F 1I6XA 1SD4A 3HOTA 2QZ8A 5L3BA 4IRGA 3I4PA 1Z1DA 2ZMEA 2VC1A 3WE2A 4B09A 3KE2A 4Z2YA 4EM0B 2PMHA 4NB5A 3WTYC 5HS9A 2DBBA 4E70A 3FXQA 4RGRA 3EETA 5D4SA 2V1XA 5K1YA 3K1MA 5HDNA 3JAMK 3FMSA 2GXGA 2H94A 3D0SA 3V8LA 5LLQA 4HW0A 4EMSA 4I09A 3IWZA 2YSRA 3GFLA 4H0EA 2PFBA 2HWVA 1X3UA 2M5WA 4U0YA 1ZRCA 1GXPA 2BEOA 4AIKA 4EM1A 3RDIA 4I02A 2GAUA 4N9HA 2OU2A 2H6BA 1O3QA 3TO6A 3T8TA 1U3EM 2H6CA 2QLZA 6PAXA 2XAGA 3ZPLA 3FWEA 3I5UA 5A2QK 4ENKA 3QU6A 4WWCA 1KU9A 2M45A 3GW2A 1T98A 4M74A 3P9CA 2A6EF 1ZHFA 3CTAA 3F8BA 1YIOA 1R36A 3RPUA 3EYIA 2STTA 2IA1A 2JRTA 1G3YA 4I7HA 1D8JA 1ZAOA 1UHWA 1E2XA 4KYWA 1JHFA 2JZYA 3WODF 1U78A 2C6YA 4KIGA 3E97A 4OMZA 3DPTA 2HYGD 1T0FA 1W5SA 3C7JA 2A69F 3F6OA 2F5FA 3HRSA 3PFIA 4M9XA 3VEPA 2V79A 4EV0A 4YG2F 5H20A 2PLYA 3R0JA 4HLYA 2K4JA 3F22A 3V7CA 4L5IA 4KDPA 4F7ZA 4BYYA 2IVMA 1UCRA 5D5VB 3DEUA 1G3WA 1H9GA 2KJBA 3K9TA 4DQ2A 4A6EA 1G6NA 2M30A 3KEQA 2KKOA 3Q5FA 3J81Z 3I71A 2QENA 2XHKA 2IPQX 2PN6A 1MJBA 4HQEA 4U0WA 4WK8F 5ED4A 3SXYA 1RI7A 4TV7A 5TJJA 5L3GA 4GXOA 2L01A 3TOBA 3IRRA 1IF1A 4L5JA 5BPIA 1V4RA 1QGPA 1IN8A 4KICA 4MHGA 2LDUA 2QYOA 2HGCA 1LEAA 4XBFA 5DV5A 1ODDA 2VN2A 1I1GA 4GO1A 1O3TA 2IT0A 2ZNZA 1XCBA 5F64A 3GEZA 1DP7P 2ADUA 2O6GE 4RS8A 3M8EA 2V6CA 5DUIA 2MA3A 3DXJF 1PUEE 5L3DA 4S04A 3T0YA 4G6DA 1LVAA 1P4WA 5JHUA 4FX4A 5BPDA 1KQ0A 4KUMA 3G73A 5LBQA 2A6HF 1OMIA 4S05A 1IN6A 3WE3A 1PP7U 1JHHA 3IHUA 1TBXA 3SHFA 2EK5A 1AOYA 4HX8A 2DPUA 1YQAA 1IUYA 4L9TA 2XGXA 3R60A 3TQNA 1IN7A 3TDZC 3GZ5A 2YR2A 2RC4A 3E5UA 4Q48A 5ILSA 3GWZA 3JTGA 3FMQA 2KRFA 3NQOA 5DYMA 3TKYA 1FX7A 3F8MA 3T8RA 2JPCA 1FOKA 4LLGF 4KNYA 1XGSA 4EGYA 2MH9A 3V8JA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4HX7 A;  2E1C A;  1LNW A;  3DFG A;  5F1R A;  1SMY F;  3GXO A;  2OA4 A;  1SMT A;  3R6S A;  4WF2 A;  2CYY A;  4HDV A;  4IRH A;  3D5L A;  1FC3 A;  1P2F A;  2Z5U A;  1HSJ A;  2Q2E A;  1HW1 A;  5BMZ A;  3ZMT A;  1LEB A;  2F5E A;  5IT9 Z;  2PQ8 A;  2PEX A;  3L00 A;  4HF0 A;  2EB7 A;  4ESJ A;  3FM5 A;  2RVC A;  4R79 A;  3I0T A;  4A6D A;  1IRG A;  4OIQ F;  4XSX F;  3HYI A;  3HSF A;  2K27 A;  1TTY A;  4LB6 B;  1G4D A;  3M9A A;  2KIU A;  2RKH A;  4IVN A;  3V7R A;  2OQG A;  5E8I A;  3PQJ A;  4AIH A;  1U2W A;  3J80 K;  5K5O A;  2Q8K A;  3F8N A;  3QP5 A;  1R23 A;  1CGP A;  1D8K A;  1DPR A;  1FZP B;  3LAP A;  3I58 A;  2EFP A;  3WU0 A;  2M87 A;  3FZV A;  3EUH A;  3BZ6 A;  1K79 A;  5ICE A;  3DQV C;  2O03 A;  1C0W A;  2HTJ A;  1HW5 A;  4EJT A;  4L18 B;  4UXN A;  3WTW C;  3J7A O;  5CVV A;  1YW7 A;  4NQW A;  2R7F A;  2IW5 A;  2DK5 A;  4P55 A;  1LQ1 A;  1K6O A;  1FSH A;  5D4R A;  2B0L A;  4IHS A;  1F4K A;  5K5Q A;  5D5X B;  5E17 F;  1BI2 A;  1XSX A;  2YX7 A;  2MC3 A;  5ILU A;  3LA2 A;  1H9T A;  2VON A;  1WWX A;  3U1D A;  3KP5 A;  1UHM A;  3O2P E;  5ICF A;  5BQT A;  3IRQ A;  2P5K A;  3ERE D;  1YW9 A;  4M72 A;  3GUD A;  1B9N A;  5IT3 A;  4I0B A;  5DD4 A;  4A0Y A;  1S29 A;  5HLG A;  1ZLK A;  2X4H A;  2QBY B;  5HLI A;  2GZW A;  5LHG A;  2FML A;  1XD7 A;  1J9I A;  4M73 A;  3TO7 A;  3WTX C;  5E20 A;  4HLX A;  2Z9O A;  2V9V A;  1KU7 A;  1STZ A;  2DT5 A;  1XB4 A;  3GX4 X;  1JE8 A;  1FBS A;  2O3F A;  3NRV A;  4YFK F;  4EGZ A;  4BHC A;  2L4A A;  1U5T B;  2HQN A;  4BQA A;  5ILV A;  1MDM B;  2A68 F;  5D8L B;  2EA4 A;  4OIO F;  4PZJ A;  2JSC A;  4LK1 F;  4UV9 A;  2HKO A;  2EFN A;  4PDK A;  4HX4 A;  3ZMV A;  3N4M A;  3WU1 B;  2GQQ A;  3HRT A;  4L9N A;  2ZFW A;  3KZZ A;  2V1D A;  1FYL A;  3WTT C;  3I59 B;  3ABT A;  2QBY A;  4Y13 A;  3KET A;  4CDG A;  3H3Z A;  3O6B B;  4JQF A;  1ZRF A;  1R1T A;  5E1Z B;  4DNC A;  2UWM A;  1BC8 C;  4R8H A;  3WTZ A;  1MZB A;  1USS A;  1XSD A;  1XGO A;  1SD6 A;  2CWE A;  1UST A;  3EYY A;  1BIA A;  5HOO A;  1MDM A;  5A2Q Z;  1R5H A;  5E1W A;  4UVC A;  2A61 A;  2VC0 A;  5FO5 A;  3HIF A;  2E7X A;  4O3M A;  2D2W A;  2CGP A;  3KP3 A;  2RNJ A;  3WGH A;  1D5V A;  5DCM B;  1KGS A;  2OAZ A;  2AS5 F;  4G9Y A;  1XDU A;  2Y48 A;  2J5O A;  4L9V A;  3VOD A;  4HV5 A;  3KLO A;  5DUK A;  2LF8 A;  2XAF A;  1TNT A;  4I01 A;  4OIN F;  4GYI A;  5L3C A;  1FSE A;  3VB2 A;  2EFQ A;  5JVT A;  4EJU A;  3L9F A;  2CO5 A;  2TDX A;  3BWG A;  3GF2 A;  4G94 A;  3ML6 A;  4RAY A;  4LLL A;  5EEH A;  2DLL A;  3C1D A;  2L54 A;  2R3S A;  1XMA A;  2FBI A;  4CHU A;  4M6Y A;  1OKR A;  3M8F A;  1FP1 D;  1KU3 A;  3DV8 A;  2P6T A;  3RKY A;  5LHH A;  2E7W A;  4RB0 A;  5K5R A;  1FLI A;  5DCM A;  3JSO A;  4ENN A;  1B1B A;  3BJ6 A;  2IA0 A;  2R7D A;  1REP C;  1IXR C;  2HR3 A;  4EVI A;  4BHP A;  5ERI A;  1ULY A;  4LK0 F;  4AIJ A;  3E6M A;  3H3U A;  3F23 A;  4KN7 X;  1ZG5 A;  3ZMS A;  3IKV A;  2H27 A;  2F2E A;  2PJP A;  3FXR A;  4AD9 A;  1KYW A;  1Z91 A;  4M71 A;  4ZYD A;  3TDU C;  1KQ8 A;  4KA4 A;  1CF7 B;  2VE9 A;  5LHI A;  3I54 A;  1BI0 A;  5HDK A;  1TLH B;  1W7P D;  4UNO A;  1Z6R A;  3I53 A;  2OZ6 A;  1IAW A;  1MGT A;  2HQR A;  3QPT A;  4BHB A;  4O5V A;  1TNS A;  1FPQ A;  1AWC A;  1W4M A;  2JTV A;  2FRH A;  1IN4 A;  4LJZ F;  5HS8 A;  1EH8 A;  4GYG A;  1R58 A;  2CFX A;  2PMU A;  4I98 B;  2ESN A;  2HFH A;  2L3D A;  3HTS B;  3KP2 A;  1F9N A;  2KIF A;  1TQI A;  2GXB A;  1YYV A;  2P7C B;  3GO5 A;  1FBQ A;  1YS7 A;  2FMY A;  5LGT A;  5HVQ C;  4BAY A;  5LRS A;  3MAJ A;  4RB1 A;  1OPC A;  1CF7 A;  2NNN A;  3REO A;  1Z05 A;  1V3F A;  4ENJ A;  1B9M A;  1WRJ A;  4OMY A;  2PBI A;  3KP6 A;  2D1V A;  3WGG A;  4A5N A;  1BOA A;  5DD8 A;  4LD5 A;  3RYP A;  2VOO A;  3RJP A;  1I27 A;  4NHJ A;  5E1X A;  1G3S A;  2NYX A;  2F5D A;  1HQC A;  4L9J A;  4HF1 A;  2FQ3 A;  1ZH5 A;  1FT9 A;  4A0Z A;  3F3X A;  4G8X A;  3QOP A;  4RB2 C;  4L0Y B;  3T5X A;  2UXX A;  4YIF A;  1FNN A;  2HKX A;  1NHA A;  2HOE A;  4ESB A;  4BXU A;  1ZRD A;  4R1H A;  4RGS A;  3ZP5 A;  2MLK A;  4IPA A;  2H09 A;  1FWZ A;  2P8T A;  1J5Y A;  3BPV A;  5E18 F;  4HOB A;  2E1N A;  5DCF A;  4XLP F;  1FYK A;  1JGS A;  3BPX A;  5L3E A;  3DPL C;  2EJR A;  4ZH4 F;  2LSO A;  5CVU A;  4G7Z F;  3ZMD A;  3GYH X;  5LGU A;  5FFX A;  3LQR A;  2G7H A;  5FLX K;  2EFW A;  3ELK A;  3ROU A;  1R1U A;  2HDC A;  3GFJ A;  1MD0 A;  1ON1 A;  2RN7 A;  3CUQ B;  3HUG A;  2W24 A;  2FU4 A;  2MBF A;  3TGN A;  3BOQ A;  2QQA A;  4D0P A;  5DEQ A;  3RPQ A;  1J2X A;  4FX0 A;  5FFZ A;  4PCQ A;  3IKT A;  1QBJ A;  1ZGJ A;  4WX9 A;  1UFM A;  2XV4 S;  2JT1 A;  2EV0 A;  3J80 Z;  1ZAR A;  2A3S A;  1HW2 A;  2VBZ A;  4N9I A;  2FEZ A;  4I0A A;  1HBX G;  2GA1 A;  5KVR A;  2EV6 A;  2MLG A;  1P4X A;  4U88 A;  2O0Y A;  4GCV A;  2P6S A;  1IXC A;  1HKS A;  5DDG A;  1OR7 A;  3HHG A;  4OOI A;  3CLO A;  4P9U A;  3RIR A;  2GWR A;  5CVJ A;  2FNA A;  4MNU A;  4JK1 X;  1E17 A;  2MD5 A;  3CO7 C;  2PI0 A;  3GFM A;  3CUQ A;  1DDN A;  4HBL A;  1XGM A;  3MZY A;  3QP6 A;  1T39 A;  1IRF A;  2BE5 F;  4XLN F;  2P7V B;  1ZN2 A;  3WTS C;  1OYI A;  2DAO A;  5D6F A;  1K78 B;  4OIR F;  1U5T C;  4CXF A;  1U6G A;  3SFZ A;  1OYY A;  4OU0 A;  2DO7 A;  3DF8 A;  3JSP A;  3WTU C;  2RDP A;  2L4M A;  2XUB A;  2Y0M A;  3DKW A;  4IXA A;  3P9K A;  1XGN A;  1XDS A;  2K02 A;  4AWX B;  4MQV A;  1R00 A;  3E6D A;  3HSE A;  2QQB A;  1HST A;  1S8N A;  3FHZ A;  3FXU A;  4FT8 A;  4HA8 A;  1YFH A;  4MTE A;  3RI4 A;  3ECO A;  2D45 A;  2LKP A;  1O7F A;  3HRM A;  4MEY F;  4Q4Z F;  4IHT A;  4UUV A;  2HYF A;  1PP8 F;  2IA2 A;  4UVB A;  3MQ0 A;  2FA5 A;  3T1B A;  3K2Z A;  5J8C A;  1EH6 A;  1Z7U A;  5JI6 A;  4RGU A;  4IRI A;  2FBH A;  4RAZ A;  5E8G A;  1L3L A;  4KMU X;  3NEU A;  3VOE A;  3KLN A;  4ESF A;  2FE3 A;  2YPR A;  2W25 A;  2ZME B;  3ZN1 A;  3L2C A;  3LAJ A;  3Q9S A;  4B8X A;  2XAJ A;  5LEJ A;  1ZG3 A;  4PGG A;  1B59 A;  1TW2 A;  4EQQ A;  1JXS A;  2IP2 A;  5CJ9 A;  4A5M A;  3V8K A;  2FSW A;  5BS6 A;  2FF4 A;  4ZYG A;  1F5T A;  2WV0 A;  2VE8 A;  2XVC A;  1SD5 A;  3ZQ7 A;  5FD5 A;  4XSZ F;  5D8K B;  4UHT A;  1D3Y A;  3ECH A;  3QAH A;  3KP4 A;  1LB2 A;  1SFU A;  5CYV A;  3JAM Z;  2GA2 A;  1BN5 A;  4WXH A;  2STW A;  3KFW X;  4LG0 B;  3JW4 A;  1RUN A;  1ZYR F;  3MFK A;  1LJ9 A;  1WKM A;  5L3F A;  3F21 A;  1QZY A;  1J75 A;  4CGZ A;  1HKT A;  2Q0O A;  3KP7 A;  1LDJ A;  4LMY A;  1EH7 A;  3SQN A;  1O7L A;  3FF5 A;  4HQM A;  1Q1H A;  4JBA A;  4LFU A;  1TQM A;  2HS5 A;  4EM2 A;  1SFE A;  2NNY A;  5LEK A;  1YLF A;  2F5C A;  4G6Q A;  1U5T A;  3FX3 A;  2HZT A;  2WC2 A;  2W57 A;  2KJC A;  2BBY A;  3JTH A;  3HTU A;  2ETH A;  1UB9 A;  2LF7 A;  2DU9 A;  4Q47 A;  2BYV E;  1U8R A;  2MH2 A;  3C18 A;  3EDP A;  5AIQ A;  5ICC A;  3LA3 A;  4Q5S F;  1VTN C;  3SZT A;  4QLC U;  1PDN C;  2CG4 A;  4A2U A;  1DPU A;  1ZGA A;  2HEO A;  4I2O A;  1K7A A;  3EQL F;  2KIM A;  4LG0 A;  1ZLJ A;  3I59 A;  4GGG A;  2V1U A;  3E5X A;  4CO8 A;  4MEX F;  3AAF A;  2UZK A;  1ZRE A;  1FBU A;  2L02 A;  3S2W A;  3OOP A;  1Y0U A;  3COA C;  1RUO A;  4MTD A;  2QVO A;  3MWM A;  4HV6 A;  1J7K A;  1IZ1 A;  4IF4 A;  3WG9 A;  2XAQ A;  1T2K A;  3L7W A;  3P9I A;  2P5V A;  1YG2 A;  1S7O A;  2VXZ A;  4YFX F;  4P5O A;  1KU2 A;  3QPH A;  5AON A;  4ASN A;  4WCG A;  1LDK B;  1QQI A;  2D1H A;  1RIO H;  2VBX A;  4O6J A;  1TQP A;  1BI3 A;  2ISY A;  1XN7 A;  3KEO A;  5F6F A;  4G7O F;  5ICG A;  1R22 A;  3G3Z A;  3ABU A;  5JR3 A;  2OD5 A;  2XRN A;  5JFR A;  4EJV A;  1BJA A;  1KYZ A;  3CO6 C;  2UXN A;  2EA2 A;  2ELH A;  2K4B A;  1XSV A;  4MQ9 F;  1O57 A;  1SD7 A;  4RB3 C;  5D5W B;  2Y75 A;  1YTY A;  4A0X A;  2XKO A;  3O3K A;  1BI1 A;  3BP8 A;  3RKW A;  2QWW A;  4ZZD A;  3KZY A;  3E6C C;  3GZ6 A;  4KFC A;  1Z9C A;  1YS6 A;  4HYE A;  1S6L A;  2XAS A;  2DQR A;  1J59 A;  4BNC A;  4OIP F;  4A12 A;  3M7G A;  2COM A;  1MJA A;  1MJ9 A;  5CVR A;  2W84 A;  1XCV A;  4AVP A;  1IN5 A;  5D6E A;  2FXA A;  5HDG A;  2YU3 A;  3F72 A;  2ESH A;  5J8F A;  3F6V A;  3R61 A;  4HF2 A;  3GFI A;  3BJO A;  3VFZ A;  3TO9 A;  2WWY A;  5HLH A;  4CIC A;  1RZ4 A;  2X0L A;  2BGC A;  5HS7 A;  1BM9 A;  1R5G A;  4CZZ A;  4PGH A;  4ETS A;  4M6X A;  2IRF G;  4KIB A;  2RV8 A;  2OBP A;  4LGW A;  1W7P B;  2XKP A;  2RQP A;  3J81 K;  4WXC A;  3LQQ A;  1RNL A;  4LB5 A;  1I5Z A;  1P6R A;  1GXQ A;  4CYD A;  5EEG A;  2CQK A;  3IC7 A;  1MKM A;  2DFI A;  3CUQ C;  5CVI A;  3SZP A;  1ZG1 A;  2JPB A;  1T6S A;  3R0A A;  4HDU A;  5H6R A;  2G9W A;  1B6A A;  1S7A A;  2XRO A;  4HAM A;  2ZCW A;  2Z33 A;  3BJA A;  3LA7 A;  3H92 A;  5FLX Z;  2K7L A;  2VBY A;  2ACJ A;  1WSU A;  1QO0 D;  2WTE A;  2VT3 A;  4EJO A;  3V7S A;  1FYM A;  3HSR A;  4Y15 A;  5LGN A;  3RKX A;  3IWF A;  2DPD A;  5FB2 A;  1W7P A;  4M9Z A;  4UV8 A;  5CLS A;  4EJW A;  2NRA C;  2O61 A;  2YX4 A;  5TRD A;  2VBW A;  3ZMZ A;  3HRU A;  1R7J A;  5J6X A;  1GHC A;  3U9G A;  1OYW A;  1IXS B;  1B4A A;  1ONV A;  2HTS A;  2CSO A;  4K2E A;  4YII A;  2P4W A;  1O3R A;  1YW8 A;  1G3T A;  2A5Y B;  3C3W A;  1P4A A;  2DQL A;  3W6J B;  1LDD A;  2FOK A;  2Z99 A;  1I1S A;  3B02 A;  3HHH A;  4P96 A;  1ON2 A;  4BH9 A;  4M9S A;  1WI9 A;  3LWF A;  3IL2 A;  4U7B A;  3BDD A;  1BBY A;  1GVJ A;  5AIP A;  3K69 A;  3MCZ A;  3RTR A;  3BY6 A;  2P5L C;  2J5P A;  3ZMU A;  3CJN A;  2IJL A;  3GVA A;  2ISZ A;  1BC7 C;  2EV5 A;  4KN4 X;  5D5U B;  1FY7 A;  2RGV A;  4LLN A;  2VT2 A;  3P7N A;  3V4G A;  3GLX A;  2DTR A;  4Y17 A;  4UVA A;  1DUX C;  2M1B A;  3QRF F;  4XRF A;  1HKQ A;  3E5Q A;  4ZYE A;  3U2R A;  2QUF A;  3E6B A;  4N0B A;  3M1E A;  1EV7 A;  5H6Q A;  4KT5 C;  1KA8 A;  1F1Z A;  5FGM A;  3FM3 A;  2DK8 A;  2PG4 A;  3ZN0 A;  4ENM A;  2W85 A;  4QWQ A;  4ZZL A;  2BV6 A;  1J0R A;  1A04 A;  1Z6T A;  1SFX A;  3MEX A;  3N97 A;  2G7U A;  3DP7 A;  5IT9 K;  4MGR A;  1L0O C;  2ZO4 A;  3QU3 A;  4HZF A;  1S3J A;  3F8F A;  1XMK A;  4RGX A;  3PQK A;  5KK1 A;  1IW7 F;  1SAX A;  3W6K B;  3LFK A;  2A07 F;  1YO5 C;  2XIG A;  5LRR A;  4G7H F;  1QZZ A;  3LST A;  3TOA A;  3OV8 A;  2EFO A;  2GIV A;  2ZJ2 A;  2QM3 A;  4U7D A;  1HXD A;  3K0L A;  4KMF A;  3KCC A;  1QNT A;  1WQ2 A;  2NS0 A;  5FD6 A;  3L09 A;  2DI3 A;  4U0V A;  2VOP A;  3I64 A;  3F8C A;  5BOX A;  2QQ9 A;  3Q9V A;  1W5T A;  1P92 A;  2AXL A;  3K1N A;  4ON0 A;  3K1P A;  1R1V A;  3R4K A;  2LNB A;  3RYR A;  3E3V A;  1K78 A;  2M8E A;  1QPM A;  3ISP A;  2FNP A;  2ZNY A;  4L0Z B;  4P9F A;  1FP2 A;  2DW4 A;  4IJA A;  2K86 A;  2ZXJ A;  4KIF A;  1T38 A;  1O3S A;  3B73 A;  3WTV C;  3CUO A;  2EWN A;  4WXD A;  4ZYH A;  2ZBK A;  3ULQ B;  1BIB A;  2OZU A;  2Z3Y A;  2FBK A;  3WGI A;  4YFN F;  3BRO A;  3FMR A;  2VOD A;  1KQ9 A;  2OQR A;  3CDH A;  3MZH A;  2NAZ A;  2ZKZ A;  1H0M A;  1TW3 A;  2XAH A;  4FHT A;  3HOS A;  2O8X A;  2CW0 F;  1I6X A;  1SD4 A;  3HOT A;  2QZ8 A;  5L3B A;  4IRG A;  3I4P A;  1Z1D A;  2ZME A;  2VC1 A;  3WE2 A;  4B09 A;  3KE2 A;  4Z2Y A;  4EM0 B;  2PMH A;  4NB5 A;  3WTY C;  5HS9 A;  2DBB A;  4E70 A;  3FXQ A;  4RGR A;  3EET A;  5D4S A;  2V1X A;  5K1Y A;  3K1M A;  5HDN A;  3JAM K;  3FMS A;  2GXG A;  2H94 A;  3D0S A;  3V8L A;  5LLQ A;  4HW0 A;  4EMS A;  4I09 A;  3IWZ A;  2YSR A;  3GFL A;  4H0E A;  2PFB A;  2HWV A;  1X3U A;  2M5W A;  4U0Y A;  1ZRC A;  1GXP A;  2BEO A;  4AIK A;  4EM1 A;  3RDI A;  4I02 A;  2GAU A;  4N9H A;  2OU2 A;  2H6B A;  1O3Q A;  3TO6 A;  3T8T A;  1U3E M;  2H6C A;  2QLZ A;  6PAX A;  2XAG A;  3ZPL A;  3FWE A;  3I5U A;  5A2Q K;  4ENK A;  3QU6 A;  4WWC A;  1KU9 A;  2M45 A;  3GW2 A;  1T98 A;  4M74 A;  3P9C A;  2A6E F;  1ZHF A;  3CTA A;  3F8B A;  1YIO A;  1R36 A;  3RPU A;  3EYI A;  2STT A;  2IA1 A;  2JRT A;  1G3Y A;  4I7H A;  1D8J A;  1ZAO A;  1UHW A;  1E2X A;  4KYW A;  1JHF A;  2JZY A;  3WOD F;  1U78 A;  2C6Y A;  4KIG A;  3E97 A;  4OMZ A;  3DPT A;  2HYG D;  1T0F A;  1W5S A;  3C7J A;  2A69 F;  3F6O A;  2F5F A;  3HRS A;  3PFI A;  4M9X A;  3VEP A;  2V79 A;  4EV0 A;  4YG2 F;  5H20 A;  2PLY A;  3R0J A;  4HLY A;  2K4J A;  3F22 A;  3V7C A;  4L5I A;  4KDP A;  4F7Z A;  4BYY A;  2IVM A;  1UCR A;  5D5V B;  3DEU A;  1G3W A;  1H9G A;  2KJB A;  3K9T A;  4DQ2 A;  4A6E A;  1G6N A;  2M30 A;  3KEQ A;  2KKO A;  3Q5F A;  3J81 Z;  3I71 A;  2QEN A;  2XHK A;  2IPQ X;  2PN6 A;  1MJB A;  4HQE A;  4U0W A;  4WK8 F;  5ED4 A;  3SXY A;  1RI7 A;  4TV7 A;  5TJJ A;  5L3G A;  4GXO A;  2L01 A;  3TOB A;  3IRR A;  1IF1 A;  4L5J A;  5BPI A;  1V4R A;  1QGP A;  1IN8 A;  4KIC A;  4MHG A;  2LDU A;  2QYO A;  2HGC A;  1LEA A;  4XBF A;  5DV5 A;  1ODD A;  2VN2 A;  1I1G A;  4GO1 A;  1O3T A;  2IT0 A;  2ZNZ A;  1XCB A;  5F64 A;  3GEZ A;  1DP7 P;  2ADU A;  2O6G E;  4RS8 A;  3M8E A;  2V6C A;  5DUI A;  2MA3 A;  3DXJ F;  1PUE E;  5L3D A;  4S04 A;  3T0Y A;  4G6D A;  1LVA A;  1P4W A;  5JHU A;  4FX4 A;  5BPD A;  1KQ0 A;  4KUM A;  3G73 A;  5LBQ A;  2A6H F;  1OMI A;  4S05 A;  1IN6 A;  3WE3 A;  1PP7 U;  1JHH A;  3IHU A;  1TBX A;  3SHF A;  2EK5 A;  1AOY A;  4HX8 A;  2DPU A;  1YQA A;  1IUY A;  4L9T A;  2XGX A;  3R60 A;  3TQN A;  1IN7 A;  3TDZ C;  3GZ5 A;  2YR2 A;  2RC4 A;  3E5U A;  4Q48 A;  5ILS A;  3GWZ A;  3JTG A;  3FMQ A;  2KRF A;  3NQO A;  5DYM A;  3TKY A;  1FX7 A;  3F8M A;  3T8R A;  2JPC A;  1FOK A;  4LLG F;  4KNY A;  1XGS A;  4EGY A;  2MH9 A;  3V8J A; 
#chains in the Genus database with same CATH topology
 2L2O A;  4HX7 A;  2OJE D;  2E1C A;  2JVG A;  1LNW A;  3DFG A;  2V9P A;  3TBI A;  5F1R A;  1SMY F;  3VSL A;  9ANT A;  4PSX A;  2FJ1 A;  3GXO A;  3GTL J;  2OA4 A;  1SMT A;  1MND A;  1NH3 A;  2LY9 A;  3R6S A;  4WF2 A;  2NOG A;  2CYY A;  2VQC A;  1Y39 A;  1DP3 A;  4HDV A;  2L7Z A;  4CSW A;  4IHY A;  4IRH A;  3D5L A;  2R4G A;  1FC3 A;  4RDU A;  1P2F A;  2Z5U A;  3W2A A;  2K9S A;  1HSJ A;  3MKW B;  4G6T B;  3A01 A;  2IBD A;  2Q2E A;  3CJT B;  1YHQ I;  1HW1 A;  3F9K A;  4UB6 C;  5BMZ A;  1YOV B;  3F0C A;  2LP0 A;  1V54 H;  1XG1 A;  2PMZ N;  3ZMT A;  2V6E A;  3ZQH A;  1Y8Q B;  2X51 A;  1LEB A;  2PJR B;  4UUS B;  5JLX A;  2F5E A;  4NQW B;  5IT9 Z;  2EZK A;  2PQ8 A;  2PEX A;  4HRI A;  3L00 A;  4HF0 A;  2EB7 A;  2VXD A;  4ESJ A;  3DTI A;  3FM5 A;  2RVC A;  1MMA A;  3LSR A;  4R79 A;  2BHY A;  1OCC H;  2CQX A;  4FTH A;  3I0T A;  4A6D A;  5F1J A;  2MYS A;  3ASN H;  1IRG A;  4BGD A;  4OIQ F;  4M3G A;  4XSX F;  2E2H J;  3FDY A;  3HYI A;  2CQQ A;  3OYA A;  3HSF A;  4HST A;  1BR4 A;  3HPG A;  2K27 A;  2KRC A;  1TTY A;  1LE8 A;  3CD6 I;  4V2F A;  4A3B J;  2NVU B;  4LB6 B;  2ME0 A;  2WAQ A;  1G4D A;  3M9A A;  5LFA A;  4ITV A;  2KIU A;  2RKH A;  2DCE A;  4IVN A;  3V7R A;  1WJE A;  2OQG A;  3PQJ A;  5E8I A;  3AKZ A;  1MBG A;  4AIH A;  1A31 A;  1U2W A;  1T08 B;  4Y33 A;  1Z0X A;  2EBI A;  5K5O A;  2Q8K A;  3J80 K;  3F8N A;  5C3E J;  2EPF A;  4PJM A;  3QP5 A;  1X1C A;  2ZME C;  1MBH A;  4DYC A;  1R23 A;  4XK4 A;  1CGP A;  1D8K A;  1DPR A;  1FZP B;  5HOD A;  3LAP A;  3I58 A;  1WJ5 A;  1TT5 B;  2BXZ A;  2DN0 A;  2EFP A;  4RLQ A;  3WU0 A;  1T95 A;  3BZC A;  2M87 A;  2YS9 A;  3FZV A;  5J40 A;  3JRC A;  3EUH A;  5EZG A;  5GAD J;  3BZ6 A;  4IHW A;  1K61 A;  2M34 A;  1K79 A;  5ICE A;  3DQV C;  2O03 A;  1EJ9 A;  1JT0 A;  1C0W A;  1MBJ A;  2HTJ A;  2V4J C;  1ENH A;  3OYM A;  2KHM A;  3W2W A;  1HW5 A;  4EJT A;  2MGQ A;  4L18 B;  1W36 C;  4UXN A;  3WTW C;  3PNY A;  3J7A O;  5CVV A;  2EIL H;  2PJR A;  4UUS A;  1YW7 A;  4NQW A;  2R7F A;  2IW5 A;  2DK5 A;  4XL9 A;  1MMD A;  4P55 A;  1LQ1 A;  1K6O A;  5FKM A;  5D4R A;  1FSH A;  2B0L A;  1KZH A;  2OUM A;  4IHS A;  1F4K A;  5K5Q A;  5D5X B;  3CLQ A;  3VYR B;  5E17 F;  1BI2 A;  1XSX A;  2Q1Z B;  2YX7 A;  2MC3 A;  4XLA A;  5C4X J;  1F43 A;  5ILU A;  1TWF J;  3LA2 A;  1H9T A;  2VON A;  1WWX A;  3U1D A;  2WBM A;  3KP5 A;  1UHM A;  3O2P E;  5ICF A;  1LUJ B;  5BQT A;  3IRQ A;  3HOU J;  2P5K A;  2ZSH B;  3BLY A;  3ERE D;  1YW9 A;  4M72 A;  3GUD A;  2CV1 A;  2K40 A;  3Q0V A;  5E3O A;  2X9D A;  2FQ4 A;  4BJ6 C;  2VLA A;  1B9N A;  1N77 A;  2R5Y A;  5IT3 A;  3S2H J;  4I0B A;  5DD4 A;  4A0Y A;  3D1N I;  1S29 A;  5HLG A;  1ZLK A;  2W48 A;  2X4H A;  5J1R A;  2QBY B;  3FXL A;  1W36 D;  2KQR A;  2GZW A;  5HLI A;  5LHG A;  2FML A;  1XD7 A;  1YI2 I;  1VQ7 I;  1J9I A;  2GOM A;  4V2G A;  2E5N A;  4M73 A;  2VJJ A;  2CUJ A;  3TO7 A;  3S8P A;  3WTX C;  5E20 A;  4II3 A;  4HLX A;  3HKZ A;  2WV1 A;  2Z9O A;  2V9V A;  4RM2 A;  1KU7 A;  1STZ A;  2DT5 A;  1WCM J;  4NC8 A;  1XB4 A;  3GX4 X;  1JE8 A;  1FBS A;  4DYQ A;  2O3F A;  1H89 C;  3NRV A;  1WI3 A;  3FXO A;  4YFK F;  3OIO A;  5FKN A;  4EGZ A;  1VI0 A;  4BHC A;  3L2U A;  2L4A A;  1U5T B;  2HQN A;  4BQA A;  5ILV A;  3JRD A;  1R6R A;  3ASO H;  3RQ4 A;  1A35 A;  2XGD A;  1MDM B;  1MW7 A;  2A68 F;  3S15 J;  2XC7 A;  5D8L B;  2EA4 A;  3I4M J;  4RAF A;  3CCQ I;  3CZ6 A;  4CZC A;  4OIO F;  4PZJ A;  2JSC A;  4LK1 F;  4UV9 A;  2HKO A;  2JN6 A;  2KL4 A;  1QU3 A;  1T0F C;  4MIM A;  2EFN A;  1OFC X;  4HX4 A;  1D0Z A;  4PDK A;  3ZMV A;  3OS2 A;  2IS2 A;  3M8J A;  5EZH A;  1YRN A;  1ETO A;  3N4M A;  2E35 A;  3WU1 B;  2GQQ A;  3HRT A;  4L9N A;  2ZFW A;  3KZZ A;  5K7F A;  1PJR A;  4PFP A;  2V1D A;  3MKZ A;  3C2H A;  1FYL A;  5EDN A;  3K4L A;  3WTT C;  3I59 B;  3ABT A;  1W0T A;  1BJZ A;  3CDL A;  4BU2 A;  2QBY A;  4Y13 A;  2DT7 B;  4L5E A;  2W7N A;  2M8G X;  4M3D A;  3KET A;  1FTT A;  5F0C A;  3PUB A;  5KHD A;  2DMT A;  2CFO A;  1A5J A;  3CC2 I;  4CDG A;  3H3Z A;  2BY3 A;  2CS3 A;  3O6B B;  1JT6 A;  1FMW A;  4JQF A;  1ZRF A;  1R1T A;  5E1Z B;  5F08 A;  4DNC A;  2UWM A;  3JRE A;  2R7W A;  1BC8 C;  4R8H A;  5JVG F;  3WTZ A;  1JKO C;  2CW8 A;  1MZB A;  3PUF A;  1USS A;  1XSD A;  1XGO A;  1MMN A;  4BEH B;  4E7Z A;  1SD6 A;  4BQN A;  1Y6I A;  2CWE A;  3PIP F;  4B44 A;  1UST A;  3CDI A;  3HOV J;  1EF4 A;  5C44 J;  2L9V A;  4UUT A;  3EYY A;  1BIA A;  5HOO A;  1MDM A;  4M3F A;  3RSN A;  4D5C A;  5A2Q Z;  3BG9 A;  1R5H A;  4M6V A;  1FIP A;  2F48 A;  3PSF A;  5E1W A;  4UVC A;  2A61 A;  4QPQ A;  5IYC J;  3G6E I;  2VC0 A;  5FO5 A;  3OSG A;  1G2H A;  3HIF A;  2BXY A;  1ETX A;  2E7X A;  4O3M A;  1AKH B;  5HLT A;  2D2W A;  1Y1V J;  2CGP A;  3KP3 A;  1ACI A;  3QYB A;  2OCC H;  2RNJ A;  3WGH A;  4D9J A;  1D5V A;  1MNM C;  2CH0 A;  3MZ8 A;  1KGS A;  5DCM B;  2OAZ A;  4YEL A;  2AS5 F;  4G9Y A;  3CCM I;  1XDU A;  5JLW A;  2Y48 A;  1POG A;  4B47 A;  2J5O A;  4L9V A;  1I3A A;  3VOD A;  4HV5 A;  5HNH A;  3KLO A;  5DUK A;  4J01 A;  2LY2 A;  2LF8 A;  4C3H J;  2XAF A;  3MN2 A;  3AL0 B;  3ZRG A;  2XSD C;  1BW6 A;  1TNT A;  2R7O A;  2XGE A;  3WG7 H;  2LY1 A;  4IHX A;  2R7Z J;  4I01 A;  3ZQI A;  2Y9Z A;  2L9N A;  3H0D A;  3FXM A;  4OIN F;  4GYI A;  5L3C A;  5J47 A;  1FSE A;  3OYC A;  3VB2 A;  4DZJ A;  3LSI A;  2EFQ A;  3OIQ A;  2R92 J;  2A05 A;  5JVT A;  4EJU A;  1BL0 A;  2H1K A;  3FK6 A;  1R4M B;  3L9F A;  4DGW B;  2CO5 A;  2HQ5 A;  2TDX A;  5GTH C;  3BWG A;  3PL8 A;  2QKM B;  3GF2 A;  4KT6 A;  1QVU A;  4CCK A;  3JCU C;  4G94 A;  3I56 I;  5IY5 H;  1I39 A;  3ML6 A;  4RAY A;  4LLL A;  1XX5 A;  5EEH A;  1E3H A;  1SFK A;  2DLL A;  3C1D A;  1VFC A;  4XKB A;  2L54 A;  2R3S A;  3BR6 A;  1XMA A;  2FBI A;  3SEQ A;  3FKI J;  4CHU A;  3A03 A;  4M6Y A;  1MNE A;  4EAT A;  1OKR A;  4CA0 A;  2L7K A;  3M8F A;  2EIN H;  1FP1 D;  3I9V 2;  4FAS D;  1KU3 A;  3DV8 A;  1H88 C;  4HSR A;  2P6T A;  1VQK I;  3RKY A;  4LIV A;  4A69 C;  5LHH A;  4G12 A;  3HOZ J;  3I55 I;  2E7W A;  2VQL A;  4RB0 A;  3C2G A;  5K5R A;  1FLI A;  5DCM A;  2QF7 A;  3JSO A;  4PJL A;  2E5Z A;  4ENN A;  3ONQ A;  3GTM J;  3BCA A;  1B1B A;  3BJ6 A;  2IA0 A;  2R7D A;  5CKT A;  4CH7 A;  1REP C;  2R7V A;  2IGO A;  4ZTJ A;  4B1R A;  3FIS A;  1IXR C;  1X1P A;  2HR3 A;  3W6V A;  2F4O B;  3VYU B;  4EVI A;  4BHP A;  3CCJ I;  5ERI A;  1ULY A;  4LK0 F;  4AIJ A;  3J7Y J;  3S2D J;  2YUS A;  3OYL A;  3E6M A;  3H3U A;  3MVP A;  1PUF A;  4XID A;  3F23 A;  1GLN A;  4KN7 X;  1ZG5 A;  3ZMS A;  2MFZ A;  2Y0S N;  5J1U A;  1WVR A;  1AHD P;  3IKV A;  2DMP A;  3OIP A;  4FCY A;  2H27 A;  2F2E A;  2PJP A;  1HCR A;  2R7Q A;  3FXR A;  4AD9 A;  1KYW A;  1Z91 A;  4M71 A;  4ZYD A;  3TDU C;  2VL8 A;  2O7O A;  3IAS 2;  2BVL A;  1KQ8 A;  4KA4 A;  4C30 A;  1CF7 B;  2Z2S B;  1D0Y A;  2IGM A;  1DU6 A;  2VE9 A;  4M3B A;  5LHI A;  2BOL A;  3I54 A;  1Z3Y A;  1OJL A;  1BI0 A;  1O4X A;  1MMS A;  3S16 J;  5HDK A;  1TLH B;  3I4N J;  3GBG A;  1M1E B;  1W7P D;  4UNO A;  2AO9 A;  1Z6R A;  1IV8 A;  2OZ6 A;  3I53 A;  1IAW A;  2RRE A;  1MGT A;  4EEF G;  2E1O A;  2QQ8 A;  1X1B A;  2HQR A;  3QPT A;  2WB1 A;  3GLL A;  2XRL A;  3HBL A;  2DXI A;  4BHB A;  4NC6 A;  1LFP A;  2VQG A;  4O5V A;  1VND A;  1WH7 A;  1ERD A;  3OY9 A;  1TNS A;  1FPQ A;  3TMO A;  1AWC A;  2QSH X;  1TWG J;  3RQI A;  1WJD A;  1P7I A;  1W4M A;  2LG4 A;  3SYT A;  5M3F J;  2JTV A;  2W4S A;  2FRH A;  1V5E A;  1IN4 A;  4LJZ F;  1IRZ A;  5HS8 A;  3K10 A;  1EH8 A;  2ECB A;  4GYG A;  1R58 A;  3CMM A;  2CFX A;  2PMU A;  3VSK A;  4A3J J;  4I98 B;  2ESN A;  2HFH A;  2L3D A;  1HDP A;  3HTS B;  1E3P A;  3KP2 A;  3HPH A;  2M4G A;  2ID6 A;  1F9N A;  2KIF A;  1TQI A;  2GXB A;  1YYV A;  4E6K G;  2P7C B;  3N05 A;  2IGN A;  3GO5 A;  2R5Z A;  1FBQ A;  2B7E A;  1YS7 A;  2QCO A;  2FMY A;  5LGT A;  4AYB N;  5HVQ C;  1B8I B;  3IH3 A;  1MBK A;  4BAY A;  5LRS A;  3KYL A;  3MAJ A;  3DBL B;  4RB1 A;  1OPC A;  4IOC F;  1CF7 A;  4E7L A;  3K70 C;  2NNN A;  3REO A;  1Z05 A;  3CCR I;  2QA4 I;  1V3F A;  4ENJ A;  3FBN B;  1B9M A;  1W1W E;  1WRJ A;  4OMY A;  3UKG A;  2PBI A;  1WFX A;  1IO2 A;  2WAE A;  3KP6 A;  2D1V A;  3WGG A;  2OTL I;  4BQO A;  2I5U A;  4A5N A;  5IYD J;  1BOA A;  5DD8 A;  4LD5 A;  3RYP A;  2VOO A;  2IS4 A;  3RJP A;  2K9M A;  1I27 A;  4BAC A;  4NHJ A;  3EUH C;  5E1X A;  3ABK H;  1G3S A;  1V5F A;  2NYX A;  3HUG B;  4J00 A;  5EGO B;  1XTA A;  3FBI B;  2F5D A;  1HQC A;  4MLO A;  2VB6 A;  4L9J A;  1UG0 A;  2FQ3 A;  4BJT A;  4HF1 A;  1ZH5 A;  1FT9 A;  4A0Z A;  3F3X A;  2F6C A;  3DKY A;  4G8X A;  3QOP A;  4RB2 C;  1WJC A;  3ZQC A;  1I3Q J;  4L0Y B;  1WJB A;  4XLE A;  1K4T A;  3T5X A;  2UXX A;  4YIF A;  1FNN A;  2HKX A;  3ZXS A;  4RMN A;  1NHA A;  2HOE A;  4ESB A;  1R9T J;  4BXU A;  4NC7 A;  1ZRD A;  4B4C A;  4R1H A;  1SVL A;  4RGS A;  4JOM A;  3ZP5 A;  2MLK A;  4IPA A;  2H09 A;  1ETQ A;  1FWZ A;  2P8T A;  1U9O A;  2A6T A;  2LRE A;  1J5Y A;  1R71 A;  3ERM A;  3H9Q A;  3K70 D;  3BPV A;  5E18 F;  4XKV A;  4HOB A;  2E1N A;  5DCF A;  1WZ2 A;  3BTC A;  4XLP F;  2CW7 A;  1FYK A;  1JGS A;  1T33 A;  1GT0 C;  5GPA A;  2LFB A;  2M7A A;  3BPX A;  2DOE A;  4PJJ A;  5L3E A;  3DPL C;  2JA7 J;  2EJR A;  1B8I A;  4ZH4 F;  3K4J A;  3H5A A;  4H4K C;  2BW3 A;  2LSO A;  5CVU A;  4G7Z F;  3ZMD A;  3CP2 A;  4NUB A;  4F91 B;  3GYH X;  5LGU A;  5FFX A;  1BW5 A;  3LQR A;  3DBH B;  2G7H A;  5FLX K;  2XSJ C;  1X3W B;  1B72 A;  2CUZ A;  4HEA 2;  1PVE A;  2EFW A;  3ZR8 X;  3ELK A;  3ROU A;  3OYD A;  3E1S A;  1R1U A;  2HDC A;  2H1L A;  3GFJ A;  2ZC2 A;  4XN3 A;  1MMG A;  3LNQ A;  1MD0 A;  1ON1 A;  2RN7 A;  3CUQ B;  1VQM I;  3HUG A;  2W24 A;  3PO3 J;  5EGO A;  1ORK A;  2FU4 A;  2MBF A;  3S1N J;  4HNV A;  3TGN A;  3BOQ A;  2QQA A;  4D0P A;  5DEQ A;  3RPQ A;  2X1C A;  4A3E J;  1J2X A;  5J3L A;  4DIQ A;  4FX0 A;  4C3J J;  2DJN A;  5FFZ A;  1UG2 A;  2BZT A;  2XB5 A;  1YIJ I;  1DGW Y;  4PCQ A;  4CYC B;  3CCL I;  3IKT A;  4U87 A;  2B9S A;  1QBJ A;  1ZGJ A;  3CC4 I;  2Y2Z A;  4WX9 A;  2CJJ A;  2I10 A;  1UFM A;  2XV4 S;  2IXS A;  2JT1 A;  2EV0 A;  3SFI A;  2K9Q A;  3J80 Z;  1ZAR A;  2D5V A;  2LRD A;  2LMD A;  2A3S A;  5IOY A;  3SDB A;  4Y7N J;  4FE7 A;  5J4V A;  3OL4 A;  2VBZ A;  1HW2 A;  4N9I A;  2FEZ A;  4I0A A;  1HBX G;  1W0U A;  4DBR A;  2P81 A;  2GA1 A;  2LVS A;  5KVR A;  2EV6 A;  1P7J A;  4X1E A;  4GFB A;  2MLG A;  1P4X A;  4U88 A;  3K7A J;  2O0Y A;  4GCV A;  2NS7 A;  3EUA A;  2R7X A;  2P6S A;  1LPQ A;  2VIX A;  2MC4 A;  1IXC A;  1HKS A;  5B3S H;  1VQN I;  5DDG A;  1OR7 A;  3A1Y A;  3HHG A;  1FTZ A;  2M4K A;  2W00 A;  2K9L A;  4OOI A;  1Z21 A;  3CLO A;  4P9U A;  3RIR A;  1TT0 A;  2GWR A;  2JUG A;  5CVJ A;  2FNA A;  2KFD A;  2LH9 A;  5F04 A;  3JRA A;  3JRG A;  1X4O A;  4BY7 J;  5M5X J;  4MNU A;  2UV1 A;  3DTK A;  4JK1 X;  1E0E A;  3HXL A;  1E17 A;  2MD5 A;  4KIT B;  4BDY A;  3BT9 A;  3CO7 C;  2PI0 A;  2IS6 A;  2R7S A;  1TC3 C;  3GFM A;  3CUQ A;  1DDN A;  2DOD A;  4HBL A;  3PSI A;  4XRS A;  1XGM A;  2OF7 A;  3BCB A;  3MZY A;  3QP6 A;  3S93 A;  1K6Y A;  1T39 A;  1IRF A;  2BE5 F;  4XLN F;  2P7V B;  2LR8 A;  3WHB A;  1ZN2 A;  3WTS C;  2FUG 2;  1OYI A;  4RA2 A;  2DAO A;  5D6F A;  5EJC A;  5J4Y A;  3G71 I;  1K78 B;  4OIR F;  4XIC A;  1U5T C;  4CXF A;  1GUU A;  3KZI C;  4Z6Y A;  1U6G A;  3SFZ A;  5FJ8 J;  1JGG A;  1OYY A;  2HI3 A;  2M3A A;  4OU0 A;  2DO7 A;  2E36 A;  2PMZ A;  3DF8 A;  3JSP A;  3WTU C;  2RDP A;  4ZTF A;  1HF0 A;  3DCF A;  2L4M A;  2XUB A;  4DOZ A;  2Y0M A;  3DKW A;  5F0F A;  3MKL A;  3MKY B;  2KDZ A;  2L7M P;  4B43 A;  3CMA I;  3HC7 A;  1D1A A;  4DZP A;  3IUO A;  1SAU A;  2M7B A;  4IXA A;  1EKE A;  3P9K A;  3IP4 B;  3OSF A;  1XGN A;  2HOT A;  4XOP A;  3CCS I;  1XDS A;  2K02 A;  3MD2 A;  4W97 A;  4AWX B;  3J7Z I;  3H35 A;  1ZGW A;  2F5V A;  3GME A;  4MQV A;  2DYS H;  4D7M A;  1R00 A;  3E6D A;  4KJZ A;  2DOA A;  1U9N A;  3HSE A;  2QQB A;  1HST A;  5TIS C;  1S8N A;  3GCM A;  1SEU A;  4BQQ A;  4Y52 J;  3FHZ A;  5HNF A;  3FXU A;  4FT8 A;  3H5N A;  4HA8 A;  3DTE A;  1YFH A;  3BTJ A;  4MTE A;  3RI4 A;  3ECO A;  2D45 A;  2LKP A;  1O7F A;  3HRM A;  4MEY F;  3PM1 A;  4XOT A;  4F3Q A;  4Q4Z F;  4IHT A;  2DT6 A;  4UUV A;  3S1R J;  2HYF A;  1PP8 F;  2IA2 A;  4UVB A;  2WAD A;  4A3I J;  4NBQ A;  3MQ0 A;  3A2K A;  2E1M C;  2FA5 A;  4IX7 A;  5IP6 A;  3SEZ A;  3T1B A;  1SVM A;  4FIS A;  2A5W A;  3K2Z A;  5J8C A;  1EH6 A;  1Z7U A;  2K5C A;  5GAH J;  5JI6 A;  1R4N B;  4RGU A;  4IRI A;  2FBH A;  4UY8 I;  4RAZ A;  2HYJ A;  5E8G A;  3OYG A;  2EIM H;  3OYF A;  1IV6 A;  1L3L A;  3ZQG A;  4KMU X;  4AU7 A;  3NEU A;  3VOE A;  3KLN A;  1JKR C;  2JK3 A;  2FE3 A;  4ESF A;  2ZME B;  2W25 A;  2YPR A;  1D0X A;  3O8H A;  3ZN1 A;  3L2C A;  3LAJ A;  2WY8 Q;  5GAE J;  3Q9S A;  3JR9 A;  4B8X A;  2XAJ A;  5LEJ A;  1ZG3 A;  3K4C A;  4PGG A;  1B59 A;  1TW2 A;  4EQQ A;  1JXS A;  2IP2 A;  5CJ9 A;  4A5M A;  3V8K A;  1BA5 A;  2FSW A;  4OAY A;  5BS6 A;  2FF4 A;  5FKL A;  4ZYG A;  2WV0 A;  1F5T A;  2VE8 A;  1V5G A;  2XVC A;  4QPO A;  1SD5 A;  1I6H J;  1OLT A;  3ZQ7 A;  4XNF A;  5FD5 A;  4XSZ F;  5D8K B;  4UHT A;  1D3Y A;  3ECH A;  3QAH A;  5EYR A;  4E4H A;  1IJW C;  3KP4 A;  1LB2 A;  2O5R A;  3FK7 A;  2QKL B;  2O9L A;  1SFU A;  5CYV A;  3JAM Z;  5EG0 B;  2GA2 A;  1BN5 A;  3OOU A;  3ZCO A;  4WXH A;  2STW A;  3KFW X;  4XMY A;  3LMM A;  3AL0 C;  2BY0 A;  4LG0 B;  3VPR A;  2EZI A;  3JW4 A;  1RUN A;  1ZYR F;  2DJI A;  3MFK A;  1LJ9 A;  2JRM A;  4XLF A;  1WKM A;  5L3F A;  3ABL H;  2VKE A;  2R7R A;  4XON A;  3K4M A;  1VQ6 I;  2E19 A;  3F21 A;  4XOR A;  1QZY A;  5FRO A;  1J75 A;  3RPU D;  4CGZ A;  4ZC3 A;  1HKT A;  2Q0O A;  3KP7 A;  1UJ8 A;  5LD2 C;  1LDJ A;  4LMY A;  1APL C;  2HOS A;  1EH7 A;  3SQN A;  1A36 A;  3OR2 C;  1O7L A;  3JRI A;  3FF5 A;  1FOY A;  4HQM A;  1Q1H A;  4JBA A;  4LFU A;  3S3N A;  1TQM A;  4QIW N;  2F4M B;  2HS5 A;  2L5Q A;  4EM2 A;  1SFE A;  4KIS A;  2NNY A;  5LEK A;  1YLF A;  2F5C A;  4G6Q A;  1D1B A;  2FD5 A;  1NG7 A;  1U5T A;  3FX3 A;  1WGX A;  2HZT A;  2WC2 A;  4DYR A;  2W57 A;  1S72 I;  2KJC A;  3Q0W A;  2BBY A;  4JYK A;  4MFD A;  3JTH A;  3HTU A;  4A3D J;  2ETH A;  1UB9 A;  2LF7 A;  2DU9 A;  4BS9 A;  4Q47 A;  2LLK A;  2BYV E;  2JMW A;  1U8R A;  3LSM A;  5KAI C;  2MH2 A;  3C18 A;  3EDP A;  5AIQ A;  5ICC A;  2HZD A;  1HA8 A;  3LA3 A;  3HM5 A;  1VTN C;  4Q5S F;  1ETY A;  3SZT A;  1YIT I;  3AG3 H;  2DYR H;  4QLC U;  3CMY A;  4E7J A;  3PO2 J;  1PDN C;  2CG4 A;  4A2U A;  1FJL A;  2X6Y A;  5EG0 A;  1U8B A;  1DPU A;  4RM3 A;  1ZGA A;  2HEO A;  3M1C A;  4I2O A;  4BE1 A;  1K7A A;  1R49 A;  3EQL F;  1OCP A;  2KIM A;  3K6G A;  4LG0 A;  3VDX A;  2DMN A;  2EZL A;  3RZO J;  1VQ5 I;  1OCO H;  1ZLJ A;  3I59 A;  4GGG A;  2IEK A;  2V1U A;  4A3C J;  3E5X A;  4CO8 A;  4BL0 B;  4MEX F;  5KNL A;  3BQY A;  1Y0N A;  3AAF A;  2UZK A;  2X6X A;  1ZRE A;  1FBU A;  4XRM A;  2L02 A;  3S2W A;  4AVZ A;  5DTD A;  4DJA A;  1LFB A;  5IP7 J;  2HPI A;  3M3Y J;  4ZDO A;  2DA4 A;  3OOP A;  1LVK A;  1Y0U A;  4M3E A;  3BQZ A;  4C2U A;  3X2Q H;  3K4B A;  2HVR A;  2GBY A;  4BEH A;  4BBS J;  2EH3 A;  4PK4 A;  2ID3 A;  1WJA A;  3COA C;  2H8R A;  1RUO A;  2CUE A;  1H8A C;  4MTD A;  3Q3S A;  2QVO A;  3MWM A;  4HV6 A;  1J7K A;  3TL4 X;  3CF2 A;  1IZ1 A;  4IF4 A;  3WG9 A;  2XAQ A;  2DMU A;  3CCV I;  1MH4 A;  4OAZ A;  3S3O A;  3W2V A;  4IKF A;  2L0K A;  3FKJ A;  4CCO A;  5IP9 J;  1T2K A;  3L7W A;  4V19 K;  1T56 A;  1JTY A;  4C3I J;  3P9I A;  3E0J B;  2P5V A;  1YG2 A;  1S7O A;  2VXZ A;  3HDD A;  4BUP A;  4YFX F;  1AKH A;  2HNH A;  4ZDL A;  3SZG A;  4P5O A;  3AFH A;  2ZFU A;  2HXO A;  2LKX A;  1KU2 A;  3QPH A;  5AON A;  4ASN A;  3BC8 A;  1ZTR A;  3BR5 A;  2EZH A;  4WCG A;  4J19 A;  1LDK B;  4IO9 F;  5TGT A;  2DFE A;  1QQI A;  2D1H A;  1RIO H;  3HEF A;  2VKH A;  2LKS A;  2L7F P;  2VBX A;  4O6J A;  2QSG X;  3S1Q J;  1ZKG A;  2JQ7 A;  5B1B H;  1TQP A;  1BI3 A;  2ISY A;  2M0C A;  2MG4 A;  2V26 A;  2OC6 A;  2CV2 A;  1XN7 A;  2JA6 J;  3ABM H;  3KEO A;  2NVQ J;  3S3M A;  1SFO J;  4MO7 A;  5F6F A;  4G7O F;  3VWB A;  2CV0 A;  1KON A;  2XPU A;  4QSH A;  5ICG A;  1R22 A;  3G3Z A;  4IQ4 A;  1D5Y A;  3ABU A;  2ZSI B;  2V9K A;  3GTQ J;  2XGC A;  5JR3 A;  1MBE A;  2NOJ B;  2OD5 A;  2XRN A;  4YRV A;  5JFR A;  1VQL I;  4EJV A;  1BJA A;  1KYZ A;  3HOY J;  1BR2 A;  3CO6 C;  1OIS A;  3KIO A;  3J7A Y;  2UXN A;  2EA2 A;  4PJN A;  3HGY A;  3HL2 A;  2ELH A;  2K4B A;  4F52 A;  3JRH A;  1XSV A;  5B66 C;  2HVQ A;  2VI6 A;  4MQ9 F;  1VQO I;  1O57 A;  1SD7 A;  3HOX J;  5C4J J;  1HDD C;  4RB3 C;  1RKW A;  5D5W B;  2Y75 A;  4D1Q A;  4A0X A;  2M9H A;  1YTY A;  2XKO A;  3O3K A;  1BI1 A;  3KYD B;  2HDD A;  3BP8 A;  3RKW A;  2QWW A;  4ZZD A;  3KZY A;  1QPI A;  3E6C C;  3GZ6 A;  4BBR J;  4KFC A;  3MMY B;  1Z9C A;  1YS6 A;  4HYE A;  1S6L A;  2XAS A;  3L2Q A;  2XPW A;  2DQR A;  1J59 A;  4E7K A;  3G1M A;  4BNC A;  4OIP F;  2LK2 A;  4A12 A;  3QPS A;  3M7G A;  2COM A;  1MJA A;  1MJ9 A;  5CVR A;  2KRH A;  2W84 A;  2E34 A;  3HGG A;  1XCV A;  4AVP A;  1IN5 A;  5D6E A;  2FXA A;  3K2A A;  1HLV A;  4XM3 A;  5HDG A;  3TW6 A;  1RC9 A;  2H8W A;  2YU3 A;  1Z3X A;  3F72 A;  2ESH A;  5J8F A;  4X6A J;  3F6V A;  4PJ0 C;  3R61 A;  2RQQ A;  1K4S A;  4HF2 A;  3GFI A;  3BJO A;  3VFZ A;  3TO9 A;  3HB9 A;  2WWY A;  4E7H A;  5HLH A;  4CIC A;  1RZ4 A;  2VUM J;  2X0L A;  4N4O B;  2BGC A;  5HS7 A;  1BM9 A;  1UZC A;  2JA5 J;  2COB A;  1R5G A;  3LOC A;  3QOE A;  5FKO A;  4PGH A;  4CZZ A;  4II2 A;  4ETS A;  5DS9 A;  4M6X A;  2IRF G;  4KIB A;  2RV8 A;  2CMP A;  2XF5 A;  5BNG A;  3RZD J;  1GVD A;  2OBP A;  1OR7 C;  4XRS G;  5KAF C;  2NVY J;  4A3L J;  1JKP C;  3OYB A;  2AQE A;  1Q1V A;  4NNJ A;  4W1U A;  4JX6 A;  4ANJ A;  3FXK A;  4LGW A;  1W7P B;  2Y0S A;  3DPU A;  3TED A;  2XKP A;  5M5W J;  1VQ4 I;  1GV2 A;  3BG5 A;  2RQP A;  5K7Z A;  3J81 K;  4ZDP A;  1SAN A;  2KZG A;  3LQQ A;  3LSK A;  4WXC A;  1RNL A;  2JUC A;  4LB5 A;  1I5Z A;  1P6R A;  3P5J A;  1GXQ A;  4CYD A;  5B1A H;  5EEG A;  1N25 A;  2CQK A;  3IC7 A;  1MKM A;  2AXT C;  2DFI A;  3CUQ C;  5CVI A;  3SZP A;  2YU9 J;  1NG6 A;  1ZG1 A;  2GIZ A;  2VAS A;  2JPB A;  1TZL A;  1T6S A;  2HDW A;  2OCE A;  3QYF A;  3R0A A;  2VQH A;  3OYK A;  5M3M J;  4IQJ A;  1K83 J;  4IOA F;  1XMX A;  3BR1 A;  4HDU A;  5H6R A;  4AM3 A;  2XDV A;  1SVO A;  2G9W A;  2E60 A;  4I99 C;  4AUX A;  1B6A A;  1S7A A;  3LL7 A;  1YJ9 I;  4DBQ A;  3CCU I;  2XRO A;  4HAM A;  2ZCW A;  4YIR X;  3Q0U A;  2Z33 A;  2EIJ H;  3BJA A;  4D5F A;  3LA7 A;  3H92 A;  5FLX Z;  2Y30 A;  2K7L A;  2VBY A;  2NXN B;  3KX2 A;  3BG7 A;  2ACJ A;  4A3G J;  1R5I D;  2EQR A;  3QOD A;  1S7E A;  3TP3 A;  5KCM A;  2HVS A;  1IRX A;  3NAU A;  3A01 B;  1WSU A;  2KT0 A;  1QHG A;  1Z7L A;  1QO0 D;  2Q2E B;  2WTE A;  2VT3 A;  3BTL A;  4EJO A;  3V7S A;  1FYM A;  4UB8 C;  3PIO F;  1ZEL A;  3HSR A;  2HXI A;  4Y15 A;  5LGN A;  3RKX A;  3IWF A;  3BR2 A;  3I3L A;  3ZQF A;  1NK3 P;  2DPD A;  4BJ5 C;  5FB2 A;  1UEL B;  1W7P A;  2G0E A;  2R93 J;  4M9Z A;  4UV8 A;  5CLS A;  2CRG A;  4YEJ A;  4EJW A;  2NRA C;  2KMU A;  2KPM A;  4XLC A;  2ICW G;  2O61 A;  2YX4 A;  5TRD A;  2VBW A;  5E3M A;  4A93 J;  3ZMZ A;  4AYB A;  3CCE I;  3HRU A;  5FLM J;  2WAQ N;  3S17 J;  2VJ4 A;  1R7J A;  5J6X A;  4AC0 A;  1GHC A;  3U9G A;  2X1E A;  2FOW A;  1OYW A;  1IXS B;  3OYI A;  1B4A A;  3LSP A;  1ONV A;  2XAU A;  2X85 A;  2HTS A;  1RRJ A;  1LE8 B;  2CSO A;  4K2E A;  1OCT C;  2K3P A;  4YII A;  1JJ6 C;  2P4W A;  3EPZ A;  1O3R A;  2GOX B;  1YW8 A;  2AHQ A;  1G3T A;  1QRY A;  1IDY A;  1WH5 A;  2A5Y B;  1P4A A;  3C3W A;  2DQL A;  3W6J B;  3SDG A;  1LDD A;  2FOK A;  4Y4R A;  2Z99 A;  4E7I A;  1I1S A;  3B02 A;  3BR0 A;  3HHH A;  5GTI C;  3IH2 A;  4P96 A;  1ON2 A;  1VQP I;  3KPH A;  2KZV A;  2VPL A;  4BH9 A;  4M9S A;  3V42 A;  1WI9 A;  2EIK H;  3LWF A;  3IL2 A;  1JUM A;  4U7B A;  3BDD A;  1BBY A;  1X58 A;  1GVJ A;  5GP9 A;  5AIP A;  3K69 A;  1ZR4 A;  2BHZ A;  3MCZ A;  3BY6 A;  3RTR A;  2P5L C;  2J5P A;  3ZMU A;  3CJN A;  2IJL A;  4HNT A;  4XN0 A;  2ECC A;  2XB0 X;  3GVA A;  4IZZ A;  1T8I A;  3S14 J;  2ISZ A;  3CJR B;  1BC7 C;  3B6A A;  4BE2 A;  2EV5 A;  3G4S I;  4KN4 X;  1FY7 A;  5D5U B;  2RGV A;  3JRB A;  4LLN A;  2VT2 A;  3HOW J;  2DA2 A;  2FX0 A;  3P7N A;  3G1O A;  3GLX A;  2DTR A;  3V4G A;  4Y17 A;  4UVA A;  1DUX C;  2M1B A;  3KYC B;  4XRF A;  3QRF F;  1HKQ A;  3E5Q A;  4ZYE A;  2PX9 A;  4RLF A;  1J09 A;  4IL6 C;  3U2R A;  3W3C A;  2QUF A;  3E6B A;  3H3V K;  2QGU A;  1RR8 C;  4N0B A;  2KLO A;  3M1E A;  1EA3 A;  1EV7 A;  2KDO A;  4KT5 C;  1KA8 A;  5H6Q A;  3OS0 A;  2DDA A;  2MD0 A;  4Y3O A;  1F1Z A;  5FGM A;  3FM3 A;  2V7F A;  3HG9 A;  2IS1 A;  2DK8 A;  2PG4 A;  5GAG J;  4B3A A;  1I50 J;  4XKC A;  3ZN0 A;  4C2M J;  4ENM A;  5J1Y A;  3CQZ J;  2DA1 A;  1X19 A;  2W85 A;  1X1A A;  4QWQ A;  2M0M A;  4ZZL A;  2BV6 A;  1J0R A;  2N8G A;  1A04 A;  3ZGK A;  4ZJZ A;  2R5Y B;  1ZR2 A;  1Z6T A;  1SFX A;  1P9Q C;  1ZK8 A;  3MEX A;  4CYC A;  2QEX I;  3N97 A;  2G7U A;  3DP7 A;  5IT9 K;  1JUP A;  1MSE C;  4MGR A;  2IAI A;  4F55 A;  2LC2 A;  1L0O C;  1MH3 A;  2ZO4 A;  3QU3 A;  3HKZ N;  3BR3 A;  1RPW A;  4GRI A;  3PNT A;  1Y56 A;  4HZF A;  2HU9 A;  1S3J A;  3F8F A;  4A3F J;  2VJ5 A;  3PJR A;  1XMK A;  4RGX A;  3PQK A;  2E71 A;  5KK1 A;  1IW7 F;  1V55 H;  1SAX A;  3W6K B;  3DWL E;  2KP6 A;  2CUF A;  2NVX J;  3LFK A;  3GTO J;  3JRF A;  2A07 F;  2LBF B;  1X2N A;  1HOM A;  2JVH A;  1YO5 C;  2XIG A;  2Z1D A;  4PFO A;  3L2W A;  4QTR A;  5LRR A;  1BOB A;  2ZXH A;  4G7H F;  2XF6 A;  3G2B A;  1QZZ A;  4XKW A;  3LST A;  3TOA A;  2F4I A;  3OV8 A;  2EFO A;  2GIV A;  3GZN B;  3H1C A;  2ZJ2 A;  2QM3 A;  4U7D A;  3QWL A;  2HQA A;  3L1P A;  1LFU P;  1HXD A;  3K0L A;  4KMF A;  3KCC A;  1QNT A;  3ZQL A;  1WQ2 A;  2NS0 A;  2DA6 A;  3BTI A;  5FD6 A;  3L09 A;  1VF9 A;  2DI3 A;  2DA7 A;  2WAF A;  5IOZ A;  4U0V A;  1OQY A;  3G1L A;  3U21 A;  5DM6 F;  3I64 A;  2VOP A;  4A3M J;  2KIS A;  3F8C A;  5BOX A;  1IC8 A;  3PNV A;  1YRN B;  2QQ9 A;  3Q9V A;  2DFF A;  1FOX A;  3CP8 A;  1PYV A;  1W5T A;  1P92 A;  2O8K A;  2AXL A;  1RET A;  3CC7 I;  3K1N A;  4ON0 A;  3K1P A;  1R1V A;  2GXA A;  3R4K A;  2LNB A;  1RES A;  1WPK A;  2VJI A;  3D5S C;  3RYR A;  3E3V A;  1K78 A;  5FLV A;  2P0W A;  5B5E C;  2JA8 J;  2M8E A;  1IG7 A;  1QPM A;  3ISP A;  2UUZ A;  3D5R C;  1QA6 A;  4PUS A;  2FNP A;  1N75 A;  5JHF A;  2ZNY A;  4L0Z B;  4P9F A;  1FP2 A;  2DW4 A;  4IJA A;  3RKQ A;  2K86 A;  2ZXJ A;  4KIF A;  2LBF A;  1T38 A;  4JP0 A;  1VZ0 A;  1O3S A;  3B73 A;  3WTV C;  4CCJ A;  3CUO A;  3UR3 C;  1ZQ3 P;  4HPQ A;  1Y8R B;  3OR1 C;  4MFE A;  2EWN A;  2Y69 H;  3WHC A;  2XF7 A;  4HNU A;  4WXD A;  4ZYH A;  1CQT A;  2ZBK A;  3ULQ B;  4D7N A;  1BIB A;  1NK2 P;  4JX4 A;  2OZU A;  2Z3Y A;  2FBK A;  4YFN F;  4E7S A;  3WGI A;  5E3N A;  3BRO A;  3FMR A;  2VPR A;  4PSW A;  2VOD A;  1KQ9 A;  2JWT A;  2OQR A;  4AID A;  3OMY A;  3CDH A;  3MZH A;  2NAZ A;  2ZKZ A;  3A0H C;  3LFU A;  2ZXI A;  1H0M A;  2JA2 A;  1MSF C;  1TW3 A;  3A4C A;  1ETW A;  2XAH A;  4FHT A;  3ZOB A;  2ELJ A;  1A6Q A;  2DMQ A;  3L2R A;  1F36 A;  3HOS A;  2O8X A;  1GV5 A;  3K4K A;  2CW0 F;  3DLL F;  1I6X A;  1BR1 A;  4LIU A;  1SD4 A;  3H0G J;  5IYB J;  3HOT A;  3QYE A;  3LSG A;  2M2E A;  2ZJP F;  3BG6 A;  3BG3 A;  2QZ8 A;  1TWH J;  5L3B A;  4IRG A;  1WJF A;  4IHV A;  3VYS B;  2QSF X;  1RKT A;  3I4P A;  5F27 A;  1Z1D A;  1IGN A;  2ZME A;  2VC1 A;  3WE2 A;  5CQG A;  4B09 A;  3KE2 A;  4Z2Y A;  5E79 C;  4EM0 B;  1MIJ A;  5DM7 F;  2PMH A;  2R0Q C;  1NTC A;  4BXX J;  1DGR M;  1RR7 A;  3H5R A;  2VKV A;  2W82 A;  4NB5 A;  3WTY C;  2E1M B;  5HS9 A;  3M4O J;  2DBB A;  1YE9 A;  4E70 A;  3OS1 A;  3NWT A;  1OCR H;  3FXQ A;  3CCY A;  3EET A;  4RGR A;  5D4S A;  2L9R A;  2V1X A;  5EEA A;  4CCL A;  5K1Y A;  3K1M A;  5HDN A;  2R7U A;  3JAM K;  4A3K J;  1TL8 A;  3FMS A;  2GXG A;  2H94 A;  3D0S A;  1UMQ A;  3V8L A;  3M07 A;  2MAB A;  5LLQ A;  3GTG J;  1XPX A;  3WU2 C;  4HW0 A;  5E3L A;  1N78 A;  4EMS A;  3AG2 H;  2GM4 A;  4JX5 A;  4GDF A;  2ELK A;  4I09 A;  2BY1 A;  3IWZ A;  3LSH A;  2OPT A;  2TRT A;  3OYE A;  2YSR A;  3GFL A;  3E7L A;  1S5L C;  2NS8 A;  1JI8 A;  4H0E A;  2PFB A;  1X3Z B;  2HWV A;  1X3U A;  4HG2 A;  1VQ9 I;  2M5W A;  4U0Y A;  1ZRC A;  1GXP A;  2BEO A;  4AIK A;  4RAG A;  1ETV A;  4EM1 A;  3RDI A;  2W1O A;  4I02 A;  4BDZ A;  1FIA A;  2MW8 A;  2GAU A;  3QQA A;  2OU2 A;  4N9H A;  2H6B A;  1A6I A;  1UAA A;  2K3F A;  5H2F C;  2DA5 A;  3OYN A;  1TP4 A;  3TO6 A;  3L2V A;  1O3Q A;  3T8T A;  1U3E M;  1Y1W J;  1YJN I;  3H9J A;  3H9G A;  4LOC A;  2H6C A;  2LTP A;  2QLZ A;  6PAX A;  2XAG A;  4BE0 A;  4S0H B;  2TCT A;  1PUF B;  3ZPL A;  3FWE A;  3I5U A;  2BVM A;  1Z77 A;  5A2Q K;  3S1M J;  1FOW A;  5K7H A;  4ENK A;  3IAM 2;  2VKD A;  3QU6 A;  2CQ7 A;  4WWC A;  1KU9 A;  4I76 A;  2M45 A;  2RAE A;  4RBO A;  1XS9 A;  3K4N A;  3GW2 A;  1T98 A;  4M74 A;  3P9C A;  4N4N B;  1SC7 A;  2A6E F;  2AQF A;  1ZHF A;  1FEX A;  4OWR B;  3CTA A;  1JTX A;  4BXF A;  1IUF A;  3H36 A;  3F8B A;  1YIO A;  4I6Z A;  1R36 A;  3RPU A;  3EYI A;  2STT A;  2IA1 A;  4NDL A;  2JRT A;  1G3Y A;  4I7H A;  3LSJ A;  1D8J A;  1ZAO A;  4B3X A;  1UHW A;  2WA0 A;  2WB1 N;  3C2B A;  1OCZ H;  1E2X A;  4XQF A;  2X6O A;  5GPC A;  4KYW A;  1JHF A;  2HOA A;  3HJE A;  5FKK A;  1X4P A;  2JZY A;  1QHH D;  3WOD F;  1U78 A;  2C6Y A;  3DLA A;  4KIG A;  3E97 A;  4OMZ A;  1HC8 A;  3DPT A;  2HYG D;  3TW7 A;  1T0F A;  1W5S A;  3C7J A;  2A69 F;  1LKX A;  3F6O A;  2V1N A;  2F5F A;  3HRS A;  3PFI A;  2L9S A;  4M9X A;  1YX3 A;  4LIT A;  3VEP A;  3DEW A;  2V79 A;  4EV0 A;  4DW6 A;  1D1C A;  1DQU A;  4YG2 F;  5CQE A;  5H20 A;  3QPL A;  1G59 A;  3GTP J;  2PLY A;  1Z67 A;  5M5Y J;  3R0J A;  2DOF A;  1ITY A;  2KIQ A;  5IPA A;  3A0B C;  3ESW B;  4HLY A;  2K4J A;  3F22 A;  2DDB A;  1E3O C;  3V7C A;  4F93 B;  2I8D A;  2ZJR F;  2Z16 A;  2X6W A;  3PFY A;  2R5Z B;  4L5I A;  4KDP A;  1S9H A;  4C2T A;  4F7Z A;  3VYT B;  4BYY A;  1X2M A;  3AG4 H;  2IVM A;  1UCR A;  3FHN A;  3IH4 A;  5D5V B;  1W5C C;  3DEU A;  2DFH A;  1G3W A;  2NVT J;  1H9G A;  2KJB A;  2ME6 A;  4CCN A;  3OYJ A;  4XLH A;  4P1W A;  3K9T A;  4DQ2 A;  2LYC A;  4A6E A;  1G6N A;  3SJM A;  2M30 A;  5F0H A;  3KEQ A;  2KKO A;  4X0G A;  5EF6 A;  3Q5F A;  1JJ8 C;  3J81 Z;  3I71 A;  3KEY A;  2QEN A;  4LG3 A;  2XHK A;  2IPQ X;  3DEE A;  2R7T A;  2PN6 A;  1MJB A;  2Y9Y A;  4HQE A;  4BY1 J;  4U0W A;  4WK8 F;  3FIW A;  2ZB9 A;  5ED4 A;  3SXY A;  2HPM A;  3DU6 A;  1RI7 A;  4XR6 A;  4C9Y A;  3DBR B;  4TV7 A;  2ZXW H;  5TJJ A;  5L3G A;  1AA7 A;  4GXO A;  1ETK A;  2L01 A;  3TOB A;  3CJQ B;  3EUK L;  4FET A;  3IRR A;  3U1K A;  1IF1 A;  2ZJQ F;  4L5J A;  1JKQ C;  2OTJ I;  3A02 A;  5BPI A;  1V4R A;  1QGP A;  1IN8 A;  4KIC A;  3CES A;  4MHG A;  3DU5 A;  3HZJ A;  2LDU A;  3CF5 F;  2QYO A;  2HGC A;  1LEA A;  4FQG A;  4FE4 A;  2B63 J;  2X1D A;  4XBF A;  2E2J J;  5DV5 A;  1ODD A;  3S32 A;  4ZYA A;  1QZE A;  2OV7 A;  2VN2 A;  1I1G A;  4GO1 A;  1O3T A;  2IT0 A;  2Y31 A;  4IEJ A;  2ZNZ A;  3IV5 A;  1XCB A;  5F64 A;  3GEZ A;  3DKX A;  1DP7 P;  1TWC J;  3ZQQ A;  2BW3 B;  3RCO A;  1IDZ A;  3OWT A;  2ADU A;  2O6G E;  4RS8 A;  3GTJ J;  1FMV A;  2JJ7 A;  3M8E A;  2V6C A;  2IGK A;  1YJW I;  5DUI A;  2MA3 A;  3DXJ F;  1PUE E;  1JUS A;  3BZK A;  5L3D A;  4S04 A;  3T0Y A;  2LD5 A;  1XC5 A;  2CQN A;  1DU0 A;  2XPV A;  4G6D A;  1LVA A;  1P4W A;  5JHU A;  4FX4 A;  5BPD A;  1B72 B;  1KQ0 A;  3UNG C;  2WY7 Q;  4KUM A;  3OL3 A;  2X48 A;  3G73 A;  5LBQ A;  2A6H F;  1OMI A;  1WHU A;  3NWS A;  1G8X A;  4S05 A;  1UHS A;  5FRN A;  1IN6 A;  3B6C A;  3WE3 A;  3AG1 H;  2CU7 A;  2RNG A;  2DTZ A;  3TP0 A;  1PP7 U;  1JHH A;  3IHU A;  3CME I;  2GLO A;  1TBX A;  5FRM A;  3SHF A;  2EK5 A;  1AOY A;  4HX8 A;  1X1D A;  2BY2 A;  2DPU A;  4F92 B;  1YQA A;  1MBF A;  1IUY A;  1U0J A;  4B48 A;  4L9T A;  2XGX A;  3R60 A;  3TQN A;  1IN7 A;  2K85 A;  3TDZ C;  3GZ5 A;  1YX5 A;  2YR2 A;  3FXJ A;  3NAR A;  2RC4 A;  3E5U A;  3OYH A;  1VQ8 I;  4CUG A;  4Q48 A;  1QVT A;  5ILS A;  4BKX A;  3GWZ A;  4CCM A;  3JTG A;  3FMQ A;  3GTK J;  2KRF A;  2JSP A;  3NQO A;  5DYM A;  3TKY A;  1FX7 A;  2LOO A;  1AU7 A;  3O8G A;  1GDT A;  3F8M A;  3T8R A;  2JPC A;  1FOK A;  4LLG F;  1TWA J;  4KNY A;  1XGS A;  4EGY A;  2MSY A;  2DA3 A;  2MH9 A;  2E2I J;  5CPR B;  3V8J A;  4ABZ A;  2K9N A; 
#chains in the Genus database with same CATH homology
 4HX7 A;  2E1C A;  1LNW A;  3DFG A;  5F1R A;  1SMY F;  3GXO A;  2OA4 A;  1SMT A;  3R6S A;  4WF2 A;  2CYY A;  4HDV A;  4IRH A;  3D5L A;  1FC3 A;  1P2F A;  2Z5U A;  1HSJ A;  2Q2E A;  1HW1 A;  5BMZ A;  3ZMT A;  1LEB A;  2F5E A;  5IT9 Z;  2PQ8 A;  2PEX A;  3L00 A;  4HF0 A;  2EB7 A;  4ESJ A;  3FM5 A;  2RVC A;  4R79 A;  3I0T A;  4A6D A;  1IRG A;  4OIQ F;  4XSX F;  3HYI A;  3HSF A;  2K27 A;  1TTY A;  4LB6 B;  1G4D A;  3M9A A;  2KIU A;  2RKH A;  4IVN A;  3V7R A;  2OQG A;  5E8I A;  3PQJ A;  4AIH A;  1U2W A;  3J80 K;  5K5O A;  2Q8K A;  3F8N A;  3QP5 A;  1R23 A;  1CGP A;  1D8K A;  1DPR A;  1FZP B;  3LAP A;  3I58 A;  2EFP A;  3WU0 A;  2M87 A;  3FZV A;  3EUH A;  3BZ6 A;  1K79 A;  5ICE A;  3DQV C;  2O03 A;  1C0W A;  2HTJ A;  1HW5 A;  4EJT A;  4L18 B;  4UXN A;  3WTW C;  3J7A O;  5CVV A;  1YW7 A;  4NQW A;  2R7F A;  2IW5 A;  2DK5 A;  4P55 A;  1LQ1 A;  1K6O A;  1FSH A;  5D4R A;  2B0L A;  4IHS A;  1F4K A;  5K5Q A;  5D5X B;  5E17 F;  1BI2 A;  1XSX A;  2YX7 A;  2MC3 A;  5ILU A;  3LA2 A;  1H9T A;  2VON A;  1WWX A;  3U1D A;  3KP5 A;  1UHM A;  3O2P E;  5ICF A;  5BQT A;  3IRQ A;  2P5K A;  3ERE D;  1YW9 A;  4M72 A;  3GUD A;  1B9N A;  5IT3 A;  4I0B A;  5DD4 A;  4A0Y A;  1S29 A;  5HLG A;  1ZLK A;  2X4H A;  2QBY B;  5HLI A;  2GZW A;  5LHG A;  2FML A;  1XD7 A;  1J9I A;  4M73 A;  3TO7 A;  3WTX C;  5E20 A;  4HLX A;  2Z9O A;  2V9V A;  1KU7 A;  1STZ A;  2DT5 A;  1XB4 A;  3GX4 X;  1JE8 A;  1FBS A;  2O3F A;  3NRV A;  4YFK F;  4EGZ A;  4BHC A;  2L4A A;  1U5T B;  2HQN A;  4BQA A;  5ILV A;  1MDM B;  2A68 F;  5D8L B;  2EA4 A;  4OIO F;  4PZJ A;  2JSC A;  4LK1 F;  4UV9 A;  2HKO A;  2EFN A;  4PDK A;  4HX4 A;  3ZMV A;  3N4M A;  3WU1 B;  2GQQ A;  3HRT A;  4L9N A;  2ZFW A;  3KZZ A;  2V1D A;  1FYL A;  3WTT C;  3I59 B;  3ABT A;  2QBY A;  4Y13 A;  3KET A;  4CDG A;  3H3Z A;  3O6B B;  4JQF A;  1ZRF A;  1R1T A;  5E1Z B;  4DNC A;  2UWM A;  1BC8 C;  4R8H A;  3WTZ A;  1MZB A;  1USS A;  1XSD A;  1XGO A;  1SD6 A;  2CWE A;  1UST A;  3EYY A;  1BIA A;  5HOO A;  1MDM A;  5A2Q Z;  1R5H A;  5E1W A;  4UVC A;  2A61 A;  2VC0 A;  5FO5 A;  3HIF A;  2E7X A;  4O3M A;  2D2W A;  2CGP A;  3KP3 A;  2RNJ A;  3WGH A;  1D5V A;  5DCM B;  1KGS A;  2OAZ A;  2AS5 F;  4G9Y A;  1XDU A;  2Y48 A;  2J5O A;  4L9V A;  3VOD A;  4HV5 A;  3KLO A;  5DUK A;  2LF8 A;  2XAF A;  1TNT A;  4I01 A;  4OIN F;  4GYI A;  5L3C A;  1FSE A;  3VB2 A;  2EFQ A;  5JVT A;  4EJU A;  3L9F A;  2CO5 A;  2TDX A;  3BWG A;  3GF2 A;  4G94 A;  3ML6 A;  4RAY A;  4LLL A;  5EEH A;  2DLL A;  3C1D A;  2L54 A;  2R3S A;  1XMA A;  2FBI A;  4CHU A;  4M6Y A;  1OKR A;  3M8F A;  1FP1 D;  1KU3 A;  3DV8 A;  2P6T A;  3RKY A;  5LHH A;  2E7W A;  4RB0 A;  5K5R A;  1FLI A;  5DCM A;  3JSO A;  4ENN A;  1B1B A;  3BJ6 A;  2IA0 A;  2R7D A;  1REP C;  1IXR C;  2HR3 A;  4EVI A;  4BHP A;  5ERI A;  1ULY A;  4LK0 F;  4AIJ A;  3E6M A;  3H3U A;  3F23 A;  4KN7 X;  1ZG5 A;  3ZMS A;  3IKV A;  2H27 A;  2F2E A;  2PJP A;  3FXR A;  4AD9 A;  1KYW A;  1Z91 A;  4M71 A;  4ZYD A;  3TDU C;  1KQ8 A;  4KA4 A;  1CF7 B;  2VE9 A;  5LHI A;  3I54 A;  1BI0 A;  5HDK A;  1TLH B;  1W7P D;  4UNO A;  1Z6R A;  3I53 A;  2OZ6 A;  1IAW A;  1MGT A;  2HQR A;  3QPT A;  4BHB A;  4O5V A;  1TNS A;  1FPQ A;  1AWC A;  1W4M A;  2JTV A;  2FRH A;  1IN4 A;  4LJZ F;  5HS8 A;  1EH8 A;  4GYG A;  1R58 A;  2CFX A;  2PMU A;  4I98 B;  2ESN A;  2HFH A;  2L3D A;  3HTS B;  3KP2 A;  1F9N A;  2KIF A;  1TQI A;  2GXB A;  1YYV A;  2P7C B;  3GO5 A;  1FBQ A;  1YS7 A;  2FMY A;  5LGT A;  5HVQ C;  4BAY A;  5LRS A;  3MAJ A;  4RB1 A;  1OPC A;  1CF7 A;  2NNN A;  3REO A;  1Z05 A;  1V3F A;  4ENJ A;  1B9M A;  1WRJ A;  4OMY A;  2PBI A;  3KP6 A;  2D1V A;  3WGG A;  4A5N A;  1BOA A;  5DD8 A;  4LD5 A;  3RYP A;  2VOO A;  3RJP A;  1I27 A;  4NHJ A;  5E1X A;  1G3S A;  2NYX A;  2F5D A;  1HQC A;  4L9J A;  4HF1 A;  2FQ3 A;  1ZH5 A;  1FT9 A;  4A0Z A;  3F3X A;  4G8X A;  3QOP A;  4RB2 C;  4L0Y B;  3T5X A;  2UXX A;  4YIF A;  1FNN A;  2HKX A;  1NHA A;  2HOE A;  4ESB A;  4BXU A;  1ZRD A;  4R1H A;  4RGS A;  3ZP5 A;  2MLK A;  4IPA A;  2H09 A;  1FWZ A;  2P8T A;  1J5Y A;  3BPV A;  5E18 F;  4HOB A;  2E1N A;  5DCF A;  4XLP F;  1FYK A;  1JGS A;  3BPX A;  5L3E A;  3DPL C;  2EJR A;  4ZH4 F;  2LSO A;  5CVU A;  4G7Z F;  3ZMD A;  3GYH X;  5LGU A;  5FFX A;  3LQR A;  2G7H A;  5FLX K;  2EFW A;  3ELK A;  3ROU A;  1R1U A;  2HDC A;  3GFJ A;  1MD0 A;  1ON1 A;  2RN7 A;  3CUQ B;  3HUG A;  2W24 A;  2FU4 A;  2MBF A;  3TGN A;  3BOQ A;  2QQA A;  4D0P A;  5DEQ A;  3RPQ A;  1J2X A;  4FX0 A;  5FFZ A;  4PCQ A;  3IKT A;  1QBJ A;  1ZGJ A;  4WX9 A;  1UFM A;  2XV4 S;  2JT1 A;  2EV0 A;  3J80 Z;  1ZAR A;  2A3S A;  1HW2 A;  2VBZ A;  4N9I A;  2FEZ A;  4I0A A;  1HBX G;  2GA1 A;  5KVR A;  2EV6 A;  2MLG A;  1P4X A;  4U88 A;  2O0Y A;  4GCV A;  2P6S A;  1IXC A;  1HKS A;  5DDG A;  1OR7 A;  3HHG A;  4OOI A;  3CLO A;  4P9U A;  3RIR A;  2GWR A;  5CVJ A;  2FNA A;  4MNU A;  4JK1 X;  1E17 A;  2MD5 A;  3CO7 C;  2PI0 A;  3GFM A;  3CUQ A;  1DDN A;  4HBL A;  1XGM A;  3MZY A;  3QP6 A;  1T39 A;  1IRF A;  2BE5 F;  4XLN F;  2P7V B;  1ZN2 A;  3WTS C;  1OYI A;  2DAO A;  5D6F A;  1K78 B;  4OIR F;  1U5T C;  4CXF A;  1U6G A;  3SFZ A;  1OYY A;  4OU0 A;  2DO7 A;  3DF8 A;  3JSP A;  3WTU C;  2RDP A;  2L4M A;  2XUB A;  2Y0M A;  3DKW A;  4IXA A;  3P9K A;  1XGN A;  1XDS A;  2K02 A;  4AWX B;  4MQV A;  1R00 A;  3E6D A;  3HSE A;  2QQB A;  1HST A;  1S8N A;  3FHZ A;  3FXU A;  4FT8 A;  4HA8 A;  1YFH A;  4MTE A;  3RI4 A;  3ECO A;  2D45 A;  2LKP A;  1O7F A;  3HRM A;  4MEY F;  4Q4Z F;  4IHT A;  4UUV A;  2HYF A;  1PP8 F;  2IA2 A;  4UVB A;  3MQ0 A;  2FA5 A;  3T1B A;  3K2Z A;  5J8C A;  1EH6 A;  1Z7U A;  5JI6 A;  4RGU A;  4IRI A;  2FBH A;  4RAZ A;  5E8G A;  1L3L A;  4KMU X;  3NEU A;  3VOE A;  3KLN A;  4ESF A;  2FE3 A;  2YPR A;  2W25 A;  2ZME B;  3ZN1 A;  3L2C A;  3LAJ A;  3Q9S A;  4B8X A;  2XAJ A;  5LEJ A;  1ZG3 A;  4PGG A;  1B59 A;  1TW2 A;  4EQQ A;  1JXS A;  2IP2 A;  5CJ9 A;  4A5M A;  3V8K A;  2FSW A;  5BS6 A;  2FF4 A;  4ZYG A;  1F5T A;  2WV0 A;  2VE8 A;  2XVC A;  1SD5 A;  3ZQ7 A;  5FD5 A;  4XSZ F;  5D8K B;  4UHT A;  1D3Y A;  3ECH A;  3QAH A;  3KP4 A;  1LB2 A;  1SFU A;  5CYV A;  3JAM Z;  2GA2 A;  1BN5 A;  4WXH A;  2STW A;  3KFW X;  4LG0 B;  3JW4 A;  1RUN A;  1ZYR F;  3MFK A;  1LJ9 A;  1WKM A;  5L3F A;  3F21 A;  1QZY A;  1J75 A;  4CGZ A;  1HKT A;  2Q0O A;  3KP7 A;  1LDJ A;  4LMY A;  1EH7 A;  3SQN A;  1O7L A;  3FF5 A;  4HQM A;  1Q1H A;  4JBA A;  4LFU A;  1TQM A;  2HS5 A;  4EM2 A;  1SFE A;  2NNY A;  5LEK A;  1YLF A;  2F5C A;  4G6Q A;  1U5T A;  3FX3 A;  2HZT A;  2WC2 A;  2W57 A;  2KJC A;  2BBY A;  3JTH A;  3HTU A;  2ETH A;  1UB9 A;  2LF7 A;  2DU9 A;  4Q47 A;  2BYV E;  1U8R A;  2MH2 A;  3C18 A;  3EDP A;  5AIQ A;  5ICC A;  3LA3 A;  4Q5S F;  1VTN C;  3SZT A;  4QLC U;  1PDN C;  2CG4 A;  4A2U A;  1DPU A;  1ZGA A;  2HEO A;  4I2O A;  1K7A A;  3EQL F;  2KIM A;  4LG0 A;  1ZLJ A;  3I59 A;  4GGG A;  2V1U A;  3E5X A;  4CO8 A;  4MEX F;  3AAF A;  2UZK A;  1ZRE A;  1FBU A;  2L02 A;  3S2W A;  3OOP A;  1Y0U A;  3COA C;  1RUO A;  4MTD A;  2QVO A;  3MWM A;  4HV6 A;  1J7K A;  1IZ1 A;  4IF4 A;  3WG9 A;  2XAQ A;  1T2K A;  3L7W A;  3P9I A;  2P5V A;  1YG2 A;  1S7O A;  2VXZ A;  4YFX F;  4P5O A;  1KU2 A;  3QPH A;  5AON A;  4ASN A;  4WCG A;  1LDK B;  1QQI A;  2D1H A;  1RIO H;  2VBX A;  4O6J A;  1TQP A;  1BI3 A;  2ISY A;  1XN7 A;  3KEO A;  5F6F A;  4G7O F;  5ICG A;  1R22 A;  3G3Z A;  3ABU A;  5JR3 A;  2OD5 A;  2XRN A;  5JFR A;  4EJV A;  1BJA A;  1KYZ A;  3CO6 C;  2UXN A;  2EA2 A;  2ELH A;  2K4B A;  1XSV A;  4MQ9 F;  1O57 A;  1SD7 A;  4RB3 C;  5D5W B;  2Y75 A;  1YTY A;  4A0X A;  2XKO A;  3O3K A;  1BI1 A;  3BP8 A;  3RKW A;  2QWW A;  4ZZD A;  3KZY A;  3E6C C;  3GZ6 A;  4KFC A;  1Z9C A;  1YS6 A;  4HYE A;  1S6L A;  2XAS A;  2DQR A;  1J59 A;  4BNC A;  4OIP F;  4A12 A;  3M7G A;  2COM A;  1MJA A;  1MJ9 A;  5CVR A;  2W84 A;  1XCV A;  4AVP A;  1IN5 A;  5D6E A;  2FXA A;  5HDG A;  2YU3 A;  3F72 A;  2ESH A;  5J8F A;  3F6V A;  3R61 A;  4HF2 A;  3GFI A;  3BJO A;  3VFZ A;  3TO9 A;  2WWY A;  5HLH A;  4CIC A;  1RZ4 A;  2X0L A;  2BGC A;  5HS7 A;  1BM9 A;  1R5G A;  4CZZ A;  4PGH A;  4ETS A;  4M6X A;  2IRF G;  4KIB A;  2RV8 A;  2OBP A;  4LGW A;  1W7P B;  2XKP A;  2RQP A;  3J81 K;  4WXC A;  3LQQ A;  1RNL A;  4LB5 A;  1I5Z A;  1P6R A;  1GXQ A;  4CYD A;  5EEG A;  2CQK A;  3IC7 A;  1MKM A;  2DFI A;  3CUQ C;  5CVI A;  3SZP A;  1ZG1 A;  2JPB A;  1T6S A;  3R0A A;  4HDU A;  5H6R A;  2G9W A;  1B6A A;  1S7A A;  2XRO A;  4HAM A;  2ZCW A;  2Z33 A;  3BJA A;  3LA7 A;  3H92 A;  5FLX Z;  2K7L A;  2VBY A;  2ACJ A;  1WSU A;  1QO0 D;  2WTE A;  2VT3 A;  4EJO A;  3V7S A;  1FYM A;  3HSR A;  4Y15 A;  5LGN A;  3RKX A;  3IWF A;  2DPD A;  5FB2 A;  1W7P A;  4M9Z A;  4UV8 A;  5CLS A;  4EJW A;  2NRA C;  2O61 A;  2YX4 A;  5TRD A;  2VBW A;  3ZMZ A;  3HRU A;  1R7J A;  5J6X A;  1GHC A;  3U9G A;  1OYW A;  1IXS B;  1B4A A;  1ONV A;  2HTS A;  2CSO A;  4K2E A;  4YII A;  2P4W A;  1O3R A;  1YW8 A;  1G3T A;  2A5Y B;  3C3W A;  1P4A A;  2DQL A;  3W6J B;  1LDD A;  2FOK A;  2Z99 A;  1I1S A;  3B02 A;  3HHH A;  4P96 A;  1ON2 A;  4BH9 A;  4M9S A;  1WI9 A;  3LWF A;  3IL2 A;  4U7B A;  3BDD A;  1BBY A;  1GVJ A;  5AIP A;  3K69 A;  3MCZ A;  3RTR A;  3BY6 A;  2P5L C;  2J5P A;  3ZMU A;  3CJN A;  2IJL A;  3GVA A;  2ISZ A;  1BC7 C;  2EV5 A;  4KN4 X;  5D5U B;  1FY7 A;  2RGV A;  4LLN A;  2VT2 A;  3P7N A;  3V4G A;  3GLX A;  2DTR A;  4Y17 A;  4UVA A;  1DUX C;  2M1B A;  3QRF F;  4XRF A;  1HKQ A;  3E5Q A;  4ZYE A;  3U2R A;  2QUF A;  3E6B A;  4N0B A;  3M1E A;  1EV7 A;  5H6Q A;  4KT5 C;  1KA8 A;  1F1Z A;  5FGM A;  3FM3 A;  2DK8 A;  2PG4 A;  3ZN0 A;  4ENM A;  2W85 A;  4QWQ A;  4ZZL A;  2BV6 A;  1J0R A;  1A04 A;  1Z6T A;  1SFX A;  3MEX A;  3N97 A;  2G7U A;  3DP7 A;  5IT9 K;  4MGR A;  1L0O C;  2ZO4 A;  3QU3 A;  4HZF A;  1S3J A;  3F8F A;  1XMK A;  4RGX A;  3PQK A;  5KK1 A;  1IW7 F;  1SAX A;  3W6K B;  3LFK A;  2A07 F;  1YO5 C;  2XIG A;  5LRR A;  4G7H F;  1QZZ A;  3LST A;  3TOA A;  3OV8 A;  2EFO A;  2GIV A;  2ZJ2 A;  2QM3 A;  4U7D A;  1HXD A;  3K0L A;  4KMF A;  3KCC A;  1QNT A;  1WQ2 A;  2NS0 A;  5FD6 A;  3L09 A;  2DI3 A;  4U0V A;  2VOP A;  3I64 A;  3F8C A;  5BOX A;  2QQ9 A;  3Q9V A;  1W5T A;  1P92 A;  2AXL A;  3K1N A;  4ON0 A;  3K1P A;  1R1V A;  3R4K A;  2LNB A;  3RYR A;  3E3V A;  1K78 A;  2M8E A;  1QPM A;  3ISP A;  2FNP A;  2ZNY A;  4L0Z B;  4P9F A;  1FP2 A;  2DW4 A;  4IJA A;  2K86 A;  2ZXJ A;  4KIF A;  1T38 A;  1O3S A;  3B73 A;  3WTV C;  3CUO A;  2EWN A;  4WXD A;  4ZYH A;  2ZBK A;  3ULQ B;  1BIB A;  2OZU A;  2Z3Y A;  2FBK A;  3WGI A;  4YFN F;  3BRO A;  3FMR A;  2VOD A;  1KQ9 A;  2OQR A;  3CDH A;  3MZH A;  2NAZ A;  2ZKZ A;  1H0M A;  1TW3 A;  2XAH A;  4FHT A;  3HOS A;  2O8X A;  2CW0 F;  1I6X A;  1SD4 A;  3HOT A;  2QZ8 A;  5L3B A;  4IRG A;  3I4P A;  1Z1D A;  2ZME A;  2VC1 A;  3WE2 A;  4B09 A;  3KE2 A;  4Z2Y A;  4EM0 B;  2PMH A;  4NB5 A;  3WTY C;  5HS9 A;  2DBB A;  4E70 A;  3FXQ A;  4RGR A;  3EET A;  5D4S A;  2V1X A;  5K1Y A;  3K1M A;  5HDN A;  3JAM K;  3FMS A;  2GXG A;  2H94 A;  3D0S A;  3V8L A;  5LLQ A;  4HW0 A;  4EMS A;  4I09 A;  3IWZ A;  2YSR A;  3GFL A;  4H0E A;  2PFB A;  2HWV A;  1X3U A;  2M5W A;  4U0Y A;  1ZRC A;  1GXP A;  2BEO A;  4AIK A;  4EM1 A;  3RDI A;  4I02 A;  2GAU A;  4N9H A;  2OU2 A;  2H6B A;  1O3Q A;  3TO6 A;  3T8T A;  1U3E M;  2H6C A;  2QLZ A;  6PAX A;  2XAG A;  3ZPL A;  3FWE A;  3I5U A;  5A2Q K;  4ENK A;  3QU6 A;  4WWC A;  1KU9 A;  2M45 A;  3GW2 A;  1T98 A;  4M74 A;  3P9C A;  2A6E F;  1ZHF A;  3CTA A;  3F8B A;  1YIO A;  1R36 A;  3RPU A;  3EYI A;  2STT A;  2IA1 A;  2JRT A;  1G3Y A;  4I7H A;  1D8J A;  1ZAO A;  1UHW A;  1E2X A;  4KYW A;  1JHF A;  2JZY A;  3WOD F;  1U78 A;  2C6Y A;  4KIG A;  3E97 A;  4OMZ A;  3DPT A;  2HYG D;  1T0F A;  1W5S A;  3C7J A;  2A69 F;  3F6O A;  2F5F A;  3HRS A;  3PFI A;  4M9X A;  3VEP A;  2V79 A;  4EV0 A;  4YG2 F;  5H20 A;  2PLY A;  3R0J A;  4HLY A;  2K4J A;  3F22 A;  3V7C A;  4L5I A;  4KDP A;  4F7Z A;  4BYY A;  2IVM A;  1UCR A;  5D5V B;  3DEU A;  1G3W A;  1H9G A;  2KJB A;  3K9T A;  4DQ2 A;  4A6E A;  1G6N A;  2M30 A;  3KEQ A;  2KKO A;  3Q5F A;  3J81 Z;  3I71 A;  2QEN A;  2XHK A;  2IPQ X;  2PN6 A;  1MJB A;  4HQE A;  4U0W A;  4WK8 F;  5ED4 A;  3SXY A;  1RI7 A;  4TV7 A;  5TJJ A;  5L3G A;  4GXO A;  2L01 A;  3TOB A;  3IRR A;  1IF1 A;  4L5J A;  5BPI A;  1V4R A;  1QGP A;  1IN8 A;  4KIC A;  4MHG A;  2LDU A;  2QYO A;  2HGC A;  1LEA A;  4XBF A;  5DV5 A;  1ODD A;  2VN2 A;  1I1G A;  4GO1 A;  1O3T A;  2IT0 A;  2ZNZ A;  1XCB A;  5F64 A;  3GEZ A;  1DP7 P;  2ADU A;  2O6G E;  4RS8 A;  3M8E A;  2V6C A;  5DUI A;  2MA3 A;  3DXJ F;  1PUE E;  5L3D A;  4S04 A;  3T0Y A;  4G6D A;  1LVA A;  1P4W A;  5JHU A;  4FX4 A;  5BPD A;  1KQ0 A;  4KUM A;  3G73 A;  5LBQ A;  2A6H F;  1OMI A;  4S05 A;  1IN6 A;  3WE3 A;  1PP7 U;  1JHH A;  3IHU A;  1TBX A;  3SHF A;  2EK5 A;  1AOY A;  4HX8 A;  2DPU A;  1YQA A;  1IUY A;  4L9T A;  2XGX A;  3R60 A;  3TQN A;  1IN7 A;  3TDZ C;  3GZ5 A;  2YR2 A;  2RC4 A;  3E5U A;  4Q48 A;  5ILS A;  3GWZ A;  3JTG A;  3FMQ A;  2KRF A;  3NQO A;  5DYM A;  3TKY A;  1FX7 A;  3F8M A;  3T8R A;  2JPC A;  1FOK A;  4LLG F;  4KNY A;  1XGS A;  4EGY A;  2MH9 A;  3V8J A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...