3ULQB

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
VLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/transcription activator
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ulqB00
1ZN2A 3ZMVA 3GUDA 1KU7A 2PMUA 4BQAA 5BS6A 1YW8A 4UV9A 2ACJA 2PLYA 1W5SA 2D1VA 1U3EM 3WTWC 3WTXC 1KU9A 4L9JA 1ZH5A 2P6SA 1UFMA 5E18F 4PGHA 1R7JA 5L3EA 3F8NA 4M74A 2JSCA 3NQOA 3LAPA 4I02A 5E1XA 2EK5A 3MAJA 4S04A 5BQTA 4IHTA 3B02A 1XSVA 5HVQC 1ZGJA 4R8HA 2QYOA 2B0LA 1HSJA 3HSEA 2O03A 2RNJA 5TRDA 3KP5A 4A5NA 4L18B 1BI1A 1FT9A 3J80K 4G6QA 2CSOA 2L54A 4OIRF 3KE2A 2E7WA 1P4XA 3GYHX 2V9VA 2VXZA 1F1ZA 4XLPF 3HHGA 2A6EF 4OMZA 1T0FA 1W5TA 1IN4A 5EEGA 3TOBA 3O3KA 3CO6C 2KIFA 4HZFA 2O8XA 3P9IA 4UVBA 2TDXA 3F8FA 3QU6A 3ZN0A 4KIGA 3DXJF 3HSFA 3L2CA 3ZN1A 4TV7A 2FQ3A 2G9WA 5ICEA 1O3RA 4HV5A 3RYRA 4GCVA 1Y0UA 1WSUA 2HQNA 2HQRA 5LGTA 3RYPA 4A2UA 4GXOA 1LNWA 2FOKA 4M72A 1K78B 4KN4X 5LLQA 2EA2A 2MA3A 2EV5A 5D5VB 3NRVA 4DNCA 2ZO4A 2P5LC 3FZVA 2ESNA 4MEXF 3V8KA 2GXBA 3VEPA 4D0PA 3HRMA 4MNUA 4FT8A 1IUYA 2K7LA 4WCGA 3PQKA 2XV4S 2QQ9A 3JW4A 3BJOA 4UNOA 2L01A 4KIBA 3L9FA 2JTVA 1MDMA 3DKWA 3R60A 1CF7B 3ISPA 2VT2A 2WV0A 1QO0D 1Z05A 2YPRA 4ZZLA 4OU0A 4L0YB 1HW1A 3CUQB 1Z6RA 4WF2A 4EJUA 1W4MA 3IC7A 3WE2A 3GFLA 1USSA 3F21A 4HLYA 3MEXA 4HF0A 4JBAA 3MFKA 2M1BA 3ML6A 1LEAA 3F23A 4HBLA 4ON0A 5HS8A 3BZ6A 4CGZA 2CYYA 3F6OA 5FB2A 2XAQA 5DCFA 3IWZA 3FMSA 4BHCA 4UXNA 4XSZF 3SXYA 2HYGD 2OZ6A 2FF4A 5J8CA 2GAUA 3K69A 1Z91A 3TO9A 3FMQA 4I01A 3FXQA 4EJOA 3JTHA 5K1YA 1DPUA 5E1ZB 3VB2A 3DPLC 2EV0A 5DCMB 4LMYA 2P5VA 1LQ1A 1ON1A 1IN8A 1ZG3A 4ZYHA 2F5DA 5HLIA 1U5TA 2ADUA 4E70A 1D8JA 3EETA 2XAGA 2L4MA 1T2KA 1BBYA 1O3QA 3H92A 3TOAA 2EA4A 1OYYA 3V7RA 1WQ2A 4GYIA 1ZRDA 1TQIA 3GXOA 3MZYA 2DLLA 5K5RA 3R61A 1KGSA 1OYIA 2J5PA 1LDKB 2P5KA 4QWQA 3CJNA 4A0ZA 1YTYA 3GZ6A 2ISZA 1KQ8A 1BIBA 3C1DA 2YR2A 2XRNA 4WXDA 5IT9K 3KLOA 3QPTA 1R1TA 3LA2A 4GYGA 4L5JA 3FWEA 3GFJA 2MH9A 1CGPA 1ZREA 3G3ZA 1TNTA 5DYMA 1FWZA 1XGSA 3N97A 2JPBA 3W6KB 3BDDA 3LQQA 1MKMA 3R0AA 3ZPLA 3T1BA 2QZ8A 2XAJA 5ILSA 2ZNYA 2V1XA 2VOPA 4P5OA 3WTUC 2RN7A 2A61A 5D8LB 4Q48A 1ONVA 4WWCA 4EV0A 1GXPA 1ZRCA 1K79A 1FX7A 3IRQA 2VBWA 2K86A 2HTJA 4CYDA 2ZJ2A 1BM9A 2ETHA 2RDPA 3I59A 2VE8A 1IZ1A 2IA1A 4OOIA 1TQPA 1LEBA 2M87A 4CICA 1ODDA 1DDNA 1U8RA 2XHKA 5HLGA 4ZZDA 3GF2A 2PI0A 2MD5A 2Q2EA 4BAYA 1J9IA 1R1UA 4A6EA 1BJAA 2OU2A 4LLGF 3J81Z 3P9CA 2DBBA 3IWFA 1TTYA 1QNTA 2DU9A 4ENNA 2M8EA 3GWZA 1U6GA 1GHCA 2X0LA 2AS5F 1JHFA 2A69F 2Z3YA 5L3FA 5LGUA 2ZXJA 2FMLA 2VBZA 3P7NA 4EM0B 4L9NA 2DFIA 4WX9A 2F2EA 4PGGA 2XAHA 1B9MA 1AOYA 5F64A 3VOEA 2A6HF 2IJLA 1P4AA 3KZZA 3RKYA 2HR3A 4F7ZA 2YU3A 3E5XA 1XGOA 4MEYF 4N0BA 4EQQA 4IPAA 1EH6A 1B6AA 4NB5A 2XGXA 4YIIA 4RAZA 2Z9OA 3KZYA 3CO7C 3EYIA 1L3LA 3RPUA 5ICFA 4AWXB 3HOSA 1FYLA 5FFZA 1RUOA 2Q0OA 3DF8A 3LA3A 2V1UA 1I1SA 2IVMA 1YFHA 3S2WA 3I53A 2KRFA 3GZ5A 2Q8KA 3JSPA 1GVJA 2PN6A 3FHZA 1Z9CA 3HRTA 3I71A 4HV6A 1XSDA 4RAYA 2HWVA 4RB1A 1YQAA 1IN5A 1WWXA 3ZMTA 3U1DA 5BPDA 3Q9SA 4KMFA 2ISYA 1QGPA 1C0WA 3V8JA 1MZBA 2IP2A 1KYZA 2HDCA 1LDDA 4M9SA 2UXXA 2KJCA 1FYKA 1MJAA 2CGPA 2E1NA 4N9IA 4EJWA 3KP7A 3ZMSA 3SZPA 4IF4A 2NYXA 2CWEA 1EV7A 5BPIA 4FX0A 2C6YA 4LFUA 3LQRA 2AXLA 4ZYDA 1FBSA 1U78A 2H27A 1G4DA 1TW2A 2Z99A 3I54A 3CDHA 1XSXA 2KIUA 3T5XA 5D6EA 3V8LA 3I0TA 2XKPA 5ILUA 1IW7F 1VTNC 3F6VA 4BHPA 4BYYA 4LJZF 1MJ9A 1R5GA 4G7OF 3RDIA 3K0LA 3QRFF 3M1EA 5ICCA 4U0YA 1O3SA 1FZPB 4EJVA 4O6JA 5JR3A 3ZMUA 1U5TC 2QVOA 3E97A 2NS0A 2KKOA 5L3DA 1R00A 3AAFA 1KA8A 4AIKA 3GEZA 4ETSA 3PQJA 1J7KA 3HOTA 4PZJA 2EFPA 3F3XA 2Y48A 4A0XA 5H20A 1OMIA 2UWMA 2PBIA 4L0ZB 4DQ2A 4CZZA 3DP7A 3TDZC 4N9HA 1HKQA 4HLXA 2W24A 4L9TA 3WTVC 5DEQA 1J5YA 5JHUA 3L00A 2STTA 4G6DA 2EFNA 3WTSC 2FBIA 1IXSB 3ECOA 3CLOA 1O57A 1UHMA 1XD7A 3EUHA 1JHHA 1MJBA 4IXAA 5LRRA 3JAMZ 3T8RA 1K78A 4I0AA 5DDGA 2W57A 2FEZA 4NQWA 2PG4A 3HHHA 1FP1D 2QUFA 2BV6A 1DUXC 1E2XA 2NNYA 3I4PA 4WXHA 1YS6A 1V4RA 4M6XA 2ESHA 2LF8A 3LWFA 3W6JB 1F5TA 2ELHA 1TNSA 5L3CA 4AIHA 1O7LA 1CF7A 2CW0F 2RV8A 3FF5A 1XMAA 3BP8A 4BH9A 1SFXA 3CUQA 4OIPF 5FLXK 2GZWA 4Y15A 2V1DA 1HKTA 1SFEA 1HSTA 3N4MA 2GQQA 3ZMDA 3KCCA 3HYIA 1MGTA 3R4KA 1IRFA 2EWNA 1FSEA 2HZTA 2YX7A 3LSTA 3OOPA 4OINF 3WGGA 1DPRA 1HXDA 4KT5C 2WWYA 1G6NA 2L02A 3F72A 4UVCA 3RJPA 1DP7P 1W7PD 3B73A 5DD8A 5TJJA 3C18A 4YFNF 3J80Z 2PQ8A 3D5LA 1S8NA 2DTRA 2F5FA 3IHUA 3BPVA 6PAXA 1R22A 2VBYA 4P9UA 4O3MA 5DCMA 1MDMB 3VFZA 3EYYA 3LA7A 3K9TA 3CUOA 1YG2A 3JSOA 3E5UA 5CYVA 5HS9A 3FXUA 4I7HA 3SQNA 2JT1A 1YIOA 2IA2A 2DK5A 2EFOA 3TGNA 5J8FA 5K5QA 4HAMA 3EDPA 4ESJA 4BHBA 3E6BA 2Y0MA 5J6XA 3M8EA 3FM5A 3IL2A 3I64A 1RI7A 1ZLKA 2BEOA 2H94A 1T6SA 5JI6A 3FXRA 2OAZA 5HDGA 3ABTA 1KQ9A 4M6YA 4CHUA 5D4SA 4MGRA 3V4GA 1R36A 2OD5A 4HW0A 4Z2YA 5JFRA 5D5XB 1G3YA 1BIAA 1QQIA 1ON2A 2EB7A 4UV8A 1RNLA 1HW5A 2GWRA 2PMHA 1PP7U 3C7JA 1XMKA 4A12A 1YS7A 1HW2A 2M30A 2CQKA 1BI3A 4U0WA 2VT3A 1XCBA 4FHTA 2NNNA 2GIVA 2HYFA 4RS8A 4OIOF 4KMUX 2DAOA 5F1RA 2ZMEB 1IN7A 2VOOA 3SHFA 1XGNA 1S3JA 1T39A 1K7AA 3TO7A 4YIFA 3T8TA 2VE9A 2XVCA 5AIPA 2A3SA 1KU3A 4B09A 4LG0B 2VN2A 2NAZA 2ZCWA 3ECHA 3TDUC 3RIRA 4EM2A 3LFKA 2GA1A 5L3GA 2R7DA 2QBYA 1BI2A 3GX4X 1UB9A 4EVIA 3K1MA 4KN7X 5LEJA 1QZYA 3ELKA 4IHSA 1FPQA 4ENMA 3WODF 5BMZA 3KP6A 4KA4A 2K4BA 3TO6A 5LHHA 3ROUA 2LDUA 1WI9A 2DO7A 4IVNA 5D6FA 1D3YA 3KEOA 1TW3A 3R0JA 4MQVA 4CO8A 2JZYA 1ZAOA 2VC0A 4Q47A 3WU1B 4YG2F 4XSXF 3RPQA 1I27A 5LEKA 4R1HA 4HA8A 2DPDA 3MQ0A 2IPQX 3BWGA 2DI3A 1S6LA 4LK1F 5E8IA 3FM3A 3I5UA 2HKOA 4ZYGA 1TBXA 4HF2A 2MBFA 5A2QZ 4GO1A 3EQLF 2ZFWA 1YYVA 5HDKA 4U88A 3GLXA 2MH2A 2EFQA 3WGIA 1R58A 3H3ZA 2XASA 5IT9Z 1W7PB 1IXRC 3GO5A 4AVPA 5D8KB 2M5WA 5KK1A 1EH8A 1OKRA 1XB4A 1A04A 2HOEA 5H6QA 4L5IA 3L7WA 2P4WA 4Q4ZF 3TQNA 4KYWA 5CVVA 1X3UA 5IT3A 4IRHA 1SMYF 1Z6TA 2O6GE 3DFGA 2VC1A 4P9FA 1QBJA 4HQEA 2K4JA 3BPXA 4JQFA 2ZKZA 4LD5A 2FE3A 3ZMZA 3V7CA 4XLNF 2FBKA 3CUQC 1FOKA 5LRSA 1BOAA 1UCRA 5DD4A 3I58A 3M9AA 4RGXA 1AWCA 3SFZA 1JXSA 1B1BA 1T98A 4S05A 5DV5A 2RGVA 4PCQA 2DT5A 1RUNA 2LNBA 3KP4A 3DQVC 1BC8C 2JPCA 5E1WA 3HTUA 2OZUA 1NHAA 2M45A 1JE8A 5CVUA 1HBXG 4CDGA 2V79A 1KQ0A 2FRHA 5D4RA 1G3SA 1TQMA 2FSWA 4M9ZA 3L09A 2VONA 5JVTA 2EFWA 2HTSA 5ILVA 1V3FA 4LLLA 2CG4A 3GW2A 4FX4A 1XGMA 3QOPA 4M71A 4O5VA 3TKYA 1ZARA 3ERED 4IJAA 1KYWA 5AIQA 5E20A 3K1PA 4MHGA 2X4HA 1FC3A 4L9VA 1ZG5A 1WKMA 2MC3A 4ESBA 1PUEE 2EV6A 4CXFA 2FNPA 3WTZA 4ENKA 2XAFA 5BOXA 2LF7A 1SFUA 2GXGA 4G94A 3DV8A 2P7CB 1J2XA 2K02A 2YSRA 1I5ZA 5EEHA 3O6BB 2E1CA 2LKPA 2A5YB 3PFIA 4G9YA 3O2PE 2FXAA 2HEOA 2HS5A 2A68F 1ULYA 1FLIA 2IW5A 3Q9VA 2XKOA 3JTGA 1RIOH 4I2OA 1PP8F 1S7OA 3RKWA 1XDSA 4YFXF 4OIQF 4H0EA 1S7AA 2FBHA 4M73A 5CVRA 1BN5A 1OPCA 4LK0F 1FY7A 3COAC 4LB6B 3QAHA 3K1NA 1LB2A 3QPHA 4G7HF 3KP3A 1O7FA 1STZA 3BOQA 2ZBKA 1OYWA 2DQLA 3KETA 3HTSB 1FNNA 2FA5A 2O61A 1ZHFA 5FGMA 1IRGA 4GGGA 3WG9A 3K2ZA 4HX8A 3MZHA 2O3FA 5E17F 4EM1A 4EGZA 3KEQA 5ICGA 2BGCA 3F8MA 1R5HA 5HDNA 4EGYA 5CLSA 4RGRA 4MTDA 1FYMA 2LSOA 2DPUA 1I1GA 4HX7A 3WGHA 4NHJA 2Z33A 2RQPA 1BC7C 2QM3A 1YW7A 4AD9A 3HRUA 3RTRA 3T0YA 1E17A 1SAXA 4A0YA 2R7FA 3KP2A 3DPTA 2H6BA 3F8CA 1YW9A 4G8XA 4KNYA 4WXCA 2NRAC 1IN6A 1MD0A 3IKVA 3OV8A 2O0YA 4ESFA 3MCZA 5CVJA 2HFHA 3KFWX 3WU0A 4K2EA 2XIGA 1FBQA 5FFXA 1J59A 3ULQB 1B9NA 1FSHA 5HOOA 3HUGA 4LB5A 3KLNA 3HIFA 4MQ9F 5ED4A 4HQMA 1K6OA 2MLKA 2FU4A 4B8XA 4XBFA 4QLCU 4MTEA 4KDPA 1T38A 2G7HA 3FMRA 3QP5A 4RGUA 4EMSA 4HDVA 3P9KA 2PEXA 2RKHA 1IAWA 1REPC 5CJ9A 1G3TA 1R23A 2F5EA 4M9XA 1XDUA 2H09A 2CO5A 5ERIA 4Y17A 3ZQ7A 4IRIA 1XN7A 2DQRA 1XCVA 4U7DA 3E6CC 4U7BA 5LHIA 3IRRA 4IRGA 1D8KA 4WK8F 1Z1DA 1LJ9A 2P6TA 4OMYA 2IA0A 3GVAA 1QPMA 5L3BA 1D5VA 3E3VA 3J81K 5H6RA 3HRSA 5LHGA 5E8GA 2WC2A 3M7GA 4AIJA 2ZNZA 3RKXA 4A5MA 2Z5UA 1YO5C 4I0BA 1H9GA 2WTEA 2BE5F 5FD5A 2W85A 2CFXA 1FBUA 1SD5A 1ZRFA 2ZMEA 1I6XA 2D1HA 2XROA 1YLFA 2IRFG 1RZ4A 2P8TA 4EJTA 3H3UA 5A2QK 1O3TA 4U0VA 1H0MA 4LG0A 3E5QA 2OBPA 2H6CA 1U5TB 5FLXZ 5FO5A 2G7UA 2STWA 1P2FA 2V6CA 4KIFA 2VBXA 3BY6A 2MLGA 1WRJA 1ZYRF 3CTAA 4HDUA 2UZKA 2RVCA 2Y75A 2QQBA 4P96A 3U2RA 4KICA 3IKTA 1HKSA 4LGWA 2F5CA 2HGCA 3VODA 3G73A 3Q5FA 4UVAA 5D5UB 4I98B 1J75A 4PDKA 2YX4A 2OQGA 2JRTA 1U2WA 3WTTC 5F6FA 2IT0A 3QP6A 1SD6A 1EH7A 4Y13A 3ABUA 5DUIA 3RI4A 3BJ6A 2OA4A 3R6SA 2VODA 1SD4A 1P4WA 1IF1A 1G3WA 2D45A 3WE3A 4KFCA 5DUKA 3FX3A 2QBYB 3F22A 4RB2C 4UHTA 3J7AO 4ZH4F 2HKXA 3GFIA 3I59B 4HX4A 3GFMA 2P7VB 1W7PA 1LVAA 1USTA 1ZG1A 2COMA 4UUVA 2D2WA 2KJBA 3WTYC 2EJRA 3DEUA 1PDNC 1QZZA 1B59A 1P92A 1UHWA 1F4KA 3E6DA 3F8BA 1OR7A 3BJAA 2E7XA 1B4AA 4HF1A 1ZLJA 3REOA 2FNAA 1BI0A 1SMTA 1H9TA 3C3WA 1L0OC 3HSRA 1P6RA 3D0SA 3LAJA 2BBYA 2R3SA 2BYVE 4ASNA 2QENA 4RB0A 4LLNA 2PFBA 1ZGAA 5HLHA 4HYEA 3MWMA 1TLHB 5D5WB 4RB3C 4ZYEA 4G7ZF 4R79A 3NEUA 3U9GA 2OQRA 1FP2A 2QLZA 4BNCA 1J0RA 4BXUA 4I09A 1KU2A 5AONA 5LGNA 2W25A 1GXQA 4ENJA 1JGSA 5KVRA 3M8FA 1S29A 2RC4A 1Z7UA 1F9NA 2GA2A 1LDJA 2QWWA 3JAMK 3SZTA 5FD6A 2DK8A 5K5OA 4HOBA 4P55A 1HQCA 2K27A 2A07F 2W84A 4Q5SF 1SD7A 2UXNA 3QU3A 3ZP5A 2FMYA 2PJPA 5HS7A 4KUMA 2DW4A 2QQAA 3V7SA 4JK1X 4XRFA 2L4AA 4A6DA 1R1VA 4YFKF 2XUBA 2KIMA 2J5OA 5CVIA 1IXCA 3E6MA 5LBQA 3BROA 4RGSA 1Q1HA 2L3DA
chains in the Genus database with same CATH superfamily
5F1JA 1ZN2A 5F0CA 3ZMVA 5FRMA 3GUDA 1KU7A 2PMUA 4E7IA 4BQAA 1JI8A 3CCVI 5BS6A 2HVRA 3ESWB 2AQEA 1YW8A 1R4NB 4C2UA 3S8PA 2JVGA 3DKYA 5FROA 2VB6A 4BBRJ 4UV9A 2ACJA 2PLYA 1W5SA 2EIJH 1RPWA 2D1VA 1U3EM 2RAEA 3WTWC 3WTXC 4X0GA 2LKSA 1KU9A 4HSTA 4L9JA 2KT0A 1ZH5A 5GAHJ 4LIUA 5DTDA 1XMXA 4XN3A 2RQQA 2K9LA 2P6SA 1UFMA 3VPRA 5E18F 4PGHA 1R7JA 2QSFX 1KONA 5L3EA 3F8NA 3L2UA 4M74A 2JSCA 3NQOA 3LAPA 3BR0A 4I02A 5E1XA 2EK5A 1RRJA 3MAJA 3IUOA 5C4JJ 1X4OA 4S04A 5BQTA 4IHTA 3HBLA 3B02A 1XSVA 5HVQC 2VASA 1ZGJA 2DDBA 2CQQA 5EJCA 1BOBA 4R8HA 2QYOA 4CUGA 2B0LA 3CF5F 1HSJA 3HSEA 2O03A 3C2GA 3TP0A 2GM4A 4XICA 3O8GA 2BY3A 2ZMEC 4JP0A 3GCMA 2RNJA 5TRDA 3KP5A 4A5NA 1LFBA 2W4SA 4L18B 1X1CA 1BI1A 1FT9A 5J3LA 4G6QA 3J80K 2CSOA 2L54A 1JJ8C 1ENHA 2V26A 2GOXB 2LREA 1VQ4I 4OIRF 3K4JA 3KE2A 2E7WA 4B3XA 2KHMA 3DEWA 1P4XA 2CFOA 1F36A 3GYHX 3VDXA 2L9SA 1IV8A 1BW6A 3H9QA 2DMNA 2V9VA 5FJ8J 2X1DA 2VXZA 2ZB9A 1F1ZA 3CCQI 3HOVJ 1DU6A 1QHGA 2V4JC 4XLPF 5KNLA 1VFCA 1MMDA 2DT6A 1O4XA 4BXXJ 3HHGA 3P5JA 4QSHA 4RAGA 2A6EF 4OMZA 1JKPC 4CYCB 1T0FA 1W5TA 1IN4A 4FE7A 2DFEA 1OCPA 1P7IA 5EEGA 2E36A 3TOBA 2DMUA 4XLCA 3SEZA 4E7SA 3O3KA 3CO6C 2KIFA 4HZFA 3VYSB 4E7ZA 1WH5A 1Y1WJ 1FIPA 2HI3A 2O8XA 3P9IA 5FLVA 3FXLA 3LSKA 4UVBA 1K4SA 1CQTA 2X51A 2TDXA 3F8FA 3QU6A 4RA2A 3ZN0A 1YE9A 2X1CA 4KIGA 4C2TA 3DXJF 3RQ4A 3CC2I 3DBRB 3HSFA 3L2CA 3ZN1A 2OCEA 4TV7A 4ANJA 4E7KA 2FQ3A 2G9WA 5FLMJ 3S15J 5ICEA 5IP7J 1YJNI 1O3RA 1GVDA 1OCOH 3E1SA 4HV5A 3RYRA 4GCVA 1Y0UA 5KAFC 3G71I 1WSUA 1G59A 1G8XA 2KRCA 3OR1C 2CUZA 3SYTA 1FJLA 2BVLA 2HQNA 2HQRA 3V42A 4C3HJ 5LGTA 4D5CA 1NH3A 3RYPA 3ZGKA 4A2UA 1A6QA 4XQFA 3RKQA 4GXOA 1LNWA 3GMEA 3A02A 2FOKA 4M72A 4CZCA 1K78B 1RETA 4KN4X 5LLQA 2EA2A 2E34A 2MA3A 1X1AA 4NQWB 2EV5A 5D5VB 1VI0A 3NRVA 4DNCA 2ZO4A 2P5LC 3E0JB 3FZVA 2ESNA 4MEXF 3HOXJ 3V8KA 3OIPA 1B8IB 2GXBA 3VEPA 4D0PA 3HRMA 4DIQA 4II3A 4MNUA 4FT8A 1IUYA 2K7LA 4WCGA 3OMYA 3PQKA 2XV4S 2QQ9A 3JW4A 3PNYA 4N4NB 4IL6C 1Z0XA 2BY0A 3BJOA 4UNOA 2ECBA 2L01A 1OJLA 2ZJRF 4KIBA 3ZQIA 4FE4A 3L9FA 2JTVA 2R5YB 3OYDA 3K4KA 1WJAA 3VYUB 2VIXA 2XRLA 2IEKA 2K3PA 3DKWA 3BCAA 3R60A 4CH7A 1MDMA 2LY9A 4V19K 2ZXHA 1CF7B 3ISPA 4J01A 2VT2A 1D1BA 2WV0A 5GTIC 1QO0D 1Z05A 2YPRA 4ZZLA 4OU0A 4L0YB 4RAFA 1LE8A 1HW1A 3CUQB 1Z6RA 3HKZN 4XRSA 4WF2A 4EJUA 4QPOA 1LFUP 1W4MA 3IC7A 3WE2A 3GFLA 1USSA 3F21A 3OYEA 2OC6A 4HLYA 2YS9A 1OR7C 3MEXA 4HF0A 3BQZA 4JBAA 3MFKA 3A01B 3K2AA 2M1BA 2CUEA 3ML6A 3K4MA 1LEAA 3F23A 1A6IA 1MMSA 4HBLA 4M3GA 4ON0A 5HS8A 1JUMA 3BZ6A 3GLLA 1VQ5I 2CQNA 4CGZA 2PMZN 2CYYA 3F6OA 2LY1A 4KITB 5FB2A 3BG5A 5DS9A 3PFYA 2XAQA 5DCFA 2XAUA 1SVOA 3IWZA 3FMSA 4FETA 4BHCA 4UXNA 3PSFA 4XSZF 3SXYA 2V9PA 2HYGD 2ZFUA 2OZ6A 2FF4A 5J8CA 2GAUA 4F52A 3K69A 1Z91A 5J47A 3TO9A 3FMQA 1APLC 3QPLA 2YUSA 1IJWC 4I01A 4EEFG 3FXQA 2NOJB 4IO9F 1UG2A 4LOCA 4EJOA 2VQHA 3K4NA 3JTHA 5K1YA 2BZTA 2WAEA 1DPUA 5E1ZB 3VB2A 1W0TA 4IQJA 2AO9A 3DPLC 2EV0A 1JT0A 1IDYA 5DCMB 4LMYA 4DOZA 2P5VA 1LQ1A 1ON1A 2L7FP 1IN8A 3QWLA 1ZG3A 4ZYHA 2QKLB 1FEXA 3ZQGA 1JUSA 1ZKGA 3MZ8A 3PNTA 2F5DA 2KISA 4ZTJA 1HCRA 3HEFA 5HLIA 1U5TA 4A93J 1YOVB 2CUFA 2ADUA 4ABZA 4E70A 3HPGA 3VYTB 1D8JA 3EETA 2XAGA 2L4MA 1X3WB 2B7EA 1NG7A 2ZSIB 1T2KA 2R92J 1Z67A 1BBYA 2DA7A 3ASNH 2ICWG 3H92A 1O3QA 1N75A 4DGWB 3TOAA 2EA4A 2OF7A 5E3NA 1X2MA 1OYYA 3V7RA 1WQ2A 4GYIA 1ETOA 1ZRDA 1TQIA 3GXOA 3TL4X 3MZYA 2DLLA 5K5RA 4UUSA 3R61A 1KGSA 1OYIA 2J5PA 1LDKB 2P5KA 4QWQA 3CJNA 3G6EI 4A0ZA 3J7YJ 3NAUA 1HA8A 1YTYA 3GZ6A 2CJJA 2ISZA 3LFUA 1KQ8A 2M7BA 4QIWN 1BIBA 3IP4B 1YX5A 1YITI 3C1DA 2YR2A 2XRNA 4WXDA 2X6XA 5IT9K 4A3LJ 3DBHB 1MNEA 3KLOA 3QPTA 1R1TA 3LA2A 4GYGA 4L5JA 1QA6A 3FWEA 3DU6A 3GFJA 1JKRC 2MH9A 1CGPA 1ZREA 3SDGA 3G3ZA 2K40A 3OR2C 4BEHA 2NVQJ 5IPAA 1TNTA 5DYMA 2EINH 1QRYA 1FWZA 1XGSA 3N97A 2JPBA 1NK2P 3W6KB 3BDDA 2IS2A 2FUG2 5M5YJ 2PX9A 3LQQA 1I3AA 1MKMA 2R93J 3R0AA 3ZPLA 3T1BA 2CQXA 2QZ8A 5TISC 1DGWY 4BY1J 2BVMA 4G12A 2XAJA 2QSGX 1XX5A 2IGMA 2R7RA 5ILSA 2NXNB 2ZNYA 4BS9A 1AKHB 2V1XA 2MABA 4P5OA 5CQGA 1U9NA 2VOPA 1V54H 3WTUC 2RN7A 3S3NA 2A61A 5D8LB 4Q48A 1ONVA 1D0ZA 4RM2A 1D5YA 4WWCA 4EV0A 1VQ9I 1GXPA 3IV5A 1ZRCA 4RBOA 1K79A 1FX7A 1IG7A 4A3EJ 3PUFA 3JRCA 3HGYA 3IRQA 1FMVA 2O7OA 3MKLA 3BLYA 5B66C 2VBWA 2K86A 2HTJA 1G2HA 3RZDJ 4CYDA 1TZLA 2BXYA 2ZJ2A 3ABLH 4PJNA 2JN6A 3LSJA 3H5AA 1BM9A 2ETHA 2RDPA 3FK7A 4ZDOA 3I59A 2DOAA 2VE8A 3OYLA 1MNDA 2X85A 3CJRB 1NG6A 1IZ1A 5J4YA 2IA1A 4XONA 2DA1A 4AUXA 4OOIA 3CCMI 2K9SA 1TQPA 1T8IA 2HDDA 3DU5A 2LMDA 5F0HA 1LEBA 2M87A 4CSWA 5FKOA 1FTZA 4CICA 1ODDA 1SEUA 1DDNA 2LFBA 4MFDA 1U8RA 4BQNA 2L5QA 2XHKA 2JQ7A 5HLGA 4ZZDA 3GF2A 2PI0A 3HDDA 2MD5A 2Q2EA 4BAYA 1J9IA 4NC6A 1R1UA 2NS8A 4A6EA 5IYCJ 1U0JA 1BJAA 4B47A 2OU2A 2LTPA 4LLGF 3B6AA 1K4TA 3J81Z 2A6TA 3G1LA 3P9CA 4NC8A 2DBBA 3IWFA 3FK6A 5IOZA 1TTYA 4XLHA 1QNTA 2Y9ZA 2DU9A 4IX7A 4ENNA 2M8EA 3GWZA 1U6GA 1GHCA 3OYJA 2H1LA 2X0LA 2AS5F 1JHFA 2A69F 2IS6A 2Z3YA 1TWFJ 3AG1H 2ID3A 4PSWA 5L3FA 2ZXJA 2FMLA 5LGUA 2Y9YA 1V5EA 2VBZA 1T0FC 3P7NA 4EM0B 1GV2A 3CLQA 2E71A 1PJRA 4L9NA 2DFIA 2NVYJ 2XPUA 4WX9A 2F2EA 2V6EA 4PGGA 5GAGJ 2XAHA 1B9MA 1VQKI 1AOYA 5F64A 3VOEA 2IBDA 2A6HF 2IJLA 3EUHC 2R7SA 2HU9A 3W2AA 3MN2A 1P4AA 3KZZA 4FTHA 3RKYA 2HR3A 1D1AA 5JVGF 4F7ZA 2YU3A 5FKLA 3E5XA 1XGOA 2MD0A 4MEYF 4N0BA 3ZCOA 4EQQA 4IPAA 1EH6A 3FXOA 1B6AA 3OS1A 4NB5A 2XGXA 4YIIA 4RAZA 2DN0A 2L7KA 2Z9OA 4GDFA 1HDPA 3KZYA 3CO7C 3EYIA 2LC2A 2GBYA 3ERMA 1L3LA 4AYBN 3D5RC 4IHYA 1QZEA 3RPUA 5ICFA 4AC0A 4AWXB 3HOSA 1FYLA 3OL4A 5FFZA 4PJJA 1MBHA 1RUOA 3I4NJ 5F04A 2Q0OA 1ZELA 3DF8A 3LA3A 2V1UA 2IVMA 1I1SA 2XPVA 4YIRX 1YFHA 3S2WA 3PSIA 3SFIA 3H0GJ 3I53A 3OSGA 3OL3A 2KRFA 3GZ5A 2I10A 2Q8KA 3SZGA 3JSPA 1GVJA 2PN6A 3FHZA 1Z9CA 2LVSA 3C2BA 3HRTA 2WY7Q 3HG9A 3I71A 4HV6A 4BQQA 5CPRB 1XSDA 2F4MB 4RAYA 2HWVA 4RB1A 3CC4I 1YQAA 1IN5A 2Y69H 1DQUA 1WWXA 2W48A 3U1DA 3ZMTA 5BPDA 3Q9SA 1SANA 3LMMA 4KMFA 2ISYA 4HEA2 2EZIA 2VKEA 1QGPA 1R6RA 1C0WA 4QTRA 3K70C 3V8JA 2DFFA 1MZBA 2IP2A 1KYZA 2HDCA 3AL0B 1MH3A 1QPIA 2VL8A 1MBEA 2TCTA 1LDDA 4M9SA 2UXXA 2KJCA 1FYKA 1MJAA 3CF2A 2YU9J 2CGPA 3CD6I 4IEJA 2E1NA 1SC7A 3H3VK 3PL8A 2NS7A 4N9IA 4EJWA 3WG7H 3KP7A 2Y30A 4A3IJ 4A3BJ 3ZMSA 5HNFA 3S1QJ 3DCFA 1PYVA 3N05A 2Q1ZB 4E6KG 3SZPA 4IF4A 3OYHA 3J7AY 4J19A 2NYXA 1AA7A 2CWEA 1EV7A 5BPIA 4FX0A 2C6YA 2RREA 3SEQA 1ERDA 3UR3C 1X1PA 1MBFA 4LFUA 3VYRB 3LQRA 2FOWA 3S1MJ 2AXLA 4DBRA 4ZYDA 3A0BC 1FBSA 1U78A 2MG4A 5EG0A 2H27A 1ETWA 2I8DA 1G4DA 3SDBA 1TW2A 1TL8A 2QF7A 2Z99A 3AKZA 3I54A 3CDHA 1S7EA 1XSXA 2KIUA 3JRDA 3T5XA 2IXSA 5D6EA 3V8LA 1GUUA 1LPQA 1XS9A 3I0TA 2XKPA 5ILUA 4A3CJ 2E1MC 1IW7F 1VTNC 3F6VA 4BHPA 4BYYA 3OY9A 4LJZF 1MJ9A 4BGDA 1R5GA 4G7OF 2R4GA 3RDIA 1MSFC 4GFBA 3K0LA 3C2HA 4I76A 3QRFF 2KRHA 3H0DA 3LL7A 3M1EA 2ZXWH 4D9JA 5ICCA 4U0YA 1O3SA 1FZPB 4A3KJ 3U21A 4EJVA 4O6JA 5JR3A 3ZQQA 3ZMUA 3GTQJ 2O8KA 1U5TC 2QVOA 3BTJA 2NS0A 2KKOA 3E97A 5L3DA 2BOLA 1IDZA 1MIJA 2ZC2A 1R00A 1X2NA 3AAFA 3TEDA 3BQYA 1KA8A 4AIKA 1R5ID 3BG9A 4CYCA 2IAIA 1RKWA 3GEZA 4RLFA 3WHBA 2TRTA 4ETSA 3PQJA 1J7KA 3HOTA 4PZJA 3Q0WA 5DM6F 2EFPA 5GPCA 3F3XA 1WH7A 2Y48A 4A0XA 2Y0SA 4XMYA 1OMIA 2L7ZA 5H20A 2UWMA 1MMGA 2PBIA 4L0ZB 4F93B 4LITA 4DQ2A 3TW7A 1TP4A 2CU7A 4CZZA 3DP7A 3TDZC 2DXIA 4X6AJ 4N9HA 4XKBA 1HKQA 2E5ZA 4HLXA 2W24A 4L9TA 2EBIA 2IGOA 3WTVC 1MNMC 2KLOA 5DEQA 3S14J 4JX4A 1UELB 1J5YA 5JHUA 3OYCA 2WAQA 2FD5A 3L00A 2STTA 4G6DA 2EFNA 3HL2A 4XRSG 1YRNB 3WTSC 3S3MA 3HOWJ 1T56A 1UZCA 2HVQA 4YELA 3LSIA 2FBIA 1IXSB 2R7XA 3ECOA 3CLOA 3KYDB 3I56I 1K83J 1O57A 4YRVA 1UHMA 1XD7A 3EUHA 1JHHA 1MJBA 4IXAA 5LRRA 3JAMZ 3T8RA 1H88C 1MH4A 4OAYA 2K85A 3M8JA 1K78A 4I0AA 5DDGA 1AHDP 1ZK8A 2W57A 3NARA 2BHYA 2FEZA 1WI3A 1WPKA 2Y31A 3JCUC 2PG4A 4NQWA 1VQ7I 3HHHA 3U1KA 1Z7LA 4UUTA 1FP1D 2BHZA 1X1BA 2QUFA 2BV6A 4OWRB 1DUXC 1E2XA 2NNYA 2BY2A 3I4PA 4WXHA 1B8IA 1YS6A 1P7JA 1V4RA 1DU0A 4B4CA 4M6XA 4ZDLA 2ESHA 3VSKA 1EJ9A 2E2JJ 2HQ5A 2LF8A 3LWFA 1OCCH 3W6JB 2XDVA 3TP3A 1D0YA 2W7NA 2JK3A 1F5TA 3CP8A 2ELHA 3ZXSA 4NDLA 3QPSA 3VWBA 1WHUA 1TNSA 1MBJA 2CMPA 5L3CA 4HSRA 2R5YA 5J4VA 2EZHA 4AIHA 1O7LA 2NOGA 4ITVA 5IP6A 1CF7A 2CW0F 2RV8A 5J40A 3HC7A 4HPQA 3FF5A 1XMAA 2JVHA 3BP8A 5J1YA 4CCLA 3CZ6A 2WV1A 4BH9A 1SFXA 3CUQA 2L9NA 4OIPF 2D5VA 5H2FC 5FLXK 2GZWA 4Y15A 2V1DA 2JUGA 1HKTA 3BR6A 1JGGA 1SFEA 1IUFA 3DKXA 1HSTA 3N4MA 2GQQA 2DDAA 3ZMDA 3KCCA 1T08B 1TWCJ 3A01A 3HYIA 1MGTA 3R4KA 3JRHA 4IQ4A 1IRFA 2EWNA 2F4OB 1FSEA 2HZTA 2YX7A 3BR5A 3LSTA 1EA3A 5EEAA 5C4XJ 2XGDA 3G1OA 3OOPA 2CS3A 3MKYB 4OINF 3WGGA 1Q1VA 1DPRA 1HXDA 4KT5C 4GRIA 3ZQLA 4BQOA 2WWYA 3G1MA 1G6NA 3OS2A 2L02A 3H5RA 3F72A 4UVCA 3RJPA 1DP7P 1W7PD 2HPMA 3B73A 4PFOA 5DD8A 5TJJA 3QYBA 3C18A 2VKDA 4D7MA 3DTEA 4YFNF 3J80Z 4V2GA 2PQ8A 3D5LA 1S8NA 2DTRA 2QSHX 2F5FA 1PUFA 2OJED 3IHUA 2CW8A 1VQMI 3BPVA 6PAXA 2R7VA 1R22A 2VBYA 4P9UA 4O3MA 3RZOJ 2DA6A 5DCMA 1MDMB 2ID6A 3EYYA 3VFZA 3HUGB 3JRGA 3LA7A 1A36A 3K9TA 1BL0A 3CUOA 1YG2A 3JREA 3BG7A 3JSOA 3E5UA 5CYVA 5HS9A 1ZR2A 3FXUA 5M5WJ 1LE8B 4I7HA 2KQRA 2HYJA 2JT1A 2QKMB 3SQNA 1YIOA 2IA2A 2DK5A 5GP9A 2EFOA 3TGNA 5J8FA 1HF0A 5K5QA 4HAMA 2ECCA 3EDPA 3QOEA 4ESJA 2F5VA 3CP2A 3PIOF 4BHBA 3E6BA 3BC8A 2Y0MA 2JA6J 5J6XA 3M8EA 2VJIA 3FM5A 1YHQI 3IL2A 1X3ZB 4D1QA 3I64A 1RI7A 5FKNA 3MKZA 1ZLKA 3LOCA 2XB0X 4D7NA 3CCSI 2BEOA 2H94A 2MFZA 4KT6A 1T6SA 3ZR8X 4JOMA 5JI6A 3OIQA 3FXRA 1N78A 2OAZA 3DTIA 5HDGA 3ABTA 1KQ9A 1RR7A 2WBMA 3CDIA 1LFPA 2Y2ZA 3NWSA 2WAFA 2L0KA 3OOUA 4M6YA 4CHUA 5D4SA 2M7AA 4XOTA 1WJEA 3CMEI 3PO3J 4MGRA 3V4GA 1R36A 4MIMA 1N25A 2OD5A 4B44A 5LD2C 4HW0A 1Y8RB 4F92B 4Z2YA 2VQCA 5GADJ 2P81A 4QPQA 2JRMA 1J09A 5JFRA 2DMQA 5D5XB 1G3YA 1BIAA 1QQIA 4W97A 1ON2A 2EB7A 5TGTA 4UV8A 3A2KA 1AU7A 2G0EA 2DCEA 4LG3A 2IGNA 1RNLA 1HW5A 2GWRA 2PMHA 1PP7U 1N77A 1BA5A 3C7JA 1XMKA 1JT6A 2LH9A 4A12A 1YS7A 1HW2A 3OYGA 2M30A 1VQ8I 2CQKA 3JRBA 1BI3A 2WB1A 4U0WA 2A05A 2KDOA 2VT3A 1AKHA 1XCBA 4FHTA 1YJWI 1F43A 4DZPA 3BR3A 5EF6A 2NNNA 3EUKL 2GIVA 1MW7A 1WCMJ 2E5NA 3HGGA 2HYFA 2GXAA 4RS8A 4OIOF 4KMUX 2DAOA 5F1RA 2ZMEB 3CDLA 3MVPA 2E19A 1IN7A 2VOOA 3SHFA 1XGNA 1S3JA 2BW3B 1T39A 5B1AH 1K7AA 3AG4H 3TO7A 4YIFA 5EGOA 3T8TA 4F55A 2VE9A 1OFCX 2XVCA 2OUMA 4RLQA 5AIPA 2AQFA 2A3SA 1XG1A 1KU3A 4B09A 4LG0B 2VN2A 2ME0A 3DEEA 5F08A 3J7ZI 2NAZA 2ZCWA 3ECHA 3TDUC 2FX0A 1Z77A 3RIRA 4EM2A 3W6VA 3LFKA 2GA1A 2VXDA 4P1WA 3PNVA 5L3GA 4BACA 2H8WA 2R7DA 2QBYA 1BI2A 1ETQA 2MYSA 1UB9A 4EVIA 3GX4X 1FIAA 3K1MA 1X1DA 4KN7X 5LEJA 2JUCA 2M4GA 1QZYA 3ELKA 4IHSA 4XKVA 3QQAA 1BR2A 2WADA 4XR6A 3S1RJ 3EUAA 1FPQA 2KZVA 1E0EA 3H5NA 4ENMA 3WODF 5BMZA 3KP6A 4KA4A 1TWGJ 2K4BA 2XGEA 3HOZJ 3KIOA 3TO6A 2LBFB 3CJQB 3LSPA 2LKXA 3RCOA 4HNUA 5LHHA 2CUJA 3ROUA 3BTLA 2DJIA 2LDUA 1WI9A 4UY8I 4AM3A 2LOOA 3L2RA 2DO7A 2HOTA 4IVNA 2DYRH 5D6FA 1D3YA 1JKOC 3KEOA 5E3MA 1TW3A 4BUPA 2BXZA 2XF7A 3R0JA 1RKTA 4MQVA 1Z3YA 4CO8A 2JZYA 5B5EC 3MMYB 1ZAOA 2VC0A 4Q47A 4BE2A 1QHHD 3WU1B 3A4CA 5KAIC 4YG2F 1X58A 4XSXF 3OYAA 3RPQA 2HXOA 4BBSJ 3MKWB 3KYCB 1I27A 3OYKA 5LEKA 1E3PA 3GTOJ 4R1HA 2KFDA 4HA8A 2DPDA 3CCYA 4BY7J 3MQ0A 2IPQX 2VQLA 3BWGA 3Q0UA 2DI3A 1VQ6I 3GTKJ 1S6LA 4LK1F 5E8IA 4BE0A 3FM3A 3DTKA 2EH3A 3K4BA 4BU2A 3I5UA 2HKOA 4ZYGA 1TBXA 4HF2A 1MBKA 3D5SC 2MBFA 5A2QZ 4GO1A 4C3JJ 3EQLF 3S2HJ 2CQ7A 2QGUA 5IP9J 2Q2EB 1YYVA 2ZFWA 1M1EB 5HDKA 1BR1A 4U88A 3WU2C 3I3LA 3GLXA 2R5ZA 3S17J 2MH2A 1MSEC 2EFQA 1WJCA 3WGIA 2DJNA 3OSFA 2NVXJ 1Y39A 1PVEA 1R58A 3H3ZA 1ETYA 2XASA 5IT9Z 1W7PB 4IKFA 1IXRC 2EIKH 3GO5A 2X6OA 4AVPA 2L7MP 5D8KB 4IHWA 2X48A 2M5WA 5KK1A 4XRMA 1EH8A 1OKRA 1XB4A 1A04A 2HOEA 3BR1A 5CKTA 5BNGA 2V1NA 5H6QA 2BY1A 4L5IA 3L7WA 2P4WA 4Q4ZF 1Z21A 1OCTC 3LNQA 3DLAA 5HNHA 1LVKA 2VKHA 3TQNA 4KYWA 1NK3P 5CVVA 1JTXA 1IV6A 2PJRA 1YI2I 1X3UA 1ZR4A 5IT3A 4IRHA 5F0FA 1SMYF 1Z6TA 2O6GE 4BJ6C 3DFGA 2VC1A 4P9FA 4PJMA 1QBJA 9ANTA 2DT7B 2M0MA 1W36C 2HPIA 3MD2A 4HQEA 2K4JA 3W2VA 3CESA 3BPXA 4JQFA 1H89C 2ZKZA 4LD5A 2FE3A 3ZMZA 3I4MJ 3V7CA 2HQAA 4XLNF 2FBKA 3H1CA 3UNGC 3G4SI 3CUQC 1Y0NA 5LRSA 1UMQA 1FOKA 1U9OA 1BOAA 1IGNA 5M3FJ 1UCRA 2P0WA 5DD4A 3I58A 3M9AA 4M3EA 4RGXA 3W3CA 5FRNA 5FKKA 1AWCA 3GTPJ 2DA2A 3DPUA 4E7HA 4W1UA 3SFZA 1JXSA 1B1BA 3OYNA 1T98A 4S05A 4A3DJ 3I9V2 2JSPA 4HG2A 5DV5A 1LUJB 1U8BA 2RGVA 2XPWA 1SVMA 4PCQA 1JUPA 2DT5A 1RUNA 4UB8C 2VPLA 4JYKA 3PJRA 2QCOA 1RR8C 3HJEA 2LNBA 3KP4A 3DQVC 1POGA 1BC8C 2JPCA 5E1WA 3HTUA 3H36A 5GAEJ 2OZUA 1BW5A 3IH2A 3K70D 2RNGA 1NHAA 2M45A 1JE8A 3Q0VA 1I39A 2JA2A 5CVUA 2B9SA 3K6GA 1HBXG 4CDGA 3ABMH 2IGKA 2V79A 1HLVA 1KQ0A 1W5CC 2FRHA 3IAS2 5K7ZA 1FOXA 5D4RA 1G3SA 1OQYA 1TQMA 3GTJJ 2FSWA 4M9ZA 3L09A 3K4LA 2VONA 5JVTA 2EFWA 2X6YA 2HTSA 1RESA 2JJ7A 5ILVA 1V3FA 4LLLA 2CG4A 3KZIC 1B72B 4V2FA 3TMOA 4XKWA 3OYFA 2DA3A 3GW2A 4FX4A 1XGMA 3QOPA 4M71A 4F3QA 3FDYA 4Z6YA 3H9GA 4O5VA 4PJLA 3GTLJ 3TKYA 1ZARA 2CRGA 3I55I 3ERED 3S93A 1GLNA 4IJAA 1W1WE 2WY8Q 1KYWA 5AIQA 5E20A 1T95A 3K1PA 4MHGA 1IO2A 1TC3C 2H1KA 5E3OA 2X4HA 1FC3A 4L9VA 3S3OA 1ZG5A 2R7ZJ 2ELKA 3K7AJ 3FBNB 1WKMA 2MC3A 4ESBA 3HOYJ 3RSNA 1PUEE 2EV6A 4CXFA 1ETKA 3Q3SA 2WB1N 3S32A 2FNPA 2M4KA 3WTZA 4ENKA 2XAFA 1BR4A 5BOXA 2HXIA 1V5FA 2LF7A 1WJFA 2L9VA 1SFUA 4IOAF 2K9QA 2GXGA 3CMYA 4G94A 3DV8A 1D0XA 2LRDA 3S16J 3CCLI 3F9KA 1J2XA 2K02A 3A0HC 2P7CB 5JHFA 2YSRA 1I5ZA 5IY5H 2O5RA 5EG0B 3BZCA 4BJ5C 5EEHA 1T33A 3O6BB 3FXJA 4XLEA 2E1CA 1NTCA 2LKPA 1VQPI 3O8HA 3F0CA 2A5YB 4BJTA 3SJMA 1YRNA 2LR8A 2KMUA 3PFIA 3CCEI 1QVUA 3CCRI 4G9YA 3O2PE 4MO7A 4MLOA 3ONQA 2UUZA 1ZQ3P 5JLWA 2FXAA 2HEOA 4E4HA 2HS5A 2A68F 2OTJI 1ULYA 1FLIA 1UJ8A 3JRIA 2HDWA 2OPTA 2IW5A 3Q9VA 2XKOA 3IAM2 3JTGA 4NC7A 1TWAJ 4YEJA 3PM1A 1RIOH 4I2OA 2VPRA 1PP8F 1S7OA 2K9NA 3RKWA 3ZRGA 4B43A 4BKXA 1XDSA 1UHSA 3GZNB 4YFXF 4OIQF 4II2A 4HNTA 1WJBA 4H0EA 1S7AA 4UB6C 2FBHA 1Y56A 4M73A 5CVRA 1BN5A 4XK4A 1WFXA 1OPCA 4LK0F 4XL9A 2XC7A 3ABKH 1FY7A 3COAC 4LB6B 3QAHA 3K1NA 3PUBA 3ZQFA 1LB2A 3QPHA 4KISA 4M3FA 4G7HF 1ORKA 2VJJA 2Z1DA 1H8AC 2V7FA 3CJTB 3KP3A 3FXKA 1O7FA 1STZA 2EPFA 4A3GJ 3BOQA 1ETVA 2ZBKA 5HLTA 1OYWA 2DQLA 3KETA 2FQ4A 3A1YA 3HTSB 2ZSHB 1FNNA 4LIVA 4A3JJ 2FJ1A 3JR9A 2FA5A 3BG3A 2O61A 1ZHFA 5FGMA 2M0CA 3GTMJ 4GGGA 1IRGA 3WG9A 1FOWA 1MBGA 3K2ZA 2NVUB 2CV1A 4HX8A 3MZHA 1TT0A 5B1BH 2O3FA 5E17F 1FMWA 2HZDA 4EM1A 2CH0A 4EGZA 3KEQA 5ICGA 2BGCA 2LYCA 3F8MA 2DYSH 2IS4A 4I99C 2VLAA 3NWTA 1R5HA 4FISA 4A3FJ 3D1NI 5HDNA 4EGYA 5CLSA 2R7QA 2ZJPF 2MC4A 4RGRA 2DA4A 2M8GX 4MTDA 1FYMA 1I3QJ 2LSOA 2HNHA 4BL0B 2DPUA 2CW7A 1I1GA 1MMAA 4HX7A 3WGHA 5K7HA 2OV7A 4NHJA 4XOPA 1GV5A 2XB5A 3HOUJ 4XN0A 2Z33A 2E1OA 2O9LA 2JA8J 2RQPA 1BC7C 2QM3A 2B63J 1YW7A 4AD9A 3HRUA 1VF9A 4S0HB 3DWLE 5E3LA 5E79C 4BXFA 2KP6A 4NUBA 3RTRA 3T0YA 3OIOA 1R49A 1E17A 2KDZA 1SAXA 5EDNA 4A0YA 3ZQCA 2R7FA 2QA4I 3KP2A 3DPTA 3M4OJ 2DMTA 2H6BA 2R7OA 3F8CA 4XLFA 5CQEA 1YW9A 4G8XA 4KNYA 4WXCA 2NRAC 1IN6A 2A5WA 2W1OA 1A35A 1SFKA 3K4CA 3ZQHA 1MD0A 4M6VA 3IKVA 3OV8A 2O0YA 1Y1VJ 4ESFA 1JJ6C 3MCZA 5CVJA 2E2IJ 2HFHA 3KFWX 3WU0A 2VKVA 4K2EA 4BDYA 2VJ4A 2XIGA 1SFOJ 4Y3OA 1FBQA 3M1CA 4BDZA 3S2DJ 2R7WA 3G2BA 5FFXA 1S72I 1J59A 3BT9A 3ULQB 1B9NA 1FSHA 5HOOA 3HUGA 4LB5A 3KLNA 3HIFA 1EF4A 3FXMA 3FKJA 4MQ9F 5ED4A 4HQMA 1K6OA 3FBIB 4ZJZA 3TBIA 2EZKA 2MLKA 3IH4A 3ZOBA 2FU4A 3BZKA 4AYBA 4B8XA 4XBFA 4QLCU 1ACIA 4MTEA 3CMAI 3BCBA 4KDPA 1T38A 2G7HA 3FMRA 3OWTA 3CCJI 2KIQA 2DMPA 2L2OA 2X6WA 3QP5A 4RGUA 4EMSA 4HDVA 1P9QC 4F91B 3P9KA 2ZXIA 2AHQA 2PEXA 2RKHA 2ME6A 2R0QC 1IAWA 1REPC 5CJ9A 4XORA 1G3TA 1R23A 2F5EA 3FKIJ 4M9XA 1XDUA 3LSMA 3WHCA 2H09A 2CO5A 2H8RA 5ERIA 2E35A 4Y17A 5IYDJ 3ZQ7A 4IRIA 1FOYA 1SVLA 3L2VA 4FQGA 1XN7A 2DQRA 3QODA 1XTAA 4E7LA 1XCVA 4C3IJ 2W82A 1VQNI 4U7DA 3A03A 3E6CC 4U7BA 1E3OC 1IRXA 3VSLA 3HXLA 3BTCA 3HZJA 5LHIA 2GOMA 4ZTFA 3IRRA 4IRGA 1D1CA 1D8KA 4WK8F 2IS1A 2R7UA 1Z1DA 1LJ9A 2P6TA 4OMYA 5F27A 1EKEA 4JX5A 2IA0A 1I6HJ 3GVAA 1QPMA 3KYLA 5L3BA 1D5VA 3E3VA 2E2HJ 3J81K 1PUFB 5H6RA 4XNFA 4DW6A 3HRSA 5LHGA 3LSHA 3AL0C 5E8GA 5C3EJ 1K61A 2WC2A 3M7GA 4DJAA 2ZJQF 3RPUD 4AIJA 2ZNZA 3RKXA 3LSGA 2GLOA 4A5MA 2XF6A 3W2WA 3OS0A 2Z5UA 1YO5C 3HM5A 1GDTA 2I5UA 4I0BA 5C44J 1H9GA 4EATA 2OTLI 2WTEA 2BE5F 4PFPA 2UV1A 5FD5A 4DYQA 4FCYA 4CCOA 5EYRA 2E1MB 2W85A 5K7FA 4XIDA 2CFXA 1Z3XA 4ZDPA 4Y33A 1FBUA 1SD5A 3FIWA 2ZMEA 2VI6A 2XSDC 1ZRFA 1I6XA 2D1HA 4MFEA 1YIJI 2XROA 1YLFA 2BW3A 2IRFG 3PIPF 1RZ4A 2P8TA 1WZ2A 4RM3A 4XM3A 3H9JA 4EJTA 3H3UA 5A2QK 4M3BA 4DZJA 4AIDA 1O3TA 4U0VA 1H0MA 2N8GA 4LG0A 3E5QA 2OBPA 2H6CA 1BJZA 5M3MJ 2AXTC 4BE1A 1U5TB 2JMWA 4IOCF 4NNJA 1SAUA 5FLXZ 5FO5A 2G7UA 2F48A 2STWA 1P2FA 2Z16A 1JKQC 2V6CA 4KIFA 1IRZA 2HOSA 2M3AA 2VBXA 3BR2A 3BY6A 4UUSB 2MSYA 2MLGA 1KZHA 2DOEA 4ZC3A 3GBGA 1WRJA 1ZYRF 3CTAA 1S5LC 4HDUA 3KPHA 2GIZA 2UZKA 2W00A 5LFAA 2RVCA 2Y75A 2QQBA 1ZTRA 4P96A 3U2RA 3TW6A 2LY2A 4KICA 4AVZA 2LBFA 1OISA 2Y0SN 3IKTA 3AFHA 1VZ0A 2EIMH 4J00A 2E60A 1VNDA 3L2QA 1HKSA 4LGWA 4U87A 2F5CA 1R71A 4CCMA 3QYFA 2HGCA 4BEHB 2X9DA 1Y6IA 3VODA 3L2WA 2WAQN 3G73A 3AG3H 3Q5FA 4UVAA 5D5UB 4I98B 1J75A 1IC8A 4CCJA 3OYIA 4JX6A 4PDKA 2YX4A 2OQGA 2JRTA 1U2WA 3WTTC 5F6FA 3JRAA 2IT0A 1MMNA 3QP6A 5EGOB 3UKGA 3FISA 5HODA 3GTGJ 1RC9A 2R7TA 3BTIA 1SD6A 1EH7A 3L1PA 4Y13A 3ABUA 1K6YA 1HOMA 5DUIA 3RI4A 3KX2A 4XKCA 3BJ6A 1LKXA 2OA4A 5GPAA 3R6SA 2VODA 1OLTA 1SD4A 1ETXA 1P4WA 2QEXI 3IH3A 2QQ8A 4CCKA 1XPXA 1IF1A 2LD5A 2MGQA 2M2EA 5JLXA 1G3WA 2CV2A 4CCNA 2D45A 2F6CA 3WE3A 4KFCA 4CA0A 4N4OB 2NVTJ 5DUKA 3EPZA 3FX3A 2QBYB 1QVTA 3F22A 4C30A 4RB2C 4UHTA 5IOYA 3HB9A 4IHVA 4IHXA 1TWHJ 3CMMA 3J7AO 4XLAA 5GTHC 2VJ5A 4ZH4F 4Y7NJ 2HKXA 2DTZA 3GFIA 3S1NJ 3I59B 3CQZJ 4HX4A 5DM7F 3GFMA 2P7VB 4KJZA 2LLKA 2EQRA 1W7PA 1LVAA 1USTA 1ZG1A 3CCUI 2COMA 4UUVA 2D2WA 4Y4RA 2KJBA 2K3FA 4IZZA 1ZGWA 2VUMJ 4G6TB 3WTYC 1UAAA 2EJRA 2ELJA 3DEUA 5KCMA 1PDNC 5FKMA 1QZZA 2X1EA 1B59A 1P92A 4OAZA 3AG2H 2XF5A 1UHWA 2M9HA 2M34A 1F4KA 3E6DA 3F8BA 1OR7A 5J1UA 3BJAA 2Z2SB 2E7XA 1B4AA 4HF1A 3QYEA 3KEYA 1ZLJA 3B6CA 3REOA 2FNAA 5J1RA 1BI0A 1SMTA 4X1EA 4I6ZA 1H9TA 4ZYAA 5B3SH 3C3WA 1L0OC 2DOFA 3OYMA 3CC7I 2OCCH 5EZGA 1DP3A 2JWTA 3HSRA 1P6RA 4PSXA 1VQLI 3D0SA 3LAJA 1XC5A 2BBYA 4AU7A 2R3SA 3LSRA 4HRIA 2BYVE 3E7LA 1OCZH 4B48A 3M3YJ 1W0UA 1X4PA 4ASNA 2QENA 4RB0A 4LLNA 2PFBA 2K5CA 1ZGAA 1HDDC 1QU3A 4D5FA 4PJ0C 3ASOH 1E3HA 3RQIA 3M07A 4HYEA 4RMNA 5HLHA 3PO2J 3MWMA 1TLHB 2JA5J 5D5WB 4RB3C 3HKZA 4ZYEA 4H4KC 1JTYA 3DBLB 2XSJC 4G7ZF 1WGXA 2F4IA 3FHNA 4B3AA 3X2QH 4R79A 2L9RA 5KHDA 2R5ZB 3NEUA 2KZGA 4L5EA 1WJDA 2VQGA 3U9GA 4DBQA 2OQRA 4FASD 4HNVA 4RDUA 1FP2A 2QLZA 4BNCA 5M5XJ 1J0RA 4BXUA 2XGCA 4I09A 1KU2A 2COBA 5AONA 5LGNA 2W25A 2JA7J 1W36D 1GXQA 4ENJA 1JGSA 3BG6A 4B1RA 5KVRA 2DA5A 3M8FA 1S29A 2PMZA 2RC4A 1Z7UA 2MW8A 1F9NA 3K10A 3H35A 2GA2A 1LDJA 2DODA 4A69C 4DYRA 2K9MA 1DGRM 2QWWA 1WJ5A 3OYBA 2V9KA 1B72A 2PJRB 2CV0A 4PUSA 2KL4A 1A5JA 1I50J 3HPHA 4NBQA 3SZTA 5EZHA 5FD6A 3JAMK 1TT5B 1WVRA 1S9HA 2DK8A 5K5OA 2LK2A 2LP0A 1VQOI 4HOBA 4P55A 1YX3A 1HQCA 2K27A 1X19A 2A07F 4C9YA 2W84A 5IYBJ 2EILH 4Q5SF 1SD7A 1V55H 2UXNA 3QU3A 3ZP5A 1OCRH 4E7JA 2FMYA 1R4MB 2PJPA 5HS7A 1V5GA 4KUMA 1GT0C 2DW4A 2QQAA 4C2MJ 3JRFA 4Y52J 3V7SA 4JK1X 1YJ9I 4XRFA 2KPMA 2L4AA 1FTTA 4M3DA 4A6DA 1A31A 1R1VA 4YFKF 2EZLA 2XUBA 2KIMA 1UG0A 4A3MJ 2J5OA 1HC8A 2WA0A 4PK4A 2DFHA 3DLLF 5CVIA 1R9TJ 1IXCA 3E6MA 4DYCA 5LBQA 3BROA 2LG4A 4RGSA 2HVSA 1ITYA 1Y8QB 1Q1HA 2HOAA 2L3DA
chains in the Genus database with same CATH topology
1ZN2A 3ZMVA 3GUDA 1KU7A 2PMUA 4BQAA 5BS6A 1YW8A 4UV9A 2ACJA 2PLYA 1W5SA 2D1VA 1U3EM 3WTWC 3WTXC 1KU9A 4L9JA 1ZH5A 2P6SA 1UFMA 5E18F 4PGHA 1R7JA 5L3EA 3F8NA 4M74A 2JSCA 3NQOA 3LAPA 4I02A 5E1XA 2EK5A 3MAJA 4S04A 5BQTA 4IHTA 3B02A 1XSVA 5HVQC 1ZGJA 4R8HA 2QYOA 2B0LA 1HSJA 3HSEA 2O03A 2RNJA 5TRDA 3KP5A 4A5NA 4L18B 1BI1A 1FT9A 3J80K 4G6QA 2CSOA 2L54A 4OIRF 3KE2A 2E7WA 1P4XA 3GYHX 2V9VA 2VXZA 1F1ZA 4XLPF 3HHGA 2A6EF 4OMZA 1T0FA 1W5TA 1IN4A 5EEGA 3TOBA 3O3KA 3CO6C 2KIFA 4HZFA 2O8XA 3P9IA 4UVBA 2TDXA 3F8FA 3QU6A 3ZN0A 4KIGA 3DXJF 3HSFA 3L2CA 3ZN1A 4TV7A 2FQ3A 2G9WA 5ICEA 1O3RA 4HV5A 3RYRA 4GCVA 1Y0UA 1WSUA 2HQNA 2HQRA 5LGTA 3RYPA 4A2UA 4GXOA 1LNWA 2FOKA 4M72A 1K78B 4KN4X 5LLQA 2EA2A 2MA3A 2EV5A 5D5VB 3NRVA 4DNCA 2ZO4A 2P5LC 3FZVA 2ESNA 4MEXF 3V8KA 2GXBA 3VEPA 4D0PA 3HRMA 4MNUA 4FT8A 1IUYA 2K7LA 4WCGA 3PQKA 2XV4S 2QQ9A 3JW4A 3BJOA 4UNOA 2L01A 4KIBA 3L9FA 2JTVA 1MDMA 3DKWA 3R60A 1CF7B 3ISPA 2VT2A 2WV0A 1QO0D 1Z05A 2YPRA 4ZZLA 4OU0A 4L0YB 1HW1A 3CUQB 1Z6RA 4WF2A 4EJUA 1W4MA 3IC7A 3WE2A 3GFLA 1USSA 3F21A 4HLYA 3MEXA 4HF0A 4JBAA 3MFKA 2M1BA 3ML6A 1LEAA 3F23A 4HBLA 4ON0A 5HS8A 3BZ6A 4CGZA 2CYYA 3F6OA 5FB2A 2XAQA 5DCFA 3IWZA 3FMSA 4BHCA 4UXNA 4XSZF 3SXYA 2HYGD 2OZ6A 2FF4A 5J8CA 2GAUA 3K69A 1Z91A 3TO9A 3FMQA 4I01A 3FXQA 4EJOA 3JTHA 5K1YA 1DPUA 5E1ZB 3VB2A 3DPLC 2EV0A 5DCMB 4LMYA 2P5VA 1LQ1A 1ON1A 1IN8A 1ZG3A 4ZYHA 2F5DA 5HLIA 1U5TA 2ADUA 4E70A 1D8JA 3EETA 2XAGA 2L4MA 1T2KA 1BBYA 1O3QA 3H92A 3TOAA 2EA4A 1OYYA 3V7RA 1WQ2A 4GYIA 1ZRDA 1TQIA 3GXOA 3MZYA 2DLLA 5K5RA 3R61A 1KGSA 1OYIA 2J5PA 1LDKB 2P5KA 4QWQA 3CJNA 4A0ZA 1YTYA 3GZ6A 2ISZA 1KQ8A 1BIBA 3C1DA 2YR2A 2XRNA 4WXDA 5IT9K 3KLOA 3QPTA 1R1TA 3LA2A 4GYGA 4L5JA 3FWEA 3GFJA 2MH9A 1CGPA 1ZREA 3G3ZA 1TNTA 5DYMA 1FWZA 1XGSA 3N97A 2JPBA 3W6KB 3BDDA 3LQQA 1MKMA 3R0AA 3ZPLA 3T1BA 2QZ8A 2XAJA 5ILSA 2ZNYA 2V1XA 2VOPA 4P5OA 3WTUC 2RN7A 2A61A 5D8LB 4Q48A 1ONVA 4WWCA 4EV0A 1GXPA 1ZRCA 1K79A 1FX7A 3IRQA 2VBWA 2K86A 2HTJA 4CYDA 2ZJ2A 1BM9A 2ETHA 2RDPA 3I59A 2VE8A 1IZ1A 2IA1A 4OOIA 1TQPA 1LEBA 2M87A 4CICA 1ODDA 1DDNA 1U8RA 2XHKA 5HLGA 4ZZDA 3GF2A 2PI0A 2MD5A 2Q2EA 4BAYA 1J9IA 1R1UA 4A6EA 1BJAA 2OU2A 4LLGF 3J81Z 3P9CA 2DBBA 3IWFA 1TTYA 1QNTA 2DU9A 4ENNA 2M8EA 3GWZA 1U6GA 1GHCA 2X0LA 2AS5F 1JHFA 2A69F 2Z3YA 5L3FA 5LGUA 2ZXJA 2FMLA 2VBZA 3P7NA 4EM0B 4L9NA 2DFIA 4WX9A 2F2EA 4PGGA 2XAHA 1B9MA 1AOYA 5F64A 3VOEA 2A6HF 2IJLA 1P4AA 3KZZA 3RKYA 2HR3A 4F7ZA 2YU3A 3E5XA 1XGOA 4MEYF 4N0BA 4EQQA 4IPAA 1EH6A 1B6AA 4NB5A 2XGXA 4YIIA 4RAZA 2Z9OA 3KZYA 3CO7C 3EYIA 1L3LA 3RPUA 5ICFA 4AWXB 3HOSA 1FYLA 5FFZA 1RUOA 2Q0OA 3DF8A 3LA3A 2V1UA 1I1SA 2IVMA 1YFHA 3S2WA 3I53A 2KRFA 3GZ5A 2Q8KA 3JSPA 1GVJA 2PN6A 3FHZA 1Z9CA 3HRTA 3I71A 4HV6A 1XSDA 4RAYA 2HWVA 4RB1A 1YQAA 1IN5A 1WWXA 3ZMTA 3U1DA 5BPDA 3Q9SA 4KMFA 2ISYA 1QGPA 1C0WA 3V8JA 1MZBA 2IP2A 1KYZA 2HDCA 1LDDA 4M9SA 2UXXA 2KJCA 1FYKA 1MJAA 2CGPA 2E1NA 4N9IA 4EJWA 3KP7A 3ZMSA 3SZPA 4IF4A 2NYXA 2CWEA 1EV7A 5BPIA 4FX0A 2C6YA 4LFUA 3LQRA 2AXLA 4ZYDA 1FBSA 1U78A 2H27A 1G4DA 1TW2A 2Z99A 3I54A 3CDHA 1XSXA 2KIUA 3T5XA 5D6EA 3V8LA 3I0TA 2XKPA 5ILUA 1IW7F 1VTNC 3F6VA 4BHPA 4BYYA 4LJZF 1MJ9A 1R5GA 4G7OF 3RDIA 3K0LA 3QRFF 3M1EA 5ICCA 4U0YA 1O3SA 1FZPB 4EJVA 4O6JA 5JR3A 3ZMUA 1U5TC 2QVOA 3E97A 2NS0A 2KKOA 5L3DA 1R00A 3AAFA 1KA8A 4AIKA 3GEZA 4ETSA 3PQJA 1J7KA 3HOTA 4PZJA 2EFPA 3F3XA 2Y48A 4A0XA 5H20A 1OMIA 2UWMA 2PBIA 4L0ZB 4DQ2A 4CZZA 3DP7A 3TDZC 4N9HA 1HKQA 4HLXA 2W24A 4L9TA 3WTVC 5DEQA 1J5YA 5JHUA 3L00A 2STTA 4G6DA 2EFNA 3WTSC 2FBIA 1IXSB 3ECOA 3CLOA 1O57A 1UHMA 1XD7A 3EUHA 1JHHA 1MJBA 4IXAA 5LRRA 3JAMZ 3T8RA 1K78A 4I0AA 5DDGA 2W57A 2FEZA 4NQWA 2PG4A 3HHHA 1FP1D 2QUFA 2BV6A 1DUXC 1E2XA 2NNYA 3I4PA 4WXHA 1YS6A 1V4RA 4M6XA 2ESHA 2LF8A 3LWFA 3W6JB 1F5TA 2ELHA 1TNSA 5L3CA 4AIHA 1O7LA 1CF7A 2CW0F 2RV8A 3FF5A 1XMAA 3BP8A 4BH9A 1SFXA 3CUQA 4OIPF 5FLXK 2GZWA 4Y15A 2V1DA 1HKTA 1SFEA 1HSTA 3N4MA 2GQQA 3ZMDA 3KCCA 3HYIA 1MGTA 3R4KA 1IRFA 2EWNA 1FSEA 2HZTA 2YX7A 3LSTA 3OOPA 4OINF 3WGGA 1DPRA 1HXDA 4KT5C 2WWYA 1G6NA 2L02A 3F72A 4UVCA 3RJPA 1DP7P 1W7PD 3B73A 5DD8A 5TJJA 3C18A 4YFNF 3J80Z 2PQ8A 3D5LA 1S8NA 2DTRA 2F5FA 3IHUA 3BPVA 6PAXA 1R22A 2VBYA 4P9UA 4O3MA 5DCMA 1MDMB 3VFZA 3EYYA 3LA7A 3K9TA 3CUOA 1YG2A 3JSOA 3E5UA 5CYVA 5HS9A 3FXUA 4I7HA 3SQNA 2JT1A 1YIOA 2IA2A 2DK5A 2EFOA 3TGNA 5J8FA 5K5QA 4HAMA 3EDPA 4ESJA 4BHBA 3E6BA 2Y0MA 5J6XA 3M8EA 3FM5A 3IL2A 3I64A 1RI7A 1ZLKA 2BEOA 2H94A 1T6SA 5JI6A 3FXRA 2OAZA 5HDGA 3ABTA 1KQ9A 4M6YA 4CHUA 5D4SA 4MGRA 3V4GA 1R36A 2OD5A 4HW0A 4Z2YA 5JFRA 5D5XB 1G3YA 1BIAA 1QQIA 1ON2A 2EB7A 4UV8A 1RNLA 1HW5A 2GWRA 2PMHA 1PP7U 3C7JA 1XMKA 4A12A 1YS7A 1HW2A 2M30A 2CQKA 1BI3A 4U0WA 2VT3A 1XCBA 4FHTA 2NNNA 2GIVA 2HYFA 4RS8A 4OIOF 4KMUX 2DAOA 5F1RA 2ZMEB 1IN7A 2VOOA 3SHFA 1XGNA 1S3JA 1T39A 1K7AA 3TO7A 4YIFA 3T8TA 2VE9A 2XVCA 5AIPA 2A3SA 1KU3A 4B09A 4LG0B 2VN2A 2NAZA 2ZCWA 3ECHA 3TDUC 3RIRA 4EM2A 3LFKA 2GA1A 5L3GA 2R7DA 2QBYA 1BI2A 3GX4X 1UB9A 4EVIA 3K1MA 4KN7X 5LEJA 1QZYA 3ELKA 4IHSA 1FPQA 4ENMA 3WODF 5BMZA 3KP6A 4KA4A 2K4BA 3TO6A 5LHHA 3ROUA 2LDUA 1WI9A 2DO7A 4IVNA 5D6FA 1D3YA 3KEOA 1TW3A 3R0JA 4MQVA 4CO8A 2JZYA 1ZAOA 2VC0A 4Q47A 3WU1B 4YG2F 4XSXF 3RPQA 1I27A 5LEKA 4R1HA 4HA8A 2DPDA 3MQ0A 2IPQX 3BWGA 2DI3A 1S6LA 4LK1F 5E8IA 3FM3A 3I5UA 2HKOA 4ZYGA 1TBXA 4HF2A 2MBFA 5A2QZ 4GO1A 3EQLF 2ZFWA 1YYVA 5HDKA 4U88A 3GLXA 2MH2A 2EFQA 3WGIA 1R58A 3H3ZA 2XASA 5IT9Z 1W7PB 1IXRC 3GO5A 4AVPA 5D8KB 2M5WA 5KK1A 1EH8A 1OKRA 1XB4A 1A04A 2HOEA 5H6QA 4L5IA 3L7WA 2P4WA 4Q4ZF 3TQNA 4KYWA 5CVVA 1X3UA 5IT3A 4IRHA 1SMYF 1Z6TA 2O6GE 3DFGA 2VC1A 4P9FA 1QBJA 4HQEA 2K4JA 3BPXA 4JQFA 2ZKZA 4LD5A 2FE3A 3ZMZA 3V7CA 4XLNF 2FBKA 3CUQC 1FOKA 5LRSA 1BOAA 1UCRA 5DD4A 3I58A 3M9AA 4RGXA 1AWCA 3SFZA 1JXSA 1B1BA 1T98A 4S05A 5DV5A 2RGVA 4PCQA 2DT5A 1RUNA 2LNBA 3KP4A 3DQVC 1BC8C 2JPCA 5E1WA 3HTUA 2OZUA 1NHAA 2M45A 1JE8A 5CVUA 1HBXG 4CDGA 2V79A 1KQ0A 2FRHA 5D4RA 1G3SA 1TQMA 2FSWA 4M9ZA 3L09A 2VONA 5JVTA 2EFWA 2HTSA 5ILVA 1V3FA 4LLLA 2CG4A 3GW2A 4FX4A 1XGMA 3QOPA 4M71A 4O5VA 3TKYA 1ZARA 3ERED 4IJAA 1KYWA 5AIQA 5E20A 3K1PA 4MHGA 2X4HA 1FC3A 4L9VA 1ZG5A 1WKMA 2MC3A 4ESBA 1PUEE 2EV6A 4CXFA 2FNPA 3WTZA 4ENKA 2XAFA 5BOXA 2LF7A 1SFUA 2GXGA 4G94A 3DV8A 2P7CB 1J2XA 2K02A 2YSRA 1I5ZA 5EEHA 3O6BB 2E1CA 2LKPA 2A5YB 3PFIA 4G9YA 3O2PE 2FXAA 2HEOA 2HS5A 2A68F 1ULYA 1FLIA 2IW5A 3Q9VA 2XKOA 3JTGA 1RIOH 4I2OA 1PP8F 1S7OA 3RKWA 1XDSA 4YFXF 4OIQF 4H0EA 1S7AA 2FBHA 4M73A 5CVRA 1BN5A 1OPCA 4LK0F 1FY7A 3COAC 4LB6B 3QAHA 3K1NA 1LB2A 3QPHA 4G7HF 3KP3A 1O7FA 1STZA 3BOQA 2ZBKA 1OYWA 2DQLA 3KETA 3HTSB 1FNNA 2FA5A 2O61A 1ZHFA 5FGMA 1IRGA 4GGGA 3WG9A 3K2ZA 4HX8A 3MZHA 2O3FA 5E17F 4EM1A 4EGZA 3KEQA 5ICGA 2BGCA 3F8MA 1R5HA 5HDNA 4EGYA 5CLSA 4RGRA 4MTDA 1FYMA 2LSOA 2DPUA 1I1GA 4HX7A 3WGHA 4NHJA 2Z33A 2RQPA 1BC7C 2QM3A 1YW7A 4AD9A 3HRUA 3RTRA 3T0YA 1E17A 1SAXA 4A0YA 2R7FA 3KP2A 3DPTA 2H6BA 3F8CA 1YW9A 4G8XA 4KNYA 4WXCA 2NRAC 1IN6A 1MD0A 3IKVA 3OV8A 2O0YA 4ESFA 3MCZA 5CVJA 2HFHA 3KFWX 3WU0A 4K2EA 2XIGA 1FBQA 5FFXA 1J59A 3ULQB 1B9NA 1FSHA 5HOOA 3HUGA 4LB5A 3KLNA 3HIFA 4MQ9F 5ED4A 4HQMA 1K6OA 2MLKA 2FU4A 4B8XA 4XBFA 4QLCU 4MTEA 4KDPA 1T38A 2G7HA 3FMRA 3QP5A 4RGUA 4EMSA 4HDVA 3P9KA 2PEXA 2RKHA 1IAWA 1REPC 5CJ9A 1G3TA 1R23A 2F5EA 4M9XA 1XDUA 2H09A 2CO5A 5ERIA 4Y17A 3ZQ7A 4IRIA 1XN7A 2DQRA 1XCVA 4U7DA 3E6CC 4U7BA 5LHIA 3IRRA 4IRGA 1D8KA 4WK8F 1Z1DA 1LJ9A 2P6TA 4OMYA 2IA0A 3GVAA 1QPMA 5L3BA 1D5VA 3E3VA 3J81K 5H6RA 3HRSA 5LHGA 5E8GA 2WC2A 3M7GA 4AIJA 2ZNZA 3RKXA 4A5MA 2Z5UA 1YO5C 4I0BA 1H9GA 2WTEA 2BE5F 5FD5A 2W85A 2CFXA 1FBUA 1SD5A 1ZRFA 2ZMEA 1I6XA 2D1HA 2XROA 1YLFA 2IRFG 1RZ4A 2P8TA 4EJTA 3H3UA 5A2QK 1O3TA 4U0VA 1H0MA 4LG0A 3E5QA 2OBPA 2H6CA 1U5TB 5FLXZ 5FO5A 2G7UA 2STWA 1P2FA 2V6CA 4KIFA 2VBXA 3BY6A 2MLGA 1WRJA 1ZYRF 3CTAA 4HDUA 2UZKA 2RVCA 2Y75A 2QQBA 4P96A 3U2RA 4KICA 3IKTA 1HKSA 4LGWA 2F5CA 2HGCA 3VODA 3G73A 3Q5FA 4UVAA 5D5UB 4I98B 1J75A 4PDKA 2YX4A 2OQGA 2JRTA 1U2WA 3WTTC 5F6FA 2IT0A 3QP6A 1SD6A 1EH7A 4Y13A 3ABUA 5DUIA 3RI4A 3BJ6A 2OA4A 3R6SA 2VODA 1SD4A 1P4WA 1IF1A 1G3WA 2D45A 3WE3A 4KFCA 5DUKA 3FX3A 2QBYB 3F22A 4RB2C 4UHTA 3J7AO 4ZH4F 2HKXA 3GFIA 3I59B 4HX4A 3GFMA 2P7VB 1W7PA 1LVAA 1USTA 1ZG1A 2COMA 4UUVA 2D2WA 2KJBA 3WTYC 2EJRA 3DEUA 1PDNC 1QZZA 1B59A 1P92A 1UHWA 1F4KA 3E6DA 3F8BA 1OR7A 3BJAA 2E7XA 1B4AA 4HF1A 1ZLJA 3REOA 2FNAA 1BI0A 1SMTA 1H9TA 3C3WA 1L0OC 3HSRA 1P6RA 3D0SA 3LAJA 2BBYA 2R3SA 2BYVE 4ASNA 2QENA 4RB0A 4LLNA 2PFBA 1ZGAA 5HLHA 4HYEA 3MWMA 1TLHB 5D5WB 4RB3C 4ZYEA 4G7ZF 4R79A 3NEUA 3U9GA 2OQRA 1FP2A 2QLZA 4BNCA 1J0RA 4BXUA 4I09A 1KU2A 5AONA 5LGNA 2W25A 1GXQA 4ENJA 1JGSA 5KVRA 3M8FA 1S29A 2RC4A 1Z7UA 1F9NA 2GA2A 1LDJA 2QWWA 3JAMK 3SZTA 5FD6A 2DK8A 5K5OA 4HOBA 4P55A 1HQCA 2K27A 2A07F 2W84A 4Q5SF 1SD7A 2UXNA 3QU3A 3ZP5A 2FMYA 2PJPA 5HS7A 4KUMA 2DW4A 2QQAA 3V7SA 4JK1X 4XRFA 2L4AA 4A6DA 1R1VA 4YFKF 2XUBA 2KIMA 2J5OA 5CVIA 1IXCA 3E6MA 5LBQA 3BROA 4RGSA 1Q1HA 2L3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ZN2 A;  3ZMV A;  3GUD A;  1KU7 A;  2PMU A;  4BQA A;  5BS6 A;  1YW8 A;  4UV9 A;  2ACJ A;  2PLY A;  1W5S A;  2D1V A;  1U3E M;  3WTW C;  3WTX C;  1KU9 A;  4L9J A;  1ZH5 A;  2P6S A;  1UFM A;  5E18 F;  4PGH A;  1R7J A;  5L3E A;  3F8N A;  4M74 A;  2JSC A;  3NQO A;  3LAP A;  4I02 A;  5E1X A;  2EK5 A;  3MAJ A;  4S04 A;  5BQT A;  4IHT A;  3B02 A;  1XSV A;  5HVQ C;  1ZGJ A;  4R8H A;  2QYO A;  2B0L A;  1HSJ A;  3HSE A;  2O03 A;  2RNJ A;  5TRD A;  3KP5 A;  4A5N A;  4L18 B;  1BI1 A;  1FT9 A;  3J80 K;  4G6Q A;  2CSO A;  2L54 A;  4OIR F;  3KE2 A;  2E7W A;  1P4X A;  3GYH X;  2V9V A;  2VXZ A;  1F1Z A;  4XLP F;  3HHG A;  2A6E F;  4OMZ A;  1T0F A;  1W5T A;  1IN4 A;  5EEG A;  3TOB A;  3O3K A;  3CO6 C;  2KIF A;  4HZF A;  2O8X A;  3P9I A;  4UVB A;  2TDX A;  3F8F A;  3QU6 A;  3ZN0 A;  4KIG A;  3DXJ F;  3HSF A;  3L2C A;  3ZN1 A;  4TV7 A;  2FQ3 A;  2G9W A;  5ICE A;  1O3R A;  4HV5 A;  3RYR A;  4GCV A;  1Y0U A;  1WSU A;  2HQN A;  2HQR A;  5LGT A;  3RYP A;  4A2U A;  4GXO A;  1LNW A;  2FOK A;  4M72 A;  1K78 B;  4KN4 X;  5LLQ A;  2EA2 A;  2MA3 A;  2EV5 A;  5D5V B;  3NRV A;  4DNC A;  2ZO4 A;  2P5L C;  3FZV A;  2ESN A;  4MEX F;  3V8K A;  2GXB A;  3VEP A;  4D0P A;  3HRM A;  4MNU A;  4FT8 A;  1IUY A;  2K7L A;  4WCG A;  3PQK A;  2XV4 S;  2QQ9 A;  3JW4 A;  3BJO A;  4UNO A;  2L01 A;  4KIB A;  3L9F A;  2JTV A;  1MDM A;  3DKW A;  3R60 A;  1CF7 B;  3ISP A;  2VT2 A;  2WV0 A;  1QO0 D;  1Z05 A;  2YPR A;  4ZZL A;  4OU0 A;  4L0Y B;  1HW1 A;  3CUQ B;  1Z6R A;  4WF2 A;  4EJU A;  1W4M A;  3IC7 A;  3WE2 A;  3GFL A;  1USS A;  3F21 A;  4HLY A;  3MEX A;  4HF0 A;  4JBA A;  3MFK A;  2M1B A;  3ML6 A;  1LEA A;  3F23 A;  4HBL A;  4ON0 A;  5HS8 A;  3BZ6 A;  4CGZ A;  2CYY A;  3F6O A;  5FB2 A;  2XAQ A;  5DCF A;  3IWZ A;  3FMS A;  4BHC A;  4UXN A;  4XSZ F;  3SXY A;  2HYG D;  2OZ6 A;  2FF4 A;  5J8C A;  2GAU A;  3K69 A;  1Z91 A;  3TO9 A;  3FMQ A;  4I01 A;  3FXQ A;  4EJO A;  3JTH A;  5K1Y A;  1DPU A;  5E1Z B;  3VB2 A;  3DPL C;  2EV0 A;  5DCM B;  4LMY A;  2P5V A;  1LQ1 A;  1ON1 A;  1IN8 A;  1ZG3 A;  4ZYH A;  2F5D A;  5HLI A;  1U5T A;  2ADU A;  4E70 A;  1D8J A;  3EET A;  2XAG A;  2L4M A;  1T2K A;  1BBY A;  1O3Q A;  3H92 A;  3TOA A;  2EA4 A;  1OYY A;  3V7R A;  1WQ2 A;  4GYI A;  1ZRD A;  1TQI A;  3GXO A;  3MZY A;  2DLL A;  5K5R A;  3R61 A;  1KGS A;  1OYI A;  2J5P A;  1LDK B;  2P5K A;  4QWQ A;  3CJN A;  4A0Z A;  1YTY A;  3GZ6 A;  2ISZ A;  1KQ8 A;  1BIB A;  3C1D A;  2YR2 A;  2XRN A;  4WXD A;  5IT9 K;  3KLO A;  3QPT A;  1R1T A;  3LA2 A;  4GYG A;  4L5J A;  3FWE A;  3GFJ A;  2MH9 A;  1CGP A;  1ZRE A;  3G3Z A;  1TNT A;  5DYM A;  1FWZ A;  1XGS A;  3N97 A;  2JPB A;  3W6K B;  3BDD A;  3LQQ A;  1MKM A;  3R0A A;  3ZPL A;  3T1B A;  2QZ8 A;  2XAJ A;  5ILS A;  2ZNY A;  2V1X A;  2VOP A;  4P5O A;  3WTU C;  2RN7 A;  2A61 A;  5D8L B;  4Q48 A;  1ONV A;  4WWC A;  4EV0 A;  1GXP A;  1ZRC A;  1K79 A;  1FX7 A;  3IRQ A;  2VBW A;  2K86 A;  2HTJ A;  4CYD A;  2ZJ2 A;  1BM9 A;  2ETH A;  2RDP A;  3I59 A;  2VE8 A;  1IZ1 A;  2IA1 A;  4OOI A;  1TQP A;  1LEB A;  2M87 A;  4CIC A;  1ODD A;  1DDN A;  1U8R A;  2XHK A;  5HLG A;  4ZZD A;  3GF2 A;  2PI0 A;  2MD5 A;  2Q2E A;  4BAY A;  1J9I A;  1R1U A;  4A6E A;  1BJA A;  2OU2 A;  4LLG F;  3J81 Z;  3P9C A;  2DBB A;  3IWF A;  1TTY A;  1QNT A;  2DU9 A;  4ENN A;  2M8E A;  3GWZ A;  1U6G A;  1GHC A;  2X0L A;  2AS5 F;  1JHF A;  2A69 F;  2Z3Y A;  5L3F A;  5LGU A;  2ZXJ A;  2FML A;  2VBZ A;  3P7N A;  4EM0 B;  4L9N A;  2DFI A;  4WX9 A;  2F2E A;  4PGG A;  2XAH A;  1B9M A;  1AOY A;  5F64 A;  3VOE A;  2A6H F;  2IJL A;  1P4A A;  3KZZ A;  3RKY A;  2HR3 A;  4F7Z A;  2YU3 A;  3E5X A;  1XGO A;  4MEY F;  4N0B A;  4EQQ A;  4IPA A;  1EH6 A;  1B6A A;  4NB5 A;  2XGX A;  4YII A;  4RAZ A;  2Z9O A;  3KZY A;  3CO7 C;  3EYI A;  1L3L A;  3RPU A;  5ICF A;  4AWX B;  3HOS A;  1FYL A;  5FFZ A;  1RUO A;  2Q0O A;  3DF8 A;  3LA3 A;  2V1U A;  1I1S A;  2IVM A;  1YFH A;  3S2W A;  3I53 A;  2KRF A;  3GZ5 A;  2Q8K A;  3JSP A;  1GVJ A;  2PN6 A;  3FHZ A;  1Z9C A;  3HRT A;  3I71 A;  4HV6 A;  1XSD A;  4RAY A;  2HWV A;  4RB1 A;  1YQA A;  1IN5 A;  1WWX A;  3ZMT A;  3U1D A;  5BPD A;  3Q9S A;  4KMF A;  2ISY A;  1QGP A;  1C0W A;  3V8J A;  1MZB A;  2IP2 A;  1KYZ A;  2HDC A;  1LDD A;  4M9S A;  2UXX A;  2KJC A;  1FYK A;  1MJA A;  2CGP A;  2E1N A;  4N9I A;  4EJW A;  3KP7 A;  3ZMS A;  3SZP A;  4IF4 A;  2NYX A;  2CWE A;  1EV7 A;  5BPI A;  4FX0 A;  2C6Y A;  4LFU A;  3LQR A;  2AXL A;  4ZYD A;  1FBS A;  1U78 A;  2H27 A;  1G4D A;  1TW2 A;  2Z99 A;  3I54 A;  3CDH A;  1XSX A;  2KIU A;  3T5X A;  5D6E A;  3V8L A;  3I0T A;  2XKP A;  5ILU A;  1IW7 F;  1VTN C;  3F6V A;  4BHP A;  4BYY A;  4LJZ F;  1MJ9 A;  1R5G A;  4G7O F;  3RDI A;  3K0L A;  3QRF F;  3M1E A;  5ICC A;  4U0Y A;  1O3S A;  1FZP B;  4EJV A;  4O6J A;  5JR3 A;  3ZMU A;  1U5T C;  2QVO A;  3E97 A;  2NS0 A;  2KKO A;  5L3D A;  1R00 A;  3AAF A;  1KA8 A;  4AIK A;  3GEZ A;  4ETS A;  3PQJ A;  1J7K A;  3HOT A;  4PZJ A;  2EFP A;  3F3X A;  2Y48 A;  4A0X A;  5H20 A;  1OMI A;  2UWM A;  2PBI A;  4L0Z B;  4DQ2 A;  4CZZ A;  3DP7 A;  3TDZ C;  4N9H A;  1HKQ A;  4HLX A;  2W24 A;  4L9T A;  3WTV C;  5DEQ A;  1J5Y A;  5JHU A;  3L00 A;  2STT A;  4G6D A;  2EFN A;  3WTS C;  2FBI A;  1IXS B;  3ECO A;  3CLO A;  1O57 A;  1UHM A;  1XD7 A;  3EUH A;  1JHH A;  1MJB A;  4IXA A;  5LRR A;  3JAM Z;  3T8R A;  1K78 A;  4I0A A;  5DDG A;  2W57 A;  2FEZ A;  4NQW A;  2PG4 A;  3HHH A;  1FP1 D;  2QUF A;  2BV6 A;  1DUX C;  1E2X A;  2NNY A;  3I4P A;  4WXH A;  1YS6 A;  1V4R A;  4M6X A;  2ESH A;  2LF8 A;  3LWF A;  3W6J B;  1F5T A;  2ELH A;  1TNS A;  5L3C A;  4AIH A;  1O7L A;  1CF7 A;  2CW0 F;  2RV8 A;  3FF5 A;  1XMA A;  3BP8 A;  4BH9 A;  1SFX A;  3CUQ A;  4OIP F;  5FLX K;  2GZW A;  4Y15 A;  2V1D A;  1HKT A;  1SFE A;  1HST A;  3N4M A;  2GQQ A;  3ZMD A;  3KCC A;  3HYI A;  1MGT A;  3R4K A;  1IRF A;  2EWN A;  1FSE A;  2HZT A;  2YX7 A;  3LST A;  3OOP A;  4OIN F;  3WGG A;  1DPR A;  1HXD A;  4KT5 C;  2WWY A;  1G6N A;  2L02 A;  3F72 A;  4UVC A;  3RJP A;  1DP7 P;  1W7P D;  3B73 A;  5DD8 A;  5TJJ A;  3C18 A;  4YFN F;  3J80 Z;  2PQ8 A;  3D5L A;  1S8N A;  2DTR A;  2F5F A;  3IHU A;  3BPV A;  6PAX A;  1R22 A;  2VBY A;  4P9U A;  4O3M A;  5DCM A;  1MDM B;  3VFZ A;  3EYY A;  3LA7 A;  3K9T A;  3CUO A;  1YG2 A;  3JSO A;  3E5U A;  5CYV A;  5HS9 A;  3FXU A;  4I7H A;  3SQN A;  2JT1 A;  1YIO A;  2IA2 A;  2DK5 A;  2EFO A;  3TGN A;  5J8F A;  5K5Q A;  4HAM A;  3EDP A;  4ESJ A;  4BHB A;  3E6B A;  2Y0M A;  5J6X A;  3M8E A;  3FM5 A;  3IL2 A;  3I64 A;  1RI7 A;  1ZLK A;  2BEO A;  2H94 A;  1T6S A;  5JI6 A;  3FXR A;  2OAZ A;  5HDG A;  3ABT A;  1KQ9 A;  4M6Y A;  4CHU A;  5D4S A;  4MGR A;  3V4G A;  1R36 A;  2OD5 A;  4HW0 A;  4Z2Y A;  5JFR A;  5D5X B;  1G3Y A;  1BIA A;  1QQI A;  1ON2 A;  2EB7 A;  4UV8 A;  1RNL A;  1HW5 A;  2GWR A;  2PMH A;  1PP7 U;  3C7J A;  1XMK A;  4A12 A;  1YS7 A;  1HW2 A;  2M30 A;  2CQK A;  1BI3 A;  4U0W A;  2VT3 A;  1XCB A;  4FHT A;  2NNN A;  2GIV A;  2HYF A;  4RS8 A;  4OIO F;  4KMU X;  2DAO A;  5F1R A;  2ZME B;  1IN7 A;  2VOO A;  3SHF A;  1XGN A;  1S3J A;  1T39 A;  1K7A A;  3TO7 A;  4YIF A;  3T8T A;  2VE9 A;  2XVC A;  5AIP A;  2A3S A;  1KU3 A;  4B09 A;  4LG0 B;  2VN2 A;  2NAZ A;  2ZCW A;  3ECH A;  3TDU C;  3RIR A;  4EM2 A;  3LFK A;  2GA1 A;  5L3G A;  2R7D A;  2QBY A;  1BI2 A;  3GX4 X;  1UB9 A;  4EVI A;  3K1M A;  4KN7 X;  5LEJ A;  1QZY A;  3ELK A;  4IHS A;  1FPQ A;  4ENM A;  3WOD F;  5BMZ A;  3KP6 A;  4KA4 A;  2K4B A;  3TO6 A;  5LHH A;  3ROU A;  2LDU A;  1WI9 A;  2DO7 A;  4IVN A;  5D6F A;  1D3Y A;  3KEO A;  1TW3 A;  3R0J A;  4MQV A;  4CO8 A;  2JZY A;  1ZAO A;  2VC0 A;  4Q47 A;  3WU1 B;  4YG2 F;  4XSX F;  3RPQ A;  1I27 A;  5LEK A;  4R1H A;  4HA8 A;  2DPD A;  3MQ0 A;  2IPQ X;  3BWG A;  2DI3 A;  1S6L A;  4LK1 F;  5E8I A;  3FM3 A;  3I5U A;  2HKO A;  4ZYG A;  1TBX A;  4HF2 A;  2MBF A;  5A2Q Z;  4GO1 A;  3EQL F;  2ZFW A;  1YYV A;  5HDK A;  4U88 A;  3GLX A;  2MH2 A;  2EFQ A;  3WGI A;  1R58 A;  3H3Z A;  2XAS A;  5IT9 Z;  1W7P B;  1IXR C;  3GO5 A;  4AVP A;  5D8K B;  2M5W A;  5KK1 A;  1EH8 A;  1OKR A;  1XB4 A;  1A04 A;  2HOE A;  5H6Q A;  4L5I A;  3L7W A;  2P4W A;  4Q4Z F;  3TQN A;  4KYW A;  5CVV A;  1X3U A;  5IT3 A;  4IRH A;  1SMY F;  1Z6T A;  2O6G E;  3DFG A;  2VC1 A;  4P9F A;  1QBJ A;  4HQE A;  2K4J A;  3BPX A;  4JQF A;  2ZKZ A;  4LD5 A;  2FE3 A;  3ZMZ A;  3V7C A;  4XLN F;  2FBK A;  3CUQ C;  1FOK A;  5LRS A;  1BOA A;  1UCR A;  5DD4 A;  3I58 A;  3M9A A;  4RGX A;  1AWC A;  3SFZ A;  1JXS A;  1B1B A;  1T98 A;  4S05 A;  5DV5 A;  2RGV A;  4PCQ A;  2DT5 A;  1RUN A;  2LNB A;  3KP4 A;  3DQV C;  1BC8 C;  2JPC A;  5E1W A;  3HTU A;  2OZU A;  1NHA A;  2M45 A;  1JE8 A;  5CVU A;  1HBX G;  4CDG A;  2V79 A;  1KQ0 A;  2FRH A;  5D4R A;  1G3S A;  1TQM A;  2FSW A;  4M9Z A;  3L09 A;  2VON A;  5JVT A;  2EFW A;  2HTS A;  5ILV A;  1V3F A;  4LLL A;  2CG4 A;  3GW2 A;  4FX4 A;  1XGM A;  3QOP A;  4M71 A;  4O5V A;  3TKY A;  1ZAR A;  3ERE D;  4IJA A;  1KYW A;  5AIQ A;  5E20 A;  3K1P A;  4MHG A;  2X4H A;  1FC3 A;  4L9V A;  1ZG5 A;  1WKM A;  2MC3 A;  4ESB A;  1PUE E;  2EV6 A;  4CXF A;  2FNP A;  3WTZ A;  4ENK A;  2XAF A;  5BOX A;  2LF7 A;  1SFU A;  2GXG A;  4G94 A;  3DV8 A;  2P7C B;  1J2X A;  2K02 A;  2YSR A;  1I5Z A;  5EEH A;  3O6B B;  2E1C A;  2LKP A;  2A5Y B;  3PFI A;  4G9Y A;  3O2P E;  2FXA A;  2HEO A;  2HS5 A;  2A68 F;  1ULY A;  1FLI A;  2IW5 A;  3Q9V A;  2XKO A;  3JTG A;  1RIO H;  4I2O A;  1PP8 F;  1S7O A;  3RKW A;  1XDS A;  4YFX F;  4OIQ F;  4H0E A;  1S7A A;  2FBH A;  4M73 A;  5CVR A;  1BN5 A;  1OPC A;  4LK0 F;  1FY7 A;  3COA C;  4LB6 B;  3QAH A;  3K1N A;  1LB2 A;  3QPH A;  4G7H F;  3KP3 A;  1O7F A;  1STZ A;  3BOQ A;  2ZBK A;  1OYW A;  2DQL A;  3KET A;  3HTS B;  1FNN A;  2FA5 A;  2O61 A;  1ZHF A;  5FGM A;  1IRG A;  4GGG A;  3WG9 A;  3K2Z A;  4HX8 A;  3MZH A;  2O3F A;  5E17 F;  4EM1 A;  4EGZ A;  3KEQ A;  5ICG A;  2BGC A;  3F8M A;  1R5H A;  5HDN A;  4EGY A;  5CLS A;  4RGR A;  4MTD A;  1FYM A;  2LSO A;  2DPU A;  1I1G A;  4HX7 A;  3WGH A;  4NHJ A;  2Z33 A;  2RQP A;  1BC7 C;  2QM3 A;  1YW7 A;  4AD9 A;  3HRU A;  3RTR A;  3T0Y A;  1E17 A;  1SAX A;  4A0Y A;  2R7F A;  3KP2 A;  3DPT A;  2H6B A;  3F8C A;  1YW9 A;  4G8X A;  4KNY A;  4WXC A;  2NRA C;  1IN6 A;  1MD0 A;  3IKV A;  3OV8 A;  2O0Y A;  4ESF A;  3MCZ A;  5CVJ A;  2HFH A;  3KFW X;  3WU0 A;  4K2E A;  2XIG A;  1FBQ A;  5FFX A;  1J59 A;  3ULQ B;  1B9N A;  1FSH A;  5HOO A;  3HUG A;  4LB5 A;  3KLN A;  3HIF A;  4MQ9 F;  5ED4 A;  4HQM A;  1K6O A;  2MLK A;  2FU4 A;  4B8X A;  4XBF A;  4QLC U;  4MTE A;  4KDP A;  1T38 A;  2G7H A;  3FMR A;  3QP5 A;  4RGU A;  4EMS A;  4HDV A;  3P9K A;  2PEX A;  2RKH A;  1IAW A;  1REP C;  5CJ9 A;  1G3T A;  1R23 A;  2F5E A;  4M9X A;  1XDU A;  2H09 A;  2CO5 A;  5ERI A;  4Y17 A;  3ZQ7 A;  4IRI A;  1XN7 A;  2DQR A;  1XCV A;  4U7D A;  3E6C C;  4U7B A;  5LHI A;  3IRR A;  4IRG A;  1D8K A;  4WK8 F;  1Z1D A;  1LJ9 A;  2P6T A;  4OMY A;  2IA0 A;  3GVA A;  1QPM A;  5L3B A;  1D5V A;  3E3V A;  3J81 K;  5H6R A;  3HRS A;  5LHG A;  5E8G A;  2WC2 A;  3M7G A;  4AIJ A;  2ZNZ A;  3RKX A;  4A5M A;  2Z5U A;  1YO5 C;  4I0B A;  1H9G A;  2WTE A;  2BE5 F;  5FD5 A;  2W85 A;  2CFX A;  1FBU A;  1SD5 A;  1ZRF A;  2ZME A;  1I6X A;  2D1H A;  2XRO A;  1YLF A;  2IRF G;  1RZ4 A;  2P8T A;  4EJT A;  3H3U A;  5A2Q K;  1O3T A;  4U0V A;  1H0M A;  4LG0 A;  3E5Q A;  2OBP A;  2H6C A;  1U5T B;  5FLX Z;  5FO5 A;  2G7U A;  2STW A;  1P2F A;  2V6C A;  4KIF A;  2VBX A;  3BY6 A;  2MLG A;  1WRJ A;  1ZYR F;  3CTA A;  4HDU A;  2UZK A;  2RVC A;  2Y75 A;  2QQB A;  4P96 A;  3U2R A;  4KIC A;  3IKT A;  1HKS A;  4LGW A;  2F5C A;  2HGC A;  3VOD A;  3G73 A;  3Q5F A;  4UVA A;  5D5U B;  4I98 B;  1J75 A;  4PDK A;  2YX4 A;  2OQG A;  2JRT A;  1U2W A;  3WTT C;  5F6F A;  2IT0 A;  3QP6 A;  1SD6 A;  1EH7 A;  4Y13 A;  3ABU A;  5DUI A;  3RI4 A;  3BJ6 A;  2OA4 A;  3R6S A;  2VOD A;  1SD4 A;  1P4W A;  1IF1 A;  1G3W A;  2D45 A;  3WE3 A;  4KFC A;  5DUK A;  3FX3 A;  2QBY B;  3F22 A;  4RB2 C;  4UHT A;  3J7A O;  4ZH4 F;  2HKX A;  3GFI A;  3I59 B;  4HX4 A;  3GFM A;  2P7V B;  1W7P A;  1LVA A;  1UST A;  1ZG1 A;  2COM A;  4UUV A;  2D2W A;  2KJB A;  3WTY C;  2EJR A;  3DEU A;  1PDN C;  1QZZ A;  1B59 A;  1P92 A;  1UHW A;  1F4K A;  3E6D A;  3F8B A;  1OR7 A;  3BJA A;  2E7X A;  1B4A A;  4HF1 A;  1ZLJ A;  3REO A;  2FNA A;  1BI0 A;  1SMT A;  1H9T A;  3C3W A;  1L0O C;  3HSR A;  1P6R A;  3D0S A;  3LAJ A;  2BBY A;  2R3S A;  2BYV E;  4ASN A;  2QEN A;  4RB0 A;  4LLN A;  2PFB A;  1ZGA A;  5HLH A;  4HYE A;  3MWM A;  1TLH B;  5D5W B;  4RB3 C;  4ZYE A;  4G7Z F;  4R79 A;  3NEU A;  3U9G A;  2OQR A;  1FP2 A;  2QLZ A;  4BNC A;  1J0R A;  4BXU A;  4I09 A;  1KU2 A;  5AON A;  5LGN A;  2W25 A;  1GXQ A;  4ENJ A;  1JGS A;  5KVR A;  3M8F A;  1S29 A;  2RC4 A;  1Z7U A;  1F9N A;  2GA2 A;  1LDJ A;  2QWW A;  3JAM K;  3SZT A;  5FD6 A;  2DK8 A;  5K5O A;  4HOB A;  4P55 A;  1HQC A;  2K27 A;  2A07 F;  2W84 A;  4Q5S F;  1SD7 A;  2UXN A;  3QU3 A;  3ZP5 A;  2FMY A;  2PJP A;  5HS7 A;  4KUM A;  2DW4 A;  2QQA A;  3V7S A;  4JK1 X;  4XRF A;  2L4A A;  4A6D A;  1R1V A;  4YFK F;  2XUB A;  2KIM A;  2J5O A;  5CVI A;  1IXC A;  3E6M A;  5LBQ A;  3BRO A;  4RGS A;  1Q1H A;  2L3D A; 
#chains in the Genus database with same CATH topology
 5F1J A;  1ZN2 A;  5F0C A;  3ZMV A;  5FRM A;  3GUD A;  1KU7 A;  2PMU A;  4E7I A;  4BQA A;  1JI8 A;  3CCV I;  5BS6 A;  2HVR A;  3ESW B;  2AQE A;  1YW8 A;  1R4N B;  4C2U A;  3S8P A;  2JVG A;  3DKY A;  5FRO A;  2VB6 A;  4BBR J;  4UV9 A;  2ACJ A;  2PLY A;  1W5S A;  2EIJ H;  1RPW A;  2D1V A;  1U3E M;  2RAE A;  3WTW C;  3WTX C;  4X0G A;  2LKS A;  1KU9 A;  4HST A;  4L9J A;  2KT0 A;  1ZH5 A;  5GAH J;  4LIU A;  5DTD A;  1XMX A;  4XN3 A;  2RQQ A;  2K9L A;  2P6S A;  1UFM A;  3VPR A;  5E18 F;  4PGH A;  1R7J A;  2QSF X;  1KON A;  5L3E A;  3F8N A;  3L2U A;  4M74 A;  2JSC A;  3NQO A;  3LAP A;  3BR0 A;  4I02 A;  5E1X A;  2EK5 A;  1RRJ A;  3MAJ A;  3IUO A;  5C4J J;  1X4O A;  4S04 A;  5BQT A;  4IHT A;  3HBL A;  3B02 A;  1XSV A;  5HVQ C;  2VAS A;  1ZGJ A;  2DDB A;  2CQQ A;  5EJC A;  1BOB A;  4R8H A;  2QYO A;  4CUG A;  2B0L A;  3CF5 F;  1HSJ A;  3HSE A;  2O03 A;  3C2G A;  3TP0 A;  2GM4 A;  4XIC A;  3O8G A;  2BY3 A;  2ZME C;  4JP0 A;  3GCM A;  2RNJ A;  5TRD A;  3KP5 A;  4A5N A;  1LFB A;  2W4S A;  4L18 B;  1X1C A;  1BI1 A;  1FT9 A;  5J3L A;  4G6Q A;  3J80 K;  2CSO A;  2L54 A;  1JJ8 C;  1ENH A;  2V26 A;  2GOX B;  2LRE A;  1VQ4 I;  4OIR F;  3K4J A;  3KE2 A;  2E7W A;  4B3X A;  2KHM A;  3DEW A;  1P4X A;  2CFO A;  1F36 A;  3GYH X;  3VDX A;  2L9S A;  1IV8 A;  1BW6 A;  3H9Q A;  2DMN A;  2V9V A;  5FJ8 J;  2X1D A;  2VXZ A;  2ZB9 A;  1F1Z A;  3CCQ I;  3HOV J;  1DU6 A;  1QHG A;  2V4J C;  4XLP F;  5KNL A;  1VFC A;  1MMD A;  2DT6 A;  1O4X A;  4BXX J;  3HHG A;  3P5J A;  4QSH A;  4RAG A;  2A6E F;  4OMZ A;  1JKP C;  4CYC B;  1T0F A;  1W5T A;  1IN4 A;  4FE7 A;  2DFE A;  1OCP A;  1P7I A;  5EEG A;  2E36 A;  3TOB A;  2DMU A;  4XLC A;  3SEZ A;  4E7S A;  3O3K A;  3CO6 C;  2KIF A;  4HZF A;  3VYS B;  4E7Z A;  1WH5 A;  1Y1W J;  1FIP A;  2HI3 A;  2O8X A;  3P9I A;  5FLV A;  3FXL A;  3LSK A;  4UVB A;  1K4S A;  1CQT A;  2X51 A;  2TDX A;  3F8F A;  3QU6 A;  4RA2 A;  3ZN0 A;  1YE9 A;  2X1C A;  4KIG A;  4C2T A;  3DXJ F;  3RQ4 A;  3CC2 I;  3DBR B;  3HSF A;  3L2C A;  3ZN1 A;  2OCE A;  4TV7 A;  4ANJ A;  4E7K A;  2FQ3 A;  2G9W A;  5FLM J;  3S15 J;  5ICE A;  5IP7 J;  1YJN I;  1O3R A;  1GVD A;  1OCO H;  3E1S A;  4HV5 A;  3RYR A;  4GCV A;  1Y0U A;  5KAF C;  3G71 I;  1WSU A;  1G59 A;  1G8X A;  2KRC A;  3OR1 C;  2CUZ A;  3SYT A;  1FJL A;  2BVL A;  2HQN A;  2HQR A;  3V42 A;  4C3H J;  5LGT A;  4D5C A;  1NH3 A;  3RYP A;  3ZGK A;  4A2U A;  1A6Q A;  4XQF A;  3RKQ A;  4GXO A;  1LNW A;  3GME A;  3A02 A;  2FOK A;  4M72 A;  4CZC A;  1K78 B;  1RET A;  4KN4 X;  5LLQ A;  2EA2 A;  2E34 A;  2MA3 A;  1X1A A;  4NQW B;  2EV5 A;  5D5V B;  1VI0 A;  3NRV A;  4DNC A;  2ZO4 A;  2P5L C;  3E0J B;  3FZV A;  2ESN A;  4MEX F;  3HOX J;  3V8K A;  3OIP A;  1B8I B;  2GXB A;  3VEP A;  4D0P A;  3HRM A;  4DIQ A;  4II3 A;  4MNU A;  4FT8 A;  1IUY A;  2K7L A;  4WCG A;  3OMY A;  3PQK A;  2XV4 S;  2QQ9 A;  3JW4 A;  3PNY A;  4N4N B;  4IL6 C;  1Z0X A;  2BY0 A;  3BJO A;  4UNO A;  2ECB A;  2L01 A;  1OJL A;  2ZJR F;  4KIB A;  3ZQI A;  4FE4 A;  3L9F A;  2JTV A;  2R5Y B;  3OYD A;  3K4K A;  1WJA A;  3VYU B;  2VIX A;  2XRL A;  2IEK A;  2K3P A;  3DKW A;  3BCA A;  3R60 A;  4CH7 A;  1MDM A;  2LY9 A;  4V19 K;  2ZXH A;  1CF7 B;  3ISP A;  4J01 A;  2VT2 A;  1D1B A;  2WV0 A;  5GTI C;  1QO0 D;  1Z05 A;  2YPR A;  4ZZL A;  4OU0 A;  4L0Y B;  4RAF A;  1LE8 A;  1HW1 A;  3CUQ B;  1Z6R A;  3HKZ N;  4XRS A;  4WF2 A;  4EJU A;  4QPO A;  1LFU P;  1W4M A;  3IC7 A;  3WE2 A;  3GFL A;  1USS A;  3F21 A;  3OYE A;  2OC6 A;  4HLY A;  2YS9 A;  1OR7 C;  3MEX A;  4HF0 A;  3BQZ A;  4JBA A;  3MFK A;  3A01 B;  3K2A A;  2M1B A;  2CUE A;  3ML6 A;  3K4M A;  1LEA A;  3F23 A;  1A6I A;  1MMS A;  4HBL A;  4M3G A;  4ON0 A;  5HS8 A;  1JUM A;  3BZ6 A;  3GLL A;  1VQ5 I;  2CQN A;  4CGZ A;  2PMZ N;  2CYY A;  3F6O A;  2LY1 A;  4KIT B;  5FB2 A;  3BG5 A;  5DS9 A;  3PFY A;  2XAQ A;  5DCF A;  2XAU A;  1SVO A;  3IWZ A;  3FMS A;  4FET A;  4BHC A;  4UXN A;  3PSF A;  4XSZ F;  3SXY A;  2V9P A;  2HYG D;  2ZFU A;  2OZ6 A;  2FF4 A;  5J8C A;  2GAU A;  4F52 A;  3K69 A;  1Z91 A;  5J47 A;  3TO9 A;  3FMQ A;  1APL C;  3QPL A;  2YUS A;  1IJW C;  4I01 A;  4EEF G;  3FXQ A;  2NOJ B;  4IO9 F;  1UG2 A;  4LOC A;  4EJO A;  2VQH A;  3K4N A;  3JTH A;  5K1Y A;  2BZT A;  2WAE A;  1DPU A;  5E1Z B;  3VB2 A;  1W0T A;  4IQJ A;  2AO9 A;  3DPL C;  2EV0 A;  1JT0 A;  1IDY A;  5DCM B;  4LMY A;  4DOZ A;  2P5V A;  1LQ1 A;  1ON1 A;  2L7F P;  1IN8 A;  3QWL A;  1ZG3 A;  4ZYH A;  2QKL B;  1FEX A;  3ZQG A;  1JUS A;  1ZKG A;  3MZ8 A;  3PNT A;  2F5D A;  2KIS A;  4ZTJ A;  1HCR A;  3HEF A;  5HLI A;  1U5T A;  4A93 J;  1YOV B;  2CUF A;  2ADU A;  4ABZ A;  4E70 A;  3HPG A;  3VYT B;  1D8J A;  3EET A;  2XAG A;  2L4M A;  1X3W B;  2B7E A;  1NG7 A;  2ZSI B;  1T2K A;  2R92 J;  1Z67 A;  1BBY A;  2DA7 A;  3ASN H;  2ICW G;  3H92 A;  1O3Q A;  1N75 A;  4DGW B;  3TOA A;  2EA4 A;  2OF7 A;  5E3N A;  1X2M A;  1OYY A;  3V7R A;  1WQ2 A;  4GYI A;  1ETO A;  1ZRD A;  1TQI A;  3GXO A;  3TL4 X;  3MZY A;  2DLL A;  5K5R A;  4UUS A;  3R61 A;  1KGS A;  1OYI A;  2J5P A;  1LDK B;  2P5K A;  4QWQ A;  3CJN A;  3G6E I;  4A0Z A;  3J7Y J;  3NAU A;  1HA8 A;  1YTY A;  3GZ6 A;  2CJJ A;  2ISZ A;  3LFU A;  1KQ8 A;  2M7B A;  4QIW N;  1BIB A;  3IP4 B;  1YX5 A;  1YIT I;  3C1D A;  2YR2 A;  2XRN A;  4WXD A;  2X6X A;  5IT9 K;  4A3L J;  3DBH B;  1MNE A;  3KLO A;  3QPT A;  1R1T A;  3LA2 A;  4GYG A;  4L5J A;  1QA6 A;  3FWE A;  3DU6 A;  3GFJ A;  1JKR C;  2MH9 A;  1CGP A;  1ZRE A;  3SDG A;  3G3Z A;  2K40 A;  3OR2 C;  4BEH A;  2NVQ J;  5IPA A;  1TNT A;  5DYM A;  2EIN H;  1QRY A;  1FWZ A;  1XGS A;  3N97 A;  2JPB A;  1NK2 P;  3W6K B;  3BDD A;  2IS2 A;  2FUG 2;  5M5Y J;  2PX9 A;  3LQQ A;  1I3A A;  1MKM A;  2R93 J;  3R0A A;  3ZPL A;  3T1B A;  2CQX A;  2QZ8 A;  5TIS C;  1DGW Y;  4BY1 J;  2BVM A;  4G12 A;  2XAJ A;  2QSG X;  1XX5 A;  2IGM A;  2R7R A;  5ILS A;  2NXN B;  2ZNY A;  4BS9 A;  1AKH B;  2V1X A;  2MAB A;  4P5O A;  5CQG A;  1U9N A;  2VOP A;  1V54 H;  3WTU C;  2RN7 A;  3S3N A;  2A61 A;  5D8L B;  4Q48 A;  1ONV A;  1D0Z A;  4RM2 A;  1D5Y A;  4WWC A;  4EV0 A;  1VQ9 I;  1GXP A;  3IV5 A;  1ZRC A;  4RBO A;  1K79 A;  1FX7 A;  1IG7 A;  4A3E J;  3PUF A;  3JRC A;  3HGY A;  3IRQ A;  1FMV A;  2O7O A;  3MKL A;  3BLY A;  5B66 C;  2VBW A;  2K86 A;  2HTJ A;  1G2H A;  3RZD J;  4CYD A;  1TZL A;  2BXY A;  2ZJ2 A;  3ABL H;  4PJN A;  2JN6 A;  3LSJ A;  3H5A A;  1BM9 A;  2ETH A;  2RDP A;  3FK7 A;  4ZDO A;  3I59 A;  2DOA A;  2VE8 A;  3OYL A;  1MND A;  2X85 A;  3CJR B;  1NG6 A;  1IZ1 A;  5J4Y A;  2IA1 A;  4XON A;  2DA1 A;  4AUX A;  4OOI A;  3CCM I;  2K9S A;  1TQP A;  1T8I A;  2HDD A;  3DU5 A;  2LMD A;  5F0H A;  1LEB A;  2M87 A;  4CSW A;  5FKO A;  1FTZ A;  4CIC A;  1ODD A;  1SEU A;  1DDN A;  2LFB A;  4MFD A;  1U8R A;  4BQN A;  2L5Q A;  2XHK A;  2JQ7 A;  5HLG A;  4ZZD A;  3GF2 A;  2PI0 A;  3HDD A;  2MD5 A;  2Q2E A;  4BAY A;  1J9I A;  4NC6 A;  1R1U A;  2NS8 A;  4A6E A;  5IYC J;  1U0J A;  1BJA A;  4B47 A;  2OU2 A;  2LTP A;  4LLG F;  3B6A A;  1K4T A;  3J81 Z;  2A6T A;  3G1L A;  3P9C A;  4NC8 A;  2DBB A;  3IWF A;  3FK6 A;  5IOZ A;  1TTY A;  4XLH A;  1QNT A;  2Y9Z A;  2DU9 A;  4IX7 A;  4ENN A;  2M8E A;  3GWZ A;  1U6G A;  1GHC A;  3OYJ A;  2H1L A;  2X0L A;  2AS5 F;  1JHF A;  2A69 F;  2IS6 A;  2Z3Y A;  1TWF J;  3AG1 H;  2ID3 A;  4PSW A;  5L3F A;  2ZXJ A;  2FML A;  5LGU A;  2Y9Y A;  1V5E A;  2VBZ A;  1T0F C;  3P7N A;  4EM0 B;  1GV2 A;  3CLQ A;  2E71 A;  1PJR A;  4L9N A;  2DFI A;  2NVY J;  2XPU A;  4WX9 A;  2F2E A;  2V6E A;  4PGG A;  5GAG J;  2XAH A;  1B9M A;  1VQK I;  1AOY A;  5F64 A;  3VOE A;  2IBD A;  2A6H F;  2IJL A;  3EUH C;  2R7S A;  2HU9 A;  3W2A A;  3MN2 A;  1P4A A;  3KZZ A;  4FTH A;  3RKY A;  2HR3 A;  1D1A A;  5JVG F;  4F7Z A;  2YU3 A;  5FKL A;  3E5X A;  1XGO A;  2MD0 A;  4MEY F;  4N0B A;  3ZCO A;  4EQQ A;  4IPA A;  1EH6 A;  3FXO A;  1B6A A;  3OS1 A;  4NB5 A;  2XGX A;  4YII A;  4RAZ A;  2DN0 A;  2L7K A;  2Z9O A;  4GDF A;  1HDP A;  3KZY A;  3CO7 C;  3EYI A;  2LC2 A;  2GBY A;  3ERM A;  1L3L A;  4AYB N;  3D5R C;  4IHY A;  1QZE A;  3RPU A;  5ICF A;  4AC0 A;  4AWX B;  3HOS A;  1FYL A;  3OL4 A;  5FFZ A;  4PJJ A;  1MBH A;  1RUO A;  3I4N J;  5F04 A;  2Q0O A;  1ZEL A;  3DF8 A;  3LA3 A;  2V1U A;  2IVM A;  1I1S A;  2XPV A;  4YIR X;  1YFH A;  3S2W A;  3PSI A;  3SFI A;  3H0G J;  3I53 A;  3OSG A;  3OL3 A;  2KRF A;  3GZ5 A;  2I10 A;  2Q8K A;  3SZG A;  3JSP A;  1GVJ A;  2PN6 A;  3FHZ A;  1Z9C A;  2LVS A;  3C2B A;  3HRT A;  2WY7 Q;  3HG9 A;  3I71 A;  4HV6 A;  4BQQ A;  5CPR B;  1XSD A;  2F4M B;  4RAY A;  2HWV A;  4RB1 A;  3CC4 I;  1YQA A;  1IN5 A;  2Y69 H;  1DQU A;  1WWX A;  2W48 A;  3U1D A;  3ZMT A;  5BPD A;  3Q9S A;  1SAN A;  3LMM A;  4KMF A;  2ISY A;  4HEA 2;  2EZI A;  2VKE A;  1QGP A;  1R6R A;  1C0W A;  4QTR A;  3K70 C;  3V8J A;  2DFF A;  1MZB A;  2IP2 A;  1KYZ A;  2HDC A;  3AL0 B;  1MH3 A;  1QPI A;  2VL8 A;  1MBE A;  2TCT A;  1LDD A;  4M9S A;  2UXX A;  2KJC A;  1FYK A;  1MJA A;  3CF2 A;  2YU9 J;  2CGP A;  3CD6 I;  4IEJ A;  2E1N A;  1SC7 A;  3H3V K;  3PL8 A;  2NS7 A;  4N9I A;  4EJW A;  3WG7 H;  3KP7 A;  2Y30 A;  4A3I J;  4A3B J;  3ZMS A;  5HNF A;  3S1Q J;  3DCF A;  1PYV A;  3N05 A;  2Q1Z B;  4E6K G;  3SZP A;  4IF4 A;  3OYH A;  3J7A Y;  4J19 A;  2NYX A;  1AA7 A;  2CWE A;  1EV7 A;  5BPI A;  4FX0 A;  2C6Y A;  2RRE A;  3SEQ A;  1ERD A;  3UR3 C;  1X1P A;  1MBF A;  4LFU A;  3VYR B;  3LQR A;  2FOW A;  3S1M J;  2AXL A;  4DBR A;  4ZYD A;  3A0B C;  1FBS A;  1U78 A;  2MG4 A;  5EG0 A;  2H27 A;  1ETW A;  2I8D A;  1G4D A;  3SDB A;  1TW2 A;  1TL8 A;  2QF7 A;  2Z99 A;  3AKZ A;  3I54 A;  3CDH A;  1S7E A;  1XSX A;  2KIU A;  3JRD A;  3T5X A;  2IXS A;  5D6E A;  3V8L A;  1GUU A;  1LPQ A;  1XS9 A;  3I0T A;  2XKP A;  5ILU A;  4A3C J;  2E1M C;  1IW7 F;  1VTN C;  3F6V A;  4BHP A;  4BYY A;  3OY9 A;  4LJZ F;  1MJ9 A;  4BGD A;  1R5G A;  4G7O F;  2R4G A;  3RDI A;  1MSF C;  4GFB A;  3K0L A;  3C2H A;  4I76 A;  3QRF F;  2KRH A;  3H0D A;  3LL7 A;  3M1E A;  2ZXW H;  4D9J A;  5ICC A;  4U0Y A;  1O3S A;  1FZP B;  4A3K J;  3U21 A;  4EJV A;  4O6J A;  5JR3 A;  3ZQQ A;  3ZMU A;  3GTQ J;  2O8K A;  1U5T C;  2QVO A;  3BTJ A;  2NS0 A;  2KKO A;  3E97 A;  5L3D A;  2BOL A;  1IDZ A;  1MIJ A;  2ZC2 A;  1R00 A;  1X2N A;  3AAF A;  3TED A;  3BQY A;  1KA8 A;  4AIK A;  1R5I D;  3BG9 A;  4CYC A;  2IAI A;  1RKW A;  3GEZ A;  4RLF A;  3WHB A;  2TRT A;  4ETS A;  3PQJ A;  1J7K A;  3HOT A;  4PZJ A;  3Q0W A;  5DM6 F;  2EFP A;  5GPC A;  3F3X A;  1WH7 A;  2Y48 A;  4A0X A;  2Y0S A;  4XMY A;  1OMI A;  2L7Z A;  5H20 A;  2UWM A;  1MMG A;  2PBI A;  4L0Z B;  4F93 B;  4LIT A;  4DQ2 A;  3TW7 A;  1TP4 A;  2CU7 A;  4CZZ A;  3DP7 A;  3TDZ C;  2DXI A;  4X6A J;  4N9H A;  4XKB A;  1HKQ A;  2E5Z A;  4HLX A;  2W24 A;  4L9T A;  2EBI A;  2IGO A;  3WTV C;  1MNM C;  2KLO A;  5DEQ A;  3S14 J;  4JX4 A;  1UEL B;  1J5Y A;  5JHU A;  3OYC A;  2WAQ A;  2FD5 A;  3L00 A;  2STT A;  4G6D A;  2EFN A;  3HL2 A;  4XRS G;  1YRN B;  3WTS C;  3S3M A;  3HOW J;  1T56 A;  1UZC A;  2HVQ A;  4YEL A;  3LSI A;  2FBI A;  1IXS B;  2R7X A;  3ECO A;  3CLO A;  3KYD B;  3I56 I;  1K83 J;  1O57 A;  4YRV A;  1UHM A;  1XD7 A;  3EUH A;  1JHH A;  1MJB A;  4IXA A;  5LRR A;  3JAM Z;  3T8R A;  1H88 C;  1MH4 A;  4OAY A;  2K85 A;  3M8J A;  1K78 A;  4I0A A;  5DDG A;  1AHD P;  1ZK8 A;  2W57 A;  3NAR A;  2BHY A;  2FEZ A;  1WI3 A;  1WPK A;  2Y31 A;  3JCU C;  2PG4 A;  4NQW A;  1VQ7 I;  3HHH A;  3U1K A;  1Z7L A;  4UUT A;  1FP1 D;  2BHZ A;  1X1B A;  2QUF A;  2BV6 A;  4OWR B;  1DUX C;  1E2X A;  2NNY A;  2BY2 A;  3I4P A;  4WXH A;  1B8I A;  1YS6 A;  1P7J A;  1V4R A;  1DU0 A;  4B4C A;  4M6X A;  4ZDL A;  2ESH A;  3VSK A;  1EJ9 A;  2E2J J;  2HQ5 A;  2LF8 A;  3LWF A;  1OCC H;  3W6J B;  2XDV A;  3TP3 A;  1D0Y A;  2W7N A;  2JK3 A;  1F5T A;  3CP8 A;  2ELH A;  3ZXS A;  4NDL A;  3QPS A;  3VWB A;  1WHU A;  1TNS A;  1MBJ A;  2CMP A;  5L3C A;  4HSR A;  2R5Y A;  5J4V A;  2EZH A;  4AIH A;  1O7L A;  2NOG A;  4ITV A;  5IP6 A;  1CF7 A;  2CW0 F;  2RV8 A;  5J40 A;  3HC7 A;  4HPQ A;  3FF5 A;  1XMA A;  2JVH A;  3BP8 A;  5J1Y A;  4CCL A;  3CZ6 A;  2WV1 A;  4BH9 A;  1SFX A;  3CUQ A;  2L9N A;  4OIP F;  2D5V A;  5H2F C;  5FLX K;  2GZW A;  4Y15 A;  2V1D A;  2JUG A;  1HKT A;  3BR6 A;  1JGG A;  1SFE A;  1IUF A;  3DKX A;  1HST A;  3N4M A;  2GQQ A;  2DDA A;  3ZMD A;  3KCC A;  1T08 B;  1TWC J;  3A01 A;  3HYI A;  1MGT A;  3R4K A;  3JRH A;  4IQ4 A;  1IRF A;  2EWN A;  2F4O B;  1FSE A;  2HZT A;  2YX7 A;  3BR5 A;  3LST A;  1EA3 A;  5EEA A;  5C4X J;  2XGD A;  3G1O A;  3OOP A;  2CS3 A;  3MKY B;  4OIN F;  3WGG A;  1Q1V A;  1DPR A;  1HXD A;  4KT5 C;  4GRI A;  3ZQL A;  4BQO A;  2WWY A;  3G1M A;  1G6N A;  3OS2 A;  2L02 A;  3H5R A;  3F72 A;  4UVC A;  3RJP A;  1DP7 P;  1W7P D;  2HPM A;  3B73 A;  4PFO A;  5DD8 A;  5TJJ A;  3QYB A;  3C18 A;  2VKD A;  4D7M A;  3DTE A;  4YFN F;  3J80 Z;  4V2G A;  2PQ8 A;  3D5L A;  1S8N A;  2DTR A;  2QSH X;  2F5F A;  1PUF A;  2OJE D;  3IHU A;  2CW8 A;  1VQM I;  3BPV A;  6PAX A;  2R7V A;  1R22 A;  2VBY A;  4P9U A;  4O3M A;  3RZO J;  2DA6 A;  5DCM A;  1MDM B;  2ID6 A;  3EYY A;  3VFZ A;  3HUG B;  3JRG A;  3LA7 A;  1A36 A;  3K9T A;  1BL0 A;  3CUO A;  1YG2 A;  3JRE A;  3BG7 A;  3JSO A;  3E5U A;  5CYV A;  5HS9 A;  1ZR2 A;  3FXU A;  5M5W J;  1LE8 B;  4I7H A;  2KQR A;  2HYJ A;  2JT1 A;  2QKM B;  3SQN A;  1YIO A;  2IA2 A;  2DK5 A;  5GP9 A;  2EFO A;  3TGN A;  5J8F A;  1HF0 A;  5K5Q A;  4HAM A;  2ECC A;  3EDP A;  3QOE A;  4ESJ A;  2F5V A;  3CP2 A;  3PIO F;  4BHB A;  3E6B A;  3BC8 A;  2Y0M A;  2JA6 J;  5J6X A;  3M8E A;  2VJI A;  3FM5 A;  1YHQ I;  3IL2 A;  1X3Z B;  4D1Q A;  3I64 A;  1RI7 A;  5FKN A;  3MKZ A;  1ZLK A;  3LOC A;  2XB0 X;  4D7N A;  3CCS I;  2BEO A;  2H94 A;  2MFZ A;  4KT6 A;  1T6S A;  3ZR8 X;  4JOM A;  5JI6 A;  3OIQ A;  3FXR A;  1N78 A;  2OAZ A;  3DTI A;  5HDG A;  3ABT A;  1KQ9 A;  1RR7 A;  2WBM A;  3CDI A;  1LFP A;  2Y2Z A;  3NWS A;  2WAF A;  2L0K A;  3OOU A;  4M6Y A;  4CHU A;  5D4S A;  2M7A A;  4XOT A;  1WJE A;  3CME I;  3PO3 J;  4MGR A;  3V4G A;  1R36 A;  4MIM A;  1N25 A;  2OD5 A;  4B44 A;  5LD2 C;  4HW0 A;  1Y8R B;  4F92 B;  4Z2Y A;  2VQC A;  5GAD J;  2P81 A;  4QPQ A;  2JRM A;  1J09 A;  5JFR A;  2DMQ A;  5D5X B;  1G3Y A;  1BIA A;  1QQI A;  4W97 A;  1ON2 A;  2EB7 A;  5TGT A;  4UV8 A;  3A2K A;  1AU7 A;  2G0E A;  2DCE A;  4LG3 A;  2IGN A;  1RNL A;  1HW5 A;  2GWR A;  2PMH A;  1PP7 U;  1N77 A;  1BA5 A;  3C7J A;  1XMK A;  1JT6 A;  2LH9 A;  4A12 A;  1YS7 A;  1HW2 A;  3OYG A;  2M30 A;  1VQ8 I;  2CQK A;  3JRB A;  1BI3 A;  2WB1 A;  4U0W A;  2A05 A;  2KDO A;  2VT3 A;  1AKH A;  1XCB A;  4FHT A;  1YJW I;  1F43 A;  4DZP A;  3BR3 A;  5EF6 A;  2NNN A;  3EUK L;  2GIV A;  1MW7 A;  1WCM J;  2E5N A;  3HGG A;  2HYF A;  2GXA A;  4RS8 A;  4OIO F;  4KMU X;  2DAO A;  5F1R A;  2ZME B;  3CDL A;  3MVP A;  2E19 A;  1IN7 A;  2VOO A;  3SHF A;  1XGN A;  1S3J A;  2BW3 B;  1T39 A;  5B1A H;  1K7A A;  3AG4 H;  3TO7 A;  4YIF A;  5EGO A;  3T8T A;  4F55 A;  2VE9 A;  1OFC X;  2XVC A;  2OUM A;  4RLQ A;  5AIP A;  2AQF A;  2A3S A;  1XG1 A;  1KU3 A;  4B09 A;  4LG0 B;  2VN2 A;  2ME0 A;  3DEE A;  5F08 A;  3J7Z I;  2NAZ A;  2ZCW A;  3ECH A;  3TDU C;  2FX0 A;  1Z77 A;  3RIR A;  4EM2 A;  3W6V A;  3LFK A;  2GA1 A;  2VXD A;  4P1W A;  3PNV A;  5L3G A;  4BAC A;  2H8W A;  2R7D A;  2QBY A;  1BI2 A;  1ETQ A;  2MYS A;  1UB9 A;  4EVI A;  3GX4 X;  1FIA A;  3K1M A;  1X1D A;  4KN7 X;  5LEJ A;  2JUC A;  2M4G A;  1QZY A;  3ELK A;  4IHS A;  4XKV A;  3QQA A;  1BR2 A;  2WAD A;  4XR6 A;  3S1R J;  3EUA A;  1FPQ A;  2KZV A;  1E0E A;  3H5N A;  4ENM A;  3WOD F;  5BMZ A;  3KP6 A;  4KA4 A;  1TWG J;  2K4B A;  2XGE A;  3HOZ J;  3KIO A;  3TO6 A;  2LBF B;  3CJQ B;  3LSP A;  2LKX A;  3RCO A;  4HNU A;  5LHH A;  2CUJ A;  3ROU A;  3BTL A;  2DJI A;  2LDU A;  1WI9 A;  4UY8 I;  4AM3 A;  2LOO A;  3L2R A;  2DO7 A;  2HOT A;  4IVN A;  2DYR H;  5D6F A;  1D3Y A;  1JKO C;  3KEO A;  5E3M A;  1TW3 A;  4BUP A;  2BXZ A;  2XF7 A;  3R0J A;  1RKT A;  4MQV A;  1Z3Y A;  4CO8 A;  2JZY A;  5B5E C;  3MMY B;  1ZAO A;  2VC0 A;  4Q47 A;  4BE2 A;  1QHH D;  3WU1 B;  3A4C A;  5KAI C;  4YG2 F;  1X58 A;  4XSX F;  3OYA A;  3RPQ A;  2HXO A;  4BBS J;  3MKW B;  3KYC B;  1I27 A;  3OYK A;  5LEK A;  1E3P A;  3GTO J;  4R1H A;  2KFD A;  4HA8 A;  2DPD A;  3CCY A;  4BY7 J;  3MQ0 A;  2IPQ X;  2VQL A;  3BWG A;  3Q0U A;  2DI3 A;  1VQ6 I;  3GTK J;  1S6L A;  4LK1 F;  5E8I A;  4BE0 A;  3FM3 A;  3DTK A;  2EH3 A;  3K4B A;  4BU2 A;  3I5U A;  2HKO A;  4ZYG A;  1TBX A;  4HF2 A;  1MBK A;  3D5S C;  2MBF A;  5A2Q Z;  4GO1 A;  4C3J J;  3EQL F;  3S2H J;  2CQ7 A;  2QGU A;  5IP9 J;  2Q2E B;  1YYV A;  2ZFW A;  1M1E B;  5HDK A;  1BR1 A;  4U88 A;  3WU2 C;  3I3L A;  3GLX A;  2R5Z A;  3S17 J;  2MH2 A;  1MSE C;  2EFQ A;  1WJC A;  3WGI A;  2DJN A;  3OSF A;  2NVX J;  1Y39 A;  1PVE A;  1R58 A;  3H3Z A;  1ETY A;  2XAS A;  5IT9 Z;  1W7P B;  4IKF A;  1IXR C;  2EIK H;  3GO5 A;  2X6O A;  4AVP A;  2L7M P;  5D8K B;  4IHW A;  2X48 A;  2M5W A;  5KK1 A;  4XRM A;  1EH8 A;  1OKR A;  1XB4 A;  1A04 A;  2HOE A;  3BR1 A;  5CKT A;  5BNG A;  2V1N A;  5H6Q A;  2BY1 A;  4L5I A;  3L7W A;  2P4W A;  4Q4Z F;  1Z21 A;  1OCT C;  3LNQ A;  3DLA A;  5HNH A;  1LVK A;  2VKH A;  3TQN A;  4KYW A;  1NK3 P;  5CVV A;  1JTX A;  1IV6 A;  2PJR A;  1YI2 I;  1X3U A;  1ZR4 A;  5IT3 A;  4IRH A;  5F0F A;  1SMY F;  1Z6T A;  2O6G E;  4BJ6 C;  3DFG A;  2VC1 A;  4P9F A;  4PJM A;  1QBJ A;  9ANT A;  2DT7 B;  2M0M A;  1W36 C;  2HPI A;  3MD2 A;  4HQE A;  2K4J A;  3W2V A;  3CES A;  3BPX A;  4JQF A;  1H89 C;  2ZKZ A;  4LD5 A;  2FE3 A;  3ZMZ A;  3I4M J;  3V7C A;  2HQA A;  4XLN F;  2FBK A;  3H1C A;  3UNG C;  3G4S I;  3CUQ C;  1Y0N A;  5LRS A;  1UMQ A;  1FOK A;  1U9O A;  1BOA A;  1IGN A;  5M3F J;  1UCR A;  2P0W A;  5DD4 A;  3I58 A;  3M9A A;  4M3E A;  4RGX A;  3W3C A;  5FRN A;  5FKK A;  1AWC A;  3GTP J;  2DA2 A;  3DPU A;  4E7H A;  4W1U A;  3SFZ A;  1JXS A;  1B1B A;  3OYN A;  1T98 A;  4S05 A;  4A3D J;  3I9V 2;  2JSP A;  4HG2 A;  5DV5 A;  1LUJ B;  1U8B A;  2RGV A;  2XPW A;  1SVM A;  4PCQ A;  1JUP A;  2DT5 A;  1RUN A;  4UB8 C;  2VPL A;  4JYK A;  3PJR A;  2QCO A;  1RR8 C;  3HJE A;  2LNB A;  3KP4 A;  3DQV C;  1POG A;  1BC8 C;  2JPC A;  5E1W A;  3HTU A;  3H36 A;  5GAE J;  2OZU A;  1BW5 A;  3IH2 A;  3K70 D;  2RNG A;  1NHA A;  2M45 A;  1JE8 A;  3Q0V A;  1I39 A;  2JA2 A;  5CVU A;  2B9S A;  3K6G A;  1HBX G;  4CDG A;  3ABM H;  2IGK A;  2V79 A;  1HLV A;  1KQ0 A;  1W5C C;  2FRH A;  3IAS 2;  5K7Z A;  1FOX A;  5D4R A;  1G3S A;  1OQY A;  1TQM A;  3GTJ J;  2FSW A;  4M9Z A;  3L09 A;  3K4L A;  2VON A;  5JVT A;  2EFW A;  2X6Y A;  2HTS A;  1RES A;  2JJ7 A;  5ILV A;  1V3F A;  4LLL A;  2CG4 A;  3KZI C;  1B72 B;  4V2F A;  3TMO A;  4XKW A;  3OYF A;  2DA3 A;  3GW2 A;  4FX4 A;  1XGM A;  3QOP A;  4M71 A;  4F3Q A;  3FDY A;  4Z6Y A;  3H9G A;  4O5V A;  4PJL A;  3GTL J;  3TKY A;  1ZAR A;  2CRG A;  3I55 I;  3ERE D;  3S93 A;  1GLN A;  4IJA A;  1W1W E;  2WY8 Q;  1KYW A;  5AIQ A;  5E20 A;  1T95 A;  3K1P A;  4MHG A;  1IO2 A;  1TC3 C;  2H1K A;  5E3O A;  2X4H A;  1FC3 A;  4L9V A;  3S3O A;  1ZG5 A;  2R7Z J;  2ELK A;  3K7A J;  3FBN B;  1WKM A;  2MC3 A;  4ESB A;  3HOY J;  3RSN A;  1PUE E;  2EV6 A;  4CXF A;  1ETK A;  3Q3S A;  2WB1 N;  3S32 A;  2FNP A;  2M4K A;  3WTZ A;  4ENK A;  2XAF A;  1BR4 A;  5BOX A;  2HXI A;  1V5F A;  2LF7 A;  1WJF A;  2L9V A;  1SFU A;  4IOA F;  2K9Q A;  2GXG A;  3CMY A;  4G94 A;  3DV8 A;  1D0X A;  2LRD A;  3S16 J;  3CCL I;  3F9K A;  1J2X A;  2K02 A;  3A0H C;  2P7C B;  5JHF A;  2YSR A;  1I5Z A;  5IY5 H;  2O5R A;  5EG0 B;  3BZC A;  4BJ5 C;  5EEH A;  1T33 A;  3O6B B;  3FXJ A;  4XLE A;  2E1C A;  1NTC A;  2LKP A;  1VQP I;  3O8H A;  3F0C A;  2A5Y B;  4BJT A;  3SJM A;  1YRN A;  2LR8 A;  2KMU A;  3PFI A;  3CCE I;  1QVU A;  3CCR I;  4G9Y A;  3O2P E;  4MO7 A;  4MLO A;  3ONQ A;  2UUZ A;  1ZQ3 P;  5JLW A;  2FXA A;  2HEO A;  4E4H A;  2HS5 A;  2A68 F;  2OTJ I;  1ULY A;  1FLI A;  1UJ8 A;  3JRI A;  2HDW A;  2OPT A;  2IW5 A;  3Q9V A;  2XKO A;  3IAM 2;  3JTG A;  4NC7 A;  1TWA J;  4YEJ A;  3PM1 A;  1RIO H;  4I2O A;  2VPR A;  1PP8 F;  1S7O A;  2K9N A;  3RKW A;  3ZRG A;  4B43 A;  4BKX A;  1XDS A;  1UHS A;  3GZN B;  4YFX F;  4OIQ F;  4II2 A;  4HNT A;  1WJB A;  4H0E A;  1S7A A;  4UB6 C;  2FBH A;  1Y56 A;  4M73 A;  5CVR A;  1BN5 A;  4XK4 A;  1WFX A;  1OPC A;  4LK0 F;  4XL9 A;  2XC7 A;  3ABK H;  1FY7 A;  3COA C;  4LB6 B;  3QAH A;  3K1N A;  3PUB A;  3ZQF A;  1LB2 A;  3QPH A;  4KIS A;  4M3F A;  4G7H F;  1ORK A;  2VJJ A;  2Z1D A;  1H8A C;  2V7F A;  3CJT B;  3KP3 A;  3FXK A;  1O7F A;  1STZ A;  2EPF A;  4A3G J;  3BOQ A;  1ETV A;  2ZBK A;  5HLT A;  1OYW A;  2DQL A;  3KET A;  2FQ4 A;  3A1Y A;  3HTS B;  2ZSH B;  1FNN A;  4LIV A;  4A3J J;  2FJ1 A;  3JR9 A;  2FA5 A;  3BG3 A;  2O61 A;  1ZHF A;  5FGM A;  2M0C A;  3GTM J;  4GGG A;  1IRG A;  3WG9 A;  1FOW A;  1MBG A;  3K2Z A;  2NVU B;  2CV1 A;  4HX8 A;  3MZH A;  1TT0 A;  5B1B H;  2O3F A;  5E17 F;  1FMW A;  2HZD A;  4EM1 A;  2CH0 A;  4EGZ A;  3KEQ A;  5ICG A;  2BGC A;  2LYC A;  3F8M A;  2DYS H;  2IS4 A;  4I99 C;  2VLA A;  3NWT A;  1R5H A;  4FIS A;  4A3F J;  3D1N I;  5HDN A;  4EGY A;  5CLS A;  2R7Q A;  2ZJP F;  2MC4 A;  4RGR A;  2DA4 A;  2M8G X;  4MTD A;  1FYM A;  1I3Q J;  2LSO A;  2HNH A;  4BL0 B;  2DPU A;  2CW7 A;  1I1G A;  1MMA A;  4HX7 A;  3WGH A;  5K7H A;  2OV7 A;  4NHJ A;  4XOP A;  1GV5 A;  2XB5 A;  3HOU J;  4XN0 A;  2Z33 A;  2E1O A;  2O9L A;  2JA8 J;  2RQP A;  1BC7 C;  2QM3 A;  2B63 J;  1YW7 A;  4AD9 A;  3HRU A;  1VF9 A;  4S0H B;  3DWL E;  5E3L A;  5E79 C;  4BXF A;  2KP6 A;  4NUB A;  3RTR A;  3T0Y A;  3OIO A;  1R49 A;  1E17 A;  2KDZ A;  1SAX A;  5EDN A;  4A0Y A;  3ZQC A;  2R7F A;  2QA4 I;  3KP2 A;  3DPT A;  3M4O J;  2DMT A;  2H6B A;  2R7O A;  3F8C A;  4XLF A;  5CQE A;  1YW9 A;  4G8X A;  4KNY A;  4WXC A;  2NRA C;  1IN6 A;  2A5W A;  2W1O A;  1A35 A;  1SFK A;  3K4C A;  3ZQH A;  1MD0 A;  4M6V A;  3IKV A;  3OV8 A;  2O0Y A;  1Y1V J;  4ESF A;  1JJ6 C;  3MCZ A;  5CVJ A;  2E2I J;  2HFH A;  3KFW X;  3WU0 A;  2VKV A;  4K2E A;  4BDY A;  2VJ4 A;  2XIG A;  1SFO J;  4Y3O A;  1FBQ A;  3M1C A;  4BDZ A;  3S2D J;  2R7W A;  3G2B A;  5FFX A;  1S72 I;  1J59 A;  3BT9 A;  3ULQ B;  1B9N A;  1FSH A;  5HOO A;  3HUG A;  4LB5 A;  3KLN A;  3HIF A;  1EF4 A;  3FXM A;  3FKJ A;  4MQ9 F;  5ED4 A;  4HQM A;  1K6O A;  3FBI B;  4ZJZ A;  3TBI A;  2EZK A;  2MLK A;  3IH4 A;  3ZOB A;  2FU4 A;  3BZK A;  4AYB A;  4B8X A;  4XBF A;  4QLC U;  1ACI A;  4MTE A;  3CMA I;  3BCB A;  4KDP A;  1T38 A;  2G7H A;  3FMR A;  3OWT A;  3CCJ I;  2KIQ A;  2DMP A;  2L2O A;  2X6W A;  3QP5 A;  4RGU A;  4EMS A;  4HDV A;  1P9Q C;  4F91 B;  3P9K A;  2ZXI A;  2AHQ A;  2PEX A;  2RKH A;  2ME6 A;  2R0Q C;  1IAW A;  1REP C;  5CJ9 A;  4XOR A;  1G3T A;  1R23 A;  2F5E A;  3FKI J;  4M9X A;  1XDU A;  3LSM A;  3WHC A;  2H09 A;  2CO5 A;  2H8R A;  5ERI A;  2E35 A;  4Y17 A;  5IYD J;  3ZQ7 A;  4IRI A;  1FOY A;  1SVL A;  3L2V A;  4FQG A;  1XN7 A;  2DQR A;  3QOD A;  1XTA A;  4E7L A;  1XCV A;  4C3I J;  2W82 A;  1VQN I;  4U7D A;  3A03 A;  3E6C C;  4U7B A;  1E3O C;  1IRX A;  3VSL A;  3HXL A;  3BTC A;  3HZJ A;  5LHI A;  2GOM A;  4ZTF A;  3IRR A;  4IRG A;  1D1C A;  1D8K A;  4WK8 F;  2IS1 A;  2R7U A;  1Z1D A;  1LJ9 A;  2P6T A;  4OMY A;  5F27 A;  1EKE A;  4JX5 A;  2IA0 A;  1I6H J;  3GVA A;  1QPM A;  3KYL A;  5L3B A;  1D5V A;  3E3V A;  2E2H J;  3J81 K;  1PUF B;  5H6R A;  4XNF A;  4DW6 A;  3HRS A;  5LHG A;  3LSH A;  3AL0 C;  5E8G A;  5C3E J;  1K61 A;  2WC2 A;  3M7G A;  4DJA A;  2ZJQ F;  3RPU D;  4AIJ A;  2ZNZ A;  3RKX A;  3LSG A;  2GLO A;  4A5M A;  2XF6 A;  3W2W A;  3OS0 A;  2Z5U A;  1YO5 C;  3HM5 A;  1GDT A;  2I5U A;  4I0B A;  5C44 J;  1H9G A;  4EAT A;  2OTL I;  2WTE A;  2BE5 F;  4PFP A;  2UV1 A;  5FD5 A;  4DYQ A;  4FCY A;  4CCO A;  5EYR A;  2E1M B;  2W85 A;  5K7F A;  4XID A;  2CFX A;  1Z3X A;  4ZDP A;  4Y33 A;  1FBU A;  1SD5 A;  3FIW A;  2ZME A;  2VI6 A;  2XSD C;  1ZRF A;  1I6X A;  2D1H A;  4MFE A;  1YIJ I;  2XRO A;  1YLF A;  2BW3 A;  2IRF G;  3PIP F;  1RZ4 A;  2P8T A;  1WZ2 A;  4RM3 A;  4XM3 A;  3H9J A;  4EJT A;  3H3U A;  5A2Q K;  4M3B A;  4DZJ A;  4AID A;  1O3T A;  4U0V A;  1H0M A;  2N8G A;  4LG0 A;  3E5Q A;  2OBP A;  2H6C A;  1BJZ A;  5M3M J;  2AXT C;  4BE1 A;  1U5T B;  2JMW A;  4IOC F;  4NNJ A;  1SAU A;  5FLX Z;  5FO5 A;  2G7U A;  2F48 A;  2STW A;  1P2F A;  2Z16 A;  1JKQ C;  2V6C A;  4KIF A;  1IRZ A;  2HOS A;  2M3A A;  2VBX A;  3BR2 A;  3BY6 A;  4UUS B;  2MSY A;  2MLG A;  1KZH A;  2DOE A;  4ZC3 A;  3GBG A;  1WRJ A;  1ZYR F;  3CTA A;  1S5L C;  4HDU A;  3KPH A;  2GIZ A;  2UZK A;  2W00 A;  5LFA A;  2RVC A;  2Y75 A;  2QQB A;  1ZTR A;  4P96 A;  3U2R A;  3TW6 A;  2LY2 A;  4KIC A;  4AVZ A;  2LBF A;  1OIS A;  2Y0S N;  3IKT A;  3AFH A;  1VZ0 A;  2EIM H;  4J00 A;  2E60 A;  1VND A;  3L2Q A;  1HKS A;  4LGW A;  4U87 A;  2F5C A;  1R71 A;  4CCM A;  3QYF A;  2HGC A;  4BEH B;  2X9D A;  1Y6I A;  3VOD A;  3L2W A;  2WAQ N;  3G73 A;  3AG3 H;  3Q5F A;  4UVA A;  5D5U B;  4I98 B;  1J75 A;  1IC8 A;  4CCJ A;  3OYI A;  4JX6 A;  4PDK A;  2YX4 A;  2OQG A;  2JRT A;  1U2W A;  3WTT C;  5F6F A;  3JRA A;  2IT0 A;  1MMN A;  3QP6 A;  5EGO B;  3UKG A;  3FIS A;  5HOD A;  3GTG J;  1RC9 A;  2R7T A;  3BTI A;  1SD6 A;  1EH7 A;  3L1P A;  4Y13 A;  3ABU A;  1K6Y A;  1HOM A;  5DUI A;  3RI4 A;  3KX2 A;  4XKC A;  3BJ6 A;  1LKX A;  2OA4 A;  5GPA A;  3R6S A;  2VOD A;  1OLT A;  1SD4 A;  1ETX A;  1P4W A;  2QEX I;  3IH3 A;  2QQ8 A;  4CCK A;  1XPX A;  1IF1 A;  2LD5 A;  2MGQ A;  2M2E A;  5JLX A;  1G3W A;  2CV2 A;  4CCN A;  2D45 A;  2F6C A;  3WE3 A;  4KFC A;  4CA0 A;  4N4O B;  2NVT J;  5DUK A;  3EPZ A;  3FX3 A;  2QBY B;  1QVT A;  3F22 A;  4C30 A;  4RB2 C;  4UHT A;  5IOY A;  3HB9 A;  4IHV A;  4IHX A;  1TWH J;  3CMM A;  3J7A O;  4XLA A;  5GTH C;  2VJ5 A;  4ZH4 F;  4Y7N J;  2HKX A;  2DTZ A;  3GFI A;  3S1N J;  3I59 B;  3CQZ J;  4HX4 A;  5DM7 F;  3GFM A;  2P7V B;  4KJZ A;  2LLK A;  2EQR A;  1W7P A;  1LVA A;  1UST A;  1ZG1 A;  3CCU I;  2COM A;  4UUV A;  2D2W A;  4Y4R A;  2KJB A;  2K3F A;  4IZZ A;  1ZGW A;  2VUM J;  4G6T B;  3WTY C;  1UAA A;  2EJR A;  2ELJ A;  3DEU A;  5KCM A;  1PDN C;  5FKM A;  1QZZ A;  2X1E A;  1B59 A;  1P92 A;  4OAZ A;  3AG2 H;  2XF5 A;  1UHW A;  2M9H A;  2M34 A;  1F4K A;  3E6D A;  3F8B A;  1OR7 A;  5J1U A;  3BJA A;  2Z2S B;  2E7X A;  1B4A A;  4HF1 A;  3QYE A;  3KEY A;  1ZLJ A;  3B6C A;  3REO A;  2FNA A;  5J1R A;  1BI0 A;  1SMT A;  4X1E A;  4I6Z A;  1H9T A;  4ZYA A;  5B3S H;  3C3W A;  1L0O C;  2DOF A;  3OYM A;  3CC7 I;  2OCC H;  5EZG A;  1DP3 A;  2JWT A;  3HSR A;  1P6R A;  4PSX A;  1VQL I;  3D0S A;  3LAJ A;  1XC5 A;  2BBY A;  4AU7 A;  2R3S A;  3LSR A;  4HRI A;  2BYV E;  3E7L A;  1OCZ H;  4B48 A;  3M3Y J;  1W0U A;  1X4P A;  4ASN A;  2QEN A;  4RB0 A;  4LLN A;  2PFB A;  2K5C A;  1ZGA A;  1HDD C;  1QU3 A;  4D5F A;  4PJ0 C;  3ASO H;  1E3H A;  3RQI A;  3M07 A;  4HYE A;  4RMN A;  5HLH A;  3PO2 J;  3MWM A;  1TLH B;  2JA5 J;  5D5W B;  4RB3 C;  3HKZ A;  4ZYE A;  4H4K C;  1JTY A;  3DBL B;  2XSJ C;  4G7Z F;  1WGX A;  2F4I A;  3FHN A;  4B3A A;  3X2Q H;  4R79 A;  2L9R A;  5KHD A;  2R5Z B;  3NEU A;  2KZG A;  4L5E A;  1WJD A;  2VQG A;  3U9G A;  4DBQ A;  2OQR A;  4FAS D;  4HNV A;  4RDU A;  1FP2 A;  2QLZ A;  4BNC A;  5M5X J;  1J0R A;  4BXU A;  2XGC A;  4I09 A;  1KU2 A;  2COB A;  5AON A;  5LGN A;  2W25 A;  2JA7 J;  1W36 D;  1GXQ A;  4ENJ A;  1JGS A;  3BG6 A;  4B1R A;  5KVR A;  2DA5 A;  3M8F A;  1S29 A;  2PMZ A;  2RC4 A;  1Z7U A;  2MW8 A;  1F9N A;  3K10 A;  3H35 A;  2GA2 A;  1LDJ A;  2DOD A;  4A69 C;  4DYR A;  2K9M A;  1DGR M;  2QWW A;  1WJ5 A;  3OYB A;  2V9K A;  1B72 A;  2PJR B;  2CV0 A;  4PUS A;  2KL4 A;  1A5J A;  1I50 J;  3HPH A;  4NBQ A;  3SZT A;  5EZH A;  5FD6 A;  3JAM K;  1TT5 B;  1WVR A;  1S9H A;  2DK8 A;  5K5O A;  2LK2 A;  2LP0 A;  1VQO I;  4HOB A;  4P55 A;  1YX3 A;  1HQC A;  2K27 A;  1X19 A;  2A07 F;  4C9Y A;  2W84 A;  5IYB J;  2EIL H;  4Q5S F;  1SD7 A;  1V55 H;  2UXN A;  3QU3 A;  3ZP5 A;  1OCR H;  4E7J A;  2FMY A;  1R4M B;  2PJP A;  5HS7 A;  1V5G A;  4KUM A;  1GT0 C;  2DW4 A;  2QQA A;  4C2M J;  3JRF A;  4Y52 J;  3V7S A;  4JK1 X;  1YJ9 I;  4XRF A;  2KPM A;  2L4A A;  1FTT A;  4M3D A;  4A6D A;  1A31 A;  1R1V A;  4YFK F;  2EZL A;  2XUB A;  2KIM A;  1UG0 A;  4A3M J;  2J5O A;  1HC8 A;  2WA0 A;  4PK4 A;  2DFH A;  3DLL F;  5CVI A;  1R9T J;  1IXC A;  3E6M A;  4DYC A;  5LBQ A;  3BRO A;  2LG4 A;  4RGS A;  2HVS A;  1ITY A;  1Y8Q B;  1Q1H A;  2HOA A;  2L3D A; 
#chains in the Genus database with same CATH homology
 1ZN2 A;  3ZMV A;  3GUD A;  1KU7 A;  2PMU A;  4BQA A;  5BS6 A;  1YW8 A;  4UV9 A;  2ACJ A;  2PLY A;  1W5S A;  2D1V A;  1U3E M;  3WTW C;  3WTX C;  1KU9 A;  4L9J A;  1ZH5 A;  2P6S A;  1UFM A;  5E18 F;  4PGH A;  1R7J A;  5L3E A;  3F8N A;  4M74 A;  2JSC A;  3NQO A;  3LAP A;  4I02 A;  5E1X A;  2EK5 A;  3MAJ A;  4S04 A;  5BQT A;  4IHT A;  3B02 A;  1XSV A;  5HVQ C;  1ZGJ A;  4R8H A;  2QYO A;  2B0L A;  1HSJ A;  3HSE A;  2O03 A;  2RNJ A;  5TRD A;  3KP5 A;  4A5N A;  4L18 B;  1BI1 A;  1FT9 A;  3J80 K;  4G6Q A;  2CSO A;  2L54 A;  4OIR F;  3KE2 A;  2E7W A;  1P4X A;  3GYH X;  2V9V A;  2VXZ A;  1F1Z A;  4XLP F;  3HHG A;  2A6E F;  4OMZ A;  1T0F A;  1W5T A;  1IN4 A;  5EEG A;  3TOB A;  3O3K A;  3CO6 C;  2KIF A;  4HZF A;  2O8X A;  3P9I A;  4UVB A;  2TDX A;  3F8F A;  3QU6 A;  3ZN0 A;  4KIG A;  3DXJ F;  3HSF A;  3L2C A;  3ZN1 A;  4TV7 A;  2FQ3 A;  2G9W A;  5ICE A;  1O3R A;  4HV5 A;  3RYR A;  4GCV A;  1Y0U A;  1WSU A;  2HQN A;  2HQR A;  5LGT A;  3RYP A;  4A2U A;  4GXO A;  1LNW A;  2FOK A;  4M72 A;  1K78 B;  4KN4 X;  5LLQ A;  2EA2 A;  2MA3 A;  2EV5 A;  5D5V B;  3NRV A;  4DNC A;  2ZO4 A;  2P5L C;  3FZV A;  2ESN A;  4MEX F;  3V8K A;  2GXB A;  3VEP A;  4D0P A;  3HRM A;  4MNU A;  4FT8 A;  1IUY A;  2K7L A;  4WCG A;  3PQK A;  2XV4 S;  2QQ9 A;  3JW4 A;  3BJO A;  4UNO A;  2L01 A;  4KIB A;  3L9F A;  2JTV A;  1MDM A;  3DKW A;  3R60 A;  1CF7 B;  3ISP A;  2VT2 A;  2WV0 A;  1QO0 D;  1Z05 A;  2YPR A;  4ZZL A;  4OU0 A;  4L0Y B;  1HW1 A;  3CUQ B;  1Z6R A;  4WF2 A;  4EJU A;  1W4M A;  3IC7 A;  3WE2 A;  3GFL A;  1USS A;  3F21 A;  4HLY A;  3MEX A;  4HF0 A;  4JBA A;  3MFK A;  2M1B A;  3ML6 A;  1LEA A;  3F23 A;  4HBL A;  4ON0 A;  5HS8 A;  3BZ6 A;  4CGZ A;  2CYY A;  3F6O A;  5FB2 A;  2XAQ A;  5DCF A;  3IWZ A;  3FMS A;  4BHC A;  4UXN A;  4XSZ F;  3SXY A;  2HYG D;  2OZ6 A;  2FF4 A;  5J8C A;  2GAU A;  3K69 A;  1Z91 A;  3TO9 A;  3FMQ A;  4I01 A;  3FXQ A;  4EJO A;  3JTH A;  5K1Y A;  1DPU A;  5E1Z B;  3VB2 A;  3DPL C;  2EV0 A;  5DCM B;  4LMY A;  2P5V A;  1LQ1 A;  1ON1 A;  1IN8 A;  1ZG3 A;  4ZYH A;  2F5D A;  5HLI A;  1U5T A;  2ADU A;  4E70 A;  1D8J A;  3EET A;  2XAG A;  2L4M A;  1T2K A;  1BBY A;  1O3Q A;  3H92 A;  3TOA A;  2EA4 A;  1OYY A;  3V7R A;  1WQ2 A;  4GYI A;  1ZRD A;  1TQI A;  3GXO A;  3MZY A;  2DLL A;  5K5R A;  3R61 A;  1KGS A;  1OYI A;  2J5P A;  1LDK B;  2P5K A;  4QWQ A;  3CJN A;  4A0Z A;  1YTY A;  3GZ6 A;  2ISZ A;  1KQ8 A;  1BIB A;  3C1D A;  2YR2 A;  2XRN A;  4WXD A;  5IT9 K;  3KLO A;  3QPT A;  1R1T A;  3LA2 A;  4GYG A;  4L5J A;  3FWE A;  3GFJ A;  2MH9 A;  1CGP A;  1ZRE A;  3G3Z A;  1TNT A;  5DYM A;  1FWZ A;  1XGS A;  3N97 A;  2JPB A;  3W6K B;  3BDD A;  3LQQ A;  1MKM A;  3R0A A;  3ZPL A;  3T1B A;  2QZ8 A;  2XAJ A;  5ILS A;  2ZNY A;  2V1X A;  2VOP A;  4P5O A;  3WTU C;  2RN7 A;  2A61 A;  5D8L B;  4Q48 A;  1ONV A;  4WWC A;  4EV0 A;  1GXP A;  1ZRC A;  1K79 A;  1FX7 A;  3IRQ A;  2VBW A;  2K86 A;  2HTJ A;  4CYD A;  2ZJ2 A;  1BM9 A;  2ETH A;  2RDP A;  3I59 A;  2VE8 A;  1IZ1 A;  2IA1 A;  4OOI A;  1TQP A;  1LEB A;  2M87 A;  4CIC A;  1ODD A;  1DDN A;  1U8R A;  2XHK A;  5HLG A;  4ZZD A;  3GF2 A;  2PI0 A;  2MD5 A;  2Q2E A;  4BAY A;  1J9I A;  1R1U A;  4A6E A;  1BJA A;  2OU2 A;  4LLG F;  3J81 Z;  3P9C A;  2DBB A;  3IWF A;  1TTY A;  1QNT A;  2DU9 A;  4ENN A;  2M8E A;  3GWZ A;  1U6G A;  1GHC A;  2X0L A;  2AS5 F;  1JHF A;  2A69 F;  2Z3Y A;  5L3F A;  5LGU A;  2ZXJ A;  2FML A;  2VBZ A;  3P7N A;  4EM0 B;  4L9N A;  2DFI A;  4WX9 A;  2F2E A;  4PGG A;  2XAH A;  1B9M A;  1AOY A;  5F64 A;  3VOE A;  2A6H F;  2IJL A;  1P4A A;  3KZZ A;  3RKY A;  2HR3 A;  4F7Z A;  2YU3 A;  3E5X A;  1XGO A;  4MEY F;  4N0B A;  4EQQ A;  4IPA A;  1EH6 A;  1B6A A;  4NB5 A;  2XGX A;  4YII A;  4RAZ A;  2Z9O A;  3KZY A;  3CO7 C;  3EYI A;  1L3L A;  3RPU A;  5ICF A;  4AWX B;  3HOS A;  1FYL A;  5FFZ A;  1RUO A;  2Q0O A;  3DF8 A;  3LA3 A;  2V1U A;  1I1S A;  2IVM A;  1YFH A;  3S2W A;  3I53 A;  2KRF A;  3GZ5 A;  2Q8K A;  3JSP A;  1GVJ A;  2PN6 A;  3FHZ A;  1Z9C A;  3HRT A;  3I71 A;  4HV6 A;  1XSD A;  4RAY A;  2HWV A;  4RB1 A;  1YQA A;  1IN5 A;  1WWX A;  3ZMT A;  3U1D A;  5BPD A;  3Q9S A;  4KMF A;  2ISY A;  1QGP A;  1C0W A;  3V8J A;  1MZB A;  2IP2 A;  1KYZ A;  2HDC A;  1LDD A;  4M9S A;  2UXX A;  2KJC A;  1FYK A;  1MJA A;  2CGP A;  2E1N A;  4N9I A;  4EJW A;  3KP7 A;  3ZMS A;  3SZP A;  4IF4 A;  2NYX A;  2CWE A;  1EV7 A;  5BPI A;  4FX0 A;  2C6Y A;  4LFU A;  3LQR A;  2AXL A;  4ZYD A;  1FBS A;  1U78 A;  2H27 A;  1G4D A;  1TW2 A;  2Z99 A;  3I54 A;  3CDH A;  1XSX A;  2KIU A;  3T5X A;  5D6E A;  3V8L A;  3I0T A;  2XKP A;  5ILU A;  1IW7 F;  1VTN C;  3F6V A;  4BHP A;  4BYY A;  4LJZ F;  1MJ9 A;  1R5G A;  4G7O F;  3RDI A;  3K0L A;  3QRF F;  3M1E A;  5ICC A;  4U0Y A;  1O3S A;  1FZP B;  4EJV A;  4O6J A;  5JR3 A;  3ZMU A;  1U5T C;  2QVO A;  3E97 A;  2NS0 A;  2KKO A;  5L3D A;  1R00 A;  3AAF A;  1KA8 A;  4AIK A;  3GEZ A;  4ETS A;  3PQJ A;  1J7K A;  3HOT A;  4PZJ A;  2EFP A;  3F3X A;  2Y48 A;  4A0X A;  5H20 A;  1OMI A;  2UWM A;  2PBI A;  4L0Z B;  4DQ2 A;  4CZZ A;  3DP7 A;  3TDZ C;  4N9H A;  1HKQ A;  4HLX A;  2W24 A;  4L9T A;  3WTV C;  5DEQ A;  1J5Y A;  5JHU A;  3L00 A;  2STT A;  4G6D A;  2EFN A;  3WTS C;  2FBI A;  1IXS B;  3ECO A;  3CLO A;  1O57 A;  1UHM A;  1XD7 A;  3EUH A;  1JHH A;  1MJB A;  4IXA A;  5LRR A;  3JAM Z;  3T8R A;  1K78 A;  4I0A A;  5DDG A;  2W57 A;  2FEZ A;  4NQW A;  2PG4 A;  3HHH A;  1FP1 D;  2QUF A;  2BV6 A;  1DUX C;  1E2X A;  2NNY A;  3I4P A;  4WXH A;  1YS6 A;  1V4R A;  4M6X A;  2ESH A;  2LF8 A;  3LWF A;  3W6J B;  1F5T A;  2ELH A;  1TNS A;  5L3C A;  4AIH A;  1O7L A;  1CF7 A;  2CW0 F;  2RV8 A;  3FF5 A;  1XMA A;  3BP8 A;  4BH9 A;  1SFX A;  3CUQ A;  4OIP F;  5FLX K;  2GZW A;  4Y15 A;  2V1D A;  1HKT A;  1SFE A;  1HST A;  3N4M A;  2GQQ A;  3ZMD A;  3KCC A;  3HYI A;  1MGT A;  3R4K A;  1IRF A;  2EWN A;  1FSE A;  2HZT A;  2YX7 A;  3LST A;  3OOP A;  4OIN F;  3WGG A;  1DPR A;  1HXD A;  4KT5 C;  2WWY A;  1G6N A;  2L02 A;  3F72 A;  4UVC A;  3RJP A;  1DP7 P;  1W7P D;  3B73 A;  5DD8 A;  5TJJ A;  3C18 A;  4YFN F;  3J80 Z;  2PQ8 A;  3D5L A;  1S8N A;  2DTR A;  2F5F A;  3IHU A;  3BPV A;  6PAX A;  1R22 A;  2VBY A;  4P9U A;  4O3M A;  5DCM A;  1MDM B;  3VFZ A;  3EYY A;  3LA7 A;  3K9T A;  3CUO A;  1YG2 A;  3JSO A;  3E5U A;  5CYV A;  5HS9 A;  3FXU A;  4I7H A;  3SQN A;  2JT1 A;  1YIO A;  2IA2 A;  2DK5 A;  2EFO A;  3TGN A;  5J8F A;  5K5Q A;  4HAM A;  3EDP A;  4ESJ A;  4BHB A;  3E6B A;  2Y0M A;  5J6X A;  3M8E A;  3FM5 A;  3IL2 A;  3I64 A;  1RI7 A;  1ZLK A;  2BEO A;  2H94 A;  1T6S A;  5JI6 A;  3FXR A;  2OAZ A;  5HDG A;  3ABT A;  1KQ9 A;  4M6Y A;  4CHU A;  5D4S A;  4MGR A;  3V4G A;  1R36 A;  2OD5 A;  4HW0 A;  4Z2Y A;  5JFR A;  5D5X B;  1G3Y A;  1BIA A;  1QQI A;  1ON2 A;  2EB7 A;  4UV8 A;  1RNL A;  1HW5 A;  2GWR A;  2PMH A;  1PP7 U;  3C7J A;  1XMK A;  4A12 A;  1YS7 A;  1HW2 A;  2M30 A;  2CQK A;  1BI3 A;  4U0W A;  2VT3 A;  1XCB A;  4FHT A;  2NNN A;  2GIV A;  2HYF A;  4RS8 A;  4OIO F;  4KMU X;  2DAO A;  5F1R A;  2ZME B;  1IN7 A;  2VOO A;  3SHF A;  1XGN A;  1S3J A;  1T39 A;  1K7A A;  3TO7 A;  4YIF A;  3T8T A;  2VE9 A;  2XVC A;  5AIP A;  2A3S A;  1KU3 A;  4B09 A;  4LG0 B;  2VN2 A;  2NAZ A;  2ZCW A;  3ECH A;  3TDU C;  3RIR A;  4EM2 A;  3LFK A;  2GA1 A;  5L3G A;  2R7D A;  2QBY A;  1BI2 A;  3GX4 X;  1UB9 A;  4EVI A;  3K1M A;  4KN7 X;  5LEJ A;  1QZY A;  3ELK A;  4IHS A;  1FPQ A;  4ENM A;  3WOD F;  5BMZ A;  3KP6 A;  4KA4 A;  2K4B A;  3TO6 A;  5LHH A;  3ROU A;  2LDU A;  1WI9 A;  2DO7 A;  4IVN A;  5D6F A;  1D3Y A;  3KEO A;  1TW3 A;  3R0J A;  4MQV A;  4CO8 A;  2JZY A;  1ZAO A;  2VC0 A;  4Q47 A;  3WU1 B;  4YG2 F;  4XSX F;  3RPQ A;  1I27 A;  5LEK A;  4R1H A;  4HA8 A;  2DPD A;  3MQ0 A;  2IPQ X;  3BWG A;  2DI3 A;  1S6L A;  4LK1 F;  5E8I A;  3FM3 A;  3I5U A;  2HKO A;  4ZYG A;  1TBX A;  4HF2 A;  2MBF A;  5A2Q Z;  4GO1 A;  3EQL F;  2ZFW A;  1YYV A;  5HDK A;  4U88 A;  3GLX A;  2MH2 A;  2EFQ A;  3WGI A;  1R58 A;  3H3Z A;  2XAS A;  5IT9 Z;  1W7P B;  1IXR C;  3GO5 A;  4AVP A;  5D8K B;  2M5W A;  5KK1 A;  1EH8 A;  1OKR A;  1XB4 A;  1A04 A;  2HOE A;  5H6Q A;  4L5I A;  3L7W A;  2P4W A;  4Q4Z F;  3TQN A;  4KYW A;  5CVV A;  1X3U A;  5IT3 A;  4IRH A;  1SMY F;  1Z6T A;  2O6G E;  3DFG A;  2VC1 A;  4P9F A;  1QBJ A;  4HQE A;  2K4J A;  3BPX A;  4JQF A;  2ZKZ A;  4LD5 A;  2FE3 A;  3ZMZ A;  3V7C A;  4XLN F;  2FBK A;  3CUQ C;  1FOK A;  5LRS A;  1BOA A;  1UCR A;  5DD4 A;  3I58 A;  3M9A A;  4RGX A;  1AWC A;  3SFZ A;  1JXS A;  1B1B A;  1T98 A;  4S05 A;  5DV5 A;  2RGV A;  4PCQ A;  2DT5 A;  1RUN A;  2LNB A;  3KP4 A;  3DQV C;  1BC8 C;  2JPC A;  5E1W A;  3HTU A;  2OZU A;  1NHA A;  2M45 A;  1JE8 A;  5CVU A;  1HBX G;  4CDG A;  2V79 A;  1KQ0 A;  2FRH A;  5D4R A;  1G3S A;  1TQM A;  2FSW A;  4M9Z A;  3L09 A;  2VON A;  5JVT A;  2EFW A;  2HTS A;  5ILV A;  1V3F A;  4LLL A;  2CG4 A;  3GW2 A;  4FX4 A;  1XGM A;  3QOP A;  4M71 A;  4O5V A;  3TKY A;  1ZAR A;  3ERE D;  4IJA A;  1KYW A;  5AIQ A;  5E20 A;  3K1P A;  4MHG A;  2X4H A;  1FC3 A;  4L9V A;  1ZG5 A;  1WKM A;  2MC3 A;  4ESB A;  1PUE E;  2EV6 A;  4CXF A;  2FNP A;  3WTZ A;  4ENK A;  2XAF A;  5BOX A;  2LF7 A;  1SFU A;  2GXG A;  4G94 A;  3DV8 A;  2P7C B;  1J2X A;  2K02 A;  2YSR A;  1I5Z A;  5EEH A;  3O6B B;  2E1C A;  2LKP A;  2A5Y B;  3PFI A;  4G9Y A;  3O2P E;  2FXA A;  2HEO A;  2HS5 A;  2A68 F;  1ULY A;  1FLI A;  2IW5 A;  3Q9V A;  2XKO A;  3JTG A;  1RIO H;  4I2O A;  1PP8 F;  1S7O A;  3RKW A;  1XDS A;  4YFX F;  4OIQ F;  4H0E A;  1S7A A;  2FBH A;  4M73 A;  5CVR A;  1BN5 A;  1OPC A;  4LK0 F;  1FY7 A;  3COA C;  4LB6 B;  3QAH A;  3K1N A;  1LB2 A;  3QPH A;  4G7H F;  3KP3 A;  1O7F A;  1STZ A;  3BOQ A;  2ZBK A;  1OYW A;  2DQL A;  3KET A;  3HTS B;  1FNN A;  2FA5 A;  2O61 A;  1ZHF A;  5FGM A;  1IRG A;  4GGG A;  3WG9 A;  3K2Z A;  4HX8 A;  3MZH A;  2O3F A;  5E17 F;  4EM1 A;  4EGZ A;  3KEQ A;  5ICG A;  2BGC A;  3F8M A;  1R5H A;  5HDN A;  4EGY A;  5CLS A;  4RGR A;  4MTD A;  1FYM A;  2LSO A;  2DPU A;  1I1G A;  4HX7 A;  3WGH A;  4NHJ A;  2Z33 A;  2RQP A;  1BC7 C;  2QM3 A;  1YW7 A;  4AD9 A;  3HRU A;  3RTR A;  3T0Y A;  1E17 A;  1SAX A;  4A0Y A;  2R7F A;  3KP2 A;  3DPT A;  2H6B A;  3F8C A;  1YW9 A;  4G8X A;  4KNY A;  4WXC A;  2NRA C;  1IN6 A;  1MD0 A;  3IKV A;  3OV8 A;  2O0Y A;  4ESF A;  3MCZ A;  5CVJ A;  2HFH A;  3KFW X;  3WU0 A;  4K2E A;  2XIG A;  1FBQ A;  5FFX A;  1J59 A;  3ULQ B;  1B9N A;  1FSH A;  5HOO A;  3HUG A;  4LB5 A;  3KLN A;  3HIF A;  4MQ9 F;  5ED4 A;  4HQM A;  1K6O A;  2MLK A;  2FU4 A;  4B8X A;  4XBF A;  4QLC U;  4MTE A;  4KDP A;  1T38 A;  2G7H A;  3FMR A;  3QP5 A;  4RGU A;  4EMS A;  4HDV A;  3P9K A;  2PEX A;  2RKH A;  1IAW A;  1REP C;  5CJ9 A;  1G3T A;  1R23 A;  2F5E A;  4M9X A;  1XDU A;  2H09 A;  2CO5 A;  5ERI A;  4Y17 A;  3ZQ7 A;  4IRI A;  1XN7 A;  2DQR A;  1XCV A;  4U7D A;  3E6C C;  4U7B A;  5LHI A;  3IRR A;  4IRG A;  1D8K A;  4WK8 F;  1Z1D A;  1LJ9 A;  2P6T A;  4OMY A;  2IA0 A;  3GVA A;  1QPM A;  5L3B A;  1D5V A;  3E3V A;  3J81 K;  5H6R A;  3HRS A;  5LHG A;  5E8G A;  2WC2 A;  3M7G A;  4AIJ A;  2ZNZ A;  3RKX A;  4A5M A;  2Z5U A;  1YO5 C;  4I0B A;  1H9G A;  2WTE A;  2BE5 F;  5FD5 A;  2W85 A;  2CFX A;  1FBU A;  1SD5 A;  1ZRF A;  2ZME A;  1I6X A;  2D1H A;  2XRO A;  1YLF A;  2IRF G;  1RZ4 A;  2P8T A;  4EJT A;  3H3U A;  5A2Q K;  1O3T A;  4U0V A;  1H0M A;  4LG0 A;  3E5Q A;  2OBP A;  2H6C A;  1U5T B;  5FLX Z;  5FO5 A;  2G7U A;  2STW A;  1P2F A;  2V6C A;  4KIF A;  2VBX A;  3BY6 A;  2MLG A;  1WRJ A;  1ZYR F;  3CTA A;  4HDU A;  2UZK A;  2RVC A;  2Y75 A;  2QQB A;  4P96 A;  3U2R A;  4KIC A;  3IKT A;  1HKS A;  4LGW A;  2F5C A;  2HGC A;  3VOD A;  3G73 A;  3Q5F A;  4UVA A;  5D5U B;  4I98 B;  1J75 A;  4PDK A;  2YX4 A;  2OQG A;  2JRT A;  1U2W A;  3WTT C;  5F6F A;  2IT0 A;  3QP6 A;  1SD6 A;  1EH7 A;  4Y13 A;  3ABU A;  5DUI A;  3RI4 A;  3BJ6 A;  2OA4 A;  3R6S A;  2VOD A;  1SD4 A;  1P4W A;  1IF1 A;  1G3W A;  2D45 A;  3WE3 A;  4KFC A;  5DUK A;  3FX3 A;  2QBY B;  3F22 A;  4RB2 C;  4UHT A;  3J7A O;  4ZH4 F;  2HKX A;  3GFI A;  3I59 B;  4HX4 A;  3GFM A;  2P7V B;  1W7P A;  1LVA A;  1UST A;  1ZG1 A;  2COM A;  4UUV A;  2D2W A;  2KJB A;  3WTY C;  2EJR A;  3DEU A;  1PDN C;  1QZZ A;  1B59 A;  1P92 A;  1UHW A;  1F4K A;  3E6D A;  3F8B A;  1OR7 A;  3BJA A;  2E7X A;  1B4A A;  4HF1 A;  1ZLJ A;  3REO A;  2FNA A;  1BI0 A;  1SMT A;  1H9T A;  3C3W A;  1L0O C;  3HSR A;  1P6R A;  3D0S A;  3LAJ A;  2BBY A;  2R3S A;  2BYV E;  4ASN A;  2QEN A;  4RB0 A;  4LLN A;  2PFB A;  1ZGA A;  5HLH A;  4HYE A;  3MWM A;  1TLH B;  5D5W B;  4RB3 C;  4ZYE A;  4G7Z F;  4R79 A;  3NEU A;  3U9G A;  2OQR A;  1FP2 A;  2QLZ A;  4BNC A;  1J0R A;  4BXU A;  4I09 A;  1KU2 A;  5AON A;  5LGN A;  2W25 A;  1GXQ A;  4ENJ A;  1JGS A;  5KVR A;  3M8F A;  1S29 A;  2RC4 A;  1Z7U A;  1F9N A;  2GA2 A;  1LDJ A;  2QWW A;  3JAM K;  3SZT A;  5FD6 A;  2DK8 A;  5K5O A;  4HOB A;  4P55 A;  1HQC A;  2K27 A;  2A07 F;  2W84 A;  4Q5S F;  1SD7 A;  2UXN A;  3QU3 A;  3ZP5 A;  2FMY A;  2PJP A;  5HS7 A;  4KUM A;  2DW4 A;  2QQA A;  3V7S A;  4JK1 X;  4XRF A;  2L4A A;  4A6D A;  1R1V A;  4YFK F;  2XUB A;  2KIM A;  2J5O A;  5CVI A;  1IXC A;  3E6M A;  5LBQ A;  3BRO A;  4RGS A;  1Q1H A;  2L3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...