3ULQB

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
VLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/transcription activator
molecule keywords Response regulator aspartate phosphatase F
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ulqB00
3K1NA 4AIKA 2CYYA 3GZ6A 3P7NA 1ZARA 3KEQA 1USSA 2A6EF 3KLOA 1SMYF 3F8MA 2RQPA 2QUFA 1J0RA 4G9YA 3SZTA 3VEPA 3V7RA 4R8HA 4HOBA 4MQVA 3MFKA 1FYLA 2E1NA 4Z2YA 4A0YA 4EM2A 3WTSC 2NYXA 3I59A 1IW7F 3GFJA 4LJZF 2M1BA 4UV8A 1XD7A 1KYZA 1P4WA 1R23A 2VC0A 2XASA 1MDMA 3CTAA 1HKTA 5HS7A 4LMYA 3TO7A 2M45A 3GYHX 4BHCA 2VBXA 4ZYHA 4A6DA 2M8EA 1HKSA 4EV0A 1XMAA 4CHUA 3F72A 2HS5A 3WGHA 3FHZA 2QWWA 1WWXA 4KMFA 4DQ2A 2VN2A 4EGYA 5LRSA 4NB5A 1MZBA 3E5QA 3Q9VA 5ICEA 3P9KA 4MGRA 5CLSA 1B4AA 3GEZA 2H27A 5E20A 4JK1X 3QAHA 3FXQA 3IL2A 1CF7A 3SFZA 3HHGA 4UVCA 3QRFF 3EQLF 4MHGA 4B8XA 5HLIA 3F22A 1O3RA 1TW2A 3VB2A 2DK8A 3T1BA 5JHUA 3F8FA 1IXCA 3ZMSA 3COAC 3QPTA 3I59B 2PEXA 3VODA 4WK8F 2OA4A 4MEXF 2KIFA 3IC7A 2PN6A 2HEOA 3ELKA 3AAFA 2FBKA 2OD5A 4L9TA 1SFXA 3Q5FA 3QOPA 1FC3A 5HLGA 1PDNC 1XSDA 3DFGA 1HXDA 1F1ZA 3GO5A 1O3SA 2R7DA 3F6VA 1S29A 2HYGD 1OR7A 3KEOA 4CICA 3LSTA 2MH2A 4HZFA 4N9HA 1GXQA 1KQ0A 4N0BA 3SZPA 3B73A 3HRMA 4ENJA 2QQBA 3T8RA 4UNOA 1G6NA 1FLIA 1BI1A 1FYMA 4RGUA 1A04A 4O5VA 3E5XA 4I0BA 2YSRA 4RB3C 2FU4A 1W5SA 1BM9A 5DD4A 4TV7A 1Z91A 1SFEA 1O7LA 3NRVA 2X0LA 4P55A 2XV4S 4HV6A 1FOKA 4OIPF 4S05A 2AS5F 4S04A 3KZYA 2RDPA 2XKOA 1KU3A 4LLNA 4MEYF 1DDNA 4YIIA 4HAMA 2DQLA 2HYFA 1Z05A 1L0OC 4KN4X 4PZJA 1KGSA 1IN8A 2STWA 1WKMA 3I0TA 2RN7A 3RIRA 1O7FA 1XSXA 3R60A 3ROUA 2V6CA 2BEOA 5KK1A 4LK1F 4LLGF 4HW0A 4OIQF 2QLZA 2A07F 2YX4A 5E18F 3FMRA 3EUHA 4UHTA 1YW8A 4LGWA 3V8KA 2RGVA 3ISPA 4L0ZB 3CDHA 3F21A 1T2KA 4G7ZF 2VONA 1SD6A 1Z9CA 2XAHA 2BV6A 2F5EA 3F23A 2MC3A 2WV0A 3KE2A 4EQQA 3U9GA 4AWXB 2CWEA 2YU3A 1ZRDA 1FPQA 2X4HA 2JRTA 2JPCA 1L3LA 1BIBA 2M30A 2FNPA 3WTTC 2GXGA 2DK5A 1BI2A 3L2CA 3ZMDA 3R4KA 2V79A 2FA5A 2K02A 3DEUA 3ECHA 3KP2A 2CGPA 4IXAA 3CUQB 3WE3A 1UHWA 3ECOA 3LA3A 2H6CA 2EJRA 2HFHA 3J81Z 3J7AO 2JTVA 2NRAC 3HRUA 2A61A 3RPUA 3DPLC 2RV8A 2ETHA 3MCZA 4ESBA 1ULYA 1HSTA 4BXUA 1C0WA 4HQEA 1G3YA 4RGSA 4HDUA 1GHCA 3K0LA 3K1MA 2W25A 1BBYA 1V3FA 1EH7A 3BZ6A 1K78A 3C7JA 4Y13A 1IN5A 3I64A 4HV5A 4BQAA 3DPTA 5E17F 2CFXA 2QYOA 2VBYA 3M9AA 2A68F 1G3SA 2GWRA 3F6OA 3PFIA 3BY6A 5JR3A 1YW7A 4WCGA 2DAOA 3R6SA 1F5TA 2B0LA 4UVBA 3J80Z 3DQVC 5HDGA 4L5JA 2BGCA 3L09A 4G8XA 5LBQA 2GA2A 1ZN2A 1TW3A 5K5OA 1R7JA 4GYGA 3WGIA 3ZPLA 2LDUA 5H20A 3HSFA 4KT5C 2F5FA 4K2EA 1XDSA 4ZZLA 4HX8A 3U2RA 1R36A 2M87A 3KP4A 4BNCA 3RKWA 1XCBA 4FT8A 2MBFA 5D5WB 2F2EA 4HQMA 3RTRA 3I53A 1BIAA 2IVMA 2V9VA 1D5VA 2V1XA 2UXNA 1TTYA 5LEJA 2ELHA 3HSEA 3I71A 1U5TC 4LD5A 3BJ6A 1KQ9A 3MAJA 1LQ1A 3G73A 1HBXG 1WSUA 2KIMA 4I0AA 2DBBA 2G9WA 3O2PE 2MLKA 1IXRC 2PFBA 1R5HA 1K7AA 2FEZA 1R1UA 3MZYA 1VTNC 1SD5A 2KRFA 5J6XA 5DEQA 3IWZA 1XB4A 4H0EA 2CQKA 4CXFA 2HWVA 3KP7A 3QP5A 2A6HF 4L9JA 3FM3A 4KIGA 5D8KB 4YG2F 3GWZA 2ESNA 1XSVA 1J5YA 4I2OA 1S6LA 2Y48A 2JT1A 1PUEE 1UCRA 4M9XA 2VC1A 2VOOA 1LEAA 2EV5A 2OZ6A 2A5YB 3QU6A 3C18A 4OIRF 1R1TA 3O6BB 3WE2A 2XUBA 2KJBA 3H3ZA 1JHFA 3KP3A 1YQAA 2W57A 1ZLKA 2XRNA 4HA8A 4FHTA 4ENKA 5D5UB 3BWGA 2XAQA 3HSRA 5D5XB 2Z9OA 2TDXA 2E7XA 3IKTA 3FZVA 1HW1A 2P4WA 2ZNYA 4IF4A 2GA1A 2WTEA 1P6RA 1OYIA 5L3DA 1GVJA 4WXDA 3EDPA 3F8BA 5H6QA 1Y0UA 1MGTA 3P9CA 1B9NA 2EFPA 2COMA 1R5GA 2W84A 2HQRA 5TJJA 1O3QA 3V7SA 1YG2A 2ZBKA 1X3UA 2EFNA 1FSEA 4FX4A 2ACJA 2K86A 4P96A 2C6YA 1U5TB 4QWQA 3DV8A 4HX4A 4EJUA 5DD8A 4UVAA 3BPXA 3M8EA 1I5ZA 3JAMK 4GGGA 1TBXA 2CG4A 3DF8A 3RJPA 1BOAA 2CO5A 3M7GA 3RYRA 4WF2A 2BYVE 4OMYA 2P6SA 4GO1A 4YIFA 4LK0F 2PLYA 5FLXK 1W7PA 4E70A 1JGSA 4WXHA 3ZMUA 4LLLA 1OYWA 1LJ9A 3BDDA 3V7CA 2Z3YA 4CO8A 4P9FA 5ILVA 3P9IA 5ICFA 2O61A 1V4RA 3E6DA 4O6JA 3RYPA 2BBYA 3BPVA 1YS7A 2XKPA 4HX7A 5D8LB 3ZMTA 4RGXA 4QLCU 4M71A 2D2WA 1H0MA 3HIFA 1FP2A 1WQ2A 5DUIA 3R0JA 2DPUA 2EA4A 1B59A 1JHHA 2GIVA 4ESJA 2E7WA 4IJAA 1FT9A 1LB2A 2WC2A 1LNWA 2UZKA 1GXPA 2EB7A 3GZ5A 3GFLA 3KP5A 1DP7P 1LDDA 1TQPA 1KU9A 4A6EA 2PI0A 1J7KA 1Q1HA 2EWNA 3E5UA 4EJVA 4F7ZA 4I09A 2EFOA 4LG0B 3I4PA 2EV0A 3VFZA 2FSWA 3DP7A 1YIOA 2HKOA 1RNLA 3CO7C 2ZKZA 4EGZA 3TQNA 4M6XA 3C3WA 4A0XA 2FMYA 2DTRA 3N4MA 1ONVA 4B09A 3OV8A 3FM5A 2W24A 1LDJA 1QNTA 4RS8A 4EJWA 2EV6A 2XROA 1ZHFA 5LHHA 1AOYA 2GZWA 2JPBA 3O3KA 1R58A 2HQNA 5F64A 3HOSA 4PCQA 4U0WA 4YFNF 3KP6A 1XGOA 5A2QZ 2ZCWA 1P2FA 4PGGA 2LF8A 5D6EA 4AD9A 2DU9A 2YPRA 2P7VB 5FFXA 4LFUA 3GLXA 1S7OA 1ODDA 1ZH5A 2ZJ2A 1J9IA 4BHBA 4KIBA 4IRGA 1YW9A 2VT3A 3IWFA 2H6BA 5F6FA 4HYEA 2RNJA 1B1BA 2XIGA 4JBAA 2PMHA 1YS6A 2FRHA 3WTUC 3BROA 2OQRA 4KNYA 4OIOF 4IRIA 2XAFA 4M9SA 2PJPA 5CVUA 4P5OA 4Q48A 3W6JB 4Q4ZF 3WG9A 1D8JA 1MDMB 3ZN0A 1KYWA 2J5OA 2ZMEA 2QBYB 2G7HA 2E1CA 4KUMA 4XLPF 4OOIA 2L4AA 3LQRA 4CYDA 1TNTA 3E6CC 1TQIA 4BYYA 2PMUA 2IW5A 1FWZA 1J2XA 4AVPA 4Q47A 1I6XA 3QP6A 2IA1A 4UV9A 4I98B 4WXCA 3GFMA 1XDUA 5J8FA 3FX3A 3JAMZ 4I02A 1K79A 1DPRA 3MEXA 1I1SA 5IT9Z 1KA8A 2K4BA 1LDKB 1SFUA 2K7LA 4G94A 5DCMB 1OKRA 1ZGAA 3BP8A 4UUVA 2IJLA 3I58A 3IKVA 2VE8A 1T38A 1T0FA 1HW5A 1IUYA 1R00A 2Z33A 1P4XA 2ADUA 2HZTA 4L9VA 2A69F 3WU1B 2DLLA 3PQJA 5E1ZB 3WGGA 1BC8C 5E8GA 1I1GA 1IN6A 4CZZA 3F3XA 1BI3A 4PGHA 4M6YA 1XGNA 3TDUC 5EEHA 3IHUA 2KIUA 3GFIA 3R61A 1ZLJA 3KETA 2OZUA 4BAYA 2MH9A 4N9IA 1ZRCA 2EK5A 2P5KA 2HR3A 1ZG1A 1B6AA 3TOBA 2L54A 2O03A 5CVVA 1EH8A 3I5UA 4LB6B 1REPC 5HS8A 4G6DA 3WTWC 2HGCA 1MJ9A 2RC4A 3HRTA 1QBJA 2L02A 4RGRA 4OINF 5JI6A 3BOQA 4YFKF 3D5LA 5IT9K 1JXSA 5IT3A 3K2ZA 1P92A 1G3TA 3R0AA 2KJCA 2OQGA 1YYVA 4G7HF 3GVAA 3K1PA 1HSJA 2UWMA 4ASNA 1BI0A 2NS0A 1FNNA 5DCMA 1D8KA 5CVRA 1R1VA 3V8JA 4XRFA 3GXOA 2M5WA 5ILUA 4IPAA 2OU2A 3JSOA 3TOAA 1SD7A 5LHGA 3EETA 4IVNA 5HDNA 4RB1A 4XLNF 4HDVA 3T0YA 4A5NA 4L9NA 1IN4A 5D4SA 2FE3A 2O8XA 4MTDA 1P4AA 1AWCA 1QO0D 2IPQX 2VOPA 2QVOA 2DT5A 2FBIA 5F1RA 3EYIA 5K1YA 3ULQB 2EA2A 2LNBA 3LFKA 1D3YA 4OU0A 2J5PA 2FQ3A 2Q8KA 4U7BA 3I54A 2UXXA 2XAJA 1XGSA 2FOKA 1RI7A 5ILSA 2VBWA 3SQNA 1EH6A 4Y15A 4LB5A 4KYWA 1W7PD 2YR2A 2FF4A 5LGNA 4IHSA 3KCCA 1Z1DA 4NHJA 4AIJA 1T39A 2JSCA 5L3FA 5HVQC 2ESHA 1IRFA 1SD4A 5CVIA 1OYYA 3FXRA 2GXBA 2MLGA 4ETSA 1B9MA 2PBIA 5HOOA 1IN7A 1BC7C 2CSOA 1RUNA 3WODF 4ESFA 1Z7UA 5KVRA 1ZYRF 3EYYA 1J75A 1TNSA 2F5CA 3WTXC 1U2WA 3SXYA 2Z99A 4HF2A 1XGMA 3GF2A 4EVIA 2HOEA 4U7DA 5HDKA 1QGPA 1LEBA 3TGNA 1T6SA 3FXUA 3IRQA 4EM0B 2FXAA 1RIOH 4EJTA 1LVAA 1O3TA 1IRGA 3CO6C 2VBZA 4LG0A 5L3CA 1Z6TA 3RKYA 3MWMA 1RUOA 1U3EM 3OOPA 4U88A 3H3UA 4G6QA 5E1XA 5H6RA 1HKQA 3MQ0A 2LKPA 3ZQ7A 2PG4A 2R3SA 2ISYA 4HLYA 5DCFA 2IRFG 3VOEA 5DYMA 4BH9A 4HF0A 1FYKA 2O6GE 4JQFA 1G4DA 4M9ZA 2OBPA 5E8IA 2KKOA 4WWCA 4XSXF 4U0YA 3G3ZA 3K69A 3C1DA 3TO9A 4M73A 1DUXC 3KLNA 4EM1A 3GW2A 4ZYDA 4Y17A 4I7HA 4L5IA 1CGPA 1IXSB 2H94A 4KA4A 4KICA 1PP7U 1O57A 1WRJA 5L3EA 1SAXA 2P6TA 3ZMZA 2NAZA 2ZXJA 2F5DA 1UFMA 2PQ8A 3V8LA 4KDPA 2P5VA 3HHHA 5DDGA 2FBHA 1IAWA 3WU0A 2NNNA 2V1UA 4IRHA 2P7CB 3RDIA 2QENA 2RKHA 1YLFA 1XMKA 1W5TA 3QPHA 2YX7A 3D0SA 2LF7A 3DXJF 5AONA 2VODA 5D4RA 2EFWA 3JTGA 4P9UA 1MKMA 2GAUA 3LA2A 4KMUX 6PAXA 1U78A 2W85A 2HDCA 5BPDA 4D0PA 4WX9A 5FD5A 5ICCA 5BMZA 1F9NA 1F4KA 1FX7A 3HUGA 1T98A 1ON1A 3BJAA 2MA3A 4DNCA 4ZYGA 4AIHA 4RB0A 5FB2A 5FO5A 2K27A 1RZ4A 2Y0MA 4FX0A 2VT2A 1TQMA 3J80K 3LQQA 1KU7A 2ZFWA 2VE9A 1U5TA 4KIFA 4CGZA 2P8TA 1R22A 2QQ9A 1KQ8A 1QQIA 1ZG3A 3B02A 1ZGJA 3IRRA 2DW4A 3CUQC 4A2UA 2Z5UA 1BN5A 3GX4X 1CF7B 3SHFA 2WWYA 3BJOA 4ENNA 2XVCA 1FP1D 1FY7A 2DQRA 3E6MA 2DFIA 3ABTA 1G3WA 3N97A 4U0VA 3L7WA 4A12A 4UXNA 1FBUA 5HLHA 2V1DA 5LHIA 1TLHB 3E6BA 4HLXA 3HTSB 5FGMA 2DI3A 1ZREA 2DPDA 2XGXA 1WI9A 4GCVA 3JSPA 2LSOA 2HTSA 2Q0OA 5DV5A 2O3FA 4ENMA 5DUKA 2QQAA 3ABUA 5ICGA 1HQCA 1STZA 1XN7A 5D6FA 3LWFA 1ZG5A 1HW2A 3JW4A 1W7PB 3LAJA 5CJ9A 3FMSA 2GQQA 1SMTA 4R79A 2Y75A 2OAZA 3RPQA 3T8TA 4KFCA 3WTZA 1UHMA 2P5LC 5BOXA 2STTA 3M1EA 1FSHA 2IA0A 2RVCA 4YFXF 5AIPA 5LEKA 3E3VA 5LGTA 1MJBA 3REOA 3CLOA 1H9GA 2D1VA 3L00A 1YTYA 4R1HA 3TKYA 3WTYC 1KU2A 3E97A 1JE8A 1OPCA 3FMQA 4G7OF 4ZH4F 5BQTA 5K5QA 4ON0A 2L3DA 3M8FA 5EEGA 1S7AA 4XBFA 2L4MA 1FZPB 3ZMVA 5LRRA 3QU3A 1S8NA 3FF5A 3KZZA 3T5XA 4A5MA 4OMZA 5LLQA 5D5VB 3WTVC 4A0ZA 3HYIA 3LA7A 4RB2C 2D1HA 1QPMA 2IT0A 3JTHA 3CJNA 3HRSA 2JZYA 2DO7A 1IZ1A 3HTUA 5J8CA 3KFWX 4XSZF 3F8CA 1DPUA 5FLXZ 3K9TA 3W6KB 3MZHA 1J59A 5A2QK 2ZO4A 3F8NA 2XHKA 5CYVA 5FD6A 4BHPA 4L18B 1UB9A 1FBSA 4NQWA 2HKXA 4MTEA 2L01A 1XCVA 1BJAA 1QZZA 3RI4A 3ERED 1MD0A 3U1DA 4HF1A 4MNUA 5E1WA 2QM3A 2Q2EA 2ZNZA 3LAPA 3TO6A 2D45A 4I01A 4CDGA 2QZ8A 1I27A 5TRDA 5L3BA 2ISZA 2MD5A 4GYIA 4M72A 4RAYA 1USTA 2AXLA 3Q9SA 1K78B 5BPIA 4IHTA 5AIQA 2XAGA 3PQKA 2NNYA 2BE5F 1MJAA 3L9FA 2EFQA 3NEUA 4ZZDA 1OMIA 2K4JA 5JVTA 3H92A 4GXOA 3CUQA 2VXZA 1ON2A 3ZP5A 5ERIA 2O0YA 3V4GA 5L3GA 1NHAA 1QZYA 1E2XA 3TDZC 1PP8F 3S2WA 3DKWA 1K6OA 1ZRFA 5ED4A 5CVJA 5HS9A 2CW0F 2IP2A 2A3SA 1YO5C 5FFZA 1U6GA 1E17A 3GUDA 1U8RA 3ZN1A 2R7FA 4KN7X 2HTJA 1YFHA 3RKXA 5K5RA 4O3MA 2FNAA 4PDKA 4M74A 3ML6A 3HOTA 3J81K 2H09A 4Q5SF 1IF1A 1EV7A 1Z6RA 3FWEA 1ZAOA 4RAZA 4L0YB 5LGUA 1FBQA 4EJOA 4HBLA 4ZYEA 2IA2A 3NQOA 5JFRA 3CUOA 2FMLA 1S3JA 2G7UA 2ZMEB 2QBYA 4MQ9F 1H9TA 5BS6A 4EMSA 1W4MA
chains in the Genus database with same CATH superfamily
2MD0A 2NVTJ 3K1NA 3DTEA 3PIPF 4AIKA 2CYYA 2JA6J 1WI3A 3HGYA 3GZ6A 3P7NA 2EZKA 3CQZJ 1ZARA 1E3OC 2JVHA 2WB1A 1USSA 2A6EF 3KEQA 3KLOA 4XONA 2B9SA 1SMYF 2R7OA 2GXAA 3F8MA 3ZXSA 5EZHA 2RQPA 2QUFA 1V5FA 2E34A 1J0RA 4G9YA 3SZTA 3VEPA 3HKZA 3V7RA 4R8HA 2L7KA 4HOBA 3S14J 3Q0VA 1MMDA 2JA5J 4MQVA 3MFKA 1OCOH 1Y39A 2E1NA 4Z2YA 1FYLA 2PMZA 1TP4A 5EYRA 1TL8A 3DLLF 4A0YA 3S93A 4EM2A 3WTSC 2NYXA 3I59A 1Y0NA 2WV1A 3BG6A 2Z1DA 1IW7F 5HNFA 3GFJA 3CCQI 2K40A 4LJZF 1LFUP 3LL7A 1OCCH 2M1BA 1E0EA 2F4MB 4UV8A 1XD7A 2E60A 1KYZA 4RDUA 1P4WA 5FKLA 2VPRA 3OIQA 2R5YA 2LKSA 2CH0A 1R23A 3OSFA 1RPWA 2VC0A 1YI2I 2XASA 3QYFA 3H9GA 1MDMA 2ZB9A 3CTAA 4CCMA 1HKTA 5HS7A 4LMYA 1JKRC 3TO7A 3ESWB 1E3HA 2M45A 4BHCA 2VBXA 4ZYHA 4A6DA 3GYHX 4BUPA 2PJRA 4Z6YA 2COBA 4F52A 4RLQA 3BTIA 2M8EA 1HKSA 4EV0A 2ZXHA 1XMAA 2K9NA 4A3LJ 2CUJA 4CHUA 3UNGC 2M9HA 3F72A 2HS5A 3WGHA 3FHZA 2DA7A 4CCNA 2QWWA 1P7IA 2ZC2A 5IPAA 3HXLA 5TISC 1WWXA 1K61A 4KMFA 4DQ2A 2VN2A 3E1SA 4N4NB 4EGYA 5LRSA 4NB5A 3CF2A 1AU7A 1MZBA 1R4NB 3E5QA 4CYCB 2B63J 3L2UA 1WJFA 3Q9VA 3SYTA 2VLAA 3CCJI 1SFKA 2DA2A 3A1YA 1HDPA 5ICEA 1JUPA 3P9KA 1UAAA 2KMUA 2HOAA 4MGRA 5CLSA 1B4AA 3GEZA 1T33A 4H4KC 4AM3A 3CF5F 2H27A 5E20A 4JK1X 5B3SH 3QAHA 3FXQA 5K7HA 4A3IJ 5B5EC 1S5LC 3IL2A 1CF7A 1I39A 3SFZA 3HHGA 4UVCA 3QRFF 2ZXWH 3EQLF 4MHGA 4B8XA 3OSGA 5HLIA 3F22A 1O3RA 1TW2A 3VB2A 1NG6A 3SEQA 2DK8A 3T1BA 5JHUA 3F8FA 2VKVA 1IXCA 3ZMSA 3COAC 3QPTA 3I59B 2PEXA 5E3LA 3VODA 4WK8F 2OA4A 1YJWI 2IGKA 4XNFA 2VQGA 4MEXF 4ZDPA 2BY3A 4L5EA 1WH5A 2KIFA 4HEA2 2KQRA 1FMVA 3IC7A 3S16J 1MBFA 2CQXA 2PN6A 2HEOA 4E6KG 3L2VA 3ELKA 2MGQA 3AAFA 5J47A 2X48A 5DS9A 2FBKA 2OD5A 4L9TA 4DYQA 1SFXA 3Q5FA 4UB8C 3QOPA 5EGOB 4JX5A 1FC3A 5HLGA 2HPMA 3HBLA 1PDNC 2R7XA 4E4HA 3DFGA 1HXDA 1XSDA 3GTGJ 1F1ZA 3OYGA 3O8HA 2QQ8A 3GO5A 2UUZA 1O3SA 3DKXA 2R7DA 3F6VA 1S29A 3DU6A 1WGXA 3OS1A 2HYGD 2ZXIA 1OR7A 3KEOA 5C4JJ 2K3FA 4CICA 2MFZA 3LSTA 2MH2A 4HZFA 4N9HA 1GXQA 2FQ4A 1KQ0A 4D7NA 4N0BA 2EH3A 3SZPA 3B73A 1MBEA 3HRMA 1R5ID 4ENJA 3M8JA 2QQBA 3DWLE 3T8RA 4UNOA 1XS9A 2PJRB 1XMXA 3ZOBA 1G6NA 4MO7A 1QHGA 1FLIA 1PJRA 1BI1A 2ZMEC 4RGUA 1FYMA 1A04A 4O5VA 1A5JA 1I3AA 3E5XA 4I0BA 1OLTA 2YSRA 4RB3C 3A03A 4XK4A 2FU4A 1W5SA 2XAUA 1IUFA 2OJED 3HPHA 4XQFA 1BM9A 1ZR4A 5DD4A 4TV7A 2FOWA 1Z91A 4NC6A 1SFEA 2F5VA 3S15J 1O7LA 1RKTA 3QYEA 1XX5A 1OISA 3FISA 2QKLB 4J19A 4IOAF 4XLHA 1TC3C 2DFFA 3NRVA 1O4XA 2X0LA 2X1CA 4JOMA 2TCTA 5GAEJ 1ITYA 4P55A 3BR0A 2XV4S 4HV6A 1FOKA 4OIPF 3K4CA 4S05A 2X6XA 2R7UA 4ZDOA 2AS5F 2X1EA 4S04A 3KZYA 2RDPA 2XKOA 3ABLH 1S9HA 2IS6A 1KU3A 3I55I 3JRAA 3H1CA 2HVQA 2LC2A 4LLNA 1PYVA 4FCYA 3OYFA 4MEYF 2CS3A 2M3AA 1DDNA 4YIIA 4HAMA 2XPVA 2YUSA 2DQLA 1FTZA 2HYFA 2MABA 1Z05A 2BW3B 2EIKH 4II3A 2E2HJ 5M5WJ 3CZ6A 1L0OC 1Y6IA 4PJJA 4KN4X 3VSKA 4PZJA 2CUZA 1KGSA 3ZQIA 1IN8A 2DODA 4DGWB 2HOSA 2STWA 3UR3C 5KAFC 1WKMA 4AYBA 3I0TA 2EINH 2RN7A 3RIRA 1O7FA 1XSXA 3R60A 3ROUA 3K4NA 2QCOA 2V6CA 4AYBN 1UJ8A 2BEOA 2XF6A 4LK1F 5KK1A 4LLGF 4D5FA 4FTHA 1NG7A 4HRIA 3DBLB 4HW0A 2DDAA 4OIQF 2LYCA 2QLZA 2M0CA 2A07F 2YX4A 5E18F 3FMRA 1VQNI 3EUHA 4UHTA 3IAS2 1YW8A 4LGWA 3G4SI 3DBHB 3V8KA 2RGVA 1U9OA 3IV5A 3CJRB 3ISPA 4GRIA 1POGA 4L0ZB 5F08A 3CDHA 1QU3A 3F21A 2JWTA 1T2KA 3LSRA 4G7ZF 4KITB 2VONA 1SD6A 1JJ6C 1Z9CA 2XAHA 4NC8A 2BV6A 3X2QH 4A3BJ 2F5EA 2QSGX 3F23A 2MC3A 3K4MA 1WZ2A 2WV0A 1KONA 2KT0A 3KE2A 4EQQA 3ZQLA 3PM1A 2DYSH 3U9GA 4AWXB 2CWEA 2YU3A 4N4OB 1IDZA 4CUGA 4EEFG 1ZRDA 3TBIA 1FPQA 2X4HA 2VQLA 4HG2A 4XIDA 2JRTA 4UUSB 2JPCA 1L3LA 1BIBA 2M30A 2QEXI 2FNPA 3WTTC 2GXGA 2DK5A 4OAYA 1BI2A 3H9JA 1UG0A 3L2CA 1VQMI 3ZMDA 3R4KA 2V79A 3OYCA 2FA5A 2I8DA 3HZJA 3E0JB 2K02A 2NS8A 3DEUA 3ECHA 3KP2A 2CGPA 4IXAA 2R4GA 1B8IA 4M3DA 3CUQB 3WE3A 1UHWA 3ECOA 3LA3A 4FETA 3S1RJ 2H6CA 1ENHA 4FASD 2EJRA 2AO9A 2HFHA 5F0FA 4C3IJ 3J81Z 3J7AO 2JTVA 2M7AA 1IO2A 2JA8J 1IV6A 2NRAC 3MD2A 3HRUA 3JRBA 1X1AA 1Z7LA 2A61A 3RPUA 3LSPA 3DPLC 3LSIA 1TWGJ 1ETXA 2RV8A 2ETHA 3MCZA 4I99C 2LREA 4ESBA 2BHYA 4D7MA 2HDDA 2W48A 1ULYA 3H5AA 1HSTA 3G71I 4BXUA 5E79C 1XPXA 1C0WA 1Y56A 3W3CA 2Y0SA 4HQEA 2JRMA 4BJTA 1G3YA 4E7IA 4RGSA 1HCRA 4MFEA 4HDUA 2LTPA 3VYRB 4NC7A 5KNLA 1GHCA 3K0LA 3K1MA 2W25A 1BBYA 1V3FA 1EH7A 3BZ6A 1K78A 4D1QA 2KRHA 3C7JA 1VQPI 4Y13A 1IN5A 2DMNA 3I64A 4HV5A 2HXOA 4F3QA 1K4SA 4BQAA 2KZVA 2R7RA 2XDVA 3DPTA 5E17F 3RPUD 4XKVA 3JRGA 2I10A 3RSNA 2CFXA 2HYJA 2QYOA 3PO3J 1D5YA 5J40A 1YRNA 3OYAA 2VBYA 3M9AA 2A68F 1G3SA 4V2GA 2GWRA 2KISA 2M2EA 3F6OA 3W2WA 3PFIA 4XRSA 4I6ZA 1WH7A 1QZEA 3BY6A 2QSHX 5JR3A 3JRDA 2HXIA 1YW7A 1IJWC 3ASNH 4C3JJ 4WCGA 2DAOA 3R6SA 1F5TA 4BGDA 2E1OA 2B0LA 4IX7A 4B3XA 3NARA 4UVBA 1ZELA 1RETA 5B1AH 3J80Z 3DQVC 5BNGA 4B1RA 2HVSA 3DTIA 5HDGA 4Y7NJ 2E5ZA 3FBIB 4L5JA 2BGCA 3L09A 3CD6I 4G8XA 3QPSA 1ERDA 2GA2A 5LBQA 1OCPA 2E2JJ 1ZN2A 1TW3A 5K5OA 1R7JA 4GYGA 3WGIA 3ZPLA 3IP4B 1JT0A 3BCAA 2LDUA 5H20A 5KCMA 4CCLA 1F43A 3HSFA 4KT5C 2F5FA 3BC8A 4K2EA 2JA2A 1XDSA 4ZZLA 3BR3A 4HX8A 1MH4A 2NVXJ 3U2RA 2DOAA 1WPKA 1R36A 3GZNB 2M87A 3KP4A 1BW6A 3AKZA 4BNCA 3RKWA 1Q1VA 1XCBA 1LE8A 3A0BC 2L9SA 2MBFA 4FT8A 3M4OJ 4LITA 5D5WB 3N05A 2FUG2 1JT6A 2ELJA 2F2EA 2NS7A 4HQMA 3D5SC 3QODA 3RTRA 3I53A 1BIAA 2IVMA 3BG7A 2V9VA 1D5VA 1D1AA 3L2QA 2V1XA 2UXNA 1MMGA 1X4OA 1TTYA 1AHDP 4DJAA 1HLVA 5GPAA 5LEJA 1S72I 1IRZA 1VFCA 2ELHA 3HSEA 3F0CA 3I71A 1ETOA 1U5TC 4LD5A 5E3NA 3BJ6A 3L2RA 1IC8A 1KQ9A 3MAJA 3FHNA 3G73A 1LQ1A 1HBXG 3CJQB 2KDZA 1WSUA 4CSWA 2M7BA 3OYBA 2KIMA 4I0AA 3GTQJ 1DP3A 2DBBA 2G9WA 3O2PE 2MLKA 1IXRC 2PFBA 1IRXA 1R5HA 3RCOA 1K7AA 4A3EJ 5EEAA 2FEZA 2GOXB 1R1UA 1ZKGA 3SZGA 2IS1A 3MZYA 4BE2A 1VTNC 1SD5A 2KRFA 4MIMA 3G1LA 2DMTA 3JRHA 5J6XA 5DEQA 2BOLA 3IWZA 1XB4A 4H0EA 2CQKA 4CXFA 2HWVA 3KP7A 3QP5A 3GTMJ 2E36A 3A0HC 2A6HF 4L9JA 5LD2C 4V19K 3JRFA 3FM3A 1YOVB 4KIGA 4IHYA 2NOGA 3S17J 5D8KB 4YG2F 1GV2A 3GWZA 4BJ6C 3H0GJ 2ESNA 3OY9A 1XSVA 1J5YA 3BTJA 3J7YJ 4I2OA 1FOXA 1G59A 4F93B 1S6LA 2Y48A 4IQJA 3I3LA 3BTCA 4HNTA 2LKXA 2JT1A 1PUEE 3OYMA 1X1PA 1UCRA 3JREA 4M9XA 2VC1A 2VOOA 1LEAA 2EV5A 1XG1A 2OZ6A 2A5YB 3AL0C 2HVRA 1MBHA 2OF7A 2VI6A 3C18A 3QU6A 4OIRF 3G1OA 1WJDA 1R1TA 4Y33A 5GP9A 5CQGA 3MMYB 2X9DA 2OC6A 3CC4I 1T0FC 4DW6A 3O6BB 3WE2A 4F92B 2TRTA 2X85A 2XUBA 1WHUA 2KJBA 4XICA 4W97A 3ZQCA 3H3ZA 2ZJRF 1JHFA 2EZIA 3KP3A 2XSJC 1YQAA 2W57A 1GVDA 4XOTA 2XRNA 1ZLKA 4BXXJ 4QPOA 4HA8A 4FHTA 4ENKA 5D5UB 3BWGA 2XAQA 3HSRA 5J1UA 3IH3A 5D5XB 2MW8A 1BL0A 2Y2ZA 1SEUA 2Z9OA 2TDXA 2XF5A 2E7XA 4BEHA 3IKTA 3FZVA 2RNGA 3CCYA 4B43A 1JKOC 1HW1A 1N75A 1J09A 3KX2A 2P4WA 2ZNYA 4IF4A 2O5RA 4CCKA 4XN0A 2GA1A 2WTEA 3H9QA 4ZDLA 4J00A 4BACA 2DXIA 1P6RA 1OYIA 5L3DA 3HB9A 3CP8A 1GVJA 1V5EA 4WXDA 3VDXA 3EDPA 2CQNA 3HOZJ 3F8BA 3BG3A 3FIWA 2K9SA 5H6QA 1Y0UA 1EJ9A 1MGTA 1X2NA 3ZQQA 3P9CA 1B9NA 1X4PA 2EFPA 2COMA 1R5GA 2W84A 2CW8A 2KFDA 2RQQA 2HQRA 2WAFA 5TJJA 1O3QA 3H35A 3V7SA 3SEZA 1YG2A 2ZBKA 1X3UA 2EFNA 1FSEA 1JKQC 3PSIA 4FX4A 2ACJA 1VQKI 1Z21A 2K86A 4P96A 4B3AA 1U5TB 4QWQA 2C6YA 4QTRA 3DV8A 4HX4A 1Z3YA 2XPWA 4M3GA 2I5UA 3JCUC 4UB6C 2WY8Q 3ERMA 4EJUA 5DD8A 4UVAA 4X0GA 3BPXA 4NUBA 2YS9A 1JI8A 5EF6A 1I50J 4XLAA 3M8EA 5EG0B 1I5ZA 1D1CA 3A4CA 4OWRB 3HDDA 5FLVA 3JAMK 2ELKA 2JJ7A 3VWBA 2LBFA 4GGGA 2Y69H 1TBXA 4JX4A 1QA6A 2CG4A 2EZLA 2IGMA 3DF8A 3J7ZI 3RJPA 1BOAA 3PUBA 1LE8B 3H36A 3F9KA 2CO5A 3M7GA 3RYRA 4WF2A 1XTAA 2BYVE 4OMYA 2P6SA 4GO1A 4FISA 4YIFA 1DU6A 4LK0F 2PLYA 5C44J 5FLXK 1W7PA 5FRNA 1BW5A 1SVMA 5IP9J 2IXSA 4E70A 1JGSA 4WXHA 3ZMUA 4LLLA 1OYWA 1LJ9A 3JR9A 2DA6A 2AHQA 3BDDA 3V7CA 4A3DJ 2XF7A 3CDLA 2Z3YA 4CO8A 4P9FA 5ILVA 4PFPA 3P9IA 4EATA 5ICFA 1H8AC 2O61A 2DT6A 1V4RA 3E6DA 4O6JA 1X3WB 1ZK8A 3RYPA 2H1LA 2H8RA 3WHCA 2BBYA 3C2BA 3BPVA 1YS7A 2XKPA 4HX7A 2A05A 2EQRA 5D8LB 3ZMTA 2EILH 4RGXA 3TEDA 4QLCU 4M71A 2D2WA 2R7TA 1TZLA 1H0MA 3BR1A 3HIFA 1WVRA 1FP2A 1WQ2A 5DUIA 3R0JA 5C3EJ 1EF4A 2DPUA 2EA4A 1MNEA 3K6GA 3SDGA 4C9YA 3KYCB 1B59A 4II2A 1JHHA 1UG2A 5E3MA 2GIVA 4ESJA 2E7WA 4IJAA 5GAHJ 1FT9A 1LB2A 2WC2A 3HEFA 3MKZA 1LNWA 1YJ9I 2IGNA 1WJCA 2UZKA 2ICWG 1GXPA 2EB7A 3GZ5A 2DCEA 2DA3A 3HGGA 3M1CA 1BR4A 3GFLA 3WG7H 2OV7A 3KP5A 1GUUA 3RZOJ 2QF7A 3BR2A 1LDDA 3AG4H 2R0QC 1DP7P 1TQPA 2ECBA 1QVTA 1MMAA 1KU9A 4A6EA 2PI0A 1J7KA 1Q1HA 2EWNA 3MKLA 3E5UA 4EJVA 3SJMA 2PMZN 1MNDA 4F7ZA 4I09A 2XC7A 3DPUA 2EFOA 4LG0B 3I4PA 3OIOA 2R92J 2EV0A 3L2WA 3VFZA 3IUOA 2BXZA 2FSWA 3DP7A 4UUSA 1YIOA 1WCMJ 2HKOA 3FK7A 3K4KA 1RNLA 4FE4A 4B44A 3CO7C 2ZKZA 4EGZA 4QPQA 5K7FA 3TQNA 4M6XA 3C3WA 4A0XA 2FMYA 1WJ5A 1OCZH 1SVLA 2DTRA 2M8GX 1ONVA 4B09A 3N4MA 2HOTA 3OV8A 3FM5A 4C30A 4XRSG 2W24A 2VJJA 1LDJA 1QNTA 3S3NA 4RS8A 4EJWA 2EIMH 2EV6A 2NVQJ 2XROA 2OPTA 5IOYA 4IKFA 1ZHFA 2MSYA 5LHHA 1ZR2A 2QKMB 5J4YA 1AOYA 5M5YJ 2GZWA 2JPBA 2Z16A 5HLTA 3CMEI 2G0EA 2DYRH 3O3KA 3K4BA 1R58A 2HQNA 5F64A 3HOSA 4BQOA 4PCQA 4U0WA 3OYIA 4YFNF 4BE1A 3KP6A 1XGOA 1QRYA 5CKTA 5F04A 5A2QZ 2ZCWA 1P2FA 4PGGA 2LF8A 1H88C 5D6EA 1X1CA 4AD9A 2VL8A 3CCVI 2DU9A 2YPRA 2P7VB 2L2OA 3K7AJ 4LFUA 5FFXA 3GLXA 5IYCJ 2O8KA 1VQOI 1FOWA 1S7OA 1ODDA 3CC7I 5GTHC 1ZH5A 2V1NA 2ZJ2A 2DA1A 1J9IA 4BHBA 4KIBA 4IRGA 3SFIA 1YW9A 2VT3A 2XGDA 3IWFA 2H6BA 1X2MA 5F6FA 4HYEA 4BS9A 3JRIA 3DU5A 4NBQA 2RNJA 2AXTC 3TP3A 1B1BA 1K4TA 2XIGA 2EIJH 4JBAA 2PMHA 1JJ8C 3TMOA 3FKJA 1YS6A 4PUSA 4A3CJ 2FRHA 3S1QJ 1VQ8I 3WTUC 3GTJJ 1UZCA 4RAGA 1MMSA 5C4XJ 5EZGA 3BROA 2OQRA 1JTXA 2HZDA 1JUMA 4KNYA 5M3MJ 4OIOF 3OYJA 2VASA 3CCEI 4IRIA 2FD5A 1FEXA 2XAFA 4M9SA 2WBMA 3CMYA 5CVUA 4B48A 2PJPA 4M6VA 4P5OA 4Q48A 3W6JB 4Q4ZF 3WG9A 1YX5A 4XKCA 1A6IA 4Y4RA 3BTLA 4M3EA 5DTDA 1MDMB 1D8JA 4XLEA 4UUTA 3PNVA 3ZN0A 1KYWA 2J5OA 2ZMEA 2QBYB 2HI3A 2G7HA 2LP0A 4RLFA 3BLYA 1PVEA 4IQ4A 4IHXA 2E1CA 4KUMA 1MW7A 4XLPF 3QYBA 2XPUA 3OOUA 2ME6A 5FKNA 4J01A 2AQFA 5FJ8J 4OOIA 2L5QA 1X19A 5JHFA 3PO2J 1AA7A 3W6VA 2L4AA 3W2AA 1DQUA 2K85A 3LQRA 2DTZA 2UV1A 4CYDA 2ZJQF 4HSTA 1TNTA 3PNTA 3E6CC 2VJ5A 1TQIA 4ZC3A 2BVMA 4BYYA 3UKGA 2PMUA 2IW5A 1FWZA 1J2XA 2L7ZA 2LY9A 1HC8A 2P81A 2GM4A 1X1DA 4AVPA 4BXFA 4Q47A 1I6XA 3QP6A 4A3JJ 2IA1A 4UV9A 3CC2I 4I98B 2XGEA 2F4IA 4RBOA 4WXCA 3GFMA 2L7MP 5HODA 1XDUA 2FJ1A 2ID6A 2WA0A 3FX3A 2LMDA 5J8FA 3K70D 3JAMZ 1RESA 2V6EA 1X1BA 4I02A 2K9LA 1VQ6I 1DGWY 2XSDC 3CCMI 1K79A 4A93J 1W1WE 2JA7J 1DPRA 3MEXA 2HPIA 1I1SA 5IT9Z 2W4SA 1HF0A 1KA8A 4NQWB 3H5NA 3NWSA 2K4BA 4YEJA 2WAQN 1LDKB 1SFUA 1BA5A 1HA8A 2K7LA 4G94A 5DCMB 1OKRA 3LNQA 1ZGAA 3BP8A 4YIRX 4UUVA 2IJLA 3I58A 2JN6A 3B6CA 3IKVA 2X51A 2VE8A 3QPLA 5IYBJ 1T0FA 1T38A 5GAGJ 1BR2A 1HW5A 4D5CA 1MNMC 5CQEA 1A31A 3J7AY 4Y52J 1IUYA 1R00A 4DYRA 2Z33A 2ZSIB 1P4XA 4E7HA 2ADUA 2HZTA 4L9VA 2A69F 3WU1B 2NVUB 2DLLA 3PQJA 1SFOJ 2OUMA 3P5JA 5E1ZB 3BQYA 5M3FJ 1MBGA 3WGGA 1BC8C 1VQ4I 5E8GA 1I1GA 1IN6A 2MG4A 4CZZA 2E1MB 2E19A 1VQ7I 3F3XA 4XKWA 1BI3A 1R49A 2R7ZJ 5F0CA 4PGHA 4M6YA 1PUFB 3LMMA 4C2TA 1XGNA 2Z2SB 1NTCA 3KPHA 3TDUC 2X6YA 5EEHA 2IS2A 3DKYA 2GOMA 2L9VA 3RKQA 3IHUA 4C2MJ 2KIUA 3GFIA 2Y31A 2DMPA 3R61A 4DBQA 1W5CC 1ZLJA 5B66C 3KETA 4OAZA 2OZUA 4BAYA 2MH9A 1BR1A 4N9IA 1ZRCA 2JUGA 2EK5A 1GDTA 2P5KA 2RREA 2HR3A 2LVSA 2M4KA 4AIDA 1ZG1A 1B6AA 3TOBA 2L54A 2O03A 5CVVA 1WFXA 1EH8A 4X1EA 2E71A 4QIWN 3OS2A 3I5UA 4LB6B 2K5CA 2R93J 1REPC 1D0YA 5HS8A 4G6DA 1Y1WJ 3S32A 3WTWC 3FDYA 1WJAA 2HGCA 1MJ9A 2RC4A 3M07A 3CCSI 1YIJI 3HRTA 1QBJA 2K9MA 1IDYA 4XR6A 3AG3H 3S1MJ 3VSLA 2L02A 3PUFA 4RGRA 4OINF 1OFCX 5JI6A 3CP2A 3BOQA 3HKZN 4YFKF 3D5LA 5IT9K 5FKMA 1JXSA 4IHVA 2VQHA 3GLLA 5IT3A 3K2ZA 3K4JA 3TW7A 1P92A 3KYDB 1G3TA 3R0AA 4HNVA 1Y8QB 3QWLA 2LH9A 2KJCA 2BY0A 4E7KA 2OQGA 2DMQA 3KIOA 4CZCA 1WJEA 2B7EA 1YYVA 3MVPA 5EDNA 4G7HF 3GVAA 3K1PA 1HSJA 2Y9YA 5J3LA 5J1RA 2UWMA 2CJJA 4P1WA 4ASNA 2OTJI 1BI0A 2OCCH 4PSWA 2BY2A 1OCTC 3KEYA 2NS0A 5IY5H 1N78A 2WADA 1FNNA 5DCMA 3RZDJ 1D8KA 5JVGF 2JK3A 4DIQA 3OYHA 3BT9A 4KISA 5CVRA 1R1VA 3V8JA 2R7WA 4XRFA 3HC7A 3EUAA 3GXOA 2M5WA 5ILUA 2E5NA 4IPAA 2BY1A 2OU2A 4DYCA 3TOAA 4CCOA 3JSOA 1TWCJ 1SD7A 2VKHA 5LHGA 3EETA 2VJIA 3LSKA 1FTTA 1W36C 2NVYJ 3S3MA 5EGOA 4IVNA 5HDNA 1N25A 4RB1A 2M0MA 4XLNF 4HDVA 3T0YA 4A5NA 3BR6A 4L9NA 1IN4A 5D4SA 2FE3A 3DEEA 1Z3XA 5IYDJ 2X6WA 5IOZA 2O8XA 4YELA 2JUCA 4PSXA 4MTDA 1P4AA 2LFBA 1AWCA 1QO0D 2A6TA 3C2GA 2IPQX 2VOPA 1X3ZB 2QVOA 1EA3A 4E7ZA 3OYEA 1LVKA 3GMEA 2DT5A 2FBIA 2XRLA 4IZZA 3ONQA 5F1RA 4JP0A 5K1YA 3EYIA 3ULQB 3EPZA 2BHZA 4FQGA 1W36D 1H89C 2EA2A 2GIZA 2LNBA 4F91B 3LFKA 1D3YA 4OU0A 2J5PA 2BW3A 2FQ3A 2NXNB 3HJEA 2Q8KA 4U7BA 3I54A 2EBIA 3VYTB 2UXXA 3GTLJ 2XAJA 1XGSA 2FOKA 1RI7A 2KLOA 2R7SA 4BBSJ 1R6RA 2VBWA 3A02A 2XGCA 5ILSA 3SQNA 3TL4X 1EH6A 4Y15A 1OQYA 4RAFA 4LB5A 4KYWA 1F36A 1W7PD 4FE7A 1QHHD 2OTLI 3DEWA 1T56A 3E7LA 1ZTRA 1FJLA 1YITI 3HG9A 1YHQI 5FROA 2YR2A 4NDLA 2FF4A 2KIQA 2IGOA 5LGNA 4IHSA 3KCCA 1Z1DA 1T8IA 3ZQHA 4NHJA 4AIJA 1T39A 2JSCA 5L3FA 5HVQC 2ESHA 1LFPA 1IRFA 1SD4A 2CUEA 5CVIA 4S0HB 3C2HA 1OYYA 3FXRA 2GXBA 4B47A 3BZKA 3I4NJ 1TWFJ 2MLGA 4ETSA 1B9MA 5JLWA 4A3GJ 2DFEA 2PBIA 5HOOA 1IN7A 1BC7C 1B72B 2CSOA 1RUNA 3WODF 3A01B 1U9NA 4XRMA 3CESA 4ESFA 1Z7UA 2H8WA 5KVRA 1ZYRF 4YRVA 1YJNI 1T95A 3EYYA 1J75A 1TNSA 1MH3A 4PJNA 2CV0A 1MMNA 5H2FC 2DA5A 2F5CA 3OMYA 3L1PA 2DOFA 4BJ5C 2L9RA 2R5ZB 3WTXC 5F0HA 1U2WA 3SXYA 3V42A 2Z99A 4HF2A 1XGMA 3GF2A 1G2HA 4EVIA 1QPIA 3HOWJ 2HOEA 1LKXA 4LIUA 4U7DA 5HDKA 1QGPA 1LEBA 1VI0A 2F48A 4LG3A 3DCFA 2V4JC 3TGNA 1YRNB 1R9TJ 1T6SA 3FXUA 3K4LA 3IRQA 4EM0B 1VQ5I 3FXJA 2FXAA 1RIOH 4PJ0C 4BBRJ 5GTIC 4EJTA 4BL0B 1LVAA 1O3TA 4GDFA 2LBFB 1IRGA 3CO6C 2VBZA 4LG0A 1D0XA 2RAEA 5L3CA 2JQ7A 1Z6TA 3RKYA 5K7ZA 3MWMA 3BR5A 1RUOA 1U3EM 4XKBA 3OOPA 2ZJPF 4U88A 4GFBA 1EKEA 3H3UA 3OYLA 2D5VA 4G6QA 5E1XA 5H6RA 1HKQA 2MYSA 4V2FA 4BY1J 3MQ0A 2LKPA 2L0KA 3ZQ7A 3GTPJ 2PG4A 2R3SA 3LSHA 2ISYA 1ZGWA 3MZ8A 4HLYA 5DCFA 2IRFG 1K83J 1Z77A 3VOEA 2IS4A 2VJ4A 3GTKJ 2F6CA 4E7LA 3S2DJ 5EG0A 3K10A 5DYMA 4C2UA 4A3MJ 1ETYA 4BH9A 3HOXJ 3ZRGA 4HF0A 1FOYA 1FYKA 5FKOA 1SVOA 2O6GE 4I76A 4JQFA 1G4DA 4M9ZA 2OBPA 1YE9A 5E8IA 5DM7F 2KKOA 4BY7J 1OJLA 4XSXF 4WWCA 1DU0A 2DDBA 4U0YA 3G3ZA 4A69C 3K69A 4CYCA 3C1DA 3FXOA 2NOJB 3GCMA 2IBDA 3A2KA 3TO9A 1IG7A 3K70C 4UY8I 3H5RA 2KZGA 2M4GA 4M73A 1DUXC 1TT0A 3KLNA 1P9QC 4EM1A 3GW2A 4ZYDA 1W0UA 1X58A 3AG2H 4Y17A 3S8PA 4I7HA 4L5IA 1CGPA 1IXSB 2H94A 4DZJA 4KA4A 1A36A 4KICA 1PP7U 5JLXA 2VUMJ 1MIJA 3PFYA 1O57A 2VKDA 1WRJA 3OR2C 5L3EA 1LUJB 2ZSHB 1TT5B 3W2VA 1SAXA 3BG5A 2P6TA 2Q1ZB 3ZMZA 3JRCA 1JKPC 1LFBA 3IH2A 2NAZA 2ZXJA 2F5DA 3LSMA 5KHDA 2R5YB 1UFMA 2PQ8A 4AU7A 3V8LA 1ETKA 4KDPA 2W1OA 2P5VA 3HHHA 5DDGA 2FBHA 3OL3A 1IAWA 3ASOH 3WU0A 3S1NJ 2WAQA 2NNNA 1ORKA 2V1UA 2HDWA 4IRHA 2P7CB 1JTYA 3RDIA 4IL6C 1MSFC 2QENA 2CFOA 4ABZA 3M3YJ 2EPFA 2RKHA 2GLOA 2V7FA 1YLFA 2VQCA 3RQIA 2KRCA 1XMKA 2KL4A 4XLCA 5HNHA 1W5TA 3QPHA 2YX7A 3D0SA 2LF7A 3DXJF 5AONA 2WB1N 4DZPA 2VODA 5D4RA 2EFWA 3LSGA 1XC5A 3JTGA 4AUXA 4P9UA 5LFAA 1MSEC 5EJCA 1MKMA 2GAUA 3LA2A 4KMUX 3MN2A 3SDBA 2CW7A 1KZHA 4IO9F 1U78A 2W85A 6PAXA 2HDCA 5BPDA 4D0PA 4WX9A 5FD5A 3BCBA 3QOEA 5ICCA 3PL8A 3LFUA 4JYKA 5BMZA 4XL9A 1F9NA 3NAUA 1VZ0A 2W00A 1BJZA 1F4KA 3CCLI 4BDZA 1FX7A 2W7NA 3HOUJ 3HUGA 3DLAA 1RRJA 1T98A 3AFHA 4XMYA 1ON1A 4XM3A 2ME0A 3GBGA 4IHWA 3BJAA 2MA3A 4DNCA 2CV1A 4Y3OA 4ZYGA 4AIHA 4XLFA 4RB0A 5FB2A 5FO5A 2K27A 1RZ4A 4C3HJ 1P7JA 2Y0MA 4FX0A 2VT2A 1RR7A 2LR8A 1IGNA 2IEKA 1WJBA 1U8BA 1TQMA 3J80K 1W0TA 3I9V2 1GLNA 1R4MB 2XB5A 2BXYA 2BVLA 3LQQA 2X6OA 1A35A 1KU7A 4G6TB 2ZFWA 3CMMA 4LOCA 2VE9A 2HNHA 1U5TA 4KIFA 5FKKA 4CGZA 1HOMA 4NNJA 2P8TA 1R22A 1IV8A 2QQ9A 2V9KA 1KQ8A 3ABMH 4F55A 1QQIA 1APLC 1ZG3A 3B02A 2YU9J 2P0WA 3OS0A 5J4VA 1ZGJA 4MFDA 3IRRA 2DW4A 3OIPA 3CUQC 4A2UA 2Z5UA 4B4CA 1BN5A 3GX4X 1CF7B 1Y8RB 3SHFA 2WWYA 2CQQA 3BJOA 3LSJA 4ENNA 3ZQFA 2XVCA 4ITVA 2CU7A 1FP1D 2HQ5A 1FIPA 3HOYJ 1FY7A 2DQRA 3E6MA 1TWAJ 2DFIA 5E3OA 3ABTA 3I4MJ 1G3WA 3N97A 4PJLA 4U0VA 3WU2C 3L7WA 2WY7Q 1N77A 4A12A 4BQNA 4UXNA 1FBUA 3HUGB 5HLHA 2LLKA 2V1DA 3EUHC 1TLHB 5LHIA 3E6BA 1GV5A 3HPGA 1V5GA 4HLXA 2V9PA 3HTSB 1R71A 2CV2A 2VPLA 5FGMA 2DI3A 1FIAA 1ZREA 2IAIA 2DPDA 4W1UA 1PUFA 2XGXA 3OR1C 1WI9A 4GCVA 3JSPA 3DTKA 2R5ZA 3G6EI 2FX0A 2LSOA 2DA4A 4BDYA 2HTSA 2Q0OA 5DV5A 4PK4A 2O3FA 4ENMA 1RR8C 3FBNB 5DUKA 2QQAA 3ABUA 5ICGA 4ZYAA 2KP6A 1HQCA 1RC9A 3QQAA 4QSHA 4HPQA 3MKYB 2JVGA 1STZA 1XN7A 1SAUA 5D6FA 3LWFA 3VPRA 1ZG5A 1A6QA 4AVZA 1HW2A 2LOOA 5TGTA 3JW4A 1W7PB 3LAJA 5CJ9A 3FMSA 3CCRI 2GQQA 2QGUA 1ETVA 4PJMA 2K3PA 1UHSA 1SMTA 4R79A 2Y75A 2OAZA 4U87A 2GBYA 3S3OA 3ZQGA 3KZIC 3RPQA 3T8TA 4KFCA 3WTZA 2DT7B 5GADJ 3ABKH 1UHMA 2P5LC 5BOXA 2STTA 3A01A 2O9LA 3M1EA 1FSHA 2IA0A 2RVCA 4YFXF 1OCRH 2Y30A 5AIPA 3H3VK 5LEKA 3E3VA 1YX3A 1SC7A 2KPMA 2R7VA 5LGTA 3U21A 1MJBA 1TWHJ 3REOA 3CLOA 4M3BA 1H9GA 1AKHB 1NK3P 3D5RC 2D1VA 2CRGA 3L00A 2ECCA 3I56I 3ZGKA 2Q2EB 4A3FJ 4E7SA 1YTYA 4R1HA 3TKYA 2CUFA 3WTYC 3D1NI 4HSRA 1KU2A 2O7OA 3E97A 1JE8A 1OPCA 3FMQA 3ZCOA 4G7OF 4ZH4F 5BQTA 5K5QA 1T08B 2JSPA 4ON0A 1I3QJ 1VNDA 3B6AA 2DJNA 2L3DA 3M8FA 5EEGA 1S7AA 4XBFA 2L4MA 3U1KA 1FZPB 3ZMVA 5LRRA 2E1MC 3QU3A 1S8NA 3FF5A 2VKEA 3KZZA 3K2AA 2WAEA 3NWTA 3T5XA 3EUKL 3OYNA 4A5MA 2LRDA 4OMZA 5LLQA 2LY1A 2VXDA 4JX6A 4CH7A 5IP7J 5D5VB 3WTVC 2XB0X 2A5WA 4A0ZA 3TP0A 2VB6A 4IOCF 3HYIA 3LA7A 3CDIA 3OYDA 1VQ9I 3PSFA 2MC4A 4RB2C 2D1HA 1QPMA 2CQ7A 2QA4I 1G8XA 2IT0A 5M5XJ 3JTHA 3CJNA 3HRSA 4BEHB 2DN0A 4AC0A 4KT6A 2Y9ZA 2JZYA 2PX9A 4BE0A 1NK2P 5DM6F 1ETWA 4BU2A 2DO7A 2DOEA 4E7JA 1IZ1A 3HTUA 5J8CA 3KFWX 3BZCA 3F8CA 4XSZF 3IH4A 1DPUA 5FLXZ 3K9TA 4RMNA 3W6KB 3MZHA 1J59A 3AL0B 5A2QK 2ZO4A 3F8NA 2XHKA 5CYVA 5FD6A 2BZTA 4BHPA 3MKWB 3VYSB 4L18B 1UB9A 1FBSA 3FXLA 2HKXA 2M34A 4NQWA 1ZQ3P 4MTEA 2LY2A 2L01A 1Z67A 5F27A 5IP6A 3FXMA 1JUSA 1XCVA 3PNYA 1BJAA 1QZZA 5B1BH 1VF9A 3RI4A 3ERED 4RM3A 1MD0A 1M1EB 2HQAA 3U1DA 3BG9A 4HF1A 4MLOA 4MNUA 2R7QA 5E1WA 4BKXA 2QM3A 4BQQA 2Q2EA 2ZNZA 1ACIA 3FXKA 3Q3SA 3LAPA 1QVUA 3TO6A 3LOCA 2D45A 4I01A 1FMWA 4CDGA 2QZ8A 4D9JA 4X6AJ 4ANJA 1I27A 4XOPA 5CPRB 5TRDA 1LPQA 5L3BA 4PFOA 2ISZA 4RM2A 9ANTA 2MD5A 4DBRA 4GYIA 4M72A 4CA0A 2EZHA 3G1MA 4RAYA 4XORA 1USTA 3VYUB 2AXLA 3Q9SA 2AQEA 4XN3A 1K78B 3ZR8X 1UMQA 2DJIA 4IEJA 5BPIA 4IHTA 3FK6A 5AIQA 2XAGA 3PQKA 4ZTJA 3DBRB 2NNYA 3CCUI 4RA2A 1U0JA 2BE5F 2LG4A 1I6HJ 1MJAA 3L9FA 1GT0C 1Z0XA 2EFQA 3NEUA 1OMIA 4ZZDA 2LD5A 3AG1H 2K4JA 3HOVJ 4KJZA 5JVTA 3H92A 4A3KJ 4GXOA 3CUQA 2X1DA 2VXZA 5J1YA 3HM5A 1ON2A 1VQLI 3ZP5A 5ERIA 2O0YA 1MBKA 3V4GA 2KDOA 5L3GA 1NHAA 3Q0WA 1QZYA 1E2XA 1HDDC 1D0ZA 1Y1VJ 3TDZC 1V55H 2LK2A 2QSFX 2DFHA 1PP8F 3S2WA 3DKWA 1K6OA 1ZRFA 4DOZA 2JMWA 2F4OB 3WHBA 3CJTB 3OYKA 1B72A 2ID3A 1BOBA 1AKHA 4G12A 3S2HJ 2VIXA 2H1KA 5F1JA 1UELB 5ED4A 2DMUA 1V54H 5CVJA 1SANA 5HS9A 2CW0F 2L9NA 2IP2A 2OCEA 2A3SA 4LIVA 3RQ4A 3OL4A 1YO5C 3GTOJ 4CCJA 3Q0UA 5FFZA 5FLMJ 1U6GA 1E17A 3CMAI 1CQTA 3PJRA 3O8GA 1DGRM 4ZTFA 3GUDA 1ETQA 1OR7C 1U8RA 3H0DA 3ZN1A 2R7FA 2L7FP 1B8IB 4KN7X 3G2BA 2N8GA 3KYLA 2HTJA 1YFHA 3RKXA 1NH3A 1K6YA 5K5RA 2FNAA 4O3MA 2ZFUA 4PDKA 2Y0SN 5GPCA 1RKWA 1D1BA 4M74A 1MBJA 3ML6A 2E35A 3HOTA 2HU9A 3J81K 5KAIC 2H09A 2KHMA 1IF1A 4Q5SF 1EV7A 1Z6RA 3FWEA 1ZAOA 2W82A 3CLQA 4RAZA 4M3FA 4L0YB 5LGUA 2V26A 1JGGA 1FBQA 4EJOA 4HBLA 1S7EA 4ZYEA 3IAM2 2IA2A 3NQOA 4ZJZA 2E2IJ 3HL2A 3PIOF 5JFRA 2CMPA 2K9QA 3CUOA 4HNUA 3FKIJ 2FMLA 1S3JA 3OWTA 2G7UA 3BQZA 3TW6A 2ZMEB 2QBYA 4MQ9F 5FRMA 1H9TA 1E3PA 5BS6A 4EMSA 1W4MA
chains in the Genus database with same CATH topology
3K1NA 4AIKA 2CYYA 3GZ6A 3P7NA 1ZARA 3KEQA 1USSA 2A6EF 3KLOA 1SMYF 3F8MA 2RQPA 2QUFA 1J0RA 4G9YA 3SZTA 3VEPA 3V7RA 4R8HA 4HOBA 4MQVA 3MFKA 1FYLA 2E1NA 4Z2YA 4A0YA 4EM2A 3WTSC 2NYXA 3I59A 1IW7F 3GFJA 4LJZF 2M1BA 4UV8A 1XD7A 1KYZA 1P4WA 1R23A 2VC0A 2XASA 1MDMA 3CTAA 1HKTA 5HS7A 4LMYA 3TO7A 2M45A 3GYHX 4BHCA 2VBXA 4ZYHA 4A6DA 2M8EA 1HKSA 4EV0A 1XMAA 4CHUA 3F72A 2HS5A 3WGHA 3FHZA 2QWWA 1WWXA 4KMFA 4DQ2A 2VN2A 4EGYA 5LRSA 4NB5A 1MZBA 3E5QA 3Q9VA 5ICEA 3P9KA 4MGRA 5CLSA 1B4AA 3GEZA 2H27A 5E20A 4JK1X 3QAHA 3FXQA 3IL2A 1CF7A 3SFZA 3HHGA 4UVCA 3QRFF 3EQLF 4MHGA 4B8XA 5HLIA 3F22A 1O3RA 1TW2A 3VB2A 2DK8A 3T1BA 5JHUA 3F8FA 1IXCA 3ZMSA 3COAC 3QPTA 3I59B 2PEXA 3VODA 4WK8F 2OA4A 4MEXF 2KIFA 3IC7A 2PN6A 2HEOA 3ELKA 3AAFA 2FBKA 2OD5A 4L9TA 1SFXA 3Q5FA 3QOPA 1FC3A 5HLGA 1PDNC 1XSDA 3DFGA 1HXDA 1F1ZA 3GO5A 1O3SA 2R7DA 3F6VA 1S29A 2HYGD 1OR7A 3KEOA 4CICA 3LSTA 2MH2A 4HZFA 4N9HA 1GXQA 1KQ0A 4N0BA 3SZPA 3B73A 3HRMA 4ENJA 2QQBA 3T8RA 4UNOA 1G6NA 1FLIA 1BI1A 1FYMA 4RGUA 1A04A 4O5VA 3E5XA 4I0BA 2YSRA 4RB3C 2FU4A 1W5SA 1BM9A 5DD4A 4TV7A 1Z91A 1SFEA 1O7LA 3NRVA 2X0LA 4P55A 2XV4S 4HV6A 1FOKA 4OIPF 4S05A 2AS5F 4S04A 3KZYA 2RDPA 2XKOA 1KU3A 4LLNA 4MEYF 1DDNA 4YIIA 4HAMA 2DQLA 2HYFA 1Z05A 1L0OC 4KN4X 4PZJA 1KGSA 1IN8A 2STWA 1WKMA 3I0TA 2RN7A 3RIRA 1O7FA 1XSXA 3R60A 3ROUA 2V6CA 2BEOA 5KK1A 4LK1F 4LLGF 4HW0A 4OIQF 2QLZA 2A07F 2YX4A 5E18F 3FMRA 3EUHA 4UHTA 1YW8A 4LGWA 3V8KA 2RGVA 3ISPA 4L0ZB 3CDHA 3F21A 1T2KA 4G7ZF 2VONA 1SD6A 1Z9CA 2XAHA 2BV6A 2F5EA 3F23A 2MC3A 2WV0A 3KE2A 4EQQA 3U9GA 4AWXB 2CWEA 2YU3A 1ZRDA 1FPQA 2X4HA 2JRTA 2JPCA 1L3LA 1BIBA 2M30A 2FNPA 3WTTC 2GXGA 2DK5A 1BI2A 3L2CA 3ZMDA 3R4KA 2V79A 2FA5A 2K02A 3DEUA 3ECHA 3KP2A 2CGPA 4IXAA 3CUQB 3WE3A 1UHWA 3ECOA 3LA3A 2H6CA 2EJRA 2HFHA 3J81Z 3J7AO 2JTVA 2NRAC 3HRUA 2A61A 3RPUA 3DPLC 2RV8A 2ETHA 3MCZA 4ESBA 1ULYA 1HSTA 4BXUA 1C0WA 4HQEA 1G3YA 4RGSA 4HDUA 1GHCA 3K0LA 3K1MA 2W25A 1BBYA 1V3FA 1EH7A 3BZ6A 1K78A 3C7JA 4Y13A 1IN5A 3I64A 4HV5A 4BQAA 3DPTA 5E17F 2CFXA 2QYOA 2VBYA 3M9AA 2A68F 1G3SA 2GWRA 3F6OA 3PFIA 3BY6A 5JR3A 1YW7A 4WCGA 2DAOA 3R6SA 1F5TA 2B0LA 4UVBA 3J80Z 3DQVC 5HDGA 4L5JA 2BGCA 3L09A 4G8XA 5LBQA 2GA2A 1ZN2A 1TW3A 5K5OA 1R7JA 4GYGA 3WGIA 3ZPLA 2LDUA 5H20A 3HSFA 4KT5C 2F5FA 4K2EA 1XDSA 4ZZLA 4HX8A 3U2RA 1R36A 2M87A 3KP4A 4BNCA 3RKWA 1XCBA 4FT8A 2MBFA 5D5WB 2F2EA 4HQMA 3RTRA 3I53A 1BIAA 2IVMA 2V9VA 1D5VA 2V1XA 2UXNA 1TTYA 5LEJA 2ELHA 3HSEA 3I71A 1U5TC 4LD5A 3BJ6A 1KQ9A 3MAJA 1LQ1A 3G73A 1HBXG 1WSUA 2KIMA 4I0AA 2DBBA 2G9WA 3O2PE 2MLKA 1IXRC 2PFBA 1R5HA 1K7AA 2FEZA 1R1UA 3MZYA 1VTNC 1SD5A 2KRFA 5J6XA 5DEQA 3IWZA 1XB4A 4H0EA 2CQKA 4CXFA 2HWVA 3KP7A 3QP5A 2A6HF 4L9JA 3FM3A 4KIGA 5D8KB 4YG2F 3GWZA 2ESNA 1XSVA 1J5YA 4I2OA 1S6LA 2Y48A 2JT1A 1PUEE 1UCRA 4M9XA 2VC1A 2VOOA 1LEAA 2EV5A 2OZ6A 2A5YB 3QU6A 3C18A 4OIRF 1R1TA 3O6BB 3WE2A 2XUBA 2KJBA 3H3ZA 1JHFA 3KP3A 1YQAA 2W57A 1ZLKA 2XRNA 4HA8A 4FHTA 4ENKA 5D5UB 3BWGA 2XAQA 3HSRA 5D5XB 2Z9OA 2TDXA 2E7XA 3IKTA 3FZVA 1HW1A 2P4WA 2ZNYA 4IF4A 2GA1A 2WTEA 1P6RA 1OYIA 5L3DA 1GVJA 4WXDA 3EDPA 3F8BA 5H6QA 1Y0UA 1MGTA 3P9CA 1B9NA 2EFPA 2COMA 1R5GA 2W84A 2HQRA 5TJJA 1O3QA 3V7SA 1YG2A 2ZBKA 1X3UA 2EFNA 1FSEA 4FX4A 2ACJA 2K86A 4P96A 2C6YA 1U5TB 4QWQA 3DV8A 4HX4A 4EJUA 5DD8A 4UVAA 3BPXA 3M8EA 1I5ZA 3JAMK 4GGGA 1TBXA 2CG4A 3DF8A 3RJPA 1BOAA 2CO5A 3M7GA 3RYRA 4WF2A 2BYVE 4OMYA 2P6SA 4GO1A 4YIFA 4LK0F 2PLYA 5FLXK 1W7PA 4E70A 1JGSA 4WXHA 3ZMUA 4LLLA 1OYWA 1LJ9A 3BDDA 3V7CA 2Z3YA 4CO8A 4P9FA 5ILVA 3P9IA 5ICFA 2O61A 1V4RA 3E6DA 4O6JA 3RYPA 2BBYA 3BPVA 1YS7A 2XKPA 4HX7A 5D8LB 3ZMTA 4RGXA 4QLCU 4M71A 2D2WA 1H0MA 3HIFA 1FP2A 1WQ2A 5DUIA 3R0JA 2DPUA 2EA4A 1B59A 1JHHA 2GIVA 4ESJA 2E7WA 4IJAA 1FT9A 1LB2A 2WC2A 1LNWA 2UZKA 1GXPA 2EB7A 3GZ5A 3GFLA 3KP5A 1DP7P 1LDDA 1TQPA 1KU9A 4A6EA 2PI0A 1J7KA 1Q1HA 2EWNA 3E5UA 4EJVA 4F7ZA 4I09A 2EFOA 4LG0B 3I4PA 2EV0A 3VFZA 2FSWA 3DP7A 1YIOA 2HKOA 1RNLA 3CO7C 2ZKZA 4EGZA 3TQNA 4M6XA 3C3WA 4A0XA 2FMYA 2DTRA 3N4MA 1ONVA 4B09A 3OV8A 3FM5A 2W24A 1LDJA 1QNTA 4RS8A 4EJWA 2EV6A 2XROA 1ZHFA 5LHHA 1AOYA 2GZWA 2JPBA 3O3KA 1R58A 2HQNA 5F64A 3HOSA 4PCQA 4U0WA 4YFNF 3KP6A 1XGOA 5A2QZ 2ZCWA 1P2FA 4PGGA 2LF8A 5D6EA 4AD9A 2DU9A 2YPRA 2P7VB 5FFXA 4LFUA 3GLXA 1S7OA 1ODDA 1ZH5A 2ZJ2A 1J9IA 4BHBA 4KIBA 4IRGA 1YW9A 2VT3A 3IWFA 2H6BA 5F6FA 4HYEA 2RNJA 1B1BA 2XIGA 4JBAA 2PMHA 1YS6A 2FRHA 3WTUC 3BROA 2OQRA 4KNYA 4OIOF 4IRIA 2XAFA 4M9SA 2PJPA 5CVUA 4P5OA 4Q48A 3W6JB 4Q4ZF 3WG9A 1D8JA 1MDMB 3ZN0A 1KYWA 2J5OA 2ZMEA 2QBYB 2G7HA 2E1CA 4KUMA 4XLPF 4OOIA 2L4AA 3LQRA 4CYDA 1TNTA 3E6CC 1TQIA 4BYYA 2PMUA 2IW5A 1FWZA 1J2XA 4AVPA 4Q47A 1I6XA 3QP6A 2IA1A 4UV9A 4I98B 4WXCA 3GFMA 1XDUA 5J8FA 3FX3A 3JAMZ 4I02A 1K79A 1DPRA 3MEXA 1I1SA 5IT9Z 1KA8A 2K4BA 1LDKB 1SFUA 2K7LA 4G94A 5DCMB 1OKRA 1ZGAA 3BP8A 4UUVA 2IJLA 3I58A 3IKVA 2VE8A 1T38A 1T0FA 1HW5A 1IUYA 1R00A 2Z33A 1P4XA 2ADUA 2HZTA 4L9VA 2A69F 3WU1B 2DLLA 3PQJA 5E1ZB 3WGGA 1BC8C 5E8GA 1I1GA 1IN6A 4CZZA 3F3XA 1BI3A 4PGHA 4M6YA 1XGNA 3TDUC 5EEHA 3IHUA 2KIUA 3GFIA 3R61A 1ZLJA 3KETA 2OZUA 4BAYA 2MH9A 4N9IA 1ZRCA 2EK5A 2P5KA 2HR3A 1ZG1A 1B6AA 3TOBA 2L54A 2O03A 5CVVA 1EH8A 3I5UA 4LB6B 1REPC 5HS8A 4G6DA 3WTWC 2HGCA 1MJ9A 2RC4A 3HRTA 1QBJA 2L02A 4RGRA 4OINF 5JI6A 3BOQA 4YFKF 3D5LA 5IT9K 1JXSA 5IT3A 3K2ZA 1P92A 1G3TA 3R0AA 2KJCA 2OQGA 1YYVA 4G7HF 3GVAA 3K1PA 1HSJA 2UWMA 4ASNA 1BI0A 2NS0A 1FNNA 5DCMA 1D8KA 5CVRA 1R1VA 3V8JA 4XRFA 3GXOA 2M5WA 5ILUA 4IPAA 2OU2A 3JSOA 3TOAA 1SD7A 5LHGA 3EETA 4IVNA 5HDNA 4RB1A 4XLNF 4HDVA 3T0YA 4A5NA 4L9NA 1IN4A 5D4SA 2FE3A 2O8XA 4MTDA 1P4AA 1AWCA 1QO0D 2IPQX 2VOPA 2QVOA 2DT5A 2FBIA 5F1RA 3EYIA 5K1YA 3ULQB 2EA2A 2LNBA 3LFKA 1D3YA 4OU0A 2J5PA 2FQ3A 2Q8KA 4U7BA 3I54A 2UXXA 2XAJA 1XGSA 2FOKA 1RI7A 5ILSA 2VBWA 3SQNA 1EH6A 4Y15A 4LB5A 4KYWA 1W7PD 2YR2A 2FF4A 5LGNA 4IHSA 3KCCA 1Z1DA 4NHJA 4AIJA 1T39A 2JSCA 5L3FA 5HVQC 2ESHA 1IRFA 1SD4A 5CVIA 1OYYA 3FXRA 2GXBA 2MLGA 4ETSA 1B9MA 2PBIA 5HOOA 1IN7A 1BC7C 2CSOA 1RUNA 3WODF 4ESFA 1Z7UA 5KVRA 1ZYRF 3EYYA 1J75A 1TNSA 2F5CA 3WTXC 1U2WA 3SXYA 2Z99A 4HF2A 1XGMA 3GF2A 4EVIA 2HOEA 4U7DA 5HDKA 1QGPA 1LEBA 3TGNA 1T6SA 3FXUA 3IRQA 4EM0B 2FXAA 1RIOH 4EJTA 1LVAA 1O3TA 1IRGA 3CO6C 2VBZA 4LG0A 5L3CA 1Z6TA 3RKYA 3MWMA 1RUOA 1U3EM 3OOPA 4U88A 3H3UA 4G6QA 5E1XA 5H6RA 1HKQA 3MQ0A 2LKPA 3ZQ7A 2PG4A 2R3SA 2ISYA 4HLYA 5DCFA 2IRFG 3VOEA 5DYMA 4BH9A 4HF0A 1FYKA 2O6GE 4JQFA 1G4DA 4M9ZA 2OBPA 5E8IA 2KKOA 4WWCA 4XSXF 4U0YA 3G3ZA 3K69A 3C1DA 3TO9A 4M73A 1DUXC 3KLNA 4EM1A 3GW2A 4ZYDA 4Y17A 4I7HA 4L5IA 1CGPA 1IXSB 2H94A 4KA4A 4KICA 1PP7U 1O57A 1WRJA 5L3EA 1SAXA 2P6TA 3ZMZA 2NAZA 2ZXJA 2F5DA 1UFMA 2PQ8A 3V8LA 4KDPA 2P5VA 3HHHA 5DDGA 2FBHA 1IAWA 3WU0A 2NNNA 2V1UA 4IRHA 2P7CB 3RDIA 2QENA 2RKHA 1YLFA 1XMKA 1W5TA 3QPHA 2YX7A 3D0SA 2LF7A 3DXJF 5AONA 2VODA 5D4RA 2EFWA 3JTGA 4P9UA 1MKMA 2GAUA 3LA2A 4KMUX 6PAXA 1U78A 2W85A 2HDCA 5BPDA 4D0PA 4WX9A 5FD5A 5ICCA 5BMZA 1F9NA 1F4KA 1FX7A 3HUGA 1T98A 1ON1A 3BJAA 2MA3A 4DNCA 4ZYGA 4AIHA 4RB0A 5FB2A 5FO5A 2K27A 1RZ4A 2Y0MA 4FX0A 2VT2A 1TQMA 3J80K 3LQQA 1KU7A 2ZFWA 2VE9A 1U5TA 4KIFA 4CGZA 2P8TA 1R22A 2QQ9A 1KQ8A 1QQIA 1ZG3A 3B02A 1ZGJA 3IRRA 2DW4A 3CUQC 4A2UA 2Z5UA 1BN5A 3GX4X 1CF7B 3SHFA 2WWYA 3BJOA 4ENNA 2XVCA 1FP1D 1FY7A 2DQRA 3E6MA 2DFIA 3ABTA 1G3WA 3N97A 4U0VA 3L7WA 4A12A 4UXNA 1FBUA 5HLHA 2V1DA 5LHIA 1TLHB 3E6BA 4HLXA 3HTSB 5FGMA 2DI3A 1ZREA 2DPDA 2XGXA 1WI9A 4GCVA 3JSPA 2LSOA 2HTSA 2Q0OA 5DV5A 2O3FA 4ENMA 5DUKA 2QQAA 3ABUA 5ICGA 1HQCA 1STZA 1XN7A 5D6FA 3LWFA 1ZG5A 1HW2A 3JW4A 1W7PB 3LAJA 5CJ9A 3FMSA 2GQQA 1SMTA 4R79A 2Y75A 2OAZA 3RPQA 3T8TA 4KFCA 3WTZA 1UHMA 2P5LC 5BOXA 2STTA 3M1EA 1FSHA 2IA0A 2RVCA 4YFXF 5AIPA 5LEKA 3E3VA 5LGTA 1MJBA 3REOA 3CLOA 1H9GA 2D1VA 3L00A 1YTYA 4R1HA 3TKYA 3WTYC 1KU2A 3E97A 1JE8A 1OPCA 3FMQA 4G7OF 4ZH4F 5BQTA 5K5QA 4ON0A 2L3DA 3M8FA 5EEGA 1S7AA 4XBFA 2L4MA 1FZPB 3ZMVA 5LRRA 3QU3A 1S8NA 3FF5A 3KZZA 3T5XA 4A5MA 4OMZA 5LLQA 5D5VB 3WTVC 4A0ZA 3HYIA 3LA7A 4RB2C 2D1HA 1QPMA 2IT0A 3JTHA 3CJNA 3HRSA 2JZYA 2DO7A 1IZ1A 3HTUA 5J8CA 3KFWX 4XSZF 3F8CA 1DPUA 5FLXZ 3K9TA 3W6KB 3MZHA 1J59A 5A2QK 2ZO4A 3F8NA 2XHKA 5CYVA 5FD6A 4BHPA 4L18B 1UB9A 1FBSA 4NQWA 2HKXA 4MTEA 2L01A 1XCVA 1BJAA 1QZZA 3RI4A 3ERED 1MD0A 3U1DA 4HF1A 4MNUA 5E1WA 2QM3A 2Q2EA 2ZNZA 3LAPA 3TO6A 2D45A 4I01A 4CDGA 2QZ8A 1I27A 5TRDA 5L3BA 2ISZA 2MD5A 4GYIA 4M72A 4RAYA 1USTA 2AXLA 3Q9SA 1K78B 5BPIA 4IHTA 5AIQA 2XAGA 3PQKA 2NNYA 2BE5F 1MJAA 3L9FA 2EFQA 3NEUA 4ZZDA 1OMIA 2K4JA 5JVTA 3H92A 4GXOA 3CUQA 2VXZA 1ON2A 3ZP5A 5ERIA 2O0YA 3V4GA 5L3GA 1NHAA 1QZYA 1E2XA 3TDZC 1PP8F 3S2WA 3DKWA 1K6OA 1ZRFA 5ED4A 5CVJA 5HS9A 2CW0F 2IP2A 2A3SA 1YO5C 5FFZA 1U6GA 1E17A 3GUDA 1U8RA 3ZN1A 2R7FA 4KN7X 2HTJA 1YFHA 3RKXA 5K5RA 4O3MA 2FNAA 4PDKA 4M74A 3ML6A 3HOTA 3J81K 2H09A 4Q5SF 1IF1A 1EV7A 1Z6RA 3FWEA 1ZAOA 4RAZA 4L0YB 5LGUA 1FBQA 4EJOA 4HBLA 4ZYEA 2IA2A 3NQOA 5JFRA 3CUOA 2FMLA 1S3JA 2G7UA 2ZMEB 2QBYA 4MQ9F 1H9TA 5BS6A 4EMSA 1W4MA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1N A;  4AIK A;  2CYY A;  3GZ6 A;  3P7N A;  1ZAR A;  3KEQ A;  1USS A;  2A6E F;  3KLO A;  1SMY F;  3F8M A;  2RQP A;  2QUF A;  1J0R A;  4G9Y A;  3SZT A;  3VEP A;  3V7R A;  4R8H A;  4HOB A;  4MQV A;  3MFK A;  1FYL A;  2E1N A;  4Z2Y A;  4A0Y A;  4EM2 A;  3WTS C;  2NYX A;  3I59 A;  1IW7 F;  3GFJ A;  4LJZ F;  2M1B A;  4UV8 A;  1XD7 A;  1KYZ A;  1P4W A;  1R23 A;  2VC0 A;  2XAS A;  1MDM A;  3CTA A;  1HKT A;  5HS7 A;  4LMY A;  3TO7 A;  2M45 A;  3GYH X;  4BHC A;  2VBX A;  4ZYH A;  4A6D A;  2M8E A;  1HKS A;  4EV0 A;  1XMA A;  4CHU A;  3F72 A;  2HS5 A;  3WGH A;  3FHZ A;  2QWW A;  1WWX A;  4KMF A;  4DQ2 A;  2VN2 A;  4EGY A;  5LRS A;  4NB5 A;  1MZB A;  3E5Q A;  3Q9V A;  5ICE A;  3P9K A;  4MGR A;  5CLS A;  1B4A A;  3GEZ A;  2H27 A;  5E20 A;  4JK1 X;  3QAH A;  3FXQ A;  3IL2 A;  1CF7 A;  3SFZ A;  3HHG A;  4UVC A;  3QRF F;  3EQL F;  4MHG A;  4B8X A;  5HLI A;  3F22 A;  1O3R A;  1TW2 A;  3VB2 A;  2DK8 A;  3T1B A;  5JHU A;  3F8F A;  1IXC A;  3ZMS A;  3COA C;  3QPT A;  3I59 B;  2PEX A;  3VOD A;  4WK8 F;  2OA4 A;  4MEX F;  2KIF A;  3IC7 A;  2PN6 A;  2HEO A;  3ELK A;  3AAF A;  2FBK A;  2OD5 A;  4L9T A;  1SFX A;  3Q5F A;  3QOP A;  1FC3 A;  5HLG A;  1PDN C;  1XSD A;  3DFG A;  1HXD A;  1F1Z A;  3GO5 A;  1O3S A;  2R7D A;  3F6V A;  1S29 A;  2HYG D;  1OR7 A;  3KEO A;  4CIC A;  3LST A;  2MH2 A;  4HZF A;  4N9H A;  1GXQ A;  1KQ0 A;  4N0B A;  3SZP A;  3B73 A;  3HRM A;  4ENJ A;  2QQB A;  3T8R A;  4UNO A;  1G6N A;  1FLI A;  1BI1 A;  1FYM A;  4RGU A;  1A04 A;  4O5V A;  3E5X A;  4I0B A;  2YSR A;  4RB3 C;  2FU4 A;  1W5S A;  1BM9 A;  5DD4 A;  4TV7 A;  1Z91 A;  1SFE A;  1O7L A;  3NRV A;  2X0L A;  4P55 A;  2XV4 S;  4HV6 A;  1FOK A;  4OIP F;  4S05 A;  2AS5 F;  4S04 A;  3KZY A;  2RDP A;  2XKO A;  1KU3 A;  4LLN A;  4MEY F;  1DDN A;  4YII A;  4HAM A;  2DQL A;  2HYF A;  1Z05 A;  1L0O C;  4KN4 X;  4PZJ A;  1KGS A;  1IN8 A;  2STW A;  1WKM A;  3I0T A;  2RN7 A;  3RIR A;  1O7F A;  1XSX A;  3R60 A;  3ROU A;  2V6C A;  2BEO A;  5KK1 A;  4LK1 F;  4LLG F;  4HW0 A;  4OIQ F;  2QLZ A;  2A07 F;  2YX4 A;  5E18 F;  3FMR A;  3EUH A;  4UHT A;  1YW8 A;  4LGW A;  3V8K A;  2RGV A;  3ISP A;  4L0Z B;  3CDH A;  3F21 A;  1T2K A;  4G7Z F;  2VON A;  1SD6 A;  1Z9C A;  2XAH A;  2BV6 A;  2F5E A;  3F23 A;  2MC3 A;  2WV0 A;  3KE2 A;  4EQQ A;  3U9G A;  4AWX B;  2CWE A;  2YU3 A;  1ZRD A;  1FPQ A;  2X4H A;  2JRT A;  2JPC A;  1L3L A;  1BIB A;  2M30 A;  2FNP A;  3WTT C;  2GXG A;  2DK5 A;  1BI2 A;  3L2C A;  3ZMD A;  3R4K A;  2V79 A;  2FA5 A;  2K02 A;  3DEU A;  3ECH A;  3KP2 A;  2CGP A;  4IXA A;  3CUQ B;  3WE3 A;  1UHW A;  3ECO A;  3LA3 A;  2H6C A;  2EJR A;  2HFH A;  3J81 Z;  3J7A O;  2JTV A;  2NRA C;  3HRU A;  2A61 A;  3RPU A;  3DPL C;  2RV8 A;  2ETH A;  3MCZ A;  4ESB A;  1ULY A;  1HST A;  4BXU A;  1C0W A;  4HQE A;  1G3Y A;  4RGS A;  4HDU A;  1GHC A;  3K0L A;  3K1M A;  2W25 A;  1BBY A;  1V3F A;  1EH7 A;  3BZ6 A;  1K78 A;  3C7J A;  4Y13 A;  1IN5 A;  3I64 A;  4HV5 A;  4BQA A;  3DPT A;  5E17 F;  2CFX A;  2QYO A;  2VBY A;  3M9A A;  2A68 F;  1G3S A;  2GWR A;  3F6O A;  3PFI A;  3BY6 A;  5JR3 A;  1YW7 A;  4WCG A;  2DAO A;  3R6S A;  1F5T A;  2B0L A;  4UVB A;  3J80 Z;  3DQV C;  5HDG A;  4L5J A;  2BGC A;  3L09 A;  4G8X A;  5LBQ A;  2GA2 A;  1ZN2 A;  1TW3 A;  5K5O A;  1R7J A;  4GYG A;  3WGI A;  3ZPL A;  2LDU A;  5H20 A;  3HSF A;  4KT5 C;  2F5F A;  4K2E A;  1XDS A;  4ZZL A;  4HX8 A;  3U2R A;  1R36 A;  2M87 A;  3KP4 A;  4BNC A;  3RKW A;  1XCB A;  4FT8 A;  2MBF A;  5D5W B;  2F2E A;  4HQM A;  3RTR A;  3I53 A;  1BIA A;  2IVM A;  2V9V A;  1D5V A;  2V1X A;  2UXN A;  1TTY A;  5LEJ A;  2ELH A;  3HSE A;  3I71 A;  1U5T C;  4LD5 A;  3BJ6 A;  1KQ9 A;  3MAJ A;  1LQ1 A;  3G73 A;  1HBX G;  1WSU A;  2KIM A;  4I0A A;  2DBB A;  2G9W A;  3O2P E;  2MLK A;  1IXR C;  2PFB A;  1R5H A;  1K7A A;  2FEZ A;  1R1U A;  3MZY A;  1VTN C;  1SD5 A;  2KRF A;  5J6X A;  5DEQ A;  3IWZ A;  1XB4 A;  4H0E A;  2CQK A;  4CXF A;  2HWV A;  3KP7 A;  3QP5 A;  2A6H F;  4L9J A;  3FM3 A;  4KIG A;  5D8K B;  4YG2 F;  3GWZ A;  2ESN A;  1XSV A;  1J5Y A;  4I2O A;  1S6L A;  2Y48 A;  2JT1 A;  1PUE E;  1UCR A;  4M9X A;  2VC1 A;  2VOO A;  1LEA A;  2EV5 A;  2OZ6 A;  2A5Y B;  3QU6 A;  3C18 A;  4OIR F;  1R1T A;  3O6B B;  3WE2 A;  2XUB A;  2KJB A;  3H3Z A;  1JHF A;  3KP3 A;  1YQA A;  2W57 A;  1ZLK A;  2XRN A;  4HA8 A;  4FHT A;  4ENK A;  5D5U B;  3BWG A;  2XAQ A;  3HSR A;  5D5X B;  2Z9O A;  2TDX A;  2E7X A;  3IKT A;  3FZV A;  1HW1 A;  2P4W A;  2ZNY A;  4IF4 A;  2GA1 A;  2WTE A;  1P6R A;  1OYI A;  5L3D A;  1GVJ A;  4WXD A;  3EDP A;  3F8B A;  5H6Q A;  1Y0U A;  1MGT A;  3P9C A;  1B9N A;  2EFP A;  2COM A;  1R5G A;  2W84 A;  2HQR A;  5TJJ A;  1O3Q A;  3V7S A;  1YG2 A;  2ZBK A;  1X3U A;  2EFN A;  1FSE A;  4FX4 A;  2ACJ A;  2K86 A;  4P96 A;  2C6Y A;  1U5T B;  4QWQ A;  3DV8 A;  4HX4 A;  4EJU A;  5DD8 A;  4UVA A;  3BPX A;  3M8E A;  1I5Z A;  3JAM K;  4GGG A;  1TBX A;  2CG4 A;  3DF8 A;  3RJP A;  1BOA A;  2CO5 A;  3M7G A;  3RYR A;  4WF2 A;  2BYV E;  4OMY A;  2P6S A;  4GO1 A;  4YIF A;  4LK0 F;  2PLY A;  5FLX K;  1W7P A;  4E70 A;  1JGS A;  4WXH A;  3ZMU A;  4LLL A;  1OYW A;  1LJ9 A;  3BDD A;  3V7C A;  2Z3Y A;  4CO8 A;  4P9F A;  5ILV A;  3P9I A;  5ICF A;  2O61 A;  1V4R A;  3E6D A;  4O6J A;  3RYP A;  2BBY A;  3BPV A;  1YS7 A;  2XKP A;  4HX7 A;  5D8L B;  3ZMT A;  4RGX A;  4QLC U;  4M71 A;  2D2W A;  1H0M A;  3HIF A;  1FP2 A;  1WQ2 A;  5DUI A;  3R0J A;  2DPU A;  2EA4 A;  1B59 A;  1JHH A;  2GIV A;  4ESJ A;  2E7W A;  4IJA A;  1FT9 A;  1LB2 A;  2WC2 A;  1LNW A;  2UZK A;  1GXP A;  2EB7 A;  3GZ5 A;  3GFL A;  3KP5 A;  1DP7 P;  1LDD A;  1TQP A;  1KU9 A;  4A6E A;  2PI0 A;  1J7K A;  1Q1H A;  2EWN A;  3E5U A;  4EJV A;  4F7Z A;  4I09 A;  2EFO A;  4LG0 B;  3I4P A;  2EV0 A;  3VFZ A;  2FSW A;  3DP7 A;  1YIO A;  2HKO A;  1RNL A;  3CO7 C;  2ZKZ A;  4EGZ A;  3TQN A;  4M6X A;  3C3W A;  4A0X A;  2FMY A;  2DTR A;  3N4M A;  1ONV A;  4B09 A;  3OV8 A;  3FM5 A;  2W24 A;  1LDJ A;  1QNT A;  4RS8 A;  4EJW A;  2EV6 A;  2XRO A;  1ZHF A;  5LHH A;  1AOY A;  2GZW A;  2JPB A;  3O3K A;  1R58 A;  2HQN A;  5F64 A;  3HOS A;  4PCQ A;  4U0W A;  4YFN F;  3KP6 A;  1XGO A;  5A2Q Z;  2ZCW A;  1P2F A;  4PGG A;  2LF8 A;  5D6E A;  4AD9 A;  2DU9 A;  2YPR A;  2P7V B;  5FFX A;  4LFU A;  3GLX A;  1S7O A;  1ODD A;  1ZH5 A;  2ZJ2 A;  1J9I A;  4BHB A;  4KIB A;  4IRG A;  1YW9 A;  2VT3 A;  3IWF A;  2H6B A;  5F6F A;  4HYE A;  2RNJ A;  1B1B A;  2XIG A;  4JBA A;  2PMH A;  1YS6 A;  2FRH A;  3WTU C;  3BRO A;  2OQR A;  4KNY A;  4OIO F;  4IRI A;  2XAF A;  4M9S A;  2PJP A;  5CVU A;  4P5O A;  4Q48 A;  3W6J B;  4Q4Z F;  3WG9 A;  1D8J A;  1MDM B;  3ZN0 A;  1KYW A;  2J5O A;  2ZME A;  2QBY B;  2G7H A;  2E1C A;  4KUM A;  4XLP F;  4OOI A;  2L4A A;  3LQR A;  4CYD A;  1TNT A;  3E6C C;  1TQI A;  4BYY A;  2PMU A;  2IW5 A;  1FWZ A;  1J2X A;  4AVP A;  4Q47 A;  1I6X A;  3QP6 A;  2IA1 A;  4UV9 A;  4I98 B;  4WXC A;  3GFM A;  1XDU A;  5J8F A;  3FX3 A;  3JAM Z;  4I02 A;  1K79 A;  1DPR A;  3MEX A;  1I1S A;  5IT9 Z;  1KA8 A;  2K4B A;  1LDK B;  1SFU A;  2K7L A;  4G94 A;  5DCM B;  1OKR A;  1ZGA A;  3BP8 A;  4UUV A;  2IJL A;  3I58 A;  3IKV A;  2VE8 A;  1T38 A;  1T0F A;  1HW5 A;  1IUY A;  1R00 A;  2Z33 A;  1P4X A;  2ADU A;  2HZT A;  4L9V A;  2A69 F;  3WU1 B;  2DLL A;  3PQJ A;  5E1Z B;  3WGG A;  1BC8 C;  5E8G A;  1I1G A;  1IN6 A;  4CZZ A;  3F3X A;  1BI3 A;  4PGH A;  4M6Y A;  1XGN A;  3TDU C;  5EEH A;  3IHU A;  2KIU A;  3GFI A;  3R61 A;  1ZLJ A;  3KET A;  2OZU A;  4BAY A;  2MH9 A;  4N9I A;  1ZRC A;  2EK5 A;  2P5K A;  2HR3 A;  1ZG1 A;  1B6A A;  3TOB A;  2L54 A;  2O03 A;  5CVV A;  1EH8 A;  3I5U A;  4LB6 B;  1REP C;  5HS8 A;  4G6D A;  3WTW C;  2HGC A;  1MJ9 A;  2RC4 A;  3HRT A;  1QBJ A;  2L02 A;  4RGR A;  4OIN F;  5JI6 A;  3BOQ A;  4YFK F;  3D5L A;  5IT9 K;  1JXS A;  5IT3 A;  3K2Z A;  1P92 A;  1G3T A;  3R0A A;  2KJC A;  2OQG A;  1YYV A;  4G7H F;  3GVA A;  3K1P A;  1HSJ A;  2UWM A;  4ASN A;  1BI0 A;  2NS0 A;  1FNN A;  5DCM A;  1D8K A;  5CVR A;  1R1V A;  3V8J A;  4XRF A;  3GXO A;  2M5W A;  5ILU A;  4IPA A;  2OU2 A;  3JSO A;  3TOA A;  1SD7 A;  5LHG A;  3EET A;  4IVN A;  5HDN A;  4RB1 A;  4XLN F;  4HDV A;  3T0Y A;  4A5N A;  4L9N A;  1IN4 A;  5D4S A;  2FE3 A;  2O8X A;  4MTD A;  1P4A A;  1AWC A;  1QO0 D;  2IPQ X;  2VOP A;  2QVO A;  2DT5 A;  2FBI A;  5F1R A;  3EYI A;  5K1Y A;  3ULQ B;  2EA2 A;  2LNB A;  3LFK A;  1D3Y A;  4OU0 A;  2J5P A;  2FQ3 A;  2Q8K A;  4U7B A;  3I54 A;  2UXX A;  2XAJ A;  1XGS A;  2FOK A;  1RI7 A;  5ILS A;  2VBW A;  3SQN A;  1EH6 A;  4Y15 A;  4LB5 A;  4KYW A;  1W7P D;  2YR2 A;  2FF4 A;  5LGN A;  4IHS A;  3KCC A;  1Z1D A;  4NHJ A;  4AIJ A;  1T39 A;  2JSC A;  5L3F A;  5HVQ C;  2ESH A;  1IRF A;  1SD4 A;  5CVI A;  1OYY A;  3FXR A;  2GXB A;  2MLG A;  4ETS A;  1B9M A;  2PBI A;  5HOO A;  1IN7 A;  1BC7 C;  2CSO A;  1RUN A;  3WOD F;  4ESF A;  1Z7U A;  5KVR A;  1ZYR F;  3EYY A;  1J75 A;  1TNS A;  2F5C A;  3WTX C;  1U2W A;  3SXY A;  2Z99 A;  4HF2 A;  1XGM A;  3GF2 A;  4EVI A;  2HOE A;  4U7D A;  5HDK A;  1QGP A;  1LEB A;  3TGN A;  1T6S A;  3FXU A;  3IRQ A;  4EM0 B;  2FXA A;  1RIO H;  4EJT A;  1LVA A;  1O3T A;  1IRG A;  3CO6 C;  2VBZ A;  4LG0 A;  5L3C A;  1Z6T A;  3RKY A;  3MWM A;  1RUO A;  1U3E M;  3OOP A;  4U88 A;  3H3U A;  4G6Q A;  5E1X A;  5H6R A;  1HKQ A;  3MQ0 A;  2LKP A;  3ZQ7 A;  2PG4 A;  2R3S A;  2ISY A;  4HLY A;  5DCF A;  2IRF G;  3VOE A;  5DYM A;  4BH9 A;  4HF0 A;  1FYK A;  2O6G E;  4JQF A;  1G4D A;  4M9Z A;  2OBP A;  5E8I A;  2KKO A;  4WWC A;  4XSX F;  4U0Y A;  3G3Z A;  3K69 A;  3C1D A;  3TO9 A;  4M73 A;  1DUX C;  3KLN A;  4EM1 A;  3GW2 A;  4ZYD A;  4Y17 A;  4I7H A;  4L5I A;  1CGP A;  1IXS B;  2H94 A;  4KA4 A;  4KIC A;  1PP7 U;  1O57 A;  1WRJ A;  5L3E A;  1SAX A;  2P6T A;  3ZMZ A;  2NAZ A;  2ZXJ A;  2F5D A;  1UFM A;  2PQ8 A;  3V8L A;  4KDP A;  2P5V A;  3HHH A;  5DDG A;  2FBH A;  1IAW A;  3WU0 A;  2NNN A;  2V1U A;  4IRH A;  2P7C B;  3RDI A;  2QEN A;  2RKH A;  1YLF A;  1XMK A;  1W5T A;  3QPH A;  2YX7 A;  3D0S A;  2LF7 A;  3DXJ F;  5AON A;  2VOD A;  5D4R A;  2EFW A;  3JTG A;  4P9U A;  1MKM A;  2GAU A;  3LA2 A;  4KMU X;  6PAX A;  1U78 A;  2W85 A;  2HDC A;  5BPD A;  4D0P A;  4WX9 A;  5FD5 A;  5ICC A;  5BMZ A;  1F9N A;  1F4K A;  1FX7 A;  3HUG A;  1T98 A;  1ON1 A;  3BJA A;  2MA3 A;  4DNC A;  4ZYG A;  4AIH A;  4RB0 A;  5FB2 A;  5FO5 A;  2K27 A;  1RZ4 A;  2Y0M A;  4FX0 A;  2VT2 A;  1TQM A;  3J80 K;  3LQQ A;  1KU7 A;  2ZFW A;  2VE9 A;  1U5T A;  4KIF A;  4CGZ A;  2P8T A;  1R22 A;  2QQ9 A;  1KQ8 A;  1QQI A;  1ZG3 A;  3B02 A;  1ZGJ A;  3IRR A;  2DW4 A;  3CUQ C;  4A2U A;  2Z5U A;  1BN5 A;  3GX4 X;  1CF7 B;  3SHF A;  2WWY A;  3BJO A;  4ENN A;  2XVC A;  1FP1 D;  1FY7 A;  2DQR A;  3E6M A;  2DFI A;  3ABT A;  1G3W A;  3N97 A;  4U0V A;  3L7W A;  4A12 A;  4UXN A;  1FBU A;  5HLH A;  2V1D A;  5LHI A;  1TLH B;  3E6B A;  4HLX A;  3HTS B;  5FGM A;  2DI3 A;  1ZRE A;  2DPD A;  2XGX A;  1WI9 A;  4GCV A;  3JSP A;  2LSO A;  2HTS A;  2Q0O A;  5DV5 A;  2O3F A;  4ENM A;  5DUK A;  2QQA A;  3ABU A;  5ICG A;  1HQC A;  1STZ A;  1XN7 A;  5D6F A;  3LWF A;  1ZG5 A;  1HW2 A;  3JW4 A;  1W7P B;  3LAJ A;  5CJ9 A;  3FMS A;  2GQQ A;  1SMT A;  4R79 A;  2Y75 A;  2OAZ A;  3RPQ A;  3T8T A;  4KFC A;  3WTZ A;  1UHM A;  2P5L C;  5BOX A;  2STT A;  3M1E A;  1FSH A;  2IA0 A;  2RVC A;  4YFX F;  5AIP A;  5LEK A;  3E3V A;  5LGT A;  1MJB A;  3REO A;  3CLO A;  1H9G A;  2D1V A;  3L00 A;  1YTY A;  4R1H A;  3TKY A;  3WTY C;  1KU2 A;  3E97 A;  1JE8 A;  1OPC A;  3FMQ A;  4G7O F;  4ZH4 F;  5BQT A;  5K5Q A;  4ON0 A;  2L3D A;  3M8F A;  5EEG A;  1S7A A;  4XBF A;  2L4M A;  1FZP B;  3ZMV A;  5LRR A;  3QU3 A;  1S8N A;  3FF5 A;  3KZZ A;  3T5X A;  4A5M A;  4OMZ A;  5LLQ A;  5D5V B;  3WTV C;  4A0Z A;  3HYI A;  3LA7 A;  4RB2 C;  2D1H A;  1QPM A;  2IT0 A;  3JTH A;  3CJN A;  3HRS A;  2JZY A;  2DO7 A;  1IZ1 A;  3HTU A;  5J8C A;  3KFW X;  4XSZ F;  3F8C A;  1DPU A;  5FLX Z;  3K9T A;  3W6K B;  3MZH A;  1J59 A;  5A2Q K;  2ZO4 A;  3F8N A;  2XHK A;  5CYV A;  5FD6 A;  4BHP A;  4L18 B;  1UB9 A;  1FBS A;  4NQW A;  2HKX A;  4MTE A;  2L01 A;  1XCV A;  1BJA A;  1QZZ A;  3RI4 A;  3ERE D;  1MD0 A;  3U1D A;  4HF1 A;  4MNU A;  5E1W A;  2QM3 A;  2Q2E A;  2ZNZ A;  3LAP A;  3TO6 A;  2D45 A;  4I01 A;  4CDG A;  2QZ8 A;  1I27 A;  5TRD A;  5L3B A;  2ISZ A;  2MD5 A;  4GYI A;  4M72 A;  4RAY A;  1UST A;  2AXL A;  3Q9S A;  1K78 B;  5BPI A;  4IHT A;  5AIQ A;  2XAG A;  3PQK A;  2NNY A;  2BE5 F;  1MJA A;  3L9F A;  2EFQ A;  3NEU A;  4ZZD A;  1OMI A;  2K4J A;  5JVT A;  3H92 A;  4GXO A;  3CUQ A;  2VXZ A;  1ON2 A;  3ZP5 A;  5ERI A;  2O0Y A;  3V4G A;  5L3G A;  1NHA A;  1QZY A;  1E2X A;  3TDZ C;  1PP8 F;  3S2W A;  3DKW A;  1K6O A;  1ZRF A;  5ED4 A;  5CVJ A;  5HS9 A;  2CW0 F;  2IP2 A;  2A3S A;  1YO5 C;  5FFZ A;  1U6G A;  1E17 A;  3GUD A;  1U8R A;  3ZN1 A;  2R7F A;  4KN7 X;  2HTJ A;  1YFH A;  3RKX A;  5K5R A;  4O3M A;  2FNA A;  4PDK A;  4M74 A;  3ML6 A;  3HOT A;  3J81 K;  2H09 A;  4Q5S F;  1IF1 A;  1EV7 A;  1Z6R A;  3FWE A;  1ZAO A;  4RAZ A;  4L0Y B;  5LGU A;  1FBQ A;  4EJO A;  4HBL A;  4ZYE A;  2IA2 A;  3NQO A;  5JFR A;  3CUO A;  2FML A;  1S3J A;  2G7U A;  2ZME B;  2QBY A;  4MQ9 F;  1H9T A;  5BS6 A;  4EMS A;  1W4M A; 
#chains in the Genus database with same CATH topology
 2MD0 A;  2NVT J;  3K1N A;  3DTE A;  3PIP F;  4AIK A;  2CYY A;  2JA6 J;  1WI3 A;  3HGY A;  3GZ6 A;  3P7N A;  2EZK A;  3CQZ J;  1ZAR A;  1E3O C;  2JVH A;  2WB1 A;  1USS A;  2A6E F;  3KEQ A;  3KLO A;  4XON A;  2B9S A;  1SMY F;  2R7O A;  2GXA A;  3F8M A;  3ZXS A;  5EZH A;  2RQP A;  2QUF A;  1V5F A;  2E34 A;  1J0R A;  4G9Y A;  3SZT A;  3VEP A;  3HKZ A;  3V7R A;  4R8H A;  2L7K A;  4HOB A;  3S14 J;  3Q0V A;  1MMD A;  2JA5 J;  4MQV A;  3MFK A;  1OCO H;  1Y39 A;  2E1N A;  4Z2Y A;  1FYL A;  2PMZ A;  1TP4 A;  5EYR A;  1TL8 A;  3DLL F;  4A0Y A;  3S93 A;  4EM2 A;  3WTS C;  2NYX A;  3I59 A;  1Y0N A;  2WV1 A;  3BG6 A;  2Z1D A;  1IW7 F;  5HNF A;  3GFJ A;  3CCQ I;  2K40 A;  4LJZ F;  1LFU P;  3LL7 A;  1OCC H;  2M1B A;  1E0E A;  2F4M B;  4UV8 A;  1XD7 A;  2E60 A;  1KYZ A;  4RDU A;  1P4W A;  5FKL A;  2VPR A;  3OIQ A;  2R5Y A;  2LKS A;  2CH0 A;  1R23 A;  3OSF A;  1RPW A;  2VC0 A;  1YI2 I;  2XAS A;  3QYF A;  3H9G A;  1MDM A;  2ZB9 A;  3CTA A;  4CCM A;  1HKT A;  5HS7 A;  4LMY A;  1JKR C;  3TO7 A;  3ESW B;  1E3H A;  2M45 A;  4BHC A;  2VBX A;  4ZYH A;  4A6D A;  3GYH X;  4BUP A;  2PJR A;  4Z6Y A;  2COB A;  4F52 A;  4RLQ A;  3BTI A;  2M8E A;  1HKS A;  4EV0 A;  2ZXH A;  1XMA A;  2K9N A;  4A3L J;  2CUJ A;  4CHU A;  3UNG C;  2M9H A;  3F72 A;  2HS5 A;  3WGH A;  3FHZ A;  2DA7 A;  4CCN A;  2QWW A;  1P7I A;  2ZC2 A;  5IPA A;  3HXL A;  5TIS C;  1WWX A;  1K61 A;  4KMF A;  4DQ2 A;  2VN2 A;  3E1S A;  4N4N B;  4EGY A;  5LRS A;  4NB5 A;  3CF2 A;  1AU7 A;  1MZB A;  1R4N B;  3E5Q A;  4CYC B;  2B63 J;  3L2U A;  1WJF A;  3Q9V A;  3SYT A;  2VLA A;  3CCJ I;  1SFK A;  2DA2 A;  3A1Y A;  1HDP A;  5ICE A;  1JUP A;  3P9K A;  1UAA A;  2KMU A;  2HOA A;  4MGR A;  5CLS A;  1B4A A;  3GEZ A;  1T33 A;  4H4K C;  4AM3 A;  3CF5 F;  2H27 A;  5E20 A;  4JK1 X;  5B3S H;  3QAH A;  3FXQ A;  5K7H A;  4A3I J;  5B5E C;  1S5L C;  3IL2 A;  1CF7 A;  1I39 A;  3SFZ A;  3HHG A;  4UVC A;  3QRF F;  2ZXW H;  3EQL F;  4MHG A;  4B8X A;  3OSG A;  5HLI A;  3F22 A;  1O3R A;  1TW2 A;  3VB2 A;  1NG6 A;  3SEQ A;  2DK8 A;  3T1B A;  5JHU A;  3F8F A;  2VKV A;  1IXC A;  3ZMS A;  3COA C;  3QPT A;  3I59 B;  2PEX A;  5E3L A;  3VOD A;  4WK8 F;  2OA4 A;  1YJW I;  2IGK A;  4XNF A;  2VQG A;  4MEX F;  4ZDP A;  2BY3 A;  4L5E A;  1WH5 A;  2KIF A;  4HEA 2;  2KQR A;  1FMV A;  3IC7 A;  3S16 J;  1MBF A;  2CQX A;  2PN6 A;  2HEO A;  4E6K G;  3L2V A;  3ELK A;  2MGQ A;  3AAF A;  5J47 A;  2X48 A;  5DS9 A;  2FBK A;  2OD5 A;  4L9T A;  4DYQ A;  1SFX A;  3Q5F A;  4UB8 C;  3QOP A;  5EGO B;  4JX5 A;  1FC3 A;  5HLG A;  2HPM A;  3HBL A;  1PDN C;  2R7X A;  4E4H A;  3DFG A;  1HXD A;  1XSD A;  3GTG J;  1F1Z A;  3OYG A;  3O8H A;  2QQ8 A;  3GO5 A;  2UUZ A;  1O3S A;  3DKX A;  2R7D A;  3F6V A;  1S29 A;  3DU6 A;  1WGX A;  3OS1 A;  2HYG D;  2ZXI A;  1OR7 A;  3KEO A;  5C4J J;  2K3F A;  4CIC A;  2MFZ A;  3LST A;  2MH2 A;  4HZF A;  4N9H A;  1GXQ A;  2FQ4 A;  1KQ0 A;  4D7N A;  4N0B A;  2EH3 A;  3SZP A;  3B73 A;  1MBE A;  3HRM A;  1R5I D;  4ENJ A;  3M8J A;  2QQB A;  3DWL E;  3T8R A;  4UNO A;  1XS9 A;  2PJR B;  1XMX A;  3ZOB A;  1G6N A;  4MO7 A;  1QHG A;  1FLI A;  1PJR A;  1BI1 A;  2ZME C;  4RGU A;  1FYM A;  1A04 A;  4O5V A;  1A5J A;  1I3A A;  3E5X A;  4I0B A;  1OLT A;  2YSR A;  4RB3 C;  3A03 A;  4XK4 A;  2FU4 A;  1W5S A;  2XAU A;  1IUF A;  2OJE D;  3HPH A;  4XQF A;  1BM9 A;  1ZR4 A;  5DD4 A;  4TV7 A;  2FOW A;  1Z91 A;  4NC6 A;  1SFE A;  2F5V A;  3S15 J;  1O7L A;  1RKT A;  3QYE A;  1XX5 A;  1OIS A;  3FIS A;  2QKL B;  4J19 A;  4IOA F;  4XLH A;  1TC3 C;  2DFF A;  3NRV A;  1O4X A;  2X0L A;  2X1C A;  4JOM A;  2TCT A;  5GAE J;  1ITY A;  4P55 A;  3BR0 A;  2XV4 S;  4HV6 A;  1FOK A;  4OIP F;  3K4C A;  4S05 A;  2X6X A;  2R7U A;  4ZDO A;  2AS5 F;  2X1E A;  4S04 A;  3KZY A;  2RDP A;  2XKO A;  3ABL H;  1S9H A;  2IS6 A;  1KU3 A;  3I55 I;  3JRA A;  3H1C A;  2HVQ A;  2LC2 A;  4LLN A;  1PYV A;  4FCY A;  3OYF A;  4MEY F;  2CS3 A;  2M3A A;  1DDN A;  4YII A;  4HAM A;  2XPV A;  2YUS A;  2DQL A;  1FTZ A;  2HYF A;  2MAB A;  1Z05 A;  2BW3 B;  2EIK H;  4II3 A;  2E2H J;  5M5W J;  3CZ6 A;  1L0O C;  1Y6I A;  4PJJ A;  4KN4 X;  3VSK A;  4PZJ A;  2CUZ A;  1KGS A;  3ZQI A;  1IN8 A;  2DOD A;  4DGW B;  2HOS A;  2STW A;  3UR3 C;  5KAF C;  1WKM A;  4AYB A;  3I0T A;  2EIN H;  2RN7 A;  3RIR A;  1O7F A;  1XSX A;  3R60 A;  3ROU A;  3K4N A;  2QCO A;  2V6C A;  4AYB N;  1UJ8 A;  2BEO A;  2XF6 A;  4LK1 F;  5KK1 A;  4LLG F;  4D5F A;  4FTH A;  1NG7 A;  4HRI A;  3DBL B;  4HW0 A;  2DDA A;  4OIQ F;  2LYC A;  2QLZ A;  2M0C A;  2A07 F;  2YX4 A;  5E18 F;  3FMR A;  1VQN I;  3EUH A;  4UHT A;  3IAS 2;  1YW8 A;  4LGW A;  3G4S I;  3DBH B;  3V8K A;  2RGV A;  1U9O A;  3IV5 A;  3CJR B;  3ISP A;  4GRI A;  1POG A;  4L0Z B;  5F08 A;  3CDH A;  1QU3 A;  3F21 A;  2JWT A;  1T2K A;  3LSR A;  4G7Z F;  4KIT B;  2VON A;  1SD6 A;  1JJ6 C;  1Z9C A;  2XAH A;  4NC8 A;  2BV6 A;  3X2Q H;  4A3B J;  2F5E A;  2QSG X;  3F23 A;  2MC3 A;  3K4M A;  1WZ2 A;  2WV0 A;  1KON A;  2KT0 A;  3KE2 A;  4EQQ A;  3ZQL A;  3PM1 A;  2DYS H;  3U9G A;  4AWX B;  2CWE A;  2YU3 A;  4N4O B;  1IDZ A;  4CUG A;  4EEF G;  1ZRD A;  3TBI A;  1FPQ A;  2X4H A;  2VQL A;  4HG2 A;  4XID A;  2JRT A;  4UUS B;  2JPC A;  1L3L A;  1BIB A;  2M30 A;  2QEX I;  2FNP A;  3WTT C;  2GXG A;  2DK5 A;  4OAY A;  1BI2 A;  3H9J A;  1UG0 A;  3L2C A;  1VQM I;  3ZMD A;  3R4K A;  2V79 A;  3OYC A;  2FA5 A;  2I8D A;  3HZJ A;  3E0J B;  2K02 A;  2NS8 A;  3DEU A;  3ECH A;  3KP2 A;  2CGP A;  4IXA A;  2R4G A;  1B8I A;  4M3D A;  3CUQ B;  3WE3 A;  1UHW A;  3ECO A;  3LA3 A;  4FET A;  3S1R J;  2H6C A;  1ENH A;  4FAS D;  2EJR A;  2AO9 A;  2HFH A;  5F0F A;  4C3I J;  3J81 Z;  3J7A O;  2JTV A;  2M7A A;  1IO2 A;  2JA8 J;  1IV6 A;  2NRA C;  3MD2 A;  3HRU A;  3JRB A;  1X1A A;  1Z7L A;  2A61 A;  3RPU A;  3LSP A;  3DPL C;  3LSI A;  1TWG J;  1ETX A;  2RV8 A;  2ETH A;  3MCZ A;  4I99 C;  2LRE A;  4ESB A;  2BHY A;  4D7M A;  2HDD A;  2W48 A;  1ULY A;  3H5A A;  1HST A;  3G71 I;  4BXU A;  5E79 C;  1XPX A;  1C0W A;  1Y56 A;  3W3C A;  2Y0S A;  4HQE A;  2JRM A;  4BJT A;  1G3Y A;  4E7I A;  4RGS A;  1HCR A;  4MFE A;  4HDU A;  2LTP A;  3VYR B;  4NC7 A;  5KNL A;  1GHC A;  3K0L A;  3K1M A;  2W25 A;  1BBY A;  1V3F A;  1EH7 A;  3BZ6 A;  1K78 A;  4D1Q A;  2KRH A;  3C7J A;  1VQP I;  4Y13 A;  1IN5 A;  2DMN A;  3I64 A;  4HV5 A;  2HXO A;  4F3Q A;  1K4S A;  4BQA A;  2KZV A;  2R7R A;  2XDV A;  3DPT A;  5E17 F;  3RPU D;  4XKV A;  3JRG A;  2I10 A;  3RSN A;  2CFX A;  2HYJ A;  2QYO A;  3PO3 J;  1D5Y A;  5J40 A;  1YRN A;  3OYA A;  2VBY A;  3M9A A;  2A68 F;  1G3S A;  4V2G A;  2GWR A;  2KIS A;  2M2E A;  3F6O A;  3W2W A;  3PFI A;  4XRS A;  4I6Z A;  1WH7 A;  1QZE A;  3BY6 A;  2QSH X;  5JR3 A;  3JRD A;  2HXI A;  1YW7 A;  1IJW C;  3ASN H;  4C3J J;  4WCG A;  2DAO A;  3R6S A;  1F5T A;  4BGD A;  2E1O A;  2B0L A;  4IX7 A;  4B3X A;  3NAR A;  4UVB A;  1ZEL A;  1RET A;  5B1A H;  3J80 Z;  3DQV C;  5BNG A;  4B1R A;  2HVS A;  3DTI A;  5HDG A;  4Y7N J;  2E5Z A;  3FBI B;  4L5J A;  2BGC A;  3L09 A;  3CD6 I;  4G8X A;  3QPS A;  1ERD A;  2GA2 A;  5LBQ A;  1OCP A;  2E2J J;  1ZN2 A;  1TW3 A;  5K5O A;  1R7J A;  4GYG A;  3WGI A;  3ZPL A;  3IP4 B;  1JT0 A;  3BCA A;  2LDU A;  5H20 A;  5KCM A;  4CCL A;  1F43 A;  3HSF A;  4KT5 C;  2F5F A;  3BC8 A;  4K2E A;  2JA2 A;  1XDS A;  4ZZL A;  3BR3 A;  4HX8 A;  1MH4 A;  2NVX J;  3U2R A;  2DOA A;  1WPK A;  1R36 A;  3GZN B;  2M87 A;  3KP4 A;  1BW6 A;  3AKZ A;  4BNC A;  3RKW A;  1Q1V A;  1XCB A;  1LE8 A;  3A0B C;  2L9S A;  2MBF A;  4FT8 A;  3M4O J;  4LIT A;  5D5W B;  3N05 A;  2FUG 2;  1JT6 A;  2ELJ A;  2F2E A;  2NS7 A;  4HQM A;  3D5S C;  3QOD A;  3RTR A;  3I53 A;  1BIA A;  2IVM A;  3BG7 A;  2V9V A;  1D5V A;  1D1A A;  3L2Q A;  2V1X A;  2UXN A;  1MMG A;  1X4O A;  1TTY A;  1AHD P;  4DJA A;  1HLV A;  5GPA A;  5LEJ A;  1S72 I;  1IRZ A;  1VFC A;  2ELH A;  3HSE A;  3F0C A;  3I71 A;  1ETO A;  1U5T C;  4LD5 A;  5E3N A;  3BJ6 A;  3L2R A;  1IC8 A;  1KQ9 A;  3MAJ A;  3FHN A;  3G73 A;  1LQ1 A;  1HBX G;  3CJQ B;  2KDZ A;  1WSU A;  4CSW A;  2M7B A;  3OYB A;  2KIM A;  4I0A A;  3GTQ J;  1DP3 A;  2DBB A;  2G9W A;  3O2P E;  2MLK A;  1IXR C;  2PFB A;  1IRX A;  1R5H A;  3RCO A;  1K7A A;  4A3E J;  5EEA A;  2FEZ A;  2GOX B;  1R1U A;  1ZKG A;  3SZG A;  2IS1 A;  3MZY A;  4BE2 A;  1VTN C;  1SD5 A;  2KRF A;  4MIM A;  3G1L A;  2DMT A;  3JRH A;  5J6X A;  5DEQ A;  2BOL A;  3IWZ A;  1XB4 A;  4H0E A;  2CQK A;  4CXF A;  2HWV A;  3KP7 A;  3QP5 A;  3GTM J;  2E36 A;  3A0H C;  2A6H F;  4L9J A;  5LD2 C;  4V19 K;  3JRF A;  3FM3 A;  1YOV B;  4KIG A;  4IHY A;  2NOG A;  3S17 J;  5D8K B;  4YG2 F;  1GV2 A;  3GWZ A;  4BJ6 C;  3H0G J;  2ESN A;  3OY9 A;  1XSV A;  1J5Y A;  3BTJ A;  3J7Y J;  4I2O A;  1FOX A;  1G59 A;  4F93 B;  1S6L A;  2Y48 A;  4IQJ A;  3I3L A;  3BTC A;  4HNT A;  2LKX A;  2JT1 A;  1PUE E;  3OYM A;  1X1P A;  1UCR A;  3JRE A;  4M9X A;  2VC1 A;  2VOO A;  1LEA A;  2EV5 A;  1XG1 A;  2OZ6 A;  2A5Y B;  3AL0 C;  2HVR A;  1MBH A;  2OF7 A;  2VI6 A;  3C18 A;  3QU6 A;  4OIR F;  3G1O A;  1WJD A;  1R1T A;  4Y33 A;  5GP9 A;  5CQG A;  3MMY B;  2X9D A;  2OC6 A;  3CC4 I;  1T0F C;  4DW6 A;  3O6B B;  3WE2 A;  4F92 B;  2TRT A;  2X85 A;  2XUB A;  1WHU A;  2KJB A;  4XIC A;  4W97 A;  3ZQC A;  3H3Z A;  2ZJR F;  1JHF A;  2EZI A;  3KP3 A;  2XSJ C;  1YQA A;  2W57 A;  1GVD A;  4XOT A;  2XRN A;  1ZLK A;  4BXX J;  4QPO A;  4HA8 A;  4FHT A;  4ENK A;  5D5U B;  3BWG A;  2XAQ A;  3HSR A;  5J1U A;  3IH3 A;  5D5X B;  2MW8 A;  1BL0 A;  2Y2Z A;  1SEU A;  2Z9O A;  2TDX A;  2XF5 A;  2E7X A;  4BEH A;  3IKT A;  3FZV A;  2RNG A;  3CCY A;  4B43 A;  1JKO C;  1HW1 A;  1N75 A;  1J09 A;  3KX2 A;  2P4W A;  2ZNY A;  4IF4 A;  2O5R A;  4CCK A;  4XN0 A;  2GA1 A;  2WTE A;  3H9Q A;  4ZDL A;  4J00 A;  4BAC A;  2DXI A;  1P6R A;  1OYI A;  5L3D A;  3HB9 A;  3CP8 A;  1GVJ A;  1V5E A;  4WXD A;  3VDX A;  3EDP A;  2CQN A;  3HOZ J;  3F8B A;  3BG3 A;  3FIW A;  2K9S A;  5H6Q A;  1Y0U A;  1EJ9 A;  1MGT A;  1X2N A;  3ZQQ A;  3P9C A;  1B9N A;  1X4P A;  2EFP A;  2COM A;  1R5G A;  2W84 A;  2CW8 A;  2KFD A;  2RQQ A;  2HQR A;  2WAF A;  5TJJ A;  1O3Q A;  3H35 A;  3V7S A;  3SEZ A;  1YG2 A;  2ZBK A;  1X3U A;  2EFN A;  1FSE A;  1JKQ C;  3PSI A;  4FX4 A;  2ACJ A;  1VQK I;  1Z21 A;  2K86 A;  4P96 A;  4B3A A;  1U5T B;  4QWQ A;  2C6Y A;  4QTR A;  3DV8 A;  4HX4 A;  1Z3Y A;  2XPW A;  4M3G A;  2I5U A;  3JCU C;  4UB6 C;  2WY8 Q;  3ERM A;  4EJU A;  5DD8 A;  4UVA A;  4X0G A;  3BPX A;  4NUB A;  2YS9 A;  1JI8 A;  5EF6 A;  1I50 J;  4XLA A;  3M8E A;  5EG0 B;  1I5Z A;  1D1C A;  3A4C A;  4OWR B;  3HDD A;  5FLV A;  3JAM K;  2ELK A;  2JJ7 A;  3VWB A;  2LBF A;  4GGG A;  2Y69 H;  1TBX A;  4JX4 A;  1QA6 A;  2CG4 A;  2EZL A;  2IGM A;  3DF8 A;  3J7Z I;  3RJP A;  1BOA A;  3PUB A;  1LE8 B;  3H36 A;  3F9K A;  2CO5 A;  3M7G A;  3RYR A;  4WF2 A;  1XTA A;  2BYV E;  4OMY A;  2P6S A;  4GO1 A;  4FIS A;  4YIF A;  1DU6 A;  4LK0 F;  2PLY A;  5C44 J;  5FLX K;  1W7P A;  5FRN A;  1BW5 A;  1SVM A;  5IP9 J;  2IXS A;  4E70 A;  1JGS A;  4WXH A;  3ZMU A;  4LLL A;  1OYW A;  1LJ9 A;  3JR9 A;  2DA6 A;  2AHQ A;  3BDD A;  3V7C A;  4A3D J;  2XF7 A;  3CDL A;  2Z3Y A;  4CO8 A;  4P9F A;  5ILV A;  4PFP A;  3P9I A;  4EAT A;  5ICF A;  1H8A C;  2O61 A;  2DT6 A;  1V4R A;  3E6D A;  4O6J A;  1X3W B;  1ZK8 A;  3RYP A;  2H1L A;  2H8R A;  3WHC A;  2BBY A;  3C2B A;  3BPV A;  1YS7 A;  2XKP A;  4HX7 A;  2A05 A;  2EQR A;  5D8L B;  3ZMT A;  2EIL H;  4RGX A;  3TED A;  4QLC U;  4M71 A;  2D2W A;  2R7T A;  1TZL A;  1H0M A;  3BR1 A;  3HIF A;  1WVR A;  1FP2 A;  1WQ2 A;  5DUI A;  3R0J A;  5C3E J;  1EF4 A;  2DPU A;  2EA4 A;  1MNE A;  3K6G A;  3SDG A;  4C9Y A;  3KYC B;  1B59 A;  4II2 A;  1JHH A;  1UG2 A;  5E3M A;  2GIV A;  4ESJ A;  2E7W A;  4IJA A;  5GAH J;  1FT9 A;  1LB2 A;  2WC2 A;  3HEF A;  3MKZ A;  1LNW A;  1YJ9 I;  2IGN A;  1WJC A;  2UZK A;  2ICW G;  1GXP A;  2EB7 A;  3GZ5 A;  2DCE A;  2DA3 A;  3HGG A;  3M1C A;  1BR4 A;  3GFL A;  3WG7 H;  2OV7 A;  3KP5 A;  1GUU A;  3RZO J;  2QF7 A;  3BR2 A;  1LDD A;  3AG4 H;  2R0Q C;  1DP7 P;  1TQP A;  2ECB A;  1QVT A;  1MMA A;  1KU9 A;  4A6E A;  2PI0 A;  1J7K A;  1Q1H A;  2EWN A;  3MKL A;  3E5U A;  4EJV A;  3SJM A;  2PMZ N;  1MND A;  4F7Z A;  4I09 A;  2XC7 A;  3DPU A;  2EFO A;  4LG0 B;  3I4P A;  3OIO A;  2R92 J;  2EV0 A;  3L2W A;  3VFZ A;  3IUO A;  2BXZ A;  2FSW A;  3DP7 A;  4UUS A;  1YIO A;  1WCM J;  2HKO A;  3FK7 A;  3K4K A;  1RNL A;  4FE4 A;  4B44 A;  3CO7 C;  2ZKZ A;  4EGZ A;  4QPQ A;  5K7F A;  3TQN A;  4M6X A;  3C3W A;  4A0X A;  2FMY A;  1WJ5 A;  1OCZ H;  1SVL A;  2DTR A;  2M8G X;  1ONV A;  4B09 A;  3N4M A;  2HOT A;  3OV8 A;  3FM5 A;  4C30 A;  4XRS G;  2W24 A;  2VJJ A;  1LDJ A;  1QNT A;  3S3N A;  4RS8 A;  4EJW A;  2EIM H;  2EV6 A;  2NVQ J;  2XRO A;  2OPT A;  5IOY A;  4IKF A;  1ZHF A;  2MSY A;  5LHH A;  1ZR2 A;  2QKM B;  5J4Y A;  1AOY A;  5M5Y J;  2GZW A;  2JPB A;  2Z16 A;  5HLT A;  3CME I;  2G0E A;  2DYR H;  3O3K A;  3K4B A;  1R58 A;  2HQN A;  5F64 A;  3HOS A;  4BQO A;  4PCQ A;  4U0W A;  3OYI A;  4YFN F;  4BE1 A;  3KP6 A;  1XGO A;  1QRY A;  5CKT A;  5F04 A;  5A2Q Z;  2ZCW A;  1P2F A;  4PGG A;  2LF8 A;  1H88 C;  5D6E A;  1X1C A;  4AD9 A;  2VL8 A;  3CCV I;  2DU9 A;  2YPR A;  2P7V B;  2L2O A;  3K7A J;  4LFU A;  5FFX A;  3GLX A;  5IYC J;  2O8K A;  1VQO I;  1FOW A;  1S7O A;  1ODD A;  3CC7 I;  5GTH C;  1ZH5 A;  2V1N A;  2ZJ2 A;  2DA1 A;  1J9I A;  4BHB A;  4KIB A;  4IRG A;  3SFI A;  1YW9 A;  2VT3 A;  2XGD A;  3IWF A;  2H6B A;  1X2M A;  5F6F A;  4HYE A;  4BS9 A;  3JRI A;  3DU5 A;  4NBQ A;  2RNJ A;  2AXT C;  3TP3 A;  1B1B A;  1K4T A;  2XIG A;  2EIJ H;  4JBA A;  2PMH A;  1JJ8 C;  3TMO A;  3FKJ A;  1YS6 A;  4PUS A;  4A3C J;  2FRH A;  3S1Q J;  1VQ8 I;  3WTU C;  3GTJ J;  1UZC A;  4RAG A;  1MMS A;  5C4X J;  5EZG A;  3BRO A;  2OQR A;  1JTX A;  2HZD A;  1JUM A;  4KNY A;  5M3M J;  4OIO F;  3OYJ A;  2VAS A;  3CCE I;  4IRI A;  2FD5 A;  1FEX A;  2XAF A;  4M9S A;  2WBM A;  3CMY A;  5CVU A;  4B48 A;  2PJP A;  4M6V A;  4P5O A;  4Q48 A;  3W6J B;  4Q4Z F;  3WG9 A;  1YX5 A;  4XKC A;  1A6I A;  4Y4R A;  3BTL A;  4M3E A;  5DTD A;  1MDM B;  1D8J A;  4XLE A;  4UUT A;  3PNV A;  3ZN0 A;  1KYW A;  2J5O A;  2ZME A;  2QBY B;  2HI3 A;  2G7H A;  2LP0 A;  4RLF A;  3BLY A;  1PVE A;  4IQ4 A;  4IHX A;  2E1C A;  4KUM A;  1MW7 A;  4XLP F;  3QYB A;  2XPU A;  3OOU A;  2ME6 A;  5FKN A;  4J01 A;  2AQF A;  5FJ8 J;  4OOI A;  2L5Q A;  1X19 A;  5JHF A;  3PO2 J;  1AA7 A;  3W6V A;  2L4A A;  3W2A A;  1DQU A;  2K85 A;  3LQR A;  2DTZ A;  2UV1 A;  4CYD A;  2ZJQ F;  4HST A;  1TNT A;  3PNT A;  3E6C C;  2VJ5 A;  1TQI A;  4ZC3 A;  2BVM A;  4BYY A;  3UKG A;  2PMU A;  2IW5 A;  1FWZ A;  1J2X A;  2L7Z A;  2LY9 A;  1HC8 A;  2P81 A;  2GM4 A;  1X1D A;  4AVP A;  4BXF A;  4Q47 A;  1I6X A;  3QP6 A;  4A3J J;  2IA1 A;  4UV9 A;  3CC2 I;  4I98 B;  2XGE A;  2F4I A;  4RBO A;  4WXC A;  3GFM A;  2L7M P;  5HOD A;  1XDU A;  2FJ1 A;  2ID6 A;  2WA0 A;  3FX3 A;  2LMD A;  5J8F A;  3K70 D;  3JAM Z;  1RES A;  2V6E A;  1X1B A;  4I02 A;  2K9L A;  1VQ6 I;  1DGW Y;  2XSD C;  3CCM I;  1K79 A;  4A93 J;  1W1W E;  2JA7 J;  1DPR A;  3MEX A;  2HPI A;  1I1S A;  5IT9 Z;  2W4S A;  1HF0 A;  1KA8 A;  4NQW B;  3H5N A;  3NWS A;  2K4B A;  4YEJ A;  2WAQ N;  1LDK B;  1SFU A;  1BA5 A;  1HA8 A;  2K7L A;  4G94 A;  5DCM B;  1OKR A;  3LNQ A;  1ZGA A;  3BP8 A;  4YIR X;  4UUV A;  2IJL A;  3I58 A;  2JN6 A;  3B6C A;  3IKV A;  2X51 A;  2VE8 A;  3QPL A;  5IYB J;  1T0F A;  1T38 A;  5GAG J;  1BR2 A;  1HW5 A;  4D5C A;  1MNM C;  5CQE A;  1A31 A;  3J7A Y;  4Y52 J;  1IUY A;  1R00 A;  4DYR A;  2Z33 A;  2ZSI B;  1P4X A;  4E7H A;  2ADU A;  2HZT A;  4L9V A;  2A69 F;  3WU1 B;  2NVU B;  2DLL A;  3PQJ A;  1SFO J;  2OUM A;  3P5J A;  5E1Z B;  3BQY A;  5M3F J;  1MBG A;  3WGG A;  1BC8 C;  1VQ4 I;  5E8G A;  1I1G A;  1IN6 A;  2MG4 A;  4CZZ A;  2E1M B;  2E19 A;  1VQ7 I;  3F3X A;  4XKW A;  1BI3 A;  1R49 A;  2R7Z J;  5F0C A;  4PGH A;  4M6Y A;  1PUF B;  3LMM A;  4C2T A;  1XGN A;  2Z2S B;  1NTC A;  3KPH A;  3TDU C;  2X6Y A;  5EEH A;  2IS2 A;  3DKY A;  2GOM A;  2L9V A;  3RKQ A;  3IHU A;  4C2M J;  2KIU A;  3GFI A;  2Y31 A;  2DMP A;  3R61 A;  4DBQ A;  1W5C C;  1ZLJ A;  5B66 C;  3KET A;  4OAZ A;  2OZU A;  4BAY A;  2MH9 A;  1BR1 A;  4N9I A;  1ZRC A;  2JUG A;  2EK5 A;  1GDT A;  2P5K A;  2RRE A;  2HR3 A;  2LVS A;  2M4K A;  4AID A;  1ZG1 A;  1B6A A;  3TOB A;  2L54 A;  2O03 A;  5CVV A;  1WFX A;  1EH8 A;  4X1E A;  2E71 A;  4QIW N;  3OS2 A;  3I5U A;  4LB6 B;  2K5C A;  2R93 J;  1REP C;  1D0Y A;  5HS8 A;  4G6D A;  1Y1W J;  3S32 A;  3WTW C;  3FDY A;  1WJA A;  2HGC A;  1MJ9 A;  2RC4 A;  3M07 A;  3CCS I;  1YIJ I;  3HRT A;  1QBJ A;  2K9M A;  1IDY A;  4XR6 A;  3AG3 H;  3S1M J;  3VSL A;  2L02 A;  3PUF A;  4RGR A;  4OIN F;  1OFC X;  5JI6 A;  3CP2 A;  3BOQ A;  3HKZ N;  4YFK F;  3D5L A;  5IT9 K;  5FKM A;  1JXS A;  4IHV A;  2VQH A;  3GLL A;  5IT3 A;  3K2Z A;  3K4J A;  3TW7 A;  1P92 A;  3KYD B;  1G3T A;  3R0A A;  4HNV A;  1Y8Q B;  3QWL A;  2LH9 A;  2KJC A;  2BY0 A;  4E7K A;  2OQG A;  2DMQ A;  3KIO A;  4CZC A;  1WJE A;  2B7E A;  1YYV A;  3MVP A;  5EDN A;  4G7H F;  3GVA A;  3K1P A;  1HSJ A;  2Y9Y A;  5J3L A;  5J1R A;  2UWM A;  2CJJ A;  4P1W A;  4ASN A;  2OTJ I;  1BI0 A;  2OCC H;  4PSW A;  2BY2 A;  1OCT C;  3KEY A;  2NS0 A;  5IY5 H;  1N78 A;  2WAD A;  1FNN A;  5DCM A;  3RZD J;  1D8K A;  5JVG F;  2JK3 A;  4DIQ A;  3OYH A;  3BT9 A;  4KIS A;  5CVR A;  1R1V A;  3V8J A;  2R7W A;  4XRF A;  3HC7 A;  3EUA A;  3GXO A;  2M5W A;  5ILU A;  2E5N A;  4IPA A;  2BY1 A;  2OU2 A;  4DYC A;  3TOA A;  4CCO A;  3JSO A;  1TWC J;  1SD7 A;  2VKH A;  5LHG A;  3EET A;  2VJI A;  3LSK A;  1FTT A;  1W36 C;  2NVY J;  3S3M A;  5EGO A;  4IVN A;  5HDN A;  1N25 A;  4RB1 A;  2M0M A;  4XLN F;  4HDV A;  3T0Y A;  4A5N A;  3BR6 A;  4L9N A;  1IN4 A;  5D4S A;  2FE3 A;  3DEE A;  1Z3X A;  5IYD J;  2X6W A;  5IOZ A;  2O8X A;  4YEL A;  2JUC A;  4PSX A;  4MTD A;  1P4A A;  2LFB A;  1AWC A;  1QO0 D;  2A6T A;  3C2G A;  2IPQ X;  2VOP A;  1X3Z B;  2QVO A;  1EA3 A;  4E7Z A;  3OYE A;  1LVK A;  3GME A;  2DT5 A;  2FBI A;  2XRL A;  4IZZ A;  3ONQ A;  5F1R A;  4JP0 A;  5K1Y A;  3EYI A;  3ULQ B;  3EPZ A;  2BHZ A;  4FQG A;  1W36 D;  1H89 C;  2EA2 A;  2GIZ A;  2LNB A;  4F91 B;  3LFK A;  1D3Y A;  4OU0 A;  2J5P A;  2BW3 A;  2FQ3 A;  2NXN B;  3HJE A;  2Q8K A;  4U7B A;  3I54 A;  2EBI A;  3VYT B;  2UXX A;  3GTL J;  2XAJ A;  1XGS A;  2FOK A;  1RI7 A;  2KLO A;  2R7S A;  4BBS J;  1R6R A;  2VBW A;  3A02 A;  2XGC A;  5ILS A;  3SQN A;  3TL4 X;  1EH6 A;  4Y15 A;  1OQY A;  4RAF A;  4LB5 A;  4KYW A;  1F36 A;  1W7P D;  4FE7 A;  1QHH D;  2OTL I;  3DEW A;  1T56 A;  3E7L A;  1ZTR A;  1FJL A;  1YIT I;  3HG9 A;  1YHQ I;  5FRO A;  2YR2 A;  4NDL A;  2FF4 A;  2KIQ A;  2IGO A;  5LGN A;  4IHS A;  3KCC A;  1Z1D A;  1T8I A;  3ZQH A;  4NHJ A;  4AIJ A;  1T39 A;  2JSC A;  5L3F A;  5HVQ C;  2ESH A;  1LFP A;  1IRF A;  1SD4 A;  2CUE A;  5CVI A;  4S0H B;  3C2H A;  1OYY A;  3FXR A;  2GXB A;  4B47 A;  3BZK A;  3I4N J;  1TWF J;  2MLG A;  4ETS A;  1B9M A;  5JLW A;  4A3G J;  2DFE A;  2PBI A;  5HOO A;  1IN7 A;  1BC7 C;  1B72 B;  2CSO A;  1RUN A;  3WOD F;  3A01 B;  1U9N A;  4XRM A;  3CES A;  4ESF A;  1Z7U A;  2H8W A;  5KVR A;  1ZYR F;  4YRV A;  1YJN I;  1T95 A;  3EYY A;  1J75 A;  1TNS A;  1MH3 A;  4PJN A;  2CV0 A;  1MMN A;  5H2F C;  2DA5 A;  2F5C A;  3OMY A;  3L1P A;  2DOF A;  4BJ5 C;  2L9R A;  2R5Z B;  3WTX C;  5F0H A;  1U2W A;  3SXY A;  3V42 A;  2Z99 A;  4HF2 A;  1XGM A;  3GF2 A;  1G2H A;  4EVI A;  1QPI A;  3HOW J;  2HOE A;  1LKX A;  4LIU A;  4U7D A;  5HDK A;  1QGP A;  1LEB A;  1VI0 A;  2F48 A;  4LG3 A;  3DCF A;  2V4J C;  3TGN A;  1YRN B;  1R9T J;  1T6S A;  3FXU A;  3K4L A;  3IRQ A;  4EM0 B;  1VQ5 I;  3FXJ A;  2FXA A;  1RIO H;  4PJ0 C;  4BBR J;  5GTI C;  4EJT A;  4BL0 B;  1LVA A;  1O3T A;  4GDF A;  2LBF B;  1IRG A;  3CO6 C;  2VBZ A;  4LG0 A;  1D0X A;  2RAE A;  5L3C A;  2JQ7 A;  1Z6T A;  3RKY A;  5K7Z A;  3MWM A;  3BR5 A;  1RUO A;  1U3E M;  4XKB A;  3OOP A;  2ZJP F;  4U88 A;  4GFB A;  1EKE A;  3H3U A;  3OYL A;  2D5V A;  4G6Q A;  5E1X A;  5H6R A;  1HKQ A;  2MYS A;  4V2F A;  4BY1 J;  3MQ0 A;  2LKP A;  2L0K A;  3ZQ7 A;  3GTP J;  2PG4 A;  2R3S A;  3LSH A;  2ISY A;  1ZGW A;  3MZ8 A;  4HLY A;  5DCF A;  2IRF G;  1K83 J;  1Z77 A;  3VOE A;  2IS4 A;  2VJ4 A;  3GTK J;  2F6C A;  4E7L A;  3S2D J;  5EG0 A;  3K10 A;  5DYM A;  4C2U A;  4A3M J;  1ETY A;  4BH9 A;  3HOX J;  3ZRG A;  4HF0 A;  1FOY A;  1FYK A;  5FKO A;  1SVO A;  2O6G E;  4I76 A;  4JQF A;  1G4D A;  4M9Z A;  2OBP A;  1YE9 A;  5E8I A;  5DM7 F;  2KKO A;  4BY7 J;  1OJL A;  4XSX F;  4WWC A;  1DU0 A;  2DDB A;  4U0Y A;  3G3Z A;  4A69 C;  3K69 A;  4CYC A;  3C1D A;  3FXO A;  2NOJ B;  3GCM A;  2IBD A;  3A2K A;  3TO9 A;  1IG7 A;  3K70 C;  4UY8 I;  3H5R A;  2KZG A;  2M4G A;  4M73 A;  1DUX C;  1TT0 A;  3KLN A;  1P9Q C;  4EM1 A;  3GW2 A;  4ZYD A;  1W0U A;  1X58 A;  3AG2 H;  4Y17 A;  3S8P A;  4I7H A;  4L5I A;  1CGP A;  1IXS B;  2H94 A;  4DZJ A;  4KA4 A;  1A36 A;  4KIC A;  1PP7 U;  5JLX A;  2VUM J;  1MIJ A;  3PFY A;  1O57 A;  2VKD A;  1WRJ A;  3OR2 C;  5L3E A;  1LUJ B;  2ZSH B;  1TT5 B;  3W2V A;  1SAX A;  3BG5 A;  2P6T A;  2Q1Z B;  3ZMZ A;  3JRC A;  1JKP C;  1LFB A;  3IH2 A;  2NAZ A;  2ZXJ A;  2F5D A;  3LSM A;  5KHD A;  2R5Y B;  1UFM A;  2PQ8 A;  4AU7 A;  3V8L A;  1ETK A;  4KDP A;  2W1O A;  2P5V A;  3HHH A;  5DDG A;  2FBH A;  3OL3 A;  1IAW A;  3ASO H;  3WU0 A;  3S1N J;  2WAQ A;  2NNN A;  1ORK A;  2V1U A;  2HDW A;  4IRH A;  2P7C B;  1JTY A;  3RDI A;  4IL6 C;  1MSF C;  2QEN A;  2CFO A;  4ABZ A;  3M3Y J;  2EPF A;  2RKH A;  2GLO A;  2V7F A;  1YLF A;  2VQC A;  3RQI A;  2KRC A;  1XMK A;  2KL4 A;  4XLC A;  5HNH A;  1W5T A;  3QPH A;  2YX7 A;  3D0S A;  2LF7 A;  3DXJ F;  5AON A;  2WB1 N;  4DZP A;  2VOD A;  5D4R A;  2EFW A;  3LSG A;  1XC5 A;  3JTG A;  4AUX A;  4P9U A;  5LFA A;  1MSE C;  5EJC A;  1MKM A;  2GAU A;  3LA2 A;  4KMU X;  3MN2 A;  3SDB A;  2CW7 A;  1KZH A;  4IO9 F;  1U78 A;  2W85 A;  6PAX A;  2HDC A;  5BPD A;  4D0P A;  4WX9 A;  5FD5 A;  3BCB A;  3QOE A;  5ICC A;  3PL8 A;  3LFU A;  4JYK A;  5BMZ A;  4XL9 A;  1F9N A;  3NAU A;  1VZ0 A;  2W00 A;  1BJZ A;  1F4K A;  3CCL I;  4BDZ A;  1FX7 A;  2W7N A;  3HOU J;  3HUG A;  3DLA A;  1RRJ A;  1T98 A;  3AFH A;  4XMY A;  1ON1 A;  4XM3 A;  2ME0 A;  3GBG A;  4IHW A;  3BJA A;  2MA3 A;  4DNC A;  2CV1 A;  4Y3O A;  4ZYG A;  4AIH A;  4XLF A;  4RB0 A;  5FB2 A;  5FO5 A;  2K27 A;  1RZ4 A;  4C3H J;  1P7J A;  2Y0M A;  4FX0 A;  2VT2 A;  1RR7 A;  2LR8 A;  1IGN A;  2IEK A;  1WJB A;  1U8B A;  1TQM A;  3J80 K;  1W0T A;  3I9V 2;  1GLN A;  1R4M B;  2XB5 A;  2BXY A;  2BVL A;  3LQQ A;  2X6O A;  1A35 A;  1KU7 A;  4G6T B;  2ZFW A;  3CMM A;  4LOC A;  2VE9 A;  2HNH A;  1U5T A;  4KIF A;  5FKK A;  4CGZ A;  1HOM A;  4NNJ A;  2P8T A;  1R22 A;  1IV8 A;  2QQ9 A;  2V9K A;  1KQ8 A;  3ABM H;  4F55 A;  1QQI A;  1APL C;  1ZG3 A;  3B02 A;  2YU9 J;  2P0W A;  3OS0 A;  5J4V A;  1ZGJ A;  4MFD A;  3IRR A;  2DW4 A;  3OIP A;  3CUQ C;  4A2U A;  2Z5U A;  4B4C A;  1BN5 A;  3GX4 X;  1CF7 B;  1Y8R B;  3SHF A;  2WWY A;  2CQQ A;  3BJO A;  3LSJ A;  4ENN A;  3ZQF A;  2XVC A;  4ITV A;  2CU7 A;  1FP1 D;  2HQ5 A;  1FIP A;  3HOY J;  1FY7 A;  2DQR A;  3E6M A;  1TWA J;  2DFI A;  5E3O A;  3ABT A;  3I4M J;  1G3W A;  3N97 A;  4PJL A;  4U0V A;  3WU2 C;  3L7W A;  2WY7 Q;  1N77 A;  4A12 A;  4BQN A;  4UXN A;  1FBU A;  3HUG B;  5HLH A;  2LLK A;  2V1D A;  3EUH C;  1TLH B;  5LHI A;  3E6B A;  1GV5 A;  3HPG A;  1V5G A;  4HLX A;  2V9P A;  3HTS B;  1R71 A;  2CV2 A;  2VPL A;  5FGM A;  2DI3 A;  1FIA A;  1ZRE A;  2IAI A;  2DPD A;  4W1U A;  1PUF A;  2XGX A;  3OR1 C;  1WI9 A;  4GCV A;  3JSP A;  3DTK A;  2R5Z A;  3G6E I;  2FX0 A;  2LSO A;  2DA4 A;  4BDY A;  2HTS A;  2Q0O A;  5DV5 A;  4PK4 A;  2O3F A;  4ENM A;  1RR8 C;  3FBN B;  5DUK A;  2QQA A;  3ABU A;  5ICG A;  4ZYA A;  2KP6 A;  1HQC A;  1RC9 A;  3QQA A;  4QSH A;  4HPQ A;  3MKY B;  2JVG A;  1STZ A;  1XN7 A;  1SAU A;  5D6F A;  3LWF A;  3VPR A;  1ZG5 A;  1A6Q A;  4AVZ A;  1HW2 A;  2LOO A;  5TGT A;  3JW4 A;  1W7P B;  3LAJ A;  5CJ9 A;  3FMS A;  3CCR I;  2GQQ A;  2QGU A;  1ETV A;  4PJM A;  2K3P A;  1UHS A;  1SMT A;  4R79 A;  2Y75 A;  2OAZ A;  4U87 A;  2GBY A;  3S3O A;  3ZQG A;  3KZI C;  3RPQ A;  3T8T A;  4KFC A;  3WTZ A;  2DT7 B;  5GAD J;  3ABK H;  1UHM A;  2P5L C;  5BOX A;  2STT A;  3A01 A;  2O9L A;  3M1E A;  1FSH A;  2IA0 A;  2RVC A;  4YFX F;  1OCR H;  2Y30 A;  5AIP A;  3H3V K;  5LEK A;  3E3V A;  1YX3 A;  1SC7 A;  2KPM A;  2R7V A;  5LGT A;  3U21 A;  1MJB A;  1TWH J;  3REO A;  3CLO A;  4M3B A;  1H9G A;  1AKH B;  1NK3 P;  3D5R C;  2D1V A;  2CRG A;  3L00 A;  2ECC A;  3I56 I;  3ZGK A;  2Q2E B;  4A3F J;  4E7S A;  1YTY A;  4R1H A;  3TKY A;  2CUF A;  3WTY C;  3D1N I;  4HSR A;  1KU2 A;  2O7O A;  3E97 A;  1JE8 A;  1OPC A;  3FMQ A;  3ZCO A;  4G7O F;  4ZH4 F;  5BQT A;  5K5Q A;  1T08 B;  2JSP A;  4ON0 A;  1I3Q J;  1VND A;  3B6A A;  2DJN A;  2L3D A;  3M8F A;  5EEG A;  1S7A A;  4XBF A;  2L4M A;  3U1K A;  1FZP B;  3ZMV A;  5LRR A;  2E1M C;  3QU3 A;  1S8N A;  3FF5 A;  2VKE A;  3KZZ A;  3K2A A;  2WAE A;  3NWT A;  3T5X A;  3EUK L;  3OYN A;  4A5M A;  2LRD A;  4OMZ A;  5LLQ A;  2LY1 A;  2VXD A;  4JX6 A;  4CH7 A;  5IP7 J;  5D5V B;  3WTV C;  2XB0 X;  2A5W A;  4A0Z A;  3TP0 A;  2VB6 A;  4IOC F;  3HYI A;  3LA7 A;  3CDI A;  3OYD A;  1VQ9 I;  3PSF A;  2MC4 A;  4RB2 C;  2D1H A;  1QPM A;  2CQ7 A;  2QA4 I;  1G8X A;  2IT0 A;  5M5X J;  3JTH A;  3CJN A;  3HRS A;  4BEH B;  2DN0 A;  4AC0 A;  4KT6 A;  2Y9Z A;  2JZY A;  2PX9 A;  4BE0 A;  1NK2 P;  5DM6 F;  1ETW A;  4BU2 A;  2DO7 A;  2DOE A;  4E7J A;  1IZ1 A;  3HTU A;  5J8C A;  3KFW X;  3BZC A;  3F8C A;  4XSZ F;  3IH4 A;  1DPU A;  5FLX Z;  3K9T A;  4RMN A;  3W6K B;  3MZH A;  1J59 A;  3AL0 B;  5A2Q K;  2ZO4 A;  3F8N A;  2XHK A;  5CYV A;  5FD6 A;  2BZT A;  4BHP A;  3MKW B;  3VYS B;  4L18 B;  1UB9 A;  1FBS A;  3FXL A;  2HKX A;  2M34 A;  4NQW A;  1ZQ3 P;  4MTE A;  2LY2 A;  2L01 A;  1Z67 A;  5F27 A;  5IP6 A;  3FXM A;  1JUS A;  1XCV A;  3PNY A;  1BJA A;  1QZZ A;  5B1B H;  1VF9 A;  3RI4 A;  3ERE D;  4RM3 A;  1MD0 A;  1M1E B;  2HQA A;  3U1D A;  3BG9 A;  4HF1 A;  4MLO A;  4MNU A;  2R7Q A;  5E1W A;  4BKX A;  2QM3 A;  4BQQ A;  2Q2E A;  2ZNZ A;  1ACI A;  3FXK A;  3Q3S A;  3LAP A;  1QVU A;  3TO6 A;  3LOC A;  2D45 A;  4I01 A;  1FMW A;  4CDG A;  2QZ8 A;  4D9J A;  4X6A J;  4ANJ A;  1I27 A;  4XOP A;  5CPR B;  5TRD A;  1LPQ A;  5L3B A;  4PFO A;  2ISZ A;  4RM2 A;  9ANT A;  2MD5 A;  4DBR A;  4GYI A;  4M72 A;  4CA0 A;  2EZH A;  3G1M A;  4RAY A;  4XOR A;  1UST A;  3VYU B;  2AXL A;  3Q9S A;  2AQE A;  4XN3 A;  1K78 B;  3ZR8 X;  1UMQ A;  2DJI A;  4IEJ A;  5BPI A;  4IHT A;  3FK6 A;  5AIQ A;  2XAG A;  3PQK A;  4ZTJ A;  3DBR B;  2NNY A;  3CCU I;  4RA2 A;  1U0J A;  2BE5 F;  2LG4 A;  1I6H J;  1MJA A;  3L9F A;  1GT0 C;  1Z0X A;  2EFQ A;  3NEU A;  1OMI A;  4ZZD A;  2LD5 A;  3AG1 H;  2K4J A;  3HOV J;  4KJZ A;  5JVT A;  3H92 A;  4A3K J;  4GXO A;  3CUQ A;  2X1D A;  2VXZ A;  5J1Y A;  3HM5 A;  1ON2 A;  1VQL I;  3ZP5 A;  5ERI A;  2O0Y A;  1MBK A;  3V4G A;  2KDO A;  5L3G A;  1NHA A;  3Q0W A;  1QZY A;  1E2X A;  1HDD C;  1D0Z A;  1Y1V J;  3TDZ C;  1V55 H;  2LK2 A;  2QSF X;  2DFH A;  1PP8 F;  3S2W A;  3DKW A;  1K6O A;  1ZRF A;  4DOZ A;  2JMW A;  2F4O B;  3WHB A;  3CJT B;  3OYK A;  1B72 A;  2ID3 A;  1BOB A;  1AKH A;  4G12 A;  3S2H J;  2VIX A;  2H1K A;  5F1J A;  1UEL B;  5ED4 A;  2DMU A;  1V54 H;  5CVJ A;  1SAN A;  5HS9 A;  2CW0 F;  2L9N A;  2IP2 A;  2OCE A;  2A3S A;  4LIV A;  3RQ4 A;  3OL4 A;  1YO5 C;  3GTO J;  4CCJ A;  3Q0U A;  5FFZ A;  5FLM J;  1U6G A;  1E17 A;  3CMA I;  1CQT A;  3PJR A;  3O8G A;  1DGR M;  4ZTF A;  3GUD A;  1ETQ A;  1OR7 C;  1U8R A;  3H0D A;  3ZN1 A;  2R7F A;  2L7F P;  1B8I B;  4KN7 X;  3G2B A;  2N8G A;  3KYL A;  2HTJ A;  1YFH A;  3RKX A;  1NH3 A;  1K6Y A;  5K5R A;  2FNA A;  4O3M A;  2ZFU A;  4PDK A;  2Y0S N;  5GPC A;  1RKW A;  1D1B A;  4M74 A;  1MBJ A;  3ML6 A;  2E35 A;  3HOT A;  2HU9 A;  3J81 K;  5KAI C;  2H09 A;  2KHM A;  1IF1 A;  4Q5S F;  1EV7 A;  1Z6R A;  3FWE A;  1ZAO A;  2W82 A;  3CLQ A;  4RAZ A;  4M3F A;  4L0Y B;  5LGU A;  2V26 A;  1JGG A;  1FBQ A;  4EJO A;  4HBL A;  1S7E A;  4ZYE A;  3IAM 2;  2IA2 A;  3NQO A;  4ZJZ A;  2E2I J;  3HL2 A;  3PIO F;  5JFR A;  2CMP A;  2K9Q A;  3CUO A;  4HNU A;  3FKI J;  2FML A;  1S3J A;  3OWT A;  2G7U A;  3BQZ A;  3TW6 A;  2ZME B;  2QBY A;  4MQ9 F;  5FRM A;  1H9T A;  1E3P A;  5BS6 A;  4EMS A;  1W4M A; 
#chains in the Genus database with same CATH homology
 3K1N A;  4AIK A;  2CYY A;  3GZ6 A;  3P7N A;  1ZAR A;  3KEQ A;  1USS A;  2A6E F;  3KLO A;  1SMY F;  3F8M A;  2RQP A;  2QUF A;  1J0R A;  4G9Y A;  3SZT A;  3VEP A;  3V7R A;  4R8H A;  4HOB A;  4MQV A;  3MFK A;  1FYL A;  2E1N A;  4Z2Y A;  4A0Y A;  4EM2 A;  3WTS C;  2NYX A;  3I59 A;  1IW7 F;  3GFJ A;  4LJZ F;  2M1B A;  4UV8 A;  1XD7 A;  1KYZ A;  1P4W A;  1R23 A;  2VC0 A;  2XAS A;  1MDM A;  3CTA A;  1HKT A;  5HS7 A;  4LMY A;  3TO7 A;  2M45 A;  3GYH X;  4BHC A;  2VBX A;  4ZYH A;  4A6D A;  2M8E A;  1HKS A;  4EV0 A;  1XMA A;  4CHU A;  3F72 A;  2HS5 A;  3WGH A;  3FHZ A;  2QWW A;  1WWX A;  4KMF A;  4DQ2 A;  2VN2 A;  4EGY A;  5LRS A;  4NB5 A;  1MZB A;  3E5Q A;  3Q9V A;  5ICE A;  3P9K A;  4MGR A;  5CLS A;  1B4A A;  3GEZ A;  2H27 A;  5E20 A;  4JK1 X;  3QAH A;  3FXQ A;  3IL2 A;  1CF7 A;  3SFZ A;  3HHG A;  4UVC A;  3QRF F;  3EQL F;  4MHG A;  4B8X A;  5HLI A;  3F22 A;  1O3R A;  1TW2 A;  3VB2 A;  2DK8 A;  3T1B A;  5JHU A;  3F8F A;  1IXC A;  3ZMS A;  3COA C;  3QPT A;  3I59 B;  2PEX A;  3VOD A;  4WK8 F;  2OA4 A;  4MEX F;  2KIF A;  3IC7 A;  2PN6 A;  2HEO A;  3ELK A;  3AAF A;  2FBK A;  2OD5 A;  4L9T A;  1SFX A;  3Q5F A;  3QOP A;  1FC3 A;  5HLG A;  1PDN C;  1XSD A;  3DFG A;  1HXD A;  1F1Z A;  3GO5 A;  1O3S A;  2R7D A;  3F6V A;  1S29 A;  2HYG D;  1OR7 A;  3KEO A;  4CIC A;  3LST A;  2MH2 A;  4HZF A;  4N9H A;  1GXQ A;  1KQ0 A;  4N0B A;  3SZP A;  3B73 A;  3HRM A;  4ENJ A;  2QQB A;  3T8R A;  4UNO A;  1G6N A;  1FLI A;  1BI1 A;  1FYM A;  4RGU A;  1A04 A;  4O5V A;  3E5X A;  4I0B A;  2YSR A;  4RB3 C;  2FU4 A;  1W5S A;  1BM9 A;  5DD4 A;  4TV7 A;  1Z91 A;  1SFE A;  1O7L A;  3NRV A;  2X0L A;  4P55 A;  2XV4 S;  4HV6 A;  1FOK A;  4OIP F;  4S05 A;  2AS5 F;  4S04 A;  3KZY A;  2RDP A;  2XKO A;  1KU3 A;  4LLN A;  4MEY F;  1DDN A;  4YII A;  4HAM A;  2DQL A;  2HYF A;  1Z05 A;  1L0O C;  4KN4 X;  4PZJ A;  1KGS A;  1IN8 A;  2STW A;  1WKM A;  3I0T A;  2RN7 A;  3RIR A;  1O7F A;  1XSX A;  3R60 A;  3ROU A;  2V6C A;  2BEO A;  5KK1 A;  4LK1 F;  4LLG F;  4HW0 A;  4OIQ F;  2QLZ A;  2A07 F;  2YX4 A;  5E18 F;  3FMR A;  3EUH A;  4UHT A;  1YW8 A;  4LGW A;  3V8K A;  2RGV A;  3ISP A;  4L0Z B;  3CDH A;  3F21 A;  1T2K A;  4G7Z F;  2VON A;  1SD6 A;  1Z9C A;  2XAH A;  2BV6 A;  2F5E A;  3F23 A;  2MC3 A;  2WV0 A;  3KE2 A;  4EQQ A;  3U9G A;  4AWX B;  2CWE A;  2YU3 A;  1ZRD A;  1FPQ A;  2X4H A;  2JRT A;  2JPC A;  1L3L A;  1BIB A;  2M30 A;  2FNP A;  3WTT C;  2GXG A;  2DK5 A;  1BI2 A;  3L2C A;  3ZMD A;  3R4K A;  2V79 A;  2FA5 A;  2K02 A;  3DEU A;  3ECH A;  3KP2 A;  2CGP A;  4IXA A;  3CUQ B;  3WE3 A;  1UHW A;  3ECO A;  3LA3 A;  2H6C A;  2EJR A;  2HFH A;  3J81 Z;  3J7A O;  2JTV A;  2NRA C;  3HRU A;  2A61 A;  3RPU A;  3DPL C;  2RV8 A;  2ETH A;  3MCZ A;  4ESB A;  1ULY A;  1HST A;  4BXU A;  1C0W A;  4HQE A;  1G3Y A;  4RGS A;  4HDU A;  1GHC A;  3K0L A;  3K1M A;  2W25 A;  1BBY A;  1V3F A;  1EH7 A;  3BZ6 A;  1K78 A;  3C7J A;  4Y13 A;  1IN5 A;  3I64 A;  4HV5 A;  4BQA A;  3DPT A;  5E17 F;  2CFX A;  2QYO A;  2VBY A;  3M9A A;  2A68 F;  1G3S A;  2GWR A;  3F6O A;  3PFI A;  3BY6 A;  5JR3 A;  1YW7 A;  4WCG A;  2DAO A;  3R6S A;  1F5T A;  2B0L A;  4UVB A;  3J80 Z;  3DQV C;  5HDG A;  4L5J A;  2BGC A;  3L09 A;  4G8X A;  5LBQ A;  2GA2 A;  1ZN2 A;  1TW3 A;  5K5O A;  1R7J A;  4GYG A;  3WGI A;  3ZPL A;  2LDU A;  5H20 A;  3HSF A;  4KT5 C;  2F5F A;  4K2E A;  1XDS A;  4ZZL A;  4HX8 A;  3U2R A;  1R36 A;  2M87 A;  3KP4 A;  4BNC A;  3RKW A;  1XCB A;  4FT8 A;  2MBF A;  5D5W B;  2F2E A;  4HQM A;  3RTR A;  3I53 A;  1BIA A;  2IVM A;  2V9V A;  1D5V A;  2V1X A;  2UXN A;  1TTY A;  5LEJ A;  2ELH A;  3HSE A;  3I71 A;  1U5T C;  4LD5 A;  3BJ6 A;  1KQ9 A;  3MAJ A;  1LQ1 A;  3G73 A;  1HBX G;  1WSU A;  2KIM A;  4I0A A;  2DBB A;  2G9W A;  3O2P E;  2MLK A;  1IXR C;  2PFB A;  1R5H A;  1K7A A;  2FEZ A;  1R1U A;  3MZY A;  1VTN C;  1SD5 A;  2KRF A;  5J6X A;  5DEQ A;  3IWZ A;  1XB4 A;  4H0E A;  2CQK A;  4CXF A;  2HWV A;  3KP7 A;  3QP5 A;  2A6H F;  4L9J A;  3FM3 A;  4KIG A;  5D8K B;  4YG2 F;  3GWZ A;  2ESN A;  1XSV A;  1J5Y A;  4I2O A;  1S6L A;  2Y48 A;  2JT1 A;  1PUE E;  1UCR A;  4M9X A;  2VC1 A;  2VOO A;  1LEA A;  2EV5 A;  2OZ6 A;  2A5Y B;  3QU6 A;  3C18 A;  4OIR F;  1R1T A;  3O6B B;  3WE2 A;  2XUB A;  2KJB A;  3H3Z A;  1JHF A;  3KP3 A;  1YQA A;  2W57 A;  1ZLK A;  2XRN A;  4HA8 A;  4FHT A;  4ENK A;  5D5U B;  3BWG A;  2XAQ A;  3HSR A;  5D5X B;  2Z9O A;  2TDX A;  2E7X A;  3IKT A;  3FZV A;  1HW1 A;  2P4W A;  2ZNY A;  4IF4 A;  2GA1 A;  2WTE A;  1P6R A;  1OYI A;  5L3D A;  1GVJ A;  4WXD A;  3EDP A;  3F8B A;  5H6Q A;  1Y0U A;  1MGT A;  3P9C A;  1B9N A;  2EFP A;  2COM A;  1R5G A;  2W84 A;  2HQR A;  5TJJ A;  1O3Q A;  3V7S A;  1YG2 A;  2ZBK A;  1X3U A;  2EFN A;  1FSE A;  4FX4 A;  2ACJ A;  2K86 A;  4P96 A;  2C6Y A;  1U5T B;  4QWQ A;  3DV8 A;  4HX4 A;  4EJU A;  5DD8 A;  4UVA A;  3BPX A;  3M8E A;  1I5Z A;  3JAM K;  4GGG A;  1TBX A;  2CG4 A;  3DF8 A;  3RJP A;  1BOA A;  2CO5 A;  3M7G A;  3RYR A;  4WF2 A;  2BYV E;  4OMY A;  2P6S A;  4GO1 A;  4YIF A;  4LK0 F;  2PLY A;  5FLX K;  1W7P A;  4E70 A;  1JGS A;  4WXH A;  3ZMU A;  4LLL A;  1OYW A;  1LJ9 A;  3BDD A;  3V7C A;  2Z3Y A;  4CO8 A;  4P9F A;  5ILV A;  3P9I A;  5ICF A;  2O61 A;  1V4R A;  3E6D A;  4O6J A;  3RYP A;  2BBY A;  3BPV A;  1YS7 A;  2XKP A;  4HX7 A;  5D8L B;  3ZMT A;  4RGX A;  4QLC U;  4M71 A;  2D2W A;  1H0M A;  3HIF A;  1FP2 A;  1WQ2 A;  5DUI A;  3R0J A;  2DPU A;  2EA4 A;  1B59 A;  1JHH A;  2GIV A;  4ESJ A;  2E7W A;  4IJA A;  1FT9 A;  1LB2 A;  2WC2 A;  1LNW A;  2UZK A;  1GXP A;  2EB7 A;  3GZ5 A;  3GFL A;  3KP5 A;  1DP7 P;  1LDD A;  1TQP A;  1KU9 A;  4A6E A;  2PI0 A;  1J7K A;  1Q1H A;  2EWN A;  3E5U A;  4EJV A;  4F7Z A;  4I09 A;  2EFO A;  4LG0 B;  3I4P A;  2EV0 A;  3VFZ A;  2FSW A;  3DP7 A;  1YIO A;  2HKO A;  1RNL A;  3CO7 C;  2ZKZ A;  4EGZ A;  3TQN A;  4M6X A;  3C3W A;  4A0X A;  2FMY A;  2DTR A;  3N4M A;  1ONV A;  4B09 A;  3OV8 A;  3FM5 A;  2W24 A;  1LDJ A;  1QNT A;  4RS8 A;  4EJW A;  2EV6 A;  2XRO A;  1ZHF A;  5LHH A;  1AOY A;  2GZW A;  2JPB A;  3O3K A;  1R58 A;  2HQN A;  5F64 A;  3HOS A;  4PCQ A;  4U0W A;  4YFN F;  3KP6 A;  1XGO A;  5A2Q Z;  2ZCW A;  1P2F A;  4PGG A;  2LF8 A;  5D6E A;  4AD9 A;  2DU9 A;  2YPR A;  2P7V B;  5FFX A;  4LFU A;  3GLX A;  1S7O A;  1ODD A;  1ZH5 A;  2ZJ2 A;  1J9I A;  4BHB A;  4KIB A;  4IRG A;  1YW9 A;  2VT3 A;  3IWF A;  2H6B A;  5F6F A;  4HYE A;  2RNJ A;  1B1B A;  2XIG A;  4JBA A;  2PMH A;  1YS6 A;  2FRH A;  3WTU C;  3BRO A;  2OQR A;  4KNY A;  4OIO F;  4IRI A;  2XAF A;  4M9S A;  2PJP A;  5CVU A;  4P5O A;  4Q48 A;  3W6J B;  4Q4Z F;  3WG9 A;  1D8J A;  1MDM B;  3ZN0 A;  1KYW A;  2J5O A;  2ZME A;  2QBY B;  2G7H A;  2E1C A;  4KUM A;  4XLP F;  4OOI A;  2L4A A;  3LQR A;  4CYD A;  1TNT A;  3E6C C;  1TQI A;  4BYY A;  2PMU A;  2IW5 A;  1FWZ A;  1J2X A;  4AVP A;  4Q47 A;  1I6X A;  3QP6 A;  2IA1 A;  4UV9 A;  4I98 B;  4WXC A;  3GFM A;  1XDU A;  5J8F A;  3FX3 A;  3JAM Z;  4I02 A;  1K79 A;  1DPR A;  3MEX A;  1I1S A;  5IT9 Z;  1KA8 A;  2K4B A;  1LDK B;  1SFU A;  2K7L A;  4G94 A;  5DCM B;  1OKR A;  1ZGA A;  3BP8 A;  4UUV A;  2IJL A;  3I58 A;  3IKV A;  2VE8 A;  1T38 A;  1T0F A;  1HW5 A;  1IUY A;  1R00 A;  2Z33 A;  1P4X A;  2ADU A;  2HZT A;  4L9V A;  2A69 F;  3WU1 B;  2DLL A;  3PQJ A;  5E1Z B;  3WGG A;  1BC8 C;  5E8G A;  1I1G A;  1IN6 A;  4CZZ A;  3F3X A;  1BI3 A;  4PGH A;  4M6Y A;  1XGN A;  3TDU C;  5EEH A;  3IHU A;  2KIU A;  3GFI A;  3R61 A;  1ZLJ A;  3KET A;  2OZU A;  4BAY A;  2MH9 A;  4N9I A;  1ZRC A;  2EK5 A;  2P5K A;  2HR3 A;  1ZG1 A;  1B6A A;  3TOB A;  2L54 A;  2O03 A;  5CVV A;  1EH8 A;  3I5U A;  4LB6 B;  1REP C;  5HS8 A;  4G6D A;  3WTW C;  2HGC A;  1MJ9 A;  2RC4 A;  3HRT A;  1QBJ A;  2L02 A;  4RGR A;  4OIN F;  5JI6 A;  3BOQ A;  4YFK F;  3D5L A;  5IT9 K;  1JXS A;  5IT3 A;  3K2Z A;  1P92 A;  1G3T A;  3R0A A;  2KJC A;  2OQG A;  1YYV A;  4G7H F;  3GVA A;  3K1P A;  1HSJ A;  2UWM A;  4ASN A;  1BI0 A;  2NS0 A;  1FNN A;  5DCM A;  1D8K A;  5CVR A;  1R1V A;  3V8J A;  4XRF A;  3GXO A;  2M5W A;  5ILU A;  4IPA A;  2OU2 A;  3JSO A;  3TOA A;  1SD7 A;  5LHG A;  3EET A;  4IVN A;  5HDN A;  4RB1 A;  4XLN F;  4HDV A;  3T0Y A;  4A5N A;  4L9N A;  1IN4 A;  5D4S A;  2FE3 A;  2O8X A;  4MTD A;  1P4A A;  1AWC A;  1QO0 D;  2IPQ X;  2VOP A;  2QVO A;  2DT5 A;  2FBI A;  5F1R A;  3EYI A;  5K1Y A;  3ULQ B;  2EA2 A;  2LNB A;  3LFK A;  1D3Y A;  4OU0 A;  2J5P A;  2FQ3 A;  2Q8K A;  4U7B A;  3I54 A;  2UXX A;  2XAJ A;  1XGS A;  2FOK A;  1RI7 A;  5ILS A;  2VBW A;  3SQN A;  1EH6 A;  4Y15 A;  4LB5 A;  4KYW A;  1W7P D;  2YR2 A;  2FF4 A;  5LGN A;  4IHS A;  3KCC A;  1Z1D A;  4NHJ A;  4AIJ A;  1T39 A;  2JSC A;  5L3F A;  5HVQ C;  2ESH A;  1IRF A;  1SD4 A;  5CVI A;  1OYY A;  3FXR A;  2GXB A;  2MLG A;  4ETS A;  1B9M A;  2PBI A;  5HOO A;  1IN7 A;  1BC7 C;  2CSO A;  1RUN A;  3WOD F;  4ESF A;  1Z7U A;  5KVR A;  1ZYR F;  3EYY A;  1J75 A;  1TNS A;  2F5C A;  3WTX C;  1U2W A;  3SXY A;  2Z99 A;  4HF2 A;  1XGM A;  3GF2 A;  4EVI A;  2HOE A;  4U7D A;  5HDK A;  1QGP A;  1LEB A;  3TGN A;  1T6S A;  3FXU A;  3IRQ A;  4EM0 B;  2FXA A;  1RIO H;  4EJT A;  1LVA A;  1O3T A;  1IRG A;  3CO6 C;  2VBZ A;  4LG0 A;  5L3C A;  1Z6T A;  3RKY A;  3MWM A;  1RUO A;  1U3E M;  3OOP A;  4U88 A;  3H3U A;  4G6Q A;  5E1X A;  5H6R A;  1HKQ A;  3MQ0 A;  2LKP A;  3ZQ7 A;  2PG4 A;  2R3S A;  2ISY A;  4HLY A;  5DCF A;  2IRF G;  3VOE A;  5DYM A;  4BH9 A;  4HF0 A;  1FYK A;  2O6G E;  4JQF A;  1G4D A;  4M9Z A;  2OBP A;  5E8I A;  2KKO A;  4WWC A;  4XSX F;  4U0Y A;  3G3Z A;  3K69 A;  3C1D A;  3TO9 A;  4M73 A;  1DUX C;  3KLN A;  4EM1 A;  3GW2 A;  4ZYD A;  4Y17 A;  4I7H A;  4L5I A;  1CGP A;  1IXS B;  2H94 A;  4KA4 A;  4KIC A;  1PP7 U;  1O57 A;  1WRJ A;  5L3E A;  1SAX A;  2P6T A;  3ZMZ A;  2NAZ A;  2ZXJ A;  2F5D A;  1UFM A;  2PQ8 A;  3V8L A;  4KDP A;  2P5V A;  3HHH A;  5DDG A;  2FBH A;  1IAW A;  3WU0 A;  2NNN A;  2V1U A;  4IRH A;  2P7C B;  3RDI A;  2QEN A;  2RKH A;  1YLF A;  1XMK A;  1W5T A;  3QPH A;  2YX7 A;  3D0S A;  2LF7 A;  3DXJ F;  5AON A;  2VOD A;  5D4R A;  2EFW A;  3JTG A;  4P9U A;  1MKM A;  2GAU A;  3LA2 A;  4KMU X;  6PAX A;  1U78 A;  2W85 A;  2HDC A;  5BPD A;  4D0P A;  4WX9 A;  5FD5 A;  5ICC A;  5BMZ A;  1F9N A;  1F4K A;  1FX7 A;  3HUG A;  1T98 A;  1ON1 A;  3BJA A;  2MA3 A;  4DNC A;  4ZYG A;  4AIH A;  4RB0 A;  5FB2 A;  5FO5 A;  2K27 A;  1RZ4 A;  2Y0M A;  4FX0 A;  2VT2 A;  1TQM A;  3J80 K;  3LQQ A;  1KU7 A;  2ZFW A;  2VE9 A;  1U5T A;  4KIF A;  4CGZ A;  2P8T A;  1R22 A;  2QQ9 A;  1KQ8 A;  1QQI A;  1ZG3 A;  3B02 A;  1ZGJ A;  3IRR A;  2DW4 A;  3CUQ C;  4A2U A;  2Z5U A;  1BN5 A;  3GX4 X;  1CF7 B;  3SHF A;  2WWY A;  3BJO A;  4ENN A;  2XVC A;  1FP1 D;  1FY7 A;  2DQR A;  3E6M A;  2DFI A;  3ABT A;  1G3W A;  3N97 A;  4U0V A;  3L7W A;  4A12 A;  4UXN A;  1FBU A;  5HLH A;  2V1D A;  5LHI A;  1TLH B;  3E6B A;  4HLX A;  3HTS B;  5FGM A;  2DI3 A;  1ZRE A;  2DPD A;  2XGX A;  1WI9 A;  4GCV A;  3JSP A;  2LSO A;  2HTS A;  2Q0O A;  5DV5 A;  2O3F A;  4ENM A;  5DUK A;  2QQA A;  3ABU A;  5ICG A;  1HQC A;  1STZ A;  1XN7 A;  5D6F A;  3LWF A;  1ZG5 A;  1HW2 A;  3JW4 A;  1W7P B;  3LAJ A;  5CJ9 A;  3FMS A;  2GQQ A;  1SMT A;  4R79 A;  2Y75 A;  2OAZ A;  3RPQ A;  3T8T A;  4KFC A;  3WTZ A;  1UHM A;  2P5L C;  5BOX A;  2STT A;  3M1E A;  1FSH A;  2IA0 A;  2RVC A;  4YFX F;  5AIP A;  5LEK A;  3E3V A;  5LGT A;  1MJB A;  3REO A;  3CLO A;  1H9G A;  2D1V A;  3L00 A;  1YTY A;  4R1H A;  3TKY A;  3WTY C;  1KU2 A;  3E97 A;  1JE8 A;  1OPC A;  3FMQ A;  4G7O F;  4ZH4 F;  5BQT A;  5K5Q A;  4ON0 A;  2L3D A;  3M8F A;  5EEG A;  1S7A A;  4XBF A;  2L4M A;  1FZP B;  3ZMV A;  5LRR A;  3QU3 A;  1S8N A;  3FF5 A;  3KZZ A;  3T5X A;  4A5M A;  4OMZ A;  5LLQ A;  5D5V B;  3WTV C;  4A0Z A;  3HYI A;  3LA7 A;  4RB2 C;  2D1H A;  1QPM A;  2IT0 A;  3JTH A;  3CJN A;  3HRS A;  2JZY A;  2DO7 A;  1IZ1 A;  3HTU A;  5J8C A;  3KFW X;  4XSZ F;  3F8C A;  1DPU A;  5FLX Z;  3K9T A;  3W6K B;  3MZH A;  1J59 A;  5A2Q K;  2ZO4 A;  3F8N A;  2XHK A;  5CYV A;  5FD6 A;  4BHP A;  4L18 B;  1UB9 A;  1FBS A;  4NQW A;  2HKX A;  4MTE A;  2L01 A;  1XCV A;  1BJA A;  1QZZ A;  3RI4 A;  3ERE D;  1MD0 A;  3U1D A;  4HF1 A;  4MNU A;  5E1W A;  2QM3 A;  2Q2E A;  2ZNZ A;  3LAP A;  3TO6 A;  2D45 A;  4I01 A;  4CDG A;  2QZ8 A;  1I27 A;  5TRD A;  5L3B A;  2ISZ A;  2MD5 A;  4GYI A;  4M72 A;  4RAY A;  1UST A;  2AXL A;  3Q9S A;  1K78 B;  5BPI A;  4IHT A;  5AIQ A;  2XAG A;  3PQK A;  2NNY A;  2BE5 F;  1MJA A;  3L9F A;  2EFQ A;  3NEU A;  4ZZD A;  1OMI A;  2K4J A;  5JVT A;  3H92 A;  4GXO A;  3CUQ A;  2VXZ A;  1ON2 A;  3ZP5 A;  5ERI A;  2O0Y A;  3V4G A;  5L3G A;  1NHA A;  1QZY A;  1E2X A;  3TDZ C;  1PP8 F;  3S2W A;  3DKW A;  1K6O A;  1ZRF A;  5ED4 A;  5CVJ A;  5HS9 A;  2CW0 F;  2IP2 A;  2A3S A;  1YO5 C;  5FFZ A;  1U6G A;  1E17 A;  3GUD A;  1U8R A;  3ZN1 A;  2R7F A;  4KN7 X;  2HTJ A;  1YFH A;  3RKX A;  5K5R A;  4O3M A;  2FNA A;  4PDK A;  4M74 A;  3ML6 A;  3HOT A;  3J81 K;  2H09 A;  4Q5S F;  1IF1 A;  1EV7 A;  1Z6R A;  3FWE A;  1ZAO A;  4RAZ A;  4L0Y B;  5LGU A;  1FBQ A;  4EJO A;  4HBL A;  4ZYE A;  2IA2 A;  3NQO A;  5JFR A;  3CUO A;  2FML A;  1S3J A;  2G7U A;  2ZME B;  2QBY A;  4MQ9 F;  1H9T A;  5BS6 A;  4EMS A;  1W4M A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...