3ULQB

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
b'VLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Gene regulation/transcription activator
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ulqB00
3GFLA 3E5XA 2RGVA 3LA7A 4Y17A 2HKOA 2R7FA 2NNYA 2P8TA 2RVCA 4O6JA 3J81K 2M45A 1T2KA 2O0YA 5HS7A 1RUOA 2V6CA 1W7PD 5ERIA 4U7DA 1XB4A 2GXGA 2EFOA 4P9UA 4KN4X 5LHHA 4XBFA 1R58A 4PZJA 4HF1A 2XAHA 3ZMVA 4A12A 1ZAOA 3ROUA 1BI3A 1GXPA 4L0YB 1ZH5A 5FLXK 3K1NA 4M9SA 3V7SA 4RB2C 2OZUA 4O3MA 2P6TA 2BEOA 4ENJA 2XAQA 3V8KA 5D5VB 3BJAA 3I64A 1CF7B 4HQEA 1YFHA 2A6EF 1XDSA 1NHAA 1Z1DA 2F2EA 2FBKA 4IJAA 3E6CC 4UV8A 3DP7A 4CICA 4N9IA 5CVVA 5EEGA 3U9GA 2PJPA 1LB2A 3SQNA 2ZBKA 1RI7A 4EJTA 2MA3A 3JTGA 1FYKA 2E1CA 3GX4X 1WWXA 1YW7A 1YW9A 3TO7A 2QVOA 3ABUA 2KRFA 3PQJA 3HOSA 4RS8A 3WTXC 3R60A 4A5MA 4L9TA 5ILVA 1SD7A 4EM1A 3K0LA 2FRHA 1FP1D 2ETHA 3TGNA 3CDHA 1WKMA 4IXAA 1O57A 3GO5A 5HVQC 4G7HF 2DFIA 1FSHA 3FF5A 4HX4A 3U2RA 1J0RA 2LNBA 2ZFWA 4M6XA 2XKPA 2QQBA 3VEPA 4H0EA 5HS9A 1K78A 2VBZA 4A0XA 3LA2A 1IAWA 1SD4A 1T38A 5E1XA 3V7CA 3N4MA 2CQKA 2DQLA 4P55A 1R5GA 5FB2A 1IF1A 5JR3A 3CO6C 2EK5A 4LG0B 3E5UA 3HSEA 4KIBA 2XGXA 3ECHA 2W84A 2F5CA 5BMZA 1SMTA 1QO0D 3WODF 5E1ZB 2EB7A 3GWZA 1J2XA 1S6LA 3QP6A 1TQPA 3O6BB 2H6BA 2XASA 2ESNA 2LSOA 3R0AA 4PGGA 5ILUA 2ISZA 4YFKF 2GZWA 4UUVA 4IRGA 3I0TA 4N0BA 1HKTA 2XAGA 1IN6A 3I53A 2QBYB 4AIKA 1XSXA 1AOYA 2PG4A 5ICGA 3WTUC 3FM5A 5FD5A 1T39A 4HW0A 2XROA 1CF7A 1UHMA 1ZG5A 3NEUA 4ASNA 2XRNA 2FF4A 4E70A 4ZYDA 2A68F 3WTWC 2Q0OA 3K1MA 5DCMB 4UNOA 4L9JA 1FX7A 3HTSB 2HWVA 4XRFA 1OR7A 2ZNZA 3FWEA 1W5TA 2RKHA 4HV5A 3K69A 3C1DA 1LEAA 1R00A 2HDCA 1R1TA 1IXRC 3V8JA 4G8XA 4OIRF 1WSUA 2FXAA 4HAMA 3KZZA 4OMZA 4IRHA 2NYXA 5D8LB 2OAZA 3MAJA 5HDNA 4JBAA 2E7WA 1QQIA 2A69F 4WCGA 3N97A 3MZHA 3M8FA 3R61A 1ZRDA 2ISYA 2DQRA 1O3SA 2OZ6A 2HYFA 4LD5A 3QP5A 1YYVA 1H0MA 1IRFA 4U0YA 3IWFA 2CO5A 4NHJA 1R36A 2H09A 4MHGA 2VXZA 1DPRA 4L18B 2HKXA 3HSFA 3RPQA 2COMA 1F4KA 1FLIA 1U2WA 2VODA 2D45A 1G4DA 3B73A 4KICA 1U5TC 1XMKA 4HQMA 3F8NA 1ON2A 2V9VA 3HRTA 2PN6A 4DNCA 3K9TA 2H94A 1IXCA 5HLHA 2W85A 3R0JA 4MTDA 1BC8C 2HGCA 2HYGD 2VBYA 5LEJA 4M73A 5J8FA 3I54A 1FC3A 2K4BA 4KYWA 3PFIA 3IKTA 1Z05A 4Z2YA 4G7OF 1BM9A 3JTHA 3ZN1A 3WU1B 4HDUA 1I27A 3O2PE 5A2QK 3TDZC 4AVPA 1Q1HA 3D0SA 1SFXA 4D0PA 1KU7A 3BPVA 1Z6TA 2D1VA 3BJOA 5IT9K 4HBLA 2VT3A 2QBYA 3WTVC 3WTZA 4BYYA 1STZA 1X3UA 3IRRA 4EM0B 1O3RA 1G3SA 4FHTA 1QZZA 3GLXA 2OQGA 3T5XA 1UCRA 1IW7F 2FBIA 5BOXA 1QZYA 2XUBA 4HX7A 1GXQA 2GA2A 3I4PA 3W6JB 4Y13A 4ZH4F 2OBPA 3I71A 2A5YB 2EV0A 5DCMA 5IT9Z 1J59A 3KLNA 3FMSA 2VBXA 2DBBA 4U88A 2A07F 1ONVA 4MQVA 4KMUX 4F7ZA 1Z6RA 5JVTA 3WGGA 1JE8A 1FYLA 2PI0A 1V4RA 3GW2A 4KDPA 3HSRA 4RGXA 2JPBA 1UFMA 2XVCA 3RYRA 3KEQA 3LFKA 2ACJA 5LBQA 4HF2A 2FBHA 4EJOA 5BPIA 5F1RA 1EH6A 1T0FA 2A61A 4MTEA 1LDDA 4ZYGA 6PAXA 4CGZA 4LFUA 3NRVA 2IJLA 2M30A 1JXSA 2P5VA 3WE2A 1HXDA 1J75A 1B1BA 3ECOA 1W7PB 2K02A 3T8TA 4S04A 2Z5UA 5K5RA 2NNNA 2M87A 1O3QA 2RNJA 1YS7A 5DEQA 5DDGA 1BI2A 1F1ZA 1HSJA 4OIQF 4KIFA 2K86A 2CWEA 5DYMA 2DK8A 2PLYA 4ESJA 4MEYF 2DT5A 4OINF 2GIVA 2HTSA 2FMLA 4OU0A 1D8KA 4M9XA 4Q47A 1XCBA 1ZREA 2UXXA 1MKMA 1YTYA 4KNYA 3ML6A 1IZ1A 1HSTA 3P9CA 3P7NA 5IT3A 5LGNA 2RC4A 5ED4A 2RV8A 2ELHA 4GYIA 1LQ1A 4ZYHA 3L09A 1W5SA 2PFBA 1ON1A 4P9FA 5FO5A 2E7XA 3MWMA 3JW4A 2GQQA 4G6QA 2EA2A 4L5IA 2MBFA 3JSPA 2W24A 4UVBA 1S8NA 1UB9A 5CYVA 2DLLA 3JAMZ 3GZ5A 2Y0MA 2F5FA 4ENKA 2MC3A 5JHUA 2K7LA 5LRSA 2P5KA 3RIRA 2CG4A 2R3SA 1T6SA 2ZCWA 5FD6A 5E17F 4U0WA 4L5JA 1QPMA 3S2WA 4ESFA 3Q5FA 4LK0F 1KU3A 4UV9A 2CGPA 4HLYA 3E6BA 5EEHA 2DO7A 3M9AA 4HV6A 1H9TA 5LRRA 2NAZA 3F22A 1ZYRF 5ICEA 4EJUA 1JHHA 1LDKB 3RTRA 2OQRA 4MEXF 3WGHA 2FU4A 1WQ2A 4ESBA 5L3EA 3F8MA 1KU9A 1IN7A 3BWGA 2CYYA 1BI1A 4M9ZA 2F5DA 3KP6A 5F6FA 3P9KA 1ZRFA 3ZMSA 5D6FA 2YX7A 5HDKA 2L01A 1TLHB 4FX4A 4G9YA 2DTRA 1W7PA 1RUNA 3C3WA 2WC2A 5KK1A 4Q4ZF 4I0BA 4I0AA 1L3LA 4HOBA 3ERED 4BXUA 2IVMA 2JPCA 3QU3A 1KYZA 2P7VB 3JSOA 2F5EA 4WX9A 1HW5A 2IW5A 3BROA 2Q8KA 4IF4A 3BJ6A 3HUGA 4IHTA 2QLZA 5LEKA 3QRFF 3TO9A 3DPTA 2KIUA 2L4AA 1R22A 4A0ZA 1R23A 4IPAA 1USSA 5LGUA 4QLCU 2GAUA 3BPXA 4LJZF 2JRTA 2HQNA 3ABTA 4WWCA 3IC7A 4ENNA 3ZMZA 2FMYA 2KIMA 4ZZDA 3QPTA 2A6HF 4BHBA 3CJNA 2IA2A 3H92A 2HEOA 3NQOA 4M74A 2H27A 1XN7A 3M1EA 1DP7P 1FY7A 2V1UA 3Q9SA 3J7AO 1ZLKA 3F6OA 2OA4A 1BC7C 2X0LA 1FP2A 5DV5A 2FA5A 1U6GA 1SFEA 1R1VA 3IWZA 4G94A 1Z9CA 2P6SA 4BH9A 2UZKA 1J5YA 4FX0A 2P7CB 4Q48A 1ZN2A 1KQ9A 1R1UA 2Z99A 1ULYA 2KJBA 5D5UB 4K2EA 2EWNA 3F72A 3I5UA 1WI9A 5D5XB 3CLOA 4KFCA 1SD6A 1RZ4A 1P4AA 2EFPA 5D4SA 1R7JA 1JHFA 5J8CA 2WWYA 2L02A 1USTA 3GEZA 4R1HA 3E6MA 3WTSC 3ULQB 2M5WA 1IXSB 1FBUA 2Z33A 4IHSA 4BNCA 2FOKA 1KGSA 1FYMA 4EQQA 2YX4A 3F8FA 4WXDA 5CVRA 5AIPA 3F8CA 3MCZA 4PCQA 3QOPA 3BY6A 2JTVA 4P96A 1U8RA 1L0OC 1GVJA 2G7HA 3EDPA 1IN8A 2WTEA 3HIFA 3HTUA 1XSVA 1WRJA 2Y75A 3ZN0A 3K2ZA 3RI4A 4RGSA 3MEXA 2DW4A 3WU0A 4Q5SF 2HTJA 4A6EA 2DK5A 4B09A 3J80K 4AIJA 1QBJA 1XCVA 1ZRCA 1DDNA 4LGWA 2R7DA 4A5NA 2H6CA 1HKSA 3M8EA 2O6GE 3WTTC 4CO8A 3CUOA 1K6OA 3CO7C 3DV8A 2VC0A 4BAYA 4HX8A 2O3FA 5TJJA 5D4RA 1SFUA 2NS0A 2MLGA 2HQRA 3FM3A 3PQKA 1XGMA 3VODA 3J80Z 3HHGA 3F6VA 2HR3A 3LWFA 4OIOF 4GO1A 3E3VA 1FWZA 3ZMUA 4CXFA 1HBXG 2EJRA 3COAC 2VE8A 1XDUA 1JGSA 3LAPA 4LLLA 1XGOA 2G9WA 4LB6B 2LF7A 4ZYEA 5E20A 2QM3A 2VC1A 3QAHA 3C18A 2UXNA 4DQ2A 5CJ9A 1YO5C 2ADUA 2BGCA 4A0YA 5DUKA 2W57A 3ZMTA 4EM2A 5TRDA 4L9NA 3EQLF 2IA0A 2O8XA 5JFRA 1KU2A 3E97A 3LQQA 3WGIA 1XSDA 3HRSA 1KQ0A 4AWXB 1H9GA 3C7JA 2L3DA 3RJPA 1PP8F 2KJCA 2KKOA 3H3UA 3O3KA 1HW1A 1XMAA 3KP3A 1YQAA 4AIHA 4KMFA 1YS6A 3TOAA 4NB5A 4BHCA 2ZNYA 3MQ0A 4XSXF 3KLOA 1TW3A 3IKVA 5H6RA 3HRMA 1BIBA 2W25A 4WF2A 4YFXF 3LA3A 3R4KA 4PGHA 3KP2A 1LEBA 2MD5A 5LLQA 2V1DA 4YIFA 4EJVA 2A3SA 1EH7A 3EUHA 3I59B 2VBWA 3CTAA 2LF8A 1OYYA 2IRFG 1DUXC 1REPC 3QPHA 3F21A 4JK1X 1S7AA 3BZ6A 2M1BA 3F23A 1MD0A 3JAMK 1OMIA 5CVIA 3IHUA 1O3TA 2PQ8A 4M72A 2JT1A 5L3BA 2BV6A 3RKYA 1OPCA 2QYOA 5K1YA 2UWMA 1Z91A 2VONA 1MJ9A 3HOTA 4HYEA 5FFXA 1MGTA 3OV8A 2PEXA 1SMYF 4GCVA 1PDNC 1BI0A 2YU3A 4MQ9F 5K5OA 1KQ8A 1MZBA 4EMSA 3DF8A 3KP5A 1YLFA 2XHKA 1IN4A 2FE3A 3ZPLA 4EGYA 5D8KB 3LSTA 4B8XA 2K27A 2ZXJA 2P5LC 4CDGA 3DXJF 3RKWA 3V8LA 2BBYA 1B6AA 2BE5F 3CUQB 1J7KA 5HLGA 2ZKZA 4L9VA 1YG2A 4MNUA 1XGNA 1OKRA 5E1WA 4L0ZB 1FPQA 4EV0A 2PMHA 3KEOA 4U0VA 1AWCA 4I7HA 1S3JA 3GFMA 5FGMA 5H20A 2J5PA 4LB5A 4R79A 1PP7U 3U1DA 4YG2F 2EFQA 5D5WB 1FNNA 1G6NA 3M7GA 3DPLC 3GF2A 3J81Z 3ELKA 3DEUA 1Y0UA 1S29A 1G3YA 1ZG1A 5LHGA 4XSZF 1U5TA 2CW0F 3HRUA 2FSWA 5KVRA 2HOEA 2YPRA 1SAXA 3KP4A 3T0YA 3TO6A 3TOBA 1XD7A 1ZARA 4U7BA 3FX3A 5FLXZ 3AAFA 2QWWA 3HYIA 1ZGJA 2XAJA 4ZZLA 4GYGA 1BJAA 5BS6A 3LAJA 2P4WA 1HW2A 5DUIA 1A04A 1OYIA 2B0LA 2D1HA 1D5VA 4P5OA 4G7ZF 1F9NA 1MJBA 2XAFA 1QNTA 3F8BA 3SHFA 2O61A 2QENA 2HZTA 2Y48A 2MH2A 1ZLJA 2STWA 3I59A 5AIQA 2NRAC 2TDXA 3BP8A 4OIPF 2RN7A 3L9FA 5E8GA 5JI6A 2FNPA 1ZG3A 2RQPA 1OYWA 3DKWA 4UXNA 3FXQA 3T8RA 2WV0A 1U78A 4CZZA 3TQNA 4HLXA 1P6RA 5BQTA 4WK8F 3KE2A 3K1PA 5F64A 3ISPA 4A2UA 3REOA 1YIOA 3RYPA 2J5OA 2LKPA 3F3XA 1MDMB 1O7FA 2ZMEB 1CGPA 3VFZA 2JZYA 2DPDA 1I5ZA 2DI3A 1Z7UA 3BOQA 4RGRA 1FZPB 3QU6A 4KT5C 4EGZA 3ZQ7A 3KZYA 2ZJ2A 2IP2A 3GUDA 1S7OA 5LGTA 2EFNA 2QUFA 3CUQA 4KIGA 5L3GA 4QWQA 4HZFA 3RKXA 2AS5F 3MZYA 5AONA 3KETA 4KA4A 5DD8A 4JQFA 4PDKA 5HOOA 3L7WA 1LNWA 2X4HA 2IA1A 2PBIA 3EETA 1TBXA 1TNTA 2K4JA 1B4AA 1P4XA 3W6KB 2FQ3A 4FT8A 3D5LA 4I2OA 3FXUA 2V1XA 4I09A 3BDDA 1IRGA 2EA4A 4OMYA 2BYVE 4UVAA 4I98B 1GHCA 4IVNA 5D6EA 1I1GA 5E18F 2PMUA 3RDIA 5CLSA 4XLNF 4BHPA 5CVJA 3GFIA 1FSEA 1K7AA 4RAYA 5L3DA 4KUMA 4I02A 1BBYA 3RPUA 3MFKA 2D2WA 3H3ZA 4YFNF 4LLNA 3SZTA 3WTYC 4UHTA 1LDJA 1EH8A 4NQWA 4EJWA 2VN2A 3WE3A 3EYYA 5ICFA 2IT0A 5H6QA 3VB2A 2MH9A 3R6SA 3ZMDA 3GYHX 4LK1F 5DCFA 1KYWA 2RDPA 4GGGA 3I58A 1O7LA 2DAOA 4IRIA 1TNSA 1YW8A 2Z3YA 2DPUA 3E5QA 1P92A 4RB0A 5J6XA 3FMQA 1T98A 1EV7A 2ESHA 4WXHA 3DQVC 1J9IA 1ZHFA 1KA8A 2CFXA 2AXLA 5CVUA 1TW2A 3GZ6A 2ZO4A 2G7UA 2OD5A 1RIOH 4XLPF 1LJ9A 2HS5A 1XGSA 2FEZA 2EV6A 1BOAA 2STTA 4HA8A 1K79A 3EYIA 1G3WA 4Y15A 3V7RA 2GA1A 1TTYA 2QZ8A 5ILSA 2FNAA 1FOKA 4O5VA 1MDMA 1G3TA 2ZMEA 3IL2A 1B59A 3KFWX 2DU9A 1LVAA 1B9NA 4LG0A 3VOEA 2QQAA 2JSCA 3V4GA 2MLKA 4WXCA 4LLGF 1IN5A 3TDUC 2O03A 4ENMA 1RNLA 5LHIA 2GXBA 4UVCA 2VE9A 3GXOA 4RGUA 1U3EM 3WG9A 2VOOA 3T1BA 3LQRA 1D8JA 3GVAA 1FBQA 2EV5A 3G3ZA 4N9HA 3TKYA 3G73A 1FT9A 2XKOA 2XIGA 1DPUA 5L3FA 4EVIA 4ON0A 4RB1A 1P2FA 2E1NA 5HS8A 3SZPA 1I1SA 2LDUA 1VTNC 2HFHA 2YR2A 2Z9OA 5K5QA 1TQMA 5A2QZ 4BQAA 3P9IA 1BN5A 2VT2A 3OOPA 4I01A 1R5HA 4KN7X 4RB3C 5ICCA 1U5TB 2OU2A 4LMYA 4HF0A 3FMRA 3KCCA 1V3FA 1D3YA 3FXRA 2CSOA 5DD4A 5HLIA 4TV7A 4RAZA 5L3CA 1BIAA 4R8HA 4ETSA 4M6YA 2L4MA 5BPDA 4S05A 2C6YA 3Q9VA 3B02A 1SD5A 1P4WA 1QGPA 2V79A 3GFJA 3L2CA 5HDGA 2VOPA 4GXOA 3CUQC 1TQIA 4YIIA 3HHHA 3SFZA 2EFWA 5E8IA 1B9MA 4CYDA 3L00A 4G6DA 4M71A 1IUYA 1E2XA 3KP7A 1HQCA 2GWRA 2XV4S 2M8EA 3FHZA 4AD9A 4OOIA 1I6XA 1PUEE 1E17A 1C0WA 5FFZA 1HKQA 3DFGA 3ZP5A 1ZGAA 2Q2EA 1K78B 3E6DA 1W4MA 4A6DA 1FBSA 2IPQX 2QQ9A 1ODDA 4HDVA 1F5TA 2KIFA 4CHUA 1UHWA 3FZVA 2L54A 2YSRA 1MJAA 3IRQA 4MGRA 3SXYA
chains in the Genus database with same CATH superfamily
3GFLA 3E5XA 2K3FA 2RGVA 3LA7A 4RAFA 4Y17A 1JKPC 5EF6A 2HKOA 3PIPF 5EG0A 5K7HA 2R7FA 4F91B 3HOYJ 2NNYA 2P8TA 2LY9A 2RVCA 2EIJH 4O6JA 3J81K 2M45A 4FE7A 1T2KA 1X2NA 2I10A 2XC7A 2DA6A 4PJ0C 2HDDA 1K6YA 3ERMA 2O0YA 1ORKA 5HS7A 1RUOA 2Z2SB 1RPWA 2V6CA 1W7PD 3H0GJ 5ERIA 4U7DA 1WH7A 1T56A 2PJRA 1XB4A 2GXGA 3BR5A 2EFOA 2A6TA 4RM2A 2XPUA 1WJBA 4P9UA 1MSEC 5J40A 4KN4X 5LHHA 3DKXA 4E4HA 1YX3A 2ZFUA 4XBFA 1R58A 3ZQQA 4PZJA 4HF1A 1ETXA 1EA3A 2XAHA 4IHVA 3ZMVA 2CS3A 4A12A 1ZAOA 3CCSI 2F4IA 3OIPA 3ROUA 2W48A 1BI3A 1GXPA 4L0YB 1ZH5A 1SVLA 1MNMC 2L9RA 2GXAA 5FLXK 4BGDA 2HVRA 2R5YA 3K1NA 4IO9F 4M9SA 2QQ8A 3K4LA 3V7SA 4RB2C 2OZUA 3S16J 4O3MA 2P6TA 2QA4I 1H88C 3PJRA 4XR6A 3M8JA 2BEOA 4ENJA 2XAQA 3V8KA 5D5VB 1IDYA 1K4SA 3BJAA 3I64A 3L1PA 4RA2A 1CF7B 3TP0A 5IOYA 3VWBA 4HQEA 3HEFA 3QODA 4AYBN 3A01B 1YFHA 2A6EF 1XDSA 4II3A 1M1EB 1NHAA 1Z1DA 2F2EA 4C3IJ 2FBKA 1MH4A 2K9NA 4IJAA 4HSRA 3E6CC 3N05A 4UV8A 3DP7A 4CICA 2ZMEC 1XPXA 1WCMJ 4N9IA 5CVVA 5EEGA 5TGTA 3U9GA 4PSXA 3S3MA 3A0HC 4F55A 2Y0SA 4U87A 2PJPA 1LB2A 5C44J 3SQNA 2ZBKA 1RI7A 4EJTA 2QCOA 5M5XJ 3HOUJ 1HF0A 2MA3A 3JTGA 2JQ7A 1FYKA 2E1CA 3GX4X 4E7SA 1IGNA 1WWXA 3FK7A 1YW7A 1YW9A 3TO7A 4LITA 2QVOA 3ABUA 2VLAA 4LIUA 2KRFA 1Y56A 3PQJA 1TL8A 3HOSA 1K83J 3JRCA 4RS8A 1S7EA 4Z6YA 3WTXC 3R60A 3BC8A 4A5MA 4L9TA 5ILVA 1SD7A 4EM1A 2K5CA 3K0LA 2FRHA 1FP1D 5IP7J 3L2WA 1IJWC 2ETHA 3TGNA 5E3NA 3CDHA 3Q0WA 1WKMA 2R7WA 1VQ8I 3LSIA 4IXAA 1O57A 1TT5B 3GO5A 5HVQC 4G7HF 2DFIA 4MFEA 3FF5A 4BDZA 1FSHA 4HX4A 3U2RA 1J0RA 2LNBA 2M2EA 2ZFWA 4M6XA 2XKPA 2EZKA 1UHSA 1GLNA 2QQBA 3NWTA 4M3GA 3IH3A 3VEPA 5HS9A 4H0EA 3U1KA 1K78A 3KYDB 2VBZA 4G12A 2CMPA 4A0XA 3LA2A 2FQ4A 1IAWA 3DEEA 1SD4A 2M4GA 2LY2A 3S2DJ 4OAZA 1T38A 3H5AA 3BR1A 5E1XA 1QVTA 3V7CA 3N4MA 4AUXA 2CQKA 5JLWA 1JKOC 2DQLA 1MBEA 4NNJA 4BUPA 3S8PA 1A6IA 4Y33A 4P55A 2WA0A 2JUCA 5IYBJ 1R5GA 5FB2A 4ANJA 1IF1A 5JR3A 3CO6C 3CP2A 2EK5A 3CJTB 1IUFA 2LYCA 4LG0B 2WAQN 1MIJA 3E5UA 2DJNA 3GBGA 3HSEA 3K7AJ 4KIBA 3SDGA 4AU7A 3AL0B 5FJ8J 2XGXA 3ECHA 2W84A 2F5CA 2OF7A 5BMZA 3HOWJ 1SMTA 1QO0D 4V2FA 3WODF 4XKCA 5EJCA 3CMMA 1TP4A 1MBKA 3IAS2 1SFOJ 5E1ZB 3DTKA 3IAM2 2EB7A 2R7OA 3GWZA 1J2XA 1S6LA 5GADJ 4AYBA 4RAGA 3QP6A 1TQPA 3O6BB 2H6BA 4DOZA 3V42A 2XASA 2ESNA 2DJIA 2LSOA 3R0AA 4PGGA 1NG6A 3VYRB 3DBRB 3LNQA 1B8IA 3OR2C 5ILUA 1OCTC 3DEWA 2NVUB 2ISZA 4YFKF 4ZDLA 3CLQA 4PUSA 2GZWA 5F08A 4UUVA 1FOXA 2E1OA 4IRGA 2O8KA 3I0TA 1LKXA 4N0BA 1HKTA 2XAGA 1IN6A 3I53A 2QBYB 2R7ZJ 4AIKA 2VKDA 1XSXA 1AOYA 1JJ6C 1V55H 2PG4A 5ICGA 3WTUC 2OCEA 3K4MA 3FM5A 2A5WA 5FD5A 1WPKA 2VJJA 1T39A 2R0QC 3KIOA 5KCMA 1BR4A 4HW0A 4A3BJ 2XROA 1CF7A 1YRNB 1UHMA 1MMGA 1ZG5A 3NEUA 2LRDA 4ASNA 3BQYA 2XRNA 2FF4A 3ZQHA 1LE8B 4E70A 4ZYDA 2JA8J 2A68F 3WTWC 1Z3XA 5GAEJ 3J7YJ 2Q0OA 2HPIA 2OPTA 1GVDA 3K1MA 1VFCA 5DCMB 4UNOA 4XRMA 4L9JA 2F4MB 2HXOA 2M34A 3CC7I 1FX7A 4C2MJ 3HTSB 1LUJB 2HWVA 4XRFA 1OR7A 4ZC3A 2ZNZA 3FWEA 4F92B 1W5TA 3RKQA 1W0TA 2RKHA 1WJEA 4HV5A 4A3FJ 2LBFA 2JVHA 3K69A 3C1DA 4AIDA 2L7FP 1LEAA 3L2RA 1R00A 2HDCA 1R1TA 1IXRC 3V8JA 2VIXA 4CCLA 2E35A 2VB6A 3LSGA 4G8XA 4OIRF 3KYLA 5CQGA 1FTTA 1MBFA 2XB0X 1WSUA 2FXAA 4XL9A 5GTHC 4HAMA 3KZZA 4OMZA 2OV7A 4IRHA 2NYXA 3NAUA 5D8LB 2OAZA 4DGWB 1JTXA 3MAJA 3H3VK 5HDNA 4JBAA 1TWGJ 2K9LA 2QKLB 2E7WA 4BQNA 2XPWA 3ZQCA 1QQIA 2A69F 4WCGA 1FOYA 2M4KA 3BTLA 3N97A 1ZKGA 3MZHA 3MD2A 3M8FA 2DA4A 1Y1VJ 3R61A 1ZRDA 3Q0UA 2ISYA 2DQRA 1O3SA 2OZ6A 3ZRGA 4M6VA 2HYFA 4LD5A 4HRIA 1OISA 2WADA 3QP5A 2CQ7A 1YYVA 4D5CA 1MW7A 1H0MA 3CC2I 1OFCX 1JT6A 3A02A 2YUSA 1DGRM 2ZXHA 1WVRA 2VKEA 1IRFA 4U0YA 3IWFA 2LOOA 2BZTA 2CO5A 3KEYA 2DOEA 5IY5H 4NHJA 1Y1WJ 1R36A 5BNGA 2HVQA 2H09A 2E71A 2NOGA 4MHGA 1EF4A 2VXZA 4CCJA 2R7SA 3OWTA 1DPRA 1XTAA 4L18B 2HKXA 3HSFA 3TP3A 3RPQA 2COMA 1KONA 1BL0A 1F4KA 2IGNA 3JCUC 4BE2A 3HZJA 1FLIA 4ZDOA 3ZQIA 1U2WA 1PUFA 3PIOF 2VODA 1NH3A 3HXLA 3F0CA 2D45A 4B48A 3K4BA 1G4DA 3B73A 4KICA 1U5TC 1XMKA 4HQMA 3F8NA 1ON2A 2V9VA 3HRTA 2PN6A 4DNCA 1TWFJ 1BOBA 3K9TA 2H94A 1IXCA 4B3AA 2LH9A 2L7ZA 5HLHA 1GV5A 3VSKA 1EKEA 2W85A 3R0JA 3ZOBA 5M3FJ 2CJJA 4MTDA 3C2HA 1BC8C 2HGCA 2HYGD 1ETKA 2VBYA 1R5ID 5LEJA 5F1JA 3C2GA 4M73A 5J8FA 3I54A 1VQKI 4XRSA 2VL8A 1XX5A 4E7IA 1FC3A 1UAAA 2K4BA 4KYWA 3PFIA 2Y69H 2E5ZA 3IKTA 1Z05A 4Z2YA 4G7OF 1BM9A 3JTHA 3ZN1A 3WU1B 4H4KC 4HDUA 3QPLA 1I27A 2UUZA 3O2PE 3TDZC 5A2QK 4AVPA 1YITI 1Q1HA 3D0SA 4F3QA 1SFXA 4D0PA 1KU7A 1QHGA 3BPVA 5DTDA 1RC9A 1Z6TA 2D1VA 2DDAA 3BJOA 5IT9K 1Y0NA 4HBLA 3CQZJ 2W82A 2KISA 2VT3A 2QBYA 3WTVC 3WTZA 5CQEA 2NVXJ 4BYYA 3O8GA 2KDOA 4I6ZA 1STZA 5F0HA 1X3UA 1ETQA 3IRRA 4N4OB 4EM0B 4BY7J 1LFUP 1QVUA 1O3RA 1G3SA 1N75A 4FHTA 1E3PA 5IP9J 1QZZA 3GLXA 2OQGA 3T5XA 4AM3A 2QEXI 1UCRA 1IW7F 4NBQA 2FBIA 3DBHB 2EZHA 5BOXA 1QZYA 2XUBA 4HX7A 4MLOA 1GXQA 2GA2A 3I4PA 3WHCA 4C9YA 4CZCA 3W6JB 4Y13A 2BHZA 4ZH4F 3M3YJ 2OBPA 3I71A 2DMNA 3CESA 3FBNB 1MMSA 2A5YB 2V9PA 2EV0A 5DCMA 2CQNA 3CCQI 4V2GA 2IEKA 3S14J 5IT9Z 1J59A 3KLNA 2XSJC 3FMSA 3GMEA 2VBXA 4YRVA 2DMPA 2HQ5A 2WB1N 2DBBA 2GM4A 2L7MP 2YS9A 3S15J 4U88A 3TEDA 1ONVA 1X3WB 2A07F 1GT0C 4MQVA 2R7UA 5C4JJ 2IGMA 4KMUX 2NS8A 4UUTA 3BR6A 4IKFA 3G2BA 3VYUB 4F7ZA 1Z6RA 5JVTA 3WGGA 5TISC 4XKVA 1JE8A 3ZCOA 1FYLA 2PI0A 1V4RA 3GW2A 4KDPA 3HSRA 3I55I 3IH2A 4RGXA 3BZKA 2JPBA 1UFMA 3SYTA 4XN0A 2XVCA 5IYCJ 4BJ5C 1RKTA 3ABMH 3RYRA 4IQJA 3KEQA 3LFKA 5EDNA 5LBQA 2ACJA 4HF2A 2FBHA 4EJOA 2E19A 5BPIA 1WFXA 3MKYB 5F1RA 4IZZA 1EH6A 1T0FA 3PFYA 2DA2A 2A61A 3ESWB 3I4MJ 3VSLA 4MTEA 1LDDA 2KQRA 2DMTA 4ZYGA 6PAXA 2JVGA 4CGZA 4LFUA 3NRVA 3OYCA 1E3HA 3QYBA 4NDLA 2IJLA 2X9DA 2M30A 1FJLA 3EUAA 1JXSA 4FQGA 2P5VA 2W1OA 4IHWA 3WE2A 1HXDA 1J75A 1B1BA 4DIQA 3ECOA 2CQXA 1W7PB 1GUUA 1GV2A 4XONA 2K02A 1RRJA 5E79C 3T8TA 2YU9J 4S04A 2Z5UA 5K5RA 4QIWN 1S9HA 2NNNA 3W6VA 1V5GA 2M87A 2I5UA 1O3QA 2RNJA 4IOCF 1YS7A 4YEJA 5DEQA 2HXIA 2CFOA 3SEQA 5DDGA 1MBHA 2VPLA 1BI2A 1F1ZA 1QA6A 5J1UA 3G1MA 5EZHA 1HSJA 2JMWA 4OIQF 4KIFA 2K86A 2OTLI 2CWEA 4CSWA 5DYMA 2HOSA 2ZJQF 4A3CJ 3LMMA 2DK8A 4BY1J 2V7FA 3HUGB 1HDDC 1DU0A 2PLYA 2P81A 4MEYF 4ESJA 4F52A 1OR7C 2DT5A 3FXLA 4OINF 2ME6A 2GIVA 3PNYA 2HTSA 2FMLA 1TZLA 4OU0A 1D8KA 4M9XA 2HVSA 4Q47A 1XCBA 1ZREA 3DLAA 2UXXA 1MKMA 1RETA 4A3EJ 2KT0A 1YTYA 4KNYA 2XF7A 3ML6A 1IZ1A 1HSTA 4A3JJ 2XGDA 3P9CA 1IC8A 3P7NA 5IT3A 5LGNA 2RC4A 5ED4A 2X1DA 3H9QA 2RV8A 3OYIA 2K3PA 2ELHA 2JRMA 2V26A 4GYIA 1LQ1A 2B7EA 4ZYHA 3L09A 4B3XA 2KDZA 1W5SA 2CUEA 2PFBA 1ON1A 4P9FA 5FO5A 2E7XA 4GDFA 1D0ZA 1POGA 2LKSA 3MWMA 3ZQGA 3JW4A 5E3OA 2GQQA 4G6QA 2X6XA 1I50J 2EA2A 4BS9A 4L5IA 3CF5F 2MBFA 3JSPA 2W24A 4UVBA 2AQEA 1IO2A 5GPAA 1S8NA 2ME0A 1UB9A 4QTRA 1X1BA 1W36D 1B8IB 5CYVA 2WB1A 4UB8C 3HM5A 1ZELA 3GTOJ 2DLLA 5FROA 3FHNA 3JAMZ 1VQPI 4BJ6C 1VI0A 5E3MA 3PSFA 2GLOA 3GZ5A 2Y0MA 4JOMA 2OC6A 2F5FA 4ENKA 2MC3A 5JHUA 3OYEA 2K7LA 5LRSA 2IS6A 1MMDA 2XF5A 2P5KA 1YX5A 3RIRA 5FRMA 1X1AA 2QKMB 2CG4A 2R3SA 1T6SA 2ZCWA 4BXFA 5FD6A 5E17F 4U0WA 4L5JA 4D9JA 2DA3A 1QPMA 1WJFA 3S2WA 4XOPA 2VQGA 4ESFA 5CPRB 1X1CA 4B43A 3MKLA 3Q5FA 2AO9A 4LK0F 1KU3A 4UV9A 3H9JA 2CGPA 1FTZA 4HLYA 3E6BA 1R49A 2X6WA 2DO7A 5EEHA 2VQLA 3QYFA 3M9AA 4HV6A 1H9TA 4ZJZA 4XRSG 5LRRA 2NAZA 3F22A 1ZYRF 4CCMA 5ICEA 4C30A 4EJUA 4RM3A 2XGEA 2RAEA 3A03A 2LBFB 2XRLA 1YIJI 3GTKJ 2LMDA 1JHHA 1LDKB 2L7KA 2E60A 3RTRA 3AL0C 5FKLA 3RZOJ 3VYTB 2OQRA 3WG7H 4MEXF 3WGHA 2FU4A 1WQ2A 4ESBA 5L3EA 1SC7A 2FJ1A 3F8MA 1D1AA 3IUOA 3OYGA 1D0XA 2LREA 1KU9A 1IN7A 3BWGA 2CYYA 1N78A 1BI1A 4M9ZA 4Y3OA 4FE4A 2F5DA 3G1OA 1WHUA 3KP6A 4QPOA 3CCEI 5F6FA 3P9KA 1ZRFA 3ZMSA 4AC0A 1MMNA 1UG0A 2EBIA 5D6FA 2YX7A 5HDKA 2L01A 1TLHB 4B47A 3HPGA 4FX4A 3I56I 4G9YA 2DTRA 1W7PA 1RUNA 3C3WA 2WC2A 5KK1A 4Q4ZF 2NS7A 3K70D 2DTZA 4I0BA 2FX0A 4I0AA 3OS2A 1L3LA 3JR9A 3ASNH 4HOBA 2OJED 3K10A 3ERED 4BXUA 2IVMA 2JPCA 3QU3A 3CCJI 1KYZA 2P7VB 3JSOA 4M3FA 2MD0A 4Y52J 3OIOA 2NVQJ 1V54H 1WJAA 2F5EA 4WX9A 3SJMA 1HW5A 2IW5A 4BBRJ 1A36A 3BROA 5FKMA 2Q8KA 4HNUA 3LL7A 3QPSA 4IF4A 1PUFB 3BJ6A 3HUGA 4BDYA 4BKXA 1X1DA 3D5RC 4IHTA 2QLZA 3M1CA 2XGCA 5LEKA 3QRFF 3BCAA 3X2QH 3GTMJ 3W2AA 3TO9A 3DPTA 2KIUA 2L4AA 1R22A 3FKJA 1OCZH 1R23A 4A0ZA 3UKGA 4IPAA 1USSA 1ERDA 3J7ZI 1Y8RB 5LGUA 4QLCU 2GAUA 1AHDP 3RPUD 2MW8A 3BPXA 1BR2A 3OYFA 1N77A 2KLOA 1MBJA 1W5CC 2JRTA 1VNDA 2EZIA 2HQNA 4LJZF 4XORA 2OCCH 4JX5A 3ABTA 4WWCA 2ZXIA 2E2JJ 4F93B 3IC7A 4ENNA 3ZMZA 2R7XA 2FMYA 2KIMA 4ZZDA 3QPTA 2A05A 2NVTJ 2A6HF 2Z16A 1HC8A 2R4GA 4UUSB 4BHBA 2HI3A 3CJNA 2IA2A 3H92A 2HEOA 3NQOA 2EQRA 4M74A 2H27A 1U9OA 1XN7A 3M1EA 1FY7A 5EGOB 1DP7P 5IOZA 2X48A 3L2UA 2V1UA 1T0FC 1XC5A 2F6CA 3ZQFA 2DYSH 3Q9SA 3J7AO 1ZLKA 3F6OA 2OA4A 4A3MJ 2E1MC 2VPRA 2X0LA 1BC7C 1FP2A 1VQLI 5DM6F 1P7JA 5DV5A 2FA5A 1U6GA 4JX4A 4IOAF 2L9SA 3LFUA 4XM3A 1SFEA 2TCTA 1R1VA 3IWZA 4G94A 1F36A 1Z9CA 2P6SA 3OL3A 4BH9A 2QSFX 3L2VA 2UZKA 1J5YA 2WY8Q 3HGYA 4C3JJ 4ZYAA 2OTJI 1QHHD 4FX0A 1GDTA 3BG7A 3FKIJ 2P7CB 4Q48A 1ZN2A 1KQ9A 4HNVA 1R1UA 3BR3A 2L9VA 1ULYA 2KJBA 2Z99A 5D5UB 3DPUA 4K2EA 2EWNA 1QRYA 1V5EA 1AKHB 3F72A 2M7AA 1W0UA 3W3CA 1YHQI 3I5UA 1WI9A 5D5XB 2CV2A 3CLOA 4KFCA 1SD6A 2KFDA 3UR3C 3W2VA 1RZ4A 3DLLF 4FTHA 1LVKA 5EZGA 1P4AA 2EFPA 3GTJJ 5D4SA 1R7JA 1JHFA 5J8CA 3BQZA 5KAFC 2L02A 2VASA 3G6EI 2WWYA 1USTA 3GEZA 4R1HA 3E6MA 4XICA 3WTSC 5FLVA 3ULQB 2M5WA 1IXSB 1FBUA 5B66C 3OSFA 3D5SC 2Z33A 4IHSA 4BNCA 2FOKA 3WHBA 1KGSA 2ID3A 2XPVA 1FYMA 2LVSA 3H35A 4Y4RA 4EQQA 4W1UA 3K2AA 4JP0A 2R7QA 3P5JA 2ZSIB 2YX4A 4E7HA 1B72B 3HC7A 3F8FA 4WXDA 3BCBA 5CVRA 5AIPA 3F8CA 4BEHA 1JI8A 3MCZA 4PCQA 2BXYA 2X6OA 3QOPA 3BY6A 2JTVA 3L2QA 4P96A 5E3LA 1U8RA 1L0OC 2DOAA 4X0GA 2GBYA 3DWLE 1GVJA 2G7HA 2VKHA 2WBMA 1ZR2A 1WZ2A 2L2OA 1XG1A 3EDPA 1IN8A 2MFZA 2WTEA 3HIFA 3HTUA 1XSVA 3BG5A 1WRJA 2Y75A 5DS9A 4M3EA 2LR8A 4C2TA 2H1LA 1N25A 5EYRA 2E1MB 1U8BA 3ZN0A 3K2ZA 4CUGA 3RI4A 4V19K 4RGSA 3MEXA 3HDDA 2DW4A 2P0WA 4BL0B 5IYDJ 1NG7A 3WU0A 3JRBA 4Q5SF 1G8XA 2HTJA 2H8RA 4A6EA 2DK5A 4B09A 1W1WE 2ECCA 4M3DA 3W2WA 4BBSJ 3J80K 4AIJA 3G71I 3DBLB 3CMEI 1UG2A 3CF2A 4RLQA 3CCLI 2QSGX 5EEAA 3ABKH 3OR1C 2CUJA 1QBJA 1XCVA 4PSWA 3S3OA 4DZJA 1ZRCA 1DDNA 2JJ7A 2GIZA 2Y2ZA 4KJZA 4LGWA 1SVOA 2R7DA 1X2MA 4HG2A 4A5NA 3CDIA 2H6CA 3GTPJ 1HKSA 2EH3A 2CQQA 3DTEA 3M8EA 2O6GE 3WTTC 1HCRA 4CO8A 3CUOA 1K6OA 3CO7C 1WJ5A 3CCRI 3DV8A 2CV0A 4D7NA 2VC0A 4BAYA 2VKVA 4HX8A 2JSPA 3E1SA 2L0KA 2O3FA 4P1WA 1VQ5I 1Z7LA 5KAIC 2CH0A 2X1CA 1VQ4I 1DU6A 2JN6A 4PJMA 2MABA 1X3ZB 2WY7Q 5TJJA 5D4RA 3SFIA 1SFUA 2NS0A 1A31A 2MLGA 2HQRA 3FM3A 3BG6A 3PQKA 1XGMA 2LLKA 1T8IA 2OUMA 5J3LA 4UY8I 3VODA 5IP6A 4E7JA 4UUSA 3J80Z 3HHGA 3F6VA 1E0EA 4YIRX 1VQOI 5EGOA 2X51A 3GTGJ 3S93A 2JA7J 2HR3A 3LWFA 3TBIA 5K7FA 3BLYA 4OIOF 4DBQA 2QGUA 4I99C 4DYRA 4GO1A 3E3VA 4XMYA 1FWZA 3ZMUA 4HPQA 2ZJRF 5IPAA 4CXFA 2ZB9A 1HBXG 2EJRA 2XAUA 1VZ0A 3COAC 4EATA 5KHDA 2MC4A 1FMVA 2VE8A 3CJQB 2R93J 5F27A 5FKNA 3TW7A 1XDUA 1JGSA 3FIWA 3GCMA 1W36C 3LAPA 4LLLA 1XGOA 3G4SI 1Z67A 5FKOA 2G9WA 4LB6B 3I4NJ 2LF7A 4ZYEA 4IHYA 5E20A 3ONQA 3RQ4A 3PNVA 2FUG2 2QM3A 2N8GA 2VC1A 3QAHA 3DKYA 1JKRC 3C18A 2UXNA 4DQ2A 1AKHA 5CJ9A 2BVLA 3GZNB 3OS0A 1YO5C 2ADUA 1FMWA 2BGCA 2LTPA 4OWRB 1R6RA 4A0YA 1I3AA 5DUKA 1ETOA 2W57A 3MMYB 3OSGA 1H8AC 1O4XA 3ZMTA 4EM2A 5M3MJ 5TRDA 4L9NA 3EQLF 2K9SA 1J09A 2TRTA 2IA0A 4XN3A 1Z21A 2NOJB 2O8XA 4CA0A 2ZC2A 3EUKL 5JFRA 1KU2A 3E97A 3LQQA 3WGIA 3OYHA 2F48A 4S0HB 2M8GX 1XSDA 1WI3A 2KRHA 2AQFA 3HRSA 2EZLA 1KQ0A 4AWXB 1H9GA 2FOWA 1DGWY 2L3DA 2X6YA 3C7JA 3RJPA 1PP8F 5J4YA 2KJCA 3H5RA 3ZR8X 2KKOA 3H3UA 3O3KA 1HW1A 4D7MA 1B72A 1D0YA 2HDWA 4I76A 1JUMA 1KZHA 1BR1A 1XMAA 2MG4A 2BOLA 3KP3A 2K40A 1YQAA 4AIHA 4KMFA 3K4CA 1YS6A 3TOAA 4NB5A 2IS1A 4BHCA 5F04A 2ZNYA 3MQ0A 1FIPA 1FEXA 4XSXF 3KLOA 1TW3A 1BJZA 3IKVA 5H6RA 4BACA 3AG2H 3HRMA 2XDVA 1BIBA 1MSFC 4LIVA 4A93J 3QOEA 2W25A 3FXJA 4WF2A 1BW5A 3HOZJ 4YFXF 2VI6A 3LA3A 1X19A 3R4KA 5F0CA 4PGHA 3D1NI 3KP2A 1LEBA 4HEA2 2BHYA 2MD5A 3HGGA 2VJ4A 3S17J 2GOMA 3HPHA 1JUSA 5LLQA 1ZQ3P 4IX7A 4B1RA 5FKKA 4EEFG 4BE0A 4GRIA 3ZQLA 2V1DA 2E34A 4YIFA 2DA1A 3CMYA 4EJVA 2A3SA 3LSHA 1EH7A 3DCFA 4B44A 3EUHA 3I59B 3RCOA 2VBWA 1MNEA 2CRGA 2LF8A 3CTAA 4IL6C 1FIAA 1OYYA 4Y7NJ 4PJLA 3CD6I 1SFKA 2IRFG 1DUXC 1REPC 3QPHA 3F21A 1PVEA 4JK1X 1YE9A 1S7AA 3BZ6A 2KP6A 4HSTA 4CH7A 3HOXJ 2M1BA 3OYMA 3HOVJ 1U0JA 2IXSA 2RQQA 3OIQA 4X1EA 3BT9A 2VQHA 3F23A 2ZXWH 2L5QA 1MD0A 3JAMK 1OMIA 5CVIA 2V1NA 1SEUA 4BE1A 3OL4A 3IHUA 1O3TA 1VF9A 2PQ8A 4M72A 2JT1A 4W97A 5L3BA 3OYAA 2BV6A 4DZPA 3A0BC 3RKYA 4CCOA 2IBDA 1OPCA 2BVMA 2QYOA 5K1YA 3H9GA 2DYRH 2UWMA 1Z91A 2VONA 1MJ9A 3HOTA 4HYEA 5FFXA 1MGTA 4MO7A 3M4OJ 3OV8A 2PEXA 2JK3A 4CYCB 4UB6C 2DA7A 3MZ8A 1SMYF 4AVZA 4N4NB 3JRIA 4GCVA 4OAYA 1PDNC 1BI0A 2JWTA 2JUGA 2YU3A 1ETYA 4MQ9F 1TWCJ 5K5OA 1KQ8A 4ITVA 1MZBA 4EMSA 3DF8A 3KP5A 1YLFA 2XHKA 1IN4A 2FE3A 2Z1DA 3ZPLA 4EGYA 5D8KB 3LSTA 1D1BA 4B8XA 2K27A 2ZXJA 3F9KA 2P5LC 4CDGA 3DXJF 3RKWA 3V8LA 2BBYA 1B6AA 2BE5F 3CUQB 1J7KA 4KISA 2PMZN 5HLGA 3OYNA 1HOMA 2ZKZA 3NARA 4L9VA 2R92J 1YG2A 1CQTA 2G0EA 4MNUA 1XGNA 2EILH 1OKRA 5E1WA 4L0ZB 1FPQA 3K4KA 4EV0A 3FBIB 2PMHA 2H8WA 4ZTFA 4B4CA 3KEOA 4U0VA 1AWCA 4I7HA 1S3JA 3GFMA 5FGMA 5H20A 2J5PA 1JT0A 3O8HA 3S2HJ 4LB5A 4R79A 4A3GJ 1PP7U 2DOFA 4MFDA 3U1DA 5B1AH 4YG2F 5B5EC 2EFQA 2VQCA 1RR8C 5D5WB 1FNNA 1G6NA 3M7GA 4GFBA 3DPLC 2LG4A 3GF2A 3J81Z 3ELKA 2HU9A 3QYEA 3OYJA 3DEUA 1Y0UA 1S29A 2VJIA 1G3YA 1ZG1A 3PUFA 2F5VA 5FRNA 5LHGA 1OQYA 2X1EA 4XSZF 2LD5A 1U5TA 3GLLA 3CZ6A 2CW0F 3BR0A 3HRUA 5M5YJ 2F4OB 2FSWA 5KVRA 2ELJA 1G2HA 1T33A 2HOEA 3HB9A 2YPRA 1SAXA 1ZGWA 2B9SA 1K4TA 3KP4A 3T0YA 1WH5A 3TO6A 3FXMA 3TOBA 1TT0A 1XD7A 1ZARA 4II2A 4U7BA 1HDPA 3FX3A 4RLFA 4BEHB 5LFAA 5FLXZ 2NVYJ 3ZGKA 3AAFA 2QWWA 3HYIA 1ZGJA 1VQ7I 1X58A 1JKQC 3EPZA 2XAJA 2Y30A 4ZZLA 1SVMA 2LC2A 4GYGA 1NK3P 3VYSB 2LY1A 1TC3C 2KL4A 4NQWB 2LFBA 4HNTA 1LFBA 3LOCA 5DM7F 4XKWA 5KNLA 1BJAA 1A6QA 5BS6A 4FETA 1RESA 1DQUA 2RREA 2P4WA 3FDYA 3LAJA 3KYCB 4E7KA 1HW2A 3H0DA 5DUIA 1A04A 3BG9A 1OYIA 2B0LA 3TL4X 2E5NA 2D1HA 1JGGA 1QU3A 2DODA 4P5OA 1D5VA 4G7ZF 1F9NA 1MJBA 2XAFA 1QNTA 3F8BA 3M07A 3JRHA 3TW6A 4LG3A 3SHFA 2O61A 2QENA 2O5RA 2HZTA 2Y48A 2MH2A 1ZLJA 2STWA 1DP3A 3I59A 4BQQA 2XF6A 2Y31A 3J7AY 5AIQA 4D1QA 3RZDJ 2NRAC 2TDXA 3BP8A 3CJRB 2RN7A 3L9FA 4OIPF 5C4XJ 5M5WJ 3HL2A 5E8GA 3CCMI 1YJNI 5JI6A 2JA6J 2KPMA 2FNPA 1ZG3A 2RQPA 1OYWA 3DKWA 4UXNA 2JA5J 1TWAJ 2QSHX 3FXQA 3T8RA 4KITB 2WV0A 1XS9A 1U78A 2K9QA 3ZXSA 5CKTA 4QPQA 4CZZA 4A3KJ 1BW6A 3TQNA 3DTIA 4HLXA 4JX6A 1P6RA 3OS1A 1R9TJ 1YJWI 3HKZN 2WAEA 5BQTA 4WK8F 3KE2A 3PO2J 5J47A 1RKWA 3K1PA 5F64A 3ISPA 1H89C 4A2UA 2FD5A 4NC8A 3AG4H 5JHFA 2V4JC 2PMZA 4ZTJA 3REOA 1NTCA 1YIOA 3RYPA 3JRDA 3Q0VA 2W00A 2J5OA 2LKPA 4XLEA 3A4CA 4DYCA 3IH4A 3F3XA 2DN0A 1MDMB 3H1CA 4CYCA 4CCNA 1O7FA 2ICWG 1ZR4A 1OCRH 2ZMEB 1CGPA 3OYDA 3VFZA 1VQMI 2JZYA 1MMAA 3AKZA 4XKBA 1T95A 1NK2P 2DPDA 1I3QJ 1I5ZA 2DI3A 1Z7UA 3BOQA 4RGRA 1FZPB 3UNGC 3SEZA 3QU6A 2LP0A 3BTJA 4KT5C 2DFFA 4EGZA 3CC4I 3ZQ7A 3KZYA 1OLTA 2MYSA 2ZJ2A 1R4NB 3BTIA 2IP2A 3FK6A 3OOUA 3SZGA 3GUDA 1UMQA 4C3HJ 1S7OA 1TWHJ 3I9V2 5LGTA 2EFNA 2QUFA 3CUQA 4KIGA 5L3GA 4DW6A 3GTLJ 1WGXA 3S1QJ 4QWQA 1APLC 2AXTC 1S5LC 4HZFA 3PNTA 1YJ9I 3RKXA 2AS5F 3MZYA 5AONA 2BW3B 3KETA 2W7NA 4KA4A 5DD8A 4BJTA 3BG3A 4JQFA 2KMUA 4PDKA 3IP4B 4JYKA 5GTIC 5HOOA 4RBOA 3L7WA 1LNWA 2X4HA 1AA7A 2IA1A 2PBIA 3EETA 1XMXA 3MKZA 2LK2A 3EUHC 1TBXA 1Z0XA 1TNTA 2MGQA 2K4JA 3B6CA 1B4AA 1P4XA 5J1YA 4DBRA 3MN2A 1R71A 3S32A 3W6KB 2FQ3A 3JREA 4FT8A 4XNFA 3D5LA 4G6TB 3HG9A 4PJNA 4I2OA 3FXUA 3GTQJ 4X6AJ 5HODA 2V1XA 4I09A 3BDDA 1IRGA 2X85A 2EA4A 4OMYA 2CUZA 2BYVE 2DFHA 4UVAA 4I98B 3A01A 1GHCA 4IVNA 5D6EA 4D5FA 1I1GA 1JTYA 2R7TA 4IEJA 5E18F 1EJ9A 3ABLH 2PMUA 3B6AA 3RDIA 5CLSA 4XLNF 4BHPA 2E36A 3Q3SA 5CVJA 2UV1A 3E0JB 1YI2I 3GFIA 1FSEA 4YELA 1K7AA 4RAYA 2V6EA 5L3DA 4KUMA 2AHQA 5HNHA 4I02A 3U21A 4XIDA 2HNHA 1A35A 5B3SH 1BBYA 2CUFA 3RPUA 3CP8A 3MFKA 1LPQA 2D2WA 3H3ZA 4YFNF 2R5ZB 4LLNA 3SZTA 3WTYC 2CW7A 4UHTA 1LDJA 1EH8A 4NUBA 1MNDA 3LSKA 4NQWA 1D1CA 2VN2A 3WE3A 4EJWA 2DA5A 3EYYA 5ICFA 2IT0A 5H6QA 3VB2A 4L5EA 3AG1H 4M3BA 2EPFA 2MH9A 3HKZA 3R6SA 3ZMDA 1QPIA 3GYHX 5HNFA 3KX2A 3CCYA 4LK1F 1RR7A 3S3NA 5JLXA 5DCFA 3S1RJ 4FCYA 3ASOH 1F43A 1G59A 3DU6A 1KYWA 1X4PA 2RDPA 4GGGA 3I58A 1O7LA 2ID6A 3AFHA 2DAOA 2EIKH 3MVPA 4E7ZA 3OYBA 2LKXA 4IRIA 1TNSA 1YW8A 2Z3YA 2DPUA 1Y39A 1IRZA 3E5QA 3S1NJ 1P92A 4RB0A 5J6XA 4J19A 3FMQA 1UELB 1T98A 2HYJA 1EV7A 2M0MA 3I3LA 2ESHA 4WXHA 1JJ8C 3QQAA 3CMAI 2O9LA 1YOVB 2JA2A 3AG3H 2ECBA 5K7ZA 3KZIC 3DQVC 1V5FA 1J9IA 1ZHFA 4J00A 1VQ9I 2WAQA 1KA8A 2CFXA 2AXLA 2IGKA 5LD2C 5CVUA 1TW2A 3WU2C 1LFPA 3GZ6A 2ZO4A 3C2BA 2EIMH 3PO3J 2G7UA 2NXNB 2OD5A 1RIOH 5B1BH 2H1KA 4XLPF 1LJ9A 1VQNI 2HS5A 1XGSA 2FEZA 2EV6A 1BOAA 1OCOH 3A1YA 2Q2EB 1OCPA 1IG7A 2STTA 1ACIA 4HA8A 1K79A 3EYIA 1G3WA 4Y15A 3K6GA 3QWLA 4IHXA 1BA5A 3V7RA 2BXZA 5JVGF 5HLTA 2GA1A 1TTYA 2QZ8A 4C2UA 5ILSA 2FNAA 1FOKA 4FISA 4O5VA 1MDMA 2M3AA 2I8DA 1G3TA 2Y9YA 2ZMEA 5F0FA 2DMUA 3IL2A 1B59A 2BY2A 1ZTRA 1X1PA 3KFWX 2DU9A 4A3DJ 1LVAA 4DJAA 4XK4A 1B9NA 2D5VA 4LG0A 2IGOA 3VOEA 2QQAA 2JSCA 1Y6IA 2KZGA 3V4GA 1IV8A 1Y8QB 3CDLA 3S1MJ 2MLKA 2DT7B 2XB5A 2HOAA 4LLGF 4WXCA 1IN5A 2ZJPF 2B63J 1OJLA 2O03A 3TDUC 4ENMA 2IS2A 1RNLA 1P9QC 5LHIA 2W4SA 2GXBA 5EG0B 3VDXA 4UVCA 1T08B 3E7LA 2VE9A 3GXOA 4RGUA 3G1LA 3TMOA 3H5NA 1U3EM 3WG9A 1D5YA 2VOOA 3T1BA 3LQRA 1D8JA 4XLAA 2BW3A 3MKWB 3GVAA 4PFPA 1FBQA 2E2HJ 2EV5A 2WAFA 2DMQA 3G3ZA 4N9HA 2O7OA 2PJRB 2KIQA 1IDZA 3TKYA 3G73A 2GOXB 2RNGA 1FT9A 2XKOA 2XIGA 3RQIA 2M9HA 3OY9A 1HLVA 1DPUA 5L3FA 4EVIA 5GAGJ 4LOCA 1ZK8A 4XLFA 4XLHA 3LSRA 4ON0A 1JUPA 4RB1A 2IS4A 1P2FA 3FISA 1PYVA 1IRXA 1R4MB 2E1NA 2K9MA 3JRFA 2R5YB 1MBGA 3PM1A 2QF7A 4A3IJ 2ELKA 3JRAA 3K4NA 5HS8A 1YRNA 2R7RA 3SZPA 2COBA 1I1SA 2LDUA 2Q1ZB 1VTNC 2HFHA 5J1RA 1Z77A 4J01A 4A69C 2YR2A 1WJDA 4KT6A 4IQ4A 1LE8A 2Z9OA 2HZDA 5K5QA 1TQMA 5A2QZ 3IV5A 4BQAA 3HJEA 5J4VA 4A3LJ 3P9IA 1BN5A 2DXIA 2VT2A 3OOPA 1HA8A 4CCKA 2HQAA 4I01A 1FOWA 1R5HA 4KN7X 4RB3C 5ICCA 1U5TB 2KHMA 2M0CA 2BY0A 2OU2A 4LMYA 4ZDPA 4HF0A 2R5ZA 3FMRA 4E7LA 2VUMJ 3KCCA 1V3FA 1D3YA 1X4OA 3FXRA 3HBLA 1QZEA 1S72I 2DT6A 2CSOA 4XLCA 5DD4A 4TV7A 3PSIA 5HLIA 4RAZA 5L3CA 4E6KG 2IAIA 1BIAA 1MH3A 4R8HA 4ETSA 4M6YA 1E3OC 2L4MA 4MIMA 4NC6A 5BPDA 4S05A 2C6YA 3Q9VA 4RDUA 3H36A 3B02A 5FLMJ 1SD5A 5GAHJ 4XQFA 1P4WA 1QGPA 2V79A 3GFJA 3L2CA 3DU5A 3FXKA 2E2IJ 2WV1A 5HDGA 3LSPA 2VOPA 4GXOA 3CUQC 1VQ6I 3PUBA 1TQIA 3FXOA 2CW8A 2PX9A 3KPHA 4YIIA 2HPMA 1AU7A 3HHHA 2CV1A 4XOTA 3NWSA 3SFZA 2EFWA 2VXDA 3OYLA 1UZCA 5E8IA 2DCEA 1B9MA 4CYDA 3K70C 5C3EJ 5GPCA 3JRGA 3L00A 2MSYA 1SAUA 2KZVA 4G6DA 2Y0SN 4M71A 3BZCA 3OYKA 1IUYA 1P7IA 2BY1A 1PJRA 1E2XA 3KP7A 1HQCA 4PFOA 2HOTA 2XV4S 2GWRA 3BR2A 1ETVA 1UJ8A 2KRCA 2M8EA 3FHZA 1SANA 2VJ5A 3VPRA 2XSDC 2Y9ZA 4BXXJ 4AD9A 4OOIA 1I6XA 4RMNA 3CCVI 3LSMA 1PUEE 1E17A 1ENHA 1C0WA 4FASD 5FFZA 3SDBA 2K85A 1HKQA 3DFGA 2BY3A 4NC7A 1ZGAA 3ZP5A 1U9NA 2Q2EA 1ETWA 2L9NA 1Q1VA 1K78B 2V9KA 1A5JA 2DFEA 3E6DA 4PJJA 1W4MA 4A6DA 1FBSA 4PK4A 4BQOA 1Z3YA 2EINH 2R7VA 2IPQX 1I39A 1K61A 2QQ9A 3LSJA 1I6HJ 1ODDA 2ZSHB 3K4JA 4HDVA 1F5TA 2KIFA 4ABZA 5H2FC 3RSNA 2DDBA 4CHUA 5GP9A 1WJCA 3PL8A 1UHWA 3FZVA 3BTCA 1ITYA 2L54A 3OMYA 2YSRA 1MJAA 2M7BA 9ANTA 4BU2A 4QSHA 3CCUI 3IRQA 1OCCH 4MGRA 3SXYA 2CU7A 4DYQA 3A2KA 1IV6A
chains in the Genus database with same CATH topology
3GFLA 3E5XA 2RGVA 3LA7A 4Y17A 2HKOA 2R7FA 2NNYA 2P8TA 2RVCA 4O6JA 3J81K 2M45A 1T2KA 2O0YA 5HS7A 1RUOA 2V6CA 1W7PD 5ERIA 4U7DA 1XB4A 2GXGA 2EFOA 4P9UA 4KN4X 5LHHA 4XBFA 1R58A 4PZJA 4HF1A 2XAHA 3ZMVA 4A12A 1ZAOA 3ROUA 1BI3A 1GXPA 4L0YB 1ZH5A 5FLXK 3K1NA 4M9SA 3V7SA 4RB2C 2OZUA 4O3MA 2P6TA 2BEOA 4ENJA 2XAQA 3V8KA 5D5VB 3BJAA 3I64A 1CF7B 4HQEA 1YFHA 2A6EF 1XDSA 1NHAA 1Z1DA 2F2EA 2FBKA 4IJAA 3E6CC 4UV8A 3DP7A 4CICA 4N9IA 5CVVA 5EEGA 3U9GA 2PJPA 1LB2A 3SQNA 2ZBKA 1RI7A 4EJTA 2MA3A 3JTGA 1FYKA 2E1CA 3GX4X 1WWXA 1YW7A 1YW9A 3TO7A 2QVOA 3ABUA 2KRFA 3PQJA 3HOSA 4RS8A 3WTXC 3R60A 4A5MA 4L9TA 5ILVA 1SD7A 4EM1A 3K0LA 2FRHA 1FP1D 2ETHA 3TGNA 3CDHA 1WKMA 4IXAA 1O57A 3GO5A 5HVQC 4G7HF 2DFIA 1FSHA 3FF5A 4HX4A 3U2RA 1J0RA 2LNBA 2ZFWA 4M6XA 2XKPA 2QQBA 3VEPA 4H0EA 5HS9A 1K78A 2VBZA 4A0XA 3LA2A 1IAWA 1SD4A 1T38A 5E1XA 3V7CA 3N4MA 2CQKA 2DQLA 4P55A 1R5GA 5FB2A 1IF1A 5JR3A 3CO6C 2EK5A 4LG0B 3E5UA 3HSEA 4KIBA 2XGXA 3ECHA 2W84A 2F5CA 5BMZA 1SMTA 1QO0D 3WODF 5E1ZB 2EB7A 3GWZA 1J2XA 1S6LA 3QP6A 1TQPA 3O6BB 2H6BA 2XASA 2ESNA 2LSOA 3R0AA 4PGGA 5ILUA 2ISZA 4YFKF 2GZWA 4UUVA 4IRGA 3I0TA 4N0BA 1HKTA 2XAGA 1IN6A 3I53A 2QBYB 4AIKA 1XSXA 1AOYA 2PG4A 5ICGA 3WTUC 3FM5A 5FD5A 1T39A 4HW0A 2XROA 1CF7A 1UHMA 1ZG5A 3NEUA 4ASNA 2XRNA 2FF4A 4E70A 4ZYDA 2A68F 3WTWC 2Q0OA 3K1MA 5DCMB 4UNOA 4L9JA 1FX7A 3HTSB 2HWVA 4XRFA 1OR7A 2ZNZA 3FWEA 1W5TA 2RKHA 4HV5A 3K69A 3C1DA 1LEAA 1R00A 2HDCA 1R1TA 1IXRC 3V8JA 4G8XA 4OIRF 1WSUA 2FXAA 4HAMA 3KZZA 4OMZA 4IRHA 2NYXA 5D8LB 2OAZA 3MAJA 5HDNA 4JBAA 2E7WA 1QQIA 2A69F 4WCGA 3N97A 3MZHA 3M8FA 3R61A 1ZRDA 2ISYA 2DQRA 1O3SA 2OZ6A 2HYFA 4LD5A 3QP5A 1YYVA 1H0MA 1IRFA 4U0YA 3IWFA 2CO5A 4NHJA 1R36A 2H09A 4MHGA 2VXZA 1DPRA 4L18B 2HKXA 3HSFA 3RPQA 2COMA 1F4KA 1FLIA 1U2WA 2VODA 2D45A 1G4DA 3B73A 4KICA 1U5TC 1XMKA 4HQMA 3F8NA 1ON2A 2V9VA 3HRTA 2PN6A 4DNCA 3K9TA 2H94A 1IXCA 5HLHA 2W85A 3R0JA 4MTDA 1BC8C 2HGCA 2HYGD 2VBYA 5LEJA 4M73A 5J8FA 3I54A 1FC3A 2K4BA 4KYWA 3PFIA 3IKTA 1Z05A 4Z2YA 4G7OF 1BM9A 3JTHA 3ZN1A 3WU1B 4HDUA 1I27A 3O2PE 5A2QK 3TDZC 4AVPA 1Q1HA 3D0SA 1SFXA 4D0PA 1KU7A 3BPVA 1Z6TA 2D1VA 3BJOA 5IT9K 4HBLA 2VT3A 2QBYA 3WTVC 3WTZA 4BYYA 1STZA 1X3UA 3IRRA 4EM0B 1O3RA 1G3SA 4FHTA 1QZZA 3GLXA 2OQGA 3T5XA 1UCRA 1IW7F 2FBIA 5BOXA 1QZYA 2XUBA 4HX7A 1GXQA 2GA2A 3I4PA 3W6JB 4Y13A 4ZH4F 2OBPA 3I71A 2A5YB 2EV0A 5DCMA 5IT9Z 1J59A 3KLNA 3FMSA 2VBXA 2DBBA 4U88A 2A07F 1ONVA 4MQVA 4KMUX 4F7ZA 1Z6RA 5JVTA 3WGGA 1JE8A 1FYLA 2PI0A 1V4RA 3GW2A 4KDPA 3HSRA 4RGXA 2JPBA 1UFMA 2XVCA 3RYRA 3KEQA 3LFKA 2ACJA 5LBQA 4HF2A 2FBHA 4EJOA 5BPIA 5F1RA 1EH6A 1T0FA 2A61A 4MTEA 1LDDA 4ZYGA 6PAXA 4CGZA 4LFUA 3NRVA 2IJLA 2M30A 1JXSA 2P5VA 3WE2A 1HXDA 1J75A 1B1BA 3ECOA 1W7PB 2K02A 3T8TA 4S04A 2Z5UA 5K5RA 2NNNA 2M87A 1O3QA 2RNJA 1YS7A 5DEQA 5DDGA 1BI2A 1F1ZA 1HSJA 4OIQF 4KIFA 2K86A 2CWEA 5DYMA 2DK8A 2PLYA 4ESJA 4MEYF 2DT5A 4OINF 2GIVA 2HTSA 2FMLA 4OU0A 1D8KA 4M9XA 4Q47A 1XCBA 1ZREA 2UXXA 1MKMA 1YTYA 4KNYA 3ML6A 1IZ1A 1HSTA 3P9CA 3P7NA 5IT3A 5LGNA 2RC4A 5ED4A 2RV8A 2ELHA 4GYIA 1LQ1A 4ZYHA 3L09A 1W5SA 2PFBA 1ON1A 4P9FA 5FO5A 2E7XA 3MWMA 3JW4A 2GQQA 4G6QA 2EA2A 4L5IA 2MBFA 3JSPA 2W24A 4UVBA 1S8NA 1UB9A 5CYVA 2DLLA 3JAMZ 3GZ5A 2Y0MA 2F5FA 4ENKA 2MC3A 5JHUA 2K7LA 5LRSA 2P5KA 3RIRA 2CG4A 2R3SA 1T6SA 2ZCWA 5FD6A 5E17F 4U0WA 4L5JA 1QPMA 3S2WA 4ESFA 3Q5FA 4LK0F 1KU3A 4UV9A 2CGPA 4HLYA 3E6BA 5EEHA 2DO7A 3M9AA 4HV6A 1H9TA 5LRRA 2NAZA 3F22A 1ZYRF 5ICEA 4EJUA 1JHHA 1LDKB 3RTRA 2OQRA 4MEXF 3WGHA 2FU4A 1WQ2A 4ESBA 5L3EA 3F8MA 1KU9A 1IN7A 3BWGA 2CYYA 1BI1A 4M9ZA 2F5DA 3KP6A 5F6FA 3P9KA 1ZRFA 3ZMSA 5D6FA 2YX7A 5HDKA 2L01A 1TLHB 4FX4A 4G9YA 2DTRA 1W7PA 1RUNA 3C3WA 2WC2A 5KK1A 4Q4ZF 4I0BA 4I0AA 1L3LA 4HOBA 3ERED 4BXUA 2IVMA 2JPCA 3QU3A 1KYZA 2P7VB 3JSOA 2F5EA 4WX9A 1HW5A 2IW5A 3BROA 2Q8KA 4IF4A 3BJ6A 3HUGA 4IHTA 2QLZA 5LEKA 3QRFF 3TO9A 3DPTA 2KIUA 2L4AA 1R22A 4A0ZA 1R23A 4IPAA 1USSA 5LGUA 4QLCU 2GAUA 3BPXA 4LJZF 2JRTA 2HQNA 3ABTA 4WWCA 3IC7A 4ENNA 3ZMZA 2FMYA 2KIMA 4ZZDA 3QPTA 2A6HF 4BHBA 3CJNA 2IA2A 3H92A 2HEOA 3NQOA 4M74A 2H27A 1XN7A 3M1EA 1DP7P 1FY7A 2V1UA 3Q9SA 3J7AO 1ZLKA 3F6OA 2OA4A 1BC7C 2X0LA 1FP2A 5DV5A 2FA5A 1U6GA 1SFEA 1R1VA 3IWZA 4G94A 1Z9CA 2P6SA 4BH9A 2UZKA 1J5YA 4FX0A 2P7CB 4Q48A 1ZN2A 1KQ9A 1R1UA 2Z99A 1ULYA 2KJBA 5D5UB 4K2EA 2EWNA 3F72A 3I5UA 1WI9A 5D5XB 3CLOA 4KFCA 1SD6A 1RZ4A 1P4AA 2EFPA 5D4SA 1R7JA 1JHFA 5J8CA 2WWYA 2L02A 1USTA 3GEZA 4R1HA 3E6MA 3WTSC 3ULQB 2M5WA 1IXSB 1FBUA 2Z33A 4IHSA 4BNCA 2FOKA 1KGSA 1FYMA 4EQQA 2YX4A 3F8FA 4WXDA 5CVRA 5AIPA 3F8CA 3MCZA 4PCQA 3QOPA 3BY6A 2JTVA 4P96A 1U8RA 1L0OC 1GVJA 2G7HA 3EDPA 1IN8A 2WTEA 3HIFA 3HTUA 1XSVA 1WRJA 2Y75A 3ZN0A 3K2ZA 3RI4A 4RGSA 3MEXA 2DW4A 3WU0A 4Q5SF 2HTJA 4A6EA 2DK5A 4B09A 3J80K 4AIJA 1QBJA 1XCVA 1ZRCA 1DDNA 4LGWA 2R7DA 4A5NA 2H6CA 1HKSA 3M8EA 2O6GE 3WTTC 4CO8A 3CUOA 1K6OA 3CO7C 3DV8A 2VC0A 4BAYA 4HX8A 2O3FA 5TJJA 5D4RA 1SFUA 2NS0A 2MLGA 2HQRA 3FM3A 3PQKA 1XGMA 3VODA 3J80Z 3HHGA 3F6VA 2HR3A 3LWFA 4OIOF 4GO1A 3E3VA 1FWZA 3ZMUA 4CXFA 1HBXG 2EJRA 3COAC 2VE8A 1XDUA 1JGSA 3LAPA 4LLLA 1XGOA 2G9WA 4LB6B 2LF7A 4ZYEA 5E20A 2QM3A 2VC1A 3QAHA 3C18A 2UXNA 4DQ2A 5CJ9A 1YO5C 2ADUA 2BGCA 4A0YA 5DUKA 2W57A 3ZMTA 4EM2A 5TRDA 4L9NA 3EQLF 2IA0A 2O8XA 5JFRA 1KU2A 3E97A 3LQQA 3WGIA 1XSDA 3HRSA 1KQ0A 4AWXB 1H9GA 3C7JA 2L3DA 3RJPA 1PP8F 2KJCA 2KKOA 3H3UA 3O3KA 1HW1A 1XMAA 3KP3A 1YQAA 4AIHA 4KMFA 1YS6A 3TOAA 4NB5A 4BHCA 2ZNYA 3MQ0A 4XSXF 3KLOA 1TW3A 3IKVA 5H6RA 3HRMA 1BIBA 2W25A 4WF2A 4YFXF 3LA3A 3R4KA 4PGHA 3KP2A 1LEBA 2MD5A 5LLQA 2V1DA 4YIFA 4EJVA 2A3SA 1EH7A 3EUHA 3I59B 2VBWA 3CTAA 2LF8A 1OYYA 2IRFG 1DUXC 1REPC 3QPHA 3F21A 4JK1X 1S7AA 3BZ6A 2M1BA 3F23A 1MD0A 3JAMK 1OMIA 5CVIA 3IHUA 1O3TA 2PQ8A 4M72A 2JT1A 5L3BA 2BV6A 3RKYA 1OPCA 2QYOA 5K1YA 2UWMA 1Z91A 2VONA 1MJ9A 3HOTA 4HYEA 5FFXA 1MGTA 3OV8A 2PEXA 1SMYF 4GCVA 1PDNC 1BI0A 2YU3A 4MQ9F 5K5OA 1KQ8A 1MZBA 4EMSA 3DF8A 3KP5A 1YLFA 2XHKA 1IN4A 2FE3A 3ZPLA 4EGYA 5D8KB 3LSTA 4B8XA 2K27A 2ZXJA 2P5LC 4CDGA 3DXJF 3RKWA 3V8LA 2BBYA 1B6AA 2BE5F 3CUQB 1J7KA 5HLGA 2ZKZA 4L9VA 1YG2A 4MNUA 1XGNA 1OKRA 5E1WA 4L0ZB 1FPQA 4EV0A 2PMHA 3KEOA 4U0VA 1AWCA 4I7HA 1S3JA 3GFMA 5FGMA 5H20A 2J5PA 4LB5A 4R79A 1PP7U 3U1DA 4YG2F 2EFQA 5D5WB 1FNNA 1G6NA 3M7GA 3DPLC 3GF2A 3J81Z 3ELKA 3DEUA 1Y0UA 1S29A 1G3YA 1ZG1A 5LHGA 4XSZF 1U5TA 2CW0F 3HRUA 2FSWA 5KVRA 2HOEA 2YPRA 1SAXA 3KP4A 3T0YA 3TO6A 3TOBA 1XD7A 1ZARA 4U7BA 3FX3A 5FLXZ 3AAFA 2QWWA 3HYIA 1ZGJA 2XAJA 4ZZLA 4GYGA 1BJAA 5BS6A 3LAJA 2P4WA 1HW2A 5DUIA 1A04A 1OYIA 2B0LA 2D1HA 1D5VA 4P5OA 4G7ZF 1F9NA 1MJBA 2XAFA 1QNTA 3F8BA 3SHFA 2O61A 2QENA 2HZTA 2Y48A 2MH2A 1ZLJA 2STWA 3I59A 5AIQA 2NRAC 2TDXA 3BP8A 4OIPF 2RN7A 3L9FA 5E8GA 5JI6A 2FNPA 1ZG3A 2RQPA 1OYWA 3DKWA 4UXNA 3FXQA 3T8RA 2WV0A 1U78A 4CZZA 3TQNA 4HLXA 1P6RA 5BQTA 4WK8F 3KE2A 3K1PA 5F64A 3ISPA 4A2UA 3REOA 1YIOA 3RYPA 2J5OA 2LKPA 3F3XA 1MDMB 1O7FA 2ZMEB 1CGPA 3VFZA 2JZYA 2DPDA 1I5ZA 2DI3A 1Z7UA 3BOQA 4RGRA 1FZPB 3QU6A 4KT5C 4EGZA 3ZQ7A 3KZYA 2ZJ2A 2IP2A 3GUDA 1S7OA 5LGTA 2EFNA 2QUFA 3CUQA 4KIGA 5L3GA 4QWQA 4HZFA 3RKXA 2AS5F 3MZYA 5AONA 3KETA 4KA4A 5DD8A 4JQFA 4PDKA 5HOOA 3L7WA 1LNWA 2X4HA 2IA1A 2PBIA 3EETA 1TBXA 1TNTA 2K4JA 1B4AA 1P4XA 3W6KB 2FQ3A 4FT8A 3D5LA 4I2OA 3FXUA 2V1XA 4I09A 3BDDA 1IRGA 2EA4A 4OMYA 2BYVE 4UVAA 4I98B 1GHCA 4IVNA 5D6EA 1I1GA 5E18F 2PMUA 3RDIA 5CLSA 4XLNF 4BHPA 5CVJA 3GFIA 1FSEA 1K7AA 4RAYA 5L3DA 4KUMA 4I02A 1BBYA 3RPUA 3MFKA 2D2WA 3H3ZA 4YFNF 4LLNA 3SZTA 3WTYC 4UHTA 1LDJA 1EH8A 4NQWA 4EJWA 2VN2A 3WE3A 3EYYA 5ICFA 2IT0A 5H6QA 3VB2A 2MH9A 3R6SA 3ZMDA 3GYHX 4LK1F 5DCFA 1KYWA 2RDPA 4GGGA 3I58A 1O7LA 2DAOA 4IRIA 1TNSA 1YW8A 2Z3YA 2DPUA 3E5QA 1P92A 4RB0A 5J6XA 3FMQA 1T98A 1EV7A 2ESHA 4WXHA 3DQVC 1J9IA 1ZHFA 1KA8A 2CFXA 2AXLA 5CVUA 1TW2A 3GZ6A 2ZO4A 2G7UA 2OD5A 1RIOH 4XLPF 1LJ9A 2HS5A 1XGSA 2FEZA 2EV6A 1BOAA 2STTA 4HA8A 1K79A 3EYIA 1G3WA 4Y15A 3V7RA 2GA1A 1TTYA 2QZ8A 5ILSA 2FNAA 1FOKA 4O5VA 1MDMA 1G3TA 2ZMEA 3IL2A 1B59A 3KFWX 2DU9A 1LVAA 1B9NA 4LG0A 3VOEA 2QQAA 2JSCA 3V4GA 2MLKA 4WXCA 4LLGF 1IN5A 3TDUC 2O03A 4ENMA 1RNLA 5LHIA 2GXBA 4UVCA 2VE9A 3GXOA 4RGUA 1U3EM 3WG9A 2VOOA 3T1BA 3LQRA 1D8JA 3GVAA 1FBQA 2EV5A 3G3ZA 4N9HA 3TKYA 3G73A 1FT9A 2XKOA 2XIGA 1DPUA 5L3FA 4EVIA 4ON0A 4RB1A 1P2FA 2E1NA 5HS8A 3SZPA 1I1SA 2LDUA 1VTNC 2HFHA 2YR2A 2Z9OA 5K5QA 1TQMA 5A2QZ 4BQAA 3P9IA 1BN5A 2VT2A 3OOPA 4I01A 1R5HA 4KN7X 4RB3C 5ICCA 1U5TB 2OU2A 4LMYA 4HF0A 3FMRA 3KCCA 1V3FA 1D3YA 3FXRA 2CSOA 5DD4A 5HLIA 4TV7A 4RAZA 5L3CA 1BIAA 4R8HA 4ETSA 4M6YA 2L4MA 5BPDA 4S05A 2C6YA 3Q9VA 3B02A 1SD5A 1P4WA 1QGPA 2V79A 3GFJA 3L2CA 5HDGA 2VOPA 4GXOA 3CUQC 1TQIA 4YIIA 3HHHA 3SFZA 2EFWA 5E8IA 1B9MA 4CYDA 3L00A 4G6DA 4M71A 1IUYA 1E2XA 3KP7A 1HQCA 2GWRA 2XV4S 2M8EA 3FHZA 4AD9A 4OOIA 1I6XA 1PUEE 1E17A 1C0WA 5FFZA 1HKQA 3DFGA 3ZP5A 1ZGAA 2Q2EA 1K78B 3E6DA 1W4MA 4A6DA 1FBSA 2IPQX 2QQ9A 1ODDA 4HDVA 1F5TA 2KIFA 4CHUA 1UHWA 3FZVA 2L54A 2YSRA 1MJAA 3IRQA 4MGRA 3SXYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GFL A;  3E5X A;  2RGV A;  3LA7 A;  4Y17 A;  2HKO A;  2R7F A;  2NNY A;  2P8T A;  2RVC A;  4O6J A;  3J81 K;  2M45 A;  1T2K A;  2O0Y A;  5HS7 A;  1RUO A;  2V6C A;  1W7P D;  5ERI A;  4U7D A;  1XB4 A;  2GXG A;  2EFO A;  4P9U A;  4KN4 X;  5LHH A;  4XBF A;  1R58 A;  4PZJ A;  4HF1 A;  2XAH A;  3ZMV A;  4A12 A;  1ZAO A;  3ROU A;  1BI3 A;  1GXP A;  4L0Y B;  1ZH5 A;  5FLX K;  3K1N A;  4M9S A;  3V7S A;  4RB2 C;  2OZU A;  4O3M A;  2P6T A;  2BEO A;  4ENJ A;  2XAQ A;  3V8K A;  5D5V B;  3BJA A;  3I64 A;  1CF7 B;  4HQE A;  1YFH A;  2A6E F;  1XDS A;  1NHA A;  1Z1D A;  2F2E A;  2FBK A;  4IJA A;  3E6C C;  4UV8 A;  3DP7 A;  4CIC A;  4N9I A;  5CVV A;  5EEG A;  3U9G A;  2PJP A;  1LB2 A;  3SQN A;  2ZBK A;  1RI7 A;  4EJT A;  2MA3 A;  3JTG A;  1FYK A;  2E1C A;  3GX4 X;  1WWX A;  1YW7 A;  1YW9 A;  3TO7 A;  2QVO A;  3ABU A;  2KRF A;  3PQJ A;  3HOS A;  4RS8 A;  3WTX C;  3R60 A;  4A5M A;  4L9T A;  5ILV A;  1SD7 A;  4EM1 A;  3K0L A;  2FRH A;  1FP1 D;  2ETH A;  3TGN A;  3CDH A;  1WKM A;  4IXA A;  1O57 A;  3GO5 A;  5HVQ C;  4G7H F;  2DFI A;  1FSH A;  3FF5 A;  4HX4 A;  3U2R A;  1J0R A;  2LNB A;  2ZFW A;  4M6X A;  2XKP A;  2QQB A;  3VEP A;  4H0E A;  5HS9 A;  1K78 A;  2VBZ A;  4A0X A;  3LA2 A;  1IAW A;  1SD4 A;  1T38 A;  5E1X A;  3V7C A;  3N4M A;  2CQK A;  2DQL A;  4P55 A;  1R5G A;  5FB2 A;  1IF1 A;  5JR3 A;  3CO6 C;  2EK5 A;  4LG0 B;  3E5U A;  3HSE A;  4KIB A;  2XGX A;  3ECH A;  2W84 A;  2F5C A;  5BMZ A;  1SMT A;  1QO0 D;  3WOD F;  5E1Z B;  2EB7 A;  3GWZ A;  1J2X A;  1S6L A;  3QP6 A;  1TQP A;  3O6B B;  2H6B A;  2XAS A;  2ESN A;  2LSO A;  3R0A A;  4PGG A;  5ILU A;  2ISZ A;  4YFK F;  2GZW A;  4UUV A;  4IRG A;  3I0T A;  4N0B A;  1HKT A;  2XAG A;  1IN6 A;  3I53 A;  2QBY B;  4AIK A;  1XSX A;  1AOY A;  2PG4 A;  5ICG A;  3WTU C;  3FM5 A;  5FD5 A;  1T39 A;  4HW0 A;  2XRO A;  1CF7 A;  1UHM A;  1ZG5 A;  3NEU A;  4ASN A;  2XRN A;  2FF4 A;  4E70 A;  4ZYD A;  2A68 F;  3WTW C;  2Q0O A;  3K1M A;  5DCM B;  4UNO A;  4L9J A;  1FX7 A;  3HTS B;  2HWV A;  4XRF A;  1OR7 A;  2ZNZ A;  3FWE A;  1W5T A;  2RKH A;  4HV5 A;  3K69 A;  3C1D A;  1LEA A;  1R00 A;  2HDC A;  1R1T A;  1IXR C;  3V8J A;  4G8X A;  4OIR F;  1WSU A;  2FXA A;  4HAM A;  3KZZ A;  4OMZ A;  4IRH A;  2NYX A;  5D8L B;  2OAZ A;  3MAJ A;  5HDN A;  4JBA A;  2E7W A;  1QQI A;  2A69 F;  4WCG A;  3N97 A;  3MZH A;  3M8F A;  3R61 A;  1ZRD A;  2ISY A;  2DQR A;  1O3S A;  2OZ6 A;  2HYF A;  4LD5 A;  3QP5 A;  1YYV A;  1H0M A;  1IRF A;  4U0Y A;  3IWF A;  2CO5 A;  4NHJ A;  1R36 A;  2H09 A;  4MHG A;  2VXZ A;  1DPR A;  4L18 B;  2HKX A;  3HSF A;  3RPQ A;  2COM A;  1F4K A;  1FLI A;  1U2W A;  2VOD A;  2D45 A;  1G4D A;  3B73 A;  4KIC A;  1U5T C;  1XMK A;  4HQM A;  3F8N A;  1ON2 A;  2V9V A;  3HRT A;  2PN6 A;  4DNC A;  3K9T A;  2H94 A;  1IXC A;  5HLH A;  2W85 A;  3R0J A;  4MTD A;  1BC8 C;  2HGC A;  2HYG D;  2VBY A;  5LEJ A;  4M73 A;  5J8F A;  3I54 A;  1FC3 A;  2K4B A;  4KYW A;  3PFI A;  3IKT A;  1Z05 A;  4Z2Y A;  4G7O F;  1BM9 A;  3JTH A;  3ZN1 A;  3WU1 B;  4HDU A;  1I27 A;  3O2P E;  5A2Q K;  3TDZ C;  4AVP A;  1Q1H A;  3D0S A;  1SFX A;  4D0P A;  1KU7 A;  3BPV A;  1Z6T A;  2D1V A;  3BJO A;  5IT9 K;  4HBL A;  2VT3 A;  2QBY A;  3WTV C;  3WTZ A;  4BYY A;  1STZ A;  1X3U A;  3IRR A;  4EM0 B;  1O3R A;  1G3S A;  4FHT A;  1QZZ A;  3GLX A;  2OQG A;  3T5X A;  1UCR A;  1IW7 F;  2FBI A;  5BOX A;  1QZY A;  2XUB A;  4HX7 A;  1GXQ A;  2GA2 A;  3I4P A;  3W6J B;  4Y13 A;  4ZH4 F;  2OBP A;  3I71 A;  2A5Y B;  2EV0 A;  5DCM A;  5IT9 Z;  1J59 A;  3KLN A;  3FMS A;  2VBX A;  2DBB A;  4U88 A;  2A07 F;  1ONV A;  4MQV A;  4KMU X;  4F7Z A;  1Z6R A;  5JVT A;  3WGG A;  1JE8 A;  1FYL A;  2PI0 A;  1V4R A;  3GW2 A;  4KDP A;  3HSR A;  4RGX A;  2JPB A;  1UFM A;  2XVC A;  3RYR A;  3KEQ A;  3LFK A;  2ACJ A;  5LBQ A;  4HF2 A;  2FBH A;  4EJO A;  5BPI A;  5F1R A;  1EH6 A;  1T0F A;  2A61 A;  4MTE A;  1LDD A;  4ZYG A;  6PAX A;  4CGZ A;  4LFU A;  3NRV A;  2IJL A;  2M30 A;  1JXS A;  2P5V A;  3WE2 A;  1HXD A;  1J75 A;  1B1B A;  3ECO A;  1W7P B;  2K02 A;  3T8T A;  4S04 A;  2Z5U A;  5K5R A;  2NNN A;  2M87 A;  1O3Q A;  2RNJ A;  1YS7 A;  5DEQ A;  5DDG A;  1BI2 A;  1F1Z A;  1HSJ A;  4OIQ F;  4KIF A;  2K86 A;  2CWE A;  5DYM A;  2DK8 A;  2PLY A;  4ESJ A;  4MEY F;  2DT5 A;  4OIN F;  2GIV A;  2HTS A;  2FML A;  4OU0 A;  1D8K A;  4M9X A;  4Q47 A;  1XCB A;  1ZRE A;  2UXX A;  1MKM A;  1YTY A;  4KNY A;  3ML6 A;  1IZ1 A;  1HST A;  3P9C A;  3P7N A;  5IT3 A;  5LGN A;  2RC4 A;  5ED4 A;  2RV8 A;  2ELH A;  4GYI A;  1LQ1 A;  4ZYH A;  3L09 A;  1W5S A;  2PFB A;  1ON1 A;  4P9F A;  5FO5 A;  2E7X A;  3MWM A;  3JW4 A;  2GQQ A;  4G6Q A;  2EA2 A;  4L5I A;  2MBF A;  3JSP A;  2W24 A;  4UVB A;  1S8N A;  1UB9 A;  5CYV A;  2DLL A;  3JAM Z;  3GZ5 A;  2Y0M A;  2F5F A;  4ENK A;  2MC3 A;  5JHU A;  2K7L A;  5LRS A;  2P5K A;  3RIR A;  2CG4 A;  2R3S A;  1T6S A;  2ZCW A;  5FD6 A;  5E17 F;  4U0W A;  4L5J A;  1QPM A;  3S2W A;  4ESF A;  3Q5F A;  4LK0 F;  1KU3 A;  4UV9 A;  2CGP A;  4HLY A;  3E6B A;  5EEH A;  2DO7 A;  3M9A A;  4HV6 A;  1H9T A;  5LRR A;  2NAZ A;  3F22 A;  1ZYR F;  5ICE A;  4EJU A;  1JHH A;  1LDK B;  3RTR A;  2OQR A;  4MEX F;  3WGH A;  2FU4 A;  1WQ2 A;  4ESB A;  5L3E A;  3F8M A;  1KU9 A;  1IN7 A;  3BWG A;  2CYY A;  1BI1 A;  4M9Z A;  2F5D A;  3KP6 A;  5F6F A;  3P9K A;  1ZRF A;  3ZMS A;  5D6F A;  2YX7 A;  5HDK A;  2L01 A;  1TLH B;  4FX4 A;  4G9Y A;  2DTR A;  1W7P A;  1RUN A;  3C3W A;  2WC2 A;  5KK1 A;  4Q4Z F;  4I0B A;  4I0A A;  1L3L A;  4HOB A;  3ERE D;  4BXU A;  2IVM A;  2JPC A;  3QU3 A;  1KYZ A;  2P7V B;  3JSO A;  2F5E A;  4WX9 A;  1HW5 A;  2IW5 A;  3BRO A;  2Q8K A;  4IF4 A;  3BJ6 A;  3HUG A;  4IHT A;  2QLZ A;  5LEK A;  3QRF F;  3TO9 A;  3DPT A;  2KIU A;  2L4A A;  1R22 A;  4A0Z A;  1R23 A;  4IPA A;  1USS A;  5LGU A;  4QLC U;  2GAU A;  3BPX A;  4LJZ F;  2JRT A;  2HQN A;  3ABT A;  4WWC A;  3IC7 A;  4ENN A;  3ZMZ A;  2FMY A;  2KIM A;  4ZZD A;  3QPT A;  2A6H F;  4BHB A;  3CJN A;  2IA2 A;  3H92 A;  2HEO A;  3NQO A;  4M74 A;  2H27 A;  1XN7 A;  3M1E A;  1DP7 P;  1FY7 A;  2V1U A;  3Q9S A;  3J7A O;  1ZLK A;  3F6O A;  2OA4 A;  1BC7 C;  2X0L A;  1FP2 A;  5DV5 A;  2FA5 A;  1U6G A;  1SFE A;  1R1V A;  3IWZ A;  4G94 A;  1Z9C A;  2P6S A;  4BH9 A;  2UZK A;  1J5Y A;  4FX0 A;  2P7C B;  4Q48 A;  1ZN2 A;  1KQ9 A;  1R1U A;  2Z99 A;  1ULY A;  2KJB A;  5D5U B;  4K2E A;  2EWN A;  3F72 A;  3I5U A;  1WI9 A;  5D5X B;  3CLO A;  4KFC A;  1SD6 A;  1RZ4 A;  1P4A A;  2EFP A;  5D4S A;  1R7J A;  1JHF A;  5J8C A;  2WWY A;  2L02 A;  1UST A;  3GEZ A;  4R1H A;  3E6M A;  3WTS C;  3ULQ B;  2M5W A;  1IXS B;  1FBU A;  2Z33 A;  4IHS A;  4BNC A;  2FOK A;  1KGS A;  1FYM A;  4EQQ A;  2YX4 A;  3F8F A;  4WXD A;  5CVR A;  5AIP A;  3F8C A;  3MCZ A;  4PCQ A;  3QOP A;  3BY6 A;  2JTV A;  4P96 A;  1U8R A;  1L0O C;  1GVJ A;  2G7H A;  3EDP A;  1IN8 A;  2WTE A;  3HIF A;  3HTU A;  1XSV A;  1WRJ A;  2Y75 A;  3ZN0 A;  3K2Z A;  3RI4 A;  4RGS A;  3MEX A;  2DW4 A;  3WU0 A;  4Q5S F;  2HTJ A;  4A6E A;  2DK5 A;  4B09 A;  3J80 K;  4AIJ A;  1QBJ A;  1XCV A;  1ZRC A;  1DDN A;  4LGW A;  2R7D A;  4A5N A;  2H6C A;  1HKS A;  3M8E A;  2O6G E;  3WTT C;  4CO8 A;  3CUO A;  1K6O A;  3CO7 C;  3DV8 A;  2VC0 A;  4BAY A;  4HX8 A;  2O3F A;  5TJJ A;  5D4R A;  1SFU A;  2NS0 A;  2MLG A;  2HQR A;  3FM3 A;  3PQK A;  1XGM A;  3VOD A;  3J80 Z;  3HHG A;  3F6V A;  2HR3 A;  3LWF A;  4OIO F;  4GO1 A;  3E3V A;  1FWZ A;  3ZMU A;  4CXF A;  1HBX G;  2EJR A;  3COA C;  2VE8 A;  1XDU A;  1JGS A;  3LAP A;  4LLL A;  1XGO A;  2G9W A;  4LB6 B;  2LF7 A;  4ZYE A;  5E20 A;  2QM3 A;  2VC1 A;  3QAH A;  3C18 A;  2UXN A;  4DQ2 A;  5CJ9 A;  1YO5 C;  2ADU A;  2BGC A;  4A0Y A;  5DUK A;  2W57 A;  3ZMT A;  4EM2 A;  5TRD A;  4L9N A;  3EQL F;  2IA0 A;  2O8X A;  5JFR A;  1KU2 A;  3E97 A;  3LQQ A;  3WGI A;  1XSD A;  3HRS A;  1KQ0 A;  4AWX B;  1H9G A;  3C7J A;  2L3D A;  3RJP A;  1PP8 F;  2KJC A;  2KKO A;  3H3U A;  3O3K A;  1HW1 A;  1XMA A;  3KP3 A;  1YQA A;  4AIH A;  4KMF A;  1YS6 A;  3TOA A;  4NB5 A;  4BHC A;  2ZNY A;  3MQ0 A;  4XSX F;  3KLO A;  1TW3 A;  3IKV A;  5H6R A;  3HRM A;  1BIB A;  2W25 A;  4WF2 A;  4YFX F;  3LA3 A;  3R4K A;  4PGH A;  3KP2 A;  1LEB A;  2MD5 A;  5LLQ A;  2V1D A;  4YIF A;  4EJV A;  2A3S A;  1EH7 A;  3EUH A;  3I59 B;  2VBW A;  3CTA A;  2LF8 A;  1OYY A;  2IRF G;  1DUX C;  1REP C;  3QPH A;  3F21 A;  4JK1 X;  1S7A A;  3BZ6 A;  2M1B A;  3F23 A;  1MD0 A;  3JAM K;  1OMI A;  5CVI A;  3IHU A;  1O3T A;  2PQ8 A;  4M72 A;  2JT1 A;  5L3B A;  2BV6 A;  3RKY A;  1OPC A;  2QYO A;  5K1Y A;  2UWM A;  1Z91 A;  2VON A;  1MJ9 A;  3HOT A;  4HYE A;  5FFX A;  1MGT A;  3OV8 A;  2PEX A;  1SMY F;  4GCV A;  1PDN C;  1BI0 A;  2YU3 A;  4MQ9 F;  5K5O A;  1KQ8 A;  1MZB A;  4EMS A;  3DF8 A;  3KP5 A;  1YLF A;  2XHK A;  1IN4 A;  2FE3 A;  3ZPL A;  4EGY A;  5D8K B;  3LST A;  4B8X A;  2K27 A;  2ZXJ A;  2P5L C;  4CDG A;  3DXJ F;  3RKW A;  3V8L A;  2BBY A;  1B6A A;  2BE5 F;  3CUQ B;  1J7K A;  5HLG A;  2ZKZ A;  4L9V A;  1YG2 A;  4MNU A;  1XGN A;  1OKR A;  5E1W A;  4L0Z B;  1FPQ A;  4EV0 A;  2PMH A;  3KEO A;  4U0V A;  1AWC A;  4I7H A;  1S3J A;  3GFM A;  5FGM A;  5H20 A;  2J5P A;  4LB5 A;  4R79 A;  1PP7 U;  3U1D A;  4YG2 F;  2EFQ A;  5D5W B;  1FNN A;  1G6N A;  3M7G A;  3DPL C;  3GF2 A;  3J81 Z;  3ELK A;  3DEU A;  1Y0U A;  1S29 A;  1G3Y A;  1ZG1 A;  5LHG A;  4XSZ F;  1U5T A;  2CW0 F;  3HRU A;  2FSW A;  5KVR A;  2HOE A;  2YPR A;  1SAX A;  3KP4 A;  3T0Y A;  3TO6 A;  3TOB A;  1XD7 A;  1ZAR A;  4U7B A;  3FX3 A;  5FLX Z;  3AAF A;  2QWW A;  3HYI A;  1ZGJ A;  2XAJ A;  4ZZL A;  4GYG A;  1BJA A;  5BS6 A;  3LAJ A;  2P4W A;  1HW2 A;  5DUI A;  1A04 A;  1OYI A;  2B0L A;  2D1H A;  1D5V A;  4P5O A;  4G7Z F;  1F9N A;  1MJB A;  2XAF A;  1QNT A;  3F8B A;  3SHF A;  2O61 A;  2QEN A;  2HZT A;  2Y48 A;  2MH2 A;  1ZLJ A;  2STW A;  3I59 A;  5AIQ A;  2NRA C;  2TDX A;  3BP8 A;  4OIP F;  2RN7 A;  3L9F A;  5E8G A;  5JI6 A;  2FNP A;  1ZG3 A;  2RQP A;  1OYW A;  3DKW A;  4UXN A;  3FXQ A;  3T8R A;  2WV0 A;  1U78 A;  4CZZ A;  3TQN A;  4HLX A;  1P6R A;  5BQT A;  4WK8 F;  3KE2 A;  3K1P A;  5F64 A;  3ISP A;  4A2U A;  3REO A;  1YIO A;  3RYP A;  2J5O A;  2LKP A;  3F3X A;  1MDM B;  1O7F A;  2ZME B;  1CGP A;  3VFZ A;  2JZY A;  2DPD A;  1I5Z A;  2DI3 A;  1Z7U A;  3BOQ A;  4RGR A;  1FZP B;  3QU6 A;  4KT5 C;  4EGZ A;  3ZQ7 A;  3KZY A;  2ZJ2 A;  2IP2 A;  3GUD A;  1S7O A;  5LGT A;  2EFN A;  2QUF A;  3CUQ A;  4KIG A;  5L3G A;  4QWQ A;  4HZF A;  3RKX A;  2AS5 F;  3MZY A;  5AON A;  3KET A;  4KA4 A;  5DD8 A;  4JQF A;  4PDK A;  5HOO A;  3L7W A;  1LNW A;  2X4H A;  2IA1 A;  2PBI A;  3EET A;  1TBX A;  1TNT A;  2K4J A;  1B4A A;  1P4X A;  3W6K B;  2FQ3 A;  4FT8 A;  3D5L A;  4I2O A;  3FXU A;  2V1X A;  4I09 A;  3BDD A;  1IRG A;  2EA4 A;  4OMY A;  2BYV E;  4UVA A;  4I98 B;  1GHC A;  4IVN A;  5D6E A;  1I1G A;  5E18 F;  2PMU A;  3RDI A;  5CLS A;  4XLN F;  4BHP A;  5CVJ A;  3GFI A;  1FSE A;  1K7A A;  4RAY A;  5L3D A;  4KUM A;  4I02 A;  1BBY A;  3RPU A;  3MFK A;  2D2W A;  3H3Z A;  4YFN F;  4LLN A;  3SZT A;  3WTY C;  4UHT A;  1LDJ A;  1EH8 A;  4NQW A;  4EJW A;  2VN2 A;  3WE3 A;  3EYY A;  5ICF A;  2IT0 A;  5H6Q A;  3VB2 A;  2MH9 A;  3R6S A;  3ZMD A;  3GYH X;  4LK1 F;  5DCF A;  1KYW A;  2RDP A;  4GGG A;  3I58 A;  1O7L A;  2DAO A;  4IRI A;  1TNS A;  1YW8 A;  2Z3Y A;  2DPU A;  3E5Q A;  1P92 A;  4RB0 A;  5J6X A;  3FMQ A;  1T98 A;  1EV7 A;  2ESH A;  4WXH A;  3DQV C;  1J9I A;  1ZHF A;  1KA8 A;  2CFX A;  2AXL A;  5CVU A;  1TW2 A;  3GZ6 A;  2ZO4 A;  2G7U A;  2OD5 A;  1RIO H;  4XLP F;  1LJ9 A;  2HS5 A;  1XGS A;  2FEZ A;  2EV6 A;  1BOA A;  2STT A;  4HA8 A;  1K79 A;  3EYI A;  1G3W A;  4Y15 A;  3V7R A;  2GA1 A;  1TTY A;  2QZ8 A;  5ILS A;  2FNA A;  1FOK A;  4O5V A;  1MDM A;  1G3T A;  2ZME A;  3IL2 A;  1B59 A;  3KFW X;  2DU9 A;  1LVA A;  1B9N A;  4LG0 A;  3VOE A;  2QQA A;  2JSC A;  3V4G A;  2MLK A;  4WXC A;  4LLG F;  1IN5 A;  3TDU C;  2O03 A;  4ENM A;  1RNL A;  5LHI A;  2GXB A;  4UVC A;  2VE9 A;  3GXO A;  4RGU A;  1U3E M;  3WG9 A;  2VOO A;  3T1B A;  3LQR A;  1D8J A;  3GVA A;  1FBQ A;  2EV5 A;  3G3Z A;  4N9H A;  3TKY A;  3G73 A;  1FT9 A;  2XKO A;  2XIG A;  1DPU A;  5L3F A;  4EVI A;  4ON0 A;  4RB1 A;  1P2F A;  2E1N A;  5HS8 A;  3SZP A;  1I1S A;  2LDU A;  1VTN C;  2HFH A;  2YR2 A;  2Z9O A;  5K5Q A;  1TQM A;  5A2Q Z;  4BQA A;  3P9I A;  1BN5 A;  2VT2 A;  3OOP A;  4I01 A;  1R5H A;  4KN7 X;  4RB3 C;  5ICC A;  1U5T B;  2OU2 A;  4LMY A;  4HF0 A;  3FMR A;  3KCC A;  1V3F A;  1D3Y A;  3FXR A;  2CSO A;  5DD4 A;  5HLI A;  4TV7 A;  4RAZ A;  5L3C A;  1BIA A;  4R8H A;  4ETS A;  4M6Y A;  2L4M A;  5BPD A;  4S05 A;  2C6Y A;  3Q9V A;  3B02 A;  1SD5 A;  1P4W A;  1QGP A;  2V79 A;  3GFJ A;  3L2C A;  5HDG A;  2VOP A;  4GXO A;  3CUQ C;  1TQI A;  4YII A;  3HHH A;  3SFZ A;  2EFW A;  5E8I A;  1B9M A;  4CYD A;  3L00 A;  4G6D A;  4M71 A;  1IUY A;  1E2X A;  3KP7 A;  1HQC A;  2GWR A;  2XV4 S;  2M8E A;  3FHZ A;  4AD9 A;  4OOI A;  1I6X A;  1PUE E;  1E17 A;  1C0W A;  5FFZ A;  1HKQ A;  3DFG A;  3ZP5 A;  1ZGA A;  2Q2E A;  1K78 B;  3E6D A;  1W4M A;  4A6D A;  1FBS A;  2IPQ X;  2QQ9 A;  1ODD A;  4HDV A;  1F5T A;  2KIF A;  4CHU A;  1UHW A;  3FZV A;  2L54 A;  2YSR A;  1MJA A;  3IRQ A;  4MGR A;  3SXY A; 
#chains in the Genus database with same CATH topology
 3GFL A;  3E5X A;  2K3F A;  2RGV A;  3LA7 A;  4RAF A;  4Y17 A;  1JKP C;  5EF6 A;  2HKO A;  3PIP F;  5EG0 A;  5K7H A;  2R7F A;  4F91 B;  3HOY J;  2NNY A;  2P8T A;  2LY9 A;  2RVC A;  2EIJ H;  4O6J A;  3J81 K;  2M45 A;  4FE7 A;  1T2K A;  1X2N A;  2I10 A;  2XC7 A;  2DA6 A;  4PJ0 C;  2HDD A;  1K6Y A;  3ERM A;  2O0Y A;  1ORK A;  5HS7 A;  1RUO A;  2Z2S B;  1RPW A;  2V6C A;  1W7P D;  3H0G J;  5ERI A;  4U7D A;  1WH7 A;  1T56 A;  2PJR A;  1XB4 A;  2GXG A;  3BR5 A;  2EFO A;  2A6T A;  4RM2 A;  2XPU A;  1WJB A;  4P9U A;  1MSE C;  5J40 A;  4KN4 X;  5LHH A;  3DKX A;  4E4H A;  1YX3 A;  2ZFU A;  4XBF A;  1R58 A;  3ZQQ A;  4PZJ A;  4HF1 A;  1ETX A;  1EA3 A;  2XAH A;  4IHV A;  3ZMV A;  2CS3 A;  4A12 A;  1ZAO A;  3CCS I;  2F4I A;  3OIP A;  3ROU A;  2W48 A;  1BI3 A;  1GXP A;  4L0Y B;  1ZH5 A;  1SVL A;  1MNM C;  2L9R A;  2GXA A;  5FLX K;  4BGD A;  2HVR A;  2R5Y A;  3K1N A;  4IO9 F;  4M9S A;  2QQ8 A;  3K4L A;  3V7S A;  4RB2 C;  2OZU A;  3S16 J;  4O3M A;  2P6T A;  2QA4 I;  1H88 C;  3PJR A;  4XR6 A;  3M8J A;  2BEO A;  4ENJ A;  2XAQ A;  3V8K A;  5D5V B;  1IDY A;  1K4S A;  3BJA A;  3I64 A;  3L1P A;  4RA2 A;  1CF7 B;  3TP0 A;  5IOY A;  3VWB A;  4HQE A;  3HEF A;  3QOD A;  4AYB N;  3A01 B;  1YFH A;  2A6E F;  1XDS A;  4II3 A;  1M1E B;  1NHA A;  1Z1D A;  2F2E A;  4C3I J;  2FBK A;  1MH4 A;  2K9N A;  4IJA A;  4HSR A;  3E6C C;  3N05 A;  4UV8 A;  3DP7 A;  4CIC A;  2ZME C;  1XPX A;  1WCM J;  4N9I A;  5CVV A;  5EEG A;  5TGT A;  3U9G A;  4PSX A;  3S3M A;  3A0H C;  4F55 A;  2Y0S A;  4U87 A;  2PJP A;  1LB2 A;  5C44 J;  3SQN A;  2ZBK A;  1RI7 A;  4EJT A;  2QCO A;  5M5X J;  3HOU J;  1HF0 A;  2MA3 A;  3JTG A;  2JQ7 A;  1FYK A;  2E1C A;  3GX4 X;  4E7S A;  1IGN A;  1WWX A;  3FK7 A;  1YW7 A;  1YW9 A;  3TO7 A;  4LIT A;  2QVO A;  3ABU A;  2VLA A;  4LIU A;  2KRF A;  1Y56 A;  3PQJ A;  1TL8 A;  3HOS A;  1K83 J;  3JRC A;  4RS8 A;  1S7E A;  4Z6Y A;  3WTX C;  3R60 A;  3BC8 A;  4A5M A;  4L9T A;  5ILV A;  1SD7 A;  4EM1 A;  2K5C A;  3K0L A;  2FRH A;  1FP1 D;  5IP7 J;  3L2W A;  1IJW C;  2ETH A;  3TGN A;  5E3N A;  3CDH A;  3Q0W A;  1WKM A;  2R7W A;  1VQ8 I;  3LSI A;  4IXA A;  1O57 A;  1TT5 B;  3GO5 A;  5HVQ C;  4G7H F;  2DFI A;  4MFE A;  3FF5 A;  4BDZ A;  1FSH A;  4HX4 A;  3U2R A;  1J0R A;  2LNB A;  2M2E A;  2ZFW A;  4M6X A;  2XKP A;  2EZK A;  1UHS A;  1GLN A;  2QQB A;  3NWT A;  4M3G A;  3IH3 A;  3VEP A;  5HS9 A;  4H0E A;  3U1K A;  1K78 A;  3KYD B;  2VBZ A;  4G12 A;  2CMP A;  4A0X A;  3LA2 A;  2FQ4 A;  1IAW A;  3DEE A;  1SD4 A;  2M4G A;  2LY2 A;  3S2D J;  4OAZ A;  1T38 A;  3H5A A;  3BR1 A;  5E1X A;  1QVT A;  3V7C A;  3N4M A;  4AUX A;  2CQK A;  5JLW A;  1JKO C;  2DQL A;  1MBE A;  4NNJ A;  4BUP A;  3S8P A;  1A6I A;  4Y33 A;  4P55 A;  2WA0 A;  2JUC A;  5IYB J;  1R5G A;  5FB2 A;  4ANJ A;  1IF1 A;  5JR3 A;  3CO6 C;  3CP2 A;  2EK5 A;  3CJT B;  1IUF A;  2LYC A;  4LG0 B;  2WAQ N;  1MIJ A;  3E5U A;  2DJN A;  3GBG A;  3HSE A;  3K7A J;  4KIB A;  3SDG A;  4AU7 A;  3AL0 B;  5FJ8 J;  2XGX A;  3ECH A;  2W84 A;  2F5C A;  2OF7 A;  5BMZ A;  3HOW J;  1SMT A;  1QO0 D;  4V2F A;  3WOD F;  4XKC A;  5EJC A;  3CMM A;  1TP4 A;  1MBK A;  3IAS 2;  1SFO J;  5E1Z B;  3DTK A;  3IAM 2;  2EB7 A;  2R7O A;  3GWZ A;  1J2X A;  1S6L A;  5GAD J;  4AYB A;  4RAG A;  3QP6 A;  1TQP A;  3O6B B;  2H6B A;  4DOZ A;  3V42 A;  2XAS A;  2ESN A;  2DJI A;  2LSO A;  3R0A A;  4PGG A;  1NG6 A;  3VYR B;  3DBR B;  3LNQ A;  1B8I A;  3OR2 C;  5ILU A;  1OCT C;  3DEW A;  2NVU B;  2ISZ A;  4YFK F;  4ZDL A;  3CLQ A;  4PUS A;  2GZW A;  5F08 A;  4UUV A;  1FOX A;  2E1O A;  4IRG A;  2O8K A;  3I0T A;  1LKX A;  4N0B A;  1HKT A;  2XAG A;  1IN6 A;  3I53 A;  2QBY B;  2R7Z J;  4AIK A;  2VKD A;  1XSX A;  1AOY A;  1JJ6 C;  1V55 H;  2PG4 A;  5ICG A;  3WTU C;  2OCE A;  3K4M A;  3FM5 A;  2A5W A;  5FD5 A;  1WPK A;  2VJJ A;  1T39 A;  2R0Q C;  3KIO A;  5KCM A;  1BR4 A;  4HW0 A;  4A3B J;  2XRO A;  1CF7 A;  1YRN B;  1UHM A;  1MMG A;  1ZG5 A;  3NEU A;  2LRD A;  4ASN A;  3BQY A;  2XRN A;  2FF4 A;  3ZQH A;  1LE8 B;  4E70 A;  4ZYD A;  2JA8 J;  2A68 F;  3WTW C;  1Z3X A;  5GAE J;  3J7Y J;  2Q0O A;  2HPI A;  2OPT A;  1GVD A;  3K1M A;  1VFC A;  5DCM B;  4UNO A;  4XRM A;  4L9J A;  2F4M B;  2HXO A;  2M34 A;  3CC7 I;  1FX7 A;  4C2M J;  3HTS B;  1LUJ B;  2HWV A;  4XRF A;  1OR7 A;  4ZC3 A;  2ZNZ A;  3FWE A;  4F92 B;  1W5T A;  3RKQ A;  1W0T A;  2RKH A;  1WJE A;  4HV5 A;  4A3F J;  2LBF A;  2JVH A;  3K69 A;  3C1D A;  4AID A;  2L7F P;  1LEA A;  3L2R A;  1R00 A;  2HDC A;  1R1T A;  1IXR C;  3V8J A;  2VIX A;  4CCL A;  2E35 A;  2VB6 A;  3LSG A;  4G8X A;  4OIR F;  3KYL A;  5CQG A;  1FTT A;  1MBF A;  2XB0 X;  1WSU A;  2FXA A;  4XL9 A;  5GTH C;  4HAM A;  3KZZ A;  4OMZ A;  2OV7 A;  4IRH A;  2NYX A;  3NAU A;  5D8L B;  2OAZ A;  4DGW B;  1JTX A;  3MAJ A;  3H3V K;  5HDN A;  4JBA A;  1TWG J;  2K9L A;  2QKL B;  2E7W A;  4BQN A;  2XPW A;  3ZQC A;  1QQI A;  2A69 F;  4WCG A;  1FOY A;  2M4K A;  3BTL A;  3N97 A;  1ZKG A;  3MZH A;  3MD2 A;  3M8F A;  2DA4 A;  1Y1V J;  3R61 A;  1ZRD A;  3Q0U A;  2ISY A;  2DQR A;  1O3S A;  2OZ6 A;  3ZRG A;  4M6V A;  2HYF A;  4LD5 A;  4HRI A;  1OIS A;  2WAD A;  3QP5 A;  2CQ7 A;  1YYV A;  4D5C A;  1MW7 A;  1H0M A;  3CC2 I;  1OFC X;  1JT6 A;  3A02 A;  2YUS A;  1DGR M;  2ZXH A;  1WVR A;  2VKE A;  1IRF A;  4U0Y A;  3IWF A;  2LOO A;  2BZT A;  2CO5 A;  3KEY A;  2DOE A;  5IY5 H;  4NHJ A;  1Y1W J;  1R36 A;  5BNG A;  2HVQ A;  2H09 A;  2E71 A;  2NOG A;  4MHG A;  1EF4 A;  2VXZ A;  4CCJ A;  2R7S A;  3OWT A;  1DPR A;  1XTA A;  4L18 B;  2HKX A;  3HSF A;  3TP3 A;  3RPQ A;  2COM A;  1KON A;  1BL0 A;  1F4K A;  2IGN A;  3JCU C;  4BE2 A;  3HZJ A;  1FLI A;  4ZDO A;  3ZQI A;  1U2W A;  1PUF A;  3PIO F;  2VOD A;  1NH3 A;  3HXL A;  3F0C A;  2D45 A;  4B48 A;  3K4B A;  1G4D A;  3B73 A;  4KIC A;  1U5T C;  1XMK A;  4HQM A;  3F8N A;  1ON2 A;  2V9V A;  3HRT A;  2PN6 A;  4DNC A;  1TWF J;  1BOB A;  3K9T A;  2H94 A;  1IXC A;  4B3A A;  2LH9 A;  2L7Z A;  5HLH A;  1GV5 A;  3VSK A;  1EKE A;  2W85 A;  3R0J A;  3ZOB A;  5M3F J;  2CJJ A;  4MTD A;  3C2H A;  1BC8 C;  2HGC A;  2HYG D;  1ETK A;  2VBY A;  1R5I D;  5LEJ A;  5F1J A;  3C2G A;  4M73 A;  5J8F A;  3I54 A;  1VQK I;  4XRS A;  2VL8 A;  1XX5 A;  4E7I A;  1FC3 A;  1UAA A;  2K4B A;  4KYW A;  3PFI A;  2Y69 H;  2E5Z A;  3IKT A;  1Z05 A;  4Z2Y A;  4G7O F;  1BM9 A;  3JTH A;  3ZN1 A;  3WU1 B;  4H4K C;  4HDU A;  3QPL A;  1I27 A;  2UUZ A;  3O2P E;  3TDZ C;  5A2Q K;  4AVP A;  1YIT I;  1Q1H A;  3D0S A;  4F3Q A;  1SFX A;  4D0P A;  1KU7 A;  1QHG A;  3BPV A;  5DTD A;  1RC9 A;  1Z6T A;  2D1V A;  2DDA A;  3BJO A;  5IT9 K;  1Y0N A;  4HBL A;  3CQZ J;  2W82 A;  2KIS A;  2VT3 A;  2QBY A;  3WTV C;  3WTZ A;  5CQE A;  2NVX J;  4BYY A;  3O8G A;  2KDO A;  4I6Z A;  1STZ A;  5F0H A;  1X3U A;  1ETQ A;  3IRR A;  4N4O B;  4EM0 B;  4BY7 J;  1LFU P;  1QVU A;  1O3R A;  1G3S A;  1N75 A;  4FHT A;  1E3P A;  5IP9 J;  1QZZ A;  3GLX A;  2OQG A;  3T5X A;  4AM3 A;  2QEX I;  1UCR A;  1IW7 F;  4NBQ A;  2FBI A;  3DBH B;  2EZH A;  5BOX A;  1QZY A;  2XUB A;  4HX7 A;  4MLO A;  1GXQ A;  2GA2 A;  3I4P A;  3WHC A;  4C9Y A;  4CZC A;  3W6J B;  4Y13 A;  2BHZ A;  4ZH4 F;  3M3Y J;  2OBP A;  3I71 A;  2DMN A;  3CES A;  3FBN B;  1MMS A;  2A5Y B;  2V9P A;  2EV0 A;  5DCM A;  2CQN A;  3CCQ I;  4V2G A;  2IEK A;  3S14 J;  5IT9 Z;  1J59 A;  3KLN A;  2XSJ C;  3FMS A;  3GME A;  2VBX A;  4YRV A;  2DMP A;  2HQ5 A;  2WB1 N;  2DBB A;  2GM4 A;  2L7M P;  2YS9 A;  3S15 J;  4U88 A;  3TED A;  1ONV A;  1X3W B;  2A07 F;  1GT0 C;  4MQV A;  2R7U A;  5C4J J;  2IGM A;  4KMU X;  2NS8 A;  4UUT A;  3BR6 A;  4IKF A;  3G2B A;  3VYU B;  4F7Z A;  1Z6R A;  5JVT A;  3WGG A;  5TIS C;  4XKV A;  1JE8 A;  3ZCO A;  1FYL A;  2PI0 A;  1V4R A;  3GW2 A;  4KDP A;  3HSR A;  3I55 I;  3IH2 A;  4RGX A;  3BZK A;  2JPB A;  1UFM A;  3SYT A;  4XN0 A;  2XVC A;  5IYC J;  4BJ5 C;  1RKT A;  3ABM H;  3RYR A;  4IQJ A;  3KEQ A;  3LFK A;  5EDN A;  5LBQ A;  2ACJ A;  4HF2 A;  2FBH A;  4EJO A;  2E19 A;  5BPI A;  1WFX A;  3MKY B;  5F1R A;  4IZZ A;  1EH6 A;  1T0F A;  3PFY A;  2DA2 A;  2A61 A;  3ESW B;  3I4M J;  3VSL A;  4MTE A;  1LDD A;  2KQR A;  2DMT A;  4ZYG A;  6PAX A;  2JVG A;  4CGZ A;  4LFU A;  3NRV A;  3OYC A;  1E3H A;  3QYB A;  4NDL A;  2IJL A;  2X9D A;  2M30 A;  1FJL A;  3EUA A;  1JXS A;  4FQG A;  2P5V A;  2W1O A;  4IHW A;  3WE2 A;  1HXD A;  1J75 A;  1B1B A;  4DIQ A;  3ECO A;  2CQX A;  1W7P B;  1GUU A;  1GV2 A;  4XON A;  2K02 A;  1RRJ A;  5E79 C;  3T8T A;  2YU9 J;  4S04 A;  2Z5U A;  5K5R A;  4QIW N;  1S9H A;  2NNN A;  3W6V A;  1V5G A;  2M87 A;  2I5U A;  1O3Q A;  2RNJ A;  4IOC F;  1YS7 A;  4YEJ A;  5DEQ A;  2HXI A;  2CFO A;  3SEQ A;  5DDG A;  1MBH A;  2VPL A;  1BI2 A;  1F1Z A;  1QA6 A;  5J1U A;  3G1M A;  5EZH A;  1HSJ A;  2JMW A;  4OIQ F;  4KIF A;  2K86 A;  2OTL I;  2CWE A;  4CSW A;  5DYM A;  2HOS A;  2ZJQ F;  4A3C J;  3LMM A;  2DK8 A;  4BY1 J;  2V7F A;  3HUG B;  1HDD C;  1DU0 A;  2PLY A;  2P81 A;  4MEY F;  4ESJ A;  4F52 A;  1OR7 C;  2DT5 A;  3FXL A;  4OIN F;  2ME6 A;  2GIV A;  3PNY A;  2HTS A;  2FML A;  1TZL A;  4OU0 A;  1D8K A;  4M9X A;  2HVS A;  4Q47 A;  1XCB A;  1ZRE A;  3DLA A;  2UXX A;  1MKM A;  1RET A;  4A3E J;  2KT0 A;  1YTY A;  4KNY A;  2XF7 A;  3ML6 A;  1IZ1 A;  1HST A;  4A3J J;  2XGD A;  3P9C A;  1IC8 A;  3P7N A;  5IT3 A;  5LGN A;  2RC4 A;  5ED4 A;  2X1D A;  3H9Q A;  2RV8 A;  3OYI A;  2K3P A;  2ELH A;  2JRM A;  2V26 A;  4GYI A;  1LQ1 A;  2B7E A;  4ZYH A;  3L09 A;  4B3X A;  2KDZ A;  1W5S A;  2CUE A;  2PFB A;  1ON1 A;  4P9F A;  5FO5 A;  2E7X A;  4GDF A;  1D0Z A;  1POG A;  2LKS A;  3MWM A;  3ZQG A;  3JW4 A;  5E3O A;  2GQQ A;  4G6Q A;  2X6X A;  1I50 J;  2EA2 A;  4BS9 A;  4L5I A;  3CF5 F;  2MBF A;  3JSP A;  2W24 A;  4UVB A;  2AQE A;  1IO2 A;  5GPA A;  1S8N A;  2ME0 A;  1UB9 A;  4QTR A;  1X1B A;  1W36 D;  1B8I B;  5CYV A;  2WB1 A;  4UB8 C;  3HM5 A;  1ZEL A;  3GTO J;  2DLL A;  5FRO A;  3FHN A;  3JAM Z;  1VQP I;  4BJ6 C;  1VI0 A;  5E3M A;  3PSF A;  2GLO A;  3GZ5 A;  2Y0M A;  4JOM A;  2OC6 A;  2F5F A;  4ENK A;  2MC3 A;  5JHU A;  3OYE A;  2K7L A;  5LRS A;  2IS6 A;  1MMD A;  2XF5 A;  2P5K A;  1YX5 A;  3RIR A;  5FRM A;  1X1A A;  2QKM B;  2CG4 A;  2R3S A;  1T6S A;  2ZCW A;  4BXF A;  5FD6 A;  5E17 F;  4U0W A;  4L5J A;  4D9J A;  2DA3 A;  1QPM A;  1WJF A;  3S2W A;  4XOP A;  2VQG A;  4ESF A;  5CPR B;  1X1C A;  4B43 A;  3MKL A;  3Q5F A;  2AO9 A;  4LK0 F;  1KU3 A;  4UV9 A;  3H9J A;  2CGP A;  1FTZ A;  4HLY A;  3E6B A;  1R49 A;  2X6W A;  2DO7 A;  5EEH A;  2VQL A;  3QYF A;  3M9A A;  4HV6 A;  1H9T A;  4ZJZ A;  4XRS G;  5LRR A;  2NAZ A;  3F22 A;  1ZYR F;  4CCM A;  5ICE A;  4C30 A;  4EJU A;  4RM3 A;  2XGE A;  2RAE A;  3A03 A;  2LBF B;  2XRL A;  1YIJ I;  3GTK J;  2LMD A;  1JHH A;  1LDK B;  2L7K A;  2E60 A;  3RTR A;  3AL0 C;  5FKL A;  3RZO J;  3VYT B;  2OQR A;  3WG7 H;  4MEX F;  3WGH A;  2FU4 A;  1WQ2 A;  4ESB A;  5L3E A;  1SC7 A;  2FJ1 A;  3F8M A;  1D1A A;  3IUO A;  3OYG A;  1D0X A;  2LRE A;  1KU9 A;  1IN7 A;  3BWG A;  2CYY A;  1N78 A;  1BI1 A;  4M9Z A;  4Y3O A;  4FE4 A;  2F5D A;  3G1O A;  1WHU A;  3KP6 A;  4QPO A;  3CCE I;  5F6F A;  3P9K A;  1ZRF A;  3ZMS A;  4AC0 A;  1MMN A;  1UG0 A;  2EBI A;  5D6F A;  2YX7 A;  5HDK A;  2L01 A;  1TLH B;  4B47 A;  3HPG A;  4FX4 A;  3I56 I;  4G9Y A;  2DTR A;  1W7P A;  1RUN A;  3C3W A;  2WC2 A;  5KK1 A;  4Q4Z F;  2NS7 A;  3K70 D;  2DTZ A;  4I0B A;  2FX0 A;  4I0A A;  3OS2 A;  1L3L A;  3JR9 A;  3ASN H;  4HOB A;  2OJE D;  3K10 A;  3ERE D;  4BXU A;  2IVM A;  2JPC A;  3QU3 A;  3CCJ I;  1KYZ A;  2P7V B;  3JSO A;  4M3F A;  2MD0 A;  4Y52 J;  3OIO A;  2NVQ J;  1V54 H;  1WJA A;  2F5E A;  4WX9 A;  3SJM A;  1HW5 A;  2IW5 A;  4BBR J;  1A36 A;  3BRO A;  5FKM A;  2Q8K A;  4HNU A;  3LL7 A;  3QPS A;  4IF4 A;  1PUF B;  3BJ6 A;  3HUG A;  4BDY A;  4BKX A;  1X1D A;  3D5R C;  4IHT A;  2QLZ A;  3M1C A;  2XGC A;  5LEK A;  3QRF F;  3BCA A;  3X2Q H;  3GTM J;  3W2A A;  3TO9 A;  3DPT A;  2KIU A;  2L4A A;  1R22 A;  3FKJ A;  1OCZ H;  1R23 A;  4A0Z A;  3UKG A;  4IPA A;  1USS A;  1ERD A;  3J7Z I;  1Y8R B;  5LGU A;  4QLC U;  2GAU A;  1AHD P;  3RPU D;  2MW8 A;  3BPX A;  1BR2 A;  3OYF A;  1N77 A;  2KLO A;  1MBJ A;  1W5C C;  2JRT A;  1VND A;  2EZI A;  2HQN A;  4LJZ F;  4XOR A;  2OCC H;  4JX5 A;  3ABT A;  4WWC A;  2ZXI A;  2E2J J;  4F93 B;  3IC7 A;  4ENN A;  3ZMZ A;  2R7X A;  2FMY A;  2KIM A;  4ZZD A;  3QPT A;  2A05 A;  2NVT J;  2A6H F;  2Z16 A;  1HC8 A;  2R4G A;  4UUS B;  4BHB A;  2HI3 A;  3CJN A;  2IA2 A;  3H92 A;  2HEO A;  3NQO A;  2EQR A;  4M74 A;  2H27 A;  1U9O A;  1XN7 A;  3M1E A;  1FY7 A;  5EGO B;  1DP7 P;  5IOZ A;  2X48 A;  3L2U A;  2V1U A;  1T0F C;  1XC5 A;  2F6C A;  3ZQF A;  2DYS H;  3Q9S A;  3J7A O;  1ZLK A;  3F6O A;  2OA4 A;  4A3M J;  2E1M C;  2VPR A;  2X0L A;  1BC7 C;  1FP2 A;  1VQL I;  5DM6 F;  1P7J A;  5DV5 A;  2FA5 A;  1U6G A;  4JX4 A;  4IOA F;  2L9S A;  3LFU A;  4XM3 A;  1SFE A;  2TCT A;  1R1V A;  3IWZ A;  4G94 A;  1F36 A;  1Z9C A;  2P6S A;  3OL3 A;  4BH9 A;  2QSF X;  3L2V A;  2UZK A;  1J5Y A;  2WY8 Q;  3HGY A;  4C3J J;  4ZYA A;  2OTJ I;  1QHH D;  4FX0 A;  1GDT A;  3BG7 A;  3FKI J;  2P7C B;  4Q48 A;  1ZN2 A;  1KQ9 A;  4HNV A;  1R1U A;  3BR3 A;  2L9V A;  1ULY A;  2KJB A;  2Z99 A;  5D5U B;  3DPU A;  4K2E A;  2EWN A;  1QRY A;  1V5E A;  1AKH B;  3F72 A;  2M7A A;  1W0U A;  3W3C A;  1YHQ I;  3I5U A;  1WI9 A;  5D5X B;  2CV2 A;  3CLO A;  4KFC A;  1SD6 A;  2KFD A;  3UR3 C;  3W2V A;  1RZ4 A;  3DLL F;  4FTH A;  1LVK A;  5EZG A;  1P4A A;  2EFP A;  3GTJ J;  5D4S A;  1R7J A;  1JHF A;  5J8C A;  3BQZ A;  5KAF C;  2L02 A;  2VAS A;  3G6E I;  2WWY A;  1UST A;  3GEZ A;  4R1H A;  3E6M A;  4XIC A;  3WTS C;  5FLV A;  3ULQ B;  2M5W A;  1IXS B;  1FBU A;  5B66 C;  3OSF A;  3D5S C;  2Z33 A;  4IHS A;  4BNC A;  2FOK A;  3WHB A;  1KGS A;  2ID3 A;  2XPV A;  1FYM A;  2LVS A;  3H35 A;  4Y4R A;  4EQQ A;  4W1U A;  3K2A A;  4JP0 A;  2R7Q A;  3P5J A;  2ZSI B;  2YX4 A;  4E7H A;  1B72 B;  3HC7 A;  3F8F A;  4WXD A;  3BCB A;  5CVR A;  5AIP A;  3F8C A;  4BEH A;  1JI8 A;  3MCZ A;  4PCQ A;  2BXY A;  2X6O A;  3QOP A;  3BY6 A;  2JTV A;  3L2Q A;  4P96 A;  5E3L A;  1U8R A;  1L0O C;  2DOA A;  4X0G A;  2GBY A;  3DWL E;  1GVJ A;  2G7H A;  2VKH A;  2WBM A;  1ZR2 A;  1WZ2 A;  2L2O A;  1XG1 A;  3EDP A;  1IN8 A;  2MFZ A;  2WTE A;  3HIF A;  3HTU A;  1XSV A;  3BG5 A;  1WRJ A;  2Y75 A;  5DS9 A;  4M3E A;  2LR8 A;  4C2T A;  2H1L A;  1N25 A;  5EYR A;  2E1M B;  1U8B A;  3ZN0 A;  3K2Z A;  4CUG A;  3RI4 A;  4V19 K;  4RGS A;  3MEX A;  3HDD A;  2DW4 A;  2P0W A;  4BL0 B;  5IYD J;  1NG7 A;  3WU0 A;  3JRB A;  4Q5S F;  1G8X A;  2HTJ A;  2H8R A;  4A6E A;  2DK5 A;  4B09 A;  1W1W E;  2ECC A;  4M3D A;  3W2W A;  4BBS J;  3J80 K;  4AIJ A;  3G71 I;  3DBL B;  3CME I;  1UG2 A;  3CF2 A;  4RLQ A;  3CCL I;  2QSG X;  5EEA A;  3ABK H;  3OR1 C;  2CUJ A;  1QBJ A;  1XCV A;  4PSW A;  3S3O A;  4DZJ A;  1ZRC A;  1DDN A;  2JJ7 A;  2GIZ A;  2Y2Z A;  4KJZ A;  4LGW A;  1SVO A;  2R7D A;  1X2M A;  4HG2 A;  4A5N A;  3CDI A;  2H6C A;  3GTP J;  1HKS A;  2EH3 A;  2CQQ A;  3DTE A;  3M8E A;  2O6G E;  3WTT C;  1HCR A;  4CO8 A;  3CUO A;  1K6O A;  3CO7 C;  1WJ5 A;  3CCR I;  3DV8 A;  2CV0 A;  4D7N A;  2VC0 A;  4BAY A;  2VKV A;  4HX8 A;  2JSP A;  3E1S A;  2L0K A;  2O3F A;  4P1W A;  1VQ5 I;  1Z7L A;  5KAI C;  2CH0 A;  2X1C A;  1VQ4 I;  1DU6 A;  2JN6 A;  4PJM A;  2MAB A;  1X3Z B;  2WY7 Q;  5TJJ A;  5D4R A;  3SFI A;  1SFU A;  2NS0 A;  1A31 A;  2MLG A;  2HQR A;  3FM3 A;  3BG6 A;  3PQK A;  1XGM A;  2LLK A;  1T8I A;  2OUM A;  5J3L A;  4UY8 I;  3VOD A;  5IP6 A;  4E7J A;  4UUS A;  3J80 Z;  3HHG A;  3F6V A;  1E0E A;  4YIR X;  1VQO I;  5EGO A;  2X51 A;  3GTG J;  3S93 A;  2JA7 J;  2HR3 A;  3LWF A;  3TBI A;  5K7F A;  3BLY A;  4OIO F;  4DBQ A;  2QGU A;  4I99 C;  4DYR A;  4GO1 A;  3E3V A;  4XMY A;  1FWZ A;  3ZMU A;  4HPQ A;  2ZJR F;  5IPA A;  4CXF A;  2ZB9 A;  1HBX G;  2EJR A;  2XAU A;  1VZ0 A;  3COA C;  4EAT A;  5KHD A;  2MC4 A;  1FMV A;  2VE8 A;  3CJQ B;  2R93 J;  5F27 A;  5FKN A;  3TW7 A;  1XDU A;  1JGS A;  3FIW A;  3GCM A;  1W36 C;  3LAP A;  4LLL A;  1XGO A;  3G4S I;  1Z67 A;  5FKO A;  2G9W A;  4LB6 B;  3I4N J;  2LF7 A;  4ZYE A;  4IHY A;  5E20 A;  3ONQ A;  3RQ4 A;  3PNV A;  2FUG 2;  2QM3 A;  2N8G A;  2VC1 A;  3QAH A;  3DKY A;  1JKR C;  3C18 A;  2UXN A;  4DQ2 A;  1AKH A;  5CJ9 A;  2BVL A;  3GZN B;  3OS0 A;  1YO5 C;  2ADU A;  1FMW A;  2BGC A;  2LTP A;  4OWR B;  1R6R A;  4A0Y A;  1I3A A;  5DUK A;  1ETO A;  2W57 A;  3MMY B;  3OSG A;  1H8A C;  1O4X A;  3ZMT A;  4EM2 A;  5M3M J;  5TRD A;  4L9N A;  3EQL F;  2K9S A;  1J09 A;  2TRT A;  2IA0 A;  4XN3 A;  1Z21 A;  2NOJ B;  2O8X A;  4CA0 A;  2ZC2 A;  3EUK L;  5JFR A;  1KU2 A;  3E97 A;  3LQQ A;  3WGI A;  3OYH A;  2F48 A;  4S0H B;  2M8G X;  1XSD A;  1WI3 A;  2KRH A;  2AQF A;  3HRS A;  2EZL A;  1KQ0 A;  4AWX B;  1H9G A;  2FOW A;  1DGW Y;  2L3D A;  2X6Y A;  3C7J A;  3RJP A;  1PP8 F;  5J4Y A;  2KJC A;  3H5R A;  3ZR8 X;  2KKO A;  3H3U A;  3O3K A;  1HW1 A;  4D7M A;  1B72 A;  1D0Y A;  2HDW A;  4I76 A;  1JUM A;  1KZH A;  1BR1 A;  1XMA A;  2MG4 A;  2BOL A;  3KP3 A;  2K40 A;  1YQA A;  4AIH A;  4KMF A;  3K4C A;  1YS6 A;  3TOA A;  4NB5 A;  2IS1 A;  4BHC A;  5F04 A;  2ZNY A;  3MQ0 A;  1FIP A;  1FEX A;  4XSX F;  3KLO A;  1TW3 A;  1BJZ A;  3IKV A;  5H6R A;  4BAC A;  3AG2 H;  3HRM A;  2XDV A;  1BIB A;  1MSF C;  4LIV A;  4A93 J;  3QOE A;  2W25 A;  3FXJ A;  4WF2 A;  1BW5 A;  3HOZ J;  4YFX F;  2VI6 A;  3LA3 A;  1X19 A;  3R4K A;  5F0C A;  4PGH A;  3D1N I;  3KP2 A;  1LEB A;  4HEA 2;  2BHY A;  2MD5 A;  3HGG A;  2VJ4 A;  3S17 J;  2GOM A;  3HPH A;  1JUS A;  5LLQ A;  1ZQ3 P;  4IX7 A;  4B1R A;  5FKK A;  4EEF G;  4BE0 A;  4GRI A;  3ZQL A;  2V1D A;  2E34 A;  4YIF A;  2DA1 A;  3CMY A;  4EJV A;  2A3S A;  3LSH A;  1EH7 A;  3DCF A;  4B44 A;  3EUH A;  3I59 B;  3RCO A;  2VBW A;  1MNE A;  2CRG A;  2LF8 A;  3CTA A;  4IL6 C;  1FIA A;  1OYY A;  4Y7N J;  4PJL A;  3CD6 I;  1SFK A;  2IRF G;  1DUX C;  1REP C;  3QPH A;  3F21 A;  1PVE A;  4JK1 X;  1YE9 A;  1S7A A;  3BZ6 A;  2KP6 A;  4HST A;  4CH7 A;  3HOX J;  2M1B A;  3OYM A;  3HOV J;  1U0J A;  2IXS A;  2RQQ A;  3OIQ A;  4X1E A;  3BT9 A;  2VQH A;  3F23 A;  2ZXW H;  2L5Q A;  1MD0 A;  3JAM K;  1OMI A;  5CVI A;  2V1N A;  1SEU A;  4BE1 A;  3OL4 A;  3IHU A;  1O3T A;  1VF9 A;  2PQ8 A;  4M72 A;  2JT1 A;  4W97 A;  5L3B A;  3OYA A;  2BV6 A;  4DZP A;  3A0B C;  3RKY A;  4CCO A;  2IBD A;  1OPC A;  2BVM A;  2QYO A;  5K1Y A;  3H9G A;  2DYR H;  2UWM A;  1Z91 A;  2VON A;  1MJ9 A;  3HOT A;  4HYE A;  5FFX A;  1MGT A;  4MO7 A;  3M4O J;  3OV8 A;  2PEX A;  2JK3 A;  4CYC B;  4UB6 C;  2DA7 A;  3MZ8 A;  1SMY F;  4AVZ A;  4N4N B;  3JRI A;  4GCV A;  4OAY A;  1PDN C;  1BI0 A;  2JWT A;  2JUG A;  2YU3 A;  1ETY A;  4MQ9 F;  1TWC J;  5K5O A;  1KQ8 A;  4ITV A;  1MZB A;  4EMS A;  3DF8 A;  3KP5 A;  1YLF A;  2XHK A;  1IN4 A;  2FE3 A;  2Z1D A;  3ZPL A;  4EGY A;  5D8K B;  3LST A;  1D1B A;  4B8X A;  2K27 A;  2ZXJ A;  3F9K A;  2P5L C;  4CDG A;  3DXJ F;  3RKW A;  3V8L A;  2BBY A;  1B6A A;  2BE5 F;  3CUQ B;  1J7K A;  4KIS A;  2PMZ N;  5HLG A;  3OYN A;  1HOM A;  2ZKZ A;  3NAR A;  4L9V A;  2R92 J;  1YG2 A;  1CQT A;  2G0E A;  4MNU A;  1XGN A;  2EIL H;  1OKR A;  5E1W A;  4L0Z B;  1FPQ A;  3K4K A;  4EV0 A;  3FBI B;  2PMH A;  2H8W A;  4ZTF A;  4B4C A;  3KEO A;  4U0V A;  1AWC A;  4I7H A;  1S3J A;  3GFM A;  5FGM A;  5H20 A;  2J5P A;  1JT0 A;  3O8H A;  3S2H J;  4LB5 A;  4R79 A;  4A3G J;  1PP7 U;  2DOF A;  4MFD A;  3U1D A;  5B1A H;  4YG2 F;  5B5E C;  2EFQ A;  2VQC A;  1RR8 C;  5D5W B;  1FNN A;  1G6N A;  3M7G A;  4GFB A;  3DPL C;  2LG4 A;  3GF2 A;  3J81 Z;  3ELK A;  2HU9 A;  3QYE A;  3OYJ A;  3DEU A;  1Y0U A;  1S29 A;  2VJI A;  1G3Y A;  1ZG1 A;  3PUF A;  2F5V A;  5FRN A;  5LHG A;  1OQY A;  2X1E A;  4XSZ F;  2LD5 A;  1U5T A;  3GLL A;  3CZ6 A;  2CW0 F;  3BR0 A;  3HRU A;  5M5Y J;  2F4O B;  2FSW A;  5KVR A;  2ELJ A;  1G2H A;  1T33 A;  2HOE A;  3HB9 A;  2YPR A;  1SAX A;  1ZGW A;  2B9S A;  1K4T A;  3KP4 A;  3T0Y A;  1WH5 A;  3TO6 A;  3FXM A;  3TOB A;  1TT0 A;  1XD7 A;  1ZAR A;  4II2 A;  4U7B A;  1HDP A;  3FX3 A;  4RLF A;  4BEH B;  5LFA A;  5FLX Z;  2NVY J;  3ZGK A;  3AAF A;  2QWW A;  3HYI A;  1ZGJ A;  1VQ7 I;  1X58 A;  1JKQ C;  3EPZ A;  2XAJ A;  2Y30 A;  4ZZL A;  1SVM A;  2LC2 A;  4GYG A;  1NK3 P;  3VYS B;  2LY1 A;  1TC3 C;  2KL4 A;  4NQW B;  2LFB A;  4HNT A;  1LFB A;  3LOC A;  5DM7 F;  4XKW A;  5KNL A;  1BJA A;  1A6Q A;  5BS6 A;  4FET A;  1RES A;  1DQU A;  2RRE A;  2P4W A;  3FDY A;  3LAJ A;  3KYC B;  4E7K A;  1HW2 A;  3H0D A;  5DUI A;  1A04 A;  3BG9 A;  1OYI A;  2B0L A;  3TL4 X;  2E5N A;  2D1H A;  1JGG A;  1QU3 A;  2DOD A;  4P5O A;  1D5V A;  4G7Z F;  1F9N A;  1MJB A;  2XAF A;  1QNT A;  3F8B A;  3M07 A;  3JRH A;  3TW6 A;  4LG3 A;  3SHF A;  2O61 A;  2QEN A;  2O5R A;  2HZT A;  2Y48 A;  2MH2 A;  1ZLJ A;  2STW A;  1DP3 A;  3I59 A;  4BQQ A;  2XF6 A;  2Y31 A;  3J7A Y;  5AIQ A;  4D1Q A;  3RZD J;  2NRA C;  2TDX A;  3BP8 A;  3CJR B;  2RN7 A;  3L9F A;  4OIP F;  5C4X J;  5M5W J;  3HL2 A;  5E8G A;  3CCM I;  1YJN I;  5JI6 A;  2JA6 J;  2KPM A;  2FNP A;  1ZG3 A;  2RQP A;  1OYW A;  3DKW A;  4UXN A;  2JA5 J;  1TWA J;  2QSH X;  3FXQ A;  3T8R A;  4KIT B;  2WV0 A;  1XS9 A;  1U78 A;  2K9Q A;  3ZXS A;  5CKT A;  4QPQ A;  4CZZ A;  4A3K J;  1BW6 A;  3TQN A;  3DTI A;  4HLX A;  4JX6 A;  1P6R A;  3OS1 A;  1R9T J;  1YJW I;  3HKZ N;  2WAE A;  5BQT A;  4WK8 F;  3KE2 A;  3PO2 J;  5J47 A;  1RKW A;  3K1P A;  5F64 A;  3ISP A;  1H89 C;  4A2U A;  2FD5 A;  4NC8 A;  3AG4 H;  5JHF A;  2V4J C;  2PMZ A;  4ZTJ A;  3REO A;  1NTC A;  1YIO A;  3RYP A;  3JRD A;  3Q0V A;  2W00 A;  2J5O A;  2LKP A;  4XLE A;  3A4C A;  4DYC A;  3IH4 A;  3F3X A;  2DN0 A;  1MDM B;  3H1C A;  4CYC A;  4CCN A;  1O7F A;  2ICW G;  1ZR4 A;  1OCR H;  2ZME B;  1CGP A;  3OYD A;  3VFZ A;  1VQM I;  2JZY A;  1MMA A;  3AKZ A;  4XKB A;  1T95 A;  1NK2 P;  2DPD A;  1I3Q J;  1I5Z A;  2DI3 A;  1Z7U A;  3BOQ A;  4RGR A;  1FZP B;  3UNG C;  3SEZ A;  3QU6 A;  2LP0 A;  3BTJ A;  4KT5 C;  2DFF A;  4EGZ A;  3CC4 I;  3ZQ7 A;  3KZY A;  1OLT A;  2MYS A;  2ZJ2 A;  1R4N B;  3BTI A;  2IP2 A;  3FK6 A;  3OOU A;  3SZG A;  3GUD A;  1UMQ A;  4C3H J;  1S7O A;  1TWH J;  3I9V 2;  5LGT A;  2EFN A;  2QUF A;  3CUQ A;  4KIG A;  5L3G A;  4DW6 A;  3GTL J;  1WGX A;  3S1Q J;  4QWQ A;  1APL C;  2AXT C;  1S5L C;  4HZF A;  3PNT A;  1YJ9 I;  3RKX A;  2AS5 F;  3MZY A;  5AON A;  2BW3 B;  3KET A;  2W7N A;  4KA4 A;  5DD8 A;  4BJT A;  3BG3 A;  4JQF A;  2KMU A;  4PDK A;  3IP4 B;  4JYK A;  5GTI C;  5HOO A;  4RBO A;  3L7W A;  1LNW A;  2X4H A;  1AA7 A;  2IA1 A;  2PBI A;  3EET A;  1XMX A;  3MKZ A;  2LK2 A;  3EUH C;  1TBX A;  1Z0X A;  1TNT A;  2MGQ A;  2K4J A;  3B6C A;  1B4A A;  1P4X A;  5J1Y A;  4DBR A;  3MN2 A;  1R71 A;  3S32 A;  3W6K B;  2FQ3 A;  3JRE A;  4FT8 A;  4XNF A;  3D5L A;  4G6T B;  3HG9 A;  4PJN A;  4I2O A;  3FXU A;  3GTQ J;  4X6A J;  5HOD A;  2V1X A;  4I09 A;  3BDD A;  1IRG A;  2X85 A;  2EA4 A;  4OMY A;  2CUZ A;  2BYV E;  2DFH A;  4UVA A;  4I98 B;  3A01 A;  1GHC A;  4IVN A;  5D6E A;  4D5F A;  1I1G A;  1JTY A;  2R7T A;  4IEJ A;  5E18 F;  1EJ9 A;  3ABL H;  2PMU A;  3B6A A;  3RDI A;  5CLS A;  4XLN F;  4BHP A;  2E36 A;  3Q3S A;  5CVJ A;  2UV1 A;  3E0J B;  1YI2 I;  3GFI A;  1FSE A;  4YEL A;  1K7A A;  4RAY A;  2V6E A;  5L3D A;  4KUM A;  2AHQ A;  5HNH A;  4I02 A;  3U21 A;  4XID A;  2HNH A;  1A35 A;  5B3S H;  1BBY A;  2CUF A;  3RPU A;  3CP8 A;  3MFK A;  1LPQ A;  2D2W A;  3H3Z A;  4YFN F;  2R5Z B;  4LLN A;  3SZT A;  3WTY C;  2CW7 A;  4UHT A;  1LDJ A;  1EH8 A;  4NUB A;  1MND A;  3LSK A;  4NQW A;  1D1C A;  2VN2 A;  3WE3 A;  4EJW A;  2DA5 A;  3EYY A;  5ICF A;  2IT0 A;  5H6Q A;  3VB2 A;  4L5E A;  3AG1 H;  4M3B A;  2EPF A;  2MH9 A;  3HKZ A;  3R6S A;  3ZMD A;  1QPI A;  3GYH X;  5HNF A;  3KX2 A;  3CCY A;  4LK1 F;  1RR7 A;  3S3N A;  5JLX A;  5DCF A;  3S1R J;  4FCY A;  3ASO H;  1F43 A;  1G59 A;  3DU6 A;  1KYW A;  1X4P A;  2RDP A;  4GGG A;  3I58 A;  1O7L A;  2ID6 A;  3AFH A;  2DAO A;  2EIK H;  3MVP A;  4E7Z A;  3OYB A;  2LKX A;  4IRI A;  1TNS A;  1YW8 A;  2Z3Y A;  2DPU A;  1Y39 A;  1IRZ A;  3E5Q A;  3S1N J;  1P92 A;  4RB0 A;  5J6X A;  4J19 A;  3FMQ A;  1UEL B;  1T98 A;  2HYJ A;  1EV7 A;  2M0M A;  3I3L A;  2ESH A;  4WXH A;  1JJ8 C;  3QQA A;  3CMA I;  2O9L A;  1YOV B;  2JA2 A;  3AG3 H;  2ECB A;  5K7Z A;  3KZI C;  3DQV C;  1V5F A;  1J9I A;  1ZHF A;  4J00 A;  1VQ9 I;  2WAQ A;  1KA8 A;  2CFX A;  2AXL A;  2IGK A;  5LD2 C;  5CVU A;  1TW2 A;  3WU2 C;  1LFP A;  3GZ6 A;  2ZO4 A;  3C2B A;  2EIM H;  3PO3 J;  2G7U A;  2NXN B;  2OD5 A;  1RIO H;  5B1B H;  2H1K A;  4XLP F;  1LJ9 A;  1VQN I;  2HS5 A;  1XGS A;  2FEZ A;  2EV6 A;  1BOA A;  1OCO H;  3A1Y A;  2Q2E B;  1OCP A;  1IG7 A;  2STT A;  1ACI A;  4HA8 A;  1K79 A;  3EYI A;  1G3W A;  4Y15 A;  3K6G A;  3QWL A;  4IHX A;  1BA5 A;  3V7R A;  2BXZ A;  5JVG F;  5HLT A;  2GA1 A;  1TTY A;  2QZ8 A;  4C2U A;  5ILS A;  2FNA A;  1FOK A;  4FIS A;  4O5V A;  1MDM A;  2M3A A;  2I8D A;  1G3T A;  2Y9Y A;  2ZME A;  5F0F A;  2DMU A;  3IL2 A;  1B59 A;  2BY2 A;  1ZTR A;  1X1P A;  3KFW X;  2DU9 A;  4A3D J;  1LVA A;  4DJA A;  4XK4 A;  1B9N A;  2D5V A;  4LG0 A;  2IGO A;  3VOE A;  2QQA A;  2JSC A;  1Y6I A;  2KZG A;  3V4G A;  1IV8 A;  1Y8Q B;  3CDL A;  3S1M J;  2MLK A;  2DT7 B;  2XB5 A;  2HOA A;  4LLG F;  4WXC A;  1IN5 A;  2ZJP F;  2B63 J;  1OJL A;  2O03 A;  3TDU C;  4ENM A;  2IS2 A;  1RNL A;  1P9Q C;  5LHI A;  2W4S A;  2GXB A;  5EG0 B;  3VDX A;  4UVC A;  1T08 B;  3E7L A;  2VE9 A;  3GXO A;  4RGU A;  3G1L A;  3TMO A;  3H5N A;  1U3E M;  3WG9 A;  1D5Y A;  2VOO A;  3T1B A;  3LQR A;  1D8J A;  4XLA A;  2BW3 A;  3MKW B;  3GVA A;  4PFP A;  1FBQ A;  2E2H J;  2EV5 A;  2WAF A;  2DMQ A;  3G3Z A;  4N9H A;  2O7O A;  2PJR B;  2KIQ A;  1IDZ A;  3TKY A;  3G73 A;  2GOX B;  2RNG A;  1FT9 A;  2XKO A;  2XIG A;  3RQI A;  2M9H A;  3OY9 A;  1HLV A;  1DPU A;  5L3F A;  4EVI A;  5GAG J;  4LOC A;  1ZK8 A;  4XLF A;  4XLH A;  3LSR A;  4ON0 A;  1JUP A;  4RB1 A;  2IS4 A;  1P2F A;  3FIS A;  1PYV A;  1IRX A;  1R4M B;  2E1N A;  2K9M A;  3JRF A;  2R5Y B;  1MBG A;  3PM1 A;  2QF7 A;  4A3I J;  2ELK A;  3JRA A;  3K4N A;  5HS8 A;  1YRN A;  2R7R A;  3SZP A;  2COB A;  1I1S A;  2LDU A;  2Q1Z B;  1VTN C;  2HFH A;  5J1R A;  1Z77 A;  4J01 A;  4A69 C;  2YR2 A;  1WJD A;  4KT6 A;  4IQ4 A;  1LE8 A;  2Z9O A;  2HZD A;  5K5Q A;  1TQM A;  5A2Q Z;  3IV5 A;  4BQA A;  3HJE A;  5J4V A;  4A3L J;  3P9I A;  1BN5 A;  2DXI A;  2VT2 A;  3OOP A;  1HA8 A;  4CCK A;  2HQA A;  4I01 A;  1FOW A;  1R5H A;  4KN7 X;  4RB3 C;  5ICC A;  1U5T B;  2KHM A;  2M0C A;  2BY0 A;  2OU2 A;  4LMY A;  4ZDP A;  4HF0 A;  2R5Z A;  3FMR A;  4E7L A;  2VUM J;  3KCC A;  1V3F A;  1D3Y A;  1X4O A;  3FXR A;  3HBL A;  1QZE A;  1S72 I;  2DT6 A;  2CSO A;  4XLC A;  5DD4 A;  4TV7 A;  3PSI A;  5HLI A;  4RAZ A;  5L3C A;  4E6K G;  2IAI A;  1BIA A;  1MH3 A;  4R8H A;  4ETS A;  4M6Y A;  1E3O C;  2L4M A;  4MIM A;  4NC6 A;  5BPD A;  4S05 A;  2C6Y A;  3Q9V A;  4RDU A;  3H36 A;  3B02 A;  5FLM J;  1SD5 A;  5GAH J;  4XQF A;  1P4W A;  1QGP A;  2V79 A;  3GFJ A;  3L2C A;  3DU5 A;  3FXK A;  2E2I J;  2WV1 A;  5HDG A;  3LSP A;  2VOP A;  4GXO A;  3CUQ C;  1VQ6 I;  3PUB A;  1TQI A;  3FXO A;  2CW8 A;  2PX9 A;  3KPH A;  4YII A;  2HPM A;  1AU7 A;  3HHH A;  2CV1 A;  4XOT A;  3NWS A;  3SFZ A;  2EFW A;  2VXD A;  3OYL A;  1UZC A;  5E8I A;  2DCE A;  1B9M A;  4CYD A;  3K70 C;  5C3E J;  5GPC A;  3JRG A;  3L00 A;  2MSY A;  1SAU A;  2KZV A;  4G6D A;  2Y0S N;  4M71 A;  3BZC A;  3OYK A;  1IUY A;  1P7I A;  2BY1 A;  1PJR A;  1E2X A;  3KP7 A;  1HQC A;  4PFO A;  2HOT A;  2XV4 S;  2GWR A;  3BR2 A;  1ETV A;  1UJ8 A;  2KRC A;  2M8E A;  3FHZ A;  1SAN A;  2VJ5 A;  3VPR A;  2XSD C;  2Y9Z A;  4BXX J;  4AD9 A;  4OOI A;  1I6X A;  4RMN A;  3CCV I;  3LSM A;  1PUE E;  1E17 A;  1ENH A;  1C0W A;  4FAS D;  5FFZ A;  3SDB A;  2K85 A;  1HKQ A;  3DFG A;  2BY3 A;  4NC7 A;  1ZGA A;  3ZP5 A;  1U9N A;  2Q2E A;  1ETW A;  2L9N A;  1Q1V A;  1K78 B;  2V9K A;  1A5J A;  2DFE A;  3E6D A;  4PJJ A;  1W4M A;  4A6D A;  1FBS A;  4PK4 A;  4BQO A;  1Z3Y A;  2EIN H;  2R7V A;  2IPQ X;  1I39 A;  1K61 A;  2QQ9 A;  3LSJ A;  1I6H J;  1ODD A;  2ZSH B;  3K4J A;  4HDV A;  1F5T A;  2KIF A;  4ABZ A;  5H2F C;  3RSN A;  2DDB A;  4CHU A;  5GP9 A;  1WJC A;  3PL8 A;  1UHW A;  3FZV A;  3BTC A;  1ITY A;  2L54 A;  3OMY A;  2YSR A;  1MJA A;  2M7B A;  9ANT A;  4BU2 A;  4QSH A;  3CCU I;  3IRQ A;  1OCC H;  4MGR A;  3SXY A;  2CU7 A;  4DYQ A;  3A2K A;  1IV6 A; 
#chains in the Genus database with same CATH homology
 3GFL A;  3E5X A;  2RGV A;  3LA7 A;  4Y17 A;  2HKO A;  2R7F A;  2NNY A;  2P8T A;  2RVC A;  4O6J A;  3J81 K;  2M45 A;  1T2K A;  2O0Y A;  5HS7 A;  1RUO A;  2V6C A;  1W7P D;  5ERI A;  4U7D A;  1XB4 A;  2GXG A;  2EFO A;  4P9U A;  4KN4 X;  5LHH A;  4XBF A;  1R58 A;  4PZJ A;  4HF1 A;  2XAH A;  3ZMV A;  4A12 A;  1ZAO A;  3ROU A;  1BI3 A;  1GXP A;  4L0Y B;  1ZH5 A;  5FLX K;  3K1N A;  4M9S A;  3V7S A;  4RB2 C;  2OZU A;  4O3M A;  2P6T A;  2BEO A;  4ENJ A;  2XAQ A;  3V8K A;  5D5V B;  3BJA A;  3I64 A;  1CF7 B;  4HQE A;  1YFH A;  2A6E F;  1XDS A;  1NHA A;  1Z1D A;  2F2E A;  2FBK A;  4IJA A;  3E6C C;  4UV8 A;  3DP7 A;  4CIC A;  4N9I A;  5CVV A;  5EEG A;  3U9G A;  2PJP A;  1LB2 A;  3SQN A;  2ZBK A;  1RI7 A;  4EJT A;  2MA3 A;  3JTG A;  1FYK A;  2E1C A;  3GX4 X;  1WWX A;  1YW7 A;  1YW9 A;  3TO7 A;  2QVO A;  3ABU A;  2KRF A;  3PQJ A;  3HOS A;  4RS8 A;  3WTX C;  3R60 A;  4A5M A;  4L9T A;  5ILV A;  1SD7 A;  4EM1 A;  3K0L A;  2FRH A;  1FP1 D;  2ETH A;  3TGN A;  3CDH A;  1WKM A;  4IXA A;  1O57 A;  3GO5 A;  5HVQ C;  4G7H F;  2DFI A;  1FSH A;  3FF5 A;  4HX4 A;  3U2R A;  1J0R A;  2LNB A;  2ZFW A;  4M6X A;  2XKP A;  2QQB A;  3VEP A;  4H0E A;  5HS9 A;  1K78 A;  2VBZ A;  4A0X A;  3LA2 A;  1IAW A;  1SD4 A;  1T38 A;  5E1X A;  3V7C A;  3N4M A;  2CQK A;  2DQL A;  4P55 A;  1R5G A;  5FB2 A;  1IF1 A;  5JR3 A;  3CO6 C;  2EK5 A;  4LG0 B;  3E5U A;  3HSE A;  4KIB A;  2XGX A;  3ECH A;  2W84 A;  2F5C A;  5BMZ A;  1SMT A;  1QO0 D;  3WOD F;  5E1Z B;  2EB7 A;  3GWZ A;  1J2X A;  1S6L A;  3QP6 A;  1TQP A;  3O6B B;  2H6B A;  2XAS A;  2ESN A;  2LSO A;  3R0A A;  4PGG A;  5ILU A;  2ISZ A;  4YFK F;  2GZW A;  4UUV A;  4IRG A;  3I0T A;  4N0B A;  1HKT A;  2XAG A;  1IN6 A;  3I53 A;  2QBY B;  4AIK A;  1XSX A;  1AOY A;  2PG4 A;  5ICG A;  3WTU C;  3FM5 A;  5FD5 A;  1T39 A;  4HW0 A;  2XRO A;  1CF7 A;  1UHM A;  1ZG5 A;  3NEU A;  4ASN A;  2XRN A;  2FF4 A;  4E70 A;  4ZYD A;  2A68 F;  3WTW C;  2Q0O A;  3K1M A;  5DCM B;  4UNO A;  4L9J A;  1FX7 A;  3HTS B;  2HWV A;  4XRF A;  1OR7 A;  2ZNZ A;  3FWE A;  1W5T A;  2RKH A;  4HV5 A;  3K69 A;  3C1D A;  1LEA A;  1R00 A;  2HDC A;  1R1T A;  1IXR C;  3V8J A;  4G8X A;  4OIR F;  1WSU A;  2FXA A;  4HAM A;  3KZZ A;  4OMZ A;  4IRH A;  2NYX A;  5D8L B;  2OAZ A;  3MAJ A;  5HDN A;  4JBA A;  2E7W A;  1QQI A;  2A69 F;  4WCG A;  3N97 A;  3MZH A;  3M8F A;  3R61 A;  1ZRD A;  2ISY A;  2DQR A;  1O3S A;  2OZ6 A;  2HYF A;  4LD5 A;  3QP5 A;  1YYV A;  1H0M A;  1IRF A;  4U0Y A;  3IWF A;  2CO5 A;  4NHJ A;  1R36 A;  2H09 A;  4MHG A;  2VXZ A;  1DPR A;  4L18 B;  2HKX A;  3HSF A;  3RPQ A;  2COM A;  1F4K A;  1FLI A;  1U2W A;  2VOD A;  2D45 A;  1G4D A;  3B73 A;  4KIC A;  1U5T C;  1XMK A;  4HQM A;  3F8N A;  1ON2 A;  2V9V A;  3HRT A;  2PN6 A;  4DNC A;  3K9T A;  2H94 A;  1IXC A;  5HLH A;  2W85 A;  3R0J A;  4MTD A;  1BC8 C;  2HGC A;  2HYG D;  2VBY A;  5LEJ A;  4M73 A;  5J8F A;  3I54 A;  1FC3 A;  2K4B A;  4KYW A;  3PFI A;  3IKT A;  1Z05 A;  4Z2Y A;  4G7O F;  1BM9 A;  3JTH A;  3ZN1 A;  3WU1 B;  4HDU A;  1I27 A;  3O2P E;  5A2Q K;  3TDZ C;  4AVP A;  1Q1H A;  3D0S A;  1SFX A;  4D0P A;  1KU7 A;  3BPV A;  1Z6T A;  2D1V A;  3BJO A;  5IT9 K;  4HBL A;  2VT3 A;  2QBY A;  3WTV C;  3WTZ A;  4BYY A;  1STZ A;  1X3U A;  3IRR A;  4EM0 B;  1O3R A;  1G3S A;  4FHT A;  1QZZ A;  3GLX A;  2OQG A;  3T5X A;  1UCR A;  1IW7 F;  2FBI A;  5BOX A;  1QZY A;  2XUB A;  4HX7 A;  1GXQ A;  2GA2 A;  3I4P A;  3W6J B;  4Y13 A;  4ZH4 F;  2OBP A;  3I71 A;  2A5Y B;  2EV0 A;  5DCM A;  5IT9 Z;  1J59 A;  3KLN A;  3FMS A;  2VBX A;  2DBB A;  4U88 A;  2A07 F;  1ONV A;  4MQV A;  4KMU X;  4F7Z A;  1Z6R A;  5JVT A;  3WGG A;  1JE8 A;  1FYL A;  2PI0 A;  1V4R A;  3GW2 A;  4KDP A;  3HSR A;  4RGX A;  2JPB A;  1UFM A;  2XVC A;  3RYR A;  3KEQ A;  3LFK A;  2ACJ A;  5LBQ A;  4HF2 A;  2FBH A;  4EJO A;  5BPI A;  5F1R A;  1EH6 A;  1T0F A;  2A61 A;  4MTE A;  1LDD A;  4ZYG A;  6PAX A;  4CGZ A;  4LFU A;  3NRV A;  2IJL A;  2M30 A;  1JXS A;  2P5V A;  3WE2 A;  1HXD A;  1J75 A;  1B1B A;  3ECO A;  1W7P B;  2K02 A;  3T8T A;  4S04 A;  2Z5U A;  5K5R A;  2NNN A;  2M87 A;  1O3Q A;  2RNJ A;  1YS7 A;  5DEQ A;  5DDG A;  1BI2 A;  1F1Z A;  1HSJ A;  4OIQ F;  4KIF A;  2K86 A;  2CWE A;  5DYM A;  2DK8 A;  2PLY A;  4ESJ A;  4MEY F;  2DT5 A;  4OIN F;  2GIV A;  2HTS A;  2FML A;  4OU0 A;  1D8K A;  4M9X A;  4Q47 A;  1XCB A;  1ZRE A;  2UXX A;  1MKM A;  1YTY A;  4KNY A;  3ML6 A;  1IZ1 A;  1HST A;  3P9C A;  3P7N A;  5IT3 A;  5LGN A;  2RC4 A;  5ED4 A;  2RV8 A;  2ELH A;  4GYI A;  1LQ1 A;  4ZYH A;  3L09 A;  1W5S A;  2PFB A;  1ON1 A;  4P9F A;  5FO5 A;  2E7X A;  3MWM A;  3JW4 A;  2GQQ A;  4G6Q A;  2EA2 A;  4L5I A;  2MBF A;  3JSP A;  2W24 A;  4UVB A;  1S8N A;  1UB9 A;  5CYV A;  2DLL A;  3JAM Z;  3GZ5 A;  2Y0M A;  2F5F A;  4ENK A;  2MC3 A;  5JHU A;  2K7L A;  5LRS A;  2P5K A;  3RIR A;  2CG4 A;  2R3S A;  1T6S A;  2ZCW A;  5FD6 A;  5E17 F;  4U0W A;  4L5J A;  1QPM A;  3S2W A;  4ESF A;  3Q5F A;  4LK0 F;  1KU3 A;  4UV9 A;  2CGP A;  4HLY A;  3E6B A;  5EEH A;  2DO7 A;  3M9A A;  4HV6 A;  1H9T A;  5LRR A;  2NAZ A;  3F22 A;  1ZYR F;  5ICE A;  4EJU A;  1JHH A;  1LDK B;  3RTR A;  2OQR A;  4MEX F;  3WGH A;  2FU4 A;  1WQ2 A;  4ESB A;  5L3E A;  3F8M A;  1KU9 A;  1IN7 A;  3BWG A;  2CYY A;  1BI1 A;  4M9Z A;  2F5D A;  3KP6 A;  5F6F A;  3P9K A;  1ZRF A;  3ZMS A;  5D6F A;  2YX7 A;  5HDK A;  2L01 A;  1TLH B;  4FX4 A;  4G9Y A;  2DTR A;  1W7P A;  1RUN A;  3C3W A;  2WC2 A;  5KK1 A;  4Q4Z F;  4I0B A;  4I0A A;  1L3L A;  4HOB A;  3ERE D;  4BXU A;  2IVM A;  2JPC A;  3QU3 A;  1KYZ A;  2P7V B;  3JSO A;  2F5E A;  4WX9 A;  1HW5 A;  2IW5 A;  3BRO A;  2Q8K A;  4IF4 A;  3BJ6 A;  3HUG A;  4IHT A;  2QLZ A;  5LEK A;  3QRF F;  3TO9 A;  3DPT A;  2KIU A;  2L4A A;  1R22 A;  4A0Z A;  1R23 A;  4IPA A;  1USS A;  5LGU A;  4QLC U;  2GAU A;  3BPX A;  4LJZ F;  2JRT A;  2HQN A;  3ABT A;  4WWC A;  3IC7 A;  4ENN A;  3ZMZ A;  2FMY A;  2KIM A;  4ZZD A;  3QPT A;  2A6H F;  4BHB A;  3CJN A;  2IA2 A;  3H92 A;  2HEO A;  3NQO A;  4M74 A;  2H27 A;  1XN7 A;  3M1E A;  1DP7 P;  1FY7 A;  2V1U A;  3Q9S A;  3J7A O;  1ZLK A;  3F6O A;  2OA4 A;  1BC7 C;  2X0L A;  1FP2 A;  5DV5 A;  2FA5 A;  1U6G A;  1SFE A;  1R1V A;  3IWZ A;  4G94 A;  1Z9C A;  2P6S A;  4BH9 A;  2UZK A;  1J5Y A;  4FX0 A;  2P7C B;  4Q48 A;  1ZN2 A;  1KQ9 A;  1R1U A;  2Z99 A;  1ULY A;  2KJB A;  5D5U B;  4K2E A;  2EWN A;  3F72 A;  3I5U A;  1WI9 A;  5D5X B;  3CLO A;  4KFC A;  1SD6 A;  1RZ4 A;  1P4A A;  2EFP A;  5D4S A;  1R7J A;  1JHF A;  5J8C A;  2WWY A;  2L02 A;  1UST A;  3GEZ A;  4R1H A;  3E6M A;  3WTS C;  3ULQ B;  2M5W A;  1IXS B;  1FBU A;  2Z33 A;  4IHS A;  4BNC A;  2FOK A;  1KGS A;  1FYM A;  4EQQ A;  2YX4 A;  3F8F A;  4WXD A;  5CVR A;  5AIP A;  3F8C A;  3MCZ A;  4PCQ A;  3QOP A;  3BY6 A;  2JTV A;  4P96 A;  1U8R A;  1L0O C;  1GVJ A;  2G7H A;  3EDP A;  1IN8 A;  2WTE A;  3HIF A;  3HTU A;  1XSV A;  1WRJ A;  2Y75 A;  3ZN0 A;  3K2Z A;  3RI4 A;  4RGS A;  3MEX A;  2DW4 A;  3WU0 A;  4Q5S F;  2HTJ A;  4A6E A;  2DK5 A;  4B09 A;  3J80 K;  4AIJ A;  1QBJ A;  1XCV A;  1ZRC A;  1DDN A;  4LGW A;  2R7D A;  4A5N A;  2H6C A;  1HKS A;  3M8E A;  2O6G E;  3WTT C;  4CO8 A;  3CUO A;  1K6O A;  3CO7 C;  3DV8 A;  2VC0 A;  4BAY A;  4HX8 A;  2O3F A;  5TJJ A;  5D4R A;  1SFU A;  2NS0 A;  2MLG A;  2HQR A;  3FM3 A;  3PQK A;  1XGM A;  3VOD A;  3J80 Z;  3HHG A;  3F6V A;  2HR3 A;  3LWF A;  4OIO F;  4GO1 A;  3E3V A;  1FWZ A;  3ZMU A;  4CXF A;  1HBX G;  2EJR A;  3COA C;  2VE8 A;  1XDU A;  1JGS A;  3LAP A;  4LLL A;  1XGO A;  2G9W A;  4LB6 B;  2LF7 A;  4ZYE A;  5E20 A;  2QM3 A;  2VC1 A;  3QAH A;  3C18 A;  2UXN A;  4DQ2 A;  5CJ9 A;  1YO5 C;  2ADU A;  2BGC A;  4A0Y A;  5DUK A;  2W57 A;  3ZMT A;  4EM2 A;  5TRD A;  4L9N A;  3EQL F;  2IA0 A;  2O8X A;  5JFR A;  1KU2 A;  3E97 A;  3LQQ A;  3WGI A;  1XSD A;  3HRS A;  1KQ0 A;  4AWX B;  1H9G A;  3C7J A;  2L3D A;  3RJP A;  1PP8 F;  2KJC A;  2KKO A;  3H3U A;  3O3K A;  1HW1 A;  1XMA A;  3KP3 A;  1YQA A;  4AIH A;  4KMF A;  1YS6 A;  3TOA A;  4NB5 A;  4BHC A;  2ZNY A;  3MQ0 A;  4XSX F;  3KLO A;  1TW3 A;  3IKV A;  5H6R A;  3HRM A;  1BIB A;  2W25 A;  4WF2 A;  4YFX F;  3LA3 A;  3R4K A;  4PGH A;  3KP2 A;  1LEB A;  2MD5 A;  5LLQ A;  2V1D A;  4YIF A;  4EJV A;  2A3S A;  1EH7 A;  3EUH A;  3I59 B;  2VBW A;  3CTA A;  2LF8 A;  1OYY A;  2IRF G;  1DUX C;  1REP C;  3QPH A;  3F21 A;  4JK1 X;  1S7A A;  3BZ6 A;  2M1B A;  3F23 A;  1MD0 A;  3JAM K;  1OMI A;  5CVI A;  3IHU A;  1O3T A;  2PQ8 A;  4M72 A;  2JT1 A;  5L3B A;  2BV6 A;  3RKY A;  1OPC A;  2QYO A;  5K1Y A;  2UWM A;  1Z91 A;  2VON A;  1MJ9 A;  3HOT A;  4HYE A;  5FFX A;  1MGT A;  3OV8 A;  2PEX A;  1SMY F;  4GCV A;  1PDN C;  1BI0 A;  2YU3 A;  4MQ9 F;  5K5O A;  1KQ8 A;  1MZB A;  4EMS A;  3DF8 A;  3KP5 A;  1YLF A;  2XHK A;  1IN4 A;  2FE3 A;  3ZPL A;  4EGY A;  5D8K B;  3LST A;  4B8X A;  2K27 A;  2ZXJ A;  2P5L C;  4CDG A;  3DXJ F;  3RKW A;  3V8L A;  2BBY A;  1B6A A;  2BE5 F;  3CUQ B;  1J7K A;  5HLG A;  2ZKZ A;  4L9V A;  1YG2 A;  4MNU A;  1XGN A;  1OKR A;  5E1W A;  4L0Z B;  1FPQ A;  4EV0 A;  2PMH A;  3KEO A;  4U0V A;  1AWC A;  4I7H A;  1S3J A;  3GFM A;  5FGM A;  5H20 A;  2J5P A;  4LB5 A;  4R79 A;  1PP7 U;  3U1D A;  4YG2 F;  2EFQ A;  5D5W B;  1FNN A;  1G6N A;  3M7G A;  3DPL C;  3GF2 A;  3J81 Z;  3ELK A;  3DEU A;  1Y0U A;  1S29 A;  1G3Y A;  1ZG1 A;  5LHG A;  4XSZ F;  1U5T A;  2CW0 F;  3HRU A;  2FSW A;  5KVR A;  2HOE A;  2YPR A;  1SAX A;  3KP4 A;  3T0Y A;  3TO6 A;  3TOB A;  1XD7 A;  1ZAR A;  4U7B A;  3FX3 A;  5FLX Z;  3AAF A;  2QWW A;  3HYI A;  1ZGJ A;  2XAJ A;  4ZZL A;  4GYG A;  1BJA A;  5BS6 A;  3LAJ A;  2P4W A;  1HW2 A;  5DUI A;  1A04 A;  1OYI A;  2B0L A;  2D1H A;  1D5V A;  4P5O A;  4G7Z F;  1F9N A;  1MJB A;  2XAF A;  1QNT A;  3F8B A;  3SHF A;  2O61 A;  2QEN A;  2HZT A;  2Y48 A;  2MH2 A;  1ZLJ A;  2STW A;  3I59 A;  5AIQ A;  2NRA C;  2TDX A;  3BP8 A;  4OIP F;  2RN7 A;  3L9F A;  5E8G A;  5JI6 A;  2FNP A;  1ZG3 A;  2RQP A;  1OYW A;  3DKW A;  4UXN A;  3FXQ A;  3T8R A;  2WV0 A;  1U78 A;  4CZZ A;  3TQN A;  4HLX A;  1P6R A;  5BQT A;  4WK8 F;  3KE2 A;  3K1P A;  5F64 A;  3ISP A;  4A2U A;  3REO A;  1YIO A;  3RYP A;  2J5O A;  2LKP A;  3F3X A;  1MDM B;  1O7F A;  2ZME B;  1CGP A;  3VFZ A;  2JZY A;  2DPD A;  1I5Z A;  2DI3 A;  1Z7U A;  3BOQ A;  4RGR A;  1FZP B;  3QU6 A;  4KT5 C;  4EGZ A;  3ZQ7 A;  3KZY A;  2ZJ2 A;  2IP2 A;  3GUD A;  1S7O A;  5LGT A;  2EFN A;  2QUF A;  3CUQ A;  4KIG A;  5L3G A;  4QWQ A;  4HZF A;  3RKX A;  2AS5 F;  3MZY A;  5AON A;  3KET A;  4KA4 A;  5DD8 A;  4JQF A;  4PDK A;  5HOO A;  3L7W A;  1LNW A;  2X4H A;  2IA1 A;  2PBI A;  3EET A;  1TBX A;  1TNT A;  2K4J A;  1B4A A;  1P4X A;  3W6K B;  2FQ3 A;  4FT8 A;  3D5L A;  4I2O A;  3FXU A;  2V1X A;  4I09 A;  3BDD A;  1IRG A;  2EA4 A;  4OMY A;  2BYV E;  4UVA A;  4I98 B;  1GHC A;  4IVN A;  5D6E A;  1I1G A;  5E18 F;  2PMU A;  3RDI A;  5CLS A;  4XLN F;  4BHP A;  5CVJ A;  3GFI A;  1FSE A;  1K7A A;  4RAY A;  5L3D A;  4KUM A;  4I02 A;  1BBY A;  3RPU A;  3MFK A;  2D2W A;  3H3Z A;  4YFN F;  4LLN A;  3SZT A;  3WTY C;  4UHT A;  1LDJ A;  1EH8 A;  4NQW A;  4EJW A;  2VN2 A;  3WE3 A;  3EYY A;  5ICF A;  2IT0 A;  5H6Q A;  3VB2 A;  2MH9 A;  3R6S A;  3ZMD A;  3GYH X;  4LK1 F;  5DCF A;  1KYW A;  2RDP A;  4GGG A;  3I58 A;  1O7L A;  2DAO A;  4IRI A;  1TNS A;  1YW8 A;  2Z3Y A;  2DPU A;  3E5Q A;  1P92 A;  4RB0 A;  5J6X A;  3FMQ A;  1T98 A;  1EV7 A;  2ESH A;  4WXH A;  3DQV C;  1J9I A;  1ZHF A;  1KA8 A;  2CFX A;  2AXL A;  5CVU A;  1TW2 A;  3GZ6 A;  2ZO4 A;  2G7U A;  2OD5 A;  1RIO H;  4XLP F;  1LJ9 A;  2HS5 A;  1XGS A;  2FEZ A;  2EV6 A;  1BOA A;  2STT A;  4HA8 A;  1K79 A;  3EYI A;  1G3W A;  4Y15 A;  3V7R A;  2GA1 A;  1TTY A;  2QZ8 A;  5ILS A;  2FNA A;  1FOK A;  4O5V A;  1MDM A;  1G3T A;  2ZME A;  3IL2 A;  1B59 A;  3KFW X;  2DU9 A;  1LVA A;  1B9N A;  4LG0 A;  3VOE A;  2QQA A;  2JSC A;  3V4G A;  2MLK A;  4WXC A;  4LLG F;  1IN5 A;  3TDU C;  2O03 A;  4ENM A;  1RNL A;  5LHI A;  2GXB A;  4UVC A;  2VE9 A;  3GXO A;  4RGU A;  1U3E M;  3WG9 A;  2VOO A;  3T1B A;  3LQR A;  1D8J A;  3GVA A;  1FBQ A;  2EV5 A;  3G3Z A;  4N9H A;  3TKY A;  3G73 A;  1FT9 A;  2XKO A;  2XIG A;  1DPU A;  5L3F A;  4EVI A;  4ON0 A;  4RB1 A;  1P2F A;  2E1N A;  5HS8 A;  3SZP A;  1I1S A;  2LDU A;  1VTN C;  2HFH A;  2YR2 A;  2Z9O A;  5K5Q A;  1TQM A;  5A2Q Z;  4BQA A;  3P9I A;  1BN5 A;  2VT2 A;  3OOP A;  4I01 A;  1R5H A;  4KN7 X;  4RB3 C;  5ICC A;  1U5T B;  2OU2 A;  4LMY A;  4HF0 A;  3FMR A;  3KCC A;  1V3F A;  1D3Y A;  3FXR A;  2CSO A;  5DD4 A;  5HLI A;  4TV7 A;  4RAZ A;  5L3C A;  1BIA A;  4R8H A;  4ETS A;  4M6Y A;  2L4M A;  5BPD A;  4S05 A;  2C6Y A;  3Q9V A;  3B02 A;  1SD5 A;  1P4W A;  1QGP A;  2V79 A;  3GFJ A;  3L2C A;  5HDG A;  2VOP A;  4GXO A;  3CUQ C;  1TQI A;  4YII A;  3HHH A;  3SFZ A;  2EFW A;  5E8I A;  1B9M A;  4CYD A;  3L00 A;  4G6D A;  4M71 A;  1IUY A;  1E2X A;  3KP7 A;  1HQC A;  2GWR A;  2XV4 S;  2M8E A;  3FHZ A;  4AD9 A;  4OOI A;  1I6X A;  1PUE E;  1E17 A;  1C0W A;  5FFZ A;  1HKQ A;  3DFG A;  3ZP5 A;  1ZGA A;  2Q2E A;  1K78 B;  3E6D A;  1W4M A;  4A6D A;  1FBS A;  2IPQ X;  2QQ9 A;  1ODD A;  4HDV A;  1F5T A;  2KIF A;  4CHU A;  1UHW A;  3FZV A;  2L54 A;  2YSR A;  1MJA A;  3IRQ A;  4MGR A;  3SXY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...