3ULQB

Crystal structure of the anti-activator rapf complexed with the response regulator coma dna binding domain
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
58
structure length
58
Chain Sequence
VLTPRECLILQEVEKGFTNQEIADALHLSKRSIEYSLTSIFNKLNVGSRTEAVLIAKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Gene regulation/transcription activator
molecule keywords Response regulator aspartate phosphatase F
publication title Structural basis of response regulator inhibition by a bacterial anti-activator protein.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 23
structure length 58
sequence length 58
ec nomenclature
pdb deposition date 2011-11-11

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
B PF00196 GerE Bacterial regulatory proteins, luxR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ulqB00
1YLFA 1GHCA 1R36A 1QQIA 2P8TA 4RB0A 2X4HA 3DF8A 4P9UA 4UV8A 5CVRA 3HYIA 1KU2A 3E6DA 2OQGA 3FMQA 3DKWA 3JSOA 2ELHA 3F8FA 1TW3A 3GFMA 3F3XA 2HWVA 2EV0A 3M7GA 1HSJA 5CLSA 4NB5A 3V7SA 4QLCU 1J9IA 2FF4A 3CTAA 3U1DA 1OMIA 3J81Z 2HDCA 1J75A 5KVRA 2NS0A 4HF0A 4LLLA 5DEQA 3KLNA 2ACJA 2HQNA 3MQ0A 4ENJA 3ZMUA 2EA2A 3SQNA 4K2EA 3LA7A 3DV8A 3BROA 2TDXA 5LHIA 4L9VA 3G73A 2NNNA 4WXDA 4EJWA 2UXNA 2EJRA 4UVCA 5FFXA 3WTZA 4AVPA 3COAC 4L9TA 3RTRA 5D5VB 5LHHA 4MEYF 3KZYA 4PCQA 3LSTA 2F5FA 4GO1A 1ZG3A 4EJTA 3DXJF 2CFXA 5E8GA 4PGGA 3RPUA 1SD6A 4P5OA 2PQ8A 4I01A 2EFOA 3WTUC 4ENNA 5JHUA 2K4BA 2KJCA 1USSA 4I7HA 1XN7A 2FQ3A 4KDPA 4L5JA 4EM1A 1G6NA 3IKTA 1IW7F 3T5XA 4HQMA 3K69A 2FBHA 2MBFA 1R5GA 3HOTA 3O2PE 3TO6A 3JAMK 5LEKA 5ILSA 1IAWA 3FXQA 2P7VB 3F22A 1G3TA 1U3EM 2QQBA 4M6XA 2LSOA 3WU0A 1MDMA 1E2XA 5LEJA 2ZXJA 1BC8C 2VE9A 2XAGA 3VB2A 3HTUA 1KA8A 3MEXA 4HV6A 1I27A 3NQOA 1P2FA 2IP2A 2RDPA 4GCVA 4A5NA 4OIPF 2F2EA 5J8FA 3EYYA 1TQPA 4R79A 2CWEA 1LEBA 3Q5FA 2V1DA 5K5OA 3F8MA 3ZQ7A 5TRDA 3FMRA 1JXSA 5ERIA 5ILVA 2O03A 3JTGA 2XGXA 3GWZA 2XVCA 3GEZA 3QOPA 2MH9A 3L09A 4LB6B 3F23A 1JHFA 4M6YA 2XAJA 2PMHA 4OU0A 1SFXA 2DBBA 1DUXC 1TQMA 4KMFA 3CO6C 1F9NA 4UVAA 3HSEA 2EV5A 1LDDA 3HTSB 2HS5A 3REOA 2CQKA 2YPRA 2M45A 4MEXF 3GX4X 2RV8A 2ESNA 2O3FA 2WWYA 5HS8A 3CUQC 3GFLA 1WKMA 1TNTA 4ESFA 4KN7X 3FZVA 1J5YA 1EH7A 1TLHB 2UWMA 3T8RA 3IHUA 2GA2A 3P9KA 2OBPA 1Z6RA 3P7NA 1B59A 4I0AA 1IF1A 5DYMA 3KETA 3TO7A 4WXCA 2A3SA 4XLPF 1QBJA 1OR7A 4LJZF 4UXNA 3RPQA 3F6VA 2CG4A 1KQ8A 2NYXA 1IN7A 5E20A 1S29A 2NNYA 2R3SA 1U8RA 2EB7A 4I0BA 3QAHA 2D1HA 3GZ5A 4P9FA 3O3KA 4RAZA 4U0YA 3HRTA 3QPHA 1ZLJA 3FXUA 1P4WA 2YX4A 5DUKA 2FSWA 4CGZA 3GW2A 3EQLF 1REPC 1ZREA 1TQIA 5HS9A 4GXOA 5LRSA 1K78B 1SD5A 4Y13A 2M8EA 3FHZA 5HOOA 1K6OA 4RGXA 3E6MA 1XCBA 1R1TA 5L3CA 3RIRA 2ZO4A 1U5TA 1KGSA 3ZMDA 3R60A 4LFUA 3RKXA 3GLXA 1G3YA 4JK1X 2XHKA 3F8BA 3TO9A 5FLXK 1FOKA 3N97A 1FLIA 2COMA 2FMLA 3R4KA 4U0WA 4OINF 2QYOA 2XKOA 3DPLC 3OOPA 2VBWA 4HDVA 3ML6A 4A12A 2LF8A 3KLOA 1ZRCA 4KIBA 4I02A 3TGNA 1FPQA 2IA1A 3I4PA 2M87A 3BJ6A 3J81K 3J80Z 2PFBA 1V4RA 6PAXA 2MC3A 2KJBA 4WXHA 4KN4X 1JGSA 1PDNC 1MD0A 5FO5A 1ULYA 5D5XB 5DCMA 1FY7A 1QO0D 2Y75A 2VOOA 1J59A 3HUGA 2VOPA 4HQEA 2H6CA 1FP2A 1IN4A 4HX8A 1WQ2A 1FBQA 4G6QA 2EWNA 3I54A 1XDUA 2A6HF 3F72A 1QPMA 4A6EA 4I09A 1HQCA 1FBSA 1FNNA 3B02A 2A5YB 1H9TA 3V4GA 3WODF 1XMAA 3F21A 2DK8A 5H6RA 1F1ZA 3Q9SA 3ABUA 5F1RA 5HLGA 3QP5A 2XROA 1WWXA 1TW2A 5J8CA 4UNOA 2J5OA 2IA0A 1D5VA 3WU1B 1LVAA 1IN6A 2PMUA 1YW8A 3IC7A 3MAJA 2F5DA 2HZTA 1LEAA 4KIFA 2G7HA 3P9CA 4B8XA 3U9GA 1R7JA 1I5ZA 3CO7C 1CF7B 2VBZA 2O8XA 2FE3A 2YSRA 4L9NA 1Z05A 4MQ9F 1XMKA 4AIJA 4M9XA 1KU3A 4RGSA 1O3RA 1K7AA 1FSEA 3PQJA 3KEOA 1W7PD 3BPVA 2L3DA 2VODA 1Z1DA 2IW5A 2XAHA 1B4AA 3SZPA 5EEGA 4BH9A 4U0VA 2H94A 5HVQC 2L01A 3CLOA 3LA2A 3WGIA 2M1BA 1XB4A 4BHPA 5FD5A 5FGMA 2VBYA 1ZYRF 1U5TC 2V79A 3M8EA 1LNWA 5IT9K 3PQKA 3FMSA 1LJ9A 1DP7P 1O57A 2YU3A 3VODA 1MJAA 4MTDA 4A0YA 4YFKF 1K79A 2K4JA 4M74A 4OIQF 2H27A 1ZGAA 4A2UA 2DPUA 1HW1A 1ZGJA 2HYGD 4RGUA 2RNJA 2L4MA 4RAYA 2CYYA 2JPBA 5E1WA 4G94A 4LK1F 4HX7A 3W6KB 1SAXA 3SFZA 1I1GA 1S3JA 2HOEA 2QQAA 3I59B 3CUQB 2W84A 2CW0F 4HF1A 1KYZA 2EV6A 3KP2A 2P5VA 3F6OA 1HXDA 4R8HA 2FXAA 3G3ZA 5ICGA 2Z9OA 1T2KA 2P4WA 1MKMA 2HTSA 1TNSA 1I1SA 5A2QK 2FOKA 4RS8A 3C7JA 3EETA 1QNTA 1U6GA 2H6BA 3I58A 2RKHA 3BZ6A 4AWXB 2GIVA 2IVMA 4DNCA 2GZWA 2OZUA 1BIAA 4LGWA 3GVAA 1FP1D 2DW4A 5D8LB 5BPDA 2BGCA 2QBYA 3IKVA 4HZFA 4IPAA 4G6DA 3R0JA 4P96A 4WX9A 2ZFWA 3CJNA 1XGSA 4F7ZA 2QQ9A 3L9FA 4RB1A 2W85A 2V9VA 3ZMVA 5D5WB 4EJVA 1PP7U 2L4AA 3JSPA 2STWA 2PG4A 1RUNA 1T98A 2HFHA 2OAZA 1HKSA 2G7UA 4ETSA 4WCGA 5HDGA 1CGPA 1U2WA 2QZ8A 3BY6A 4MHGA 5E1ZB 1IRFA 2F5CA 3E6BA 5L3DA 2FU4A 1BI3A 3TKYA 2B0LA 4G7OF 2YX7A 5K1YA 2PBIA 2AXLA 3ZMSA 4OIOF 3TOBA 2VXZA 1SFUA 2DK5A 2PLYA 1XGNA 4HA8A 4Q47A 3DQVC 1WRJA 3C1DA 2LDUA 4WF2A 4N0BA 2MLGA 1UCRA 2BV6A 1ZHFA 3LAJA 1V3FA 4Y15A 1Z6TA 1T0FA 4QWQA 1Q1HA 4L5IA 5LRRA 1MDMB 4KFCA 1P4AA 4KA4A 2Q2EA 5E1XA 2VN2A 4LLGF 2UZKA 3WTXC 4OMYA 3T0YA 1T6SA 5EEHA 2RQPA 3ECHA 3I53A 4EVIA 4U7DA 1J2XA 1S7AA 4ASNA 3R6SA 1VTNC 1G3SA 4JBAA 2HGCA 4Q5SF 4E70A 1P92A 1BOAA 5D4SA 3KP7A 2QWWA 1IXSB 4UV9A 1DPUA 5ICCA 1O3TA 3ZMTA 2HKOA 3I5UA 4UHTA 5KK1A 3RDIA 1K78A 3TDZC 4AIHA 1F5TA 5K5RA 2FA5A 2FBKA 2IT0A 1FT9A 1F4KA 1RZ4A 3BJOA 2ZNYA 2JSCA 3GO5A 2EFQA 2K27A 4RGRA 5TJJA 4IRIA 5ICFA 2X0LA 3BPXA 2EFPA 1UHMA 1Z7UA 4OMZA 1L0OC 4HX4A 3WE3A 1ZRDA 4CDGA 2PJPA 2JZYA 5H20A 1L3LA 2KIUA 1HBXG 2ZMEA 5HLIA 3OV8A 2LKPA 3EDPA 4L9JA 3WTVC 1YS6A 1H9GA 3S2WA 3KFWX 4M73A 2EA4A 4S05A 2A61A 3KP6A 1PUEE 3IWZA 3JTHA 1NHAA 4ON0A 5DD8A 1X3UA 3HRMA 1OYYA 3ECOA 4LK0F 2D1VA 1ZG5A 4HDUA 3RI4A 3KP4A 3M8FA 1S6LA 2A07F 2ISZA 4U88A 2DFIA 2E1NA 5K5QA 4WK8F 4TV7A 3VFZA 5CVJA 2J5PA 4JQFA 4EGZA 2FRHA 5BOXA 3JAMZ 1R58A 1R22A 2KIFA 2QVOA 1I6XA 1ODDA 2E1CA 5LLQA 4HBLA 3ERED 2M5WA 1U5TB 4G8XA 2ISYA 3GFJA 4LG0A 1W7PA 3WGHA 2Q0OA 2V6CA 2NAZA 4UVBA 5BS6A 3P9IA 4Y17A 1IXCA 4ZH4F 2DU9A 1FBUA 3FWEA 1HSTA 1SMTA 2Z99A 3NEUA 3EYIA 2O61A 4PDKA 4Q48A 2GAUA 2OD5A 2WC2A 4IVNA 4O6JA 3E3VA 4ZYGA 1UB9A 4YG2F 2P5KA 1USTA 3AAFA 2XUBA 2Z3YA 4XLNF 4S04A 1FYMA 5ED4A 2W25A 1XCVA 1R5HA 2DQLA 3D0SA 4A5MA 1S8NA 3ROUA 1D8JA 2QUFA 4IRHA 5DCFA 3V7RA 2QLZA 5CVUA 1WSUA 1ON1A 5ICEA 3E6CC 3GYHX 4OOIA 5LGNA 2IPQX 4XRFA 1MJBA 3LA3A 1YS7A 1R00A 3C3WA 2VT2A 1MJ9A 1HKTA 4EMSA 3QU3A 2DLLA 3E5QA 2P5LC 2DAOA 1HKQA 2VBXA 2NRAC 5L3BA 1BIBA 1RNLA 1XGMA 1H0MA 3FX3A 1LQ1A 3ZMZA 3M9AA 2HR3A 3BP8A 2OU2A 3CUOA 3WE2A 1D3YA 4PGHA 1OYIA 1OKRA 5LHGA 3BDDA 3IL2A 2K02A 4GYGA 1OYWA 4LB5A 1PP8F 2F5EA 4ZYDA 5J6XA 1ZRFA 1BI0A 3B73A 1EH6A 4HLXA 2VT3A 3RYPA 3LAPA 3HIFA 2VE8A 3O6BB 3IRRA 2JRTA 3LWFA 1UFMA 3ZN1A 4CHUA 5L3GA 3KP5A 3K1PA 2C6YA 4UUVA 3L7WA 5D4RA 1IN5A 1B9MA 1SFEA 4I2OA 4M9ZA 3E5UA 4KICA 2CGPA 3V8LA 3TQNA 4ZZLA 1O3QA 1FSHA 1YIOA 3I59A 4CXFA 2GWRA 3V8KA 5FLXZ 2DI3A 3BOQA 4HF2A 3L00A 1SD4A 3E5XA 4KUMA 1QZYA 1YG2A 5DUIA 1XGOA 4G9YA 1FZPB 3IWFA 4BHBA 4ENMA 1Y0UA 3HHGA 1FX7A 3MCZA 4R1HA 4NQWA 3KCCA 3NRVA 3HSRA 2CSOA 4FHTA 3KP3A 4KNYA 2Y48A 2A68F 4Z2YA 3V7CA 2XRNA 4RB3C 3Q9VA 1ZG1A 5BMZA 3CDHA 1IN8A 4I98B 3HSFA 4YIFA 1BM9A 3WG9A 2PEXA 3GXOA 5HDNA 4IHSA 4KYWA 4EGYA 1OPCA 4HAMA 3ZN0A 4CZZA 2L02A 3RYRA 2D2WA 2KRFA 3K1NA 1LDKB 5D6EA 1STZA 4HLYA 3T1BA 2VC1A 3F8NA 1S7OA 4PZJA 4BQAA 2DT5A 2JT1A 2GXGA 4XSZF 5L3FA 4ENKA 4FX0A 3F8CA 5JR3A 1XD7A 1FWZA 3H92A 3TDUC 5CVVA 3TOAA 3MZHA 1JHHA 3MWMA 4ESJA 1ON2A 3SZTA 4U7BA 4Q4ZF 2IA2A 1P6RA 4XBFA 4FX4A 5D6FA 3GZ6A 2Q8KA 3K9TA 4N9HA 1FYLA 1BJAA 3VEPA 4HW0A 1E17A 3WTWC 5BPIA 2OQRA 4HV5A 4ZYEA 3J80K 2ETHA 3WTSC 1W5SA 4N9IA 1DPRA 3V8JA 5AONA 5E18F 5FD6A 2QBYB 3RKYA 5JI6A 3LQRA 1Z91A 2P6SA 2JTVA 4M9SA 2MLKA 5E8IA 4M71A 1BN5A 4A0XA 3FXRA 3DPTA 2ZNZA 3HHHA 3K1MA 1GXPA 1HW5A 3SHFA 4P55A 3HRUA 1O7FA 1TTYA 3FM3A 2FNPA 4AIKA 1T39A 2BYVE 4ZZDA 3KEQA 2DTRA 5D5UB 2RC4A 4B09A 2XIGA 3I71A 3ZPLA 1TBXA 1ZARA 4NHJA 1IXRC 1ONVA 3ABTA 3SXYA 2HQRA 4GGGA 3LFKA 2MD5A 5E17F 2BE5F 2OZ6A 1YW9A 3J7AO 5F6FA 3QRFF 1EV7A 1BC7C 3QP6A 3ZP5A 3K2ZA 4O5VA 1UHWA 1KYWA 4A6DA 2RVCA 1SD7A 2V1UA 2GA1A 3IRQA 1AOYA 1AWCA 1IUYA 5IT9Z 1B1BA 2WTEA 1YQAA 5HS7A 3KE2A 1MGTA 3RJPA 4EV0A 4XSXF 2Y0MA 4EM0B 1WI9A 4KMUX 3QU6A 5LGUA 2EFNA 2STTA 3RKWA 4MGRA 4M72A 3W6JB 4IRGA 5FFZA 4L0ZB 3M1EA 5ILUA 4BAYA 1XSXA 3DP7A 4G7ZF 4YFNF 2QENA 2WV0A 2VC0A 2Z5UA 1RUOA 1XSVA 1R1UA 1O7LA 1W4MA 3L2CA 5FB2A 2QM3A 2V1XA 1U78A 2XAQA 2DPDA 5DV5A 4IHTA 2K7LA 4CO8A 1YTYA 2FNAA 1W5TA 2AS5F 2BBYA 4AD9A 2R7DA 2P6TA 5A2QZ 3HRSA 1YFHA 1YYVA 5H6QA 4IXAA 2DO7A 5AIPA 4ESBA 3K0LA 3MZYA 2PN6A 2HYFA 4BXUA 2A6EF 3I64A 3GF2A 2W24A 2KKOA 2EK5A 2ZJ2A 2MH2A 3WTYC 1XSDA 4EM2A 5LGTA 1YO5C 5JFRA 1R1VA 2IJLA 2EFWA 1KQ9A 4LMYA 3JW4A 4BHCA 2ESHA 4ZYHA 4CYDA 4L18B 1J0RA 2XKPA 2MA3A 3D5LA 3I0TA 1D8KA 1DDNA 2K86A 5HLHA 3T8TA 2P7CB 4G7HF 4FT8A 5DDGA 4GYIA 2ZMEB 1A04A 5LBQA 2XV4S 1LB2A 3EUHA 2UXXA 1JE8A 3MFKA 2LF7A 5HDKA 2VONA 2YR2A 4WWCA 3LQQA 1P4XA 1SMYF 2ZCWA 1RI7A 4BNCA 4D0PA 3WGGA 1G3WA 3WTTC 3BWGA 1T38A 4YIIA 4HOBA 2HEOA 4KT5C 2PI0A 4MNUA 2XAFA 1KU7A 1KQ0A 3R61A 1QGPA 1KU9A 3KZZA 2IRFG 2GQQA 3ULQB 1Z9CA 3QPTA 4EQQA 1ZAOA 5CYVA 1FYKA 1B9NA 4LD5A 2CO5A 1CF7A 2D45A 1RIOH 2R7FA 3FM5A 1R23A 4MQVA 1YW7A 5F64A 5BQTA 1G4DA 5DCMB 4O3MA 2ADUA 4LG0B 1W7PB 3ELKA 1B6AA 5IT3A 1FC3A 1ZN2A 3E97A 3H3UA 2H09A 1MZBA 3BJAA 4L0YB 4RB2C 2XASA 3H3ZA 2KIMA 3GFIA 1ZH5A 5L3EA 2BEOA 3PFIA 4KIGA 3DFGA 2FMYA 1ZLKA 1GVJA 5AIQA 4A0ZA 3U2RA 1BBYA 1C0WA 1IRGA 2O0YA 2LNBA 2ZKZA 5DD4A 3DEUA 3GUDA 1XDSA 2OA4A 1O3SA 5D8KB 4BYYA 4CICA 4LLNA 5CVIA 1LDJA 2M30A 1J7KA 2DQRA 1GXQA 2G9WA 2RGVA 2A69F 2E7WA 3ISPA 4IJAA 1QZZA 1IZ1A 2W57A 2O6GE 2E7XA 3VOEA 4MTEA 1BI1A 3FF5A 3N4MA 2FBIA 1EH8A 4EJOA 4OIRF 4HYEA 2ZBKA 2RN7A 4YFXF 5CJ9A 2FEZA 4IF4A 2JPCA 4EJUA 3C18A 1HW2A 2HTJA 4H0EA 1BI2A 2GXBA 2L54A 2HKXA 3HOSA 4DQ2A 3R0AA 2Z33A 3CUQA 5JVTA
chains in the Genus database with same CATH superfamily
1YLFA 3RKQA 4JX4A 4PFOA 1R36A 1QQIA 2DFFA 4XKCA 3QOEA 2P8TA 4DBRA 4RB0A 2X4HA 5EG0B 3K4MA 1X4PA 3DF8A 3DPUA 4P9UA 1SEUA 3S1MJ 4UV8A 5CVRA 3HYIA 1KU2A 3E6DA 2OQGA 3FMQA 2XB5A 3DKWA 4B4CA 1I50J 3JSOA 4AVZA 2ELHA 2OPTA 2BZTA 3FXLA 3GBGA 4LITA 4CCMA 1ZR2A 3F8FA 1TW3A 3GFMA 1H88C 1R4MB 3F3XA 1CQTA 2O8KA 2HWVA 2EV0A 3M7GA 3C2HA 1HSJA 5CLSA 3DEWA 4NB5A 3V7SA 2R7TA 4QLCU 1J9IA 3FISA 2FF4A 3IH2A 3Q0WA 3CTAA 4DIQA 3U1DA 2PMZN 1OMIA 2CS3A 3J81Z 2HDCA 1J75A 5KVRA 2L7MP 3K4KA 2NS0A 4HF0A 4LLLA 5DEQA 3KLNA 2ACJA 1MBGA 2HQNA 2ZB9A 3MQ0A 4ENJA 1YRNA 1JUPA 2ID6A 3ZMUA 5H2FC 3EUHC 4Y52J 3FDYA 2OJED 2EA2A 3SQNA 2NVTJ 3JRFA 4AU7A 4K2EA 3GMEA 3LA7A 3DV8A 3WHCA 3BROA 2TDXA 5LHIA 2G0EA 4L9VA 4FTHA 4A3CJ 1K6YA 2HQ5A 1LFBA 3G73A 2NNNA 2LFBA 4E7IA 4WXDA 4PSWA 4EJWA 2UXNA 2EJRA 4UVCA 5FFXA 3WTZA 1MBEA 4AVPA 4XN3A 4Z6YA 1N78A 1VZ0A 3L1PA 3COAC 4L9TA 3RTRA 3G4SI 3A2KA 4BE2A 2DT7B 2FUG2 2KMUA 2M9HA 4YELA 5D5VB 5LHHA 4MEYF 3CCYA 1WZ2A 3KZYA 4E7JA 1QPIA 1HDDC 4PCQA 3TW7A 3LSTA 1S5LC 2F5FA 4GO1A 1ZG3A 4G12A 4NQWB 3PJRA 4EJTA 3DXJF 1ETXA 1FOYA 2CFXA 5E8GA 4PGGA 2V9KA 3RPUA 1SD6A 4P5OA 2PQ8A 4I01A 2L9SA 2EFOA 4MFDA 1TC3C 4B47A 4C2UA 3WTUC 2B63J 4ENNA 2TCTA 5JHUA 2JK3A 2K4BA 2KJCA 2K85A 3HBLA 5GPAA 4E7HA 1Z3YA 2CQNA 1X3ZB 2L9NA 4EATA 1USSA 2F4MB 3ZQGA 4I7HA 1XN7A 2MC4A 2BVLA 3CCQI 4A3DJ 2JQ7A 2FQ3A 1X1DA 4KDPA 4L5JA 3U21A 4EM1A 4LIVA 1G6NA 5E3MA 2DJNA 3IKTA 2DA6A 1IW7F 3T5XA 4J01A 4HQMA 2VQLA 3K69A 4OAYA 2FBHA 4CUGA 2JJ7A 2MBFA 5DM6F 3OYHA 3HL2A 1R5GA 3HOTA 4RAGA 3O2PE 3TO6A 4AIDA 3JAMK 1RRJA 5LEKA 2M0MA 4XQFA 5ILSA 3L2UA 1JJ6C 3FXQA 1IAWA 2P7VB 3F22A 1G3TA 4C9YA 3JRCA 1SFOJ 2QKMB 3GLLA 4A3LJ 1U3EM 3S1RJ 2W48A 4XRSA 2QQBA 4HG2A 2QA4I 4M6XA 2LREA 2LSOA 2DA2A 1XG1A 1PYVA 1T56A 3WU0A 2NS8A 1FIPA 1MDMA 1E2XA 1JJ8C 2BOLA 2I5UA 1U9NA 5LEJA 5M5WJ 1DGWY 4ABZA 2ZXJA 1BC8C 2VE9A 2H1LA 2XAGA 1UELB 3VB2A 1GLNA 2RAEA 1I39A 1KA8A 1Z0XA 3HTUA 3MEXA 4HV6A 1I27A 1AKHA 1B8IA 3OYKA 4Y7NJ 2JSPA 3NQOA 4AC0A 1P2FA 1D0ZA 2IP2A 3OR2C 2RDPA 4GCVA 1U0JA 4HNUA 2X6OA 4DW6A 3CCSI 3ZQHA 4A5NA 4BGDA 4OIPF 2F2EA 4HSTA 2BW3A 5J8FA 2WA0A 3EYYA 3CD6I 1TQPA 1NG7A 2CWEA 4R79A 1R71A 1LEBA 3Q5FA 3I3LA 1X1BA 1X1AA 2V1DA 5K5OA 3F8MA 3ZQ7A 5TRDA 3FMRA 3DTEA 1JXSA 1P7JA 5ERIA 5ILVA 2O03A 3JTGA 2XGXA 3GWZA 1LVKA 1Z7LA 2XVCA 3GEZA 4CYCA 3QOPA 2MH9A 1LE8A 3L09A 4LB6B 1EKEA 1JHFA 4M6YA 2XAJA 3F23A 4BDZA 2R7XA 2PMHA 2BHZA 4OU0A 1SFXA 2DMUA 2LH9A 2DBBA 2QQ8A 3MMYB 3IP4B 1DUXC 1TQMA 4KMFA 3Q0VA 3CO6C 1E3OC 3D5RC 1F9NA 4UVAA 3HSEA 5FROA 1UG2A 2EILH 2EV5A 1LDDA 3HTSB 2HS5A 3REOA 2CQKA 3NWSA 2YPRA 2M45A 4MEXF 3GX4X 2RV8A 2ESNA 3CCMI 2O3FA 2WWYA 5HS8A 3WU2C 3CUQC 3GFLA 4A3MJ 2R7SA 1WKMA 1TNTA 4ESFA 1VFCA 4KN7X 3FZVA 1J5YA 2LTPA 3VYUB 1EH7A 1TLHB 5FLVA 1OQYA 2CQXA 2UWMA 2X1EA 3T8RA 1Y1WJ 1IDZA 3IHUA 3LFUA 2GA2A 2Y0SA 4ANJA 2OCCH 3P9KA 2OBPA 1Z6RA 5BNGA 2X6XA 3P7NA 4LG3A 2R7OA 1W1WE 2E1MB 3OYEA 2XGDA 1B59A 4A3JJ 4C2TA 4I0AA 3L2QA 4PJJA 5DYMA 1G59A 1IF1A 1D1AA 3KETA 3TO7A 4WXCA 2MABA 2AQFA 2Q2EB 2A3SA 4XLPF 1QBJA 1OR7A 4LJZF 4UXNA 3RPQA 2W7NA 3F6VA 2CG4A 1QRYA 4XOPA 2QEXI 1KQ8A 2NYXA 1IN7A 5E20A 1S29A 3MN2A 3CZ6A 2NNYA 5FKLA 1E3HA 5F08A 2ZJQF 3ONQA 1TWHJ 4KJZA 3HOUJ 1HLVA 2R3SA 1ZTRA 1U8RA 4A93J 2EB7A 4I0BA 3QAHA 2L7KA 1DU0A 5C4XJ 3AG3H 2NVQJ 2D1HA 3GZ5A 4P9FA 3JRAA 3O3KA 4RAZA 3KYDB 4U0YA 3HRTA 1SVMA 3QPSA 3K10A 3QPHA 5J47A 1J09A 4XLEA 1ZLJA 2ZSHB 1B72A 3FXUA 3H9QA 1P4WA 3HPGA 2YX4A 5DUKA 2FSWA 3K70D 1OJLA 3G6EI 1HC8A 2NVUB 4CGZA 2EBIA 3GW2A 3VPRA 3EQLF 1REPC 4OAZA 1ZREA 1TQIA 5HS9A 4GXOA 5LRSA 2ZJPF 1K78B 1SD5A 1T8IA 4Y13A 2M8EA 2MD0A 1R49A 4BY7J 4B3XA 4XN0A 1QVTA 1LKXA 2B7EA 3FHZA 3FK6A 5FKKA 2DYSH 3AG1H 2BXZA 3PIOF 5HOOA 2VLAA 1K6OA 1OCOH 3ZXSA 4RGXA 1W0UA 3E6MA 1XCBA 1R1TA 4AUXA 5L3CA 5LFAA 3NAUA 3RIRA 2ZO4A 4PJLA 1U5TA 3L2WA 1KGSA 3ZMDA 2VASA 3R60A 5KHDA 3IH4A 4LFUA 3RKXA 4HNVA 3GLXA 1G3YA 4JK1X 4DYQA 2XHKA 3F8BA 3TO9A 2PJRA 1ZQ3P 5FLXK 1FOKA 5KAIC 5IY5H 1SC7A 3N97A 1FLIA 2COMA 4JYKA 4CCJA 1JT6A 2DT6A 3M3YJ 2FMLA 3R4KA 2HDDA 3A1YA 4U0WA 2JWTA 4OINF 2QYOA 5IPAA 1D0YA 4XL9A 2XKOA 3DPLC 3OOPA 2VBWA 4HDVA 2CRGA 1W36D 3EUAA 3PO3J 3CF2A 4G6TB 3ML6A 4A12A 2LF8A 4ZDLA 2XB0X 1VQNI 2R7RA 2E36A 3KLOA 3W2WA 1ZRCA 4KIBA 3ZCOA 4I02A 5EZHA 1Q1VA 3TGNA 3JRHA 1AHDP 1LFUP 2P81A 2LD5A 1XTAA 4HEA2 1HOMA 1FPQA 2KRCA 2IA1A 3I4PA 2M87A 3BJ6A 3J81K 3A0HC 3J80Z 1OCZH 2MG4A 3E7LA 2VJ5A 2PFBA 3OL4A 1V4RA 1MNDA 1Y1VJ 3OL3A 3BTLA 1I3AA 2R7WA 2IS2A 2YU9J 6PAXA 1IO2A 1G8XA 2MC3A 1V55H 1QA6A 2GIZA 5GAGJ 2KJBA 4WXHA 2HXOA 4XNFA 3DEEA 2Y0SN 4KN4X 1M1EB 1JGSA 2DA4A 2EINH 1ZK8A 4JOMA 1PDNC 1DP3A 1MD0A 4XR6A 5FO5A 2IS1A 2VKDA 1ULYA 5D5XB 4YRVA 1IC8A 5DCMA 1X1CA 1FY7A 1QO0D 2Y75A 2E2IJ 3DBRB 4BDYA 4PJ0C 1XS9A 3QWLA 3GTKJ 5IOZA 2ZSIB 2VOOA 4II2A 3AL0C 1J59A 3HUGA 2VOPA 4HQEA 2K5CA 2VPLA 2H6CA 1FP2A 1Z21A 1IN4A 4HX8A 1SAUA 1WQ2A 1FBQA 4G6QA 2EWNA 3I54A 1XDUA 2V26A 2A6HF 1GUUA 2NS7A 2P0WA 1NTCA 3F72A 4I99C 1QPMA 4A6EA 4I09A 1HQCA 1FBSA 1FNNA 3K4BA 3B02A 2E19A 2A5YB 2DA3A 1H9TA 3V4GA 3WODF 1XMAA 3F21A 4Y4RA 2DK8A 2K9NA 4UUSA 5H6RA 2V1NA 1F1ZA 1MMSA 3Q9SA 1WJ5A 2QF7A 4AYBA 5B1AH 2DOAA 5IYCJ 2R93J 4F91B 3F0CA 2E60A 5E3NA 5JLWA 2X51A 5CKTA 2E2JJ 3ABUA 1YI2I 5F1RA 5J1RA 5HLGA 3QP5A 4BJTA 2XROA 4ZTJA 1WWXA 1TW2A 5J8CA 2WADA 2XRLA 4UNOA 2Y9ZA 2F4OB 2J5OA 4BUPA 3PNYA 2FQ4A 2IA0A 1D5VA 3WU1B 1LVAA 2F6CA 1IN6A 1RR8C 2F4IA 2PMUA 2R5YA 2VKHA 1YW8A 4A3IJ 2CV0A 2BY1A 3IC7A 3MAJA 2F5DA 2HZTA 1LEAA 1ZGWA 1VI0A 4KIFA 2G7HA 1VQ4I 3P9CA 3HXLA 3OIQA 1SVLA 1GHCA 2WAEA 5KCMA 3IAS2 2OF7A 2CW8A 3SDBA 3K2AA 4B8XA 1N77A 3GTGJ 4X0GA 3CF5F 3U9GA 1R7JA 1I5ZA 3CO7C 1CF7B 1F43A 1ENHA 2VBZA 1MBKA 2YUSA 2O8XA 1PUFB 3QPLA 5EGOB 3CCJI 2FE3A 2YSRA 2VJ4A 4L9NA 1VQOI 1OR7C 2L2OA 1Z05A 4C3JJ 3SEQA 4MQ9F 5FJ8J 3FXKA 2CW7A 3OS1A 3LSHA 1BJZA 2LMDA 5J40A 2JA7J 5EG0A 4HRIA 1XMKA 4AIJA 3VDXA 4M9XA 1KU3A 3K4JA 4RGSA 1O3RA 2ECCA 4FCYA 1FSEA 1K7AA 2QSFX 3PQJA 3KEOA 2VQCA 1WGXA 4M3DA 1TWAJ 2YS9A 4XMYA 3ZGKA 5GADJ 3H5NA 2WY7Q 1W7PD 3BPVA 2L3DA 2LVSA 2B9SA 2VODA 1Z1DA 1V5EA 3CMMA 1YHQI 5TISC 2IW5A 2XAHA 1B4AA 4CCKA 2XF6A 3SZPA 2R5ZA 4CH7A 1UJ8A 1WJBA 2FD5A 3HKZA 5EEGA 4BH9A 1ORKA 4U0VA 4D5CA 4DJAA 3PNTA 2H94A 5HVQC 1FMVA 2L01A 3CLOA 3LA2A 3FXJA 2L7FP 3BR3A 2V7FA 4Y33A 1S72I 4F92B 2HDWA 3WGIA 1OCCH 4RAFA 3ASOH 2M1BA 5K7ZA 3LSPA 1XB4A 2BXYA 4BHPA 3A01B 2ZMEC 5FD5A 3ESWB 3OIPA 2XPVA 2XPUA 5FGMA 4FE7A 3HOYJ 2E71A 2VBYA 1ZYRF 1U5TC 4XLHA 2V79A 3M8EA 1LNWA 2LY2A 1RPWA 5IT9K 3PQKA 3FMSA 1LJ9A 3LMMA 1DP7P 1O57A 2YU3A 3VODA 2M7BA 1MJAA 4MTDA 1O4XA 4A0YA 2R7QA 4YFKF 2GOMA 1AA7A 4XIDA 2QKLB 5K7FA 1K79A 2K4JA 4M74A 4OIQF 3S16J 2BHYA 4XKBA 2H27A 1ZGAA 1RETA 4A2UA 2DPUA 1HW1A 4QTRA 3G1LA 3DBLB 1ZGJA 3DKXA 4AYBN 2HYGD 4RGUA 2RNJA 2L4MA 4RAYA 1IJWC 1HA8A 3MD2A 2R4GA 2F48A 4CCNA 1WH7A 3UR3C 2CYYA 2JPBA 4E7ZA 5E1WA 4G94A 4IHYA 1WJDA 3QYFA 2XGCA 4LK1F 2DMQA 4HX7A 1JUMA 2UUZA 3W6KB 1SAXA 3SFZA 1I1GA 1S3JA 2HOEA 4IX7A 2QQAA 3I59B 3CUQB 2W84A 2CW0F 4HF1A 1KYZA 2EV6A 3KP2A 3J7YJ 4M3EA 2P5VA 3F6OA 1JKPC 1HXDA 1GVDA 1IUFA 2JA8J 2CU7A 2ZFUA 3I56I 1A5JA 4R8HA 3M8JA 2FXAA 3G3ZA 2IS4A 5ICGA 4NC6A 2VL8A 4A3GJ 2Z9OA 3A03A 1T2KA 1UG0A 2P4WA 4IQ4A 3CDLA 3PIPF 2HTSA 1MKMA 1TNSA 1I1SA 5A2QK 1TWGJ 2FOKA 3ASNH 4RS8A 4IQJA 5F04A 3C7JA 3HOZJ 2GBYA 3EETA 4IOCF 3FKJA 1QNTA 4MFEA 1MIJA 1U6GA 2H6BA 3I58A 3OSGA 2Z2SB 2NOJB 1ETVA 2RKHA 3BZ6A 4LOCA 4AWXB 2GIVA 4PJMA 3OMYA 2IVMA 2JVGA 3SYTA 4DNCA 1K4TA 9ANTA 1IV6A 2GZWA 2OZUA 1BIAA 4LGWA 3GVAA 3OYAA 3EUKL 2ME6A 2JUCA 1FP1D 1WI3A 2DW4A 1YIJI 2ECBA 3OYGA 2VJIA 5D8LB 5BPDA 2K3PA 2BGCA 2QBYA 1MMAA 2ICWG 3IKVA 5K7HA 4HZFA 1VQKI 4IPAA 4XRSG 4G6DA 4N4NB 3R0JA 4P96A 2XSDC 4WX9A 5GTHC 2ZFWA 3CJNA 2HVRA 4XLCA 1XGSA 4F7ZA 3BG5A 2QQ9A 4IOAF 3L9FA 4RB1A 1JGGA 2W85A 2V9VA 2JA2A 3ZMVA 5D5WB 2VIXA 4EJVA 4UB8C 1PP7U 1QHGA 2L4AA 2X6WA 3JREA 2ZXHA 4RM3A 3JSPA 2STWA 2PG4A 4ZYAA 1RUNA 3DLLF 1T98A 2IBDA 2HFHA 2OAZA 1K4SA 1HKSA 3UNGC 1PJRA 2G7UA 4ETSA 4MLOA 3ZQIA 4WCGA 5FRNA 1TT5B 4B48A 2EZHA 4N4OB 4ZTFA 4IZZA 5HDGA 1CGPA 1U2WA 2QZ8A 3BY6A 3A02A 4MHGA 5E1ZB 1IRFA 1MNEA 2F5CA 4NC7A 2OTJI 4BJ5C 3FHNA 3DTIA 3BCAA 3E6BA 5L3DA 1TWCJ 3VSLA 2FU4A 1BI3A 3TKYA 2EIKH 3E1SA 2B0LA 2L0KA 4G7OF 2YX7A 3LNQA 3ZQLA 2CQ7A 4FETA 5K1YA 5EF6A 5M3MJ 2PBIA 3O8HA 2R7ZJ 3CJQB 4II3A 2AXLA 3ZMSA 4GDFA 1JKQC 4UB6C 4OIOF 4BU2A 3TOBA 2VXZA 2CUZA 2K40A 3H5AA 1SFUA 2DK5A 2PLYA 2KLOA 1XGNA 2XF7A 5KAFC 4HA8A 4Q47A 1TWFJ 3DQVC 3Q0UA 2LC2A 4Y3OA 1WRJA 2E1OA 2IAIA 3C1DA 3OY9A 2D5VA 1FIAA 2LDUA 1A31A 5EYRA 4WF2A 4N0BA 2HU9A 2MLGA 1UCRA 2BV6A 2M8GX 1QHHD 3MVPA 1ZHFA 1DU6A 1V3FA 4Y15A 3LAJA 1Z6TA 4NDLA 1T0FA 3DLAA 4NC8A 2EZIA 4QWQA 3GTJJ 2Y30A 1Q1HA 1GDTA 1SANA 4L5IA 5LRRA 1MDMB 4KFCA 1P4AA 4KA4A 1VQ5I 3TMOA 2Q2EA 5E1XA 4M3BA 4PSXA 2VN2A 4LLGF 1WHUA 2UZKA 1WH5A 3VWBA 5FRMA 3BG7A 3WTXC 4OMYA 1X3WB 2EIMH 1ZELA 4BBSJ 1B8IB 4LIUA 1T6SA 2AQEA 2DDAA 3T0YA 1VQ6I 5EEHA 2RQPA 3ECHA 2AXTC 2XF5A 3LSIA 4E4HA 3I53A 4JX6A 4EVIA 2K9SA 4M6VA 4U7DA 1J2XA 1S7AA 3LSJA 4ASNA 3KIOA 3R6SA 4E7SA 3OWTA 3OYLA 1VTNC 1G3SA 4JBAA 2HGCA 4Q5SF 4E70A 1P92A 1BOAA 3FKIJ 3NWTA 1MMGA 5D4SA 3FXOA 2ELKA 3KP7A 2QWWA 3RQIA 2CUJA 1IXSB 3BCBA 3TP0A 4UV9A 1DPUA 5F0CA 2OC6A 2EZLA 5ICCA 1G2HA 1O3TA 1JUSA 2KQRA 4CYCB 1U9OA 3ZMTA 4OWRB 1LE8B 3DTKA 2HKOA 2VQHA 4BEHA 1X2MA 4ZDPA 3I5UA 3OYMA 5M5YJ 1ETOA 2HQAA 2X6YA 4UHTA 5KK1A 3RDIA 3MKWB 1K78A 3TDZC 4AIHA 3BG9A 1LUJB 1F5TA 5K5RA 2FA5A 4IHXA 2FBKA 4S0HB 1ZR4A 2IT0A 1FT9A 2CJJA 1WJEA 1F4KA 1RZ4A 3QODA 1VNDA 2LOOA 4DYRA 1VQ7I 3BJOA 2ZNYA 2JSCA 3GO5A 2EFQA 2K27A 4RGRA 5TJJA 3KX2A 4IRIA 3I4MJ 1K61A 5ICFA 1IV8A 2X0LA 3H0DA 4JX5A 1MNMC 3SJMA 3BPXA 4V19K 1NK2P 3OYJA 2EFPA 3DCFA 1UHMA 4PFPA 1JKOC 1Z7UA 4OMZA 3HOWJ 1L0OC 2NVYJ 4HX4A 3S2HJ 3PUFA 1ITYA 4XKWA 3KEYA 3WE3A 1ZRDA 1Z77A 4CDGA 2PJPA 1DGRM 3TBIA 3CCEI 2JZYA 5H20A 1JT0A 2DTZA 1L3LA 2KIUA 1R5ID 1MBHA 3OS2A 2DXIA 4L5EA 1HBXG 2KHMA 2ZMEA 4RLFA 3S2DJ 5JLXA 5HLIA 3PL8A 3OV8A 2LKPA 3HJEA 2Q1ZB 3EDPA 1YJNI 1SFKA 3DBHB 4L9JA 3WTVC 1YS6A 1H9GA 3S2WA 3KFWX 3N05A 1QVUA 4M73A 2EA4A 4S05A 3K4NA 4YEJA 2A61A 3KP6A 1PUEE 3K7AJ 5IP7J 3IWZA 3JTHA 1JTXA 1NHAA 3H0GJ 2FJ1A 5DD8A 4ON0A 1X3UA 3HRMA 4PK4A 1OYYA 3ECOA 4LK0F 2D1VA 1ZG5A 2DA1A 4HDUA 3RI4A 1D5YA 1MSFC 1BL0A 3HB9A 3KP4A 3GZNB 4X6AJ 2W4SA 4ZC3A 3M8FA 4E7KA 2LG4A 4FE4A 1IRZA 2KDZA 1YJ9I 2EZKA 1S6LA 2A07F 2ISZA 3WG7H 4U88A 2DFIA 2E1NA 1B72B 5EJCA 5K5QA 1D1BA 4WK8F 4QPQA 2X9DA 4TV7A 3VFZA 5CVJA 3CC4I 2J5PA 4JQFA 3OYFA 4EGZA 2FRHA 3ZQFA 5BOXA 3KYLA 3JAMZ 1AU7A 3HEFA 1R58A 1R22A 2KIFA 3CCRI 2QVOA 4HNTA 1P7IA 2MW8A 1I6XA 1ODDA 2E1CA 1Y6IA 3CP8A 3I4NJ 5LLQA 3A4CA 4HBLA 5GAHJ 3ERED 2LR8A 2LBFB 2LK2A 4IKFA 2M5WA 2QGUA 1U5TB 2H8WA 4G8XA 4D5FA 3OSFA 1T33A 2VJJA 3Q3SA 4F93B 5HLTA 2ISYA 3GFJA 2DN0A 2PJRB 4LG0A 1W7PA 3WGHA 1FTZA 1Y0NA 2EIJH 2Q0OA 2NAZA 2V6CA 2MGQA 4UVBA 5BS6A 1WCMJ 4BQNA 3P9IA 4Y17A 1IXCA 4ZH4F 2M7AA 3VYTB 2IGMA 3K70C 2HPIA 2DU9A 1FBUA 4QSHA 4FISA 2BY2A 3FWEA 1HSTA 4V2FA 3IV5A 3DU5A 1SMTA 2Z99A 3NEUA 3H36A 4NBQA 3EYIA 3GTPJ 2O61A 1WJCA 4PUSA 4BKXA 2K9LA 4PDKA 4Q48A 2GAUA 2OD5A 2XAUA 2WC2A 3PM1A 4IVNA 4O6JA 5GP9A 1OLTA 3E3VA 4ZYGA 1E3PA 1UB9A 4B43A 4IHWA 4YG2F 5B5EC 3GTOJ 2P5KA 4IEJA 1TP4A 1USTA 3AAFA 2XUBA 2TRTA 1BW6A 2FX0A 2Z3YA 3FBIB 4XLNF 1YE9A 5EZGA 2OTLI 4S04A 1FYMA 5ED4A 2W25A 1X2NA 1Y8QB 3C2GA 1XCVA 1R5HA 2K9QA 1R4NB 2DQLA 2X1CA 3D0SA 2XDVA 4B44A 2DMNA 4NUBA 4A5MA 1T0FC 2IXSA 3G1OA 1S8NA 5IP6A 3WHBA 3G1MA 3S14J 1FOWA 3ROUA 1WJFA 1D8JA 1GV5A 4GFBA 2QUFA 4IRHA 5DCFA 3V7RA 4DYCA 1LPQA 2GLOA 2QLZA 5CVUA 3IAM2 1WSUA 5IYBJ 1W36C 1EF4A 1TT0A 1X58A 1ON1A 3B6CA 5ICEA 3ABKH 3E6CC 3HOVJ 1YJWI 3OOUA 4BACA 1N25A 3GYHX 4OOIA 5LGNA 2BY3A 2NOGA 1RC9A 2GM4A 2IPQX 2DOEA 4XRFA 4MIMA 1MJBA 3LA3A 1YS7A 1R00A 3C3WA 2VT2A 3RCOA 5IYDJ 1FJLA 4D7NA 1MJ9A 1X1PA 3HC7A 1HKTA 4A3FJ 1OCPA 4EMSA 3QU3A 2DLLA 3OYBA 1NH3A 3E5QA 2P5LC 2DAOA 1HKQA 2VBXA 4QIWN 4CSWA 5TGTA 2NRAC 2X85A 5L3BA 4M3FA 1BIBA 3RZDJ 5IP9J 1RNLA 1ETWA 1XGMA 3G71I 1H0MA 3FX3A 3J7AY 3AKZA 2R7VA 1BR4A 3CMEI 1LQ1A 4XKVA 2IGOA 3LSKA 4DBQA 3ZMZA 3S15J 3M9AA 2HR3A 3BP8A 2OU2A 1JTYA 3CUOA 3WE2A 1D3YA 4BQOA 4EEFG 5J4YA 1VQ9I 1U8BA 4PGHA 1V5FA 5GAEJ 2HOSA 1OYIA 1OKRA 4YIRX 5LHGA 3BDDA 3IL2A 3BR5A 4CZCA 2K02A 1PVEA 2DOFA 4GYGA 1BA5A 1OYWA 4LB5A 1IRXA 1PP8F 2F5EA 3A01A 4ZYDA 3BT9A 5CPRB 1X4OA 4XLAA 2DODA 5J6XA 1BI0A 1ZRFA 2Y31A 3B73A 5E3LA 4A69C 1EH6A 2JN6A 4HLXA 2VT3A 3RYPA 3LAPA 3HIFA 3BZCA 2VE8A 2WB1A 3O6BB 2M0CA 2JRTA 3IRRA 4MO7A 3LWFA 1UFMA 4I6ZA 3ZN1A 4CHUA 5L3GA 3KP5A 3K1PA 2C6YA 3OYIA 4UUVA 3L7WA 2RQQA 1UMQA 5F27A 5D4RA 3K6GA 4I76A 1IN5A 3TEDA 3H1CA 3W2AA 5C4JJ 1B9MA 3AFHA 1HF0A 3M1CA 2RREA 3O8GA 3S3MA 4P1WA 1SFEA 4I2OA 4M9ZA 3E5UA 2R92J 4DGWB 4KICA 3FBNB 1E0EA 5B66C 2CGPA 3V8LA 3CDIA 3TQNA 2CMPA 2KISA 4ZZLA 3CMAI 3BR2A 1W0TA 2A05A 1O3QA 1FSHA 3DWLE 1HCRA 1XPXA 3S1NJ 3HZJA 1YIOA 3QQAA 2O7OA 2VPRA 3I59A 4CXFA 5B1BH 2GWRA 5LD2C 3J7ZI 3HOXJ 3GTMJ 3OS0A 2VB6A 3V8KA 2CH0A 5FLXZ 2DI3A 2Z1DA 3BOQA 4HF2A 1GT0C 3L00A 3JRBA 1SD4A 3E5XA 4KUMA 1QZYA 2KL4A 3BTIA 1TZLA 3SEZA 1WFXA 2DJIA 4F52A 1YG2A 1KZHA 4GRIA 5DUIA 4RBOA 3NARA 1XGOA 2A5WA 4G9YA 1FZPB 1POGA 1K83J 3IWFA 4BHBA 3QYBA 4ENMA 1BR1A 3RSNA 1Y0UA 5HNHA 3CJTB 2E34A 4RMNA 3HHGA 2R5ZB 1NG6A 2L9VA 1FX7A 3MCZA 4R1HA 4D7MA 2R7UA 4NQWA 2IS6A 3KCCA 3NRVA 3FK7A 3HSRA 2CSOA 4FHTA 5GTIC 3B6AA 3KP3A 4KNYA 2Y48A 3HG9A 5J3LA 2A68F 2BVMA 3CQZJ 3VYRB 1UZCA 1D0XA 2JMWA 4Z2YA 3V7CA 2XRNA 3BTJA 4RB3C 3Q9VA 2VXDA 1I3QJ 3AG2H 5GPCA 1ZG1A 3H35A 5BMZA 3BLYA 3W3CA 3CDHA 2O9LA 1IN8A 4I98B 3HSFA 3VSKA 4YIFA 1BM9A 3BG6A 3WG9A 2PEXA 3GXOA 4ZDOA 3IH3A 5HDNA 4IHSA 2WAFA 5JVGF 1RKTA 4KYWA 4EGYA 1OPCA 3ABMH 3KZIC 4HAMA 5E79C 3ZN0A 3D1NI 4CZZA 2L02A 3PFYA 1HDPA 3RYRA 2D2WA 2KRFA 2WAQA 3K1NA 1LDKB 1YITI 1BR2A 3CC7I 5D6EA 1STZA 4HLYA 3T1BA 2VC1A 3F8NA 1S7OA 4PZJA 3D5SC 4BQAA 4M3GA 2DT5A 2JT1A 1OCRH 4PJNA 1Y8RB 2GXGA 1KONA 2HPMA 2KFDA 1Z3XA 2CUEA 4XSZF 5L3FA 2F5VA 1YRNB 4ENKA 2GOXB 4FX0A 3F8CA 5JR3A 1XD7A 1FWZA 3H92A 3KPHA 3TDUC 1VQMI 2VKVA 5CVVA 3TOAA 2HYJA 2WB1N 3K4LA 3MZHA 1JHHA 3MWMA 4RLQA 1VQLI 5M3FJ 4CCOA 4ESJA 1ON2A 2KT0A 3CC2I 3SZTA 2DFHA 4U7BA 3ABLH 2HI3A 4A3KJ 2RNGA 4Q4ZF 2IA2A 1P6RA 2JA5J 2DDBA 4X1EA 4HPQA 3HKZN 4DOZA 4XBFA 2OCEA 3CJRB 4FX4A 5D6FA 3GZ6A 2DCEA 4B1RA 3I9V2 2E2HJ 3BQYA 3F9KA 2KRHA 2Q8KA 2KZGA 4AM3A 3K9TA 5JHFA 3JR9A 4N9HA 3OYDA 1FYLA 3H3VK 1BJAA 2M4GA 3SDGA 3VEPA 1QU3A 4BXFA 4HW0A 1E17A 3WTWC 5CQGA 5BPIA 3RQ4A 2OQRA 4HV5A 4ZYEA 3J80K 2ETHA 4UY8I 2VKEA 4BY1J 1ETKA 3ZQQA 4D9JA 3WTSC 2Y2ZA 1W5SA 4N9IA 3BR0A 2M34A 3VYSB 1DPRA 2CV1A 5FKNA 3V8JA 2KPMA 2DA7A 5AONA 3LL7A 5E18F 5FD6A 1Y56A 2WV1A 2CFOA 2IGKA 3PNVA 2LY1A 2VI6A 4BQQA 3OYCA 1OFCX 3CP2A 3E0JB 3RKYA 5JI6A 2QBYB 3LQRA 1Z91A 2P6SA 2PX9A 2JTVA 4M9SA 1IDYA 2A6TA 2MLKA 3H5RA 1YX3A 2E5NA 4BS9A 5E8IA 4M71A 1BN5A 1WPKA 4IHVA 5F0FA 4A0XA 3FXRA 3DPTA 4BXXJ 2ZNZA 2HOAA 3HHHA 2W00A 3K1MA 1MW7A 1GXPA 1ACIA 1HW5A 3SHFA 1EA3A 2X48A 3HRUA 4P55A 1O7FA 2JUGA 4DZJA 3PSIA 2H1KA 1VQ8I 4UUTA 1TTYA 3FM3A 2FNPA 4AIKA 1T39A 2BYVE 2CV2A 2GXAA 4ZZDA 3KEQA 2DTRA 5D5UB 2RC4A 4B09A 2XIGA 4XOTA 3OYNA 4D1QA 3I71A 3ZPLA 1TBXA 1ZARA 2XGEA 5J4VA 3S3NA 4NHJA 4XLFA 1IXRC 1ONVA 4QPOA 3ABTA 2QCOA 3SXYA 1A35A 1NK3P 2HQRA 4GGGA 3H9GA 3LFKA 3BR1A 2MD5A 5E17F 1MMNA 2BE5F 1T08B 2OZ6A 1YW9A 4ZJZA 3SZGA 3J7AO 5F6FA 3QRFF 4XORA 1EV7A 2LP0A 1BC7C 1AKHB 3QP6A 3ZP5A 3ZQCA 3AL0B 1YOVB 2CQQA 3K2ZA 4O5VA 4XK4A 2WAQN 2HXIA 3DKYA 1UHWA 1KYWA 3U1KA 4W1UA 2AO9A 4A6DA 2RVCA 2KZVA 5FLMJ 3RPUD 1SD7A 3AG4H 2V1UA 2GA1A 3IRQA 2BW3B 1AOYA 1XC5A 3TW6A 3I55I 1AWCA 1IUYA 5IT9Z 1B1BA 2WTEA 1YQAA 2L7ZA 5HS7A 1FOXA 3KE2A 1MGTA 2QSGX 1APLC 1UAAA 3FXMA 3BZKA 3RJPA 1RKWA 4EV0A 2E5ZA 4RDUA 3QYEA 2MYSA 3IUOA 1H89C 4XSXF 5M5XJ 2Y0MA 3BR6A 4EM0B 1XMXA 1WI9A 4RM2A 4KMUX 3GCMA 2HVQA 5J1UA 3QU6A 5LGUA 2EFNA 4B3AA 2STTA 3RKWA 4A3BJ 4MGRA 4M72A 1S9HA 3W6JB 3LSMA 4BBRJ 4C30A 4IRGA 1RESA 5FFZA 4L0ZB 2DMTA 2HZDA 3M1EA 1R6RA 5ILUA 4BAYA 1XSXA 3TP3A 3DP7A 3SFIA 4G7ZF 4YFNF 2WY8Q 2QENA 2WV0A 2ME0A 2VC0A 3LSRA 2Z5UA 1RUOA 4H4KC 2I10A 4BJ6C 4C3IJ 1XSVA 1R1UA 2LLKA 2BY0A 1WVRA 1O7LA 1W4MA 3L2CA 5FB2A 2QM3A 3ZOBA 2V1XA 3V42A 1U78A 2XAQA 2DPDA 5DV5A 3GTLJ 4XM3A 4IHTA 2K7LA 1ETQA 2W82A 4CO8A 1MMDA 1YTYA 2FNAA 1W5TA 2AS5F 2BBYA 1N75A 3W2VA 2E35A 2UV1A 1LFPA 4AD9A 2R7DA 2P6TA 2XSJC 2H8RA 2I8DA 1P9QC 5A2QZ 3PUBA 5F1JA 3HRSA 4CCLA 1X19A 4XICA 3BTCA 1YFHA 1YYVA 4RA2A 5HNFA 3JRGA 5H6QA 2NXNB 4IXAA 2DO7A 5AIPA 4BEHB 2HVSA 4ESBA 1OCTC 3K0LA 3MZYA 3ZRGA 2PN6A 2HYFA 1ZKGA 1MSEC 1YX5A 4BXUA 4XONA 2A6EF 1H8AC 4E7LA 3I64A 3GF2A 5FKMA 4NNJA 4BE1A 4C2MJ 2W24A 2KKOA 2EK5A 4KT6A 1EJ9A 1TL8A 3MKLA 1FEXA 2ZJ2A 2MH2A 2FOWA 2LBFA 3WTYC 1XSDA 3ERMA 4EM2A 3X2QH 2HNHA 5LGTA 1YO5C 2R0QC 5JFRA 2AHQA 1R1VA 2DFEA 2IJLA 3S32A 4JP0A 2EFWA 4KITB 1JKRC 1KQ9A 2L9RA 3HPHA 1MH3A 2MFZA 2V9PA 3BG3A 4LMYA 3FIWA 3JW4A 1FMWA 1UHSA 3DU6A 1Z67A 3K4CA 4BHCA 3HGGA 3CMYA 2ESHA 2OUMA 4ZYHA 4CYDA 1DQUA 2OV7A 4L18B 1J0RA 1D1CA 2XKPA 2MA3A 3D5LA 3I0TA 1D8KA 1MH4A 3S8PA 2KP6A 4IL6C 1DDNA 2K3FA 2K86A 5HLHA 3T8TA 1T95A 2P7CB 5B3SH 4G7HF 4FT8A 5DDGA 4GYIA 2JA6J 2IEKA 2ZMEB 1A04A 5LBQA 2XV4S 1LB2A 1QZEA 3CLQA 5E3OA 2DYRH 4ITVA 3CESA 3EUHA 2UXXA 1JE8A 1I6HJ 3KYCB 3MFKA 2LRDA 4J19A 2LF7A 5HDKA 2VONA 2YR2A 4WWCA 1IGNA 5DS9A 5FKOA 3LOCA 3LQQA 5J1YA 3TL4X 1P4XA 1SMYF 2ZCWA 1RI7A 5IOYA 1VF9A 4BNCA 1OISA 4D0PA 1RR7A 4IO9F 2KDOA 3WGGA 2JVHA 1FTTA 1MBJA 5F0HA 4V2GA 1G3WA 3S17J 3WTTC 3BWGA 3M07A 2W1OA 2EQRA 1T38A 4YIIA 4HOBA 2HEOA 4KT5C 2PI0A 2Y69H 1MBFA 4MNUA 2XAFA 1KU7A 1A6QA 3L2RA 1KQ0A 3R61A 1QGPA 1KU9A 3KZZA 3PO2J 1A36A 2IRFG 2GQQA 3ULQB 1Z9CA 3QPTA 3MZ8A 2O5RA 4FQGA 4F3QA 3MKZA 4EQQA 2E1MC 1ETYA 1ZAOA 5CYVA 1W5CC 2JRMA 3PSFA 1FYKA 1B9NA 4LD5A 4E6KG 2CO5A 1CF7A 2D45A 3W6VA 4U87A 4HSRA 2R7FA 3FM5A 1RIOH 1R23A 3CCLI 4C3HJ 4MQVA 1SVOA 5C3EJ 1S7EA 3GTQJ 1YW7A 5EGOA 1PUFA 3BC8A 2VUMJ 5EDNA 5F64A 3CCUI 2VQGA 5BQTA 1G4DA 2M4KA 5DCMB 4O3MA 1Y39A 2PMZA 3HDDA 3H9JA 2ADUA 4LG0B 1W7PB 3ELKA 2EPFA 1B6AA 1JI8A 5IT3A 1FC3A 1ZN2A 1BW5A 1IG7A 2QSHX 3HUGB 3E97A 2HOTA 3MKYB 3H3UA 2H09A 1MZBA 3BJAA 4L0YB 4RB2C 2XASA 3H3ZA 2KIMA 3JCUC 1ERDA 2ZXIA 1XX5A 3GFIA 2V6EA 3EPZA 3S93A 3G2BA 1ZH5A 2ZXWH 2BEOA 5L3EA 3PFIA 4KIGA 5KNLA 3DFGA 2FMYA 5CQEA 1ZLKA 2LYCA 2WBMA 1GVJA 3HGYA 4UUSB 3C2BA 5AIQA 4BE0A 4A0ZA 1VQPI 2LKSA 2KIQA 3U2RA 1BBYA 1WJAA 1C0WA 2O0YA 2NVXJ 1IRGA 2DA5A 3ZR8X 2LNBA 3HM5A 3S1QJ 2ZKZA 5DD4A 3DEUA 3GUDA 5DM7F 2K9MA 1XDSA 2OA4A 2ID3A 3M4OJ 1O3SA 5D8KB 5DTDA 1BOBA 4BYYA 4CICA 3OR1C 4LLNA 5CVIA 3LSGA 2ZC2A 2EH3A 1GV2A 1LDJA 2M30A 1J7KA 3JRDA 2DQRA 1GXQA 2RGVA 2G9WA 2L5QA 3UKGA 2A69F 2XPWA 2E7WA 3ISPA 2M3AA 4F55A 4IJAA 1A6IA 2COBA 4KISA 3RZOJ 1QZZA 1IZ1A 2R5YB 1R9TJ 1F36A 5HODA 4W97A 2W57A 4J00A 2O6GE 3CCVI 2E7XA 3VOEA 3A0BC 4DZPA 2Y9YA 4MTEA 3OIOA 1BI1A 2XC7A 3FF5A 4A3EJ 5EEAA 5C44J 4FASD 4BL0B 3N4MA 2FBIA 3S3OA 1EH8A 2LY9A 2IGNA 4EJOA 2V4JC 2MSYA 4OIRF 3L2VA 2DMPA 4HYEA 2ZBKA 3JRIA 2RN7A 2N8GA 4YFXF 5CJ9A 2ZJRF 2FEZA 4CA0A 4IF4A 2JPCA 4EJUA 3C18A 2X1DA 2CUFA 1HW2A 2HTJA 4XRMA 3P5JA 4H0EA 1BI2A 2GXBA 3BQZA 2L54A 1V54H 2HKXA 3HOSA 4DQ2A 3R0AA 2M2EA 2Z33A 2LKXA 3CUQA 5JVTA 1V5GA 2ELJA 2Z16A
chains in the Genus database with same CATH topology
1YLFA 1GHCA 1R36A 1QQIA 2P8TA 4RB0A 2X4HA 3DF8A 4P9UA 4UV8A 5CVRA 3HYIA 1KU2A 3E6DA 2OQGA 3FMQA 3DKWA 3JSOA 2ELHA 3F8FA 1TW3A 3GFMA 3F3XA 2HWVA 2EV0A 3M7GA 1HSJA 5CLSA 4NB5A 3V7SA 4QLCU 1J9IA 2FF4A 3CTAA 3U1DA 1OMIA 3J81Z 2HDCA 1J75A 5KVRA 2NS0A 4HF0A 4LLLA 5DEQA 3KLNA 2ACJA 2HQNA 3MQ0A 4ENJA 3ZMUA 2EA2A 3SQNA 4K2EA 3LA7A 3DV8A 3BROA 2TDXA 5LHIA 4L9VA 3G73A 2NNNA 4WXDA 4EJWA 2UXNA 2EJRA 4UVCA 5FFXA 3WTZA 4AVPA 3COAC 4L9TA 3RTRA 5D5VB 5LHHA 4MEYF 3KZYA 4PCQA 3LSTA 2F5FA 4GO1A 1ZG3A 4EJTA 3DXJF 2CFXA 5E8GA 4PGGA 3RPUA 1SD6A 4P5OA 2PQ8A 4I01A 2EFOA 3WTUC 4ENNA 5JHUA 2K4BA 2KJCA 1USSA 4I7HA 1XN7A 2FQ3A 4KDPA 4L5JA 4EM1A 1G6NA 3IKTA 1IW7F 3T5XA 4HQMA 3K69A 2FBHA 2MBFA 1R5GA 3HOTA 3O2PE 3TO6A 3JAMK 5LEKA 5ILSA 1IAWA 3FXQA 2P7VB 3F22A 1G3TA 1U3EM 2QQBA 4M6XA 2LSOA 3WU0A 1MDMA 1E2XA 5LEJA 2ZXJA 1BC8C 2VE9A 2XAGA 3VB2A 3HTUA 1KA8A 3MEXA 4HV6A 1I27A 3NQOA 1P2FA 2IP2A 2RDPA 4GCVA 4A5NA 4OIPF 2F2EA 5J8FA 3EYYA 1TQPA 4R79A 2CWEA 1LEBA 3Q5FA 2V1DA 5K5OA 3F8MA 3ZQ7A 5TRDA 3FMRA 1JXSA 5ERIA 5ILVA 2O03A 3JTGA 2XGXA 3GWZA 2XVCA 3GEZA 3QOPA 2MH9A 3L09A 4LB6B 3F23A 1JHFA 4M6YA 2XAJA 2PMHA 4OU0A 1SFXA 2DBBA 1DUXC 1TQMA 4KMFA 3CO6C 1F9NA 4UVAA 3HSEA 2EV5A 1LDDA 3HTSB 2HS5A 3REOA 2CQKA 2YPRA 2M45A 4MEXF 3GX4X 2RV8A 2ESNA 2O3FA 2WWYA 5HS8A 3CUQC 3GFLA 1WKMA 1TNTA 4ESFA 4KN7X 3FZVA 1J5YA 1EH7A 1TLHB 2UWMA 3T8RA 3IHUA 2GA2A 3P9KA 2OBPA 1Z6RA 3P7NA 1B59A 4I0AA 1IF1A 5DYMA 3KETA 3TO7A 4WXCA 2A3SA 4XLPF 1QBJA 1OR7A 4LJZF 4UXNA 3RPQA 3F6VA 2CG4A 1KQ8A 2NYXA 1IN7A 5E20A 1S29A 2NNYA 2R3SA 1U8RA 2EB7A 4I0BA 3QAHA 2D1HA 3GZ5A 4P9FA 3O3KA 4RAZA 4U0YA 3HRTA 3QPHA 1ZLJA 3FXUA 1P4WA 2YX4A 5DUKA 2FSWA 4CGZA 3GW2A 3EQLF 1REPC 1ZREA 1TQIA 5HS9A 4GXOA 5LRSA 1K78B 1SD5A 4Y13A 2M8EA 3FHZA 5HOOA 1K6OA 4RGXA 3E6MA 1XCBA 1R1TA 5L3CA 3RIRA 2ZO4A 1U5TA 1KGSA 3ZMDA 3R60A 4LFUA 3RKXA 3GLXA 1G3YA 4JK1X 2XHKA 3F8BA 3TO9A 5FLXK 1FOKA 3N97A 1FLIA 2COMA 2FMLA 3R4KA 4U0WA 4OINF 2QYOA 2XKOA 3DPLC 3OOPA 2VBWA 4HDVA 3ML6A 4A12A 2LF8A 3KLOA 1ZRCA 4KIBA 4I02A 3TGNA 1FPQA 2IA1A 3I4PA 2M87A 3BJ6A 3J81K 3J80Z 2PFBA 1V4RA 6PAXA 2MC3A 2KJBA 4WXHA 4KN4X 1JGSA 1PDNC 1MD0A 5FO5A 1ULYA 5D5XB 5DCMA 1FY7A 1QO0D 2Y75A 2VOOA 1J59A 3HUGA 2VOPA 4HQEA 2H6CA 1FP2A 1IN4A 4HX8A 1WQ2A 1FBQA 4G6QA 2EWNA 3I54A 1XDUA 2A6HF 3F72A 1QPMA 4A6EA 4I09A 1HQCA 1FBSA 1FNNA 3B02A 2A5YB 1H9TA 3V4GA 3WODF 1XMAA 3F21A 2DK8A 5H6RA 1F1ZA 3Q9SA 3ABUA 5F1RA 5HLGA 3QP5A 2XROA 1WWXA 1TW2A 5J8CA 4UNOA 2J5OA 2IA0A 1D5VA 3WU1B 1LVAA 1IN6A 2PMUA 1YW8A 3IC7A 3MAJA 2F5DA 2HZTA 1LEAA 4KIFA 2G7HA 3P9CA 4B8XA 3U9GA 1R7JA 1I5ZA 3CO7C 1CF7B 2VBZA 2O8XA 2FE3A 2YSRA 4L9NA 1Z05A 4MQ9F 1XMKA 4AIJA 4M9XA 1KU3A 4RGSA 1O3RA 1K7AA 1FSEA 3PQJA 3KEOA 1W7PD 3BPVA 2L3DA 2VODA 1Z1DA 2IW5A 2XAHA 1B4AA 3SZPA 5EEGA 4BH9A 4U0VA 2H94A 5HVQC 2L01A 3CLOA 3LA2A 3WGIA 2M1BA 1XB4A 4BHPA 5FD5A 5FGMA 2VBYA 1ZYRF 1U5TC 2V79A 3M8EA 1LNWA 5IT9K 3PQKA 3FMSA 1LJ9A 1DP7P 1O57A 2YU3A 3VODA 1MJAA 4MTDA 4A0YA 4YFKF 1K79A 2K4JA 4M74A 4OIQF 2H27A 1ZGAA 4A2UA 2DPUA 1HW1A 1ZGJA 2HYGD 4RGUA 2RNJA 2L4MA 4RAYA 2CYYA 2JPBA 5E1WA 4G94A 4LK1F 4HX7A 3W6KB 1SAXA 3SFZA 1I1GA 1S3JA 2HOEA 2QQAA 3I59B 3CUQB 2W84A 2CW0F 4HF1A 1KYZA 2EV6A 3KP2A 2P5VA 3F6OA 1HXDA 4R8HA 2FXAA 3G3ZA 5ICGA 2Z9OA 1T2KA 2P4WA 1MKMA 2HTSA 1TNSA 1I1SA 5A2QK 2FOKA 4RS8A 3C7JA 3EETA 1QNTA 1U6GA 2H6BA 3I58A 2RKHA 3BZ6A 4AWXB 2GIVA 2IVMA 4DNCA 2GZWA 2OZUA 1BIAA 4LGWA 3GVAA 1FP1D 2DW4A 5D8LB 5BPDA 2BGCA 2QBYA 3IKVA 4HZFA 4IPAA 4G6DA 3R0JA 4P96A 4WX9A 2ZFWA 3CJNA 1XGSA 4F7ZA 2QQ9A 3L9FA 4RB1A 2W85A 2V9VA 3ZMVA 5D5WB 4EJVA 1PP7U 2L4AA 3JSPA 2STWA 2PG4A 1RUNA 1T98A 2HFHA 2OAZA 1HKSA 2G7UA 4ETSA 4WCGA 5HDGA 1CGPA 1U2WA 2QZ8A 3BY6A 4MHGA 5E1ZB 1IRFA 2F5CA 3E6BA 5L3DA 2FU4A 1BI3A 3TKYA 2B0LA 4G7OF 2YX7A 5K1YA 2PBIA 2AXLA 3ZMSA 4OIOF 3TOBA 2VXZA 1SFUA 2DK5A 2PLYA 1XGNA 4HA8A 4Q47A 3DQVC 1WRJA 3C1DA 2LDUA 4WF2A 4N0BA 2MLGA 1UCRA 2BV6A 1ZHFA 3LAJA 1V3FA 4Y15A 1Z6TA 1T0FA 4QWQA 1Q1HA 4L5IA 5LRRA 1MDMB 4KFCA 1P4AA 4KA4A 2Q2EA 5E1XA 2VN2A 4LLGF 2UZKA 3WTXC 4OMYA 3T0YA 1T6SA 5EEHA 2RQPA 3ECHA 3I53A 4EVIA 4U7DA 1J2XA 1S7AA 4ASNA 3R6SA 1VTNC 1G3SA 4JBAA 2HGCA 4Q5SF 4E70A 1P92A 1BOAA 5D4SA 3KP7A 2QWWA 1IXSB 4UV9A 1DPUA 5ICCA 1O3TA 3ZMTA 2HKOA 3I5UA 4UHTA 5KK1A 3RDIA 1K78A 3TDZC 4AIHA 1F5TA 5K5RA 2FA5A 2FBKA 2IT0A 1FT9A 1F4KA 1RZ4A 3BJOA 2ZNYA 2JSCA 3GO5A 2EFQA 2K27A 4RGRA 5TJJA 4IRIA 5ICFA 2X0LA 3BPXA 2EFPA 1UHMA 1Z7UA 4OMZA 1L0OC 4HX4A 3WE3A 1ZRDA 4CDGA 2PJPA 2JZYA 5H20A 1L3LA 2KIUA 1HBXG 2ZMEA 5HLIA 3OV8A 2LKPA 3EDPA 4L9JA 3WTVC 1YS6A 1H9GA 3S2WA 3KFWX 4M73A 2EA4A 4S05A 2A61A 3KP6A 1PUEE 3IWZA 3JTHA 1NHAA 4ON0A 5DD8A 1X3UA 3HRMA 1OYYA 3ECOA 4LK0F 2D1VA 1ZG5A 4HDUA 3RI4A 3KP4A 3M8FA 1S6LA 2A07F 2ISZA 4U88A 2DFIA 2E1NA 5K5QA 4WK8F 4TV7A 3VFZA 5CVJA 2J5PA 4JQFA 4EGZA 2FRHA 5BOXA 3JAMZ 1R58A 1R22A 2KIFA 2QVOA 1I6XA 1ODDA 2E1CA 5LLQA 4HBLA 3ERED 2M5WA 1U5TB 4G8XA 2ISYA 3GFJA 4LG0A 1W7PA 3WGHA 2Q0OA 2V6CA 2NAZA 4UVBA 5BS6A 3P9IA 4Y17A 1IXCA 4ZH4F 2DU9A 1FBUA 3FWEA 1HSTA 1SMTA 2Z99A 3NEUA 3EYIA 2O61A 4PDKA 4Q48A 2GAUA 2OD5A 2WC2A 4IVNA 4O6JA 3E3VA 4ZYGA 1UB9A 4YG2F 2P5KA 1USTA 3AAFA 2XUBA 2Z3YA 4XLNF 4S04A 1FYMA 5ED4A 2W25A 1XCVA 1R5HA 2DQLA 3D0SA 4A5MA 1S8NA 3ROUA 1D8JA 2QUFA 4IRHA 5DCFA 3V7RA 2QLZA 5CVUA 1WSUA 1ON1A 5ICEA 3E6CC 3GYHX 4OOIA 5LGNA 2IPQX 4XRFA 1MJBA 3LA3A 1YS7A 1R00A 3C3WA 2VT2A 1MJ9A 1HKTA 4EMSA 3QU3A 2DLLA 3E5QA 2P5LC 2DAOA 1HKQA 2VBXA 2NRAC 5L3BA 1BIBA 1RNLA 1XGMA 1H0MA 3FX3A 1LQ1A 3ZMZA 3M9AA 2HR3A 3BP8A 2OU2A 3CUOA 3WE2A 1D3YA 4PGHA 1OYIA 1OKRA 5LHGA 3BDDA 3IL2A 2K02A 4GYGA 1OYWA 4LB5A 1PP8F 2F5EA 4ZYDA 5J6XA 1ZRFA 1BI0A 3B73A 1EH6A 4HLXA 2VT3A 3RYPA 3LAPA 3HIFA 2VE8A 3O6BB 3IRRA 2JRTA 3LWFA 1UFMA 3ZN1A 4CHUA 5L3GA 3KP5A 3K1PA 2C6YA 4UUVA 3L7WA 5D4RA 1IN5A 1B9MA 1SFEA 4I2OA 4M9ZA 3E5UA 4KICA 2CGPA 3V8LA 3TQNA 4ZZLA 1O3QA 1FSHA 1YIOA 3I59A 4CXFA 2GWRA 3V8KA 5FLXZ 2DI3A 3BOQA 4HF2A 3L00A 1SD4A 3E5XA 4KUMA 1QZYA 1YG2A 5DUIA 1XGOA 4G9YA 1FZPB 3IWFA 4BHBA 4ENMA 1Y0UA 3HHGA 1FX7A 3MCZA 4R1HA 4NQWA 3KCCA 3NRVA 3HSRA 2CSOA 4FHTA 3KP3A 4KNYA 2Y48A 2A68F 4Z2YA 3V7CA 2XRNA 4RB3C 3Q9VA 1ZG1A 5BMZA 3CDHA 1IN8A 4I98B 3HSFA 4YIFA 1BM9A 3WG9A 2PEXA 3GXOA 5HDNA 4IHSA 4KYWA 4EGYA 1OPCA 4HAMA 3ZN0A 4CZZA 2L02A 3RYRA 2D2WA 2KRFA 3K1NA 1LDKB 5D6EA 1STZA 4HLYA 3T1BA 2VC1A 3F8NA 1S7OA 4PZJA 4BQAA 2DT5A 2JT1A 2GXGA 4XSZF 5L3FA 4ENKA 4FX0A 3F8CA 5JR3A 1XD7A 1FWZA 3H92A 3TDUC 5CVVA 3TOAA 3MZHA 1JHHA 3MWMA 4ESJA 1ON2A 3SZTA 4U7BA 4Q4ZF 2IA2A 1P6RA 4XBFA 4FX4A 5D6FA 3GZ6A 2Q8KA 3K9TA 4N9HA 1FYLA 1BJAA 3VEPA 4HW0A 1E17A 3WTWC 5BPIA 2OQRA 4HV5A 4ZYEA 3J80K 2ETHA 3WTSC 1W5SA 4N9IA 1DPRA 3V8JA 5AONA 5E18F 5FD6A 2QBYB 3RKYA 5JI6A 3LQRA 1Z91A 2P6SA 2JTVA 4M9SA 2MLKA 5E8IA 4M71A 1BN5A 4A0XA 3FXRA 3DPTA 2ZNZA 3HHHA 3K1MA 1GXPA 1HW5A 3SHFA 4P55A 3HRUA 1O7FA 1TTYA 3FM3A 2FNPA 4AIKA 1T39A 2BYVE 4ZZDA 3KEQA 2DTRA 5D5UB 2RC4A 4B09A 2XIGA 3I71A 3ZPLA 1TBXA 1ZARA 4NHJA 1IXRC 1ONVA 3ABTA 3SXYA 2HQRA 4GGGA 3LFKA 2MD5A 5E17F 2BE5F 2OZ6A 1YW9A 3J7AO 5F6FA 3QRFF 1EV7A 1BC7C 3QP6A 3ZP5A 3K2ZA 4O5VA 1UHWA 1KYWA 4A6DA 2RVCA 1SD7A 2V1UA 2GA1A 3IRQA 1AOYA 1AWCA 1IUYA 5IT9Z 1B1BA 2WTEA 1YQAA 5HS7A 3KE2A 1MGTA 3RJPA 4EV0A 4XSXF 2Y0MA 4EM0B 1WI9A 4KMUX 3QU6A 5LGUA 2EFNA 2STTA 3RKWA 4MGRA 4M72A 3W6JB 4IRGA 5FFZA 4L0ZB 3M1EA 5ILUA 4BAYA 1XSXA 3DP7A 4G7ZF 4YFNF 2QENA 2WV0A 2VC0A 2Z5UA 1RUOA 1XSVA 1R1UA 1O7LA 1W4MA 3L2CA 5FB2A 2QM3A 2V1XA 1U78A 2XAQA 2DPDA 5DV5A 4IHTA 2K7LA 4CO8A 1YTYA 2FNAA 1W5TA 2AS5F 2BBYA 4AD9A 2R7DA 2P6TA 5A2QZ 3HRSA 1YFHA 1YYVA 5H6QA 4IXAA 2DO7A 5AIPA 4ESBA 3K0LA 3MZYA 2PN6A 2HYFA 4BXUA 2A6EF 3I64A 3GF2A 2W24A 2KKOA 2EK5A 2ZJ2A 2MH2A 3WTYC 1XSDA 4EM2A 5LGTA 1YO5C 5JFRA 1R1VA 2IJLA 2EFWA 1KQ9A 4LMYA 3JW4A 4BHCA 2ESHA 4ZYHA 4CYDA 4L18B 1J0RA 2XKPA 2MA3A 3D5LA 3I0TA 1D8KA 1DDNA 2K86A 5HLHA 3T8TA 2P7CB 4G7HF 4FT8A 5DDGA 4GYIA 2ZMEB 1A04A 5LBQA 2XV4S 1LB2A 3EUHA 2UXXA 1JE8A 3MFKA 2LF7A 5HDKA 2VONA 2YR2A 4WWCA 3LQQA 1P4XA 1SMYF 2ZCWA 1RI7A 4BNCA 4D0PA 3WGGA 1G3WA 3WTTC 3BWGA 1T38A 4YIIA 4HOBA 2HEOA 4KT5C 2PI0A 4MNUA 2XAFA 1KU7A 1KQ0A 3R61A 1QGPA 1KU9A 3KZZA 2IRFG 2GQQA 3ULQB 1Z9CA 3QPTA 4EQQA 1ZAOA 5CYVA 1FYKA 1B9NA 4LD5A 2CO5A 1CF7A 2D45A 1RIOH 2R7FA 3FM5A 1R23A 4MQVA 1YW7A 5F64A 5BQTA 1G4DA 5DCMB 4O3MA 2ADUA 4LG0B 1W7PB 3ELKA 1B6AA 5IT3A 1FC3A 1ZN2A 3E97A 3H3UA 2H09A 1MZBA 3BJAA 4L0YB 4RB2C 2XASA 3H3ZA 2KIMA 3GFIA 1ZH5A 5L3EA 2BEOA 3PFIA 4KIGA 3DFGA 2FMYA 1ZLKA 1GVJA 5AIQA 4A0ZA 3U2RA 1BBYA 1C0WA 1IRGA 2O0YA 2LNBA 2ZKZA 5DD4A 3DEUA 3GUDA 1XDSA 2OA4A 1O3SA 5D8KB 4BYYA 4CICA 4LLNA 5CVIA 1LDJA 2M30A 1J7KA 2DQRA 1GXQA 2G9WA 2RGVA 2A69F 2E7WA 3ISPA 4IJAA 1QZZA 1IZ1A 2W57A 2O6GE 2E7XA 3VOEA 4MTEA 1BI1A 3FF5A 3N4MA 2FBIA 1EH8A 4EJOA 4OIRF 4HYEA 2ZBKA 2RN7A 4YFXF 5CJ9A 2FEZA 4IF4A 2JPCA 4EJUA 3C18A 1HW2A 2HTJA 4H0EA 1BI2A 2GXBA 2L54A 2HKXA 3HOSA 4DQ2A 3R0AA 2Z33A 3CUQA 5JVTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YLF A;  1GHC A;  1R36 A;  1QQI A;  2P8T A;  4RB0 A;  2X4H A;  3DF8 A;  4P9U A;  4UV8 A;  5CVR A;  3HYI A;  1KU2 A;  3E6D A;  2OQG A;  3FMQ A;  3DKW A;  3JSO A;  2ELH A;  3F8F A;  1TW3 A;  3GFM A;  3F3X A;  2HWV A;  2EV0 A;  3M7G A;  1HSJ A;  5CLS A;  4NB5 A;  3V7S A;  4QLC U;  1J9I A;  2FF4 A;  3CTA A;  3U1D A;  1OMI A;  3J81 Z;  2HDC A;  1J75 A;  5KVR A;  2NS0 A;  4HF0 A;  4LLL A;  5DEQ A;  3KLN A;  2ACJ A;  2HQN A;  3MQ0 A;  4ENJ A;  3ZMU A;  2EA2 A;  3SQN A;  4K2E A;  3LA7 A;  3DV8 A;  3BRO A;  2TDX A;  5LHI A;  4L9V A;  3G73 A;  2NNN A;  4WXD A;  4EJW A;  2UXN A;  2EJR A;  4UVC A;  5FFX A;  3WTZ A;  4AVP A;  3COA C;  4L9T A;  3RTR A;  5D5V B;  5LHH A;  4MEY F;  3KZY A;  4PCQ A;  3LST A;  2F5F A;  4GO1 A;  1ZG3 A;  4EJT A;  3DXJ F;  2CFX A;  5E8G A;  4PGG A;  3RPU A;  1SD6 A;  4P5O A;  2PQ8 A;  4I01 A;  2EFO A;  3WTU C;  4ENN A;  5JHU A;  2K4B A;  2KJC A;  1USS A;  4I7H A;  1XN7 A;  2FQ3 A;  4KDP A;  4L5J A;  4EM1 A;  1G6N A;  3IKT A;  1IW7 F;  3T5X A;  4HQM A;  3K69 A;  2FBH A;  2MBF A;  1R5G A;  3HOT A;  3O2P E;  3TO6 A;  3JAM K;  5LEK A;  5ILS A;  1IAW A;  3FXQ A;  2P7V B;  3F22 A;  1G3T A;  1U3E M;  2QQB A;  4M6X A;  2LSO A;  3WU0 A;  1MDM A;  1E2X A;  5LEJ A;  2ZXJ A;  1BC8 C;  2VE9 A;  2XAG A;  3VB2 A;  3HTU A;  1KA8 A;  3MEX A;  4HV6 A;  1I27 A;  3NQO A;  1P2F A;  2IP2 A;  2RDP A;  4GCV A;  4A5N A;  4OIP F;  2F2E A;  5J8F A;  3EYY A;  1TQP A;  4R79 A;  2CWE A;  1LEB A;  3Q5F A;  2V1D A;  5K5O A;  3F8M A;  3ZQ7 A;  5TRD A;  3FMR A;  1JXS A;  5ERI A;  5ILV A;  2O03 A;  3JTG A;  2XGX A;  3GWZ A;  2XVC A;  3GEZ A;  3QOP A;  2MH9 A;  3L09 A;  4LB6 B;  3F23 A;  1JHF A;  4M6Y A;  2XAJ A;  2PMH A;  4OU0 A;  1SFX A;  2DBB A;  1DUX C;  1TQM A;  4KMF A;  3CO6 C;  1F9N A;  4UVA A;  3HSE A;  2EV5 A;  1LDD A;  3HTS B;  2HS5 A;  3REO A;  2CQK A;  2YPR A;  2M45 A;  4MEX F;  3GX4 X;  2RV8 A;  2ESN A;  2O3F A;  2WWY A;  5HS8 A;  3CUQ C;  3GFL A;  1WKM A;  1TNT A;  4ESF A;  4KN7 X;  3FZV A;  1J5Y A;  1EH7 A;  1TLH B;  2UWM A;  3T8R A;  3IHU A;  2GA2 A;  3P9K A;  2OBP A;  1Z6R A;  3P7N A;  1B59 A;  4I0A A;  1IF1 A;  5DYM A;  3KET A;  3TO7 A;  4WXC A;  2A3S A;  4XLP F;  1QBJ A;  1OR7 A;  4LJZ F;  4UXN A;  3RPQ A;  3F6V A;  2CG4 A;  1KQ8 A;  2NYX A;  1IN7 A;  5E20 A;  1S29 A;  2NNY A;  2R3S A;  1U8R A;  2EB7 A;  4I0B A;  3QAH A;  2D1H A;  3GZ5 A;  4P9F A;  3O3K A;  4RAZ A;  4U0Y A;  3HRT A;  3QPH A;  1ZLJ A;  3FXU A;  1P4W A;  2YX4 A;  5DUK A;  2FSW A;  4CGZ A;  3GW2 A;  3EQL F;  1REP C;  1ZRE A;  1TQI A;  5HS9 A;  4GXO A;  5LRS A;  1K78 B;  1SD5 A;  4Y13 A;  2M8E A;  3FHZ A;  5HOO A;  1K6O A;  4RGX A;  3E6M A;  1XCB A;  1R1T A;  5L3C A;  3RIR A;  2ZO4 A;  1U5T A;  1KGS A;  3ZMD A;  3R60 A;  4LFU A;  3RKX A;  3GLX A;  1G3Y A;  4JK1 X;  2XHK A;  3F8B A;  3TO9 A;  5FLX K;  1FOK A;  3N97 A;  1FLI A;  2COM A;  2FML A;  3R4K A;  4U0W A;  4OIN F;  2QYO A;  2XKO A;  3DPL C;  3OOP A;  2VBW A;  4HDV A;  3ML6 A;  4A12 A;  2LF8 A;  3KLO A;  1ZRC A;  4KIB A;  4I02 A;  3TGN A;  1FPQ A;  2IA1 A;  3I4P A;  2M87 A;  3BJ6 A;  3J81 K;  3J80 Z;  2PFB A;  1V4R A;  6PAX A;  2MC3 A;  2KJB A;  4WXH A;  4KN4 X;  1JGS A;  1PDN C;  1MD0 A;  5FO5 A;  1ULY A;  5D5X B;  5DCM A;  1FY7 A;  1QO0 D;  2Y75 A;  2VOO A;  1J59 A;  3HUG A;  2VOP A;  4HQE A;  2H6C A;  1FP2 A;  1IN4 A;  4HX8 A;  1WQ2 A;  1FBQ A;  4G6Q A;  2EWN A;  3I54 A;  1XDU A;  2A6H F;  3F72 A;  1QPM A;  4A6E A;  4I09 A;  1HQC A;  1FBS A;  1FNN A;  3B02 A;  2A5Y B;  1H9T A;  3V4G A;  3WOD F;  1XMA A;  3F21 A;  2DK8 A;  5H6R A;  1F1Z A;  3Q9S A;  3ABU A;  5F1R A;  5HLG A;  3QP5 A;  2XRO A;  1WWX A;  1TW2 A;  5J8C A;  4UNO A;  2J5O A;  2IA0 A;  1D5V A;  3WU1 B;  1LVA A;  1IN6 A;  2PMU A;  1YW8 A;  3IC7 A;  3MAJ A;  2F5D A;  2HZT A;  1LEA A;  4KIF A;  2G7H A;  3P9C A;  4B8X A;  3U9G A;  1R7J A;  1I5Z A;  3CO7 C;  1CF7 B;  2VBZ A;  2O8X A;  2FE3 A;  2YSR A;  4L9N A;  1Z05 A;  4MQ9 F;  1XMK A;  4AIJ A;  4M9X A;  1KU3 A;  4RGS A;  1O3R A;  1K7A A;  1FSE A;  3PQJ A;  3KEO A;  1W7P D;  3BPV A;  2L3D A;  2VOD A;  1Z1D A;  2IW5 A;  2XAH A;  1B4A A;  3SZP A;  5EEG A;  4BH9 A;  4U0V A;  2H94 A;  5HVQ C;  2L01 A;  3CLO A;  3LA2 A;  3WGI A;  2M1B A;  1XB4 A;  4BHP A;  5FD5 A;  5FGM A;  2VBY A;  1ZYR F;  1U5T C;  2V79 A;  3M8E A;  1LNW A;  5IT9 K;  3PQK A;  3FMS A;  1LJ9 A;  1DP7 P;  1O57 A;  2YU3 A;  3VOD A;  1MJA A;  4MTD A;  4A0Y A;  4YFK F;  1K79 A;  2K4J A;  4M74 A;  4OIQ F;  2H27 A;  1ZGA A;  4A2U A;  2DPU A;  1HW1 A;  1ZGJ A;  2HYG D;  4RGU A;  2RNJ A;  2L4M A;  4RAY A;  2CYY A;  2JPB A;  5E1W A;  4G94 A;  4LK1 F;  4HX7 A;  3W6K B;  1SAX A;  3SFZ A;  1I1G A;  1S3J A;  2HOE A;  2QQA A;  3I59 B;  3CUQ B;  2W84 A;  2CW0 F;  4HF1 A;  1KYZ A;  2EV6 A;  3KP2 A;  2P5V A;  3F6O A;  1HXD A;  4R8H A;  2FXA A;  3G3Z A;  5ICG A;  2Z9O A;  1T2K A;  2P4W A;  1MKM A;  2HTS A;  1TNS A;  1I1S A;  5A2Q K;  2FOK A;  4RS8 A;  3C7J A;  3EET A;  1QNT A;  1U6G A;  2H6B A;  3I58 A;  2RKH A;  3BZ6 A;  4AWX B;  2GIV A;  2IVM A;  4DNC A;  2GZW A;  2OZU A;  1BIA A;  4LGW A;  3GVA A;  1FP1 D;  2DW4 A;  5D8L B;  5BPD A;  2BGC A;  2QBY A;  3IKV A;  4HZF A;  4IPA A;  4G6D A;  3R0J A;  4P96 A;  4WX9 A;  2ZFW A;  3CJN A;  1XGS A;  4F7Z A;  2QQ9 A;  3L9F A;  4RB1 A;  2W85 A;  2V9V A;  3ZMV A;  5D5W B;  4EJV A;  1PP7 U;  2L4A A;  3JSP A;  2STW A;  2PG4 A;  1RUN A;  1T98 A;  2HFH A;  2OAZ A;  1HKS A;  2G7U A;  4ETS A;  4WCG A;  5HDG A;  1CGP A;  1U2W A;  2QZ8 A;  3BY6 A;  4MHG A;  5E1Z B;  1IRF A;  2F5C A;  3E6B A;  5L3D A;  2FU4 A;  1BI3 A;  3TKY A;  2B0L A;  4G7O F;  2YX7 A;  5K1Y A;  2PBI A;  2AXL A;  3ZMS A;  4OIO F;  3TOB A;  2VXZ A;  1SFU A;  2DK5 A;  2PLY A;  1XGN A;  4HA8 A;  4Q47 A;  3DQV C;  1WRJ A;  3C1D A;  2LDU A;  4WF2 A;  4N0B A;  2MLG A;  1UCR A;  2BV6 A;  1ZHF A;  3LAJ A;  1V3F A;  4Y15 A;  1Z6T A;  1T0F A;  4QWQ A;  1Q1H A;  4L5I A;  5LRR A;  1MDM B;  4KFC A;  1P4A A;  4KA4 A;  2Q2E A;  5E1X A;  2VN2 A;  4LLG F;  2UZK A;  3WTX C;  4OMY A;  3T0Y A;  1T6S A;  5EEH A;  2RQP A;  3ECH A;  3I53 A;  4EVI A;  4U7D A;  1J2X A;  1S7A A;  4ASN A;  3R6S A;  1VTN C;  1G3S A;  4JBA A;  2HGC A;  4Q5S F;  4E70 A;  1P92 A;  1BOA A;  5D4S A;  3KP7 A;  2QWW A;  1IXS B;  4UV9 A;  1DPU A;  5ICC A;  1O3T A;  3ZMT A;  2HKO A;  3I5U A;  4UHT A;  5KK1 A;  3RDI A;  1K78 A;  3TDZ C;  4AIH A;  1F5T A;  5K5R A;  2FA5 A;  2FBK A;  2IT0 A;  1FT9 A;  1F4K A;  1RZ4 A;  3BJO A;  2ZNY A;  2JSC A;  3GO5 A;  2EFQ A;  2K27 A;  4RGR A;  5TJJ A;  4IRI A;  5ICF A;  2X0L A;  3BPX A;  2EFP A;  1UHM A;  1Z7U A;  4OMZ A;  1L0O C;  4HX4 A;  3WE3 A;  1ZRD A;  4CDG A;  2PJP A;  2JZY A;  5H20 A;  1L3L A;  2KIU A;  1HBX G;  2ZME A;  5HLI A;  3OV8 A;  2LKP A;  3EDP A;  4L9J A;  3WTV C;  1YS6 A;  1H9G A;  3S2W A;  3KFW X;  4M73 A;  2EA4 A;  4S05 A;  2A61 A;  3KP6 A;  1PUE E;  3IWZ A;  3JTH A;  1NHA A;  4ON0 A;  5DD8 A;  1X3U A;  3HRM A;  1OYY A;  3ECO A;  4LK0 F;  2D1V A;  1ZG5 A;  4HDU A;  3RI4 A;  3KP4 A;  3M8F A;  1S6L A;  2A07 F;  2ISZ A;  4U88 A;  2DFI A;  2E1N A;  5K5Q A;  4WK8 F;  4TV7 A;  3VFZ A;  5CVJ A;  2J5P A;  4JQF A;  4EGZ A;  2FRH A;  5BOX A;  3JAM Z;  1R58 A;  1R22 A;  2KIF A;  2QVO A;  1I6X A;  1ODD A;  2E1C A;  5LLQ A;  4HBL A;  3ERE D;  2M5W A;  1U5T B;  4G8X A;  2ISY A;  3GFJ A;  4LG0 A;  1W7P A;  3WGH A;  2Q0O A;  2V6C A;  2NAZ A;  4UVB A;  5BS6 A;  3P9I A;  4Y17 A;  1IXC A;  4ZH4 F;  2DU9 A;  1FBU A;  3FWE A;  1HST A;  1SMT A;  2Z99 A;  3NEU A;  3EYI A;  2O61 A;  4PDK A;  4Q48 A;  2GAU A;  2OD5 A;  2WC2 A;  4IVN A;  4O6J A;  3E3V A;  4ZYG A;  1UB9 A;  4YG2 F;  2P5K A;  1UST A;  3AAF A;  2XUB A;  2Z3Y A;  4XLN F;  4S04 A;  1FYM A;  5ED4 A;  2W25 A;  1XCV A;  1R5H A;  2DQL A;  3D0S A;  4A5M A;  1S8N A;  3ROU A;  1D8J A;  2QUF A;  4IRH A;  5DCF A;  3V7R A;  2QLZ A;  5CVU A;  1WSU A;  1ON1 A;  5ICE A;  3E6C C;  3GYH X;  4OOI A;  5LGN A;  2IPQ X;  4XRF A;  1MJB A;  3LA3 A;  1YS7 A;  1R00 A;  3C3W A;  2VT2 A;  1MJ9 A;  1HKT A;  4EMS A;  3QU3 A;  2DLL A;  3E5Q A;  2P5L C;  2DAO A;  1HKQ A;  2VBX A;  2NRA C;  5L3B A;  1BIB A;  1RNL A;  1XGM A;  1H0M A;  3FX3 A;  1LQ1 A;  3ZMZ A;  3M9A A;  2HR3 A;  3BP8 A;  2OU2 A;  3CUO A;  3WE2 A;  1D3Y A;  4PGH A;  1OYI A;  1OKR A;  5LHG A;  3BDD A;  3IL2 A;  2K02 A;  4GYG A;  1OYW A;  4LB5 A;  1PP8 F;  2F5E A;  4ZYD A;  5J6X A;  1ZRF A;  1BI0 A;  3B73 A;  1EH6 A;  4HLX A;  2VT3 A;  3RYP A;  3LAP A;  3HIF A;  2VE8 A;  3O6B B;  3IRR A;  2JRT A;  3LWF A;  1UFM A;  3ZN1 A;  4CHU A;  5L3G A;  3KP5 A;  3K1P A;  2C6Y A;  4UUV A;  3L7W A;  5D4R A;  1IN5 A;  1B9M A;  1SFE A;  4I2O A;  4M9Z A;  3E5U A;  4KIC A;  2CGP A;  3V8L A;  3TQN A;  4ZZL A;  1O3Q A;  1FSH A;  1YIO A;  3I59 A;  4CXF A;  2GWR A;  3V8K A;  5FLX Z;  2DI3 A;  3BOQ A;  4HF2 A;  3L00 A;  1SD4 A;  3E5X A;  4KUM A;  1QZY A;  1YG2 A;  5DUI A;  1XGO A;  4G9Y A;  1FZP B;  3IWF A;  4BHB A;  4ENM A;  1Y0U A;  3HHG A;  1FX7 A;  3MCZ A;  4R1H A;  4NQW A;  3KCC A;  3NRV A;  3HSR A;  2CSO A;  4FHT A;  3KP3 A;  4KNY A;  2Y48 A;  2A68 F;  4Z2Y A;  3V7C A;  2XRN A;  4RB3 C;  3Q9V A;  1ZG1 A;  5BMZ A;  3CDH A;  1IN8 A;  4I98 B;  3HSF A;  4YIF A;  1BM9 A;  3WG9 A;  2PEX A;  3GXO A;  5HDN A;  4IHS A;  4KYW A;  4EGY A;  1OPC A;  4HAM A;  3ZN0 A;  4CZZ A;  2L02 A;  3RYR A;  2D2W A;  2KRF A;  3K1N A;  1LDK B;  5D6E A;  1STZ A;  4HLY A;  3T1B A;  2VC1 A;  3F8N A;  1S7O A;  4PZJ A;  4BQA A;  2DT5 A;  2JT1 A;  2GXG A;  4XSZ F;  5L3F A;  4ENK A;  4FX0 A;  3F8C A;  5JR3 A;  1XD7 A;  1FWZ A;  3H92 A;  3TDU C;  5CVV A;  3TOA A;  3MZH A;  1JHH A;  3MWM A;  4ESJ A;  1ON2 A;  3SZT A;  4U7B A;  4Q4Z F;  2IA2 A;  1P6R A;  4XBF A;  4FX4 A;  5D6F A;  3GZ6 A;  2Q8K A;  3K9T A;  4N9H A;  1FYL A;  1BJA A;  3VEP A;  4HW0 A;  1E17 A;  3WTW C;  5BPI A;  2OQR A;  4HV5 A;  4ZYE A;  3J80 K;  2ETH A;  3WTS C;  1W5S A;  4N9I A;  1DPR A;  3V8J A;  5AON A;  5E18 F;  5FD6 A;  2QBY B;  3RKY A;  5JI6 A;  3LQR A;  1Z91 A;  2P6S A;  2JTV A;  4M9S A;  2MLK A;  5E8I A;  4M71 A;  1BN5 A;  4A0X A;  3FXR A;  3DPT A;  2ZNZ A;  3HHH A;  3K1M A;  1GXP A;  1HW5 A;  3SHF A;  4P55 A;  3HRU A;  1O7F A;  1TTY A;  3FM3 A;  2FNP A;  4AIK A;  1T39 A;  2BYV E;  4ZZD A;  3KEQ A;  2DTR A;  5D5U B;  2RC4 A;  4B09 A;  2XIG A;  3I71 A;  3ZPL A;  1TBX A;  1ZAR A;  4NHJ A;  1IXR C;  1ONV A;  3ABT A;  3SXY A;  2HQR A;  4GGG A;  3LFK A;  2MD5 A;  5E17 F;  2BE5 F;  2OZ6 A;  1YW9 A;  3J7A O;  5F6F A;  3QRF F;  1EV7 A;  1BC7 C;  3QP6 A;  3ZP5 A;  3K2Z A;  4O5V A;  1UHW A;  1KYW A;  4A6D A;  2RVC A;  1SD7 A;  2V1U A;  2GA1 A;  3IRQ A;  1AOY A;  1AWC A;  1IUY A;  5IT9 Z;  1B1B A;  2WTE A;  1YQA A;  5HS7 A;  3KE2 A;  1MGT A;  3RJP A;  4EV0 A;  4XSX F;  2Y0M A;  4EM0 B;  1WI9 A;  4KMU X;  3QU6 A;  5LGU A;  2EFN A;  2STT A;  3RKW A;  4MGR A;  4M72 A;  3W6J B;  4IRG A;  5FFZ A;  4L0Z B;  3M1E A;  5ILU A;  4BAY A;  1XSX A;  3DP7 A;  4G7Z F;  4YFN F;  2QEN A;  2WV0 A;  2VC0 A;  2Z5U A;  1RUO A;  1XSV A;  1R1U A;  1O7L A;  1W4M A;  3L2C A;  5FB2 A;  2QM3 A;  2V1X A;  1U78 A;  2XAQ A;  2DPD A;  5DV5 A;  4IHT A;  2K7L A;  4CO8 A;  1YTY A;  2FNA A;  1W5T A;  2AS5 F;  2BBY A;  4AD9 A;  2R7D A;  2P6T A;  5A2Q Z;  3HRS A;  1YFH A;  1YYV A;  5H6Q A;  4IXA A;  2DO7 A;  5AIP A;  4ESB A;  3K0L A;  3MZY A;  2PN6 A;  2HYF A;  4BXU A;  2A6E F;  3I64 A;  3GF2 A;  2W24 A;  2KKO A;  2EK5 A;  2ZJ2 A;  2MH2 A;  3WTY C;  1XSD A;  4EM2 A;  5LGT A;  1YO5 C;  5JFR A;  1R1V A;  2IJL A;  2EFW A;  1KQ9 A;  4LMY A;  3JW4 A;  4BHC A;  2ESH A;  4ZYH A;  4CYD A;  4L18 B;  1J0R A;  2XKP A;  2MA3 A;  3D5L A;  3I0T A;  1D8K A;  1DDN A;  2K86 A;  5HLH A;  3T8T A;  2P7C B;  4G7H F;  4FT8 A;  5DDG A;  4GYI A;  2ZME B;  1A04 A;  5LBQ A;  2XV4 S;  1LB2 A;  3EUH A;  2UXX A;  1JE8 A;  3MFK A;  2LF7 A;  5HDK A;  2VON A;  2YR2 A;  4WWC A;  3LQQ A;  1P4X A;  1SMY F;  2ZCW A;  1RI7 A;  4BNC A;  4D0P A;  3WGG A;  1G3W A;  3WTT C;  3BWG A;  1T38 A;  4YII A;  4HOB A;  2HEO A;  4KT5 C;  2PI0 A;  4MNU A;  2XAF A;  1KU7 A;  1KQ0 A;  3R61 A;  1QGP A;  1KU9 A;  3KZZ A;  2IRF G;  2GQQ A;  3ULQ B;  1Z9C A;  3QPT A;  4EQQ A;  1ZAO A;  5CYV A;  1FYK A;  1B9N A;  4LD5 A;  2CO5 A;  1CF7 A;  2D45 A;  1RIO H;  2R7F A;  3FM5 A;  1R23 A;  4MQV A;  1YW7 A;  5F64 A;  5BQT A;  1G4D A;  5DCM B;  4O3M A;  2ADU A;  4LG0 B;  1W7P B;  3ELK A;  1B6A A;  5IT3 A;  1FC3 A;  1ZN2 A;  3E97 A;  3H3U A;  2H09 A;  1MZB A;  3BJA A;  4L0Y B;  4RB2 C;  2XAS A;  3H3Z A;  2KIM A;  3GFI A;  1ZH5 A;  5L3E A;  2BEO A;  3PFI A;  4KIG A;  3DFG A;  2FMY A;  1ZLK A;  1GVJ A;  5AIQ A;  4A0Z A;  3U2R A;  1BBY A;  1C0W A;  1IRG A;  2O0Y A;  2LNB A;  2ZKZ A;  5DD4 A;  3DEU A;  3GUD A;  1XDS A;  2OA4 A;  1O3S A;  5D8K B;  4BYY A;  4CIC A;  4LLN A;  5CVI A;  1LDJ A;  2M30 A;  1J7K A;  2DQR A;  1GXQ A;  2G9W A;  2RGV A;  2A69 F;  2E7W A;  3ISP A;  4IJA A;  1QZZ A;  1IZ1 A;  2W57 A;  2O6G E;  2E7X A;  3VOE A;  4MTE A;  1BI1 A;  3FF5 A;  3N4M A;  2FBI A;  1EH8 A;  4EJO A;  4OIR F;  4HYE A;  2ZBK A;  2RN7 A;  4YFX F;  5CJ9 A;  2FEZ A;  4IF4 A;  2JPC A;  4EJU A;  3C18 A;  1HW2 A;  2HTJ A;  4H0E A;  1BI2 A;  2GXB A;  2L54 A;  2HKX A;  3HOS A;  4DQ2 A;  3R0A A;  2Z33 A;  3CUQ A;  5JVT A; 
#chains in the Genus database with same CATH topology
 1YLF A;  3RKQ A;  4JX4 A;  4PFO A;  1R36 A;  1QQI A;  2DFF A;  4XKC A;  3QOE A;  2P8T A;  4DBR A;  4RB0 A;  2X4H A;  5EG0 B;  3K4M A;  1X4P A;  3DF8 A;  3DPU A;  4P9U A;  1SEU A;  3S1M J;  4UV8 A;  5CVR A;  3HYI A;  1KU2 A;  3E6D A;  2OQG A;  3FMQ A;  2XB5 A;  3DKW A;  4B4C A;  1I50 J;  3JSO A;  4AVZ A;  2ELH A;  2OPT A;  2BZT A;  3FXL A;  3GBG A;  4LIT A;  4CCM A;  1ZR2 A;  3F8F A;  1TW3 A;  3GFM A;  1H88 C;  1R4M B;  3F3X A;  1CQT A;  2O8K A;  2HWV A;  2EV0 A;  3M7G A;  3C2H A;  1HSJ A;  5CLS A;  3DEW A;  4NB5 A;  3V7S A;  2R7T A;  4QLC U;  1J9I A;  3FIS A;  2FF4 A;  3IH2 A;  3Q0W A;  3CTA A;  4DIQ A;  3U1D A;  2PMZ N;  1OMI A;  2CS3 A;  3J81 Z;  2HDC A;  1J75 A;  5KVR A;  2L7M P;  3K4K A;  2NS0 A;  4HF0 A;  4LLL A;  5DEQ A;  3KLN A;  2ACJ A;  1MBG A;  2HQN A;  2ZB9 A;  3MQ0 A;  4ENJ A;  1YRN A;  1JUP A;  2ID6 A;  3ZMU A;  5H2F C;  3EUH C;  4Y52 J;  3FDY A;  2OJE D;  2EA2 A;  3SQN A;  2NVT J;  3JRF A;  4AU7 A;  4K2E A;  3GME A;  3LA7 A;  3DV8 A;  3WHC A;  3BRO A;  2TDX A;  5LHI A;  2G0E A;  4L9V A;  4FTH A;  4A3C J;  1K6Y A;  2HQ5 A;  1LFB A;  3G73 A;  2NNN A;  2LFB A;  4E7I A;  4WXD A;  4PSW A;  4EJW A;  2UXN A;  2EJR A;  4UVC A;  5FFX A;  3WTZ A;  1MBE A;  4AVP A;  4XN3 A;  4Z6Y A;  1N78 A;  1VZ0 A;  3L1P A;  3COA C;  4L9T A;  3RTR A;  3G4S I;  3A2K A;  4BE2 A;  2DT7 B;  2FUG 2;  2KMU A;  2M9H A;  4YEL A;  5D5V B;  5LHH A;  4MEY F;  3CCY A;  1WZ2 A;  3KZY A;  4E7J A;  1QPI A;  1HDD C;  4PCQ A;  3TW7 A;  3LST A;  1S5L C;  2F5F A;  4GO1 A;  1ZG3 A;  4G12 A;  4NQW B;  3PJR A;  4EJT A;  3DXJ F;  1ETX A;  1FOY A;  2CFX A;  5E8G A;  4PGG A;  2V9K A;  3RPU A;  1SD6 A;  4P5O A;  2PQ8 A;  4I01 A;  2L9S A;  2EFO A;  4MFD A;  1TC3 C;  4B47 A;  4C2U A;  3WTU C;  2B63 J;  4ENN A;  2TCT A;  5JHU A;  2JK3 A;  2K4B A;  2KJC A;  2K85 A;  3HBL A;  5GPA A;  4E7H A;  1Z3Y A;  2CQN A;  1X3Z B;  2L9N A;  4EAT A;  1USS A;  2F4M B;  3ZQG A;  4I7H A;  1XN7 A;  2MC4 A;  2BVL A;  3CCQ I;  4A3D J;  2JQ7 A;  2FQ3 A;  1X1D A;  4KDP A;  4L5J A;  3U21 A;  4EM1 A;  4LIV A;  1G6N A;  5E3M A;  2DJN A;  3IKT A;  2DA6 A;  1IW7 F;  3T5X A;  4J01 A;  4HQM A;  2VQL A;  3K69 A;  4OAY A;  2FBH A;  4CUG A;  2JJ7 A;  2MBF A;  5DM6 F;  3OYH A;  3HL2 A;  1R5G A;  3HOT A;  4RAG A;  3O2P E;  3TO6 A;  4AID A;  3JAM K;  1RRJ A;  5LEK A;  2M0M A;  4XQF A;  5ILS A;  3L2U A;  1JJ6 C;  3FXQ A;  1IAW A;  2P7V B;  3F22 A;  1G3T A;  4C9Y A;  3JRC A;  1SFO J;  2QKM B;  3GLL A;  4A3L J;  1U3E M;  3S1R J;  2W48 A;  4XRS A;  2QQB A;  4HG2 A;  2QA4 I;  4M6X A;  2LRE A;  2LSO A;  2DA2 A;  1XG1 A;  1PYV A;  1T56 A;  3WU0 A;  2NS8 A;  1FIP A;  1MDM A;  1E2X A;  1JJ8 C;  2BOL A;  2I5U A;  1U9N A;  5LEJ A;  5M5W J;  1DGW Y;  4ABZ A;  2ZXJ A;  1BC8 C;  2VE9 A;  2H1L A;  2XAG A;  1UEL B;  3VB2 A;  1GLN A;  2RAE A;  1I39 A;  1KA8 A;  1Z0X A;  3HTU A;  3MEX A;  4HV6 A;  1I27 A;  1AKH A;  1B8I A;  3OYK A;  4Y7N J;  2JSP A;  3NQO A;  4AC0 A;  1P2F A;  1D0Z A;  2IP2 A;  3OR2 C;  2RDP A;  4GCV A;  1U0J A;  4HNU A;  2X6O A;  4DW6 A;  3CCS I;  3ZQH A;  4A5N A;  4BGD A;  4OIP F;  2F2E A;  4HST A;  2BW3 A;  5J8F A;  2WA0 A;  3EYY A;  3CD6 I;  1TQP A;  1NG7 A;  2CWE A;  4R79 A;  1R71 A;  1LEB A;  3Q5F A;  3I3L A;  1X1B A;  1X1A A;  2V1D A;  5K5O A;  3F8M A;  3ZQ7 A;  5TRD A;  3FMR A;  3DTE A;  1JXS A;  1P7J A;  5ERI A;  5ILV A;  2O03 A;  3JTG A;  2XGX A;  3GWZ A;  1LVK A;  1Z7L A;  2XVC A;  3GEZ A;  4CYC A;  3QOP A;  2MH9 A;  1LE8 A;  3L09 A;  4LB6 B;  1EKE A;  1JHF A;  4M6Y A;  2XAJ A;  3F23 A;  4BDZ A;  2R7X A;  2PMH A;  2BHZ A;  4OU0 A;  1SFX A;  2DMU A;  2LH9 A;  2DBB A;  2QQ8 A;  3MMY B;  3IP4 B;  1DUX C;  1TQM A;  4KMF A;  3Q0V A;  3CO6 C;  1E3O C;  3D5R C;  1F9N A;  4UVA A;  3HSE A;  5FRO A;  1UG2 A;  2EIL H;  2EV5 A;  1LDD A;  3HTS B;  2HS5 A;  3REO A;  2CQK A;  3NWS A;  2YPR A;  2M45 A;  4MEX F;  3GX4 X;  2RV8 A;  2ESN A;  3CCM I;  2O3F A;  2WWY A;  5HS8 A;  3WU2 C;  3CUQ C;  3GFL A;  4A3M J;  2R7S A;  1WKM A;  1TNT A;  4ESF A;  1VFC A;  4KN7 X;  3FZV A;  1J5Y A;  2LTP A;  3VYU B;  1EH7 A;  1TLH B;  5FLV A;  1OQY A;  2CQX A;  2UWM A;  2X1E A;  3T8R A;  1Y1W J;  1IDZ A;  3IHU A;  3LFU A;  2GA2 A;  2Y0S A;  4ANJ A;  2OCC H;  3P9K A;  2OBP A;  1Z6R A;  5BNG A;  2X6X A;  3P7N A;  4LG3 A;  2R7O A;  1W1W E;  2E1M B;  3OYE A;  2XGD A;  1B59 A;  4A3J J;  4C2T A;  4I0A A;  3L2Q A;  4PJJ A;  5DYM A;  1G59 A;  1IF1 A;  1D1A A;  3KET A;  3TO7 A;  4WXC A;  2MAB A;  2AQF A;  2Q2E B;  2A3S A;  4XLP F;  1QBJ A;  1OR7 A;  4LJZ F;  4UXN A;  3RPQ A;  2W7N A;  3F6V A;  2CG4 A;  1QRY A;  4XOP A;  2QEX I;  1KQ8 A;  2NYX A;  1IN7 A;  5E20 A;  1S29 A;  3MN2 A;  3CZ6 A;  2NNY A;  5FKL A;  1E3H A;  5F08 A;  2ZJQ F;  3ONQ A;  1TWH J;  4KJZ A;  3HOU J;  1HLV A;  2R3S A;  1ZTR A;  1U8R A;  4A93 J;  2EB7 A;  4I0B A;  3QAH A;  2L7K A;  1DU0 A;  5C4X J;  3AG3 H;  2NVQ J;  2D1H A;  3GZ5 A;  4P9F A;  3JRA A;  3O3K A;  4RAZ A;  3KYD B;  4U0Y A;  3HRT A;  1SVM A;  3QPS A;  3K10 A;  3QPH A;  5J47 A;  1J09 A;  4XLE A;  1ZLJ A;  2ZSH B;  1B72 A;  3FXU A;  3H9Q A;  1P4W A;  3HPG A;  2YX4 A;  5DUK A;  2FSW A;  3K70 D;  1OJL A;  3G6E I;  1HC8 A;  2NVU B;  4CGZ A;  2EBI A;  3GW2 A;  3VPR A;  3EQL F;  1REP C;  4OAZ A;  1ZRE A;  1TQI A;  5HS9 A;  4GXO A;  5LRS A;  2ZJP F;  1K78 B;  1SD5 A;  1T8I A;  4Y13 A;  2M8E A;  2MD0 A;  1R49 A;  4BY7 J;  4B3X A;  4XN0 A;  1QVT A;  1LKX A;  2B7E A;  3FHZ A;  3FK6 A;  5FKK A;  2DYS H;  3AG1 H;  2BXZ A;  3PIO F;  5HOO A;  2VLA A;  1K6O A;  1OCO H;  3ZXS A;  4RGX A;  1W0U A;  3E6M A;  1XCB A;  1R1T A;  4AUX A;  5L3C A;  5LFA A;  3NAU A;  3RIR A;  2ZO4 A;  4PJL A;  1U5T A;  3L2W A;  1KGS A;  3ZMD A;  2VAS A;  3R60 A;  5KHD A;  3IH4 A;  4LFU A;  3RKX A;  4HNV A;  3GLX A;  1G3Y A;  4JK1 X;  4DYQ A;  2XHK A;  3F8B A;  3TO9 A;  2PJR A;  1ZQ3 P;  5FLX K;  1FOK A;  5KAI C;  5IY5 H;  1SC7 A;  3N97 A;  1FLI A;  2COM A;  4JYK A;  4CCJ A;  1JT6 A;  2DT6 A;  3M3Y J;  2FML A;  3R4K A;  2HDD A;  3A1Y A;  4U0W A;  2JWT A;  4OIN F;  2QYO A;  5IPA A;  1D0Y A;  4XL9 A;  2XKO A;  3DPL C;  3OOP A;  2VBW A;  4HDV A;  2CRG A;  1W36 D;  3EUA A;  3PO3 J;  3CF2 A;  4G6T B;  3ML6 A;  4A12 A;  2LF8 A;  4ZDL A;  2XB0 X;  1VQN I;  2R7R A;  2E36 A;  3KLO A;  3W2W A;  1ZRC A;  4KIB A;  3ZCO A;  4I02 A;  5EZH A;  1Q1V A;  3TGN A;  3JRH A;  1AHD P;  1LFU P;  2P81 A;  2LD5 A;  1XTA A;  4HEA 2;  1HOM A;  1FPQ A;  2KRC A;  2IA1 A;  3I4P A;  2M87 A;  3BJ6 A;  3J81 K;  3A0H C;  3J80 Z;  1OCZ H;  2MG4 A;  3E7L A;  2VJ5 A;  2PFB A;  3OL4 A;  1V4R A;  1MND A;  1Y1V J;  3OL3 A;  3BTL A;  1I3A A;  2R7W A;  2IS2 A;  2YU9 J;  6PAX A;  1IO2 A;  1G8X A;  2MC3 A;  1V55 H;  1QA6 A;  2GIZ A;  5GAG J;  2KJB A;  4WXH A;  2HXO A;  4XNF A;  3DEE A;  2Y0S N;  4KN4 X;  1M1E B;  1JGS A;  2DA4 A;  2EIN H;  1ZK8 A;  4JOM A;  1PDN C;  1DP3 A;  1MD0 A;  4XR6 A;  5FO5 A;  2IS1 A;  2VKD A;  1ULY A;  5D5X B;  4YRV A;  1IC8 A;  5DCM A;  1X1C A;  1FY7 A;  1QO0 D;  2Y75 A;  2E2I J;  3DBR B;  4BDY A;  4PJ0 C;  1XS9 A;  3QWL A;  3GTK J;  5IOZ A;  2ZSI B;  2VOO A;  4II2 A;  3AL0 C;  1J59 A;  3HUG A;  2VOP A;  4HQE A;  2K5C A;  2VPL A;  2H6C A;  1FP2 A;  1Z21 A;  1IN4 A;  4HX8 A;  1SAU A;  1WQ2 A;  1FBQ A;  4G6Q A;  2EWN A;  3I54 A;  1XDU A;  2V26 A;  2A6H F;  1GUU A;  2NS7 A;  2P0W A;  1NTC A;  3F72 A;  4I99 C;  1QPM A;  4A6E A;  4I09 A;  1HQC A;  1FBS A;  1FNN A;  3K4B A;  3B02 A;  2E19 A;  2A5Y B;  2DA3 A;  1H9T A;  3V4G A;  3WOD F;  1XMA A;  3F21 A;  4Y4R A;  2DK8 A;  2K9N A;  4UUS A;  5H6R A;  2V1N A;  1F1Z A;  1MMS A;  3Q9S A;  1WJ5 A;  2QF7 A;  4AYB A;  5B1A H;  2DOA A;  5IYC J;  2R93 J;  4F91 B;  3F0C A;  2E60 A;  5E3N A;  5JLW A;  2X51 A;  5CKT A;  2E2J J;  3ABU A;  1YI2 I;  5F1R A;  5J1R A;  5HLG A;  3QP5 A;  4BJT A;  2XRO A;  4ZTJ A;  1WWX A;  1TW2 A;  5J8C A;  2WAD A;  2XRL A;  4UNO A;  2Y9Z A;  2F4O B;  2J5O A;  4BUP A;  3PNY A;  2FQ4 A;  2IA0 A;  1D5V A;  3WU1 B;  1LVA A;  2F6C A;  1IN6 A;  1RR8 C;  2F4I A;  2PMU A;  2R5Y A;  2VKH A;  1YW8 A;  4A3I J;  2CV0 A;  2BY1 A;  3IC7 A;  3MAJ A;  2F5D A;  2HZT A;  1LEA A;  1ZGW A;  1VI0 A;  4KIF A;  2G7H A;  1VQ4 I;  3P9C A;  3HXL A;  3OIQ A;  1SVL A;  1GHC A;  2WAE A;  5KCM A;  3IAS 2;  2OF7 A;  2CW8 A;  3SDB A;  3K2A A;  4B8X A;  1N77 A;  3GTG J;  4X0G A;  3CF5 F;  3U9G A;  1R7J A;  1I5Z A;  3CO7 C;  1CF7 B;  1F43 A;  1ENH A;  2VBZ A;  1MBK A;  2YUS A;  2O8X A;  1PUF B;  3QPL A;  5EGO B;  3CCJ I;  2FE3 A;  2YSR A;  2VJ4 A;  4L9N A;  1VQO I;  1OR7 C;  2L2O A;  1Z05 A;  4C3J J;  3SEQ A;  4MQ9 F;  5FJ8 J;  3FXK A;  2CW7 A;  3OS1 A;  3LSH A;  1BJZ A;  2LMD A;  5J40 A;  2JA7 J;  5EG0 A;  4HRI A;  1XMK A;  4AIJ A;  3VDX A;  4M9X A;  1KU3 A;  3K4J A;  4RGS A;  1O3R A;  2ECC A;  4FCY A;  1FSE A;  1K7A A;  2QSF X;  3PQJ A;  3KEO A;  2VQC A;  1WGX A;  4M3D A;  1TWA J;  2YS9 A;  4XMY A;  3ZGK A;  5GAD J;  3H5N A;  2WY7 Q;  1W7P D;  3BPV A;  2L3D A;  2LVS A;  2B9S A;  2VOD A;  1Z1D A;  1V5E A;  3CMM A;  1YHQ I;  5TIS C;  2IW5 A;  2XAH A;  1B4A A;  4CCK A;  2XF6 A;  3SZP A;  2R5Z A;  4CH7 A;  1UJ8 A;  1WJB A;  2FD5 A;  3HKZ A;  5EEG A;  4BH9 A;  1ORK A;  4U0V A;  4D5C A;  4DJA A;  3PNT A;  2H94 A;  5HVQ C;  1FMV A;  2L01 A;  3CLO A;  3LA2 A;  3FXJ A;  2L7F P;  3BR3 A;  2V7F A;  4Y33 A;  1S72 I;  4F92 B;  2HDW A;  3WGI A;  1OCC H;  4RAF A;  3ASO H;  2M1B A;  5K7Z A;  3LSP A;  1XB4 A;  2BXY A;  4BHP A;  3A01 B;  2ZME C;  5FD5 A;  3ESW B;  3OIP A;  2XPV A;  2XPU A;  5FGM A;  4FE7 A;  3HOY J;  2E71 A;  2VBY A;  1ZYR F;  1U5T C;  4XLH A;  2V79 A;  3M8E A;  1LNW A;  2LY2 A;  1RPW A;  5IT9 K;  3PQK A;  3FMS A;  1LJ9 A;  3LMM A;  1DP7 P;  1O57 A;  2YU3 A;  3VOD A;  2M7B A;  1MJA A;  4MTD A;  1O4X A;  4A0Y A;  2R7Q A;  4YFK F;  2GOM A;  1AA7 A;  4XID A;  2QKL B;  5K7F A;  1K79 A;  2K4J A;  4M74 A;  4OIQ F;  3S16 J;  2BHY A;  4XKB A;  2H27 A;  1ZGA A;  1RET A;  4A2U A;  2DPU A;  1HW1 A;  4QTR A;  3G1L A;  3DBL B;  1ZGJ A;  3DKX A;  4AYB N;  2HYG D;  4RGU A;  2RNJ A;  2L4M A;  4RAY A;  1IJW C;  1HA8 A;  3MD2 A;  2R4G A;  2F48 A;  4CCN A;  1WH7 A;  3UR3 C;  2CYY A;  2JPB A;  4E7Z A;  5E1W A;  4G94 A;  4IHY A;  1WJD A;  3QYF A;  2XGC A;  4LK1 F;  2DMQ A;  4HX7 A;  1JUM A;  2UUZ A;  3W6K B;  1SAX A;  3SFZ A;  1I1G A;  1S3J A;  2HOE A;  4IX7 A;  2QQA A;  3I59 B;  3CUQ B;  2W84 A;  2CW0 F;  4HF1 A;  1KYZ A;  2EV6 A;  3KP2 A;  3J7Y J;  4M3E A;  2P5V A;  3F6O A;  1JKP C;  1HXD A;  1GVD A;  1IUF A;  2JA8 J;  2CU7 A;  2ZFU A;  3I56 I;  1A5J A;  4R8H A;  3M8J A;  2FXA A;  3G3Z A;  2IS4 A;  5ICG A;  4NC6 A;  2VL8 A;  4A3G J;  2Z9O A;  3A03 A;  1T2K A;  1UG0 A;  2P4W A;  4IQ4 A;  3CDL A;  3PIP F;  2HTS A;  1MKM A;  1TNS A;  1I1S A;  5A2Q K;  1TWG J;  2FOK A;  3ASN H;  4RS8 A;  4IQJ A;  5F04 A;  3C7J A;  3HOZ J;  2GBY A;  3EET A;  4IOC F;  3FKJ A;  1QNT A;  4MFE A;  1MIJ A;  1U6G A;  2H6B A;  3I58 A;  3OSG A;  2Z2S B;  2NOJ B;  1ETV A;  2RKH A;  3BZ6 A;  4LOC A;  4AWX B;  2GIV A;  4PJM A;  3OMY A;  2IVM A;  2JVG A;  3SYT A;  4DNC A;  1K4T A;  9ANT A;  1IV6 A;  2GZW A;  2OZU A;  1BIA A;  4LGW A;  3GVA A;  3OYA A;  3EUK L;  2ME6 A;  2JUC A;  1FP1 D;  1WI3 A;  2DW4 A;  1YIJ I;  2ECB A;  3OYG A;  2VJI A;  5D8L B;  5BPD A;  2K3P A;  2BGC A;  2QBY A;  1MMA A;  2ICW G;  3IKV A;  5K7H A;  4HZF A;  1VQK I;  4IPA A;  4XRS G;  4G6D A;  4N4N B;  3R0J A;  4P96 A;  2XSD C;  4WX9 A;  5GTH C;  2ZFW A;  3CJN A;  2HVR A;  4XLC A;  1XGS A;  4F7Z A;  3BG5 A;  2QQ9 A;  4IOA F;  3L9F A;  4RB1 A;  1JGG A;  2W85 A;  2V9V A;  2JA2 A;  3ZMV A;  5D5W B;  2VIX A;  4EJV A;  4UB8 C;  1PP7 U;  1QHG A;  2L4A A;  2X6W A;  3JRE A;  2ZXH A;  4RM3 A;  3JSP A;  2STW A;  2PG4 A;  4ZYA A;  1RUN A;  3DLL F;  1T98 A;  2IBD A;  2HFH A;  2OAZ A;  1K4S A;  1HKS A;  3UNG C;  1PJR A;  2G7U A;  4ETS A;  4MLO A;  3ZQI A;  4WCG A;  5FRN A;  1TT5 B;  4B48 A;  2EZH A;  4N4O B;  4ZTF A;  4IZZ A;  5HDG A;  1CGP A;  1U2W A;  2QZ8 A;  3BY6 A;  3A02 A;  4MHG A;  5E1Z B;  1IRF A;  1MNE A;  2F5C A;  4NC7 A;  2OTJ I;  4BJ5 C;  3FHN A;  3DTI A;  3BCA A;  3E6B A;  5L3D A;  1TWC J;  3VSL A;  2FU4 A;  1BI3 A;  3TKY A;  2EIK H;  3E1S A;  2B0L A;  2L0K A;  4G7O F;  2YX7 A;  3LNQ A;  3ZQL A;  2CQ7 A;  4FET A;  5K1Y A;  5EF6 A;  5M3M J;  2PBI A;  3O8H A;  2R7Z J;  3CJQ B;  4II3 A;  2AXL A;  3ZMS A;  4GDF A;  1JKQ C;  4UB6 C;  4OIO F;  4BU2 A;  3TOB A;  2VXZ A;  2CUZ A;  2K40 A;  3H5A A;  1SFU A;  2DK5 A;  2PLY A;  2KLO A;  1XGN A;  2XF7 A;  5KAF C;  4HA8 A;  4Q47 A;  1TWF J;  3DQV C;  3Q0U A;  2LC2 A;  4Y3O A;  1WRJ A;  2E1O A;  2IAI A;  3C1D A;  3OY9 A;  2D5V A;  1FIA A;  2LDU A;  1A31 A;  5EYR A;  4WF2 A;  4N0B A;  2HU9 A;  2MLG A;  1UCR A;  2BV6 A;  2M8G X;  1QHH D;  3MVP A;  1ZHF A;  1DU6 A;  1V3F A;  4Y15 A;  3LAJ A;  1Z6T A;  4NDL A;  1T0F A;  3DLA A;  4NC8 A;  2EZI A;  4QWQ A;  3GTJ J;  2Y30 A;  1Q1H A;  1GDT A;  1SAN A;  4L5I A;  5LRR A;  1MDM B;  4KFC A;  1P4A A;  4KA4 A;  1VQ5 I;  3TMO A;  2Q2E A;  5E1X A;  4M3B A;  4PSX A;  2VN2 A;  4LLG F;  1WHU A;  2UZK A;  1WH5 A;  3VWB A;  5FRM A;  3BG7 A;  3WTX C;  4OMY A;  1X3W B;  2EIM H;  1ZEL A;  4BBS J;  1B8I B;  4LIU A;  1T6S A;  2AQE A;  2DDA A;  3T0Y A;  1VQ6 I;  5EEH A;  2RQP A;  3ECH A;  2AXT C;  2XF5 A;  3LSI A;  4E4H A;  3I53 A;  4JX6 A;  4EVI A;  2K9S A;  4M6V A;  4U7D A;  1J2X A;  1S7A A;  3LSJ A;  4ASN A;  3KIO A;  3R6S A;  4E7S A;  3OWT A;  3OYL A;  1VTN C;  1G3S A;  4JBA A;  2HGC A;  4Q5S F;  4E70 A;  1P92 A;  1BOA A;  3FKI J;  3NWT A;  1MMG A;  5D4S A;  3FXO A;  2ELK A;  3KP7 A;  2QWW A;  3RQI A;  2CUJ A;  1IXS B;  3BCB A;  3TP0 A;  4UV9 A;  1DPU A;  5F0C A;  2OC6 A;  2EZL A;  5ICC A;  1G2H A;  1O3T A;  1JUS A;  2KQR A;  4CYC B;  1U9O A;  3ZMT A;  4OWR B;  1LE8 B;  3DTK A;  2HKO A;  2VQH A;  4BEH A;  1X2M A;  4ZDP A;  3I5U A;  3OYM A;  5M5Y J;  1ETO A;  2HQA A;  2X6Y A;  4UHT A;  5KK1 A;  3RDI A;  3MKW B;  1K78 A;  3TDZ C;  4AIH A;  3BG9 A;  1LUJ B;  1F5T A;  5K5R A;  2FA5 A;  4IHX A;  2FBK A;  4S0H B;  1ZR4 A;  2IT0 A;  1FT9 A;  2CJJ A;  1WJE A;  1F4K A;  1RZ4 A;  3QOD A;  1VND A;  2LOO A;  4DYR A;  1VQ7 I;  3BJO A;  2ZNY A;  2JSC A;  3GO5 A;  2EFQ A;  2K27 A;  4RGR A;  5TJJ A;  3KX2 A;  4IRI A;  3I4M J;  1K61 A;  5ICF A;  1IV8 A;  2X0L A;  3H0D A;  4JX5 A;  1MNM C;  3SJM A;  3BPX A;  4V19 K;  1NK2 P;  3OYJ A;  2EFP A;  3DCF A;  1UHM A;  4PFP A;  1JKO C;  1Z7U A;  4OMZ A;  3HOW J;  1L0O C;  2NVY J;  4HX4 A;  3S2H J;  3PUF A;  1ITY A;  4XKW A;  3KEY A;  3WE3 A;  1ZRD A;  1Z77 A;  4CDG A;  2PJP A;  1DGR M;  3TBI A;  3CCE I;  2JZY A;  5H20 A;  1JT0 A;  2DTZ A;  1L3L A;  2KIU A;  1R5I D;  1MBH A;  3OS2 A;  2DXI A;  4L5E A;  1HBX G;  2KHM A;  2ZME A;  4RLF A;  3S2D J;  5JLX A;  5HLI A;  3PL8 A;  3OV8 A;  2LKP A;  3HJE A;  2Q1Z B;  3EDP A;  1YJN I;  1SFK A;  3DBH B;  4L9J A;  3WTV C;  1YS6 A;  1H9G A;  3S2W A;  3KFW X;  3N05 A;  1QVU A;  4M73 A;  2EA4 A;  4S05 A;  3K4N A;  4YEJ A;  2A61 A;  3KP6 A;  1PUE E;  3K7A J;  5IP7 J;  3IWZ A;  3JTH A;  1JTX A;  1NHA A;  3H0G J;  2FJ1 A;  5DD8 A;  4ON0 A;  1X3U A;  3HRM A;  4PK4 A;  1OYY A;  3ECO A;  4LK0 F;  2D1V A;  1ZG5 A;  2DA1 A;  4HDU A;  3RI4 A;  1D5Y A;  1MSF C;  1BL0 A;  3HB9 A;  3KP4 A;  3GZN B;  4X6A J;  2W4S A;  4ZC3 A;  3M8F A;  4E7K A;  2LG4 A;  4FE4 A;  1IRZ A;  2KDZ A;  1YJ9 I;  2EZK A;  1S6L A;  2A07 F;  2ISZ A;  3WG7 H;  4U88 A;  2DFI A;  2E1N A;  1B72 B;  5EJC A;  5K5Q A;  1D1B A;  4WK8 F;  4QPQ A;  2X9D A;  4TV7 A;  3VFZ A;  5CVJ A;  3CC4 I;  2J5P A;  4JQF A;  3OYF A;  4EGZ A;  2FRH A;  3ZQF A;  5BOX A;  3KYL A;  3JAM Z;  1AU7 A;  3HEF A;  1R58 A;  1R22 A;  2KIF A;  3CCR I;  2QVO A;  4HNT A;  1P7I A;  2MW8 A;  1I6X A;  1ODD A;  2E1C A;  1Y6I A;  3CP8 A;  3I4N J;  5LLQ A;  3A4C A;  4HBL A;  5GAH J;  3ERE D;  2LR8 A;  2LBF B;  2LK2 A;  4IKF A;  2M5W A;  2QGU A;  1U5T B;  2H8W A;  4G8X A;  4D5F A;  3OSF A;  1T33 A;  2VJJ A;  3Q3S A;  4F93 B;  5HLT A;  2ISY A;  3GFJ A;  2DN0 A;  2PJR B;  4LG0 A;  1W7P A;  3WGH A;  1FTZ A;  1Y0N A;  2EIJ H;  2Q0O A;  2NAZ A;  2V6C A;  2MGQ A;  4UVB A;  5BS6 A;  1WCM J;  4BQN A;  3P9I A;  4Y17 A;  1IXC A;  4ZH4 F;  2M7A A;  3VYT B;  2IGM A;  3K70 C;  2HPI A;  2DU9 A;  1FBU A;  4QSH A;  4FIS A;  2BY2 A;  3FWE A;  1HST A;  4V2F A;  3IV5 A;  3DU5 A;  1SMT A;  2Z99 A;  3NEU A;  3H36 A;  4NBQ A;  3EYI A;  3GTP J;  2O61 A;  1WJC A;  4PUS A;  4BKX A;  2K9L A;  4PDK A;  4Q48 A;  2GAU A;  2OD5 A;  2XAU A;  2WC2 A;  3PM1 A;  4IVN A;  4O6J A;  5GP9 A;  1OLT A;  3E3V A;  4ZYG A;  1E3P A;  1UB9 A;  4B43 A;  4IHW A;  4YG2 F;  5B5E C;  3GTO J;  2P5K A;  4IEJ A;  1TP4 A;  1UST A;  3AAF A;  2XUB A;  2TRT A;  1BW6 A;  2FX0 A;  2Z3Y A;  3FBI B;  4XLN F;  1YE9 A;  5EZG A;  2OTL I;  4S04 A;  1FYM A;  5ED4 A;  2W25 A;  1X2N A;  1Y8Q B;  3C2G A;  1XCV A;  1R5H A;  2K9Q A;  1R4N B;  2DQL A;  2X1C A;  3D0S A;  2XDV A;  4B44 A;  2DMN A;  4NUB A;  4A5M A;  1T0F C;  2IXS A;  3G1O A;  1S8N A;  5IP6 A;  3WHB A;  3G1M A;  3S14 J;  1FOW A;  3ROU A;  1WJF A;  1D8J A;  1GV5 A;  4GFB A;  2QUF A;  4IRH A;  5DCF A;  3V7R A;  4DYC A;  1LPQ A;  2GLO A;  2QLZ A;  5CVU A;  3IAM 2;  1WSU A;  5IYB J;  1W36 C;  1EF4 A;  1TT0 A;  1X58 A;  1ON1 A;  3B6C A;  5ICE A;  3ABK H;  3E6C C;  3HOV J;  1YJW I;  3OOU A;  4BAC A;  1N25 A;  3GYH X;  4OOI A;  5LGN A;  2BY3 A;  2NOG A;  1RC9 A;  2GM4 A;  2IPQ X;  2DOE A;  4XRF A;  4MIM A;  1MJB A;  3LA3 A;  1YS7 A;  1R00 A;  3C3W A;  2VT2 A;  3RCO A;  5IYD J;  1FJL A;  4D7N A;  1MJ9 A;  1X1P A;  3HC7 A;  1HKT A;  4A3F J;  1OCP A;  4EMS A;  3QU3 A;  2DLL A;  3OYB A;  1NH3 A;  3E5Q A;  2P5L C;  2DAO A;  1HKQ A;  2VBX A;  4QIW N;  4CSW A;  5TGT A;  2NRA C;  2X85 A;  5L3B A;  4M3F A;  1BIB A;  3RZD J;  5IP9 J;  1RNL A;  1ETW A;  1XGM A;  3G71 I;  1H0M A;  3FX3 A;  3J7A Y;  3AKZ A;  2R7V A;  1BR4 A;  3CME I;  1LQ1 A;  4XKV A;  2IGO A;  3LSK A;  4DBQ A;  3ZMZ A;  3S15 J;  3M9A A;  2HR3 A;  3BP8 A;  2OU2 A;  1JTY A;  3CUO A;  3WE2 A;  1D3Y A;  4BQO A;  4EEF G;  5J4Y A;  1VQ9 I;  1U8B A;  4PGH A;  1V5F A;  5GAE J;  2HOS A;  1OYI A;  1OKR A;  4YIR X;  5LHG A;  3BDD A;  3IL2 A;  3BR5 A;  4CZC A;  2K02 A;  1PVE A;  2DOF A;  4GYG A;  1BA5 A;  1OYW A;  4LB5 A;  1IRX A;  1PP8 F;  2F5E A;  3A01 A;  4ZYD A;  3BT9 A;  5CPR B;  1X4O A;  4XLA A;  2DOD A;  5J6X A;  1BI0 A;  1ZRF A;  2Y31 A;  3B73 A;  5E3L A;  4A69 C;  1EH6 A;  2JN6 A;  4HLX A;  2VT3 A;  3RYP A;  3LAP A;  3HIF A;  3BZC A;  2VE8 A;  2WB1 A;  3O6B B;  2M0C A;  2JRT A;  3IRR A;  4MO7 A;  3LWF A;  1UFM A;  4I6Z A;  3ZN1 A;  4CHU A;  5L3G A;  3KP5 A;  3K1P A;  2C6Y A;  3OYI A;  4UUV A;  3L7W A;  2RQQ A;  1UMQ A;  5F27 A;  5D4R A;  3K6G A;  4I76 A;  1IN5 A;  3TED A;  3H1C A;  3W2A A;  5C4J J;  1B9M A;  3AFH A;  1HF0 A;  3M1C A;  2RRE A;  3O8G A;  3S3M A;  4P1W A;  1SFE A;  4I2O A;  4M9Z A;  3E5U A;  2R92 J;  4DGW B;  4KIC A;  3FBN B;  1E0E A;  5B66 C;  2CGP A;  3V8L A;  3CDI A;  3TQN A;  2CMP A;  2KIS A;  4ZZL A;  3CMA I;  3BR2 A;  1W0T A;  2A05 A;  1O3Q A;  1FSH A;  3DWL E;  1HCR A;  1XPX A;  3S1N J;  3HZJ A;  1YIO A;  3QQA A;  2O7O A;  2VPR A;  3I59 A;  4CXF A;  5B1B H;  2GWR A;  5LD2 C;  3J7Z I;  3HOX J;  3GTM J;  3OS0 A;  2VB6 A;  3V8K A;  2CH0 A;  5FLX Z;  2DI3 A;  2Z1D A;  3BOQ A;  4HF2 A;  1GT0 C;  3L00 A;  3JRB A;  1SD4 A;  3E5X A;  4KUM A;  1QZY A;  2KL4 A;  3BTI A;  1TZL A;  3SEZ A;  1WFX A;  2DJI A;  4F52 A;  1YG2 A;  1KZH A;  4GRI A;  5DUI A;  4RBO A;  3NAR A;  1XGO A;  2A5W A;  4G9Y A;  1FZP B;  1POG A;  1K83 J;  3IWF A;  4BHB A;  3QYB A;  4ENM A;  1BR1 A;  3RSN A;  1Y0U A;  5HNH A;  3CJT B;  2E34 A;  4RMN A;  3HHG A;  2R5Z B;  1NG6 A;  2L9V A;  1FX7 A;  3MCZ A;  4R1H A;  4D7M A;  2R7U A;  4NQW A;  2IS6 A;  3KCC A;  3NRV A;  3FK7 A;  3HSR A;  2CSO A;  4FHT A;  5GTI C;  3B6A A;  3KP3 A;  4KNY A;  2Y48 A;  3HG9 A;  5J3L A;  2A68 F;  2BVM A;  3CQZ J;  3VYR B;  1UZC A;  1D0X A;  2JMW A;  4Z2Y A;  3V7C A;  2XRN A;  3BTJ A;  4RB3 C;  3Q9V A;  2VXD A;  1I3Q J;  3AG2 H;  5GPC A;  1ZG1 A;  3H35 A;  5BMZ A;  3BLY A;  3W3C A;  3CDH A;  2O9L A;  1IN8 A;  4I98 B;  3HSF A;  3VSK A;  4YIF A;  1BM9 A;  3BG6 A;  3WG9 A;  2PEX A;  3GXO A;  4ZDO A;  3IH3 A;  5HDN A;  4IHS A;  2WAF A;  5JVG F;  1RKT A;  4KYW A;  4EGY A;  1OPC A;  3ABM H;  3KZI C;  4HAM A;  5E79 C;  3ZN0 A;  3D1N I;  4CZZ A;  2L02 A;  3PFY A;  1HDP A;  3RYR A;  2D2W A;  2KRF A;  2WAQ A;  3K1N A;  1LDK B;  1YIT I;  1BR2 A;  3CC7 I;  5D6E A;  1STZ A;  4HLY A;  3T1B A;  2VC1 A;  3F8N A;  1S7O A;  4PZJ A;  3D5S C;  4BQA A;  4M3G A;  2DT5 A;  2JT1 A;  1OCR H;  4PJN A;  1Y8R B;  2GXG A;  1KON A;  2HPM A;  2KFD A;  1Z3X A;  2CUE A;  4XSZ F;  5L3F A;  2F5V A;  1YRN B;  4ENK A;  2GOX B;  4FX0 A;  3F8C A;  5JR3 A;  1XD7 A;  1FWZ A;  3H92 A;  3KPH A;  3TDU C;  1VQM I;  2VKV A;  5CVV A;  3TOA A;  2HYJ A;  2WB1 N;  3K4L A;  3MZH A;  1JHH A;  3MWM A;  4RLQ A;  1VQL I;  5M3F J;  4CCO A;  4ESJ A;  1ON2 A;  2KT0 A;  3CC2 I;  3SZT A;  2DFH A;  4U7B A;  3ABL H;  2HI3 A;  4A3K J;  2RNG A;  4Q4Z F;  2IA2 A;  1P6R A;  2JA5 J;  2DDB A;  4X1E A;  4HPQ A;  3HKZ N;  4DOZ A;  4XBF A;  2OCE A;  3CJR B;  4FX4 A;  5D6F A;  3GZ6 A;  2DCE A;  4B1R A;  3I9V 2;  2E2H J;  3BQY A;  3F9K A;  2KRH A;  2Q8K A;  2KZG A;  4AM3 A;  3K9T A;  5JHF A;  3JR9 A;  4N9H A;  3OYD A;  1FYL A;  3H3V K;  1BJA A;  2M4G A;  3SDG A;  3VEP A;  1QU3 A;  4BXF A;  4HW0 A;  1E17 A;  3WTW C;  5CQG A;  5BPI A;  3RQ4 A;  2OQR A;  4HV5 A;  4ZYE A;  3J80 K;  2ETH A;  4UY8 I;  2VKE A;  4BY1 J;  1ETK A;  3ZQQ A;  4D9J A;  3WTS C;  2Y2Z A;  1W5S A;  4N9I A;  3BR0 A;  2M34 A;  3VYS B;  1DPR A;  2CV1 A;  5FKN A;  3V8J A;  2KPM A;  2DA7 A;  5AON A;  3LL7 A;  5E18 F;  5FD6 A;  1Y56 A;  2WV1 A;  2CFO A;  2IGK A;  3PNV A;  2LY1 A;  2VI6 A;  4BQQ A;  3OYC A;  1OFC X;  3CP2 A;  3E0J B;  3RKY A;  5JI6 A;  2QBY B;  3LQR A;  1Z91 A;  2P6S A;  2PX9 A;  2JTV A;  4M9S A;  1IDY A;  2A6T A;  2MLK A;  3H5R A;  1YX3 A;  2E5N A;  4BS9 A;  5E8I A;  4M71 A;  1BN5 A;  1WPK A;  4IHV A;  5F0F A;  4A0X A;  3FXR A;  3DPT A;  4BXX J;  2ZNZ A;  2HOA A;  3HHH A;  2W00 A;  3K1M A;  1MW7 A;  1GXP A;  1ACI A;  1HW5 A;  3SHF A;  1EA3 A;  2X48 A;  3HRU A;  4P55 A;  1O7F A;  2JUG A;  4DZJ A;  3PSI A;  2H1K A;  1VQ8 I;  4UUT A;  1TTY A;  3FM3 A;  2FNP A;  4AIK A;  1T39 A;  2BYV E;  2CV2 A;  2GXA A;  4ZZD A;  3KEQ A;  2DTR A;  5D5U B;  2RC4 A;  4B09 A;  2XIG A;  4XOT A;  3OYN A;  4D1Q A;  3I71 A;  3ZPL A;  1TBX A;  1ZAR A;  2XGE A;  5J4V A;  3S3N A;  4NHJ A;  4XLF A;  1IXR C;  1ONV A;  4QPO A;  3ABT A;  2QCO A;  3SXY A;  1A35 A;  1NK3 P;  2HQR A;  4GGG A;  3H9G A;  3LFK A;  3BR1 A;  2MD5 A;  5E17 F;  1MMN A;  2BE5 F;  1T08 B;  2OZ6 A;  1YW9 A;  4ZJZ A;  3SZG A;  3J7A O;  5F6F A;  3QRF F;  4XOR A;  1EV7 A;  2LP0 A;  1BC7 C;  1AKH B;  3QP6 A;  3ZP5 A;  3ZQC A;  3AL0 B;  1YOV B;  2CQQ A;  3K2Z A;  4O5V A;  4XK4 A;  2WAQ N;  2HXI A;  3DKY A;  1UHW A;  1KYW A;  3U1K A;  4W1U A;  2AO9 A;  4A6D A;  2RVC A;  2KZV A;  5FLM J;  3RPU D;  1SD7 A;  3AG4 H;  2V1U A;  2GA1 A;  3IRQ A;  2BW3 B;  1AOY A;  1XC5 A;  3TW6 A;  3I55 I;  1AWC A;  1IUY A;  5IT9 Z;  1B1B A;  2WTE A;  1YQA A;  2L7Z A;  5HS7 A;  1FOX A;  3KE2 A;  1MGT A;  2QSG X;  1APL C;  1UAA A;  3FXM A;  3BZK A;  3RJP A;  1RKW A;  4EV0 A;  2E5Z A;  4RDU A;  3QYE A;  2MYS A;  3IUO A;  1H89 C;  4XSX F;  5M5X J;  2Y0M A;  3BR6 A;  4EM0 B;  1XMX A;  1WI9 A;  4RM2 A;  4KMU X;  3GCM A;  2HVQ A;  5J1U A;  3QU6 A;  5LGU A;  2EFN A;  4B3A A;  2STT A;  3RKW A;  4A3B J;  4MGR A;  4M72 A;  1S9H A;  3W6J B;  3LSM A;  4BBR J;  4C30 A;  4IRG A;  1RES A;  5FFZ A;  4L0Z B;  2DMT A;  2HZD A;  3M1E A;  1R6R A;  5ILU A;  4BAY A;  1XSX A;  3TP3 A;  3DP7 A;  3SFI A;  4G7Z F;  4YFN F;  2WY8 Q;  2QEN A;  2WV0 A;  2ME0 A;  2VC0 A;  3LSR A;  2Z5U A;  1RUO A;  4H4K C;  2I10 A;  4BJ6 C;  4C3I J;  1XSV A;  1R1U A;  2LLK A;  2BY0 A;  1WVR A;  1O7L A;  1W4M A;  3L2C A;  5FB2 A;  2QM3 A;  3ZOB A;  2V1X A;  3V42 A;  1U78 A;  2XAQ A;  2DPD A;  5DV5 A;  3GTL J;  4XM3 A;  4IHT A;  2K7L A;  1ETQ A;  2W82 A;  4CO8 A;  1MMD A;  1YTY A;  2FNA A;  1W5T A;  2AS5 F;  2BBY A;  1N75 A;  3W2V A;  2E35 A;  2UV1 A;  1LFP A;  4AD9 A;  2R7D A;  2P6T A;  2XSJ C;  2H8R A;  2I8D A;  1P9Q C;  5A2Q Z;  3PUB A;  5F1J A;  3HRS A;  4CCL A;  1X19 A;  4XIC A;  3BTC A;  1YFH A;  1YYV A;  4RA2 A;  5HNF A;  3JRG A;  5H6Q A;  2NXN B;  4IXA A;  2DO7 A;  5AIP A;  4BEH B;  2HVS A;  4ESB A;  1OCT C;  3K0L A;  3MZY A;  3ZRG A;  2PN6 A;  2HYF A;  1ZKG A;  1MSE C;  1YX5 A;  4BXU A;  4XON A;  2A6E F;  1H8A C;  4E7L A;  3I64 A;  3GF2 A;  5FKM A;  4NNJ A;  4BE1 A;  4C2M J;  2W24 A;  2KKO A;  2EK5 A;  4KT6 A;  1EJ9 A;  1TL8 A;  3MKL A;  1FEX A;  2ZJ2 A;  2MH2 A;  2FOW A;  2LBF A;  3WTY C;  1XSD A;  3ERM A;  4EM2 A;  3X2Q H;  2HNH A;  5LGT A;  1YO5 C;  2R0Q C;  5JFR A;  2AHQ A;  1R1V A;  2DFE A;  2IJL A;  3S32 A;  4JP0 A;  2EFW A;  4KIT B;  1JKR C;  1KQ9 A;  2L9R A;  3HPH A;  1MH3 A;  2MFZ A;  2V9P A;  3BG3 A;  4LMY A;  3FIW A;  3JW4 A;  1FMW A;  1UHS A;  3DU6 A;  1Z67 A;  3K4C A;  4BHC A;  3HGG A;  3CMY A;  2ESH A;  2OUM A;  4ZYH A;  4CYD A;  1DQU A;  2OV7 A;  4L18 B;  1J0R A;  1D1C A;  2XKP A;  2MA3 A;  3D5L A;  3I0T A;  1D8K A;  1MH4 A;  3S8P A;  2KP6 A;  4IL6 C;  1DDN A;  2K3F A;  2K86 A;  5HLH A;  3T8T A;  1T95 A;  2P7C B;  5B3S H;  4G7H F;  4FT8 A;  5DDG A;  4GYI A;  2JA6 J;  2IEK A;  2ZME B;  1A04 A;  5LBQ A;  2XV4 S;  1LB2 A;  1QZE A;  3CLQ A;  5E3O A;  2DYR H;  4ITV A;  3CES A;  3EUH A;  2UXX A;  1JE8 A;  1I6H J;  3KYC B;  3MFK A;  2LRD A;  4J19 A;  2LF7 A;  5HDK A;  2VON A;  2YR2 A;  4WWC A;  1IGN A;  5DS9 A;  5FKO A;  3LOC A;  3LQQ A;  5J1Y A;  3TL4 X;  1P4X A;  1SMY F;  2ZCW A;  1RI7 A;  5IOY A;  1VF9 A;  4BNC A;  1OIS A;  4D0P A;  1RR7 A;  4IO9 F;  2KDO A;  3WGG A;  2JVH A;  1FTT A;  1MBJ A;  5F0H A;  4V2G A;  1G3W A;  3S17 J;  3WTT C;  3BWG A;  3M07 A;  2W1O A;  2EQR A;  1T38 A;  4YII A;  4HOB A;  2HEO A;  4KT5 C;  2PI0 A;  2Y69 H;  1MBF A;  4MNU A;  2XAF A;  1KU7 A;  1A6Q A;  3L2R A;  1KQ0 A;  3R61 A;  1QGP A;  1KU9 A;  3KZZ A;  3PO2 J;  1A36 A;  2IRF G;  2GQQ A;  3ULQ B;  1Z9C A;  3QPT A;  3MZ8 A;  2O5R A;  4FQG A;  4F3Q A;  3MKZ A;  4EQQ A;  2E1M C;  1ETY A;  1ZAO A;  5CYV A;  1W5C C;  2JRM A;  3PSF A;  1FYK A;  1B9N A;  4LD5 A;  4E6K G;  2CO5 A;  1CF7 A;  2D45 A;  3W6V A;  4U87 A;  4HSR A;  2R7F A;  3FM5 A;  1RIO H;  1R23 A;  3CCL I;  4C3H J;  4MQV A;  1SVO A;  5C3E J;  1S7E A;  3GTQ J;  1YW7 A;  5EGO A;  1PUF A;  3BC8 A;  2VUM J;  5EDN A;  5F64 A;  3CCU I;  2VQG A;  5BQT A;  1G4D A;  2M4K A;  5DCM B;  4O3M A;  1Y39 A;  2PMZ A;  3HDD A;  3H9J A;  2ADU A;  4LG0 B;  1W7P B;  3ELK A;  2EPF A;  1B6A A;  1JI8 A;  5IT3 A;  1FC3 A;  1ZN2 A;  1BW5 A;  1IG7 A;  2QSH X;  3HUG B;  3E97 A;  2HOT A;  3MKY B;  3H3U A;  2H09 A;  1MZB A;  3BJA A;  4L0Y B;  4RB2 C;  2XAS A;  3H3Z A;  2KIM A;  3JCU C;  1ERD A;  2ZXI A;  1XX5 A;  3GFI A;  2V6E A;  3EPZ A;  3S93 A;  3G2B A;  1ZH5 A;  2ZXW H;  2BEO A;  5L3E A;  3PFI A;  4KIG A;  5KNL A;  3DFG A;  2FMY A;  5CQE A;  1ZLK A;  2LYC A;  2WBM A;  1GVJ A;  3HGY A;  4UUS B;  3C2B A;  5AIQ A;  4BE0 A;  4A0Z A;  1VQP I;  2LKS A;  2KIQ A;  3U2R A;  1BBY A;  1WJA A;  1C0W A;  2O0Y A;  2NVX J;  1IRG A;  2DA5 A;  3ZR8 X;  2LNB A;  3HM5 A;  3S1Q J;  2ZKZ A;  5DD4 A;  3DEU A;  3GUD A;  5DM7 F;  2K9M A;  1XDS A;  2OA4 A;  2ID3 A;  3M4O J;  1O3S A;  5D8K B;  5DTD A;  1BOB A;  4BYY A;  4CIC A;  3OR1 C;  4LLN A;  5CVI A;  3LSG A;  2ZC2 A;  2EH3 A;  1GV2 A;  1LDJ A;  2M30 A;  1J7K A;  3JRD A;  2DQR A;  1GXQ A;  2RGV A;  2G9W A;  2L5Q A;  3UKG A;  2A69 F;  2XPW A;  2E7W A;  3ISP A;  2M3A A;  4F55 A;  4IJA A;  1A6I A;  2COB A;  4KIS A;  3RZO J;  1QZZ A;  1IZ1 A;  2R5Y B;  1R9T J;  1F36 A;  5HOD A;  4W97 A;  2W57 A;  4J00 A;  2O6G E;  3CCV I;  2E7X A;  3VOE A;  3A0B C;  4DZP A;  2Y9Y A;  4MTE A;  3OIO A;  1BI1 A;  2XC7 A;  3FF5 A;  4A3E J;  5EEA A;  5C44 J;  4FAS D;  4BL0 B;  3N4M A;  2FBI A;  3S3O A;  1EH8 A;  2LY9 A;  2IGN A;  4EJO A;  2V4J C;  2MSY A;  4OIR F;  3L2V A;  2DMP A;  4HYE A;  2ZBK A;  3JRI A;  2RN7 A;  2N8G A;  4YFX F;  5CJ9 A;  2ZJR F;  2FEZ A;  4CA0 A;  4IF4 A;  2JPC A;  4EJU A;  3C18 A;  2X1D A;  2CUF A;  1HW2 A;  2HTJ A;  4XRM A;  3P5J A;  4H0E A;  1BI2 A;  2GXB A;  3BQZ A;  2L54 A;  1V54 H;  2HKX A;  3HOS A;  4DQ2 A;  3R0A A;  2M2E A;  2Z33 A;  2LKX A;  3CUQ A;  5JVT A;  1V5G A;  2ELJ A;  2Z16 A; 
#chains in the Genus database with same CATH homology
 1YLF A;  1GHC A;  1R36 A;  1QQI A;  2P8T A;  4RB0 A;  2X4H A;  3DF8 A;  4P9U A;  4UV8 A;  5CVR A;  3HYI A;  1KU2 A;  3E6D A;  2OQG A;  3FMQ A;  3DKW A;  3JSO A;  2ELH A;  3F8F A;  1TW3 A;  3GFM A;  3F3X A;  2HWV A;  2EV0 A;  3M7G A;  1HSJ A;  5CLS A;  4NB5 A;  3V7S A;  4QLC U;  1J9I A;  2FF4 A;  3CTA A;  3U1D A;  1OMI A;  3J81 Z;  2HDC A;  1J75 A;  5KVR A;  2NS0 A;  4HF0 A;  4LLL A;  5DEQ A;  3KLN A;  2ACJ A;  2HQN A;  3MQ0 A;  4ENJ A;  3ZMU A;  2EA2 A;  3SQN A;  4K2E A;  3LA7 A;  3DV8 A;  3BRO A;  2TDX A;  5LHI A;  4L9V A;  3G73 A;  2NNN A;  4WXD A;  4EJW A;  2UXN A;  2EJR A;  4UVC A;  5FFX A;  3WTZ A;  4AVP A;  3COA C;  4L9T A;  3RTR A;  5D5V B;  5LHH A;  4MEY F;  3KZY A;  4PCQ A;  3LST A;  2F5F A;  4GO1 A;  1ZG3 A;  4EJT A;  3DXJ F;  2CFX A;  5E8G A;  4PGG A;  3RPU A;  1SD6 A;  4P5O A;  2PQ8 A;  4I01 A;  2EFO A;  3WTU C;  4ENN A;  5JHU A;  2K4B A;  2KJC A;  1USS A;  4I7H A;  1XN7 A;  2FQ3 A;  4KDP A;  4L5J A;  4EM1 A;  1G6N A;  3IKT A;  1IW7 F;  3T5X A;  4HQM A;  3K69 A;  2FBH A;  2MBF A;  1R5G A;  3HOT A;  3O2P E;  3TO6 A;  3JAM K;  5LEK A;  5ILS A;  1IAW A;  3FXQ A;  2P7V B;  3F22 A;  1G3T A;  1U3E M;  2QQB A;  4M6X A;  2LSO A;  3WU0 A;  1MDM A;  1E2X A;  5LEJ A;  2ZXJ A;  1BC8 C;  2VE9 A;  2XAG A;  3VB2 A;  3HTU A;  1KA8 A;  3MEX A;  4HV6 A;  1I27 A;  3NQO A;  1P2F A;  2IP2 A;  2RDP A;  4GCV A;  4A5N A;  4OIP F;  2F2E A;  5J8F A;  3EYY A;  1TQP A;  4R79 A;  2CWE A;  1LEB A;  3Q5F A;  2V1D A;  5K5O A;  3F8M A;  3ZQ7 A;  5TRD A;  3FMR A;  1JXS A;  5ERI A;  5ILV A;  2O03 A;  3JTG A;  2XGX A;  3GWZ A;  2XVC A;  3GEZ A;  3QOP A;  2MH9 A;  3L09 A;  4LB6 B;  3F23 A;  1JHF A;  4M6Y A;  2XAJ A;  2PMH A;  4OU0 A;  1SFX A;  2DBB A;  1DUX C;  1TQM A;  4KMF A;  3CO6 C;  1F9N A;  4UVA A;  3HSE A;  2EV5 A;  1LDD A;  3HTS B;  2HS5 A;  3REO A;  2CQK A;  2YPR A;  2M45 A;  4MEX F;  3GX4 X;  2RV8 A;  2ESN A;  2O3F A;  2WWY A;  5HS8 A;  3CUQ C;  3GFL A;  1WKM A;  1TNT A;  4ESF A;  4KN7 X;  3FZV A;  1J5Y A;  1EH7 A;  1TLH B;  2UWM A;  3T8R A;  3IHU A;  2GA2 A;  3P9K A;  2OBP A;  1Z6R A;  3P7N A;  1B59 A;  4I0A A;  1IF1 A;  5DYM A;  3KET A;  3TO7 A;  4WXC A;  2A3S A;  4XLP F;  1QBJ A;  1OR7 A;  4LJZ F;  4UXN A;  3RPQ A;  3F6V A;  2CG4 A;  1KQ8 A;  2NYX A;  1IN7 A;  5E20 A;  1S29 A;  2NNY A;  2R3S A;  1U8R A;  2EB7 A;  4I0B A;  3QAH A;  2D1H A;  3GZ5 A;  4P9F A;  3O3K A;  4RAZ A;  4U0Y A;  3HRT A;  3QPH A;  1ZLJ A;  3FXU A;  1P4W A;  2YX4 A;  5DUK A;  2FSW A;  4CGZ A;  3GW2 A;  3EQL F;  1REP C;  1ZRE A;  1TQI A;  5HS9 A;  4GXO A;  5LRS A;  1K78 B;  1SD5 A;  4Y13 A;  2M8E A;  3FHZ A;  5HOO A;  1K6O A;  4RGX A;  3E6M A;  1XCB A;  1R1T A;  5L3C A;  3RIR A;  2ZO4 A;  1U5T A;  1KGS A;  3ZMD A;  3R60 A;  4LFU A;  3RKX A;  3GLX A;  1G3Y A;  4JK1 X;  2XHK A;  3F8B A;  3TO9 A;  5FLX K;  1FOK A;  3N97 A;  1FLI A;  2COM A;  2FML A;  3R4K A;  4U0W A;  4OIN F;  2QYO A;  2XKO A;  3DPL C;  3OOP A;  2VBW A;  4HDV A;  3ML6 A;  4A12 A;  2LF8 A;  3KLO A;  1ZRC A;  4KIB A;  4I02 A;  3TGN A;  1FPQ A;  2IA1 A;  3I4P A;  2M87 A;  3BJ6 A;  3J81 K;  3J80 Z;  2PFB A;  1V4R A;  6PAX A;  2MC3 A;  2KJB A;  4WXH A;  4KN4 X;  1JGS A;  1PDN C;  1MD0 A;  5FO5 A;  1ULY A;  5D5X B;  5DCM A;  1FY7 A;  1QO0 D;  2Y75 A;  2VOO A;  1J59 A;  3HUG A;  2VOP A;  4HQE A;  2H6C A;  1FP2 A;  1IN4 A;  4HX8 A;  1WQ2 A;  1FBQ A;  4G6Q A;  2EWN A;  3I54 A;  1XDU A;  2A6H F;  3F72 A;  1QPM A;  4A6E A;  4I09 A;  1HQC A;  1FBS A;  1FNN A;  3B02 A;  2A5Y B;  1H9T A;  3V4G A;  3WOD F;  1XMA A;  3F21 A;  2DK8 A;  5H6R A;  1F1Z A;  3Q9S A;  3ABU A;  5F1R A;  5HLG A;  3QP5 A;  2XRO A;  1WWX A;  1TW2 A;  5J8C A;  4UNO A;  2J5O A;  2IA0 A;  1D5V A;  3WU1 B;  1LVA A;  1IN6 A;  2PMU A;  1YW8 A;  3IC7 A;  3MAJ A;  2F5D A;  2HZT A;  1LEA A;  4KIF A;  2G7H A;  3P9C A;  4B8X A;  3U9G A;  1R7J A;  1I5Z A;  3CO7 C;  1CF7 B;  2VBZ A;  2O8X A;  2FE3 A;  2YSR A;  4L9N A;  1Z05 A;  4MQ9 F;  1XMK A;  4AIJ A;  4M9X A;  1KU3 A;  4RGS A;  1O3R A;  1K7A A;  1FSE A;  3PQJ A;  3KEO A;  1W7P D;  3BPV A;  2L3D A;  2VOD A;  1Z1D A;  2IW5 A;  2XAH A;  1B4A A;  3SZP A;  5EEG A;  4BH9 A;  4U0V A;  2H94 A;  5HVQ C;  2L01 A;  3CLO A;  3LA2 A;  3WGI A;  2M1B A;  1XB4 A;  4BHP A;  5FD5 A;  5FGM A;  2VBY A;  1ZYR F;  1U5T C;  2V79 A;  3M8E A;  1LNW A;  5IT9 K;  3PQK A;  3FMS A;  1LJ9 A;  1DP7 P;  1O57 A;  2YU3 A;  3VOD A;  1MJA A;  4MTD A;  4A0Y A;  4YFK F;  1K79 A;  2K4J A;  4M74 A;  4OIQ F;  2H27 A;  1ZGA A;  4A2U A;  2DPU A;  1HW1 A;  1ZGJ A;  2HYG D;  4RGU A;  2RNJ A;  2L4M A;  4RAY A;  2CYY A;  2JPB A;  5E1W A;  4G94 A;  4LK1 F;  4HX7 A;  3W6K B;  1SAX A;  3SFZ A;  1I1G A;  1S3J A;  2HOE A;  2QQA A;  3I59 B;  3CUQ B;  2W84 A;  2CW0 F;  4HF1 A;  1KYZ A;  2EV6 A;  3KP2 A;  2P5V A;  3F6O A;  1HXD A;  4R8H A;  2FXA A;  3G3Z A;  5ICG A;  2Z9O A;  1T2K A;  2P4W A;  1MKM A;  2HTS A;  1TNS A;  1I1S A;  5A2Q K;  2FOK A;  4RS8 A;  3C7J A;  3EET A;  1QNT A;  1U6G A;  2H6B A;  3I58 A;  2RKH A;  3BZ6 A;  4AWX B;  2GIV A;  2IVM A;  4DNC A;  2GZW A;  2OZU A;  1BIA A;  4LGW A;  3GVA A;  1FP1 D;  2DW4 A;  5D8L B;  5BPD A;  2BGC A;  2QBY A;  3IKV A;  4HZF A;  4IPA A;  4G6D A;  3R0J A;  4P96 A;  4WX9 A;  2ZFW A;  3CJN A;  1XGS A;  4F7Z A;  2QQ9 A;  3L9F A;  4RB1 A;  2W85 A;  2V9V A;  3ZMV A;  5D5W B;  4EJV A;  1PP7 U;  2L4A A;  3JSP A;  2STW A;  2PG4 A;  1RUN A;  1T98 A;  2HFH A;  2OAZ A;  1HKS A;  2G7U A;  4ETS A;  4WCG A;  5HDG A;  1CGP A;  1U2W A;  2QZ8 A;  3BY6 A;  4MHG A;  5E1Z B;  1IRF A;  2F5C A;  3E6B A;  5L3D A;  2FU4 A;  1BI3 A;  3TKY A;  2B0L A;  4G7O F;  2YX7 A;  5K1Y A;  2PBI A;  2AXL A;  3ZMS A;  4OIO F;  3TOB A;  2VXZ A;  1SFU A;  2DK5 A;  2PLY A;  1XGN A;  4HA8 A;  4Q47 A;  3DQV C;  1WRJ A;  3C1D A;  2LDU A;  4WF2 A;  4N0B A;  2MLG A;  1UCR A;  2BV6 A;  1ZHF A;  3LAJ A;  1V3F A;  4Y15 A;  1Z6T A;  1T0F A;  4QWQ A;  1Q1H A;  4L5I A;  5LRR A;  1MDM B;  4KFC A;  1P4A A;  4KA4 A;  2Q2E A;  5E1X A;  2VN2 A;  4LLG F;  2UZK A;  3WTX C;  4OMY A;  3T0Y A;  1T6S A;  5EEH A;  2RQP A;  3ECH A;  3I53 A;  4EVI A;  4U7D A;  1J2X A;  1S7A A;  4ASN A;  3R6S A;  1VTN C;  1G3S A;  4JBA A;  2HGC A;  4Q5S F;  4E70 A;  1P92 A;  1BOA A;  5D4S A;  3KP7 A;  2QWW A;  1IXS B;  4UV9 A;  1DPU A;  5ICC A;  1O3T A;  3ZMT A;  2HKO A;  3I5U A;  4UHT A;  5KK1 A;  3RDI A;  1K78 A;  3TDZ C;  4AIH A;  1F5T A;  5K5R A;  2FA5 A;  2FBK A;  2IT0 A;  1FT9 A;  1F4K A;  1RZ4 A;  3BJO A;  2ZNY A;  2JSC A;  3GO5 A;  2EFQ A;  2K27 A;  4RGR A;  5TJJ A;  4IRI A;  5ICF A;  2X0L A;  3BPX A;  2EFP A;  1UHM A;  1Z7U A;  4OMZ A;  1L0O C;  4HX4 A;  3WE3 A;  1ZRD A;  4CDG A;  2PJP A;  2JZY A;  5H20 A;  1L3L A;  2KIU A;  1HBX G;  2ZME A;  5HLI A;  3OV8 A;  2LKP A;  3EDP A;  4L9J A;  3WTV C;  1YS6 A;  1H9G A;  3S2W A;  3KFW X;  4M73 A;  2EA4 A;  4S05 A;  2A61 A;  3KP6 A;  1PUE E;  3IWZ A;  3JTH A;  1NHA A;  4ON0 A;  5DD8 A;  1X3U A;  3HRM A;  1OYY A;  3ECO A;  4LK0 F;  2D1V A;  1ZG5 A;  4HDU A;  3RI4 A;  3KP4 A;  3M8F A;  1S6L A;  2A07 F;  2ISZ A;  4U88 A;  2DFI A;  2E1N A;  5K5Q A;  4WK8 F;  4TV7 A;  3VFZ A;  5CVJ A;  2J5P A;  4JQF A;  4EGZ A;  2FRH A;  5BOX A;  3JAM Z;  1R58 A;  1R22 A;  2KIF A;  2QVO A;  1I6X A;  1ODD A;  2E1C A;  5LLQ A;  4HBL A;  3ERE D;  2M5W A;  1U5T B;  4G8X A;  2ISY A;  3GFJ A;  4LG0 A;  1W7P A;  3WGH A;  2Q0O A;  2V6C A;  2NAZ A;  4UVB A;  5BS6 A;  3P9I A;  4Y17 A;  1IXC A;  4ZH4 F;  2DU9 A;  1FBU A;  3FWE A;  1HST A;  1SMT A;  2Z99 A;  3NEU A;  3EYI A;  2O61 A;  4PDK A;  4Q48 A;  2GAU A;  2OD5 A;  2WC2 A;  4IVN A;  4O6J A;  3E3V A;  4ZYG A;  1UB9 A;  4YG2 F;  2P5K A;  1UST A;  3AAF A;  2XUB A;  2Z3Y A;  4XLN F;  4S04 A;  1FYM A;  5ED4 A;  2W25 A;  1XCV A;  1R5H A;  2DQL A;  3D0S A;  4A5M A;  1S8N A;  3ROU A;  1D8J A;  2QUF A;  4IRH A;  5DCF A;  3V7R A;  2QLZ A;  5CVU A;  1WSU A;  1ON1 A;  5ICE A;  3E6C C;  3GYH X;  4OOI A;  5LGN A;  2IPQ X;  4XRF A;  1MJB A;  3LA3 A;  1YS7 A;  1R00 A;  3C3W A;  2VT2 A;  1MJ9 A;  1HKT A;  4EMS A;  3QU3 A;  2DLL A;  3E5Q A;  2P5L C;  2DAO A;  1HKQ A;  2VBX A;  2NRA C;  5L3B A;  1BIB A;  1RNL A;  1XGM A;  1H0M A;  3FX3 A;  1LQ1 A;  3ZMZ A;  3M9A A;  2HR3 A;  3BP8 A;  2OU2 A;  3CUO A;  3WE2 A;  1D3Y A;  4PGH A;  1OYI A;  1OKR A;  5LHG A;  3BDD A;  3IL2 A;  2K02 A;  4GYG A;  1OYW A;  4LB5 A;  1PP8 F;  2F5E A;  4ZYD A;  5J6X A;  1ZRF A;  1BI0 A;  3B73 A;  1EH6 A;  4HLX A;  2VT3 A;  3RYP A;  3LAP A;  3HIF A;  2VE8 A;  3O6B B;  3IRR A;  2JRT A;  3LWF A;  1UFM A;  3ZN1 A;  4CHU A;  5L3G A;  3KP5 A;  3K1P A;  2C6Y A;  4UUV A;  3L7W A;  5D4R A;  1IN5 A;  1B9M A;  1SFE A;  4I2O A;  4M9Z A;  3E5U A;  4KIC A;  2CGP A;  3V8L A;  3TQN A;  4ZZL A;  1O3Q A;  1FSH A;  1YIO A;  3I59 A;  4CXF A;  2GWR A;  3V8K A;  5FLX Z;  2DI3 A;  3BOQ A;  4HF2 A;  3L00 A;  1SD4 A;  3E5X A;  4KUM A;  1QZY A;  1YG2 A;  5DUI A;  1XGO A;  4G9Y A;  1FZP B;  3IWF A;  4BHB A;  4ENM A;  1Y0U A;  3HHG A;  1FX7 A;  3MCZ A;  4R1H A;  4NQW A;  3KCC A;  3NRV A;  3HSR A;  2CSO A;  4FHT A;  3KP3 A;  4KNY A;  2Y48 A;  2A68 F;  4Z2Y A;  3V7C A;  2XRN A;  4RB3 C;  3Q9V A;  1ZG1 A;  5BMZ A;  3CDH A;  1IN8 A;  4I98 B;  3HSF A;  4YIF A;  1BM9 A;  3WG9 A;  2PEX A;  3GXO A;  5HDN A;  4IHS A;  4KYW A;  4EGY A;  1OPC A;  4HAM A;  3ZN0 A;  4CZZ A;  2L02 A;  3RYR A;  2D2W A;  2KRF A;  3K1N A;  1LDK B;  5D6E A;  1STZ A;  4HLY A;  3T1B A;  2VC1 A;  3F8N A;  1S7O A;  4PZJ A;  4BQA A;  2DT5 A;  2JT1 A;  2GXG A;  4XSZ F;  5L3F A;  4ENK A;  4FX0 A;  3F8C A;  5JR3 A;  1XD7 A;  1FWZ A;  3H92 A;  3TDU C;  5CVV A;  3TOA A;  3MZH A;  1JHH A;  3MWM A;  4ESJ A;  1ON2 A;  3SZT A;  4U7B A;  4Q4Z F;  2IA2 A;  1P6R A;  4XBF A;  4FX4 A;  5D6F A;  3GZ6 A;  2Q8K A;  3K9T A;  4N9H A;  1FYL A;  1BJA A;  3VEP A;  4HW0 A;  1E17 A;  3WTW C;  5BPI A;  2OQR A;  4HV5 A;  4ZYE A;  3J80 K;  2ETH A;  3WTS C;  1W5S A;  4N9I A;  1DPR A;  3V8J A;  5AON A;  5E18 F;  5FD6 A;  2QBY B;  3RKY A;  5JI6 A;  3LQR A;  1Z91 A;  2P6S A;  2JTV A;  4M9S A;  2MLK A;  5E8I A;  4M71 A;  1BN5 A;  4A0X A;  3FXR A;  3DPT A;  2ZNZ A;  3HHH A;  3K1M A;  1GXP A;  1HW5 A;  3SHF A;  4P55 A;  3HRU A;  1O7F A;  1TTY A;  3FM3 A;  2FNP A;  4AIK A;  1T39 A;  2BYV E;  4ZZD A;  3KEQ A;  2DTR A;  5D5U B;  2RC4 A;  4B09 A;  2XIG A;  3I71 A;  3ZPL A;  1TBX A;  1ZAR A;  4NHJ A;  1IXR C;  1ONV A;  3ABT A;  3SXY A;  2HQR A;  4GGG A;  3LFK A;  2MD5 A;  5E17 F;  2BE5 F;  2OZ6 A;  1YW9 A;  3J7A O;  5F6F A;  3QRF F;  1EV7 A;  1BC7 C;  3QP6 A;  3ZP5 A;  3K2Z A;  4O5V A;  1UHW A;  1KYW A;  4A6D A;  2RVC A;  1SD7 A;  2V1U A;  2GA1 A;  3IRQ A;  1AOY A;  1AWC A;  1IUY A;  5IT9 Z;  1B1B A;  2WTE A;  1YQA A;  5HS7 A;  3KE2 A;  1MGT A;  3RJP A;  4EV0 A;  4XSX F;  2Y0M A;  4EM0 B;  1WI9 A;  4KMU X;  3QU6 A;  5LGU A;  2EFN A;  2STT A;  3RKW A;  4MGR A;  4M72 A;  3W6J B;  4IRG A;  5FFZ A;  4L0Z B;  3M1E A;  5ILU A;  4BAY A;  1XSX A;  3DP7 A;  4G7Z F;  4YFN F;  2QEN A;  2WV0 A;  2VC0 A;  2Z5U A;  1RUO A;  1XSV A;  1R1U A;  1O7L A;  1W4M A;  3L2C A;  5FB2 A;  2QM3 A;  2V1X A;  1U78 A;  2XAQ A;  2DPD A;  5DV5 A;  4IHT A;  2K7L A;  4CO8 A;  1YTY A;  2FNA A;  1W5T A;  2AS5 F;  2BBY A;  4AD9 A;  2R7D A;  2P6T A;  5A2Q Z;  3HRS A;  1YFH A;  1YYV A;  5H6Q A;  4IXA A;  2DO7 A;  5AIP A;  4ESB A;  3K0L A;  3MZY A;  2PN6 A;  2HYF A;  4BXU A;  2A6E F;  3I64 A;  3GF2 A;  2W24 A;  2KKO A;  2EK5 A;  2ZJ2 A;  2MH2 A;  3WTY C;  1XSD A;  4EM2 A;  5LGT A;  1YO5 C;  5JFR A;  1R1V A;  2IJL A;  2EFW A;  1KQ9 A;  4LMY A;  3JW4 A;  4BHC A;  2ESH A;  4ZYH A;  4CYD A;  4L18 B;  1J0R A;  2XKP A;  2MA3 A;  3D5L A;  3I0T A;  1D8K A;  1DDN A;  2K86 A;  5HLH A;  3T8T A;  2P7C B;  4G7H F;  4FT8 A;  5DDG A;  4GYI A;  2ZME B;  1A04 A;  5LBQ A;  2XV4 S;  1LB2 A;  3EUH A;  2UXX A;  1JE8 A;  3MFK A;  2LF7 A;  5HDK A;  2VON A;  2YR2 A;  4WWC A;  3LQQ A;  1P4X A;  1SMY F;  2ZCW A;  1RI7 A;  4BNC A;  4D0P A;  3WGG A;  1G3W A;  3WTT C;  3BWG A;  1T38 A;  4YII A;  4HOB A;  2HEO A;  4KT5 C;  2PI0 A;  4MNU A;  2XAF A;  1KU7 A;  1KQ0 A;  3R61 A;  1QGP A;  1KU9 A;  3KZZ A;  2IRF G;  2GQQ A;  3ULQ B;  1Z9C A;  3QPT A;  4EQQ A;  1ZAO A;  5CYV A;  1FYK A;  1B9N A;  4LD5 A;  2CO5 A;  1CF7 A;  2D45 A;  1RIO H;  2R7F A;  3FM5 A;  1R23 A;  4MQV A;  1YW7 A;  5F64 A;  5BQT A;  1G4D A;  5DCM B;  4O3M A;  2ADU A;  4LG0 B;  1W7P B;  3ELK A;  1B6A A;  5IT3 A;  1FC3 A;  1ZN2 A;  3E97 A;  3H3U A;  2H09 A;  1MZB A;  3BJA A;  4L0Y B;  4RB2 C;  2XAS A;  3H3Z A;  2KIM A;  3GFI A;  1ZH5 A;  5L3E A;  2BEO A;  3PFI A;  4KIG A;  3DFG A;  2FMY A;  1ZLK A;  1GVJ A;  5AIQ A;  4A0Z A;  3U2R A;  1BBY A;  1C0W A;  1IRG A;  2O0Y A;  2LNB A;  2ZKZ A;  5DD4 A;  3DEU A;  3GUD A;  1XDS A;  2OA4 A;  1O3S A;  5D8K B;  4BYY A;  4CIC A;  4LLN A;  5CVI A;  1LDJ A;  2M30 A;  1J7K A;  2DQR A;  1GXQ A;  2G9W A;  2RGV A;  2A69 F;  2E7W A;  3ISP A;  4IJA A;  1QZZ A;  1IZ1 A;  2W57 A;  2O6G E;  2E7X A;  3VOE A;  4MTE A;  1BI1 A;  3FF5 A;  3N4M A;  2FBI A;  1EH8 A;  4EJO A;  4OIR F;  4HYE A;  2ZBK A;  2RN7 A;  4YFX F;  5CJ9 A;  2FEZ A;  4IF4 A;  2JPC A;  4EJU A;  3C18 A;  1HW2 A;  2HTJ A;  4H0E A;  1BI2 A;  2GXB A;  2L54 A;  2HKX A;  3HOS A;  4DQ2 A;  3R0A A;  2Z33 A;  3CUQ A;  5JVT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...