2NVQJ

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription,transferase/dna-rna hybrid
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvqJ00
1JKPC 1E3OC 9ANTA 1AKHB 2DMTA 3G1LA 3BG9A 1MBEA 2X9DA 3LSRA 2ID6A 5EF6A 4C3HJ 4IHXA 2DA1A 1G2HA 2QF7A 2W48A 2XGCA 3BR1A 3JRBA 5J1UA 1JT0A 4L5EA 1FIPA 5FKLA 3LNQA 2HOTA 4EEFG 2DA7A 1B8IA 4JX5A 3VPRA 5IPAA 3IH3A 2IAIA 4DYQA 1JTXA 2MG4A 4A3MJ 4BBSJ 3I4MJ 2EBIA 1ZK8A 4D7NA 3JRFA 3SFIA 5K7HA 1T33A 3HBLA 1PUFB 3JREA 5M5YJ 5FKMA 4V2FA 4DYCA 1QRYA 2HDDA 3QPLA 5M5WJ 2ECCA 2VKEA 4BXXJ 4FE7A 3FIWA 4BY1J 2AO9A 2E2IJ 1TWGJ 1LFUP 2DMNA 5F0CA 1JKQC 2M9HA 1R9TJ 1K61A 2EZKA 2Y9ZA 4W97A 2EH3A 3BR0A 2LK2A 3GTOJ 1I50J 4ABZA 4J19A 1U8BA 1JGGA 2ELKA 3JRGA 1NK2P 1VFCA 1ZTRA 2WAQN 2FX0A 4IEJA 3E7LA 4D7MA 2HYJA 5E3OA 4FTHA 1ITYA 3LSGA 4BBRJ 2NVYJ 3K2AA 3HM5A 2L7FP 2DMQA 2XRLA 5C4JJ 1RETA 2CQXA 3HB9A 4UUSA 1Y1VJ 1QVTA 3TW6A 3HOWJ 1RESA 3TW7A 4JX4A 1ORKA 1Y1WJ 2HOSA 3HGYA 1JJ8C 1B72B 2CQQA 1VF9A 1MSEC 2H8RA 3Q0VA 5C4XJ 2MW8A 2LR8A 1FJLA 3CCYA 1APLC 4M6VA 4JP0A 3BTJA 1K83J 1IGNA 1WH7A 2OPTA 1P7IA 2L7MP 4XRSA 1IDYA 5M3MJ 5FJ8J 3ZQHA 4UUSB 5F04A 1EF4A 3TEDA 2VUMJ 1IV6A 1ENHA 2L7ZA 3FK7A 3OOUA 4XRSG 1X2MA 2R5YB 2K9NA 2AHQA 5JLWA 1SFOJ 4C3JJ 4GFBA 1AU7A 1D5YA 4MFDA 1H89C 5J3LA 4A3DJ 2CUFA 2JWTA 1BJZA 1W0TA 3G1OA 3GTJJ 2HQ5A 5FKKA 1IUFA 4BKXA 1ETWA 1WPKA 1GV2A 3SJMA 4D5FA 4DZPA 3CMYA 1ETXA 1JT6A 2DA4A 2ID3A 3IV5A 3Q3SA 3JRCA 2NS8A 2TRTA 2LP0A 1I6HJ 2R92J 2COBA 2R5ZA 4Y7NJ 5FLMJ 3G1MA 1WH5A 5E3LA 1BW6A 2Y0SN 4JYKA 4I6ZA 3ZQLA 1FEXA 1QPIA 1AHDP 1TWAJ 1GDTA 5F0HA 3S14J 5EEAA 4RDUA 4IHWA 1T56A 2XB0X 3GTLJ 2R5ZB 3NAUA 2YU9J 4QIWN 3D1NI 3BR6A 2P81A 2JN6A 4I76A 4X6AJ 5F1JA 3BR5A 1UG2A 2WB1N 4XRMA 1ZGWA 1JTYA 3RKQA 5GP9A 5IYCJ 2VKVA 3S16J 1ETQA 2EZHA 2X48A 2PMZN 2H1KA 4A3IJ 4A3EJ 4IHVA 3GTKJ 2I10A 5E3MA 1B8IB 2CJJA 4A93J 3HEFA 3OSGA 2HXOA 3Q0UA 2M8GX 1O4XA 1VI0A 5J1YA 4NDLA 4A3GJ 2NOGA 1ZR4A 1Z77A 3S2HJ 2LY9A 3OSFA 3JRHA 2KDZA 2JA5J 1P7JA 2NVQJ 1F43A 1RPWA 4V2GA 4JX6A 5IYDJ 2M0CA 3QQAA 3M4OJ 3IH4A 1GV5A 2FQ4A 3K7AJ 2JA6J 1X58A 4DW6A 3GTMJ 1UMQA 1JKOC 1MBKA 2ECBA 3HOYJ 1H88C 1GVDA 3HOUJ 3DEWA 4QSHA 2DMUA 2ZB9A 2LTPA 3ZQCA 3OIOA 2X6OA 4M3BA 1FTTA 3O8GA 1SANA 4M3EA 4A3JJ 4AUXA 1YRNA 1MNMC 3DCFA 5F0FA 2LFBA 1A6IA 1ETVA 2N8GA 4CYCA 1ZR2A 3CDLA 1JUPA 1WGXA 1OFCX 5J1RA 3A02A 1IG7A 2G0EA 4FCYA 1A5JA 2LVSA 2JJ7A 4D5CA 3B6CA 2XPVA 5EGOA 2CRGA 3RQIA 1CQTA 1XC5A 3BT9A 5EG0A 3LSPA 4B4CA 4Y52J 2IEKA 1JKRC 2YS9A 2E1OA 3FKIJ 2R7ZJ 3NARA 4S0HB 4CYCB 2XGEA 1H8AC 2FD5A 2GLOA 2E19A 1Q1VA 3S15J 1F36A 5EDNA 3W6VA 2YUSA 1XG1A 5F08A 2XGDA 5EGOB 3GTPJ 2XPUA 5EG0B 1POGA 2DA6A 2RAEA 1JUMA 2NVTJ 3A01A 1BW5A 3WHBA 4FISA 1QVUA 5IP6A 2D5VA 2JA7J 3PM1A 1RKTA 5EZGA 2HXIA 1FTZA 1HLVA 4A3LJ 1LFBA 3S2DJ 2XSDC 5K7ZA 1DU0A 5E3NA 1LE8A 3BTCA 3BQZA 3HOVJ 1ETOA 5JLXA 4DZJA 3A01B 5GPAA 2VPRA 1JUSA 3BTLA 3JR9A 2DA5A 3BR3A 1BL0A 3LSJA 1HDDC 4FE4A 1U9OA 1TWCJ 2DJNA 5BNGA 3JRDA 1ZQ3P 4AYBN 2JMWA 5M3FJ 2E2HJ 4RBOA 2O8KA 1ETKA 1OCTC 5EYRA 1LE8B 1IC8A 4UUTA 1OCPA 2DMPA 5C44J 3MN2A 3GBGA 4A69C 2WV1A 3CQZJ 4M3GA 1MBJA 4MIMA 1PUFA 2OF7A 2DTZA 5C3EJ 3GTGJ 1TWHJ 1NK3P 2KT0A 3HOXJ 2L0KA 5IYBJ 3BG3A 5HODA 5DTDA 3MVPA 4A3BJ 3IH2A 1IRZA 4G12A 2M2EA 4A3CJ 3S1MJ 3H0GJ 1ETYA 4M3FA 1NTCA 1JJ6C 3GTQJ 4BY7J 1XS9A 2FJ1A 2ME6A 2LLKA 2M34A 2E2JJ 2EZIA 2GBYA 3HKZN 3PO3J 2CU7A 2IBDA 4B3AA 5IOZA 2JK3A 3UKGA 3Q0WA 2LD5A 3ZQGA 3PO2J 5F27A 5M5XJ 1GUUA 1S7EA 5EZHA 3BQYA 1FIAA 2XPWA 1TC3C 5K7FA 4XIDA 3TP0A 5GPCA 2HOAA 2R0QC 2B63J 1MBHA 1WCMJ 2O7OA 3ZQFA 2K40A 3BG5A 3FISA 2L9RA 4W1UA 3M3YJ 1IJWC 1BA5A 2EZLA 2DA2A 4XICA 3L1PA 1B72A 2Y2ZA 3B6AA 2Y30A 1RKWA 3JRAA 1TWFJ 4HNVA 1HDPA 1MBFA 4A3KJ 3FK6A 2DN0A 4B1RA 2NVXJ 4MFEA 3S1RJ 5FKNA 1MSFC 2MSYA 3SDGA 1WI3A 2K9SA 2MGQA 4DYRA 5FLVA 2TCTA 3ZQIA 2VI6A 2LKXA 2R93J 3I4NJ 1X2NA 4C2MJ 5DS9A 2EQRA 1YRNB 3HDDA 4AC0A 4IHYA 1HF0A 1MBGA 2GM4A 2R5YA 1DU6A 2XB5A 1I3QJ 3F0CA 2HI3A 2O9LA 2QCOA 2NS7A 3MKLA 4MO7A 2CUEA 2DA3A 5IP9J 3O8HA 3BR2A 1ZKGA 1MH4A 3A03A 3WHCA 4XK4A 3ZOBA 5FKOA 4QTRA 3RZOJ 1HOMA 1IDZA 3S1QJ 1MH3A 1Z0XA 3BTIA 5IP7J 2ME0A 4A3FJ 1HCRA 5IOYA 2Y9YA 2K9QA 3C2BA 4M3DA 1AKHA 3S1NJ 4MLOA 1UHSA 1VNDA 3TP3A 4X1EA 1OJLA 3LOCA 3S17J 3HGGA 3RZDJ 1GT0C 1RR7A 1W0UA 3JRIA 2Y31A 3HOZJ 3H3VK 4C3IJ 2JA8J 3QPSA 4LOCA 1U9NA 1U78A
chains in the Genus database with same CATH superfamily
2OU2A 4XBFA 3ZMSA 1E3OC 3KZZA 9ANTA 2A3SA 4G6TB 1J7KA 1AKHB 1V5GA 2DMTA 1FSHA 3W2VA 3BZKA 3BG9A 5HDGA 4ZZDA 2HU9A 2X9DA 4HDVA 3KLOA 4C3HJ 4DOZA 2M8EA 4RGRA 2QF7A 3DV8A 3K4CA 3N97A 1XN7A 1JT0A 5DD8A 2IJLA 2VL8A 4BDZA 2DA7A 2IGKA 3EETA 4JX5A 3KX2A 4FX4A 1CF7B 2HNHA 2XIGA 1TTYA 3SHFA 2UXXA 2L4AA 1B1BA 1W7PD 4AWXB 4A3MJ 4NHJA 4FQGA 3I4MJ 1O7LA 2OCCH 4P1WA 2UXNA 1T33A 1HSTA 1BIBA 2EV5A 5E8IA 4ZC3A 3IUOA 4ANJA 4DYCA 2PMHA 2HDDA 2H27A 3O3KA 3QPLA 2A6TA 2Z2SB 3WTWC 3F8BA 4Y3OA 2ECCA 2Z16A 3D5LA 5LHIA 3VEPA 2K5CA 2M9HA 2ZNYA 4W97A 1M1EB 2P5KA 3DBRB 3BR0A 2QBYB 2F5VA 3FWEA 3DKYA 3FMSA 4GCVA 1U8BA 1D8KA 1X1AA 1LUJB 2JT1A 3KYCB 3ZN0A 4FHTA 1ZTRA 3E7LA 4QWQA 3PIPF 2X6XA 2WA0A 2DTRA 4KISA 1R49A 3FKJA 4XN0A 4IJAA 4HV6A 1Z67A 3K2AA 3W3CA 2OA4A 3LFUA 5FGMA 3AG1H 2JPBA 1FP2A 1QVTA 3TW6A 2QLZA 4DBRA 4JX4A 4CDGA 2HOSA 4CSWA 3VFZA 2CQQA 2IS6A 5CVVA 5KVRA 5C4XJ 4YG2F 2MW8A 2XRNA 5ILSA 3DFGA 1ZN2A 2HQRA 1FJLA 2L3DA 4II3A 4MQVA 4HSRA 3BTJA 3T8TA 1WH7A 4XRSA 1KQ8A 2CYYA 5D5XB 2HVSA 2WAFA 1IDYA 2QM3A 3ZQHA 5LGNA 2DOAA 2O03A 3I53A 2WV0A 2DI3A 3FK7A 3OOUA 4L9NA 5BPDA 1ZRFA 2LREA 4C9YA 1SD6A 1P4WA 2EIKH 3I4PA 2R5YB 2K9NA 4OAZA 2OJED 2BXYA 1FOWA 3J81Z 3MQ0A 1W4MA 1AU7A 3K0LA 1FMWA 1HSJA 4S04A 3CCJI 1RR8C 3OYFA 2M4GA 3LA3A 3V42A 1BJZA 2LMDA 2DFFA 2H8WA 2DPUA 3G4SI 2ZXJA 1IUFA 5GTHC 2B9SA 3GF2A 1N78A 1EJ9A 2X51A 5KK1A 3A0HC 1KU3A 1SVLA 2XAQA 5EEHA 2TRTA 2LP0A 3F8FA 1I6HJ 3QYBA 4XLAA 2ZJPF 2GXAA 3G1MA 3TGNA 1FOKA 3KLNA 2F4MB 1BW6A 2Y0SN 3SQNA 4L9TA 1VQPI 2E1MB 3E6CC 5LFAA 5CPRB 3GFJA 2AXLA 1GDTA 1TWAJ 1UB9A 2VXDA 2FOKA 2PI0A 2ELHA 1JGSA 1HQCA 3QU6A 1IN6A 2MBFA 1SFUA 1ZGJA 1X1BA 2XUBA 1U6GA 3GTLJ 3I9V2 2R5ZB 3NAUA 1W5CC 4I0BA 5DD4A 3D1NI 3E1SA 2R7QA 3FX3A 2EFNA 4BJTA 3IKVA 1QBJA 2BGCA 1ZGWA 2VE8A 3QP6A 2OCEA 5GP9A 3M8EA 4HRIA 1T2KA 2EPFA 1ETQA 4RB2C 2EFWA 2R7WA 5H2FC 1SD7A 2EILH 2V9KA 2VE9A 4HSTA 2X48A 3CMEI 2PMZN 2KRHA 3H9QA 1YW8A 2ACJA 2I10A 2V9VA 5E3MA 1W36D 4LK0F 4O5VA 4A6DA 2COMA 4DBQA 1YJNI 2RREA 4A5MA 4HEA2 3FBNB 1HW5A 1VI0A 4EV0A 4YFKF 1QHHD 4A3GJ 2NOGA 5HDNA 1Z77A 2VONA 4RGSA 4L5IA 1FYMA 1D3YA 1TBXA 4M72A 1BC7C 3L7WA 5CVUA 4JX6A 4HLYA 4HX4A 5IYDJ 1USTA 2KRFA 3R0AA 3SDBA 2IXSA 3BJ6A 3K7AJ 2JA6J 4HF1A 3SYTA 3LAPA 1Z6RA 1MMNA 4HBLA 3VYUB 4AD9A 4CH7A 2M5WA 3V7SA 3H1CA 3C1DA 1XDSA 5KHDA 3CO7C 3RIRA 4QSHA 2DMUA 2CW8A 3O2PE 5H6RA 2DYSH 5J4VA 3MZHA 4KIGA 1FOYA 2X6OA 1FTTA 2MD0A 1STZA 4GDFA 2HQNA 5E1ZB 4M3EA 4HX8A 3S3NA 4YFNF 3CLOA 4J00A 1WKMA 2DPDA 3PNYA 3V8JA 1WJCA 3ZPLA 1IG7A 1JUPA 1WGXA 2ELJA 3EDPA 5J1RA 2WY7Q 1A5JA 3CD6I 1D5VA 2JJ7A 1MKMA 5ERIA 4GYGA 3X2QH 1XMKA 1E3HA 5HNFA 3LSPA 4EJUA 4N0BA 1MMSA 1LDDA 2ETHA 5HVQC 5E8GA 4RB0A 1HW1A 1XGOA 2QENA 4E4HA 1L0OC 2KISA 4IRIA 3NARA 3ABLH 1VZ0A 3K4BA 2VBYA 2QWWA 2E19A 2A5YB 2IP2A 1N75A 3LSMA 4OMZA 1XG1A 3HJEA 3KP5A 2F5DA 2XPUA 4UB8C 3RCOA 1POGA 1AOYA 2HPIA 1GVJA 2DOEA 4PCQA 2NVTJ 4GXOA 1HXDA 1FYLA 5HLGA 2KIUA 2KL4A 4XLCA 2F2EA 3OYEA 2EFQA 2HXIA 4PUSA 1UG0A 3PUFA 5GAGJ 2R7XA 2XSDC 2PJRB 2ICWG 3BG7A 1DU0A 2LDUA 1P6RA 3BTCA 1TL8A 1FP1D 3PJRA 4KMUX 2ISYA 3LSJA 1YJWI 3CP8A 1Z9CA 2KJCA 1DP3A 1YITI 3HPGA 3DBLB 5M3FJ 3QP5A 4ZDLA 2E2HJ 4RBOA 1RIOH 3L09A 4OIRF 5DM6F 1ZLKA 3KFWX 4XORA 1OCTC 2Z5UA 1LE8B 4U87A 3C2HA 3LSTA 5GADJ 4BQNA 2RQQA 2WV1A 4M3GA 1R6RA 3DU6A 4YIIA 4BE1A 3MD2A 1QQIA 1DQUA 1TWHJ 2WC2A 4UV8A 5DV5A 5DTDA 2GAUA 1T0FC 4F93B 3IH2A 3LWFA 1DPUA 2XF5A 1Z1DA 1HA8A 4NB5A 2CGPA 2QA4I 4BY7J 3FXKA 2FJ1A 3HPHA 2DQLA 3FXJA 3ABTA 2J5PA 1KU7A 2EV6A 3HKZN 4CCJA 4B3AA 2EJRA 2LD5A 3ZQGA 5FD6A 5F27A 5M5XJ 4IX7A 1OYYA 2FU4A 1Z91A 4CCLA 1FMVA 2R0QC 2I5UA 1QGPA 2B63J 4LJZF 1RC9A 3ZQFA 4W1UA 1IJWC 4BE2A 2DA2A 1O3TA 2CQKA 4XICA 4RAYA 4NUBA 2YX7A 1F5TA 1YHQI 3OYMA 1ZG1A 4HNVA 3QRFF 3MKYB 1HDPA 1MBFA 3E3VA 4A3KJ 1OCZH 2CV2A 1J0RA 3WODF 3SDGA 2DOFA 5DEQA 3BROA 1MNEA 3K70C 1Z05A 2V26A 3F8NA 3KP4A 3OYGA 5FLVA 2LKXA 1SMTA 4U7DA 1MW7A 3S8PA 1X2NA 4LD5A 4C2MJ 4ESFA 3I0TA 2OAZA 3GFMA 3I59B 4ENNA 1MBGA 1OCCH 3ASNH 4FASD 1DU6A 5JHFA 2F5CA 3BJAA 1E2XA 5CKTA 4HQEA 2E36A 4XLPF 3MKLA 2DT6A 3AG2H 4PJJA 1X3WB 1XGMA 1BI0A 3J7ZI 1UHWA 1MMAA 1SD4A 2DA3A 3HHGA 3QOPA 2PN6A 1ZKGA 3BR2A 3WHCA 4XK4A 2CW7A 2NVUB 3JSOA 2KQRA 3CJRB 3S32A 5D5UB 1HOMA 3S1QJ 3OS1A 3TMOA 3F21A 3LSIA 2ME0A 4KYWA 3RQ4A 4R8HA 1XMAA 1VQKI 1UHSA 1SFXA 1VNDA 3H3ZA 4BQOA 2LG4A 3TP3A 3WTSC 4ZYDA 3LOCA 2DDAA 3HGGA 4L5JA 4RLQA 5E79C 2CQ7A 3HOZJ 2IS2A 2V1XA 2LF8A 4RAGA 5HLHA 2JA8J 5KNLA 4LOCA 2KZVA 2W84A 1U9NA 5ICGA 4RB3C 4BXUA 1G6NA 2M7AA 2CV1A 3SFZA 3ZMUA 1D0ZA 4IOCF 2QQAA 2KIQA 5DCFA 2AQEA 2BVMA 1J09A 2ID6A 3I55I 5EF6A 1ACIA 2IVMA 3BLYA 2BYVE 2V7FA 2VN2A 3MMYB 2MC3A 2X6WA 2VQGA 5CVIA 2L01A 3ZMDA 1P9QC 1T0FA 3F9KA 4MQ9F 2LBFA 3ZMZA 5FKLA 2MH9A 2HOTA 3E5XA 1A6QA 1LFPA 2L9NA 2R7SA 2E1NA 1G3SA 2K3PA 2ZMEA 1OCRH 2BY1A 4PSXA 4U0VA 1WJ5A 2VC0A 2XKOA 3VPRA 3SZTA 1SEUA 2OZ6A 2IAIA 4G6DA 2DDBA 3ECOA 4F92B 3UR3C 4C30A 1S7AA 4PFPA 1MMGA 2ZJQF 1KYZA 1JTXA 2MG4A 2XVCA 4HNUA 4EQQA 4ENMA 4ESJA 2WAQA 3TO7A 4KUMA 2HYGD 5K7HA 2CWEA 1K79A 1D8JA 3DEUA 2HPMA 3M7GA 5IT3A 3QPTA 4V2FA 3N05A 1WWXA 3V8KA 3IKTA 4G7HF 3K10A 3CCSI 2LRDA 4E7SA 4E7IA 3K4MA 4O3MA 2XAUA 3ISPA 2OTJI 4BY1J 3L2QA 2E2IJ 1TWGJ 2DMNA 1R9TJ 2EZKA 4BE0A 2OD5A 4I98B 1LDKB 2DFEA 3JCUC 3OL3A 4J19A 1JGGA 2ELKA 1WJBA 1NK2P 4S05A 2HTJA 2BW3B 3ABKH 2WAQN 2XC7A 3HUGA 4BUPA 5BQTA 5JI6A 1TNSA 4MNUA 4AIJA 2HYJA 4YFXF 4FTHA 1W7PB 4AU7A 4ENJA 1AWCA 3ZGKA 4A0ZA 2EB7A 4BBRJ 2O3FA 3HM5A 3GCMA 1K4TA 3DLAA 1V4RA 2X85A 4RS8A 2CQXA 2V79A 1FNNA 1Y1VJ 4KICA 4LIVA 5BS6A 3NWTA 3R4KA 4IQJA 3AKZA 2H6BA 4XOPA 1XX5A 3IAM2 4RLFA 4OMYA 2QKMB 2YPRA 1MSEC 2DU9A 3Q0VA 3DKXA 5E20A 1JXSA 5CVRA 4RM3A 4MHGA 5E18F 1VQLI 2V6EA 2B0LA 2VT3A 2M87A 3CCYA 4M6VA 4I7HA 3TBIA 1K83J 2FBKA 4EATA 1ZRCA 1IV8A 3IL2A 1P7IA 2L7MP 3L2RA 3H5NA 1Y6IA 5M3MJ 2P5LC 3CESA 3WU0A 1EF4A 5F04A 3TEDA 4UXNA 1ZYRF 4KITB 3SXYA 1ENHA 2L7ZA 4XRSG 2JSPA 3TL4X 5FRNA 2ZSHB 3F3XA 4XKWA 2RNGA 3KP2A 4XLFA 3J80K 4E7JA 2FQ3A 2KDOA 5J3LA 1F9NA 4NQWA 1OYWA 1G59A 5CJ9A 1W0TA 1ON2A 3DP7A 3OYKA 2HQ5A 3I3LA 1GLNA 1ETWA 2FBIA 1WPKA 1GV2A 3AG3H 1MMDA 2ZO4A 4HX7A 4D5FA 3C3WA 2XAJA 3P9KA 1IXSB 1K78B 1OR7C 2LF7A 2VASA 4N4OB 1A35A 2R92J 3NEUA 4F52A 1LNWA 2IGOA 2IPQX 1V55H 3BG6A 3GZ6A 4JYKA 3ZQLA 1BC8C 1P4XA 2VQLA 1EA3A 2A6EF 1DGRM 3MAJA 4UVCA 3S3MA 5AIPA 4A12A 5GAEJ 3MZYA 3M8JA 3ROUA 2HVQA 4IHWA 1RUNA 2YX4A 3R0JA 1T56A 5CYVA 3FXQA 3LSKA 1QA6A 3F6VA 5LLQA 4I76A 3OYJA 5F1JA 3BR5A 1UG2A 1QHGA 2KIFA 1JTYA 3RKQA 1H9GA 5F6FA 1U8RA 2VKVA 1Y8QB 2EZHA 4HF0A 1VQ6I 1Z6TA 2H1KA 4A3IJ 4B09A 4XONA 4H0EA 5JHUA 1B8IB 5D8LB 4BQAA 2CJJA 3PNVA 2E5NA 2XV4S 3WU2C 1MIJA 3Q0UA 2ESNA 4L18B 4NDLA 4HPQA 2QKLB 4RA2A 5LD2C 2L9SA 4C2UA 2LY9A 2O5RA 1LEBA 2JA5J 1G3TA 2NVQJ 3F72A 5J8FA 4EJVA 4XRFA 2M0CA 3QQAA 1GV5A 2D1VA 1J2XA 2FQ4A 1TZLA 1X58A 4DW6A 3I71A 2DT7B 2D1HA 3C7JA 1MBKA 2WAEA 1LPQA 3OS2A 1GVDA 3HRUA 2DO7A 4IVNA 3OYDA 5KAFC 2K4BA 5AONA 1V5FA 3GZ5A 3RKXA 3EUAA 1LQ1A 2EIMH 4U0WA 3OIOA 1JE8A 1OKRA 4M9SA 3CUOA 4M3BA 2W82A 1X19A 1ZHFA 3G3ZA 4IF4A 1SANA 1SFEA 1I6XA 3CCVI 3KEOA 4AUXA 2Z3YA 2JTVA 1YRNA 2UUZA 2DLLA 2HKOA 2LFBA 1LJ9A 1A6IA 1SFKA 4CYCA 4BJ6C 2HOEA 2O61A 5BPIA 1QNTA 1TW2A 2I8DA 4PZJA 1OFCX 2L5QA 4YRVA 2BBYA 2MYSA 2AS5F 3HTSB 2ZCWA 1Z3YA 5EGOA 1CQTA 5EG0A 1BOBA 4Y33A 4Y4RA 2CV0A 4CO8A 2BE5F 1XB4A 1FSEA 2MABA 3QU3A 4S0HB 4CICA 1TW3A 2Y0SA 4ETSA 5D4RA 2Z9OA 2VB6A 2FD5A 2G9WA 2KFDA 5A2QZ 4MTEA 1KQ9A 5ED4A 1PYVA 1WJDA 5FB2A 2L02A 3LQRA 2DJIA 2RVCA 5DYMA 3GTPJ 1OR7A 2HKXA 3COAC 2PX9A 2G7UA 1RI7A 3GX4X 3SZGA 3CDIA 2L7KA 4LB6B 5IP6A 5EZGA 3GO5A 4OIPF 1FTZA 2HR3A 2H6CA 2MFZA 2ZNZA 4XLHA 2Z33A 4ZTFA 3DPUA 4KN7X 2JUGA 1I1SA 2PMZA 5K7ZA 1IO2A 1XDUA 3HIFA 4BH9A 2WY8Q 3I58A 1NH3A 4DNCA 1T8IA 1ETOA 1OISA 1YS7A 2E35A 4DZJA 1Z7LA 1QPMA 3GMEA 1PUEE 4NC7A 2VT2A 3KP3A 3BTLA 4XOTA 4P9FA 2JQ7A 1O57A 1D0YA 2DA5A 2K9MA 3BR3A 2KJBA 1HDDC 4Y13A 1HW2A 3TKYA 1TWCJ 2JZYA 1ZQ3P 3KCCA 2JA2A 4UHTA 4M73A 3RJPA 2LKSA 1IF1A 3DKWA 5DUKA 3BY6A 3E0JB 1ZG5A 3QODA 4JBAA 2GA1A 3M9AA 3MN2A 4HDUA 4MGRA 1MBJA 2FEZA 2CO5A 3EUKL 2OF7A 5B1AH 4JK1X 2L0KA 2QQ9A 2YR2A 5HODA 5HS8A 2EWNA 4YEJA 3DBHB 4I01A 4WK8F 3VODA 5EJCA 2NNYA 2M2EA 3IRQA 1QU3A 3S1MJ 3TOBA 4M3FA 1NTCA 2PMUA 2P6TA 3ZRGA 1HC8A 5HLTA 1S72I 3OR1C 2ME6A 3J80Z 2HZTA 2LLKA 5GAHJ 3DXJF 2H09A 2QBYA 1U5TC 3ABMH 2GBYA 3HHHA 1UZCA 2MH2A 1VQ9I 2CU7A 2W25A 1N77A 1WZ2A 3UKGA 2JPCA 2PG4A 3CF2A 2DW4A 1I3AA 3PO2J 2EIJH 2XKPA 4P96A 1S7EA 4BL0B 4EMSA 3EUHC 1GXQA 4FETA 2HS5A 1TC3C 5K7FA 2DXIA 1BI2A 1USSA 3W6JB 4V19K 3ECHA 1WFXA 2H1LA 3ESWB 2O7OA 3BG5A 1C0WA 2L9RA 1BA5A 3WTXC 3DPTA 3IAS2 3UNGC 3OWTA 2VODA 3E6MA 5FROA 1MD0A 2K02A 3HZJA 4OU0A 1R5ID 3QYFA 1LDJA 3L1PA 2Y2ZA 3B6AA 5LHHA 1RKWA 3JRAA 3U1DA 4M71A 3RTRA 1OLTA 1TWFJ 1HBXG 1XSDA 3ZMVA 1GXPA 4LLGF 1KU9A 4BACA 1WI3A 2K9SA 1D1AA 2ZSIB 2VJ5A 3IP4B 1FZPB 3K1NA 5E1XA 1Z3XA 3ZCOA 3TDZC 1EH8A 5JR3A 2HWVA 4IHYA 1KA8A 2X1EA 2QZ8A 2FMLA 2R5YA 1TT5B 2GM4A 1IRGA 3N4MA 3VSLA 2RKHA 2O9LA 3S3OA 1D1CA 5D6FA 3RYRA 3HG9A 2P6SA 2CUZA 2MD5A 3E6BA 5IY5H 4MO7A 4HG2A 1G8XA 3RPUA 4E6KG 3CZ6A 1TT0A 3OYCA 5LBQA 2DT5A 1MH4A 3V8LA 1X1CA 2A68F 2WBMA 1WVRA 4QTRA 2VJJA 5HS9A 4IOAF 1D0XA 3ZR8X 1IDZA 3BTIA 3F8MA 2MA3A 5IP7J 1FWZA 2K9LA 5IOYA 1VQ4I 1LKXA 3ONQA 3S1NJ 2VC1A 2X4HA 3S17J 2ESHA 2QUFA 4XSZF 3RZDJ 3OYAA 1W0UA 3JRIA 5E1WA 2KP6A 1KGSA 4BU2A 4KJZA 1XCVA 2Y48A 2ZC2A 5FLXK 1T98A 5D5WB 2A69F 3QYEA 3R61A 4A2UA 1J5YA 4C3IJ 3ZMTA 2P7CB 3BZ6A 2RQPA 2MLKA 1JKPC 4N4NB 4BEHB 1SVMA 3G71I 3G1LA 3K1PA 5K5QA 3CCRI 3LSRA 3HKZA 4AVZA 4IHXA 1R4NB 2DA1A 2P7VB 1X1DA 3DPLC 3BR1A 3PSIA 3JRBA 2BXZA 4L5EA 3F8CA 2D2WA 2ISZA 2D45A 1BI1A 4EEFG 4HW0A 5JVTA 2VBWA 2ZFWA 2VJIA 5IPAA 3DQVC 1FC3A 4LK1F 4DYQA 1R1VA 4WXHA 3MKZA 2A5WA 1PVEA 4CA0A 1U5TA 3PUBA 3CUQC 3PL8A 1YG2A 3LAJA 4BBSJ 1MDMB 1D1BA 5JFRA 4EVIA 2EBIA 2OZUA 3QPHA 1ZK8A 4CYDA 1V54H 2J5OA 4D7NA 3SFIA 3D5SC 4XN3A 2LBFB 3VYRB 3HBLA 3J7YJ 2RGVA 1PUFB 3CJNA 3JREA 2E34A 3EUHA 3KPHA 5FKMA 1FBSA 2ZMEB 1QRYA 1S9HA 4J01A 4Y15A 4RGXA 1QZEA 4I99C 5M5WJ 2XSJC 4IRHA 1G4DA 2LY1A 1YS6A 2VKEA 1VTNC 2XAFA 4XMYA 4KT6A 2DK5A 2KRCA 1Z21A 3ZP5A 1K61A 2Y9ZA 2JRMA 2PFBA 1K6YA 2R3SA 3T0YA 2EH3A 2LK2A 3FHNA 2FF4A 2KHMA 1I50J 3U1KA 2HEOA 2Z1DA 3GTOJ 4ABZA 2DQRA 1VQOI 3FXUA 3JRGA 3Q5FA 1YOVB 2E1CA 2B7EA 4IEJA 1J59A 1A04A 4WX9A 3MKWB 2IS1A 3ML6A 1R58A 3HRMA 2A6HF 2UZKA 1ZREA 4B44A 1ITYA 3LSGA 2NVYJ 5CQGA 4BDYA 2PJPA 1RZ4A 3D5RC 2L7FP 3DTKA 2BHYA 4XLEA 2DMQA 3NQOA 1RETA 4UUSA 2OTLI 1Y39A 5FFXA 1RESA 2W00A 4HNTA 1Y1WJ 2BZTA 3HUGB 1B72B 3S2WA 1P4AA 1VF9A 1BOAA 1NG7A 4ZZLA 4IXAA 3H9JA 1Y0UA 2LR8A 2C6YA 2GXBA 4JP0A 1IGNA 2E60A 2OPTA 5DM7F 2OQRA 3KYLA 5FJ8J 3AG4H 2STWA 4IRGA 5HOOA 3PQKA 1IV6A 4G7ZF 1LVKA 1IN5A 1X2MA 3DTIA 2XASA 1FYKA 3GFLA 1BBYA 5TJJA 3RKWA 1ZAOA 4GFBA 1SFOJ 4C3JJ 2ZXIA 4JQFA 1H89C 4NNJA 3OS0A 1UELB 4F7ZA 4E7ZA 3HSFA 3WGHA 4EM1A 1FLIA 4BHCA 3K9TA 2GIZA 1FY7A 2E7WA 2JVGA 4BKXA 1MJBA 3H9GA 3HC7A 4L9JA 2BY0A 3I5UA 1IXRC 1YIJI 3CMYA 1ETXA 5ICFA 1ZRDA 1JT6A 2DA4A 2ID3A 1QZZA 4XM3A 3IV5A 2WB1A 2GXGA 3LMMA 2Q1ZB 3IWZA 3HSRA 3PFYA 2A07F 2COBA 3WTZA 2ADUA 3GLLA 4RGUA 5FLMJ 2QYOA 4RB1A 2V1NA 2ZJ2A 3ELKA 4EGZA 3BP8A 3P5JA 1LVAA 1AHDP 2H94A 1QPIA 4M9ZA 2QGUA 4PK4A 5J4YA 3S14J 2LH9A 5EEAA 4WXCA 4RDUA 1ZLJA 3H0DA 3CUQA 2XB0X 4QLCU 4UNOA 3BR6A 4ITVA 2WADA 2P81A 2MC4A 2K7LA 3KIOA 1MJ9A 2JN6A 3M1EA 4X6AJ 1GHCA 2KIMA 2WB1N 3A0BC 1XMXA 2DFHA 4ZYHA 5IYCJ 2HYFA 1S8NA 3K2ZA 4G6QA 3U21A 4HF2A 1K4SA 1X3ZB 2JVHA 3GTKJ 2X1DA 3WGIA 2P8TA 4HA8A 4U7BA 1YW9A 4ZDOA 4GO1A 3OSGA 3CCUI 2HXOA 3K70D 1O4XA 3FZVA 5J1YA 1YX5A 2Q0OA 2R7RA 1YIOA 1KU2A 1ZR4A 3ZN1A 3S2HJ 3OIQA 3JRHA 1FBUA 3CMAI 2FA5A 3M07A 1K6OA 1RPWA 3M8FA 3AL0B 3WE2A 1H0MA 1O3RA 2KZGA 3IH4A 1UCRA 4KIBA 4A0XA 4YIFA 2R7OA 2Z99A 2ZKZA 3ABUA 5D8KB 5FLXZ 6PAXA 3K4NA 3HOUJ 2CMPA 3DEWA 4ZYEA 4XKCA 2LNBA 4B3XA 1ON1A 1ERDA 2OBPA 3L2WA 3E6DA 2XAGA 3BJOA 3W2WA 4CZZA 2XGXA 3OYBA 1WJEA 3O8GA 3ZQ7A 1JHHA 2V6CA 1SC7A 2HTSA 3ZQQA 3I59A 1ODDA 5F0FA 4Z2YA 1ETVA 2N8GA 4H4KC 2CFOA 2YSRA 1IW7F 3CDLA 2G0EA 4MEYF 2LVSA 2IW5A 1KYWA 3OYIA 1W5SA 2ZBKA 2JSCA 3B6CA 4BAYA 2XPVA 2CRGA 3KE2A 3O6BB 3RQIA 2X0LA 3BT9A 3IRRA 4B4CA 2M3AA 3V4GA 2GIVA 2YS9A 2VKHA 1OMIA 3VYTB 2NXNB 3OV8A 4BHBA 2A61A 5CQEA 1WHUA 3G73A 2R7ZJ 4R79A 4A0YA 5FD5A 5L3GA 4CYCB 2ZXWH 3S15J 3IHUA 1F36A 1NG6A 4RMNA 3CMMA 2YUSA 3EQLF 4NBQA 4DGWB 2LY2A 3MWMA 2BY3A 2FNPA 2XF6A 2XGDA 5EGOB 1G3WA 2GOMA 3K4KA 5EG0B 2NRAC 1BR4A 5F64A 1AA7A 1JUMA 4OWRB 4AM3A 4AYBA 3A01A 2FSWA 1BW5A 1XGSA 3NRVA 1QVUA 3BOQA 3MCZA 1RKTA 3RDIA 2VUMJ 4QPQA 4F91B 3R60A 2M1BA 2FNAA 1I27A 3C18A 2DODA 1LFBA 2VBXA 3S2DJ 2IRFG 3EYYA 2EA4A 3L00A 3KZIC 4PFOA 4L9VA 3BQZA 5L3FA 1ONVA 3HSEA 2VLAA 1JUSA 3SEZA 3JR9A 3F22A 4ASNA 2R7UA 3CO6C 4CHUA 1EH7A 3BZCA 1BL0A 3LFKA 1OQYA 2KKOA 5BNGA 2DJNA 2XF7A 3JRDA 1YJ9I 4MEXF 4AYBN 2M4KA 2JMWA 5HS7A 2O8KA 4PDKA 3GWZA 3LA7A 4CCKA 1B4AA 2FMYA 4I0AA 2Q2EA 1OCPA 1ZARA 2F5FA 1WJAA 1LB2A 2GZWA 4D9JA 4LG0A 4A69C 3CQZJ 3PNTA 2R7VA 2O8XA 3V7CA 4MIMA 3H36A 4KNYA 2R7FA 3BDDA 1KZHA 2TDXA 2DTZA 4CCOA 5C3EJ 4E7LA 1Y56A 3CTAA 4BS9A 1NK3P 4BJ5C 2KT0A 3HOXJ 1R5GA 3EYIA 3BG3A 1BR1A 4BNCA 2W24A 3MVPA 2GOXB 4A3BJ 2X1CA 3FXOA 4G12A 5LGTA 3VWBA 3H0GJ 3DF8A 5H20A 3VDXA 3GVAA 1JJ6C 3GEZA 3GTQJ 4OINF 4M9XA 4Q48A 2M34A 4BHPA 3HXLA 3CC4I 2QSFX 2EZIA 3TO6A 1WSUA 2IA0A 2OUMA 5H6QA 3PO3J 2IBDA 5IOZA 5L3BA 3WG7H 3I54A 3Q0WA 2MLGA 4IZZA 4P55A 1DUXC 1VQ5I 2BW3A 4HV5A 1GUUA 2QSHX 2HGCA 5AIQA 3BQYA 1VQ8I 5KAIC 1DP7P 2A05A 2XPWA 1W7PA 2NNNA 1R71A 2CSOA 3L9FA 3E5QA 3TP0A 4C2TA 5B1BH 5TISC 2PLYA 1MBHA 4AVPA 4G8XA 1WCMJ 5GTIC 2K40A 3FISA 5ICEA 3WE3A 2NOJB 4A5NA 2LOOA 1U0JA 1SAUA 1MGTA 2LYCA 3BC8A 3CCEI 4B47A 3MFKA 3AAFA 1R00A 5TRDA 3GYHX 3SZPA 1Q1HA 3FK6A 4E7KA 1W36C 1XSXA 2DN0A 4B1RA 2NVXJ 4MFEA 3S1RJ 1MSFC 3FMRA 3IWFA 2TCTA 3JW4A 3ZQIA 2R93J 3I4NJ 5FO5A 1YFHA 1Y8RB 1WI9A 2EQRA 3VSKA 4XR6A 4ESBA 1HF0A 2E5ZA 2M7BA 3A1YA 1IN7A 4LMYA 2XB5A 2HZDA 1I3QJ 1YTYA 2EFOA 2EINH 1T95A 1R1TA 2BY2A 2NS7A 1A31A 2F6CA 3GUDA 4HZFA 3GW2A 4II2A 5IT9K 5L3DA 3HOSA 2QQ8A 3GFIA 5IP9J 1MZBA 3FBIB 3G2BA 4Y17A 3PQJA 2P0WA 2PBIA 3A03A 3QWLA 3ZOBA 4KA4A 2Q8KA 1K78A 3OR2C 5DCMA 5K1YA 3IC7A 1SMYF 1Z0XA 4CZCA 1FT9A 2XAHA 5D5VB 3ULQB 2QVOA 2K9QA 2Y9YA 3C2BA 4G94A 1AKHA 4MLOA 1VQMI 4X1EA 1OJLA 4UB6C 4KDPA 2DYRH 3KP7A 1RR7A 5BMZA 1GT0C 2K85A 2Y31A 4Q47A 3OL4A 3Q9VA 1IN8A 3H3VK 1W5TA 1IAWA 1IXCA 2E1MC 1PP8F 3W6KB 4XNFA 3TW7A 1U78A 1HKQA 4NC6A 1CF7A 3HRSA 4IQ4A 1V3FA 4IO9F 4IKFA 1MBEA 1S7OA 1R36A 2VQCA 5LRRA 2BV6A 1PDNC 4M6YA 1ZG3A 1IUYA 3VB2A 1G2HA 2W48A 2XGCA 5KCMA 1TQIA 2CG4A 5J1UA 5K5RA 1FPQA 1FIPA 2NS0A 3LNQA 3H92A 2M30A 4XLNF 4P9UA 1B8IA 2GQQA 4Q4ZF 5D6EA 2W7NA 3IH3A 4UVAA 4OIOF 2IT0A 2FBHA 3K4JA 2VJ4A 4ZTJA 1TQMA 2YU3A 3REOA 5HDKA 3M1CA 2KLOA 1Y0NA 1IN4A 2V1DA 3JRFA 3WG9A 3RSNA 5B3SH 3KETA 1UFMA 4JOMA 1TNTA 1YX3A 4OOIA 5M5YJ 1T39A 1XD7A 5FFZA 5B66C 3CLQA 2FE3A 3ZXSA 4RAFA 4AIKA 1O3SA 4LLNA 3FM5A 1WQ2A 1I5ZA 2OQGA 4BXXJ 1U5TB 4FE7A 3FIWA 1O3QA 1X4OA 2AO9A 4MTDA 1E3PA 3FHZA 3FDYA 1LFUP 1S3JA 2RN7A 5F0CA 2EV0A 1JKQC 3U2RA 4DJAA 3RI4A 1RNLA 1E17A 1R4MB 3E97A 2FUG2 4HQMA 5L3CA 1VFCA 1JI8A 5J8CA 2FX0A 1P92A 4D7MA 3JSPA 5L3EA 4UY8I 5E3OA 2G7HA 3QOEA 3AFHA 1LEAA 3JAMK 3TO9A 1I39A 3RPUD 3BPXA 4FT8A 2XRLA 5C4JJ 3HB9A 2VQHA 4GRIA 2HDWA 1YO5C 2STTA 3HOWJ 4IPAA 1ORKA 3HGYA 4N9IA 1JJ8C 4PJNA 4HOBA 1DPRA 2H8RA 1XPXA 3HTUA 4O6JA 1APLC 4WF2A 4ZYAA 2Y0MA 3V7RA 5HLIA 5LEJA 1SD5A 1BI3A 2V4JC 2K27A 1HKTA 4UUSB 1BR2A 2M45A 4D1QA 3H5AA 1YLFA 3WTVC 2ZXHA 2RDPA 4M74A 4E70A 2AHQA 5JLWA 2DBBA 1T38A 3VYSB 5HNHA 1D5YA 4MFDA 3P9CA 4A3DJ 1EH6A 2L9VA 2LC2A 3KYDB 2CUFA 2JWTA 1X4PA 3PFIA 4F55A 3G1OA 3OOPA 4HAMA 3GTJJ 1VQ7I 5FKKA 2UWMA 1U3EM 1T6SA 3A4CA 1E0EA 3SJMA 3MZ8A 4R1HA 4DZPA 2WTEA 3OYHA 3L2UA 3GLXA 3CCLI 2XDVA 4PGHA 3Q3SA 3JRCA 4CUGA 2NS8A 3I56I 3DU5A 1NHAA 2R5ZA 1ULYA 2EFPA 2LKPA 4Y7NJ 1OCOH 3RPQA 4F3QA 2Y69H 2KMUA 1WH5A 2HVRA 3F23A 2M0MA 5E3LA 4I6ZA 1FEXA 1F4KA 1S6LA 2OV7A 5F0HA 1R22A 1B59A 3TQNA 3D0SA 4M6XA 4ZJZA 3P9IA 4KN4X 2IA1A 3RKYA 4BQQA 1JHFA 2E7XA 1IZ1A 2YU9J 3PIOF 1FOXA 4QIWN 3CC2I 4NC8A 1EKEA 4DQ2A 2GWRA 1U2WA 4XRMA 2HQAA 5FRMA 2L2OA 3E5UA 3HL2A 3HOTA 3S16J 2F4IA 3L2VA 1QO0D 2F5EA 2CS3A 4PJ0C 1P2FA 3BPVA 4A3EJ 4IHVA 3WGGA 3JTHA 4U88A 1DDNA 1ZH5A 2E71A 3CUQB 4X0GA 4A93J 2V1UA 5IT9Z 3HEFA 3LL7A 2M8GX 4BYYA 4UVBA 3KEYA 2BEOA 2PEXA 3ASOH 3FF5A 3OSFA 1KQ0A 2ZMEC 2ZJRF 1ZGAA 2KDZA 3K69A 1P7JA 2CUJA 3BCBA 1F43A 3PSFA 3TDUC 4V2GA 4L0ZB 4D0PA 3GXOA 1Z7UA 2GA2A 2XROA 4N9HA 4IHSA 4G7OF 3M4OJ 5K5OA 4LLLA 3DWLE 3GTMJ 4PSWA 1UMQA 2JRTA 1JKOC 3KP6A 4BXFA 4I2OA 2ECBA 2FXAA 5J47A 3W2AA 4OAYA 1H88C 3HOYJ 1W1WE 1IRXA 1J75A 1RUOA 1A36A 4A6EA 5CLSA 3T1BA 2IGNA 3B73A 4DIQA 3J7AO 2ZB9A 3DLLF 2EK5A 2LTPA 3ZQCA 1XGNA 4L0YB 3K1MA 1J9IA 2IS4A 3LSHA 1MNDA 3CJTB 4A3JJ 1MNMC 3DCFA 3BWGA 4GGGA 1YI2I 1ZR2A 1FX7A 2FOWA 1YW7A 2CFXA 3A02A 2CQNA 3LQQA 1B6AA 4FCYA 4YIRX 1CGPA 4EGYA 4D5CA 1XSVA 3H3UA 4IL6C 4PJMA 4ENKA 1XC5A 2P5VA 4Y52J 2IEKA 1JKRC 3U9GA 2VBZA 4IHTA 2X6YA 2HFHA 2E1OA 3FKIJ 3HYIA 2Y75A 2IGMA 3KZYA 1TP4A 4KT5C 4PJLA 4HLXA 2XGEA 1H8AC 2GLOA 3FXMA 2FRHA 1Q1VA 4I09A 4TV7A 5CVJA 3RYPA 4B43A 5EDNA 3W6VA 3L2CA 1O7FA 4I02A 1YYVA 3J7AY 1DGWY 5F08A 3S93A 4OIQF 4EJOA 3EPZA 2PJRA 2VPLA 2VOOA 3K4LA 3LA2A 2DA6A 1KONA 4XL9A 4YELA 2RAEA 3VOEA 4G9YA 1ZELA 2DFIA 2VOPA 3WHBA 4FISA 4CXFA 4P5OA 3OYLA 2D5VA 2V9PA 2JA7J 1S5LC 2CW0F 3PM1A 1R7JA 2DCEA 1TQPA 1IRFA 5B5EC 3CDHA 3CCMI 3SEQA 1HLVA 4KMFA 4A3LJ 2L54A 4LIUA 2O6GE 4BEHA 3I64A 4NQWB 2OC6A 4CGZA 2HDCA 4ZYGA 5E3NA 4LB5A 1X1PA 4PGGA 1LE8A 3HOVJ 1YE9A 5JLXA 2CH0A 4Z6YA 3FXRA 5GPAA 2VPRA 4GYIA 4ZDPA 3A01B 1FBQA 5J6XA 1TLHB 5TGTA 3R6SA 3JAMZ 4EM2A 1OPCA 4FE4A 1U9OA 2EA2A 2QSGX 3FXLA 4XSXF 3G6EI 2BVLA 1B9MA 5D4SA 2R7TA 3FM3A 2PQ8A 3H35A 1SAXA 1ETKA 5ILUA 5EYRA 4BGDA 1IC8A 4UUTA 3WU1B 3WTYC 3A2KA 2W4SA 4FX0A 1MDMA 2DMPA 5C44J 3DEEA 3ERMA 1SVOA 3NWSA 1RRJA 1BM9A 3GBGA 5J40A 4U0YA 2VKDA 3CF5F 2DK8A 1PUFA 2R7DA 1L3LA 2JUCA 3GTGJ 3FMQA 3CC7I 4XKVA 5IYBJ 4K2EA 3TOAA 1I1GA 1IRZA 4ON0A 1HKSA 4A3CJ 5DDGA 1ETYA 3OMYA 2Q2EB 2WWYA 1XS9A 4KIFA 2RNJA 4CCMA 4LG0B 1QZYA 3H5RA 2E2JJ 4CCNA 1F1ZA 5A2QK 3J81K 2K86A 3B02A 1N25A 2JK3A 3JTGA 2QEXI 4LITA 1EV7A 1UJ8A 4WCGA 3OIPA 3AL0C 2W57A 3QAHA 1WJFA 4EJTA 5EZHA 2AQFA 1FIAA 1V5EA 2KPMA 1K7AA 2W1OA 4LFUA 4LGWA 4XIDA 1XCBA 5E17F 1XTAA 5GPCA 2HOAA 2AXTC 2NAZA 5LGUA 3GZNB 2O0YA 1T08B 5ICCA 1BIAA 3M3YJ 4B48A 1WRJA 2VXZA 2EZLA 3C2GA 1H9TA 4LG3A 5ILVA 4KFCA 1R1UA 1B72A 1S29A 2K3FA 4Q5SF 2Y30A 5DUIA 5LEKA 3T5XA 3OYNA 3Q9SA 1B9NA 1X3UA 2QQBA 2VIXA 3CP2A 3HRTA 4EJWA 3OY9A 3WTTC 2F48A 5FKNA 1UHMA 2MSYA 2MGQA 2UV1A 4DYRA 3KEQA 4RM2A 2VI6A 4XQFA 4AIHA 4WWCA 5DS9A 1YRNB 4B8XA 3HDDA 4AC0A 1REPC 2W85A 3K6GA 1BN5A 2RV8A 2LSOA 2NYXA 4AIDA 2K4JA 2L4MA 3F0CA 1PJRA 5BOXA 4UUVA 1VQNI 2HI3A 1BJAA 2IA2A 2BHZA 2QCOA 1G3YA 4EM0B 5F1RA 3CCQI 2XHKA 4HYEA 2ZFUA 1UAAA 2CUEA 2R4GA 5JVGF 3O8HA 3P7NA 3DTEA 1YQAA 4ZH4F 5FKOA 1R23A 5EEGA 5LRSA 3ERED 3RZOJ 5LHGA 3WTUC 1MH3A 4A3FJ 2DAOA 1HCRA 2RC4A 1MJAA 4RAZA 1OYIA 3T8RA 2BOLA 4M3DA 4E7HA 2F4OB 4QPOA 2P4WA 3F6OA 4WXDA 1R5HA 3BCAA 3MEXA 4UV9A 4XKBA 5DCMB 3QPSA 1PP7U 3CJQB
chains in the Genus database with same CATH topology
1JKPC 1E3OC 9ANTA 1AKHB 2DMTA 3G1LA 3BG9A 1MBEA 2X9DA 3LSRA 2ID6A 5EF6A 4C3HJ 4IHXA 2DA1A 1G2HA 2QF7A 2W48A 2XGCA 3BR1A 3JRBA 5J1UA 1JT0A 4L5EA 1FIPA 5FKLA 3LNQA 2HOTA 4EEFG 2DA7A 1B8IA 4JX5A 3VPRA 5IPAA 3IH3A 2IAIA 4DYQA 1JTXA 2MG4A 4A3MJ 4BBSJ 3I4MJ 2EBIA 1ZK8A 4D7NA 3JRFA 3SFIA 5K7HA 1T33A 3HBLA 1PUFB 3JREA 5M5YJ 5FKMA 4V2FA 4DYCA 1QRYA 2HDDA 3QPLA 5M5WJ 2ECCA 2VKEA 4BXXJ 4FE7A 3FIWA 4BY1J 2AO9A 2E2IJ 1TWGJ 1LFUP 2DMNA 5F0CA 1JKQC 2M9HA 1R9TJ 1K61A 2EZKA 2Y9ZA 4W97A 2EH3A 3BR0A 2LK2A 3GTOJ 1I50J 4ABZA 4J19A 1U8BA 1JGGA 2ELKA 3JRGA 1NK2P 1VFCA 1ZTRA 2WAQN 2FX0A 4IEJA 3E7LA 4D7MA 2HYJA 5E3OA 4FTHA 1ITYA 3LSGA 4BBRJ 2NVYJ 3K2AA 3HM5A 2L7FP 2DMQA 2XRLA 5C4JJ 1RETA 2CQXA 3HB9A 4UUSA 1Y1VJ 1QVTA 3TW6A 3HOWJ 1RESA 3TW7A 4JX4A 1ORKA 1Y1WJ 2HOSA 3HGYA 1JJ8C 1B72B 2CQQA 1VF9A 1MSEC 2H8RA 3Q0VA 5C4XJ 2MW8A 2LR8A 1FJLA 3CCYA 1APLC 4M6VA 4JP0A 3BTJA 1K83J 1IGNA 1WH7A 2OPTA 1P7IA 2L7MP 4XRSA 1IDYA 5M3MJ 5FJ8J 3ZQHA 4UUSB 5F04A 1EF4A 3TEDA 2VUMJ 1IV6A 1ENHA 2L7ZA 3FK7A 3OOUA 4XRSG 1X2MA 2R5YB 2K9NA 2AHQA 5JLWA 1SFOJ 4C3JJ 4GFBA 1AU7A 1D5YA 4MFDA 1H89C 5J3LA 4A3DJ 2CUFA 2JWTA 1BJZA 1W0TA 3G1OA 3GTJJ 2HQ5A 5FKKA 1IUFA 4BKXA 1ETWA 1WPKA 1GV2A 3SJMA 4D5FA 4DZPA 3CMYA 1ETXA 1JT6A 2DA4A 2ID3A 3IV5A 3Q3SA 3JRCA 2NS8A 2TRTA 2LP0A 1I6HJ 2R92J 2COBA 2R5ZA 4Y7NJ 5FLMJ 3G1MA 1WH5A 5E3LA 1BW6A 2Y0SN 4JYKA 4I6ZA 3ZQLA 1FEXA 1QPIA 1AHDP 1TWAJ 1GDTA 5F0HA 3S14J 5EEAA 4RDUA 4IHWA 1T56A 2XB0X 3GTLJ 2R5ZB 3NAUA 2YU9J 4QIWN 3D1NI 3BR6A 2P81A 2JN6A 4I76A 4X6AJ 5F1JA 3BR5A 1UG2A 2WB1N 4XRMA 1ZGWA 1JTYA 3RKQA 5GP9A 5IYCJ 2VKVA 3S16J 1ETQA 2EZHA 2X48A 2PMZN 2H1KA 4A3IJ 4A3EJ 4IHVA 3GTKJ 2I10A 5E3MA 1B8IB 2CJJA 4A93J 3HEFA 3OSGA 2HXOA 3Q0UA 2M8GX 1O4XA 1VI0A 5J1YA 4NDLA 4A3GJ 2NOGA 1ZR4A 1Z77A 3S2HJ 2LY9A 3OSFA 3JRHA 2KDZA 2JA5J 1P7JA 2NVQJ 1F43A 1RPWA 4V2GA 4JX6A 5IYDJ 2M0CA 3QQAA 3M4OJ 3IH4A 1GV5A 2FQ4A 3K7AJ 2JA6J 1X58A 4DW6A 3GTMJ 1UMQA 1JKOC 1MBKA 2ECBA 3HOYJ 1H88C 1GVDA 3HOUJ 3DEWA 4QSHA 2DMUA 2ZB9A 2LTPA 3ZQCA 3OIOA 2X6OA 4M3BA 1FTTA 3O8GA 1SANA 4M3EA 4A3JJ 4AUXA 1YRNA 1MNMC 3DCFA 5F0FA 2LFBA 1A6IA 1ETVA 2N8GA 4CYCA 1ZR2A 3CDLA 1JUPA 1WGXA 1OFCX 5J1RA 3A02A 1IG7A 2G0EA 4FCYA 1A5JA 2LVSA 2JJ7A 4D5CA 3B6CA 2XPVA 5EGOA 2CRGA 3RQIA 1CQTA 1XC5A 3BT9A 5EG0A 3LSPA 4B4CA 4Y52J 2IEKA 1JKRC 2YS9A 2E1OA 3FKIJ 2R7ZJ 3NARA 4S0HB 4CYCB 2XGEA 1H8AC 2FD5A 2GLOA 2E19A 1Q1VA 3S15J 1F36A 5EDNA 3W6VA 2YUSA 1XG1A 5F08A 2XGDA 5EGOB 3GTPJ 2XPUA 5EG0B 1POGA 2DA6A 2RAEA 1JUMA 2NVTJ 3A01A 1BW5A 3WHBA 4FISA 1QVUA 5IP6A 2D5VA 2JA7J 3PM1A 1RKTA 5EZGA 2HXIA 1FTZA 1HLVA 4A3LJ 1LFBA 3S2DJ 2XSDC 5K7ZA 1DU0A 5E3NA 1LE8A 3BTCA 3BQZA 3HOVJ 1ETOA 5JLXA 4DZJA 3A01B 5GPAA 2VPRA 1JUSA 3BTLA 3JR9A 2DA5A 3BR3A 1BL0A 3LSJA 1HDDC 4FE4A 1U9OA 1TWCJ 2DJNA 5BNGA 3JRDA 1ZQ3P 4AYBN 2JMWA 5M3FJ 2E2HJ 4RBOA 2O8KA 1ETKA 1OCTC 5EYRA 1LE8B 1IC8A 4UUTA 1OCPA 2DMPA 5C44J 3MN2A 3GBGA 4A69C 2WV1A 3CQZJ 4M3GA 1MBJA 4MIMA 1PUFA 2OF7A 2DTZA 5C3EJ 3GTGJ 1TWHJ 1NK3P 2KT0A 3HOXJ 2L0KA 5IYBJ 3BG3A 5HODA 5DTDA 3MVPA 4A3BJ 3IH2A 1IRZA 4G12A 2M2EA 4A3CJ 3S1MJ 3H0GJ 1ETYA 4M3FA 1NTCA 1JJ6C 3GTQJ 4BY7J 1XS9A 2FJ1A 2ME6A 2LLKA 2M34A 2E2JJ 2EZIA 2GBYA 3HKZN 3PO3J 2CU7A 2IBDA 4B3AA 5IOZA 2JK3A 3UKGA 3Q0WA 2LD5A 3ZQGA 3PO2J 5F27A 5M5XJ 1GUUA 1S7EA 5EZHA 3BQYA 1FIAA 2XPWA 1TC3C 5K7FA 4XIDA 3TP0A 5GPCA 2HOAA 2R0QC 2B63J 1MBHA 1WCMJ 2O7OA 3ZQFA 2K40A 3BG5A 3FISA 2L9RA 4W1UA 3M3YJ 1IJWC 1BA5A 2EZLA 2DA2A 4XICA 3L1PA 1B72A 2Y2ZA 3B6AA 2Y30A 1RKWA 3JRAA 1TWFJ 4HNVA 1HDPA 1MBFA 4A3KJ 3FK6A 2DN0A 4B1RA 2NVXJ 4MFEA 3S1RJ 5FKNA 1MSFC 2MSYA 3SDGA 1WI3A 2K9SA 2MGQA 4DYRA 5FLVA 2TCTA 3ZQIA 2VI6A 2LKXA 2R93J 3I4NJ 1X2NA 4C2MJ 5DS9A 2EQRA 1YRNB 3HDDA 4AC0A 4IHYA 1HF0A 1MBGA 2GM4A 2R5YA 1DU6A 2XB5A 1I3QJ 3F0CA 2HI3A 2O9LA 2QCOA 2NS7A 3MKLA 4MO7A 2CUEA 2DA3A 5IP9J 3O8HA 3BR2A 1ZKGA 1MH4A 3A03A 3WHCA 4XK4A 3ZOBA 5FKOA 4QTRA 3RZOJ 1HOMA 1IDZA 3S1QJ 1MH3A 1Z0XA 3BTIA 5IP7J 2ME0A 4A3FJ 1HCRA 5IOYA 2Y9YA 2K9QA 3C2BA 4M3DA 1AKHA 3S1NJ 4MLOA 1UHSA 1VNDA 3TP3A 4X1EA 1OJLA 3LOCA 3S17J 3HGGA 3RZDJ 1GT0C 1RR7A 1W0UA 3JRIA 2Y31A 3HOZJ 3H3VK 4C3IJ 2JA8J 3QPSA 4LOCA 1U9NA 1U78A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1JKP C;  1E3O C;  9ANT A;  1AKH B;  2DMT A;  3G1L A;  3BG9 A;  1MBE A;  2X9D A;  3LSR A;  2ID6 A;  5EF6 A;  4C3H J;  4IHX A;  2DA1 A;  1G2H A;  2QF7 A;  2W48 A;  2XGC A;  3BR1 A;  3JRB A;  5J1U A;  1JT0 A;  4L5E A;  1FIP A;  5FKL A;  3LNQ A;  2HOT A;  4EEF G;  2DA7 A;  1B8I A;  4JX5 A;  3VPR A;  5IPA A;  3IH3 A;  2IAI A;  4DYQ A;  1JTX A;  2MG4 A;  4A3M J;  4BBS J;  3I4M J;  2EBI A;  1ZK8 A;  4D7N A;  3JRF A;  3SFI A;  5K7H A;  1T33 A;  3HBL A;  1PUF B;  3JRE A;  5M5Y J;  5FKM A;  4V2F A;  4DYC A;  1QRY A;  2HDD A;  3QPL A;  5M5W J;  2ECC A;  2VKE A;  4BXX J;  4FE7 A;  3FIW A;  4BY1 J;  2AO9 A;  2E2I J;  1TWG J;  1LFU P;  2DMN A;  5F0C A;  1JKQ C;  2M9H A;  1R9T J;  1K61 A;  2EZK A;  2Y9Z A;  4W97 A;  2EH3 A;  3BR0 A;  2LK2 A;  3GTO J;  1I50 J;  4ABZ A;  4J19 A;  1U8B A;  1JGG A;  2ELK A;  3JRG A;  1NK2 P;  1VFC A;  1ZTR A;  2WAQ N;  2FX0 A;  4IEJ A;  3E7L A;  4D7M A;  2HYJ A;  5E3O A;  4FTH A;  1ITY A;  3LSG A;  4BBR J;  2NVY J;  3K2A A;  3HM5 A;  2L7F P;  2DMQ A;  2XRL A;  5C4J J;  1RET A;  2CQX A;  3HB9 A;  4UUS A;  1Y1V J;  1QVT A;  3TW6 A;  3HOW J;  1RES A;  3TW7 A;  4JX4 A;  1ORK A;  1Y1W J;  2HOS A;  3HGY A;  1JJ8 C;  1B72 B;  2CQQ A;  1VF9 A;  1MSE C;  2H8R A;  3Q0V A;  5C4X J;  2MW8 A;  2LR8 A;  1FJL A;  3CCY A;  1APL C;  4M6V A;  4JP0 A;  3BTJ A;  1K83 J;  1IGN A;  1WH7 A;  2OPT A;  1P7I A;  2L7M P;  4XRS A;  1IDY A;  5M3M J;  5FJ8 J;  3ZQH A;  4UUS B;  5F04 A;  1EF4 A;  3TED A;  2VUM J;  1IV6 A;  1ENH A;  2L7Z A;  3FK7 A;  3OOU A;  4XRS G;  1X2M A;  2R5Y B;  2K9N A;  2AHQ A;  5JLW A;  1SFO J;  4C3J J;  4GFB A;  1AU7 A;  1D5Y A;  4MFD A;  1H89 C;  5J3L A;  4A3D J;  2CUF A;  2JWT A;  1BJZ A;  1W0T A;  3G1O A;  3GTJ J;  2HQ5 A;  5FKK A;  1IUF A;  4BKX A;  1ETW A;  1WPK A;  1GV2 A;  3SJM A;  4D5F A;  4DZP A;  3CMY A;  1ETX A;  1JT6 A;  2DA4 A;  2ID3 A;  3IV5 A;  3Q3S A;  3JRC A;  2NS8 A;  2TRT A;  2LP0 A;  1I6H J;  2R92 J;  2COB A;  2R5Z A;  4Y7N J;  5FLM J;  3G1M A;  1WH5 A;  5E3L A;  1BW6 A;  2Y0S N;  4JYK A;  4I6Z A;  3ZQL A;  1FEX A;  1QPI A;  1AHD P;  1TWA J;  1GDT A;  5F0H A;  3S14 J;  5EEA A;  4RDU A;  4IHW A;  1T56 A;  2XB0 X;  3GTL J;  2R5Z B;  3NAU A;  2YU9 J;  4QIW N;  3D1N I;  3BR6 A;  2P81 A;  2JN6 A;  4I76 A;  4X6A J;  5F1J A;  3BR5 A;  1UG2 A;  2WB1 N;  4XRM A;  1ZGW A;  1JTY A;  3RKQ A;  5GP9 A;  5IYC J;  2VKV A;  3S16 J;  1ETQ A;  2EZH A;  2X48 A;  2PMZ N;  2H1K A;  4A3I J;  4A3E J;  4IHV A;  3GTK J;  2I10 A;  5E3M A;  1B8I B;  2CJJ A;  4A93 J;  3HEF A;  3OSG A;  2HXO A;  3Q0U A;  2M8G X;  1O4X A;  1VI0 A;  5J1Y A;  4NDL A;  4A3G J;  2NOG A;  1ZR4 A;  1Z77 A;  3S2H J;  2LY9 A;  3OSF A;  3JRH A;  2KDZ A;  2JA5 J;  1P7J A;  2NVQ J;  1F43 A;  1RPW A;  4V2G A;  4JX6 A;  5IYD J;  2M0C A;  3QQA A;  3M4O J;  3IH4 A;  1GV5 A;  2FQ4 A;  3K7A J;  2JA6 J;  1X58 A;  4DW6 A;  3GTM J;  1UMQ A;  1JKO C;  1MBK A;  2ECB A;  3HOY J;  1H88 C;  1GVD A;  3HOU J;  3DEW A;  4QSH A;  2DMU A;  2ZB9 A;  2LTP A;  3ZQC A;  3OIO A;  2X6O A;  4M3B A;  1FTT A;  3O8G A;  1SAN A;  4M3E A;  4A3J J;  4AUX A;  1YRN A;  1MNM C;  3DCF A;  5F0F A;  2LFB A;  1A6I A;  1ETV A;  2N8G A;  4CYC A;  1ZR2 A;  3CDL A;  1JUP A;  1WGX A;  1OFC X;  5J1R A;  3A02 A;  1IG7 A;  2G0E A;  4FCY A;  1A5J A;  2LVS A;  2JJ7 A;  4D5C A;  3B6C A;  2XPV A;  5EGO A;  2CRG A;  3RQI A;  1CQT A;  1XC5 A;  3BT9 A;  5EG0 A;  3LSP A;  4B4C A;  4Y52 J;  2IEK A;  1JKR C;  2YS9 A;  2E1O A;  3FKI J;  2R7Z J;  3NAR A;  4S0H B;  4CYC B;  2XGE A;  1H8A C;  2FD5 A;  2GLO A;  2E19 A;  1Q1V A;  3S15 J;  1F36 A;  5EDN A;  3W6V A;  2YUS A;  1XG1 A;  5F08 A;  2XGD A;  5EGO B;  3GTP J;  2XPU A;  5EG0 B;  1POG A;  2DA6 A;  2RAE A;  1JUM A;  2NVT J;  3A01 A;  1BW5 A;  3WHB A;  4FIS A;  1QVU A;  5IP6 A;  2D5V A;  2JA7 J;  3PM1 A;  1RKT A;  5EZG A;  2HXI A;  1FTZ A;  1HLV A;  4A3L J;  1LFB A;  3S2D J;  2XSD C;  5K7Z A;  1DU0 A;  5E3N A;  1LE8 A;  3BTC A;  3BQZ A;  3HOV J;  1ETO A;  5JLX A;  4DZJ A;  3A01 B;  5GPA A;  2VPR A;  1JUS A;  3BTL A;  3JR9 A;  2DA5 A;  3BR3 A;  1BL0 A;  3LSJ A;  1HDD C;  4FE4 A;  1U9O A;  1TWC J;  2DJN A;  5BNG A;  3JRD A;  1ZQ3 P;  4AYB N;  2JMW A;  5M3F J;  2E2H J;  4RBO A;  2O8K A;  1ETK A;  1OCT C;  5EYR A;  1LE8 B;  1IC8 A;  4UUT A;  1OCP A;  2DMP A;  5C44 J;  3MN2 A;  3GBG A;  4A69 C;  2WV1 A;  3CQZ J;  4M3G A;  1MBJ A;  4MIM A;  1PUF A;  2OF7 A;  2DTZ A;  5C3E J;  3GTG J;  1TWH J;  1NK3 P;  2KT0 A;  3HOX J;  2L0K A;  5IYB J;  3BG3 A;  5HOD A;  5DTD A;  3MVP A;  4A3B J;  3IH2 A;  1IRZ A;  4G12 A;  2M2E A;  4A3C J;  3S1M J;  3H0G J;  1ETY A;  4M3F A;  1NTC A;  1JJ6 C;  3GTQ J;  4BY7 J;  1XS9 A;  2FJ1 A;  2ME6 A;  2LLK A;  2M34 A;  2E2J J;  2EZI A;  2GBY A;  3HKZ N;  3PO3 J;  2CU7 A;  2IBD A;  4B3A A;  5IOZ A;  2JK3 A;  3UKG A;  3Q0W A;  2LD5 A;  3ZQG A;  3PO2 J;  5F27 A;  5M5X J;  1GUU A;  1S7E A;  5EZH A;  3BQY A;  1FIA A;  2XPW A;  1TC3 C;  5K7F A;  4XID A;  3TP0 A;  5GPC A;  2HOA A;  2R0Q C;  2B63 J;  1MBH A;  1WCM J;  2O7O A;  3ZQF A;  2K40 A;  3BG5 A;  3FIS A;  2L9R A;  4W1U A;  3M3Y J;  1IJW C;  1BA5 A;  2EZL A;  2DA2 A;  4XIC A;  3L1P A;  1B72 A;  2Y2Z A;  3B6A A;  2Y30 A;  1RKW A;  3JRA A;  1TWF J;  4HNV A;  1HDP A;  1MBF A;  4A3K J;  3FK6 A;  2DN0 A;  4B1R A;  2NVX J;  4MFE A;  3S1R J;  5FKN A;  1MSF C;  2MSY A;  3SDG A;  1WI3 A;  2K9S A;  2MGQ A;  4DYR A;  5FLV A;  2TCT A;  3ZQI A;  2VI6 A;  2LKX A;  2R93 J;  3I4N J;  1X2N A;  4C2M J;  5DS9 A;  2EQR A;  1YRN B;  3HDD A;  4AC0 A;  4IHY A;  1HF0 A;  1MBG A;  2GM4 A;  2R5Y A;  1DU6 A;  2XB5 A;  1I3Q J;  3F0C A;  2HI3 A;  2O9L A;  2QCO A;  2NS7 A;  3MKL A;  4MO7 A;  2CUE A;  2DA3 A;  5IP9 J;  3O8H A;  3BR2 A;  1ZKG A;  1MH4 A;  3A03 A;  3WHC A;  4XK4 A;  3ZOB A;  5FKO A;  4QTR A;  3RZO J;  1HOM A;  1IDZ A;  3S1Q J;  1MH3 A;  1Z0X A;  3BTI A;  5IP7 J;  2ME0 A;  4A3F J;  1HCR A;  5IOY A;  2Y9Y A;  2K9Q A;  3C2B A;  4M3D A;  1AKH A;  3S1N J;  4MLO A;  1UHS A;  1VND A;  3TP3 A;  4X1E A;  1OJL A;  3LOC A;  3S17 J;  3HGG A;  3RZD J;  1GT0 C;  1RR7 A;  1W0U A;  3JRI A;  2Y31 A;  3HOZ J;  3H3V K;  4C3I J;  2JA8 J;  3QPS A;  4LOC A;  1U9N A;  1U78 A; 
#chains in the Genus database with same CATH topology
 2OU2 A;  4XBF A;  3ZMS A;  1E3O C;  3KZZ A;  9ANT A;  2A3S A;  4G6T B;  1J7K A;  1AKH B;  1V5G A;  2DMT A;  1FSH A;  3W2V A;  3BZK A;  3BG9 A;  5HDG A;  4ZZD A;  2HU9 A;  2X9D A;  4HDV A;  3KLO A;  4C3H J;  4DOZ A;  2M8E A;  4RGR A;  2QF7 A;  3DV8 A;  3K4C A;  3N97 A;  1XN7 A;  1JT0 A;  5DD8 A;  2IJL A;  2VL8 A;  4BDZ A;  2DA7 A;  2IGK A;  3EET A;  4JX5 A;  3KX2 A;  4FX4 A;  1CF7 B;  2HNH A;  2XIG A;  1TTY A;  3SHF A;  2UXX A;  2L4A A;  1B1B A;  1W7P D;  4AWX B;  4A3M J;  4NHJ A;  4FQG A;  3I4M J;  1O7L A;  2OCC H;  4P1W A;  2UXN A;  1T33 A;  1HST A;  1BIB A;  2EV5 A;  5E8I A;  4ZC3 A;  3IUO A;  4ANJ A;  4DYC A;  2PMH A;  2HDD A;  2H27 A;  3O3K A;  3QPL A;  2A6T A;  2Z2S B;  3WTW C;  3F8B A;  4Y3O A;  2ECC A;  2Z16 A;  3D5L A;  5LHI A;  3VEP A;  2K5C A;  2M9H A;  2ZNY A;  4W97 A;  1M1E B;  2P5K A;  3DBR B;  3BR0 A;  2QBY B;  2F5V A;  3FWE A;  3DKY A;  3FMS A;  4GCV A;  1U8B A;  1D8K A;  1X1A A;  1LUJ B;  2JT1 A;  3KYC B;  3ZN0 A;  4FHT A;  1ZTR A;  3E7L A;  4QWQ A;  3PIP F;  2X6X A;  2WA0 A;  2DTR A;  4KIS A;  1R49 A;  3FKJ A;  4XN0 A;  4IJA A;  4HV6 A;  1Z67 A;  3K2A A;  3W3C A;  2OA4 A;  3LFU A;  5FGM A;  3AG1 H;  2JPB A;  1FP2 A;  1QVT A;  3TW6 A;  2QLZ A;  4DBR A;  4JX4 A;  4CDG A;  2HOS A;  4CSW A;  3VFZ A;  2CQQ A;  2IS6 A;  5CVV A;  5KVR A;  5C4X J;  4YG2 F;  2MW8 A;  2XRN A;  5ILS A;  3DFG A;  1ZN2 A;  2HQR A;  1FJL A;  2L3D A;  4II3 A;  4MQV A;  4HSR A;  3BTJ A;  3T8T A;  1WH7 A;  4XRS A;  1KQ8 A;  2CYY A;  5D5X B;  2HVS A;  2WAF A;  1IDY A;  2QM3 A;  3ZQH A;  5LGN A;  2DOA A;  2O03 A;  3I53 A;  2WV0 A;  2DI3 A;  3FK7 A;  3OOU A;  4L9N A;  5BPD A;  1ZRF A;  2LRE A;  4C9Y A;  1SD6 A;  1P4W A;  2EIK H;  3I4P A;  2R5Y B;  2K9N A;  4OAZ A;  2OJE D;  2BXY A;  1FOW A;  3J81 Z;  3MQ0 A;  1W4M A;  1AU7 A;  3K0L A;  1FMW A;  1HSJ A;  4S04 A;  3CCJ I;  1RR8 C;  3OYF A;  2M4G A;  3LA3 A;  3V42 A;  1BJZ A;  2LMD A;  2DFF A;  2H8W A;  2DPU A;  3G4S I;  2ZXJ A;  1IUF A;  5GTH C;  2B9S A;  3GF2 A;  1N78 A;  1EJ9 A;  2X51 A;  5KK1 A;  3A0H C;  1KU3 A;  1SVL A;  2XAQ A;  5EEH A;  2TRT A;  2LP0 A;  3F8F A;  1I6H J;  3QYB A;  4XLA A;  2ZJP F;  2GXA A;  3G1M A;  3TGN A;  1FOK A;  3KLN A;  2F4M B;  1BW6 A;  2Y0S N;  3SQN A;  4L9T A;  1VQP I;  2E1M B;  3E6C C;  5LFA A;  5CPR B;  3GFJ A;  2AXL A;  1GDT A;  1TWA J;  1UB9 A;  2VXD A;  2FOK A;  2PI0 A;  2ELH A;  1JGS A;  1HQC A;  3QU6 A;  1IN6 A;  2MBF A;  1SFU A;  1ZGJ A;  1X1B A;  2XUB A;  1U6G A;  3GTL J;  3I9V 2;  2R5Z B;  3NAU A;  1W5C C;  4I0B A;  5DD4 A;  3D1N I;  3E1S A;  2R7Q A;  3FX3 A;  2EFN A;  4BJT A;  3IKV A;  1QBJ A;  2BGC A;  1ZGW A;  2VE8 A;  3QP6 A;  2OCE A;  5GP9 A;  3M8E A;  4HRI A;  1T2K A;  2EPF A;  1ETQ A;  4RB2 C;  2EFW A;  2R7W A;  5H2F C;  1SD7 A;  2EIL H;  2V9K A;  2VE9 A;  4HST A;  2X48 A;  3CME I;  2PMZ N;  2KRH A;  3H9Q A;  1YW8 A;  2ACJ A;  2I10 A;  2V9V A;  5E3M A;  1W36 D;  4LK0 F;  4O5V A;  4A6D A;  2COM A;  4DBQ A;  1YJN I;  2RRE A;  4A5M A;  4HEA 2;  3FBN B;  1HW5 A;  1VI0 A;  4EV0 A;  4YFK F;  1QHH D;  4A3G J;  2NOG A;  5HDN A;  1Z77 A;  2VON A;  4RGS A;  4L5I A;  1FYM A;  1D3Y A;  1TBX A;  4M72 A;  1BC7 C;  3L7W A;  5CVU A;  4JX6 A;  4HLY A;  4HX4 A;  5IYD J;  1UST A;  2KRF A;  3R0A A;  3SDB A;  2IXS A;  3BJ6 A;  3K7A J;  2JA6 J;  4HF1 A;  3SYT A;  3LAP A;  1Z6R A;  1MMN A;  4HBL A;  3VYU B;  4AD9 A;  4CH7 A;  2M5W A;  3V7S A;  3H1C A;  3C1D A;  1XDS A;  5KHD A;  3CO7 C;  3RIR A;  4QSH A;  2DMU A;  2CW8 A;  3O2P E;  5H6R A;  2DYS H;  5J4V A;  3MZH A;  4KIG A;  1FOY A;  2X6O A;  1FTT A;  2MD0 A;  1STZ A;  4GDF A;  2HQN A;  5E1Z B;  4M3E A;  4HX8 A;  3S3N A;  4YFN F;  3CLO A;  4J00 A;  1WKM A;  2DPD A;  3PNY A;  3V8J A;  1WJC A;  3ZPL A;  1IG7 A;  1JUP A;  1WGX A;  2ELJ A;  3EDP A;  5J1R A;  2WY7 Q;  1A5J A;  3CD6 I;  1D5V A;  2JJ7 A;  1MKM A;  5ERI A;  4GYG A;  3X2Q H;  1XMK A;  1E3H A;  5HNF A;  3LSP A;  4EJU A;  4N0B A;  1MMS A;  1LDD A;  2ETH A;  5HVQ C;  5E8G A;  4RB0 A;  1HW1 A;  1XGO A;  2QEN A;  4E4H A;  1L0O C;  2KIS A;  4IRI A;  3NAR A;  3ABL H;  1VZ0 A;  3K4B A;  2VBY A;  2QWW A;  2E19 A;  2A5Y B;  2IP2 A;  1N75 A;  3LSM A;  4OMZ A;  1XG1 A;  3HJE A;  3KP5 A;  2F5D A;  2XPU A;  4UB8 C;  3RCO A;  1POG A;  1AOY A;  2HPI A;  1GVJ A;  2DOE A;  4PCQ A;  2NVT J;  4GXO A;  1HXD A;  1FYL A;  5HLG A;  2KIU A;  2KL4 A;  4XLC A;  2F2E A;  3OYE A;  2EFQ A;  2HXI A;  4PUS A;  1UG0 A;  3PUF A;  5GAG J;  2R7X A;  2XSD C;  2PJR B;  2ICW G;  3BG7 A;  1DU0 A;  2LDU A;  1P6R A;  3BTC A;  1TL8 A;  1FP1 D;  3PJR A;  4KMU X;  2ISY A;  3LSJ A;  1YJW I;  3CP8 A;  1Z9C A;  2KJC A;  1DP3 A;  1YIT I;  3HPG A;  3DBL B;  5M3F J;  3QP5 A;  4ZDL A;  2E2H J;  4RBO A;  1RIO H;  3L09 A;  4OIR F;  5DM6 F;  1ZLK A;  3KFW X;  4XOR A;  1OCT C;  2Z5U A;  1LE8 B;  4U87 A;  3C2H A;  3LST A;  5GAD J;  4BQN A;  2RQQ A;  2WV1 A;  4M3G A;  1R6R A;  3DU6 A;  4YII A;  4BE1 A;  3MD2 A;  1QQI A;  1DQU A;  1TWH J;  2WC2 A;  4UV8 A;  5DV5 A;  5DTD A;  2GAU A;  1T0F C;  4F93 B;  3IH2 A;  3LWF A;  1DPU A;  2XF5 A;  1Z1D A;  1HA8 A;  4NB5 A;  2CGP A;  2QA4 I;  4BY7 J;  3FXK A;  2FJ1 A;  3HPH A;  2DQL A;  3FXJ A;  3ABT A;  2J5P A;  1KU7 A;  2EV6 A;  3HKZ N;  4CCJ A;  4B3A A;  2EJR A;  2LD5 A;  3ZQG A;  5FD6 A;  5F27 A;  5M5X J;  4IX7 A;  1OYY A;  2FU4 A;  1Z91 A;  4CCL A;  1FMV A;  2R0Q C;  2I5U A;  1QGP A;  2B63 J;  4LJZ F;  1RC9 A;  3ZQF A;  4W1U A;  1IJW C;  4BE2 A;  2DA2 A;  1O3T A;  2CQK A;  4XIC A;  4RAY A;  4NUB A;  2YX7 A;  1F5T A;  1YHQ I;  3OYM A;  1ZG1 A;  4HNV A;  3QRF F;  3MKY B;  1HDP A;  1MBF A;  3E3V A;  4A3K J;  1OCZ H;  2CV2 A;  1J0R A;  3WOD F;  3SDG A;  2DOF A;  5DEQ A;  3BRO A;  1MNE A;  3K70 C;  1Z05 A;  2V26 A;  3F8N A;  3KP4 A;  3OYG A;  5FLV A;  2LKX A;  1SMT A;  4U7D A;  1MW7 A;  3S8P A;  1X2N A;  4LD5 A;  4C2M J;  4ESF A;  3I0T A;  2OAZ A;  3GFM A;  3I59 B;  4ENN A;  1MBG A;  1OCC H;  3ASN H;  4FAS D;  1DU6 A;  5JHF A;  2F5C A;  3BJA A;  1E2X A;  5CKT A;  4HQE A;  2E36 A;  4XLP F;  3MKL A;  2DT6 A;  3AG2 H;  4PJJ A;  1X3W B;  1XGM A;  1BI0 A;  3J7Z I;  1UHW A;  1MMA A;  1SD4 A;  2DA3 A;  3HHG A;  3QOP A;  2PN6 A;  1ZKG A;  3BR2 A;  3WHC A;  4XK4 A;  2CW7 A;  2NVU B;  3JSO A;  2KQR A;  3CJR B;  3S32 A;  5D5U B;  1HOM A;  3S1Q J;  3OS1 A;  3TMO A;  3F21 A;  3LSI A;  2ME0 A;  4KYW A;  3RQ4 A;  4R8H A;  1XMA A;  1VQK I;  1UHS A;  1SFX A;  1VND A;  3H3Z A;  4BQO A;  2LG4 A;  3TP3 A;  3WTS C;  4ZYD A;  3LOC A;  2DDA A;  3HGG A;  4L5J A;  4RLQ A;  5E79 C;  2CQ7 A;  3HOZ J;  2IS2 A;  2V1X A;  2LF8 A;  4RAG A;  5HLH A;  2JA8 J;  5KNL A;  4LOC A;  2KZV A;  2W84 A;  1U9N A;  5ICG A;  4RB3 C;  4BXU A;  1G6N A;  2M7A A;  2CV1 A;  3SFZ A;  3ZMU A;  1D0Z A;  4IOC F;  2QQA A;  2KIQ A;  5DCF A;  2AQE A;  2BVM A;  1J09 A;  2ID6 A;  3I55 I;  5EF6 A;  1ACI A;  2IVM A;  3BLY A;  2BYV E;  2V7F A;  2VN2 A;  3MMY B;  2MC3 A;  2X6W A;  2VQG A;  5CVI A;  2L01 A;  3ZMD A;  1P9Q C;  1T0F A;  3F9K A;  4MQ9 F;  2LBF A;  3ZMZ A;  5FKL A;  2MH9 A;  2HOT A;  3E5X A;  1A6Q A;  1LFP A;  2L9N A;  2R7S A;  2E1N A;  1G3S A;  2K3P A;  2ZME A;  1OCR H;  2BY1 A;  4PSX A;  4U0V A;  1WJ5 A;  2VC0 A;  2XKO A;  3VPR A;  3SZT A;  1SEU A;  2OZ6 A;  2IAI A;  4G6D A;  2DDB A;  3ECO A;  4F92 B;  3UR3 C;  4C30 A;  1S7A A;  4PFP A;  1MMG A;  2ZJQ F;  1KYZ A;  1JTX A;  2MG4 A;  2XVC A;  4HNU A;  4EQQ A;  4ENM A;  4ESJ A;  2WAQ A;  3TO7 A;  4KUM A;  2HYG D;  5K7H A;  2CWE A;  1K79 A;  1D8J A;  3DEU A;  2HPM A;  3M7G A;  5IT3 A;  3QPT A;  4V2F A;  3N05 A;  1WWX A;  3V8K A;  3IKT A;  4G7H F;  3K10 A;  3CCS I;  2LRD A;  4E7S A;  4E7I A;  3K4M A;  4O3M A;  2XAU A;  3ISP A;  2OTJ I;  4BY1 J;  3L2Q A;  2E2I J;  1TWG J;  2DMN A;  1R9T J;  2EZK A;  4BE0 A;  2OD5 A;  4I98 B;  1LDK B;  2DFE A;  3JCU C;  3OL3 A;  4J19 A;  1JGG A;  2ELK A;  1WJB A;  1NK2 P;  4S05 A;  2HTJ A;  2BW3 B;  3ABK H;  2WAQ N;  2XC7 A;  3HUG A;  4BUP A;  5BQT A;  5JI6 A;  1TNS A;  4MNU A;  4AIJ A;  2HYJ A;  4YFX F;  4FTH A;  1W7P B;  4AU7 A;  4ENJ A;  1AWC A;  3ZGK A;  4A0Z A;  2EB7 A;  4BBR J;  2O3F A;  3HM5 A;  3GCM A;  1K4T A;  3DLA A;  1V4R A;  2X85 A;  4RS8 A;  2CQX A;  2V79 A;  1FNN A;  1Y1V J;  4KIC A;  4LIV A;  5BS6 A;  3NWT A;  3R4K A;  4IQJ A;  3AKZ A;  2H6B A;  4XOP A;  1XX5 A;  3IAM 2;  4RLF A;  4OMY A;  2QKM B;  2YPR A;  1MSE C;  2DU9 A;  3Q0V A;  3DKX A;  5E20 A;  1JXS A;  5CVR A;  4RM3 A;  4MHG A;  5E18 F;  1VQL I;  2V6E A;  2B0L A;  2VT3 A;  2M87 A;  3CCY A;  4M6V A;  4I7H A;  3TBI A;  1K83 J;  2FBK A;  4EAT A;  1ZRC A;  1IV8 A;  3IL2 A;  1P7I A;  2L7M P;  3L2R A;  3H5N A;  1Y6I A;  5M3M J;  2P5L C;  3CES A;  3WU0 A;  1EF4 A;  5F04 A;  3TED A;  4UXN A;  1ZYR F;  4KIT B;  3SXY A;  1ENH A;  2L7Z A;  4XRS G;  2JSP A;  3TL4 X;  5FRN A;  2ZSH B;  3F3X A;  4XKW A;  2RNG A;  3KP2 A;  4XLF A;  3J80 K;  4E7J A;  2FQ3 A;  2KDO A;  5J3L A;  1F9N A;  4NQW A;  1OYW A;  1G59 A;  5CJ9 A;  1W0T A;  1ON2 A;  3DP7 A;  3OYK A;  2HQ5 A;  3I3L A;  1GLN A;  1ETW A;  2FBI A;  1WPK A;  1GV2 A;  3AG3 H;  1MMD A;  2ZO4 A;  4HX7 A;  4D5F A;  3C3W A;  2XAJ A;  3P9K A;  1IXS B;  1K78 B;  1OR7 C;  2LF7 A;  2VAS A;  4N4O B;  1A35 A;  2R92 J;  3NEU A;  4F52 A;  1LNW A;  2IGO A;  2IPQ X;  1V55 H;  3BG6 A;  3GZ6 A;  4JYK A;  3ZQL A;  1BC8 C;  1P4X A;  2VQL A;  1EA3 A;  2A6E F;  1DGR M;  3MAJ A;  4UVC A;  3S3M A;  5AIP A;  4A12 A;  5GAE J;  3MZY A;  3M8J A;  3ROU A;  2HVQ A;  4IHW A;  1RUN A;  2YX4 A;  3R0J A;  1T56 A;  5CYV A;  3FXQ A;  3LSK A;  1QA6 A;  3F6V A;  5LLQ A;  4I76 A;  3OYJ A;  5F1J A;  3BR5 A;  1UG2 A;  1QHG A;  2KIF A;  1JTY A;  3RKQ A;  1H9G A;  5F6F A;  1U8R A;  2VKV A;  1Y8Q B;  2EZH A;  4HF0 A;  1VQ6 I;  1Z6T A;  2H1K A;  4A3I J;  4B09 A;  4XON A;  4H0E A;  5JHU A;  1B8I B;  5D8L B;  4BQA A;  2CJJ A;  3PNV A;  2E5N A;  2XV4 S;  3WU2 C;  1MIJ A;  3Q0U A;  2ESN A;  4L18 B;  4NDL A;  4HPQ A;  2QKL B;  4RA2 A;  5LD2 C;  2L9S A;  4C2U A;  2LY9 A;  2O5R A;  1LEB A;  2JA5 J;  1G3T A;  2NVQ J;  3F72 A;  5J8F A;  4EJV A;  4XRF A;  2M0C A;  3QQA A;  1GV5 A;  2D1V A;  1J2X A;  2FQ4 A;  1TZL A;  1X58 A;  4DW6 A;  3I71 A;  2DT7 B;  2D1H A;  3C7J A;  1MBK A;  2WAE A;  1LPQ A;  3OS2 A;  1GVD A;  3HRU A;  2DO7 A;  4IVN A;  3OYD A;  5KAF C;  2K4B A;  5AON A;  1V5F A;  3GZ5 A;  3RKX A;  3EUA A;  1LQ1 A;  2EIM H;  4U0W A;  3OIO A;  1JE8 A;  1OKR A;  4M9S A;  3CUO A;  4M3B A;  2W82 A;  1X19 A;  1ZHF A;  3G3Z A;  4IF4 A;  1SAN A;  1SFE A;  1I6X A;  3CCV I;  3KEO A;  4AUX A;  2Z3Y A;  2JTV A;  1YRN A;  2UUZ A;  2DLL A;  2HKO A;  2LFB A;  1LJ9 A;  1A6I A;  1SFK A;  4CYC A;  4BJ6 C;  2HOE A;  2O61 A;  5BPI A;  1QNT A;  1TW2 A;  2I8D A;  4PZJ A;  1OFC X;  2L5Q A;  4YRV A;  2BBY A;  2MYS A;  2AS5 F;  3HTS B;  2ZCW A;  1Z3Y A;  5EGO A;  1CQT A;  5EG0 A;  1BOB A;  4Y33 A;  4Y4R A;  2CV0 A;  4CO8 A;  2BE5 F;  1XB4 A;  1FSE A;  2MAB A;  3QU3 A;  4S0H B;  4CIC A;  1TW3 A;  2Y0S A;  4ETS A;  5D4R A;  2Z9O A;  2VB6 A;  2FD5 A;  2G9W A;  2KFD A;  5A2Q Z;  4MTE A;  1KQ9 A;  5ED4 A;  1PYV A;  1WJD A;  5FB2 A;  2L02 A;  3LQR A;  2DJI A;  2RVC A;  5DYM A;  3GTP J;  1OR7 A;  2HKX A;  3COA C;  2PX9 A;  2G7U A;  1RI7 A;  3GX4 X;  3SZG A;  3CDI A;  2L7K A;  4LB6 B;  5IP6 A;  5EZG A;  3GO5 A;  4OIP F;  1FTZ A;  2HR3 A;  2H6C A;  2MFZ A;  2ZNZ A;  4XLH A;  2Z33 A;  4ZTF A;  3DPU A;  4KN7 X;  2JUG A;  1I1S A;  2PMZ A;  5K7Z A;  1IO2 A;  1XDU A;  3HIF A;  4BH9 A;  2WY8 Q;  3I58 A;  1NH3 A;  4DNC A;  1T8I A;  1ETO A;  1OIS A;  1YS7 A;  2E35 A;  4DZJ A;  1Z7L A;  1QPM A;  3GME A;  1PUE E;  4NC7 A;  2VT2 A;  3KP3 A;  3BTL A;  4XOT A;  4P9F A;  2JQ7 A;  1O57 A;  1D0Y A;  2DA5 A;  2K9M A;  3BR3 A;  2KJB A;  1HDD C;  4Y13 A;  1HW2 A;  3TKY A;  1TWC J;  2JZY A;  1ZQ3 P;  3KCC A;  2JA2 A;  4UHT A;  4M73 A;  3RJP A;  2LKS A;  1IF1 A;  3DKW A;  5DUK A;  3BY6 A;  3E0J B;  1ZG5 A;  3QOD A;  4JBA A;  2GA1 A;  3M9A A;  3MN2 A;  4HDU A;  4MGR A;  1MBJ A;  2FEZ A;  2CO5 A;  3EUK L;  2OF7 A;  5B1A H;  4JK1 X;  2L0K A;  2QQ9 A;  2YR2 A;  5HOD A;  5HS8 A;  2EWN A;  4YEJ A;  3DBH B;  4I01 A;  4WK8 F;  3VOD A;  5EJC A;  2NNY A;  2M2E A;  3IRQ A;  1QU3 A;  3S1M J;  3TOB A;  4M3F A;  1NTC A;  2PMU A;  2P6T A;  3ZRG A;  1HC8 A;  5HLT A;  1S72 I;  3OR1 C;  2ME6 A;  3J80 Z;  2HZT A;  2LLK A;  5GAH J;  3DXJ F;  2H09 A;  2QBY A;  1U5T C;  3ABM H;  2GBY A;  3HHH A;  1UZC A;  2MH2 A;  1VQ9 I;  2CU7 A;  2W25 A;  1N77 A;  1WZ2 A;  3UKG A;  2JPC A;  2PG4 A;  3CF2 A;  2DW4 A;  1I3A A;  3PO2 J;  2EIJ H;  2XKP A;  4P96 A;  1S7E A;  4BL0 B;  4EMS A;  3EUH C;  1GXQ A;  4FET A;  2HS5 A;  1TC3 C;  5K7F A;  2DXI A;  1BI2 A;  1USS A;  3W6J B;  4V19 K;  3ECH A;  1WFX A;  2H1L A;  3ESW B;  2O7O A;  3BG5 A;  1C0W A;  2L9R A;  1BA5 A;  3WTX C;  3DPT A;  3IAS 2;  3UNG C;  3OWT A;  2VOD A;  3E6M A;  5FRO A;  1MD0 A;  2K02 A;  3HZJ A;  4OU0 A;  1R5I D;  3QYF A;  1LDJ A;  3L1P A;  2Y2Z A;  3B6A A;  5LHH A;  1RKW A;  3JRA A;  3U1D A;  4M71 A;  3RTR A;  1OLT A;  1TWF J;  1HBX G;  1XSD A;  3ZMV A;  1GXP A;  4LLG F;  1KU9 A;  4BAC A;  1WI3 A;  2K9S A;  1D1A A;  2ZSI B;  2VJ5 A;  3IP4 B;  1FZP B;  3K1N A;  5E1X A;  1Z3X A;  3ZCO A;  3TDZ C;  1EH8 A;  5JR3 A;  2HWV A;  4IHY A;  1KA8 A;  2X1E A;  2QZ8 A;  2FML A;  2R5Y A;  1TT5 B;  2GM4 A;  1IRG A;  3N4M A;  3VSL A;  2RKH A;  2O9L A;  3S3O A;  1D1C A;  5D6F A;  3RYR A;  3HG9 A;  2P6S A;  2CUZ A;  2MD5 A;  3E6B A;  5IY5 H;  4MO7 A;  4HG2 A;  1G8X A;  3RPU A;  4E6K G;  3CZ6 A;  1TT0 A;  3OYC A;  5LBQ A;  2DT5 A;  1MH4 A;  3V8L A;  1X1C A;  2A68 F;  2WBM A;  1WVR A;  4QTR A;  2VJJ A;  5HS9 A;  4IOA F;  1D0X A;  3ZR8 X;  1IDZ A;  3BTI A;  3F8M A;  2MA3 A;  5IP7 J;  1FWZ A;  2K9L A;  5IOY A;  1VQ4 I;  1LKX A;  3ONQ A;  3S1N J;  2VC1 A;  2X4H A;  3S17 J;  2ESH A;  2QUF A;  4XSZ F;  3RZD J;  3OYA A;  1W0U A;  3JRI A;  5E1W A;  2KP6 A;  1KGS A;  4BU2 A;  4KJZ A;  1XCV A;  2Y48 A;  2ZC2 A;  5FLX K;  1T98 A;  5D5W B;  2A69 F;  3QYE A;  3R61 A;  4A2U A;  1J5Y A;  4C3I J;  3ZMT A;  2P7C B;  3BZ6 A;  2RQP A;  2MLK A;  1JKP C;  4N4N B;  4BEH B;  1SVM A;  3G71 I;  3G1L A;  3K1P A;  5K5Q A;  3CCR I;  3LSR A;  3HKZ A;  4AVZ A;  4IHX A;  1R4N B;  2DA1 A;  2P7V B;  1X1D A;  3DPL C;  3BR1 A;  3PSI A;  3JRB A;  2BXZ A;  4L5E A;  3F8C A;  2D2W A;  2ISZ A;  2D45 A;  1BI1 A;  4EEF G;  4HW0 A;  5JVT A;  2VBW A;  2ZFW A;  2VJI A;  5IPA A;  3DQV C;  1FC3 A;  4LK1 F;  4DYQ A;  1R1V A;  4WXH A;  3MKZ A;  2A5W A;  1PVE A;  4CA0 A;  1U5T A;  3PUB A;  3CUQ C;  3PL8 A;  1YG2 A;  3LAJ A;  4BBS J;  1MDM B;  1D1B A;  5JFR A;  4EVI A;  2EBI A;  2OZU A;  3QPH A;  1ZK8 A;  4CYD A;  1V54 H;  2J5O A;  4D7N A;  3SFI A;  3D5S C;  4XN3 A;  2LBF B;  3VYR B;  3HBL A;  3J7Y J;  2RGV A;  1PUF B;  3CJN A;  3JRE A;  2E34 A;  3EUH A;  3KPH A;  5FKM A;  1FBS A;  2ZME B;  1QRY A;  1S9H A;  4J01 A;  4Y15 A;  4RGX A;  1QZE A;  4I99 C;  5M5W J;  2XSJ C;  4IRH A;  1G4D A;  2LY1 A;  1YS6 A;  2VKE A;  1VTN C;  2XAF A;  4XMY A;  4KT6 A;  2DK5 A;  2KRC A;  1Z21 A;  3ZP5 A;  1K61 A;  2Y9Z A;  2JRM A;  2PFB A;  1K6Y A;  2R3S A;  3T0Y A;  2EH3 A;  2LK2 A;  3FHN A;  2FF4 A;  2KHM A;  1I50 J;  3U1K A;  2HEO A;  2Z1D A;  3GTO J;  4ABZ A;  2DQR A;  1VQO I;  3FXU A;  3JRG A;  3Q5F A;  1YOV B;  2E1C A;  2B7E A;  4IEJ A;  1J59 A;  1A04 A;  4WX9 A;  3MKW B;  2IS1 A;  3ML6 A;  1R58 A;  3HRM A;  2A6H F;  2UZK A;  1ZRE A;  4B44 A;  1ITY A;  3LSG A;  2NVY J;  5CQG A;  4BDY A;  2PJP A;  1RZ4 A;  3D5R C;  2L7F P;  3DTK A;  2BHY A;  4XLE A;  2DMQ A;  3NQO A;  1RET A;  4UUS A;  2OTL I;  1Y39 A;  5FFX A;  1RES A;  2W00 A;  4HNT A;  1Y1W J;  2BZT A;  3HUG B;  1B72 B;  3S2W A;  1P4A A;  1VF9 A;  1BOA A;  1NG7 A;  4ZZL A;  4IXA A;  3H9J A;  1Y0U A;  2LR8 A;  2C6Y A;  2GXB A;  4JP0 A;  1IGN A;  2E60 A;  2OPT A;  5DM7 F;  2OQR A;  3KYL A;  5FJ8 J;  3AG4 H;  2STW A;  4IRG A;  5HOO A;  3PQK A;  1IV6 A;  4G7Z F;  1LVK A;  1IN5 A;  1X2M A;  3DTI A;  2XAS A;  1FYK A;  3GFL A;  1BBY A;  5TJJ A;  3RKW A;  1ZAO A;  4GFB A;  1SFO J;  4C3J J;  2ZXI A;  4JQF A;  1H89 C;  4NNJ A;  3OS0 A;  1UEL B;  4F7Z A;  4E7Z A;  3HSF A;  3WGH A;  4EM1 A;  1FLI A;  4BHC A;  3K9T A;  2GIZ A;  1FY7 A;  2E7W A;  2JVG A;  4BKX A;  1MJB A;  3H9G A;  3HC7 A;  4L9J A;  2BY0 A;  3I5U A;  1IXR C;  1YIJ I;  3CMY A;  1ETX A;  5ICF A;  1ZRD A;  1JT6 A;  2DA4 A;  2ID3 A;  1QZZ A;  4XM3 A;  3IV5 A;  2WB1 A;  2GXG A;  3LMM A;  2Q1Z B;  3IWZ A;  3HSR A;  3PFY A;  2A07 F;  2COB A;  3WTZ A;  2ADU A;  3GLL A;  4RGU A;  5FLM J;  2QYO A;  4RB1 A;  2V1N A;  2ZJ2 A;  3ELK A;  4EGZ A;  3BP8 A;  3P5J A;  1LVA A;  1AHD P;  2H94 A;  1QPI A;  4M9Z A;  2QGU A;  4PK4 A;  5J4Y A;  3S14 J;  2LH9 A;  5EEA A;  4WXC A;  4RDU A;  1ZLJ A;  3H0D A;  3CUQ A;  2XB0 X;  4QLC U;  4UNO A;  3BR6 A;  4ITV A;  2WAD A;  2P81 A;  2MC4 A;  2K7L A;  3KIO A;  1MJ9 A;  2JN6 A;  3M1E A;  4X6A J;  1GHC A;  2KIM A;  2WB1 N;  3A0B C;  1XMX A;  2DFH A;  4ZYH A;  5IYC J;  2HYF A;  1S8N A;  3K2Z A;  4G6Q A;  3U21 A;  4HF2 A;  1K4S A;  1X3Z B;  2JVH A;  3GTK J;  2X1D A;  3WGI A;  2P8T A;  4HA8 A;  4U7B A;  1YW9 A;  4ZDO A;  4GO1 A;  3OSG A;  3CCU I;  2HXO A;  3K70 D;  1O4X A;  3FZV A;  5J1Y A;  1YX5 A;  2Q0O A;  2R7R A;  1YIO A;  1KU2 A;  1ZR4 A;  3ZN1 A;  3S2H J;  3OIQ A;  3JRH A;  1FBU A;  3CMA I;  2FA5 A;  3M07 A;  1K6O A;  1RPW A;  3M8F A;  3AL0 B;  3WE2 A;  1H0M A;  1O3R A;  2KZG A;  3IH4 A;  1UCR A;  4KIB A;  4A0X A;  4YIF A;  2R7O A;  2Z99 A;  2ZKZ A;  3ABU A;  5D8K B;  5FLX Z;  6PAX A;  3K4N A;  3HOU J;  2CMP A;  3DEW A;  4ZYE A;  4XKC A;  2LNB A;  4B3X A;  1ON1 A;  1ERD A;  2OBP A;  3L2W A;  3E6D A;  2XAG A;  3BJO A;  3W2W A;  4CZZ A;  2XGX A;  3OYB A;  1WJE A;  3O8G A;  3ZQ7 A;  1JHH A;  2V6C A;  1SC7 A;  2HTS A;  3ZQQ A;  3I59 A;  1ODD A;  5F0F A;  4Z2Y A;  1ETV A;  2N8G A;  4H4K C;  2CFO A;  2YSR A;  1IW7 F;  3CDL A;  2G0E A;  4MEY F;  2LVS A;  2IW5 A;  1KYW A;  3OYI A;  1W5S A;  2ZBK A;  2JSC A;  3B6C A;  4BAY A;  2XPV A;  2CRG A;  3KE2 A;  3O6B B;  3RQI A;  2X0L A;  3BT9 A;  3IRR A;  4B4C A;  2M3A A;  3V4G A;  2GIV A;  2YS9 A;  2VKH A;  1OMI A;  3VYT B;  2NXN B;  3OV8 A;  4BHB A;  2A61 A;  5CQE A;  1WHU A;  3G73 A;  2R7Z J;  4R79 A;  4A0Y A;  5FD5 A;  5L3G A;  4CYC B;  2ZXW H;  3S15 J;  3IHU A;  1F36 A;  1NG6 A;  4RMN A;  3CMM A;  2YUS A;  3EQL F;  4NBQ A;  4DGW B;  2LY2 A;  3MWM A;  2BY3 A;  2FNP A;  2XF6 A;  2XGD A;  5EGO B;  1G3W A;  2GOM A;  3K4K A;  5EG0 B;  2NRA C;  1BR4 A;  5F64 A;  1AA7 A;  1JUM A;  4OWR B;  4AM3 A;  4AYB A;  3A01 A;  2FSW A;  1BW5 A;  1XGS A;  3NRV A;  1QVU A;  3BOQ A;  3MCZ A;  1RKT A;  3RDI A;  2VUM J;  4QPQ A;  4F91 B;  3R60 A;  2M1B A;  2FNA A;  1I27 A;  3C18 A;  2DOD A;  1LFB A;  2VBX A;  3S2D J;  2IRF G;  3EYY A;  2EA4 A;  3L00 A;  3KZI C;  4PFO A;  4L9V A;  3BQZ A;  5L3F A;  1ONV A;  3HSE A;  2VLA A;  1JUS A;  3SEZ A;  3JR9 A;  3F22 A;  4ASN A;  2R7U A;  3CO6 C;  4CHU A;  1EH7 A;  3BZC A;  1BL0 A;  3LFK A;  1OQY A;  2KKO A;  5BNG A;  2DJN A;  2XF7 A;  3JRD A;  1YJ9 I;  4MEX F;  4AYB N;  2M4K A;  2JMW A;  5HS7 A;  2O8K A;  4PDK A;  3GWZ A;  3LA7 A;  4CCK A;  1B4A A;  2FMY A;  4I0A A;  2Q2E A;  1OCP A;  1ZAR A;  2F5F A;  1WJA A;  1LB2 A;  2GZW A;  4D9J A;  4LG0 A;  4A69 C;  3CQZ J;  3PNT A;  2R7V A;  2O8X A;  3V7C A;  4MIM A;  3H36 A;  4KNY A;  2R7F A;  3BDD A;  1KZH A;  2TDX A;  2DTZ A;  4CCO A;  5C3E J;  4E7L A;  1Y56 A;  3CTA A;  4BS9 A;  1NK3 P;  4BJ5 C;  2KT0 A;  3HOX J;  1R5G A;  3EYI A;  3BG3 A;  1BR1 A;  4BNC A;  2W24 A;  3MVP A;  2GOX B;  4A3B J;  2X1C A;  3FXO A;  4G12 A;  5LGT A;  3VWB A;  3H0G J;  3DF8 A;  5H20 A;  3VDX A;  3GVA A;  1JJ6 C;  3GEZ A;  3GTQ J;  4OIN F;  4M9X A;  4Q48 A;  2M34 A;  4BHP A;  3HXL A;  3CC4 I;  2QSF X;  2EZI A;  3TO6 A;  1WSU A;  2IA0 A;  2OUM A;  5H6Q A;  3PO3 J;  2IBD A;  5IOZ A;  5L3B A;  3WG7 H;  3I54 A;  3Q0W A;  2MLG A;  4IZZ A;  4P55 A;  1DUX C;  1VQ5 I;  2BW3 A;  4HV5 A;  1GUU A;  2QSH X;  2HGC A;  5AIQ A;  3BQY A;  1VQ8 I;  5KAI C;  1DP7 P;  2A05 A;  2XPW A;  1W7P A;  2NNN A;  1R71 A;  2CSO A;  3L9F A;  3E5Q A;  3TP0 A;  4C2T A;  5B1B H;  5TIS C;  2PLY A;  1MBH A;  4AVP A;  4G8X A;  1WCM J;  5GTI C;  2K40 A;  3FIS A;  5ICE A;  3WE3 A;  2NOJ B;  4A5N A;  2LOO A;  1U0J A;  1SAU A;  1MGT A;  2LYC A;  3BC8 A;  3CCE I;  4B47 A;  3MFK A;  3AAF A;  1R00 A;  5TRD A;  3GYH X;  3SZP A;  1Q1H A;  3FK6 A;  4E7K A;  1W36 C;  1XSX A;  2DN0 A;  4B1R A;  2NVX J;  4MFE A;  3S1R J;  1MSF C;  3FMR A;  3IWF A;  2TCT A;  3JW4 A;  3ZQI A;  2R93 J;  3I4N J;  5FO5 A;  1YFH A;  1Y8R B;  1WI9 A;  2EQR A;  3VSK A;  4XR6 A;  4ESB A;  1HF0 A;  2E5Z A;  2M7B A;  3A1Y A;  1IN7 A;  4LMY A;  2XB5 A;  2HZD A;  1I3Q J;  1YTY A;  2EFO A;  2EIN H;  1T95 A;  1R1T A;  2BY2 A;  2NS7 A;  1A31 A;  2F6C A;  3GUD A;  4HZF A;  3GW2 A;  4II2 A;  5IT9 K;  5L3D A;  3HOS A;  2QQ8 A;  3GFI A;  5IP9 J;  1MZB A;  3FBI B;  3G2B A;  4Y17 A;  3PQJ A;  2P0W A;  2PBI A;  3A03 A;  3QWL A;  3ZOB A;  4KA4 A;  2Q8K A;  1K78 A;  3OR2 C;  5DCM A;  5K1Y A;  3IC7 A;  1SMY F;  1Z0X A;  4CZC A;  1FT9 A;  2XAH A;  5D5V B;  3ULQ B;  2QVO A;  2K9Q A;  2Y9Y A;  3C2B A;  4G94 A;  1AKH A;  4MLO A;  1VQM I;  4X1E A;  1OJL A;  4UB6 C;  4KDP A;  2DYR H;  3KP7 A;  1RR7 A;  5BMZ A;  1GT0 C;  2K85 A;  2Y31 A;  4Q47 A;  3OL4 A;  3Q9V A;  1IN8 A;  3H3V K;  1W5T A;  1IAW A;  1IXC A;  2E1M C;  1PP8 F;  3W6K B;  4XNF A;  3TW7 A;  1U78 A;  1HKQ A;  4NC6 A;  1CF7 A;  3HRS A;  4IQ4 A;  1V3F A;  4IO9 F;  4IKF A;  1MBE A;  1S7O A;  1R36 A;  2VQC A;  5LRR A;  2BV6 A;  1PDN C;  4M6Y A;  1ZG3 A;  1IUY A;  3VB2 A;  1G2H A;  2W48 A;  2XGC A;  5KCM A;  1TQI A;  2CG4 A;  5J1U A;  5K5R A;  1FPQ A;  1FIP A;  2NS0 A;  3LNQ A;  3H92 A;  2M30 A;  4XLN F;  4P9U A;  1B8I A;  2GQQ A;  4Q4Z F;  5D6E A;  2W7N A;  3IH3 A;  4UVA A;  4OIO F;  2IT0 A;  2FBH A;  3K4J A;  2VJ4 A;  4ZTJ A;  1TQM A;  2YU3 A;  3REO A;  5HDK A;  3M1C A;  2KLO A;  1Y0N A;  1IN4 A;  2V1D A;  3JRF A;  3WG9 A;  3RSN A;  5B3S H;  3KET A;  1UFM A;  4JOM A;  1TNT A;  1YX3 A;  4OOI A;  5M5Y J;  1T39 A;  1XD7 A;  5FFZ A;  5B66 C;  3CLQ A;  2FE3 A;  3ZXS A;  4RAF A;  4AIK A;  1O3S A;  4LLN A;  3FM5 A;  1WQ2 A;  1I5Z A;  2OQG A;  4BXX J;  1U5T B;  4FE7 A;  3FIW A;  1O3Q A;  1X4O A;  2AO9 A;  4MTD A;  1E3P A;  3FHZ A;  3FDY A;  1LFU P;  1S3J A;  2RN7 A;  5F0C A;  2EV0 A;  1JKQ C;  3U2R A;  4DJA A;  3RI4 A;  1RNL A;  1E17 A;  1R4M B;  3E97 A;  2FUG 2;  4HQM A;  5L3C A;  1VFC A;  1JI8 A;  5J8C A;  2FX0 A;  1P92 A;  4D7M A;  3JSP A;  5L3E A;  4UY8 I;  5E3O A;  2G7H A;  3QOE A;  3AFH A;  1LEA A;  3JAM K;  3TO9 A;  1I39 A;  3RPU D;  3BPX A;  4FT8 A;  2XRL A;  5C4J J;  3HB9 A;  2VQH A;  4GRI A;  2HDW A;  1YO5 C;  2STT A;  3HOW J;  4IPA A;  1ORK A;  3HGY A;  4N9I A;  1JJ8 C;  4PJN A;  4HOB A;  1DPR A;  2H8R A;  1XPX A;  3HTU A;  4O6J A;  1APL C;  4WF2 A;  4ZYA A;  2Y0M A;  3V7R A;  5HLI A;  5LEJ A;  1SD5 A;  1BI3 A;  2V4J C;  2K27 A;  1HKT A;  4UUS B;  1BR2 A;  2M45 A;  4D1Q A;  3H5A A;  1YLF A;  3WTV C;  2ZXH A;  2RDP A;  4M74 A;  4E70 A;  2AHQ A;  5JLW A;  2DBB A;  1T38 A;  3VYS B;  5HNH A;  1D5Y A;  4MFD A;  3P9C A;  4A3D J;  1EH6 A;  2L9V A;  2LC2 A;  3KYD B;  2CUF A;  2JWT A;  1X4P A;  3PFI A;  4F55 A;  3G1O A;  3OOP A;  4HAM A;  3GTJ J;  1VQ7 I;  5FKK A;  2UWM A;  1U3E M;  1T6S A;  3A4C A;  1E0E A;  3SJM A;  3MZ8 A;  4R1H A;  4DZP A;  2WTE A;  3OYH A;  3L2U A;  3GLX A;  3CCL I;  2XDV A;  4PGH A;  3Q3S A;  3JRC A;  4CUG A;  2NS8 A;  3I56 I;  3DU5 A;  1NHA A;  2R5Z A;  1ULY A;  2EFP A;  2LKP A;  4Y7N J;  1OCO H;  3RPQ A;  4F3Q A;  2Y69 H;  2KMU A;  1WH5 A;  2HVR A;  3F23 A;  2M0M A;  5E3L A;  4I6Z A;  1FEX A;  1F4K A;  1S6L A;  2OV7 A;  5F0H A;  1R22 A;  1B59 A;  3TQN A;  3D0S A;  4M6X A;  4ZJZ A;  3P9I A;  4KN4 X;  2IA1 A;  3RKY A;  4BQQ A;  1JHF A;  2E7X A;  1IZ1 A;  2YU9 J;  3PIO F;  1FOX A;  4QIW N;  3CC2 I;  4NC8 A;  1EKE A;  4DQ2 A;  2GWR A;  1U2W A;  4XRM A;  2HQA A;  5FRM A;  2L2O A;  3E5U A;  3HL2 A;  3HOT A;  3S16 J;  2F4I A;  3L2V A;  1QO0 D;  2F5E A;  2CS3 A;  4PJ0 C;  1P2F A;  3BPV A;  4A3E J;  4IHV A;  3WGG A;  3JTH A;  4U88 A;  1DDN A;  1ZH5 A;  2E71 A;  3CUQ B;  4X0G A;  4A93 J;  2V1U A;  5IT9 Z;  3HEF A;  3LL7 A;  2M8G X;  4BYY A;  4UVB A;  3KEY A;  2BEO A;  2PEX A;  3ASO H;  3FF5 A;  3OSF A;  1KQ0 A;  2ZME C;  2ZJR F;  1ZGA A;  2KDZ A;  3K69 A;  1P7J A;  2CUJ A;  3BCB A;  1F43 A;  3PSF A;  3TDU C;  4V2G A;  4L0Z B;  4D0P A;  3GXO A;  1Z7U A;  2GA2 A;  2XRO A;  4N9H A;  4IHS A;  4G7O F;  3M4O J;  5K5O A;  4LLL A;  3DWL E;  3GTM J;  4PSW A;  1UMQ A;  2JRT A;  1JKO C;  3KP6 A;  4BXF A;  4I2O A;  2ECB A;  2FXA A;  5J47 A;  3W2A A;  4OAY A;  1H88 C;  3HOY J;  1W1W E;  1IRX A;  1J75 A;  1RUO A;  1A36 A;  4A6E A;  5CLS A;  3T1B A;  2IGN A;  3B73 A;  4DIQ A;  3J7A O;  2ZB9 A;  3DLL F;  2EK5 A;  2LTP A;  3ZQC A;  1XGN A;  4L0Y B;  3K1M A;  1J9I A;  2IS4 A;  3LSH A;  1MND A;  3CJT B;  4A3J J;  1MNM C;  3DCF A;  3BWG A;  4GGG A;  1YI2 I;  1ZR2 A;  1FX7 A;  2FOW A;  1YW7 A;  2CFX A;  3A02 A;  2CQN A;  3LQQ A;  1B6A A;  4FCY A;  4YIR X;  1CGP A;  4EGY A;  4D5C A;  1XSV A;  3H3U A;  4IL6 C;  4PJM A;  4ENK A;  1XC5 A;  2P5V A;  4Y52 J;  2IEK A;  1JKR C;  3U9G A;  2VBZ A;  4IHT A;  2X6Y A;  2HFH A;  2E1O A;  3FKI J;  3HYI A;  2Y75 A;  2IGM A;  3KZY A;  1TP4 A;  4KT5 C;  4PJL A;  4HLX A;  2XGE A;  1H8A C;  2GLO A;  3FXM A;  2FRH A;  1Q1V A;  4I09 A;  4TV7 A;  5CVJ A;  3RYP A;  4B43 A;  5EDN A;  3W6V A;  3L2C A;  1O7F A;  4I02 A;  1YYV A;  3J7A Y;  1DGW Y;  5F08 A;  3S93 A;  4OIQ F;  4EJO A;  3EPZ A;  2PJR A;  2VPL A;  2VOO A;  3K4L A;  3LA2 A;  2DA6 A;  1KON A;  4XL9 A;  4YEL A;  2RAE A;  3VOE A;  4G9Y A;  1ZEL A;  2DFI A;  2VOP A;  3WHB A;  4FIS A;  4CXF A;  4P5O A;  3OYL A;  2D5V A;  2V9P A;  2JA7 J;  1S5L C;  2CW0 F;  3PM1 A;  1R7J A;  2DCE A;  1TQP A;  1IRF A;  5B5E C;  3CDH A;  3CCM I;  3SEQ A;  1HLV A;  4KMF A;  4A3L J;  2L54 A;  4LIU A;  2O6G E;  4BEH A;  3I64 A;  4NQW B;  2OC6 A;  4CGZ A;  2HDC A;  4ZYG A;  5E3N A;  4LB5 A;  1X1P A;  4PGG A;  1LE8 A;  3HOV J;  1YE9 A;  5JLX A;  2CH0 A;  4Z6Y A;  3FXR A;  5GPA A;  2VPR A;  4GYI A;  4ZDP A;  3A01 B;  1FBQ A;  5J6X A;  1TLH B;  5TGT A;  3R6S A;  3JAM Z;  4EM2 A;  1OPC A;  4FE4 A;  1U9O A;  2EA2 A;  2QSG X;  3FXL A;  4XSX F;  3G6E I;  2BVL A;  1B9M A;  5D4S A;  2R7T A;  3FM3 A;  2PQ8 A;  3H35 A;  1SAX A;  1ETK A;  5ILU A;  5EYR A;  4BGD A;  1IC8 A;  4UUT A;  3WU1 B;  3WTY C;  3A2K A;  2W4S A;  4FX0 A;  1MDM A;  2DMP A;  5C44 J;  3DEE A;  3ERM A;  1SVO A;  3NWS A;  1RRJ A;  1BM9 A;  3GBG A;  5J40 A;  4U0Y A;  2VKD A;  3CF5 F;  2DK8 A;  1PUF A;  2R7D A;  1L3L A;  2JUC A;  3GTG J;  3FMQ A;  3CC7 I;  4XKV A;  5IYB J;  4K2E A;  3TOA A;  1I1G A;  1IRZ A;  4ON0 A;  1HKS A;  4A3C J;  5DDG A;  1ETY A;  3OMY A;  2Q2E B;  2WWY A;  1XS9 A;  4KIF A;  2RNJ A;  4CCM A;  4LG0 B;  1QZY A;  3H5R A;  2E2J J;  4CCN A;  1F1Z A;  5A2Q K;  3J81 K;  2K86 A;  3B02 A;  1N25 A;  2JK3 A;  3JTG A;  2QEX I;  4LIT A;  1EV7 A;  1UJ8 A;  4WCG A;  3OIP A;  3AL0 C;  2W57 A;  3QAH A;  1WJF A;  4EJT A;  5EZH A;  2AQF A;  1FIA A;  1V5E A;  2KPM A;  1K7A A;  2W1O A;  4LFU A;  4LGW A;  4XID A;  1XCB A;  5E17 F;  1XTA A;  5GPC A;  2HOA A;  2AXT C;  2NAZ A;  5LGU A;  3GZN B;  2O0Y A;  1T08 B;  5ICC A;  1BIA A;  3M3Y J;  4B48 A;  1WRJ A;  2VXZ A;  2EZL A;  3C2G A;  1H9T A;  4LG3 A;  5ILV A;  4KFC A;  1R1U A;  1B72 A;  1S29 A;  2K3F A;  4Q5S F;  2Y30 A;  5DUI A;  5LEK A;  3T5X A;  3OYN A;  3Q9S A;  1B9N A;  1X3U A;  2QQB A;  2VIX A;  3CP2 A;  3HRT A;  4EJW A;  3OY9 A;  3WTT C;  2F48 A;  5FKN A;  1UHM A;  2MSY A;  2MGQ A;  2UV1 A;  4DYR A;  3KEQ A;  4RM2 A;  2VI6 A;  4XQF A;  4AIH A;  4WWC A;  5DS9 A;  1YRN B;  4B8X A;  3HDD A;  4AC0 A;  1REP C;  2W85 A;  3K6G A;  1BN5 A;  2RV8 A;  2LSO A;  2NYX A;  4AID A;  2K4J A;  2L4M A;  3F0C A;  1PJR A;  5BOX A;  4UUV A;  1VQN I;  2HI3 A;  1BJA A;  2IA2 A;  2BHZ A;  2QCO A;  1G3Y A;  4EM0 B;  5F1R A;  3CCQ I;  2XHK A;  4HYE A;  2ZFU A;  1UAA A;  2CUE A;  2R4G A;  5JVG F;  3O8H A;  3P7N A;  3DTE A;  1YQA A;  4ZH4 F;  5FKO A;  1R23 A;  5EEG A;  5LRS A;  3ERE D;  3RZO J;  5LHG A;  3WTU C;  1MH3 A;  4A3F J;  2DAO A;  1HCR A;  2RC4 A;  1MJA A;  4RAZ A;  1OYI A;  3T8R A;  2BOL A;  4M3D A;  4E7H A;  2F4O B;  4QPO A;  2P4W A;  3F6O A;  4WXD A;  1R5H A;  3BCA A;  3MEX A;  4UV9 A;  4XKB A;  5DCM B;  3QPS A;  1PP7 U;  3CJQ B; 
#chains in the Genus database with same CATH homology
 1JKP C;  1E3O C;  9ANT A;  1AKH B;  2DMT A;  3G1L A;  3BG9 A;  1MBE A;  2X9D A;  3LSR A;  2ID6 A;  5EF6 A;  4C3H J;  4IHX A;  2DA1 A;  1G2H A;  2QF7 A;  2W48 A;  2XGC A;  3BR1 A;  3JRB A;  5J1U A;  1JT0 A;  4L5E A;  1FIP A;  5FKL A;  3LNQ A;  2HOT A;  4EEF G;  2DA7 A;  1B8I A;  4JX5 A;  3VPR A;  5IPA A;  3IH3 A;  2IAI A;  4DYQ A;  1JTX A;  2MG4 A;  4A3M J;  4BBS J;  3I4M J;  2EBI A;  1ZK8 A;  4D7N A;  3JRF A;  3SFI A;  5K7H A;  1T33 A;  3HBL A;  1PUF B;  3JRE A;  5M5Y J;  5FKM A;  4V2F A;  4DYC A;  1QRY A;  2HDD A;  3QPL A;  5M5W J;  2ECC A;  2VKE A;  4BXX J;  4FE7 A;  3FIW A;  4BY1 J;  2AO9 A;  2E2I J;  1TWG J;  1LFU P;  2DMN A;  5F0C A;  1JKQ C;  2M9H A;  1R9T J;  1K61 A;  2EZK A;  2Y9Z A;  4W97 A;  2EH3 A;  3BR0 A;  2LK2 A;  3GTO J;  1I50 J;  4ABZ A;  4J19 A;  1U8B A;  1JGG A;  2ELK A;  3JRG A;  1NK2 P;  1VFC A;  1ZTR A;  2WAQ N;  2FX0 A;  4IEJ A;  3E7L A;  4D7M A;  2HYJ A;  5E3O A;  4FTH A;  1ITY A;  3LSG A;  4BBR J;  2NVY J;  3K2A A;  3HM5 A;  2L7F P;  2DMQ A;  2XRL A;  5C4J J;  1RET A;  2CQX A;  3HB9 A;  4UUS A;  1Y1V J;  1QVT A;  3TW6 A;  3HOW J;  1RES A;  3TW7 A;  4JX4 A;  1ORK A;  1Y1W J;  2HOS A;  3HGY A;  1JJ8 C;  1B72 B;  2CQQ A;  1VF9 A;  1MSE C;  2H8R A;  3Q0V A;  5C4X J;  2MW8 A;  2LR8 A;  1FJL A;  3CCY A;  1APL C;  4M6V A;  4JP0 A;  3BTJ A;  1K83 J;  1IGN A;  1WH7 A;  2OPT A;  1P7I A;  2L7M P;  4XRS A;  1IDY A;  5M3M J;  5FJ8 J;  3ZQH A;  4UUS B;  5F04 A;  1EF4 A;  3TED A;  2VUM J;  1IV6 A;  1ENH A;  2L7Z A;  3FK7 A;  3OOU A;  4XRS G;  1X2M A;  2R5Y B;  2K9N A;  2AHQ A;  5JLW A;  1SFO J;  4C3J J;  4GFB A;  1AU7 A;  1D5Y A;  4MFD A;  1H89 C;  5J3L A;  4A3D J;  2CUF A;  2JWT A;  1BJZ A;  1W0T A;  3G1O A;  3GTJ J;  2HQ5 A;  5FKK A;  1IUF A;  4BKX A;  1ETW A;  1WPK A;  1GV2 A;  3SJM A;  4D5F A;  4DZP A;  3CMY A;  1ETX A;  1JT6 A;  2DA4 A;  2ID3 A;  3IV5 A;  3Q3S A;  3JRC A;  2NS8 A;  2TRT A;  2LP0 A;  1I6H J;  2R92 J;  2COB A;  2R5Z A;  4Y7N J;  5FLM J;  3G1M A;  1WH5 A;  5E3L A;  1BW6 A;  2Y0S N;  4JYK A;  4I6Z A;  3ZQL A;  1FEX A;  1QPI A;  1AHD P;  1TWA J;  1GDT A;  5F0H A;  3S14 J;  5EEA A;  4RDU A;  4IHW A;  1T56 A;  2XB0 X;  3GTL J;  2R5Z B;  3NAU A;  2YU9 J;  4QIW N;  3D1N I;  3BR6 A;  2P81 A;  2JN6 A;  4I76 A;  4X6A J;  5F1J A;  3BR5 A;  1UG2 A;  2WB1 N;  4XRM A;  1ZGW A;  1JTY A;  3RKQ A;  5GP9 A;  5IYC J;  2VKV A;  3S16 J;  1ETQ A;  2EZH A;  2X48 A;  2PMZ N;  2H1K A;  4A3I J;  4A3E J;  4IHV A;  3GTK J;  2I10 A;  5E3M A;  1B8I B;  2CJJ A;  4A93 J;  3HEF A;  3OSG A;  2HXO A;  3Q0U A;  2M8G X;  1O4X A;  1VI0 A;  5J1Y A;  4NDL A;  4A3G J;  2NOG A;  1ZR4 A;  1Z77 A;  3S2H J;  2LY9 A;  3OSF A;  3JRH A;  2KDZ A;  2JA5 J;  1P7J A;  2NVQ J;  1F43 A;  1RPW A;  4V2G A;  4JX6 A;  5IYD J;  2M0C A;  3QQA A;  3M4O J;  3IH4 A;  1GV5 A;  2FQ4 A;  3K7A J;  2JA6 J;  1X58 A;  4DW6 A;  3GTM J;  1UMQ A;  1JKO C;  1MBK A;  2ECB A;  3HOY J;  1H88 C;  1GVD A;  3HOU J;  3DEW A;  4QSH A;  2DMU A;  2ZB9 A;  2LTP A;  3ZQC A;  3OIO A;  2X6O A;  4M3B A;  1FTT A;  3O8G A;  1SAN A;  4M3E A;  4A3J J;  4AUX A;  1YRN A;  1MNM C;  3DCF A;  5F0F A;  2LFB A;  1A6I A;  1ETV A;  2N8G A;  4CYC A;  1ZR2 A;  3CDL A;  1JUP A;  1WGX A;  1OFC X;  5J1R A;  3A02 A;  1IG7 A;  2G0E A;  4FCY A;  1A5J A;  2LVS A;  2JJ7 A;  4D5C A;  3B6C A;  2XPV A;  5EGO A;  2CRG A;  3RQI A;  1CQT A;  1XC5 A;  3BT9 A;  5EG0 A;  3LSP A;  4B4C A;  4Y52 J;  2IEK A;  1JKR C;  2YS9 A;  2E1O A;  3FKI J;  2R7Z J;  3NAR A;  4S0H B;  4CYC B;  2XGE A;  1H8A C;  2FD5 A;  2GLO A;  2E19 A;  1Q1V A;  3S15 J;  1F36 A;  5EDN A;  3W6V A;  2YUS A;  1XG1 A;  5F08 A;  2XGD A;  5EGO B;  3GTP J;  2XPU A;  5EG0 B;  1POG A;  2DA6 A;  2RAE A;  1JUM A;  2NVT J;  3A01 A;  1BW5 A;  3WHB A;  4FIS A;  1QVU A;  5IP6 A;  2D5V A;  2JA7 J;  3PM1 A;  1RKT A;  5EZG A;  2HXI A;  1FTZ A;  1HLV A;  4A3L J;  1LFB A;  3S2D J;  2XSD C;  5K7Z A;  1DU0 A;  5E3N A;  1LE8 A;  3BTC A;  3BQZ A;  3HOV J;  1ETO A;  5JLX A;  4DZJ A;  3A01 B;  5GPA A;  2VPR A;  1JUS A;  3BTL A;  3JR9 A;  2DA5 A;  3BR3 A;  1BL0 A;  3LSJ A;  1HDD C;  4FE4 A;  1U9O A;  1TWC J;  2DJN A;  5BNG A;  3JRD A;  1ZQ3 P;  4AYB N;  2JMW A;  5M3F J;  2E2H J;  4RBO A;  2O8K A;  1ETK A;  1OCT C;  5EYR A;  1LE8 B;  1IC8 A;  4UUT A;  1OCP A;  2DMP A;  5C44 J;  3MN2 A;  3GBG A;  4A69 C;  2WV1 A;  3CQZ J;  4M3G A;  1MBJ A;  4MIM A;  1PUF A;  2OF7 A;  2DTZ A;  5C3E J;  3GTG J;  1TWH J;  1NK3 P;  2KT0 A;  3HOX J;  2L0K A;  5IYB J;  3BG3 A;  5HOD A;  5DTD A;  3MVP A;  4A3B J;  3IH2 A;  1IRZ A;  4G12 A;  2M2E A;  4A3C J;  3S1M J;  3H0G J;  1ETY A;  4M3F A;  1NTC A;  1JJ6 C;  3GTQ J;  4BY7 J;  1XS9 A;  2FJ1 A;  2ME6 A;  2LLK A;  2M34 A;  2E2J J;  2EZI A;  2GBY A;  3HKZ N;  3PO3 J;  2CU7 A;  2IBD A;  4B3A A;  5IOZ A;  2JK3 A;  3UKG A;  3Q0W A;  2LD5 A;  3ZQG A;  3PO2 J;  5F27 A;  5M5X J;  1GUU A;  1S7E A;  5EZH A;  3BQY A;  1FIA A;  2XPW A;  1TC3 C;  5K7F A;  4XID A;  3TP0 A;  5GPC A;  2HOA A;  2R0Q C;  2B63 J;  1MBH A;  1WCM J;  2O7O A;  3ZQF A;  2K40 A;  3BG5 A;  3FIS A;  2L9R A;  4W1U A;  3M3Y J;  1IJW C;  1BA5 A;  2EZL A;  2DA2 A;  4XIC A;  3L1P A;  1B72 A;  2Y2Z A;  3B6A A;  2Y30 A;  1RKW A;  3JRA A;  1TWF J;  4HNV A;  1HDP A;  1MBF A;  4A3K J;  3FK6 A;  2DN0 A;  4B1R A;  2NVX J;  4MFE A;  3S1R J;  5FKN A;  1MSF C;  2MSY A;  3SDG A;  1WI3 A;  2K9S A;  2MGQ A;  4DYR A;  5FLV A;  2TCT A;  3ZQI A;  2VI6 A;  2LKX A;  2R93 J;  3I4N J;  1X2N A;  4C2M J;  5DS9 A;  2EQR A;  1YRN B;  3HDD A;  4AC0 A;  4IHY A;  1HF0 A;  1MBG A;  2GM4 A;  2R5Y A;  1DU6 A;  2XB5 A;  1I3Q J;  3F0C A;  2HI3 A;  2O9L A;  2QCO A;  2NS7 A;  3MKL A;  4MO7 A;  2CUE A;  2DA3 A;  5IP9 J;  3O8H A;  3BR2 A;  1ZKG A;  1MH4 A;  3A03 A;  3WHC A;  4XK4 A;  3ZOB A;  5FKO A;  4QTR A;  3RZO J;  1HOM A;  1IDZ A;  3S1Q J;  1MH3 A;  1Z0X A;  3BTI A;  5IP7 J;  2ME0 A;  4A3F J;  1HCR A;  5IOY A;  2Y9Y A;  2K9Q A;  3C2B A;  4M3D A;  1AKH A;  3S1N J;  4MLO A;  1UHS A;  1VND A;  3TP3 A;  4X1E A;  1OJL A;  3LOC A;  3S17 J;  3HGG A;  3RZD J;  1GT0 C;  1RR7 A;  1W0U A;  3JRI A;  2Y31 A;  3HOZ J;  3H3V K;  4C3I J;  2JA8 J;  3QPS A;  4LOC A;  1U9N A;  1U78 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...