2NVQJ

Rna polymerase ii elongation complex in 150 mm mg+2 with 2'dutp
Total Genus 15
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
15
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-R(*AP*UP*CP*GP*AP*GP*AP*GP*GP*A)-3'
publication title Structural basis of transcription: role of the trigger loop in substrate specificity and catalysis
pubmed doi rcsb
molecule tags Transcription,transferase/dna-rna hybrid
total genus 15
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2nvqJ00
4FISA 5IYBJ 3WHBA 5IYCJ 1X58A 4A69C 1W0TA 5E3NA 2MG4A 2FQ4A 1CQTA 1ETVA 2PMZN 2RAEA 1OJLA 4Y7NJ 4JX6A 1AKHA 3BR6A 2DMTA 2M2EA 4A3CJ 2HDDA 1Y1VJ 5EZHA 3FKIJ 2R5ZA 2Y9ZA 1ZR2A 2QF7A 2HXIA 3JRHA 4RDUA 4XRSA 2LVSA 4JX4A 1BW5A 1GUUA 5C4XJ 1U9NA 2E1OA 1JUMA 1ZGWA 2HOTA 3W6VA 2XRLA 4V2FA 4BBSJ 3HOZJ 5M5WJ 3CQZJ 4FTHA 1IG7A 3A02A 4A3JJ 1ZR4A 2E2HJ 1NK3P 2NVTJ 2NOGA 5C44J 1NTCA 1P7JA 1R9TJ 1MSEC 1IUFA 3PO3J 4HNVA 2GM4A 4JP0A 2L7FP 3S2DJ 5EGOA 3K2AA 2LP0A 2JA6J 1RR7A 4BBRJ 1ZKGA 5K7FA 3E7LA 3HOUJ 3HBLA 2NVXJ 4C3IJ 5DS9A 4FE7A 2Y31A 3BR2A 1UG2A 4B4CA 1ORKA 2X6OA 3QQAA 4M3BA 5F04A 1JJ8C 2NVQJ 4MFEA 2N8GA 1IV6A 1DU0A 3F0CA 1QVTA 3MKLA 1IC8A 5FKOA 3JRDA 3VPRA 1GVDA 2VPRA 3DEWA 3GTGJ 1FIPA 5IOZA 3BR5A 3HKZN 4D7NA 3A01A 2ELKA 2FX0A 4RBOA 4EEFG 1JJ6C 3JRFA 3GTQJ 3GTLJ 1H89C 2DN0A 1POGA 4S0HB 3C2BA 2ME6A 1ITYA 2CUEA 2O7OA 5F1JA 4FE4A 1GV2A 5E3OA 3RZOJ 1WCMJ 2MW8A 3L1PA 2Y0SN 2JA8J 2FD5A 4UUSA 3S1NJ 5F08A 3JRGA 4QTRA 2K9NA 5F0HA 4CYCA 1JT0A 1ZTRA 3HEFA 4MIMA 3TP3A 2DMNA 3ZQGA 3JRAA 2HQ5A 2TRTA 4D7MA 4XRSG 4A3MJ 1BL0A 3BR3A 3GTJJ 5M3MJ 3HB9A 2CU7A 2W48A 1VNDA 1RKTA 5J3LA 4LOCA 1P7IA 4QIWN 2DA1A 2JJ7A 2E19A 5IPAA 2XB0X 3JRCA 1YRNB 3I4NJ 1IDZA 1U9OA 4C3JJ 3TW7A 2XGCA 3HGYA 2XPUA 5EDNA 2X48A 3OSFA 5M3FJ 1JKQC 2O8KA 3S1MJ 4A3EJ 3FK7A 1JGGA 2LR8A 2Y2ZA 4FCYA 3CMYA 1Y1WJ 5EG0B 2HOAA 1HOMA 4M3DA 3IH3A 1AHDP 3TEDA 2XGEA 1APLC 2ID6A 2K9QA 4XRMA 1T33A 5K7ZA 2P81A 3K7AJ 3RKQA 2DA5A 4IHWA 3HOXJ 5GPAA 4B3AA 3JRIA 3CCYA 3BG5A 5GPCA 1LE8B 4A3LJ 5DTDA 2OF7A 5F0CA 1S7EA 3ZOBA 1SFOJ 2IEKA 2HXOA 2M34A 1WH5A 3G1MA 3OSGA 1B8IB 2K40A 3UKGA 1F36A 1RESA 2EBIA 3SFIA 5C3EJ 3DCFA 4G12A 2GLOA 3JR9A 2XSDC 3ZQLA 1WGXA 1K61A 3M4OJ 2L9RA 3LSGA 4MLOA 3WHCA 2JA7J 3Q0UA 3BTIA 2ECCA 2YU9J 1IRZA 2JMWA 4UUTA 1MBKA 3SDGA 1H88C 1BJZA 2LLKA 1WH7A 2JK3A 2ECBA 5J1YA 1AKHB 3BR0A 1JUSA 2YUSA 1TWAJ 2LFBA 3IV5A 4JX5A 3HOYJ 2CUFA 2L7MP 1MH4A 2CRGA 1WPKA 2B63J 1RPWA 4QSHA 3GTPJ 2TCTA 2DA2A 3S17J 1MSFC 2DA3A 1FIAA 1JKPC 1PUFA 2YS9A 4A3IJ 3G1LA 1WI3A 3SJMA 4I6ZA 3GTKJ 2VKEA 1JT6A 2KT0A 5IP7J 3LNQA 4BKXA 1F43A 2R5YA 1OFCX 5F0FA 1LFUP 3B6CA 1AU7A 1H8AC 4X1EA 3FIWA 5M5XJ 2D5VA 2MSYA 5IP6A 4IEJA 3QPLA 1FTTA 3HOWJ 4AUXA 2DA7A 2H8RA 2I10A 2Y30A 3PM1A 3ZQHA 1K83J 2EZKA 2JA5J 4A3DJ 2HYJA 1IGNA 3TW6A 3Q3SA 4BY7J 2R7ZJ 1ZK8A 1Z0XA 3I4MJ 3Q0VA 5E3MA 1UMQA 3NAUA 4DYRA 4A3KJ 3O8GA 4AC0A 5JLXA 1ZQ3P 4A3GJ 1Z77A 2AHQA 2XGDA 1HDDC 2VKVA 1FJLA 4GFBA 4W1UA 1G2HA 4A3FJ 3S2HJ 2L7ZA 1I50J 1RKWA 1XC5A 5FLMJ 3ZQCA 2X9DA 3TP0A 1MBEA 5FKLA 2EZLA 2DA4A 3FISA 3BTLA 3NARA 1GV5A 5FLVA 3BG9A 3OOUA 4UUSB 1UHSA 5IP9J 3S1RJ 1TWFJ 3S15J 2Y9YA 1E3OC 3GTMJ 4D5CA 1QPIA 2EZIA 2DMUA 4I76A 5EEAA 4BXXJ 4DYQA 1B72B 1QVUA 1JTXA 4JYKA 2WB1N 1VF9A 4NDLA 1ETWA 1B8IA 1MBJA 1U8BA 4J19A 4M3FA 2R92J 1T56A 3O8HA 5FKKA 3BQYA 1LFBA 2XPVA 2QCOA 1MNMC 1I6HJ 2NS7A 1FEXA 3BT9A 5IYDJ 1QRYA 2M9HA 3RQIA 2DMQA 1ETXA 3H0GJ 5C4JJ 3BTJA 2CQXA 5M5YJ 2OPTA 4XICA 4L5EA 1TWHJ 3LSPA 1JUPA 4Y52J 2LTPA 1U78A 3MN2A 3PO2J 2JN6A 2K9SA 2ID3A 3BG3A 3IH2A 3JRBA 1W0UA 1IJWC 3Q0WA 2EZHA 4M6VA 1NK2P 2COBA 1D5YA 1OCTC 5GP9A 1Q1VA 3QPSA 1HCRA 4IHYA 1ETOA 2R5ZB 2IBDA 1HF0A 2VUMJ 5J1UA 3LOCA 2LY9A 2KDZA 5K7HA 3MVPA 2MGQA 4B1RA 3HGGA 3BQZA 1ETKA 1ETQA 1FTZA 2IAIA 5EYRA 1DU6A 9ANTA 5JLWA 1X2NA 4DZJA 3HOVJ 4ABZA 1VFCA 3S1QJ 5F27A 2VI6A 3H3VK 5EGOB 4M3EA 3JREA 4AYBN 4BY1J 1ETYA 2GBYA 4A3BJ 1MBFA 1SANA 2WAQN 3IH4A 2DTZA 2NVYJ 1TC3C 4W97A 4XK4A 5BNGA 2G0EA 3CDLA 4V2GA 2L0KA 4C2MJ 4C3HJ 3LSJA 1RETA 1XS9A 1TWGJ 1O4XA 1MH3A 1VI0A 1A5JA 4D5FA 5IOYA 4A93J 2XB5A 3OIOA 1GDTA 3ZQFA 4X6AJ 1A6IA 4DZPA 2M0CA 1PUFB 1YRNA 2E2JJ 2JWTA 3GTOJ 3S14J 1EF4A 2ME0A 2CQQA 1I3QJ 2EH3A 3GBGA 4DW6A 3A01B 2DA6A 2ZB9A 2R5YB 2LK2A 3B6AA 5FJ8J 3D1NI 5EG0A 1GT0C 2O9LA 2M8GX 3ZQIA 3BR1A 1IDYA 5EZGA 2AO9A 2FJ1A 1OCPA 2DMPA 3M3YJ 4MO7A 3A03A 2XPWA 1B72A 4XIDA 1XG1A 3G1OA 4IHVA 1MBHA 5EF6A 4CYCB 3LSRA 2NS8A 3RZDJ 1ENHA 1LE8A 1BW6A 3HM5A 1HDPA 4IHXA 3HDDA 2HI3A 1JKOC 5HODA 1MBGA 1BA5A 5FKMA 5J1RA 3BTCA 5FKNA 4DYCA 1JTYA 2CJJA 2WV1A 2R0QC 3FK6A 1TWCJ 4M3GA 1HLVA 2LD5A 3S16J 4MFDA 2DJNA 5E3LA 2LKXA 1JKRC 2H1KA 2R93J 2EQRA 2E2IJ 1X2MA 2HOSA
chains in the Genus database with same CATH superfamily
2X6YA 3VYUB 4ZYGA 5IYBJ 1SD4A 2X4HA 3W3CA 3WHBA 3ZN0A 3S32A 4HPQA 3DEEA 1CQTA 2DTRA 2RAEA 1OJLA 1Z7LA 1Z67A 3COAC 3LL7A 4G8XA 3HRMA 1NG7A 2DMTA 4A3CJ 1R49A 4YRVA 5HLGA 2Z3YA 3KCCA 2QF7A 3I54A 4FQGA 2R5ZA 4RDUA 3DQVC 3EUKL 1ZRCA 5C4XJ 1O57A 2FUG2 1HXDA 1TP4A 2NNNA 2QBYB 2EB7A 3WTTC 5LGUA 2HOTA 1BIAA 4BBSJ 3HOZJ 4L9NA 3RPQA 4FTHA 1QA6A 2XAHA 5K5QA 2QUFA 4JOMA 3RKWA 4HF2A 1Y0UA 2E7XA 3ABUA 2UXXA 2RKHA 3HG9A 2NVTJ 1Y6IA 2GXGA 2CQNA 5C44J 2WAFA 3F8CA 1R9TJ 4OAYA 4CCJA 1OCCH 3S3NA 2GM4A 1P4XA 5EGOA 2EK5A 2LP0A 4AU7A 1SAXA 1HW2A 1ZKGA 3E7LA 2Y48A 3H5NA 1OQYA 3HOUJ 4A6EA 2GAUA 4C3IJ 4JBAA 3CCRI 2ZBKA 4FE7A 3QOPA 4B4CA 1FSEA 3JSPA 1JJ8C 3F22A 4B47A 4MFEA 2CW7A 3IAM2 4ZZDA 3J80Z 1DU0A 3DWLE 4UV8A 4A0ZA 1IO2A 3K4LA 4KNYA 1GVDA 2VPRA 3BCAA 2W7NA 3CJNA 2LSOA 2K9MA 2KJBA 3GW2A 3FHZA 3BR5A 3HKZN 2LBFB 1JXSA 2FX0A 4RBOA 2VJ5A 1JJ6C 1B59A 2R7DA 2ZXJA 1POGA 1OR7C 5F1JA 1DP7P 3RZOJ 1XGMA 3C7JA 5B66C 2W25A 2Y0SN 2CO5A 2ZJ2A 4I7HA 5HOOA 1UHMA 2JA8J 1YW7A 5DCMB 2H09A 2M7BA 3A0BC 3CJQB 3BPXA 3DP7A 1IXCA 1SFXA 4EMSA 5JI6A 4QTRA 4HQEA 2UWMA 3KE2A 4ESJA 3AKZA 3WG9A 5CLSA 4IXAA 4MIMA 3TP3A 2DMNA 2OTJI 2LKSA 2UUZA 4PFOA 2AS5F 1YE9A 1TZLA 2HTJA 3K4KA 5E17F 2HQ5A 3GZ5A 2LF8A 3KYCB 3OYNA 4A3MJ 2K3FA 1HBXG 2CV0A 1Q1HA 2DBBA 2M5WA 4Y17A 3LA7A 3WU2C 2L5QA 2W48A 3BG7A 2HR3A 5J3LA 1DUXC 5FRNA 4I01A 2B7EA 2XB0X 4BGDA 2HOEA 4G6DA 1IDZA 1RNLA 4C3JJ 2XROA 2X48A 4HF0A 4RAZA 5H6QA 1Z6TA 4KN7X 3RPUD 2MH2A 1K78B 4UUVA 3ZP5A 2QSFX 1OMIA 1FX7A 3RQ4A 4BU2A 5EG0B 3KP4A 1HOMA 3IH3A 1MIJA 1X4PA 3MZYA 5FROA 3OYAA 1AHDP 3TEDA 1K79A 1IXRC 3HYIA 4XLFA 2K9QA 4YEJA 1T33A 5K7ZA 4S04A 4G7HF 2MD5A 3K7AJ 3RKQA 3HPGA 2VBXA 1ZHFA 5J47A 4KIBA 1PP8F 4MTEA 5CYVA 5GPCA 3KETA 2MA3A 1F5TA 2IGOA 1J59A 1HQCA 3NEUA 2DFEA 2K02A 3FXRA 1OCRH 2CMPA 5F0CA 1O3RA 3SDBA 2HXOA 2M34A 4UXNA 1WH5A 4GGGA 4AYBA 1GVJA 2MD0A 1J5YA 5JVGF 3H36A 2K40A 4F92B 2EBIA 3UKGA 3OWTA 4A2UA 2LC2A 3I3LA 4G12A 3VDXA 2ZFUA 4QWQA 3HUGB 1XMKA 3DU6A 2DFIA 2Q1ZB 2FQ3A 3Q0UA 2BW3A 4EGYA 1DPRA 2X0LA 3BTIA 4DJAA 1W1WE 2KHMA 4UUTA 1H88C 3WU0A 2DPUA 3OS0A 1N78A 4ESBA 1HSTA 2JK3A 5FGMA 4CGZA 1R4MB 5J1YA 1VQ7I 3BR0A 4Z6YA 2GZWA 2CUJA 3AG3H 1TWAJ 4JX5A 3HOYJ 2KPMA 2CUFA 2KLOA 5KCMA 2L7MP 1S7AA 3V42A 3AG2H 2CSOA 2B63J 1XD7A 2VOOA 3OYGA 4KISA 1W5CC 3CCUI 3GTPJ 2HPIA 2DA2A 1X1AA 3J81Z 1DDNA 2DA3A 3VEPA 4M71A 1FIAA 2EINH 5CJ9A 1PUFA 4A5NA 4E70A 4A3IJ 4UHTA 2FF4A 2O3FA 2DFFA 1SVMA 3GTKJ 2B9SA 2KT0A 3LNQA 1JI8A 1F43A 4KUMA 2YR2A 2R5YA 5AONA 5F0FA 1NH3A 3FIWA 4BJ5C 2D5VA 4PZJA 3OYHA 2MSYA 2OZ6A 3F8MA 2RN7A 1IN4A 4XLPF 5BPIA 2GOMA 3LMMA 4HX7A 3HOWJ 1KU7A 2O61A 2KZGA 2DA7A 2CGPA 4EJWA 4EM2A 4DGWB 2OD5A 2HYJA 2MLKA 1SMTA 2M1BA 4E7JA 3Q3SA 2ISYA 4XONA 3WTYC 1KYZA 1ZK8A 3NWTA 4JQFA 2F4OB 5FFXA 4BQQA 3NAUA 4DYRA 4EQQA 3DBRB 2AQEA 2AHQA 1YI2I 3BJOA 3WU1B 2DPDA 4CSWA 1V3FA 4C9YA 2BXZA 2L7ZA 3CCQI 2QM3A 4ZYEA 5JFRA 2R7OA 2BHZA 2CWEA 4CHUA 1U6GA 1MZBA 1G8XA 2OZUA 2DI3A 4RB1A 4UUSB 1UHSA 1HKTA 2BHYA 1E3HA 1YTYA 3E97A 1K4TA 2Y9YA 5HDGA 3LFKA 4ENNA 3GTMJ 4D5CA 3P5JA 5CVIA 3ZMTA 5E20A 1ZRDA 2HKOA 5ICGA 3OV8A 5EEAA 4Q4ZF 4DYQA 4NC7A 4AVPA 3ABTA 1PUEE 1SVLA 3C3WA 4CZCA 1MMDA 2ZKZA 1QVUA 4D9JA 2WB1N 5H2FC 3BROA 4J19A 2ZXWH 3S3OA 2P6TA 4UNOA 1KQ0A 2E34A 3GWZA 1EKEA 1T95A 2V1NA 1WJAA 5L3DA 2ZXHA 1M1EB 4YIIA 5D5XB 1K4SA 2H6CA 2M9HA 3CO6C 1QO0D 4F3QA 1GXQA 3H9QA 4CCKA 3JTHA 2R7XA 1J09A 3QOEA 2QLZA 4RGSA 1PJRA 1QHHD 4XICA 3JCUC 4L5EA 2Y75A 3IKVA 3GVAA 3WTWC 1FLIA 3LSPA 2L2OA 1JUPA 2DT6A 2LTPA 3PIPF 3MN2A 2STWA 2JN6A 1YIOA 5L3CA 2DK8A 2ID3A 2L9SA 2VB6A 3IH2A 3J7ZI 1UFMA 3I59B 2XAQA 2A69F 3J7AY 1K6OA 2FOWA 5FLXZ 2DOEA 2XF7A 4XORA 5GP9A 2R7UA 1Q1VA 3QRFF 2GA2A 2RQPA 3SZTA 1RC9A 1ODDA 4OWRB 5DD8A 1MW7A 2VOPA 2R5ZB 3O3KA 4Y3OA 2VUMJ 5J1UA 3FXKA 2PI0A 2E71A 3F9KA 4HYEA 1BI1A 3HRTA 2KDZA 1I39A 5K7HA 4BAYA 2UXNA 2MGQA 1IXSB 3RTRA 1YIJI 1IF1A 1JHFA 2LRDA 3K9TA 4PFPA 3SZPA 2VLAA 2IRFG 2IAIA 2IXSA 4LJZF 2X85A 1ZELA 5DCMA 1X2NA 1VZ0A 2COMA 3CC7I 3E5QA 1ZAOA 1WQ2A 4BEHB 2XVCA 3RDIA 2A5WA 2HWVA 5EGOB 2R7RA 4M3EA 1ULYA 5DUKA 5D5VB 3I56I 3JREA 3VYSB 2HGCA 1MBFA 1LQ1A 1XN7A 3Q5FA 1YJ9I 2NVYJ 4EGZA 1FYMA 2BZTA 1LVKA 5BNGA 2IGKA 2G0EA 3NWSA 2FA5A 2VASA 2IA0A 3VFZA 4V2GA 1MMNA 1P2FA 2IPQX 4L5JA 4XKWA 1MH3A 4E7IA 2DOFA 2Z2SB 4D5FA 5IOYA 1E17A 1OPCA 2XB5A 1GDTA 1U8RA 4X6AJ 1A6IA 4DZPA 2A5YB 2M0CA 2JWTA 3PFYA 2OCEA 1HKQA 3I58A 3WTZA 3GBGA 4RAGA 3ABLH 1W5SA 2ZB9A 2K27A 5AIPA 1FOYA 3DKYA 1R00A 3T5XA 4MEYF 5EG0A 3OY9A 4BE2A 1GT0C 2CQKA 1TT5B 3ZQIA 5HLTA 1S8NA 4XL9A 5EZGA 1UJ8A 2KL4A 2AO9A 1OCPA 4DIQA 3LFUA 3OR2C 4ZYDA 3MQ0A 2ZO4A 2VKHA 4AIDA 1U5TC 1SD6A 2HU9A 5TGTA 1T0FC 5B1AH 2XSJC 4UVCA 1BBYA 1BW6A 3HM5A 1HDPA 4DOZA 3I71A 3HDDA 2HI3A 5KVRA 2TDXA 3GYHX 2P6SA 4KIGA 2K86A 4ZYHA 4YIFA 2F5DA 3M07A 2AQFA 4XKBA 1ZLKA 2J5PA 3VOEA 3S16J 4MFDA 5LHGA 1W5TA 4LK1F 2LOOA 2BY3A 1U2WA 4YELA 1T8IA 4ZYAA 3WTVC 3F3XA 1H0MA 2VIXA 3I64A 5IYCJ 5HLHA 4A69C 3L9FA 4IZZA 5E3NA 2MG4A 2HQAA 4U88A 2PMZN 3S93A 4IRHA 4BHPA 3K70C 2HQNA 3ZMDA 1STZA 3GO5A 1O3QA 2DDBA 3OR1C 1PVEA 4V19K 3GZ6A 4RGUA 2VE8A 1ZR2A 5EZHA 2Y9ZA 4WX9A 1S72I 3QYFA 5JVTA 2KIUA 3LWFA 2LVSA 3HSEA 1J7KA 2ZMEC 2ELHA 3KLOA 2OQGA 2JVGA 4AVZA 2XRLA 2HDWA 4V2FA 3D0SA 2ZC2A 3KLNA 2QWWA 4EV0A 3GZNB 4EJTA 3CQZJ 2XAGA 2M4GA 3A02A 4A3JJ 5F6FA 1VQ5I 2CH0A 1ZYRF 1ZR4A 4KT5C 2DXIA 2F5CA 2D1VA 3N4MA 1NTCA 2VQLA 1KYWA 1J2XA 2YSRA 1MSEC 3BDDA 3O6BB 4JP0A 2L7FP 2F5FA 2WA0A 3K2AA 1RR7A 4E4HA 1Z6RA 5K7FA 1X4OA 3BPVA 2I5UA 2R7WA 4LLNA 3QP6A 5CVVA 3A2KA 2BW3B 4GO1A 3E3VA 3JSOA 4JK1X 4XLHA 5DM7F 1XTAA 1O3TA 2X6OA 2E1NA 2VQCA 3QQAA 3UR3C 1IV6A 4RAYA 3K4CA 2ETHA 4A6DA 1IC8A 5FKOA 3JRDA 3VPRA 4ON0A 2ZJQF 4LIUA 1A36A 1O7LA 2FMLA 1GHCA 4A0YA 1S6LA 1R71A 3CO7C 5E8GA 4HX4A 4MQVA 2EA4A 2EV5A 2DN0A 1T38A 5GTIC 3SXYA 2CUEA 4IOCF 4FE4A 2EV0A 4BJ6C 1XDUA 5JHUA 2GOXB 3CC4I 2W24A 1RZ4A 2VJIA 3HRUA 4RLFA 2FD5A 4UUSA 1QBJA 1OISA 2UV1A 3S1NJ 2FU4A 4Y15A 2OUMA 1KQ8A 3JRGA 5F0HA 4CYCA 2GA1A 3FHNA 2GXAA 4BNCA 3CMAI 3HEFA 2IGNA 3HHHA 4ESFA 2HYFA 2HEOA 1HW1A 3C1DA 4IVNA 4D7MA 4B09A 3BR3A 4O6JA 3FKJA 1LFPA 5ILUA 5ICEA 4HV5A 1WWXA 4NQWB 1GLNA 1O3SA 1X3WB 5M3MJ 2CU7A 1YG2A 2ESNA 1YX3A 1R5ID 1RKTA 3VWBA 4QIWN 4LOCA 1P7IA 4OIOF 2F4MB 2DA1A 3IL2A 2JJ7A 2E19A 2VKDA 1IW7F 4H0EA 4PGGA 3H9GA 2HYGD 2PMHA 2BY0A 5EDNA 1IN7A 2R7SA 5ED4A 3OSFA 3E6CC 3PNTA 3S1MJ 5CQEA 3IUOA 3WODF 4IKFA 1AOYA 2LR8A 2Y2ZA 3SZGA 2F5EA 4ENMA 2V9PA 1FP2A 1Y1WJ 3I53A 4M3DA 1B4AA 3TL4X 3IP4B 1BN5A 2XGEA 3CCEI 3K4NA 4XRMA 2KFDA 3I59A 1SC7A 4PSXA 3MEXA 2MC3A 2KQRA 3H92A 4WF2A 3TDUC 5GPAA 3HOXJ 4XMYA 3LSKA 2BYVE 3JRIA 3CCYA 3BG5A 3B02A 3AL0C 4C2UA 1T39A 4A3LJ 1GXPA 3F72A 1A31A 2IEKA 2R4GA 2Y0MA 3DEUA 3PSIA 1G6NA 4U0VA 4D0PA 4LG0B 3CUQC 3SFIA 3CLOA 1VQ8I 3PUBA 2PG4A 1ZG3A 2OCCH 4DBRA 2DQLA 1G3TA 3JR9A 4Q5SF 2V26A 2DYRH 2VQHA 4M73A 2XSDC 2XASA 1BC7C 3LSGA 4MLOA 1TL8A 3CMMA 1F1ZA 2DT7B 4BEHA 5D6EA 2ECCA 1BR4A 1FOWA 5LRSA 2EPFA 1MBKA 2E1MB 3SDGA 1BJZA 2LLKA 1WH7A 3QWLA 2O03A 4B3XA 1AKHB 2RQQA 3IV5A 1L0OC 3N05A 3HIFA 3CCSI 2XIGA 1RPWA 2Z33A 3VSLA 4KYWA 3EETA 2KIFA 1YW8A 2JSPA 2XF6A 4YIRX 4ZJZA 2A6HF 3F8FA 1WI3A 3SJMA 3CC2I 4I6ZA 3LSHA 3RPUA 2KIMA 1JT6A 2K4BA 2VKEA 4IQJA 2QENA 3U21A 5F64A 1D1BA 1OFCX 3N97A 1LFUP 3B6CA 5H20A 4X1EA 4HX8A 4NNJA 4PK4A 5D8KB 5IP6A 2DLLA 5L3BA 2A6EF 3BJ6A 5HLIA 1VTNC 2H8RA 1DGWY 3IWFA 1TQPA 3H0DA 2EZKA 1XB4A 1CF7A 3ZQQA 5KHDA 3ERED 5ERIA 2H27A 1R23A 3ZMZA 4A3DJ 1J0RA 2HTSA 2QKMB 4UB8C 5B5EC 1I1GA 1FNNA 3LQRA 1ZLJA 4MHGA 3TO7A 2KJCA 3KP5A 5IT3A 2LYCA 3FM3A 1QPMA 2V1DA 2XHKA 2WADA 2F4IA 3MCZA 2V4JC 4AC0A 5LHHA 1Z77A 3TOBA 2P8TA 2E35A 2ZSHB 4EATA 2QA4I 4W1UA 4A3FJ 4EM1A 1SFUA 3S2HJ 3J80K 4FX4A 4HZFA 1XC5A 2K7LA 1BJAA 1MBEA 1USTA 3WE2A 5GAGJ 2JVHA 3IRRA 3FDYA 4LITA 3FISA 5JR3A 3BTLA 1GV5A 5FLVA 1TT0A 3BZKA 4KDPA 1TQIA 3M7GA 3WTUC 3O2PE 3S1RJ 2V1UA 1MJAA 1E3OC 1QPIA 4KFCA 2XRNA 1UB9A 1BI3A 2IS4A 2E36A 5L3FA 2DO7A 3WGGA 2JA2A 4I76A 3M8JA 1MJBA 1U5TA 3GLXA 2GWRA 2CS3A 3ZXSA 4M72A 3CP2A 2BVMA 1JTXA 1Z9CA 4JYKA 1RUNA 1VF9A 4NDLA 2K5CA 1B8IA 3PUFA 4ASNA 2FE3A 1U8BA 1WVRA 3CD6I 2R92J 2EFQA 3H3ZA 2L9NA 3RCOA 5FKKA 3U1DA 3V7SA 4R8HA 3BQYA 2OTLI 1W36C 3H5AA 3CZ6A 1I6HJ 1XGOA 3QYEA 3OS2A 1FEXA 1I6XA 5IYDJ 3W2WA 4E7HA 1RUOA 3RQIA 2WAQA 3V4GA 3OYEA 1ETXA 3R0AA 2CFXA 3R0JA 4A12A 3L7WA 3V7RA 3GXOA 3HKZA 4G6QA 4IHSA 1R5HA 4Y52J 2IT0A 1FY7A 3I5UA 1U78A 1G3YA 3BCBA 3FMQA 4U7DA 2FSWA 2K9SA 5J8CA 1XGNA 2EFWA 3JW4A 1ON2A 3Q0WA 2EZHA 2M45A 3OYIA 3JTGA 4I0AA 2YX4A 3R60A 1NK2P 3CJTB 4FT8A 5ICFA 3H1CA 3ZN1A 3MKYB 1R1VA 4EVIA 1HCRA 2XAJA 1ETOA 5DCFA 1SFEA 3F8NA 1KA8A 3D5SC 2IBDA 5DDGA 3LOCA 4RAFA 3ASOH 4XM3A 3MVPA 4DQ2A 3HGGA 4XN3A 4C30A 1FTZA 1MD0A 3I0TA 3DU5A 3HXLA 2VT3A 4HG2A 1Z05A 5JLWA 1TNSA 2PEXA 2W57A 3AG1H 3TGNA 5LEKA 5KAIC 4DZJA 2D2WA 1D0XA 1HW5A 1HC8A 4WWCA 3S1QJ 1X1CA 2VI6A 4ZZLA 2DJIA 1A6QA 4ZTJA 2M4KA 5IY5H 4CCNA 2IS6A 4KIFA 4BY1J 4I99C 2GBYA 4A3BJ 3IH4A 4LIVA 1B1BA 2DTZA 1RI7A 4XKVA 4W97A 2VXDA 3ELKA 1BIBA 4XK4A 5K5OA 4NQWA 3CDLA 2QQ9A 2A07F 3PJRA 1FYKA 1O4XA 3CJRB 4PJMA 2X1EA 3C2HA 4KICA 6PAXA 5IT9K 2CFOA 3DBLB 3K70D 5GADJ 2OV7A 1FT9A 3CCLI 3GTOJ 4ZH4F 2DU9A 2ME0A 3FWEA 4BHCA 1SFKA 2P5LC 1I3QJ 2EH3A 4DW6A 3D5RC 1JHHA 1TLHB 3M1CA 4A5MA 2WC2A 2DA6A 2A61A 4NUBA 3J81K 1QZEA 3D1NI 5FJ8J 2VJ4A 1Y8QB 4OIPF 2PQ8A 3E6MA 2JUCA 3EUHC 4XLEA 1IDYA 1LDDA 2FJ1A 3IHUA 2DMPA 4LLGF 3SFZA 3BWGA 2PX9A 3SHFA 1WFXA 2ZNYA 1W7PA 2OQRA 1VQKI 1V54H 5EF6A 4CYCB 1MNEA 4BUPA 4AM3A 4XKCA 3X2QH 1JGSA 4IHXA 3OL3A 1XSVA 1JKOC 4BYYA 1PP7U 1LVAA 4CDGA 5FKNA 4BQAA 4Q47A 4DYCA 2HNHA 1LPQA 1JTYA 2XGXA 2X6XA 2D1HA 1U0JA 1T98A 3ZGKA 4CZZA 3HTUA 4LG0A 3DKWA 3WE3A 3VODA 4ZDPA 1X1DA 1F4KA 3FXMA 2LKXA 4OOIA 3FXJA 1JKRC 2HDCA 2NAZA 1G3WA 3E6DA 1HA8A 4QLCU 2EV6A 4FISA 4IF4A 5DD4A 2PJRA 1B6AA 1I5ZA 1W0TA 5F1RA 2L4AA 3REOA 1ETVA 2BY2A 1SD5A 2AXLA 1ZGAA 3V7CA 2ACJA 4AIJA 1AKHA 4C2TA 3BR6A 3QAHA 3K2ZA 1U3EM 2HDDA 3G71I 1Y1VJ 3GX4X 5D4RA 3V8JA 4XRSA 1R5GA 2V7FA 4CH7A 4OMYA 4N4NB 4XNFA 3ASNH 1QHGA 2E1OA 5LGNA 1W7PD 3ABMH 2A05A 5M5WJ 4U7BA 1FYLA 1LDJA 2ELJA 2HQRA 2G7UA 1R22A 1ERDA 1NK3P 3BLYA 3CTAA 4KN4X 3VB2A 3ZMVA 1B9MA 4ZC3A 2OBPA 1IUFA 3PO3J 4HNVA 2JA6J 3OL4A 4BBRJ 2E7WA 2PN6A 2EIJH 4CYDA 2NS0A 4WXCA 3CCVI 4XSXF 3HBLA 2NVXJ 4P55A 4L9JA 5LD2C 5BMZA 4ANJA 3BR2A 1UG2A 2DOAA 1ORKA 2MBFA 4M3BA 5F04A 5B1BH 4BJTA 2ESHA 2H6BA 2QVOA 3HL2A 2N8GA 5HS8A 4BL0B 3MKLA 4CXFA 1FMVA 2QKLB 2VXZA 2V9VA 3EUAA 5AIQA 3G6EI 3GTGJ 1FIPA 3KZIC 1MMSA 1TW3A 4XR6A 4WXDA 2ELKA 2V79A 4Q48A 3GTQJ 2Q8KA 3JRFA 3DTIA 2ZNZA 3T8RA 2JTVA 3OYDA 3GTLJ 5FLXK 3QPHA 1NG6A 2AXTC 4RGRA 5FRMA 2MABA 2WB1A 2L9VA 5J40A 2W84A 5JHFA 3L1PA 3FX3A 1FOKA 3LSIA 3K4MA 4XN0A 1FPQA 3FMRA 5F08A 1OR7A 2DODA 2WY8Q 2VC0A 1JT0A 5BOXA 2YU3A 3BZCA 1YITI 1V55H 3ZQGA 3JRAA 3CCMI 1N75A 3H35A 5DYMA 2TRTA 4XRSG 3GCMA 2CW8A 3G3ZA 1CF7B 1Z91A 3GTJJ 3ULQB 3L2RA 1VNDA 1FOXA 3GEZA 2KRHA 4MQ9F 1WJCA 1UELB 1P4WA 3JRCA 1DP3A 2R7TA 1YRNB 2V1XA 1OLTA 3I4NJ 1ZRFA 1U9OA 3TW7A 2XGCA 2XPUA 4FHTA 2XF5A 2O8KA 3PQJA 4A3EJ 1JGGA 3WTXC 3KP6A 4CCOA 5HNFA 5E1XA 4IOAF 3CMYA 2XKOA 2VC1A 5J4YA 1X19A 4J00A 1S3JA 2GIZA 1RRJA 5CKTA 1PYVA 4NC8A 1KQ9A 1IAWA 3VSKA 1OCOH 3FBNB 5FB2A 4OMZA 3KYDB 4B3AA 5E79C 3P9CA 2OA4A 1LE8B 2KRCA 1Y8RB 2LY1A 5DTDA 1S7EA 1U5TB 3R4KA 3R61A 3H9JA 2CUZA 3G1MA 1KZHA 4N4OB 3OSGA 4B44A 1B8IB 1XMAA 1RESA 4PJJA 5A2QZ 4O3MA 3DCFA 4F93B 2QZ8A 4MNUA 4XQFA 3P7NA 4Y33A 1G59A 3BC8A 4FASD 4N9IA 2QQBA 3A4CA 3AFHA 3ZQLA 1WGXA 3C2GA 3M4OJ 2L9RA 5FD5A 4CCMA 2X51A 4LG3A 4RA2A 1J75A 4IRGA 1VQOI 2XAFA 4LB5A 3IKTA 2NXNB 4HF1A 2IA1A 4XLCA 3CF2A 2ECBA 4OINF 1QGPA 3W2AA 2PJPA 2YUSA 2IP2A 3SEQA 1XSDA 2O0YA 3IC7A 3KZYA 3M8FA 1K6YA 5D4SA 1MH4A 2CRGA 4II2A 3EDPA 4P1WA 1WPKA 1FC3A 2KISA 2I8DA 4QSHA 2TCTA 4PJLA 5EEHA 3S17J 1SEUA 1I3AA 1MSFC 3A1YA 4U0YA 3IAS2 2LMDA 2P0WA 1YHQI 3BY6A 3G1LA 4YFXF 3JAMZ 3UNGC 1OCZH 1JE8A 5IP7J 5LGTA 2QQAA 4BKXA 2EFOA 2F48A 5E8IA 4M9XA 4AIHA 2ISZA 2JRMA 1H8AC 4G7OF 3RYPA 2DAOA 3R6SA 4BDZA 4IEJA 3QPLA 1LDKB 4EJVA 1FTTA 3CDIA 2G7HA 4M9SA 5D6FA 2I10A 2Y30A 3PM1A 3ZQHA 1IN8A 1K83J 3WTSC 2JA5J 3NRVA 5KK1A 4YFKF 3TW6A 2BE5F 4F7ZA 3M1EA 4BXFA 4GCVA 2FEZA 4BY7J 5E18F 2R7ZJ 1XDSA 4LB6B 3I4MJ 3Q0VA 3FXUA 1UMQA 4R1HA 3L00A 3SYTA 5D8LB 4A3KJ 3O8GA 4A3GJ 5JLXA 1ZQ3P 4HOBA 2XGDA 3BP8A 2VODA 1XGSA 3FM5A 1HDDC 1FJLA 4XOPA 3ISPA 4P96A 3F23A 2BBYA 3OOPA 5DEQA 4QPQA 5HDNA 3ABKH 3KX2A 2XV4S 5FLMJ 2VBZA 4BQOA 5GAEJ 2X9DA 3TP0A 3ZQCA 1R1UA 2RDPA 5D5WB 4LMYA 3QU3A 5FKLA 3W6KB 1EH7A 3L2UA 2CV2A 3L2WA 2DA4A 2HPMA 4S05A 2Z9OA 2RVCA 1ON1A 3OOUA 5IP9J 3ZPLA 2OAZA 3QPTA 1TWFJ 3ZQ7A 3S15J 3EUHA 3HHGA 4M6YA 4RMNA 4ZTFA 1YQAA 2ADUA 2DMUA 5CVRA 2WV0A 3KEYA 4WK8F 1K7AA 3I55I 1VQ4I 2DT5A 2KIQA 4BXXJ 2LF7A 1D5VA 2Q2EA 2JPBA 3GFMA 4OIRF 2ZJPF 1W7PB 2KKOA 1ETWA 1E2XA 1MBJA 4M3FA 2F6CA 1EH8A 4UY8I 3S3MA 3O8HA 2A68F 1USSA 2E1MC 1FWZA 3PFIA 1IRFA 4FX0A 2VQGA 4O5VA 1LFBA 3HSRA 2QCOA 1RR8C 5ICCA 4OAZA 1MNMC 4AIKA 3BT9A 2EFPA 3E5XA 3G2BA 4HBLA 1QRYA 4HLXA 2DMQA 4B43A 5C4JJ 1KU9A 2CQXA 3VYRB 2NNYA 5LLQA 3P9KA 3DFGA 4BS9A 3ZMUA 4RM3A 3PO2J 3BG3A 3V8LA 2OU2A 1TNTA 1QZYA 3MZ8A 2PJRB 1L3LA 2EFNA 4Y13A 4KMUX 4M6VA 1P6RA 2COBA 3DBHB 2MLGA 2IVMA 1OCTC 1Y0NA 3HC7A 2F5VA 3CCJI 3QPSA 4BACA 3MKZA 1EH6A 1OKRA 1WJDA 1DPUA 2QGUA 1I27A 4IHYA 3HRSA 3KZZA 1N25A 2NRAC 1XMXA 1WKMA 2KP6A 2HVSA 3EYIA 2LY9A 2EJRA 2PFBA 2Q0OA 3H3UA 4B1RA 1V4RA 4B8XA 3BQZA 3AL0B 2K9LA 1VQ6I 2P7VB 1ETQA 1ZARA 5EYRA 4BE0A 1ZN2A 3HSFA 1BM9A 1Z7UA 2L3DA 9ANTA 1LEBA 5HS9A 1H9TA 3KYLA 3OYLA 3HOVJ 1CGPA 3CUQB 4UB6C 4ABZA 4CCLA 1VFCA 2E5NA 2W00A 4L18B 2MYSA 2VL8A 4GRIA 4E7ZA 1WRJA 3I9V2 2ZSIB 3SQNA 4AYBN 1ETYA 1DGRM 2WAQN 1ACIA 1KGSA 2BV6A 1ZG1A 3ZMSA 3U2RA 2EA2A 3Q9SA 4RGXA 3FXLA 2GQQA 2W4SA 4C3HJ 3DPUA 4BDYA 2Z99A 2V9KA 3DTKA 1BI0A 2DCEA 1VI0A 2ZCWA 4J01A 3GLLA 1VQ9I 2CV1A 2R3SA 3OIOA 1OYWA 4I2OA 3ZQFA 3ESWB 1YRNA 2E2JJ 5BPDA 3OYJA 4RB3C 1ZGJA 3CUOA 2DK5A 2CQQA 1XPXA 2WBMA 3MD2A 3T8TA 2KZVA 4U0WA 2CYYA 1A35A 3FXQA 3BG6A 1WHUA 4GYGA 4HQMA 2LK2A 1A04A 1MMAA 4XBFA 3B6AA 3F6OA 4R79A 2XUBA 2M8GX 3BR1A 4HLYA 1VQNI 4M9ZA 1LB2A 5HS7A 1XX5A 2XPWA 4A0XA 1B72A 3FF5A 3TO6A 3GF2A 1SAUA 3G1OA 2E60A 4XLNF 2M30A 4IHVA 1MBHA 3LSRA 1D1AA 2NS8A 3S2WA 3K4BA 1ENHA 3E5UA 5LFAA 5LBQA 1LE8A 4M6XA 1UAAA 2FBIA 3QYBA 3CLQA 1O7FA 4BQNA 2VT2A 1T0FA 3LAPA 4G9YA 2WV1A 4XSZF 1BC8C 1R7JA 4CUGA 1TWCJ 3H5RA 3F6VA 1HLVA 3J7YJ 2D45A 1QU3A 1WZ2A 4MGRA 2JUGA 2EQRA 2J5OA 4LLLA 2M0MA 1ZG5A 4G7ZF 2HOSA 3G73A 2GXBA 1X58A 2CG4A 4D1QA 3EYYA 3OYKA 3KFWX 2IGMA 2FQ4A 4BH9A 3TDZC 2LKPA 4Y7NJ 3FBIB 3FZVA 3RIRA 4JX6A 5EJCA 2JSCA 2M2EA 3GFJA 3S8PA 5FO5A 1R4NB 2FOKA 1YS6A 3FKIJ 3JRHA 2HXIA 4DNCA 1YLFA 4JX4A 1MDMB 1I1SA 2GIVA 3PQKA 1BW5A 2Y0SA 1GUUA 1U9NA 4HEA2 4KA4A 1EJ9A 1HSJA 4L9VA 1ZGWA 1JUMA 3W6VA 2EIMH 5TISC 2O6GE 3E1SA 2OJED 1IG7A 2ZMEA 2E2HJ 2M3AA 1J9IA 2NOGA 1P7JA 2LDUA 1MJ9A 3KEOA 3MMYB 3T1BA 3VYTB 5DUIA 5CQGA 3S2DJ 1TW2A 4ENJA 5CVUA 5IT9Z 1YO5C 4G6TB 1R58A 2P5VA 4I98B 5LEJA 2HZDA 4PCQA 5DS9A 1FSHA 4MEXF 3DF8A 4PGHA 2Y31A 1FZPB 5DM6F 1BOBA 2RNJA 2LH9A 1R36A 2JPCA 2NVQJ 4YG2F 3F0CA 3ZR8X 1QVTA 4LGWA 1Y56A 2XDVA 1LJ9A 3K0LA 3F21A 3DEWA 2B0LA 2LG4A 5IOZA 3CF5F 4KMFA 3GUDA 4E7LA 3A01A 3CMEI 4D7NA 2L4MA 2FNPA 3RKYA 4EEFG 1D0YA 1H89C 2FBHA 3LQQA 1T08B 4S0HB 3C2BA 2ME6A 1ITYA 2O7OA 1GV2A 2BEOA 3DLAA 5E3OA 1WCMJ 2MW8A 1WJEA 1T6SA 2JRTA 3KP3A 3M8EA 4KT6A 3DV8A 4HNUA 1IRGA 1G3SA 3L2QA 1R6RA 3TBIA 3WG7H 3HOSA 2K9NA 4GXOA 1ZTRA 1P9QC 3PNVA 2MFZA 1EA3A 3OIQA 3ML6A 2QEXI 4ZDOA 2H94A 1MGTA 1Z21A 2LY2A 1V5EA 1V5FA 3LSMA 1PDNC 2HS5A 2KDOA 3CP8A 1BL0A 2PLYA 2ICWG 3K1PA 3KIOA 1UZCA 4HW0A 1TTYA 4G94A 1G4DA 3HB9A 1X3ZB 3E0JB 2L54A 4QPOA 4L0YB 2VBWA 2DDAA 1D0ZA 2VE9A 4OIQF 2DQRA 5TRDA 5BS6A 5IPAA 1X3UA 4WXHA 1YOVB 5E1WA 5K5RA 2EILH 3MWMA 4XOTA 1FBQA 3HGYA 4U87A 5KAFC 4DBQA 4HRIA 3OS1A 1E0EA 5M3FJ 1JKQC 3FK7A 4FCYA 2KRFA 2HOAA 4AWXB 1UHWA 2BOLA 1APLC 4L5IA 2ID6A 3IRQA 1WJBA 2YPRA 2P81A 3I4PA 3IWZA 2DA5A 4IHWA 2QBYA 1NHAA 5HNHA 2QSGX 4AD9A 4HAMA 1IV8A 2DYSH 2CW0F 4TV7A 4IO9F 2OF7A 5D5UB 2STTA 3ZOBA 1SFOJ 2Q2EB 4UVAA 3AG4H 2O5RA 4IL6C 1BOAA 3W2VA 4OU0A 1F36A 4RB2C 5LHIA 5C3EJ 4IJAA 4UV9A 2NVUB 2GLOA 1WJFA 5J8FA 1MNDA 1KU3A 4II3A 1N77A 2YX7A 1K61A 2JA7J 2DW4A 3K6GA 3WHCA 4CO8A 3A0HC 2QQ8A 5DV5A 2W1OA 3SEZA 4LFUA 3CUQA 2YU9J 1IRZA 2JMWA 2O8XA 1YYVA 3DXJF 2WTEA 3GFIA 2HZTA 3E6BA 1BR2A 1ONVA 1H9GA 1LKXA 2P7CB 4UVBA 1JUSA 2RV8A 2LFBA 4RM2A 4ITVA 3ERMA 3PIOF 5HDKA 2LBFA 3V8KA 4RB0A 4F55A 2BY1A 2R7VA 2FXAA 4XLAA 4HDUA 1JKPC 2ZFWA 2VBYA 3K1MA 2E1CA 5E1ZB 1HKSA 2YS9A 3WGHA 4IHTA 2QYOA 3HTSB 2JQ7A 3KP2A 1QNTA 1V5GA 2WY7Q 3M9AA 1DQUA 3Q9VA 2VPLA 2Z5UA 2DFHA 4I02A 2NYXA 1AU7A 4N0BA 5M5XJ 2A3SA 2X1DA 4CICA 2ZXIA 3OYMA 5ILVA 4I0BA 2XAUA 1IUYA 4HA8A 4KJZA 5HVQC 2MC4A 2X1CA 3K4JA 3U1KA 1AA7A 3MAJA 4K2EA 4AUXA 1QQIA 2IS2A 4X0GA 3KPHA 2LREA 3DKXA 2V6EA 1IGNA 2L01A 1S7OA 2BVLA 3B73A 2VONA 1X1BA 2CQ7A 4E6KG 1IRXA 1Z0XA 2G9WA 5E3MA 1D1CA 2ZJRF 2R7FA 3LA2A 1WI9A 3RI4A 2L7KA 1REPC 4PDKA 3LA3A 5BQTA 2VKVA 4GFBA 1G2HA 4WCGA 1W4MA 2WAEA 1F9NA 1K78A 1YFHA 1I50J 1RKWA 2V6CA 2Z1DA 4E7KA 1XCVA 2P5KA 3ZRGA 2BXYA 3TQNA 2HVRA 1R1TA 2RGVA 2EZLA 3FXOA 3NARA 1SD7A 3BG9A 5L3EA 1IZ1A 2OC6A 4IX7A 2RNGA 4NB5A 4F91B 3AAFA 1AWCA 5CVJA 3LAJA 4PUSA 2EZIA 4HV6A 1S9HA 4HNTA 4XRFA 3PSFA 1BI2A 2H1LA 1VQPI 1MKMA 4EJOA 3QP5A 2F2EA 1MDMA 1B72B 2EIKH 3MFKA 3ECHA 2HKXA 1KU2A 5FFZA 3L2CA 3QU6A 2C6YA 1TBXA 5B3SH 1Z1DA 1XSXA 3DPTA 3G4SI 3HUGA 1T56A 3D5LA 1YJNI 3F8BA 4L9TA 1YS7A 4HDVA 1VQLI 2W85A 1XCBA 2XPVA 3P9IA 4KITB 1UCRA 2NS7A 4FETA 2M87A 3EQLF 4Y4RA 2BGCA 2PBIA 3H0GJ 2K4JA 5K1YA 5LRRA 3TMOA 1Z3YA 3BTJA 1D3YA 5M5YJ 2OPTA 3HJEA 5CPRB 5H6RA 3K10A 3HZJA 1TWHJ 3KEQA 3K69A 5J6XA 1SMYF 4P9FA 1S29A 3OYCA 1UG0A 3ROUA 3ZCOA 4ZDLA 1TQMA 3PNYA 4P5OA 4H4KC 4M74A 1Y39A 4YFNF 3JRBA 1E3PA 4EJUA 3MZHA 1W0UA 1IJWC 3OYFA 2FNAA 4MTDA 1D5YA 2L02A 1EV7A 4ENKA 1IN5A 2VN2A 4PJNA 3BZ6A 3CESA 1Z3XA 5TJJA 3CDHA 1C0WA 1LUJB 2MH9A 1HF0A 2M8EA 3RSNA 4B48A 4E7SA 3KP7A 3RJPA 3T0YA 1RIOH 2FRHA 2IW5A 3TKYA 1OYYA 1B9NA 4NBQA 2M7AA 1ETKA 2HFHA 1FMWA 3OYBA 2FBKA 1DU6A 5J4VA 2ZMEB 3FMSA 2P4WA 4GYIA 3RKXA 2JZYA 4NHJA 5F27A 5A2QK 2HVQA 3U9GA 1FP1D 3K1NA 4IRIA 2IA2A 3H3VK 2R7QA 2XKPA 4LD5A 1OYIA 3WGIA 1X1PA 1SANA 1W36D 1TC3C 2RREA 5EEGA 3DTEA 3L2VA 3QODA 3OIPA 1MMGA 3HOTA 2L0KA 4C2MJ 3LSJA 1RETA 2PMUA 4PSWA 4EM0B 1XS9A 1YX5A 1TWGJ 1ZREA 4PJ0C 1A5JA 3NQOA 4A93J 2PMZA 2X6WA 3DPLC 1FBSA 1PUFB 2IJLA 4L0ZB 3S14J 1EF4A 4LK0F 5ILSA 2W82A 1D8KA 4BHBA 1QZZA 2UZKA 2Y69H 1P92A 3BOQA 3OMYA 4NC6A 4HSRA 3A01B 4ETSA 3GFLA 2Z16A 2R5YB 4BE1A 5KNLA 1YW9A 2JT1A 2IS1A 2K3PA 4P9UA 2EWNA 4N9HA 2VJJA 4Z2YA 2O9LA 3HPHA 4I09A 3PL8A 3BJAA 1SVOA 2QSHX 3L09A 3TOAA 1S5LC 3JAMK 2WWYA 2LNBA 4CA0A 3M3YJ 4MO7A 3A03A 4RLQA 1P4AA 2H8WA 3EPZA 5FD6A 1XG1A 4XIDA 2XC7A 1WJ5A 3TO9A 1D8JA 1KONA 1ZH5A 2NOJB 2A6TA 3C18A 3RZDJ 2K85A 5L3GA 4RS8A 3RYRA 5HODA 1MBGA 1BA5A 5FKMA 5J1RA 3BTCA 1LEAA 1IN6A 4IQ4A 2RC4A 3MKWB 4HSTA 1WSUA 2CJJA 2FMYA 2E5ZA 1BR1A 3ONQA 2R0QC 1T2KA 1FBUA 3FK6A 3W6JB 4F52A 1YJWI 4GDFA 4M3GA 1VQMI 4BXUA 5GAHJ 2LD5A 2KMUA 3GMEA 2DJNA 5E3LA 4IPAA 3ECOA 3LSTA 5GTHC 2H1KA 2R93J 3DLLF 2E2IJ 1X2MA 1LNWA 3J7AO
chains in the Genus database with same CATH topology
4FISA 5IYBJ 3WHBA 5IYCJ 1X58A 4A69C 1W0TA 5E3NA 2MG4A 2FQ4A 1CQTA 1ETVA 2PMZN 2RAEA 1OJLA 4Y7NJ 4JX6A 1AKHA 3BR6A 2DMTA 2M2EA 4A3CJ 2HDDA 1Y1VJ 5EZHA 3FKIJ 2R5ZA 2Y9ZA 1ZR2A 2QF7A 2HXIA 3JRHA 4RDUA 4XRSA 2LVSA 4JX4A 1BW5A 1GUUA 5C4XJ 1U9NA 2E1OA 1JUMA 1ZGWA 2HOTA 3W6VA 2XRLA 4V2FA 4BBSJ 3HOZJ 5M5WJ 3CQZJ 4FTHA 1IG7A 3A02A 4A3JJ 1ZR4A 2E2HJ 1NK3P 2NVTJ 2NOGA 5C44J 1NTCA 1P7JA 1R9TJ 1MSEC 1IUFA 3PO3J 4HNVA 2GM4A 4JP0A 2L7FP 3S2DJ 5EGOA 3K2AA 2LP0A 2JA6J 1RR7A 4BBRJ 1ZKGA 5K7FA 3E7LA 3HOUJ 3HBLA 2NVXJ 4C3IJ 5DS9A 4FE7A 2Y31A 3BR2A 1UG2A 4B4CA 1ORKA 2X6OA 3QQAA 4M3BA 5F04A 1JJ8C 2NVQJ 4MFEA 2N8GA 1IV6A 1DU0A 3F0CA 1QVTA 3MKLA 1IC8A 5FKOA 3JRDA 3VPRA 1GVDA 2VPRA 3DEWA 3GTGJ 1FIPA 5IOZA 3BR5A 3HKZN 4D7NA 3A01A 2ELKA 2FX0A 4RBOA 4EEFG 1JJ6C 3JRFA 3GTQJ 3GTLJ 1H89C 2DN0A 1POGA 4S0HB 3C2BA 2ME6A 1ITYA 2CUEA 2O7OA 5F1JA 4FE4A 1GV2A 5E3OA 3RZOJ 1WCMJ 2MW8A 3L1PA 2Y0SN 2JA8J 2FD5A 4UUSA 3S1NJ 5F08A 3JRGA 4QTRA 2K9NA 5F0HA 4CYCA 1JT0A 1ZTRA 3HEFA 4MIMA 3TP3A 2DMNA 3ZQGA 3JRAA 2HQ5A 2TRTA 4D7MA 4XRSG 4A3MJ 1BL0A 3BR3A 3GTJJ 5M3MJ 3HB9A 2CU7A 2W48A 1VNDA 1RKTA 5J3LA 4LOCA 1P7IA 4QIWN 2DA1A 2JJ7A 2E19A 5IPAA 2XB0X 3JRCA 1YRNB 3I4NJ 1IDZA 1U9OA 4C3JJ 3TW7A 2XGCA 3HGYA 2XPUA 5EDNA 2X48A 3OSFA 5M3FJ 1JKQC 2O8KA 3S1MJ 4A3EJ 3FK7A 1JGGA 2LR8A 2Y2ZA 4FCYA 3CMYA 1Y1WJ 5EG0B 2HOAA 1HOMA 4M3DA 3IH3A 1AHDP 3TEDA 2XGEA 1APLC 2ID6A 2K9QA 4XRMA 1T33A 5K7ZA 2P81A 3K7AJ 3RKQA 2DA5A 4IHWA 3HOXJ 5GPAA 4B3AA 3JRIA 3CCYA 3BG5A 5GPCA 1LE8B 4A3LJ 5DTDA 2OF7A 5F0CA 1S7EA 3ZOBA 1SFOJ 2IEKA 2HXOA 2M34A 1WH5A 3G1MA 3OSGA 1B8IB 2K40A 3UKGA 1F36A 1RESA 2EBIA 3SFIA 5C3EJ 3DCFA 4G12A 2GLOA 3JR9A 2XSDC 3ZQLA 1WGXA 1K61A 3M4OJ 2L9RA 3LSGA 4MLOA 3WHCA 2JA7J 3Q0UA 3BTIA 2ECCA 2YU9J 1IRZA 2JMWA 4UUTA 1MBKA 3SDGA 1H88C 1BJZA 2LLKA 1WH7A 2JK3A 2ECBA 5J1YA 1AKHB 3BR0A 1JUSA 2YUSA 1TWAJ 2LFBA 3IV5A 4JX5A 3HOYJ 2CUFA 2L7MP 1MH4A 2CRGA 1WPKA 2B63J 1RPWA 4QSHA 3GTPJ 2TCTA 2DA2A 3S17J 1MSFC 2DA3A 1FIAA 1JKPC 1PUFA 2YS9A 4A3IJ 3G1LA 1WI3A 3SJMA 4I6ZA 3GTKJ 2VKEA 1JT6A 2KT0A 5IP7J 3LNQA 4BKXA 1F43A 2R5YA 1OFCX 5F0FA 1LFUP 3B6CA 1AU7A 1H8AC 4X1EA 3FIWA 5M5XJ 2D5VA 2MSYA 5IP6A 4IEJA 3QPLA 1FTTA 3HOWJ 4AUXA 2DA7A 2H8RA 2I10A 2Y30A 3PM1A 3ZQHA 1K83J 2EZKA 2JA5J 4A3DJ 2HYJA 1IGNA 3TW6A 3Q3SA 4BY7J 2R7ZJ 1ZK8A 1Z0XA 3I4MJ 3Q0VA 5E3MA 1UMQA 3NAUA 4DYRA 4A3KJ 3O8GA 4AC0A 5JLXA 1ZQ3P 4A3GJ 1Z77A 2AHQA 2XGDA 1HDDC 2VKVA 1FJLA 4GFBA 4W1UA 1G2HA 4A3FJ 3S2HJ 2L7ZA 1I50J 1RKWA 1XC5A 5FLMJ 3ZQCA 2X9DA 3TP0A 1MBEA 5FKLA 2EZLA 2DA4A 3FISA 3BTLA 3NARA 1GV5A 5FLVA 3BG9A 3OOUA 4UUSB 1UHSA 5IP9J 3S1RJ 1TWFJ 3S15J 2Y9YA 1E3OC 3GTMJ 4D5CA 1QPIA 2EZIA 2DMUA 4I76A 5EEAA 4BXXJ 4DYQA 1B72B 1QVUA 1JTXA 4JYKA 2WB1N 1VF9A 4NDLA 1ETWA 1B8IA 1MBJA 1U8BA 4J19A 4M3FA 2R92J 1T56A 3O8HA 5FKKA 3BQYA 1LFBA 2XPVA 2QCOA 1MNMC 1I6HJ 2NS7A 1FEXA 3BT9A 5IYDJ 1QRYA 2M9HA 3RQIA 2DMQA 1ETXA 3H0GJ 5C4JJ 3BTJA 2CQXA 5M5YJ 2OPTA 4XICA 4L5EA 1TWHJ 3LSPA 1JUPA 4Y52J 2LTPA 1U78A 3MN2A 3PO2J 2JN6A 2K9SA 2ID3A 3BG3A 3IH2A 3JRBA 1W0UA 1IJWC 3Q0WA 2EZHA 4M6VA 1NK2P 2COBA 1D5YA 1OCTC 5GP9A 1Q1VA 3QPSA 1HCRA 4IHYA 1ETOA 2R5ZB 2IBDA 1HF0A 2VUMJ 5J1UA 3LOCA 2LY9A 2KDZA 5K7HA 3MVPA 2MGQA 4B1RA 3HGGA 3BQZA 1ETKA 1ETQA 1FTZA 2IAIA 5EYRA 1DU6A 9ANTA 5JLWA 1X2NA 4DZJA 3HOVJ 4ABZA 1VFCA 3S1QJ 5F27A 2VI6A 3H3VK 5EGOB 4M3EA 3JREA 4AYBN 4BY1J 1ETYA 2GBYA 4A3BJ 1MBFA 1SANA 2WAQN 3IH4A 2DTZA 2NVYJ 1TC3C 4W97A 4XK4A 5BNGA 2G0EA 3CDLA 4V2GA 2L0KA 4C2MJ 4C3HJ 3LSJA 1RETA 1XS9A 1TWGJ 1O4XA 1MH3A 1VI0A 1A5JA 4D5FA 5IOYA 4A93J 2XB5A 3OIOA 1GDTA 3ZQFA 4X6AJ 1A6IA 4DZPA 2M0CA 1PUFB 1YRNA 2E2JJ 2JWTA 3GTOJ 3S14J 1EF4A 2ME0A 2CQQA 1I3QJ 2EH3A 3GBGA 4DW6A 3A01B 2DA6A 2ZB9A 2R5YB 2LK2A 3B6AA 5FJ8J 3D1NI 5EG0A 1GT0C 2O9LA 2M8GX 3ZQIA 3BR1A 1IDYA 5EZGA 2AO9A 2FJ1A 1OCPA 2DMPA 3M3YJ 4MO7A 3A03A 2XPWA 1B72A 4XIDA 1XG1A 3G1OA 4IHVA 1MBHA 5EF6A 4CYCB 3LSRA 2NS8A 3RZDJ 1ENHA 1LE8A 1BW6A 3HM5A 1HDPA 4IHXA 3HDDA 2HI3A 1JKOC 5HODA 1MBGA 1BA5A 5FKMA 5J1RA 3BTCA 5FKNA 4DYCA 1JTYA 2CJJA 2WV1A 2R0QC 3FK6A 1TWCJ 4M3GA 1HLVA 2LD5A 3S16J 4MFDA 2DJNA 5E3LA 2LKXA 1JKRC 2H1KA 2R93J 2EQRA 2E2IJ 1X2MA 2HOSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FIS A;  5IYB J;  3WHB A;  5IYC J;  1X58 A;  4A69 C;  1W0T A;  5E3N A;  2MG4 A;  2FQ4 A;  1CQT A;  1ETV A;  2PMZ N;  2RAE A;  1OJL A;  4Y7N J;  4JX6 A;  1AKH A;  3BR6 A;  2DMT A;  2M2E A;  4A3C J;  2HDD A;  1Y1V J;  5EZH A;  3FKI J;  2R5Z A;  2Y9Z A;  1ZR2 A;  2QF7 A;  2HXI A;  3JRH A;  4RDU A;  4XRS A;  2LVS A;  4JX4 A;  1BW5 A;  1GUU A;  5C4X J;  1U9N A;  2E1O A;  1JUM A;  1ZGW A;  2HOT A;  3W6V A;  2XRL A;  4V2F A;  4BBS J;  3HOZ J;  5M5W J;  3CQZ J;  4FTH A;  1IG7 A;  3A02 A;  4A3J J;  1ZR4 A;  2E2H J;  1NK3 P;  2NVT J;  2NOG A;  5C44 J;  1NTC A;  1P7J A;  1R9T J;  1MSE C;  1IUF A;  3PO3 J;  4HNV A;  2GM4 A;  4JP0 A;  2L7F P;  3S2D J;  5EGO A;  3K2A A;  2LP0 A;  2JA6 J;  1RR7 A;  4BBR J;  1ZKG A;  5K7F A;  3E7L A;  3HOU J;  3HBL A;  2NVX J;  4C3I J;  5DS9 A;  4FE7 A;  2Y31 A;  3BR2 A;  1UG2 A;  4B4C A;  1ORK A;  2X6O A;  3QQA A;  4M3B A;  5F04 A;  1JJ8 C;  2NVQ J;  4MFE A;  2N8G A;  1IV6 A;  1DU0 A;  3F0C A;  1QVT A;  3MKL A;  1IC8 A;  5FKO A;  3JRD A;  3VPR A;  1GVD A;  2VPR A;  3DEW A;  3GTG J;  1FIP A;  5IOZ A;  3BR5 A;  3HKZ N;  4D7N A;  3A01 A;  2ELK A;  2FX0 A;  4RBO A;  4EEF G;  1JJ6 C;  3JRF A;  3GTQ J;  3GTL J;  1H89 C;  2DN0 A;  1POG A;  4S0H B;  3C2B A;  2ME6 A;  1ITY A;  2CUE A;  2O7O A;  5F1J A;  4FE4 A;  1GV2 A;  5E3O A;  3RZO J;  1WCM J;  2MW8 A;  3L1P A;  2Y0S N;  2JA8 J;  2FD5 A;  4UUS A;  3S1N J;  5F08 A;  3JRG A;  4QTR A;  2K9N A;  5F0H A;  4CYC A;  1JT0 A;  1ZTR A;  3HEF A;  4MIM A;  3TP3 A;  2DMN A;  3ZQG A;  3JRA A;  2HQ5 A;  2TRT A;  4D7M A;  4XRS G;  4A3M J;  1BL0 A;  3BR3 A;  3GTJ J;  5M3M J;  3HB9 A;  2CU7 A;  2W48 A;  1VND A;  1RKT A;  5J3L A;  4LOC A;  1P7I A;  4QIW N;  2DA1 A;  2JJ7 A;  2E19 A;  5IPA A;  2XB0 X;  3JRC A;  1YRN B;  3I4N J;  1IDZ A;  1U9O A;  4C3J J;  3TW7 A;  2XGC A;  3HGY A;  2XPU A;  5EDN A;  2X48 A;  3OSF A;  5M3F J;  1JKQ C;  2O8K A;  3S1M J;  4A3E J;  3FK7 A;  1JGG A;  2LR8 A;  2Y2Z A;  4FCY A;  3CMY A;  1Y1W J;  5EG0 B;  2HOA A;  1HOM A;  4M3D A;  3IH3 A;  1AHD P;  3TED A;  2XGE A;  1APL C;  2ID6 A;  2K9Q A;  4XRM A;  1T33 A;  5K7Z A;  2P81 A;  3K7A J;  3RKQ A;  2DA5 A;  4IHW A;  3HOX J;  5GPA A;  4B3A A;  3JRI A;  3CCY A;  3BG5 A;  5GPC A;  1LE8 B;  4A3L J;  5DTD A;  2OF7 A;  5F0C A;  1S7E A;  3ZOB A;  1SFO J;  2IEK A;  2HXO A;  2M34 A;  1WH5 A;  3G1M A;  3OSG A;  1B8I B;  2K40 A;  3UKG A;  1F36 A;  1RES A;  2EBI A;  3SFI A;  5C3E J;  3DCF A;  4G12 A;  2GLO A;  3JR9 A;  2XSD C;  3ZQL A;  1WGX A;  1K61 A;  3M4O J;  2L9R A;  3LSG A;  4MLO A;  3WHC A;  2JA7 J;  3Q0U A;  3BTI A;  2ECC A;  2YU9 J;  1IRZ A;  2JMW A;  4UUT A;  1MBK A;  3SDG A;  1H88 C;  1BJZ A;  2LLK A;  1WH7 A;  2JK3 A;  2ECB A;  5J1Y A;  1AKH B;  3BR0 A;  1JUS A;  2YUS A;  1TWA J;  2LFB A;  3IV5 A;  4JX5 A;  3HOY J;  2CUF A;  2L7M P;  1MH4 A;  2CRG A;  1WPK A;  2B63 J;  1RPW A;  4QSH A;  3GTP J;  2TCT A;  2DA2 A;  3S17 J;  1MSF C;  2DA3 A;  1FIA A;  1JKP C;  1PUF A;  2YS9 A;  4A3I J;  3G1L A;  1WI3 A;  3SJM A;  4I6Z A;  3GTK J;  2VKE A;  1JT6 A;  2KT0 A;  5IP7 J;  3LNQ A;  4BKX A;  1F43 A;  2R5Y A;  1OFC X;  5F0F A;  1LFU P;  3B6C A;  1AU7 A;  1H8A C;  4X1E A;  3FIW A;  5M5X J;  2D5V A;  2MSY A;  5IP6 A;  4IEJ A;  3QPL A;  1FTT A;  3HOW J;  4AUX A;  2DA7 A;  2H8R A;  2I10 A;  2Y30 A;  3PM1 A;  3ZQH A;  1K83 J;  2EZK A;  2JA5 J;  4A3D J;  2HYJ A;  1IGN A;  3TW6 A;  3Q3S A;  4BY7 J;  2R7Z J;  1ZK8 A;  1Z0X A;  3I4M J;  3Q0V A;  5E3M A;  1UMQ A;  3NAU A;  4DYR A;  4A3K J;  3O8G A;  4AC0 A;  5JLX A;  1ZQ3 P;  4A3G J;  1Z77 A;  2AHQ A;  2XGD A;  1HDD C;  2VKV A;  1FJL A;  4GFB A;  4W1U A;  1G2H A;  4A3F J;  3S2H J;  2L7Z A;  1I50 J;  1RKW A;  1XC5 A;  5FLM J;  3ZQC A;  2X9D A;  3TP0 A;  1MBE A;  5FKL A;  2EZL A;  2DA4 A;  3FIS A;  3BTL A;  3NAR A;  1GV5 A;  5FLV A;  3BG9 A;  3OOU A;  4UUS B;  1UHS A;  5IP9 J;  3S1R J;  1TWF J;  3S15 J;  2Y9Y A;  1E3O C;  3GTM J;  4D5C A;  1QPI A;  2EZI A;  2DMU A;  4I76 A;  5EEA A;  4BXX J;  4DYQ A;  1B72 B;  1QVU A;  1JTX A;  4JYK A;  2WB1 N;  1VF9 A;  4NDL A;  1ETW A;  1B8I A;  1MBJ A;  1U8B A;  4J19 A;  4M3F A;  2R92 J;  1T56 A;  3O8H A;  5FKK A;  3BQY A;  1LFB A;  2XPV A;  2QCO A;  1MNM C;  1I6H J;  2NS7 A;  1FEX A;  3BT9 A;  5IYD J;  1QRY A;  2M9H A;  3RQI A;  2DMQ A;  1ETX A;  3H0G J;  5C4J J;  3BTJ A;  2CQX A;  5M5Y J;  2OPT A;  4XIC A;  4L5E A;  1TWH J;  3LSP A;  1JUP A;  4Y52 J;  2LTP A;  1U78 A;  3MN2 A;  3PO2 J;  2JN6 A;  2K9S A;  2ID3 A;  3BG3 A;  3IH2 A;  3JRB A;  1W0U A;  1IJW C;  3Q0W A;  2EZH A;  4M6V A;  1NK2 P;  2COB A;  1D5Y A;  1OCT C;  5GP9 A;  1Q1V A;  3QPS A;  1HCR A;  4IHY A;  1ETO A;  2R5Z B;  2IBD A;  1HF0 A;  2VUM J;  5J1U A;  3LOC A;  2LY9 A;  2KDZ A;  5K7H A;  3MVP A;  2MGQ A;  4B1R A;  3HGG A;  3BQZ A;  1ETK A;  1ETQ A;  1FTZ A;  2IAI A;  5EYR A;  1DU6 A;  9ANT A;  5JLW A;  1X2N A;  4DZJ A;  3HOV J;  4ABZ A;  1VFC A;  3S1Q J;  5F27 A;  2VI6 A;  3H3V K;  5EGO B;  4M3E A;  3JRE A;  4AYB N;  4BY1 J;  1ETY A;  2GBY A;  4A3B J;  1MBF A;  1SAN A;  2WAQ N;  3IH4 A;  2DTZ A;  2NVY J;  1TC3 C;  4W97 A;  4XK4 A;  5BNG A;  2G0E A;  3CDL A;  4V2G A;  2L0K A;  4C2M J;  4C3H J;  3LSJ A;  1RET A;  1XS9 A;  1TWG J;  1O4X A;  1MH3 A;  1VI0 A;  1A5J A;  4D5F A;  5IOY A;  4A93 J;  2XB5 A;  3OIO A;  1GDT A;  3ZQF A;  4X6A J;  1A6I A;  4DZP A;  2M0C A;  1PUF B;  1YRN A;  2E2J J;  2JWT A;  3GTO J;  3S14 J;  1EF4 A;  2ME0 A;  2CQQ A;  1I3Q J;  2EH3 A;  3GBG A;  4DW6 A;  3A01 B;  2DA6 A;  2ZB9 A;  2R5Y B;  2LK2 A;  3B6A A;  5FJ8 J;  3D1N I;  5EG0 A;  1GT0 C;  2O9L A;  2M8G X;  3ZQI A;  3BR1 A;  1IDY A;  5EZG A;  2AO9 A;  2FJ1 A;  1OCP A;  2DMP A;  3M3Y J;  4MO7 A;  3A03 A;  2XPW A;  1B72 A;  4XID A;  1XG1 A;  3G1O A;  4IHV A;  1MBH A;  5EF6 A;  4CYC B;  3LSR A;  2NS8 A;  3RZD J;  1ENH A;  1LE8 A;  1BW6 A;  3HM5 A;  1HDP A;  4IHX A;  3HDD A;  2HI3 A;  1JKO C;  5HOD A;  1MBG A;  1BA5 A;  5FKM A;  5J1R A;  3BTC A;  5FKN A;  4DYC A;  1JTY A;  2CJJ A;  2WV1 A;  2R0Q C;  3FK6 A;  1TWC J;  4M3G A;  1HLV A;  2LD5 A;  3S16 J;  4MFD A;  2DJN A;  5E3L A;  2LKX A;  1JKR C;  2H1K A;  2R93 J;  2EQR A;  2E2I J;  1X2M A;  2HOS A; 
#chains in the Genus database with same CATH topology
 2X6Y A;  3VYU B;  4ZYG A;  5IYB J;  1SD4 A;  2X4H A;  3W3C A;  3WHB A;  3ZN0 A;  3S32 A;  4HPQ A;  3DEE A;  1CQT A;  2DTR A;  2RAE A;  1OJL A;  1Z7L A;  1Z67 A;  3COA C;  3LL7 A;  4G8X A;  3HRM A;  1NG7 A;  2DMT A;  4A3C J;  1R49 A;  4YRV A;  5HLG A;  2Z3Y A;  3KCC A;  2QF7 A;  3I54 A;  4FQG A;  2R5Z A;  4RDU A;  3DQV C;  3EUK L;  1ZRC A;  5C4X J;  1O57 A;  2FUG 2;  1HXD A;  1TP4 A;  2NNN A;  2QBY B;  2EB7 A;  3WTT C;  5LGU A;  2HOT A;  1BIA A;  4BBS J;  3HOZ J;  4L9N A;  3RPQ A;  4FTH A;  1QA6 A;  2XAH A;  5K5Q A;  2QUF A;  4JOM A;  3RKW A;  4HF2 A;  1Y0U A;  2E7X A;  3ABU A;  2UXX A;  2RKH A;  3HG9 A;  2NVT J;  1Y6I A;  2GXG A;  2CQN A;  5C44 J;  2WAF A;  3F8C A;  1R9T J;  4OAY A;  4CCJ A;  1OCC H;  3S3N A;  2GM4 A;  1P4X A;  5EGO A;  2EK5 A;  2LP0 A;  4AU7 A;  1SAX A;  1HW2 A;  1ZKG A;  3E7L A;  2Y48 A;  3H5N A;  1OQY A;  3HOU J;  4A6E A;  2GAU A;  4C3I J;  4JBA A;  3CCR I;  2ZBK A;  4FE7 A;  3QOP A;  4B4C A;  1FSE A;  3JSP A;  1JJ8 C;  3F22 A;  4B47 A;  4MFE A;  2CW7 A;  3IAM 2;  4ZZD A;  3J80 Z;  1DU0 A;  3DWL E;  4UV8 A;  4A0Z A;  1IO2 A;  3K4L A;  4KNY A;  1GVD A;  2VPR A;  3BCA A;  2W7N A;  3CJN A;  2LSO A;  2K9M A;  2KJB A;  3GW2 A;  3FHZ A;  3BR5 A;  3HKZ N;  2LBF B;  1JXS A;  2FX0 A;  4RBO A;  2VJ5 A;  1JJ6 C;  1B59 A;  2R7D A;  2ZXJ A;  1POG A;  1OR7 C;  5F1J A;  1DP7 P;  3RZO J;  1XGM A;  3C7J A;  5B66 C;  2W25 A;  2Y0S N;  2CO5 A;  2ZJ2 A;  4I7H A;  5HOO A;  1UHM A;  2JA8 J;  1YW7 A;  5DCM B;  2H09 A;  2M7B A;  3A0B C;  3CJQ B;  3BPX A;  3DP7 A;  1IXC A;  1SFX A;  4EMS A;  5JI6 A;  4QTR A;  4HQE A;  2UWM A;  3KE2 A;  4ESJ A;  3AKZ A;  3WG9 A;  5CLS A;  4IXA A;  4MIM A;  3TP3 A;  2DMN A;  2OTJ I;  2LKS A;  2UUZ A;  4PFO A;  2AS5 F;  1YE9 A;  1TZL A;  2HTJ A;  3K4K A;  5E17 F;  2HQ5 A;  3GZ5 A;  2LF8 A;  3KYC B;  3OYN A;  4A3M J;  2K3F A;  1HBX G;  2CV0 A;  1Q1H A;  2DBB A;  2M5W A;  4Y17 A;  3LA7 A;  3WU2 C;  2L5Q A;  2W48 A;  3BG7 A;  2HR3 A;  5J3L A;  1DUX C;  5FRN A;  4I01 A;  2B7E A;  2XB0 X;  4BGD A;  2HOE A;  4G6D A;  1IDZ A;  1RNL A;  4C3J J;  2XRO A;  2X48 A;  4HF0 A;  4RAZ A;  5H6Q A;  1Z6T A;  4KN7 X;  3RPU D;  2MH2 A;  1K78 B;  4UUV A;  3ZP5 A;  2QSF X;  1OMI A;  1FX7 A;  3RQ4 A;  4BU2 A;  5EG0 B;  3KP4 A;  1HOM A;  3IH3 A;  1MIJ A;  1X4P A;  3MZY A;  5FRO A;  3OYA A;  1AHD P;  3TED A;  1K79 A;  1IXR C;  3HYI A;  4XLF A;  2K9Q A;  4YEJ A;  1T33 A;  5K7Z A;  4S04 A;  4G7H F;  2MD5 A;  3K7A J;  3RKQ A;  3HPG A;  2VBX A;  1ZHF A;  5J47 A;  4KIB A;  1PP8 F;  4MTE A;  5CYV A;  5GPC A;  3KET A;  2MA3 A;  1F5T A;  2IGO A;  1J59 A;  1HQC A;  3NEU A;  2DFE A;  2K02 A;  3FXR A;  1OCR H;  2CMP A;  5F0C A;  1O3R A;  3SDB A;  2HXO A;  2M34 A;  4UXN A;  1WH5 A;  4GGG A;  4AYB A;  1GVJ A;  2MD0 A;  1J5Y A;  5JVG F;  3H36 A;  2K40 A;  4F92 B;  2EBI A;  3UKG A;  3OWT A;  4A2U A;  2LC2 A;  3I3L A;  4G12 A;  3VDX A;  2ZFU A;  4QWQ A;  3HUG B;  1XMK A;  3DU6 A;  2DFI A;  2Q1Z B;  2FQ3 A;  3Q0U A;  2BW3 A;  4EGY A;  1DPR A;  2X0L A;  3BTI A;  4DJA A;  1W1W E;  2KHM A;  4UUT A;  1H88 C;  3WU0 A;  2DPU A;  3OS0 A;  1N78 A;  4ESB A;  1HST A;  2JK3 A;  5FGM A;  4CGZ A;  1R4M B;  5J1Y A;  1VQ7 I;  3BR0 A;  4Z6Y A;  2GZW A;  2CUJ A;  3AG3 H;  1TWA J;  4JX5 A;  3HOY J;  2KPM A;  2CUF A;  2KLO A;  5KCM A;  2L7M P;  1S7A A;  3V42 A;  3AG2 H;  2CSO A;  2B63 J;  1XD7 A;  2VOO A;  3OYG A;  4KIS A;  1W5C C;  3CCU I;  3GTP J;  2HPI A;  2DA2 A;  1X1A A;  3J81 Z;  1DDN A;  2DA3 A;  3VEP A;  4M71 A;  1FIA A;  2EIN H;  5CJ9 A;  1PUF A;  4A5N A;  4E70 A;  4A3I J;  4UHT A;  2FF4 A;  2O3F A;  2DFF A;  1SVM A;  3GTK J;  2B9S A;  2KT0 A;  3LNQ A;  1JI8 A;  1F43 A;  4KUM A;  2YR2 A;  2R5Y A;  5AON A;  5F0F A;  1NH3 A;  3FIW A;  4BJ5 C;  2D5V A;  4PZJ A;  3OYH A;  2MSY A;  2OZ6 A;  3F8M A;  2RN7 A;  1IN4 A;  4XLP F;  5BPI A;  2GOM A;  3LMM A;  4HX7 A;  3HOW J;  1KU7 A;  2O61 A;  2KZG A;  2DA7 A;  2CGP A;  4EJW A;  4EM2 A;  4DGW B;  2OD5 A;  2HYJ A;  2MLK A;  1SMT A;  2M1B A;  4E7J A;  3Q3S A;  2ISY A;  4XON A;  3WTY C;  1KYZ A;  1ZK8 A;  3NWT A;  4JQF A;  2F4O B;  5FFX A;  4BQQ A;  3NAU A;  4DYR A;  4EQQ A;  3DBR B;  2AQE A;  2AHQ A;  1YI2 I;  3BJO A;  3WU1 B;  2DPD A;  4CSW A;  1V3F A;  4C9Y A;  2BXZ A;  2L7Z A;  3CCQ I;  2QM3 A;  4ZYE A;  5JFR A;  2R7O A;  2BHZ A;  2CWE A;  4CHU A;  1U6G A;  1MZB A;  1G8X A;  2OZU A;  2DI3 A;  4RB1 A;  4UUS B;  1UHS A;  1HKT A;  2BHY A;  1E3H A;  1YTY A;  3E97 A;  1K4T A;  2Y9Y A;  5HDG A;  3LFK A;  4ENN A;  3GTM J;  4D5C A;  3P5J A;  5CVI A;  3ZMT A;  5E20 A;  1ZRD A;  2HKO A;  5ICG A;  3OV8 A;  5EEA A;  4Q4Z F;  4DYQ A;  4NC7 A;  4AVP A;  3ABT A;  1PUE E;  1SVL A;  3C3W A;  4CZC A;  1MMD A;  2ZKZ A;  1QVU A;  4D9J A;  2WB1 N;  5H2F C;  3BRO A;  4J19 A;  2ZXW H;  3S3O A;  2P6T A;  4UNO A;  1KQ0 A;  2E34 A;  3GWZ A;  1EKE A;  1T95 A;  2V1N A;  1WJA A;  5L3D A;  2ZXH A;  1M1E B;  4YII A;  5D5X B;  1K4S A;  2H6C A;  2M9H A;  3CO6 C;  1QO0 D;  4F3Q A;  1GXQ A;  3H9Q A;  4CCK A;  3JTH A;  2R7X A;  1J09 A;  3QOE A;  2QLZ A;  4RGS A;  1PJR A;  1QHH D;  4XIC A;  3JCU C;  4L5E A;  2Y75 A;  3IKV A;  3GVA A;  3WTW C;  1FLI A;  3LSP A;  2L2O A;  1JUP A;  2DT6 A;  2LTP A;  3PIP F;  3MN2 A;  2STW A;  2JN6 A;  1YIO A;  5L3C A;  2DK8 A;  2ID3 A;  2L9S A;  2VB6 A;  3IH2 A;  3J7Z I;  1UFM A;  3I59 B;  2XAQ A;  2A69 F;  3J7A Y;  1K6O A;  2FOW A;  5FLX Z;  2DOE A;  2XF7 A;  4XOR A;  5GP9 A;  2R7U A;  1Q1V A;  3QRF F;  2GA2 A;  2RQP A;  3SZT A;  1RC9 A;  1ODD A;  4OWR B;  5DD8 A;  1MW7 A;  2VOP A;  2R5Z B;  3O3K A;  4Y3O A;  2VUM J;  5J1U A;  3FXK A;  2PI0 A;  2E71 A;  3F9K A;  4HYE A;  1BI1 A;  3HRT A;  2KDZ A;  1I39 A;  5K7H A;  4BAY A;  2UXN A;  2MGQ A;  1IXS B;  3RTR A;  1YIJ I;  1IF1 A;  1JHF A;  2LRD A;  3K9T A;  4PFP A;  3SZP A;  2VLA A;  2IRF G;  2IAI A;  2IXS A;  4LJZ F;  2X85 A;  1ZEL A;  5DCM A;  1X2N A;  1VZ0 A;  2COM A;  3CC7 I;  3E5Q A;  1ZAO A;  1WQ2 A;  4BEH B;  2XVC A;  3RDI A;  2A5W A;  2HWV A;  5EGO B;  2R7R A;  4M3E A;  1ULY A;  5DUK A;  5D5V B;  3I56 I;  3JRE A;  3VYS B;  2HGC A;  1MBF A;  1LQ1 A;  1XN7 A;  3Q5F A;  1YJ9 I;  2NVY J;  4EGZ A;  1FYM A;  2BZT A;  1LVK A;  5BNG A;  2IGK A;  2G0E A;  3NWS A;  2FA5 A;  2VAS A;  2IA0 A;  3VFZ A;  4V2G A;  1MMN A;  1P2F A;  2IPQ X;  4L5J A;  4XKW A;  1MH3 A;  4E7I A;  2DOF A;  2Z2S B;  4D5F A;  5IOY A;  1E17 A;  1OPC A;  2XB5 A;  1GDT A;  1U8R A;  4X6A J;  1A6I A;  4DZP A;  2A5Y B;  2M0C A;  2JWT A;  3PFY A;  2OCE A;  1HKQ A;  3I58 A;  3WTZ A;  3GBG A;  4RAG A;  3ABL H;  1W5S A;  2ZB9 A;  2K27 A;  5AIP A;  1FOY A;  3DKY A;  1R00 A;  3T5X A;  4MEY F;  5EG0 A;  3OY9 A;  4BE2 A;  1GT0 C;  2CQK A;  1TT5 B;  3ZQI A;  5HLT A;  1S8N A;  4XL9 A;  5EZG A;  1UJ8 A;  2KL4 A;  2AO9 A;  1OCP A;  4DIQ A;  3LFU A;  3OR2 C;  4ZYD A;  3MQ0 A;  2ZO4 A;  2VKH A;  4AID A;  1U5T C;  1SD6 A;  2HU9 A;  5TGT A;  1T0F C;  5B1A H;  2XSJ C;  4UVC A;  1BBY A;  1BW6 A;  3HM5 A;  1HDP A;  4DOZ A;  3I71 A;  3HDD A;  2HI3 A;  5KVR A;  2TDX A;  3GYH X;  2P6S A;  4KIG A;  2K86 A;  4ZYH A;  4YIF A;  2F5D A;  3M07 A;  2AQF A;  4XKB A;  1ZLK A;  2J5P A;  3VOE A;  3S16 J;  4MFD A;  5LHG A;  1W5T A;  4LK1 F;  2LOO A;  2BY3 A;  1U2W A;  4YEL A;  1T8I A;  4ZYA A;  3WTV C;  3F3X A;  1H0M A;  2VIX A;  3I64 A;  5IYC J;  5HLH A;  4A69 C;  3L9F A;  4IZZ A;  5E3N A;  2MG4 A;  2HQA A;  4U88 A;  2PMZ N;  3S93 A;  4IRH A;  4BHP A;  3K70 C;  2HQN A;  3ZMD A;  1STZ A;  3GO5 A;  1O3Q A;  2DDB A;  3OR1 C;  1PVE A;  4V19 K;  3GZ6 A;  4RGU A;  2VE8 A;  1ZR2 A;  5EZH A;  2Y9Z A;  4WX9 A;  1S72 I;  3QYF A;  5JVT A;  2KIU A;  3LWF A;  2LVS A;  3HSE A;  1J7K A;  2ZME C;  2ELH A;  3KLO A;  2OQG A;  2JVG A;  4AVZ A;  2XRL A;  2HDW A;  4V2F A;  3D0S A;  2ZC2 A;  3KLN A;  2QWW A;  4EV0 A;  3GZN B;  4EJT A;  3CQZ J;  2XAG A;  2M4G A;  3A02 A;  4A3J J;  5F6F A;  1VQ5 I;  2CH0 A;  1ZYR F;  1ZR4 A;  4KT5 C;  2DXI A;  2F5C A;  2D1V A;  3N4M A;  1NTC A;  2VQL A;  1KYW A;  1J2X A;  2YSR A;  1MSE C;  3BDD A;  3O6B B;  4JP0 A;  2L7F P;  2F5F A;  2WA0 A;  3K2A A;  1RR7 A;  4E4H A;  1Z6R A;  5K7F A;  1X4O A;  3BPV A;  2I5U A;  2R7W A;  4LLN A;  3QP6 A;  5CVV A;  3A2K A;  2BW3 B;  4GO1 A;  3E3V A;  3JSO A;  4JK1 X;  4XLH A;  5DM7 F;  1XTA A;  1O3T A;  2X6O A;  2E1N A;  2VQC A;  3QQA A;  3UR3 C;  1IV6 A;  4RAY A;  3K4C A;  2ETH A;  4A6D A;  1IC8 A;  5FKO A;  3JRD A;  3VPR A;  4ON0 A;  2ZJQ F;  4LIU A;  1A36 A;  1O7L A;  2FML A;  1GHC A;  4A0Y A;  1S6L A;  1R71 A;  3CO7 C;  5E8G A;  4HX4 A;  4MQV A;  2EA4 A;  2EV5 A;  2DN0 A;  1T38 A;  5GTI C;  3SXY A;  2CUE A;  4IOC F;  4FE4 A;  2EV0 A;  4BJ6 C;  1XDU A;  5JHU A;  2GOX B;  3CC4 I;  2W24 A;  1RZ4 A;  2VJI A;  3HRU A;  4RLF A;  2FD5 A;  4UUS A;  1QBJ A;  1OIS A;  2UV1 A;  3S1N J;  2FU4 A;  4Y15 A;  2OUM A;  1KQ8 A;  3JRG A;  5F0H A;  4CYC A;  2GA1 A;  3FHN A;  2GXA A;  4BNC A;  3CMA I;  3HEF A;  2IGN A;  3HHH A;  4ESF A;  2HYF A;  2HEO A;  1HW1 A;  3C1D A;  4IVN A;  4D7M A;  4B09 A;  3BR3 A;  4O6J A;  3FKJ A;  1LFP A;  5ILU A;  5ICE A;  4HV5 A;  1WWX A;  4NQW B;  1GLN A;  1O3S A;  1X3W B;  5M3M J;  2CU7 A;  1YG2 A;  2ESN A;  1YX3 A;  1R5I D;  1RKT A;  3VWB A;  4QIW N;  4LOC A;  1P7I A;  4OIO F;  2F4M B;  2DA1 A;  3IL2 A;  2JJ7 A;  2E19 A;  2VKD A;  1IW7 F;  4H0E A;  4PGG A;  3H9G A;  2HYG D;  2PMH A;  2BY0 A;  5EDN A;  1IN7 A;  2R7S A;  5ED4 A;  3OSF A;  3E6C C;  3PNT A;  3S1M J;  5CQE A;  3IUO A;  3WOD F;  4IKF A;  1AOY A;  2LR8 A;  2Y2Z A;  3SZG A;  2F5E A;  4ENM A;  2V9P A;  1FP2 A;  1Y1W J;  3I53 A;  4M3D A;  1B4A A;  3TL4 X;  3IP4 B;  1BN5 A;  2XGE A;  3CCE I;  3K4N A;  4XRM A;  2KFD A;  3I59 A;  1SC7 A;  4PSX A;  3MEX A;  2MC3 A;  2KQR A;  3H92 A;  4WF2 A;  3TDU C;  5GPA A;  3HOX J;  4XMY A;  3LSK A;  2BYV E;  3JRI A;  3CCY A;  3BG5 A;  3B02 A;  3AL0 C;  4C2U A;  1T39 A;  4A3L J;  1GXP A;  3F72 A;  1A31 A;  2IEK A;  2R4G A;  2Y0M A;  3DEU A;  3PSI A;  1G6N A;  4U0V A;  4D0P A;  4LG0 B;  3CUQ C;  3SFI A;  3CLO A;  1VQ8 I;  3PUB A;  2PG4 A;  1ZG3 A;  2OCC H;  4DBR A;  2DQL A;  1G3T A;  3JR9 A;  4Q5S F;  2V26 A;  2DYR H;  2VQH A;  4M73 A;  2XSD C;  2XAS A;  1BC7 C;  3LSG A;  4MLO A;  1TL8 A;  3CMM A;  1F1Z A;  2DT7 B;  4BEH A;  5D6E A;  2ECC A;  1BR4 A;  1FOW A;  5LRS A;  2EPF A;  1MBK A;  2E1M B;  3SDG A;  1BJZ A;  2LLK A;  1WH7 A;  3QWL A;  2O03 A;  4B3X A;  1AKH B;  2RQQ A;  3IV5 A;  1L0O C;  3N05 A;  3HIF A;  3CCS I;  2XIG A;  1RPW A;  2Z33 A;  3VSL A;  4KYW A;  3EET A;  2KIF A;  1YW8 A;  2JSP A;  2XF6 A;  4YIR X;  4ZJZ A;  2A6H F;  3F8F A;  1WI3 A;  3SJM A;  3CC2 I;  4I6Z A;  3LSH A;  3RPU A;  2KIM A;  1JT6 A;  2K4B A;  2VKE A;  4IQJ A;  2QEN A;  3U21 A;  5F64 A;  1D1B A;  1OFC X;  3N97 A;  1LFU P;  3B6C A;  5H20 A;  4X1E A;  4HX8 A;  4NNJ A;  4PK4 A;  5D8K B;  5IP6 A;  2DLL A;  5L3B A;  2A6E F;  3BJ6 A;  5HLI A;  1VTN C;  2H8R A;  1DGW Y;  3IWF A;  1TQP A;  3H0D A;  2EZK A;  1XB4 A;  1CF7 A;  3ZQQ A;  5KHD A;  3ERE D;  5ERI A;  2H27 A;  1R23 A;  3ZMZ A;  4A3D J;  1J0R A;  2HTS A;  2QKM B;  4UB8 C;  5B5E C;  1I1G A;  1FNN A;  3LQR A;  1ZLJ A;  4MHG A;  3TO7 A;  2KJC A;  3KP5 A;  5IT3 A;  2LYC A;  3FM3 A;  1QPM A;  2V1D A;  2XHK A;  2WAD A;  2F4I A;  3MCZ A;  2V4J C;  4AC0 A;  5LHH A;  1Z77 A;  3TOB A;  2P8T A;  2E35 A;  2ZSH B;  4EAT A;  2QA4 I;  4W1U A;  4A3F J;  4EM1 A;  1SFU A;  3S2H J;  3J80 K;  4FX4 A;  4HZF A;  1XC5 A;  2K7L A;  1BJA A;  1MBE A;  1UST A;  3WE2 A;  5GAG J;  2JVH A;  3IRR A;  3FDY A;  4LIT A;  3FIS A;  5JR3 A;  3BTL A;  1GV5 A;  5FLV A;  1TT0 A;  3BZK A;  4KDP A;  1TQI A;  3M7G A;  3WTU C;  3O2P E;  3S1R J;  2V1U A;  1MJA A;  1E3O C;  1QPI A;  4KFC A;  2XRN A;  1UB9 A;  1BI3 A;  2IS4 A;  2E36 A;  5L3F A;  2DO7 A;  3WGG A;  2JA2 A;  4I76 A;  3M8J A;  1MJB A;  1U5T A;  3GLX A;  2GWR A;  2CS3 A;  3ZXS A;  4M72 A;  3CP2 A;  2BVM A;  1JTX A;  1Z9C A;  4JYK A;  1RUN A;  1VF9 A;  4NDL A;  2K5C A;  1B8I A;  3PUF A;  4ASN A;  2FE3 A;  1U8B A;  1WVR A;  3CD6 I;  2R92 J;  2EFQ A;  3H3Z A;  2L9N A;  3RCO A;  5FKK A;  3U1D A;  3V7S A;  4R8H A;  3BQY A;  2OTL I;  1W36 C;  3H5A A;  3CZ6 A;  1I6H J;  1XGO A;  3QYE A;  3OS2 A;  1FEX A;  1I6X A;  5IYD J;  3W2W A;  4E7H A;  1RUO A;  3RQI A;  2WAQ A;  3V4G A;  3OYE A;  1ETX A;  3R0A A;  2CFX A;  3R0J A;  4A12 A;  3L7W A;  3V7R A;  3GXO A;  3HKZ A;  4G6Q A;  4IHS A;  1R5H A;  4Y52 J;  2IT0 A;  1FY7 A;  3I5U A;  1U78 A;  1G3Y A;  3BCB A;  3FMQ A;  4U7D A;  2FSW A;  2K9S A;  5J8C A;  1XGN A;  2EFW A;  3JW4 A;  1ON2 A;  3Q0W A;  2EZH A;  2M45 A;  3OYI A;  3JTG A;  4I0A A;  2YX4 A;  3R60 A;  1NK2 P;  3CJT B;  4FT8 A;  5ICF A;  3H1C A;  3ZN1 A;  3MKY B;  1R1V A;  4EVI A;  1HCR A;  2XAJ A;  1ETO A;  5DCF A;  1SFE A;  3F8N A;  1KA8 A;  3D5S C;  2IBD A;  5DDG A;  3LOC A;  4RAF A;  3ASO H;  4XM3 A;  3MVP A;  4DQ2 A;  3HGG A;  4XN3 A;  4C30 A;  1FTZ A;  1MD0 A;  3I0T A;  3DU5 A;  3HXL A;  2VT3 A;  4HG2 A;  1Z05 A;  5JLW A;  1TNS A;  2PEX A;  2W57 A;  3AG1 H;  3TGN A;  5LEK A;  5KAI C;  4DZJ A;  2D2W A;  1D0X A;  1HW5 A;  1HC8 A;  4WWC A;  3S1Q J;  1X1C A;  2VI6 A;  4ZZL A;  2DJI A;  1A6Q A;  4ZTJ A;  2M4K A;  5IY5 H;  4CCN A;  2IS6 A;  4KIF A;  4BY1 J;  4I99 C;  2GBY A;  4A3B J;  3IH4 A;  4LIV A;  1B1B A;  2DTZ A;  1RI7 A;  4XKV A;  4W97 A;  2VXD A;  3ELK A;  1BIB A;  4XK4 A;  5K5O A;  4NQW A;  3CDL A;  2QQ9 A;  2A07 F;  3PJR A;  1FYK A;  1O4X A;  3CJR B;  4PJM A;  2X1E A;  3C2H A;  4KIC A;  6PAX A;  5IT9 K;  2CFO A;  3DBL B;  3K70 D;  5GAD J;  2OV7 A;  1FT9 A;  3CCL I;  3GTO J;  4ZH4 F;  2DU9 A;  2ME0 A;  3FWE A;  4BHC A;  1SFK A;  2P5L C;  1I3Q J;  2EH3 A;  4DW6 A;  3D5R C;  1JHH A;  1TLH B;  3M1C A;  4A5M A;  2WC2 A;  2DA6 A;  2A61 A;  4NUB A;  3J81 K;  1QZE A;  3D1N I;  5FJ8 J;  2VJ4 A;  1Y8Q B;  4OIP F;  2PQ8 A;  3E6M A;  2JUC A;  3EUH C;  4XLE A;  1IDY A;  1LDD A;  2FJ1 A;  3IHU A;  2DMP A;  4LLG F;  3SFZ A;  3BWG A;  2PX9 A;  3SHF A;  1WFX A;  2ZNY A;  1W7P A;  2OQR A;  1VQK I;  1V54 H;  5EF6 A;  4CYC B;  1MNE A;  4BUP A;  4AM3 A;  4XKC A;  3X2Q H;  1JGS A;  4IHX A;  3OL3 A;  1XSV A;  1JKO C;  4BYY A;  1PP7 U;  1LVA A;  4CDG A;  5FKN A;  4BQA A;  4Q47 A;  4DYC A;  2HNH A;  1LPQ A;  1JTY A;  2XGX A;  2X6X A;  2D1H A;  1U0J A;  1T98 A;  3ZGK A;  4CZZ A;  3HTU A;  4LG0 A;  3DKW A;  3WE3 A;  3VOD A;  4ZDP A;  1X1D A;  1F4K A;  3FXM A;  2LKX A;  4OOI A;  3FXJ A;  1JKR C;  2HDC A;  2NAZ A;  1G3W A;  3E6D A;  1HA8 A;  4QLC U;  2EV6 A;  4FIS A;  4IF4 A;  5DD4 A;  2PJR A;  1B6A A;  1I5Z A;  1W0T A;  5F1R A;  2L4A A;  3REO A;  1ETV A;  2BY2 A;  1SD5 A;  2AXL A;  1ZGA A;  3V7C A;  2ACJ A;  4AIJ A;  1AKH A;  4C2T A;  3BR6 A;  3QAH A;  3K2Z A;  1U3E M;  2HDD A;  3G71 I;  1Y1V J;  3GX4 X;  5D4R A;  3V8J A;  4XRS A;  1R5G A;  2V7F A;  4CH7 A;  4OMY A;  4N4N B;  4XNF A;  3ASN H;  1QHG A;  2E1O A;  5LGN A;  1W7P D;  3ABM H;  2A05 A;  5M5W J;  4U7B A;  1FYL A;  1LDJ A;  2ELJ A;  2HQR A;  2G7U A;  1R22 A;  1ERD A;  1NK3 P;  3BLY A;  3CTA A;  4KN4 X;  3VB2 A;  3ZMV A;  1B9M A;  4ZC3 A;  2OBP A;  1IUF A;  3PO3 J;  4HNV A;  2JA6 J;  3OL4 A;  4BBR J;  2E7W A;  2PN6 A;  2EIJ H;  4CYD A;  2NS0 A;  4WXC A;  3CCV I;  4XSX F;  3HBL A;  2NVX J;  4P55 A;  4L9J A;  5LD2 C;  5BMZ A;  4ANJ A;  3BR2 A;  1UG2 A;  2DOA A;  1ORK A;  2MBF A;  4M3B A;  5F04 A;  5B1B H;  4BJT A;  2ESH A;  2H6B A;  2QVO A;  3HL2 A;  2N8G A;  5HS8 A;  4BL0 B;  3MKL A;  4CXF A;  1FMV A;  2QKL B;  2VXZ A;  2V9V A;  3EUA A;  5AIQ A;  3G6E I;  3GTG J;  1FIP A;  3KZI C;  1MMS A;  1TW3 A;  4XR6 A;  4WXD A;  2ELK A;  2V79 A;  4Q48 A;  3GTQ J;  2Q8K A;  3JRF A;  3DTI A;  2ZNZ A;  3T8R A;  2JTV A;  3OYD A;  3GTL J;  5FLX K;  3QPH A;  1NG6 A;  2AXT C;  4RGR A;  5FRM A;  2MAB A;  2WB1 A;  2L9V A;  5J40 A;  2W84 A;  5JHF A;  3L1P A;  3FX3 A;  1FOK A;  3LSI A;  3K4M A;  4XN0 A;  1FPQ A;  3FMR A;  5F08 A;  1OR7 A;  2DOD A;  2WY8 Q;  2VC0 A;  1JT0 A;  5BOX A;  2YU3 A;  3BZC A;  1YIT I;  1V55 H;  3ZQG A;  3JRA A;  3CCM I;  1N75 A;  3H35 A;  5DYM A;  2TRT A;  4XRS G;  3GCM A;  2CW8 A;  3G3Z A;  1CF7 B;  1Z91 A;  3GTJ J;  3ULQ B;  3L2R A;  1VND A;  1FOX A;  3GEZ A;  2KRH A;  4MQ9 F;  1WJC A;  1UEL B;  1P4W A;  3JRC A;  1DP3 A;  2R7T A;  1YRN B;  2V1X A;  1OLT A;  3I4N J;  1ZRF A;  1U9O A;  3TW7 A;  2XGC A;  2XPU A;  4FHT A;  2XF5 A;  2O8K A;  3PQJ A;  4A3E J;  1JGG A;  3WTX C;  3KP6 A;  4CCO A;  5HNF A;  5E1X A;  4IOA F;  3CMY A;  2XKO A;  2VC1 A;  5J4Y A;  1X19 A;  4J00 A;  1S3J A;  2GIZ A;  1RRJ A;  5CKT A;  1PYV A;  4NC8 A;  1KQ9 A;  1IAW A;  3VSK A;  1OCO H;  3FBN B;  5FB2 A;  4OMZ A;  3KYD B;  4B3A A;  5E79 C;  3P9C A;  2OA4 A;  1LE8 B;  2KRC A;  1Y8R B;  2LY1 A;  5DTD A;  1S7E A;  1U5T B;  3R4K A;  3R61 A;  3H9J A;  2CUZ A;  3G1M A;  1KZH A;  4N4O B;  3OSG A;  4B44 A;  1B8I B;  1XMA A;  1RES A;  4PJJ A;  5A2Q Z;  4O3M A;  3DCF A;  4F93 B;  2QZ8 A;  4MNU A;  4XQF A;  3P7N A;  4Y33 A;  1G59 A;  3BC8 A;  4FAS D;  4N9I A;  2QQB A;  3A4C A;  3AFH A;  3ZQL A;  1WGX A;  3C2G A;  3M4O J;  2L9R A;  5FD5 A;  4CCM A;  2X51 A;  4LG3 A;  4RA2 A;  1J75 A;  4IRG A;  1VQO I;  2XAF A;  4LB5 A;  3IKT A;  2NXN B;  4HF1 A;  2IA1 A;  4XLC A;  3CF2 A;  2ECB A;  4OIN F;  1QGP A;  3W2A A;  2PJP A;  2YUS A;  2IP2 A;  3SEQ A;  1XSD A;  2O0Y A;  3IC7 A;  3KZY A;  3M8F A;  1K6Y A;  5D4S A;  1MH4 A;  2CRG A;  4II2 A;  3EDP A;  4P1W A;  1WPK A;  1FC3 A;  2KIS A;  2I8D A;  4QSH A;  2TCT A;  4PJL A;  5EEH A;  3S17 J;  1SEU A;  1I3A A;  1MSF C;  3A1Y A;  4U0Y A;  3IAS 2;  2LMD A;  2P0W A;  1YHQ I;  3BY6 A;  3G1L A;  4YFX F;  3JAM Z;  3UNG C;  1OCZ H;  1JE8 A;  5IP7 J;  5LGT A;  2QQA A;  4BKX A;  2EFO A;  2F48 A;  5E8I A;  4M9X A;  4AIH A;  2ISZ A;  2JRM A;  1H8A C;  4G7O F;  3RYP A;  2DAO A;  3R6S A;  4BDZ A;  4IEJ A;  3QPL A;  1LDK B;  4EJV A;  1FTT A;  3CDI A;  2G7H A;  4M9S A;  5D6F A;  2I10 A;  2Y30 A;  3PM1 A;  3ZQH A;  1IN8 A;  1K83 J;  3WTS C;  2JA5 J;  3NRV A;  5KK1 A;  4YFK F;  3TW6 A;  2BE5 F;  4F7Z A;  3M1E A;  4BXF A;  4GCV A;  2FEZ A;  4BY7 J;  5E18 F;  2R7Z J;  1XDS A;  4LB6 B;  3I4M J;  3Q0V A;  3FXU A;  1UMQ A;  4R1H A;  3L00 A;  3SYT A;  5D8L B;  4A3K J;  3O8G A;  4A3G J;  5JLX A;  1ZQ3 P;  4HOB A;  2XGD A;  3BP8 A;  2VOD A;  1XGS A;  3FM5 A;  1HDD C;  1FJL A;  4XOP A;  3ISP A;  4P96 A;  3F23 A;  2BBY A;  3OOP A;  5DEQ A;  4QPQ A;  5HDN A;  3ABK H;  3KX2 A;  2XV4 S;  5FLM J;  2VBZ A;  4BQO A;  5GAE J;  2X9D A;  3TP0 A;  3ZQC A;  1R1U A;  2RDP A;  5D5W B;  4LMY A;  3QU3 A;  5FKL A;  3W6K B;  1EH7 A;  3L2U A;  2CV2 A;  3L2W A;  2DA4 A;  2HPM A;  4S05 A;  2Z9O A;  2RVC A;  1ON1 A;  3OOU A;  5IP9 J;  3ZPL A;  2OAZ A;  3QPT A;  1TWF J;  3ZQ7 A;  3S15 J;  3EUH A;  3HHG A;  4M6Y A;  4RMN A;  4ZTF A;  1YQA A;  2ADU A;  2DMU A;  5CVR A;  2WV0 A;  3KEY A;  4WK8 F;  1K7A A;  3I55 I;  1VQ4 I;  2DT5 A;  2KIQ A;  4BXX J;  2LF7 A;  1D5V A;  2Q2E A;  2JPB A;  3GFM A;  4OIR F;  2ZJP F;  1W7P B;  2KKO A;  1ETW A;  1E2X A;  1MBJ A;  4M3F A;  2F6C A;  1EH8 A;  4UY8 I;  3S3M A;  3O8H A;  2A68 F;  1USS A;  2E1M C;  1FWZ A;  3PFI A;  1IRF A;  4FX0 A;  2VQG A;  4O5V A;  1LFB A;  3HSR A;  2QCO A;  1RR8 C;  5ICC A;  4OAZ A;  1MNM C;  4AIK A;  3BT9 A;  2EFP A;  3E5X A;  3G2B A;  4HBL A;  1QRY A;  4HLX A;  2DMQ A;  4B43 A;  5C4J J;  1KU9 A;  2CQX A;  3VYR B;  2NNY A;  5LLQ A;  3P9K A;  3DFG A;  4BS9 A;  3ZMU A;  4RM3 A;  3PO2 J;  3BG3 A;  3V8L A;  2OU2 A;  1TNT A;  1QZY A;  3MZ8 A;  2PJR B;  1L3L A;  2EFN A;  4Y13 A;  4KMU X;  4M6V A;  1P6R A;  2COB A;  3DBH B;  2MLG A;  2IVM A;  1OCT C;  1Y0N A;  3HC7 A;  2F5V A;  3CCJ I;  3QPS A;  4BAC A;  3MKZ A;  1EH6 A;  1OKR A;  1WJD A;  1DPU A;  2QGU A;  1I27 A;  4IHY A;  3HRS A;  3KZZ A;  1N25 A;  2NRA C;  1XMX A;  1WKM A;  2KP6 A;  2HVS A;  3EYI A;  2LY9 A;  2EJR A;  2PFB A;  2Q0O A;  3H3U A;  4B1R A;  1V4R A;  4B8X A;  3BQZ A;  3AL0 B;  2K9L A;  1VQ6 I;  2P7V B;  1ETQ A;  1ZAR A;  5EYR A;  4BE0 A;  1ZN2 A;  3HSF A;  1BM9 A;  1Z7U A;  2L3D A;  9ANT A;  1LEB A;  5HS9 A;  1H9T A;  3KYL A;  3OYL A;  3HOV J;  1CGP A;  3CUQ B;  4UB6 C;  4ABZ A;  4CCL A;  1VFC A;  2E5N A;  2W00 A;  4L18 B;  2MYS A;  2VL8 A;  4GRI A;  4E7Z A;  1WRJ A;  3I9V 2;  2ZSI B;  3SQN A;  4AYB N;  1ETY A;  1DGR M;  2WAQ N;  1ACI A;  1KGS A;  2BV6 A;  1ZG1 A;  3ZMS A;  3U2R A;  2EA2 A;  3Q9S A;  4RGX A;  3FXL A;  2GQQ A;  2W4S A;  4C3H J;  3DPU A;  4BDY A;  2Z99 A;  2V9K A;  3DTK A;  1BI0 A;  2DCE A;  1VI0 A;  2ZCW A;  4J01 A;  3GLL A;  1VQ9 I;  2CV1 A;  2R3S A;  3OIO A;  1OYW A;  4I2O A;  3ZQF A;  3ESW B;  1YRN A;  2E2J J;  5BPD A;  3OYJ A;  4RB3 C;  1ZGJ A;  3CUO A;  2DK5 A;  2CQQ A;  1XPX A;  2WBM A;  3MD2 A;  3T8T A;  2KZV A;  4U0W A;  2CYY A;  1A35 A;  3FXQ A;  3BG6 A;  1WHU A;  4GYG A;  4HQM A;  2LK2 A;  1A04 A;  1MMA A;  4XBF A;  3B6A A;  3F6O A;  4R79 A;  2XUB A;  2M8G X;  3BR1 A;  4HLY A;  1VQN I;  4M9Z A;  1LB2 A;  5HS7 A;  1XX5 A;  2XPW A;  4A0X A;  1B72 A;  3FF5 A;  3TO6 A;  3GF2 A;  1SAU A;  3G1O A;  2E60 A;  4XLN F;  2M30 A;  4IHV A;  1MBH A;  3LSR A;  1D1A A;  2NS8 A;  3S2W A;  3K4B A;  1ENH A;  3E5U A;  5LFA A;  5LBQ A;  1LE8 A;  4M6X A;  1UAA A;  2FBI A;  3QYB A;  3CLQ A;  1O7F A;  4BQN A;  2VT2 A;  1T0F A;  3LAP A;  4G9Y A;  2WV1 A;  4XSZ F;  1BC8 C;  1R7J A;  4CUG A;  1TWC J;  3H5R A;  3F6V A;  1HLV A;  3J7Y J;  2D45 A;  1QU3 A;  1WZ2 A;  4MGR A;  2JUG A;  2EQR A;  2J5O A;  4LLL A;  2M0M A;  1ZG5 A;  4G7Z F;  2HOS A;  3G73 A;  2GXB A;  1X58 A;  2CG4 A;  4D1Q A;  3EYY A;  3OYK A;  3KFW X;  2IGM A;  2FQ4 A;  4BH9 A;  3TDZ C;  2LKP A;  4Y7N J;  3FBI B;  3FZV A;  3RIR A;  4JX6 A;  5EJC A;  2JSC A;  2M2E A;  3GFJ A;  3S8P A;  5FO5 A;  1R4N B;  2FOK A;  1YS6 A;  3FKI J;  3JRH A;  2HXI A;  4DNC A;  1YLF A;  4JX4 A;  1MDM B;  1I1S A;  2GIV A;  3PQK A;  1BW5 A;  2Y0S A;  1GUU A;  1U9N A;  4HEA 2;  4KA4 A;  1EJ9 A;  1HSJ A;  4L9V A;  1ZGW A;  1JUM A;  3W6V A;  2EIM H;  5TIS C;  2O6G E;  3E1S A;  2OJE D;  1IG7 A;  2ZME A;  2E2H J;  2M3A A;  1J9I A;  2NOG A;  1P7J A;  2LDU A;  1MJ9 A;  3KEO A;  3MMY B;  3T1B A;  3VYT B;  5DUI A;  5CQG A;  3S2D J;  1TW2 A;  4ENJ A;  5CVU A;  5IT9 Z;  1YO5 C;  4G6T B;  1R58 A;  2P5V A;  4I98 B;  5LEJ A;  2HZD A;  4PCQ A;  5DS9 A;  1FSH A;  4MEX F;  3DF8 A;  4PGH A;  2Y31 A;  1FZP B;  5DM6 F;  1BOB A;  2RNJ A;  2LH9 A;  1R36 A;  2JPC A;  2NVQ J;  4YG2 F;  3F0C A;  3ZR8 X;  1QVT A;  4LGW A;  1Y56 A;  2XDV A;  1LJ9 A;  3K0L A;  3F21 A;  3DEW A;  2B0L A;  2LG4 A;  5IOZ A;  3CF5 F;  4KMF A;  3GUD A;  4E7L A;  3A01 A;  3CME I;  4D7N A;  2L4M A;  2FNP A;  3RKY A;  4EEF G;  1D0Y A;  1H89 C;  2FBH A;  3LQQ A;  1T08 B;  4S0H B;  3C2B A;  2ME6 A;  1ITY A;  2O7O A;  1GV2 A;  2BEO A;  3DLA A;  5E3O A;  1WCM J;  2MW8 A;  1WJE A;  1T6S A;  2JRT A;  3KP3 A;  3M8E A;  4KT6 A;  3DV8 A;  4HNU A;  1IRG A;  1G3S A;  3L2Q A;  1R6R A;  3TBI A;  3WG7 H;  3HOS A;  2K9N A;  4GXO A;  1ZTR A;  1P9Q C;  3PNV A;  2MFZ A;  1EA3 A;  3OIQ A;  3ML6 A;  2QEX I;  4ZDO A;  2H94 A;  1MGT A;  1Z21 A;  2LY2 A;  1V5E A;  1V5F A;  3LSM A;  1PDN C;  2HS5 A;  2KDO A;  3CP8 A;  1BL0 A;  2PLY A;  2ICW G;  3K1P A;  3KIO A;  1UZC A;  4HW0 A;  1TTY A;  4G94 A;  1G4D A;  3HB9 A;  1X3Z B;  3E0J B;  2L54 A;  4QPO A;  4L0Y B;  2VBW A;  2DDA A;  1D0Z A;  2VE9 A;  4OIQ F;  2DQR A;  5TRD A;  5BS6 A;  5IPA A;  1X3U A;  4WXH A;  1YOV B;  5E1W A;  5K5R A;  2EIL H;  3MWM A;  4XOT A;  1FBQ A;  3HGY A;  4U87 A;  5KAF C;  4DBQ A;  4HRI A;  3OS1 A;  1E0E A;  5M3F J;  1JKQ C;  3FK7 A;  4FCY A;  2KRF A;  2HOA A;  4AWX B;  1UHW A;  2BOL A;  1APL C;  4L5I A;  2ID6 A;  3IRQ A;  1WJB A;  2YPR A;  2P81 A;  3I4P A;  3IWZ A;  2DA5 A;  4IHW A;  2QBY A;  1NHA A;  5HNH A;  2QSG X;  4AD9 A;  4HAM A;  1IV8 A;  2DYS H;  2CW0 F;  4TV7 A;  4IO9 F;  2OF7 A;  5D5U B;  2STT A;  3ZOB A;  1SFO J;  2Q2E B;  4UVA A;  3AG4 H;  2O5R A;  4IL6 C;  1BOA A;  3W2V A;  4OU0 A;  1F36 A;  4RB2 C;  5LHI A;  5C3E J;  4IJA A;  4UV9 A;  2NVU B;  2GLO A;  1WJF A;  5J8F A;  1MND A;  1KU3 A;  4II3 A;  1N77 A;  2YX7 A;  1K61 A;  2JA7 J;  2DW4 A;  3K6G A;  3WHC A;  4CO8 A;  3A0H C;  2QQ8 A;  5DV5 A;  2W1O A;  3SEZ A;  4LFU A;  3CUQ A;  2YU9 J;  1IRZ A;  2JMW A;  2O8X A;  1YYV A;  3DXJ F;  2WTE A;  3GFI A;  2HZT A;  3E6B A;  1BR2 A;  1ONV A;  1H9G A;  1LKX A;  2P7C B;  4UVB A;  1JUS A;  2RV8 A;  2LFB A;  4RM2 A;  4ITV A;  3ERM A;  3PIO F;  5HDK A;  2LBF A;  3V8K A;  4RB0 A;  4F55 A;  2BY1 A;  2R7V A;  2FXA A;  4XLA A;  4HDU A;  1JKP C;  2ZFW A;  2VBY A;  3K1M A;  2E1C A;  5E1Z B;  1HKS A;  2YS9 A;  3WGH A;  4IHT A;  2QYO A;  3HTS B;  2JQ7 A;  3KP2 A;  1QNT A;  1V5G A;  2WY7 Q;  3M9A A;  1DQU A;  3Q9V A;  2VPL A;  2Z5U A;  2DFH A;  4I02 A;  2NYX A;  1AU7 A;  4N0B A;  5M5X J;  2A3S A;  2X1D A;  4CIC A;  2ZXI A;  3OYM A;  5ILV A;  4I0B A;  2XAU A;  1IUY A;  4HA8 A;  4KJZ A;  5HVQ C;  2MC4 A;  2X1C A;  3K4J A;  3U1K A;  1AA7 A;  3MAJ A;  4K2E A;  4AUX A;  1QQI A;  2IS2 A;  4X0G A;  3KPH A;  2LRE A;  3DKX A;  2V6E A;  1IGN A;  2L01 A;  1S7O A;  2BVL A;  3B73 A;  2VON A;  1X1B A;  2CQ7 A;  4E6K G;  1IRX A;  1Z0X A;  2G9W A;  5E3M A;  1D1C A;  2ZJR F;  2R7F A;  3LA2 A;  1WI9 A;  3RI4 A;  2L7K A;  1REP C;  4PDK A;  3LA3 A;  5BQT A;  2VKV A;  4GFB A;  1G2H A;  4WCG A;  1W4M A;  2WAE A;  1F9N A;  1K78 A;  1YFH A;  1I50 J;  1RKW A;  2V6C A;  2Z1D A;  4E7K A;  1XCV A;  2P5K A;  3ZRG A;  2BXY A;  3TQN A;  2HVR A;  1R1T A;  2RGV A;  2EZL A;  3FXO A;  3NAR A;  1SD7 A;  3BG9 A;  5L3E A;  1IZ1 A;  2OC6 A;  4IX7 A;  2RNG A;  4NB5 A;  4F91 B;  3AAF A;  1AWC A;  5CVJ A;  3LAJ A;  4PUS A;  2EZI A;  4HV6 A;  1S9H A;  4HNT A;  4XRF A;  3PSF A;  1BI2 A;  2H1L A;  1VQP I;  1MKM A;  4EJO A;  3QP5 A;  2F2E A;  1MDM A;  1B72 B;  2EIK H;  3MFK A;  3ECH A;  2HKX A;  1KU2 A;  5FFZ A;  3L2C A;  3QU6 A;  2C6Y A;  1TBX A;  5B3S H;  1Z1D A;  1XSX A;  3DPT A;  3G4S I;  3HUG A;  1T56 A;  3D5L A;  1YJN I;  3F8B A;  4L9T A;  1YS7 A;  4HDV A;  1VQL I;  2W85 A;  1XCB A;  2XPV A;  3P9I A;  4KIT B;  1UCR A;  2NS7 A;  4FET A;  2M87 A;  3EQL F;  4Y4R A;  2BGC A;  2PBI A;  3H0G J;  2K4J A;  5K1Y A;  5LRR A;  3TMO A;  1Z3Y A;  3BTJ A;  1D3Y A;  5M5Y J;  2OPT A;  3HJE A;  5CPR B;  5H6R A;  3K10 A;  3HZJ A;  1TWH J;  3KEQ A;  3K69 A;  5J6X A;  1SMY F;  4P9F A;  1S29 A;  3OYC A;  1UG0 A;  3ROU A;  3ZCO A;  4ZDL A;  1TQM A;  3PNY A;  4P5O A;  4H4K C;  4M74 A;  1Y39 A;  4YFN F;  3JRB A;  1E3P A;  4EJU A;  3MZH A;  1W0U A;  1IJW C;  3OYF A;  2FNA A;  4MTD A;  1D5Y A;  2L02 A;  1EV7 A;  4ENK A;  1IN5 A;  2VN2 A;  4PJN A;  3BZ6 A;  3CES A;  1Z3X A;  5TJJ A;  3CDH A;  1C0W A;  1LUJ B;  2MH9 A;  1HF0 A;  2M8E A;  3RSN A;  4B48 A;  4E7S A;  3KP7 A;  3RJP A;  3T0Y A;  1RIO H;  2FRH A;  2IW5 A;  3TKY A;  1OYY A;  1B9N A;  4NBQ A;  2M7A A;  1ETK A;  2HFH A;  1FMW A;  3OYB A;  2FBK A;  1DU6 A;  5J4V A;  2ZME B;  3FMS A;  2P4W A;  4GYI A;  3RKX A;  2JZY A;  4NHJ A;  5F27 A;  5A2Q K;  2HVQ A;  3U9G A;  1FP1 D;  3K1N A;  4IRI A;  2IA2 A;  3H3V K;  2R7Q A;  2XKP A;  4LD5 A;  1OYI A;  3WGI A;  1X1P A;  1SAN A;  1W36 D;  1TC3 C;  2RRE A;  5EEG A;  3DTE A;  3L2V A;  3QOD A;  3OIP A;  1MMG A;  3HOT A;  2L0K A;  4C2M J;  3LSJ A;  1RET A;  2PMU A;  4PSW A;  4EM0 B;  1XS9 A;  1YX5 A;  1TWG J;  1ZRE A;  4PJ0 C;  1A5J A;  3NQO A;  4A93 J;  2PMZ A;  2X6W A;  3DPL C;  1FBS A;  1PUF B;  2IJL A;  4L0Z B;  3S14 J;  1EF4 A;  4LK0 F;  5ILS A;  2W82 A;  1D8K A;  4BHB A;  1QZZ A;  2UZK A;  2Y69 H;  1P92 A;  3BOQ A;  3OMY A;  4NC6 A;  4HSR A;  3A01 B;  4ETS A;  3GFL A;  2Z16 A;  2R5Y B;  4BE1 A;  5KNL A;  1YW9 A;  2JT1 A;  2IS1 A;  2K3P A;  4P9U A;  2EWN A;  4N9H A;  2VJJ A;  4Z2Y A;  2O9L A;  3HPH A;  4I09 A;  3PL8 A;  3BJA A;  1SVO A;  2QSH X;  3L09 A;  3TOA A;  1S5L C;  3JAM K;  2WWY A;  2LNB A;  4CA0 A;  3M3Y J;  4MO7 A;  3A03 A;  4RLQ A;  1P4A A;  2H8W A;  3EPZ A;  5FD6 A;  1XG1 A;  4XID A;  2XC7 A;  1WJ5 A;  3TO9 A;  1D8J A;  1KON A;  1ZH5 A;  2NOJ B;  2A6T A;  3C18 A;  3RZD J;  2K85 A;  5L3G A;  4RS8 A;  3RYR A;  5HOD A;  1MBG A;  1BA5 A;  5FKM A;  5J1R A;  3BTC A;  1LEA A;  1IN6 A;  4IQ4 A;  2RC4 A;  3MKW B;  4HST A;  1WSU A;  2CJJ A;  2FMY A;  2E5Z A;  1BR1 A;  3ONQ A;  2R0Q C;  1T2K A;  1FBU A;  3FK6 A;  3W6J B;  4F52 A;  1YJW I;  4GDF A;  4M3G A;  1VQM I;  4BXU A;  5GAH J;  2LD5 A;  2KMU A;  3GME A;  2DJN A;  5E3L A;  4IPA A;  3ECO A;  3LST A;  5GTH C;  2H1K A;  2R93 J;  3DLL F;  2E2I J;  1X2M A;  1LNW A;  3J7A O; 
#chains in the Genus database with same CATH homology
 4FIS A;  5IYB J;  3WHB A;  5IYC J;  1X58 A;  4A69 C;  1W0T A;  5E3N A;  2MG4 A;  2FQ4 A;  1CQT A;  1ETV A;  2PMZ N;  2RAE A;  1OJL A;  4Y7N J;  4JX6 A;  1AKH A;  3BR6 A;  2DMT A;  2M2E A;  4A3C J;  2HDD A;  1Y1V J;  5EZH A;  3FKI J;  2R5Z A;  2Y9Z A;  1ZR2 A;  2QF7 A;  2HXI A;  3JRH A;  4RDU A;  4XRS A;  2LVS A;  4JX4 A;  1BW5 A;  1GUU A;  5C4X J;  1U9N A;  2E1O A;  1JUM A;  1ZGW A;  2HOT A;  3W6V A;  2XRL A;  4V2F A;  4BBS J;  3HOZ J;  5M5W J;  3CQZ J;  4FTH A;  1IG7 A;  3A02 A;  4A3J J;  1ZR4 A;  2E2H J;  1NK3 P;  2NVT J;  2NOG A;  5C44 J;  1NTC A;  1P7J A;  1R9T J;  1MSE C;  1IUF A;  3PO3 J;  4HNV A;  2GM4 A;  4JP0 A;  2L7F P;  3S2D J;  5EGO A;  3K2A A;  2LP0 A;  2JA6 J;  1RR7 A;  4BBR J;  1ZKG A;  5K7F A;  3E7L A;  3HOU J;  3HBL A;  2NVX J;  4C3I J;  5DS9 A;  4FE7 A;  2Y31 A;  3BR2 A;  1UG2 A;  4B4C A;  1ORK A;  2X6O A;  3QQA A;  4M3B A;  5F04 A;  1JJ8 C;  2NVQ J;  4MFE A;  2N8G A;  1IV6 A;  1DU0 A;  3F0C A;  1QVT A;  3MKL A;  1IC8 A;  5FKO A;  3JRD A;  3VPR A;  1GVD A;  2VPR A;  3DEW A;  3GTG J;  1FIP A;  5IOZ A;  3BR5 A;  3HKZ N;  4D7N A;  3A01 A;  2ELK A;  2FX0 A;  4RBO A;  4EEF G;  1JJ6 C;  3JRF A;  3GTQ J;  3GTL J;  1H89 C;  2DN0 A;  1POG A;  4S0H B;  3C2B A;  2ME6 A;  1ITY A;  2CUE A;  2O7O A;  5F1J A;  4FE4 A;  1GV2 A;  5E3O A;  3RZO J;  1WCM J;  2MW8 A;  3L1P A;  2Y0S N;  2JA8 J;  2FD5 A;  4UUS A;  3S1N J;  5F08 A;  3JRG A;  4QTR A;  2K9N A;  5F0H A;  4CYC A;  1JT0 A;  1ZTR A;  3HEF A;  4MIM A;  3TP3 A;  2DMN A;  3ZQG A;  3JRA A;  2HQ5 A;  2TRT A;  4D7M A;  4XRS G;  4A3M J;  1BL0 A;  3BR3 A;  3GTJ J;  5M3M J;  3HB9 A;  2CU7 A;  2W48 A;  1VND A;  1RKT A;  5J3L A;  4LOC A;  1P7I A;  4QIW N;  2DA1 A;  2JJ7 A;  2E19 A;  5IPA A;  2XB0 X;  3JRC A;  1YRN B;  3I4N J;  1IDZ A;  1U9O A;  4C3J J;  3TW7 A;  2XGC A;  3HGY A;  2XPU A;  5EDN A;  2X48 A;  3OSF A;  5M3F J;  1JKQ C;  2O8K A;  3S1M J;  4A3E J;  3FK7 A;  1JGG A;  2LR8 A;  2Y2Z A;  4FCY A;  3CMY A;  1Y1W J;  5EG0 B;  2HOA A;  1HOM A;  4M3D A;  3IH3 A;  1AHD P;  3TED A;  2XGE A;  1APL C;  2ID6 A;  2K9Q A;  4XRM A;  1T33 A;  5K7Z A;  2P81 A;  3K7A J;  3RKQ A;  2DA5 A;  4IHW A;  3HOX J;  5GPA A;  4B3A A;  3JRI A;  3CCY A;  3BG5 A;  5GPC A;  1LE8 B;  4A3L J;  5DTD A;  2OF7 A;  5F0C A;  1S7E A;  3ZOB A;  1SFO J;  2IEK A;  2HXO A;  2M34 A;  1WH5 A;  3G1M A;  3OSG A;  1B8I B;  2K40 A;  3UKG A;  1F36 A;  1RES A;  2EBI A;  3SFI A;  5C3E J;  3DCF A;  4G12 A;  2GLO A;  3JR9 A;  2XSD C;  3ZQL A;  1WGX A;  1K61 A;  3M4O J;  2L9R A;  3LSG A;  4MLO A;  3WHC A;  2JA7 J;  3Q0U A;  3BTI A;  2ECC A;  2YU9 J;  1IRZ A;  2JMW A;  4UUT A;  1MBK A;  3SDG A;  1H88 C;  1BJZ A;  2LLK A;  1WH7 A;  2JK3 A;  2ECB A;  5J1Y A;  1AKH B;  3BR0 A;  1JUS A;  2YUS A;  1TWA J;  2LFB A;  3IV5 A;  4JX5 A;  3HOY J;  2CUF A;  2L7M P;  1MH4 A;  2CRG A;  1WPK A;  2B63 J;  1RPW A;  4QSH A;  3GTP J;  2TCT A;  2DA2 A;  3S17 J;  1MSF C;  2DA3 A;  1FIA A;  1JKP C;  1PUF A;  2YS9 A;  4A3I J;  3G1L A;  1WI3 A;  3SJM A;  4I6Z A;  3GTK J;  2VKE A;  1JT6 A;  2KT0 A;  5IP7 J;  3LNQ A;  4BKX A;  1F43 A;  2R5Y A;  1OFC X;  5F0F A;  1LFU P;  3B6C A;  1AU7 A;  1H8A C;  4X1E A;  3FIW A;  5M5X J;  2D5V A;  2MSY A;  5IP6 A;  4IEJ A;  3QPL A;  1FTT A;  3HOW J;  4AUX A;  2DA7 A;  2H8R A;  2I10 A;  2Y30 A;  3PM1 A;  3ZQH A;  1K83 J;  2EZK A;  2JA5 J;  4A3D J;  2HYJ A;  1IGN A;  3TW6 A;  3Q3S A;  4BY7 J;  2R7Z J;  1ZK8 A;  1Z0X A;  3I4M J;  3Q0V A;  5E3M A;  1UMQ A;  3NAU A;  4DYR A;  4A3K J;  3O8G A;  4AC0 A;  5JLX A;  1ZQ3 P;  4A3G J;  1Z77 A;  2AHQ A;  2XGD A;  1HDD C;  2VKV A;  1FJL A;  4GFB A;  4W1U A;  1G2H A;  4A3F J;  3S2H J;  2L7Z A;  1I50 J;  1RKW A;  1XC5 A;  5FLM J;  3ZQC A;  2X9D A;  3TP0 A;  1MBE A;  5FKL A;  2EZL A;  2DA4 A;  3FIS A;  3BTL A;  3NAR A;  1GV5 A;  5FLV A;  3BG9 A;  3OOU A;  4UUS B;  1UHS A;  5IP9 J;  3S1R J;  1TWF J;  3S15 J;  2Y9Y A;  1E3O C;  3GTM J;  4D5C A;  1QPI A;  2EZI A;  2DMU A;  4I76 A;  5EEA A;  4BXX J;  4DYQ A;  1B72 B;  1QVU A;  1JTX A;  4JYK A;  2WB1 N;  1VF9 A;  4NDL A;  1ETW A;  1B8I A;  1MBJ A;  1U8B A;  4J19 A;  4M3F A;  2R92 J;  1T56 A;  3O8H A;  5FKK A;  3BQY A;  1LFB A;  2XPV A;  2QCO A;  1MNM C;  1I6H J;  2NS7 A;  1FEX A;  3BT9 A;  5IYD J;  1QRY A;  2M9H A;  3RQI A;  2DMQ A;  1ETX A;  3H0G J;  5C4J J;  3BTJ A;  2CQX A;  5M5Y J;  2OPT A;  4XIC A;  4L5E A;  1TWH J;  3LSP A;  1JUP A;  4Y52 J;  2LTP A;  1U78 A;  3MN2 A;  3PO2 J;  2JN6 A;  2K9S A;  2ID3 A;  3BG3 A;  3IH2 A;  3JRB A;  1W0U A;  1IJW C;  3Q0W A;  2EZH A;  4M6V A;  1NK2 P;  2COB A;  1D5Y A;  1OCT C;  5GP9 A;  1Q1V A;  3QPS A;  1HCR A;  4IHY A;  1ETO A;  2R5Z B;  2IBD A;  1HF0 A;  2VUM J;  5J1U A;  3LOC A;  2LY9 A;  2KDZ A;  5K7H A;  3MVP A;  2MGQ A;  4B1R A;  3HGG A;  3BQZ A;  1ETK A;  1ETQ A;  1FTZ A;  2IAI A;  5EYR A;  1DU6 A;  9ANT A;  5JLW A;  1X2N A;  4DZJ A;  3HOV J;  4ABZ A;  1VFC A;  3S1Q J;  5F27 A;  2VI6 A;  3H3V K;  5EGO B;  4M3E A;  3JRE A;  4AYB N;  4BY1 J;  1ETY A;  2GBY A;  4A3B J;  1MBF A;  1SAN A;  2WAQ N;  3IH4 A;  2DTZ A;  2NVY J;  1TC3 C;  4W97 A;  4XK4 A;  5BNG A;  2G0E A;  3CDL A;  4V2G A;  2L0K A;  4C2M J;  4C3H J;  3LSJ A;  1RET A;  1XS9 A;  1TWG J;  1O4X A;  1MH3 A;  1VI0 A;  1A5J A;  4D5F A;  5IOY A;  4A93 J;  2XB5 A;  3OIO A;  1GDT A;  3ZQF A;  4X6A J;  1A6I A;  4DZP A;  2M0C A;  1PUF B;  1YRN A;  2E2J J;  2JWT A;  3GTO J;  3S14 J;  1EF4 A;  2ME0 A;  2CQQ A;  1I3Q J;  2EH3 A;  3GBG A;  4DW6 A;  3A01 B;  2DA6 A;  2ZB9 A;  2R5Y B;  2LK2 A;  3B6A A;  5FJ8 J;  3D1N I;  5EG0 A;  1GT0 C;  2O9L A;  2M8G X;  3ZQI A;  3BR1 A;  1IDY A;  5EZG A;  2AO9 A;  2FJ1 A;  1OCP A;  2DMP A;  3M3Y J;  4MO7 A;  3A03 A;  2XPW A;  1B72 A;  4XID A;  1XG1 A;  3G1O A;  4IHV A;  1MBH A;  5EF6 A;  4CYC B;  3LSR A;  2NS8 A;  3RZD J;  1ENH A;  1LE8 A;  1BW6 A;  3HM5 A;  1HDP A;  4IHX A;  3HDD A;  2HI3 A;  1JKO C;  5HOD A;  1MBG A;  1BA5 A;  5FKM A;  5J1R A;  3BTC A;  5FKN A;  4DYC A;  1JTY A;  2CJJ A;  2WV1 A;  2R0Q C;  3FK6 A;  1TWC J;  4M3G A;  1HLV A;  2LD5 A;  3S16 J;  4MFD A;  2DJN A;  5E3L A;  2LKX A;  1JKR C;  2H1K A;  2R93 J;  2EQR A;  2E2I J;  1X2M A;  2HOS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...