4HOBA

The crystal structure of the zalpha domain from cyprinid herpes virus 3
Total Genus 17
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
17
sequence length
62
structure length
62
Chain Sequence
PISEEMNLKILAYLGTKQGAKAVHIAQSLGAQRSEVNRHLYRMSEDGRVRKHPQHPVWYLPA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein
molecule keywords Putative uncharacterized protein
publication title Crystal structure of a poxvirus-like zalpha domain from cyprinid herpesvirus 3
pubmed doi rcsb
source organism Cyprinid herpesvirus 3
total genus 17
structure length 62
sequence length 62
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2012-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02295 z-alpha Adenosine deaminase z-alpha domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4hobA00
2XUBA 4YG2F 4HV6A 3GZ6A 5D5VB 2KRFA 4HX4A 3O3KA 1VTNC 3I58A 2HZTA 1BI1A 2MBFA 1KA8A 3PFIA 3GW2A 2HOEA 4I01A 2M30A 3TOBA 4CXFA 3IHUA 2MH9A 2ZXJA 4ESJA 1W4MA 4UV9A 3RYPA 2RNJA 3RDIA 2XGXA 5ICFA 3QAHA 2STTA 1Z1DA 5JVTA 3SZPA 3PQJA 2H09A 4ZZLA 2DBBA 4FHTA 4P5OA 4L9NA 1HKQA 5F64A 4LG0B 3DPTA 1I6XA 5J6XA 4MQ9F 2LDUA 4UV8A 3FHZA 1L0OC 1YW9A 4OIRF 3JTGA 1YYVA 2YU3A 1EH7A 1Z7UA 2QBYA 4ETSA 2PG4A 1REPC 2L02A 1U8RA 4L9TA 4WK8F 1R7JA 3WTSC 2P7VB 2X4HA 4U0VA 4Z2YA 3JAMK 4GYIA 4R1HA 2WV0A 3U9GA 1E2XA 2DTRA 3IWZA 2ELHA 5JR3A 3MZYA 4IF4A 3DPLC 1DDNA 3HSRA 4KDPA 2L3DA 1P4WA 2H6CA 3K1MA 3VODA 5DCMA 2GA2A 3FMSA 1QO0D 3CO7C 3F8BA 5IT9Z 3RKWA 3I71A 2IPQX 2P5KA 3DQVC 1FSHA 3ERED 3KEQA 3LAJA 2KJCA 2RKHA 4GGGA 1QZYA 5HLIA 4L0ZB 4RB3C 1V3FA 2DFIA 4BHCA 5HS8A 3DP7A 4NQWA 2DQRA 3HHHA 5E1XA 1TQPA 3IL2A 3HIFA 2IW5A 3KEOA 3ZN0A 4FX0A 2L4AA 2ZNYA 4UXNA 2ZMEB 3M8EA 4IRIA 3R6SA 3FXQA 1BC8C 2YR2A 3K0LA 1T6SA 5A2QZ 1H9GA 3GFIA 2Q0OA 5ICCA 4PGGA 1FNNA 1UFMA 1WWXA 3HRMA 2D1VA 5ED4A 1G3TA 2HTJA 5ILUA 1IXCA 1B4AA 4TV7A 3ECHA 2M87A 1PDNC 3IC7A 4EJVA 2CFXA 3GYHX 3I4PA 1J5YA 4HOBA 2QBYB 3KP2A 5FFZA 1SFEA 2VE8A 2YSRA 2FBHA 1XGOA 4GXOA 4KUMA 5LRSA 1MDMB 2BBYA 1GHCA 3WE3A 1KU3A 5D5WB 5DDGA 1Z6RA 4U7BA 2P8TA 3PQKA 3IRRA 5DCMB 3SXYA 1RUOA 4S04A 1IN8A 5ILSA 1P2FA 4KIFA 1HQCA 3GWZA 4ENKA 3COAC 3T8TA 2GWRA 2NNYA 4FX4A 1XSDA 3MFKA 1G3YA 2JRTA 5K5QA 1T98A 2IA1A 2LSOA 2Q8KA 5HS9A 1YQAA 2BE5F 4A6EA 1B9NA 1LDKB 1IRGA 2PMUA 2QM3A 3KZZA 3TKYA 1R36A 1R5HA 4ASNA 4BQAA 5E1WA 4ZYGA 4Q4ZF 3C7JA 3BDDA 3KLOA 1P4XA 4RGRA 5ICGA 4XSZF 1ZHFA 1K78A 4N9HA 1U5TA 1SMYF 1HW2A 1OR7A 4U0YA 2FXAA 2CO5A 3KZYA 3I59B 4XRFA 3WG9A 4HV5A 4IJAA 3D0SA 5FD6A 1GVJA 2F5EA 2B0LA 5TRDA 3BOQA 1UHMA 1IF1A 1O3QA 2D2WA 4M71A 1G4DA 4HDUA 4G7OF 4LGWA 1QQIA 2EK5A 3IWFA 1BN5A 3IKTA 1U6GA 5LBQA 1LEBA 2P4WA 3C1DA 2MH2A 1MGTA 2VBWA 2XIGA 2TDXA 1ZREA 2VT3A 1I27A 4IHSA 4N9IA 1J0RA 1B9MA 4O3MA 1W7PB 1YW7A 1J9IA 2PI0A 2XAGA 4CZZA 1W7PD 5D5XB 3FMQA 3F3XA 3GVAA 4YFXF 5CVVA 3F72A 2EA2A 2HS5A 4B8XA 4CYDA 3V7CA 3ZMDA 3KE2A 4EJUA 2JSCA 4LLLA 2PN6A 1RZ4A 5K5RA 3P9KA 1FOKA 3CJNA 5KK1A 1ZRDA 4OIOF 1H0MA 4P55A 4I98B 3GLXA 3LA7A 3E97A 1K78B 1XDSA 1IN6A 3B02A 1U5TB 4RAZA 3ZMUA 2UWMA 2M1BA 2QQAA 1U2WA 3I54A 3E5XA 4O5VA 4EGYA 4CO8A 3HSFA 1WQ2A 1LDJA 4AD9A 1L3LA 4A0ZA 5HVQC 4CICA 1YFHA 1H9TA 1TTYA 2ZJ2A 1CF7B 3FM5A 5EEGA 4LLGF 5KVRA 4FT8A 4IPAA 1ON1A 1TQMA 3LA3A 1HXDA 2A5YB 3K69A 3NQOA 3BROA 1T2KA 2RGVA 2ZO4A 3RI4A 3R0AA 1DPUA 4UNOA 3BJ6A 3GXOA 1R1VA 1UHWA 3DF8A 3VOEA 3WTXC 4LG0A 1XGMA 1FWZA 1FPQA 1ZH5A 4P9UA 3TO7A 4MEXF 4LMYA 4BH9A 2OQGA 3QP5A 4BHBA 2QUFA 4E70A 3GEZA 1PP7U 5FO5A 5HOOA 3ELKA 3J80K 5FGMA 2PJPA 1MJ9A 4MHGA 2W57A 2PBIA 5K1YA 2XKPA 2HGCA 1P92A 1ZLKA 1Q1HA 1R5GA 2QVOA 2FEZA 2MD5A 2P5LC 5ICEA 1FSEA 4MEYF 4OIQF 2H27A 3QPHA 4PGHA 2GIVA 4EJWA 3TDZC 4I7HA 1U5TC 2JZYA 2P6SA 2CQKA 4U0WA 3BWGA 4LD5A 4XLNF 3ZMZA 3RKYA 3WU1B 2EFOA 5F6FA 4MTEA 1W5TA 3WTVC 3TOAA 2QQBA 2AS5F 4M6YA 2NYXA 2OZUA 2E1NA 4MNUA 1MD0A 1SD6A 2PQ8A 4I09A 2CYYA 2ZMEA 3BP8A 2FNPA 2YPRA 1ZRFA 2R7DA 2KKOA 4HQEA 3ECOA 1BBYA 2FA5A 3RKXA 5AONA 1AWCA 1BC7C 2EFNA 4I0AA 2HKOA 4AIKA 3JSPA 2RN7A 4IRHA 4LJZF 4AIJA 1JHFA 1RUNA 2LF7A 1HKTA 1FBQA 2IJLA 3LFKA 2VN2A 3C18A 4A6DA 4WXDA 3TO9A 1O57A 2G7UA 5D5UB 5D6EA 2DAOA 2HWVA 3SZTA 5FLXZ 1J7KA 2VONA 2VODA 2Q2EA 2O8XA 2Z99A 3GZ5A 2F5FA 4YFKF 3F21A 1SD7A 2J5OA 3E6DA 5JI6A 1ZG1A 1OYYA 3F8CA 3BJOA 1FYKA 2EV5A 4OIPF 3T0YA 5H6RA 4WX9A 1A04A 1P4AA 4A2UA 2XASA 2ZKZA 4BHPA 3RPQA 2RQPA 2OQRA 1MDMA 3Q9VA 5EEHA 5HDGA 1OYIA 2EA4A 2MLGA 3LAPA 3Q5FA 1Z9CA 1BI0A 2KIMA 2CW0F 1F4KA 2P7CB 2Y48A 1WKMA 1R1TA 2PMHA 1FP2A 3K1PA 4MTDA 2HYGD 2V9VA 1IRFA 1UB9A 1JXSA 3Q9SA 2OD5A 2O0YA 1P6RA 4XSXF 1KYWA 3T8RA 5IT3A 3JW4A 2RC4A 3EETA 5LEKA 4MQVA 4ENNA 3ABTA 5TJJA 3HRSA 1S29A 4EQQA 1Z6TA 3L9FA 1SAXA 1MJBA 2MLKA 4PZJA 4EM1A 3R60A 3HTSB 2FOKA 3QU3A 2K4BA 4HLYA 3ZMVA 4EVIA 2GXBA 4QLCU 3M8FA 5DYMA 1IXRC 4YFNF 4RGUA 3WTWC 3W6KB 2VC1A 2XV4S 2EB7A 5J8FA 2F2EA 1JGSA 2EFWA 3I59A 3BPXA 4A0YA 3V8JA 1YLFA 3HSEA 4Y15A 2QENA 5L3FA 5CVIA 2EFPA 2ISYA 1F9NA 2Z9OA 2QZ8A 1ZRCA 5DCFA 3M1EA 2CG4A 3QU6A 4BYYA 1EH6A 3EDPA 1R58A 3HOSA 2D1HA 4A5NA 2ZCWA 3L00A 3IKVA 3J81Z 2UZKA 4HX7A 4KMUX 3LA2A 2A6HF 4PCQA 1K6OA 3KP3A 3FXUA 5DEQA 5BPIA 2A6EF 4A12A 3KP7A 3P9IA 3TO6A 1W7PA 4S05A 2PLYA 3U2RA 3V7SA 2E7WA 1G6NA 4BXUA 3QOPA 1HBXG 4JK1X 4DQ2A 4YIFA 4G9YA 2FNAA 1TNTA 5HDNA 2KIUA 1ON2A 1XSXA 3SFZA 4M73A 4Q5SF 3K1NA 4Y13A 2P6TA 4PDKA 3F23A 1ZN2A 2ZNZA 3REOA 3G3ZA 1U78A 2DK8A 2HQNA 5D8LB 3KP6A 3WGGA 3OOPA 1KQ8A 2GXGA 2VBXA 1QZZA 4HZFA 5ILVA 4HW0A 1TBXA 2UXNA 1T0FA 2M45A 1IZ1A 2DPDA 1LJ9A 3U1DA 4WF2A 3SHFA 2BGCA 1XCBA 2QYOA 1CF7A 4CDGA 5AIQA 4OINF 3IRQA 1XB4A 4KICA 4NB5A 2W84A 5JFRA 4G6DA 4ENJA 2V79A 1IW7F 3KLNA 1K7AA 2O61A 3FMRA 3GFLA 1LEAA 4DNCA 1O7FA 2HKXA 2K4JA 1ULYA 3G73A 4L5IA 2FQ3A 2H6BA 4HF1A 4HF2A 3N4MA 3JAMZ 4GO1A 1O7LA 3P7NA 2A68F 1SD5A 3GUDA 2EFQA 2L01A 6PAXA 2K27A 4U7DA 4OMYA 2XAQA 5L3DA 2G7HA 2A07F 5LGTA 2XROA 4WCGA 2EV0A 2FMLA 2FBKA 1F5TA 2DI3A 1TLHB 1IN4A 1FZPB 2EV6A 3E3VA 4L5JA 2EJRA 4ON0A 2GAUA 1FLIA 3JTHA 3HUGA 5IT9K 1WSUA 2NNNA 4HF0A 3WTZA 2D45A 2QLZA 2ESHA 3H3ZA 5DV5A 4MGRA 1V4RA 2VBZA 4K2EA 3DFGA 2HFHA 2XRNA 2W25A 2COMA 2Z3YA 5DUIA 2M8EA 3JSOA 3ROUA 4G8XA 3MZHA 1BI3A 1S8NA 2RV8A 5A2QK 2FMYA 3HRTA 2K02A 1IUYA 3RJPA 2JPCA 3MEXA 3HOTA 2FU4A 2FSWA 5LHIA 1FC3A 4QWQA 2C6YA 4OU0A 3F8MA 2R3SA 2XAJA 3E6CC 4UVBA 3ML6A 1FY7A 4M9XA 3EUHA 3FXRA 4M9ZA 1OKRA 2IA2A 2J5PA 2MA3A 2A61A 4ZYEA 1JE8A 1R00A 5HDKA 3N97A 2A69F 1C0WA 4AVPA 1DPRA 4IXAA 2PEXA 3VEPA 4RGXA 2Y75A 4F7ZA 3GO5A 1S7AA 4RB1A 1ZLJA 4EM0B 3GFMA 3E5UA 1BJAA 1O3TA 3BZ6A 1MKMA 3CLOA 5FD5A 2VE9A 3VB2A 1U3EM 3KFWX 2XHKA 1ZGAA 4G7HF 3F8NA 3RPUA 2WWYA 1MZBA 1ZYRF 3BJAA 3NRVA 3ZP5A 2M5WA 1IN5A 5LLQA 3RTRA 5CVJA 3CDHA 1XMAA 3GFJA 2YX7A 4HX8A 1T38A 1Z05A 4IRGA 4B09A 1O3SA 1YS6A 1LQ1A 1FBUA 2E7XA 4ZZDA 3HRUA 2MC3A 1RI7A 4KT5C 1BIAA 2RVCA 1EV7A 2IA0A 3ULQB 4ZYHA 5CVRA 4P96A 2JT1A 4EJOA 1B59A 3BPVA 1HSJA 1DP7P 3D5LA 2LKPA 2XAFA 1IAWA 2V1XA 3K9TA 4HDVA 3K2ZA 4KIGA 1XDUA 4IHTA 2WC2A 2HDCA 3V8LA 1USSA 2L4MA 2JPBA 2XVCA 3QP6A 1GXQA 3F22A 3HHGA 4HA8A 1LB2A 2Y0MA 2FBIA 2L54A 3DKWA 2YX4A 4KMFA 2K7LA 4HLXA 2OAZA 4AIHA 2F5CA 1DUXC 1FBSA 5F1RA 1SMTA 2STWA 2QWWA 3BY6A 4ZH4F 3F6OA 3LQQA 1G3SA 1KU2A 4Q47A 5BOXA 4ESFA 3ABUA 1R22A 4UVCA 1B6AA 3FF5A 3MAJA 5E8IA 2PFBA 1CGPA 1AOYA 5HLHA 2IRFG 3RYRA 1SFUA 1QBJA 1S3JA 3W6JB 3WGIA 4CGZA 2VOOA 2DPUA 4L9VA 5E8GA 1XCVA 4EV0A 2OZ6A 1YW8A 4OMZA 2GQQA 2EWNA 2O03A 3DV8A 2G9WA 1J59A 1ODDA 3ZMSA 3FZVA 4LB5A 1ZAOA 5H20A 4G94A 2CWEA 1BM9A 1SFXA 2HTSA 4D0PA 1BIBA 1O3RA 4U88A 1OPCA 2F5DA 1WI9A 1USTA 3EYYA 2KJBA 2VXZA 3L09A 4KYWA 1F1ZA 5DD4A 1KQ0A 5D8KB 3H3UA 2UXXA 1ZG3A 2HQRA 1E17A 1ZG5A 1ONVA 3LWFA 3TDUC 5LRRA 4NHJA 3F8FA 2IT0A 3P9CA 1D8KA 3R0JA 5L3GA 5D4RA 1KU9A 5BPDA 1S7OA 3QPTA 2GA1A 3HYIA 3O2PE 2JTVA 2W24A 3TQNA 1MJAA 5E17F 3LSTA 3V4GA 5BQTA 1QGPA 2RDPA 4HBLA 3TGNA 2VOPA 1HKSA 1XD7A 1Y0UA 4JBAA 4O6JA 4EGZA 1I5ZA 3E6MA 3WTUC 1LNWA 1IXSB 3VFZA 3F6VA 4KN7X 4LLNA 3MWMA 4XLPF 2HYFA 3WTTC 1LDDA 2NRAC 5LHHA 2W85A 3CUQA 2K86A 3QRFF 3V8KA 4Q48A 3M7GA 3L2CA 4Y17A 1S6LA 3WE2A 4KIBA 3J80Z 5ERIA 3T5XA 5BS6A 3E6BA 4EJTA 5HLGA 2ADUA 2NAZA 3KP4A 3WTYC 3GX4X 3EQLF 3CO6C 4I2OA 2O6GE 3I5UA 2NS0A 2VT2A 5JHUA 2V1DA 4OOIA 4UVAA 3I53A 3ZQ7A 5AIPA 3DEUA 4RB0A 1PUEE 2BV6A 5CVUA 2XKOA 2QQ9A 4H0EA 2IVMA 4JQFA 4IVNA 1FYMA 5CJ9A 1B1BA 4CHUA 4I02A 4AWXB 1FT9A 5LGNA 2CSOA 5FB2A 3R61A 4GCVA 3ISPA 3B73A 1NHAA 3I64A 3M9AA 5L3EA 3ZPLA 3ZMTA 1K79A 1IN7A 1TNSA 3KCCA 4LB6B 1KQ9A 2LNBA 5FFXA 1RNLA 4ZYDA 3I0TA 4WWCA 3MQ0A 4YIIA 5HS7A 5CLSA 3AAFA 3HTUA 1X3UA 2ACJA 2BEOA 4I0BA 2H94A 4HAMA 2FF4A 4UHTA 2DK5A 2ZBKA 4L0YB 1I1SA 2HEOA 1QPMA 1SD4A 1JHHA 3J7AO 1QNTA 5H6QA 3EYIA 2OA4A 3CUQB 5LEJA 1YTYA 2R7FA 5BMZA 5FLXK 1YIOA 1I1GA 1ZGJA 4ESBA 1OMIA 1TQIA 3MCZA 2DT5A 2WTEA 4HYEA 5L3CA 1OYWA 1EH8A 2HR3A 3DXJF 4L18B 5E18F 1GXPA 1FX7A 4LK0F 4BAYA 1D5VA 1R23A 4L9JA 4RAYA 4G6QA 5CYVA 4N0BA 3WU0A 1KU7A 4UUVA 3NEUA 5LGUA 2CGPA 2V6CA 1XN7A 4EMSA 1HW5A 3WODF 3WGHA 4GYGA 2E1CA 1G3WA 1HW1A 3S2WA 5DUKA 1D8JA 4EM2A 3E5QA 2KIFA 1WRJA 4WXCA 2AXLA 2ISZA 2XAHA 4M72A 4LFUA 1BOAA 3V7RA 4WXHA 1W5SA 1HSTA 1YG2A 1YS7A 4KNYA 3FM3A 5L3BA 2DLLA 4A0XA 1TW3A 2V1UA 1LVAA 2ZFWA 1STZA 2GZWA 4P9FA 4RS8A 1ZARA 4KN4X 1FP1D 2O3FA 2DU9A 2ESNA 2FE3A 3ZN1A 3L7WA 2A3SA 3CTAA 4KA4A 2DW4A 5E1ZB 4R79A 3CUQC 1RIOH 2BYVE 1XGSA 3FX3A 3KP5A 2OU2A 5K5OA 3R4KA 2Z5UA 2LF8A 3GF2A 2ETHA 2DQLA 4M9SA 4RB2C 3H92A 1XSVA 3T1BA 1R1UA 5D6FA 1XMKA 1T39A 2DO7A 4M6XA 3CUOA 1Z91A 2P5VA 3FWEA 4M74A 3J81K 2VC0A 5E20A 4BNCA 5D4SA 2FRHA 2VBYA 2Z33A 3OV8A 1BI2A 4KFCA 1TW2A 3RIRA 3C3WA 1FYLA 1KGSA 4RGSA 4HQMA 4R8HA 1YO5C 5DD8A 2OBPA 3KETA 4A5MA 3O6BB 2IP2A 2X0LA 1J75A 5LHGA 3LQRA 3SQNA 1XGNA 5J8CA 1D3YA 4XBFA 4G7ZF 4ENMA 1PP8F 1J2XA 1UCRA 4LK1F 1KYZA
chains in the Genus database with same CATH superfamily
2XUBA 4YG2F 4HV6A 2LMDA 3GZ6A 2TCTA 3BLYA 2WADA 5D5VB 2KRFA 1R4NB 1SFKA 4IQ4A 3L2RA 4HX4A 3O3KA 1VTNC 3I58A 1QHGA 2HZTA 1BI1A 2MBFA 1KA8A 1QPIA 3GTLJ 1E3PA 1WJ5A 3PFIA 3GW2A 2HOEA 5B5EC 4I01A 3MKWB 9ANTA 5DS9A 1I39A 2VKDA 2M30A 4QIWN 1MMDA 3TOBA 2JQ7A 4JOMA 4CXFA 3JRBA 3HZJA 2DTZA 4V2GA 4E7ZA 3CJQB 3IHUA 2MH9A 2ZXJA 2KDZA 1W4MA 4ESJA 3JRFA 3OL4A 1PJRA 4UV9A 3SEZA 3RYPA 2RNJA 3RDIA 2XGXA 4FE7A 5ICFA 2KMUA 5K7HA 3OYEA 3OYKA 3P5JA 3QAHA 1JJ8C 3LFUA 3QYBA 3FXOA 2STTA 4AM3A 1Z1DA 4V2FA 1QZEA 3JRHA 2HYJA 5JVTA 2LKSA 1HF0A 3SZPA 3PQJA 2H09A 4ZZLA 2DBBA 2R0QC 4FHTA 1WFXA 4P5OA 4L9NA 1VQ4I 1HKQA 4XR6A 2I10A 2BW3A 5F64A 4LG0B 3DPTA 1I6XA 5J6XA 2WB1A 4XL9A 2KPMA 3RQIA 3G1OA 2KHMA 4MQ9F 2LDUA 4UV8A 3FHZA 1L0OC 4F3QA 2BHZA 3DEEA 2DT6A 1YW9A 1MBEA 2RAEA 3H9GA 4OIRF 4BL0B 2CW7A 3IH4A 3JTGA 1YYVA 2YU3A 1EH7A 1Z7UA 2QBYA 4ETSA 2PG4A 1REPC 3A2KA 2PJRB 2L02A 1U8RA 4L9TA 1FOYA 1XX5A 2BXYA 3PIPF 2CQ7A 4WK8F 5E3LA 1R7JA 5IYCJ 2LBFB 3WTSC 1RKWA 2LOOA 1R9TJ 2P7VB 2X4HA 4U0VA 4Z2YA 3JAMK 4BDZA 4GYIA 1U9OA 3PSIA 4R1HA 2WV0A 1A36A 3U9GA 3RZDJ 1E2XA 1X1BA 2DTRA 2EIKH 1PUFA 3IWZA 2ELHA 4BS9A 2B63J 2WY7Q 5JR3A 3MZYA 5K7FA 4IF4A 3DPLC 1DDNA 3HSRA 1V5FA 4AIDA 2ME6A 4KDPA 2L3DA 2JA8J 1P4WA 1DQUA 2LRDA 3CLQA 2H6CA 3K1MA 2HVQA 3VODA 5HODA 1K61A 5DCMA 3VSKA 1W0UA 2GA2A 3SZGA 4YELA 3FMSA 5KAIC 1OJLA 1OCPA 1QO0D 2BVLA 2KRCA 3CO7C 1ACIA 2GBYA 3F8BA 1ZKGA 3KYLA 2X6OA 4M3BA 2X48A 5IT9Z 3KEYA 3RKWA 3I71A 1YJ9I 2IPQX 2P5KA 4IHXA 1MSEC 3A01A 3MN2A 3DQVC 1FSHA 3ERED 3ZQHA 3CESA 3KEQA 3LAJA 2L9VA 2KJCA 2RKHA 4GGGA 5EF6A 1QZYA 4RAGA 1T56A 5HLIA 2Y9YA 4L0ZB 1AKHB 4A69C 1V3FA 4RB3C 2DFIA 2Y0SN 4BHCA 5HS8A 2HZDA 3DP7A 1X1CA 4NQWA 1S9HA 2DQRA 3HHHA 5E1XA 1TQPA 3IL2A 3HIFA 2IW5A 4AYBN 1E0EA 1X2MA 1FTTA 3KEOA 3ZN0A 4FX0A 3HM5A 3ASNH 2L4AA 2ZNYA 4D5CA 1UZCA 2ZMEB 4UXNA 1A31A 2RNGA 3M8EA 4IRIA 2CW8A 3R6SA 3FXQA 3DBLB 1BC8C 5C3EJ 1VQ6I 3JR9A 2V4JC 2YR2A 3K0LA 4LIVA 4W97A 2DOFA 1T6SA 1IC8A 5A2QZ 1H9GA 3OS2A 2CFOA 2Q0OA 5IPAA 3GFIA 2MG4A 3EPZA 5C4JJ 3C2HA 3K6GA 4B48A 1I6HJ 5EG0B 5ICCA 2FOWA 4PGGA 5IOYA 1FNNA 1UFMA 1WWXA 3HRMA 4C3JJ 1B72A 2D1VA 2KIQA 2DA1A 3U1KA 5ED4A 1G3TA 2HTJA 1BW6A 2OJED 2JMWA 5ILUA 3OYFA 2EILH 1S72I 1IXCA 1B4AA 5GTIC 4TV7A 3ECHA 2M87A 4KITB 1PDNC 3I4NJ 3IC7A 4EJVA 2KRHA 2CFXA 3GYHX 3I4PA 1JKRC 2Q2EB 1J5YA 4HOBA 2OCCH 1ETYA 3L2UA 2QBYB 3KP2A 2ME0A 4II2A 5FFZA 1SFEA 4DBQA 2VE8A 1ZTRA 2YSRA 2FBHA 1XGOA 3QYEA 2K9SA 1VQ8I 4GXOA 4KUMA 2ZC2A 1PUFB 5IYBJ 1OCOH 2IS6A 5LRSA 1UMQA 2XGDA 3OYGA 1NG7A 4ABZA 1MDMB 3H1CA 3AG1H 2VLAA 1VQ7I 2BBYA 4X1EA 1GHCA 3WE3A 2K9LA 1KU3A 2DYSH 3G1MA 1KONA 2CJJA 4C3IJ 5D5WB 3LSKA 1Z6RA 5DDGA 3JRIA 4U7BA 2P8TA 4XLFA 3PQKA 3IRRA 1IV6A 3CP2A 2LLKA 3BG6A 2ID3A 5DCMB 3SXYA 1RUOA 3IH3A 2CV1A 1ETWA 1Y0NA 4S04A 3S3NA 1IN8A 4BDYA 2WA0A 4HNVA 5ILSA 5TGTA 2BY2A 2O8KA 4CCLA 1P2FA 4KIFA 1HQCA 1W36D 3GWZA 4ENKA 2COBA 3COAC 3T8TA 2GWRA 2NNYA 1XTAA 4FX4A 2ECCA 1XSDA 4D7MA 4UUSA 3MFKA 1X1PA 3BG3A 1G3YA 2XF5A 2JRTA 3RQ4A 5K5QA 1TWGJ 4RDUA 3JRDA 3D1NI 4BJ5C 4GFBA 5KHDA 1T98A 2IA1A 2LSOA 4J00A 3CCLI 2Q8KA 4MFEA 5HS9A 4NQWB 3H9QA 1YQAA 2CUEA 1POGA 3HEFA 3ZGKA 3BQYA 2BE5F 2W82A 3K4KA 2W7NA 3K70C 4KISA 4A6EA 3S17J 1B9NA 2WAFA 3RSNA 1LDKB 2P81A 1ETVA 3CD6I 3LSJA 3IP4B 1IRGA 1D0ZA 3TW7A 2PMUA 2ZFUA 2QM3A 4MIMA 3KZZA 3TKYA 3ZQGA 1R36A 1R5HA 5KCMA 2O9LA 4ASNA 4BQAA 1DGRM 5E1WA 4ZYGA 4Q4ZF 2H8RA 3C7JA 3BDDA 2R7QA 1Z3YA 1O4XA 4X6AJ 2QQ8A 2NVYJ 3KLOA 1SFOJ 1GV5A 1UG2A 1B72B 3OYDA 3CCQI 1P4XA 4RGRA 3BCAA 5ICGA 4XSZF 5E3OA 1ZHFA 3K4BA 1K78A 4N9HA 3H9JA 2VQLA 1U5TA 1SMYF 4PFOA 1HW2A 1OR7A 3S2DJ 4U0YA 2E5ZA 2FXAA 2CO5A 5F0FA 3CCUI 3KZYA 3I59B 3HGYA 2F48A 3ABLH 3S93A 1ERDA 5FKOA 2V9KA 4XRFA 3H3VK 5GPAA 3WG9A 2M2EA 4HV5A 4IJAA 3D0SA 5FD6A 1ITYA 1GVJA 2F5EA 1IDZA 2B0LA 2BHYA 5TRDA 1YJWI 3BOQA 4X0GA 1J09A 2DYRH 1UHMA 1IF1A 2QKMB 1O3QA 3GBGA 3RKQA 2D2WA 1ZK8A 1TWAJ 3ZQFA 4A3FJ 4M71A 1G4DA 3LNQA 4HDUA 1JJ6C 1I3QJ 4G7OF 4LGWA 4XKVA 2E35A 1QQIA 4EATA 4PJLA 1TWHJ 2EK5A 3IWFA 3FK7A 1BN5A 2R7OA 1SVLA 1U6GA 5LBQA 3IKTA 2VPLA 2I8DA 2H1KA 2P4WA 3C1DA 2MH2A 5DM7F 1LEBA 1MGTA 2V9PA 1DU0A 3LSMA 3HOUJ 2XSJC 2VBWA 2XIGA 2MD0A 2LYCA 2TDXA 3CDIA 1ZREA 2VT3A 4U87A 2QEXI 3SDBA 1I27A 4IL6C 4IHSA 4N9IA 1J0RA 1B9MA 3PNVA 4DYCA 4O3MA 1W7PB 3CMYA 1YW7A 4RLQA 1BW5A 3DTIA 4YIRX 2JJ7A 2Y2ZA 3HBLA 4YRVA 1J9IA 1QA6A 2A6TA 2PI0A 2XAGA 4CZZA 1W7PD 5D5XB 2E71A 1XC5A 2XF7A 2QA4I 3CQZJ 3FMQA 3F3XA 3GVAA 4YFXF 2K3FA 3AG4H 5CVVA 1WJEA 3DLAA 4MLOA 2GOXB 3F72A 3L2WA 2EA2A 2HS5A 5JLXA 2VQGA 4I6ZA 4B8XA 4CYDA 4A3KJ 1IG7A 4Y52J 3V7CA 5B1AH 3ZMDA 3KE2A 4EJUA 2JSCA 2FUG2 3W2AA 1T8IA 4LLLA 2V6EA 3QPSA 2PN6A 3M07A 3I55I 3NARA 1RZ4A 3CCRI 2ZSHB 2H8WA 5K5RA 3P9KA 1FOKA 5EGOB 4XICA 3CJNA 1V5GA 2DA4A 4B43A 1VNDA 3OR2C 5KK1A 1ZRDA 4OIOF 1H0MA 4P55A 4DIQA 1S5LC 1R6RA 4I98B 1OCZH 2M3AA 1VQ9I 3GLXA 2W00A 3E97A 3LA7A 1K78B 1U9NA 1XDSA 4F91B 3FKJA 1IN6A 3B02A 2HOSA 3BTCA 1U5TB 2DMPA 4RAZA 3ZMUA 2UWMA 2M1BA 2QQAA 4DYRA 1U8BA 1U2WA 3I54A 4CCMA 1HCRA 4A3JJ 3E5XA 5J3LA 3FKIJ 4J19A 3F9KA 4O5VA 2H1LA 5FKMA 4EGYA 2JN6A 2BY1A 4CO8A 3NWSA 3HSFA 1WQ2A 2LVSA 3K10A 2LG4A 1LDJA 4AD9A 2E5NA 1L3LA 4A0ZA 5HVQC 4IHVA 4CICA 1JGGA 4M6VA 2IGNA 2JA2A 1YFHA 1H9TA 1TTYA 2DA7A 2ZJ2A 1CF7B 2NVXJ 3CCVI 3FM5A 5EEGA 4LLGF 4B47A 3TP3A 4HNUA 5KVRA 2QKLB 1N75A 1MMAA 2EZLA 2DMNA 4FT8A 4IPAA 1ON1A 1TQMA 3LA3A 1VQKI 2R7UA 1HXDA 2A5YB 2LY9A 3K69A 3NQOA 3BROA 1T2KA 1E3HA 2RGVA 2ZO4A 3FBIB 3RI4A 2OTLI 3NAUA 2CQNA 3R0AA 1E3OC 3M8JA 1DPUA 3C2BA 4UNOA 1DP3A 3BJ6A 3GXOA 1R1VA 5H2FC 5IY5H 4D5FA 1UHWA 1SVMA 2CV2A 4DYQA 3DF8A 3WU2C 3VOEA 3G71I 3WTXC 4LG0A 3OYLA 1XGMA 3B6AA 3EUKL 4Y7NJ 1FWZA 1WH5A 3FBNB 1FPQA 1VQNI 2NS8A 4NDLA 4RA2A 1W1WE 2JSPA 4N4OB 1ZH5A 4P9UA 4CCJA 4XN3A 4XONA 3TO7A 2WB1N 2WV1A 4LMYA 4MEXF 4BH9A 3UKGA 2OQGA 3QP5A 2K85A 3S8PA 2LC2A 4BHBA 2QUFA 4E70A 3GEZA 1PP7U 2PJRA 3KX2A 2KISA 5J4YA 1Y6IA 5FO5A 5HOOA 3U21A 4C9YA 2DT7B 5M5YJ 3A0HC 3ELKA 3J80K 3HOXJ 5FGMA 4A3EJ 2K9QA 4DW6A 3GCMA 2PJPA 1MJ9A 4MHGA 2X85A 2W57A 4CA0A 4B44A 3IV5A 1DGWY 2PBIA 5EYRA 3E7LA 1YE9A 2Y9ZA 5K1YA 2XKPA 2HGCA 3PIOF 2BY3A 1LUJB 4HPQA 4XRSG 1P92A 2O7OA 5E79C 1ZLKA 1Q1HA 1R5GA 2QVOA 2FEZA 3E1SA 4XLEA 3W2WA 2MD5A 2P5LC 5ICEA 1FSEA 2IBDA 1YJNI 4IHWA 3CMMA 4MEYF 4OIQF 3OIQA 2H27A 3QPHA 4FE4A 5IP7J 4NNJA 4PGHA 2GIVA 4EJWA 2WAEA 3TDZC 4I7HA 1U5TC 2JZYA 4V19K 2P6SA 5J47A 1OR7C 1WGXA 2MSYA 3ERMA 1SVOA 2CQKA 4U0WA 3VDXA 3BWGA 4LD5A 4XLNF 2EZHA 2QSFX 2WAQN 3RKYA 3ZMZA 1RR8C 3QPLA 3WU1B 3S3MA 2L9RA 1N77A 2EFOA 5F6FA 2Z2SB 4XQFA 4GDFA 4RM2A 1RETA 1BL0A 4MTEA 3X2QH 1APLC 1W5TA 1AKHA 4DZJA 3WTVC 2X6YA 3TOAA 2QQBA 3GTGJ 2AS5F 4M6YA 2VI6A 2NYXA 3V42A 2OZUA 2E1NA 1X19A 4MNUA 2ZXHA 2JVHA 1MD0A 1SD6A 1HC8A 2VQHA 1I3AA 2PQ8A 4I09A 1SEUA 2CYYA 2ZMEA 3BP8A 1ETQA 2FNPA 2YPRA 3H5AA 5EJCA 2R7DA 1ZRFA 3JRGA 3UNGC 2F4OB 2VB6A 2L5QA 5JLWA 2HOTA 2KKOA 3HB9A 4HQEA 4PUSA 2Z16A 3ECOA 1GLNA 2EZIA 3Q3SA 1BBYA 3S1MJ 2FA5A 3RKXA 2HNHA 5AONA 1AWCA 2VUMJ 3BR0A 4RM3A 1BC7C 2EFNA 1QHHD 3GTQJ 3FXMA 4I0AA 2HKOA 1HOMA 2XB5A 4NC7A 5EG0A 4AIKA 3FXLA 3BR3A 3JSPA 2RN7A 4IRHA 4LJZF 1WJBA 4AIJA 1JHFA 1RUNA 2LF7A 1ZELA 1HKTA 3TBIA 1FBQA 2IJLA 3LFKA 2VN2A 1ZQ3P 2AQFA 3C18A 4A6DA 2M7BA 4WXDA 3TO9A 1O57A 1VQ5I 4B3AA 2G7UA 5D5UB 1EA3A 5D6EA 2X1EA 4BE2A 2DAOA 2HWVA 4JYKA 3SZTA 2HOAA 5FLXZ 1XS9A 1J7KA 2VONA 2VODA 1X1AA 2Q2EA 2O8XA 2Z99A 3GZ5A 3OS0A 2F5FA 4YFKF 3F21A 1SD7A 2J5OA 3E6DA 5JI6A 1ZG1A 4NUBA 3DLLF 1OYYA 2ELKA 5E3NA 3F8CA 3K4MA 2X9DA 3BJOA 1FYKA 2EV5A 4OIPF 3BT9A 1OLTA 3T0YA 5H6RA 1A04A 1P4AA 4A2UA 4WX9A 2XASA 2ZKZA 1LPQA 4BHPA 4XOPA 3RPQA 1GUUA 2RQPA 2OQRA 1MDMA 1IRXA 3Q9VA 3RPUD 2X6WA 5EEHA 2Y69H 5HDGA 1OYIA 2EPFA 3JRAA 2EA4A 2JK3A 4CZCA 4BJ6C 2MLGA 3LAPA 3Q5FA 1Z9CA 2VXDA 3QWLA 4IHYA 1BI0A 2IXSA 2KIMA 2CW0F 1F4KA 2N8GA 3GLLA 1EJ9A 2AO9A 5EDNA 2DODA 2P7CB 3H0DA 2Y48A 4RLFA 1WKMA 4W1UA 4CUGA 1R1TA 1RPWA 2PMHA 1FP2A 3K1PA 2VKEA 2HYGD 2L7FP 4MTDA 1A6IA 2V9VA 1IRFA 2ECBA 3K4CA 1JKQC 5C44J 1UB9A 1F43A 4UB8C 1EKEA 1JXSA 3Q9SA 2MFZA 2OD5A 3CC7I 2O0YA 1P6RA 2PMZN 4PSXA 4XSXF 3ZR8X 4NC6A 1KYWA 4M3FA 3T8RA 5IT3A 3JW4A 3KYCB 1WH7A 2RC4A 1Q1VA 3EETA 5LEKA 2GIZA 4MQVA 3VPRA 2YU9J 3PUFA 3M1CA 4ENNA 3ABTA 3BR6A 4ZC3A 5F08A 4PFPA 5TJJA 1YHQI 3HRSA 1S29A 1M1EB 5IYDJ 4EQQA 1Z6TA 4CCOA 3L9FA 4II3A 2E19A 1SAXA 3M4OJ 3S1RJ 1MJBA 2MLKA 3CCYA 4PZJA 4EM1A 3R60A 3HTSB 2FOKA 4XKCA 3QU3A 2KZGA 4XORA 2K4BA 4S0HB 4HLYA 5DTDA 1U0JA 3ZMVA 4EVIA 4QLCU 2GXBA 4HSTA 4A3BJ 2MABA 3BZCA 3M8FA 3KZIC 4NBQA 5DYMA 1UAAA 1IXRC 4YFNF 2IS1A 4RGUA 2P0WA 3AFHA 5GPCA 2ICWG 3W6KB 3WTWC 1Z0XA 2VC1A 2XV4S 4A3DJ 3A4CA 4FTHA 2V7FA 1GDTA 2EB7A 1NK3P 5J8FA 4BBRJ 2F2EA 1JGSA 2EFWA 3I59A 3BPXA 4A0YA 3SDGA 3GMEA 4AUXA 1QVTA 3V8JA 1GT0C 4BACA 4Y4RA 1YLFA 2VQCA 2L7MP 2ZXWH 2AXTC 3HSEA 4Y15A 1B8IA 3CF5F 2QENA 4XLAA 5JVGF 2MGQA 2BZTA 3PO2J 1AA7A 5CVIA 5L3FA 2EFPA 1GV2A 2ISYA 1F9NA 5GAGJ 2OC6A 2Z9OA 4XRSA 1YRNB 3JCUC 2QZ8A 1ZRCA 1P7IA 1IUFA 5DCFA 4DOZA 3M1EA 2AHQA 2CG4A 3QU6A 3G6EI 4BYYA 1EH6A 1BR4A 3EDPA 1R58A 3HOSA 2M34A 2D1HA 4A5NA 2NVTJ 4G6TB 2ZCWA 3L00A 4IKFA 3IKVA 3J81Z 2W4SA 1D1BA 2UZKA 4HX7A 1YX3A 4KMUX 3LA2A 4BQOA 3BTIA 2A6HF 4F93B 5C4XJ 1FOWA 2DCEA 4PCQA 1K6OA 1RRJA 1CQTA 2MC4A 4E7LA 2IGMA 2Z1DA 4BEHA 2KP6A 3KP3A 1YX5A 3FXUA 4PJMA 5DEQA 2L7ZA 5BPIA 3B6CA 1VQMI 3S14J 2A6EF 4A12A 3KP7A 3P9IA 3TO6A 1W7PA 4S05A 2PLYA 3U2RA 3V7SA 2JRMA 2E7WA 1G6NA 3OYAA 3FDYA 4A93J 3ZQLA 1PYVA 4BY1J 2K5CA 2ZXIA 4BXUA 4XM3A 3QOPA 2EIMH 3OIOA 2Y0SA 4UUTA 1HBXG 2D5VA 4JK1X 4DQ2A 4DGWB 2ZMEC 4ZDOA 1WCMJ 4YIFA 4G9YA 4DBRA 2ZJPF 4AYBA 2FNAA 4FASD 1TNTA 5HDNA 1D1AA 2GXAA 1NH3A 4A3LJ 2KIUA 1ON2A 1XSXA 5LD2C 3SFZA 2G0EA 4JP0A 3SEQA 4M73A 4Q5SF 2LK2A 3K1NA 2LP0A 4Y13A 2P6TA 3DEWA 2VJ5A 4PDKA 5EGOA 5M3MJ 3F23A 1ZN2A 2ZNZA 5B66C 3A1YA 2L9NA 3PNTA 3REOA 3G3ZA 1ZGWA 1G2HA 3OYJA 1U78A 2DK8A 2HQNA 5D8LB 2JWTA 3MKZA 3ABMH 3KP6A 3WGGA 3OOPA 2ID6A 4IX7A 3FISA 1KQ8A 3DU5A 1VFCA 3SYTA 2GXGA 2VBXA 3FIWA 2L0KA 1QZZA 4HZFA 4IEJA 1LKXA 4UB6C 5ILVA 4HW0A 4QPQA 1TBXA 2UXNA 2LTPA 2HPIA 3LOCA 4FQGA 5IP9J 4AC0A 1T0FA 2GLOA 3H35A 1MMNA 1SAUA 2M45A 1IZ1A 2DPDA 1LJ9A 3U1DA 2HQ5A 1Y39A 2CS3A 4C2UA 1N78A 2CH0A 1JUPA 4WF2A 1B8IB 3SHFA 3CCJI 2BGCA 3ZXSA 3HC7A 2JA6J 1XCBA 1Y56A 2QYOA 1CF7A 1WHUA 4BKXA 4CDGA 5AIQA 4Y33A 1JKOC 4OINF 3HOYJ 1TWFJ 3IRQA 1D0XA 2LREA 1XB4A 4KICA 4NB5A 3WHCA 5GAEJ 5GTHC 2W84A 5JFRA 1R5ID 4G6DA 4ENJA 2V79A 1IJWC 1IW7F 3KLNA 3HOVJ 1K7AA 2O61A 1V54H 2NOGA 3FMRA 3GFLA 2FD5A 3AG3H 4E7JA 1LEAA 4DNCA 2V26A 1S7EA 3CCSI 1O7FA 2JUCA 2HKXA 1X3ZB 1W36C 2K4JA 4CH7A 1Y8RB 4PK4A 1ULYA 5J1UA 3G73A 4L5IA 4BEHB 1ETXA 1UHSA 3BCBA 1X58A 2FQ3A 2H6BA 1JT6A 4HF1A 4HF2A 3N4MA 2HXOA 3JAMZ 1NG6A 4GO1A 3TP0A 1JUMA 1O7LA 2OCEA 5GADJ 3OS1A 4E7HA 1NTCA 3H0GJ 2KQRA 3P7NA 3VYTB 2A68F 4C2TA 1SD5A 3BG5A 3GTPJ 3GUDA 2EFQA 2L01A 6PAXA 3W3CA 2K27A 4U7DA 2ZJQF 3OOUA 4OMYA 3BTJA 2XAQA 1X2NA 5B3SH 5FLMJ 1RR7A 5L3DA 2G7HA 2A07F 3KIOA 1BR2A 5LGTA 5CKTA 2XROA 4WCGA 3OYCA 1A6QA 2M0MA 2EV0A 4BE1A 3ESWB 2FMLA 5J40A 2LY2A 4AVZA 2FBKA 3CJRB 1F5TA 3PJRA 2DI3A 1TLHB 1IN4A 2E60A 3K4NA 1FZPB 2EZKA 2EV6A 1TL8A 3E3VA 4L5JA 2EJRA 4RAFA 4ON0A 4ZDLA 3FXJA 3DPUA 2GAUA 1FLIA 3JTHA 1YI2I 3NWTA 3HUGA 5IT9K 2HU9A 1WSUA 1MMSA 2NNNA 4HF0A 3Q0WA 3WTZA 2R7XA 2L9SA 2D45A 2QLZA 2ESHA 1ENHA 1UJ8A 2HDDA 3H3ZA 5DV5A 3F0CA 4MGRA 1V4RA 1QVUA 2OUMA 2VBZA 3MZ8A 3L2QA 3AG2H 2DFEA 2KZVA 1FTZA 4K2EA 1WJFA 3CZ6A 3DFGA 2HFHA 2XRNA 2W25A 3OY9A 3DKXA 2COMA 1V5EA 2CUFA 2Z3YA 5EZHA 5DUIA 1NK2P 2M8EA 2LY1A 4EEFG 3JSOA 4I99C 3ROUA 3ABKH 4G8XA 4MFDA 2L7KA 5F04A 3MZHA 1BI3A 1S8NA 3L1PA 2RV8A 4A3IJ 4UY8I 2NS7A 5A2QK 4KJZA 2FMYA 4IZZA 3HRTA 4BY7J 2BY0A 2K02A 4G12A 5EEAA 2X1CA 1IUYA 3GTMJ 3RJPA 2JPCA 3MEXA 2HVRA 1MH4A 3HOTA 2FU4A 2NOJB 3TMOA 2FSWA 1P9QC 5LHIA 2OPTA 1FC3A 4QWQA 2C6YA 1LE8A 1OQYA 3HL2A 1MBGA 1Z3XA 4OU0A 3OYHA 2IS4A 3F8MA 2R3SA 2XAJA 2R5ZB 3E6CC 4UVBA 2FQ4A 3ML6A 3W2VA 1FY7A 2FX0A 4M3EA 4M9XA 3W6VA 1YITI 3FK6A 1IO2A 3EUHA 3FXRA 4BJTA 4M9ZA 1OKRA 2IA2A 2J5PA 2MA3A 4H4KC 3H36A 1MBKA 2A61A 3FXKA 1MW7A 4ZYEA 1PVEA 2E2HJ 4A3GJ 1FOXA 1JE8A 1R00A 2AQEA 5HDKA 4HRIA 1X3WB 3N97A 1DU6A 2A69F 2PX9A 4Z6YA 1C0WA 4AVPA 2JA5J 1DPRA 1SC7A 4IXAA 2PEXA 3O8GA 3VEPA 4RGXA 2Y75A 4F7ZA 3GO5A 3TEDA 1S7AA 1ZLJA 4EM0B 4RB1A 1TT5B 3GFMA 3E5UA 3OL3A 3OYIA 1BJAA 2NXNB 1O3TA 4XMYA 2CV0A 3BZ6A 3QODA 3EUAA 1MKMA 3CLOA 5FD5A 2VE9A 4P1WA 3IH2A 3VB2A 2WY8Q 4LOCA 1U3EM 4XKBA 1VZ0A 2K3PA 3KFWX 2XHKA 3QQAA 3OYMA 1ZGAA 3I3LA 4G7HF 3F8NA 3RPUA 3GTKJ 4BUPA 4QSHA 2WWYA 4B4CA 1MZBA 1ZYRF 1WVRA 2EINH 4FISA 3BJAA 5CPRB 1R4MB 2QCOA 3A0BC 1VQLI 3NRVA 3ZP5A 2M5WA 4ZJZA 1IN5A 3HUGB 3SJMA 5LLQA 4OWRB 3RTRA 2BXZA 2EBIA 5CVJA 2I5UA 1XMAA 3CDHA 2YX7A 3GFJA 4HX8A 4NC8A 5GAHJ 1T38A 4ANJA 4IO9F 3HKZA 2X6XA 1Z05A 1WJCA 4IRGA 4B09A 1O3SA 1YS6A 1JUSA 4QPOA 1LQ1A 1W5CC 2IGOA 5FLVA 1FBUA 2E7XA 4ZZDA 4PSWA 4E7KA 1K4TA 4D7NA 4XRMA 1H8AC 3SFIA 3HRUA 2MC3A 1RI7A 3J7AY 3BZKA 1T0FC 4KT5C 1BIAA 2RVCA 1JI8A 3GTJJ 1EV7A 2X1DA 2IA0A 3ULQB 5B1BH 4ZYHA 2OV7A 1MNMC 5CVRA 4P96A 2JT1A 4C30A 2NVUB 4EJOA 4GRIA 1B59A 3BPVA 1HSJA 4XK4A 1ORKA 1DP7P 1HA8A 2R93J 3D5LA 1TZLA 3LSHA 2ZJRF 2LKPA 2XAFA 1IAWA 2VL8A 2V1XA 1ZR2A 1WZ2A 3K9TA 4HDVA 4LITA 3I4MJ 2UV1A 3D5SC 3HGGA 3K2ZA 4KIGA 2XSDC 1XDUA 1Y8QB 3ZQQA 4IHTA 2WC2A 3BQZA 2M0CA 1R49A 2A5WA 5F0CA 2HDCA 1LFBA 2E2JJ 1OISA 2CQXA 3V8LA 4DJAA 1USSA 2L4MA 2JPBA 1FMWA 2XVCA 2B9SA 3QP6A 1GXQA 3F22A 1LE8B 1JTYA 3ASOH 3HHGA 1MBJA 4HA8A 1LB2A 1T08B 3LL7A 2Y0MA 4PJ0C 3QYFA 3S15J 2FBIA 2L54A 4HEA2 5BNGA 3DKWA 1JKPC 2YX4A 2YUSA 1P7JA 4KMFA 2K7LA 4HLXA 3OR1C 3RCOA 5F0HA 2OAZA 4AIHA 2XAUA 1JTXA 2F5CA 3GZNB 2VJJA 1DUXC 5E3MA 1FBSA 4BU2A 5F1RA 4ZTJA 1SMTA 4CYCB 2STWA 2QWWA 3BY6A 4PJNA 4ZH4F 3F6OA 3LQQA 3A02A 5GP9A 3LSGA 1G3SA 1KU2A 4Q47A 5BOXA 4ESFA 2CUZA 3ABUA 2IEKA 3CMEI 1R22A 4UVCA 2VKVA 3DCFA 1B6AA 2IAIA 3FF5A 3MAJA 5E8IA 2PFBA 5HNHA 2HVSA 2FJ1A 2F5VA 1CGPA 2F6CA 1AOYA 5HLHA 1ZR4A 2IRFG 3RYRA 1SFUA 2XPUA 1QBJA 1S3JA 3W6JB 3WGIA 4CGZA 2VOOA 1K83J 3ZQCA 5K7ZA 4L9VA 2DPUA 2KLOA 1VI0A 5E8GA 2F4MB 2Y30A 1OCTC 3S16J 1XCVA 1YRNA 1BR1A 4EV0A 2O5RA 2OZ6A 3S32A 1YW8A 4OMZA 2GQQA 4BQNA 2EWNA 2O03A 3BTLA 3DV8A 2K40A 2G9WA 3MD2A 1GVDA 3OIPA 4BGDA 1R71A 1J59A 1ODDA 3ZMSA 3DKYA 2QGUA 3CF2A 3FZVA 4OAYA 4LB5A 1ZAOA 2JVGA 5H20A 3E0JB 4G94A 2CWEA 1BM9A 1SFXA 2DJNA 2HTSA 3CJTB 2HI3A 4RBOA 5LFAA 2V1NA 4M3GA 4D0PA 2Q1ZB 2WAQA 1BIBA 3CC2I 3G4SI 1O3RA 3AL0B 3HJEA 4U88A 3OSGA 1OPCA 2F5DA 1WI9A 2CUJA 1USTA 1V55H 3BG9A 2KJBA 3EYYA 2VXZA 1EF4A 1SANA 4IOCF 2DN0A 3L09A 4KYWA 1F1ZA 5DD4A 1KQ0A 5D8KB 2W1OA 3H3UA 1D0YA 5FRNA 3G1LA 1VQOI 2UXXA 4A3CJ 1ZG3A 2HQRA 1E17A 1ZG5A 2E34A 3HDDA 3ONQA 1ONVA 4L5EA 3K70D 3LWFA 3MKYB 1MBFA 3DWLE 3TDUC 5LRRA 4MO7A 1TC3C 4NHJA 3F8FA 2IT0A 4E7SA 1X4OA 3P9CA 1D8KA 3R0JA 5L3GA 3EUHC 5D4RA 4B3XA 1IV8A 1MNDA 1KU9A 5BPDA 1S7OA 3QPTA 5DM6F 2GA1A 5IP6A 2DDBA 2E1MB 3O8HA 1D1CA 3HYIA 2BW3B 3O2PE 2CRGA 2DA3A 1AHDP 2JTVA 2VASA 3H5RA 2W24A 4C2MJ 3CP8A 3TQNA 1MJAA 3OWTA 5E17F 4DZPA 1QU3A 3LMMA 2GOMA 2LR8A 3K2AA 2K9NA 3LSTA 4XLCA 3V4GA 5BQTA 1A35A 1QGPA 2RDPA 3BR1A 2IGKA 4HBLA 3TGNA 5FROA 2VOPA 4Y3OA 1HKSA 1BJZA 1XD7A 4XLHA 4F55A 2DXIA 1Y0UA 4JBAA 5KAFC 4CCNA 4O6JA 5FKKA 3CMAI 4EGZA 1I5ZA 3E6MA 3WTUC 3S2HJ 1LNWA 3MKLA 2DFHA 1IXSB 2B7EA 3VFZA 3F6VA 4KN7X 2XDVA 4A3MJ 3MWMA 4LLNA 1N25A 2E2IJ 1G59A 4XLPF 2HYFA 4BQQA 3WTTC 1LDDA 1FIPA 2DMQA 2NRAC 5LHHA 2A05A 1IRZA 4BBSJ 1TT0A 2W85A 3CUQA 2K86A 4HSRA 1D5YA 1HDPA 3QRFF 3V8KA 2E1OA 4ITVA 4Q48A 3ZRGA 2VKHA 3M7GA 2RQQA 3OYNA 5M3FJ 4E6KG 3L2CA 4Y17A 1S6LA 1W0TA 1FIAA 2XRLA 1WI3A 3WE2A 2LKXA 3VYUB 2R5YA 4KIBA 3J80Z 5ERIA 3LSRA 2QSGX 3T5XA 2WBMA 3LSIA 1ETKA 2VPRA 5BS6A 3M3YJ 4BXXJ 3E6BA 5HNFA 2HPMA 5KNLA 5HLGA 2ADUA 1I50J 4EJTA 3AL0C 4JX5A 3K4LA 1BOBA 4F52A 2M8GX 1X4PA 2NAZA 2HQAA 3KP4A 3WTYC 3JRCA 3GX4X 3EQLF 3CO6C 3A01B 2W48A 3VYSB 4I2OA 3HOWJ 3I56I 2O6GE 3I5UA 1T33A 2XB0X 2XGCA 2M4KA 2NS0A 2VT2A 2OF7A 2V1DA 5JHUA 4OOIA 4UVAA 2QF7A 3I53A 3ZQ7A 5AIPA 2XPVA 2PMZA 3DEUA 3OSFA 2UUZA 4LIUA 4RB0A 1PUEE 2BV6A 5CVUA 1TWCJ 2XKOA 2QQ9A 3PL8A 4H0EA 2IVMA 4JQFA 4IVNA 3J7YJ 1FYMA 5CJ9A 1B1BA 4CHUA 4BE0A 3H5NA 1MNEA 4I02A 2R7TA 4AWXB 3Q0UA 1MIJA 1FT9A 2ZSIB 3LSPA 3VSLA 5LGNA 2CSOA 5FKNA 2DOEA 1RESA 5FB2A 4IOAF 3R61A 2E1MC 4GCVA 2DOAA 3ISPA 3B73A 3HPHA 1NHAA 3I64A 1KZHA 3HG9A 2DA6A 1WJAA 2XF6A 3M9AA 2MYSA 5L3EA 3WG7H 2VJ4A 3AKZA 3ZPLA 3ZMTA 1K79A 1IN7A 4D9JA 2K9MA 1TNSA 3C2GA 3KCCA 3QOEA 4LB6B 1KQ9A 3IAS2 3CCMI 1HDDC 2LNBA 5CQGA 5FFXA 1RNLA 4ZYDA 3I0TA 4WWCA 2CQQA 2GM4A 3MQ0A 4XNFA 2LFBA 4YIIA 5HS7A 5CLSA 4IQJA 3AAFA 3HTUA 1UG0A 1JT0A 1X3UA 2ACJA 2BEOA 4I0BA 2H94A 4HAMA 3HPGA 3OYBA 2FF4A 4UHTA 1Z7LA 2LD5A 1K4SA 4I76A 4XN0A 2DK5A 2ZBKA 2NVQJ 2KL4A 1FMVA 1VF9A 4L0YB 1I1SA 5IOZA 3DBHB 4CSWA 3K4JA 3A03A 2HEOA 3BR5A 5FRMA 5M5XJ 1RC9A 1QPMA 4E7IA 1SD4A 1JHHA 3J7AO 1QNTA 5H6QA 3EYIA 2MW8A 2DMUA 2OA4A 3CUQB 5LEJA 1YTYA 1X1DA 2R7FA 3BC8A 4F92B 1YIOA 5BMZA 5FLXK 2R5ZA 1I1GA 1ZGJA 2DDAA 3PUBA 4ESBA 4CCKA 1OMIA 1TQIA 2R5YB 2L2OA 1RKTA 3MCZA 3IUOA 2DT5A 2WTEA 2OTJI 4HYEA 5L3CA 1FEXA 1OYWA 2JUGA 5TISC 1EH8A 4XKWA 2R7VA 3HXLA 2HR3A 3PNYA 3DXJF 1XPXA 3PO3J 5FKLA 4L18B 1OCRH 5E18F 3S3OA 3MVPA 1GXPA 1FX7A 4HNTA 3RZOJ 4LK0F 4BAYA 3DU6A 1D5VA 1R23A 4L9JA 4RAYA 2HDWA 4JX4A 3ZCOA 5FJ8J 4G6QA 4XIDA 5CYVA 4UUSB 2CMPA 4N0BA 4C3HJ 3JREA 3WU0A 1KU7A 5F27A 1H88C 4UUVA 3NEUA 5LGUA 3VWBA 2CGPA 2V6CA 2X51A 1XN7A 2R7WA 4EMSA 3CC4I 1HW5A 3WODF 3WGHA 4ZDPA 1A5JA 4GYGA 5J1RA 2E1CA 1G3WA 1HW1A 1Z77A 1Z67A 3S2WA 3WHBA 3N05A 4OAZA 5DUKA 4ZTFA 1MBHA 1D8JA 4KT6A 4EM2A 3G2BA 3MMYB 2M7AA 3BR2A 3ZOBA 4B1RA 1AU7A 2DJIA 3E5QA 2KIFA 1WRJA 1IGNA 2TRTA 4J01A 2QSHX 4WXCA 2AXLA 2ISZA 2XAHA 4M72A 4LFUA 3HKZN 1BOAA 3V7RA 3OMYA 2XGEA 4N4NB 4WXHA 2R92J 1W5SA 4E4HA 3GTOJ 1HSTA 3BG7A 1FJLA 1YG2A 1YOVB 1YS7A 2F4IA 3PFYA 4KNYA 2M4GA 3FM3A 5L3BA 4ZYAA 2DLLA 1F36A 4A0XA 1TW3A 1MMGA 2V1UA 1LVAA 1IDYA 2ZFWA 3CCEI 1STZA 4RMNA 1Y1VJ 2GZWA 4P9FA 4RS8A 2KDOA 2LH9A 1HLVA 3DTKA 1WPKA 1ZARA 4KN4X 1FP1D 2JA7J 2O3FA 2DU9A 2M9HA 5J1YA 2ESNA 3UR3C 1G8XA 1T95A 2FE3A 4HG2A 4QTRA 3I9V2 1WJDA 3D5RC 1Y1WJ 3ZN1A 3J7ZI 1XMXA 3S1QJ 3L7WA 2VJIA 1H89C 2DFFA 4LG3A 2A3SA 3CTAA 3ZQIA 3VYRB 2BOLA 4KA4A 2EIJH 2R7SA 2DW4A 5E1ZB 4R79A 2IS2A 3CUQC 5HLTA 1RIOH 1K6YA 2BYVE 2Y31A 1XGSA 3K7AJ 3FX3A 3KP5A 2OU2A 5K5OA 3R4KA 4YEJA 3HOZJ 2Z5UA 4FCYA 3KPHA 1LFPA 2EQRA 2LF8A 3TW6A 3GF2A 4JX6A 2ETHA 3DBRB 1XG1A 2BVMA 2XPWA 4CYCA 3PSFA 2DQLA 4M9SA 4RB2C 4XOTA 1ETOA 3H92A 1MH3A 1XSVA 3T1BA 1R1UA 5D6FA 5J4VA 3DTEA 1XMKA 3KYDB 1T39A 5M5WJ 2DO7A 1BA5A 4M6XA 5JHFA 3CUOA 2KFDA 5CQEA 1Z91A 2CU7A 3PM1A 2P5VA 3FWEA 4M74A 4AU7A 3J81K 2VC0A 2VIXA 5E20A 4BNCA 5D4SA 2FRHA 2HXIA 2VBYA 4FETA 2Z33A 3OV8A 2RREA 2XC7A 2R7RA 2R4GA 1OCCH 1LVKA 1YIJI 2DA5A 4BXFA 1BI2A 1OFCX 2E36A 3CDLA 4KFCA 3L2VA 1TW2A 1QRYA 4D1QA 3RIRA 2ZB9A 2LBFA 3C3WA 1FYLA 3S1NJ 1UELB 1KGSA 4RGSA 5EZGA 4HQMA 4R8HA 1VQPI 1YO5C 5DD8A 2OBPA 2DMTA 1Z21A 3Q0VA 3KETA 4A5MA 3O6BB 2IP2A 2X0LA 1J75A 5LHGA 1LFUP 2EH3A 3LQRA 3SQNA 1XGNA 4PJJA 5J8CA 3FHNA 3TL4X 1D3YA 4XBFA 4G7ZF 1TP4A 4ENMA 5F1JA 1PP8F 2ELJA 2YS9A 1J2XA 3IAM2 1UCRA 2DA2A 4LK1F 4M3DA 2R7ZJ 1KYZA 2KT0A 1MSFC
chains in the Genus database with same CATH topology
2XUBA 4YG2F 4HV6A 3GZ6A 5D5VB 2KRFA 4HX4A 3O3KA 1VTNC 3I58A 2HZTA 1BI1A 2MBFA 1KA8A 3PFIA 3GW2A 2HOEA 4I01A 2M30A 3TOBA 4CXFA 3IHUA 2MH9A 2ZXJA 4ESJA 1W4MA 4UV9A 3RYPA 2RNJA 3RDIA 2XGXA 5ICFA 3QAHA 2STTA 1Z1DA 5JVTA 3SZPA 3PQJA 2H09A 4ZZLA 2DBBA 4FHTA 4P5OA 4L9NA 1HKQA 5F64A 4LG0B 3DPTA 1I6XA 5J6XA 4MQ9F 2LDUA 4UV8A 3FHZA 1L0OC 1YW9A 4OIRF 3JTGA 1YYVA 2YU3A 1EH7A 1Z7UA 2QBYA 4ETSA 2PG4A 1REPC 2L02A 1U8RA 4L9TA 4WK8F 1R7JA 3WTSC 2P7VB 2X4HA 4U0VA 4Z2YA 3JAMK 4GYIA 4R1HA 2WV0A 3U9GA 1E2XA 2DTRA 3IWZA 2ELHA 5JR3A 3MZYA 4IF4A 3DPLC 1DDNA 3HSRA 4KDPA 2L3DA 1P4WA 2H6CA 3K1MA 3VODA 5DCMA 2GA2A 3FMSA 1QO0D 3CO7C 3F8BA 5IT9Z 3RKWA 3I71A 2IPQX 2P5KA 3DQVC 1FSHA 3ERED 3KEQA 3LAJA 2KJCA 2RKHA 4GGGA 1QZYA 5HLIA 4L0ZB 4RB3C 1V3FA 2DFIA 4BHCA 5HS8A 3DP7A 4NQWA 2DQRA 3HHHA 5E1XA 1TQPA 3IL2A 3HIFA 2IW5A 3KEOA 3ZN0A 4FX0A 2L4AA 2ZNYA 4UXNA 2ZMEB 3M8EA 4IRIA 3R6SA 3FXQA 1BC8C 2YR2A 3K0LA 1T6SA 5A2QZ 1H9GA 3GFIA 2Q0OA 5ICCA 4PGGA 1FNNA 1UFMA 1WWXA 3HRMA 2D1VA 5ED4A 1G3TA 2HTJA 5ILUA 1IXCA 1B4AA 4TV7A 3ECHA 2M87A 1PDNC 3IC7A 4EJVA 2CFXA 3GYHX 3I4PA 1J5YA 4HOBA 2QBYB 3KP2A 5FFZA 1SFEA 2VE8A 2YSRA 2FBHA 1XGOA 4GXOA 4KUMA 5LRSA 1MDMB 2BBYA 1GHCA 3WE3A 1KU3A 5D5WB 5DDGA 1Z6RA 4U7BA 2P8TA 3PQKA 3IRRA 5DCMB 3SXYA 1RUOA 4S04A 1IN8A 5ILSA 1P2FA 4KIFA 1HQCA 3GWZA 4ENKA 3COAC 3T8TA 2GWRA 2NNYA 4FX4A 1XSDA 3MFKA 1G3YA 2JRTA 5K5QA 1T98A 2IA1A 2LSOA 2Q8KA 5HS9A 1YQAA 2BE5F 4A6EA 1B9NA 1LDKB 1IRGA 2PMUA 2QM3A 3KZZA 3TKYA 1R36A 1R5HA 4ASNA 4BQAA 5E1WA 4ZYGA 4Q4ZF 3C7JA 3BDDA 3KLOA 1P4XA 4RGRA 5ICGA 4XSZF 1ZHFA 1K78A 4N9HA 1U5TA 1SMYF 1HW2A 1OR7A 4U0YA 2FXAA 2CO5A 3KZYA 3I59B 4XRFA 3WG9A 4HV5A 4IJAA 3D0SA 5FD6A 1GVJA 2F5EA 2B0LA 5TRDA 3BOQA 1UHMA 1IF1A 1O3QA 2D2WA 4M71A 1G4DA 4HDUA 4G7OF 4LGWA 1QQIA 2EK5A 3IWFA 1BN5A 3IKTA 1U6GA 5LBQA 1LEBA 2P4WA 3C1DA 2MH2A 1MGTA 2VBWA 2XIGA 2TDXA 1ZREA 2VT3A 1I27A 4IHSA 4N9IA 1J0RA 1B9MA 4O3MA 1W7PB 1YW7A 1J9IA 2PI0A 2XAGA 4CZZA 1W7PD 5D5XB 3FMQA 3F3XA 3GVAA 4YFXF 5CVVA 3F72A 2EA2A 2HS5A 4B8XA 4CYDA 3V7CA 3ZMDA 3KE2A 4EJUA 2JSCA 4LLLA 2PN6A 1RZ4A 5K5RA 3P9KA 1FOKA 3CJNA 5KK1A 1ZRDA 4OIOF 1H0MA 4P55A 4I98B 3GLXA 3LA7A 3E97A 1K78B 1XDSA 1IN6A 3B02A 1U5TB 4RAZA 3ZMUA 2UWMA 2M1BA 2QQAA 1U2WA 3I54A 3E5XA 4O5VA 4EGYA 4CO8A 3HSFA 1WQ2A 1LDJA 4AD9A 1L3LA 4A0ZA 5HVQC 4CICA 1YFHA 1H9TA 1TTYA 2ZJ2A 1CF7B 3FM5A 5EEGA 4LLGF 5KVRA 4FT8A 4IPAA 1ON1A 1TQMA 3LA3A 1HXDA 2A5YB 3K69A 3NQOA 3BROA 1T2KA 2RGVA 2ZO4A 3RI4A 3R0AA 1DPUA 4UNOA 3BJ6A 3GXOA 1R1VA 1UHWA 3DF8A 3VOEA 3WTXC 4LG0A 1XGMA 1FWZA 1FPQA 1ZH5A 4P9UA 3TO7A 4MEXF 4LMYA 4BH9A 2OQGA 3QP5A 4BHBA 2QUFA 4E70A 3GEZA 1PP7U 5FO5A 5HOOA 3ELKA 3J80K 5FGMA 2PJPA 1MJ9A 4MHGA 2W57A 2PBIA 5K1YA 2XKPA 2HGCA 1P92A 1ZLKA 1Q1HA 1R5GA 2QVOA 2FEZA 2MD5A 2P5LC 5ICEA 1FSEA 4MEYF 4OIQF 2H27A 3QPHA 4PGHA 2GIVA 4EJWA 3TDZC 4I7HA 1U5TC 2JZYA 2P6SA 2CQKA 4U0WA 3BWGA 4LD5A 4XLNF 3ZMZA 3RKYA 3WU1B 2EFOA 5F6FA 4MTEA 1W5TA 3WTVC 3TOAA 2QQBA 2AS5F 4M6YA 2NYXA 2OZUA 2E1NA 4MNUA 1MD0A 1SD6A 2PQ8A 4I09A 2CYYA 2ZMEA 3BP8A 2FNPA 2YPRA 1ZRFA 2R7DA 2KKOA 4HQEA 3ECOA 1BBYA 2FA5A 3RKXA 5AONA 1AWCA 1BC7C 2EFNA 4I0AA 2HKOA 4AIKA 3JSPA 2RN7A 4IRHA 4LJZF 4AIJA 1JHFA 1RUNA 2LF7A 1HKTA 1FBQA 2IJLA 3LFKA 2VN2A 3C18A 4A6DA 4WXDA 3TO9A 1O57A 2G7UA 5D5UB 5D6EA 2DAOA 2HWVA 3SZTA 5FLXZ 1J7KA 2VONA 2VODA 2Q2EA 2O8XA 2Z99A 3GZ5A 2F5FA 4YFKF 3F21A 1SD7A 2J5OA 3E6DA 5JI6A 1ZG1A 1OYYA 3F8CA 3BJOA 1FYKA 2EV5A 4OIPF 3T0YA 5H6RA 4WX9A 1A04A 1P4AA 4A2UA 2XASA 2ZKZA 4BHPA 3RPQA 2RQPA 2OQRA 1MDMA 3Q9VA 5EEHA 5HDGA 1OYIA 2EA4A 2MLGA 3LAPA 3Q5FA 1Z9CA 1BI0A 2KIMA 2CW0F 1F4KA 2P7CB 2Y48A 1WKMA 1R1TA 2PMHA 1FP2A 3K1PA 4MTDA 2HYGD 2V9VA 1IRFA 1UB9A 1JXSA 3Q9SA 2OD5A 2O0YA 1P6RA 4XSXF 1KYWA 3T8RA 5IT3A 3JW4A 2RC4A 3EETA 5LEKA 4MQVA 4ENNA 3ABTA 5TJJA 3HRSA 1S29A 4EQQA 1Z6TA 3L9FA 1SAXA 1MJBA 2MLKA 4PZJA 4EM1A 3R60A 3HTSB 2FOKA 3QU3A 2K4BA 4HLYA 3ZMVA 4EVIA 2GXBA 4QLCU 3M8FA 5DYMA 1IXRC 4YFNF 4RGUA 3WTWC 3W6KB 2VC1A 2XV4S 2EB7A 5J8FA 2F2EA 1JGSA 2EFWA 3I59A 3BPXA 4A0YA 3V8JA 1YLFA 3HSEA 4Y15A 2QENA 5L3FA 5CVIA 2EFPA 2ISYA 1F9NA 2Z9OA 2QZ8A 1ZRCA 5DCFA 3M1EA 2CG4A 3QU6A 4BYYA 1EH6A 3EDPA 1R58A 3HOSA 2D1HA 4A5NA 2ZCWA 3L00A 3IKVA 3J81Z 2UZKA 4HX7A 4KMUX 3LA2A 2A6HF 4PCQA 1K6OA 3KP3A 3FXUA 5DEQA 5BPIA 2A6EF 4A12A 3KP7A 3P9IA 3TO6A 1W7PA 4S05A 2PLYA 3U2RA 3V7SA 2E7WA 1G6NA 4BXUA 3QOPA 1HBXG 4JK1X 4DQ2A 4YIFA 4G9YA 2FNAA 1TNTA 5HDNA 2KIUA 1ON2A 1XSXA 3SFZA 4M73A 4Q5SF 3K1NA 4Y13A 2P6TA 4PDKA 3F23A 1ZN2A 2ZNZA 3REOA 3G3ZA 1U78A 2DK8A 2HQNA 5D8LB 3KP6A 3WGGA 3OOPA 1KQ8A 2GXGA 2VBXA 1QZZA 4HZFA 5ILVA 4HW0A 1TBXA 2UXNA 1T0FA 2M45A 1IZ1A 2DPDA 1LJ9A 3U1DA 4WF2A 3SHFA 2BGCA 1XCBA 2QYOA 1CF7A 4CDGA 5AIQA 4OINF 3IRQA 1XB4A 4KICA 4NB5A 2W84A 5JFRA 4G6DA 4ENJA 2V79A 1IW7F 3KLNA 1K7AA 2O61A 3FMRA 3GFLA 1LEAA 4DNCA 1O7FA 2HKXA 2K4JA 1ULYA 3G73A 4L5IA 2FQ3A 2H6BA 4HF1A 4HF2A 3N4MA 3JAMZ 4GO1A 1O7LA 3P7NA 2A68F 1SD5A 3GUDA 2EFQA 2L01A 6PAXA 2K27A 4U7DA 4OMYA 2XAQA 5L3DA 2G7HA 2A07F 5LGTA 2XROA 4WCGA 2EV0A 2FMLA 2FBKA 1F5TA 2DI3A 1TLHB 1IN4A 1FZPB 2EV6A 3E3VA 4L5JA 2EJRA 4ON0A 2GAUA 1FLIA 3JTHA 3HUGA 5IT9K 1WSUA 2NNNA 4HF0A 3WTZA 2D45A 2QLZA 2ESHA 3H3ZA 5DV5A 4MGRA 1V4RA 2VBZA 4K2EA 3DFGA 2HFHA 2XRNA 2W25A 2COMA 2Z3YA 5DUIA 2M8EA 3JSOA 3ROUA 4G8XA 3MZHA 1BI3A 1S8NA 2RV8A 5A2QK 2FMYA 3HRTA 2K02A 1IUYA 3RJPA 2JPCA 3MEXA 3HOTA 2FU4A 2FSWA 5LHIA 1FC3A 4QWQA 2C6YA 4OU0A 3F8MA 2R3SA 2XAJA 3E6CC 4UVBA 3ML6A 1FY7A 4M9XA 3EUHA 3FXRA 4M9ZA 1OKRA 2IA2A 2J5PA 2MA3A 2A61A 4ZYEA 1JE8A 1R00A 5HDKA 3N97A 2A69F 1C0WA 4AVPA 1DPRA 4IXAA 2PEXA 3VEPA 4RGXA 2Y75A 4F7ZA 3GO5A 1S7AA 4RB1A 1ZLJA 4EM0B 3GFMA 3E5UA 1BJAA 1O3TA 3BZ6A 1MKMA 3CLOA 5FD5A 2VE9A 3VB2A 1U3EM 3KFWX 2XHKA 1ZGAA 4G7HF 3F8NA 3RPUA 2WWYA 1MZBA 1ZYRF 3BJAA 3NRVA 3ZP5A 2M5WA 1IN5A 5LLQA 3RTRA 5CVJA 3CDHA 1XMAA 3GFJA 2YX7A 4HX8A 1T38A 1Z05A 4IRGA 4B09A 1O3SA 1YS6A 1LQ1A 1FBUA 2E7XA 4ZZDA 3HRUA 2MC3A 1RI7A 4KT5C 1BIAA 2RVCA 1EV7A 2IA0A 3ULQB 4ZYHA 5CVRA 4P96A 2JT1A 4EJOA 1B59A 3BPVA 1HSJA 1DP7P 3D5LA 2LKPA 2XAFA 1IAWA 2V1XA 3K9TA 4HDVA 3K2ZA 4KIGA 1XDUA 4IHTA 2WC2A 2HDCA 3V8LA 1USSA 2L4MA 2JPBA 2XVCA 3QP6A 1GXQA 3F22A 3HHGA 4HA8A 1LB2A 2Y0MA 2FBIA 2L54A 3DKWA 2YX4A 4KMFA 2K7LA 4HLXA 2OAZA 4AIHA 2F5CA 1DUXC 1FBSA 5F1RA 1SMTA 2STWA 2QWWA 3BY6A 4ZH4F 3F6OA 3LQQA 1G3SA 1KU2A 4Q47A 5BOXA 4ESFA 3ABUA 1R22A 4UVCA 1B6AA 3FF5A 3MAJA 5E8IA 2PFBA 1CGPA 1AOYA 5HLHA 2IRFG 3RYRA 1SFUA 1QBJA 1S3JA 3W6JB 3WGIA 4CGZA 2VOOA 2DPUA 4L9VA 5E8GA 1XCVA 4EV0A 2OZ6A 1YW8A 4OMZA 2GQQA 2EWNA 2O03A 3DV8A 2G9WA 1J59A 1ODDA 3ZMSA 3FZVA 4LB5A 1ZAOA 5H20A 4G94A 2CWEA 1BM9A 1SFXA 2HTSA 4D0PA 1BIBA 1O3RA 4U88A 1OPCA 2F5DA 1WI9A 1USTA 3EYYA 2KJBA 2VXZA 3L09A 4KYWA 1F1ZA 5DD4A 1KQ0A 5D8KB 3H3UA 2UXXA 1ZG3A 2HQRA 1E17A 1ZG5A 1ONVA 3LWFA 3TDUC 5LRRA 4NHJA 3F8FA 2IT0A 3P9CA 1D8KA 3R0JA 5L3GA 5D4RA 1KU9A 5BPDA 1S7OA 3QPTA 2GA1A 3HYIA 3O2PE 2JTVA 2W24A 3TQNA 1MJAA 5E17F 3LSTA 3V4GA 5BQTA 1QGPA 2RDPA 4HBLA 3TGNA 2VOPA 1HKSA 1XD7A 1Y0UA 4JBAA 4O6JA 4EGZA 1I5ZA 3E6MA 3WTUC 1LNWA 1IXSB 3VFZA 3F6VA 4KN7X 4LLNA 3MWMA 4XLPF 2HYFA 3WTTC 1LDDA 2NRAC 5LHHA 2W85A 3CUQA 2K86A 3QRFF 3V8KA 4Q48A 3M7GA 3L2CA 4Y17A 1S6LA 3WE2A 4KIBA 3J80Z 5ERIA 3T5XA 5BS6A 3E6BA 4EJTA 5HLGA 2ADUA 2NAZA 3KP4A 3WTYC 3GX4X 3EQLF 3CO6C 4I2OA 2O6GE 3I5UA 2NS0A 2VT2A 5JHUA 2V1DA 4OOIA 4UVAA 3I53A 3ZQ7A 5AIPA 3DEUA 4RB0A 1PUEE 2BV6A 5CVUA 2XKOA 2QQ9A 4H0EA 2IVMA 4JQFA 4IVNA 1FYMA 5CJ9A 1B1BA 4CHUA 4I02A 4AWXB 1FT9A 5LGNA 2CSOA 5FB2A 3R61A 4GCVA 3ISPA 3B73A 1NHAA 3I64A 3M9AA 5L3EA 3ZPLA 3ZMTA 1K79A 1IN7A 1TNSA 3KCCA 4LB6B 1KQ9A 2LNBA 5FFXA 1RNLA 4ZYDA 3I0TA 4WWCA 3MQ0A 4YIIA 5HS7A 5CLSA 3AAFA 3HTUA 1X3UA 2ACJA 2BEOA 4I0BA 2H94A 4HAMA 2FF4A 4UHTA 2DK5A 2ZBKA 4L0YB 1I1SA 2HEOA 1QPMA 1SD4A 1JHHA 3J7AO 1QNTA 5H6QA 3EYIA 2OA4A 3CUQB 5LEJA 1YTYA 2R7FA 5BMZA 5FLXK 1YIOA 1I1GA 1ZGJA 4ESBA 1OMIA 1TQIA 3MCZA 2DT5A 2WTEA 4HYEA 5L3CA 1OYWA 1EH8A 2HR3A 3DXJF 4L18B 5E18F 1GXPA 1FX7A 4LK0F 4BAYA 1D5VA 1R23A 4L9JA 4RAYA 4G6QA 5CYVA 4N0BA 3WU0A 1KU7A 4UUVA 3NEUA 5LGUA 2CGPA 2V6CA 1XN7A 4EMSA 1HW5A 3WODF 3WGHA 4GYGA 2E1CA 1G3WA 1HW1A 3S2WA 5DUKA 1D8JA 4EM2A 3E5QA 2KIFA 1WRJA 4WXCA 2AXLA 2ISZA 2XAHA 4M72A 4LFUA 1BOAA 3V7RA 4WXHA 1W5SA 1HSTA 1YG2A 1YS7A 4KNYA 3FM3A 5L3BA 2DLLA 4A0XA 1TW3A 2V1UA 1LVAA 2ZFWA 1STZA 2GZWA 4P9FA 4RS8A 1ZARA 4KN4X 1FP1D 2O3FA 2DU9A 2ESNA 2FE3A 3ZN1A 3L7WA 2A3SA 3CTAA 4KA4A 2DW4A 5E1ZB 4R79A 3CUQC 1RIOH 2BYVE 1XGSA 3FX3A 3KP5A 2OU2A 5K5OA 3R4KA 2Z5UA 2LF8A 3GF2A 2ETHA 2DQLA 4M9SA 4RB2C 3H92A 1XSVA 3T1BA 1R1UA 5D6FA 1XMKA 1T39A 2DO7A 4M6XA 3CUOA 1Z91A 2P5VA 3FWEA 4M74A 3J81K 2VC0A 5E20A 4BNCA 5D4SA 2FRHA 2VBYA 2Z33A 3OV8A 1BI2A 4KFCA 1TW2A 3RIRA 3C3WA 1FYLA 1KGSA 4RGSA 4HQMA 4R8HA 1YO5C 5DD8A 2OBPA 3KETA 4A5MA 3O6BB 2IP2A 2X0LA 1J75A 5LHGA 3LQRA 3SQNA 1XGNA 5J8CA 1D3YA 4XBFA 4G7ZF 4ENMA 1PP8F 1J2XA 1UCRA 4LK1F 1KYZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XUB A;  4YG2 F;  4HV6 A;  3GZ6 A;  5D5V B;  2KRF A;  4HX4 A;  3O3K A;  1VTN C;  3I58 A;  2HZT A;  1BI1 A;  2MBF A;  1KA8 A;  3PFI A;  3GW2 A;  2HOE A;  4I01 A;  2M30 A;  3TOB A;  4CXF A;  3IHU A;  2MH9 A;  2ZXJ A;  4ESJ A;  1W4M A;  4UV9 A;  3RYP A;  2RNJ A;  3RDI A;  2XGX A;  5ICF A;  3QAH A;  2STT A;  1Z1D A;  5JVT A;  3SZP A;  3PQJ A;  2H09 A;  4ZZL A;  2DBB A;  4FHT A;  4P5O A;  4L9N A;  1HKQ A;  5F64 A;  4LG0 B;  3DPT A;  1I6X A;  5J6X A;  4MQ9 F;  2LDU A;  4UV8 A;  3FHZ A;  1L0O C;  1YW9 A;  4OIR F;  3JTG A;  1YYV A;  2YU3 A;  1EH7 A;  1Z7U A;  2QBY A;  4ETS A;  2PG4 A;  1REP C;  2L02 A;  1U8R A;  4L9T A;  4WK8 F;  1R7J A;  3WTS C;  2P7V B;  2X4H A;  4U0V A;  4Z2Y A;  3JAM K;  4GYI A;  4R1H A;  2WV0 A;  3U9G A;  1E2X A;  2DTR A;  3IWZ A;  2ELH A;  5JR3 A;  3MZY A;  4IF4 A;  3DPL C;  1DDN A;  3HSR A;  4KDP A;  2L3D A;  1P4W A;  2H6C A;  3K1M A;  3VOD A;  5DCM A;  2GA2 A;  3FMS A;  1QO0 D;  3CO7 C;  3F8B A;  5IT9 Z;  3RKW A;  3I71 A;  2IPQ X;  2P5K A;  3DQV C;  1FSH A;  3ERE D;  3KEQ A;  3LAJ A;  2KJC A;  2RKH A;  4GGG A;  1QZY A;  5HLI A;  4L0Z B;  4RB3 C;  1V3F A;  2DFI A;  4BHC A;  5HS8 A;  3DP7 A;  4NQW A;  2DQR A;  3HHH A;  5E1X A;  1TQP A;  3IL2 A;  3HIF A;  2IW5 A;  3KEO A;  3ZN0 A;  4FX0 A;  2L4A A;  2ZNY A;  4UXN A;  2ZME B;  3M8E A;  4IRI A;  3R6S A;  3FXQ A;  1BC8 C;  2YR2 A;  3K0L A;  1T6S A;  5A2Q Z;  1H9G A;  3GFI A;  2Q0O A;  5ICC A;  4PGG A;  1FNN A;  1UFM A;  1WWX A;  3HRM A;  2D1V A;  5ED4 A;  1G3T A;  2HTJ A;  5ILU A;  1IXC A;  1B4A A;  4TV7 A;  3ECH A;  2M87 A;  1PDN C;  3IC7 A;  4EJV A;  2CFX A;  3GYH X;  3I4P A;  1J5Y A;  4HOB A;  2QBY B;  3KP2 A;  5FFZ A;  1SFE A;  2VE8 A;  2YSR A;  2FBH A;  1XGO A;  4GXO A;  4KUM A;  5LRS A;  1MDM B;  2BBY A;  1GHC A;  3WE3 A;  1KU3 A;  5D5W B;  5DDG A;  1Z6R A;  4U7B A;  2P8T A;  3PQK A;  3IRR A;  5DCM B;  3SXY A;  1RUO A;  4S04 A;  1IN8 A;  5ILS A;  1P2F A;  4KIF A;  1HQC A;  3GWZ A;  4ENK A;  3COA C;  3T8T A;  2GWR A;  2NNY A;  4FX4 A;  1XSD A;  3MFK A;  1G3Y A;  2JRT A;  5K5Q A;  1T98 A;  2IA1 A;  2LSO A;  2Q8K A;  5HS9 A;  1YQA A;  2BE5 F;  4A6E A;  1B9N A;  1LDK B;  1IRG A;  2PMU A;  2QM3 A;  3KZZ A;  3TKY A;  1R36 A;  1R5H A;  4ASN A;  4BQA A;  5E1W A;  4ZYG A;  4Q4Z F;  3C7J A;  3BDD A;  3KLO A;  1P4X A;  4RGR A;  5ICG A;  4XSZ F;  1ZHF A;  1K78 A;  4N9H A;  1U5T A;  1SMY F;  1HW2 A;  1OR7 A;  4U0Y A;  2FXA A;  2CO5 A;  3KZY A;  3I59 B;  4XRF A;  3WG9 A;  4HV5 A;  4IJA A;  3D0S A;  5FD6 A;  1GVJ A;  2F5E A;  2B0L A;  5TRD A;  3BOQ A;  1UHM A;  1IF1 A;  1O3Q A;  2D2W A;  4M71 A;  1G4D A;  4HDU A;  4G7O F;  4LGW A;  1QQI A;  2EK5 A;  3IWF A;  1BN5 A;  3IKT A;  1U6G A;  5LBQ A;  1LEB A;  2P4W A;  3C1D A;  2MH2 A;  1MGT A;  2VBW A;  2XIG A;  2TDX A;  1ZRE A;  2VT3 A;  1I27 A;  4IHS A;  4N9I A;  1J0R A;  1B9M A;  4O3M A;  1W7P B;  1YW7 A;  1J9I A;  2PI0 A;  2XAG A;  4CZZ A;  1W7P D;  5D5X B;  3FMQ A;  3F3X A;  3GVA A;  4YFX F;  5CVV A;  3F72 A;  2EA2 A;  2HS5 A;  4B8X A;  4CYD A;  3V7C A;  3ZMD A;  3KE2 A;  4EJU A;  2JSC A;  4LLL A;  2PN6 A;  1RZ4 A;  5K5R A;  3P9K A;  1FOK A;  3CJN A;  5KK1 A;  1ZRD A;  4OIO F;  1H0M A;  4P55 A;  4I98 B;  3GLX A;  3LA7 A;  3E97 A;  1K78 B;  1XDS A;  1IN6 A;  3B02 A;  1U5T B;  4RAZ A;  3ZMU A;  2UWM A;  2M1B A;  2QQA A;  1U2W A;  3I54 A;  3E5X A;  4O5V A;  4EGY A;  4CO8 A;  3HSF A;  1WQ2 A;  1LDJ A;  4AD9 A;  1L3L A;  4A0Z A;  5HVQ C;  4CIC A;  1YFH A;  1H9T A;  1TTY A;  2ZJ2 A;  1CF7 B;  3FM5 A;  5EEG A;  4LLG F;  5KVR A;  4FT8 A;  4IPA A;  1ON1 A;  1TQM A;  3LA3 A;  1HXD A;  2A5Y B;  3K69 A;  3NQO A;  3BRO A;  1T2K A;  2RGV A;  2ZO4 A;  3RI4 A;  3R0A A;  1DPU A;  4UNO A;  3BJ6 A;  3GXO A;  1R1V A;  1UHW A;  3DF8 A;  3VOE A;  3WTX C;  4LG0 A;  1XGM A;  1FWZ A;  1FPQ A;  1ZH5 A;  4P9U A;  3TO7 A;  4MEX F;  4LMY A;  4BH9 A;  2OQG A;  3QP5 A;  4BHB A;  2QUF A;  4E70 A;  3GEZ A;  1PP7 U;  5FO5 A;  5HOO A;  3ELK A;  3J80 K;  5FGM A;  2PJP A;  1MJ9 A;  4MHG A;  2W57 A;  2PBI A;  5K1Y A;  2XKP A;  2HGC A;  1P92 A;  1ZLK A;  1Q1H A;  1R5G A;  2QVO A;  2FEZ A;  2MD5 A;  2P5L C;  5ICE A;  1FSE A;  4MEY F;  4OIQ F;  2H27 A;  3QPH A;  4PGH A;  2GIV A;  4EJW A;  3TDZ C;  4I7H A;  1U5T C;  2JZY A;  2P6S A;  2CQK A;  4U0W A;  3BWG A;  4LD5 A;  4XLN F;  3ZMZ A;  3RKY A;  3WU1 B;  2EFO A;  5F6F A;  4MTE A;  1W5T A;  3WTV C;  3TOA A;  2QQB A;  2AS5 F;  4M6Y A;  2NYX A;  2OZU A;  2E1N A;  4MNU A;  1MD0 A;  1SD6 A;  2PQ8 A;  4I09 A;  2CYY A;  2ZME A;  3BP8 A;  2FNP A;  2YPR A;  1ZRF A;  2R7D A;  2KKO A;  4HQE A;  3ECO A;  1BBY A;  2FA5 A;  3RKX A;  5AON A;  1AWC A;  1BC7 C;  2EFN A;  4I0A A;  2HKO A;  4AIK A;  3JSP A;  2RN7 A;  4IRH A;  4LJZ F;  4AIJ A;  1JHF A;  1RUN A;  2LF7 A;  1HKT A;  1FBQ A;  2IJL A;  3LFK A;  2VN2 A;  3C18 A;  4A6D A;  4WXD A;  3TO9 A;  1O57 A;  2G7U A;  5D5U B;  5D6E A;  2DAO A;  2HWV A;  3SZT A;  5FLX Z;  1J7K A;  2VON A;  2VOD A;  2Q2E A;  2O8X A;  2Z99 A;  3GZ5 A;  2F5F A;  4YFK F;  3F21 A;  1SD7 A;  2J5O A;  3E6D A;  5JI6 A;  1ZG1 A;  1OYY A;  3F8C A;  3BJO A;  1FYK A;  2EV5 A;  4OIP F;  3T0Y A;  5H6R A;  4WX9 A;  1A04 A;  1P4A A;  4A2U A;  2XAS A;  2ZKZ A;  4BHP A;  3RPQ A;  2RQP A;  2OQR A;  1MDM A;  3Q9V A;  5EEH A;  5HDG A;  1OYI A;  2EA4 A;  2MLG A;  3LAP A;  3Q5F A;  1Z9C A;  1BI0 A;  2KIM A;  2CW0 F;  1F4K A;  2P7C B;  2Y48 A;  1WKM A;  1R1T A;  2PMH A;  1FP2 A;  3K1P A;  4MTD A;  2HYG D;  2V9V A;  1IRF A;  1UB9 A;  1JXS A;  3Q9S A;  2OD5 A;  2O0Y A;  1P6R A;  4XSX F;  1KYW A;  3T8R A;  5IT3 A;  3JW4 A;  2RC4 A;  3EET A;  5LEK A;  4MQV A;  4ENN A;  3ABT A;  5TJJ A;  3HRS A;  1S29 A;  4EQQ A;  1Z6T A;  3L9F A;  1SAX A;  1MJB A;  2MLK A;  4PZJ A;  4EM1 A;  3R60 A;  3HTS B;  2FOK A;  3QU3 A;  2K4B A;  4HLY A;  3ZMV A;  4EVI A;  2GXB A;  4QLC U;  3M8F A;  5DYM A;  1IXR C;  4YFN F;  4RGU A;  3WTW C;  3W6K B;  2VC1 A;  2XV4 S;  2EB7 A;  5J8F A;  2F2E A;  1JGS A;  2EFW A;  3I59 A;  3BPX A;  4A0Y A;  3V8J A;  1YLF A;  3HSE A;  4Y15 A;  2QEN A;  5L3F A;  5CVI A;  2EFP A;  2ISY A;  1F9N A;  2Z9O A;  2QZ8 A;  1ZRC A;  5DCF A;  3M1E A;  2CG4 A;  3QU6 A;  4BYY A;  1EH6 A;  3EDP A;  1R58 A;  3HOS A;  2D1H A;  4A5N A;  2ZCW A;  3L00 A;  3IKV A;  3J81 Z;  2UZK A;  4HX7 A;  4KMU X;  3LA2 A;  2A6H F;  4PCQ A;  1K6O A;  3KP3 A;  3FXU A;  5DEQ A;  5BPI A;  2A6E F;  4A12 A;  3KP7 A;  3P9I A;  3TO6 A;  1W7P A;  4S05 A;  2PLY A;  3U2R A;  3V7S A;  2E7W A;  1G6N A;  4BXU A;  3QOP A;  1HBX G;  4JK1 X;  4DQ2 A;  4YIF A;  4G9Y A;  2FNA A;  1TNT A;  5HDN A;  2KIU A;  1ON2 A;  1XSX A;  3SFZ A;  4M73 A;  4Q5S F;  3K1N A;  4Y13 A;  2P6T A;  4PDK A;  3F23 A;  1ZN2 A;  2ZNZ A;  3REO A;  3G3Z A;  1U78 A;  2DK8 A;  2HQN A;  5D8L B;  3KP6 A;  3WGG A;  3OOP A;  1KQ8 A;  2GXG A;  2VBX A;  1QZZ A;  4HZF A;  5ILV A;  4HW0 A;  1TBX A;  2UXN A;  1T0F A;  2M45 A;  1IZ1 A;  2DPD A;  1LJ9 A;  3U1D A;  4WF2 A;  3SHF A;  2BGC A;  1XCB A;  2QYO A;  1CF7 A;  4CDG A;  5AIQ A;  4OIN F;  3IRQ A;  1XB4 A;  4KIC A;  4NB5 A;  2W84 A;  5JFR A;  4G6D A;  4ENJ A;  2V79 A;  1IW7 F;  3KLN A;  1K7A A;  2O61 A;  3FMR A;  3GFL A;  1LEA A;  4DNC A;  1O7F A;  2HKX A;  2K4J A;  1ULY A;  3G73 A;  4L5I A;  2FQ3 A;  2H6B A;  4HF1 A;  4HF2 A;  3N4M A;  3JAM Z;  4GO1 A;  1O7L A;  3P7N A;  2A68 F;  1SD5 A;  3GUD A;  2EFQ A;  2L01 A;  6PAX A;  2K27 A;  4U7D A;  4OMY A;  2XAQ A;  5L3D A;  2G7H A;  2A07 F;  5LGT A;  2XRO A;  4WCG A;  2EV0 A;  2FML A;  2FBK A;  1F5T A;  2DI3 A;  1TLH B;  1IN4 A;  1FZP B;  2EV6 A;  3E3V A;  4L5J A;  2EJR A;  4ON0 A;  2GAU A;  1FLI A;  3JTH A;  3HUG A;  5IT9 K;  1WSU A;  2NNN A;  4HF0 A;  3WTZ A;  2D45 A;  2QLZ A;  2ESH A;  3H3Z A;  5DV5 A;  4MGR A;  1V4R A;  2VBZ A;  4K2E A;  3DFG A;  2HFH A;  2XRN A;  2W25 A;  2COM A;  2Z3Y A;  5DUI A;  2M8E A;  3JSO A;  3ROU A;  4G8X A;  3MZH A;  1BI3 A;  1S8N A;  2RV8 A;  5A2Q K;  2FMY A;  3HRT A;  2K02 A;  1IUY A;  3RJP A;  2JPC A;  3MEX A;  3HOT A;  2FU4 A;  2FSW A;  5LHI A;  1FC3 A;  4QWQ A;  2C6Y A;  4OU0 A;  3F8M A;  2R3S A;  2XAJ A;  3E6C C;  4UVB A;  3ML6 A;  1FY7 A;  4M9X A;  3EUH A;  3FXR A;  4M9Z A;  1OKR A;  2IA2 A;  2J5P A;  2MA3 A;  2A61 A;  4ZYE A;  1JE8 A;  1R00 A;  5HDK A;  3N97 A;  2A69 F;  1C0W A;  4AVP A;  1DPR A;  4IXA A;  2PEX A;  3VEP A;  4RGX A;  2Y75 A;  4F7Z A;  3GO5 A;  1S7A A;  4RB1 A;  1ZLJ A;  4EM0 B;  3GFM A;  3E5U A;  1BJA A;  1O3T A;  3BZ6 A;  1MKM A;  3CLO A;  5FD5 A;  2VE9 A;  3VB2 A;  1U3E M;  3KFW X;  2XHK A;  1ZGA A;  4G7H F;  3F8N A;  3RPU A;  2WWY A;  1MZB A;  1ZYR F;  3BJA A;  3NRV A;  3ZP5 A;  2M5W A;  1IN5 A;  5LLQ A;  3RTR A;  5CVJ A;  3CDH A;  1XMA A;  3GFJ A;  2YX7 A;  4HX8 A;  1T38 A;  1Z05 A;  4IRG A;  4B09 A;  1O3S A;  1YS6 A;  1LQ1 A;  1FBU A;  2E7X A;  4ZZD A;  3HRU A;  2MC3 A;  1RI7 A;  4KT5 C;  1BIA A;  2RVC A;  1EV7 A;  2IA0 A;  3ULQ B;  4ZYH A;  5CVR A;  4P96 A;  2JT1 A;  4EJO A;  1B59 A;  3BPV A;  1HSJ A;  1DP7 P;  3D5L A;  2LKP A;  2XAF A;  1IAW A;  2V1X A;  3K9T A;  4HDV A;  3K2Z A;  4KIG A;  1XDU A;  4IHT A;  2WC2 A;  2HDC A;  3V8L A;  1USS A;  2L4M A;  2JPB A;  2XVC A;  3QP6 A;  1GXQ A;  3F22 A;  3HHG A;  4HA8 A;  1LB2 A;  2Y0M A;  2FBI A;  2L54 A;  3DKW A;  2YX4 A;  4KMF A;  2K7L A;  4HLX A;  2OAZ A;  4AIH A;  2F5C A;  1DUX C;  1FBS A;  5F1R A;  1SMT A;  2STW A;  2QWW A;  3BY6 A;  4ZH4 F;  3F6O A;  3LQQ A;  1G3S A;  1KU2 A;  4Q47 A;  5BOX A;  4ESF A;  3ABU A;  1R22 A;  4UVC A;  1B6A A;  3FF5 A;  3MAJ A;  5E8I A;  2PFB A;  1CGP A;  1AOY A;  5HLH A;  2IRF G;  3RYR A;  1SFU A;  1QBJ A;  1S3J A;  3W6J B;  3WGI A;  4CGZ A;  2VOO A;  2DPU A;  4L9V A;  5E8G A;  1XCV A;  4EV0 A;  2OZ6 A;  1YW8 A;  4OMZ A;  2GQQ A;  2EWN A;  2O03 A;  3DV8 A;  2G9W A;  1J59 A;  1ODD A;  3ZMS A;  3FZV A;  4LB5 A;  1ZAO A;  5H20 A;  4G94 A;  2CWE A;  1BM9 A;  1SFX A;  2HTS A;  4D0P A;  1BIB A;  1O3R A;  4U88 A;  1OPC A;  2F5D A;  1WI9 A;  1UST A;  3EYY A;  2KJB A;  2VXZ A;  3L09 A;  4KYW A;  1F1Z A;  5DD4 A;  1KQ0 A;  5D8K B;  3H3U A;  2UXX A;  1ZG3 A;  2HQR A;  1E17 A;  1ZG5 A;  1ONV A;  3LWF A;  3TDU C;  5LRR A;  4NHJ A;  3F8F A;  2IT0 A;  3P9C A;  1D8K A;  3R0J A;  5L3G A;  5D4R A;  1KU9 A;  5BPD A;  1S7O A;  3QPT A;  2GA1 A;  3HYI A;  3O2P E;  2JTV A;  2W24 A;  3TQN A;  1MJA A;  5E17 F;  3LST A;  3V4G A;  5BQT A;  1QGP A;  2RDP A;  4HBL A;  3TGN A;  2VOP A;  1HKS A;  1XD7 A;  1Y0U A;  4JBA A;  4O6J A;  4EGZ A;  1I5Z A;  3E6M A;  3WTU C;  1LNW A;  1IXS B;  3VFZ A;  3F6V A;  4KN7 X;  4LLN A;  3MWM A;  4XLP F;  2HYF A;  3WTT C;  1LDD A;  2NRA C;  5LHH A;  2W85 A;  3CUQ A;  2K86 A;  3QRF F;  3V8K A;  4Q48 A;  3M7G A;  3L2C A;  4Y17 A;  1S6L A;  3WE2 A;  4KIB A;  3J80 Z;  5ERI A;  3T5X A;  5BS6 A;  3E6B A;  4EJT A;  5HLG A;  2ADU A;  2NAZ A;  3KP4 A;  3WTY C;  3GX4 X;  3EQL F;  3CO6 C;  4I2O A;  2O6G E;  3I5U A;  2NS0 A;  2VT2 A;  5JHU A;  2V1D A;  4OOI A;  4UVA A;  3I53 A;  3ZQ7 A;  5AIP A;  3DEU A;  4RB0 A;  1PUE E;  2BV6 A;  5CVU A;  2XKO A;  2QQ9 A;  4H0E A;  2IVM A;  4JQF A;  4IVN A;  1FYM A;  5CJ9 A;  1B1B A;  4CHU A;  4I02 A;  4AWX B;  1FT9 A;  5LGN A;  2CSO A;  5FB2 A;  3R61 A;  4GCV A;  3ISP A;  3B73 A;  1NHA A;  3I64 A;  3M9A A;  5L3E A;  3ZPL A;  3ZMT A;  1K79 A;  1IN7 A;  1TNS A;  3KCC A;  4LB6 B;  1KQ9 A;  2LNB A;  5FFX A;  1RNL A;  4ZYD A;  3I0T A;  4WWC A;  3MQ0 A;  4YII A;  5HS7 A;  5CLS A;  3AAF A;  3HTU A;  1X3U A;  2ACJ A;  2BEO A;  4I0B A;  2H94 A;  4HAM A;  2FF4 A;  4UHT A;  2DK5 A;  2ZBK A;  4L0Y B;  1I1S A;  2HEO A;  1QPM A;  1SD4 A;  1JHH A;  3J7A O;  1QNT A;  5H6Q A;  3EYI A;  2OA4 A;  3CUQ B;  5LEJ A;  1YTY A;  2R7F A;  5BMZ A;  5FLX K;  1YIO A;  1I1G A;  1ZGJ A;  4ESB A;  1OMI A;  1TQI A;  3MCZ A;  2DT5 A;  2WTE A;  4HYE A;  5L3C A;  1OYW A;  1EH8 A;  2HR3 A;  3DXJ F;  4L18 B;  5E18 F;  1GXP A;  1FX7 A;  4LK0 F;  4BAY A;  1D5V A;  1R23 A;  4L9J A;  4RAY A;  4G6Q A;  5CYV A;  4N0B A;  3WU0 A;  1KU7 A;  4UUV A;  3NEU A;  5LGU A;  2CGP A;  2V6C A;  1XN7 A;  4EMS A;  1HW5 A;  3WOD F;  3WGH A;  4GYG A;  2E1C A;  1G3W A;  1HW1 A;  3S2W A;  5DUK A;  1D8J A;  4EM2 A;  3E5Q A;  2KIF A;  1WRJ A;  4WXC A;  2AXL A;  2ISZ A;  2XAH A;  4M72 A;  4LFU A;  1BOA A;  3V7R A;  4WXH A;  1W5S A;  1HST A;  1YG2 A;  1YS7 A;  4KNY A;  3FM3 A;  5L3B A;  2DLL A;  4A0X A;  1TW3 A;  2V1U A;  1LVA A;  2ZFW A;  1STZ A;  2GZW A;  4P9F A;  4RS8 A;  1ZAR A;  4KN4 X;  1FP1 D;  2O3F A;  2DU9 A;  2ESN A;  2FE3 A;  3ZN1 A;  3L7W A;  2A3S A;  3CTA A;  4KA4 A;  2DW4 A;  5E1Z B;  4R79 A;  3CUQ C;  1RIO H;  2BYV E;  1XGS A;  3FX3 A;  3KP5 A;  2OU2 A;  5K5O A;  3R4K A;  2Z5U A;  2LF8 A;  3GF2 A;  2ETH A;  2DQL A;  4M9S A;  4RB2 C;  3H92 A;  1XSV A;  3T1B A;  1R1U A;  5D6F A;  1XMK A;  1T39 A;  2DO7 A;  4M6X A;  3CUO A;  1Z91 A;  2P5V A;  3FWE A;  4M74 A;  3J81 K;  2VC0 A;  5E20 A;  4BNC A;  5D4S A;  2FRH A;  2VBY A;  2Z33 A;  3OV8 A;  1BI2 A;  4KFC A;  1TW2 A;  3RIR A;  3C3W A;  1FYL A;  1KGS A;  4RGS A;  4HQM A;  4R8H A;  1YO5 C;  5DD8 A;  2OBP A;  3KET A;  4A5M A;  3O6B B;  2IP2 A;  2X0L A;  1J75 A;  5LHG A;  3LQR A;  3SQN A;  1XGN A;  5J8C A;  1D3Y A;  4XBF A;  4G7Z F;  4ENM A;  1PP8 F;  1J2X A;  1UCR A;  4LK1 F;  1KYZ A; 
#chains in the Genus database with same CATH topology
 2XUB A;  4YG2 F;  4HV6 A;  2LMD A;  3GZ6 A;  2TCT A;  3BLY A;  2WAD A;  5D5V B;  2KRF A;  1R4N B;  1SFK A;  4IQ4 A;  3L2R A;  4HX4 A;  3O3K A;  1VTN C;  3I58 A;  1QHG A;  2HZT A;  1BI1 A;  2MBF A;  1KA8 A;  1QPI A;  3GTL J;  1E3P A;  1WJ5 A;  3PFI A;  3GW2 A;  2HOE A;  5B5E C;  4I01 A;  3MKW B;  9ANT A;  5DS9 A;  1I39 A;  2VKD A;  2M30 A;  4QIW N;  1MMD A;  3TOB A;  2JQ7 A;  4JOM A;  4CXF A;  3JRB A;  3HZJ A;  2DTZ A;  4V2G A;  4E7Z A;  3CJQ B;  3IHU A;  2MH9 A;  2ZXJ A;  2KDZ A;  1W4M A;  4ESJ A;  3JRF A;  3OL4 A;  1PJR A;  4UV9 A;  3SEZ A;  3RYP A;  2RNJ A;  3RDI A;  2XGX A;  4FE7 A;  5ICF A;  2KMU A;  5K7H A;  3OYE A;  3OYK A;  3P5J A;  3QAH A;  1JJ8 C;  3LFU A;  3QYB A;  3FXO A;  2STT A;  4AM3 A;  1Z1D A;  4V2F A;  1QZE A;  3JRH A;  2HYJ A;  5JVT A;  2LKS A;  1HF0 A;  3SZP A;  3PQJ A;  2H09 A;  4ZZL A;  2DBB A;  2R0Q C;  4FHT A;  1WFX A;  4P5O A;  4L9N A;  1VQ4 I;  1HKQ A;  4XR6 A;  2I10 A;  2BW3 A;  5F64 A;  4LG0 B;  3DPT A;  1I6X A;  5J6X A;  2WB1 A;  4XL9 A;  2KPM A;  3RQI A;  3G1O A;  2KHM A;  4MQ9 F;  2LDU A;  4UV8 A;  3FHZ A;  1L0O C;  4F3Q A;  2BHZ A;  3DEE A;  2DT6 A;  1YW9 A;  1MBE A;  2RAE A;  3H9G A;  4OIR F;  4BL0 B;  2CW7 A;  3IH4 A;  3JTG A;  1YYV A;  2YU3 A;  1EH7 A;  1Z7U A;  2QBY A;  4ETS A;  2PG4 A;  1REP C;  3A2K A;  2PJR B;  2L02 A;  1U8R A;  4L9T A;  1FOY A;  1XX5 A;  2BXY A;  3PIP F;  2CQ7 A;  4WK8 F;  5E3L A;  1R7J A;  5IYC J;  2LBF B;  3WTS C;  1RKW A;  2LOO A;  1R9T J;  2P7V B;  2X4H A;  4U0V A;  4Z2Y A;  3JAM K;  4BDZ A;  4GYI A;  1U9O A;  3PSI A;  4R1H A;  2WV0 A;  1A36 A;  3U9G A;  3RZD J;  1E2X A;  1X1B A;  2DTR A;  2EIK H;  1PUF A;  3IWZ A;  2ELH A;  4BS9 A;  2B63 J;  2WY7 Q;  5JR3 A;  3MZY A;  5K7F A;  4IF4 A;  3DPL C;  1DDN A;  3HSR A;  1V5F A;  4AID A;  2ME6 A;  4KDP A;  2L3D A;  2JA8 J;  1P4W A;  1DQU A;  2LRD A;  3CLQ A;  2H6C A;  3K1M A;  2HVQ A;  3VOD A;  5HOD A;  1K61 A;  5DCM A;  3VSK A;  1W0U A;  2GA2 A;  3SZG A;  4YEL A;  3FMS A;  5KAI C;  1OJL A;  1OCP A;  1QO0 D;  2BVL A;  2KRC A;  3CO7 C;  1ACI A;  2GBY A;  3F8B A;  1ZKG A;  3KYL A;  2X6O A;  4M3B A;  2X48 A;  5IT9 Z;  3KEY A;  3RKW A;  3I71 A;  1YJ9 I;  2IPQ X;  2P5K A;  4IHX A;  1MSE C;  3A01 A;  3MN2 A;  3DQV C;  1FSH A;  3ERE D;  3ZQH A;  3CES A;  3KEQ A;  3LAJ A;  2L9V A;  2KJC A;  2RKH A;  4GGG A;  5EF6 A;  1QZY A;  4RAG A;  1T56 A;  5HLI A;  2Y9Y A;  4L0Z B;  1AKH B;  4A69 C;  1V3F A;  4RB3 C;  2DFI A;  2Y0S N;  4BHC A;  5HS8 A;  2HZD A;  3DP7 A;  1X1C A;  4NQW A;  1S9H A;  2DQR A;  3HHH A;  5E1X A;  1TQP A;  3IL2 A;  3HIF A;  2IW5 A;  4AYB N;  1E0E A;  1X2M A;  1FTT A;  3KEO A;  3ZN0 A;  4FX0 A;  3HM5 A;  3ASN H;  2L4A A;  2ZNY A;  4D5C A;  1UZC A;  2ZME B;  4UXN A;  1A31 A;  2RNG A;  3M8E A;  4IRI A;  2CW8 A;  3R6S A;  3FXQ A;  3DBL B;  1BC8 C;  5C3E J;  1VQ6 I;  3JR9 A;  2V4J C;  2YR2 A;  3K0L A;  4LIV A;  4W97 A;  2DOF A;  1T6S A;  1IC8 A;  5A2Q Z;  1H9G A;  3OS2 A;  2CFO A;  2Q0O A;  5IPA A;  3GFI A;  2MG4 A;  3EPZ A;  5C4J J;  3C2H A;  3K6G A;  4B48 A;  1I6H J;  5EG0 B;  5ICC A;  2FOW A;  4PGG A;  5IOY A;  1FNN A;  1UFM A;  1WWX A;  3HRM A;  4C3J J;  1B72 A;  2D1V A;  2KIQ A;  2DA1 A;  3U1K A;  5ED4 A;  1G3T A;  2HTJ A;  1BW6 A;  2OJE D;  2JMW A;  5ILU A;  3OYF A;  2EIL H;  1S72 I;  1IXC A;  1B4A A;  5GTI C;  4TV7 A;  3ECH A;  2M87 A;  4KIT B;  1PDN C;  3I4N J;  3IC7 A;  4EJV A;  2KRH A;  2CFX A;  3GYH X;  3I4P A;  1JKR C;  2Q2E B;  1J5Y A;  4HOB A;  2OCC H;  1ETY A;  3L2U A;  2QBY B;  3KP2 A;  2ME0 A;  4II2 A;  5FFZ A;  1SFE A;  4DBQ A;  2VE8 A;  1ZTR A;  2YSR A;  2FBH A;  1XGO A;  3QYE A;  2K9S A;  1VQ8 I;  4GXO A;  4KUM A;  2ZC2 A;  1PUF B;  5IYB J;  1OCO H;  2IS6 A;  5LRS A;  1UMQ A;  2XGD A;  3OYG A;  1NG7 A;  4ABZ A;  1MDM B;  3H1C A;  3AG1 H;  2VLA A;  1VQ7 I;  2BBY A;  4X1E A;  1GHC A;  3WE3 A;  2K9L A;  1KU3 A;  2DYS H;  3G1M A;  1KON A;  2CJJ A;  4C3I J;  5D5W B;  3LSK A;  1Z6R A;  5DDG A;  3JRI A;  4U7B A;  2P8T A;  4XLF A;  3PQK A;  3IRR A;  1IV6 A;  3CP2 A;  2LLK A;  3BG6 A;  2ID3 A;  5DCM B;  3SXY A;  1RUO A;  3IH3 A;  2CV1 A;  1ETW A;  1Y0N A;  4S04 A;  3S3N A;  1IN8 A;  4BDY A;  2WA0 A;  4HNV A;  5ILS A;  5TGT A;  2BY2 A;  2O8K A;  4CCL A;  1P2F A;  4KIF A;  1HQC A;  1W36 D;  3GWZ A;  4ENK A;  2COB A;  3COA C;  3T8T A;  2GWR A;  2NNY A;  1XTA A;  4FX4 A;  2ECC A;  1XSD A;  4D7M A;  4UUS A;  3MFK A;  1X1P A;  3BG3 A;  1G3Y A;  2XF5 A;  2JRT A;  3RQ4 A;  5K5Q A;  1TWG J;  4RDU A;  3JRD A;  3D1N I;  4BJ5 C;  4GFB A;  5KHD A;  1T98 A;  2IA1 A;  2LSO A;  4J00 A;  3CCL I;  2Q8K A;  4MFE A;  5HS9 A;  4NQW B;  3H9Q A;  1YQA A;  2CUE A;  1POG A;  3HEF A;  3ZGK A;  3BQY A;  2BE5 F;  2W82 A;  3K4K A;  2W7N A;  3K70 C;  4KIS A;  4A6E A;  3S17 J;  1B9N A;  2WAF A;  3RSN A;  1LDK B;  2P81 A;  1ETV A;  3CD6 I;  3LSJ A;  3IP4 B;  1IRG A;  1D0Z A;  3TW7 A;  2PMU A;  2ZFU A;  2QM3 A;  4MIM A;  3KZZ A;  3TKY A;  3ZQG A;  1R36 A;  1R5H A;  5KCM A;  2O9L A;  4ASN A;  4BQA A;  1DGR M;  5E1W A;  4ZYG A;  4Q4Z F;  2H8R A;  3C7J A;  3BDD A;  2R7Q A;  1Z3Y A;  1O4X A;  4X6A J;  2QQ8 A;  2NVY J;  3KLO A;  1SFO J;  1GV5 A;  1UG2 A;  1B72 B;  3OYD A;  3CCQ I;  1P4X A;  4RGR A;  3BCA A;  5ICG A;  4XSZ F;  5E3O A;  1ZHF A;  3K4B A;  1K78 A;  4N9H A;  3H9J A;  2VQL A;  1U5T A;  1SMY F;  4PFO A;  1HW2 A;  1OR7 A;  3S2D J;  4U0Y A;  2E5Z A;  2FXA A;  2CO5 A;  5F0F A;  3CCU I;  3KZY A;  3I59 B;  3HGY A;  2F48 A;  3ABL H;  3S93 A;  1ERD A;  5FKO A;  2V9K A;  4XRF A;  3H3V K;  5GPA A;  3WG9 A;  2M2E A;  4HV5 A;  4IJA A;  3D0S A;  5FD6 A;  1ITY A;  1GVJ A;  2F5E A;  1IDZ A;  2B0L A;  2BHY A;  5TRD A;  1YJW I;  3BOQ A;  4X0G A;  1J09 A;  2DYR H;  1UHM A;  1IF1 A;  2QKM B;  1O3Q A;  3GBG A;  3RKQ A;  2D2W A;  1ZK8 A;  1TWA J;  3ZQF A;  4A3F J;  4M71 A;  1G4D A;  3LNQ A;  4HDU A;  1JJ6 C;  1I3Q J;  4G7O F;  4LGW A;  4XKV A;  2E35 A;  1QQI A;  4EAT A;  4PJL A;  1TWH J;  2EK5 A;  3IWF A;  3FK7 A;  1BN5 A;  2R7O A;  1SVL A;  1U6G A;  5LBQ A;  3IKT A;  2VPL A;  2I8D A;  2H1K A;  2P4W A;  3C1D A;  2MH2 A;  5DM7 F;  1LEB A;  1MGT A;  2V9P A;  1DU0 A;  3LSM A;  3HOU J;  2XSJ C;  2VBW A;  2XIG A;  2MD0 A;  2LYC A;  2TDX A;  3CDI A;  1ZRE A;  2VT3 A;  4U87 A;  2QEX I;  3SDB A;  1I27 A;  4IL6 C;  4IHS A;  4N9I A;  1J0R A;  1B9M A;  3PNV A;  4DYC A;  4O3M A;  1W7P B;  3CMY A;  1YW7 A;  4RLQ A;  1BW5 A;  3DTI A;  4YIR X;  2JJ7 A;  2Y2Z A;  3HBL A;  4YRV A;  1J9I A;  1QA6 A;  2A6T A;  2PI0 A;  2XAG A;  4CZZ A;  1W7P D;  5D5X B;  2E71 A;  1XC5 A;  2XF7 A;  2QA4 I;  3CQZ J;  3FMQ A;  3F3X A;  3GVA A;  4YFX F;  2K3F A;  3AG4 H;  5CVV A;  1WJE A;  3DLA A;  4MLO A;  2GOX B;  3F72 A;  3L2W A;  2EA2 A;  2HS5 A;  5JLX A;  2VQG A;  4I6Z A;  4B8X A;  4CYD A;  4A3K J;  1IG7 A;  4Y52 J;  3V7C A;  5B1A H;  3ZMD A;  3KE2 A;  4EJU A;  2JSC A;  2FUG 2;  3W2A A;  1T8I A;  4LLL A;  2V6E A;  3QPS A;  2PN6 A;  3M07 A;  3I55 I;  3NAR A;  1RZ4 A;  3CCR I;  2ZSH B;  2H8W A;  5K5R A;  3P9K A;  1FOK A;  5EGO B;  4XIC A;  3CJN A;  1V5G A;  2DA4 A;  4B43 A;  1VND A;  3OR2 C;  5KK1 A;  1ZRD A;  4OIO F;  1H0M A;  4P55 A;  4DIQ A;  1S5L C;  1R6R A;  4I98 B;  1OCZ H;  2M3A A;  1VQ9 I;  3GLX A;  2W00 A;  3E97 A;  3LA7 A;  1K78 B;  1U9N A;  1XDS A;  4F91 B;  3FKJ A;  1IN6 A;  3B02 A;  2HOS A;  3BTC A;  1U5T B;  2DMP A;  4RAZ A;  3ZMU A;  2UWM A;  2M1B A;  2QQA A;  4DYR A;  1U8B A;  1U2W A;  3I54 A;  4CCM A;  1HCR A;  4A3J J;  3E5X A;  5J3L A;  3FKI J;  4J19 A;  3F9K A;  4O5V A;  2H1L A;  5FKM A;  4EGY A;  2JN6 A;  2BY1 A;  4CO8 A;  3NWS A;  3HSF A;  1WQ2 A;  2LVS A;  3K10 A;  2LG4 A;  1LDJ A;  4AD9 A;  2E5N A;  1L3L A;  4A0Z A;  5HVQ C;  4IHV A;  4CIC A;  1JGG A;  4M6V A;  2IGN A;  2JA2 A;  1YFH A;  1H9T A;  1TTY A;  2DA7 A;  2ZJ2 A;  1CF7 B;  2NVX J;  3CCV I;  3FM5 A;  5EEG A;  4LLG F;  4B47 A;  3TP3 A;  4HNU A;  5KVR A;  2QKL B;  1N75 A;  1MMA A;  2EZL A;  2DMN A;  4FT8 A;  4IPA A;  1ON1 A;  1TQM A;  3LA3 A;  1VQK I;  2R7U A;  1HXD A;  2A5Y B;  2LY9 A;  3K69 A;  3NQO A;  3BRO A;  1T2K A;  1E3H A;  2RGV A;  2ZO4 A;  3FBI B;  3RI4 A;  2OTL I;  3NAU A;  2CQN A;  3R0A A;  1E3O C;  3M8J A;  1DPU A;  3C2B A;  4UNO A;  1DP3 A;  3BJ6 A;  3GXO A;  1R1V A;  5H2F C;  5IY5 H;  4D5F A;  1UHW A;  1SVM A;  2CV2 A;  4DYQ A;  3DF8 A;  3WU2 C;  3VOE A;  3G71 I;  3WTX C;  4LG0 A;  3OYL A;  1XGM A;  3B6A A;  3EUK L;  4Y7N J;  1FWZ A;  1WH5 A;  3FBN B;  1FPQ A;  1VQN I;  2NS8 A;  4NDL A;  4RA2 A;  1W1W E;  2JSP A;  4N4O B;  1ZH5 A;  4P9U A;  4CCJ A;  4XN3 A;  4XON A;  3TO7 A;  2WB1 N;  2WV1 A;  4LMY A;  4MEX F;  4BH9 A;  3UKG A;  2OQG A;  3QP5 A;  2K85 A;  3S8P A;  2LC2 A;  4BHB A;  2QUF A;  4E70 A;  3GEZ A;  1PP7 U;  2PJR A;  3KX2 A;  2KIS A;  5J4Y A;  1Y6I A;  5FO5 A;  5HOO A;  3U21 A;  4C9Y A;  2DT7 B;  5M5Y J;  3A0H C;  3ELK A;  3J80 K;  3HOX J;  5FGM A;  4A3E J;  2K9Q A;  4DW6 A;  3GCM A;  2PJP A;  1MJ9 A;  4MHG A;  2X85 A;  2W57 A;  4CA0 A;  4B44 A;  3IV5 A;  1DGW Y;  2PBI A;  5EYR A;  3E7L A;  1YE9 A;  2Y9Z A;  5K1Y A;  2XKP A;  2HGC A;  3PIO F;  2BY3 A;  1LUJ B;  4HPQ A;  4XRS G;  1P92 A;  2O7O A;  5E79 C;  1ZLK A;  1Q1H A;  1R5G A;  2QVO A;  2FEZ A;  3E1S A;  4XLE A;  3W2W A;  2MD5 A;  2P5L C;  5ICE A;  1FSE A;  2IBD A;  1YJN I;  4IHW A;  3CMM A;  4MEY F;  4OIQ F;  3OIQ A;  2H27 A;  3QPH A;  4FE4 A;  5IP7 J;  4NNJ A;  4PGH A;  2GIV A;  4EJW A;  2WAE A;  3TDZ C;  4I7H A;  1U5T C;  2JZY A;  4V19 K;  2P6S A;  5J47 A;  1OR7 C;  1WGX A;  2MSY A;  3ERM A;  1SVO A;  2CQK A;  4U0W A;  3VDX A;  3BWG A;  4LD5 A;  4XLN F;  2EZH A;  2QSF X;  2WAQ N;  3RKY A;  3ZMZ A;  1RR8 C;  3QPL A;  3WU1 B;  3S3M A;  2L9R A;  1N77 A;  2EFO A;  5F6F A;  2Z2S B;  4XQF A;  4GDF A;  4RM2 A;  1RET A;  1BL0 A;  4MTE A;  3X2Q H;  1APL C;  1W5T A;  1AKH A;  4DZJ A;  3WTV C;  2X6Y A;  3TOA A;  2QQB A;  3GTG J;  2AS5 F;  4M6Y A;  2VI6 A;  2NYX A;  3V42 A;  2OZU A;  2E1N A;  1X19 A;  4MNU A;  2ZXH A;  2JVH A;  1MD0 A;  1SD6 A;  1HC8 A;  2VQH A;  1I3A A;  2PQ8 A;  4I09 A;  1SEU A;  2CYY A;  2ZME A;  3BP8 A;  1ETQ A;  2FNP A;  2YPR A;  3H5A A;  5EJC A;  2R7D A;  1ZRF A;  3JRG A;  3UNG C;  2F4O B;  2VB6 A;  2L5Q A;  5JLW A;  2HOT A;  2KKO A;  3HB9 A;  4HQE A;  4PUS A;  2Z16 A;  3ECO A;  1GLN A;  2EZI A;  3Q3S A;  1BBY A;  3S1M J;  2FA5 A;  3RKX A;  2HNH A;  5AON A;  1AWC A;  2VUM J;  3BR0 A;  4RM3 A;  1BC7 C;  2EFN A;  1QHH D;  3GTQ J;  3FXM A;  4I0A A;  2HKO A;  1HOM A;  2XB5 A;  4NC7 A;  5EG0 A;  4AIK A;  3FXL A;  3BR3 A;  3JSP A;  2RN7 A;  4IRH A;  4LJZ F;  1WJB A;  4AIJ A;  1JHF A;  1RUN A;  2LF7 A;  1ZEL A;  1HKT A;  3TBI A;  1FBQ A;  2IJL A;  3LFK A;  2VN2 A;  1ZQ3 P;  2AQF A;  3C18 A;  4A6D A;  2M7B A;  4WXD A;  3TO9 A;  1O57 A;  1VQ5 I;  4B3A A;  2G7U A;  5D5U B;  1EA3 A;  5D6E A;  2X1E A;  4BE2 A;  2DAO A;  2HWV A;  4JYK A;  3SZT A;  2HOA A;  5FLX Z;  1XS9 A;  1J7K A;  2VON A;  2VOD A;  1X1A A;  2Q2E A;  2O8X A;  2Z99 A;  3GZ5 A;  3OS0 A;  2F5F A;  4YFK F;  3F21 A;  1SD7 A;  2J5O A;  3E6D A;  5JI6 A;  1ZG1 A;  4NUB A;  3DLL F;  1OYY A;  2ELK A;  5E3N A;  3F8C A;  3K4M A;  2X9D A;  3BJO A;  1FYK A;  2EV5 A;  4OIP F;  3BT9 A;  1OLT A;  3T0Y A;  5H6R A;  1A04 A;  1P4A A;  4A2U A;  4WX9 A;  2XAS A;  2ZKZ A;  1LPQ A;  4BHP A;  4XOP A;  3RPQ A;  1GUU A;  2RQP A;  2OQR A;  1MDM A;  1IRX A;  3Q9V A;  3RPU D;  2X6W A;  5EEH A;  2Y69 H;  5HDG A;  1OYI A;  2EPF A;  3JRA A;  2EA4 A;  2JK3 A;  4CZC A;  4BJ6 C;  2MLG A;  3LAP A;  3Q5F A;  1Z9C A;  2VXD A;  3QWL A;  4IHY A;  1BI0 A;  2IXS A;  2KIM A;  2CW0 F;  1F4K A;  2N8G A;  3GLL A;  1EJ9 A;  2AO9 A;  5EDN A;  2DOD A;  2P7C B;  3H0D A;  2Y48 A;  4RLF A;  1WKM A;  4W1U A;  4CUG A;  1R1T A;  1RPW A;  2PMH A;  1FP2 A;  3K1P A;  2VKE A;  2HYG D;  2L7F P;  4MTD A;  1A6I A;  2V9V A;  1IRF A;  2ECB A;  3K4C A;  1JKQ C;  5C44 J;  1UB9 A;  1F43 A;  4UB8 C;  1EKE A;  1JXS A;  3Q9S A;  2MFZ A;  2OD5 A;  3CC7 I;  2O0Y A;  1P6R A;  2PMZ N;  4PSX A;  4XSX F;  3ZR8 X;  4NC6 A;  1KYW A;  4M3F A;  3T8R A;  5IT3 A;  3JW4 A;  3KYC B;  1WH7 A;  2RC4 A;  1Q1V A;  3EET A;  5LEK A;  2GIZ A;  4MQV A;  3VPR A;  2YU9 J;  3PUF A;  3M1C A;  4ENN A;  3ABT A;  3BR6 A;  4ZC3 A;  5F08 A;  4PFP A;  5TJJ A;  1YHQ I;  3HRS A;  1S29 A;  1M1E B;  5IYD J;  4EQQ A;  1Z6T A;  4CCO A;  3L9F A;  4II3 A;  2E19 A;  1SAX A;  3M4O J;  3S1R J;  1MJB A;  2MLK A;  3CCY A;  4PZJ A;  4EM1 A;  3R60 A;  3HTS B;  2FOK A;  4XKC A;  3QU3 A;  2KZG A;  4XOR A;  2K4B A;  4S0H B;  4HLY A;  5DTD A;  1U0J A;  3ZMV A;  4EVI A;  4QLC U;  2GXB A;  4HST A;  4A3B J;  2MAB A;  3BZC A;  3M8F A;  3KZI C;  4NBQ A;  5DYM A;  1UAA A;  1IXR C;  4YFN F;  2IS1 A;  4RGU A;  2P0W A;  3AFH A;  5GPC A;  2ICW G;  3W6K B;  3WTW C;  1Z0X A;  2VC1 A;  2XV4 S;  4A3D J;  3A4C A;  4FTH A;  2V7F A;  1GDT A;  2EB7 A;  1NK3 P;  5J8F A;  4BBR J;  2F2E A;  1JGS A;  2EFW A;  3I59 A;  3BPX A;  4A0Y A;  3SDG A;  3GME A;  4AUX A;  1QVT A;  3V8J A;  1GT0 C;  4BAC A;  4Y4R A;  1YLF A;  2VQC A;  2L7M P;  2ZXW H;  2AXT C;  3HSE A;  4Y15 A;  1B8I A;  3CF5 F;  2QEN A;  4XLA A;  5JVG F;  2MGQ A;  2BZT A;  3PO2 J;  1AA7 A;  5CVI A;  5L3F A;  2EFP A;  1GV2 A;  2ISY A;  1F9N A;  5GAG J;  2OC6 A;  2Z9O A;  4XRS A;  1YRN B;  3JCU C;  2QZ8 A;  1ZRC A;  1P7I A;  1IUF A;  5DCF A;  4DOZ A;  3M1E A;  2AHQ A;  2CG4 A;  3QU6 A;  3G6E I;  4BYY A;  1EH6 A;  1BR4 A;  3EDP A;  1R58 A;  3HOS A;  2M34 A;  2D1H A;  4A5N A;  2NVT J;  4G6T B;  2ZCW A;  3L00 A;  4IKF A;  3IKV A;  3J81 Z;  2W4S A;  1D1B A;  2UZK A;  4HX7 A;  1YX3 A;  4KMU X;  3LA2 A;  4BQO A;  3BTI A;  2A6H F;  4F93 B;  5C4X J;  1FOW A;  2DCE A;  4PCQ A;  1K6O A;  1RRJ A;  1CQT A;  2MC4 A;  4E7L A;  2IGM A;  2Z1D A;  4BEH A;  2KP6 A;  3KP3 A;  1YX5 A;  3FXU A;  4PJM A;  5DEQ A;  2L7Z A;  5BPI A;  3B6C A;  1VQM I;  3S14 J;  2A6E F;  4A12 A;  3KP7 A;  3P9I A;  3TO6 A;  1W7P A;  4S05 A;  2PLY A;  3U2R A;  3V7S A;  2JRM A;  2E7W A;  1G6N A;  3OYA A;  3FDY A;  4A93 J;  3ZQL A;  1PYV A;  4BY1 J;  2K5C A;  2ZXI A;  4BXU A;  4XM3 A;  3QOP A;  2EIM H;  3OIO A;  2Y0S A;  4UUT A;  1HBX G;  2D5V A;  4JK1 X;  4DQ2 A;  4DGW B;  2ZME C;  4ZDO A;  1WCM J;  4YIF A;  4G9Y A;  4DBR A;  2ZJP F;  4AYB A;  2FNA A;  4FAS D;  1TNT A;  5HDN A;  1D1A A;  2GXA A;  1NH3 A;  4A3L J;  2KIU A;  1ON2 A;  1XSX A;  5LD2 C;  3SFZ A;  2G0E A;  4JP0 A;  3SEQ A;  4M73 A;  4Q5S F;  2LK2 A;  3K1N A;  2LP0 A;  4Y13 A;  2P6T A;  3DEW A;  2VJ5 A;  4PDK A;  5EGO A;  5M3M J;  3F23 A;  1ZN2 A;  2ZNZ A;  5B66 C;  3A1Y A;  2L9N A;  3PNT A;  3REO A;  3G3Z A;  1ZGW A;  1G2H A;  3OYJ A;  1U78 A;  2DK8 A;  2HQN A;  5D8L B;  2JWT A;  3MKZ A;  3ABM H;  3KP6 A;  3WGG A;  3OOP A;  2ID6 A;  4IX7 A;  3FIS A;  1KQ8 A;  3DU5 A;  1VFC A;  3SYT A;  2GXG A;  2VBX A;  3FIW A;  2L0K A;  1QZZ A;  4HZF A;  4IEJ A;  1LKX A;  4UB6 C;  5ILV A;  4HW0 A;  4QPQ A;  1TBX A;  2UXN A;  2LTP A;  2HPI A;  3LOC A;  4FQG A;  5IP9 J;  4AC0 A;  1T0F A;  2GLO A;  3H35 A;  1MMN A;  1SAU A;  2M45 A;  1IZ1 A;  2DPD A;  1LJ9 A;  3U1D A;  2HQ5 A;  1Y39 A;  2CS3 A;  4C2U A;  1N78 A;  2CH0 A;  1JUP A;  4WF2 A;  1B8I B;  3SHF A;  3CCJ I;  2BGC A;  3ZXS A;  3HC7 A;  2JA6 J;  1XCB A;  1Y56 A;  2QYO A;  1CF7 A;  1WHU A;  4BKX A;  4CDG A;  5AIQ A;  4Y33 A;  1JKO C;  4OIN F;  3HOY J;  1TWF J;  3IRQ A;  1D0X A;  2LRE A;  1XB4 A;  4KIC A;  4NB5 A;  3WHC A;  5GAE J;  5GTH C;  2W84 A;  5JFR A;  1R5I D;  4G6D A;  4ENJ A;  2V79 A;  1IJW C;  1IW7 F;  3KLN A;  3HOV J;  1K7A A;  2O61 A;  1V54 H;  2NOG A;  3FMR A;  3GFL A;  2FD5 A;  3AG3 H;  4E7J A;  1LEA A;  4DNC A;  2V26 A;  1S7E A;  3CCS I;  1O7F A;  2JUC A;  2HKX A;  1X3Z B;  1W36 C;  2K4J A;  4CH7 A;  1Y8R B;  4PK4 A;  1ULY A;  5J1U A;  3G73 A;  4L5I A;  4BEH B;  1ETX A;  1UHS A;  3BCB A;  1X58 A;  2FQ3 A;  2H6B A;  1JT6 A;  4HF1 A;  4HF2 A;  3N4M A;  2HXO A;  3JAM Z;  1NG6 A;  4GO1 A;  3TP0 A;  1JUM A;  1O7L A;  2OCE A;  5GAD J;  3OS1 A;  4E7H A;  1NTC A;  3H0G J;  2KQR A;  3P7N A;  3VYT B;  2A68 F;  4C2T A;  1SD5 A;  3BG5 A;  3GTP J;  3GUD A;  2EFQ A;  2L01 A;  6PAX A;  3W3C A;  2K27 A;  4U7D A;  2ZJQ F;  3OOU A;  4OMY A;  3BTJ A;  2XAQ A;  1X2N A;  5B3S H;  5FLM J;  1RR7 A;  5L3D A;  2G7H A;  2A07 F;  3KIO A;  1BR2 A;  5LGT A;  5CKT A;  2XRO A;  4WCG A;  3OYC A;  1A6Q A;  2M0M A;  2EV0 A;  4BE1 A;  3ESW B;  2FML A;  5J40 A;  2LY2 A;  4AVZ A;  2FBK A;  3CJR B;  1F5T A;  3PJR A;  2DI3 A;  1TLH B;  1IN4 A;  2E60 A;  3K4N A;  1FZP B;  2EZK A;  2EV6 A;  1TL8 A;  3E3V A;  4L5J A;  2EJR A;  4RAF A;  4ON0 A;  4ZDL A;  3FXJ A;  3DPU A;  2GAU A;  1FLI A;  3JTH A;  1YI2 I;  3NWT A;  3HUG A;  5IT9 K;  2HU9 A;  1WSU A;  1MMS A;  2NNN A;  4HF0 A;  3Q0W A;  3WTZ A;  2R7X A;  2L9S A;  2D45 A;  2QLZ A;  2ESH A;  1ENH A;  1UJ8 A;  2HDD A;  3H3Z A;  5DV5 A;  3F0C A;  4MGR A;  1V4R A;  1QVU A;  2OUM A;  2VBZ A;  3MZ8 A;  3L2Q A;  3AG2 H;  2DFE A;  2KZV A;  1FTZ A;  4K2E A;  1WJF A;  3CZ6 A;  3DFG A;  2HFH A;  2XRN A;  2W25 A;  3OY9 A;  3DKX A;  2COM A;  1V5E A;  2CUF A;  2Z3Y A;  5EZH A;  5DUI A;  1NK2 P;  2M8E A;  2LY1 A;  4EEF G;  3JSO A;  4I99 C;  3ROU A;  3ABK H;  4G8X A;  4MFD A;  2L7K A;  5F04 A;  3MZH A;  1BI3 A;  1S8N A;  3L1P A;  2RV8 A;  4A3I J;  4UY8 I;  2NS7 A;  5A2Q K;  4KJZ A;  2FMY A;  4IZZ A;  3HRT A;  4BY7 J;  2BY0 A;  2K02 A;  4G12 A;  5EEA A;  2X1C A;  1IUY A;  3GTM J;  3RJP A;  2JPC A;  3MEX A;  2HVR A;  1MH4 A;  3HOT A;  2FU4 A;  2NOJ B;  3TMO A;  2FSW A;  1P9Q C;  5LHI A;  2OPT A;  1FC3 A;  4QWQ A;  2C6Y A;  1LE8 A;  1OQY A;  3HL2 A;  1MBG A;  1Z3X A;  4OU0 A;  3OYH A;  2IS4 A;  3F8M A;  2R3S A;  2XAJ A;  2R5Z B;  3E6C C;  4UVB A;  2FQ4 A;  3ML6 A;  3W2V A;  1FY7 A;  2FX0 A;  4M3E A;  4M9X A;  3W6V A;  1YIT I;  3FK6 A;  1IO2 A;  3EUH A;  3FXR A;  4BJT A;  4M9Z A;  1OKR A;  2IA2 A;  2J5P A;  2MA3 A;  4H4K C;  3H36 A;  1MBK A;  2A61 A;  3FXK A;  1MW7 A;  4ZYE A;  1PVE A;  2E2H J;  4A3G J;  1FOX A;  1JE8 A;  1R00 A;  2AQE A;  5HDK A;  4HRI A;  1X3W B;  3N97 A;  1DU6 A;  2A69 F;  2PX9 A;  4Z6Y A;  1C0W A;  4AVP A;  2JA5 J;  1DPR A;  1SC7 A;  4IXA A;  2PEX A;  3O8G A;  3VEP A;  4RGX A;  2Y75 A;  4F7Z A;  3GO5 A;  3TED A;  1S7A A;  1ZLJ A;  4EM0 B;  4RB1 A;  1TT5 B;  3GFM A;  3E5U A;  3OL3 A;  3OYI A;  1BJA A;  2NXN B;  1O3T A;  4XMY A;  2CV0 A;  3BZ6 A;  3QOD A;  3EUA A;  1MKM A;  3CLO A;  5FD5 A;  2VE9 A;  4P1W A;  3IH2 A;  3VB2 A;  2WY8 Q;  4LOC A;  1U3E M;  4XKB A;  1VZ0 A;  2K3P A;  3KFW X;  2XHK A;  3QQA A;  3OYM A;  1ZGA A;  3I3L A;  4G7H F;  3F8N A;  3RPU A;  3GTK J;  4BUP A;  4QSH A;  2WWY A;  4B4C A;  1MZB A;  1ZYR F;  1WVR A;  2EIN H;  4FIS A;  3BJA A;  5CPR B;  1R4M B;  2QCO A;  3A0B C;  1VQL I;  3NRV A;  3ZP5 A;  2M5W A;  4ZJZ A;  1IN5 A;  3HUG B;  3SJM A;  5LLQ A;  4OWR B;  3RTR A;  2BXZ A;  2EBI A;  5CVJ A;  2I5U A;  1XMA A;  3CDH A;  2YX7 A;  3GFJ A;  4HX8 A;  4NC8 A;  5GAH J;  1T38 A;  4ANJ A;  4IO9 F;  3HKZ A;  2X6X A;  1Z05 A;  1WJC A;  4IRG A;  4B09 A;  1O3S A;  1YS6 A;  1JUS A;  4QPO A;  1LQ1 A;  1W5C C;  2IGO A;  5FLV A;  1FBU A;  2E7X A;  4ZZD A;  4PSW A;  4E7K A;  1K4T A;  4D7N A;  4XRM A;  1H8A C;  3SFI A;  3HRU A;  2MC3 A;  1RI7 A;  3J7A Y;  3BZK A;  1T0F C;  4KT5 C;  1BIA A;  2RVC A;  1JI8 A;  3GTJ J;  1EV7 A;  2X1D A;  2IA0 A;  3ULQ B;  5B1B H;  4ZYH A;  2OV7 A;  1MNM C;  5CVR A;  4P96 A;  2JT1 A;  4C30 A;  2NVU B;  4EJO A;  4GRI A;  1B59 A;  3BPV A;  1HSJ A;  4XK4 A;  1ORK A;  1DP7 P;  1HA8 A;  2R93 J;  3D5L A;  1TZL A;  3LSH A;  2ZJR F;  2LKP A;  2XAF A;  1IAW A;  2VL8 A;  2V1X A;  1ZR2 A;  1WZ2 A;  3K9T A;  4HDV A;  4LIT A;  3I4M J;  2UV1 A;  3D5S C;  3HGG A;  3K2Z A;  4KIG A;  2XSD C;  1XDU A;  1Y8Q B;  3ZQQ A;  4IHT A;  2WC2 A;  3BQZ A;  2M0C A;  1R49 A;  2A5W A;  5F0C A;  2HDC A;  1LFB A;  2E2J J;  1OIS A;  2CQX A;  3V8L A;  4DJA A;  1USS A;  2L4M A;  2JPB A;  1FMW A;  2XVC A;  2B9S A;  3QP6 A;  1GXQ A;  3F22 A;  1LE8 B;  1JTY A;  3ASO H;  3HHG A;  1MBJ A;  4HA8 A;  1LB2 A;  1T08 B;  3LL7 A;  2Y0M A;  4PJ0 C;  3QYF A;  3S15 J;  2FBI A;  2L54 A;  4HEA 2;  5BNG A;  3DKW A;  1JKP C;  2YX4 A;  2YUS A;  1P7J A;  4KMF A;  2K7L A;  4HLX A;  3OR1 C;  3RCO A;  5F0H A;  2OAZ A;  4AIH A;  2XAU A;  1JTX A;  2F5C A;  3GZN B;  2VJJ A;  1DUX C;  5E3M A;  1FBS A;  4BU2 A;  5F1R A;  4ZTJ A;  1SMT A;  4CYC B;  2STW A;  2QWW A;  3BY6 A;  4PJN A;  4ZH4 F;  3F6O A;  3LQQ A;  3A02 A;  5GP9 A;  3LSG A;  1G3S A;  1KU2 A;  4Q47 A;  5BOX A;  4ESF A;  2CUZ A;  3ABU A;  2IEK A;  3CME I;  1R22 A;  4UVC A;  2VKV A;  3DCF A;  1B6A A;  2IAI A;  3FF5 A;  3MAJ A;  5E8I A;  2PFB A;  5HNH A;  2HVS A;  2FJ1 A;  2F5V A;  1CGP A;  2F6C A;  1AOY A;  5HLH A;  1ZR4 A;  2IRF G;  3RYR A;  1SFU A;  2XPU A;  1QBJ A;  1S3J A;  3W6J B;  3WGI A;  4CGZ A;  2VOO A;  1K83 J;  3ZQC A;  5K7Z A;  4L9V A;  2DPU A;  2KLO A;  1VI0 A;  5E8G A;  2F4M B;  2Y30 A;  1OCT C;  3S16 J;  1XCV A;  1YRN A;  1BR1 A;  4EV0 A;  2O5R A;  2OZ6 A;  3S32 A;  1YW8 A;  4OMZ A;  2GQQ A;  4BQN A;  2EWN A;  2O03 A;  3BTL A;  3DV8 A;  2K40 A;  2G9W A;  3MD2 A;  1GVD A;  3OIP A;  4BGD A;  1R71 A;  1J59 A;  1ODD A;  3ZMS A;  3DKY A;  2QGU A;  3CF2 A;  3FZV A;  4OAY A;  4LB5 A;  1ZAO A;  2JVG A;  5H20 A;  3E0J B;  4G94 A;  2CWE A;  1BM9 A;  1SFX A;  2DJN A;  2HTS A;  3CJT B;  2HI3 A;  4RBO A;  5LFA A;  2V1N A;  4M3G A;  4D0P A;  2Q1Z B;  2WAQ A;  1BIB A;  3CC2 I;  3G4S I;  1O3R A;  3AL0 B;  3HJE A;  4U88 A;  3OSG A;  1OPC A;  2F5D A;  1WI9 A;  2CUJ A;  1UST A;  1V55 H;  3BG9 A;  2KJB A;  3EYY A;  2VXZ A;  1EF4 A;  1SAN A;  4IOC F;  2DN0 A;  3L09 A;  4KYW A;  1F1Z A;  5DD4 A;  1KQ0 A;  5D8K B;  2W1O A;  3H3U A;  1D0Y A;  5FRN A;  3G1L A;  1VQO I;  2UXX A;  4A3C J;  1ZG3 A;  2HQR A;  1E17 A;  1ZG5 A;  2E34 A;  3HDD A;  3ONQ A;  1ONV A;  4L5E A;  3K70 D;  3LWF A;  3MKY B;  1MBF A;  3DWL E;  3TDU C;  5LRR A;  4MO7 A;  1TC3 C;  4NHJ A;  3F8F A;  2IT0 A;  4E7S A;  1X4O A;  3P9C A;  1D8K A;  3R0J A;  5L3G A;  3EUH C;  5D4R A;  4B3X A;  1IV8 A;  1MND A;  1KU9 A;  5BPD A;  1S7O A;  3QPT A;  5DM6 F;  2GA1 A;  5IP6 A;  2DDB A;  2E1M B;  3O8H A;  1D1C A;  3HYI A;  2BW3 B;  3O2P E;  2CRG A;  2DA3 A;  1AHD P;  2JTV A;  2VAS A;  3H5R A;  2W24 A;  4C2M J;  3CP8 A;  3TQN A;  1MJA A;  3OWT A;  5E17 F;  4DZP A;  1QU3 A;  3LMM A;  2GOM A;  2LR8 A;  3K2A A;  2K9N A;  3LST A;  4XLC A;  3V4G A;  5BQT A;  1A35 A;  1QGP A;  2RDP A;  3BR1 A;  2IGK A;  4HBL A;  3TGN A;  5FRO A;  2VOP A;  4Y3O A;  1HKS A;  1BJZ A;  1XD7 A;  4XLH A;  4F55 A;  2DXI A;  1Y0U A;  4JBA A;  5KAF C;  4CCN A;  4O6J A;  5FKK A;  3CMA I;  4EGZ A;  1I5Z A;  3E6M A;  3WTU C;  3S2H J;  1LNW A;  3MKL A;  2DFH A;  1IXS B;  2B7E A;  3VFZ A;  3F6V A;  4KN7 X;  2XDV A;  4A3M J;  3MWM A;  4LLN A;  1N25 A;  2E2I J;  1G59 A;  4XLP F;  2HYF A;  4BQQ A;  3WTT C;  1LDD A;  1FIP A;  2DMQ A;  2NRA C;  5LHH A;  2A05 A;  1IRZ A;  4BBS J;  1TT0 A;  2W85 A;  3CUQ A;  2K86 A;  4HSR A;  1D5Y A;  1HDP A;  3QRF F;  3V8K A;  2E1O A;  4ITV A;  4Q48 A;  3ZRG A;  2VKH A;  3M7G A;  2RQQ A;  3OYN A;  5M3F J;  4E6K G;  3L2C A;  4Y17 A;  1S6L A;  1W0T A;  1FIA A;  2XRL A;  1WI3 A;  3WE2 A;  2LKX A;  3VYU B;  2R5Y A;  4KIB A;  3J80 Z;  5ERI A;  3LSR A;  2QSG X;  3T5X A;  2WBM A;  3LSI A;  1ETK A;  2VPR A;  5BS6 A;  3M3Y J;  4BXX J;  3E6B A;  5HNF A;  2HPM A;  5KNL A;  5HLG A;  2ADU A;  1I50 J;  4EJT A;  3AL0 C;  4JX5 A;  3K4L A;  1BOB A;  4F52 A;  2M8G X;  1X4P A;  2NAZ A;  2HQA A;  3KP4 A;  3WTY C;  3JRC A;  3GX4 X;  3EQL F;  3CO6 C;  3A01 B;  2W48 A;  3VYS B;  4I2O A;  3HOW J;  3I56 I;  2O6G E;  3I5U A;  1T33 A;  2XB0 X;  2XGC A;  2M4K A;  2NS0 A;  2VT2 A;  2OF7 A;  2V1D A;  5JHU A;  4OOI A;  4UVA A;  2QF7 A;  3I53 A;  3ZQ7 A;  5AIP A;  2XPV A;  2PMZ A;  3DEU A;  3OSF A;  2UUZ A;  4LIU A;  4RB0 A;  1PUE E;  2BV6 A;  5CVU A;  1TWC J;  2XKO A;  2QQ9 A;  3PL8 A;  4H0E A;  2IVM A;  4JQF A;  4IVN A;  3J7Y J;  1FYM A;  5CJ9 A;  1B1B A;  4CHU A;  4BE0 A;  3H5N A;  1MNE A;  4I02 A;  2R7T A;  4AWX B;  3Q0U A;  1MIJ A;  1FT9 A;  2ZSI B;  3LSP A;  3VSL A;  5LGN A;  2CSO A;  5FKN A;  2DOE A;  1RES A;  5FB2 A;  4IOA F;  3R61 A;  2E1M C;  4GCV A;  2DOA A;  3ISP A;  3B73 A;  3HPH A;  1NHA A;  3I64 A;  1KZH A;  3HG9 A;  2DA6 A;  1WJA A;  2XF6 A;  3M9A A;  2MYS A;  5L3E A;  3WG7 H;  2VJ4 A;  3AKZ A;  3ZPL A;  3ZMT A;  1K79 A;  1IN7 A;  4D9J A;  2K9M A;  1TNS A;  3C2G A;  3KCC A;  3QOE A;  4LB6 B;  1KQ9 A;  3IAS 2;  3CCM I;  1HDD C;  2LNB A;  5CQG A;  5FFX A;  1RNL A;  4ZYD A;  3I0T A;  4WWC A;  2CQQ A;  2GM4 A;  3MQ0 A;  4XNF A;  2LFB A;  4YII A;  5HS7 A;  5CLS A;  4IQJ A;  3AAF A;  3HTU A;  1UG0 A;  1JT0 A;  1X3U A;  2ACJ A;  2BEO A;  4I0B A;  2H94 A;  4HAM A;  3HPG A;  3OYB A;  2FF4 A;  4UHT A;  1Z7L A;  2LD5 A;  1K4S A;  4I76 A;  4XN0 A;  2DK5 A;  2ZBK A;  2NVQ J;  2KL4 A;  1FMV A;  1VF9 A;  4L0Y B;  1I1S A;  5IOZ A;  3DBH B;  4CSW A;  3K4J A;  3A03 A;  2HEO A;  3BR5 A;  5FRM A;  5M5X J;  1RC9 A;  1QPM A;  4E7I A;  1SD4 A;  1JHH A;  3J7A O;  1QNT A;  5H6Q A;  3EYI A;  2MW8 A;  2DMU A;  2OA4 A;  3CUQ B;  5LEJ A;  1YTY A;  1X1D A;  2R7F A;  3BC8 A;  4F92 B;  1YIO A;  5BMZ A;  5FLX K;  2R5Z A;  1I1G A;  1ZGJ A;  2DDA A;  3PUB A;  4ESB A;  4CCK A;  1OMI A;  1TQI A;  2R5Y B;  2L2O A;  1RKT A;  3MCZ A;  3IUO A;  2DT5 A;  2WTE A;  2OTJ I;  4HYE A;  5L3C A;  1FEX A;  1OYW A;  2JUG A;  5TIS C;  1EH8 A;  4XKW A;  2R7V A;  3HXL A;  2HR3 A;  3PNY A;  3DXJ F;  1XPX A;  3PO3 J;  5FKL A;  4L18 B;  1OCR H;  5E18 F;  3S3O A;  3MVP A;  1GXP A;  1FX7 A;  4HNT A;  3RZO J;  4LK0 F;  4BAY A;  3DU6 A;  1D5V A;  1R23 A;  4L9J A;  4RAY A;  2HDW A;  4JX4 A;  3ZCO A;  5FJ8 J;  4G6Q A;  4XID A;  5CYV A;  4UUS B;  2CMP A;  4N0B A;  4C3H J;  3JRE A;  3WU0 A;  1KU7 A;  5F27 A;  1H88 C;  4UUV A;  3NEU A;  5LGU A;  3VWB A;  2CGP A;  2V6C A;  2X51 A;  1XN7 A;  2R7W A;  4EMS A;  3CC4 I;  1HW5 A;  3WOD F;  3WGH A;  4ZDP A;  1A5J A;  4GYG A;  5J1R A;  2E1C A;  1G3W A;  1HW1 A;  1Z77 A;  1Z67 A;  3S2W A;  3WHB A;  3N05 A;  4OAZ A;  5DUK A;  4ZTF A;  1MBH A;  1D8J A;  4KT6 A;  4EM2 A;  3G2B A;  3MMY B;  2M7A A;  3BR2 A;  3ZOB A;  4B1R A;  1AU7 A;  2DJI A;  3E5Q A;  2KIF A;  1WRJ A;  1IGN A;  2TRT A;  4J01 A;  2QSH X;  4WXC A;  2AXL A;  2ISZ A;  2XAH A;  4M72 A;  4LFU A;  3HKZ N;  1BOA A;  3V7R A;  3OMY A;  2XGE A;  4N4N B;  4WXH A;  2R92 J;  1W5S A;  4E4H A;  3GTO J;  1HST A;  3BG7 A;  1FJL A;  1YG2 A;  1YOV B;  1YS7 A;  2F4I A;  3PFY A;  4KNY A;  2M4G A;  3FM3 A;  5L3B A;  4ZYA A;  2DLL A;  1F36 A;  4A0X A;  1TW3 A;  1MMG A;  2V1U A;  1LVA A;  1IDY A;  2ZFW A;  3CCE I;  1STZ A;  4RMN A;  1Y1V J;  2GZW A;  4P9F A;  4RS8 A;  2KDO A;  2LH9 A;  1HLV A;  3DTK A;  1WPK A;  1ZAR A;  4KN4 X;  1FP1 D;  2JA7 J;  2O3F A;  2DU9 A;  2M9H A;  5J1Y A;  2ESN A;  3UR3 C;  1G8X A;  1T95 A;  2FE3 A;  4HG2 A;  4QTR A;  3I9V 2;  1WJD A;  3D5R C;  1Y1W J;  3ZN1 A;  3J7Z I;  1XMX A;  3S1Q J;  3L7W A;  2VJI A;  1H89 C;  2DFF A;  4LG3 A;  2A3S A;  3CTA A;  3ZQI A;  3VYR B;  2BOL A;  4KA4 A;  2EIJ H;  2R7S A;  2DW4 A;  5E1Z B;  4R79 A;  2IS2 A;  3CUQ C;  5HLT A;  1RIO H;  1K6Y A;  2BYV E;  2Y31 A;  1XGS A;  3K7A J;  3FX3 A;  3KP5 A;  2OU2 A;  5K5O A;  3R4K A;  4YEJ A;  3HOZ J;  2Z5U A;  4FCY A;  3KPH A;  1LFP A;  2EQR A;  2LF8 A;  3TW6 A;  3GF2 A;  4JX6 A;  2ETH A;  3DBR B;  1XG1 A;  2BVM A;  2XPW A;  4CYC A;  3PSF A;  2DQL A;  4M9S A;  4RB2 C;  4XOT A;  1ETO A;  3H92 A;  1MH3 A;  1XSV A;  3T1B A;  1R1U A;  5D6F A;  5J4V A;  3DTE A;  1XMK A;  3KYD B;  1T39 A;  5M5W J;  2DO7 A;  1BA5 A;  4M6X A;  5JHF A;  3CUO A;  2KFD A;  5CQE A;  1Z91 A;  2CU7 A;  3PM1 A;  2P5V A;  3FWE A;  4M74 A;  4AU7 A;  3J81 K;  2VC0 A;  2VIX A;  5E20 A;  4BNC A;  5D4S A;  2FRH A;  2HXI A;  2VBY A;  4FET A;  2Z33 A;  3OV8 A;  2RRE A;  2XC7 A;  2R7R A;  2R4G A;  1OCC H;  1LVK A;  1YIJ I;  2DA5 A;  4BXF A;  1BI2 A;  1OFC X;  2E36 A;  3CDL A;  4KFC A;  3L2V A;  1TW2 A;  1QRY A;  4D1Q A;  3RIR A;  2ZB9 A;  2LBF A;  3C3W A;  1FYL A;  3S1N J;  1UEL B;  1KGS A;  4RGS A;  5EZG A;  4HQM A;  4R8H A;  1VQP I;  1YO5 C;  5DD8 A;  2OBP A;  2DMT A;  1Z21 A;  3Q0V A;  3KET A;  4A5M A;  3O6B B;  2IP2 A;  2X0L A;  1J75 A;  5LHG A;  1LFU P;  2EH3 A;  3LQR A;  3SQN A;  1XGN A;  4PJJ A;  5J8C A;  3FHN A;  3TL4 X;  1D3Y A;  4XBF A;  4G7Z F;  1TP4 A;  4ENM A;  5F1J A;  1PP8 F;  2ELJ A;  2YS9 A;  1J2X A;  3IAM 2;  1UCR A;  2DA2 A;  4LK1 F;  4M3D A;  2R7Z J;  1KYZ A;  2KT0 A;  1MSF C; 
#chains in the Genus database with same CATH homology
 2XUB A;  4YG2 F;  4HV6 A;  3GZ6 A;  5D5V B;  2KRF A;  4HX4 A;  3O3K A;  1VTN C;  3I58 A;  2HZT A;  1BI1 A;  2MBF A;  1KA8 A;  3PFI A;  3GW2 A;  2HOE A;  4I01 A;  2M30 A;  3TOB A;  4CXF A;  3IHU A;  2MH9 A;  2ZXJ A;  4ESJ A;  1W4M A;  4UV9 A;  3RYP A;  2RNJ A;  3RDI A;  2XGX A;  5ICF A;  3QAH A;  2STT A;  1Z1D A;  5JVT A;  3SZP A;  3PQJ A;  2H09 A;  4ZZL A;  2DBB A;  4FHT A;  4P5O A;  4L9N A;  1HKQ A;  5F64 A;  4LG0 B;  3DPT A;  1I6X A;  5J6X A;  4MQ9 F;  2LDU A;  4UV8 A;  3FHZ A;  1L0O C;  1YW9 A;  4OIR F;  3JTG A;  1YYV A;  2YU3 A;  1EH7 A;  1Z7U A;  2QBY A;  4ETS A;  2PG4 A;  1REP C;  2L02 A;  1U8R A;  4L9T A;  4WK8 F;  1R7J A;  3WTS C;  2P7V B;  2X4H A;  4U0V A;  4Z2Y A;  3JAM K;  4GYI A;  4R1H A;  2WV0 A;  3U9G A;  1E2X A;  2DTR A;  3IWZ A;  2ELH A;  5JR3 A;  3MZY A;  4IF4 A;  3DPL C;  1DDN A;  3HSR A;  4KDP A;  2L3D A;  1P4W A;  2H6C A;  3K1M A;  3VOD A;  5DCM A;  2GA2 A;  3FMS A;  1QO0 D;  3CO7 C;  3F8B A;  5IT9 Z;  3RKW A;  3I71 A;  2IPQ X;  2P5K A;  3DQV C;  1FSH A;  3ERE D;  3KEQ A;  3LAJ A;  2KJC A;  2RKH A;  4GGG A;  1QZY A;  5HLI A;  4L0Z B;  4RB3 C;  1V3F A;  2DFI A;  4BHC A;  5HS8 A;  3DP7 A;  4NQW A;  2DQR A;  3HHH A;  5E1X A;  1TQP A;  3IL2 A;  3HIF A;  2IW5 A;  3KEO A;  3ZN0 A;  4FX0 A;  2L4A A;  2ZNY A;  4UXN A;  2ZME B;  3M8E A;  4IRI A;  3R6S A;  3FXQ A;  1BC8 C;  2YR2 A;  3K0L A;  1T6S A;  5A2Q Z;  1H9G A;  3GFI A;  2Q0O A;  5ICC A;  4PGG A;  1FNN A;  1UFM A;  1WWX A;  3HRM A;  2D1V A;  5ED4 A;  1G3T A;  2HTJ A;  5ILU A;  1IXC A;  1B4A A;  4TV7 A;  3ECH A;  2M87 A;  1PDN C;  3IC7 A;  4EJV A;  2CFX A;  3GYH X;  3I4P A;  1J5Y A;  4HOB A;  2QBY B;  3KP2 A;  5FFZ A;  1SFE A;  2VE8 A;  2YSR A;  2FBH A;  1XGO A;  4GXO A;  4KUM A;  5LRS A;  1MDM B;  2BBY A;  1GHC A;  3WE3 A;  1KU3 A;  5D5W B;  5DDG A;  1Z6R A;  4U7B A;  2P8T A;  3PQK A;  3IRR A;  5DCM B;  3SXY A;  1RUO A;  4S04 A;  1IN8 A;  5ILS A;  1P2F A;  4KIF A;  1HQC A;  3GWZ A;  4ENK A;  3COA C;  3T8T A;  2GWR A;  2NNY A;  4FX4 A;  1XSD A;  3MFK A;  1G3Y A;  2JRT A;  5K5Q A;  1T98 A;  2IA1 A;  2LSO A;  2Q8K A;  5HS9 A;  1YQA A;  2BE5 F;  4A6E A;  1B9N A;  1LDK B;  1IRG A;  2PMU A;  2QM3 A;  3KZZ A;  3TKY A;  1R36 A;  1R5H A;  4ASN A;  4BQA A;  5E1W A;  4ZYG A;  4Q4Z F;  3C7J A;  3BDD A;  3KLO A;  1P4X A;  4RGR A;  5ICG A;  4XSZ F;  1ZHF A;  1K78 A;  4N9H A;  1U5T A;  1SMY F;  1HW2 A;  1OR7 A;  4U0Y A;  2FXA A;  2CO5 A;  3KZY A;  3I59 B;  4XRF A;  3WG9 A;  4HV5 A;  4IJA A;  3D0S A;  5FD6 A;  1GVJ A;  2F5E A;  2B0L A;  5TRD A;  3BOQ A;  1UHM A;  1IF1 A;  1O3Q A;  2D2W A;  4M71 A;  1G4D A;  4HDU A;  4G7O F;  4LGW A;  1QQI A;  2EK5 A;  3IWF A;  1BN5 A;  3IKT A;  1U6G A;  5LBQ A;  1LEB A;  2P4W A;  3C1D A;  2MH2 A;  1MGT A;  2VBW A;  2XIG A;  2TDX A;  1ZRE A;  2VT3 A;  1I27 A;  4IHS A;  4N9I A;  1J0R A;  1B9M A;  4O3M A;  1W7P B;  1YW7 A;  1J9I A;  2PI0 A;  2XAG A;  4CZZ A;  1W7P D;  5D5X B;  3FMQ A;  3F3X A;  3GVA A;  4YFX F;  5CVV A;  3F72 A;  2EA2 A;  2HS5 A;  4B8X A;  4CYD A;  3V7C A;  3ZMD A;  3KE2 A;  4EJU A;  2JSC A;  4LLL A;  2PN6 A;  1RZ4 A;  5K5R A;  3P9K A;  1FOK A;  3CJN A;  5KK1 A;  1ZRD A;  4OIO F;  1H0M A;  4P55 A;  4I98 B;  3GLX A;  3LA7 A;  3E97 A;  1K78 B;  1XDS A;  1IN6 A;  3B02 A;  1U5T B;  4RAZ A;  3ZMU A;  2UWM A;  2M1B A;  2QQA A;  1U2W A;  3I54 A;  3E5X A;  4O5V A;  4EGY A;  4CO8 A;  3HSF A;  1WQ2 A;  1LDJ A;  4AD9 A;  1L3L A;  4A0Z A;  5HVQ C;  4CIC A;  1YFH A;  1H9T A;  1TTY A;  2ZJ2 A;  1CF7 B;  3FM5 A;  5EEG A;  4LLG F;  5KVR A;  4FT8 A;  4IPA A;  1ON1 A;  1TQM A;  3LA3 A;  1HXD A;  2A5Y B;  3K69 A;  3NQO A;  3BRO A;  1T2K A;  2RGV A;  2ZO4 A;  3RI4 A;  3R0A A;  1DPU A;  4UNO A;  3BJ6 A;  3GXO A;  1R1V A;  1UHW A;  3DF8 A;  3VOE A;  3WTX C;  4LG0 A;  1XGM A;  1FWZ A;  1FPQ A;  1ZH5 A;  4P9U A;  3TO7 A;  4MEX F;  4LMY A;  4BH9 A;  2OQG A;  3QP5 A;  4BHB A;  2QUF A;  4E70 A;  3GEZ A;  1PP7 U;  5FO5 A;  5HOO A;  3ELK A;  3J80 K;  5FGM A;  2PJP A;  1MJ9 A;  4MHG A;  2W57 A;  2PBI A;  5K1Y A;  2XKP A;  2HGC A;  1P92 A;  1ZLK A;  1Q1H A;  1R5G A;  2QVO A;  2FEZ A;  2MD5 A;  2P5L C;  5ICE A;  1FSE A;  4MEY F;  4OIQ F;  2H27 A;  3QPH A;  4PGH A;  2GIV A;  4EJW A;  3TDZ C;  4I7H A;  1U5T C;  2JZY A;  2P6S A;  2CQK A;  4U0W A;  3BWG A;  4LD5 A;  4XLN F;  3ZMZ A;  3RKY A;  3WU1 B;  2EFO A;  5F6F A;  4MTE A;  1W5T A;  3WTV C;  3TOA A;  2QQB A;  2AS5 F;  4M6Y A;  2NYX A;  2OZU A;  2E1N A;  4MNU A;  1MD0 A;  1SD6 A;  2PQ8 A;  4I09 A;  2CYY A;  2ZME A;  3BP8 A;  2FNP A;  2YPR A;  1ZRF A;  2R7D A;  2KKO A;  4HQE A;  3ECO A;  1BBY A;  2FA5 A;  3RKX A;  5AON A;  1AWC A;  1BC7 C;  2EFN A;  4I0A A;  2HKO A;  4AIK A;  3JSP A;  2RN7 A;  4IRH A;  4LJZ F;  4AIJ A;  1JHF A;  1RUN A;  2LF7 A;  1HKT A;  1FBQ A;  2IJL A;  3LFK A;  2VN2 A;  3C18 A;  4A6D A;  4WXD A;  3TO9 A;  1O57 A;  2G7U A;  5D5U B;  5D6E A;  2DAO A;  2HWV A;  3SZT A;  5FLX Z;  1J7K A;  2VON A;  2VOD A;  2Q2E A;  2O8X A;  2Z99 A;  3GZ5 A;  2F5F A;  4YFK F;  3F21 A;  1SD7 A;  2J5O A;  3E6D A;  5JI6 A;  1ZG1 A;  1OYY A;  3F8C A;  3BJO A;  1FYK A;  2EV5 A;  4OIP F;  3T0Y A;  5H6R A;  4WX9 A;  1A04 A;  1P4A A;  4A2U A;  2XAS A;  2ZKZ A;  4BHP A;  3RPQ A;  2RQP A;  2OQR A;  1MDM A;  3Q9V A;  5EEH A;  5HDG A;  1OYI A;  2EA4 A;  2MLG A;  3LAP A;  3Q5F A;  1Z9C A;  1BI0 A;  2KIM A;  2CW0 F;  1F4K A;  2P7C B;  2Y48 A;  1WKM A;  1R1T A;  2PMH A;  1FP2 A;  3K1P A;  4MTD A;  2HYG D;  2V9V A;  1IRF A;  1UB9 A;  1JXS A;  3Q9S A;  2OD5 A;  2O0Y A;  1P6R A;  4XSX F;  1KYW A;  3T8R A;  5IT3 A;  3JW4 A;  2RC4 A;  3EET A;  5LEK A;  4MQV A;  4ENN A;  3ABT A;  5TJJ A;  3HRS A;  1S29 A;  4EQQ A;  1Z6T A;  3L9F A;  1SAX A;  1MJB A;  2MLK A;  4PZJ A;  4EM1 A;  3R60 A;  3HTS B;  2FOK A;  3QU3 A;  2K4B A;  4HLY A;  3ZMV A;  4EVI A;  2GXB A;  4QLC U;  3M8F A;  5DYM A;  1IXR C;  4YFN F;  4RGU A;  3WTW C;  3W6K B;  2VC1 A;  2XV4 S;  2EB7 A;  5J8F A;  2F2E A;  1JGS A;  2EFW A;  3I59 A;  3BPX A;  4A0Y A;  3V8J A;  1YLF A;  3HSE A;  4Y15 A;  2QEN A;  5L3F A;  5CVI A;  2EFP A;  2ISY A;  1F9N A;  2Z9O A;  2QZ8 A;  1ZRC A;  5DCF A;  3M1E A;  2CG4 A;  3QU6 A;  4BYY A;  1EH6 A;  3EDP A;  1R58 A;  3HOS A;  2D1H A;  4A5N A;  2ZCW A;  3L00 A;  3IKV A;  3J81 Z;  2UZK A;  4HX7 A;  4KMU X;  3LA2 A;  2A6H F;  4PCQ A;  1K6O A;  3KP3 A;  3FXU A;  5DEQ A;  5BPI A;  2A6E F;  4A12 A;  3KP7 A;  3P9I A;  3TO6 A;  1W7P A;  4S05 A;  2PLY A;  3U2R A;  3V7S A;  2E7W A;  1G6N A;  4BXU A;  3QOP A;  1HBX G;  4JK1 X;  4DQ2 A;  4YIF A;  4G9Y A;  2FNA A;  1TNT A;  5HDN A;  2KIU A;  1ON2 A;  1XSX A;  3SFZ A;  4M73 A;  4Q5S F;  3K1N A;  4Y13 A;  2P6T A;  4PDK A;  3F23 A;  1ZN2 A;  2ZNZ A;  3REO A;  3G3Z A;  1U78 A;  2DK8 A;  2HQN A;  5D8L B;  3KP6 A;  3WGG A;  3OOP A;  1KQ8 A;  2GXG A;  2VBX A;  1QZZ A;  4HZF A;  5ILV A;  4HW0 A;  1TBX A;  2UXN A;  1T0F A;  2M45 A;  1IZ1 A;  2DPD A;  1LJ9 A;  3U1D A;  4WF2 A;  3SHF A;  2BGC A;  1XCB A;  2QYO A;  1CF7 A;  4CDG A;  5AIQ A;  4OIN F;  3IRQ A;  1XB4 A;  4KIC A;  4NB5 A;  2W84 A;  5JFR A;  4G6D A;  4ENJ A;  2V79 A;  1IW7 F;  3KLN A;  1K7A A;  2O61 A;  3FMR A;  3GFL A;  1LEA A;  4DNC A;  1O7F A;  2HKX A;  2K4J A;  1ULY A;  3G73 A;  4L5I A;  2FQ3 A;  2H6B A;  4HF1 A;  4HF2 A;  3N4M A;  3JAM Z;  4GO1 A;  1O7L A;  3P7N A;  2A68 F;  1SD5 A;  3GUD A;  2EFQ A;  2L01 A;  6PAX A;  2K27 A;  4U7D A;  4OMY A;  2XAQ A;  5L3D A;  2G7H A;  2A07 F;  5LGT A;  2XRO A;  4WCG A;  2EV0 A;  2FML A;  2FBK A;  1F5T A;  2DI3 A;  1TLH B;  1IN4 A;  1FZP B;  2EV6 A;  3E3V A;  4L5J A;  2EJR A;  4ON0 A;  2GAU A;  1FLI A;  3JTH A;  3HUG A;  5IT9 K;  1WSU A;  2NNN A;  4HF0 A;  3WTZ A;  2D45 A;  2QLZ A;  2ESH A;  3H3Z A;  5DV5 A;  4MGR A;  1V4R A;  2VBZ A;  4K2E A;  3DFG A;  2HFH A;  2XRN A;  2W25 A;  2COM A;  2Z3Y A;  5DUI A;  2M8E A;  3JSO A;  3ROU A;  4G8X A;  3MZH A;  1BI3 A;  1S8N A;  2RV8 A;  5A2Q K;  2FMY A;  3HRT A;  2K02 A;  1IUY A;  3RJP A;  2JPC A;  3MEX A;  3HOT A;  2FU4 A;  2FSW A;  5LHI A;  1FC3 A;  4QWQ A;  2C6Y A;  4OU0 A;  3F8M A;  2R3S A;  2XAJ A;  3E6C C;  4UVB A;  3ML6 A;  1FY7 A;  4M9X A;  3EUH A;  3FXR A;  4M9Z A;  1OKR A;  2IA2 A;  2J5P A;  2MA3 A;  2A61 A;  4ZYE A;  1JE8 A;  1R00 A;  5HDK A;  3N97 A;  2A69 F;  1C0W A;  4AVP A;  1DPR A;  4IXA A;  2PEX A;  3VEP A;  4RGX A;  2Y75 A;  4F7Z A;  3GO5 A;  1S7A A;  4RB1 A;  1ZLJ A;  4EM0 B;  3GFM A;  3E5U A;  1BJA A;  1O3T A;  3BZ6 A;  1MKM A;  3CLO A;  5FD5 A;  2VE9 A;  3VB2 A;  1U3E M;  3KFW X;  2XHK A;  1ZGA A;  4G7H F;  3F8N A;  3RPU A;  2WWY A;  1MZB A;  1ZYR F;  3BJA A;  3NRV A;  3ZP5 A;  2M5W A;  1IN5 A;  5LLQ A;  3RTR A;  5CVJ A;  3CDH A;  1XMA A;  3GFJ A;  2YX7 A;  4HX8 A;  1T38 A;  1Z05 A;  4IRG A;  4B09 A;  1O3S A;  1YS6 A;  1LQ1 A;  1FBU A;  2E7X A;  4ZZD A;  3HRU A;  2MC3 A;  1RI7 A;  4KT5 C;  1BIA A;  2RVC A;  1EV7 A;  2IA0 A;  3ULQ B;  4ZYH A;  5CVR A;  4P96 A;  2JT1 A;  4EJO A;  1B59 A;  3BPV A;  1HSJ A;  1DP7 P;  3D5L A;  2LKP A;  2XAF A;  1IAW A;  2V1X A;  3K9T A;  4HDV A;  3K2Z A;  4KIG A;  1XDU A;  4IHT A;  2WC2 A;  2HDC A;  3V8L A;  1USS A;  2L4M A;  2JPB A;  2XVC A;  3QP6 A;  1GXQ A;  3F22 A;  3HHG A;  4HA8 A;  1LB2 A;  2Y0M A;  2FBI A;  2L54 A;  3DKW A;  2YX4 A;  4KMF A;  2K7L A;  4HLX A;  2OAZ A;  4AIH A;  2F5C A;  1DUX C;  1FBS A;  5F1R A;  1SMT A;  2STW A;  2QWW A;  3BY6 A;  4ZH4 F;  3F6O A;  3LQQ A;  1G3S A;  1KU2 A;  4Q47 A;  5BOX A;  4ESF A;  3ABU A;  1R22 A;  4UVC A;  1B6A A;  3FF5 A;  3MAJ A;  5E8I A;  2PFB A;  1CGP A;  1AOY A;  5HLH A;  2IRF G;  3RYR A;  1SFU A;  1QBJ A;  1S3J A;  3W6J B;  3WGI A;  4CGZ A;  2VOO A;  2DPU A;  4L9V A;  5E8G A;  1XCV A;  4EV0 A;  2OZ6 A;  1YW8 A;  4OMZ A;  2GQQ A;  2EWN A;  2O03 A;  3DV8 A;  2G9W A;  1J59 A;  1ODD A;  3ZMS A;  3FZV A;  4LB5 A;  1ZAO A;  5H20 A;  4G94 A;  2CWE A;  1BM9 A;  1SFX A;  2HTS A;  4D0P A;  1BIB A;  1O3R A;  4U88 A;  1OPC A;  2F5D A;  1WI9 A;  1UST A;  3EYY A;  2KJB A;  2VXZ A;  3L09 A;  4KYW A;  1F1Z A;  5DD4 A;  1KQ0 A;  5D8K B;  3H3U A;  2UXX A;  1ZG3 A;  2HQR A;  1E17 A;  1ZG5 A;  1ONV A;  3LWF A;  3TDU C;  5LRR A;  4NHJ A;  3F8F A;  2IT0 A;  3P9C A;  1D8K A;  3R0J A;  5L3G A;  5D4R A;  1KU9 A;  5BPD A;  1S7O A;  3QPT A;  2GA1 A;  3HYI A;  3O2P E;  2JTV A;  2W24 A;  3TQN A;  1MJA A;  5E17 F;  3LST A;  3V4G A;  5BQT A;  1QGP A;  2RDP A;  4HBL A;  3TGN A;  2VOP A;  1HKS A;  1XD7 A;  1Y0U A;  4JBA A;  4O6J A;  4EGZ A;  1I5Z A;  3E6M A;  3WTU C;  1LNW A;  1IXS B;  3VFZ A;  3F6V A;  4KN7 X;  4LLN A;  3MWM A;  4XLP F;  2HYF A;  3WTT C;  1LDD A;  2NRA C;  5LHH A;  2W85 A;  3CUQ A;  2K86 A;  3QRF F;  3V8K A;  4Q48 A;  3M7G A;  3L2C A;  4Y17 A;  1S6L A;  3WE2 A;  4KIB A;  3J80 Z;  5ERI A;  3T5X A;  5BS6 A;  3E6B A;  4EJT A;  5HLG A;  2ADU A;  2NAZ A;  3KP4 A;  3WTY C;  3GX4 X;  3EQL F;  3CO6 C;  4I2O A;  2O6G E;  3I5U A;  2NS0 A;  2VT2 A;  5JHU A;  2V1D A;  4OOI A;  4UVA A;  3I53 A;  3ZQ7 A;  5AIP A;  3DEU A;  4RB0 A;  1PUE E;  2BV6 A;  5CVU A;  2XKO A;  2QQ9 A;  4H0E A;  2IVM A;  4JQF A;  4IVN A;  1FYM A;  5CJ9 A;  1B1B A;  4CHU A;  4I02 A;  4AWX B;  1FT9 A;  5LGN A;  2CSO A;  5FB2 A;  3R61 A;  4GCV A;  3ISP A;  3B73 A;  1NHA A;  3I64 A;  3M9A A;  5L3E A;  3ZPL A;  3ZMT A;  1K79 A;  1IN7 A;  1TNS A;  3KCC A;  4LB6 B;  1KQ9 A;  2LNB A;  5FFX A;  1RNL A;  4ZYD A;  3I0T A;  4WWC A;  3MQ0 A;  4YII A;  5HS7 A;  5CLS A;  3AAF A;  3HTU A;  1X3U A;  2ACJ A;  2BEO A;  4I0B A;  2H94 A;  4HAM A;  2FF4 A;  4UHT A;  2DK5 A;  2ZBK A;  4L0Y B;  1I1S A;  2HEO A;  1QPM A;  1SD4 A;  1JHH A;  3J7A O;  1QNT A;  5H6Q A;  3EYI A;  2OA4 A;  3CUQ B;  5LEJ A;  1YTY A;  2R7F A;  5BMZ A;  5FLX K;  1YIO A;  1I1G A;  1ZGJ A;  4ESB A;  1OMI A;  1TQI A;  3MCZ A;  2DT5 A;  2WTE A;  4HYE A;  5L3C A;  1OYW A;  1EH8 A;  2HR3 A;  3DXJ F;  4L18 B;  5E18 F;  1GXP A;  1FX7 A;  4LK0 F;  4BAY A;  1D5V A;  1R23 A;  4L9J A;  4RAY A;  4G6Q A;  5CYV A;  4N0B A;  3WU0 A;  1KU7 A;  4UUV A;  3NEU A;  5LGU A;  2CGP A;  2V6C A;  1XN7 A;  4EMS A;  1HW5 A;  3WOD F;  3WGH A;  4GYG A;  2E1C A;  1G3W A;  1HW1 A;  3S2W A;  5DUK A;  1D8J A;  4EM2 A;  3E5Q A;  2KIF A;  1WRJ A;  4WXC A;  2AXL A;  2ISZ A;  2XAH A;  4M72 A;  4LFU A;  1BOA A;  3V7R A;  4WXH A;  1W5S A;  1HST A;  1YG2 A;  1YS7 A;  4KNY A;  3FM3 A;  5L3B A;  2DLL A;  4A0X A;  1TW3 A;  2V1U A;  1LVA A;  2ZFW A;  1STZ A;  2GZW A;  4P9F A;  4RS8 A;  1ZAR A;  4KN4 X;  1FP1 D;  2O3F A;  2DU9 A;  2ESN A;  2FE3 A;  3ZN1 A;  3L7W A;  2A3S A;  3CTA A;  4KA4 A;  2DW4 A;  5E1Z B;  4R79 A;  3CUQ C;  1RIO H;  2BYV E;  1XGS A;  3FX3 A;  3KP5 A;  2OU2 A;  5K5O A;  3R4K A;  2Z5U A;  2LF8 A;  3GF2 A;  2ETH A;  2DQL A;  4M9S A;  4RB2 C;  3H92 A;  1XSV A;  3T1B A;  1R1U A;  5D6F A;  1XMK A;  1T39 A;  2DO7 A;  4M6X A;  3CUO A;  1Z91 A;  2P5V A;  3FWE A;  4M74 A;  3J81 K;  2VC0 A;  5E20 A;  4BNC A;  5D4S A;  2FRH A;  2VBY A;  2Z33 A;  3OV8 A;  1BI2 A;  4KFC A;  1TW2 A;  3RIR A;  3C3W A;  1FYL A;  1KGS A;  4RGS A;  4HQM A;  4R8H A;  1YO5 C;  5DD8 A;  2OBP A;  3KET A;  4A5M A;  3O6B B;  2IP2 A;  2X0L A;  1J75 A;  5LHG A;  3LQR A;  3SQN A;  1XGN A;  5J8C A;  1D3Y A;  4XBF A;  4G7Z F;  4ENM A;  1PP8 F;  1J2X A;  1UCR A;  4LK1 F;  1KYZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...