2HDDA

Engrailed homeodomain q50k variant dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*CP*CP*C
publication title Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 20
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hddA00
2R93J 4IHXA 1YRNA 2R0QC 2M8GX 1S7EA 3HEFA 2E19A 3QPLA 2RAEA 2NOGA 2XGCA 2KT0A 2HOAA 4QIWN 1JJ8C 1HDPA 3RKQA 1F36A 5GPCA 5M3FJ 3TEDA 1ETQA 4V2GA 2HYJA 4A3JJ 3G1OA 5EDNA 5E3OA 1FTTA 2MGQA 1TWHJ 1K83J 5E3LA 2VPRA 2DN0A 1VF9A 4IHYA 1IGNA 3S15J 3GTLJ 3PO3J 2Y0SN 3RQIA 1ORKA 2O8KA 1MBGA 3O8HA 1MBHA 1Z0XA 4A3KJ 5F0FA 4IHVA 2NVTJ 1NK3P 4IHWA 3BT9A 1VNDA 4JP0A 2DA3A 3BG9A 1AKHA 2DA6A 5HODA 1WI3A 2N8GA 3E7LA 2M9HA 3S17J 4DZPA 2G0EA 1MSFC 5FKKA 2JA6J 4D7MA 1LE8A 4A69C 2CQQA 1B72B 3I4NJ 4Y52J 1ITYA 3GTPJ 5IP6A 5IPAA 4B3AA 3IV5A 4M3BA 3RZDJ 2GLOA 2FX0A 3HOVJ 2M0CA 2VKEA 3H0GJ 4FISA 4MFEA 1ZQ3P 3HBLA 3OSGA 3GTOJ 1SFOJ 2K9SA 1JJ6C 4BY1J 1H88C 3S14J 2ME6A 1RR7A 3FKIJ 5IP7J 3LSPA 2XSDC 1GVDA 2XGEA 2HDDA 3IH3A 4JYKA 3JRDA 1ENHA 1RKWA 4C3IJ 3BG3A 3JRBA 3HGGA 4QSHA 3OIOA 2DMQA 2XRLA 3BTJA 4AYBN 1XS9A 4HNVA 4A3MJ 2MSYA 3ZQGA 3BTIA 1POGA 3HB9A 4M3FA 1VFCA 4UUSA 2VUMJ 3CCYA 3L1PA 3MVPA 4Y7NJ 1U78A 3S2DJ 5M3MJ 5FLMJ 2L7FP 2DMNA 1GUUA 2YS9A 2OPTA 3G1MA 2HXOA 3FIWA 2QCOA 3IH2A 4C3HJ 5M5WJ 1CQTA 3RZOJ 3GTJJ 2HI3A 1GV2A 3UKGA 3SFIA 3GTKJ 3M3YJ 2CJJA 1GV5A 2LY9A 3PO2J 5FKOA 2LR8A 3HOUJ 1JKRC 1PUFB 3MN2A 1APLC 2ECBA 1ZKGA 2R5ZA 2Y9ZA 2LTPA 2ELKA 4B1RA 3G1LA 2EZHA 1E3OC 5IOZA 3ZQHA 4CYCA 2FD5A 3B6AA 3S1QJ 1MH4A 2Y31A 5K7FA 3HOZJ 1NTCA 1XC5A 2LVSA 3NARA 1QVTA 5F04A 2AO9A 4UUTA 3GTGJ 2EQRA 2LLKA 1ETYA 5J1RA 2W48A 3LOCA 5EG0B 2LKXA 2O9LA 1VI0A 1P7JA 2DA1A 3PM1A 2YU9J 3WHCA 5F27A 3BR6A 3BQYA 1IDYA 5JLXA 2P81A 1TC3C 2GBYA 1UG2A 2DMPA 3A03A 2VKVA 1Y1WJ 1ETVA 1LFUP 1LFBA 2JA5J 4A3EJ 1T33A 1DU0A 2YUSA 2OF7A 3FK6A 5IYCJ 1JT6A 1OFCX 3JREA 4D5CA 2MW8A 5FJ8J 2NVXJ 1DU6A 3F0CA 3Q0VA 4JX4A 1TWAJ 2JK3A 2ID6A 2ID3A 2L7ZA 2COBA 2PMZN 5EGOA 2R5YB 1PUFA 2DJNA 2FQ4A 3JRGA 4JX5A 1MBEA 1QRYA 1HLVA 1B8IB 2I10A 3ZQFA 3FISA 4QTRA 1JUSA 5F0CA 3TW6A 1U8BA 1I6HJ 2L0KA 5JLWA 5GPAA 2NVQJ 3S1MJ 1JTXA 3Q0UA 4I6ZA 1JT0A 2EZLA 5C3EJ 2CU7A 2LD5A 1W0UA 4V2FA 4XIDA 3CMYA 2LP0A 5K7HA 1HDDC 2IAIA 4GFBA 1EF4A 3BR2A 4W1UA 2XPWA 5M5YJ 1JKQC 1HOMA 5EG0A 3M4OJ 4S0HB 3ZQIA 2GM4A 4DYCA 3WHBA 1JTYA 3S2HJ 1BL0A 4DYRA 4C2MJ 1UMQA 3DCFA 3QPSA 3A01B 1H89C 3K2AA 3TP0A 1Q1VA 5C44J 4FTHA 1G2HA 2X6OA 2O7OA 2EZKA 2Y9YA 5EZGA 1TWGJ 2IBDA 1H8AC 2DMTA 3OOUA 1IV6A 2HQ5A 1ETXA 2FJ1A 2DA7A 4A3IJ 1W0TA 4BBSJ 1Z77A 3B6CA 3HKZN 4DZJA 1BW5A 2HOSA 1P7IA 3NAUA 2XGDA 4DW6A 2DA4A 2E1OA 1YRNB 1QPIA 2DA5A 2EBIA 1IRZA 5J3LA 2R5YA 2JA8J 1MBKA 2XB0X 4BKXA 3A02A 1QVUA 1RETA 3W6VA 4MLOA 4X6AJ 4DYQA 2E2JJ 1HCRA 4M6VA 4EEFG 1B72A 4A93J 4XRMA 1U9OA 3O8GA 1XG1A 5IYDJ 1HF0A 1BW6A 2H8RA 3FK7A 4A3CJ 2NVYJ 1X58A 2DMUA 2D5VA 4AC0A 1UHSA 2CUEA 3SJMA 2JA7J 2M2EA 1ZR4A 2XB5A 2NS7A 4C3JJ 3HOYJ 5F1JA 1A5JA 2X9DA 1ZK8A 3BR5A 3MKLA 4M3GA 4A3DJ 4BY7J 2B63J 5DS9A 4A3GJ 2EZIA 3HGYA 1I50J 3HDDA 5EYRA 3JRFA 4A3FJ 4XICA 1WH5A 3D1NI 4J19A 3GTQJ 4XRSA 1O4XA 4MO7A 3LNQA 3QQAA 1FIPA 1U9NA 1TWFJ 2WV1A 1JKPC 1LE8B 2DA2A 3Q3SA 3DEWA 2NS8A 2JN6A 2Y2ZA 5E3NA 1IJWC 4D5FA 3BG5A 2K9QA 1F43A 1JUPA 2TRTA 2ZB9A 3GTMJ 3BR0A 2CUFA 1JKOC 2ME0A 2K40A 4I76A 5FLVA 1X2MA 5F0HA 5M5XJ 4X1EA 3HOWJ 5EEAA 3S16J 1JUMA 1ETWA 5GP9A 2HXIA 1ETOA 3BR1A 9ANTA 4FCYA 1A6IA 2K9NA 3SDGA 3TW7A 4D7NA 4M3EA 1OCTC 1OCPA 1I3QJ 5F08A 4UUSB 4LOCA 3ZQLA 1WH7A 2IEKA 1JGGA 2R7ZJ 3S1NJ 5FKLA 2H1KA 1AHDP 4RBOA 1X2NA 5FKMA 5J1YA 4FE7A 5IOYA 1R9TJ 1RKTA 3JR9A 3HOXJ 1NK2P 4NDLA 2M34A 1SANA 3BTLA 1RESA 3GBGA 4MFDA 2EH3A 2LK2A 4B4CA 3OSFA 2VI6A 3JRAA 5C4XJ 3LSJA 2R5ZB 3H3VK 3IH4A 2E2HJ 1BJZA 1ZR2A 4CYCB 2JWTA 5FKNA 4A3BJ 2XPVA 1MBJA 1ZGWA 1WGXA 3CDLA 5BNGA 3JRIA 2LFBA 5K7ZA 3TP3A 1WCMJ 3ZOBA 4XRSG 2XPUA 3CQZJ 4IEJA 2MG4A 1FIAA 4M3DA 3VPRA 4A3LJ 5IYBJ 1MSEC 5E3MA 5DTDA 1B8IA 4ABZA 2L7MP 4W97A 1IDZA 2Y30A 1T56A 3S1RJ 3BTCA 2JJ7A 2E2IJ 1MH3A 1RPWA 2AHQA 2QF7A 4FE4A 3I4MJ 3Q0WA 2TCTA 4G12A 1TWCJ 4BXXJ 3JRCA 3HM5A 3LSGA 4RDUA 5EF6A 2WB1N 1GDTA 1FEXA 4L5EA 1D5YA 2CQXA 1K61A 1BA5A 3K7AJ 2WAQN 2R92J 1ETKA 4MIMA 1GT0C 5EZHA 2HOTA 4JX6A 1IUFA 5IP9J 1FTZA 5EGOB 1MBFA 3A01A 3C2BA 1Y1VJ 1ZTRA 1OJLA 2X48A 2DTZA 5J1UA 1AKHB 3BR3A 1WPKA 2KDZA 2L9RA 1FJLA 3ZQCA 1IC8A 1IG7A 4BBRJ 1AU7A 2ECCA 4XK4A 4AUXA 1MNMC 5C4JJ 3JRHA 3BQZA 2CRGA 3LSRA 2JMWA
chains in the Genus database with same CATH superfamily
2R93J 3BG6A 1YRNA 4P9FA 4F93B 4LIVA 4IHXA 3PQJA 3GMEA 1O3RA 3HEFA 1VQ8I 2IP2A 5HS8A 1U2WA 5H6RA 1TW2A 2DDBA 1H0MA 4BQQA 1MJBA 2ZJ2A 3ZMDA 3ZPLA 5GPCA 4P1WA 3HRTA 2HQNA 4QPOA 4IX7A 3KP4A 4C30A 5EEHA 1N25A 2HYJA 4A3JJ 1PYVA 5E3OA 5FRNA 1FTTA 1DP3A 2AXLA 5FO5A 4F7ZA 1DQUA 4RGRA 4ZYGA 1LDJA 4IHYA 1IGNA 4A6DA 4BHCA 5GAHJ 2Y0SN 3K4LA 3ECOA 4BUPA 1HXDA 3LL7A 5F0FA 5KNLA 1YOVB 4ZDPA 2CWEA 5K5QA 4HNUA 4IHTA 2JVHA 2A5YB 3LAPA 4ITVA 3BG9A 3FXOA 2VXDA 5CLSA 1S29A 1YJ9I 2DA6A 1FPQA 1WI3A 2J5PA 3S17J 4DZPA 2CFOA 1XB4A 1Z6TA 4F3QA 1MSFC 4KIGA 3EYIA 3GXOA 3I0TA 2DOAA 1WJEA 1Z7UA 3GTPJ 5ICFA 3BJ6A 3KP3A 2XAQA 3IV5A 3KETA 3RZDJ 3S8PA 2V1NA 2YU3A 3G3ZA 4FT8A 3H0GJ 1R4MB 4P96A 2P5LC 4F92B 4MTDA 1JJ6C 3OYBA 2HR3A 1RR7A 3FKIJ 1J7KA 4XLCA 3BG3A 3FBIB 3JRBA 4PFPA 3B02A 1E3HA 3K70C 1XGMA 2NRAC 4BNCA 3OIOA 2XRLA 3BTJA 3V8KA 1XS9A 4A3MJ 3BTIA 1K79A 4M3FA 1VFCA 3HOTA 3KEQA 2IXSA 4UUSA 3M1EA 1KQ9A 5D6FA 1BOBA 2C6YA 2ISZA 3KLOA 1BI1A 1Y0UA 4M72A 3E6BA 3MVPA 4Y7NJ 3S2DJ 3J80K 2ZJPF 5FLMJ 1WJFA 2FBIA 5JVTA 4IZZA 2P0WA 2AQEA 3IH2A 1BJAA 4C3HJ 3CO7C 1CQTA 2HI3A 3ONQA 5DUIA 3SYTA 3LFUA 2IS6A 5FKOA 1A35A 4XLHA 1JKRC 1B1BA 3PUBA 2L4MA 3GW2A 3EETA 2J5OA 3EUKL 4PCQA 4XMYA 3B6AA 4HRIA 3RI4A 4LITA 1XTAA 2LVSA 3CC2I 3NARA 4BDZA 4UUTA 4XM3A 4E70A 5BS6A 1VQNI 1Z7LA 2EQRA 1VQKI 2LLKA 5J1RA 1A04A 3LOCA 2PEXA 2CUJA 2W84A 1MMSA 2WY7Q 1P7JA 5TISC 2CV2A 4ASNA 4XL9A 3WHCA 2HKXA 1LQ1A 3P9IA 2X0LA 4DOZA 2LY1A 2VT2A 2M30A 1WJBA 2IS4A 1X3ZB 2G9WA 1QA6A 4OMZA 3QRFF 4MEYF 2Q2EB 1K78A 2DOFA 2DYSH 1UG2A 1ZHFA 2L2OA 4BU2A 1VQ9I 1QNTA 4WXHA 3WTSC 2QVOA 3F8FA 1FOWA 4QWQA 1W7PD 5ED4A 1WI9A 4EM2A 1LFUP 1X3UA 2JTVA 4JOMA 1T33A 5HS7A 4Y13A 4IL6C 4MQVA 3ABMH 2O03A 2X1CA 2M8EA 1JT6A 3JREA 2EFPA 4AWXB 2OCEA 4D5CA 1QHHD 2BVMA 3J81K 3QP5A 2WC2A 2NVXJ 1BR1A 1MZBA 3Q0VA 1DU6A 4JX4A 1QZYA 2YSRA 4YEJA 3PNVA 2JK3A 2CW7A 2RVCA 2ID3A 2COBA 2YPRA 2R5YB 2ZCWA 2FQ3A 3DTKA 1X1PA 2DJNA 2FQ4A 2PFBA 1K4TA 2CUZA 3E5QA 1HLVA 5BPIA 2JSPA 3FXQA 5EEGA 4QTRA 3BROA 3TQNA 2KRCA 2JT1A 1SD6A 2VQHA 2RN7A 3IHUA 2FRHA 2L0KA 1SMYF 3NEUA 1D0YA 5IT9Z 3HL2A 3VODA 4CCLA 2EIKH 4S05A 2XV4S 3CMYA 5DDGA 3M8JA 1HOMA 3OS2A 3G6EI 2XUBA 2V9PA 2COMA 5B3SH 2E5NA 3H5RA 3W6KB 2R7XA 1V54H 2UV1A 4HF0A 4FQGA 5IT9K 3RKXA 4ZDOA 2Z1DA 2G7UA 5LGNA 1SFKA 1MJ9A 1BI0A 5L3GA 1B6AA 2Q2EA 5C44J 5J6XA 1S72I 2JPBA 3OYAA 4FASD 1H8AC 4HW0A 5AIQA 2DMTA 2FF4A 4PSXA 1I3AA 1FP2A 1ON1A 2LF7A 2DA7A 3PUFA 4B48A 2OQGA 1UZCA 1I39A 4DZJA 1A6QA 1BW5A 2OA4A 1IRFA 1TP4A 1S9HA 3LMMA 3TO9A 1DGRM 2DA5A 5F1RA 1P9QC 1O7LA 2X6WA 4QPQA 3DBRB 2R5YA 2GQQA 2VE8A 1BI3A 4ZC3A 4BQNA 3VWBA 1MBKA 4Q4ZF 3ZN1A 4KNYA 3FM3A 4KA4A 2HPIA 4IRGA 3K6GA 4L9NA 5HS9A 2K4JA 3CCVI 3I4PA 3BOQA 4HPQA 2DO7A 4XRMA 1U9OA 1XG1A 5IYDJ 4A12A 4IPAA 4KISA 4EV0A 5LLQA 4XRFA 4I2OA 5L3BA 4A3CJ 3F8NA 4FX4A 3MD2A 2HOEA 4RLFA 1IZ1A 1ZG3A 2CUEA 4BHBA 3HIFA 1PP7U 5HVQC 2XB5A 2NS7A 2BW3B 2I5UA 3L7WA 4LGWA 4KN7X 1EJ9A 4X0GA 2KJCA 3CP2A 1BIAA 1LUJB 3QWLA 2EB7A 2X9DA 1ZK8A 3IKVA 5DS9A 3CUOA 4A3GJ 3GVAA 4LJZF 3HDDA 3JRFA 4YRVA 4FETA 3DQVC 3WG9A 3K1NA 4XRSA 4MO7A 2HZTA 3E5UA 2QQ9A 1HQCA 1U9NA 2K3PA 1USSA 2L9SA 5GTIC 4XN3A 4I0AA 2OTLI 2DA2A 3ZN0A 2QUFA 2DODA 2EV6A 3CLQA 4H4KC 2FEZA 1IRGA 3ISPA 2F2EA 2NS8A 3H9GA 4AVZA 2K5CA 2GAUA 3C7JA 2CS3A 3BG5A 3CDIA 2HVQA 2Y48A 2FOKA 4IOAF 4AD9A 2BOLA 3JSOA 2FU4A 1JKOC 1T95A 1Z1DA 5TJJA 4QLCU 4V19K 3HOWJ 1S5LC 1ETWA 2D1VA 3FXLA 4RGUA 3CDHA 2Z3YA 4G7HF 3CMEI 2M0MA 3H3UA 2CW8A 3SDGA 1XSVA 4BJ5C 4AIKA 2NOJB 2VODA 1ULYA 3QYBA 2P8TA 2W57A 4LOCA 4HLXA 4UB8C 1YIOA 4BGDA 2HS5A 3DKYA 3K2ZA 4I98B 3S1NJ 5J1YA 2R7QA 2NAZA 1YIJI 3CCJI 4OU0A 1KU3A 4NB5A 3QYFA 1OR7C 2JRTA 2K86A 2DCEA 1B9MA 3BTLA 3GBGA 4DGWB 4J01A 3SQNA 4RB2C 4MFDA 1OPCA 3HSRA 2EH3A 2VC1A 1G59A 4FHTA 2V9KA 3OSFA 3CCSI 2ZFWA 5D5UB 4L9TA 2RKHA 1J59A 2X85A 2CH0A 4PK4A 3I56I 4NBQA 3K70D 2R5ZB 4C2UA 3TOBA 1BJZA 1MMAA 3CTAA 4HG2A 3KZIC 3GX4X 3IAM2 2HQAA 1YI2I 4PJJA 1HBXG 3GFJA 1MJAA 3G73A 2PJRA 1U5TC 3FWEA 3OYFA 4KT6A 3CF2A 1ZGWA 3QU3A 2BV6A 3ERMA 3JRIA 4OIOF 2KIMA 5BMZA 3FXKA 3HTUA 1TT0A 2DTRA 3R0JA 2ZSIB 3ABUA 3EDPA 3CMMA 3ZXSA 3WGGA 2EFQA 4IEJA 1EH8A 5HOOA 1SVLA 2W00A 5IYBJ 4ZYDA 3LAJA 2F4IA 3CESA 4CXFA 4ABZA 4IKFA 3C3WA 5D5VB 3F8MA 3BTCA 2DFIA 4OIQF 2X4HA 2DU9A 1PP8F 1ZGJA 2AHQA 3V8JA 4XN0A 2CFXA 3TL4X 2DI3A 1EH6A 3K69A 4MNUA 3Q0WA 4KITB 1TWCJ 4BXXJ 4KMUX 3E6DA 1BIBA 2ZNYA 3QYEA 3RYPA 2D45A 2LKSA 1WJ5A 3H5AA 1LVAA 2KKOA 2X6YA 4Y17A 5JR3A 2VL8A 3K7AJ 1D1AA 3VYUB 2KHMA 4A0XA 2VJ5A 5EZHA 4ZYHA 2H6CA 1PDNC 2NXNB 1IUFA 3ESWB 3JAMZ 3A2KA 1IO2A 2E1NA 1MBFA 4S04A 1P4AA 3HC7A 4PSWA 3C2BA 4DQ2A 4PJMA 1AKHB 5J1UA 1MMNA 1AU7A 3S32A 2ZNZA 4XK4A 5D6EA 3JAMK 2PMZA 1FY7A 5CVIA 3JRHA 3PNTA 1TT5B 1FOKA 3QOEA 1YO5C 5E1WA 2O61A 1MGTA 2R7RA 2RDPA 3HHGA 3LSRA 5FFZA 3FXJA 2R0QC 2ZXHA 3OV8A 2V4JC 3AFHA 2ELJA 2E19A 4XONA 2IT0A 4H0EA 3LA2A 3K1PA 4HEA2 4QIWN 1Y39A 1HDPA 3RKQA 2ZFUA 2HQRA 4PGHA 3LQQA 1WJAA 2A6TA 1ETQA 4V2GA 2QM3A 4A5MA 2OUMA 3L2WA 3R6SA 3T1BA 4G8XA 2V26A 5DCMA 1LVKA 4E7SA 3LSMA 2K9LA 1AWCA 2DN0A 1VF9A 2BBYA 3GTLJ 3KP7A 3IL2A 3BPVA 2W82A 1FBQA 3GLLA 1FZPB 2HKOA 5JFRA 4A3KJ 4CSWA 2CW0F 4IHVA 2Z2SB 4KDPA 3MCZA 3BT9A 4HOBA 2DJIA 3W6JB 2ZO4A 1W5TA 1AKHA 2XKPA 4A5NA 4A6EA 2GA2A 3BP8A 4XLEA 4XQFA 3K4JA 4C2TA 3HUGA 1OKRA 5HLTA 3E7LA 2YR2A 5FKKA 3BZCA 5LEKA 4D7MA 2H27A 2V79A 3R4KA 4Y52J 4UHTA 3T5XA 1LDDA 2DXIA 4Y3OA 5C4XJ 5LGUA 3K4CA 3DBLB 1ZREA 1A31A 5DEQA 2FX0A 2VN2A 5CVUA 3KZYA 1TL8A 4BEHB 1ZQ3P 2M4KA 1IN8A 3CF5F 2GOMA 3OYKA 3ABLH 2QSHX 2XC7A 1FLIA 2DK8A 4UVBA 3CC4I 1T98A 2QLZA 1REPC 2ME6A 5IP7J 1R00A 3OYEA 2HDDA 1GVDA 2XGEA 4WX9A 3FXRA 4I02A 3IH3A 1J0RA 4LLGF 4UB6C 3IP4B 1KA8A 4JYKA 3JRDA 4C3IJ 1WZ2A 4D0PA 3HGGA 2ZMEA 2IA2A 1OCCH 1JI8A 2GXBA 5HNHA 1POGA 3K4NA 4AIHA 3NWTA 4PUSA 2JVGA 2IS1A 1VZ0A 3CCYA 4HV5A 2VUMJ 4ZZLA 3PL8A 4LD5A 1Q1HA 3TDUC 4JBAA 2DMNA 3GZNB 1YS6A 4G9YA 3EPZA 1W5SA 2E1CA 3G1MA 2VKDA 2HXOA 1ZGAA 2KL4A 1V3FA 3H5NA 3S2WA 3G71I 5M5WJ 1ZLKA 4M9XA 1FWZA 5DCFA 3PFYA 2CJJA 4UNOA 2DFFA 3DF8A 2L9NA 3WTXC 5B1AH 3H3VK 2ZXJA 3HHHA 5D4SA 4KIBA 4WXDA 5H20A 2QEXI 1APLC 3ELKA 4IXAA 3S3MA 2IRFG 4B1RA 3G1LA 1NG7A 3TGNA 2EIJH 2A68F 2ZKZA 2FNPA 2QSGX 3HPGA 1ZRCA 2EJRA 2XRNA 3HPHA 4HQEA 1XC5A 1D0XA 2EWNA 2GIVA 3M1CA 2OJED 3CJNA 2ESHA 4BL0B 4U7BA 3BCAA 1XPXA 5J47A 2LMDA 3C1DA 3FMRA 2KP6A 2X6XA 5B1BH 2LKXA 4ZDLA 1VI0A 2M7AA 2DA1A 4Y4RA 3BR6A 1WVRA 3W2VA 3BQYA 2Z33A 3MQ0A 1IDYA 5JLXA 1Z67A 2P81A 2LBFB 5HDKA 3JW4A 1TC3C 1VQ7I 3IAS2 1XMKA 1FOYA 4Z6YA 3CCRI 4GCVA 2GBYA 1CF7B 2IS2A 3K10A 2DMPA 3CCQI 1F9NA 5BQTA 2VKVA 1Y1WJ 1UJ8A 3I71A 1BN5A 2Q0OA 3NRVA 2ISYA 3FK6A 3RQ4A 3K0LA 1DPUA 1U0JA 2MW8A 5LRSA 1S8NA 4OAYA 5FJ8J 3F0CA 1EKEA 2ID6A 4N9IA 1J09A 3WODF 2L7ZA 3E3VA 2PMZN 5L3CA 1UFMA 1W7PA 3KP2A 3LSIA 3F8CA 3JRGA 3RJPA 2I10A 4CO8A 3ML6A 3OL3A 3ZR8X 2DW4A 2VQCA 3TW6A 1U8BA 4EJWA 3F3XA 2CV1A 1I6HJ 1P4WA 5GPAA 1QZZA 3KZZA 3TOAA 1JTXA 2XF5A 4DJAA 4PDKA 5C3EJ 3E5XA 2ACJA 1Y8QB 2LD5A 4V2FA 1QHGA 4XIDA 2F5VA 2LP0A 5GAGJ 2IAIA 3LQRA 2XPWA 1JKQC 2UZKA 5FD5A 4RMNA 1K7AA 4DYCA 1BC8C 3WHBA 3KP5A 1R1VA 1K6OA 2FMYA 1BL0A 5AIPA 5ICEA 1BC7C 2PLYA 4DYRA 2CSOA 4Q5SF 1ODDA 3DCFA 1H89C 3H0DA 1YG2A 3BC8A 2HYGD 3OR2C 5FGMA 1M1EB 1R5HA 4FTHA 1G2HA 2M5WA 2QQ8A 4J00A 2B9SA 3GFMA 1SEUA 1S7AA 5IY5H 3OOUA 1T39A 3U2RA 4BXUA 4I99C 2X1DA 5B5EC 1ETXA 2FJ1A 2E60A 4RGSA 1IAWA 4BBSJ 3B6CA 3I55I 1P7IA 2F4MB 3NAUA 1ZG1A 1D8JA 1FBSA 2LKPA 3H92A 3JTGA 2EBIA 2CO5A 2GOXB 3Q9VA 2BEOA 1IRZA 1TNTA 4RB0A 3CC7I 3CJQB 3BY6A 4AIDA 2XB0X 3A02A 1QVUA 2BE5F 1WKMA 3Q5FA 4MGRA 1P92A 4U7DA 2D1HA 1S3JA 5BOXA 2E2JJ 3MFKA 1HCRA 4ESBA 3DBHB 4XKWA 3SZPA 4M6VA 4A93J 5L3FA 1UB9A 3SEQA 3W2WA 2RV8A 2M45A 5FD6A 1G4DA 1IRXA 2WV0A 3FK7A 3I58A 1W1WE 1X58A 2FSWA 2D5VA 2OTJI 4AM3A 2H09A 1UHSA 4E7ZA 4Z2YA 2V9VA 2F5EA 3OL4A 3SJMA 2M2EA 2JA7J 1ZR4A 1TQMA 1TBXA 4AVPA 4C3JJ 3MZHA 3L2VA 3I59B 5F1JA 4I01A 4A0ZA 2JQ7A 1J2XA 2L54A 3LWFA 4Q48A 5DYMA 4BY7J 3PQKA 2EZIA 1I50J 2CGPA 4A3FJ 4YFXF 3WU0A 1H9GA 2WA0A 4II2A 2DFEA 1O4XA 3LNQA 4ANJA 1MNEA 1FIPA 2LC2A 1JKPC 2WV1A 1UHMA 2HTJA 2IA1A 1LE8B 1RUNA 2K85A 3KEOA 3OIQA 4YELA 3FKJA 1OMIA 4ZTFA 2JN6A 1GXPA 4L0YB 3D0SA 3DU6A 3ZGKA 3QPTA 1IJWC 1EH7A 1NG6A 2WBMA 4HDVA 1JUPA 2QKMB 2BY0A 3V8LA 3PSIA 3GTMJ 4RA2A 1FMWA 4ZYAA 4BAYA 3J7AY 4L9JA 1IN4A 4DBRA 1O57A 2HDWA 3Q9SA 1ZARA 1JUMA 1QGPA 2XF7A 5D4RA 5ICCA 5LGTA 1AA7A 5KCMA 3F8BA 3CP8A 1B59A 1D1BA 4RAZA 3TW7A 2X1EA 5CVJA 3RPQA 5HLIA 5FFXA 1A36A 1G3SA 4OIRF 5F08A 3AG3H 1WH7A 2KIQA 1JGGA 2R7ZJ 3DKXA 1G6NA 4AYBA 4LLLA 3KEYA 5FKLA 3HSEA 4KT5C 2H1KA 4YIIA 1AHDP 2LH9A 3GLXA 3GZ6A 4FE7A 3AL0C 1RKTA 3JR9A 4LG0B 3RPUD 3WTWC 1NK2P 4NDLA 2W7NA 3I5UA 1RESA 1R36A 4MHGA 2R3SA 2HWVA 3OYJA 3U1DA 2H1LA 1RNLA 3MKYB 2VQLA 2LK2A 2W25A 3VSLA 2RNGA 1KQ8A 2VI6A 3IWFA 2H8WA 2XVCA 4AIJA 3IH4A 2NYXA 4RAFA 5KHDA 1KONA 2F5FA 4F55A 4EJTA 2E7WA 1R5GA 4CYCB 2UWMA 2JPCA 1BM9A 2VB6A 2EFNA 5CVRA 1H9TA 1R22A 3BCBA 3U1KA 4O6JA 3LA3A 1G3TA 2P7CB 4JQFA 1TZLA 3TP3A 1WCMJ 4HF2A 2MG4A 3C18A 2E36A 3GFLA 1HSTA 1FYMA 3VPRA 2EV0A 5KAIC 4GGGA 5LRRA 3F21A 5DTDA 2OU2A 1E3PA 4KIFA 3SHFA 4HZFA 4W97A 1T56A 2KZVA 4Y33A 1KGSA 1X1CA 2VBZA 3P9KA 1YX3A 2E2IJ 2HFHA 1MH3A 2R7TA 5JVGF 2XDVA 5J4YA 2DLLA 2MH9A 4G12A 3IC7A 2GXGA 1MIJA 2IGNA 1ONVA 4PZJA 2BZTA 2FUG2 4ESJA 1LNWA 1GXQA 3LSGA 1MW7A 4RDUA 5EF6A 2ZC2A 2VBYA 3A0HC 1YITI 1D5YA 2CQXA 4CH7A 4IQJA 1W36D 2IGOA 4MIMA 4U0VA 3K1MA 1TQIA 4G6QA 5LFAA 4JX6A 3GFIA 1P4XA 2VLAA 4OOIA 5EGOB 3FZVA 2QZ8A 1Y1VJ 4CCMA 1OJLA 1XCVA 1Z21A 4XSXF 3BR3A 3T8RA 1FJLA 2L9RA 5DD8A 4KJZA 4EGYA 4BBRJ 4ESFA 5J8FA 5C4JJ 2HVRA 3HSFA 4NQWB 3OS1A 3TMOA 1HKQA 4XLFA 2O3FA 3OYIA 4R1HA 3I54A 4BE2A 5CYVA 3E97A 3BLYA 2BYVE 2M8GX 3ASOH 2BVLA 2KRFA 2B0LA 2JRMA 3QPLA 2RAEA 2XGCA 2LNBA 5A2QZ 3CCEI 1LDKB 1RZ4A 2AQFA 2DBBA 3T0YA 1D5VA 2HGCA 2P5VA 2ZXIA 1F36A 3V4GA 5GADJ 3TBIA 4M6YA 5E1XA 5M3FJ 2RNJA 3TEDA 2EA4A 5A2QK 3G1OA 4XKVA 1S7OA 5JHFA 1W5CC 2MGQA 3FHNA 5K5RA 1XSDA 4GDFA 3CCUI 2VPRA 1FYKA 3S15J 3U9GA 1ZN2A 3H1CA 3BWGA 1T0FA 3W2AA 2Q1ZB 3DEUA 2XKOA 2BW3A 1ORKA 1FBUA 2CQKA 2H94A 1MBGA 2PQ8A 2CG4A 1Z0XA 3O8HA 3ULQB 4F52A 3OYMA 1VQ6I 4P55A 2XF6A 1NK3P 2VPLA 1VNDA 5E17F 2KIFA 3HKZA 2DPUA 5HODA 1USTA 2M9HA 4NC7A 2G0EA 2OQRA 3GUDA 1R1UA 4NQWA 4HSTA 3TKYA 1B72B 2DT5A 3I4NJ 1ITYA 5L3DA 1B4AA 5K5OA 1IW7F 5IPAA 4BH9A 2LOOA 2Y69H 4B3AA 1YJWI 4M3BA 1J75A 2GLOA 1Z6RA 1IN5A 3HOVJ 1KU2A 2KDOA 3OOPA 4FISA 4HSRA 2CQNA 3OSGA 1Z3XA 3EUHA 1SFOJ 4BY1J 1P2FA 2I8DA 3WGHA 3S14J 2RQPA 2A05A 3LSPA 1YQAA 1R58A 3L00A 4KN4X 1RKWA 2MD0A 2R7VA 2FOWA 3V42A 4BHPA 1FMVA 3OYHA 1UHWA 3A1YA 2VE9A 4XOPA 1LFPA 1TTYA 4AYBN 3BZKA 4EQQA 2EFOA 3BPXA 5FLXZ 2HU9A 2ZMEC 2PI0A 2L4AA 2WY8Q 2F4OB 1ACIA 2HDCA 1MMDA 1QU3A 3L1PA 2IA0A 1FP1D 3A4CA 1IN7A 1OCOH 3FXMA 5M3MJ 1L3LA 2R7SA 5TRDA 4CHUA 1HKSA 4NNJA 3FIWA 3C2HA 5FROA 3UNGC 3GTJJ 1Y0NA 1V55H 4UVAA 3E1SA 3ZP5A 3GYHX 1GV5A 2LY9A 3PO2J 5CJ9A 2M7BA 2VQGA 3HOSA 4G7OF 4LK0F 3N05A 2ECBA 3MEXA 5JHUA 1ZKGA 4N0BA 2R5ZA 2O5RA 2ELKA 2EA2A 4XLAA 2EZHA 1KU7A 5K1YA 4G6TB 1XX5A 4D9JA 1WJCA 2FD5A 4UVCA 2Y31A 4EMSA 4CGZA 5K7FA 2LRDA 2RC4A 1NTCA 4OAZA 1ZG5A 1KU9A 2AO9A 5F04A 2NVUB 4CZZA 4I7HA 5D5XB 1ETYA 2DAOA 3BG7A 1T8IA 5EG0B 3CLOA 3SEZA 2O9LA 5E20A 4E4HA 1BR2A 1T6SA 3PM1A 4BYYA 1Y56A 4RM2A 5F27A 1D1CA 2W24A 1VQPI 4CYDA 2EPFA 5KAFC 4MTEA 4ZYEA 1IV8A 1LEAA 3N97A 2P4WA 3NQOA 1YHQI 4IVNA 1U5TB 3HRUA 2MYSA 1QQIA 3KLNA 4TV7A 1R7JA 1RUOA 3AAFA 1UELB 4CCOA 2V6CA 2PBIA 4C9YA 3KPHA 1S6LA 1LFBA 5LBQA 4ENJA 4XOTA 4A3EJ 2XASA 5J4VA 4G6DA 2P7VB 2YUSA 2OF7A 1DU0A 5IYCJ 4M6XA 3D5RC 5ICGA 2DYRH 5KVRA 3R0AA 4DIQA 2Y75A 2H6BA 2EIMH 1HW1A 4E7HA 2A5WA 3ZMZA 4BDYA 2ADUA 4O3MA 1B8IB 3IRQA 1E17A 4M71A 3FISA 3FDYA 5LHHA 3KYDB 3LSHA 5HNFA 1JUSA 3LSKA 1WJDA 1D3YA 1GLNA 2XAHA 2L3DA 1ON2A 5JLWA 1HKTA 3VYSB 1I6XA 1OR7A 2L5QA 4LG3A 2EZLA 1UCRA 3OYGA 1JT0A 1O3TA 2CU7A 1HDDC 3RCOA 1LKXA 5K7HA 1EF4A 2K9MA 3BR2A 5E8IA 5M5YJ 4M9ZA 5EG0A 4BQAA 3CUQB 4ETSA 3ZQIA 1FT9A 2GM4A 2QYOA 3F22A 2ICWG 2PMHA 1JTYA 3S2HJ 2A6HF 3BDDA 1ZRFA 1ZH5A 2ZSHB 1YW7A 3QOPA 1UMQA 3QPSA 5HLGA 3A01B 1VQ5I 3REOA 3K2AA 3TP0A 1U5TA 2KIUA 2WAQA 3F23A 1R4NB 2UXNA 2X6OA 2O7OA 2Y9YA 2YX7A 3DLAA 3KFWX 1TWGJ 1SC7A 4CCKA 1XMAA 2HQ5A 2VONA 4A3IJ 1Z77A 3WG7H 3HKZN 3ASNH 3RYRA 1KYZA 2XGDA 4DW6A 4UXNA 2PMUA 2STWA 3PJRA 2E1OA 1YRNB 2OBPA 3V7RA 2LDUA 2VT3A 4HAMA 4WXCA 5J3LA 3ZQ7A 1TW3A 2IPQX 4ENMA 3I9V2 2JA8J 2EINH 4KUMA 1WSUA 2A3SA 4EGZA 5FB2A 3J7YJ 4G7ZF 3S3NA 4RLQA 2A6EF 4DYQA 2VJJA 3OIPA 5DM7F 3E6MA 3CCMI 5H6QA 4RS8A 4EJVA 2E1MB 3O8GA 1OYIA 4CA0A 2L7KA 5D5WB 3DFGA 4NC6A 4BE0A 2DMUA 3COAC 1TQPA 3ZMSA 4AC0A 1OLTA 2WADA 4L0ZB 3CUQA 2RQQA 4BEHA 4BXFA 3P9CA 3VFZA 2QQAA 3HOYJ 1BR4A 2QQBA 4HLYA 1OISA 4A0YA 2DDAA 3BR5A 2QENA 3HXLA 2B63J 3QP6A 3QAHA 1R49A 4YIFA 1ZRDA 3HGYA 1N77A 4XICA 1WH5A 3F9KA 2K4BA 2EFWA 1XSXA 5E8GA 3FHZA 3ROUA 4MEXF 3ECHA 1EV7A 1TWFJ 4ENKA 1JHFA 1X3WB 1LB2A 3Q3SA 2DK5A 1KQ0A 2FNAA 5F6FA 2GA1A 2IGKA 1D0ZA 5HDGA 3HJEA 2DT7B 3FBNB 1DGWY 4E7LA 5E3NA 3EUAA 4HYEA 4D5FA 2LG4A 1XGSA 3G2BA 4CUGA 1F43A 4M9SA 1ZYRF 1FSEA 1G3YA 3PIPF 2CUFA 2ME0A 3FMQA 2K40A 4E7IA 3FMSA 3SDBA 5FLVA 1X2MA 3D5LA 4LMYA 3VDXA 5F0HA 5M5XJ 2VBWA 1N78A 4CCJA 2HXIA 1VQ4I 2VKHA 4RGXA 3WGIA 2QA4I 1SMTA 1RRJA 4BS9A 3NWSA 3H35A 3HRSA 1QZEA 1NHAA 1IXSB 2HNHA 2UUZA 1A6IA 2K9NA 3DP7A 3J7ZI 2ZJRF 3K9TA 4HQMA 4D7NA 3ZQQA 1OCPA 5ERIA 4CZCA 2Z5UA 4UUSB 1YE9A 3ZQLA 1MNDA 2IEKA 3H9QA 4EM0B 4OMYA 3HRMA 4YIRX 4HX4A 1SAXA 2PN6A 4RBOA 4LB5A 2V7FA 1R9TJ 1QO0D 4XSZF 2Z16A 3R60A 4XLNF 2OAZA 1SANA 3MAJA 3RSNA 4DBQA 2R7UA 3O3KA 3V7SA 1FC3A 4XR6A 3OYDA 2V1UA 2QWWA 2KPMA 2MBFA 2BGCA 4UUVA 3DTIA 3L2CA 4CICA 2LBFA 1IUYA 2VBXA 3PSFA 3LSJA 1CF7A 3ZMVA 2E2HJ 3RPUA 4YFKF 2VOOA 2FXAA 3TO6A 5LHIA 2JWTA 1MBJA 3MWMA 1RC9A 4OWRB 1YW8A 2L02A 3DKWA 3O2PE 2LFBA 3KX2A 5K7ZA 2V1XA 1WWXA 2K27A 1VQOI 1KZHA 1JXSA 4E7KA 4XRSG 2XPUA 1FIAA 2MD5A 4A3LJ 2M87A 3IUOA 5E3MA 3L2RA 1RI7A 6PAXA 4U0YA 3WTVC 3MZ8A 1IDZA 2Y30A 3S1RJ 1ZELA 1DP7P 3J80Z 2XROA 3E6CC 2JJ7A 1STZA 3RDIA 1RPWA 4FE4A 4B44A 4U87A 3W3CA 1SD7A 1K78B 1MDMB 2TCTA 1R23A 1F4KA 2R7OA 3HM5A 3T8TA 2BHYA 2EK5A 5J8CA 2CV0A 3R61A 5E1ZB 1GDTA 1FEXA 1SD4A 2IW5A 4WF2A 2VIXA 1BA5A 5DUKA 1VQLI 2B7EA 2WAQN 4RM3A 3OY9A 2R92J 1ETKA 2OZ6A 2HOTA 4Y15A 5IP9J 1FTZA 2QSFX 3F6VA 3PFIA 2KISA 4GRIA 1ZTRA 2X48A 2YX4A 3EYYA 1WQ2A 3VB2A 1WPKA 3ZQCA 1IC8A 3N4MA 1I1SA 3LA7A 1MMGA 1MNMC 4GXOA 3BQZA 1XD7A 4XKBA 2IVMA 4I09A 4YFNF 1T08B 2MA3A 3BJAA 4CCNA 5L3EA 1U8RA 3JRAA 1U3EM 3HTSB 1S7EA 2V6EA 3H36A 4ZTJA 4HNTA 2NOGA 4PJ0C 2XAUA 2ELHA 3FX3A 2KT0A 3CD6I 2HOAA 3GEZA 1K4SA 1JJ8C 4BACA 2VJ4A 2JUGA 2KRHA 1O7FA 3P7NA 4G94A 5CPRB 3DPTA 5EDNA 1MDMA 4II3A 1TWHJ 3I64A 3P5JA 4P9UA 3J81Z 1K83J 1W4MA 5E3LA 2WWYA 3WU2C 3S3OA 4MQ9F 2HYFA 4RAGA 2RGVA 1X1DA 3IWZA 3PO3J 2E34A 2A69F 3L2UA 4GYGA 2QKLB 3RQIA 2XGXA 2O8KA 2L9VA 4LK1F 3I59A 4XBFA 1MBHA 4GO1A 4K2EA 2DT6A 3IRRA 2MH2A 2NVTJ 1T0FC 4IHWA 4JP0A 2DA3A 3FM5A 1SVMA 1C0WA 1W0UA 5CVVA 2OV7A 3IKTA 2K02A 2TDXA 4IQ4A 2N8GA 2FBKA 1X1AA 4Q47A 5LEJA 2JA6J 2JSCA 4B8XA 1LE8A 5EJCA 3I3LA 4A69C 2CQQA 2M4GA 2RREA 1O3SA 2R7DA 2D2WA 5IP6A 2AS5F 2PG4A 4DNCA 2ZXWH 2ESNA 1DPRA 2M0CA 2ZJQF 2VKEA 4MFEA 5E18F 4BE1A 1YS7A 3TDZC 2F5CA 3HBLA 3OS0A 1X19A 3JCUC 1FSHA 3GTOJ 4EJOA 5D8LB 2K9SA 1HW5A 1H88C 1IF1A 1MD0A 1SD5A 2XSDC 3EUHC 3GF2A 4WK8F 3CMAI 3LFKA 1ENHA 2JUCA 2LSOA 2X51A 1HC8A 3GZ5A 4ZJZA 2MFZA 4QSHA 4KMFA 2DMQA 3L9FA 5CKTA 2XAGA 3KYCB 3HZJA 4HNVA 2MSYA 3ZQGA 2P6SA 1OYYA 4M74A 1L0OC 3HB9A 3ZCOA 1VQMI 3LSTA 5E79C 1F1ZA 1FOXA 5ILUA 3QPHA 4EM1A 2IJLA 4EJUA 1U78A 1G3WA 2L7FP 3M9AA 1GUUA 2YS9A 2OPTA 4LG0A 2OCCH 3SZGA 2Z9OA 3BJOA 3K4BA 2NNNA 3KIOA 2OZUA 2E35A 4NHJA 2QCOA 3AKZA 2F5DA 2PJPA 3RZOJ 4HV6A 1GV2A 3UKGA 3SFIA 3GTKJ 5BPDA 3M3YJ 1X4OA 4PJNA 2XSJC 1J5YA 3HOUJ 2LR8A 4N4OB 5DD4A 2E71A 2JZYA 1PUFB 3MN2A 2FBHA 2Y9ZA 3I53A 2CQ7A 2LTPA 2JA2A 4WCGA 1E3OC 5IOZA 1E2XA 3ZQHA 1FNNA 1FX7A 4CYCA 3S1QJ 1MH4A 3WU1B 2DQRA 3MKZA 1X4PA 3HOZJ 1E0EA 3ERED 2NS0A 2W4SA 1QVTA 1UAAA 2MLKA 3AL0B 4EATA 1YTYA 3GTGJ 2VASA 1OCRH 3GWZA 2BXYA 2W48A 3ABTA 2UXXA 3A0BC 2LREA 4RB1A 4IO9F 1OQYA 2YU9J 1JHHA 3VOEA 1DDNA 4KYWA 1V5FA 3OYLA 2BY3A 3WE2A 5AONA 1U6GA 3QU6A 2VJIA 2Y0MA 3WTTC 3A03A 1V4RA 3EQLF 1ETVA 2PJRB 2NNYA 5KK1A 2JA5J 3GO5A 3WTZA 1OFCX 3E0JB 1SVOA 2WTEA 3L09A 4PGGA 1O3QA 4L18B 1TWAJ 2V1DA 5JI6A 1AOYA 2HTSA 3VEPA 5EGOA 4HDUA 4E7JA 2R7FA 4ZH4F 1PUFA 2A61A 1K6YA 1IXRC 4JX5A 3SFZA 1MBEA 1QRYA 2MC4A 2W85A 3ZQFA 2QGUA 2M1BA 4NC8A 4ON0A 4BQOA 1IXCA 2PX9A 5F0CA 1V5EA 3ZMUA 1QBJA 5FRMA 2OC6A 4B47A 1I27A 4KICA 2NVQJ 3S1MJ 5ILSA 3DWLE 3Q0UA 3WTUC 4I6ZA 5TGTA 1R5ID 3H9JA 3AG4H 1PJRA 3FXUA 1XDSA 4GFBA 5ILVA 1V5GA 1NH3A 4W1UA 1XN7A 3M4OJ 3VYRB 4S0HB 1WRJA 3L2QA 1FYLA 2O8XA 2GIZA 4B43A 3DXJF 1HW2A 3HYIA 2GWRA 1P6RA 2G7HA 4WWCA 4UY8I 1VTNC 1Z3YA 2WB1A 1ZLJA 3F72A 4C2MJ 3JSPA 4IHSA 3DEEA 1YYVA 2MABA 1Q1VA 2EILH 2WAEA 1G8XA 2EZKA 5EZGA 4F91B 2MLGA 4RB3C 3KP6A 2IBDA 2P5KA 2LYCA 3K4KA 1IV6A 4NUBA 1YLFA 4RAYA 3RIRA 1W0TA 1OYWA 2KFDA 1LEBA 5B66C 2HOSA 2ZBKA 2KQRA 2K3FA 2DA4A 1EA3A 2R7WA 1Z91A 2DOEA 1QPIA 4LLNA 2DFHA 5DV5A 5H2FC 1IN6A 1LJ9A 1PVEA 1QPMA 1ERDA 3G4SI 2HVSA 5FLXK 3DPUA 2EV5A 4N9HA 3S93A 4BKXA 3AG2H 3W6VA 1RETA 1PUEE 1TNSA 4MLOA 4X6AJ 4HX8A 4UV8A 5J40A 4B09A 1XDUA 1DUXC 3QODA 1R71A 3O6BB 4EEFG 1B72A 2VOPA 4I0BA 2Q8KA 5IT3A 3X2QH 1SAUA 1YX5A 1HF0A 4R8HA 3D5SC 1BW6A 5DCMB 2H8RA 3MZYA 2NVYJ 5F64A 2QBYB 3M07A 4L9VA 1BOAA 1TLHB 3OYNA 4PFOA 1YFHA 1I5ZA 1ZAOA 3KYLA 2A07F 3OWTA 1JE8A 3AG1H 5CQEA 4O5VA 4YG2F 1A5JA 1Z9CA 3CUQC 4M3GA 3MKLA 4A3DJ 4A2UA 2Y0SA 5EYRA 1HSJA 3OMYA 3D1NI 2STTA 4J19A 2HPMA 3GTQJ 3VSKA 3GCMA 3M8EA 3HUGB 3QQAA 3JTHA 4U88A 2AXTC 4IRHA 3MKWB 4OINF 1LPQA 3DEWA 2Z99A 1SFEA 3KE2A 3C2GA 4L5JA 2Y2ZA 3DU5A 4HA8A 1GHCA 1Z05A 1T2KA 2K9QA 3WTYC 4IF4A 4AU7A 2LY2A 2TRTA 2ZB9A 3HG9A 4ENNA 3M8FA 3BR0A 4BJ6C 4I76A 3ABKH 3J7AO 3RKYA 1WHUA 1BBYA 2WAFA 4X1EA 1YW9A 5EEAA 3S16J 1Y8RB 4P5OA 4B3XA 5GP9A 4XNFA 1ETOA 3BR1A 2ETHA 2O0YA 9ANTA 2ZMEB 4FCYA 5LHGA 1XMXA 4HF1A 3WE3A 2QBYA 3F6OA 2E1MC 2FMLA 3ZRGA 4M3EA 4XLPF 1OCTC 1I3QJ 2BY2A 1GVJA 1SFXA 5D8KB 3CJTB 2VC0A 4LB6B 2XIGA 2BHZA 4XKCA 2F48A 1X2NA 2E5ZA 3K4MA 4UV9A 5FKMA 3BZ6A 2GZWA 5IOYA 4HBLA 3HOXJ 2LF8A 2M34A 2GXAA 2KJBA 5HLHA 3RKWA 1XCBA 2DQLA 2HZDA 4OIPF 4B4CA 2R4GA 3CCLI 2KLOA 4EVIA 1XGNA 3KCCA 2W1OA 2F6CA 2BY1A 3PIOF 1BI2A 2XHKA 3V7CA 1ZR2A 2K7LA 5FKNA 4A3BJ 2XPVA 3VYTB 3SZTA 2KZGA 1UG0A 1WGXA 2E7XA 3CDLA 5BNGA 3ZMTA 4IOCF 2O6GE 4FX0A 3DTEA 4BJTA 1R1TA 3U21A 4IRIA 1SFUA 3ZOBA 1KYWA 3CQZJ 4ZZDA 3UR3C 4M3DA 5GAEJ 5GTHC 1MSEC 1F5TA 2M3AA 3OYCA 3DPLC 4IJAA 3TO7A 5HDNA 4L5IA 4U0WA 5CQGA 1B8IA 2L7MP 2VXZA 1WFXA 2BXZA 4E6KG 1T38A 5LD2C 4LIUA 4LFUA 2OD5A 4GYIA 2MC3A 3CO6C 1B9NA 2IGMA 2QF7A 1R6RA 2L01A 5DM6F 3I4MJ 3FF5A 3CJRB 3OR1C 1MKMA 1OCZH 2XAFA 1CGPA 3RTRA 2DPDA 3B73A 2CYYA 4KFCA 3JRCA 1X1BA 4R79A 2FE3A 2FA5A 4M73A 2WB1N 4L5EA 1Y6IA 4JK1X 1K61A 4PJLA 3M7GA 3SXYA 1HA8A 1GT0C 2P6TA 4HX7A 1I1GA 1YJNI 4XORA 2KMUA 1XGOA 3DV8A 1RR8C 3A01A 1W7PB 1N75A 4D1QA 2DTZA 4CDGA 2CMPA 1JGSA 2KDZA 1RIOH 3H3ZA 1IG7A 1J9IA 2ECCA 4AUXA 3CZ6A 3PNYA 4N4NB 3DLLF 2HEOA 3MMYB 1D8KA 2XAJA 2CRGA 1W36C 2JMWA
chains in the Genus database with same CATH topology
2R93J 4IHXA 1YRNA 2R0QC 2M8GX 1S7EA 3HEFA 2E19A 3QPLA 2RAEA 2NOGA 2XGCA 2KT0A 2HOAA 4QIWN 1JJ8C 1HDPA 3RKQA 1F36A 5GPCA 5M3FJ 3TEDA 1ETQA 4V2GA 2HYJA 4A3JJ 3G1OA 5EDNA 5E3OA 1FTTA 2MGQA 1TWHJ 1K83J 5E3LA 2VPRA 2DN0A 1VF9A 4IHYA 1IGNA 3S15J 3GTLJ 3PO3J 2Y0SN 3RQIA 1ORKA 2O8KA 1MBGA 3O8HA 1MBHA 1Z0XA 4A3KJ 5F0FA 4IHVA 2NVTJ 1NK3P 4IHWA 3BT9A 1VNDA 4JP0A 2DA3A 3BG9A 1AKHA 2DA6A 5HODA 1WI3A 2N8GA 3E7LA 2M9HA 3S17J 4DZPA 2G0EA 1MSFC 5FKKA 2JA6J 4D7MA 1LE8A 4A69C 2CQQA 1B72B 3I4NJ 4Y52J 1ITYA 3GTPJ 5IP6A 5IPAA 4B3AA 3IV5A 4M3BA 3RZDJ 2GLOA 2FX0A 3HOVJ 2M0CA 2VKEA 3H0GJ 4FISA 4MFEA 1ZQ3P 3HBLA 3OSGA 3GTOJ 1SFOJ 2K9SA 1JJ6C 4BY1J 1H88C 3S14J 2ME6A 1RR7A 3FKIJ 5IP7J 3LSPA 2XSDC 1GVDA 2XGEA 2HDDA 3IH3A 4JYKA 3JRDA 1ENHA 1RKWA 4C3IJ 3BG3A 3JRBA 3HGGA 4QSHA 3OIOA 2DMQA 2XRLA 3BTJA 4AYBN 1XS9A 4HNVA 4A3MJ 2MSYA 3ZQGA 3BTIA 1POGA 3HB9A 4M3FA 1VFCA 4UUSA 2VUMJ 3CCYA 3L1PA 3MVPA 4Y7NJ 1U78A 3S2DJ 5M3MJ 5FLMJ 2L7FP 2DMNA 1GUUA 2YS9A 2OPTA 3G1MA 2HXOA 3FIWA 2QCOA 3IH2A 4C3HJ 5M5WJ 1CQTA 3RZOJ 3GTJJ 2HI3A 1GV2A 3UKGA 3SFIA 3GTKJ 3M3YJ 2CJJA 1GV5A 2LY9A 3PO2J 5FKOA 2LR8A 3HOUJ 1JKRC 1PUFB 3MN2A 1APLC 2ECBA 1ZKGA 2R5ZA 2Y9ZA 2LTPA 2ELKA 4B1RA 3G1LA 2EZHA 1E3OC 5IOZA 3ZQHA 4CYCA 2FD5A 3B6AA 3S1QJ 1MH4A 2Y31A 5K7FA 3HOZJ 1NTCA 1XC5A 2LVSA 3NARA 1QVTA 5F04A 2AO9A 4UUTA 3GTGJ 2EQRA 2LLKA 1ETYA 5J1RA 2W48A 3LOCA 5EG0B 2LKXA 2O9LA 1VI0A 1P7JA 2DA1A 3PM1A 2YU9J 3WHCA 5F27A 3BR6A 3BQYA 1IDYA 5JLXA 2P81A 1TC3C 2GBYA 1UG2A 2DMPA 3A03A 2VKVA 1Y1WJ 1ETVA 1LFUP 1LFBA 2JA5J 4A3EJ 1T33A 1DU0A 2YUSA 2OF7A 3FK6A 5IYCJ 1JT6A 1OFCX 3JREA 4D5CA 2MW8A 5FJ8J 2NVXJ 1DU6A 3F0CA 3Q0VA 4JX4A 1TWAJ 2JK3A 2ID6A 2ID3A 2L7ZA 2COBA 2PMZN 5EGOA 2R5YB 1PUFA 2DJNA 2FQ4A 3JRGA 4JX5A 1MBEA 1QRYA 1HLVA 1B8IB 2I10A 3ZQFA 3FISA 4QTRA 1JUSA 5F0CA 3TW6A 1U8BA 1I6HJ 2L0KA 5JLWA 5GPAA 2NVQJ 3S1MJ 1JTXA 3Q0UA 4I6ZA 1JT0A 2EZLA 5C3EJ 2CU7A 2LD5A 1W0UA 4V2FA 4XIDA 3CMYA 2LP0A 5K7HA 1HDDC 2IAIA 4GFBA 1EF4A 3BR2A 4W1UA 2XPWA 5M5YJ 1JKQC 1HOMA 5EG0A 3M4OJ 4S0HB 3ZQIA 2GM4A 4DYCA 3WHBA 1JTYA 3S2HJ 1BL0A 4DYRA 4C2MJ 1UMQA 3DCFA 3QPSA 3A01B 1H89C 3K2AA 3TP0A 1Q1VA 5C44J 4FTHA 1G2HA 2X6OA 2O7OA 2EZKA 2Y9YA 5EZGA 1TWGJ 2IBDA 1H8AC 2DMTA 3OOUA 1IV6A 2HQ5A 1ETXA 2FJ1A 2DA7A 4A3IJ 1W0TA 4BBSJ 1Z77A 3B6CA 3HKZN 4DZJA 1BW5A 2HOSA 1P7IA 3NAUA 2XGDA 4DW6A 2DA4A 2E1OA 1YRNB 1QPIA 2DA5A 2EBIA 1IRZA 5J3LA 2R5YA 2JA8J 1MBKA 2XB0X 4BKXA 3A02A 1QVUA 1RETA 3W6VA 4MLOA 4X6AJ 4DYQA 2E2JJ 1HCRA 4M6VA 4EEFG 1B72A 4A93J 4XRMA 1U9OA 3O8GA 1XG1A 5IYDJ 1HF0A 1BW6A 2H8RA 3FK7A 4A3CJ 2NVYJ 1X58A 2DMUA 2D5VA 4AC0A 1UHSA 2CUEA 3SJMA 2JA7J 2M2EA 1ZR4A 2XB5A 2NS7A 4C3JJ 3HOYJ 5F1JA 1A5JA 2X9DA 1ZK8A 3BR5A 3MKLA 4M3GA 4A3DJ 4BY7J 2B63J 5DS9A 4A3GJ 2EZIA 3HGYA 1I50J 3HDDA 5EYRA 3JRFA 4A3FJ 4XICA 1WH5A 3D1NI 4J19A 3GTQJ 4XRSA 1O4XA 4MO7A 3LNQA 3QQAA 1FIPA 1U9NA 1TWFJ 2WV1A 1JKPC 1LE8B 2DA2A 3Q3SA 3DEWA 2NS8A 2JN6A 2Y2ZA 5E3NA 1IJWC 4D5FA 3BG5A 2K9QA 1F43A 1JUPA 2TRTA 2ZB9A 3GTMJ 3BR0A 2CUFA 1JKOC 2ME0A 2K40A 4I76A 5FLVA 1X2MA 5F0HA 5M5XJ 4X1EA 3HOWJ 5EEAA 3S16J 1JUMA 1ETWA 5GP9A 2HXIA 1ETOA 3BR1A 9ANTA 4FCYA 1A6IA 2K9NA 3SDGA 3TW7A 4D7NA 4M3EA 1OCTC 1OCPA 1I3QJ 5F08A 4UUSB 4LOCA 3ZQLA 1WH7A 2IEKA 1JGGA 2R7ZJ 3S1NJ 5FKLA 2H1KA 1AHDP 4RBOA 1X2NA 5FKMA 5J1YA 4FE7A 5IOYA 1R9TJ 1RKTA 3JR9A 3HOXJ 1NK2P 4NDLA 2M34A 1SANA 3BTLA 1RESA 3GBGA 4MFDA 2EH3A 2LK2A 4B4CA 3OSFA 2VI6A 3JRAA 5C4XJ 3LSJA 2R5ZB 3H3VK 3IH4A 2E2HJ 1BJZA 1ZR2A 4CYCB 2JWTA 5FKNA 4A3BJ 2XPVA 1MBJA 1ZGWA 1WGXA 3CDLA 5BNGA 3JRIA 2LFBA 5K7ZA 3TP3A 1WCMJ 3ZOBA 4XRSG 2XPUA 3CQZJ 4IEJA 2MG4A 1FIAA 4M3DA 3VPRA 4A3LJ 5IYBJ 1MSEC 5E3MA 5DTDA 1B8IA 4ABZA 2L7MP 4W97A 1IDZA 2Y30A 1T56A 3S1RJ 3BTCA 2JJ7A 2E2IJ 1MH3A 1RPWA 2AHQA 2QF7A 4FE4A 3I4MJ 3Q0WA 2TCTA 4G12A 1TWCJ 4BXXJ 3JRCA 3HM5A 3LSGA 4RDUA 5EF6A 2WB1N 1GDTA 1FEXA 4L5EA 1D5YA 2CQXA 1K61A 1BA5A 3K7AJ 2WAQN 2R92J 1ETKA 4MIMA 1GT0C 5EZHA 2HOTA 4JX6A 1IUFA 5IP9J 1FTZA 5EGOB 1MBFA 3A01A 3C2BA 1Y1VJ 1ZTRA 1OJLA 2X48A 2DTZA 5J1UA 1AKHB 3BR3A 1WPKA 2KDZA 2L9RA 1FJLA 3ZQCA 1IC8A 1IG7A 4BBRJ 1AU7A 2ECCA 4XK4A 4AUXA 1MNMC 5C4JJ 3JRHA 3BQZA 2CRGA 3LSRA 2JMWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2R93 J;  4IHX A;  1YRN A;  2R0Q C;  2M8G X;  1S7E A;  3HEF A;  2E19 A;  3QPL A;  2RAE A;  2NOG A;  2XGC A;  2KT0 A;  2HOA A;  4QIW N;  1JJ8 C;  1HDP A;  3RKQ A;  1F36 A;  5GPC A;  5M3F J;  3TED A;  1ETQ A;  4V2G A;  2HYJ A;  4A3J J;  3G1O A;  5EDN A;  5E3O A;  1FTT A;  2MGQ A;  1TWH J;  1K83 J;  5E3L A;  2VPR A;  2DN0 A;  1VF9 A;  4IHY A;  1IGN A;  3S15 J;  3GTL J;  3PO3 J;  2Y0S N;  3RQI A;  1ORK A;  2O8K A;  1MBG A;  3O8H A;  1MBH A;  1Z0X A;  4A3K J;  5F0F A;  4IHV A;  2NVT J;  1NK3 P;  4IHW A;  3BT9 A;  1VND A;  4JP0 A;  2DA3 A;  3BG9 A;  1AKH A;  2DA6 A;  5HOD A;  1WI3 A;  2N8G A;  3E7L A;  2M9H A;  3S17 J;  4DZP A;  2G0E A;  1MSF C;  5FKK A;  2JA6 J;  4D7M A;  1LE8 A;  4A69 C;  2CQQ A;  1B72 B;  3I4N J;  4Y52 J;  1ITY A;  3GTP J;  5IP6 A;  5IPA A;  4B3A A;  3IV5 A;  4M3B A;  3RZD J;  2GLO A;  2FX0 A;  3HOV J;  2M0C A;  2VKE A;  3H0G J;  4FIS A;  4MFE A;  1ZQ3 P;  3HBL A;  3OSG A;  3GTO J;  1SFO J;  2K9S A;  1JJ6 C;  4BY1 J;  1H88 C;  3S14 J;  2ME6 A;  1RR7 A;  3FKI J;  5IP7 J;  3LSP A;  2XSD C;  1GVD A;  2XGE A;  2HDD A;  3IH3 A;  4JYK A;  3JRD A;  1ENH A;  1RKW A;  4C3I J;  3BG3 A;  3JRB A;  3HGG A;  4QSH A;  3OIO A;  2DMQ A;  2XRL A;  3BTJ A;  4AYB N;  1XS9 A;  4HNV A;  4A3M J;  2MSY A;  3ZQG A;  3BTI A;  1POG A;  3HB9 A;  4M3F A;  1VFC A;  4UUS A;  2VUM J;  3CCY A;  3L1P A;  3MVP A;  4Y7N J;  1U78 A;  3S2D J;  5M3M J;  5FLM J;  2L7F P;  2DMN A;  1GUU A;  2YS9 A;  2OPT A;  3G1M A;  2HXO A;  3FIW A;  2QCO A;  3IH2 A;  4C3H J;  5M5W J;  1CQT A;  3RZO J;  3GTJ J;  2HI3 A;  1GV2 A;  3UKG A;  3SFI A;  3GTK J;  3M3Y J;  2CJJ A;  1GV5 A;  2LY9 A;  3PO2 J;  5FKO A;  2LR8 A;  3HOU J;  1JKR C;  1PUF B;  3MN2 A;  1APL C;  2ECB A;  1ZKG A;  2R5Z A;  2Y9Z A;  2LTP A;  2ELK A;  4B1R A;  3G1L A;  2EZH A;  1E3O C;  5IOZ A;  3ZQH A;  4CYC A;  2FD5 A;  3B6A A;  3S1Q J;  1MH4 A;  2Y31 A;  5K7F A;  3HOZ J;  1NTC A;  1XC5 A;  2LVS A;  3NAR A;  1QVT A;  5F04 A;  2AO9 A;  4UUT A;  3GTG J;  2EQR A;  2LLK A;  1ETY A;  5J1R A;  2W48 A;  3LOC A;  5EG0 B;  2LKX A;  2O9L A;  1VI0 A;  1P7J A;  2DA1 A;  3PM1 A;  2YU9 J;  3WHC A;  5F27 A;  3BR6 A;  3BQY A;  1IDY A;  5JLX A;  2P81 A;  1TC3 C;  2GBY A;  1UG2 A;  2DMP A;  3A03 A;  2VKV A;  1Y1W J;  1ETV A;  1LFU P;  1LFB A;  2JA5 J;  4A3E J;  1T33 A;  1DU0 A;  2YUS A;  2OF7 A;  3FK6 A;  5IYC J;  1JT6 A;  1OFC X;  3JRE A;  4D5C A;  2MW8 A;  5FJ8 J;  2NVX J;  1DU6 A;  3F0C A;  3Q0V A;  4JX4 A;  1TWA J;  2JK3 A;  2ID6 A;  2ID3 A;  2L7Z A;  2COB A;  2PMZ N;  5EGO A;  2R5Y B;  1PUF A;  2DJN A;  2FQ4 A;  3JRG A;  4JX5 A;  1MBE A;  1QRY A;  1HLV A;  1B8I B;  2I10 A;  3ZQF A;  3FIS A;  4QTR A;  1JUS A;  5F0C A;  3TW6 A;  1U8B A;  1I6H J;  2L0K A;  5JLW A;  5GPA A;  2NVQ J;  3S1M J;  1JTX A;  3Q0U A;  4I6Z A;  1JT0 A;  2EZL A;  5C3E J;  2CU7 A;  2LD5 A;  1W0U A;  4V2F A;  4XID A;  3CMY A;  2LP0 A;  5K7H A;  1HDD C;  2IAI A;  4GFB A;  1EF4 A;  3BR2 A;  4W1U A;  2XPW A;  5M5Y J;  1JKQ C;  1HOM A;  5EG0 A;  3M4O J;  4S0H B;  3ZQI A;  2GM4 A;  4DYC A;  3WHB A;  1JTY A;  3S2H J;  1BL0 A;  4DYR A;  4C2M J;  1UMQ A;  3DCF A;  3QPS A;  3A01 B;  1H89 C;  3K2A A;  3TP0 A;  1Q1V A;  5C44 J;  4FTH A;  1G2H A;  2X6O A;  2O7O A;  2EZK A;  2Y9Y A;  5EZG A;  1TWG J;  2IBD A;  1H8A C;  2DMT A;  3OOU A;  1IV6 A;  2HQ5 A;  1ETX A;  2FJ1 A;  2DA7 A;  4A3I J;  1W0T A;  4BBS J;  1Z77 A;  3B6C A;  3HKZ N;  4DZJ A;  1BW5 A;  2HOS A;  1P7I A;  3NAU A;  2XGD A;  4DW6 A;  2DA4 A;  2E1O A;  1YRN B;  1QPI A;  2DA5 A;  2EBI A;  1IRZ A;  5J3L A;  2R5Y A;  2JA8 J;  1MBK A;  2XB0 X;  4BKX A;  3A02 A;  1QVU A;  1RET A;  3W6V A;  4MLO A;  4X6A J;  4DYQ A;  2E2J J;  1HCR A;  4M6V A;  4EEF G;  1B72 A;  4A93 J;  4XRM A;  1U9O A;  3O8G A;  1XG1 A;  5IYD J;  1HF0 A;  1BW6 A;  2H8R A;  3FK7 A;  4A3C J;  2NVY J;  1X58 A;  2DMU A;  2D5V A;  4AC0 A;  1UHS A;  2CUE A;  3SJM A;  2JA7 J;  2M2E A;  1ZR4 A;  2XB5 A;  2NS7 A;  4C3J J;  3HOY J;  5F1J A;  1A5J A;  2X9D A;  1ZK8 A;  3BR5 A;  3MKL A;  4M3G A;  4A3D J;  4BY7 J;  2B63 J;  5DS9 A;  4A3G J;  2EZI A;  3HGY A;  1I50 J;  3HDD A;  5EYR A;  3JRF A;  4A3F J;  4XIC A;  1WH5 A;  3D1N I;  4J19 A;  3GTQ J;  4XRS A;  1O4X A;  4MO7 A;  3LNQ A;  3QQA A;  1FIP A;  1U9N A;  1TWF J;  2WV1 A;  1JKP C;  1LE8 B;  2DA2 A;  3Q3S A;  3DEW A;  2NS8 A;  2JN6 A;  2Y2Z A;  5E3N A;  1IJW C;  4D5F A;  3BG5 A;  2K9Q A;  1F43 A;  1JUP A;  2TRT A;  2ZB9 A;  3GTM J;  3BR0 A;  2CUF A;  1JKO C;  2ME0 A;  2K40 A;  4I76 A;  5FLV A;  1X2M A;  5F0H A;  5M5X J;  4X1E A;  3HOW J;  5EEA A;  3S16 J;  1JUM A;  1ETW A;  5GP9 A;  2HXI A;  1ETO A;  3BR1 A;  9ANT A;  4FCY A;  1A6I A;  2K9N A;  3SDG A;  3TW7 A;  4D7N A;  4M3E A;  1OCT C;  1OCP A;  1I3Q J;  5F08 A;  4UUS B;  4LOC A;  3ZQL A;  1WH7 A;  2IEK A;  1JGG A;  2R7Z J;  3S1N J;  5FKL A;  2H1K A;  1AHD P;  4RBO A;  1X2N A;  5FKM A;  5J1Y A;  4FE7 A;  5IOY A;  1R9T J;  1RKT A;  3JR9 A;  3HOX J;  1NK2 P;  4NDL A;  2M34 A;  1SAN A;  3BTL A;  1RES A;  3GBG A;  4MFD A;  2EH3 A;  2LK2 A;  4B4C A;  3OSF A;  2VI6 A;  3JRA A;  5C4X J;  3LSJ A;  2R5Z B;  3H3V K;  3IH4 A;  2E2H J;  1BJZ A;  1ZR2 A;  4CYC B;  2JWT A;  5FKN A;  4A3B J;  2XPV A;  1MBJ A;  1ZGW A;  1WGX A;  3CDL A;  5BNG A;  3JRI A;  2LFB A;  5K7Z A;  3TP3 A;  1WCM J;  3ZOB A;  4XRS G;  2XPU A;  3CQZ J;  4IEJ A;  2MG4 A;  1FIA A;  4M3D A;  3VPR A;  4A3L J;  5IYB J;  1MSE C;  5E3M A;  5DTD A;  1B8I A;  4ABZ A;  2L7M P;  4W97 A;  1IDZ A;  2Y30 A;  1T56 A;  3S1R J;  3BTC A;  2JJ7 A;  2E2I J;  1MH3 A;  1RPW A;  2AHQ A;  2QF7 A;  4FE4 A;  3I4M J;  3Q0W A;  2TCT A;  4G12 A;  1TWC J;  4BXX J;  3JRC A;  3HM5 A;  3LSG A;  4RDU A;  5EF6 A;  2WB1 N;  1GDT A;  1FEX A;  4L5E A;  1D5Y A;  2CQX A;  1K61 A;  1BA5 A;  3K7A J;  2WAQ N;  2R92 J;  1ETK A;  4MIM A;  1GT0 C;  5EZH A;  2HOT A;  4JX6 A;  1IUF A;  5IP9 J;  1FTZ A;  5EGO B;  1MBF A;  3A01 A;  3C2B A;  1Y1V J;  1ZTR A;  1OJL A;  2X48 A;  2DTZ A;  5J1U A;  1AKH B;  3BR3 A;  1WPK A;  2KDZ A;  2L9R A;  1FJL A;  3ZQC A;  1IC8 A;  1IG7 A;  4BBR J;  1AU7 A;  2ECC A;  4XK4 A;  4AUX A;  1MNM C;  5C4J J;  3JRH A;  3BQZ A;  2CRG A;  3LSR A;  2JMW A; 
#chains in the Genus database with same CATH topology
 2R93 J;  3BG6 A;  1YRN A;  4P9F A;  4F93 B;  4LIV A;  4IHX A;  3PQJ A;  3GME A;  1O3R A;  3HEF A;  1VQ8 I;  2IP2 A;  5HS8 A;  1U2W A;  5H6R A;  1TW2 A;  2DDB A;  1H0M A;  4BQQ A;  1MJB A;  2ZJ2 A;  3ZMD A;  3ZPL A;  5GPC A;  4P1W A;  3HRT A;  2HQN A;  4QPO A;  4IX7 A;  3KP4 A;  4C30 A;  5EEH A;  1N25 A;  2HYJ A;  4A3J J;  1PYV A;  5E3O A;  5FRN A;  1FTT A;  1DP3 A;  2AXL A;  5FO5 A;  4F7Z A;  1DQU A;  4RGR A;  4ZYG A;  1LDJ A;  4IHY A;  1IGN A;  4A6D A;  4BHC A;  5GAH J;  2Y0S N;  3K4L A;  3ECO A;  4BUP A;  1HXD A;  3LL7 A;  5F0F A;  5KNL A;  1YOV B;  4ZDP A;  2CWE A;  5K5Q A;  4HNU A;  4IHT A;  2JVH A;  2A5Y B;  3LAP A;  4ITV A;  3BG9 A;  3FXO A;  2VXD A;  5CLS A;  1S29 A;  1YJ9 I;  2DA6 A;  1FPQ A;  1WI3 A;  2J5P A;  3S17 J;  4DZP A;  2CFO A;  1XB4 A;  1Z6T A;  4F3Q A;  1MSF C;  4KIG A;  3EYI A;  3GXO A;  3I0T A;  2DOA A;  1WJE A;  1Z7U A;  3GTP J;  5ICF A;  3BJ6 A;  3KP3 A;  2XAQ A;  3IV5 A;  3KET A;  3RZD J;  3S8P A;  2V1N A;  2YU3 A;  3G3Z A;  4FT8 A;  3H0G J;  1R4M B;  4P96 A;  2P5L C;  4F92 B;  4MTD A;  1JJ6 C;  3OYB A;  2HR3 A;  1RR7 A;  3FKI J;  1J7K A;  4XLC A;  3BG3 A;  3FBI B;  3JRB A;  4PFP A;  3B02 A;  1E3H A;  3K70 C;  1XGM A;  2NRA C;  4BNC A;  3OIO A;  2XRL A;  3BTJ A;  3V8K A;  1XS9 A;  4A3M J;  3BTI A;  1K79 A;  4M3F A;  1VFC A;  3HOT A;  3KEQ A;  2IXS A;  4UUS A;  3M1E A;  1KQ9 A;  5D6F A;  1BOB A;  2C6Y A;  2ISZ A;  3KLO A;  1BI1 A;  1Y0U A;  4M72 A;  3E6B A;  3MVP A;  4Y7N J;  3S2D J;  3J80 K;  2ZJP F;  5FLM J;  1WJF A;  2FBI A;  5JVT A;  4IZZ A;  2P0W A;  2AQE A;  3IH2 A;  1BJA A;  4C3H J;  3CO7 C;  1CQT A;  2HI3 A;  3ONQ A;  5DUI A;  3SYT A;  3LFU A;  2IS6 A;  5FKO A;  1A35 A;  4XLH A;  1JKR C;  1B1B A;  3PUB A;  2L4M A;  3GW2 A;  3EET A;  2J5O A;  3EUK L;  4PCQ A;  4XMY A;  3B6A A;  4HRI A;  3RI4 A;  4LIT A;  1XTA A;  2LVS A;  3CC2 I;  3NAR A;  4BDZ A;  4UUT A;  4XM3 A;  4E70 A;  5BS6 A;  1VQN I;  1Z7L A;  2EQR A;  1VQK I;  2LLK A;  5J1R A;  1A04 A;  3LOC A;  2PEX A;  2CUJ A;  2W84 A;  1MMS A;  2WY7 Q;  1P7J A;  5TIS C;  2CV2 A;  4ASN A;  4XL9 A;  3WHC A;  2HKX A;  1LQ1 A;  3P9I A;  2X0L A;  4DOZ A;  2LY1 A;  2VT2 A;  2M30 A;  1WJB A;  2IS4 A;  1X3Z B;  2G9W A;  1QA6 A;  4OMZ A;  3QRF F;  4MEY F;  2Q2E B;  1K78 A;  2DOF A;  2DYS H;  1UG2 A;  1ZHF A;  2L2O A;  4BU2 A;  1VQ9 I;  1QNT A;  4WXH A;  3WTS C;  2QVO A;  3F8F A;  1FOW A;  4QWQ A;  1W7P D;  5ED4 A;  1WI9 A;  4EM2 A;  1LFU P;  1X3U A;  2JTV A;  4JOM A;  1T33 A;  5HS7 A;  4Y13 A;  4IL6 C;  4MQV A;  3ABM H;  2O03 A;  2X1C A;  2M8E A;  1JT6 A;  3JRE A;  2EFP A;  4AWX B;  2OCE A;  4D5C A;  1QHH D;  2BVM A;  3J81 K;  3QP5 A;  2WC2 A;  2NVX J;  1BR1 A;  1MZB A;  3Q0V A;  1DU6 A;  4JX4 A;  1QZY A;  2YSR A;  4YEJ A;  3PNV A;  2JK3 A;  2CW7 A;  2RVC A;  2ID3 A;  2COB A;  2YPR A;  2R5Y B;  2ZCW A;  2FQ3 A;  3DTK A;  1X1P A;  2DJN A;  2FQ4 A;  2PFB A;  1K4T A;  2CUZ A;  3E5Q A;  1HLV A;  5BPI A;  2JSP A;  3FXQ A;  5EEG A;  4QTR A;  3BRO A;  3TQN A;  2KRC A;  2JT1 A;  1SD6 A;  2VQH A;  2RN7 A;  3IHU A;  2FRH A;  2L0K A;  1SMY F;  3NEU A;  1D0Y A;  5IT9 Z;  3HL2 A;  3VOD A;  4CCL A;  2EIK H;  4S05 A;  2XV4 S;  3CMY A;  5DDG A;  3M8J A;  1HOM A;  3OS2 A;  3G6E I;  2XUB A;  2V9P A;  2COM A;  5B3S H;  2E5N A;  3H5R A;  3W6K B;  2R7X A;  1V54 H;  2UV1 A;  4HF0 A;  4FQG A;  5IT9 K;  3RKX A;  4ZDO A;  2Z1D A;  2G7U A;  5LGN A;  1SFK A;  1MJ9 A;  1BI0 A;  5L3G A;  1B6A A;  2Q2E A;  5C44 J;  5J6X A;  1S72 I;  2JPB A;  3OYA A;  4FAS D;  1H8A C;  4HW0 A;  5AIQ A;  2DMT A;  2FF4 A;  4PSX A;  1I3A A;  1FP2 A;  1ON1 A;  2LF7 A;  2DA7 A;  3PUF A;  4B48 A;  2OQG A;  1UZC A;  1I39 A;  4DZJ A;  1A6Q A;  1BW5 A;  2OA4 A;  1IRF A;  1TP4 A;  1S9H A;  3LMM A;  3TO9 A;  1DGR M;  2DA5 A;  5F1R A;  1P9Q C;  1O7L A;  2X6W A;  4QPQ A;  3DBR B;  2R5Y A;  2GQQ A;  2VE8 A;  1BI3 A;  4ZC3 A;  4BQN A;  3VWB A;  1MBK A;  4Q4Z F;  3ZN1 A;  4KNY A;  3FM3 A;  4KA4 A;  2HPI A;  4IRG A;  3K6G A;  4L9N A;  5HS9 A;  2K4J A;  3CCV I;  3I4P A;  3BOQ A;  4HPQ A;  2DO7 A;  4XRM A;  1U9O A;  1XG1 A;  5IYD J;  4A12 A;  4IPA A;  4KIS A;  4EV0 A;  5LLQ A;  4XRF A;  4I2O A;  5L3B A;  4A3C J;  3F8N A;  4FX4 A;  3MD2 A;  2HOE A;  4RLF A;  1IZ1 A;  1ZG3 A;  2CUE A;  4BHB A;  3HIF A;  1PP7 U;  5HVQ C;  2XB5 A;  2NS7 A;  2BW3 B;  2I5U A;  3L7W A;  4LGW A;  4KN7 X;  1EJ9 A;  4X0G A;  2KJC A;  3CP2 A;  1BIA A;  1LUJ B;  3QWL A;  2EB7 A;  2X9D A;  1ZK8 A;  3IKV A;  5DS9 A;  3CUO A;  4A3G J;  3GVA A;  4LJZ F;  3HDD A;  3JRF A;  4YRV A;  4FET A;  3DQV C;  3WG9 A;  3K1N A;  4XRS A;  4MO7 A;  2HZT A;  3E5U A;  2QQ9 A;  1HQC A;  1U9N A;  2K3P A;  1USS A;  2L9S A;  5GTI C;  4XN3 A;  4I0A A;  2OTL I;  2DA2 A;  3ZN0 A;  2QUF A;  2DOD A;  2EV6 A;  3CLQ A;  4H4K C;  2FEZ A;  1IRG A;  3ISP A;  2F2E A;  2NS8 A;  3H9G A;  4AVZ A;  2K5C A;  2GAU A;  3C7J A;  2CS3 A;  3BG5 A;  3CDI A;  2HVQ A;  2Y48 A;  2FOK A;  4IOA F;  4AD9 A;  2BOL A;  3JSO A;  2FU4 A;  1JKO C;  1T95 A;  1Z1D A;  5TJJ A;  4QLC U;  4V19 K;  3HOW J;  1S5L C;  1ETW A;  2D1V A;  3FXL A;  4RGU A;  3CDH A;  2Z3Y A;  4G7H F;  3CME I;  2M0M A;  3H3U A;  2CW8 A;  3SDG A;  1XSV A;  4BJ5 C;  4AIK A;  2NOJ B;  2VOD A;  1ULY A;  3QYB A;  2P8T A;  2W57 A;  4LOC A;  4HLX A;  4UB8 C;  1YIO A;  4BGD A;  2HS5 A;  3DKY A;  3K2Z A;  4I98 B;  3S1N J;  5J1Y A;  2R7Q A;  2NAZ A;  1YIJ I;  3CCJ I;  4OU0 A;  1KU3 A;  4NB5 A;  3QYF A;  1OR7 C;  2JRT A;  2K86 A;  2DCE A;  1B9M A;  3BTL A;  3GBG A;  4DGW B;  4J01 A;  3SQN A;  4RB2 C;  4MFD A;  1OPC A;  3HSR A;  2EH3 A;  2VC1 A;  1G59 A;  4FHT A;  2V9K A;  3OSF A;  3CCS I;  2ZFW A;  5D5U B;  4L9T A;  2RKH A;  1J59 A;  2X85 A;  2CH0 A;  4PK4 A;  3I56 I;  4NBQ A;  3K70 D;  2R5Z B;  4C2U A;  3TOB A;  1BJZ A;  1MMA A;  3CTA A;  4HG2 A;  3KZI C;  3GX4 X;  3IAM 2;  2HQA A;  1YI2 I;  4PJJ A;  1HBX G;  3GFJ A;  1MJA A;  3G73 A;  2PJR A;  1U5T C;  3FWE A;  3OYF A;  4KT6 A;  3CF2 A;  1ZGW A;  3QU3 A;  2BV6 A;  3ERM A;  3JRI A;  4OIO F;  2KIM A;  5BMZ A;  3FXK A;  3HTU A;  1TT0 A;  2DTR A;  3R0J A;  2ZSI B;  3ABU A;  3EDP A;  3CMM A;  3ZXS A;  3WGG A;  2EFQ A;  4IEJ A;  1EH8 A;  5HOO A;  1SVL A;  2W00 A;  5IYB J;  4ZYD A;  3LAJ A;  2F4I A;  3CES A;  4CXF A;  4ABZ A;  4IKF A;  3C3W A;  5D5V B;  3F8M A;  3BTC A;  2DFI A;  4OIQ F;  2X4H A;  2DU9 A;  1PP8 F;  1ZGJ A;  2AHQ A;  3V8J A;  4XN0 A;  2CFX A;  3TL4 X;  2DI3 A;  1EH6 A;  3K69 A;  4MNU A;  3Q0W A;  4KIT B;  1TWC J;  4BXX J;  4KMU X;  3E6D A;  1BIB A;  2ZNY A;  3QYE A;  3RYP A;  2D45 A;  2LKS A;  1WJ5 A;  3H5A A;  1LVA A;  2KKO A;  2X6Y A;  4Y17 A;  5JR3 A;  2VL8 A;  3K7A J;  1D1A A;  3VYU B;  2KHM A;  4A0X A;  2VJ5 A;  5EZH A;  4ZYH A;  2H6C A;  1PDN C;  2NXN B;  1IUF A;  3ESW B;  3JAM Z;  3A2K A;  1IO2 A;  2E1N A;  1MBF A;  4S04 A;  1P4A A;  3HC7 A;  4PSW A;  3C2B A;  4DQ2 A;  4PJM A;  1AKH B;  5J1U A;  1MMN A;  1AU7 A;  3S32 A;  2ZNZ A;  4XK4 A;  5D6E A;  3JAM K;  2PMZ A;  1FY7 A;  5CVI A;  3JRH A;  3PNT A;  1TT5 B;  1FOK A;  3QOE A;  1YO5 C;  5E1W A;  2O61 A;  1MGT A;  2R7R A;  2RDP A;  3HHG A;  3LSR A;  5FFZ A;  3FXJ A;  2R0Q C;  2ZXH A;  3OV8 A;  2V4J C;  3AFH A;  2ELJ A;  2E19 A;  4XON A;  2IT0 A;  4H0E A;  3LA2 A;  3K1P A;  4HEA 2;  4QIW N;  1Y39 A;  1HDP A;  3RKQ A;  2ZFU A;  2HQR A;  4PGH A;  3LQQ A;  1WJA A;  2A6T A;  1ETQ A;  4V2G A;  2QM3 A;  4A5M A;  2OUM A;  3L2W A;  3R6S A;  3T1B A;  4G8X A;  2V26 A;  5DCM A;  1LVK A;  4E7S A;  3LSM A;  2K9L A;  1AWC A;  2DN0 A;  1VF9 A;  2BBY A;  3GTL J;  3KP7 A;  3IL2 A;  3BPV A;  2W82 A;  1FBQ A;  3GLL A;  1FZP B;  2HKO A;  5JFR A;  4A3K J;  4CSW A;  2CW0 F;  4IHV A;  2Z2S B;  4KDP A;  3MCZ A;  3BT9 A;  4HOB A;  2DJI A;  3W6J B;  2ZO4 A;  1W5T A;  1AKH A;  2XKP A;  4A5N A;  4A6E A;  2GA2 A;  3BP8 A;  4XLE A;  4XQF A;  3K4J A;  4C2T A;  3HUG A;  1OKR A;  5HLT A;  3E7L A;  2YR2 A;  5FKK A;  3BZC A;  5LEK A;  4D7M A;  2H27 A;  2V79 A;  3R4K A;  4Y52 J;  4UHT A;  3T5X A;  1LDD A;  2DXI A;  4Y3O A;  5C4X J;  5LGU A;  3K4C A;  3DBL B;  1ZRE A;  1A31 A;  5DEQ A;  2FX0 A;  2VN2 A;  5CVU A;  3KZY A;  1TL8 A;  4BEH B;  1ZQ3 P;  2M4K A;  1IN8 A;  3CF5 F;  2GOM A;  3OYK A;  3ABL H;  2QSH X;  2XC7 A;  1FLI A;  2DK8 A;  4UVB A;  3CC4 I;  1T98 A;  2QLZ A;  1REP C;  2ME6 A;  5IP7 J;  1R00 A;  3OYE A;  2HDD A;  1GVD A;  2XGE A;  4WX9 A;  3FXR A;  4I02 A;  3IH3 A;  1J0R A;  4LLG F;  4UB6 C;  3IP4 B;  1KA8 A;  4JYK A;  3JRD A;  4C3I J;  1WZ2 A;  4D0P A;  3HGG A;  2ZME A;  2IA2 A;  1OCC H;  1JI8 A;  2GXB A;  5HNH A;  1POG A;  3K4N A;  4AIH A;  3NWT A;  4PUS A;  2JVG A;  2IS1 A;  1VZ0 A;  3CCY A;  4HV5 A;  2VUM J;  4ZZL A;  3PL8 A;  4LD5 A;  1Q1H A;  3TDU C;  4JBA A;  2DMN A;  3GZN B;  1YS6 A;  4G9Y A;  3EPZ A;  1W5S A;  2E1C A;  3G1M A;  2VKD A;  2HXO A;  1ZGA A;  2KL4 A;  1V3F A;  3H5N A;  3S2W A;  3G71 I;  5M5W J;  1ZLK A;  4M9X A;  1FWZ A;  5DCF A;  3PFY A;  2CJJ A;  4UNO A;  2DFF A;  3DF8 A;  2L9N A;  3WTX C;  5B1A H;  3H3V K;  2ZXJ A;  3HHH A;  5D4S A;  4KIB A;  4WXD A;  5H20 A;  2QEX I;  1APL C;  3ELK A;  4IXA A;  3S3M A;  2IRF G;  4B1R A;  3G1L A;  1NG7 A;  3TGN A;  2EIJ H;  2A68 F;  2ZKZ A;  2FNP A;  2QSG X;  3HPG A;  1ZRC A;  2EJR A;  2XRN A;  3HPH A;  4HQE A;  1XC5 A;  1D0X A;  2EWN A;  2GIV A;  3M1C A;  2OJE D;  3CJN A;  2ESH A;  4BL0 B;  4U7B A;  3BCA A;  1XPX A;  5J47 A;  2LMD A;  3C1D A;  3FMR A;  2KP6 A;  2X6X A;  5B1B H;  2LKX A;  4ZDL A;  1VI0 A;  2M7A A;  2DA1 A;  4Y4R A;  3BR6 A;  1WVR A;  3W2V A;  3BQY A;  2Z33 A;  3MQ0 A;  1IDY A;  5JLX A;  1Z67 A;  2P81 A;  2LBF B;  5HDK A;  3JW4 A;  1TC3 C;  1VQ7 I;  3IAS 2;  1XMK A;  1FOY A;  4Z6Y A;  3CCR I;  4GCV A;  2GBY A;  1CF7 B;  2IS2 A;  3K10 A;  2DMP A;  3CCQ I;  1F9N A;  5BQT A;  2VKV A;  1Y1W J;  1UJ8 A;  3I71 A;  1BN5 A;  2Q0O A;  3NRV A;  2ISY A;  3FK6 A;  3RQ4 A;  3K0L A;  1DPU A;  1U0J A;  2MW8 A;  5LRS A;  1S8N A;  4OAY A;  5FJ8 J;  3F0C A;  1EKE A;  2ID6 A;  4N9I A;  1J09 A;  3WOD F;  2L7Z A;  3E3V A;  2PMZ N;  5L3C A;  1UFM A;  1W7P A;  3KP2 A;  3LSI A;  3F8C A;  3JRG A;  3RJP A;  2I10 A;  4CO8 A;  3ML6 A;  3OL3 A;  3ZR8 X;  2DW4 A;  2VQC A;  3TW6 A;  1U8B A;  4EJW A;  3F3X A;  2CV1 A;  1I6H J;  1P4W A;  5GPA A;  1QZZ A;  3KZZ A;  3TOA A;  1JTX A;  2XF5 A;  4DJA A;  4PDK A;  5C3E J;  3E5X A;  2ACJ A;  1Y8Q B;  2LD5 A;  4V2F A;  1QHG A;  4XID A;  2F5V A;  2LP0 A;  5GAG J;  2IAI A;  3LQR A;  2XPW A;  1JKQ C;  2UZK A;  5FD5 A;  4RMN A;  1K7A A;  4DYC A;  1BC8 C;  3WHB A;  3KP5 A;  1R1V A;  1K6O A;  2FMY A;  1BL0 A;  5AIP A;  5ICE A;  1BC7 C;  2PLY A;  4DYR A;  2CSO A;  4Q5S F;  1ODD A;  3DCF A;  1H89 C;  3H0D A;  1YG2 A;  3BC8 A;  2HYG D;  3OR2 C;  5FGM A;  1M1E B;  1R5H A;  4FTH A;  1G2H A;  2M5W A;  2QQ8 A;  4J00 A;  2B9S A;  3GFM A;  1SEU A;  1S7A A;  5IY5 H;  3OOU A;  1T39 A;  3U2R A;  4BXU A;  4I99 C;  2X1D A;  5B5E C;  1ETX A;  2FJ1 A;  2E60 A;  4RGS A;  1IAW A;  4BBS J;  3B6C A;  3I55 I;  1P7I A;  2F4M B;  3NAU A;  1ZG1 A;  1D8J A;  1FBS A;  2LKP A;  3H92 A;  3JTG A;  2EBI A;  2CO5 A;  2GOX B;  3Q9V A;  2BEO A;  1IRZ A;  1TNT A;  4RB0 A;  3CC7 I;  3CJQ B;  3BY6 A;  4AID A;  2XB0 X;  3A02 A;  1QVU A;  2BE5 F;  1WKM A;  3Q5F A;  4MGR A;  1P92 A;  4U7D A;  2D1H A;  1S3J A;  5BOX A;  2E2J J;  3MFK A;  1HCR A;  4ESB A;  3DBH B;  4XKW A;  3SZP A;  4M6V A;  4A93 J;  5L3F A;  1UB9 A;  3SEQ A;  3W2W A;  2RV8 A;  2M45 A;  5FD6 A;  1G4D A;  1IRX A;  2WV0 A;  3FK7 A;  3I58 A;  1W1W E;  1X58 A;  2FSW A;  2D5V A;  2OTJ I;  4AM3 A;  2H09 A;  1UHS A;  4E7Z A;  4Z2Y A;  2V9V A;  2F5E A;  3OL4 A;  3SJM A;  2M2E A;  2JA7 J;  1ZR4 A;  1TQM A;  1TBX A;  4AVP A;  4C3J J;  3MZH A;  3L2V A;  3I59 B;  5F1J A;  4I01 A;  4A0Z A;  2JQ7 A;  1J2X A;  2L54 A;  3LWF A;  4Q48 A;  5DYM A;  4BY7 J;  3PQK A;  2EZI A;  1I50 J;  2CGP A;  4A3F J;  4YFX F;  3WU0 A;  1H9G A;  2WA0 A;  4II2 A;  2DFE A;  1O4X A;  3LNQ A;  4ANJ A;  1MNE A;  1FIP A;  2LC2 A;  1JKP C;  2WV1 A;  1UHM A;  2HTJ A;  2IA1 A;  1LE8 B;  1RUN A;  2K85 A;  3KEO A;  3OIQ A;  4YEL A;  3FKJ A;  1OMI A;  4ZTF A;  2JN6 A;  1GXP A;  4L0Y B;  3D0S A;  3DU6 A;  3ZGK A;  3QPT A;  1IJW C;  1EH7 A;  1NG6 A;  2WBM A;  4HDV A;  1JUP A;  2QKM B;  2BY0 A;  3V8L A;  3PSI A;  3GTM J;  4RA2 A;  1FMW A;  4ZYA A;  4BAY A;  3J7A Y;  4L9J A;  1IN4 A;  4DBR A;  1O57 A;  2HDW A;  3Q9S A;  1ZAR A;  1JUM A;  1QGP A;  2XF7 A;  5D4R A;  5ICC A;  5LGT A;  1AA7 A;  5KCM A;  3F8B A;  3CP8 A;  1B59 A;  1D1B A;  4RAZ A;  3TW7 A;  2X1E A;  5CVJ A;  3RPQ A;  5HLI A;  5FFX A;  1A36 A;  1G3S A;  4OIR F;  5F08 A;  3AG3 H;  1WH7 A;  2KIQ A;  1JGG A;  2R7Z J;  3DKX A;  1G6N A;  4AYB A;  4LLL A;  3KEY A;  5FKL A;  3HSE A;  4KT5 C;  2H1K A;  4YII A;  1AHD P;  2LH9 A;  3GLX A;  3GZ6 A;  4FE7 A;  3AL0 C;  1RKT A;  3JR9 A;  4LG0 B;  3RPU D;  3WTW C;  1NK2 P;  4NDL A;  2W7N A;  3I5U A;  1RES A;  1R36 A;  4MHG A;  2R3S A;  2HWV A;  3OYJ A;  3U1D A;  2H1L A;  1RNL A;  3MKY B;  2VQL A;  2LK2 A;  2W25 A;  3VSL A;  2RNG A;  1KQ8 A;  2VI6 A;  3IWF A;  2H8W A;  2XVC A;  4AIJ A;  3IH4 A;  2NYX A;  4RAF A;  5KHD A;  1KON A;  2F5F A;  4F55 A;  4EJT A;  2E7W A;  1R5G A;  4CYC B;  2UWM A;  2JPC A;  1BM9 A;  2VB6 A;  2EFN A;  5CVR A;  1H9T A;  1R22 A;  3BCB A;  3U1K A;  4O6J A;  3LA3 A;  1G3T A;  2P7C B;  4JQF A;  1TZL A;  3TP3 A;  1WCM J;  4HF2 A;  2MG4 A;  3C18 A;  2E36 A;  3GFL A;  1HST A;  1FYM A;  3VPR A;  2EV0 A;  5KAI C;  4GGG A;  5LRR A;  3F21 A;  5DTD A;  2OU2 A;  1E3P A;  4KIF A;  3SHF A;  4HZF A;  4W97 A;  1T56 A;  2KZV A;  4Y33 A;  1KGS A;  1X1C A;  2VBZ A;  3P9K A;  1YX3 A;  2E2I J;  2HFH A;  1MH3 A;  2R7T A;  5JVG F;  2XDV A;  5J4Y A;  2DLL A;  2MH9 A;  4G12 A;  3IC7 A;  2GXG A;  1MIJ A;  2IGN A;  1ONV A;  4PZJ A;  2BZT A;  2FUG 2;  4ESJ A;  1LNW A;  1GXQ A;  3LSG A;  1MW7 A;  4RDU A;  5EF6 A;  2ZC2 A;  2VBY A;  3A0H C;  1YIT I;  1D5Y A;  2CQX A;  4CH7 A;  4IQJ A;  1W36 D;  2IGO A;  4MIM A;  4U0V A;  3K1M A;  1TQI A;  4G6Q A;  5LFA A;  4JX6 A;  3GFI A;  1P4X A;  2VLA A;  4OOI A;  5EGO B;  3FZV A;  2QZ8 A;  1Y1V J;  4CCM A;  1OJL A;  1XCV A;  1Z21 A;  4XSX F;  3BR3 A;  3T8R A;  1FJL A;  2L9R A;  5DD8 A;  4KJZ A;  4EGY A;  4BBR J;  4ESF A;  5J8F A;  5C4J J;  2HVR A;  3HSF A;  4NQW B;  3OS1 A;  3TMO A;  1HKQ A;  4XLF A;  2O3F A;  3OYI A;  4R1H A;  3I54 A;  4BE2 A;  5CYV A;  3E97 A;  3BLY A;  2BYV E;  2M8G X;  3ASO H;  2BVL A;  2KRF A;  2B0L A;  2JRM A;  3QPL A;  2RAE A;  2XGC A;  2LNB A;  5A2Q Z;  3CCE I;  1LDK B;  1RZ4 A;  2AQF A;  2DBB A;  3T0Y A;  1D5V A;  2HGC A;  2P5V A;  2ZXI A;  1F36 A;  3V4G A;  5GAD J;  3TBI A;  4M6Y A;  5E1X A;  5M3F J;  2RNJ A;  3TED A;  2EA4 A;  5A2Q K;  3G1O A;  4XKV A;  1S7O A;  5JHF A;  1W5C C;  2MGQ A;  3FHN A;  5K5R A;  1XSD A;  4GDF A;  3CCU I;  2VPR A;  1FYK A;  3S15 J;  3U9G A;  1ZN2 A;  3H1C A;  3BWG A;  1T0F A;  3W2A A;  2Q1Z B;  3DEU A;  2XKO A;  2BW3 A;  1ORK A;  1FBU A;  2CQK A;  2H94 A;  1MBG A;  2PQ8 A;  2CG4 A;  1Z0X A;  3O8H A;  3ULQ B;  4F52 A;  3OYM A;  1VQ6 I;  4P55 A;  2XF6 A;  1NK3 P;  2VPL A;  1VND A;  5E17 F;  2KIF A;  3HKZ A;  2DPU A;  5HOD A;  1UST A;  2M9H A;  4NC7 A;  2G0E A;  2OQR A;  3GUD A;  1R1U A;  4NQW A;  4HST A;  3TKY A;  1B72 B;  2DT5 A;  3I4N J;  1ITY A;  5L3D A;  1B4A A;  5K5O A;  1IW7 F;  5IPA A;  4BH9 A;  2LOO A;  2Y69 H;  4B3A A;  1YJW I;  4M3B A;  1J75 A;  2GLO A;  1Z6R A;  1IN5 A;  3HOV J;  1KU2 A;  2KDO A;  3OOP A;  4FIS A;  4HSR A;  2CQN A;  3OSG A;  1Z3X A;  3EUH A;  1SFO J;  4BY1 J;  1P2F A;  2I8D A;  3WGH A;  3S14 J;  2RQP A;  2A05 A;  3LSP A;  1YQA A;  1R58 A;  3L00 A;  4KN4 X;  1RKW A;  2MD0 A;  2R7V A;  2FOW A;  3V42 A;  4BHP A;  1FMV A;  3OYH A;  1UHW A;  3A1Y A;  2VE9 A;  4XOP A;  1LFP A;  1TTY A;  4AYB N;  3BZK A;  4EQQ A;  2EFO A;  3BPX A;  5FLX Z;  2HU9 A;  2ZME C;  2PI0 A;  2L4A A;  2WY8 Q;  2F4O B;  1ACI A;  2HDC A;  1MMD A;  1QU3 A;  3L1P A;  2IA0 A;  1FP1 D;  3A4C A;  1IN7 A;  1OCO H;  3FXM A;  5M3M J;  1L3L A;  2R7S A;  5TRD A;  4CHU A;  1HKS A;  4NNJ A;  3FIW A;  3C2H A;  5FRO A;  3UNG C;  3GTJ J;  1Y0N A;  1V55 H;  4UVA A;  3E1S A;  3ZP5 A;  3GYH X;  1GV5 A;  2LY9 A;  3PO2 J;  5CJ9 A;  2M7B A;  2VQG A;  3HOS A;  4G7O F;  4LK0 F;  3N05 A;  2ECB A;  3MEX A;  5JHU A;  1ZKG A;  4N0B A;  2R5Z A;  2O5R A;  2ELK A;  2EA2 A;  4XLA A;  2EZH A;  1KU7 A;  5K1Y A;  4G6T B;  1XX5 A;  4D9J A;  1WJC A;  2FD5 A;  4UVC A;  2Y31 A;  4EMS A;  4CGZ A;  5K7F A;  2LRD A;  2RC4 A;  1NTC A;  4OAZ A;  1ZG5 A;  1KU9 A;  2AO9 A;  5F04 A;  2NVU B;  4CZZ A;  4I7H A;  5D5X B;  1ETY A;  2DAO A;  3BG7 A;  1T8I A;  5EG0 B;  3CLO A;  3SEZ A;  2O9L A;  5E20 A;  4E4H A;  1BR2 A;  1T6S A;  3PM1 A;  4BYY A;  1Y56 A;  4RM2 A;  5F27 A;  1D1C A;  2W24 A;  1VQP I;  4CYD A;  2EPF A;  5KAF C;  4MTE A;  4ZYE A;  1IV8 A;  1LEA A;  3N97 A;  2P4W A;  3NQO A;  1YHQ I;  4IVN A;  1U5T B;  3HRU A;  2MYS A;  1QQI A;  3KLN A;  4TV7 A;  1R7J A;  1RUO A;  3AAF A;  1UEL B;  4CCO A;  2V6C A;  2PBI A;  4C9Y A;  3KPH A;  1S6L A;  1LFB A;  5LBQ A;  4ENJ A;  4XOT A;  4A3E J;  2XAS A;  5J4V A;  4G6D A;  2P7V B;  2YUS A;  2OF7 A;  1DU0 A;  5IYC J;  4M6X A;  3D5R C;  5ICG A;  2DYR H;  5KVR A;  3R0A A;  4DIQ A;  2Y75 A;  2H6B A;  2EIM H;  1HW1 A;  4E7H A;  2A5W A;  3ZMZ A;  4BDY A;  2ADU A;  4O3M A;  1B8I B;  3IRQ A;  1E17 A;  4M71 A;  3FIS A;  3FDY A;  5LHH A;  3KYD B;  3LSH A;  5HNF A;  1JUS A;  3LSK A;  1WJD A;  1D3Y A;  1GLN A;  2XAH A;  2L3D A;  1ON2 A;  5JLW A;  1HKT A;  3VYS B;  1I6X A;  1OR7 A;  2L5Q A;  4LG3 A;  2EZL A;  1UCR A;  3OYG A;  1JT0 A;  1O3T A;  2CU7 A;  1HDD C;  3RCO A;  1LKX A;  5K7H A;  1EF4 A;  2K9M A;  3BR2 A;  5E8I A;  5M5Y J;  4M9Z A;  5EG0 A;  4BQA A;  3CUQ B;  4ETS A;  3ZQI A;  1FT9 A;  2GM4 A;  2QYO A;  3F22 A;  2ICW G;  2PMH A;  1JTY A;  3S2H J;  2A6H F;  3BDD A;  1ZRF A;  1ZH5 A;  2ZSH B;  1YW7 A;  3QOP A;  1UMQ A;  3QPS A;  5HLG A;  3A01 B;  1VQ5 I;  3REO A;  3K2A A;  3TP0 A;  1U5T A;  2KIU A;  2WAQ A;  3F23 A;  1R4N B;  2UXN A;  2X6O A;  2O7O A;  2Y9Y A;  2YX7 A;  3DLA A;  3KFW X;  1TWG J;  1SC7 A;  4CCK A;  1XMA A;  2HQ5 A;  2VON A;  4A3I J;  1Z77 A;  3WG7 H;  3HKZ N;  3ASN H;  3RYR A;  1KYZ A;  2XGD A;  4DW6 A;  4UXN A;  2PMU A;  2STW A;  3PJR A;  2E1O A;  1YRN B;  2OBP A;  3V7R A;  2LDU A;  2VT3 A;  4HAM A;  4WXC A;  5J3L A;  3ZQ7 A;  1TW3 A;  2IPQ X;  4ENM A;  3I9V 2;  2JA8 J;  2EIN H;  4KUM A;  1WSU A;  2A3S A;  4EGZ A;  5FB2 A;  3J7Y J;  4G7Z F;  3S3N A;  4RLQ A;  2A6E F;  4DYQ A;  2VJJ A;  3OIP A;  5DM7 F;  3E6M A;  3CCM I;  5H6Q A;  4RS8 A;  4EJV A;  2E1M B;  3O8G A;  1OYI A;  4CA0 A;  2L7K A;  5D5W B;  3DFG A;  4NC6 A;  4BE0 A;  2DMU A;  3COA C;  1TQP A;  3ZMS A;  4AC0 A;  1OLT A;  2WAD A;  4L0Z B;  3CUQ A;  2RQQ A;  4BEH A;  4BXF A;  3P9C A;  3VFZ A;  2QQA A;  3HOY J;  1BR4 A;  2QQB A;  4HLY A;  1OIS A;  4A0Y A;  2DDA A;  3BR5 A;  2QEN A;  3HXL A;  2B63 J;  3QP6 A;  3QAH A;  1R49 A;  4YIF A;  1ZRD A;  3HGY A;  1N77 A;  4XIC A;  1WH5 A;  3F9K A;  2K4B A;  2EFW A;  1XSX A;  5E8G A;  3FHZ A;  3ROU A;  4MEX F;  3ECH A;  1EV7 A;  1TWF J;  4ENK A;  1JHF A;  1X3W B;  1LB2 A;  3Q3S A;  2DK5 A;  1KQ0 A;  2FNA A;  5F6F A;  2GA1 A;  2IGK A;  1D0Z A;  5HDG A;  3HJE A;  2DT7 B;  3FBN B;  1DGW Y;  4E7L A;  5E3N A;  3EUA A;  4HYE A;  4D5F A;  2LG4 A;  1XGS A;  3G2B A;  4CUG A;  1F43 A;  4M9S A;  1ZYR F;  1FSE A;  1G3Y A;  3PIP F;  2CUF A;  2ME0 A;  3FMQ A;  2K40 A;  4E7I A;  3FMS A;  3SDB A;  5FLV A;  1X2M A;  3D5L A;  4LMY A;  3VDX A;  5F0H A;  5M5X J;  2VBW A;  1N78 A;  4CCJ A;  2HXI A;  1VQ4 I;  2VKH A;  4RGX A;  3WGI A;  2QA4 I;  1SMT A;  1RRJ A;  4BS9 A;  3NWS A;  3H35 A;  3HRS A;  1QZE A;  1NHA A;  1IXS B;  2HNH A;  2UUZ A;  1A6I A;  2K9N A;  3DP7 A;  3J7Z I;  2ZJR F;  3K9T A;  4HQM A;  4D7N A;  3ZQQ A;  1OCP A;  5ERI A;  4CZC A;  2Z5U A;  4UUS B;  1YE9 A;  3ZQL A;  1MND A;  2IEK A;  3H9Q A;  4EM0 B;  4OMY A;  3HRM A;  4YIR X;  4HX4 A;  1SAX A;  2PN6 A;  4RBO A;  4LB5 A;  2V7F A;  1R9T J;  1QO0 D;  4XSZ F;  2Z16 A;  3R60 A;  4XLN F;  2OAZ A;  1SAN A;  3MAJ A;  3RSN A;  4DBQ A;  2R7U A;  3O3K A;  3V7S A;  1FC3 A;  4XR6 A;  3OYD A;  2V1U A;  2QWW A;  2KPM A;  2MBF A;  2BGC A;  4UUV A;  3DTI A;  3L2C A;  4CIC A;  2LBF A;  1IUY A;  2VBX A;  3PSF A;  3LSJ A;  1CF7 A;  3ZMV A;  2E2H J;  3RPU A;  4YFK F;  2VOO A;  2FXA A;  3TO6 A;  5LHI A;  2JWT A;  1MBJ A;  3MWM A;  1RC9 A;  4OWR B;  1YW8 A;  2L02 A;  3DKW A;  3O2P E;  2LFB A;  3KX2 A;  5K7Z A;  2V1X A;  1WWX A;  2K27 A;  1VQO I;  1KZH A;  1JXS A;  4E7K A;  4XRS G;  2XPU A;  1FIA A;  2MD5 A;  4A3L J;  2M87 A;  3IUO A;  5E3M A;  3L2R A;  1RI7 A;  6PAX A;  4U0Y A;  3WTV C;  3MZ8 A;  1IDZ A;  2Y30 A;  3S1R J;  1ZEL A;  1DP7 P;  3J80 Z;  2XRO A;  3E6C C;  2JJ7 A;  1STZ A;  3RDI A;  1RPW A;  4FE4 A;  4B44 A;  4U87 A;  3W3C A;  1SD7 A;  1K78 B;  1MDM B;  2TCT A;  1R23 A;  1F4K A;  2R7O A;  3HM5 A;  3T8T A;  2BHY A;  2EK5 A;  5J8C A;  2CV0 A;  3R61 A;  5E1Z B;  1GDT A;  1FEX A;  1SD4 A;  2IW5 A;  4WF2 A;  2VIX A;  1BA5 A;  5DUK A;  1VQL I;  2B7E A;  2WAQ N;  4RM3 A;  3OY9 A;  2R92 J;  1ETK A;  2OZ6 A;  2HOT A;  4Y15 A;  5IP9 J;  1FTZ A;  2QSF X;  3F6V A;  3PFI A;  2KIS A;  4GRI A;  1ZTR A;  2X48 A;  2YX4 A;  3EYY A;  1WQ2 A;  3VB2 A;  1WPK A;  3ZQC A;  1IC8 A;  3N4M A;  1I1S A;  3LA7 A;  1MMG A;  1MNM C;  4GXO A;  3BQZ A;  1XD7 A;  4XKB A;  2IVM A;  4I09 A;  4YFN F;  1T08 B;  2MA3 A;  3BJA A;  4CCN A;  5L3E A;  1U8R A;  3JRA A;  1U3E M;  3HTS B;  1S7E A;  2V6E A;  3H36 A;  4ZTJ A;  4HNT A;  2NOG A;  4PJ0 C;  2XAU A;  2ELH A;  3FX3 A;  2KT0 A;  3CD6 I;  2HOA A;  3GEZ A;  1K4S A;  1JJ8 C;  4BAC A;  2VJ4 A;  2JUG A;  2KRH A;  1O7F A;  3P7N A;  4G94 A;  5CPR B;  3DPT A;  5EDN A;  1MDM A;  4II3 A;  1TWH J;  3I64 A;  3P5J A;  4P9U A;  3J81 Z;  1K83 J;  1W4M A;  5E3L A;  2WWY A;  3WU2 C;  3S3O A;  4MQ9 F;  2HYF A;  4RAG A;  2RGV A;  1X1D A;  3IWZ A;  3PO3 J;  2E34 A;  2A69 F;  3L2U A;  4GYG A;  2QKL B;  3RQI A;  2XGX A;  2O8K A;  2L9V A;  4LK1 F;  3I59 A;  4XBF A;  1MBH A;  4GO1 A;  4K2E A;  2DT6 A;  3IRR A;  2MH2 A;  2NVT J;  1T0F C;  4IHW A;  4JP0 A;  2DA3 A;  3FM5 A;  1SVM A;  1C0W A;  1W0U A;  5CVV A;  2OV7 A;  3IKT A;  2K02 A;  2TDX A;  4IQ4 A;  2N8G A;  2FBK A;  1X1A A;  4Q47 A;  5LEJ A;  2JA6 J;  2JSC A;  4B8X A;  1LE8 A;  5EJC A;  3I3L A;  4A69 C;  2CQQ A;  2M4G A;  2RRE A;  1O3S A;  2R7D A;  2D2W A;  5IP6 A;  2AS5 F;  2PG4 A;  4DNC A;  2ZXW H;  2ESN A;  1DPR A;  2M0C A;  2ZJQ F;  2VKE A;  4MFE A;  5E18 F;  4BE1 A;  1YS7 A;  3TDZ C;  2F5C A;  3HBL A;  3OS0 A;  1X19 A;  3JCU C;  1FSH A;  3GTO J;  4EJO A;  5D8L B;  2K9S A;  1HW5 A;  1H88 C;  1IF1 A;  1MD0 A;  1SD5 A;  2XSD C;  3EUH C;  3GF2 A;  4WK8 F;  3CMA I;  3LFK A;  1ENH A;  2JUC A;  2LSO A;  2X51 A;  1HC8 A;  3GZ5 A;  4ZJZ A;  2MFZ A;  4QSH A;  4KMF A;  2DMQ A;  3L9F A;  5CKT A;  2XAG A;  3KYC B;  3HZJ A;  4HNV A;  2MSY A;  3ZQG A;  2P6S A;  1OYY A;  4M74 A;  1L0O C;  3HB9 A;  3ZCO A;  1VQM I;  3LST A;  5E79 C;  1F1Z A;  1FOX A;  5ILU A;  3QPH A;  4EM1 A;  2IJL A;  4EJU A;  1U78 A;  1G3W A;  2L7F P;  3M9A A;  1GUU A;  2YS9 A;  2OPT A;  4LG0 A;  2OCC H;  3SZG A;  2Z9O A;  3BJO A;  3K4B A;  2NNN A;  3KIO A;  2OZU A;  2E35 A;  4NHJ A;  2QCO A;  3AKZ A;  2F5D A;  2PJP A;  3RZO J;  4HV6 A;  1GV2 A;  3UKG A;  3SFI A;  3GTK J;  5BPD A;  3M3Y J;  1X4O A;  4PJN A;  2XSJ C;  1J5Y A;  3HOU J;  2LR8 A;  4N4O B;  5DD4 A;  2E71 A;  2JZY A;  1PUF B;  3MN2 A;  2FBH A;  2Y9Z A;  3I53 A;  2CQ7 A;  2LTP A;  2JA2 A;  4WCG A;  1E3O C;  5IOZ A;  1E2X A;  3ZQH A;  1FNN A;  1FX7 A;  4CYC A;  3S1Q J;  1MH4 A;  3WU1 B;  2DQR A;  3MKZ A;  1X4P A;  3HOZ J;  1E0E A;  3ERE D;  2NS0 A;  2W4S A;  1QVT A;  1UAA A;  2MLK A;  3AL0 B;  4EAT A;  1YTY A;  3GTG J;  2VAS A;  1OCR H;  3GWZ A;  2BXY A;  2W48 A;  3ABT A;  2UXX A;  3A0B C;  2LRE A;  4RB1 A;  4IO9 F;  1OQY A;  2YU9 J;  1JHH A;  3VOE A;  1DDN A;  4KYW A;  1V5F A;  3OYL A;  2BY3 A;  3WE2 A;  5AON A;  1U6G A;  3QU6 A;  2VJI A;  2Y0M A;  3WTT C;  3A03 A;  1V4R A;  3EQL F;  1ETV A;  2PJR B;  2NNY A;  5KK1 A;  2JA5 J;  3GO5 A;  3WTZ A;  1OFC X;  3E0J B;  1SVO A;  2WTE A;  3L09 A;  4PGG A;  1O3Q A;  4L18 B;  1TWA J;  2V1D A;  5JI6 A;  1AOY A;  2HTS A;  3VEP A;  5EGO A;  4HDU A;  4E7J A;  2R7F A;  4ZH4 F;  1PUF A;  2A61 A;  1K6Y A;  1IXR C;  4JX5 A;  3SFZ A;  1MBE A;  1QRY A;  2MC4 A;  2W85 A;  3ZQF A;  2QGU A;  2M1B A;  4NC8 A;  4ON0 A;  4BQO A;  1IXC A;  2PX9 A;  5F0C A;  1V5E A;  3ZMU A;  1QBJ A;  5FRM A;  2OC6 A;  4B47 A;  1I27 A;  4KIC A;  2NVQ J;  3S1M J;  5ILS A;  3DWL E;  3Q0U A;  3WTU C;  4I6Z A;  5TGT A;  1R5I D;  3H9J A;  3AG4 H;  1PJR A;  3FXU A;  1XDS A;  4GFB A;  5ILV A;  1V5G A;  1NH3 A;  4W1U A;  1XN7 A;  3M4O J;  3VYR B;  4S0H B;  1WRJ A;  3L2Q A;  1FYL A;  2O8X A;  2GIZ A;  4B43 A;  3DXJ F;  1HW2 A;  3HYI A;  2GWR A;  1P6R A;  2G7H A;  4WWC A;  4UY8 I;  1VTN C;  1Z3Y A;  2WB1 A;  1ZLJ A;  3F72 A;  4C2M J;  3JSP A;  4IHS A;  3DEE A;  1YYV A;  2MAB A;  1Q1V A;  2EIL H;  2WAE A;  1G8X A;  2EZK A;  5EZG A;  4F91 B;  2MLG A;  4RB3 C;  3KP6 A;  2IBD A;  2P5K A;  2LYC A;  3K4K A;  1IV6 A;  4NUB A;  1YLF A;  4RAY A;  3RIR A;  1W0T A;  1OYW A;  2KFD A;  1LEB A;  5B66 C;  2HOS A;  2ZBK A;  2KQR A;  2K3F A;  2DA4 A;  1EA3 A;  2R7W A;  1Z91 A;  2DOE A;  1QPI A;  4LLN A;  2DFH A;  5DV5 A;  5H2F C;  1IN6 A;  1LJ9 A;  1PVE A;  1QPM A;  1ERD A;  3G4S I;  2HVS A;  5FLX K;  3DPU A;  2EV5 A;  4N9H A;  3S93 A;  4BKX A;  3AG2 H;  3W6V A;  1RET A;  1PUE E;  1TNS A;  4MLO A;  4X6A J;  4HX8 A;  4UV8 A;  5J40 A;  4B09 A;  1XDU A;  1DUX C;  3QOD A;  1R71 A;  3O6B B;  4EEF G;  1B72 A;  2VOP A;  4I0B A;  2Q8K A;  5IT3 A;  3X2Q H;  1SAU A;  1YX5 A;  1HF0 A;  4R8H A;  3D5S C;  1BW6 A;  5DCM B;  2H8R A;  3MZY A;  2NVY J;  5F64 A;  2QBY B;  3M07 A;  4L9V A;  1BOA A;  1TLH B;  3OYN A;  4PFO A;  1YFH A;  1I5Z A;  1ZAO A;  3KYL A;  2A07 F;  3OWT A;  1JE8 A;  3AG1 H;  5CQE A;  4O5V A;  4YG2 F;  1A5J A;  1Z9C A;  3CUQ C;  4M3G A;  3MKL A;  4A3D J;  4A2U A;  2Y0S A;  5EYR A;  1HSJ A;  3OMY A;  3D1N I;  2STT A;  4J19 A;  2HPM A;  3GTQ J;  3VSK A;  3GCM A;  3M8E A;  3HUG B;  3QQA A;  3JTH A;  4U88 A;  2AXT C;  4IRH A;  3MKW B;  4OIN F;  1LPQ A;  3DEW A;  2Z99 A;  1SFE A;  3KE2 A;  3C2G A;  4L5J A;  2Y2Z A;  3DU5 A;  4HA8 A;  1GHC A;  1Z05 A;  1T2K A;  2K9Q A;  3WTY C;  4IF4 A;  4AU7 A;  2LY2 A;  2TRT A;  2ZB9 A;  3HG9 A;  4ENN A;  3M8F A;  3BR0 A;  4BJ6 C;  4I76 A;  3ABK H;  3J7A O;  3RKY A;  1WHU A;  1BBY A;  2WAF A;  4X1E A;  1YW9 A;  5EEA A;  3S16 J;  1Y8R B;  4P5O A;  4B3X A;  5GP9 A;  4XNF A;  1ETO A;  3BR1 A;  2ETH A;  2O0Y A;  9ANT A;  2ZME B;  4FCY A;  5LHG A;  1XMX A;  4HF1 A;  3WE3 A;  2QBY A;  3F6O A;  2E1M C;  2FML A;  3ZRG A;  4M3E A;  4XLP F;  1OCT C;  1I3Q J;  2BY2 A;  1GVJ A;  1SFX A;  5D8K B;  3CJT B;  2VC0 A;  4LB6 B;  2XIG A;  2BHZ A;  4XKC A;  2F48 A;  1X2N A;  2E5Z A;  3K4M A;  4UV9 A;  5FKM A;  3BZ6 A;  2GZW A;  5IOY A;  4HBL A;  3HOX J;  2LF8 A;  2M34 A;  2GXA A;  2KJB A;  5HLH A;  3RKW A;  1XCB A;  2DQL A;  2HZD A;  4OIP F;  4B4C A;  2R4G A;  3CCL I;  2KLO A;  4EVI A;  1XGN A;  3KCC A;  2W1O A;  2F6C A;  2BY1 A;  3PIO F;  1BI2 A;  2XHK A;  3V7C A;  1ZR2 A;  2K7L A;  5FKN A;  4A3B J;  2XPV A;  3VYT B;  3SZT A;  2KZG A;  1UG0 A;  1WGX A;  2E7X A;  3CDL A;  5BNG A;  3ZMT A;  4IOC F;  2O6G E;  4FX0 A;  3DTE A;  4BJT A;  1R1T A;  3U21 A;  4IRI A;  1SFU A;  3ZOB A;  1KYW A;  3CQZ J;  4ZZD A;  3UR3 C;  4M3D A;  5GAE J;  5GTH C;  1MSE C;  1F5T A;  2M3A A;  3OYC A;  3DPL C;  4IJA A;  3TO7 A;  5HDN A;  4L5I A;  4U0W A;  5CQG A;  1B8I A;  2L7M P;  2VXZ A;  1WFX A;  2BXZ A;  4E6K G;  1T38 A;  5LD2 C;  4LIU A;  4LFU A;  2OD5 A;  4GYI A;  2MC3 A;  3CO6 C;  1B9N A;  2IGM A;  2QF7 A;  1R6R A;  2L01 A;  5DM6 F;  3I4M J;  3FF5 A;  3CJR B;  3OR1 C;  1MKM A;  1OCZ H;  2XAF A;  1CGP A;  3RTR A;  2DPD A;  3B73 A;  2CYY A;  4KFC A;  3JRC A;  1X1B A;  4R79 A;  2FE3 A;  2FA5 A;  4M73 A;  2WB1 N;  4L5E A;  1Y6I A;  4JK1 X;  1K61 A;  4PJL A;  3M7G A;  3SXY A;  1HA8 A;  1GT0 C;  2P6T A;  4HX7 A;  1I1G A;  1YJN I;  4XOR A;  2KMU A;  1XGO A;  3DV8 A;  1RR8 C;  3A01 A;  1W7P B;  1N75 A;  4D1Q A;  2DTZ A;  4CDG A;  2CMP A;  1JGS A;  2KDZ A;  1RIO H;  3H3Z A;  1IG7 A;  1J9I A;  2ECC A;  4AUX A;  3CZ6 A;  3PNY A;  4N4N B;  3DLL F;  2HEO A;  3MMY B;  1D8K A;  2XAJ A;  2CRG A;  1W36 C;  2JMW A; 
#chains in the Genus database with same CATH homology
 2R93 J;  4IHX A;  1YRN A;  2R0Q C;  2M8G X;  1S7E A;  3HEF A;  2E19 A;  3QPL A;  2RAE A;  2NOG A;  2XGC A;  2KT0 A;  2HOA A;  4QIW N;  1JJ8 C;  1HDP A;  3RKQ A;  1F36 A;  5GPC A;  5M3F J;  3TED A;  1ETQ A;  4V2G A;  2HYJ A;  4A3J J;  3G1O A;  5EDN A;  5E3O A;  1FTT A;  2MGQ A;  1TWH J;  1K83 J;  5E3L A;  2VPR A;  2DN0 A;  1VF9 A;  4IHY A;  1IGN A;  3S15 J;  3GTL J;  3PO3 J;  2Y0S N;  3RQI A;  1ORK A;  2O8K A;  1MBG A;  3O8H A;  1MBH A;  1Z0X A;  4A3K J;  5F0F A;  4IHV A;  2NVT J;  1NK3 P;  4IHW A;  3BT9 A;  1VND A;  4JP0 A;  2DA3 A;  3BG9 A;  1AKH A;  2DA6 A;  5HOD A;  1WI3 A;  2N8G A;  3E7L A;  2M9H A;  3S17 J;  4DZP A;  2G0E A;  1MSF C;  5FKK A;  2JA6 J;  4D7M A;  1LE8 A;  4A69 C;  2CQQ A;  1B72 B;  3I4N J;  4Y52 J;  1ITY A;  3GTP J;  5IP6 A;  5IPA A;  4B3A A;  3IV5 A;  4M3B A;  3RZD J;  2GLO A;  2FX0 A;  3HOV J;  2M0C A;  2VKE A;  3H0G J;  4FIS A;  4MFE A;  1ZQ3 P;  3HBL A;  3OSG A;  3GTO J;  1SFO J;  2K9S A;  1JJ6 C;  4BY1 J;  1H88 C;  3S14 J;  2ME6 A;  1RR7 A;  3FKI J;  5IP7 J;  3LSP A;  2XSD C;  1GVD A;  2XGE A;  2HDD A;  3IH3 A;  4JYK A;  3JRD A;  1ENH A;  1RKW A;  4C3I J;  3BG3 A;  3JRB A;  3HGG A;  4QSH A;  3OIO A;  2DMQ A;  2XRL A;  3BTJ A;  4AYB N;  1XS9 A;  4HNV A;  4A3M J;  2MSY A;  3ZQG A;  3BTI A;  1POG A;  3HB9 A;  4M3F A;  1VFC A;  4UUS A;  2VUM J;  3CCY A;  3L1P A;  3MVP A;  4Y7N J;  1U78 A;  3S2D J;  5M3M J;  5FLM J;  2L7F P;  2DMN A;  1GUU A;  2YS9 A;  2OPT A;  3G1M A;  2HXO A;  3FIW A;  2QCO A;  3IH2 A;  4C3H J;  5M5W J;  1CQT A;  3RZO J;  3GTJ J;  2HI3 A;  1GV2 A;  3UKG A;  3SFI A;  3GTK J;  3M3Y J;  2CJJ A;  1GV5 A;  2LY9 A;  3PO2 J;  5FKO A;  2LR8 A;  3HOU J;  1JKR C;  1PUF B;  3MN2 A;  1APL C;  2ECB A;  1ZKG A;  2R5Z A;  2Y9Z A;  2LTP A;  2ELK A;  4B1R A;  3G1L A;  2EZH A;  1E3O C;  5IOZ A;  3ZQH A;  4CYC A;  2FD5 A;  3B6A A;  3S1Q J;  1MH4 A;  2Y31 A;  5K7F A;  3HOZ J;  1NTC A;  1XC5 A;  2LVS A;  3NAR A;  1QVT A;  5F04 A;  2AO9 A;  4UUT A;  3GTG J;  2EQR A;  2LLK A;  1ETY A;  5J1R A;  2W48 A;  3LOC A;  5EG0 B;  2LKX A;  2O9L A;  1VI0 A;  1P7J A;  2DA1 A;  3PM1 A;  2YU9 J;  3WHC A;  5F27 A;  3BR6 A;  3BQY A;  1IDY A;  5JLX A;  2P81 A;  1TC3 C;  2GBY A;  1UG2 A;  2DMP A;  3A03 A;  2VKV A;  1Y1W J;  1ETV A;  1LFU P;  1LFB A;  2JA5 J;  4A3E J;  1T33 A;  1DU0 A;  2YUS A;  2OF7 A;  3FK6 A;  5IYC J;  1JT6 A;  1OFC X;  3JRE A;  4D5C A;  2MW8 A;  5FJ8 J;  2NVX J;  1DU6 A;  3F0C A;  3Q0V A;  4JX4 A;  1TWA J;  2JK3 A;  2ID6 A;  2ID3 A;  2L7Z A;  2COB A;  2PMZ N;  5EGO A;  2R5Y B;  1PUF A;  2DJN A;  2FQ4 A;  3JRG A;  4JX5 A;  1MBE A;  1QRY A;  1HLV A;  1B8I B;  2I10 A;  3ZQF A;  3FIS A;  4QTR A;  1JUS A;  5F0C A;  3TW6 A;  1U8B A;  1I6H J;  2L0K A;  5JLW A;  5GPA A;  2NVQ J;  3S1M J;  1JTX A;  3Q0U A;  4I6Z A;  1JT0 A;  2EZL A;  5C3E J;  2CU7 A;  2LD5 A;  1W0U A;  4V2F A;  4XID A;  3CMY A;  2LP0 A;  5K7H A;  1HDD C;  2IAI A;  4GFB A;  1EF4 A;  3BR2 A;  4W1U A;  2XPW A;  5M5Y J;  1JKQ C;  1HOM A;  5EG0 A;  3M4O J;  4S0H B;  3ZQI A;  2GM4 A;  4DYC A;  3WHB A;  1JTY A;  3S2H J;  1BL0 A;  4DYR A;  4C2M J;  1UMQ A;  3DCF A;  3QPS A;  3A01 B;  1H89 C;  3K2A A;  3TP0 A;  1Q1V A;  5C44 J;  4FTH A;  1G2H A;  2X6O A;  2O7O A;  2EZK A;  2Y9Y A;  5EZG A;  1TWG J;  2IBD A;  1H8A C;  2DMT A;  3OOU A;  1IV6 A;  2HQ5 A;  1ETX A;  2FJ1 A;  2DA7 A;  4A3I J;  1W0T A;  4BBS J;  1Z77 A;  3B6C A;  3HKZ N;  4DZJ A;  1BW5 A;  2HOS A;  1P7I A;  3NAU A;  2XGD A;  4DW6 A;  2DA4 A;  2E1O A;  1YRN B;  1QPI A;  2DA5 A;  2EBI A;  1IRZ A;  5J3L A;  2R5Y A;  2JA8 J;  1MBK A;  2XB0 X;  4BKX A;  3A02 A;  1QVU A;  1RET A;  3W6V A;  4MLO A;  4X6A J;  4DYQ A;  2E2J J;  1HCR A;  4M6V A;  4EEF G;  1B72 A;  4A93 J;  4XRM A;  1U9O A;  3O8G A;  1XG1 A;  5IYD J;  1HF0 A;  1BW6 A;  2H8R A;  3FK7 A;  4A3C J;  2NVY J;  1X58 A;  2DMU A;  2D5V A;  4AC0 A;  1UHS A;  2CUE A;  3SJM A;  2JA7 J;  2M2E A;  1ZR4 A;  2XB5 A;  2NS7 A;  4C3J J;  3HOY J;  5F1J A;  1A5J A;  2X9D A;  1ZK8 A;  3BR5 A;  3MKL A;  4M3G A;  4A3D J;  4BY7 J;  2B63 J;  5DS9 A;  4A3G J;  2EZI A;  3HGY A;  1I50 J;  3HDD A;  5EYR A;  3JRF A;  4A3F J;  4XIC A;  1WH5 A;  3D1N I;  4J19 A;  3GTQ J;  4XRS A;  1O4X A;  4MO7 A;  3LNQ A;  3QQA A;  1FIP A;  1U9N A;  1TWF J;  2WV1 A;  1JKP C;  1LE8 B;  2DA2 A;  3Q3S A;  3DEW A;  2NS8 A;  2JN6 A;  2Y2Z A;  5E3N A;  1IJW C;  4D5F A;  3BG5 A;  2K9Q A;  1F43 A;  1JUP A;  2TRT A;  2ZB9 A;  3GTM J;  3BR0 A;  2CUF A;  1JKO C;  2ME0 A;  2K40 A;  4I76 A;  5FLV A;  1X2M A;  5F0H A;  5M5X J;  4X1E A;  3HOW J;  5EEA A;  3S16 J;  1JUM A;  1ETW A;  5GP9 A;  2HXI A;  1ETO A;  3BR1 A;  9ANT A;  4FCY A;  1A6I A;  2K9N A;  3SDG A;  3TW7 A;  4D7N A;  4M3E A;  1OCT C;  1OCP A;  1I3Q J;  5F08 A;  4UUS B;  4LOC A;  3ZQL A;  1WH7 A;  2IEK A;  1JGG A;  2R7Z J;  3S1N J;  5FKL A;  2H1K A;  1AHD P;  4RBO A;  1X2N A;  5FKM A;  5J1Y A;  4FE7 A;  5IOY A;  1R9T J;  1RKT A;  3JR9 A;  3HOX J;  1NK2 P;  4NDL A;  2M34 A;  1SAN A;  3BTL A;  1RES A;  3GBG A;  4MFD A;  2EH3 A;  2LK2 A;  4B4C A;  3OSF A;  2VI6 A;  3JRA A;  5C4X J;  3LSJ A;  2R5Z B;  3H3V K;  3IH4 A;  2E2H J;  1BJZ A;  1ZR2 A;  4CYC B;  2JWT A;  5FKN A;  4A3B J;  2XPV A;  1MBJ A;  1ZGW A;  1WGX A;  3CDL A;  5BNG A;  3JRI A;  2LFB A;  5K7Z A;  3TP3 A;  1WCM J;  3ZOB A;  4XRS G;  2XPU A;  3CQZ J;  4IEJ A;  2MG4 A;  1FIA A;  4M3D A;  3VPR A;  4A3L J;  5IYB J;  1MSE C;  5E3M A;  5DTD A;  1B8I A;  4ABZ A;  2L7M P;  4W97 A;  1IDZ A;  2Y30 A;  1T56 A;  3S1R J;  3BTC A;  2JJ7 A;  2E2I J;  1MH3 A;  1RPW A;  2AHQ A;  2QF7 A;  4FE4 A;  3I4M J;  3Q0W A;  2TCT A;  4G12 A;  1TWC J;  4BXX J;  3JRC A;  3HM5 A;  3LSG A;  4RDU A;  5EF6 A;  2WB1 N;  1GDT A;  1FEX A;  4L5E A;  1D5Y A;  2CQX A;  1K61 A;  1BA5 A;  3K7A J;  2WAQ N;  2R92 J;  1ETK A;  4MIM A;  1GT0 C;  5EZH A;  2HOT A;  4JX6 A;  1IUF A;  5IP9 J;  1FTZ A;  5EGO B;  1MBF A;  3A01 A;  3C2B A;  1Y1V J;  1ZTR A;  1OJL A;  2X48 A;  2DTZ A;  5J1U A;  1AKH B;  3BR3 A;  1WPK A;  2KDZ A;  2L9R A;  1FJL A;  3ZQC A;  1IC8 A;  1IG7 A;  4BBR J;  1AU7 A;  2ECC A;  4XK4 A;  4AUX A;  1MNM C;  5C4J J;  3JRH A;  3BQZ A;  2CRG A;  3LSR A;  2JMW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...