2HDDA

Engrailed homeodomain q50k variant dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*CP*CP*C
publication title Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 20
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hddA00
3ZQHA 4IHYA 4A93J 1G2HA 3S1QJ 3CDLA 5GPCA 2Y31A 2XSDC 1ETOA 3UKGA 5EEAA 4AC0A 5K7HA 1U9NA 1RPWA 2DTZA 1AU7A 5EYRA 3BR0A 1OJLA 1BL0A 2HOSA 1IGNA 3B6AA 4UUTA 4XICA 2DMQA 1XC5A 1DU6A 3S15J 1IDZA 2ECBA 2CUFA 4I6ZA 1H88C 2LVSA 4CYCB 1GT0C 4DYRA 2XGCA 4HNVA 2M8GX 1MNMC 4DYCA 2E2IJ 5M3FJ 1SFOJ 4A3EJ 2ECCA 3LSPA 3GTQJ 4XIDA 2R5ZA 2NOGA 5GP9A 3GTOJ 2EH3A 4FCYA 2I10A 2JN6A 1AKHA 1IDYA 2P81A 3QPSA 3TP3A 3HOUJ 2O7OA 3JRCA 4NDLA 2NVXJ 5JLXA 1XS9A 5C3EJ 1TWHJ 2HOAA 1VF9A 1MH3A 2JA8J 2NVQJ 1RKTA 1NK3P 3BTJA 5F27A 3K2AA 1WCMJ 2LY9A 2M0CA 1MBGA 2R0QC 5C4XJ 1NTCA 2HYJA 4DW6A 1JTXA 3RZOJ 3LNQA 4IEJA 2X6OA 2LLKA 1S7EA 2OPTA 4G12A 5EGOB 2GLOA 1UMQA 2ID3A 5C44J 1D5YA 3BTIA 5FKMA 4MLOA 2MW8A 2R5YA 1FEXA 1IV6A 2L7ZA 3B6CA 3HOZJ 2HQ5A 3Q0UA 2FD5A 4A3DJ 2K9SA 1P7IA 3HM5A 2FJ1A 4FTHA 3BR2A 3BR6A 2DA4A 2NVTJ 5F08A 3IH2A 3DCFA 1DU0A 2COBA 1TWCJ 3M3YJ 4ABZA 2XGEA 2R93J 1LFBA 2RAEA 5J1RA 1JKRC 2JA6J 2L7MP 3S1MJ 3Q0VA 1B72A 3E7LA 1IJWC 3IH4A 1FIPA 5FLVA 3HB9A 3G1LA 4Y52J 3MKLA 2H8RA 3HOWJ 3HBLA 1QVUA 4M3FA 1U9OA 2LR8A 1TWAJ 2JK3A 1ETYA 3FIWA 1K83J 3NAUA 3PO3J 3TW6A 1JKQC 3FKIJ 2R7ZJ 1TC3C 5IOZA 5EG0B 2K9NA 1AHDP 1QVTA 3RZDJ 1O4XA 1WH5A 3WHBA 5M5WJ 5FJ8J 1H8AC 1RETA 1MBHA 1ZTRA 2JMWA 3S14J 1ZK8A 4W97A 1ZKGA 3G1OA 5EDNA 3HKZN 4A69C 2NVYJ 2FX0A 3DEWA 4J19A 1RR7A 3OSFA 1Y1WJ 2HXIA 1JKOC 3QQAA 2MSYA 2M2EA 1BW6A 4IHWA 5IYCJ 3A02A 1PUFA 2XGDA 3LSGA 3SFIA 4M3GA 1RKWA 3GBGA 1MBFA 5IPAA 4GFBA 2MGQA 3FK7A 1SANA 1ETVA 2KT0A 3H3VK 3I4MJ 1GDTA 1X2MA 3BTCA 1HLVA 2LKXA 5M5YJ 4C2MJ 1FIAA 1ORKA 3BR1A 4D7MA 1APLC 2WB1N 2CU7A 1POGA 2JJ7A 1YRNB 4MIMA 3QPLA 5M3MJ 1ETWA 2FQ4A 1CQTA 1GUUA 3JRIA 2IBDA 1P7JA 1JKPC 1A5JA 4A3MJ 2HI3A 5GPAA 3BG5A 4JP0A 3BR3A 4XK4A 3ZOBA 5IYBJ 5FLMJ 2R5ZB 1HDDC 4A3JJ 3ZQLA 5F0HA 1QPIA 4BY1J 4XRMA 4A3CJ 3JRFA 1MSEC 3BG9A 1LE8A 2D5VA 2HOTA 4IHVA 4I76A 1ZR4A 3C2BA 3GTKJ 3RKQA 1JUPA 3SJMA 4FE4A 1B8IB 1WPKA 2DN0A 4M3EA 3TW7A 2NS8A 1Y1VJ 2CQQA 3HGYA 1HCRA 1MBJA 4UUSA 3HOXJ 3WHCA 3OSGA 1U8BA 5E3LA 2QCOA 4DZPA 1F36A 2ID6A 1T33A 1R9TJ 3H0GJ 2G0EA 5F04A 5F0FA 2ZB9A 3BT9A 3FK6A 4JYKA 4A3GJ 4AYBN 2EQRA 2R5YB 2VPRA 1ITYA 1FTZA 4DYQA 2DMNA 2L7FP 2M9HA 2X9DA 1MH4A 1ZQ3P 2CJJA 3A01A 3JRBA 2EZKA 2YUSA 3GTJJ 1Q1VA 2DA7A 3MVPA 4BXXJ 5J1UA 2JA7J 1JTYA 2AHQA 5J3LA 5E3OA 3ZQIA 2LTPA 2EBIA 1JJ6C 3ZQFA 1VI0A 2ME6A 2X48A 2VUMJ 1FJLA 3BQZA 2DMUA 4QTRA 2XB0X 2YS9A 2QF7A 3G1MA 4BBSJ 4A3IJ 2N8GA 1B72B 1K61A 3OIOA 4A3FJ 1LFUP 3BR5A 3TP0A 3PO2J 3SDGA 1ETXA 3RQIA 1VNDA 5J1YA 2DMPA 3JREA 2EZLA 1OCPA 3PM1A 1I50J 3JRGA 2EZIA 4M3DA 2B63J 1IUFA 3IH3A 3S16J 1OCTC 3O8HA 3BQYA 4JX5A 3GTMJ 3ZQCA 2DA5A 2W48A 3BG3A 2M34A 1BJZA 2MG4A 2E2JJ 2Y2ZA 3F0CA 2JA5J 2VI6A 1PUFB 4M6VA 1GV5A 2L0KA 1U78A 2DA6A 2IEKA 5IP7J 2PMZN 1GVDA 2K40A 5IP9J 1TWGJ 2L9RA 1TWFJ 4BKXA 5F0CA 3HOVJ 5K7ZA 2IAIA 2OF7A 4D5FA 5DS9A 3S1NJ 1JGGA 1IC8A 1JUSA 2LK2A 1F43A 1A6IA 5HODA 1JJ8C 1I3QJ 1HOMA 4V2FA 5C4JJ 4S0HB 3A03A 2Y30A 4IHXA 2O8KA 2Y0SN 3BTLA 3S1RJ 4CYCA 1Z0XA 5F1JA 3GTGJ 1NK2P 5FKNA 3NARA 1YRNA 3I4NJ 4JX4A 1BW5A 4X6AJ 1WGXA 5M5XJ 4V2GA 2CUEA 2TCTA 1MBEA 3VPRA 2EZHA 3HGGA 5K7FA 2Y9ZA 3S2DJ 2DA3A 1ETQA 1AKHB 2E1OA 1GV2A 1UHSA 5FKLA 3JRDA 5E3MA 1WI3A 2TRTA 4Y7NJ 2YU9J 4XRSA 1LE8B 1IRZA 3M4OJ 4FISA 1JT6A 4XRSG 3D1NI 2XB5A 4MFEA 1X2NA 2GBYA 3K7AJ 3LSJA 1ETKA 4B4CA 2HDDA 2ELKA 5EZGA 1JT0A 2DMTA 4RDUA 4JX6A 3CMYA 1B8IA 4UUSB 3FISA 2R92J 5EF6A 5IYDJ 3JRHA 1JUMA 4C3IJ 3S2HJ 4B1RA 1HDPA 3JRAA 1ZR2A 3TEDA 3LOCA 5EZHA 5EGOA 1W0TA 4L5EA 4W1UA 4A3KJ 2DJNA 2WAQN 5FKOA 2WV1A 4LOCA 4A3BJ 2E2HJ 1H89C 3LSRA 3L1PA 4BY7J 3MN2A 3GTLJ 1UG2A 2CRGA 1EF4A 3A01B 3CQZJ 3Q0WA 4C3JJ 2LP0A 4MFDA 4C3HJ 3W6VA 4QIWN 2DA2A 3HOYJ 2O9LA 3HDDA 2LD5A 3S17J 1QRYA 4D5CA 2KDZA 1Z77A 1XG1A 2ME0A 3CCYA 2XPUA 2AO9A 1ENHA 2H1KA 4BBRJ 4EEFG 1FTTA 3JR9A 4A3LJ 5BNGA 2K9QA 2DA1A 4DZJA 4AUXA 1IG7A 1VFCA 1OFCX 3IV5A 2Y9YA 4B3AA 1WH7A 4MO7A 4X1EA 1I6HJ 3O8GA 1X58A 4QSHA 5EG0A 2XRLA 1BA5A 5DTDA 4RBOA 2LFBA 5IOYA 1MBKA 2NS7A 3Q3SA 1T56A 2CQXA 4FE7A 9ANTA 5JLWA 1E3OC 3ZQGA 3OOUA 2VKEA 2XPVA 4M3BA 5E3NA 1ZGWA 4D7NA 5IP6A 1RESA 2HXOA 1W0UA 3HEFA 5FKKA 1MSFC 2GM4A 2JWTA 2E19A 1HF0A 2VKVA 3GTPJ 2XPWA
chains in the Genus database with same CATH superfamily
3ZQHA 1SMYF 4IHYA 4HRIA 3PFYA 5GPCA 3UKGA 1MMAA 1E2XA 1N75A 2MH2A 1VTNC 5EEAA 4X0GA 3EPZA 2IGKA 1IGNA 3F23A 4UUTA 4HA8A 2DMQA 1DU6A 3GCMA 2LF7A 2ECBA 1BI3A 5HLGA 1HW5A 2M87A 1X1CA 1USTA 4I6ZA 3OV8A 1PDNC 1LDJA 1MJBA 1LUJB 1ZG3A 2M4KA 5J47A 2XGCA 2EIMH 4S05A 2YU3A 2JUCA 3C1DA 2A07F 4BAYA 1WJCA 2E2IJ 4U88A 5M3FJ 2F4IA 2WY7Q 4UV8A 3J7YJ 4ZZDA 3GTQJ 2FMYA 1J7KA 1LVKA 3MD2A 4PJJA 2OBPA 1E3PA 2NOGA 3O3KA 2XV4S 1TT0A 3L2CA 3CCSI 1FC3A 4A2UA 3S8PA 4B48A 4FCYA 3K4NA 1AKHA 3QPSA 1O3TA 4AIJA 4XORA 2NVXJ 1K78A 4KN7X 1O3QA 3I9V2 4EJVA 1XMKA 1IRXA 2DFEA 3RYRA 1VF9A 5HLIA 4KIBA 2X6YA 1SEUA 2HEOA 3BTJA 5F27A 4AVZA 1VQKI 2LY9A 3CO6C 5C4XJ 1N77A 1C0WA 3GEZA 2R4GA 4HBLA 4PFPA 1QNTA 3MWMA 4DW6A 4OWRB 2HQNA 4IEJA 4BL0B 2X6XA 2FA5A 3HUGB 4G12A 3GF2A 2KRCA 2HVSA 4MLOA 2MW8A 5HDGA 2R5YA 2V1UA 5E18F 2FQ3A 2Y69H 3LAJA 4EJTA 4A3DJ 1R7JA 4ZDPA 2BEOA 4EV0A 1SFKA 2DPUA 5DUKA 2HGCA 3BR6A 2DA4A 5J4YA 2HQRA 2M7AA 1ZARA 2COBA 1R22A 1TWCJ 4KT6A 1ONVA 3ELKA 3RPQA 2XGEA 4I0AA 1FYMA 2DCEA 4EMSA 1R5GA 3WTVC 3OYEA 3F9KA 4Q47A 5DD4A 2L7MP 3QYEA 3TQNA 2M8EA 4L9VA 5AIPA 3U21A 2ZJ2A 5BQTA 2DK5A 2K3FA 5LFAA 3MKLA 3OIQA 4LG3A 2H8RA 1MKMA 4YIIA 3HOWJ 3VODA 2BXYA 1FYLA 5EJCA 2IS2A 1QVUA 2LR8A 3FIWA 3OYMA 3NAUA 4ENNA 1D5VA 3IAM2 1IRGA 1IZ1A 1Y6IA 2OZ6A 1AHDP 2HWVA 4ZYEA 1O4XA 3WHBA 2JPCA 2WBMA 1A31A 1ZK8A 4WX9A 5EDNA 1YJNI 3ZPLA 2NVYJ 3KLOA 2R7DA 4BUPA 1LDKB 3ULQB 1UCRA 2FX0A 1RR7A 3A2KA 3OSFA 1Y1WJ 1OYIA 3OYAA 3C2GA 2MSYA 2M2EA 3HJEA 1EH8A 3GWZA 4XRFA 2XVCA 4RS8A 1PVEA 2BY0A 2MH9A 4GXOA 1PUFA 2DPDA 1FYKA 3Q9SA 1FLIA 4N4NB 1MBFA 2MC3A 1A35A 5GAHJ 1S6LA 4HX4A 2LSOA 3FK7A 2MLKA 5D8LB 1ETVA 2QQBA 2RV8A 4I0BA 2PEXA 3JSPA 1DP3A 4XKVA 3RPUA 1HLVA 2BE5F 4B47A 3EUKL 3BR1A 3MKYB 4A0XA 2WB1N 1QBJA 1MIJA 3RIRA 4C2UA 1BR1A 2CSOA 3NWSA 2FQ4A 1MW7A 2O6GE 3L2WA 3TGNA 1KGSA 4ZZLA 1A04A 1YIJI 4UXNA 3JRIA 4OAZA 3DTEA 2ZC2A 2JQ7A 3BCBA 4CH7A 3D5RC 4JP0A 4ZDOA 4PGGA 2DBBA 3K9TA 3M8EA 5BOXA 2E34A 2FSWA 1YS7A 4F7ZA 1MZBA 1ZYRF 3WGHA 3L00A 2XC7A 5L3EA 1FSEA 2HOTA 1HQCA 3BLYA 2E7XA 2D5VA 1BR2A 1ZR4A 2X1CA 4AU7A 1X1BA 4BQAA 1PYVA 2RN7A 3C2BA 1Z3YA 5BPDA 1HC8A 1JUPA 2MD5A 3AG2H 4FE4A 1B8IB 2XF7A 2BZTA 4M3EA 4HQEA 3TBIA 5LHGA 2ZXIA 2QBYB 3J80Z 3KYLA 3HGYA 2VXDA 4DIQA 4LK0F 4UUSA 3OSGA 1R23A 2P7CB 4UHTA 4CA0A 3REOA 1F36A 4A0YA 2ZNYA 3D5SC 4QPOA 2KDOA 2G0EA 4E7IA 2PQ8A 5F0FA 3DEEA 4BJ5C 4A3GJ 2OU2A 2DYRH 3WTZA 1BBYA 2FXAA 3PQJA 4XLPF 2DMNA 2L7FP 2M9HA 1MH4A 1ZQ3P 3J7AY 3JRBA 2F4MB 2DA7A 2ETHA 4DQ2A 5HLTA 1T08B 3MZYA 3WTSC 4YEJA 1QZZA 1D8JA 3WE2A 1RIOH 3WU2C 2QENA 2LTPA 1VQMI 1SFUA 3OL3A 3CDIA 2ME6A 4AYBA 2VUMJ 3C3WA 3DLAA 4BXUA 4IHSA 4QTRA 1LFPA 3RTRA 3V7RA 1G6NA 5K5OA 4KN4X 1B72B 4FHTA 4A3FJ 4BDYA 1LFUP 3BR5A 4L0ZB 3P7NA 3SDGA 3A4CA 3ONQA 3QP5A 1VQOI 4ESJA 1BIBA 2GWRA 5J1YA 2V1NA 2RKHA 2ZSHB 4XSXF 4BXFA 2DOAA 5AIQA 1TZLA 1KU2A 3HSEA 4HG2A 2CG4A 3JRGA 1FMVA 3GX4X 4L9JA 1X3UA 1HKSA 3FF5A 3JTHA 2IW5A 2IS6A 2J5OA 3VYRB 2ADUA 1SD7A 3BQYA 4JX5A 3RDIA 3ZQCA 2CUZA 3R0AA 3BG3A 1S8NA 2K5CA 4AIHA 1HXDA 2E7WA 2HOEA 3M9AA 5JFRA 2TDXA 2DFHA 5K5QA 4O6JA 1XD7A 1R1TA 1V4RA 3QODA 5HDNA 1U78A 2VE8A 5H2FC 2K40A 1DDNA 2LY1A 4DBQA 1P4WA 1DP7P 1TWGJ 4MEYF 1QZEA 2EA4A 3HOVJ 4ESBA 3ZMZA 3PIPF 2UZKA 4KT5C 3CUQB 5DS9A 3TO6A 1P4AA 3T0YA 3W6KB 3MAJA 1IC8A 2IA0A 2LK2A 1A6IA 2Q2EB 3ZMVA 1HOMA 1V5EA 3TMOA 1S3JA 3LA7A 1X1AA 2KIFA 2O8KA 5CKTA 2Q1ZB 1YX5A 2Y0SN 1V3FA 2PMZA 3FWEA 1NG7A 2FBKA 4B44A 2K3PA 5F1JA 1S5LC 3CCUI 1NK2P 2EA2A 4ENJA 2CUJA 1WKMA 1BW5A 4X6AJ 5M5XJ 4EQQA 3ZMSA 2UXNA 2KRHA 2EZHA 5K7FA 2Y9ZA 3S2DJ 2DA3A 2ZO4A 3VYUB 3OS2A 1K7AA 5FKLA 5JHUA 3JRDA 3V8JA 4G6QA 4L9NA 4IVNA 1KQ9A 4HLXA 3RKYA 2VXZA 1GHCA 1MNEA 1FX7A 2WY8Q 4LMYA 5KHDA 3IP4B 3M4OJ 2XRNA 3IAS2 5JI6A 2Y48A 4C2TA 3A0HC 4WXCA 1JT6A 4RGUA 2XB5A 3FKJA 5CVUA 3GFIA 1NHAA 2DFIA 1JHHA 1X2NA 1X1PA 3LSJA 1BC8C 1WVRA 2X0LA 4RDUA 3EUAA 5D5WB 3S3NA 2RVCA 4BQOA 2M30A 3LWFA 1I1GA 1HDPA 1DQUA 3JRAA 2EFWA 4B43A 3IWFA 5EZHA 5EGOA 3CJTB 5L3CA 2DJIA 3OYCA 4A3KJ 2JVGA 1X1DA 2WV1A 2E2HJ 4G7OF 4KJZA 4E7JA 1H89C 3LSRA 3L1PA 4BY7J 2O0YA 1UG2A 2CRGA 2VT2A 4HV6A 1X4OA 4LG0A 4XKCA 3CQZJ 3Q0WA 5D6EA 3WU0A 2ZMEA 4UB6C 4C3JJ 4YG2F 3HOTA 3L7WA 4CYDA 4F3QA 3ASNH 2LY2A 3K4BA 1FBQA 1W5CC 2QYOA 3RJPA 3HOYJ 1QRYA 5FO5A 1YOVB 2ME0A 3KP6A 4RAGA 1W7PD 3CCYA 2CW7A 3VYTB 4RAFA 4DJAA 3SEQA 2JTVA 3KPHA 1ENHA 3QAHA 4YFNF 4BBRJ 4OMZA 4BQNA 4EEFG 4HEA2 4A0ZA 1EH7A 4PJ0C 1G3SA 1XTAA 2H8WA 5BNGA 4DZJA 1MMNA 2G7HA 3PJRA 3LFKA 2R3SA 1ON1A 2NAZA 5GADJ 2Y9YA 4MO7A 4X1EA 1LKXA 1FP1D 1KU7A 1ZH5A 2NXNB 3K70D 1O7FA 5DTDA 2QSHX 2AXTC 4ZDLA 2F2EA 1S7OA 5DCMA 1D1CA 3BPVA 5DEQA 1E3OC 2IT0A 3ZQGA 3WTYC 2STTA 2DLLA 5GTHC 1Y0NA 2BY1A 2V7FA 4LIUA 3K70C 2HS5A 4NHJA 2HXOA 3ISPA 2Y0MA 5E1XA 3S3OA 4KA4A 2BHYA 2VJIA 2GM4A 4DGWB 3GTPJ 4M6XA 3BWGA 3BPXA 1GXQA 1IV8A 2QZ8A 3QOEA 3I56I 4ENMA 5TISC 3PNTA 3K4JA 2P4WA 1WWXA 4AC0A 4I7HA 2Z9OA 3OYKA 5JR3A 3CCLI 1AU7A 5EYRA 1MJ9A 3B6AA 3NQOA 1DGWY 3I71A 4PJMA 3MMYB 4XICA 1XCVA 2WAEA 4IL6C 1GLNA 5ERIA 2ZFWA 1H88C 4CYCB 3WGIA 2M8GX 1V5GA 3E5UA 2Z3YA 1DPRA 3VSKA 1MGTA 1SFOJ 3AAFA 2ECCA 3LSPA 4XIDA 2IGNA 5HS8A 1LEBA 1P4XA 5GP9A 3VEPA 3GTOJ 4MEXF 2IA1A 2I10A 3H3UA 4A12A 2JN6A 4EJUA 3KP7A 1H9TA 3UNGC 4M74A 2F5CA 3K4MA 2O7OA 4G94A 5D6FA 3N97A 3G2BA 4RAZA 5JLXA 1XS9A 2CMPA 5C3EJ 4L9TA 4Y17A 2HOAA 3IUOA 2CGPA 1BI2A 1YO5C 2NVQJ 1NK3P 2BV6A 1K79A 5FROA 4I02A 3GZ5A 4II2A 3FM5A 2R0QC 3GFMA 1NTCA 2HYJA 5CVJA 5FD6A 5BMZA 1JTXA 5HOOA 5EEHA 3M1EA 4PZJA 1CF7A 1VQ4I 2E1MC 1REPC 3OYDA 1S7EA 2OPTA 4FT8A 4HNUA 2UV1A 2GA1A 2ID3A 5C44J 2EWNA 2BGCA 4CUGA 1W4MA 1UZCA 1IV6A 2MBFA 3KETA 3OYFA 3Q0UA 2FD5A 1R5ID 1LPQA 3E0JB 5CYVA 3JSOA 1J9IA 1WHUA 2JRTA 3AL0B 2D2WA 3P9CA 3I4PA 5E8IA 1JHFA 2FMLA 5DUIA 1X19A 2YX7A 3H9QA 1TNTA 3WG7H 2EFQA 4KISA 2HFHA 2R93J 2GXAA 1LDDA 5ICCA 2L54A 2V6CA 3DEUA 5FFXA 2JA6J 3V7SA 5AONA 2QQ8A 3E7LA 5CVVA 1IJWC 4LB6B 1HSTA 2QUFA 4Y52J 2EFNA 2PLYA 2BW3B 4AVPA 3ZQQA 1U9OA 3SYTA 1YJWI 2V9PA 1ETYA 3E5XA 1K83J 3H36A 3ABMH 4XMYA 3LFUA 4RLQA 4BE0A 2CFOA 4E7ZA 3ECHA 1IW7F 3AG3H 5IOZA 5EG0B 3K10A 5D5XB 4KIFA 4QPQA 2K4JA 3I0TA 4LLLA 3W2WA 5FJ8J 1H8AC 4Z2YA 3CCJI 3KIOA 1ZTRA 1XSXA 3S14J 1KYWA 4W97A 3TL4X 3G1OA 4P55A 2ZSIB 1F9NA 1B59A 5D4RA 2A6EF 1ZLKA 1TTYA 1T8IA 4GYIA 3QQAA 3TDUC 3AL0C 1HSJA 2HU9A 3DV8A 4E4HA 1ZG1A 2CQ7A 1SVMA 2XAQA 3A02A 1O57A 3I5UA 1I39A 2XGDA 3LSGA 1IN4A 1UG0A 4ESFA 3GBGA 1SANA 3ABKH 3TO9A 1PP7U 3HKZA 4XLCA 1ULYA 3SZTA 2I5UA 3K69A 2M7BA 3BTCA 3H0DA 4H0EA 1BI1A 4WF2A 4XONA 4D7MA 1APLC 2EB7A 3OIPA 2IGMA 1EV7A 4TV7A 5M3MJ 3Q9VA 1L0OC 1ETWA 5HS9A 3ABUA 4HX7A 3CJRB 3QYFA 5HVQC 1JKPC 2A05A 4N4OB 1KU9A 5B5EC 4A3MJ 2V4JC 4MGRA 2HI3A 2KISA 2VBYA 2DOEA 1RZ4A 4RMNA 5GPAA 1IN5A 2IP2A 2P5KA 3ZOBA 5IYBJ 1ZAOA 3ROUA 1KZHA 5FLMJ 1FOYA 1Z21A 4R79A 1JGSA 1P6RA 2ZXHA 4HDVA 3FMRA 1MMDA 3FBIB 4BY1J 4A3CJ 1HKTA 3BG9A 2WA0A 1F4KA 2W84A 1OYWA 2EPFA 2MFZA 1K78B 3SEZA 1TBXA 3HSFA 3GTKJ 3SJMA 1WPKA 3TW7A 2GXBA 2EV0A 5FLXK 2PJRA 4UNOA 4ON0A 2CQQA 2XDVA 1VQ5I 4YIRX 2HR3A 3CCRI 4G7ZF 1E3HA 1U8BA 3KFWX 2JSPA 4XOTA 6PAXA 3VFZA 2YSRA 2W25A 4I99C 3L2RA 4RGRA 3HC7A 3MKZA 2R5YB 3DXJF 2JPBA 5FLXZ 2MYSA 1ITYA 5B1AH 2KIQA 3W6JB 4DYQA 3FMSA 3MQ0A 2X9DA 4ZYDA 4XLFA 3BJ6A 3GTJJ 4A6DA 4KUMA 1T2KA 4F92B 2JA7J 1XB4A 2XGXA 5DYMA 1XGMA 5E3OA 5ILSA 4EJWA 4CCOA 4OOIA 1QO0D 1ACIA 1JJ6C 4G9YA 2X48A 2KZGA 4HDUA 3BQZA 3F6OA 1TL8A 2P8TA 4ASNA 4HW0A 4AWXB 4A3IJ 2N8GA 3DKXA 3J7ZI 4ZTJA 3OYLA 2B7EA 2HQAA 3FMQA 3TP0A 3PO2J 4NQWB 2CW0F 4L18B 3EUHC 2EIJH 2LC2A 2ZXWH 1VNDA 4EGZA 1U5TB 2DOFA 4NBQA 4BU2A 2DQLA 4HYEA 1YIOA 4CCMA 1R71A 1MMGA 1J75A 1I50J 4CHUA 5FFZA 1SFXA 1TLHB 4C30A 3VB2A 2QM3A 1WJ5A 3F8MA 3MKWB 4E7HA 3IH3A 2QEXI 2XF5A 3BY6A 1BI0A 1OCTC 1OCZH 4BJ6C 2E1CA 2GXGA 1G3YA 2L7KA 1BJZA 3F72A 3TOBA 4L0YB 2X6WA 2R7XA 3ZRGA 2Y2ZA 3F0CA 2JA5J 1PUFB 4HF2A 1SD5A 2L0KA 2VBZA 4DOZA 3K0LA 4U0YA 2CWEA 2DA6A 2IEKA 5IP7J 1GVDA 2KJBA 5IP9J 1X4PA 1TWFJ 4IOAF 4BKXA 2XAGA 2WTEA 4PCQA 2CV2A 5GAEJ 3IKVA 3FXMA 3V7CA 1B4AA 3S1NJ 1JGGA 2BXZA 3HL2A 2OCEA 5HODA 2O8XA 3FBNB 4V2FA 4S0HB 2DDAA 1YW9A 3A03A 3RKWA 1JE8A 2VQGA 4XKWA 1U5TC 1L3LA 4KMFA 2VOOA 4II3A 2F6CA 4IHXA 3HPHA 1HW2A 5E79C 2XAHA 3BZKA 3GTGJ 5FKNA 4P5OA 1YJ9I 1B9MA 4HF1A 3J80K 3VPRA 2TCTA 1WJEA 1ETQA 3TO7A 1GV2A 3OOPA 1KONA 1R4NB 5E3MA 1WI3A 4UB8C 2LBFA 4Y7NJ 3C7JA 4XLHA 3IHUA 5E17F 4XRSA 2OZUA 3CJQB 2HVQA 4UVAA 3BZ6A 2HYGD 1B1BA 2ESNA 2NOJB 1RC9A 3CZ6A 4I2OA 2VJ4A 1P92A 3K2ZA 1T39A 3K7AJ 1V55H 1JT0A 5D8KB 4MTDA 1B8IA 4UUSB 3FISA 1Z6TA 2R92J 2R7FA 3SQNA 2HNHA 2OAZA 2PX9A 4MNUA 4WWCA 3TEDA 1EJ9A 3LOCA 4RB1A 1ON2A 2LG4A 4ZH4F 3BOQA 2WAQN 3FX3A 3WU1B 1SFEA 2M0MA 2IS1A 3MN2A 3HYIA 1XDSA 2GAUA 1UHMA 5E8GA 4QWQA 2EIKH 3G71I 2GZWA 2DI3A 3DTKA 1BIAA 2MD0A 2WWYA 2PMUA 2O9LA 4MQVA 2W4SA 1OMIA 2A69F 2LD5A 3S17J 2DT7B 1TT5B 4D5CA 1Y8RB 2K27A 3DLLF 1TP4A 1VQ9I 3V8KA 4UY8I 4BJTA 2XPUA 3QWLA 3VDXA 4LJZF 2F5EA 4CO8A 1FTTA 2P7VB 3ESWB 4OU0A 4A3LJ 2VL8A 4EVIA 4IRGA 2VJJA 3FXUA 1KQ8A 4I01A 3DPTA 1J2XA 1XMXA 4BHBA 3PUBA 3BC8A 3O8GA 3R4KA 4QSHA 1WJBA 2IA2A 3A1YA 5CQGA 2NS0A 5ILUA 5IOYA 2VC1A 3I59A 5KK1A 4WXHA 1MBKA 3U1KA 2DW4A 1OLTA 3LMMA 3OOUA 1GVJA 2XPVA 4M3BA 3H9GA 2E5ZA 4OIQF 5BS6A 5LBQA 3OYNA 3GLXA 4PJLA 3K4CA 1VQ7I 3CD6I 3O2PE 3CUOA 3HEFA 2MLGA 3LSMA 3RI4A 1RUNA 5F6FA 5FKKA 2ZJQF 4RM2A 2ICWG 3KEYA 2QKMB 2EK5A 4IPAA 1Z6RA 5FD5A 1R4MB 1LJ9A 1SAUA 2GIVA 5A2QK 3SFZA 1OISA 1X3WB 5K7HA 1MDMB 2DTZA 1BL0A 1OJLA 2HOSA 1FBSA 4JBAA 3M07A 1R5HA 1FY7A 1K6YA 3ZN1A 3QYBA 2CUFA 2Q2EA 5K1YA 1GT0C 1D1AA 4DYRA 3PIOF 3U9GA 2OV7A 2UUZA 3BDDA 3VYSB 2GQQA 2K9MA 4BHPA 4DYCA 5A2QZ 5CPRB 4A3EJ 5BPIA 3PFIA 1SD4A 2R5ZA 3MFKA 1YYVA 3CJNA 4AD9A 2EH3A 4PSXA 2XKOA 3DWLE 4XBFA 1FZPB 1OR7C 3U1DA 5KAFC 2FNPA 3DU5A 3AFHA 3HOUJ 4XQFA 3OYJA 1ERDA 4PGHA 3JRCA 4NDLA 2HYFA 5TJJA 3L2VA 2HDWA 5LGTA 2LREA 3CUQC 2A68F 2VN2A 4M6YA 1MH3A 2ELHA 4RB3C 4BACA 1F1ZA 3QPTA 2QVOA 3K2AA 2M0CA 1MBGA 2WV0A 2VE9A 2HKOA 3E1SA 4Y15A 4HSRA 1I5ZA 3RZOJ 3LNQA 3BG7A 1MNDA 4CSWA 1T6SA 1W7PA 1DPUA 1OCRH 2Z16A 1K4TA 3FHZA 5E20A 3PNVA 2OQGA 5EGOB 2GLOA 3BTIA 3PUFA 5FKMA 1FEXA 2OA4A 2BBYA 3B6CA 3BCAA 3HOZJ 3LSIA 1Z7LA 1KU3A 4BEHA 2HQ5A 2AQFA 3KP4A 3QU6A 2K9SA 3H9JA 1P7IA 2L9VA 4LG0B 3HM5A 5LGNA 3G6EI 5CVRA 2ZMEB 1TW3A 1UFMA 5FRMA 1Z1DA 2IXSA 3GZ6A 1FOXA 5F08A 2BVLA 1DU0A 3A0BC 2XKPA 2UXXA 4ABZA 3D0SA 2YR2A 1AA7A 3G3ZA 5FGMA 2IS4A 3LL7A 1P9QC 1D1BA 1J0RA 4U0WA 3S1MJ 1STZA 1D8KA 1FIPA 3FZVA 1TNSA 3WTTC 3HB9A 4HPQA 1IAWA 5FLVA 2XAUA 3E3VA 1ZLJA 3LSTA 1VQ8I 1V54H 4S04A 3LQRA 2V1DA 1E0EA 1P2FA 2V9KA 3S2WA 1JKQC 3PO3J 3FKIJ 2R7ZJ 3F6VA 1TC3C 3L9FA 3ZQ7A 4OIRF 2K9NA 2QQAA 5D5UB 2V26A 5JHFA 2ZJRF 3GZNB 4F52A 5M5WJ 2X4HA 5DCMB 3DFGA 4A5NA 5J4VA 3FM3A 1RETA 2JMWA 3G73A 1EKEA 1ZKGA 2VJ5A 3FXKA 5J6XA 3SZPA 2M1BA 3DEWA 1U8RA 1Y0UA 4N9HA 4Y3OA 1BW6A 4IKFA 3L09A 4IHWA 5IYCJ 1ZG5A 2KJCA 2O5RA 1UAAA 3PSIA 2FU4A 3AG1H 3DBHB 3QU3A 3W3CA 2OTLI 1W5SA 2QA4I 1YW7A 3ABLH 1RKWA 4M3GA 4M9XA 2BY2A 2NNNA 3M8JA 4M73A 5IPAA 2FEZA 1HKQA 2Y75A 1EH6A 4OIOF 1I1SA 1GDTA 3V42A 1X2MA 1ORKA 4CCJA 2BHZA 1U2WA 5L3GA 2CU7A 3CP2A 3GXOA 5ICFA 3ZMUA 3OYHA 5LLQA 1YRNB 4G8XA 3H5RA 2RQPA 1GUUA 2KFDA 1A5JA 4DNCA 4YRVA 2D1HA 1A6QA 3PL8A 2IGOA 3BR3A 1AWCA 2R7OA 3KP2A 3VOEA 2VBWA 1HDDC 4A3JJ 3DTIA 4LIVA 4IOCF 4FASD 2WB1A 3CDHA 1W1WE 4XRMA 3V4GA 5E1ZB 3JRFA 3MZHA 1MSEC 1J59A 4RB2C 1LE8A 3KZIC 4HQMA 1O3RA 1V5FA 4ETSA 1U0JA 2FNAA 2VIXA 2K9LA 2CV0A 4IXAA 1PJRA 4ZC3A 2NS8A 3E5QA 1DGRM 4PK4A 2OQRA 4KMUX 1WJDA 3W2AA 4DBRA 3I3LA 3F8FA 4Q5SF 5LRSA 3WHCA 1YFHA 4HNTA 2K86A 5E3LA 2LKSA 5H6RA 4DZPA 1CF7B 3BJAA 2XUBA 4GO1A 1R9TJ 3H0GJ 2MC4A 3FXQA 3PSFA 5L3FA 2ZB9A 2P5LC 3ECOA 3FK6A 4AYBN 2VPRA 2AXLA 1N25A 4UV9A 4LFUA 2J5PA 1LQ1A 1X3ZB 1FTZA 3OS1A 4I98B 1WRJA 2JVHA 3A01A 1PUEE 2EZKA 2YUSA 1FOWA 1Q1VA 2WAFA 2R7WA 2H1LA 4HLYA 4BXXJ 4LGWA 2FF4A 1KA8A 1KQ0A 3K1PA 4M9SA 2AHQA 5J3LA 2VPLA 3ZQIA 2A61A 3LQQA 2VODA 3GYHX 3PQKA 4ZYAA 3HHHA 2VBXA 5LHHA 2CW8A 2EILH 3ZQFA 2RGVA 4L5IA 3K6GA 4A5MA 1VI0A 2VC0A 1E17A 2E35A 1SC7A 1FJLA 4P9UA 4CCLA 4BBSJ 3M8FA 2OD5A 4JOMA 1BC7C 5CJ9A 2RQQA 3Q5FA 1K61A 3OIOA 2K02A 4ANJA 3NRVA 2I8DA 3RSNA 2CO5A 3RQIA 1LVAA 4CZZA 2PN6A 3JREA 2EZLA 1OCPA 2XAFA 1S9HA 3PM1A 2KIUA 2KIMA 3KE2A 1LNWA 4ZTFA 4EJOA 5KCMA 1GXPA 4NB5A 3S16J 4CICA 3O8HA 1Z9CA 4HX8A 4QLCU 3GW2A 2QWWA 2W85A 2DA5A 2W48A 3GMEA 2XASA 3OY9A 4NC7A 4HSTA 5LHIA 2E2JJ 1IXCA 4M6VA 4KITB 5LRRA 1XDUA 4OIPF 3B02A 2ACJA 4NC8A 1R49A 2PMZN 2HVRA 4PSWA 4AM3A 2L9RA 1W5TA 5F0CA 5K7ZA 1QU3A 4BNCA 2IAIA 2OF7A 2E1NA 4D5FA 2L4MA 2IRFG 1T0FC 1JUSA 4IF4A 2VKDA 1F43A 2JUGA 4U7BA 3H3ZA 5C4JJ 4R1HA 1ZHFA 1BOBA 3WGGA 2L02A 3ZMTA 3CC2I 4UVBA 2KQRA 1SVLA 3RCOA 1U6GA 1ODDA 1QZYA 4LLGF 4OINF 1Z0XA 3NARA 4D0PA 3SXYA 4OMYA 2CUEA 2PMHA 4XNFA 5DM7F 2LMDA 1ZN2A 3HGGA 3CP8A 1IN7A 3HZJA 4KICA 5ICEA 1IF1A 1AKHB 2P5VA 2A6HF 2WC2A 2FBHA 2HKXA 1FT9A 2V6EA 2TRTA 1R36A 1YHQI 4D9JA 3OR2C 1Q1HA 2Y0SA 5GTIC 3LSHA 4FISA 4GDFA 2LRDA 4Y4RA 4XRSG 3D1NI 2ZFUA 3WTUC 4MFEA 2R7UA 1QHGA 2PJRB 1S72I 5DV5A 1ETKA 2P6SA 4B4CA 2HDDA 4FQGA 3WE3A 4M71A 1XCBA 2DXIA 3ASOH 4JX6A 3CMYA 2CYYA 4N0BA 5IYDJ 3COAC 2IJLA 2DU9A 2ZNZA 4BQQA 1JUMA 4B1RA 3EUHA 1ZR2A 2D1VA 3FXLA 1NG6A 3HUGA 4A6EA 1W0TA 2R7RA 3GVAA 4L5EA 4W1UA 2BOLA 1FNNA 4RAYA 2CV1A 3BJOA 3HRTA 2DAOA 4A3BJ 2VKHA 3GLLA 2GA2A 1EF4A 5CLSA 3TKYA 3CF2A 4MFDA 1IO2A 3S32A 4C3HJ 3W6VA 3DU6A 2FOWA 4NNJA 3OS0A 2K7LA 3HDDA 4AIKA 1YE9A 4KNYA 5F1RA 3HOSA 3P9IA 1XG1A 1D0ZA 1SD6A 2NNYA 3HRSA 1Y8QB 3B73A 4XN3A 3VWBA 3CLQA 2AO9A 3WTXC 3BP8A 4HOBA 5F64A 4WK8F 3CTAA 5JVTA 4XM3A 3FXRA 1YG2A 5JVGF 3JR9A 3I53A 2DA1A 2LF8A 4AUXA 2GIZA 1VFCA 2ZBKA 3HG9A 2HZTA 4OAYA 1OFCX 3IV5A 3EDPA 4HF0A 4NQWA 4Q48A 1M1EB 2DODA 2R7SA 1I6HJ 3HSRA 4ITVA 3OYIA 1ZRDA 2KKOA 1X58A 4HAMA 1Y56A 2NYXA 2XRLA 2JT1A 2G9WA 1U5TA 2E71A 2LFBA 2HPMA 3CC7I 3HXLA 2NS7A 2W00A 3Q3SA 1T56A 2CQXA 3CESA 5JLWA 1B6AA 3ZP5A 3D5LA 2VKEA 2F5DA 3SHFA 2Z2SB 1KYZA 3HTSB 3KYCB 3ZGKA 2QSFX 3JW4A 5IP6A 4H4KC 1RESA 3TDZC 1D0XA 1W0UA 2LDUA 2XSJC 2VQLA 4XR6A 1R1VA 2JWTA 2E19A 5K5RA 3H1CA 4G6DA 3F22A 4XL9A 2VB6A 3ZMDA 3F21A 2F5FA 3OWTA 2XPWA 1W36D 4J00A 4A93J 5LEJA 1G2HA 2X51A 5B3SH 3S1QJ 3CDLA 3CCEI 3DKYA 3KX2A 2O3FA 2Y31A 3C18A 2XSDC 1ETOA 2QLZA 4MQ9F 1U9NA 4ZYHA 1RPWA 4M72A 3BR0A 3FDYA 4JK1X 2V79A 4B3XA 3JCUC 1XC5A 1W36C 3S15J 2PFBA 1IDZA 1DUXC 4LB5A 1MJAA 1IN8A 5EEGA 2LVSA 2NVUB 4UUVA 4HNVA 3MEXA 2DFFA 3UR3C 1BM9A 1YX3A 1BOAA 2KPMA 2W57A 3RYPA 3BZCA 3SDBA 4XN0A 3KEQA 4BGDA 4KDPA 4AIDA 4KIGA 2E36A 2KZVA 3MZ8A 1FPQA 2CQKA 3RPUD 2LBFB 1U3EM 1MMSA 3K1MA 1MD0A 1IDYA 1R6RA 2P81A 3TP3A 1RR8C 1BN5A 2LH9A 1XGSA 2GOXB 1R58A 2E60A 1A36A 5DD8A 1WJFA 1TWHJ 3CF5F 2H6BA 2JA8J 4P96A 5TRDA 3DQVC 1RKTA 1OQYA 2QBYA 4GCVA 1TW2A 1WCMJ 4RM3A 2KHMA 1WI9A 2MABA 3T1BA 2BVMA 2M4GA 3HHGA 3HTUA 1UJ8A 2ISZA 1FOKA 3CMMA 1T98A 3E97A 5GAGJ 1RUOA 4BDZA 2JRMA 4B8XA 4EM0B 2X6OA 2LLKA 3RKXA 3R0JA 2DTRA 2LOOA 3KZYA 1UMQA 4WCGA 1JXSA 3IKTA 1D5YA 3OL4A 1R00A 3NWTA 3GO5A 4GGGA 2L7ZA 3GFJA 4F91B 1D0YA 2Z5UA 4B09A 1CGPA 1YITI 5HNFA 1D3YA 2F4OB 1FP2A 1JI8A 2FJ1A 2K85A 4FTHA 1I27A 1UB9A 3CMEI 3FXJA 4IHTA 3BR2A 5B66C 3FXOA 4M9ZA 2NVTJ 2H27A 3DBRB 3IH2A 1RNLA 3DCFA 4LK1F 3VSLA 1Z3XA 3CCQI 3M3YJ 1OCCH 3F8CA 1LFBA 2RAEA 2HTJA 5J1RA 1JKRC 4IZZA 3WG9A 4U0VA 3Q0VA 1B72A 3CLOA 2XHKA 5HLHA 3E6CC 3IH4A 4BE2A 2D45A 4P1WA 1G3TA 3G1LA 2QQ9A 2FBIA 3KEOA 4P9FA 3HBLA 4GRIA 4M3FA 4UVCA 1TWAJ 2Z33A 2CFXA 2JK3A 2ELJA 1LB2A 3TW6A 3T8RA 4EGYA 3GUDA 1OCOH 4O3MA 4LD5A 3T5XA 1WQ2A 2E5NA 4RGSA 2EV6A 1YW8A 1QVTA 3DPLC 1O7LA 3RZDJ 3N05A 2W24A 3E6BA 1WH5A 2M3AA 4YELA 3HRMA 3I59B 1MBHA 2FUG2 1AOYA 2EV5A 3HKZN 4A69C 5ICGA 4E7LA 5E1WA 5CQEA 4J19A 3TOAA 4CCNA 3OYGA 1FBUA 2HXIA 2EFPA 1XGOA 1JKOC 2EJRA 2RREA 3AKZA 5KVRA 1XN7A 5KNLA 1USSA 5LD2C 1YQAA 5TGTA 3H5AA 3IL2A 4U87A 3SFIA 1OR7A 3EETA 2STWA 3ML6A 2QSGX 1BJAA 4GFBA 1I6XA 2MGQA 2KRFA 4FX0A 2LKPA 4Y33A 5IT9K 2KT0A 3H3VK 3I4MJ 3CUQA 4JQFA 3MCZA 3L2QA 2LKXA 5M5YJ 3ZR8X 4C2MJ 2OJED 1FIAA 3KP5A 2Z99A 2EFOA 1MNMC 5HNHA 1O3SA 1POGA 4BHCA 2JJ7A 2F48A 4MIMA 3QPLA 1MDMA 4NC6A 1CQTA 3DKWA 1OPCA 5J8FA 3BROA 4WXDA 2IBDA 3EYIA 1IXRC 1P7JA 4PFOA 5FB2A 5B1BH 1NH3A 5H20A 5IT9Z 2GOMA 2OC6A 4R8HA 2HPIA 4YIFA 2BYVE 3BG5A 1ZREA 2X1EA 3R60A 5DDGA 4XK4A 5HDKA 3P5JA 3JTGA 3CCMI 2DDBA 4N9IA 4Z6YA 2R5ZB 4EM2A 3ZQLA 4IQJA 5F0HA 2C6YA 1QPIA 4LLNA 1HA8A 2P0WA 4KFCA 2L9SA 2QGUA 2R7QA 5L3BA 1HW1A 4IHVA 2B0LA 2KP6A 1YS6A 4I76A 2BY3A 3X2QH 2XF6A 2F5VA 2P6TA 3I54A 3ZN0A 3RKQA 5H6QA 1IUYA 3RQ4A 5ED4A 4ZYGA 4YFXF 2DN0A 1G4DA 5HS7A 2VT3A 4BH9A 3P9KA 3J81K 1Y1VJ 3WTWC 3BG6A 2ISYA 1S7AA 1HCRA 1MBJA 1B9NA 3R6SA 1QGPA 1QQIA 3HOXJ 4E6KG 4G7HF 2COMA 4Y13A 2UWMA 1ZGJA 4MTEA 3LSKA 2QCOA 3O6BB 5CVIA 3HRUA 4PJNA 1W7PB 2M5WA 1XGNA 1T33A 2ID6A 3E6DA 4E70A 5F04A 4IQ4A 3BT9A 4IRHA 1IN6A 5J8CA 4JYKA 4FETA 2AQEA 2EQRA 2H09A 4YFKF 4BYYA 3QRFF 1WFXA 1RRJA 4O5VA 4BEHB 3J81Z 2L2OA 1Y39A 2FOKA 3DF8A 2JZYA 2CJJA 4NUBA 3MVPA 5J1UA 2G7UA 4CZCA 1TQMA 1JTYA 3LAPA 4ENKA 1XSDA 2CH0A 3H35A 4RGXA 1QA6A 2CQNA 3F3XA 1EA3A 3F8BA 2PJPA 2X85A 2EBIA 3H5NA 1PP8F 3V8LA 3I58A 5ILVA 3U2RA 2DO7A 3H92A 2DMUA 1UHWA 2XB0X 2YS9A 2QF7A 3G1MA 5D5VB 1G59A 3IWZA 2PI0A 2L4AA 1ZELA 1XPXA 1QPMA 3KYDB 4CDGA 4ZJZA 2XIGA 3OMYA 4J01A 1RI7A 2RNJA 3N4MA 2DT6A 1ETXA 1F5TA 4IX7A 3K4LA 1IRFA 2DMPA 3T8TA 4RB0A 1VQPI 4L5JA 2KMUA 2VASA 4D1QA 2LNBA 2EZIA 2V1XA 3EQLF 4E7SA 5IY5H 3NEUA 2ZMEC 4M3DA 3AG4H 2B63J 1IUFA 2VONA 4E7KA 2H6CA 3LA3A 3GTMJ 2XAJA 2JA2A 2IPQX 2M34A 2MG4A 5LEKA 1Z67A 3M1CA 5L3DA 2VI6A 3DBLB 4PUSA 1GV5A 5FRNA 4F93B 3S93A 2QKLB 2EINH 2JSCA 2O03A 4HZFA 3S3MA 1TQPA 1TQIA 3R61A 4IRIA 3ERMA 1Z91A 1J09A 2DT5A 1JJ8C 1I3QJ 1WZ2A 1ZRCA 4XLNF 3I64A 4XSZF 4RA2A 2Y30A 4KYWA 3F8NA 3QP6A 1FMWA 3BTLA 4XOPA 3K4KA 3J7AO 4CGZA 3S1RJ 4CYCA 2RC4A 2E1MB 5DCFA 5DM6F 1I3AA 1OYYA 1YRNA 4JX4A 3I4NJ 3HIFA 1WGXA 4V2GA 1MBEA 2W7NA 3ZXSA 2IVMA 2AS5F 1Z05A 2PBIA 3GFLA 2E1OA 1LEAA 1UHSA 1VZ0A 2M45A 4MHGA 4PDKA 2ZXJA 1T38A 1J5YA 1IXSB 5J40A 3JAMK 2YU9J 1LE8B 2FE3A 2ZKZA 2R7TA 1IRZA 2ZCWA 2W1OA 3HPGA 1FWZA 2YX4A 1H0MA 2NRAC 3I55I 1H9GA 2RDPA 4Q4ZF 3ZCOA 5D4SA 2HZDA 3KLNA 4LITA 2YPRA 1VQNI 1ZGAA 2WADA 4HV5A 2VQCA 2GBYA 2A5YB 3IC7A 1ZRFA 3QPHA 2ELKA 3KP3A 1XMAA 5EZGA 2DMTA 2DQRA 3IRQA 1QHHD 2L3DA 3LA2A 2Q8KA 1VQ6I 3PNYA 2OCCH 5EF6A 3JAMZ 3JRHA 4EM1A 2FRHA 2MA3A 1G3WA 4XLAA 4C3IJ 3S2HJ 3QOPA 4GYGA 5IT3A 2L5QA 2OTJI 4CXFA 1T95A 2DJNA 3CO7C 5FKOA 4LOCA 2XROA 4BE1A 1G8XA 3CCVI 2K4BA 1VQLI 3GTLJ 1SAXA 3A01B 5LGUA 2LYCA 4XLEA 3WODF 2CS3A 2LP0A 2VOPA 4QIWN 1YLFA 2DA2A 1HBXG 3CC4I 2KLOA 4I09A 4RLFA 4XKBA 4K2EA 3KZZA 3M7GA 1XSVA 2KDZA 1Z77A 2H94A 2VQHA 3OR1C 3L2UA 2WAQA 3CMAI 2ZJPF 3ERED 1SVOA 4CCKA 2H1KA 2Z1DA 4EATA 3SZGA 2HTSA 4C9YA 2HDCA 1K4SA 1BR4A 4IO9F 4FX4A 2K9QA 1R1UA 3E6MA 2BW3A 1WSUA 4IJAA 4U7DA 1IG7A 3ABTA 2A6TA 3DP7A 3G4SI 1T0FA 2KL4A 4BS9A 2Q0OA 3OYBA 4B3AA 1WH7A 3IRRA 3W2VA 2R7VA 1FSHA 2L9NA 3KCCA 5EG0A 2X1DA 1BA5A 3FHNA 2ESHA 1K6OA 1S29A 4RBOA 2OUMA 2DK8A 2VLAA 2B9SA 1N78A 3C2HA 1XX5A 2L01A 4FE7A 9ANTA 2PG4A 5KAIC 1SMTA 5E3NA 2A5WA 3DPUA 1WJAA 1ZGWA 4D7NA 1YTYA 2RNGA 1YI2I 1OKRA 4F55A 4V19K 2V9VA 3EYYA 4G6TB 1MSFC 2W82A 1UELB 1HF0A 2O61A 2VKVA 2A3SA 3K1NA 1Z7UA 2DYSH
chains in the Genus database with same CATH topology
3ZQHA 4IHYA 4A93J 1G2HA 3S1QJ 3CDLA 5GPCA 2Y31A 2XSDC 1ETOA 3UKGA 5EEAA 4AC0A 5K7HA 1U9NA 1RPWA 2DTZA 1AU7A 5EYRA 3BR0A 1OJLA 1BL0A 2HOSA 1IGNA 3B6AA 4UUTA 4XICA 2DMQA 1XC5A 1DU6A 3S15J 1IDZA 2ECBA 2CUFA 4I6ZA 1H88C 2LVSA 4CYCB 1GT0C 4DYRA 2XGCA 4HNVA 2M8GX 1MNMC 4DYCA 2E2IJ 5M3FJ 1SFOJ 4A3EJ 2ECCA 3LSPA 3GTQJ 4XIDA 2R5ZA 2NOGA 5GP9A 3GTOJ 2EH3A 4FCYA 2I10A 2JN6A 1AKHA 1IDYA 2P81A 3QPSA 3TP3A 3HOUJ 2O7OA 3JRCA 4NDLA 2NVXJ 5JLXA 1XS9A 5C3EJ 1TWHJ 2HOAA 1VF9A 1MH3A 2JA8J 2NVQJ 1RKTA 1NK3P 3BTJA 5F27A 3K2AA 1WCMJ 2LY9A 2M0CA 1MBGA 2R0QC 5C4XJ 1NTCA 2HYJA 4DW6A 1JTXA 3RZOJ 3LNQA 4IEJA 2X6OA 2LLKA 1S7EA 2OPTA 4G12A 5EGOB 2GLOA 1UMQA 2ID3A 5C44J 1D5YA 3BTIA 5FKMA 4MLOA 2MW8A 2R5YA 1FEXA 1IV6A 2L7ZA 3B6CA 3HOZJ 2HQ5A 3Q0UA 2FD5A 4A3DJ 2K9SA 1P7IA 3HM5A 2FJ1A 4FTHA 3BR2A 3BR6A 2DA4A 2NVTJ 5F08A 3IH2A 3DCFA 1DU0A 2COBA 1TWCJ 3M3YJ 4ABZA 2XGEA 2R93J 1LFBA 2RAEA 5J1RA 1JKRC 2JA6J 2L7MP 3S1MJ 3Q0VA 1B72A 3E7LA 1IJWC 3IH4A 1FIPA 5FLVA 3HB9A 3G1LA 4Y52J 3MKLA 2H8RA 3HOWJ 3HBLA 1QVUA 4M3FA 1U9OA 2LR8A 1TWAJ 2JK3A 1ETYA 3FIWA 1K83J 3NAUA 3PO3J 3TW6A 1JKQC 3FKIJ 2R7ZJ 1TC3C 5IOZA 5EG0B 2K9NA 1AHDP 1QVTA 3RZDJ 1O4XA 1WH5A 3WHBA 5M5WJ 5FJ8J 1H8AC 1RETA 1MBHA 1ZTRA 2JMWA 3S14J 1ZK8A 4W97A 1ZKGA 3G1OA 5EDNA 3HKZN 4A69C 2NVYJ 2FX0A 3DEWA 4J19A 1RR7A 3OSFA 1Y1WJ 2HXIA 1JKOC 3QQAA 2MSYA 2M2EA 1BW6A 4IHWA 5IYCJ 3A02A 1PUFA 2XGDA 3LSGA 3SFIA 4M3GA 1RKWA 3GBGA 1MBFA 5IPAA 4GFBA 2MGQA 3FK7A 1SANA 1ETVA 2KT0A 3H3VK 3I4MJ 1GDTA 1X2MA 3BTCA 1HLVA 2LKXA 5M5YJ 4C2MJ 1FIAA 1ORKA 3BR1A 4D7MA 1APLC 2WB1N 2CU7A 1POGA 2JJ7A 1YRNB 4MIMA 3QPLA 5M3MJ 1ETWA 2FQ4A 1CQTA 1GUUA 3JRIA 2IBDA 1P7JA 1JKPC 1A5JA 4A3MJ 2HI3A 5GPAA 3BG5A 4JP0A 3BR3A 4XK4A 3ZOBA 5IYBJ 5FLMJ 2R5ZB 1HDDC 4A3JJ 3ZQLA 5F0HA 1QPIA 4BY1J 4XRMA 4A3CJ 3JRFA 1MSEC 3BG9A 1LE8A 2D5VA 2HOTA 4IHVA 4I76A 1ZR4A 3C2BA 3GTKJ 3RKQA 1JUPA 3SJMA 4FE4A 1B8IB 1WPKA 2DN0A 4M3EA 3TW7A 2NS8A 1Y1VJ 2CQQA 3HGYA 1HCRA 1MBJA 4UUSA 3HOXJ 3WHCA 3OSGA 1U8BA 5E3LA 2QCOA 4DZPA 1F36A 2ID6A 1T33A 1R9TJ 3H0GJ 2G0EA 5F04A 5F0FA 2ZB9A 3BT9A 3FK6A 4JYKA 4A3GJ 4AYBN 2EQRA 2R5YB 2VPRA 1ITYA 1FTZA 4DYQA 2DMNA 2L7FP 2M9HA 2X9DA 1MH4A 1ZQ3P 2CJJA 3A01A 3JRBA 2EZKA 2YUSA 3GTJJ 1Q1VA 2DA7A 3MVPA 4BXXJ 5J1UA 2JA7J 1JTYA 2AHQA 5J3LA 5E3OA 3ZQIA 2LTPA 2EBIA 1JJ6C 3ZQFA 1VI0A 2ME6A 2X48A 2VUMJ 1FJLA 3BQZA 2DMUA 4QTRA 2XB0X 2YS9A 2QF7A 3G1MA 4BBSJ 4A3IJ 2N8GA 1B72B 1K61A 3OIOA 4A3FJ 1LFUP 3BR5A 3TP0A 3PO2J 3SDGA 1ETXA 3RQIA 1VNDA 5J1YA 2DMPA 3JREA 2EZLA 1OCPA 3PM1A 1I50J 3JRGA 2EZIA 4M3DA 2B63J 1IUFA 3IH3A 3S16J 1OCTC 3O8HA 3BQYA 4JX5A 3GTMJ 3ZQCA 2DA5A 2W48A 3BG3A 2M34A 1BJZA 2MG4A 2E2JJ 2Y2ZA 3F0CA 2JA5J 2VI6A 1PUFB 4M6VA 1GV5A 2L0KA 1U78A 2DA6A 2IEKA 5IP7J 2PMZN 1GVDA 2K40A 5IP9J 1TWGJ 2L9RA 1TWFJ 4BKXA 5F0CA 3HOVJ 5K7ZA 2IAIA 2OF7A 4D5FA 5DS9A 3S1NJ 1JGGA 1IC8A 1JUSA 2LK2A 1F43A 1A6IA 5HODA 1JJ8C 1I3QJ 1HOMA 4V2FA 5C4JJ 4S0HB 3A03A 2Y30A 4IHXA 2O8KA 2Y0SN 3BTLA 3S1RJ 4CYCA 1Z0XA 5F1JA 3GTGJ 1NK2P 5FKNA 3NARA 1YRNA 3I4NJ 4JX4A 1BW5A 4X6AJ 1WGXA 5M5XJ 4V2GA 2CUEA 2TCTA 1MBEA 3VPRA 2EZHA 3HGGA 5K7FA 2Y9ZA 3S2DJ 2DA3A 1ETQA 1AKHB 2E1OA 1GV2A 1UHSA 5FKLA 3JRDA 5E3MA 1WI3A 2TRTA 4Y7NJ 2YU9J 4XRSA 1LE8B 1IRZA 3M4OJ 4FISA 1JT6A 4XRSG 3D1NI 2XB5A 4MFEA 1X2NA 2GBYA 3K7AJ 3LSJA 1ETKA 4B4CA 2HDDA 2ELKA 5EZGA 1JT0A 2DMTA 4RDUA 4JX6A 3CMYA 1B8IA 4UUSB 3FISA 2R92J 5EF6A 5IYDJ 3JRHA 1JUMA 4C3IJ 3S2HJ 4B1RA 1HDPA 3JRAA 1ZR2A 3TEDA 3LOCA 5EZHA 5EGOA 1W0TA 4L5EA 4W1UA 4A3KJ 2DJNA 2WAQN 5FKOA 2WV1A 4LOCA 4A3BJ 2E2HJ 1H89C 3LSRA 3L1PA 4BY7J 3MN2A 3GTLJ 1UG2A 2CRGA 1EF4A 3A01B 3CQZJ 3Q0WA 4C3JJ 2LP0A 4MFDA 4C3HJ 3W6VA 4QIWN 2DA2A 3HOYJ 2O9LA 3HDDA 2LD5A 3S17J 1QRYA 4D5CA 2KDZA 1Z77A 1XG1A 2ME0A 3CCYA 2XPUA 2AO9A 1ENHA 2H1KA 4BBRJ 4EEFG 1FTTA 3JR9A 4A3LJ 5BNGA 2K9QA 2DA1A 4DZJA 4AUXA 1IG7A 1VFCA 1OFCX 3IV5A 2Y9YA 4B3AA 1WH7A 4MO7A 4X1EA 1I6HJ 3O8GA 1X58A 4QSHA 5EG0A 2XRLA 1BA5A 5DTDA 4RBOA 2LFBA 5IOYA 1MBKA 2NS7A 3Q3SA 1T56A 2CQXA 4FE7A 9ANTA 5JLWA 1E3OC 3ZQGA 3OOUA 2VKEA 2XPVA 4M3BA 5E3NA 1ZGWA 4D7NA 5IP6A 1RESA 2HXOA 1W0UA 3HEFA 5FKKA 1MSFC 2GM4A 2JWTA 2E19A 1HF0A 2VKVA 3GTPJ 2XPWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQH A;  4IHY A;  4A93 J;  1G2H A;  3S1Q J;  3CDL A;  5GPC A;  2Y31 A;  2XSD C;  1ETO A;  3UKG A;  5EEA A;  4AC0 A;  5K7H A;  1U9N A;  1RPW A;  2DTZ A;  1AU7 A;  5EYR A;  3BR0 A;  1OJL A;  1BL0 A;  2HOS A;  1IGN A;  3B6A A;  4UUT A;  4XIC A;  2DMQ A;  1XC5 A;  1DU6 A;  3S15 J;  1IDZ A;  2ECB A;  2CUF A;  4I6Z A;  1H88 C;  2LVS A;  4CYC B;  1GT0 C;  4DYR A;  2XGC A;  4HNV A;  2M8G X;  1MNM C;  4DYC A;  2E2I J;  5M3F J;  1SFO J;  4A3E J;  2ECC A;  3LSP A;  3GTQ J;  4XID A;  2R5Z A;  2NOG A;  5GP9 A;  3GTO J;  2EH3 A;  4FCY A;  2I10 A;  2JN6 A;  1AKH A;  1IDY A;  2P81 A;  3QPS A;  3TP3 A;  3HOU J;  2O7O A;  3JRC A;  4NDL A;  2NVX J;  5JLX A;  1XS9 A;  5C3E J;  1TWH J;  2HOA A;  1VF9 A;  1MH3 A;  2JA8 J;  2NVQ J;  1RKT A;  1NK3 P;  3BTJ A;  5F27 A;  3K2A A;  1WCM J;  2LY9 A;  2M0C A;  1MBG A;  2R0Q C;  5C4X J;  1NTC A;  2HYJ A;  4DW6 A;  1JTX A;  3RZO J;  3LNQ A;  4IEJ A;  2X6O A;  2LLK A;  1S7E A;  2OPT A;  4G12 A;  5EGO B;  2GLO A;  1UMQ A;  2ID3 A;  5C44 J;  1D5Y A;  3BTI A;  5FKM A;  4MLO A;  2MW8 A;  2R5Y A;  1FEX A;  1IV6 A;  2L7Z A;  3B6C A;  3HOZ J;  2HQ5 A;  3Q0U A;  2FD5 A;  4A3D J;  2K9S A;  1P7I A;  3HM5 A;  2FJ1 A;  4FTH A;  3BR2 A;  3BR6 A;  2DA4 A;  2NVT J;  5F08 A;  3IH2 A;  3DCF A;  1DU0 A;  2COB A;  1TWC J;  3M3Y J;  4ABZ A;  2XGE A;  2R93 J;  1LFB A;  2RAE A;  5J1R A;  1JKR C;  2JA6 J;  2L7M P;  3S1M J;  3Q0V A;  1B72 A;  3E7L A;  1IJW C;  3IH4 A;  1FIP A;  5FLV A;  3HB9 A;  3G1L A;  4Y52 J;  3MKL A;  2H8R A;  3HOW J;  3HBL A;  1QVU A;  4M3F A;  1U9O A;  2LR8 A;  1TWA J;  2JK3 A;  1ETY A;  3FIW A;  1K83 J;  3NAU A;  3PO3 J;  3TW6 A;  1JKQ C;  3FKI J;  2R7Z J;  1TC3 C;  5IOZ A;  5EG0 B;  2K9N A;  1AHD P;  1QVT A;  3RZD J;  1O4X A;  1WH5 A;  3WHB A;  5M5W J;  5FJ8 J;  1H8A C;  1RET A;  1MBH A;  1ZTR A;  2JMW A;  3S14 J;  1ZK8 A;  4W97 A;  1ZKG A;  3G1O A;  5EDN A;  3HKZ N;  4A69 C;  2NVY J;  2FX0 A;  3DEW A;  4J19 A;  1RR7 A;  3OSF A;  1Y1W J;  2HXI A;  1JKO C;  3QQA A;  2MSY A;  2M2E A;  1BW6 A;  4IHW A;  5IYC J;  3A02 A;  1PUF A;  2XGD A;  3LSG A;  3SFI A;  4M3G A;  1RKW A;  3GBG A;  1MBF A;  5IPA A;  4GFB A;  2MGQ A;  3FK7 A;  1SAN A;  1ETV A;  2KT0 A;  3H3V K;  3I4M J;  1GDT A;  1X2M A;  3BTC A;  1HLV A;  2LKX A;  5M5Y J;  4C2M J;  1FIA A;  1ORK A;  3BR1 A;  4D7M A;  1APL C;  2WB1 N;  2CU7 A;  1POG A;  2JJ7 A;  1YRN B;  4MIM A;  3QPL A;  5M3M J;  1ETW A;  2FQ4 A;  1CQT A;  1GUU A;  3JRI A;  2IBD A;  1P7J A;  1JKP C;  1A5J A;  4A3M J;  2HI3 A;  5GPA A;  3BG5 A;  4JP0 A;  3BR3 A;  4XK4 A;  3ZOB A;  5IYB J;  5FLM J;  2R5Z B;  1HDD C;  4A3J J;  3ZQL A;  5F0H A;  1QPI A;  4BY1 J;  4XRM A;  4A3C J;  3JRF A;  1MSE C;  3BG9 A;  1LE8 A;  2D5V A;  2HOT A;  4IHV A;  4I76 A;  1ZR4 A;  3C2B A;  3GTK J;  3RKQ A;  1JUP A;  3SJM A;  4FE4 A;  1B8I B;  1WPK A;  2DN0 A;  4M3E A;  3TW7 A;  2NS8 A;  1Y1V J;  2CQQ A;  3HGY A;  1HCR A;  1MBJ A;  4UUS A;  3HOX J;  3WHC A;  3OSG A;  1U8B A;  5E3L A;  2QCO A;  4DZP A;  1F36 A;  2ID6 A;  1T33 A;  1R9T J;  3H0G J;  2G0E A;  5F04 A;  5F0F A;  2ZB9 A;  3BT9 A;  3FK6 A;  4JYK A;  4A3G J;  4AYB N;  2EQR A;  2R5Y B;  2VPR A;  1ITY A;  1FTZ A;  4DYQ A;  2DMN A;  2L7F P;  2M9H A;  2X9D A;  1MH4 A;  1ZQ3 P;  2CJJ A;  3A01 A;  3JRB A;  2EZK A;  2YUS A;  3GTJ J;  1Q1V A;  2DA7 A;  3MVP A;  4BXX J;  5J1U A;  2JA7 J;  1JTY A;  2AHQ A;  5J3L A;  5E3O A;  3ZQI A;  2LTP A;  2EBI A;  1JJ6 C;  3ZQF A;  1VI0 A;  2ME6 A;  2X48 A;  2VUM J;  1FJL A;  3BQZ A;  2DMU A;  4QTR A;  2XB0 X;  2YS9 A;  2QF7 A;  3G1M A;  4BBS J;  4A3I J;  2N8G A;  1B72 B;  1K61 A;  3OIO A;  4A3F J;  1LFU P;  3BR5 A;  3TP0 A;  3PO2 J;  3SDG A;  1ETX A;  3RQI A;  1VND A;  5J1Y A;  2DMP A;  3JRE A;  2EZL A;  1OCP A;  3PM1 A;  1I50 J;  3JRG A;  2EZI A;  4M3D A;  2B63 J;  1IUF A;  3IH3 A;  3S16 J;  1OCT C;  3O8H A;  3BQY A;  4JX5 A;  3GTM J;  3ZQC A;  2DA5 A;  2W48 A;  3BG3 A;  2M34 A;  1BJZ A;  2MG4 A;  2E2J J;  2Y2Z A;  3F0C A;  2JA5 J;  2VI6 A;  1PUF B;  4M6V A;  1GV5 A;  2L0K A;  1U78 A;  2DA6 A;  2IEK A;  5IP7 J;  2PMZ N;  1GVD A;  2K40 A;  5IP9 J;  1TWG J;  2L9R A;  1TWF J;  4BKX A;  5F0C A;  3HOV J;  5K7Z A;  2IAI A;  2OF7 A;  4D5F A;  5DS9 A;  3S1N J;  1JGG A;  1IC8 A;  1JUS A;  2LK2 A;  1F43 A;  1A6I A;  5HOD A;  1JJ8 C;  1I3Q J;  1HOM A;  4V2F A;  5C4J J;  4S0H B;  3A03 A;  2Y30 A;  4IHX A;  2O8K A;  2Y0S N;  3BTL A;  3S1R J;  4CYC A;  1Z0X A;  5F1J A;  3GTG J;  1NK2 P;  5FKN A;  3NAR A;  1YRN A;  3I4N J;  4JX4 A;  1BW5 A;  4X6A J;  1WGX A;  5M5X J;  4V2G A;  2CUE A;  2TCT A;  1MBE A;  3VPR A;  2EZH A;  3HGG A;  5K7F A;  2Y9Z A;  3S2D J;  2DA3 A;  1ETQ A;  1AKH B;  2E1O A;  1GV2 A;  1UHS A;  5FKL A;  3JRD A;  5E3M A;  1WI3 A;  2TRT A;  4Y7N J;  2YU9 J;  4XRS A;  1LE8 B;  1IRZ A;  3M4O J;  4FIS A;  1JT6 A;  4XRS G;  3D1N I;  2XB5 A;  4MFE A;  1X2N A;  2GBY A;  3K7A J;  3LSJ A;  1ETK A;  4B4C A;  2HDD A;  2ELK A;  5EZG A;  1JT0 A;  2DMT A;  4RDU A;  4JX6 A;  3CMY A;  1B8I A;  4UUS B;  3FIS A;  2R92 J;  5EF6 A;  5IYD J;  3JRH A;  1JUM A;  4C3I J;  3S2H J;  4B1R A;  1HDP A;  3JRA A;  1ZR2 A;  3TED A;  3LOC A;  5EZH A;  5EGO A;  1W0T A;  4L5E A;  4W1U A;  4A3K J;  2DJN A;  2WAQ N;  5FKO A;  2WV1 A;  4LOC A;  4A3B J;  2E2H J;  1H89 C;  3LSR A;  3L1P A;  4BY7 J;  3MN2 A;  3GTL J;  1UG2 A;  2CRG A;  1EF4 A;  3A01 B;  3CQZ J;  3Q0W A;  4C3J J;  2LP0 A;  4MFD A;  4C3H J;  3W6V A;  4QIW N;  2DA2 A;  3HOY J;  2O9L A;  3HDD A;  2LD5 A;  3S17 J;  1QRY A;  4D5C A;  2KDZ A;  1Z77 A;  1XG1 A;  2ME0 A;  3CCY A;  2XPU A;  2AO9 A;  1ENH A;  2H1K A;  4BBR J;  4EEF G;  1FTT A;  3JR9 A;  4A3L J;  5BNG A;  2K9Q A;  2DA1 A;  4DZJ A;  4AUX A;  1IG7 A;  1VFC A;  1OFC X;  3IV5 A;  2Y9Y A;  4B3A A;  1WH7 A;  4MO7 A;  4X1E A;  1I6H J;  3O8G A;  1X58 A;  4QSH A;  5EG0 A;  2XRL A;  1BA5 A;  5DTD A;  4RBO A;  2LFB A;  5IOY A;  1MBK A;  2NS7 A;  3Q3S A;  1T56 A;  2CQX A;  4FE7 A;  9ANT A;  5JLW A;  1E3O C;  3ZQG A;  3OOU A;  2VKE A;  2XPV A;  4M3B A;  5E3N A;  1ZGW A;  4D7N A;  5IP6 A;  1RES A;  2HXO A;  1W0U A;  3HEF A;  5FKK A;  1MSF C;  2GM4 A;  2JWT A;  2E19 A;  1HF0 A;  2VKV A;  3GTP J;  2XPW A; 
#chains in the Genus database with same CATH topology
 3ZQH A;  1SMY F;  4IHY A;  4HRI A;  3PFY A;  5GPC A;  3UKG A;  1MMA A;  1E2X A;  1N75 A;  2MH2 A;  1VTN C;  5EEA A;  4X0G A;  3EPZ A;  2IGK A;  1IGN A;  3F23 A;  4UUT A;  4HA8 A;  2DMQ A;  1DU6 A;  3GCM A;  2LF7 A;  2ECB A;  1BI3 A;  5HLG A;  1HW5 A;  2M87 A;  1X1C A;  1UST A;  4I6Z A;  3OV8 A;  1PDN C;  1LDJ A;  1MJB A;  1LUJ B;  1ZG3 A;  2M4K A;  5J47 A;  2XGC A;  2EIM H;  4S05 A;  2YU3 A;  2JUC A;  3C1D A;  2A07 F;  4BAY A;  1WJC A;  2E2I J;  4U88 A;  5M3F J;  2F4I A;  2WY7 Q;  4UV8 A;  3J7Y J;  4ZZD A;  3GTQ J;  2FMY A;  1J7K A;  1LVK A;  3MD2 A;  4PJJ A;  2OBP A;  1E3P A;  2NOG A;  3O3K A;  2XV4 S;  1TT0 A;  3L2C A;  3CCS I;  1FC3 A;  4A2U A;  3S8P A;  4B48 A;  4FCY A;  3K4N A;  1AKH A;  3QPS A;  1O3T A;  4AIJ A;  4XOR A;  2NVX J;  1K78 A;  4KN7 X;  1O3Q A;  3I9V 2;  4EJV A;  1XMK A;  1IRX A;  2DFE A;  3RYR A;  1VF9 A;  5HLI A;  4KIB A;  2X6Y A;  1SEU A;  2HEO A;  3BTJ A;  5F27 A;  4AVZ A;  1VQK I;  2LY9 A;  3CO6 C;  5C4X J;  1N77 A;  1C0W A;  3GEZ A;  2R4G A;  4HBL A;  4PFP A;  1QNT A;  3MWM A;  4DW6 A;  4OWR B;  2HQN A;  4IEJ A;  4BL0 B;  2X6X A;  2FA5 A;  3HUG B;  4G12 A;  3GF2 A;  2KRC A;  2HVS A;  4MLO A;  2MW8 A;  5HDG A;  2R5Y A;  2V1U A;  5E18 F;  2FQ3 A;  2Y69 H;  3LAJ A;  4EJT A;  4A3D J;  1R7J A;  4ZDP A;  2BEO A;  4EV0 A;  1SFK A;  2DPU A;  5DUK A;  2HGC A;  3BR6 A;  2DA4 A;  5J4Y A;  2HQR A;  2M7A A;  1ZAR A;  2COB A;  1R22 A;  1TWC J;  4KT6 A;  1ONV A;  3ELK A;  3RPQ A;  2XGE A;  4I0A A;  1FYM A;  2DCE A;  4EMS A;  1R5G A;  3WTV C;  3OYE A;  3F9K A;  4Q47 A;  5DD4 A;  2L7M P;  3QYE A;  3TQN A;  2M8E A;  4L9V A;  5AIP A;  3U21 A;  2ZJ2 A;  5BQT A;  2DK5 A;  2K3F A;  5LFA A;  3MKL A;  3OIQ A;  4LG3 A;  2H8R A;  1MKM A;  4YII A;  3HOW J;  3VOD A;  2BXY A;  1FYL A;  5EJC A;  2IS2 A;  1QVU A;  2LR8 A;  3FIW A;  3OYM A;  3NAU A;  4ENN A;  1D5V A;  3IAM 2;  1IRG A;  1IZ1 A;  1Y6I A;  2OZ6 A;  1AHD P;  2HWV A;  4ZYE A;  1O4X A;  3WHB A;  2JPC A;  2WBM A;  1A31 A;  1ZK8 A;  4WX9 A;  5EDN A;  1YJN I;  3ZPL A;  2NVY J;  3KLO A;  2R7D A;  4BUP A;  1LDK B;  3ULQ B;  1UCR A;  2FX0 A;  1RR7 A;  3A2K A;  3OSF A;  1Y1W J;  1OYI A;  3OYA A;  3C2G A;  2MSY A;  2M2E A;  3HJE A;  1EH8 A;  3GWZ A;  4XRF A;  2XVC A;  4RS8 A;  1PVE A;  2BY0 A;  2MH9 A;  4GXO A;  1PUF A;  2DPD A;  1FYK A;  3Q9S A;  1FLI A;  4N4N B;  1MBF A;  2MC3 A;  1A35 A;  5GAH J;  1S6L A;  4HX4 A;  2LSO A;  3FK7 A;  2MLK A;  5D8L B;  1ETV A;  2QQB A;  2RV8 A;  4I0B A;  2PEX A;  3JSP A;  1DP3 A;  4XKV A;  3RPU A;  1HLV A;  2BE5 F;  4B47 A;  3EUK L;  3BR1 A;  3MKY B;  4A0X A;  2WB1 N;  1QBJ A;  1MIJ A;  3RIR A;  4C2U A;  1BR1 A;  2CSO A;  3NWS A;  2FQ4 A;  1MW7 A;  2O6G E;  3L2W A;  3TGN A;  1KGS A;  4ZZL A;  1A04 A;  1YIJ I;  4UXN A;  3JRI A;  4OAZ A;  3DTE A;  2ZC2 A;  2JQ7 A;  3BCB A;  4CH7 A;  3D5R C;  4JP0 A;  4ZDO A;  4PGG A;  2DBB A;  3K9T A;  3M8E A;  5BOX A;  2E34 A;  2FSW A;  1YS7 A;  4F7Z A;  1MZB A;  1ZYR F;  3WGH A;  3L00 A;  2XC7 A;  5L3E A;  1FSE A;  2HOT A;  1HQC A;  3BLY A;  2E7X A;  2D5V A;  1BR2 A;  1ZR4 A;  2X1C A;  4AU7 A;  1X1B A;  4BQA A;  1PYV A;  2RN7 A;  3C2B A;  1Z3Y A;  5BPD A;  1HC8 A;  1JUP A;  2MD5 A;  3AG2 H;  4FE4 A;  1B8I B;  2XF7 A;  2BZT A;  4M3E A;  4HQE A;  3TBI A;  5LHG A;  2ZXI A;  2QBY B;  3J80 Z;  3KYL A;  3HGY A;  2VXD A;  4DIQ A;  4LK0 F;  4UUS A;  3OSG A;  1R23 A;  2P7C B;  4UHT A;  4CA0 A;  3REO A;  1F36 A;  4A0Y A;  2ZNY A;  3D5S C;  4QPO A;  2KDO A;  2G0E A;  4E7I A;  2PQ8 A;  5F0F A;  3DEE A;  4BJ5 C;  4A3G J;  2OU2 A;  2DYR H;  3WTZ A;  1BBY A;  2FXA A;  3PQJ A;  4XLP F;  2DMN A;  2L7F P;  2M9H A;  1MH4 A;  1ZQ3 P;  3J7A Y;  3JRB A;  2F4M B;  2DA7 A;  2ETH A;  4DQ2 A;  5HLT A;  1T08 B;  3MZY A;  3WTS C;  4YEJ A;  1QZZ A;  1D8J A;  3WE2 A;  1RIO H;  3WU2 C;  2QEN A;  2LTP A;  1VQM I;  1SFU A;  3OL3 A;  3CDI A;  2ME6 A;  4AYB A;  2VUM J;  3C3W A;  3DLA A;  4BXU A;  4IHS A;  4QTR A;  1LFP A;  3RTR A;  3V7R A;  1G6N A;  5K5O A;  4KN4 X;  1B72 B;  4FHT A;  4A3F J;  4BDY A;  1LFU P;  3BR5 A;  4L0Z B;  3P7N A;  3SDG A;  3A4C A;  3ONQ A;  3QP5 A;  1VQO I;  4ESJ A;  1BIB A;  2GWR A;  5J1Y A;  2V1N A;  2RKH A;  2ZSH B;  4XSX F;  4BXF A;  2DOA A;  5AIQ A;  1TZL A;  1KU2 A;  3HSE A;  4HG2 A;  2CG4 A;  3JRG A;  1FMV A;  3GX4 X;  4L9J A;  1X3U A;  1HKS A;  3FF5 A;  3JTH A;  2IW5 A;  2IS6 A;  2J5O A;  3VYR B;  2ADU A;  1SD7 A;  3BQY A;  4JX5 A;  3RDI A;  3ZQC A;  2CUZ A;  3R0A A;  3BG3 A;  1S8N A;  2K5C A;  4AIH A;  1HXD A;  2E7W A;  2HOE A;  3M9A A;  5JFR A;  2TDX A;  2DFH A;  5K5Q A;  4O6J A;  1XD7 A;  1R1T A;  1V4R A;  3QOD A;  5HDN A;  1U78 A;  2VE8 A;  5H2F C;  2K40 A;  1DDN A;  2LY1 A;  4DBQ A;  1P4W A;  1DP7 P;  1TWG J;  4MEY F;  1QZE A;  2EA4 A;  3HOV J;  4ESB A;  3ZMZ A;  3PIP F;  2UZK A;  4KT5 C;  3CUQ B;  5DS9 A;  3TO6 A;  1P4A A;  3T0Y A;  3W6K B;  3MAJ A;  1IC8 A;  2IA0 A;  2LK2 A;  1A6I A;  2Q2E B;  3ZMV A;  1HOM A;  1V5E A;  3TMO A;  1S3J A;  3LA7 A;  1X1A A;  2KIF A;  2O8K A;  5CKT A;  2Q1Z B;  1YX5 A;  2Y0S N;  1V3F A;  2PMZ A;  3FWE A;  1NG7 A;  2FBK A;  4B44 A;  2K3P A;  5F1J A;  1S5L C;  3CCU I;  1NK2 P;  2EA2 A;  4ENJ A;  2CUJ A;  1WKM A;  1BW5 A;  4X6A J;  5M5X J;  4EQQ A;  3ZMS A;  2UXN A;  2KRH A;  2EZH A;  5K7F A;  2Y9Z A;  3S2D J;  2DA3 A;  2ZO4 A;  3VYU B;  3OS2 A;  1K7A A;  5FKL A;  5JHU A;  3JRD A;  3V8J A;  4G6Q A;  4L9N A;  4IVN A;  1KQ9 A;  4HLX A;  3RKY A;  2VXZ A;  1GHC A;  1MNE A;  1FX7 A;  2WY8 Q;  4LMY A;  5KHD A;  3IP4 B;  3M4O J;  2XRN A;  3IAS 2;  5JI6 A;  2Y48 A;  4C2T A;  3A0H C;  4WXC A;  1JT6 A;  4RGU A;  2XB5 A;  3FKJ A;  5CVU A;  3GFI A;  1NHA A;  2DFI A;  1JHH A;  1X2N A;  1X1P A;  3LSJ A;  1BC8 C;  1WVR A;  2X0L A;  4RDU A;  3EUA A;  5D5W B;  3S3N A;  2RVC A;  4BQO A;  2M30 A;  3LWF A;  1I1G A;  1HDP A;  1DQU A;  3JRA A;  2EFW A;  4B43 A;  3IWF A;  5EZH A;  5EGO A;  3CJT B;  5L3C A;  2DJI A;  3OYC A;  4A3K J;  2JVG A;  1X1D A;  2WV1 A;  2E2H J;  4G7O F;  4KJZ A;  4E7J A;  1H89 C;  3LSR A;  3L1P A;  4BY7 J;  2O0Y A;  1UG2 A;  2CRG A;  2VT2 A;  4HV6 A;  1X4O A;  4LG0 A;  4XKC A;  3CQZ J;  3Q0W A;  5D6E A;  3WU0 A;  2ZME A;  4UB6 C;  4C3J J;  4YG2 F;  3HOT A;  3L7W A;  4CYD A;  4F3Q A;  3ASN H;  2LY2 A;  3K4B A;  1FBQ A;  1W5C C;  2QYO A;  3RJP A;  3HOY J;  1QRY A;  5FO5 A;  1YOV B;  2ME0 A;  3KP6 A;  4RAG A;  1W7P D;  3CCY A;  2CW7 A;  3VYT B;  4RAF A;  4DJA A;  3SEQ A;  2JTV A;  3KPH A;  1ENH A;  3QAH A;  4YFN F;  4BBR J;  4OMZ A;  4BQN A;  4EEF G;  4HEA 2;  4A0Z A;  1EH7 A;  4PJ0 C;  1G3S A;  1XTA A;  2H8W A;  5BNG A;  4DZJ A;  1MMN A;  2G7H A;  3PJR A;  3LFK A;  2R3S A;  1ON1 A;  2NAZ A;  5GAD J;  2Y9Y A;  4MO7 A;  4X1E A;  1LKX A;  1FP1 D;  1KU7 A;  1ZH5 A;  2NXN B;  3K70 D;  1O7F A;  5DTD A;  2QSH X;  2AXT C;  4ZDL A;  2F2E A;  1S7O A;  5DCM A;  1D1C A;  3BPV A;  5DEQ A;  1E3O C;  2IT0 A;  3ZQG A;  3WTY C;  2STT A;  2DLL A;  5GTH C;  1Y0N A;  2BY1 A;  2V7F A;  4LIU A;  3K70 C;  2HS5 A;  4NHJ A;  2HXO A;  3ISP A;  2Y0M A;  5E1X A;  3S3O A;  4KA4 A;  2BHY A;  2VJI A;  2GM4 A;  4DGW B;  3GTP J;  4M6X A;  3BWG A;  3BPX A;  1GXQ A;  1IV8 A;  2QZ8 A;  3QOE A;  3I56 I;  4ENM A;  5TIS C;  3PNT A;  3K4J A;  2P4W A;  1WWX A;  4AC0 A;  4I7H A;  2Z9O A;  3OYK A;  5JR3 A;  3CCL I;  1AU7 A;  5EYR A;  1MJ9 A;  3B6A A;  3NQO A;  1DGW Y;  3I71 A;  4PJM A;  3MMY B;  4XIC A;  1XCV A;  2WAE A;  4IL6 C;  1GLN A;  5ERI A;  2ZFW A;  1H88 C;  4CYC B;  3WGI A;  2M8G X;  1V5G A;  3E5U A;  2Z3Y A;  1DPR A;  3VSK A;  1MGT A;  1SFO J;  3AAF A;  2ECC A;  3LSP A;  4XID A;  2IGN A;  5HS8 A;  1LEB A;  1P4X A;  5GP9 A;  3VEP A;  3GTO J;  4MEX F;  2IA1 A;  2I10 A;  3H3U A;  4A12 A;  2JN6 A;  4EJU A;  3KP7 A;  1H9T A;  3UNG C;  4M74 A;  2F5C A;  3K4M A;  2O7O A;  4G94 A;  5D6F A;  3N97 A;  3G2B A;  4RAZ A;  5JLX A;  1XS9 A;  2CMP A;  5C3E J;  4L9T A;  4Y17 A;  2HOA A;  3IUO A;  2CGP A;  1BI2 A;  1YO5 C;  2NVQ J;  1NK3 P;  2BV6 A;  1K79 A;  5FRO A;  4I02 A;  3GZ5 A;  4II2 A;  3FM5 A;  2R0Q C;  3GFM A;  1NTC A;  2HYJ A;  5CVJ A;  5FD6 A;  5BMZ A;  1JTX A;  5HOO A;  5EEH A;  3M1E A;  4PZJ A;  1CF7 A;  1VQ4 I;  2E1M C;  1REP C;  3OYD A;  1S7E A;  2OPT A;  4FT8 A;  4HNU A;  2UV1 A;  2GA1 A;  2ID3 A;  5C44 J;  2EWN A;  2BGC A;  4CUG A;  1W4M A;  1UZC A;  1IV6 A;  2MBF A;  3KET A;  3OYF A;  3Q0U A;  2FD5 A;  1R5I D;  1LPQ A;  3E0J B;  5CYV A;  3JSO A;  1J9I A;  1WHU A;  2JRT A;  3AL0 B;  2D2W A;  3P9C A;  3I4P A;  5E8I A;  1JHF A;  2FML A;  5DUI A;  1X19 A;  2YX7 A;  3H9Q A;  1TNT A;  3WG7 H;  2EFQ A;  4KIS A;  2HFH A;  2R93 J;  2GXA A;  1LDD A;  5ICC A;  2L54 A;  2V6C A;  3DEU A;  5FFX A;  2JA6 J;  3V7S A;  5AON A;  2QQ8 A;  3E7L A;  5CVV A;  1IJW C;  4LB6 B;  1HST A;  2QUF A;  4Y52 J;  2EFN A;  2PLY A;  2BW3 B;  4AVP A;  3ZQQ A;  1U9O A;  3SYT A;  1YJW I;  2V9P A;  1ETY A;  3E5X A;  1K83 J;  3H36 A;  3ABM H;  4XMY A;  3LFU A;  4RLQ A;  4BE0 A;  2CFO A;  4E7Z A;  3ECH A;  1IW7 F;  3AG3 H;  5IOZ A;  5EG0 B;  3K10 A;  5D5X B;  4KIF A;  4QPQ A;  2K4J A;  3I0T A;  4LLL A;  3W2W A;  5FJ8 J;  1H8A C;  4Z2Y A;  3CCJ I;  3KIO A;  1ZTR A;  1XSX A;  3S14 J;  1KYW A;  4W97 A;  3TL4 X;  3G1O A;  4P55 A;  2ZSI B;  1F9N A;  1B59 A;  5D4R A;  2A6E F;  1ZLK A;  1TTY A;  1T8I A;  4GYI A;  3QQA A;  3TDU C;  3AL0 C;  1HSJ A;  2HU9 A;  3DV8 A;  4E4H A;  1ZG1 A;  2CQ7 A;  1SVM A;  2XAQ A;  3A02 A;  1O57 A;  3I5U A;  1I39 A;  2XGD A;  3LSG A;  1IN4 A;  1UG0 A;  4ESF A;  3GBG A;  1SAN A;  3ABK H;  3TO9 A;  1PP7 U;  3HKZ A;  4XLC A;  1ULY A;  3SZT A;  2I5U A;  3K69 A;  2M7B A;  3BTC A;  3H0D A;  4H0E A;  1BI1 A;  4WF2 A;  4XON A;  4D7M A;  1APL C;  2EB7 A;  3OIP A;  2IGM A;  1EV7 A;  4TV7 A;  5M3M J;  3Q9V A;  1L0O C;  1ETW A;  5HS9 A;  3ABU A;  4HX7 A;  3CJR B;  3QYF A;  5HVQ C;  1JKP C;  2A05 A;  4N4O B;  1KU9 A;  5B5E C;  4A3M J;  2V4J C;  4MGR A;  2HI3 A;  2KIS A;  2VBY A;  2DOE A;  1RZ4 A;  4RMN A;  5GPA A;  1IN5 A;  2IP2 A;  2P5K A;  3ZOB A;  5IYB J;  1ZAO A;  3ROU A;  1KZH A;  5FLM J;  1FOY A;  1Z21 A;  4R79 A;  1JGS A;  1P6R A;  2ZXH A;  4HDV A;  3FMR A;  1MMD A;  3FBI B;  4BY1 J;  4A3C J;  1HKT A;  3BG9 A;  2WA0 A;  1F4K A;  2W84 A;  1OYW A;  2EPF A;  2MFZ A;  1K78 B;  3SEZ A;  1TBX A;  3HSF A;  3GTK J;  3SJM A;  1WPK A;  3TW7 A;  2GXB A;  2EV0 A;  5FLX K;  2PJR A;  4UNO A;  4ON0 A;  2CQQ A;  2XDV A;  1VQ5 I;  4YIR X;  2HR3 A;  3CCR I;  4G7Z F;  1E3H A;  1U8B A;  3KFW X;  2JSP A;  4XOT A;  6PAX A;  3VFZ A;  2YSR A;  2W25 A;  4I99 C;  3L2R A;  4RGR A;  3HC7 A;  3MKZ A;  2R5Y B;  3DXJ F;  2JPB A;  5FLX Z;  2MYS A;  1ITY A;  5B1A H;  2KIQ A;  3W6J B;  4DYQ A;  3FMS A;  3MQ0 A;  2X9D A;  4ZYD A;  4XLF A;  3BJ6 A;  3GTJ J;  4A6D A;  4KUM A;  1T2K A;  4F92 B;  2JA7 J;  1XB4 A;  2XGX A;  5DYM A;  1XGM A;  5E3O A;  5ILS A;  4EJW A;  4CCO A;  4OOI A;  1QO0 D;  1ACI A;  1JJ6 C;  4G9Y A;  2X48 A;  2KZG A;  4HDU A;  3BQZ A;  3F6O A;  1TL8 A;  2P8T A;  4ASN A;  4HW0 A;  4AWX B;  4A3I J;  2N8G A;  3DKX A;  3J7Z I;  4ZTJ A;  3OYL A;  2B7E A;  2HQA A;  3FMQ A;  3TP0 A;  3PO2 J;  4NQW B;  2CW0 F;  4L18 B;  3EUH C;  2EIJ H;  2LC2 A;  2ZXW H;  1VND A;  4EGZ A;  1U5T B;  2DOF A;  4NBQ A;  4BU2 A;  2DQL A;  4HYE A;  1YIO A;  4CCM A;  1R71 A;  1MMG A;  1J75 A;  1I50 J;  4CHU A;  5FFZ A;  1SFX A;  1TLH B;  4C30 A;  3VB2 A;  2QM3 A;  1WJ5 A;  3F8M A;  3MKW B;  4E7H A;  3IH3 A;  2QEX I;  2XF5 A;  3BY6 A;  1BI0 A;  1OCT C;  1OCZ H;  4BJ6 C;  2E1C A;  2GXG A;  1G3Y A;  2L7K A;  1BJZ A;  3F72 A;  3TOB A;  4L0Y B;  2X6W A;  2R7X A;  3ZRG A;  2Y2Z A;  3F0C A;  2JA5 J;  1PUF B;  4HF2 A;  1SD5 A;  2L0K A;  2VBZ A;  4DOZ A;  3K0L A;  4U0Y A;  2CWE A;  2DA6 A;  2IEK A;  5IP7 J;  1GVD A;  2KJB A;  5IP9 J;  1X4P A;  1TWF J;  4IOA F;  4BKX A;  2XAG A;  2WTE A;  4PCQ A;  2CV2 A;  5GAE J;  3IKV A;  3FXM A;  3V7C A;  1B4A A;  3S1N J;  1JGG A;  2BXZ A;  3HL2 A;  2OCE A;  5HOD A;  2O8X A;  3FBN B;  4V2F A;  4S0H B;  2DDA A;  1YW9 A;  3A03 A;  3RKW A;  1JE8 A;  2VQG A;  4XKW A;  1U5T C;  1L3L A;  4KMF A;  2VOO A;  4II3 A;  2F6C A;  4IHX A;  3HPH A;  1HW2 A;  5E79 C;  2XAH A;  3BZK A;  3GTG J;  5FKN A;  4P5O A;  1YJ9 I;  1B9M A;  4HF1 A;  3J80 K;  3VPR A;  2TCT A;  1WJE A;  1ETQ A;  3TO7 A;  1GV2 A;  3OOP A;  1KON A;  1R4N B;  5E3M A;  1WI3 A;  4UB8 C;  2LBF A;  4Y7N J;  3C7J A;  4XLH A;  3IHU A;  5E17 F;  4XRS A;  2OZU A;  3CJQ B;  2HVQ A;  4UVA A;  3BZ6 A;  2HYG D;  1B1B A;  2ESN A;  2NOJ B;  1RC9 A;  3CZ6 A;  4I2O A;  2VJ4 A;  1P92 A;  3K2Z A;  1T39 A;  3K7A J;  1V55 H;  1JT0 A;  5D8K B;  4MTD A;  1B8I A;  4UUS B;  3FIS A;  1Z6T A;  2R92 J;  2R7F A;  3SQN A;  2HNH A;  2OAZ A;  2PX9 A;  4MNU A;  4WWC A;  3TED A;  1EJ9 A;  3LOC A;  4RB1 A;  1ON2 A;  2LG4 A;  4ZH4 F;  3BOQ A;  2WAQ N;  3FX3 A;  3WU1 B;  1SFE A;  2M0M A;  2IS1 A;  3MN2 A;  3HYI A;  1XDS A;  2GAU A;  1UHM A;  5E8G A;  4QWQ A;  2EIK H;  3G71 I;  2GZW A;  2DI3 A;  3DTK A;  1BIA A;  2MD0 A;  2WWY A;  2PMU A;  2O9L A;  4MQV A;  2W4S A;  1OMI A;  2A69 F;  2LD5 A;  3S17 J;  2DT7 B;  1TT5 B;  4D5C A;  1Y8R B;  2K27 A;  3DLL F;  1TP4 A;  1VQ9 I;  3V8K A;  4UY8 I;  4BJT A;  2XPU A;  3QWL A;  3VDX A;  4LJZ F;  2F5E A;  4CO8 A;  1FTT A;  2P7V B;  3ESW B;  4OU0 A;  4A3L J;  2VL8 A;  4EVI A;  4IRG A;  2VJJ A;  3FXU A;  1KQ8 A;  4I01 A;  3DPT A;  1J2X A;  1XMX A;  4BHB A;  3PUB A;  3BC8 A;  3O8G A;  3R4K A;  4QSH A;  1WJB A;  2IA2 A;  3A1Y A;  5CQG A;  2NS0 A;  5ILU A;  5IOY A;  2VC1 A;  3I59 A;  5KK1 A;  4WXH A;  1MBK A;  3U1K A;  2DW4 A;  1OLT A;  3LMM A;  3OOU A;  1GVJ A;  2XPV A;  4M3B A;  3H9G A;  2E5Z A;  4OIQ F;  5BS6 A;  5LBQ A;  3OYN A;  3GLX A;  4PJL A;  3K4C A;  1VQ7 I;  3CD6 I;  3O2P E;  3CUO A;  3HEF A;  2MLG A;  3LSM A;  3RI4 A;  1RUN A;  5F6F A;  5FKK A;  2ZJQ F;  4RM2 A;  2ICW G;  3KEY A;  2QKM B;  2EK5 A;  4IPA A;  1Z6R A;  5FD5 A;  1R4M B;  1LJ9 A;  1SAU A;  2GIV A;  5A2Q K;  3SFZ A;  1OIS A;  1X3W B;  5K7H A;  1MDM B;  2DTZ A;  1BL0 A;  1OJL A;  2HOS A;  1FBS A;  4JBA A;  3M07 A;  1R5H A;  1FY7 A;  1K6Y A;  3ZN1 A;  3QYB A;  2CUF A;  2Q2E A;  5K1Y A;  1GT0 C;  1D1A A;  4DYR A;  3PIO F;  3U9G A;  2OV7 A;  2UUZ A;  3BDD A;  3VYS B;  2GQQ A;  2K9M A;  4BHP A;  4DYC A;  5A2Q Z;  5CPR B;  4A3E J;  5BPI A;  3PFI A;  1SD4 A;  2R5Z A;  3MFK A;  1YYV A;  3CJN A;  4AD9 A;  2EH3 A;  4PSX A;  2XKO A;  3DWL E;  4XBF A;  1FZP B;  1OR7 C;  3U1D A;  5KAF C;  2FNP A;  3DU5 A;  3AFH A;  3HOU J;  4XQF A;  3OYJ A;  1ERD A;  4PGH A;  3JRC A;  4NDL A;  2HYF A;  5TJJ A;  3L2V A;  2HDW A;  5LGT A;  2LRE A;  3CUQ C;  2A68 F;  2VN2 A;  4M6Y A;  1MH3 A;  2ELH A;  4RB3 C;  4BAC A;  1F1Z A;  3QPT A;  2QVO A;  3K2A A;  2M0C A;  1MBG A;  2WV0 A;  2VE9 A;  2HKO A;  3E1S A;  4Y15 A;  4HSR A;  1I5Z A;  3RZO J;  3LNQ A;  3BG7 A;  1MND A;  4CSW A;  1T6S A;  1W7P A;  1DPU A;  1OCR H;  2Z16 A;  1K4T A;  3FHZ A;  5E20 A;  3PNV A;  2OQG A;  5EGO B;  2GLO A;  3BTI A;  3PUF A;  5FKM A;  1FEX A;  2OA4 A;  2BBY A;  3B6C A;  3BCA A;  3HOZ J;  3LSI A;  1Z7L A;  1KU3 A;  4BEH A;  2HQ5 A;  2AQF A;  3KP4 A;  3QU6 A;  2K9S A;  3H9J A;  1P7I A;  2L9V A;  4LG0 B;  3HM5 A;  5LGN A;  3G6E I;  5CVR A;  2ZME B;  1TW3 A;  1UFM A;  5FRM A;  1Z1D A;  2IXS A;  3GZ6 A;  1FOX A;  5F08 A;  2BVL A;  1DU0 A;  3A0B C;  2XKP A;  2UXX A;  4ABZ A;  3D0S A;  2YR2 A;  1AA7 A;  3G3Z A;  5FGM A;  2IS4 A;  3LL7 A;  1P9Q C;  1D1B A;  1J0R A;  4U0W A;  3S1M J;  1STZ A;  1D8K A;  1FIP A;  3FZV A;  1TNS A;  3WTT C;  3HB9 A;  4HPQ A;  1IAW A;  5FLV A;  2XAU A;  3E3V A;  1ZLJ A;  3LST A;  1VQ8 I;  1V54 H;  4S04 A;  3LQR A;  2V1D A;  1E0E A;  1P2F A;  2V9K A;  3S2W A;  1JKQ C;  3PO3 J;  3FKI J;  2R7Z J;  3F6V A;  1TC3 C;  3L9F A;  3ZQ7 A;  4OIR F;  2K9N A;  2QQA A;  5D5U B;  2V26 A;  5JHF A;  2ZJR F;  3GZN B;  4F52 A;  5M5W J;  2X4H A;  5DCM B;  3DFG A;  4A5N A;  5J4V A;  3FM3 A;  1RET A;  2JMW A;  3G73 A;  1EKE A;  1ZKG A;  2VJ5 A;  3FXK A;  5J6X A;  3SZP A;  2M1B A;  3DEW A;  1U8R A;  1Y0U A;  4N9H A;  4Y3O A;  1BW6 A;  4IKF A;  3L09 A;  4IHW A;  5IYC J;  1ZG5 A;  2KJC A;  2O5R A;  1UAA A;  3PSI A;  2FU4 A;  3AG1 H;  3DBH B;  3QU3 A;  3W3C A;  2OTL I;  1W5S A;  2QA4 I;  1YW7 A;  3ABL H;  1RKW A;  4M3G A;  4M9X A;  2BY2 A;  2NNN A;  3M8J A;  4M73 A;  5IPA A;  2FEZ A;  1HKQ A;  2Y75 A;  1EH6 A;  4OIO F;  1I1S A;  1GDT A;  3V42 A;  1X2M A;  1ORK A;  4CCJ A;  2BHZ A;  1U2W A;  5L3G A;  2CU7 A;  3CP2 A;  3GXO A;  5ICF A;  3ZMU A;  3OYH A;  5LLQ A;  1YRN B;  4G8X A;  3H5R A;  2RQP A;  1GUU A;  2KFD A;  1A5J A;  4DNC A;  4YRV A;  2D1H A;  1A6Q A;  3PL8 A;  2IGO A;  3BR3 A;  1AWC A;  2R7O A;  3KP2 A;  3VOE A;  2VBW A;  1HDD C;  4A3J J;  3DTI A;  4LIV A;  4IOC F;  4FAS D;  2WB1 A;  3CDH A;  1W1W E;  4XRM A;  3V4G A;  5E1Z B;  3JRF A;  3MZH A;  1MSE C;  1J59 A;  4RB2 C;  1LE8 A;  3KZI C;  4HQM A;  1O3R A;  1V5F A;  4ETS A;  1U0J A;  2FNA A;  2VIX A;  2K9L A;  2CV0 A;  4IXA A;  1PJR A;  4ZC3 A;  2NS8 A;  3E5Q A;  1DGR M;  4PK4 A;  2OQR A;  4KMU X;  1WJD A;  3W2A A;  4DBR A;  3I3L A;  3F8F A;  4Q5S F;  5LRS A;  3WHC A;  1YFH A;  4HNT A;  2K86 A;  5E3L A;  2LKS A;  5H6R A;  4DZP A;  1CF7 B;  3BJA A;  2XUB A;  4GO1 A;  1R9T J;  3H0G J;  2MC4 A;  3FXQ A;  3PSF A;  5L3F A;  2ZB9 A;  2P5L C;  3ECO A;  3FK6 A;  4AYB N;  2VPR A;  2AXL A;  1N25 A;  4UV9 A;  4LFU A;  2J5P A;  1LQ1 A;  1X3Z B;  1FTZ A;  3OS1 A;  4I98 B;  1WRJ A;  2JVH A;  3A01 A;  1PUE E;  2EZK A;  2YUS A;  1FOW A;  1Q1V A;  2WAF A;  2R7W A;  2H1L A;  4HLY A;  4BXX J;  4LGW A;  2FF4 A;  1KA8 A;  1KQ0 A;  3K1P A;  4M9S A;  2AHQ A;  5J3L A;  2VPL A;  3ZQI A;  2A61 A;  3LQQ A;  2VOD A;  3GYH X;  3PQK A;  4ZYA A;  3HHH A;  2VBX A;  5LHH A;  2CW8 A;  2EIL H;  3ZQF A;  2RGV A;  4L5I A;  3K6G A;  4A5M A;  1VI0 A;  2VC0 A;  1E17 A;  2E35 A;  1SC7 A;  1FJL A;  4P9U A;  4CCL A;  4BBS J;  3M8F A;  2OD5 A;  4JOM A;  1BC7 C;  5CJ9 A;  2RQQ A;  3Q5F A;  1K61 A;  3OIO A;  2K02 A;  4ANJ A;  3NRV A;  2I8D A;  3RSN A;  2CO5 A;  3RQI A;  1LVA A;  4CZZ A;  2PN6 A;  3JRE A;  2EZL A;  1OCP A;  2XAF A;  1S9H A;  3PM1 A;  2KIU A;  2KIM A;  3KE2 A;  1LNW A;  4ZTF A;  4EJO A;  5KCM A;  1GXP A;  4NB5 A;  3S16 J;  4CIC A;  3O8H A;  1Z9C A;  4HX8 A;  4QLC U;  3GW2 A;  2QWW A;  2W85 A;  2DA5 A;  2W48 A;  3GME A;  2XAS A;  3OY9 A;  4NC7 A;  4HST A;  5LHI A;  2E2J J;  1IXC A;  4M6V A;  4KIT B;  5LRR A;  1XDU A;  4OIP F;  3B02 A;  2ACJ A;  4NC8 A;  1R49 A;  2PMZ N;  2HVR A;  4PSW A;  4AM3 A;  2L9R A;  1W5T A;  5F0C A;  5K7Z A;  1QU3 A;  4BNC A;  2IAI A;  2OF7 A;  2E1N A;  4D5F A;  2L4M A;  2IRF G;  1T0F C;  1JUS A;  4IF4 A;  2VKD A;  1F43 A;  2JUG A;  4U7B A;  3H3Z A;  5C4J J;  4R1H A;  1ZHF A;  1BOB A;  3WGG A;  2L02 A;  3ZMT A;  3CC2 I;  4UVB A;  2KQR A;  1SVL A;  3RCO A;  1U6G A;  1ODD A;  1QZY A;  4LLG F;  4OIN F;  1Z0X A;  3NAR A;  4D0P A;  3SXY A;  4OMY A;  2CUE A;  2PMH A;  4XNF A;  5DM7 F;  2LMD A;  1ZN2 A;  3HGG A;  3CP8 A;  1IN7 A;  3HZJ A;  4KIC A;  5ICE A;  1IF1 A;  1AKH B;  2P5V A;  2A6H F;  2WC2 A;  2FBH A;  2HKX A;  1FT9 A;  2V6E A;  2TRT A;  1R36 A;  1YHQ I;  4D9J A;  3OR2 C;  1Q1H A;  2Y0S A;  5GTI C;  3LSH A;  4FIS A;  4GDF A;  2LRD A;  4Y4R A;  4XRS G;  3D1N I;  2ZFU A;  3WTU C;  4MFE A;  2R7U A;  1QHG A;  2PJR B;  1S72 I;  5DV5 A;  1ETK A;  2P6S A;  4B4C A;  2HDD A;  4FQG A;  3WE3 A;  4M71 A;  1XCB A;  2DXI A;  3ASO H;  4JX6 A;  3CMY A;  2CYY A;  4N0B A;  5IYD J;  3COA C;  2IJL A;  2DU9 A;  2ZNZ A;  4BQQ A;  1JUM A;  4B1R A;  3EUH A;  1ZR2 A;  2D1V A;  3FXL A;  1NG6 A;  3HUG A;  4A6E A;  1W0T A;  2R7R A;  3GVA A;  4L5E A;  4W1U A;  2BOL A;  1FNN A;  4RAY A;  2CV1 A;  3BJO A;  3HRT A;  2DAO A;  4A3B J;  2VKH A;  3GLL A;  2GA2 A;  1EF4 A;  5CLS A;  3TKY A;  3CF2 A;  4MFD A;  1IO2 A;  3S32 A;  4C3H J;  3W6V A;  3DU6 A;  2FOW A;  4NNJ A;  3OS0 A;  2K7L A;  3HDD A;  4AIK A;  1YE9 A;  4KNY A;  5F1R A;  3HOS A;  3P9I A;  1XG1 A;  1D0Z A;  1SD6 A;  2NNY A;  3HRS A;  1Y8Q B;  3B73 A;  4XN3 A;  3VWB A;  3CLQ A;  2AO9 A;  3WTX C;  3BP8 A;  4HOB A;  5F64 A;  4WK8 F;  3CTA A;  5JVT A;  4XM3 A;  3FXR A;  1YG2 A;  5JVG F;  3JR9 A;  3I53 A;  2DA1 A;  2LF8 A;  4AUX A;  2GIZ A;  1VFC A;  2ZBK A;  3HG9 A;  2HZT A;  4OAY A;  1OFC X;  3IV5 A;  3EDP A;  4HF0 A;  4NQW A;  4Q48 A;  1M1E B;  2DOD A;  2R7S A;  1I6H J;  3HSR A;  4ITV A;  3OYI A;  1ZRD A;  2KKO A;  1X58 A;  4HAM A;  1Y56 A;  2NYX A;  2XRL A;  2JT1 A;  2G9W A;  1U5T A;  2E71 A;  2LFB A;  2HPM A;  3CC7 I;  3HXL A;  2NS7 A;  2W00 A;  3Q3S A;  1T56 A;  2CQX A;  3CES A;  5JLW A;  1B6A A;  3ZP5 A;  3D5L A;  2VKE A;  2F5D A;  3SHF A;  2Z2S B;  1KYZ A;  3HTS B;  3KYC B;  3ZGK A;  2QSF X;  3JW4 A;  5IP6 A;  4H4K C;  1RES A;  3TDZ C;  1D0X A;  1W0U A;  2LDU A;  2XSJ C;  2VQL A;  4XR6 A;  1R1V A;  2JWT A;  2E19 A;  5K5R A;  3H1C A;  4G6D A;  3F22 A;  4XL9 A;  2VB6 A;  3ZMD A;  3F21 A;  2F5F A;  3OWT A;  2XPW A;  1W36 D;  4J00 A;  4A93 J;  5LEJ A;  1G2H A;  2X51 A;  5B3S H;  3S1Q J;  3CDL A;  3CCE I;  3DKY A;  3KX2 A;  2O3F A;  2Y31 A;  3C18 A;  2XSD C;  1ETO A;  2QLZ A;  4MQ9 F;  1U9N A;  4ZYH A;  1RPW A;  4M72 A;  3BR0 A;  3FDY A;  4JK1 X;  2V79 A;  4B3X A;  3JCU C;  1XC5 A;  1W36 C;  3S15 J;  2PFB A;  1IDZ A;  1DUX C;  4LB5 A;  1MJA A;  1IN8 A;  5EEG A;  2LVS A;  2NVU B;  4UUV A;  4HNV A;  3MEX A;  2DFF A;  3UR3 C;  1BM9 A;  1YX3 A;  1BOA A;  2KPM A;  2W57 A;  3RYP A;  3BZC A;  3SDB A;  4XN0 A;  3KEQ A;  4BGD A;  4KDP A;  4AID A;  4KIG A;  2E36 A;  2KZV A;  3MZ8 A;  1FPQ A;  2CQK A;  3RPU D;  2LBF B;  1U3E M;  1MMS A;  3K1M A;  1MD0 A;  1IDY A;  1R6R A;  2P81 A;  3TP3 A;  1RR8 C;  1BN5 A;  2LH9 A;  1XGS A;  2GOX B;  1R58 A;  2E60 A;  1A36 A;  5DD8 A;  1WJF A;  1TWH J;  3CF5 F;  2H6B A;  2JA8 J;  4P96 A;  5TRD A;  3DQV C;  1RKT A;  1OQY A;  2QBY A;  4GCV A;  1TW2 A;  1WCM J;  4RM3 A;  2KHM A;  1WI9 A;  2MAB A;  3T1B A;  2BVM A;  2M4G A;  3HHG A;  3HTU A;  1UJ8 A;  2ISZ A;  1FOK A;  3CMM A;  1T98 A;  3E97 A;  5GAG J;  1RUO A;  4BDZ A;  2JRM A;  4B8X A;  4EM0 B;  2X6O A;  2LLK A;  3RKX A;  3R0J A;  2DTR A;  2LOO A;  3KZY A;  1UMQ A;  4WCG A;  1JXS A;  3IKT A;  1D5Y A;  3OL4 A;  1R00 A;  3NWT A;  3GO5 A;  4GGG A;  2L7Z A;  3GFJ A;  4F91 B;  1D0Y A;  2Z5U A;  4B09 A;  1CGP A;  1YIT I;  5HNF A;  1D3Y A;  2F4O B;  1FP2 A;  1JI8 A;  2FJ1 A;  2K85 A;  4FTH A;  1I27 A;  1UB9 A;  3CME I;  3FXJ A;  4IHT A;  3BR2 A;  5B66 C;  3FXO A;  4M9Z A;  2NVT J;  2H27 A;  3DBR B;  3IH2 A;  1RNL A;  3DCF A;  4LK1 F;  3VSL A;  1Z3X A;  3CCQ I;  3M3Y J;  1OCC H;  3F8C A;  1LFB A;  2RAE A;  2HTJ A;  5J1R A;  1JKR C;  4IZZ A;  3WG9 A;  4U0V A;  3Q0V A;  1B72 A;  3CLO A;  2XHK A;  5HLH A;  3E6C C;  3IH4 A;  4BE2 A;  2D45 A;  4P1W A;  1G3T A;  3G1L A;  2QQ9 A;  2FBI A;  3KEO A;  4P9F A;  3HBL A;  4GRI A;  4M3F A;  4UVC A;  1TWA J;  2Z33 A;  2CFX A;  2JK3 A;  2ELJ A;  1LB2 A;  3TW6 A;  3T8R A;  4EGY A;  3GUD A;  1OCO H;  4O3M A;  4LD5 A;  3T5X A;  1WQ2 A;  2E5N A;  4RGS A;  2EV6 A;  1YW8 A;  1QVT A;  3DPL C;  1O7L A;  3RZD J;  3N05 A;  2W24 A;  3E6B A;  1WH5 A;  2M3A A;  4YEL A;  3HRM A;  3I59 B;  1MBH A;  2FUG 2;  1AOY A;  2EV5 A;  3HKZ N;  4A69 C;  5ICG A;  4E7L A;  5E1W A;  5CQE A;  4J19 A;  3TOA A;  4CCN A;  3OYG A;  1FBU A;  2HXI A;  2EFP A;  1XGO A;  1JKO C;  2EJR A;  2RRE A;  3AKZ A;  5KVR A;  1XN7 A;  5KNL A;  1USS A;  5LD2 C;  1YQA A;  5TGT A;  3H5A A;  3IL2 A;  4U87 A;  3SFI A;  1OR7 A;  3EET A;  2STW A;  3ML6 A;  2QSG X;  1BJA A;  4GFB A;  1I6X A;  2MGQ A;  2KRF A;  4FX0 A;  2LKP A;  4Y33 A;  5IT9 K;  2KT0 A;  3H3V K;  3I4M J;  3CUQ A;  4JQF A;  3MCZ A;  3L2Q A;  2LKX A;  5M5Y J;  3ZR8 X;  4C2M J;  2OJE D;  1FIA A;  3KP5 A;  2Z99 A;  2EFO A;  1MNM C;  5HNH A;  1O3S A;  1POG A;  4BHC A;  2JJ7 A;  2F48 A;  4MIM A;  3QPL A;  1MDM A;  4NC6 A;  1CQT A;  3DKW A;  1OPC A;  5J8F A;  3BRO A;  4WXD A;  2IBD A;  3EYI A;  1IXR C;  1P7J A;  4PFO A;  5FB2 A;  5B1B H;  1NH3 A;  5H20 A;  5IT9 Z;  2GOM A;  2OC6 A;  4R8H A;  2HPI A;  4YIF A;  2BYV E;  3BG5 A;  1ZRE A;  2X1E A;  3R60 A;  5DDG A;  4XK4 A;  5HDK A;  3P5J A;  3JTG A;  3CCM I;  2DDB A;  4N9I A;  4Z6Y A;  2R5Z B;  4EM2 A;  3ZQL A;  4IQJ A;  5F0H A;  2C6Y A;  1QPI A;  4LLN A;  1HA8 A;  2P0W A;  4KFC A;  2L9S A;  2QGU A;  2R7Q A;  5L3B A;  1HW1 A;  4IHV A;  2B0L A;  2KP6 A;  1YS6 A;  4I76 A;  2BY3 A;  3X2Q H;  2XF6 A;  2F5V A;  2P6T A;  3I54 A;  3ZN0 A;  3RKQ A;  5H6Q A;  1IUY A;  3RQ4 A;  5ED4 A;  4ZYG A;  4YFX F;  2DN0 A;  1G4D A;  5HS7 A;  2VT3 A;  4BH9 A;  3P9K A;  3J81 K;  1Y1V J;  3WTW C;  3BG6 A;  2ISY A;  1S7A A;  1HCR A;  1MBJ A;  1B9N A;  3R6S A;  1QGP A;  1QQI A;  3HOX J;  4E6K G;  4G7H F;  2COM A;  4Y13 A;  2UWM A;  1ZGJ A;  4MTE A;  3LSK A;  2QCO A;  3O6B B;  5CVI A;  3HRU A;  4PJN A;  1W7P B;  2M5W A;  1XGN A;  1T33 A;  2ID6 A;  3E6D A;  4E70 A;  5F04 A;  4IQ4 A;  3BT9 A;  4IRH A;  1IN6 A;  5J8C A;  4JYK A;  4FET A;  2AQE A;  2EQR A;  2H09 A;  4YFK F;  4BYY A;  3QRF F;  1WFX A;  1RRJ A;  4O5V A;  4BEH B;  3J81 Z;  2L2O A;  1Y39 A;  2FOK A;  3DF8 A;  2JZY A;  2CJJ A;  4NUB A;  3MVP A;  5J1U A;  2G7U A;  4CZC A;  1TQM A;  1JTY A;  3LAP A;  4ENK A;  1XSD A;  2CH0 A;  3H35 A;  4RGX A;  1QA6 A;  2CQN A;  3F3X A;  1EA3 A;  3F8B A;  2PJP A;  2X85 A;  2EBI A;  3H5N A;  1PP8 F;  3V8L A;  3I58 A;  5ILV A;  3U2R A;  2DO7 A;  3H92 A;  2DMU A;  1UHW A;  2XB0 X;  2YS9 A;  2QF7 A;  3G1M A;  5D5V B;  1G59 A;  3IWZ A;  2PI0 A;  2L4A A;  1ZEL A;  1XPX A;  1QPM A;  3KYD B;  4CDG A;  4ZJZ A;  2XIG A;  3OMY A;  4J01 A;  1RI7 A;  2RNJ A;  3N4M A;  2DT6 A;  1ETX A;  1F5T A;  4IX7 A;  3K4L A;  1IRF A;  2DMP A;  3T8T A;  4RB0 A;  1VQP I;  4L5J A;  2KMU A;  2VAS A;  4D1Q A;  2LNB A;  2EZI A;  2V1X A;  3EQL F;  4E7S A;  5IY5 H;  3NEU A;  2ZME C;  4M3D A;  3AG4 H;  2B63 J;  1IUF A;  2VON A;  4E7K A;  2H6C A;  3LA3 A;  3GTM J;  2XAJ A;  2JA2 A;  2IPQ X;  2M34 A;  2MG4 A;  5LEK A;  1Z67 A;  3M1C A;  5L3D A;  2VI6 A;  3DBL B;  4PUS A;  1GV5 A;  5FRN A;  4F93 B;  3S93 A;  2QKL B;  2EIN H;  2JSC A;  2O03 A;  4HZF A;  3S3M A;  1TQP A;  1TQI A;  3R61 A;  4IRI A;  3ERM A;  1Z91 A;  1J09 A;  2DT5 A;  1JJ8 C;  1I3Q J;  1WZ2 A;  1ZRC A;  4XLN F;  3I64 A;  4XSZ F;  4RA2 A;  2Y30 A;  4KYW A;  3F8N A;  3QP6 A;  1FMW A;  3BTL A;  4XOP A;  3K4K A;  3J7A O;  4CGZ A;  3S1R J;  4CYC A;  2RC4 A;  2E1M B;  5DCF A;  5DM6 F;  1I3A A;  1OYY A;  1YRN A;  4JX4 A;  3I4N J;  3HIF A;  1WGX A;  4V2G A;  1MBE A;  2W7N A;  3ZXS A;  2IVM A;  2AS5 F;  1Z05 A;  2PBI A;  3GFL A;  2E1O A;  1LEA A;  1UHS A;  1VZ0 A;  2M45 A;  4MHG A;  4PDK A;  2ZXJ A;  1T38 A;  1J5Y A;  1IXS B;  5J40 A;  3JAM K;  2YU9 J;  1LE8 B;  2FE3 A;  2ZKZ A;  2R7T A;  1IRZ A;  2ZCW A;  2W1O A;  3HPG A;  1FWZ A;  2YX4 A;  1H0M A;  2NRA C;  3I55 I;  1H9G A;  2RDP A;  4Q4Z F;  3ZCO A;  5D4S A;  2HZD A;  3KLN A;  4LIT A;  2YPR A;  1VQN I;  1ZGA A;  2WAD A;  4HV5 A;  2VQC A;  2GBY A;  2A5Y B;  3IC7 A;  1ZRF A;  3QPH A;  2ELK A;  3KP3 A;  1XMA A;  5EZG A;  2DMT A;  2DQR A;  3IRQ A;  1QHH D;  2L3D A;  3LA2 A;  2Q8K A;  1VQ6 I;  3PNY A;  2OCC H;  5EF6 A;  3JAM Z;  3JRH A;  4EM1 A;  2FRH A;  2MA3 A;  1G3W A;  4XLA A;  4C3I J;  3S2H J;  3QOP A;  4GYG A;  5IT3 A;  2L5Q A;  2OTJ I;  4CXF A;  1T95 A;  2DJN A;  3CO7 C;  5FKO A;  4LOC A;  2XRO A;  4BE1 A;  1G8X A;  3CCV I;  2K4B A;  1VQL I;  3GTL J;  1SAX A;  3A01 B;  5LGU A;  2LYC A;  4XLE A;  3WOD F;  2CS3 A;  2LP0 A;  2VOP A;  4QIW N;  1YLF A;  2DA2 A;  1HBX G;  3CC4 I;  2KLO A;  4I09 A;  4RLF A;  4XKB A;  4K2E A;  3KZZ A;  3M7G A;  1XSV A;  2KDZ A;  1Z77 A;  2H94 A;  2VQH A;  3OR1 C;  3L2U A;  2WAQ A;  3CMA I;  2ZJP F;  3ERE D;  1SVO A;  4CCK A;  2H1K A;  2Z1D A;  4EAT A;  3SZG A;  2HTS A;  4C9Y A;  2HDC A;  1K4S A;  1BR4 A;  4IO9 F;  4FX4 A;  2K9Q A;  1R1U A;  3E6M A;  2BW3 A;  1WSU A;  4IJA A;  4U7D A;  1IG7 A;  3ABT A;  2A6T A;  3DP7 A;  3G4S I;  1T0F A;  2KL4 A;  4BS9 A;  2Q0O A;  3OYB A;  4B3A A;  1WH7 A;  3IRR A;  3W2V A;  2R7V A;  1FSH A;  2L9N A;  3KCC A;  5EG0 A;  2X1D A;  1BA5 A;  3FHN A;  2ESH A;  1K6O A;  1S29 A;  4RBO A;  2OUM A;  2DK8 A;  2VLA A;  2B9S A;  1N78 A;  3C2H A;  1XX5 A;  2L01 A;  4FE7 A;  9ANT A;  2PG4 A;  5KAI C;  1SMT A;  5E3N A;  2A5W A;  3DPU A;  1WJA A;  1ZGW A;  4D7N A;  1YTY A;  2RNG A;  1YI2 I;  1OKR A;  4F55 A;  4V19 K;  2V9V A;  3EYY A;  4G6T B;  1MSF C;  2W82 A;  1UEL B;  1HF0 A;  2O61 A;  2VKV A;  2A3S A;  3K1N A;  1Z7U A;  2DYS H; 
#chains in the Genus database with same CATH homology
 3ZQH A;  4IHY A;  4A93 J;  1G2H A;  3S1Q J;  3CDL A;  5GPC A;  2Y31 A;  2XSD C;  1ETO A;  3UKG A;  5EEA A;  4AC0 A;  5K7H A;  1U9N A;  1RPW A;  2DTZ A;  1AU7 A;  5EYR A;  3BR0 A;  1OJL A;  1BL0 A;  2HOS A;  1IGN A;  3B6A A;  4UUT A;  4XIC A;  2DMQ A;  1XC5 A;  1DU6 A;  3S15 J;  1IDZ A;  2ECB A;  2CUF A;  4I6Z A;  1H88 C;  2LVS A;  4CYC B;  1GT0 C;  4DYR A;  2XGC A;  4HNV A;  2M8G X;  1MNM C;  4DYC A;  2E2I J;  5M3F J;  1SFO J;  4A3E J;  2ECC A;  3LSP A;  3GTQ J;  4XID A;  2R5Z A;  2NOG A;  5GP9 A;  3GTO J;  2EH3 A;  4FCY A;  2I10 A;  2JN6 A;  1AKH A;  1IDY A;  2P81 A;  3QPS A;  3TP3 A;  3HOU J;  2O7O A;  3JRC A;  4NDL A;  2NVX J;  5JLX A;  1XS9 A;  5C3E J;  1TWH J;  2HOA A;  1VF9 A;  1MH3 A;  2JA8 J;  2NVQ J;  1RKT A;  1NK3 P;  3BTJ A;  5F27 A;  3K2A A;  1WCM J;  2LY9 A;  2M0C A;  1MBG A;  2R0Q C;  5C4X J;  1NTC A;  2HYJ A;  4DW6 A;  1JTX A;  3RZO J;  3LNQ A;  4IEJ A;  2X6O A;  2LLK A;  1S7E A;  2OPT A;  4G12 A;  5EGO B;  2GLO A;  1UMQ A;  2ID3 A;  5C44 J;  1D5Y A;  3BTI A;  5FKM A;  4MLO A;  2MW8 A;  2R5Y A;  1FEX A;  1IV6 A;  2L7Z A;  3B6C A;  3HOZ J;  2HQ5 A;  3Q0U A;  2FD5 A;  4A3D J;  2K9S A;  1P7I A;  3HM5 A;  2FJ1 A;  4FTH A;  3BR2 A;  3BR6 A;  2DA4 A;  2NVT J;  5F08 A;  3IH2 A;  3DCF A;  1DU0 A;  2COB A;  1TWC J;  3M3Y J;  4ABZ A;  2XGE A;  2R93 J;  1LFB A;  2RAE A;  5J1R A;  1JKR C;  2JA6 J;  2L7M P;  3S1M J;  3Q0V A;  1B72 A;  3E7L A;  1IJW C;  3IH4 A;  1FIP A;  5FLV A;  3HB9 A;  3G1L A;  4Y52 J;  3MKL A;  2H8R A;  3HOW J;  3HBL A;  1QVU A;  4M3F A;  1U9O A;  2LR8 A;  1TWA J;  2JK3 A;  1ETY A;  3FIW A;  1K83 J;  3NAU A;  3PO3 J;  3TW6 A;  1JKQ C;  3FKI J;  2R7Z J;  1TC3 C;  5IOZ A;  5EG0 B;  2K9N A;  1AHD P;  1QVT A;  3RZD J;  1O4X A;  1WH5 A;  3WHB A;  5M5W J;  5FJ8 J;  1H8A C;  1RET A;  1MBH A;  1ZTR A;  2JMW A;  3S14 J;  1ZK8 A;  4W97 A;  1ZKG A;  3G1O A;  5EDN A;  3HKZ N;  4A69 C;  2NVY J;  2FX0 A;  3DEW A;  4J19 A;  1RR7 A;  3OSF A;  1Y1W J;  2HXI A;  1JKO C;  3QQA A;  2MSY A;  2M2E A;  1BW6 A;  4IHW A;  5IYC J;  3A02 A;  1PUF A;  2XGD A;  3LSG A;  3SFI A;  4M3G A;  1RKW A;  3GBG A;  1MBF A;  5IPA A;  4GFB A;  2MGQ A;  3FK7 A;  1SAN A;  1ETV A;  2KT0 A;  3H3V K;  3I4M J;  1GDT A;  1X2M A;  3BTC A;  1HLV A;  2LKX A;  5M5Y J;  4C2M J;  1FIA A;  1ORK A;  3BR1 A;  4D7M A;  1APL C;  2WB1 N;  2CU7 A;  1POG A;  2JJ7 A;  1YRN B;  4MIM A;  3QPL A;  5M3M J;  1ETW A;  2FQ4 A;  1CQT A;  1GUU A;  3JRI A;  2IBD A;  1P7J A;  1JKP C;  1A5J A;  4A3M J;  2HI3 A;  5GPA A;  3BG5 A;  4JP0 A;  3BR3 A;  4XK4 A;  3ZOB A;  5IYB J;  5FLM J;  2R5Z B;  1HDD C;  4A3J J;  3ZQL A;  5F0H A;  1QPI A;  4BY1 J;  4XRM A;  4A3C J;  3JRF A;  1MSE C;  3BG9 A;  1LE8 A;  2D5V A;  2HOT A;  4IHV A;  4I76 A;  1ZR4 A;  3C2B A;  3GTK J;  3RKQ A;  1JUP A;  3SJM A;  4FE4 A;  1B8I B;  1WPK A;  2DN0 A;  4M3E A;  3TW7 A;  2NS8 A;  1Y1V J;  2CQQ A;  3HGY A;  1HCR A;  1MBJ A;  4UUS A;  3HOX J;  3WHC A;  3OSG A;  1U8B A;  5E3L A;  2QCO A;  4DZP A;  1F36 A;  2ID6 A;  1T33 A;  1R9T J;  3H0G J;  2G0E A;  5F04 A;  5F0F A;  2ZB9 A;  3BT9 A;  3FK6 A;  4JYK A;  4A3G J;  4AYB N;  2EQR A;  2R5Y B;  2VPR A;  1ITY A;  1FTZ A;  4DYQ A;  2DMN A;  2L7F P;  2M9H A;  2X9D A;  1MH4 A;  1ZQ3 P;  2CJJ A;  3A01 A;  3JRB A;  2EZK A;  2YUS A;  3GTJ J;  1Q1V A;  2DA7 A;  3MVP A;  4BXX J;  5J1U A;  2JA7 J;  1JTY A;  2AHQ A;  5J3L A;  5E3O A;  3ZQI A;  2LTP A;  2EBI A;  1JJ6 C;  3ZQF A;  1VI0 A;  2ME6 A;  2X48 A;  2VUM J;  1FJL A;  3BQZ A;  2DMU A;  4QTR A;  2XB0 X;  2YS9 A;  2QF7 A;  3G1M A;  4BBS J;  4A3I J;  2N8G A;  1B72 B;  1K61 A;  3OIO A;  4A3F J;  1LFU P;  3BR5 A;  3TP0 A;  3PO2 J;  3SDG A;  1ETX A;  3RQI A;  1VND A;  5J1Y A;  2DMP A;  3JRE A;  2EZL A;  1OCP A;  3PM1 A;  1I50 J;  3JRG A;  2EZI A;  4M3D A;  2B63 J;  1IUF A;  3IH3 A;  3S16 J;  1OCT C;  3O8H A;  3BQY A;  4JX5 A;  3GTM J;  3ZQC A;  2DA5 A;  2W48 A;  3BG3 A;  2M34 A;  1BJZ A;  2MG4 A;  2E2J J;  2Y2Z A;  3F0C A;  2JA5 J;  2VI6 A;  1PUF B;  4M6V A;  1GV5 A;  2L0K A;  1U78 A;  2DA6 A;  2IEK A;  5IP7 J;  2PMZ N;  1GVD A;  2K40 A;  5IP9 J;  1TWG J;  2L9R A;  1TWF J;  4BKX A;  5F0C A;  3HOV J;  5K7Z A;  2IAI A;  2OF7 A;  4D5F A;  5DS9 A;  3S1N J;  1JGG A;  1IC8 A;  1JUS A;  2LK2 A;  1F43 A;  1A6I A;  5HOD A;  1JJ8 C;  1I3Q J;  1HOM A;  4V2F A;  5C4J J;  4S0H B;  3A03 A;  2Y30 A;  4IHX A;  2O8K A;  2Y0S N;  3BTL A;  3S1R J;  4CYC A;  1Z0X A;  5F1J A;  3GTG J;  1NK2 P;  5FKN A;  3NAR A;  1YRN A;  3I4N J;  4JX4 A;  1BW5 A;  4X6A J;  1WGX A;  5M5X J;  4V2G A;  2CUE A;  2TCT A;  1MBE A;  3VPR A;  2EZH A;  3HGG A;  5K7F A;  2Y9Z A;  3S2D J;  2DA3 A;  1ETQ A;  1AKH B;  2E1O A;  1GV2 A;  1UHS A;  5FKL A;  3JRD A;  5E3M A;  1WI3 A;  2TRT A;  4Y7N J;  2YU9 J;  4XRS A;  1LE8 B;  1IRZ A;  3M4O J;  4FIS A;  1JT6 A;  4XRS G;  3D1N I;  2XB5 A;  4MFE A;  1X2N A;  2GBY A;  3K7A J;  3LSJ A;  1ETK A;  4B4C A;  2HDD A;  2ELK A;  5EZG A;  1JT0 A;  2DMT A;  4RDU A;  4JX6 A;  3CMY A;  1B8I A;  4UUS B;  3FIS A;  2R92 J;  5EF6 A;  5IYD J;  3JRH A;  1JUM A;  4C3I J;  3S2H J;  4B1R A;  1HDP A;  3JRA A;  1ZR2 A;  3TED A;  3LOC A;  5EZH A;  5EGO A;  1W0T A;  4L5E A;  4W1U A;  4A3K J;  2DJN A;  2WAQ N;  5FKO A;  2WV1 A;  4LOC A;  4A3B J;  2E2H J;  1H89 C;  3LSR A;  3L1P A;  4BY7 J;  3MN2 A;  3GTL J;  1UG2 A;  2CRG A;  1EF4 A;  3A01 B;  3CQZ J;  3Q0W A;  4C3J J;  2LP0 A;  4MFD A;  4C3H J;  3W6V A;  4QIW N;  2DA2 A;  3HOY J;  2O9L A;  3HDD A;  2LD5 A;  3S17 J;  1QRY A;  4D5C A;  2KDZ A;  1Z77 A;  1XG1 A;  2ME0 A;  3CCY A;  2XPU A;  2AO9 A;  1ENH A;  2H1K A;  4BBR J;  4EEF G;  1FTT A;  3JR9 A;  4A3L J;  5BNG A;  2K9Q A;  2DA1 A;  4DZJ A;  4AUX A;  1IG7 A;  1VFC A;  1OFC X;  3IV5 A;  2Y9Y A;  4B3A A;  1WH7 A;  4MO7 A;  4X1E A;  1I6H J;  3O8G A;  1X58 A;  4QSH A;  5EG0 A;  2XRL A;  1BA5 A;  5DTD A;  4RBO A;  2LFB A;  5IOY A;  1MBK A;  2NS7 A;  3Q3S A;  1T56 A;  2CQX A;  4FE7 A;  9ANT A;  5JLW A;  1E3O C;  3ZQG A;  3OOU A;  2VKE A;  2XPV A;  4M3B A;  5E3N A;  1ZGW A;  4D7N A;  5IP6 A;  1RES A;  2HXO A;  1W0U A;  3HEF A;  5FKK A;  1MSF C;  2GM4 A;  2JWT A;  2E19 A;  1HF0 A;  2VKV A;  3GTP J;  2XPW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...