2HDDA

Engrailed homeodomain q50k variant dna complex
Total Genus 20
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
20
sequence length
55
structure length
55
Chain Sequence
RTAFSSEQLARLKREFNENRYLTERRRQQLSSELGLNEAQIKIWFKNKRAKIKKS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA (5'-D(*TP*TP*TP*TP*GP*CP*CP*AP*TP*GP*TP*AP*AP*TP*CP*CP*C
publication title Engrailed (Gln50-->Lys) homeodomain-DNA complex at 1.9 A resolution: structural basis for enhanced affinity and altered specificity.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 20
structure length 55
sequence length 55
chains with identical sequence B
ec nomenclature
pdb deposition date 1998-02-10

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hddA00
1GV2A 5FKKA 1MSFC 5E3MA 2NS8A 3GTOJ 3HOXJ 4IHWA 2YUSA 1ORKA 2L9RA 1SANA 3S17J 4C3IJ 3K7AJ 1WH7A 5HODA 3BQZA 2VKEA 4JX5A 1TWFJ 2HOSA 5EEAA 2L7ZA 1NK3P 2DMUA 1DU6A 1BA5A 2DMQA 1QRYA 1GV5A 1ZR2A 2XB5A 4MFEA 1TC3C 3TW7A 4D5FA 2EH3A 3HOWJ 3TP3A 1MBKA 1FEXA 5IOZA 4XRMA 1JUMA 3Q0UA 2IEKA 3B6AA 1ETXA 4A93J 4I6ZA 1JT0A 2R5YB 1XS9A 3JRCA 1FIAA 1S7EA 1OCPA 3G1LA 4DZPA 2XSDC 3GTMJ 2LD5A 3NARA 1AHDP 3A01A 3RZOJ 5EZGA 4GFBA 3S2DJ 2MW8A 3O8HA 1ZQ3P 3BG3A 3JR9A 1E3OC 1XG1A 1BL0A 2LLKA 4BKXA 1IC8A 1MBHA 2P81A 1ETYA 4QTRA 1LE8B 3H3VK 3BTJA 1GUUA 2TCTA 4M3BA 2L7FP 1EF4A 4DZJA 3S16J 2EZHA 1ZR4A 2RAEA 2JA7J 5C3EJ 1ZKGA 3K2AA 2HYJA 2R5ZB 5FKLA 1JGGA 4UUTA 4B4CA 2NOGA 3LNQA 2E1OA 1P7IA 5JLXA 2DA1A 2LFBA 1JKPC 3HOVJ 4UUSB 5C4JJ 3JRFA 2NVQJ 1RESA 4MO7A 4BY1J 2NVYJ 5J1YA 2YS9A 2HXOA 4G12A 1CQTA 5F08A 3QPSA 5IYCJ 3CMYA 3Q0VA 3HGGA 3LSGA 5F1JA 3FISA 2NVTJ 5FLMJ 2G0EA 5M5WJ 2JA5J 3FK6A 1RR7A 5FLVA 1X2NA 2KT0A 2CU7A 5FKMA 3BR3A 4M3DA 3DEWA 3UKGA 1POGA 1FTTA 3MVPA 4JX4A 2LY9A 3BG5A 4A3LJ 5K7HA 3HDDA 4L5EA 1PUFB 3S15J 4DYCA 4Y52J 3CQZJ 4A3EJ 1GT0C 4C3HJ 4X6AJ 3OIOA 3GTQJ 2HOAA 5M5XJ 2AHQA 5EYRA 1VNDA 1T33A 2I10A 5IYBJ 1BW5A 4JYKA 1IGNA 4C2MJ 5E3OA 2FD5A 2R7ZJ 3G1MA 2Y2ZA 4DW6A 1IJWC 2CRGA 4I76A 3HKZN 5M3MJ 5F0HA 3HEFA 3LSPA 3E7LA 3GTKJ 2HOTA 1Y1WJ 2CUEA 4X1EA 1AKHB 2EQRA 1U8BA 4V2FA 1RPWA 4A3JJ 1A6IA 3ZOBA 2VI6A 4D5CA 1GVDA 3FIWA 3A01B 3LSJA 1FTZA 3BTLA 2GBYA 1JTYA 2EZKA 1DU0A 1BW6A 3I4NJ 3ZQIA 2H1KA 3L1PA 2MGQA 5EGOA 2ECCA 3IH4A 4A3CJ 5C4XJ 2PMZN 3MKLA 4Y7NJ 2VPRA 4BXXJ 1Z0XA 2WAQN 5IPAA 2TRTA 1H89C 2Y0SN 2XGCA 5EDNA 3G1OA 1ETVA 2DA2A 2XPUA 1LFUP 1AKHA 4FE4A 2Y30A 4W97A 3IH3A 2ID6A 1W0UA 1TWGJ 1WCMJ 3GTPJ 3QPLA 3FK7A 2KDZA 1HCRA 3BR1A 3OSFA 4D7NA 2ELKA 4XRSG 4LOCA 5IP7J 2QF7A 3C2BA 2ME6A 2XRLA 4DYRA 1A5JA 4M3EA 1RKWA 2LVSA 2DMNA 2O7OA 1FIPA 1VI0A 1WGXA 1H88C 1ZK8A 5J1UA 2E19A 4A3DJ 4MLOA 2XGDA 5FJ8J 3GTGJ 1BJZA 3IH2A 2QCOA 4A3FJ 1IV6A 2DTZA 3B6CA 2NS7A 2X48A 3TP0A 2IBDA 2CJJA 5DS9A 1K83J 1OFCX 3RKQA 1JJ8C 3WHCA 4FE7A 1ETQA 3PO2J 2JWTA 4J19A 2X6OA 1Q1VA 1NTCA 2HXIA 4RBOA 2L7MP 4QIWN 3GBGA 1OJLA 2VUMJ 1ZTRA 1WI3A 2LR8A 1MH3A 3BTCA 4DYQA 3WHBA 3BR6A 4FCYA 2Y31A 2N8GA 5J3LA 1IDZA 2DA4A 1Z77A 5F27A 3IV5A 3JRHA 2B63J 1UG2A 1U9OA 4EEFG 2JK3A 1IG7A 5M5YJ 1APLC 1JUPA 2OPTA 4IHXA 2D5VA 2HQ5A 5E3LA 4RDUA 1JKOC 2R92J 3O8GA 2GM4A 1U9NA 3ZQLA 4XRSA 3JRBA 1SFOJ 1IUFA 5IOYA 1YRNA 1ETWA 4XICA 2NVXJ 1F36A 3TW6A 2EBIA 3BT9A 1JTXA 2K9SA 3M3YJ 2CQXA 3A02A 2M2EA 3BR0A 3S1RJ 5F04A 5EG0A 1RKTA 2O9LA 3S2HJ 4A3KJ 4IHYA 2WV1A 1VF9A 4XK4A 5EGOB 1MH4A 3SFIA 4QSHA 4M6VA 1NK2P 2YU9J 3JRGA 2E2JJ 3ZQHA 3A03A 3H0GJ 2K9NA 1H8AC 3HBLA 1LFBA 1F43A 1K61A 1B72A 4A3BJ 4V2GA 2DA7A 3CCYA 2XB0X 1MBFA 2LKXA 4CYCA 4A3MJ 2HDDA 1JKQC 3HGYA 1TWHJ 2W48A 3HOUJ 4JP0A 1QVUA 3S1QJ 1QPIA 4S0HB 2ECBA 4AUXA 2H8RA 3NAUA 9ANTA 3D1NI 1G2HA 1MSEC 4NDLA 5IP6A 1JUSA 1HDDC 4HNVA 3OSGA 1HF0A 1MBGA 2IAIA 1R9TJ 3S1NJ 2GLOA 2DA5A 2JN6A 3HB9A 1JJ6C 5DTDA 2COBA 5J1RA 2R0QC 4D7MA 5K7ZA 1IRZA 2VKVA 1U78A 4MFDA 4B1RA 1HOMA 1B8IA 3JRAA 1I50J 3SDGA 1ZGWA 1MNMC 4AYBN 5EF6A 2O8KA 1RETA 5K7FA 2XGEA 3GTLJ 1TWAJ 2ME0A 3HOYJ 2FJ1A 2X9DA 1ITYA 1GDTA 4XIDA 1P7JA 3ZQCA 3SJMA 3GTJJ 3VPRA 5FKNA 3QQAA 3HOZJ 1ETKA 2ID3A 2M34A 3BR5A 3F0CA 5EZHA 3BR2A 3HM5A 1WPKA 3PM1A 3LOCA 3JRIA 1I3QJ 5E3NA 2LK2A 2ZB9A 3OOUA 1W0TA 5IYDJ 4B3AA 2EZIA 1YRNB 4MIMA 1I6HJ 1IDYA 1MBEA 2FX0A 1VFCA 3TEDA 2M0CA 2M8GX 5IP9J 2K9QA 2MG4A 1Y1VJ 2JA6J 4A3IJ 5BNGA 4AC0A 5GPAA 5EG0B 2R5YA 2DMTA 3S1MJ 2XPVA 3MN2A 1O4XA 2DMPA 3JRDA 1AU7A 1UMQA 3W6VA 3BQYA 1MBJA 2CQQA 1TWCJ 5C44J 3PO3J 1B72B 4FTHA 2DA3A 1HDPA 3DCFA 2XPWA 4A3GJ 1JT6A 5F0CA 4CYCB 2K40A 1LE8A 3ZQGA 1WH5A 1D5YA 2LP0A 5M3FJ 2L0KA 4BBSJ 4W1UA 3RQIA 2R93J 2DJNA 2JA8J 1XC5A 2R5ZA 1T56A 2EZLA 2MSYA 1HLVA 3CDLA 4C3JJ 2HI3A 3BTIA 3FKIJ 5F0FA 5FKOA 2JMWA 1JKRC 1QVTA 4UUSA 5GPCA 1UHSA 3Q3SA 2AO9A 3Q0WA 5GP9A 2OF7A 4IEJA 2DA6A 2Y9YA 3I4MJ 4IHVA 4JX6A 4M3FA 4A69C 2JJ7A 2M9HA 5JLWA 1ETOA 2LTPA 3ZQFA 3LSRA 1B8IB 1X58A 3BG9A 4ABZA 1X2MA 1OCTC 4M3GA 1ENHA 4FISA 2E2HJ 3S14J 4BY7J 1FJLA 2Y9ZA 3M4OJ 2CUFA 2WB1N 2E2IJ 3RZDJ 1PUFA 3JREA 2FQ4A 4BBRJ 2DN0A
chains in the Genus database with same CATH superfamily
5JHFA 3FBNB 5LGNA 3K4MA 3RYRA 5FFZA 3PNYA 2YUSA 1BC8C 3CUQA 2L9RA 4OIRF 1SANA 4WK8F 2GXAA 1HC8A 1WH7A 5LEKA 4JX5A 2XHKA 3I0TA 2HOSA 4L5JA 3FXRA 1V55H 2A3SA 3HJEA 4IO9F 4DGWB 4RLQA 5DUKA 2QQBA 3CF5F 2FXAA 4KITB 4WWCA 2IA2A 4IKFA 2CO5A 3T5XA 1WZ2A 1TC3C 3CLQA 1XDSA 3HRMA 2AXLA 5TGTA 1QZZA 2DFIA 1R6RA 4KNYA 1D3YA 1JUMA 1ETXA 3PL8A 4LLLA 4A93J 1D1AA 3IAS2 4TV7A 2P8TA 2JVHA 3B73A 3VODA 4CZZA 1ZG1A 1S7EA 1ZN2A 1A35A 3E6MA 4FX4A 4DZPA 2QLZA 3NARA 4PZJA 1AHDP 3A01A 1Y0UA 3KX2A 1MMSA 2DBBA 1A04A 5EZGA 3S2DJ 3O8HA 1ZQ3P 3BG3A 3F21A 1NHAA 4PFPA 4G9YA 2V7FA 3RPUA 1I3AA 1XG1A 3LQRA 1BL0A 2HGCA 4C30A 1ONVA 1MBHA 5L3GA 5CPRB 3IHUA 4HSTA 5HS8A 1FOKA 3RKXA 2XF5A 3G3ZA 3BPVA 3FZVA 3CJNA 1YW7A 3QP5A 1XSXA 2RAEA 3CF2A 1BC7C 5FD5A 1ZKGA 1UB9A 2LC2A 2R5ZB 1OCCH 2M4GA 4HX8A 3CJQB 5FLXZ 1BR4A 2NOGA 2V1DA 4HAMA 3SFZA 2DA1A 2LFBA 1JKPC 2VODA 4UUSB 5C4JJ 3HOVJ 1FC3A 3M9AA 4EJWA 2NVQJ 3G6EI 4BUPA 3FMSA 2F5EA 2QZ8A 2W00A 5K5RA 4KIGA 1XGNA 2YS9A 4G12A 3QPSA 4AWXB 1TQMA 3HGGA 5EEHA 4CCNA 3DF8A 3LSGA 2BEOA 5F1JA 4GO1A 4PJMA 1R5ID 2DFFA 5FLMJ 1J0RA 4FETA 5TRDA 3GZ5A 1YIJI 2X6WA 2KT0A 5KCMA 1Y8QB 3LA7A 2KISA 1ZRFA 3O2PE 2FEZA 3V8JA 3DKXA 2Y69H 1WJAA 3CCLI 3HDDA 5B66C 1T8IA 4A0ZA 2R7VA 1SMTA 5K5OA 5CVJA 3GVAA 4C3HJ 4YFNF 2XAUA 5D8KB 3ISPA 1VNDA 4PFOA 1I1SA 2I10A 2PFBA 2OU2A 4JYKA 1LDKB 4ENMA 1IGNA 2KIQA 5H6QA 3VYSB 4I2OA 2O8XA 1HQCA 3REOA 4A0YA 3JSOA 2R7XA 2CRGA 3BY6A 2H94A 4HNTA 1J9IA 3HEFA 5FROA 3QRFF 3GFLA 3MD2A 2ESNA 2A5YB 3E5XA 3E7LA 4QLCU 2HOTA 3AG4H 3GTKJ 2CUEA 1AKHB 3KLOA 4MGRA 1U8BA 3L9FA 1IN7A 1XTAA 4U7DA 3WTVC 3HPGA 5DM6F 1FZPB 2KL4A 3FXJA 2NNYA 5CVIA 3FIWA 3LSJA 3BTLA 3I71A 3EYYA 2EZKA 1SEUA 1BW6A 2NNNA 2Y0SA 3OIQA 2H1KA 2MGQA 2XAGA 1J5YA 1X4OA 2ECCA 3DKWA 3RYPA 1G8XA 2GXBA 2ZO4A 5TISC 3QAHA 4PJNA 2VPRA 4ZDOA 2WAQN 2F4OB 1FT9A 5D4RA 4QPOA 5CQEA 2TRTA 1H89C 2PI0A 4N9HA 5EDNA 5CVRA 5D6EA 1LFUP 2DYRH 4FE4A 1O3SA 2Y30A 1S3JA 1TWGJ 2R7OA 2L02A 3RCOA 2KJBA 1BOBA 1BM9A 4ZZDA 4UNOA 2Y0MA 2ME6A 1MIJA 1KQ0A 2XRLA 3N05A 3TO6A 2DTRA 5LRSA 2BHZA 4WCGA 1A5JA 4EATA 1I1GA 2O7OA 4YIIA 2XSJC 4V19K 2OD5A 2OC6A 1K78B 2M3AA 5FRNA 1ZG3A 1FY7A 2AQFA 1BJZA 2HNHA 5KHDA 1S7OA 1Z1DA 2QCOA 1MNDA 4KUMA 4EGYA 1VQ8I 4Y15A 2DTZA 3TP0A 2IBDA 3KZYA 2DXIA 2RREA 3PO2J 2QQAA 1SMYF 1XMAA 2DFHA 1IRFA 5E1XA 2GWRA 2CUZA 3IUOA 4EJVA 3CCMI 2VASA 4AIDA 3P9KA 4BJ6C 3J7AO 2QVOA 1WI3A 1T08B 2GA2A 3TGNA 4XOTA 3WHBA 2CG4A 3O3KA 3BR6A 2UXNA 4Q48A 2OV7A 4B43A 1WFXA 4IX7A 5F27A 3JRHA 3IV5A 2WY8Q 4LG0B 1IRGA 2HPIA 2FNAA 2A68F 4IHXA 5HLGA 4HNUA 3HTUA 2PMUA 5E3LA 1KU3A 4RDUA 3K10A 1G3TA 2CUJA 2KIMA 2ZMEC 3HOSA 4HDVA 3JW4A 3O8GA 3L00A 3G2BA 3WTZA 1U9NA 1D0XA 1OYYA 3ZQLA 4G7OF 1H0MA 2CGPA 1IUFA 5IOYA 1ETWA 2ZJQF 2YU3A 1F36A 5J4YA 3T8TA 3BT9A 2L4AA 4BE2A 2CQXA 4HEA2 3FM5A 5HDGA 4ZYDA 4UVBA 1HW5A 3S1RJ 3IWZA 3L7WA 1XMKA 5EG0A 2GAUA 2O9LA 2WC2A 1TP4A 5DD8A 3HIFA 4Z6YA 2KDOA 4LB6B 4OWRB 5CKTA 5CYVA 1NK2P 3JRGA 3C18A 2ZXIA 2ZNYA 3ZQHA 1BI3A 3ABMH 1H8AC 3BWGA 2VPLA 1LFBA 1QHHD 3PUFA 2EK5A 5DD4A 3S8PA 3WGHA 1K61A 1R23A 2EIKH 5FD6A 3M7GA 3TL4X 1RI7A 1NH3A 2ETHA 1JKQC 2ADUA 4UVAA 2DK8A 4IOCF 1AWCA 3CLOA 3QYBA 4JP0A 2HU9A 2D1VA 3KIOA 4NBQA 5J40A 4NQWB 4Q5SF 4AIJA 3K70C 1XCVA 1XGSA 5AONA 3BC8A 2DFEA 3FXOA 1D0YA 4LMYA 3TOBA 2ECBA 3OS0A 1SAUA 1IO2A 3F8NA 4G94A 3ABTA 2VJIA 3KP7A 3WTSC 1MZBA 1OYWA 1RRJA 3A2KA 2L54A 5L3FA 5FLXK 4B44A 2OZ6A 1EH6A 1RNLA 4HZFA 1HDDC 1HF0A 3BJAA 2XRNA 1R9TJ 4LK1F 2X1DA 5DTDA 5J1RA 2R0QC 2CV2A 1W36C 4N0BA 4D7MA 1UFMA 4O5VA 4HA8A 3PFYA 2PN6A 1U2WA 4II3A 2O0YA 2QKLB 3P5JA 2ACJA 2KMUA 2NAZA 2L9NA 3JRAA 1XMXA 1MNMC 5CVVA 3J7ZI 1R58A 1XD7A 3I4PA 2VN2A 2XGEA 1TWAJ 4F93B 2FJ1A 1ITYA 1QPMA 5LHGA 5J8CA 4FX0A 2DPUA 1FBQA 5CJ9A 3AAFA 2WA0A 5F6FA 1LQ1A 3QP6A 1HBXG 2HKOA 2F5VA 2ZXHA 3VPRA 1B9NA 4NB5A 3QQAA 3GMEA 4XKCA 3BR5A 3CCVI 2PBIA 4QPQA 2Q8KA 4A2UA 5DYMA 1D8JA 5IYDJ 4HQEA 2EZIA 1YRNB 4RGUA 1REPC 1OLTA 2HS5A 1XCBA 4MIMA 4UXNA 1IDYA 2OCEA 2QQ9A 1DGRM 3VEPA 1U8RA 3HPHA 3TEDA 2L4MA 2M8GX 2K9QA 3HG9A 4PSWA 4XKWA 1VQ5I 1R5HA 5BNGA 4AVZA 2DO7A 4HLXA 5GPAA 3K4CA 2RNGA 3GUDA 1LPQA 2IW5A 2H6BA 3V8KA 4DOZA 4U88A 3S3MA 3W6VA 2MH2A 1G3WA 2KQRA 4GDFA 4PJ0C 2VC0A 1TWCJ 3K4KA 3WU1B 2Y75A 3W6KB 3V42A 2VXDA 2XPWA 3J7YJ 3DPTA 1PVEA 4CYCB 3WODF 2IJLA 1B6AA 1V5EA 4PJJA 1GLNA 3ZQGA 3ZN0A 4ZH4F 4MQVA 4L0ZB 1UZCA 4LK0F 2HEOA 3WGGA 5LBQA 2W82A 3I59B 2ELHA 3TQNA 4W1UA 2JT1A 4ZYEA 4IJAA 4XBFA 3AG2H 1FOXA 4NC6A 4EM0B 2GIZA 3G73A 3ROUA 2R5ZA 4OIQF 1TTYA 5KNLA 3OL4A 5DCMB 1HLVA 2JMWA 3BCBA 1QVTA 4UUSA 4EMSA 1JKRC 2OF7A 2O03A 4IPAA 5L3EA 4OIOF 1BR2A 1VQOI 2F5CA 5D5UB 4L5IA 2ZJPF 4M3FA 4A69C 3LAPA 2R7QA 2JJ7A 2M30A 2VT2A 3FDYA 2Q2EB 2XUBA 4OMZA 4GYGA 2OBPA 1YJ9I 2CS3A 2EA2A 4BE1A 4ABZA 2W1OA 3L09A 4F92B 1BIAA 2UUZA 4IRGA 2PJPA 1FJLA 4B47A 2E7XA 2E2IJ 1HA8A 4BBRJ 1STZA 2Z99A 2I8DA 4HOBA 2HWVA 3H9GA 1MMGA 4RB3C 4R79A 3HOXJ 4XKBA 5ILSA 3EUAA 5HODA 2HDCA 1LNWA 2R7UA 3ZMDA 5EEAA 2AS5F 4AVPA 1NK3P 1MDMB 1J7KA 3ERED 4AM3A 2E1MC 3C2GA 3OY9A 1TW3A 2DMQA 1ACIA 5L3CA 3EUHC 1PUEE 1P6RA 1UJ8A 4YRVA 1OKRA 3SDBA 2EH3A 3CJTB 1FYMA 3KPHA 1MBKA 4A5NA 2LF7A 4L9NA 5IOZA 4C2TA 1Z6TA 2VIXA 4E7HA 2A05A 2CWEA 3HC7A 2KIFA 3B6AA 4ETSA 3LSIA 1JT0A 2IGNA 4BACA 3MKZA 3JRCA 3DTKA 3G1LA 1GVJA 1ZLKA 4BHPA 2XSDC 2DAOA 3GTMJ 3I56I 3OYNA 2K9LA 3JSPA 2KZVA 3UNGC 1Z9CA 4ZYAA 3PIPF 4O6JA 1KU7A 3GFIA 1FMWA 3CUQC 3F23A 1E3OC 2ZBKA 2VE9A 1VQ6I 4BKXA 5J8FA 1IC8A 2G9WA 3NWTA 3BTJA 2TCTA 2K7LA 3KZZA 3ZP5A 2J5OA 1FBUA 3GZ6A 4DZJA 1PP7U 3S16J 2VBWA 5JHUA 4G6QA 3ABUA 1Z21A 1ZR4A 4IXAA 2CFOA 5DUIA 4DBRA 5C3EJ 1WWXA 2HYJA 3LA3A 1BI1A 1BBYA 2XAJA 1IV8A 1DPRA 5FKLA 1J2XA 4B4CA 5BS6A 3LNQA 1OCZH 2RQQA 4YIRX 4OAYA 2E34A 3GLLA 2JUGA 1IXRC 1RESA 2F5FA 3VYUB 1V54H 4BQQA 4BY1J 1EV7A 3D5RC 1CQTA 2FQ3A 5F08A 4DIQA 1K78A 4XRFA 2BVMA 1BI0A 4UV9A 1IF1A 1NG7A 2HZDA 2VKHA 3A0HC 1U0JA 4D9JA 3KCCA 3FISA 4CXFA 2G0EA 1WHUA 1P9QC 2IS2A 5FFXA 1E2XA 2JRMA 1B1BA 3DU5A 3FXUA 3ECOA 3FK6A 1C0WA 1RR7A 2OAZA 4FT8A 5A2QK 5FLVA 5FKMA 3BR3A 3KP6A 3DEWA 5B3SH 2L7KA 3MVPA 4BXUA 2XROA 2LY9A 3BG5A 4RM3A 4BS9A 3DTIA 2JSCA 4PGGA 2X1CA 4I09A 5K7HA 2R4GA 3C7JA 3S15J 1BI2A 4DYCA 2VQCA 4M9ZA 2IS4A 3CMEI 2V1XA 2IS1A 4RAZA 2FOWA 3CQZJ 2LMDA 3WTYC 4A3EJ 3ZXSA 3E5QA 3PQJA 4CYDA 1GT0C 4X6AJ 2HOAA 2KPMA 2AHQA 4G6DA 5LFAA 4E7KA 2DU9A 1YW9A 3T0YA 3WE2A 1BW5A 3DEUA 4UY8I 4C2MJ 2RGVA 4LG0A 3DFGA 3HUGB 4CH7A 2HR3A 1R4NB 2BGCA 2Y2ZA 4LD5A 2F5DA 3BPXA 3CCUI 3U1KA 4I76A 4BJ5C 2RNJA 5F0HA 2JZYA 2EV5A 3LSPA 2HVRA 3OR2C 4X1EA 4L9TA 4XM3A 3F72A 2ZFWA 3NWSA 2EQRA 2CQ7A 4BYYA 2H1LA 3K4NA 3HRSA 4XSZF 1FOYA 1RPWA 2KZGA 3K4BA 2OA4A 3JAMK 3CO7C 2Z9OA 4XNFA 2HQRA 2VLAA 2LRDA 3ZOBA 4D5CA 2ESHA 2RQPA 5LRRA 3FHZA 4HDUA 3I4NJ 1FMVA 3ZQIA 5BPDA 3WTTC 1VQMI 3PQKA 3IH4A 1LKXA 1B59A 4A3CJ 2PMZN 1XPXA 4HSRA 4E70A 4Y7NJ 3OYJA 1BR1A 2O6GE 4F52A 2A61A 1SC7A 3CDHA 4XLAA 4HRIA 3V4GA 1MJ9A 3V8LA 2FBHA 3VDXA 3HXLA 3H0DA 3IH3A 1VQ4I 2STTA 4XLPF 1WCMJ 2LKPA 4Y13A 3U9GA 3FK7A 1HSTA 2HOEA 4NQWA 1DUXC 1R36A 3C2BA 3H3UA 3F8FA 3GF2A 1X3WB 2R7WA 1ZRCA 2ZJ2A 4Q47A 3CO6C 3TKYA 2DDAA 3SEQA 3VOEA 2R7TA 4RGXA 4Y33A 1ZK8A 5IT9Z 4A3DJ 1QQIA 2JPCA 4YELA 5AIPA 3RTRA 3BJOA 3SEZA 5EJCA 5CVUA 5HDNA 1R49A 2E5ZA 2P5KA 4A3FJ 1IV6A 1IZ1A 3E97A 3O6BB 1ERDA 3CCEI 2NS7A 5DS9A 3QWLA 1HKTA 1OFCX 4YG2F 3H3ZA 4S05A 2V9VA 3K4JA 3I9V2 2UV1A 3ELKA 4BE0A 2CW8A 3PNTA 3BLYA 2X6OA 1KYZA 1NTCA 2HXIA 3HHGA 2L7MP 1OJLA 3KP3A 3QYEA 1WVRA 1MH3A 2O3FA 1S9HA 1T95A 1V4RA 2X85A 4EQQA 1LDDA 2M45A 3W3CA 4HV5A 3L2QA 4LIUA 1VQLI 2N8GA 3F9KA 4BXFA 4XONA 2IXSA 3DPLC 5J3LA 1Z77A 1UG2A 1YS6A 1U9OA 5D4SA 3RJPA 3GZNB 3SXYA 2OPTA 1DPUA 1W4MA 4WXHA 4YEJA 2XASA 2HQ5A 2R7FA 5LGTA 1EH8A 1O57A 1Z3YA 4GCVA 1IUYA 2GM4A 5JVGF 1RUNA 5E79C 4XRSA 3JRBA 1T6SA 1YRNA 1V3FA 2NVXJ 1TW2A 3BJ6A 6PAXA 5ICCA 2EBIA 2K5CA 3M1CA 5KAIC 3A02A 2BZTA 2M2EA 5HNFA 3GO5A 1XB4A 3H36A 2PLYA 4DJAA 5DEQA 2KFDA 2E35A 3TO7A 5F04A 3V7CA 1RKTA 4FHTA 4XOPA 1SD6A 2J5PA 2EILH 2WV1A 3HRTA 2QYOA 3SFIA 3LSTA 3RPQA 2YU9J 1X3ZB 2D45A 3BZCA 4IF4A 3RPUD 1Q1HA 4U0VA 3CP2A 2Z16A 2K9NA 2G7UA 1HW2A 2LY1A 2ZXWH 1R1TA 4ESBA 1DGWY 2RKHA 5GAHJ 1FX7A 4CO8A 1WQ2A 4HF2A 2DA7A 3AFHA 3CMMA 3CCYA 2XB0X 2LKXA 1OISA 4CYCA 3OYIA 3IRQA 4BU2A 4BAYA 1T39A 1PJRA 1F4KA 2DLLA 2DOAA 2LBFB 1H9GA 2H6CA 3ZGKA 4P9FA 1Z91A 4CHUA 1OQYA 5JVTA 3I59A 2BVLA 1S29A 1SD7A 4S0HB 1W7PB 4IHTA 1IN6A 4P1WA 4AUXA 3Q5FA 1SVMA 4PSXA 3NAUA 1K4SA 4RAFA 5BOXA 2B7EA 5IP6A 2EJRA 2VB6A 4HNVA 3LQQA 3PNVA 1MBGA 4CZCA 3S1NJ 5GTHC 3Q9VA 2Q2EA 3ZRGA 2QWWA 3OYLA 4MTEA 5ILUA 4R8HA 3SDGA 2NVUB 3H35A 3U1DA 1YFHA 3SYTA 1ZGWA 1WJEA 2PEXA 2O8KA 5EF6A 1JHFA 2EA4A 5K7FA 3HOYJ 1HSJA 3K69A 2X9DA 1QO0D 5D5VB 2Z1DA 4XIDA 2LDUA 4RAYA 5GADJ 2M0MA 1K6YA 4RB2C 4MTDA 1JI8A 4U0YA 2IRFG 2LKSA 1P7JA 1UG0A 3R6SA 5JI6A 3L2UA 4B8XA 4RA2A 3KP5A 1YX3A 2HQAA 2VOOA 2IS6A 2BY2A 2OQGA 1R22A 4FQGA 3E0JB 2ID3A 1WJFA 2M34A 3BROA 3HM5A 2LH9A 1MDMA 4P9UA 4UB6C 4KN7X 2E71A 3HTSB 3OIPA 3OOUA 4B3AA 3DTEA 5DCFA 4GRIA 1XSDA 3I58A 1U6GA 3GFJA 1PDNC 1ON1A 2K3FA 1U5TC 3ZQQA 1I6HJ 3VYRB 2Q1ZB 3R0JA 3AL0B 1E17A 2HVSA 2EPFA 2MG4A 5H6RA 2JA6J 4CCLA 4A3IJ 3IP4B 4AC0A 2I5UA 2XPVA 2FU4A 3MN2A 2JUCA 2BXZA 1UMQA 4AU7A 3D5LA 3MQ0A 4DQ2A 1IW7F 4ZYHA 1PYVA 2ZKZA 4YIFA 3U21A 2VBXA 4E7IA 4WXCA 1B72B 1FOWA 2RV8A 1HDPA 1QNTA 1YOVB 4BHBA 5F0CA 2F6CA 2DT7B 2IGKA 2K40A 3F8MA 3V7RA 3OYGA 1ZGJA 1WH5A 3BDDA 1V5FA 3CCSI 4IHSA 2O5RA 3H9JA 1O3RA 2LP0A 2QSGX 5ICFA 3DQVC 2R93J 4XLHA 2DJNA 2ZSHB 1XC5A 2PQ8A 3SZTA 5D6FA 4PCQA 3CZ6A 2EZLA 2MSYA 4C3JJ 4N9IA 3BTIA 5FKOA 4LLNA 3RKYA 5LHHA 5FRMA 1KU9A 3P9IA 2AO9A 3Q3SA 2UWMA 4XMYA 2XF6A 2P6SA 2QEXI 3E3VA 2JA2A 4WX9A 1IXSB 1XDUA 1P4AA 2MABA 4OAZA 2GOXB 2QKMB 1D1BA 5JLWA 4H4KC 1ETOA 4YFXF 3JCUC 2BY1A 5E8GA 1TT0A 2B9SA 5IT9K 1X58A 3S93A 1IN4A 4ZTFA 1X19A 4GGGA 1X2MA 4BH9A 3VSLA 4M3GA 1ENHA 1Y39A 2E2HJ 3OV8A 3BP8A 4ZDPA 2QSFX 1G3SA 1CGPA 3BOQA 3PSFA 2K27A 1RC9A 5AIQA 2CUFA 2CH0A 2ZNZA 4HG2A 3RZDJ 2CQKA 3OYBA 3JREA 4G8XA 3HHHA 3CUOA 1WJBA 4PDKA 4R1HA 1GV2A 5FKKA 5E1WA 3OYKA 1YJNI 3GYHX 2KLOA 1WSUA 1MSFC 3GTOJ 4BHCA 2IPQX 4G7HF 1ORKA 3S17J 4C3IJ 1EH7A 1FYLA 2DPDA 5B1BH 1RZ4A 3FXKA 1TWFJ 2PG4A 3SHFA 1W5SA 4HW0A 1USTA 1DU6A 5IY5H 3HSEA 1YG2A 5BQTA 1N75A 1U5TA 1QRYA 3I55I 4KYWA 1JXSA 1GV5A 5LD2C 3C1DA 3HUGA 3ONQA 1SD4A 3EYIA 3TW7A 4D5FA 1OMIA 3HOWJ 3MZYA 3H1CA 1T0FA 3ZMUA 4JBAA 2P0WA 4NNJA 2DODA 2D1HA 4XRMA 2HZTA 3Q0UA 3DLLF 3MFKA 4L9VA 1OR7A 1S7AA 2DDBA 2V9KA 4I6ZA 1H9TA 2PJRB 2R5YB 1LVKA 2IVMA 4LGWA 1W1WE 4OU0A 1DP7P 4Q4ZF 4OIPF 2H27A 4HYEA 1E0EA 3RZOJ 4G6TB 3DV8A 3D0SA 1QBJA 5ICGA 4GFBA 3RKWA 1TL8A 4B3XA 2L3DA 2Q0OA 3LMMA 2LLKA 4ASNA 1GXPA 2A6EF 3KLNA 2HDWA 2GZWA 2V6EA 5LLQA 4QTRA 3H3VK 4NHJA 4B48A 4M3BA 3IL2A 2X6YA 4EGZA 2L7FP 2MC4A 1EF4A 4I99C 2DI3A 3GWZA 2ISZA 4A0XA 3EPZA 1KQ8A 1P4XA 1E3PA 4II2A 1LVAA 2EV0A 3G71I 3FXMA 2EFNA 2OJED 2E1OA 2JSPA 3KE2A 1A36A 3OS2A 2YSRA 3ZCOA 2Z33A 3E6CC 2HPMA 5FO5A 4J00A 2WAEA 3FBIB 4NC8A 5J1YA 4E7ZA 1HW1A 2V6CA 3RQ4A 4LG3A 1YJWI 3OYMA 1ULYA 2K4BA 1ZAOA 2HYGD 3PIOF 2WY7Q 4YFKF 4I01A 4ZJZA 2DOFA 3KZIC 1FSHA 4HLYA 3EUKL 4CCKA 2M7BA 4M3DA 3L2RA 1POGA 3H5RA 2LSOA 5HS7A 3BCAA 5B1AH 1PUFB 2F48A 3ZN1A 3ABLH 4RGSA 1LDJA 3PFIA 2GXGA 2VL8A 1ODDA 5H2FC 2FOKA 3K1NA 3OIOA 5GAGJ 5LEJA 1YW8A 2M5WA 1BIBA 2OQRA 2KKOA 4LB5A 5IYBJ 5E3OA 2V79A 2R7ZJ 3KYCB 1MMDA 3G1MA 1Y6IA 4DW6A 4JK1X 1IJWC 2FBIA 5M3MJ 1K4TA 4CDGA 1IN5A 2MD0A 4KJZA 4HPQA 4PGHA 4F55A 4RB1A 2CYYA 4V2FA 3AKZA 2W85A 3K6GA 1JHHA 3T1BA 4C2UA 1A6IA 2WV0A 3IRRA 2K86A 2RVCA 2VI6A 4IQ4A 3SQNA 1T38A 2JVGA 2V1NA 1SFKA 2V1UA 1JTYA 2WAQA 2ZSIB 3SZGA 1DU0A 1KZHA 5DDGA 3L1PA 3KP2A 2CV1A 4XN3A 5C4XJ 2M8EA 2FUG2 2A5WA 1USSA 2W25A 4BXXJ 2YX7A 3EETA 3ML6A 1Z0XA 2JTVA 5IPAA 2Y0SN 4AIKA 2E36A 2XGCA 1ETVA 3I54A 2XPUA 1AKHA 4XORA 5HLHA 2KIUA 2L9SA 4W97A 1YHQI 1QA6A 3K9TA 2VT3A 3PSIA 3GTPJ 2LBFA 3QPLA 4ZZLA 2E1NA 1VQNI 2KDZA 1HCRA 3BR1A 3OSFA 4D7NA 1LEBA 2ELKA 3DP7A 2GQQA 1MD0A 1P4WA 4DYRA 4CUGA 3DBRB 2DMNA 2UZKA 1FIPA 5KAFC 1VI0A 2D2WA 1J59A 2IP2A 2XV4S 4BGDA 5LHIA 1H88C 4UUVA 1XGMA 5J1UA 2E19A 5BPIA 4MLOA 2XGDA 2QBYB 4CGZA 4BQNA 3K1PA 4XQFA 1TNSA 4B09A 4EJOA 4S04A 4RMNA 3HSRA 2ELJA 2E1CA 4MEXF 2X48A 5B5EC 1MJAA 5K1YA 2YPRA 3MCZA 3RKQA 2BE5F 2X51A 3WHCA 3FMQA 4WXDA 2MFZA 4J19A 1LJ9A 2DT5A 1QZYA 1HKSA 3D5SC 4LLGF 1Q1VA 2Z2SB 1UHMA 5JFRA 2DK5A 4HV6A 4QIWN 3GBGA 4DNCA 2OCCH 2WAFA 1ZTRA 4CICA 3BTCA 2PX9A 4DYQA 2F2EA 3M8JA 2BBYA 3GW2A 2XAQA 2Y31A 2BOLA 3IKTA 3OS1A 2B63J 5IT3A 4EEFG 1CF7B 1VQKI 2JK3A 1T98A 4XSXF 1APLC 3H5NA 1I5ZA 3H9QA 2EV6A 4I7HA 2D5VA 1SFXA 2E60A 2DCEA 4OINF 2LREA 2W24A 3L2VA 2FMYA 2R92J 2XF7A 2VONA 5ED4A 3GXOA 1X1BA 3KEYA 3OMYA 3FXQA 1QHGA 4XLFA 4XICA 1ZG5A 1MW7A 4ANJA 1TBXA 1JTXA 1X3UA 4HF0A 4L9JA 3BR0A 2EB7A 2VKDA 3HKZA 2RN7A 4RGRA 1FBSA 3UR3C 3RIRA 4KISA 1ZARA 2LG4A 4E4HA 4IHYA 2X6XA 1VF9A 3F6VA 5EGOB 4QSHA 4M6VA 1O7LA 3OYCA 3F3XA 4XR6A 2BXYA 2E2JJ 1S8NA 3A03A 3FHNA 1K79A 1LUJB 2OZUA 3HBLA 5J4VA 4HF1A 3H92A 1U3EM 1F43A 1B72A 5L3BA 4A3BJ 2HDDA 3HGYA 1K6OA 1SAXA 2W48A 3HOUJ 4KT5C 4EV0A 2R7RA 1QVUA 1IN8A 5E8IA 3HOTA 2W4SA 3S1QJ 3J81Z 4XLCA 2E7WA 4BDZA 4BL0B 4MEYF 2LOOA 2H8RA 1LB2A 1I6XA 9ANTA 3D1NI 2AXTC 3NQOA 4U7BA 3G4SI 4HBLA 1G2HA 2EFWA 1ZYRF 4K2EA 1OPCA 2ZMEB 3OSGA 4G7ZF 2DA5A 1JJ6C 1IXCA 4C9YA 3E5UA 2VQGA 2EIJH 2COBA 4KICA 2A69F 4CSWA 2NXNB 3E6DA 2X0LA 2VKVA 1U78A 4ENJA 1ZLJA 4MFDA 4BQOA 3CJRB 3W2AA 2RC4A 1I50J 4ON0A 1J75A 4ESJA 1EJ9A 2YX4A 2COMA 5LGUA 1RETA 3WG7H 3C2HA 3ASOH 3CP8A 3H5AA 2JQ7A 3OOPA 1O3QA 2DYSH 2WBMA 2L5QA 4M6XA 1RIOH 2IGMA 2RDPA 3ZQCA 3SJMA 1Z05A 3L2WA 3R0AA 2F4MB 5FKNA 3HOZJ 4RAGA 1X1PA 3RDIA 1GHCA 5EZHA 1EA3A 3CMAI 3PM1A 4EVIA 3JRIA 4LJZF 1OYIA 1YS7A 3I3LA 1I3QJ 2LK2A 2ZB9A 5CQGA 1W0TA 1EKEA 1Y0NA 2XKOA 5FB2A 3V7SA 4F91B 4XN0A 3K2ZA 2STWA 3I64A 2FX0A 4NUBA 1I27A 4PJLA 2XAFA 5IP9J 3PUBA 4M9XA 1Y1VJ 4BEHB 2PJRA 2B0LA 1S72I 2R5YA 2DMTA 2HKXA 1WKMA 2VJ4A 4HX7A 2QA4I 1O4XA 2DMPA 3JRDA 4O3MA 3FF5A 1Z3XA 4LFUA 4XKVA 3M8FA 4KFCA 2V9PA 1R5GA 4BJTA 4AIHA 1YQAA 3FKJA 3OYHA 2MD5A 3HYIA 2PMHA 4IRHA 3OYAA 2VQLA 1JT6A 4CA0A 4M9SA 1YYVA 1D5YA 2KHMA 3HSFA 3CD6I 2K3PA 3VFZA 4BBSJ 1A31A 1DDNA 3J7AY 3CESA 5E1ZB 2JA8J 1T56A 4A12A 4L0YB 1W5TA 5F0FA 3OWTA 2CFXA 2KRHA 3DWLE 4GXOA 1XX5A 5GPCA 4M6YA 1UHSA 3Q0WA 5GP9A 4IEJA 1RUOA 2YR2A 3JTGA 2E5NA 2V26A 2Y9YA 3I4MJ 4KN4X 2MLGA 2W84A 3DKYA 3OYEA 2V4JC 4KT6A 1HXDA 2DQRA 3WU2C 1V5GA 1WJDA 2LTPA 4DBQA 3ZQFA 4M74A 1B8IB 4EJTA 5TJJA 1OCTC 4CCMA 4OMYA 4FISA 3DU6A 1MNEA 4RM2A 4PK4A 4BY7J 3S14J 2M1BA 2R3SA 3LSKA 4I0BA 5DCMA 2Y9ZA 3VYTB 3M4OJ 2BY0A 1SD5A 2GOMA 3K0LA 2FQ4A 4KIFA 3MKWB 1PUFA 2CQNA 3QOPA 3DEEA 2R7SA 2KRCA 3VSKA 5E3MA 2NS8A 3E6BA 1O7FA 4IHWA 4D0PA 1F1ZA 4U87A 3K7AJ 2M4KA 3HL2A 3ZMVA 3BQZA 2M87A 2VKEA 4AYBA 2DT6A 5HS9A 2L7ZA 2HFHA 4WF2A 2DMUA 2BY3A 4QWQA 1BA5A 3E1SA 3QU6A 1ZR2A 2BW3B 3DXJF 2XB5A 1K7AA 4MFEA 3M07A 1XSVA 1M1EB 5D5WB 3R4KA 4N4OB 3M1EA 3B02A 3TP3A 3A0BC 3VWBA 2CW0F 1FEXA 3N97A 1DP3A 1R1UA 2CSOA 2IEKA 2H09A 2WTEA 3LL7A 1N78A 3IC7A 3P9CA 3NRVA 4HX4A 1XS9A 4KMFA 1MKMA 1FIAA 3GCMA 1OCPA 2EINH 1TQIA 2LY2A 2LD5A 3I5UA 5JR3A 4BDYA 2P7CB 3N4MA 1KYWA 1L3LA 3RSNA 2MW8A 2IGOA 2G7HA 1G59A 3JR9A 2L01A 4MQ9F 2CV0A 1ZGAA 3IWFA 2P81A 3ULQB 2QM3A 1ETYA 1LE8B 1GUUA 2XC7A 4I0AA 1YO5C 2EZHA 3MAJA 5ICEA 4KIBA 2QGUA 5CLSA 3WTWC 4UV8A 1T0FC 3K2AA 4UUTA 1D8KA 1Z67A 2R7DA 3W2VA 1P7IA 2ZFUA 5JLXA 4P55A 2K9MA 3JRFA 2VJ5A 3KYLA 1OR7C 3CCRI 2K4JA 4MO7A 2CW7A 2NVYJ 2E1MB 3ZPLA 2HXOA 4F7ZA 3CMYA 5IYCJ 3J81K 5HDKA 3Q0VA 2QBYA 2OTJI 2W57A 2NVTJ 4E7LA 4KA4A 4U0WA 3J80Z 2UXXA 1R71A 5M5WJ 4P96A 4J01A 1UAAA 3LWFA 2JA5J 2LNBA 4UVCA 1X2NA 1ZHFA 2CU7A 1FP2A 5E18F 3UKGA 1FTTA 2IT0A 5ILVA 4JX4A 1G3YA 1P2FA 3HZJA 3T8RA 4A3LJ 2CMPA 4L5EA 5KVRA 4Y52J 4ZTJA 2AQEA 3CUQB 5DV5A 4EM2A 5KK1A 3WE3A 3GTQJ 5M5XJ 5EYRA 1X1DA 2MYSA 4EJUA 1T33A 1YE9A 4ZDLA 3AG3H 2WB1A 4ESFA 1BOAA 1TT5B 1MJBA 2FD5A 1YLFA 3F8CA 1CF7A 4A6DA 1NG6A 3FMRA 3WGIA 3HKZN 2OTLI 4UB8C 1F5TA 3W6JB 1X4PA 1WRJA 2Z3YA 4IQJA 3FM3A 1Z7LA 1Y1WJ 4Y4RA 2ZXJA 2A6TA 2MC3A 1TZLA 3IAM2 3TMOA 2WWYA 4LITA 1HKQA 1X1AA 2FE3A 4A3JJ 3CDIA 5GTIC 1O3TA 2PMZA 3KP4A 1GVDA 3A01B 3LAJA 1FTZA 2H8WA 2GBYA 4GYIA 2Y48A 4LIVA 2K02A 5HLIA 2IA1A 2A07F 3TDUC 5EGOA 1F9NA 3TO9A 5K5QA 3OR1C 2ICWG 3MKLA 1B9MA 2XKPA 5A2QZ 3HRUA 3COAC 4CCJA 1LEAA 3LA2A 4OOIA 1W5CC 2BV6A 3ZQ7A 2P5LC 5L3DA 3NEUA 3G1OA 2KJCA 3LSMA 2DA2A 1AOYA 3L2CA 3CC7I 5J6XA 3KYDB 3IKVA 3ZMZA 2JRTA 1I39A 2ID6A 4IZZA 1W0UA 3K1MA 4ZC3A 4D1QA 1P92A 3P7NA 2X4HA 1ZRDA 1KGSA 2QQ8A 1E3HA 3EDPA 4LOCA 2QF7A 4XRSG 5IP7J 4M3EA 1UHWA 2F4IA 1RKWA 2LVSA 2MLKA 3EQLF 1VTNC 3AG1H 1WGXA 2GIVA 4JOMA 1R1VA 2NOJB 2L2OA 5FJ8J 1JGGA 3GTGJ 5HLTA 3IH2A 1XGOA 3QOEA 2ZMEA 3MEXA 3MZ8A 4BNCA 4IRIA 1BN5A 3WTXC 3B6CA 5E20A 3C3WA 2CJJA 3S3NA 1K83J 2MA3A 5D5XB 1JJ8C 2VBYA 2ZJRF 4FE7A 1ETQA 2JWTA 3GLXA 4MHGA 3FWEA 3MWMA 3DLAA 1FLIA 3KEOA 2DQLA 2M7AA 2ZC2A 4ZYGA 1KA8A 3JAMZ 4RBOA 4RLFA 2VUMJ 4CCOA 2HTJA 4Z2YA 3BZ6A 2LR8A 2P6TA 3W2WA 4A6EA 3ECHA 3LSHA 4FCYA 4ENKA 2XIGA 2IA0A 1QZEA 4MNUA 3RI4A 2HVQA 1J09A 1S5LC 2DA4A 1IDZA 1AA7A 3U2RA 4E7SA 3GFMA 4AD9A 2VJJA 1SVLA 4N4NB 4M72A 3ZMTA 1IG7A 5M5YJ 1JUPA 2XGXA 2EFPA 1IRXA 2VE8A 3X2QH 1JKOC 1YI2I 2EFQA 2Z5UA 3S3OA 1TNTA 1X1CA 2LF8A 3LFKA 1SFOJ 1KONA 1WJCA 2P5VA 2DOEA 4M73A 3TW6A 1Z6RA 4M71A 4A5MA 2K9SA 3M3YJ 4XL9A 3QPHA 2HTSA 5HOOA 1ON2A 2XAHA 4NC7A 1XN7A 4BEHA 5GAEJ 3OYDA 2VXZA 3CC2I 4XLEA 1IAWA 4ITVA 4A3KJ 3S2HJ 3VB2A 5J47A 1MGTA 3LFUA 4XK4A 1MMNA 1MH4A 4XLNF 3H0GJ 2C6YA 2VQHA 1N77A 1KU2A 1BJAA 1D1CA 3WTUC 2NS0A 4V2GA 4L18B 1MBFA 4A3MJ 3TOAA 1VQPI 3WU0A 3DBHB 2QSHX 1TWHJ 2XVCA 4P5OA 1R00A 1YIOA 2WADA 4PUSA 3KEQA 5DM7F 1A6QA 1LFPA 4I98B 1QPIA 3A4CA 2QUFA 3ABKH 3BG6A 1ZELA 2ZCWA 2HQNA 3AL0C 3ZR8X 1YX5A 4BQAA 1MSEC 2GA1A 4NDLA 3S2WA 4Y17A 1JUSA 3OL3A 2OUMA 4H0EA 2IAIA 2GLOA 2JN6A 3HB9A 1YITI 3FXLA 1YTYA 3F6OA 5K7ZA 1IRZA 1ZREA 2DJIA 4UHTA 2FBKA 2EWNA 2KRFA 3DPUA 4B1RA 3CCQI 3CCJI 1B8IA 1HOMA 2HYFA 5FGMA 1ZH5A 2L9VA 1JE8A 4AYBN 1N25A 1QU3A 1DQUA 4HQMA 1UCRA 3A1YA 4IVNA 5H20A 3J80K 2ME0A 3GTLJ 1W7PA 1GDTA 1VZ0A 3ESWB 1UELB 3K70D 3R61A 3ERMA 3QODA 1QGPA 3ASNH 2JPBA 2ISYA 1FWZA 1OCRH 1GXQA 3GTJJ 2VBZA 1ETKA 2FA5A 3F0CA 2FNPA 3BG7A 5HNHA 1S6LA 3BR2A 1WPKA 1T2KA 3LOCA 3R60A 5EEGA 2A6HF 4F3QA 5F64A 3KFWX 1W36D 2BW3A 1TQPA 5E3NA 1R4MB 4IL6C 2LYCA 1WJ5A 2BHYA 2FRHA 1FP1D 4I02A 1MBEA 2P4WA 1VFCA 3CTAA 4E6KG 1RR8C 3PJRA 1D5VA 3CC4I 2M0CA 1G4DA 3MZHA 5EG0B 3S1MJ 4KDPA 1Z7UA 1B4AA 5ERIA 4JQFA 2BYVE 3TBIA 3Q9SA 1AU7A 2MBFA 1SVOA 3BQYA 1MBJA 1KQ9A 1PP8F 2CQQA 2DW4A 5C44J 2FSWA 3PO3J 2X1EA 3WG9A 4FTHA 2DA3A 3DBLB 3DCFA 3MMYB 3GX4X 5E17F 4A3GJ 1Y8RB 5F1RA 2K85A 1FPQA 4Y3OA 1LE8A 3QYFA 1FNNA 4RS8A 1WI9A 1SFUA 3F8BA 2FMLA 2JA7J 5M3FJ 2L0KA 2VC1A 4EM1A 2EIMH 3RQIA 3ZMSA 1Y56A 1VQ7I 3OYFA 1OCOH 1D0ZA 3FX3A 3I53A 4FASD 3QU3A 3K4LA 3QPTA 2NRAC 2KP6A 2P7VB 3CDLA 2HI3A 3FKIJ 3TDZC 1W7PD 1G6NA 2DA6A 1TLHB 1FYKA 4IHVA 4RB0A 4ENNA 1MMAA 4JX6A 3MKYB 2VOPA 3EUHA 1SFEA 1FSEA 3SZPA 3GEZA 2XDVA 2NYXA 4E7JA 2W7NA 2FF4A 3S32A 2M9HA 3JTHA 2MH9A 4IOAF 3BZKA 4KMUX 2TDXA 5D8LB 3LSRA 1U5TB 1VQ9I 3BG9A 3F22A 3KETA 1R7JA 2QENA 2EFOA 5BMZA 3M8EA 1L0OC 5HVQC 2WB1N 2DN0A 1JGSA 2O61A 4X0GA
chains in the Genus database with same CATH topology
1GV2A 5FKKA 1MSFC 5E3MA 2NS8A 3GTOJ 3HOXJ 4IHWA 2YUSA 1ORKA 2L9RA 1SANA 3S17J 4C3IJ 3K7AJ 1WH7A 5HODA 3BQZA 2VKEA 4JX5A 1TWFJ 2HOSA 5EEAA 2L7ZA 1NK3P 2DMUA 1DU6A 1BA5A 2DMQA 1QRYA 1GV5A 1ZR2A 2XB5A 4MFEA 1TC3C 3TW7A 4D5FA 2EH3A 3HOWJ 3TP3A 1MBKA 1FEXA 5IOZA 4XRMA 1JUMA 3Q0UA 2IEKA 3B6AA 1ETXA 4A93J 4I6ZA 1JT0A 2R5YB 1XS9A 3JRCA 1FIAA 1S7EA 1OCPA 3G1LA 4DZPA 2XSDC 3GTMJ 2LD5A 3NARA 1AHDP 3A01A 3RZOJ 5EZGA 4GFBA 3S2DJ 2MW8A 3O8HA 1ZQ3P 3BG3A 3JR9A 1E3OC 1XG1A 1BL0A 2LLKA 4BKXA 1IC8A 1MBHA 2P81A 1ETYA 4QTRA 1LE8B 3H3VK 3BTJA 1GUUA 2TCTA 4M3BA 2L7FP 1EF4A 4DZJA 3S16J 2EZHA 1ZR4A 2RAEA 2JA7J 5C3EJ 1ZKGA 3K2AA 2HYJA 2R5ZB 5FKLA 1JGGA 4UUTA 4B4CA 2NOGA 3LNQA 2E1OA 1P7IA 5JLXA 2DA1A 2LFBA 1JKPC 3HOVJ 4UUSB 5C4JJ 3JRFA 2NVQJ 1RESA 4MO7A 4BY1J 2NVYJ 5J1YA 2YS9A 2HXOA 4G12A 1CQTA 5F08A 3QPSA 5IYCJ 3CMYA 3Q0VA 3HGGA 3LSGA 5F1JA 3FISA 2NVTJ 5FLMJ 2G0EA 5M5WJ 2JA5J 3FK6A 1RR7A 5FLVA 1X2NA 2KT0A 2CU7A 5FKMA 3BR3A 4M3DA 3DEWA 3UKGA 1POGA 1FTTA 3MVPA 4JX4A 2LY9A 3BG5A 4A3LJ 5K7HA 3HDDA 4L5EA 1PUFB 3S15J 4DYCA 4Y52J 3CQZJ 4A3EJ 1GT0C 4C3HJ 4X6AJ 3OIOA 3GTQJ 2HOAA 5M5XJ 2AHQA 5EYRA 1VNDA 1T33A 2I10A 5IYBJ 1BW5A 4JYKA 1IGNA 4C2MJ 5E3OA 2FD5A 2R7ZJ 3G1MA 2Y2ZA 4DW6A 1IJWC 2CRGA 4I76A 3HKZN 5M3MJ 5F0HA 3HEFA 3LSPA 3E7LA 3GTKJ 2HOTA 1Y1WJ 2CUEA 4X1EA 1AKHB 2EQRA 1U8BA 4V2FA 1RPWA 4A3JJ 1A6IA 3ZOBA 2VI6A 4D5CA 1GVDA 3FIWA 3A01B 3LSJA 1FTZA 3BTLA 2GBYA 1JTYA 2EZKA 1DU0A 1BW6A 3I4NJ 3ZQIA 2H1KA 3L1PA 2MGQA 5EGOA 2ECCA 3IH4A 4A3CJ 5C4XJ 2PMZN 3MKLA 4Y7NJ 2VPRA 4BXXJ 1Z0XA 2WAQN 5IPAA 2TRTA 1H89C 2Y0SN 2XGCA 5EDNA 3G1OA 1ETVA 2DA2A 2XPUA 1LFUP 1AKHA 4FE4A 2Y30A 4W97A 3IH3A 2ID6A 1W0UA 1TWGJ 1WCMJ 3GTPJ 3QPLA 3FK7A 2KDZA 1HCRA 3BR1A 3OSFA 4D7NA 2ELKA 4XRSG 4LOCA 5IP7J 2QF7A 3C2BA 2ME6A 2XRLA 4DYRA 1A5JA 4M3EA 1RKWA 2LVSA 2DMNA 2O7OA 1FIPA 1VI0A 1WGXA 1H88C 1ZK8A 5J1UA 2E19A 4A3DJ 4MLOA 2XGDA 5FJ8J 3GTGJ 1BJZA 3IH2A 2QCOA 4A3FJ 1IV6A 2DTZA 3B6CA 2NS7A 2X48A 3TP0A 2IBDA 2CJJA 5DS9A 1K83J 1OFCX 3RKQA 1JJ8C 3WHCA 4FE7A 1ETQA 3PO2J 2JWTA 4J19A 2X6OA 1Q1VA 1NTCA 2HXIA 4RBOA 2L7MP 4QIWN 3GBGA 1OJLA 2VUMJ 1ZTRA 1WI3A 2LR8A 1MH3A 3BTCA 4DYQA 3WHBA 3BR6A 4FCYA 2Y31A 2N8GA 5J3LA 1IDZA 2DA4A 1Z77A 5F27A 3IV5A 3JRHA 2B63J 1UG2A 1U9OA 4EEFG 2JK3A 1IG7A 5M5YJ 1APLC 1JUPA 2OPTA 4IHXA 2D5VA 2HQ5A 5E3LA 4RDUA 1JKOC 2R92J 3O8GA 2GM4A 1U9NA 3ZQLA 4XRSA 3JRBA 1SFOJ 1IUFA 5IOYA 1YRNA 1ETWA 4XICA 2NVXJ 1F36A 3TW6A 2EBIA 3BT9A 1JTXA 2K9SA 3M3YJ 2CQXA 3A02A 2M2EA 3BR0A 3S1RJ 5F04A 5EG0A 1RKTA 2O9LA 3S2HJ 4A3KJ 4IHYA 2WV1A 1VF9A 4XK4A 5EGOB 1MH4A 3SFIA 4QSHA 4M6VA 1NK2P 2YU9J 3JRGA 2E2JJ 3ZQHA 3A03A 3H0GJ 2K9NA 1H8AC 3HBLA 1LFBA 1F43A 1K61A 1B72A 4A3BJ 4V2GA 2DA7A 3CCYA 2XB0X 1MBFA 2LKXA 4CYCA 4A3MJ 2HDDA 1JKQC 3HGYA 1TWHJ 2W48A 3HOUJ 4JP0A 1QVUA 3S1QJ 1QPIA 4S0HB 2ECBA 4AUXA 2H8RA 3NAUA 9ANTA 3D1NI 1G2HA 1MSEC 4NDLA 5IP6A 1JUSA 1HDDC 4HNVA 3OSGA 1HF0A 1MBGA 2IAIA 1R9TJ 3S1NJ 2GLOA 2DA5A 2JN6A 3HB9A 1JJ6C 5DTDA 2COBA 5J1RA 2R0QC 4D7MA 5K7ZA 1IRZA 2VKVA 1U78A 4MFDA 4B1RA 1HOMA 1B8IA 3JRAA 1I50J 3SDGA 1ZGWA 1MNMC 4AYBN 5EF6A 2O8KA 1RETA 5K7FA 2XGEA 3GTLJ 1TWAJ 2ME0A 3HOYJ 2FJ1A 2X9DA 1ITYA 1GDTA 4XIDA 1P7JA 3ZQCA 3SJMA 3GTJJ 3VPRA 5FKNA 3QQAA 3HOZJ 1ETKA 2ID3A 2M34A 3BR5A 3F0CA 5EZHA 3BR2A 3HM5A 1WPKA 3PM1A 3LOCA 3JRIA 1I3QJ 5E3NA 2LK2A 2ZB9A 3OOUA 1W0TA 5IYDJ 4B3AA 2EZIA 1YRNB 4MIMA 1I6HJ 1IDYA 1MBEA 2FX0A 1VFCA 3TEDA 2M0CA 2M8GX 5IP9J 2K9QA 2MG4A 1Y1VJ 2JA6J 4A3IJ 5BNGA 4AC0A 5GPAA 5EG0B 2R5YA 2DMTA 3S1MJ 2XPVA 3MN2A 1O4XA 2DMPA 3JRDA 1AU7A 1UMQA 3W6VA 3BQYA 1MBJA 2CQQA 1TWCJ 5C44J 3PO3J 1B72B 4FTHA 2DA3A 1HDPA 3DCFA 2XPWA 4A3GJ 1JT6A 5F0CA 4CYCB 2K40A 1LE8A 3ZQGA 1WH5A 1D5YA 2LP0A 5M3FJ 2L0KA 4BBSJ 4W1UA 3RQIA 2R93J 2DJNA 2JA8J 1XC5A 2R5ZA 1T56A 2EZLA 2MSYA 1HLVA 3CDLA 4C3JJ 2HI3A 3BTIA 3FKIJ 5F0FA 5FKOA 2JMWA 1JKRC 1QVTA 4UUSA 5GPCA 1UHSA 3Q3SA 2AO9A 3Q0WA 5GP9A 2OF7A 4IEJA 2DA6A 2Y9YA 3I4MJ 4IHVA 4JX6A 4M3FA 4A69C 2JJ7A 2M9HA 5JLWA 1ETOA 2LTPA 3ZQFA 3LSRA 1B8IB 1X58A 3BG9A 4ABZA 1X2MA 1OCTC 4M3GA 1ENHA 4FISA 2E2HJ 3S14J 4BY7J 1FJLA 2Y9ZA 3M4OJ 2CUFA 2WB1N 2E2IJ 3RZDJ 1PUFA 3JREA 2FQ4A 4BBRJ 2DN0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1GV2 A;  5FKK A;  1MSF C;  5E3M A;  2NS8 A;  3GTO J;  3HOX J;  4IHW A;  2YUS A;  1ORK A;  2L9R A;  1SAN A;  3S17 J;  4C3I J;  3K7A J;  1WH7 A;  5HOD A;  3BQZ A;  2VKE A;  4JX5 A;  1TWF J;  2HOS A;  5EEA A;  2L7Z A;  1NK3 P;  2DMU A;  1DU6 A;  1BA5 A;  2DMQ A;  1QRY A;  1GV5 A;  1ZR2 A;  2XB5 A;  4MFE A;  1TC3 C;  3TW7 A;  4D5F A;  2EH3 A;  3HOW J;  3TP3 A;  1MBK A;  1FEX A;  5IOZ A;  4XRM A;  1JUM A;  3Q0U A;  2IEK A;  3B6A A;  1ETX A;  4A93 J;  4I6Z A;  1JT0 A;  2R5Y B;  1XS9 A;  3JRC A;  1FIA A;  1S7E A;  1OCP A;  3G1L A;  4DZP A;  2XSD C;  3GTM J;  2LD5 A;  3NAR A;  1AHD P;  3A01 A;  3RZO J;  5EZG A;  4GFB A;  3S2D J;  2MW8 A;  3O8H A;  1ZQ3 P;  3BG3 A;  3JR9 A;  1E3O C;  1XG1 A;  1BL0 A;  2LLK A;  4BKX A;  1IC8 A;  1MBH A;  2P81 A;  1ETY A;  4QTR A;  1LE8 B;  3H3V K;  3BTJ A;  1GUU A;  2TCT A;  4M3B A;  2L7F P;  1EF4 A;  4DZJ A;  3S16 J;  2EZH A;  1ZR4 A;  2RAE A;  2JA7 J;  5C3E J;  1ZKG A;  3K2A A;  2HYJ A;  2R5Z B;  5FKL A;  1JGG A;  4UUT A;  4B4C A;  2NOG A;  3LNQ A;  2E1O A;  1P7I A;  5JLX A;  2DA1 A;  2LFB A;  1JKP C;  3HOV J;  4UUS B;  5C4J J;  3JRF A;  2NVQ J;  1RES A;  4MO7 A;  4BY1 J;  2NVY J;  5J1Y A;  2YS9 A;  2HXO A;  4G12 A;  1CQT A;  5F08 A;  3QPS A;  5IYC J;  3CMY A;  3Q0V A;  3HGG A;  3LSG A;  5F1J A;  3FIS A;  2NVT J;  5FLM J;  2G0E A;  5M5W J;  2JA5 J;  3FK6 A;  1RR7 A;  5FLV A;  1X2N A;  2KT0 A;  2CU7 A;  5FKM A;  3BR3 A;  4M3D A;  3DEW A;  3UKG A;  1POG A;  1FTT A;  3MVP A;  4JX4 A;  2LY9 A;  3BG5 A;  4A3L J;  5K7H A;  3HDD A;  4L5E A;  1PUF B;  3S15 J;  4DYC A;  4Y52 J;  3CQZ J;  4A3E J;  1GT0 C;  4C3H J;  4X6A J;  3OIO A;  3GTQ J;  2HOA A;  5M5X J;  2AHQ A;  5EYR A;  1VND A;  1T33 A;  2I10 A;  5IYB J;  1BW5 A;  4JYK A;  1IGN A;  4C2M J;  5E3O A;  2FD5 A;  2R7Z J;  3G1M A;  2Y2Z A;  4DW6 A;  1IJW C;  2CRG A;  4I76 A;  3HKZ N;  5M3M J;  5F0H A;  3HEF A;  3LSP A;  3E7L A;  3GTK J;  2HOT A;  1Y1W J;  2CUE A;  4X1E A;  1AKH B;  2EQR A;  1U8B A;  4V2F A;  1RPW A;  4A3J J;  1A6I A;  3ZOB A;  2VI6 A;  4D5C A;  1GVD A;  3FIW A;  3A01 B;  3LSJ A;  1FTZ A;  3BTL A;  2GBY A;  1JTY A;  2EZK A;  1DU0 A;  1BW6 A;  3I4N J;  3ZQI A;  2H1K A;  3L1P A;  2MGQ A;  5EGO A;  2ECC A;  3IH4 A;  4A3C J;  5C4X J;  2PMZ N;  3MKL A;  4Y7N J;  2VPR A;  4BXX J;  1Z0X A;  2WAQ N;  5IPA A;  2TRT A;  1H89 C;  2Y0S N;  2XGC A;  5EDN A;  3G1O A;  1ETV A;  2DA2 A;  2XPU A;  1LFU P;  1AKH A;  4FE4 A;  2Y30 A;  4W97 A;  3IH3 A;  2ID6 A;  1W0U A;  1TWG J;  1WCM J;  3GTP J;  3QPL A;  3FK7 A;  2KDZ A;  1HCR A;  3BR1 A;  3OSF A;  4D7N A;  2ELK A;  4XRS G;  4LOC A;  5IP7 J;  2QF7 A;  3C2B A;  2ME6 A;  2XRL A;  4DYR A;  1A5J A;  4M3E A;  1RKW A;  2LVS A;  2DMN A;  2O7O A;  1FIP A;  1VI0 A;  1WGX A;  1H88 C;  1ZK8 A;  5J1U A;  2E19 A;  4A3D J;  4MLO A;  2XGD A;  5FJ8 J;  3GTG J;  1BJZ A;  3IH2 A;  2QCO A;  4A3F J;  1IV6 A;  2DTZ A;  3B6C A;  2NS7 A;  2X48 A;  3TP0 A;  2IBD A;  2CJJ A;  5DS9 A;  1K83 J;  1OFC X;  3RKQ A;  1JJ8 C;  3WHC A;  4FE7 A;  1ETQ A;  3PO2 J;  2JWT A;  4J19 A;  2X6O A;  1Q1V A;  1NTC A;  2HXI A;  4RBO A;  2L7M P;  4QIW N;  3GBG A;  1OJL A;  2VUM J;  1ZTR A;  1WI3 A;  2LR8 A;  1MH3 A;  3BTC A;  4DYQ A;  3WHB A;  3BR6 A;  4FCY A;  2Y31 A;  2N8G A;  5J3L A;  1IDZ A;  2DA4 A;  1Z77 A;  5F27 A;  3IV5 A;  3JRH A;  2B63 J;  1UG2 A;  1U9O A;  4EEF G;  2JK3 A;  1IG7 A;  5M5Y J;  1APL C;  1JUP A;  2OPT A;  4IHX A;  2D5V A;  2HQ5 A;  5E3L A;  4RDU A;  1JKO C;  2R92 J;  3O8G A;  2GM4 A;  1U9N A;  3ZQL A;  4XRS A;  3JRB A;  1SFO J;  1IUF A;  5IOY A;  1YRN A;  1ETW A;  4XIC A;  2NVX J;  1F36 A;  3TW6 A;  2EBI A;  3BT9 A;  1JTX A;  2K9S A;  3M3Y J;  2CQX A;  3A02 A;  2M2E A;  3BR0 A;  3S1R J;  5F04 A;  5EG0 A;  1RKT A;  2O9L A;  3S2H J;  4A3K J;  4IHY A;  2WV1 A;  1VF9 A;  4XK4 A;  5EGO B;  1MH4 A;  3SFI A;  4QSH A;  4M6V A;  1NK2 P;  2YU9 J;  3JRG A;  2E2J J;  3ZQH A;  3A03 A;  3H0G J;  2K9N A;  1H8A C;  3HBL A;  1LFB A;  1F43 A;  1K61 A;  1B72 A;  4A3B J;  4V2G A;  2DA7 A;  3CCY A;  2XB0 X;  1MBF A;  2LKX A;  4CYC A;  4A3M J;  2HDD A;  1JKQ C;  3HGY A;  1TWH J;  2W48 A;  3HOU J;  4JP0 A;  1QVU A;  3S1Q J;  1QPI A;  4S0H B;  2ECB A;  4AUX A;  2H8R A;  3NAU A;  9ANT A;  3D1N I;  1G2H A;  1MSE C;  4NDL A;  5IP6 A;  1JUS A;  1HDD C;  4HNV A;  3OSG A;  1HF0 A;  1MBG A;  2IAI A;  1R9T J;  3S1N J;  2GLO A;  2DA5 A;  2JN6 A;  3HB9 A;  1JJ6 C;  5DTD A;  2COB A;  5J1R A;  2R0Q C;  4D7M A;  5K7Z A;  1IRZ A;  2VKV A;  1U78 A;  4MFD A;  4B1R A;  1HOM A;  1B8I A;  3JRA A;  1I50 J;  3SDG A;  1ZGW A;  1MNM C;  4AYB N;  5EF6 A;  2O8K A;  1RET A;  5K7F A;  2XGE A;  3GTL J;  1TWA J;  2ME0 A;  3HOY J;  2FJ1 A;  2X9D A;  1ITY A;  1GDT A;  4XID A;  1P7J A;  3ZQC A;  3SJM A;  3GTJ J;  3VPR A;  5FKN A;  3QQA A;  3HOZ J;  1ETK A;  2ID3 A;  2M34 A;  3BR5 A;  3F0C A;  5EZH A;  3BR2 A;  3HM5 A;  1WPK A;  3PM1 A;  3LOC A;  3JRI A;  1I3Q J;  5E3N A;  2LK2 A;  2ZB9 A;  3OOU A;  1W0T A;  5IYD J;  4B3A A;  2EZI A;  1YRN B;  4MIM A;  1I6H J;  1IDY A;  1MBE A;  2FX0 A;  1VFC A;  3TED A;  2M0C A;  2M8G X;  5IP9 J;  2K9Q A;  2MG4 A;  1Y1V J;  2JA6 J;  4A3I J;  5BNG A;  4AC0 A;  5GPA A;  5EG0 B;  2R5Y A;  2DMT A;  3S1M J;  2XPV A;  3MN2 A;  1O4X A;  2DMP A;  3JRD A;  1AU7 A;  1UMQ A;  3W6V A;  3BQY A;  1MBJ A;  2CQQ A;  1TWC J;  5C44 J;  3PO3 J;  1B72 B;  4FTH A;  2DA3 A;  1HDP A;  3DCF A;  2XPW A;  4A3G J;  1JT6 A;  5F0C A;  4CYC B;  2K40 A;  1LE8 A;  3ZQG A;  1WH5 A;  1D5Y A;  2LP0 A;  5M3F J;  2L0K A;  4BBS J;  4W1U A;  3RQI A;  2R93 J;  2DJN A;  2JA8 J;  1XC5 A;  2R5Z A;  1T56 A;  2EZL A;  2MSY A;  1HLV A;  3CDL A;  4C3J J;  2HI3 A;  3BTI A;  3FKI J;  5F0F A;  5FKO A;  2JMW A;  1JKR C;  1QVT A;  4UUS A;  5GPC A;  1UHS A;  3Q3S A;  2AO9 A;  3Q0W A;  5GP9 A;  2OF7 A;  4IEJ A;  2DA6 A;  2Y9Y A;  3I4M J;  4IHV A;  4JX6 A;  4M3F A;  4A69 C;  2JJ7 A;  2M9H A;  5JLW A;  1ETO A;  2LTP A;  3ZQF A;  3LSR A;  1B8I B;  1X58 A;  3BG9 A;  4ABZ A;  1X2M A;  1OCT C;  4M3G A;  1ENH A;  4FIS A;  2E2H J;  3S14 J;  4BY7 J;  1FJL A;  2Y9Z A;  3M4O J;  2CUF A;  2WB1 N;  2E2I J;  3RZD J;  1PUF A;  3JRE A;  2FQ4 A;  4BBR J;  2DN0 A; 
#chains in the Genus database with same CATH topology
 5JHF A;  3FBN B;  5LGN A;  3K4M A;  3RYR A;  5FFZ A;  3PNY A;  2YUS A;  1BC8 C;  3CUQ A;  2L9R A;  4OIR F;  1SAN A;  4WK8 F;  2GXA A;  1HC8 A;  1WH7 A;  5LEK A;  4JX5 A;  2XHK A;  3I0T A;  2HOS A;  4L5J A;  3FXR A;  1V55 H;  2A3S A;  3HJE A;  4IO9 F;  4DGW B;  4RLQ A;  5DUK A;  2QQB A;  3CF5 F;  2FXA A;  4KIT B;  4WWC A;  2IA2 A;  4IKF A;  2CO5 A;  3T5X A;  1WZ2 A;  1TC3 C;  3CLQ A;  1XDS A;  3HRM A;  2AXL A;  5TGT A;  1QZZ A;  2DFI A;  1R6R A;  4KNY A;  1D3Y A;  1JUM A;  1ETX A;  3PL8 A;  4LLL A;  4A93 J;  1D1A A;  3IAS 2;  4TV7 A;  2P8T A;  2JVH A;  3B73 A;  3VOD A;  4CZZ A;  1ZG1 A;  1S7E A;  1ZN2 A;  1A35 A;  3E6M A;  4FX4 A;  4DZP A;  2QLZ A;  3NAR A;  4PZJ A;  1AHD P;  3A01 A;  1Y0U A;  3KX2 A;  1MMS A;  2DBB A;  1A04 A;  5EZG A;  3S2D J;  3O8H A;  1ZQ3 P;  3BG3 A;  3F21 A;  1NHA A;  4PFP A;  4G9Y A;  2V7F A;  3RPU A;  1I3A A;  1XG1 A;  3LQR A;  1BL0 A;  2HGC A;  4C30 A;  1ONV A;  1MBH A;  5L3G A;  5CPR B;  3IHU A;  4HST A;  5HS8 A;  1FOK A;  3RKX A;  2XF5 A;  3G3Z A;  3BPV A;  3FZV A;  3CJN A;  1YW7 A;  3QP5 A;  1XSX A;  2RAE A;  3CF2 A;  1BC7 C;  5FD5 A;  1ZKG A;  1UB9 A;  2LC2 A;  2R5Z B;  1OCC H;  2M4G A;  4HX8 A;  3CJQ B;  5FLX Z;  1BR4 A;  2NOG A;  2V1D A;  4HAM A;  3SFZ A;  2DA1 A;  2LFB A;  1JKP C;  2VOD A;  4UUS B;  5C4J J;  3HOV J;  1FC3 A;  3M9A A;  4EJW A;  2NVQ J;  3G6E I;  4BUP A;  3FMS A;  2F5E A;  2QZ8 A;  2W00 A;  5K5R A;  4KIG A;  1XGN A;  2YS9 A;  4G12 A;  3QPS A;  4AWX B;  1TQM A;  3HGG A;  5EEH A;  4CCN A;  3DF8 A;  3LSG A;  2BEO A;  5F1J A;  4GO1 A;  4PJM A;  1R5I D;  2DFF A;  5FLM J;  1J0R A;  4FET A;  5TRD A;  3GZ5 A;  1YIJ I;  2X6W A;  2KT0 A;  5KCM A;  1Y8Q B;  3LA7 A;  2KIS A;  1ZRF A;  3O2P E;  2FEZ A;  3V8J A;  3DKX A;  2Y69 H;  1WJA A;  3CCL I;  3HDD A;  5B66 C;  1T8I A;  4A0Z A;  2R7V A;  1SMT A;  5K5O A;  5CVJ A;  3GVA A;  4C3H J;  4YFN F;  2XAU A;  5D8K B;  3ISP A;  1VND A;  4PFO A;  1I1S A;  2I10 A;  2PFB A;  2OU2 A;  4JYK A;  1LDK B;  4ENM A;  1IGN A;  2KIQ A;  5H6Q A;  3VYS B;  4I2O A;  2O8X A;  1HQC A;  3REO A;  4A0Y A;  3JSO A;  2R7X A;  2CRG A;  3BY6 A;  2H94 A;  4HNT A;  1J9I A;  3HEF A;  5FRO A;  3QRF F;  3GFL A;  3MD2 A;  2ESN A;  2A5Y B;  3E5X A;  3E7L A;  4QLC U;  2HOT A;  3AG4 H;  3GTK J;  2CUE A;  1AKH B;  3KLO A;  4MGR A;  1U8B A;  3L9F A;  1IN7 A;  1XTA A;  4U7D A;  3WTV C;  3HPG A;  5DM6 F;  1FZP B;  2KL4 A;  3FXJ A;  2NNY A;  5CVI A;  3FIW A;  3LSJ A;  3BTL A;  3I71 A;  3EYY A;  2EZK A;  1SEU A;  1BW6 A;  2NNN A;  2Y0S A;  3OIQ A;  2H1K A;  2MGQ A;  2XAG A;  1J5Y A;  1X4O A;  2ECC A;  3DKW A;  3RYP A;  1G8X A;  2GXB A;  2ZO4 A;  5TIS C;  3QAH A;  4PJN A;  2VPR A;  4ZDO A;  2WAQ N;  2F4O B;  1FT9 A;  5D4R A;  4QPO A;  5CQE A;  2TRT A;  1H89 C;  2PI0 A;  4N9H A;  5EDN A;  5CVR A;  5D6E A;  1LFU P;  2DYR H;  4FE4 A;  1O3S A;  2Y30 A;  1S3J A;  1TWG J;  2R7O A;  2L02 A;  3RCO A;  2KJB A;  1BOB A;  1BM9 A;  4ZZD A;  4UNO A;  2Y0M A;  2ME6 A;  1MIJ A;  1KQ0 A;  2XRL A;  3N05 A;  3TO6 A;  2DTR A;  5LRS A;  2BHZ A;  4WCG A;  1A5J A;  4EAT A;  1I1G A;  2O7O A;  4YII A;  2XSJ C;  4V19 K;  2OD5 A;  2OC6 A;  1K78 B;  2M3A A;  5FRN A;  1ZG3 A;  1FY7 A;  2AQF A;  1BJZ A;  2HNH A;  5KHD A;  1S7O A;  1Z1D A;  2QCO A;  1MND A;  4KUM A;  4EGY A;  1VQ8 I;  4Y15 A;  2DTZ A;  3TP0 A;  2IBD A;  3KZY A;  2DXI A;  2RRE A;  3PO2 J;  2QQA A;  1SMY F;  1XMA A;  2DFH A;  1IRF A;  5E1X A;  2GWR A;  2CUZ A;  3IUO A;  4EJV A;  3CCM I;  2VAS A;  4AID A;  3P9K A;  4BJ6 C;  3J7A O;  2QVO A;  1WI3 A;  1T08 B;  2GA2 A;  3TGN A;  4XOT A;  3WHB A;  2CG4 A;  3O3K A;  3BR6 A;  2UXN A;  4Q48 A;  2OV7 A;  4B43 A;  1WFX A;  4IX7 A;  5F27 A;  3JRH A;  3IV5 A;  2WY8 Q;  4LG0 B;  1IRG A;  2HPI A;  2FNA A;  2A68 F;  4IHX A;  5HLG A;  4HNU A;  3HTU A;  2PMU A;  5E3L A;  1KU3 A;  4RDU A;  3K10 A;  1G3T A;  2CUJ A;  2KIM A;  2ZME C;  3HOS A;  4HDV A;  3JW4 A;  3O8G A;  3L00 A;  3G2B A;  3WTZ A;  1U9N A;  1D0X A;  1OYY A;  3ZQL A;  4G7O F;  1H0M A;  2CGP A;  1IUF A;  5IOY A;  1ETW A;  2ZJQ F;  2YU3 A;  1F36 A;  5J4Y A;  3T8T A;  3BT9 A;  2L4A A;  4BE2 A;  2CQX A;  4HEA 2;  3FM5 A;  5HDG A;  4ZYD A;  4UVB A;  1HW5 A;  3S1R J;  3IWZ A;  3L7W A;  1XMK A;  5EG0 A;  2GAU A;  2O9L A;  2WC2 A;  1TP4 A;  5DD8 A;  3HIF A;  4Z6Y A;  2KDO A;  4LB6 B;  4OWR B;  5CKT A;  5CYV A;  1NK2 P;  3JRG A;  3C18 A;  2ZXI A;  2ZNY A;  3ZQH A;  1BI3 A;  3ABM H;  1H8A C;  3BWG A;  2VPL A;  1LFB A;  1QHH D;  3PUF A;  2EK5 A;  5DD4 A;  3S8P A;  3WGH A;  1K61 A;  1R23 A;  2EIK H;  5FD6 A;  3M7G A;  3TL4 X;  1RI7 A;  1NH3 A;  2ETH A;  1JKQ C;  2ADU A;  4UVA A;  2DK8 A;  4IOC F;  1AWC A;  3CLO A;  3QYB A;  4JP0 A;  2HU9 A;  2D1V A;  3KIO A;  4NBQ A;  5J40 A;  4NQW B;  4Q5S F;  4AIJ A;  3K70 C;  1XCV A;  1XGS A;  5AON A;  3BC8 A;  2DFE A;  3FXO A;  1D0Y A;  4LMY A;  3TOB A;  2ECB A;  3OS0 A;  1SAU A;  1IO2 A;  3F8N A;  4G94 A;  3ABT A;  2VJI A;  3KP7 A;  3WTS C;  1MZB A;  1OYW A;  1RRJ A;  3A2K A;  2L54 A;  5L3F A;  5FLX K;  4B44 A;  2OZ6 A;  1EH6 A;  1RNL A;  4HZF A;  1HDD C;  1HF0 A;  3BJA A;  2XRN A;  1R9T J;  4LK1 F;  2X1D A;  5DTD A;  5J1R A;  2R0Q C;  2CV2 A;  1W36 C;  4N0B A;  4D7M A;  1UFM A;  4O5V A;  4HA8 A;  3PFY A;  2PN6 A;  1U2W A;  4II3 A;  2O0Y A;  2QKL B;  3P5J A;  2ACJ A;  2KMU A;  2NAZ A;  2L9N A;  3JRA A;  1XMX A;  1MNM C;  5CVV A;  3J7Z I;  1R58 A;  1XD7 A;  3I4P A;  2VN2 A;  2XGE A;  1TWA J;  4F93 B;  2FJ1 A;  1ITY A;  1QPM A;  5LHG A;  5J8C A;  4FX0 A;  2DPU A;  1FBQ A;  5CJ9 A;  3AAF A;  2WA0 A;  5F6F A;  1LQ1 A;  3QP6 A;  1HBX G;  2HKO A;  2F5V A;  2ZXH A;  3VPR A;  1B9N A;  4NB5 A;  3QQA A;  3GME A;  4XKC A;  3BR5 A;  3CCV I;  2PBI A;  4QPQ A;  2Q8K A;  4A2U A;  5DYM A;  1D8J A;  5IYD J;  4HQE A;  2EZI A;  1YRN B;  4RGU A;  1REP C;  1OLT A;  2HS5 A;  1XCB A;  4MIM A;  4UXN A;  1IDY A;  2OCE A;  2QQ9 A;  1DGR M;  3VEP A;  1U8R A;  3HPH A;  3TED A;  2L4M A;  2M8G X;  2K9Q A;  3HG9 A;  4PSW A;  4XKW A;  1VQ5 I;  1R5H A;  5BNG A;  4AVZ A;  2DO7 A;  4HLX A;  5GPA A;  3K4C A;  2RNG A;  3GUD A;  1LPQ A;  2IW5 A;  2H6B A;  3V8K A;  4DOZ A;  4U88 A;  3S3M A;  3W6V A;  2MH2 A;  1G3W A;  2KQR A;  4GDF A;  4PJ0 C;  2VC0 A;  1TWC J;  3K4K A;  3WU1 B;  2Y75 A;  3W6K B;  3V42 A;  2VXD A;  2XPW A;  3J7Y J;  3DPT A;  1PVE A;  4CYC B;  3WOD F;  2IJL A;  1B6A A;  1V5E A;  4PJJ A;  1GLN A;  3ZQG A;  3ZN0 A;  4ZH4 F;  4MQV A;  4L0Z B;  1UZC A;  4LK0 F;  2HEO A;  3WGG A;  5LBQ A;  2W82 A;  3I59 B;  2ELH A;  3TQN A;  4W1U A;  2JT1 A;  4ZYE A;  4IJA A;  4XBF A;  3AG2 H;  1FOX A;  4NC6 A;  4EM0 B;  2GIZ A;  3G73 A;  3ROU A;  2R5Z A;  4OIQ F;  1TTY A;  5KNL A;  3OL4 A;  5DCM B;  1HLV A;  2JMW A;  3BCB A;  1QVT A;  4UUS A;  4EMS A;  1JKR C;  2OF7 A;  2O03 A;  4IPA A;  5L3E A;  4OIO F;  1BR2 A;  1VQO I;  2F5C A;  5D5U B;  4L5I A;  2ZJP F;  4M3F A;  4A69 C;  3LAP A;  2R7Q A;  2JJ7 A;  2M30 A;  2VT2 A;  3FDY A;  2Q2E B;  2XUB A;  4OMZ A;  4GYG A;  2OBP A;  1YJ9 I;  2CS3 A;  2EA2 A;  4BE1 A;  4ABZ A;  2W1O A;  3L09 A;  4F92 B;  1BIA A;  2UUZ A;  4IRG A;  2PJP A;  1FJL A;  4B47 A;  2E7X A;  2E2I J;  1HA8 A;  4BBR J;  1STZ A;  2Z99 A;  2I8D A;  4HOB A;  2HWV A;  3H9G A;  1MMG A;  4RB3 C;  4R79 A;  3HOX J;  4XKB A;  5ILS A;  3EUA A;  5HOD A;  2HDC A;  1LNW A;  2R7U A;  3ZMD A;  5EEA A;  2AS5 F;  4AVP A;  1NK3 P;  1MDM B;  1J7K A;  3ERE D;  4AM3 A;  2E1M C;  3C2G A;  3OY9 A;  1TW3 A;  2DMQ A;  1ACI A;  5L3C A;  3EUH C;  1PUE E;  1P6R A;  1UJ8 A;  4YRV A;  1OKR A;  3SDB A;  2EH3 A;  3CJT B;  1FYM A;  3KPH A;  1MBK A;  4A5N A;  2LF7 A;  4L9N A;  5IOZ A;  4C2T A;  1Z6T A;  2VIX A;  4E7H A;  2A05 A;  2CWE A;  3HC7 A;  2KIF A;  3B6A A;  4ETS A;  3LSI A;  1JT0 A;  2IGN A;  4BAC A;  3MKZ A;  3JRC A;  3DTK A;  3G1L A;  1GVJ A;  1ZLK A;  4BHP A;  2XSD C;  2DAO A;  3GTM J;  3I56 I;  3OYN A;  2K9L A;  3JSP A;  2KZV A;  3UNG C;  1Z9C A;  4ZYA A;  3PIP F;  4O6J A;  1KU7 A;  3GFI A;  1FMW A;  3CUQ C;  3F23 A;  1E3O C;  2ZBK A;  2VE9 A;  1VQ6 I;  4BKX A;  5J8F A;  1IC8 A;  2G9W A;  3NWT A;  3BTJ A;  2TCT A;  2K7L A;  3KZZ A;  3ZP5 A;  2J5O A;  1FBU A;  3GZ6 A;  4DZJ A;  1PP7 U;  3S16 J;  2VBW A;  5JHU A;  4G6Q A;  3ABU A;  1Z21 A;  1ZR4 A;  4IXA A;  2CFO A;  5DUI A;  4DBR A;  5C3E J;  1WWX A;  2HYJ A;  3LA3 A;  1BI1 A;  1BBY A;  2XAJ A;  1IV8 A;  1DPR A;  5FKL A;  1J2X A;  4B4C A;  5BS6 A;  3LNQ A;  1OCZ H;  2RQQ A;  4YIR X;  4OAY A;  2E34 A;  3GLL A;  2JUG A;  1IXR C;  1RES A;  2F5F A;  3VYU B;  1V54 H;  4BQQ A;  4BY1 J;  1EV7 A;  3D5R C;  1CQT A;  2FQ3 A;  5F08 A;  4DIQ A;  1K78 A;  4XRF A;  2BVM A;  1BI0 A;  4UV9 A;  1IF1 A;  1NG7 A;  2HZD A;  2VKH A;  3A0H C;  1U0J A;  4D9J A;  3KCC A;  3FIS A;  4CXF A;  2G0E A;  1WHU A;  1P9Q C;  2IS2 A;  5FFX A;  1E2X A;  2JRM A;  1B1B A;  3DU5 A;  3FXU A;  3ECO A;  3FK6 A;  1C0W A;  1RR7 A;  2OAZ A;  4FT8 A;  5A2Q K;  5FLV A;  5FKM A;  3BR3 A;  3KP6 A;  3DEW A;  5B3S H;  2L7K A;  3MVP A;  4BXU A;  2XRO A;  2LY9 A;  3BG5 A;  4RM3 A;  4BS9 A;  3DTI A;  2JSC A;  4PGG A;  2X1C A;  4I09 A;  5K7H A;  2R4G A;  3C7J A;  3S15 J;  1BI2 A;  4DYC A;  2VQC A;  4M9Z A;  2IS4 A;  3CME I;  2V1X A;  2IS1 A;  4RAZ A;  2FOW A;  3CQZ J;  2LMD A;  3WTY C;  4A3E J;  3ZXS A;  3E5Q A;  3PQJ A;  4CYD A;  1GT0 C;  4X6A J;  2HOA A;  2KPM A;  2AHQ A;  4G6D A;  5LFA A;  4E7K A;  2DU9 A;  1YW9 A;  3T0Y A;  3WE2 A;  1BW5 A;  3DEU A;  4UY8 I;  4C2M J;  2RGV A;  4LG0 A;  3DFG A;  3HUG B;  4CH7 A;  2HR3 A;  1R4N B;  2BGC A;  2Y2Z A;  4LD5 A;  2F5D A;  3BPX A;  3CCU I;  3U1K A;  4I76 A;  4BJ5 C;  2RNJ A;  5F0H A;  2JZY A;  2EV5 A;  3LSP A;  2HVR A;  3OR2 C;  4X1E A;  4L9T A;  4XM3 A;  3F72 A;  2ZFW A;  3NWS A;  2EQR A;  2CQ7 A;  4BYY A;  2H1L A;  3K4N A;  3HRS A;  4XSZ F;  1FOY A;  1RPW A;  2KZG A;  3K4B A;  2OA4 A;  3JAM K;  3CO7 C;  2Z9O A;  4XNF A;  2HQR A;  2VLA A;  2LRD A;  3ZOB A;  4D5C A;  2ESH A;  2RQP A;  5LRR A;  3FHZ A;  4HDU A;  3I4N J;  1FMV A;  3ZQI A;  5BPD A;  3WTT C;  1VQM I;  3PQK A;  3IH4 A;  1LKX A;  1B59 A;  4A3C J;  2PMZ N;  1XPX A;  4HSR A;  4E70 A;  4Y7N J;  3OYJ A;  1BR1 A;  2O6G E;  4F52 A;  2A61 A;  1SC7 A;  3CDH A;  4XLA A;  4HRI A;  3V4G A;  1MJ9 A;  3V8L A;  2FBH A;  3VDX A;  3HXL A;  3H0D A;  3IH3 A;  1VQ4 I;  2STT A;  4XLP F;  1WCM J;  2LKP A;  4Y13 A;  3U9G A;  3FK7 A;  1HST A;  2HOE A;  4NQW A;  1DUX C;  1R36 A;  3C2B A;  3H3U A;  3F8F A;  3GF2 A;  1X3W B;  2R7W A;  1ZRC A;  2ZJ2 A;  4Q47 A;  3CO6 C;  3TKY A;  2DDA A;  3SEQ A;  3VOE A;  2R7T A;  4RGX A;  4Y33 A;  1ZK8 A;  5IT9 Z;  4A3D J;  1QQI A;  2JPC A;  4YEL A;  5AIP A;  3RTR A;  3BJO A;  3SEZ A;  5EJC A;  5CVU A;  5HDN A;  1R49 A;  2E5Z A;  2P5K A;  4A3F J;  1IV6 A;  1IZ1 A;  3E97 A;  3O6B B;  1ERD A;  3CCE I;  2NS7 A;  5DS9 A;  3QWL A;  1HKT A;  1OFC X;  4YG2 F;  3H3Z A;  4S05 A;  2V9V A;  3K4J A;  3I9V 2;  2UV1 A;  3ELK A;  4BE0 A;  2CW8 A;  3PNT A;  3BLY A;  2X6O A;  1KYZ A;  1NTC A;  2HXI A;  3HHG A;  2L7M P;  1OJL A;  3KP3 A;  3QYE A;  1WVR A;  1MH3 A;  2O3F A;  1S9H A;  1T95 A;  1V4R A;  2X85 A;  4EQQ A;  1LDD A;  2M45 A;  3W3C A;  4HV5 A;  3L2Q A;  4LIU A;  1VQL I;  2N8G A;  3F9K A;  4BXF A;  4XON A;  2IXS A;  3DPL C;  5J3L A;  1Z77 A;  1UG2 A;  1YS6 A;  1U9O A;  5D4S A;  3RJP A;  3GZN B;  3SXY A;  2OPT A;  1DPU A;  1W4M A;  4WXH A;  4YEJ A;  2XAS A;  2HQ5 A;  2R7F A;  5LGT A;  1EH8 A;  1O57 A;  1Z3Y A;  4GCV A;  1IUY A;  2GM4 A;  5JVG F;  1RUN A;  5E79 C;  4XRS A;  3JRB A;  1T6S A;  1YRN A;  1V3F A;  2NVX J;  1TW2 A;  3BJ6 A;  6PAX A;  5ICC A;  2EBI A;  2K5C A;  3M1C A;  5KAI C;  3A02 A;  2BZT A;  2M2E A;  5HNF A;  3GO5 A;  1XB4 A;  3H36 A;  2PLY A;  4DJA A;  5DEQ A;  2KFD A;  2E35 A;  3TO7 A;  5F04 A;  3V7C A;  1RKT A;  4FHT A;  4XOP A;  1SD6 A;  2J5P A;  2EIL H;  2WV1 A;  3HRT A;  2QYO A;  3SFI A;  3LST A;  3RPQ A;  2YU9 J;  1X3Z B;  2D45 A;  3BZC A;  4IF4 A;  3RPU D;  1Q1H A;  4U0V A;  3CP2 A;  2Z16 A;  2K9N A;  2G7U A;  1HW2 A;  2LY1 A;  2ZXW H;  1R1T A;  4ESB A;  1DGW Y;  2RKH A;  5GAH J;  1FX7 A;  4CO8 A;  1WQ2 A;  4HF2 A;  2DA7 A;  3AFH A;  3CMM A;  3CCY A;  2XB0 X;  2LKX A;  1OIS A;  4CYC A;  3OYI A;  3IRQ A;  4BU2 A;  4BAY A;  1T39 A;  1PJR A;  1F4K A;  2DLL A;  2DOA A;  2LBF B;  1H9G A;  2H6C A;  3ZGK A;  4P9F A;  1Z91 A;  4CHU A;  1OQY A;  5JVT A;  3I59 A;  2BVL A;  1S29 A;  1SD7 A;  4S0H B;  1W7P B;  4IHT A;  1IN6 A;  4P1W A;  4AUX A;  3Q5F A;  1SVM A;  4PSX A;  3NAU A;  1K4S A;  4RAF A;  5BOX A;  2B7E A;  5IP6 A;  2EJR A;  2VB6 A;  4HNV A;  3LQQ A;  3PNV A;  1MBG A;  4CZC A;  3S1N J;  5GTH C;  3Q9V A;  2Q2E A;  3ZRG A;  2QWW A;  3OYL A;  4MTE A;  5ILU A;  4R8H A;  3SDG A;  2NVU B;  3H35 A;  3U1D A;  1YFH A;  3SYT A;  1ZGW A;  1WJE A;  2PEX A;  2O8K A;  5EF6 A;  1JHF A;  2EA4 A;  5K7F A;  3HOY J;  1HSJ A;  3K69 A;  2X9D A;  1QO0 D;  5D5V B;  2Z1D A;  4XID A;  2LDU A;  4RAY A;  5GAD J;  2M0M A;  1K6Y A;  4RB2 C;  4MTD A;  1JI8 A;  4U0Y A;  2IRF G;  2LKS A;  1P7J A;  1UG0 A;  3R6S A;  5JI6 A;  3L2U A;  4B8X A;  4RA2 A;  3KP5 A;  1YX3 A;  2HQA A;  2VOO A;  2IS6 A;  2BY2 A;  2OQG A;  1R22 A;  4FQG A;  3E0J B;  2ID3 A;  1WJF A;  2M34 A;  3BRO A;  3HM5 A;  2LH9 A;  1MDM A;  4P9U A;  4UB6 C;  4KN7 X;  2E71 A;  3HTS B;  3OIP A;  3OOU A;  4B3A A;  3DTE A;  5DCF A;  4GRI A;  1XSD A;  3I58 A;  1U6G A;  3GFJ A;  1PDN C;  1ON1 A;  2K3F A;  1U5T C;  3ZQQ A;  1I6H J;  3VYR B;  2Q1Z B;  3R0J A;  3AL0 B;  1E17 A;  2HVS A;  2EPF A;  2MG4 A;  5H6R A;  2JA6 J;  4CCL A;  4A3I J;  3IP4 B;  4AC0 A;  2I5U A;  2XPV A;  2FU4 A;  3MN2 A;  2JUC A;  2BXZ A;  1UMQ A;  4AU7 A;  3D5L A;  3MQ0 A;  4DQ2 A;  1IW7 F;  4ZYH A;  1PYV A;  2ZKZ A;  4YIF A;  3U21 A;  2VBX A;  4E7I A;  4WXC A;  1B72 B;  1FOW A;  2RV8 A;  1HDP A;  1QNT A;  1YOV B;  4BHB A;  5F0C A;  2F6C A;  2DT7 B;  2IGK A;  2K40 A;  3F8M A;  3V7R A;  3OYG A;  1ZGJ A;  1WH5 A;  3BDD A;  1V5F A;  3CCS I;  4IHS A;  2O5R A;  3H9J A;  1O3R A;  2LP0 A;  2QSG X;  5ICF A;  3DQV C;  2R93 J;  4XLH A;  2DJN A;  2ZSH B;  1XC5 A;  2PQ8 A;  3SZT A;  5D6F A;  4PCQ A;  3CZ6 A;  2EZL A;  2MSY A;  4C3J J;  4N9I A;  3BTI A;  5FKO A;  4LLN A;  3RKY A;  5LHH A;  5FRM A;  1KU9 A;  3P9I A;  2AO9 A;  3Q3S A;  2UWM A;  4XMY A;  2XF6 A;  2P6S A;  2QEX I;  3E3V A;  2JA2 A;  4WX9 A;  1IXS B;  1XDU A;  1P4A A;  2MAB A;  4OAZ A;  2GOX B;  2QKM B;  1D1B A;  5JLW A;  4H4K C;  1ETO A;  4YFX F;  3JCU C;  2BY1 A;  5E8G A;  1TT0 A;  2B9S A;  5IT9 K;  1X58 A;  3S93 A;  1IN4 A;  4ZTF A;  1X19 A;  4GGG A;  1X2M A;  4BH9 A;  3VSL A;  4M3G A;  1ENH A;  1Y39 A;  2E2H J;  3OV8 A;  3BP8 A;  4ZDP A;  2QSF X;  1G3S A;  1CGP A;  3BOQ A;  3PSF A;  2K27 A;  1RC9 A;  5AIQ A;  2CUF A;  2CH0 A;  2ZNZ A;  4HG2 A;  3RZD J;  2CQK A;  3OYB A;  3JRE A;  4G8X A;  3HHH A;  3CUO A;  1WJB A;  4PDK A;  4R1H A;  1GV2 A;  5FKK A;  5E1W A;  3OYK A;  1YJN I;  3GYH X;  2KLO A;  1WSU A;  1MSF C;  3GTO J;  4BHC A;  2IPQ X;  4G7H F;  1ORK A;  3S17 J;  4C3I J;  1EH7 A;  1FYL A;  2DPD A;  5B1B H;  1RZ4 A;  3FXK A;  1TWF J;  2PG4 A;  3SHF A;  1W5S A;  4HW0 A;  1UST A;  1DU6 A;  5IY5 H;  3HSE A;  1YG2 A;  5BQT A;  1N75 A;  1U5T A;  1QRY A;  3I55 I;  4KYW A;  1JXS A;  1GV5 A;  5LD2 C;  3C1D A;  3HUG A;  3ONQ A;  1SD4 A;  3EYI A;  3TW7 A;  4D5F A;  1OMI A;  3HOW J;  3MZY A;  3H1C A;  1T0F A;  3ZMU A;  4JBA A;  2P0W A;  4NNJ A;  2DOD A;  2D1H A;  4XRM A;  2HZT A;  3Q0U A;  3DLL F;  3MFK A;  4L9V A;  1OR7 A;  1S7A A;  2DDB A;  2V9K A;  4I6Z A;  1H9T A;  2PJR B;  2R5Y B;  1LVK A;  2IVM A;  4LGW A;  1W1W E;  4OU0 A;  1DP7 P;  4Q4Z F;  4OIP F;  2H27 A;  4HYE A;  1E0E A;  3RZO J;  4G6T B;  3DV8 A;  3D0S A;  1QBJ A;  5ICG A;  4GFB A;  3RKW A;  1TL8 A;  4B3X A;  2L3D A;  2Q0O A;  3LMM A;  2LLK A;  4ASN A;  1GXP A;  2A6E F;  3KLN A;  2HDW A;  2GZW A;  2V6E A;  5LLQ A;  4QTR A;  3H3V K;  4NHJ A;  4B48 A;  4M3B A;  3IL2 A;  2X6Y A;  4EGZ A;  2L7F P;  2MC4 A;  1EF4 A;  4I99 C;  2DI3 A;  3GWZ A;  2ISZ A;  4A0X A;  3EPZ A;  1KQ8 A;  1P4X A;  1E3P A;  4II2 A;  1LVA A;  2EV0 A;  3G71 I;  3FXM A;  2EFN A;  2OJE D;  2E1O A;  2JSP A;  3KE2 A;  1A36 A;  3OS2 A;  2YSR A;  3ZCO A;  2Z33 A;  3E6C C;  2HPM A;  5FO5 A;  4J00 A;  2WAE A;  3FBI B;  4NC8 A;  5J1Y A;  4E7Z A;  1HW1 A;  2V6C A;  3RQ4 A;  4LG3 A;  1YJW I;  3OYM A;  1ULY A;  2K4B A;  1ZAO A;  2HYG D;  3PIO F;  2WY7 Q;  4YFK F;  4I01 A;  4ZJZ A;  2DOF A;  3KZI C;  1FSH A;  4HLY A;  3EUK L;  4CCK A;  2M7B A;  4M3D A;  3L2R A;  1POG A;  3H5R A;  2LSO A;  5HS7 A;  3BCA A;  5B1A H;  1PUF B;  2F48 A;  3ZN1 A;  3ABL H;  4RGS A;  1LDJ A;  3PFI A;  2GXG A;  2VL8 A;  1ODD A;  5H2F C;  2FOK A;  3K1N A;  3OIO A;  5GAG J;  5LEJ A;  1YW8 A;  2M5W A;  1BIB A;  2OQR A;  2KKO A;  4LB5 A;  5IYB J;  5E3O A;  2V79 A;  2R7Z J;  3KYC B;  1MMD A;  3G1M A;  1Y6I A;  4DW6 A;  4JK1 X;  1IJW C;  2FBI A;  5M3M J;  1K4T A;  4CDG A;  1IN5 A;  2MD0 A;  4KJZ A;  4HPQ A;  4PGH A;  4F55 A;  4RB1 A;  2CYY A;  4V2F A;  3AKZ A;  2W85 A;  3K6G A;  1JHH A;  3T1B A;  4C2U A;  1A6I A;  2WV0 A;  3IRR A;  2K86 A;  2RVC A;  2VI6 A;  4IQ4 A;  3SQN A;  1T38 A;  2JVG A;  2V1N A;  1SFK A;  2V1U A;  1JTY A;  2WAQ A;  2ZSI B;  3SZG A;  1DU0 A;  1KZH A;  5DDG A;  3L1P A;  3KP2 A;  2CV1 A;  4XN3 A;  5C4X J;  2M8E A;  2FUG 2;  2A5W A;  1USS A;  2W25 A;  4BXX J;  2YX7 A;  3EET A;  3ML6 A;  1Z0X A;  2JTV A;  5IPA A;  2Y0S N;  4AIK A;  2E36 A;  2XGC A;  1ETV A;  3I54 A;  2XPU A;  1AKH A;  4XOR A;  5HLH A;  2KIU A;  2L9S A;  4W97 A;  1YHQ I;  1QA6 A;  3K9T A;  2VT3 A;  3PSI A;  3GTP J;  2LBF A;  3QPL A;  4ZZL A;  2E1N A;  1VQN I;  2KDZ A;  1HCR A;  3BR1 A;  3OSF A;  4D7N A;  1LEB A;  2ELK A;  3DP7 A;  2GQQ A;  1MD0 A;  1P4W A;  4DYR A;  4CUG A;  3DBR B;  2DMN A;  2UZK A;  1FIP A;  5KAF C;  1VI0 A;  2D2W A;  1J59 A;  2IP2 A;  2XV4 S;  4BGD A;  5LHI A;  1H88 C;  4UUV A;  1XGM A;  5J1U A;  2E19 A;  5BPI A;  4MLO A;  2XGD A;  2QBY B;  4CGZ A;  4BQN A;  3K1P A;  4XQF A;  1TNS A;  4B09 A;  4EJO A;  4S04 A;  4RMN A;  3HSR A;  2ELJ A;  2E1C A;  4MEX F;  2X48 A;  5B5E C;  1MJA A;  5K1Y A;  2YPR A;  3MCZ A;  3RKQ A;  2BE5 F;  2X51 A;  3WHC A;  3FMQ A;  4WXD A;  2MFZ A;  4J19 A;  1LJ9 A;  2DT5 A;  1QZY A;  1HKS A;  3D5S C;  4LLG F;  1Q1V A;  2Z2S B;  1UHM A;  5JFR A;  2DK5 A;  4HV6 A;  4QIW N;  3GBG A;  4DNC A;  2OCC H;  2WAF A;  1ZTR A;  4CIC A;  3BTC A;  2PX9 A;  4DYQ A;  2F2E A;  3M8J A;  2BBY A;  3GW2 A;  2XAQ A;  2Y31 A;  2BOL A;  3IKT A;  3OS1 A;  2B63 J;  5IT3 A;  4EEF G;  1CF7 B;  1VQK I;  2JK3 A;  1T98 A;  4XSX F;  1APL C;  3H5N A;  1I5Z A;  3H9Q A;  2EV6 A;  4I7H A;  2D5V A;  1SFX A;  2E60 A;  2DCE A;  4OIN F;  2LRE A;  2W24 A;  3L2V A;  2FMY A;  2R92 J;  2XF7 A;  2VON A;  5ED4 A;  3GXO A;  1X1B A;  3KEY A;  3OMY A;  3FXQ A;  1QHG A;  4XLF A;  4XIC A;  1ZG5 A;  1MW7 A;  4ANJ A;  1TBX A;  1JTX A;  1X3U A;  4HF0 A;  4L9J A;  3BR0 A;  2EB7 A;  2VKD A;  3HKZ A;  2RN7 A;  4RGR A;  1FBS A;  3UR3 C;  3RIR A;  4KIS A;  1ZAR A;  2LG4 A;  4E4H A;  4IHY A;  2X6X A;  1VF9 A;  3F6V A;  5EGO B;  4QSH A;  4M6V A;  1O7L A;  3OYC A;  3F3X A;  4XR6 A;  2BXY A;  2E2J J;  1S8N A;  3A03 A;  3FHN A;  1K79 A;  1LUJ B;  2OZU A;  3HBL A;  5J4V A;  4HF1 A;  3H92 A;  1U3E M;  1F43 A;  1B72 A;  5L3B A;  4A3B J;  2HDD A;  3HGY A;  1K6O A;  1SAX A;  2W48 A;  3HOU J;  4KT5 C;  4EV0 A;  2R7R A;  1QVU A;  1IN8 A;  5E8I A;  3HOT A;  2W4S A;  3S1Q J;  3J81 Z;  4XLC A;  2E7W A;  4BDZ A;  4BL0 B;  4MEY F;  2LOO A;  2H8R A;  1LB2 A;  1I6X A;  9ANT A;  3D1N I;  2AXT C;  3NQO A;  4U7B A;  3G4S I;  4HBL A;  1G2H A;  2EFW A;  1ZYR F;  4K2E A;  1OPC A;  2ZME B;  3OSG A;  4G7Z F;  2DA5 A;  1JJ6 C;  1IXC A;  4C9Y A;  3E5U A;  2VQG A;  2EIJ H;  2COB A;  4KIC A;  2A69 F;  4CSW A;  2NXN B;  3E6D A;  2X0L A;  2VKV A;  1U78 A;  4ENJ A;  1ZLJ A;  4MFD A;  4BQO A;  3CJR B;  3W2A A;  2RC4 A;  1I50 J;  4ON0 A;  1J75 A;  4ESJ A;  1EJ9 A;  2YX4 A;  2COM A;  5LGU A;  1RET A;  3WG7 H;  3C2H A;  3ASO H;  3CP8 A;  3H5A A;  2JQ7 A;  3OOP A;  1O3Q A;  2DYS H;  2WBM A;  2L5Q A;  4M6X A;  1RIO H;  2IGM A;  2RDP A;  3ZQC A;  3SJM A;  1Z05 A;  3L2W A;  3R0A A;  2F4M B;  5FKN A;  3HOZ J;  4RAG A;  1X1P A;  3RDI A;  1GHC A;  5EZH A;  1EA3 A;  3CMA I;  3PM1 A;  4EVI A;  3JRI A;  4LJZ F;  1OYI A;  1YS7 A;  3I3L A;  1I3Q J;  2LK2 A;  2ZB9 A;  5CQG A;  1W0T A;  1EKE A;  1Y0N A;  2XKO A;  5FB2 A;  3V7S A;  4F91 B;  4XN0 A;  3K2Z A;  2STW A;  3I64 A;  2FX0 A;  4NUB A;  1I27 A;  4PJL A;  2XAF A;  5IP9 J;  3PUB A;  4M9X A;  1Y1V J;  4BEH B;  2PJR A;  2B0L A;  1S72 I;  2R5Y A;  2DMT A;  2HKX A;  1WKM A;  2VJ4 A;  4HX7 A;  2QA4 I;  1O4X A;  2DMP A;  3JRD A;  4O3M A;  3FF5 A;  1Z3X A;  4LFU A;  4XKV A;  3M8F A;  4KFC A;  2V9P A;  1R5G A;  4BJT A;  4AIH A;  1YQA A;  3FKJ A;  3OYH A;  2MD5 A;  3HYI A;  2PMH A;  4IRH A;  3OYA A;  2VQL A;  1JT6 A;  4CA0 A;  4M9S A;  1YYV A;  1D5Y A;  2KHM A;  3HSF A;  3CD6 I;  2K3P A;  3VFZ A;  4BBS J;  1A31 A;  1DDN A;  3J7A Y;  3CES A;  5E1Z B;  2JA8 J;  1T56 A;  4A12 A;  4L0Y B;  1W5T A;  5F0F A;  3OWT A;  2CFX A;  2KRH A;  3DWL E;  4GXO A;  1XX5 A;  5GPC A;  4M6Y A;  1UHS A;  3Q0W A;  5GP9 A;  4IEJ A;  1RUO A;  2YR2 A;  3JTG A;  2E5N A;  2V26 A;  2Y9Y A;  3I4M J;  4KN4 X;  2MLG A;  2W84 A;  3DKY A;  3OYE A;  2V4J C;  4KT6 A;  1HXD A;  2DQR A;  3WU2 C;  1V5G A;  1WJD A;  2LTP A;  4DBQ A;  3ZQF A;  4M74 A;  1B8I B;  4EJT A;  5TJJ A;  1OCT C;  4CCM A;  4OMY A;  4FIS A;  3DU6 A;  1MNE A;  4RM2 A;  4PK4 A;  4BY7 J;  3S14 J;  2M1B A;  2R3S A;  3LSK A;  4I0B A;  5DCM A;  2Y9Z A;  3VYT B;  3M4O J;  2BY0 A;  1SD5 A;  2GOM A;  3K0L A;  2FQ4 A;  4KIF A;  3MKW B;  1PUF A;  2CQN A;  3QOP A;  3DEE A;  2R7S A;  2KRC A;  3VSK A;  5E3M A;  2NS8 A;  3E6B A;  1O7F A;  4IHW A;  4D0P A;  1F1Z A;  4U87 A;  3K7A J;  2M4K A;  3HL2 A;  3ZMV A;  3BQZ A;  2M87 A;  2VKE A;  4AYB A;  2DT6 A;  5HS9 A;  2L7Z A;  2HFH A;  4WF2 A;  2DMU A;  2BY3 A;  4QWQ A;  1BA5 A;  3E1S A;  3QU6 A;  1ZR2 A;  2BW3 B;  3DXJ F;  2XB5 A;  1K7A A;  4MFE A;  3M07 A;  1XSV A;  1M1E B;  5D5W B;  3R4K A;  4N4O B;  3M1E A;  3B02 A;  3TP3 A;  3A0B C;  3VWB A;  2CW0 F;  1FEX A;  3N97 A;  1DP3 A;  1R1U A;  2CSO A;  2IEK A;  2H09 A;  2WTE A;  3LL7 A;  1N78 A;  3IC7 A;  3P9C A;  3NRV A;  4HX4 A;  1XS9 A;  4KMF A;  1MKM A;  1FIA A;  3GCM A;  1OCP A;  2EIN H;  1TQI A;  2LY2 A;  2LD5 A;  3I5U A;  5JR3 A;  4BDY A;  2P7C B;  3N4M A;  1KYW A;  1L3L A;  3RSN A;  2MW8 A;  2IGO A;  2G7H A;  1G59 A;  3JR9 A;  2L01 A;  4MQ9 F;  2CV0 A;  1ZGA A;  3IWF A;  2P81 A;  3ULQ B;  2QM3 A;  1ETY A;  1LE8 B;  1GUU A;  2XC7 A;  4I0A A;  1YO5 C;  2EZH A;  3MAJ A;  5ICE A;  4KIB A;  2QGU A;  5CLS A;  3WTW C;  4UV8 A;  1T0F C;  3K2A A;  4UUT A;  1D8K A;  1Z67 A;  2R7D A;  3W2V A;  1P7I A;  2ZFU A;  5JLX A;  4P55 A;  2K9M A;  3JRF A;  2VJ5 A;  3KYL A;  1OR7 C;  3CCR I;  2K4J A;  4MO7 A;  2CW7 A;  2NVY J;  2E1M B;  3ZPL A;  2HXO A;  4F7Z A;  3CMY A;  5IYC J;  3J81 K;  5HDK A;  3Q0V A;  2QBY A;  2OTJ I;  2W57 A;  2NVT J;  4E7L A;  4KA4 A;  4U0W A;  3J80 Z;  2UXX A;  1R71 A;  5M5W J;  4P96 A;  4J01 A;  1UAA A;  3LWF A;  2JA5 J;  2LNB A;  4UVC A;  1X2N A;  1ZHF A;  2CU7 A;  1FP2 A;  5E18 F;  3UKG A;  1FTT A;  2IT0 A;  5ILV A;  4JX4 A;  1G3Y A;  1P2F A;  3HZJ A;  3T8R A;  4A3L J;  2CMP A;  4L5E A;  5KVR A;  4Y52 J;  4ZTJ A;  2AQE A;  3CUQ B;  5DV5 A;  4EM2 A;  5KK1 A;  3WE3 A;  3GTQ J;  5M5X J;  5EYR A;  1X1D A;  2MYS A;  4EJU A;  1T33 A;  1YE9 A;  4ZDL A;  3AG3 H;  2WB1 A;  4ESF A;  1BOA A;  1TT5 B;  1MJB A;  2FD5 A;  1YLF A;  3F8C A;  1CF7 A;  4A6D A;  1NG6 A;  3FMR A;  3WGI A;  3HKZ N;  2OTL I;  4UB8 C;  1F5T A;  3W6J B;  1X4P A;  1WRJ A;  2Z3Y A;  4IQJ A;  3FM3 A;  1Z7L A;  1Y1W J;  4Y4R A;  2ZXJ A;  2A6T A;  2MC3 A;  1TZL A;  3IAM 2;  3TMO A;  2WWY A;  4LIT A;  1HKQ A;  1X1A A;  2FE3 A;  4A3J J;  3CDI A;  5GTI C;  1O3T A;  2PMZ A;  3KP4 A;  1GVD A;  3A01 B;  3LAJ A;  1FTZ A;  2H8W A;  2GBY A;  4GYI A;  2Y48 A;  4LIV A;  2K02 A;  5HLI A;  2IA1 A;  2A07 F;  3TDU C;  5EGO A;  1F9N A;  3TO9 A;  5K5Q A;  3OR1 C;  2ICW G;  3MKL A;  1B9M A;  2XKP A;  5A2Q Z;  3HRU A;  3COA C;  4CCJ A;  1LEA A;  3LA2 A;  4OOI A;  1W5C C;  2BV6 A;  3ZQ7 A;  2P5L C;  5L3D A;  3NEU A;  3G1O A;  2KJC A;  3LSM A;  2DA2 A;  1AOY A;  3L2C A;  3CC7 I;  5J6X A;  3KYD B;  3IKV A;  3ZMZ A;  2JRT A;  1I39 A;  2ID6 A;  4IZZ A;  1W0U A;  3K1M A;  4ZC3 A;  4D1Q A;  1P92 A;  3P7N A;  2X4H A;  1ZRD A;  1KGS A;  2QQ8 A;  1E3H A;  3EDP A;  4LOC A;  2QF7 A;  4XRS G;  5IP7 J;  4M3E A;  1UHW A;  2F4I A;  1RKW A;  2LVS A;  2MLK A;  3EQL F;  1VTN C;  3AG1 H;  1WGX A;  2GIV A;  4JOM A;  1R1V A;  2NOJ B;  2L2O A;  5FJ8 J;  1JGG A;  3GTG J;  5HLT A;  3IH2 A;  1XGO A;  3QOE A;  2ZME A;  3MEX A;  3MZ8 A;  4BNC A;  4IRI A;  1BN5 A;  3WTX C;  3B6C A;  5E20 A;  3C3W A;  2CJJ A;  3S3N A;  1K83 J;  2MA3 A;  5D5X B;  1JJ8 C;  2VBY A;  2ZJR F;  4FE7 A;  1ETQ A;  2JWT A;  3GLX A;  4MHG A;  3FWE A;  3MWM A;  3DLA A;  1FLI A;  3KEO A;  2DQL A;  2M7A A;  2ZC2 A;  4ZYG A;  1KA8 A;  3JAM Z;  4RBO A;  4RLF A;  2VUM J;  4CCO A;  2HTJ A;  4Z2Y A;  3BZ6 A;  2LR8 A;  2P6T A;  3W2W A;  4A6E A;  3ECH A;  3LSH A;  4FCY A;  4ENK A;  2XIG A;  2IA0 A;  1QZE A;  4MNU A;  3RI4 A;  2HVQ A;  1J09 A;  1S5L C;  2DA4 A;  1IDZ A;  1AA7 A;  3U2R A;  4E7S A;  3GFM A;  4AD9 A;  2VJJ A;  1SVL A;  4N4N B;  4M72 A;  3ZMT A;  1IG7 A;  5M5Y J;  1JUP A;  2XGX A;  2EFP A;  1IRX A;  2VE8 A;  3X2Q H;  1JKO C;  1YI2 I;  2EFQ A;  2Z5U A;  3S3O A;  1TNT A;  1X1C A;  2LF8 A;  3LFK A;  1SFO J;  1KON A;  1WJC A;  2P5V A;  2DOE A;  4M73 A;  3TW6 A;  1Z6R A;  4M71 A;  4A5M A;  2K9S A;  3M3Y J;  4XL9 A;  3QPH A;  2HTS A;  5HOO A;  1ON2 A;  2XAH A;  4NC7 A;  1XN7 A;  4BEH A;  5GAE J;  3OYD A;  2VXZ A;  3CC2 I;  4XLE A;  1IAW A;  4ITV A;  4A3K J;  3S2H J;  3VB2 A;  5J47 A;  1MGT A;  3LFU A;  4XK4 A;  1MMN A;  1MH4 A;  4XLN F;  3H0G J;  2C6Y A;  2VQH A;  1N77 A;  1KU2 A;  1BJA A;  1D1C A;  3WTU C;  2NS0 A;  4V2G A;  4L18 B;  1MBF A;  4A3M J;  3TOA A;  1VQP I;  3WU0 A;  3DBH B;  2QSH X;  1TWH J;  2XVC A;  4P5O A;  1R00 A;  1YIO A;  2WAD A;  4PUS A;  3KEQ A;  5DM7 F;  1A6Q A;  1LFP A;  4I98 B;  1QPI A;  3A4C A;  2QUF A;  3ABK H;  3BG6 A;  1ZEL A;  2ZCW A;  2HQN A;  3AL0 C;  3ZR8 X;  1YX5 A;  4BQA A;  1MSE C;  2GA1 A;  4NDL A;  3S2W A;  4Y17 A;  1JUS A;  3OL3 A;  2OUM A;  4H0E A;  2IAI A;  2GLO A;  2JN6 A;  3HB9 A;  1YIT I;  3FXL A;  1YTY A;  3F6O A;  5K7Z A;  1IRZ A;  1ZRE A;  2DJI A;  4UHT A;  2FBK A;  2EWN A;  2KRF A;  3DPU A;  4B1R A;  3CCQ I;  3CCJ I;  1B8I A;  1HOM A;  2HYF A;  5FGM A;  1ZH5 A;  2L9V A;  1JE8 A;  4AYB N;  1N25 A;  1QU3 A;  1DQU A;  4HQM A;  1UCR A;  3A1Y A;  4IVN A;  5H20 A;  3J80 K;  2ME0 A;  3GTL J;  1W7P A;  1GDT A;  1VZ0 A;  3ESW B;  1UEL B;  3K70 D;  3R61 A;  3ERM A;  3QOD A;  1QGP A;  3ASN H;  2JPB A;  2ISY A;  1FWZ A;  1OCR H;  1GXQ A;  3GTJ J;  2VBZ A;  1ETK A;  2FA5 A;  3F0C A;  2FNP A;  3BG7 A;  5HNH A;  1S6L A;  3BR2 A;  1WPK A;  1T2K A;  3LOC A;  3R60 A;  5EEG A;  2A6H F;  4F3Q A;  5F64 A;  3KFW X;  1W36 D;  2BW3 A;  1TQP A;  5E3N A;  1R4M B;  4IL6 C;  2LYC A;  1WJ5 A;  2BHY A;  2FRH A;  1FP1 D;  4I02 A;  1MBE A;  2P4W A;  1VFC A;  3CTA A;  4E6K G;  1RR8 C;  3PJR A;  1D5V A;  3CC4 I;  2M0C A;  1G4D A;  3MZH A;  5EG0 B;  3S1M J;  4KDP A;  1Z7U A;  1B4A A;  5ERI A;  4JQF A;  2BYV E;  3TBI A;  3Q9S A;  1AU7 A;  2MBF A;  1SVO A;  3BQY A;  1MBJ A;  1KQ9 A;  1PP8 F;  2CQQ A;  2DW4 A;  5C44 J;  2FSW A;  3PO3 J;  2X1E A;  3WG9 A;  4FTH A;  2DA3 A;  3DBL B;  3DCF A;  3MMY B;  3GX4 X;  5E17 F;  4A3G J;  1Y8R B;  5F1R A;  2K85 A;  1FPQ A;  4Y3O A;  1LE8 A;  3QYF A;  1FNN A;  4RS8 A;  1WI9 A;  1SFU A;  3F8B A;  2FML A;  2JA7 J;  5M3F J;  2L0K A;  2VC1 A;  4EM1 A;  2EIM H;  3RQI A;  3ZMS A;  1Y56 A;  1VQ7 I;  3OYF A;  1OCO H;  1D0Z A;  3FX3 A;  3I53 A;  4FAS D;  3QU3 A;  3K4L A;  3QPT A;  2NRA C;  2KP6 A;  2P7V B;  3CDL A;  2HI3 A;  3FKI J;  3TDZ C;  1W7P D;  1G6N A;  2DA6 A;  1TLH B;  1FYK A;  4IHV A;  4RB0 A;  4ENN A;  1MMA A;  4JX6 A;  3MKY B;  2VOP A;  3EUH A;  1SFE A;  1FSE A;  3SZP A;  3GEZ A;  2XDV A;  2NYX A;  4E7J A;  2W7N A;  2FF4 A;  3S32 A;  2M9H A;  3JTH A;  2MH9 A;  4IOA F;  3BZK A;  4KMU X;  2TDX A;  5D8L B;  3LSR A;  1U5T B;  1VQ9 I;  3BG9 A;  3F22 A;  3KET A;  1R7J A;  2QEN A;  2EFO A;  5BMZ A;  3M8E A;  1L0O C;  5HVQ C;  2WB1 N;  2DN0 A;  1JGS A;  2O61 A;  4X0G A; 
#chains in the Genus database with same CATH homology
 1GV2 A;  5FKK A;  1MSF C;  5E3M A;  2NS8 A;  3GTO J;  3HOX J;  4IHW A;  2YUS A;  1ORK A;  2L9R A;  1SAN A;  3S17 J;  4C3I J;  3K7A J;  1WH7 A;  5HOD A;  3BQZ A;  2VKE A;  4JX5 A;  1TWF J;  2HOS A;  5EEA A;  2L7Z A;  1NK3 P;  2DMU A;  1DU6 A;  1BA5 A;  2DMQ A;  1QRY A;  1GV5 A;  1ZR2 A;  2XB5 A;  4MFE A;  1TC3 C;  3TW7 A;  4D5F A;  2EH3 A;  3HOW J;  3TP3 A;  1MBK A;  1FEX A;  5IOZ A;  4XRM A;  1JUM A;  3Q0U A;  2IEK A;  3B6A A;  1ETX A;  4A93 J;  4I6Z A;  1JT0 A;  2R5Y B;  1XS9 A;  3JRC A;  1FIA A;  1S7E A;  1OCP A;  3G1L A;  4DZP A;  2XSD C;  3GTM J;  2LD5 A;  3NAR A;  1AHD P;  3A01 A;  3RZO J;  5EZG A;  4GFB A;  3S2D J;  2MW8 A;  3O8H A;  1ZQ3 P;  3BG3 A;  3JR9 A;  1E3O C;  1XG1 A;  1BL0 A;  2LLK A;  4BKX A;  1IC8 A;  1MBH A;  2P81 A;  1ETY A;  4QTR A;  1LE8 B;  3H3V K;  3BTJ A;  1GUU A;  2TCT A;  4M3B A;  2L7F P;  1EF4 A;  4DZJ A;  3S16 J;  2EZH A;  1ZR4 A;  2RAE A;  2JA7 J;  5C3E J;  1ZKG A;  3K2A A;  2HYJ A;  2R5Z B;  5FKL A;  1JGG A;  4UUT A;  4B4C A;  2NOG A;  3LNQ A;  2E1O A;  1P7I A;  5JLX A;  2DA1 A;  2LFB A;  1JKP C;  3HOV J;  4UUS B;  5C4J J;  3JRF A;  2NVQ J;  1RES A;  4MO7 A;  4BY1 J;  2NVY J;  5J1Y A;  2YS9 A;  2HXO A;  4G12 A;  1CQT A;  5F08 A;  3QPS A;  5IYC J;  3CMY A;  3Q0V A;  3HGG A;  3LSG A;  5F1J A;  3FIS A;  2NVT J;  5FLM J;  2G0E A;  5M5W J;  2JA5 J;  3FK6 A;  1RR7 A;  5FLV A;  1X2N A;  2KT0 A;  2CU7 A;  5FKM A;  3BR3 A;  4M3D A;  3DEW A;  3UKG A;  1POG A;  1FTT A;  3MVP A;  4JX4 A;  2LY9 A;  3BG5 A;  4A3L J;  5K7H A;  3HDD A;  4L5E A;  1PUF B;  3S15 J;  4DYC A;  4Y52 J;  3CQZ J;  4A3E J;  1GT0 C;  4C3H J;  4X6A J;  3OIO A;  3GTQ J;  2HOA A;  5M5X J;  2AHQ A;  5EYR A;  1VND A;  1T33 A;  2I10 A;  5IYB J;  1BW5 A;  4JYK A;  1IGN A;  4C2M J;  5E3O A;  2FD5 A;  2R7Z J;  3G1M A;  2Y2Z A;  4DW6 A;  1IJW C;  2CRG A;  4I76 A;  3HKZ N;  5M3M J;  5F0H A;  3HEF A;  3LSP A;  3E7L A;  3GTK J;  2HOT A;  1Y1W J;  2CUE A;  4X1E A;  1AKH B;  2EQR A;  1U8B A;  4V2F A;  1RPW A;  4A3J J;  1A6I A;  3ZOB A;  2VI6 A;  4D5C A;  1GVD A;  3FIW A;  3A01 B;  3LSJ A;  1FTZ A;  3BTL A;  2GBY A;  1JTY A;  2EZK A;  1DU0 A;  1BW6 A;  3I4N J;  3ZQI A;  2H1K A;  3L1P A;  2MGQ A;  5EGO A;  2ECC A;  3IH4 A;  4A3C J;  5C4X J;  2PMZ N;  3MKL A;  4Y7N J;  2VPR A;  4BXX J;  1Z0X A;  2WAQ N;  5IPA A;  2TRT A;  1H89 C;  2Y0S N;  2XGC A;  5EDN A;  3G1O A;  1ETV A;  2DA2 A;  2XPU A;  1LFU P;  1AKH A;  4FE4 A;  2Y30 A;  4W97 A;  3IH3 A;  2ID6 A;  1W0U A;  1TWG J;  1WCM J;  3GTP J;  3QPL A;  3FK7 A;  2KDZ A;  1HCR A;  3BR1 A;  3OSF A;  4D7N A;  2ELK A;  4XRS G;  4LOC A;  5IP7 J;  2QF7 A;  3C2B A;  2ME6 A;  2XRL A;  4DYR A;  1A5J A;  4M3E A;  1RKW A;  2LVS A;  2DMN A;  2O7O A;  1FIP A;  1VI0 A;  1WGX A;  1H88 C;  1ZK8 A;  5J1U A;  2E19 A;  4A3D J;  4MLO A;  2XGD A;  5FJ8 J;  3GTG J;  1BJZ A;  3IH2 A;  2QCO A;  4A3F J;  1IV6 A;  2DTZ A;  3B6C A;  2NS7 A;  2X48 A;  3TP0 A;  2IBD A;  2CJJ A;  5DS9 A;  1K83 J;  1OFC X;  3RKQ A;  1JJ8 C;  3WHC A;  4FE7 A;  1ETQ A;  3PO2 J;  2JWT A;  4J19 A;  2X6O A;  1Q1V A;  1NTC A;  2HXI A;  4RBO A;  2L7M P;  4QIW N;  3GBG A;  1OJL A;  2VUM J;  1ZTR A;  1WI3 A;  2LR8 A;  1MH3 A;  3BTC A;  4DYQ A;  3WHB A;  3BR6 A;  4FCY A;  2Y31 A;  2N8G A;  5J3L A;  1IDZ A;  2DA4 A;  1Z77 A;  5F27 A;  3IV5 A;  3JRH A;  2B63 J;  1UG2 A;  1U9O A;  4EEF G;  2JK3 A;  1IG7 A;  5M5Y J;  1APL C;  1JUP A;  2OPT A;  4IHX A;  2D5V A;  2HQ5 A;  5E3L A;  4RDU A;  1JKO C;  2R92 J;  3O8G A;  2GM4 A;  1U9N A;  3ZQL A;  4XRS A;  3JRB A;  1SFO J;  1IUF A;  5IOY A;  1YRN A;  1ETW A;  4XIC A;  2NVX J;  1F36 A;  3TW6 A;  2EBI A;  3BT9 A;  1JTX A;  2K9S A;  3M3Y J;  2CQX A;  3A02 A;  2M2E A;  3BR0 A;  3S1R J;  5F04 A;  5EG0 A;  1RKT A;  2O9L A;  3S2H J;  4A3K J;  4IHY A;  2WV1 A;  1VF9 A;  4XK4 A;  5EGO B;  1MH4 A;  3SFI A;  4QSH A;  4M6V A;  1NK2 P;  2YU9 J;  3JRG A;  2E2J J;  3ZQH A;  3A03 A;  3H0G J;  2K9N A;  1H8A C;  3HBL A;  1LFB A;  1F43 A;  1K61 A;  1B72 A;  4A3B J;  4V2G A;  2DA7 A;  3CCY A;  2XB0 X;  1MBF A;  2LKX A;  4CYC A;  4A3M J;  2HDD A;  1JKQ C;  3HGY A;  1TWH J;  2W48 A;  3HOU J;  4JP0 A;  1QVU A;  3S1Q J;  1QPI A;  4S0H B;  2ECB A;  4AUX A;  2H8R A;  3NAU A;  9ANT A;  3D1N I;  1G2H A;  1MSE C;  4NDL A;  5IP6 A;  1JUS A;  1HDD C;  4HNV A;  3OSG A;  1HF0 A;  1MBG A;  2IAI A;  1R9T J;  3S1N J;  2GLO A;  2DA5 A;  2JN6 A;  3HB9 A;  1JJ6 C;  5DTD A;  2COB A;  5J1R A;  2R0Q C;  4D7M A;  5K7Z A;  1IRZ A;  2VKV A;  1U78 A;  4MFD A;  4B1R A;  1HOM A;  1B8I A;  3JRA A;  1I50 J;  3SDG A;  1ZGW A;  1MNM C;  4AYB N;  5EF6 A;  2O8K A;  1RET A;  5K7F A;  2XGE A;  3GTL J;  1TWA J;  2ME0 A;  3HOY J;  2FJ1 A;  2X9D A;  1ITY A;  1GDT A;  4XID A;  1P7J A;  3ZQC A;  3SJM A;  3GTJ J;  3VPR A;  5FKN A;  3QQA A;  3HOZ J;  1ETK A;  2ID3 A;  2M34 A;  3BR5 A;  3F0C A;  5EZH A;  3BR2 A;  3HM5 A;  1WPK A;  3PM1 A;  3LOC A;  3JRI A;  1I3Q J;  5E3N A;  2LK2 A;  2ZB9 A;  3OOU A;  1W0T A;  5IYD J;  4B3A A;  2EZI A;  1YRN B;  4MIM A;  1I6H J;  1IDY A;  1MBE A;  2FX0 A;  1VFC A;  3TED A;  2M0C A;  2M8G X;  5IP9 J;  2K9Q A;  2MG4 A;  1Y1V J;  2JA6 J;  4A3I J;  5BNG A;  4AC0 A;  5GPA A;  5EG0 B;  2R5Y A;  2DMT A;  3S1M J;  2XPV A;  3MN2 A;  1O4X A;  2DMP A;  3JRD A;  1AU7 A;  1UMQ A;  3W6V A;  3BQY A;  1MBJ A;  2CQQ A;  1TWC J;  5C44 J;  3PO3 J;  1B72 B;  4FTH A;  2DA3 A;  1HDP A;  3DCF A;  2XPW A;  4A3G J;  1JT6 A;  5F0C A;  4CYC B;  2K40 A;  1LE8 A;  3ZQG A;  1WH5 A;  1D5Y A;  2LP0 A;  5M3F J;  2L0K A;  4BBS J;  4W1U A;  3RQI A;  2R93 J;  2DJN A;  2JA8 J;  1XC5 A;  2R5Z A;  1T56 A;  2EZL A;  2MSY A;  1HLV A;  3CDL A;  4C3J J;  2HI3 A;  3BTI A;  3FKI J;  5F0F A;  5FKO A;  2JMW A;  1JKR C;  1QVT A;  4UUS A;  5GPC A;  1UHS A;  3Q3S A;  2AO9 A;  3Q0W A;  5GP9 A;  2OF7 A;  4IEJ A;  2DA6 A;  2Y9Y A;  3I4M J;  4IHV A;  4JX6 A;  4M3F A;  4A69 C;  2JJ7 A;  2M9H A;  5JLW A;  1ETO A;  2LTP A;  3ZQF A;  3LSR A;  1B8I B;  1X58 A;  3BG9 A;  4ABZ A;  1X2M A;  1OCT C;  4M3G A;  1ENH A;  4FIS A;  2E2H J;  3S14 J;  4BY7 J;  1FJL A;  2Y9Z A;  3M4O J;  2CUF A;  2WB1 N;  2E2I J;  3RZD J;  1PUF A;  3JRE A;  2FQ4 A;  4BBR J;  2DN0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...