2R5ZA

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
75
Chain Sequence
KKNPPQIYPWMKRVHLRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 25
structure length 75
sequence length 87
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zA00
2NS7A 4X1EA 2EH3A 2OPTA 1VI0A 3BG5A 2HXIA 1VFCA 3BT9A 4CYCA 1ZQ3P 2XGDA 2TCTA 3G1LA 5K7ZA 4MFDA 4XRSA 4A3BJ 2K9QA 2W48A 5E3OA 3BR6A 3E7LA 4M3FA 1WI3A 5EG0B 3LSRA 1T56A 3OOUA 5C44J 4DYQA 2EZHA 1QRYA 2N8GA 3NAUA 3O8HA 3B6CA 3HOXJ 3BQZA 2O8KA 5J1UA 1A6IA 2O7OA 2KT0A 5IP9J 2DA2A 2E2HJ 5F0FA 2ECCA 4A93J 5M3MJ 5FKLA 4HNVA 2HDDA 4FTHA 5E3LA 1H8AC 3LSJA 1TWFJ 3CMYA 4A3MJ 2DA4A 2EBIA 1ETWA 3JRAA 2R93J 2R7ZJ 2WB1N 5IP6A 2HI3A 4DW6A 1SFOJ 3TEDA 4A3EJ 1APLC 2JK3A 1MSEC 1ZTRA 4IEJA 4LOCA 1TWAJ 4FE7A 3BR5A 2XPUA 5HODA 1X2NA 1IRZA 2DMTA 2ID3A 4D7NA 5EGOA 3TW7A 4GFBA 3MKLA 4XICA 1RETA 2X6OA 2Y0SN 2DA1A 2JA5J 4X6AJ 4JX6A 1IGNA 1HCRA 2XGCA 5FKOA 1LE8B 3NARA 1OCTC 1LFUP 2IBDA 2H8RA 5J1RA 1U8BA 5C4XJ 1BW6A 3HOWJ 5FKMA 1B72B 3BQYA 3SFIA 1JKPC 1D5YA 1Z0XA 2Y9YA 2VPRA 3WHBA 5E3NA 2GLOA 4BBRJ 3O8GA 2CQQA 1AKHB 2AHQA 3SJMA 1ZKGA 4IHXA 1JKRC 3FK6A 1JTYA 3PM1A 5EYRA 4A69C 2VKVA 1GDTA 3ZQHA 1S7EA 1IDYA 2JA7J 3BTCA 1VF9A 1JJ6C 3RQIA 1CQTA 4XRSG 2LFBA 1AU7A 1GUUA 4B1RA 4Y7NJ 4AYBN 4D5CA 2G0EA 4S0HB 2MGQA 5GPCA 3BR2A 1Y1VJ 2NVXJ 3BR0A 2M8GX 4C2MJ 2CRGA 3LNQA 1NK3P 4CYCB 3I4MJ 3K2AA 5EEAA 1RR7A 5M5YJ 4QTRA 3CDLA 2IAIA 2NS8A 4XRMA 1ETXA 1OFCX 2HXOA 4JX5A 3S2DJ 4A3CJ 4M3GA 2XB5A 5F04A 5K7FA 3QPLA 4C3JJ 4A3FJ 1Y1WJ 2CU7A 5C4JJ 1H88C 3HOZJ 4MO7A 3S1NJ 1WGXA 4C3HJ 1YRNA 4D7MA 3IH2A 3A02A 3Q3SA 3S14J 1F36A 4NDLA 5M5WJ 1WPKA 2I10A 4D5FA 3FK7A 3S1RJ 1LFBA 1WH5A 1ETVA 2QF7A 3ZOBA 2DMQA 4AUXA 1GVDA 1QVTA 3M4OJ 1TC3C 3HBLA 1T33A 2XPWA 2RAEA 2DJNA 1RKWA 1FEXA 2EZLA 3CQZJ 1JUPA 1B8IA 4DYCA 3OSFA 3IV5A 5FLMJ 5K7HA 3JRDA 2Y30A 3CCYA 4I6ZA 5EGOB 5EZHA 4IHYA 1JT6A 1X58A 3A01A 3OIOA 3HKZN 1BW5A 1EF4A 1HOMA 1ZR2A 5M5XJ 2R92J 4XK4A 1O4XA 4A3IJ 5BNGA 3JRHA 1FIAA 2CUFA 2DA3A 2EQRA 2L7MP 1FJLA 5FJ8J 2LD5A 2Y2ZA 2LP0A 3Q0VA 1MBKA 2ME0A 4MFEA 2R5ZA 1JT0A 3HEFA 2DA5A 1HF0A 1X2MA 2FX0A 1MH4A 2O9LA 1MSFC 2H1KA 1RESA 3ZQGA 4FISA 2FQ4A 1UG2A 2K9SA 3FISA 2XB0X 4XIDA 1XG1A 2CQXA 2CJJA 1IJWC 2JA6J 1IC8A 3PO2J 1Z77A 3HB9A 1NTCA 1P7JA 4BBSJ 1IUFA 3TW6A 4V2FA 4M3EA 3OSGA 5IYBJ 3HGYA 1MBGA 3S17J 2DA7A 2XPVA 5E3MA 4QIWN 1FIPA 3GBGA 4QSHA 4V2GA 3H3VK 3ZQCA 1RPWA 1NK2P 2MG4A 3QPSA 4RDUA 1GT0C 1TWHJ 1JGGA 2L9RA 3M3YJ 2VKEA 3S1MJ 3G1OA 2OF7A 1MBFA 4A3GJ 4AC0A 1AHDP 2LLKA 4J19A 2NVQJ 1JUMA 4M3DA 1W0TA 4FCYA 3RZDJ 5IYDJ 3FKIJ 1ETQA 1MBJA 1YRNB 1ZR4A 2HOSA 4B4CA 2JMWA 2ECBA 2E1OA 2LTPA 4M6VA 2IEKA 3QQAA 4MIMA 3GTJJ 2R5YA 1XS9A 3JRFA 2XGEA 3BR1A 1SANA 2ELKA 4Y52J 2NOGA 3D1NI 2M34A 1B8IB 2DMNA 3DCFA 1VNDA 3PO3J 4ABZA 4I76A 1HDPA 3JREA 1HLVA 1A5JA 3B6AA 3A01B 1R9TJ 3GTQJ 1ENHA 1JKOC 1JTXA 3LSPA 3GTOJ 1UHSA 3C2BA 5FKKA 2DTZA 2COBA 2DN0A 4BKXA 5IOZA 2ME6A 3JRBA 3UKGA 1PUFA 1F43A 2M2EA 4A3DJ 1K83J 1UMQA 4W97A 2R5ZB 2XSDC 1I50J 4DZJA 2JN6A 2MSYA 2NVYJ 5DTDA 2GM4A 3BG9A 3HM5A 4UUSA 3L1PA 1JJ8C 2WV1A 1MNMC 2M9HA 5F27A 2VUMJ 4BXXJ 1IDZA 2LKXA 1IG7A 2R0QC 1TWCJ 1K61A 2QCOA 2P81A 3HDDA 1U9OA 3HOYJ 2E2IJ 2ID6A 4JP0A 1ETOA 4IHVA 5J3LA 3GTGJ 2M0CA 2D5VA 3LOCA 3VPRA 3LSGA 2K9NA 2L7ZA 1ZGWA 4EEFG 2KDZA 1OJLA 1QPIA 3JRCA 3W6VA 1BJZA 4BY1J 1QVUA 4C3IJ 5EG0A 1Q1VA 3IH3A 3TP0A 3S1QJ 5F0CA 4JYKA 3S15J 3I4NJ 3A03A 2YU9J 2L7FP 5IOYA 4A3KJ 2NVTJ 2EZIA 1ITYA 1MBEA 1W0UA 2E19A 2HYJA 3S16J 4G12A 5F0HA 1ORKA 1P7IA 3HGGA 5M3FJ 3IH4A 4W1UA 3DEWA 2MW8A 1GV5A 2K40A 2TRTA 4JX4A 2HOTA 3HOVJ 2B63J 5EF6A 2Y31A 1DU0A 2X9DA 2EZKA 1WCMJ 2JA8J 2DA6A 4A3JJ 3BTIA 4B3AA 2R5YB 2DMPA 2XRLA 4MLOA 5GP9A 2PMZN 4UUTA 1G2HA 3FIWA 3K7AJ 1POGA 3GTMJ 1GV2A 5J1YA 2YUSA 5JLWA 5IYCJ 3GTPJ 1FTTA 2WAQN 3H0GJ 3ZQIA 1ETYA 3Q0WA 1OCPA 1FTZA 1JKQC 2AO9A 3GTLJ 4M3BA 5IPAA 1HDDC 1BL0A 3HOUJ 5FKNA 2FD5A 1ZK8A 3BR3A 3RKQA 3BTJA 2JWTA 1IV6A 4RBOA 2HOAA 1E3OC 1LE8A 2LVSA 3F0CA 5DS9A 1RKTA 2CUEA 2ZB9A 1DU6A 1I3QJ 4L5EA 3S2HJ 4FE4A 2LY9A 3SDGA 5F08A 2LR8A 1PUFB 3BTLA 1B72A 1ETKA 3JRGA 2E2JJ 9ANTA 2LK2A 1U9NA 1XC5A 2JJ7A 1TWGJ 1JUSA 3MVPA 3JR9A 1AKHA 1BA5A 1MH3A 2FJ1A 5JLXA 3ZQLA 2DMUA 3G1MA 4UUSB 1U78A 4A3LJ 3BG3A 2VI6A 5IP7J 5F1JA 3Q0UA 5C3EJ 5GPAA 4DYRA 4DZPA 3WHCA 2GBYA 3GTKJ 2L0KA 1I6HJ 5EZGA 2X48A 5FLVA 1MBHA 3MN2A 3TP3A 3RZOJ 1H89C 4BY7J 2HQ5A 2YS9A 3JRIA 2Y9ZA 4IHWA 3ZQFA 1WH7A 5EDNA
chains in the Genus database with same CATH superfamily
2R7DA 1MJBA 1WJFA 3K1PA 3MFKA 4I98B 1FC3A 2DPDA 4M9SA 2XAJA 4AVZA 2FA5A 2CFXA 3BT9A 2RDPA 2R7SA 2XGDA 2TCTA 5K7ZA 4MFDA 2K9QA 2V1DA 1EJ9A 5H6QA 4M3FA 3E5QA 3OYBA 1T39A 5EG0B 4P1WA 3GUDA 2W24A 4LLLA 4DYQA 1Z3YA 4QWQA 3DQVC 3NWSA 3HYIA 4ZYHA 3HOSA 2DOEA 4E70A 2ZJQF 2DA2A 2E2HJ 4A93J 5M3MJ 1BIAA 2BBYA 2F48A 4CCJA 4E6KG 5BOXA 4IQJA 4LB5A 4HNVA 2HDDA 1A6QA 5LRRA 5L3FA 2F5CA 5E8IA 5FB2A 4J01A 3DBLB 1TWFJ 5HDNA 2DA4A 2FOKA 4IRGA 2GOXB 3BY6A 2E7XA 4EQQA 1ETWA 1GVJA 4FHTA 4G6QA 4NBQA 3WG9A 3S8PA 4RGXA 1MJ9A 3WU2C 4YIRX 2LF8A 2WB1N 3CESA 4DW6A 1SFOJ 4Z2YA 4A3EJ 3L09A 1MSEC 2DQLA 4IEJA 4LOCA 3REOA 4M6XA 4HNUA 1WVRA 4CH7A 3N05A 4C2UA 1J9IA 2PJPA 1X2NA 1P6RA 1J59A 5FLXZ 3KYDB 2P5LC 3WE2A 3TW7A 4GFBA 1RETA 2A5WA 2HTSA 1Z9CA 4G6TB 2H94A 4EJOA 2Q0OA 4K2EA 3ABLH 5DYMA 4EM1A 2XGCA 1LEBA 3FXQA 1N75A 3BPXA 1LFUP 4FQGA 4AIHA 2A69F 2H8RA 3A4CA 1BW6A 4PSXA 1ZGJA 1D5YA 1Z0XA 2X0LA 3WHBA 1IRFA 3FXRA 2O5RA 4IKFA 1P9QC 1BN5A 2BEOA 2HVQA 1XMXA 4GXOA 1KGSA 4PFOA 3F6OA 4IHXA 1JKRC 1BI1A 3PM1A 2QBYB 1XX5A 4GYGA 3DEEA 3HG9A 4Y4RA 1MMDA 4L0YB 1S7EA 1IDYA 3P5JA 1JJ6C 3K69A 3RQIA 1KQ9A 4XRSG 3CC4I 2LG4A 2VKHA 4G9YA 4UHTA 1D1CA 4AYBN 3T8TA 5ICEA 3OYGA 3RQ4A 4M9XA 5HNHA 1DP3A 4YIFA 3F8FA 3F9KA 2ZXIA 1Y1VJ 3I3LA 2EFQA 1XSVA 1U5TA 3CUQA 4C2MJ 2P8TA 3T1BA 2PJRA 3PSIA 4ASNA 3K2AA 1FNNA 2JA2A 3KZZA 2IT0A 1DDNA 3DPLC 3LSHA 3VYRB 2XB5A 1YIJI 4XR6A 1SVMA 2OZ6A 3NWTA 2CFOA 4RAGA 1V55H 2E35A 2L9SA 2HWVA 1YW7A 5B66C 4MO7A 4XLNF 2HVRA 3HOZJ 5J47A 3K4KA 2FXAA 4D7MA 3L2VA 3S14J 3FM5A 5M5WJ 1D0ZA 2M4GA 1WPKA 2EFOA 4NC6A 3FK7A 4RAZA 4CZCA 1HW1A 3S1RJ 3Q9SA 2O61A 3GF2A 3BZ6A 2VBWA 3OYIA 5HNFA 4J00A 1WH5A 1ETVA 2QEXI 3S32A 2OTLI 3CCEI 2Z33A 3FBIB 1KU3A 1QVTA 2P6TA 2VE8A 4WF2A 2WBMA 2XPWA 5E18F 2VOOA 1RKWA 4AM3A 1FEXA 1YG2A 3RI4A 4BYYA 4DYCA 3M8JA 1S72I 4RMNA 3V8KA 3GWZA 3OSFA 3IV5A 5FLMJ 4OMYA 1R36A 2KZGA 5K7HA 2FBKA 2VQHA 2P4WA 3QODA 3BWGA 4O3MA 4C30A 3A01A 3OIOA 1FOWA 1QZEA 3SFZA 2IXSA 1STZA 3CP8A 1HOMA 2DO7A 1FLIA 1JHHA 1ZR2A 3OYFA 1B9MA 4ZDOA 4A3IJ 2VB6A 5J8CA 4ENNA 3DKYA 2CUFA 2EQRA 1ZRFA 4RB0A 2CGPA 1LDJA 3ZN0A 3VB2A 3CMEI 2FNPA 2Y2ZA 2LP0A 3Q0VA 2WV0A 5A2QZ 3LQRA 1W36D 1ZLKA 2O6GE 4M71A 3HEFA 1HF0A 3ZQQA 3PNTA 4OAZA 1F4KA 4OIQF 1OR7A 2WAEA 1MKMA 3GFMA 1MSFC 3HUGA 3SEQA 3GX4X 4ZDPA 3V42A 1SMYF 1EV7A 2MABA 1UG2A 1PDNC 3SYTA 2XB0X 2R7TA 4XIDA 1USSA 1D0YA 1R71A 5B1AH 1IO2A 1HW5A 4UVBA 1UFMA 1D8JA 3RDIA 3MKYB 1Z77A 1NTCA 4KITB 1G3TA 4E4HA 3CO7C 4M3EA 2QQ8A 2K02A 1MBGA 3WODF 3S17J 1LUJB 4OIOF 4QIWN 1FMWA 4IZZA 4KN4X 1NK2P 2MG4A 2VBXA 1IN6A 1G3WA 1WQ2A 3K1NA 1DPUA 4XLEA 5KVRA 3S1MJ 1GXPA 2E5ZA 2MH9A 2V9VA 2NVUB 1V5FA 2OD5A 2DFFA 4AC0A 4HQEA 4OOIA 2FSWA 3JSOA 1ETQA 3MZ8A 3CUOA 3HHGA 2HOSA 3F72A 1U3EM 3MMYB 2LTPA 3I4PA 4HF0A 4M6VA 3FXLA 1O7LA 4MIMA 2R5YA 4UB6C 3ASNH 3KE2A 4HX8A 4A6EA 3OV8A 5K1YA 3JRFA 3BR1A 4HF1A 1SANA 2ELKA 2QSGX 4HZFA 4LK0F 2M34A 4DQ2A 5JFRA 2KRFA 1OYIA 5FFXA 3EQLF 2PFBA 3FX3A 5E1ZB 1HDPA 3JREA 1HLVA 2AXTC 2W1OA 2HR3A 3G4SI 2E34A 1USTA 2LREA 3H3ZA 1AA7A 3HPGA 3PJRA 1FWZA 2E36A 1JTXA 1X1BA 3GTOJ 2Y0MA 1GLNA 2QSFX 5LFAA 2LC2A 2DTZA 2ZJRF 4E7IA 1ONVA 2DN0A 4ZTJA 2EB7A 2FNAA 2FRHA 3K70D 1WFXA 2M2EA 3FKJA 3E6DA 3KYLA 2RKHA 1V4RA 2DDAA 3CCMI 5TGTA 4L9NA 3GZ5A 4W97A 3ERED 2R5ZB 3DU5A 4B09A 2LYCA 4G94A 4QPQA 2MSYA 1FMVA 2BY0A 2NVYJ 3R0JA 5DTDA 1KQ0A 1RUNA 1JJ8C 4RAYA 3K4CA 1MNMC 1UG0A 2IPQX 2EFPA 1YW9A 2O03A 1V3FA 2VBYA 2DOFA 2STWA 2VUMJ 5ILSA 2DQRA 1TW2A 2UZKA 1K61A 3K0LA 3HDDA 5D6EA 5TISC 1QGPA 2WC2A 1U9OA 2ZMEC 4KN7X 1QO0D 1G6NA 2ID6A 3I55I 1YX3A 1SFXA 5ICFA 5LGNA 2M0CA 3HKZA 3ZR8X 1T95A 2DCEA 2FEZA 1ZGWA 1R5HA 2EA4A 3GMEA 2HKOA 3JRCA 2OJED 4OMZA 1QVUA 3J81Z 2C6YA 1MNEA 5E1WA 4C3IJ 5EG0A 1Q1VA 2B0LA 2GIZA 5CYVA 3AFHA 4IOCF 3U1KA 3OOPA 1TLHB 4Y3OA 5IT9K 3S15J 3K4JA 3M7GA 2L7FP 2NVTJ 3I54A 3L2RA 2JSPA 1LJ9A 3S16J 2XF7A 2ISYA 1A31A 4R1HA 2QKMB 3DEWA 2F4OB 3G2BA 2HDWA 1WJCA 2B63J 4MTEA 2Y31A 2P5KA 3BCAA 4XKVA 3RJPA 4KDPA 4KIGA 5KCMA 1T0FA 3WE3A 2WY7Q 4QPOA 4B3AA 1QA6A 4UUTA 3JCUC 3C7JA 4I2OA 1POGA 1YE9A 1A04A 4RM2A 4A5MA 2K86A 2YUSA 2OZUA 2HEOA 1W4MA 3LSTA 1OKRA 2F4IA 3ZQIA 3MWMA 3A1YA 3Q0WA 5BS6A 1JKQC 2KJBA 4AVPA 3M9AA 3F23A 2AO9A 4M9ZA 3GTLJ 3O3KA 2XF5A 5IPAA 4PFPA 3OYKA 1R7JA 3GLLA 4LIVA 5FKNA 1JI8A 3BR3A 2PMZA 4IL6C 2JWTA 2FU4A 3BOQA 2BHZA 2DJIA 3O2PE 2V1XA 4CGZA 2OA4A 5DS9A 3ELKA 2EV0A 2ZB9A 5DM6F 2P6SA 1DU6A 1I3QJ 2W82A 2VJ5A 3S2HJ 4FE4A 1WSUA 1E2XA 3ZMVA 4NC7A 2VODA 3BPVA 2LY9A 3AG3H 2LR8A 1PUFB 3BTLA 2QGUA 1FSHA 2EJRA 3W3CA 1NHAA 1ETKA 1JXSA 3T5XA 1R1VA 2DFHA 2BXZA 2KHMA 3P9KA 2JJ7A 3OYAA 1TWGJ 3JR9A 3LAPA 3G71I 1BA5A 1YI2I 2CV1A 2FJ1A 2CWEA 2Q2EB 4UUSB 4A3LJ 2QBYA 5IP7J 2XAUA 4XKBA 2V1NA 1MGTA 2GBYA 4DZPA 4KUMA 3BZCA 3OMYA 4U7BA 2LDUA 3MN2A 3RYPA 3RZOJ 2HGCA 4EGYA 1H89C 1KYWA 3F6VA 3H35A 3I59B 3L2WA 2YS9A 2EFWA 1I3AA 1O3RA 2IA0A 2NS7A 2MFZA 5CVVA 4A0XA 3PNVA 3BG5A 2HXIA 4KFCA 2EK5A 1VFCA 1W5TA 1ZQ3P 2W7NA 1B59A 1OMIA 3RTRA 2W48A 4NC8A 3H92A 3W2VA 3BR6A 3E7LA 4UXNA 1U8RA 2ZFWA 4MHGA 4YFKF 4G7ZF 2COMA 2DT5A 3OOUA 2OAZA 3LA3A 2N8GA 2HKXA 2ZSHB 3S3MA 3HOXJ 3F8BA 1P4WA 3OYNA 1A6IA 2O7OA 4BEHB 5F0FA 1ZRDA 2P0WA 3GVAA 2V6EA 1QNTA 2A05A 4FTHA 3LSJA 2R7WA 2QM3A 4A3MJ 3DLAA 2YX7A 5HLIA 3JRAA 1XMKA 2R93J 4ZZDA 5IP6A 5HS9A 3J7AO 1APLC 2UWMA 5J6XA 1ZTRA 3PL8A 1J75A 2IGMA 4NHJA 4HG2A 4CCKA 2BY2A 4OIPF 3ABTA 4FE7A 3RSNA 2YSRA 2F5VA 3B73A 3F8NA 3G3ZA 4XQFA 5HOOA 4XLAA 4HOBA 1R00A 1WWXA 3MKLA 4XICA 2X6OA 2XASA 2NRAC 1X4OA 3LSMA 2WB1A 2DA1A 4EJUA 3H5NA 4KICA 4X6AJ 1LDDA 4JX6A 1OCOH 3QP5A 1BIBA 3H36A 2HZTA 1YQAA 1ZELA 5FKOA 1VQ4I 1LE8B 3CCLI 1I6XA 4RB3C 1OCTC 2A6TA 1H9TA 2L7KA 1U8BA 3ZMDA 1ZH5A 1QHHD 2IS4A 2FF4A 2X6WA 3PUBA 3A0HC 5FKMA 1B72B 3DTIA 3SFIA 1JKPC 5D8LB 2JUGA 3KEYA 5LEKA 4QLCU 2W84A 4Q47A 3O8GA 1SC7A 2CV2A 4BHPA 5EJCA 2R7OA 5TJJA 2AHQA 1BR1A 1ZKGA 3DP7A 3FK6A 3HJEA 2NYXA 2VKVA 3ZQHA 3CJNA 1TT0A 1VF9A 3SZPA 5AIQA 1CQTA 1AU7A 2WAQA 1GUUA 4B1RA 1FOYA 1FBQA 3N97A 2LF7A 3U1DA 4Y7NJ 2G0EA 1VQLI 4S0HB 1TTYA 2MGQA 1YJNI 2XAGA 3I58A 3MKWB 2DAOA 2BYVE 1HSJA 4JQFA 2LMDA 2D2WA 3D5LA 1UHMA 2VT3A 3I4MJ 2IGKA 5EEAA 4OU0A 2KL4A 4HRIA 2MD0A 3M1CA 1X3ZB 2W57A 4A3CJ 4AYBA 4PCQA 1MJAA 4M3GA 3QPLA 4A3FJ 4MEXF 3E5UA 5GADJ 5C4JJ 3K9TA 1WGXA 4A0YA 1X1AA 3HXLA 3WGGA 4C3HJ 3OIPA 2DFIA 1H9GA 2I10A 3BG6A 1DPRA 2H27A 4YEJA 3IKTA 4LJZF 1BI3A 1R6RA 1WHUA 1ZAOA 2WTEA 3M4OJ 2PMHA 1T33A 3HBLA 3WTVC 3DKWA 3CQZJ 1JUPA 3QYEA 4C2TA 2A6HF 3JAMZ 1D0XA 3QAHA 2ZCWA 4JBAA 1FYLA 1PP8F 3EETA 2X85A 4AD9A 4HAMA 4JK1X 4BS9A 5EZHA 1YHQI 3OYJA 1MW7A 4NB5A 2KRCA 4ESBA 2GAUA 1EKEA 2RREA 3WGIA 4XBFA 2RNJA 3BP8A 5E8GA 1S5LC 3JRHA 1OYYA 3G6EI 3HRMA 5CVUA 2JRTA 3E6CC 2BVMA 1S29A 2GA1A 2L7MP 1FJLA 5FJ8J 3OL3A 4CCMA 1R49A 5L3EA 1MBKA 2ME0A 5GAHJ 2VIXA 3COAC 3VODA 3WG7H 4EGZA 2R5ZA 2M7BA 3QPHA 1KA8A 5LHHA 2DLLA 1X2MA 3WTYC 2TDXA 4CCNA 5JR3A 1FT9A 1JGSA 3U2RA 4I0AA 2H1KA 3FXOA 4ZDLA 5DEQA 2L5QA 1BI0A 1W1WE 3SQNA 2K9SA 3EYIA 2MLKA 2K85A 1GXQA 2E5NA 2HQRA 1S3JA 4OINF 3V4GA 2NAZA 3VYTB 1I39A 1IC8A 4Y13A 3PO2J 4EM2A 1P7JA 4BAYA 1O7FA 4U0YA 4IRHA 4V2FA 4I99C 4BL0B 5IYBJ 2PN6A 3CD6I 1K78B 3LFKA 3HL2A 1TT5B 5D5UB 3H3VK 3ZQCA 2P5VA 2DK5A 1YO5C 3KP6A 3QPSA 1B1BA 2XRNA 1GT0C 4KT6A 4BXUA 4F93B 1FP2A 4CHUA 3LL7A 2VKEA 3TO7A 3MZHA 4KYWA 2OF7A 3J7ZI 3CLQA 1KONA 2V26A 4YELA 1AHDP 2LLKA 4J19A 1QU3A 1LVAA 5D5XB 5K5OA 4M3DA 4FCYA 3CCQI 4OAYA 3CTAA 2QKLB 1TZLA 5IYDJ 1Q1HA 1X4PA 1MBJA 3BZKA 1IRXA 1YRNB 2YR2A 4OIRF 5JHUA 1HKTA 2BXYA 3R4KA 2CV0A 5LEJA 4HLYA 2E1OA 2IJLA 1E3PA 1DQUA 1R58A 1WJEA 1OYWA 2ZC2A 1FBUA 1PP7U 1ZYRF 1XS9A 2ZXWH 1FPQA 1J5YA 2OU2A 4Y52J 1S7AA 1PVEA 2CSOA 4XNFA 3NEUA 3BJ6A 2IS6A 4FASD 4FX0A 1HC8A 1YTYA 1V5GA 5FROA 4MNUA 1VQMI 4YFNF 2V1UA 1XGOA 2FMYA 2K27A 4EM0B 2IS2A 1R9TJ 3GTQJ 4M74A 3CCRI 5HLTA 4G6DA 1SD4A 4KIBA 1Z3XA 4PJNA 3C2BA 5FKKA 3WTTC 2QENA 2COBA 2K9LA 3KP2A 2VJJA 5IOZA 4HBLA 3JRBA 1PUFA 1P92A 3BROA 3O6BB 1PUEE 1SMTA 3BLYA 2CW0F 1RIOH 4CZZA 2KKOA 3IAS2 1YW8A 2OTJI 2IA2A 4XN0A 1R4MB 5EEGA 4BU2A 2XSDC 4DZJA 4IX7A 4LK1F 2GM4A 2Q2EA 4UUSA 1BOAA 1SAUA 1FOXA 2VT2A 3S2WA 5FLXK 5LBQA 2W25A 2WV1A 4RAFA 2NNYA 5LGTA 4P5OA 1K7AA 2EFNA 3JTGA 2ZJPF 3RKXA 1XCBA 3Q5FA 4F52A 1UHWA 2D1HA 1UCRA 1A35A 4BXXJ 1IDZA 1DUXC 1R5GA 5CQEA 5GTHC 4I01A 4HX7A 3GFLA 3I59A 3WTWC 3QYBA 1ZG5A 3MEXA 3IRQA 5CPRB 2RGVA 4CCLA 3GTGJ 2CQ7A 3IP4B 3LOCA 1IN8A 4L9JA 3MCZA 2QYOA 1ON1A 3HOTA 1N77A 2K9NA 2L7ZA 1QPIA 2MC3A 3LSKA 4U0WA 1T8IA 3OWTA 2WA0A 2M5WA 1G3SA 3I9V2 4I09A 2EINH 3S1QJ 5H2FC 1M1EB 4ETSA 4U7DA 1ZLJA 2DI3A 3I4NJ 5E20A 3OYMA 4A0ZA 2XF6A 1OPCA 4BEHA 5IOYA 4A3KJ 5CVJA 2EZIA 1ITYA 3DBRB 1W0UA 4CYDA 5LLQA 2VN2A 4HPQA 6PAXA 3NRVA 4PJJA 3S3NA 3DWLE 2M7AA 1KYZA 4W1UA 4BNCA 2K40A 2KFDA 3HOVJ 1TL8A 4PUSA 4LG0B 3L2UA 1HKSA 3DBHB 3M1EA 3MQ0A 3TL4X 1VQNI 2E60A 3F8CA 2EZKA 3OYEA 1S7OA 4XLFA 3HHHA 2JA8J 3GZNB 2JQ7A 4KIFA 2L4MA 4PGHA 5KHDA 1O57A 2ZXHA 3CCSI 3QP6A 5LRSA 1D5VA 1SFUA 1Y56A 4XLCA 5J1YA 3GFIA 4MQ9F 1BBYA 2HDCA 3GTPJ 3G73A 3B02A 3GCMA 4LLGF 1B4AA 4CSWA 1XD7A 3AKZA 1ZG3A 2XHKA 3H9QA 2ELHA 4Y17A 1HBXG 2MYSA 3TKYA 3FMQA 3ZQ7A 1ZK8A 4O6JA 1IV6A 4RBOA 1E3OC 3A0BC 1LE8A 1RKTA 3I53A 1PYVA 4I02A 5FRNA 3V7SA 4IPAA 5D5WB 2KLOA 2IS1A 1ZARA 2A61A 1B72A 2VL8A 1NG7A 3PFIA 3R60A 4RS8A 9ANTA 2QVOA 1U9NA 1XC5A 2AS5F 1JUSA 1J7KA 2W4SA 1UAAA 4BUPA 2X1DA 2VI6A 1VQ5I 2CO5A 5F1JA 5C3EJ 4BQAA 4NNJA 3WHCA 3CDHA 4RLFA 4AWXB 4LLNA 3GTKJ 2X48A 1OISA 1MBHA 1Y0NA 2ZMEB 4HEA2 3SZGA 1Z1DA 2M8EA 3TMOA 3JTHA 4E7KA 2Y75A 1YJ9I 2EH3A 1VI0A 3K6GA 2IA1A 2BY3A 4HNTA 3VYSB 2KPMA 2F5EA 4BHCA 3G1LA 5A2QK 3DFGA 2X6XA 4XM3A 5J4VA 2K3PA 1T08B 4ZTFA 2DXIA 5CVIA 3I71A 1WZ2A 3L2CA 3LSRA 3DU6A 2IGNA 2QQBA 1QRYA 5ERIA 1C0WA 3O8HA 1IN4A 2XKPA 3UNGC 1E3HA 2ADUA 4G7OF 3UR3C 2A6EF 2O8KA 5J1UA 1I1GA 1PJRA 4A12A 2RQQA 1YFHA 1R5ID 3FXUA 1J09A 3FXMA 1H8AC 1F5TA 3CMYA 2EBIA 2I8DA 2X1EA 1K6OA 2NOJB 1QQIA 2VBZA 2LOOA 1LKXA 5ED4A 4M73A 2R7ZJ 3LFUA 5KAFC 4I0BA 1FYMA 1RZ4A 3OYLA 1P4XA 2CH0A 3KPHA 2XSJC 2JK3A 3C3WA 2BHYA 1VQ8I 1MDMB 1BC8C 2IGOA 3LA7A 4WXCA 3OIQA 2XPUA 2QSHX 1IRZA 1UELB 2ID3A 4D7NA 3HSFA 3P9IA 2JSCA 3EPZA 3SHFA 1R4NB 2EV6A 2V4JC 3PIPF 5D4RA 4BGDA 5HLHA 2KDOA 1FZPB 4D1QA 2Y0SN 3ZCOA 4ZZLA 2JA5J 3RKWA 3V8JA 3CC7I 1IGNA 1Z05A 3FHZA 1RI7A 4DBQA 1HCRA 2VOPA 3MD2A 1XSXA 4Y15A 3VDXA 4DBRA 3L7WA 4N4NB 3J80Z 2IBDA 4II2A 4MGRA 2GXGA 3KLNA 3RCOA 2KZVA 1Z21A 2NS0A 4L9VA 2A68F 4B3XA 2MH2A 2RN7A 3HRTA 1L3LA 2BY1A 2FUG2 2GWRA 5E3NA 1D3YA 1YLFA 4BBRJ 2L4AA 2XIGA 3E0JB 5FO5A 1R1UA 2JT1A 2ESHA 2HPIA 1JTYA 1IN5A 1X3WB 1VQ6I 2JA7J 1F1ZA 4WXHA 3FMRA 2WY8Q 5JVTA 2D1VA 2XC7A 2LFBA 1T38A 4GCVA 1D8KA 1KZHA 4R8HA 3QYFA 4D5CA 4HV5A 3ROUA 3GYHX 2DT6A 2QWWA 3KZYA 3VFZA 1YX5A 3HRUA 4B43A 3E5XA 3TQNA 2XAHA 1BOBA 2WWYA 2JUCA 2IRFG 2CRGA 1K78A 4N9HA 1I1SA 3LNQA 1U5TC 4CYCB 3EDPA 4N0BA 2OQRA 5KK1A 5IY5H 2Q1ZB 2CYYA 1FY7A 3HSRA 3OR2C 3RPQA 2XVCA 4B47A 3RYRA 5L3CA 3BC8A 4QTRA 3PQJA 3OYCA 3L2QA 2IAIA 1N78A 2NS8A 2L9NA 2EIMH 2HXOA 4JX5A 3S2DJ 1SVLA 5F04A 4C9YA 2L2OA 2RVCA 4BACA 4BQQA 2PBIA 1Y39A 1Y1WJ 3AL0C 2XDVA 5CLSA 1R23A 4I7HA 3S1NJ 1Y8QB 3GFJA 4ENKA 1LVKA 1WJ5A 2RNGA 2OQGA 1VZ0A 4B44A 2YX4A 1YRNA 3IH2A 3FBNB 4NDLA 2O8XA 1BM9A 4D5FA 3I0TA 4XOPA 2VQCA 2V9PA 2VLAA 2R7XA 3ZOBA 2R7VA 1SAXA 1AOYA 4AUXA 5HS8A 1QBJA 2M30A 1TC3C 2PQ8A 2XV4S 1YIOA 3SZTA 2MD5A 4ON0A 2DW4A 3I64A 3FMSA 3ECHA 3LMMA 3JRDA 2FE3A 4RGRA 2Y30A 1ZHFA 4I6ZA 5EGOB 1JT6A 3IWZA 1X58A 5DD8A 4DJAA 4LITA 3HKZN 1BW5A 2CG4A 1EF4A 1RC9A 2XAFA 5M5XJ 2I5UA 3CP2A 3SXYA 4KJZA 5BNGA 1XB4A 2DTRA 1EH6A 2G7HA 4E7HA 1SD5A 3JW4A 2DA3A 4EJTA 4U0VA 4E7SA 2X4HA 1WRJA 1G4DA 4L0ZB 4HA8A 2LD5A 2HVSA 4P9UA 3ULQB 4IXAA 4UV9A 3VSKA 2F5DA 3VYUB 1JT0A 3H1CA 1F9NA 2FX0A 1T6SA 1XDUA 5HVQC 2K9MA 1MH4A 1MMAA 2FBHA 5LHIA 1WKMA 1JHFA 4GO1A 2ACJA 3H3UA 4U88A 4P96A 2GQQA 2FQ4A 3DPTA 5L3BA 4UNOA 1ODDA 2Z9OA 1P4AA 2CQXA 1XPXA 3DEUA 2P7VB 2JPCA 2CJJA 2HQNA 4IQ4A 4PZJA 5CKTA 4CICA 3FF5A 1IJWC 3EYYA 1G8XA 3HZJA 1MIJA 3HB9A 2P7CB 4EJVA 4BBSJ 3NQOA 3TW6A 4E7ZA 4Q48A 2Z16A 3IWFA 3OSGA 2DPUA 2DODA 3HGYA 2VQLA 3KZIC 2DA7A 3KFWX 1IZ1A 3W6KB 5BPDA 5E3MA 4MQVA 1FIPA 3GBGA 4QSHA 2DT7B 2ZNZA 4UB8C 4A6DA 5CVRA 4A5NA 2FOWA 1FP1D 1WJAA 2LKSA 3W6JB 3OS0A 1JGGA 4A2UA 2DOAA 1FSEA 3M3YJ 3E97A 1IV8A 4O5VA 4EV0A 1MBFA 2XKOA 4RM3A 1UB9A 2OBPA 3IUOA 2NVQJ 4CDGA 2Q8KA 1JUMA 3WGHA 1V54H 2B9SA 4LFUA 3K4MA 2OC6A 3OY9A 4LG0A 2VASA 1KU9A 1ZR4A 2JMWA 4F91B 2ECBA 3GTJJ 2IEKA 4XLHA 1HKQA 5JVGF 1OLTA 2EIJH 1REPC 2B7EA 2CMPA 1U2WA 4PSWA 3VWBA 2M0MA 2NNNA 5FRMA 2VXDA 2F2EA 3T0YA 1B8IB 2O3FA 3DCFA 3IHUA 1VNDA 3QWLA 4DNCA 3PO3J 3W2AA 4LG3A 3FWEA 2HNHA 3R6SA 4E7LA 2PMUA 2PI0A 1XDSA 3B6AA 2HTJA 1X3UA 3CJRB 2KJCA 2KP6A 1HQCA 3GXOA 1ENHA 2CS3A 1D1AA 1EA3A 3LQQA 3LSPA 1W5CC 2UUZA 3D5SC 1NH3A 1UHSA 4XKCA 1YITI 2BW3B 2R4GA 3FM3A 3DKXA 4F3QA 2HPMA 2ME6A 3J7AY 3JSPA 3UKGA 3FXJA 3ECOA 3BCBA 2E1NA 2L3DA 4A3DJ 1K83J 2MC4A 1UMQA 4XLPF 4LD5A 1LEAA 4ZYDA 4E7JA 2ESNA 5GAEJ 3L1PA 1RR8C 4WWCA 2XGXA 2M9HA 5F27A 4OWRB 5K5QA 1O3QA 2VONA 2VXZA 4D0PA 5HDKA 2LKXA 1Y0UA 1LNWA 2ZMEA 2R0QC 1IG7A 2QCOA 2P81A 2VPLA 2F5FA 3H9JA 2ZXJA 2E2IJ 4GGGA 5FGMA 4YG2F 4JP0A 2LY2A 4IHVA 1W7PB 2LRDA 2V79A 5J3LA 4FX4A 1XTAA 3GO5A 3AG4H 2H1LA 3ZMZA 1TW3A 5ILVA 5F6FA 4BE1A 4EEFG 3WTSC 1OJLA 2LBFB 3GEZA 2DYRH 2V6CA 4D9JA 1U0JA 4NQWB 2Z2SB 3MAJA 3U9GA 3CLOA 3CMMA 2NXNB 1G59A 3IH3A 2ZNYA 1XGNA 2VC0A 3TP0A 1ON2A 5F0CA 5J40A 5H20A 3CMAI 4JYKA 4JOMA 2LH9A 3A03A 4PK4A 2YU9J 4HW0A 1DP7P 3KYCB 4RLQA 5FD6A 3E3VA 4KMFA 2OUMA 1YS6A 4RB2C 2HYJA 5F0HA 3BJAA 1ORKA 2HU9A 1CGPA 2QLZA 2MW8A 2HOTA 1HW2A 3AG1H 3H9GA 5EF6A 1W5SA 4ZYAA 1DU0A 3OS2A 1K4SA 4UVAA 4H4KC 2ZSIB 5F1RA 1WCMJ 3F21A 4BH9A 4ZYEA 4A3JJ 4YRVA 1XGSA 2DFEA 4LB6B 3BTIA 3QPTA 1XSDA 2EPFA 2XRLA 4MLOA 1MNDA 1T0FC 2DBBA 3FIWA 5B5EC 3K7AJ 3KLOA 3GTMJ 2KIQA 1MDMA 1Z6RA 5IYCJ 3TBIA 1FTTA 2ELJA 1XGMA 2WAQN 3H0GJ 3HTSB 5D8KB 1VQ9I 1FTZA 2WADA 1QHGA 2ZBKA 3E6BA 3OS1A 3GZ6A 5DV5A 4KA4A 5LD2C 3ZMUA 3RKQA 3BTJA 2HOAA 1Z7UA 3RPUA 5ILUA 2JTVA 2LVSA 2VJIA 3F0CA 3KX2A 1IN7A 2CUEA 2R7UA 2CW7A 1OCZH 1R1TA 1VQOI 3QOEA 4LIUA 2G7UA 5F08A 1W7PD 1B6AA 4ZH4F 3ESWB 3WTUC 4Z6YA 5BPIA 2BE5F 2E2JJ 2IP2A 2LK2A 3JAMK 3S3OA 5BMZA 4ENMA 1LFPA 1MH3A 3IRRA 1IW7F 5JLXA 2K5CA 3DTEA 3G1MA 1U78A 2PG4A 5FD5A 1IRGA 2M4KA 3Q0UA 2EV5A 2FQ3A 2GIVA 1XMAA 3FDYA 2L0KA 2ZFUA 2YU3A 5BQTA 5FLVA 4L5IA 1UZCA 4XOTA 4BY7J 3E6MA 5JHFA 3H0DA 5DCMB 3JRIA 2GZWA 2BZTA 3ZQFA 3KETA 2XUBA 3M8FA 4X1EA 2OPTA 2Z5UA 4HV6A 1W36C 3QU3A 4FT8A 4GRIA 2ZJ2A 4CYCA 1Z6TA 2PEXA 2ISZA 1TQPA 4XRSA 4V19K 3F3XA 1WI9A 3ZP5A 1P2FA 4A3BJ 3ABMH 5E3OA 2ZKZA 4DOZA 4F55A 1CF7B 3ZGKA 3VEPA 1TP4A 1WI3A 3TGNA 1T2KA 1T56A 3PUFA 5C44J 4B48A 2EZHA 1BR4A 3TDUC 3NAUA 5L3GA 3B6CA 3OYHA 1ACIA 1B9NA 3BQZA 3BJOA 1J2XA 3H5RA 2KT0A 3PSFA 5IP9J 3AAFA 3IAM2 3FXKA 2AQFA 3PQKA 4AIDA 1BC7C 2ECCA 3TOAA 3H5AA 2VQGA 5FKLA 2QQ9A 3EUKL 5E3LA 2XAQA 2F6CA 4BE2A 4YFXF 5IT3A 2DDBA 3E1SA 2K4BA 4EVIA 5LHGA 3WTZA 3DLLF 1QPMA 1IXCA 4XMYA 3KP7A 5DUKA 3OL4A 1MD0A 2HI3A 3WTXC 4TV7A 3TEDA 5E79C 2RQPA 2STTA 4G7HF 1TWAJ 2HYFA 2FMLA 2GOMA 3TDZC 2VE9A 3BR5A 5HODA 1DGRM 2DMTA 5EGOA 3ZMSA 3V7CA 3C18A 3AG2H 2G9WA 3I56I 4BDYA 1S6LA 4XKWA 4KNYA 1QZYA 3C2GA 5LGUA 2K7LA 5DCFA 3NARA 3ERMA 2A3SA 4IVNA 4B8XA 1BR2A 4R79A 5J1RA 5C4XJ 1S9HA 3N4MA 4YIIA 3HOWJ 3BQYA 4BJ6C 2Y9YA 1FX7A 2VPRA 2Y0SA 2GLOA 4BJTA 1U6GA 2CQQA 3A2KA 5D5VB 1AKHB 1YJWI 5L3DA 3D5RC 2ETHA 3HTUA 2MA3A 1LQ1A 4ZC3A 5IT9Z 3SJMA 4ENJA 2Z3YA 3ZMTA 4IF4A 5EYRA 3V7RA 4A69C 1GDTA 1SD7A 2OV7A 3BTCA 3KIOA 3D0SA 3CF2A 5EEHA 2HOEA 1K79A 4UY8I 1Y8RB 1YYVA 3P7NA 5DUIA 3GW2A 5D6FA 4WXDA 3WU0A 1V5EA 3DXJF 3K70C 1A36A 5GPCA 3BR2A 3R61A 2NVXJ 4Y33A 3BR0A 2M8GX 1H0MA 4F92B 3EUHC 2UV1A 5KAIC 1NK3P 2LKPA 2KISA 3L9FA 4LGWA 2OCEA 3DF8A 2DYSH 3IC7A 3MKZA 2M1BA 1RR7A 5M5YJ 5DDGA 1RRJA 3CDLA 2ICWG 4PJ0C 4XRMA 1ETXA 1OFCX 1J0RA 4L18B 5K7FA 2Y69H 4KISA 4C3JJ 2W00A 1VTNC 2CU7A 5ICGA 1H88C 2HYGD 5DM7F 3VOEA 2Z99A 1S8NA 2EIKH 3HRSA 1OCCH 3Q3SA 3A02A 2CUZA 1KQ8A 1F36A 3CO6C 1SFEA 2HFHA 2V7FA 1LFBA 3ISPA 2HS5A 2QF7A 3ZPLA 1K4TA 2DMQA 4HSRA 5F64A 2M3AA 3QOPA 1GVDA 5TRDA 3RIRA 4MEYF 2RV8A 2RAEA 2DJNA 2E1MB 3BDDA 4PGGA 2EZLA 5GTIC 4RGSA 4XN3A 4XORA 1N25A 1B8IA 3ML6A 1G3YA 3C2HA 5K5RA 2H6CA 2YPRA 5H6RA 5CJ9A 2CW8A 4RGUA 1Z91A 2AXLA 3CDIA 4HF2A 2R7RA 1RNLA 4MTDA 3CCYA 2FBIA 4IHYA 4IJAA 4BDZA 4NUBA 2M45A 4S04A 1T98A 2V9KA 2XROA 2MBFA 1HXDA 2R92J 4XK4A 1O4XA 1EH8A 1K6YA 2BW3A 2IVMA 1IUYA 5E1XA 4II3A 1FIAA 2X51A 4ZJZA 1ZG1A 2KRHA 2UXXA 4IRIA 2PX9A 2L54A 1I5ZA 2E1MC 4UVCA 4GDFA 5B1BH 4GYIA 4MFEA 4BQOA 2E7WA 2A07F 3CJQB 4CA0A 2JZYA 3KEQA 1NG6A 3L00A 2DA5A 4BE0A 4IHTA 3MZYA 1HSTA 2O9LA 5HLGA 3Q9VA 4CCOA 1RESA 1Z7LA 3ZQGA 4FISA 4EMSA 4CXFA 2RC4A 4U87A 4WCGA 5J4YA 3FISA 4Q4ZF 1XG1A 1MZBA 3P9CA 3ABUA 2F4MB 4CO8A 2CUJA 2JA6J 3CCJI 1SEUA 1SD6A 1MMGA 1W7PA 1TQIA 2DK8A 2Z1DA 2JVHA 1BJAA 1IUFA 1WJBA 1U5TB 4P55A 2L02A 4ESJA 3CUQB 4ESFA 2LBFA 4HLXA 4N9IA 2XPVA 5DD4A 4NQWA 2PJRB 3GLXA 4V2GA 1IF1A 3EUAA 2LSOA 4IOAF 3I5UA 1RPWA 4S05A 4RDUA 1TWHJ 5GAGJ 4AIJA 4M72A 2L9RA 1LPQA 1TNTA 2Y48A 3G1OA 4FETA 3AL0B 4A3GJ 5AIPA 3PIOF 2W85A 3K4LA 3KCCA 2LNBA 2H09A 3RZDJ 1W0TA 1TBXA 1VQKI 3LAJA 1JE8A 3FKIJ 1Y6IA 3LWFA 1BI2A 3FHNA 3KP5A 4B4CA 1AWCA 3ONQA 4DGWB 4UUVA 3CUQC 3QQAA 2JPBA 3K4BA 1X1DA 3C1DA 5CQGA 2X6YA 2XGEA 1FBSA 3CF5F 4EATA 2NOGA 3D1NI 4HSTA 3HSEA 1GHCA 1ZN2A 2KIMA 3DV8A 2DMNA 3HC7A 1OCRH 2KIUA 4BXFA 2H8WA 2K4JA 2A5YB 4UV8A 3R0AA 3W2WA 2GA2A 4ABZA 4I76A 4L9TA 2EA2A 1LDKB 4H0EA 2QZ8A 1A5JA 4BHBA 3IKVA 2EWNA 3ZXSA 1KU2A 4XL9A 4XSZF 3F8MA 3A01B 5D4SA 2DU9A 2D45A 1TQMA 2BVLA 3M07A 1JKOC 5JI6A 2L9VA 4KT5C 2LY1A 3K10A 1XCVA 3X2QH 3RPUD 3QRFF 4PJMA 4N4OB 2R7QA 2PLYA 1DGWY 3HPHA 1X1CA 4BKXA 1SVOA 1UJ8A 3J81K 4M6YA 4ANJA 1F43A 5HDGA 3OYDA 2QA4I 1HA8A 1X19A 1I50J 5E17F 4P9FA 2JN6A 2H6BA 1TNSA 3BG9A 3HM5A 1O3SA 3ZRGA 2VKDA 5B3SH 1QZZA 2HQAA 2J5OA 3HUGB 4L5JA 4RA2A 1EH7A 2GXAA 3KP3A 1TWCJ 1MMSA 3SDBA 4AU7A 3K1MA 2GXBA 5DCMA 4BQNA 3HOYJ 3M8EA 4KMUX 2VC1A 3OR1C 1ETOA 2JRMA 3F22A 2J5PA 3J80K 1KU7A 2D5VA 1VQ7I 2K3FA 3SEZA 3VPRA 2KQRA 5FFZA 3LSGA 2KDZA 2ZO4A 4WK8F 3W6VA 1VQPI 1BJZA 1CF7A 4BY1J 2E71A 1I27A 3LSIA 1OR7C 4XRFA 3CCVI 4HX4A 3T8RA 2JVGA 2VJ4A 2E1CA 1Z67A 2M87A 2R3SA 3V8LA 2BOLA 3PNYA 2QQAA 1MBEA 5ICCA 2E19A 4IO9F 4G12A 5M3FJ 1P7IA 3HGGA 4HQMA 3VSLA 3IH4A 4LMYA 4JX4A 1GV5A 2TRTA 4X0GA 1MMNA 3PFYA 2X9DA 2MLGA 2L01A 4RB1A 1E0EA 2QUFA 5HS7A 4XONA 3TO6A 2DA6A 4PJLA 2KIFA 3CCUI 1RUOA 2O0YA 1R22A 2DMPA 2R5YB 4IHSA 2CQKA 4AIKA 4EJWA 5GP9A 1X1PA 2PMZN 2WAFA 3ABKH 4XSXF 1G2HA 4HDVA 3TOBA 1GV2A 4HDUA 4PDKA 5JLWA 3DTKA 2OCCH 2R7FA 1ETYA 3S93A 1OCPA 1IXRC 3HIFA 4Q5SF 4BJ5C 1LB2A 4M3BA 1ERDA 3U21A 1ZRCA 4F7ZA 1HDDC 1BL0A 2X1CA 1O3TA 3FZVA 3HOUJ 2FD5A 3KP4A 2BV6A 1ULYA 2BGCA 3K2ZA 3LA2A 1IAWA 3ASOH 4HYEA 3WU1B 2IW5A 4WX9A 1WJDA 1E17A 3DPUA 1ZGAA 2CQNA 1IXSB 3CJTB 4L5EA 4ZYGA 1D1BA 1XN7A 3CC2I 2HZDA 3CZ6A 1OQYA 3SDGA 4DIQA 3IL2A 5J8FA 1YS7A 3EUHA 3RKYA 1YOVB 1FYKA 3JRGA 2EILH 3MVPA 1AKHA 3QU6A 1L0OC 3ZN1A 3KEOA 5AONA 3J7YJ 3ZQLA 2DMUA 3BG3A 1SFKA 5KNLA 5GPAA 4DYRA 2KMUA 3BG7A 1I6HJ 5EZGA 2UXNA 4G8XA 3K4NA 3TO9A 3TP3A 1FOKA 2HQ5A 4ITVA 4CUGA 1ZREA 2AQEA 2Y9ZA 4IHWA 1WH7A 5EDNA
chains in the Genus database with same CATH topology
2NS7A 4X1EA 2EH3A 2OPTA 1VI0A 3BG5A 2HXIA 1VFCA 3BT9A 4CYCA 1ZQ3P 2XGDA 2TCTA 3G1LA 5K7ZA 4MFDA 4XRSA 4A3BJ 2K9QA 2W48A 5E3OA 3BR6A 3E7LA 4M3FA 1WI3A 5EG0B 3LSRA 1T56A 3OOUA 5C44J 4DYQA 2EZHA 1QRYA 2N8GA 3NAUA 3O8HA 3B6CA 3HOXJ 3BQZA 2O8KA 5J1UA 1A6IA 2O7OA 2KT0A 5IP9J 2DA2A 2E2HJ 5F0FA 2ECCA 4A93J 5M3MJ 5FKLA 4HNVA 2HDDA 4FTHA 5E3LA 1H8AC 3LSJA 1TWFJ 3CMYA 4A3MJ 2DA4A 2EBIA 1ETWA 3JRAA 2R93J 2R7ZJ 2WB1N 5IP6A 2HI3A 4DW6A 1SFOJ 3TEDA 4A3EJ 1APLC 2JK3A 1MSEC 1ZTRA 4IEJA 4LOCA 1TWAJ 4FE7A 3BR5A 2XPUA 5HODA 1X2NA 1IRZA 2DMTA 2ID3A 4D7NA 5EGOA 3TW7A 4GFBA 3MKLA 4XICA 1RETA 2X6OA 2Y0SN 2DA1A 2JA5J 4X6AJ 4JX6A 1IGNA 1HCRA 2XGCA 5FKOA 1LE8B 3NARA 1OCTC 1LFUP 2IBDA 2H8RA 5J1RA 1U8BA 5C4XJ 1BW6A 3HOWJ 5FKMA 1B72B 3BQYA 3SFIA 1JKPC 1D5YA 1Z0XA 2Y9YA 2VPRA 3WHBA 5E3NA 2GLOA 4BBRJ 3O8GA 2CQQA 1AKHB 2AHQA 3SJMA 1ZKGA 4IHXA 1JKRC 3FK6A 1JTYA 3PM1A 5EYRA 4A69C 2VKVA 1GDTA 3ZQHA 1S7EA 1IDYA 2JA7J 3BTCA 1VF9A 1JJ6C 3RQIA 1CQTA 4XRSG 2LFBA 1AU7A 1GUUA 4B1RA 4Y7NJ 4AYBN 4D5CA 2G0EA 4S0HB 2MGQA 5GPCA 3BR2A 1Y1VJ 2NVXJ 3BR0A 2M8GX 4C2MJ 2CRGA 3LNQA 1NK3P 4CYCB 3I4MJ 3K2AA 5EEAA 1RR7A 5M5YJ 4QTRA 3CDLA 2IAIA 2NS8A 4XRMA 1ETXA 1OFCX 2HXOA 4JX5A 3S2DJ 4A3CJ 4M3GA 2XB5A 5F04A 5K7FA 3QPLA 4C3JJ 4A3FJ 1Y1WJ 2CU7A 5C4JJ 1H88C 3HOZJ 4MO7A 3S1NJ 1WGXA 4C3HJ 1YRNA 4D7MA 3IH2A 3A02A 3Q3SA 3S14J 1F36A 4NDLA 5M5WJ 1WPKA 2I10A 4D5FA 3FK7A 3S1RJ 1LFBA 1WH5A 1ETVA 2QF7A 3ZOBA 2DMQA 4AUXA 1GVDA 1QVTA 3M4OJ 1TC3C 3HBLA 1T33A 2XPWA 2RAEA 2DJNA 1RKWA 1FEXA 2EZLA 3CQZJ 1JUPA 1B8IA 4DYCA 3OSFA 3IV5A 5FLMJ 5K7HA 3JRDA 2Y30A 3CCYA 4I6ZA 5EGOB 5EZHA 4IHYA 1JT6A 1X58A 3A01A 3OIOA 3HKZN 1BW5A 1EF4A 1HOMA 1ZR2A 5M5XJ 2R92J 4XK4A 1O4XA 4A3IJ 5BNGA 3JRHA 1FIAA 2CUFA 2DA3A 2EQRA 2L7MP 1FJLA 5FJ8J 2LD5A 2Y2ZA 2LP0A 3Q0VA 1MBKA 2ME0A 4MFEA 2R5ZA 1JT0A 3HEFA 2DA5A 1HF0A 1X2MA 2FX0A 1MH4A 2O9LA 1MSFC 2H1KA 1RESA 3ZQGA 4FISA 2FQ4A 1UG2A 2K9SA 3FISA 2XB0X 4XIDA 1XG1A 2CQXA 2CJJA 1IJWC 2JA6J 1IC8A 3PO2J 1Z77A 3HB9A 1NTCA 1P7JA 4BBSJ 1IUFA 3TW6A 4V2FA 4M3EA 3OSGA 5IYBJ 3HGYA 1MBGA 3S17J 2DA7A 2XPVA 5E3MA 4QIWN 1FIPA 3GBGA 4QSHA 4V2GA 3H3VK 3ZQCA 1RPWA 1NK2P 2MG4A 3QPSA 4RDUA 1GT0C 1TWHJ 1JGGA 2L9RA 3M3YJ 2VKEA 3S1MJ 3G1OA 2OF7A 1MBFA 4A3GJ 4AC0A 1AHDP 2LLKA 4J19A 2NVQJ 1JUMA 4M3DA 1W0TA 4FCYA 3RZDJ 5IYDJ 3FKIJ 1ETQA 1MBJA 1YRNB 1ZR4A 2HOSA 4B4CA 2JMWA 2ECBA 2E1OA 2LTPA 4M6VA 2IEKA 3QQAA 4MIMA 3GTJJ 2R5YA 1XS9A 3JRFA 2XGEA 3BR1A 1SANA 2ELKA 4Y52J 2NOGA 3D1NI 2M34A 1B8IB 2DMNA 3DCFA 1VNDA 3PO3J 4ABZA 4I76A 1HDPA 3JREA 1HLVA 1A5JA 3B6AA 3A01B 1R9TJ 3GTQJ 1ENHA 1JKOC 1JTXA 3LSPA 3GTOJ 1UHSA 3C2BA 5FKKA 2DTZA 2COBA 2DN0A 4BKXA 5IOZA 2ME6A 3JRBA 3UKGA 1PUFA 1F43A 2M2EA 4A3DJ 1K83J 1UMQA 4W97A 2R5ZB 2XSDC 1I50J 4DZJA 2JN6A 2MSYA 2NVYJ 5DTDA 2GM4A 3BG9A 3HM5A 4UUSA 3L1PA 1JJ8C 2WV1A 1MNMC 2M9HA 5F27A 2VUMJ 4BXXJ 1IDZA 2LKXA 1IG7A 2R0QC 1TWCJ 1K61A 2QCOA 2P81A 3HDDA 1U9OA 3HOYJ 2E2IJ 2ID6A 4JP0A 1ETOA 4IHVA 5J3LA 3GTGJ 2M0CA 2D5VA 3LOCA 3VPRA 3LSGA 2K9NA 2L7ZA 1ZGWA 4EEFG 2KDZA 1OJLA 1QPIA 3JRCA 3W6VA 1BJZA 4BY1J 1QVUA 4C3IJ 5EG0A 1Q1VA 3IH3A 3TP0A 3S1QJ 5F0CA 4JYKA 3S15J 3I4NJ 3A03A 2YU9J 2L7FP 5IOYA 4A3KJ 2NVTJ 2EZIA 1ITYA 1MBEA 1W0UA 2E19A 2HYJA 3S16J 4G12A 5F0HA 1ORKA 1P7IA 3HGGA 5M3FJ 3IH4A 4W1UA 3DEWA 2MW8A 1GV5A 2K40A 2TRTA 4JX4A 2HOTA 3HOVJ 2B63J 5EF6A 2Y31A 1DU0A 2X9DA 2EZKA 1WCMJ 2JA8J 2DA6A 4A3JJ 3BTIA 4B3AA 2R5YB 2DMPA 2XRLA 4MLOA 5GP9A 2PMZN 4UUTA 1G2HA 3FIWA 3K7AJ 1POGA 3GTMJ 1GV2A 5J1YA 2YUSA 5JLWA 5IYCJ 3GTPJ 1FTTA 2WAQN 3H0GJ 3ZQIA 1ETYA 3Q0WA 1OCPA 1FTZA 1JKQC 2AO9A 3GTLJ 4M3BA 5IPAA 1HDDC 1BL0A 3HOUJ 5FKNA 2FD5A 1ZK8A 3BR3A 3RKQA 3BTJA 2JWTA 1IV6A 4RBOA 2HOAA 1E3OC 1LE8A 2LVSA 3F0CA 5DS9A 1RKTA 2CUEA 2ZB9A 1DU6A 1I3QJ 4L5EA 3S2HJ 4FE4A 2LY9A 3SDGA 5F08A 2LR8A 1PUFB 3BTLA 1B72A 1ETKA 3JRGA 2E2JJ 9ANTA 2LK2A 1U9NA 1XC5A 2JJ7A 1TWGJ 1JUSA 3MVPA 3JR9A 1AKHA 1BA5A 1MH3A 2FJ1A 5JLXA 3ZQLA 2DMUA 3G1MA 4UUSB 1U78A 4A3LJ 3BG3A 2VI6A 5IP7J 5F1JA 3Q0UA 5C3EJ 5GPAA 4DYRA 4DZPA 3WHCA 2GBYA 3GTKJ 2L0KA 1I6HJ 5EZGA 2X48A 5FLVA 1MBHA 3MN2A 3TP3A 3RZOJ 1H89C 4BY7J 2HQ5A 2YS9A 3JRIA 2Y9ZA 4IHWA 3ZQFA 1WH7A 5EDNA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS7 A;  4X1E A;  2EH3 A;  2OPT A;  1VI0 A;  3BG5 A;  2HXI A;  1VFC A;  3BT9 A;  4CYC A;  1ZQ3 P;  2XGD A;  2TCT A;  3G1L A;  5K7Z A;  4MFD A;  4XRS A;  4A3B J;  2K9Q A;  2W48 A;  5E3O A;  3BR6 A;  3E7L A;  4M3F A;  1WI3 A;  5EG0 B;  3LSR A;  1T56 A;  3OOU A;  5C44 J;  4DYQ A;  2EZH A;  1QRY A;  2N8G A;  3NAU A;  3O8H A;  3B6C A;  3HOX J;  3BQZ A;  2O8K A;  5J1U A;  1A6I A;  2O7O A;  2KT0 A;  5IP9 J;  2DA2 A;  2E2H J;  5F0F A;  2ECC A;  4A93 J;  5M3M J;  5FKL A;  4HNV A;  2HDD A;  4FTH A;  5E3L A;  1H8A C;  3LSJ A;  1TWF J;  3CMY A;  4A3M J;  2DA4 A;  2EBI A;  1ETW A;  3JRA A;  2R93 J;  2R7Z J;  2WB1 N;  5IP6 A;  2HI3 A;  4DW6 A;  1SFO J;  3TED A;  4A3E J;  1APL C;  2JK3 A;  1MSE C;  1ZTR A;  4IEJ A;  4LOC A;  1TWA J;  4FE7 A;  3BR5 A;  2XPU A;  5HOD A;  1X2N A;  1IRZ A;  2DMT A;  2ID3 A;  4D7N A;  5EGO A;  3TW7 A;  4GFB A;  3MKL A;  4XIC A;  1RET A;  2X6O A;  2Y0S N;  2DA1 A;  2JA5 J;  4X6A J;  4JX6 A;  1IGN A;  1HCR A;  2XGC A;  5FKO A;  1LE8 B;  3NAR A;  1OCT C;  1LFU P;  2IBD A;  2H8R A;  5J1R A;  1U8B A;  5C4X J;  1BW6 A;  3HOW J;  5FKM A;  1B72 B;  3BQY A;  3SFI A;  1JKP C;  1D5Y A;  1Z0X A;  2Y9Y A;  2VPR A;  3WHB A;  5E3N A;  2GLO A;  4BBR J;  3O8G A;  2CQQ A;  1AKH B;  2AHQ A;  3SJM A;  1ZKG A;  4IHX A;  1JKR C;  3FK6 A;  1JTY A;  3PM1 A;  5EYR A;  4A69 C;  2VKV A;  1GDT A;  3ZQH A;  1S7E A;  1IDY A;  2JA7 J;  3BTC A;  1VF9 A;  1JJ6 C;  3RQI A;  1CQT A;  4XRS G;  2LFB A;  1AU7 A;  1GUU A;  4B1R A;  4Y7N J;  4AYB N;  4D5C A;  2G0E A;  4S0H B;  2MGQ A;  5GPC A;  3BR2 A;  1Y1V J;  2NVX J;  3BR0 A;  2M8G X;  4C2M J;  2CRG A;  3LNQ A;  1NK3 P;  4CYC B;  3I4M J;  3K2A A;  5EEA A;  1RR7 A;  5M5Y J;  4QTR A;  3CDL A;  2IAI A;  2NS8 A;  4XRM A;  1ETX A;  1OFC X;  2HXO A;  4JX5 A;  3S2D J;  4A3C J;  4M3G A;  2XB5 A;  5F04 A;  5K7F A;  3QPL A;  4C3J J;  4A3F J;  1Y1W J;  2CU7 A;  5C4J J;  1H88 C;  3HOZ J;  4MO7 A;  3S1N J;  1WGX A;  4C3H J;  1YRN A;  4D7M A;  3IH2 A;  3A02 A;  3Q3S A;  3S14 J;  1F36 A;  4NDL A;  5M5W J;  1WPK A;  2I10 A;  4D5F A;  3FK7 A;  3S1R J;  1LFB A;  1WH5 A;  1ETV A;  2QF7 A;  3ZOB A;  2DMQ A;  4AUX A;  1GVD A;  1QVT A;  3M4O J;  1TC3 C;  3HBL A;  1T33 A;  2XPW A;  2RAE A;  2DJN A;  1RKW A;  1FEX A;  2EZL A;  3CQZ J;  1JUP A;  1B8I A;  4DYC A;  3OSF A;  3IV5 A;  5FLM J;  5K7H A;  3JRD A;  2Y30 A;  3CCY A;  4I6Z A;  5EGO B;  5EZH A;  4IHY A;  1JT6 A;  1X58 A;  3A01 A;  3OIO A;  3HKZ N;  1BW5 A;  1EF4 A;  1HOM A;  1ZR2 A;  5M5X J;  2R92 J;  4XK4 A;  1O4X A;  4A3I J;  5BNG A;  3JRH A;  1FIA A;  2CUF A;  2DA3 A;  2EQR A;  2L7M P;  1FJL A;  5FJ8 J;  2LD5 A;  2Y2Z A;  2LP0 A;  3Q0V A;  1MBK A;  2ME0 A;  4MFE A;  2R5Z A;  1JT0 A;  3HEF A;  2DA5 A;  1HF0 A;  1X2M A;  2FX0 A;  1MH4 A;  2O9L A;  1MSF C;  2H1K A;  1RES A;  3ZQG A;  4FIS A;  2FQ4 A;  1UG2 A;  2K9S A;  3FIS A;  2XB0 X;  4XID A;  1XG1 A;  2CQX A;  2CJJ A;  1IJW C;  2JA6 J;  1IC8 A;  3PO2 J;  1Z77 A;  3HB9 A;  1NTC A;  1P7J A;  4BBS J;  1IUF A;  3TW6 A;  4V2F A;  4M3E A;  3OSG A;  5IYB J;  3HGY A;  1MBG A;  3S17 J;  2DA7 A;  2XPV A;  5E3M A;  4QIW N;  1FIP A;  3GBG A;  4QSH A;  4V2G A;  3H3V K;  3ZQC A;  1RPW A;  1NK2 P;  2MG4 A;  3QPS A;  4RDU A;  1GT0 C;  1TWH J;  1JGG A;  2L9R A;  3M3Y J;  2VKE A;  3S1M J;  3G1O A;  2OF7 A;  1MBF A;  4A3G J;  4AC0 A;  1AHD P;  2LLK A;  4J19 A;  2NVQ J;  1JUM A;  4M3D A;  1W0T A;  4FCY A;  3RZD J;  5IYD J;  3FKI J;  1ETQ A;  1MBJ A;  1YRN B;  1ZR4 A;  2HOS A;  4B4C A;  2JMW A;  2ECB A;  2E1O A;  2LTP A;  4M6V A;  2IEK A;  3QQA A;  4MIM A;  3GTJ J;  2R5Y A;  1XS9 A;  3JRF A;  2XGE A;  3BR1 A;  1SAN A;  2ELK A;  4Y52 J;  2NOG A;  3D1N I;  2M34 A;  1B8I B;  2DMN A;  3DCF A;  1VND A;  3PO3 J;  4ABZ A;  4I76 A;  1HDP A;  3JRE A;  1HLV A;  1A5J A;  3B6A A;  3A01 B;  1R9T J;  3GTQ J;  1ENH A;  1JKO C;  1JTX A;  3LSP A;  3GTO J;  1UHS A;  3C2B A;  5FKK A;  2DTZ A;  2COB A;  2DN0 A;  4BKX A;  5IOZ A;  2ME6 A;  3JRB A;  3UKG A;  1PUF A;  1F43 A;  2M2E A;  4A3D J;  1K83 J;  1UMQ A;  4W97 A;  2R5Z B;  2XSD C;  1I50 J;  4DZJ A;  2JN6 A;  2MSY A;  2NVY J;  5DTD A;  2GM4 A;  3BG9 A;  3HM5 A;  4UUS A;  3L1P A;  1JJ8 C;  2WV1 A;  1MNM C;  2M9H A;  5F27 A;  2VUM J;  4BXX J;  1IDZ A;  2LKX A;  1IG7 A;  2R0Q C;  1TWC J;  1K61 A;  2QCO A;  2P81 A;  3HDD A;  1U9O A;  3HOY J;  2E2I J;  2ID6 A;  4JP0 A;  1ETO A;  4IHV A;  5J3L A;  3GTG J;  2M0C A;  2D5V A;  3LOC A;  3VPR A;  3LSG A;  2K9N A;  2L7Z A;  1ZGW A;  4EEF G;  2KDZ A;  1OJL A;  1QPI A;  3JRC A;  3W6V A;  1BJZ A;  4BY1 J;  1QVU A;  4C3I J;  5EG0 A;  1Q1V A;  3IH3 A;  3TP0 A;  3S1Q J;  5F0C A;  4JYK A;  3S15 J;  3I4N J;  3A03 A;  2YU9 J;  2L7F P;  5IOY A;  4A3K J;  2NVT J;  2EZI A;  1ITY A;  1MBE A;  1W0U A;  2E19 A;  2HYJ A;  3S16 J;  4G12 A;  5F0H A;  1ORK A;  1P7I A;  3HGG A;  5M3F J;  3IH4 A;  4W1U A;  3DEW A;  2MW8 A;  1GV5 A;  2K40 A;  2TRT A;  4JX4 A;  2HOT A;  3HOV J;  2B63 J;  5EF6 A;  2Y31 A;  1DU0 A;  2X9D A;  2EZK A;  1WCM J;  2JA8 J;  2DA6 A;  4A3J J;  3BTI A;  4B3A A;  2R5Y B;  2DMP A;  2XRL A;  4MLO A;  5GP9 A;  2PMZ N;  4UUT A;  1G2H A;  3FIW A;  3K7A J;  1POG A;  3GTM J;  1GV2 A;  5J1Y A;  2YUS A;  5JLW A;  5IYC J;  3GTP J;  1FTT A;  2WAQ N;  3H0G J;  3ZQI A;  1ETY A;  3Q0W A;  1OCP A;  1FTZ A;  1JKQ C;  2AO9 A;  3GTL J;  4M3B A;  5IPA A;  1HDD C;  1BL0 A;  3HOU J;  5FKN A;  2FD5 A;  1ZK8 A;  3BR3 A;  3RKQ A;  3BTJ A;  2JWT A;  1IV6 A;  4RBO A;  2HOA A;  1E3O C;  1LE8 A;  2LVS A;  3F0C A;  5DS9 A;  1RKT A;  2CUE A;  2ZB9 A;  1DU6 A;  1I3Q J;  4L5E A;  3S2H J;  4FE4 A;  2LY9 A;  3SDG A;  5F08 A;  2LR8 A;  1PUF B;  3BTL A;  1B72 A;  1ETK A;  3JRG A;  2E2J J;  9ANT A;  2LK2 A;  1U9N A;  1XC5 A;  2JJ7 A;  1TWG J;  1JUS A;  3MVP A;  3JR9 A;  1AKH A;  1BA5 A;  1MH3 A;  2FJ1 A;  5JLX A;  3ZQL A;  2DMU A;  3G1M A;  4UUS B;  1U78 A;  4A3L J;  3BG3 A;  2VI6 A;  5IP7 J;  5F1J A;  3Q0U A;  5C3E J;  5GPA A;  4DYR A;  4DZP A;  3WHC A;  2GBY A;  3GTK J;  2L0K A;  1I6H J;  5EZG A;  2X48 A;  5FLV A;  1MBH A;  3MN2 A;  3TP3 A;  3RZO J;  1H89 C;  4BY7 J;  2HQ5 A;  2YS9 A;  3JRI A;  2Y9Z A;  4IHW A;  3ZQF A;  1WH7 A;  5EDN A; 
#chains in the Genus database with same CATH topology
 2R7D A;  1MJB A;  1WJF A;  3K1P A;  3MFK A;  4I98 B;  1FC3 A;  2DPD A;  4M9S A;  2XAJ A;  4AVZ A;  2FA5 A;  2CFX A;  3BT9 A;  2RDP A;  2R7S A;  2XGD A;  2TCT A;  5K7Z A;  4MFD A;  2K9Q A;  2V1D A;  1EJ9 A;  5H6Q A;  4M3F A;  3E5Q A;  3OYB A;  1T39 A;  5EG0 B;  4P1W A;  3GUD A;  2W24 A;  4LLL A;  4DYQ A;  1Z3Y A;  4QWQ A;  3DQV C;  3NWS A;  3HYI A;  4ZYH A;  3HOS A;  2DOE A;  4E70 A;  2ZJQ F;  2DA2 A;  2E2H J;  4A93 J;  5M3M J;  1BIA A;  2BBY A;  2F48 A;  4CCJ A;  4E6K G;  5BOX A;  4IQJ A;  4LB5 A;  4HNV A;  2HDD A;  1A6Q A;  5LRR A;  5L3F A;  2F5C A;  5E8I A;  5FB2 A;  4J01 A;  3DBL B;  1TWF J;  5HDN A;  2DA4 A;  2FOK A;  4IRG A;  2GOX B;  3BY6 A;  2E7X A;  4EQQ A;  1ETW A;  1GVJ A;  4FHT A;  4G6Q A;  4NBQ A;  3WG9 A;  3S8P A;  4RGX A;  1MJ9 A;  3WU2 C;  4YIR X;  2LF8 A;  2WB1 N;  3CES A;  4DW6 A;  1SFO J;  4Z2Y A;  4A3E J;  3L09 A;  1MSE C;  2DQL A;  4IEJ A;  4LOC A;  3REO A;  4M6X A;  4HNU A;  1WVR A;  4CH7 A;  3N05 A;  4C2U A;  1J9I A;  2PJP A;  1X2N A;  1P6R A;  1J59 A;  5FLX Z;  3KYD B;  2P5L C;  3WE2 A;  3TW7 A;  4GFB A;  1RET A;  2A5W A;  2HTS A;  1Z9C A;  4G6T B;  2H94 A;  4EJO A;  2Q0O A;  4K2E A;  3ABL H;  5DYM A;  4EM1 A;  2XGC A;  1LEB A;  3FXQ A;  1N75 A;  3BPX A;  1LFU P;  4FQG A;  4AIH A;  2A69 F;  2H8R A;  3A4C A;  1BW6 A;  4PSX A;  1ZGJ A;  1D5Y A;  1Z0X A;  2X0L A;  3WHB A;  1IRF A;  3FXR A;  2O5R A;  4IKF A;  1P9Q C;  1BN5 A;  2BEO A;  2HVQ A;  1XMX A;  4GXO A;  1KGS A;  4PFO A;  3F6O A;  4IHX A;  1JKR C;  1BI1 A;  3PM1 A;  2QBY B;  1XX5 A;  4GYG A;  3DEE A;  3HG9 A;  4Y4R A;  1MMD A;  4L0Y B;  1S7E A;  1IDY A;  3P5J A;  1JJ6 C;  3K69 A;  3RQI A;  1KQ9 A;  4XRS G;  3CC4 I;  2LG4 A;  2VKH A;  4G9Y A;  4UHT A;  1D1C A;  4AYB N;  3T8T A;  5ICE A;  3OYG A;  3RQ4 A;  4M9X A;  5HNH A;  1DP3 A;  4YIF A;  3F8F A;  3F9K A;  2ZXI A;  1Y1V J;  3I3L A;  2EFQ A;  1XSV A;  1U5T A;  3CUQ A;  4C2M J;  2P8T A;  3T1B A;  2PJR A;  3PSI A;  4ASN A;  3K2A A;  1FNN A;  2JA2 A;  3KZZ A;  2IT0 A;  1DDN A;  3DPL C;  3LSH A;  3VYR B;  2XB5 A;  1YIJ I;  4XR6 A;  1SVM A;  2OZ6 A;  3NWT A;  2CFO A;  4RAG A;  1V55 H;  2E35 A;  2L9S A;  2HWV A;  1YW7 A;  5B66 C;  4MO7 A;  4XLN F;  2HVR A;  3HOZ J;  5J47 A;  3K4K A;  2FXA A;  4D7M A;  3L2V A;  3S14 J;  3FM5 A;  5M5W J;  1D0Z A;  2M4G A;  1WPK A;  2EFO A;  4NC6 A;  3FK7 A;  4RAZ A;  4CZC A;  1HW1 A;  3S1R J;  3Q9S A;  2O61 A;  3GF2 A;  3BZ6 A;  2VBW A;  3OYI A;  5HNF A;  4J00 A;  1WH5 A;  1ETV A;  2QEX I;  3S32 A;  2OTL I;  3CCE I;  2Z33 A;  3FBI B;  1KU3 A;  1QVT A;  2P6T A;  2VE8 A;  4WF2 A;  2WBM A;  2XPW A;  5E18 F;  2VOO A;  1RKW A;  4AM3 A;  1FEX A;  1YG2 A;  3RI4 A;  4BYY A;  4DYC A;  3M8J A;  1S72 I;  4RMN A;  3V8K A;  3GWZ A;  3OSF A;  3IV5 A;  5FLM J;  4OMY A;  1R36 A;  2KZG A;  5K7H A;  2FBK A;  2VQH A;  2P4W A;  3QOD A;  3BWG A;  4O3M A;  4C30 A;  3A01 A;  3OIO A;  1FOW A;  1QZE A;  3SFZ A;  2IXS A;  1STZ A;  3CP8 A;  1HOM A;  2DO7 A;  1FLI A;  1JHH A;  1ZR2 A;  3OYF A;  1B9M A;  4ZDO A;  4A3I J;  2VB6 A;  5J8C A;  4ENN A;  3DKY A;  2CUF A;  2EQR A;  1ZRF A;  4RB0 A;  2CGP A;  1LDJ A;  3ZN0 A;  3VB2 A;  3CME I;  2FNP A;  2Y2Z A;  2LP0 A;  3Q0V A;  2WV0 A;  5A2Q Z;  3LQR A;  1W36 D;  1ZLK A;  2O6G E;  4M71 A;  3HEF A;  1HF0 A;  3ZQQ A;  3PNT A;  4OAZ A;  1F4K A;  4OIQ F;  1OR7 A;  2WAE A;  1MKM A;  3GFM A;  1MSF C;  3HUG A;  3SEQ A;  3GX4 X;  4ZDP A;  3V42 A;  1SMY F;  1EV7 A;  2MAB A;  1UG2 A;  1PDN C;  3SYT A;  2XB0 X;  2R7T A;  4XID A;  1USS A;  1D0Y A;  1R71 A;  5B1A H;  1IO2 A;  1HW5 A;  4UVB A;  1UFM A;  1D8J A;  3RDI A;  3MKY B;  1Z77 A;  1NTC A;  4KIT B;  1G3T A;  4E4H A;  3CO7 C;  4M3E A;  2QQ8 A;  2K02 A;  1MBG A;  3WOD F;  3S17 J;  1LUJ B;  4OIO F;  4QIW N;  1FMW A;  4IZZ A;  4KN4 X;  1NK2 P;  2MG4 A;  2VBX A;  1IN6 A;  1G3W A;  1WQ2 A;  3K1N A;  1DPU A;  4XLE A;  5KVR A;  3S1M J;  1GXP A;  2E5Z A;  2MH9 A;  2V9V A;  2NVU B;  1V5F A;  2OD5 A;  2DFF A;  4AC0 A;  4HQE A;  4OOI A;  2FSW A;  3JSO A;  1ETQ A;  3MZ8 A;  3CUO A;  3HHG A;  2HOS A;  3F72 A;  1U3E M;  3MMY B;  2LTP A;  3I4P A;  4HF0 A;  4M6V A;  3FXL A;  1O7L A;  4MIM A;  2R5Y A;  4UB6 C;  3ASN H;  3KE2 A;  4HX8 A;  4A6E A;  3OV8 A;  5K1Y A;  3JRF A;  3BR1 A;  4HF1 A;  1SAN A;  2ELK A;  2QSG X;  4HZF A;  4LK0 F;  2M34 A;  4DQ2 A;  5JFR A;  2KRF A;  1OYI A;  5FFX A;  3EQL F;  2PFB A;  3FX3 A;  5E1Z B;  1HDP A;  3JRE A;  1HLV A;  2AXT C;  2W1O A;  2HR3 A;  3G4S I;  2E34 A;  1UST A;  2LRE A;  3H3Z A;  1AA7 A;  3HPG A;  3PJR A;  1FWZ A;  2E36 A;  1JTX A;  1X1B A;  3GTO J;  2Y0M A;  1GLN A;  2QSF X;  5LFA A;  2LC2 A;  2DTZ A;  2ZJR F;  4E7I A;  1ONV A;  2DN0 A;  4ZTJ A;  2EB7 A;  2FNA A;  2FRH A;  3K70 D;  1WFX A;  2M2E A;  3FKJ A;  3E6D A;  3KYL A;  2RKH A;  1V4R A;  2DDA A;  3CCM I;  5TGT A;  4L9N A;  3GZ5 A;  4W97 A;  3ERE D;  2R5Z B;  3DU5 A;  4B09 A;  2LYC A;  4G94 A;  4QPQ A;  2MSY A;  1FMV A;  2BY0 A;  2NVY J;  3R0J A;  5DTD A;  1KQ0 A;  1RUN A;  1JJ8 C;  4RAY A;  3K4C A;  1MNM C;  1UG0 A;  2IPQ X;  2EFP A;  1YW9 A;  2O03 A;  1V3F A;  2VBY A;  2DOF A;  2STW A;  2VUM J;  5ILS A;  2DQR A;  1TW2 A;  2UZK A;  1K61 A;  3K0L A;  3HDD A;  5D6E A;  5TIS C;  1QGP A;  2WC2 A;  1U9O A;  2ZME C;  4KN7 X;  1QO0 D;  1G6N A;  2ID6 A;  3I55 I;  1YX3 A;  1SFX A;  5ICF A;  5LGN A;  2M0C A;  3HKZ A;  3ZR8 X;  1T95 A;  2DCE A;  2FEZ A;  1ZGW A;  1R5H A;  2EA4 A;  3GME A;  2HKO A;  3JRC A;  2OJE D;  4OMZ A;  1QVU A;  3J81 Z;  2C6Y A;  1MNE A;  5E1W A;  4C3I J;  5EG0 A;  1Q1V A;  2B0L A;  2GIZ A;  5CYV A;  3AFH A;  4IOC F;  3U1K A;  3OOP A;  1TLH B;  4Y3O A;  5IT9 K;  3S15 J;  3K4J A;  3M7G A;  2L7F P;  2NVT J;  3I54 A;  3L2R A;  2JSP A;  1LJ9 A;  3S16 J;  2XF7 A;  2ISY A;  1A31 A;  4R1H A;  2QKM B;  3DEW A;  2F4O B;  3G2B A;  2HDW A;  1WJC A;  2B63 J;  4MTE A;  2Y31 A;  2P5K A;  3BCA A;  4XKV A;  3RJP A;  4KDP A;  4KIG A;  5KCM A;  1T0F A;  3WE3 A;  2WY7 Q;  4QPO A;  4B3A A;  1QA6 A;  4UUT A;  3JCU C;  3C7J A;  4I2O A;  1POG A;  1YE9 A;  1A04 A;  4RM2 A;  4A5M A;  2K86 A;  2YUS A;  2OZU A;  2HEO A;  1W4M A;  3LST A;  1OKR A;  2F4I A;  3ZQI A;  3MWM A;  3A1Y A;  3Q0W A;  5BS6 A;  1JKQ C;  2KJB A;  4AVP A;  3M9A A;  3F23 A;  2AO9 A;  4M9Z A;  3GTL J;  3O3K A;  2XF5 A;  5IPA A;  4PFP A;  3OYK A;  1R7J A;  3GLL A;  4LIV A;  5FKN A;  1JI8 A;  3BR3 A;  2PMZ A;  4IL6 C;  2JWT A;  2FU4 A;  3BOQ A;  2BHZ A;  2DJI A;  3O2P E;  2V1X A;  4CGZ A;  2OA4 A;  5DS9 A;  3ELK A;  2EV0 A;  2ZB9 A;  5DM6 F;  2P6S A;  1DU6 A;  1I3Q J;  2W82 A;  2VJ5 A;  3S2H J;  4FE4 A;  1WSU A;  1E2X A;  3ZMV A;  4NC7 A;  2VOD A;  3BPV A;  2LY9 A;  3AG3 H;  2LR8 A;  1PUF B;  3BTL A;  2QGU A;  1FSH A;  2EJR A;  3W3C A;  1NHA A;  1ETK A;  1JXS A;  3T5X A;  1R1V A;  2DFH A;  2BXZ A;  2KHM A;  3P9K A;  2JJ7 A;  3OYA A;  1TWG J;  3JR9 A;  3LAP A;  3G71 I;  1BA5 A;  1YI2 I;  2CV1 A;  2FJ1 A;  2CWE A;  2Q2E B;  4UUS B;  4A3L J;  2QBY A;  5IP7 J;  2XAU A;  4XKB A;  2V1N A;  1MGT A;  2GBY A;  4DZP A;  4KUM A;  3BZC A;  3OMY A;  4U7B A;  2LDU A;  3MN2 A;  3RYP A;  3RZO J;  2HGC A;  4EGY A;  1H89 C;  1KYW A;  3F6V A;  3H35 A;  3I59 B;  3L2W A;  2YS9 A;  2EFW A;  1I3A A;  1O3R A;  2IA0 A;  2NS7 A;  2MFZ A;  5CVV A;  4A0X A;  3PNV A;  3BG5 A;  2HXI A;  4KFC A;  2EK5 A;  1VFC A;  1W5T A;  1ZQ3 P;  2W7N A;  1B59 A;  1OMI A;  3RTR A;  2W48 A;  4NC8 A;  3H92 A;  3W2V A;  3BR6 A;  3E7L A;  4UXN A;  1U8R A;  2ZFW A;  4MHG A;  4YFK F;  4G7Z F;  2COM A;  2DT5 A;  3OOU A;  2OAZ A;  3LA3 A;  2N8G A;  2HKX A;  2ZSH B;  3S3M A;  3HOX J;  3F8B A;  1P4W A;  3OYN A;  1A6I A;  2O7O A;  4BEH B;  5F0F A;  1ZRD A;  2P0W A;  3GVA A;  2V6E A;  1QNT A;  2A05 A;  4FTH A;  3LSJ A;  2R7W A;  2QM3 A;  4A3M J;  3DLA A;  2YX7 A;  5HLI A;  3JRA A;  1XMK A;  2R93 J;  4ZZD A;  5IP6 A;  5HS9 A;  3J7A O;  1APL C;  2UWM A;  5J6X A;  1ZTR A;  3PL8 A;  1J75 A;  2IGM A;  4NHJ A;  4HG2 A;  4CCK A;  2BY2 A;  4OIP F;  3ABT A;  4FE7 A;  3RSN A;  2YSR A;  2F5V A;  3B73 A;  3F8N A;  3G3Z A;  4XQF A;  5HOO A;  4XLA A;  4HOB A;  1R00 A;  1WWX A;  3MKL A;  4XIC A;  2X6O A;  2XAS A;  2NRA C;  1X4O A;  3LSM A;  2WB1 A;  2DA1 A;  4EJU A;  3H5N A;  4KIC A;  4X6A J;  1LDD A;  4JX6 A;  1OCO H;  3QP5 A;  1BIB A;  3H36 A;  2HZT A;  1YQA A;  1ZEL A;  5FKO A;  1VQ4 I;  1LE8 B;  3CCL I;  1I6X A;  4RB3 C;  1OCT C;  2A6T A;  1H9T A;  2L7K A;  1U8B A;  3ZMD A;  1ZH5 A;  1QHH D;  2IS4 A;  2FF4 A;  2X6W A;  3PUB A;  3A0H C;  5FKM A;  1B72 B;  3DTI A;  3SFI A;  1JKP C;  5D8L B;  2JUG A;  3KEY A;  5LEK A;  4QLC U;  2W84 A;  4Q47 A;  3O8G A;  1SC7 A;  2CV2 A;  4BHP A;  5EJC A;  2R7O A;  5TJJ A;  2AHQ A;  1BR1 A;  1ZKG A;  3DP7 A;  3FK6 A;  3HJE A;  2NYX A;  2VKV A;  3ZQH A;  3CJN A;  1TT0 A;  1VF9 A;  3SZP A;  5AIQ A;  1CQT A;  1AU7 A;  2WAQ A;  1GUU A;  4B1R A;  1FOY A;  1FBQ A;  3N97 A;  2LF7 A;  3U1D A;  4Y7N J;  2G0E A;  1VQL I;  4S0H B;  1TTY A;  2MGQ A;  1YJN I;  2XAG A;  3I58 A;  3MKW B;  2DAO A;  2BYV E;  1HSJ A;  4JQF A;  2LMD A;  2D2W A;  3D5L A;  1UHM A;  2VT3 A;  3I4M J;  2IGK A;  5EEA A;  4OU0 A;  2KL4 A;  4HRI A;  2MD0 A;  3M1C A;  1X3Z B;  2W57 A;  4A3C J;  4AYB A;  4PCQ A;  1MJA A;  4M3G A;  3QPL A;  4A3F J;  4MEX F;  3E5U A;  5GAD J;  5C4J J;  3K9T A;  1WGX A;  4A0Y A;  1X1A A;  3HXL A;  3WGG A;  4C3H J;  3OIP A;  2DFI A;  1H9G A;  2I10 A;  3BG6 A;  1DPR A;  2H27 A;  4YEJ A;  3IKT A;  4LJZ F;  1BI3 A;  1R6R A;  1WHU A;  1ZAO A;  2WTE A;  3M4O J;  2PMH A;  1T33 A;  3HBL A;  3WTV C;  3DKW A;  3CQZ J;  1JUP A;  3QYE A;  4C2T A;  2A6H F;  3JAM Z;  1D0X A;  3QAH A;  2ZCW A;  4JBA A;  1FYL A;  1PP8 F;  3EET A;  2X85 A;  4AD9 A;  4HAM A;  4JK1 X;  4BS9 A;  5EZH A;  1YHQ I;  3OYJ A;  1MW7 A;  4NB5 A;  2KRC A;  4ESB A;  2GAU A;  1EKE A;  2RRE A;  3WGI A;  4XBF A;  2RNJ A;  3BP8 A;  5E8G A;  1S5L C;  3JRH A;  1OYY A;  3G6E I;  3HRM A;  5CVU A;  2JRT A;  3E6C C;  2BVM A;  1S29 A;  2GA1 A;  2L7M P;  1FJL A;  5FJ8 J;  3OL3 A;  4CCM A;  1R49 A;  5L3E A;  1MBK A;  2ME0 A;  5GAH J;  2VIX A;  3COA C;  3VOD A;  3WG7 H;  4EGZ A;  2R5Z A;  2M7B A;  3QPH A;  1KA8 A;  5LHH A;  2DLL A;  1X2M A;  3WTY C;  2TDX A;  4CCN A;  5JR3 A;  1FT9 A;  1JGS A;  3U2R A;  4I0A A;  2H1K A;  3FXO A;  4ZDL A;  5DEQ A;  2L5Q A;  1BI0 A;  1W1W E;  3SQN A;  2K9S A;  3EYI A;  2MLK A;  2K85 A;  1GXQ A;  2E5N A;  2HQR A;  1S3J A;  4OIN F;  3V4G A;  2NAZ A;  3VYT B;  1I39 A;  1IC8 A;  4Y13 A;  3PO2 J;  4EM2 A;  1P7J A;  4BAY A;  1O7F A;  4U0Y A;  4IRH A;  4V2F A;  4I99 C;  4BL0 B;  5IYB J;  2PN6 A;  3CD6 I;  1K78 B;  3LFK A;  3HL2 A;  1TT5 B;  5D5U B;  3H3V K;  3ZQC A;  2P5V A;  2DK5 A;  1YO5 C;  3KP6 A;  3QPS A;  1B1B A;  2XRN A;  1GT0 C;  4KT6 A;  4BXU A;  4F93 B;  1FP2 A;  4CHU A;  3LL7 A;  2VKE A;  3TO7 A;  3MZH A;  4KYW A;  2OF7 A;  3J7Z I;  3CLQ A;  1KON A;  2V26 A;  4YEL A;  1AHD P;  2LLK A;  4J19 A;  1QU3 A;  1LVA A;  5D5X B;  5K5O A;  4M3D A;  4FCY A;  3CCQ I;  4OAY A;  3CTA A;  2QKL B;  1TZL A;  5IYD J;  1Q1H A;  1X4P A;  1MBJ A;  3BZK A;  1IRX A;  1YRN B;  2YR2 A;  4OIR F;  5JHU A;  1HKT A;  2BXY A;  3R4K A;  2CV0 A;  5LEJ A;  4HLY A;  2E1O A;  2IJL A;  1E3P A;  1DQU A;  1R58 A;  1WJE A;  1OYW A;  2ZC2 A;  1FBU A;  1PP7 U;  1ZYR F;  1XS9 A;  2ZXW H;  1FPQ A;  1J5Y A;  2OU2 A;  4Y52 J;  1S7A A;  1PVE A;  2CSO A;  4XNF A;  3NEU A;  3BJ6 A;  2IS6 A;  4FAS D;  4FX0 A;  1HC8 A;  1YTY A;  1V5G A;  5FRO A;  4MNU A;  1VQM I;  4YFN F;  2V1U A;  1XGO A;  2FMY A;  2K27 A;  4EM0 B;  2IS2 A;  1R9T J;  3GTQ J;  4M74 A;  3CCR I;  5HLT A;  4G6D A;  1SD4 A;  4KIB A;  1Z3X A;  4PJN A;  3C2B A;  5FKK A;  3WTT C;  2QEN A;  2COB A;  2K9L A;  3KP2 A;  2VJJ A;  5IOZ A;  4HBL A;  3JRB A;  1PUF A;  1P92 A;  3BRO A;  3O6B B;  1PUE E;  1SMT A;  3BLY A;  2CW0 F;  1RIO H;  4CZZ A;  2KKO A;  3IAS 2;  1YW8 A;  2OTJ I;  2IA2 A;  4XN0 A;  1R4M B;  5EEG A;  4BU2 A;  2XSD C;  4DZJ A;  4IX7 A;  4LK1 F;  2GM4 A;  2Q2E A;  4UUS A;  1BOA A;  1SAU A;  1FOX A;  2VT2 A;  3S2W A;  5FLX K;  5LBQ A;  2W25 A;  2WV1 A;  4RAF A;  2NNY A;  5LGT A;  4P5O A;  1K7A A;  2EFN A;  3JTG A;  2ZJP F;  3RKX A;  1XCB A;  3Q5F A;  4F52 A;  1UHW A;  2D1H A;  1UCR A;  1A35 A;  4BXX J;  1IDZ A;  1DUX C;  1R5G A;  5CQE A;  5GTH C;  4I01 A;  4HX7 A;  3GFL A;  3I59 A;  3WTW C;  3QYB A;  1ZG5 A;  3MEX A;  3IRQ A;  5CPR B;  2RGV A;  4CCL A;  3GTG J;  2CQ7 A;  3IP4 B;  3LOC A;  1IN8 A;  4L9J A;  3MCZ A;  2QYO A;  1ON1 A;  3HOT A;  1N77 A;  2K9N A;  2L7Z A;  1QPI A;  2MC3 A;  3LSK A;  4U0W A;  1T8I A;  3OWT A;  2WA0 A;  2M5W A;  1G3S A;  3I9V 2;  4I09 A;  2EIN H;  3S1Q J;  5H2F C;  1M1E B;  4ETS A;  4U7D A;  1ZLJ A;  2DI3 A;  3I4N J;  5E20 A;  3OYM A;  4A0Z A;  2XF6 A;  1OPC A;  4BEH A;  5IOY A;  4A3K J;  5CVJ A;  2EZI A;  1ITY A;  3DBR B;  1W0U A;  4CYD A;  5LLQ A;  2VN2 A;  4HPQ A;  6PAX A;  3NRV A;  4PJJ A;  3S3N A;  3DWL E;  2M7A A;  1KYZ A;  4W1U A;  4BNC A;  2K40 A;  2KFD A;  3HOV J;  1TL8 A;  4PUS A;  4LG0 B;  3L2U A;  1HKS A;  3DBH B;  3M1E A;  3MQ0 A;  3TL4 X;  1VQN I;  2E60 A;  3F8C A;  2EZK A;  3OYE A;  1S7O A;  4XLF A;  3HHH A;  2JA8 J;  3GZN B;  2JQ7 A;  4KIF A;  2L4M A;  4PGH A;  5KHD A;  1O57 A;  2ZXH A;  3CCS I;  3QP6 A;  5LRS A;  1D5V A;  1SFU A;  1Y56 A;  4XLC A;  5J1Y A;  3GFI A;  4MQ9 F;  1BBY A;  2HDC A;  3GTP J;  3G73 A;  3B02 A;  3GCM A;  4LLG F;  1B4A A;  4CSW A;  1XD7 A;  3AKZ A;  1ZG3 A;  2XHK A;  3H9Q A;  2ELH A;  4Y17 A;  1HBX G;  2MYS A;  3TKY A;  3FMQ A;  3ZQ7 A;  1ZK8 A;  4O6J A;  1IV6 A;  4RBO A;  1E3O C;  3A0B C;  1LE8 A;  1RKT A;  3I53 A;  1PYV A;  4I02 A;  5FRN A;  3V7S A;  4IPA A;  5D5W B;  2KLO A;  2IS1 A;  1ZAR A;  2A61 A;  1B72 A;  2VL8 A;  1NG7 A;  3PFI A;  3R60 A;  4RS8 A;  9ANT A;  2QVO A;  1U9N A;  1XC5 A;  2AS5 F;  1JUS A;  1J7K A;  2W4S A;  1UAA A;  4BUP A;  2X1D A;  2VI6 A;  1VQ5 I;  2CO5 A;  5F1J A;  5C3E J;  4BQA A;  4NNJ A;  3WHC A;  3CDH A;  4RLF A;  4AWX B;  4LLN A;  3GTK J;  2X48 A;  1OIS A;  1MBH A;  1Y0N A;  2ZME B;  4HEA 2;  3SZG A;  1Z1D A;  2M8E A;  3TMO A;  3JTH A;  4E7K A;  2Y75 A;  1YJ9 I;  2EH3 A;  1VI0 A;  3K6G A;  2IA1 A;  2BY3 A;  4HNT A;  3VYS B;  2KPM A;  2F5E A;  4BHC A;  3G1L A;  5A2Q K;  3DFG A;  2X6X A;  4XM3 A;  5J4V A;  2K3P A;  1T08 B;  4ZTF A;  2DXI A;  5CVI A;  3I71 A;  1WZ2 A;  3L2C A;  3LSR A;  3DU6 A;  2IGN A;  2QQB A;  1QRY A;  5ERI A;  1C0W A;  3O8H A;  1IN4 A;  2XKP A;  3UNG C;  1E3H A;  2ADU A;  4G7O F;  3UR3 C;  2A6E F;  2O8K A;  5J1U A;  1I1G A;  1PJR A;  4A12 A;  2RQQ A;  1YFH A;  1R5I D;  3FXU A;  1J09 A;  3FXM A;  1H8A C;  1F5T A;  3CMY A;  2EBI A;  2I8D A;  2X1E A;  1K6O A;  2NOJ B;  1QQI A;  2VBZ A;  2LOO A;  1LKX A;  5ED4 A;  4M73 A;  2R7Z J;  3LFU A;  5KAF C;  4I0B A;  1FYM A;  1RZ4 A;  3OYL A;  1P4X A;  2CH0 A;  3KPH A;  2XSJ C;  2JK3 A;  3C3W A;  2BHY A;  1VQ8 I;  1MDM B;  1BC8 C;  2IGO A;  3LA7 A;  4WXC A;  3OIQ A;  2XPU A;  2QSH X;  1IRZ A;  1UEL B;  2ID3 A;  4D7N A;  3HSF A;  3P9I A;  2JSC A;  3EPZ A;  3SHF A;  1R4N B;  2EV6 A;  2V4J C;  3PIP F;  5D4R A;  4BGD A;  5HLH A;  2KDO A;  1FZP B;  4D1Q A;  2Y0S N;  3ZCO A;  4ZZL A;  2JA5 J;  3RKW A;  3V8J A;  3CC7 I;  1IGN A;  1Z05 A;  3FHZ A;  1RI7 A;  4DBQ A;  1HCR A;  2VOP A;  3MD2 A;  1XSX A;  4Y15 A;  3VDX A;  4DBR A;  3L7W A;  4N4N B;  3J80 Z;  2IBD A;  4II2 A;  4MGR A;  2GXG A;  3KLN A;  3RCO A;  2KZV A;  1Z21 A;  2NS0 A;  4L9V A;  2A68 F;  4B3X A;  2MH2 A;  2RN7 A;  3HRT A;  1L3L A;  2BY1 A;  2FUG 2;  2GWR A;  5E3N A;  1D3Y A;  1YLF A;  4BBR J;  2L4A A;  2XIG A;  3E0J B;  5FO5 A;  1R1U A;  2JT1 A;  2ESH A;  2HPI A;  1JTY A;  1IN5 A;  1X3W B;  1VQ6 I;  2JA7 J;  1F1Z A;  4WXH A;  3FMR A;  2WY8 Q;  5JVT A;  2D1V A;  2XC7 A;  2LFB A;  1T38 A;  4GCV A;  1D8K A;  1KZH A;  4R8H A;  3QYF A;  4D5C A;  4HV5 A;  3ROU A;  3GYH X;  2DT6 A;  2QWW A;  3KZY A;  3VFZ A;  1YX5 A;  3HRU A;  4B43 A;  3E5X A;  3TQN A;  2XAH A;  1BOB A;  2WWY A;  2JUC A;  2IRF G;  2CRG A;  1K78 A;  4N9H A;  1I1S A;  3LNQ A;  1U5T C;  4CYC B;  3EDP A;  4N0B A;  2OQR A;  5KK1 A;  5IY5 H;  2Q1Z B;  2CYY A;  1FY7 A;  3HSR A;  3OR2 C;  3RPQ A;  2XVC A;  4B47 A;  3RYR A;  5L3C A;  3BC8 A;  4QTR A;  3PQJ A;  3OYC A;  3L2Q A;  2IAI A;  1N78 A;  2NS8 A;  2L9N A;  2EIM H;  2HXO A;  4JX5 A;  3S2D J;  1SVL A;  5F04 A;  4C9Y A;  2L2O A;  2RVC A;  4BAC A;  4BQQ A;  2PBI A;  1Y39 A;  1Y1W J;  3AL0 C;  2XDV A;  5CLS A;  1R23 A;  4I7H A;  3S1N J;  1Y8Q B;  3GFJ A;  4ENK A;  1LVK A;  1WJ5 A;  2RNG A;  2OQG A;  1VZ0 A;  4B44 A;  2YX4 A;  1YRN A;  3IH2 A;  3FBN B;  4NDL A;  2O8X A;  1BM9 A;  4D5F A;  3I0T A;  4XOP A;  2VQC A;  2V9P A;  2VLA A;  2R7X A;  3ZOB A;  2R7V A;  1SAX A;  1AOY A;  4AUX A;  5HS8 A;  1QBJ A;  2M30 A;  1TC3 C;  2PQ8 A;  2XV4 S;  1YIO A;  3SZT A;  2MD5 A;  4ON0 A;  2DW4 A;  3I64 A;  3FMS A;  3ECH A;  3LMM A;  3JRD A;  2FE3 A;  4RGR A;  2Y30 A;  1ZHF A;  4I6Z A;  5EGO B;  1JT6 A;  3IWZ A;  1X58 A;  5DD8 A;  4DJA A;  4LIT A;  3HKZ N;  1BW5 A;  2CG4 A;  1EF4 A;  1RC9 A;  2XAF A;  5M5X J;  2I5U A;  3CP2 A;  3SXY A;  4KJZ A;  5BNG A;  1XB4 A;  2DTR A;  1EH6 A;  2G7H A;  4E7H A;  1SD5 A;  3JW4 A;  2DA3 A;  4EJT A;  4U0V A;  4E7S A;  2X4H A;  1WRJ A;  1G4D A;  4L0Z B;  4HA8 A;  2LD5 A;  2HVS A;  4P9U A;  3ULQ B;  4IXA A;  4UV9 A;  3VSK A;  2F5D A;  3VYU B;  1JT0 A;  3H1C A;  1F9N A;  2FX0 A;  1T6S A;  1XDU A;  5HVQ C;  2K9M A;  1MH4 A;  1MMA A;  2FBH A;  5LHI A;  1WKM A;  1JHF A;  4GO1 A;  2ACJ A;  3H3U A;  4U88 A;  4P96 A;  2GQQ A;  2FQ4 A;  3DPT A;  5L3B A;  4UNO A;  1ODD A;  2Z9O A;  1P4A A;  2CQX A;  1XPX A;  3DEU A;  2P7V B;  2JPC A;  2CJJ A;  2HQN A;  4IQ4 A;  4PZJ A;  5CKT A;  4CIC A;  3FF5 A;  1IJW C;  3EYY A;  1G8X A;  3HZJ A;  1MIJ A;  3HB9 A;  2P7C B;  4EJV A;  4BBS J;  3NQO A;  3TW6 A;  4E7Z A;  4Q48 A;  2Z16 A;  3IWF A;  3OSG A;  2DPU A;  2DOD A;  3HGY A;  2VQL A;  3KZI C;  2DA7 A;  3KFW X;  1IZ1 A;  3W6K B;  5BPD A;  5E3M A;  4MQV A;  1FIP A;  3GBG A;  4QSH A;  2DT7 B;  2ZNZ A;  4UB8 C;  4A6D A;  5CVR A;  4A5N A;  2FOW A;  1FP1 D;  1WJA A;  2LKS A;  3W6J B;  3OS0 A;  1JGG A;  4A2U A;  2DOA A;  1FSE A;  3M3Y J;  3E97 A;  1IV8 A;  4O5V A;  4EV0 A;  1MBF A;  2XKO A;  4RM3 A;  1UB9 A;  2OBP A;  3IUO A;  2NVQ J;  4CDG A;  2Q8K A;  1JUM A;  3WGH A;  1V54 H;  2B9S A;  4LFU A;  3K4M A;  2OC6 A;  3OY9 A;  4LG0 A;  2VAS A;  1KU9 A;  1ZR4 A;  2JMW A;  4F91 B;  2ECB A;  3GTJ J;  2IEK A;  4XLH A;  1HKQ A;  5JVG F;  1OLT A;  2EIJ H;  1REP C;  2B7E A;  2CMP A;  1U2W A;  4PSW A;  3VWB A;  2M0M A;  2NNN A;  5FRM A;  2VXD A;  2F2E A;  3T0Y A;  1B8I B;  2O3F A;  3DCF A;  3IHU A;  1VND A;  3QWL A;  4DNC A;  3PO3 J;  3W2A A;  4LG3 A;  3FWE A;  2HNH A;  3R6S A;  4E7L A;  2PMU A;  2PI0 A;  1XDS A;  3B6A A;  2HTJ A;  1X3U A;  3CJR B;  2KJC A;  2KP6 A;  1HQC A;  3GXO A;  1ENH A;  2CS3 A;  1D1A A;  1EA3 A;  3LQQ A;  3LSP A;  1W5C C;  2UUZ A;  3D5S C;  1NH3 A;  1UHS A;  4XKC A;  1YIT I;  2BW3 B;  2R4G A;  3FM3 A;  3DKX A;  4F3Q A;  2HPM A;  2ME6 A;  3J7A Y;  3JSP A;  3UKG A;  3FXJ A;  3ECO A;  3BCB A;  2E1N A;  2L3D A;  4A3D J;  1K83 J;  2MC4 A;  1UMQ A;  4XLP F;  4LD5 A;  1LEA A;  4ZYD A;  4E7J A;  2ESN A;  5GAE J;  3L1P A;  1RR8 C;  4WWC A;  2XGX A;  2M9H A;  5F27 A;  4OWR B;  5K5Q A;  1O3Q A;  2VON A;  2VXZ A;  4D0P A;  5HDK A;  2LKX A;  1Y0U A;  1LNW A;  2ZME A;  2R0Q C;  1IG7 A;  2QCO A;  2P81 A;  2VPL A;  2F5F A;  3H9J A;  2ZXJ A;  2E2I J;  4GGG A;  5FGM A;  4YG2 F;  4JP0 A;  2LY2 A;  4IHV A;  1W7P B;  2LRD A;  2V79 A;  5J3L A;  4FX4 A;  1XTA A;  3GO5 A;  3AG4 H;  2H1L A;  3ZMZ A;  1TW3 A;  5ILV A;  5F6F A;  4BE1 A;  4EEF G;  3WTS C;  1OJL A;  2LBF B;  3GEZ A;  2DYR H;  2V6C A;  4D9J A;  1U0J A;  4NQW B;  2Z2S B;  3MAJ A;  3U9G A;  3CLO A;  3CMM A;  2NXN B;  1G59 A;  3IH3 A;  2ZNY A;  1XGN A;  2VC0 A;  3TP0 A;  1ON2 A;  5F0C A;  5J40 A;  5H20 A;  3CMA I;  4JYK A;  4JOM A;  2LH9 A;  3A03 A;  4PK4 A;  2YU9 J;  4HW0 A;  1DP7 P;  3KYC B;  4RLQ A;  5FD6 A;  3E3V A;  4KMF A;  2OUM A;  1YS6 A;  4RB2 C;  2HYJ A;  5F0H A;  3BJA A;  1ORK A;  2HU9 A;  1CGP A;  2QLZ A;  2MW8 A;  2HOT A;  1HW2 A;  3AG1 H;  3H9G A;  5EF6 A;  1W5S A;  4ZYA A;  1DU0 A;  3OS2 A;  1K4S A;  4UVA A;  4H4K C;  2ZSI B;  5F1R A;  1WCM J;  3F21 A;  4BH9 A;  4ZYE A;  4A3J J;  4YRV A;  1XGS A;  2DFE A;  4LB6 B;  3BTI A;  3QPT A;  1XSD A;  2EPF A;  2XRL A;  4MLO A;  1MND A;  1T0F C;  2DBB A;  3FIW A;  5B5E C;  3K7A J;  3KLO A;  3GTM J;  2KIQ A;  1MDM A;  1Z6R A;  5IYC J;  3TBI A;  1FTT A;  2ELJ A;  1XGM A;  2WAQ N;  3H0G J;  3HTS B;  5D8K B;  1VQ9 I;  1FTZ A;  2WAD A;  1QHG A;  2ZBK A;  3E6B A;  3OS1 A;  3GZ6 A;  5DV5 A;  4KA4 A;  5LD2 C;  3ZMU A;  3RKQ A;  3BTJ A;  2HOA A;  1Z7U A;  3RPU A;  5ILU A;  2JTV A;  2LVS A;  2VJI A;  3F0C A;  3KX2 A;  1IN7 A;  2CUE A;  2R7U A;  2CW7 A;  1OCZ H;  1R1T A;  1VQO I;  3QOE A;  4LIU A;  2G7U A;  5F08 A;  1W7P D;  1B6A A;  4ZH4 F;  3ESW B;  3WTU C;  4Z6Y A;  5BPI A;  2BE5 F;  2E2J J;  2IP2 A;  2LK2 A;  3JAM K;  3S3O A;  5BMZ A;  4ENM A;  1LFP A;  1MH3 A;  3IRR A;  1IW7 F;  5JLX A;  2K5C A;  3DTE A;  3G1M A;  1U78 A;  2PG4 A;  5FD5 A;  1IRG A;  2M4K A;  3Q0U A;  2EV5 A;  2FQ3 A;  2GIV A;  1XMA A;  3FDY A;  2L0K A;  2ZFU A;  2YU3 A;  5BQT A;  5FLV A;  4L5I A;  1UZC A;  4XOT A;  4BY7 J;  3E6M A;  5JHF A;  3H0D A;  5DCM B;  3JRI A;  2GZW A;  2BZT A;  3ZQF A;  3KET A;  2XUB A;  3M8F A;  4X1E A;  2OPT A;  2Z5U A;  4HV6 A;  1W36 C;  3QU3 A;  4FT8 A;  4GRI A;  2ZJ2 A;  4CYC A;  1Z6T A;  2PEX A;  2ISZ A;  1TQP A;  4XRS A;  4V19 K;  3F3X A;  1WI9 A;  3ZP5 A;  1P2F A;  4A3B J;  3ABM H;  5E3O A;  2ZKZ A;  4DOZ A;  4F55 A;  1CF7 B;  3ZGK A;  3VEP A;  1TP4 A;  1WI3 A;  3TGN A;  1T2K A;  1T56 A;  3PUF A;  5C44 J;  4B48 A;  2EZH A;  1BR4 A;  3TDU C;  3NAU A;  5L3G A;  3B6C A;  3OYH A;  1ACI A;  1B9N A;  3BQZ A;  3BJO A;  1J2X A;  3H5R A;  2KT0 A;  3PSF A;  5IP9 J;  3AAF A;  3IAM 2;  3FXK A;  2AQF A;  3PQK A;  4AID A;  1BC7 C;  2ECC A;  3TOA A;  3H5A A;  2VQG A;  5FKL A;  2QQ9 A;  3EUK L;  5E3L A;  2XAQ A;  2F6C A;  4BE2 A;  4YFX F;  5IT3 A;  2DDB A;  3E1S A;  2K4B A;  4EVI A;  5LHG A;  3WTZ A;  3DLL F;  1QPM A;  1IXC A;  4XMY A;  3KP7 A;  5DUK A;  3OL4 A;  1MD0 A;  2HI3 A;  3WTX C;  4TV7 A;  3TED A;  5E79 C;  2RQP A;  2STT A;  4G7H F;  1TWA J;  2HYF A;  2FML A;  2GOM A;  3TDZ C;  2VE9 A;  3BR5 A;  5HOD A;  1DGR M;  2DMT A;  5EGO A;  3ZMS A;  3V7C A;  3C18 A;  3AG2 H;  2G9W A;  3I56 I;  4BDY A;  1S6L A;  4XKW A;  4KNY A;  1QZY A;  3C2G A;  5LGU A;  2K7L A;  5DCF A;  3NAR A;  3ERM A;  2A3S A;  4IVN A;  4B8X A;  1BR2 A;  4R79 A;  5J1R A;  5C4X J;  1S9H A;  3N4M A;  4YII A;  3HOW J;  3BQY A;  4BJ6 C;  2Y9Y A;  1FX7 A;  2VPR A;  2Y0S A;  2GLO A;  4BJT A;  1U6G A;  2CQQ A;  3A2K A;  5D5V B;  1AKH B;  1YJW I;  5L3D A;  3D5R C;  2ETH A;  3HTU A;  2MA3 A;  1LQ1 A;  4ZC3 A;  5IT9 Z;  3SJM A;  4ENJ A;  2Z3Y A;  3ZMT A;  4IF4 A;  5EYR A;  3V7R A;  4A69 C;  1GDT A;  1SD7 A;  2OV7 A;  3BTC A;  3KIO A;  3D0S A;  3CF2 A;  5EEH A;  2HOE A;  1K79 A;  4UY8 I;  1Y8R B;  1YYV A;  3P7N A;  5DUI A;  3GW2 A;  5D6F A;  4WXD A;  3WU0 A;  1V5E A;  3DXJ F;  3K70 C;  1A36 A;  5GPC A;  3BR2 A;  3R61 A;  2NVX J;  4Y33 A;  3BR0 A;  2M8G X;  1H0M A;  4F92 B;  3EUH C;  2UV1 A;  5KAI C;  1NK3 P;  2LKP A;  2KIS A;  3L9F A;  4LGW A;  2OCE A;  3DF8 A;  2DYS H;  3IC7 A;  3MKZ A;  2M1B A;  1RR7 A;  5M5Y J;  5DDG A;  1RRJ A;  3CDL A;  2ICW G;  4PJ0 C;  4XRM A;  1ETX A;  1OFC X;  1J0R A;  4L18 B;  5K7F A;  2Y69 H;  4KIS A;  4C3J J;  2W00 A;  1VTN C;  2CU7 A;  5ICG A;  1H88 C;  2HYG D;  5DM7 F;  3VOE A;  2Z99 A;  1S8N A;  2EIK H;  3HRS A;  1OCC H;  3Q3S A;  3A02 A;  2CUZ A;  1KQ8 A;  1F36 A;  3CO6 C;  1SFE A;  2HFH A;  2V7F A;  1LFB A;  3ISP A;  2HS5 A;  2QF7 A;  3ZPL A;  1K4T A;  2DMQ A;  4HSR A;  5F64 A;  2M3A A;  3QOP A;  1GVD A;  5TRD A;  3RIR A;  4MEY F;  2RV8 A;  2RAE A;  2DJN A;  2E1M B;  3BDD A;  4PGG A;  2EZL A;  5GTI C;  4RGS A;  4XN3 A;  4XOR A;  1N25 A;  1B8I A;  3ML6 A;  1G3Y A;  3C2H A;  5K5R A;  2H6C A;  2YPR A;  5H6R A;  5CJ9 A;  2CW8 A;  4RGU A;  1Z91 A;  2AXL A;  3CDI A;  4HF2 A;  2R7R A;  1RNL A;  4MTD A;  3CCY A;  2FBI A;  4IHY A;  4IJA A;  4BDZ A;  4NUB A;  2M45 A;  4S04 A;  1T98 A;  2V9K A;  2XRO A;  2MBF A;  1HXD A;  2R92 J;  4XK4 A;  1O4X A;  1EH8 A;  1K6Y A;  2BW3 A;  2IVM A;  1IUY A;  5E1X A;  4II3 A;  1FIA A;  2X51 A;  4ZJZ A;  1ZG1 A;  2KRH A;  2UXX A;  4IRI A;  2PX9 A;  2L54 A;  1I5Z A;  2E1M C;  4UVC A;  4GDF A;  5B1B H;  4GYI A;  4MFE A;  4BQO A;  2E7W A;  2A07 F;  3CJQ B;  4CA0 A;  2JZY A;  3KEQ A;  1NG6 A;  3L00 A;  2DA5 A;  4BE0 A;  4IHT A;  3MZY A;  1HST A;  2O9L A;  5HLG A;  3Q9V A;  4CCO A;  1RES A;  1Z7L A;  3ZQG A;  4FIS A;  4EMS A;  4CXF A;  2RC4 A;  4U87 A;  4WCG A;  5J4Y A;  3FIS A;  4Q4Z F;  1XG1 A;  1MZB A;  3P9C A;  3ABU A;  2F4M B;  4CO8 A;  2CUJ A;  2JA6 J;  3CCJ I;  1SEU A;  1SD6 A;  1MMG A;  1W7P A;  1TQI A;  2DK8 A;  2Z1D A;  2JVH A;  1BJA A;  1IUF A;  1WJB A;  1U5T B;  4P55 A;  2L02 A;  4ESJ A;  3CUQ B;  4ESF A;  2LBF A;  4HLX A;  4N9I A;  2XPV A;  5DD4 A;  4NQW A;  2PJR B;  3GLX A;  4V2G A;  1IF1 A;  3EUA A;  2LSO A;  4IOA F;  3I5U A;  1RPW A;  4S05 A;  4RDU A;  1TWH J;  5GAG J;  4AIJ A;  4M72 A;  2L9R A;  1LPQ A;  1TNT A;  2Y48 A;  3G1O A;  4FET A;  3AL0 B;  4A3G J;  5AIP A;  3PIO F;  2W85 A;  3K4L A;  3KCC A;  2LNB A;  2H09 A;  3RZD J;  1W0T A;  1TBX A;  1VQK I;  3LAJ A;  1JE8 A;  3FKI J;  1Y6I A;  3LWF A;  1BI2 A;  3FHN A;  3KP5 A;  4B4C A;  1AWC A;  3ONQ A;  4DGW B;  4UUV A;  3CUQ C;  3QQA A;  2JPB A;  3K4B A;  1X1D A;  3C1D A;  5CQG A;  2X6Y A;  2XGE A;  1FBS A;  3CF5 F;  4EAT A;  2NOG A;  3D1N I;  4HST A;  3HSE A;  1GHC A;  1ZN2 A;  2KIM A;  3DV8 A;  2DMN A;  3HC7 A;  1OCR H;  2KIU A;  4BXF A;  2H8W A;  2K4J A;  2A5Y B;  4UV8 A;  3R0A A;  3W2W A;  2GA2 A;  4ABZ A;  4I76 A;  4L9T A;  2EA2 A;  1LDK B;  4H0E A;  2QZ8 A;  1A5J A;  4BHB A;  3IKV A;  2EWN A;  3ZXS A;  1KU2 A;  4XL9 A;  4XSZ F;  3F8M A;  3A01 B;  5D4S A;  2DU9 A;  2D45 A;  1TQM A;  2BVL A;  3M07 A;  1JKO C;  5JI6 A;  2L9V A;  4KT5 C;  2LY1 A;  3K10 A;  1XCV A;  3X2Q H;  3RPU D;  3QRF F;  4PJM A;  4N4O B;  2R7Q A;  2PLY A;  1DGW Y;  3HPH A;  1X1C A;  4BKX A;  1SVO A;  1UJ8 A;  3J81 K;  4M6Y A;  4ANJ A;  1F43 A;  5HDG A;  3OYD A;  2QA4 I;  1HA8 A;  1X19 A;  1I50 J;  5E17 F;  4P9F A;  2JN6 A;  2H6B A;  1TNS A;  3BG9 A;  3HM5 A;  1O3S A;  3ZRG A;  2VKD A;  5B3S H;  1QZZ A;  2HQA A;  2J5O A;  3HUG B;  4L5J A;  4RA2 A;  1EH7 A;  2GXA A;  3KP3 A;  1TWC J;  1MMS A;  3SDB A;  4AU7 A;  3K1M A;  2GXB A;  5DCM A;  4BQN A;  3HOY J;  3M8E A;  4KMU X;  2VC1 A;  3OR1 C;  1ETO A;  2JRM A;  3F22 A;  2J5P A;  3J80 K;  1KU7 A;  2D5V A;  1VQ7 I;  2K3F A;  3SEZ A;  3VPR A;  2KQR A;  5FFZ A;  3LSG A;  2KDZ A;  2ZO4 A;  4WK8 F;  3W6V A;  1VQP I;  1BJZ A;  1CF7 A;  4BY1 J;  2E71 A;  1I27 A;  3LSI A;  1OR7 C;  4XRF A;  3CCV I;  4HX4 A;  3T8R A;  2JVG A;  2VJ4 A;  2E1C A;  1Z67 A;  2M87 A;  2R3S A;  3V8L A;  2BOL A;  3PNY A;  2QQA A;  1MBE A;  5ICC A;  2E19 A;  4IO9 F;  4G12 A;  5M3F J;  1P7I A;  3HGG A;  4HQM A;  3VSL A;  3IH4 A;  4LMY A;  4JX4 A;  1GV5 A;  2TRT A;  4X0G A;  1MMN A;  3PFY A;  2X9D A;  2MLG A;  2L01 A;  4RB1 A;  1E0E A;  2QUF A;  5HS7 A;  4XON A;  3TO6 A;  2DA6 A;  4PJL A;  2KIF A;  3CCU I;  1RUO A;  2O0Y A;  1R22 A;  2DMP A;  2R5Y B;  4IHS A;  2CQK A;  4AIK A;  4EJW A;  5GP9 A;  1X1P A;  2PMZ N;  2WAF A;  3ABK H;  4XSX F;  1G2H A;  4HDV A;  3TOB A;  1GV2 A;  4HDU A;  4PDK A;  5JLW A;  3DTK A;  2OCC H;  2R7F A;  1ETY A;  3S93 A;  1OCP A;  1IXR C;  3HIF A;  4Q5S F;  4BJ5 C;  1LB2 A;  4M3B A;  1ERD A;  3U21 A;  1ZRC A;  4F7Z A;  1HDD C;  1BL0 A;  2X1C A;  1O3T A;  3FZV A;  3HOU J;  2FD5 A;  3KP4 A;  2BV6 A;  1ULY A;  2BGC A;  3K2Z A;  3LA2 A;  1IAW A;  3ASO H;  4HYE A;  3WU1 B;  2IW5 A;  4WX9 A;  1WJD A;  1E17 A;  3DPU A;  1ZGA A;  2CQN A;  1IXS B;  3CJT B;  4L5E A;  4ZYG A;  1D1B A;  1XN7 A;  3CC2 I;  2HZD A;  3CZ6 A;  1OQY A;  3SDG A;  4DIQ A;  3IL2 A;  5J8F A;  1YS7 A;  3EUH A;  3RKY A;  1YOV B;  1FYK A;  3JRG A;  2EIL H;  3MVP A;  1AKH A;  3QU6 A;  1L0O C;  3ZN1 A;  3KEO A;  5AON A;  3J7Y J;  3ZQL A;  2DMU A;  3BG3 A;  1SFK A;  5KNL A;  5GPA A;  4DYR A;  2KMU A;  3BG7 A;  1I6H J;  5EZG A;  2UXN A;  4G8X A;  3K4N A;  3TO9 A;  3TP3 A;  1FOK A;  2HQ5 A;  4ITV A;  4CUG A;  1ZRE A;  2AQE A;  2Y9Z A;  4IHW A;  1WH7 A;  5EDN A; 
#chains in the Genus database with same CATH homology
 2NS7 A;  4X1E A;  2EH3 A;  2OPT A;  1VI0 A;  3BG5 A;  2HXI A;  1VFC A;  3BT9 A;  4CYC A;  1ZQ3 P;  2XGD A;  2TCT A;  3G1L A;  5K7Z A;  4MFD A;  4XRS A;  4A3B J;  2K9Q A;  2W48 A;  5E3O A;  3BR6 A;  3E7L A;  4M3F A;  1WI3 A;  5EG0 B;  3LSR A;  1T56 A;  3OOU A;  5C44 J;  4DYQ A;  2EZH A;  1QRY A;  2N8G A;  3NAU A;  3O8H A;  3B6C A;  3HOX J;  3BQZ A;  2O8K A;  5J1U A;  1A6I A;  2O7O A;  2KT0 A;  5IP9 J;  2DA2 A;  2E2H J;  5F0F A;  2ECC A;  4A93 J;  5M3M J;  5FKL A;  4HNV A;  2HDD A;  4FTH A;  5E3L A;  1H8A C;  3LSJ A;  1TWF J;  3CMY A;  4A3M J;  2DA4 A;  2EBI A;  1ETW A;  3JRA A;  2R93 J;  2R7Z J;  2WB1 N;  5IP6 A;  2HI3 A;  4DW6 A;  1SFO J;  3TED A;  4A3E J;  1APL C;  2JK3 A;  1MSE C;  1ZTR A;  4IEJ A;  4LOC A;  1TWA J;  4FE7 A;  3BR5 A;  2XPU A;  5HOD A;  1X2N A;  1IRZ A;  2DMT A;  2ID3 A;  4D7N A;  5EGO A;  3TW7 A;  4GFB A;  3MKL A;  4XIC A;  1RET A;  2X6O A;  2Y0S N;  2DA1 A;  2JA5 J;  4X6A J;  4JX6 A;  1IGN A;  1HCR A;  2XGC A;  5FKO A;  1LE8 B;  3NAR A;  1OCT C;  1LFU P;  2IBD A;  2H8R A;  5J1R A;  1U8B A;  5C4X J;  1BW6 A;  3HOW J;  5FKM A;  1B72 B;  3BQY A;  3SFI A;  1JKP C;  1D5Y A;  1Z0X A;  2Y9Y A;  2VPR A;  3WHB A;  5E3N A;  2GLO A;  4BBR J;  3O8G A;  2CQQ A;  1AKH B;  2AHQ A;  3SJM A;  1ZKG A;  4IHX A;  1JKR C;  3FK6 A;  1JTY A;  3PM1 A;  5EYR A;  4A69 C;  2VKV A;  1GDT A;  3ZQH A;  1S7E A;  1IDY A;  2JA7 J;  3BTC A;  1VF9 A;  1JJ6 C;  3RQI A;  1CQT A;  4XRS G;  2LFB A;  1AU7 A;  1GUU A;  4B1R A;  4Y7N J;  4AYB N;  4D5C A;  2G0E A;  4S0H B;  2MGQ A;  5GPC A;  3BR2 A;  1Y1V J;  2NVX J;  3BR0 A;  2M8G X;  4C2M J;  2CRG A;  3LNQ A;  1NK3 P;  4CYC B;  3I4M J;  3K2A A;  5EEA A;  1RR7 A;  5M5Y J;  4QTR A;  3CDL A;  2IAI A;  2NS8 A;  4XRM A;  1ETX A;  1OFC X;  2HXO A;  4JX5 A;  3S2D J;  4A3C J;  4M3G A;  2XB5 A;  5F04 A;  5K7F A;  3QPL A;  4C3J J;  4A3F J;  1Y1W J;  2CU7 A;  5C4J J;  1H88 C;  3HOZ J;  4MO7 A;  3S1N J;  1WGX A;  4C3H J;  1YRN A;  4D7M A;  3IH2 A;  3A02 A;  3Q3S A;  3S14 J;  1F36 A;  4NDL A;  5M5W J;  1WPK A;  2I10 A;  4D5F A;  3FK7 A;  3S1R J;  1LFB A;  1WH5 A;  1ETV A;  2QF7 A;  3ZOB A;  2DMQ A;  4AUX A;  1GVD A;  1QVT A;  3M4O J;  1TC3 C;  3HBL A;  1T33 A;  2XPW A;  2RAE A;  2DJN A;  1RKW A;  1FEX A;  2EZL A;  3CQZ J;  1JUP A;  1B8I A;  4DYC A;  3OSF A;  3IV5 A;  5FLM J;  5K7H A;  3JRD A;  2Y30 A;  3CCY A;  4I6Z A;  5EGO B;  5EZH A;  4IHY A;  1JT6 A;  1X58 A;  3A01 A;  3OIO A;  3HKZ N;  1BW5 A;  1EF4 A;  1HOM A;  1ZR2 A;  5M5X J;  2R92 J;  4XK4 A;  1O4X A;  4A3I J;  5BNG A;  3JRH A;  1FIA A;  2CUF A;  2DA3 A;  2EQR A;  2L7M P;  1FJL A;  5FJ8 J;  2LD5 A;  2Y2Z A;  2LP0 A;  3Q0V A;  1MBK A;  2ME0 A;  4MFE A;  2R5Z A;  1JT0 A;  3HEF A;  2DA5 A;  1HF0 A;  1X2M A;  2FX0 A;  1MH4 A;  2O9L A;  1MSF C;  2H1K A;  1RES A;  3ZQG A;  4FIS A;  2FQ4 A;  1UG2 A;  2K9S A;  3FIS A;  2XB0 X;  4XID A;  1XG1 A;  2CQX A;  2CJJ A;  1IJW C;  2JA6 J;  1IC8 A;  3PO2 J;  1Z77 A;  3HB9 A;  1NTC A;  1P7J A;  4BBS J;  1IUF A;  3TW6 A;  4V2F A;  4M3E A;  3OSG A;  5IYB J;  3HGY A;  1MBG A;  3S17 J;  2DA7 A;  2XPV A;  5E3M A;  4QIW N;  1FIP A;  3GBG A;  4QSH A;  4V2G A;  3H3V K;  3ZQC A;  1RPW A;  1NK2 P;  2MG4 A;  3QPS A;  4RDU A;  1GT0 C;  1TWH J;  1JGG A;  2L9R A;  3M3Y J;  2VKE A;  3S1M J;  3G1O A;  2OF7 A;  1MBF A;  4A3G J;  4AC0 A;  1AHD P;  2LLK A;  4J19 A;  2NVQ J;  1JUM A;  4M3D A;  1W0T A;  4FCY A;  3RZD J;  5IYD J;  3FKI J;  1ETQ A;  1MBJ A;  1YRN B;  1ZR4 A;  2HOS A;  4B4C A;  2JMW A;  2ECB A;  2E1O A;  2LTP A;  4M6V A;  2IEK A;  3QQA A;  4MIM A;  3GTJ J;  2R5Y A;  1XS9 A;  3JRF A;  2XGE A;  3BR1 A;  1SAN A;  2ELK A;  4Y52 J;  2NOG A;  3D1N I;  2M34 A;  1B8I B;  2DMN A;  3DCF A;  1VND A;  3PO3 J;  4ABZ A;  4I76 A;  1HDP A;  3JRE A;  1HLV A;  1A5J A;  3B6A A;  3A01 B;  1R9T J;  3GTQ J;  1ENH A;  1JKO C;  1JTX A;  3LSP A;  3GTO J;  1UHS A;  3C2B A;  5FKK A;  2DTZ A;  2COB A;  2DN0 A;  4BKX A;  5IOZ A;  2ME6 A;  3JRB A;  3UKG A;  1PUF A;  1F43 A;  2M2E A;  4A3D J;  1K83 J;  1UMQ A;  4W97 A;  2R5Z B;  2XSD C;  1I50 J;  4DZJ A;  2JN6 A;  2MSY A;  2NVY J;  5DTD A;  2GM4 A;  3BG9 A;  3HM5 A;  4UUS A;  3L1P A;  1JJ8 C;  2WV1 A;  1MNM C;  2M9H A;  5F27 A;  2VUM J;  4BXX J;  1IDZ A;  2LKX A;  1IG7 A;  2R0Q C;  1TWC J;  1K61 A;  2QCO A;  2P81 A;  3HDD A;  1U9O A;  3HOY J;  2E2I J;  2ID6 A;  4JP0 A;  1ETO A;  4IHV A;  5J3L A;  3GTG J;  2M0C A;  2D5V A;  3LOC A;  3VPR A;  3LSG A;  2K9N A;  2L7Z A;  1ZGW A;  4EEF G;  2KDZ A;  1OJL A;  1QPI A;  3JRC A;  3W6V A;  1BJZ A;  4BY1 J;  1QVU A;  4C3I J;  5EG0 A;  1Q1V A;  3IH3 A;  3TP0 A;  3S1Q J;  5F0C A;  4JYK A;  3S15 J;  3I4N J;  3A03 A;  2YU9 J;  2L7F P;  5IOY A;  4A3K J;  2NVT J;  2EZI A;  1ITY A;  1MBE A;  1W0U A;  2E19 A;  2HYJ A;  3S16 J;  4G12 A;  5F0H A;  1ORK A;  1P7I A;  3HGG A;  5M3F J;  3IH4 A;  4W1U A;  3DEW A;  2MW8 A;  1GV5 A;  2K40 A;  2TRT A;  4JX4 A;  2HOT A;  3HOV J;  2B63 J;  5EF6 A;  2Y31 A;  1DU0 A;  2X9D A;  2EZK A;  1WCM J;  2JA8 J;  2DA6 A;  4A3J J;  3BTI A;  4B3A A;  2R5Y B;  2DMP A;  2XRL A;  4MLO A;  5GP9 A;  2PMZ N;  4UUT A;  1G2H A;  3FIW A;  3K7A J;  1POG A;  3GTM J;  1GV2 A;  5J1Y A;  2YUS A;  5JLW A;  5IYC J;  3GTP J;  1FTT A;  2WAQ N;  3H0G J;  3ZQI A;  1ETY A;  3Q0W A;  1OCP A;  1FTZ A;  1JKQ C;  2AO9 A;  3GTL J;  4M3B A;  5IPA A;  1HDD C;  1BL0 A;  3HOU J;  5FKN A;  2FD5 A;  1ZK8 A;  3BR3 A;  3RKQ A;  3BTJ A;  2JWT A;  1IV6 A;  4RBO A;  2HOA A;  1E3O C;  1LE8 A;  2LVS A;  3F0C A;  5DS9 A;  1RKT A;  2CUE A;  2ZB9 A;  1DU6 A;  1I3Q J;  4L5E A;  3S2H J;  4FE4 A;  2LY9 A;  3SDG A;  5F08 A;  2LR8 A;  1PUF B;  3BTL A;  1B72 A;  1ETK A;  3JRG A;  2E2J J;  9ANT A;  2LK2 A;  1U9N A;  1XC5 A;  2JJ7 A;  1TWG J;  1JUS A;  3MVP A;  3JR9 A;  1AKH A;  1BA5 A;  1MH3 A;  2FJ1 A;  5JLX A;  3ZQL A;  2DMU A;  3G1M A;  4UUS B;  1U78 A;  4A3L J;  3BG3 A;  2VI6 A;  5IP7 J;  5F1J A;  3Q0U A;  5C3E J;  5GPA A;  4DYR A;  4DZP A;  3WHC A;  2GBY A;  3GTK J;  2L0K A;  1I6H J;  5EZG A;  2X48 A;  5FLV A;  1MBH A;  3MN2 A;  3TP3 A;  3RZO J;  1H89 C;  4BY7 J;  2HQ5 A;  2YS9 A;  3JRI A;  2Y9Z A;  4IHW A;  3ZQF A;  1WH7 A;  5EDN A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...