2R5ZA

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
75
Chain Sequence
KKNPPQIYPWMKRVHLRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 25
structure length 75
sequence length 87
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zA00
4FE4A 2R7ZJ 1BW5A 5EYRA 2O7OA 1I3QJ 1ORKA 3FIWA 3HM5A 5EEAA 1BA5A 4JX6A 1FIAA 5C44J 1FEXA 2GBYA 2XGDA 4D5CA 3VPRA 1JUPA 4A3EJ 2NVQJ 4BXXJ 1RKWA 4JP0A 3NAUA 4C3IJ 4FE7A 4BBRJ 1QRYA 5IOZA 2YU9J 4GFBA 3HB9A 2K9QA 2ECCA 3LSGA 3S16J 4FTHA 1QVUA 3HBLA 3IH3A 4V2FA 2ME0A 3JRFA 5IP7J 1MSFC 4QTRA 4A3DJ 2XB5A 1IGNA 4D5FA 2IEKA 2HOSA 3OIOA 1Q1VA 3QQAA 4RBOA 1XG1A 3ZQIA 1ETXA 3BG9A 3CDLA 2DA7A 4CYCB 1MH4A 1ENHA 3Q3SA 4X1EA 1GV2A 5EGOB 1Y1WJ 2JN6A 3K2AA 5M5YJ 2ID3A 1IG7A 2D5VA 2O8KA 2LP0A 5E3MA 2LTPA 3W6VA 2NOGA 4A3GJ 5J3LA 3MN2A 3TW7A 3BR0A 2DMUA 4A3JJ 2YS9A 1SANA 1NTCA 2JK3A 3G1LA 1RR7A 4MLOA 3FISA 3BQZA 4QSHA 4HNVA 1NK3P 3I4MJ 4A3BJ 3BR1A 2H8RA 4B4CA 4W1UA 1U9OA 2YUSA 2LKXA 1G2HA 3IV5A 2X48A 4CYCA 1T56A 2HYJA 2HOTA 1EF4A 2WB1N 3IH4A 5EGOA 1RPWA 3QPLA 3OSGA 2EZKA 1Z77A 3JRIA 2XB0X 5E3LA 1ETQA 3O8GA 4AUXA 5IYCJ 1OCTC 2MSYA 1RESA 2DTZA 3F0CA 3PM1A 1JJ6C 1WCMJ 4BBSJ 2X6OA 2B63J 1P7IA 1TWAJ 1R9TJ 3S2HJ 1S7EA 1GV5A 4BKXA 5DS9A 1ETKA 1ZR4A 5HODA 2DN0A 2EZLA 3GBGA 2N8GA 3BTLA 4B3AA 4AC0A 2DMNA 1FTTA 3NARA 2E1OA 2VKEA 3SDGA 1ZKGA 3GTMJ 1GVDA 2ELKA 5FKOA 1DU0A 1UMQA 2DA6A 1QPIA 1UHSA 2AHQA 1OCPA 4RDUA 1QVTA 1VI0A 2R93J 4M6VA 4A3CJ 5F0CA 3BR3A 1IV6A 1WPKA 4XRSA 2CU7A 3SJMA 4DYCA 2R92J 3A02A 1IRZA 3HOWJ 2Y9YA 1ITYA 3JREA 1SFOJ 3ZQCA 3GTJJ 2M9HA 4C3HJ 4JX4A 3G1OA 1O4XA 2H1KA 1MBGA 5C4XJ 1JT6A 4A69C 1ZR2A 1ETVA 1XC5A 3JRGA 1W0UA 3MVPA 3B6AA 3MKLA 1BW6A 5K7FA 2MG4A 1OFCX 4A3MJ 4I6ZA 4XICA 5FJ8J 1K61A 3DEWA 1JJ8C 1TWCJ 3DCFA 3JRCA 1HCRA 2DMQA 1YRNB 3WHCA 2JA8J 4S0HB 4EEFG 2QF7A 4I76A 3H3VK 5M3MJ 2Y9ZA 2GM4A 3E7LA 2NS8A 3BTCA 1B8IA 1LFBA 3S17J 3LSJA 1OJLA 3ZQLA 2COBA 2NVTJ 1JUSA 4Y52J 4BY7J 3BR2A 2KDZA 3S1QJ 1WI3A 1F43A 1DU6A 1FIPA 2K40A 3RZOJ 2HQ5A 2XPVA 1MBHA 2HDDA 1BJZA 1YRNA 3ZQHA 3JRBA 3GTOJ 4BY1J 4A3LJ 4ABZA 3Q0WA 2K9NA 2LFBA 9ANTA 3HGYA 2CQQA 3BTJA 1JT0A 3TEDA 4IHWA 5M5WJ 3JRHA 2M2EA 4DYQA 1JUMA 3HEFA 5M3FJ 2PMZN 5IYBJ 5F0FA 5GPCA 2FD5A 1P7JA 5F0HA 2HXIA 2DA3A 3GTLJ 4QIWN 2VKVA 1MBFA 3FK6A 2NS7A 5F27A 2OPTA 1VF9A 2P81A 2EQRA 1F36A 1WGXA 5M5XJ 1JKQC 1GDTA 2VUMJ 2FQ4A 3TP0A 2ZB9A 4XRMA 5EG0B 2CQXA 2HXOA 5EF6A 2XPUA 4FCYA 3BG3A 3Q0VA 4M3DA 3M4OJ 3GTQJ 2W48A 2I10A 5FLVA 1HDPA 2XGCA 3UKGA 5DTDA 4A3KJ 2WV1A 2VI6A 5F04A 3BG5A 1MBJA 2LY9A 2MW8A 4D7MA 2L7FP 4A3FJ 1TWHJ 3Q0UA 3FKIJ 3S1MJ 5EG0A 1X2NA 1APLC 5IP6A 1ETYA 3C2BA 5FKNA 3ZQGA 1ZQ3P 1Y1VJ 5F08A 2R5ZB 2IBDA 2Y0SN 2E2HJ 5F1JA 5JLXA 4W97A 3HGGA 2CUEA 1PUFB 3RQIA 5IOYA 4XIDA 1RETA 2DA2A 2E2IJ 3BR5A 1HLVA 3IH2A 3A03A 3RZDJ 3GTPJ 3O8HA 4XRSG 3BTIA 1JTXA 4UUSB 1MSEC 3B6CA 4IEJA 2EH3A 2R5YB 1B8IB 2JA5J 3HDDA 3OSFA 3BR6A 3WHBA 1TWGJ 2R5ZA 1H89C 4V2GA 2R0QC 4M3EA 3CCYA 1PUFA 5E3NA 2HOAA 1LE8A 1U8BA 2LR8A 2L7MP 2EZHA 4DZJA 2X9DA 4JYKA 2O9LA 2RAEA 2XGEA 3LNQA 4IHVA 4A93J 4NDLA 2E19A 3HOYJ 3S14J 5FKKA 4UUSA 5EZHA 4DYRA 4MO7A 2QCOA 2M0CA 2VPRA 4UUTA 4C3JJ 2R5YA 3I4NJ 3S2DJ 2LVSA 2LLKA 4A3IJ 2JWTA 1NK2P 1HOMA 1ETWA 3HOUJ 4XK4A 1X2MA 3LOCA 2JA6J 3ZQFA 1D5YA 2G0EA 2DJNA 2LD5A 1A6IA 2GLOA 5J1UA 1H8AC 2CUFA 1MBKA 1FTZA 5J1RA 3D1NI 4M3BA 3RKQA 5FKMA 5IP9J 2JA7J 1ZGWA 2JMWA 2NVYJ 1UG2A 4DW6A 5JLWA 1A5JA 1AU7A 1ETOA 1GUUA 3JR9A 5K7HA 1BL0A 3S1NJ 1JTYA 1HF0A 1Z0XA 1ZK8A 1AKHB 3GTKJ 1RKTA 2Y30A 5IPAA 1IC8A 2XPWA 3LSPA 5C4JJ 1POGA 2XRLA 3BQYA 2DA1A 3H0GJ 5EDNA 1MNMC 3L1PA 1VFCA 2EZIA 2ME6A 3FK7A 4L5EA 2Y2ZA 2DA5A 1W0TA 3G1MA 3OOUA 1TC3C 3JRDA 3JRAA 1X58A 2IAIA 1I50J 1JKOC 2LK2A 2L7ZA 4MIMA 2TRTA 3K7AJ 2WAQN 1B72B 4FISA 2KT0A 1T33A 2TCTA 1JGGA 1AKHA 3SFIA 1VNDA 2CJJA 2AO9A 2FX0A 3M3YJ 1K83J 2FJ1A 1XS9A 1JKRC 1CQTA 2OF7A 5FKLA 3S1RJ 5GP9A 1ZTRA 3A01B 4MFDA 1H88C 1MBEA 4IHYA 3ZOBA 1JKPC 2ECBA 4Y7NJ 3PO2J 4X6AJ 2L0KA 1HDDC 2M34A 3HOXJ 2M8GX 5E3OA 2Y31A 1B72A 1IUFA 3HOZJ 4B1RA 4DZPA 4MFEA 5J1YA 2E2JJ 1U9NA 4G12A 1FJLA 4IHXA 3HKZN 2HI3A 1E3OC 2NVXJ 3A01A 3TP3A 3HOVJ 1TWFJ 1LE8B 2K9SA 5BNGA 3CQZJ 2EBIA 4J19A 4M3FA 1WH7A 4D7NA 5FLMJ 1AHDP 4JX5A 4AYBN 4LOCA 1MH3A 3TW6A 1IJWC 3QPSA 3GTGJ 5C3EJ 1IDZA 5K7ZA 2JJ7A 3LSRA 4M3GA 3CMYA 1GT0C 5IYDJ 3BT9A 2CRGA 2XSDC 1LFUP 5EZGA 2MGQA 2L9RA 3PO3J 1U78A 4C2MJ 2DMPA 1WH5A 1I6HJ 1IDYA 3S15J 2DMTA 2DA4A 2ID6A 5GPAA
chains in the Genus database with same CATH superfamily
1Z7UA 3GLXA 2R7ZJ 5EYRA 3C3WA 2L3DA 4CZCA 1ZH5A 3K0LA 2OCCH 1R00A 3OIPA 1I3QJ 3QU3A 4KISA 1BA5A 2RREA 3PFIA 4BHPA 5CVRA 3VPRA 4BXXJ 3F6OA 4JP0A 5DCMB 4M6YA 1LQ1A 4LGWA 1P6RA 3FXJA 3EDPA 2CSOA 4Q47A 3DEUA 5KHDA 2HU9A 4RAFA 2K9QA 1XSVA 3D0SA 2VT2A 4Y4RA 1Z6RA 1QVUA 2WY8Q 1QNTA 4F7ZA 2J5OA 2ME0A 1IRFA 3IL2A 1MSFC 2IPQX 1RZ4A 1ZLJA 2DYSH 5H6RA 1SD6A 2RVCA 2IGKA 4HLYA 3RCOA 2XROA 1PUEE 3JSPA 1FBQA 2IGMA 3MCZA 3QQAA 1FBUA 3VSKA 4A5NA 2DOEA 2DOFA 2DA7A 2R4GA 1MH4A 4II2A 5D5VB 1OKRA 3QODA 1Y1WJ 1TLHB 5M5YJ 2ID3A 2D5VA 5E1WA 3W2WA 2P6SA 3FZVA 3BZ6A 4HSTA 3DKWA 3GLLA 1ZYRF 1K78A 2VJ4A 4HF2A 1NTCA 2CQKA 3P5JA 3WG9A 2GOXB 3BQZA 1NK3P 1FZPB 1BJAA 4E7SA 1W7PD 3BCAA 2YUSA 4KIFA 3WODF 1FX7A 1WRJA 2KQRA 1A35A 2MC4A 2K3PA 4C30A 4CYCA 2HOTA 1YOVB 3OL4A 1R1TA 4BDYA 3EYIA 3IH4A 4RAGA 5EGOA 1VQ6I 1T98A 3OSGA 3A0BC 1Z77A 3JRIA 4BE2A 1HSTA 2M7AA 1ETQA 1XSXA 3O8GA 4F55A 1S5LC 1Q1HA 3VYUB 1MJBA 4AM3A 1WCMJ 4BBSJ 2X6OA 2RKHA 3KP5A 3CCJI 1P7IA 4HV5A 3RJPA 4XLCA 1S7EA 4BKXA 3OYCA 2BYVE 3K4MA 4UHTA 5HODA 4RGXA 1OR7C 5JR3A 5KAFC 3VYSB 4F92B 2DN0A 3OYLA 3BTLA 4XSZF 3J81Z 4B3AA 2DMNA 4U0VA 1FTTA 5EEHA 2STTA 1PP7U 5L3GA 3GTMJ 1FOYA 3RKXA 1GVDA 2HFHA 4L9NA 4RLQA 4E7JA 5CLSA 2DK5A 4L5IA 3OR1C 1QPIA 3FDYA 3GFLA 4P5OA 2GXAA 2AHQA 3K1PA 1QVTA 2Y0MA 1UG0A 2BGCA 3BR3A 3LA2A 5J47A 3LQRA 2CU7A 1Z3XA 2PX9A 2EPFA 5ILSA 2CH0A 1XTAA 1D0ZA 1ZGAA 4N0BA 2F5FA 3I71A 2X1CA 2M9HA 1IXSB 4ZC3A 4C3HJ 1DUXC 4RGRA 2LKPA 1XGNA 5L3CA 3GF2A 3E0JB 1JT6A 3SZTA 1BM9A 4FETA 4EJUA 2KMUA 1B59A 1YX3A 3MKLA 1BW6A 2QZ8A 1G8XA 2W82A 2MG4A 4XBFA 1BIBA 4YRVA 5LRSA 2JZYA 2OU2A 4AD9A 5FJ8J 1K6OA 2QSGX 5HS8A 4QLCU 1K61A 1J09A 1WJ5A 1Z05A 4XMYA 3OY9A 1TWCJ 2PMHA 3TO6A 2YU3A 3JRCA 3E6BA 2DMQA 2D1HA 1FLIA 1X4OA 2LBFA 3MZHA 1E3HA 2GZWA 2P7CB 3RTRA 2VE9A 2KZVA 3BTCA 3I59A 3K2ZA 3ZR8X 1VQ4I 2OCEA 1B8IA 1BR4A 3S17J 3LSJA 5TGTA 1JUSA 1XGSA 1S6LA 1D1BA 1X4PA 4H0EA 2KDZA 3KP7A 4LG0A 3S1QJ 4Q5SF 1WI3A 2MABA 2L4AA 2A05A 5TISC 2E5NA 1DU6A 2K40A 2DQLA 1ZELA 4ETSA 2XPVA 4AU7A 1YRNA 3FXRA 2ISYA 3GTOJ 3RKYA 4A3LJ 4ABZA 4IOCF 2K9NA 2DPUA 4ESJA 2LH9A 1X3UA 2L9NA 9ANTA 5J40A 1FYMA 3HGYA 3TOBA 1TQMA 3FHZA 4KT5C 3RPUD 1JT0A 2E5ZA 4XKCA 5L3EA 2LREA 4BJ5C 4DQ2A 5HNFA 4GYIA 5E1ZB 2WB1A 1W36C 6PAXA 3WGHA 1A36A 4XLFA 2VXZA 4G6DA 2G7HA 3HEFA 3IUOA 3CMMA 3H0DA 5IYBJ 1E0EA 3CCEI 1ERDA 2HXIA 4ZYAA 2E1CA 4LB6B 2DA3A 3CP8A 4KJZA 4QIWN 2WWYA 4QPOA 2OUMA 3OYIA 3FK6A 1KU7A 2P81A 2BY0A 2EQRA 3K10A 4OIRF 4CCMA 2DXIA 2DW4A 2DFFA 4PGGA 2ZB9A 3HHHA 4GYGA 4I01A 1BI0A 3FMRA 1VTNC 2XGXA 3FWEA 2HXOA 1YITI 5FO5A 1LVAA 2GA1A 3ERMA 3I5UA 3DP7A 3KP4A 3BJ6A 4RB0A 3GTQJ 1RR8C 4BE1A 1FSEA 2W48A 2V1NA 3UKGA 2CWEA 2Z3YA 4OWRB 4A5MA 2Z99A 4N4OB 3EUAA 1SMYF 5F04A 3DPTA 4IOAF 2R7SA 3ZMTA 2MW8A 4CCNA 1IN5A 2O8XA 2P7VB 3M8JA 3LL7A 2QVOA 4EM1A 3FKIJ 3KZYA 2O03A 3E6CC 3S1MJ 1FYLA 1HKSA 4M73A 5AIQA 2ZJQF 1UHMA 4CCJA 1VQ9I 2ADUA 5FKNA 4ZZDA 4EJTA 3Q9VA 2R5ZB 4IX7A 4A0XA 1HA8A 2K3FA 3E1SA 5F1JA 3GO5A 2W57A 5JLXA 3HGGA 2CUEA 1D8KA 4B09A 3RQIA 4C9YA 3TDZC 2F2EA 3I3LA 3CCSI 3SYTA 3IAS2 3BR5A 3V4GA 3WTZA 3KEOA 2EV0A 2D1VA 3ZCOA 4KT6A 2E7XA 3DEEA 4A6DA 5CPRB 2P6TA 1PVEA 3ECOA 4PJLA 4WF2A 4IEJA 2DLLA 3GFMA 2IA1A 3PSIA 1FMWA 2JA5J 2DT7B 3HDDA 2QM3A 3OSFA 1OYYA 1OCCH 1H89C 4NC7A 4YFXF 1G6NA 3CCYA 2MLKA 2A5YB 1LE8A 4I02A 3ONQA 1G3WA 3ECHA 3ULQB 2LR8A 3P9IA 1G3YA 3K70D 2JUGA 3W2AA 2X9DA 5KAIC 2O9LA 1IRXA 1C0WA 3ABUA 3PSFA 2IS2A 1BBYA 1AWCA 4A93J 2I8DA 3SEQA 5HS9A 5EZHA 3OYDA 1VQ5I 2IP2A 2XKPA 3DPUA 3S2DJ 2ZCWA 2LVSA 2OD5A 1QA6A 4LIVA 1NK2P 2JWTA 4RLFA 1ETWA 3DLAA 3HOUJ 3ZQFA 1D5YA 2LD5A 1V55H 2OZ6A 3A4CA 2DU9A 3C18A 2CUFA 3K69A 3M9AA 1XPXA 2ZSHB 2ZJ2A 4XL9A 5J1RA 3RKQA 1N75A 5FKMA 3OYGA 5BQTA 2RN7A 2Y69H 3MKWB 4BS9A 2NVYJ 2ISZA 1IXRC 5HS7A 2R7TA 2WBMA 2X6XA 4L9JA 1LDDA 3R0AA 1X3WB 3SEZA 4E70A 2BXZA 2NS0A 4I7HA 3P9KA 3J7AO 2W25A 3KIOA 5K7HA 2V6EA 2Q8KA 1XMKA 4ITVA 2Y30A 5GTIC 1XCBA 5IPAA 1IC8A 2Q2EA 2GA2A 3KETA 2PMZA 5C4JJ 2I5UA 2EILH 3OV8A 1ZRCA 1POGA 2XRLA 1YQAA 2ZFWA 2XF6A 4GO1A 3OIQA 1BI1A 5E79C 4P96A 5EDNA 1IW7F 1TT0A 3L1PA 4TV7A 5AIPA 3FK7A 2ME6A 4F93B 3G1MA 2X0LA 1TC3C 1R71A 3CCVI 1I50J 1JKOC 1D3YA 2L7ZA 3FXLA 4I0AA 2Y48A 4NBQA 1WI9A 2M87A 4DOZA 5LHIA 4FISA 2DDAA 2TCTA 3ZMZA 5GAEJ 3SFIA 1VNDA 1WJCA 2CJJA 3HXLA 4LITA 1LEAA 2FX0A 5JVGF 1R23A 4ENKA 1FY7A 2XAHA 4EM2A 1JKRC 2WA0A 1EH8A 4K2EA 2A6TA 5FKLA 4PJJA 3S1RJ 2QBYB 2FE3A 4MFDA 1VQ8I 2KRHA 1T0FC 1L3LA 4IHYA 2VQGA 4LD5A 1BC8C 4LK1F 3ESWB 3ISPA 1JKPC 1VQNI 1WJBA 4HAMA 4F3QA 1HDDC 3HOXJ 2M8GX 1IF1A 1B72A 4HLXA 5E8IA 1IUFA 1PYVA 5K5RA 3BDDA 4M74A 1L0OC 2CMPA 2UWMA 1YLFA 3CLQA 1V3FA 1TNSA 2E2JJ 4G6QA 3DXJF 3M1EA 4HDVA 1W1WE 3R61A 3WTXC 4Y13A 3FX3A 3P7NA 3R0JA 1E3OC 3CMEI 4WCGA 2GXBA 3V8LA 4WK8F 5LGTA 2COMA 5CVVA 3CQZJ 2LSOA 2JUCA 4M3FA 1AHDP 5FROA 4LOCA 4IXAA 4PSWA 3WU0A 3LSRA 1J5YA 4L18B 4M3GA 1UELB 4D1QA 5A2QZ 3BJAA 2CRGA 2OJED 1O3SA 3DF8A 2XSDC 1LB2A 2TDXA 4ZTJA 1Y39A 2R7QA 1BR1A 2L5QA 3H92A 2EIJH 1I6HJ 3L7WA 4P9FA 5FFXA 1OYIA 3CO6C 2DA4A 2ID6A 4LG3A 2BHZA 1BW5A 3HRMA 3BCBA 2V6CA 2UXNA 1QQIA 2O7OA 3CCLI 1H9GA 4F91B 3FIWA 3HM5A 2OBPA 2QUFA 2ZO4A 3QP6A 2PEXA 4DBQA 1FIAA 5LLQA 1FEXA 1LNWA 2XGDA 3S32A 1QU3A 4A3EJ 1ZLKA 2XDVA 5D5WB 2JSPA 2CGPA 1R6RA 1UHWA 4KITB 2WTEA 1ZARA 3AL0C 4H4KC 3HRUA 1KU3A 3LSGA 1IZ1A 1FT9A 2X6YA 3K4NA 4BXFA 1AOYA 4UV9A 1K78B 3JRFA 1YO5C 2KISA 4ON0A 4A3DJ 3H9JA 4M9XA 1ON2A 1IGNA 1TQPA 2HOSA 3OIOA 1Q1VA 1V4RA 3T5XA 1KQ8A 4C2UA 1DPRA 4PJ0C 4RBOA 1XG1A 4DGWB 1T8IA 1ETXA 3M7GA 4Y17A 4LLNA 1KYWA 4CYCB 3EPZA 1U2WA 5TJJA 2K85A 3Q3SA 1GV2A 5EGOB 2EWNA 3K2AA 3V8KA 2M8EA 4UUVA 2LG4A 3KEQA 3ZMVA 3AAFA 4U0WA 2CYYA 3L2RA 2ZXHA 3OYNA 3TW7A 2DMUA 1D1CA 3WTUC 2YS9A 5B5EC 1SANA 3CCUI 1P9QC 4E7LA 4U87A 1E3PA 2W24A 1OLTA 3G1LA 2P5LC 4MLOA 3FISA 4IRGA 4QSHA 4HNVA 1VQLI 3I4MJ 3CO7C 3BR1A 4B4CA 4W1UA 3OYKA 1OCZH 2P8TA 2FBKA 2Z33A 2LKXA 4AIHA 3HIFA 2HPMA 1U5TA 3K4BA 1G2HA 2E35A 1T56A 5D6FA 2ZMEA 1R5HA 3FMQA 4LK0F 3AKZA 2WB1N 1SEUA 1N78A 4L9TA 2JSCA 2ZJRF 3DTIA 1S7AA 5E3LA 4AUXA 1SD4A 2MSYA 2F5VA 4KUMA 2C6YA 1SMTA 3PM1A 4ZYHA 5DD4A 1REPC 3HSRA 3QP5A 1JXSA 4ZYEA 1B4AA 1GV5A 2A6EF 1ZR4A 3HZJA 3OYMA 1SVOA 4G9YA 5ERIA 2ZNYA 1ZHFA 3DBLB 4IZZA 3HSFA 4IL6C 4FHTA 3NARA 2VKEA 2KIFA 4ZYDA 1HBXG 3B02A 2FA5A 1PJRA 4AYBA 3NRVA 4A6EA 4IKFA 2ELKA 5FKOA 5HOOA 1ZG3A 2DA6A 3OR2C 4GRIA 5D8LB 4JOMA 2OA4A 1OCPA 4RDUA 2R93J 1VI0A 5DUIA 3CJQB 1EKEA 3S3OA 4A3CJ 3LWFA 2LDUA 1HW2A 4I09A 5CVUA 2KPMA 2W4SA 1BR2A 1ITYA 2KIQA 2AQEA 2MYSA 4UB8C 2EIMH 4G6TB 3RPUA 1ACIA 3DFGA 3G1OA 5BPIA 2H1KA 5C4XJ 5H2FC 3U2RA 1ETVA 1VQKI 1E2XA 3JAMK 2LBFB 3B6AA 4OIOF 1VQOI 2WADA 3AG4H 3I59B 1TP4A 1XGMA 4I6ZA 4A3MJ 4XICA 1STZA 4FQGA 3R4KA 1D8JA 1KONA 3DQVC 3ASOH 2K5CA 4O6JA 5FGMA 3DEWA 4LG0B 3C2GA 2V1DA 3HC7A 1I3AA 1R5ID 4HNTA 4BGDA 1R49A 3BROA 5ED4A 2G7UA 3I54A 3HUGA 1CF7B 3I55I 1YRNB 1XB4A 2JA8J 1SVLA 4HQEA 2X85A 2LY1A 4PZJA 2RQQA 1MMGA 5M3MJ 4WWCA 5CKTA 3T8RA 1QBJA 4PJNA 3ZQLA 2YX7A 5LD2C 3VOEA 2XF5A 4R1HA 3VDXA 2JA2A 2B7EA 3ZQQA 4MTDA 4LLGF 2E60A 1G59A 2F4MB 2MC3A 2WAFA 3AG1H 3FF5A 2OV7A 2RC4A 4Q4ZF 3ZQHA 1ZREA 4BY1J 3KP3A 4BUPA 4PUSA 5BMZA 5E8GA 2LFBA 1S8NA 4XKWA 2OAZA 3CC4I 4OIPF 3K4KA 3HRTA 4V19K 2VC1A 1MDMA 2PJRA 2CQQA 4IHWA 1MKMA 3MKYB 2B9SA 2NXNB 1BI3A 3OOPA 3LSHA 5M5WJ 3MFKA 2XRNA 3BZCA 2M2EA 2E36A 1GVJA 1JUMA 3M8FA 2PMZN 2XAGA 1ZAOA 5F0FA 1P7JA 3QU6A 5F0HA 2MFZA 1KU9A 4A0YA 3GTLJ 1Z91A 5TRDA 2M3AA 4IF4A 2EA4A 4NNJA 1O57A 3R60A 5AONA 3S8PA 3GMEA 3AL0B 3C1DA 5L3BA 1WGXA 1JKQC 2QQ8A 3M8EA 2QSHX 2L54A 4EGYA 2BZTA 3TP0A 3I53A 3PNYA 1SAUA 3MAJA 4XRMA 1O3RA 3CD6I 5KVRA 1R22A 3VYRB 5A2QK 1ZG5A 3IHUA 4FCYA 1LPQA 1IUYA 2HVSA 1MW7A 4M3DA 1OCRH 4XNFA 3G3ZA 3TOAA 2I10A 3RQ4A 1P4AA 2ESHA 1JHHA 4A3KJ 3OYBA 2UUZA 2VASA 2VI6A 2F5EA 4HF1A 4IHSA 1MBJA 3J7YJ 3T1BA 1Z67A 4M9ZA 3F8FA 3Q0UA 2KIUA 2DFIA 3J80K 2KRFA 3G2BA 4OU0A 2HTJA 3LAJA 2IJLA 1APLC 4AIKA 4NC8A 4NQWA 1YX5A 5J4YA 1FP1D 3DV8A 4LIUA 1FOWA 1NG7A 3GUDA 3LSIA 1A31A 5HLGA 2LY2A 1UAAA 4XQFA 4JQFA 1BIAA 3VWBA 2E2IJ 4II3A 3PQJA 2EB7A 2GXGA 3A03A 2H94A 3J7AY 5LGUA 1ZN2A 2ZMEC 2OC6A 1MSEC 2OTJI 3WGGA 5E20A 3BR6A 1S7OA 5FD5A 1YHQI 2AXLA 3L09A 3JTHA 2R0QC 1VQ7I 1NG6A 2X1DA 1JI8A 1PUFA 3G6EI 2HYGD 1TQIA 1U0JA 4CH7A 3DKXA 3G73A 3L2QA 4E7KA 1DPUA 2L7MP 3OWTA 2EZHA 2QLZA 2X6WA 1EH7A 1R1UA 4DZJA 3F21A 2ACJA 4JYKA 4MEXF 1RUNA 2K27A 2XGEA 3LNQA 1I1SA 5DDGA 3N4MA 5HLHA 4IHVA 3HOYJ 3S14J 1FBSA 2XASA 5GAHJ 2L02A 2QCOA 2R5YA 1W5TA 3E6MA 2F5CA 4BJTA 1YW9A 2LLKA 2UZKA 4ENJA 2XV4S 2ZKZA 2PG4A 1U6GA 2Q2EB 2L9VA 3LOCA 1VQPI 3CDIA 2G0EA 2DJNA 3FXOA 1A6IA 3FM3A 5F6FA 3W2VA 2J5PA 1FTZA 3D1NI 4E7ZA 2VKHA 2JA7J 3BC8A 2R3SA 3IRRA 2YSRA 1MMSA 4LMYA 1KYZA 5ICGA 3JR9A 2HZTA 3KFWX 1YS6A 1HF0A 1Z0XA 5J6XA 2M0MA 1RKTA 3GTKJ 1N25A 1ZGJA 2GOMA 2XPWA 3CMAI 1FNNA 3O2PE 4BHBA 4ZH4F 2K02A 3WU1B 2DA1A 5CVIA 1DGWY 1YG2A 2MLGA 1MNMC 2DJIA 4EATA 1VFCA 4L5EA 4BL0B 2LMDA 2Y2ZA 1IAWA 1I5ZA 1WQ2A 2X1EA 1W0TA 4BQQA 1HQCA 2KL4A 2DTRA 2IAIA 3F8NA 1W36D 3K7AJ 1B72B 2ZXWH 1T33A 1NH3A 1AKHA 5LEJA 2CFOA 3N97A 1V5EA 3RYRA 3M3YJ 1FSHA 3ABKH 2FJ1A 1XS9A 3OMYA 3H9GA 2H6CA 2DYRH 3OS2A 5D8KB 5LBQA 5ICFA 2A61A 3BPVA 5CQEA 2W1OA 1TW2A 3ZOBA 4Q48A 5K1YA 3QPTA 2HKXA 4Y7NJ 4X6AJ 3PIOF 2Q1ZB 2CG4A 2K86A 1I27A 1O7LA 4HX4A 4EJVA 4GDFA 3BPXA 1TT5B 2CW0F 2VJJA 2CQNA 3CC2I 1DP7P 2L7KA 4QWQA 2V9KA 2XUBA 1FJLA 4CO8A 5B3SH 2CS3A 3HKZN 2HI3A 3ABTA 2WY7Q 2NVXJ 3DBRB 3A01A 2FNAA 3HTSB 3LQQA 4J19A 1WH7A 2CW8A 4HX8A 2EV6A 3BWGA 4AYBN 1IJWC 3QPSA 1SFUA 5C3EJ 3GTGJ 1IDZA 3QWLA 1Y0NA 2XC7A 2VIXA 5FFZA 3H5AA 1KZHA 3CZ6A 3K6GA 3HJEA 3GZ5A 2KLOA 4WXCA 3DLLF 3BZKA 4DNCA 2OZUA 1LFUP 1K79A 1WKMA 4UXNA 4XLAA 1U78A 4C2MJ 3KLNA 1X1DA 4IO9F 2BHYA 5HDGA 2ETHA 1T38A 1IDYA 2XAFA 1MJAA 3FKJA 3WTVC 3ML6A 5GPAA 2E34A 3HOVJ 4FE4A 4XR6A 4ZZLA 2O61A 3E97A 1D0XA 1WJFA 4EVIA 2X4HA 2PQ8A 1ORKA 5EEAA 3BY6A 5ILUA 4JX6A 1EH6A 4BAYA 1ZRDA 4Y33A 4D5CA 2VOPA 4RA2A 2NVQJ 3NAUA 2VJIA 3O3KA 3U21A 2MD0A 1CGPA 4FE7A 1R58A 3LSKA 4P1WA 1SFKA 5LEKA 5IOZA 2YU9J 3JAMZ 2NAZA 2XF7A 2A69F 5J8FA 3D5LA 4N9HA 5CVJA 1OCOH 1RUOA 2V79A 5ICEA 2Z9OA 2IEKA 2A3SA 1K4TA 3A2KA 3VYTB 2K4JA 1U5TB 3DWLE 1OMIA 2MBFA 3BG9A 3ZQIA 1OPCA 2ZMEB 3KEYA 4X1EA 2FBHA 1T6SA 2MD5A 5JHUA 2LNBA 4KICA 2HTSA 4XN0A 2LP0A 3UR3C 2DFHA 5E3MA 2LTPA 4KFCA 2NOGA 3CLOA 3K4JA 3MN2A 3BR0A 1RIOH 3BLYA 1UJ8A 2LF8A 4M9SA 2JK3A 3QAHA 1M1EB 1HW5A 3N05A 3V42A 1ONVA 3DTEA 2DO7A 2KJCA 2GIVA 4BXUA 3M07A 3BOQA 3LA7A 2H8RA 4I2OA 1U9OA 4WXHA 1YIOA 4AIJA 3I58A 4BHCA 4BQAA 3CUQA 2X48A 1EJ9A 2HYJA 1EF4A 2GIZA 1G4DA 4G7ZF 2E1NA 1KA8A 3CDHA 4HF0A 2L4MA 4RB2C 1IN7A 3BG6A 4B48A 3MMYB 4PCQA 1OCTC 1RESA 1YS7A 3FHNA 1S9HA 3R6SA 3F0CA 4BNCA 4E7IA 1JJ6C 4CHUA 4UVBA 5HDNA 1R9TJ 2PMUA 1O3QA 1GXPA 2ZFUA 5DS9A 4BH9A 3KP6A 3FXKA 4KIGA 3GBGA 2EZLA 3IWZA 2R7RA 4AC0A 1XD7A 2QEXI 2VODA 3Q9SA 1ZKGA 1S72I 3GXOA 4NHJA 4CCKA 3V8JA 1UHSA 2BV6A 4ZDLA 1RNLA 1Y6IA 4M6VA 3I0TA 5F0CA 3S93A 4CDGA 4ZJZA 1VQMI 2QSFX 4MNUA 5K5QA 1AA7A 2R92J 1IRZA 3HOWJ 3OL3A 3EYYA 1J7KA 1SFOJ 3GTJJ 3TBIA 4JX4A 2XHKA 1P2FA 2VQLA 1YTYA 1QPMA 1W7PA 3WGIA 4X0GA 1HKTA 2LRDA 3QYFA 3KCCA 4BEHA 3HUGB 1T2KA 1J59A 2Q0OA 2ZBKA 3GX4X 3G71I 4YEJA 3JRGA 1KQ0A 3MVPA 3J80Z 3OS1A 1YFHA 2EFQA 3MEXA 1MD0A 1UZCA 3QYEA 1QZEA 4RMNA 4D0PA 2JPBA 1V54H 3OYHA 1JJ8C 3I56I 3U1KA 4N4NB 1R36A 5E1XA 2VBZA 1WJDA 1Y0UA 1N77A 2RGVA 3DCFA 4UB6C 3HL2A 3RYPA 1WJEA 3PFYA 4G7OF 5JI6A 2ZC2A 1OISA 4L9VA 4S0HB 1TW3A 1ULYA 3GZNB 2GQQA 2Y9ZA 3E7LA 3QPHA 1KQ9A 1D1AA 4ENNA 1MDMB 1OJLA 2PJRB 1QZYA 2A68F 2COBA 2NNNA 3NWTA 3NWSA 2QENA 4G8XA 4B47A 4Y52J 2IS1A 4AVZA 1F43A 2VBXA 2KKOA 1FIPA 2BY1A 4AWXB 3CP2A 3RZOJ 5BS6A 1HXDA 3MZ8A 1YYVA 4EQQA 1OR7A 2FNPA 1MBHA 3KP2A 4BYYA 4IHTA 2M7BA 3Q5FA 4J01A 2HYFA 3ZXSA 2EJRA 4U0YA 3Q0WA 3PIPF 1F9NA 3F22A 2VLAA 1X1PA 2BW3A 3TGNA 3GW2A 3BTJA 1DDNA 2V1UA 2XKOA 1MMDA 3JRHA 2D45A 3GCMA 3RPQA 2ICWG 2V9VA 3GWZA 5LFAA 5LHGA 5GPCA 2HS5A 3AG3H 4MQ9F 2W00A 2DK8A 4P55A 2IS4A 2CUJA 1B6AA 1IN8A 1MBFA 2HVRA 3AFHA 5F27A 5H6QA 2OPTA 2M4GA 2R7VA 4XORA 4BJ6C 3T8TA 2F48A 1F36A 3W3CA 5M5XJ 4DIQA 3OYEA 3QOPA 3S3MA 5CQGA 3CCQI 2K9LA 3PNVA 3WTSC 4RAYA 4M72A 2A5WA 1LEBA 4HYEA 4CGZA 2RNGA 2XVCA 2O5RA 3MWMA 2PI0A 3FXUA 5EF6A 2XPUA 4NQWB 2BE5F 2VT3A 3Q0VA 2M5WA 1MMAA 5BPDA 2BY3A 3ZMUA 3L2CA 3GZ6A 5FLVA 5DTDA 3BG5A 2Z16A 5IT9K 5J8CA 3TL4X 2M30A 4ZDPA 1FYKA 2L7FP 4A3FJ 1IO2A 1TWHJ 2H1LA 3IP4B 3CCRI 2O6GE 1K7AA 5EG0A 1X2NA 3RKWA 5IP6A 1ETYA 3C2BA 1T95A 3ZQGA 1TBXA 1BC7C 2E2HJ 3CJTB 5F1RA 4UVAA 4XSXF 2E71A 4W97A 3ZRGA 2VL8A 3QRFF 3ROUA 1Y8RB 1PUFB 4BU2A 2QQAA 3E3VA 3L2UA 1J0RA 1PP8F 5IOYA 3FBIB 3H5RA 2H09A 4HG2A 3U1DA 3IH2A 3GTPJ 3O8HA 3H36A 5B1AH 3CUQC 1JTXA 1XN7A 1K4SA 1WVRA 2IXSA 1ZG1A 3W6JB 2EH3A 2R5YB 1B8IB 2HDWA 1KGSA 3WHBA 2KHMA 3HYIA 1SAXA 4BQOA 2VXDA 2XSJC 2A07F 3HTUA 3ABLH 4V2GA 3X2QH 3L2VA 2PFBA 1X1AA 2DAOA 1YJ9I 2F4IA 4E6KG 1G3SA 3UNGC 2H27A 5F64A 5D4RA 2EFOA 2RAEA 4GXOA 4ESFA 2HZDA 2DI3A 5CYVA 2R7DA 2ZNZA 4PJMA 1I6XA 4NDLA 2V7FA 4CCOA 4UUSA 3SDBA 2EINH 1WSUA 3TQNA 2M0CA 4UUTA 3I4NJ 4MGRA 2W84A 4L5JA 1K6YA 1UB9A 4XK4A 3CUOA 1X2MA 4L0YB 2ESNA 2JA6J 4ESBA 2GLOA 1H8AC 3LAPA 2K7LA 1MBKA 2AXTC 3EUHA 3W6KB 4IQJA 3E5UA 5HDKA 3DU5A 5IP9J 4E4HA 1ZGWA 1TNTA 2VJ5A 3WG7H 2VOOA 4RAZA 2VQHA 2RNJA 3KPHA 5JLWA 1AU7A 1A5JA 1ETOA 1Y56A 5DV5A 2R7XA 4FT8A 2IT0A 3DTKA 3GVAA 3H3ZA 3J7ZI 1RRJA 3HPHA 2YR2A 3F8CA 4RM2A 2YX4A 3PL8A 4FX0A 2BOLA 3OYFA 1AKHB 2JRMA 4WX9A 4MEYF 3LSPA 3MZYA 4EM0B 3BQYA 4NB5A 1IXCA 2DBBA 1WZ2A 3H0GJ 1FP2A 4MTEA 3DU6A 2EZIA 2Z1DA 4PGHA 2QWWA 3E5XA 1Z1DA 3OOUA 2V4JC 4OMZA 2FMLA 1Y8QB 2KRCA 4HBLA 3TO7A 1HKQA 2F6CA 3L9FA 4OIQF 2FEZA 1JGGA 5DD8A 1VZ0A 3FXQA 3WTYC 4C2TA 1K83J 2DQRA 5DM6F 4PK4A 5DYMA 1FWZA 1CQTA 1SFEA 2OF7A 3EUKL 4ANJA 3M1CA 5GP9A 4Y3OA 3K1MA 3RDIA 3ZQ7A 3A01B 4E7HA 1JE8A 4HOBA 1MBEA 2W7NA 2V1XA 1NHAA 3HSEA 1X1BA 4N9IA 2FSWA 4LFUA 1EV7A 2L0KA 3EETA 2BEOA 3GFIA 1YJWI 4HPQA 2M34A 2HDCA 5L3FA 5E3OA 2Y31A 2OQRA 3I64A 3IRQA 4U88A 3HOZJ 3SFZA 2HQRA 2FOWA 2Y0SA 4MFEA 3KZIC 1GXQA 1OYWA 2AS5F 5EEGA 4GGGA 1E17A 1Z7LA 1U9NA 4A0ZA 4OOIA 3MKZA 2DOAA 2E1MB 2CUZA 1WFXA 1YIJI 4PSXA 3JSOA 1LE8B 2A6HF 5BNGA 3PUFA 3LSTA 3I4PA 4EGZA 3AG2H 1MH3A 4R8HA 3TW6A 1U5TC 2JJ7A 2PLYA 1J9IA 3CMYA 1GT0C 3K9TA 2V9PA 2H6BA 5IYDJ 2P5VA 4CUGA 4U7DA 1BI2A 5EZGA 4BACA 2L9RA 3GFJA 3PO3J 4XLHA 4I98B 2DMPA 3PUBA 3QYBA 4YG2F 1WH5A 4YFKF 1QHGA 1QO0D 1PDNC 2E7WA 2WAEA 3S15J 2DMTA 2QA4I 1I39A 4CICA 3LSMA 1F5TA 1MNEA 4OMYA 1P92A 4RB1A 1IN6A 4HZFA 2ELHA 3E5QA 4EJWA 2LYCA 1T08B 3DBHB 3F9KA 2G9WA 3U9GA 1W4MA 5IY5H 5C44J 2GBYA 3I9V2 3BP8A 1JUPA 4CYDA 1MIJA 5GTHC 1RKWA 4XLPF 2DCEA 2M1BA 4C3IJ 1TZLA 3H35A 2FQ3A 5FLXK 4ZDOA 2EA2A 2RQPA 4BBRJ 3ELKA 2X51A 5GAGJ 4S04A 1QGPA 1DQUA 1QRYA 4GFBA 2V26A 4XKBA 3SZPA 3HB9A 3ASNH 2ECCA 3F3XA 3MQ0A 2HGCA 5D4SA 3TMOA 4FTHA 3S16J 4Y15A 2HWVA 1X1CA 1Z6TA 4P9UA 2KIMA 3HBLA 3IH3A 5DEQA 3EQLF 4V2FA 3P9CA 5IP7J 4QTRA 1T0FA 3MD2A 4DJAA 3F8MA 3HOTA 2XB5A 4D5FA 3REOA 4G7HF 5DCMA 1A04A 4A2UA 1TTYA 4Z6YA 3CUQB 2FU4A 3CDLA 1SD5A 5L3DA 1ENHA 2DT5A 2JT1A 3BJOA 1LDJA 2EV5A 2JN6A 4NUBA 1IG7A 3ABMH 2O8KA 2M4KA 2LC2A 1CF7A 3GEZA 2GAUA 1XDUA 3W6VA 4A3GJ 1O7FA 2MH9A 5J3LA 3SZGA 4FX4A 4A3JJ 5B1BH 1JHFA 5JFRA 2WAQA 1RR7A 4AVPA 3BG7A 4RB3C 4RGSA 5ICCA 3H1CA 1WJAA 4A3BJ 1BOAA 3HRSA 3K4CA 2R7OA 3IV5A 2HPIA 3V7RA 4B3XA 2DDBA 1MZBA 1RPWA 3KX2A 3QPLA 3D5SC 1W5CC 4IJAA 2EZKA 3F23A 2XB0X 2CO5A 2VBWA 3F6VA 3WTWC 3H5NA 4FASD 2HNHA 2XAJA 5IYCJ 1USTA 3C7JA 3GYHX 2QQBA 5GADJ 1SFXA 2DTZA 2B63J 2HQAA 3VB2A 1TWAJ 4XLNF 3S2HJ 1GHCA 2XIGA 1WWXA 3E6DA 3B73A 1ETKA 3EUHC 4BQNA 4XOTA 3IWFA 2N8GA 4KN7X 2E1OA 3SDGA 1W7PB 4EJOA 1U3EM 1DU0A 4BEHB 1UMQA 2EFPA 2CQ7A 1T39A 4B43A 3TO9A 4RS8A 4XKVA 4CSWA 2VPLA 1ON1A 1ODDA 3ZP5A 1IV6A 1WPKA 2VE8A 4XRSA 1D5VA 3O6BB 3SJMA 4IVNA 4DYCA 3A02A 1SVMA 4HA8A 2Y9YA 3CJNA 5D6EA 3KE2A 2NVUB 2ZXJA 4Z2YA 4YIRX 3JREA 3ZQCA 2O0YA 1LKXA 1B9MA 1YE9A 2EIKH 3FM5A 3NQOA 1O4XA 1SD7A 5IT9Z 1MBGA 1XCVA 1FC3A 1F1ZA 3HPGA 4A69C 1ZR2A 3IKVA 4KA4A 4A12A 1H0MA 1EA3A 1XC5A 1FMVA 3K70C 3IKTA 1MJ9A 1MNDA 1W0UA 5K7FA 1V5GA 2P5KA 1OFCX 3HG9A 2QKMB 3PJRA 5HNHA 4XRFA 2FF4A 2JRTA 3IC7A 1XMAA 2VN2A 2W85A 2BVMA 3PQKA 4LLLA 1U8RA 2XAUA 1WHUA 4IRIA 2IS6A 4KDPA 1HCRA 2QGUA 1IV8A 3H9QA 1KU2A 3WHCA 4EEFG 2GWRA 2UV1A 3G4SI 2QF7A 4I76A 3H3VK 2P4WA 2GM4A 2NS8A 3VFZA 1XDSA 2IGNA 2BW3B 1LFBA 3KZZA 2BVLA 2HKOA 2IRFG 1XGOA 2NVTJ 1LDKB 4BY7J 3BR2A 2QQ9A 1V5FA 1UFMA 4HDUA 4NC6A 5LGNA 1G3TA 4IQ4A 2BY2A 2HQ5A 3ERED 3WE2A 2VB6A 2HEOA 4CZZA 1J75A 2HDDA 1BJZA 3S3NA 4UNOA 3JRBA 1XX5A 2QYOA 4J00A 4KYWA 4ASNA 4BDZA 2FOKA 3CCMI 4CCLA 4CXFA 4ZTFA 2R7WA 2H8WA 2STWA 3RI4A 1IRGA 3TEDA 3RSNA 1HC8A 5JHFA 4RGUA 1YJNI 5BOXA 2K4BA 2NYXA 4DYQA 4LB5A 1YW7A 3K1NA 5FD6A 4RM3A 5M3FJ 4ENMA 2FD5A 2JPCA 2PN6A 2ZSIB 4U7BA 3J81K 1XSDA 2VKVA 2HVQA 3CC7I 2NS7A 4IPAA 1VF9A 5H20A 2L9SA 3K4LA 2HOEA 4F52A 1FPQA 1Z21A 1GDTA 3KLOA 2VUMJ 4HX7A 1FOXA 5FRMA 2FQ4A 4OAYA 4WXDA 3A1YA 2CV2A 5EG0B 4HNUA 2CQXA 2D2WA 3CESA 4M71A 1MMNA 4XOPA 5LRRA 5DUKA 3SHFA 1LVKA 2CW7A 3BG3A 3VEPA 4KMFA 1P4WA 3M4OJ 4I99C 5K5OA 2EFNA 4PFOA 1HDPA 2DFEA 2IA0A 2XGCA 4KIBA 5DM7F 1R5GA 2CV0A 2WV1A 3CF5F 3DKYA 4D7MA 2LY9A 4HV6A 5EJCA 2XAQA 5HLIA 3T0YA 2NNYA 2PBIA 3QOEA 3LA3A 3ZN1A 1R4MB 4G94A 3ZMSA 4YIFA 1S3JA 2JVHA 5KCMA 5D5UB 2DPDA 1ZQ3P 1Y1VJ 5F08A 2IBDA 2FMYA 2Y0SN 5B66C 2HQNA 2O3FA 4UY8I 5E18F 1O3TA 2ELJA 1RI7A 1H9TA 1J2XA 2HR3A 4I0BA 5J4VA 2JVGA 4XIDA 1RETA 5JVTA 4LJZF 2DA2A 3ZMDA 4ZYGA 1BOBA 3LFKA 1I1GA 3L00A 1HLVA 4YIIA 3RZDJ 4XRSG 2IVMA 2DODA 3BTIA 3CTAA 3JW4A 3WTTC 2P0WA 1DGRM 4UUSB 3B6CA 5IT3A 3F72A 2EK5A 3FBNB 2FRHA 2ZJPF 3OS0A 2ZXIA 1TWGJ 1W5SA 4JK1X 2R5ZA 1BN5A 3ZN0A 2KJBA 4PDKA 4M3EA 3PNTA 4YFNF 2YPRA 5E3NA 2HOAA 3WU2C 5HVQC 3KYLA 4QPQA 2CFXA 1U8BA 4KMUX 3KYDB 1Z3YA 2EFWA 2E19A 3A0HC 4PFPA 5FKKA 3V7CA 1JGSA 2AQFA 4AIDA 4DYRA 2OTLI 3OYAA 5ILVA 4MO7A 2VQCA 4C3JJ 2VPRA 2VBYA 3SXYA 1TL8A 1LUJB 2B0LA 2L2OA 4A3IJ 3WE3A 1DP3A 2Z5UA 3F8BA 3VSLA 2R7UA 1HOMA 1X3ZB 2KDOA 4EV0A 5J1UA 3CJRB 1OQYA 4HW0A 4M3BA 2VKDA 5FRNA 1B9NA 4B44A 4S05A 3V7SA 3RIRA 2WC2A 2JMWA 1UG2A 3H3UA 2NOJB 4DW6A 2KFDA 5D5XB 4OINF 3HHGA 1GUUA 1BL0A 2E1MC 1JTYA 1R4NB 2CV1A 3S1NJ 5KNLA 1ZK8A 2BBYA 1FOKA 5FLXZ 3FMSA 2FBIA 4CA0A 5HLTA 3DPLC 2R7FA 4B8XA 2OQGA 3CF2A 2K9MA 2DT6A 4UV8A 4XN3A 3IAM2 3C2HA 2MA3A 4MQVA 2M45A 5KK1A 1UCRA 2DA5A 2JTVA 3SQNA 4JBAA 2IA2A 2L01A 3JRDA 1B1BA 3L2WA 3JRAA 5DCFA 1QZZA 1X58A 4XONA 2LK2A 2Z2SB 3TKYA 3JCUC 4MIMA 2TRTA 2WAQN 2KT0A 2KP6A 5FB2A 4M6XA 2F4OB 2IGOA 1X19A 3D5RC 5LHHA 2LKSA 2AO9A 1SC7A 2BXYA 2RV8A 1HSJA 2FXAA 2LF7A 4L0ZB 3KYCB 2Y75A 4HSRA 4OAZA 3JTGA 1F4KA 4IRHA 1Z9CA 3ZPLA 1ZTRA 2JQ7A 1YI2I 2MH2A 2WV0A 3NEUA 1H88C 2PJPA 2NRAC 3COAC 4KNYA 2ECBA 4O3MA 2KZGA 4EMSA 3PO2J 4HQMA 4D9JA 1XMXA 3ZGKA 1A6QA 3HOSA 1ZRFA 3VODA 4B1RA 4DZPA 1S29A 2VC0A 3HKZA 1LJ9A 5J1YA 1P4XA 4DBRA 3TDUC 4G12A 2F5DA 1LFPA 4YELA 4BE0A 4IHXA 3OYJA 1R7JA 2FUG2 5CJ9A 3S2WA 2QBYA 4XLEA 3TP3A 1TWFJ 2K9SA 2EBIA 5E17F 2IW5A 1MGTA 4D7NA 5FLMJ 2VONA 4JX5A 1R1VA 1USSA 1HW1A 4MHGA 5K7ZA 2QKLB 3LFUA 1D0YA 2UXXA 1YW8A 4XM3A 3BT9A 1GLNA 4GCVA 4O5VA 4UVCA 2LOOA 3FXMA 2MGQA 1RC9A 3LMMA 1IN4A 1QHHD 2RDPA 4KN4X 4R79A 4HRIA 4HEA2
chains in the Genus database with same CATH topology
4FE4A 2R7ZJ 1BW5A 5EYRA 2O7OA 1I3QJ 1ORKA 3FIWA 3HM5A 5EEAA 1BA5A 4JX6A 1FIAA 5C44J 1FEXA 2GBYA 2XGDA 4D5CA 3VPRA 1JUPA 4A3EJ 2NVQJ 4BXXJ 1RKWA 4JP0A 3NAUA 4C3IJ 4FE7A 4BBRJ 1QRYA 5IOZA 2YU9J 4GFBA 3HB9A 2K9QA 2ECCA 3LSGA 3S16J 4FTHA 1QVUA 3HBLA 3IH3A 4V2FA 2ME0A 3JRFA 5IP7J 1MSFC 4QTRA 4A3DJ 2XB5A 1IGNA 4D5FA 2IEKA 2HOSA 3OIOA 1Q1VA 3QQAA 4RBOA 1XG1A 3ZQIA 1ETXA 3BG9A 3CDLA 2DA7A 4CYCB 1MH4A 1ENHA 3Q3SA 4X1EA 1GV2A 5EGOB 1Y1WJ 2JN6A 3K2AA 5M5YJ 2ID3A 1IG7A 2D5VA 2O8KA 2LP0A 5E3MA 2LTPA 3W6VA 2NOGA 4A3GJ 5J3LA 3MN2A 3TW7A 3BR0A 2DMUA 4A3JJ 2YS9A 1SANA 1NTCA 2JK3A 3G1LA 1RR7A 4MLOA 3FISA 3BQZA 4QSHA 4HNVA 1NK3P 3I4MJ 4A3BJ 3BR1A 2H8RA 4B4CA 4W1UA 1U9OA 2YUSA 2LKXA 1G2HA 3IV5A 2X48A 4CYCA 1T56A 2HYJA 2HOTA 1EF4A 2WB1N 3IH4A 5EGOA 1RPWA 3QPLA 3OSGA 2EZKA 1Z77A 3JRIA 2XB0X 5E3LA 1ETQA 3O8GA 4AUXA 5IYCJ 1OCTC 2MSYA 1RESA 2DTZA 3F0CA 3PM1A 1JJ6C 1WCMJ 4BBSJ 2X6OA 2B63J 1P7IA 1TWAJ 1R9TJ 3S2HJ 1S7EA 1GV5A 4BKXA 5DS9A 1ETKA 1ZR4A 5HODA 2DN0A 2EZLA 3GBGA 2N8GA 3BTLA 4B3AA 4AC0A 2DMNA 1FTTA 3NARA 2E1OA 2VKEA 3SDGA 1ZKGA 3GTMJ 1GVDA 2ELKA 5FKOA 1DU0A 1UMQA 2DA6A 1QPIA 1UHSA 2AHQA 1OCPA 4RDUA 1QVTA 1VI0A 2R93J 4M6VA 4A3CJ 5F0CA 3BR3A 1IV6A 1WPKA 4XRSA 2CU7A 3SJMA 4DYCA 2R92J 3A02A 1IRZA 3HOWJ 2Y9YA 1ITYA 3JREA 1SFOJ 3ZQCA 3GTJJ 2M9HA 4C3HJ 4JX4A 3G1OA 1O4XA 2H1KA 1MBGA 5C4XJ 1JT6A 4A69C 1ZR2A 1ETVA 1XC5A 3JRGA 1W0UA 3MVPA 3B6AA 3MKLA 1BW6A 5K7FA 2MG4A 1OFCX 4A3MJ 4I6ZA 4XICA 5FJ8J 1K61A 3DEWA 1JJ8C 1TWCJ 3DCFA 3JRCA 1HCRA 2DMQA 1YRNB 3WHCA 2JA8J 4S0HB 4EEFG 2QF7A 4I76A 3H3VK 5M3MJ 2Y9ZA 2GM4A 3E7LA 2NS8A 3BTCA 1B8IA 1LFBA 3S17J 3LSJA 1OJLA 3ZQLA 2COBA 2NVTJ 1JUSA 4Y52J 4BY7J 3BR2A 2KDZA 3S1QJ 1WI3A 1F43A 1DU6A 1FIPA 2K40A 3RZOJ 2HQ5A 2XPVA 1MBHA 2HDDA 1BJZA 1YRNA 3ZQHA 3JRBA 3GTOJ 4BY1J 4A3LJ 4ABZA 3Q0WA 2K9NA 2LFBA 9ANTA 3HGYA 2CQQA 3BTJA 1JT0A 3TEDA 4IHWA 5M5WJ 3JRHA 2M2EA 4DYQA 1JUMA 3HEFA 5M3FJ 2PMZN 5IYBJ 5F0FA 5GPCA 2FD5A 1P7JA 5F0HA 2HXIA 2DA3A 3GTLJ 4QIWN 2VKVA 1MBFA 3FK6A 2NS7A 5F27A 2OPTA 1VF9A 2P81A 2EQRA 1F36A 1WGXA 5M5XJ 1JKQC 1GDTA 2VUMJ 2FQ4A 3TP0A 2ZB9A 4XRMA 5EG0B 2CQXA 2HXOA 5EF6A 2XPUA 4FCYA 3BG3A 3Q0VA 4M3DA 3M4OJ 3GTQJ 2W48A 2I10A 5FLVA 1HDPA 2XGCA 3UKGA 5DTDA 4A3KJ 2WV1A 2VI6A 5F04A 3BG5A 1MBJA 2LY9A 2MW8A 4D7MA 2L7FP 4A3FJ 1TWHJ 3Q0UA 3FKIJ 3S1MJ 5EG0A 1X2NA 1APLC 5IP6A 1ETYA 3C2BA 5FKNA 3ZQGA 1ZQ3P 1Y1VJ 5F08A 2R5ZB 2IBDA 2Y0SN 2E2HJ 5F1JA 5JLXA 4W97A 3HGGA 2CUEA 1PUFB 3RQIA 5IOYA 4XIDA 1RETA 2DA2A 2E2IJ 3BR5A 1HLVA 3IH2A 3A03A 3RZDJ 3GTPJ 3O8HA 4XRSG 3BTIA 1JTXA 4UUSB 1MSEC 3B6CA 4IEJA 2EH3A 2R5YB 1B8IB 2JA5J 3HDDA 3OSFA 3BR6A 3WHBA 1TWGJ 2R5ZA 1H89C 4V2GA 2R0QC 4M3EA 3CCYA 1PUFA 5E3NA 2HOAA 1LE8A 1U8BA 2LR8A 2L7MP 2EZHA 4DZJA 2X9DA 4JYKA 2O9LA 2RAEA 2XGEA 3LNQA 4IHVA 4A93J 4NDLA 2E19A 3HOYJ 3S14J 5FKKA 4UUSA 5EZHA 4DYRA 4MO7A 2QCOA 2M0CA 2VPRA 4UUTA 4C3JJ 2R5YA 3I4NJ 3S2DJ 2LVSA 2LLKA 4A3IJ 2JWTA 1NK2P 1HOMA 1ETWA 3HOUJ 4XK4A 1X2MA 3LOCA 2JA6J 3ZQFA 1D5YA 2G0EA 2DJNA 2LD5A 1A6IA 2GLOA 5J1UA 1H8AC 2CUFA 1MBKA 1FTZA 5J1RA 3D1NI 4M3BA 3RKQA 5FKMA 5IP9J 2JA7J 1ZGWA 2JMWA 2NVYJ 1UG2A 4DW6A 5JLWA 1A5JA 1AU7A 1ETOA 1GUUA 3JR9A 5K7HA 1BL0A 3S1NJ 1JTYA 1HF0A 1Z0XA 1ZK8A 1AKHB 3GTKJ 1RKTA 2Y30A 5IPAA 1IC8A 2XPWA 3LSPA 5C4JJ 1POGA 2XRLA 3BQYA 2DA1A 3H0GJ 5EDNA 1MNMC 3L1PA 1VFCA 2EZIA 2ME6A 3FK7A 4L5EA 2Y2ZA 2DA5A 1W0TA 3G1MA 3OOUA 1TC3C 3JRDA 3JRAA 1X58A 2IAIA 1I50J 1JKOC 2LK2A 2L7ZA 4MIMA 2TRTA 3K7AJ 2WAQN 1B72B 4FISA 2KT0A 1T33A 2TCTA 1JGGA 1AKHA 3SFIA 1VNDA 2CJJA 2AO9A 2FX0A 3M3YJ 1K83J 2FJ1A 1XS9A 1JKRC 1CQTA 2OF7A 5FKLA 3S1RJ 5GP9A 1ZTRA 3A01B 4MFDA 1H88C 1MBEA 4IHYA 3ZOBA 1JKPC 2ECBA 4Y7NJ 3PO2J 4X6AJ 2L0KA 1HDDC 2M34A 3HOXJ 2M8GX 5E3OA 2Y31A 1B72A 1IUFA 3HOZJ 4B1RA 4DZPA 4MFEA 5J1YA 2E2JJ 1U9NA 4G12A 1FJLA 4IHXA 3HKZN 2HI3A 1E3OC 2NVXJ 3A01A 3TP3A 3HOVJ 1TWFJ 1LE8B 2K9SA 5BNGA 3CQZJ 2EBIA 4J19A 4M3FA 1WH7A 4D7NA 5FLMJ 1AHDP 4JX5A 4AYBN 4LOCA 1MH3A 3TW6A 1IJWC 3QPSA 3GTGJ 5C3EJ 1IDZA 5K7ZA 2JJ7A 3LSRA 4M3GA 3CMYA 1GT0C 5IYDJ 3BT9A 2CRGA 2XSDC 1LFUP 5EZGA 2MGQA 2L9RA 3PO3J 1U78A 4C2MJ 2DMPA 1WH5A 1I6HJ 1IDYA 3S15J 2DMTA 2DA4A 2ID6A 5GPAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FE4 A;  2R7Z J;  1BW5 A;  5EYR A;  2O7O A;  1I3Q J;  1ORK A;  3FIW A;  3HM5 A;  5EEA A;  1BA5 A;  4JX6 A;  1FIA A;  5C44 J;  1FEX A;  2GBY A;  2XGD A;  4D5C A;  3VPR A;  1JUP A;  4A3E J;  2NVQ J;  4BXX J;  1RKW A;  4JP0 A;  3NAU A;  4C3I J;  4FE7 A;  4BBR J;  1QRY A;  5IOZ A;  2YU9 J;  4GFB A;  3HB9 A;  2K9Q A;  2ECC A;  3LSG A;  3S16 J;  4FTH A;  1QVU A;  3HBL A;  3IH3 A;  4V2F A;  2ME0 A;  3JRF A;  5IP7 J;  1MSF C;  4QTR A;  4A3D J;  2XB5 A;  1IGN A;  4D5F A;  2IEK A;  2HOS A;  3OIO A;  1Q1V A;  3QQA A;  4RBO A;  1XG1 A;  3ZQI A;  1ETX A;  3BG9 A;  3CDL A;  2DA7 A;  4CYC B;  1MH4 A;  1ENH A;  3Q3S A;  4X1E A;  1GV2 A;  5EGO B;  1Y1W J;  2JN6 A;  3K2A A;  5M5Y J;  2ID3 A;  1IG7 A;  2D5V A;  2O8K A;  2LP0 A;  5E3M A;  2LTP A;  3W6V A;  2NOG A;  4A3G J;  5J3L A;  3MN2 A;  3TW7 A;  3BR0 A;  2DMU A;  4A3J J;  2YS9 A;  1SAN A;  1NTC A;  2JK3 A;  3G1L A;  1RR7 A;  4MLO A;  3FIS A;  3BQZ A;  4QSH A;  4HNV A;  1NK3 P;  3I4M J;  4A3B J;  3BR1 A;  2H8R A;  4B4C A;  4W1U A;  1U9O A;  2YUS A;  2LKX A;  1G2H A;  3IV5 A;  2X48 A;  4CYC A;  1T56 A;  2HYJ A;  2HOT A;  1EF4 A;  2WB1 N;  3IH4 A;  5EGO A;  1RPW A;  3QPL A;  3OSG A;  2EZK A;  1Z77 A;  3JRI A;  2XB0 X;  5E3L A;  1ETQ A;  3O8G A;  4AUX A;  5IYC J;  1OCT C;  2MSY A;  1RES A;  2DTZ A;  3F0C A;  3PM1 A;  1JJ6 C;  1WCM J;  4BBS J;  2X6O A;  2B63 J;  1P7I A;  1TWA J;  1R9T J;  3S2H J;  1S7E A;  1GV5 A;  4BKX A;  5DS9 A;  1ETK A;  1ZR4 A;  5HOD A;  2DN0 A;  2EZL A;  3GBG A;  2N8G A;  3BTL A;  4B3A A;  4AC0 A;  2DMN A;  1FTT A;  3NAR A;  2E1O A;  2VKE A;  3SDG A;  1ZKG A;  3GTM J;  1GVD A;  2ELK A;  5FKO A;  1DU0 A;  1UMQ A;  2DA6 A;  1QPI A;  1UHS A;  2AHQ A;  1OCP A;  4RDU A;  1QVT A;  1VI0 A;  2R93 J;  4M6V A;  4A3C J;  5F0C A;  3BR3 A;  1IV6 A;  1WPK A;  4XRS A;  2CU7 A;  3SJM A;  4DYC A;  2R92 J;  3A02 A;  1IRZ A;  3HOW J;  2Y9Y A;  1ITY A;  3JRE A;  1SFO J;  3ZQC A;  3GTJ J;  2M9H A;  4C3H J;  4JX4 A;  3G1O A;  1O4X A;  2H1K A;  1MBG A;  5C4X J;  1JT6 A;  4A69 C;  1ZR2 A;  1ETV A;  1XC5 A;  3JRG A;  1W0U A;  3MVP A;  3B6A A;  3MKL A;  1BW6 A;  5K7F A;  2MG4 A;  1OFC X;  4A3M J;  4I6Z A;  4XIC A;  5FJ8 J;  1K61 A;  3DEW A;  1JJ8 C;  1TWC J;  3DCF A;  3JRC A;  1HCR A;  2DMQ A;  1YRN B;  3WHC A;  2JA8 J;  4S0H B;  4EEF G;  2QF7 A;  4I76 A;  3H3V K;  5M3M J;  2Y9Z A;  2GM4 A;  3E7L A;  2NS8 A;  3BTC A;  1B8I A;  1LFB A;  3S17 J;  3LSJ A;  1OJL A;  3ZQL A;  2COB A;  2NVT J;  1JUS A;  4Y52 J;  4BY7 J;  3BR2 A;  2KDZ A;  3S1Q J;  1WI3 A;  1F43 A;  1DU6 A;  1FIP A;  2K40 A;  3RZO J;  2HQ5 A;  2XPV A;  1MBH A;  2HDD A;  1BJZ A;  1YRN A;  3ZQH A;  3JRB A;  3GTO J;  4BY1 J;  4A3L J;  4ABZ A;  3Q0W A;  2K9N A;  2LFB A;  9ANT A;  3HGY A;  2CQQ A;  3BTJ A;  1JT0 A;  3TED A;  4IHW A;  5M5W J;  3JRH A;  2M2E A;  4DYQ A;  1JUM A;  3HEF A;  5M3F J;  2PMZ N;  5IYB J;  5F0F A;  5GPC A;  2FD5 A;  1P7J A;  5F0H A;  2HXI A;  2DA3 A;  3GTL J;  4QIW N;  2VKV A;  1MBF A;  3FK6 A;  2NS7 A;  5F27 A;  2OPT A;  1VF9 A;  2P81 A;  2EQR A;  1F36 A;  1WGX A;  5M5X J;  1JKQ C;  1GDT A;  2VUM J;  2FQ4 A;  3TP0 A;  2ZB9 A;  4XRM A;  5EG0 B;  2CQX A;  2HXO A;  5EF6 A;  2XPU A;  4FCY A;  3BG3 A;  3Q0V A;  4M3D A;  3M4O J;  3GTQ J;  2W48 A;  2I10 A;  5FLV A;  1HDP A;  2XGC A;  3UKG A;  5DTD A;  4A3K J;  2WV1 A;  2VI6 A;  5F04 A;  3BG5 A;  1MBJ A;  2LY9 A;  2MW8 A;  4D7M A;  2L7F P;  4A3F J;  1TWH J;  3Q0U A;  3FKI J;  3S1M J;  5EG0 A;  1X2N A;  1APL C;  5IP6 A;  1ETY A;  3C2B A;  5FKN A;  3ZQG A;  1ZQ3 P;  1Y1V J;  5F08 A;  2R5Z B;  2IBD A;  2Y0S N;  2E2H J;  5F1J A;  5JLX A;  4W97 A;  3HGG A;  2CUE A;  1PUF B;  3RQI A;  5IOY A;  4XID A;  1RET A;  2DA2 A;  2E2I J;  3BR5 A;  1HLV A;  3IH2 A;  3A03 A;  3RZD J;  3GTP J;  3O8H A;  4XRS G;  3BTI A;  1JTX A;  4UUS B;  1MSE C;  3B6C A;  4IEJ A;  2EH3 A;  2R5Y B;  1B8I B;  2JA5 J;  3HDD A;  3OSF A;  3BR6 A;  3WHB A;  1TWG J;  2R5Z A;  1H89 C;  4V2G A;  2R0Q C;  4M3E A;  3CCY A;  1PUF A;  5E3N A;  2HOA A;  1LE8 A;  1U8B A;  2LR8 A;  2L7M P;  2EZH A;  4DZJ A;  2X9D A;  4JYK A;  2O9L A;  2RAE A;  2XGE A;  3LNQ A;  4IHV A;  4A93 J;  4NDL A;  2E19 A;  3HOY J;  3S14 J;  5FKK A;  4UUS A;  5EZH A;  4DYR A;  4MO7 A;  2QCO A;  2M0C A;  2VPR A;  4UUT A;  4C3J J;  2R5Y A;  3I4N J;  3S2D J;  2LVS A;  2LLK A;  4A3I J;  2JWT A;  1NK2 P;  1HOM A;  1ETW A;  3HOU J;  4XK4 A;  1X2M A;  3LOC A;  2JA6 J;  3ZQF A;  1D5Y A;  2G0E A;  2DJN A;  2LD5 A;  1A6I A;  2GLO A;  5J1U A;  1H8A C;  2CUF A;  1MBK A;  1FTZ A;  5J1R A;  3D1N I;  4M3B A;  3RKQ A;  5FKM A;  5IP9 J;  2JA7 J;  1ZGW A;  2JMW A;  2NVY J;  1UG2 A;  4DW6 A;  5JLW A;  1A5J A;  1AU7 A;  1ETO A;  1GUU A;  3JR9 A;  5K7H A;  1BL0 A;  3S1N J;  1JTY A;  1HF0 A;  1Z0X A;  1ZK8 A;  1AKH B;  3GTK J;  1RKT A;  2Y30 A;  5IPA A;  1IC8 A;  2XPW A;  3LSP A;  5C4J J;  1POG A;  2XRL A;  3BQY A;  2DA1 A;  3H0G J;  5EDN A;  1MNM C;  3L1P A;  1VFC A;  2EZI A;  2ME6 A;  3FK7 A;  4L5E A;  2Y2Z A;  2DA5 A;  1W0T A;  3G1M A;  3OOU A;  1TC3 C;  3JRD A;  3JRA A;  1X58 A;  2IAI A;  1I50 J;  1JKO C;  2LK2 A;  2L7Z A;  4MIM A;  2TRT A;  3K7A J;  2WAQ N;  1B72 B;  4FIS A;  2KT0 A;  1T33 A;  2TCT A;  1JGG A;  1AKH A;  3SFI A;  1VND A;  2CJJ A;  2AO9 A;  2FX0 A;  3M3Y J;  1K83 J;  2FJ1 A;  1XS9 A;  1JKR C;  1CQT A;  2OF7 A;  5FKL A;  3S1R J;  5GP9 A;  1ZTR A;  3A01 B;  4MFD A;  1H88 C;  1MBE A;  4IHY A;  3ZOB A;  1JKP C;  2ECB A;  4Y7N J;  3PO2 J;  4X6A J;  2L0K A;  1HDD C;  2M34 A;  3HOX J;  2M8G X;  5E3O A;  2Y31 A;  1B72 A;  1IUF A;  3HOZ J;  4B1R A;  4DZP A;  4MFE A;  5J1Y A;  2E2J J;  1U9N A;  4G12 A;  1FJL A;  4IHX A;  3HKZ N;  2HI3 A;  1E3O C;  2NVX J;  3A01 A;  3TP3 A;  3HOV J;  1TWF J;  1LE8 B;  2K9S A;  5BNG A;  3CQZ J;  2EBI A;  4J19 A;  4M3F A;  1WH7 A;  4D7N A;  5FLM J;  1AHD P;  4JX5 A;  4AYB N;  4LOC A;  1MH3 A;  3TW6 A;  1IJW C;  3QPS A;  3GTG J;  5C3E J;  1IDZ A;  5K7Z A;  2JJ7 A;  3LSR A;  4M3G A;  3CMY A;  1GT0 C;  5IYD J;  3BT9 A;  2CRG A;  2XSD C;  1LFU P;  5EZG A;  2MGQ A;  2L9R A;  3PO3 J;  1U78 A;  4C2M J;  2DMP A;  1WH5 A;  1I6H J;  1IDY A;  3S15 J;  2DMT A;  2DA4 A;  2ID6 A;  5GPA A; 
#chains in the Genus database with same CATH topology
 1Z7U A;  3GLX A;  2R7Z J;  5EYR A;  3C3W A;  2L3D A;  4CZC A;  1ZH5 A;  3K0L A;  2OCC H;  1R00 A;  3OIP A;  1I3Q J;  3QU3 A;  4KIS A;  1BA5 A;  2RRE A;  3PFI A;  4BHP A;  5CVR A;  3VPR A;  4BXX J;  3F6O A;  4JP0 A;  5DCM B;  4M6Y A;  1LQ1 A;  4LGW A;  1P6R A;  3FXJ A;  3EDP A;  2CSO A;  4Q47 A;  3DEU A;  5KHD A;  2HU9 A;  4RAF A;  2K9Q A;  1XSV A;  3D0S A;  2VT2 A;  4Y4R A;  1Z6R A;  1QVU A;  2WY8 Q;  1QNT A;  4F7Z A;  2J5O A;  2ME0 A;  1IRF A;  3IL2 A;  1MSF C;  2IPQ X;  1RZ4 A;  1ZLJ A;  2DYS H;  5H6R A;  1SD6 A;  2RVC A;  2IGK A;  4HLY A;  3RCO A;  2XRO A;  1PUE E;  3JSP A;  1FBQ A;  2IGM A;  3MCZ A;  3QQA A;  1FBU A;  3VSK A;  4A5N A;  2DOE A;  2DOF A;  2DA7 A;  2R4G A;  1MH4 A;  4II2 A;  5D5V B;  1OKR A;  3QOD A;  1Y1W J;  1TLH B;  5M5Y J;  2ID3 A;  2D5V A;  5E1W A;  3W2W A;  2P6S A;  3FZV A;  3BZ6 A;  4HST A;  3DKW A;  3GLL A;  1ZYR F;  1K78 A;  2VJ4 A;  4HF2 A;  1NTC A;  2CQK A;  3P5J A;  3WG9 A;  2GOX B;  3BQZ A;  1NK3 P;  1FZP B;  1BJA A;  4E7S A;  1W7P D;  3BCA A;  2YUS A;  4KIF A;  3WOD F;  1FX7 A;  1WRJ A;  2KQR A;  1A35 A;  2MC4 A;  2K3P A;  4C30 A;  4CYC A;  2HOT A;  1YOV B;  3OL4 A;  1R1T A;  4BDY A;  3EYI A;  3IH4 A;  4RAG A;  5EGO A;  1VQ6 I;  1T98 A;  3OSG A;  3A0B C;  1Z77 A;  3JRI A;  4BE2 A;  1HST A;  2M7A A;  1ETQ A;  1XSX A;  3O8G A;  4F55 A;  1S5L C;  1Q1H A;  3VYU B;  1MJB A;  4AM3 A;  1WCM J;  4BBS J;  2X6O A;  2RKH A;  3KP5 A;  3CCJ I;  1P7I A;  4HV5 A;  3RJP A;  4XLC A;  1S7E A;  4BKX A;  3OYC A;  2BYV E;  3K4M A;  4UHT A;  5HOD A;  4RGX A;  1OR7 C;  5JR3 A;  5KAF C;  3VYS B;  4F92 B;  2DN0 A;  3OYL A;  3BTL A;  4XSZ F;  3J81 Z;  4B3A A;  2DMN A;  4U0V A;  1FTT A;  5EEH A;  2STT A;  1PP7 U;  5L3G A;  3GTM J;  1FOY A;  3RKX A;  1GVD A;  2HFH A;  4L9N A;  4RLQ A;  4E7J A;  5CLS A;  2DK5 A;  4L5I A;  3OR1 C;  1QPI A;  3FDY A;  3GFL A;  4P5O A;  2GXA A;  2AHQ A;  3K1P A;  1QVT A;  2Y0M A;  1UG0 A;  2BGC A;  3BR3 A;  3LA2 A;  5J47 A;  3LQR A;  2CU7 A;  1Z3X A;  2PX9 A;  2EPF A;  5ILS A;  2CH0 A;  1XTA A;  1D0Z A;  1ZGA A;  4N0B A;  2F5F A;  3I71 A;  2X1C A;  2M9H A;  1IXS B;  4ZC3 A;  4C3H J;  1DUX C;  4RGR A;  2LKP A;  1XGN A;  5L3C A;  3GF2 A;  3E0J B;  1JT6 A;  3SZT A;  1BM9 A;  4FET A;  4EJU A;  2KMU A;  1B59 A;  1YX3 A;  3MKL A;  1BW6 A;  2QZ8 A;  1G8X A;  2W82 A;  2MG4 A;  4XBF A;  1BIB A;  4YRV A;  5LRS A;  2JZY A;  2OU2 A;  4AD9 A;  5FJ8 J;  1K6O A;  2QSG X;  5HS8 A;  4QLC U;  1K61 A;  1J09 A;  1WJ5 A;  1Z05 A;  4XMY A;  3OY9 A;  1TWC J;  2PMH A;  3TO6 A;  2YU3 A;  3JRC A;  3E6B A;  2DMQ A;  2D1H A;  1FLI A;  1X4O A;  2LBF A;  3MZH A;  1E3H A;  2GZW A;  2P7C B;  3RTR A;  2VE9 A;  2KZV A;  3BTC A;  3I59 A;  3K2Z A;  3ZR8 X;  1VQ4 I;  2OCE A;  1B8I A;  1BR4 A;  3S17 J;  3LSJ A;  5TGT A;  1JUS A;  1XGS A;  1S6L A;  1D1B A;  1X4P A;  4H0E A;  2KDZ A;  3KP7 A;  4LG0 A;  3S1Q J;  4Q5S F;  1WI3 A;  2MAB A;  2L4A A;  2A05 A;  5TIS C;  2E5N A;  1DU6 A;  2K40 A;  2DQL A;  1ZEL A;  4ETS A;  2XPV A;  4AU7 A;  1YRN A;  3FXR A;  2ISY A;  3GTO J;  3RKY A;  4A3L J;  4ABZ A;  4IOC F;  2K9N A;  2DPU A;  4ESJ A;  2LH9 A;  1X3U A;  2L9N A;  9ANT A;  5J40 A;  1FYM A;  3HGY A;  3TOB A;  1TQM A;  3FHZ A;  4KT5 C;  3RPU D;  1JT0 A;  2E5Z A;  4XKC A;  5L3E A;  2LRE A;  4BJ5 C;  4DQ2 A;  5HNF A;  4GYI A;  5E1Z B;  2WB1 A;  1W36 C;  6PAX A;  3WGH A;  1A36 A;  4XLF A;  2VXZ A;  4G6D A;  2G7H A;  3HEF A;  3IUO A;  3CMM A;  3H0D A;  5IYB J;  1E0E A;  3CCE I;  1ERD A;  2HXI A;  4ZYA A;  2E1C A;  4LB6 B;  2DA3 A;  3CP8 A;  4KJZ A;  4QIW N;  2WWY A;  4QPO A;  2OUM A;  3OYI A;  3FK6 A;  1KU7 A;  2P81 A;  2BY0 A;  2EQR A;  3K10 A;  4OIR F;  4CCM A;  2DXI A;  2DW4 A;  2DFF A;  4PGG A;  2ZB9 A;  3HHH A;  4GYG A;  4I01 A;  1BI0 A;  3FMR A;  1VTN C;  2XGX A;  3FWE A;  2HXO A;  1YIT I;  5FO5 A;  1LVA A;  2GA1 A;  3ERM A;  3I5U A;  3DP7 A;  3KP4 A;  3BJ6 A;  4RB0 A;  3GTQ J;  1RR8 C;  4BE1 A;  1FSE A;  2W48 A;  2V1N A;  3UKG A;  2CWE A;  2Z3Y A;  4OWR B;  4A5M A;  2Z99 A;  4N4O B;  3EUA A;  1SMY F;  5F04 A;  3DPT A;  4IOA F;  2R7S A;  3ZMT A;  2MW8 A;  4CCN A;  1IN5 A;  2O8X A;  2P7V B;  3M8J A;  3LL7 A;  2QVO A;  4EM1 A;  3FKI J;  3KZY A;  2O03 A;  3E6C C;  3S1M J;  1FYL A;  1HKS A;  4M73 A;  5AIQ A;  2ZJQ F;  1UHM A;  4CCJ A;  1VQ9 I;  2ADU A;  5FKN A;  4ZZD A;  4EJT A;  3Q9V A;  2R5Z B;  4IX7 A;  4A0X A;  1HA8 A;  2K3F A;  3E1S A;  5F1J A;  3GO5 A;  2W57 A;  5JLX A;  3HGG A;  2CUE A;  1D8K A;  4B09 A;  3RQI A;  4C9Y A;  3TDZ C;  2F2E A;  3I3L A;  3CCS I;  3SYT A;  3IAS 2;  3BR5 A;  3V4G A;  3WTZ A;  3KEO A;  2EV0 A;  2D1V A;  3ZCO A;  4KT6 A;  2E7X A;  3DEE A;  4A6D A;  5CPR B;  2P6T A;  1PVE A;  3ECO A;  4PJL A;  4WF2 A;  4IEJ A;  2DLL A;  3GFM A;  2IA1 A;  3PSI A;  1FMW A;  2JA5 J;  2DT7 B;  3HDD A;  2QM3 A;  3OSF A;  1OYY A;  1OCC H;  1H89 C;  4NC7 A;  4YFX F;  1G6N A;  3CCY A;  2MLK A;  2A5Y B;  1LE8 A;  4I02 A;  3ONQ A;  1G3W A;  3ECH A;  3ULQ B;  2LR8 A;  3P9I A;  1G3Y A;  3K70 D;  2JUG A;  3W2A A;  2X9D A;  5KAI C;  2O9L A;  1IRX A;  1C0W A;  3ABU A;  3PSF A;  2IS2 A;  1BBY A;  1AWC A;  4A93 J;  2I8D A;  3SEQ A;  5HS9 A;  5EZH A;  3OYD A;  1VQ5 I;  2IP2 A;  2XKP A;  3DPU A;  3S2D J;  2ZCW A;  2LVS A;  2OD5 A;  1QA6 A;  4LIV A;  1NK2 P;  2JWT A;  4RLF A;  1ETW A;  3DLA A;  3HOU J;  3ZQF A;  1D5Y A;  2LD5 A;  1V55 H;  2OZ6 A;  3A4C A;  2DU9 A;  3C18 A;  2CUF A;  3K69 A;  3M9A A;  1XPX A;  2ZSH B;  2ZJ2 A;  4XL9 A;  5J1R A;  3RKQ A;  1N75 A;  5FKM A;  3OYG A;  5BQT A;  2RN7 A;  2Y69 H;  3MKW B;  4BS9 A;  2NVY J;  2ISZ A;  1IXR C;  5HS7 A;  2R7T A;  2WBM A;  2X6X A;  4L9J A;  1LDD A;  3R0A A;  1X3W B;  3SEZ A;  4E70 A;  2BXZ A;  2NS0 A;  4I7H A;  3P9K A;  3J7A O;  2W25 A;  3KIO A;  5K7H A;  2V6E A;  2Q8K A;  1XMK A;  4ITV A;  2Y30 A;  5GTI C;  1XCB A;  5IPA A;  1IC8 A;  2Q2E A;  2GA2 A;  3KET A;  2PMZ A;  5C4J J;  2I5U A;  2EIL H;  3OV8 A;  1ZRC A;  1POG A;  2XRL A;  1YQA A;  2ZFW A;  2XF6 A;  4GO1 A;  3OIQ A;  1BI1 A;  5E79 C;  4P96 A;  5EDN A;  1IW7 F;  1TT0 A;  3L1P A;  4TV7 A;  5AIP A;  3FK7 A;  2ME6 A;  4F93 B;  3G1M A;  2X0L A;  1TC3 C;  1R71 A;  3CCV I;  1I50 J;  1JKO C;  1D3Y A;  2L7Z A;  3FXL A;  4I0A A;  2Y48 A;  4NBQ A;  1WI9 A;  2M87 A;  4DOZ A;  5LHI A;  4FIS A;  2DDA A;  2TCT A;  3ZMZ A;  5GAE J;  3SFI A;  1VND A;  1WJC A;  2CJJ A;  3HXL A;  4LIT A;  1LEA A;  2FX0 A;  5JVG F;  1R23 A;  4ENK A;  1FY7 A;  2XAH A;  4EM2 A;  1JKR C;  2WA0 A;  1EH8 A;  4K2E A;  2A6T A;  5FKL A;  4PJJ A;  3S1R J;  2QBY B;  2FE3 A;  4MFD A;  1VQ8 I;  2KRH A;  1T0F C;  1L3L A;  4IHY A;  2VQG A;  4LD5 A;  1BC8 C;  4LK1 F;  3ESW B;  3ISP A;  1JKP C;  1VQN I;  1WJB A;  4HAM A;  4F3Q A;  1HDD C;  3HOX J;  2M8G X;  1IF1 A;  1B72 A;  4HLX A;  5E8I A;  1IUF A;  1PYV A;  5K5R A;  3BDD A;  4M74 A;  1L0O C;  2CMP A;  2UWM A;  1YLF A;  3CLQ A;  1V3F A;  1TNS A;  2E2J J;  4G6Q A;  3DXJ F;  3M1E A;  4HDV A;  1W1W E;  3R61 A;  3WTX C;  4Y13 A;  3FX3 A;  3P7N A;  3R0J A;  1E3O C;  3CME I;  4WCG A;  2GXB A;  3V8L A;  4WK8 F;  5LGT A;  2COM A;  5CVV A;  3CQZ J;  2LSO A;  2JUC A;  4M3F A;  1AHD P;  5FRO A;  4LOC A;  4IXA A;  4PSW A;  3WU0 A;  3LSR A;  1J5Y A;  4L18 B;  4M3G A;  1UEL B;  4D1Q A;  5A2Q Z;  3BJA A;  2CRG A;  2OJE D;  1O3S A;  3DF8 A;  2XSD C;  1LB2 A;  2TDX A;  4ZTJ A;  1Y39 A;  2R7Q A;  1BR1 A;  2L5Q A;  3H92 A;  2EIJ H;  1I6H J;  3L7W A;  4P9F A;  5FFX A;  1OYI A;  3CO6 C;  2DA4 A;  2ID6 A;  4LG3 A;  2BHZ A;  1BW5 A;  3HRM A;  3BCB A;  2V6C A;  2UXN A;  1QQI A;  2O7O A;  3CCL I;  1H9G A;  4F91 B;  3FIW A;  3HM5 A;  2OBP A;  2QUF A;  2ZO4 A;  3QP6 A;  2PEX A;  4DBQ A;  1FIA A;  5LLQ A;  1FEX A;  1LNW A;  2XGD A;  3S32 A;  1QU3 A;  4A3E J;  1ZLK A;  2XDV A;  5D5W B;  2JSP A;  2CGP A;  1R6R A;  1UHW A;  4KIT B;  2WTE A;  1ZAR A;  3AL0 C;  4H4K C;  3HRU A;  1KU3 A;  3LSG A;  1IZ1 A;  1FT9 A;  2X6Y A;  3K4N A;  4BXF A;  1AOY A;  4UV9 A;  1K78 B;  3JRF A;  1YO5 C;  2KIS A;  4ON0 A;  4A3D J;  3H9J A;  4M9X A;  1ON2 A;  1IGN A;  1TQP A;  2HOS A;  3OIO A;  1Q1V A;  1V4R A;  3T5X A;  1KQ8 A;  4C2U A;  1DPR A;  4PJ0 C;  4RBO A;  1XG1 A;  4DGW B;  1T8I A;  1ETX A;  3M7G A;  4Y17 A;  4LLN A;  1KYW A;  4CYC B;  3EPZ A;  1U2W A;  5TJJ A;  2K85 A;  3Q3S A;  1GV2 A;  5EGO B;  2EWN A;  3K2A A;  3V8K A;  2M8E A;  4UUV A;  2LG4 A;  3KEQ A;  3ZMV A;  3AAF A;  4U0W A;  2CYY A;  3L2R A;  2ZXH A;  3OYN A;  3TW7 A;  2DMU A;  1D1C A;  3WTU C;  2YS9 A;  5B5E C;  1SAN A;  3CCU I;  1P9Q C;  4E7L A;  4U87 A;  1E3P A;  2W24 A;  1OLT A;  3G1L A;  2P5L C;  4MLO A;  3FIS A;  4IRG A;  4QSH A;  4HNV A;  1VQL I;  3I4M J;  3CO7 C;  3BR1 A;  4B4C A;  4W1U A;  3OYK A;  1OCZ H;  2P8T A;  2FBK A;  2Z33 A;  2LKX A;  4AIH A;  3HIF A;  2HPM A;  1U5T A;  3K4B A;  1G2H A;  2E35 A;  1T56 A;  5D6F A;  2ZME A;  1R5H A;  3FMQ A;  4LK0 F;  3AKZ A;  2WB1 N;  1SEU A;  1N78 A;  4L9T A;  2JSC A;  2ZJR F;  3DTI A;  1S7A A;  5E3L A;  4AUX A;  1SD4 A;  2MSY A;  2F5V A;  4KUM A;  2C6Y A;  1SMT A;  3PM1 A;  4ZYH A;  5DD4 A;  1REP C;  3HSR A;  3QP5 A;  1JXS A;  4ZYE A;  1B4A A;  1GV5 A;  2A6E F;  1ZR4 A;  3HZJ A;  3OYM A;  1SVO A;  4G9Y A;  5ERI A;  2ZNY A;  1ZHF A;  3DBL B;  4IZZ A;  3HSF A;  4IL6 C;  4FHT A;  3NAR A;  2VKE A;  2KIF A;  4ZYD A;  1HBX G;  3B02 A;  2FA5 A;  1PJR A;  4AYB A;  3NRV A;  4A6E A;  4IKF A;  2ELK A;  5FKO A;  5HOO A;  1ZG3 A;  2DA6 A;  3OR2 C;  4GRI A;  5D8L B;  4JOM A;  2OA4 A;  1OCP A;  4RDU A;  2R93 J;  1VI0 A;  5DUI A;  3CJQ B;  1EKE A;  3S3O A;  4A3C J;  3LWF A;  2LDU A;  1HW2 A;  4I09 A;  5CVU A;  2KPM A;  2W4S A;  1BR2 A;  1ITY A;  2KIQ A;  2AQE A;  2MYS A;  4UB8 C;  2EIM H;  4G6T B;  3RPU A;  1ACI A;  3DFG A;  3G1O A;  5BPI A;  2H1K A;  5C4X J;  5H2F C;  3U2R A;  1ETV A;  1VQK I;  1E2X A;  3JAM K;  2LBF B;  3B6A A;  4OIO F;  1VQO I;  2WAD A;  3AG4 H;  3I59 B;  1TP4 A;  1XGM A;  4I6Z A;  4A3M J;  4XIC A;  1STZ A;  4FQG A;  3R4K A;  1D8J A;  1KON A;  3DQV C;  3ASO H;  2K5C A;  4O6J A;  5FGM A;  3DEW A;  4LG0 B;  3C2G A;  2V1D A;  3HC7 A;  1I3A A;  1R5I D;  4HNT A;  4BGD A;  1R49 A;  3BRO A;  5ED4 A;  2G7U A;  3I54 A;  3HUG A;  1CF7 B;  3I55 I;  1YRN B;  1XB4 A;  2JA8 J;  1SVL A;  4HQE A;  2X85 A;  2LY1 A;  4PZJ A;  2RQQ A;  1MMG A;  5M3M J;  4WWC A;  5CKT A;  3T8R A;  1QBJ A;  4PJN A;  3ZQL A;  2YX7 A;  5LD2 C;  3VOE A;  2XF5 A;  4R1H A;  3VDX A;  2JA2 A;  2B7E A;  3ZQQ A;  4MTD A;  4LLG F;  2E60 A;  1G59 A;  2F4M B;  2MC3 A;  2WAF A;  3AG1 H;  3FF5 A;  2OV7 A;  2RC4 A;  4Q4Z F;  3ZQH A;  1ZRE A;  4BY1 J;  3KP3 A;  4BUP A;  4PUS A;  5BMZ A;  5E8G A;  2LFB A;  1S8N A;  4XKW A;  2OAZ A;  3CC4 I;  4OIP F;  3K4K A;  3HRT A;  4V19 K;  2VC1 A;  1MDM A;  2PJR A;  2CQQ A;  4IHW A;  1MKM A;  3MKY B;  2B9S A;  2NXN B;  1BI3 A;  3OOP A;  3LSH A;  5M5W J;  3MFK A;  2XRN A;  3BZC A;  2M2E A;  2E36 A;  1GVJ A;  1JUM A;  3M8F A;  2PMZ N;  2XAG A;  1ZAO A;  5F0F A;  1P7J A;  3QU6 A;  5F0H A;  2MFZ A;  1KU9 A;  4A0Y A;  3GTL J;  1Z91 A;  5TRD A;  2M3A A;  4IF4 A;  2EA4 A;  4NNJ A;  1O57 A;  3R60 A;  5AON A;  3S8P A;  3GME A;  3AL0 B;  3C1D A;  5L3B A;  1WGX A;  1JKQ C;  2QQ8 A;  3M8E A;  2QSH X;  2L54 A;  4EGY A;  2BZT A;  3TP0 A;  3I53 A;  3PNY A;  1SAU A;  3MAJ A;  4XRM A;  1O3R A;  3CD6 I;  5KVR A;  1R22 A;  3VYR B;  5A2Q K;  1ZG5 A;  3IHU A;  4FCY A;  1LPQ A;  1IUY A;  2HVS A;  1MW7 A;  4M3D A;  1OCR H;  4XNF A;  3G3Z A;  3TOA A;  2I10 A;  3RQ4 A;  1P4A A;  2ESH A;  1JHH A;  4A3K J;  3OYB A;  2UUZ A;  2VAS A;  2VI6 A;  2F5E A;  4HF1 A;  4IHS A;  1MBJ A;  3J7Y J;  3T1B A;  1Z67 A;  4M9Z A;  3F8F A;  3Q0U A;  2KIU A;  2DFI A;  3J80 K;  2KRF A;  3G2B A;  4OU0 A;  2HTJ A;  3LAJ A;  2IJL A;  1APL C;  4AIK A;  4NC8 A;  4NQW A;  1YX5 A;  5J4Y A;  1FP1 D;  3DV8 A;  4LIU A;  1FOW A;  1NG7 A;  3GUD A;  3LSI A;  1A31 A;  5HLG A;  2LY2 A;  1UAA A;  4XQF A;  4JQF A;  1BIA A;  3VWB A;  2E2I J;  4II3 A;  3PQJ A;  2EB7 A;  2GXG A;  3A03 A;  2H94 A;  3J7A Y;  5LGU A;  1ZN2 A;  2ZME C;  2OC6 A;  1MSE C;  2OTJ I;  3WGG A;  5E20 A;  3BR6 A;  1S7O A;  5FD5 A;  1YHQ I;  2AXL A;  3L09 A;  3JTH A;  2R0Q C;  1VQ7 I;  1NG6 A;  2X1D A;  1JI8 A;  1PUF A;  3G6E I;  2HYG D;  1TQI A;  1U0J A;  4CH7 A;  3DKX A;  3G73 A;  3L2Q A;  4E7K A;  1DPU A;  2L7M P;  3OWT A;  2EZH A;  2QLZ A;  2X6W A;  1EH7 A;  1R1U A;  4DZJ A;  3F21 A;  2ACJ A;  4JYK A;  4MEX F;  1RUN A;  2K27 A;  2XGE A;  3LNQ A;  1I1S A;  5DDG A;  3N4M A;  5HLH A;  4IHV A;  3HOY J;  3S14 J;  1FBS A;  2XAS A;  5GAH J;  2L02 A;  2QCO A;  2R5Y A;  1W5T A;  3E6M A;  2F5C A;  4BJT A;  1YW9 A;  2LLK A;  2UZK A;  4ENJ A;  2XV4 S;  2ZKZ A;  2PG4 A;  1U6G A;  2Q2E B;  2L9V A;  3LOC A;  1VQP I;  3CDI A;  2G0E A;  2DJN A;  3FXO A;  1A6I A;  3FM3 A;  5F6F A;  3W2V A;  2J5P A;  1FTZ A;  3D1N I;  4E7Z A;  2VKH A;  2JA7 J;  3BC8 A;  2R3S A;  3IRR A;  2YSR A;  1MMS A;  4LMY A;  1KYZ A;  5ICG A;  3JR9 A;  2HZT A;  3KFW X;  1YS6 A;  1HF0 A;  1Z0X A;  5J6X A;  2M0M A;  1RKT A;  3GTK J;  1N25 A;  1ZGJ A;  2GOM A;  2XPW A;  3CMA I;  1FNN A;  3O2P E;  4BHB A;  4ZH4 F;  2K02 A;  3WU1 B;  2DA1 A;  5CVI A;  1DGW Y;  1YG2 A;  2MLG A;  1MNM C;  2DJI A;  4EAT A;  1VFC A;  4L5E A;  4BL0 B;  2LMD A;  2Y2Z A;  1IAW A;  1I5Z A;  1WQ2 A;  2X1E A;  1W0T A;  4BQQ A;  1HQC A;  2KL4 A;  2DTR A;  2IAI A;  3F8N A;  1W36 D;  3K7A J;  1B72 B;  2ZXW H;  1T33 A;  1NH3 A;  1AKH A;  5LEJ A;  2CFO A;  3N97 A;  1V5E A;  3RYR A;  3M3Y J;  1FSH A;  3ABK H;  2FJ1 A;  1XS9 A;  3OMY A;  3H9G A;  2H6C A;  2DYR H;  3OS2 A;  5D8K B;  5LBQ A;  5ICF A;  2A61 A;  3BPV A;  5CQE A;  2W1O A;  1TW2 A;  3ZOB A;  4Q48 A;  5K1Y A;  3QPT A;  2HKX A;  4Y7N J;  4X6A J;  3PIO F;  2Q1Z B;  2CG4 A;  2K86 A;  1I27 A;  1O7L A;  4HX4 A;  4EJV A;  4GDF A;  3BPX A;  1TT5 B;  2CW0 F;  2VJJ A;  2CQN A;  3CC2 I;  1DP7 P;  2L7K A;  4QWQ A;  2V9K A;  2XUB A;  1FJL A;  4CO8 A;  5B3S H;  2CS3 A;  3HKZ N;  2HI3 A;  3ABT A;  2WY7 Q;  2NVX J;  3DBR B;  3A01 A;  2FNA A;  3HTS B;  3LQQ A;  4J19 A;  1WH7 A;  2CW8 A;  4HX8 A;  2EV6 A;  3BWG A;  4AYB N;  1IJW C;  3QPS A;  1SFU A;  5C3E J;  3GTG J;  1IDZ A;  3QWL A;  1Y0N A;  2XC7 A;  2VIX A;  5FFZ A;  3H5A A;  1KZH A;  3CZ6 A;  3K6G A;  3HJE A;  3GZ5 A;  2KLO A;  4WXC A;  3DLL F;  3BZK A;  4DNC A;  2OZU A;  1LFU P;  1K79 A;  1WKM A;  4UXN A;  4XLA A;  1U78 A;  4C2M J;  3KLN A;  1X1D A;  4IO9 F;  2BHY A;  5HDG A;  2ETH A;  1T38 A;  1IDY A;  2XAF A;  1MJA A;  3FKJ A;  3WTV C;  3ML6 A;  5GPA A;  2E34 A;  3HOV J;  4FE4 A;  4XR6 A;  4ZZL A;  2O61 A;  3E97 A;  1D0X A;  1WJF A;  4EVI A;  2X4H A;  2PQ8 A;  1ORK A;  5EEA A;  3BY6 A;  5ILU A;  4JX6 A;  1EH6 A;  4BAY A;  1ZRD A;  4Y33 A;  4D5C A;  2VOP A;  4RA2 A;  2NVQ J;  3NAU A;  2VJI A;  3O3K A;  3U21 A;  2MD0 A;  1CGP A;  4FE7 A;  1R58 A;  3LSK A;  4P1W A;  1SFK A;  5LEK A;  5IOZ A;  2YU9 J;  3JAM Z;  2NAZ A;  2XF7 A;  2A69 F;  5J8F A;  3D5L A;  4N9H A;  5CVJ A;  1OCO H;  1RUO A;  2V79 A;  5ICE A;  2Z9O A;  2IEK A;  2A3S A;  1K4T A;  3A2K A;  3VYT B;  2K4J A;  1U5T B;  3DWL E;  1OMI A;  2MBF A;  3BG9 A;  3ZQI A;  1OPC A;  2ZME B;  3KEY A;  4X1E A;  2FBH A;  1T6S A;  2MD5 A;  5JHU A;  2LNB A;  4KIC A;  2HTS A;  4XN0 A;  2LP0 A;  3UR3 C;  2DFH A;  5E3M A;  2LTP A;  4KFC A;  2NOG A;  3CLO A;  3K4J A;  3MN2 A;  3BR0 A;  1RIO H;  3BLY A;  1UJ8 A;  2LF8 A;  4M9S A;  2JK3 A;  3QAH A;  1M1E B;  1HW5 A;  3N05 A;  3V42 A;  1ONV A;  3DTE A;  2DO7 A;  2KJC A;  2GIV A;  4BXU A;  3M07 A;  3BOQ A;  3LA7 A;  2H8R A;  4I2O A;  1U9O A;  4WXH A;  1YIO A;  4AIJ A;  3I58 A;  4BHC A;  4BQA A;  3CUQ A;  2X48 A;  1EJ9 A;  2HYJ A;  1EF4 A;  2GIZ A;  1G4D A;  4G7Z F;  2E1N A;  1KA8 A;  3CDH A;  4HF0 A;  2L4M A;  4RB2 C;  1IN7 A;  3BG6 A;  4B48 A;  3MMY B;  4PCQ A;  1OCT C;  1RES A;  1YS7 A;  3FHN A;  1S9H A;  3R6S A;  3F0C A;  4BNC A;  4E7I A;  1JJ6 C;  4CHU A;  4UVB A;  5HDN A;  1R9T J;  2PMU A;  1O3Q A;  1GXP A;  2ZFU A;  5DS9 A;  4BH9 A;  3KP6 A;  3FXK A;  4KIG A;  3GBG A;  2EZL A;  3IWZ A;  2R7R A;  4AC0 A;  1XD7 A;  2QEX I;  2VOD A;  3Q9S A;  1ZKG A;  1S72 I;  3GXO A;  4NHJ A;  4CCK A;  3V8J A;  1UHS A;  2BV6 A;  4ZDL A;  1RNL A;  1Y6I A;  4M6V A;  3I0T A;  5F0C A;  3S93 A;  4CDG A;  4ZJZ A;  1VQM I;  2QSF X;  4MNU A;  5K5Q A;  1AA7 A;  2R92 J;  1IRZ A;  3HOW J;  3OL3 A;  3EYY A;  1J7K A;  1SFO J;  3GTJ J;  3TBI A;  4JX4 A;  2XHK A;  1P2F A;  2VQL A;  1YTY A;  1QPM A;  1W7P A;  3WGI A;  4X0G A;  1HKT A;  2LRD A;  3QYF A;  3KCC A;  4BEH A;  3HUG B;  1T2K A;  1J59 A;  2Q0O A;  2ZBK A;  3GX4 X;  3G71 I;  4YEJ A;  3JRG A;  1KQ0 A;  3MVP A;  3J80 Z;  3OS1 A;  1YFH A;  2EFQ A;  3MEX A;  1MD0 A;  1UZC A;  3QYE A;  1QZE A;  4RMN A;  4D0P A;  2JPB A;  1V54 H;  3OYH A;  1JJ8 C;  3I56 I;  3U1K A;  4N4N B;  1R36 A;  5E1X A;  2VBZ A;  1WJD A;  1Y0U A;  1N77 A;  2RGV A;  3DCF A;  4UB6 C;  3HL2 A;  3RYP A;  1WJE A;  3PFY A;  4G7O F;  5JI6 A;  2ZC2 A;  1OIS A;  4L9V A;  4S0H B;  1TW3 A;  1ULY A;  3GZN B;  2GQQ A;  2Y9Z A;  3E7L A;  3QPH A;  1KQ9 A;  1D1A A;  4ENN A;  1MDM B;  1OJL A;  2PJR B;  1QZY A;  2A68 F;  2COB A;  2NNN A;  3NWT A;  3NWS A;  2QEN A;  4G8X A;  4B47 A;  4Y52 J;  2IS1 A;  4AVZ A;  1F43 A;  2VBX A;  2KKO A;  1FIP A;  2BY1 A;  4AWX B;  3CP2 A;  3RZO J;  5BS6 A;  1HXD A;  3MZ8 A;  1YYV A;  4EQQ A;  1OR7 A;  2FNP A;  1MBH A;  3KP2 A;  4BYY A;  4IHT A;  2M7B A;  3Q5F A;  4J01 A;  2HYF A;  3ZXS A;  2EJR A;  4U0Y A;  3Q0W A;  3PIP F;  1F9N A;  3F22 A;  2VLA A;  1X1P A;  2BW3 A;  3TGN A;  3GW2 A;  3BTJ A;  1DDN A;  2V1U A;  2XKO A;  1MMD A;  3JRH A;  2D45 A;  3GCM A;  3RPQ A;  2ICW G;  2V9V A;  3GWZ A;  5LFA A;  5LHG A;  5GPC A;  2HS5 A;  3AG3 H;  4MQ9 F;  2W00 A;  2DK8 A;  4P55 A;  2IS4 A;  2CUJ A;  1B6A A;  1IN8 A;  1MBF A;  2HVR A;  3AFH A;  5F27 A;  5H6Q A;  2OPT A;  2M4G A;  2R7V A;  4XOR A;  4BJ6 C;  3T8T A;  2F48 A;  1F36 A;  3W3C A;  5M5X J;  4DIQ A;  3OYE A;  3QOP A;  3S3M A;  5CQG A;  3CCQ I;  2K9L A;  3PNV A;  3WTS C;  4RAY A;  4M72 A;  2A5W A;  1LEB A;  4HYE A;  4CGZ A;  2RNG A;  2XVC A;  2O5R A;  3MWM A;  2PI0 A;  3FXU A;  5EF6 A;  2XPU A;  4NQW B;  2BE5 F;  2VT3 A;  3Q0V A;  2M5W A;  1MMA A;  5BPD A;  2BY3 A;  3ZMU A;  3L2C A;  3GZ6 A;  5FLV A;  5DTD A;  3BG5 A;  2Z16 A;  5IT9 K;  5J8C A;  3TL4 X;  2M30 A;  4ZDP A;  1FYK A;  2L7F P;  4A3F J;  1IO2 A;  1TWH J;  2H1L A;  3IP4 B;  3CCR I;  2O6G E;  1K7A A;  5EG0 A;  1X2N A;  3RKW A;  5IP6 A;  1ETY A;  3C2B A;  1T95 A;  3ZQG A;  1TBX A;  1BC7 C;  2E2H J;  3CJT B;  5F1R A;  4UVA A;  4XSX F;  2E71 A;  4W97 A;  3ZRG A;  2VL8 A;  3QRF F;  3ROU A;  1Y8R B;  1PUF B;  4BU2 A;  2QQA A;  3E3V A;  3L2U A;  1J0R A;  1PP8 F;  5IOY A;  3FBI B;  3H5R A;  2H09 A;  4HG2 A;  3U1D A;  3IH2 A;  3GTP J;  3O8H A;  3H36 A;  5B1A H;  3CUQ C;  1JTX A;  1XN7 A;  1K4S A;  1WVR A;  2IXS A;  1ZG1 A;  3W6J B;  2EH3 A;  2R5Y B;  1B8I B;  2HDW A;  1KGS A;  3WHB A;  2KHM A;  3HYI A;  1SAX A;  4BQO A;  2VXD A;  2XSJ C;  2A07 F;  3HTU A;  3ABL H;  4V2G A;  3X2Q H;  3L2V A;  2PFB A;  1X1A A;  2DAO A;  1YJ9 I;  2F4I A;  4E6K G;  1G3S A;  3UNG C;  2H27 A;  5F64 A;  5D4R A;  2EFO A;  2RAE A;  4GXO A;  4ESF A;  2HZD A;  2DI3 A;  5CYV A;  2R7D A;  2ZNZ A;  4PJM A;  1I6X A;  4NDL A;  2V7F A;  4CCO A;  4UUS A;  3SDB A;  2EIN H;  1WSU A;  3TQN A;  2M0C A;  4UUT A;  3I4N J;  4MGR A;  2W84 A;  4L5J A;  1K6Y A;  1UB9 A;  4XK4 A;  3CUO A;  1X2M A;  4L0Y B;  2ESN A;  2JA6 J;  4ESB A;  2GLO A;  1H8A C;  3LAP A;  2K7L A;  1MBK A;  2AXT C;  3EUH A;  3W6K B;  4IQJ A;  3E5U A;  5HDK A;  3DU5 A;  5IP9 J;  4E4H A;  1ZGW A;  1TNT A;  2VJ5 A;  3WG7 H;  2VOO A;  4RAZ A;  2VQH A;  2RNJ A;  3KPH A;  5JLW A;  1AU7 A;  1A5J A;  1ETO A;  1Y56 A;  5DV5 A;  2R7X A;  4FT8 A;  2IT0 A;  3DTK A;  3GVA A;  3H3Z A;  3J7Z I;  1RRJ A;  3HPH A;  2YR2 A;  3F8C A;  4RM2 A;  2YX4 A;  3PL8 A;  4FX0 A;  2BOL A;  3OYF A;  1AKH B;  2JRM A;  4WX9 A;  4MEY F;  3LSP A;  3MZY A;  4EM0 B;  3BQY A;  4NB5 A;  1IXC A;  2DBB A;  1WZ2 A;  3H0G J;  1FP2 A;  4MTE A;  3DU6 A;  2EZI A;  2Z1D A;  4PGH A;  2QWW A;  3E5X A;  1Z1D A;  3OOU A;  2V4J C;  4OMZ A;  2FML A;  1Y8Q B;  2KRC A;  4HBL A;  3TO7 A;  1HKQ A;  2F6C A;  3L9F A;  4OIQ F;  2FEZ A;  1JGG A;  5DD8 A;  1VZ0 A;  3FXQ A;  3WTY C;  4C2T A;  1K83 J;  2DQR A;  5DM6 F;  4PK4 A;  5DYM A;  1FWZ A;  1CQT A;  1SFE A;  2OF7 A;  3EUK L;  4ANJ A;  3M1C A;  5GP9 A;  4Y3O A;  3K1M A;  3RDI A;  3ZQ7 A;  3A01 B;  4E7H A;  1JE8 A;  4HOB A;  1MBE A;  2W7N A;  2V1X A;  1NHA A;  3HSE A;  1X1B A;  4N9I A;  2FSW A;  4LFU A;  1EV7 A;  2L0K A;  3EET A;  2BEO A;  3GFI A;  1YJW I;  4HPQ A;  2M34 A;  2HDC A;  5L3F A;  5E3O A;  2Y31 A;  2OQR A;  3I64 A;  3IRQ A;  4U88 A;  3HOZ J;  3SFZ A;  2HQR A;  2FOW A;  2Y0S A;  4MFE A;  3KZI C;  1GXQ A;  1OYW A;  2AS5 F;  5EEG A;  4GGG A;  1E17 A;  1Z7L A;  1U9N A;  4A0Z A;  4OOI A;  3MKZ A;  2DOA A;  2E1M B;  2CUZ A;  1WFX A;  1YIJ I;  4PSX A;  3JSO A;  1LE8 B;  2A6H F;  5BNG A;  3PUF A;  3LST A;  3I4P A;  4EGZ A;  3AG2 H;  1MH3 A;  4R8H A;  3TW6 A;  1U5T C;  2JJ7 A;  2PLY A;  1J9I A;  3CMY A;  1GT0 C;  3K9T A;  2V9P A;  2H6B A;  5IYD J;  2P5V A;  4CUG A;  4U7D A;  1BI2 A;  5EZG A;  4BAC A;  2L9R A;  3GFJ A;  3PO3 J;  4XLH A;  4I98 B;  2DMP A;  3PUB A;  3QYB A;  4YG2 F;  1WH5 A;  4YFK F;  1QHG A;  1QO0 D;  1PDN C;  2E7W A;  2WAE A;  3S15 J;  2DMT A;  2QA4 I;  1I39 A;  4CIC A;  3LSM A;  1F5T A;  1MNE A;  4OMY A;  1P92 A;  4RB1 A;  1IN6 A;  4HZF A;  2ELH A;  3E5Q A;  4EJW A;  2LYC A;  1T08 B;  3DBH B;  3F9K A;  2G9W A;  3U9G A;  1W4M A;  5IY5 H;  5C44 J;  2GBY A;  3I9V 2;  3BP8 A;  1JUP A;  4CYD A;  1MIJ A;  5GTH C;  1RKW A;  4XLP F;  2DCE A;  2M1B A;  4C3I J;  1TZL A;  3H35 A;  2FQ3 A;  5FLX K;  4ZDO A;  2EA2 A;  2RQP A;  4BBR J;  3ELK A;  2X51 A;  5GAG J;  4S04 A;  1QGP A;  1DQU A;  1QRY A;  4GFB A;  2V26 A;  4XKB A;  3SZP A;  3HB9 A;  3ASN H;  2ECC A;  3F3X A;  3MQ0 A;  2HGC A;  5D4S A;  3TMO A;  4FTH A;  3S16 J;  4Y15 A;  2HWV A;  1X1C A;  1Z6T A;  4P9U A;  2KIM A;  3HBL A;  3IH3 A;  5DEQ A;  3EQL F;  4V2F A;  3P9C A;  5IP7 J;  4QTR A;  1T0F A;  3MD2 A;  4DJA A;  3F8M A;  3HOT A;  2XB5 A;  4D5F A;  3REO A;  4G7H F;  5DCM A;  1A04 A;  4A2U A;  1TTY A;  4Z6Y A;  3CUQ B;  2FU4 A;  3CDL A;  1SD5 A;  5L3D A;  1ENH A;  2DT5 A;  2JT1 A;  3BJO A;  1LDJ A;  2EV5 A;  2JN6 A;  4NUB A;  1IG7 A;  3ABM H;  2O8K A;  2M4K A;  2LC2 A;  1CF7 A;  3GEZ A;  2GAU A;  1XDU A;  3W6V A;  4A3G J;  1O7F A;  2MH9 A;  5J3L A;  3SZG A;  4FX4 A;  4A3J J;  5B1B H;  1JHF A;  5JFR A;  2WAQ A;  1RR7 A;  4AVP A;  3BG7 A;  4RB3 C;  4RGS A;  5ICC A;  3H1C A;  1WJA A;  4A3B J;  1BOA A;  3HRS A;  3K4C A;  2R7O A;  3IV5 A;  2HPI A;  3V7R A;  4B3X A;  2DDB A;  1MZB A;  1RPW A;  3KX2 A;  3QPL A;  3D5S C;  1W5C C;  4IJA A;  2EZK A;  3F23 A;  2XB0 X;  2CO5 A;  2VBW A;  3F6V A;  3WTW C;  3H5N A;  4FAS D;  2HNH A;  2XAJ A;  5IYC J;  1UST A;  3C7J A;  3GYH X;  2QQB A;  5GAD J;  1SFX A;  2DTZ A;  2B63 J;  2HQA A;  3VB2 A;  1TWA J;  4XLN F;  3S2H J;  1GHC A;  2XIG A;  1WWX A;  3E6D A;  3B73 A;  1ETK A;  3EUH C;  4BQN A;  4XOT A;  3IWF A;  2N8G A;  4KN7 X;  2E1O A;  3SDG A;  1W7P B;  4EJO A;  1U3E M;  1DU0 A;  4BEH B;  1UMQ A;  2EFP A;  2CQ7 A;  1T39 A;  4B43 A;  3TO9 A;  4RS8 A;  4XKV A;  4CSW A;  2VPL A;  1ON1 A;  1ODD A;  3ZP5 A;  1IV6 A;  1WPK A;  2VE8 A;  4XRS A;  1D5V A;  3O6B B;  3SJM A;  4IVN A;  4DYC A;  3A02 A;  1SVM A;  4HA8 A;  2Y9Y A;  3CJN A;  5D6E A;  3KE2 A;  2NVU B;  2ZXJ A;  4Z2Y A;  4YIR X;  3JRE A;  3ZQC A;  2O0Y A;  1LKX A;  1B9M A;  1YE9 A;  2EIK H;  3FM5 A;  3NQO A;  1O4X A;  1SD7 A;  5IT9 Z;  1MBG A;  1XCV A;  1FC3 A;  1F1Z A;  3HPG A;  4A69 C;  1ZR2 A;  3IKV A;  4KA4 A;  4A12 A;  1H0M A;  1EA3 A;  1XC5 A;  1FMV A;  3K70 C;  3IKT A;  1MJ9 A;  1MND A;  1W0U A;  5K7F A;  1V5G A;  2P5K A;  1OFC X;  3HG9 A;  2QKM B;  3PJR A;  5HNH A;  4XRF A;  2FF4 A;  2JRT A;  3IC7 A;  1XMA A;  2VN2 A;  2W85 A;  2BVM A;  3PQK A;  4LLL A;  1U8R A;  2XAU A;  1WHU A;  4IRI A;  2IS6 A;  4KDP A;  1HCR A;  2QGU A;  1IV8 A;  3H9Q A;  1KU2 A;  3WHC A;  4EEF G;  2GWR A;  2UV1 A;  3G4S I;  2QF7 A;  4I76 A;  3H3V K;  2P4W A;  2GM4 A;  2NS8 A;  3VFZ A;  1XDS A;  2IGN A;  2BW3 B;  1LFB A;  3KZZ A;  2BVL A;  2HKO A;  2IRF G;  1XGO A;  2NVT J;  1LDK B;  4BY7 J;  3BR2 A;  2QQ9 A;  1V5F A;  1UFM A;  4HDU A;  4NC6 A;  5LGN A;  1G3T A;  4IQ4 A;  2BY2 A;  2HQ5 A;  3ERE D;  3WE2 A;  2VB6 A;  2HEO A;  4CZZ A;  1J75 A;  2HDD A;  1BJZ A;  3S3N A;  4UNO A;  3JRB A;  1XX5 A;  2QYO A;  4J00 A;  4KYW A;  4ASN A;  4BDZ A;  2FOK A;  3CCM I;  4CCL A;  4CXF A;  4ZTF A;  2R7W A;  2H8W A;  2STW A;  3RI4 A;  1IRG A;  3TED A;  3RSN A;  1HC8 A;  5JHF A;  4RGU A;  1YJN I;  5BOX A;  2K4B A;  2NYX A;  4DYQ A;  4LB5 A;  1YW7 A;  3K1N A;  5FD6 A;  4RM3 A;  5M3F J;  4ENM A;  2FD5 A;  2JPC A;  2PN6 A;  2ZSI B;  4U7B A;  3J81 K;  1XSD A;  2VKV A;  2HVQ A;  3CC7 I;  2NS7 A;  4IPA A;  1VF9 A;  5H20 A;  2L9S A;  3K4L A;  2HOE A;  4F52 A;  1FPQ A;  1Z21 A;  1GDT A;  3KLO A;  2VUM J;  4HX7 A;  1FOX A;  5FRM A;  2FQ4 A;  4OAY A;  4WXD A;  3A1Y A;  2CV2 A;  5EG0 B;  4HNU A;  2CQX A;  2D2W A;  3CES A;  4M71 A;  1MMN A;  4XOP A;  5LRR A;  5DUK A;  3SHF A;  1LVK A;  2CW7 A;  3BG3 A;  3VEP A;  4KMF A;  1P4W A;  3M4O J;  4I99 C;  5K5O A;  2EFN A;  4PFO A;  1HDP A;  2DFE A;  2IA0 A;  2XGC A;  4KIB A;  5DM7 F;  1R5G A;  2CV0 A;  2WV1 A;  3CF5 F;  3DKY A;  4D7M A;  2LY9 A;  4HV6 A;  5EJC A;  2XAQ A;  5HLI A;  3T0Y A;  2NNY A;  2PBI A;  3QOE A;  3LA3 A;  3ZN1 A;  1R4M B;  4G94 A;  3ZMS A;  4YIF A;  1S3J A;  2JVH A;  5KCM A;  5D5U B;  2DPD A;  1ZQ3 P;  1Y1V J;  5F08 A;  2IBD A;  2FMY A;  2Y0S N;  5B66 C;  2HQN A;  2O3F A;  4UY8 I;  5E18 F;  1O3T A;  2ELJ A;  1RI7 A;  1H9T A;  1J2X A;  2HR3 A;  4I0B A;  5J4V A;  2JVG A;  4XID A;  1RET A;  5JVT A;  4LJZ F;  2DA2 A;  3ZMD A;  4ZYG A;  1BOB A;  3LFK A;  1I1G A;  3L00 A;  1HLV A;  4YII A;  3RZD J;  4XRS G;  2IVM A;  2DOD A;  3BTI A;  3CTA A;  3JW4 A;  3WTT C;  2P0W A;  1DGR M;  4UUS B;  3B6C A;  5IT3 A;  3F72 A;  2EK5 A;  3FBN B;  2FRH A;  2ZJP F;  3OS0 A;  2ZXI A;  1TWG J;  1W5S A;  4JK1 X;  2R5Z A;  1BN5 A;  3ZN0 A;  2KJB A;  4PDK A;  4M3E A;  3PNT A;  4YFN F;  2YPR A;  5E3N A;  2HOA A;  3WU2 C;  5HVQ C;  3KYL A;  4QPQ A;  2CFX A;  1U8B A;  4KMU X;  3KYD B;  1Z3Y A;  2EFW A;  2E19 A;  3A0H C;  4PFP A;  5FKK A;  3V7C A;  1JGS A;  2AQF A;  4AID A;  4DYR A;  2OTL I;  3OYA A;  5ILV A;  4MO7 A;  2VQC A;  4C3J J;  2VPR A;  2VBY A;  3SXY A;  1TL8 A;  1LUJ B;  2B0L A;  2L2O A;  4A3I J;  3WE3 A;  1DP3 A;  2Z5U A;  3F8B A;  3VSL A;  2R7U A;  1HOM A;  1X3Z B;  2KDO A;  4EV0 A;  5J1U A;  3CJR B;  1OQY A;  4HW0 A;  4M3B A;  2VKD A;  5FRN A;  1B9N A;  4B44 A;  4S05 A;  3V7S A;  3RIR A;  2WC2 A;  2JMW A;  1UG2 A;  3H3U A;  2NOJ B;  4DW6 A;  2KFD A;  5D5X B;  4OIN F;  3HHG A;  1GUU A;  1BL0 A;  2E1M C;  1JTY A;  1R4N B;  2CV1 A;  3S1N J;  5KNL A;  1ZK8 A;  2BBY A;  1FOK A;  5FLX Z;  3FMS A;  2FBI A;  4CA0 A;  5HLT A;  3DPL C;  2R7F A;  4B8X A;  2OQG A;  3CF2 A;  2K9M A;  2DT6 A;  4UV8 A;  4XN3 A;  3IAM 2;  3C2H A;  2MA3 A;  4MQV A;  2M45 A;  5KK1 A;  1UCR A;  2DA5 A;  2JTV A;  3SQN A;  4JBA A;  2IA2 A;  2L01 A;  3JRD A;  1B1B A;  3L2W A;  3JRA A;  5DCF A;  1QZZ A;  1X58 A;  4XON A;  2LK2 A;  2Z2S B;  3TKY A;  3JCU C;  4MIM A;  2TRT A;  2WAQ N;  2KT0 A;  2KP6 A;  5FB2 A;  4M6X A;  2F4O B;  2IGO A;  1X19 A;  3D5R C;  5LHH A;  2LKS A;  2AO9 A;  1SC7 A;  2BXY A;  2RV8 A;  1HSJ A;  2FXA A;  2LF7 A;  4L0Z B;  3KYC B;  2Y75 A;  4HSR A;  4OAZ A;  3JTG A;  1F4K A;  4IRH A;  1Z9C A;  3ZPL A;  1ZTR A;  2JQ7 A;  1YI2 I;  2MH2 A;  2WV0 A;  3NEU A;  1H88 C;  2PJP A;  2NRA C;  3COA C;  4KNY A;  2ECB A;  4O3M A;  2KZG A;  4EMS A;  3PO2 J;  4HQM A;  4D9J A;  1XMX A;  3ZGK A;  1A6Q A;  3HOS A;  1ZRF A;  3VOD A;  4B1R A;  4DZP A;  1S29 A;  2VC0 A;  3HKZ A;  1LJ9 A;  5J1Y A;  1P4X A;  4DBR A;  3TDU C;  4G12 A;  2F5D A;  1LFP A;  4YEL A;  4BE0 A;  4IHX A;  3OYJ A;  1R7J A;  2FUG 2;  5CJ9 A;  3S2W A;  2QBY A;  4XLE A;  3TP3 A;  1TWF J;  2K9S A;  2EBI A;  5E17 F;  2IW5 A;  1MGT A;  4D7N A;  5FLM J;  2VON A;  4JX5 A;  1R1V A;  1USS A;  1HW1 A;  4MHG A;  5K7Z A;  2QKL B;  3LFU A;  1D0Y A;  2UXX A;  1YW8 A;  4XM3 A;  3BT9 A;  1GLN A;  4GCV A;  4O5V A;  4UVC A;  2LOO A;  3FXM A;  2MGQ A;  1RC9 A;  3LMM A;  1IN4 A;  1QHH D;  2RDP A;  4KN4 X;  4R79 A;  4HRI A;  4HEA 2; 
#chains in the Genus database with same CATH homology
 4FE4 A;  2R7Z J;  1BW5 A;  5EYR A;  2O7O A;  1I3Q J;  1ORK A;  3FIW A;  3HM5 A;  5EEA A;  1BA5 A;  4JX6 A;  1FIA A;  5C44 J;  1FEX A;  2GBY A;  2XGD A;  4D5C A;  3VPR A;  1JUP A;  4A3E J;  2NVQ J;  4BXX J;  1RKW A;  4JP0 A;  3NAU A;  4C3I J;  4FE7 A;  4BBR J;  1QRY A;  5IOZ A;  2YU9 J;  4GFB A;  3HB9 A;  2K9Q A;  2ECC A;  3LSG A;  3S16 J;  4FTH A;  1QVU A;  3HBL A;  3IH3 A;  4V2F A;  2ME0 A;  3JRF A;  5IP7 J;  1MSF C;  4QTR A;  4A3D J;  2XB5 A;  1IGN A;  4D5F A;  2IEK A;  2HOS A;  3OIO A;  1Q1V A;  3QQA A;  4RBO A;  1XG1 A;  3ZQI A;  1ETX A;  3BG9 A;  3CDL A;  2DA7 A;  4CYC B;  1MH4 A;  1ENH A;  3Q3S A;  4X1E A;  1GV2 A;  5EGO B;  1Y1W J;  2JN6 A;  3K2A A;  5M5Y J;  2ID3 A;  1IG7 A;  2D5V A;  2O8K A;  2LP0 A;  5E3M A;  2LTP A;  3W6V A;  2NOG A;  4A3G J;  5J3L A;  3MN2 A;  3TW7 A;  3BR0 A;  2DMU A;  4A3J J;  2YS9 A;  1SAN A;  1NTC A;  2JK3 A;  3G1L A;  1RR7 A;  4MLO A;  3FIS A;  3BQZ A;  4QSH A;  4HNV A;  1NK3 P;  3I4M J;  4A3B J;  3BR1 A;  2H8R A;  4B4C A;  4W1U A;  1U9O A;  2YUS A;  2LKX A;  1G2H A;  3IV5 A;  2X48 A;  4CYC A;  1T56 A;  2HYJ A;  2HOT A;  1EF4 A;  2WB1 N;  3IH4 A;  5EGO A;  1RPW A;  3QPL A;  3OSG A;  2EZK A;  1Z77 A;  3JRI A;  2XB0 X;  5E3L A;  1ETQ A;  3O8G A;  4AUX A;  5IYC J;  1OCT C;  2MSY A;  1RES A;  2DTZ A;  3F0C A;  3PM1 A;  1JJ6 C;  1WCM J;  4BBS J;  2X6O A;  2B63 J;  1P7I A;  1TWA J;  1R9T J;  3S2H J;  1S7E A;  1GV5 A;  4BKX A;  5DS9 A;  1ETK A;  1ZR4 A;  5HOD A;  2DN0 A;  2EZL A;  3GBG A;  2N8G A;  3BTL A;  4B3A A;  4AC0 A;  2DMN A;  1FTT A;  3NAR A;  2E1O A;  2VKE A;  3SDG A;  1ZKG A;  3GTM J;  1GVD A;  2ELK A;  5FKO A;  1DU0 A;  1UMQ A;  2DA6 A;  1QPI A;  1UHS A;  2AHQ A;  1OCP A;  4RDU A;  1QVT A;  1VI0 A;  2R93 J;  4M6V A;  4A3C J;  5F0C A;  3BR3 A;  1IV6 A;  1WPK A;  4XRS A;  2CU7 A;  3SJM A;  4DYC A;  2R92 J;  3A02 A;  1IRZ A;  3HOW J;  2Y9Y A;  1ITY A;  3JRE A;  1SFO J;  3ZQC A;  3GTJ J;  2M9H A;  4C3H J;  4JX4 A;  3G1O A;  1O4X A;  2H1K A;  1MBG A;  5C4X J;  1JT6 A;  4A69 C;  1ZR2 A;  1ETV A;  1XC5 A;  3JRG A;  1W0U A;  3MVP A;  3B6A A;  3MKL A;  1BW6 A;  5K7F A;  2MG4 A;  1OFC X;  4A3M J;  4I6Z A;  4XIC A;  5FJ8 J;  1K61 A;  3DEW A;  1JJ8 C;  1TWC J;  3DCF A;  3JRC A;  1HCR A;  2DMQ A;  1YRN B;  3WHC A;  2JA8 J;  4S0H B;  4EEF G;  2QF7 A;  4I76 A;  3H3V K;  5M3M J;  2Y9Z A;  2GM4 A;  3E7L A;  2NS8 A;  3BTC A;  1B8I A;  1LFB A;  3S17 J;  3LSJ A;  1OJL A;  3ZQL A;  2COB A;  2NVT J;  1JUS A;  4Y52 J;  4BY7 J;  3BR2 A;  2KDZ A;  3S1Q J;  1WI3 A;  1F43 A;  1DU6 A;  1FIP A;  2K40 A;  3RZO J;  2HQ5 A;  2XPV A;  1MBH A;  2HDD A;  1BJZ A;  1YRN A;  3ZQH A;  3JRB A;  3GTO J;  4BY1 J;  4A3L J;  4ABZ A;  3Q0W A;  2K9N A;  2LFB A;  9ANT A;  3HGY A;  2CQQ A;  3BTJ A;  1JT0 A;  3TED A;  4IHW A;  5M5W J;  3JRH A;  2M2E A;  4DYQ A;  1JUM A;  3HEF A;  5M3F J;  2PMZ N;  5IYB J;  5F0F A;  5GPC A;  2FD5 A;  1P7J A;  5F0H A;  2HXI A;  2DA3 A;  3GTL J;  4QIW N;  2VKV A;  1MBF A;  3FK6 A;  2NS7 A;  5F27 A;  2OPT A;  1VF9 A;  2P81 A;  2EQR A;  1F36 A;  1WGX A;  5M5X J;  1JKQ C;  1GDT A;  2VUM J;  2FQ4 A;  3TP0 A;  2ZB9 A;  4XRM A;  5EG0 B;  2CQX A;  2HXO A;  5EF6 A;  2XPU A;  4FCY A;  3BG3 A;  3Q0V A;  4M3D A;  3M4O J;  3GTQ J;  2W48 A;  2I10 A;  5FLV A;  1HDP A;  2XGC A;  3UKG A;  5DTD A;  4A3K J;  2WV1 A;  2VI6 A;  5F04 A;  3BG5 A;  1MBJ A;  2LY9 A;  2MW8 A;  4D7M A;  2L7F P;  4A3F J;  1TWH J;  3Q0U A;  3FKI J;  3S1M J;  5EG0 A;  1X2N A;  1APL C;  5IP6 A;  1ETY A;  3C2B A;  5FKN A;  3ZQG A;  1ZQ3 P;  1Y1V J;  5F08 A;  2R5Z B;  2IBD A;  2Y0S N;  2E2H J;  5F1J A;  5JLX A;  4W97 A;  3HGG A;  2CUE A;  1PUF B;  3RQI A;  5IOY A;  4XID A;  1RET A;  2DA2 A;  2E2I J;  3BR5 A;  1HLV A;  3IH2 A;  3A03 A;  3RZD J;  3GTP J;  3O8H A;  4XRS G;  3BTI A;  1JTX A;  4UUS B;  1MSE C;  3B6C A;  4IEJ A;  2EH3 A;  2R5Y B;  1B8I B;  2JA5 J;  3HDD A;  3OSF A;  3BR6 A;  3WHB A;  1TWG J;  2R5Z A;  1H89 C;  4V2G A;  2R0Q C;  4M3E A;  3CCY A;  1PUF A;  5E3N A;  2HOA A;  1LE8 A;  1U8B A;  2LR8 A;  2L7M P;  2EZH A;  4DZJ A;  2X9D A;  4JYK A;  2O9L A;  2RAE A;  2XGE A;  3LNQ A;  4IHV A;  4A93 J;  4NDL A;  2E19 A;  3HOY J;  3S14 J;  5FKK A;  4UUS A;  5EZH A;  4DYR A;  4MO7 A;  2QCO A;  2M0C A;  2VPR A;  4UUT A;  4C3J J;  2R5Y A;  3I4N J;  3S2D J;  2LVS A;  2LLK A;  4A3I J;  2JWT A;  1NK2 P;  1HOM A;  1ETW A;  3HOU J;  4XK4 A;  1X2M A;  3LOC A;  2JA6 J;  3ZQF A;  1D5Y A;  2G0E A;  2DJN A;  2LD5 A;  1A6I A;  2GLO A;  5J1U A;  1H8A C;  2CUF A;  1MBK A;  1FTZ A;  5J1R A;  3D1N I;  4M3B A;  3RKQ A;  5FKM A;  5IP9 J;  2JA7 J;  1ZGW A;  2JMW A;  2NVY J;  1UG2 A;  4DW6 A;  5JLW A;  1A5J A;  1AU7 A;  1ETO A;  1GUU A;  3JR9 A;  5K7H A;  1BL0 A;  3S1N J;  1JTY A;  1HF0 A;  1Z0X A;  1ZK8 A;  1AKH B;  3GTK J;  1RKT A;  2Y30 A;  5IPA A;  1IC8 A;  2XPW A;  3LSP A;  5C4J J;  1POG A;  2XRL A;  3BQY A;  2DA1 A;  3H0G J;  5EDN A;  1MNM C;  3L1P A;  1VFC A;  2EZI A;  2ME6 A;  3FK7 A;  4L5E A;  2Y2Z A;  2DA5 A;  1W0T A;  3G1M A;  3OOU A;  1TC3 C;  3JRD A;  3JRA A;  1X58 A;  2IAI A;  1I50 J;  1JKO C;  2LK2 A;  2L7Z A;  4MIM A;  2TRT A;  3K7A J;  2WAQ N;  1B72 B;  4FIS A;  2KT0 A;  1T33 A;  2TCT A;  1JGG A;  1AKH A;  3SFI A;  1VND A;  2CJJ A;  2AO9 A;  2FX0 A;  3M3Y J;  1K83 J;  2FJ1 A;  1XS9 A;  1JKR C;  1CQT A;  2OF7 A;  5FKL A;  3S1R J;  5GP9 A;  1ZTR A;  3A01 B;  4MFD A;  1H88 C;  1MBE A;  4IHY A;  3ZOB A;  1JKP C;  2ECB A;  4Y7N J;  3PO2 J;  4X6A J;  2L0K A;  1HDD C;  2M34 A;  3HOX J;  2M8G X;  5E3O A;  2Y31 A;  1B72 A;  1IUF A;  3HOZ J;  4B1R A;  4DZP A;  4MFE A;  5J1Y A;  2E2J J;  1U9N A;  4G12 A;  1FJL A;  4IHX A;  3HKZ N;  2HI3 A;  1E3O C;  2NVX J;  3A01 A;  3TP3 A;  3HOV J;  1TWF J;  1LE8 B;  2K9S A;  5BNG A;  3CQZ J;  2EBI A;  4J19 A;  4M3F A;  1WH7 A;  4D7N A;  5FLM J;  1AHD P;  4JX5 A;  4AYB N;  4LOC A;  1MH3 A;  3TW6 A;  1IJW C;  3QPS A;  3GTG J;  5C3E J;  1IDZ A;  5K7Z A;  2JJ7 A;  3LSR A;  4M3G A;  3CMY A;  1GT0 C;  5IYD J;  3BT9 A;  2CRG A;  2XSD C;  1LFU P;  5EZG A;  2MGQ A;  2L9R A;  3PO3 J;  1U78 A;  4C2M J;  2DMP A;  1WH5 A;  1I6H J;  1IDY A;  3S15 J;  2DMT A;  2DA4 A;  2ID6 A;  5GPA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...