2R5ZA

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
75
Chain Sequence
b'KKNPPQIYPWMKRVHLRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
total genus 25
structure length 75
sequence length 87
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zA00
1K83J 4M6VA 2OPTA 5J1UA 1B72A 5C3EJ 1MBEA 4FISA 1F36A 2CU7A 1DU6A 2EZIA 3CCYA 2HOTA 4BBRJ 3K7AJ 1JUSA 1MH4A 2XB5A 5FKOA 1RESA 1OJLA 4BY7J 3FKIJ 3GTPJ 2IEKA 1Z77A 2NOGA 4QTRA 3TW7A 4V2FA 3S15J 3Q0WA 2FJ1A 2H1KA 2K40A 4XIDA 3A01A 3G1LA 1BJZA 4LOCA 5FLVA 2R92J 4MLOA 4CYCB 5IYBJ 2R5YB 1R9TJ 1PUFB 2EBIA 4D5CA 2I10A 3JRAA 3JR9A 1A5JA 4M3FA 1JTXA 1ZK8A 1Y1WJ 5EYRA 2EZKA 2FD5A 4A3EJ 2XGCA 4XRSA 2MGQA 2DA4A 3BTLA 2HXIA 3FK7A 3MKLA 2YS9A 4NDLA 1FJLA 1IGNA 1ORKA 2VPRA 2R5ZB 3HB9A 4JX6A 1HLVA 1BW5A 1WH7A 5M5XJ 3PO2J 2DA6A 2XPUA 2E2IJ 1MBKA 1W0TA 2CUEA 4AC0A 1ETXA 2X48A 1RKWA 4C3JJ 3I4MJ 4D7MA 1LE8A 3SJMA 2LVSA 1TWFJ 5EG0B 2O8KA 4FCYA 2GBYA 1X2MA 2VI6A 4C3HJ 4D7NA 1IJWC 3LSJA 4ABZA 1B72B 2WV1A 1HOMA 3GTGJ 4C3IJ 5C44J 3ZQIA 2XGEA 3NARA 1T33A 3S1NJ 3M3YJ 3BR3A 2TRTA 1UHSA 1XG1A 2Y31A 3QPLA 2AO9A 5M3FJ 2O9LA 5GPCA 3BR5A 4A3CJ 2GM4A 3HKZN 2GLOA 5EGOA 4W97A 3ZQHA 5FJ8J 1YRNA 2JK3A 2O7OA 1SFOJ 2CRGA 3A01B 2TCTA 1K61A 1ITYA 1HDDC 4X1EA 3JRDA 1IDYA 3UKGA 3I4NJ 1ETQA 3DEWA 1NTCA 4A3DJ 3MN2A 2XGDA 5F27A 2VKVA 1ZTRA 4XRMA 5JLXA 4BY1J 4M3BA 3H0GJ 2M9HA 2HI3A 1U9NA 1XS9A 1TWGJ 1VFCA 2XB0X 5E3NA 2DTZA 1IG7A 1RR7A 1AKHA 2NVTJ 1IDZA 1O4XA 3FIWA 4IHVA 1JKOC 5F08A 4J19A 2COBA 2E2HJ 2MW8A 2AHQA 1AU7A 4A3IJ 3ZQGA 1QPIA 1ZKGA 4A3GJ 2MG4A 1ETOA 4A69C 2P81A 3NAUA 3HBLA 2K9SA 1D5YA 3BQZA 2XSDC 2IBDA 4XICA 2DA1A 4B1RA 1LE8B 4M3EA 1GUUA 5J1YA 5GP9A 1H88C 4DZPA 3S1QJ 4V2GA 1B8IA 3IH3A 2ZB9A 1VNDA 3A02A 3MVPA 2VUMJ 3RKQA 3ZOBA 2LY9A 4D5FA 1F43A 4FE4A 1BL0A 5DS9A 5J1RA 1Z0XA 4L5EA 5F04A 1HF0A 5IP7J 1SANA 3HOYJ 2JA6J 1X2NA 4A3KJ 3JRFA 4M3DA 4M3GA 3OIOA 1MBGA 4MFEA 1TWHJ 4IHWA 1JJ8C 1AHDP 2DN0A 2DMTA 2CQXA 1YRNB 4S0HB 2ME0A 4MFDA 5DTDA 4DYQA 1ZR2A 1E3OC 4FTHA 2H8RA 4A3MJ 3S14J 1TWCJ 4C2MJ 2XRLA 2DJNA 1TWAJ 3ZQCA 2LLKA 1EF4A 5J3LA 1RETA 1JT6A 2ECCA 1Q1VA 3GTMJ 4UUSA 3PM1A 1ZGWA 4MIMA 4A93J 1AKHB 3HEFA 3IV5A 3OSGA 1BA5A 1FEXA 4DZJA 5IOYA 1NK2P 2Y9ZA 3BR0A 3OSFA 3GTKJ 2Y9YA 1HCRA 2ID3A 2NVYJ 3K2AA 1ETVA 2EQRA 2RAEA 5E3OA 4A3JJ 1LFBA 2HQ5A 2ELKA 2EZLA 3Q0VA 3BTCA 4IEJA 1FIPA 2HOSA 2FX0A 3IH2A 1RPWA 2LP0A 2DMQA 1B8IB 3S17J 4GFBA 2R7ZJ 2XPWA 5GPAA 4Y52J 2E1OA 2NVXJ 3HOZJ 2CJJA 3GTLJ 1MBHA 4XK4A 2R0QC 2NS8A 5F0CA 2JA5J 1I6HJ 4JX4A 4QIWN 3BTIA 5K7FA 3S2HJ 5FKMA 1TC3C 1GDTA 4IHXA 3ZQFA 1JTYA 2DMUA 2JA8J 3RZDJ 2HDDA 1WCMJ 3HOWJ 3BG3A 1JKQC 2L7ZA 3GBGA 1A6IA 5IYDJ 2XPVA 4A3LJ 2HYJA 3D1NI 4I6ZA 2N8GA 1JKPC 4RBOA 2JA7J 2M2EA 2KT0A 4I76A 2FQ4A 3JREA 1P7JA 1FTTA 1WI3A 5EF6A 5IPAA 4UUSB 3RQIA 2E2JJ 2EZHA 3QPSA 3JRHA 2LD5A 3PO3J 1I50J 1GVDA 1X58A 3Q3SA 3TP3A 2DA3A 1VF9A 5K7HA 1S7EA 3CQZJ 4DW6A 2Y2ZA 3WHBA 3S16J 5FKNA 3F0CA 1ZQ3P 4QSHA 5M5YJ 1WH5A 1MNMC 3IH4A 4A3BJ 2LFBA 3E7LA 1JGGA 1ENHA 2EH3A 1GV5A 2CQQA 2L9RA 4JYKA 3VPRA 3G1MA 3BR1A 3TW6A 3LSGA 1OFCX 5F1JA 2JJ7A 1MSFC 3SDGA 3G1OA 4RDUA 4DYCA 4XRSG 5IP9J 3CMYA 2D5VA 3RZOJ 1JT0A 2DMPA 3HOVJ 5EGOB 1I3QJ 3GTOJ 4X6AJ 3B6AA 1IUFA 2DMNA 5C4JJ 2HXOA 1ETYA 3B6CA 1H89C 1FIAA 1MSEC 5IP6A 2HOAA 3TEDA 3S1RJ 2NVQJ 2QCOA 5K7ZA 4DYRA 3A03A 2R93J 1XC5A 2L0KA 3SFIA 1WPKA 2M0CA 4B4CA 3LOCA 1T56A 3HOXJ 1LFUP 1JUMA 1MBJA 5FLMJ 2ECBA 1GT0C 3H3VK 4W1UA 1JKRC 1FTZA 2YUSA 1WGXA 3GTJJ 2B63J 3JRGA 2DA7A 1QRYA 5FKLA 4AUXA 1Y1VJ 4HNVA 3FISA 2X9DA 2K9NA 2G0EA 3GTQJ 4MO7A 1GV2A 1QVTA 2LTPA 3W6VA 4A3FJ 2LR8A 3TP0A 1G2HA 3HOUJ 2L7MP 5IYCJ 9ANTA 2JWTA 1IV6A 3BQYA 3S1MJ 4BXXJ 3O8GA 1U78A 3BR6A 5F0HA 5FKKA 2WAQN 2LK2A 3M4OJ 1MBFA 3JRIA 5BNGA 3LSPA 1QVUA 1U9OA 2ME6A 5E3LA 1OCTC 3ZQLA 3HGYA 1APLC 3BG9A 4UUTA 5IOZA 1POGA 5EEAA 5JLWA 1ETKA 4EEFG 5EDNA 3OOUA 4BBSJ 5M3MJ 1IC8A 3C2BA 1CQTA 3HGGA 3L1PA 4FE7A 3Q0UA 5EZHA 2M34A 5F0FA 3BR2A 3WHCA 4B3AA 2DA5A 1HDPA 2K9QA 2L7FP 2VKEA 2M8GX 2ID6A 2WB1N 4CYCA 1UG2A 2R5YA 1OCPA 2LKXA 1NK3P 2W48A 4BKXA 2YU9J 3DCFA 1MH3A 1PUFA 2DA2A 3O8HA 1RKTA 3LNQA 1BW6A 3JRCA 2KDZA 4Y7NJ 1IRZA 3S2DJ 3JRBA 1DU0A 1UMQA 1JJ6C 3BG5A 1JUPA 1U8BA 4JX5A 1W0UA 3BT9A 2Y0SN 4IHYA 2JMWA 3HM5A 1ZR4A 2R5ZA 3HDDA 4G12A 5HODA 5M5WJ 2MSYA 3CDLA 5C4XJ 2X6OA 3LSRA 2IAIA 2OF7A 5EZGA 2CUFA 1H8AC 2PMZN 2QF7A 1P7IA 1VI0A 2NS7A 2JN6A 2E19A 5EG0A 2Y30A 1ETWA 3QQAA 5E3MA 4AYBN 4JP0A 3BTJA 3FK6A
chains in the Genus database with same CATH superfamily
3WE2A 3JCUC 2BBYA 2OPTA 4HEA2 5C3EJ 1I6XA 1MBEA 4FISA 3SDBA 2KPMA 1T08B 1O57A 1X1DA 3DP7A 3H9JA 3ZMDA 1TQPA 2P5KA 3LL7A 2M1BA 4BBRJ 3K7AJ 1JUSA 1MH4A 3BJ6A 2XROA 3RCOA 2A6EF 4EV0A 1YE9A 2R7XA 1FOKA 2DQLA 1Z77A 2NOGA 3CCRI 4V2FA 2R7WA 4L9TA 5HLIA 4F91B 2WY7Q 4B09A 3OYDA 3I59B 2YU3A 3KP3A 4CCMA 5ILUA 4XIDA 3A01A 1XSXA 1XCBA 4LOCA 3C18A 5KVRA 1WI9A 2DFIA 2L3DA 4ZYEA 4ZZLA 1R9TJ 5E20A 1ACIA 1LFPA 5GAEJ 5L3EA 1W4MA 1R36A 2E1MC 3S3MA 2A6TA 1JTXA 2KZGA 1DGRM 1Y1WJ 1J5YA 2K85A 1Y0UA 2EZKA 2FD5A 4G7OF 5D4RA 2IGMA 4KT6A 2XGCA 4NDLA 4XN3A 2GIVA 3L2CA 4JX6A 1WH7A 3AG2H 5CQEA 3WTWC 2CGPA 2MABA 4LB6B 2XPUA 1YJ9I 1MBKA 1YOVB 1W7PB 1R23A 3VB2A 1ETXA 4C3JJ 3KYCB 3MKWB 2JTVA 1E17A 1ZHFA 1OQYA 3CJTB 2Z99A 4KMUX 1SVOA 2R7DA 1X2MA 1Z6RA 4FETA 2R7RA 4C3HJ 2OTJI 2ZJ2A 3VYUB 4ZTJA 4ZH4F 3AG1H 5HDNA 1ULYA 2OZUA 4CCOA 3RPUD 4RM2A 2ESHA 3MMYB 1XG1A 5M3FJ 5DCMA 4BQOA 2RREA 1IV8A 3BR5A 3N4MA 1ZELA 4HRIA 1SFEA 2H8WA 2PJPA 2EA2A 4PJMA 3HOTA 1W36D 2A5WA 2OUMA 3CUQC 3QYEA 4U7DA 2IS1A 3ZMSA 1XCVA 2W4SA 2W82A 5DDGA 1YW9A 2JK3A 4I01A 3OS1A 3A01B 1DP7P 2ZNZA 1MMSA 1ITYA 1HDDC 3JRDA 4GCVA 1N77A 5TISC 3AL0C 4XOPA 4A3DJ 3MN2A 3R0JA 2QKLB 3K70C 4B48A 3ZMVA 3BP8A 4Z6YA 4XRMA 5JLXA 4BY1J 1U9NA 3FMSA 1VFCA 1YIOA 2M0MA 4Z2YA 5BPIA 2O61A 5FLXK 4HG2A 1OCCH 1X1CA 4HBLA 5HLTA 4IL6C 1F5TA 1ZGJA 2XF7A 5EEHA 2DT7B 1T98A 2C6YA 4L5JA 3KZZA 4LLNA 3KEYA 1RUOA 2F5EA 2BE5F 2KRFA 5H6QA 1S7OA 3M8JA 4A3GJ 2BOLA 3PFYA 1G4DA 3KX2A 2MH2A 1R1UA 5AONA 1IZ1A 2R7VA 1T8IA 2MFZA 2P81A 1FOYA 1TQMA 1SD7A 2O3FA 3BQZA 3E5QA 3OL4A 2HQNA 1M1EB 4XICA 2R7UA 2A3SA 1LNWA 3D5SC 4RGXA 4O5VA 2F4OB 2DU9A 5D5UB 5GADJ 2EPFA 3RKQA 5E17F 3ZOBA 4RLFA 2XF5A 4FE4A 5DS9A 5HS7A 2HR3A 5LLQA 5F04A 2RDPA 2O03A 1HF0A 2RQPA 4KISA 2IA0A 5IP7J 4NC7A 1SANA 2JRMA 2JA6J 2O6GE 3HOYJ 2V9PA 2F4IA 1ZGAA 3F8MA 1K7AA 2DYSH 5GTIC 1SD6A 4A3KJ 2EB7A 4M3GA 3OIOA 1PUEE 1MBGA 1R4MB 4YIFA 3JSPA 1TWHJ 4HSTA 1SFKA 2Y69H 3BZ6A 3QYBA 2O0YA 2WV0A 3DU6A 4PJNA 2CFOA 1BN5A 2ZXHA 1ZR2A 3CLQA 5H2FC 2CUJA 3VFZA 2H8RA 2XRLA 2DJNA 2JZYA 2UZKA 1EF4A 3TMOA 4F3QA 2TDXA 4XL9A 2QM3A 2ECCA 1Q1VA 5GAHJ 2ISZA 4CZZA 4NNJA 4Q4ZF 2K7LA 1ZGWA 1F4KA 2JQ7A 2A69F 5D6EA 3HEFA 3OSGA 3EYIA 1SFXA 4E7LA 1TQIA 2JT1A 3ZR8X 3CUOA 3NEUA 3C2HA 4MEYF 4ENKA 1W1WE 1ZARA 2HDWA 3FX3A 4ITVA 1TP4A 1HCRA 1OKRA 3K2AA 1ETVA 5LEJA 4RB2C 2HQ5A 3WTUC 3A0HC 2HQAA 3E5XA 1W5SA 3P9CA 1ZYRF 2F2EA 3H0DA 3B73A 4ESJA 1HBXG 4UV9A 4WXHA 3ZRGA 2E1CA 1ON1A 3HOZJ 2EV5A 3H5NA 2ZJQF 3FXKA 4XK4A 3LSMA 1N75A 3E1SA 3OV8A 5IY5H 4H0EA 3PL8A 3BTIA 2Q8KA 3F6VA 2NYXA 2X6YA 5LHIA 3TO7A 4P9FA 3K4LA 2NS0A 5ERIA 4QLCU 2KIQA 3P9KA 3PNVA 1A31A 3G3ZA 5B66C 1BBYA 1YW7A 3BG3A 3BY6A 3GBGA 5LRSA 2XC7A 1A6IA 4LB5A 3GVAA 2XPVA 5KK1A 2HYJA 2R7SA 2HTJA 2Q2EA 4KJZA 4P1WA 1TT0A 1DUXC 2N8GA 4V19K 5J4VA 2X0LA 1QHGA 2BGCA 3CDHA 3L2VA 2M2EA 2JA7J 2KT0A 4I76A 3EYYA 2OV7A 2FQ4A 2FA5A 2V1NA 1P7JA 1FTTA 5B1AH 5IPAA 3RQIA 1PP8F 1XMAA 2PG4A 2KIUA 1LDJA 2XAUA 2E2JJ 1JXSA 2Y0SA 2R3SA 4KIGA 4KT5C 3PO3J 2H27A 2XAHA 3OYNA 2EV6A 3Q3SA 1VQOI 2Y48A 1IXSB 1I3AA 3BZKA 4EJOA 1S7EA 1HKQA 2GXBA 4DW6A 2LYCA 3KP6A 1BI0A 5K5OA 1J09A 2ZKZA 5LHHA 3D0SA 4AVPA 2WAFA 1F9NA 1WWXA 1WKMA 5J6XA 4B43A 1Z9CA 4XKBA 2E1MB 4XRFA 2LFBA 2EIJH 3G73A 4IZZA 1ENHA 3TO6A 3RQ4A 3Q9VA 4IRGA 2VOPA 3G1MA 3FXUA 4L9VA 2BY0A 2JJ7A 1MD0A 1MSFC 4BNCA 5H20A 4PGGA 4LITA 4DYCA 1XPXA 5IP9J 2V9KA 3TGNA 4WXDA 3F8FA 4RS8A 2HTSA 5EGOB 2XGXA 2CMPA 3DBHB 3GTOJ 1FSHA 2K3FA 2V1DA 3NWSA 3LSTA 5KAFC 5LGTA 3RYRA 1STZA 2F4MB 2Z5UA 3I58A 2Q2EB 3JAMZ 2WA0A 1FT9A 2NVQJ 1FY7A 2CFXA 2QCOA 3E97A 4HF2A 3DTEA 4UVBA 4AIDA 1YW8A 1KA8A 3NQOA 2DYRH 1WPKA 4CA0A 3KP5A 3VYRB 3LOCA 2L4MA 3HOXJ 3DBRB 1LFUP 1JUMA 2QLZA 2F5CA 4CGZA 1USTA 4YEJA 3HUGA 3ZMTA 2E60A 1FTZA 2VQLA 2P8TA 1QO0D 1T2KA 3WU1B 1KYZA 1YJNI 1DDNA 4FHTA 1NHAA 2RVCA 4ENMA 4AUXA 5DD4A 1Y1VJ 4NC6A 2V9VA 2M3AA 6PAXA 3GO5A 2K9NA 2IS2A 2G0EA 1KONA 2IW5A 3B02A 5FB2A 3GTQJ 1GV2A 4BHBA 4A12A 2ZSIB 1CF7A 3W6VA 3J80Z 1V55H 1XGSA 3X2QH 4PJ0C 1KYWA 2K4BA 3LSHA 2V1XA 3HOUJ 2L7MP 1A6QA 1IV6A 4PSWA 2OZ6A 4BXXJ 3IHUA 1U5TC 1FMWA 3OOPA 1FBUA 2LK2A 2L5QA 3HKZA 3DEUA 3HPHA 3LSPA 2BVLA 1E0EA 4JK1X 3HGYA 1U0JA 1TW3A 5CKTA 4HF0A 3ZCOA 2CV1A 5DD8A 3HRTA 2OJED 2GXAA 1ETKA 3V42A 2NNNA 4BBSJ 2VLAA 2X1CA 5M3MJ 3C2BA 1XDSA 3HGGA 5L3CA 1Z7LA 3CCJI 4UB8C 3Q0UA 5CVVA 2OBPA 5EZHA 5AIPA 3BC8A 5F0FA 3WHCA 3I55I 1G3WA 1EH7A 1W5CC 2VKEA 1J7KA 2ID6A 4U0VA 2R5YA 4BJ5C 2W48A 3E6MA 3F6OA 4R79A 3K10A 3HUGB 5A2QZ 1BW6A 1EV7A 2QQAA 2W00A 3CZ6A 3DTIA 1IRZA 1YLFA 2R7TA 4UXNA 1D0ZA 3I4PA 1Q1HA 1Y8QB 2OQGA 4XMYA 2CQ7A 2PBIA 4G6TB 5LD2C 3FDYA 3WU2C 4B8XA 1CF7B 4D9JA 1FBSA 4XSZF 3V8JA 3FF5A 3ASOH 3LSRA 2R7OA 1H8AC 1T38A 1P7IA 1TT5B 1MJ9A 5ICCA 5EG0A 2Y30A 2BVMA 2JVHA 2VJIA 5CVRA 5HLHA 4IHVA 3FK6A 4S04A 1YHQI 2COMA 5J1UA 4DIQA 1O3QA 3CCLI 4N0BA 4CYDA 3U1KA 2CU7A 2DBBA 2EFPA 4ZYAA 1YFHA 1DU6A 2X85A 3GZ6A 3CCYA 2V26A 4MQ9F 1FP2A 4ZYDA 2XB5A 3K2ZA 5FKOA 2VJJA 4CCKA 1YI2I 4HLYA 3ZP5A 3FKIJ 1KQ8A 2QUFA 4IHSA 3HRSA 1EJ9A 1T95A 3Q0WA 4BQAA 3EUHC 1FSEA 2GA2A 1LDDA 2JSCA 1BJZA 3TOAA 1FPQA 2P7VB 2DFHA 3FXQA 4M6YA 5GTHC 5JR3A 2R5YB 2XSJC 2HZDA 4IO9F 3G6EI 2IA2A 3FZVA 5TRDA 1F1ZA 2K02A 1TNSA 4D5CA 2I10A 3M1CA 3CC4I 3JW4A 2XF6A 3T1BA 3D5RC 2XAGA 3REOA 1AWCA 4P96A 2H1LA 1MKMA 4CCNA 4ENJA 4Q47A 4LMYA 3EUAA 4XRSA 3S3OA 2DA4A 4XSXF 3FK7A 1K4SA 1Z91A 2J5OA 2VASA 1Y39A 1ORKA 1ZRFA 2RGVA 3HB9A 4CCLA 2OCEA 4IOAF 2Z33A 2Q1ZB 4KDPA 3PO2J 5E79C 3AFHA 4RAFA 5DV5A 5ILSA 3D5LA 1HSJA 4AC0A 2MD5A 2FOKA 1DPUA 3BZCA 2MD0A 2V7FA 4IOCF 1WQ2A 3HZJA 3QOEA 1LE8A 1P9QC 2DPUA 4HX4A 1X4OA 1TWFJ 5EG0B 2O8KA 5IT3A 3HJEA 3FM5A 4O3MA 3MZ8A 4D7NA 1IJWC 1N78A 3LSJA 4HLXA 4LJZF 4XLEA 4ABZA 4C2UA 2QA4I 3GTGJ 3WG9A 3L2QA 5C44J 3NARA 4ESBA 3FBIB 3S1NJ 2WY8Q 1OR7C 3M3YJ 2TRTA 1V5EA 3A0BC 3KZIC 3WG7H 2X51A 3E5UA 3A2KA 2AO9A 2BXZA 5GPCA 3KP2A 3WE3A 5B3SH 2DLLA 2GM4A 4LIVA 2GLOA 4XLCA 2ADUA 3F22A 4RGUA 2E7XA 3ZQHA 1D1CA 5FJ8J 3DPTA 1YRNA 1B6AA 4BHPA 5HNHA 1SVMA 3KEQA 2O7OA 1U5TA 2M7AA 2RQQA 2CRGA 2A68F 3W2AA 3FHZA 1O3SA 3I4NJ 1ETQA 1FBQA 2QEXI 1FX7A 3ZGKA 1Z67A 4AM3A 3MAJA 4RAZA 1T0FC 2XGDA 2EA4A 2L7KA 3F8CA 2KQRA 3H3UA 4B47A 4BL0B 1FNNA 3SZTA 3HSEA 1XS9A 2YSRA 1DGWY 3SEZA 1W36C 1A36A 2DTZA 1IRGA 2NVTJ 1UB9A 1IDZA 4J19A 3GLLA 2COBA 2E2HJ 2CV2A 1A35A 3AAFA 2M4GA 2XKPA 1FYKA 4ZYHA 1HA8A 1R00A 2L9SA 4EATA 2PJRA 3HSFA 2HVQA 3EUKL 1ETOA 4G7HF 2E5NA 4CSWA 1RIOH 3NAUA 3LQRA 1MDMA 2XSDC 4K2EA 3ISPA 1XX5A 3QOPA 1LE8B 5H6RA 1GUUA 5E1XA 1LKXA 4DZPA 1H88C 2KRHA 3IH3A 2CV0A 3A02A 4WK8F 2VUMJ 2E1NA 1V5GA 4D5FA 2XUBA 3IRRA 1U2WA 1OYYA 2LNBA 5J1RA 2LKPA 3WTYC 2A5YB 2WBMA 1O7LA 2PQ8A 4BU2A 3KE2A 3OYMA 2P5LC 3PJRA 1IN5A 5L3BA 1SAXA 4HV5A 5LHGA 3LAJA 3JRFA 2UXNA 4MFEA 5BMZA 4IHWA 1P92A 2R4GA 2VN2A 3IL2A 4Q5SF 1YRNB 2HQRA 2ME0A 1U5TB 2CS3A 3LSKA 5DTDA 1E3OC 4IHTA 1D1BA 1RRJA 1YX5A 2VBWA 3J81Z 3M7GA 2L02A 1JT6A 4IVNA 3W2WA 3MWMA 4BJTA 3ZQ7A 4UUSA 2FBHA 2BW3A 2W85A 4QWQA 1B59A 2FMYA 3CCVI 3ABMH 2FF4A 3V8LA 3IV5A 4DZJA 2ZFWA 2PN6A 2MYSA 1WJEA 2OA4A 3GTKJ 2FSWA 5DUKA 1YTYA 4GYGA 2DK5A 3ROUA 4EM1A 2PJRB 1WFXA 3O3KA 2NVYJ 3ECOA 2LF7A 2Z2SB 3HIFA 5CLSA 4A3JJ 1DP3A 3NWTA 3R6SA 3OL3A 2LREA 3BTCA 4XLFA 1FIPA 1FWZA 2FX0A 3IH2A 5DEQA 4E7HA 2E34A 2DMQA 2M30A 1K6YA 4MTDA 4GFBA 2R7FA 4Y52J 5E8IA 1TTYA 4F93B 3PQJA 2R0QC 3K4CA 1I6HJ 4IKFA 1X3ZB 4KA4A 1EH6A 4L5IA 2CUZA 5K7FA 4M73A 2GXGA 3I9V2 5AIQA 1TC3C 2V6CA 5KAIC 2G9WA 3S93A 1GDTA 2NRAC 3I54A 3N05A 3OYIA 3CCSI 5BOXA 4E7JA 3CMEI 2DAOA 3CC7I 3W3CA 2ZO4A 4A6EA 2NNYA 2WB1A 1D3YA 1JKQC 5FFZA 2VE9A 5IYDJ 3I64A 1VQ4I 2K27A 4I6ZA 4OMYA 1D0YA 3CP8A 3JAMK 2FRHA 4PGHA 3JREA 2BZTA 2FNAA 1ZG5A 1OR7A 3AG3H 3OYCA 3QU3A 1D1AA 4UUVA 4UUSB 2PX9A 2BW3B 4XORA 2EZHA 1I50J 1AOYA 1ZRCA 2K5CA 2FBKA 3V7CA 1C0WA 1UCRA 2JUCA 2DCEA 5FRNA 1Y6IA 3QWLA 1HKTA 3BCAA 2MLGA 2ETHA 4A5NA 4KYWA 2ZFUA 5D5XB 5HLGA 2QSGX 2EILH 1VQLI 2BY3A 2Y2ZA 4HQEA 1K4TA 1P2FA 4O6JA 3JSOA 2YPRA 3RYPA 4HV6A 3RPUA 3K9TA 4QSHA 2J5PA 4I0AA 4A3BJ 3CDIA 1PVEA 1JGSA 4Y17A 3E7LA 4A0YA 1R7JA 5JI6A 3RKXA 1FLIA 1HQCA 2CQQA 3QP6A 3ZN0A 3TW6A 5F1JA 5B5EC 1Z7UA 1S5LC 2JVGA 2IXSA 3P5JA 5HS8A 2FE3A 4RDUA 2P7CB 5DCMB 2AXLA 4XRSG 2D5VA 1RZ4A 3DKWA 4RAYA 3S2WA 4RB3C 1B4AA 1HC8A 2ELJA 3R0AA 1BC8C 2KISA 2B9SA 2QGUA 3T8TA 4IXAA 4HF1A 3FHNA 3HOVJ 4OWRB 3ZPLA 2AXTC 4X6AJ 1S9HA 3TDUC 2GOXB 3FXMA 3L7WA 2DOFA 1H89C 1QA6A 3Q5FA 1MMGA 4M72A 2HOAA 3ONQA 3S1RJ 4PK4A 2FXAA 3M07A 4DYRA 4FX0A 2QQ9A 3DWLE 1R1TA 4M74A 1UHWA 1IN6A 4E7IA 2M0CA 4B4CA 5IT9Z 1YITI 1T56A 2RV8A 1MGTA 3FMQA 1HSTA 3GZ5A 5TGTA 1HW2A 1P4WA 2VODA 5ILVA 2JUGA 1R49A 4ANJA 1JKRC 3UNGC 3GWZA 2HS5A 4L18B 4RB0A 1YX3A 3DBLB 3K4MA 1QRYA 5FKLA 1R6RA 2OQRA 2XAQA 3GFIA 3AG4H 2W24A 3BLYA 1QVTA 1U6GA 4HDUA 4G94A 3JTGA 2HKXA 1FYLA 3GCMA 4A3FJ 3PUFA 2XKOA 2KJBA 2E5ZA 4ZTFA 1PP7U 4A0ZA 2HDCA 3OYFA 3DLLF 1SEUA 2A61A 4HW0A 1BR1A 4Y15A 1K6OA 1BC7C 3VEPA 3LFKA 2VPLA 1EA3A 1XMXA 3BR6A 3GX4X 2WAQN 3OY9A 3M4OJ 1MBFA 3PIOF 2Q0OA 3RI4A 1S29A 4CXFA 5CVJA 2CYYA 2ME6A 3QYFA 3OWTA 3CCMI 1APLC 2HVSA 1GHCA 2IJLA 4UUTA 4N9HA 2ACJA 1POGA 3BJAA 1IXRC 3FKJA 4NUBA 3OOUA 2EJRA 3KLNA 5K1YA 2CO5A 3K69A 1IF1A 3BROA 3M1EA 3OYJA 4Y4RA 2LY1A 4JBAA 2W7NA 1R4NB 2EFWA 4B3AA 1G3SA 2LRDA 5DUIA 2FEZA 2DPDA 1UZCA 3CP2A 2JPCA 3TL4X 1U8RA 1UG2A 4XLPF 4I02A 3M8EA 2LKXA 1NK3P 1FOXA 2MC4A 2YU9J 4BKXA 3F8BA 4KFCA 2ESNA 1MNDA 3CUQA 1XGOA 2DA2A 1WJCA 4L0ZB 3O8HA 2DQRA 1RKTA 4KN7X 4RGRA 2KDZA 5D8LB 1FYMA 1BR4A 2XRNA 1UMQA 3C1DA 1OPCA 2IP2A 2HFHA 1VQ7I 3BG5A 1MMDA 4M9XA 2CH0A 4HQMA 2KKOA 3BOQA 3GXOA 4CH7A 2JMWA 1FOWA 1ZR4A 2R5ZA 3HDDA 4R1HA 4G12A 2CQKA 5TJJA 5C4XJ 3HXLA 3KP4A 2OF7A 2ZCWA 5EZGA 2CUFA 1IW7F 2XV4S 2P5VA 2XHKA 3QAHA 2NS7A 3VOEA 4WX9A 2VQCA 4MEXF 4II3A 4RMNA 5LRRA 3MZHA 3E6BA 3F9KA 5DCFA 3QQAA 1PDNC 5E3MA 4CHUA 1K83J 5JVTA 3SXYA 1R58A 2DFFA 1B9NA 5CQGA 1VQ8I 3KCCA 4YELA 4GO1A 3WU0A 3E6CC 4HX7A 2PLYA 2EZIA 3FM3A 4GYIA 1B1BA 2QQ8A 3IRQA 3MZYA 2ZMEC 1QNTA 5HOOA 2EIMH 5D8KB 1RESA 1OJLA 3H9QA 1BJAA 1OCRH 3HRMA 2LH9A 1XMKA 2IEKA 3GTPJ 2OCCH 3I53A 2BHZA 4RA2A 1PYVA 3TW7A 3ABKH 4KITB 3C3WA 2K40A 3WODF 5FLVA 4MLOA 1QU3A 4RM3A 1ZN2A 4MTEA 1J59A 1FZPB 3CUQB 3V8KA 3BDDA 1G6NA 3CMMA 3G71I 3JRAA 1G8XA 2D45A 1A5JA 1P4XA 1ZK8A 1ZLJA 2WC2A 3SQNA 1WHUA 3GEZA 5FLXZ 4A3EJ 2BHYA 2Z3YA 3TDZC 4L0YB 3LFUA 2H6BA 3AL0B 2MGQA 1I1GA 3CCEI 1G3YA 2EFOA 2YS9A 4G6DA 4XONA 3ZQQA 1FJLA 2R5ZB 3CO7C 1BW5A 2F6CA 5M5XJ 2E2IJ 4BQQA 1X3WB 2CUEA 3O6BB 4BE2A 3QPHA 2E35A 4EJUA 1IUYA 1RKWA 2GIZA 2M4KA 2XASA 4Y13A 3OYHA 3S3NA 2VIXA 3BJOA 4LK1F 4D7MA 3HPGA 2EFNA 3T8RA 2M87A 3CCUI 1WVRA 2GBYA 2VI6A 2KHMA 1WJ5A 5KCMA 2FQ3A 1ON2A 4HNUA 4C3IJ 3ZQIA 1R5HA 2GA1A 1Y56A 4IF4A 2VONA 2KP6A 3ML6A 1KGSA 1UHSA 1YQAA 2L9VA 2O9LA 3EQLF 2M8EA 1Z6TA 1EH8A 3OIPA 1X1PA 2CW0F 4U0YA 4W97A 3ERMA 2ZXWH 4LLGF 1FP1D 1SFOJ 5KNLA 3VSKA 3FXJA 2P0WA 2CG4A 4X1EA 4EGZA 4ENNA 1R5ID 1NTCA 4Y33A 3IAS2 2FBIA 1KU2A 1KU3A 1ZG3A 3J81K 5F27A 5F64A 2HWVA 1KZHA 3K1PA 4M3BA 2BEOA 2E7WA 3H0GJ 2M9HA 2HI3A 2X1EA 1TWGJ 3PQKA 3OYEA 2XB0X 2VKDA 2H94A 5E3NA 1IG7A 1O4XA 3FIWA 2H6CA 4HAMA 4R8HA 5F08A 1JKOC 2QYOA 2MW8A 2AHQA 1LQ1A 3A4CA 1WJDA 4AIKA 2WTEA 4A3IJ 1BM9A 1AU7A 3PNTA 3H9GA 3RJPA 2HYGD 3VODA 3K1NA 1ZKGA 2MG4A 1I39A 1P6RA 2YX4A 2BXYA 4G8XA 2FNPA 3VYSB 3HRUA 3W2VA 1MMNA 2K9SA 1Y8RB 2VBYA 2IBDA 4M3EA 3KYLA 3J7AO 5J1YA 3KYDB 5CYVA 3S1QJ 3JTHA 4JOMA 1WSUA 2LBFA 2ZB9A 1VNDA 2LOOA 5E1WA 4BE1A 5LBQA 2LY9A 2MLKA 1S3JA 3MQ0A 4I98B 1Z0XA 3SEQA 1TW2A 4L5EA 4PJJA 1ODDA 4LG3A 3KZYA 2LKSA 3L09A 4ZDPA 3ZMZA 5BQTA 1X2NA 1J9IA 2ZXJA 1OCZH 3COAC 4M3DA 4AD9A 4KNYA 4S05A 1KQ9A 1VQMI 1MJAA 1P4AA 4XR6A 3AKZA 1JJ8C 1AHDP 4NB5A 2DN0A 2DMTA 4HYEA 2IGNA 4L9NA 4A3MJ 4ZDLA 1BI2A 4XNFA 1RR8C 4Q48A 4CO8A 3K4NA 4M9ZA 4I09A 4OAYA 2DT5A 3IWFA 1IO2A 1T6SA 1LVKA 3E3VA 3GTMJ 1MMAA 4ZC3A 1GXPA 2ZMEA 4MIMA 1E3HA 2HPIA 2VBXA 4EJVA 1OLTA 1BA5A 1FEXA 4LFUA 1X1BA 4KICA 1XTAA 1Z3YA 3H36A 4F55A 5LGNA 4KMFA 1NK2P 4E70A 2Y9ZA 3BR0A 1JE8A 3OSFA 1RI7A 1A04A 2RC4A 1ERDA 5LGUA 1GXQA 3J7AY 2OAZA 3HYIA 5HVQC 1RNLA 3GLXA 2RAEA 3EETA 4YFNF 5E3OA 4CCJA 1R71A 1LFBA 2ELKA 2EZLA 3Q0VA 3GF2A 2OTLI 2UV1A 4ZDOA 2HOSA 2VOOA 2JRTA 4XQFA 3LA3A 4F52A 3S17J 2LBFB 4AU7A 1QHHD 2XPWA 5J8FA 3GTLJ 1MBHA 4L9JA 3F3XA 4HNTA 5F0CA 5HS9A 2JA5J 2MC3A 2GZWA 3RIRA 4XKVA 2KJCA 4IRHA 5FKMA 2UXXA 4IHXA 3ZQFA 2W1OA 5D6FA 3DTKA 2EK5A 2JA8J 3I3LA 3IAM2 1W7PD 1BR2A 1S6LA 4A5MA 1H0MA 3RZDJ 2VJ4A 2PMUA 1YO5C 2HDDA 3CJQB 2L7ZA 4OU0A 5J47A 4A3LJ 3D1NI 4E7ZA 4U0WA 2A07F 2PFBA 1ZG1A 3BPXA 1GVJA 3HHGA 1HKSA 1AA7A 1WI3A 3GFMA 3DFGA 5EF6A 1Z21A 2HU9A 3A1YA 3GFJA 3ZMUA 2OD5A 4ETSA 2ZMEB 2VQGA 3OMYA 2LD5A 4HZFA 4PSXA 1X58A 3PUBA 5DYMA 4WCGA 2DA3A 4AIHA 2G7UA 4DGWB 1V3FA 5K7HA 1L3LA 1V54H 3VDXA 2V79A 3PNYA 4ZJZA 4E7SA 3S16J 2EV0A 1REPC 2RNGA 3F0CA 1ZQ3P 1UG0A 2D1VA 3M8FA 2IRFG 1QQIA 2PEXA 5L3DA 1WH5A 1MNMC 3KIOA 3QPTA 2VT3A 2XVCA 1JGGA 3R60A 5HNFA 2EH3A 1GV5A 1IAWA 2DI3A 3RPQA 4JYKA 3TKYA 3LA7A 1YJWI 4HSRA 3BWGA 4I0BA 2F5DA 1SD5A 3WGGA 1SMYF 3SDGA 4YG2F 4C30A 2KZVA 3G1OA 2MA3A 1IN7A 4EM0B 5FD5A 4YIRX 2K9LA 5KHDA 4WF2A 2Y0MA 4DNCA 1S8NA 2A6HF 2DMPA 3K1MA 1I3QJ 2LMDA 4P5OA 4AIJA 4XKWA 1IUFA 2DMNA 1ETYA 3CCQI 3B6CA 1FIAA 5DM7F 5ICFA 1MSEC 1IRXA 5IP6A 5D5VB 3J7YJ 2IGOA 1LEAA 1X19A 4GRIA 4DQ2A 4F92B 3K4JA 5K7ZA 3A03A 1OYIA 1I27A 2R93J 1XC5A 4C9YA 1U3EM 2EWNA 3WTTC 1Z3XA 3HL2A 2KL4A 1J75A 2CW8A 3U21A 5FLMJ 2ECBA 3H35A 2QSFX 3LWFA 4LLLA 4TV7A 3MKZA 1ZAOA 1GT0C 3EUHA 1WGXA 1GLNA 3FXLA 4E4HA 2B63J 2QVOA 3L2UA 1E3PA 5F6FA 2LG4A 4BQNA 3HHHA 4HNVA 1UELB 3NRVA 3FISA 1UJ8A 1SC7A 1MDMB 2F48A 1ZLKA 3S8PA 4IX7A 2LTPA 1T39A 3DU5A 3TQNA 5FGMA 2MBFA 3TP0A 3W6JB 1LUJB 4BXFA 1QPMA 3OYBA 3ZN1A 5IYCJ 1UAAA 4IJAA 9ANTA 2GQQA 3M9AA 3WTZA 3BQYA 3S1MJ 4XLAA 3O8GA 2YR2A 3FXRA 2P6SA 1D8JA 1LDKB 2DW4A 4XBFA 4FASD 5F0HA 2NAZA 3R4KA 4BYYA 4N9IA 2Z16A 5E1ZB 1U9OA 3RSNA 2W57A 1OCTC 1XGNA 3GUDA 4PDKA 5ED4A 3T0YA 3U2RA 3SZGA 1RC9A 5IOZA 2XAJA 4YRVA 3OR2C 3ERED 2IGKA 4DBQA 1Y0NA 1XSVA 4ZYGA 4M6XA 1NG6A 1CQTA 2DO7A 2X4HA 1E2XA 3V4GA 1K79A 5FRMA 3L1PA 4XOTA 2QQBA 1UFMA 2FOWA 2XAFA 1K78A 2M34A 3BR2A 2KLOA 2I5UA 2K9QA 3E6DA 2L7FP 3IKVA 4MQVA 3V7RA 3KETA 2M8GX 4BACA 4CYCA 4DJAA 4XN0A 3HSRA 1FC3A 5CVUA 3DCFA 1XGMA 4BE0A 1PUFA 3OR1C 3DPLC 4EJTA 4KIBA 4MGRA 3KEOA 3S2DJ 3JRBA 1DU0A 3MFKA 1JJ6C 4U87A 2RKHA 1JUPA 2LF8A 4HA8A 3H92A 4UVCA 2KIFA 1W0UA 2X6XA 3L9FA 2LSOA 2Y0SN 1T0FA 4XLNF 2DT6A 4PFOA 3L00A 3Q9SA 1QZYA 3I0TA 1KQ0A 1NH3A 2K3PA 1SVLA 1DPRA 3J80K 2QBYA 5HODA 3OYAA 5M5WJ 4JQFA 4PCQA 1VQ9I 3OYGA 1LVAA 2PMZN 1WJFA 2QF7A 3QODA 4ON0A 1QBJA 2RNJA 2IA1A 2JN6A 2KIMA 3CMAI 2B7EA 3OYLA 4J00A 1JI8A 2DOAA 4X0GA 4HOBA 4AYBN 4JP0A 3N97A 4B44A 4M6VA 3C2GA 1B72A 4IRIA 4BGDA 1VTNC 4A0XA 1NG7A 2ZC2A 1F36A 4YFKF 3LA2A 4UB6C 4OIOF 2HPMA 1BIBA 3I5UA 1IXCA 4LGWA 2HOTA 2UWMA 2I8DA 1YYVA 4F7ZA 3L2RA 2V6EA 1I1SA 2FMLA 4BY7J 2DODA 4AVZA 4QTRA 2V4JC 4I7HA 4UV8A 1O3TA 1VQNI 3S15J 2L01A 4PZJA 4HX8A 2WAEA 1K78B 2FJ1A 4BDYA 1YIJI 2H1KA 3BPVA 3DKXA 3G1LA 2R92J 4CYCB 5IYBJ 1J0RA 2IPQX 2IT0A 4DOZA 3MKYB 1TLHB 1X3UA 4PFPA 2KRCA 2DJIA 1PUFB 2LDUA 5A2QK 2G7HA 4LIUA 2EBIA 3ABLH 1N25A 3JR9A 2AQFA 3DV8A 2QENA 4M3FA 1ZH5A 4BH9A 2KMUA 4II2A 5EYRA 5JFRA 1DQUA 1R22A 3IKTA 3CO6C 5CJ9A 2NVUB 3BTLA 3CJRB 3MKLA 2HXIA 5FD6A 4UVAA 4OIRF 1IGNA 2VPRA 1OCOH 1HLVA 2M7BA 1MIJA 2QBYB 4NC8A 2DA6A 1VQ6I 2LY2A 4M71A 4HPQA 1W0TA 3BCBA 3HG9A 5E8GA 4BJ6C 2B0LA 2X48A 3H3ZA 1H9TA 3I4MJ 4ZZDA 1W5TA 3CTAA 2DTRA 4H4KC 1MNEA 4EQQA 3SJMA 2LVSA 4WWCA 4FCYA 2Y75A 3LQQA 2CW7A 3ELKA 1VQKI 4XKCA 1B72B 2WV1A 3TOBA 2L2OA 1HOMA 4E7KA 2XGEA 3CLOA 3FWEA 1T33A 3V7SA 3BR3A 2P6TA 2GOMA 4QPOA 3K70D 2STTA 5LEKA 1QZEA 2Y31A 3QPLA 4KIFA 2IVMA 3ULQB 4A3CJ 4LD5A 3HKZN 4IQ4A 3KFWX 1JHFA 3CC2I 5EGOA 3SFZA 2ZSHB 2VL8A 2A05A 4KUMA 1TL8A 2TCTA 2HEOA 1K61A 1IDYA 4AWXB 3UKGA 1MZBA 3DEWA 2OC6A 4MNUA 2EFQA 2PI0A 2VKVA 5EJCA 1ZTRA 4BAYA 2UUZA 4A6DA 3IP4B 3U9GA 5HDGA 2NOJB 3FMRA 1RR7A 1AKHA 5K5QA 2R7QA 3EDPA 2HNHA 3ZQGA 5BPDA 1QPIA 4PUSA 3DF8A 1BOAA 4FX4A 2ZXIA 1SD4A 1BIAA 2PMZA 3F23A 2ZNYA 3QU6A 2JPBA 4A69C 5ICGA 2FU4A 5JHFA 1XD7A 3HBLA 1D5YA 1IN4A 3K4BA 2Z9OA 2HOEA 3ASNH 1SAUA 3LAPA 3F72A 2JSPA 3IUOA 2DA1A 1QZZA 3K0LA 2BV6A 3PFIA 1VZ0A 2XIGA 3U1DA 1OMIA 4B1RA 5F1RA 4AYBA 5GP9A 2CWEA 4V2GA 4P55A 1B8IA 5CVIA 3MCZA 2IS4A 2CQNA 3MVPA 4BXUA 4EGYA 4Y3OA 3PSFA 2DK8A 1F43A 1BL0A 3MEXA 2V1UA 2K86A 1S72I 4N4NB 4D1QA 1LB2A 2H09A 4YIIA 4UHTA 5L3FA 1VQPI 4IPAA 4XLHA 3QP5A 2GWRA 2WADA 1ZREA 1D0XA 1WJAA 3S32A 3E0JB 1TZLA 3DLAA 4BEHA 2CQXA 5JHUA 5ICEA 2BY1A 2BYVE 4J01A 4S0HB 4MFDA 2KFDA 4DYQA 4CUGA 3WTSC 4FTHA 3S14J 1TWCJ 4C2MJ 1IN8A 2DDBA 4WXCA 2RN7A 3TO9A 5LFAA 5BS6A 3KPHA 2D2WA 1TWAJ 3ZQCA 2LLKA 5J3LA 1RETA 2EINH 2VXDA 4XM3A 4GXOA 4I2OA 3DQVC 5J4YA 3IWZA 3PM1A 3VWBA 1USSA 1X1AA 1SMTA 4A93J 5CPRB 1S7AA 1AKHB 4G6QA 2VT2A 2ISYA 2VXZA 2O8XA 3FBNB 4ESFA 1XDUA 1G59A 5IOYA 1EKEA 4RLQA 5L3GA 4GDFA 4ASNA 2LC2A 2Y9YA 4NBQA 1SFUA 4UY8I 2ID3A 4NHJA 3CESA 2IS6A 2EQRA 2QZ8A 4G9YA 4I99C 2WAQA 4IEJA 1RPWA 2LP0A 4RAGA 1B8IB 2HVRA 2R7ZJ 2DFEA 5GPAA 2E1OA 4CDGA 2NVXJ 2CJJA 2NS8A 2E71A 2ELHA 1D5VA 4JX4A 3SHFA 4QIWN 5HDKA 1Z1DA 1G3TA 2WWYA 3S2HJ 2ICWG 4NQWA 3ABUA 2AQEA 1JTYA 2DMUA 3BG7A 3LSIA 3WGIA 2VBZA 5FFXA 3O2PE 1WCMJ 1MJBA 3I71A 4CZCA 3L2WA 3HOWJ 1FMVA 1BOBA 2BY2A 3DEEA 4BEHB 3P7NA 2K9MA 5GAGJ 2ZJPF 1JKPC 4RBOA 3SZPA 1RUNA 4OOIA 4CICA 5DM6F 1HW1A 2VKHA 3R61A 2VQHA 2L9NA 3DXJF 3T5XA 4EJWA 2F5VA 1HXDA 1IRFA 2M5WA 4EM2A 3CF5F 3WTVC 3QPSA 3JRHA 3ESWB 1GVDA 2DDAA 3EPZA 1VQ5I 1YG2A 4UNOA 2NXNB 3TP3A 1V5FA 4BUPA 2PMHA 2E36A 1VF9A 5D5WB 1BI3A 2P4WA 3K4KA 3HOSA 3QRFF 1HW5A 2VE8A 2KDOA 3CQZJ 3F21A 1BI1A 3HTUA 3OS0A 3KP7A 3WHBA 4OMZA 5FKNA 4BHCA 1UHMA 5J8CA 1V4RA 1PJRA 2W25A 4YFXF 5M5YJ 5FROA 1B9MA 3MD2A 3RDIA 3IH4A 3H5AA 3RKWA 1ONVA 1R1VA 1MW7A 1XN7A 2L9RA 3VPRA 4G7ZF 3BR1A 2EIKH 2STWA 3LSGA 3ABTA 1OFCX 3HC7A 3ZXSA 4RB1A 1WJBA 1CGPA 3CMYA 3PSIA 2VB6A 3RZOJ 4LG0A 3BG6A 1JT0A 4NQWB 1YS7A 3LMMA 5JVGF 4PJLA 1I5ZA 4OINF 2VC1A 4QPQA 3B6AA 5C4JJ 4DBRA 2HXOA 4OIPF 3TEDA 1YS6A 4BS9A 1OISA 2DOEA 2L54A 1XB4A 4OIQF 1ZRDA 3G4SI 3P9IA 2JA2A 5B1BH 2L0KA 3SFIA 2HKOA 3H1CA 4IQJA 2HZTA 1J2XA 1MBJA 3OIQA 3F8NA 1TBXA 2O5RA 3H3VK 4W1UA 5J40A 2YUSA 3GTJJ 3JRGA 2DA7A 2X9DA 3WGHA 3OS2A 4FQGA 2QKMB 4MO7A 4LK0F 5E18F 4M9SA 3GW2A 2LR8A 3H5RA 1D8KA 3RKYA 1KU7A 3J7ZI 1G2HA 2GAUA 2M45A 1H9GA 2QSHX 3W6KB 1LPQA 2CSOA 2JWTA 1U78A 1OYWA 4RGSA 3PIPF 5FKKA 4EMSA 5EEGA 3CD6I 2D1HA 3JRIA 5BNGA 2OU2A 3K6GA 3SYTA 1QVUA 3FXOA 2HYFA 4B3XA 3VSLA 2QWWA 2XDVA 3DKYA 2VJ5A 5E3LA 3ZQLA 4LG0B 2ZBKA 1LEBA 3BG9A 2HGCA 3TBIA 5EEAA 2Z1DA 5JLWA 1O3RA 4EEFG 5EDNA 3UR3C 4E6KG 1IC8A 2MH9A 1XSDA 4GGGA 4D0PA 4BDZA 1LJ9A 2L4AA 3I56I 4U7BA 4FE7A 2F5FA 1TNTA 2X6WA 4P9UA 4C2TA 2DA5A 3I59A 3G2BA 4U88A 1JHHA 1HDPA 4FT8A 3GZNB 3CJNA 3C7JA 1O7FA 2WB1N 5IT9K 1OCPA 4OAZA 1WZ2A 3KLOA 1MH3A 4HDVA 3GYHX 4MHGA 5D4SA 1X4PA 3HTSB 3LNQA 3JRCA 1R5GA 3VYTB 3GMEA 4N4OB 4Y7NJ 2W84A 3ECHA 4KN4X 4EVIA 2ZJRF 1U8BA 1KU9A 4JX5A 3WTXC 2AS5F 3BT9A 4A2UA 4IHYA 1L0OC 3HM5A 3RTRA 1QGPA 1Z05A 5K5RA 2MSYA 3CDLA 2X6OA 3GFLA 3CF2A 3OYKA 2IAIA 5FO5A 3IC7A 1W7PA 2YX7A 3DPUA 2X1DA 1VI0A 2FUG2 1WRJA 2VC0A 2E19A 1ETWA 2DXIA 2K4JA 3BTJA
chains in the Genus database with same CATH topology
1K83J 4M6VA 2OPTA 5J1UA 1B72A 5C3EJ 1MBEA 4FISA 1F36A 2CU7A 1DU6A 2EZIA 3CCYA 2HOTA 4BBRJ 3K7AJ 1JUSA 1MH4A 2XB5A 5FKOA 1RESA 1OJLA 4BY7J 3FKIJ 3GTPJ 2IEKA 1Z77A 2NOGA 4QTRA 3TW7A 4V2FA 3S15J 3Q0WA 2FJ1A 2H1KA 2K40A 4XIDA 3A01A 3G1LA 1BJZA 4LOCA 5FLVA 2R92J 4MLOA 4CYCB 5IYBJ 2R5YB 1R9TJ 1PUFB 2EBIA 4D5CA 2I10A 3JRAA 3JR9A 1A5JA 4M3FA 1JTXA 1ZK8A 1Y1WJ 5EYRA 2EZKA 2FD5A 4A3EJ 2XGCA 4XRSA 2MGQA 2DA4A 3BTLA 2HXIA 3FK7A 3MKLA 2YS9A 4NDLA 1FJLA 1IGNA 1ORKA 2VPRA 2R5ZB 3HB9A 4JX6A 1HLVA 1BW5A 1WH7A 5M5XJ 3PO2J 2DA6A 2XPUA 2E2IJ 1MBKA 1W0TA 2CUEA 4AC0A 1ETXA 2X48A 1RKWA 4C3JJ 3I4MJ 4D7MA 1LE8A 3SJMA 2LVSA 1TWFJ 5EG0B 2O8KA 4FCYA 2GBYA 1X2MA 2VI6A 4C3HJ 4D7NA 1IJWC 3LSJA 4ABZA 1B72B 2WV1A 1HOMA 3GTGJ 4C3IJ 5C44J 3ZQIA 2XGEA 3NARA 1T33A 3S1NJ 3M3YJ 3BR3A 2TRTA 1UHSA 1XG1A 2Y31A 3QPLA 2AO9A 5M3FJ 2O9LA 5GPCA 3BR5A 4A3CJ 2GM4A 3HKZN 2GLOA 5EGOA 4W97A 3ZQHA 5FJ8J 1YRNA 2JK3A 2O7OA 1SFOJ 2CRGA 3A01B 2TCTA 1K61A 1ITYA 1HDDC 4X1EA 3JRDA 1IDYA 3UKGA 3I4NJ 1ETQA 3DEWA 1NTCA 4A3DJ 3MN2A 2XGDA 5F27A 2VKVA 1ZTRA 4XRMA 5JLXA 4BY1J 4M3BA 3H0GJ 2M9HA 2HI3A 1U9NA 1XS9A 1TWGJ 1VFCA 2XB0X 5E3NA 2DTZA 1IG7A 1RR7A 1AKHA 2NVTJ 1IDZA 1O4XA 3FIWA 4IHVA 1JKOC 5F08A 4J19A 2COBA 2E2HJ 2MW8A 2AHQA 1AU7A 4A3IJ 3ZQGA 1QPIA 1ZKGA 4A3GJ 2MG4A 1ETOA 4A69C 2P81A 3NAUA 3HBLA 2K9SA 1D5YA 3BQZA 2XSDC 2IBDA 4XICA 2DA1A 4B1RA 1LE8B 4M3EA 1GUUA 5J1YA 5GP9A 1H88C 4DZPA 3S1QJ 4V2GA 1B8IA 3IH3A 2ZB9A 1VNDA 3A02A 3MVPA 2VUMJ 3RKQA 3ZOBA 2LY9A 4D5FA 1F43A 4FE4A 1BL0A 5DS9A 5J1RA 1Z0XA 4L5EA 5F04A 1HF0A 5IP7J 1SANA 3HOYJ 2JA6J 1X2NA 4A3KJ 3JRFA 4M3DA 4M3GA 3OIOA 1MBGA 4MFEA 1TWHJ 4IHWA 1JJ8C 1AHDP 2DN0A 2DMTA 2CQXA 1YRNB 4S0HB 2ME0A 4MFDA 5DTDA 4DYQA 1ZR2A 1E3OC 4FTHA 2H8RA 4A3MJ 3S14J 1TWCJ 4C2MJ 2XRLA 2DJNA 1TWAJ 3ZQCA 2LLKA 1EF4A 5J3LA 1RETA 1JT6A 2ECCA 1Q1VA 3GTMJ 4UUSA 3PM1A 1ZGWA 4MIMA 4A93J 1AKHB 3HEFA 3IV5A 3OSGA 1BA5A 1FEXA 4DZJA 5IOYA 1NK2P 2Y9ZA 3BR0A 3OSFA 3GTKJ 2Y9YA 1HCRA 2ID3A 2NVYJ 3K2AA 1ETVA 2EQRA 2RAEA 5E3OA 4A3JJ 1LFBA 2HQ5A 2ELKA 2EZLA 3Q0VA 3BTCA 4IEJA 1FIPA 2HOSA 2FX0A 3IH2A 1RPWA 2LP0A 2DMQA 1B8IB 3S17J 4GFBA 2R7ZJ 2XPWA 5GPAA 4Y52J 2E1OA 2NVXJ 3HOZJ 2CJJA 3GTLJ 1MBHA 4XK4A 2R0QC 2NS8A 5F0CA 2JA5J 1I6HJ 4JX4A 4QIWN 3BTIA 5K7FA 3S2HJ 5FKMA 1TC3C 1GDTA 4IHXA 3ZQFA 1JTYA 2DMUA 2JA8J 3RZDJ 2HDDA 1WCMJ 3HOWJ 3BG3A 1JKQC 2L7ZA 3GBGA 1A6IA 5IYDJ 2XPVA 4A3LJ 2HYJA 3D1NI 4I6ZA 2N8GA 1JKPC 4RBOA 2JA7J 2M2EA 2KT0A 4I76A 2FQ4A 3JREA 1P7JA 1FTTA 1WI3A 5EF6A 5IPAA 4UUSB 3RQIA 2E2JJ 2EZHA 3QPSA 3JRHA 2LD5A 3PO3J 1I50J 1GVDA 1X58A 3Q3SA 3TP3A 2DA3A 1VF9A 5K7HA 1S7EA 3CQZJ 4DW6A 2Y2ZA 3WHBA 3S16J 5FKNA 3F0CA 1ZQ3P 4QSHA 5M5YJ 1WH5A 1MNMC 3IH4A 4A3BJ 2LFBA 3E7LA 1JGGA 1ENHA 2EH3A 1GV5A 2CQQA 2L9RA 4JYKA 3VPRA 3G1MA 3BR1A 3TW6A 3LSGA 1OFCX 5F1JA 2JJ7A 1MSFC 3SDGA 3G1OA 4RDUA 4DYCA 4XRSG 5IP9J 3CMYA 2D5VA 3RZOJ 1JT0A 2DMPA 3HOVJ 5EGOB 1I3QJ 3GTOJ 4X6AJ 3B6AA 1IUFA 2DMNA 5C4JJ 2HXOA 1ETYA 3B6CA 1H89C 1FIAA 1MSEC 5IP6A 2HOAA 3TEDA 3S1RJ 2NVQJ 2QCOA 5K7ZA 4DYRA 3A03A 2R93J 1XC5A 2L0KA 3SFIA 1WPKA 2M0CA 4B4CA 3LOCA 1T56A 3HOXJ 1LFUP 1JUMA 1MBJA 5FLMJ 2ECBA 1GT0C 3H3VK 4W1UA 1JKRC 1FTZA 2YUSA 1WGXA 3GTJJ 2B63J 3JRGA 2DA7A 1QRYA 5FKLA 4AUXA 1Y1VJ 4HNVA 3FISA 2X9DA 2K9NA 2G0EA 3GTQJ 4MO7A 1GV2A 1QVTA 2LTPA 3W6VA 4A3FJ 2LR8A 3TP0A 1G2HA 3HOUJ 2L7MP 5IYCJ 9ANTA 2JWTA 1IV6A 3BQYA 3S1MJ 4BXXJ 3O8GA 1U78A 3BR6A 5F0HA 5FKKA 2WAQN 2LK2A 3M4OJ 1MBFA 3JRIA 5BNGA 3LSPA 1QVUA 1U9OA 2ME6A 5E3LA 1OCTC 3ZQLA 3HGYA 1APLC 3BG9A 4UUTA 5IOZA 1POGA 5EEAA 5JLWA 1ETKA 4EEFG 5EDNA 3OOUA 4BBSJ 5M3MJ 1IC8A 3C2BA 1CQTA 3HGGA 3L1PA 4FE7A 3Q0UA 5EZHA 2M34A 5F0FA 3BR2A 3WHCA 4B3AA 2DA5A 1HDPA 2K9QA 2L7FP 2VKEA 2M8GX 2ID6A 2WB1N 4CYCA 1UG2A 2R5YA 1OCPA 2LKXA 1NK3P 2W48A 4BKXA 2YU9J 3DCFA 1MH3A 1PUFA 2DA2A 3O8HA 1RKTA 3LNQA 1BW6A 3JRCA 2KDZA 4Y7NJ 1IRZA 3S2DJ 3JRBA 1DU0A 1UMQA 1JJ6C 3BG5A 1JUPA 1U8BA 4JX5A 1W0UA 3BT9A 2Y0SN 4IHYA 2JMWA 3HM5A 1ZR4A 2R5ZA 3HDDA 4G12A 5HODA 5M5WJ 2MSYA 3CDLA 5C4XJ 2X6OA 3LSRA 2IAIA 2OF7A 5EZGA 2CUFA 1H8AC 2PMZN 2QF7A 1P7IA 1VI0A 2NS7A 2JN6A 2E19A 5EG0A 2Y30A 1ETWA 3QQAA 5E3MA 4AYBN 4JP0A 3BTJA 3FK6A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1K83 J;  4M6V A;  2OPT A;  5J1U A;  1B72 A;  5C3E J;  1MBE A;  4FIS A;  1F36 A;  2CU7 A;  1DU6 A;  2EZI A;  3CCY A;  2HOT A;  4BBR J;  3K7A J;  1JUS A;  1MH4 A;  2XB5 A;  5FKO A;  1RES A;  1OJL A;  4BY7 J;  3FKI J;  3GTP J;  2IEK A;  1Z77 A;  2NOG A;  4QTR A;  3TW7 A;  4V2F A;  3S15 J;  3Q0W A;  2FJ1 A;  2H1K A;  2K40 A;  4XID A;  3A01 A;  3G1L A;  1BJZ A;  4LOC A;  5FLV A;  2R92 J;  4MLO A;  4CYC B;  5IYB J;  2R5Y B;  1R9T J;  1PUF B;  2EBI A;  4D5C A;  2I10 A;  3JRA A;  3JR9 A;  1A5J A;  4M3F A;  1JTX A;  1ZK8 A;  1Y1W J;  5EYR A;  2EZK A;  2FD5 A;  4A3E J;  2XGC A;  4XRS A;  2MGQ A;  2DA4 A;  3BTL A;  2HXI A;  3FK7 A;  3MKL A;  2YS9 A;  4NDL A;  1FJL A;  1IGN A;  1ORK A;  2VPR A;  2R5Z B;  3HB9 A;  4JX6 A;  1HLV A;  1BW5 A;  1WH7 A;  5M5X J;  3PO2 J;  2DA6 A;  2XPU A;  2E2I J;  1MBK A;  1W0T A;  2CUE A;  4AC0 A;  1ETX A;  2X48 A;  1RKW A;  4C3J J;  3I4M J;  4D7M A;  1LE8 A;  3SJM A;  2LVS A;  1TWF J;  5EG0 B;  2O8K A;  4FCY A;  2GBY A;  1X2M A;  2VI6 A;  4C3H J;  4D7N A;  1IJW C;  3LSJ A;  4ABZ A;  1B72 B;  2WV1 A;  1HOM A;  3GTG J;  4C3I J;  5C44 J;  3ZQI A;  2XGE A;  3NAR A;  1T33 A;  3S1N J;  3M3Y J;  3BR3 A;  2TRT A;  1UHS A;  1XG1 A;  2Y31 A;  3QPL A;  2AO9 A;  5M3F J;  2O9L A;  5GPC A;  3BR5 A;  4A3C J;  2GM4 A;  3HKZ N;  2GLO A;  5EGO A;  4W97 A;  3ZQH A;  5FJ8 J;  1YRN A;  2JK3 A;  2O7O A;  1SFO J;  2CRG A;  3A01 B;  2TCT A;  1K61 A;  1ITY A;  1HDD C;  4X1E A;  3JRD A;  1IDY A;  3UKG A;  3I4N J;  1ETQ A;  3DEW A;  1NTC A;  4A3D J;  3MN2 A;  2XGD A;  5F27 A;  2VKV A;  1ZTR A;  4XRM A;  5JLX A;  4BY1 J;  4M3B A;  3H0G J;  2M9H A;  2HI3 A;  1U9N A;  1XS9 A;  1TWG J;  1VFC A;  2XB0 X;  5E3N A;  2DTZ A;  1IG7 A;  1RR7 A;  1AKH A;  2NVT J;  1IDZ A;  1O4X A;  3FIW A;  4IHV A;  1JKO C;  5F08 A;  4J19 A;  2COB A;  2E2H J;  2MW8 A;  2AHQ A;  1AU7 A;  4A3I J;  3ZQG A;  1QPI A;  1ZKG A;  4A3G J;  2MG4 A;  1ETO A;  4A69 C;  2P81 A;  3NAU A;  3HBL A;  2K9S A;  1D5Y A;  3BQZ A;  2XSD C;  2IBD A;  4XIC A;  2DA1 A;  4B1R A;  1LE8 B;  4M3E A;  1GUU A;  5J1Y A;  5GP9 A;  1H88 C;  4DZP A;  3S1Q J;  4V2G A;  1B8I A;  3IH3 A;  2ZB9 A;  1VND A;  3A02 A;  3MVP A;  2VUM J;  3RKQ A;  3ZOB A;  2LY9 A;  4D5F A;  1F43 A;  4FE4 A;  1BL0 A;  5DS9 A;  5J1R A;  1Z0X A;  4L5E A;  5F04 A;  1HF0 A;  5IP7 J;  1SAN A;  3HOY J;  2JA6 J;  1X2N A;  4A3K J;  3JRF A;  4M3D A;  4M3G A;  3OIO A;  1MBG A;  4MFE A;  1TWH J;  4IHW A;  1JJ8 C;  1AHD P;  2DN0 A;  2DMT A;  2CQX A;  1YRN B;  4S0H B;  2ME0 A;  4MFD A;  5DTD A;  4DYQ A;  1ZR2 A;  1E3O C;  4FTH A;  2H8R A;  4A3M J;  3S14 J;  1TWC J;  4C2M J;  2XRL A;  2DJN A;  1TWA J;  3ZQC A;  2LLK A;  1EF4 A;  5J3L A;  1RET A;  1JT6 A;  2ECC A;  1Q1V A;  3GTM J;  4UUS A;  3PM1 A;  1ZGW A;  4MIM A;  4A93 J;  1AKH B;  3HEF A;  3IV5 A;  3OSG A;  1BA5 A;  1FEX A;  4DZJ A;  5IOY A;  1NK2 P;  2Y9Z A;  3BR0 A;  3OSF A;  3GTK J;  2Y9Y A;  1HCR A;  2ID3 A;  2NVY J;  3K2A A;  1ETV A;  2EQR A;  2RAE A;  5E3O A;  4A3J J;  1LFB A;  2HQ5 A;  2ELK A;  2EZL A;  3Q0V A;  3BTC A;  4IEJ A;  1FIP A;  2HOS A;  2FX0 A;  3IH2 A;  1RPW A;  2LP0 A;  2DMQ A;  1B8I B;  3S17 J;  4GFB A;  2R7Z J;  2XPW A;  5GPA A;  4Y52 J;  2E1O A;  2NVX J;  3HOZ J;  2CJJ A;  3GTL J;  1MBH A;  4XK4 A;  2R0Q C;  2NS8 A;  5F0C A;  2JA5 J;  1I6H J;  4JX4 A;  4QIW N;  3BTI A;  5K7F A;  3S2H J;  5FKM A;  1TC3 C;  1GDT A;  4IHX A;  3ZQF A;  1JTY A;  2DMU A;  2JA8 J;  3RZD J;  2HDD A;  1WCM J;  3HOW J;  3BG3 A;  1JKQ C;  2L7Z A;  3GBG A;  1A6I A;  5IYD J;  2XPV A;  4A3L J;  2HYJ A;  3D1N I;  4I6Z A;  2N8G A;  1JKP C;  4RBO A;  2JA7 J;  2M2E A;  2KT0 A;  4I76 A;  2FQ4 A;  3JRE A;  1P7J A;  1FTT A;  1WI3 A;  5EF6 A;  5IPA A;  4UUS B;  3RQI A;  2E2J J;  2EZH A;  3QPS A;  3JRH A;  2LD5 A;  3PO3 J;  1I50 J;  1GVD A;  1X58 A;  3Q3S A;  3TP3 A;  2DA3 A;  1VF9 A;  5K7H A;  1S7E A;  3CQZ J;  4DW6 A;  2Y2Z A;  3WHB A;  3S16 J;  5FKN A;  3F0C A;  1ZQ3 P;  4QSH A;  5M5Y J;  1WH5 A;  1MNM C;  3IH4 A;  4A3B J;  2LFB A;  3E7L A;  1JGG A;  1ENH A;  2EH3 A;  1GV5 A;  2CQQ A;  2L9R A;  4JYK A;  3VPR A;  3G1M A;  3BR1 A;  3TW6 A;  3LSG A;  1OFC X;  5F1J A;  2JJ7 A;  1MSF C;  3SDG A;  3G1O A;  4RDU A;  4DYC A;  4XRS G;  5IP9 J;  3CMY A;  2D5V A;  3RZO J;  1JT0 A;  2DMP A;  3HOV J;  5EGO B;  1I3Q J;  3GTO J;  4X6A J;  3B6A A;  1IUF A;  2DMN A;  5C4J J;  2HXO A;  1ETY A;  3B6C A;  1H89 C;  1FIA A;  1MSE C;  5IP6 A;  2HOA A;  3TED A;  3S1R J;  2NVQ J;  2QCO A;  5K7Z A;  4DYR A;  3A03 A;  2R93 J;  1XC5 A;  2L0K A;  3SFI A;  1WPK A;  2M0C A;  4B4C A;  3LOC A;  1T56 A;  3HOX J;  1LFU P;  1JUM A;  1MBJ A;  5FLM J;  2ECB A;  1GT0 C;  3H3V K;  4W1U A;  1JKR C;  1FTZ A;  2YUS A;  1WGX A;  3GTJ J;  2B63 J;  3JRG A;  2DA7 A;  1QRY A;  5FKL A;  4AUX A;  1Y1V J;  4HNV A;  3FIS A;  2X9D A;  2K9N A;  2G0E A;  3GTQ J;  4MO7 A;  1GV2 A;  1QVT A;  2LTP A;  3W6V A;  4A3F J;  2LR8 A;  3TP0 A;  1G2H A;  3HOU J;  2L7M P;  5IYC J;  9ANT A;  2JWT A;  1IV6 A;  3BQY A;  3S1M J;  4BXX J;  3O8G A;  1U78 A;  3BR6 A;  5F0H A;  5FKK A;  2WAQ N;  2LK2 A;  3M4O J;  1MBF A;  3JRI A;  5BNG A;  3LSP A;  1QVU A;  1U9O A;  2ME6 A;  5E3L A;  1OCT C;  3ZQL A;  3HGY A;  1APL C;  3BG9 A;  4UUT A;  5IOZ A;  1POG A;  5EEA A;  5JLW A;  1ETK A;  4EEF G;  5EDN A;  3OOU A;  4BBS J;  5M3M J;  1IC8 A;  3C2B A;  1CQT A;  3HGG A;  3L1P A;  4FE7 A;  3Q0U A;  5EZH A;  2M34 A;  5F0F A;  3BR2 A;  3WHC A;  4B3A A;  2DA5 A;  1HDP A;  2K9Q A;  2L7F P;  2VKE A;  2M8G X;  2ID6 A;  2WB1 N;  4CYC A;  1UG2 A;  2R5Y A;  1OCP A;  2LKX A;  1NK3 P;  2W48 A;  4BKX A;  2YU9 J;  3DCF A;  1MH3 A;  1PUF A;  2DA2 A;  3O8H A;  1RKT A;  3LNQ A;  1BW6 A;  3JRC A;  2KDZ A;  4Y7N J;  1IRZ A;  3S2D J;  3JRB A;  1DU0 A;  1UMQ A;  1JJ6 C;  3BG5 A;  1JUP A;  1U8B A;  4JX5 A;  1W0U A;  3BT9 A;  2Y0S N;  4IHY A;  2JMW A;  3HM5 A;  1ZR4 A;  2R5Z A;  3HDD A;  4G12 A;  5HOD A;  5M5W J;  2MSY A;  3CDL A;  5C4X J;  2X6O A;  3LSR A;  2IAI A;  2OF7 A;  5EZG A;  2CUF A;  1H8A C;  2PMZ N;  2QF7 A;  1P7I A;  1VI0 A;  2NS7 A;  2JN6 A;  2E19 A;  5EG0 A;  2Y30 A;  1ETW A;  3QQA A;  5E3M A;  4AYB N;  4JP0 A;  3BTJ A;  3FK6 A; 
#chains in the Genus database with same CATH topology
 3WE2 A;  3JCU C;  2BBY A;  2OPT A;  4HEA 2;  5C3E J;  1I6X A;  1MBE A;  4FIS A;  3SDB A;  2KPM A;  1T08 B;  1O57 A;  1X1D A;  3DP7 A;  3H9J A;  3ZMD A;  1TQP A;  2P5K A;  3LL7 A;  2M1B A;  4BBR J;  3K7A J;  1JUS A;  1MH4 A;  3BJ6 A;  2XRO A;  3RCO A;  2A6E F;  4EV0 A;  1YE9 A;  2R7X A;  1FOK A;  2DQL A;  1Z77 A;  2NOG A;  3CCR I;  4V2F A;  2R7W A;  4L9T A;  5HLI A;  4F91 B;  2WY7 Q;  4B09 A;  3OYD A;  3I59 B;  2YU3 A;  3KP3 A;  4CCM A;  5ILU A;  4XID A;  3A01 A;  1XSX A;  1XCB A;  4LOC A;  3C18 A;  5KVR A;  1WI9 A;  2DFI A;  2L3D A;  4ZYE A;  4ZZL A;  1R9T J;  5E20 A;  1ACI A;  1LFP A;  5GAE J;  5L3E A;  1W4M A;  1R36 A;  2E1M C;  3S3M A;  2A6T A;  1JTX A;  2KZG A;  1DGR M;  1Y1W J;  1J5Y A;  2K85 A;  1Y0U A;  2EZK A;  2FD5 A;  4G7O F;  5D4R A;  2IGM A;  4KT6 A;  2XGC A;  4NDL A;  4XN3 A;  2GIV A;  3L2C A;  4JX6 A;  1WH7 A;  3AG2 H;  5CQE A;  3WTW C;  2CGP A;  2MAB A;  4LB6 B;  2XPU A;  1YJ9 I;  1MBK A;  1YOV B;  1W7P B;  1R23 A;  3VB2 A;  1ETX A;  4C3J J;  3KYC B;  3MKW B;  2JTV A;  1E17 A;  1ZHF A;  1OQY A;  3CJT B;  2Z99 A;  4KMU X;  1SVO A;  2R7D A;  1X2M A;  1Z6R A;  4FET A;  2R7R A;  4C3H J;  2OTJ I;  2ZJ2 A;  3VYU B;  4ZTJ A;  4ZH4 F;  3AG1 H;  5HDN A;  1ULY A;  2OZU A;  4CCO A;  3RPU D;  4RM2 A;  2ESH A;  3MMY B;  1XG1 A;  5M3F J;  5DCM A;  4BQO A;  2RRE A;  1IV8 A;  3BR5 A;  3N4M A;  1ZEL A;  4HRI A;  1SFE A;  2H8W A;  2PJP A;  2EA2 A;  4PJM A;  3HOT A;  1W36 D;  2A5W A;  2OUM A;  3CUQ C;  3QYE A;  4U7D A;  2IS1 A;  3ZMS A;  1XCV A;  2W4S A;  2W82 A;  5DDG A;  1YW9 A;  2JK3 A;  4I01 A;  3OS1 A;  3A01 B;  1DP7 P;  2ZNZ A;  1MMS A;  1ITY A;  1HDD C;  3JRD A;  4GCV A;  1N77 A;  5TIS C;  3AL0 C;  4XOP A;  4A3D J;  3MN2 A;  3R0J A;  2QKL B;  3K70 C;  4B48 A;  3ZMV A;  3BP8 A;  4Z6Y A;  4XRM A;  5JLX A;  4BY1 J;  1U9N A;  3FMS A;  1VFC A;  1YIO A;  2M0M A;  4Z2Y A;  5BPI A;  2O61 A;  5FLX K;  4HG2 A;  1OCC H;  1X1C A;  4HBL A;  5HLT A;  4IL6 C;  1F5T A;  1ZGJ A;  2XF7 A;  5EEH A;  2DT7 B;  1T98 A;  2C6Y A;  4L5J A;  3KZZ A;  4LLN A;  3KEY A;  1RUO A;  2F5E A;  2BE5 F;  2KRF A;  5H6Q A;  1S7O A;  3M8J A;  4A3G J;  2BOL A;  3PFY A;  1G4D A;  3KX2 A;  2MH2 A;  1R1U A;  5AON A;  1IZ1 A;  2R7V A;  1T8I A;  2MFZ A;  2P81 A;  1FOY A;  1TQM A;  1SD7 A;  2O3F A;  3BQZ A;  3E5Q A;  3OL4 A;  2HQN A;  1M1E B;  4XIC A;  2R7U A;  2A3S A;  1LNW A;  3D5S C;  4RGX A;  4O5V A;  2F4O B;  2DU9 A;  5D5U B;  5GAD J;  2EPF A;  3RKQ A;  5E17 F;  3ZOB A;  4RLF A;  2XF5 A;  4FE4 A;  5DS9 A;  5HS7 A;  2HR3 A;  5LLQ A;  5F04 A;  2RDP A;  2O03 A;  1HF0 A;  2RQP A;  4KIS A;  2IA0 A;  5IP7 J;  4NC7 A;  1SAN A;  2JRM A;  2JA6 J;  2O6G E;  3HOY J;  2V9P A;  2F4I A;  1ZGA A;  3F8M A;  1K7A A;  2DYS H;  5GTI C;  1SD6 A;  4A3K J;  2EB7 A;  4M3G A;  3OIO A;  1PUE E;  1MBG A;  1R4M B;  4YIF A;  3JSP A;  1TWH J;  4HST A;  1SFK A;  2Y69 H;  3BZ6 A;  3QYB A;  2O0Y A;  2WV0 A;  3DU6 A;  4PJN A;  2CFO A;  1BN5 A;  2ZXH A;  1ZR2 A;  3CLQ A;  5H2F C;  2CUJ A;  3VFZ A;  2H8R A;  2XRL A;  2DJN A;  2JZY A;  2UZK A;  1EF4 A;  3TMO A;  4F3Q A;  2TDX A;  4XL9 A;  2QM3 A;  2ECC A;  1Q1V A;  5GAH J;  2ISZ A;  4CZZ A;  4NNJ A;  4Q4Z F;  2K7L A;  1ZGW A;  1F4K A;  2JQ7 A;  2A69 F;  5D6E A;  3HEF A;  3OSG A;  3EYI A;  1SFX A;  4E7L A;  1TQI A;  2JT1 A;  3ZR8 X;  3CUO A;  3NEU A;  3C2H A;  4MEY F;  4ENK A;  1W1W E;  1ZAR A;  2HDW A;  3FX3 A;  4ITV A;  1TP4 A;  1HCR A;  1OKR A;  3K2A A;  1ETV A;  5LEJ A;  4RB2 C;  2HQ5 A;  3WTU C;  3A0H C;  2HQA A;  3E5X A;  1W5S A;  3P9C A;  1ZYR F;  2F2E A;  3H0D A;  3B73 A;  4ESJ A;  1HBX G;  4UV9 A;  4WXH A;  3ZRG A;  2E1C A;  1ON1 A;  3HOZ J;  2EV5 A;  3H5N A;  2ZJQ F;  3FXK A;  4XK4 A;  3LSM A;  1N75 A;  3E1S A;  3OV8 A;  5IY5 H;  4H0E A;  3PL8 A;  3BTI A;  2Q8K A;  3F6V A;  2NYX A;  2X6Y A;  5LHI A;  3TO7 A;  4P9F A;  3K4L A;  2NS0 A;  5ERI A;  4QLC U;  2KIQ A;  3P9K A;  3PNV A;  1A31 A;  3G3Z A;  5B66 C;  1BBY A;  1YW7 A;  3BG3 A;  3BY6 A;  3GBG A;  5LRS A;  2XC7 A;  1A6I A;  4LB5 A;  3GVA A;  2XPV A;  5KK1 A;  2HYJ A;  2R7S A;  2HTJ A;  2Q2E A;  4KJZ A;  4P1W A;  1TT0 A;  1DUX C;  2N8G A;  4V19 K;  5J4V A;  2X0L A;  1QHG A;  2BGC A;  3CDH A;  3L2V A;  2M2E A;  2JA7 J;  2KT0 A;  4I76 A;  3EYY A;  2OV7 A;  2FQ4 A;  2FA5 A;  2V1N A;  1P7J A;  1FTT A;  5B1A H;  5IPA A;  3RQI A;  1PP8 F;  1XMA A;  2PG4 A;  2KIU A;  1LDJ A;  2XAU A;  2E2J J;  1JXS A;  2Y0S A;  2R3S A;  4KIG A;  4KT5 C;  3PO3 J;  2H27 A;  2XAH A;  3OYN A;  2EV6 A;  3Q3S A;  1VQO I;  2Y48 A;  1IXS B;  1I3A A;  3BZK A;  4EJO A;  1S7E A;  1HKQ A;  2GXB A;  4DW6 A;  2LYC A;  3KP6 A;  1BI0 A;  5K5O A;  1J09 A;  2ZKZ A;  5LHH A;  3D0S A;  4AVP A;  2WAF A;  1F9N A;  1WWX A;  1WKM A;  5J6X A;  4B43 A;  1Z9C A;  4XKB A;  2E1M B;  4XRF A;  2LFB A;  2EIJ H;  3G73 A;  4IZZ A;  1ENH A;  3TO6 A;  3RQ4 A;  3Q9V A;  4IRG A;  2VOP A;  3G1M A;  3FXU A;  4L9V A;  2BY0 A;  2JJ7 A;  1MD0 A;  1MSF C;  4BNC A;  5H20 A;  4PGG A;  4LIT A;  4DYC A;  1XPX A;  5IP9 J;  2V9K A;  3TGN A;  4WXD A;  3F8F A;  4RS8 A;  2HTS A;  5EGO B;  2XGX A;  2CMP A;  3DBH B;  3GTO J;  1FSH A;  2K3F A;  2V1D A;  3NWS A;  3LST A;  5KAF C;  5LGT A;  3RYR A;  1STZ A;  2F4M B;  2Z5U A;  3I58 A;  2Q2E B;  3JAM Z;  2WA0 A;  1FT9 A;  2NVQ J;  1FY7 A;  2CFX A;  2QCO A;  3E97 A;  4HF2 A;  3DTE A;  4UVB A;  4AID A;  1YW8 A;  1KA8 A;  3NQO A;  2DYR H;  1WPK A;  4CA0 A;  3KP5 A;  3VYR B;  3LOC A;  2L4M A;  3HOX J;  3DBR B;  1LFU P;  1JUM A;  2QLZ A;  2F5C A;  4CGZ A;  1UST A;  4YEJ A;  3HUG A;  3ZMT A;  2E60 A;  1FTZ A;  2VQL A;  2P8T A;  1QO0 D;  1T2K A;  3WU1 B;  1KYZ A;  1YJN I;  1DDN A;  4FHT A;  1NHA A;  2RVC A;  4ENM A;  4AUX A;  5DD4 A;  1Y1V J;  4NC6 A;  2V9V A;  2M3A A;  6PAX A;  3GO5 A;  2K9N A;  2IS2 A;  2G0E A;  1KON A;  2IW5 A;  3B02 A;  5FB2 A;  3GTQ J;  1GV2 A;  4BHB A;  4A12 A;  2ZSI B;  1CF7 A;  3W6V A;  3J80 Z;  1V55 H;  1XGS A;  3X2Q H;  4PJ0 C;  1KYW A;  2K4B A;  3LSH A;  2V1X A;  3HOU J;  2L7M P;  1A6Q A;  1IV6 A;  4PSW A;  2OZ6 A;  4BXX J;  3IHU A;  1U5T C;  1FMW A;  3OOP A;  1FBU A;  2LK2 A;  2L5Q A;  3HKZ A;  3DEU A;  3HPH A;  3LSP A;  2BVL A;  1E0E A;  4JK1 X;  3HGY A;  1U0J A;  1TW3 A;  5CKT A;  4HF0 A;  3ZCO A;  2CV1 A;  5DD8 A;  3HRT A;  2OJE D;  2GXA A;  1ETK A;  3V42 A;  2NNN A;  4BBS J;  2VLA A;  2X1C A;  5M3M J;  3C2B A;  1XDS A;  3HGG A;  5L3C A;  1Z7L A;  3CCJ I;  4UB8 C;  3Q0U A;  5CVV A;  2OBP A;  5EZH A;  5AIP A;  3BC8 A;  5F0F A;  3WHC A;  3I55 I;  1G3W A;  1EH7 A;  1W5C C;  2VKE A;  1J7K A;  2ID6 A;  4U0V A;  2R5Y A;  4BJ5 C;  2W48 A;  3E6M A;  3F6O A;  4R79 A;  3K10 A;  3HUG B;  5A2Q Z;  1BW6 A;  1EV7 A;  2QQA A;  2W00 A;  3CZ6 A;  3DTI A;  1IRZ A;  1YLF A;  2R7T A;  4UXN A;  1D0Z A;  3I4P A;  1Q1H A;  1Y8Q B;  2OQG A;  4XMY A;  2CQ7 A;  2PBI A;  4G6T B;  5LD2 C;  3FDY A;  3WU2 C;  4B8X A;  1CF7 B;  4D9J A;  1FBS A;  4XSZ F;  3V8J A;  3FF5 A;  3ASO H;  3LSR A;  2R7O A;  1H8A C;  1T38 A;  1P7I A;  1TT5 B;  1MJ9 A;  5ICC A;  5EG0 A;  2Y30 A;  2BVM A;  2JVH A;  2VJI A;  5CVR A;  5HLH A;  4IHV A;  3FK6 A;  4S04 A;  1YHQ I;  2COM A;  5J1U A;  4DIQ A;  1O3Q A;  3CCL I;  4N0B A;  4CYD A;  3U1K A;  2CU7 A;  2DBB A;  2EFP A;  4ZYA A;  1YFH A;  1DU6 A;  2X85 A;  3GZ6 A;  3CCY A;  2V26 A;  4MQ9 F;  1FP2 A;  4ZYD A;  2XB5 A;  3K2Z A;  5FKO A;  2VJJ A;  4CCK A;  1YI2 I;  4HLY A;  3ZP5 A;  3FKI J;  1KQ8 A;  2QUF A;  4IHS A;  3HRS A;  1EJ9 A;  1T95 A;  3Q0W A;  4BQA A;  3EUH C;  1FSE A;  2GA2 A;  1LDD A;  2JSC A;  1BJZ A;  3TOA A;  1FPQ A;  2P7V B;  2DFH A;  3FXQ A;  4M6Y A;  5GTH C;  5JR3 A;  2R5Y B;  2XSJ C;  2HZD A;  4IO9 F;  3G6E I;  2IA2 A;  3FZV A;  5TRD A;  1F1Z A;  2K02 A;  1TNS A;  4D5C A;  2I10 A;  3M1C A;  3CC4 I;  3JW4 A;  2XF6 A;  3T1B A;  3D5R C;  2XAG A;  3REO A;  1AWC A;  4P96 A;  2H1L A;  1MKM A;  4CCN A;  4ENJ A;  4Q47 A;  4LMY A;  3EUA A;  4XRS A;  3S3O A;  2DA4 A;  4XSX F;  3FK7 A;  1K4S A;  1Z91 A;  2J5O A;  2VAS A;  1Y39 A;  1ORK A;  1ZRF A;  2RGV A;  3HB9 A;  4CCL A;  2OCE A;  4IOA F;  2Z33 A;  2Q1Z B;  4KDP A;  3PO2 J;  5E79 C;  3AFH A;  4RAF A;  5DV5 A;  5ILS A;  3D5L A;  1HSJ A;  4AC0 A;  2MD5 A;  2FOK A;  1DPU A;  3BZC A;  2MD0 A;  2V7F A;  4IOC F;  1WQ2 A;  3HZJ A;  3QOE A;  1LE8 A;  1P9Q C;  2DPU A;  4HX4 A;  1X4O A;  1TWF J;  5EG0 B;  2O8K A;  5IT3 A;  3HJE A;  3FM5 A;  4O3M A;  3MZ8 A;  4D7N A;  1IJW C;  1N78 A;  3LSJ A;  4HLX A;  4LJZ F;  4XLE A;  4ABZ A;  4C2U A;  2QA4 I;  3GTG J;  3WG9 A;  3L2Q A;  5C44 J;  3NAR A;  4ESB A;  3FBI B;  3S1N J;  2WY8 Q;  1OR7 C;  3M3Y J;  2TRT A;  1V5E A;  3A0B C;  3KZI C;  3WG7 H;  2X51 A;  3E5U A;  3A2K A;  2AO9 A;  2BXZ A;  5GPC A;  3KP2 A;  3WE3 A;  5B3S H;  2DLL A;  2GM4 A;  4LIV A;  2GLO A;  4XLC A;  2ADU A;  3F22 A;  4RGU A;  2E7X A;  3ZQH A;  1D1C A;  5FJ8 J;  3DPT A;  1YRN A;  1B6A A;  4BHP A;  5HNH A;  1SVM A;  3KEQ A;  2O7O A;  1U5T A;  2M7A A;  2RQQ A;  2CRG A;  2A68 F;  3W2A A;  3FHZ A;  1O3S A;  3I4N J;  1ETQ A;  1FBQ A;  2QEX I;  1FX7 A;  3ZGK A;  1Z67 A;  4AM3 A;  3MAJ A;  4RAZ A;  1T0F C;  2XGD A;  2EA4 A;  2L7K A;  3F8C A;  2KQR A;  3H3U A;  4B47 A;  4BL0 B;  1FNN A;  3SZT A;  3HSE A;  1XS9 A;  2YSR A;  1DGW Y;  3SEZ A;  1W36 C;  1A36 A;  2DTZ A;  1IRG A;  2NVT J;  1UB9 A;  1IDZ A;  4J19 A;  3GLL A;  2COB A;  2E2H J;  2CV2 A;  1A35 A;  3AAF A;  2M4G A;  2XKP A;  1FYK A;  4ZYH A;  1HA8 A;  1R00 A;  2L9S A;  4EAT A;  2PJR A;  3HSF A;  2HVQ A;  3EUK L;  1ETO A;  4G7H F;  2E5N A;  4CSW A;  1RIO H;  3NAU A;  3LQR A;  1MDM A;  2XSD C;  4K2E A;  3ISP A;  1XX5 A;  3QOP A;  1LE8 B;  5H6R A;  1GUU A;  5E1X A;  1LKX A;  4DZP A;  1H88 C;  2KRH A;  3IH3 A;  2CV0 A;  3A02 A;  4WK8 F;  2VUM J;  2E1N A;  1V5G A;  4D5F A;  2XUB A;  3IRR A;  1U2W A;  1OYY A;  2LNB A;  5J1R A;  2LKP A;  3WTY C;  2A5Y B;  2WBM A;  1O7L A;  2PQ8 A;  4BU2 A;  3KE2 A;  3OYM A;  2P5L C;  3PJR A;  1IN5 A;  5L3B A;  1SAX A;  4HV5 A;  5LHG A;  3LAJ A;  3JRF A;  2UXN A;  4MFE A;  5BMZ A;  4IHW A;  1P92 A;  2R4G A;  2VN2 A;  3IL2 A;  4Q5S F;  1YRN B;  2HQR A;  2ME0 A;  1U5T B;  2CS3 A;  3LSK A;  5DTD A;  1E3O C;  4IHT A;  1D1B A;  1RRJ A;  1YX5 A;  2VBW A;  3J81 Z;  3M7G A;  2L02 A;  1JT6 A;  4IVN A;  3W2W A;  3MWM A;  4BJT A;  3ZQ7 A;  4UUS A;  2FBH A;  2BW3 A;  2W85 A;  4QWQ A;  1B59 A;  2FMY A;  3CCV I;  3ABM H;  2FF4 A;  3V8L A;  3IV5 A;  4DZJ A;  2ZFW A;  2PN6 A;  2MYS A;  1WJE A;  2OA4 A;  3GTK J;  2FSW A;  5DUK A;  1YTY A;  4GYG A;  2DK5 A;  3ROU A;  4EM1 A;  2PJR B;  1WFX A;  3O3K A;  2NVY J;  3ECO A;  2LF7 A;  2Z2S B;  3HIF A;  5CLS A;  4A3J J;  1DP3 A;  3NWT A;  3R6S A;  3OL3 A;  2LRE A;  3BTC A;  4XLF A;  1FIP A;  1FWZ A;  2FX0 A;  3IH2 A;  5DEQ A;  4E7H A;  2E34 A;  2DMQ A;  2M30 A;  1K6Y A;  4MTD A;  4GFB A;  2R7F A;  4Y52 J;  5E8I A;  1TTY A;  4F93 B;  3PQJ A;  2R0Q C;  3K4C A;  1I6H J;  4IKF A;  1X3Z B;  4KA4 A;  1EH6 A;  4L5I A;  2CUZ A;  5K7F A;  4M73 A;  2GXG A;  3I9V 2;  5AIQ A;  1TC3 C;  2V6C A;  5KAI C;  2G9W A;  3S93 A;  1GDT A;  2NRA C;  3I54 A;  3N05 A;  3OYI A;  3CCS I;  5BOX A;  4E7J A;  3CME I;  2DAO A;  3CC7 I;  3W3C A;  2ZO4 A;  4A6E A;  2NNY A;  2WB1 A;  1D3Y A;  1JKQ C;  5FFZ A;  2VE9 A;  5IYD J;  3I64 A;  1VQ4 I;  2K27 A;  4I6Z A;  4OMY A;  1D0Y A;  3CP8 A;  3JAM K;  2FRH A;  4PGH A;  3JRE A;  2BZT A;  2FNA A;  1ZG5 A;  1OR7 A;  3AG3 H;  3OYC A;  3QU3 A;  1D1A A;  4UUV A;  4UUS B;  2PX9 A;  2BW3 B;  4XOR A;  2EZH A;  1I50 J;  1AOY A;  1ZRC A;  2K5C A;  2FBK A;  3V7C A;  1C0W A;  1UCR A;  2JUC A;  2DCE A;  5FRN A;  1Y6I A;  3QWL A;  1HKT A;  3BCA A;  2MLG A;  2ETH A;  4A5N A;  4KYW A;  2ZFU A;  5D5X B;  5HLG A;  2QSG X;  2EIL H;  1VQL I;  2BY3 A;  2Y2Z A;  4HQE A;  1K4T A;  1P2F A;  4O6J A;  3JSO A;  2YPR A;  3RYP A;  4HV6 A;  3RPU A;  3K9T A;  4QSH A;  2J5P A;  4I0A A;  4A3B J;  3CDI A;  1PVE A;  1JGS A;  4Y17 A;  3E7L A;  4A0Y A;  1R7J A;  5JI6 A;  3RKX A;  1FLI A;  1HQC A;  2CQQ A;  3QP6 A;  3ZN0 A;  3TW6 A;  5F1J A;  5B5E C;  1Z7U A;  1S5L C;  2JVG A;  2IXS A;  3P5J A;  5HS8 A;  2FE3 A;  4RDU A;  2P7C B;  5DCM B;  2AXL A;  4XRS G;  2D5V A;  1RZ4 A;  3DKW A;  4RAY A;  3S2W A;  4RB3 C;  1B4A A;  1HC8 A;  2ELJ A;  3R0A A;  1BC8 C;  2KIS A;  2B9S A;  2QGU A;  3T8T A;  4IXA A;  4HF1 A;  3FHN A;  3HOV J;  4OWR B;  3ZPL A;  2AXT C;  4X6A J;  1S9H A;  3TDU C;  2GOX B;  3FXM A;  3L7W A;  2DOF A;  1H89 C;  1QA6 A;  3Q5F A;  1MMG A;  4M72 A;  2HOA A;  3ONQ A;  3S1R J;  4PK4 A;  2FXA A;  3M07 A;  4DYR A;  4FX0 A;  2QQ9 A;  3DWL E;  1R1T A;  4M74 A;  1UHW A;  1IN6 A;  4E7I A;  2M0C A;  4B4C A;  5IT9 Z;  1YIT I;  1T56 A;  2RV8 A;  1MGT A;  3FMQ A;  1HST A;  3GZ5 A;  5TGT A;  1HW2 A;  1P4W A;  2VOD A;  5ILV A;  2JUG A;  1R49 A;  4ANJ A;  1JKR C;  3UNG C;  3GWZ A;  2HS5 A;  4L18 B;  4RB0 A;  1YX3 A;  3DBL B;  3K4M A;  1QRY A;  5FKL A;  1R6R A;  2OQR A;  2XAQ A;  3GFI A;  3AG4 H;  2W24 A;  3BLY A;  1QVT A;  1U6G A;  4HDU A;  4G94 A;  3JTG A;  2HKX A;  1FYL A;  3GCM A;  4A3F J;  3PUF A;  2XKO A;  2KJB A;  2E5Z A;  4ZTF A;  1PP7 U;  4A0Z A;  2HDC A;  3OYF A;  3DLL F;  1SEU A;  2A61 A;  4HW0 A;  1BR1 A;  4Y15 A;  1K6O A;  1BC7 C;  3VEP A;  3LFK A;  2VPL A;  1EA3 A;  1XMX A;  3BR6 A;  3GX4 X;  2WAQ N;  3OY9 A;  3M4O J;  1MBF A;  3PIO F;  2Q0O A;  3RI4 A;  1S29 A;  4CXF A;  5CVJ A;  2CYY A;  2ME6 A;  3QYF A;  3OWT A;  3CCM I;  1APL C;  2HVS A;  1GHC A;  2IJL A;  4UUT A;  4N9H A;  2ACJ A;  1POG A;  3BJA A;  1IXR C;  3FKJ A;  4NUB A;  3OOU A;  2EJR A;  3KLN A;  5K1Y A;  2CO5 A;  3K69 A;  1IF1 A;  3BRO A;  3M1E A;  3OYJ A;  4Y4R A;  2LY1 A;  4JBA A;  2W7N A;  1R4N B;  2EFW A;  4B3A A;  1G3S A;  2LRD A;  5DUI A;  2FEZ A;  2DPD A;  1UZC A;  3CP2 A;  2JPC A;  3TL4 X;  1U8R A;  1UG2 A;  4XLP F;  4I02 A;  3M8E A;  2LKX A;  1NK3 P;  1FOX A;  2MC4 A;  2YU9 J;  4BKX A;  3F8B A;  4KFC A;  2ESN A;  1MND A;  3CUQ A;  1XGO A;  2DA2 A;  1WJC A;  4L0Z B;  3O8H A;  2DQR A;  1RKT A;  4KN7 X;  4RGR A;  2KDZ A;  5D8L B;  1FYM A;  1BR4 A;  2XRN A;  1UMQ A;  3C1D A;  1OPC A;  2IP2 A;  2HFH A;  1VQ7 I;  3BG5 A;  1MMD A;  4M9X A;  2CH0 A;  4HQM A;  2KKO A;  3BOQ A;  3GXO A;  4CH7 A;  2JMW A;  1FOW A;  1ZR4 A;  2R5Z A;  3HDD A;  4R1H A;  4G12 A;  2CQK A;  5TJJ A;  5C4X J;  3HXL A;  3KP4 A;  2OF7 A;  2ZCW A;  5EZG A;  2CUF A;  1IW7 F;  2XV4 S;  2P5V A;  2XHK A;  3QAH A;  2NS7 A;  3VOE A;  4WX9 A;  2VQC A;  4MEX F;  4II3 A;  4RMN A;  5LRR A;  3MZH A;  3E6B A;  3F9K A;  5DCF A;  3QQA A;  1PDN C;  5E3M A;  4CHU A;  1K83 J;  5JVT A;  3SXY A;  1R58 A;  2DFF A;  1B9N A;  5CQG A;  1VQ8 I;  3KCC A;  4YEL A;  4GO1 A;  3WU0 A;  3E6C C;  4HX7 A;  2PLY A;  2EZI A;  3FM3 A;  4GYI A;  1B1B A;  2QQ8 A;  3IRQ A;  3MZY A;  2ZME C;  1QNT A;  5HOO A;  2EIM H;  5D8K B;  1RES A;  1OJL A;  3H9Q A;  1BJA A;  1OCR H;  3HRM A;  2LH9 A;  1XMK A;  2IEK A;  3GTP J;  2OCC H;  3I53 A;  2BHZ A;  4RA2 A;  1PYV A;  3TW7 A;  3ABK H;  4KIT B;  3C3W A;  2K40 A;  3WOD F;  5FLV A;  4MLO A;  1QU3 A;  4RM3 A;  1ZN2 A;  4MTE A;  1J59 A;  1FZP B;  3CUQ B;  3V8K A;  3BDD A;  1G6N A;  3CMM A;  3G71 I;  3JRA A;  1G8X A;  2D45 A;  1A5J A;  1P4X A;  1ZK8 A;  1ZLJ A;  2WC2 A;  3SQN A;  1WHU A;  3GEZ A;  5FLX Z;  4A3E J;  2BHY A;  2Z3Y A;  3TDZ C;  4L0Y B;  3LFU A;  2H6B A;  3AL0 B;  2MGQ A;  1I1G A;  3CCE I;  1G3Y A;  2EFO A;  2YS9 A;  4G6D A;  4XON A;  3ZQQ A;  1FJL A;  2R5Z B;  3CO7 C;  1BW5 A;  2F6C A;  5M5X J;  2E2I J;  4BQQ A;  1X3W B;  2CUE A;  3O6B B;  4BE2 A;  3QPH A;  2E35 A;  4EJU A;  1IUY A;  1RKW A;  2GIZ A;  2M4K A;  2XAS A;  4Y13 A;  3OYH A;  3S3N A;  2VIX A;  3BJO A;  4LK1 F;  4D7M A;  3HPG A;  2EFN A;  3T8R A;  2M87 A;  3CCU I;  1WVR A;  2GBY A;  2VI6 A;  2KHM A;  1WJ5 A;  5KCM A;  2FQ3 A;  1ON2 A;  4HNU A;  4C3I J;  3ZQI A;  1R5H A;  2GA1 A;  1Y56 A;  4IF4 A;  2VON A;  2KP6 A;  3ML6 A;  1KGS A;  1UHS A;  1YQA A;  2L9V A;  2O9L A;  3EQL F;  2M8E A;  1Z6T A;  1EH8 A;  3OIP A;  1X1P A;  2CW0 F;  4U0Y A;  4W97 A;  3ERM A;  2ZXW H;  4LLG F;  1FP1 D;  1SFO J;  5KNL A;  3VSK A;  3FXJ A;  2P0W A;  2CG4 A;  4X1E A;  4EGZ A;  4ENN A;  1R5I D;  1NTC A;  4Y33 A;  3IAS 2;  2FBI A;  1KU2 A;  1KU3 A;  1ZG3 A;  3J81 K;  5F27 A;  5F64 A;  2HWV A;  1KZH A;  3K1P A;  4M3B A;  2BEO A;  2E7W A;  3H0G J;  2M9H A;  2HI3 A;  2X1E A;  1TWG J;  3PQK A;  3OYE A;  2XB0 X;  2VKD A;  2H94 A;  5E3N A;  1IG7 A;  1O4X A;  3FIW A;  2H6C A;  4HAM A;  4R8H A;  5F08 A;  1JKO C;  2QYO A;  2MW8 A;  2AHQ A;  1LQ1 A;  3A4C A;  1WJD A;  4AIK A;  2WTE A;  4A3I J;  1BM9 A;  1AU7 A;  3PNT A;  3H9G A;  3RJP A;  2HYG D;  3VOD A;  3K1N A;  1ZKG A;  2MG4 A;  1I39 A;  1P6R A;  2YX4 A;  2BXY A;  4G8X A;  2FNP A;  3VYS B;  3HRU A;  3W2V A;  1MMN A;  2K9S A;  1Y8R B;  2VBY A;  2IBD A;  4M3E A;  3KYL A;  3J7A O;  5J1Y A;  3KYD B;  5CYV A;  3S1Q J;  3JTH A;  4JOM A;  1WSU A;  2LBF A;  2ZB9 A;  1VND A;  2LOO A;  5E1W A;  4BE1 A;  5LBQ A;  2LY9 A;  2MLK A;  1S3J A;  3MQ0 A;  4I98 B;  1Z0X A;  3SEQ A;  1TW2 A;  4L5E A;  4PJJ A;  1ODD A;  4LG3 A;  3KZY A;  2LKS A;  3L09 A;  4ZDP A;  3ZMZ A;  5BQT A;  1X2N A;  1J9I A;  2ZXJ A;  1OCZ H;  3COA C;  4M3D A;  4AD9 A;  4KNY A;  4S05 A;  1KQ9 A;  1VQM I;  1MJA A;  1P4A A;  4XR6 A;  3AKZ A;  1JJ8 C;  1AHD P;  4NB5 A;  2DN0 A;  2DMT A;  4HYE A;  2IGN A;  4L9N A;  4A3M J;  4ZDL A;  1BI2 A;  4XNF A;  1RR8 C;  4Q48 A;  4CO8 A;  3K4N A;  4M9Z A;  4I09 A;  4OAY A;  2DT5 A;  3IWF A;  1IO2 A;  1T6S A;  1LVK A;  3E3V A;  3GTM J;  1MMA A;  4ZC3 A;  1GXP A;  2ZME A;  4MIM A;  1E3H A;  2HPI A;  2VBX A;  4EJV A;  1OLT A;  1BA5 A;  1FEX A;  4LFU A;  1X1B A;  4KIC A;  1XTA A;  1Z3Y A;  3H36 A;  4F55 A;  5LGN A;  4KMF A;  1NK2 P;  4E70 A;  2Y9Z A;  3BR0 A;  1JE8 A;  3OSF A;  1RI7 A;  1A04 A;  2RC4 A;  1ERD A;  5LGU A;  1GXQ A;  3J7A Y;  2OAZ A;  3HYI A;  5HVQ C;  1RNL A;  3GLX A;  2RAE A;  3EET A;  4YFN F;  5E3O A;  4CCJ A;  1R71 A;  1LFB A;  2ELK A;  2EZL A;  3Q0V A;  3GF2 A;  2OTL I;  2UV1 A;  4ZDO A;  2HOS A;  2VOO A;  2JRT A;  4XQF A;  3LA3 A;  4F52 A;  3S17 J;  2LBF B;  4AU7 A;  1QHH D;  2XPW A;  5J8F A;  3GTL J;  1MBH A;  4L9J A;  3F3X A;  4HNT A;  5F0C A;  5HS9 A;  2JA5 J;  2MC3 A;  2GZW A;  3RIR A;  4XKV A;  2KJC A;  4IRH A;  5FKM A;  2UXX A;  4IHX A;  3ZQF A;  2W1O A;  5D6F A;  3DTK A;  2EK5 A;  2JA8 J;  3I3L A;  3IAM 2;  1W7P D;  1BR2 A;  1S6L A;  4A5M A;  1H0M A;  3RZD J;  2VJ4 A;  2PMU A;  1YO5 C;  2HDD A;  3CJQ B;  2L7Z A;  4OU0 A;  5J47 A;  4A3L J;  3D1N I;  4E7Z A;  4U0W A;  2A07 F;  2PFB A;  1ZG1 A;  3BPX A;  1GVJ A;  3HHG A;  1HKS A;  1AA7 A;  1WI3 A;  3GFM A;  3DFG A;  5EF6 A;  1Z21 A;  2HU9 A;  3A1Y A;  3GFJ A;  3ZMU A;  2OD5 A;  4ETS A;  2ZME B;  2VQG A;  3OMY A;  2LD5 A;  4HZF A;  4PSX A;  1X58 A;  3PUB A;  5DYM A;  4WCG A;  2DA3 A;  4AIH A;  2G7U A;  4DGW B;  1V3F A;  5K7H A;  1L3L A;  1V54 H;  3VDX A;  2V79 A;  3PNY A;  4ZJZ A;  4E7S A;  3S16 J;  2EV0 A;  1REP C;  2RNG A;  3F0C A;  1ZQ3 P;  1UG0 A;  2D1V A;  3M8F A;  2IRF G;  1QQI A;  2PEX A;  5L3D A;  1WH5 A;  1MNM C;  3KIO A;  3QPT A;  2VT3 A;  2XVC A;  1JGG A;  3R60 A;  5HNF A;  2EH3 A;  1GV5 A;  1IAW A;  2DI3 A;  3RPQ A;  4JYK A;  3TKY A;  3LA7 A;  1YJW I;  4HSR A;  3BWG A;  4I0B A;  2F5D A;  1SD5 A;  3WGG A;  1SMY F;  3SDG A;  4YG2 F;  4C30 A;  2KZV A;  3G1O A;  2MA3 A;  1IN7 A;  4EM0 B;  5FD5 A;  4YIR X;  2K9L A;  5KHD A;  4WF2 A;  2Y0M A;  4DNC A;  1S8N A;  2A6H F;  2DMP A;  3K1M A;  1I3Q J;  2LMD A;  4P5O A;  4AIJ A;  4XKW A;  1IUF A;  2DMN A;  1ETY A;  3CCQ I;  3B6C A;  1FIA A;  5DM7 F;  5ICF A;  1MSE C;  1IRX A;  5IP6 A;  5D5V B;  3J7Y J;  2IGO A;  1LEA A;  1X19 A;  4GRI A;  4DQ2 A;  4F92 B;  3K4J A;  5K7Z A;  3A03 A;  1OYI A;  1I27 A;  2R93 J;  1XC5 A;  4C9Y A;  1U3E M;  2EWN A;  3WTT C;  1Z3X A;  3HL2 A;  2KL4 A;  1J75 A;  2CW8 A;  3U21 A;  5FLM J;  2ECB A;  3H35 A;  2QSF X;  3LWF A;  4LLL A;  4TV7 A;  3MKZ A;  1ZAO A;  1GT0 C;  3EUH A;  1WGX A;  1GLN A;  3FXL A;  4E4H A;  2B63 J;  2QVO A;  3L2U A;  1E3P A;  5F6F A;  2LG4 A;  4BQN A;  3HHH A;  4HNV A;  1UEL B;  3NRV A;  3FIS A;  1UJ8 A;  1SC7 A;  1MDM B;  2F48 A;  1ZLK A;  3S8P A;  4IX7 A;  2LTP A;  1T39 A;  3DU5 A;  3TQN A;  5FGM A;  2MBF A;  3TP0 A;  3W6J B;  1LUJ B;  4BXF A;  1QPM A;  3OYB A;  3ZN1 A;  5IYC J;  1UAA A;  4IJA A;  9ANT A;  2GQQ A;  3M9A A;  3WTZ A;  3BQY A;  3S1M J;  4XLA A;  3O8G A;  2YR2 A;  3FXR A;  2P6S A;  1D8J A;  1LDK B;  2DW4 A;  4XBF A;  4FAS D;  5F0H A;  2NAZ A;  3R4K A;  4BYY A;  4N9I A;  2Z16 A;  5E1Z B;  1U9O A;  3RSN A;  2W57 A;  1OCT C;  1XGN A;  3GUD A;  4PDK A;  5ED4 A;  3T0Y A;  3U2R A;  3SZG A;  1RC9 A;  5IOZ A;  2XAJ A;  4YRV A;  3OR2 C;  3ERE D;  2IGK A;  4DBQ A;  1Y0N A;  1XSV A;  4ZYG A;  4M6X A;  1NG6 A;  1CQT A;  2DO7 A;  2X4H A;  1E2X A;  3V4G A;  1K79 A;  5FRM A;  3L1P A;  4XOT A;  2QQB A;  1UFM A;  2FOW A;  2XAF A;  1K78 A;  2M34 A;  3BR2 A;  2KLO A;  2I5U A;  2K9Q A;  3E6D A;  2L7F P;  3IKV A;  4MQV A;  3V7R A;  3KET A;  2M8G X;  4BAC A;  4CYC A;  4DJA A;  4XN0 A;  3HSR A;  1FC3 A;  5CVU A;  3DCF A;  1XGM A;  4BE0 A;  1PUF A;  3OR1 C;  3DPL C;  4EJT A;  4KIB A;  4MGR A;  3KEO A;  3S2D J;  3JRB A;  1DU0 A;  3MFK A;  1JJ6 C;  4U87 A;  2RKH A;  1JUP A;  2LF8 A;  4HA8 A;  3H92 A;  4UVC A;  2KIF A;  1W0U A;  2X6X A;  3L9F A;  2LSO A;  2Y0S N;  1T0F A;  4XLN F;  2DT6 A;  4PFO A;  3L00 A;  3Q9S A;  1QZY A;  3I0T A;  1KQ0 A;  1NH3 A;  2K3P A;  1SVL A;  1DPR A;  3J80 K;  2QBY A;  5HOD A;  3OYA A;  5M5W J;  4JQF A;  4PCQ A;  1VQ9 I;  3OYG A;  1LVA A;  2PMZ N;  1WJF A;  2QF7 A;  3QOD A;  4ON0 A;  1QBJ A;  2RNJ A;  2IA1 A;  2JN6 A;  2KIM A;  3CMA I;  2B7E A;  3OYL A;  4J00 A;  1JI8 A;  2DOA A;  4X0G A;  4HOB A;  4AYB N;  4JP0 A;  3N97 A;  4B44 A;  4M6V A;  3C2G A;  1B72 A;  4IRI A;  4BGD A;  1VTN C;  4A0X A;  1NG7 A;  2ZC2 A;  1F36 A;  4YFK F;  3LA2 A;  4UB6 C;  4OIO F;  2HPM A;  1BIB A;  3I5U A;  1IXC A;  4LGW A;  2HOT A;  2UWM A;  2I8D A;  1YYV A;  4F7Z A;  3L2R A;  2V6E A;  1I1S A;  2FML A;  4BY7 J;  2DOD A;  4AVZ A;  4QTR A;  2V4J C;  4I7H A;  4UV8 A;  1O3T A;  1VQN I;  3S15 J;  2L01 A;  4PZJ A;  4HX8 A;  2WAE A;  1K78 B;  2FJ1 A;  4BDY A;  1YIJ I;  2H1K A;  3BPV A;  3DKX A;  3G1L A;  2R92 J;  4CYC B;  5IYB J;  1J0R A;  2IPQ X;  2IT0 A;  4DOZ A;  3MKY B;  1TLH B;  1X3U A;  4PFP A;  2KRC A;  2DJI A;  1PUF B;  2LDU A;  5A2Q K;  2G7H A;  4LIU A;  2EBI A;  3ABL H;  1N25 A;  3JR9 A;  2AQF A;  3DV8 A;  2QEN A;  4M3F A;  1ZH5 A;  4BH9 A;  2KMU A;  4II2 A;  5EYR A;  5JFR A;  1DQU A;  1R22 A;  3IKT A;  3CO6 C;  5CJ9 A;  2NVU B;  3BTL A;  3CJR B;  3MKL A;  2HXI A;  5FD6 A;  4UVA A;  4OIR F;  1IGN A;  2VPR A;  1OCO H;  1HLV A;  2M7B A;  1MIJ A;  2QBY B;  4NC8 A;  2DA6 A;  1VQ6 I;  2LY2 A;  4M71 A;  4HPQ A;  1W0T A;  3BCB A;  3HG9 A;  5E8G A;  4BJ6 C;  2B0L A;  2X48 A;  3H3Z A;  1H9T A;  3I4M J;  4ZZD A;  1W5T A;  3CTA A;  2DTR A;  4H4K C;  1MNE A;  4EQQ A;  3SJM A;  2LVS A;  4WWC A;  4FCY A;  2Y75 A;  3LQQ A;  2CW7 A;  3ELK A;  1VQK I;  4XKC A;  1B72 B;  2WV1 A;  3TOB A;  2L2O A;  1HOM A;  4E7K A;  2XGE A;  3CLO A;  3FWE A;  1T33 A;  3V7S A;  3BR3 A;  2P6T A;  2GOM A;  4QPO A;  3K70 D;  2STT A;  5LEK A;  1QZE A;  2Y31 A;  3QPL A;  4KIF A;  2IVM A;  3ULQ B;  4A3C J;  4LD5 A;  3HKZ N;  4IQ4 A;  3KFW X;  1JHF A;  3CC2 I;  5EGO A;  3SFZ A;  2ZSH B;  2VL8 A;  2A05 A;  4KUM A;  1TL8 A;  2TCT A;  2HEO A;  1K61 A;  1IDY A;  4AWX B;  3UKG A;  1MZB A;  3DEW A;  2OC6 A;  4MNU A;  2EFQ A;  2PI0 A;  2VKV A;  5EJC A;  1ZTR A;  4BAY A;  2UUZ A;  4A6D A;  3IP4 B;  3U9G A;  5HDG A;  2NOJ B;  3FMR A;  1RR7 A;  1AKH A;  5K5Q A;  2R7Q A;  3EDP A;  2HNH A;  3ZQG A;  5BPD A;  1QPI A;  4PUS A;  3DF8 A;  1BOA A;  4FX4 A;  2ZXI A;  1SD4 A;  1BIA A;  2PMZ A;  3F23 A;  2ZNY A;  3QU6 A;  2JPB A;  4A69 C;  5ICG A;  2FU4 A;  5JHF A;  1XD7 A;  3HBL A;  1D5Y A;  1IN4 A;  3K4B A;  2Z9O A;  2HOE A;  3ASN H;  1SAU A;  3LAP A;  3F72 A;  2JSP A;  3IUO A;  2DA1 A;  1QZZ A;  3K0L A;  2BV6 A;  3PFI A;  1VZ0 A;  2XIG A;  3U1D A;  1OMI A;  4B1R A;  5F1R A;  4AYB A;  5GP9 A;  2CWE A;  4V2G A;  4P55 A;  1B8I A;  5CVI A;  3MCZ A;  2IS4 A;  2CQN A;  3MVP A;  4BXU A;  4EGY A;  4Y3O A;  3PSF A;  2DK8 A;  1F43 A;  1BL0 A;  3MEX A;  2V1U A;  2K86 A;  1S72 I;  4N4N B;  4D1Q A;  1LB2 A;  2H09 A;  4YII A;  4UHT A;  5L3F A;  1VQP I;  4IPA A;  4XLH A;  3QP5 A;  2GWR A;  2WAD A;  1ZRE A;  1D0X A;  1WJA A;  3S32 A;  3E0J B;  1TZL A;  3DLA A;  4BEH A;  2CQX A;  5JHU A;  5ICE A;  2BY1 A;  2BYV E;  4J01 A;  4S0H B;  4MFD A;  2KFD A;  4DYQ A;  4CUG A;  3WTS C;  4FTH A;  3S14 J;  1TWC J;  4C2M J;  1IN8 A;  2DDB A;  4WXC A;  2RN7 A;  3TO9 A;  5LFA A;  5BS6 A;  3KPH A;  2D2W A;  1TWA J;  3ZQC A;  2LLK A;  5J3L A;  1RET A;  2EIN H;  2VXD A;  4XM3 A;  4GXO A;  4I2O A;  3DQV C;  5J4Y A;  3IWZ A;  3PM1 A;  3VWB A;  1USS A;  1X1A A;  1SMT A;  4A93 J;  5CPR B;  1S7A A;  1AKH B;  4G6Q A;  2VT2 A;  2ISY A;  2VXZ A;  2O8X A;  3FBN B;  4ESF A;  1XDU A;  1G59 A;  5IOY A;  1EKE A;  4RLQ A;  5L3G A;  4GDF A;  4ASN A;  2LC2 A;  2Y9Y A;  4NBQ A;  1SFU A;  4UY8 I;  2ID3 A;  4NHJ A;  3CES A;  2IS6 A;  2EQR A;  2QZ8 A;  4G9Y A;  4I99 C;  2WAQ A;  4IEJ A;  1RPW A;  2LP0 A;  4RAG A;  1B8I B;  2HVR A;  2R7Z J;  2DFE A;  5GPA A;  2E1O A;  4CDG A;  2NVX J;  2CJJ A;  2NS8 A;  2E71 A;  2ELH A;  1D5V A;  4JX4 A;  3SHF A;  4QIW N;  5HDK A;  1Z1D A;  1G3T A;  2WWY A;  3S2H J;  2ICW G;  4NQW A;  3ABU A;  2AQE A;  1JTY A;  2DMU A;  3BG7 A;  3LSI A;  3WGI A;  2VBZ A;  5FFX A;  3O2P E;  1WCM J;  1MJB A;  3I71 A;  4CZC A;  3L2W A;  3HOW J;  1FMV A;  1BOB A;  2BY2 A;  3DEE A;  4BEH B;  3P7N A;  2K9M A;  5GAG J;  2ZJP F;  1JKP C;  4RBO A;  3SZP A;  1RUN A;  4OOI A;  4CIC A;  5DM6 F;  1HW1 A;  2VKH A;  3R61 A;  2VQH A;  2L9N A;  3DXJ F;  3T5X A;  4EJW A;  2F5V A;  1HXD A;  1IRF A;  2M5W A;  4EM2 A;  3CF5 F;  3WTV C;  3QPS A;  3JRH A;  3ESW B;  1GVD A;  2DDA A;  3EPZ A;  1VQ5 I;  1YG2 A;  4UNO A;  2NXN B;  3TP3 A;  1V5F A;  4BUP A;  2PMH A;  2E36 A;  1VF9 A;  5D5W B;  1BI3 A;  2P4W A;  3K4K A;  3HOS A;  3QRF F;  1HW5 A;  2VE8 A;  2KDO A;  3CQZ J;  3F21 A;  1BI1 A;  3HTU A;  3OS0 A;  3KP7 A;  3WHB A;  4OMZ A;  5FKN A;  4BHC A;  1UHM A;  5J8C A;  1V4R A;  1PJR A;  2W25 A;  4YFX F;  5M5Y J;  5FRO A;  1B9M A;  3MD2 A;  3RDI A;  3IH4 A;  3H5A A;  3RKW A;  1ONV A;  1R1V A;  1MW7 A;  1XN7 A;  2L9R A;  3VPR A;  4G7Z F;  3BR1 A;  2EIK H;  2STW A;  3LSG A;  3ABT A;  1OFC X;  3HC7 A;  3ZXS A;  4RB1 A;  1WJB A;  1CGP A;  3CMY A;  3PSI A;  2VB6 A;  3RZO J;  4LG0 A;  3BG6 A;  1JT0 A;  4NQW B;  1YS7 A;  3LMM A;  5JVG F;  4PJL A;  1I5Z A;  4OIN F;  2VC1 A;  4QPQ A;  3B6A A;  5C4J J;  4DBR A;  2HXO A;  4OIP F;  3TED A;  1YS6 A;  4BS9 A;  1OIS A;  2DOE A;  2L54 A;  1XB4 A;  4OIQ F;  1ZRD A;  3G4S I;  3P9I A;  2JA2 A;  5B1B H;  2L0K A;  3SFI A;  2HKO A;  3H1C A;  4IQJ A;  2HZT A;  1J2X A;  1MBJ A;  3OIQ A;  3F8N A;  1TBX A;  2O5R A;  3H3V K;  4W1U A;  5J40 A;  2YUS A;  3GTJ J;  3JRG A;  2DA7 A;  2X9D A;  3WGH A;  3OS2 A;  4FQG A;  2QKM B;  4MO7 A;  4LK0 F;  5E18 F;  4M9S A;  3GW2 A;  2LR8 A;  3H5R A;  1D8K A;  3RKY A;  1KU7 A;  3J7Z I;  1G2H A;  2GAU A;  2M45 A;  1H9G A;  2QSH X;  3W6K B;  1LPQ A;  2CSO A;  2JWT A;  1U78 A;  1OYW A;  4RGS A;  3PIP F;  5FKK A;  4EMS A;  5EEG A;  3CD6 I;  2D1H A;  3JRI A;  5BNG A;  2OU2 A;  3K6G A;  3SYT A;  1QVU A;  3FXO A;  2HYF A;  4B3X A;  3VSL A;  2QWW A;  2XDV A;  3DKY A;  2VJ5 A;  5E3L A;  3ZQL A;  4LG0 B;  2ZBK A;  1LEB A;  3BG9 A;  2HGC A;  3TBI A;  5EEA A;  2Z1D A;  5JLW A;  1O3R A;  4EEF G;  5EDN A;  3UR3 C;  4E6K G;  1IC8 A;  2MH9 A;  1XSD A;  4GGG A;  4D0P A;  4BDZ A;  1LJ9 A;  2L4A A;  3I56 I;  4U7B A;  4FE7 A;  2F5F A;  1TNT A;  2X6W A;  4P9U A;  4C2T A;  2DA5 A;  3I59 A;  3G2B A;  4U88 A;  1JHH A;  1HDP A;  4FT8 A;  3GZN B;  3CJN A;  3C7J A;  1O7F A;  2WB1 N;  5IT9 K;  1OCP A;  4OAZ A;  1WZ2 A;  3KLO A;  1MH3 A;  4HDV A;  3GYH X;  4MHG A;  5D4S A;  1X4P A;  3HTS B;  3LNQ A;  3JRC A;  1R5G A;  3VYT B;  3GME A;  4N4O B;  4Y7N J;  2W84 A;  3ECH A;  4KN4 X;  4EVI A;  2ZJR F;  1U8B A;  1KU9 A;  4JX5 A;  3WTX C;  2AS5 F;  3BT9 A;  4A2U A;  4IHY A;  1L0O C;  3HM5 A;  3RTR A;  1QGP A;  1Z05 A;  5K5R A;  2MSY A;  3CDL A;  2X6O A;  3GFL A;  3CF2 A;  3OYK A;  2IAI A;  5FO5 A;  3IC7 A;  1W7P A;  2YX7 A;  3DPU A;  2X1D A;  1VI0 A;  2FUG 2;  1WRJ A;  2VC0 A;  2E19 A;  1ETW A;  2DXI A;  2K4J A;  3BTJ A; 
#chains in the Genus database with same CATH homology
 1K83 J;  4M6V A;  2OPT A;  5J1U A;  1B72 A;  5C3E J;  1MBE A;  4FIS A;  1F36 A;  2CU7 A;  1DU6 A;  2EZI A;  3CCY A;  2HOT A;  4BBR J;  3K7A J;  1JUS A;  1MH4 A;  2XB5 A;  5FKO A;  1RES A;  1OJL A;  4BY7 J;  3FKI J;  3GTP J;  2IEK A;  1Z77 A;  2NOG A;  4QTR A;  3TW7 A;  4V2F A;  3S15 J;  3Q0W A;  2FJ1 A;  2H1K A;  2K40 A;  4XID A;  3A01 A;  3G1L A;  1BJZ A;  4LOC A;  5FLV A;  2R92 J;  4MLO A;  4CYC B;  5IYB J;  2R5Y B;  1R9T J;  1PUF B;  2EBI A;  4D5C A;  2I10 A;  3JRA A;  3JR9 A;  1A5J A;  4M3F A;  1JTX A;  1ZK8 A;  1Y1W J;  5EYR A;  2EZK A;  2FD5 A;  4A3E J;  2XGC A;  4XRS A;  2MGQ A;  2DA4 A;  3BTL A;  2HXI A;  3FK7 A;  3MKL A;  2YS9 A;  4NDL A;  1FJL A;  1IGN A;  1ORK A;  2VPR A;  2R5Z B;  3HB9 A;  4JX6 A;  1HLV A;  1BW5 A;  1WH7 A;  5M5X J;  3PO2 J;  2DA6 A;  2XPU A;  2E2I J;  1MBK A;  1W0T A;  2CUE A;  4AC0 A;  1ETX A;  2X48 A;  1RKW A;  4C3J J;  3I4M J;  4D7M A;  1LE8 A;  3SJM A;  2LVS A;  1TWF J;  5EG0 B;  2O8K A;  4FCY A;  2GBY A;  1X2M A;  2VI6 A;  4C3H J;  4D7N A;  1IJW C;  3LSJ A;  4ABZ A;  1B72 B;  2WV1 A;  1HOM A;  3GTG J;  4C3I J;  5C44 J;  3ZQI A;  2XGE A;  3NAR A;  1T33 A;  3S1N J;  3M3Y J;  3BR3 A;  2TRT A;  1UHS A;  1XG1 A;  2Y31 A;  3QPL A;  2AO9 A;  5M3F J;  2O9L A;  5GPC A;  3BR5 A;  4A3C J;  2GM4 A;  3HKZ N;  2GLO A;  5EGO A;  4W97 A;  3ZQH A;  5FJ8 J;  1YRN A;  2JK3 A;  2O7O A;  1SFO J;  2CRG A;  3A01 B;  2TCT A;  1K61 A;  1ITY A;  1HDD C;  4X1E A;  3JRD A;  1IDY A;  3UKG A;  3I4N J;  1ETQ A;  3DEW A;  1NTC A;  4A3D J;  3MN2 A;  2XGD A;  5F27 A;  2VKV A;  1ZTR A;  4XRM A;  5JLX A;  4BY1 J;  4M3B A;  3H0G J;  2M9H A;  2HI3 A;  1U9N A;  1XS9 A;  1TWG J;  1VFC A;  2XB0 X;  5E3N A;  2DTZ A;  1IG7 A;  1RR7 A;  1AKH A;  2NVT J;  1IDZ A;  1O4X A;  3FIW A;  4IHV A;  1JKO C;  5F08 A;  4J19 A;  2COB A;  2E2H J;  2MW8 A;  2AHQ A;  1AU7 A;  4A3I J;  3ZQG A;  1QPI A;  1ZKG A;  4A3G J;  2MG4 A;  1ETO A;  4A69 C;  2P81 A;  3NAU A;  3HBL A;  2K9S A;  1D5Y A;  3BQZ A;  2XSD C;  2IBD A;  4XIC A;  2DA1 A;  4B1R A;  1LE8 B;  4M3E A;  1GUU A;  5J1Y A;  5GP9 A;  1H88 C;  4DZP A;  3S1Q J;  4V2G A;  1B8I A;  3IH3 A;  2ZB9 A;  1VND A;  3A02 A;  3MVP A;  2VUM J;  3RKQ A;  3ZOB A;  2LY9 A;  4D5F A;  1F43 A;  4FE4 A;  1BL0 A;  5DS9 A;  5J1R A;  1Z0X A;  4L5E A;  5F04 A;  1HF0 A;  5IP7 J;  1SAN A;  3HOY J;  2JA6 J;  1X2N A;  4A3K J;  3JRF A;  4M3D A;  4M3G A;  3OIO A;  1MBG A;  4MFE A;  1TWH J;  4IHW A;  1JJ8 C;  1AHD P;  2DN0 A;  2DMT A;  2CQX A;  1YRN B;  4S0H B;  2ME0 A;  4MFD A;  5DTD A;  4DYQ A;  1ZR2 A;  1E3O C;  4FTH A;  2H8R A;  4A3M J;  3S14 J;  1TWC J;  4C2M J;  2XRL A;  2DJN A;  1TWA J;  3ZQC A;  2LLK A;  1EF4 A;  5J3L A;  1RET A;  1JT6 A;  2ECC A;  1Q1V A;  3GTM J;  4UUS A;  3PM1 A;  1ZGW A;  4MIM A;  4A93 J;  1AKH B;  3HEF A;  3IV5 A;  3OSG A;  1BA5 A;  1FEX A;  4DZJ A;  5IOY A;  1NK2 P;  2Y9Z A;  3BR0 A;  3OSF A;  3GTK J;  2Y9Y A;  1HCR A;  2ID3 A;  2NVY J;  3K2A A;  1ETV A;  2EQR A;  2RAE A;  5E3O A;  4A3J J;  1LFB A;  2HQ5 A;  2ELK A;  2EZL A;  3Q0V A;  3BTC A;  4IEJ A;  1FIP A;  2HOS A;  2FX0 A;  3IH2 A;  1RPW A;  2LP0 A;  2DMQ A;  1B8I B;  3S17 J;  4GFB A;  2R7Z J;  2XPW A;  5GPA A;  4Y52 J;  2E1O A;  2NVX J;  3HOZ J;  2CJJ A;  3GTL J;  1MBH A;  4XK4 A;  2R0Q C;  2NS8 A;  5F0C A;  2JA5 J;  1I6H J;  4JX4 A;  4QIW N;  3BTI A;  5K7F A;  3S2H J;  5FKM A;  1TC3 C;  1GDT A;  4IHX A;  3ZQF A;  1JTY A;  2DMU A;  2JA8 J;  3RZD J;  2HDD A;  1WCM J;  3HOW J;  3BG3 A;  1JKQ C;  2L7Z A;  3GBG A;  1A6I A;  5IYD J;  2XPV A;  4A3L J;  2HYJ A;  3D1N I;  4I6Z A;  2N8G A;  1JKP C;  4RBO A;  2JA7 J;  2M2E A;  2KT0 A;  4I76 A;  2FQ4 A;  3JRE A;  1P7J A;  1FTT A;  1WI3 A;  5EF6 A;  5IPA A;  4UUS B;  3RQI A;  2E2J J;  2EZH A;  3QPS A;  3JRH A;  2LD5 A;  3PO3 J;  1I50 J;  1GVD A;  1X58 A;  3Q3S A;  3TP3 A;  2DA3 A;  1VF9 A;  5K7H A;  1S7E A;  3CQZ J;  4DW6 A;  2Y2Z A;  3WHB A;  3S16 J;  5FKN A;  3F0C A;  1ZQ3 P;  4QSH A;  5M5Y J;  1WH5 A;  1MNM C;  3IH4 A;  4A3B J;  2LFB A;  3E7L A;  1JGG A;  1ENH A;  2EH3 A;  1GV5 A;  2CQQ A;  2L9R A;  4JYK A;  3VPR A;  3G1M A;  3BR1 A;  3TW6 A;  3LSG A;  1OFC X;  5F1J A;  2JJ7 A;  1MSF C;  3SDG A;  3G1O A;  4RDU A;  4DYC A;  4XRS G;  5IP9 J;  3CMY A;  2D5V A;  3RZO J;  1JT0 A;  2DMP A;  3HOV J;  5EGO B;  1I3Q J;  3GTO J;  4X6A J;  3B6A A;  1IUF A;  2DMN A;  5C4J J;  2HXO A;  1ETY A;  3B6C A;  1H89 C;  1FIA A;  1MSE C;  5IP6 A;  2HOA A;  3TED A;  3S1R J;  2NVQ J;  2QCO A;  5K7Z A;  4DYR A;  3A03 A;  2R93 J;  1XC5 A;  2L0K A;  3SFI A;  1WPK A;  2M0C A;  4B4C A;  3LOC A;  1T56 A;  3HOX J;  1LFU P;  1JUM A;  1MBJ A;  5FLM J;  2ECB A;  1GT0 C;  3H3V K;  4W1U A;  1JKR C;  1FTZ A;  2YUS A;  1WGX A;  3GTJ J;  2B63 J;  3JRG A;  2DA7 A;  1QRY A;  5FKL A;  4AUX A;  1Y1V J;  4HNV A;  3FIS A;  2X9D A;  2K9N A;  2G0E A;  3GTQ J;  4MO7 A;  1GV2 A;  1QVT A;  2LTP A;  3W6V A;  4A3F J;  2LR8 A;  3TP0 A;  1G2H A;  3HOU J;  2L7M P;  5IYC J;  9ANT A;  2JWT A;  1IV6 A;  3BQY A;  3S1M J;  4BXX J;  3O8G A;  1U78 A;  3BR6 A;  5F0H A;  5FKK A;  2WAQ N;  2LK2 A;  3M4O J;  1MBF A;  3JRI A;  5BNG A;  3LSP A;  1QVU A;  1U9O A;  2ME6 A;  5E3L A;  1OCT C;  3ZQL A;  3HGY A;  1APL C;  3BG9 A;  4UUT A;  5IOZ A;  1POG A;  5EEA A;  5JLW A;  1ETK A;  4EEF G;  5EDN A;  3OOU A;  4BBS J;  5M3M J;  1IC8 A;  3C2B A;  1CQT A;  3HGG A;  3L1P A;  4FE7 A;  3Q0U A;  5EZH A;  2M34 A;  5F0F A;  3BR2 A;  3WHC A;  4B3A A;  2DA5 A;  1HDP A;  2K9Q A;  2L7F P;  2VKE A;  2M8G X;  2ID6 A;  2WB1 N;  4CYC A;  1UG2 A;  2R5Y A;  1OCP A;  2LKX A;  1NK3 P;  2W48 A;  4BKX A;  2YU9 J;  3DCF A;  1MH3 A;  1PUF A;  2DA2 A;  3O8H A;  1RKT A;  3LNQ A;  1BW6 A;  3JRC A;  2KDZ A;  4Y7N J;  1IRZ A;  3S2D J;  3JRB A;  1DU0 A;  1UMQ A;  1JJ6 C;  3BG5 A;  1JUP A;  1U8B A;  4JX5 A;  1W0U A;  3BT9 A;  2Y0S N;  4IHY A;  2JMW A;  3HM5 A;  1ZR4 A;  2R5Z A;  3HDD A;  4G12 A;  5HOD A;  5M5W J;  2MSY A;  3CDL A;  5C4X J;  2X6O A;  3LSR A;  2IAI A;  2OF7 A;  5EZG A;  2CUF A;  1H8A C;  2PMZ N;  2QF7 A;  1P7I A;  1VI0 A;  2NS7 A;  2JN6 A;  2E19 A;  5EG0 A;  2Y30 A;  1ETW A;  3QQA A;  5E3M A;  4AYB N;  4JP0 A;  3BTJ A;  3FK6 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...