2R5ZA

Structure of scr/exd complex bound to a dna sequence derived from the fkh gene
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
87
structure length
75
Chain Sequence
KKNPPQIYPWMKRVHLRQRTSYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKEHK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Functional specificity of a Hox protein mediated by the recognition of minor groove structure
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription/dna
molecule keywords DNA (5'-D(*DAP*DCP*DTP*DCP*DTP*DAP*DAP*DGP*DAP*DTP*DTP*DAP*D
total genus 25
structure length 75
sequence length 87
ec nomenclature
pdb deposition date 2007-09-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2r5zA00
2HDDA 1AKHA 2Y31A 5F0CA 5EZGA 2E2HJ 2HOTA 1G2HA 1LE8B 1X58A 1P7IA 3BT9A 3GTPJ 4QSHA 2WAQN 2NS7A 2JA8J 4XK4A 2EZKA 2HXIA 2HOAA 2JA6J 3LSGA 4QTRA 2L0KA 4IHXA 1WI3A 3ZOBA 1MH3A 3NAUA 3O8HA 2O9LA 3HEFA 5EZHA 3QPLA 3D1NI 3BG3A 5FLVA 1GV2A 3WHBA 1WH5A 1FEXA 2WV1A 2MW8A 3RQIA 1UG2A 1JT6A 2EZIA 2DA6A 2COBA 3GTOJ 3H3VK 4W1UA 5M5XJ 1ZR2A 4UUSB 3HGYA 2L7MP 4DZPA 2OF7A 2JK3A 3CDLA 3FK6A 2HQ5A 1EF4A 1ETOA 4JX6A 1S7EA 3IH2A 3HGGA 1JUPA 3JRCA 3ZQFA 3ZQLA 2CU7A 4FE7A 4GFBA 2OPTA 3OIOA 3H0GJ 4D5FA 1RETA 2R92J 4NDLA 4MLOA 3RKQA 1FJLA 2GM4A 3GTKJ 3I4MJ 4Y7NJ 4FISA 2HI3A 3LNQA 4IHVA 3GTGJ 3HOZJ 3BR6A 3JRGA 2ECBA 4BY1J 2LFBA 5JLWA 5FKMA 4A3JJ 1LE8A 2NOGA 1PUFA 2DA2A 4FE4A 2QF7A 3BR1A 5GPCA 1X2MA 2EH3A 5GPAA 1GV5A 4UUSA 4DYQA 2B63J 2LD5A 5F04A 2L7ZA 3BR2A 3HOWJ 4C3HJ 2DMUA 2LKXA 3IH4A 1HLVA 4AUXA 4M3DA 3FKIJ 2CQQA 1A5JA 1Y1VJ 5F1JA 4MIMA 2XPUA 1LFBA 2HXOA 2XPWA 3BTCA 2NS8A 3ZQIA 2FQ4A 2CUFA 2FJ1A 3MVPA 4JX4A 1UMQA 3G1OA 2HOSA 2E19A 1XG1A 2GBYA 5E3OA 1B8IA 2IAIA 4A3DJ 1UHSA 2IEKA 1NK2P 1A6IA 2E2JJ 3JRHA 2VPRA 5IP7J 2R0QC 1Z0XA 1GUUA 4DYCA 5C4XJ 5K7HA 1TWGJ 3IH3A 1JTXA 4J19A 1MSFC 4BXXJ 1MBGA 1ETKA 1FIAA 2M2EA 2VI6A 1GDTA 3HM5A 3SFIA 3RZOJ 2CQXA 1JUSA 2LVSA 4QIWN 1VNDA 4I6ZA 1HF0A 3Q0UA 1ETVA 1RESA 2FX0A 5FKKA 2ME0A 2L9RA 1CQTA 5M5WJ 3A02A 2RAEA 1IUFA 2JA5J 4A3LJ 3W6VA 1DU0A 5IOYA 2NVXJ 3BG9A 4XICA 2YUSA 3S1RJ 5FLMJ 5C3EJ 4A3BJ 3S2HJ 1IDYA 3C2BA 9ANTA 2XSDC 1P7JA 5C44J 2EBIA 1JTYA 5DTDA 4B3AA 3UKGA 2DN0A 2K9NA 1U9NA 1MBHA 2JN6A 2N8GA 2LLKA 5EG0B 1U78A 3G1LA 1BL0A 2K9SA 2JJ7A 2JWTA 1I3QJ 4C2MJ 1I50J 3B6CA 1ZQ3P 4BBRJ 3HOUJ 4M6VA 3ZQHA 1OJLA 2DA7A 5E3NA 1OCPA 3LSPA 4G12A 4C3IJ 5IYDJ 4D5CA 2NVTJ 2R5ZA 4S0HB 4W97A 3DCFA 3HOXJ 5J3LA 5HODA 3TEDA 1TWCJ 2XB5A 4DYRA 2M9HA 1TWHJ 3JRIA 4AYBN 1JJ6C 4B1RA 1WCMJ 4IEJA 1RKTA 3CMYA 2G0EA 5K7FA 3S2DJ 1NK3P 1F36A 4AC0A 1MSEC 3A01A 4X6AJ 3M4OJ 1Y1WJ 3S15J 1TWFJ 4XIDA 3TP3A 1MH4A 2ME6A 5J1RA 5DS9A 2XGEA 2O8KA 2LP0A 3S1QJ 4EEFG 4DW6A 4CYCA 1JKQC 1BW5A 1NTCA 1RR7A 1ETWA 3TW7A 2QCOA 4V2GA 5FKNA 1HDDC 2Y0SN 3WHCA 4A3FJ 4C3JJ 4CYCB 1GVDA 2L7FP 1B8IB 2TCTA 1MBEA 4RDUA 1QPIA 5GP9A 4UUTA 3G1MA 1QVUA 1APLC 5J1YA 2DJNA 3TP0A 2AHQA 1POGA 4B4CA 5EGOA 2ZB9A 1XS9A 2I10A 2DMPA 3OSGA 1IDZA 3QPSA 2VKEA 1OFCX 1FIPA 1Z77A 4DZJA 3LSRA 2XGCA 3IV5A 1SANA 3Q0WA 1MBKA 2KT0A 2R5ZB 3HOVJ 1QRYA 1LFUP 4A69C 1B72A 1OCTC 2XPVA 2X48A 2AO9A 3GTLJ 2M8GX 2TRTA 1MBFA 1ETYA 2EZLA 1BA5A 2PMZN 1ETQA 3B6AA 3ZQGA 1WPKA 1O4XA 2M0CA 4XRSG 2X9DA 2DA4A 1ZGWA 3Q3SA 2Y9YA 3S1NJ 5IYCJ 1DU6A 5K7ZA 1U8BA 1AHDP 2YU9J 2VUMJ 3E7LA 5M3MJ 1YRNA 2R7ZJ 1VF9A 3S1MJ 1ZTRA 2X6OA 3F0CA 5FJ8J 3K2AA 2HYJA 3LSJA 2H1KA 3BTLA 1IV6A 1ORKA 1T56A 1IRZA 2R5YB 1R9TJ 2LTPA 2CRGA 5EDNA 3CQZJ 3Q0VA 1HCRA 3LOCA 1WGXA 2Y30A 4MFEA 1AU7A 3RZDJ 2EZHA 5IP9J 5FKOA 4ABZA 2EQRA 2DTZA 2W48A 2DMTA 3CCYA 3A03A 1K61A 3VPRA 4M3FA 1ZKGA 5EG0A 1B72B 3PM1A 3NARA 3OOUA 5FKLA 1X2NA 5JLXA 4BBSJ 3JRAA 1VFCA 4XRMA 2MGQA 4L5EA 5IP6A 3BQZA 4I76A 3JRDA 4A3MJ 2LK2A 2KDZA 2E1OA 1TC3C 1SFOJ 1JKOC 2ID3A 2DA5A 1IG7A 4A93J 3JRFA 5EGOB 3S16J 3L1PA 2ECCA 2K9QA 1D5YA 2NVYJ 3BQYA 1IGNA 5F08A 4Y52J 2VKVA 1BW6A 4JP0A 2Y2ZA 4X1EA 1T33A 3GTMJ 3O8GA 3BR3A 1VI0A 1K83J 1U9OA 4A3EJ 2CUEA 4V2FA 5M3FJ 2DMQA 3JRBA 2M34A 4M3EA 1JKPC 5BNGA 1MNMC 1FTZA 3PO2J 1ENHA 2ELKA 3FK7A 4RBOA 2XGDA 5F0FA 1I6HJ 4A3CJ 1JT0A 3DEWA 1Q1VA 1GT0C 5J1UA 4D7MA 2R5YA 4LOCA 2R93J 2O7OA 1HOMA 5EF6A 2ID6A 3HBLA 1TWAJ 2LY9A 4JYKA 4HNVA 1IJWC 2MSYA 2GLOA 3A01B 3GTQJ 4A3GJ 3JREA 5IPAA 1JUMA 3I4NJ 3BR0A 2XB0X 2P81A 3ZQCA 1W0TA 3SDGA 3MKLA 3S14J 3S17J 3PO3J 1JKRC 1AKHB 2DA3A 1QVTA 5F27A 1XC5A 4IHWA 1H8AC 2YS9A 1FTTA 5F0HA 2E2IJ 2JA7J 2Y9ZA 4M3BA 2DA1A 3JR9A 1F43A 4MO7A 2XRLA 2K40A 3SJMA 3FIWA 1RPWA 1JGGA 1JJ8C 1H89C 4FCYA 1E3OC 5E3LA 1ZK8A 3TW6A 3BR5A 3FISA 1PUFB 1ITYA 1IC8A 4FTHA 1W0UA 3BTIA 2DMNA 2JMWA 4A3IJ 1MBJA 5E3MA 2H8RA 1RKWA 4A3KJ 2WB1N 2D5VA 3QQAA 3GTJJ 3HKZN 5M5YJ 3BG5A 4MFDA 1YRNB 1BJZA 3HOYJ 1HDPA 4BKXA 1ETXA 2LR8A 2MG4A 5IYBJ 3OSFA 3HB9A 1ZR4A 4JX5A 3MN2A 4M3GA 4XRSA 5C4JJ 3M3YJ 5EEAA 3BTJA 2NVQJ 1H88C 4IHYA 2CJJA 2IBDA 5IOZA 3K7AJ 4BY7J 3GBGA 5EYRA 4D7NA 3HDDA 1WH7A 2FD5A
chains in the Genus database with same CATH superfamily
1P92A 4KIBA 1YITI 5EZGA 1W7PB 1G2HA 4EVIA 3BT9A 2MA3A 2MC4A 4LGWA 5LRRA 4IRIA 2P7VB 2WAQN 3IAM2 2E34A 1T2KA 4XK4A 1JXSA 4PSWA 1XD7A 3EUKL 3ZMVA 3CF5F 1Y56A 1J7KA 1BOBA 3F8FA 2UZKA 2K7LA 3FX3A 1VQNI 1U0JA 2ZBKA 2O9LA 3O8HA 1IN6A 3BCAA 3HEFA 3D1NI 3X2QH 3PIOF 5FLVA 3NWTA 1GV2A 5D5VB 4BEHB 3BY6A 2L9NA 2WV1A 5KVRA 2QSHX 3KZYA 1IF1A 2V7FA 1ZH5A 1OCRH 3HHGA 2XF6A 4IJAA 4XKCA 5AONA 3H3VK 2WV0A 3DF8A 5L3CA 2VBXA 4F93B 2CH0A 1RUNA 1TW3A 2BW3B 3CDHA 4HX8A 1EF4A 3JTGA 2I5UA 1FMVA 3J7ZI 3BZKA 1VZ0A 2MLGA 1O3SA 1O57A 1Y0NA 3OIOA 3CUQC 1TBXA 3H0GJ 3CP8A 5EJCA 2VQGA 5HS9A 1R7JA 1RETA 2R92J 4HNTA 3RKQA 1FJLA 2GM4A 2X0LA 1LNWA 2GXAA 4FISA 4IHVA 2QEXI 3IP4B 3KP6A 2GOMA 3E97A 3V4GA 4BY1J 4PGHA 5JLWA 1USTA 5FKMA 4B48A 4I7HA 2ISYA 4KMUX 2NOGA 1XMAA 2DA2A 1X1BA 4B47A 2QZ8A 3FDYA 1X2MA 2Z5UA 3RKYA 2L3DA 1DP7P 1OYYA 2DDAA 2OA4A 3FXQA 4YFNF 4DYQA 4ZJZA 2LD5A 2VOOA 1WKMA 3CJQB 4FX4A 4XLNF 2L7ZA 3BR2A 4C3HJ 3K2ZA 3WTTC 2E35A 1E17A 1HLVA 5DCFA 1FMWA 1IAWA 2QQAA 4M3DA 2CQQA 1A5JA 1Y1VJ 2IA1A 1M1EB 2WAQA 4MIMA 2XPWA 5FD5A 4EM2A 2NS8A 3ZQIA 2K86A 4WCGA 2X1DA 2CUFA 2CV0A 4L9JA 1ZGAA 3F6VA 5BQTA 2R7XA 2E5NA 2UXXA 2OTJI 1MMDA 1O7FA 3ESWB 4M6XA 1UHWA 1ZLKA 1SFKA 2E19A 3JTHA 1ZARA 2A5WA 3PNVA 1MNEA 3K6GA 3G2BA 2CV1A 4UB8C 4UVAA 5HDNA 4PDKA 1TLHB 1ACIA 4E7LA 3QODA 2VPRA 5IP7J 1ZYRF 5HNHA 2L5QA 1JI8A 5C4XJ 1J75A 4XN0A 4XR6A 5K7HA 2XIGA 3TMOA 3OYNA 2KQRA 4L0YB 4BXXJ 4XN3A 5DCMA 4LIVA 2OD5A 3M7GA 4M6YA 3MKZA 1LJ9A 1E3PA 4NNJA 3MZHA 2EFPA 2XDVA 1MD0A 2X1EA 1W5CC 3SFIA 2BHZA 3RZOJ 2CQXA 1SD6A 3WGGA 2WAEA 4RM2A 4E6KG 3KETA 4XL9A 2VIXA 3OYJA 2FX0A 4Y15A 1S3JA 4XM3A 1DUXC 3PJRA 2L9RA 3H9JA 5M5WJ 1Z67A 1W7PD 2NVUB 2RAEA 2JA5J 5IOYA 2NVXJ 3BG9A 4AYBA 3S1RJ 1ONVA 5FLMJ 2AQEA 4XRFA 9ANTA 1YYVA 2EPFA 4FHTA 5H6QA 1P4XA 2LBFA 2STWA 1FWZA 1F9NA 1IUYA 1U6GA 2VQHA 4B3AA 4EV0A 1PYVA 1XDSA 2CQ7A 1LDKB 1MBHA 4II2A 3F72A 4G8XA 3E5XA 2PEXA 2K9SA 1I3QJ 1O7LA 5E1WA 4C2MJ 1MZBA 4OU0A 1T08B 2DK8A 1OCZH 4CYDA 4CHUA 3CCUI 4E7KA 3IWFA 4EQQA 4G12A 4HOBA 4BU2A 4C3IJ 3L2WA 4S0HB 3RPUD 1ZN2A 1W4MA 2FOWA 3HOXJ 5DDGA 1BIAA 1G8XA 2VXDA 3FXLA 4OAYA 5HODA 4EMSA 1YW8A 2XB5A 4P9UA 5D8KB 1G3WA 4AYBN 1KQ8A 2IP2A 4RAFA 3HL2A 1RKTA 5KAFC 2QM3A 5HVQC 3S2DJ 1F36A 1XDUA 2AXLA 1MSEC 2HYFA 3A01A 3BDDA 3S15J 1TWFJ 5J1RA 4Y13A 5DS9A 1OCOH 4BYYA 1W7PA 1ZG5A 1X1AA 1QHHD 2VN2A 4XKVA 4MEYF 3CUOA 4CYCA 2ZXHA 3COAC 1BW5A 4UVBA 4Z2YA 3OY9A 4IXAA 3HXLA 4L0ZB 1S7OA 5FKNA 2CV2A 3WTXC 4A3FJ 2TCTA 3AG4H 1A36A 3A4CA 1QPIA 2GAUA 3KP7A 1EV7A 5ICEA 1APLC 4KUMA 3JAMZ 3TP0A 5KNLA 2AHQA 4HEA2 4B4CA 2FEZA 5TISC 2D1HA 1P4AA 4EGZA 3U1KA 2FBKA 1XS9A 2VONA 1QNTA 2DMPA 4ETSA 5CVVA 3QPSA 1J09A 1OFCX 4PK4A 1FLIA 3LSRA 3I59A 2XHKA 2Z1DA 1SANA 1I3AA 2LF7A 2ZXJA 4Y4RA 2PQ8A 3AG2H 2ETHA 2R5ZB 5BMZA 3HIFA 1MGTA 4OMYA 3PNYA 4RB0A 1QRYA 3S32A 2ACJA 3HSFA 1LFUP 4A69C 2ZC2A 1Z1DA 4GRIA 5ICFA 3P5JA 2FE3A 2HVSA 4E4HA 1QHGA 3GTLJ 5CLSA 2KL4A 1V5EA 3LA3A 1MBFA 2DT7B 1B1BA 3IWZA 3OR2C 5HLHA 3QOPA 4GXOA 3QPTA 2EIJH 3B6AA 5JHFA 3OYKA 1WPKA 4PJLA 2OCEA 2KZGA 4MGRA 2GZWA 2JSCA 1LVKA 3Q3SA 1DP3A 3N4MA 2QSFX 1PUEE 4Q5SF 3PL8A 1W5TA 5K7ZA 3K70D 1AHDP 5LRSA 2YU9J 3OYMA 1RRJA 5M3MJ 2FQ3A 2R7ZJ 2LH9A 1ZTRA 2AS5F 5FJ8J 3K2AA 1PP8F 2FNAA 2LC2A 5DV5A 3W2WA 4HBLA 3FMQA 1ORKA 1TL8A 3CF2A 2E5ZA 3KYLA 1R9TJ 3T1BA 3GX4X 2F5VA 2NAZA 4HF1A 5EDNA 3Q0VA 4BE1A 2OTLI 3L2CA 4CCKA 3Q5FA 3J81Z 2Y30A 2Z2SB 1OCCH 4MFEA 2K3FA 4BHBA 4D0PA 2DOFA 2GIZA 5FB2A 2EZHA 1FBSA 5FKOA 3K1MA 4F7ZA 4EM0B 2EQRA 2DTZA 2F4MB 2DMTA 5K5QA 2IS2A 3A03A 4FETA 4ESJA 3VPRA 3GZNB 5EG0A 1GXPA 1X2NA 4ENKA 4IRHA 4ZC3A 4BBSJ 1SAXA 2JT1A 4L5EA 1T38A 3BQZA 3GFMA 5AIPA 3WE3A 2W82A 3JCUC 3CCVI 2FUG2 2BEOA 1XCVA 4A93J 1T8IA 1FOYA 1USSA 2DU9A 2NVYJ 3ZCOA 4A0YA 1Z3XA 3UR3C 2VKVA 4C2TA 2L9VA 2BW3A 2KHMA 4KIFA 3A2KA 1K83J 2GXBA 4KT5C 1U9OA 1OR7C 2DMQA 1IN7A 4M3EA 1FTZA 3CO7C 5E1ZB 1ENHA 5J8CA 3GVAA 4U0YA 3ZMZA 5ICCA 3DEWA 1Q1VA 3C2HA 1GT0C 5HDKA 4LOCA 1XGMA 3QYFA 2VC0A 4LLLA 1BI1A 5D4SA 1TWAJ 1TTYA 4JYKA 4KIGA 1IJWC 4G94A 3JREA 4N9HA 4IQJA 4X0GA 2M45A 5L3DA 3WU0A 3AL0C 3I4NJ 1KGSA 1P9QC 1TZLA 5LBQA 3OS1A 2LYCA 6PAXA 3MKLA 4RLFA 3WODF 2VPLA 4I98B 4AIKA 1AKHB 4N4NB 2IPQX 1Z3YA 2KIQA 3TO9A 1XC5A 4JOMA 1VQ8I 2HZDA 5J6XA 4E70A 3DLLF 3QYEA 3TOBA 1FTTA 1XSVA 5CKTA 4HSRA 2LBFB 2F5FA 2DA1A 2P4WA 3FIWA 3L2UA 3I71A 5BOXA 2EIKH 2DLLA 2WC2A 4R1HA 4NC8A 1O3TA 2R7UA 3EYIA 3FISA 1PUFB 4ENNA 5TRDA 2NS0A 3A0HC 4FTHA 4LLGF 5LEJA 3BTIA 5CQGA 1V5GA 1LKXA 1XPXA 3GXOA 4HV6A 1REPC 4A5NA 1T0FC 1AOYA 4HSTA 2L54A 4RLQA 2FBHA 3JSOA 5CVRA 2RDPA 1DGWY 3A1YA 3HOYJ 1I1SA 1IRFA 2LR8A 2HFHA 4ZDPA 2EWNA 1ON1A 2G9WA 1MJBA 1IN4A 2MG4A 2XKOA 3HB9A 2R7RA 2GA1A 4JX5A 4DJAA 3MN2A 3CUQB 3JW4A 5FGMA 3D5LA 3KYCB 2DK5A 4CZZA 3M3YJ 5EEAA 3LMMA 2XVCA 2F5CA 3OL4A 2IVMA 5IOZA 4IHYA 4A6EA 3GFIA 2K85A 4UV9A 5IT9K 3PQKA 5CQEA 4GYGA 2HOEA 1I5ZA 4XLHA 5EYRA 4D7NA 4I0BA 2E2JJ 2FD5A 1S72I 3QWLA 2HDDA 3Q9VA 1IRXA 1H9GA 2Y31A 5F0CA 1KU2A 4G6DA 4R79A 4HDVA 1YI2I 4RAGA 4CCLA 2CFOA 1VQLI 2L9SA 3OYDA 1D0XA 4G7ZF 1TQMA 2QKMB 1QA6A 4M74A 3OYHA 2NS7A 4Y3OA 2DAOA 2JA8J 1P4WA 3V8KA 2EZKA 2HOAA 2YU3A 5FFZA 1KYWA 2L0KA 1DGRM 3HJEA 3LSHA 3ZOBA 5D5UB 2STTA 1D8JA 1BM9A 2W4SA 4OWRB 1TNTA 2JTVA 2XASA 5D6FA 2MW8A 3HUGB 1JT6A 2OV7A 3KLOA 2OQRA 3PSIA 2DA6A 3RSNA 4RGXA 2M0MA 2DI3A 4UUSB 3HGYA 2L7MP 4DZPA 3U21A 2JK3A 3EQLF 1S7EA 3LFKA 4BE0A 1MNDA 2FSWA 4Q4ZF 3HGGA 2IW5A 3GWZA 4XOPA 2MD0A 1D1BA 3W6KB 3ZQFA 4FE7A 3FF5A 2X6YA 2DQLA 2DPUA 3I4MJ 1F1ZA 4Y7NJ 1TNSA 2MH9A 3IRQA 2HI3A 4ZYAA 4BHCA 1YS6A 2VC1A 3CD6I 3FWEA 2X85A 3BR6A 3JRGA 3DU6A 1FSHA 2JA2A 2M87A 4A3JJ 1GXQA 3RTRA 1XGOA 2QF7A 3BR1A 5GPCA 2EH3A 5GPAA 4XOTA 1GV5A 2B63J 4XSXF 3S2WA 1OLTA 3LL7A 1SVMA 2CYYA 2IGKA 4AU7A 3I55I 1HW1A 5LFAA 1VQPI 3IH4A 5GADJ 4XSZF 5F1JA 1NH3A 4HLXA 2XPUA 4RA2A 1YG2A 2W85A 1QZZA 5LGUA 2FQ4A 3DPTA 1FP2A 1Z7UA 1X1DA 5B5EC 1QZYA 5ILUA 2QKLB 2RN7A 2V79A 2Z99A 1F4KA 4J00A 2QGUA 4PJJA 4RAZA 5LGTA 4ZYDA 2R3SA 2YPRA 3ONQA 3BJ6A 4ZDLA 3QRFF 4KMFA 1WWXA 1XG1A 2WBMA 2GBYA 4HAMA 1WJEA 1SFUA 4IRGA 2DFFA 2IAIA 1SC7A 1NK2P 1YS7A 3KEYA 4CDGA 3BP8A 5L3FA 4DYCA 1ZLJA 1T95A 3V7RA 4I0AA 3F22A 2JRTA 4BUPA 5H6RA 2VB6A 1WJ5A 1MSFC 1MBGA 5HNFA 2JVGA 3L00A 4KN4X 4B44A 3KZIC 5A2QK 3HRMA 2JUGA 1WQ2A 1ZG3A 3ASNH 1VNDA 4I6ZA 1HF0A 1K79A 3Q0UA 2RV8A 4H0EA 2R7TA 2IGNA 5FKKA 2M4GA 2VBWA 3A02A 4HX7A 2FBIA 1FP1D 2EA2A 4E7SA 1WJCA 4IO9F 2ZKZA 3TOAA 2KLOA 3IRRA 1BR1A 1YX5A 3G6EI 1V55H 2PJPA 4A3BJ 1IDYA 3C2BA 2XSDC 1P7JA 2P5KA 4ASNA 4GDFA 4E7IA 3DP7A 4LMYA 2EFOA 3EPZA 3CMMA 3BG6A 1WJDA 4F3QA 5JVTA 3UKGA 5F1RA 3L2QA 2K9NA 1JHFA 2CW7A 2LLKA 3QPHA 4HNUA 1BL0A 3GLLA 3G1LA 1U78A 3H92A 3V8LA 2JJ7A 1G3YA 2HU9A 3DKXA 3AKZA 2V1UA 1I50J 5DM7F 2K4BA 3I9V2 2DOEA 3HOUJ 2DPDA 1FT9A 2MLKA 2QWWA 2DA7A 1EH7A 2BVMA 3KX2A 3OYIA 1Z6TA 2Q2EA 3KFWX 1R58A 4RM3A 1FY7A 2M9HA 2GA2A 2F5DA 1WCMJ 4IEJA 4XLFA 1Y8RB 5L3BA 3CMYA 1YFHA 4PJ0C 2CMPA 3KYDB 2E36A 4AC0A 5K1YA 4X6AJ 3SFZA 4IX7A 1BC7C 3TP3A 4RB2C 4YIFA 2XGEA 3BROA 2O8KA 2HTJA 2LP0A 3K0LA 5HLGA 4PUSA 2JUCA 1UJ8A 1V3FA 2ZMEB 4C9YA 4DIQA 1J2XA 2PMHA 2QCOA 5ILSA 2CW8A 2EFQA 3QU6A 5E18F 5B3SH 2QQBA 2O0YA 4CYCB 1GVDA 2V6CA 3CUQA 3SXYA 3DTIA 4RDUA 5GP9A 1K6YA 3TKYA 1FOXA 3VODA 5GAEJ 2ZJRF 2GOXB 4ZTJA 2DJNA 1QPMA 3RKWA 1POGA 3ZQ7A 1IO2A 4FT8A 5GTIC 4UXNA 3J7AY 1WFXA 5J47A 2P6SA 3TO6A 2BHYA 1FIPA 2ZSHB 1Z77A 4B8XA 2RQQA 5DYMA 1LQ1A 3Q0WA 1MBKA 3LQQA 3BG7A 4LJZF 3V7SA 1D1CA 3GUDA 3U2RA 4BQQA 1XGNA 3DQVC 1R36A 4M9SA 1DQUA 3PUBA 3TL4X 2OBPA 1YE9A 3SDBA 1RIOH 3E6MA 2X48A 2DDBA 2HNHA 2GXGA 2M8GX 1K78B 2E7XA 5ICGA 3F8CA 3DEUA 3W3CA 2EZLA 4EJOA 1BA5A 4ON0A 2EJRA 4XKWA 3EDPA 3GW2A 2ZFUA 2M0CA 4XRSG 2DA4A 2ELHA 3ABTA 1ZGWA 3EUHA 1BI0A 2LY1A 1B59A 2Y9YA 3HSRA 1MMNA 1MJAA 1J59A 3MD2A 1U8BA 2KP6A 5DD4A 4S05A 2WTEA 3MWMA 3N97A 1YLFA 3P7NA 1KZHA 3F0CA 1G3SA 3SEZA 4XORA 3LSJA 2H1KA 3ZPLA 3BTLA 1T56A 2KJCA 4RAYA 1TT0A 3HC7A 2PFBA 4M9XA 3RPQA 2LTPA 2VJ5A 4LG3A 3KP4A 4XBFA 2KIFA 5LLQA 1J5YA 1XB4A 3AAFA 1AU7A 3L9FA 4NB5A 3RZDJ 1Z9CA 4HZFA 1IV8A 4HW0A 3KIOA 2W48A 3CCYA 2K3PA 3KP3A 3GO5A 3KE2A 5HS7A 3FXKA 3K4CA 1K61A 4M3FA 2L02A 4LK1F 3NARA 4PCQA 4YG2F 1WJFA 1VFCA 3DTKA 2MGQA 5E8GA 5IP6A 4YIRX 3JRDA 2BY2A 2JPBA 1B4AA 3LFUA 2LK2A 1TC3C 2E1OA 4YIIA 2BY3A 1B9NA 2FF4A 2ID3A 3ZQQA 1JKOC 2VE9A 2RREA 2VOPA 4RS8A 3I56I 2HDWA 4LD5A 3WE2A 2PLYA 4ESBA 2K9MA 3L1PA 2ECCA 2CO5A 2A6HF 3BQYA 3V7CA 2P7CB 3R4KA 2UXNA 2PI0A 3EYYA 1BW6A 2LSOA 5F64A 2ZJPF 2D2WA 1T33A 1U5TA 2DXIA 2NNYA 4A3EJ 2V6EA 3ZMUA 3JRBA 3KEOA 1FBUA 2P8TA 1MNMC 5BNGA 1N75A 3O6BB 3K70C 4CCMA 3FK7A 4NQWA 1EJ9A 5FROA 2R5YA 1JGSA 1X4PA 2R7DA 1HOMA 4KISA 2ID6A 3HBLA 3QP5A 2A07F 4HNVA 2ZNZA 2RVCA 2DW4A 1R71A 5IPAA 4Y33A 1HBXG 5CVIA 2F6CA 2K27A 2FOKA 3WG7H 3ZQCA 2KIMA 2XAGA 4DBQA 1TQIA 3SDGA 2VE8A 3L2RA 2JRMA 3K10A 4V19K 2W00A 2DA3A 2MD5A 2HDCA 1QVTA 2H27A 2V9VA 3MZYA 3F21A 1H8AC 2XAJA 2HPIA 1HXDA 1QQIA 5F0HA 3GZ6A 1YO5C 3T5XA 2FU4A 4MQVA 1FYKA 3HRSA 4J01A 4M72A 5KK1A 4BGDA 2ELJA 5FFXA 1UHMA 3SQNA 2XRLA 4P9FA 2QQ9A 1JJ8C 2C6YA 2VQCA 3BPXA 3E5QA 1EKEA 4OINF 1E3OC 3KZZA 5E3LA 3TDZC 3BR5A 2KKOA 3RKXA 1ITYA 4H4KC 1FOWA 3FMSA 1W0UA 2DMNA 2LY2A 2HKXA 3R0JA 4I2OA 2JMWA 3EETA 1LPQA 1FNNA 5B66C 2DO7A 1MBJA 2FXAA 5E3MA 2NRAC 2K9LA 2H8RA 4A12A 3W2AA 2WB1N 4MTEA 3BJAA 3QQAA 3GTJJ 3S93A 1YRNB 1RR8C 3FHNA 4P96A 4XLEA 3R0AA 4BKXA 1ETXA 2BVLA 4CCNA 2LKPA 4DBRA 4EGYA 5IYBJ 3ZMDA 3G73A 1XCBA 3CC2I 1I39A 5C4JJ 4IKFA 3SZTA 3K4KA 2IGOA 1P6RA 2CQKA 4HQMA 4P1WA 3NQOA 3K7AJ 1HW5A 2O8XA 3C2GA 3PQJA 1FOKA 1AA7A 4MNUA 1ZAOA 2BYVE 2M3AA 5GAHJ 2E2HJ 4NHJA 1ULYA 2M5WA 3FZVA 4XNFA 4BQNA 3J7AO 1V5FA 4QPQA 4AIJA 1X58A 2DFHA 5K5RA 3BWGA 2HQRA 2JVHA 2ZJQF 3OL3A 4A5MA 3ZRGA 2EFNA 2JA6J 1HC8A 3LSGA 3EUAA 4QTRA 4WF2A 2PX9A 2VL8A 1MH3A 3ZP5A 3BCBA 2JZYA 3LA7A 3NAUA 2YR2A 3QPLA 2J5PA 2B7EA 3PFYA 3BG3A 2QA4I 3WHBA 2V1DA 1HSJA 4HF2A 1Z05A 1OISA 1WH5A 2LF8A 3RQIA 4O3MA 4KYWA 5DUIA 1CF7A 2COBA 3GTOJ 5CVJA 5FO5A 5LHGA 3BLYA 4W1UA 2MYSA 3FMRA 4CSWA 3M8JA 1ZR2A 3H5RA 1VTNC 1D0YA 1XGSA 2E7WA 2F4OB 2QUFA 3BC8A 3CDLA 5HOOA 3FK6A 3EUHC 3DXJF 2HQ5A 3HOTA 1ETOA 2ZMEA 3RDIA 3ML6A 1NG7A 4JX6A 4IOAF 3CP2A 5D8LB 2E1NA 1JUPA 4IQ4A 3ZQLA 1RUOA 4GFBA 2DJIA 4D5FA 3I0TA 1W1WE 1LEAA 4AD9A 4AIHA 3A0BC 2O5RA 4MLOA 1VQKI 2K4JA 1H9TA 3GCMA 1O3RA 3AG3H 4U7DA 3VSKA 2RC4A 2H8WA 2R4GA 3LNQA 3H1CA 3WTUC 3L2VA 1W5SA 1T39A 4IHTA 4ZTFA 2LFBA 4RGRA 1U2WA 3I54A 1RC9A 1MKMA 3RIRA 2IS1A 5LD2C 3T8TA 4ZYEA 2MABA 2O03A 1OQYA 1QU3A 1D0ZA 4UUSA 4ITVA 5F04A 1SFEA 4O5VA 2Z9OA 2V4JC 3HOWJ 1BJAA 2DMUA 2LKXA 4WXHA 3OYAA 3FKIJ 1R5HA 4B43A 3BTCA 2Y69H 3KPHA 4K2EA 4HX4A 3DLAA 1LEBA 4FX0A 1Z6RA 3TDUC 4UUVA 2J5OA 1STZA 2FJ1A 2HQAA 4BH9A 3OYFA 3DPUA 3MVPA 2PJRA 2JQ7A 3G1OA 4HLYA 2KIUA 3CC4I 1R6RA 3CJRB 4FQGA 4HG2A 2H1LA 3IKTA 3GYHX 3MCZA 1B8IA 1VQ6I 2LRDA 1UHSA 2DYSH 2IEKA 2COMA 1A6IA 4I02A 3JRHA 3C7JA 1SD7A 2R0QC 2ZO4A 3JAMK 1Z0XA 5F6FA 4ZH4F 4DGWB 1TWGJ 2Y75A 4U87A 3CCMI 1JTXA 2NOJB 1V4RA 4J19A 1UAAA 3K1PA 4RGUA 4BE2A 1LDJA 1RZ4A 1J9IA 2ZXWH 1ON2A 2VI6A 3TO7A 4UV8A 1GDTA 2X1CA 3HPHA 1GLNA 2Z33A 2PG4A 3LSTA 4LITA 1A35A 3WTVC 1ETVA 1RESA 4HQEA 2L01A 2DFIA 1CQTA 1R23A 4KITB 4JK1X 5LGNA 2WADA 1OPCA 4A3LJ 4RB1A 3CCJI 3D5SC 4DNCA 3W6VA 5E1XA 4AIDA 4XICA 3IL2A 1BI3A 4I99C 5C3EJ 3ISPA 5DD8A 5GTHC 4CXFA 4WX9A 4PGGA 3FXJA 1G6NA 3F8NA 3F8MA 1Y6IA 3R60A 3N05A 3DWLE 3VDXA 3LSIA 1XSDA 3PFIA 3REOA 1W36D 2OAZA 1UCRA 2DN0A 2R7QA 4MTDA 2JN6A 2N8GA 5H20A 4G9YA 4PJNA 2FA5A 3I64A 5EG0B 3ZMTA 3IC7A 5ILVA 2JWTA 3OYBA 1OYWA 2YX7A 5D4RA 5B1BH 1IXCA 3OR1C 2IS4A 2VKHA 2XGXA 4M6VA 2D1VA 2FNPA 2DQRA 1OJLA 3VB2A 2R7WA 3LSPA 5IYDJ 4LG0B 2R5ZA 3KLNA 2H09A 4GGGA 4JBAA 3DCFA 4L9TA 3H0DA 5J3LA 1U3EM 1JHHA 1XX5A 3TEDA 1KYZA 1BI2A 1TWHJ 3JRIA 1S7AA 1R5ID 2CQNA 4KDPA 2HPMA 3F3XA 3V42A 2G0EA 4BJ6C 5K7FA 4F91B 3M4OJ 4ESFA 4OMZA 1Y1WJ 1KQ0A 2BBYA 4XIDA 2BV6A 2VODA 2OCCH 2ME6A 5EEHA 2DTRA 2CGPA 1BN5A 1B9MA 2Z16A 3S1QJ 2HYGD 2CS3A 1RR7A 1ETWA 2QVOA 4HPQA 1FYMA 2IJLA 2LREA 1R5GA 2A61A 2L7FP 1B8IB 1MBEA 4HF0A 4HDUA 2XAUA 1OYIA 4UUTA 3G1MA 1QVUA 2XF7A 1R00A 2ZMEC 2X6XA 3CJTB 3K9TA 3QP6A 4ZYGA 5EGOA 4EJTA 5DM6F 2V9KA 4CUGA 1WZ2A 5E79C 4OIRF 2I10A 3OSGA 2HVRA 1IDZA 4L5JA 2OC6A 5L3EA 2VKEA 2A3SA 1YHQI 2R7VA 1SD4A 5FRNA 2I8DA 2XGCA 4HA8A 4R8HA 3H9QA 2H6BA 1X3WB 2KT0A 3HPGA 4HRIA 3S3NA 4OIPF 3DU5A 4KFCA 1B72A 2BZTA 4BHPA 1OCTC 2VJJA 4TV7A 3FXMA 1QZEA 3HTSB 2AO9A 1JE8A 1BBYA 1T98A 1KU3A 1SVLA 1ETYA 1XSXA 1KONA 1P2FA 2PMZN 2P0WA 2IA2A 3ZQGA 3VYSB 1O4XA 1SMTA 2DCEA 2L4AA 4BEHA 5BPIA 2WB1A 4F55A 2FMLA 3SEQA 5IYCJ 1DU6A 2IA0A 1D8KA 1LVAA 4KJZA 1VQOI 2CG4A 2VUMJ 2A5YB 1WI9A 3S1MJ 2CWEA 1TQPA 3RJPA 2X6OA 1HW2A 3V8JA 5KCMA 4UVCA 2VASA 1HKTA 3PNTA 5LHHA 4ZDOA 4YFXF 3M1CA 5DUKA 1IV6A 1TT5B 2O6GE 2BGCA 3GZ5A 4WXDA 1IRZA 2E1CA 4A6DA 2A6TA 2XF5A 4KICA 3ECOA 5B1AH 2EV6A 4UB6C 4BDZA 1HCRA 3LOCA 1WGXA 3E1SA 3VWBA 4G7OF 1K78A 5IP9J 4Z6YA 1YX3A 4OAZA 3FM5A 3HTUA 3B02A 5EEGA 5CPRB 3VYTB 1R4MB 1B72B 3NEUA 3PM1A 3DBHB 2E1MB 3M8FA 4G6TB 3ROUA 1G4DA 2HR3A 4U0VA 3I53A 3JRAA 4AWXB 4BAYA 3H36A 1R1VA 5E8IA 2R7OA 2OZ6A 4I76A 3OYLA 3HG9A 2KMUA 1SFOJ 1IN8A 2DA5A 2E60A 4M9ZA 1EH6A 1E2XA 2XAHA 1L3LA 4E7JA 2HZTA 3FKJA 4L5IA 1IG7A 3JRFA 2M8EA 1S8NA 1LFPA 5EGOB 4F52A 3S16J 2OQGA 1FZPB 1Z7LA 1MDMA 1D5YA 2HS5A 5CVUA 1W36C 1IGNA 4WWCA 2W7NA 2Y0SA 4I01A 4X1EA 3SZPA 3K1NA 3BZ6A 3ERMA 3BR3A 2QQ8A 2IRFG 3H3UA 2Q0OA 2A68F 2CUEA 5M3FJ 2VBYA 4Q48A 1KQ9A 2ELKA 3GLXA 1S29A 2M30A 3LAJA 5F0FA 1JT0A 1E3HA 1WJAA 2HVQA 3FBIB 3W2VA 2R93J 2O7OA 1MMSA 1A04A 4C2UA 2GLOA 4A3GJ 4UNOA 4G6QA 2V1NA 2VKDA 2MC3A 1I1GA 3BR0A 3K4JA 3LSMA 4CICA 2XB0X 2KJBA 3M07A 1OKRA 1U5TC 1W0TA 2XRNA 3M1EA 4B09A 3S17J 3GFJA 2F48A 4IVNA 4OOIA 3ZGKA 4D9JA 1JKRC 1D1AA 2KRHA 2VJIA 3OIPA 3T0YA 5F27A 1FSEA 4XLAA 2CW0F 3K4MA 3VYUB 2UV1A 4IHWA 3WGIA 1SVOA 2P6TA 2IGMA 1S9HA 4L9NA 3M9AA 2JA7J 3MFKA 3B73A 2Y9ZA 3E6DA 4M3BA 3W6JB 4BQAA 3O2PE 1F43A 1J0RA 3HUGA 3SJMA 1A31A 2K40A 4CH7A 4CA0A 4BL0B 1MDMB 1HSTA 4A0XA 1MW7A 4ZZLA 2ZNYA 3QAHA 4FCYA 3RYPA 5ED4A 2XV4S 4YFKF 2RNGA 5K5OA 1I27A 3J7YJ 2EIMH 4LB5A 1BR4A 2HTSA 3L7WA 1OR7A 1B6AA 2LNBA 4BDYA 3S3MA 3ZR8X 4YEJA 3OS2A 1S5LC 4A3IJ 1RKWA 2ESHA 3OYCA 1UFMA 1FBQA 4NC6A 3HKZN 1WRJA 3Q9SA 2VT2A 1ERDA 3VOEA 4Y17A 2KFDA 4LLNA 3GEZA 1K4TA 1YTYA 4KA4A 2K5CA 2TDXA 3OSFA 2KPMA 5J40A 2A69F 3ECHA 4CO8A 3U9GA 2AQFA 1D5VA 2LDUA 3LA2A 1VQMI 1H88C 3BJOA 2CJJA 2IBDA 1BIBA 5DCMB 4BY7J 2HGCA 1UZCA 3FBNB 3GBGA 3RI4A 2X51A 3HDDA 4XKBA 2X4HA 2L2OA 3ZMSA 1IW7F 2HQNA 3FXRA 3IHUA 4PSXA 1AKHA 2PBIA 2HOTA 3F8BA 1LE8B 2V9PA 2CUZA 2QBYA 1H0MA 1P7IA 1HKSA 3GTPJ 2W84A 4QSHA 1ZELA 3ABKH 4GO1A 2HXIA 2M4KA 3J80K 4A0ZA 3CCLI 1ZRDA 4G7HF 4LFUA 3F23A 4IHXA 1WI3A 1VQ9I 4Q47A 1QGPA 5EZHA 3E0JB 4IPAA 4U7BA 2LOOA 1PVEA 2E1MC 2KDOA 4N9IA 4ENJA 4QPOA 1FEXA 1VQ4I 2CSOA 1YW7A 1UG2A 2XKPA 1CGPA 4HV5A 4FASD 1R1UA 3CESA 2EZIA 3NRVA 1CF7B 2UWMA 4D1QA 4U88A 3AG1H 1ZHFA 5M5XJ 3O3KA 3I58A 1ZRFA 4XONA 1Y39A 3RCOA 2OF7A 1I6XA 2XSJC 2KRCA 1FC3A 2L7KA 3H35A 4ANJA 4QLCU 3IH2A 3TQNA 5GAGJ 2QYOA 5J4YA 1MMGA 2YSRA 4E7ZA 2W57A 3MKWB 3OV8A 4NUBA 3JRCA 3MKYB 2CU7A 4MHGA 2A6EF 2OPTA 2Y48A 4IF4A 2PN6A 4NDLA 3ZN1A 2DYRH 3GTKJ 3KCCA 3CCEI 5LHIA 1ZREA 4BNCA 3GTGJ 3HOZJ 2F4IA 2ECBA 2LMDA 2GIVA 1NG6A 1RI7A 5FLXZ 1Y0UA 3P9IA 3H9GA 4RB3C 2M7BA 1VQ5I 1LE8A 1PUFA 4FE4A 1MIJA 5FRMA 3R61A 1LB2A 1EA3A 5AIQA 2JPCA 2JSPA 2Q8KA 5D5XB 1ZRCA 3E5UA 4ZZDA 2WY8Q 1A6QA 1MJ9A 2F5EA 4YELA 2DT5A 3HRUA 3DPLC 5BS6A 4AUXA 2O61A 2A05A 4YRVA 1LFBA 2HXOA 4QWQA 4ENMA 1XMXA 3CTAA 4E7HA 3CJNA 3I4PA 2WY7Q 5JVGF 3LWFA 2E71A 4JX4A 2KRFA 3HHHA 4MQ9F 4EJUA 1UMQA 2HOSA 2Q2EB 3DTEA 1GVJA 5CYVA 5E3OA 2IT0A 3CCSI 3QOEA 2ICWG 2EV5A 3CZ6A 2WWYA 4PFOA 4A3DJ 2NXNB 3I3LA 4NQWB 4U0WA 3HOSA 2XC7A 1GUUA 2H6CA 2RGVA 2PMZA 3IH3A 3CLOA 5CJ9A 2GQQA 4WXCA 2OZUA 3E3VA 4XLCA 2Y0MA 1ETKA 2NYXA 1FIAA 2EK5A 1KU9A 2H94A 2M2EA 2CFXA 3HM5A 1XTAA 4UY8I 1JUSA 2LVSA 4QIWN 3IUOA 1X1PA 2V26A 3UNGC 3OWTA 3P9CA 1WSUA 3IKVA 2YX4A 5JI6A 2ME0A 2RKHA 3ABLH 3K4LA 3S3OA 2WA0A 1IUFA 2PJRB 3OYGA 5IT3A 1DU0A 1X19A 4AVPA 2YUSA 2HEOA 4L18B 3DFGA 1R4NB 2DT6A 3S2HJ 4LK0F 4IHSA 1U8RA 1DPRA 4S04A 5C44J 5D5WB 2QLZA 3JSPA 2KZVA 3ABUA 4EM1A 2EBIA 3DKWA 1K6OA 1JTYA 5DTDA 1YIOA 2VQLA 4BACA 1U9NA 3C3WA 2MBFA 1YJWI 4A2UA 3VEPA 2DFEA 3B6CA 1ZQ3P 1MMAA 3FXOA 3CCRI 4BBRJ 3ZQHA 3QYBA 1OCPA 4IL6C 5E3NA 5KAIC 3WU2C 3CMAI 2BE5F 1UG0A 4BJ5C 5HLIA 4D5CA 2NVTJ 4DQ2A 5J8FA 4W97A 4XLPF 3H5NA 1X3UA 3FM3A 5LEKA 1TWCJ 3HZJA 3OIQA 4DYRA 1GHCA 5J4VA 2VT3A 2DBBA 1JJ6C 2F2EA 4B1RA 3G71I 3DBRB 1NK3P 3TGNA 4XQFA 5FD6A 3VYRB 2XAFA 2ZJ2A 1K7AA 1MH4A 2ZCWA 2XROA 4OIQF 3BPVA 3LQRA 2G7UA 3MMYB 1PJRA 4EEFG 4PFPA 1FPQA 2BY0A 3U1DA 4DW6A 2P5LC 1JKQC 3F9KA 1NTCA 3ZN0A 4MEXF 3M8EA 1L0OC 3TW7A 1Z91A 4V2GA 1SAUA 1G59A 4BXUA 4B3XA 1HDDC 2Y0SN 3WHCA 3MZ8A 4C3JJ 1QO0D 4IOCF 5JHUA 4I09A 3VFZA 1UELB 5E20A 4BQOA 1FX7A 4XMYA 3GFLA 3WTZA 5J1YA 4BJTA 3OYEA 2BXYA 4ZYHA 2VBZA 2ZB9A 2W1OA 3QU3A 4F92B 3G4SI 1IN5A 1V54H 2AXTC 4EJVA 2KISA 2QBYB 3L09A 1K4SA 3CMEI 4DZJA 5KHDA 5HS8A 1XN7A 3IV5A 2R7FA 1SFXA 2B9SA 2ZFWA 1RNLA 4LIUA 3E6BA 3NWSA 3HOVJ 4CCOA 2O3FA 2WAFA 3I5UA 3PSFA 4LB6B 3IAS2 4BXFA 2LG4A 2Q1ZB 3DBLB 4OIOF 2XPVA 1G3TA 2D45A 1DDNA 2B0LA 3HYIA 3P9KA 2TRTA 1VQ7I 2EILH 3D5RC 3VSLA 1ETQA 5A2QZ 1N25A 4NC7A 3HRTA 2BOLA 2VXZA 2EA4A 2X9DA 1SEUA 1TP4A 3DKYA 1X3ZB 3CCQI 1R22A 1WJBA 3PUFA 3S1NJ 3I59B 3KP5A 2RNJA 3E7LA 1YRNA 5HLTA 1VF9A 2W24A 3RPUA 3S8PA 2VLAA 4KNYA 2L4MA 3GMEA 4PJMA 1X4OA 2HYJA 3WG9A 4RMNA 1HA8A 2G7HA 5E17F 4PZJA 1Q1HA 3HSEA 2QENA 3CO6C 1QBJA 3DEEA 2R5YB 1YIJI 4GCVA 2CRGA 3CQZJ 5IT9Z 4P55A 3LSKA 1YJNI 3ZXSA 1BR2A 3CDIA 1T0FA 3LAPA 4CCJA 2X6WA 4ABZA 2MH2A 1HKQA 3FHZA 5HDGA 3WU1B 3WTWC 1ZKGA 1YW9A 5ERIA 1NHAA 3DV8A 3OOUA 5FKLA 5JLXA 5DEQA 3OOPA 1BC8C 3K4NA 2ZXIA 4M73A 4AVZA 4XRMA 2EFWA 2VJ4A 1IZ1A 2OJED 3ABMH 4A3MJ 1E0EA 1C0WA 4M71A 2KDZA 2HKOA 5L3GA 1KA8A 1X1CA 3BZCA 2K02A 3C18A 2R7SA 2IS6A 1YQAA 2V1XA 3H5AA 4AM3A 1N78A 2EV0A 3WTSC 1LUJB 2ZSIB 2K9QA 4L9VA 4NBQA 1YJ9I 1SD5A 1N77A 3CC7I 5F08A 4Y52J 3J81K 1T6SA 2DOAA 4JP0A 5JFRA 2Y2ZA 5JR3A 1UB9A 3GTMJ 3O8GA 4IZZA 1VI0A 4WK8F 2UUZA 1AWCA 3OMYA 4V2FA 1IXSB 2M34A 1JKPC 1BOAA 5TJJA 3PO2J 2QSGX 4RBOA 3F6OA 4KT6A 2XGDA 1WHUA 1I6HJ 4A3CJ 3R6SA 3OS0A 5IY5H 5J1UA 3K69A 4D7MA 3BOQA 2IXSA 4P5OA 2W25A 5EF6A 3J80Z 1HQCA 4KN7X 1Y8QB 2LY9A 2NNNA 2MSYA 4HYEA 3A01B 1ZG1A 1F5TA 3GTQJ 1JUMA 3TBIA 2MFZA 1YOVB 1SMYF 2RQPA 3MAJA 1PDNC 3RQ4A 4GYIA 1PP7U 3T8RA 3GF2A 3CLQA 3KEQA 1LDDA 1ZGJA 3MQ0A 4EJWA 1OMIA 2P81A 1R49A 4JQFA 2PMUA 5H2FC 2BXZA 3K4BA 1ODDA 5BPDA 3S14J 4II3A 3PO3J 3HKZA 5D6EA 1IRGA 1D3YA 1IXRC 4LG0A 3AFHA 1KU7A 4N4OB 2DODA 3AL0B 5FLXK 4DOZA 2YS9A 1O3QA 2ISZA 2M7AA 2E2IJ 3D0SA 1EH8A 3JR9A 3SYTA 2GWRA 3WGHA 3ELKA 4MO7A 2ADUA 2EB7A 2HWVA 1RPWA 1JGGA 4N0BA 1H89C 3C1DA 3ULQB 1ZK8A 1S6LA 3TW6A 4CZCA 4UHTA 1IC8A 3G3ZA 3WTYC 3ERED 2P5VA 2XAQA 4RGSA 1Z21A 2LKSA 4C30A 1TW2A 2FRHA 3MEXA 3RYRA 1DPUA 3E6CC 2FMYA 2BY1A 4A3KJ 2D5VA 4CGZA 5M5YJ 3BG5A 4MFDA 2EINH 1BJZA 3SHFA 4BS9A 1XMKA 2OU2A 1HDPA 2M1BA 1R1TA 4O6JA 2Z3YA 1ZR4A 3ASOH 4M3GA 4XRSA 2CUJA 2ESNA 3FXUA 3BTJA 2XUBA 1WVRA 3PIPF 2NVQJ 3SZGA 1FYLA 3KP2A 5TGTA 3H3ZA 1U5TB 1WH7A 2OUMA 4EATA
chains in the Genus database with same CATH topology
2HDDA 1AKHA 2Y31A 5F0CA 5EZGA 2E2HJ 2HOTA 1G2HA 1LE8B 1X58A 1P7IA 3BT9A 3GTPJ 4QSHA 2WAQN 2NS7A 2JA8J 4XK4A 2EZKA 2HXIA 2HOAA 2JA6J 3LSGA 4QTRA 2L0KA 4IHXA 1WI3A 3ZOBA 1MH3A 3NAUA 3O8HA 2O9LA 3HEFA 5EZHA 3QPLA 3D1NI 3BG3A 5FLVA 1GV2A 3WHBA 1WH5A 1FEXA 2WV1A 2MW8A 3RQIA 1UG2A 1JT6A 2EZIA 2DA6A 2COBA 3GTOJ 3H3VK 4W1UA 5M5XJ 1ZR2A 4UUSB 3HGYA 2L7MP 4DZPA 2OF7A 2JK3A 3CDLA 3FK6A 2HQ5A 1EF4A 1ETOA 4JX6A 1S7EA 3IH2A 3HGGA 1JUPA 3JRCA 3ZQFA 3ZQLA 2CU7A 4FE7A 4GFBA 2OPTA 3OIOA 3H0GJ 4D5FA 1RETA 2R92J 4NDLA 4MLOA 3RKQA 1FJLA 2GM4A 3GTKJ 3I4MJ 4Y7NJ 4FISA 2HI3A 3LNQA 4IHVA 3GTGJ 3HOZJ 3BR6A 3JRGA 2ECBA 4BY1J 2LFBA 5JLWA 5FKMA 4A3JJ 1LE8A 2NOGA 1PUFA 2DA2A 4FE4A 2QF7A 3BR1A 5GPCA 1X2MA 2EH3A 5GPAA 1GV5A 4UUSA 4DYQA 2B63J 2LD5A 5F04A 2L7ZA 3BR2A 3HOWJ 4C3HJ 2DMUA 2LKXA 3IH4A 1HLVA 4AUXA 4M3DA 3FKIJ 2CQQA 1A5JA 1Y1VJ 5F1JA 4MIMA 2XPUA 1LFBA 2HXOA 2XPWA 3BTCA 2NS8A 3ZQIA 2FQ4A 2CUFA 2FJ1A 3MVPA 4JX4A 1UMQA 3G1OA 2HOSA 2E19A 1XG1A 2GBYA 5E3OA 1B8IA 2IAIA 4A3DJ 1UHSA 2IEKA 1NK2P 1A6IA 2E2JJ 3JRHA 2VPRA 5IP7J 2R0QC 1Z0XA 1GUUA 4DYCA 5C4XJ 5K7HA 1TWGJ 3IH3A 1JTXA 4J19A 1MSFC 4BXXJ 1MBGA 1ETKA 1FIAA 2M2EA 2VI6A 1GDTA 3HM5A 3SFIA 3RZOJ 2CQXA 1JUSA 2LVSA 4QIWN 1VNDA 4I6ZA 1HF0A 3Q0UA 1ETVA 1RESA 2FX0A 5FKKA 2ME0A 2L9RA 1CQTA 5M5WJ 3A02A 2RAEA 1IUFA 2JA5J 4A3LJ 3W6VA 1DU0A 5IOYA 2NVXJ 3BG9A 4XICA 2YUSA 3S1RJ 5FLMJ 5C3EJ 4A3BJ 3S2HJ 1IDYA 3C2BA 9ANTA 2XSDC 1P7JA 5C44J 2EBIA 1JTYA 5DTDA 4B3AA 3UKGA 2DN0A 2K9NA 1U9NA 1MBHA 2JN6A 2N8GA 2LLKA 5EG0B 1U78A 3G1LA 1BL0A 2K9SA 2JJ7A 2JWTA 1I3QJ 4C2MJ 1I50J 3B6CA 1ZQ3P 4BBRJ 3HOUJ 4M6VA 3ZQHA 1OJLA 2DA7A 5E3NA 1OCPA 3LSPA 4G12A 4C3IJ 5IYDJ 4D5CA 2NVTJ 2R5ZA 4S0HB 4W97A 3DCFA 3HOXJ 5J3LA 5HODA 3TEDA 1TWCJ 2XB5A 4DYRA 2M9HA 1TWHJ 3JRIA 4AYBN 1JJ6C 4B1RA 1WCMJ 4IEJA 1RKTA 3CMYA 2G0EA 5K7FA 3S2DJ 1NK3P 1F36A 4AC0A 1MSEC 3A01A 4X6AJ 3M4OJ 1Y1WJ 3S15J 1TWFJ 4XIDA 3TP3A 1MH4A 2ME6A 5J1RA 5DS9A 2XGEA 2O8KA 2LP0A 3S1QJ 4EEFG 4DW6A 4CYCA 1JKQC 1BW5A 1NTCA 1RR7A 1ETWA 3TW7A 2QCOA 4V2GA 5FKNA 1HDDC 2Y0SN 3WHCA 4A3FJ 4C3JJ 4CYCB 1GVDA 2L7FP 1B8IB 2TCTA 1MBEA 4RDUA 1QPIA 5GP9A 4UUTA 3G1MA 1QVUA 1APLC 5J1YA 2DJNA 3TP0A 2AHQA 1POGA 4B4CA 5EGOA 2ZB9A 1XS9A 2I10A 2DMPA 3OSGA 1IDZA 3QPSA 2VKEA 1OFCX 1FIPA 1Z77A 4DZJA 3LSRA 2XGCA 3IV5A 1SANA 3Q0WA 1MBKA 2KT0A 2R5ZB 3HOVJ 1QRYA 1LFUP 4A69C 1B72A 1OCTC 2XPVA 2X48A 2AO9A 3GTLJ 2M8GX 2TRTA 1MBFA 1ETYA 2EZLA 1BA5A 2PMZN 1ETQA 3B6AA 3ZQGA 1WPKA 1O4XA 2M0CA 4XRSG 2X9DA 2DA4A 1ZGWA 3Q3SA 2Y9YA 3S1NJ 5IYCJ 1DU6A 5K7ZA 1U8BA 1AHDP 2YU9J 2VUMJ 3E7LA 5M3MJ 1YRNA 2R7ZJ 1VF9A 3S1MJ 1ZTRA 2X6OA 3F0CA 5FJ8J 3K2AA 2HYJA 3LSJA 2H1KA 3BTLA 1IV6A 1ORKA 1T56A 1IRZA 2R5YB 1R9TJ 2LTPA 2CRGA 5EDNA 3CQZJ 3Q0VA 1HCRA 3LOCA 1WGXA 2Y30A 4MFEA 1AU7A 3RZDJ 2EZHA 5IP9J 5FKOA 4ABZA 2EQRA 2DTZA 2W48A 2DMTA 3CCYA 3A03A 1K61A 3VPRA 4M3FA 1ZKGA 5EG0A 1B72B 3PM1A 3NARA 3OOUA 5FKLA 1X2NA 5JLXA 4BBSJ 3JRAA 1VFCA 4XRMA 2MGQA 4L5EA 5IP6A 3BQZA 4I76A 3JRDA 4A3MJ 2LK2A 2KDZA 2E1OA 1TC3C 1SFOJ 1JKOC 2ID3A 2DA5A 1IG7A 4A93J 3JRFA 5EGOB 3S16J 3L1PA 2ECCA 2K9QA 1D5YA 2NVYJ 3BQYA 1IGNA 5F08A 4Y52J 2VKVA 1BW6A 4JP0A 2Y2ZA 4X1EA 1T33A 3GTMJ 3O8GA 3BR3A 1VI0A 1K83J 1U9OA 4A3EJ 2CUEA 4V2FA 5M3FJ 2DMQA 3JRBA 2M34A 4M3EA 1JKPC 5BNGA 1MNMC 1FTZA 3PO2J 1ENHA 2ELKA 3FK7A 4RBOA 2XGDA 5F0FA 1I6HJ 4A3CJ 1JT0A 3DEWA 1Q1VA 1GT0C 5J1UA 4D7MA 2R5YA 4LOCA 2R93J 2O7OA 1HOMA 5EF6A 2ID6A 3HBLA 1TWAJ 2LY9A 4JYKA 4HNVA 1IJWC 2MSYA 2GLOA 3A01B 3GTQJ 4A3GJ 3JREA 5IPAA 1JUMA 3I4NJ 3BR0A 2XB0X 2P81A 3ZQCA 1W0TA 3SDGA 3MKLA 3S14J 3S17J 3PO3J 1JKRC 1AKHB 2DA3A 1QVTA 5F27A 1XC5A 4IHWA 1H8AC 2YS9A 1FTTA 5F0HA 2E2IJ 2JA7J 2Y9ZA 4M3BA 2DA1A 3JR9A 1F43A 4MO7A 2XRLA 2K40A 3SJMA 3FIWA 1RPWA 1JGGA 1JJ8C 1H89C 4FCYA 1E3OC 5E3LA 1ZK8A 3TW6A 3BR5A 3FISA 1PUFB 1ITYA 1IC8A 4FTHA 1W0UA 3BTIA 2DMNA 2JMWA 4A3IJ 1MBJA 5E3MA 2H8RA 1RKWA 4A3KJ 2WB1N 2D5VA 3QQAA 3GTJJ 3HKZN 5M5YJ 3BG5A 4MFDA 1YRNB 1BJZA 3HOYJ 1HDPA 4BKXA 1ETXA 2LR8A 2MG4A 5IYBJ 3OSFA 3HB9A 1ZR4A 4JX5A 3MN2A 4M3GA 4XRSA 5C4JJ 3M3YJ 5EEAA 3BTJA 2NVQJ 1H88C 4IHYA 2CJJA 2IBDA 5IOZA 3K7AJ 4BY7J 3GBGA 5EYRA 4D7NA 3HDDA 1WH7A 2FD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2HDD A;  1AKH A;  2Y31 A;  5F0C A;  5EZG A;  2E2H J;  2HOT A;  1G2H A;  1LE8 B;  1X58 A;  1P7I A;  3BT9 A;  3GTP J;  4QSH A;  2WAQ N;  2NS7 A;  2JA8 J;  4XK4 A;  2EZK A;  2HXI A;  2HOA A;  2JA6 J;  3LSG A;  4QTR A;  2L0K A;  4IHX A;  1WI3 A;  3ZOB A;  1MH3 A;  3NAU A;  3O8H A;  2O9L A;  3HEF A;  5EZH A;  3QPL A;  3D1N I;  3BG3 A;  5FLV A;  1GV2 A;  3WHB A;  1WH5 A;  1FEX A;  2WV1 A;  2MW8 A;  3RQI A;  1UG2 A;  1JT6 A;  2EZI A;  2DA6 A;  2COB A;  3GTO J;  3H3V K;  4W1U A;  5M5X J;  1ZR2 A;  4UUS B;  3HGY A;  2L7M P;  4DZP A;  2OF7 A;  2JK3 A;  3CDL A;  3FK6 A;  2HQ5 A;  1EF4 A;  1ETO A;  4JX6 A;  1S7E A;  3IH2 A;  3HGG A;  1JUP A;  3JRC A;  3ZQF A;  3ZQL A;  2CU7 A;  4FE7 A;  4GFB A;  2OPT A;  3OIO A;  3H0G J;  4D5F A;  1RET A;  2R92 J;  4NDL A;  4MLO A;  3RKQ A;  1FJL A;  2GM4 A;  3GTK J;  3I4M J;  4Y7N J;  4FIS A;  2HI3 A;  3LNQ A;  4IHV A;  3GTG J;  3HOZ J;  3BR6 A;  3JRG A;  2ECB A;  4BY1 J;  2LFB A;  5JLW A;  5FKM A;  4A3J J;  1LE8 A;  2NOG A;  1PUF A;  2DA2 A;  4FE4 A;  2QF7 A;  3BR1 A;  5GPC A;  1X2M A;  2EH3 A;  5GPA A;  1GV5 A;  4UUS A;  4DYQ A;  2B63 J;  2LD5 A;  5F04 A;  2L7Z A;  3BR2 A;  3HOW J;  4C3H J;  2DMU A;  2LKX A;  3IH4 A;  1HLV A;  4AUX A;  4M3D A;  3FKI J;  2CQQ A;  1A5J A;  1Y1V J;  5F1J A;  4MIM A;  2XPU A;  1LFB A;  2HXO A;  2XPW A;  3BTC A;  2NS8 A;  3ZQI A;  2FQ4 A;  2CUF A;  2FJ1 A;  3MVP A;  4JX4 A;  1UMQ A;  3G1O A;  2HOS A;  2E19 A;  1XG1 A;  2GBY A;  5E3O A;  1B8I A;  2IAI A;  4A3D J;  1UHS A;  2IEK A;  1NK2 P;  1A6I A;  2E2J J;  3JRH A;  2VPR A;  5IP7 J;  2R0Q C;  1Z0X A;  1GUU A;  4DYC A;  5C4X J;  5K7H A;  1TWG J;  3IH3 A;  1JTX A;  4J19 A;  1MSF C;  4BXX J;  1MBG A;  1ETK A;  1FIA A;  2M2E A;  2VI6 A;  1GDT A;  3HM5 A;  3SFI A;  3RZO J;  2CQX A;  1JUS A;  2LVS A;  4QIW N;  1VND A;  4I6Z A;  1HF0 A;  3Q0U A;  1ETV A;  1RES A;  2FX0 A;  5FKK A;  2ME0 A;  2L9R A;  1CQT A;  5M5W J;  3A02 A;  2RAE A;  1IUF A;  2JA5 J;  4A3L J;  3W6V A;  1DU0 A;  5IOY A;  2NVX J;  3BG9 A;  4XIC A;  2YUS A;  3S1R J;  5FLM J;  5C3E J;  4A3B J;  3S2H J;  1IDY A;  3C2B A;  9ANT A;  2XSD C;  1P7J A;  5C44 J;  2EBI A;  1JTY A;  5DTD A;  4B3A A;  3UKG A;  2DN0 A;  2K9N A;  1U9N A;  1MBH A;  2JN6 A;  2N8G A;  2LLK A;  5EG0 B;  1U78 A;  3G1L A;  1BL0 A;  2K9S A;  2JJ7 A;  2JWT A;  1I3Q J;  4C2M J;  1I50 J;  3B6C A;  1ZQ3 P;  4BBR J;  3HOU J;  4M6V A;  3ZQH A;  1OJL A;  2DA7 A;  5E3N A;  1OCP A;  3LSP A;  4G12 A;  4C3I J;  5IYD J;  4D5C A;  2NVT J;  2R5Z A;  4S0H B;  4W97 A;  3DCF A;  3HOX J;  5J3L A;  5HOD A;  3TED A;  1TWC J;  2XB5 A;  4DYR A;  2M9H A;  1TWH J;  3JRI A;  4AYB N;  1JJ6 C;  4B1R A;  1WCM J;  4IEJ A;  1RKT A;  3CMY A;  2G0E A;  5K7F A;  3S2D J;  1NK3 P;  1F36 A;  4AC0 A;  1MSE C;  3A01 A;  4X6A J;  3M4O J;  1Y1W J;  3S15 J;  1TWF J;  4XID A;  3TP3 A;  1MH4 A;  2ME6 A;  5J1R A;  5DS9 A;  2XGE A;  2O8K A;  2LP0 A;  3S1Q J;  4EEF G;  4DW6 A;  4CYC A;  1JKQ C;  1BW5 A;  1NTC A;  1RR7 A;  1ETW A;  3TW7 A;  2QCO A;  4V2G A;  5FKN A;  1HDD C;  2Y0S N;  3WHC A;  4A3F J;  4C3J J;  4CYC B;  1GVD A;  2L7F P;  1B8I B;  2TCT A;  1MBE A;  4RDU A;  1QPI A;  5GP9 A;  4UUT A;  3G1M A;  1QVU A;  1APL C;  5J1Y A;  2DJN A;  3TP0 A;  2AHQ A;  1POG A;  4B4C A;  5EGO A;  2ZB9 A;  1XS9 A;  2I10 A;  2DMP A;  3OSG A;  1IDZ A;  3QPS A;  2VKE A;  1OFC X;  1FIP A;  1Z77 A;  4DZJ A;  3LSR A;  2XGC A;  3IV5 A;  1SAN A;  3Q0W A;  1MBK A;  2KT0 A;  2R5Z B;  3HOV J;  1QRY A;  1LFU P;  4A69 C;  1B72 A;  1OCT C;  2XPV A;  2X48 A;  2AO9 A;  3GTL J;  2M8G X;  2TRT A;  1MBF A;  1ETY A;  2EZL A;  1BA5 A;  2PMZ N;  1ETQ A;  3B6A A;  3ZQG A;  1WPK A;  1O4X A;  2M0C A;  4XRS G;  2X9D A;  2DA4 A;  1ZGW A;  3Q3S A;  2Y9Y A;  3S1N J;  5IYC J;  1DU6 A;  5K7Z A;  1U8B A;  1AHD P;  2YU9 J;  2VUM J;  3E7L A;  5M3M J;  1YRN A;  2R7Z J;  1VF9 A;  3S1M J;  1ZTR A;  2X6O A;  3F0C A;  5FJ8 J;  3K2A A;  2HYJ A;  3LSJ A;  2H1K A;  3BTL A;  1IV6 A;  1ORK A;  1T56 A;  1IRZ A;  2R5Y B;  1R9T J;  2LTP A;  2CRG A;  5EDN A;  3CQZ J;  3Q0V A;  1HCR A;  3LOC A;  1WGX A;  2Y30 A;  4MFE A;  1AU7 A;  3RZD J;  2EZH A;  5IP9 J;  5FKO A;  4ABZ A;  2EQR A;  2DTZ A;  2W48 A;  2DMT A;  3CCY A;  3A03 A;  1K61 A;  3VPR A;  4M3F A;  1ZKG A;  5EG0 A;  1B72 B;  3PM1 A;  3NAR A;  3OOU A;  5FKL A;  1X2N A;  5JLX A;  4BBS J;  3JRA A;  1VFC A;  4XRM A;  2MGQ A;  4L5E A;  5IP6 A;  3BQZ A;  4I76 A;  3JRD A;  4A3M J;  2LK2 A;  2KDZ A;  2E1O A;  1TC3 C;  1SFO J;  1JKO C;  2ID3 A;  2DA5 A;  1IG7 A;  4A93 J;  3JRF A;  5EGO B;  3S16 J;  3L1P A;  2ECC A;  2K9Q A;  1D5Y A;  2NVY J;  3BQY A;  1IGN A;  5F08 A;  4Y52 J;  2VKV A;  1BW6 A;  4JP0 A;  2Y2Z A;  4X1E A;  1T33 A;  3GTM J;  3O8G A;  3BR3 A;  1VI0 A;  1K83 J;  1U9O A;  4A3E J;  2CUE A;  4V2F A;  5M3F J;  2DMQ A;  3JRB A;  2M34 A;  4M3E A;  1JKP C;  5BNG A;  1MNM C;  1FTZ A;  3PO2 J;  1ENH A;  2ELK A;  3FK7 A;  4RBO A;  2XGD A;  5F0F A;  1I6H J;  4A3C J;  1JT0 A;  3DEW A;  1Q1V A;  1GT0 C;  5J1U A;  4D7M A;  2R5Y A;  4LOC A;  2R93 J;  2O7O A;  1HOM A;  5EF6 A;  2ID6 A;  3HBL A;  1TWA J;  2LY9 A;  4JYK A;  4HNV A;  1IJW C;  2MSY A;  2GLO A;  3A01 B;  3GTQ J;  4A3G J;  3JRE A;  5IPA A;  1JUM A;  3I4N J;  3BR0 A;  2XB0 X;  2P81 A;  3ZQC A;  1W0T A;  3SDG A;  3MKL A;  3S14 J;  3S17 J;  3PO3 J;  1JKR C;  1AKH B;  2DA3 A;  1QVT A;  5F27 A;  1XC5 A;  4IHW A;  1H8A C;  2YS9 A;  1FTT A;  5F0H A;  2E2I J;  2JA7 J;  2Y9Z A;  4M3B A;  2DA1 A;  3JR9 A;  1F43 A;  4MO7 A;  2XRL A;  2K40 A;  3SJM A;  3FIW A;  1RPW A;  1JGG A;  1JJ8 C;  1H89 C;  4FCY A;  1E3O C;  5E3L A;  1ZK8 A;  3TW6 A;  3BR5 A;  3FIS A;  1PUF B;  1ITY A;  1IC8 A;  4FTH A;  1W0U A;  3BTI A;  2DMN A;  2JMW A;  4A3I J;  1MBJ A;  5E3M A;  2H8R A;  1RKW A;  4A3K J;  2WB1 N;  2D5V A;  3QQA A;  3GTJ J;  3HKZ N;  5M5Y J;  3BG5 A;  4MFD A;  1YRN B;  1BJZ A;  3HOY J;  1HDP A;  4BKX A;  1ETX A;  2LR8 A;  2MG4 A;  5IYB J;  3OSF A;  3HB9 A;  1ZR4 A;  4JX5 A;  3MN2 A;  4M3G A;  4XRS A;  5C4J J;  3M3Y J;  5EEA A;  3BTJ A;  2NVQ J;  1H88 C;  4IHY A;  2CJJ A;  2IBD A;  5IOZ A;  3K7A J;  4BY7 J;  3GBG A;  5EYR A;  4D7N A;  3HDD A;  1WH7 A;  2FD5 A; 
#chains in the Genus database with same CATH topology
 1P92 A;  4KIB A;  1YIT I;  5EZG A;  1W7P B;  1G2H A;  4EVI A;  3BT9 A;  2MA3 A;  2MC4 A;  4LGW A;  5LRR A;  4IRI A;  2P7V B;  2WAQ N;  3IAM 2;  2E34 A;  1T2K A;  4XK4 A;  1JXS A;  4PSW A;  1XD7 A;  3EUK L;  3ZMV A;  3CF5 F;  1Y56 A;  1J7K A;  1BOB A;  3F8F A;  2UZK A;  2K7L A;  3FX3 A;  1VQN I;  1U0J A;  2ZBK A;  2O9L A;  3O8H A;  1IN6 A;  3BCA A;  3HEF A;  3D1N I;  3X2Q H;  3PIO F;  5FLV A;  3NWT A;  1GV2 A;  5D5V B;  4BEH B;  3BY6 A;  2L9N A;  2WV1 A;  5KVR A;  2QSH X;  3KZY A;  1IF1 A;  2V7F A;  1ZH5 A;  1OCR H;  3HHG A;  2XF6 A;  4IJA A;  4XKC A;  5AON A;  3H3V K;  2WV0 A;  3DF8 A;  5L3C A;  2VBX A;  4F93 B;  2CH0 A;  1RUN A;  1TW3 A;  2BW3 B;  3CDH A;  4HX8 A;  1EF4 A;  3JTG A;  2I5U A;  1FMV A;  3J7Z I;  3BZK A;  1VZ0 A;  2MLG A;  1O3S A;  1O57 A;  1Y0N A;  3OIO A;  3CUQ C;  1TBX A;  3H0G J;  3CP8 A;  5EJC A;  2VQG A;  5HS9 A;  1R7J A;  1RET A;  2R92 J;  4HNT A;  3RKQ A;  1FJL A;  2GM4 A;  2X0L A;  1LNW A;  2GXA A;  4FIS A;  4IHV A;  2QEX I;  3IP4 B;  3KP6 A;  2GOM A;  3E97 A;  3V4G A;  4BY1 J;  4PGH A;  5JLW A;  1UST A;  5FKM A;  4B48 A;  4I7H A;  2ISY A;  4KMU X;  2NOG A;  1XMA A;  2DA2 A;  1X1B A;  4B47 A;  2QZ8 A;  3FDY A;  1X2M A;  2Z5U A;  3RKY A;  2L3D A;  1DP7 P;  1OYY A;  2DDA A;  2OA4 A;  3FXQ A;  4YFN F;  4DYQ A;  4ZJZ A;  2LD5 A;  2VOO A;  1WKM A;  3CJQ B;  4FX4 A;  4XLN F;  2L7Z A;  3BR2 A;  4C3H J;  3K2Z A;  3WTT C;  2E35 A;  1E17 A;  1HLV A;  5DCF A;  1FMW A;  1IAW A;  2QQA A;  4M3D A;  2CQQ A;  1A5J A;  1Y1V J;  2IA1 A;  1M1E B;  2WAQ A;  4MIM A;  2XPW A;  5FD5 A;  4EM2 A;  2NS8 A;  3ZQI A;  2K86 A;  4WCG A;  2X1D A;  2CUF A;  2CV0 A;  4L9J A;  1ZGA A;  3F6V A;  5BQT A;  2R7X A;  2E5N A;  2UXX A;  2OTJ I;  1MMD A;  1O7F A;  3ESW B;  4M6X A;  1UHW A;  1ZLK A;  1SFK A;  2E19 A;  3JTH A;  1ZAR A;  2A5W A;  3PNV A;  1MNE A;  3K6G A;  3G2B A;  2CV1 A;  4UB8 C;  4UVA A;  5HDN A;  4PDK A;  1TLH B;  1ACI A;  4E7L A;  3QOD A;  2VPR A;  5IP7 J;  1ZYR F;  5HNH A;  2L5Q A;  1JI8 A;  5C4X J;  1J75 A;  4XN0 A;  4XR6 A;  5K7H A;  2XIG A;  3TMO A;  3OYN A;  2KQR A;  4L0Y B;  4BXX J;  4XN3 A;  5DCM A;  4LIV A;  2OD5 A;  3M7G A;  4M6Y A;  3MKZ A;  1LJ9 A;  1E3P A;  4NNJ A;  3MZH A;  2EFP A;  2XDV A;  1MD0 A;  2X1E A;  1W5C C;  3SFI A;  2BHZ A;  3RZO J;  2CQX A;  1SD6 A;  3WGG A;  2WAE A;  4RM2 A;  4E6K G;  3KET A;  4XL9 A;  2VIX A;  3OYJ A;  2FX0 A;  4Y15 A;  1S3J A;  4XM3 A;  1DUX C;  3PJR A;  2L9R A;  3H9J A;  5M5W J;  1Z67 A;  1W7P D;  2NVU B;  2RAE A;  2JA5 J;  5IOY A;  2NVX J;  3BG9 A;  4AYB A;  3S1R J;  1ONV A;  5FLM J;  2AQE A;  4XRF A;  9ANT A;  1YYV A;  2EPF A;  4FHT A;  5H6Q A;  1P4X A;  2LBF A;  2STW A;  1FWZ A;  1F9N A;  1IUY A;  1U6G A;  2VQH A;  4B3A A;  4EV0 A;  1PYV A;  1XDS A;  2CQ7 A;  1LDK B;  1MBH A;  4II2 A;  3F72 A;  4G8X A;  3E5X A;  2PEX A;  2K9S A;  1I3Q J;  1O7L A;  5E1W A;  4C2M J;  1MZB A;  4OU0 A;  1T08 B;  2DK8 A;  1OCZ H;  4CYD A;  4CHU A;  3CCU I;  4E7K A;  3IWF A;  4EQQ A;  4G12 A;  4HOB A;  4BU2 A;  4C3I J;  3L2W A;  4S0H B;  3RPU D;  1ZN2 A;  1W4M A;  2FOW A;  3HOX J;  5DDG A;  1BIA A;  1G8X A;  2VXD A;  3FXL A;  4OAY A;  5HOD A;  4EMS A;  1YW8 A;  2XB5 A;  4P9U A;  5D8K B;  1G3W A;  4AYB N;  1KQ8 A;  2IP2 A;  4RAF A;  3HL2 A;  1RKT A;  5KAF C;  2QM3 A;  5HVQ C;  3S2D J;  1F36 A;  1XDU A;  2AXL A;  1MSE C;  2HYF A;  3A01 A;  3BDD A;  3S15 J;  1TWF J;  5J1R A;  4Y13 A;  5DS9 A;  1OCO H;  4BYY A;  1W7P A;  1ZG5 A;  1X1A A;  1QHH D;  2VN2 A;  4XKV A;  4MEY F;  3CUO A;  4CYC A;  2ZXH A;  3COA C;  1BW5 A;  4UVB A;  4Z2Y A;  3OY9 A;  4IXA A;  3HXL A;  4L0Z B;  1S7O A;  5FKN A;  2CV2 A;  3WTX C;  4A3F J;  2TCT A;  3AG4 H;  1A36 A;  3A4C A;  1QPI A;  2GAU A;  3KP7 A;  1EV7 A;  5ICE A;  1APL C;  4KUM A;  3JAM Z;  3TP0 A;  5KNL A;  2AHQ A;  4HEA 2;  4B4C A;  2FEZ A;  5TIS C;  2D1H A;  1P4A A;  4EGZ A;  3U1K A;  2FBK A;  1XS9 A;  2VON A;  1QNT A;  2DMP A;  4ETS A;  5CVV A;  3QPS A;  1J09 A;  1OFC X;  4PK4 A;  1FLI A;  3LSR A;  3I59 A;  2XHK A;  2Z1D A;  1SAN A;  1I3A A;  2LF7 A;  2ZXJ A;  4Y4R A;  2PQ8 A;  3AG2 H;  2ETH A;  2R5Z B;  5BMZ A;  3HIF A;  1MGT A;  4OMY A;  3PNY A;  4RB0 A;  1QRY A;  3S32 A;  2ACJ A;  3HSF A;  1LFU P;  4A69 C;  2ZC2 A;  1Z1D A;  4GRI A;  5ICF A;  3P5J A;  2FE3 A;  2HVS A;  4E4H A;  1QHG A;  3GTL J;  5CLS A;  2KL4 A;  1V5E A;  3LA3 A;  1MBF A;  2DT7 B;  1B1B A;  3IWZ A;  3OR2 C;  5HLH A;  3QOP A;  4GXO A;  3QPT A;  2EIJ H;  3B6A A;  5JHF A;  3OYK A;  1WPK A;  4PJL A;  2OCE A;  2KZG A;  4MGR A;  2GZW A;  2JSC A;  1LVK A;  3Q3S A;  1DP3 A;  3N4M A;  2QSF X;  1PUE E;  4Q5S F;  3PL8 A;  1W5T A;  5K7Z A;  3K70 D;  1AHD P;  5LRS A;  2YU9 J;  3OYM A;  1RRJ A;  5M3M J;  2FQ3 A;  2R7Z J;  2LH9 A;  1ZTR A;  2AS5 F;  5FJ8 J;  3K2A A;  1PP8 F;  2FNA A;  2LC2 A;  5DV5 A;  3W2W A;  4HBL A;  3FMQ A;  1ORK A;  1TL8 A;  3CF2 A;  2E5Z A;  3KYL A;  1R9T J;  3T1B A;  3GX4 X;  2F5V A;  2NAZ A;  4HF1 A;  5EDN A;  3Q0V A;  4BE1 A;  2OTL I;  3L2C A;  4CCK A;  3Q5F A;  3J81 Z;  2Y30 A;  2Z2S B;  1OCC H;  4MFE A;  2K3F A;  4BHB A;  4D0P A;  2DOF A;  2GIZ A;  5FB2 A;  2EZH A;  1FBS A;  5FKO A;  3K1M A;  4F7Z A;  4EM0 B;  2EQR A;  2DTZ A;  2F4M B;  2DMT A;  5K5Q A;  2IS2 A;  3A03 A;  4FET A;  4ESJ A;  3VPR A;  3GZN B;  5EG0 A;  1GXP A;  1X2N A;  4ENK A;  4IRH A;  4ZC3 A;  4BBS J;  1SAX A;  2JT1 A;  4L5E A;  1T38 A;  3BQZ A;  3GFM A;  5AIP A;  3WE3 A;  2W82 A;  3JCU C;  3CCV I;  2FUG 2;  2BEO A;  1XCV A;  4A93 J;  1T8I A;  1FOY A;  1USS A;  2DU9 A;  2NVY J;  3ZCO A;  4A0Y A;  1Z3X A;  3UR3 C;  2VKV A;  4C2T A;  2L9V A;  2BW3 A;  2KHM A;  4KIF A;  3A2K A;  1K83 J;  2GXB A;  4KT5 C;  1U9O A;  1OR7 C;  2DMQ A;  1IN7 A;  4M3E A;  1FTZ A;  3CO7 C;  5E1Z B;  1ENH A;  5J8C A;  3GVA A;  4U0Y A;  3ZMZ A;  5ICC A;  3DEW A;  1Q1V A;  3C2H A;  1GT0 C;  5HDK A;  4LOC A;  1XGM A;  3QYF A;  2VC0 A;  4LLL A;  1BI1 A;  5D4S A;  1TWA J;  1TTY A;  4JYK A;  4KIG A;  1IJW C;  4G94 A;  3JRE A;  4N9H A;  4IQJ A;  4X0G A;  2M45 A;  5L3D A;  3WU0 A;  3AL0 C;  3I4N J;  1KGS A;  1P9Q C;  1TZL A;  5LBQ A;  3OS1 A;  2LYC A;  6PAX A;  3MKL A;  4RLF A;  3WOD F;  2VPL A;  4I98 B;  4AIK A;  1AKH B;  4N4N B;  2IPQ X;  1Z3Y A;  2KIQ A;  3TO9 A;  1XC5 A;  4JOM A;  1VQ8 I;  2HZD A;  5J6X A;  4E70 A;  3DLL F;  3QYE A;  3TOB A;  1FTT A;  1XSV A;  5CKT A;  4HSR A;  2LBF B;  2F5F A;  2DA1 A;  2P4W A;  3FIW A;  3L2U A;  3I71 A;  5BOX A;  2EIK H;  2DLL A;  2WC2 A;  4R1H A;  4NC8 A;  1O3T A;  2R7U A;  3EYI A;  3FIS A;  1PUF B;  4ENN A;  5TRD A;  2NS0 A;  3A0H C;  4FTH A;  4LLG F;  5LEJ A;  3BTI A;  5CQG A;  1V5G A;  1LKX A;  1XPX A;  3GXO A;  4HV6 A;  1REP C;  4A5N A;  1T0F C;  1AOY A;  4HST A;  2L54 A;  4RLQ A;  2FBH A;  3JSO A;  5CVR A;  2RDP A;  1DGW Y;  3A1Y A;  3HOY J;  1I1S A;  1IRF A;  2LR8 A;  2HFH A;  4ZDP A;  2EWN A;  1ON1 A;  2G9W A;  1MJB A;  1IN4 A;  2MG4 A;  2XKO A;  3HB9 A;  2R7R A;  2GA1 A;  4JX5 A;  4DJA A;  3MN2 A;  3CUQ B;  3JW4 A;  5FGM A;  3D5L A;  3KYC B;  2DK5 A;  4CZZ A;  3M3Y J;  5EEA A;  3LMM A;  2XVC A;  2F5C A;  3OL4 A;  2IVM A;  5IOZ A;  4IHY A;  4A6E A;  3GFI A;  2K85 A;  4UV9 A;  5IT9 K;  3PQK A;  5CQE A;  4GYG A;  2HOE A;  1I5Z A;  4XLH A;  5EYR A;  4D7N A;  4I0B A;  2E2J J;  2FD5 A;  1S72 I;  3QWL A;  2HDD A;  3Q9V A;  1IRX A;  1H9G A;  2Y31 A;  5F0C A;  1KU2 A;  4G6D A;  4R79 A;  4HDV A;  1YI2 I;  4RAG A;  4CCL A;  2CFO A;  1VQL I;  2L9S A;  3OYD A;  1D0X A;  4G7Z F;  1TQM A;  2QKM B;  1QA6 A;  4M74 A;  3OYH A;  2NS7 A;  4Y3O A;  2DAO A;  2JA8 J;  1P4W A;  3V8K A;  2EZK A;  2HOA A;  2YU3 A;  5FFZ A;  1KYW A;  2L0K A;  1DGR M;  3HJE A;  3LSH A;  3ZOB A;  5D5U B;  2STT A;  1D8J A;  1BM9 A;  2W4S A;  4OWR B;  1TNT A;  2JTV A;  2XAS A;  5D6F A;  2MW8 A;  3HUG B;  1JT6 A;  2OV7 A;  3KLO A;  2OQR A;  3PSI A;  2DA6 A;  3RSN A;  4RGX A;  2M0M A;  2DI3 A;  4UUS B;  3HGY A;  2L7M P;  4DZP A;  3U21 A;  2JK3 A;  3EQL F;  1S7E A;  3LFK A;  4BE0 A;  1MND A;  2FSW A;  4Q4Z F;  3HGG A;  2IW5 A;  3GWZ A;  4XOP A;  2MD0 A;  1D1B A;  3W6K B;  3ZQF A;  4FE7 A;  3FF5 A;  2X6Y A;  2DQL A;  2DPU A;  3I4M J;  1F1Z A;  4Y7N J;  1TNS A;  2MH9 A;  3IRQ A;  2HI3 A;  4ZYA A;  4BHC A;  1YS6 A;  2VC1 A;  3CD6 I;  3FWE A;  2X85 A;  3BR6 A;  3JRG A;  3DU6 A;  1FSH A;  2JA2 A;  2M87 A;  4A3J J;  1GXQ A;  3RTR A;  1XGO A;  2QF7 A;  3BR1 A;  5GPC A;  2EH3 A;  5GPA A;  4XOT A;  1GV5 A;  2B63 J;  4XSX F;  3S2W A;  1OLT A;  3LL7 A;  1SVM A;  2CYY A;  2IGK A;  4AU7 A;  3I55 I;  1HW1 A;  5LFA A;  1VQP I;  3IH4 A;  5GAD J;  4XSZ F;  5F1J A;  1NH3 A;  4HLX A;  2XPU A;  4RA2 A;  1YG2 A;  2W85 A;  1QZZ A;  5LGU A;  2FQ4 A;  3DPT A;  1FP2 A;  1Z7U A;  1X1D A;  5B5E C;  1QZY A;  5ILU A;  2QKL B;  2RN7 A;  2V79 A;  2Z99 A;  1F4K A;  4J00 A;  2QGU A;  4PJJ A;  4RAZ A;  5LGT A;  4ZYD A;  2R3S A;  2YPR A;  3ONQ A;  3BJ6 A;  4ZDL A;  3QRF F;  4KMF A;  1WWX A;  1XG1 A;  2WBM A;  2GBY A;  4HAM A;  1WJE A;  1SFU A;  4IRG A;  2DFF A;  2IAI A;  1SC7 A;  1NK2 P;  1YS7 A;  3KEY A;  4CDG A;  3BP8 A;  5L3F A;  4DYC A;  1ZLJ A;  1T95 A;  3V7R A;  4I0A A;  3F22 A;  2JRT A;  4BUP A;  5H6R A;  2VB6 A;  1WJ5 A;  1MSF C;  1MBG A;  5HNF A;  2JVG A;  3L00 A;  4KN4 X;  4B44 A;  3KZI C;  5A2Q K;  3HRM A;  2JUG A;  1WQ2 A;  1ZG3 A;  3ASN H;  1VND A;  4I6Z A;  1HF0 A;  1K79 A;  3Q0U A;  2RV8 A;  4H0E A;  2R7T A;  2IGN A;  5FKK A;  2M4G A;  2VBW A;  3A02 A;  4HX7 A;  2FBI A;  1FP1 D;  2EA2 A;  4E7S A;  1WJC A;  4IO9 F;  2ZKZ A;  3TOA A;  2KLO A;  3IRR A;  1BR1 A;  1YX5 A;  3G6E I;  1V55 H;  2PJP A;  4A3B J;  1IDY A;  3C2B A;  2XSD C;  1P7J A;  2P5K A;  4ASN A;  4GDF A;  4E7I A;  3DP7 A;  4LMY A;  2EFO A;  3EPZ A;  3CMM A;  3BG6 A;  1WJD A;  4F3Q A;  5JVT A;  3UKG A;  5F1R A;  3L2Q A;  2K9N A;  1JHF A;  2CW7 A;  2LLK A;  3QPH A;  4HNU A;  1BL0 A;  3GLL A;  3G1L A;  1U78 A;  3H92 A;  3V8L A;  2JJ7 A;  1G3Y A;  2HU9 A;  3DKX A;  3AKZ A;  2V1U A;  1I50 J;  5DM7 F;  2K4B A;  3I9V 2;  2DOE A;  3HOU J;  2DPD A;  1FT9 A;  2MLK A;  2QWW A;  2DA7 A;  1EH7 A;  2BVM A;  3KX2 A;  3OYI A;  1Z6T A;  2Q2E A;  3KFW X;  1R58 A;  4RM3 A;  1FY7 A;  2M9H A;  2GA2 A;  2F5D A;  1WCM J;  4IEJ A;  4XLF A;  1Y8R B;  5L3B A;  3CMY A;  1YFH A;  4PJ0 C;  2CMP A;  3KYD B;  2E36 A;  4AC0 A;  5K1Y A;  4X6A J;  3SFZ A;  4IX7 A;  1BC7 C;  3TP3 A;  4RB2 C;  4YIF A;  2XGE A;  3BRO A;  2O8K A;  2HTJ A;  2LP0 A;  3K0L A;  5HLG A;  4PUS A;  2JUC A;  1UJ8 A;  1V3F A;  2ZME B;  4C9Y A;  4DIQ A;  1J2X A;  2PMH A;  2QCO A;  5ILS A;  2CW8 A;  2EFQ A;  3QU6 A;  5E18 F;  5B3S H;  2QQB A;  2O0Y A;  4CYC B;  1GVD A;  2V6C A;  3CUQ A;  3SXY A;  3DTI A;  4RDU A;  5GP9 A;  1K6Y A;  3TKY A;  1FOX A;  3VOD A;  5GAE J;  2ZJR F;  2GOX B;  4ZTJ A;  2DJN A;  1QPM A;  3RKW A;  1POG A;  3ZQ7 A;  1IO2 A;  4FT8 A;  5GTI C;  4UXN A;  3J7A Y;  1WFX A;  5J47 A;  2P6S A;  3TO6 A;  2BHY A;  1FIP A;  2ZSH B;  1Z77 A;  4B8X A;  2RQQ A;  5DYM A;  1LQ1 A;  3Q0W A;  1MBK A;  3LQQ A;  3BG7 A;  4LJZ F;  3V7S A;  1D1C A;  3GUD A;  3U2R A;  4BQQ A;  1XGN A;  3DQV C;  1R36 A;  4M9S A;  1DQU A;  3PUB A;  3TL4 X;  2OBP A;  1YE9 A;  3SDB A;  1RIO H;  3E6M A;  2X48 A;  2DDB A;  2HNH A;  2GXG A;  2M8G X;  1K78 B;  2E7X A;  5ICG A;  3F8C A;  3DEU A;  3W3C A;  2EZL A;  4EJO A;  1BA5 A;  4ON0 A;  2EJR A;  4XKW A;  3EDP A;  3GW2 A;  2ZFU A;  2M0C A;  4XRS G;  2DA4 A;  2ELH A;  3ABT A;  1ZGW A;  3EUH A;  1BI0 A;  2LY1 A;  1B59 A;  2Y9Y A;  3HSR A;  1MMN A;  1MJA A;  1J59 A;  3MD2 A;  1U8B A;  2KP6 A;  5DD4 A;  4S05 A;  2WTE A;  3MWM A;  3N97 A;  1YLF A;  3P7N A;  1KZH A;  3F0C A;  1G3S A;  3SEZ A;  4XOR A;  3LSJ A;  2H1K A;  3ZPL A;  3BTL A;  1T56 A;  2KJC A;  4RAY A;  1TT0 A;  3HC7 A;  2PFB A;  4M9X A;  3RPQ A;  2LTP A;  2VJ5 A;  4LG3 A;  3KP4 A;  4XBF A;  2KIF A;  5LLQ A;  1J5Y A;  1XB4 A;  3AAF A;  1AU7 A;  3L9F A;  4NB5 A;  3RZD J;  1Z9C A;  4HZF A;  1IV8 A;  4HW0 A;  3KIO A;  2W48 A;  3CCY A;  2K3P A;  3KP3 A;  3GO5 A;  3KE2 A;  5HS7 A;  3FXK A;  3K4C A;  1K61 A;  4M3F A;  2L02 A;  4LK1 F;  3NAR A;  4PCQ A;  4YG2 F;  1WJF A;  1VFC A;  3DTK A;  2MGQ A;  5E8G A;  5IP6 A;  4YIR X;  3JRD A;  2BY2 A;  2JPB A;  1B4A A;  3LFU A;  2LK2 A;  1TC3 C;  2E1O A;  4YII A;  2BY3 A;  1B9N A;  2FF4 A;  2ID3 A;  3ZQQ A;  1JKO C;  2VE9 A;  2RRE A;  2VOP A;  4RS8 A;  3I56 I;  2HDW A;  4LD5 A;  3WE2 A;  2PLY A;  4ESB A;  2K9M A;  3L1P A;  2ECC A;  2CO5 A;  2A6H F;  3BQY A;  3V7C A;  2P7C B;  3R4K A;  2UXN A;  2PI0 A;  3EYY A;  1BW6 A;  2LSO A;  5F64 A;  2ZJP F;  2D2W A;  1T33 A;  1U5T A;  2DXI A;  2NNY A;  4A3E J;  2V6E A;  3ZMU A;  3JRB A;  3KEO A;  1FBU A;  2P8T A;  1MNM C;  5BNG A;  1N75 A;  3O6B B;  3K70 C;  4CCM A;  3FK7 A;  4NQW A;  1EJ9 A;  5FRO A;  2R5Y A;  1JGS A;  1X4P A;  2R7D A;  1HOM A;  4KIS A;  2ID6 A;  3HBL A;  3QP5 A;  2A07 F;  4HNV A;  2ZNZ A;  2RVC A;  2DW4 A;  1R71 A;  5IPA A;  4Y33 A;  1HBX G;  5CVI A;  2F6C A;  2K27 A;  2FOK A;  3WG7 H;  3ZQC A;  2KIM A;  2XAG A;  4DBQ A;  1TQI A;  3SDG A;  2VE8 A;  3L2R A;  2JRM A;  3K10 A;  4V19 K;  2W00 A;  2DA3 A;  2MD5 A;  2HDC A;  1QVT A;  2H27 A;  2V9V A;  3MZY A;  3F21 A;  1H8A C;  2XAJ A;  2HPI A;  1HXD A;  1QQI A;  5F0H A;  3GZ6 A;  1YO5 C;  3T5X A;  2FU4 A;  4MQV A;  1FYK A;  3HRS A;  4J01 A;  4M72 A;  5KK1 A;  4BGD A;  2ELJ A;  5FFX A;  1UHM A;  3SQN A;  2XRL A;  4P9F A;  2QQ9 A;  1JJ8 C;  2C6Y A;  2VQC A;  3BPX A;  3E5Q A;  1EKE A;  4OIN F;  1E3O C;  3KZZ A;  5E3L A;  3TDZ C;  3BR5 A;  2KKO A;  3RKX A;  1ITY A;  4H4K C;  1FOW A;  3FMS A;  1W0U A;  2DMN A;  2LY2 A;  2HKX A;  3R0J A;  4I2O A;  2JMW A;  3EET A;  1LPQ A;  1FNN A;  5B66 C;  2DO7 A;  1MBJ A;  2FXA A;  5E3M A;  2NRA C;  2K9L A;  2H8R A;  4A12 A;  3W2A A;  2WB1 N;  4MTE A;  3BJA A;  3QQA A;  3GTJ J;  3S93 A;  1YRN B;  1RR8 C;  3FHN A;  4P96 A;  4XLE A;  3R0A A;  4BKX A;  1ETX A;  2BVL A;  4CCN A;  2LKP A;  4DBR A;  4EGY A;  5IYB J;  3ZMD A;  3G73 A;  1XCB A;  3CC2 I;  1I39 A;  5C4J J;  4IKF A;  3SZT A;  3K4K A;  2IGO A;  1P6R A;  2CQK A;  4HQM A;  4P1W A;  3NQO A;  3K7A J;  1HW5 A;  2O8X A;  3C2G A;  3PQJ A;  1FOK A;  1AA7 A;  4MNU A;  1ZAO A;  2BYV E;  2M3A A;  5GAH J;  2E2H J;  4NHJ A;  1ULY A;  2M5W A;  3FZV A;  4XNF A;  4BQN A;  3J7A O;  1V5F A;  4QPQ A;  4AIJ A;  1X58 A;  2DFH A;  5K5R A;  3BWG A;  2HQR A;  2JVH A;  2ZJQ F;  3OL3 A;  4A5M A;  3ZRG A;  2EFN A;  2JA6 J;  1HC8 A;  3LSG A;  3EUA A;  4QTR A;  4WF2 A;  2PX9 A;  2VL8 A;  1MH3 A;  3ZP5 A;  3BCB A;  2JZY A;  3LA7 A;  3NAU A;  2YR2 A;  3QPL A;  2J5P A;  2B7E A;  3PFY A;  3BG3 A;  2QA4 I;  3WHB A;  2V1D A;  1HSJ A;  4HF2 A;  1Z05 A;  1OIS A;  1WH5 A;  2LF8 A;  3RQI A;  4O3M A;  4KYW A;  5DUI A;  1CF7 A;  2COB A;  3GTO J;  5CVJ A;  5FO5 A;  5LHG A;  3BLY A;  4W1U A;  2MYS A;  3FMR A;  4CSW A;  3M8J A;  1ZR2 A;  3H5R A;  1VTN C;  1D0Y A;  1XGS A;  2E7W A;  2F4O B;  2QUF A;  3BC8 A;  3CDL A;  5HOO A;  3FK6 A;  3EUH C;  3DXJ F;  2HQ5 A;  3HOT A;  1ETO A;  2ZME A;  3RDI A;  3ML6 A;  1NG7 A;  4JX6 A;  4IOA F;  3CP2 A;  5D8L B;  2E1N A;  1JUP A;  4IQ4 A;  3ZQL A;  1RUO A;  4GFB A;  2DJI A;  4D5F A;  3I0T A;  1W1W E;  1LEA A;  4AD9 A;  4AIH A;  3A0B C;  2O5R A;  4MLO A;  1VQK I;  2K4J A;  1H9T A;  3GCM A;  1O3R A;  3AG3 H;  4U7D A;  3VSK A;  2RC4 A;  2H8W A;  2R4G A;  3LNQ A;  3H1C A;  3WTU C;  3L2V A;  1W5S A;  1T39 A;  4IHT A;  4ZTF A;  2LFB A;  4RGR A;  1U2W A;  3I54 A;  1RC9 A;  1MKM A;  3RIR A;  2IS1 A;  5LD2 C;  3T8T A;  4ZYE A;  2MAB A;  2O03 A;  1OQY A;  1QU3 A;  1D0Z A;  4UUS A;  4ITV A;  5F04 A;  1SFE A;  4O5V A;  2Z9O A;  2V4J C;  3HOW J;  1BJA A;  2DMU A;  2LKX A;  4WXH A;  3OYA A;  3FKI J;  1R5H A;  4B43 A;  3BTC A;  2Y69 H;  3KPH A;  4K2E A;  4HX4 A;  3DLA A;  1LEB A;  4FX0 A;  1Z6R A;  3TDU C;  4UUV A;  2J5O A;  1STZ A;  2FJ1 A;  2HQA A;  4BH9 A;  3OYF A;  3DPU A;  3MVP A;  2PJR A;  2JQ7 A;  3G1O A;  4HLY A;  2KIU A;  3CC4 I;  1R6R A;  3CJR B;  4FQG A;  4HG2 A;  2H1L A;  3IKT A;  3GYH X;  3MCZ A;  1B8I A;  1VQ6 I;  2LRD A;  1UHS A;  2DYS H;  2IEK A;  2COM A;  1A6I A;  4I02 A;  3JRH A;  3C7J A;  1SD7 A;  2R0Q C;  2ZO4 A;  3JAM K;  1Z0X A;  5F6F A;  4ZH4 F;  4DGW B;  1TWG J;  2Y75 A;  4U87 A;  3CCM I;  1JTX A;  2NOJ B;  1V4R A;  4J19 A;  1UAA A;  3K1P A;  4RGU A;  4BE2 A;  1LDJ A;  1RZ4 A;  1J9I A;  2ZXW H;  1ON2 A;  2VI6 A;  3TO7 A;  4UV8 A;  1GDT A;  2X1C A;  3HPH A;  1GLN A;  2Z33 A;  2PG4 A;  3LST A;  4LIT A;  1A35 A;  3WTV C;  1ETV A;  1RES A;  4HQE A;  2L01 A;  2DFI A;  1CQT A;  1R23 A;  4KIT B;  4JK1 X;  5LGN A;  2WAD A;  1OPC A;  4A3L J;  4RB1 A;  3CCJ I;  3D5S C;  4DNC A;  3W6V A;  5E1X A;  4AID A;  4XIC A;  3IL2 A;  1BI3 A;  4I99 C;  5C3E J;  3ISP A;  5DD8 A;  5GTH C;  4CXF A;  4WX9 A;  4PGG A;  3FXJ A;  1G6N A;  3F8N A;  3F8M A;  1Y6I A;  3R60 A;  3N05 A;  3DWL E;  3VDX A;  3LSI A;  1XSD A;  3PFI A;  3REO A;  1W36 D;  2OAZ A;  1UCR A;  2DN0 A;  2R7Q A;  4MTD A;  2JN6 A;  2N8G A;  5H20 A;  4G9Y A;  4PJN A;  2FA5 A;  3I64 A;  5EG0 B;  3ZMT A;  3IC7 A;  5ILV A;  2JWT A;  3OYB A;  1OYW A;  2YX7 A;  5D4R A;  5B1B H;  1IXC A;  3OR1 C;  2IS4 A;  2VKH A;  2XGX A;  4M6V A;  2D1V A;  2FNP A;  2DQR A;  1OJL A;  3VB2 A;  2R7W A;  3LSP A;  5IYD J;  4LG0 B;  2R5Z A;  3KLN A;  2H09 A;  4GGG A;  4JBA A;  3DCF A;  4L9T A;  3H0D A;  5J3L A;  1U3E M;  1JHH A;  1XX5 A;  3TED A;  1KYZ A;  1BI2 A;  1TWH J;  3JRI A;  1S7A A;  1R5I D;  2CQN A;  4KDP A;  2HPM A;  3F3X A;  3V42 A;  2G0E A;  4BJ6 C;  5K7F A;  4F91 B;  3M4O J;  4ESF A;  4OMZ A;  1Y1W J;  1KQ0 A;  2BBY A;  4XID A;  2BV6 A;  2VOD A;  2OCC H;  2ME6 A;  5EEH A;  2DTR A;  2CGP A;  1BN5 A;  1B9M A;  2Z16 A;  3S1Q J;  2HYG D;  2CS3 A;  1RR7 A;  1ETW A;  2QVO A;  4HPQ A;  1FYM A;  2IJL A;  2LRE A;  1R5G A;  2A61 A;  2L7F P;  1B8I B;  1MBE A;  4HF0 A;  4HDU A;  2XAU A;  1OYI A;  4UUT A;  3G1M A;  1QVU A;  2XF7 A;  1R00 A;  2ZME C;  2X6X A;  3CJT B;  3K9T A;  3QP6 A;  4ZYG A;  5EGO A;  4EJT A;  5DM6 F;  2V9K A;  4CUG A;  1WZ2 A;  5E79 C;  4OIR F;  2I10 A;  3OSG A;  2HVR A;  1IDZ A;  4L5J A;  2OC6 A;  5L3E A;  2VKE A;  2A3S A;  1YHQ I;  2R7V A;  1SD4 A;  5FRN A;  2I8D A;  2XGC A;  4HA8 A;  4R8H A;  3H9Q A;  2H6B A;  1X3W B;  2KT0 A;  3HPG A;  4HRI A;  3S3N A;  4OIP F;  3DU5 A;  4KFC A;  1B72 A;  2BZT A;  4BHP A;  1OCT C;  2VJJ A;  4TV7 A;  3FXM A;  1QZE A;  3HTS B;  2AO9 A;  1JE8 A;  1BBY A;  1T98 A;  1KU3 A;  1SVL A;  1ETY A;  1XSX A;  1KON A;  1P2F A;  2PMZ N;  2P0W A;  2IA2 A;  3ZQG A;  3VYS B;  1O4X A;  1SMT A;  2DCE A;  2L4A A;  4BEH A;  5BPI A;  2WB1 A;  4F55 A;  2FML A;  3SEQ A;  5IYC J;  1DU6 A;  2IA0 A;  1D8K A;  1LVA A;  4KJZ A;  1VQO I;  2CG4 A;  2VUM J;  2A5Y B;  1WI9 A;  3S1M J;  2CWE A;  1TQP A;  3RJP A;  2X6O A;  1HW2 A;  3V8J A;  5KCM A;  4UVC A;  2VAS A;  1HKT A;  3PNT A;  5LHH A;  4ZDO A;  4YFX F;  3M1C A;  5DUK A;  1IV6 A;  1TT5 B;  2O6G E;  2BGC A;  3GZ5 A;  4WXD A;  1IRZ A;  2E1C A;  4A6D A;  2A6T A;  2XF5 A;  4KIC A;  3ECO A;  5B1A H;  2EV6 A;  4UB6 C;  4BDZ A;  1HCR A;  3LOC A;  1WGX A;  3E1S A;  3VWB A;  4G7O F;  1K78 A;  5IP9 J;  4Z6Y A;  1YX3 A;  4OAZ A;  3FM5 A;  3HTU A;  3B02 A;  5EEG A;  5CPR B;  3VYT B;  1R4M B;  1B72 B;  3NEU A;  3PM1 A;  3DBH B;  2E1M B;  3M8F A;  4G6T B;  3ROU A;  1G4D A;  2HR3 A;  4U0V A;  3I53 A;  3JRA A;  4AWX B;  4BAY A;  3H36 A;  1R1V A;  5E8I A;  2R7O A;  2OZ6 A;  4I76 A;  3OYL A;  3HG9 A;  2KMU A;  1SFO J;  1IN8 A;  2DA5 A;  2E60 A;  4M9Z A;  1EH6 A;  1E2X A;  2XAH A;  1L3L A;  4E7J A;  2HZT A;  3FKJ A;  4L5I A;  1IG7 A;  3JRF A;  2M8E A;  1S8N A;  1LFP A;  5EGO B;  4F52 A;  3S16 J;  2OQG A;  1FZP B;  1Z7L A;  1MDM A;  1D5Y A;  2HS5 A;  5CVU A;  1W36 C;  1IGN A;  4WWC A;  2W7N A;  2Y0S A;  4I01 A;  4X1E A;  3SZP A;  3K1N A;  3BZ6 A;  3ERM A;  3BR3 A;  2QQ8 A;  2IRF G;  3H3U A;  2Q0O A;  2A68 F;  2CUE A;  5M3F J;  2VBY A;  4Q48 A;  1KQ9 A;  2ELK A;  3GLX A;  1S29 A;  2M30 A;  3LAJ A;  5F0F A;  1JT0 A;  1E3H A;  1WJA A;  2HVQ A;  3FBI B;  3W2V A;  2R93 J;  2O7O A;  1MMS A;  1A04 A;  4C2U A;  2GLO A;  4A3G J;  4UNO A;  4G6Q A;  2V1N A;  2VKD A;  2MC3 A;  1I1G A;  3BR0 A;  3K4J A;  3LSM A;  4CIC A;  2XB0 X;  2KJB A;  3M07 A;  1OKR A;  1U5T C;  1W0T A;  2XRN A;  3M1E A;  4B09 A;  3S17 J;  3GFJ A;  2F48 A;  4IVN A;  4OOI A;  3ZGK A;  4D9J A;  1JKR C;  1D1A A;  2KRH A;  2VJI A;  3OIP A;  3T0Y A;  5F27 A;  1FSE A;  4XLA A;  2CW0 F;  3K4M A;  3VYU B;  2UV1 A;  4IHW A;  3WGI A;  1SVO A;  2P6T A;  2IGM A;  1S9H A;  4L9N A;  3M9A A;  2JA7 J;  3MFK A;  3B73 A;  2Y9Z A;  3E6D A;  4M3B A;  3W6J B;  4BQA A;  3O2P E;  1F43 A;  1J0R A;  3HUG A;  3SJM A;  1A31 A;  2K40 A;  4CH7 A;  4CA0 A;  4BL0 B;  1MDM B;  1HST A;  4A0X A;  1MW7 A;  4ZZL A;  2ZNY A;  3QAH A;  4FCY A;  3RYP A;  5ED4 A;  2XV4 S;  4YFK F;  2RNG A;  5K5O A;  1I27 A;  3J7Y J;  2EIM H;  4LB5 A;  1BR4 A;  2HTS A;  3L7W A;  1OR7 A;  1B6A A;  2LNB A;  4BDY A;  3S3M A;  3ZR8 X;  4YEJ A;  3OS2 A;  1S5L C;  4A3I J;  1RKW A;  2ESH A;  3OYC A;  1UFM A;  1FBQ A;  4NC6 A;  3HKZ N;  1WRJ A;  3Q9S A;  2VT2 A;  1ERD A;  3VOE A;  4Y17 A;  2KFD A;  4LLN A;  3GEZ A;  1K4T A;  1YTY A;  4KA4 A;  2K5C A;  2TDX A;  3OSF A;  2KPM A;  5J40 A;  2A69 F;  3ECH A;  4CO8 A;  3U9G A;  2AQF A;  1D5V A;  2LDU A;  3LA2 A;  1VQM I;  1H88 C;  3BJO A;  2CJJ A;  2IBD A;  1BIB A;  5DCM B;  4BY7 J;  2HGC A;  1UZC A;  3FBN B;  3GBG A;  3RI4 A;  2X51 A;  3HDD A;  4XKB A;  2X4H A;  2L2O A;  3ZMS A;  1IW7 F;  2HQN A;  3FXR A;  3IHU A;  4PSX A;  1AKH A;  2PBI A;  2HOT A;  3F8B A;  1LE8 B;  2V9P A;  2CUZ A;  2QBY A;  1H0M A;  1P7I A;  1HKS A;  3GTP J;  2W84 A;  4QSH A;  1ZEL A;  3ABK H;  4GO1 A;  2HXI A;  2M4K A;  3J80 K;  4A0Z A;  3CCL I;  1ZRD A;  4G7H F;  4LFU A;  3F23 A;  4IHX A;  1WI3 A;  1VQ9 I;  4Q47 A;  1QGP A;  5EZH A;  3E0J B;  4IPA A;  4U7B A;  2LOO A;  1PVE A;  2E1M C;  2KDO A;  4N9I A;  4ENJ A;  4QPO A;  1FEX A;  1VQ4 I;  2CSO A;  1YW7 A;  1UG2 A;  2XKP A;  1CGP A;  4HV5 A;  4FAS D;  1R1U A;  3CES A;  2EZI A;  3NRV A;  1CF7 B;  2UWM A;  4D1Q A;  4U88 A;  3AG1 H;  1ZHF A;  5M5X J;  3O3K A;  3I58 A;  1ZRF A;  4XON A;  1Y39 A;  3RCO A;  2OF7 A;  1I6X A;  2XSJ C;  2KRC A;  1FC3 A;  2L7K A;  3H35 A;  4ANJ A;  4QLC U;  3IH2 A;  3TQN A;  5GAG J;  2QYO A;  5J4Y A;  1MMG A;  2YSR A;  4E7Z A;  2W57 A;  3MKW B;  3OV8 A;  4NUB A;  3JRC A;  3MKY B;  2CU7 A;  4MHG A;  2A6E F;  2OPT A;  2Y48 A;  4IF4 A;  2PN6 A;  4NDL A;  3ZN1 A;  2DYR H;  3GTK J;  3KCC A;  3CCE I;  5LHI A;  1ZRE A;  4BNC A;  3GTG J;  3HOZ J;  2F4I A;  2ECB A;  2LMD A;  2GIV A;  1NG6 A;  1RI7 A;  5FLX Z;  1Y0U A;  3P9I A;  3H9G A;  4RB3 C;  2M7B A;  1VQ5 I;  1LE8 A;  1PUF A;  4FE4 A;  1MIJ A;  5FRM A;  3R61 A;  1LB2 A;  1EA3 A;  5AIQ A;  2JPC A;  2JSP A;  2Q8K A;  5D5X B;  1ZRC A;  3E5U A;  4ZZD A;  2WY8 Q;  1A6Q A;  1MJ9 A;  2F5E A;  4YEL A;  2DT5 A;  3HRU A;  3DPL C;  5BS6 A;  4AUX A;  2O61 A;  2A05 A;  4YRV A;  1LFB A;  2HXO A;  4QWQ A;  4ENM A;  1XMX A;  3CTA A;  4E7H A;  3CJN A;  3I4P A;  2WY7 Q;  5JVG F;  3LWF A;  2E71 A;  4JX4 A;  2KRF A;  3HHH A;  4MQ9 F;  4EJU A;  1UMQ A;  2HOS A;  2Q2E B;  3DTE A;  1GVJ A;  5CYV A;  5E3O A;  2IT0 A;  3CCS I;  3QOE A;  2ICW G;  2EV5 A;  3CZ6 A;  2WWY A;  4PFO A;  4A3D J;  2NXN B;  3I3L A;  4NQW B;  4U0W A;  3HOS A;  2XC7 A;  1GUU A;  2H6C A;  2RGV A;  2PMZ A;  3IH3 A;  3CLO A;  5CJ9 A;  2GQQ A;  4WXC A;  2OZU A;  3E3V A;  4XLC A;  2Y0M A;  1ETK A;  2NYX A;  1FIA A;  2EK5 A;  1KU9 A;  2H94 A;  2M2E A;  2CFX A;  3HM5 A;  1XTA A;  4UY8 I;  1JUS A;  2LVS A;  4QIW N;  3IUO A;  1X1P A;  2V26 A;  3UNG C;  3OWT A;  3P9C A;  1WSU A;  3IKV A;  2YX4 A;  5JI6 A;  2ME0 A;  2RKH A;  3ABL H;  3K4L A;  3S3O A;  2WA0 A;  1IUF A;  2PJR B;  3OYG A;  5IT3 A;  1DU0 A;  1X19 A;  4AVP A;  2YUS A;  2HEO A;  4L18 B;  3DFG A;  1R4N B;  2DT6 A;  3S2H J;  4LK0 F;  4IHS A;  1U8R A;  1DPR A;  4S04 A;  5C44 J;  5D5W B;  2QLZ A;  3JSP A;  2KZV A;  3ABU A;  4EM1 A;  2EBI A;  3DKW A;  1K6O A;  1JTY A;  5DTD A;  1YIO A;  2VQL A;  4BAC A;  1U9N A;  3C3W A;  2MBF A;  1YJW I;  4A2U A;  3VEP A;  2DFE A;  3B6C A;  1ZQ3 P;  1MMA A;  3FXO A;  3CCR I;  4BBR J;  3ZQH A;  3QYB A;  1OCP A;  4IL6 C;  5E3N A;  5KAI C;  3WU2 C;  3CMA I;  2BE5 F;  1UG0 A;  4BJ5 C;  5HLI A;  4D5C A;  2NVT J;  4DQ2 A;  5J8F A;  4W97 A;  4XLP F;  3H5N A;  1X3U A;  3FM3 A;  5LEK A;  1TWC J;  3HZJ A;  3OIQ A;  4DYR A;  1GHC A;  5J4V A;  2VT3 A;  2DBB A;  1JJ6 C;  2F2E A;  4B1R A;  3G71 I;  3DBR B;  1NK3 P;  3TGN A;  4XQF A;  5FD6 A;  3VYR B;  2XAF A;  2ZJ2 A;  1K7A A;  1MH4 A;  2ZCW A;  2XRO A;  4OIQ F;  3BPV A;  3LQR A;  2G7U A;  3MMY B;  1PJR A;  4EEF G;  4PFP A;  1FPQ A;  2BY0 A;  3U1D A;  4DW6 A;  2P5L C;  1JKQ C;  3F9K A;  1NTC A;  3ZN0 A;  4MEX F;  3M8E A;  1L0O C;  3TW7 A;  1Z91 A;  4V2G A;  1SAU A;  1G59 A;  4BXU A;  4B3X A;  1HDD C;  2Y0S N;  3WHC A;  3MZ8 A;  4C3J J;  1QO0 D;  4IOC F;  5JHU A;  4I09 A;  3VFZ A;  1UEL B;  5E20 A;  4BQO A;  1FX7 A;  4XMY A;  3GFL A;  3WTZ A;  5J1Y A;  4BJT A;  3OYE A;  2BXY A;  4ZYH A;  2VBZ A;  2ZB9 A;  2W1O A;  3QU3 A;  4F92 B;  3G4S I;  1IN5 A;  1V54 H;  2AXT C;  4EJV A;  2KIS A;  2QBY B;  3L09 A;  1K4S A;  3CME I;  4DZJ A;  5KHD A;  5HS8 A;  1XN7 A;  3IV5 A;  2R7F A;  1SFX A;  2B9S A;  2ZFW A;  1RNL A;  4LIU A;  3E6B A;  3NWS A;  3HOV J;  4CCO A;  2O3F A;  2WAF A;  3I5U A;  3PSF A;  4LB6 B;  3IAS 2;  4BXF A;  2LG4 A;  2Q1Z B;  3DBL B;  4OIO F;  2XPV A;  1G3T A;  2D45 A;  1DDN A;  2B0L A;  3HYI A;  3P9K A;  2TRT A;  1VQ7 I;  2EIL H;  3D5R C;  3VSL A;  1ETQ A;  5A2Q Z;  1N25 A;  4NC7 A;  3HRT A;  2BOL A;  2VXZ A;  2EA4 A;  2X9D A;  1SEU A;  1TP4 A;  3DKY A;  1X3Z B;  3CCQ I;  1R22 A;  1WJB A;  3PUF A;  3S1N J;  3I59 B;  3KP5 A;  2RNJ A;  3E7L A;  1YRN A;  5HLT A;  1VF9 A;  2W24 A;  3RPU A;  3S8P A;  2VLA A;  4KNY A;  2L4M A;  3GME A;  4PJM A;  1X4O A;  2HYJ A;  3WG9 A;  4RMN A;  1HA8 A;  2G7H A;  5E17 F;  4PZJ A;  1Q1H A;  3HSE A;  2QEN A;  3CO6 C;  1QBJ A;  3DEE A;  2R5Y B;  1YIJ I;  4GCV A;  2CRG A;  3CQZ J;  5IT9 Z;  4P55 A;  3LSK A;  1YJN I;  3ZXS A;  1BR2 A;  3CDI A;  1T0F A;  3LAP A;  4CCJ A;  2X6W A;  4ABZ A;  2MH2 A;  1HKQ A;  3FHZ A;  5HDG A;  3WU1 B;  3WTW C;  1ZKG A;  1YW9 A;  5ERI A;  1NHA A;  3DV8 A;  3OOU A;  5FKL A;  5JLX A;  5DEQ A;  3OOP A;  1BC8 C;  3K4N A;  2ZXI A;  4M73 A;  4AVZ A;  4XRM A;  2EFW A;  2VJ4 A;  1IZ1 A;  2OJE D;  3ABM H;  4A3M J;  1E0E A;  1C0W A;  4M71 A;  2KDZ A;  2HKO A;  5L3G A;  1KA8 A;  1X1C A;  3BZC A;  2K02 A;  3C18 A;  2R7S A;  2IS6 A;  1YQA A;  2V1X A;  3H5A A;  4AM3 A;  1N78 A;  2EV0 A;  3WTS C;  1LUJ B;  2ZSI B;  2K9Q A;  4L9V A;  4NBQ A;  1YJ9 I;  1SD5 A;  1N77 A;  3CC7 I;  5F08 A;  4Y52 J;  3J81 K;  1T6S A;  2DOA A;  4JP0 A;  5JFR A;  2Y2Z A;  5JR3 A;  1UB9 A;  3GTM J;  3O8G A;  4IZZ A;  1VI0 A;  4WK8 F;  2UUZ A;  1AWC A;  3OMY A;  4V2F A;  1IXS B;  2M34 A;  1JKP C;  1BOA A;  5TJJ A;  3PO2 J;  2QSG X;  4RBO A;  3F6O A;  4KT6 A;  2XGD A;  1WHU A;  1I6H J;  4A3C J;  3R6S A;  3OS0 A;  5IY5 H;  5J1U A;  3K69 A;  4D7M A;  3BOQ A;  2IXS A;  4P5O A;  2W25 A;  5EF6 A;  3J80 Z;  1HQC A;  4KN7 X;  1Y8Q B;  2LY9 A;  2NNN A;  2MSY A;  4HYE A;  3A01 B;  1ZG1 A;  1F5T A;  3GTQ J;  1JUM A;  3TBI A;  2MFZ A;  1YOV B;  1SMY F;  2RQP A;  3MAJ A;  1PDN C;  3RQ4 A;  4GYI A;  1PP7 U;  3T8R A;  3GF2 A;  3CLQ A;  3KEQ A;  1LDD A;  1ZGJ A;  3MQ0 A;  4EJW A;  1OMI A;  2P81 A;  1R49 A;  4JQF A;  2PMU A;  5H2F C;  2BXZ A;  3K4B A;  1ODD A;  5BPD A;  3S14 J;  4II3 A;  3PO3 J;  3HKZ A;  5D6E A;  1IRG A;  1D3Y A;  1IXR C;  4LG0 A;  3AFH A;  1KU7 A;  4N4O B;  2DOD A;  3AL0 B;  5FLX K;  4DOZ A;  2YS9 A;  1O3Q A;  2ISZ A;  2M7A A;  2E2I J;  3D0S A;  1EH8 A;  3JR9 A;  3SYT A;  2GWR A;  3WGH A;  3ELK A;  4MO7 A;  2ADU A;  2EB7 A;  2HWV A;  1RPW A;  1JGG A;  4N0B A;  1H89 C;  3C1D A;  3ULQ B;  1ZK8 A;  1S6L A;  3TW6 A;  4CZC A;  4UHT A;  1IC8 A;  3G3Z A;  3WTY C;  3ERE D;  2P5V A;  2XAQ A;  4RGS A;  1Z21 A;  2LKS A;  4C30 A;  1TW2 A;  2FRH A;  3MEX A;  3RYR A;  1DPU A;  3E6C C;  2FMY A;  2BY1 A;  4A3K J;  2D5V A;  4CGZ A;  5M5Y J;  3BG5 A;  4MFD A;  2EIN H;  1BJZ A;  3SHF A;  4BS9 A;  1XMK A;  2OU2 A;  1HDP A;  2M1B A;  1R1T A;  4O6J A;  2Z3Y A;  1ZR4 A;  3ASO H;  4M3G A;  4XRS A;  2CUJ A;  2ESN A;  3FXU A;  3BTJ A;  2XUB A;  1WVR A;  3PIP F;  2NVQ J;  3SZG A;  1FYL A;  3KP2 A;  5TGT A;  3H3Z A;  1U5T B;  1WH7 A;  2OUM A;  4EAT A; 
#chains in the Genus database with same CATH homology
 2HDD A;  1AKH A;  2Y31 A;  5F0C A;  5EZG A;  2E2H J;  2HOT A;  1G2H A;  1LE8 B;  1X58 A;  1P7I A;  3BT9 A;  3GTP J;  4QSH A;  2WAQ N;  2NS7 A;  2JA8 J;  4XK4 A;  2EZK A;  2HXI A;  2HOA A;  2JA6 J;  3LSG A;  4QTR A;  2L0K A;  4IHX A;  1WI3 A;  3ZOB A;  1MH3 A;  3NAU A;  3O8H A;  2O9L A;  3HEF A;  5EZH A;  3QPL A;  3D1N I;  3BG3 A;  5FLV A;  1GV2 A;  3WHB A;  1WH5 A;  1FEX A;  2WV1 A;  2MW8 A;  3RQI A;  1UG2 A;  1JT6 A;  2EZI A;  2DA6 A;  2COB A;  3GTO J;  3H3V K;  4W1U A;  5M5X J;  1ZR2 A;  4UUS B;  3HGY A;  2L7M P;  4DZP A;  2OF7 A;  2JK3 A;  3CDL A;  3FK6 A;  2HQ5 A;  1EF4 A;  1ETO A;  4JX6 A;  1S7E A;  3IH2 A;  3HGG A;  1JUP A;  3JRC A;  3ZQF A;  3ZQL A;  2CU7 A;  4FE7 A;  4GFB A;  2OPT A;  3OIO A;  3H0G J;  4D5F A;  1RET A;  2R92 J;  4NDL A;  4MLO A;  3RKQ A;  1FJL A;  2GM4 A;  3GTK J;  3I4M J;  4Y7N J;  4FIS A;  2HI3 A;  3LNQ A;  4IHV A;  3GTG J;  3HOZ J;  3BR6 A;  3JRG A;  2ECB A;  4BY1 J;  2LFB A;  5JLW A;  5FKM A;  4A3J J;  1LE8 A;  2NOG A;  1PUF A;  2DA2 A;  4FE4 A;  2QF7 A;  3BR1 A;  5GPC A;  1X2M A;  2EH3 A;  5GPA A;  1GV5 A;  4UUS A;  4DYQ A;  2B63 J;  2LD5 A;  5F04 A;  2L7Z A;  3BR2 A;  3HOW J;  4C3H J;  2DMU A;  2LKX A;  3IH4 A;  1HLV A;  4AUX A;  4M3D A;  3FKI J;  2CQQ A;  1A5J A;  1Y1V J;  5F1J A;  4MIM A;  2XPU A;  1LFB A;  2HXO A;  2XPW A;  3BTC A;  2NS8 A;  3ZQI A;  2FQ4 A;  2CUF A;  2FJ1 A;  3MVP A;  4JX4 A;  1UMQ A;  3G1O A;  2HOS A;  2E19 A;  1XG1 A;  2GBY A;  5E3O A;  1B8I A;  2IAI A;  4A3D J;  1UHS A;  2IEK A;  1NK2 P;  1A6I A;  2E2J J;  3JRH A;  2VPR A;  5IP7 J;  2R0Q C;  1Z0X A;  1GUU A;  4DYC A;  5C4X J;  5K7H A;  1TWG J;  3IH3 A;  1JTX A;  4J19 A;  1MSF C;  4BXX J;  1MBG A;  1ETK A;  1FIA A;  2M2E A;  2VI6 A;  1GDT A;  3HM5 A;  3SFI A;  3RZO J;  2CQX A;  1JUS A;  2LVS A;  4QIW N;  1VND A;  4I6Z A;  1HF0 A;  3Q0U A;  1ETV A;  1RES A;  2FX0 A;  5FKK A;  2ME0 A;  2L9R A;  1CQT A;  5M5W J;  3A02 A;  2RAE A;  1IUF A;  2JA5 J;  4A3L J;  3W6V A;  1DU0 A;  5IOY A;  2NVX J;  3BG9 A;  4XIC A;  2YUS A;  3S1R J;  5FLM J;  5C3E J;  4A3B J;  3S2H J;  1IDY A;  3C2B A;  9ANT A;  2XSD C;  1P7J A;  5C44 J;  2EBI A;  1JTY A;  5DTD A;  4B3A A;  3UKG A;  2DN0 A;  2K9N A;  1U9N A;  1MBH A;  2JN6 A;  2N8G A;  2LLK A;  5EG0 B;  1U78 A;  3G1L A;  1BL0 A;  2K9S A;  2JJ7 A;  2JWT A;  1I3Q J;  4C2M J;  1I50 J;  3B6C A;  1ZQ3 P;  4BBR J;  3HOU J;  4M6V A;  3ZQH A;  1OJL A;  2DA7 A;  5E3N A;  1OCP A;  3LSP A;  4G12 A;  4C3I J;  5IYD J;  4D5C A;  2NVT J;  2R5Z A;  4S0H B;  4W97 A;  3DCF A;  3HOX J;  5J3L A;  5HOD A;  3TED A;  1TWC J;  2XB5 A;  4DYR A;  2M9H A;  1TWH J;  3JRI A;  4AYB N;  1JJ6 C;  4B1R A;  1WCM J;  4IEJ A;  1RKT A;  3CMY A;  2G0E A;  5K7F A;  3S2D J;  1NK3 P;  1F36 A;  4AC0 A;  1MSE C;  3A01 A;  4X6A J;  3M4O J;  1Y1W J;  3S15 J;  1TWF J;  4XID A;  3TP3 A;  1MH4 A;  2ME6 A;  5J1R A;  5DS9 A;  2XGE A;  2O8K A;  2LP0 A;  3S1Q J;  4EEF G;  4DW6 A;  4CYC A;  1JKQ C;  1BW5 A;  1NTC A;  1RR7 A;  1ETW A;  3TW7 A;  2QCO A;  4V2G A;  5FKN A;  1HDD C;  2Y0S N;  3WHC A;  4A3F J;  4C3J J;  4CYC B;  1GVD A;  2L7F P;  1B8I B;  2TCT A;  1MBE A;  4RDU A;  1QPI A;  5GP9 A;  4UUT A;  3G1M A;  1QVU A;  1APL C;  5J1Y A;  2DJN A;  3TP0 A;  2AHQ A;  1POG A;  4B4C A;  5EGO A;  2ZB9 A;  1XS9 A;  2I10 A;  2DMP A;  3OSG A;  1IDZ A;  3QPS A;  2VKE A;  1OFC X;  1FIP A;  1Z77 A;  4DZJ A;  3LSR A;  2XGC A;  3IV5 A;  1SAN A;  3Q0W A;  1MBK A;  2KT0 A;  2R5Z B;  3HOV J;  1QRY A;  1LFU P;  4A69 C;  1B72 A;  1OCT C;  2XPV A;  2X48 A;  2AO9 A;  3GTL J;  2M8G X;  2TRT A;  1MBF A;  1ETY A;  2EZL A;  1BA5 A;  2PMZ N;  1ETQ A;  3B6A A;  3ZQG A;  1WPK A;  1O4X A;  2M0C A;  4XRS G;  2X9D A;  2DA4 A;  1ZGW A;  3Q3S A;  2Y9Y A;  3S1N J;  5IYC J;  1DU6 A;  5K7Z A;  1U8B A;  1AHD P;  2YU9 J;  2VUM J;  3E7L A;  5M3M J;  1YRN A;  2R7Z J;  1VF9 A;  3S1M J;  1ZTR A;  2X6O A;  3F0C A;  5FJ8 J;  3K2A A;  2HYJ A;  3LSJ A;  2H1K A;  3BTL A;  1IV6 A;  1ORK A;  1T56 A;  1IRZ A;  2R5Y B;  1R9T J;  2LTP A;  2CRG A;  5EDN A;  3CQZ J;  3Q0V A;  1HCR A;  3LOC A;  1WGX A;  2Y30 A;  4MFE A;  1AU7 A;  3RZD J;  2EZH A;  5IP9 J;  5FKO A;  4ABZ A;  2EQR A;  2DTZ A;  2W48 A;  2DMT A;  3CCY A;  3A03 A;  1K61 A;  3VPR A;  4M3F A;  1ZKG A;  5EG0 A;  1B72 B;  3PM1 A;  3NAR A;  3OOU A;  5FKL A;  1X2N A;  5JLX A;  4BBS J;  3JRA A;  1VFC A;  4XRM A;  2MGQ A;  4L5E A;  5IP6 A;  3BQZ A;  4I76 A;  3JRD A;  4A3M J;  2LK2 A;  2KDZ A;  2E1O A;  1TC3 C;  1SFO J;  1JKO C;  2ID3 A;  2DA5 A;  1IG7 A;  4A93 J;  3JRF A;  5EGO B;  3S16 J;  3L1P A;  2ECC A;  2K9Q A;  1D5Y A;  2NVY J;  3BQY A;  1IGN A;  5F08 A;  4Y52 J;  2VKV A;  1BW6 A;  4JP0 A;  2Y2Z A;  4X1E A;  1T33 A;  3GTM J;  3O8G A;  3BR3 A;  1VI0 A;  1K83 J;  1U9O A;  4A3E J;  2CUE A;  4V2F A;  5M3F J;  2DMQ A;  3JRB A;  2M34 A;  4M3E A;  1JKP C;  5BNG A;  1MNM C;  1FTZ A;  3PO2 J;  1ENH A;  2ELK A;  3FK7 A;  4RBO A;  2XGD A;  5F0F A;  1I6H J;  4A3C J;  1JT0 A;  3DEW A;  1Q1V A;  1GT0 C;  5J1U A;  4D7M A;  2R5Y A;  4LOC A;  2R93 J;  2O7O A;  1HOM A;  5EF6 A;  2ID6 A;  3HBL A;  1TWA J;  2LY9 A;  4JYK A;  4HNV A;  1IJW C;  2MSY A;  2GLO A;  3A01 B;  3GTQ J;  4A3G J;  3JRE A;  5IPA A;  1JUM A;  3I4N J;  3BR0 A;  2XB0 X;  2P81 A;  3ZQC A;  1W0T A;  3SDG A;  3MKL A;  3S14 J;  3S17 J;  3PO3 J;  1JKR C;  1AKH B;  2DA3 A;  1QVT A;  5F27 A;  1XC5 A;  4IHW A;  1H8A C;  2YS9 A;  1FTT A;  5F0H A;  2E2I J;  2JA7 J;  2Y9Z A;  4M3B A;  2DA1 A;  3JR9 A;  1F43 A;  4MO7 A;  2XRL A;  2K40 A;  3SJM A;  3FIW A;  1RPW A;  1JGG A;  1JJ8 C;  1H89 C;  4FCY A;  1E3O C;  5E3L A;  1ZK8 A;  3TW6 A;  3BR5 A;  3FIS A;  1PUF B;  1ITY A;  1IC8 A;  4FTH A;  1W0U A;  3BTI A;  2DMN A;  2JMW A;  4A3I J;  1MBJ A;  5E3M A;  2H8R A;  1RKW A;  4A3K J;  2WB1 N;  2D5V A;  3QQA A;  3GTJ J;  3HKZ N;  5M5Y J;  3BG5 A;  4MFD A;  1YRN B;  1BJZ A;  3HOY J;  1HDP A;  4BKX A;  1ETX A;  2LR8 A;  2MG4 A;  5IYB J;  3OSF A;  3HB9 A;  1ZR4 A;  4JX5 A;  3MN2 A;  4M3G A;  4XRS A;  5C4J J;  3M3Y J;  5EEA A;  3BTJ A;  2NVQ J;  1H88 C;  4IHY A;  2CJJ A;  2IBD A;  5IOZ A;  3K7A J;  4BY7 J;  3GBG A;  5EYR A;  4D7N A;  3HDD A;  1WH7 A;  2FD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...