5HS7A

Reduced form of the transcriptional regulator yodb from b. subtilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
102
structure length
102
Chain Sequence
MMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEPGD
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
total genus 34
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs7A00
3ERED 2RC4A 5H20A 1BIAA 2CGPA 2DQRA 3WGIA 4LGWA 4EM2A 2BYVE 5EEGA 3FXQA 3WGGA 2R7FA 2P5KA 1UB9A 2OQRA 3FMQA 5DCMA 1TW2A 3HOSA 2IT0A 1IUYA 1P4XA 2V1DA 5J8CA 3F6OA 1F1ZA 1Z6RA 4GYGA 3LSTA 5BPDA 5D6EA 3KP7A 3T1BA 4HF2A 1H9TA 4EJTA 3BWGA 2GZWA 4HLXA 4ZH4F 1V3FA 3LA7A 1O7FA 1IRFA 3F8BA 5D5VB 3E6CC 2K27A 1Z05A 1H0MA 1RUOA 4LB6B 4ENJA 5LEJA 3V7CA 1RNLA 3WTTC 3GF2A 2QBYA 4ETSA 2VBZA 1XDUA 2HKXA 2DK8A 2K86A 3RPQA 4KN7X 2H27A 4XRFA 5E1ZB 5A2QZ 4HLYA 3M9AA 3KEOA 2X4HA 1FSEA 5KK1A 1I1GA 1O3SA 2EFQA 3R0JA 1AWCA 2PEXA 4Q48A 1ZH5A 5F64A 1QZYA 2P7VB 1USSA 4ENNA 4I0BA 4DNCA 3FMRA 2RQPA 3F8MA 3S2WA 2EK5A 4LLGF 2QENA 5BS6A 2OU2A 2YX4A 1WI9A 1SD7A 2R3SA 3RYPA 2O61A 1FLIA 1B9MA 3K0LA 3KP3A 2FBIA 3D5LA 3MWMA 2DLLA 3R60A 2W24A 2PMUA 3HRMA 3NEUA 3GLXA 4IF4A 5EEHA 4LLNA 3E5XA 4OIQF 3RYRA 4M74A 5HDNA 1O7LA 1G6NA 2VXZA 2QWWA 3C1DA 2EV5A 2RDPA 3FM5A 1XSVA 3QRFF 3F21A 2UXNA 3WTYC 1EH8A 3ECOA 1OYWA 4PGHA 1D5VA 1XCBA 5D5UB 2CSOA 4ZZDA 5FFXA 3LQRA 1Q1HA 2FOKA 3MCZA 3F8CA 2QVOA 1Z6TA 4MTDA 3T8RA 5LGNA 4BHBA 2H6CA 2L3DA 1SAXA 1SD5A 1B4AA 4GCVA 1BI0A 3IRRA 2OAZA 3JAMK 2JZYA 1OKRA 1W5TA 4CO8A 5FB2A 4U88A 3QOPA 5CVRA 3F8FA 1S8NA 1XN7A 1FX7A 2FNPA 1MKMA 4N9HA 3C3WA 4PDKA 1IXSB 3TO6A 3E3VA 3RI4A 2COMA 4UVCA 1ZHFA 4MNUA 4XSZF 4IVNA 2QM3A 3JTGA 3DXJF 5IT9K 2ZXJA 3O3KA 3N4MA 1TW3A 5BMZA 4RAYA 1CF7B 3QP6A 1SFXA 1S7OA 2GA1A 3LA2A 2NRAC 3TGNA 4AVPA 2KRFA 4L0YB 3KP6A 3HYIA 3V8KA 3WE2A 3WTVC 3SHFA 1HKQA 1KU9A 2VBXA 3QPHA 4JK1X 2FE3A 2CG4A 2Y75A 1IN4A 2A3SA 2JPCA 3REOA 5D4SA 5J8FA 2A6EF 2HTJA 2MH2A 3I58A 1WRJA 2IRFG 3DV8A 1E2XA 1MD0A 4L5JA 4KFCA 3DP7A 3FXRA 2K4JA 5AIPA 2W85A 1U5TB 3LWFA 4U0WA 5E1WA 4UVBA 3M7GA 2AS5F 4RGXA 4HYEA 5L3EA 4L9NA 1U78A 2DW4A 5LGTA 2VT2A 1ZG3A 5D6FA 3WG9A 1B6AA 3FF5A 1GHCA 4ON0A 2MA3A 3P9IA 2ZMEB 2PI0A 2OZUA 1HW1A 2DFIA 5H6RA 3TOAA 2ACJA 2F2EA 4EQQA 2DAOA 1QGPA 2M8EA 2M1BA 4XSXF 5D5WB 1F5TA 5K5OA 3JSPA 3KCCA 4EJWA 3EETA 1UCRA 1ON1A 5AIQA 4ZYDA 1CGPA 3K1MA 1T2KA 4OINF 3OV8A 2CW0F 2CO5A 4I09A 4IPAA 4MGRA 3VEPA 4BAYA 1QBJA 3IRQA 2LNBA 4WK8F 3NRVA 3LAPA 2VODA 4IJAA 1PDNC 5DUKA 4DQ2A 4FX4A 4HBLA 2QYOA 5IT3A 1K78A 3I59A 1LVAA 3EQLF 3J81K 3GW2A 1FSHA 1UHWA 5ILSA 4HV6A 4IXAA 2WWYA 3HTUA 1U2WA 2JSCA 2XAGA 4A0ZA 2MBFA 2FMYA 2OD5A 4JBAA 4WXDA 2XAJA 1RIOH 4HF1A 2GWRA 3E6MA 2K7LA 4EJOA 5HDKA 2KKOA 3VOEA 2E7XA 3CUQC 3R0AA 1PUEE 4HV5A 3B73A 4LK1F 3IC7A 3LFKA 2HR3A 4A2UA 1ZG1A 1XGMA 2IVMA 5HS7A 2HS5A 3WTWC 1USTA 2KIUA 1LDJA 1R1UA 1ZLKA 4IRHA 1S7AA 2GAUA 5ILUA 2QLZA 2YU3A 5DV5A 2V1XA 4ASNA 3GUDA 4GYIA 2A68F 3CUQA 2HKOA 3D0SA 4HA8A 2PQ8A 1U8RA 4O3MA 3ZMSA 3TQNA 1REPC 2DPUA 4M72A 2HYGD 2WV0A 3EYIA 1U3EM 2Q8KA 1SD6A 1KGSA 4B09A 4KYWA 4L9TA 1R36A 1D8JA 4FT8A 1T6SA 2X0LA 5HLIA 3MFKA 5HLGA 4U0VA 3COAC 3GX4X 2VOPA 5DYMA 1ZRFA 2RN7A 4XBFA 5TJJA 2OZ6A 2PFBA 4L9JA 4OIOF 4H0EA 3DKWA 2XKPA 1VTNC 3BJOA 4WX9A 3WTUC 4Z2YA 5ICGA 4D0PA 2UXXA 4L0ZB 1DDNA 3H3UA 2BGCA 1DPUA 1LNWA 1HSTA 1MZBA 3FXUA 1W7PB 3QAHA 2DI3A 4BHPA 3R4KA 3BOQA 3K69A 1UFMA 4UHTA 1JHFA 3NQOA 1P2FA 3PQKA 2Z33A 4LK0F 1IF1A 3HSFA 3ISPA 1OYYA 1ZN2A 4EM1A 5AONA 4HF0A 3RIRA 2V79A 1SFEA 3BROA 4GO1A 2ETHA 1R5HA 2VE8A 5D5XB 2H94A 5HLHA 5E1XA 5DD4A 1IN7A 1STZA 3R6SA 2RNJA 1EH6A 3ZN1A 2ZO4A 1K79A 2ZBKA 3KP5A 2F5DA 3IKTA 4YFKF 2DO7A 2A61A 2EFOA 5F6FA 1O3QA 5CYVA 3RPUA 4IHTA 2P5VA 3WTSC 2L02A 3V8JA 4ZYEA 2FBHA 4WXHA 2GXGA 3L7WA 2V6CA 2MH9A 2G9WA 4A5MA 2PJPA 2QZ8A 1AOYA 4EJUA 4R79A 3KLNA 3RTRA 4UV8A 3IL2A 4OMYA 1XMAA 1FT9A 2FSWA 2BV6A 1S29A 2H6BA 3J80Z 2IA1A 5FFZA 1LEBA 4RB1A 3M8EA 4KDPA 5LGUA 4G7HF 4A0YA 5JI6A 2HTSA 4ESJA 3VODA 4HZFA 1ZYRF 1FBUA 1YG2A 2Y0MA 3M1EA 1O57A 4QWQA 4S04A 2E1NA 2VONA 1YW7A 2E7WA 3LAJA 2FEZA 3HIFA 4ZYGA 1XSDA 4WCGA 3GYHX 1KA8A 4N9IA 4I01A 1WWXA 4KMUX 1KYZA 3Q9SA 1R22A 2VN2A 1MJ9A 3R61A 1QO0D 2HQRA 1TQMA 1SMTA 5CVIA 4LG0B 4EM0B 1FPQA 3K9TA 3ZMTA 3CO7C 2XAQA 1LJ9A 2ZJ2A 4LLLA 1MDMB 2L4AA 6PAXA 2KIFA 5LRRA 4U0YA 3T5XA 4HDVA 4M9XA 3V7RA 3ABTA 2IA0A 5D8LB 2FMLA 3RKWA 2HFHA 3L09A 4KIBA 1E17A 3O2PE 3V8LA 1L3LA 2L01A 2M45A 2DQLA 1RUNA 1ULYA 2M30A 1I1SA 4MHGA 2XAFA 3HHHA 4BNCA 3ZPLA 1B9NA 3P9CA 1IW7F 3GZ5A 3E97A 2Q2EA 3PFIA 3WTXC 4CICA 4OMZA 1LDDA 4HDUA 4YG2F 4ENMA 4Y15A 3W6JB 4IHSA 1FBQA 3SXYA 3AAFA 2KJCA 2EFNA 1YS7A 2FF4A 2Z3YA 1BJAA 2P4WA 4RGUA 1B59A 2CWEA 3ECHA 4KA4A 2NS0A 4EV0A 2P6TA 5LRSA 2A5YB 4HX8A 2IPQX 4R8HA 2O3FA 2MD5A 1D3YA 4MQVA 3CUOA 2P7CB 1P6RA 3U1DA 5LHHA 3H3ZA 1G3YA 1XB4A 1GXQA 1R7JA 4E70A 2PLYA 4P9UA 3MZYA 2RGVA 3L9FA 1YS6A 5D8KB 4M6XA 2ADUA 3GFMA 4CXFA 5CVJA 2JRTA 2VC0A 2PG4A 4PZJA 1LDKB 2ZFWA 3GXOA 3O6BB 3U9GA 1P4AA 5BQTA 3IKVA 3KFWX 1I5ZA 2ZKZA 3BPXA 3RJPA 2STTA 3I54A 2VC1A 3K2ZA 3ULQB 2XV4S 2DK5A 1YIOA 1QNTA 4WF2A 4Y17A 2D45A 4B8XA 4A0XA 2D1HA 2QQ9A 2K4BA 1W5SA 3JTHA 1IZ1A 3ELKA 2LF8A 3HRSA 3RDIA 2XVCA 4NB5A 2XROA 5K5RA 5DUIA 3DEUA 3ZMZA 2ZNYA 2EA4A 1HBXG 1SD4A 2LSOA 3BZ6A 3N97A 2D2WA 4RB2C 1G3TA 4Q4ZF 1J2XA 5JHUA 4KIFA 2QQBA 2OBPA 5DCMB 4EGZA 1IN5A 3T0YA 1QPMA 3ABUA 4HW0A 5IT9Z 5HOOA 2HZTA 3KP2A 2LF7A 5FLXZ 2XIGA 4OOIA 2Y48A 5ED4A 5K1YA 1W4MA 3G3ZA 3TKYA 1HKSA 3M8FA 2VBWA 4UNOA 5LBQA 2QQAA 4UUVA 3GVAA 1ZRCA 3WU0A 1ZGAA 3V4GA 3GO5A 5E8GA 1K7AA 4ESBA 2ELHA 2ZCWA 4P96A 4HX4A 3TO7A 4A6DA 3KETA 1YW8A 2QBYB 1J7KA 1NHAA 2RVCA 3F22A 2PMHA 1OPCA 3WE3A 3F72A 4CGZA 2FNAA 3ZQ7A 4P5OA 1IN6A 1R23A 2G7HA 2FRHA 3HUGA 4RS8A 4Y13A 2PBIA 4KMFA 4OIPF 2F5FA 1X3UA 3I0TA 4P55A 3DPTA 2JTVA 1FWZA 2PN6A 2HYFA 2L54A 2F5CA 2UZKA 1ZLJA 4FX0A 4WXCA 3E6BA 2Z9OA 1WKMA 1DP7P 5CVUA 1KU3A 1ONVA 1G3WA 1Z9CA 2LKPA 4KICA 4G6QA 4GXOA 4EMSA 3EUHA 3KE2A 1YQAA 4P9FA 5HVQC 1R5GA 2M87A 4JQFA 1CF7A 4YFNF 1UHMA 3V7SA 2H09A 4M6YA 1KYWA 2ESNA 1BI1A 2EV6A 2WC2A 4L18B 1KQ0A 1XDSA 2IW5A 4U7BA 2OQGA 2Z99A 4M73A 1FYLA 4Q5SF 2EJRA 5CLSA 2BEOA 3FWEA 1T98A 1QZZA 1JHHA 2KJBA 3E5QA 3WGHA 3B02A 4CZZA 1U5TC 4GGGA 1Z91A 3QU6A 5FO5A 3I53A 1MJBA 4HQMA 4RB0A 2P6SA 4LJZF 4G9YA 4MTEA 2HOEA 3QP5A 1Z7UA 1H9GA 3G73A 3J81Z 3GZ6A 1U5TA 1ZGJA 2GXBA 5A2QK 1ON2A 1HQCA 1TNTA 1LQ1A 4UV9A 2STWA 3DFGA 3P9KA 3CTAA 1BIBA 2W25A 3GWZA 4ZYHA 3BDDA 1SMYF 1RI7A 1J9IA 3CO6C 4BH9A 1FYKA 1J5YA 3J80K 4KNYA 2VBYA 3JSOA 2ZMEA 4R1HA 5DEQA 1ZAOA 3JW4A 3VFZA 1YTYA 4WWCA 3SFZA 4I2OA 4OIRF 2Z5UA 1F4KA 3F6VA 3T8TA 2MLKA 3IWFA 1KQ8A 5BOXA 2LDUA 4K2EA 1WSUA 3H92A 4UXNA 2YSRA 2B0LA 2A6HF 2J5PA 3RKXA 1BI3A 3ZMUA 3HRTA 3FZVA 3OOPA 4MQ9F 2K02A 2XGXA 3SQNA 2JPBA 3TDZC 2GA2A 3HOTA 1BC7C 2P8TA 2EB7A 4L9VA 3ROUA 1KU7A 4NQWA 3WU1B 5TRDA 4RB3C 2XKOA 1SFUA 2NAZA 2HGCA 4KN4X 3PQJA 2XRNA 5ILVA 3ZP5A 4I98B 1V4RA 1S3JA 1R1TA 3P7NA 3TDUC 3KLOA 5L3GA 2TDXA 2QUFA 4F7ZA 2D1VA 1XSXA 4BYYA 2G7UA 1LB2A 1FP1D 2FQ3A 3BPVA 2GQQA 2DPDA 1FYMA 1KU2A 3ZMVA 1GVJA 1HKTA 3C18A 5HS8A 2ISYA 1O3RA 3HTSB 4KT5C 2XUBA 2RV8A 3I4PA 5D4RA 1YYVA 4ESFA 1XCVA 2FU4A 1T0FA 3DPLC 1TTYA 2FA5A 5ICCA 1HW2A 3E6DA 3FMSA 3LA3A 2FXAA 1YLFA 1HSJA 2BBYA 1DUXC 1QQIA 1FP2A 1FNNA 3U2RA 4EJVA 2DBBA 3RKYA 1KQ9A 5ICEA 4L5IA 2XAHA 1TQIA 1MGTA 1GXPA 3MZHA 1BN5A 2KIMA 2HQNA 1G3SA 1YO5C 2MLGA 2ZNZA 1P92A 4BHCA 4TV7A 5CVVA 2IA2A 4A6EA 3IHUA 2XHKA 5H6QA 1JXSA 5LEKA 2Q0OA 3VB2A 3EDPA 2FBKA 1J0RA 2W84A 3WTZA 1K78B 2EWNA 3HRUA 1RZ4A 3I59B 3GFLA 4M9SA 2GIVA 3KP4A 1J75A 2NYXA 5CJ9A 2XASA 1Z1DA 3CDHA 2R7DA 4AWXB 4AIHA 4NHJA 4EVIA 2W57A 1JE8A 1BBYA 4RAZA 4ENKA 5E18F 1W7PA 3HSRA 2A07F 3MQ0A 3K1NA 1IXCA 1ZG5A 4BQAA 1TQPA 3I71A 5FD6A 2EA2A 3FM3A 3F8NA 4Q47A 2HWVA 4LB5A 3EYYA 3K1PA 2OA4A 1MJAA 2YPRA 2RKHA 1OR7A 2IP2A 1FC3A 2WTEA 3DQVC 1L0OC 4EGYA 3CUQB 1K6OA 4UVAA 4HOBA 4XLPF 2J5OA 4G94A 1R58A 1PP8F 5LHGA 5FLXK 2ISZA 2F5EA 1FZPB 3F23A 5L3BA 4A12A 3KZZA 4YFXF 1Y0UA 1TNSA 2DTRA 1OYIA 5L3DA 3E5UA 4G7ZF 2HDCA 3GFIA 2IJLA 4RGSA 1YW9A 2YX7A 4AIJA 3J7AO 2DU9A 2E1CA 3BP8A 1XGSA 1F9NA 4O6JA 2V9VA 4I0AA 4OU0A 4IRIA 5J6XA 2M5WA 2AXLA 2UWMA 3JAMZ 3MEXA 1IN8A 1YFHA 4FHTA 3BJAA 1EH7A 1R1VA 4HAMA 4CDGA 2HEOA 1T38A 2CYYA 2DT5A 4G8XA 5HS9A 5JVTA 5F1RA 1LEAA 1C0WA 3DF8A 1JGSA 4U7DA 2O8XA 2A69F 1XMKA 1BC8C 1FOKA 3ZN0A 1DPRA 1IXRC 2P5LC 3QU3A 2YR2A 4RGRA 2BE5F 3FX3A 2EFPA 4G7OF 2EV0A 3CJNA 1OMIA 5LHIA 5LLQA 4CYDA 5KVRA 3Q9VA 5E8IA 5L3FA 4I7HA 1PP7U 4LG0A 1ZRDA 4MEXF 1EV7A 5ICFA 3L00A 1W7PD 1ODDA 1T39A 5FD5A 1MDMA 4M9ZA 1A04A 2JT1A 2EFWA 5E20A 3F3XA 5DDGA 4CHUA 2L4MA 1ZARA 4I02A 4G6DA 1TLHB 4M71A 1IAWA 4S05A 3SZTA 3SZPA 5DD8A 4YIFA 4BXUA 1I27A 2O6GE 5L3CA 2CQKA 2VOOA 1D8KA 3TO9A 1O3TA 5JFRA 3HSEA 2O03A 3KEQA 2VE9A 1BOAA 4LFUA 3TOBA 2ESHA 1HXDA 4AD9A 2NNYA 4YIIA 1XD7A 1FY7A 3WODF 4PCQA 1P4WA 4PGGA 1XGNA 4IRGA 1FBSA 5BPIA 1G4DA 5FGMA 3BY6A 4AIKA 4XLNF 5HDGA 3MAJA 3GEZA 2MC3A 4LMYA 1HW5A 4HQEA 1B1BA 3FHZA 5JR3A 2O0YA 5E17F 4KUMA 1S6LA 1BM9A 3C7JA 1R00A 1IRGA 5K5QA 3HHGA 1I6XA 5ERIA 4MEYF 1TBXA 4QLCU 3I5UA 1U6GA 3GFJA 2C6YA 3QPTA 1J59A 4O5VA 2NNNA 2VT3A 3LQQA 3ML6A 4ZZLA 1BI2A 3CLOA 3BJ6A 3I64A 2CFXA 4LD5A 3W6KB 4HX7A 3IWZA 4KIGA 1XGOA 1WQ2A 3Q5FA 3KZYA 5DCFA 4A5NA 3L2CA 1ZREA 4N0BA 2V1UA 3ZMDA
chains in the Genus database with same CATH superfamily
3ERED 2RC4A 2OJED 4HNUA 3GTGJ 5C4JJ 2EZHA 1UMQA 5H20A 4BBSJ 1BIAA 2CGPA 2DQRA 3WGIA 3L2WA 4IKFA 4LGWA 4IHWA 5K7ZA 3I3LA 4EM2A 2BYVE 3BG7A 1FMWA 3L2UA 1VI0A 5EEGA 2K85A 3FXQA 3WGGA 2R7FA 2P5KA 1UB9A 4BKXA 3KYLA 5C44J 2VXDA 2LY1A 3CJRB 2OQRA 3FMQA 5DCMA 1AA7A 2MYSA 4CSWA 1TW2A 3HOSA 3A2KA 2IT0A 1IUYA 1P4XA 2V1DA 3CC2I 4Y3OA 4B47A 4HRIA 2Z2SB 5J8CA 2E34A 4A3IJ 4MIMA 1MSFC 3F6OA 1V55H 1F1ZA 1Z6RA 1OCTC 2VQCA 1FIPA 2K9MA 2Y31A 4GYGA 3LSTA 3CJTB 5BPDA 2XF5A 5D6EA 3KP7A 3T1BA 4HF2A 1H9TA 1B72B 4E7SA 4EJTA 3BWGA 4HEA2 2BZTA 1BJZA 4KJZA 1K83J 2GZWA 2IEKA 2JA6J 1K6YA 4HLXA 4ZH4F 1V3FA 3LA7A 2OCEA 1O7FA 1P7JA 2ZC2A 5GTIC 1IRFA 3F8BA 1YRNA 3OYEA 3K4KA 5D5VB 4CCLA 2L7MP 5KAIC 3E6CC 2E2JJ 2K27A 2R4GA 5CQGA 2LMDA 3TP0A 1Z05A 3K10A 4XN3A 1SEUA 2LLKA 4RDUA 2FUG2 1H0MA 4LB6B 4ENJA 1RUOA 5LEJA 3V7CA 2XGCA 1RNLA 4W1UA 3WTTC 3VYUB 3GF2A 3TMOA 2LBFA 1QA6A 3A0BC 2QBYA 4ETSA 4C2TA 4N4OB 1MBFA 2VBZA 5EZGA 3H9JA 3A4CA 1XDUA 2M7BA 2HKXA 2DK8A 1T0FC 1TWGJ 2CUFA 4NBQA 1WZ2A 2K86A 3S14J 3M3YJ 3RPQA 3CMAI 5F0HA 5J4YA 4KN7X 2EINH 2M4GA 2H27A 5K7HA 4XRFA 5E1ZB 3K4BA 5A2QZ 4HLYA 3M9AA 3KEOA 2X4HA 4A3KJ 4B4CA 1FSEA 3TL4X 2W48A 3V42A 3RZOJ 3PNVA 5KK1A 1I1GA 1O3SA 3CDLA 2EFQA 4DYRA 1SVMA 2E19A 3R0JA 1AWCA 2PEXA 2IGMA 4Q48A 2MW8A 1OLTA 1ZH5A 5F64A 4A3DJ 2NVQJ 1QZYA 2P7VB 2DA3A 1USSA 4ENNA 3B6AA 4I0BA 4DNCA 3FMRA 2RQPA 3F8MA 3S2WA 1SFOJ 4D1QA 2EK5A 3I55I 4LLGF 2QENA 5BS6A 1DU0A 1H88C 5CPRB 1WJAA 3LSJA 5GPAA 2DMTA 3I9V2 2OU2A 1TWAJ 2IBDA 2YX4A 1WI9A 3FDYA 1VQLI 1SD7A 1OISA 2R3SA 2BY0A 3OWTA 3RYPA 3H9QA 2O61A 1FLIA 1X4OA 1B9MA 5DTDA 3K0LA 1JKOC 4FCYA 4GRIA 2L2OA 3ASNH 3BCAA 4NUBA 3S8PA 3KP3A 1I50J 2FBIA 3D5LA 2X51A 3CCUI 3MWMA 3D1NI 4XIDA 2ECBA 3CCRI 2M3AA 1I39A 1DGWY 4IOCF 2DLLA 5B5EC 3R60A 2DMUA 2DT6A 4LIVA 2W24A 4U87A 1TWCJ 2PMUA 3HRMA 2L0KA 3NEUA 3GLXA 4IF4A 3HZJA 5EEHA 4LLNA 3E5XA 3K4LA 4OIQF 3AL0B 3RYRA 4M74A 5HDNA 1O7LA 3NWTA 1G6NA 2VXZA 1N78A 2KZVA 5GADJ 1OCRH 2DYRH 3W2WA 1ZR2A 5E3LA 2QWWA 1X1PA 1ZGWA 1EA3A 2DCEA 3C1DA 1I6HJ 2EV5A 2RDPA 3BG9A 3FBNB 2QKMB 3FM5A 5B1AH 1PUFA 1U9OA 1XSVA 2BOLA 3QRFF 1XG1A 2DTZA 3CLQA 3F21A 2DT7B 1AKHA 1Z3YA 1Q1VA 1WJDA 2UXNA 3WTYC 1EH8A 3ECOA 2W82A 1OYWA 4PGHA 3FIWA 1MNMC 1D5VA 4E7ZA 1XCBA 5D5UB 5J40A 2CSOA 5KHDA 4ZZDA 1UELB 5FFXA 2CUZA 3Q3SA 3LQRA 1Q1HA 2FOKA 3MCZA 3F8CA 2QVOA 1Z6TA 4MTDA 3VYTB 4E7JA 3T8RA 5LGNA 3HUGB 2CQQA 4BHBA 3JRDA 2EIJH 2DMQA 2H6CA 2L3DA 1SAXA 1SD5A 3DLLF 3CCMI 4BE1A 3HXLA 1B4AA 4GCVA 1BI0A 3IRRA 3JRIA 2OAZA 3JAMK 2JZYA 1OKRA 1W5TA 4CO8A 5FB2A 1UZCA 3PUFA 2V7FA 4U88A 3QOPA 2R5YB 5CVRA 3F8FA 4M3GA 1S8NA 3ZOBA 2PJRA 1XN7A 4BL0B 4XQFA 2OC6A 1FX7A 3BTLA 4B44A 1QRYA 2VL8A 2FNPA 3PM1A 1MKMA 4N9HA 4IO9F 3C3WA 2HOAA 4RMNA 4PDKA 3OY9A 1TT5B 1IXSB 3TO6A 3E3VA 3RI4A 2COMA 4UVCA 3CD6I 1X2NA 3E0JB 4HPQA 1ZHFA 2F6CA 5IYBJ 2Z16A 4MNUA 3QODA 3PNYA 2HDDA 3DTEA 4XSZF 3ZQGA 1OCPA 4IVNA 3PJRA 2QM3A 3JTGA 2Y69H 3DXJF 5JHFA 5IT9K 2ZXJA 5KAFC 3O3KA 3O8HA 5GAGJ 3N4MA 1TW3A 5BMZA 4RAYA 1CF7B 2XGDA 3QP6A 1SFXA 1S7OA 1D1CA 2GA1A 3C2BA 3LA2A 5E3NA 2NRAC 4PFPA 1POGA 3TGNA 4JYKA 3JRHA 4AVPA 4ZDLA 2Y2ZA 2COBA 4PJ0C 3TBIA 2KRFA 1A35A 1HC8A 2K9LA 4L0YB 3S16J 3KP6A 3HYIA 3V8KA 2E5ZA 1P9QC 3WE2A 3WTVC 3S2DJ 3SHFA 1LE8B 1HKQA 1KU9A 2VBXA 3QPHA 5B1BH 1GT0C 2M34A 4JK1X 4BQNA 3CESA 2FE3A 2CG4A 2KQRA 2HOTA 1XPXA 2Y75A 1IN4A 2A3SA 2JPCA 2KLOA 3JRBA 4I76A 4A3FJ 3REOA 1ZKGA 5D4SA 2A6EF 5J8FA 2HTJA 2MH2A 5FLVA 1B8IB 4BY7J 2JN6A 2DOFA 3I58A 4A3EJ 1VQ7I 1WRJA 4Y4RA 2IRFG 4BJ5C 3DV8A 1WJFA 1E2XA 1MD0A 4L5JA 5LFAA 2JSPA 3J7ZI 4BXFA 4KFCA 2IGOA 3DP7A 3RKQA 4M6VA 3GTMJ 3FXRA 2K4JA 4CCNA 2BW3A 2EH3A 5AIPA 2W85A 3QWLA 3TW6A 1U5TB 3LWFA 3C2GA 1BR1A 4U0WA 5E1WA 3MVPA 4UVBA 4DOZA 1YIJI 3M7GA 2VUMJ 3OR2C 1BOBA 2AS5F 1OJLA 3B6CA 2JVHA 1W5CC 4LOCA 4RGXA 3ZQFA 1JT6A 4HYEA 2VKDA 5L3EA 1Z3XA 4L9NA 1WCMJ 1U78A 2DW4A 4C3JJ 1VQ9I 2AHQA 1NG7A 5LGTA 2VT2A 1G59A 1U9NA 5IPAA 2GOXB 1ZG3A 5D6FA 3WG9A 3JRAA 3CF5F 5M5WJ 1B6AA 3FF5A 1GLNA 4M3FA 1GHCA 1W36D 4ON0A 4BUPA 4IHXA 2MA3A 2MGQA 3P9IA 4W97A 2ZMEB 4LIUA 2PI0A 2CQ7A 2IS1A 2OZUA 2F5VA 1HW1A 2DFIA 5H6RA 3TOAA 5FROA 2F2EA 4EQQA 2ACJA 2DAOA 2V9KA 1QGPA 1K61A 3H3VK 1ERDA 2M8EA 4BU2A 3K70C 2M1BA 4XSXF 5D5WB 1F5TA 3RCOA 1MMGA 5K5OA 1VQPI 2GM4A 3OYKA 3JSPA 1P7IA 1J09A 3KCCA 4EJWA 3EETA 1UCRA 2L9VA 1ON1A 4F92B 3ABKH 5AIQA 4ZYDA 1CGPA 2EZLA 2VASA 2YS9A 1D5YA 2OTLI 2JRMA 3K1MA 1T2KA 1Z0XA 3S1MJ 4OINF 2CUJA 4A3CJ 1ZELA 1BR4A 5F08A 4DJAA 2M8GX 3OV8A 1MBGA 2CW0F 4XR6A 2NS7A 2CO5A 3O8GA 4NQWB 3HOYJ 4I09A 4QSHA 2LFBA 4IPAA 4MGRA 3VEPA 4BAYA 3BQZA 1YITI 2P81A 4AUXA 3IRQA 1QBJA 1HOMA 2LC2A 1RETA 4RM3A 3VYSB 2LNBA 2WAQA 2XPWA 1RPWA 3SEQA 4WK8F 4ABZA 4E7LA 1UAAA 2ZB9A 2KDOA 3WG7H 1FEXA 5F0FA 2OCCH 3NRVA 1IO2A 3DTKA 4XKCA 3LAPA 2VODA 5K7FA 4IJAA 1PDNC 5DUKA 4DZJA 4DQ2A 2EIKH 2FX0A 3ZCOA 3LSMA 5EGOB 4HBLA 2HU9A 4FX4A 3ERMA 1VQMI 2QYOA 2E36A 5IT3A 1K78A 3I59A 4HSRA 1LVAA 3HL2A 3EQLF 3J81K 3GW2A 1FSHA 1FTZA 3P5JA 2HPIA 1UHWA 5ILSA 1BW6A 4HV6A 1JTXA 4IXAA 4C9YA 2WWYA 1WGXA 3HBLA 3HTUA 4UUSB 1U2WA 5J1UA 3IH3A 2JSCA 3OYNA 3HG9A 2XAGA 4DGWB 2P0WA 4L5EA 4A0ZA 1VF9A 4OAYA 2MBFA 4CCMA 2FMYA 2OD5A 2X1CA 2JQ7A 4JBAA 4WXDA 2XAJA 3JRFA 1RIOH 4HF1A 2GWRA 1F43A 4NDLA 3E6MA 2K7LA 4EJOA 5HDKA 1DGRM 2KKOA 2W4SA 3VOEA 2E7XA 3CUQC 4DYQA 2EZIA 3R0AA 2FQ4A 1PUEE 3CCYA 3B73A 4HV5A 4LK1F 3IC7A 3LFKA 2HR3A 4A2UA 5M5XJ 1ZG1A 1XGMA 2IVMA 2B7EA 4XLFA 5HS7A 2HNHA 5EG0B 2HS5A 3WTWC 1USTA 2KIUA 1LDJA 1R1UA 2ID6A 2WB1A 1ZLKA 4D9JA 1Y0NA 1IG7A 4IRHA 4V2GA 3DBRB 1S7AA 2GAUA 1WJEA 3PSIA 4JP0A 5ILUA 2QLZA 2QSHX 4CCKA 2V4JC 2WY7Q 3QOEA 2YU3A 5DV5A 2V1XA 4ASNA 3GUDA 2IS4A 2WAEA 4GYIA 2A68F 1SVOA 4D5CA 3CUQA 2HKOA 3D0SA 4HA8A 2OV7A 3GMEA 2PQ8A 1U8RA 4O3MA 3ZMSA 2R5ZB 3TQNA 1REPC 4XL9A 4M72A 2DPUA 2HYGD 4C2UA 2WV0A 3EYIA 1U3EM 3L2QA 1OQYA 2Q8KA 1SD6A 2EIMH 2E1MB 3MKWB 1KGSA 4B09A 1JUPA 2QSGX 4KYWA 2DA6A 1ZQ3P 2MD0A 1MNDA 1AHDP 4XICA 3DTIA 5FKMA 4L9TA 4V19K 1R36A 2M0MA 3CCJI 1D8JA 4FT8A 2OF7A 1T6SA 3H36A 2X0LA 2OPTA 5HLIA 3MFKA 2KIQA 3FXKA 5HLGA 1JT0A 4U0VA 3COAC 3GX4X 2VOPA 5DYMA 3L2RA 1ZRFA 2RN7A 4XBFA 5TJJA 2BVLA 1GUUA 3LOCA 2OZ6A 2EILH 4XMYA 3OIPA 1Y8RB 2EQRA 2PFBA 4L9JA 4OIOF 4JX4A 2XSJC 4UB8C 5KCMA 4H0EA 3DKWA 2XKPA 4AIDA 1VTNC 3OS1A 3BJOA 3H5NA 4IHVA 4WX9A 2X48A 1A5JA 5CQEA 3M07A 3WTUC 5JVGF 4AM3A 3CQZJ 1MNEA 1JUSA 1S7EA 4Z2YA 4BE2A 4B3AA 5ICGA 2CH0A 4D0PA 2UXXA 4L0ZB 1QU3A 2XB5A 1MH4A 1FOXA 1DDNA 3H3UA 3ONQA 2BGCA 2LG4A 2JWTA 3K4NA 4GDFA 3BTCA 1LNWA 1HSTA 1MZBA 3FXUA 1TL8A 1DPUA 1W7PB 3QAHA 2DI3A 2M7AA 4BHPA 3R4KA 1HA8A 1D1AA 5DM6F 1ZTRA 3ZQHA 3BOQA 3K69A 1UFMA 4UHTA 3W6VA 1Y39A 1JHFA 2FD5A 2Y9YA 3NQOA 1P2FA 3ZQQA 2VJJA 2HVQA 5KNLA 3PQKA 3BLYA 2Z33A 4LK0F 2DA7A 3HSFA 3ISPA 1IF1A 4BACA 1OYYA 5FKOA 1ZN2A 2DMPA 4C30A 4EM1A 1MW7A 1CQTA 1TWHJ 2CS3A 1W1WE 4A3MJ 1A31A 5AONA 3E7LA 1RKTA 2E5NA 4HF0A 3RIRA 2V79A 2JMWA 3G6EI 1SFEA 3JRCA 4CCOA 3PIOF 3BROA 3CCEI 2R92J 3DBLB 3HGYA 1QPIA 4Y33A 4ZJZA 1UG2A 3EPZA 1QZEA 4GO1A 2ELKA 2ETHA 4J00A 1R5HA 2VE8A 3IH4A 2H94A 5D5XB 5HLHA 2KRHA 5E1XA 5GAHJ 5DD4A 1IN7A 1V5EA 2DFHA 1STZA 2CW7A 3R6SA 2RNJA 3G1LA 1EH6A 2FJ1A 3ZN1A 2ZO4A 1K79A 2ZBKA 3BTIA 1NK2P 3KP5A 2F5DA 1OCCH 1IRXA 1SAUA 3U1KA 2XF6A 3PSFA 3IKTA 3H0DA 3JR9A 2H8RA 1MSEC 4YFKF 2DO7A 1ENHA 3OYGA 2DA4A 4NNJA 2WAFA 3FK7A 1LFPA 2A61A 2EFOA 2M2EA 5F6FA 3NWSA 3L1PA 1O3QA 5CYVA 1IV8A 2RNGA 3RPUA 4IHTA 2P5VA 3WTSC 3S1NJ 3EUAA 2L02A 3V8JA 4ZYEA 2FBHA 4WXHA 2GXGA 3L7WA 2V6CA 2MH9A 2G9WA 4A5MA 3G4SI 2PJPA 3IH2A 2QZ8A 1AOYA 4EJUA 2DA2A 1JJ6C 5GTHC 3LNQA 3KZIC 4R79A 3M8JA 3KLNA 3RTRA 2R7QA 2X6YA 4UV8A 2ME6A 1X3ZB 4JX5A 3IL2A 4OMYA 1XMAA 3CP2A 1FT9A 1V5GA 2FSWA 3DCFA 2BV6A 2LR8A 3SZGA 1S29A 3F9KA 3S2HJ 2H6BA 3J80Z 2HI3A 2IA1A 4UB6C 5FFZA 4RB1A 1LEBA 3AG2H 2HQAA 1ETVA 3M8EA 4KDPA 5LGUA 4G7HF 4OAZA 4A0YA 5JI6A 4QPOA 2VJIA 1YHQI 5JLWA 5FKKA 3OYMA 1YJNI 2HTSA 3CMEI 3VODA 4HZFA 1FBUA 1ZYRF 3DU6A 4ESJA 1NK3P 1YG2A 2XDVA 2Y0MA 3K7AJ 2NVXJ 3BR5A 3M1EA 1O57A 4QWQA 4S04A 2E1NA 2D5VA 1JGGA 1U8BA 3TW7A 2VONA 4X6AJ 2DXIA 4BEHB 1YW7A 2ZSHB 2E7WA 4AU7A 4P1WA 3LAJA 1MIJA 2FEZA 3HIFA 5IP7J 4ZYGA 1X58A 5DM7F 4J01A 3OYLA 4E4HA 4BY1J 2VJ5A 5EDNA 1XSDA 4CA0A 4WCGA 1IUFA 4XLHA 1KA8A 4N9IA 3GYHX 1BW5A 1XX5A 4I01A 2MFZA 1WWXA 3FKIJ 1KYZA 3Q9SA 1R22A 2VN2A 1MJ9A 4KMUX 2B63J 2PX9A 2M4KA 3R61A 4ZTJA 1X1AA 5EZHA 1QO0D 2HQRA 1TQMA 1SMTA 5CVIA 4LG0B 4EM0B 3ESWB 2WV1A 1FPQA 3A02A 3K9TA 3VPRA 1Y1VJ 3KPHA 4JX6A 3ZMTA 3CO7C 2XAQA 2XPUA 1LJ9A 1VFCA 2ZJ2A 4LLLA 2VB6A 2CV0A 1MDMB 1Z77A 4XM3A 2L4AA 6PAXA 2KIFA 5LRRA 5M3MJ 2R7VA 3H5AA 4MO7A 4S0HB 4AYBA 4U0YA 4PJLA 3T5XA 4HDVA 1T8IA 1LKXA 4M9XA 3V7RA 3ABTA 2IA0A 2K9QA 2H1KA 5D8LB 2FMLA 1JUMA 3RKWA 2HFHA 4PJMA 3L09A 4KIBA 2DODA 1E17A 3O2PE 4E7IA 3S17J 3V8LA 4IOAF 1YX3A 2CV1A 5M3FJ 5FLMJ 1L3LA 2L01A 2M45A 2DQLA 2NS8A 2G0EA 4D5FA 3K4MA 1RUNA 1ULYA 3OS2A 3ABLH 2M30A 1I1SA 3A01B 4MHGA 2XAFA 3HHHA 4BNCA 3ZPLA 1B9NA 4J19A 3P9CA 4RM2A 2LY9A 3DEEA 1BL0A 3HB9A 1IW7F 1RR8C 1ACIA 1FJLA 4QIWN 2ID3A 4ANJA 4YELA 3GZ5A 3E97A 3BQYA 2Q2EA 3EUKL 3IP4B 3PFIA 3WTXC 4CICA 4OMZA 2K3FA 1LDDA 2K9SA 4HDUA 4YG2F 4ENMA 3G2BA 4Y15A 3W6JB 4IHSA 1FBQA 2JUCA 3HDDA 3SXYA 2JJ7A 3AAFA 4LITA 2KJCA 2EFNA 1DU6A 1SFKA 1YS7A 2A05A 2FF4A 1WFXA 2Z3YA 2GXAA 1X3WB 1BJAA 1WJCA 2P4WA 1DQUA 4RGUA 4H4KC 3RPUD 1B59A 4F3QA 4CYCB 5FRMA 2CWEA 2GBYA 3ECHA 2NS0A 4KA4A 3TEDA 4EV0A 2P6TA 4BGDA 5F1JA 5LRSA 5HLTA 1VQNI 2A5YB 3N05A 3E1SA 4HX8A 2IPQX 3W2VA 4R8HA 2O3FA 2R0QC 4XRSG 1WJ5A 2MD5A 3LSGA 1D3YA 3OL3A 4MQVA 3S15J 3CUOA 3QYEA 2P7CB 1D0YA 5EF6A 3Q0UA 2CMPA 3MMYB 1Y1WJ 1P6RA 3U1DA 1X1DA 5LHHA 1WPKA 4F55A 3H3ZA 3IUOA 1QHHD 1G3YA 1XB4A 2WBMA 2N8GA 1GXQA 1X1BA 1R7JA 4E70A 1B72A 2PLYA 4M3DA 4P9UA 3MZYA 2RGVA 3L9FA 1YS6A 5D8KB 1MBEA 2W00A 4M6XA 2ADUA 3GFMA 4CXFA 4A3GJ 4A3LJ 4FISA 5FKNA 1GVDA 5CVJA 1MBKA 2I5UA 2JRTA 2PG4A 2VC0A 4PZJA 1LDKB 2ZFWA 1S72I 3GXOA 3SEZA 1PVEA 3O6BB 3U9GA 5J1RA 3GTQJ 1P4AA 4HNTA 5BQTA 2KMUA 3AG3H 3IKVA 3KFWX 3JCUC 1I5ZA 2JA5J 2DYSH 2ZKZA 3BPXA 3RJPA 2STTA 1X19A 3I54A 2VC1A 3K2ZA 3QPLA 1IRZA 3FXJA 2E1OA 3ULQB 4YRVA 1LVKA 2XV4S 3HEFA 2DK5A 3LSKA 1YIOA 2BHYA 1QNTA 1K4TA 4WF2A 4Y17A 2LD5A 4Y52J 5IP6A 3BR3A 2K40A 2D45A 2PMZA 1EF4A 4B8XA 1WHUA 4A0XA 3CCQI 2D1HA 3C2HA 3DWLE 2QQ9A 2Y9ZA 2K4BA 1I3QJ 1W5SA 2M0CA 3JTHA 3S93A 5LD2C 1IZ1A 3ELKA 1IDYA 1OCZH 2DDBA 4E6KG 2CW8A 2DA5A 2LF8A 3HRSA 3RDIA 2XVCA 4NB5A 2XROA 2JUGA 5K5RA 1O4XA 5DUIA 1R4MB 4PFOA 2YUSA 3DEUA 3ZMZA 1UJ8A 2ZNYA 2EA4A 1F36A 1HBXG 1SD4A 2LSOA 3BZ6A 3N97A 2D2WA 2KPMA 2RREA 4RB2C 1G3TA 3GZNB 4F52A 3D5RC 3H0GJ 4Q4ZF 3AL0C 1J2XA 5JHUA 4D7MA 4KIFA 3BR6A 2QQBA 2OBPA 5DCMB 4EGZA 1IN5A 3T0YA 1QPMA 2NVYJ 3ABUA 2WA0A 4XK4A 2NVUB 2LH9A 1AU7A 4HW0A 5IT9Z 4DYCA 1JKRC 2R93J 5HOOA 3KYCB 2HZTA 3KP2A 2JA8J 3K4CA 3FISA 1UG0A 2LF7A 4RAGA 1R5ID 2XIGA 3CMMA 1WJBA 5FLXZ 3OL4A 2BHZA 4KISA 1X1CA 2HDWA 4OOIA 2Y48A 3HM5A 3MZ8A 4HNVA 5ED4A 5K1YA 1RR7A 1W4MA 3G3ZA 3TKYA 3OIOA 1IJWC 2BXYA 2IAIA 1TZLA 1HKSA 4Z6YA 1YRNB 2Y0SA 2LKSA 3M8FA 2VBWA 5H2FC 5LBQA 2QF7A 2QQAA 1EJ9A 4UNOA 3GVAA 4UUVA 2R7XA 1ZRCA 3WU0A 1ZGAA 3OIQA 1ETQA 4YIRX 3V4GA 3GO5A 2MABA 3CF2A 5E8GA 3RQIA 1K7AA 4ESBA 3UKGA 1IV6A 3GTOJ 2ELHA 1PJRA 1R4NB 3LSHA 2ZCWA 4P96A 4HX4A 3TO7A 4A6DA 3KETA 2L5QA 2QA4I 2DA1A 2LBFB 3U21A 2RAEA 1JJ8C 4BDYA 1YW8A 2QBYB 1J7KA 1NHAA 1U0JA 2L9SA 2OUMA 4X1EA 2RVCA 2ME0A 3F22A 3AG1H 2Q1ZB 2PMHA 1OPCA 3WE3A 1HLVA 1PYVA 3F72A 2CV2A 3OYDA 4CGZA 2FNAA 5CKTA 3ZQ7A 1HF0A 4P5OA 1IN6A 1R23A 2G7HA 2FRHA 3HUGA 4RS8A 1FIAA 3K2AA 4Y13A 2PBIA 2LY2A 4KMFA 4OIPF 1ZK8A 4XNFA 4F93B 2F5FA 5FRNA 1X3UA 3I0TA 4XKVA 2XRLA 2LP0A 2IS6A 1JTYA 3BR1A 2DOAA 3A03A 2MSYA 3EUHC 4P55A 3DPTA 5IOZA 2JTVA 2MC4A 1FWZA 2X9DA 2K3PA 2HYFA 2L54A 2PN6A 3CCSI 2R5YA 2F5CA 2UZKA 1ZLJA 4FX0A 1YJ9I 4WXCA 3M4OJ 2DMNA 4PUSA 3E6BA 2Z9OA 1WKMA 2VQLA 1DP7P 5CVUA 2QSFX 1KU3A 3HOUJ 1RRJA 1ONVA 1G3WA 3I56I 1T95A 1Z9CA 2LKPA 4KICA 4G6QA 4IEJA 4GXOA 3MD2A 4EMSA 3EUHA 3I4NJ 3KE2A 1YQAA 1A6QA 4P9FA 5HVQC 1R5GA 1S5LC 2M87A 2NOJB 4JQFA 4YFNF 1CF7A 1FMVA 2R7UA 5J47A 3PO3J 1UHMA 3V7SA 2H09A 4M6YA 1KYWA 5EYRA 1M1EB 1BI1A 2ESNA 2EV6A 1KZHA 1E3PA 2KP6A 4D7NA 2WC2A 3BG5A 1QVUA 4N4NB 4RLFA 4L18B 1KQ0A 1XDSA 2IW5A 3ASOH 4U7BA 2OQGA 2Z99A 2Y30A 2UUZA 4M73A 1FYLA 4Q5SF 2EBIA 2XSDC 2EJRA 5CLSA 2CRGA 2BEOA 1ZR4A 3D5SC 3FWEA 3GBGA 1T98A 3LSRA 1QZZA 1PUFB 1LE8A 1JHHA 3S3OA 2KJBA 3BCBA 3E5QA 3WGHA 3B02A 4CZZA 1U5TC 4GGGA 1HDDC 1D0ZA 1Z91A 3QU6A 1LUJB 1AKHB 2E2HJ 5FO5A 2L7KA 3I53A 1MJBA 3VSKA 2XPVA 3S1RJ 3KYDB 4HQMA 4RB0A 4DIQA 2NVTJ 2P6SA 4LJZF 2KL4A 4G9YA 4DBRA 2VPLA 1W0UA 4MTEA 2HOEA 1B8IA 3G1OA 3K6GA 3QP5A 1Z7UA 3W2AA 1H9GA 4ZTFA 3OMYA 4II3A 4IQ4A 4CUGA 1MMAA 4XOTA 3DKXA 3G73A 4F91B 2H8WA 4A93J 4PJJA 3J81Z 2ZMEC 3GZ6A 1U5TA 3MKLA 1ZGJA 2GXBA 2QEXI 5A2QK 1ON2A 2HOSA 1HQCA 1TNTA 1LQ1A 4UV9A 2STWA 3DFGA 4XN0A 3P9KA 3CTAA 1BIBA 2W25A 3GWZA 4ZYHA 3K70D 2E71A 3BDDA 1MBJA 3JREA 1SMYF 1RI7A 1OCOH 1J9IA 2PJRB 3CO6C 4BH9A 1FYKA 5F27A 3MKYB 1NTCA 4FASD 2A5WA 1J5YA 2ELJA 2L7FP 3H1CA 3J80K 4KNYA 4CH7A 3UNGC 2ZSIB 3L2VA 5EJCA 5IYCJ 2VBYA 4PJNA 1TP4A 3JSOA 2ZMEA 4R1HA 2LKXA 5FKLA 4PSWA 5DEQA 1ZAOA 3JW4A 1V54H 3VFZA 1YTYA 3VYRB 4WWCA 3SFZA 4AYBN 4I2OA 4OIRF 2Z5UA 2CJJA 3FHNA 1F4KA 5F04A 3HOVJ 3F6VA 3FXMA 3DBHB 1MBHA 3T8TA 2ZFUA 1VQ4I 2MLKA 3IWFA 1KQ8A 3GTKJ 2QQ8A 5BOXA 3BR0A 3CC4I 2LDUA 1JI8A 4NC8A 4K2EA 4BS9A 1WSUA 2E35A 3H92A 4B48A 4UXNA 2YSRA 2B0LA 4MLOA 1WH7A 1IGNA 2A6HF 2J5PA 3FK6A 2XAUA 3RKXA 1BI3A 3ZMUA 1NH3A 2FOWA 1T08B 3SFIA 3PUBA 3HRTA 3FZVA 2KISA 3OOPA 1A36A 2HVRA 4MQ9F 2K02A 2XGXA 3SQNA 1MMSA 4IX7A 2JPBA 3TDZC 2GA2A 1ETKA 3HOTA 1BC7C 3AFHA 2P8TA 2EB7A 4L9VA 3ROUA 2B9SA 1KU7A 4NQWA 1E0EA 3WU1B 5TRDA 2O8KA 1VNDA 3CJQB 4RB3C 2IXSA 2XKOA 1SFUA 3CZ6A 2NAZA 3RSNA 2H1LA 2HGCA 4KN4X 2R7ZJ 2HQ5A 3PQJA 2XRNA 5ILVA 3ZP5A 1HDPA 1ETYA 4I98B 1V4RA 5GP9A 1S3JA 5J3LA 1R1TA 3P7NA 3TDUC 3HJEA 3KLOA 3BTJA 5L3GA 5EGOA 2BXZA 2TDXA 3RQ4A 5DS9A 4EEFG 2X6XA 2BW3B 4KT6A 2QUFA 4F7ZA 2D1VA 4A69C 4NC6A 4AC0A 1XSXA 3SDGA 4BYYA 2G7UA 1Z7LA 1LB2A 1Z21A 3CCLI 2GIZA 1FP1D 3BPVA 1SVLA 2FQ3A 3X2QH 2GQQA 3OYIA 4C3IJ 3UR3C 1FYMA 2DPDA 3VWBA 5IOYA 1KU2A 3HOXJ 3ZMVA 1GVJA 4UUSA 1HKTA 3C18A 5HS8A 2ISYA 3ZQCA 1O3RA 2JVGA 3A1YA 1APLC 3HTSB 4KT5C 2XUBA 3ZGKA 2XC7A 2RV8A 3CDIA 4B43A 3I4PA 5D4RA 1YYVA 4ESFA 1XCVA 2XB0X 3CCVI 2FU4A 2KRCA 1T0FA 5M5YJ 2BY1A 3DPLC 3FBIB 1TTYA 2FA5A 5ICCA 3OSGA 3HKZA 1HW2A 2DJNA 3E6DA 3GTLJ 2BY3A 4XOPA 3G1MA 3ZQLA 3FMSA 3LA3A 2FXAA 5EG0A 1I3AA 5BNGA 2EPFA 2E1MC 1N25A 3LFUA 1YLFA 2QGUA 1HSJA 2BBYA 2XF7A 1DUXC 1QQIA 2CU7A 1FP2A 2EZKA 2KHMA 2BY2A 2VKHA 1FNNA 3U2RA 4EJVA 1W36C 3BR2A 2M9HA 2DBBA 3RKYA 4B3XA 3OYCA 3HPHA 1KQ9A 2V9PA 5ICEA 4L5IA 1RESA 2XAHA 1TQIA 2HPMA 1K4SA 2PMZN 1N75A 1MGTA 2VIXA 3FXOA 2R5ZA 1GXPA 2E2IJ 3MZHA 1BN5A 5J1YA 3PL8A 2AO9A 2KIMA 3KEYA 2X6WA 2CQXA 2HQNA 1G3SA 4E7KA 2VKEA 3S1QJ 2KDZA 2MLGA 2ZNZA 1YO5C 2ICWG 2GLOA 3JRGA 1P92A 5GAEJ 5E3MA 4BHCA 3SYTA 4TV7A 2LREA 5CVVA 2IA2A 1DP3A 4A6EA 3IHUA 2XHKA 5H6QA 3HPGA 2O5RA 3BZCA 1JXSA 5LEKA 1H89C 1YE9A 3LL7A 1LFUP 2IGNA 2Q0OA 3VB2A 3EDPA 1N77A 2FBKA 1FTTA 3BG3A 1J0RA 2W84A 3WTZA 1K78B 2EWNA 3HC7A 3HRUA 1RZ4A 3I59B 3QYFA 3GFLA 1NG6A 4M9SA 2GIVA 2O9LA 3KP4A 1J75A 3OYAA 4BXXJ 2NYXA 5CJ9A 2XASA 1WVRA 1Z1DA 3S3NA 5TGTA 4PSXA 3CDHA 2R7DA 4AWXB 4ZDOA 3KX2A 4AIHA 2I8DA 3NAUA 4NHJA 2DDAA 4II2A 4EVIA 4AVZA 2W57A 2VKVA 2TRTA 1RC9A 1JE8A 3S3MA 2CQNA 1UHSA 2L9NA 2HXOA 3GTPJ 2LTPA 2R7TA 5C4XJ 1BBYA 4RAZA 4ENKA 1X2MA 5E18F 2VI6A 2ZJPF 4FE4A 1TT0A 1W7PA 3HSRA 2A07F 1OR7C 2R7SA 1W0TA 3MQ0A 2XGEA 3K1NA 4PK4A 2VQHA 1IXCA 2Y0SN 1ZG5A 5B66C 4LG3A 4BQAA 1RKWA 1TQPA 2AQFA 3I71A 5FD6A 2EA2A 1ETOA 3Q0WA 3BC8A 3BZKA 2WAQN 3FM3A 2A6TA 3VSLA 3F8NA 5EEAA 4Q47A 1GV5A 2HWVA 4V2FA 4LB5A 3EYYA 3K1PA 2OA4A 1VQ6I 4XLEA 3PO2J 4I99C 5HNFA 1MJAA 2IGKA 2YPRA 2RQQA 3W3CA 3LMMA 2LOOA 3DU5A 5E3OA 1KONA 2RKHA 4GFBA 1OR7A 2IP2A 1FC3A 2WTEA 3DQVC 3HGGA 1VQKI 4RAFA 1L0OC 1Y8QB 4EGYA 2UV1A 3CUQB 1K6OA 3I4MJ 4UVAA 4HOBA 4XLPF 2J5OA 4G94A 1R58A 3OSFA 1PP8F 5LHGA 1TWFJ 1T56A 5FLXK 2ISZA 1LFBA 2F5EA 1FZPB 3F23A 2ZXIA 5L3BA 4A12A 3KZZA 4YFXF 1V5FA 3BG6A 3RZDJ 4BQQA 1Y0UA 5FJ8J 1TNSA 2DTRA 1OYIA 1R6RA 2ZXHA 3TP3A 5L3DA 4XKBA 3E5UA 4X0GA 4IL6C 4G7ZF 4C3HJ 2HDCA 3J7AY 3GFIA 2IJLA 4MFEA 3S32A 2F4OB 3FKJA 5GPCA 4RGSA 4A3BJ 1YW9A 2YX7A 4AIJA 3OYHA 3J7AO 2DU9A 2E1CA 5F0CA 3BP8A 1XGSA 2HYJA 1F9NA 4XKWA 4O6JA 2V9VA 4I0AA 2LYCA 4OU0A 5IP9J 4RBOA 4IRIA 1YOVB 1Y6IA 5J6XA 1GDTA 2M5WA 1G8XA 2WB1N 3WU2C 3CMYA 3J7YJ 2AXLA 2UWMA 3JAMZ 3MEXA 1GV2A 2ZXWH 1EKEA 1IN8A 1H8AC 3OYJA 2V1NA 2YU9J 3Q0VA 1YFHA 4FHTA 3BJAA 2DFEA 4FE7A 2Z1DA 1EH7A 1R1VA 4HAMA 4MFDA 2NOGA 4BBRJ 4CDGA 2HEOA 4FTHA 1T38A 2WADA 4XLCA 4BJTA 2CYYA 2DT5A 4G8XA 3QQAA 5HS9A 5JVTA 4IQJA 3DKYA 3WHCA 2TCTA 5F1RA 5TISC 4ZC3A 2W7NA 1LEAA 1VZ0A 1XMXA 1C0WA 3DF8A 3K4JA 3A0HC 1YJWI 4CCJA 1S9HA 1JGSA 4U7DA 1YI2I 1VQ8I 3CC7I 2HXIA 4G12A 2O8XA 4XORA 1VQ5I 2A69F 1XMKA 2HZDA 1BC8C 1FOKA 3ZN0A 3SDBA 1DPRA 2X85A 4ITVA 1BA5A 1IXRC 1IC8A 2P5LC 3DPUA 3QU3A 2K5CA 3KIOA 4QPQA 2YR2A 4RGRA 2L9RA 1WH5A 2DJIA 4BEHA 2BE5F 2KFDA 2VPRA 3FX3A 2VQGA 2EFPA 2X1EA 1XTAA 4G7OF 4HG2A 2R7WA 2EV0A 3CJNA 1OMIA 5J4VA 5LLQA 5LHIA 4CYDA 5KVRA 3Q9VA 3MKZA 4ZYAA 5E8IA 4BQOA 5L3FA 2KZGA 3SJMA 4I7HA 1PP7U 4LG0A 4BE0A 2E60A 2ZJQF 1WI3A 4B1RA 1ZRDA 1E3OC 2MG4A 1D0XA 4MEXF 4IHYA 4XLAA 1ETXA 4OWRB 3DEWA 1EV7A 5ICFA 2L7ZA 3L00A 2O7OA 1W7PD 4Y7NJ 1ODDA 1T39A 4M3EA 5FD5A 4UY8I 4RLQA 5HODA 1QHGA 3M1CA 1MDMA 4M9ZA 2V6EA 3VDXA 1A04A 2JT1A 3LSIA 2EFWA 5E20A 2BVMA 3F3XA 3IV5A 2V26A 5DDGA 1D1BA 4CHUA 2L4MA 1ZARA 4I02A 1R9TJ 4G6DA 2QKLB 4BJ6C 1E3HA 1TLHB 4M71A 1IAWA 4S05A 3SZTA 2DFFA 3SZPA 3H5RA 3OR1C 5DD8A 4UUTA 4DZPA 4YIFA 3ZXSA 4BXUA 1ETWA 1YX5A 2CUEA 1I27A 2O6GE 4JOMA 5L3CA 2CQKA 4M3BA 1Z67A 2K9NA 2VOOA 3A01A 1D8KA 2VJ4A 3TO9A 1O3TA 5JFRA 1MMDA 2R7RA 3HSEA 2O03A 3KEQA 2VE9A 3ZR8X 1BOAA 2AXTC 3BT9A 4LFUA 3TOBA 3ZRGA 1VQOI 2ESHA 1HXDA 4AD9A 1A6IA 4XRSA 2NNYA 1SANA 4YIIA 1R71A 3QPSA 1TC3C 3IAM2 2HVSA 2AQEA 3H35A 2F4MB 2DN0A 3GCMA 4DBQA 1XD7A 2WY8Q 1FY7A 3NARA 1BR2A 4NC7A 3WODF 1ORKA 2DOEA 2NXNB 4PCQA 5IYDJ 1P4WA 2IS2A 1OFCX 4I6ZA 3LSPA 4PGGA 4A3JJ 1XGNA 1R49A 1XC5A 4IRGA 1X4PA 3WHBA 4CYCA 1FBSA 5BPIA 3GTJJ 1G4DA 2ZJRF 5FGMA 3BY6A 4AIKA 2JA7J 2LK2A 3OOUA 1FOYA 3AG4H 3OYFA 4KITB 4BDZA 1QVTA 4XLNF 5HDGA 3MAJA 3OYBA 3GEZA 2MC3A 4LMYA 3F0CA 3HOWJ 1HW5A 2F4IA 2JK3A 5IY5H 4HQEA 3PIPF 2KT0A 2R7OA 1B1BA 2X6OA 3FHZA 5JR3A 4XONA 2O0YA 1IDZA 1JKPC 1G2HA 1HCRA 3QYBA 1FOWA 5E17F 4CZCA 4KUMA 1S6LA 4C2MJ 2JA2A 1BM9A 1Y56A 4QTRA 9ANTA 3C7JA 4XRMA 5E79C 1R00A 1IRGA 2F48A 4IZZA 3ZQIA 2LRDA 5K5QA 1XS9A 3HHGA 1T33A 4HSTA 1I6XA 5ERIA 3HOZJ 2OTJI 2I10A 4MEYF 1TBXA 4QLCU 3I5UA 3MN2A 1U6GA 3GFJA 2C6YA 3QPTA 3H9GA 1J59A 4O5VA 4ZDPA 2NNNA 5B3SH 1MMNA 2CFOA 3OS0A 4DW6A 2W1OA 2VT3A 1ITYA 2ECCA 4YEJA 3G71I 3FXLA 3LQQA 3ML6A 5JLXA 1SC7A 4ZZLA 4E7HA 3PNTA 4G6TB 3GLLA 4FQGA 1BI2A 4EATA 3CLOA 3BJ6A 3CP8A 3HKZN 3I64A 2CFXA 4LD5A 3W6KB 4FETA 5C3EJ 4HX7A 1MH3A 5HNHA 3IAS2 3PFYA 3IWZA 4KIGA 3DLAA 1XGOA 4RA2A 1WQ2A 3Q5FA 3KZYA 2X1DA 5DCFA 2Q2EB 4A5NA 3L2CA 1LPQA 1ZREA 3ABMH 3AKZA 4N0BA 2V1UA 3ZMDA 2QCOA 2LVSA 2GOMA 2VLAA 1JKQC
chains in the Genus database with same CATH topology
3ERED 2RC4A 5H20A 1BIAA 2CGPA 2DQRA 3WGIA 4LGWA 4EM2A 2BYVE 5EEGA 3FXQA 3WGGA 2R7FA 2P5KA 1UB9A 2OQRA 3FMQA 5DCMA 1TW2A 3HOSA 2IT0A 1IUYA 1P4XA 2V1DA 5J8CA 3F6OA 1F1ZA 1Z6RA 4GYGA 3LSTA 5BPDA 5D6EA 3KP7A 3T1BA 4HF2A 1H9TA 4EJTA 3BWGA 2GZWA 4HLXA 4ZH4F 1V3FA 3LA7A 1O7FA 1IRFA 3F8BA 5D5VB 3E6CC 2K27A 1Z05A 1H0MA 1RUOA 4LB6B 4ENJA 5LEJA 3V7CA 1RNLA 3WTTC 3GF2A 2QBYA 4ETSA 2VBZA 1XDUA 2HKXA 2DK8A 2K86A 3RPQA 4KN7X 2H27A 4XRFA 5E1ZB 5A2QZ 4HLYA 3M9AA 3KEOA 2X4HA 1FSEA 5KK1A 1I1GA 1O3SA 2EFQA 3R0JA 1AWCA 2PEXA 4Q48A 1ZH5A 5F64A 1QZYA 2P7VB 1USSA 4ENNA 4I0BA 4DNCA 3FMRA 2RQPA 3F8MA 3S2WA 2EK5A 4LLGF 2QENA 5BS6A 2OU2A 2YX4A 1WI9A 1SD7A 2R3SA 3RYPA 2O61A 1FLIA 1B9MA 3K0LA 3KP3A 2FBIA 3D5LA 3MWMA 2DLLA 3R60A 2W24A 2PMUA 3HRMA 3NEUA 3GLXA 4IF4A 5EEHA 4LLNA 3E5XA 4OIQF 3RYRA 4M74A 5HDNA 1O7LA 1G6NA 2VXZA 2QWWA 3C1DA 2EV5A 2RDPA 3FM5A 1XSVA 3QRFF 3F21A 2UXNA 3WTYC 1EH8A 3ECOA 1OYWA 4PGHA 1D5VA 1XCBA 5D5UB 2CSOA 4ZZDA 5FFXA 3LQRA 1Q1HA 2FOKA 3MCZA 3F8CA 2QVOA 1Z6TA 4MTDA 3T8RA 5LGNA 4BHBA 2H6CA 2L3DA 1SAXA 1SD5A 1B4AA 4GCVA 1BI0A 3IRRA 2OAZA 3JAMK 2JZYA 1OKRA 1W5TA 4CO8A 5FB2A 4U88A 3QOPA 5CVRA 3F8FA 1S8NA 1XN7A 1FX7A 2FNPA 1MKMA 4N9HA 3C3WA 4PDKA 1IXSB 3TO6A 3E3VA 3RI4A 2COMA 4UVCA 1ZHFA 4MNUA 4XSZF 4IVNA 2QM3A 3JTGA 3DXJF 5IT9K 2ZXJA 3O3KA 3N4MA 1TW3A 5BMZA 4RAYA 1CF7B 3QP6A 1SFXA 1S7OA 2GA1A 3LA2A 2NRAC 3TGNA 4AVPA 2KRFA 4L0YB 3KP6A 3HYIA 3V8KA 3WE2A 3WTVC 3SHFA 1HKQA 1KU9A 2VBXA 3QPHA 4JK1X 2FE3A 2CG4A 2Y75A 1IN4A 2A3SA 2JPCA 3REOA 5D4SA 5J8FA 2A6EF 2HTJA 2MH2A 3I58A 1WRJA 2IRFG 3DV8A 1E2XA 1MD0A 4L5JA 4KFCA 3DP7A 3FXRA 2K4JA 5AIPA 2W85A 1U5TB 3LWFA 4U0WA 5E1WA 4UVBA 3M7GA 2AS5F 4RGXA 4HYEA 5L3EA 4L9NA 1U78A 2DW4A 5LGTA 2VT2A 1ZG3A 5D6FA 3WG9A 1B6AA 3FF5A 1GHCA 4ON0A 2MA3A 3P9IA 2ZMEB 2PI0A 2OZUA 1HW1A 2DFIA 5H6RA 3TOAA 2ACJA 2F2EA 4EQQA 2DAOA 1QGPA 2M8EA 2M1BA 4XSXF 5D5WB 1F5TA 5K5OA 3JSPA 3KCCA 4EJWA 3EETA 1UCRA 1ON1A 5AIQA 4ZYDA 1CGPA 3K1MA 1T2KA 4OINF 3OV8A 2CW0F 2CO5A 4I09A 4IPAA 4MGRA 3VEPA 4BAYA 1QBJA 3IRQA 2LNBA 4WK8F 3NRVA 3LAPA 2VODA 4IJAA 1PDNC 5DUKA 4DQ2A 4FX4A 4HBLA 2QYOA 5IT3A 1K78A 3I59A 1LVAA 3EQLF 3J81K 3GW2A 1FSHA 1UHWA 5ILSA 4HV6A 4IXAA 2WWYA 3HTUA 1U2WA 2JSCA 2XAGA 4A0ZA 2MBFA 2FMYA 2OD5A 4JBAA 4WXDA 2XAJA 1RIOH 4HF1A 2GWRA 3E6MA 2K7LA 4EJOA 5HDKA 2KKOA 3VOEA 2E7XA 3CUQC 3R0AA 1PUEE 4HV5A 3B73A 4LK1F 3IC7A 3LFKA 2HR3A 4A2UA 1ZG1A 1XGMA 2IVMA 5HS7A 2HS5A 3WTWC 1USTA 2KIUA 1LDJA 1R1UA 1ZLKA 4IRHA 1S7AA 2GAUA 5ILUA 2QLZA 2YU3A 5DV5A 2V1XA 4ASNA 3GUDA 4GYIA 2A68F 3CUQA 2HKOA 3D0SA 4HA8A 2PQ8A 1U8RA 4O3MA 3ZMSA 3TQNA 1REPC 2DPUA 4M72A 2HYGD 2WV0A 3EYIA 1U3EM 2Q8KA 1SD6A 1KGSA 4B09A 4KYWA 4L9TA 1R36A 1D8JA 4FT8A 1T6SA 2X0LA 5HLIA 3MFKA 5HLGA 4U0VA 3COAC 3GX4X 2VOPA 5DYMA 1ZRFA 2RN7A 4XBFA 5TJJA 2OZ6A 2PFBA 4L9JA 4OIOF 4H0EA 3DKWA 2XKPA 1VTNC 3BJOA 4WX9A 3WTUC 4Z2YA 5ICGA 4D0PA 2UXXA 4L0ZB 1DDNA 3H3UA 2BGCA 1DPUA 1LNWA 1HSTA 1MZBA 3FXUA 1W7PB 3QAHA 2DI3A 4BHPA 3R4KA 3BOQA 3K69A 1UFMA 4UHTA 1JHFA 3NQOA 1P2FA 3PQKA 2Z33A 4LK0F 1IF1A 3HSFA 3ISPA 1OYYA 1ZN2A 4EM1A 5AONA 4HF0A 3RIRA 2V79A 1SFEA 3BROA 4GO1A 2ETHA 1R5HA 2VE8A 5D5XB 2H94A 5HLHA 5E1XA 5DD4A 1IN7A 1STZA 3R6SA 2RNJA 1EH6A 3ZN1A 2ZO4A 1K79A 2ZBKA 3KP5A 2F5DA 3IKTA 4YFKF 2DO7A 2A61A 2EFOA 5F6FA 1O3QA 5CYVA 3RPUA 4IHTA 2P5VA 3WTSC 2L02A 3V8JA 4ZYEA 2FBHA 4WXHA 2GXGA 3L7WA 2V6CA 2MH9A 2G9WA 4A5MA 2PJPA 2QZ8A 1AOYA 4EJUA 4R79A 3KLNA 3RTRA 4UV8A 3IL2A 4OMYA 1XMAA 1FT9A 2FSWA 2BV6A 1S29A 2H6BA 3J80Z 2IA1A 5FFZA 1LEBA 4RB1A 3M8EA 4KDPA 5LGUA 4G7HF 4A0YA 5JI6A 2HTSA 4ESJA 3VODA 4HZFA 1ZYRF 1FBUA 1YG2A 2Y0MA 3M1EA 1O57A 4QWQA 4S04A 2E1NA 2VONA 1YW7A 2E7WA 3LAJA 2FEZA 3HIFA 4ZYGA 1XSDA 4WCGA 3GYHX 1KA8A 4N9IA 4I01A 1WWXA 4KMUX 1KYZA 3Q9SA 1R22A 2VN2A 1MJ9A 3R61A 1QO0D 2HQRA 1TQMA 1SMTA 5CVIA 4LG0B 4EM0B 1FPQA 3K9TA 3ZMTA 3CO7C 2XAQA 1LJ9A 2ZJ2A 4LLLA 1MDMB 2L4AA 6PAXA 2KIFA 5LRRA 4U0YA 3T5XA 4HDVA 4M9XA 3V7RA 3ABTA 2IA0A 5D8LB 2FMLA 3RKWA 2HFHA 3L09A 4KIBA 1E17A 3O2PE 3V8LA 1L3LA 2L01A 2M45A 2DQLA 1RUNA 1ULYA 2M30A 1I1SA 4MHGA 2XAFA 3HHHA 4BNCA 3ZPLA 1B9NA 3P9CA 1IW7F 3GZ5A 3E97A 2Q2EA 3PFIA 3WTXC 4CICA 4OMZA 1LDDA 4HDUA 4YG2F 4ENMA 4Y15A 3W6JB 4IHSA 1FBQA 3SXYA 3AAFA 2KJCA 2EFNA 1YS7A 2FF4A 2Z3YA 1BJAA 2P4WA 4RGUA 1B59A 2CWEA 3ECHA 4KA4A 2NS0A 4EV0A 2P6TA 5LRSA 2A5YB 4HX8A 2IPQX 4R8HA 2O3FA 2MD5A 1D3YA 4MQVA 3CUOA 2P7CB 1P6RA 3U1DA 5LHHA 3H3ZA 1G3YA 1XB4A 1GXQA 1R7JA 4E70A 2PLYA 4P9UA 3MZYA 2RGVA 3L9FA 1YS6A 5D8KB 4M6XA 2ADUA 3GFMA 4CXFA 5CVJA 2JRTA 2VC0A 2PG4A 4PZJA 1LDKB 2ZFWA 3GXOA 3O6BB 3U9GA 1P4AA 5BQTA 3IKVA 3KFWX 1I5ZA 2ZKZA 3BPXA 3RJPA 2STTA 3I54A 2VC1A 3K2ZA 3ULQB 2XV4S 2DK5A 1YIOA 1QNTA 4WF2A 4Y17A 2D45A 4B8XA 4A0XA 2D1HA 2QQ9A 2K4BA 1W5SA 3JTHA 1IZ1A 3ELKA 2LF8A 3HRSA 3RDIA 2XVCA 4NB5A 2XROA 5K5RA 5DUIA 3DEUA 3ZMZA 2ZNYA 2EA4A 1HBXG 1SD4A 2LSOA 3BZ6A 3N97A 2D2WA 4RB2C 1G3TA 4Q4ZF 1J2XA 5JHUA 4KIFA 2QQBA 2OBPA 5DCMB 4EGZA 1IN5A 3T0YA 1QPMA 3ABUA 4HW0A 5IT9Z 5HOOA 2HZTA 3KP2A 2LF7A 5FLXZ 2XIGA 4OOIA 2Y48A 5ED4A 5K1YA 1W4MA 3G3ZA 3TKYA 1HKSA 3M8FA 2VBWA 4UNOA 5LBQA 2QQAA 4UUVA 3GVAA 1ZRCA 3WU0A 1ZGAA 3V4GA 3GO5A 5E8GA 1K7AA 4ESBA 2ELHA 2ZCWA 4P96A 4HX4A 3TO7A 4A6DA 3KETA 1YW8A 2QBYB 1J7KA 1NHAA 2RVCA 3F22A 2PMHA 1OPCA 3WE3A 3F72A 4CGZA 2FNAA 3ZQ7A 4P5OA 1IN6A 1R23A 2G7HA 2FRHA 3HUGA 4RS8A 4Y13A 2PBIA 4KMFA 4OIPF 2F5FA 1X3UA 3I0TA 4P55A 3DPTA 2JTVA 1FWZA 2PN6A 2HYFA 2L54A 2F5CA 2UZKA 1ZLJA 4FX0A 4WXCA 3E6BA 2Z9OA 1WKMA 1DP7P 5CVUA 1KU3A 1ONVA 1G3WA 1Z9CA 2LKPA 4KICA 4G6QA 4GXOA 4EMSA 3EUHA 3KE2A 1YQAA 4P9FA 5HVQC 1R5GA 2M87A 4JQFA 1CF7A 4YFNF 1UHMA 3V7SA 2H09A 4M6YA 1KYWA 2ESNA 1BI1A 2EV6A 2WC2A 4L18B 1KQ0A 1XDSA 2IW5A 4U7BA 2OQGA 2Z99A 4M73A 1FYLA 4Q5SF 2EJRA 5CLSA 2BEOA 3FWEA 1T98A 1QZZA 1JHHA 2KJBA 3E5QA 3WGHA 3B02A 4CZZA 1U5TC 4GGGA 1Z91A 3QU6A 5FO5A 3I53A 1MJBA 4HQMA 4RB0A 2P6SA 4LJZF 4G9YA 4MTEA 2HOEA 3QP5A 1Z7UA 1H9GA 3G73A 3J81Z 3GZ6A 1U5TA 1ZGJA 2GXBA 5A2QK 1ON2A 1HQCA 1TNTA 1LQ1A 4UV9A 2STWA 3DFGA 3P9KA 3CTAA 1BIBA 2W25A 3GWZA 4ZYHA 3BDDA 1SMYF 1RI7A 1J9IA 3CO6C 4BH9A 1FYKA 1J5YA 3J80K 4KNYA 2VBYA 3JSOA 2ZMEA 4R1HA 5DEQA 1ZAOA 3JW4A 3VFZA 1YTYA 4WWCA 3SFZA 4I2OA 4OIRF 2Z5UA 1F4KA 3F6VA 3T8TA 2MLKA 3IWFA 1KQ8A 5BOXA 2LDUA 4K2EA 1WSUA 3H92A 4UXNA 2YSRA 2B0LA 2A6HF 2J5PA 3RKXA 1BI3A 3ZMUA 3HRTA 3FZVA 3OOPA 4MQ9F 2K02A 2XGXA 3SQNA 2JPBA 3TDZC 2GA2A 3HOTA 1BC7C 2P8TA 2EB7A 4L9VA 3ROUA 1KU7A 4NQWA 3WU1B 5TRDA 4RB3C 2XKOA 1SFUA 2NAZA 2HGCA 4KN4X 3PQJA 2XRNA 5ILVA 3ZP5A 4I98B 1V4RA 1S3JA 1R1TA 3P7NA 3TDUC 3KLOA 5L3GA 2TDXA 2QUFA 4F7ZA 2D1VA 1XSXA 4BYYA 2G7UA 1LB2A 1FP1D 2FQ3A 3BPVA 2GQQA 2DPDA 1FYMA 1KU2A 3ZMVA 1GVJA 1HKTA 3C18A 5HS8A 2ISYA 1O3RA 3HTSB 4KT5C 2XUBA 2RV8A 3I4PA 5D4RA 1YYVA 4ESFA 1XCVA 2FU4A 1T0FA 3DPLC 1TTYA 2FA5A 5ICCA 1HW2A 3E6DA 3FMSA 3LA3A 2FXAA 1YLFA 1HSJA 2BBYA 1DUXC 1QQIA 1FP2A 1FNNA 3U2RA 4EJVA 2DBBA 3RKYA 1KQ9A 5ICEA 4L5IA 2XAHA 1TQIA 1MGTA 1GXPA 3MZHA 1BN5A 2KIMA 2HQNA 1G3SA 1YO5C 2MLGA 2ZNZA 1P92A 4BHCA 4TV7A 5CVVA 2IA2A 4A6EA 3IHUA 2XHKA 5H6QA 1JXSA 5LEKA 2Q0OA 3VB2A 3EDPA 2FBKA 1J0RA 2W84A 3WTZA 1K78B 2EWNA 3HRUA 1RZ4A 3I59B 3GFLA 4M9SA 2GIVA 3KP4A 1J75A 2NYXA 5CJ9A 2XASA 1Z1DA 3CDHA 2R7DA 4AWXB 4AIHA 4NHJA 4EVIA 2W57A 1JE8A 1BBYA 4RAZA 4ENKA 5E18F 1W7PA 3HSRA 2A07F 3MQ0A 3K1NA 1IXCA 1ZG5A 4BQAA 1TQPA 3I71A 5FD6A 2EA2A 3FM3A 3F8NA 4Q47A 2HWVA 4LB5A 3EYYA 3K1PA 2OA4A 1MJAA 2YPRA 2RKHA 1OR7A 2IP2A 1FC3A 2WTEA 3DQVC 1L0OC 4EGYA 3CUQB 1K6OA 4UVAA 4HOBA 4XLPF 2J5OA 4G94A 1R58A 1PP8F 5LHGA 5FLXK 2ISZA 2F5EA 1FZPB 3F23A 5L3BA 4A12A 3KZZA 4YFXF 1Y0UA 1TNSA 2DTRA 1OYIA 5L3DA 3E5UA 4G7ZF 2HDCA 3GFIA 2IJLA 4RGSA 1YW9A 2YX7A 4AIJA 3J7AO 2DU9A 2E1CA 3BP8A 1XGSA 1F9NA 4O6JA 2V9VA 4I0AA 4OU0A 4IRIA 5J6XA 2M5WA 2AXLA 2UWMA 3JAMZ 3MEXA 1IN8A 1YFHA 4FHTA 3BJAA 1EH7A 1R1VA 4HAMA 4CDGA 2HEOA 1T38A 2CYYA 2DT5A 4G8XA 5HS9A 5JVTA 5F1RA 1LEAA 1C0WA 3DF8A 1JGSA 4U7DA 2O8XA 2A69F 1XMKA 1BC8C 1FOKA 3ZN0A 1DPRA 1IXRC 2P5LC 3QU3A 2YR2A 4RGRA 2BE5F 3FX3A 2EFPA 4G7OF 2EV0A 3CJNA 1OMIA 5LHIA 5LLQA 4CYDA 5KVRA 3Q9VA 5E8IA 5L3FA 4I7HA 1PP7U 4LG0A 1ZRDA 4MEXF 1EV7A 5ICFA 3L00A 1W7PD 1ODDA 1T39A 5FD5A 1MDMA 4M9ZA 1A04A 2JT1A 2EFWA 5E20A 3F3XA 5DDGA 4CHUA 2L4MA 1ZARA 4I02A 4G6DA 1TLHB 4M71A 1IAWA 4S05A 3SZTA 3SZPA 5DD8A 4YIFA 4BXUA 1I27A 2O6GE 5L3CA 2CQKA 2VOOA 1D8KA 3TO9A 1O3TA 5JFRA 3HSEA 2O03A 3KEQA 2VE9A 1BOAA 4LFUA 3TOBA 2ESHA 1HXDA 4AD9A 2NNYA 4YIIA 1XD7A 1FY7A 3WODF 4PCQA 1P4WA 4PGGA 1XGNA 4IRGA 1FBSA 5BPIA 1G4DA 5FGMA 3BY6A 4AIKA 4XLNF 5HDGA 3MAJA 3GEZA 2MC3A 4LMYA 1HW5A 4HQEA 1B1BA 3FHZA 5JR3A 2O0YA 5E17F 4KUMA 1S6LA 1BM9A 3C7JA 1R00A 1IRGA 5K5QA 3HHGA 1I6XA 5ERIA 4MEYF 1TBXA 4QLCU 3I5UA 1U6GA 3GFJA 2C6YA 3QPTA 1J59A 4O5VA 2NNNA 2VT3A 3LQQA 3ML6A 4ZZLA 1BI2A 3CLOA 3BJ6A 3I64A 2CFXA 4LD5A 3W6KB 4HX7A 3IWZA 4KIGA 1XGOA 1WQ2A 3Q5FA 3KZYA 5DCFA 4A5NA 3L2CA 1ZREA 4N0BA 2V1UA 3ZMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ERE D;  2RC4 A;  5H20 A;  1BIA A;  2CGP A;  2DQR A;  3WGI A;  4LGW A;  4EM2 A;  2BYV E;  5EEG A;  3FXQ A;  3WGG A;  2R7F A;  2P5K A;  1UB9 A;  2OQR A;  3FMQ A;  5DCM A;  1TW2 A;  3HOS A;  2IT0 A;  1IUY A;  1P4X A;  2V1D A;  5J8C A;  3F6O A;  1F1Z A;  1Z6R A;  4GYG A;  3LST A;  5BPD A;  5D6E A;  3KP7 A;  3T1B A;  4HF2 A;  1H9T A;  4EJT A;  3BWG A;  2GZW A;  4HLX A;  4ZH4 F;  1V3F A;  3LA7 A;  1O7F A;  1IRF A;  3F8B A;  5D5V B;  3E6C C;  2K27 A;  1Z05 A;  1H0M A;  1RUO A;  4LB6 B;  4ENJ A;  5LEJ A;  3V7C A;  1RNL A;  3WTT C;  3GF2 A;  2QBY A;  4ETS A;  2VBZ A;  1XDU A;  2HKX A;  2DK8 A;  2K86 A;  3RPQ A;  4KN7 X;  2H27 A;  4XRF A;  5E1Z B;  5A2Q Z;  4HLY A;  3M9A A;  3KEO A;  2X4H A;  1FSE A;  5KK1 A;  1I1G A;  1O3S A;  2EFQ A;  3R0J A;  1AWC A;  2PEX A;  4Q48 A;  1ZH5 A;  5F64 A;  1QZY A;  2P7V B;  1USS A;  4ENN A;  4I0B A;  4DNC A;  3FMR A;  2RQP A;  3F8M A;  3S2W A;  2EK5 A;  4LLG F;  2QEN A;  5BS6 A;  2OU2 A;  2YX4 A;  1WI9 A;  1SD7 A;  2R3S A;  3RYP A;  2O61 A;  1FLI A;  1B9M A;  3K0L A;  3KP3 A;  2FBI A;  3D5L A;  3MWM A;  2DLL A;  3R60 A;  2W24 A;  2PMU A;  3HRM A;  3NEU A;  3GLX A;  4IF4 A;  5EEH A;  4LLN A;  3E5X A;  4OIQ F;  3RYR A;  4M74 A;  5HDN A;  1O7L A;  1G6N A;  2VXZ A;  2QWW A;  3C1D A;  2EV5 A;  2RDP A;  3FM5 A;  1XSV A;  3QRF F;  3F21 A;  2UXN A;  3WTY C;  1EH8 A;  3ECO A;  1OYW A;  4PGH A;  1D5V A;  1XCB A;  5D5U B;  2CSO A;  4ZZD A;  5FFX A;  3LQR A;  1Q1H A;  2FOK A;  3MCZ A;  3F8C A;  2QVO A;  1Z6T A;  4MTD A;  3T8R A;  5LGN A;  4BHB A;  2H6C A;  2L3D A;  1SAX A;  1SD5 A;  1B4A A;  4GCV A;  1BI0 A;  3IRR A;  2OAZ A;  3JAM K;  2JZY A;  1OKR A;  1W5T A;  4CO8 A;  5FB2 A;  4U88 A;  3QOP A;  5CVR A;  3F8F A;  1S8N A;  1XN7 A;  1FX7 A;  2FNP A;  1MKM A;  4N9H A;  3C3W A;  4PDK A;  1IXS B;  3TO6 A;  3E3V A;  3RI4 A;  2COM A;  4UVC A;  1ZHF A;  4MNU A;  4XSZ F;  4IVN A;  2QM3 A;  3JTG A;  3DXJ F;  5IT9 K;  2ZXJ A;  3O3K A;  3N4M A;  1TW3 A;  5BMZ A;  4RAY A;  1CF7 B;  3QP6 A;  1SFX A;  1S7O A;  2GA1 A;  3LA2 A;  2NRA C;  3TGN A;  4AVP A;  2KRF A;  4L0Y B;  3KP6 A;  3HYI A;  3V8K A;  3WE2 A;  3WTV C;  3SHF A;  1HKQ A;  1KU9 A;  2VBX A;  3QPH A;  4JK1 X;  2FE3 A;  2CG4 A;  2Y75 A;  1IN4 A;  2A3S A;  2JPC A;  3REO A;  5D4S A;  5J8F A;  2A6E F;  2HTJ A;  2MH2 A;  3I58 A;  1WRJ A;  2IRF G;  3DV8 A;  1E2X A;  1MD0 A;  4L5J A;  4KFC A;  3DP7 A;  3FXR A;  2K4J A;  5AIP A;  2W85 A;  1U5T B;  3LWF A;  4U0W A;  5E1W A;  4UVB A;  3M7G A;  2AS5 F;  4RGX A;  4HYE A;  5L3E A;  4L9N A;  1U78 A;  2DW4 A;  5LGT A;  2VT2 A;  1ZG3 A;  5D6F A;  3WG9 A;  1B6A A;  3FF5 A;  1GHC A;  4ON0 A;  2MA3 A;  3P9I A;  2ZME B;  2PI0 A;  2OZU A;  1HW1 A;  2DFI A;  5H6R A;  3TOA A;  2ACJ A;  2F2E A;  4EQQ A;  2DAO A;  1QGP A;  2M8E A;  2M1B A;  4XSX F;  5D5W B;  1F5T A;  5K5O A;  3JSP A;  3KCC A;  4EJW A;  3EET A;  1UCR A;  1ON1 A;  5AIQ A;  4ZYD A;  1CGP A;  3K1M A;  1T2K A;  4OIN F;  3OV8 A;  2CW0 F;  2CO5 A;  4I09 A;  4IPA A;  4MGR A;  3VEP A;  4BAY A;  1QBJ A;  3IRQ A;  2LNB A;  4WK8 F;  3NRV A;  3LAP A;  2VOD A;  4IJA A;  1PDN C;  5DUK A;  4DQ2 A;  4FX4 A;  4HBL A;  2QYO A;  5IT3 A;  1K78 A;  3I59 A;  1LVA A;  3EQL F;  3J81 K;  3GW2 A;  1FSH A;  1UHW A;  5ILS A;  4HV6 A;  4IXA A;  2WWY A;  3HTU A;  1U2W A;  2JSC A;  2XAG A;  4A0Z A;  2MBF A;  2FMY A;  2OD5 A;  4JBA A;  4WXD A;  2XAJ A;  1RIO H;  4HF1 A;  2GWR A;  3E6M A;  2K7L A;  4EJO A;  5HDK A;  2KKO A;  3VOE A;  2E7X A;  3CUQ C;  3R0A A;  1PUE E;  4HV5 A;  3B73 A;  4LK1 F;  3IC7 A;  3LFK A;  2HR3 A;  4A2U A;  1ZG1 A;  1XGM A;  2IVM A;  5HS7 A;  2HS5 A;  3WTW C;  1UST A;  2KIU A;  1LDJ A;  1R1U A;  1ZLK A;  4IRH A;  1S7A A;  2GAU A;  5ILU A;  2QLZ A;  2YU3 A;  5DV5 A;  2V1X A;  4ASN A;  3GUD A;  4GYI A;  2A68 F;  3CUQ A;  2HKO A;  3D0S A;  4HA8 A;  2PQ8 A;  1U8R A;  4O3M A;  3ZMS A;  3TQN A;  1REP C;  2DPU A;  4M72 A;  2HYG D;  2WV0 A;  3EYI A;  1U3E M;  2Q8K A;  1SD6 A;  1KGS A;  4B09 A;  4KYW A;  4L9T A;  1R36 A;  1D8J A;  4FT8 A;  1T6S A;  2X0L A;  5HLI A;  3MFK A;  5HLG A;  4U0V A;  3COA C;  3GX4 X;  2VOP A;  5DYM A;  1ZRF A;  2RN7 A;  4XBF A;  5TJJ A;  2OZ6 A;  2PFB A;  4L9J A;  4OIO F;  4H0E A;  3DKW A;  2XKP A;  1VTN C;  3BJO A;  4WX9 A;  3WTU C;  4Z2Y A;  5ICG A;  4D0P A;  2UXX A;  4L0Z B;  1DDN A;  3H3U A;  2BGC A;  1DPU A;  1LNW A;  1HST A;  1MZB A;  3FXU A;  1W7P B;  3QAH A;  2DI3 A;  4BHP A;  3R4K A;  3BOQ A;  3K69 A;  1UFM A;  4UHT A;  1JHF A;  3NQO A;  1P2F A;  3PQK A;  2Z33 A;  4LK0 F;  1IF1 A;  3HSF A;  3ISP A;  1OYY A;  1ZN2 A;  4EM1 A;  5AON A;  4HF0 A;  3RIR A;  2V79 A;  1SFE A;  3BRO A;  4GO1 A;  2ETH A;  1R5H A;  2VE8 A;  5D5X B;  2H94 A;  5HLH A;  5E1X A;  5DD4 A;  1IN7 A;  1STZ A;  3R6S A;  2RNJ A;  1EH6 A;  3ZN1 A;  2ZO4 A;  1K79 A;  2ZBK A;  3KP5 A;  2F5D A;  3IKT A;  4YFK F;  2DO7 A;  2A61 A;  2EFO A;  5F6F A;  1O3Q A;  5CYV A;  3RPU A;  4IHT A;  2P5V A;  3WTS C;  2L02 A;  3V8J A;  4ZYE A;  2FBH A;  4WXH A;  2GXG A;  3L7W A;  2V6C A;  2MH9 A;  2G9W A;  4A5M A;  2PJP A;  2QZ8 A;  1AOY A;  4EJU A;  4R79 A;  3KLN A;  3RTR A;  4UV8 A;  3IL2 A;  4OMY A;  1XMA A;  1FT9 A;  2FSW A;  2BV6 A;  1S29 A;  2H6B A;  3J80 Z;  2IA1 A;  5FFZ A;  1LEB A;  4RB1 A;  3M8E A;  4KDP A;  5LGU A;  4G7H F;  4A0Y A;  5JI6 A;  2HTS A;  4ESJ A;  3VOD A;  4HZF A;  1ZYR F;  1FBU A;  1YG2 A;  2Y0M A;  3M1E A;  1O57 A;  4QWQ A;  4S04 A;  2E1N A;  2VON A;  1YW7 A;  2E7W A;  3LAJ A;  2FEZ A;  3HIF A;  4ZYG A;  1XSD A;  4WCG A;  3GYH X;  1KA8 A;  4N9I A;  4I01 A;  1WWX A;  4KMU X;  1KYZ A;  3Q9S A;  1R22 A;  2VN2 A;  1MJ9 A;  3R61 A;  1QO0 D;  2HQR A;  1TQM A;  1SMT A;  5CVI A;  4LG0 B;  4EM0 B;  1FPQ A;  3K9T A;  3ZMT A;  3CO7 C;  2XAQ A;  1LJ9 A;  2ZJ2 A;  4LLL A;  1MDM B;  2L4A A;  6PAX A;  2KIF A;  5LRR A;  4U0Y A;  3T5X A;  4HDV A;  4M9X A;  3V7R A;  3ABT A;  2IA0 A;  5D8L B;  2FML A;  3RKW A;  2HFH A;  3L09 A;  4KIB A;  1E17 A;  3O2P E;  3V8L A;  1L3L A;  2L01 A;  2M45 A;  2DQL A;  1RUN A;  1ULY A;  2M30 A;  1I1S A;  4MHG A;  2XAF A;  3HHH A;  4BNC A;  3ZPL A;  1B9N A;  3P9C A;  1IW7 F;  3GZ5 A;  3E97 A;  2Q2E A;  3PFI A;  3WTX C;  4CIC A;  4OMZ A;  1LDD A;  4HDU A;  4YG2 F;  4ENM A;  4Y15 A;  3W6J B;  4IHS A;  1FBQ A;  3SXY A;  3AAF A;  2KJC A;  2EFN A;  1YS7 A;  2FF4 A;  2Z3Y A;  1BJA A;  2P4W A;  4RGU A;  1B59 A;  2CWE A;  3ECH A;  4KA4 A;  2NS0 A;  4EV0 A;  2P6T A;  5LRS A;  2A5Y B;  4HX8 A;  2IPQ X;  4R8H A;  2O3F A;  2MD5 A;  1D3Y A;  4MQV A;  3CUO A;  2P7C B;  1P6R A;  3U1D A;  5LHH A;  3H3Z A;  1G3Y A;  1XB4 A;  1GXQ A;  1R7J A;  4E70 A;  2PLY A;  4P9U A;  3MZY A;  2RGV A;  3L9F A;  1YS6 A;  5D8K B;  4M6X A;  2ADU A;  3GFM A;  4CXF A;  5CVJ A;  2JRT A;  2VC0 A;  2PG4 A;  4PZJ A;  1LDK B;  2ZFW A;  3GXO A;  3O6B B;  3U9G A;  1P4A A;  5BQT A;  3IKV A;  3KFW X;  1I5Z A;  2ZKZ A;  3BPX A;  3RJP A;  2STT A;  3I54 A;  2VC1 A;  3K2Z A;  3ULQ B;  2XV4 S;  2DK5 A;  1YIO A;  1QNT A;  4WF2 A;  4Y17 A;  2D45 A;  4B8X A;  4A0X A;  2D1H A;  2QQ9 A;  2K4B A;  1W5S A;  3JTH A;  1IZ1 A;  3ELK A;  2LF8 A;  3HRS A;  3RDI A;  2XVC A;  4NB5 A;  2XRO A;  5K5R A;  5DUI A;  3DEU A;  3ZMZ A;  2ZNY A;  2EA4 A;  1HBX G;  1SD4 A;  2LSO A;  3BZ6 A;  3N97 A;  2D2W A;  4RB2 C;  1G3T A;  4Q4Z F;  1J2X A;  5JHU A;  4KIF A;  2QQB A;  2OBP A;  5DCM B;  4EGZ A;  1IN5 A;  3T0Y A;  1QPM A;  3ABU A;  4HW0 A;  5IT9 Z;  5HOO A;  2HZT A;  3KP2 A;  2LF7 A;  5FLX Z;  2XIG A;  4OOI A;  2Y48 A;  5ED4 A;  5K1Y A;  1W4M A;  3G3Z A;  3TKY A;  1HKS A;  3M8F A;  2VBW A;  4UNO A;  5LBQ A;  2QQA A;  4UUV A;  3GVA A;  1ZRC A;  3WU0 A;  1ZGA A;  3V4G A;  3GO5 A;  5E8G A;  1K7A A;  4ESB A;  2ELH A;  2ZCW A;  4P96 A;  4HX4 A;  3TO7 A;  4A6D A;  3KET A;  1YW8 A;  2QBY B;  1J7K A;  1NHA A;  2RVC A;  3F22 A;  2PMH A;  1OPC A;  3WE3 A;  3F72 A;  4CGZ A;  2FNA A;  3ZQ7 A;  4P5O A;  1IN6 A;  1R23 A;  2G7H A;  2FRH A;  3HUG A;  4RS8 A;  4Y13 A;  2PBI A;  4KMF A;  4OIP F;  2F5F A;  1X3U A;  3I0T A;  4P55 A;  3DPT A;  2JTV A;  1FWZ A;  2PN6 A;  2HYF A;  2L54 A;  2F5C A;  2UZK A;  1ZLJ A;  4FX0 A;  4WXC A;  3E6B A;  2Z9O A;  1WKM A;  1DP7 P;  5CVU A;  1KU3 A;  1ONV A;  1G3W A;  1Z9C A;  2LKP A;  4KIC A;  4G6Q A;  4GXO A;  4EMS A;  3EUH A;  3KE2 A;  1YQA A;  4P9F A;  5HVQ C;  1R5G A;  2M87 A;  4JQF A;  1CF7 A;  4YFN F;  1UHM A;  3V7S A;  2H09 A;  4M6Y A;  1KYW A;  2ESN A;  1BI1 A;  2EV6 A;  2WC2 A;  4L18 B;  1KQ0 A;  1XDS A;  2IW5 A;  4U7B A;  2OQG A;  2Z99 A;  4M73 A;  1FYL A;  4Q5S F;  2EJR A;  5CLS A;  2BEO A;  3FWE A;  1T98 A;  1QZZ A;  1JHH A;  2KJB A;  3E5Q A;  3WGH A;  3B02 A;  4CZZ A;  1U5T C;  4GGG A;  1Z91 A;  3QU6 A;  5FO5 A;  3I53 A;  1MJB A;  4HQM A;  4RB0 A;  2P6S A;  4LJZ F;  4G9Y A;  4MTE A;  2HOE A;  3QP5 A;  1Z7U A;  1H9G A;  3G73 A;  3J81 Z;  3GZ6 A;  1U5T A;  1ZGJ A;  2GXB A;  5A2Q K;  1ON2 A;  1HQC A;  1TNT A;  1LQ1 A;  4UV9 A;  2STW A;  3DFG A;  3P9K A;  3CTA A;  1BIB A;  2W25 A;  3GWZ A;  4ZYH A;  3BDD A;  1SMY F;  1RI7 A;  1J9I A;  3CO6 C;  4BH9 A;  1FYK A;  1J5Y A;  3J80 K;  4KNY A;  2VBY A;  3JSO A;  2ZME A;  4R1H A;  5DEQ A;  1ZAO A;  3JW4 A;  3VFZ A;  1YTY A;  4WWC A;  3SFZ A;  4I2O A;  4OIR F;  2Z5U A;  1F4K A;  3F6V A;  3T8T A;  2MLK A;  3IWF A;  1KQ8 A;  5BOX A;  2LDU A;  4K2E A;  1WSU A;  3H92 A;  4UXN A;  2YSR A;  2B0L A;  2A6H F;  2J5P A;  3RKX A;  1BI3 A;  3ZMU A;  3HRT A;  3FZV A;  3OOP A;  4MQ9 F;  2K02 A;  2XGX A;  3SQN A;  2JPB A;  3TDZ C;  2GA2 A;  3HOT A;  1BC7 C;  2P8T A;  2EB7 A;  4L9V A;  3ROU A;  1KU7 A;  4NQW A;  3WU1 B;  5TRD A;  4RB3 C;  2XKO A;  1SFU A;  2NAZ A;  2HGC A;  4KN4 X;  3PQJ A;  2XRN A;  5ILV A;  3ZP5 A;  4I98 B;  1V4R A;  1S3J A;  1R1T A;  3P7N A;  3TDU C;  3KLO A;  5L3G A;  2TDX A;  2QUF A;  4F7Z A;  2D1V A;  1XSX A;  4BYY A;  2G7U A;  1LB2 A;  1FP1 D;  2FQ3 A;  3BPV A;  2GQQ A;  2DPD A;  1FYM A;  1KU2 A;  3ZMV A;  1GVJ A;  1HKT A;  3C18 A;  5HS8 A;  2ISY A;  1O3R A;  3HTS B;  4KT5 C;  2XUB A;  2RV8 A;  3I4P A;  5D4R A;  1YYV A;  4ESF A;  1XCV A;  2FU4 A;  1T0F A;  3DPL C;  1TTY A;  2FA5 A;  5ICC A;  1HW2 A;  3E6D A;  3FMS A;  3LA3 A;  2FXA A;  1YLF A;  1HSJ A;  2BBY A;  1DUX C;  1QQI A;  1FP2 A;  1FNN A;  3U2R A;  4EJV A;  2DBB A;  3RKY A;  1KQ9 A;  5ICE A;  4L5I A;  2XAH A;  1TQI A;  1MGT A;  1GXP A;  3MZH A;  1BN5 A;  2KIM A;  2HQN A;  1G3S A;  1YO5 C;  2MLG A;  2ZNZ A;  1P92 A;  4BHC A;  4TV7 A;  5CVV A;  2IA2 A;  4A6E A;  3IHU A;  2XHK A;  5H6Q A;  1JXS A;  5LEK A;  2Q0O A;  3VB2 A;  3EDP A;  2FBK A;  1J0R A;  2W84 A;  3WTZ A;  1K78 B;  2EWN A;  3HRU A;  1RZ4 A;  3I59 B;  3GFL A;  4M9S A;  2GIV A;  3KP4 A;  1J75 A;  2NYX A;  5CJ9 A;  2XAS A;  1Z1D A;  3CDH A;  2R7D A;  4AWX B;  4AIH A;  4NHJ A;  4EVI A;  2W57 A;  1JE8 A;  1BBY A;  4RAZ A;  4ENK A;  5E18 F;  1W7P A;  3HSR A;  2A07 F;  3MQ0 A;  3K1N A;  1IXC A;  1ZG5 A;  4BQA A;  1TQP A;  3I71 A;  5FD6 A;  2EA2 A;  3FM3 A;  3F8N A;  4Q47 A;  2HWV A;  4LB5 A;  3EYY A;  3K1P A;  2OA4 A;  1MJA A;  2YPR A;  2RKH A;  1OR7 A;  2IP2 A;  1FC3 A;  2WTE A;  3DQV C;  1L0O C;  4EGY A;  3CUQ B;  1K6O A;  4UVA A;  4HOB A;  4XLP F;  2J5O A;  4G94 A;  1R58 A;  1PP8 F;  5LHG A;  5FLX K;  2ISZ A;  2F5E A;  1FZP B;  3F23 A;  5L3B A;  4A12 A;  3KZZ A;  4YFX F;  1Y0U A;  1TNS A;  2DTR A;  1OYI A;  5L3D A;  3E5U A;  4G7Z F;  2HDC A;  3GFI A;  2IJL A;  4RGS A;  1YW9 A;  2YX7 A;  4AIJ A;  3J7A O;  2DU9 A;  2E1C A;  3BP8 A;  1XGS A;  1F9N A;  4O6J A;  2V9V A;  4I0A A;  4OU0 A;  4IRI A;  5J6X A;  2M5W A;  2AXL A;  2UWM A;  3JAM Z;  3MEX A;  1IN8 A;  1YFH A;  4FHT A;  3BJA A;  1EH7 A;  1R1V A;  4HAM A;  4CDG A;  2HEO A;  1T38 A;  2CYY A;  2DT5 A;  4G8X A;  5HS9 A;  5JVT A;  5F1R A;  1LEA A;  1C0W A;  3DF8 A;  1JGS A;  4U7D A;  2O8X A;  2A69 F;  1XMK A;  1BC8 C;  1FOK A;  3ZN0 A;  1DPR A;  1IXR C;  2P5L C;  3QU3 A;  2YR2 A;  4RGR A;  2BE5 F;  3FX3 A;  2EFP A;  4G7O F;  2EV0 A;  3CJN A;  1OMI A;  5LHI A;  5LLQ A;  4CYD A;  5KVR A;  3Q9V A;  5E8I A;  5L3F A;  4I7H A;  1PP7 U;  4LG0 A;  1ZRD A;  4MEX F;  1EV7 A;  5ICF A;  3L00 A;  1W7P D;  1ODD A;  1T39 A;  5FD5 A;  1MDM A;  4M9Z A;  1A04 A;  2JT1 A;  2EFW A;  5E20 A;  3F3X A;  5DDG A;  4CHU A;  2L4M A;  1ZAR A;  4I02 A;  4G6D A;  1TLH B;  4M71 A;  1IAW A;  4S05 A;  3SZT A;  3SZP A;  5DD8 A;  4YIF A;  4BXU A;  1I27 A;  2O6G E;  5L3C A;  2CQK A;  2VOO A;  1D8K A;  3TO9 A;  1O3T A;  5JFR A;  3HSE A;  2O03 A;  3KEQ A;  2VE9 A;  1BOA A;  4LFU A;  3TOB A;  2ESH A;  1HXD A;  4AD9 A;  2NNY A;  4YII A;  1XD7 A;  1FY7 A;  3WOD F;  4PCQ A;  1P4W A;  4PGG A;  1XGN A;  4IRG A;  1FBS A;  5BPI A;  1G4D A;  5FGM A;  3BY6 A;  4AIK A;  4XLN F;  5HDG A;  3MAJ A;  3GEZ A;  2MC3 A;  4LMY A;  1HW5 A;  4HQE A;  1B1B A;  3FHZ A;  5JR3 A;  2O0Y A;  5E17 F;  4KUM A;  1S6L A;  1BM9 A;  3C7J A;  1R00 A;  1IRG A;  5K5Q A;  3HHG A;  1I6X A;  5ERI A;  4MEY F;  1TBX A;  4QLC U;  3I5U A;  1U6G A;  3GFJ A;  2C6Y A;  3QPT A;  1J59 A;  4O5V A;  2NNN A;  2VT3 A;  3LQQ A;  3ML6 A;  4ZZL A;  1BI2 A;  3CLO A;  3BJ6 A;  3I64 A;  2CFX A;  4LD5 A;  3W6K B;  4HX7 A;  3IWZ A;  4KIG A;  1XGO A;  1WQ2 A;  3Q5F A;  3KZY A;  5DCF A;  4A5N A;  3L2C A;  1ZRE A;  4N0B A;  2V1U A;  3ZMD A; 
#chains in the Genus database with same CATH topology
 3ERE D;  2RC4 A;  2OJE D;  4HNU A;  3GTG J;  5C4J J;  2EZH A;  1UMQ A;  5H20 A;  4BBS J;  1BIA A;  2CGP A;  2DQR A;  3WGI A;  3L2W A;  4IKF A;  4LGW A;  4IHW A;  5K7Z A;  3I3L A;  4EM2 A;  2BYV E;  3BG7 A;  1FMW A;  3L2U A;  1VI0 A;  5EEG A;  2K85 A;  3FXQ A;  3WGG A;  2R7F A;  2P5K A;  1UB9 A;  4BKX A;  3KYL A;  5C44 J;  2VXD A;  2LY1 A;  3CJR B;  2OQR A;  3FMQ A;  5DCM A;  1AA7 A;  2MYS A;  4CSW A;  1TW2 A;  3HOS A;  3A2K A;  2IT0 A;  1IUY A;  1P4X A;  2V1D A;  3CC2 I;  4Y3O A;  4B47 A;  4HRI A;  2Z2S B;  5J8C A;  2E34 A;  4A3I J;  4MIM A;  1MSF C;  3F6O A;  1V55 H;  1F1Z A;  1Z6R A;  1OCT C;  2VQC A;  1FIP A;  2K9M A;  2Y31 A;  4GYG A;  3LST A;  3CJT B;  5BPD A;  2XF5 A;  5D6E A;  3KP7 A;  3T1B A;  4HF2 A;  1H9T A;  1B72 B;  4E7S A;  4EJT A;  3BWG A;  4HEA 2;  2BZT A;  1BJZ A;  4KJZ A;  1K83 J;  2GZW A;  2IEK A;  2JA6 J;  1K6Y A;  4HLX A;  4ZH4 F;  1V3F A;  3LA7 A;  2OCE A;  1O7F A;  1P7J A;  2ZC2 A;  5GTI C;  1IRF A;  3F8B A;  1YRN A;  3OYE A;  3K4K A;  5D5V B;  4CCL A;  2L7M P;  5KAI C;  3E6C C;  2E2J J;  2K27 A;  2R4G A;  5CQG A;  2LMD A;  3TP0 A;  1Z05 A;  3K10 A;  4XN3 A;  1SEU A;  2LLK A;  4RDU A;  2FUG 2;  1H0M A;  4LB6 B;  4ENJ A;  1RUO A;  5LEJ A;  3V7C A;  2XGC A;  1RNL A;  4W1U A;  3WTT C;  3VYU B;  3GF2 A;  3TMO A;  2LBF A;  1QA6 A;  3A0B C;  2QBY A;  4ETS A;  4C2T A;  4N4O B;  1MBF A;  2VBZ A;  5EZG A;  3H9J A;  3A4C A;  1XDU A;  2M7B A;  2HKX A;  2DK8 A;  1T0F C;  1TWG J;  2CUF A;  4NBQ A;  1WZ2 A;  2K86 A;  3S14 J;  3M3Y J;  3RPQ A;  3CMA I;  5F0H A;  5J4Y A;  4KN7 X;  2EIN H;  2M4G A;  2H27 A;  5K7H A;  4XRF A;  5E1Z B;  3K4B A;  5A2Q Z;  4HLY A;  3M9A A;  3KEO A;  2X4H A;  4A3K J;  4B4C A;  1FSE A;  3TL4 X;  2W48 A;  3V42 A;  3RZO J;  3PNV A;  5KK1 A;  1I1G A;  1O3S A;  3CDL A;  2EFQ A;  4DYR A;  1SVM A;  2E19 A;  3R0J A;  1AWC A;  2PEX A;  2IGM A;  4Q48 A;  2MW8 A;  1OLT A;  1ZH5 A;  5F64 A;  4A3D J;  2NVQ J;  1QZY A;  2P7V B;  2DA3 A;  1USS A;  4ENN A;  3B6A A;  4I0B A;  4DNC A;  3FMR A;  2RQP A;  3F8M A;  3S2W A;  1SFO J;  4D1Q A;  2EK5 A;  3I55 I;  4LLG F;  2QEN A;  5BS6 A;  1DU0 A;  1H88 C;  5CPR B;  1WJA A;  3LSJ A;  5GPA A;  2DMT A;  3I9V 2;  2OU2 A;  1TWA J;  2IBD A;  2YX4 A;  1WI9 A;  3FDY A;  1VQL I;  1SD7 A;  1OIS A;  2R3S A;  2BY0 A;  3OWT A;  3RYP A;  3H9Q A;  2O61 A;  1FLI A;  1X4O A;  1B9M A;  5DTD A;  3K0L A;  1JKO C;  4FCY A;  4GRI A;  2L2O A;  3ASN H;  3BCA A;  4NUB A;  3S8P A;  3KP3 A;  1I50 J;  2FBI A;  3D5L A;  2X51 A;  3CCU I;  3MWM A;  3D1N I;  4XID A;  2ECB A;  3CCR I;  2M3A A;  1I39 A;  1DGW Y;  4IOC F;  2DLL A;  5B5E C;  3R60 A;  2DMU A;  2DT6 A;  4LIV A;  2W24 A;  4U87 A;  1TWC J;  2PMU A;  3HRM A;  2L0K A;  3NEU A;  3GLX A;  4IF4 A;  3HZJ A;  5EEH A;  4LLN A;  3E5X A;  3K4L A;  4OIQ F;  3AL0 B;  3RYR A;  4M74 A;  5HDN A;  1O7L A;  3NWT A;  1G6N A;  2VXZ A;  1N78 A;  2KZV A;  5GAD J;  1OCR H;  2DYR H;  3W2W A;  1ZR2 A;  5E3L A;  2QWW A;  1X1P A;  1ZGW A;  1EA3 A;  2DCE A;  3C1D A;  1I6H J;  2EV5 A;  2RDP A;  3BG9 A;  3FBN B;  2QKM B;  3FM5 A;  5B1A H;  1PUF A;  1U9O A;  1XSV A;  2BOL A;  3QRF F;  1XG1 A;  2DTZ A;  3CLQ A;  3F21 A;  2DT7 B;  1AKH A;  1Z3Y A;  1Q1V A;  1WJD A;  2UXN A;  3WTY C;  1EH8 A;  3ECO A;  2W82 A;  1OYW A;  4PGH A;  3FIW A;  1MNM C;  1D5V A;  4E7Z A;  1XCB A;  5D5U B;  5J40 A;  2CSO A;  5KHD A;  4ZZD A;  1UEL B;  5FFX A;  2CUZ A;  3Q3S A;  3LQR A;  1Q1H A;  2FOK A;  3MCZ A;  3F8C A;  2QVO A;  1Z6T A;  4MTD A;  3VYT B;  4E7J A;  3T8R A;  5LGN A;  3HUG B;  2CQQ A;  4BHB A;  3JRD A;  2EIJ H;  2DMQ A;  2H6C A;  2L3D A;  1SAX A;  1SD5 A;  3DLL F;  3CCM I;  4BE1 A;  3HXL A;  1B4A A;  4GCV A;  1BI0 A;  3IRR A;  3JRI A;  2OAZ A;  3JAM K;  2JZY A;  1OKR A;  1W5T A;  4CO8 A;  5FB2 A;  1UZC A;  3PUF A;  2V7F A;  4U88 A;  3QOP A;  2R5Y B;  5CVR A;  3F8F A;  4M3G A;  1S8N A;  3ZOB A;  2PJR A;  1XN7 A;  4BL0 B;  4XQF A;  2OC6 A;  1FX7 A;  3BTL A;  4B44 A;  1QRY A;  2VL8 A;  2FNP A;  3PM1 A;  1MKM A;  4N9H A;  4IO9 F;  3C3W A;  2HOA A;  4RMN A;  4PDK A;  3OY9 A;  1TT5 B;  1IXS B;  3TO6 A;  3E3V A;  3RI4 A;  2COM A;  4UVC A;  3CD6 I;  1X2N A;  3E0J B;  4HPQ A;  1ZHF A;  2F6C A;  5IYB J;  2Z16 A;  4MNU A;  3QOD A;  3PNY A;  2HDD A;  3DTE A;  4XSZ F;  3ZQG A;  1OCP A;  4IVN A;  3PJR A;  2QM3 A;  3JTG A;  2Y69 H;  3DXJ F;  5JHF A;  5IT9 K;  2ZXJ A;  5KAF C;  3O3K A;  3O8H A;  5GAG J;  3N4M A;  1TW3 A;  5BMZ A;  4RAY A;  1CF7 B;  2XGD A;  3QP6 A;  1SFX A;  1S7O A;  1D1C A;  2GA1 A;  3C2B A;  3LA2 A;  5E3N A;  2NRA C;  4PFP A;  1POG A;  3TGN A;  4JYK A;  3JRH A;  4AVP A;  4ZDL A;  2Y2Z A;  2COB A;  4PJ0 C;  3TBI A;  2KRF A;  1A35 A;  1HC8 A;  2K9L A;  4L0Y B;  3S16 J;  3KP6 A;  3HYI A;  3V8K A;  2E5Z A;  1P9Q C;  3WE2 A;  3WTV C;  3S2D J;  3SHF A;  1LE8 B;  1HKQ A;  1KU9 A;  2VBX A;  3QPH A;  5B1B H;  1GT0 C;  2M34 A;  4JK1 X;  4BQN A;  3CES A;  2FE3 A;  2CG4 A;  2KQR A;  2HOT A;  1XPX A;  2Y75 A;  1IN4 A;  2A3S A;  2JPC A;  2KLO A;  3JRB A;  4I76 A;  4A3F J;  3REO A;  1ZKG A;  5D4S A;  2A6E F;  5J8F A;  2HTJ A;  2MH2 A;  5FLV A;  1B8I B;  4BY7 J;  2JN6 A;  2DOF A;  3I58 A;  4A3E J;  1VQ7 I;  1WRJ A;  4Y4R A;  2IRF G;  4BJ5 C;  3DV8 A;  1WJF A;  1E2X A;  1MD0 A;  4L5J A;  5LFA A;  2JSP A;  3J7Z I;  4BXF A;  4KFC A;  2IGO A;  3DP7 A;  3RKQ A;  4M6V A;  3GTM J;  3FXR A;  2K4J A;  4CCN A;  2BW3 A;  2EH3 A;  5AIP A;  2W85 A;  3QWL A;  3TW6 A;  1U5T B;  3LWF A;  3C2G A;  1BR1 A;  4U0W A;  5E1W A;  3MVP A;  4UVB A;  4DOZ A;  1YIJ I;  3M7G A;  2VUM J;  3OR2 C;  1BOB A;  2AS5 F;  1OJL A;  3B6C A;  2JVH A;  1W5C C;  4LOC A;  4RGX A;  3ZQF A;  1JT6 A;  4HYE A;  2VKD A;  5L3E A;  1Z3X A;  4L9N A;  1WCM J;  1U78 A;  2DW4 A;  4C3J J;  1VQ9 I;  2AHQ A;  1NG7 A;  5LGT A;  2VT2 A;  1G59 A;  1U9N A;  5IPA A;  2GOX B;  1ZG3 A;  5D6F A;  3WG9 A;  3JRA A;  3CF5 F;  5M5W J;  1B6A A;  3FF5 A;  1GLN A;  4M3F A;  1GHC A;  1W36 D;  4ON0 A;  4BUP A;  4IHX A;  2MA3 A;  2MGQ A;  3P9I A;  4W97 A;  2ZME B;  4LIU A;  2PI0 A;  2CQ7 A;  2IS1 A;  2OZU A;  2F5V A;  1HW1 A;  2DFI A;  5H6R A;  3TOA A;  5FRO A;  2F2E A;  4EQQ A;  2ACJ A;  2DAO A;  2V9K A;  1QGP A;  1K61 A;  3H3V K;  1ERD A;  2M8E A;  4BU2 A;  3K70 C;  2M1B A;  4XSX F;  5D5W B;  1F5T A;  3RCO A;  1MMG A;  5K5O A;  1VQP I;  2GM4 A;  3OYK A;  3JSP A;  1P7I A;  1J09 A;  3KCC A;  4EJW A;  3EET A;  1UCR A;  2L9V A;  1ON1 A;  4F92 B;  3ABK H;  5AIQ A;  4ZYD A;  1CGP A;  2EZL A;  2VAS A;  2YS9 A;  1D5Y A;  2OTL I;  2JRM A;  3K1M A;  1T2K A;  1Z0X A;  3S1M J;  4OIN F;  2CUJ A;  4A3C J;  1ZEL A;  1BR4 A;  5F08 A;  4DJA A;  2M8G X;  3OV8 A;  1MBG A;  2CW0 F;  4XR6 A;  2NS7 A;  2CO5 A;  3O8G A;  4NQW B;  3HOY J;  4I09 A;  4QSH A;  2LFB A;  4IPA A;  4MGR A;  3VEP A;  4BAY A;  3BQZ A;  1YIT I;  2P81 A;  4AUX A;  3IRQ A;  1QBJ A;  1HOM A;  2LC2 A;  1RET A;  4RM3 A;  3VYS B;  2LNB A;  2WAQ A;  2XPW A;  1RPW A;  3SEQ A;  4WK8 F;  4ABZ A;  4E7L A;  1UAA A;  2ZB9 A;  2KDO A;  3WG7 H;  1FEX A;  5F0F A;  2OCC H;  3NRV A;  1IO2 A;  3DTK A;  4XKC A;  3LAP A;  2VOD A;  5K7F A;  4IJA A;  1PDN C;  5DUK A;  4DZJ A;  4DQ2 A;  2EIK H;  2FX0 A;  3ZCO A;  3LSM A;  5EGO B;  4HBL A;  2HU9 A;  4FX4 A;  3ERM A;  1VQM I;  2QYO A;  2E36 A;  5IT3 A;  1K78 A;  3I59 A;  4HSR A;  1LVA A;  3HL2 A;  3EQL F;  3J81 K;  3GW2 A;  1FSH A;  1FTZ A;  3P5J A;  2HPI A;  1UHW A;  5ILS A;  1BW6 A;  4HV6 A;  1JTX A;  4IXA A;  4C9Y A;  2WWY A;  1WGX A;  3HBL A;  3HTU A;  4UUS B;  1U2W A;  5J1U A;  3IH3 A;  2JSC A;  3OYN A;  3HG9 A;  2XAG A;  4DGW B;  2P0W A;  4L5E A;  4A0Z A;  1VF9 A;  4OAY A;  2MBF A;  4CCM A;  2FMY A;  2OD5 A;  2X1C A;  2JQ7 A;  4JBA A;  4WXD A;  2XAJ A;  3JRF A;  1RIO H;  4HF1 A;  2GWR A;  1F43 A;  4NDL A;  3E6M A;  2K7L A;  4EJO A;  5HDK A;  1DGR M;  2KKO A;  2W4S A;  3VOE A;  2E7X A;  3CUQ C;  4DYQ A;  2EZI A;  3R0A A;  2FQ4 A;  1PUE E;  3CCY A;  3B73 A;  4HV5 A;  4LK1 F;  3IC7 A;  3LFK A;  2HR3 A;  4A2U A;  5M5X J;  1ZG1 A;  1XGM A;  2IVM A;  2B7E A;  4XLF A;  5HS7 A;  2HNH A;  5EG0 B;  2HS5 A;  3WTW C;  1UST A;  2KIU A;  1LDJ A;  1R1U A;  2ID6 A;  2WB1 A;  1ZLK A;  4D9J A;  1Y0N A;  1IG7 A;  4IRH A;  4V2G A;  3DBR B;  1S7A A;  2GAU A;  1WJE A;  3PSI A;  4JP0 A;  5ILU A;  2QLZ A;  2QSH X;  4CCK A;  2V4J C;  2WY7 Q;  3QOE A;  2YU3 A;  5DV5 A;  2V1X A;  4ASN A;  3GUD A;  2IS4 A;  2WAE A;  4GYI A;  2A68 F;  1SVO A;  4D5C A;  3CUQ A;  2HKO A;  3D0S A;  4HA8 A;  2OV7 A;  3GME A;  2PQ8 A;  1U8R A;  4O3M A;  3ZMS A;  2R5Z B;  3TQN A;  1REP C;  4XL9 A;  4M72 A;  2DPU A;  2HYG D;  4C2U A;  2WV0 A;  3EYI A;  1U3E M;  3L2Q A;  1OQY A;  2Q8K A;  1SD6 A;  2EIM H;  2E1M B;  3MKW B;  1KGS A;  4B09 A;  1JUP A;  2QSG X;  4KYW A;  2DA6 A;  1ZQ3 P;  2MD0 A;  1MND A;  1AHD P;  4XIC A;  3DTI A;  5FKM A;  4L9T A;  4V19 K;  1R36 A;  2M0M A;  3CCJ I;  1D8J A;  4FT8 A;  2OF7 A;  1T6S A;  3H36 A;  2X0L A;  2OPT A;  5HLI A;  3MFK A;  2KIQ A;  3FXK A;  5HLG A;  1JT0 A;  4U0V A;  3COA C;  3GX4 X;  2VOP A;  5DYM A;  3L2R A;  1ZRF A;  2RN7 A;  4XBF A;  5TJJ A;  2BVL A;  1GUU A;  3LOC A;  2OZ6 A;  2EIL H;  4XMY A;  3OIP A;  1Y8R B;  2EQR A;  2PFB A;  4L9J A;  4OIO F;  4JX4 A;  2XSJ C;  4UB8 C;  5KCM A;  4H0E A;  3DKW A;  2XKP A;  4AID A;  1VTN C;  3OS1 A;  3BJO A;  3H5N A;  4IHV A;  4WX9 A;  2X48 A;  1A5J A;  5CQE A;  3M07 A;  3WTU C;  5JVG F;  4AM3 A;  3CQZ J;  1MNE A;  1JUS A;  1S7E A;  4Z2Y A;  4BE2 A;  4B3A A;  5ICG A;  2CH0 A;  4D0P A;  2UXX A;  4L0Z B;  1QU3 A;  2XB5 A;  1MH4 A;  1FOX A;  1DDN A;  3H3U A;  3ONQ A;  2BGC A;  2LG4 A;  2JWT A;  3K4N A;  4GDF A;  3BTC A;  1LNW A;  1HST A;  1MZB A;  3FXU A;  1TL8 A;  1DPU A;  1W7P B;  3QAH A;  2DI3 A;  2M7A A;  4BHP A;  3R4K A;  1HA8 A;  1D1A A;  5DM6 F;  1ZTR A;  3ZQH A;  3BOQ A;  3K69 A;  1UFM A;  4UHT A;  3W6V A;  1Y39 A;  1JHF A;  2FD5 A;  2Y9Y A;  3NQO A;  1P2F A;  3ZQQ A;  2VJJ A;  2HVQ A;  5KNL A;  3PQK A;  3BLY A;  2Z33 A;  4LK0 F;  2DA7 A;  3HSF A;  3ISP A;  1IF1 A;  4BAC A;  1OYY A;  5FKO A;  1ZN2 A;  2DMP A;  4C30 A;  4EM1 A;  1MW7 A;  1CQT A;  1TWH J;  2CS3 A;  1W1W E;  4A3M J;  1A31 A;  5AON A;  3E7L A;  1RKT A;  2E5N A;  4HF0 A;  3RIR A;  2V79 A;  2JMW A;  3G6E I;  1SFE A;  3JRC A;  4CCO A;  3PIO F;  3BRO A;  3CCE I;  2R92 J;  3DBL B;  3HGY A;  1QPI A;  4Y33 A;  4ZJZ A;  1UG2 A;  3EPZ A;  1QZE A;  4GO1 A;  2ELK A;  2ETH A;  4J00 A;  1R5H A;  2VE8 A;  3IH4 A;  2H94 A;  5D5X B;  5HLH A;  2KRH A;  5E1X A;  5GAH J;  5DD4 A;  1IN7 A;  1V5E A;  2DFH A;  1STZ A;  2CW7 A;  3R6S A;  2RNJ A;  3G1L A;  1EH6 A;  2FJ1 A;  3ZN1 A;  2ZO4 A;  1K79 A;  2ZBK A;  3BTI A;  1NK2 P;  3KP5 A;  2F5D A;  1OCC H;  1IRX A;  1SAU A;  3U1K A;  2XF6 A;  3PSF A;  3IKT A;  3H0D A;  3JR9 A;  2H8R A;  1MSE C;  4YFK F;  2DO7 A;  1ENH A;  3OYG A;  2DA4 A;  4NNJ A;  2WAF A;  3FK7 A;  1LFP A;  2A61 A;  2EFO A;  2M2E A;  5F6F A;  3NWS A;  3L1P A;  1O3Q A;  5CYV A;  1IV8 A;  2RNG A;  3RPU A;  4IHT A;  2P5V A;  3WTS C;  3S1N J;  3EUA A;  2L02 A;  3V8J A;  4ZYE A;  2FBH A;  4WXH A;  2GXG A;  3L7W A;  2V6C A;  2MH9 A;  2G9W A;  4A5M A;  3G4S I;  2PJP A;  3IH2 A;  2QZ8 A;  1AOY A;  4EJU A;  2DA2 A;  1JJ6 C;  5GTH C;  3LNQ A;  3KZI C;  4R79 A;  3M8J A;  3KLN A;  3RTR A;  2R7Q A;  2X6Y A;  4UV8 A;  2ME6 A;  1X3Z B;  4JX5 A;  3IL2 A;  4OMY A;  1XMA A;  3CP2 A;  1FT9 A;  1V5G A;  2FSW A;  3DCF A;  2BV6 A;  2LR8 A;  3SZG A;  1S29 A;  3F9K A;  3S2H J;  2H6B A;  3J80 Z;  2HI3 A;  2IA1 A;  4UB6 C;  5FFZ A;  4RB1 A;  1LEB A;  3AG2 H;  2HQA A;  1ETV A;  3M8E A;  4KDP A;  5LGU A;  4G7H F;  4OAZ A;  4A0Y A;  5JI6 A;  4QPO A;  2VJI A;  1YHQ I;  5JLW A;  5FKK A;  3OYM A;  1YJN I;  2HTS A;  3CME I;  3VOD A;  4HZF A;  1FBU A;  1ZYR F;  3DU6 A;  4ESJ A;  1NK3 P;  1YG2 A;  2XDV A;  2Y0M A;  3K7A J;  2NVX J;  3BR5 A;  3M1E A;  1O57 A;  4QWQ A;  4S04 A;  2E1N A;  2D5V A;  1JGG A;  1U8B A;  3TW7 A;  2VON A;  4X6A J;  2DXI A;  4BEH B;  1YW7 A;  2ZSH B;  2E7W A;  4AU7 A;  4P1W A;  3LAJ A;  1MIJ A;  2FEZ A;  3HIF A;  5IP7 J;  4ZYG A;  1X58 A;  5DM7 F;  4J01 A;  3OYL A;  4E4H A;  4BY1 J;  2VJ5 A;  5EDN A;  1XSD A;  4CA0 A;  4WCG A;  1IUF A;  4XLH A;  1KA8 A;  4N9I A;  3GYH X;  1BW5 A;  1XX5 A;  4I01 A;  2MFZ A;  1WWX A;  3FKI J;  1KYZ A;  3Q9S A;  1R22 A;  2VN2 A;  1MJ9 A;  4KMU X;  2B63 J;  2PX9 A;  2M4K A;  3R61 A;  4ZTJ A;  1X1A A;  5EZH A;  1QO0 D;  2HQR A;  1TQM A;  1SMT A;  5CVI A;  4LG0 B;  4EM0 B;  3ESW B;  2WV1 A;  1FPQ A;  3A02 A;  3K9T A;  3VPR A;  1Y1V J;  3KPH A;  4JX6 A;  3ZMT A;  3CO7 C;  2XAQ A;  2XPU A;  1LJ9 A;  1VFC A;  2ZJ2 A;  4LLL A;  2VB6 A;  2CV0 A;  1MDM B;  1Z77 A;  4XM3 A;  2L4A A;  6PAX A;  2KIF A;  5LRR A;  5M3M J;  2R7V A;  3H5A A;  4MO7 A;  4S0H B;  4AYB A;  4U0Y A;  4PJL A;  3T5X A;  4HDV A;  1T8I A;  1LKX A;  4M9X A;  3V7R A;  3ABT A;  2IA0 A;  2K9Q A;  2H1K A;  5D8L B;  2FML A;  1JUM A;  3RKW A;  2HFH A;  4PJM A;  3L09 A;  4KIB A;  2DOD A;  1E17 A;  3O2P E;  4E7I A;  3S17 J;  3V8L A;  4IOA F;  1YX3 A;  2CV1 A;  5M3F J;  5FLM J;  1L3L A;  2L01 A;  2M45 A;  2DQL A;  2NS8 A;  2G0E A;  4D5F A;  3K4M A;  1RUN A;  1ULY A;  3OS2 A;  3ABL H;  2M30 A;  1I1S A;  3A01 B;  4MHG A;  2XAF A;  3HHH A;  4BNC A;  3ZPL A;  1B9N A;  4J19 A;  3P9C A;  4RM2 A;  2LY9 A;  3DEE A;  1BL0 A;  3HB9 A;  1IW7 F;  1RR8 C;  1ACI A;  1FJL A;  4QIW N;  2ID3 A;  4ANJ A;  4YEL A;  3GZ5 A;  3E97 A;  3BQY A;  2Q2E A;  3EUK L;  3IP4 B;  3PFI A;  3WTX C;  4CIC A;  4OMZ A;  2K3F A;  1LDD A;  2K9S A;  4HDU A;  4YG2 F;  4ENM A;  3G2B A;  4Y15 A;  3W6J B;  4IHS A;  1FBQ A;  2JUC A;  3HDD A;  3SXY A;  2JJ7 A;  3AAF A;  4LIT A;  2KJC A;  2EFN A;  1DU6 A;  1SFK A;  1YS7 A;  2A05 A;  2FF4 A;  1WFX A;  2Z3Y A;  2GXA A;  1X3W B;  1BJA A;  1WJC A;  2P4W A;  1DQU A;  4RGU A;  4H4K C;  3RPU D;  1B59 A;  4F3Q A;  4CYC B;  5FRM A;  2CWE A;  2GBY A;  3ECH A;  2NS0 A;  4KA4 A;  3TED A;  4EV0 A;  2P6T A;  4BGD A;  5F1J A;  5LRS A;  5HLT A;  1VQN I;  2A5Y B;  3N05 A;  3E1S A;  4HX8 A;  2IPQ X;  3W2V A;  4R8H A;  2O3F A;  2R0Q C;  4XRS G;  1WJ5 A;  2MD5 A;  3LSG A;  1D3Y A;  3OL3 A;  4MQV A;  3S15 J;  3CUO A;  3QYE A;  2P7C B;  1D0Y A;  5EF6 A;  3Q0U A;  2CMP A;  3MMY B;  1Y1W J;  1P6R A;  3U1D A;  1X1D A;  5LHH A;  1WPK A;  4F55 A;  3H3Z A;  3IUO A;  1QHH D;  1G3Y A;  1XB4 A;  2WBM A;  2N8G A;  1GXQ A;  1X1B A;  1R7J A;  4E70 A;  1B72 A;  2PLY A;  4M3D A;  4P9U A;  3MZY A;  2RGV A;  3L9F A;  1YS6 A;  5D8K B;  1MBE A;  2W00 A;  4M6X A;  2ADU A;  3GFM A;  4CXF A;  4A3G J;  4A3L J;  4FIS A;  5FKN A;  1GVD A;  5CVJ A;  1MBK A;  2I5U A;  2JRT A;  2PG4 A;  2VC0 A;  4PZJ A;  1LDK B;  2ZFW A;  1S72 I;  3GXO A;  3SEZ A;  1PVE A;  3O6B B;  3U9G A;  5J1R A;  3GTQ J;  1P4A A;  4HNT A;  5BQT A;  2KMU A;  3AG3 H;  3IKV A;  3KFW X;  3JCU C;  1I5Z A;  2JA5 J;  2DYS H;  2ZKZ A;  3BPX A;  3RJP A;  2STT A;  1X19 A;  3I54 A;  2VC1 A;  3K2Z A;  3QPL A;  1IRZ A;  3FXJ A;  2E1O A;  3ULQ B;  4YRV A;  1LVK A;  2XV4 S;  3HEF A;  2DK5 A;  3LSK A;  1YIO A;  2BHY A;  1QNT A;  1K4T A;  4WF2 A;  4Y17 A;  2LD5 A;  4Y52 J;  5IP6 A;  3BR3 A;  2K40 A;  2D45 A;  2PMZ A;  1EF4 A;  4B8X A;  1WHU A;  4A0X A;  3CCQ I;  2D1H A;  3C2H A;  3DWL E;  2QQ9 A;  2Y9Z A;  2K4B A;  1I3Q J;  1W5S A;  2M0C A;  3JTH A;  3S93 A;  5LD2 C;  1IZ1 A;  3ELK A;  1IDY A;  1OCZ H;  2DDB A;  4E6K G;  2CW8 A;  2DA5 A;  2LF8 A;  3HRS A;  3RDI A;  2XVC A;  4NB5 A;  2XRO A;  2JUG A;  5K5R A;  1O4X A;  5DUI A;  1R4M B;  4PFO A;  2YUS A;  3DEU A;  3ZMZ A;  1UJ8 A;  2ZNY A;  2EA4 A;  1F36 A;  1HBX G;  1SD4 A;  2LSO A;  3BZ6 A;  3N97 A;  2D2W A;  2KPM A;  2RRE A;  4RB2 C;  1G3T A;  3GZN B;  4F52 A;  3D5R C;  3H0G J;  4Q4Z F;  3AL0 C;  1J2X A;  5JHU A;  4D7M A;  4KIF A;  3BR6 A;  2QQB A;  2OBP A;  5DCM B;  4EGZ A;  1IN5 A;  3T0Y A;  1QPM A;  2NVY J;  3ABU A;  2WA0 A;  4XK4 A;  2NVU B;  2LH9 A;  1AU7 A;  4HW0 A;  5IT9 Z;  4DYC A;  1JKR C;  2R93 J;  5HOO A;  3KYC B;  2HZT A;  3KP2 A;  2JA8 J;  3K4C A;  3FIS A;  1UG0 A;  2LF7 A;  4RAG A;  1R5I D;  2XIG A;  3CMM A;  1WJB A;  5FLX Z;  3OL4 A;  2BHZ A;  4KIS A;  1X1C A;  2HDW A;  4OOI A;  2Y48 A;  3HM5 A;  3MZ8 A;  4HNV A;  5ED4 A;  5K1Y A;  1RR7 A;  1W4M A;  3G3Z A;  3TKY A;  3OIO A;  1IJW C;  2BXY A;  2IAI A;  1TZL A;  1HKS A;  4Z6Y A;  1YRN B;  2Y0S A;  2LKS A;  3M8F A;  2VBW A;  5H2F C;  5LBQ A;  2QF7 A;  2QQA A;  1EJ9 A;  4UNO A;  3GVA A;  4UUV A;  2R7X A;  1ZRC A;  3WU0 A;  1ZGA A;  3OIQ A;  1ETQ A;  4YIR X;  3V4G A;  3GO5 A;  2MAB A;  3CF2 A;  5E8G A;  3RQI A;  1K7A A;  4ESB A;  3UKG A;  1IV6 A;  3GTO J;  2ELH A;  1PJR A;  1R4N B;  3LSH A;  2ZCW A;  4P96 A;  4HX4 A;  3TO7 A;  4A6D A;  3KET A;  2L5Q A;  2QA4 I;  2DA1 A;  2LBF B;  3U21 A;  2RAE A;  1JJ8 C;  4BDY A;  1YW8 A;  2QBY B;  1J7K A;  1NHA A;  1U0J A;  2L9S A;  2OUM A;  4X1E A;  2RVC A;  2ME0 A;  3F22 A;  3AG1 H;  2Q1Z B;  2PMH A;  1OPC A;  3WE3 A;  1HLV A;  1PYV A;  3F72 A;  2CV2 A;  3OYD A;  4CGZ A;  2FNA A;  5CKT A;  3ZQ7 A;  1HF0 A;  4P5O A;  1IN6 A;  1R23 A;  2G7H A;  2FRH A;  3HUG A;  4RS8 A;  1FIA A;  3K2A A;  4Y13 A;  2PBI A;  2LY2 A;  4KMF A;  4OIP F;  1ZK8 A;  4XNF A;  4F93 B;  2F5F A;  5FRN A;  1X3U A;  3I0T A;  4XKV A;  2XRL A;  2LP0 A;  2IS6 A;  1JTY A;  3BR1 A;  2DOA A;  3A03 A;  2MSY A;  3EUH C;  4P55 A;  3DPT A;  5IOZ A;  2JTV A;  2MC4 A;  1FWZ A;  2X9D A;  2K3P A;  2HYF A;  2L54 A;  2PN6 A;  3CCS I;  2R5Y A;  2F5C A;  2UZK A;  1ZLJ A;  4FX0 A;  1YJ9 I;  4WXC A;  3M4O J;  2DMN A;  4PUS A;  3E6B A;  2Z9O A;  1WKM A;  2VQL A;  1DP7 P;  5CVU A;  2QSF X;  1KU3 A;  3HOU J;  1RRJ A;  1ONV A;  1G3W A;  3I56 I;  1T95 A;  1Z9C A;  2LKP A;  4KIC A;  4G6Q A;  4IEJ A;  4GXO A;  3MD2 A;  4EMS A;  3EUH A;  3I4N J;  3KE2 A;  1YQA A;  1A6Q A;  4P9F A;  5HVQ C;  1R5G A;  1S5L C;  2M87 A;  2NOJ B;  4JQF A;  4YFN F;  1CF7 A;  1FMV A;  2R7U A;  5J47 A;  3PO3 J;  1UHM A;  3V7S A;  2H09 A;  4M6Y A;  1KYW A;  5EYR A;  1M1E B;  1BI1 A;  2ESN A;  2EV6 A;  1KZH A;  1E3P A;  2KP6 A;  4D7N A;  2WC2 A;  3BG5 A;  1QVU A;  4N4N B;  4RLF A;  4L18 B;  1KQ0 A;  1XDS A;  2IW5 A;  3ASO H;  4U7B A;  2OQG A;  2Z99 A;  2Y30 A;  2UUZ A;  4M73 A;  1FYL A;  4Q5S F;  2EBI A;  2XSD C;  2EJR A;  5CLS A;  2CRG A;  2BEO A;  1ZR4 A;  3D5S C;  3FWE A;  3GBG A;  1T98 A;  3LSR A;  1QZZ A;  1PUF B;  1LE8 A;  1JHH A;  3S3O A;  2KJB A;  3BCB A;  3E5Q A;  3WGH A;  3B02 A;  4CZZ A;  1U5T C;  4GGG A;  1HDD C;  1D0Z A;  1Z91 A;  3QU6 A;  1LUJ B;  1AKH B;  2E2H J;  5FO5 A;  2L7K A;  3I53 A;  1MJB A;  3VSK A;  2XPV A;  3S1R J;  3KYD B;  4HQM A;  4RB0 A;  4DIQ A;  2NVT J;  2P6S A;  4LJZ F;  2KL4 A;  4G9Y A;  4DBR A;  2VPL A;  1W0U A;  4MTE A;  2HOE A;  1B8I A;  3G1O A;  3K6G A;  3QP5 A;  1Z7U A;  3W2A A;  1H9G A;  4ZTF A;  3OMY A;  4II3 A;  4IQ4 A;  4CUG A;  1MMA A;  4XOT A;  3DKX A;  3G73 A;  4F91 B;  2H8W A;  4A93 J;  4PJJ A;  3J81 Z;  2ZME C;  3GZ6 A;  1U5T A;  3MKL A;  1ZGJ A;  2GXB A;  2QEX I;  5A2Q K;  1ON2 A;  2HOS A;  1HQC A;  1TNT A;  1LQ1 A;  4UV9 A;  2STW A;  3DFG A;  4XN0 A;  3P9K A;  3CTA A;  1BIB A;  2W25 A;  3GWZ A;  4ZYH A;  3K70 D;  2E71 A;  3BDD A;  1MBJ A;  3JRE A;  1SMY F;  1RI7 A;  1OCO H;  1J9I A;  2PJR B;  3CO6 C;  4BH9 A;  1FYK A;  5F27 A;  3MKY B;  1NTC A;  4FAS D;  2A5W A;  1J5Y A;  2ELJ A;  2L7F P;  3H1C A;  3J80 K;  4KNY A;  4CH7 A;  3UNG C;  2ZSI B;  3L2V A;  5EJC A;  5IYC J;  2VBY A;  4PJN A;  1TP4 A;  3JSO A;  2ZME A;  4R1H A;  2LKX A;  5FKL A;  4PSW A;  5DEQ A;  1ZAO A;  3JW4 A;  1V54 H;  3VFZ A;  1YTY A;  3VYR B;  4WWC A;  3SFZ A;  4AYB N;  4I2O A;  4OIR F;  2Z5U A;  2CJJ A;  3FHN A;  1F4K A;  5F04 A;  3HOV J;  3F6V A;  3FXM A;  3DBH B;  1MBH A;  3T8T A;  2ZFU A;  1VQ4 I;  2MLK A;  3IWF A;  1KQ8 A;  3GTK J;  2QQ8 A;  5BOX A;  3BR0 A;  3CC4 I;  2LDU A;  1JI8 A;  4NC8 A;  4K2E A;  4BS9 A;  1WSU A;  2E35 A;  3H92 A;  4B48 A;  4UXN A;  2YSR A;  2B0L A;  4MLO A;  1WH7 A;  1IGN A;  2A6H F;  2J5P A;  3FK6 A;  2XAU A;  3RKX A;  1BI3 A;  3ZMU A;  1NH3 A;  2FOW A;  1T08 B;  3SFI A;  3PUB A;  3HRT A;  3FZV A;  2KIS A;  3OOP A;  1A36 A;  2HVR A;  4MQ9 F;  2K02 A;  2XGX A;  3SQN A;  1MMS A;  4IX7 A;  2JPB A;  3TDZ C;  2GA2 A;  1ETK A;  3HOT A;  1BC7 C;  3AFH A;  2P8T A;  2EB7 A;  4L9V A;  3ROU A;  2B9S A;  1KU7 A;  4NQW A;  1E0E A;  3WU1 B;  5TRD A;  2O8K A;  1VND A;  3CJQ B;  4RB3 C;  2IXS A;  2XKO A;  1SFU A;  3CZ6 A;  2NAZ A;  3RSN A;  2H1L A;  2HGC A;  4KN4 X;  2R7Z J;  2HQ5 A;  3PQJ A;  2XRN A;  5ILV A;  3ZP5 A;  1HDP A;  1ETY A;  4I98 B;  1V4R A;  5GP9 A;  1S3J A;  5J3L A;  1R1T A;  3P7N A;  3TDU C;  3HJE A;  3KLO A;  3BTJ A;  5L3G A;  5EGO A;  2BXZ A;  2TDX A;  3RQ4 A;  5DS9 A;  4EEF G;  2X6X A;  2BW3 B;  4KT6 A;  2QUF A;  4F7Z A;  2D1V A;  4A69 C;  4NC6 A;  4AC0 A;  1XSX A;  3SDG A;  4BYY A;  2G7U A;  1Z7L A;  1LB2 A;  1Z21 A;  3CCL I;  2GIZ A;  1FP1 D;  3BPV A;  1SVL A;  2FQ3 A;  3X2Q H;  2GQQ A;  3OYI A;  4C3I J;  3UR3 C;  1FYM A;  2DPD A;  3VWB A;  5IOY A;  1KU2 A;  3HOX J;  3ZMV A;  1GVJ A;  4UUS A;  1HKT A;  3C18 A;  5HS8 A;  2ISY A;  3ZQC A;  1O3R A;  2JVG A;  3A1Y A;  1APL C;  3HTS B;  4KT5 C;  2XUB A;  3ZGK A;  2XC7 A;  2RV8 A;  3CDI A;  4B43 A;  3I4P A;  5D4R A;  1YYV A;  4ESF A;  1XCV A;  2XB0 X;  3CCV I;  2FU4 A;  2KRC A;  1T0F A;  5M5Y J;  2BY1 A;  3DPL C;  3FBI B;  1TTY A;  2FA5 A;  5ICC A;  3OSG A;  3HKZ A;  1HW2 A;  2DJN A;  3E6D A;  3GTL J;  2BY3 A;  4XOP A;  3G1M A;  3ZQL A;  3FMS A;  3LA3 A;  2FXA A;  5EG0 A;  1I3A A;  5BNG A;  2EPF A;  2E1M C;  1N25 A;  3LFU A;  1YLF A;  2QGU A;  1HSJ A;  2BBY A;  2XF7 A;  1DUX C;  1QQI A;  2CU7 A;  1FP2 A;  2EZK A;  2KHM A;  2BY2 A;  2VKH A;  1FNN A;  3U2R A;  4EJV A;  1W36 C;  3BR2 A;  2M9H A;  2DBB A;  3RKY A;  4B3X A;  3OYC A;  3HPH A;  1KQ9 A;  2V9P A;  5ICE A;  4L5I A;  1RES A;  2XAH A;  1TQI A;  2HPM A;  1K4S A;  2PMZ N;  1N75 A;  1MGT A;  2VIX A;  3FXO A;  2R5Z A;  1GXP A;  2E2I J;  3MZH A;  1BN5 A;  5J1Y A;  3PL8 A;  2AO9 A;  2KIM A;  3KEY A;  2X6W A;  2CQX A;  2HQN A;  1G3S A;  4E7K A;  2VKE A;  3S1Q J;  2KDZ A;  2MLG A;  2ZNZ A;  1YO5 C;  2ICW G;  2GLO A;  3JRG A;  1P92 A;  5GAE J;  5E3M A;  4BHC A;  3SYT A;  4TV7 A;  2LRE A;  5CVV A;  2IA2 A;  1DP3 A;  4A6E A;  3IHU A;  2XHK A;  5H6Q A;  3HPG A;  2O5R A;  3BZC A;  1JXS A;  5LEK A;  1H89 C;  1YE9 A;  3LL7 A;  1LFU P;  2IGN A;  2Q0O A;  3VB2 A;  3EDP A;  1N77 A;  2FBK A;  1FTT A;  3BG3 A;  1J0R A;  2W84 A;  3WTZ A;  1K78 B;  2EWN A;  3HC7 A;  3HRU A;  1RZ4 A;  3I59 B;  3QYF A;  3GFL A;  1NG6 A;  4M9S A;  2GIV A;  2O9L A;  3KP4 A;  1J75 A;  3OYA A;  4BXX J;  2NYX A;  5CJ9 A;  2XAS A;  1WVR A;  1Z1D A;  3S3N A;  5TGT A;  4PSX A;  3CDH A;  2R7D A;  4AWX B;  4ZDO A;  3KX2 A;  4AIH A;  2I8D A;  3NAU A;  4NHJ A;  2DDA A;  4II2 A;  4EVI A;  4AVZ A;  2W57 A;  2VKV A;  2TRT A;  1RC9 A;  1JE8 A;  3S3M A;  2CQN A;  1UHS A;  2L9N A;  2HXO A;  3GTP J;  2LTP A;  2R7T A;  5C4X J;  1BBY A;  4RAZ A;  4ENK A;  1X2M A;  5E18 F;  2VI6 A;  2ZJP F;  4FE4 A;  1TT0 A;  1W7P A;  3HSR A;  2A07 F;  1OR7 C;  2R7S A;  1W0T A;  3MQ0 A;  2XGE A;  3K1N A;  4PK4 A;  2VQH A;  1IXC A;  2Y0S N;  1ZG5 A;  5B66 C;  4LG3 A;  4BQA A;  1RKW A;  1TQP A;  2AQF A;  3I71 A;  5FD6 A;  2EA2 A;  1ETO A;  3Q0W A;  3BC8 A;  3BZK A;  2WAQ N;  3FM3 A;  2A6T A;  3VSL A;  3F8N A;  5EEA A;  4Q47 A;  1GV5 A;  2HWV A;  4V2F A;  4LB5 A;  3EYY A;  3K1P A;  2OA4 A;  1VQ6 I;  4XLE A;  3PO2 J;  4I99 C;  5HNF A;  1MJA A;  2IGK A;  2YPR A;  2RQQ A;  3W3C A;  3LMM A;  2LOO A;  3DU5 A;  5E3O A;  1KON A;  2RKH A;  4GFB A;  1OR7 A;  2IP2 A;  1FC3 A;  2WTE A;  3DQV C;  3HGG A;  1VQK I;  4RAF A;  1L0O C;  1Y8Q B;  4EGY A;  2UV1 A;  3CUQ B;  1K6O A;  3I4M J;  4UVA A;  4HOB A;  4XLP F;  2J5O A;  4G94 A;  1R58 A;  3OSF A;  1PP8 F;  5LHG A;  1TWF J;  1T56 A;  5FLX K;  2ISZ A;  1LFB A;  2F5E A;  1FZP B;  3F23 A;  2ZXI A;  5L3B A;  4A12 A;  3KZZ A;  4YFX F;  1V5F A;  3BG6 A;  3RZD J;  4BQQ A;  1Y0U A;  5FJ8 J;  1TNS A;  2DTR A;  1OYI A;  1R6R A;  2ZXH A;  3TP3 A;  5L3D A;  4XKB A;  3E5U A;  4X0G A;  4IL6 C;  4G7Z F;  4C3H J;  2HDC A;  3J7A Y;  3GFI A;  2IJL A;  4MFE A;  3S32 A;  2F4O B;  3FKJ A;  5GPC A;  4RGS A;  4A3B J;  1YW9 A;  2YX7 A;  4AIJ A;  3OYH A;  3J7A O;  2DU9 A;  2E1C A;  5F0C A;  3BP8 A;  1XGS A;  2HYJ A;  1F9N A;  4XKW A;  4O6J A;  2V9V A;  4I0A A;  2LYC A;  4OU0 A;  5IP9 J;  4RBO A;  4IRI A;  1YOV B;  1Y6I A;  5J6X A;  1GDT A;  2M5W A;  1G8X A;  2WB1 N;  3WU2 C;  3CMY A;  3J7Y J;  2AXL A;  2UWM A;  3JAM Z;  3MEX A;  1GV2 A;  2ZXW H;  1EKE A;  1IN8 A;  1H8A C;  3OYJ A;  2V1N A;  2YU9 J;  3Q0V A;  1YFH A;  4FHT A;  3BJA A;  2DFE A;  4FE7 A;  2Z1D A;  1EH7 A;  1R1V A;  4HAM A;  4MFD A;  2NOG A;  4BBR J;  4CDG A;  2HEO A;  4FTH A;  1T38 A;  2WAD A;  4XLC A;  4BJT A;  2CYY A;  2DT5 A;  4G8X A;  3QQA A;  5HS9 A;  5JVT A;  4IQJ A;  3DKY A;  3WHC A;  2TCT A;  5F1R A;  5TIS C;  4ZC3 A;  2W7N A;  1LEA A;  1VZ0 A;  1XMX A;  1C0W A;  3DF8 A;  3K4J A;  3A0H C;  1YJW I;  4CCJ A;  1S9H A;  1JGS A;  4U7D A;  1YI2 I;  1VQ8 I;  3CC7 I;  2HXI A;  4G12 A;  2O8X A;  4XOR A;  1VQ5 I;  2A69 F;  1XMK A;  2HZD A;  1BC8 C;  1FOK A;  3ZN0 A;  3SDB A;  1DPR A;  2X85 A;  4ITV A;  1BA5 A;  1IXR C;  1IC8 A;  2P5L C;  3DPU A;  3QU3 A;  2K5C A;  3KIO A;  4QPQ A;  2YR2 A;  4RGR A;  2L9R A;  1WH5 A;  2DJI A;  4BEH A;  2BE5 F;  2KFD A;  2VPR A;  3FX3 A;  2VQG A;  2EFP A;  2X1E A;  1XTA A;  4G7O F;  4HG2 A;  2R7W A;  2EV0 A;  3CJN A;  1OMI A;  5J4V A;  5LLQ A;  5LHI A;  4CYD A;  5KVR A;  3Q9V A;  3MKZ A;  4ZYA A;  5E8I A;  4BQO A;  5L3F A;  2KZG A;  3SJM A;  4I7H A;  1PP7 U;  4LG0 A;  4BE0 A;  2E60 A;  2ZJQ F;  1WI3 A;  4B1R A;  1ZRD A;  1E3O C;  2MG4 A;  1D0X A;  4MEX F;  4IHY A;  4XLA A;  1ETX A;  4OWR B;  3DEW A;  1EV7 A;  5ICF A;  2L7Z A;  3L00 A;  2O7O A;  1W7P D;  4Y7N J;  1ODD A;  1T39 A;  4M3E A;  5FD5 A;  4UY8 I;  4RLQ A;  5HOD A;  1QHG A;  3M1C A;  1MDM A;  4M9Z A;  2V6E A;  3VDX A;  1A04 A;  2JT1 A;  3LSI A;  2EFW A;  5E20 A;  2BVM A;  3F3X A;  3IV5 A;  2V26 A;  5DDG A;  1D1B A;  4CHU A;  2L4M A;  1ZAR A;  4I02 A;  1R9T J;  4G6D A;  2QKL B;  4BJ6 C;  1E3H A;  1TLH B;  4M71 A;  1IAW A;  4S05 A;  3SZT A;  2DFF A;  3SZP A;  3H5R A;  3OR1 C;  5DD8 A;  4UUT A;  4DZP A;  4YIF A;  3ZXS A;  4BXU A;  1ETW A;  1YX5 A;  2CUE A;  1I27 A;  2O6G E;  4JOM A;  5L3C A;  2CQK A;  4M3B A;  1Z67 A;  2K9N A;  2VOO A;  3A01 A;  1D8K A;  2VJ4 A;  3TO9 A;  1O3T A;  5JFR A;  1MMD A;  2R7R A;  3HSE A;  2O03 A;  3KEQ A;  2VE9 A;  3ZR8 X;  1BOA A;  2AXT C;  3BT9 A;  4LFU A;  3TOB A;  3ZRG A;  1VQO I;  2ESH A;  1HXD A;  4AD9 A;  1A6I A;  4XRS A;  2NNY A;  1SAN A;  4YII A;  1R71 A;  3QPS A;  1TC3 C;  3IAM 2;  2HVS A;  2AQE A;  3H35 A;  2F4M B;  2DN0 A;  3GCM A;  4DBQ A;  1XD7 A;  2WY8 Q;  1FY7 A;  3NAR A;  1BR2 A;  4NC7 A;  3WOD F;  1ORK A;  2DOE A;  2NXN B;  4PCQ A;  5IYD J;  1P4W A;  2IS2 A;  1OFC X;  4I6Z A;  3LSP A;  4PGG A;  4A3J J;  1XGN A;  1R49 A;  1XC5 A;  4IRG A;  1X4P A;  3WHB A;  4CYC A;  1FBS A;  5BPI A;  3GTJ J;  1G4D A;  2ZJR F;  5FGM A;  3BY6 A;  4AIK A;  2JA7 J;  2LK2 A;  3OOU A;  1FOY A;  3AG4 H;  3OYF A;  4KIT B;  4BDZ A;  1QVT A;  4XLN F;  5HDG A;  3MAJ A;  3OYB A;  3GEZ A;  2MC3 A;  4LMY A;  3F0C A;  3HOW J;  1HW5 A;  2F4I A;  2JK3 A;  5IY5 H;  4HQE A;  3PIP F;  2KT0 A;  2R7O A;  1B1B A;  2X6O A;  3FHZ A;  5JR3 A;  4XON A;  2O0Y A;  1IDZ A;  1JKP C;  1G2H A;  1HCR A;  3QYB A;  1FOW A;  5E17 F;  4CZC A;  4KUM A;  1S6L A;  4C2M J;  2JA2 A;  1BM9 A;  1Y56 A;  4QTR A;  9ANT A;  3C7J A;  4XRM A;  5E79 C;  1R00 A;  1IRG A;  2F48 A;  4IZZ A;  3ZQI A;  2LRD A;  5K5Q A;  1XS9 A;  3HHG A;  1T33 A;  4HST A;  1I6X A;  5ERI A;  3HOZ J;  2OTJ I;  2I10 A;  4MEY F;  1TBX A;  4QLC U;  3I5U A;  3MN2 A;  1U6G A;  3GFJ A;  2C6Y A;  3QPT A;  3H9G A;  1J59 A;  4O5V A;  4ZDP A;  2NNN A;  5B3S H;  1MMN A;  2CFO A;  3OS0 A;  4DW6 A;  2W1O A;  2VT3 A;  1ITY A;  2ECC A;  4YEJ A;  3G71 I;  3FXL A;  3LQQ A;  3ML6 A;  5JLX A;  1SC7 A;  4ZZL A;  4E7H A;  3PNT A;  4G6T B;  3GLL A;  4FQG A;  1BI2 A;  4EAT A;  3CLO A;  3BJ6 A;  3CP8 A;  3HKZ N;  3I64 A;  2CFX A;  4LD5 A;  3W6K B;  4FET A;  5C3E J;  4HX7 A;  1MH3 A;  5HNH A;  3IAS 2;  3PFY A;  3IWZ A;  4KIG A;  3DLA A;  1XGO A;  4RA2 A;  1WQ2 A;  3Q5F A;  3KZY A;  2X1D A;  5DCF A;  2Q2E B;  4A5N A;  3L2C A;  1LPQ A;  1ZRE A;  3ABM H;  3AKZ A;  4N0B A;  2V1U A;  3ZMD A;  2QCO A;  2LVS A;  2GOM A;  2VLA A;  1JKQ C; 
#chains in the Genus database with same CATH homology
 3ERE D;  2RC4 A;  5H20 A;  1BIA A;  2CGP A;  2DQR A;  3WGI A;  4LGW A;  4EM2 A;  2BYV E;  5EEG A;  3FXQ A;  3WGG A;  2R7F A;  2P5K A;  1UB9 A;  2OQR A;  3FMQ A;  5DCM A;  1TW2 A;  3HOS A;  2IT0 A;  1IUY A;  1P4X A;  2V1D A;  5J8C A;  3F6O A;  1F1Z A;  1Z6R A;  4GYG A;  3LST A;  5BPD A;  5D6E A;  3KP7 A;  3T1B A;  4HF2 A;  1H9T A;  4EJT A;  3BWG A;  2GZW A;  4HLX A;  4ZH4 F;  1V3F A;  3LA7 A;  1O7F A;  1IRF A;  3F8B A;  5D5V B;  3E6C C;  2K27 A;  1Z05 A;  1H0M A;  1RUO A;  4LB6 B;  4ENJ A;  5LEJ A;  3V7C A;  1RNL A;  3WTT C;  3GF2 A;  2QBY A;  4ETS A;  2VBZ A;  1XDU A;  2HKX A;  2DK8 A;  2K86 A;  3RPQ A;  4KN7 X;  2H27 A;  4XRF A;  5E1Z B;  5A2Q Z;  4HLY A;  3M9A A;  3KEO A;  2X4H A;  1FSE A;  5KK1 A;  1I1G A;  1O3S A;  2EFQ A;  3R0J A;  1AWC A;  2PEX A;  4Q48 A;  1ZH5 A;  5F64 A;  1QZY A;  2P7V B;  1USS A;  4ENN A;  4I0B A;  4DNC A;  3FMR A;  2RQP A;  3F8M A;  3S2W A;  2EK5 A;  4LLG F;  2QEN A;  5BS6 A;  2OU2 A;  2YX4 A;  1WI9 A;  1SD7 A;  2R3S A;  3RYP A;  2O61 A;  1FLI A;  1B9M A;  3K0L A;  3KP3 A;  2FBI A;  3D5L A;  3MWM A;  2DLL A;  3R60 A;  2W24 A;  2PMU A;  3HRM A;  3NEU A;  3GLX A;  4IF4 A;  5EEH A;  4LLN A;  3E5X A;  4OIQ F;  3RYR A;  4M74 A;  5HDN A;  1O7L A;  1G6N A;  2VXZ A;  2QWW A;  3C1D A;  2EV5 A;  2RDP A;  3FM5 A;  1XSV A;  3QRF F;  3F21 A;  2UXN A;  3WTY C;  1EH8 A;  3ECO A;  1OYW A;  4PGH A;  1D5V A;  1XCB A;  5D5U B;  2CSO A;  4ZZD A;  5FFX A;  3LQR A;  1Q1H A;  2FOK A;  3MCZ A;  3F8C A;  2QVO A;  1Z6T A;  4MTD A;  3T8R A;  5LGN A;  4BHB A;  2H6C A;  2L3D A;  1SAX A;  1SD5 A;  1B4A A;  4GCV A;  1BI0 A;  3IRR A;  2OAZ A;  3JAM K;  2JZY A;  1OKR A;  1W5T A;  4CO8 A;  5FB2 A;  4U88 A;  3QOP A;  5CVR A;  3F8F A;  1S8N A;  1XN7 A;  1FX7 A;  2FNP A;  1MKM A;  4N9H A;  3C3W A;  4PDK A;  1IXS B;  3TO6 A;  3E3V A;  3RI4 A;  2COM A;  4UVC A;  1ZHF A;  4MNU A;  4XSZ F;  4IVN A;  2QM3 A;  3JTG A;  3DXJ F;  5IT9 K;  2ZXJ A;  3O3K A;  3N4M A;  1TW3 A;  5BMZ A;  4RAY A;  1CF7 B;  3QP6 A;  1SFX A;  1S7O A;  2GA1 A;  3LA2 A;  2NRA C;  3TGN A;  4AVP A;  2KRF A;  4L0Y B;  3KP6 A;  3HYI A;  3V8K A;  3WE2 A;  3WTV C;  3SHF A;  1HKQ A;  1KU9 A;  2VBX A;  3QPH A;  4JK1 X;  2FE3 A;  2CG4 A;  2Y75 A;  1IN4 A;  2A3S A;  2JPC A;  3REO A;  5D4S A;  5J8F A;  2A6E F;  2HTJ A;  2MH2 A;  3I58 A;  1WRJ A;  2IRF G;  3DV8 A;  1E2X A;  1MD0 A;  4L5J A;  4KFC A;  3DP7 A;  3FXR A;  2K4J A;  5AIP A;  2W85 A;  1U5T B;  3LWF A;  4U0W A;  5E1W A;  4UVB A;  3M7G A;  2AS5 F;  4RGX A;  4HYE A;  5L3E A;  4L9N A;  1U78 A;  2DW4 A;  5LGT A;  2VT2 A;  1ZG3 A;  5D6F A;  3WG9 A;  1B6A A;  3FF5 A;  1GHC A;  4ON0 A;  2MA3 A;  3P9I A;  2ZME B;  2PI0 A;  2OZU A;  1HW1 A;  2DFI A;  5H6R A;  3TOA A;  2ACJ A;  2F2E A;  4EQQ A;  2DAO A;  1QGP A;  2M8E A;  2M1B A;  4XSX F;  5D5W B;  1F5T A;  5K5O A;  3JSP A;  3KCC A;  4EJW A;  3EET A;  1UCR A;  1ON1 A;  5AIQ A;  4ZYD A;  1CGP A;  3K1M A;  1T2K A;  4OIN F;  3OV8 A;  2CW0 F;  2CO5 A;  4I09 A;  4IPA A;  4MGR A;  3VEP A;  4BAY A;  1QBJ A;  3IRQ A;  2LNB A;  4WK8 F;  3NRV A;  3LAP A;  2VOD A;  4IJA A;  1PDN C;  5DUK A;  4DQ2 A;  4FX4 A;  4HBL A;  2QYO A;  5IT3 A;  1K78 A;  3I59 A;  1LVA A;  3EQL F;  3J81 K;  3GW2 A;  1FSH A;  1UHW A;  5ILS A;  4HV6 A;  4IXA A;  2WWY A;  3HTU A;  1U2W A;  2JSC A;  2XAG A;  4A0Z A;  2MBF A;  2FMY A;  2OD5 A;  4JBA A;  4WXD A;  2XAJ A;  1RIO H;  4HF1 A;  2GWR A;  3E6M A;  2K7L A;  4EJO A;  5HDK A;  2KKO A;  3VOE A;  2E7X A;  3CUQ C;  3R0A A;  1PUE E;  4HV5 A;  3B73 A;  4LK1 F;  3IC7 A;  3LFK A;  2HR3 A;  4A2U A;  1ZG1 A;  1XGM A;  2IVM A;  5HS7 A;  2HS5 A;  3WTW C;  1UST A;  2KIU A;  1LDJ A;  1R1U A;  1ZLK A;  4IRH A;  1S7A A;  2GAU A;  5ILU A;  2QLZ A;  2YU3 A;  5DV5 A;  2V1X A;  4ASN A;  3GUD A;  4GYI A;  2A68 F;  3CUQ A;  2HKO A;  3D0S A;  4HA8 A;  2PQ8 A;  1U8R A;  4O3M A;  3ZMS A;  3TQN A;  1REP C;  2DPU A;  4M72 A;  2HYG D;  2WV0 A;  3EYI A;  1U3E M;  2Q8K A;  1SD6 A;  1KGS A;  4B09 A;  4KYW A;  4L9T A;  1R36 A;  1D8J A;  4FT8 A;  1T6S A;  2X0L A;  5HLI A;  3MFK A;  5HLG A;  4U0V A;  3COA C;  3GX4 X;  2VOP A;  5DYM A;  1ZRF A;  2RN7 A;  4XBF A;  5TJJ A;  2OZ6 A;  2PFB A;  4L9J A;  4OIO F;  4H0E A;  3DKW A;  2XKP A;  1VTN C;  3BJO A;  4WX9 A;  3WTU C;  4Z2Y A;  5ICG A;  4D0P A;  2UXX A;  4L0Z B;  1DDN A;  3H3U A;  2BGC A;  1DPU A;  1LNW A;  1HST A;  1MZB A;  3FXU A;  1W7P B;  3QAH A;  2DI3 A;  4BHP A;  3R4K A;  3BOQ A;  3K69 A;  1UFM A;  4UHT A;  1JHF A;  3NQO A;  1P2F A;  3PQK A;  2Z33 A;  4LK0 F;  1IF1 A;  3HSF A;  3ISP A;  1OYY A;  1ZN2 A;  4EM1 A;  5AON A;  4HF0 A;  3RIR A;  2V79 A;  1SFE A;  3BRO A;  4GO1 A;  2ETH A;  1R5H A;  2VE8 A;  5D5X B;  2H94 A;  5HLH A;  5E1X A;  5DD4 A;  1IN7 A;  1STZ A;  3R6S A;  2RNJ A;  1EH6 A;  3ZN1 A;  2ZO4 A;  1K79 A;  2ZBK A;  3KP5 A;  2F5D A;  3IKT A;  4YFK F;  2DO7 A;  2A61 A;  2EFO A;  5F6F A;  1O3Q A;  5CYV A;  3RPU A;  4IHT A;  2P5V A;  3WTS C;  2L02 A;  3V8J A;  4ZYE A;  2FBH A;  4WXH A;  2GXG A;  3L7W A;  2V6C A;  2MH9 A;  2G9W A;  4A5M A;  2PJP A;  2QZ8 A;  1AOY A;  4EJU A;  4R79 A;  3KLN A;  3RTR A;  4UV8 A;  3IL2 A;  4OMY A;  1XMA A;  1FT9 A;  2FSW A;  2BV6 A;  1S29 A;  2H6B A;  3J80 Z;  2IA1 A;  5FFZ A;  1LEB A;  4RB1 A;  3M8E A;  4KDP A;  5LGU A;  4G7H F;  4A0Y A;  5JI6 A;  2HTS A;  4ESJ A;  3VOD A;  4HZF A;  1ZYR F;  1FBU A;  1YG2 A;  2Y0M A;  3M1E A;  1O57 A;  4QWQ A;  4S04 A;  2E1N A;  2VON A;  1YW7 A;  2E7W A;  3LAJ A;  2FEZ A;  3HIF A;  4ZYG A;  1XSD A;  4WCG A;  3GYH X;  1KA8 A;  4N9I A;  4I01 A;  1WWX A;  4KMU X;  1KYZ A;  3Q9S A;  1R22 A;  2VN2 A;  1MJ9 A;  3R61 A;  1QO0 D;  2HQR A;  1TQM A;  1SMT A;  5CVI A;  4LG0 B;  4EM0 B;  1FPQ A;  3K9T A;  3ZMT A;  3CO7 C;  2XAQ A;  1LJ9 A;  2ZJ2 A;  4LLL A;  1MDM B;  2L4A A;  6PAX A;  2KIF A;  5LRR A;  4U0Y A;  3T5X A;  4HDV A;  4M9X A;  3V7R A;  3ABT A;  2IA0 A;  5D8L B;  2FML A;  3RKW A;  2HFH A;  3L09 A;  4KIB A;  1E17 A;  3O2P E;  3V8L A;  1L3L A;  2L01 A;  2M45 A;  2DQL A;  1RUN A;  1ULY A;  2M30 A;  1I1S A;  4MHG A;  2XAF A;  3HHH A;  4BNC A;  3ZPL A;  1B9N A;  3P9C A;  1IW7 F;  3GZ5 A;  3E97 A;  2Q2E A;  3PFI A;  3WTX C;  4CIC A;  4OMZ A;  1LDD A;  4HDU A;  4YG2 F;  4ENM A;  4Y15 A;  3W6J B;  4IHS A;  1FBQ A;  3SXY A;  3AAF A;  2KJC A;  2EFN A;  1YS7 A;  2FF4 A;  2Z3Y A;  1BJA A;  2P4W A;  4RGU A;  1B59 A;  2CWE A;  3ECH A;  4KA4 A;  2NS0 A;  4EV0 A;  2P6T A;  5LRS A;  2A5Y B;  4HX8 A;  2IPQ X;  4R8H A;  2O3F A;  2MD5 A;  1D3Y A;  4MQV A;  3CUO A;  2P7C B;  1P6R A;  3U1D A;  5LHH A;  3H3Z A;  1G3Y A;  1XB4 A;  1GXQ A;  1R7J A;  4E70 A;  2PLY A;  4P9U A;  3MZY A;  2RGV A;  3L9F A;  1YS6 A;  5D8K B;  4M6X A;  2ADU A;  3GFM A;  4CXF A;  5CVJ A;  2JRT A;  2VC0 A;  2PG4 A;  4PZJ A;  1LDK B;  2ZFW A;  3GXO A;  3O6B B;  3U9G A;  1P4A A;  5BQT A;  3IKV A;  3KFW X;  1I5Z A;  2ZKZ A;  3BPX A;  3RJP A;  2STT A;  3I54 A;  2VC1 A;  3K2Z A;  3ULQ B;  2XV4 S;  2DK5 A;  1YIO A;  1QNT A;  4WF2 A;  4Y17 A;  2D45 A;  4B8X A;  4A0X A;  2D1H A;  2QQ9 A;  2K4B A;  1W5S A;  3JTH A;  1IZ1 A;  3ELK A;  2LF8 A;  3HRS A;  3RDI A;  2XVC A;  4NB5 A;  2XRO A;  5K5R A;  5DUI A;  3DEU A;  3ZMZ A;  2ZNY A;  2EA4 A;  1HBX G;  1SD4 A;  2LSO A;  3BZ6 A;  3N97 A;  2D2W A;  4RB2 C;  1G3T A;  4Q4Z F;  1J2X A;  5JHU A;  4KIF A;  2QQB A;  2OBP A;  5DCM B;  4EGZ A;  1IN5 A;  3T0Y A;  1QPM A;  3ABU A;  4HW0 A;  5IT9 Z;  5HOO A;  2HZT A;  3KP2 A;  2LF7 A;  5FLX Z;  2XIG A;  4OOI A;  2Y48 A;  5ED4 A;  5K1Y A;  1W4M A;  3G3Z A;  3TKY A;  1HKS A;  3M8F A;  2VBW A;  4UNO A;  5LBQ A;  2QQA A;  4UUV A;  3GVA A;  1ZRC A;  3WU0 A;  1ZGA A;  3V4G A;  3GO5 A;  5E8G A;  1K7A A;  4ESB A;  2ELH A;  2ZCW A;  4P96 A;  4HX4 A;  3TO7 A;  4A6D A;  3KET A;  1YW8 A;  2QBY B;  1J7K A;  1NHA A;  2RVC A;  3F22 A;  2PMH A;  1OPC A;  3WE3 A;  3F72 A;  4CGZ A;  2FNA A;  3ZQ7 A;  4P5O A;  1IN6 A;  1R23 A;  2G7H A;  2FRH A;  3HUG A;  4RS8 A;  4Y13 A;  2PBI A;  4KMF A;  4OIP F;  2F5F A;  1X3U A;  3I0T A;  4P55 A;  3DPT A;  2JTV A;  1FWZ A;  2PN6 A;  2HYF A;  2L54 A;  2F5C A;  2UZK A;  1ZLJ A;  4FX0 A;  4WXC A;  3E6B A;  2Z9O A;  1WKM A;  1DP7 P;  5CVU A;  1KU3 A;  1ONV A;  1G3W A;  1Z9C A;  2LKP A;  4KIC A;  4G6Q A;  4GXO A;  4EMS A;  3EUH A;  3KE2 A;  1YQA A;  4P9F A;  5HVQ C;  1R5G A;  2M87 A;  4JQF A;  1CF7 A;  4YFN F;  1UHM A;  3V7S A;  2H09 A;  4M6Y A;  1KYW A;  2ESN A;  1BI1 A;  2EV6 A;  2WC2 A;  4L18 B;  1KQ0 A;  1XDS A;  2IW5 A;  4U7B A;  2OQG A;  2Z99 A;  4M73 A;  1FYL A;  4Q5S F;  2EJR A;  5CLS A;  2BEO A;  3FWE A;  1T98 A;  1QZZ A;  1JHH A;  2KJB A;  3E5Q A;  3WGH A;  3B02 A;  4CZZ A;  1U5T C;  4GGG A;  1Z91 A;  3QU6 A;  5FO5 A;  3I53 A;  1MJB A;  4HQM A;  4RB0 A;  2P6S A;  4LJZ F;  4G9Y A;  4MTE A;  2HOE A;  3QP5 A;  1Z7U A;  1H9G A;  3G73 A;  3J81 Z;  3GZ6 A;  1U5T A;  1ZGJ A;  2GXB A;  5A2Q K;  1ON2 A;  1HQC A;  1TNT A;  1LQ1 A;  4UV9 A;  2STW A;  3DFG A;  3P9K A;  3CTA A;  1BIB A;  2W25 A;  3GWZ A;  4ZYH A;  3BDD A;  1SMY F;  1RI7 A;  1J9I A;  3CO6 C;  4BH9 A;  1FYK A;  1J5Y A;  3J80 K;  4KNY A;  2VBY A;  3JSO A;  2ZME A;  4R1H A;  5DEQ A;  1ZAO A;  3JW4 A;  3VFZ A;  1YTY A;  4WWC A;  3SFZ A;  4I2O A;  4OIR F;  2Z5U A;  1F4K A;  3F6V A;  3T8T A;  2MLK A;  3IWF A;  1KQ8 A;  5BOX A;  2LDU A;  4K2E A;  1WSU A;  3H92 A;  4UXN A;  2YSR A;  2B0L A;  2A6H F;  2J5P A;  3RKX A;  1BI3 A;  3ZMU A;  3HRT A;  3FZV A;  3OOP A;  4MQ9 F;  2K02 A;  2XGX A;  3SQN A;  2JPB A;  3TDZ C;  2GA2 A;  3HOT A;  1BC7 C;  2P8T A;  2EB7 A;  4L9V A;  3ROU A;  1KU7 A;  4NQW A;  3WU1 B;  5TRD A;  4RB3 C;  2XKO A;  1SFU A;  2NAZ A;  2HGC A;  4KN4 X;  3PQJ A;  2XRN A;  5ILV A;  3ZP5 A;  4I98 B;  1V4R A;  1S3J A;  1R1T A;  3P7N A;  3TDU C;  3KLO A;  5L3G A;  2TDX A;  2QUF A;  4F7Z A;  2D1V A;  1XSX A;  4BYY A;  2G7U A;  1LB2 A;  1FP1 D;  2FQ3 A;  3BPV A;  2GQQ A;  2DPD A;  1FYM A;  1KU2 A;  3ZMV A;  1GVJ A;  1HKT A;  3C18 A;  5HS8 A;  2ISY A;  1O3R A;  3HTS B;  4KT5 C;  2XUB A;  2RV8 A;  3I4P A;  5D4R A;  1YYV A;  4ESF A;  1XCV A;  2FU4 A;  1T0F A;  3DPL C;  1TTY A;  2FA5 A;  5ICC A;  1HW2 A;  3E6D A;  3FMS A;  3LA3 A;  2FXA A;  1YLF A;  1HSJ A;  2BBY A;  1DUX C;  1QQI A;  1FP2 A;  1FNN A;  3U2R A;  4EJV A;  2DBB A;  3RKY A;  1KQ9 A;  5ICE A;  4L5I A;  2XAH A;  1TQI A;  1MGT A;  1GXP A;  3MZH A;  1BN5 A;  2KIM A;  2HQN A;  1G3S A;  1YO5 C;  2MLG A;  2ZNZ A;  1P92 A;  4BHC A;  4TV7 A;  5CVV A;  2IA2 A;  4A6E A;  3IHU A;  2XHK A;  5H6Q A;  1JXS A;  5LEK A;  2Q0O A;  3VB2 A;  3EDP A;  2FBK A;  1J0R A;  2W84 A;  3WTZ A;  1K78 B;  2EWN A;  3HRU A;  1RZ4 A;  3I59 B;  3GFL A;  4M9S A;  2GIV A;  3KP4 A;  1J75 A;  2NYX A;  5CJ9 A;  2XAS A;  1Z1D A;  3CDH A;  2R7D A;  4AWX B;  4AIH A;  4NHJ A;  4EVI A;  2W57 A;  1JE8 A;  1BBY A;  4RAZ A;  4ENK A;  5E18 F;  1W7P A;  3HSR A;  2A07 F;  3MQ0 A;  3K1N A;  1IXC A;  1ZG5 A;  4BQA A;  1TQP A;  3I71 A;  5FD6 A;  2EA2 A;  3FM3 A;  3F8N A;  4Q47 A;  2HWV A;  4LB5 A;  3EYY A;  3K1P A;  2OA4 A;  1MJA A;  2YPR A;  2RKH A;  1OR7 A;  2IP2 A;  1FC3 A;  2WTE A;  3DQV C;  1L0O C;  4EGY A;  3CUQ B;  1K6O A;  4UVA A;  4HOB A;  4XLP F;  2J5O A;  4G94 A;  1R58 A;  1PP8 F;  5LHG A;  5FLX K;  2ISZ A;  2F5E A;  1FZP B;  3F23 A;  5L3B A;  4A12 A;  3KZZ A;  4YFX F;  1Y0U A;  1TNS A;  2DTR A;  1OYI A;  5L3D A;  3E5U A;  4G7Z F;  2HDC A;  3GFI A;  2IJL A;  4RGS A;  1YW9 A;  2YX7 A;  4AIJ A;  3J7A O;  2DU9 A;  2E1C A;  3BP8 A;  1XGS A;  1F9N A;  4O6J A;  2V9V A;  4I0A A;  4OU0 A;  4IRI A;  5J6X A;  2M5W A;  2AXL A;  2UWM A;  3JAM Z;  3MEX A;  1IN8 A;  1YFH A;  4FHT A;  3BJA A;  1EH7 A;  1R1V A;  4HAM A;  4CDG A;  2HEO A;  1T38 A;  2CYY A;  2DT5 A;  4G8X A;  5HS9 A;  5JVT A;  5F1R A;  1LEA A;  1C0W A;  3DF8 A;  1JGS A;  4U7D A;  2O8X A;  2A69 F;  1XMK A;  1BC8 C;  1FOK A;  3ZN0 A;  1DPR A;  1IXR C;  2P5L C;  3QU3 A;  2YR2 A;  4RGR A;  2BE5 F;  3FX3 A;  2EFP A;  4G7O F;  2EV0 A;  3CJN A;  1OMI A;  5LHI A;  5LLQ A;  4CYD A;  5KVR A;  3Q9V A;  5E8I A;  5L3F A;  4I7H A;  1PP7 U;  4LG0 A;  1ZRD A;  4MEX F;  1EV7 A;  5ICF A;  3L00 A;  1W7P D;  1ODD A;  1T39 A;  5FD5 A;  1MDM A;  4M9Z A;  1A04 A;  2JT1 A;  2EFW A;  5E20 A;  3F3X A;  5DDG A;  4CHU A;  2L4M A;  1ZAR A;  4I02 A;  4G6D A;  1TLH B;  4M71 A;  1IAW A;  4S05 A;  3SZT A;  3SZP A;  5DD8 A;  4YIF A;  4BXU A;  1I27 A;  2O6G E;  5L3C A;  2CQK A;  2VOO A;  1D8K A;  3TO9 A;  1O3T A;  5JFR A;  3HSE A;  2O03 A;  3KEQ A;  2VE9 A;  1BOA A;  4LFU A;  3TOB A;  2ESH A;  1HXD A;  4AD9 A;  2NNY A;  4YII A;  1XD7 A;  1FY7 A;  3WOD F;  4PCQ A;  1P4W A;  4PGG A;  1XGN A;  4IRG A;  1FBS A;  5BPI A;  1G4D A;  5FGM A;  3BY6 A;  4AIK A;  4XLN F;  5HDG A;  3MAJ A;  3GEZ A;  2MC3 A;  4LMY A;  1HW5 A;  4HQE A;  1B1B A;  3FHZ A;  5JR3 A;  2O0Y A;  5E17 F;  4KUM A;  1S6L A;  1BM9 A;  3C7J A;  1R00 A;  1IRG A;  5K5Q A;  3HHG A;  1I6X A;  5ERI A;  4MEY F;  1TBX A;  4QLC U;  3I5U A;  1U6G A;  3GFJ A;  2C6Y A;  3QPT A;  1J59 A;  4O5V A;  2NNN A;  2VT3 A;  3LQQ A;  3ML6 A;  4ZZL A;  1BI2 A;  3CLO A;  3BJ6 A;  3I64 A;  2CFX A;  4LD5 A;  3W6K B;  4HX7 A;  3IWZ A;  4KIG A;  1XGO A;  1WQ2 A;  3Q5F A;  3KZY A;  5DCF A;  4A5N A;  3L2C A;  1ZRE A;  4N0B A;  2V1U A;  3ZMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...