5HS7A

Reduced form of the transcriptional regulator yodb from b. subtilis
Total Genus 34
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
34
sequence length
102
structure length
102
Chain Sequence
b'MMCPKMESAFSLLGKRWNGLIIHVLMDGPKRFKEITETIPMISQKMLAERLKELEQNEIVERQVLPETPVKVIYTLTEKGTALQAVFQEMQAWADQFCEPGD'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords HTH-type transcriptional regulator YodB
publication title Two distinct mechanisms of transcriptional regulation by the redox sensor YodB
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Dna binding protein
total genus 34
structure length 102
sequence length 102
chains with identical sequence B
ec nomenclature
pdb deposition date 2016-01-25

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01638 HxlR HxlR-like helix-turn-helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 5hs7A00
1R5GA 2ZMEA 2GWRA 1LVAA 5CYVA 2YU3A 2VT3A 5TRDA 4EGZA 2ZNZA 2M5WA 2FU4A 1WI9A 4Y17A 4CICA 5CVJA 4KICA 4UUVA 3EETA 1O7LA 3HTUA 3WE3A 1GXPA 4MQVA 1JGSA 2KIMA 2VXZA 2ESNA 5D6FA 2VN2A 4HLYA 2V79A 5E17F 3GZ5A 1ZAOA 4RAZA 2RDPA 1ZG1A 3P7NA 1W5TA 2HDCA 3ZMDA 3LQRA 1HBXG 2CO5A 3LA2A 4HBLA 5ERIA 1KGSA 1Z91A 4ESJA 3HSEA 4BH9A 2KKOA 3E6CC 2PBIA 1SMYF 1R1UA 5H6RA 3FWEA 1YQAA 2OA4A 1HKQA 2XUBA 3ZP5A 4NQWA 3L09A 1J9IA 1R1VA 4CDGA 1GXQA 1F9NA 4L9NA 1G3TA 1OYWA 2GA2A 5E18F 2O3FA 3PQKA 4HX8A 2ZFWA 1WRJA 3V8JA 3RJPA 3D5LA 5FFXA 1P92A 1W7PA 3DPLC 2V1DA 3LAJA 1F5TA 4L9TA 3RTRA 2WWYA 2FA5A 4CHUA 2P8TA 5ICGA 1ZYRF 3I54A 1KA8A 4ASNA 3KFWX 4U7BA 3F8BA 2HOEA 2L54A 3T8TA 4BNCA 3P9KA 5HS8A 2LKPA 2VBZA 2KJCA 2LDUA 1O3SA 1IXRC 4BAYA 2K4BA 2K7LA 1SFUA 4GCVA 2QYOA 3CUQA 3BOQA 1J5YA 4I01A 2JT1A 5E20A 1MKMA 4RGXA 2FE3A 4Q48A 4EVIA 2V1UA 1UFMA 1R22A 4HX4A 3CO7C 1XSXA 3R0JA 1TW2A 5LRSA 1H9GA 1BI3A 3HSRA 4CYDA 3DXJF 1O3RA 3HRSA 3PQJA 2O6GE 3V7RA 1KU3A 1YW8A 4G7HF 1FBQA 1WSUA 1T98A 4LG0A 4KUMA 5DD4A 3WGIA 2HYFA 1MZBA 2QLZA 2W57A 5FB2A 2MBFA 5DDGA 1S7OA 4FX0A 5D5WB 1BJAA 4MQ9F 2PMHA 2RN7A 2OQRA 3KZZA 4PGGA 3TOBA 2GQQA 2XROA 1T38A 2EB7A 1H0MA 3K1MA 5DCMB 1U3EM 2Z33A 1R36A 4LD5A 3ERED 2Y48A 2PQ8A 2FBKA 2ETHA 3HOTA 1PUEE 3JAMK 1XGNA 4OINF 3WG9A 3M8EA 2EK5A 1R00A 1Z6TA 2EA2A 1JHFA 3RPQA 3CUQC 4RGUA 3SZPA 3LA7A 3L00A 3M7GA 1WWXA 5IT9K 1MDMB 4YIIA 3I0TA 3CJNA 4CO8A 4WF2A 4HF1A 1FPQA 3I59A 3IWZA 2VOPA 2Q2EA 3FM5A 1FY7A 1ON1A 2W84A 5HLIA 3CDHA 4EJTA 1BBYA 2KIUA 5D5XB 1T6SA 2HZTA 4P9FA 4EJVA 4IRGA 1HKSA 4HW0A 3K2ZA 4GO1A 3FXQA 3WTZA 4I0BA 2RV8A 3REOA 4YFNF 4WXHA 1YW9A 2FMLA 2EFWA 1OKRA 2MA3A 2EFNA 4LB5A 2CSOA 1B59A 5KVRA 3I5UA 5E8GA 1QZZA 3WTXC 2P7VB 1KYZA 1OPCA 5FLXZ 2H27A 3RDIA 1EH6A 3JSOA 3WU1B 4KDPA 3S2WA 2DK5A 4FX4A 2H09A 1PDNC 4Q5SF 3SQNA 2VE8A 1K6OA 1RI7A 3K69A 3W6JB 1FP2A 4MNUA 5CVUA 3TOAA 2M45A 1IN8A 3FMRA 1NHAA 4HAMA 5BPIA 3MZYA 5DUKA 5E1XA 5IT3A 3Q5FA 1FSHA 5HLGA 1U2WA 3WGGA 5LRRA 1U5TB 1O7FA 5J8CA 1HKTA 1F4KA 3SFZA 3RIRA 4NB5A 4U0VA 5BPDA 4L18B 1B9NA 3GFIA 5L3GA 4M9SA 4MTDA 1O3QA 3J80K 3WTTC 4GYGA 1RNLA 2DTRA 3J81K 4WK8F 1G6NA 1OMIA 4XBFA 1YTYA 1LJ9A 4HV6A 5ED4A 2XAFA 3MAJA 4ESBA 3JTHA 1USSA 1FBUA 5LGUA 1WKMA 3JTGA 2P7CB 3IWFA 3H3ZA 2ZCWA 3I64A 2EA4A 2G7UA 4EJWA 3E3VA 2P5KA 5LHIA 1KU2A 2MLGA 2XAQA 4A5NA 2ZXJA 2IW5A 2FMYA 1CF7A 4UV8A 2W24A 1LDDA 3F22A 4ZZLA 2P5VA 2W85A 4AIHA 1QNTA 1HW2A 2FEZA 1J59A 1BI2A 4UNOA 1UCRA 2F5EA 4A0ZA 4U0WA 1XGMA 1FT9A 1SAXA 5ILVA 2Y75A 4Q47A 5JHUA 4BYYA 4RB3C 1IRFA 2F2EA 4LGWA 1G3SA 2V6CA 2HFHA 3JW4A 2D45A 2A3SA 3RPUA 4KFCA 1QPMA 2WTEA 2PI0A 4RB0A 4ZH4F 1C0WA 5JFRA 1ZRDA 3R60A 2DI3A 5ICCA 2BBYA 2R7DA 4RS8A 5D8KB 5FD5A 4M9XA 1E17A 5K1YA 5K5OA 4MGRA 4WWCA 1L0OC 5ICFA 3GO5A 1FLIA 4ENMA 4UXNA 4LLGF 3R0AA 2MH9A 5A2QK 2HWVA 3GFLA 1R7JA 4XLPF 1XMKA 1BIBA 2YX4A 1ZRFA 2HQNA 2FF4A 4ENNA 5L3BA 3EQLF 3GZ6A 4LLLA 2STTA 1ULYA 2P4WA 1XCBA 2XKOA 4HF2A 4XLNF 4XRFA 1Z1DA 3F6OA 1ZLKA 1E2XA 2VC0A 2IP2A 1HW1A 5D4RA 1FYMA 3I53A 4HA8A 5FFZA 5DEQA 3O6BB 4KNYA 4N0BA 4MTEA 3ZMZA 3WTYC 1OR7A 4U0YA 4G8XA 4WXCA 3VB2A 3FMSA 5HDNA 4EM0B 1U78A 2P5LC 4FT8A 2NRAC 2FNAA 3T5XA 4M73A 1ZREA 5L3EA 4O3MA 2FOKA 5J6XA 5DCFA 1GHCA 6PAXA 1FZPB 2XAGA 3F21A 1STZA 2W25A 4UVAA 3OOPA 5CVIA 5D5UB 1XCVA 5F1RA 3ABTA 4HQEA 2XRNA 2IRFG 3KLOA 1HQCA 3DPTA 3E97A 3I58A 2HTJA 2STWA 1SD4A 3F8FA 2FSWA 1V3FA 3H3UA 1SD7A 4G94A 2DLLA 4EQQA 2CQKA 2RQPA 2XHKA 5BOXA 2QVOA 1IN7A 3J80Z 2BGCA 2EFPA 3K9TA 3F72A 1D8KA 3WTWC 4EMSA 5LGTA 1ZH5A 5L3FA 4QWQA 4RB2C 1RUOA 1UB9A 1R1TA 2X0LA 1QBJA 2BEOA 2COMA 1BC7C 2XV4S 4BQAA 3C3WA 3GXOA 1DPUA 1REPC 4LK0F 5D8LB 4A2UA 1P2FA 1J7KA 2YPRA 1W4MA 4A0XA 2M30A 3ECHA 4KIFA 3M1EA 2DPDA 3KP5A 4RB1A 1BN5A 1R23A 1IZ1A 2QQAA 3FM3A 2GXBA 4AIKA 4S05A 3DKWA 4I02A 2QBYA 3TGNA 3DP7A 4LJZF 3W6KB 1K7AA 5HOOA 1G4DA 2L4AA 4EJUA 3G3ZA 4KYWA 4ZYEA 3WTSC 3V4GA 3IHUA 3HYIA 2Q8KA 1KQ0A 2XAHA 2XAJA 2XIGA 1VTNC 3B73A 1ZN2A 4HOBA 4ZYHA 3ISPA 1LDKB 1TLHB 3E6MA 3L7WA 1SFXA 4KMFA 2E1NA 5CVVA 3FZVA 1IUYA 2DU9A 1SD5A 4AWXB 1IXCA 1BC8C 1AWCA 1T39A 2VBXA 4FHTA 3GUDA 3T8RA 1JE8A 2JZYA 3C18A 3H92A 3QP5A 1RIOH 3RI4A 1B4AA 2KJBA 2D1HA 1S7AA 2H94A 1HW5A 1I6XA 4I2OA 2ZJ2A 2VE9A 2K27A 1B6AA 4AIJA 2ISZA 1ZG3A 3COAC 3BDDA 2D1VA 1K78B 4Q4ZF 3BJ6A 4EGYA 4N9IA 2EV0A 2QM3A 2ZKZA 2R7FA 3L9FA 5L3DA 2DO7A 4CZZA 5LEKA 4O5VA 4BHPA 3DFGA 2VOOA 3WTUC 3HTSB 2XASA 2H6CA 1B1BA 2DBBA 4PCQA 3F23A 2O03A 4G7OF 1XGOA 4DQ2A 2ESHA 3LFKA 3LQQA 3FMQA 5AIQA 4I7HA 1BI1A 2VBYA 3NQOA 3ECOA 4L5IA 1F1ZA 3ROUA 5AIPA 4IF4A 1ODDA 4AD9A 3R6SA 3KE2A 1XN7A 4YG2F 3CO6C 3V7CA 1ZGAA 2C6YA 2ZO4A 4I98B 4OMZA 4WCGA 3JSPA 1IF1A 4M9ZA 4PDKA 3HRTA 3V8LA 1JHHA 2V9VA 3DF8A 4DNCA 3MCZA 4YFXF 4E70A 3ELKA 3F3XA 4S04A 5JI6A 4IRIA 1P6RA 2CG4A 4BHBA 5K5QA 3IRQA 3TKYA 4EM2A 4B8XA 1LQ1A 1XDUA 2ZMEB 3ABUA 4OIPF 2HGCA 2NS0A 2JSCA 4G6DA 2P6SA 3QPTA 3GYHX 5D6EA 2HYGD 2QZ8A 1RUNA 5CVRA 1OYIA 1FSEA 3E5UA 3BJOA 4ZYDA 4HZFA 3BP8A 2FBHA 3Q9VA 5HS9A 3QP6A 3WODF 2HR3A 2IPQX 5D5VB 2YSRA 4P96A 3GFJA 4IRHA 5DCMA 2HEOA 2ACJA 3ULQB 5FGMA 2A6HF 2CW0F 5LLQA 3ZMSA 1JXSA 3ZMVA 2GAUA 5LGNA 2FNPA 3SXYA 1EV7A 2QWWA 4XSZF 4GXOA 2DPUA 4M6YA 5HDKA 1U8RA 3TO9A 2EWNA 1QQIA 3G73A 4A0YA 2FXAA 1S29A 1MDMA 2RVCA 4KIGA 4KT5C 1W7PB 3BY6A 2HQRA 2E7XA 4MEYF 4M6XA 2FBIA 2KIFA 3M9AA 2ELHA 2HKXA 2ZBKA 3P9CA 1Z9CA 1PP7U 2PN6A 1ZARA 1LNWA 1W5SA 3JAMZ 3QAHA 4WX9A 3N4MA 2M8EA 2UZKA 3LSTA 3U2RA 4I09A 2OZ6A 2D2WA 1FP1D 1S3JA 2GZWA 4EM1A 3QPHA 3OV8A 5DD8A 2A6EF 1XGSA 5D4SA 3WU0A 4KN7X 2YR2A 3HIFA 1YIOA 3BPVA 5IT9Z 3QU3A 2UWMA 4L9JA 4OIRF 2PMUA 3CUQB 4P55A 3IRRA 5LHGA 5BMZA 2E1CA 1P4WA 1IAWA 3IKTA 4LK1F 2CGPA 1IW7F 2G9WA 3KEOA 1MJAA 5H20A 3QRFF 3T0YA 4Z2YA 1BOAA 2IJLA 3CTAA 3GF2A 3RYRA 2JPBA 3O2PE 2RC4A 2L3DA 3HSFA 3C1DA 1TQMA 1KQ8A 1HXDA 3TO6A 2IVMA 2Z9OA 4LFUA 1U5TA 3RKXA 4BXUA 4LG0B 5DUIA 2PJPA 4KIBA 2K02A 3HHGA 1KU9A 3K1NA 1W7PD 3IKVA 2V1XA 4HV5A 1YYVA 2Z99A 2R3SA 4JBAA 4LB6B 3PFIA 5ILUA 4N9HA 1P4XA 1FYKA 1I1SA 4EV0A 4JQFA 5JVTA 1G3YA 4JK1X 1CGPA 1R58A 2M1BA 3DV8A 1S6LA 4ZYGA 3HRMA 2A61A 4P5OA 2GXGA 3QOPA 3K0LA 1FWZA 1ONVA 2UXNA 3F8CA 4HQMA 4GGGA 1EH7A 5BQTA 3HOSA 2GIVA 5ILSA 1IRGA 5LEJA 2ISYA 3GW2A 3NRVA 1TBXA 2NNYA 1GVJA 5E1WA 5FLXK 2QENA 3KP4A 2KRFA 3FXRA 1ZHFA 3BJAA 1ZGJA 4OOIA 3I59B 1Z6RA 3DQVC 4IHTA 2L01A 2XKPA 1I5ZA 2JTVA 3LA3A 2A69F 1TW3A 5AONA 2DQRA 3U1DA 1WQ2A 1QZYA 4ENJA 2CYYA 3VEPA 3J81Z 4IVNA 3VODA 1H9TA 1U5TC 2QQ9A 4HYEA 1S8NA 2LNBA 5F64A 4OU0A 2PLYA 2DQLA 1USTA 4R79A 2BE5F 4O6JA 1J75A 3BWGA 2NAZA 1BIAA 2TDXA 2FRHA 4MHGA 1DP7P 2IA1A 3E6BA 1DDNA 4G9YA 4L0ZB 4B09A 1YS6A 2CWEA 2HS5A 2RGVA 1MJBA 4RGSA 2EV6A 2OAZA 1HSJA 2A07F 3KP7A 2J5PA 3KP2A 2OQGA 3F8MA 4TV7A 2O8XA 3K1PA 3MWMA 4CGZA 1TTYA 1I27A 4KMUX 2NNNA 1L3LA 4PZJA 2DK8A 1YW7A 4Y13A 2IT0A 1XDSA 2VT2A 2EV5A 3KZYA 1O57A 1UHMA 3LAPA 2PFBA 1KU7A 1SFEA 1QGPA 3MFKA 3C7JA 1XMAA 3SHFA 1LB2A 5CJ9A 1DPRA 3P9IA 3E6DA 1UHWA 2AXLA 4KA4A 4HF0A 3DEUA 2Z3YA 1ZRCA 1IN4A 5HLHA 4QLCU 2BV6A 2A5YB 2OU2A 3J7AO 2DW4A 4K2EA 1AOYA 3WGHA 1SMTA 5ICEA 2VBWA 1IXSB 5E1ZB 1BI0A 5KK1A 1YS7A 3AAFA 5HS7A 5A2QZ 2VONA 2OZUA 2HKOA 1K79A 2P6TA 2L02A 3NEUA 1KYWA 5HDGA 3MQ0A 2DT5A 2K4JA 5CLSA 2MD5A 3FXUA 2EFQA 4AVPA 2LF8A 2MC3A 1MD0A 2VC1A 4M74A 1KQ9A 4ZZDA 4G6QA 1T2KA 1P4AA 2E7WA 2J5OA 4ETSA 1TNTA 4A6DA 4HX7A 1ZLJA 3L2CA 2XVCA 3FX3A 5BS6A 1CF7B 2RKHA 2EJRA 4R8HA 3O3KA 3RKYA 1O3TA 5E8IA 3QU6A 3Q9SA 4UVBA 1U6GA 4M72A 3R4KA 4IXAA 5HVQC 4NHJA 5EEGA 3HRUA 2Q0OA 4Y15A 5F6FA 3R61A 2MH2A 3TQNA 3D0SA 1EH8A 3ZN1A 2JRTA 2O0YA 3ZMTA 4ESFA 1IN6A 3KEQA 1MGTA 2B0LA 3F8NA 3GLXA 2FQ3A 4EJOA 2H6BA 2RNJA 4G7ZF 5DYMA 5H6QA 1XD7A 4A12A 5K5RA 2OD5A 1YO5C 2EFOA 1DUXC 1ON2A 4LMYA 2YX7A 1D8JA 5JR3A 2LF7A 3GVAA 1ZG5A 3N97A 1RZ4A 4UHTA 3TDUC 3ZN0A 3BROA 3KP6A 1V4RA 4L5JA 3RYPA 3U9GA 2XGXA 3FF5A 2K86A 1LEBA 3LWFA 4R1HA 4YIFA 2LSOA 3I4PA 3EDPA 1Z05A 4UVCA 4OIOF 4OMYA 3GEZA 4L0YB 3E5QA 2QUFA 4HLXA 1FC3A 3ZQ7A 3EUHA 2DAOA 4OIQF 3TDZC 1YLFA 1TQPA 3F6VA 1J0RA 3I71A 3GX4X 2L4MA 1LEAA 1D3YA 4UV9A 1FYLA 2OBPA 2WC2A 2IA0A 2PEXA 4P9UA 1SD6A 4GYIA 2MLKA 4IPAA 2O61A 4KN4X 4A5MA 4ON0A 2PG4A 3CLOA 5LBQA 3BPXA 1Q1HA 1QO0D 1FNNA 4WXDA 1D5VA 2ADUA 2VODA 1G3WA 3MEXA 1PP8F 4PGHA 4M71A 4H0EA 3KETA 3ZPLA 1T0FA 3GFMA 2F5CA 2WV0A 2Y0MA 4HDUA 2NYXA 4IHSA 3TO7A 1R5HA 1YG2A 2G7HA 3ZMUA 1TQIA 3VFZA 1BM9A 1K78A 1I1GA 1A04A 3EYYA 1OYYA 1TNSA 5TJJA 1YFHA 3IC7A 1FBSA 1X3UA 4IJAA 3EYIA 2X4HA 2UXXA 2M87A 5J8FA 3CUOA 1XSDA 5FO5A 1FOKA 3V8KA 2GA1A 2CFXA 3KP3A 4L9VA 3BZ6A 2IA2A 4LLNA 1Y0UA 1J2XA 3IL2A 4D0PA 3RKWA 4YFKF 1XSVA 2AS5F 2HTSA 3M8FA 4BHCA 4XSXF 5L3CA 3SZTA 3B02A 3E5XA 4RAYA 4MEXF 1HSTA 3KLNA 3KCCA 2F5FA 5FD6A 3V7SA 1IN5A 3GWZA 2JPCA 4CXFA 4HDVA 2QQBA 2DFIA 3HHHA 2Z5UA 3WE2A 2BYVE 4RGRA 5EEHA 3HUGA 3T1BA 3WTVC 3ML6A 2A68F 1LDJA 2QBYB 5DV5A 3VOEA 4A6EA 3FHZA 1B9MA 4U88A 1FX7A 4ENKA 4U7DA 4I0AA 4F7ZA 1Z7UA 1MJ9A 5LHHA 1XB4A 2F5DA 3MZHA 2ZNYA
chains in the Genus database with same CATH superfamily
1R5GA 2ZMEA 4DJAA 2GWRA 1JJ6C 1LVAA 5CYVA 2YU3A 2VT3A 3C2GA 5B1AH 4EGZA 5TRDA 2ZNZA 2M5WA 2FU4A 1WJBA 1WI9A 3CMAI 1D1BA 3FXOA 5IP6A 1OCRH 3FXMA 4Y17A 1MMAA 2IS6A 4CICA 1WJEA 3CESA 3S2DJ 2LREA 5CVJA 4KICA 2E5NA 5J3LA 5HNFA 2M9HA 3ZQCA 4UUVA 3EETA 4XLAA 2KRHA 2BY0A 2LFBA 1O7LA 3HTUA 1T95A 3WE3A 4IX7A 1I39A 1GXPA 2PJRA 2DDAA 4MQVA 2VPLA 1JGSA 2KIMA 2VXZA 2ESNA 5D6FA 5EGOB 2VN2A 4GRIA 1ZR4A 4KITB 2XGDA 4HLYA 4XICA 2V79A 5E17F 2UUZA 3GZ5A 1HDDC 1ZAOA 4RAZA 2RDPA 2RREA 2VXDA 3P7NA 1ZG1A 4G12A 2VKHA 2GIZA 1W5TA 1XG1A 2HDCA 3ZMDA 2WB1N 3LQRA 1HBXG 2CO5A 2CQ7A 1MSFC 3LA2A 4HBLA 5GPAA 5ERIA 2R7UA 1KGSA 1Z91A 4ESJA 3HSEA 4BH9A 2KKOA 3E6CC 2PBIA 1YHQI 1SMYF 1R1UA 3FWEA 5H6RA 1YQAA 2OA4A 1HKQA 2XUBA 3E0JB 5GPCA 3ZP5A 5KNLA 3UNGC 4NQWA 3L09A 4NC8A 2XSJC 1J9IA 1OJLA 5F0CA 1R1VA 3I4NJ 3K4CA 4CDGA 5F04A 5GAEJ 2X6XA 4BDZA 1GXQA 3GTQJ 1T56A 1F9NA 3CC7I 4L9NA 1G3TA 1OYWA 3BR2A 4XRMA 1XPXA 1YE9A 2GA2A 1B8IA 5E18F 2O3FA 1PUFA 3PQKA 4HX8A 2ZFWA 2NVQJ 3VYUB 1T33A 1WRJA 2R7OA 3V8JA 3RJPA 3D5LA 5FFXA 1P92A 4IHXA 1W7PA 3DPLC 2Y9ZA 2V1DA 3LAJA 1NH3A 1WCMJ 1F5TA 4L9TA 2VQGA 2ZMEC 3G71I 3RTRA 2VL8A 2AO9A 1GUUA 2WWYA 2FA5A 4RM2A 3SZGA 4CHUA 4XONA 2P8TA 2GLOA 4PJNA 5ICGA 2HDWA 1ZYRF 3I54A 1KA8A 3LSHA 4ASNA 4F91B 3KFWX 1XX5A 4U7BA 3V42A 1OCTC 2XB5A 2W7NA 2EZKA 3F8BA 2HOEA 2L54A 1OLTA 3T8TA 3VPRA 4CYCB 4BNCA 1N25A 3P9KA 1VQ4I 5HS8A 3LSRA 2LKPA 2VBZA 4JX6A 3SDGA 2CUFA 2KJCA 3FK6A 2LDUA 1O3SA 1IXRC 1QVTA 2HU9A 4BAYA 2K4BA 2DXIA 2R7TA 1TZLA 2K7LA 4NBQA 1SFUA 4GCVA 2QYOA 4X1EA 3A01B 1MBHA 3K10A 3CUQA 3BOQA 5JHFA 3GTPJ 1J5YA 4I01A 4BXFA 2GBYA 4YIRX 2JT1A 1ITYA 5E20A 1WJDA 3S3OA 4D7NA 3IV5A 1MKMA 4RGXA 4RLQA 1NG6A 2FE3A 4Q48A 1KONA 4EVIA 2F48A 2O7OA 2DYSH 2VKDA 4BDYA 4BJTA 4C3HJ 4FQGA 3H36A 1Z3YA 2V1UA 1UFMA 1R22A 2MABA 3GTMJ 4E7HA 4JYKA 3JRBA 3ZQHA 4G6TB 4HX4A 3CO7C 1MH3A 1XSXA 2NOJB 3R0JA 1TW2A 2AQEA 5LRSA 1H9GA 1BI3A 3HSRA 3LMMA 1JUPA 4CYDA 4XLEA 3DXJF 1O3RA 4A3IJ 3ZGKA 1D0YA 3HRSA 3PQJA 3WG7H 2O6GE 3V7RA 1KU3A 4HPQA 1YW8A 1X1CA 3G4SI 4D7MA 4G7HF 5F27A 2L7FP 1FBQA 5CKTA 2CJJA 2EZIA 3K6GA 1WSUA 1T98A 4LG0A 4KUMA 5LFAA 4ZJZA 1NTCA 5DD4A 1X1AA 1UAAA 3WGIA 2HYFA 1MZBA 1ZK8A 2QLZA 3S2HJ 2W57A 2PMZA 5FB2A 3MKWB 2MBFA 5DDGA 1H88C 2H8WA 1S7OA 4FX0A 5D5WB 1BJAA 4MQ9F 2PMHA 2RN7A 1WVRA 2OQRA 3BR5A 4PJ0C 3KZZA 1WI3A 2ELKA 4PGGA 2M8GX 2JA5J 3OYCA 3TOBA 2GQQA 2XROA 1T38A 2EB7A 1H0MA 3K1MA 5DCMB 4IQ4A 3S1MJ 2YS9A 1U3EM 4BY7J 3VSLA 2R93J 2Z33A 2HOSA 1TWCJ 1R36A 3KYCB 5B1BH 4LD5A 3ERED 4FETA 2Y48A 2WAFA 5F0FA 3QYEA 1EF4A 2PQ8A 2WAEA 2FBKA 2ETHA 3HOTA 1PUEE 1WJCA 3HBLA 3JAMK 4PFPA 1XGNA 4OINF 1Z21A 3WG9A 3M8EA 2EK5A 2B9SA 1R00A 1V54H 3FIWA 1Z6TA 2EA2A 1R6RA 3MZ8A 3M4OJ 1JHFA 1RKTA 3RPQA 2ZJRF 3S14J 3CUQC 3PNYA 2VKVA 2BY2A 3DKXA 4RGUA 1MMNA 3SZPA 5F0HA 5DM7F 3LA7A 3L00A 3M7GA 1XTAA 1LFBA 1GT0C 2VLAA 4CCKA 1WWXA 5CQGA 3GTGJ 5IT9K 3HOVJ 1HF0A 3G1OA 1MDMB 4YIIA 3I0TA 3CJNA 4CO8A 4WF2A 4A3LJ 4HF1A 3C2HA 1FPQA 2QA4I 3I59A 2IEKA 1VQ8I 4XKCA 2JUCA 4C3IJ 2RAEA 3AG3H 3IWZA 3OYFA 3H5RA 4XLCA 2VOPA 2Q2EA 3FM5A 1FY7A 4ZDPA 1DGWY 1WJ5A 5JLWA 2LK2A 1ON1A 2W84A 3EPZA 4M3DA 2QSHX 5HLIA 3CDHA 3OS1A 2E1MB 4EJTA 1BBYA 2KIUA 3PIOF 5D5XB 1T6SA 4ANJA 2HZTA 2DMTA 3ABMH 4P9FA 1WFXA 2UV1A 4IRGA 4EJVA 1G8XA 1HKSA 2Y0SN 4IZZA 2M0CA 4HW0A 3K2ZA 4GO1A 3FXQA 3JRAA 5E79C 3WTZA 2KP6A 4I0BA 4XLHA 2RV8A 3REOA 3PL8A 4YFNF 4WXHA 1YW9A 2FMLA 2EFWA 1OKRA 2MA3A 2EFNA 3OMYA 4LB5A 2CSOA 3VYSB 4C9YA 1B59A 4E7ZA 5KVRA 2K9LA 3I5UA 2W4SA 4HG2A 4YEJA 5E8GA 1QZZA 3JCUC 4F52A 3H0GJ 4QPOA 4E6KG 3WTXC 2P7VB 1KYZA 3ZCOA 3QOEA 1OPCA 5FLXZ 2H27A 3RDIA 2OTLI 1EH6A 4J19A 3KPHA 3JSOA 3WU1B 4KDPA 4L5EA 2Y69H 3S2WA 4B43A 2DK5A 4FX4A 4MFDA 2H09A 1PDNC 4Q5SF 4A3GJ 3SQNA 1MBJA 2VE8A 1W0TA 1K6OA 1NK2P 1RI7A 3I56I 3K69A 3NWSA 3W6JB 4DYCA 2XSDC 1FP2A 3KX2A 1EJ9A 4MNUA 5CVUA 2JK3A 3TOAA 4BGDA 3QODA 4ZTJA 4S0HB 2M45A 4RAFA 1IN8A 4F3QA 2HVQA 3CMEI 2IGMA 3OIOA 3FMRA 1NHAA 4HAMA 4H4KC 3CDLA 3OYIA 5BPIA 4GDFA 2KLOA 2WY7Q 3MZYA 5DUKA 2V7FA 1I3AA 3AG4H 3HJEA 5E1XA 3SYTA 5IT3A 1X1BA 3Q5FA 1K83J 3H9GA 3L2QA 4NNJA 1FSHA 5HLGA 2LR8A 1U2WA 4KISA 3WGGA 5LRRA 2L9RA 1JKPC 1U5TB 1VNDA 5LD2C 2OF7A 1O7FA 3WU2C 5DTDA 4A3DJ 2IBDA 5J8CA 1U9NA 3CCJI 2CH0A 2DOEA 1HKTA 1F4KA 3GTOJ 3GBGA 2XF5A 3SFZA 2LD5A 1XC5A 3RIRA 4A3EJ 1UG0A 2JJ7A 4D1QA 2OV7A 4NB5A 4U0VA 5BPDA 4L18B 1UHSA 1B9NA 1TWFJ 3GFIA 5L3GA 2M34A 4M9SA 4MTDA 1O3QA 1LVKA 3OYHA 3ABLH 3S16J 2E2HJ 1QRYA 2V6EA 1HCRA 1K4SA 3J80K 1MSEC 3WTTC 4GYGA 5C4XJ 1RNLA 2L7ZA 2DTRA 3VSKA 3J81K 1JKOC 1B72A 4WK8F 3AFHA 1G6NA 3PNTA 1OMIA 4XBFA 1YTYA 3OYEA 2K9QA 2K9MA 2CQNA 3ABKH 1LJ9A 2M0MA 4HV6A 5ED4A 1YOVB 2YUSA 2XAFA 3MAJA 2R5YB 3S93A 1HOMA 1M1EB 4ESBA 3JTHA 1USSA 4J01A 1FBUA 5LGUA 4E7JA 1WKMA 3JTGA 3S32A 3RCOA 2P7CB 2LOOA 2WA0A 1JTXA 3IWFA 3H3ZA 4YELA 2ZCWA 4IQJA 3I64A 1WZ2A 2EA4A 3GLLA 4ZDOA 2G7UA 4AYBN 4EJWA 2F5VA 3N05A 3E3VA 2P5KA 1POGA 2ZFUA 5LHIA 1VQLI 3SFIA 1KU2A 2B7EA 2MLGA 4CCJA 2XAQA 1ZR2A 4A5NA 2ZXJA 2IW5A 2FMYA 1CF7A 5EZGA 1X4OA 3OYKA 5KCMA 2FX0A 4UV8A 2W24A 1LDDA 2ZXWH 3J7YJ 3F22A 2DYRH 4ZZLA 2BHYA 2JN6A 2P5VA 2W85A 4AIHA 3DCFA 1D1CA 1QNTA 3M8JA 2CUEA 2LP0A 1HW2A 2FEZA 1A6QA 4V2FA 1J59A 3CMYA 1BI2A 1YX5A 4UNOA 4HNUA 3PO2J 4PFOA 1UCRA 3HOZJ 1X4PA 3QWLA 3QYBA 4CA0A 2F5EA 4V2GA 1NG7A 4A0ZA 2DN0A 4U0WA 2X51A 3DTEA 2CUJA 3QPLA 3U1KA 1P7JA 2KFDA 1XGMA 2CFOA 1FT9A 1WGXA 2WBMA 3A4CA 1SAXA 5EJCA 1I50J 3HOUJ 5ILVA 2Y75A 2X6OA 4Q47A 5JHUA 2QQ8A 4BYYA 5F08A 4RB3C 1IRFA 3VWBA 1Y56A 2F2EA 4LGWA 1G3SA 4IHVA 2V6CA 2HFHA 4M3GA 3JW4A 2DA2A 3KIOA 2NXNB 3RZOJ 3TP0A 2D45A 2A3SA 2ME6A 3RPUA 4KFCA 3W2VA 1QPMA 2WTEA 2PI0A 3HXLA 4RB0A 4BUPA 1SAUA 3H9QA 4ZH4F 2DA4A 3ONQA 4MFEA 1ZQ3P 1C0WA 3DLAA 2KHMA 3BLYA 3F9KA 5JFRA 1ZRDA 1YI2I 1MIJA 2JVHA 3R60A 4IOAF 2ECBA 2DI3A 5ICCA 3HKZA 2BBYA 2R7DA 4RS8A 5D8KB 5FD5A 3HB9A 3DPUA 4M9XA 2R5ZB 1E17A 5K1YA 5K5OA 4MGRA 4WWCA 1L0OC 5IYCJ 5ICFA 3CP8A 3GO5A 4IL6C 1LPQA 4OAYA 4AIDA 2WAQA 1FLIA 1VI0A 2K9NA 4Y4RA 2Z1DA 4UXNA 4ENMA 4LLGF 1AKHB 3S17J 1LUJB 3R0AA 2MH9A 5A2QK 4IOCF 2HWVA 3GFLA 5JLXA 1R7JA 2BOLA 5GAGJ 3A0HC 4XLPF 2R7XA 1XMKA 1X2NA 3CMMA 3OIPA 1BIBA 5DM6F 1BW5A 2YX4A 2VI6A 1ZRFA 4FE4A 3FHNA 2HQNA 2DA6A 2FF4A 4ENNA 5L3BA 3EQLF 3GZ6A 4LLLA 1ZGWA 2STTA 2A5WA 2DA7A 1ULYA 2LTPA 2E71A 4UB8C 2FQ4A 2P4WA 1I3QJ 1XCBA 2XKOA 4HF2A 4XLNF 3AG1H 4XRFA 3PM1A 1Z1DA 3F6OA 1ZLKA 1E2XA 2YU9J 2DOAA 2VC0A 2IGOA 3LSGA 3CZ6A 5FROA 2IP2A 5J40A 1HW1A 2FJ1A 1MNDA 4BEHB 5IP9J 5D4RA 3MKLA 2TCTA 3LSIA 2ZJQF 1FYMA 3OYLA 2VKEA 3I53A 4HA8A 2MSYA 5DEQA 5FFZA 1IGNA 2W1OA 3O6BB 4CSWA 3O8HA 4KNYA 4N0BA 2DT7B 4MTEA 3ZMZA 1IV6A 2N8GA 3WTYC 1OR7A 2CW7A 4U0YA 4HNVA 5M5YJ 1U8BA 4G8XA 3DBLB 2Y2ZA 4WXCA 2L5QA 2X9DA 4BACA 3VB2A 4XORA 3FMSA 3AL0C 1K4TA 5HDNA 2CW8A 2BHZA 3TBIA 4EM0B 1U78A 3FXJA 4UY8I 4GFBA 4XQFA 5EG0A 4CCOA 4F55A 2EH3A 3ZQIA 4ZYAA 2P5LC 4FT8A 2NRAC 2MFZA 5IOYA 2FNAA 3Q0VA 3T5XA 3ZQQA 4M73A 1ZREA 5L3EA 1IG7A 4O3MA 2FOKA 5J6XA 2PX9A 5DCFA 2R7ZJ 2I5UA 1GHCA 6PAXA 5KAFC 1FZPB 2XAGA 3F21A 3AG2H 1STZA 2W25A 3Q3SA 2AHQA 4M3FA 4UVAA 3OOPA 2ZSIB 5CVIA 5D5UB 1XCVA 5F1RA 3ABTA 2QSGX 4HQEA 2XRNA 2IRFG 3KLOA 1IUFA 2K5CA 5M3FJ 1HQCA 2IXSA 3DPTA 3E97A 3I58A 5C44J 2HTJA 2STWA 1SD4A 3BZKA 3F8FA 2FSWA 2DCEA 1V3FA 3H3UA 4RMNA 1SD7A 4G94A 2DLLA 3CCRI 4N4NB 3UR3C 3BR0A 4BY1J 1GLNA 1R5ID 3A1YA 1QU3A 4EQQA 2CQKA 2P81A 4CH7A 3FK7A 1FEXA 2RQPA 3VYRB 5M3MJ 3TMOA 2XHKA 2HVRA 1ERDA 3G6EI 1TL8A 3DKYA 5BOXA 2JA7J 2IS1A 1ZTRA 2QVOA 3HEFA 1IN7A 3G1MA 3J80Z 3CC4I 2BGCA 2EFPA 3FXKA 2FD5A 3K9TA 3F72A 4RDUA 1UG2A 1D8KA 3BR1A 3WTWC 4EMSA 4DGWB 5GP9A 5LGTA 1ZH5A 1TT0A 2VPRA 5J4YA 2IGKA 5L3FA 1D5YA 2LYCA 4QWQA 1N78A 4RB2C 1PYVA 1LE8A 1RUOA 1GVDA 4PUSA 1UB9A 1R1TA 2X0LA 4F93B 2F4MB 3W3CA 3CCVI 2BEOA 4QSHA 1QBJA 1OR7C 3MVPA 3FBNB 4Z6YA 3CCLI 2COMA 2VJIA 1BC7C 2XV4S 3LSPA 1A5JA 5C4JJ 4BQAA 1V5FA 3C3WA 3GXOA 1DPUA 2Y31A 3BR6A 1REPC 4LK0F 4JP0A 1QA6A 5D8LB 2KIQA 4A2UA 4Y7NJ 1P2FA 4LIUA 1J7KA 2YPRA 1W4MA 3K2AA 5E3LA 3U21A 2M30A 3ECHA 4KIFA 4A0XA 3M1EA 2KL4A 4CCNA 2DPDA 3KP5A 3IAS2 4RB1A 1BN5A 1R23A 2JA8J 2BVLA 5GAHJ 1IZ1A 1YRNB 4UB6C 2QQAA 4XIDA 3OYNA 3FM3A 2GXBA 2DJNA 4E7IA 2LRDA 4AIKA 4S05A 3DKWA 4I02A 2QBYA 2OJED 4B48A 3TGNA 2RQQA 3W2WA 2M7BA 3DP7A 3G1LA 4LJZF 3W6KB 1K7AA 5HOOA 1N77A 2F4OB 1G4DA 3CCYA 4N4OB 1DGRM 2L4AA 4EJUA 3G3ZA 4KYWA 3LSKA 4ZYEA 3WTSC 2M4KA 3V4GA 2VIXA 2OCCH 1J09A 2XPWA 3ASNH 3IHUA 3ASOH 3HYIA 2Q8KA 2HYJA 4DIQA 1BR2A 1X2MA 2LKXA 1KQ0A 2XAHA 1BR1A 3PSFA 4BKXA 2XAJA 1FJLA 2XIGA 1VTNC 3B73A 3BCAA 2E19A 3BC8A 1ZN2A 2K85A 4HOBA 4C3JJ 4ZYHA 5FRMA 3ISPA 1LDKB 1TLHB 3E6MA 3FBIB 3L7WA 2EPFA 3H3VK 1G59A 1SFXA 4KMFA 2E1NA 1Y1VJ 5CVVA 3FZVA 1IUYA 3PIPF 5CPRB 2KZGA 1Y0NA 2DU9A 3I55I 2MYSA 1SD5A 4AWXB 1IXCA 1BC8C 1AWCA 1IC8A 2CV1A 4J00A 1T39A 2Z16A 5EGOA 2VBXA 4I76A 4FHTA 3GUDA 3JRCA 3T8RA 2IGNA 1JE8A 3BCBA 4NC7A 2JZYA 3C18A 3H92A 3QP5A 1RIOH 3RI4A 4QPQA 1B4AA 2KJBA 1GDTA 2D1HA 5EZHA 5FKLA 2NS7A 1VQNI 1S7AA 1WH5A 2H94A 5J47A 5B66C 1HW5A 4DYRA 1FIAA 1I6XA 4KJZA 4ITVA 4BJ6C 2IS2A 4I2OA 2ZJ2A 2VE9A 2K27A 1B6AA 2L9NA 4M6VA 4AIJA 4LG3A 2ISZA 1ZG3A 3CCMI 2V9PA 2NVYJ 5B5EC 5E3OA 1P7IA 1UJ8A 3COAC 1VF9A 3BDDA 3S15J 1X1PA 2D1VA 1K78B 4Q4ZF 3L2UA 3BJ6A 1YJWI 4EGYA 4ZDLA 4BE2A 2NVTJ 3CC2I 5EEAA 2HOAA 1AA7A 4HEA2 4BBRJ 2R7QA 4N9IA 2EV0A 2QM3A 2ZKZA 2R7FA 1X1DA 1MNEA 2HXOA 3OYMA 2TRTA 3F0CA 3L9FA 1MMSA 2VB6A 4XKVA 5L3DA 1W5CC 1S72I 2DO7A 1IRZA 4C2MJ 4CZZA 5LEKA 4O5VA 4BHPA 1SVMA 5GADJ 3DFGA 2VOOA 3DEEA 1MBFA 3WTUC 3HTSB 2XASA 2A6TA 2H6CA 1BOBA 1PVEA 3S8PA 1FMVA 1B1BA 2DBBA 4PCQA 4BJ5C 3F23A 2O03A 3LOCA 5FKOA 2E2JJ 1XGOA 4MO7A 4DQ2A 2P0WA 1H8AC 3HDDA 3PJRA 2E35A 1MMDA 3CF5F 4AU7A 2LMDA 3CF2A 2ESHA 3LFKA 4NDLA 2EBIA 1U0JA 3LQQA 3FMQA 5AIQA 4I7HA 1R49A 1LKXA 3PFYA 1BI1A 3OYJA 2VBYA 4XN0A 4IKFA 4FTHA 3NQOA 3ECOA 1X3WB 4L5IA 1F1ZA 3RSNA 2V9KA 3NWTA 2I10A 3CLQA 2OC6A 3ROUA 5AIPA 4IF4A 4HNTA 2JRMA 2KDOA 4HRIA 1ODDA 1U9OA 4CYCA 4HSTA 4AD9A 3ESWB 1IRXA 1ZELA 5FKMA 3R6SA 1YJNI 1HC8A 3KE2A 2HQAA 1XN7A 4YG2F 3CO6C 3LSMA 3V7CA 1ZGAA 1HLVA 2K3PA 2NVUB 3ZXSA 2C6YA 2ZO4A 1VZ0A 4I98B 4AM3A 4OMZA 2BY1A 4WCGA 4Y3OA 4AC0A 3RKQA 1ETKA 5IPAA 2X1EA 3JSPA 3A01A 3BG7A 3JRIA 1IF1A 3DU6A 3HUGB 3CQZJ 1XMXA 2JWTA 4M9ZA 4PDKA 3HRTA 3ERMA 3V8LA 5J1RA 1RKWA 2XGEA 1JHHA 3KYLA 2DDBA 2V9VA 3DF8A 2FOWA 3MCZA 4DNCA 4YFXF 3S1NJ 4E70A 3ELKA 3F3XA 5IOZA 4S04A 2EIMH 3BG3A 3DWLE 5JI6A 4IRIA 1P6RA 2L2OA 2CG4A 5IP7J 4BHBA 5K5QA 3IRQA 2HNHA 1UMQA 4XR6A 3TKYA 4EM2A 4II2A 4B8XA 3H35A 3D5SC 2MD0A 1LQ1A 1XDUA 1W0UA 2ZMEB 2HVSA 1R4NB 3ABUA 2M2EA 4BU2A 4OIPF 2HGCA 2IAIA 3BT9A 3OY9A 2NS0A 4PSXA 1BW6A 2JSCA 4A69C 2F4IA 3DLLF 4G6DA 3IP4B 4C2TA 2MC4A 2P6SA 3QPTA 3GYHX 2E2IJ 2CRGA 5D6EA 2HYGD 1LFUP 2QZ8A 1RUNA 2LVSA 2Z2SB 3K4JA 2H1KA 5CVRA 2VUMJ 1OYIA 1FSEA 4BQNA 3E5UA 3CCSI 2JUGA 3BJOA 3BQYA 4ZYDA 1H89C 5IYDJ 4HZFA 3BP8A 2LY1A 5FKNA 3RZDJ 2FBHA 3Q9VA 5HS9A 3QP6A 3OYAA 2PJRB 2R7RA 2ICWG 5J1UA 3WODF 2HR3A 3DTIA 1TWHJ 2IPQX 3WHBA 5D5VB 2GXAA 2XB0X 2YSRA 4P96A 1PJRA 3GFJA 4IRHA 4OAZA 1VQ5I 4BQQA 5DCMA 2KDZA 3HOXJ 3OR2C 4HSRA 2HEOA 2CQQA 1VQ6I 5FLVA 2ACJA 1BJZA 5E3MA 3ULQB 1V55H 3SDBA 2DMNA 5FGMA 2A6HF 2CW0F 5LLQA 3ZMSA 3HG9A 1JXSA 3ZMVA 2GAUA 5LGNA 2FNPA 3SXYA 1YITI 3W2AA 1EV7A 2QWWA 2LY2A 2K40A 1S7EA 4XSZF 3GTKJ 3RQ4A 4GXOA 4NQWB 4IHWA 3JRGA 1TWGJ 1VQKI 2DPUA 2Y0SA 4LOCA 4M6YA 5HDKA 1U8RA 5IYBJ 3SEQA 3TO9A 3BG6A 2EWNA 5EF6A 1QQIA 1BL0A 3G73A 1F36A 2FXAA 4A0YA 4A3CJ 1ETYA 1YIJI 5M5XJ 3W6VA 1B8IB 4IHYA 1JUMA 4F92B 3CD6I 1PUFB 1S29A 1MDMA 2RVCA 4KIGA 3DU5A 4KT5C 5TGTA 2QEXI 1W7PB 2HDDA 1IO2A 4U87A 3S1RJ 3BY6A 3MKZA 2HQRA 2E7XA 4XK4A 4MEYF 4M6XA 2FBIA 5K7HA 4Y52J 1E3HA 2LBFB 3ZQLA 3OYGA 2KIFA 2LKSA 3M9AA 2ELHA 1ZKGA 3HC7A 2HKXA 4A3JJ 2MG4A 2ZBKA 1D1AA 3P9CA 1Z9CA 1PP7U 2PN6A 2NVXJ 2QKLB 3CDIA 4FE7A 1MNMC 1ZARA 2W00A 4RA2A 1LNWA 1W5SA 2MGQA 4IEJA 4E7SA 3JAMZ 3QAHA 4WX9A 1Z67A 3AKZA 2M8EA 3N4MA 2UZKA 2D5VA 3LSTA 1T8IA 3U2RA 4I09A 2OZ6A 2D2WA 1FP1D 1S3JA 1AHDP 2GZWA 3QPHA 1Y6IA 3OV8A 2E1OA 5DD8A 4EM1A 2A6EF 1XGSA 4B1RA 5D4SA 3WU0A 4KN7X 2YR2A 1QPIA 2JQ7A 3HIFA 2XAUA 4X0GA 3K4KA 1ORKA 1MBGA 1YIOA 3BPVA 5IT9Z 3QU3A 2UWMA 3OIQA 2BXYA 4L9JA 4OIRF 1W36C 2PMUA 3CUQB 4P55A 3IRRA 1MBEA 3LNQA 1GV5A 2XPUA 5LHGA 5BMZA 2E1CA 1P4WA 2JMWA 3FDYA 3ZOBA 1IAWA 4B3AA 3I4MJ 3IKTA 4LK1F 2CGPA 1IW7F 2G9WA 3KEOA 1MJAA 1Z7LA 3HGGA 5H20A 4C30A 3QRFF 2ZXHA 3BTJA 3T0YA 1Q1VA 4Z2YA 4DOZA 3K70C 1DU6A 1BOAA 1TC3C 2HPIA 2IJLA 2WV1A 3CTAA 2HQ5A 3GF2A 2QGUA 4FISA 3RYRA 3KEYA 2JPBA 1YX3A 3O2PE 2RC4A 3HZJA 2L3DA 3QYFA 3HSFA 2VQLA 2ZJPF 2QKMB 3C1DA 3IH3A 1MBKA 1TQMA 4BE1A 1KQ8A 1Y8QB 4PJMA 4Y33A 3CCQI 1TWAJ 1HXDA 3TO6A 2Y30A 2COBA 1QVUA 3K4BA 2IVMA 3BTIA 2ZB9A 3S1QJ 2Z9OA 4LFUA 1U5TA 1DU0A 3RKXA 3S3MA 2XF6A 4BXUA 4LG0B 2EZLA 2X1DA 3J7AY 3VYTB 3TW7A 5DUIA 4KIBA 2PJPA 3A03A 1E3PA 2K02A 1RC9A 3HHGA 1KU9A 3K1NA 1W7PD 3IKVA 3RQIA 3DEWA 4YRVA 2V1XA 4HV5A 1ENHA 3PSIA 1YYVA 2Z99A 1FTZA 1ETQA 2R3SA 4JBAA 3PFIA 4LB6B 5ILUA 4N9HA 1P4XA 2E1MC 1Y1WJ 2BZTA 1FYKA 5M5WJ 4B4CA 4EV0A 3OOUA 1I1SA 3FKIJ 4JQFA 1SANA 5JVTA 1JT6A 3NARA 1G3YA 4JK1X 5HNHA 1CGPA 4AYBA 1R58A 2M1BA 4A3FJ 4OWRB 3DV8A 1S6LA 2R7WA 3H9JA 4ZYGA 3HRMA 2A61A 1R4MB 2ID3A 4P5OA 1JKQC 2GXGA 4M3BA 3QOPA 3CCUI 1E3OC 3JREA 2KT0A 1OCOH 3K0LA 1Z3XA 5FLMJ 3TEDA 3E7LA 1FWZA 1K6YA 5KAIC 1ONVA 2UXNA 3M07A 2HOTA 3LFUA 3F8CA 4HQMA 4GGGA 1EH7A 2CV0A 5BQTA 3HOSA 2GIVA 5ILSA 2OTJI 1IRGA 5LEJA 5GTIC 2R5YA 3ZR8X 2ISYA 3GW2A 3FKJA 2VJ4A 3BQZA 2WADA 3NRVA 1JUSA 3LSJA 2PMZN 2GOXB 1TBXA 3Q0WA 2NNYA 3OL3A 1GVJA 5E1WA 5FLXK 3B6AA 2QENA 3KP4A 2DA5A 2KRFA 2OPTA 3FXRA 1DP3A 1ZHFA 3O8GA 2DA3A 3I3LA 3BJAA 2LH9A 1ZGJA 3H1CA 3SJMA 1APLC 4OOIA 3I59B 3CCEI 4EATA 1IDZA 3OR1C 1Z6RA 3DQVC 4IHTA 3B6CA 2I8DA 5B3SH 2CS3A 2Q2EB 2L01A 1ETXA 2ZSHB 2ZXIA 2X48A 2XKPA 1I5ZA 5FRNA 2JTVA 3LA3A 2A69F 1TW3A 5AONA 2B63J 2DQRA 3Q0UA 2AXTC 3U1DA 1WQ2A 1QZYA 2L7KA 4DZJA 4JOMA 1MMGA 5J4VA 4CCMA 4ENJA 1NK3P 2CYYA 3FXLA 3VEPA 3J81Z 4IVNA 3VODA 1H9TA 2QCOA 3PO3J 1U5TC 2QF7A 5KHDA 4P1WA 3L2WA 2QQ9A 1FMWA 4HYEA 1OCCH 1S8NA 2LBFA 2LNBA 5F64A 5FKKA 2V4JC 1CQTA 4RBOA 1JTYA 4II3A 2XDVA 1Z77A 4XRSA 2HPMA 4OU0A 2PLYA 4C2UA 2K9SA 3PNVA 2W48A 3KYDB 2DQLA 2X1CA 2ME0A 2X85A 1USTA 2KMUA 2BE5F 4R79A 4O6JA 3VDXA 4XMYA 4I99C 1J75A 3BWGA 1IJWC 3UKGA 2NAZA 1BIAA 1SC7A 2TDXA 2FRHA 4MHGA 1DP7P 2IA1A 1ETVA 3E6BA 1DDNA 4G9YA 4DW6A 2KZVA 5EDNA 4L0ZB 2ZC2A 2XRLA 4B09A 1YS6A 3LL7A 4RM3A 4E4HA 4B47A 2CWEA 2HS5A 3MD2A 2RGVA 1MJBA 4RGSA 2EV6A 3OL4A 2OUMA 4XOPA 2O8KA 1X19A 2OAZA 1HSJA 2A07F 3KP7A 2J5PA 4V19K 3K7AJ 3KP2A 2OQGA 3F8MA 2R0QC 4PSWA 4TV7A 2CV2A 2BY3A 2O8XA 3K1PA 2H1LA 2R5ZA 1A36A 2F6CA 2R7SA 3MWMA 3M1CA 4A93J 2E5ZA 1D0ZA 2OCEA 4CGZA 1TTYA 3HL2A 4FCYA 1I27A 4KMUX 1A6IA 3OYBA 1AKHA 2NNNA 1L3LA 1UELB 2ID6A 1IV8A 1RR8C 4XM3A 1A31A 4PZJA 2DK8A 1JJ8C 2M7AA 1YW7A 4XKBA 4Y13A 1FOWA 2EIKH 4FASD 2IT0A 2WB1A 1XDSA 2VT2A 4QIWN 2EV5A 3TL4X 5HODA 3KZYA 2DMUA 1VFCA 1O57A 2NOGA 2H8RA 1MH4A 4M3EA 1UHMA 2V1NA 1R71A 3LAPA 2PFBA 2DTZA 2EINH 1KU7A 1VQ9I 1SFEA 1QGPA 3MFKA 3C7JA 2DJIA 4MIMA 1XMAA 1O4XA 3SHFA 4DBRA 1LB2A 2IS4A 5CJ9A 1DPRA 3P9IA 3E6DA 3J7ZI 3FISA 1UHWA 3JRDA 2DOFA 2AXLA 4KA4A 1AU7A 4HF0A 3BG5A 2E34A 4BEHA 3DEUA 4AUXA 2Z3YA 1ZRCA 1IN4A 5HLHA 3IH2A 4QLCU 2BV6A 1Y8RB 2A5YB 3CJTB 2EILH 2OU2A 3J7AO 2DW4A 4K2EA 5TISC 1AOYA 2LY9A 3WGHA 1SMTA 5ICEA 4IO9F 1OISA 2VBWA 1IXSB 2M3AA 5FJ8J 4A3KJ 5E1ZB 1B72B 1V5EA 1BI0A 3PUBA 5KK1A 1YS7A 3AAFA 4XKWA 5HS7A 2LC2A 4DYQA 4KT6A 5A2QZ 2VONA 2OZUA 3A0BC 3L2VA 1SFOJ 2HKOA 1K61A 3CJRB 1K79A 4D5FA 4CZCA 2BVMA 3JRHA 2P6TA 2L02A 3NEUA 3X2QH 1KYWA 1WHUA 3M3YJ 2VQCA 5HDGA 4X6AJ 3MQ0A 1EA3A 2DT5A 4NUBA 2K4JA 2EIJH 5CLSA 2JSPA 2MD5A 4BL0B 3FXUA 2EFQA 4AVPA 2L9VA 2LF8A 2MC3A 4I6ZA 2RNGA 3BR3A 1MD0A 2VC1A 4M74A 3IAM2 1GV2A 1SVOA 4AVZA 2O5RA 3K4NA 5J1YA 3HPGA 2MW8A 1KQ9A 4ZZDA 4G6QA 1T2KA 1P4AA 2DFEA 2E7WA 2J5OA 3KZIC 2E36A 3D5RC 1TNTA 3SEZA 4A6DA 4ETSA 4UUSB 4HX7A 1OCZH 1ZLJA 3ZRGA 3L2CA 4NC6A 2XVCA 3FX3A 3MKYB 3DTKA 1WH7A 5BS6A 1CF7B 1P9QC 2RKHA 1SEUA 2EJRA 4R8HA 3O3KA 4XLFA 3L2RA 1FTTA 3RKYA 1O3TA 2QSFX 5E8IA 2O9LA 1Y39A 3QU6A 3Q9SA 4UVBA 1U6GA 2CQXA 4G7OF 1FIPA 3K4LA 4M72A 1R9TJ 3R4KA 4IXAA 5HVQC 4NHJA 1T08B 4MLOA 3IUOA 4XL9A 5EEGA 3HRUA 2Q0OA 4Y15A 5F6FA 3R61A 1JI8A 2MH2A 3TQNA 1MW7A 3AL0B 3D0SA 1EH8A 3ZN1A 1HA8A 1VQMI 1HDPA 2GOMA 2JRTA 2O0YA 3ZMTA 2Q1ZB 4ESFA 1IN6A 2BW3B 3KEQA 1F43A 2EQRA 1MGTA 2B0LA 2CU7A 5C3EJ 1A35A 3F8NA 3IH4A 1RR7A 2FQ3A 3GLXA 4EJOA 2H6BA 2RNJA 3BZCA 4G7ZF 3ZQGA 1VQ7I 3CJQB 2G0EA 2JVGA 2R7VA 2LLKA 5DYMA 5H6QA 1XD7A 2KQRA 4A12A 5K5RA 2OD5A 1YO5C 2EFOA 1DUXC 1ON2A 2HZDA 4E7KA 3OWTA 4LMYA 5K7ZA 2YX7A 1D8JA 5JR3A 2LF7A 3GVAA 2A05A 1ZG5A 4EEFG 1OFCX 3N97A 1RZ4A 1W36D 4UHTA 1S9HA 3C2BA 3TW6A 3TDUC 3WHCA 3ZN0A 3BROA 3KP6A 2HXIA 1V4RA 4L5JA 3A2KA 3BTLA 3RYPA 3U9GA 2XGXA 3FF5A 2K86A 2DA1A 3HOWJ 1LEBA 3LWFA 4R1HA 2DFHA 2VASA 2Y9YA 1YRNA 2HI3A 1S5LC 4ZC3A 1QHHD 3K70D 5JVGF 4YIFA 2LSOA 3I4PA 3EDPA 1Z05A 4UVCA 4B44A 3GZNB 4DZPA 4OIOF 4OMYA 1SVLA 3D1NI 1WPKA 2R4GA 3GEZA 4L0YB 3E5QA 2QUFA 4HLXA 1OCPA 1FC3A 3I9V2 3ZQ7A 3EUHA 1WJFA 1ACIA 2NS8A 1Z0XA 2DAOA 4OIQF 4D5CA 3TDZC 1YLFA 1TQPA 3F6VA 2WY8Q 2ECCA 2M4GA 2XC7A 1J0RA 3I71A 3GX4X 3E1SA 2L4MA 1LEAA 3HKZN 1D3YA 4UV9A 1QZEA 2ELJA 2L9SA 1FYLA 2OBPA 2WC2A 3HPHA 2IA0A 2PEXA 3GMEA 4LIVA 4P9UA 2CMPA 3OSGA 2V26A 4ZTFA 1SD6A 4GYIA 2WAQN 2MLKA 4XNFA 4IPAA 1KZHA 2O61A 4KN4X 4A5MA 4D9JA 3H5NA 4ON0A 4PK4A 2PG4A 4A3MJ 4BBSJ 5F1JA 1BA5A 4DBQA 1I6HJ 4XRSG 1TT5B 3CLOA 5LBQA 1ETWA 3OSFA 3BPXA 4W97A 3OS0A 4A3BJ 1Q1HA 1QO0D 3A02A 3K4MA 5EG0B 1FNNA 3S3NA 3GTLJ 4UUTA 1XS9A 3HOYJ 4WXDA 1D5VA 2ADUA 2VODA 1G3WA 4RLFA 2EZHA 5HLTA 1IDYA 3MEXA 1PP8F 1QHGA 4PGHA 4BQOA 3EUAA 4M71A 4H0EA 3KETA 3MMYB 3ZPLA 1T0FA 3GFMA 2DT6A 2F5CA 2K3FA 4CUGA 3RPUD 2WV0A 5H2FC 1UZCA 1LFPA 1EKEA 2Y0MA 3OS2A 4HDUA 1VQPI 1FOXA 3H5AA 4ABZA 2NYXA 4IHSA 3TO7A 1R5HA 1N75A 1YG2A 1BR4A 1X58A 1SFKA 4PJLA 1JGGA 2G7HA 3ZMUA 1TQIA 3VFZA 2CUZA 1BM9A 1E0EA 1K78A 4JX5A 2W82A 3ZQFA 3L1PA 1G2HA 1I1GA 1A04A 3EYYA 1OYYA 5E3NA 1TNSA 3JR9A 5BNGA 1OQYA 5TJJA 3IC7A 1YFHA 5CQEA 4JX4A 1FBSA 1X3UA 4IJAA 2DMQA 1ETOA 2BXZA 3EYIA 2X4HA 2XPVA 2UXXA 4B3XA 2M87A 5J8FA 1JKRC 3CUOA 3OYDA 4E7LA 1XSDA 5FO5A 1FOKA 3V8KA 2XF7A 4UUSA 3EUHC 4BE0A 4BS9A 1RETA 2GA1A 2CFXA 3GCMA 3BTCA 3KP3A 2VJ5A 3DBHB 4L9VA 4RAGA 2L7MP 3GTJJ 1DQUA 3BZ6A 3MN2A 3TP3A 1YJ9I 2IA2A 2R92J 4LLNA 1Y0UA 1FOYA 4BXXJ 1J2XA 3IL2A 4D0PA 2KPMA 3RKWA 4YFKF 1XSVA 3QQAA 4LITA 3PUFA 2AS5F 2HTSA 3M8FA 2X6WA 2FUG2 4XSXF 4BHCA 5L3CA 1LE8B 3CP2A 2E60A 3SZTA 1D0XA 3B02A 3E5XA 2LG4A 1X3ZB 2X6YA 4RAYA 4MEXF 1HSTA 3KLNA 3HGYA 3KCCA 2F5FA 5FD6A 2DMPA 3V7SA 9ANTA 2BW3A 1IN5A 3GWZA 2JPCA 4XOTA 4CXFA 4HDVA 1TP4A 2QQBA 2DFIA 5K7FA 3HHHA 3HM5A 2Z5UA 2XGCA 3WE2A 2BYVE 4RGRA 4CCLA 5EEHA 2AQFA 2JA2A 1RESA 2L0KA 4XN3A 3DBRB 1VQOI 3G2BA 5IY5H 2VQHA 3BG9A 1T0FC 3HUGA 1WJAA 4QTRA 5GTHC 3NAUA 3T1BA 3WTVC 3ML6A 2JA6J 2A68F 1LDJA 2KRCA 5EYRA 2QBYB 5DS9A 3H0DA 2KISA 2VJJA 5DV5A 3P5JA 3VOEA 4A6EA 3FHZA 3JRFA 4PJJA 1B9MA 1V5GA 4U88A 1FX7A 4ENKA 3QPSA 4U7DA 4I0AA 2DFFA 3EUKL 4W1UA 4F7ZA 1Z7UA 1RPWA 1JT0A 2DODA 1RRJA 1MJ9A 5LHHA 1W1WE 1XB4A 2F5DA 2GM4A 3MZHA 2ZNYA
chains in the Genus database with same CATH topology
1R5GA 2ZMEA 2GWRA 1LVAA 5CYVA 2YU3A 2VT3A 5TRDA 4EGZA 2ZNZA 2M5WA 2FU4A 1WI9A 4Y17A 4CICA 5CVJA 4KICA 4UUVA 3EETA 1O7LA 3HTUA 3WE3A 1GXPA 4MQVA 1JGSA 2KIMA 2VXZA 2ESNA 5D6FA 2VN2A 4HLYA 2V79A 5E17F 3GZ5A 1ZAOA 4RAZA 2RDPA 1ZG1A 3P7NA 1W5TA 2HDCA 3ZMDA 3LQRA 1HBXG 2CO5A 3LA2A 4HBLA 5ERIA 1KGSA 1Z91A 4ESJA 3HSEA 4BH9A 2KKOA 3E6CC 2PBIA 1SMYF 1R1UA 5H6RA 3FWEA 1YQAA 2OA4A 1HKQA 2XUBA 3ZP5A 4NQWA 3L09A 1J9IA 1R1VA 4CDGA 1GXQA 1F9NA 4L9NA 1G3TA 1OYWA 2GA2A 5E18F 2O3FA 3PQKA 4HX8A 2ZFWA 1WRJA 3V8JA 3RJPA 3D5LA 5FFXA 1P92A 1W7PA 3DPLC 2V1DA 3LAJA 1F5TA 4L9TA 3RTRA 2WWYA 2FA5A 4CHUA 2P8TA 5ICGA 1ZYRF 3I54A 1KA8A 4ASNA 3KFWX 4U7BA 3F8BA 2HOEA 2L54A 3T8TA 4BNCA 3P9KA 5HS8A 2LKPA 2VBZA 2KJCA 2LDUA 1O3SA 1IXRC 4BAYA 2K4BA 2K7LA 1SFUA 4GCVA 2QYOA 3CUQA 3BOQA 1J5YA 4I01A 2JT1A 5E20A 1MKMA 4RGXA 2FE3A 4Q48A 4EVIA 2V1UA 1UFMA 1R22A 4HX4A 3CO7C 1XSXA 3R0JA 1TW2A 5LRSA 1H9GA 1BI3A 3HSRA 4CYDA 3DXJF 1O3RA 3HRSA 3PQJA 2O6GE 3V7RA 1KU3A 1YW8A 4G7HF 1FBQA 1WSUA 1T98A 4LG0A 4KUMA 5DD4A 3WGIA 2HYFA 1MZBA 2QLZA 2W57A 5FB2A 2MBFA 5DDGA 1S7OA 4FX0A 5D5WB 1BJAA 4MQ9F 2PMHA 2RN7A 2OQRA 3KZZA 4PGGA 3TOBA 2GQQA 2XROA 1T38A 2EB7A 1H0MA 3K1MA 5DCMB 1U3EM 2Z33A 1R36A 4LD5A 3ERED 2Y48A 2PQ8A 2FBKA 2ETHA 3HOTA 1PUEE 3JAMK 1XGNA 4OINF 3WG9A 3M8EA 2EK5A 1R00A 1Z6TA 2EA2A 1JHFA 3RPQA 3CUQC 4RGUA 3SZPA 3LA7A 3L00A 3M7GA 1WWXA 5IT9K 1MDMB 4YIIA 3I0TA 3CJNA 4CO8A 4WF2A 4HF1A 1FPQA 3I59A 3IWZA 2VOPA 2Q2EA 3FM5A 1FY7A 1ON1A 2W84A 5HLIA 3CDHA 4EJTA 1BBYA 2KIUA 5D5XB 1T6SA 2HZTA 4P9FA 4EJVA 4IRGA 1HKSA 4HW0A 3K2ZA 4GO1A 3FXQA 3WTZA 4I0BA 2RV8A 3REOA 4YFNF 4WXHA 1YW9A 2FMLA 2EFWA 1OKRA 2MA3A 2EFNA 4LB5A 2CSOA 1B59A 5KVRA 3I5UA 5E8GA 1QZZA 3WTXC 2P7VB 1KYZA 1OPCA 5FLXZ 2H27A 3RDIA 1EH6A 3JSOA 3WU1B 4KDPA 3S2WA 2DK5A 4FX4A 2H09A 1PDNC 4Q5SF 3SQNA 2VE8A 1K6OA 1RI7A 3K69A 3W6JB 1FP2A 4MNUA 5CVUA 3TOAA 2M45A 1IN8A 3FMRA 1NHAA 4HAMA 5BPIA 3MZYA 5DUKA 5E1XA 5IT3A 3Q5FA 1FSHA 5HLGA 1U2WA 3WGGA 5LRRA 1U5TB 1O7FA 5J8CA 1HKTA 1F4KA 3SFZA 3RIRA 4NB5A 4U0VA 5BPDA 4L18B 1B9NA 3GFIA 5L3GA 4M9SA 4MTDA 1O3QA 3J80K 3WTTC 4GYGA 1RNLA 2DTRA 3J81K 4WK8F 1G6NA 1OMIA 4XBFA 1YTYA 1LJ9A 4HV6A 5ED4A 2XAFA 3MAJA 4ESBA 3JTHA 1USSA 1FBUA 5LGUA 1WKMA 3JTGA 2P7CB 3IWFA 3H3ZA 2ZCWA 3I64A 2EA4A 2G7UA 4EJWA 3E3VA 2P5KA 5LHIA 1KU2A 2MLGA 2XAQA 4A5NA 2ZXJA 2IW5A 2FMYA 1CF7A 4UV8A 2W24A 1LDDA 3F22A 4ZZLA 2P5VA 2W85A 4AIHA 1QNTA 1HW2A 2FEZA 1J59A 1BI2A 4UNOA 1UCRA 2F5EA 4A0ZA 4U0WA 1XGMA 1FT9A 1SAXA 5ILVA 2Y75A 4Q47A 5JHUA 4BYYA 4RB3C 1IRFA 2F2EA 4LGWA 1G3SA 2V6CA 2HFHA 3JW4A 2D45A 2A3SA 3RPUA 4KFCA 1QPMA 2WTEA 2PI0A 4RB0A 4ZH4F 1C0WA 5JFRA 1ZRDA 3R60A 2DI3A 5ICCA 2BBYA 2R7DA 4RS8A 5D8KB 5FD5A 4M9XA 1E17A 5K1YA 5K5OA 4MGRA 4WWCA 1L0OC 5ICFA 3GO5A 1FLIA 4ENMA 4UXNA 4LLGF 3R0AA 2MH9A 5A2QK 2HWVA 3GFLA 1R7JA 4XLPF 1XMKA 1BIBA 2YX4A 1ZRFA 2HQNA 2FF4A 4ENNA 5L3BA 3EQLF 3GZ6A 4LLLA 2STTA 1ULYA 2P4WA 1XCBA 2XKOA 4HF2A 4XLNF 4XRFA 1Z1DA 3F6OA 1ZLKA 1E2XA 2VC0A 2IP2A 1HW1A 5D4RA 1FYMA 3I53A 4HA8A 5FFZA 5DEQA 3O6BB 4KNYA 4N0BA 4MTEA 3ZMZA 3WTYC 1OR7A 4U0YA 4G8XA 4WXCA 3VB2A 3FMSA 5HDNA 4EM0B 1U78A 2P5LC 4FT8A 2NRAC 2FNAA 3T5XA 4M73A 1ZREA 5L3EA 4O3MA 2FOKA 5J6XA 5DCFA 1GHCA 6PAXA 1FZPB 2XAGA 3F21A 1STZA 2W25A 4UVAA 3OOPA 5CVIA 5D5UB 1XCVA 5F1RA 3ABTA 4HQEA 2XRNA 2IRFG 3KLOA 1HQCA 3DPTA 3E97A 3I58A 2HTJA 2STWA 1SD4A 3F8FA 2FSWA 1V3FA 3H3UA 1SD7A 4G94A 2DLLA 4EQQA 2CQKA 2RQPA 2XHKA 5BOXA 2QVOA 1IN7A 3J80Z 2BGCA 2EFPA 3K9TA 3F72A 1D8KA 3WTWC 4EMSA 5LGTA 1ZH5A 5L3FA 4QWQA 4RB2C 1RUOA 1UB9A 1R1TA 2X0LA 1QBJA 2BEOA 2COMA 1BC7C 2XV4S 4BQAA 3C3WA 3GXOA 1DPUA 1REPC 4LK0F 5D8LB 4A2UA 1P2FA 1J7KA 2YPRA 1W4MA 4A0XA 2M30A 3ECHA 4KIFA 3M1EA 2DPDA 3KP5A 4RB1A 1BN5A 1R23A 1IZ1A 2QQAA 3FM3A 2GXBA 4AIKA 4S05A 3DKWA 4I02A 2QBYA 3TGNA 3DP7A 4LJZF 3W6KB 1K7AA 5HOOA 1G4DA 2L4AA 4EJUA 3G3ZA 4KYWA 4ZYEA 3WTSC 3V4GA 3IHUA 3HYIA 2Q8KA 1KQ0A 2XAHA 2XAJA 2XIGA 1VTNC 3B73A 1ZN2A 4HOBA 4ZYHA 3ISPA 1LDKB 1TLHB 3E6MA 3L7WA 1SFXA 4KMFA 2E1NA 5CVVA 3FZVA 1IUYA 2DU9A 1SD5A 4AWXB 1IXCA 1BC8C 1AWCA 1T39A 2VBXA 4FHTA 3GUDA 3T8RA 1JE8A 2JZYA 3C18A 3H92A 3QP5A 1RIOH 3RI4A 1B4AA 2KJBA 2D1HA 1S7AA 2H94A 1HW5A 1I6XA 4I2OA 2ZJ2A 2VE9A 2K27A 1B6AA 4AIJA 2ISZA 1ZG3A 3COAC 3BDDA 2D1VA 1K78B 4Q4ZF 3BJ6A 4EGYA 4N9IA 2EV0A 2QM3A 2ZKZA 2R7FA 3L9FA 5L3DA 2DO7A 4CZZA 5LEKA 4O5VA 4BHPA 3DFGA 2VOOA 3WTUC 3HTSB 2XASA 2H6CA 1B1BA 2DBBA 4PCQA 3F23A 2O03A 4G7OF 1XGOA 4DQ2A 2ESHA 3LFKA 3LQQA 3FMQA 5AIQA 4I7HA 1BI1A 2VBYA 3NQOA 3ECOA 4L5IA 1F1ZA 3ROUA 5AIPA 4IF4A 1ODDA 4AD9A 3R6SA 3KE2A 1XN7A 4YG2F 3CO6C 3V7CA 1ZGAA 2C6YA 2ZO4A 4I98B 4OMZA 4WCGA 3JSPA 1IF1A 4M9ZA 4PDKA 3HRTA 3V8LA 1JHHA 2V9VA 3DF8A 4DNCA 3MCZA 4YFXF 4E70A 3ELKA 3F3XA 4S04A 5JI6A 4IRIA 1P6RA 2CG4A 4BHBA 5K5QA 3IRQA 3TKYA 4EM2A 4B8XA 1LQ1A 1XDUA 2ZMEB 3ABUA 4OIPF 2HGCA 2NS0A 2JSCA 4G6DA 2P6SA 3QPTA 3GYHX 5D6EA 2HYGD 2QZ8A 1RUNA 5CVRA 1OYIA 1FSEA 3E5UA 3BJOA 4ZYDA 4HZFA 3BP8A 2FBHA 3Q9VA 5HS9A 3QP6A 3WODF 2HR3A 2IPQX 5D5VB 2YSRA 4P96A 3GFJA 4IRHA 5DCMA 2HEOA 2ACJA 3ULQB 5FGMA 2A6HF 2CW0F 5LLQA 3ZMSA 1JXSA 3ZMVA 2GAUA 5LGNA 2FNPA 3SXYA 1EV7A 2QWWA 4XSZF 4GXOA 2DPUA 4M6YA 5HDKA 1U8RA 3TO9A 2EWNA 1QQIA 3G73A 4A0YA 2FXAA 1S29A 1MDMA 2RVCA 4KIGA 4KT5C 1W7PB 3BY6A 2HQRA 2E7XA 4MEYF 4M6XA 2FBIA 2KIFA 3M9AA 2ELHA 2HKXA 2ZBKA 3P9CA 1Z9CA 1PP7U 2PN6A 1ZARA 1LNWA 1W5SA 3JAMZ 3QAHA 4WX9A 3N4MA 2M8EA 2UZKA 3LSTA 3U2RA 4I09A 2OZ6A 2D2WA 1FP1D 1S3JA 2GZWA 4EM1A 3QPHA 3OV8A 5DD8A 2A6EF 1XGSA 5D4SA 3WU0A 4KN7X 2YR2A 3HIFA 1YIOA 3BPVA 5IT9Z 3QU3A 2UWMA 4L9JA 4OIRF 2PMUA 3CUQB 4P55A 3IRRA 5LHGA 5BMZA 2E1CA 1P4WA 1IAWA 3IKTA 4LK1F 2CGPA 1IW7F 2G9WA 3KEOA 1MJAA 5H20A 3QRFF 3T0YA 4Z2YA 1BOAA 2IJLA 3CTAA 3GF2A 3RYRA 2JPBA 3O2PE 2RC4A 2L3DA 3HSFA 3C1DA 1TQMA 1KQ8A 1HXDA 3TO6A 2IVMA 2Z9OA 4LFUA 1U5TA 3RKXA 4BXUA 4LG0B 5DUIA 2PJPA 4KIBA 2K02A 3HHGA 1KU9A 3K1NA 1W7PD 3IKVA 2V1XA 4HV5A 1YYVA 2Z99A 2R3SA 4JBAA 4LB6B 3PFIA 5ILUA 4N9HA 1P4XA 1FYKA 1I1SA 4EV0A 4JQFA 5JVTA 1G3YA 4JK1X 1CGPA 1R58A 2M1BA 3DV8A 1S6LA 4ZYGA 3HRMA 2A61A 4P5OA 2GXGA 3QOPA 3K0LA 1FWZA 1ONVA 2UXNA 3F8CA 4HQMA 4GGGA 1EH7A 5BQTA 3HOSA 2GIVA 5ILSA 1IRGA 5LEJA 2ISYA 3GW2A 3NRVA 1TBXA 2NNYA 1GVJA 5E1WA 5FLXK 2QENA 3KP4A 2KRFA 3FXRA 1ZHFA 3BJAA 1ZGJA 4OOIA 3I59B 1Z6RA 3DQVC 4IHTA 2L01A 2XKPA 1I5ZA 2JTVA 3LA3A 2A69F 1TW3A 5AONA 2DQRA 3U1DA 1WQ2A 1QZYA 4ENJA 2CYYA 3VEPA 3J81Z 4IVNA 3VODA 1H9TA 1U5TC 2QQ9A 4HYEA 1S8NA 2LNBA 5F64A 4OU0A 2PLYA 2DQLA 1USTA 4R79A 2BE5F 4O6JA 1J75A 3BWGA 2NAZA 1BIAA 2TDXA 2FRHA 4MHGA 1DP7P 2IA1A 3E6BA 1DDNA 4G9YA 4L0ZB 4B09A 1YS6A 2CWEA 2HS5A 2RGVA 1MJBA 4RGSA 2EV6A 2OAZA 1HSJA 2A07F 3KP7A 2J5PA 3KP2A 2OQGA 3F8MA 4TV7A 2O8XA 3K1PA 3MWMA 4CGZA 1TTYA 1I27A 4KMUX 2NNNA 1L3LA 4PZJA 2DK8A 1YW7A 4Y13A 2IT0A 1XDSA 2VT2A 2EV5A 3KZYA 1O57A 1UHMA 3LAPA 2PFBA 1KU7A 1SFEA 1QGPA 3MFKA 3C7JA 1XMAA 3SHFA 1LB2A 5CJ9A 1DPRA 3P9IA 3E6DA 1UHWA 2AXLA 4KA4A 4HF0A 3DEUA 2Z3YA 1ZRCA 1IN4A 5HLHA 4QLCU 2BV6A 2A5YB 2OU2A 3J7AO 2DW4A 4K2EA 1AOYA 3WGHA 1SMTA 5ICEA 2VBWA 1IXSB 5E1ZB 1BI0A 5KK1A 1YS7A 3AAFA 5HS7A 5A2QZ 2VONA 2OZUA 2HKOA 1K79A 2P6TA 2L02A 3NEUA 1KYWA 5HDGA 3MQ0A 2DT5A 2K4JA 5CLSA 2MD5A 3FXUA 2EFQA 4AVPA 2LF8A 2MC3A 1MD0A 2VC1A 4M74A 1KQ9A 4ZZDA 4G6QA 1T2KA 1P4AA 2E7WA 2J5OA 4ETSA 1TNTA 4A6DA 4HX7A 1ZLJA 3L2CA 2XVCA 3FX3A 5BS6A 1CF7B 2RKHA 2EJRA 4R8HA 3O3KA 3RKYA 1O3TA 5E8IA 3QU6A 3Q9SA 4UVBA 1U6GA 4M72A 3R4KA 4IXAA 5HVQC 4NHJA 5EEGA 3HRUA 2Q0OA 4Y15A 5F6FA 3R61A 2MH2A 3TQNA 3D0SA 1EH8A 3ZN1A 2JRTA 2O0YA 3ZMTA 4ESFA 1IN6A 3KEQA 1MGTA 2B0LA 3F8NA 3GLXA 2FQ3A 4EJOA 2H6BA 2RNJA 4G7ZF 5DYMA 5H6QA 1XD7A 4A12A 5K5RA 2OD5A 1YO5C 2EFOA 1DUXC 1ON2A 4LMYA 2YX7A 1D8JA 5JR3A 2LF7A 3GVAA 1ZG5A 3N97A 1RZ4A 4UHTA 3TDUC 3ZN0A 3BROA 3KP6A 1V4RA 4L5JA 3RYPA 3U9GA 2XGXA 3FF5A 2K86A 1LEBA 3LWFA 4R1HA 4YIFA 2LSOA 3I4PA 3EDPA 1Z05A 4UVCA 4OIOF 4OMYA 3GEZA 4L0YB 3E5QA 2QUFA 4HLXA 1FC3A 3ZQ7A 3EUHA 2DAOA 4OIQF 3TDZC 1YLFA 1TQPA 3F6VA 1J0RA 3I71A 3GX4X 2L4MA 1LEAA 1D3YA 4UV9A 1FYLA 2OBPA 2WC2A 2IA0A 2PEXA 4P9UA 1SD6A 4GYIA 2MLKA 4IPAA 2O61A 4KN4X 4A5MA 4ON0A 2PG4A 3CLOA 5LBQA 3BPXA 1Q1HA 1QO0D 1FNNA 4WXDA 1D5VA 2ADUA 2VODA 1G3WA 3MEXA 1PP8F 4PGHA 4M71A 4H0EA 3KETA 3ZPLA 1T0FA 3GFMA 2F5CA 2WV0A 2Y0MA 4HDUA 2NYXA 4IHSA 3TO7A 1R5HA 1YG2A 2G7HA 3ZMUA 1TQIA 3VFZA 1BM9A 1K78A 1I1GA 1A04A 3EYYA 1OYYA 1TNSA 5TJJA 1YFHA 3IC7A 1FBSA 1X3UA 4IJAA 3EYIA 2X4HA 2UXXA 2M87A 5J8FA 3CUOA 1XSDA 5FO5A 1FOKA 3V8KA 2GA1A 2CFXA 3KP3A 4L9VA 3BZ6A 2IA2A 4LLNA 1Y0UA 1J2XA 3IL2A 4D0PA 3RKWA 4YFKF 1XSVA 2AS5F 2HTSA 3M8FA 4BHCA 4XSXF 5L3CA 3SZTA 3B02A 3E5XA 4RAYA 4MEXF 1HSTA 3KLNA 3KCCA 2F5FA 5FD6A 3V7SA 1IN5A 3GWZA 2JPCA 4CXFA 4HDVA 2QQBA 2DFIA 3HHHA 2Z5UA 3WE2A 2BYVE 4RGRA 5EEHA 3HUGA 3T1BA 3WTVC 3ML6A 2A68F 1LDJA 2QBYB 5DV5A 3VOEA 4A6EA 3FHZA 1B9MA 4U88A 1FX7A 4ENKA 4U7DA 4I0AA 4F7ZA 1Z7UA 1MJ9A 5LHHA 1XB4A 2F5DA 3MZHA 2ZNYA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R5G A;  2ZME A;  2GWR A;  1LVA A;  5CYV A;  2YU3 A;  2VT3 A;  5TRD A;  4EGZ A;  2ZNZ A;  2M5W A;  2FU4 A;  1WI9 A;  4Y17 A;  4CIC A;  5CVJ A;  4KIC A;  4UUV A;  3EET A;  1O7L A;  3HTU A;  3WE3 A;  1GXP A;  4MQV A;  1JGS A;  2KIM A;  2VXZ A;  2ESN A;  5D6F A;  2VN2 A;  4HLY A;  2V79 A;  5E17 F;  3GZ5 A;  1ZAO A;  4RAZ A;  2RDP A;  1ZG1 A;  3P7N A;  1W5T A;  2HDC A;  3ZMD A;  3LQR A;  1HBX G;  2CO5 A;  3LA2 A;  4HBL A;  5ERI A;  1KGS A;  1Z91 A;  4ESJ A;  3HSE A;  4BH9 A;  2KKO A;  3E6C C;  2PBI A;  1SMY F;  1R1U A;  5H6R A;  3FWE A;  1YQA A;  2OA4 A;  1HKQ A;  2XUB A;  3ZP5 A;  4NQW A;  3L09 A;  1J9I A;  1R1V A;  4CDG A;  1GXQ A;  1F9N A;  4L9N A;  1G3T A;  1OYW A;  2GA2 A;  5E18 F;  2O3F A;  3PQK A;  4HX8 A;  2ZFW A;  1WRJ A;  3V8J A;  3RJP A;  3D5L A;  5FFX A;  1P92 A;  1W7P A;  3DPL C;  2V1D A;  3LAJ A;  1F5T A;  4L9T A;  3RTR A;  2WWY A;  2FA5 A;  4CHU A;  2P8T A;  5ICG A;  1ZYR F;  3I54 A;  1KA8 A;  4ASN A;  3KFW X;  4U7B A;  3F8B A;  2HOE A;  2L54 A;  3T8T A;  4BNC A;  3P9K A;  5HS8 A;  2LKP A;  2VBZ A;  2KJC A;  2LDU A;  1O3S A;  1IXR C;  4BAY A;  2K4B A;  2K7L A;  1SFU A;  4GCV A;  2QYO A;  3CUQ A;  3BOQ A;  1J5Y A;  4I01 A;  2JT1 A;  5E20 A;  1MKM A;  4RGX A;  2FE3 A;  4Q48 A;  4EVI A;  2V1U A;  1UFM A;  1R22 A;  4HX4 A;  3CO7 C;  1XSX A;  3R0J A;  1TW2 A;  5LRS A;  1H9G A;  1BI3 A;  3HSR A;  4CYD A;  3DXJ F;  1O3R A;  3HRS A;  3PQJ A;  2O6G E;  3V7R A;  1KU3 A;  1YW8 A;  4G7H F;  1FBQ A;  1WSU A;  1T98 A;  4LG0 A;  4KUM A;  5DD4 A;  3WGI A;  2HYF A;  1MZB A;  2QLZ A;  2W57 A;  5FB2 A;  2MBF A;  5DDG A;  1S7O A;  4FX0 A;  5D5W B;  1BJA A;  4MQ9 F;  2PMH A;  2RN7 A;  2OQR A;  3KZZ A;  4PGG A;  3TOB A;  2GQQ A;  2XRO A;  1T38 A;  2EB7 A;  1H0M A;  3K1M A;  5DCM B;  1U3E M;  2Z33 A;  1R36 A;  4LD5 A;  3ERE D;  2Y48 A;  2PQ8 A;  2FBK A;  2ETH A;  3HOT A;  1PUE E;  3JAM K;  1XGN A;  4OIN F;  3WG9 A;  3M8E A;  2EK5 A;  1R00 A;  1Z6T A;  2EA2 A;  1JHF A;  3RPQ A;  3CUQ C;  4RGU A;  3SZP A;  3LA7 A;  3L00 A;  3M7G A;  1WWX A;  5IT9 K;  1MDM B;  4YII A;  3I0T A;  3CJN A;  4CO8 A;  4WF2 A;  4HF1 A;  1FPQ A;  3I59 A;  3IWZ A;  2VOP A;  2Q2E A;  3FM5 A;  1FY7 A;  1ON1 A;  2W84 A;  5HLI A;  3CDH A;  4EJT A;  1BBY A;  2KIU A;  5D5X B;  1T6S A;  2HZT A;  4P9F A;  4EJV A;  4IRG A;  1HKS A;  4HW0 A;  3K2Z A;  4GO1 A;  3FXQ A;  3WTZ A;  4I0B A;  2RV8 A;  3REO A;  4YFN F;  4WXH A;  1YW9 A;  2FML A;  2EFW A;  1OKR A;  2MA3 A;  2EFN A;  4LB5 A;  2CSO A;  1B59 A;  5KVR A;  3I5U A;  5E8G A;  1QZZ A;  3WTX C;  2P7V B;  1KYZ A;  1OPC A;  5FLX Z;  2H27 A;  3RDI A;  1EH6 A;  3JSO A;  3WU1 B;  4KDP A;  3S2W A;  2DK5 A;  4FX4 A;  2H09 A;  1PDN C;  4Q5S F;  3SQN A;  2VE8 A;  1K6O A;  1RI7 A;  3K69 A;  3W6J B;  1FP2 A;  4MNU A;  5CVU A;  3TOA A;  2M45 A;  1IN8 A;  3FMR A;  1NHA A;  4HAM A;  5BPI A;  3MZY A;  5DUK A;  5E1X A;  5IT3 A;  3Q5F A;  1FSH A;  5HLG A;  1U2W A;  3WGG A;  5LRR A;  1U5T B;  1O7F A;  5J8C A;  1HKT A;  1F4K A;  3SFZ A;  3RIR A;  4NB5 A;  4U0V A;  5BPD A;  4L18 B;  1B9N A;  3GFI A;  5L3G A;  4M9S A;  4MTD A;  1O3Q A;  3J80 K;  3WTT C;  4GYG A;  1RNL A;  2DTR A;  3J81 K;  4WK8 F;  1G6N A;  1OMI A;  4XBF A;  1YTY A;  1LJ9 A;  4HV6 A;  5ED4 A;  2XAF A;  3MAJ A;  4ESB A;  3JTH A;  1USS A;  1FBU A;  5LGU A;  1WKM A;  3JTG A;  2P7C B;  3IWF A;  3H3Z A;  2ZCW A;  3I64 A;  2EA4 A;  2G7U A;  4EJW A;  3E3V A;  2P5K A;  5LHI A;  1KU2 A;  2MLG A;  2XAQ A;  4A5N A;  2ZXJ A;  2IW5 A;  2FMY A;  1CF7 A;  4UV8 A;  2W24 A;  1LDD A;  3F22 A;  4ZZL A;  2P5V A;  2W85 A;  4AIH A;  1QNT A;  1HW2 A;  2FEZ A;  1J59 A;  1BI2 A;  4UNO A;  1UCR A;  2F5E A;  4A0Z A;  4U0W A;  1XGM A;  1FT9 A;  1SAX A;  5ILV A;  2Y75 A;  4Q47 A;  5JHU A;  4BYY A;  4RB3 C;  1IRF A;  2F2E A;  4LGW A;  1G3S A;  2V6C A;  2HFH A;  3JW4 A;  2D45 A;  2A3S A;  3RPU A;  4KFC A;  1QPM A;  2WTE A;  2PI0 A;  4RB0 A;  4ZH4 F;  1C0W A;  5JFR A;  1ZRD A;  3R60 A;  2DI3 A;  5ICC A;  2BBY A;  2R7D A;  4RS8 A;  5D8K B;  5FD5 A;  4M9X A;  1E17 A;  5K1Y A;  5K5O A;  4MGR A;  4WWC A;  1L0O C;  5ICF A;  3GO5 A;  1FLI A;  4ENM A;  4UXN A;  4LLG F;  3R0A A;  2MH9 A;  5A2Q K;  2HWV A;  3GFL A;  1R7J A;  4XLP F;  1XMK A;  1BIB A;  2YX4 A;  1ZRF A;  2HQN A;  2FF4 A;  4ENN A;  5L3B A;  3EQL F;  3GZ6 A;  4LLL A;  2STT A;  1ULY A;  2P4W A;  1XCB A;  2XKO A;  4HF2 A;  4XLN F;  4XRF A;  1Z1D A;  3F6O A;  1ZLK A;  1E2X A;  2VC0 A;  2IP2 A;  1HW1 A;  5D4R A;  1FYM A;  3I53 A;  4HA8 A;  5FFZ A;  5DEQ A;  3O6B B;  4KNY A;  4N0B A;  4MTE A;  3ZMZ A;  3WTY C;  1OR7 A;  4U0Y A;  4G8X A;  4WXC A;  3VB2 A;  3FMS A;  5HDN A;  4EM0 B;  1U78 A;  2P5L C;  4FT8 A;  2NRA C;  2FNA A;  3T5X A;  4M73 A;  1ZRE A;  5L3E A;  4O3M A;  2FOK A;  5J6X A;  5DCF A;  1GHC A;  6PAX A;  1FZP B;  2XAG A;  3F21 A;  1STZ A;  2W25 A;  4UVA A;  3OOP A;  5CVI A;  5D5U B;  1XCV A;  5F1R A;  3ABT A;  4HQE A;  2XRN A;  2IRF G;  3KLO A;  1HQC A;  3DPT A;  3E97 A;  3I58 A;  2HTJ A;  2STW A;  1SD4 A;  3F8F A;  2FSW A;  1V3F A;  3H3U A;  1SD7 A;  4G94 A;  2DLL A;  4EQQ A;  2CQK A;  2RQP A;  2XHK A;  5BOX A;  2QVO A;  1IN7 A;  3J80 Z;  2BGC A;  2EFP A;  3K9T A;  3F72 A;  1D8K A;  3WTW C;  4EMS A;  5LGT A;  1ZH5 A;  5L3F A;  4QWQ A;  4RB2 C;  1RUO A;  1UB9 A;  1R1T A;  2X0L A;  1QBJ A;  2BEO A;  2COM A;  1BC7 C;  2XV4 S;  4BQA A;  3C3W A;  3GXO A;  1DPU A;  1REP C;  4LK0 F;  5D8L B;  4A2U A;  1P2F A;  1J7K A;  2YPR A;  1W4M A;  4A0X A;  2M30 A;  3ECH A;  4KIF A;  3M1E A;  2DPD A;  3KP5 A;  4RB1 A;  1BN5 A;  1R23 A;  1IZ1 A;  2QQA A;  3FM3 A;  2GXB A;  4AIK A;  4S05 A;  3DKW A;  4I02 A;  2QBY A;  3TGN A;  3DP7 A;  4LJZ F;  3W6K B;  1K7A A;  5HOO A;  1G4D A;  2L4A A;  4EJU A;  3G3Z A;  4KYW A;  4ZYE A;  3WTS C;  3V4G A;  3IHU A;  3HYI A;  2Q8K A;  1KQ0 A;  2XAH A;  2XAJ A;  2XIG A;  1VTN C;  3B73 A;  1ZN2 A;  4HOB A;  4ZYH A;  3ISP A;  1LDK B;  1TLH B;  3E6M A;  3L7W A;  1SFX A;  4KMF A;  2E1N A;  5CVV A;  3FZV A;  1IUY A;  2DU9 A;  1SD5 A;  4AWX B;  1IXC A;  1BC8 C;  1AWC A;  1T39 A;  2VBX A;  4FHT A;  3GUD A;  3T8R A;  1JE8 A;  2JZY A;  3C18 A;  3H92 A;  3QP5 A;  1RIO H;  3RI4 A;  1B4A A;  2KJB A;  2D1H A;  1S7A A;  2H94 A;  1HW5 A;  1I6X A;  4I2O A;  2ZJ2 A;  2VE9 A;  2K27 A;  1B6A A;  4AIJ A;  2ISZ A;  1ZG3 A;  3COA C;  3BDD A;  2D1V A;  1K78 B;  4Q4Z F;  3BJ6 A;  4EGY A;  4N9I A;  2EV0 A;  2QM3 A;  2ZKZ A;  2R7F A;  3L9F A;  5L3D A;  2DO7 A;  4CZZ A;  5LEK A;  4O5V A;  4BHP A;  3DFG A;  2VOO A;  3WTU C;  3HTS B;  2XAS A;  2H6C A;  1B1B A;  2DBB A;  4PCQ A;  3F23 A;  2O03 A;  4G7O F;  1XGO A;  4DQ2 A;  2ESH A;  3LFK A;  3LQQ A;  3FMQ A;  5AIQ A;  4I7H A;  1BI1 A;  2VBY A;  3NQO A;  3ECO A;  4L5I A;  1F1Z A;  3ROU A;  5AIP A;  4IF4 A;  1ODD A;  4AD9 A;  3R6S A;  3KE2 A;  1XN7 A;  4YG2 F;  3CO6 C;  3V7C A;  1ZGA A;  2C6Y A;  2ZO4 A;  4I98 B;  4OMZ A;  4WCG A;  3JSP A;  1IF1 A;  4M9Z A;  4PDK A;  3HRT A;  3V8L A;  1JHH A;  2V9V A;  3DF8 A;  4DNC A;  3MCZ A;  4YFX F;  4E70 A;  3ELK A;  3F3X A;  4S04 A;  5JI6 A;  4IRI A;  1P6R A;  2CG4 A;  4BHB A;  5K5Q A;  3IRQ A;  3TKY A;  4EM2 A;  4B8X A;  1LQ1 A;  1XDU A;  2ZME B;  3ABU A;  4OIP F;  2HGC A;  2NS0 A;  2JSC A;  4G6D A;  2P6S A;  3QPT A;  3GYH X;  5D6E A;  2HYG D;  2QZ8 A;  1RUN A;  5CVR A;  1OYI A;  1FSE A;  3E5U A;  3BJO A;  4ZYD A;  4HZF A;  3BP8 A;  2FBH A;  3Q9V A;  5HS9 A;  3QP6 A;  3WOD F;  2HR3 A;  2IPQ X;  5D5V B;  2YSR A;  4P96 A;  3GFJ A;  4IRH A;  5DCM A;  2HEO A;  2ACJ A;  3ULQ B;  5FGM A;  2A6H F;  2CW0 F;  5LLQ A;  3ZMS A;  1JXS A;  3ZMV A;  2GAU A;  5LGN A;  2FNP A;  3SXY A;  1EV7 A;  2QWW A;  4XSZ F;  4GXO A;  2DPU A;  4M6Y A;  5HDK A;  1U8R A;  3TO9 A;  2EWN A;  1QQI A;  3G73 A;  4A0Y A;  2FXA A;  1S29 A;  1MDM A;  2RVC A;  4KIG A;  4KT5 C;  1W7P B;  3BY6 A;  2HQR A;  2E7X A;  4MEY F;  4M6X A;  2FBI A;  2KIF A;  3M9A A;  2ELH A;  2HKX A;  2ZBK A;  3P9C A;  1Z9C A;  1PP7 U;  2PN6 A;  1ZAR A;  1LNW A;  1W5S A;  3JAM Z;  3QAH A;  4WX9 A;  3N4M A;  2M8E A;  2UZK A;  3LST A;  3U2R A;  4I09 A;  2OZ6 A;  2D2W A;  1FP1 D;  1S3J A;  2GZW A;  4EM1 A;  3QPH A;  3OV8 A;  5DD8 A;  2A6E F;  1XGS A;  5D4S A;  3WU0 A;  4KN7 X;  2YR2 A;  3HIF A;  1YIO A;  3BPV A;  5IT9 Z;  3QU3 A;  2UWM A;  4L9J A;  4OIR F;  2PMU A;  3CUQ B;  4P55 A;  3IRR A;  5LHG A;  5BMZ A;  2E1C A;  1P4W A;  1IAW A;  3IKT A;  4LK1 F;  2CGP A;  1IW7 F;  2G9W A;  3KEO A;  1MJA A;  5H20 A;  3QRF F;  3T0Y A;  4Z2Y A;  1BOA A;  2IJL A;  3CTA A;  3GF2 A;  3RYR A;  2JPB A;  3O2P E;  2RC4 A;  2L3D A;  3HSF A;  3C1D A;  1TQM A;  1KQ8 A;  1HXD A;  3TO6 A;  2IVM A;  2Z9O A;  4LFU A;  1U5T A;  3RKX A;  4BXU A;  4LG0 B;  5DUI A;  2PJP A;  4KIB A;  2K02 A;  3HHG A;  1KU9 A;  3K1N A;  1W7P D;  3IKV A;  2V1X A;  4HV5 A;  1YYV A;  2Z99 A;  2R3S A;  4JBA A;  4LB6 B;  3PFI A;  5ILU A;  4N9H A;  1P4X A;  1FYK A;  1I1S A;  4EV0 A;  4JQF A;  5JVT A;  1G3Y A;  4JK1 X;  1CGP A;  1R58 A;  2M1B A;  3DV8 A;  1S6L A;  4ZYG A;  3HRM A;  2A61 A;  4P5O A;  2GXG A;  3QOP A;  3K0L A;  1FWZ A;  1ONV A;  2UXN A;  3F8C A;  4HQM A;  4GGG A;  1EH7 A;  5BQT A;  3HOS A;  2GIV A;  5ILS A;  1IRG A;  5LEJ A;  2ISY A;  3GW2 A;  3NRV A;  1TBX A;  2NNY A;  1GVJ A;  5E1W A;  5FLX K;  2QEN A;  3KP4 A;  2KRF A;  3FXR A;  1ZHF A;  3BJA A;  1ZGJ A;  4OOI A;  3I59 B;  1Z6R A;  3DQV C;  4IHT A;  2L01 A;  2XKP A;  1I5Z A;  2JTV A;  3LA3 A;  2A69 F;  1TW3 A;  5AON A;  2DQR A;  3U1D A;  1WQ2 A;  1QZY A;  4ENJ A;  2CYY A;  3VEP A;  3J81 Z;  4IVN A;  3VOD A;  1H9T A;  1U5T C;  2QQ9 A;  4HYE A;  1S8N A;  2LNB A;  5F64 A;  4OU0 A;  2PLY A;  2DQL A;  1UST A;  4R79 A;  2BE5 F;  4O6J A;  1J75 A;  3BWG A;  2NAZ A;  1BIA A;  2TDX A;  2FRH A;  4MHG A;  1DP7 P;  2IA1 A;  3E6B A;  1DDN A;  4G9Y A;  4L0Z B;  4B09 A;  1YS6 A;  2CWE A;  2HS5 A;  2RGV A;  1MJB A;  4RGS A;  2EV6 A;  2OAZ A;  1HSJ A;  2A07 F;  3KP7 A;  2J5P A;  3KP2 A;  2OQG A;  3F8M A;  4TV7 A;  2O8X A;  3K1P A;  3MWM A;  4CGZ A;  1TTY A;  1I27 A;  4KMU X;  2NNN A;  1L3L A;  4PZJ A;  2DK8 A;  1YW7 A;  4Y13 A;  2IT0 A;  1XDS A;  2VT2 A;  2EV5 A;  3KZY A;  1O57 A;  1UHM A;  3LAP A;  2PFB A;  1KU7 A;  1SFE A;  1QGP A;  3MFK A;  3C7J A;  1XMA A;  3SHF A;  1LB2 A;  5CJ9 A;  1DPR A;  3P9I A;  3E6D A;  1UHW A;  2AXL A;  4KA4 A;  4HF0 A;  3DEU A;  2Z3Y A;  1ZRC A;  1IN4 A;  5HLH A;  4QLC U;  2BV6 A;  2A5Y B;  2OU2 A;  3J7A O;  2DW4 A;  4K2E A;  1AOY A;  3WGH A;  1SMT A;  5ICE A;  2VBW A;  1IXS B;  5E1Z B;  1BI0 A;  5KK1 A;  1YS7 A;  3AAF A;  5HS7 A;  5A2Q Z;  2VON A;  2OZU A;  2HKO A;  1K79 A;  2P6T A;  2L02 A;  3NEU A;  1KYW A;  5HDG A;  3MQ0 A;  2DT5 A;  2K4J A;  5CLS A;  2MD5 A;  3FXU A;  2EFQ A;  4AVP A;  2LF8 A;  2MC3 A;  1MD0 A;  2VC1 A;  4M74 A;  1KQ9 A;  4ZZD A;  4G6Q A;  1T2K A;  1P4A A;  2E7W A;  2J5O A;  4ETS A;  1TNT A;  4A6D A;  4HX7 A;  1ZLJ A;  3L2C A;  2XVC A;  3FX3 A;  5BS6 A;  1CF7 B;  2RKH A;  2EJR A;  4R8H A;  3O3K A;  3RKY A;  1O3T A;  5E8I A;  3QU6 A;  3Q9S A;  4UVB A;  1U6G A;  4M72 A;  3R4K A;  4IXA A;  5HVQ C;  4NHJ A;  5EEG A;  3HRU A;  2Q0O A;  4Y15 A;  5F6F A;  3R61 A;  2MH2 A;  3TQN A;  3D0S A;  1EH8 A;  3ZN1 A;  2JRT A;  2O0Y A;  3ZMT A;  4ESF A;  1IN6 A;  3KEQ A;  1MGT A;  2B0L A;  3F8N A;  3GLX A;  2FQ3 A;  4EJO A;  2H6B A;  2RNJ A;  4G7Z F;  5DYM A;  5H6Q A;  1XD7 A;  4A12 A;  5K5R A;  2OD5 A;  1YO5 C;  2EFO A;  1DUX C;  1ON2 A;  4LMY A;  2YX7 A;  1D8J A;  5JR3 A;  2LF7 A;  3GVA A;  1ZG5 A;  3N97 A;  1RZ4 A;  4UHT A;  3TDU C;  3ZN0 A;  3BRO A;  3KP6 A;  1V4R A;  4L5J A;  3RYP A;  3U9G A;  2XGX A;  3FF5 A;  2K86 A;  1LEB A;  3LWF A;  4R1H A;  4YIF A;  2LSO A;  3I4P A;  3EDP A;  1Z05 A;  4UVC A;  4OIO F;  4OMY A;  3GEZ A;  4L0Y B;  3E5Q A;  2QUF A;  4HLX A;  1FC3 A;  3ZQ7 A;  3EUH A;  2DAO A;  4OIQ F;  3TDZ C;  1YLF A;  1TQP A;  3F6V A;  1J0R A;  3I71 A;  3GX4 X;  2L4M A;  1LEA A;  1D3Y A;  4UV9 A;  1FYL A;  2OBP A;  2WC2 A;  2IA0 A;  2PEX A;  4P9U A;  1SD6 A;  4GYI A;  2MLK A;  4IPA A;  2O61 A;  4KN4 X;  4A5M A;  4ON0 A;  2PG4 A;  3CLO A;  5LBQ A;  3BPX A;  1Q1H A;  1QO0 D;  1FNN A;  4WXD A;  1D5V A;  2ADU A;  2VOD A;  1G3W A;  3MEX A;  1PP8 F;  4PGH A;  4M71 A;  4H0E A;  3KET A;  3ZPL A;  1T0F A;  3GFM A;  2F5C A;  2WV0 A;  2Y0M A;  4HDU A;  2NYX A;  4IHS A;  3TO7 A;  1R5H A;  1YG2 A;  2G7H A;  3ZMU A;  1TQI A;  3VFZ A;  1BM9 A;  1K78 A;  1I1G A;  1A04 A;  3EYY A;  1OYY A;  1TNS A;  5TJJ A;  1YFH A;  3IC7 A;  1FBS A;  1X3U A;  4IJA A;  3EYI A;  2X4H A;  2UXX A;  2M87 A;  5J8F A;  3CUO A;  1XSD A;  5FO5 A;  1FOK A;  3V8K A;  2GA1 A;  2CFX A;  3KP3 A;  4L9V A;  3BZ6 A;  2IA2 A;  4LLN A;  1Y0U A;  1J2X A;  3IL2 A;  4D0P A;  3RKW A;  4YFK F;  1XSV A;  2AS5 F;  2HTS A;  3M8F A;  4BHC A;  4XSX F;  5L3C A;  3SZT A;  3B02 A;  3E5X A;  4RAY A;  4MEX F;  1HST A;  3KLN A;  3KCC A;  2F5F A;  5FD6 A;  3V7S A;  1IN5 A;  3GWZ A;  2JPC A;  4CXF A;  4HDV A;  2QQB A;  2DFI A;  3HHH A;  2Z5U A;  3WE2 A;  2BYV E;  4RGR A;  5EEH A;  3HUG A;  3T1B A;  3WTV C;  3ML6 A;  2A68 F;  1LDJ A;  2QBY B;  5DV5 A;  3VOE A;  4A6E A;  3FHZ A;  1B9M A;  4U88 A;  1FX7 A;  4ENK A;  4U7D A;  4I0A A;  4F7Z A;  1Z7U A;  1MJ9 A;  5LHH A;  1XB4 A;  2F5D A;  3MZH A;  2ZNY A; 
#chains in the Genus database with same CATH topology
 1R5G A;  2ZME A;  4DJA A;  2GWR A;  1JJ6 C;  1LVA A;  5CYV A;  2YU3 A;  2VT3 A;  3C2G A;  5B1A H;  4EGZ A;  5TRD A;  2ZNZ A;  2M5W A;  2FU4 A;  1WJB A;  1WI9 A;  3CMA I;  1D1B A;  3FXO A;  5IP6 A;  1OCR H;  3FXM A;  4Y17 A;  1MMA A;  2IS6 A;  4CIC A;  1WJE A;  3CES A;  3S2D J;  2LRE A;  5CVJ A;  4KIC A;  2E5N A;  5J3L A;  5HNF A;  2M9H A;  3ZQC A;  4UUV A;  3EET A;  4XLA A;  2KRH A;  2BY0 A;  2LFB A;  1O7L A;  3HTU A;  1T95 A;  3WE3 A;  4IX7 A;  1I39 A;  1GXP A;  2PJR A;  2DDA A;  4MQV A;  2VPL A;  1JGS A;  2KIM A;  2VXZ A;  2ESN A;  5D6F A;  5EGO B;  2VN2 A;  4GRI A;  1ZR4 A;  4KIT B;  2XGD A;  4HLY A;  4XIC A;  2V79 A;  5E17 F;  2UUZ A;  3GZ5 A;  1HDD C;  1ZAO A;  4RAZ A;  2RDP A;  2RRE A;  2VXD A;  3P7N A;  1ZG1 A;  4G12 A;  2VKH A;  2GIZ A;  1W5T A;  1XG1 A;  2HDC A;  3ZMD A;  2WB1 N;  3LQR A;  1HBX G;  2CO5 A;  2CQ7 A;  1MSF C;  3LA2 A;  4HBL A;  5GPA A;  5ERI A;  2R7U A;  1KGS A;  1Z91 A;  4ESJ A;  3HSE A;  4BH9 A;  2KKO A;  3E6C C;  2PBI A;  1YHQ I;  1SMY F;  1R1U A;  3FWE A;  5H6R A;  1YQA A;  2OA4 A;  1HKQ A;  2XUB A;  3E0J B;  5GPC A;  3ZP5 A;  5KNL A;  3UNG C;  4NQW A;  3L09 A;  4NC8 A;  2XSJ C;  1J9I A;  1OJL A;  5F0C A;  1R1V A;  3I4N J;  3K4C A;  4CDG A;  5F04 A;  5GAE J;  2X6X A;  4BDZ A;  1GXQ A;  3GTQ J;  1T56 A;  1F9N A;  3CC7 I;  4L9N A;  1G3T A;  1OYW A;  3BR2 A;  4XRM A;  1XPX A;  1YE9 A;  2GA2 A;  1B8I A;  5E18 F;  2O3F A;  1PUF A;  3PQK A;  4HX8 A;  2ZFW A;  2NVQ J;  3VYU B;  1T33 A;  1WRJ A;  2R7O A;  3V8J A;  3RJP A;  3D5L A;  5FFX A;  1P92 A;  4IHX A;  1W7P A;  3DPL C;  2Y9Z A;  2V1D A;  3LAJ A;  1NH3 A;  1WCM J;  1F5T A;  4L9T A;  2VQG A;  2ZME C;  3G71 I;  3RTR A;  2VL8 A;  2AO9 A;  1GUU A;  2WWY A;  2FA5 A;  4RM2 A;  3SZG A;  4CHU A;  4XON A;  2P8T A;  2GLO A;  4PJN A;  5ICG A;  2HDW A;  1ZYR F;  3I54 A;  1KA8 A;  3LSH A;  4ASN A;  4F91 B;  3KFW X;  1XX5 A;  4U7B A;  3V42 A;  1OCT C;  2XB5 A;  2W7N A;  2EZK A;  3F8B A;  2HOE A;  2L54 A;  1OLT A;  3T8T A;  3VPR A;  4CYC B;  4BNC A;  1N25 A;  3P9K A;  1VQ4 I;  5HS8 A;  3LSR A;  2LKP A;  2VBZ A;  4JX6 A;  3SDG A;  2CUF A;  2KJC A;  3FK6 A;  2LDU A;  1O3S A;  1IXR C;  1QVT A;  2HU9 A;  4BAY A;  2K4B A;  2DXI A;  2R7T A;  1TZL A;  2K7L A;  4NBQ A;  1SFU A;  4GCV A;  2QYO A;  4X1E A;  3A01 B;  1MBH A;  3K10 A;  3CUQ A;  3BOQ A;  5JHF A;  3GTP J;  1J5Y A;  4I01 A;  4BXF A;  2GBY A;  4YIR X;  2JT1 A;  1ITY A;  5E20 A;  1WJD A;  3S3O A;  4D7N A;  3IV5 A;  1MKM A;  4RGX A;  4RLQ A;  1NG6 A;  2FE3 A;  4Q48 A;  1KON A;  4EVI A;  2F48 A;  2O7O A;  2DYS H;  2VKD A;  4BDY A;  4BJT A;  4C3H J;  4FQG A;  3H36 A;  1Z3Y A;  2V1U A;  1UFM A;  1R22 A;  2MAB A;  3GTM J;  4E7H A;  4JYK A;  3JRB A;  3ZQH A;  4G6T B;  4HX4 A;  3CO7 C;  1MH3 A;  1XSX A;  2NOJ B;  3R0J A;  1TW2 A;  2AQE A;  5LRS A;  1H9G A;  1BI3 A;  3HSR A;  3LMM A;  1JUP A;  4CYD A;  4XLE A;  3DXJ F;  1O3R A;  4A3I J;  3ZGK A;  1D0Y A;  3HRS A;  3PQJ A;  3WG7 H;  2O6G E;  3V7R A;  1KU3 A;  4HPQ A;  1YW8 A;  1X1C A;  3G4S I;  4D7M A;  4G7H F;  5F27 A;  2L7F P;  1FBQ A;  5CKT A;  2CJJ A;  2EZI A;  3K6G A;  1WSU A;  1T98 A;  4LG0 A;  4KUM A;  5LFA A;  4ZJZ A;  1NTC A;  5DD4 A;  1X1A A;  1UAA A;  3WGI A;  2HYF A;  1MZB A;  1ZK8 A;  2QLZ A;  3S2H J;  2W57 A;  2PMZ A;  5FB2 A;  3MKW B;  2MBF A;  5DDG A;  1H88 C;  2H8W A;  1S7O A;  4FX0 A;  5D5W B;  1BJA A;  4MQ9 F;  2PMH A;  2RN7 A;  1WVR A;  2OQR A;  3BR5 A;  4PJ0 C;  3KZZ A;  1WI3 A;  2ELK A;  4PGG A;  2M8G X;  2JA5 J;  3OYC A;  3TOB A;  2GQQ A;  2XRO A;  1T38 A;  2EB7 A;  1H0M A;  3K1M A;  5DCM B;  4IQ4 A;  3S1M J;  2YS9 A;  1U3E M;  4BY7 J;  3VSL A;  2R93 J;  2Z33 A;  2HOS A;  1TWC J;  1R36 A;  3KYC B;  5B1B H;  4LD5 A;  3ERE D;  4FET A;  2Y48 A;  2WAF A;  5F0F A;  3QYE A;  1EF4 A;  2PQ8 A;  2WAE A;  2FBK A;  2ETH A;  3HOT A;  1PUE E;  1WJC A;  3HBL A;  3JAM K;  4PFP A;  1XGN A;  4OIN F;  1Z21 A;  3WG9 A;  3M8E A;  2EK5 A;  2B9S A;  1R00 A;  1V54 H;  3FIW A;  1Z6T A;  2EA2 A;  1R6R A;  3MZ8 A;  3M4O J;  1JHF A;  1RKT A;  3RPQ A;  2ZJR F;  3S14 J;  3CUQ C;  3PNY A;  2VKV A;  2BY2 A;  3DKX A;  4RGU A;  1MMN A;  3SZP A;  5F0H A;  5DM7 F;  3LA7 A;  3L00 A;  3M7G A;  1XTA A;  1LFB A;  1GT0 C;  2VLA A;  4CCK A;  1WWX A;  5CQG A;  3GTG J;  5IT9 K;  3HOV J;  1HF0 A;  3G1O A;  1MDM B;  4YII A;  3I0T A;  3CJN A;  4CO8 A;  4WF2 A;  4A3L J;  4HF1 A;  3C2H A;  1FPQ A;  2QA4 I;  3I59 A;  2IEK A;  1VQ8 I;  4XKC A;  2JUC A;  4C3I J;  2RAE A;  3AG3 H;  3IWZ A;  3OYF A;  3H5R A;  4XLC A;  2VOP A;  2Q2E A;  3FM5 A;  1FY7 A;  4ZDP A;  1DGW Y;  1WJ5 A;  5JLW A;  2LK2 A;  1ON1 A;  2W84 A;  3EPZ A;  4M3D A;  2QSH X;  5HLI A;  3CDH A;  3OS1 A;  2E1M B;  4EJT A;  1BBY A;  2KIU A;  3PIO F;  5D5X B;  1T6S A;  4ANJ A;  2HZT A;  2DMT A;  3ABM H;  4P9F A;  1WFX A;  2UV1 A;  4IRG A;  4EJV A;  1G8X A;  1HKS A;  2Y0S N;  4IZZ A;  2M0C A;  4HW0 A;  3K2Z A;  4GO1 A;  3FXQ A;  3JRA A;  5E79 C;  3WTZ A;  2KP6 A;  4I0B A;  4XLH A;  2RV8 A;  3REO A;  3PL8 A;  4YFN F;  4WXH A;  1YW9 A;  2FML A;  2EFW A;  1OKR A;  2MA3 A;  2EFN A;  3OMY A;  4LB5 A;  2CSO A;  3VYS B;  4C9Y A;  1B59 A;  4E7Z A;  5KVR A;  2K9L A;  3I5U A;  2W4S A;  4HG2 A;  4YEJ A;  5E8G A;  1QZZ A;  3JCU C;  4F52 A;  3H0G J;  4QPO A;  4E6K G;  3WTX C;  2P7V B;  1KYZ A;  3ZCO A;  3QOE A;  1OPC A;  5FLX Z;  2H27 A;  3RDI A;  2OTL I;  1EH6 A;  4J19 A;  3KPH A;  3JSO A;  3WU1 B;  4KDP A;  4L5E A;  2Y69 H;  3S2W A;  4B43 A;  2DK5 A;  4FX4 A;  4MFD A;  2H09 A;  1PDN C;  4Q5S F;  4A3G J;  3SQN A;  1MBJ A;  2VE8 A;  1W0T A;  1K6O A;  1NK2 P;  1RI7 A;  3I56 I;  3K69 A;  3NWS A;  3W6J B;  4DYC A;  2XSD C;  1FP2 A;  3KX2 A;  1EJ9 A;  4MNU A;  5CVU A;  2JK3 A;  3TOA A;  4BGD A;  3QOD A;  4ZTJ A;  4S0H B;  2M45 A;  4RAF A;  1IN8 A;  4F3Q A;  2HVQ A;  3CME I;  2IGM A;  3OIO A;  3FMR A;  1NHA A;  4HAM A;  4H4K C;  3CDL A;  3OYI A;  5BPI A;  4GDF A;  2KLO A;  2WY7 Q;  3MZY A;  5DUK A;  2V7F A;  1I3A A;  3AG4 H;  3HJE A;  5E1X A;  3SYT A;  5IT3 A;  1X1B A;  3Q5F A;  1K83 J;  3H9G A;  3L2Q A;  4NNJ A;  1FSH A;  5HLG A;  2LR8 A;  1U2W A;  4KIS A;  3WGG A;  5LRR A;  2L9R A;  1JKP C;  1U5T B;  1VND A;  5LD2 C;  2OF7 A;  1O7F A;  3WU2 C;  5DTD A;  4A3D J;  2IBD A;  5J8C A;  1U9N A;  3CCJ I;  2CH0 A;  2DOE A;  1HKT A;  1F4K A;  3GTO J;  3GBG A;  2XF5 A;  3SFZ A;  2LD5 A;  1XC5 A;  3RIR A;  4A3E J;  1UG0 A;  2JJ7 A;  4D1Q A;  2OV7 A;  4NB5 A;  4U0V A;  5BPD A;  4L18 B;  1UHS A;  1B9N A;  1TWF J;  3GFI A;  5L3G A;  2M34 A;  4M9S A;  4MTD A;  1O3Q A;  1LVK A;  3OYH A;  3ABL H;  3S16 J;  2E2H J;  1QRY A;  2V6E A;  1HCR A;  1K4S A;  3J80 K;  1MSE C;  3WTT C;  4GYG A;  5C4X J;  1RNL A;  2L7Z A;  2DTR A;  3VSK A;  3J81 K;  1JKO C;  1B72 A;  4WK8 F;  3AFH A;  1G6N A;  3PNT A;  1OMI A;  4XBF A;  1YTY A;  3OYE A;  2K9Q A;  2K9M A;  2CQN A;  3ABK H;  1LJ9 A;  2M0M A;  4HV6 A;  5ED4 A;  1YOV B;  2YUS A;  2XAF A;  3MAJ A;  2R5Y B;  3S93 A;  1HOM A;  1M1E B;  4ESB A;  3JTH A;  1USS A;  4J01 A;  1FBU A;  5LGU A;  4E7J A;  1WKM A;  3JTG A;  3S32 A;  3RCO A;  2P7C B;  2LOO A;  2WA0 A;  1JTX A;  3IWF A;  3H3Z A;  4YEL A;  2ZCW A;  4IQJ A;  3I64 A;  1WZ2 A;  2EA4 A;  3GLL A;  4ZDO A;  2G7U A;  4AYB N;  4EJW A;  2F5V A;  3N05 A;  3E3V A;  2P5K A;  1POG A;  2ZFU A;  5LHI A;  1VQL I;  3SFI A;  1KU2 A;  2B7E A;  2MLG A;  4CCJ A;  2XAQ A;  1ZR2 A;  4A5N A;  2ZXJ A;  2IW5 A;  2FMY A;  1CF7 A;  5EZG A;  1X4O A;  3OYK A;  5KCM A;  2FX0 A;  4UV8 A;  2W24 A;  1LDD A;  2ZXW H;  3J7Y J;  3F22 A;  2DYR H;  4ZZL A;  2BHY A;  2JN6 A;  2P5V A;  2W85 A;  4AIH A;  3DCF A;  1D1C A;  1QNT A;  3M8J A;  2CUE A;  2LP0 A;  1HW2 A;  2FEZ A;  1A6Q A;  4V2F A;  1J59 A;  3CMY A;  1BI2 A;  1YX5 A;  4UNO A;  4HNU A;  3PO2 J;  4PFO A;  1UCR A;  3HOZ J;  1X4P A;  3QWL A;  3QYB A;  4CA0 A;  2F5E A;  4V2G A;  1NG7 A;  4A0Z A;  2DN0 A;  4U0W A;  2X51 A;  3DTE A;  2CUJ A;  3QPL A;  3U1K A;  1P7J A;  2KFD A;  1XGM A;  2CFO A;  1FT9 A;  1WGX A;  2WBM A;  3A4C A;  1SAX A;  5EJC A;  1I50 J;  3HOU J;  5ILV A;  2Y75 A;  2X6O A;  4Q47 A;  5JHU A;  2QQ8 A;  4BYY A;  5F08 A;  4RB3 C;  1IRF A;  3VWB A;  1Y56 A;  2F2E A;  4LGW A;  1G3S A;  4IHV A;  2V6C A;  2HFH A;  4M3G A;  3JW4 A;  2DA2 A;  3KIO A;  2NXN B;  3RZO J;  3TP0 A;  2D45 A;  2A3S A;  2ME6 A;  3RPU A;  4KFC A;  3W2V A;  1QPM A;  2WTE A;  2PI0 A;  3HXL A;  4RB0 A;  4BUP A;  1SAU A;  3H9Q A;  4ZH4 F;  2DA4 A;  3ONQ A;  4MFE A;  1ZQ3 P;  1C0W A;  3DLA A;  2KHM A;  3BLY A;  3F9K A;  5JFR A;  1ZRD A;  1YI2 I;  1MIJ A;  2JVH A;  3R60 A;  4IOA F;  2ECB A;  2DI3 A;  5ICC A;  3HKZ A;  2BBY A;  2R7D A;  4RS8 A;  5D8K B;  5FD5 A;  3HB9 A;  3DPU A;  4M9X A;  2R5Z B;  1E17 A;  5K1Y A;  5K5O A;  4MGR A;  4WWC A;  1L0O C;  5IYC J;  5ICF A;  3CP8 A;  3GO5 A;  4IL6 C;  1LPQ A;  4OAY A;  4AID A;  2WAQ A;  1FLI A;  1VI0 A;  2K9N A;  4Y4R A;  2Z1D A;  4UXN A;  4ENM A;  4LLG F;  1AKH B;  3S17 J;  1LUJ B;  3R0A A;  2MH9 A;  5A2Q K;  4IOC F;  2HWV A;  3GFL A;  5JLX A;  1R7J A;  2BOL A;  5GAG J;  3A0H C;  4XLP F;  2R7X A;  1XMK A;  1X2N A;  3CMM A;  3OIP A;  1BIB A;  5DM6 F;  1BW5 A;  2YX4 A;  2VI6 A;  1ZRF A;  4FE4 A;  3FHN A;  2HQN A;  2DA6 A;  2FF4 A;  4ENN A;  5L3B A;  3EQL F;  3GZ6 A;  4LLL A;  1ZGW A;  2STT A;  2A5W A;  2DA7 A;  1ULY A;  2LTP A;  2E71 A;  4UB8 C;  2FQ4 A;  2P4W A;  1I3Q J;  1XCB A;  2XKO A;  4HF2 A;  4XLN F;  3AG1 H;  4XRF A;  3PM1 A;  1Z1D A;  3F6O A;  1ZLK A;  1E2X A;  2YU9 J;  2DOA A;  2VC0 A;  2IGO A;  3LSG A;  3CZ6 A;  5FRO A;  2IP2 A;  5J40 A;  1HW1 A;  2FJ1 A;  1MND A;  4BEH B;  5IP9 J;  5D4R A;  3MKL A;  2TCT A;  3LSI A;  2ZJQ F;  1FYM A;  3OYL A;  2VKE A;  3I53 A;  4HA8 A;  2MSY A;  5DEQ A;  5FFZ A;  1IGN A;  2W1O A;  3O6B B;  4CSW A;  3O8H A;  4KNY A;  4N0B A;  2DT7 B;  4MTE A;  3ZMZ A;  1IV6 A;  2N8G A;  3WTY C;  1OR7 A;  2CW7 A;  4U0Y A;  4HNV A;  5M5Y J;  1U8B A;  4G8X A;  3DBL B;  2Y2Z A;  4WXC A;  2L5Q A;  2X9D A;  4BAC A;  3VB2 A;  4XOR A;  3FMS A;  3AL0 C;  1K4T A;  5HDN A;  2CW8 A;  2BHZ A;  3TBI A;  4EM0 B;  1U78 A;  3FXJ A;  4UY8 I;  4GFB A;  4XQF A;  5EG0 A;  4CCO A;  4F55 A;  2EH3 A;  3ZQI A;  4ZYA A;  2P5L C;  4FT8 A;  2NRA C;  2MFZ A;  5IOY A;  2FNA A;  3Q0V A;  3T5X A;  3ZQQ A;  4M73 A;  1ZRE A;  5L3E A;  1IG7 A;  4O3M A;  2FOK A;  5J6X A;  2PX9 A;  5DCF A;  2R7Z J;  2I5U A;  1GHC A;  6PAX A;  5KAF C;  1FZP B;  2XAG A;  3F21 A;  3AG2 H;  1STZ A;  2W25 A;  3Q3S A;  2AHQ A;  4M3F A;  4UVA A;  3OOP A;  2ZSI B;  5CVI A;  5D5U B;  1XCV A;  5F1R A;  3ABT A;  2QSG X;  4HQE A;  2XRN A;  2IRF G;  3KLO A;  1IUF A;  2K5C A;  5M3F J;  1HQC A;  2IXS A;  3DPT A;  3E97 A;  3I58 A;  5C44 J;  2HTJ A;  2STW A;  1SD4 A;  3BZK A;  3F8F A;  2FSW A;  2DCE A;  1V3F A;  3H3U A;  4RMN A;  1SD7 A;  4G94 A;  2DLL A;  3CCR I;  4N4N B;  3UR3 C;  3BR0 A;  4BY1 J;  1GLN A;  1R5I D;  3A1Y A;  1QU3 A;  4EQQ A;  2CQK A;  2P81 A;  4CH7 A;  3FK7 A;  1FEX A;  2RQP A;  3VYR B;  5M3M J;  3TMO A;  2XHK A;  2HVR A;  1ERD A;  3G6E I;  1TL8 A;  3DKY A;  5BOX A;  2JA7 J;  2IS1 A;  1ZTR A;  2QVO A;  3HEF A;  1IN7 A;  3G1M A;  3J80 Z;  3CC4 I;  2BGC A;  2EFP A;  3FXK A;  2FD5 A;  3K9T A;  3F72 A;  4RDU A;  1UG2 A;  1D8K A;  3BR1 A;  3WTW C;  4EMS A;  4DGW B;  5GP9 A;  5LGT A;  1ZH5 A;  1TT0 A;  2VPR A;  5J4Y A;  2IGK A;  5L3F A;  1D5Y A;  2LYC A;  4QWQ A;  1N78 A;  4RB2 C;  1PYV A;  1LE8 A;  1RUO A;  1GVD A;  4PUS A;  1UB9 A;  1R1T A;  2X0L A;  4F93 B;  2F4M B;  3W3C A;  3CCV I;  2BEO A;  4QSH A;  1QBJ A;  1OR7 C;  3MVP A;  3FBN B;  4Z6Y A;  3CCL I;  2COM A;  2VJI A;  1BC7 C;  2XV4 S;  3LSP A;  1A5J A;  5C4J J;  4BQA A;  1V5F A;  3C3W A;  3GXO A;  1DPU A;  2Y31 A;  3BR6 A;  1REP C;  4LK0 F;  4JP0 A;  1QA6 A;  5D8L B;  2KIQ A;  4A2U A;  4Y7N J;  1P2F A;  4LIU A;  1J7K A;  2YPR A;  1W4M A;  3K2A A;  5E3L A;  3U21 A;  2M30 A;  3ECH A;  4KIF A;  4A0X A;  3M1E A;  2KL4 A;  4CCN A;  2DPD A;  3KP5 A;  3IAS 2;  4RB1 A;  1BN5 A;  1R23 A;  2JA8 J;  2BVL A;  5GAH J;  1IZ1 A;  1YRN B;  4UB6 C;  2QQA A;  4XID A;  3OYN A;  3FM3 A;  2GXB A;  2DJN A;  4E7I A;  2LRD A;  4AIK A;  4S05 A;  3DKW A;  4I02 A;  2QBY A;  2OJE D;  4B48 A;  3TGN A;  2RQQ A;  3W2W A;  2M7B A;  3DP7 A;  3G1L A;  4LJZ F;  3W6K B;  1K7A A;  5HOO A;  1N77 A;  2F4O B;  1G4D A;  3CCY A;  4N4O B;  1DGR M;  2L4A A;  4EJU A;  3G3Z A;  4KYW A;  3LSK A;  4ZYE A;  3WTS C;  2M4K A;  3V4G A;  2VIX A;  2OCC H;  1J09 A;  2XPW A;  3ASN H;  3IHU A;  3ASO H;  3HYI A;  2Q8K A;  2HYJ A;  4DIQ A;  1BR2 A;  1X2M A;  2LKX A;  1KQ0 A;  2XAH A;  1BR1 A;  3PSF A;  4BKX A;  2XAJ A;  1FJL A;  2XIG A;  1VTN C;  3B73 A;  3BCA A;  2E19 A;  3BC8 A;  1ZN2 A;  2K85 A;  4HOB A;  4C3J J;  4ZYH A;  5FRM A;  3ISP A;  1LDK B;  1TLH B;  3E6M A;  3FBI B;  3L7W A;  2EPF A;  3H3V K;  1G59 A;  1SFX A;  4KMF A;  2E1N A;  1Y1V J;  5CVV A;  3FZV A;  1IUY A;  3PIP F;  5CPR B;  2KZG A;  1Y0N A;  2DU9 A;  3I55 I;  2MYS A;  1SD5 A;  4AWX B;  1IXC A;  1BC8 C;  1AWC A;  1IC8 A;  2CV1 A;  4J00 A;  1T39 A;  2Z16 A;  5EGO A;  2VBX A;  4I76 A;  4FHT A;  3GUD A;  3JRC A;  3T8R A;  2IGN A;  1JE8 A;  3BCB A;  4NC7 A;  2JZY A;  3C18 A;  3H92 A;  3QP5 A;  1RIO H;  3RI4 A;  4QPQ A;  1B4A A;  2KJB A;  1GDT A;  2D1H A;  5EZH A;  5FKL A;  2NS7 A;  1VQN I;  1S7A A;  1WH5 A;  2H94 A;  5J47 A;  5B66 C;  1HW5 A;  4DYR A;  1FIA A;  1I6X A;  4KJZ A;  4ITV A;  4BJ6 C;  2IS2 A;  4I2O A;  2ZJ2 A;  2VE9 A;  2K27 A;  1B6A A;  2L9N A;  4M6V A;  4AIJ A;  4LG3 A;  2ISZ A;  1ZG3 A;  3CCM I;  2V9P A;  2NVY J;  5B5E C;  5E3O A;  1P7I A;  1UJ8 A;  3COA C;  1VF9 A;  3BDD A;  3S15 J;  1X1P A;  2D1V A;  1K78 B;  4Q4Z F;  3L2U A;  3BJ6 A;  1YJW I;  4EGY A;  4ZDL A;  4BE2 A;  2NVT J;  3CC2 I;  5EEA A;  2HOA A;  1AA7 A;  4HEA 2;  4BBR J;  2R7Q A;  4N9I A;  2EV0 A;  2QM3 A;  2ZKZ A;  2R7F A;  1X1D A;  1MNE A;  2HXO A;  3OYM A;  2TRT A;  3F0C A;  3L9F A;  1MMS A;  2VB6 A;  4XKV A;  5L3D A;  1W5C C;  1S72 I;  2DO7 A;  1IRZ A;  4C2M J;  4CZZ A;  5LEK A;  4O5V A;  4BHP A;  1SVM A;  5GAD J;  3DFG A;  2VOO A;  3DEE A;  1MBF A;  3WTU C;  3HTS B;  2XAS A;  2A6T A;  2H6C A;  1BOB A;  1PVE A;  3S8P A;  1FMV A;  1B1B A;  2DBB A;  4PCQ A;  4BJ5 C;  3F23 A;  2O03 A;  3LOC A;  5FKO A;  2E2J J;  1XGO A;  4MO7 A;  4DQ2 A;  2P0W A;  1H8A C;  3HDD A;  3PJR A;  2E35 A;  1MMD A;  3CF5 F;  4AU7 A;  2LMD A;  3CF2 A;  2ESH A;  3LFK A;  4NDL A;  2EBI A;  1U0J A;  3LQQ A;  3FMQ A;  5AIQ A;  4I7H A;  1R49 A;  1LKX A;  3PFY A;  1BI1 A;  3OYJ A;  2VBY A;  4XN0 A;  4IKF A;  4FTH A;  3NQO A;  3ECO A;  1X3W B;  4L5I A;  1F1Z A;  3RSN A;  2V9K A;  3NWT A;  2I10 A;  3CLQ A;  2OC6 A;  3ROU A;  5AIP A;  4IF4 A;  4HNT A;  2JRM A;  2KDO A;  4HRI A;  1ODD A;  1U9O A;  4CYC A;  4HST A;  4AD9 A;  3ESW B;  1IRX A;  1ZEL A;  5FKM A;  3R6S A;  1YJN I;  1HC8 A;  3KE2 A;  2HQA A;  1XN7 A;  4YG2 F;  3CO6 C;  3LSM A;  3V7C A;  1ZGA A;  1HLV A;  2K3P A;  2NVU B;  3ZXS A;  2C6Y A;  2ZO4 A;  1VZ0 A;  4I98 B;  4AM3 A;  4OMZ A;  2BY1 A;  4WCG A;  4Y3O A;  4AC0 A;  3RKQ A;  1ETK A;  5IPA A;  2X1E A;  3JSP A;  3A01 A;  3BG7 A;  3JRI A;  1IF1 A;  3DU6 A;  3HUG B;  3CQZ J;  1XMX A;  2JWT A;  4M9Z A;  4PDK A;  3HRT A;  3ERM A;  3V8L A;  5J1R A;  1RKW A;  2XGE A;  1JHH A;  3KYL A;  2DDB A;  2V9V A;  3DF8 A;  2FOW A;  3MCZ A;  4DNC A;  4YFX F;  3S1N J;  4E70 A;  3ELK A;  3F3X A;  5IOZ A;  4S04 A;  2EIM H;  3BG3 A;  3DWL E;  5JI6 A;  4IRI A;  1P6R A;  2L2O A;  2CG4 A;  5IP7 J;  4BHB A;  5K5Q A;  3IRQ A;  2HNH A;  1UMQ A;  4XR6 A;  3TKY A;  4EM2 A;  4II2 A;  4B8X A;  3H35 A;  3D5S C;  2MD0 A;  1LQ1 A;  1XDU A;  1W0U A;  2ZME B;  2HVS A;  1R4N B;  3ABU A;  2M2E A;  4BU2 A;  4OIP F;  2HGC A;  2IAI A;  3BT9 A;  3OY9 A;  2NS0 A;  4PSX A;  1BW6 A;  2JSC A;  4A69 C;  2F4I A;  3DLL F;  4G6D A;  3IP4 B;  4C2T A;  2MC4 A;  2P6S A;  3QPT A;  3GYH X;  2E2I J;  2CRG A;  5D6E A;  2HYG D;  1LFU P;  2QZ8 A;  1RUN A;  2LVS A;  2Z2S B;  3K4J A;  2H1K A;  5CVR A;  2VUM J;  1OYI A;  1FSE A;  4BQN A;  3E5U A;  3CCS I;  2JUG A;  3BJO A;  3BQY A;  4ZYD A;  1H89 C;  5IYD J;  4HZF A;  3BP8 A;  2LY1 A;  5FKN A;  3RZD J;  2FBH A;  3Q9V A;  5HS9 A;  3QP6 A;  3OYA A;  2PJR B;  2R7R A;  2ICW G;  5J1U A;  3WOD F;  2HR3 A;  3DTI A;  1TWH J;  2IPQ X;  3WHB A;  5D5V B;  2GXA A;  2XB0 X;  2YSR A;  4P96 A;  1PJR A;  3GFJ A;  4IRH A;  4OAZ A;  1VQ5 I;  4BQQ A;  5DCM A;  2KDZ A;  3HOX J;  3OR2 C;  4HSR A;  2HEO A;  2CQQ A;  1VQ6 I;  5FLV A;  2ACJ A;  1BJZ A;  5E3M A;  3ULQ B;  1V55 H;  3SDB A;  2DMN A;  5FGM A;  2A6H F;  2CW0 F;  5LLQ A;  3ZMS A;  3HG9 A;  1JXS A;  3ZMV A;  2GAU A;  5LGN A;  2FNP A;  3SXY A;  1YIT I;  3W2A A;  1EV7 A;  2QWW A;  2LY2 A;  2K40 A;  1S7E A;  4XSZ F;  3GTK J;  3RQ4 A;  4GXO A;  4NQW B;  4IHW A;  3JRG A;  1TWG J;  1VQK I;  2DPU A;  2Y0S A;  4LOC A;  4M6Y A;  5HDK A;  1U8R A;  5IYB J;  3SEQ A;  3TO9 A;  3BG6 A;  2EWN A;  5EF6 A;  1QQI A;  1BL0 A;  3G73 A;  1F36 A;  2FXA A;  4A0Y A;  4A3C J;  1ETY A;  1YIJ I;  5M5X J;  3W6V A;  1B8I B;  4IHY A;  1JUM A;  4F92 B;  3CD6 I;  1PUF B;  1S29 A;  1MDM A;  2RVC A;  4KIG A;  3DU5 A;  4KT5 C;  5TGT A;  2QEX I;  1W7P B;  2HDD A;  1IO2 A;  4U87 A;  3S1R J;  3BY6 A;  3MKZ A;  2HQR A;  2E7X A;  4XK4 A;  4MEY F;  4M6X A;  2FBI A;  5K7H A;  4Y52 J;  1E3H A;  2LBF B;  3ZQL A;  3OYG A;  2KIF A;  2LKS A;  3M9A A;  2ELH A;  1ZKG A;  3HC7 A;  2HKX A;  4A3J J;  2MG4 A;  2ZBK A;  1D1A A;  3P9C A;  1Z9C A;  1PP7 U;  2PN6 A;  2NVX J;  2QKL B;  3CDI A;  4FE7 A;  1MNM C;  1ZAR A;  2W00 A;  4RA2 A;  1LNW A;  1W5S A;  2MGQ A;  4IEJ A;  4E7S A;  3JAM Z;  3QAH A;  4WX9 A;  1Z67 A;  3AKZ A;  2M8E A;  3N4M A;  2UZK A;  2D5V A;  3LST A;  1T8I A;  3U2R A;  4I09 A;  2OZ6 A;  2D2W A;  1FP1 D;  1S3J A;  1AHD P;  2GZW A;  3QPH A;  1Y6I A;  3OV8 A;  2E1O A;  5DD8 A;  4EM1 A;  2A6E F;  1XGS A;  4B1R A;  5D4S A;  3WU0 A;  4KN7 X;  2YR2 A;  1QPI A;  2JQ7 A;  3HIF A;  2XAU A;  4X0G A;  3K4K A;  1ORK A;  1MBG A;  1YIO A;  3BPV A;  5IT9 Z;  3QU3 A;  2UWM A;  3OIQ A;  2BXY A;  4L9J A;  4OIR F;  1W36 C;  2PMU A;  3CUQ B;  4P55 A;  3IRR A;  1MBE A;  3LNQ A;  1GV5 A;  2XPU A;  5LHG A;  5BMZ A;  2E1C A;  1P4W A;  2JMW A;  3FDY A;  3ZOB A;  1IAW A;  4B3A A;  3I4M J;  3IKT A;  4LK1 F;  2CGP A;  1IW7 F;  2G9W A;  3KEO A;  1MJA A;  1Z7L A;  3HGG A;  5H20 A;  4C30 A;  3QRF F;  2ZXH A;  3BTJ A;  3T0Y A;  1Q1V A;  4Z2Y A;  4DOZ A;  3K70 C;  1DU6 A;  1BOA A;  1TC3 C;  2HPI A;  2IJL A;  2WV1 A;  3CTA A;  2HQ5 A;  3GF2 A;  2QGU A;  4FIS A;  3RYR A;  3KEY A;  2JPB A;  1YX3 A;  3O2P E;  2RC4 A;  3HZJ A;  2L3D A;  3QYF A;  3HSF A;  2VQL A;  2ZJP F;  2QKM B;  3C1D A;  3IH3 A;  1MBK A;  1TQM A;  4BE1 A;  1KQ8 A;  1Y8Q B;  4PJM A;  4Y33 A;  3CCQ I;  1TWA J;  1HXD A;  3TO6 A;  2Y30 A;  2COB A;  1QVU A;  3K4B A;  2IVM A;  3BTI A;  2ZB9 A;  3S1Q J;  2Z9O A;  4LFU A;  1U5T A;  1DU0 A;  3RKX A;  3S3M A;  2XF6 A;  4BXU A;  4LG0 B;  2EZL A;  2X1D A;  3J7A Y;  3VYT B;  3TW7 A;  5DUI A;  4KIB A;  2PJP A;  3A03 A;  1E3P A;  2K02 A;  1RC9 A;  3HHG A;  1KU9 A;  3K1N A;  1W7P D;  3IKV A;  3RQI A;  3DEW A;  4YRV A;  2V1X A;  4HV5 A;  1ENH A;  3PSI A;  1YYV A;  2Z99 A;  1FTZ A;  1ETQ A;  2R3S A;  4JBA A;  3PFI A;  4LB6 B;  5ILU A;  4N9H A;  1P4X A;  2E1M C;  1Y1W J;  2BZT A;  1FYK A;  5M5W J;  4B4C A;  4EV0 A;  3OOU A;  1I1S A;  3FKI J;  4JQF A;  1SAN A;  5JVT A;  1JT6 A;  3NAR A;  1G3Y A;  4JK1 X;  5HNH A;  1CGP A;  4AYB A;  1R58 A;  2M1B A;  4A3F J;  4OWR B;  3DV8 A;  1S6L A;  2R7W A;  3H9J A;  4ZYG A;  3HRM A;  2A61 A;  1R4M B;  2ID3 A;  4P5O A;  1JKQ C;  2GXG A;  4M3B A;  3QOP A;  3CCU I;  1E3O C;  3JRE A;  2KT0 A;  1OCO H;  3K0L A;  1Z3X A;  5FLM J;  3TED A;  3E7L A;  1FWZ A;  1K6Y A;  5KAI C;  1ONV A;  2UXN A;  3M07 A;  2HOT A;  3LFU A;  3F8C A;  4HQM A;  4GGG A;  1EH7 A;  2CV0 A;  5BQT A;  3HOS A;  2GIV A;  5ILS A;  2OTJ I;  1IRG A;  5LEJ A;  5GTI C;  2R5Y A;  3ZR8 X;  2ISY A;  3GW2 A;  3FKJ A;  2VJ4 A;  3BQZ A;  2WAD A;  3NRV A;  1JUS A;  3LSJ A;  2PMZ N;  2GOX B;  1TBX A;  3Q0W A;  2NNY A;  3OL3 A;  1GVJ A;  5E1W A;  5FLX K;  3B6A A;  2QEN A;  3KP4 A;  2DA5 A;  2KRF A;  2OPT A;  3FXR A;  1DP3 A;  1ZHF A;  3O8G A;  2DA3 A;  3I3L A;  3BJA A;  2LH9 A;  1ZGJ A;  3H1C A;  3SJM A;  1APL C;  4OOI A;  3I59 B;  3CCE I;  4EAT A;  1IDZ A;  3OR1 C;  1Z6R A;  3DQV C;  4IHT A;  3B6C A;  2I8D A;  5B3S H;  2CS3 A;  2Q2E B;  2L01 A;  1ETX A;  2ZSH B;  2ZXI A;  2X48 A;  2XKP A;  1I5Z A;  5FRN A;  2JTV A;  3LA3 A;  2A69 F;  1TW3 A;  5AON A;  2B63 J;  2DQR A;  3Q0U A;  2AXT C;  3U1D A;  1WQ2 A;  1QZY A;  2L7K A;  4DZJ A;  4JOM A;  1MMG A;  5J4V A;  4CCM A;  4ENJ A;  1NK3 P;  2CYY A;  3FXL A;  3VEP A;  3J81 Z;  4IVN A;  3VOD A;  1H9T A;  2QCO A;  3PO3 J;  1U5T C;  2QF7 A;  5KHD A;  4P1W A;  3L2W A;  2QQ9 A;  1FMW A;  4HYE A;  1OCC H;  1S8N A;  2LBF A;  2LNB A;  5F64 A;  5FKK A;  2V4J C;  1CQT A;  4RBO A;  1JTY A;  4II3 A;  2XDV A;  1Z77 A;  4XRS A;  2HPM A;  4OU0 A;  2PLY A;  4C2U A;  2K9S A;  3PNV A;  2W48 A;  3KYD B;  2DQL A;  2X1C A;  2ME0 A;  2X85 A;  1UST A;  2KMU A;  2BE5 F;  4R79 A;  4O6J A;  3VDX A;  4XMY A;  4I99 C;  1J75 A;  3BWG A;  1IJW C;  3UKG A;  2NAZ A;  1BIA A;  1SC7 A;  2TDX A;  2FRH A;  4MHG A;  1DP7 P;  2IA1 A;  1ETV A;  3E6B A;  1DDN A;  4G9Y A;  4DW6 A;  2KZV A;  5EDN A;  4L0Z B;  2ZC2 A;  2XRL A;  4B09 A;  1YS6 A;  3LL7 A;  4RM3 A;  4E4H A;  4B47 A;  2CWE A;  2HS5 A;  3MD2 A;  2RGV A;  1MJB A;  4RGS A;  2EV6 A;  3OL4 A;  2OUM A;  4XOP A;  2O8K A;  1X19 A;  2OAZ A;  1HSJ A;  2A07 F;  3KP7 A;  2J5P A;  4V19 K;  3K7A J;  3KP2 A;  2OQG A;  3F8M A;  2R0Q C;  4PSW A;  4TV7 A;  2CV2 A;  2BY3 A;  2O8X A;  3K1P A;  2H1L A;  2R5Z A;  1A36 A;  2F6C A;  2R7S A;  3MWM A;  3M1C A;  4A93 J;  2E5Z A;  1D0Z A;  2OCE A;  4CGZ A;  1TTY A;  3HL2 A;  4FCY A;  1I27 A;  4KMU X;  1A6I A;  3OYB A;  1AKH A;  2NNN A;  1L3L A;  1UEL B;  2ID6 A;  1IV8 A;  1RR8 C;  4XM3 A;  1A31 A;  4PZJ A;  2DK8 A;  1JJ8 C;  2M7A A;  1YW7 A;  4XKB A;  4Y13 A;  1FOW A;  2EIK H;  4FAS D;  2IT0 A;  2WB1 A;  1XDS A;  2VT2 A;  4QIW N;  2EV5 A;  3TL4 X;  5HOD A;  3KZY A;  2DMU A;  1VFC A;  1O57 A;  2NOG A;  2H8R A;  1MH4 A;  4M3E A;  1UHM A;  2V1N A;  1R71 A;  3LAP A;  2PFB A;  2DTZ A;  2EIN H;  1KU7 A;  1VQ9 I;  1SFE A;  1QGP A;  3MFK A;  3C7J A;  2DJI A;  4MIM A;  1XMA A;  1O4X A;  3SHF A;  4DBR A;  1LB2 A;  2IS4 A;  5CJ9 A;  1DPR A;  3P9I A;  3E6D A;  3J7Z I;  3FIS A;  1UHW A;  3JRD A;  2DOF A;  2AXL A;  4KA4 A;  1AU7 A;  4HF0 A;  3BG5 A;  2E34 A;  4BEH A;  3DEU A;  4AUX A;  2Z3Y A;  1ZRC A;  1IN4 A;  5HLH A;  3IH2 A;  4QLC U;  2BV6 A;  1Y8R B;  2A5Y B;  3CJT B;  2EIL H;  2OU2 A;  3J7A O;  2DW4 A;  4K2E A;  5TIS C;  1AOY A;  2LY9 A;  3WGH A;  1SMT A;  5ICE A;  4IO9 F;  1OIS A;  2VBW A;  1IXS B;  2M3A A;  5FJ8 J;  4A3K J;  5E1Z B;  1B72 B;  1V5E A;  1BI0 A;  3PUB A;  5KK1 A;  1YS7 A;  3AAF A;  4XKW A;  5HS7 A;  2LC2 A;  4DYQ A;  4KT6 A;  5A2Q Z;  2VON A;  2OZU A;  3A0B C;  3L2V A;  1SFO J;  2HKO A;  1K61 A;  3CJR B;  1K79 A;  4D5F A;  4CZC A;  2BVM A;  3JRH A;  2P6T A;  2L02 A;  3NEU A;  3X2Q H;  1KYW A;  1WHU A;  3M3Y J;  2VQC A;  5HDG A;  4X6A J;  3MQ0 A;  1EA3 A;  2DT5 A;  4NUB A;  2K4J A;  2EIJ H;  5CLS A;  2JSP A;  2MD5 A;  4BL0 B;  3FXU A;  2EFQ A;  4AVP A;  2L9V A;  2LF8 A;  2MC3 A;  4I6Z A;  2RNG A;  3BR3 A;  1MD0 A;  2VC1 A;  4M74 A;  3IAM 2;  1GV2 A;  1SVO A;  4AVZ A;  2O5R A;  3K4N A;  5J1Y A;  3HPG A;  2MW8 A;  1KQ9 A;  4ZZD A;  4G6Q A;  1T2K A;  1P4A A;  2DFE A;  2E7W A;  2J5O A;  3KZI C;  2E36 A;  3D5R C;  1TNT A;  3SEZ A;  4A6D A;  4ETS A;  4UUS B;  4HX7 A;  1OCZ H;  1ZLJ A;  3ZRG A;  3L2C A;  4NC6 A;  2XVC A;  3FX3 A;  3MKY B;  3DTK A;  1WH7 A;  5BS6 A;  1CF7 B;  1P9Q C;  2RKH A;  1SEU A;  2EJR A;  4R8H A;  3O3K A;  4XLF A;  3L2R A;  1FTT A;  3RKY A;  1O3T A;  2QSF X;  5E8I A;  2O9L A;  1Y39 A;  3QU6 A;  3Q9S A;  4UVB A;  1U6G A;  2CQX A;  4G7O F;  1FIP A;  3K4L A;  4M72 A;  1R9T J;  3R4K A;  4IXA A;  5HVQ C;  4NHJ A;  1T08 B;  4MLO A;  3IUO A;  4XL9 A;  5EEG A;  3HRU A;  2Q0O A;  4Y15 A;  5F6F A;  3R61 A;  1JI8 A;  2MH2 A;  3TQN A;  1MW7 A;  3AL0 B;  3D0S A;  1EH8 A;  3ZN1 A;  1HA8 A;  1VQM I;  1HDP A;  2GOM A;  2JRT A;  2O0Y A;  3ZMT A;  2Q1Z B;  4ESF A;  1IN6 A;  2BW3 B;  3KEQ A;  1F43 A;  2EQR A;  1MGT A;  2B0L A;  2CU7 A;  5C3E J;  1A35 A;  3F8N A;  3IH4 A;  1RR7 A;  2FQ3 A;  3GLX A;  4EJO A;  2H6B A;  2RNJ A;  3BZC A;  4G7Z F;  3ZQG A;  1VQ7 I;  3CJQ B;  2G0E A;  2JVG A;  2R7V A;  2LLK A;  5DYM A;  5H6Q A;  1XD7 A;  2KQR A;  4A12 A;  5K5R A;  2OD5 A;  1YO5 C;  2EFO A;  1DUX C;  1ON2 A;  2HZD A;  4E7K A;  3OWT A;  4LMY A;  5K7Z A;  2YX7 A;  1D8J A;  5JR3 A;  2LF7 A;  3GVA A;  2A05 A;  1ZG5 A;  4EEF G;  1OFC X;  3N97 A;  1RZ4 A;  1W36 D;  4UHT A;  1S9H A;  3C2B A;  3TW6 A;  3TDU C;  3WHC A;  3ZN0 A;  3BRO A;  3KP6 A;  2HXI A;  1V4R A;  4L5J A;  3A2K A;  3BTL A;  3RYP A;  3U9G A;  2XGX A;  3FF5 A;  2K86 A;  2DA1 A;  3HOW J;  1LEB A;  3LWF A;  4R1H A;  2DFH A;  2VAS A;  2Y9Y A;  1YRN A;  2HI3 A;  1S5L C;  4ZC3 A;  1QHH D;  3K70 D;  5JVG F;  4YIF A;  2LSO A;  3I4P A;  3EDP A;  1Z05 A;  4UVC A;  4B44 A;  3GZN B;  4DZP A;  4OIO F;  4OMY A;  1SVL A;  3D1N I;  1WPK A;  2R4G A;  3GEZ A;  4L0Y B;  3E5Q A;  2QUF A;  4HLX A;  1OCP A;  1FC3 A;  3I9V 2;  3ZQ7 A;  3EUH A;  1WJF A;  1ACI A;  2NS8 A;  1Z0X A;  2DAO A;  4OIQ F;  4D5C A;  3TDZ C;  1YLF A;  1TQP A;  3F6V A;  2WY8 Q;  2ECC A;  2M4G A;  2XC7 A;  1J0R A;  3I71 A;  3GX4 X;  3E1S A;  2L4M A;  1LEA A;  3HKZ N;  1D3Y A;  4UV9 A;  1QZE A;  2ELJ A;  2L9S A;  1FYL A;  2OBP A;  2WC2 A;  3HPH A;  2IA0 A;  2PEX A;  3GME A;  4LIV A;  4P9U A;  2CMP A;  3OSG A;  2V26 A;  4ZTF A;  1SD6 A;  4GYI A;  2WAQ N;  2MLK A;  4XNF A;  4IPA A;  1KZH A;  2O61 A;  4KN4 X;  4A5M A;  4D9J A;  3H5N A;  4ON0 A;  4PK4 A;  2PG4 A;  4A3M J;  4BBS J;  5F1J A;  1BA5 A;  4DBQ A;  1I6H J;  4XRS G;  1TT5 B;  3CLO A;  5LBQ A;  1ETW A;  3OSF A;  3BPX A;  4W97 A;  3OS0 A;  4A3B J;  1Q1H A;  1QO0 D;  3A02 A;  3K4M A;  5EG0 B;  1FNN A;  3S3N A;  3GTL J;  4UUT A;  1XS9 A;  3HOY J;  4WXD A;  1D5V A;  2ADU A;  2VOD A;  1G3W A;  4RLF A;  2EZH A;  5HLT A;  1IDY A;  3MEX A;  1PP8 F;  1QHG A;  4PGH A;  4BQO A;  3EUA A;  4M71 A;  4H0E A;  3KET A;  3MMY B;  3ZPL A;  1T0F A;  3GFM A;  2DT6 A;  2F5C A;  2K3F A;  4CUG A;  3RPU D;  2WV0 A;  5H2F C;  1UZC A;  1LFP A;  1EKE A;  2Y0M A;  3OS2 A;  4HDU A;  1VQP I;  1FOX A;  3H5A A;  4ABZ A;  2NYX A;  4IHS A;  3TO7 A;  1R5H A;  1N75 A;  1YG2 A;  1BR4 A;  1X58 A;  1SFK A;  4PJL A;  1JGG A;  2G7H A;  3ZMU A;  1TQI A;  3VFZ A;  2CUZ A;  1BM9 A;  1E0E A;  1K78 A;  4JX5 A;  2W82 A;  3ZQF A;  3L1P A;  1G2H A;  1I1G A;  1A04 A;  3EYY A;  1OYY A;  5E3N A;  1TNS A;  3JR9 A;  5BNG A;  1OQY A;  5TJJ A;  3IC7 A;  1YFH A;  5CQE A;  4JX4 A;  1FBS A;  1X3U A;  4IJA A;  2DMQ A;  1ETO A;  2BXZ A;  3EYI A;  2X4H A;  2XPV A;  2UXX A;  4B3X A;  2M87 A;  5J8F A;  1JKR C;  3CUO A;  3OYD A;  4E7L A;  1XSD A;  5FO5 A;  1FOK A;  3V8K A;  2XF7 A;  4UUS A;  3EUH C;  4BE0 A;  4BS9 A;  1RET A;  2GA1 A;  2CFX A;  3GCM A;  3BTC A;  3KP3 A;  2VJ5 A;  3DBH B;  4L9V A;  4RAG A;  2L7M P;  3GTJ J;  1DQU A;  3BZ6 A;  3MN2 A;  3TP3 A;  1YJ9 I;  2IA2 A;  2R92 J;  4LLN A;  1Y0U A;  1FOY A;  4BXX J;  1J2X A;  3IL2 A;  4D0P A;  2KPM A;  3RKW A;  4YFK F;  1XSV A;  3QQA A;  4LIT A;  3PUF A;  2AS5 F;  2HTS A;  3M8F A;  2X6W A;  2FUG 2;  4XSX F;  4BHC A;  5L3C A;  1LE8 B;  3CP2 A;  2E60 A;  3SZT A;  1D0X A;  3B02 A;  3E5X A;  2LG4 A;  1X3Z B;  2X6Y A;  4RAY A;  4MEX F;  1HST A;  3KLN A;  3HGY A;  3KCC A;  2F5F A;  5FD6 A;  2DMP A;  3V7S A;  9ANT A;  2BW3 A;  1IN5 A;  3GWZ A;  2JPC A;  4XOT A;  4CXF A;  4HDV A;  1TP4 A;  2QQB A;  2DFI A;  5K7F A;  3HHH A;  3HM5 A;  2Z5U A;  2XGC A;  3WE2 A;  2BYV E;  4RGR A;  4CCL A;  5EEH A;  2AQF A;  2JA2 A;  1RES A;  2L0K A;  4XN3 A;  3DBR B;  1VQO I;  3G2B A;  5IY5 H;  2VQH A;  3BG9 A;  1T0F C;  3HUG A;  1WJA A;  4QTR A;  5GTH C;  3NAU A;  3T1B A;  3WTV C;  3ML6 A;  2JA6 J;  2A68 F;  1LDJ A;  2KRC A;  5EYR A;  2QBY B;  5DS9 A;  3H0D A;  2KIS A;  2VJJ A;  5DV5 A;  3P5J A;  3VOE A;  4A6E A;  3FHZ A;  3JRF A;  4PJJ A;  1B9M A;  1V5G A;  4U88 A;  1FX7 A;  4ENK A;  3QPS A;  4U7D A;  4I0A A;  2DFF A;  3EUK L;  4W1U A;  4F7Z A;  1Z7U A;  1RPW A;  1JT0 A;  2DOD A;  1RRJ A;  1MJ9 A;  5LHH A;  1W1W E;  1XB4 A;  2F5D A;  2GM4 A;  3MZH A;  2ZNY A; 
#chains in the Genus database with same CATH homology
 1R5G A;  2ZME A;  2GWR A;  1LVA A;  5CYV A;  2YU3 A;  2VT3 A;  5TRD A;  4EGZ A;  2ZNZ A;  2M5W A;  2FU4 A;  1WI9 A;  4Y17 A;  4CIC A;  5CVJ A;  4KIC A;  4UUV A;  3EET A;  1O7L A;  3HTU A;  3WE3 A;  1GXP A;  4MQV A;  1JGS A;  2KIM A;  2VXZ A;  2ESN A;  5D6F A;  2VN2 A;  4HLY A;  2V79 A;  5E17 F;  3GZ5 A;  1ZAO A;  4RAZ A;  2RDP A;  1ZG1 A;  3P7N A;  1W5T A;  2HDC A;  3ZMD A;  3LQR A;  1HBX G;  2CO5 A;  3LA2 A;  4HBL A;  5ERI A;  1KGS A;  1Z91 A;  4ESJ A;  3HSE A;  4BH9 A;  2KKO A;  3E6C C;  2PBI A;  1SMY F;  1R1U A;  5H6R A;  3FWE A;  1YQA A;  2OA4 A;  1HKQ A;  2XUB A;  3ZP5 A;  4NQW A;  3L09 A;  1J9I A;  1R1V A;  4CDG A;  1GXQ A;  1F9N A;  4L9N A;  1G3T A;  1OYW A;  2GA2 A;  5E18 F;  2O3F A;  3PQK A;  4HX8 A;  2ZFW A;  1WRJ A;  3V8J A;  3RJP A;  3D5L A;  5FFX A;  1P92 A;  1W7P A;  3DPL C;  2V1D A;  3LAJ A;  1F5T A;  4L9T A;  3RTR A;  2WWY A;  2FA5 A;  4CHU A;  2P8T A;  5ICG A;  1ZYR F;  3I54 A;  1KA8 A;  4ASN A;  3KFW X;  4U7B A;  3F8B A;  2HOE A;  2L54 A;  3T8T A;  4BNC A;  3P9K A;  5HS8 A;  2LKP A;  2VBZ A;  2KJC A;  2LDU A;  1O3S A;  1IXR C;  4BAY A;  2K4B A;  2K7L A;  1SFU A;  4GCV A;  2QYO A;  3CUQ A;  3BOQ A;  1J5Y A;  4I01 A;  2JT1 A;  5E20 A;  1MKM A;  4RGX A;  2FE3 A;  4Q48 A;  4EVI A;  2V1U A;  1UFM A;  1R22 A;  4HX4 A;  3CO7 C;  1XSX A;  3R0J A;  1TW2 A;  5LRS A;  1H9G A;  1BI3 A;  3HSR A;  4CYD A;  3DXJ F;  1O3R A;  3HRS A;  3PQJ A;  2O6G E;  3V7R A;  1KU3 A;  1YW8 A;  4G7H F;  1FBQ A;  1WSU A;  1T98 A;  4LG0 A;  4KUM A;  5DD4 A;  3WGI A;  2HYF A;  1MZB A;  2QLZ A;  2W57 A;  5FB2 A;  2MBF A;  5DDG A;  1S7O A;  4FX0 A;  5D5W B;  1BJA A;  4MQ9 F;  2PMH A;  2RN7 A;  2OQR A;  3KZZ A;  4PGG A;  3TOB A;  2GQQ A;  2XRO A;  1T38 A;  2EB7 A;  1H0M A;  3K1M A;  5DCM B;  1U3E M;  2Z33 A;  1R36 A;  4LD5 A;  3ERE D;  2Y48 A;  2PQ8 A;  2FBK A;  2ETH A;  3HOT A;  1PUE E;  3JAM K;  1XGN A;  4OIN F;  3WG9 A;  3M8E A;  2EK5 A;  1R00 A;  1Z6T A;  2EA2 A;  1JHF A;  3RPQ A;  3CUQ C;  4RGU A;  3SZP A;  3LA7 A;  3L00 A;  3M7G A;  1WWX A;  5IT9 K;  1MDM B;  4YII A;  3I0T A;  3CJN A;  4CO8 A;  4WF2 A;  4HF1 A;  1FPQ A;  3I59 A;  3IWZ A;  2VOP A;  2Q2E A;  3FM5 A;  1FY7 A;  1ON1 A;  2W84 A;  5HLI A;  3CDH A;  4EJT A;  1BBY A;  2KIU A;  5D5X B;  1T6S A;  2HZT A;  4P9F A;  4EJV A;  4IRG A;  1HKS A;  4HW0 A;  3K2Z A;  4GO1 A;  3FXQ A;  3WTZ A;  4I0B A;  2RV8 A;  3REO A;  4YFN F;  4WXH A;  1YW9 A;  2FML A;  2EFW A;  1OKR A;  2MA3 A;  2EFN A;  4LB5 A;  2CSO A;  1B59 A;  5KVR A;  3I5U A;  5E8G A;  1QZZ A;  3WTX C;  2P7V B;  1KYZ A;  1OPC A;  5FLX Z;  2H27 A;  3RDI A;  1EH6 A;  3JSO A;  3WU1 B;  4KDP A;  3S2W A;  2DK5 A;  4FX4 A;  2H09 A;  1PDN C;  4Q5S F;  3SQN A;  2VE8 A;  1K6O A;  1RI7 A;  3K69 A;  3W6J B;  1FP2 A;  4MNU A;  5CVU A;  3TOA A;  2M45 A;  1IN8 A;  3FMR A;  1NHA A;  4HAM A;  5BPI A;  3MZY A;  5DUK A;  5E1X A;  5IT3 A;  3Q5F A;  1FSH A;  5HLG A;  1U2W A;  3WGG A;  5LRR A;  1U5T B;  1O7F A;  5J8C A;  1HKT A;  1F4K A;  3SFZ A;  3RIR A;  4NB5 A;  4U0V A;  5BPD A;  4L18 B;  1B9N A;  3GFI A;  5L3G A;  4M9S A;  4MTD A;  1O3Q A;  3J80 K;  3WTT C;  4GYG A;  1RNL A;  2DTR A;  3J81 K;  4WK8 F;  1G6N A;  1OMI A;  4XBF A;  1YTY A;  1LJ9 A;  4HV6 A;  5ED4 A;  2XAF A;  3MAJ A;  4ESB A;  3JTH A;  1USS A;  1FBU A;  5LGU A;  1WKM A;  3JTG A;  2P7C B;  3IWF A;  3H3Z A;  2ZCW A;  3I64 A;  2EA4 A;  2G7U A;  4EJW A;  3E3V A;  2P5K A;  5LHI A;  1KU2 A;  2MLG A;  2XAQ A;  4A5N A;  2ZXJ A;  2IW5 A;  2FMY A;  1CF7 A;  4UV8 A;  2W24 A;  1LDD A;  3F22 A;  4ZZL A;  2P5V A;  2W85 A;  4AIH A;  1QNT A;  1HW2 A;  2FEZ A;  1J59 A;  1BI2 A;  4UNO A;  1UCR A;  2F5E A;  4A0Z A;  4U0W A;  1XGM A;  1FT9 A;  1SAX A;  5ILV A;  2Y75 A;  4Q47 A;  5JHU A;  4BYY A;  4RB3 C;  1IRF A;  2F2E A;  4LGW A;  1G3S A;  2V6C A;  2HFH A;  3JW4 A;  2D45 A;  2A3S A;  3RPU A;  4KFC A;  1QPM A;  2WTE A;  2PI0 A;  4RB0 A;  4ZH4 F;  1C0W A;  5JFR A;  1ZRD A;  3R60 A;  2DI3 A;  5ICC A;  2BBY A;  2R7D A;  4RS8 A;  5D8K B;  5FD5 A;  4M9X A;  1E17 A;  5K1Y A;  5K5O A;  4MGR A;  4WWC A;  1L0O C;  5ICF A;  3GO5 A;  1FLI A;  4ENM A;  4UXN A;  4LLG F;  3R0A A;  2MH9 A;  5A2Q K;  2HWV A;  3GFL A;  1R7J A;  4XLP F;  1XMK A;  1BIB A;  2YX4 A;  1ZRF A;  2HQN A;  2FF4 A;  4ENN A;  5L3B A;  3EQL F;  3GZ6 A;  4LLL A;  2STT A;  1ULY A;  2P4W A;  1XCB A;  2XKO A;  4HF2 A;  4XLN F;  4XRF A;  1Z1D A;  3F6O A;  1ZLK A;  1E2X A;  2VC0 A;  2IP2 A;  1HW1 A;  5D4R A;  1FYM A;  3I53 A;  4HA8 A;  5FFZ A;  5DEQ A;  3O6B B;  4KNY A;  4N0B A;  4MTE A;  3ZMZ A;  3WTY C;  1OR7 A;  4U0Y A;  4G8X A;  4WXC A;  3VB2 A;  3FMS A;  5HDN A;  4EM0 B;  1U78 A;  2P5L C;  4FT8 A;  2NRA C;  2FNA A;  3T5X A;  4M73 A;  1ZRE A;  5L3E A;  4O3M A;  2FOK A;  5J6X A;  5DCF A;  1GHC A;  6PAX A;  1FZP B;  2XAG A;  3F21 A;  1STZ A;  2W25 A;  4UVA A;  3OOP A;  5CVI A;  5D5U B;  1XCV A;  5F1R A;  3ABT A;  4HQE A;  2XRN A;  2IRF G;  3KLO A;  1HQC A;  3DPT A;  3E97 A;  3I58 A;  2HTJ A;  2STW A;  1SD4 A;  3F8F A;  2FSW A;  1V3F A;  3H3U A;  1SD7 A;  4G94 A;  2DLL A;  4EQQ A;  2CQK A;  2RQP A;  2XHK A;  5BOX A;  2QVO A;  1IN7 A;  3J80 Z;  2BGC A;  2EFP A;  3K9T A;  3F72 A;  1D8K A;  3WTW C;  4EMS A;  5LGT A;  1ZH5 A;  5L3F A;  4QWQ A;  4RB2 C;  1RUO A;  1UB9 A;  1R1T A;  2X0L A;  1QBJ A;  2BEO A;  2COM A;  1BC7 C;  2XV4 S;  4BQA A;  3C3W A;  3GXO A;  1DPU A;  1REP C;  4LK0 F;  5D8L B;  4A2U A;  1P2F A;  1J7K A;  2YPR A;  1W4M A;  4A0X A;  2M30 A;  3ECH A;  4KIF A;  3M1E A;  2DPD A;  3KP5 A;  4RB1 A;  1BN5 A;  1R23 A;  1IZ1 A;  2QQA A;  3FM3 A;  2GXB A;  4AIK A;  4S05 A;  3DKW A;  4I02 A;  2QBY A;  3TGN A;  3DP7 A;  4LJZ F;  3W6K B;  1K7A A;  5HOO A;  1G4D A;  2L4A A;  4EJU A;  3G3Z A;  4KYW A;  4ZYE A;  3WTS C;  3V4G A;  3IHU A;  3HYI A;  2Q8K A;  1KQ0 A;  2XAH A;  2XAJ A;  2XIG A;  1VTN C;  3B73 A;  1ZN2 A;  4HOB A;  4ZYH A;  3ISP A;  1LDK B;  1TLH B;  3E6M A;  3L7W A;  1SFX A;  4KMF A;  2E1N A;  5CVV A;  3FZV A;  1IUY A;  2DU9 A;  1SD5 A;  4AWX B;  1IXC A;  1BC8 C;  1AWC A;  1T39 A;  2VBX A;  4FHT A;  3GUD A;  3T8R A;  1JE8 A;  2JZY A;  3C18 A;  3H92 A;  3QP5 A;  1RIO H;  3RI4 A;  1B4A A;  2KJB A;  2D1H A;  1S7A A;  2H94 A;  1HW5 A;  1I6X A;  4I2O A;  2ZJ2 A;  2VE9 A;  2K27 A;  1B6A A;  4AIJ A;  2ISZ A;  1ZG3 A;  3COA C;  3BDD A;  2D1V A;  1K78 B;  4Q4Z F;  3BJ6 A;  4EGY A;  4N9I A;  2EV0 A;  2QM3 A;  2ZKZ A;  2R7F A;  3L9F A;  5L3D A;  2DO7 A;  4CZZ A;  5LEK A;  4O5V A;  4BHP A;  3DFG A;  2VOO A;  3WTU C;  3HTS B;  2XAS A;  2H6C A;  1B1B A;  2DBB A;  4PCQ A;  3F23 A;  2O03 A;  4G7O F;  1XGO A;  4DQ2 A;  2ESH A;  3LFK A;  3LQQ A;  3FMQ A;  5AIQ A;  4I7H A;  1BI1 A;  2VBY A;  3NQO A;  3ECO A;  4L5I A;  1F1Z A;  3ROU A;  5AIP A;  4IF4 A;  1ODD A;  4AD9 A;  3R6S A;  3KE2 A;  1XN7 A;  4YG2 F;  3CO6 C;  3V7C A;  1ZGA A;  2C6Y A;  2ZO4 A;  4I98 B;  4OMZ A;  4WCG A;  3JSP A;  1IF1 A;  4M9Z A;  4PDK A;  3HRT A;  3V8L A;  1JHH A;  2V9V A;  3DF8 A;  4DNC A;  3MCZ A;  4YFX F;  4E70 A;  3ELK A;  3F3X A;  4S04 A;  5JI6 A;  4IRI A;  1P6R A;  2CG4 A;  4BHB A;  5K5Q A;  3IRQ A;  3TKY A;  4EM2 A;  4B8X A;  1LQ1 A;  1XDU A;  2ZME B;  3ABU A;  4OIP F;  2HGC A;  2NS0 A;  2JSC A;  4G6D A;  2P6S A;  3QPT A;  3GYH X;  5D6E A;  2HYG D;  2QZ8 A;  1RUN A;  5CVR A;  1OYI A;  1FSE A;  3E5U A;  3BJO A;  4ZYD A;  4HZF A;  3BP8 A;  2FBH A;  3Q9V A;  5HS9 A;  3QP6 A;  3WOD F;  2HR3 A;  2IPQ X;  5D5V B;  2YSR A;  4P96 A;  3GFJ A;  4IRH A;  5DCM A;  2HEO A;  2ACJ A;  3ULQ B;  5FGM A;  2A6H F;  2CW0 F;  5LLQ A;  3ZMS A;  1JXS A;  3ZMV A;  2GAU A;  5LGN A;  2FNP A;  3SXY A;  1EV7 A;  2QWW A;  4XSZ F;  4GXO A;  2DPU A;  4M6Y A;  5HDK A;  1U8R A;  3TO9 A;  2EWN A;  1QQI A;  3G73 A;  4A0Y A;  2FXA A;  1S29 A;  1MDM A;  2RVC A;  4KIG A;  4KT5 C;  1W7P B;  3BY6 A;  2HQR A;  2E7X A;  4MEY F;  4M6X A;  2FBI A;  2KIF A;  3M9A A;  2ELH A;  2HKX A;  2ZBK A;  3P9C A;  1Z9C A;  1PP7 U;  2PN6 A;  1ZAR A;  1LNW A;  1W5S A;  3JAM Z;  3QAH A;  4WX9 A;  3N4M A;  2M8E A;  2UZK A;  3LST A;  3U2R A;  4I09 A;  2OZ6 A;  2D2W A;  1FP1 D;  1S3J A;  2GZW A;  4EM1 A;  3QPH A;  3OV8 A;  5DD8 A;  2A6E F;  1XGS A;  5D4S A;  3WU0 A;  4KN7 X;  2YR2 A;  3HIF A;  1YIO A;  3BPV A;  5IT9 Z;  3QU3 A;  2UWM A;  4L9J A;  4OIR F;  2PMU A;  3CUQ B;  4P55 A;  3IRR A;  5LHG A;  5BMZ A;  2E1C A;  1P4W A;  1IAW A;  3IKT A;  4LK1 F;  2CGP A;  1IW7 F;  2G9W A;  3KEO A;  1MJA A;  5H20 A;  3QRF F;  3T0Y A;  4Z2Y A;  1BOA A;  2IJL A;  3CTA A;  3GF2 A;  3RYR A;  2JPB A;  3O2P E;  2RC4 A;  2L3D A;  3HSF A;  3C1D A;  1TQM A;  1KQ8 A;  1HXD A;  3TO6 A;  2IVM A;  2Z9O A;  4LFU A;  1U5T A;  3RKX A;  4BXU A;  4LG0 B;  5DUI A;  2PJP A;  4KIB A;  2K02 A;  3HHG A;  1KU9 A;  3K1N A;  1W7P D;  3IKV A;  2V1X A;  4HV5 A;  1YYV A;  2Z99 A;  2R3S A;  4JBA A;  4LB6 B;  3PFI A;  5ILU A;  4N9H A;  1P4X A;  1FYK A;  1I1S A;  4EV0 A;  4JQF A;  5JVT A;  1G3Y A;  4JK1 X;  1CGP A;  1R58 A;  2M1B A;  3DV8 A;  1S6L A;  4ZYG A;  3HRM A;  2A61 A;  4P5O A;  2GXG A;  3QOP A;  3K0L A;  1FWZ A;  1ONV A;  2UXN A;  3F8C A;  4HQM A;  4GGG A;  1EH7 A;  5BQT A;  3HOS A;  2GIV A;  5ILS A;  1IRG A;  5LEJ A;  2ISY A;  3GW2 A;  3NRV A;  1TBX A;  2NNY A;  1GVJ A;  5E1W A;  5FLX K;  2QEN A;  3KP4 A;  2KRF A;  3FXR A;  1ZHF A;  3BJA A;  1ZGJ A;  4OOI A;  3I59 B;  1Z6R A;  3DQV C;  4IHT A;  2L01 A;  2XKP A;  1I5Z A;  2JTV A;  3LA3 A;  2A69 F;  1TW3 A;  5AON A;  2DQR A;  3U1D A;  1WQ2 A;  1QZY A;  4ENJ A;  2CYY A;  3VEP A;  3J81 Z;  4IVN A;  3VOD A;  1H9T A;  1U5T C;  2QQ9 A;  4HYE A;  1S8N A;  2LNB A;  5F64 A;  4OU0 A;  2PLY A;  2DQL A;  1UST A;  4R79 A;  2BE5 F;  4O6J A;  1J75 A;  3BWG A;  2NAZ A;  1BIA A;  2TDX A;  2FRH A;  4MHG A;  1DP7 P;  2IA1 A;  3E6B A;  1DDN A;  4G9Y A;  4L0Z B;  4B09 A;  1YS6 A;  2CWE A;  2HS5 A;  2RGV A;  1MJB A;  4RGS A;  2EV6 A;  2OAZ A;  1HSJ A;  2A07 F;  3KP7 A;  2J5P A;  3KP2 A;  2OQG A;  3F8M A;  4TV7 A;  2O8X A;  3K1P A;  3MWM A;  4CGZ A;  1TTY A;  1I27 A;  4KMU X;  2NNN A;  1L3L A;  4PZJ A;  2DK8 A;  1YW7 A;  4Y13 A;  2IT0 A;  1XDS A;  2VT2 A;  2EV5 A;  3KZY A;  1O57 A;  1UHM A;  3LAP A;  2PFB A;  1KU7 A;  1SFE A;  1QGP A;  3MFK A;  3C7J A;  1XMA A;  3SHF A;  1LB2 A;  5CJ9 A;  1DPR A;  3P9I A;  3E6D A;  1UHW A;  2AXL A;  4KA4 A;  4HF0 A;  3DEU A;  2Z3Y A;  1ZRC A;  1IN4 A;  5HLH A;  4QLC U;  2BV6 A;  2A5Y B;  2OU2 A;  3J7A O;  2DW4 A;  4K2E A;  1AOY A;  3WGH A;  1SMT A;  5ICE A;  2VBW A;  1IXS B;  5E1Z B;  1BI0 A;  5KK1 A;  1YS7 A;  3AAF A;  5HS7 A;  5A2Q Z;  2VON A;  2OZU A;  2HKO A;  1K79 A;  2P6T A;  2L02 A;  3NEU A;  1KYW A;  5HDG A;  3MQ0 A;  2DT5 A;  2K4J A;  5CLS A;  2MD5 A;  3FXU A;  2EFQ A;  4AVP A;  2LF8 A;  2MC3 A;  1MD0 A;  2VC1 A;  4M74 A;  1KQ9 A;  4ZZD A;  4G6Q A;  1T2K A;  1P4A A;  2E7W A;  2J5O A;  4ETS A;  1TNT A;  4A6D A;  4HX7 A;  1ZLJ A;  3L2C A;  2XVC A;  3FX3 A;  5BS6 A;  1CF7 B;  2RKH A;  2EJR A;  4R8H A;  3O3K A;  3RKY A;  1O3T A;  5E8I A;  3QU6 A;  3Q9S A;  4UVB A;  1U6G A;  4M72 A;  3R4K A;  4IXA A;  5HVQ C;  4NHJ A;  5EEG A;  3HRU A;  2Q0O A;  4Y15 A;  5F6F A;  3R61 A;  2MH2 A;  3TQN A;  3D0S A;  1EH8 A;  3ZN1 A;  2JRT A;  2O0Y A;  3ZMT A;  4ESF A;  1IN6 A;  3KEQ A;  1MGT A;  2B0L A;  3F8N A;  3GLX A;  2FQ3 A;  4EJO A;  2H6B A;  2RNJ A;  4G7Z F;  5DYM A;  5H6Q A;  1XD7 A;  4A12 A;  5K5R A;  2OD5 A;  1YO5 C;  2EFO A;  1DUX C;  1ON2 A;  4LMY A;  2YX7 A;  1D8J A;  5JR3 A;  2LF7 A;  3GVA A;  1ZG5 A;  3N97 A;  1RZ4 A;  4UHT A;  3TDU C;  3ZN0 A;  3BRO A;  3KP6 A;  1V4R A;  4L5J A;  3RYP A;  3U9G A;  2XGX A;  3FF5 A;  2K86 A;  1LEB A;  3LWF A;  4R1H A;  4YIF A;  2LSO A;  3I4P A;  3EDP A;  1Z05 A;  4UVC A;  4OIO F;  4OMY A;  3GEZ A;  4L0Y B;  3E5Q A;  2QUF A;  4HLX A;  1FC3 A;  3ZQ7 A;  3EUH A;  2DAO A;  4OIQ F;  3TDZ C;  1YLF A;  1TQP A;  3F6V A;  1J0R A;  3I71 A;  3GX4 X;  2L4M A;  1LEA A;  1D3Y A;  4UV9 A;  1FYL A;  2OBP A;  2WC2 A;  2IA0 A;  2PEX A;  4P9U A;  1SD6 A;  4GYI A;  2MLK A;  4IPA A;  2O61 A;  4KN4 X;  4A5M A;  4ON0 A;  2PG4 A;  3CLO A;  5LBQ A;  3BPX A;  1Q1H A;  1QO0 D;  1FNN A;  4WXD A;  1D5V A;  2ADU A;  2VOD A;  1G3W A;  3MEX A;  1PP8 F;  4PGH A;  4M71 A;  4H0E A;  3KET A;  3ZPL A;  1T0F A;  3GFM A;  2F5C A;  2WV0 A;  2Y0M A;  4HDU A;  2NYX A;  4IHS A;  3TO7 A;  1R5H A;  1YG2 A;  2G7H A;  3ZMU A;  1TQI A;  3VFZ A;  1BM9 A;  1K78 A;  1I1G A;  1A04 A;  3EYY A;  1OYY A;  1TNS A;  5TJJ A;  1YFH A;  3IC7 A;  1FBS A;  1X3U A;  4IJA A;  3EYI A;  2X4H A;  2UXX A;  2M87 A;  5J8F A;  3CUO A;  1XSD A;  5FO5 A;  1FOK A;  3V8K A;  2GA1 A;  2CFX A;  3KP3 A;  4L9V A;  3BZ6 A;  2IA2 A;  4LLN A;  1Y0U A;  1J2X A;  3IL2 A;  4D0P A;  3RKW A;  4YFK F;  1XSV A;  2AS5 F;  2HTS A;  3M8F A;  4BHC A;  4XSX F;  5L3C A;  3SZT A;  3B02 A;  3E5X A;  4RAY A;  4MEX F;  1HST A;  3KLN A;  3KCC A;  2F5F A;  5FD6 A;  3V7S A;  1IN5 A;  3GWZ A;  2JPC A;  4CXF A;  4HDV A;  2QQB A;  2DFI A;  3HHH A;  2Z5U A;  3WE2 A;  2BYV E;  4RGR A;  5EEH A;  3HUG A;  3T1B A;  3WTV C;  3ML6 A;  2A68 F;  1LDJ A;  2QBY B;  5DV5 A;  3VOE A;  4A6E A;  3FHZ A;  1B9M A;  4U88 A;  1FX7 A;  4ENK A;  4U7D A;  4I0A A;  4F7Z A;  1Z7U A;  1MJ9 A;  5LHH A;  1XB4 A;  2F5D A;  3MZH A;  2ZNY A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...