2UZKA

Crystal structure of the human foxo3a-dbd bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORKHEAD BOX PROTEIN O3A
publication title Crystal Structure of the Human Foxo3A-Dbd/DNA Complex Suggests the Effects of Post-Translational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2uzkA01
1CF7B 4Q48A 1SD4A 2O0YA 1QO0D 1D8JA 2DBBA 4M6YA 3ZMUA 4ON0A 1KU9A 1OYWA 2L3DA 4RB2C 2LF8A 5ED4A 1G3TA 3J7AO 4ZZLA 2ZNYA 5E1WA 1D5VA 3F6VA 2HS5A 2M8EA 1KQ0A 4G8XA 1YFHA 3BZ6A 4QWQA 4BHBA 5BPIA 2CQKA 2Z33A 2F5CA 2A68F 1IN7A 1HSTA 2A5YB 3KP2A 2E7XA 3F23A 4ENKA 4QLCU 3I53A 1IN8A 1LDDA 3ZQ7A 1XDUA 2YR2A 3E6BA 4ZYDA 1K78A 4XSXF 1TQMA 3CDHA 3U9GA 5IT9K 2VBYA 2ZJ2A 1GXPA 5LGNA 1FP1D 1VTNC 1BN5A 3CUQB 1JHHA 2IVMA 2D1HA 1IN4A 1IZ1A 4L9VA 3R0JA 3P7NA 4U7DA 1FOKA 1MDMB 1G3SA 5LGUA 1ZGJA 2PN6A 2VOPA 1FLIA 5HLGA 4H0EA 1D8KA 2ISYA 3MCZA 3B02A 1SMYF 3J80K 1EH7A 2W25A 4WXCA 4EJVA 4DNCA 4I09A 3ABUA 4KIBA 3QP6A 1B9MA 2B0LA 2P5KA 1I6XA 3Q9SA 1TTYA 3HUGA 1W7PA 5L3CA 5HDNA 2PJPA 2YU3A 1V4RA 3HIFA 1FYKA 5FO5A 3ZN0A 2XROA 2FU4A 3QPHA 5HLIA 3L2CA 4TV7A 2ZXJA 1R58A 2P7VB 2EV0A 2W24A 1JE8A 3TOBA 2QVOA 3P9IA 2V9VA 3F21A 3E6MA 1F4KA 1LEAA 1Z7UA 2HYGD 2EWNA 3KP4A 2YPRA 1Q1HA 2OD5A 3BY6A 5LHHA 5E1XA 3C1DA 5A2QZ 5D5XB 3PQJA 3VOEA 1DP7P 5D5UB 5HVQC 2STWA 3WTZA 4JQFA 1FPQA 2L54A 2PMUA 2GA1A 5BPDA 4EGYA 4UV8A 1P2FA 1OR7A 2D1VA 2HOEA 4ASNA 4LK0F 3K2ZA 1ZHFA 3T1BA 1TNTA 1HQCA 1ZRCA 2DPUA 2BBYA 4GO1A 2EV6A 3KLOA 3FF5A 2X4HA 3U1DA 5HDKA 3GEZA 2ETHA 4LK1F 4LMYA 4G9YA 3V4GA 1SFXA 2E1CA 2VBXA 4D0PA 2FMYA 5E8GA 3FHZA 4U0VA 1I5ZA 1XSXA 4ENMA 4LG0B 4L9JA 2ISZA 5E1ZB 3EYYA 1ZRDA 3W6KB 5HOOA 1BJAA 1FWZA 2QLZA 4EJTA 5JI6A 5JFRA 4HYEA 3DQVC 2HKXA 1O3RA 5ICFA 5HS9A 2DAOA 5FB2A 2Z99A 3NRVA 3I59B 4B09A 2HKOA 2OZ6A 2GWRA 5CVVA 2VT3A 4IHTA 2Q8KA 4E70A 4CYDA 2DT5A 1LDKB 1YIOA 2JPBA 4R79A 2XAGA 2M45A 4M6XA 2W57A 4P55A 4EJUA 5K5QA 2ZFWA 2HTJA 3TKYA 1YG2A 4BHCA 3TO9A 4HLXA 1I1GA 3MWMA 1KQ9A 1J7KA 1IXRC 1IXCA 1YLFA 1SD6A 1IN5A 1H9TA 3GFJA 3EDPA 4WF2A 4B8XA 2GZWA 3O3KA 1CF7A 3LQQA 5DCMB 4G6QA 3ZN1A 3H3ZA 1HKTA 3FMSA 2XAQA 1XB4A 4EMSA 5DD4A 4NHJA 4UVCA 1S29A 4NB5A 2RGVA 3DPLC 2COMA 4OU0A 5HLHA 2H6CA 1C0WA 5DDGA 3E97A 4S05A 3DEUA 4OIQF 1EH6A 2A61A 1TNSA 2W85A 2JZYA 2FRHA 2M30A 3RDIA 3JW4A 4ZYEA 5FFXA 1F1ZA 5DEQA 1KYZA 4XBFA 2RQPA 3RJPA 4M74A 3LA7A 1U3EM 3QRFF 3IKVA 3REOA 3O2PE 2IA0A 4G7OF 3J81Z 1W5TA 3T8TA 3L00A 1IN6A 3E5XA 2G9WA 1U6GA 1XDSA 3CUQA 4CICA 2DLLA 2FEZA 5FLXK 5LGTA 1RUOA 4UNOA 4WK8F 4IRHA 2ZNZA 3CUQC 1MDMA 4HF0A 4L9TA 3VEPA 1A04A 2R7DA 2V1DA 1B6AA 3M7GA 2PG4A 2HWVA 3LAPA 3QU6A 2W84A 1KU2A 1EH8A 4UVAA 2C6YA 4HA8A 3RTRA 1T38A 3ULQB 2CSOA 4HX4A 3QPTA 3E6CC 4OIOF 5FGMA 4RGXA 1D3YA 1PP8F 1O3QA 4LLNA 1FZPB 4MQ9F 1Z1DA 3DV8A 5IT3A 4CHUA 2QQ9A 1UFMA 5H6QA 3BJOA 2MC3A 3MQ0A 1R5GA 1YW7A 3WU0A 2K86A 4RGUA 4KIFA 2MLGA 4EVIA 1S3JA 4HQMA 3DPTA 3M8EA 2HYFA 1YW8A 3JTHA 1S7OA 2YX7A 1BI2A 2ZO4A 4G6DA 1CGPA 1H9GA 4OIPF 3M1EA 3FMQA 2VC1A 1QNTA 4BH9A 3BP8A 4ENNA 2Z9OA 3V7CA 1B1BA 1SAXA 1XCVA 3QAHA 3VODA 4BHPA 3BWGA 1KQ8A 3IC7A 5FD5A 3FM5A 3I0TA 1FY7A 1X3UA 4MQVA 2XKPA 4F7ZA 1USTA 4PGGA 1HW1A 3KE2A 3CO6C 2QM3A 2F5DA 1FYMA 3I71A 1MGTA 2H27A 2KIFA 3PFIA 5L3EA 4BQAA 1BI3A 3ISPA 3P9CA 2ZMEB 3ZMDA 2NYXA 5LBQA 3WGGA 3MZYA 1BIAA 3RYPA 3WE3A 3JAMZ 1FBUA 4CO8A 1T98A 1W5SA 5J8FA 4HZFA 5E17F 2KRFA 4EM1A 4FX4A 2Q2EA 3ECOA 1XD7A 1ZLJA 1LEBA 3MZHA 3R4KA 4JBAA 2DK8A 4I0BA 2K27A 5LEKA 4P5OA 2CG4A 1ON1A 4LG0A 3EETA 1XSVA 2KIMA 4A12A 3BJAA 1WI9A 2ESHA 4EQQA 3GYHX 2IPQX 3E5UA 3WG9A 3JSOA 3SZTA 1QGPA 3E3VA 1MZBA 1WWXA 3ZMSA 5LLQA 5L3DA 2AXLA 3ABTA 2G7UA 4OIRF 1SD7A 4YFXF 1YTYA 4R8HA 3I59A 3F8FA 3F6OA 4RB1A 2YSRA 1JGSA 2M1BA 2WC2A 4RAZA 2A6HF 3F8BA 1ZLKA 3J81K 4HDUA 3I4PA 1Y0UA 2O3FA 2P6TA 1RI7A 2FNAA 2J5OA 3DXJF 4Y15A 3RIRA 2VBWA 3BJ6A 5ICCA 1RZ4A 1W7PD 3K0LA 1IAWA 2RKHA 5K5OA 1ZRFA 1YYVA 4O3MA 3EUHA 1WSUA 2IJLA 3MFKA 1XMAA 1RUNA 3RKXA 3DP7A 4BYYA 1QZZA 3D5LA 3WTXC 6PAXA 3GW2A 2IP2A 3GFIA 2OA4A 5DCMA 1ON2A 3K1PA 2M5WA 1O57A 2RN7A 4L5JA 3N4MA 5JR3A 1YW9A 4GGGA 4YFNF 2XUBA 3WTSC 4Q5SF 2HEOA 1J9IA 2L4MA 3IRQA 4CXFA 5HS8A 1XCBA 3KP6A 1BM9A 5LHIA 3WODF 2O61A 2EB7A 1UHWA 3FXRA 4Y13A 3R0AA 3GLXA 3GX4X 3Q9VA 3T5XA 1SMTA 2H09A 3KCCA 4XSZF 1K7AA 2EV5A 2P7CB 1R36A 1I1SA 4FHTA 2BYVE 4LB5A 3GXOA 2LKPA 2V1XA 2OAZA 1SFUA 5FD6A 3BOQA 2XAHA 2M87A 1Z6TA 2XIGA 5LHGA 4IVNA 2A3SA 4A5MA 2HQNA 1BI0A 4KN4X 4Y17A 2A6EF 5DUIA 1ODDA 3ZMTA 3WE2A 1R1VA 1BBYA 3FMRA 4FT8A 5L3GA 1U5TB 3HHGA 3FWEA 3JSPA 1R7JA 5EEHA 1BC8C 1RIOH 2IA2A 4N9IA 1Z05A 3H92A 3L9FA 3M8FA 1XSDA 1XGSA 4YG2F 1PUEE 4I7HA 5ILUA 3LFKA 4UHTA 5CVJA 2QYOA 1SFEA 4BXUA 3IKTA 1LB2A 3ZP5A 1K6OA 3LQRA 3CUOA 3CJNA 1UHMA 4U88A 2V6CA 4RGSA 2G7HA 2CGPA 3LAJA 2A69F 4P9FA 3EQLF 1PDNC 1P92A 3ROUA 5BOXA 1O7LA 3HOTA 4OMYA 2XGXA 4L18B 4CGZA 2ZCWA 4KNYA 5DCFA 4O6JA 4LB6B 3FXQA 4HX7A 2H94A 3MEXA 4GYIA 2O6GE 1Z9CA 3C7JA 2KJCA 5CVRA 1ZG3A 4RB3C 3S2WA 4UUVA 3SZPA 5KK1A 2HDCA 5ILVA 1FBSA 2DO7A 1E17A 2QBYB 1ZYRF 1P4WA 1FP2A 2ESNA 3EYIA 4DQ2A 3GWZA 1ULYA 4YIIA 4AIHA 1IF1A 3L09A 2VT2A 4MEYF 2HGCA 4OOIA 1JXSA 1F9NA 2GQQA 2FF4A 2HR3A 4HX8A 2RDPA 4I0AA 5ILSA 2ZMEA 2Z5UA 1E2XA 2OQRA 5F64A 4HAMA 1TW3A 3I54A 2LDUA 1J2XA 2BEOA 3ERED 5DV5A 1WQ2A 1R1UA 5D4RA 4G7HF 4KA4A 1QPMA 3IWZA 5HDGA 3R61A 4BAYA 2EFNA 3E5QA 2DQRA 3C3WA 2O03A 2EJRA 2V79A 3RKYA 3D0SA 4PZJA 5L3BA 4RGRA 3WGIA 2FBHA 3GVAA 2QQAA 2DK5A 1ZH5A 3F72A 5JVTA 1P4AA 4AVPA 1IRFA 4HV6A 1W7PB 3IWFA 4L9NA 5EEGA 3P9KA 3ZMVA 4WX9A 3BPVA 3RKWA 4KIGA 1ZARA 4LJZF 4ESJA 5A2QK 3HRSA 2IT0A 1S6LA 2XV4S 4MEXF 4EJWA 4WCGA 2QUFA 4LLLA 2FOKA 2EA4A 4PCQA 1DUXC 2MH2A 1F5TA 4KDPA 4L0YB 2CWEA 5AONA 2OQGA 3QP5A 2WTEA 1KYWA 2PFBA 1B4AA 1P4XA 1B9NA 4PGHA 1T6SA 3WTYC 1J0RA 2HZTA 3V8JA 1GHCA 4UVBA 1USSA 3WTVC 4U7BA 5AIQA 1R5HA 2DW4A 4AIKA 2XVCA 3KLNA 5E20A 4LD5A 4KYWA 1QZYA 3HRUA 1MJBA 4LFUA 4HV5A 4GYGA 1G4DA 3J80Z 1L3LA 1T2KA 4Q4ZF 2L01A 1G6NA 1ZG5A 1TQIA 4RS8A 2F2EA 3FXUA 3WU1B 3E6DA 3LWFA 1YQAA 1KA8A 1REPC 5H20A 2L4AA 1HKSA 4K2EA 3CLOA 1I27A 3W6JB 3HSEA 1IRGA 4HF2A 5D4SA 1RNLA 5F6FA 3HRMA 5LRRA 3KETA 4KMFA 4M72A 1U5TA 4OINF 3ECHA 3K69A 1U5TC 1MJ9A 3RPQA 2VONA 4AWXB 2IRFG 2XAFA 3HHHA 2GXGA 3G3ZA 4I98B 3WTUC 4XLNF 3HRTA 2CYYA 2DTRA 4IXAA 5D8LB 5D6EA 4G94A 4S04A 4RB0A 1LJ9A 3KP5A 2OU2A 1HSJA 4IHSA 3RPUA 2FBIA 3TGNA 3KEOA 4HDVA 2F5EA 1XGMA 4HF1A 2EFPA 5H6RA 5D5VB 1ZN2A 4CZZA 3CO7C 4P9UA 2FQ3A 1OMIA 2MBFA 3TQNA 1TQPA 3KZZA 4KMUX 5D6FA 2QZ8A 1IUYA 2GIVA 4U0YA 4A0XA 1MD0A 4ENJA 4OMZA 4ZYHA 3IHUA 3VB2A 2XHKA 2QBYA 5AIPA 1ONVA 4GCVA 5ICGA 1H0MA 3CTAA 2VODA 1IW7F 2ELHA 2CO5A 5CVUA 2A07F 2NS0A 1JHFA 2IA1A 2K4BA 1OPCA 5L3FA 2FBKA 2CFXA 4Z2YA 1YS7A 2VBZA 2X0LA 2P5LC 4EM2A 3PQKA 3H3UA 1XN7A 2UXXA 1FSEA 5BS6A 3GFMA 1QBJA 2Y0MA 5ICEA 2K7LA 1T0FA 3NEUA 5E8IA 1OKRA 1LNWA 4HQEA 2ZBKA 5J6XA 2P8TA 4I02A 4ESBA 2VXZA 1G3WA 5K1YA 2Y75A 2MD5A 3LSTA 2DPDA 2EK5A 2LSOA 2NRAC 2GA2A 4PDKA 1KU3A 1R22A 1U2WA 3KZYA 3TDUC 4IRGA 5BQTA 4ZYGA 4XLPF 1NHAA 1S7AA 2EFWA 1DDNA 4UXNA 1FC3A 4A5NA 1R23A 3HYIA 3FZVA 2PEXA 1XGOA 4Q47A 1R00A 2P5VA 1MJAA 3F8CA 2BE5F 4KFCA 1FT9A 3ELKA 3SHFA 4YFKF 1R1TA 4M9XA 4IRIA 2JPCA 4RAYA 4ESFA 4MHGA 2BV6A 3U2RA 1FBQA 4AIJA 3KP7A 2UZKA 5LRSA 2KIUA 1BIBA 4R1HA 4KICA 1UCRA 2HFHA 4HW0A 1J59A 1HBXG 3HOSA 1ZREA 5F1RA 3KFWX 3M9AA 3N97A 2JRTA 2OZUA 2QENA 2EFOA 3VFZA 4A6DA 4MTEA 1QQIA 5JHUA 2LNBA 3JAMK 2UXNA 1KGSA 3DF8A 2KJBA 1SD5A 3R6SA 3C18A 4HLYA 2HQRA 1EV7A 5FLXZ 1YO5C 1OYIA 3JTGA 3KP3A 3Q5FA 5DUKA 4M9SA 3GUDA 1AWCA 4YIFA 2AS5F 2PMHA 3HSRA 3AAFA 3RI4A 3R60A 3GFLA 4MGRA 1P6RA 2EA2A 2MA3A 5D8KB 2EFQA 4AD9A 4WXDA 3V7RA 3GF2A 1AOYA 3FX3A 2Y48A 2D45A 3L7WA 4HBLA 5HS7A 1S8NA 3SXYA 1FNNA 2UWMA 2RC4A 2FNPA 4P96A 5CYVA 2NAZA 2JTVA 2DU9A 1LVAA 4U0WA 3TOAA 1U78A 1GXQA 3F22A 2WWYA 2P6SA 3SFZA 3MAJA 2DFIA 2FMLA 3QU3A 4XRFA 5TRDA 4N0BA 4WXHA 3GZ6A 2VE9A 4FX0A 1K79A 3ZPLA 1J5YA 1DPUA 4HOBA 2BGCA 2RNJA 4O5VA 4CDGA 2DQLA 3IL2A 3V8LA 2VN2A 3BPXA 3O6BB 1K78B 4BNCA 5ERIA 2RVCA 2ACJA 1FYLA 2ADUA 3OV8A 1IXSB 3LA2A 3I64A 3KEQA 4IF4A 1BOAA 3NQOA 2DI3A 5BMZA 3HTUA 1FSHA 4I2OA 3K9TA 1HXDA 1HKQA 3G73A 2PBIA 3F3XA 2E7WA 1ZG1A 2QQBA 5J8CA 3LA3A 1GVJA 1WKMA 2MLKA 4KN7X 4ETSA 1OYYA 1O3SA 5TJJA 3TO7A 3DFGA 2FA5A 1KU7A 2GAUA 3F8NA 1ZGAA 1B59A 1DPRA 2OBPA 2WV0A 3V8KA 3B73A 2JT1A 1W4MA 5DYMA 4LGWA 2E1NA 3HTSB 1G3YA 4MNUA 4EV0A 3I5UA 2Z3YA 5CLSA 2PI0A 5K5RA 2F5FA 4WWCA 4I01A 2KKOA 3RYRA 2ZKZA 1J75A 4ZH4F 2O8XA 2NNNA 4UV9A 5FFZA 1LDJA 2VOOA 4NQWA 5CJ9A 4ZZDA 2P4WA 5IT9Z 2R7FA 2LF7A 3HSFA 4MTDA 4JK1X 1XMKA 4A2UA 1ZAOA 3IRRA 3BDDA 1FX7A 2MH9A 1STZA 1HW2A 2XKOA 2TDXA 4A0ZA 3WTWC 2VC0A 3DKWA 4IJAA 2VE8A 2R3SA 3GO5A 4M71A 2STTA 3TO6A 1WRJA 2H6BA 1LQ1A 2PLYA 3COAC 3ML6A 2GXBA 2QWWA 3OOPA 1U8RA 3T8RA 5DD8A 4A6EA 2D2WA 2FSWA 3WGHA 1O7FA 1UB9A 4IPAA 4GXOA 1T39A 2YX4A 3GZ5A 4EM0B 5LEJA 3TDZC 4M73A 3WTTC 2J5PA 1TLHB 2RV8A 3K1MA 4EJOA 2K4JA 4A0YA 2Q0OA 5E18F 1Z6RA 1L0OC 4G7ZF 5KVRA 1HW5A 4N9HA 2XAJA 5CVIA 1XGNA 1Z91A 3I58A 2IW5A 3K1NA 3QOPA 3BROA 2XRNA 2NNYA 1BI1A 3SQNA 2FE3A 2K02A 1BC7C 1TW2A 2HTSA 2V1UA 5D5WB 2FXAA 4EGZA 2L02A 1TBXA 4M9ZA 3F8MA 3ZMZA 2XASA 1V3FA 2CW0F 4L0ZB 1YS6A 3FM3A 4KUMA 4KT5C 4L5IA 4LLGF 2PQ8A 1O3TA 1MKMA 3T0YA 2JSCA 1PP7U 3V7SA
chains in the Genus database with same CATH superfamily
1CF7B 4Q48A 2XPWA 1SD4A 2O0YA 5FLMJ 1QO0D 2VPRA 3HC7A 1D8JA 1CQTA 1FIAA 2DBBA 3KIOA 4M6YA 3ZMUA 4ON0A 1KU9A 1OYWA 2L3DA 4RB2C 2BXZA 3GTOJ 3M4OJ 2LF8A 2LFBA 2Y31A 5ED4A 3OS0A 1G3TA 3BCAA 3UNGC 2ZNYA 5E1WA 4ZZLA 3J7AO 1MBFA 1D5VA 3W2WA 2HPIA 3AFHA 3DTIA 3F6VA 2HS5A 2M8EA 2PJRA 1KQ0A 4G8XA 1YFHA 4PSWA 3BZ6A 4QWQA 4BHBA 5BPIA 2QSFX 4V2FA 2CQKA 2Z33A 2CQ7A 2A68F 2F5CA 1IN7A 1HSTA 1BR2A 2A5YB 5JHFA 3DU6A 3KP2A 4B3XA 2E7XA 3F23A 4ENKA 4QLCU 2VKVA 3I53A 1SAUA 1IN8A 4XKCA 4LOCA 1LDDA 3HOWJ 3ZQ7A 2R92J 5E3LA 1XDUA 1SVLA 4EATA 2YR2A 2HVSA 3E6BA 4ZYDA 3FBNB 1K78A 2M2EA 3S3MA 4XSXF 3ZQIA 1TQMA 3CDHA 3U9GA 2DMQA 5IT9K 1HC8A 2VBYA 2L9VA 2ZJ2A 1GXPA 3GTMJ 3CZ6A 1WJFA 1X58A 3DU5A 1FP1D 5LGNA 1VTNC 2ECCA 2LVSA 2R7VA 3L2UA 1BN5A 3CUQB 1JJ8C 1JHHA 2IVMA 2D1HA 3DBLB 1IN4A 5J40A 1IZ1A 4C3JJ 1X19A 3R0JA 3P7NA 4L9VA 4U7DA 1FOKA 1MDMB 3K4BA 4C2MJ 1G3SA 2QEXI 5LGUA 1ZGJA 2PN6A 2K9SA 2VOPA 1FLIA 2E34A 3HOVJ 1IV8A 5HLGA 3HKZA 3CF2A 1XX5A 2VXDA 4H0EA 2MC4A 2IS6A 2BOLA 1D8KA 1K4SA 2DCEA 2ISYA 2HQ5A 3MCZA 3B02A 2NXNB 1SMYF 3J80K 1EH7A 2OCEA 3B6AA 1ITYA 1WJCA 4XLCA 2W25A 1I6HJ 4ZDOA 2E1MB 2LLKA 4WXCA 4EJVA 1MNEA 4DNCA 4I09A 3ABUA 4KIBA 2ZC2A 3QP6A 3PM1A 4DBRA 1B9MA 2B0LA 2P5KA 4A3CJ 4S0HB 2L5QA 1I6XA 3Q9SA 2E2IJ 1TTYA 3HUGA 1W7PA 5L3CA 2R7RA 5HDNA 1OQYA 2UV1A 4PK4A 4QTRA 1FTTA 2PJPA 3MMYB 1RR7A 1WVRA 1TZLA 2YU3A 1V4RA 3HIFA 3GTKJ 1FYKA 5FO5A 3ZN0A 2XROA 3A03A 1K4TA 2FU4A 3QPHA 5HLIA 4GFBA 1E3OC 3L2CA 4TV7A 4Y3OA 4A93J 4MLOA 2ZXJA 1R58A 2M4GA 2JA7J 2P7VB 1WCMJ 2DFEA 2EV0A 2L7ZA 2W24A 2XF6A 3S3NA 3DCFA 4II3A 1JE8A 3KEYA 3TOBA 2H8RA 2QVOA 3P9IA 4Y4RA 4CCMA 2VJIA 2V9VA 3F21A 2VQCA 3E6MA 4XRSG 3BLYA 1F4KA 1LEAA 4FETA 3DBRB 1MBKA 3NARA 1Z7UA 2HYGD 3RQ4A 1FOYA 1V5GA 3DKYA 1S72I 4OAZA 2DA7A 2EWNA 3KP4A 2YPRA 1Q1HA 3OYBA 1LFBA 1T56A 2OD5A 3SFIA 3BY6A 1UELB 5LHHA 2MABA 5E1XA 1PJRA 3E7LA 2A6TA 3C1DA 3DEEA 5A2QZ 5D5XB 4NUBA 1MMDA 2K9LA 4C9YA 3H35A 3PQJA 2KMUA 4DZJA 3VOEA 1DP7P 5D5UB 1MH4A 1MW7A 1ENHA 5HVQC 2STWA 2DJNA 3OYKA 3WTZA 4JQFA 3HOXJ 5IYDJ 1FPQA 2L54A 2PMUA 2RREA 2GA1A 3K70C 5BPDA 4XM3A 4EGYA 4UV8A 1P2FA 1OR7A 2D1VA 2HOEA 2IBDA 4ASNA 2X48A 4LK0F 1G59A 3PO3J 1E3PA 3FKIJ 3K2ZA 1ZHFA 3T1BA 1TNTA 1HQCA 1IRZA 2BW3A 1ZRCA 2DPUA 2Y9ZA 2BBYA 1U0JA 1QVUA 3C2BA 4GO1A 2EV6A 1TWHJ 3KLOA 2JWTA 3AG3H 3FF5A 2E5NA 5FRMA 3SEQA 3CCJI 2X4HA 4ZDLA 4BACA 4V2GA 4G6TB 3U1DA 1D1BA 3EUKL 5HDKA 1UJ8A 3GEZA 2ETHA 4LK1F 5FKLA 1Q1VA 4LMYA 4G9YA 3CCUI 5EG0B 3V4GA 3PNVA 2OCCH 3LNQA 1R6RA 3M3YJ 1SFXA 2E1CA 2VBXA 4XRMA 4D0PA 2FMYA 4Y33A 5E8GA 3FHZA 2V9KA 4U0VA 1WFXA 1IG7A 1I5ZA 1YRNA 4D5CA 1XSXA 1FOXA 5GTHC 2V1NA 4J00A 4L9JA 4ENMA 2V6EA 4LG0B 3DBHB 3E1SA 3G1LA 2ISZA 2E60A 1HDDC 3CP8A 5E1ZB 4V19K 3EYYA 4XONA 1ZRDA 3W6KB 4E7KA 2OJED 5HOOA 2BY1A 3QODA 1BJAA 2BZTA 4UB8C 1FWZA 2QLZA 4HNUA 5IYCJ 1BL0A 4BY1J 4EJTA 5JI6A 5JFRA 5GPCA 2Y0SA 4HYEA 3DQVC 1MNMC 2HKXA 4ZC3A 1O3RA 1JUPA 4IEJA 5ICFA 1B8IA 5HS9A 2DAOA 1T95A 5FB2A 2Z99A 2L2OA 4OWRB 3NRVA 3A01B 3I59B 4BDYA 4B09A 2MYSA 2HKOA 2OZ6A 1TT5B 1YX5A 2XPVA 2V7FA 3TMOA 2IGOA 2GWRA 5CVVA 4UY8I 2KRHA 3LSJA 2KRCA 2NS8A 2VT3A 4IHTA 1TT0A 2Q8KA 4RLQA 4E70A 4CYDA 1ACIA 2DT5A 3MN2A 3CD6I 1LDKB 1YIOA 2JPBA 4R79A 2XAGA 2M45A 2KZVA 4M6XA 3S14J 2W57A 3OYIA 4P55A 3HBLA 4EJUA 3CJRB 1ETVA 2LBFB 5K5QA 4NBQA 2ZFWA 2HTJA 3TKYA 1YG2A 1KONA 2CU7A 4BHCA 4JX5A 3TO9A 2R7OA 2R5ZA 1OCCH 4HLXA 3QYBA 4OAYA 1I1GA 1S7EA 5F04A 3MWMA 2O8KA 1KQ9A 1J7KA 1IXRC 4CYCB 4IOCF 1IXCA 1BJZA 1YLFA 4BQQA 4IQJA 1SD6A 3K4CA 1IN5A 1H9TA 1SC7A 3GFJA 3LSHA 1Z7LA 3GTLJ 2ICWG 3EDPA 4WF2A 2M0MA 4B8XA 2GZWA 3O3KA 1CF7A 3LQQA 2VQGA 4H4KC 5DCMB 1G2HA 2AO9A 4A3MJ 3ZQFA 4G6QA 3ZN1A 3H3ZA 2BVLA 1LE8B 2HOSA 1HKTA 2VASA 3FMSA 2XAQA 3OL4A 4IHVA 1XB4A 1QZEA 4EMSA 5DD4A 4NHJA 4UVCA 3QYFA 1EA3A 1S29A 4NB5A 2NOGA 2RGVA 4E7JA 4BU2A 2VPLA 1WH7A 5FKKA 5IOYA 3CQZJ 2DA5A 3FIWA 3DPLC 2HXIA 2KFDA 2K3PA 2F5VA 2COMA 4OU0A 5HLHA 2H6CA 1C0WA 3BTJA 3HJEA 5DDGA 2L9RA 1JUMA 3E97A 4S05A 3DEUA 3ZGKA 4OIQF 1EH6A 1JT6A 5E79C 2A61A 2XSDC 1TNSA 3MZ8A 1UG2A 3H0GJ 2IAIA 2W85A 1X1CA 4W1UA 4CCNA 4B43A 2RAEA 2JZYA 2WAFA 2FRHA 2M30A 3RDIA 3JW4A 3ABMH 1A6IA 2AXTC 4ZYEA 5B1AH 1JUSA 3A0BC 3BR2A 3IUOA 5FFXA 2LK2A 2K3FA 3FXMA 1F1ZA 5DEQA 3HOUJ 1KYZA 4XBFA 2RQPA 2OTJI 4IL6C 2ZXHA 5CKTA 3RJPA 4M74A 3LA7A 2M3AA 1U3EM 2F48A 3ZXSA 3QRFF 3IKVA 3REOA 3JRHA 3O2PE 2CQXA 2IA0A 4G7OF 2DOEA 2HNHA 4Z6YA 3J81Z 1W5TA 3T8TA 3L00A 1IGNA 1IN6A 2VB6A 1BW6A 3E5XA 3MKYB 4XR6A 2G9WA 1U6GA 1XDSA 3CUQA 4CICA 1OCRH 2A05A 2DLLA 2M34A 2FEZA 5FLXK 3D5RC 1V5FA 5CQEA 2CRGA 5LGTA 3G4SI 1RUOA 3VYUB 2HZDA 4UNOA 4WK8F 4IRHA 2ZNZA 5FRNA 3CUQC 1MDMA 4HF0A 4PJJA 1H8AC 1R5ID 4L9TA 3VEPA 1LVKA 1A04A 3CC4I 2R7DA 2ZXIA 3HGYA 2V1DA 1ZELA 1SFOJ 1B6AA 3M7GA 1MIJA 2PG4A 3JREA 2HWVA 3BG5A 3LAPA 3QU6A 2W84A 1X1BA 1AU7A 1KU2A 1EH8A 2GM4A 4UVAA 3ZQQA 2VJ4A 3VSKA 3G6EI 1N78A 1U9NA 5KCMA 2C6YA 4HA8A 3RTRA 3TW7A 2XGDA 1T38A 3ULQB 1Y56A 2CSOA 3QPTA 2M8GX 4HX4A 5FGMA 3E6CC 4OIOF 4RGXA 1D3YA 1PP8F 3ASOH 5J1RA 1GVDA 2E1MC 1O3QA 2R7SA 1AHDP 3J7YJ 4LLNA 1OCPA 4HNVA 4RM3A 1FZPB 4MQ9F 2JVHA 1Z1DA 4XN0A 3DV8A 5IT3A 4CHUA 1N25A 2QQ9A 2IS2A 1UFMA 2TCTA 2LOOA 5H6QA 3BJOA 2MC3A 3MQ0A 1W0TA 3H9JA 1R5GA 4LITA 1YW7A 3WU0A 3SJMA 2K86A 4JX4A 3KZIC 2L9SA 3U21A 4RGUA 4KIFA 3CJQB 2DMUA 2MLGA 4EVIA 1S3JA 4HQMA 3DPTA 3M8EA 4D1QA 3CCMI 2HYFA 1D1AA 1YW8A 4X0GA 3H0DA 3JTHA 4BE0A 2KQRA 4YEJA 1S7OA 1QA6A 3GTGJ 2YX7A 1BI2A 2ZO4A 4G6DA 1CGPA 1H9GA 4OIPF 3FK6A 3WHBA 3M1EA 3FMQA 4F91B 2DA3A 5HNHA 1HLVA 2VC1A 1QNTA 4BH9A 3BP8A 4ENNA 2ZB9A 3LL7A 5EJCA 2Z9OA 3V7CA 4XN3A 4BEHB 4XK4A 5TISC 1B1BA 1SAXA 1XCVA 3HG9A 3QAHA 3VODA 4BHPA 3J7ZI 3BWGA 1KQ8A 3IC7A 5FD5A 4CZCA 1JT0A 1N75A 3FM5A 1P7IA 4HNTA 3PSIA 2E2HJ 1DGWY 4HSTA 4Y7NJ 3I0TA 1FY7A 1X3UA 4MQVA 3CMYA 2M0CA 2LKXA 3CDIA 4Y52J 4BJ5C 2XKPA 3H36A 4F7ZA 1I39A 1USTA 3HM5A 4PGGA 3S32A 1HW1A 2CUEA 4IHWA 3KE2A 2NVQJ 3CO6C 3OL3A 3TEDA 4XNFA 1J09A 2DA4A 4GRIA 1W0UA 2QM3A 1NG6A 2OTLI 2F5DA 2VKHA 1FYMA 3S3OA 3I71A 1MGTA 4KITB 2H27A 3HEFA 2KIFA 2LD5A 3PFIA 5L3EA 4BQAA 4PJ0C 1BI3A 2EQRA 3ISPA 3P9CA 5M3MJ 2DXIA 2ZMEB 1R4MB 1WJBA 2NYXA 3ZMDA 4DYRA 5LBQA 4A3LJ 1V5EA 3WGGA 4DIQA 3MZYA 1BIAA 3RYPA 3WE3A 3BQYA 3JAMZ 1FBUA 3ZR8X 4CO8A 1T98A 1W5SA 5J8FA 4BE1A 4ZDPA 3F9KA 4HZFA 5E17F 2KRFA 4EM1A 2OV7A 4FX4A 1Z3YA 5EG0A 1MNDA 2Q2EA 3ECOA 1XD7A 2ID3A 1ZLJA 3S2DJ 1LEBA 3MZHA 2NOJB 3R4KA 5H2FC 3CESA 4X6AJ 1FIPA 2IGKA 4JBAA 1WHUA 2DK8A 4I0BA 2K27A 2ZJPF 2DDAA 4I6ZA 5LEKA 3HKZN 2CG4A 2X85A 1ON1A 4P5OA 4CA0A 2VUMJ 4LG0A 3EETA 1XSVA 4DYCA 2MFZA 2KIMA 2R7XA 4A12A 3BJAA 3ABLH 3CMEI 3LSRA 4KISA 1WI9A 2ESHA 4EQQA 1IJWC 3GYHX 2IPQX 3E5UA 4CCOA 3WG9A 5KNLA 3JSOA 4PUSA 1TWFJ 3SZTA 1QGPA 3E3VA 4XLAA 1MZBA 1WWXA 3ZMSA 1VQNI 5LLQA 2VQHA 3W6VA 5L3DA 2AXLA 3ABTA 2G7UA 4OIRF 1SD7A 3IV5A 4YFXF 4D7NA 1YTYA 2LYCA 4RA2A 4R8HA 2R7QA 4X1EA 3PJRA 3I59A 5J4YA 3F8FA 3F6OA 4RB1A 2YSRA 4XICA 1JGSA 2M1BA 3BR6A 2WC2A 3PUFA 1MBHA 2H1KA 3HXLA 2LP0A 3OR1C 4RAZA 2E5ZA 2A6HF 3F8BA 3K4MA 1ZLKA 3J81K 4HDUA 3I4PA 2V4JC 1Y0UA 2O3FA 4LG3A 3VYTB 2P6TA 2DT6A 4RM2A 1RI7A 2FNAA 2J5OA 2LREA 2OUMA 3DXJF 4Y15A 2VBWA 3RIRA 2B9SA 1XMXA 3BJ6A 5ICCA 1RZ4A 2JRMA 2QSHX 2R5YB 2B63J 1W7PD 3DLAA 3GTJJ 1Z67A 3M07A 3JRCA 3W2AA 3K0LA 1IAWA 2RKHA 1NTCA 5K5OA 2LC2A 1ZRFA 1VFCA 2YU9J 1YYVA 2F4IA 4O3MA 2KT0A 3EUHA 1WSUA 5EZHA 2IJLA 3MFKA 2Y69H 4NNJA 1XMAA 5FJ8J 1RUNA 2EZHA 3RKXA 3EUHC 2EPFA 3L2RA 2CW7A 2NVUB 3DP7A 4BYYA 4KT6A 2DA1A 1ZK8A 4CYCA 1EJ9A 2WAQN 1MSEC 4UUTA 1QZZA 3D5LA 5DM7F 4NQWB 4JX6A 3BTLA 3WTXC 6PAXA 4BY7J 4D9JA 4UUSB 5B1BH 1YE9A 2PMZA 5GPAA 3GW2A 2IP2A 3GFIA 2OA4A 5DCMA 2EIKH 2CUJA 1ON2A 3K1PA 3CCQI 2M5WA 1O57A 2RN7A 4L5JA 3TP0A 5EGOB 3N4MA 5JR3A 1YW9A 4GGGA 4YFNF 4YELA 2XUBA 3WTSC 4Q5SF 2HEOA 1J9IA 2L4MA 1Y8RB 3L1PA 3LSMA 3H1CA 3WU2C 3IRQA 1VI0A 4CXFA 3X2QH 3KPHA 5FKMA 4BS9A 2ZSHB 4CUGA 5HS8A 2ECBA 2FOWA 3JR9A 3ZRGA 1XCBA 3KP6A 3K70D 1JKQC 3JRFA 5DM6F 1BM9A 2E71A 5LHIA 2DT7B 5J4VA 1NK3P 3HGGA 3OIOA 3WODF 1UHSA 2O61A 2EB7A 1UHWA 3FXRA 4Y13A 3R0AA 2JUGA 3BTCA 3GLXA 4IOAF 3CCRI 4AVZA 3GX4X 3GLLA 1JGGA 3Q9VA 2L7MP 3T5XA 2JA8J 3OYGA 3A2KA 1SMTA 1IDYA 2H09A 4C2TA 3G2BA 3KCCA 3Q0VA 3ZQLA 1K83J 4XSZF 1K7AA 2EV5A 1IV6A 4W97A 2P7CB 2JUCA 2QCOA 3RZOJ 1R36A 1ERDA 1I1SA 4FHTA 2Y2ZA 2BYVE 2AQEA 4LB5A 3GXOA 2LKPA 4A3GJ 2V1XA 2OAZA 1SFUA 1JTXA 1GLNA 4DOZA 3LSPA 5FD6A 3BOQA 1WGXA 2XAHA 2ME6A 2M87A 2Y0SN 2WAQA 1Z6TA 3FDYA 5J1YA 2XIGA 5LHGA 4IVNA 3GBGA 3O8HA 2A3SA 1Y0NA 4A5MA 1X1PA 2HQNA 3SZGA 3VYRB 2HDWA 1OCZH 1TWGJ 3L2QA 1BI0A 4KN4X 4BXXJ 4Y17A 2XC7A 1D0YA 2A6EF 3BR5A 5DUIA 1ODDA 2LTPA 5LD2C 3ZMTA 3WE2A 3I4NJ 1R1VA 1PUFB 3G71I 4AU7A 2EH3A 4HG2A 1BBYA 3CCSI 3FMRA 3BG6A 1X4PA 4FT8A 1U5TB 3HHGA 5L3GA 3K4NA 4PJMA 3FWEA 4UB6C 3JSPA 1R7JA 5EEHA 1BC8C 1RIOH 2IA2A 3KYDB 4N9IA 1Z05A 3H92A 2AQFA 4A3IJ 1Y1WJ 3OY9A 3SDGA 3L9FA 3HDDA 2VKEA 3H5AA 2L7KA 3M8FA 2X9DA 1WJEA 1XSDA 1XGSA 4YG2F 1PUEE 4I7HA 3BG7A 3LFKA 5ILUA 3CMAI 3MKZA 4UHTA 5CVJA 2QYOA 1IRXA 5EDNA 5CQGA 1SFEA 2LKSA 4BXUA 3IKTA 2K40A 1LB2A 3ZP5A 2NVYJ 1K6OA 2M7BA 3LQRA 2HDDA 1D5YA 1MMSA 3OIQA 3CUOA 3CJNA 4LIUA 4XL9A 4AM3A 1QRYA 1ZTRA 1UHMA 4U88A 2V6CA 4DYQA 4RGSA 5IP6A 1MH3A 2W48A 2G7HA 4E7LA 2CGPA 3LAJA 3PIOF 2A69F 4P9FA 2WB1N 3EQLF 3S1QJ 1A6QA 1PDNC 1P92A 2KIQA 3ROUA 2DOFA 5BOXA 1O7LA 3HOTA 2R93J 4OMYA 2XGXA 1BA5A 4L18B 4CGZA 3Q0WA 2ZCWA 4KNYA 5DCFA 3QOEA 4O6JA 4LB6B 4IZZA 3HB9A 2EZLA 3FXQA 4HX7A 2H94A 3MEXA 4GYIA 1RESA 2O6GE 3FXLA 3A1YA 1S5LC 3CC7I 1Z9CA 3H9QA 1HOMA 1VQ5I 3C7JA 2KJCA 5CVRA 1ZG3A 4RB3C 3AG4H 4BEHA 3S2WA 4UUVA 2JSPA 4A3DJ 2ZJRF 3SZPA 2I8DA 2XSJC 1X1DA 5KK1A 2HDCA 5ILVA 1FBSA 2XPUA 4C3HJ 2DO7A 2W7NA 2IS4A 1E17A 2XB0X 3PIPF 2QBYB 1ZYRF 3BZKA 1P4WA 1FP2A 2ESNA 5F27A 3EYIA 2L9NA 4DQ2A 1MSFC 3GWZA 3HPGA 3NWTA 1ULYA 4YIIA 1WI3A 4AIHA 3ABKH 1IF1A 2X6XA 2VT2A 3L09A 1RKTA 5FROA 4MEYF 2HGCA 3FISA 3PFYA 3OYCA 1VQ8I 1OJLA 4OOIA 1ETQA 2R7ZJ 1JXSA 4F52A 1ORKA 2DOAA 1F9NA 2GQQA 2KLOA 1IC8A 4BBSJ 2FF4A 2RQQA 1RRJA 2HR3A 5EF6A 4HX8A 5M5YJ 2RDPA 2DA2A 4I0AA 5ILSA 5KHDA 2LRDA 2Y9YA 1SFKA 2ZMEA 3FXKA 2Z5UA 1EF4A 1E2XA 2OQRA 5F64A 4HAMA 4XKBA 1TW3A 2EINH 2XB5A 3I54A 2ZMEC 2LDUA 4E7HA 1J2XA 2VJJA 2WB1A 2BEOA 3S1RJ 2FX0A 3CLQA 3ERED 3EPZA 3RSNA 1I50J 1X1AA 1W36D 1WJ5A 3ASNH 5DV5A 1WQ2A 1Z0XA 1R1UA 3QPLA 5D4RA 4G7HF 4KA4A 3CJTB 2JVGA 2KISA 1QPMA 3IWZA 3GTQJ 4DGWB 4AYBA 5HDGA 3R61A 4BAYA 2EFNA 3E5QA 1EKEA 2Y30A 2XF5A 3K10A 2DQRA 3C3WA 2JK3A 2O03A 2EJRA 3BR0A 2V79A 3RKYA 3D0SA 4PZJA 3O8GA 3OYAA 5L3BA 4ANJA 4HSRA 4MIMA 3CC2I 1X4OA 1VQ9I 4RGRA 3WGIA 2FBHA 3GVAA 1QHGA 2QQAA 4E7IA 2DK5A 2ELJA 3CDLA 1ZH5A 3VDXA 4IHYA 3F72A 5K7FA 5JVTA 1P4AA 4AVPA 2AHQA 1IRFA 1G8XA 1W7PB 2I10A 4HV6A 3L2WA 3IWFA 1QHHD 4L9NA 1E0EA 5EEGA 3P9KA 1AA7A 3ZMVA 5C4JJ 1O4XA 3HZJA 4WX9A 3BPVA 3RKWA 4KIGA 1ZARA 2EIJH 4LJZF 2EZKA 1GUUA 1NG7A 3E0JB 3FBIB 4RAGA 4ESJA 2X6WA 5A2QK 2DN0A 2K5CA 3HRSA 3JRBA 4M3FA 1ZR2A 2IT0A 2W82A 1S6LA 2XV4S 2R5YA 4A3EJ 4MEXF 4JP0A 2OC6A 2IGMA 4EJWA 2V26A 1RPWA 2M9HA 3IH3A 3VYSB 4WCGA 2QUFA 4LLLA 1QVTA 2ZXWH 3LSGA 2FOKA 2HU9A 2EA4A 3DEWA 4PCQA 2KDZA 1XG1A 3S8PA 2MH2A 1DUXC 5EEAA 1ZR4A 4CCJA 1GT0C 1F5TA 4KDPA 2CWEA 4L0YB 3HOYJ 1DGRM 3TW6A 5AONA 1BR1A 2OQGA 3QP5A 5TGTA 1ZGWA 2HVQA 2WTEA 4IQ4A 1KYWA 4XLFA 3TP3A 2GOXB 2PFBA 1B4AA 1P4XA 3NWSA 3IAM2 1B9NA 4PGHA 1T6SA 3WTYC 1J0RA 1RKWA 3RZDJ 3K6GA 4B48A 4YIRX 1IO2A 2HZTA 4UUSA 3V8JA 2ID6A 5FKNA 2R0QC 1GHCA 4HEA2 2L0KA 3PNYA 5HODA 1VF9A 2W4SA 4UVBA 1MMAA 1USSA 2WAEA 1OISA 5EGOA 3WTVC 4U7BA 4QPOA 5AIQA 1R5HA 4E6KG 2LG4A 1R4NB 3S2HJ 5F0FA 2DW4A 2NS7A 4AIKA 1YOVB 2XVCA 3KLNA 2GBYA 1VQKI 5E20A 4LD5A 4KYWA 1QZYA 1XPXA 3HRUA 2HXOA 4AUXA 2O5RA 3CF5F 1SEUA 1MJBA 1JKPC 4LFUA 4HV5A 3S16J 4B1RA 2K9MA 4GYGA 3G1MA 3BT9A 2BY3A 1G4DA 2DFHA 4F55A 4XKWA 3J80Z 1L3LA 1T2KA 1XC5A 4Q4ZF 3ERMA 2L01A 1G6NA 1ZG5A 1TQIA 4PJLA 2IGNA 4RS8A 5C3EJ 4XLHA 5BNGA 2F2EA 2WADA 3FXUA 3WU1B 3OMYA 2L7FP 2I5UA 4E7ZA 3E6DA 2CJJA 1YRNB 2HOTA 3LWFA 1YQAA 1KA8A 2ELKA 2CUFA 1REPC 1HA8A 5H20A 4RAFA 1XTAA 2A5WA 4M3BA 2L4AA 1HKSA 2UUZA 4K2EA 3CLOA 3OYLA 4RMNA 1I27A 5J1UA 3W6JB 3HSEA 4MFEA 1VQ4I 2R4GA 4M3EA 1IRGA 1RETA 4HF2A 5D4SA 1RNLA 3MKLA 5F6FA 3HRMA 3OYFA 5LRRA 4XKVA 1R49A 1B8IB 3KETA 1DP3A 4KMFA 4BBRJ 4M72A 1U5TA 3OYMA 3DTKA 4OINF 3ECHA 3WG7H 3K69A 1VQ6I 5E3NA 1U5TC 3S17J 1MJ9A 1LPQA 2YUSA 3RPQA 4FCYA 2VONA 4AWXB 2IRFG 2XAFA 3AL0B 3HHHA 2GXGA 4BDZA 1PVEA 3I9V2 3G3ZA 5F0HA 3GTPJ 4I98B 3WTUC 4XLNF 1TP4A 1P7JA 3LMMA 4ITVA 2HI3A 3HRTA 2LY2A 2RNGA 2DFFA 3SYTA 2CYYA 4CCLA 3OS2A 5J3LA 2VKDA 1FEXA 2ZJQF 2DTRA 4I76A 4IXAA 4II2A 5D8LB 5D6EA 4G94A 3RQIA 4S04A 4RB0A 1LJ9A 3IAS2 2F4OB 2OU2A 3KP5A 3M8JA 5JLWA 1HSJA 4G12A 4IHSA 1R9TJ 1SVMA 1V55H 3HL2A 3RPUA 2FBIA 1BR4A 4U87A 2CW8A 3TGNA 3KEOA 4HDVA 2F5EA 1XGMA 2CV1A 3RCOA 2PMZN 4BUPA 2HVRA 4HF1A 2EFPA 5H6RA 2IEKA 1ZN2A 5D5VB 2IS1A 4CZZA 4A3FJ 3CO7C 1UMQA 4P9UA 1SANA 2FQ3A 1OMIA 3QWLA 2MBFA 4BGDA 3TQNA 1TQPA 1I3QJ 2VI6A 3KZZA 2H8WA 4KMUX 2QZ8A 2WY8Q 5D6FA 1IUYA 4B44A 3A02A 2GIVA 1T33A 4U0YA 3A01A 5K7ZA 2CQQA 4A0XA 1MD0A 5IPAA 5J47A 4ENJA 4OMZA 2FQ4A 3OYEA 2CFOA 4ZYHA 3IHUA 3VB2A 1TWAJ 2XHKA 2QBYA 2EZIA 5AIPA 1ONVA 4ZTFA 3BG9A 4GCVA 3FXJA 3CCLI 5ICGA 1H0MA 1AKHB 4BE2A 3NAUA 3J7AY 3CTAA 2VODA 1IW7F 3K4JA 2ELHA 2CO5A 4XOTA 5CVUA 1OCTC 1K61A 2A07F 2NS0A 1JHFA 2E2JJ 2IA1A 2K4BA 1OPCA 2QKMB 5L3FA 2DMTA 2FBKA 2CFXA 2BHZA 1YS7A 4Z2YA 2LBFA 2VBZA 2X0LA 3W3CA 3OYJA 2P5LC 4EM2A 3PQKA 3H3UA 2WV1A 1XN7A 2UXXA 1MBEA 4DZPA 5HLTA 1WJAA 1FSEA 1ETYA 2XRLA 5GAGJ 3GFMA 5BS6A 1YJ9I 1QBJA 2Y0MA 3BCBA 5ICEA 2DMPA 2K7LA 1A31A 4ZJZA 5GTIC 2W00A 1T0FA 3NEUA 2DODA 5E8IA 1OKRA 1LNWA 4HQEA 1TWCJ 2ZBKA 3CCEI 1I3AA 3S15J 5J6XA 1BW5A 3L2VA 1LFUP 2P8TA 2R7TA 1T0FC 4A3BJ 4DBQA 3H9GA 4I02A 4ESBA 2JQ7A 2VXZA 1G3WA 5K1YA 2Y75A 5KAFC 2DMNA 2MD5A 3I3LA 4RLFA 4EEFG 3LSTA 2DPDA 2EK5A 2LSOA 2NRAC 2GA2A 4PDKA 1LE8A 2G0EA 1KU3A 1R22A 1U2WA 3KZYA 3TDUC 4IRGA 5BQTA 2HOAA 4ZYGA 4XLPF 1NHAA 1LUJB 2M7AA 3MD2A 2X6YA 1S7AA 4L5EA 2EFWA 1Z77A 2BXYA 4UXNA 1FC3A 4A5NA 1DDNA 1VQ7I 1R23A 3HYIA 2CH0A 1Y1VJ 2D5VA 1FMWA 3FZVA 4F3QA 3I55I 3C2GA 5FKOA 1MMNA 3IP4B 2PEXA 5B3SH 1XGOA 4Q47A 3BC8A 2DDBA 1R00A 2P5VA 1APLC 4NDLA 1MJAA 2BVMA 3F8CA 2BE5F 4KFCA 2R7WA 4XORA 1FT9A 4I99C 2MW8A 2CMPA 3N05A 1OCOH 3ELKA 2Z16A 2FJ1A 1JJ6C 3SHFA 4YFKF 5IY5H 1R1TA 2P0WA 3BTIA 3GCMA 5IP9J 2JA6J 4M9XA 4IRIA 2JPCA 3OYNA 4F93B 4RAYA 1WJDA 2DYRH 3ZQCA 4ESFA 2CV2A 2LR8A 1B72B 5M5WJ 2ZSIB 1GV2A 4MHGA 2BV6A 3U2RA 1FBQA 1Y8QB 3PNTA 3KP7A 4AIJA 1VQPI 3H3VK 3S1NJ 2E1OA 2UZKA 4XOPA 3G1OA 3HOZJ 3DTEA 4IHXA 5LRSA 3W2VA 2VLAA 5C4XJ 2KIUA 1BIBA 3I4MJ 4IO9F 2W1OA 4R1HA 1OLTA 4KICA 3JRIA 2K9QA 1UCRA 3JCUC 2HFHA 3OSGA 2MG4A 4HW0A 1J59A 5HNFA 4NC7A 4RBOA 1HBXG 3H5RA 3HOSA 1ZREA 5F1RA 2DYSH 4IKFA 3KYCB 3KFWX 3JRDA 3M9AA 3N97A 5C44J 2JRTA 4M6VA 2MD0A 2OZUA 2QENA 3U1KA 2EFOA 5M3FJ 3PO2J 2XF7A 3VFZA 4A6DA 4MTEA 5F08A 4C2UA 1QQIA 5JHUA 2LNBA 3JAMK 4C30A 2EILH 2UXNA 3OSFA 2WA0A 2LY9A 1KGSA 3DF8A 5DS9A 2KJBA 1SD5A 3R6SA 3C18A 2X1CA 4HLYA 2HQRA 1EV7A 2JMWA 1WZ2A 3JRAA 2DTZA 5FLXZ 1YO5C 4XRSA 3OOUA 1OYIA 4XIDA 3JTGA 5E3MA 1X3WB 3MKWB 3C2HA 1A35A 1K6YA 1OR7C 2HQAA 3KP3A 4BQOA 3Q5FA 4BKXA 5DUKA 4C3IJ 3KYLA 5FLVA 4B3AA 4M9SA 1T8IA 4XQFA 3SEZA 3OWTA 1FTZA 2BY2A 3Q3SA 5GAHJ 3GUDA 4AC0A 1AWCA 3AKZA 2JA2A 4YIFA 2AS5F 2PMHA 4N4OB 3BR1A 3HSRA 1JI8A 3FKJA 3AAFA 3RI4A 3R60A 3GFLA 2X1EA 4P1WA 3CCVI 4MGRA 1P6RA 2EA2A 2Q2EB 2MA3A 2QKLB 3LSIA 5D8KB 2EFQA 4AD9A 4WXDA 1KZHA 3V7RA 3K4KA 1ETOA 3GF2A 3FXOA 3FX3A 4PFPA 4AYBN 1AOYA 2Y48A 2ME0A 3L7WA 4HBLA 5F1JA 2D45A 3B6CA 5HS7A 1FOWA 1S8NA 3SXYA 1FNNA 2UWMA 2RC4A 3K4LA 1FMVA 4BL0B 2FNPA 4P96A 2KDOA 5CYVA 2NAZA 2JTVA 2DU9A 4HRIA 1LFPA 1P9QC 1LVAA 4U0WA 4D5FA 3TOAA 5M5XJ 1WH5A 1Z21A 4MO7A 5LFAA 1U78A 5E3OA 1S9HA 1A36A 1GXQA 3F22A 3D5SC 2WWYA 3M1CA 2P6SA 1D0ZA 3SFZA 3BQZA 3MAJA 2PJRB 3UR3C 4HPQA 2Z2SB 3BZCA 2DFIA 2FMLA 3QU3A 4A3JJ 1JKOC 5JVGF 4XRFA 5TRDA 4N0BA 3OYDA 2CV0A 2VJ5A 4WXHA 2MGQA 3GZ6A 1D1CA 2VE9A 2CS3A 2QA4I 4FX0A 1K79A 3ZPLA 3ZCOA 1J5YA 2HPMA 1DPUA 3KX2A 4HOBA 2CUZA 1Y39A 1LKXA 2BGCA 2RNJA 3QQAA 4O5VA 2QSGX 4CDGA 2DQLA 1H88C 3IL2A 3DKXA 3V8LA 2VN2A 2DJIA 3ZQGA 3VPRA 2LY1A 2XGCA 3BPXA 3O6BB 1K78B 1YJNI 4BNCA 3Q0UA 3UKGA 3AL0C 5ERIA 1NK2P 1YIJI 2RVCA 1H89C 1JTYA 1MBJA 2KL4A 1XS9A 4NC8A 4YRVA 2ACJA 1M1EB 4ZYAA 3ZOBA 4FE7A 3OS1A 4E4HA 5EZGA 4CCKA 4FTHA 1FYLA 3ZQHA 1MBGA 4F92B 2ADUA 3OV8A 1IXSB 9ANTA 3LA2A 2ZFUA 2WY7Q 3I64A 1U8BA 2FD5A 2P81A 2HYJA 2EBIA 3MVPA 3KEQA 3I56I 4IF4A 1ZKGA 2XAUA 4XMYA 1WPKA 2K9NA 1ETWA 1BOAA 3QYEA 3NQOA 2DI3A 3ESWB 2NVTJ 2O9LA 2COBA 1UG0A 3HTUA 5BMZA 1FSHA 5KAIC 4I2OA 1DU0A 2X51A 3K9TA 1POGA 2CQNA 1HXDA 3QPSA 1YHQI 1HKQA 1VNDA 3G73A 1W5CC 2NVXJ 3HPHA 2VL8A 3GMEA 4QPQA 1PYVA 2PBIA 5EYRA 3F3XA 5F0CA 2H1LA 3HUGB 2E7WA 1ZG1A 4KJZA 1GV5A 2QQBA 1ETKA 3AG2H 5J8CA 1DU6A 3LA3A 1GVJA 4B47A 1WKMA 2MLKA 4KN7X 4ETSA 1OYYA 1YX3A 1VZ0A 1O3SA 5TJJA 2DA6A 3TO7A 3DFGA 2QF7A 4MFDA 2FA5A 1KU7A 2GAUA 3F8NA 1ZGAA 3TBIA 1B59A 2KZGA 4B4CA 1DPRA 2OBPA 1AKHA 2WV0A 3V8KA 3BR3A 2VQLA 2X1DA 3B73A 4A3KJ 2JT1A 1FJLA 1W4MA 1HF0A 3FHNA 2B7EA 5DYMA 4D7MA 4LGWA 1GDTA 3PUBA 2E1NA 1ETXA 1X2MA 3HTSB 1G3YA 1N77A 4E7SA 3GZNB 4MNUA 4EV0A 5IP7J 2QQ8A 3DPUA 3OYHA 1VQLI 5GAEJ 3I5UA 2Z3YA 5CLSA 2PI0A 5K5RA 2F5FA 4FISA 1W36C 2FUG2 4WWCA 4I01A 2KKOA 4DJAA 4N4NB 2JJ7A 3RYRA 2ZKZA 1J75A 4IX7A 4ZH4F 3LSKA 1YI2I 2O8XA 2LMDA 2NNNA 1UAAA 4UV9A 3CP2A 2QGUA 5FFZA 2R7UA 3IH2A 4LIVA 1LDJA 5IOZA 5B5EC 2VOOA 4NQWA 5CJ9A 1MMGA 3EUAA 4M3DA 4ZZDA 1RR8C 2P4WA 3JRGA 2BY0A 4XLEA 3OIPA 3SDBA 5IT9Z 2R7FA 2LF7A 3VSLA 3V42A 3HSFA 4BJTA 4MTDA 3F0CA 4JK1X 1XMKA 4BQNA 5K7HA 4A2UA 1ZAOA 1YITI 2KHMA 1IUFA 3IRRA 3BDDA 1FX7A 1W1WE 2MH9A 1STZA 5DTDA 2LH9A 1HW2A 2F4MB 2TDXA 2XKOA 4A0ZA 3WTWC 2VC0A 1HDPA 3DKWA 4IJAA 4JOMA 2VE8A 2BW3B 4FQGA 5CPRB 4ABZA 1TC3C 3LOCA 1OFCX 2IXSA 2KPMA 2R3SA 3GO5A 2O7OA 1Y6IA 4M71A 2STTA 3TO6A 2EIMH 1WRJA 2H6BA 2OF7A 1LQ1A 1A5JA 1RC9A 5JLXA 2PLYA 1HCRA 3COAC 4PJNA 3ML6A 2GXBA 2M4KA 4A69C 3P5JA 3VWBA 2Q1ZB 3WHCA 4BJ6C 4PSXA 2QWWA 3ONQA 3OOPA 1VQOI 1U8RA 3S1MJ 3IH4A 4RDUA 2XDVA 3T8RA 5DD8A 4A6EA 2D2WA 2FSWA 1B72A 3TL4X 3WGHA 1O7FA 4JYKA 1UB9A 4IPAA 4GXOA 2MSYA 3K2AA 1T39A 1D0XA 2YX4A 3GZ5A 1V54H 4J19A 3H5NA 4EM0B 5LEJA 1VQMI 2WBMA 3TDZC 3A4CA 4M73A 2OPTA 4CSWA 2XGEA 3WTTC 2J5PA 3CMMA 3OR2C 2F6CA 2E36A 4PFOA 2K85A 1TLHB 2RV8A 3K1MA 3FK7A 1F36A 3RPUD 4EJOA 2K4JA 2JA5J 4FASD 1IDZA 1PUFA 4A0YA 3DLLF 5IYBJ 2Q0OA 4QSHA 1QU3A 3AG1H 5E18F 4J01A 2Z1DA 4CH7A 1Z6RA 2N8GA 1L0OC 1Z3XA 4G7ZF 5KVRA 2TRTA 4FE4A 1HW5A 5GP9A 1YJWI 4N9HA 2XAJA 1X3ZB 1XGNA 5CVIA 1Z91A 3I58A 4ZTJA 2BHYA 2IW5A 3K1NA 2GXAA 3QOPA 3BROA 2XRNA 3D1NI 2PX9A 2VIXA 2NNYA 1BI1A 1DQUA 2GIZA 3PL8A 3SQNA 2GLOA 4M3GA 2FE3A 2K02A 2X6OA 1BC7C 3PSFA 1TW2A 1ZQ3P 2HTSA 2V1UA 5D5WB 3A0HC 2FXAA 5B66C 4QIWN 2V9PA 4EGZA 1R71A 3DWLE 2L02A 1TL8A 3LFUA 1T08B 4DW6A 4AIDA 2KP6A 1TBXA 2GOMA 4M9ZA 3F8MA 1NH3A 3ZMZA 2XASA 4NC6A 2E19A 5GADJ 1V3FA 1BOBA 1F43A 3BG3A 2CW0F 2R5ZB 4L0ZB 4BXFA 3RKQA 1YS6A 3FM3A 4KUMA 2JN6A 4KT5C 4L5IA 4LLGF 2PQ8A 1O3TA 2YS9A 1MKMA 2E35A 1JKRC 3K7AJ 1X2NA 1E3HA 1UZCA 3T0YA 1U9OA 2JSCA 4GDFA 3CCYA 1PP7U 3V7SA 1QPIA 3S93A 1SVOA
chains in the Genus database with same CATH topology
1CF7B 4Q48A 1SD4A 2O0YA 1QO0D 1D8JA 2DBBA 4M6YA 3ZMUA 4ON0A 1KU9A 1OYWA 2L3DA 4RB2C 2LF8A 5ED4A 1G3TA 3J7AO 4ZZLA 2ZNYA 5E1WA 1D5VA 3F6VA 2HS5A 2M8EA 1KQ0A 4G8XA 1YFHA 3BZ6A 4QWQA 4BHBA 5BPIA 2CQKA 2Z33A 2F5CA 2A68F 1IN7A 1HSTA 2A5YB 3KP2A 2E7XA 3F23A 4ENKA 4QLCU 3I53A 1IN8A 1LDDA 3ZQ7A 1XDUA 2YR2A 3E6BA 4ZYDA 1K78A 4XSXF 1TQMA 3CDHA 3U9GA 5IT9K 2VBYA 2ZJ2A 1GXPA 5LGNA 1FP1D 1VTNC 1BN5A 3CUQB 1JHHA 2IVMA 2D1HA 1IN4A 1IZ1A 4L9VA 3R0JA 3P7NA 4U7DA 1FOKA 1MDMB 1G3SA 5LGUA 1ZGJA 2PN6A 2VOPA 1FLIA 5HLGA 4H0EA 1D8KA 2ISYA 3MCZA 3B02A 1SMYF 3J80K 1EH7A 2W25A 4WXCA 4EJVA 4DNCA 4I09A 3ABUA 4KIBA 3QP6A 1B9MA 2B0LA 2P5KA 1I6XA 3Q9SA 1TTYA 3HUGA 1W7PA 5L3CA 5HDNA 2PJPA 2YU3A 1V4RA 3HIFA 1FYKA 5FO5A 3ZN0A 2XROA 2FU4A 3QPHA 5HLIA 3L2CA 4TV7A 2ZXJA 1R58A 2P7VB 2EV0A 2W24A 1JE8A 3TOBA 2QVOA 3P9IA 2V9VA 3F21A 3E6MA 1F4KA 1LEAA 1Z7UA 2HYGD 2EWNA 3KP4A 2YPRA 1Q1HA 2OD5A 3BY6A 5LHHA 5E1XA 3C1DA 5A2QZ 5D5XB 3PQJA 3VOEA 1DP7P 5D5UB 5HVQC 2STWA 3WTZA 4JQFA 1FPQA 2L54A 2PMUA 2GA1A 5BPDA 4EGYA 4UV8A 1P2FA 1OR7A 2D1VA 2HOEA 4ASNA 4LK0F 3K2ZA 1ZHFA 3T1BA 1TNTA 1HQCA 1ZRCA 2DPUA 2BBYA 4GO1A 2EV6A 3KLOA 3FF5A 2X4HA 3U1DA 5HDKA 3GEZA 2ETHA 4LK1F 4LMYA 4G9YA 3V4GA 1SFXA 2E1CA 2VBXA 4D0PA 2FMYA 5E8GA 3FHZA 4U0VA 1I5ZA 1XSXA 4ENMA 4LG0B 4L9JA 2ISZA 5E1ZB 3EYYA 1ZRDA 3W6KB 5HOOA 1BJAA 1FWZA 2QLZA 4EJTA 5JI6A 5JFRA 4HYEA 3DQVC 2HKXA 1O3RA 5ICFA 5HS9A 2DAOA 5FB2A 2Z99A 3NRVA 3I59B 4B09A 2HKOA 2OZ6A 2GWRA 5CVVA 2VT3A 4IHTA 2Q8KA 4E70A 4CYDA 2DT5A 1LDKB 1YIOA 2JPBA 4R79A 2XAGA 2M45A 4M6XA 2W57A 4P55A 4EJUA 5K5QA 2ZFWA 2HTJA 3TKYA 1YG2A 4BHCA 3TO9A 4HLXA 1I1GA 3MWMA 1KQ9A 1J7KA 1IXRC 1IXCA 1YLFA 1SD6A 1IN5A 1H9TA 3GFJA 3EDPA 4WF2A 4B8XA 2GZWA 3O3KA 1CF7A 3LQQA 5DCMB 4G6QA 3ZN1A 3H3ZA 1HKTA 3FMSA 2XAQA 1XB4A 4EMSA 5DD4A 4NHJA 4UVCA 1S29A 4NB5A 2RGVA 3DPLC 2COMA 4OU0A 5HLHA 2H6CA 1C0WA 5DDGA 3E97A 4S05A 3DEUA 4OIQF 1EH6A 2A61A 1TNSA 2W85A 2JZYA 2FRHA 2M30A 3RDIA 3JW4A 4ZYEA 5FFXA 1F1ZA 5DEQA 1KYZA 4XBFA 2RQPA 3RJPA 4M74A 3LA7A 1U3EM 3QRFF 3IKVA 3REOA 3O2PE 2IA0A 4G7OF 3J81Z 1W5TA 3T8TA 3L00A 1IN6A 3E5XA 2G9WA 1U6GA 1XDSA 3CUQA 4CICA 2DLLA 2FEZA 5FLXK 5LGTA 1RUOA 4UNOA 4WK8F 4IRHA 2ZNZA 3CUQC 1MDMA 4HF0A 4L9TA 3VEPA 1A04A 2R7DA 2V1DA 1B6AA 3M7GA 2PG4A 2HWVA 3LAPA 3QU6A 2W84A 1KU2A 1EH8A 4UVAA 2C6YA 4HA8A 3RTRA 1T38A 3ULQB 2CSOA 4HX4A 3QPTA 3E6CC 4OIOF 5FGMA 4RGXA 1D3YA 1PP8F 1O3QA 4LLNA 1FZPB 4MQ9F 1Z1DA 3DV8A 5IT3A 4CHUA 2QQ9A 1UFMA 5H6QA 3BJOA 2MC3A 3MQ0A 1R5GA 1YW7A 3WU0A 2K86A 4RGUA 4KIFA 2MLGA 4EVIA 1S3JA 4HQMA 3DPTA 3M8EA 2HYFA 1YW8A 3JTHA 1S7OA 2YX7A 1BI2A 2ZO4A 4G6DA 1CGPA 1H9GA 4OIPF 3M1EA 3FMQA 2VC1A 1QNTA 4BH9A 3BP8A 4ENNA 2Z9OA 3V7CA 1B1BA 1SAXA 1XCVA 3QAHA 3VODA 4BHPA 3BWGA 1KQ8A 3IC7A 5FD5A 3FM5A 3I0TA 1FY7A 1X3UA 4MQVA 2XKPA 4F7ZA 1USTA 4PGGA 1HW1A 3KE2A 3CO6C 2QM3A 2F5DA 1FYMA 3I71A 1MGTA 2H27A 2KIFA 3PFIA 5L3EA 4BQAA 1BI3A 3ISPA 3P9CA 2ZMEB 3ZMDA 2NYXA 5LBQA 3WGGA 3MZYA 1BIAA 3RYPA 3WE3A 3JAMZ 1FBUA 4CO8A 1T98A 1W5SA 5J8FA 4HZFA 5E17F 2KRFA 4EM1A 4FX4A 2Q2EA 3ECOA 1XD7A 1ZLJA 1LEBA 3MZHA 3R4KA 4JBAA 2DK8A 4I0BA 2K27A 5LEKA 4P5OA 2CG4A 1ON1A 4LG0A 3EETA 1XSVA 2KIMA 4A12A 3BJAA 1WI9A 2ESHA 4EQQA 3GYHX 2IPQX 3E5UA 3WG9A 3JSOA 3SZTA 1QGPA 3E3VA 1MZBA 1WWXA 3ZMSA 5LLQA 5L3DA 2AXLA 3ABTA 2G7UA 4OIRF 1SD7A 4YFXF 1YTYA 4R8HA 3I59A 3F8FA 3F6OA 4RB1A 2YSRA 1JGSA 2M1BA 2WC2A 4RAZA 2A6HF 3F8BA 1ZLKA 3J81K 4HDUA 3I4PA 1Y0UA 2O3FA 2P6TA 1RI7A 2FNAA 2J5OA 3DXJF 4Y15A 3RIRA 2VBWA 3BJ6A 5ICCA 1RZ4A 1W7PD 3K0LA 1IAWA 2RKHA 5K5OA 1ZRFA 1YYVA 4O3MA 3EUHA 1WSUA 2IJLA 3MFKA 1XMAA 1RUNA 3RKXA 3DP7A 4BYYA 1QZZA 3D5LA 3WTXC 6PAXA 3GW2A 2IP2A 3GFIA 2OA4A 5DCMA 1ON2A 3K1PA 2M5WA 1O57A 2RN7A 4L5JA 3N4MA 5JR3A 1YW9A 4GGGA 4YFNF 2XUBA 3WTSC 4Q5SF 2HEOA 1J9IA 2L4MA 3IRQA 4CXFA 5HS8A 1XCBA 3KP6A 1BM9A 5LHIA 3WODF 2O61A 2EB7A 1UHWA 3FXRA 4Y13A 3R0AA 3GLXA 3GX4X 3Q9VA 3T5XA 1SMTA 2H09A 3KCCA 4XSZF 1K7AA 2EV5A 2P7CB 1R36A 1I1SA 4FHTA 2BYVE 4LB5A 3GXOA 2LKPA 2V1XA 2OAZA 1SFUA 5FD6A 3BOQA 2XAHA 2M87A 1Z6TA 2XIGA 5LHGA 4IVNA 2A3SA 4A5MA 2HQNA 1BI0A 4KN4X 4Y17A 2A6EF 5DUIA 1ODDA 3ZMTA 3WE2A 1R1VA 1BBYA 3FMRA 4FT8A 5L3GA 1U5TB 3HHGA 3FWEA 3JSPA 1R7JA 5EEHA 1BC8C 1RIOH 2IA2A 4N9IA 1Z05A 3H92A 3L9FA 3M8FA 1XSDA 1XGSA 4YG2F 1PUEE 4I7HA 5ILUA 3LFKA 4UHTA 5CVJA 2QYOA 1SFEA 4BXUA 3IKTA 1LB2A 3ZP5A 1K6OA 3LQRA 3CUOA 3CJNA 1UHMA 4U88A 2V6CA 4RGSA 2G7HA 2CGPA 3LAJA 2A69F 4P9FA 3EQLF 1PDNC 1P92A 3ROUA 5BOXA 1O7LA 3HOTA 4OMYA 2XGXA 4L18B 4CGZA 2ZCWA 4KNYA 5DCFA 4O6JA 4LB6B 3FXQA 4HX7A 2H94A 3MEXA 4GYIA 2O6GE 1Z9CA 3C7JA 2KJCA 5CVRA 1ZG3A 4RB3C 3S2WA 4UUVA 3SZPA 5KK1A 2HDCA 5ILVA 1FBSA 2DO7A 1E17A 2QBYB 1ZYRF 1P4WA 1FP2A 2ESNA 3EYIA 4DQ2A 3GWZA 1ULYA 4YIIA 4AIHA 1IF1A 3L09A 2VT2A 4MEYF 2HGCA 4OOIA 1JXSA 1F9NA 2GQQA 2FF4A 2HR3A 4HX8A 2RDPA 4I0AA 5ILSA 2ZMEA 2Z5UA 1E2XA 2OQRA 5F64A 4HAMA 1TW3A 3I54A 2LDUA 1J2XA 2BEOA 3ERED 5DV5A 1WQ2A 1R1UA 5D4RA 4G7HF 4KA4A 1QPMA 3IWZA 5HDGA 3R61A 4BAYA 2EFNA 3E5QA 2DQRA 3C3WA 2O03A 2EJRA 2V79A 3RKYA 3D0SA 4PZJA 5L3BA 4RGRA 3WGIA 2FBHA 3GVAA 2QQAA 2DK5A 1ZH5A 3F72A 5JVTA 1P4AA 4AVPA 1IRFA 4HV6A 1W7PB 3IWFA 4L9NA 5EEGA 3P9KA 3ZMVA 4WX9A 3BPVA 3RKWA 4KIGA 1ZARA 4LJZF 4ESJA 5A2QK 3HRSA 2IT0A 1S6LA 2XV4S 4MEXF 4EJWA 4WCGA 2QUFA 4LLLA 2FOKA 2EA4A 4PCQA 1DUXC 2MH2A 1F5TA 4KDPA 4L0YB 2CWEA 5AONA 2OQGA 3QP5A 2WTEA 1KYWA 2PFBA 1B4AA 1P4XA 1B9NA 4PGHA 1T6SA 3WTYC 1J0RA 2HZTA 3V8JA 1GHCA 4UVBA 1USSA 3WTVC 4U7BA 5AIQA 1R5HA 2DW4A 4AIKA 2XVCA 3KLNA 5E20A 4LD5A 4KYWA 1QZYA 3HRUA 1MJBA 4LFUA 4HV5A 4GYGA 1G4DA 3J80Z 1L3LA 1T2KA 4Q4ZF 2L01A 1G6NA 1ZG5A 1TQIA 4RS8A 2F2EA 3FXUA 3WU1B 3E6DA 3LWFA 1YQAA 1KA8A 1REPC 5H20A 2L4AA 1HKSA 4K2EA 3CLOA 1I27A 3W6JB 3HSEA 1IRGA 4HF2A 5D4SA 1RNLA 5F6FA 3HRMA 5LRRA 3KETA 4KMFA 4M72A 1U5TA 4OINF 3ECHA 3K69A 1U5TC 1MJ9A 3RPQA 2VONA 4AWXB 2IRFG 2XAFA 3HHHA 2GXGA 3G3ZA 4I98B 3WTUC 4XLNF 3HRTA 2CYYA 2DTRA 4IXAA 5D8LB 5D6EA 4G94A 4S04A 4RB0A 1LJ9A 3KP5A 2OU2A 1HSJA 4IHSA 3RPUA 2FBIA 3TGNA 3KEOA 4HDVA 2F5EA 1XGMA 4HF1A 2EFPA 5H6RA 5D5VB 1ZN2A 4CZZA 3CO7C 4P9UA 2FQ3A 1OMIA 2MBFA 3TQNA 1TQPA 3KZZA 4KMUX 5D6FA 2QZ8A 1IUYA 2GIVA 4U0YA 4A0XA 1MD0A 4ENJA 4OMZA 4ZYHA 3IHUA 3VB2A 2XHKA 2QBYA 5AIPA 1ONVA 4GCVA 5ICGA 1H0MA 3CTAA 2VODA 1IW7F 2ELHA 2CO5A 5CVUA 2A07F 2NS0A 1JHFA 2IA1A 2K4BA 1OPCA 5L3FA 2FBKA 2CFXA 4Z2YA 1YS7A 2VBZA 2X0LA 2P5LC 4EM2A 3PQKA 3H3UA 1XN7A 2UXXA 1FSEA 5BS6A 3GFMA 1QBJA 2Y0MA 5ICEA 2K7LA 1T0FA 3NEUA 5E8IA 1OKRA 1LNWA 4HQEA 2ZBKA 5J6XA 2P8TA 4I02A 4ESBA 2VXZA 1G3WA 5K1YA 2Y75A 2MD5A 3LSTA 2DPDA 2EK5A 2LSOA 2NRAC 2GA2A 4PDKA 1KU3A 1R22A 1U2WA 3KZYA 3TDUC 4IRGA 5BQTA 4ZYGA 4XLPF 1NHAA 1S7AA 2EFWA 1DDNA 4UXNA 1FC3A 4A5NA 1R23A 3HYIA 3FZVA 2PEXA 1XGOA 4Q47A 1R00A 2P5VA 1MJAA 3F8CA 2BE5F 4KFCA 1FT9A 3ELKA 3SHFA 4YFKF 1R1TA 4M9XA 4IRIA 2JPCA 4RAYA 4ESFA 4MHGA 2BV6A 3U2RA 1FBQA 4AIJA 3KP7A 2UZKA 5LRSA 2KIUA 1BIBA 4R1HA 4KICA 1UCRA 2HFHA 4HW0A 1J59A 1HBXG 3HOSA 1ZREA 5F1RA 3KFWX 3M9AA 3N97A 2JRTA 2OZUA 2QENA 2EFOA 3VFZA 4A6DA 4MTEA 1QQIA 5JHUA 2LNBA 3JAMK 2UXNA 1KGSA 3DF8A 2KJBA 1SD5A 3R6SA 3C18A 4HLYA 2HQRA 1EV7A 5FLXZ 1YO5C 1OYIA 3JTGA 3KP3A 3Q5FA 5DUKA 4M9SA 3GUDA 1AWCA 4YIFA 2AS5F 2PMHA 3HSRA 3AAFA 3RI4A 3R60A 3GFLA 4MGRA 1P6RA 2EA2A 2MA3A 5D8KB 2EFQA 4AD9A 4WXDA 3V7RA 3GF2A 1AOYA 3FX3A 2Y48A 2D45A 3L7WA 4HBLA 5HS7A 1S8NA 3SXYA 1FNNA 2UWMA 2RC4A 2FNPA 4P96A 5CYVA 2NAZA 2JTVA 2DU9A 1LVAA 4U0WA 3TOAA 1U78A 1GXQA 3F22A 2WWYA 2P6SA 3SFZA 3MAJA 2DFIA 2FMLA 3QU3A 4XRFA 5TRDA 4N0BA 4WXHA 3GZ6A 2VE9A 4FX0A 1K79A 3ZPLA 1J5YA 1DPUA 4HOBA 2BGCA 2RNJA 4O5VA 4CDGA 2DQLA 3IL2A 3V8LA 2VN2A 3BPXA 3O6BB 1K78B 4BNCA 5ERIA 2RVCA 2ACJA 1FYLA 2ADUA 3OV8A 1IXSB 3LA2A 3I64A 3KEQA 4IF4A 1BOAA 3NQOA 2DI3A 5BMZA 3HTUA 1FSHA 4I2OA 3K9TA 1HXDA 1HKQA 3G73A 2PBIA 3F3XA 2E7WA 1ZG1A 2QQBA 5J8CA 3LA3A 1GVJA 1WKMA 2MLKA 4KN7X 4ETSA 1OYYA 1O3SA 5TJJA 3TO7A 3DFGA 2FA5A 1KU7A 2GAUA 3F8NA 1ZGAA 1B59A 1DPRA 2OBPA 2WV0A 3V8KA 3B73A 2JT1A 1W4MA 5DYMA 4LGWA 2E1NA 3HTSB 1G3YA 4MNUA 4EV0A 3I5UA 2Z3YA 5CLSA 2PI0A 5K5RA 2F5FA 4WWCA 4I01A 2KKOA 3RYRA 2ZKZA 1J75A 4ZH4F 2O8XA 2NNNA 4UV9A 5FFZA 1LDJA 2VOOA 4NQWA 5CJ9A 4ZZDA 2P4WA 5IT9Z 2R7FA 2LF7A 3HSFA 4MTDA 4JK1X 1XMKA 4A2UA 1ZAOA 3IRRA 3BDDA 1FX7A 2MH9A 1STZA 1HW2A 2XKOA 2TDXA 4A0ZA 3WTWC 2VC0A 3DKWA 4IJAA 2VE8A 2R3SA 3GO5A 4M71A 2STTA 3TO6A 1WRJA 2H6BA 1LQ1A 2PLYA 3COAC 3ML6A 2GXBA 2QWWA 3OOPA 1U8RA 3T8RA 5DD8A 4A6EA 2D2WA 2FSWA 3WGHA 1O7FA 1UB9A 4IPAA 4GXOA 1T39A 2YX4A 3GZ5A 4EM0B 5LEJA 3TDZC 4M73A 3WTTC 2J5PA 1TLHB 2RV8A 3K1MA 4EJOA 2K4JA 4A0YA 2Q0OA 5E18F 1Z6RA 1L0OC 4G7ZF 5KVRA 1HW5A 4N9HA 2XAJA 5CVIA 1XGNA 1Z91A 3I58A 2IW5A 3K1NA 3QOPA 3BROA 2XRNA 2NNYA 1BI1A 3SQNA 2FE3A 2K02A 1BC7C 1TW2A 2HTSA 2V1UA 5D5WB 2FXAA 4EGZA 2L02A 1TBXA 4M9ZA 3F8MA 3ZMZA 2XASA 1V3FA 2CW0F 4L0ZB 1YS6A 3FM3A 4KUMA 4KT5C 4L5IA 4LLGF 2PQ8A 1O3TA 1MKMA 3T0YA 2JSCA 1PP7U 3V7SA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1CF7 B;  4Q48 A;  1SD4 A;  2O0Y A;  1QO0 D;  1D8J A;  2DBB A;  4M6Y A;  3ZMU A;  4ON0 A;  1KU9 A;  1OYW A;  2L3D A;  4RB2 C;  2LF8 A;  5ED4 A;  1G3T A;  3J7A O;  4ZZL A;  2ZNY A;  5E1W A;  1D5V A;  3F6V A;  2HS5 A;  2M8E A;  1KQ0 A;  4G8X A;  1YFH A;  3BZ6 A;  4QWQ A;  4BHB A;  5BPI A;  2CQK A;  2Z33 A;  2F5C A;  2A68 F;  1IN7 A;  1HST A;  2A5Y B;  3KP2 A;  2E7X A;  3F23 A;  4ENK A;  4QLC U;  3I53 A;  1IN8 A;  1LDD A;  3ZQ7 A;  1XDU A;  2YR2 A;  3E6B A;  4ZYD A;  1K78 A;  4XSX F;  1TQM A;  3CDH A;  3U9G A;  5IT9 K;  2VBY A;  2ZJ2 A;  1GXP A;  5LGN A;  1FP1 D;  1VTN C;  1BN5 A;  3CUQ B;  1JHH A;  2IVM A;  2D1H A;  1IN4 A;  1IZ1 A;  4L9V A;  3R0J A;  3P7N A;  4U7D A;  1FOK A;  1MDM B;  1G3S A;  5LGU A;  1ZGJ A;  2PN6 A;  2VOP A;  1FLI A;  5HLG A;  4H0E A;  1D8K A;  2ISY A;  3MCZ A;  3B02 A;  1SMY F;  3J80 K;  1EH7 A;  2W25 A;  4WXC A;  4EJV A;  4DNC A;  4I09 A;  3ABU A;  4KIB A;  3QP6 A;  1B9M A;  2B0L A;  2P5K A;  1I6X A;  3Q9S A;  1TTY A;  3HUG A;  1W7P A;  5L3C A;  5HDN A;  2PJP A;  2YU3 A;  1V4R A;  3HIF A;  1FYK A;  5FO5 A;  3ZN0 A;  2XRO A;  2FU4 A;  3QPH A;  5HLI A;  3L2C A;  4TV7 A;  2ZXJ A;  1R58 A;  2P7V B;  2EV0 A;  2W24 A;  1JE8 A;  3TOB A;  2QVO A;  3P9I A;  2V9V A;  3F21 A;  3E6M A;  1F4K A;  1LEA A;  1Z7U A;  2HYG D;  2EWN A;  3KP4 A;  2YPR A;  1Q1H A;  2OD5 A;  3BY6 A;  5LHH A;  5E1X A;  3C1D A;  5A2Q Z;  5D5X B;  3PQJ A;  3VOE A;  1DP7 P;  5D5U B;  5HVQ C;  2STW A;  3WTZ A;  4JQF A;  1FPQ A;  2L54 A;  2PMU A;  2GA1 A;  5BPD A;  4EGY A;  4UV8 A;  1P2F A;  1OR7 A;  2D1V A;  2HOE A;  4ASN A;  4LK0 F;  3K2Z A;  1ZHF A;  3T1B A;  1TNT A;  1HQC A;  1ZRC A;  2DPU A;  2BBY A;  4GO1 A;  2EV6 A;  3KLO A;  3FF5 A;  2X4H A;  3U1D A;  5HDK A;  3GEZ A;  2ETH A;  4LK1 F;  4LMY A;  4G9Y A;  3V4G A;  1SFX A;  2E1C A;  2VBX A;  4D0P A;  2FMY A;  5E8G A;  3FHZ A;  4U0V A;  1I5Z A;  1XSX A;  4ENM A;  4LG0 B;  4L9J A;  2ISZ A;  5E1Z B;  3EYY A;  1ZRD A;  3W6K B;  5HOO A;  1BJA A;  1FWZ A;  2QLZ A;  4EJT A;  5JI6 A;  5JFR A;  4HYE A;  3DQV C;  2HKX A;  1O3R A;  5ICF A;  5HS9 A;  2DAO A;  5FB2 A;  2Z99 A;  3NRV A;  3I59 B;  4B09 A;  2HKO A;  2OZ6 A;  2GWR A;  5CVV A;  2VT3 A;  4IHT A;  2Q8K A;  4E70 A;  4CYD A;  2DT5 A;  1LDK B;  1YIO A;  2JPB A;  4R79 A;  2XAG A;  2M45 A;  4M6X A;  2W57 A;  4P55 A;  4EJU A;  5K5Q A;  2ZFW A;  2HTJ A;  3TKY A;  1YG2 A;  4BHC A;  3TO9 A;  4HLX A;  1I1G A;  3MWM A;  1KQ9 A;  1J7K A;  1IXR C;  1IXC A;  1YLF A;  1SD6 A;  1IN5 A;  1H9T A;  3GFJ A;  3EDP A;  4WF2 A;  4B8X A;  2GZW A;  3O3K A;  1CF7 A;  3LQQ A;  5DCM B;  4G6Q A;  3ZN1 A;  3H3Z A;  1HKT A;  3FMS A;  2XAQ A;  1XB4 A;  4EMS A;  5DD4 A;  4NHJ A;  4UVC A;  1S29 A;  4NB5 A;  2RGV A;  3DPL C;  2COM A;  4OU0 A;  5HLH A;  2H6C A;  1C0W A;  5DDG A;  3E97 A;  4S05 A;  3DEU A;  4OIQ F;  1EH6 A;  2A61 A;  1TNS A;  2W85 A;  2JZY A;  2FRH A;  2M30 A;  3RDI A;  3JW4 A;  4ZYE A;  5FFX A;  1F1Z A;  5DEQ A;  1KYZ A;  4XBF A;  2RQP A;  3RJP A;  4M74 A;  3LA7 A;  1U3E M;  3QRF F;  3IKV A;  3REO A;  3O2P E;  2IA0 A;  4G7O F;  3J81 Z;  1W5T A;  3T8T A;  3L00 A;  1IN6 A;  3E5X A;  2G9W A;  1U6G A;  1XDS A;  3CUQ A;  4CIC A;  2DLL A;  2FEZ A;  5FLX K;  5LGT A;  1RUO A;  4UNO A;  4WK8 F;  4IRH A;  2ZNZ A;  3CUQ C;  1MDM A;  4HF0 A;  4L9T A;  3VEP A;  1A04 A;  2R7D A;  2V1D A;  1B6A A;  3M7G A;  2PG4 A;  2HWV A;  3LAP A;  3QU6 A;  2W84 A;  1KU2 A;  1EH8 A;  4UVA A;  2C6Y A;  4HA8 A;  3RTR A;  1T38 A;  3ULQ B;  2CSO A;  4HX4 A;  3QPT A;  3E6C C;  4OIO F;  5FGM A;  4RGX A;  1D3Y A;  1PP8 F;  1O3Q A;  4LLN A;  1FZP B;  4MQ9 F;  1Z1D A;  3DV8 A;  5IT3 A;  4CHU A;  2QQ9 A;  1UFM A;  5H6Q A;  3BJO A;  2MC3 A;  3MQ0 A;  1R5G A;  1YW7 A;  3WU0 A;  2K86 A;  4RGU A;  4KIF A;  2MLG A;  4EVI A;  1S3J A;  4HQM A;  3DPT A;  3M8E A;  2HYF A;  1YW8 A;  3JTH A;  1S7O A;  2YX7 A;  1BI2 A;  2ZO4 A;  4G6D A;  1CGP A;  1H9G A;  4OIP F;  3M1E A;  3FMQ A;  2VC1 A;  1QNT A;  4BH9 A;  3BP8 A;  4ENN A;  2Z9O A;  3V7C A;  1B1B A;  1SAX A;  1XCV A;  3QAH A;  3VOD A;  4BHP A;  3BWG A;  1KQ8 A;  3IC7 A;  5FD5 A;  3FM5 A;  3I0T A;  1FY7 A;  1X3U A;  4MQV A;  2XKP A;  4F7Z A;  1UST A;  4PGG A;  1HW1 A;  3KE2 A;  3CO6 C;  2QM3 A;  2F5D A;  1FYM A;  3I71 A;  1MGT A;  2H27 A;  2KIF A;  3PFI A;  5L3E A;  4BQA A;  1BI3 A;  3ISP A;  3P9C A;  2ZME B;  3ZMD A;  2NYX A;  5LBQ A;  3WGG A;  3MZY A;  1BIA A;  3RYP A;  3WE3 A;  3JAM Z;  1FBU A;  4CO8 A;  1T98 A;  1W5S A;  5J8F A;  4HZF A;  5E17 F;  2KRF A;  4EM1 A;  4FX4 A;  2Q2E A;  3ECO A;  1XD7 A;  1ZLJ A;  1LEB A;  3MZH A;  3R4K A;  4JBA A;  2DK8 A;  4I0B A;  2K27 A;  5LEK A;  4P5O A;  2CG4 A;  1ON1 A;  4LG0 A;  3EET A;  1XSV A;  2KIM A;  4A12 A;  3BJA A;  1WI9 A;  2ESH A;  4EQQ A;  3GYH X;  2IPQ X;  3E5U A;  3WG9 A;  3JSO A;  3SZT A;  1QGP A;  3E3V A;  1MZB A;  1WWX A;  3ZMS A;  5LLQ A;  5L3D A;  2AXL A;  3ABT A;  2G7U A;  4OIR F;  1SD7 A;  4YFX F;  1YTY A;  4R8H A;  3I59 A;  3F8F A;  3F6O A;  4RB1 A;  2YSR A;  1JGS A;  2M1B A;  2WC2 A;  4RAZ A;  2A6H F;  3F8B A;  1ZLK A;  3J81 K;  4HDU A;  3I4P A;  1Y0U A;  2O3F A;  2P6T A;  1RI7 A;  2FNA A;  2J5O A;  3DXJ F;  4Y15 A;  3RIR A;  2VBW A;  3BJ6 A;  5ICC A;  1RZ4 A;  1W7P D;  3K0L A;  1IAW A;  2RKH A;  5K5O A;  1ZRF A;  1YYV A;  4O3M A;  3EUH A;  1WSU A;  2IJL A;  3MFK A;  1XMA A;  1RUN A;  3RKX A;  3DP7 A;  4BYY A;  1QZZ A;  3D5L A;  3WTX C;  6PAX A;  3GW2 A;  2IP2 A;  3GFI A;  2OA4 A;  5DCM A;  1ON2 A;  3K1P A;  2M5W A;  1O57 A;  2RN7 A;  4L5J A;  3N4M A;  5JR3 A;  1YW9 A;  4GGG A;  4YFN F;  2XUB A;  3WTS C;  4Q5S F;  2HEO A;  1J9I A;  2L4M A;  3IRQ A;  4CXF A;  5HS8 A;  1XCB A;  3KP6 A;  1BM9 A;  5LHI A;  3WOD F;  2O61 A;  2EB7 A;  1UHW A;  3FXR A;  4Y13 A;  3R0A A;  3GLX A;  3GX4 X;  3Q9V A;  3T5X A;  1SMT A;  2H09 A;  3KCC A;  4XSZ F;  1K7A A;  2EV5 A;  2P7C B;  1R36 A;  1I1S A;  4FHT A;  2BYV E;  4LB5 A;  3GXO A;  2LKP A;  2V1X A;  2OAZ A;  1SFU A;  5FD6 A;  3BOQ A;  2XAH A;  2M87 A;  1Z6T A;  2XIG A;  5LHG A;  4IVN A;  2A3S A;  4A5M A;  2HQN A;  1BI0 A;  4KN4 X;  4Y17 A;  2A6E F;  5DUI A;  1ODD A;  3ZMT A;  3WE2 A;  1R1V A;  1BBY A;  3FMR A;  4FT8 A;  5L3G A;  1U5T B;  3HHG A;  3FWE A;  3JSP A;  1R7J A;  5EEH A;  1BC8 C;  1RIO H;  2IA2 A;  4N9I A;  1Z05 A;  3H92 A;  3L9F A;  3M8F A;  1XSD A;  1XGS A;  4YG2 F;  1PUE E;  4I7H A;  5ILU A;  3LFK A;  4UHT A;  5CVJ A;  2QYO A;  1SFE A;  4BXU A;  3IKT A;  1LB2 A;  3ZP5 A;  1K6O A;  3LQR A;  3CUO A;  3CJN A;  1UHM A;  4U88 A;  2V6C A;  4RGS A;  2G7H A;  2CGP A;  3LAJ A;  2A69 F;  4P9F A;  3EQL F;  1PDN C;  1P92 A;  3ROU A;  5BOX A;  1O7L A;  3HOT A;  4OMY A;  2XGX A;  4L18 B;  4CGZ A;  2ZCW A;  4KNY A;  5DCF A;  4O6J A;  4LB6 B;  3FXQ A;  4HX7 A;  2H94 A;  3MEX A;  4GYI A;  2O6G E;  1Z9C A;  3C7J A;  2KJC A;  5CVR A;  1ZG3 A;  4RB3 C;  3S2W A;  4UUV A;  3SZP A;  5KK1 A;  2HDC A;  5ILV A;  1FBS A;  2DO7 A;  1E17 A;  2QBY B;  1ZYR F;  1P4W A;  1FP2 A;  2ESN A;  3EYI A;  4DQ2 A;  3GWZ A;  1ULY A;  4YII A;  4AIH A;  1IF1 A;  3L09 A;  2VT2 A;  4MEY F;  2HGC A;  4OOI A;  1JXS A;  1F9N A;  2GQQ A;  2FF4 A;  2HR3 A;  4HX8 A;  2RDP A;  4I0A A;  5ILS A;  2ZME A;  2Z5U A;  1E2X A;  2OQR A;  5F64 A;  4HAM A;  1TW3 A;  3I54 A;  2LDU A;  1J2X A;  2BEO A;  3ERE D;  5DV5 A;  1WQ2 A;  1R1U A;  5D4R A;  4G7H F;  4KA4 A;  1QPM A;  3IWZ A;  5HDG A;  3R61 A;  4BAY A;  2EFN A;  3E5Q A;  2DQR A;  3C3W A;  2O03 A;  2EJR A;  2V79 A;  3RKY A;  3D0S A;  4PZJ A;  5L3B A;  4RGR A;  3WGI A;  2FBH A;  3GVA A;  2QQA A;  2DK5 A;  1ZH5 A;  3F72 A;  5JVT A;  1P4A A;  4AVP A;  1IRF A;  4HV6 A;  1W7P B;  3IWF A;  4L9N A;  5EEG A;  3P9K A;  3ZMV A;  4WX9 A;  3BPV A;  3RKW A;  4KIG A;  1ZAR A;  4LJZ F;  4ESJ A;  5A2Q K;  3HRS A;  2IT0 A;  1S6L A;  2XV4 S;  4MEX F;  4EJW A;  4WCG A;  2QUF A;  4LLL A;  2FOK A;  2EA4 A;  4PCQ A;  1DUX C;  2MH2 A;  1F5T A;  4KDP A;  4L0Y B;  2CWE A;  5AON A;  2OQG A;  3QP5 A;  2WTE A;  1KYW A;  2PFB A;  1B4A A;  1P4X A;  1B9N A;  4PGH A;  1T6S A;  3WTY C;  1J0R A;  2HZT A;  3V8J A;  1GHC A;  4UVB A;  1USS A;  3WTV C;  4U7B A;  5AIQ A;  1R5H A;  2DW4 A;  4AIK A;  2XVC A;  3KLN A;  5E20 A;  4LD5 A;  4KYW A;  1QZY A;  3HRU A;  1MJB A;  4LFU A;  4HV5 A;  4GYG A;  1G4D A;  3J80 Z;  1L3L A;  1T2K A;  4Q4Z F;  2L01 A;  1G6N A;  1ZG5 A;  1TQI A;  4RS8 A;  2F2E A;  3FXU A;  3WU1 B;  3E6D A;  3LWF A;  1YQA A;  1KA8 A;  1REP C;  5H20 A;  2L4A A;  1HKS A;  4K2E A;  3CLO A;  1I27 A;  3W6J B;  3HSE A;  1IRG A;  4HF2 A;  5D4S A;  1RNL A;  5F6F A;  3HRM A;  5LRR A;  3KET A;  4KMF A;  4M72 A;  1U5T A;  4OIN F;  3ECH A;  3K69 A;  1U5T C;  1MJ9 A;  3RPQ A;  2VON A;  4AWX B;  2IRF G;  2XAF A;  3HHH A;  2GXG A;  3G3Z A;  4I98 B;  3WTU C;  4XLN F;  3HRT A;  2CYY A;  2DTR A;  4IXA A;  5D8L B;  5D6E A;  4G94 A;  4S04 A;  4RB0 A;  1LJ9 A;  3KP5 A;  2OU2 A;  1HSJ A;  4IHS A;  3RPU A;  2FBI A;  3TGN A;  3KEO A;  4HDV A;  2F5E A;  1XGM A;  4HF1 A;  2EFP A;  5H6R A;  5D5V B;  1ZN2 A;  4CZZ A;  3CO7 C;  4P9U A;  2FQ3 A;  1OMI A;  2MBF A;  3TQN A;  1TQP A;  3KZZ A;  4KMU X;  5D6F A;  2QZ8 A;  1IUY A;  2GIV A;  4U0Y A;  4A0X A;  1MD0 A;  4ENJ A;  4OMZ A;  4ZYH A;  3IHU A;  3VB2 A;  2XHK A;  2QBY A;  5AIP A;  1ONV A;  4GCV A;  5ICG A;  1H0M A;  3CTA A;  2VOD A;  1IW7 F;  2ELH A;  2CO5 A;  5CVU A;  2A07 F;  2NS0 A;  1JHF A;  2IA1 A;  2K4B A;  1OPC A;  5L3F A;  2FBK A;  2CFX A;  4Z2Y A;  1YS7 A;  2VBZ A;  2X0L A;  2P5L C;  4EM2 A;  3PQK A;  3H3U A;  1XN7 A;  2UXX A;  1FSE A;  5BS6 A;  3GFM A;  1QBJ A;  2Y0M A;  5ICE A;  2K7L A;  1T0F A;  3NEU A;  5E8I A;  1OKR A;  1LNW A;  4HQE A;  2ZBK A;  5J6X A;  2P8T A;  4I02 A;  4ESB A;  2VXZ A;  1G3W A;  5K1Y A;  2Y75 A;  2MD5 A;  3LST A;  2DPD A;  2EK5 A;  2LSO A;  2NRA C;  2GA2 A;  4PDK A;  1KU3 A;  1R22 A;  1U2W A;  3KZY A;  3TDU C;  4IRG A;  5BQT A;  4ZYG A;  4XLP F;  1NHA A;  1S7A A;  2EFW A;  1DDN A;  4UXN A;  1FC3 A;  4A5N A;  1R23 A;  3HYI A;  3FZV A;  2PEX A;  1XGO A;  4Q47 A;  1R00 A;  2P5V A;  1MJA A;  3F8C A;  2BE5 F;  4KFC A;  1FT9 A;  3ELK A;  3SHF A;  4YFK F;  1R1T A;  4M9X A;  4IRI A;  2JPC A;  4RAY A;  4ESF A;  4MHG A;  2BV6 A;  3U2R A;  1FBQ A;  4AIJ A;  3KP7 A;  2UZK A;  5LRS A;  2KIU A;  1BIB A;  4R1H A;  4KIC A;  1UCR A;  2HFH A;  4HW0 A;  1J59 A;  1HBX G;  3HOS A;  1ZRE A;  5F1R A;  3KFW X;  3M9A A;  3N97 A;  2JRT A;  2OZU A;  2QEN A;  2EFO A;  3VFZ A;  4A6D A;  4MTE A;  1QQI A;  5JHU A;  2LNB A;  3JAM K;  2UXN A;  1KGS A;  3DF8 A;  2KJB A;  1SD5 A;  3R6S A;  3C18 A;  4HLY A;  2HQR A;  1EV7 A;  5FLX Z;  1YO5 C;  1OYI A;  3JTG A;  3KP3 A;  3Q5F A;  5DUK A;  4M9S A;  3GUD A;  1AWC A;  4YIF A;  2AS5 F;  2PMH A;  3HSR A;  3AAF A;  3RI4 A;  3R60 A;  3GFL A;  4MGR A;  1P6R A;  2EA2 A;  2MA3 A;  5D8K B;  2EFQ A;  4AD9 A;  4WXD A;  3V7R A;  3GF2 A;  1AOY A;  3FX3 A;  2Y48 A;  2D45 A;  3L7W A;  4HBL A;  5HS7 A;  1S8N A;  3SXY A;  1FNN A;  2UWM A;  2RC4 A;  2FNP A;  4P96 A;  5CYV A;  2NAZ A;  2JTV A;  2DU9 A;  1LVA A;  4U0W A;  3TOA A;  1U78 A;  1GXQ A;  3F22 A;  2WWY A;  2P6S A;  3SFZ A;  3MAJ A;  2DFI A;  2FML A;  3QU3 A;  4XRF A;  5TRD A;  4N0B A;  4WXH A;  3GZ6 A;  2VE9 A;  4FX0 A;  1K79 A;  3ZPL A;  1J5Y A;  1DPU A;  4HOB A;  2BGC A;  2RNJ A;  4O5V A;  4CDG A;  2DQL A;  3IL2 A;  3V8L A;  2VN2 A;  3BPX A;  3O6B B;  1K78 B;  4BNC A;  5ERI A;  2RVC A;  2ACJ A;  1FYL A;  2ADU A;  3OV8 A;  1IXS B;  3LA2 A;  3I64 A;  3KEQ A;  4IF4 A;  1BOA A;  3NQO A;  2DI3 A;  5BMZ A;  3HTU A;  1FSH A;  4I2O A;  3K9T A;  1HXD A;  1HKQ A;  3G73 A;  2PBI A;  3F3X A;  2E7W A;  1ZG1 A;  2QQB A;  5J8C A;  3LA3 A;  1GVJ A;  1WKM A;  2MLK A;  4KN7 X;  4ETS A;  1OYY A;  1O3S A;  5TJJ A;  3TO7 A;  3DFG A;  2FA5 A;  1KU7 A;  2GAU A;  3F8N A;  1ZGA A;  1B59 A;  1DPR A;  2OBP A;  2WV0 A;  3V8K A;  3B73 A;  2JT1 A;  1W4M A;  5DYM A;  4LGW A;  2E1N A;  3HTS B;  1G3Y A;  4MNU A;  4EV0 A;  3I5U A;  2Z3Y A;  5CLS A;  2PI0 A;  5K5R A;  2F5F A;  4WWC A;  4I01 A;  2KKO A;  3RYR A;  2ZKZ A;  1J75 A;  4ZH4 F;  2O8X A;  2NNN A;  4UV9 A;  5FFZ A;  1LDJ A;  2VOO A;  4NQW A;  5CJ9 A;  4ZZD A;  2P4W A;  5IT9 Z;  2R7F A;  2LF7 A;  3HSF A;  4MTD A;  4JK1 X;  1XMK A;  4A2U A;  1ZAO A;  3IRR A;  3BDD A;  1FX7 A;  2MH9 A;  1STZ A;  1HW2 A;  2XKO A;  2TDX A;  4A0Z A;  3WTW C;  2VC0 A;  3DKW A;  4IJA A;  2VE8 A;  2R3S A;  3GO5 A;  4M71 A;  2STT A;  3TO6 A;  1WRJ A;  2H6B A;  1LQ1 A;  2PLY A;  3COA C;  3ML6 A;  2GXB A;  2QWW A;  3OOP A;  1U8R A;  3T8R A;  5DD8 A;  4A6E A;  2D2W A;  2FSW A;  3WGH A;  1O7F A;  1UB9 A;  4IPA A;  4GXO A;  1T39 A;  2YX4 A;  3GZ5 A;  4EM0 B;  5LEJ A;  3TDZ C;  4M73 A;  3WTT C;  2J5P A;  1TLH B;  2RV8 A;  3K1M A;  4EJO A;  2K4J A;  4A0Y A;  2Q0O A;  5E18 F;  1Z6R A;  1L0O C;  4G7Z F;  5KVR A;  1HW5 A;  4N9H A;  2XAJ A;  5CVI A;  1XGN A;  1Z91 A;  3I58 A;  2IW5 A;  3K1N A;  3QOP A;  3BRO A;  2XRN A;  2NNY A;  1BI1 A;  3SQN A;  2FE3 A;  2K02 A;  1BC7 C;  1TW2 A;  2HTS A;  2V1U A;  5D5W B;  2FXA A;  4EGZ A;  2L02 A;  1TBX A;  4M9Z A;  3F8M A;  3ZMZ A;  2XAS A;  1V3F A;  2CW0 F;  4L0Z B;  1YS6 A;  3FM3 A;  4KUM A;  4KT5 C;  4L5I A;  4LLG F;  2PQ8 A;  1O3T A;  1MKM A;  3T0Y A;  2JSC A;  1PP7 U;  3V7S A; 
#chains in the Genus database with same CATH topology
 1CF7 B;  4Q48 A;  2XPW A;  1SD4 A;  2O0Y A;  5FLM J;  1QO0 D;  2VPR A;  3HC7 A;  1D8J A;  1CQT A;  1FIA A;  2DBB A;  3KIO A;  4M6Y A;  3ZMU A;  4ON0 A;  1KU9 A;  1OYW A;  2L3D A;  4RB2 C;  2BXZ A;  3GTO J;  3M4O J;  2LF8 A;  2LFB A;  2Y31 A;  5ED4 A;  3OS0 A;  1G3T A;  3BCA A;  3UNG C;  2ZNY A;  5E1W A;  4ZZL A;  3J7A O;  1MBF A;  1D5V A;  3W2W A;  2HPI A;  3AFH A;  3DTI A;  3F6V A;  2HS5 A;  2M8E A;  2PJR A;  1KQ0 A;  4G8X A;  1YFH A;  4PSW A;  3BZ6 A;  4QWQ A;  4BHB A;  5BPI A;  2QSF X;  4V2F A;  2CQK A;  2Z33 A;  2CQ7 A;  2A68 F;  2F5C A;  1IN7 A;  1HST A;  1BR2 A;  2A5Y B;  5JHF A;  3DU6 A;  3KP2 A;  4B3X A;  2E7X A;  3F23 A;  4ENK A;  4QLC U;  2VKV A;  3I53 A;  1SAU A;  1IN8 A;  4XKC A;  4LOC A;  1LDD A;  3HOW J;  3ZQ7 A;  2R92 J;  5E3L A;  1XDU A;  1SVL A;  4EAT A;  2YR2 A;  2HVS A;  3E6B A;  4ZYD A;  3FBN B;  1K78 A;  2M2E A;  3S3M A;  4XSX F;  3ZQI A;  1TQM A;  3CDH A;  3U9G A;  2DMQ A;  5IT9 K;  1HC8 A;  2VBY A;  2L9V A;  2ZJ2 A;  1GXP A;  3GTM J;  3CZ6 A;  1WJF A;  1X58 A;  3DU5 A;  1FP1 D;  5LGN A;  1VTN C;  2ECC A;  2LVS A;  2R7V A;  3L2U A;  1BN5 A;  3CUQ B;  1JJ8 C;  1JHH A;  2IVM A;  2D1H A;  3DBL B;  1IN4 A;  5J40 A;  1IZ1 A;  4C3J J;  1X19 A;  3R0J A;  3P7N A;  4L9V A;  4U7D A;  1FOK A;  1MDM B;  3K4B A;  4C2M J;  1G3S A;  2QEX I;  5LGU A;  1ZGJ A;  2PN6 A;  2K9S A;  2VOP A;  1FLI A;  2E34 A;  3HOV J;  1IV8 A;  5HLG A;  3HKZ A;  3CF2 A;  1XX5 A;  2VXD A;  4H0E A;  2MC4 A;  2IS6 A;  2BOL A;  1D8K A;  1K4S A;  2DCE A;  2ISY A;  2HQ5 A;  3MCZ A;  3B02 A;  2NXN B;  1SMY F;  3J80 K;  1EH7 A;  2OCE A;  3B6A A;  1ITY A;  1WJC A;  4XLC A;  2W25 A;  1I6H J;  4ZDO A;  2E1M B;  2LLK A;  4WXC A;  4EJV A;  1MNE A;  4DNC A;  4I09 A;  3ABU A;  4KIB A;  2ZC2 A;  3QP6 A;  3PM1 A;  4DBR A;  1B9M A;  2B0L A;  2P5K A;  4A3C J;  4S0H B;  2L5Q A;  1I6X A;  3Q9S A;  2E2I J;  1TTY A;  3HUG A;  1W7P A;  5L3C A;  2R7R A;  5HDN A;  1OQY A;  2UV1 A;  4PK4 A;  4QTR A;  1FTT A;  2PJP A;  3MMY B;  1RR7 A;  1WVR A;  1TZL A;  2YU3 A;  1V4R A;  3HIF A;  3GTK J;  1FYK A;  5FO5 A;  3ZN0 A;  2XRO A;  3A03 A;  1K4T A;  2FU4 A;  3QPH A;  5HLI A;  4GFB A;  1E3O C;  3L2C A;  4TV7 A;  4Y3O A;  4A93 J;  4MLO A;  2ZXJ A;  1R58 A;  2M4G A;  2JA7 J;  2P7V B;  1WCM J;  2DFE A;  2EV0 A;  2L7Z A;  2W24 A;  2XF6 A;  3S3N A;  3DCF A;  4II3 A;  1JE8 A;  3KEY A;  3TOB A;  2H8R A;  2QVO A;  3P9I A;  4Y4R A;  4CCM A;  2VJI A;  2V9V A;  3F21 A;  2VQC A;  3E6M A;  4XRS G;  3BLY A;  1F4K A;  1LEA A;  4FET A;  3DBR B;  1MBK A;  3NAR A;  1Z7U A;  2HYG D;  3RQ4 A;  1FOY A;  1V5G A;  3DKY A;  1S72 I;  4OAZ A;  2DA7 A;  2EWN A;  3KP4 A;  2YPR A;  1Q1H A;  3OYB A;  1LFB A;  1T56 A;  2OD5 A;  3SFI A;  3BY6 A;  1UEL B;  5LHH A;  2MAB A;  5E1X A;  1PJR A;  3E7L A;  2A6T A;  3C1D A;  3DEE A;  5A2Q Z;  5D5X B;  4NUB A;  1MMD A;  2K9L A;  4C9Y A;  3H35 A;  3PQJ A;  2KMU A;  4DZJ A;  3VOE A;  1DP7 P;  5D5U B;  1MH4 A;  1MW7 A;  1ENH A;  5HVQ C;  2STW A;  2DJN A;  3OYK A;  3WTZ A;  4JQF A;  3HOX J;  5IYD J;  1FPQ A;  2L54 A;  2PMU A;  2RRE A;  2GA1 A;  3K70 C;  5BPD A;  4XM3 A;  4EGY A;  4UV8 A;  1P2F A;  1OR7 A;  2D1V A;  2HOE A;  2IBD A;  4ASN A;  2X48 A;  4LK0 F;  1G59 A;  3PO3 J;  1E3P A;  3FKI J;  3K2Z A;  1ZHF A;  3T1B A;  1TNT A;  1HQC A;  1IRZ A;  2BW3 A;  1ZRC A;  2DPU A;  2Y9Z A;  2BBY A;  1U0J A;  1QVU A;  3C2B A;  4GO1 A;  2EV6 A;  1TWH J;  3KLO A;  2JWT A;  3AG3 H;  3FF5 A;  2E5N A;  5FRM A;  3SEQ A;  3CCJ I;  2X4H A;  4ZDL A;  4BAC A;  4V2G A;  4G6T B;  3U1D A;  1D1B A;  3EUK L;  5HDK A;  1UJ8 A;  3GEZ A;  2ETH A;  4LK1 F;  5FKL A;  1Q1V A;  4LMY A;  4G9Y A;  3CCU I;  5EG0 B;  3V4G A;  3PNV A;  2OCC H;  3LNQ A;  1R6R A;  3M3Y J;  1SFX A;  2E1C A;  2VBX A;  4XRM A;  4D0P A;  2FMY A;  4Y33 A;  5E8G A;  3FHZ A;  2V9K A;  4U0V A;  1WFX A;  1IG7 A;  1I5Z A;  1YRN A;  4D5C A;  1XSX A;  1FOX A;  5GTH C;  2V1N A;  4J00 A;  4L9J A;  4ENM A;  2V6E A;  4LG0 B;  3DBH B;  3E1S A;  3G1L A;  2ISZ A;  2E60 A;  1HDD C;  3CP8 A;  5E1Z B;  4V19 K;  3EYY A;  4XON A;  1ZRD A;  3W6K B;  4E7K A;  2OJE D;  5HOO A;  2BY1 A;  3QOD A;  1BJA A;  2BZT A;  4UB8 C;  1FWZ A;  2QLZ A;  4HNU A;  5IYC J;  1BL0 A;  4BY1 J;  4EJT A;  5JI6 A;  5JFR A;  5GPC A;  2Y0S A;  4HYE A;  3DQV C;  1MNM C;  2HKX A;  4ZC3 A;  1O3R A;  1JUP A;  4IEJ A;  5ICF A;  1B8I A;  5HS9 A;  2DAO A;  1T95 A;  5FB2 A;  2Z99 A;  2L2O A;  4OWR B;  3NRV A;  3A01 B;  3I59 B;  4BDY A;  4B09 A;  2MYS A;  2HKO A;  2OZ6 A;  1TT5 B;  1YX5 A;  2XPV A;  2V7F A;  3TMO A;  2IGO A;  2GWR A;  5CVV A;  4UY8 I;  2KRH A;  3LSJ A;  2KRC A;  2NS8 A;  2VT3 A;  4IHT A;  1TT0 A;  2Q8K A;  4RLQ A;  4E70 A;  4CYD A;  1ACI A;  2DT5 A;  3MN2 A;  3CD6 I;  1LDK B;  1YIO A;  2JPB A;  4R79 A;  2XAG A;  2M45 A;  2KZV A;  4M6X A;  3S14 J;  2W57 A;  3OYI A;  4P55 A;  3HBL A;  4EJU A;  3CJR B;  1ETV A;  2LBF B;  5K5Q A;  4NBQ A;  2ZFW A;  2HTJ A;  3TKY A;  1YG2 A;  1KON A;  2CU7 A;  4BHC A;  4JX5 A;  3TO9 A;  2R7O A;  2R5Z A;  1OCC H;  4HLX A;  3QYB A;  4OAY A;  1I1G A;  1S7E A;  5F04 A;  3MWM A;  2O8K A;  1KQ9 A;  1J7K A;  1IXR C;  4CYC B;  4IOC F;  1IXC A;  1BJZ A;  1YLF A;  4BQQ A;  4IQJ A;  1SD6 A;  3K4C A;  1IN5 A;  1H9T A;  1SC7 A;  3GFJ A;  3LSH A;  1Z7L A;  3GTL J;  2ICW G;  3EDP A;  4WF2 A;  2M0M A;  4B8X A;  2GZW A;  3O3K A;  1CF7 A;  3LQQ A;  2VQG A;  4H4K C;  5DCM B;  1G2H A;  2AO9 A;  4A3M J;  3ZQF A;  4G6Q A;  3ZN1 A;  3H3Z A;  2BVL A;  1LE8 B;  2HOS A;  1HKT A;  2VAS A;  3FMS A;  2XAQ A;  3OL4 A;  4IHV A;  1XB4 A;  1QZE A;  4EMS A;  5DD4 A;  4NHJ A;  4UVC A;  3QYF A;  1EA3 A;  1S29 A;  4NB5 A;  2NOG A;  2RGV A;  4E7J A;  4BU2 A;  2VPL A;  1WH7 A;  5FKK A;  5IOY A;  3CQZ J;  2DA5 A;  3FIW A;  3DPL C;  2HXI A;  2KFD A;  2K3P A;  2F5V A;  2COM A;  4OU0 A;  5HLH A;  2H6C A;  1C0W A;  3BTJ A;  3HJE A;  5DDG A;  2L9R A;  1JUM A;  3E97 A;  4S05 A;  3DEU A;  3ZGK A;  4OIQ F;  1EH6 A;  1JT6 A;  5E79 C;  2A61 A;  2XSD C;  1TNS A;  3MZ8 A;  1UG2 A;  3H0G J;  2IAI A;  2W85 A;  1X1C A;  4W1U A;  4CCN A;  4B43 A;  2RAE A;  2JZY A;  2WAF A;  2FRH A;  2M30 A;  3RDI A;  3JW4 A;  3ABM H;  1A6I A;  2AXT C;  4ZYE A;  5B1A H;  1JUS A;  3A0B C;  3BR2 A;  3IUO A;  5FFX A;  2LK2 A;  2K3F A;  3FXM A;  1F1Z A;  5DEQ A;  3HOU J;  1KYZ A;  4XBF A;  2RQP A;  2OTJ I;  4IL6 C;  2ZXH A;  5CKT A;  3RJP A;  4M74 A;  3LA7 A;  2M3A A;  1U3E M;  2F48 A;  3ZXS A;  3QRF F;  3IKV A;  3REO A;  3JRH A;  3O2P E;  2CQX A;  2IA0 A;  4G7O F;  2DOE A;  2HNH A;  4Z6Y A;  3J81 Z;  1W5T A;  3T8T A;  3L00 A;  1IGN A;  1IN6 A;  2VB6 A;  1BW6 A;  3E5X A;  3MKY B;  4XR6 A;  2G9W A;  1U6G A;  1XDS A;  3CUQ A;  4CIC A;  1OCR H;  2A05 A;  2DLL A;  2M34 A;  2FEZ A;  5FLX K;  3D5R C;  1V5F A;  5CQE A;  2CRG A;  5LGT A;  3G4S I;  1RUO A;  3VYU B;  2HZD A;  4UNO A;  4WK8 F;  4IRH A;  2ZNZ A;  5FRN A;  3CUQ C;  1MDM A;  4HF0 A;  4PJJ A;  1H8A C;  1R5I D;  4L9T A;  3VEP A;  1LVK A;  1A04 A;  3CC4 I;  2R7D A;  2ZXI A;  3HGY A;  2V1D A;  1ZEL A;  1SFO J;  1B6A A;  3M7G A;  1MIJ A;  2PG4 A;  3JRE A;  2HWV A;  3BG5 A;  3LAP A;  3QU6 A;  2W84 A;  1X1B A;  1AU7 A;  1KU2 A;  1EH8 A;  2GM4 A;  4UVA A;  3ZQQ A;  2VJ4 A;  3VSK A;  3G6E I;  1N78 A;  1U9N A;  5KCM A;  2C6Y A;  4HA8 A;  3RTR A;  3TW7 A;  2XGD A;  1T38 A;  3ULQ B;  1Y56 A;  2CSO A;  3QPT A;  2M8G X;  4HX4 A;  5FGM A;  3E6C C;  4OIO F;  4RGX A;  1D3Y A;  1PP8 F;  3ASO H;  5J1R A;  1GVD A;  2E1M C;  1O3Q A;  2R7S A;  1AHD P;  3J7Y J;  4LLN A;  1OCP A;  4HNV A;  4RM3 A;  1FZP B;  4MQ9 F;  2JVH A;  1Z1D A;  4XN0 A;  3DV8 A;  5IT3 A;  4CHU A;  1N25 A;  2QQ9 A;  2IS2 A;  1UFM A;  2TCT A;  2LOO A;  5H6Q A;  3BJO A;  2MC3 A;  3MQ0 A;  1W0T A;  3H9J A;  1R5G A;  4LIT A;  1YW7 A;  3WU0 A;  3SJM A;  2K86 A;  4JX4 A;  3KZI C;  2L9S A;  3U21 A;  4RGU A;  4KIF A;  3CJQ B;  2DMU A;  2MLG A;  4EVI A;  1S3J A;  4HQM A;  3DPT A;  3M8E A;  4D1Q A;  3CCM I;  2HYF A;  1D1A A;  1YW8 A;  4X0G A;  3H0D A;  3JTH A;  4BE0 A;  2KQR A;  4YEJ A;  1S7O A;  1QA6 A;  3GTG J;  2YX7 A;  1BI2 A;  2ZO4 A;  4G6D A;  1CGP A;  1H9G A;  4OIP F;  3FK6 A;  3WHB A;  3M1E A;  3FMQ A;  4F91 B;  2DA3 A;  5HNH A;  1HLV A;  2VC1 A;  1QNT A;  4BH9 A;  3BP8 A;  4ENN A;  2ZB9 A;  3LL7 A;  5EJC A;  2Z9O A;  3V7C A;  4XN3 A;  4BEH B;  4XK4 A;  5TIS C;  1B1B A;  1SAX A;  1XCV A;  3HG9 A;  3QAH A;  3VOD A;  4BHP A;  3J7Z I;  3BWG A;  1KQ8 A;  3IC7 A;  5FD5 A;  4CZC A;  1JT0 A;  1N75 A;  3FM5 A;  1P7I A;  4HNT A;  3PSI A;  2E2H J;  1DGW Y;  4HST A;  4Y7N J;  3I0T A;  1FY7 A;  1X3U A;  4MQV A;  3CMY A;  2M0C A;  2LKX A;  3CDI A;  4Y52 J;  4BJ5 C;  2XKP A;  3H36 A;  4F7Z A;  1I39 A;  1UST A;  3HM5 A;  4PGG A;  3S32 A;  1HW1 A;  2CUE A;  4IHW A;  3KE2 A;  2NVQ J;  3CO6 C;  3OL3 A;  3TED A;  4XNF A;  1J09 A;  2DA4 A;  4GRI A;  1W0U A;  2QM3 A;  1NG6 A;  2OTL I;  2F5D A;  2VKH A;  1FYM A;  3S3O A;  3I71 A;  1MGT A;  4KIT B;  2H27 A;  3HEF A;  2KIF A;  2LD5 A;  3PFI A;  5L3E A;  4BQA A;  4PJ0 C;  1BI3 A;  2EQR A;  3ISP A;  3P9C A;  5M3M J;  2DXI A;  2ZME B;  1R4M B;  1WJB A;  2NYX A;  3ZMD A;  4DYR A;  5LBQ A;  4A3L J;  1V5E A;  3WGG A;  4DIQ A;  3MZY A;  1BIA A;  3RYP A;  3WE3 A;  3BQY A;  3JAM Z;  1FBU A;  3ZR8 X;  4CO8 A;  1T98 A;  1W5S A;  5J8F A;  4BE1 A;  4ZDP A;  3F9K A;  4HZF A;  5E17 F;  2KRF A;  4EM1 A;  2OV7 A;  4FX4 A;  1Z3Y A;  5EG0 A;  1MND A;  2Q2E A;  3ECO A;  1XD7 A;  2ID3 A;  1ZLJ A;  3S2D J;  1LEB A;  3MZH A;  2NOJ B;  3R4K A;  5H2F C;  3CES A;  4X6A J;  1FIP A;  2IGK A;  4JBA A;  1WHU A;  2DK8 A;  4I0B A;  2K27 A;  2ZJP F;  2DDA A;  4I6Z A;  5LEK A;  3HKZ N;  2CG4 A;  2X85 A;  1ON1 A;  4P5O A;  4CA0 A;  2VUM J;  4LG0 A;  3EET A;  1XSV A;  4DYC A;  2MFZ A;  2KIM A;  2R7X A;  4A12 A;  3BJA A;  3ABL H;  3CME I;  3LSR A;  4KIS A;  1WI9 A;  2ESH A;  4EQQ A;  1IJW C;  3GYH X;  2IPQ X;  3E5U A;  4CCO A;  3WG9 A;  5KNL A;  3JSO A;  4PUS A;  1TWF J;  3SZT A;  1QGP A;  3E3V A;  4XLA A;  1MZB A;  1WWX A;  3ZMS A;  1VQN I;  5LLQ A;  2VQH A;  3W6V A;  5L3D A;  2AXL A;  3ABT A;  2G7U A;  4OIR F;  1SD7 A;  3IV5 A;  4YFX F;  4D7N A;  1YTY A;  2LYC A;  4RA2 A;  4R8H A;  2R7Q A;  4X1E A;  3PJR A;  3I59 A;  5J4Y A;  3F8F A;  3F6O A;  4RB1 A;  2YSR A;  4XIC A;  1JGS A;  2M1B A;  3BR6 A;  2WC2 A;  3PUF A;  1MBH A;  2H1K A;  3HXL A;  2LP0 A;  3OR1 C;  4RAZ A;  2E5Z A;  2A6H F;  3F8B A;  3K4M A;  1ZLK A;  3J81 K;  4HDU A;  3I4P A;  2V4J C;  1Y0U A;  2O3F A;  4LG3 A;  3VYT B;  2P6T A;  2DT6 A;  4RM2 A;  1RI7 A;  2FNA A;  2J5O A;  2LRE A;  2OUM A;  3DXJ F;  4Y15 A;  2VBW A;  3RIR A;  2B9S A;  1XMX A;  3BJ6 A;  5ICC A;  1RZ4 A;  2JRM A;  2QSH X;  2R5Y B;  2B63 J;  1W7P D;  3DLA A;  3GTJ J;  1Z67 A;  3M07 A;  3JRC A;  3W2A A;  3K0L A;  1IAW A;  2RKH A;  1NTC A;  5K5O A;  2LC2 A;  1ZRF A;  1VFC A;  2YU9 J;  1YYV A;  2F4I A;  4O3M A;  2KT0 A;  3EUH A;  1WSU A;  5EZH A;  2IJL A;  3MFK A;  2Y69 H;  4NNJ A;  1XMA A;  5FJ8 J;  1RUN A;  2EZH A;  3RKX A;  3EUH C;  2EPF A;  3L2R A;  2CW7 A;  2NVU B;  3DP7 A;  4BYY A;  4KT6 A;  2DA1 A;  1ZK8 A;  4CYC A;  1EJ9 A;  2WAQ N;  1MSE C;  4UUT A;  1QZZ A;  3D5L A;  5DM7 F;  4NQW B;  4JX6 A;  3BTL A;  3WTX C;  6PAX A;  4BY7 J;  4D9J A;  4UUS B;  5B1B H;  1YE9 A;  2PMZ A;  5GPA A;  3GW2 A;  2IP2 A;  3GFI A;  2OA4 A;  5DCM A;  2EIK H;  2CUJ A;  1ON2 A;  3K1P A;  3CCQ I;  2M5W A;  1O57 A;  2RN7 A;  4L5J A;  3TP0 A;  5EGO B;  3N4M A;  5JR3 A;  1YW9 A;  4GGG A;  4YFN F;  4YEL A;  2XUB A;  3WTS C;  4Q5S F;  2HEO A;  1J9I A;  2L4M A;  1Y8R B;  3L1P A;  3LSM A;  3H1C A;  3WU2 C;  3IRQ A;  1VI0 A;  4CXF A;  3X2Q H;  3KPH A;  5FKM A;  4BS9 A;  2ZSH B;  4CUG A;  5HS8 A;  2ECB A;  2FOW A;  3JR9 A;  3ZRG A;  1XCB A;  3KP6 A;  3K70 D;  1JKQ C;  3JRF A;  5DM6 F;  1BM9 A;  2E71 A;  5LHI A;  2DT7 B;  5J4V A;  1NK3 P;  3HGG A;  3OIO A;  3WOD F;  1UHS A;  2O61 A;  2EB7 A;  1UHW A;  3FXR A;  4Y13 A;  3R0A A;  2JUG A;  3BTC A;  3GLX A;  4IOA F;  3CCR I;  4AVZ A;  3GX4 X;  3GLL A;  1JGG A;  3Q9V A;  2L7M P;  3T5X A;  2JA8 J;  3OYG A;  3A2K A;  1SMT A;  1IDY A;  2H09 A;  4C2T A;  3G2B A;  3KCC A;  3Q0V A;  3ZQL A;  1K83 J;  4XSZ F;  1K7A A;  2EV5 A;  1IV6 A;  4W97 A;  2P7C B;  2JUC A;  2QCO A;  3RZO J;  1R36 A;  1ERD A;  1I1S A;  4FHT A;  2Y2Z A;  2BYV E;  2AQE A;  4LB5 A;  3GXO A;  2LKP A;  4A3G J;  2V1X A;  2OAZ A;  1SFU A;  1JTX A;  1GLN A;  4DOZ A;  3LSP A;  5FD6 A;  3BOQ A;  1WGX A;  2XAH A;  2ME6 A;  2M87 A;  2Y0S N;  2WAQ A;  1Z6T A;  3FDY A;  5J1Y A;  2XIG A;  5LHG A;  4IVN A;  3GBG A;  3O8H A;  2A3S A;  1Y0N A;  4A5M A;  1X1P A;  2HQN A;  3SZG A;  3VYR B;  2HDW A;  1OCZ H;  1TWG J;  3L2Q A;  1BI0 A;  4KN4 X;  4BXX J;  4Y17 A;  2XC7 A;  1D0Y A;  2A6E F;  3BR5 A;  5DUI A;  1ODD A;  2LTP A;  5LD2 C;  3ZMT A;  3WE2 A;  3I4N J;  1R1V A;  1PUF B;  3G71 I;  4AU7 A;  2EH3 A;  4HG2 A;  1BBY A;  3CCS I;  3FMR A;  3BG6 A;  1X4P A;  4FT8 A;  1U5T B;  3HHG A;  5L3G A;  3K4N A;  4PJM A;  3FWE A;  4UB6 C;  3JSP A;  1R7J A;  5EEH A;  1BC8 C;  1RIO H;  2IA2 A;  3KYD B;  4N9I A;  1Z05 A;  3H92 A;  2AQF A;  4A3I J;  1Y1W J;  3OY9 A;  3SDG A;  3L9F A;  3HDD A;  2VKE A;  3H5A A;  2L7K A;  3M8F A;  2X9D A;  1WJE A;  1XSD A;  1XGS A;  4YG2 F;  1PUE E;  4I7H A;  3BG7 A;  3LFK A;  5ILU A;  3CMA I;  3MKZ A;  4UHT A;  5CVJ A;  2QYO A;  1IRX A;  5EDN A;  5CQG A;  1SFE A;  2LKS A;  4BXU A;  3IKT A;  2K40 A;  1LB2 A;  3ZP5 A;  2NVY J;  1K6O A;  2M7B A;  3LQR A;  2HDD A;  1D5Y A;  1MMS A;  3OIQ A;  3CUO A;  3CJN A;  4LIU A;  4XL9 A;  4AM3 A;  1QRY A;  1ZTR A;  1UHM A;  4U88 A;  2V6C A;  4DYQ A;  4RGS A;  5IP6 A;  1MH3 A;  2W48 A;  2G7H A;  4E7L A;  2CGP A;  3LAJ A;  3PIO F;  2A69 F;  4P9F A;  2WB1 N;  3EQL F;  3S1Q J;  1A6Q A;  1PDN C;  1P92 A;  2KIQ A;  3ROU A;  2DOF A;  5BOX A;  1O7L A;  3HOT A;  2R93 J;  4OMY A;  2XGX A;  1BA5 A;  4L18 B;  4CGZ A;  3Q0W A;  2ZCW A;  4KNY A;  5DCF A;  3QOE A;  4O6J A;  4LB6 B;  4IZZ A;  3HB9 A;  2EZL A;  3FXQ A;  4HX7 A;  2H94 A;  3MEX A;  4GYI A;  1RES A;  2O6G E;  3FXL A;  3A1Y A;  1S5L C;  3CC7 I;  1Z9C A;  3H9Q A;  1HOM A;  1VQ5 I;  3C7J A;  2KJC A;  5CVR A;  1ZG3 A;  4RB3 C;  3AG4 H;  4BEH A;  3S2W A;  4UUV A;  2JSP A;  4A3D J;  2ZJR F;  3SZP A;  2I8D A;  2XSJ C;  1X1D A;  5KK1 A;  2HDC A;  5ILV A;  1FBS A;  2XPU A;  4C3H J;  2DO7 A;  2W7N A;  2IS4 A;  1E17 A;  2XB0 X;  3PIP F;  2QBY B;  1ZYR F;  3BZK A;  1P4W A;  1FP2 A;  2ESN A;  5F27 A;  3EYI A;  2L9N A;  4DQ2 A;  1MSF C;  3GWZ A;  3HPG A;  3NWT A;  1ULY A;  4YII A;  1WI3 A;  4AIH A;  3ABK H;  1IF1 A;  2X6X A;  2VT2 A;  3L09 A;  1RKT A;  5FRO A;  4MEY F;  2HGC A;  3FIS A;  3PFY A;  3OYC A;  1VQ8 I;  1OJL A;  4OOI A;  1ETQ A;  2R7Z J;  1JXS A;  4F52 A;  1ORK A;  2DOA A;  1F9N A;  2GQQ A;  2KLO A;  1IC8 A;  4BBS J;  2FF4 A;  2RQQ A;  1RRJ A;  2HR3 A;  5EF6 A;  4HX8 A;  5M5Y J;  2RDP A;  2DA2 A;  4I0A A;  5ILS A;  5KHD A;  2LRD A;  2Y9Y A;  1SFK A;  2ZME A;  3FXK A;  2Z5U A;  1EF4 A;  1E2X A;  2OQR A;  5F64 A;  4HAM A;  4XKB A;  1TW3 A;  2EIN H;  2XB5 A;  3I54 A;  2ZME C;  2LDU A;  4E7H A;  1J2X A;  2VJJ A;  2WB1 A;  2BEO A;  3S1R J;  2FX0 A;  3CLQ A;  3ERE D;  3EPZ A;  3RSN A;  1I50 J;  1X1A A;  1W36 D;  1WJ5 A;  3ASN H;  5DV5 A;  1WQ2 A;  1Z0X A;  1R1U A;  3QPL A;  5D4R A;  4G7H F;  4KA4 A;  3CJT B;  2JVG A;  2KIS A;  1QPM A;  3IWZ A;  3GTQ J;  4DGW B;  4AYB A;  5HDG A;  3R61 A;  4BAY A;  2EFN A;  3E5Q A;  1EKE A;  2Y30 A;  2XF5 A;  3K10 A;  2DQR A;  3C3W A;  2JK3 A;  2O03 A;  2EJR A;  3BR0 A;  2V79 A;  3RKY A;  3D0S A;  4PZJ A;  3O8G A;  3OYA A;  5L3B A;  4ANJ A;  4HSR A;  4MIM A;  3CC2 I;  1X4O A;  1VQ9 I;  4RGR A;  3WGI A;  2FBH A;  3GVA A;  1QHG A;  2QQA A;  4E7I A;  2DK5 A;  2ELJ A;  3CDL A;  1ZH5 A;  3VDX A;  4IHY A;  3F72 A;  5K7F A;  5JVT A;  1P4A A;  4AVP A;  2AHQ A;  1IRF A;  1G8X A;  1W7P B;  2I10 A;  4HV6 A;  3L2W A;  3IWF A;  1QHH D;  4L9N A;  1E0E A;  5EEG A;  3P9K A;  1AA7 A;  3ZMV A;  5C4J J;  1O4X A;  3HZJ A;  4WX9 A;  3BPV A;  3RKW A;  4KIG A;  1ZAR A;  2EIJ H;  4LJZ F;  2EZK A;  1GUU A;  1NG7 A;  3E0J B;  3FBI B;  4RAG A;  4ESJ A;  2X6W A;  5A2Q K;  2DN0 A;  2K5C A;  3HRS A;  3JRB A;  4M3F A;  1ZR2 A;  2IT0 A;  2W82 A;  1S6L A;  2XV4 S;  2R5Y A;  4A3E J;  4MEX F;  4JP0 A;  2OC6 A;  2IGM A;  4EJW A;  2V26 A;  1RPW A;  2M9H A;  3IH3 A;  3VYS B;  4WCG A;  2QUF A;  4LLL A;  1QVT A;  2ZXW H;  3LSG A;  2FOK A;  2HU9 A;  2EA4 A;  3DEW A;  4PCQ A;  2KDZ A;  1XG1 A;  3S8P A;  2MH2 A;  1DUX C;  5EEA A;  1ZR4 A;  4CCJ A;  1GT0 C;  1F5T A;  4KDP A;  2CWE A;  4L0Y B;  3HOY J;  1DGR M;  3TW6 A;  5AON A;  1BR1 A;  2OQG A;  3QP5 A;  5TGT A;  1ZGW A;  2HVQ A;  2WTE A;  4IQ4 A;  1KYW A;  4XLF A;  3TP3 A;  2GOX B;  2PFB A;  1B4A A;  1P4X A;  3NWS A;  3IAM 2;  1B9N A;  4PGH A;  1T6S A;  3WTY C;  1J0R A;  1RKW A;  3RZD J;  3K6G A;  4B48 A;  4YIR X;  1IO2 A;  2HZT A;  4UUS A;  3V8J A;  2ID6 A;  5FKN A;  2R0Q C;  1GHC A;  4HEA 2;  2L0K A;  3PNY A;  5HOD A;  1VF9 A;  2W4S A;  4UVB A;  1MMA A;  1USS A;  2WAE A;  1OIS A;  5EGO A;  3WTV C;  4U7B A;  4QPO A;  5AIQ A;  1R5H A;  4E6K G;  2LG4 A;  1R4N B;  3S2H J;  5F0F A;  2DW4 A;  2NS7 A;  4AIK A;  1YOV B;  2XVC A;  3KLN A;  2GBY A;  1VQK I;  5E20 A;  4LD5 A;  4KYW A;  1QZY A;  1XPX A;  3HRU A;  2HXO A;  4AUX A;  2O5R A;  3CF5 F;  1SEU A;  1MJB A;  1JKP C;  4LFU A;  4HV5 A;  3S16 J;  4B1R A;  2K9M A;  4GYG A;  3G1M A;  3BT9 A;  2BY3 A;  1G4D A;  2DFH A;  4F55 A;  4XKW A;  3J80 Z;  1L3L A;  1T2K A;  1XC5 A;  4Q4Z F;  3ERM A;  2L01 A;  1G6N A;  1ZG5 A;  1TQI A;  4PJL A;  2IGN A;  4RS8 A;  5C3E J;  4XLH A;  5BNG A;  2F2E A;  2WAD A;  3FXU A;  3WU1 B;  3OMY A;  2L7F P;  2I5U A;  4E7Z A;  3E6D A;  2CJJ A;  1YRN B;  2HOT A;  3LWF A;  1YQA A;  1KA8 A;  2ELK A;  2CUF A;  1REP C;  1HA8 A;  5H20 A;  4RAF A;  1XTA A;  2A5W A;  4M3B A;  2L4A A;  1HKS A;  2UUZ A;  4K2E A;  3CLO A;  3OYL A;  4RMN A;  1I27 A;  5J1U A;  3W6J B;  3HSE A;  4MFE A;  1VQ4 I;  2R4G A;  4M3E A;  1IRG A;  1RET A;  4HF2 A;  5D4S A;  1RNL A;  3MKL A;  5F6F A;  3HRM A;  3OYF A;  5LRR A;  4XKV A;  1R49 A;  1B8I B;  3KET A;  1DP3 A;  4KMF A;  4BBR J;  4M72 A;  1U5T A;  3OYM A;  3DTK A;  4OIN F;  3ECH A;  3WG7 H;  3K69 A;  1VQ6 I;  5E3N A;  1U5T C;  3S17 J;  1MJ9 A;  1LPQ A;  2YUS A;  3RPQ A;  4FCY A;  2VON A;  4AWX B;  2IRF G;  2XAF A;  3AL0 B;  3HHH A;  2GXG A;  4BDZ A;  1PVE A;  3I9V 2;  3G3Z A;  5F0H A;  3GTP J;  4I98 B;  3WTU C;  4XLN F;  1TP4 A;  1P7J A;  3LMM A;  4ITV A;  2HI3 A;  3HRT A;  2LY2 A;  2RNG A;  2DFF A;  3SYT A;  2CYY A;  4CCL A;  3OS2 A;  5J3L A;  2VKD A;  1FEX A;  2ZJQ F;  2DTR A;  4I76 A;  4IXA A;  4II2 A;  5D8L B;  5D6E A;  4G94 A;  3RQI A;  4S04 A;  4RB0 A;  1LJ9 A;  3IAS 2;  2F4O B;  2OU2 A;  3KP5 A;  3M8J A;  5JLW A;  1HSJ A;  4G12 A;  4IHS A;  1R9T J;  1SVM A;  1V55 H;  3HL2 A;  3RPU A;  2FBI A;  1BR4 A;  4U87 A;  2CW8 A;  3TGN A;  3KEO A;  4HDV A;  2F5E A;  1XGM A;  2CV1 A;  3RCO A;  2PMZ N;  4BUP A;  2HVR A;  4HF1 A;  2EFP A;  5H6R A;  2IEK A;  1ZN2 A;  5D5V B;  2IS1 A;  4CZZ A;  4A3F J;  3CO7 C;  1UMQ A;  4P9U A;  1SAN A;  2FQ3 A;  1OMI A;  3QWL A;  2MBF A;  4BGD A;  3TQN A;  1TQP A;  1I3Q J;  2VI6 A;  3KZZ A;  2H8W A;  4KMU X;  2QZ8 A;  2WY8 Q;  5D6F A;  1IUY A;  4B44 A;  3A02 A;  2GIV A;  1T33 A;  4U0Y A;  3A01 A;  5K7Z A;  2CQQ A;  4A0X A;  1MD0 A;  5IPA A;  5J47 A;  4ENJ A;  4OMZ A;  2FQ4 A;  3OYE A;  2CFO A;  4ZYH A;  3IHU A;  3VB2 A;  1TWA J;  2XHK A;  2QBY A;  2EZI A;  5AIP A;  1ONV A;  4ZTF A;  3BG9 A;  4GCV A;  3FXJ A;  3CCL I;  5ICG A;  1H0M A;  1AKH B;  4BE2 A;  3NAU A;  3J7A Y;  3CTA A;  2VOD A;  1IW7 F;  3K4J A;  2ELH A;  2CO5 A;  4XOT A;  5CVU A;  1OCT C;  1K61 A;  2A07 F;  2NS0 A;  1JHF A;  2E2J J;  2IA1 A;  2K4B A;  1OPC A;  2QKM B;  5L3F A;  2DMT A;  2FBK A;  2CFX A;  2BHZ A;  1YS7 A;  4Z2Y A;  2LBF A;  2VBZ A;  2X0L A;  3W3C A;  3OYJ A;  2P5L C;  4EM2 A;  3PQK A;  3H3U A;  2WV1 A;  1XN7 A;  2UXX A;  1MBE A;  4DZP A;  5HLT A;  1WJA A;  1FSE A;  1ETY A;  2XRL A;  5GAG J;  3GFM A;  5BS6 A;  1YJ9 I;  1QBJ A;  2Y0M A;  3BCB A;  5ICE A;  2DMP A;  2K7L A;  1A31 A;  4ZJZ A;  5GTI C;  2W00 A;  1T0F A;  3NEU A;  2DOD A;  5E8I A;  1OKR A;  1LNW A;  4HQE A;  1TWC J;  2ZBK A;  3CCE I;  1I3A A;  3S15 J;  5J6X A;  1BW5 A;  3L2V A;  1LFU P;  2P8T A;  2R7T A;  1T0F C;  4A3B J;  4DBQ A;  3H9G A;  4I02 A;  4ESB A;  2JQ7 A;  2VXZ A;  1G3W A;  5K1Y A;  2Y75 A;  5KAF C;  2DMN A;  2MD5 A;  3I3L A;  4RLF A;  4EEF G;  3LST A;  2DPD A;  2EK5 A;  2LSO A;  2NRA C;  2GA2 A;  4PDK A;  1LE8 A;  2G0E A;  1KU3 A;  1R22 A;  1U2W A;  3KZY A;  3TDU C;  4IRG A;  5BQT A;  2HOA A;  4ZYG A;  4XLP F;  1NHA A;  1LUJ B;  2M7A A;  3MD2 A;  2X6Y A;  1S7A A;  4L5E A;  2EFW A;  1Z77 A;  2BXY A;  4UXN A;  1FC3 A;  4A5N A;  1DDN A;  1VQ7 I;  1R23 A;  3HYI A;  2CH0 A;  1Y1V J;  2D5V A;  1FMW A;  3FZV A;  4F3Q A;  3I55 I;  3C2G A;  5FKO A;  1MMN A;  3IP4 B;  2PEX A;  5B3S H;  1XGO A;  4Q47 A;  3BC8 A;  2DDB A;  1R00 A;  2P5V A;  1APL C;  4NDL A;  1MJA A;  2BVM A;  3F8C A;  2BE5 F;  4KFC A;  2R7W A;  4XOR A;  1FT9 A;  4I99 C;  2MW8 A;  2CMP A;  3N05 A;  1OCO H;  3ELK A;  2Z16 A;  2FJ1 A;  1JJ6 C;  3SHF A;  4YFK F;  5IY5 H;  1R1T A;  2P0W A;  3BTI A;  3GCM A;  5IP9 J;  2JA6 J;  4M9X A;  4IRI A;  2JPC A;  3OYN A;  4F93 B;  4RAY A;  1WJD A;  2DYR H;  3ZQC A;  4ESF A;  2CV2 A;  2LR8 A;  1B72 B;  5M5W J;  2ZSI B;  1GV2 A;  4MHG A;  2BV6 A;  3U2R A;  1FBQ A;  1Y8Q B;  3PNT A;  3KP7 A;  4AIJ A;  1VQP I;  3H3V K;  3S1N J;  2E1O A;  2UZK A;  4XOP A;  3G1O A;  3HOZ J;  3DTE A;  4IHX A;  5LRS A;  3W2V A;  2VLA A;  5C4X J;  2KIU A;  1BIB A;  3I4M J;  4IO9 F;  2W1O A;  4R1H A;  1OLT A;  4KIC A;  3JRI A;  2K9Q A;  1UCR A;  3JCU C;  2HFH A;  3OSG A;  2MG4 A;  4HW0 A;  1J59 A;  5HNF A;  4NC7 A;  4RBO A;  1HBX G;  3H5R A;  3HOS A;  1ZRE A;  5F1R A;  2DYS H;  4IKF A;  3KYC B;  3KFW X;  3JRD A;  3M9A A;  3N97 A;  5C44 J;  2JRT A;  4M6V A;  2MD0 A;  2OZU A;  2QEN A;  3U1K A;  2EFO A;  5M3F J;  3PO2 J;  2XF7 A;  3VFZ A;  4A6D A;  4MTE A;  5F08 A;  4C2U A;  1QQI A;  5JHU A;  2LNB A;  3JAM K;  4C30 A;  2EIL H;  2UXN A;  3OSF A;  2WA0 A;  2LY9 A;  1KGS A;  3DF8 A;  5DS9 A;  2KJB A;  1SD5 A;  3R6S A;  3C18 A;  2X1C A;  4HLY A;  2HQR A;  1EV7 A;  2JMW A;  1WZ2 A;  3JRA A;  2DTZ A;  5FLX Z;  1YO5 C;  4XRS A;  3OOU A;  1OYI A;  4XID A;  3JTG A;  5E3M A;  1X3W B;  3MKW B;  3C2H A;  1A35 A;  1K6Y A;  1OR7 C;  2HQA A;  3KP3 A;  4BQO A;  3Q5F A;  4BKX A;  5DUK A;  4C3I J;  3KYL A;  5FLV A;  4B3A A;  4M9S A;  1T8I A;  4XQF A;  3SEZ A;  3OWT A;  1FTZ A;  2BY2 A;  3Q3S A;  5GAH J;  3GUD A;  4AC0 A;  1AWC A;  3AKZ A;  2JA2 A;  4YIF A;  2AS5 F;  2PMH A;  4N4O B;  3BR1 A;  3HSR A;  1JI8 A;  3FKJ A;  3AAF A;  3RI4 A;  3R60 A;  3GFL A;  2X1E A;  4P1W A;  3CCV I;  4MGR A;  1P6R A;  2EA2 A;  2Q2E B;  2MA3 A;  2QKL B;  3LSI A;  5D8K B;  2EFQ A;  4AD9 A;  4WXD A;  1KZH A;  3V7R A;  3K4K A;  1ETO A;  3GF2 A;  3FXO A;  3FX3 A;  4PFP A;  4AYB N;  1AOY A;  2Y48 A;  2ME0 A;  3L7W A;  4HBL A;  5F1J A;  2D45 A;  3B6C A;  5HS7 A;  1FOW A;  1S8N A;  3SXY A;  1FNN A;  2UWM A;  2RC4 A;  3K4L A;  1FMV A;  4BL0 B;  2FNP A;  4P96 A;  2KDO A;  5CYV A;  2NAZ A;  2JTV A;  2DU9 A;  4HRI A;  1LFP A;  1P9Q C;  1LVA A;  4U0W A;  4D5F A;  3TOA A;  5M5X J;  1WH5 A;  1Z21 A;  4MO7 A;  5LFA A;  1U78 A;  5E3O A;  1S9H A;  1A36 A;  1GXQ A;  3F22 A;  3D5S C;  2WWY A;  3M1C A;  2P6S A;  1D0Z A;  3SFZ A;  3BQZ A;  3MAJ A;  2PJR B;  3UR3 C;  4HPQ A;  2Z2S B;  3BZC A;  2DFI A;  2FML A;  3QU3 A;  4A3J J;  1JKO C;  5JVG F;  4XRF A;  5TRD A;  4N0B A;  3OYD A;  2CV0 A;  2VJ5 A;  4WXH A;  2MGQ A;  3GZ6 A;  1D1C A;  2VE9 A;  2CS3 A;  2QA4 I;  4FX0 A;  1K79 A;  3ZPL A;  3ZCO A;  1J5Y A;  2HPM A;  1DPU A;  3KX2 A;  4HOB A;  2CUZ A;  1Y39 A;  1LKX A;  2BGC A;  2RNJ A;  3QQA A;  4O5V A;  2QSG X;  4CDG A;  2DQL A;  1H88 C;  3IL2 A;  3DKX A;  3V8L A;  2VN2 A;  2DJI A;  3ZQG A;  3VPR A;  2LY1 A;  2XGC A;  3BPX A;  3O6B B;  1K78 B;  1YJN I;  4BNC A;  3Q0U A;  3UKG A;  3AL0 C;  5ERI A;  1NK2 P;  1YIJ I;  2RVC A;  1H89 C;  1JTY A;  1MBJ A;  2KL4 A;  1XS9 A;  4NC8 A;  4YRV A;  2ACJ A;  1M1E B;  4ZYA A;  3ZOB A;  4FE7 A;  3OS1 A;  4E4H A;  5EZG A;  4CCK A;  4FTH A;  1FYL A;  3ZQH A;  1MBG A;  4F92 B;  2ADU A;  3OV8 A;  1IXS B;  9ANT A;  3LA2 A;  2ZFU A;  2WY7 Q;  3I64 A;  1U8B A;  2FD5 A;  2P81 A;  2HYJ A;  2EBI A;  3MVP A;  3KEQ A;  3I56 I;  4IF4 A;  1ZKG A;  2XAU A;  4XMY A;  1WPK A;  2K9N A;  1ETW A;  1BOA A;  3QYE A;  3NQO A;  2DI3 A;  3ESW B;  2NVT J;  2O9L A;  2COB A;  1UG0 A;  3HTU A;  5BMZ A;  1FSH A;  5KAI C;  4I2O A;  1DU0 A;  2X51 A;  3K9T A;  1POG A;  2CQN A;  1HXD A;  3QPS A;  1YHQ I;  1HKQ A;  1VND A;  3G73 A;  1W5C C;  2NVX J;  3HPH A;  2VL8 A;  3GME A;  4QPQ A;  1PYV A;  2PBI A;  5EYR A;  3F3X A;  5F0C A;  2H1L A;  3HUG B;  2E7W A;  1ZG1 A;  4KJZ A;  1GV5 A;  2QQB A;  1ETK A;  3AG2 H;  5J8C A;  1DU6 A;  3LA3 A;  1GVJ A;  4B47 A;  1WKM A;  2MLK A;  4KN7 X;  4ETS A;  1OYY A;  1YX3 A;  1VZ0 A;  1O3S A;  5TJJ A;  2DA6 A;  3TO7 A;  3DFG A;  2QF7 A;  4MFD A;  2FA5 A;  1KU7 A;  2GAU A;  3F8N A;  1ZGA A;  3TBI A;  1B59 A;  2KZG A;  4B4C A;  1DPR A;  2OBP A;  1AKH A;  2WV0 A;  3V8K A;  3BR3 A;  2VQL A;  2X1D A;  3B73 A;  4A3K J;  2JT1 A;  1FJL A;  1W4M A;  1HF0 A;  3FHN A;  2B7E A;  5DYM A;  4D7M A;  4LGW A;  1GDT A;  3PUB A;  2E1N A;  1ETX A;  1X2M A;  3HTS B;  1G3Y A;  1N77 A;  4E7S A;  3GZN B;  4MNU A;  4EV0 A;  5IP7 J;  2QQ8 A;  3DPU A;  3OYH A;  1VQL I;  5GAE J;  3I5U A;  2Z3Y A;  5CLS A;  2PI0 A;  5K5R A;  2F5F A;  4FIS A;  1W36 C;  2FUG 2;  4WWC A;  4I01 A;  2KKO A;  4DJA A;  4N4N B;  2JJ7 A;  3RYR A;  2ZKZ A;  1J75 A;  4IX7 A;  4ZH4 F;  3LSK A;  1YI2 I;  2O8X A;  2LMD A;  2NNN A;  1UAA A;  4UV9 A;  3CP2 A;  2QGU A;  5FFZ A;  2R7U A;  3IH2 A;  4LIV A;  1LDJ A;  5IOZ A;  5B5E C;  2VOO A;  4NQW A;  5CJ9 A;  1MMG A;  3EUA A;  4M3D A;  4ZZD A;  1RR8 C;  2P4W A;  3JRG A;  2BY0 A;  4XLE A;  3OIP A;  3SDB A;  5IT9 Z;  2R7F A;  2LF7 A;  3VSL A;  3V42 A;  3HSF A;  4BJT A;  4MTD A;  3F0C A;  4JK1 X;  1XMK A;  4BQN A;  5K7H A;  4A2U A;  1ZAO A;  1YIT I;  2KHM A;  1IUF A;  3IRR A;  3BDD A;  1FX7 A;  1W1W E;  2MH9 A;  1STZ A;  5DTD A;  2LH9 A;  1HW2 A;  2F4M B;  2TDX A;  2XKO A;  4A0Z A;  3WTW C;  2VC0 A;  1HDP A;  3DKW A;  4IJA A;  4JOM A;  2VE8 A;  2BW3 B;  4FQG A;  5CPR B;  4ABZ A;  1TC3 C;  3LOC A;  1OFC X;  2IXS A;  2KPM A;  2R3S A;  3GO5 A;  2O7O A;  1Y6I A;  4M71 A;  2STT A;  3TO6 A;  2EIM H;  1WRJ A;  2H6B A;  2OF7 A;  1LQ1 A;  1A5J A;  1RC9 A;  5JLX A;  2PLY A;  1HCR A;  3COA C;  4PJN A;  3ML6 A;  2GXB A;  2M4K A;  4A69 C;  3P5J A;  3VWB A;  2Q1Z B;  3WHC A;  4BJ6 C;  4PSX A;  2QWW A;  3ONQ A;  3OOP A;  1VQO I;  1U8R A;  3S1M J;  3IH4 A;  4RDU A;  2XDV A;  3T8R A;  5DD8 A;  4A6E A;  2D2W A;  2FSW A;  1B72 A;  3TL4 X;  3WGH A;  1O7F A;  4JYK A;  1UB9 A;  4IPA A;  4GXO A;  2MSY A;  3K2A A;  1T39 A;  1D0X A;  2YX4 A;  3GZ5 A;  1V54 H;  4J19 A;  3H5N A;  4EM0 B;  5LEJ A;  1VQM I;  2WBM A;  3TDZ C;  3A4C A;  4M73 A;  2OPT A;  4CSW A;  2XGE A;  3WTT C;  2J5P A;  3CMM A;  3OR2 C;  2F6C A;  2E36 A;  4PFO A;  2K85 A;  1TLH B;  2RV8 A;  3K1M A;  3FK7 A;  1F36 A;  3RPU D;  4EJO A;  2K4J A;  2JA5 J;  4FAS D;  1IDZ A;  1PUF A;  4A0Y A;  3DLL F;  5IYB J;  2Q0O A;  4QSH A;  1QU3 A;  3AG1 H;  5E18 F;  4J01 A;  2Z1D A;  4CH7 A;  1Z6R A;  2N8G A;  1L0O C;  1Z3X A;  4G7Z F;  5KVR A;  2TRT A;  4FE4 A;  1HW5 A;  5GP9 A;  1YJW I;  4N9H A;  2XAJ A;  1X3Z B;  1XGN A;  5CVI A;  1Z91 A;  3I58 A;  4ZTJ A;  2BHY A;  2IW5 A;  3K1N A;  2GXA A;  3QOP A;  3BRO A;  2XRN A;  3D1N I;  2PX9 A;  2VIX A;  2NNY A;  1BI1 A;  1DQU A;  2GIZ A;  3PL8 A;  3SQN A;  2GLO A;  4M3G A;  2FE3 A;  2K02 A;  2X6O A;  1BC7 C;  3PSF A;  1TW2 A;  1ZQ3 P;  2HTS A;  2V1U A;  5D5W B;  3A0H C;  2FXA A;  5B66 C;  4QIW N;  2V9P A;  4EGZ A;  1R71 A;  3DWL E;  2L02 A;  1TL8 A;  3LFU A;  1T08 B;  4DW6 A;  4AID A;  2KP6 A;  1TBX A;  2GOM A;  4M9Z A;  3F8M A;  1NH3 A;  3ZMZ A;  2XAS A;  4NC6 A;  2E19 A;  5GAD J;  1V3F A;  1BOB A;  1F43 A;  3BG3 A;  2CW0 F;  2R5Z B;  4L0Z B;  4BXF A;  3RKQ A;  1YS6 A;  3FM3 A;  4KUM A;  2JN6 A;  4KT5 C;  4L5I A;  4LLG F;  2PQ8 A;  1O3T A;  2YS9 A;  1MKM A;  2E35 A;  1JKR C;  3K7A J;  1X2N A;  1E3H A;  1UZC A;  3T0Y A;  1U9O A;  2JSC A;  4GDF A;  3CCY A;  1PP7 U;  3V7S A;  1QPI A;  3S93 A;  1SVO A; 
#chains in the Genus database with same CATH homology
 1CF7 B;  4Q48 A;  1SD4 A;  2O0Y A;  1QO0 D;  1D8J A;  2DBB A;  4M6Y A;  3ZMU A;  4ON0 A;  1KU9 A;  1OYW A;  2L3D A;  4RB2 C;  2LF8 A;  5ED4 A;  1G3T A;  3J7A O;  4ZZL A;  2ZNY A;  5E1W A;  1D5V A;  3F6V A;  2HS5 A;  2M8E A;  1KQ0 A;  4G8X A;  1YFH A;  3BZ6 A;  4QWQ A;  4BHB A;  5BPI A;  2CQK A;  2Z33 A;  2F5C A;  2A68 F;  1IN7 A;  1HST A;  2A5Y B;  3KP2 A;  2E7X A;  3F23 A;  4ENK A;  4QLC U;  3I53 A;  1IN8 A;  1LDD A;  3ZQ7 A;  1XDU A;  2YR2 A;  3E6B A;  4ZYD A;  1K78 A;  4XSX F;  1TQM A;  3CDH A;  3U9G A;  5IT9 K;  2VBY A;  2ZJ2 A;  1GXP A;  5LGN A;  1FP1 D;  1VTN C;  1BN5 A;  3CUQ B;  1JHH A;  2IVM A;  2D1H A;  1IN4 A;  1IZ1 A;  4L9V A;  3R0J A;  3P7N A;  4U7D A;  1FOK A;  1MDM B;  1G3S A;  5LGU A;  1ZGJ A;  2PN6 A;  2VOP A;  1FLI A;  5HLG A;  4H0E A;  1D8K A;  2ISY A;  3MCZ A;  3B02 A;  1SMY F;  3J80 K;  1EH7 A;  2W25 A;  4WXC A;  4EJV A;  4DNC A;  4I09 A;  3ABU A;  4KIB A;  3QP6 A;  1B9M A;  2B0L A;  2P5K A;  1I6X A;  3Q9S A;  1TTY A;  3HUG A;  1W7P A;  5L3C A;  5HDN A;  2PJP A;  2YU3 A;  1V4R A;  3HIF A;  1FYK A;  5FO5 A;  3ZN0 A;  2XRO A;  2FU4 A;  3QPH A;  5HLI A;  3L2C A;  4TV7 A;  2ZXJ A;  1R58 A;  2P7V B;  2EV0 A;  2W24 A;  1JE8 A;  3TOB A;  2QVO A;  3P9I A;  2V9V A;  3F21 A;  3E6M A;  1F4K A;  1LEA A;  1Z7U A;  2HYG D;  2EWN A;  3KP4 A;  2YPR A;  1Q1H A;  2OD5 A;  3BY6 A;  5LHH A;  5E1X A;  3C1D A;  5A2Q Z;  5D5X B;  3PQJ A;  3VOE A;  1DP7 P;  5D5U B;  5HVQ C;  2STW A;  3WTZ A;  4JQF A;  1FPQ A;  2L54 A;  2PMU A;  2GA1 A;  5BPD A;  4EGY A;  4UV8 A;  1P2F A;  1OR7 A;  2D1V A;  2HOE A;  4ASN A;  4LK0 F;  3K2Z A;  1ZHF A;  3T1B A;  1TNT A;  1HQC A;  1ZRC A;  2DPU A;  2BBY A;  4GO1 A;  2EV6 A;  3KLO A;  3FF5 A;  2X4H A;  3U1D A;  5HDK A;  3GEZ A;  2ETH A;  4LK1 F;  4LMY A;  4G9Y A;  3V4G A;  1SFX A;  2E1C A;  2VBX A;  4D0P A;  2FMY A;  5E8G A;  3FHZ A;  4U0V A;  1I5Z A;  1XSX A;  4ENM A;  4LG0 B;  4L9J A;  2ISZ A;  5E1Z B;  3EYY A;  1ZRD A;  3W6K B;  5HOO A;  1BJA A;  1FWZ A;  2QLZ A;  4EJT A;  5JI6 A;  5JFR A;  4HYE A;  3DQV C;  2HKX A;  1O3R A;  5ICF A;  5HS9 A;  2DAO A;  5FB2 A;  2Z99 A;  3NRV A;  3I59 B;  4B09 A;  2HKO A;  2OZ6 A;  2GWR A;  5CVV A;  2VT3 A;  4IHT A;  2Q8K A;  4E70 A;  4CYD A;  2DT5 A;  1LDK B;  1YIO A;  2JPB A;  4R79 A;  2XAG A;  2M45 A;  4M6X A;  2W57 A;  4P55 A;  4EJU A;  5K5Q A;  2ZFW A;  2HTJ A;  3TKY A;  1YG2 A;  4BHC A;  3TO9 A;  4HLX A;  1I1G A;  3MWM A;  1KQ9 A;  1J7K A;  1IXR C;  1IXC A;  1YLF A;  1SD6 A;  1IN5 A;  1H9T A;  3GFJ A;  3EDP A;  4WF2 A;  4B8X A;  2GZW A;  3O3K A;  1CF7 A;  3LQQ A;  5DCM B;  4G6Q A;  3ZN1 A;  3H3Z A;  1HKT A;  3FMS A;  2XAQ A;  1XB4 A;  4EMS A;  5DD4 A;  4NHJ A;  4UVC A;  1S29 A;  4NB5 A;  2RGV A;  3DPL C;  2COM A;  4OU0 A;  5HLH A;  2H6C A;  1C0W A;  5DDG A;  3E97 A;  4S05 A;  3DEU A;  4OIQ F;  1EH6 A;  2A61 A;  1TNS A;  2W85 A;  2JZY A;  2FRH A;  2M30 A;  3RDI A;  3JW4 A;  4ZYE A;  5FFX A;  1F1Z A;  5DEQ A;  1KYZ A;  4XBF A;  2RQP A;  3RJP A;  4M74 A;  3LA7 A;  1U3E M;  3QRF F;  3IKV A;  3REO A;  3O2P E;  2IA0 A;  4G7O F;  3J81 Z;  1W5T A;  3T8T A;  3L00 A;  1IN6 A;  3E5X A;  2G9W A;  1U6G A;  1XDS A;  3CUQ A;  4CIC A;  2DLL A;  2FEZ A;  5FLX K;  5LGT A;  1RUO A;  4UNO A;  4WK8 F;  4IRH A;  2ZNZ A;  3CUQ C;  1MDM A;  4HF0 A;  4L9T A;  3VEP A;  1A04 A;  2R7D A;  2V1D A;  1B6A A;  3M7G A;  2PG4 A;  2HWV A;  3LAP A;  3QU6 A;  2W84 A;  1KU2 A;  1EH8 A;  4UVA A;  2C6Y A;  4HA8 A;  3RTR A;  1T38 A;  3ULQ B;  2CSO A;  4HX4 A;  3QPT A;  3E6C C;  4OIO F;  5FGM A;  4RGX A;  1D3Y A;  1PP8 F;  1O3Q A;  4LLN A;  1FZP B;  4MQ9 F;  1Z1D A;  3DV8 A;  5IT3 A;  4CHU A;  2QQ9 A;  1UFM A;  5H6Q A;  3BJO A;  2MC3 A;  3MQ0 A;  1R5G A;  1YW7 A;  3WU0 A;  2K86 A;  4RGU A;  4KIF A;  2MLG A;  4EVI A;  1S3J A;  4HQM A;  3DPT A;  3M8E A;  2HYF A;  1YW8 A;  3JTH A;  1S7O A;  2YX7 A;  1BI2 A;  2ZO4 A;  4G6D A;  1CGP A;  1H9G A;  4OIP F;  3M1E A;  3FMQ A;  2VC1 A;  1QNT A;  4BH9 A;  3BP8 A;  4ENN A;  2Z9O A;  3V7C A;  1B1B A;  1SAX A;  1XCV A;  3QAH A;  3VOD A;  4BHP A;  3BWG A;  1KQ8 A;  3IC7 A;  5FD5 A;  3FM5 A;  3I0T A;  1FY7 A;  1X3U A;  4MQV A;  2XKP A;  4F7Z A;  1UST A;  4PGG A;  1HW1 A;  3KE2 A;  3CO6 C;  2QM3 A;  2F5D A;  1FYM A;  3I71 A;  1MGT A;  2H27 A;  2KIF A;  3PFI A;  5L3E A;  4BQA A;  1BI3 A;  3ISP A;  3P9C A;  2ZME B;  3ZMD A;  2NYX A;  5LBQ A;  3WGG A;  3MZY A;  1BIA A;  3RYP A;  3WE3 A;  3JAM Z;  1FBU A;  4CO8 A;  1T98 A;  1W5S A;  5J8F A;  4HZF A;  5E17 F;  2KRF A;  4EM1 A;  4FX4 A;  2Q2E A;  3ECO A;  1XD7 A;  1ZLJ A;  1LEB A;  3MZH A;  3R4K A;  4JBA A;  2DK8 A;  4I0B A;  2K27 A;  5LEK A;  4P5O A;  2CG4 A;  1ON1 A;  4LG0 A;  3EET A;  1XSV A;  2KIM A;  4A12 A;  3BJA A;  1WI9 A;  2ESH A;  4EQQ A;  3GYH X;  2IPQ X;  3E5U A;  3WG9 A;  3JSO A;  3SZT A;  1QGP A;  3E3V A;  1MZB A;  1WWX A;  3ZMS A;  5LLQ A;  5L3D A;  2AXL A;  3ABT A;  2G7U A;  4OIR F;  1SD7 A;  4YFX F;  1YTY A;  4R8H A;  3I59 A;  3F8F A;  3F6O A;  4RB1 A;  2YSR A;  1JGS A;  2M1B A;  2WC2 A;  4RAZ A;  2A6H F;  3F8B A;  1ZLK A;  3J81 K;  4HDU A;  3I4P A;  1Y0U A;  2O3F A;  2P6T A;  1RI7 A;  2FNA A;  2J5O A;  3DXJ F;  4Y15 A;  3RIR A;  2VBW A;  3BJ6 A;  5ICC A;  1RZ4 A;  1W7P D;  3K0L A;  1IAW A;  2RKH A;  5K5O A;  1ZRF A;  1YYV A;  4O3M A;  3EUH A;  1WSU A;  2IJL A;  3MFK A;  1XMA A;  1RUN A;  3RKX A;  3DP7 A;  4BYY A;  1QZZ A;  3D5L A;  3WTX C;  6PAX A;  3GW2 A;  2IP2 A;  3GFI A;  2OA4 A;  5DCM A;  1ON2 A;  3K1P A;  2M5W A;  1O57 A;  2RN7 A;  4L5J A;  3N4M A;  5JR3 A;  1YW9 A;  4GGG A;  4YFN F;  2XUB A;  3WTS C;  4Q5S F;  2HEO A;  1J9I A;  2L4M A;  3IRQ A;  4CXF A;  5HS8 A;  1XCB A;  3KP6 A;  1BM9 A;  5LHI A;  3WOD F;  2O61 A;  2EB7 A;  1UHW A;  3FXR A;  4Y13 A;  3R0A A;  3GLX A;  3GX4 X;  3Q9V A;  3T5X A;  1SMT A;  2H09 A;  3KCC A;  4XSZ F;  1K7A A;  2EV5 A;  2P7C B;  1R36 A;  1I1S A;  4FHT A;  2BYV E;  4LB5 A;  3GXO A;  2LKP A;  2V1X A;  2OAZ A;  1SFU A;  5FD6 A;  3BOQ A;  2XAH A;  2M87 A;  1Z6T A;  2XIG A;  5LHG A;  4IVN A;  2A3S A;  4A5M A;  2HQN A;  1BI0 A;  4KN4 X;  4Y17 A;  2A6E F;  5DUI A;  1ODD A;  3ZMT A;  3WE2 A;  1R1V A;  1BBY A;  3FMR A;  4FT8 A;  5L3G A;  1U5T B;  3HHG A;  3FWE A;  3JSP A;  1R7J A;  5EEH A;  1BC8 C;  1RIO H;  2IA2 A;  4N9I A;  1Z05 A;  3H92 A;  3L9F A;  3M8F A;  1XSD A;  1XGS A;  4YG2 F;  1PUE E;  4I7H A;  5ILU A;  3LFK A;  4UHT A;  5CVJ A;  2QYO A;  1SFE A;  4BXU A;  3IKT A;  1LB2 A;  3ZP5 A;  1K6O A;  3LQR A;  3CUO A;  3CJN A;  1UHM A;  4U88 A;  2V6C A;  4RGS A;  2G7H A;  2CGP A;  3LAJ A;  2A69 F;  4P9F A;  3EQL F;  1PDN C;  1P92 A;  3ROU A;  5BOX A;  1O7L A;  3HOT A;  4OMY A;  2XGX A;  4L18 B;  4CGZ A;  2ZCW A;  4KNY A;  5DCF A;  4O6J A;  4LB6 B;  3FXQ A;  4HX7 A;  2H94 A;  3MEX A;  4GYI A;  2O6G E;  1Z9C A;  3C7J A;  2KJC A;  5CVR A;  1ZG3 A;  4RB3 C;  3S2W A;  4UUV A;  3SZP A;  5KK1 A;  2HDC A;  5ILV A;  1FBS A;  2DO7 A;  1E17 A;  2QBY B;  1ZYR F;  1P4W A;  1FP2 A;  2ESN A;  3EYI A;  4DQ2 A;  3GWZ A;  1ULY A;  4YII A;  4AIH A;  1IF1 A;  3L09 A;  2VT2 A;  4MEY F;  2HGC A;  4OOI A;  1JXS A;  1F9N A;  2GQQ A;  2FF4 A;  2HR3 A;  4HX8 A;  2RDP A;  4I0A A;  5ILS A;  2ZME A;  2Z5U A;  1E2X A;  2OQR A;  5F64 A;  4HAM A;  1TW3 A;  3I54 A;  2LDU A;  1J2X A;  2BEO A;  3ERE D;  5DV5 A;  1WQ2 A;  1R1U A;  5D4R A;  4G7H F;  4KA4 A;  1QPM A;  3IWZ A;  5HDG A;  3R61 A;  4BAY A;  2EFN A;  3E5Q A;  2DQR A;  3C3W A;  2O03 A;  2EJR A;  2V79 A;  3RKY A;  3D0S A;  4PZJ A;  5L3B A;  4RGR A;  3WGI A;  2FBH A;  3GVA A;  2QQA A;  2DK5 A;  1ZH5 A;  3F72 A;  5JVT A;  1P4A A;  4AVP A;  1IRF A;  4HV6 A;  1W7P B;  3IWF A;  4L9N A;  5EEG A;  3P9K A;  3ZMV A;  4WX9 A;  3BPV A;  3RKW A;  4KIG A;  1ZAR A;  4LJZ F;  4ESJ A;  5A2Q K;  3HRS A;  2IT0 A;  1S6L A;  2XV4 S;  4MEX F;  4EJW A;  4WCG A;  2QUF A;  4LLL A;  2FOK A;  2EA4 A;  4PCQ A;  1DUX C;  2MH2 A;  1F5T A;  4KDP A;  4L0Y B;  2CWE A;  5AON A;  2OQG A;  3QP5 A;  2WTE A;  1KYW A;  2PFB A;  1B4A A;  1P4X A;  1B9N A;  4PGH A;  1T6S A;  3WTY C;  1J0R A;  2HZT A;  3V8J A;  1GHC A;  4UVB A;  1USS A;  3WTV C;  4U7B A;  5AIQ A;  1R5H A;  2DW4 A;  4AIK A;  2XVC A;  3KLN A;  5E20 A;  4LD5 A;  4KYW A;  1QZY A;  3HRU A;  1MJB A;  4LFU A;  4HV5 A;  4GYG A;  1G4D A;  3J80 Z;  1L3L A;  1T2K A;  4Q4Z F;  2L01 A;  1G6N A;  1ZG5 A;  1TQI A;  4RS8 A;  2F2E A;  3FXU A;  3WU1 B;  3E6D A;  3LWF A;  1YQA A;  1KA8 A;  1REP C;  5H20 A;  2L4A A;  1HKS A;  4K2E A;  3CLO A;  1I27 A;  3W6J B;  3HSE A;  1IRG A;  4HF2 A;  5D4S A;  1RNL A;  5F6F A;  3HRM A;  5LRR A;  3KET A;  4KMF A;  4M72 A;  1U5T A;  4OIN F;  3ECH A;  3K69 A;  1U5T C;  1MJ9 A;  3RPQ A;  2VON A;  4AWX B;  2IRF G;  2XAF A;  3HHH A;  2GXG A;  3G3Z A;  4I98 B;  3WTU C;  4XLN F;  3HRT A;  2CYY A;  2DTR A;  4IXA A;  5D8L B;  5D6E A;  4G94 A;  4S04 A;  4RB0 A;  1LJ9 A;  3KP5 A;  2OU2 A;  1HSJ A;  4IHS A;  3RPU A;  2FBI A;  3TGN A;  3KEO A;  4HDV A;  2F5E A;  1XGM A;  4HF1 A;  2EFP A;  5H6R A;  5D5V B;  1ZN2 A;  4CZZ A;  3CO7 C;  4P9U A;  2FQ3 A;  1OMI A;  2MBF A;  3TQN A;  1TQP A;  3KZZ A;  4KMU X;  5D6F A;  2QZ8 A;  1IUY A;  2GIV A;  4U0Y A;  4A0X A;  1MD0 A;  4ENJ A;  4OMZ A;  4ZYH A;  3IHU A;  3VB2 A;  2XHK A;  2QBY A;  5AIP A;  1ONV A;  4GCV A;  5ICG A;  1H0M A;  3CTA A;  2VOD A;  1IW7 F;  2ELH A;  2CO5 A;  5CVU A;  2A07 F;  2NS0 A;  1JHF A;  2IA1 A;  2K4B A;  1OPC A;  5L3F A;  2FBK A;  2CFX A;  4Z2Y A;  1YS7 A;  2VBZ A;  2X0L A;  2P5L C;  4EM2 A;  3PQK A;  3H3U A;  1XN7 A;  2UXX A;  1FSE A;  5BS6 A;  3GFM A;  1QBJ A;  2Y0M A;  5ICE A;  2K7L A;  1T0F A;  3NEU A;  5E8I A;  1OKR A;  1LNW A;  4HQE A;  2ZBK A;  5J6X A;  2P8T A;  4I02 A;  4ESB A;  2VXZ A;  1G3W A;  5K1Y A;  2Y75 A;  2MD5 A;  3LST A;  2DPD A;  2EK5 A;  2LSO A;  2NRA C;  2GA2 A;  4PDK A;  1KU3 A;  1R22 A;  1U2W A;  3KZY A;  3TDU C;  4IRG A;  5BQT A;  4ZYG A;  4XLP F;  1NHA A;  1S7A A;  2EFW A;  1DDN A;  4UXN A;  1FC3 A;  4A5N A;  1R23 A;  3HYI A;  3FZV A;  2PEX A;  1XGO A;  4Q47 A;  1R00 A;  2P5V A;  1MJA A;  3F8C A;  2BE5 F;  4KFC A;  1FT9 A;  3ELK A;  3SHF A;  4YFK F;  1R1T A;  4M9X A;  4IRI A;  2JPC A;  4RAY A;  4ESF A;  4MHG A;  2BV6 A;  3U2R A;  1FBQ A;  4AIJ A;  3KP7 A;  2UZK A;  5LRS A;  2KIU A;  1BIB A;  4R1H A;  4KIC A;  1UCR A;  2HFH A;  4HW0 A;  1J59 A;  1HBX G;  3HOS A;  1ZRE A;  5F1R A;  3KFW X;  3M9A A;  3N97 A;  2JRT A;  2OZU A;  2QEN A;  2EFO A;  3VFZ A;  4A6D A;  4MTE A;  1QQI A;  5JHU A;  2LNB A;  3JAM K;  2UXN A;  1KGS A;  3DF8 A;  2KJB A;  1SD5 A;  3R6S A;  3C18 A;  4HLY A;  2HQR A;  1EV7 A;  5FLX Z;  1YO5 C;  1OYI A;  3JTG A;  3KP3 A;  3Q5F A;  5DUK A;  4M9S A;  3GUD A;  1AWC A;  4YIF A;  2AS5 F;  2PMH A;  3HSR A;  3AAF A;  3RI4 A;  3R60 A;  3GFL A;  4MGR A;  1P6R A;  2EA2 A;  2MA3 A;  5D8K B;  2EFQ A;  4AD9 A;  4WXD A;  3V7R A;  3GF2 A;  1AOY A;  3FX3 A;  2Y48 A;  2D45 A;  3L7W A;  4HBL A;  5HS7 A;  1S8N A;  3SXY A;  1FNN A;  2UWM A;  2RC4 A;  2FNP A;  4P96 A;  5CYV A;  2NAZ A;  2JTV A;  2DU9 A;  1LVA A;  4U0W A;  3TOA A;  1U78 A;  1GXQ A;  3F22 A;  2WWY A;  2P6S A;  3SFZ A;  3MAJ A;  2DFI A;  2FML A;  3QU3 A;  4XRF A;  5TRD A;  4N0B A;  4WXH A;  3GZ6 A;  2VE9 A;  4FX0 A;  1K79 A;  3ZPL A;  1J5Y A;  1DPU A;  4HOB A;  2BGC A;  2RNJ A;  4O5V A;  4CDG A;  2DQL A;  3IL2 A;  3V8L A;  2VN2 A;  3BPX A;  3O6B B;  1K78 B;  4BNC A;  5ERI A;  2RVC A;  2ACJ A;  1FYL A;  2ADU A;  3OV8 A;  1IXS B;  3LA2 A;  3I64 A;  3KEQ A;  4IF4 A;  1BOA A;  3NQO A;  2DI3 A;  5BMZ A;  3HTU A;  1FSH A;  4I2O A;  3K9T A;  1HXD A;  1HKQ A;  3G73 A;  2PBI A;  3F3X A;  2E7W A;  1ZG1 A;  2QQB A;  5J8C A;  3LA3 A;  1GVJ A;  1WKM A;  2MLK A;  4KN7 X;  4ETS A;  1OYY A;  1O3S A;  5TJJ A;  3TO7 A;  3DFG A;  2FA5 A;  1KU7 A;  2GAU A;  3F8N A;  1ZGA A;  1B59 A;  1DPR A;  2OBP A;  2WV0 A;  3V8K A;  3B73 A;  2JT1 A;  1W4M A;  5DYM A;  4LGW A;  2E1N A;  3HTS B;  1G3Y A;  4MNU A;  4EV0 A;  3I5U A;  2Z3Y A;  5CLS A;  2PI0 A;  5K5R A;  2F5F A;  4WWC A;  4I01 A;  2KKO A;  3RYR A;  2ZKZ A;  1J75 A;  4ZH4 F;  2O8X A;  2NNN A;  4UV9 A;  5FFZ A;  1LDJ A;  2VOO A;  4NQW A;  5CJ9 A;  4ZZD A;  2P4W A;  5IT9 Z;  2R7F A;  2LF7 A;  3HSF A;  4MTD A;  4JK1 X;  1XMK A;  4A2U A;  1ZAO A;  3IRR A;  3BDD A;  1FX7 A;  2MH9 A;  1STZ A;  1HW2 A;  2XKO A;  2TDX A;  4A0Z A;  3WTW C;  2VC0 A;  3DKW A;  4IJA A;  2VE8 A;  2R3S A;  3GO5 A;  4M71 A;  2STT A;  3TO6 A;  1WRJ A;  2H6B A;  1LQ1 A;  2PLY A;  3COA C;  3ML6 A;  2GXB A;  2QWW A;  3OOP A;  1U8R A;  3T8R A;  5DD8 A;  4A6E A;  2D2W A;  2FSW A;  3WGH A;  1O7F A;  1UB9 A;  4IPA A;  4GXO A;  1T39 A;  2YX4 A;  3GZ5 A;  4EM0 B;  5LEJ A;  3TDZ C;  4M73 A;  3WTT C;  2J5P A;  1TLH B;  2RV8 A;  3K1M A;  4EJO A;  2K4J A;  4A0Y A;  2Q0O A;  5E18 F;  1Z6R A;  1L0O C;  4G7Z F;  5KVR A;  1HW5 A;  4N9H A;  2XAJ A;  5CVI A;  1XGN A;  1Z91 A;  3I58 A;  2IW5 A;  3K1N A;  3QOP A;  3BRO A;  2XRN A;  2NNY A;  1BI1 A;  3SQN A;  2FE3 A;  2K02 A;  1BC7 C;  1TW2 A;  2HTS A;  2V1U A;  5D5W B;  2FXA A;  4EGZ A;  2L02 A;  1TBX A;  4M9Z A;  3F8M A;  3ZMZ A;  2XAS A;  1V3F A;  2CW0 F;  4L0Z B;  1YS6 A;  3FM3 A;  4KUM A;  4KT5 C;  4L5I A;  4LLG F;  2PQ8 A;  1O3T A;  1MKM A;  3T0Y A;  2JSC A;  1PP7 U;  3V7S A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...