2UZKA

Crystal structure of the human foxo3a-dbd bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORKHEAD BOX PROTEIN O3A
publication title Crystal Structure of the Human Foxo3A-Dbd/DNA Complex Suggests the Effects of Post-Translational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2uzkA01
1TNTA 2KJBA 2MBFA 2XGXA 4M6YA 2IA2A 4HAMA 1DDNA 5DYMA 3L09A 2PJPA 1R1UA 1BM9A 2QYOA 4XSXF 2PLYA 2H09A 2FA5A 4AVPA 4BHCA 4B09A 4ON0A 5LEKA 3BY6A 1SAXA 2P7VB 3R0JA 2STWA 5K5OA 3KFWX 1HSJA 5FO5A 2F5EA 1YW9A 5TRDA 4U0VA 4Q47A 2DO7A 3TOAA 1WRJA 3GW2A 4M9XA 1CGPA 3ZN1A 2VBXA 2VC0A 3PQKA 4P96A 1K79A 3HRSA 1ZG3A 4HX8A 1XCVA 2XAGA 1P2FA 2OAZA 1XB4A 5ICEA 4HLXA 4HDVA 3WTTC 2R3SA 3ZPLA 2GA2A 1H0MA 4L5IA 1O3RA 5FB2A 3JAMK 1LDJA 2Y48A 4HX4A 1HW2A 4U0WA 2V79A 4A0YA 2F2EA 5EEHA 2BYVE 3QP6A 2FXAA 2BGCA 2OZ6A 2J5PA 1C0WA 1YIOA 2OQGA 3JTGA 2O8XA 4NHJA 2HWVA 4I09A 4M6XA 4OU0A 5D5WB 2FE3A 4P9FA 2HKXA 4ZYHA 3C3WA 1IRFA 3TO7A 2DI3A 3ABTA 3ZMDA 1OYIA 4H0EA 1RUNA 5D4RA 1Z91A 4Q4ZF 2ADUA 3GXOA 2STTA 2VBZA 3VFZA 3F23A 2FSWA 5HDNA 4HW0A 2H6CA 4U88A 3ISPA 1R5GA 2FF4A 1USSA 1MJ9A 1WKMA 3ABUA 5KVRA 3JW4A 5LHGA 1ULYA 2QQ9A 2QVOA 2VODA 4ENNA 1U8RA 1Y0UA 3FXQA 1YW8A 1B9NA 1S7OA 5K1YA 2GA1A 3HUGA 1ZGJA 3MQ0A 4MGRA 2UZKA 1IN7A 2QWWA 4XLNF 1K7AA 1O57A 4B8XA 1IF1A 2Y75A 2VT3A 4EJOA 4MTDA 1PP8F 4ZH4F 4WF2A 3PFIA 1ZGAA 2X4HA 3R60A 4BYYA 1U78A 3F8BA 4L9TA 4AIKA 5BOXA 2IRFG 2L54A 1KU9A 3O6BB 4HYEA 3S2WA 3BDDA 2IA0A 3WGHA 3WG9A 4CYDA 2E1NA 5IT9K 2DBBA 5A2QZ 4OIOF 3GX4X 4MEYF 2ZMEA 2RNJA 4K2EA 4KT5C 2CSOA 5E17F 2MLGA 4IVNA 1FWZA 3F6VA 1S3JA 3GVAA 2PN6A 3RKXA 1DP7P 5E8IA 2O0YA 3EQLF 1RUOA 3C1DA 2K86A 1P6RA 2ETHA 1B6AA 4JK1X 5F1RA 3K1NA 4JQFA 2NAZA 2FBKA 2UXXA 4MEXF 5HS9A 1XMKA 1SD6A 2MH2A 3HSRA 4ASNA 5K5RA 2GIVA 3DXJF 1EH8A 3WU0A 2ACJA 3SZTA 4QWQA 4EM2A 5L3FA 4LG0A 1FYLA 1W5TA 1JE8A 3LWFA 3HOTA 2P4WA 3RKWA 5H6RA 4N9HA 3TGNA 2E1CA 2JTVA 3G73A 2RDPA 1YS6A 4WXHA 1AWCA 2GQQA 1RNLA 2ELHA 4EQQA 2XHKA 4IRIA 2UXNA 3EYYA 1TLHB 3WE3A 3PQJA 2EV0A 1SD7A 4HQMA 3CDHA 2XKPA 2EFWA 4ENJA 4CDGA 4P5OA 1Z7UA 2Q8KA 4NB5A 5CYVA 4YIIA 1XSDA 4UV9A 2HKOA 4LK1F 4Q48A 3RYRA 4IHSA 3IRRA 1KQ0A 4Q5SF 4M74A 4A5MA 1I1SA 3LAPA 1GHCA 2P5VA 3LFKA 2BV6A 2VT2A 4EJWA 1PP7U 2W84A 2XAFA 1U3EM 1IN4A 2PBIA 5L3EA 2NYXA 1BIBA 1KYWA 1B4AA 4ENKA 3T0YA 2YX4A 1IW7F 3V8KA 2L01A 5LBQA 2W85A 2K4BA 4L9JA 1W5SA 2QENA 4IXAA 2ZMEB 1FYKA 3TDUC 1ZRFA 4Y15A 3MWMA 3MEXA 3KEOA 1IXSB 1LNWA 2OD5A 2EFNA 2EB7A 3IL2A 5FLXK 5EEGA 2GXGA 3E6BA 3HSFA 1LB2A 1R58A 1G3WA 2XUBA 3FXUA 3RIRA 3KP3A 1LVAA 4UVBA 4PZJA 4Y13A 3TKYA 2COMA 3BZ6A 5DD4A 5LRRA 2A5YB 2CGPA 3FM3A 3NEUA 4TV7A 2QBYB 2LF8A 3RPUA 1KYZA 3KP4A 2RC4A 3IWFA 1TW2A 1T39A 1RIOH 2VC1A 2ZJ2A 4LG0B 2M8EA 1ZLKA 2WTEA 2PI0A 2JRTA 5L3BA 3E5XA 4KA4A 3ECOA 4OIQF 3K2ZA 2RVCA 1P4WA 3T8TA 1ZRDA 4A0XA 2HYGD 3VB2A 3GZ6A 2QUFA 4HV5A 3W6JB 2FQ3A 5HVQC 2A6HF 2DK8A 1IN5A 2ZKZA 2C6YA 4EM1A 1JHHA 2XASA 2MLKA 5FD5A 2R7DA 2GXBA 1UFMA 5E1ZB 2ISZA 1KA8A 4UUVA 4XRFA 2ZNZA 2DLLA 4LK0F 3U9GA 1XCBA 2HDCA 3ZN0A 1QBJA 2KIMA 3GUDA 1DPRA 2IP2A 2O61A 4CICA 5FD6A 1XMAA 1XDSA 1FX7A 4HQEA 3L9FA 5TJJA 3T5XA 3KETA 5E1WA 3F8MA 2HYFA 2P8TA 3JSPA 1EV7A 4UHTA 4LMYA 1D3YA 2IVMA 5L3CA 3WTSC 2FU4A 2LSOA 3I71A 5AONA 3QU3A 5DCFA 1YW7A 2O03A 2XAQA 3HRTA 1S8NA 5E18F 3J7AO 1LJ9A 1XDUA 5L3DA 1WSUA 2P6SA 3I64A 2OQRA 3F72A 4WWCA 3HHHA 4HA8A 2A61A 1ZAOA 5J6XA 4WK8F 3M8EA 4IHTA 4S05A 4YFXF 4BHPA 3I53A 1CF7B 3BOQA 4I98B 2E7WA 5AIQA 2Z3YA 1F4KA 4XSZF 1H9GA 3F3XA 3DPTA 3GFIA 4O3MA 3U2RA 4EGYA 2L4AA 3M9AA 3R61A 2D2WA 3QAHA 2K4JA 3WTZA 4I2OA 2BBYA 4IPAA 3JAMZ 2ESHA 1E17A 1JGSA 3MZYA 2KJCA 3HRUA 2FMYA 4KMFA 4ZYEA 3SFZA 5LGTA 4M73A 2MD5A 2M87A 2A6EF 4EJUA 4KIGA 5JFRA 3QP5A 3ZMVA 2HTSA 3WTXC 1YO5C 2IT0A 4KYWA 2DK5A 3WE2A 3BJAA 4CO8A 3T1BA 2BE5F 1HQCA 2A07F 3F8CA 4HV6A 4KNYA 1BIAA 1JHFA 1G4DA 2XAHA 1S29A 3J80K 5CJ9A 1KU3A 4BHBA 1MD0A 5ED4A 3BPXA 1TQPA 3V4GA 3ZQ7A 1Z1DA 4RGXA 3REOA 3RJPA 3V8LA 2FNPA 3WTVC 2YPRA 1Q1HA 4GGGA 3OOPA 3ZMUA 5ICGA 1FLIA 2IPQX 1Z05A 1XD7A 2F5FA 5DV5A 3L00A 3KP5A 5BQTA 2HGCA 1YS7A 4BH9A 3GFLA 3WTYC 1B59A 1RZ4A 4GXOA 4A12A 1HXDA 4LGWA 1IRGA 3BWGA 2NS0A 4A2UA 1XGMA 5H20A 3N4MA 3F22A 1FC3A 2YR2A 1YLFA 1BN5A 1MJAA 3Q5FA 1R00A 1SD5A 1LEAA 4LJZF 4HF1A 1MZBA 5DD8A 3MZHA 2FBIA 4ESJA 2QZ8A 2IW5A 4EV0A 2M45A 2XV4S 5HLIA 3FX3A 4Z2YA 3I59A 4HOBA 3E6MA 5KK1A 3WU1B 4O6JA 2FMLA 1BJAA 4LFUA 1MGTA 2K02A 1Z9CA 2ZCWA 4LLLA 5JR3A 1W4MA 3GYHX 4I0AA 4EMSA 5IT9Z 1FZPB 3V7RA 2O3FA 4UV8A 5FFXA 1SD4A 3RDIA 4CZZA 3F21A 3KLNA 4KICA 1I5ZA 3KP7A 3L7WA 2EWNA 5CVRA 4OIPF 1FSHA 4KDPA 2L4MA 2A68F 2R7FA 2W25A 3BPVA 1FT9A 2D1HA 5D8KB 5BS6A 2P5LC 1BI3A 4I7HA 3KLOA 1OPCA 3HTSB 1FBQA 2FRHA 4RAZA 1OYWA 3EETA 3COAC 3RYPA 1ZARA 3H3ZA 5HLGA 4D0PA 5AIPA 1QPMA 1ZREA 3CO7C 1OKRA 5HDGA 2EK5A 2LF7A 5DDGA 4IF4A 2QBYA 1J59A 1TQMA 4KMUX 1EH7A 4CHUA 4IJAA 2G7HA 1P4AA 3KZZA 3RI4A 5CVUA 2OBPA 2DPUA 2XVCA 2ZO4A 3IHUA 1BBYA 1GVJA 3FF5A 1IAWA 1WI9A 1ZH5A 1S7AA 2EFPA 4EGZA 4DQ2A 2RN7A 3RTRA 5JI6A 3TO9A 3MCZA 4OINF 1MDMA 3FHZA 5ILUA 2VONA 4P9UA 5E1XA 1R36A 4CXFA 4L9NA 4IRGA 3ECHA 4S04A 1HBXG 5HOOA 1U5TA 4CGZA 2YU3A 2DTRA 4MTEA 3FXRA 3LSTA 4ESBA 1KQ8A 1QZZA 2OA4A 1J5YA 2EJRA 4OIRF 2GZWA 5CLSA 4ESFA 4XLPF 2EA4A 3HSEA 3EUHA 3V7CA 5F6FA 3K9TA 1O3SA 4PDKA 2IJLA 2Z99A 2M1BA 4LLNA 4MQVA 4RB2C 3WTWC 3I59B 1Z6TA 2M5WA 2IA1A 4AWXB 4P55A 5HLHA 1AOYA 2W24A 4L9VA 1LDKB 2EA2A 4EJVA 3TDZC 2VBWA 1O7FA 1H9TA 4ZYDA 2FOKA 3MFKA 3K1PA 5ILVA 4MHGA 2JZYA 2OU2A 3J81K 2VBYA 1YQAA 1FBSA 2PFBA 4RGSA 3NRVA 3L2CA 3V7SA 1B1BA 3FMRA 2MH9A 5LEJA 1CF7A 1BOAA 4HF0A 5D5XB 1O7LA 2LKPA 3Q9SA 2J5OA 4M9ZA 4LB6B 5FLXZ 5BMZA 1HSTA 3BJOA 3QPTA 1UHMA 2QQAA 3H3UA 3VEPA 4FX0A 4FT8A 3ROUA 1LQ1A 2Y0MA 1JXSA 4L5JA 3AAFA 3D5LA 1E2XA 3CUQB 3E5UA 4WXDA 1SMTA 3HOSA 1V3FA 2B0LA 1IXRC 2EFQA 1ZRCA 3ZMSA 3DFGA 3DPLC 1K6OA 1F5TA 1QGPA 3MAJA 2KRFA 2ZFWA 5D5UB 2DAOA 4G8XA 2HEOA 1J75A 2JPCA 4XBFA 1KU7A 3NQOA 4GO1A 2WC2A 4GYGA 1MDMB 1KU2A 3WODF 2CO5A 5L3GA 5LLQA 3I0TA 3WTUC 1TNSA 1FBUA 2RQPA 3KEQA 1FYMA 2O6GE 1S6LA 2CWEA 1U5TB 5K5QA 5HS7A 2Q2EA 4YFKF 1MJBA 4RGUA 2XRNA 3GEZA 1X3UA 3GF2A 3O3KA 3DQVC 4N0BA 1ZHFA 4M9SA 1A04A 1XGSA 3FWEA 2V1UA 1REPC 4AD9A 4ETSA 3TO6A 2YSRA 2H27A 2LNBA 1D5VA 3I54A 1YYVA 3F6OA 1T2KA 3G3ZA 2G9WA 4RGRA 1B9MA 2HTJA 2PQ8A 2FEZA 1D8KA 4YG2F 3E5QA 1IN6A 2PG4A 4LD5A 4PGHA 1I6XA 3K0LA 5J8CA 4RB1A 3GWZA 2V1DA 4U0YA 1IXCA 1QNTA 2HR3A 1TQIA 5D6FA 3QPHA 4KN4X 2QQBA 3C18A 3P9CA 1XSXA 3IRQA 4AIHA 4HZFA 2HQNA 3K1MA 3JSOA 2AS5F 4KIBA 5ICCA 2PMHA 5H6QA 1U2WA 5FGMA 5J8FA 3F8NA 1LDDA 3CUOA 4KUMA 4I02A 1XGNA 1RI7A 1QZYA 3I5UA 4ZYGA 4L18B 1FP2A 1P92A 4EVIA 1HKTA 4MQ9F 4L0ZB 4KFCA 1W7PB 4BQAA 2ZNYA 4WXCA 3K69A 1ZG1A 3ML6A 2A69F 4R8HA 1OMIA 3P7NA 2GAUA 2JPBA 3ULQB 2F5CA 3HRMA 3F8FA 2Q0OA 3J80Z 3BJ6A 4RAYA 2UWMA 2NNNA 1PUEE 4M71A 1TBXA 4HLYA 3LAJA 2M30A 5JHUA 3ELKA 1QO0D 2CG4A 5CVJA 5ERIA 2RGVA 1FOKA 3DEUA 2VOOA 2AXLA 1SFEA 4EJTA 1P4XA 3ZMTA 4ZZDA 1OYYA 1WWXA 5BPDA 4BNCA 1O3QA 3SXYA 1NHAA 2ZBKA 4N9IA 4DNCA 3GFJA 1BI2A 1G3YA 3E6CC 3M7GA 5E20A 3KP6A 3VOEA 5D8LB 3P9KA 4JBAA 1WQ2A 3BROA 2Z33A 1SFUA 2CQKA 5LHHA 3TOBA 2HFHA 1SFXA 2H6BA 2P7CB 3GLXA 3RKYA 4G6DA 3TQNA 1HW1A 1ODDA 3QU6A 5DCMA 4YFNF 4U7BA 2JSCA 4E70A 1UHWA 1GXPA 5DUKA 5ICFA 4OMYA 4L0YB 3LA7A 3U1DA 5LHIA 4PCQA 2ESNA 1R1TA 3Q9VA 2CFXA 4KIFA 2VE9A 3FM5A 3WGGA 1Z6RA 2DQRA 2NRAC 3N97A 5FFZA 2L3DA 2DQLA 4UVAA 3R4KA 4GCVA 1XSVA 1EH6A 4U7DA 2E7XA 3VODA 2P5KA 4FHTA 1SMYF 4NQWA 2DW4A 5HS8A 2P6TA 4MNUA 1KGSA 1J9IA 1ON1A 3D0SA 3B02A 4LLGF 4OMZA 1W7PD 5A2QK 3EDPA 2GWRA 2RV8A 4IRHA 3W6KB 1FY7A 3JTHA 5DEQA 2H94A 2ZXJA 1K78A 2BEOA 4GYIA 2KIUA 1J2XA 3M1EA 2W57A 3SQNA 2VXZA 3LA2A 4HDUA 4G6QA 2EV6A 1ZG5A 3E6DA 1XGOA 3WGIA 3CUQA 1R7JA 2QM3A 5D6EA 2K27A 2YX7A 3CLOA 4YIFA 1GXQA 3LQRA 1LEBA 5DUIA 4G94A 1T6SA 1J7KA 4A0ZA 1FP1D 4KN7X 1BI0A 2HQRA 3CTAA 2LDUA 3SHFA 4A6DA 2FNAA 1BC7C 4Y17A 4EM0B 2XAJA 2G7UA 5CVVA 4A6EA 1I1GA 2EV5A 1UCRA 2KKOA 4G7HF 4AIJA 4OOIA 4R1HA 3P9IA 3QRFF 3HIFA 4G7OF 1TW3A 4UVCA 3FZVA 5LGNA 1ZN2A 2DU9A 5E8GA 3EYIA 1DPUA 1G3SA 2HZTA 3IKTA 3IC7A 1F9NA 3KCCA 1T98A 3ZP5A 5BPIA 4WX9A 1FNNA 2DT5A 2NNYA 2L02A 3C7JA 3RPQA 4I0BA 2D45A 5DCMB 1T38A 4QLCU 4HX7A 2JT1A 2MA3A 5D4SA 4LB5A 2CW0F 1L0OC 1R5HA 2VN2A 3OV8A 1IZ1A 1R1VA 3CO6C 1T0FA 3ERED 4PGGA 2KIFA 2XIGA 1OR7A 1XN7A 4BAYA 1KQ9A 1V4RA 4RB0A 1UB9A 4WCGA 2FBHA 2V9VA 5F64A 4RB3C 3I58A 1DUXC 4UXNA 4G7ZF 2DPDA 2PMUA 3FMQA 1D8JA 1HKQA 3J81Z 2XKOA 3DKWA 1L3LA 1BC8C 5CVIA 3LQQA 2QLZA 1QQIA 3KE2A 3R6SA 5LRSA 1O3TA 2D1VA 2V1XA 3FMSA 3LA3A 1USTA 2Z9OA 4A5NA 1HKSA 1BI1A 3HTUA 2WV0A 1TTYA 1ON2A 2V6CA 1R23A 1K78B 3V8JA 2RKHA 3HYIA 3CUQC 3T8RA 5JVTA 1FPQA 2HOEA 2XROA 5ILSA 3DP7A 5HDKA 4BXUA 2ISYA 4HBLA 3I4PA 4ZZLA 6PAXA 1R22A 4FX4A 1W7PA 4F7ZA 3GZ5A 3KP2A 3HHGA 1VTNC 4G9YA 3IWZA 2HS5A 2CYYA 1ZLJA 3R0AA 2TDXA 5LGUA 1G6NA 3M8FA 2PEXA 2K7LA 5D5VB 3E3VA 3SZPA 1STZA 4ENMA 1U5TC 1MKMA 1ONVA 3BP8A 3QOPA 4RS8A 3ZMZA 3O2PE 1HW5A 4M72A 3H92A 2X0LA 4UNOA 2F5DA 2EFOA 1YFHA 5IT3A 3GFMA 1J0RA 1U6GA 2Z5UA 2MC3A 3IKVA 4R79A 2VE8A 3CJNA 3E97A 3DV8A 4I01A 1YTYA 2A3SA 1FSEA 2WWYA 3GO5A 1IUYA 3B73A 1ZYRF 2VOPA 4HF2A 1IN8A 3KZYA 4O5VA 2OZUA 1YG2A 1I27A 2DFIA 1F1ZA 1G3TA 1PDNC 3DF8A
chains in the Genus database with same CATH superfamily
3JRCA 1TNTA 2KJBA 3V42A 4BU2A 1T8IA 2GOXB 3CCJI 1NK3P 2CUFA 4RM3A 2B63J 2MBFA 2E34A 2XGXA 3H0GJ 4M6YA 2IA2A 4PK4A 4HAMA 1TWAJ 1PJRA 1DDNA 4DW6A 5DYMA 2R7VA 3HGYA 3L09A 2PJPA 1R1UA 3CDLA 2WB1A 2Y0SN 4RDUA 2H8WA 2OCEA 1X2NA 4F52A 3PUFA 1BM9A 3EUKL 2QYOA 1IC8A 4XSXF 2PLYA 3QQAA 1NTCA 3H9GA 2H09A 2FA5A 3MKLA 4AVPA 3M4OJ 4I6ZA 2CW8A 2F4MB 4BHCA 3HL2A 3CCEI 4XL9A 4B09A 4ON0A 4RA2A 5LEKA 1G59A 3BY6A 1MW7A 3DU5A 1SAXA 3HOWJ 1VQ6I 4AIDA 2P7VB 3I4MJ 3R0JA 2STWA 5K5OA 3KFWX 1HSJA 2KISA 4II3A 5FO5A 4RMNA 5KNLA 3OWTA 2F5EA 4AUXA 2R5ZA 1YW9A 5TRDA 1PUFB 4U0VA 4XRSG 4EEFG 2KFDA 2MGQA 3BG5A 4ANJA 3OYIA 4Q47A 5DTDA 2RAEA 2DO7A 2LBFB 3TOAA 1WRJA 2BHYA 1V55H 4AU7A 2KLOA 3ABKH 3GW2A 2RQQA 4M9XA 1CGPA 3ZN1A 2NVQJ 2I5UA 2VBXA 2VC0A 2QF7A 3PQKA 4P96A 1K79A 5J1UA 2DJNA 1TT5B 2M0CA 3HRSA 5B3SH 1ZG3A 4XLEA 2XGCA 3A2KA 4HX8A 1XCVA 2XAGA 3M3YJ 1P2FA 2OAZA 4HG2A 1XB4A 5ICEA 4HLXA 4HDVA 3WTTC 2R3SA 2E19A 1FMWA 1ZTRA 3DEEA 3ZPLA 2GA2A 3RCOA 1H0MA 4L5IA 4BBRJ 1O3RA 3K4BA 2TRTA 5FB2A 3JAMK 1LDJA 1GUUA 2Y48A 1VQMI 4HX4A 1HW2A 4U0WA 1ETXA 5CQGA 4UUSA 2OF7A 3K70C 2V79A 2X1CA 4A0YA 2F2EA 1N77A 2R7UA 2NS8A 5EEHA 2A05A 2BYVE 3QP6A 2YU9J 1YE9A 2XAUA 2FXAA 2BGCA 2OZ6A 2J5PA 5E3OA 1ETOA 1C0WA 1GDTA 2LY1A 1YIOA 1FOWA 2OQGA 3JTGA 1Y39A 2O8XA 1MNMC 4NHJA 5GPAA 2HWVA 4I09A 4M6XA 3DCFA 4OU0A 5D5WB 2R5YA 1HOMA 2FE3A 4P9FA 4FCYA 3OYKA 2HKXA 3LSKA 2VQLA 3A02A 4ZYHA 3C3WA 2EH3A 3BR1A 1IRFA 3TO7A 3A01A 3H9QA 1K61A 4E7KA 2DI3A 3ABTA 3ZMDA 1OYIA 2LD5A 4H0EA 1RUNA 5D4RA 1Z91A 3HG9A 3MD2A 4Q4ZF 5FKNA 2VJIA 1Z0XA 2ADUA 2W48A 3GXOA 3D5RC 1Z3YA 1U8BA 2STTA 2VBZA 3VFZA 3F23A 5DS9A 5C4JJ 2FSWA 1QZEA 5HDNA 4HW0A 2EZIA 2H6CA 4DOZA 2XPUA 4U88A 3ISPA 4JX6A 2Q1ZB 1TC3C 1R5GA 2CRGA 3OIQA 2CJJA 2FF4A 2E35A 3L2RA 1USSA 1MJ9A 4EATA 1WKMA 1ITYA 1WJCA 3ABUA 5KVRA 4QPQA 4ZC3A 2HVSA 5M3FJ 2MSYA 4MO7A 5H2FC 3JW4A 4ZDLA 2R93J 2X6YA 5LHGA 1ULYA 2QQ9A 2QVOA 2VODA 1AKHB 4ENNA 4B1RA 1U8RA 2Z2SB 1Y0UA 3FXQA 2NVYJ 1YW8A 1B9NA 1S7OA 4Y7NJ 5K1YA 2GA1A 4XQFA 3HUGA 1ZGJA 3MQ0A 4E7LA 4MGRA 4BEHB 2UZKA 1IN7A 2QWWA 4XLNF 1K7AA 3KYCB 1O57A 4B8XA 1IF1A 2Y75A 1MMAA 1LVKA 2VT3A 4EJOA 4MTDA 1PP8F 4ZH4F 4WF2A 1O4XA 2VUMJ 3PFIA 4M3FA 3J7ZI 1ZGAA 1RRJA 2X4HA 3R60A 5IOZA 1Z67A 4BYYA 2DOFA 1BJZA 1U78A 3BC8A 4H4KC 1X1CA 3UKGA 1F43A 4GDFA 3F8BA 4L5EA 1A6QA 2KZVA 1SFKA 3AG1H 4L9TA 4AIKA 5BOXA 2QQ8A 3U21A 2A5WA 2IRFG 2L54A 3PIPF 1KU9A 3O6BB 1Z3XA 4HYEA 3S2WA 4Y4RA 4CCMA 3OL4A 5B5EC 2ECBA 4NDLA 1EA3A 2R5ZB 2A6TA 3BDDA 2YUSA 3OYBA 2IA0A 3WGHA 3WG9A 1X1PA 5CPRB 4CYDA 4FQGA 3ZGKA 2E1NA 3NAUA 1MNEA 5IT9K 3BTCA 1ETQA 2DBBA 5A2QZ 4OAZA 4OIOF 4OWRB 3GX4X 4MEYF 4F92B 2ZMEA 2RNJA 4K2EA 4KT5C 1YITI 2FJ1A 2H8RA 2CSOA 1ZELA 5KCMA 2MLGA 4IVNA 1V5GA 4XICA 1FWZA 3L2UA 2V7FA 5E17F 3SFIA 3DTEA 3F6VA 1S3JA 3GVAA 4KJZA 3FK6A 3CC4I 2PN6A 5J4YA 1U9OA 4ZJZA 3RKXA 3CDIA 2LYCA 4CCKA 1DP7P 3HGGA 1FJLA 2IGKA 5E8IA 2IS4A 1BR1A 2O0YA 1TZLA 3RPUD 2O7OA 1JT0A 3EQLF 1RUOA 4XN0A 4A3EJ 1VQ8I 3A0BC 3C1DA 4D7MA 2K86A 1P6RA 3H5NA 2ETHA 1B6AA 4JK1X 1JJ8C 2JMWA 5F1RA 3K1NA 4JQFA 2NAZA 2FBKA 3SEZA 2UXXA 3H3VK 1X19A 4MEXF 5HS9A 3PL8A 2L9VA 4AYBA 2VJ4A 1XMKA 2BY3A 2VB6A 1SD6A 2MH2A 5GAHJ 3HSRA 4ASNA 1T56A 2PMZN 4MFEA 3IH3A 5K5RA 1OFCX 2GIVA 3DXJF 3I55I 1X2MA 1EH8A 1R5ID 3WU0A 1QHGA 1YJNI 2P81A 1JUMA 2ACJA 3SZTA 4D7NA 4QWQA 4EM2A 1R6RA 3H5RA 4IL6C 1JJ6C 1FTZA 4B44A 5L3FA 3A01B 4LG0A 2LY9A 1FYLA 1W5TA 1ETKA 3LWFA 1JE8A 3HOTA 2P4WA 3O8HA 4XK4A 3RKWA 2DA6A 1BA5A 1X58A 1JKQC 2VKVA 2WAFA 5H6RA 1HCRA 1GT0C 4N9HA 3TGNA 2E1CA 2JTVA 2AO9A 3G73A 3JRDA 1Y1VJ 2DA2A 2BHZA 2DOAA 2CH0A 2RDPA 3S32A 2LH9A 1X1AA 2RNGA 3N05A 5HNFA 1Y0NA 4UB6C 5IYDJ 2CQXA 2E71A 1YS6A 4GFBA 1N75A 4WXHA 1AWCA 4XN3A 2GQQA 1RNLA 2ELHA 3HB9A 3ZQQA 4EQQA 2XHKA 4IRIA 2UXNA 3BTLA 5EZHA 3E0JB 3EYYA 1TLHB 3S16J 3HZJA 3WE3A 2IS2A 3PQJA 4B4CA 1DP3A 2NVUB 2EV0A 2COBA 1SD7A 4D1QA 2W82A 1K6YA 2LR8A 4HQMA 1Y6IA 3CDHA 2XKPA 2EFWA 3FXKA 2ZXHA 4ENJA 4A3LJ 4CDGA 1R4MB 4P5OA 3ZQHA 1Z7UA 1ZKGA 3CC7I 2Q8KA 5F08A 4NB5A 5CYVA 2EINH 4YIIA 5EZGA 1XSDA 4UV9A 2HKOA 4LK1F 2XSDC 4KITB 4Q48A 3GZNB 3RYRA 4B43A 1ZK8A 3OOUA 4IHSA 2KZGA 3IRRA 1KQ0A 4Q5SF 3LSPA 1SFOJ 4M74A 2QKMB 2AHQA 4A5MA 3BR2A 1I1SA 3LAPA 1MSFC 2P5VA 1GHCA 3MKYB 3W6VA 2GM4A 4JX4A 2QCOA 1JT6A 1TL8A 3LFKA 3Q0VA 2KDZA 1MBKA 2BV6A 2VT2A 2E36A 4EJWA 2FUG2 1PP7U 1QA6A 2KPMA 2W84A 2XAFA 1U3EM 1OLTA 1IN4A 4QPOA 3HPHA 1BW6A 3UR3C 2PBIA 1SANA 5L3EA 3ZQCA 2OCCH 5GPCA 2NYXA 3S3OA 5JLWA 3L1PA 1BIBA 1KYWA 3DPUA 3DWLE 1VQLI 1B4AA 1FMVA 4ENKA 3T0YA 4E7JA 4PJNA 1FTTA 3OS1A 2VPRA 1TWFJ 2YX4A 1IW7F 2DODA 5J40A 3V8KA 3K4LA 2L01A 2O9LA 5LBQA 2W85A 2K4BA 4CZCA 2M3AA 2M9HA 4L9JA 1W5SA 1JGGA 2QENA 4IXAA 1B8IB 1BW5A 2ZMEB 2K9SA 4XLCA 1ETWA 1FYKA 1S72I 2DA5A 2ZB9A 3TDUC 3JRHA 5E3NA 5J1RA 1PUFA 2E60A 2B7EA 1ZRFA 2DA3A 4B3XA 4Y15A 2F4IA 3MWMA 2BZTA 3ZQLA 1VQPI 3MEXA 4U87A 3KEOA 2E5NA 1IXSB 1LNWA 2OD5A 2EFNA 2HI3A 4JP0A 2EB7A 1GLNA 3IL2A 5FLXK 5EEGA 2QEXI 2GXGA 3AL0B 5GAGJ 3E6BA 3HSFA 3B6CA 4II2A 1LB2A 4A93J 3S8PA 3LNQA 2HDDA 1R58A 1G3WA 2XUBA 3FXUA 2IS6A 2V9KA 3RIRA 3KP3A 3NARA 1LVAA 3G1LA 4UVBA 4PZJA 2E5ZA 4Y13A 3QOEA 3TKYA 4IHWA 2COMA 3BZ6A 5DD4A 5LRRA 3FISA 2GOMA 5GTIC 2A5YB 2CGPA 3RZOJ 3FM3A 5DM6F 3NEUA 4M3EA 4TV7A 2QBYB 3FKJA 2LF8A 3RKQA 3RPUA 3VPRA 4HNVA 1KYZA 3KP4A 2RC4A 2E2IJ 3IWFA 2EZHA 1TW2A 3GTJJ 1T39A 2L7MP 3QYEA 3AKZA 1RIOH 1G2HA 3BG7A 2VC1A 2ZJ2A 4LG0B 1NG7A 2M8EA 2R92J 1ZLKA 2WTEA 2PI0A 1VQNI 1W1WE 2JRTA 2HYJA 5L3BA 1IGNA 1MNDA 4DJAA 3E5XA 4N4NB 4KA4A 3VSKA 1UHSA 3ECOA 2X48A 4OIQF 1IUFA 3K2ZA 3E7LA 2LKSA 2RVCA 1P4WA 3T8TA 4LIVA 2HOSA 4JOMA 1ZRDA 4A0XA 2HYGD 2JN6A 2ZSHB 4UUTA 3VB2A 2I8DA 3GZ6A 2QUFA 4HV5A 3W6JB 2FQ3A 5HVQC 2A6HF 2MFZA 1SVLA 3S3NA 2OPTA 1IN5A 2DK8A 2ZKZA 2C6YA 4EM1A 1JHHA 2XASA 1S5LC 3GMEA 2MLKA 3CF5F 3H9JA 5FD5A 2R7DA 2KT0A 3CCUI 1K4TA 1QVTA 1JTXA 2GXBA 1UFMA 3OR2C 2NVTJ 5E1ZB 2ISZA 1KA8A 1QRYA 2MW8A 4UUVA 4XRFA 2X6XA 2DLLA 2ZNZA 2BY2A 1RKWA 4LK0F 3U9GA 1XCBA 2HDCA 4YRVA 3ZN0A 2WAQA 1WJEA 1QBJA 2KIMA 3GUDA 1BL0A 3ZQIA 5B66C 1RETA 1DPRA 2IP2A 2R7OA 2O61A 1OISA 4CICA 5FD6A 1XMAA 1XDSA 1FX7A 1FIPA 3HJEA 4HQEA 3L9FA 5TJJA 3T5XA 4XIDA 4NBQA 1AKHA 1SEUA 4BE1A 2DT6A 3K4KA 3KETA 5M5WJ 5E1WA 3F8MA 3H5AA 2HYFA 2P8TA 3TW7A 2ECCA 2XF7A 2DXIA 3JSPA 1EV7A 3K2AA 4UHTA 4LMYA 2FD5A 1XTAA 5GP9A 1U0JA 1D3YA 2WADA 2V4JC 4BEHA 2IVMA 2K9MA 2Y30A 5L3CA 1VF9A 3WTSC 2HQ5A 2FU4A 4KT6A 3MMYB 2LSOA 3I71A 5AONA 1MH4A 1OJLA 3QU3A 5DCFA 3TP3A 1YW7A 2OUMA 3ZQGA 3KYDB 1MMDA 1N25A 2O03A 2XAQA 3HRTA 1S8NA 5E18F 3J7AO 1DGWY 1LJ9A 3ERMA 1XDUA 5J4VA 3CCQI 5L3DA 1WSUA 2P6SA 3I64A 4E7SA 1X4PA 2OQRA 3F72A 4WWCA 3W3CA 4ZDOA 2ELJA 2VQCA 3HHHA 3KYLA 4HA8A 2A61A 2X9DA 1G8XA 5DM7F 3G71I 1ZAOA 3HKZA 5J6XA 4WK8F 1H8AC 3M8EA 3OS0A 4IHTA 2IS1A 4S05A 2DFEA 4J19A 2PX9A 3IH2A 3S93A 4Y33A 4YFXF 1F36A 2KIQA 4BHPA 3EPZA 3I53A 1CF7B 2OJED 3BOQA 4HEA2 4I98B 3LSGA 3FBIB 2XGDA 2E7WA 5AIQA 2BW3B 2Z3YA 1F4KA 4XSZF 1H9GA 2BVLA 3B6AA 3F3XA 3DPTA 5FKMA 3GFIA 2HOAA 3W2VA 4O3MA 4CSWA 3U2RA 3VSLA 4EGYA 2L0KA 3PFYA 2L4AA 3M9AA 3A4CA 1XX5A 5KHDA 2Y31A 1ETVA 3KIOA 3LL7A 3R61A 3WG7H 2D2WA 3QAHA 4CCNA 2K4JA 2K85A 3WTZA 1GV5A 3LSJA 1RESA 4I2OA 3FXOA 1XG1A 2BBYA 4IPAA 2LMDA 3VYSB 2ESHA 3JAMZ 1E17A 4DYQA 3BZCA 1JGSA 3MZYA 4BY1J 2KJCA 3HRUA 2FMYA 4J00A 2Y9ZA 4KMFA 4ZYEA 3SFZA 5LGTA 4M73A 2DMUA 4E7ZA 4XLFA 4XKWA 4D5CA 4A3JJ 2MD5A 2M87A 2A6EF 5M5YJ 4M3GA 4EJUA 4DYRA 1JKRC 4KIGA 4X0GA 4CYCB 5JFRA 3QP5A 3VYTB 2K3PA 1TT0A 3ZMVA 2HTSA 4FASD 3WTXC 1W0UA 1YO5C 2Y0SA 1NH3A 2IT0A 3PM1A 1KZHA 1APLC 4KYWA 3DKYA 3NWTA 2DK5A 3WE2A 3BJAA 4CO8A 2QGUA 3T1BA 4HSRA 5J47A 2BE5F 4B48A 1HQCA 5JVGF 4BDZA 2A07F 3F8CA 3TBIA 4HV6A 2M0MA 4KNYA 2EILH 2QSFX 1BIAA 5FROA 3EUAA 4E7HA 1JHFA 2ZSIB 4BUPA 5CQEA 1G4DA 2XAHA 1S29A 1Y56A 3ZQFA 3J80K 5CJ9A 3OIPA 3RQ4A 1KU3A 4BJ6C 4BHBA 4MIMA 1WZ2A 1MD0A 4RAFA 1ENHA 2HDWA 5ED4A 3BPXA 5EDNA 4ITVA 1TQPA 3V4GA 3ZQ7A 2CS3A 2R7WA 4CA0A 3CESA 2F5VA 1Z1DA 3OY9A 4HRIA 4RGXA 3REOA 3RJPA 2DN0A 3V8LA 2ICWG 5J3LA 2FNPA 2LLKA 3WTVC 3OYGA 2HXOA 3FHNA 2Q2EB 4N4OB 2YPRA 1Q1HA 4BQOA 4GGGA 3OOPA 3CP2A 1X4OA 3ZMUA 5ICGA 1FLIA 1ERDA 2CQ7A 1SAUA 5FKLA 2IPQX 1Z05A 1XD7A 2WY7Q 1IDYA 2F5FA 3HEFA 5DV5A 2IXSA 3RSNA 3MKZA 3L00A 5FRMA 3KP5A 5BQTA 3TL4X 3QWLA 3BTJA 2HGCA 1YS7A 4BH9A 3HOZJ 1VI0A 3DTKA 3GFLA 2IGMA 3WTYC 1VQ4I 1B59A 1RZ4A 4GXOA 4A12A 1HXDA 4LGWA 1IRGA 2M2EA 3BWGA 2NS0A 4A2UA 2VIXA 1XGMA 5H20A 3N4MA 3F22A 1FC3A 2JWTA 2YR2A 1YLFA 2I10A 1H88C 1BN5A 1X1DA 1MJAA 3Q5FA 2WBMA 2HPMA 1R00A 2LTPA 2K9NA 1HF0A 1SD5A 1LEAA 2IBDA 4LJZF 4XOPA 4HF1A 2Z16A 2VQHA 1MZBA 3TEDA 5DD8A 3MZHA 2FBIA 4LOCA 2QZ8A 5EG0B 4ESJA 2IW5A 4EV0A 2R7XA 1LPQA 2M45A 1YHQI 1MH3A 4F55A 2E2JJ 2XV4S 4M3DA 5HLIA 4M3BA 3OYNA 3FX3A 4Z2YA 3I59A 1E3PA 4HOBA 3E6MA 5KK1A 3WU1B 4O6JA 2R7RA 1JI8A 2FMLA 1BJAA 4LFUA 1MGTA 2K02A 3DTIA 1Z9CA 3BG6A 2CUJA 4BJTA 2ZCWA 3BT9A 1I3QJ 3OIOA 2L5QA 4LLLA 2QSGX 4BQQA 1I39A 5JR3A 3GTLJ 3H1CA 4C2UA 1W4MA 2DA1A 4BJ5C 3GYHX 4I0AA 3U1KA 1IO2A 5EJCA 3FKIJ 2DFHA 4EMSA 5IT9Z 1FZPB 3V7RA 3L2QA 2O3FA 3IAM2 1M1EB 3BCBA 4UV8A 2NXNB 3VWBA 3SYTA 1B8IA 5FFXA 1SD4A 3AG3H 5F0CA 4ABZA 2KP6A 3OMYA 1B72B 3RDIA 1YOVB 3S14J 4CZZA 3F21A 2GIZA 2M4KA 3KLNA 3PNVA 1I5ZA 3KP7A 4KICA 2PJRA 3L7WA 3TMOA 3DKXA 1GV2A 1OCTC 5EEAA 2EWNA 5CVRA 4OIPF 1FSHA 4BGDA 4KDPA 2L4MA 1T95A 2A68F 3CJRB 2EQRA 2R7FA 2W25A 1UG0A 3BPVA 1FT9A 2D1HA 5D8KB 5E3MA 5BS6A 2P5LC 3JRGA 1BI3A 3S15J 3BG3A 2XRLA 1W0TA 4I7HA 3KLOA 5KAFC 1OPCA 4IHVA 5IP7J 3HTSB 1FBQA 1X1BA 2FRHA 4RAZA 1VZ0A 4BL0B 1HDPA 1OYWA 1ZR4A 1OCRH 2W7NA 1WCMJ 2BVMA 1X3WB 3EETA 3COAC 3RYPA 1W36D 4BBSJ 3P5JA 1ZARA 3H3ZA 5HLGA 4D0PA 4V2GA 1T08B 5AIPA 1QPMA 1LFPA 4XRMA 1ZREA 1NG6A 3CO7C 1OKRA 5HDGA 2EK5A 2LF7A 4PSXA 2KHMA 3BR0A 4IF4A 5DDGA 2QBYA 3GBGA 3CQZJ 1J59A 1MIJA 1ACIA 1TQMA 4KMUX 1EH7A 4CHUA 4IEJA 4IJAA 1K4SA 3K70D 2G7HA 1P4AA 3KZZA 3QYFA 1I50J 3RI4A 5CVUA 2OBPA 2DPUA 4A3KJ 2XVCA 1TWCJ 3UNGC 3LMMA 3MKWB 3IV5A 4BXFA 4PUSA 3C2BA 4YIRX 1Y8QB 2ZO4A 4A3DJ 3IHUA 1BBYA 1GVJA 1V5EA 3FF5A 1IAWA 2Y9YA 3HOVJ 1WI9A 4XORA 3S17J 4KISA 1ZH5A 1S7AA 2EFPA 2JUGA 4DQ2A 4EGZA 2RN7A 3G6EI 3TW6A 2DA7A 1A6IA 1D1CA 1FEXA 3RTRA 5JI6A 2AQFA 1Z21A 1E3OC 3TO9A 3MCZA 4OINF 4RM2A 3CCVI 1MDMA 2DYRH 1VQ5I 2ZXIA 3FHZA 5ILUA 2JA6J 2VONA 4P9UA 3S1QJ 5E1XA 2IEKA 1R36A 4CXFA 4L9NA 2F4OB 4IRGA 3ECHA 4C9YA 4S04A 2JA5J 1HBXG 2LOOA 5HOOA 1U5TA 5HNHA 4CGZA 4MLOA 2YU3A 2DTRA 4MTEA 2IGOA 4Y52J 3FXRA 3LSTA 2HVQA 4ESBA 1KQ8A 1QZZA 2OA4A 5M3MJ 3OYFA 2X51A 5EF6A 1J5YA 2EJRA 4RAGA 1SC7A 1MBHA 4OIRF 2GZWA 3CD6I 2LFBA 5CLSA 3L2VA 3QODA 4ESFA 1RR8C 1U9NA 3K4CA 2OC6A 3S1NJ 3GLLA 2KMUA 3PIOF 1WJBA 4XLPF 3KX2A 3DU6A 2EA4A 3HSEA 3EUHA 3OYAA 3V7CA 2PMZA 4QSHA 4C3HJ 5F6FA 3K9TA 1O3SA 4PDKA 3KEYA 3BLYA 2IJLA 2Z99A 3BTIA 3OYJA 2CU7A 2DT7B 2M1BA 3BG9A 3AG2H 2ZJRF 2JK3A 3X2QH 4LLNA 4MQVA 5JLXA 4RB2C 4PJMA 1D0XA 5B1AH 3WTWC 3I59B 3CCSI 1Z6TA 3CCYA 2M5WA 3VYRB 2OV7A 2YS9A 2IA1A 4AWXB 1A36A 2NS7A 4P55A 1K83J 5HLHA 1AOYA 5KAIC 4G12A 3LFUA 3S3MA 2W24A 4L9VA 1LDKB 2EA2A 4EJVA 3G1OA 3TDZC 2VBWA 2ZMEC 5IOYA 1O7FA 1H9TA 5M5XJ 4ZYDA 1VNDA 4QTRA 2E1MB 2FOKA 2X85A 3MFKA 3K1PA 4D5FA 5ILVA 4MHGA 2XPWA 2CV0A 2JZYA 2JRMA 5EGOB 2OU2A 3CC2I 3J81K 2VBYA 1YQAA 1FBSA 4XKBA 2AQEA 2PFBA 4RGSA 1LUJB 1UMQA 3K7AJ 3NRVA 1PYVA 3L2CA 4XLHA 2LG4A 3V7SA 1B1BA 2JSPA 3FMRA 4A69C 2MH9A 4PJLA 2Y2ZA 4NQWB 5LEJA 2PJRB 1TWGJ 1CF7A 3AL0C 1BOAA 4HPQA 4HF0A 5D5XB 1O7LA 2LKPA 3Q9SA 2QSHX 2ZC2A 4DGWB 2J5OA 4M9ZA 2BW3A 4LB6B 5FLXZ 3OYHA 5BMZA 3FK7A 3KZIC 1HSTA 3H35A 3BJOA 3BR3A 3QPTA 4DIQA 2LK2A 1UHMA 2QQAA 3H3UA 3VEPA 4E7IA 2R7ZJ 1PVEA 4FX0A 2LVSA 4FT8A 1UZCA 3ROUA 2CV1A 3K4NA 4FETA 5J1YA 1LQ1A 4JYKA 2VJJA 3CP8A 4XKVA 1SVMA 2Y0MA 2O5RA 3AG4H 1JXSA 3CF2A 4L5JA 3W2WA 2XGEA 3AAFA 4LG3A 3D5LA 1E2XA 3CUQB 2OTLI 1YX3A 3E5UA 2L2OA 3FBNB 1HC8A 1Y1WJ 1D1BA 4NC7A 4WXDA 3DBHB 5FJ8J 1SMTA 3HOSA 1TP4A 1V3FA 2B0LA 2EPFA 1IXRC 2EFQA 1ZRCA 4C2TA 4CYCA 2MD0A 4IO9F 3ZMSA 2UUZA 5EYRA 1AU7A 1ETYA 4A3BJ 3DFGA 1WH5A 1R9TJ 3DPLC 1K6OA 4E6KG 1F5TA 1QGPA 3OSFA 3FXMA 3MAJA 2KRFA 1OCCH 2ZFWA 3ABLH 3J7AY 5D5UB 1BR4A 5JHFA 4V19K 1FOXA 3S2HJ 2E1OA 2DAOA 2L7FP 2V26A 1R4NB 4G8XA 2ID6A 3FDYA 2HEOA 2WB1N 1J75A 2JPCA 4XBFA 4CCJA 3HDDA 3M1CA 1KU7A 3NQOA 4GO1A 1IRXA 2WC2A 1YJWI 4GYGA 4IKFA 1MDMB 2MYSA 1KU2A 4ZYAA 3WODF 3GTPJ 2CO5A 5L3GA 3K4JA 5LLQA 3I0TA 3WTUC 1TNSA 2MABA 1FBUA 3I3LA 4C3JJ 5C4XJ 3QPSA 1LE8A 2CV2A 2RQPA 3KEQA 1EKEA 1WHUA 2LP0A 1FYMA 2O6GE 1MMSA 5IP6A 1S6LA 2KRHA 4AM3A 2OTJI 2CWEA 1U5TB 4UB8C 3PUBA 4HNUA 3HXLA 4PFOA 5TISC 5K5QA 3OYDA 1RKTA 5HS7A 1R71A 2Q2EA 4PJJA 1MJBA 4YFKF 3I56I 4BACA 3I9V2 4RGUA 1VQ9I 2VJ5A 2XRNA 3JRBA 3GEZA 1IDZA 1OQYA 1HLVA 1X3UA 3GF2A 2GLOA 2UV1A 3O3KA 3DQVC 4N0BA 3ZOBA 1ZHFA 4M9SA 3QYBA 3FXLA 1A04A 1XGSA 3FWEA 2V1UA 3DLLF 1D0YA 1REPC 2JA2A 4AD9A 2K40A 4ETSA 3TO6A 2YSRA 2H27A 1LKXA 2LNBA 1D5VA 3I54A 1XS9A 1JUSA 2DMNA 4P1WA 2W4SA 1YYVA 3F6OA 5GAEJ 2QA4I 3DEWA 1T2KA 1IV8A 1FIAA 3G3ZA 2CUZA 2G9WA 1WFXA 4JX5A 4RGRA 1B9MA 2HTJA 2PQ8A 2FEZA 4W1UA 1D8KA 1EJ9A 4J01A 1A35A 3ASOH 2XSJC 2F48A 4YG2F 1HDDC 5EG0A 1QHHD 3E5QA 1IN6A 2PG4A 2MC4A 4LD5A 3H36A 1LFUP 1BOBA 2VPLA 4PGHA 3DBLB 3JREA 1I6XA 3K0LA 4IZZA 4LITA 2D5VA 5J8CA 4RB1A 3GWZA 2V1DA 3DLAA 4U0YA 2R7TA 1IXCA 1QNTA 4XLAA 2HR3A 2H1KA 1TQIA 5D6FA 1D1AA 3QPHA 3MVPA 4A3GJ 2NVXJ 3IH4A 4KN4X 2QQBA 3C18A 2VKHA 4LIUA 3P9CA 2O8KA 1XSXA 3IRQA 2NOJB 5B1BH 4HZFA 4AIHA 2HQNA 3K1MA 2CUEA 1ORKA 4PJ0C 3JSOA 1UAAA 2AS5F 1P7IA 4KIBA 5ICCA 4CCOA 3TP0A 1NK2P 3GTQJ 2PMHA 5BNGA 2TCTA 5H6QA 3ZRGA 4A3IJ 1U2WA 4BS9A 5FGMA 5J8FA 3CCLI 1B72A 3F8NA 4ZTJA 5E3LA 2K5CA 2XF5A 1LDDA 3CUOA 3GCMA 3IP4B 4RBOA 1D5YA 4KUMA 4I02A 1XGNA 1RI7A 1QZYA 3I5UA 4D9JA 4ZYGA 1FP2A 4L18B 2VKDA 1P92A 4EVIA 3ZCOA 3C2GA 3L2WA 1BR2A 1E3HA 3WU2C 2BY0A 4UY8I 2V9PA 3SDGA 3D1NI 1MMGA 1ZGWA 1HKTA 3C2HA 4MQ9F 4BE0A 1DGRM 3LSIA 4L0ZB 4KFCA 1W7PB 4DZPA 3OL3A 2F6CA 1W36C 4PFPA 3OYCA 4BQAA 1WGXA 2ZNYA 4WXCA 2VQGA 3K69A 4C3IJ 1ZG1A 3ML6A 2A69F 1WJFA 2DOEA 3CMMA 4R8HA 3RQIA 3SZGA 3W2AA 3Q0WA 1OMIA 3CLQA 1XPXA 3P7NA 2GAUA 2JPBA 3GTMJ 3ULQB 3FIWA 2F5CA 3HRMA 2V6EA 2K3FA 3F8FA 1YI2I 1MMNA 2L9SA 2Q0OA 3OYMA 1KONA 1J09A 2HOTA 3J80Z 3BJ6A 4RAYA 4FE7A 2UWMA 2NNNA 2XF6A 4M71A 1PUEE 1TBXA 4XRSA 3LAJA 2M30A 4HLYA 5JHUA 2WAEA 3ELKA 1QO0D 2CG4A 2DDBA 5CVJA 3S1MJ 5ERIA 2RGVA 1FOKA 2W00A 4A3MJ 3DEUA 2VOOA 2CQNA 3ONQA 2AXLA 1SFEA 3ZR8X 4EJTA 4RLFA 1P4XA 2K9QA 3ZMTA 1LE8B 4ZZDA 2JJ7A 2L9NA 3Q0UA 2R7SA 1OYYA 2XB5A 1WWXA 2WA0A 5BPDA 4BNCA 2M8GX 1DQUA 3G2BA 1O3QA 4CUGA 3SXYA 3JRIA 1NHAA 2ZBKA 4N9IA 1V54H 3GFJA 4DNCA 1BI2A 1G3YA 3JR9A 3E6CC 3M7GA 5E20A 3KP6A 3VOEA 4F91B 5D8LB 3P9KA 4JBAA 1WQ2A 3BROA 3KPHA 5GADJ 3OYLA 3G4SI 1WJAA 2Z33A 1S9HA 3PSIA 4PSWA 1AA7A 3H0DA 1SFUA 2ZJQF 2CQKA 2X1DA 1AHDP 5LHHA 2KRCA 2EIJH 3TOBA 1DU0A 2HFHA 4F93B 1SFXA 1P9QC 2H6BA 2P7CB 3GLXA 3RKYA 1MSEC 4G6DA 4YELA 3TQNA 1HW1A 1ODDA 2DMQA 2VL8A 4MFDA 3QU6A 4C30A 1YRNA 5DCMA 4YFNF 4U7BA 1RPWA 4V2FA 2JSCA 4F3QA 2LY2A 4E70A 1UHWA 1GXPA 5DUKA 5ICFA 4OMYA 1IG7A 5IP9J 4L0YB 3LA7A 2HXIA 3U1DA 5LHIA 3CJTB 4PCQA 2ESNA 2K9LA 2FX0A 1Z77A 1UJ8A 5C44J 1R1TA 3Q9VA 2CFXA 3A1YA 2RREA 4KIFA 2VE9A 3JRFA 4AYBN 3HM5A 3FM5A 3WGGA 1Z6RA 2BXZA 2DQRA 2VLAA 1ZQ3P 1FOYA 5FKKA 2NRAC 1XC5A 1E0EA 3FXJA 3N97A 2KL4A 5FFZA 2L3DA 1I3AA 2DQLA 4UVAA 4IX7A 2XC7A 3R4KA 1P7JA 4GCVA 4AC0A 2XDVA 1XSVA 2MG4A 2E2HJ 5EGOA 2JVHA 2DJIA 1EH6A 3HC7A 4U7DA 5GTHC 1VQOI 2KQRA 2E7XA 1OCPA 3VODA 2P5KA 4FHTA 2EZLA 1SMYF 4NQWA 2DW4A 5HS8A 2P6TA 4MNUA 1KGSA 3PO2J 1J9IA 1ON1A 2R4GA 3D0SA 3B02A 4LLGF 2VXDA 1A31A 4OMZA 1W7PD 1VQ7I 5A2QK 3EDPA 2GWRA 3CJQB 2RV8A 4IRHA 3W6KB 1FY7A 3JTHA 1QU3A 3S1RJ 3HOUJ 5DEQA 3PO3J 2H94A 2ZXJA 1K78A 2GBYA 2BEOA 3D5SC 4GYIA 2KIUA 1J2XA 5F1JA 3M1EA 4IHYA 2W57A 3PSFA 3IAS2 3SQNA 2VI6A 2VXZA 3I4NJ 3LA2A 3K6GA 2BXYA 2EZKA 2HNHA 1D0ZA 3BR6A 5HLTA 4GRIA 4HDUA 4G6QA 2EV6A 1ZG5A 2WY8Q 2X6WA 1XGOA 3E6DA 3WGIA 3CUQA 2H1LA 2M7BA 1R7JA 3BR5A 4FTHA 2QM3A 5D6EA 2CMPA 2K27A 2YX7A 3CLOA 4YIFA 2Z1DA 3ASNH 1MBEA 2VKEA 4UUSB 1GXQA 3LQRA 5F27A 2DTZA 1LEBA 2X1EA 3ESWB 4G94A 5DUIA 4QIWN 1T6SA 1J7KA 4A0ZA 1FP1D 4KN7X 1BI0A 2HQRA 1OCOH 2LRDA 3CTAA 2LDUA 3SHFA 2LKXA 4A6DA 2FNAA 2G0EA 1BC7C 4Y17A 4ZDPA 2W1OA 4EM0B 2XAJA 2G7UA 2R5YB 2KDOA 5CVVA 4IOCF 1YIJI 3OS2A 2R7QA 4A6EA 1I1GA 5LFAA 2DMPA 4X1EA 1IRZA 2EV5A 4HSTA 1UCRA 3SDBA 2KKOA 1MBFA 1HA8A 4G7HF 1LFBA 4AIJA 3BZKA 4OOIA 3HOXJ 1CQTA 4R1HA 3P9IA 1RC9A 3QRFF 2L7ZA 2M4GA 3MZ8A 3LSRA 3HIFA 3F0CA 5F04A 4AVZA 4G7OF 3ZXSA 1TW3A 4UVCA 1Y8RB 3PJRA 3FZVA 5LGNA 1ZN2A 4BE2A 2GXAA 4FISA 2Y69H 2DU9A 5E8GA 3EYIA 1DPUA 1G3SA 2HZTA 3IKTA 3IC7A 1F9NA 2ZXWH 3LSMA 3KCCA 2DDAA 3HPGA 3PNTA 1T98A 2HZDA 3OR1C 3ZP5A 5BPIA 4WX9A 1FNNA 2DT5A 1JKOC 2ME6A 2NNYA 2L02A 3C7JA 3RPQA 4XM3A 5IPAA 1SVOA 4I0BA 3AFHA 2D45A 1YRNB 4HNTA 5FRNA 1TWHJ 5DCMB 1T38A 4QLCU 4HX7A 2JT1A 5E79C 2EIMH 1N78A 2MA3A 3MN2A 1IV6A 2QKLB 5D4SA 4LB5A 3GTGJ 4M6VA 2IAIA 2CW0F 1L0OC 3PNYA 1R5HA 2VN2A 2BY1A 3OV8A 3SJMA 1IZ1A 3HUGB 1R1VA 3CO6C 1T0FA 5F0HA 3ERED 4PGGA 3Q3SA 2KIFA 2XIGA 2JUCA 1R49A 4BY7J 3BQYA 5FKOA 2E1MC 1OR7A 1XN7A 3M8JA 4BAYA 1KQ9A 1V4RA 1WJDA 4YEJA 2ELKA 4RB0A 4DBRA 1UB9A 4WCGA 2FBHA 5TGTA 2V9VA 5F64A 4RB3C 3I58A 1W5CC 1DUXC 2JVGA 3CCRI 4UXNA 4IHXA 4DYCA 4G7ZF 1RR7A 4XONA 2DPDA 1YX5A 3K10A 3A0HC 4I99C 2LC2A 4G6TB 2BOLA 2PMUA 4OAYA 2DCEA 3FMQA 1D8JA 1HKQA 3J81Z 2XKOA 3CMYA 1WH7A 1QVUA 3DKWA 1L3LA 4FE4A 1BC8C 4IQ4A 5CVIA 3LQQA 1UG2A 2QLZA 3OSGA 1QQIA 3KE2A 1WJ5A 1Q1VA 1ZR2A 5FLMJ 4B47A 2L9RA 3R6SA 5LRSA 2EBIA 4ZTFA 2N8GA 4X6AJ 1O3TA 2D1VA 2M7AA 2V1XA 3FMSA 4B3AA 3LA3A 3OYEA 1USTA 2Z9OA 4XR6A 4A5NA 1HKSA 4IQJA 1BI1A 3HTUA 2WV0A 1TTYA 5F0FA 1ON2A 2V6CA 1R23A 2XPVA 2DFFA 1T33A 2CQQA 1K78B 2JA8J 4A3CJ 2HPIA 3V8JA 2RKHA 1DU6A 3HYIA 3CUQC 1MBGA 3DBRB 1H89C 3T8RA 5K7FA 5JVTA 1X3ZB 2DMTA 5C3EJ 2ME0A 3JCUC 1FPQA 2HOEA 2LBFA 2XROA 4Y3OA 2EIKH 5ILSA 1Z7LA 3DP7A 5HDKA 4A3FJ 4NC8A 1OCZH 4C2MJ 4BXUA 2ISYA 5K7ZA 4HBLA 2HVRA 1S7EA 4XNFA 3I4PA 4ZZLA 2CW7A 3F9KA 6PAXA 1GVDA 1R22A 9ANTA 2WAQN 1YJ9I 4FX4A 1QPIA 1W7PA 4DBQA 3JRAA 1WI3A 5IYCJ 4F7ZA 4NNJA 2JA7J 3GZ5A 4BDYA 3KP2A 3HHGA 4E4HA 1VTNC 2ID3A 2ZFUA 4G9YA 2M34A 3WHBA 3WHCA 1A5JA 3IWZA 2JQ7A 4BKXA 3VDXA 1POGA 2DA4A 2HS5A 4RLQA 2CYYA 5K7HA 3QPLA 4NC6A 1ZLJA 3R0AA 2L7KA 1V5FA 4CCLA 2TDXA 3LOCA 5LGUA 2P0WA 1G6NA 2VASA 3M8FA 1WVRA 4BQNA 2PEXA 1EF4A 3CMAI 2K7LA 2B9SA 5D5VB 4BXXJ 3E3VA 1IJWC 3GTKJ 2DYSH 3SZPA 1STZA 3BQZA 3CZ6A 4ENMA 5IY5H 1U5TC 2FQ4A 1MKMA 2ZJPF 1ONVA 3BP8A 3NWSA 2AXTC 3QOPA 1JUPA 3VYUB 3J7YJ 4RS8A 4DZJA 3ZMZA 3O2PE 1HW5A 4M72A 3HOYJ 3H92A 1JKPC 3G1MA 3ABMH 2X0LA 4W97A 4UNOA 3HKZN 3CCMI 2F5DA 2XB0X 3M07A 2EFOA 2LREA 1YFHA 2IGNA 5IT3A 2HQAA 3GFMA 2WV1A 1J0RA 4Z6YA 4S0HB 3EUHC 3O8GA 1XMXA 5CKTA 1U6GA 3S2DJ 2CFOA 5IYBJ 2Z5UA 5FLVA 1I6HJ 2MC3A 5LD2C 3IKVA 3E1SA 4R79A 1MBJA 2VE8A 3CJNA 3E97A 3DV8A 1WPKA 1UELB 3LSHA 4I01A 1YTYA 1T0FC 2A3SA 1FSEA 3SEQA 5HODA 2WWYA 2X6OA 3GO5A 3IUOA 4NUBA 3GTOJ 1IUYA 3BCAA 4XOTA 4XMYA 1VFCA 3B73A 1ZYRF 2VOPA 1OR7C 4HF2A 1IN8A 3KZYA 4O5VA 2NOGA 4XKCA 3HBLA 2OZUA 1VQKI 1YG2A 2HU9A 4CH7A 2FOWA 2R0QC 3K4MA 1I27A 2DFIA 3CMEI 1F1ZA 1G3TA 3A03A 4I76A 1JTYA 2V1NA 3RZDJ 4IOAF 1PDNC 3DF8A
chains in the Genus database with same CATH topology
1TNTA 2KJBA 2MBFA 2XGXA 4M6YA 2IA2A 4HAMA 1DDNA 5DYMA 3L09A 2PJPA 1R1UA 1BM9A 2QYOA 4XSXF 2PLYA 2H09A 2FA5A 4AVPA 4BHCA 4B09A 4ON0A 5LEKA 3BY6A 1SAXA 2P7VB 3R0JA 2STWA 5K5OA 3KFWX 1HSJA 5FO5A 2F5EA 1YW9A 5TRDA 4U0VA 4Q47A 2DO7A 3TOAA 1WRJA 3GW2A 4M9XA 1CGPA 3ZN1A 2VBXA 2VC0A 3PQKA 4P96A 1K79A 3HRSA 1ZG3A 4HX8A 1XCVA 2XAGA 1P2FA 2OAZA 1XB4A 5ICEA 4HLXA 4HDVA 3WTTC 2R3SA 3ZPLA 2GA2A 1H0MA 4L5IA 1O3RA 5FB2A 3JAMK 1LDJA 2Y48A 4HX4A 1HW2A 4U0WA 2V79A 4A0YA 2F2EA 5EEHA 2BYVE 3QP6A 2FXAA 2BGCA 2OZ6A 2J5PA 1C0WA 1YIOA 2OQGA 3JTGA 2O8XA 4NHJA 2HWVA 4I09A 4M6XA 4OU0A 5D5WB 2FE3A 4P9FA 2HKXA 4ZYHA 3C3WA 1IRFA 3TO7A 2DI3A 3ABTA 3ZMDA 1OYIA 4H0EA 1RUNA 5D4RA 1Z91A 4Q4ZF 2ADUA 3GXOA 2STTA 2VBZA 3VFZA 3F23A 2FSWA 5HDNA 4HW0A 2H6CA 4U88A 3ISPA 1R5GA 2FF4A 1USSA 1MJ9A 1WKMA 3ABUA 5KVRA 3JW4A 5LHGA 1ULYA 2QQ9A 2QVOA 2VODA 4ENNA 1U8RA 1Y0UA 3FXQA 1YW8A 1B9NA 1S7OA 5K1YA 2GA1A 3HUGA 1ZGJA 3MQ0A 4MGRA 2UZKA 1IN7A 2QWWA 4XLNF 1K7AA 1O57A 4B8XA 1IF1A 2Y75A 2VT3A 4EJOA 4MTDA 1PP8F 4ZH4F 4WF2A 3PFIA 1ZGAA 2X4HA 3R60A 4BYYA 1U78A 3F8BA 4L9TA 4AIKA 5BOXA 2IRFG 2L54A 1KU9A 3O6BB 4HYEA 3S2WA 3BDDA 2IA0A 3WGHA 3WG9A 4CYDA 2E1NA 5IT9K 2DBBA 5A2QZ 4OIOF 3GX4X 4MEYF 2ZMEA 2RNJA 4K2EA 4KT5C 2CSOA 5E17F 2MLGA 4IVNA 1FWZA 3F6VA 1S3JA 3GVAA 2PN6A 3RKXA 1DP7P 5E8IA 2O0YA 3EQLF 1RUOA 3C1DA 2K86A 1P6RA 2ETHA 1B6AA 4JK1X 5F1RA 3K1NA 4JQFA 2NAZA 2FBKA 2UXXA 4MEXF 5HS9A 1XMKA 1SD6A 2MH2A 3HSRA 4ASNA 5K5RA 2GIVA 3DXJF 1EH8A 3WU0A 2ACJA 3SZTA 4QWQA 4EM2A 5L3FA 4LG0A 1FYLA 1W5TA 1JE8A 3LWFA 3HOTA 2P4WA 3RKWA 5H6RA 4N9HA 3TGNA 2E1CA 2JTVA 3G73A 2RDPA 1YS6A 4WXHA 1AWCA 2GQQA 1RNLA 2ELHA 4EQQA 2XHKA 4IRIA 2UXNA 3EYYA 1TLHB 3WE3A 3PQJA 2EV0A 1SD7A 4HQMA 3CDHA 2XKPA 2EFWA 4ENJA 4CDGA 4P5OA 1Z7UA 2Q8KA 4NB5A 5CYVA 4YIIA 1XSDA 4UV9A 2HKOA 4LK1F 4Q48A 3RYRA 4IHSA 3IRRA 1KQ0A 4Q5SF 4M74A 4A5MA 1I1SA 3LAPA 1GHCA 2P5VA 3LFKA 2BV6A 2VT2A 4EJWA 1PP7U 2W84A 2XAFA 1U3EM 1IN4A 2PBIA 5L3EA 2NYXA 1BIBA 1KYWA 1B4AA 4ENKA 3T0YA 2YX4A 1IW7F 3V8KA 2L01A 5LBQA 2W85A 2K4BA 4L9JA 1W5SA 2QENA 4IXAA 2ZMEB 1FYKA 3TDUC 1ZRFA 4Y15A 3MWMA 3MEXA 3KEOA 1IXSB 1LNWA 2OD5A 2EFNA 2EB7A 3IL2A 5FLXK 5EEGA 2GXGA 3E6BA 3HSFA 1LB2A 1R58A 1G3WA 2XUBA 3FXUA 3RIRA 3KP3A 1LVAA 4UVBA 4PZJA 4Y13A 3TKYA 2COMA 3BZ6A 5DD4A 5LRRA 2A5YB 2CGPA 3FM3A 3NEUA 4TV7A 2QBYB 2LF8A 3RPUA 1KYZA 3KP4A 2RC4A 3IWFA 1TW2A 1T39A 1RIOH 2VC1A 2ZJ2A 4LG0B 2M8EA 1ZLKA 2WTEA 2PI0A 2JRTA 5L3BA 3E5XA 4KA4A 3ECOA 4OIQF 3K2ZA 2RVCA 1P4WA 3T8TA 1ZRDA 4A0XA 2HYGD 3VB2A 3GZ6A 2QUFA 4HV5A 3W6JB 2FQ3A 5HVQC 2A6HF 2DK8A 1IN5A 2ZKZA 2C6YA 4EM1A 1JHHA 2XASA 2MLKA 5FD5A 2R7DA 2GXBA 1UFMA 5E1ZB 2ISZA 1KA8A 4UUVA 4XRFA 2ZNZA 2DLLA 4LK0F 3U9GA 1XCBA 2HDCA 3ZN0A 1QBJA 2KIMA 3GUDA 1DPRA 2IP2A 2O61A 4CICA 5FD6A 1XMAA 1XDSA 1FX7A 4HQEA 3L9FA 5TJJA 3T5XA 3KETA 5E1WA 3F8MA 2HYFA 2P8TA 3JSPA 1EV7A 4UHTA 4LMYA 1D3YA 2IVMA 5L3CA 3WTSC 2FU4A 2LSOA 3I71A 5AONA 3QU3A 5DCFA 1YW7A 2O03A 2XAQA 3HRTA 1S8NA 5E18F 3J7AO 1LJ9A 1XDUA 5L3DA 1WSUA 2P6SA 3I64A 2OQRA 3F72A 4WWCA 3HHHA 4HA8A 2A61A 1ZAOA 5J6XA 4WK8F 3M8EA 4IHTA 4S05A 4YFXF 4BHPA 3I53A 1CF7B 3BOQA 4I98B 2E7WA 5AIQA 2Z3YA 1F4KA 4XSZF 1H9GA 3F3XA 3DPTA 3GFIA 4O3MA 3U2RA 4EGYA 2L4AA 3M9AA 3R61A 2D2WA 3QAHA 2K4JA 3WTZA 4I2OA 2BBYA 4IPAA 3JAMZ 2ESHA 1E17A 1JGSA 3MZYA 2KJCA 3HRUA 2FMYA 4KMFA 4ZYEA 3SFZA 5LGTA 4M73A 2MD5A 2M87A 2A6EF 4EJUA 4KIGA 5JFRA 3QP5A 3ZMVA 2HTSA 3WTXC 1YO5C 2IT0A 4KYWA 2DK5A 3WE2A 3BJAA 4CO8A 3T1BA 2BE5F 1HQCA 2A07F 3F8CA 4HV6A 4KNYA 1BIAA 1JHFA 1G4DA 2XAHA 1S29A 3J80K 5CJ9A 1KU3A 4BHBA 1MD0A 5ED4A 3BPXA 1TQPA 3V4GA 3ZQ7A 1Z1DA 4RGXA 3REOA 3RJPA 3V8LA 2FNPA 3WTVC 2YPRA 1Q1HA 4GGGA 3OOPA 3ZMUA 5ICGA 1FLIA 2IPQX 1Z05A 1XD7A 2F5FA 5DV5A 3L00A 3KP5A 5BQTA 2HGCA 1YS7A 4BH9A 3GFLA 3WTYC 1B59A 1RZ4A 4GXOA 4A12A 1HXDA 4LGWA 1IRGA 3BWGA 2NS0A 4A2UA 1XGMA 5H20A 3N4MA 3F22A 1FC3A 2YR2A 1YLFA 1BN5A 1MJAA 3Q5FA 1R00A 1SD5A 1LEAA 4LJZF 4HF1A 1MZBA 5DD8A 3MZHA 2FBIA 4ESJA 2QZ8A 2IW5A 4EV0A 2M45A 2XV4S 5HLIA 3FX3A 4Z2YA 3I59A 4HOBA 3E6MA 5KK1A 3WU1B 4O6JA 2FMLA 1BJAA 4LFUA 1MGTA 2K02A 1Z9CA 2ZCWA 4LLLA 5JR3A 1W4MA 3GYHX 4I0AA 4EMSA 5IT9Z 1FZPB 3V7RA 2O3FA 4UV8A 5FFXA 1SD4A 3RDIA 4CZZA 3F21A 3KLNA 4KICA 1I5ZA 3KP7A 3L7WA 2EWNA 5CVRA 4OIPF 1FSHA 4KDPA 2L4MA 2A68F 2R7FA 2W25A 3BPVA 1FT9A 2D1HA 5D8KB 5BS6A 2P5LC 1BI3A 4I7HA 3KLOA 1OPCA 3HTSB 1FBQA 2FRHA 4RAZA 1OYWA 3EETA 3COAC 3RYPA 1ZARA 3H3ZA 5HLGA 4D0PA 5AIPA 1QPMA 1ZREA 3CO7C 1OKRA 5HDGA 2EK5A 2LF7A 5DDGA 4IF4A 2QBYA 1J59A 1TQMA 4KMUX 1EH7A 4CHUA 4IJAA 2G7HA 1P4AA 3KZZA 3RI4A 5CVUA 2OBPA 2DPUA 2XVCA 2ZO4A 3IHUA 1BBYA 1GVJA 3FF5A 1IAWA 1WI9A 1ZH5A 1S7AA 2EFPA 4EGZA 4DQ2A 2RN7A 3RTRA 5JI6A 3TO9A 3MCZA 4OINF 1MDMA 3FHZA 5ILUA 2VONA 4P9UA 5E1XA 1R36A 4CXFA 4L9NA 4IRGA 3ECHA 4S04A 1HBXG 5HOOA 1U5TA 4CGZA 2YU3A 2DTRA 4MTEA 3FXRA 3LSTA 4ESBA 1KQ8A 1QZZA 2OA4A 1J5YA 2EJRA 4OIRF 2GZWA 5CLSA 4ESFA 4XLPF 2EA4A 3HSEA 3EUHA 3V7CA 5F6FA 3K9TA 1O3SA 4PDKA 2IJLA 2Z99A 2M1BA 4LLNA 4MQVA 4RB2C 3WTWC 3I59B 1Z6TA 2M5WA 2IA1A 4AWXB 4P55A 5HLHA 1AOYA 2W24A 4L9VA 1LDKB 2EA2A 4EJVA 3TDZC 2VBWA 1O7FA 1H9TA 4ZYDA 2FOKA 3MFKA 3K1PA 5ILVA 4MHGA 2JZYA 2OU2A 3J81K 2VBYA 1YQAA 1FBSA 2PFBA 4RGSA 3NRVA 3L2CA 3V7SA 1B1BA 3FMRA 2MH9A 5LEJA 1CF7A 1BOAA 4HF0A 5D5XB 1O7LA 2LKPA 3Q9SA 2J5OA 4M9ZA 4LB6B 5FLXZ 5BMZA 1HSTA 3BJOA 3QPTA 1UHMA 2QQAA 3H3UA 3VEPA 4FX0A 4FT8A 3ROUA 1LQ1A 2Y0MA 1JXSA 4L5JA 3AAFA 3D5LA 1E2XA 3CUQB 3E5UA 4WXDA 1SMTA 3HOSA 1V3FA 2B0LA 1IXRC 2EFQA 1ZRCA 3ZMSA 3DFGA 3DPLC 1K6OA 1F5TA 1QGPA 3MAJA 2KRFA 2ZFWA 5D5UB 2DAOA 4G8XA 2HEOA 1J75A 2JPCA 4XBFA 1KU7A 3NQOA 4GO1A 2WC2A 4GYGA 1MDMB 1KU2A 3WODF 2CO5A 5L3GA 5LLQA 3I0TA 3WTUC 1TNSA 1FBUA 2RQPA 3KEQA 1FYMA 2O6GE 1S6LA 2CWEA 1U5TB 5K5QA 5HS7A 2Q2EA 4YFKF 1MJBA 4RGUA 2XRNA 3GEZA 1X3UA 3GF2A 3O3KA 3DQVC 4N0BA 1ZHFA 4M9SA 1A04A 1XGSA 3FWEA 2V1UA 1REPC 4AD9A 4ETSA 3TO6A 2YSRA 2H27A 2LNBA 1D5VA 3I54A 1YYVA 3F6OA 1T2KA 3G3ZA 2G9WA 4RGRA 1B9MA 2HTJA 2PQ8A 2FEZA 1D8KA 4YG2F 3E5QA 1IN6A 2PG4A 4LD5A 4PGHA 1I6XA 3K0LA 5J8CA 4RB1A 3GWZA 2V1DA 4U0YA 1IXCA 1QNTA 2HR3A 1TQIA 5D6FA 3QPHA 4KN4X 2QQBA 3C18A 3P9CA 1XSXA 3IRQA 4AIHA 4HZFA 2HQNA 3K1MA 3JSOA 2AS5F 4KIBA 5ICCA 2PMHA 5H6QA 1U2WA 5FGMA 5J8FA 3F8NA 1LDDA 3CUOA 4KUMA 4I02A 1XGNA 1RI7A 1QZYA 3I5UA 4ZYGA 4L18B 1FP2A 1P92A 4EVIA 1HKTA 4MQ9F 4L0ZB 4KFCA 1W7PB 4BQAA 2ZNYA 4WXCA 3K69A 1ZG1A 3ML6A 2A69F 4R8HA 1OMIA 3P7NA 2GAUA 2JPBA 3ULQB 2F5CA 3HRMA 3F8FA 2Q0OA 3J80Z 3BJ6A 4RAYA 2UWMA 2NNNA 1PUEE 4M71A 1TBXA 4HLYA 3LAJA 2M30A 5JHUA 3ELKA 1QO0D 2CG4A 5CVJA 5ERIA 2RGVA 1FOKA 3DEUA 2VOOA 2AXLA 1SFEA 4EJTA 1P4XA 3ZMTA 4ZZDA 1OYYA 1WWXA 5BPDA 4BNCA 1O3QA 3SXYA 1NHAA 2ZBKA 4N9IA 4DNCA 3GFJA 1BI2A 1G3YA 3E6CC 3M7GA 5E20A 3KP6A 3VOEA 5D8LB 3P9KA 4JBAA 1WQ2A 3BROA 2Z33A 1SFUA 2CQKA 5LHHA 3TOBA 2HFHA 1SFXA 2H6BA 2P7CB 3GLXA 3RKYA 4G6DA 3TQNA 1HW1A 1ODDA 3QU6A 5DCMA 4YFNF 4U7BA 2JSCA 4E70A 1UHWA 1GXPA 5DUKA 5ICFA 4OMYA 4L0YB 3LA7A 3U1DA 5LHIA 4PCQA 2ESNA 1R1TA 3Q9VA 2CFXA 4KIFA 2VE9A 3FM5A 3WGGA 1Z6RA 2DQRA 2NRAC 3N97A 5FFZA 2L3DA 2DQLA 4UVAA 3R4KA 4GCVA 1XSVA 1EH6A 4U7DA 2E7XA 3VODA 2P5KA 4FHTA 1SMYF 4NQWA 2DW4A 5HS8A 2P6TA 4MNUA 1KGSA 1J9IA 1ON1A 3D0SA 3B02A 4LLGF 4OMZA 1W7PD 5A2QK 3EDPA 2GWRA 2RV8A 4IRHA 3W6KB 1FY7A 3JTHA 5DEQA 2H94A 2ZXJA 1K78A 2BEOA 4GYIA 2KIUA 1J2XA 3M1EA 2W57A 3SQNA 2VXZA 3LA2A 4HDUA 4G6QA 2EV6A 1ZG5A 3E6DA 1XGOA 3WGIA 3CUQA 1R7JA 2QM3A 5D6EA 2K27A 2YX7A 3CLOA 4YIFA 1GXQA 3LQRA 1LEBA 5DUIA 4G94A 1T6SA 1J7KA 4A0ZA 1FP1D 4KN7X 1BI0A 2HQRA 3CTAA 2LDUA 3SHFA 4A6DA 2FNAA 1BC7C 4Y17A 4EM0B 2XAJA 2G7UA 5CVVA 4A6EA 1I1GA 2EV5A 1UCRA 2KKOA 4G7HF 4AIJA 4OOIA 4R1HA 3P9IA 3QRFF 3HIFA 4G7OF 1TW3A 4UVCA 3FZVA 5LGNA 1ZN2A 2DU9A 5E8GA 3EYIA 1DPUA 1G3SA 2HZTA 3IKTA 3IC7A 1F9NA 3KCCA 1T98A 3ZP5A 5BPIA 4WX9A 1FNNA 2DT5A 2NNYA 2L02A 3C7JA 3RPQA 4I0BA 2D45A 5DCMB 1T38A 4QLCU 4HX7A 2JT1A 2MA3A 5D4SA 4LB5A 2CW0F 1L0OC 1R5HA 2VN2A 3OV8A 1IZ1A 1R1VA 3CO6C 1T0FA 3ERED 4PGGA 2KIFA 2XIGA 1OR7A 1XN7A 4BAYA 1KQ9A 1V4RA 4RB0A 1UB9A 4WCGA 2FBHA 2V9VA 5F64A 4RB3C 3I58A 1DUXC 4UXNA 4G7ZF 2DPDA 2PMUA 3FMQA 1D8JA 1HKQA 3J81Z 2XKOA 3DKWA 1L3LA 1BC8C 5CVIA 3LQQA 2QLZA 1QQIA 3KE2A 3R6SA 5LRSA 1O3TA 2D1VA 2V1XA 3FMSA 3LA3A 1USTA 2Z9OA 4A5NA 1HKSA 1BI1A 3HTUA 2WV0A 1TTYA 1ON2A 2V6CA 1R23A 1K78B 3V8JA 2RKHA 3HYIA 3CUQC 3T8RA 5JVTA 1FPQA 2HOEA 2XROA 5ILSA 3DP7A 5HDKA 4BXUA 2ISYA 4HBLA 3I4PA 4ZZLA 6PAXA 1R22A 4FX4A 1W7PA 4F7ZA 3GZ5A 3KP2A 3HHGA 1VTNC 4G9YA 3IWZA 2HS5A 2CYYA 1ZLJA 3R0AA 2TDXA 5LGUA 1G6NA 3M8FA 2PEXA 2K7LA 5D5VB 3E3VA 3SZPA 1STZA 4ENMA 1U5TC 1MKMA 1ONVA 3BP8A 3QOPA 4RS8A 3ZMZA 3O2PE 1HW5A 4M72A 3H92A 2X0LA 4UNOA 2F5DA 2EFOA 1YFHA 5IT3A 3GFMA 1J0RA 1U6GA 2Z5UA 2MC3A 3IKVA 4R79A 2VE8A 3CJNA 3E97A 3DV8A 4I01A 1YTYA 2A3SA 1FSEA 2WWYA 3GO5A 1IUYA 3B73A 1ZYRF 2VOPA 4HF2A 1IN8A 3KZYA 4O5VA 2OZUA 1YG2A 1I27A 2DFIA 1F1ZA 1G3TA 1PDNC 3DF8A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1TNT A;  2KJB A;  2MBF A;  2XGX A;  4M6Y A;  2IA2 A;  4HAM A;  1DDN A;  5DYM A;  3L09 A;  2PJP A;  1R1U A;  1BM9 A;  2QYO A;  4XSX F;  2PLY A;  2H09 A;  2FA5 A;  4AVP A;  4BHC A;  4B09 A;  4ON0 A;  5LEK A;  3BY6 A;  1SAX A;  2P7V B;  3R0J A;  2STW A;  5K5O A;  3KFW X;  1HSJ A;  5FO5 A;  2F5E A;  1YW9 A;  5TRD A;  4U0V A;  4Q47 A;  2DO7 A;  3TOA A;  1WRJ A;  3GW2 A;  4M9X A;  1CGP A;  3ZN1 A;  2VBX A;  2VC0 A;  3PQK A;  4P96 A;  1K79 A;  3HRS A;  1ZG3 A;  4HX8 A;  1XCV A;  2XAG A;  1P2F A;  2OAZ A;  1XB4 A;  5ICE A;  4HLX A;  4HDV A;  3WTT C;  2R3S A;  3ZPL A;  2GA2 A;  1H0M A;  4L5I A;  1O3R A;  5FB2 A;  3JAM K;  1LDJ A;  2Y48 A;  4HX4 A;  1HW2 A;  4U0W A;  2V79 A;  4A0Y A;  2F2E A;  5EEH A;  2BYV E;  3QP6 A;  2FXA A;  2BGC A;  2OZ6 A;  2J5P A;  1C0W A;  1YIO A;  2OQG A;  3JTG A;  2O8X A;  4NHJ A;  2HWV A;  4I09 A;  4M6X A;  4OU0 A;  5D5W B;  2FE3 A;  4P9F A;  2HKX A;  4ZYH A;  3C3W A;  1IRF A;  3TO7 A;  2DI3 A;  3ABT A;  3ZMD A;  1OYI A;  4H0E A;  1RUN A;  5D4R A;  1Z91 A;  4Q4Z F;  2ADU A;  3GXO A;  2STT A;  2VBZ A;  3VFZ A;  3F23 A;  2FSW A;  5HDN A;  4HW0 A;  2H6C A;  4U88 A;  3ISP A;  1R5G A;  2FF4 A;  1USS A;  1MJ9 A;  1WKM A;  3ABU A;  5KVR A;  3JW4 A;  5LHG A;  1ULY A;  2QQ9 A;  2QVO A;  2VOD A;  4ENN A;  1U8R A;  1Y0U A;  3FXQ A;  1YW8 A;  1B9N A;  1S7O A;  5K1Y A;  2GA1 A;  3HUG A;  1ZGJ A;  3MQ0 A;  4MGR A;  2UZK A;  1IN7 A;  2QWW A;  4XLN F;  1K7A A;  1O57 A;  4B8X A;  1IF1 A;  2Y75 A;  2VT3 A;  4EJO A;  4MTD A;  1PP8 F;  4ZH4 F;  4WF2 A;  3PFI A;  1ZGA A;  2X4H A;  3R60 A;  4BYY A;  1U78 A;  3F8B A;  4L9T A;  4AIK A;  5BOX A;  2IRF G;  2L54 A;  1KU9 A;  3O6B B;  4HYE A;  3S2W A;  3BDD A;  2IA0 A;  3WGH A;  3WG9 A;  4CYD A;  2E1N A;  5IT9 K;  2DBB A;  5A2Q Z;  4OIO F;  3GX4 X;  4MEY F;  2ZME A;  2RNJ A;  4K2E A;  4KT5 C;  2CSO A;  5E17 F;  2MLG A;  4IVN A;  1FWZ A;  3F6V A;  1S3J A;  3GVA A;  2PN6 A;  3RKX A;  1DP7 P;  5E8I A;  2O0Y A;  3EQL F;  1RUO A;  3C1D A;  2K86 A;  1P6R A;  2ETH A;  1B6A A;  4JK1 X;  5F1R A;  3K1N A;  4JQF A;  2NAZ A;  2FBK A;  2UXX A;  4MEX F;  5HS9 A;  1XMK A;  1SD6 A;  2MH2 A;  3HSR A;  4ASN A;  5K5R A;  2GIV A;  3DXJ F;  1EH8 A;  3WU0 A;  2ACJ A;  3SZT A;  4QWQ A;  4EM2 A;  5L3F A;  4LG0 A;  1FYL A;  1W5T A;  1JE8 A;  3LWF A;  3HOT A;  2P4W A;  3RKW A;  5H6R A;  4N9H A;  3TGN A;  2E1C A;  2JTV A;  3G73 A;  2RDP A;  1YS6 A;  4WXH A;  1AWC A;  2GQQ A;  1RNL A;  2ELH A;  4EQQ A;  2XHK A;  4IRI A;  2UXN A;  3EYY A;  1TLH B;  3WE3 A;  3PQJ A;  2EV0 A;  1SD7 A;  4HQM A;  3CDH A;  2XKP A;  2EFW A;  4ENJ A;  4CDG A;  4P5O A;  1Z7U A;  2Q8K A;  4NB5 A;  5CYV A;  4YII A;  1XSD A;  4UV9 A;  2HKO A;  4LK1 F;  4Q48 A;  3RYR A;  4IHS A;  3IRR A;  1KQ0 A;  4Q5S F;  4M74 A;  4A5M A;  1I1S A;  3LAP A;  1GHC A;  2P5V A;  3LFK A;  2BV6 A;  2VT2 A;  4EJW A;  1PP7 U;  2W84 A;  2XAF A;  1U3E M;  1IN4 A;  2PBI A;  5L3E A;  2NYX A;  1BIB A;  1KYW A;  1B4A A;  4ENK A;  3T0Y A;  2YX4 A;  1IW7 F;  3V8K A;  2L01 A;  5LBQ A;  2W85 A;  2K4B A;  4L9J A;  1W5S A;  2QEN A;  4IXA A;  2ZME B;  1FYK A;  3TDU C;  1ZRF A;  4Y15 A;  3MWM A;  3MEX A;  3KEO A;  1IXS B;  1LNW A;  2OD5 A;  2EFN A;  2EB7 A;  3IL2 A;  5FLX K;  5EEG A;  2GXG A;  3E6B A;  3HSF A;  1LB2 A;  1R58 A;  1G3W A;  2XUB A;  3FXU A;  3RIR A;  3KP3 A;  1LVA A;  4UVB A;  4PZJ A;  4Y13 A;  3TKY A;  2COM A;  3BZ6 A;  5DD4 A;  5LRR A;  2A5Y B;  2CGP A;  3FM3 A;  3NEU A;  4TV7 A;  2QBY B;  2LF8 A;  3RPU A;  1KYZ A;  3KP4 A;  2RC4 A;  3IWF A;  1TW2 A;  1T39 A;  1RIO H;  2VC1 A;  2ZJ2 A;  4LG0 B;  2M8E A;  1ZLK A;  2WTE A;  2PI0 A;  2JRT A;  5L3B A;  3E5X A;  4KA4 A;  3ECO A;  4OIQ F;  3K2Z A;  2RVC A;  1P4W A;  3T8T A;  1ZRD A;  4A0X A;  2HYG D;  3VB2 A;  3GZ6 A;  2QUF A;  4HV5 A;  3W6J B;  2FQ3 A;  5HVQ C;  2A6H F;  2DK8 A;  1IN5 A;  2ZKZ A;  2C6Y A;  4EM1 A;  1JHH A;  2XAS A;  2MLK A;  5FD5 A;  2R7D A;  2GXB A;  1UFM A;  5E1Z B;  2ISZ A;  1KA8 A;  4UUV A;  4XRF A;  2ZNZ A;  2DLL A;  4LK0 F;  3U9G A;  1XCB A;  2HDC A;  3ZN0 A;  1QBJ A;  2KIM A;  3GUD A;  1DPR A;  2IP2 A;  2O61 A;  4CIC A;  5FD6 A;  1XMA A;  1XDS A;  1FX7 A;  4HQE A;  3L9F A;  5TJJ A;  3T5X A;  3KET A;  5E1W A;  3F8M A;  2HYF A;  2P8T A;  3JSP A;  1EV7 A;  4UHT A;  4LMY A;  1D3Y A;  2IVM A;  5L3C A;  3WTS C;  2FU4 A;  2LSO A;  3I71 A;  5AON A;  3QU3 A;  5DCF A;  1YW7 A;  2O03 A;  2XAQ A;  3HRT A;  1S8N A;  5E18 F;  3J7A O;  1LJ9 A;  1XDU A;  5L3D A;  1WSU A;  2P6S A;  3I64 A;  2OQR A;  3F72 A;  4WWC A;  3HHH A;  4HA8 A;  2A61 A;  1ZAO A;  5J6X A;  4WK8 F;  3M8E A;  4IHT A;  4S05 A;  4YFX F;  4BHP A;  3I53 A;  1CF7 B;  3BOQ A;  4I98 B;  2E7W A;  5AIQ A;  2Z3Y A;  1F4K A;  4XSZ F;  1H9G A;  3F3X A;  3DPT A;  3GFI A;  4O3M A;  3U2R A;  4EGY A;  2L4A A;  3M9A A;  3R61 A;  2D2W A;  3QAH A;  2K4J A;  3WTZ A;  4I2O A;  2BBY A;  4IPA A;  3JAM Z;  2ESH A;  1E17 A;  1JGS A;  3MZY A;  2KJC A;  3HRU A;  2FMY A;  4KMF A;  4ZYE A;  3SFZ A;  5LGT A;  4M73 A;  2MD5 A;  2M87 A;  2A6E F;  4EJU A;  4KIG A;  5JFR A;  3QP5 A;  3ZMV A;  2HTS A;  3WTX C;  1YO5 C;  2IT0 A;  4KYW A;  2DK5 A;  3WE2 A;  3BJA A;  4CO8 A;  3T1B A;  2BE5 F;  1HQC A;  2A07 F;  3F8C A;  4HV6 A;  4KNY A;  1BIA A;  1JHF A;  1G4D A;  2XAH A;  1S29 A;  3J80 K;  5CJ9 A;  1KU3 A;  4BHB A;  1MD0 A;  5ED4 A;  3BPX A;  1TQP A;  3V4G A;  3ZQ7 A;  1Z1D A;  4RGX A;  3REO A;  3RJP A;  3V8L A;  2FNP A;  3WTV C;  2YPR A;  1Q1H A;  4GGG A;  3OOP A;  3ZMU A;  5ICG A;  1FLI A;  2IPQ X;  1Z05 A;  1XD7 A;  2F5F A;  5DV5 A;  3L00 A;  3KP5 A;  5BQT A;  2HGC A;  1YS7 A;  4BH9 A;  3GFL A;  3WTY C;  1B59 A;  1RZ4 A;  4GXO A;  4A12 A;  1HXD A;  4LGW A;  1IRG A;  3BWG A;  2NS0 A;  4A2U A;  1XGM A;  5H20 A;  3N4M A;  3F22 A;  1FC3 A;  2YR2 A;  1YLF A;  1BN5 A;  1MJA A;  3Q5F A;  1R00 A;  1SD5 A;  1LEA A;  4LJZ F;  4HF1 A;  1MZB A;  5DD8 A;  3MZH A;  2FBI A;  4ESJ A;  2QZ8 A;  2IW5 A;  4EV0 A;  2M45 A;  2XV4 S;  5HLI A;  3FX3 A;  4Z2Y A;  3I59 A;  4HOB A;  3E6M A;  5KK1 A;  3WU1 B;  4O6J A;  2FML A;  1BJA A;  4LFU A;  1MGT A;  2K02 A;  1Z9C A;  2ZCW A;  4LLL A;  5JR3 A;  1W4M A;  3GYH X;  4I0A A;  4EMS A;  5IT9 Z;  1FZP B;  3V7R A;  2O3F A;  4UV8 A;  5FFX A;  1SD4 A;  3RDI A;  4CZZ A;  3F21 A;  3KLN A;  4KIC A;  1I5Z A;  3KP7 A;  3L7W A;  2EWN A;  5CVR A;  4OIP F;  1FSH A;  4KDP A;  2L4M A;  2A68 F;  2R7F A;  2W25 A;  3BPV A;  1FT9 A;  2D1H A;  5D8K B;  5BS6 A;  2P5L C;  1BI3 A;  4I7H A;  3KLO A;  1OPC A;  3HTS B;  1FBQ A;  2FRH A;  4RAZ A;  1OYW A;  3EET A;  3COA C;  3RYP A;  1ZAR A;  3H3Z A;  5HLG A;  4D0P A;  5AIP A;  1QPM A;  1ZRE A;  3CO7 C;  1OKR A;  5HDG A;  2EK5 A;  2LF7 A;  5DDG A;  4IF4 A;  2QBY A;  1J59 A;  1TQM A;  4KMU X;  1EH7 A;  4CHU A;  4IJA A;  2G7H A;  1P4A A;  3KZZ A;  3RI4 A;  5CVU A;  2OBP A;  2DPU A;  2XVC A;  2ZO4 A;  3IHU A;  1BBY A;  1GVJ A;  3FF5 A;  1IAW A;  1WI9 A;  1ZH5 A;  1S7A A;  2EFP A;  4EGZ A;  4DQ2 A;  2RN7 A;  3RTR A;  5JI6 A;  3TO9 A;  3MCZ A;  4OIN F;  1MDM A;  3FHZ A;  5ILU A;  2VON A;  4P9U A;  5E1X A;  1R36 A;  4CXF A;  4L9N A;  4IRG A;  3ECH A;  4S04 A;  1HBX G;  5HOO A;  1U5T A;  4CGZ A;  2YU3 A;  2DTR A;  4MTE A;  3FXR A;  3LST A;  4ESB A;  1KQ8 A;  1QZZ A;  2OA4 A;  1J5Y A;  2EJR A;  4OIR F;  2GZW A;  5CLS A;  4ESF A;  4XLP F;  2EA4 A;  3HSE A;  3EUH A;  3V7C A;  5F6F A;  3K9T A;  1O3S A;  4PDK A;  2IJL A;  2Z99 A;  2M1B A;  4LLN A;  4MQV A;  4RB2 C;  3WTW C;  3I59 B;  1Z6T A;  2M5W A;  2IA1 A;  4AWX B;  4P55 A;  5HLH A;  1AOY A;  2W24 A;  4L9V A;  1LDK B;  2EA2 A;  4EJV A;  3TDZ C;  2VBW A;  1O7F A;  1H9T A;  4ZYD A;  2FOK A;  3MFK A;  3K1P A;  5ILV A;  4MHG A;  2JZY A;  2OU2 A;  3J81 K;  2VBY A;  1YQA A;  1FBS A;  2PFB A;  4RGS A;  3NRV A;  3L2C A;  3V7S A;  1B1B A;  3FMR A;  2MH9 A;  5LEJ A;  1CF7 A;  1BOA A;  4HF0 A;  5D5X B;  1O7L A;  2LKP A;  3Q9S A;  2J5O A;  4M9Z A;  4LB6 B;  5FLX Z;  5BMZ A;  1HST A;  3BJO A;  3QPT A;  1UHM A;  2QQA A;  3H3U A;  3VEP A;  4FX0 A;  4FT8 A;  3ROU A;  1LQ1 A;  2Y0M A;  1JXS A;  4L5J A;  3AAF A;  3D5L A;  1E2X A;  3CUQ B;  3E5U A;  4WXD A;  1SMT A;  3HOS A;  1V3F A;  2B0L A;  1IXR C;  2EFQ A;  1ZRC A;  3ZMS A;  3DFG A;  3DPL C;  1K6O A;  1F5T A;  1QGP A;  3MAJ A;  2KRF A;  2ZFW A;  5D5U B;  2DAO A;  4G8X A;  2HEO A;  1J75 A;  2JPC A;  4XBF A;  1KU7 A;  3NQO A;  4GO1 A;  2WC2 A;  4GYG A;  1MDM B;  1KU2 A;  3WOD F;  2CO5 A;  5L3G A;  5LLQ A;  3I0T A;  3WTU C;  1TNS A;  1FBU A;  2RQP A;  3KEQ A;  1FYM A;  2O6G E;  1S6L A;  2CWE A;  1U5T B;  5K5Q A;  5HS7 A;  2Q2E A;  4YFK F;  1MJB A;  4RGU A;  2XRN A;  3GEZ A;  1X3U A;  3GF2 A;  3O3K A;  3DQV C;  4N0B A;  1ZHF A;  4M9S A;  1A04 A;  1XGS A;  3FWE A;  2V1U A;  1REP C;  4AD9 A;  4ETS A;  3TO6 A;  2YSR A;  2H27 A;  2LNB A;  1D5V A;  3I54 A;  1YYV A;  3F6O A;  1T2K A;  3G3Z A;  2G9W A;  4RGR A;  1B9M A;  2HTJ A;  2PQ8 A;  2FEZ A;  1D8K A;  4YG2 F;  3E5Q A;  1IN6 A;  2PG4 A;  4LD5 A;  4PGH A;  1I6X A;  3K0L A;  5J8C A;  4RB1 A;  3GWZ A;  2V1D A;  4U0Y A;  1IXC A;  1QNT A;  2HR3 A;  1TQI A;  5D6F A;  3QPH A;  4KN4 X;  2QQB A;  3C18 A;  3P9C A;  1XSX A;  3IRQ A;  4AIH A;  4HZF A;  2HQN A;  3K1M A;  3JSO A;  2AS5 F;  4KIB A;  5ICC A;  2PMH A;  5H6Q A;  1U2W A;  5FGM A;  5J8F A;  3F8N A;  1LDD A;  3CUO A;  4KUM A;  4I02 A;  1XGN A;  1RI7 A;  1QZY A;  3I5U A;  4ZYG A;  4L18 B;  1FP2 A;  1P92 A;  4EVI A;  1HKT A;  4MQ9 F;  4L0Z B;  4KFC A;  1W7P B;  4BQA A;  2ZNY A;  4WXC A;  3K69 A;  1ZG1 A;  3ML6 A;  2A69 F;  4R8H A;  1OMI A;  3P7N A;  2GAU A;  2JPB A;  3ULQ B;  2F5C A;  3HRM A;  3F8F A;  2Q0O A;  3J80 Z;  3BJ6 A;  4RAY A;  2UWM A;  2NNN A;  1PUE E;  4M71 A;  1TBX A;  4HLY A;  3LAJ A;  2M30 A;  5JHU A;  3ELK A;  1QO0 D;  2CG4 A;  5CVJ A;  5ERI A;  2RGV A;  1FOK A;  3DEU A;  2VOO A;  2AXL A;  1SFE A;  4EJT A;  1P4X A;  3ZMT A;  4ZZD A;  1OYY A;  1WWX A;  5BPD A;  4BNC A;  1O3Q A;  3SXY A;  1NHA A;  2ZBK A;  4N9I A;  4DNC A;  3GFJ A;  1BI2 A;  1G3Y A;  3E6C C;  3M7G A;  5E20 A;  3KP6 A;  3VOE A;  5D8L B;  3P9K A;  4JBA A;  1WQ2 A;  3BRO A;  2Z33 A;  1SFU A;  2CQK A;  5LHH A;  3TOB A;  2HFH A;  1SFX A;  2H6B A;  2P7C B;  3GLX A;  3RKY A;  4G6D A;  3TQN A;  1HW1 A;  1ODD A;  3QU6 A;  5DCM A;  4YFN F;  4U7B A;  2JSC A;  4E70 A;  1UHW A;  1GXP A;  5DUK A;  5ICF A;  4OMY A;  4L0Y B;  3LA7 A;  3U1D A;  5LHI A;  4PCQ A;  2ESN A;  1R1T A;  3Q9V A;  2CFX A;  4KIF A;  2VE9 A;  3FM5 A;  3WGG A;  1Z6R A;  2DQR A;  2NRA C;  3N97 A;  5FFZ A;  2L3D A;  2DQL A;  4UVA A;  3R4K A;  4GCV A;  1XSV A;  1EH6 A;  4U7D A;  2E7X A;  3VOD A;  2P5K A;  4FHT A;  1SMY F;  4NQW A;  2DW4 A;  5HS8 A;  2P6T A;  4MNU A;  1KGS A;  1J9I A;  1ON1 A;  3D0S A;  3B02 A;  4LLG F;  4OMZ A;  1W7P D;  5A2Q K;  3EDP A;  2GWR A;  2RV8 A;  4IRH A;  3W6K B;  1FY7 A;  3JTH A;  5DEQ A;  2H94 A;  2ZXJ A;  1K78 A;  2BEO A;  4GYI A;  2KIU A;  1J2X A;  3M1E A;  2W57 A;  3SQN A;  2VXZ A;  3LA2 A;  4HDU A;  4G6Q A;  2EV6 A;  1ZG5 A;  3E6D A;  1XGO A;  3WGI A;  3CUQ A;  1R7J A;  2QM3 A;  5D6E A;  2K27 A;  2YX7 A;  3CLO A;  4YIF A;  1GXQ A;  3LQR A;  1LEB A;  5DUI A;  4G94 A;  1T6S A;  1J7K A;  4A0Z A;  1FP1 D;  4KN7 X;  1BI0 A;  2HQR A;  3CTA A;  2LDU A;  3SHF A;  4A6D A;  2FNA A;  1BC7 C;  4Y17 A;  4EM0 B;  2XAJ A;  2G7U A;  5CVV A;  4A6E A;  1I1G A;  2EV5 A;  1UCR A;  2KKO A;  4G7H F;  4AIJ A;  4OOI A;  4R1H A;  3P9I A;  3QRF F;  3HIF A;  4G7O F;  1TW3 A;  4UVC A;  3FZV A;  5LGN A;  1ZN2 A;  2DU9 A;  5E8G A;  3EYI A;  1DPU A;  1G3S A;  2HZT A;  3IKT A;  3IC7 A;  1F9N A;  3KCC A;  1T98 A;  3ZP5 A;  5BPI A;  4WX9 A;  1FNN A;  2DT5 A;  2NNY A;  2L02 A;  3C7J A;  3RPQ A;  4I0B A;  2D45 A;  5DCM B;  1T38 A;  4QLC U;  4HX7 A;  2JT1 A;  2MA3 A;  5D4S A;  4LB5 A;  2CW0 F;  1L0O C;  1R5H A;  2VN2 A;  3OV8 A;  1IZ1 A;  1R1V A;  3CO6 C;  1T0F A;  3ERE D;  4PGG A;  2KIF A;  2XIG A;  1OR7 A;  1XN7 A;  4BAY A;  1KQ9 A;  1V4R A;  4RB0 A;  1UB9 A;  4WCG A;  2FBH A;  2V9V A;  5F64 A;  4RB3 C;  3I58 A;  1DUX C;  4UXN A;  4G7Z F;  2DPD A;  2PMU A;  3FMQ A;  1D8J A;  1HKQ A;  3J81 Z;  2XKO A;  3DKW A;  1L3L A;  1BC8 C;  5CVI A;  3LQQ A;  2QLZ A;  1QQI A;  3KE2 A;  3R6S A;  5LRS A;  1O3T A;  2D1V A;  2V1X A;  3FMS A;  3LA3 A;  1UST A;  2Z9O A;  4A5N A;  1HKS A;  1BI1 A;  3HTU A;  2WV0 A;  1TTY A;  1ON2 A;  2V6C A;  1R23 A;  1K78 B;  3V8J A;  2RKH A;  3HYI A;  3CUQ C;  3T8R A;  5JVT A;  1FPQ A;  2HOE A;  2XRO A;  5ILS A;  3DP7 A;  5HDK A;  4BXU A;  2ISY A;  4HBL A;  3I4P A;  4ZZL A;  6PAX A;  1R22 A;  4FX4 A;  1W7P A;  4F7Z A;  3GZ5 A;  3KP2 A;  3HHG A;  1VTN C;  4G9Y A;  3IWZ A;  2HS5 A;  2CYY A;  1ZLJ A;  3R0A A;  2TDX A;  5LGU A;  1G6N A;  3M8F A;  2PEX A;  2K7L A;  5D5V B;  3E3V A;  3SZP A;  1STZ A;  4ENM A;  1U5T C;  1MKM A;  1ONV A;  3BP8 A;  3QOP A;  4RS8 A;  3ZMZ A;  3O2P E;  1HW5 A;  4M72 A;  3H92 A;  2X0L A;  4UNO A;  2F5D A;  2EFO A;  1YFH A;  5IT3 A;  3GFM A;  1J0R A;  1U6G A;  2Z5U A;  2MC3 A;  3IKV A;  4R79 A;  2VE8 A;  3CJN A;  3E97 A;  3DV8 A;  4I01 A;  1YTY A;  2A3S A;  1FSE A;  2WWY A;  3GO5 A;  1IUY A;  3B73 A;  1ZYR F;  2VOP A;  4HF2 A;  1IN8 A;  3KZY A;  4O5V A;  2OZU A;  1YG2 A;  1I27 A;  2DFI A;  1F1Z A;  1G3T A;  1PDN C;  3DF8 A; 
#chains in the Genus database with same CATH topology
 3JRC A;  1TNT A;  2KJB A;  3V42 A;  4BU2 A;  1T8I A;  2GOX B;  3CCJ I;  1NK3 P;  2CUF A;  4RM3 A;  2B63 J;  2MBF A;  2E34 A;  2XGX A;  3H0G J;  4M6Y A;  2IA2 A;  4PK4 A;  4HAM A;  1TWA J;  1PJR A;  1DDN A;  4DW6 A;  5DYM A;  2R7V A;  3HGY A;  3L09 A;  2PJP A;  1R1U A;  3CDL A;  2WB1 A;  2Y0S N;  4RDU A;  2H8W A;  2OCE A;  1X2N A;  4F52 A;  3PUF A;  1BM9 A;  3EUK L;  2QYO A;  1IC8 A;  4XSX F;  2PLY A;  3QQA A;  1NTC A;  3H9G A;  2H09 A;  2FA5 A;  3MKL A;  4AVP A;  3M4O J;  4I6Z A;  2CW8 A;  2F4M B;  4BHC A;  3HL2 A;  3CCE I;  4XL9 A;  4B09 A;  4ON0 A;  4RA2 A;  5LEK A;  1G59 A;  3BY6 A;  1MW7 A;  3DU5 A;  1SAX A;  3HOW J;  1VQ6 I;  4AID A;  2P7V B;  3I4M J;  3R0J A;  2STW A;  5K5O A;  3KFW X;  1HSJ A;  2KIS A;  4II3 A;  5FO5 A;  4RMN A;  5KNL A;  3OWT A;  2F5E A;  4AUX A;  2R5Z A;  1YW9 A;  5TRD A;  1PUF B;  4U0V A;  4XRS G;  4EEF G;  2KFD A;  2MGQ A;  3BG5 A;  4ANJ A;  3OYI A;  4Q47 A;  5DTD A;  2RAE A;  2DO7 A;  2LBF B;  3TOA A;  1WRJ A;  2BHY A;  1V55 H;  4AU7 A;  2KLO A;  3ABK H;  3GW2 A;  2RQQ A;  4M9X A;  1CGP A;  3ZN1 A;  2NVQ J;  2I5U A;  2VBX A;  2VC0 A;  2QF7 A;  3PQK A;  4P96 A;  1K79 A;  5J1U A;  2DJN A;  1TT5 B;  2M0C A;  3HRS A;  5B3S H;  1ZG3 A;  4XLE A;  2XGC A;  3A2K A;  4HX8 A;  1XCV A;  2XAG A;  3M3Y J;  1P2F A;  2OAZ A;  4HG2 A;  1XB4 A;  5ICE A;  4HLX A;  4HDV A;  3WTT C;  2R3S A;  2E19 A;  1FMW A;  1ZTR A;  3DEE A;  3ZPL A;  2GA2 A;  3RCO A;  1H0M A;  4L5I A;  4BBR J;  1O3R A;  3K4B A;  2TRT A;  5FB2 A;  3JAM K;  1LDJ A;  1GUU A;  2Y48 A;  1VQM I;  4HX4 A;  1HW2 A;  4U0W A;  1ETX A;  5CQG A;  4UUS A;  2OF7 A;  3K70 C;  2V79 A;  2X1C A;  4A0Y A;  2F2E A;  1N77 A;  2R7U A;  2NS8 A;  5EEH A;  2A05 A;  2BYV E;  3QP6 A;  2YU9 J;  1YE9 A;  2XAU A;  2FXA A;  2BGC A;  2OZ6 A;  2J5P A;  5E3O A;  1ETO A;  1C0W A;  1GDT A;  2LY1 A;  1YIO A;  1FOW A;  2OQG A;  3JTG A;  1Y39 A;  2O8X A;  1MNM C;  4NHJ A;  5GPA A;  2HWV A;  4I09 A;  4M6X A;  3DCF A;  4OU0 A;  5D5W B;  2R5Y A;  1HOM A;  2FE3 A;  4P9F A;  4FCY A;  3OYK A;  2HKX A;  3LSK A;  2VQL A;  3A02 A;  4ZYH A;  3C3W A;  2EH3 A;  3BR1 A;  1IRF A;  3TO7 A;  3A01 A;  3H9Q A;  1K61 A;  4E7K A;  2DI3 A;  3ABT A;  3ZMD A;  1OYI A;  2LD5 A;  4H0E A;  1RUN A;  5D4R A;  1Z91 A;  3HG9 A;  3MD2 A;  4Q4Z F;  5FKN A;  2VJI A;  1Z0X A;  2ADU A;  2W48 A;  3GXO A;  3D5R C;  1Z3Y A;  1U8B A;  2STT A;  2VBZ A;  3VFZ A;  3F23 A;  5DS9 A;  5C4J J;  2FSW A;  1QZE A;  5HDN A;  4HW0 A;  2EZI A;  2H6C A;  4DOZ A;  2XPU A;  4U88 A;  3ISP A;  4JX6 A;  2Q1Z B;  1TC3 C;  1R5G A;  2CRG A;  3OIQ A;  2CJJ A;  2FF4 A;  2E35 A;  3L2R A;  1USS A;  1MJ9 A;  4EAT A;  1WKM A;  1ITY A;  1WJC A;  3ABU A;  5KVR A;  4QPQ A;  4ZC3 A;  2HVS A;  5M3F J;  2MSY A;  4MO7 A;  5H2F C;  3JW4 A;  4ZDL A;  2R93 J;  2X6Y A;  5LHG A;  1ULY A;  2QQ9 A;  2QVO A;  2VOD A;  1AKH B;  4ENN A;  4B1R A;  1U8R A;  2Z2S B;  1Y0U A;  3FXQ A;  2NVY J;  1YW8 A;  1B9N A;  1S7O A;  4Y7N J;  5K1Y A;  2GA1 A;  4XQF A;  3HUG A;  1ZGJ A;  3MQ0 A;  4E7L A;  4MGR A;  4BEH B;  2UZK A;  1IN7 A;  2QWW A;  4XLN F;  1K7A A;  3KYC B;  1O57 A;  4B8X A;  1IF1 A;  2Y75 A;  1MMA A;  1LVK A;  2VT3 A;  4EJO A;  4MTD A;  1PP8 F;  4ZH4 F;  4WF2 A;  1O4X A;  2VUM J;  3PFI A;  4M3F A;  3J7Z I;  1ZGA A;  1RRJ A;  2X4H A;  3R60 A;  5IOZ A;  1Z67 A;  4BYY A;  2DOF A;  1BJZ A;  1U78 A;  3BC8 A;  4H4K C;  1X1C A;  3UKG A;  1F43 A;  4GDF A;  3F8B A;  4L5E A;  1A6Q A;  2KZV A;  1SFK A;  3AG1 H;  4L9T A;  4AIK A;  5BOX A;  2QQ8 A;  3U21 A;  2A5W A;  2IRF G;  2L54 A;  3PIP F;  1KU9 A;  3O6B B;  1Z3X A;  4HYE A;  3S2W A;  4Y4R A;  4CCM A;  3OL4 A;  5B5E C;  2ECB A;  4NDL A;  1EA3 A;  2R5Z B;  2A6T A;  3BDD A;  2YUS A;  3OYB A;  2IA0 A;  3WGH A;  3WG9 A;  1X1P A;  5CPR B;  4CYD A;  4FQG A;  3ZGK A;  2E1N A;  3NAU A;  1MNE A;  5IT9 K;  3BTC A;  1ETQ A;  2DBB A;  5A2Q Z;  4OAZ A;  4OIO F;  4OWR B;  3GX4 X;  4MEY F;  4F92 B;  2ZME A;  2RNJ A;  4K2E A;  4KT5 C;  1YIT I;  2FJ1 A;  2H8R A;  2CSO A;  1ZEL A;  5KCM A;  2MLG A;  4IVN A;  1V5G A;  4XIC A;  1FWZ A;  3L2U A;  2V7F A;  5E17 F;  3SFI A;  3DTE A;  3F6V A;  1S3J A;  3GVA A;  4KJZ A;  3FK6 A;  3CC4 I;  2PN6 A;  5J4Y A;  1U9O A;  4ZJZ A;  3RKX A;  3CDI A;  2LYC A;  4CCK A;  1DP7 P;  3HGG A;  1FJL A;  2IGK A;  5E8I A;  2IS4 A;  1BR1 A;  2O0Y A;  1TZL A;  3RPU D;  2O7O A;  1JT0 A;  3EQL F;  1RUO A;  4XN0 A;  4A3E J;  1VQ8 I;  3A0B C;  3C1D A;  4D7M A;  2K86 A;  1P6R A;  3H5N A;  2ETH A;  1B6A A;  4JK1 X;  1JJ8 C;  2JMW A;  5F1R A;  3K1N A;  4JQF A;  2NAZ A;  2FBK A;  3SEZ A;  2UXX A;  3H3V K;  1X19 A;  4MEX F;  5HS9 A;  3PL8 A;  2L9V A;  4AYB A;  2VJ4 A;  1XMK A;  2BY3 A;  2VB6 A;  1SD6 A;  2MH2 A;  5GAH J;  3HSR A;  4ASN A;  1T56 A;  2PMZ N;  4MFE A;  3IH3 A;  5K5R A;  1OFC X;  2GIV A;  3DXJ F;  3I55 I;  1X2M A;  1EH8 A;  1R5I D;  3WU0 A;  1QHG A;  1YJN I;  2P81 A;  1JUM A;  2ACJ A;  3SZT A;  4D7N A;  4QWQ A;  4EM2 A;  1R6R A;  3H5R A;  4IL6 C;  1JJ6 C;  1FTZ A;  4B44 A;  5L3F A;  3A01 B;  4LG0 A;  2LY9 A;  1FYL A;  1W5T A;  1ETK A;  3LWF A;  1JE8 A;  3HOT A;  2P4W A;  3O8H A;  4XK4 A;  3RKW A;  2DA6 A;  1BA5 A;  1X58 A;  1JKQ C;  2VKV A;  2WAF A;  5H6R A;  1HCR A;  1GT0 C;  4N9H A;  3TGN A;  2E1C A;  2JTV A;  2AO9 A;  3G73 A;  3JRD A;  1Y1V J;  2DA2 A;  2BHZ A;  2DOA A;  2CH0 A;  2RDP A;  3S32 A;  2LH9 A;  1X1A A;  2RNG A;  3N05 A;  5HNF A;  1Y0N A;  4UB6 C;  5IYD J;  2CQX A;  2E71 A;  1YS6 A;  4GFB A;  1N75 A;  4WXH A;  1AWC A;  4XN3 A;  2GQQ A;  1RNL A;  2ELH A;  3HB9 A;  3ZQQ A;  4EQQ A;  2XHK A;  4IRI A;  2UXN A;  3BTL A;  5EZH A;  3E0J B;  3EYY A;  1TLH B;  3S16 J;  3HZJ A;  3WE3 A;  2IS2 A;  3PQJ A;  4B4C A;  1DP3 A;  2NVU B;  2EV0 A;  2COB A;  1SD7 A;  4D1Q A;  2W82 A;  1K6Y A;  2LR8 A;  4HQM A;  1Y6I A;  3CDH A;  2XKP A;  2EFW A;  3FXK A;  2ZXH A;  4ENJ A;  4A3L J;  4CDG A;  1R4M B;  4P5O A;  3ZQH A;  1Z7U A;  1ZKG A;  3CC7 I;  2Q8K A;  5F08 A;  4NB5 A;  5CYV A;  2EIN H;  4YII A;  5EZG A;  1XSD A;  4UV9 A;  2HKO A;  4LK1 F;  2XSD C;  4KIT B;  4Q48 A;  3GZN B;  3RYR A;  4B43 A;  1ZK8 A;  3OOU A;  4IHS A;  2KZG A;  3IRR A;  1KQ0 A;  4Q5S F;  3LSP A;  1SFO J;  4M74 A;  2QKM B;  2AHQ A;  4A5M A;  3BR2 A;  1I1S A;  3LAP A;  1MSF C;  2P5V A;  1GHC A;  3MKY B;  3W6V A;  2GM4 A;  4JX4 A;  2QCO A;  1JT6 A;  1TL8 A;  3LFK A;  3Q0V A;  2KDZ A;  1MBK A;  2BV6 A;  2VT2 A;  2E36 A;  4EJW A;  2FUG 2;  1PP7 U;  1QA6 A;  2KPM A;  2W84 A;  2XAF A;  1U3E M;  1OLT A;  1IN4 A;  4QPO A;  3HPH A;  1BW6 A;  3UR3 C;  2PBI A;  1SAN A;  5L3E A;  3ZQC A;  2OCC H;  5GPC A;  2NYX A;  3S3O A;  5JLW A;  3L1P A;  1BIB A;  1KYW A;  3DPU A;  3DWL E;  1VQL I;  1B4A A;  1FMV A;  4ENK A;  3T0Y A;  4E7J A;  4PJN A;  1FTT A;  3OS1 A;  2VPR A;  1TWF J;  2YX4 A;  1IW7 F;  2DOD A;  5J40 A;  3V8K A;  3K4L A;  2L01 A;  2O9L A;  5LBQ A;  2W85 A;  2K4B A;  4CZC A;  2M3A A;  2M9H A;  4L9J A;  1W5S A;  1JGG A;  2QEN A;  4IXA A;  1B8I B;  1BW5 A;  2ZME B;  2K9S A;  4XLC A;  1ETW A;  1FYK A;  1S72 I;  2DA5 A;  2ZB9 A;  3TDU C;  3JRH A;  5E3N A;  5J1R A;  1PUF A;  2E60 A;  2B7E A;  1ZRF A;  2DA3 A;  4B3X A;  4Y15 A;  2F4I A;  3MWM A;  2BZT A;  3ZQL A;  1VQP I;  3MEX A;  4U87 A;  3KEO A;  2E5N A;  1IXS B;  1LNW A;  2OD5 A;  2EFN A;  2HI3 A;  4JP0 A;  2EB7 A;  1GLN A;  3IL2 A;  5FLX K;  5EEG A;  2QEX I;  2GXG A;  3AL0 B;  5GAG J;  3E6B A;  3HSF A;  3B6C A;  4II2 A;  1LB2 A;  4A93 J;  3S8P A;  3LNQ A;  2HDD A;  1R58 A;  1G3W A;  2XUB A;  3FXU A;  2IS6 A;  2V9K A;  3RIR A;  3KP3 A;  3NAR A;  1LVA A;  3G1L A;  4UVB A;  4PZJ A;  2E5Z A;  4Y13 A;  3QOE A;  3TKY A;  4IHW A;  2COM A;  3BZ6 A;  5DD4 A;  5LRR A;  3FIS A;  2GOM A;  5GTI C;  2A5Y B;  2CGP A;  3RZO J;  3FM3 A;  5DM6 F;  3NEU A;  4M3E A;  4TV7 A;  2QBY B;  3FKJ A;  2LF8 A;  3RKQ A;  3RPU A;  3VPR A;  4HNV A;  1KYZ A;  3KP4 A;  2RC4 A;  2E2I J;  3IWF A;  2EZH A;  1TW2 A;  3GTJ J;  1T39 A;  2L7M P;  3QYE A;  3AKZ A;  1RIO H;  1G2H A;  3BG7 A;  2VC1 A;  2ZJ2 A;  4LG0 B;  1NG7 A;  2M8E A;  2R92 J;  1ZLK A;  2WTE A;  2PI0 A;  1VQN I;  1W1W E;  2JRT A;  2HYJ A;  5L3B A;  1IGN A;  1MND A;  4DJA A;  3E5X A;  4N4N B;  4KA4 A;  3VSK A;  1UHS A;  3ECO A;  2X48 A;  4OIQ F;  1IUF A;  3K2Z A;  3E7L A;  2LKS A;  2RVC A;  1P4W A;  3T8T A;  4LIV A;  2HOS A;  4JOM A;  1ZRD A;  4A0X A;  2HYG D;  2JN6 A;  2ZSH B;  4UUT A;  3VB2 A;  2I8D A;  3GZ6 A;  2QUF A;  4HV5 A;  3W6J B;  2FQ3 A;  5HVQ C;  2A6H F;  2MFZ A;  1SVL A;  3S3N A;  2OPT A;  1IN5 A;  2DK8 A;  2ZKZ A;  2C6Y A;  4EM1 A;  1JHH A;  2XAS A;  1S5L C;  3GME A;  2MLK A;  3CF5 F;  3H9J A;  5FD5 A;  2R7D A;  2KT0 A;  3CCU I;  1K4T A;  1QVT A;  1JTX A;  2GXB A;  1UFM A;  3OR2 C;  2NVT J;  5E1Z B;  2ISZ A;  1KA8 A;  1QRY A;  2MW8 A;  4UUV A;  4XRF A;  2X6X A;  2DLL A;  2ZNZ A;  2BY2 A;  1RKW A;  4LK0 F;  3U9G A;  1XCB A;  2HDC A;  4YRV A;  3ZN0 A;  2WAQ A;  1WJE A;  1QBJ A;  2KIM A;  3GUD A;  1BL0 A;  3ZQI A;  5B66 C;  1RET A;  1DPR A;  2IP2 A;  2R7O A;  2O61 A;  1OIS A;  4CIC A;  5FD6 A;  1XMA A;  1XDS A;  1FX7 A;  1FIP A;  3HJE A;  4HQE A;  3L9F A;  5TJJ A;  3T5X A;  4XID A;  4NBQ A;  1AKH A;  1SEU A;  4BE1 A;  2DT6 A;  3K4K A;  3KET A;  5M5W J;  5E1W A;  3F8M A;  3H5A A;  2HYF A;  2P8T A;  3TW7 A;  2ECC A;  2XF7 A;  2DXI A;  3JSP A;  1EV7 A;  3K2A A;  4UHT A;  4LMY A;  2FD5 A;  1XTA A;  5GP9 A;  1U0J A;  1D3Y A;  2WAD A;  2V4J C;  4BEH A;  2IVM A;  2K9M A;  2Y30 A;  5L3C A;  1VF9 A;  3WTS C;  2HQ5 A;  2FU4 A;  4KT6 A;  3MMY B;  2LSO A;  3I71 A;  5AON A;  1MH4 A;  1OJL A;  3QU3 A;  5DCF A;  3TP3 A;  1YW7 A;  2OUM A;  3ZQG A;  3KYD B;  1MMD A;  1N25 A;  2O03 A;  2XAQ A;  3HRT A;  1S8N A;  5E18 F;  3J7A O;  1DGW Y;  1LJ9 A;  3ERM A;  1XDU A;  5J4V A;  3CCQ I;  5L3D A;  1WSU A;  2P6S A;  3I64 A;  4E7S A;  1X4P A;  2OQR A;  3F72 A;  4WWC A;  3W3C A;  4ZDO A;  2ELJ A;  2VQC A;  3HHH A;  3KYL A;  4HA8 A;  2A61 A;  2X9D A;  1G8X A;  5DM7 F;  3G71 I;  1ZAO A;  3HKZ A;  5J6X A;  4WK8 F;  1H8A C;  3M8E A;  3OS0 A;  4IHT A;  2IS1 A;  4S05 A;  2DFE A;  4J19 A;  2PX9 A;  3IH2 A;  3S93 A;  4Y33 A;  4YFX F;  1F36 A;  2KIQ A;  4BHP A;  3EPZ A;  3I53 A;  1CF7 B;  2OJE D;  3BOQ A;  4HEA 2;  4I98 B;  3LSG A;  3FBI B;  2XGD A;  2E7W A;  5AIQ A;  2BW3 B;  2Z3Y A;  1F4K A;  4XSZ F;  1H9G A;  2BVL A;  3B6A A;  3F3X A;  3DPT A;  5FKM A;  3GFI A;  2HOA A;  3W2V A;  4O3M A;  4CSW A;  3U2R A;  3VSL A;  4EGY A;  2L0K A;  3PFY A;  2L4A A;  3M9A A;  3A4C A;  1XX5 A;  5KHD A;  2Y31 A;  1ETV A;  3KIO A;  3LL7 A;  3R61 A;  3WG7 H;  2D2W A;  3QAH A;  4CCN A;  2K4J A;  2K85 A;  3WTZ A;  1GV5 A;  3LSJ A;  1RES A;  4I2O A;  3FXO A;  1XG1 A;  2BBY A;  4IPA A;  2LMD A;  3VYS B;  2ESH A;  3JAM Z;  1E17 A;  4DYQ A;  3BZC A;  1JGS A;  3MZY A;  4BY1 J;  2KJC A;  3HRU A;  2FMY A;  4J00 A;  2Y9Z A;  4KMF A;  4ZYE A;  3SFZ A;  5LGT A;  4M73 A;  2DMU A;  4E7Z A;  4XLF A;  4XKW A;  4D5C A;  4A3J J;  2MD5 A;  2M87 A;  2A6E F;  5M5Y J;  4M3G A;  4EJU A;  4DYR A;  1JKR C;  4KIG A;  4X0G A;  4CYC B;  5JFR A;  3QP5 A;  3VYT B;  2K3P A;  1TT0 A;  3ZMV A;  2HTS A;  4FAS D;  3WTX C;  1W0U A;  1YO5 C;  2Y0S A;  1NH3 A;  2IT0 A;  3PM1 A;  1KZH A;  1APL C;  4KYW A;  3DKY A;  3NWT A;  2DK5 A;  3WE2 A;  3BJA A;  4CO8 A;  2QGU A;  3T1B A;  4HSR A;  5J47 A;  2BE5 F;  4B48 A;  1HQC A;  5JVG F;  4BDZ A;  2A07 F;  3F8C A;  3TBI A;  4HV6 A;  2M0M A;  4KNY A;  2EIL H;  2QSF X;  1BIA A;  5FRO A;  3EUA A;  4E7H A;  1JHF A;  2ZSI B;  4BUP A;  5CQE A;  1G4D A;  2XAH A;  1S29 A;  1Y56 A;  3ZQF A;  3J80 K;  5CJ9 A;  3OIP A;  3RQ4 A;  1KU3 A;  4BJ6 C;  4BHB A;  4MIM A;  1WZ2 A;  1MD0 A;  4RAF A;  1ENH A;  2HDW A;  5ED4 A;  3BPX A;  5EDN A;  4ITV A;  1TQP A;  3V4G A;  3ZQ7 A;  2CS3 A;  2R7W A;  4CA0 A;  3CES A;  2F5V A;  1Z1D A;  3OY9 A;  4HRI A;  4RGX A;  3REO A;  3RJP A;  2DN0 A;  3V8L A;  2ICW G;  5J3L A;  2FNP A;  2LLK A;  3WTV C;  3OYG A;  2HXO A;  3FHN A;  2Q2E B;  4N4O B;  2YPR A;  1Q1H A;  4BQO A;  4GGG A;  3OOP A;  3CP2 A;  1X4O A;  3ZMU A;  5ICG A;  1FLI A;  1ERD A;  2CQ7 A;  1SAU A;  5FKL A;  2IPQ X;  1Z05 A;  1XD7 A;  2WY7 Q;  1IDY A;  2F5F A;  3HEF A;  5DV5 A;  2IXS A;  3RSN A;  3MKZ A;  3L00 A;  5FRM A;  3KP5 A;  5BQT A;  3TL4 X;  3QWL A;  3BTJ A;  2HGC A;  1YS7 A;  4BH9 A;  3HOZ J;  1VI0 A;  3DTK A;  3GFL A;  2IGM A;  3WTY C;  1VQ4 I;  1B59 A;  1RZ4 A;  4GXO A;  4A12 A;  1HXD A;  4LGW A;  1IRG A;  2M2E A;  3BWG A;  2NS0 A;  4A2U A;  2VIX A;  1XGM A;  5H20 A;  3N4M A;  3F22 A;  1FC3 A;  2JWT A;  2YR2 A;  1YLF A;  2I10 A;  1H88 C;  1BN5 A;  1X1D A;  1MJA A;  3Q5F A;  2WBM A;  2HPM A;  1R00 A;  2LTP A;  2K9N A;  1HF0 A;  1SD5 A;  1LEA A;  2IBD A;  4LJZ F;  4XOP A;  4HF1 A;  2Z16 A;  2VQH A;  1MZB A;  3TED A;  5DD8 A;  3MZH A;  2FBI A;  4LOC A;  2QZ8 A;  5EG0 B;  4ESJ A;  2IW5 A;  4EV0 A;  2R7X A;  1LPQ A;  2M45 A;  1YHQ I;  1MH3 A;  4F55 A;  2E2J J;  2XV4 S;  4M3D A;  5HLI A;  4M3B A;  3OYN A;  3FX3 A;  4Z2Y A;  3I59 A;  1E3P A;  4HOB A;  3E6M A;  5KK1 A;  3WU1 B;  4O6J A;  2R7R A;  1JI8 A;  2FML A;  1BJA A;  4LFU A;  1MGT A;  2K02 A;  3DTI A;  1Z9C A;  3BG6 A;  2CUJ A;  4BJT A;  2ZCW A;  3BT9 A;  1I3Q J;  3OIO A;  2L5Q A;  4LLL A;  2QSG X;  4BQQ A;  1I39 A;  5JR3 A;  3GTL J;  3H1C A;  4C2U A;  1W4M A;  2DA1 A;  4BJ5 C;  3GYH X;  4I0A A;  3U1K A;  1IO2 A;  5EJC A;  3FKI J;  2DFH A;  4EMS A;  5IT9 Z;  1FZP B;  3V7R A;  3L2Q A;  2O3F A;  3IAM 2;  1M1E B;  3BCB A;  4UV8 A;  2NXN B;  3VWB A;  3SYT A;  1B8I A;  5FFX A;  1SD4 A;  3AG3 H;  5F0C A;  4ABZ A;  2KP6 A;  3OMY A;  1B72 B;  3RDI A;  1YOV B;  3S14 J;  4CZZ A;  3F21 A;  2GIZ A;  2M4K A;  3KLN A;  3PNV A;  1I5Z A;  3KP7 A;  4KIC A;  2PJR A;  3L7W A;  3TMO A;  3DKX A;  1GV2 A;  1OCT C;  5EEA A;  2EWN A;  5CVR A;  4OIP F;  1FSH A;  4BGD A;  4KDP A;  2L4M A;  1T95 A;  2A68 F;  3CJR B;  2EQR A;  2R7F A;  2W25 A;  1UG0 A;  3BPV A;  1FT9 A;  2D1H A;  5D8K B;  5E3M A;  5BS6 A;  2P5L C;  3JRG A;  1BI3 A;  3S15 J;  3BG3 A;  2XRL A;  1W0T A;  4I7H A;  3KLO A;  5KAF C;  1OPC A;  4IHV A;  5IP7 J;  3HTS B;  1FBQ A;  1X1B A;  2FRH A;  4RAZ A;  1VZ0 A;  4BL0 B;  1HDP A;  1OYW A;  1ZR4 A;  1OCR H;  2W7N A;  1WCM J;  2BVM A;  1X3W B;  3EET A;  3COA C;  3RYP A;  1W36 D;  4BBS J;  3P5J A;  1ZAR A;  3H3Z A;  5HLG A;  4D0P A;  4V2G A;  1T08 B;  5AIP A;  1QPM A;  1LFP A;  4XRM A;  1ZRE A;  1NG6 A;  3CO7 C;  1OKR A;  5HDG A;  2EK5 A;  2LF7 A;  4PSX A;  2KHM A;  3BR0 A;  4IF4 A;  5DDG A;  2QBY A;  3GBG A;  3CQZ J;  1J59 A;  1MIJ A;  1ACI A;  1TQM A;  4KMU X;  1EH7 A;  4CHU A;  4IEJ A;  4IJA A;  1K4S A;  3K70 D;  2G7H A;  1P4A A;  3KZZ A;  3QYF A;  1I50 J;  3RI4 A;  5CVU A;  2OBP A;  2DPU A;  4A3K J;  2XVC A;  1TWC J;  3UNG C;  3LMM A;  3MKW B;  3IV5 A;  4BXF A;  4PUS A;  3C2B A;  4YIR X;  1Y8Q B;  2ZO4 A;  4A3D J;  3IHU A;  1BBY A;  1GVJ A;  1V5E A;  3FF5 A;  1IAW A;  2Y9Y A;  3HOV J;  1WI9 A;  4XOR A;  3S17 J;  4KIS A;  1ZH5 A;  1S7A A;  2EFP A;  2JUG A;  4DQ2 A;  4EGZ A;  2RN7 A;  3G6E I;  3TW6 A;  2DA7 A;  1A6I A;  1D1C A;  1FEX A;  3RTR A;  5JI6 A;  2AQF A;  1Z21 A;  1E3O C;  3TO9 A;  3MCZ A;  4OIN F;  4RM2 A;  3CCV I;  1MDM A;  2DYR H;  1VQ5 I;  2ZXI A;  3FHZ A;  5ILU A;  2JA6 J;  2VON A;  4P9U A;  3S1Q J;  5E1X A;  2IEK A;  1R36 A;  4CXF A;  4L9N A;  2F4O B;  4IRG A;  3ECH A;  4C9Y A;  4S04 A;  2JA5 J;  1HBX G;  2LOO A;  5HOO A;  1U5T A;  5HNH A;  4CGZ A;  4MLO A;  2YU3 A;  2DTR A;  4MTE A;  2IGO A;  4Y52 J;  3FXR A;  3LST A;  2HVQ A;  4ESB A;  1KQ8 A;  1QZZ A;  2OA4 A;  5M3M J;  3OYF A;  2X51 A;  5EF6 A;  1J5Y A;  2EJR A;  4RAG A;  1SC7 A;  1MBH A;  4OIR F;  2GZW A;  3CD6 I;  2LFB A;  5CLS A;  3L2V A;  3QOD A;  4ESF A;  1RR8 C;  1U9N A;  3K4C A;  2OC6 A;  3S1N J;  3GLL A;  2KMU A;  3PIO F;  1WJB A;  4XLP F;  3KX2 A;  3DU6 A;  2EA4 A;  3HSE A;  3EUH A;  3OYA A;  3V7C A;  2PMZ A;  4QSH A;  4C3H J;  5F6F A;  3K9T A;  1O3S A;  4PDK A;  3KEY A;  3BLY A;  2IJL A;  2Z99 A;  3BTI A;  3OYJ A;  2CU7 A;  2DT7 B;  2M1B A;  3BG9 A;  3AG2 H;  2ZJR F;  2JK3 A;  3X2Q H;  4LLN A;  4MQV A;  5JLX A;  4RB2 C;  4PJM A;  1D0X A;  5B1A H;  3WTW C;  3I59 B;  3CCS I;  1Z6T A;  3CCY A;  2M5W A;  3VYR B;  2OV7 A;  2YS9 A;  2IA1 A;  4AWX B;  1A36 A;  2NS7 A;  4P55 A;  1K83 J;  5HLH A;  1AOY A;  5KAI C;  4G12 A;  3LFU A;  3S3M A;  2W24 A;  4L9V A;  1LDK B;  2EA2 A;  4EJV A;  3G1O A;  3TDZ C;  2VBW A;  2ZME C;  5IOY A;  1O7F A;  1H9T A;  5M5X J;  4ZYD A;  1VND A;  4QTR A;  2E1M B;  2FOK A;  2X85 A;  3MFK A;  3K1P A;  4D5F A;  5ILV A;  4MHG A;  2XPW A;  2CV0 A;  2JZY A;  2JRM A;  5EGO B;  2OU2 A;  3CC2 I;  3J81 K;  2VBY A;  1YQA A;  1FBS A;  4XKB A;  2AQE A;  2PFB A;  4RGS A;  1LUJ B;  1UMQ A;  3K7A J;  3NRV A;  1PYV A;  3L2C A;  4XLH A;  2LG4 A;  3V7S A;  1B1B A;  2JSP A;  3FMR A;  4A69 C;  2MH9 A;  4PJL A;  2Y2Z A;  4NQW B;  5LEJ A;  2PJR B;  1TWG J;  1CF7 A;  3AL0 C;  1BOA A;  4HPQ A;  4HF0 A;  5D5X B;  1O7L A;  2LKP A;  3Q9S A;  2QSH X;  2ZC2 A;  4DGW B;  2J5O A;  4M9Z A;  2BW3 A;  4LB6 B;  5FLX Z;  3OYH A;  5BMZ A;  3FK7 A;  3KZI C;  1HST A;  3H35 A;  3BJO A;  3BR3 A;  3QPT A;  4DIQ A;  2LK2 A;  1UHM A;  2QQA A;  3H3U A;  3VEP A;  4E7I A;  2R7Z J;  1PVE A;  4FX0 A;  2LVS A;  4FT8 A;  1UZC A;  3ROU A;  2CV1 A;  3K4N A;  4FET A;  5J1Y A;  1LQ1 A;  4JYK A;  2VJJ A;  3CP8 A;  4XKV A;  1SVM A;  2Y0M A;  2O5R A;  3AG4 H;  1JXS A;  3CF2 A;  4L5J A;  3W2W A;  2XGE A;  3AAF A;  4LG3 A;  3D5L A;  1E2X A;  3CUQ B;  2OTL I;  1YX3 A;  3E5U A;  2L2O A;  3FBN B;  1HC8 A;  1Y1W J;  1D1B A;  4NC7 A;  4WXD A;  3DBH B;  5FJ8 J;  1SMT A;  3HOS A;  1TP4 A;  1V3F A;  2B0L A;  2EPF A;  1IXR C;  2EFQ A;  1ZRC A;  4C2T A;  4CYC A;  2MD0 A;  4IO9 F;  3ZMS A;  2UUZ A;  5EYR A;  1AU7 A;  1ETY A;  4A3B J;  3DFG A;  1WH5 A;  1R9T J;  3DPL C;  1K6O A;  4E6K G;  1F5T A;  1QGP A;  3OSF A;  3FXM A;  3MAJ A;  2KRF A;  1OCC H;  2ZFW A;  3ABL H;  3J7A Y;  5D5U B;  1BR4 A;  5JHF A;  4V19 K;  1FOX A;  3S2H J;  2E1O A;  2DAO A;  2L7F P;  2V26 A;  1R4N B;  4G8X A;  2ID6 A;  3FDY A;  2HEO A;  2WB1 N;  1J75 A;  2JPC A;  4XBF A;  4CCJ A;  3HDD A;  3M1C A;  1KU7 A;  3NQO A;  4GO1 A;  1IRX A;  2WC2 A;  1YJW I;  4GYG A;  4IKF A;  1MDM B;  2MYS A;  1KU2 A;  4ZYA A;  3WOD F;  3GTP J;  2CO5 A;  5L3G A;  3K4J A;  5LLQ A;  3I0T A;  3WTU C;  1TNS A;  2MAB A;  1FBU A;  3I3L A;  4C3J J;  5C4X J;  3QPS A;  1LE8 A;  2CV2 A;  2RQP A;  3KEQ A;  1EKE A;  1WHU A;  2LP0 A;  1FYM A;  2O6G E;  1MMS A;  5IP6 A;  1S6L A;  2KRH A;  4AM3 A;  2OTJ I;  2CWE A;  1U5T B;  4UB8 C;  3PUB A;  4HNU A;  3HXL A;  4PFO A;  5TIS C;  5K5Q A;  3OYD A;  1RKT A;  5HS7 A;  1R71 A;  2Q2E A;  4PJJ A;  1MJB A;  4YFK F;  3I56 I;  4BAC A;  3I9V 2;  4RGU A;  1VQ9 I;  2VJ5 A;  2XRN A;  3JRB A;  3GEZ A;  1IDZ A;  1OQY A;  1HLV A;  1X3U A;  3GF2 A;  2GLO A;  2UV1 A;  3O3K A;  3DQV C;  4N0B A;  3ZOB A;  1ZHF A;  4M9S A;  3QYB A;  3FXL A;  1A04 A;  1XGS A;  3FWE A;  2V1U A;  3DLL F;  1D0Y A;  1REP C;  2JA2 A;  4AD9 A;  2K40 A;  4ETS A;  3TO6 A;  2YSR A;  2H27 A;  1LKX A;  2LNB A;  1D5V A;  3I54 A;  1XS9 A;  1JUS A;  2DMN A;  4P1W A;  2W4S A;  1YYV A;  3F6O A;  5GAE J;  2QA4 I;  3DEW A;  1T2K A;  1IV8 A;  1FIA A;  3G3Z A;  2CUZ A;  2G9W A;  1WFX A;  4JX5 A;  4RGR A;  1B9M A;  2HTJ A;  2PQ8 A;  2FEZ A;  4W1U A;  1D8K A;  1EJ9 A;  4J01 A;  1A35 A;  3ASO H;  2XSJ C;  2F48 A;  4YG2 F;  1HDD C;  5EG0 A;  1QHH D;  3E5Q A;  1IN6 A;  2PG4 A;  2MC4 A;  4LD5 A;  3H36 A;  1LFU P;  1BOB A;  2VPL A;  4PGH A;  3DBL B;  3JRE A;  1I6X A;  3K0L A;  4IZZ A;  4LIT A;  2D5V A;  5J8C A;  4RB1 A;  3GWZ A;  2V1D A;  3DLA A;  4U0Y A;  2R7T A;  1IXC A;  1QNT A;  4XLA A;  2HR3 A;  2H1K A;  1TQI A;  5D6F A;  1D1A A;  3QPH A;  3MVP A;  4A3G J;  2NVX J;  3IH4 A;  4KN4 X;  2QQB A;  3C18 A;  2VKH A;  4LIU A;  3P9C A;  2O8K A;  1XSX A;  3IRQ A;  2NOJ B;  5B1B H;  4HZF A;  4AIH A;  2HQN A;  3K1M A;  2CUE A;  1ORK A;  4PJ0 C;  3JSO A;  1UAA A;  2AS5 F;  1P7I A;  4KIB A;  5ICC A;  4CCO A;  3TP0 A;  1NK2 P;  3GTQ J;  2PMH A;  5BNG A;  2TCT A;  5H6Q A;  3ZRG A;  4A3I J;  1U2W A;  4BS9 A;  5FGM A;  5J8F A;  3CCL I;  1B72 A;  3F8N A;  4ZTJ A;  5E3L A;  2K5C A;  2XF5 A;  1LDD A;  3CUO A;  3GCM A;  3IP4 B;  4RBO A;  1D5Y A;  4KUM A;  4I02 A;  1XGN A;  1RI7 A;  1QZY A;  3I5U A;  4D9J A;  4ZYG A;  1FP2 A;  4L18 B;  2VKD A;  1P92 A;  4EVI A;  3ZCO A;  3C2G A;  3L2W A;  1BR2 A;  1E3H A;  3WU2 C;  2BY0 A;  4UY8 I;  2V9P A;  3SDG A;  3D1N I;  1MMG A;  1ZGW A;  1HKT A;  3C2H A;  4MQ9 F;  4BE0 A;  1DGR M;  3LSI A;  4L0Z B;  4KFC A;  1W7P B;  4DZP A;  3OL3 A;  2F6C A;  1W36 C;  4PFP A;  3OYC A;  4BQA A;  1WGX A;  2ZNY A;  4WXC A;  2VQG A;  3K69 A;  4C3I J;  1ZG1 A;  3ML6 A;  2A69 F;  1WJF A;  2DOE A;  3CMM A;  4R8H A;  3RQI A;  3SZG A;  3W2A A;  3Q0W A;  1OMI A;  3CLQ A;  1XPX A;  3P7N A;  2GAU A;  2JPB A;  3GTM J;  3ULQ B;  3FIW A;  2F5C A;  3HRM A;  2V6E A;  2K3F A;  3F8F A;  1YI2 I;  1MMN A;  2L9S A;  2Q0O A;  3OYM A;  1KON A;  1J09 A;  2HOT A;  3J80 Z;  3BJ6 A;  4RAY A;  4FE7 A;  2UWM A;  2NNN A;  2XF6 A;  4M71 A;  1PUE E;  1TBX A;  4XRS A;  3LAJ A;  2M30 A;  4HLY A;  5JHU A;  2WAE A;  3ELK A;  1QO0 D;  2CG4 A;  2DDB A;  5CVJ A;  3S1M J;  5ERI A;  2RGV A;  1FOK A;  2W00 A;  4A3M J;  3DEU A;  2VOO A;  2CQN A;  3ONQ A;  2AXL A;  1SFE A;  3ZR8 X;  4EJT A;  4RLF A;  1P4X A;  2K9Q A;  3ZMT A;  1LE8 B;  4ZZD A;  2JJ7 A;  2L9N A;  3Q0U A;  2R7S A;  1OYY A;  2XB5 A;  1WWX A;  2WA0 A;  5BPD A;  4BNC A;  2M8G X;  1DQU A;  3G2B A;  1O3Q A;  4CUG A;  3SXY A;  3JRI A;  1NHA A;  2ZBK A;  4N9I A;  1V54 H;  3GFJ A;  4DNC A;  1BI2 A;  1G3Y A;  3JR9 A;  3E6C C;  3M7G A;  5E20 A;  3KP6 A;  3VOE A;  4F91 B;  5D8L B;  3P9K A;  4JBA A;  1WQ2 A;  3BRO A;  3KPH A;  5GAD J;  3OYL A;  3G4S I;  1WJA A;  2Z33 A;  1S9H A;  3PSI A;  4PSW A;  1AA7 A;  3H0D A;  1SFU A;  2ZJQ F;  2CQK A;  2X1D A;  1AHD P;  5LHH A;  2KRC A;  2EIJ H;  3TOB A;  1DU0 A;  2HFH A;  4F93 B;  1SFX A;  1P9Q C;  2H6B A;  2P7C B;  3GLX A;  3RKY A;  1MSE C;  4G6D A;  4YEL A;  3TQN A;  1HW1 A;  1ODD A;  2DMQ A;  2VL8 A;  4MFD A;  3QU6 A;  4C30 A;  1YRN A;  5DCM A;  4YFN F;  4U7B A;  1RPW A;  4V2F A;  2JSC A;  4F3Q A;  2LY2 A;  4E70 A;  1UHW A;  1GXP A;  5DUK A;  5ICF A;  4OMY A;  1IG7 A;  5IP9 J;  4L0Y B;  3LA7 A;  2HXI A;  3U1D A;  5LHI A;  3CJT B;  4PCQ A;  2ESN A;  2K9L A;  2FX0 A;  1Z77 A;  1UJ8 A;  5C44 J;  1R1T A;  3Q9V A;  2CFX A;  3A1Y A;  2RRE A;  4KIF A;  2VE9 A;  3JRF A;  4AYB N;  3HM5 A;  3FM5 A;  3WGG A;  1Z6R A;  2BXZ A;  2DQR A;  2VLA A;  1ZQ3 P;  1FOY A;  5FKK A;  2NRA C;  1XC5 A;  1E0E A;  3FXJ A;  3N97 A;  2KL4 A;  5FFZ A;  2L3D A;  1I3A A;  2DQL A;  4UVA A;  4IX7 A;  2XC7 A;  3R4K A;  1P7J A;  4GCV A;  4AC0 A;  2XDV A;  1XSV A;  2MG4 A;  2E2H J;  5EGO A;  2JVH A;  2DJI A;  1EH6 A;  3HC7 A;  4U7D A;  5GTH C;  1VQO I;  2KQR A;  2E7X A;  1OCP A;  3VOD A;  2P5K A;  4FHT A;  2EZL A;  1SMY F;  4NQW A;  2DW4 A;  5HS8 A;  2P6T A;  4MNU A;  1KGS A;  3PO2 J;  1J9I A;  1ON1 A;  2R4G A;  3D0S A;  3B02 A;  4LLG F;  2VXD A;  1A31 A;  4OMZ A;  1W7P D;  1VQ7 I;  5A2Q K;  3EDP A;  2GWR A;  3CJQ B;  2RV8 A;  4IRH A;  3W6K B;  1FY7 A;  3JTH A;  1QU3 A;  3S1R J;  3HOU J;  5DEQ A;  3PO3 J;  2H94 A;  2ZXJ A;  1K78 A;  2GBY A;  2BEO A;  3D5S C;  4GYI A;  2KIU A;  1J2X A;  5F1J A;  3M1E A;  4IHY A;  2W57 A;  3PSF A;  3IAS 2;  3SQN A;  2VI6 A;  2VXZ A;  3I4N J;  3LA2 A;  3K6G A;  2BXY A;  2EZK A;  2HNH A;  1D0Z A;  3BR6 A;  5HLT A;  4GRI A;  4HDU A;  4G6Q A;  2EV6 A;  1ZG5 A;  2WY8 Q;  2X6W A;  1XGO A;  3E6D A;  3WGI A;  3CUQ A;  2H1L A;  2M7B A;  1R7J A;  3BR5 A;  4FTH A;  2QM3 A;  5D6E A;  2CMP A;  2K27 A;  2YX7 A;  3CLO A;  4YIF A;  2Z1D A;  3ASN H;  1MBE A;  2VKE A;  4UUS B;  1GXQ A;  3LQR A;  5F27 A;  2DTZ A;  1LEB A;  2X1E A;  3ESW B;  4G94 A;  5DUI A;  4QIW N;  1T6S A;  1J7K A;  4A0Z A;  1FP1 D;  4KN7 X;  1BI0 A;  2HQR A;  1OCO H;  2LRD A;  3CTA A;  2LDU A;  3SHF A;  2LKX A;  4A6D A;  2FNA A;  2G0E A;  1BC7 C;  4Y17 A;  4ZDP A;  2W1O A;  4EM0 B;  2XAJ A;  2G7U A;  2R5Y B;  2KDO A;  5CVV A;  4IOC F;  1YIJ I;  3OS2 A;  2R7Q A;  4A6E A;  1I1G A;  5LFA A;  2DMP A;  4X1E A;  1IRZ A;  2EV5 A;  4HST A;  1UCR A;  3SDB A;  2KKO A;  1MBF A;  1HA8 A;  4G7H F;  1LFB A;  4AIJ A;  3BZK A;  4OOI A;  3HOX J;  1CQT A;  4R1H A;  3P9I A;  1RC9 A;  3QRF F;  2L7Z A;  2M4G A;  3MZ8 A;  3LSR A;  3HIF A;  3F0C A;  5F04 A;  4AVZ A;  4G7O F;  3ZXS A;  1TW3 A;  4UVC A;  1Y8R B;  3PJR A;  3FZV A;  5LGN A;  1ZN2 A;  4BE2 A;  2GXA A;  4FIS A;  2Y69 H;  2DU9 A;  5E8G A;  3EYI A;  1DPU A;  1G3S A;  2HZT A;  3IKT A;  3IC7 A;  1F9N A;  2ZXW H;  3LSM A;  3KCC A;  2DDA A;  3HPG A;  3PNT A;  1T98 A;  2HZD A;  3OR1 C;  3ZP5 A;  5BPI A;  4WX9 A;  1FNN A;  2DT5 A;  1JKO C;  2ME6 A;  2NNY A;  2L02 A;  3C7J A;  3RPQ A;  4XM3 A;  5IPA A;  1SVO A;  4I0B A;  3AFH A;  2D45 A;  1YRN B;  4HNT A;  5FRN A;  1TWH J;  5DCM B;  1T38 A;  4QLC U;  4HX7 A;  2JT1 A;  5E79 C;  2EIM H;  1N78 A;  2MA3 A;  3MN2 A;  1IV6 A;  2QKL B;  5D4S A;  4LB5 A;  3GTG J;  4M6V A;  2IAI A;  2CW0 F;  1L0O C;  3PNY A;  1R5H A;  2VN2 A;  2BY1 A;  3OV8 A;  3SJM A;  1IZ1 A;  3HUG B;  1R1V A;  3CO6 C;  1T0F A;  5F0H A;  3ERE D;  4PGG A;  3Q3S A;  2KIF A;  2XIG A;  2JUC A;  1R49 A;  4BY7 J;  3BQY A;  5FKO A;  2E1M C;  1OR7 A;  1XN7 A;  3M8J A;  4BAY A;  1KQ9 A;  1V4R A;  1WJD A;  4YEJ A;  2ELK A;  4RB0 A;  4DBR A;  1UB9 A;  4WCG A;  2FBH A;  5TGT A;  2V9V A;  5F64 A;  4RB3 C;  3I58 A;  1W5C C;  1DUX C;  2JVG A;  3CCR I;  4UXN A;  4IHX A;  4DYC A;  4G7Z F;  1RR7 A;  4XON A;  2DPD A;  1YX5 A;  3K10 A;  3A0H C;  4I99 C;  2LC2 A;  4G6T B;  2BOL A;  2PMU A;  4OAY A;  2DCE A;  3FMQ A;  1D8J A;  1HKQ A;  3J81 Z;  2XKO A;  3CMY A;  1WH7 A;  1QVU A;  3DKW A;  1L3L A;  4FE4 A;  1BC8 C;  4IQ4 A;  5CVI A;  3LQQ A;  1UG2 A;  2QLZ A;  3OSG A;  1QQI A;  3KE2 A;  1WJ5 A;  1Q1V A;  1ZR2 A;  5FLM J;  4B47 A;  2L9R A;  3R6S A;  5LRS A;  2EBI A;  4ZTF A;  2N8G A;  4X6A J;  1O3T A;  2D1V A;  2M7A A;  2V1X A;  3FMS A;  4B3A A;  3LA3 A;  3OYE A;  1UST A;  2Z9O A;  4XR6 A;  4A5N A;  1HKS A;  4IQJ A;  1BI1 A;  3HTU A;  2WV0 A;  1TTY A;  5F0F A;  1ON2 A;  2V6C A;  1R23 A;  2XPV A;  2DFF A;  1T33 A;  2CQQ A;  1K78 B;  2JA8 J;  4A3C J;  2HPI A;  3V8J A;  2RKH A;  1DU6 A;  3HYI A;  3CUQ C;  1MBG A;  3DBR B;  1H89 C;  3T8R A;  5K7F A;  5JVT A;  1X3Z B;  2DMT A;  5C3E J;  2ME0 A;  3JCU C;  1FPQ A;  2HOE A;  2LBF A;  2XRO A;  4Y3O A;  2EIK H;  5ILS A;  1Z7L A;  3DP7 A;  5HDK A;  4A3F J;  4NC8 A;  1OCZ H;  4C2M J;  4BXU A;  2ISY A;  5K7Z A;  4HBL A;  2HVR A;  1S7E A;  4XNF A;  3I4P A;  4ZZL A;  2CW7 A;  3F9K A;  6PAX A;  1GVD A;  1R22 A;  9ANT A;  2WAQ N;  1YJ9 I;  4FX4 A;  1QPI A;  1W7P A;  4DBQ A;  3JRA A;  1WI3 A;  5IYC J;  4F7Z A;  4NNJ A;  2JA7 J;  3GZ5 A;  4BDY A;  3KP2 A;  3HHG A;  4E4H A;  1VTN C;  2ID3 A;  2ZFU A;  4G9Y A;  2M34 A;  3WHB A;  3WHC A;  1A5J A;  3IWZ A;  2JQ7 A;  4BKX A;  3VDX A;  1POG A;  2DA4 A;  2HS5 A;  4RLQ A;  2CYY A;  5K7H A;  3QPL A;  4NC6 A;  1ZLJ A;  3R0A A;  2L7K A;  1V5F A;  4CCL A;  2TDX A;  3LOC A;  5LGU A;  2P0W A;  1G6N A;  2VAS A;  3M8F A;  1WVR A;  4BQN A;  2PEX A;  1EF4 A;  3CMA I;  2K7L A;  2B9S A;  5D5V B;  4BXX J;  3E3V A;  1IJW C;  3GTK J;  2DYS H;  3SZP A;  1STZ A;  3BQZ A;  3CZ6 A;  4ENM A;  5IY5 H;  1U5T C;  2FQ4 A;  1MKM A;  2ZJP F;  1ONV A;  3BP8 A;  3NWS A;  2AXT C;  3QOP A;  1JUP A;  3VYU B;  3J7Y J;  4RS8 A;  4DZJ A;  3ZMZ A;  3O2P E;  1HW5 A;  4M72 A;  3HOY J;  3H92 A;  1JKP C;  3G1M A;  3ABM H;  2X0L A;  4W97 A;  4UNO A;  3HKZ N;  3CCM I;  2F5D A;  2XB0 X;  3M07 A;  2EFO A;  2LRE A;  1YFH A;  2IGN A;  5IT3 A;  2HQA A;  3GFM A;  2WV1 A;  1J0R A;  4Z6Y A;  4S0H B;  3EUH C;  3O8G A;  1XMX A;  5CKT A;  1U6G A;  3S2D J;  2CFO A;  5IYB J;  2Z5U A;  5FLV A;  1I6H J;  2MC3 A;  5LD2 C;  3IKV A;  3E1S A;  4R79 A;  1MBJ A;  2VE8 A;  3CJN A;  3E97 A;  3DV8 A;  1WPK A;  1UEL B;  3LSH A;  4I01 A;  1YTY A;  1T0F C;  2A3S A;  1FSE A;  3SEQ A;  5HOD A;  2WWY A;  2X6O A;  3GO5 A;  3IUO A;  4NUB A;  3GTO J;  1IUY A;  3BCA A;  4XOT A;  4XMY A;  1VFC A;  3B73 A;  1ZYR F;  2VOP A;  1OR7 C;  4HF2 A;  1IN8 A;  3KZY A;  4O5V A;  2NOG A;  4XKC A;  3HBL A;  2OZU A;  1VQK I;  1YG2 A;  2HU9 A;  4CH7 A;  2FOW A;  2R0Q C;  3K4M A;  1I27 A;  2DFI A;  3CME I;  1F1Z A;  1G3T A;  3A03 A;  4I76 A;  1JTY A;  2V1N A;  3RZD J;  4IOA F;  1PDN C;  3DF8 A; 
#chains in the Genus database with same CATH homology
 1TNT A;  2KJB A;  2MBF A;  2XGX A;  4M6Y A;  2IA2 A;  4HAM A;  1DDN A;  5DYM A;  3L09 A;  2PJP A;  1R1U A;  1BM9 A;  2QYO A;  4XSX F;  2PLY A;  2H09 A;  2FA5 A;  4AVP A;  4BHC A;  4B09 A;  4ON0 A;  5LEK A;  3BY6 A;  1SAX A;  2P7V B;  3R0J A;  2STW A;  5K5O A;  3KFW X;  1HSJ A;  5FO5 A;  2F5E A;  1YW9 A;  5TRD A;  4U0V A;  4Q47 A;  2DO7 A;  3TOA A;  1WRJ A;  3GW2 A;  4M9X A;  1CGP A;  3ZN1 A;  2VBX A;  2VC0 A;  3PQK A;  4P96 A;  1K79 A;  3HRS A;  1ZG3 A;  4HX8 A;  1XCV A;  2XAG A;  1P2F A;  2OAZ A;  1XB4 A;  5ICE A;  4HLX A;  4HDV A;  3WTT C;  2R3S A;  3ZPL A;  2GA2 A;  1H0M A;  4L5I A;  1O3R A;  5FB2 A;  3JAM K;  1LDJ A;  2Y48 A;  4HX4 A;  1HW2 A;  4U0W A;  2V79 A;  4A0Y A;  2F2E A;  5EEH A;  2BYV E;  3QP6 A;  2FXA A;  2BGC A;  2OZ6 A;  2J5P A;  1C0W A;  1YIO A;  2OQG A;  3JTG A;  2O8X A;  4NHJ A;  2HWV A;  4I09 A;  4M6X A;  4OU0 A;  5D5W B;  2FE3 A;  4P9F A;  2HKX A;  4ZYH A;  3C3W A;  1IRF A;  3TO7 A;  2DI3 A;  3ABT A;  3ZMD A;  1OYI A;  4H0E A;  1RUN A;  5D4R A;  1Z91 A;  4Q4Z F;  2ADU A;  3GXO A;  2STT A;  2VBZ A;  3VFZ A;  3F23 A;  2FSW A;  5HDN A;  4HW0 A;  2H6C A;  4U88 A;  3ISP A;  1R5G A;  2FF4 A;  1USS A;  1MJ9 A;  1WKM A;  3ABU A;  5KVR A;  3JW4 A;  5LHG A;  1ULY A;  2QQ9 A;  2QVO A;  2VOD A;  4ENN A;  1U8R A;  1Y0U A;  3FXQ A;  1YW8 A;  1B9N A;  1S7O A;  5K1Y A;  2GA1 A;  3HUG A;  1ZGJ A;  3MQ0 A;  4MGR A;  2UZK A;  1IN7 A;  2QWW A;  4XLN F;  1K7A A;  1O57 A;  4B8X A;  1IF1 A;  2Y75 A;  2VT3 A;  4EJO A;  4MTD A;  1PP8 F;  4ZH4 F;  4WF2 A;  3PFI A;  1ZGA A;  2X4H A;  3R60 A;  4BYY A;  1U78 A;  3F8B A;  4L9T A;  4AIK A;  5BOX A;  2IRF G;  2L54 A;  1KU9 A;  3O6B B;  4HYE A;  3S2W A;  3BDD A;  2IA0 A;  3WGH A;  3WG9 A;  4CYD A;  2E1N A;  5IT9 K;  2DBB A;  5A2Q Z;  4OIO F;  3GX4 X;  4MEY F;  2ZME A;  2RNJ A;  4K2E A;  4KT5 C;  2CSO A;  5E17 F;  2MLG A;  4IVN A;  1FWZ A;  3F6V A;  1S3J A;  3GVA A;  2PN6 A;  3RKX A;  1DP7 P;  5E8I A;  2O0Y A;  3EQL F;  1RUO A;  3C1D A;  2K86 A;  1P6R A;  2ETH A;  1B6A A;  4JK1 X;  5F1R A;  3K1N A;  4JQF A;  2NAZ A;  2FBK A;  2UXX A;  4MEX F;  5HS9 A;  1XMK A;  1SD6 A;  2MH2 A;  3HSR A;  4ASN A;  5K5R A;  2GIV A;  3DXJ F;  1EH8 A;  3WU0 A;  2ACJ A;  3SZT A;  4QWQ A;  4EM2 A;  5L3F A;  4LG0 A;  1FYL A;  1W5T A;  1JE8 A;  3LWF A;  3HOT A;  2P4W A;  3RKW A;  5H6R A;  4N9H A;  3TGN A;  2E1C A;  2JTV A;  3G73 A;  2RDP A;  1YS6 A;  4WXH A;  1AWC A;  2GQQ A;  1RNL A;  2ELH A;  4EQQ A;  2XHK A;  4IRI A;  2UXN A;  3EYY A;  1TLH B;  3WE3 A;  3PQJ A;  2EV0 A;  1SD7 A;  4HQM A;  3CDH A;  2XKP A;  2EFW A;  4ENJ A;  4CDG A;  4P5O A;  1Z7U A;  2Q8K A;  4NB5 A;  5CYV A;  4YII A;  1XSD A;  4UV9 A;  2HKO A;  4LK1 F;  4Q48 A;  3RYR A;  4IHS A;  3IRR A;  1KQ0 A;  4Q5S F;  4M74 A;  4A5M A;  1I1S A;  3LAP A;  1GHC A;  2P5V A;  3LFK A;  2BV6 A;  2VT2 A;  4EJW A;  1PP7 U;  2W84 A;  2XAF A;  1U3E M;  1IN4 A;  2PBI A;  5L3E A;  2NYX A;  1BIB A;  1KYW A;  1B4A A;  4ENK A;  3T0Y A;  2YX4 A;  1IW7 F;  3V8K A;  2L01 A;  5LBQ A;  2W85 A;  2K4B A;  4L9J A;  1W5S A;  2QEN A;  4IXA A;  2ZME B;  1FYK A;  3TDU C;  1ZRF A;  4Y15 A;  3MWM A;  3MEX A;  3KEO A;  1IXS B;  1LNW A;  2OD5 A;  2EFN A;  2EB7 A;  3IL2 A;  5FLX K;  5EEG A;  2GXG A;  3E6B A;  3HSF A;  1LB2 A;  1R58 A;  1G3W A;  2XUB A;  3FXU A;  3RIR A;  3KP3 A;  1LVA A;  4UVB A;  4PZJ A;  4Y13 A;  3TKY A;  2COM A;  3BZ6 A;  5DD4 A;  5LRR A;  2A5Y B;  2CGP A;  3FM3 A;  3NEU A;  4TV7 A;  2QBY B;  2LF8 A;  3RPU A;  1KYZ A;  3KP4 A;  2RC4 A;  3IWF A;  1TW2 A;  1T39 A;  1RIO H;  2VC1 A;  2ZJ2 A;  4LG0 B;  2M8E A;  1ZLK A;  2WTE A;  2PI0 A;  2JRT A;  5L3B A;  3E5X A;  4KA4 A;  3ECO A;  4OIQ F;  3K2Z A;  2RVC A;  1P4W A;  3T8T A;  1ZRD A;  4A0X A;  2HYG D;  3VB2 A;  3GZ6 A;  2QUF A;  4HV5 A;  3W6J B;  2FQ3 A;  5HVQ C;  2A6H F;  2DK8 A;  1IN5 A;  2ZKZ A;  2C6Y A;  4EM1 A;  1JHH A;  2XAS A;  2MLK A;  5FD5 A;  2R7D A;  2GXB A;  1UFM A;  5E1Z B;  2ISZ A;  1KA8 A;  4UUV A;  4XRF A;  2ZNZ A;  2DLL A;  4LK0 F;  3U9G A;  1XCB A;  2HDC A;  3ZN0 A;  1QBJ A;  2KIM A;  3GUD A;  1DPR A;  2IP2 A;  2O61 A;  4CIC A;  5FD6 A;  1XMA A;  1XDS A;  1FX7 A;  4HQE A;  3L9F A;  5TJJ A;  3T5X A;  3KET A;  5E1W A;  3F8M A;  2HYF A;  2P8T A;  3JSP A;  1EV7 A;  4UHT A;  4LMY A;  1D3Y A;  2IVM A;  5L3C A;  3WTS C;  2FU4 A;  2LSO A;  3I71 A;  5AON A;  3QU3 A;  5DCF A;  1YW7 A;  2O03 A;  2XAQ A;  3HRT A;  1S8N A;  5E18 F;  3J7A O;  1LJ9 A;  1XDU A;  5L3D A;  1WSU A;  2P6S A;  3I64 A;  2OQR A;  3F72 A;  4WWC A;  3HHH A;  4HA8 A;  2A61 A;  1ZAO A;  5J6X A;  4WK8 F;  3M8E A;  4IHT A;  4S05 A;  4YFX F;  4BHP A;  3I53 A;  1CF7 B;  3BOQ A;  4I98 B;  2E7W A;  5AIQ A;  2Z3Y A;  1F4K A;  4XSZ F;  1H9G A;  3F3X A;  3DPT A;  3GFI A;  4O3M A;  3U2R A;  4EGY A;  2L4A A;  3M9A A;  3R61 A;  2D2W A;  3QAH A;  2K4J A;  3WTZ A;  4I2O A;  2BBY A;  4IPA A;  3JAM Z;  2ESH A;  1E17 A;  1JGS A;  3MZY A;  2KJC A;  3HRU A;  2FMY A;  4KMF A;  4ZYE A;  3SFZ A;  5LGT A;  4M73 A;  2MD5 A;  2M87 A;  2A6E F;  4EJU A;  4KIG A;  5JFR A;  3QP5 A;  3ZMV A;  2HTS A;  3WTX C;  1YO5 C;  2IT0 A;  4KYW A;  2DK5 A;  3WE2 A;  3BJA A;  4CO8 A;  3T1B A;  2BE5 F;  1HQC A;  2A07 F;  3F8C A;  4HV6 A;  4KNY A;  1BIA A;  1JHF A;  1G4D A;  2XAH A;  1S29 A;  3J80 K;  5CJ9 A;  1KU3 A;  4BHB A;  1MD0 A;  5ED4 A;  3BPX A;  1TQP A;  3V4G A;  3ZQ7 A;  1Z1D A;  4RGX A;  3REO A;  3RJP A;  3V8L A;  2FNP A;  3WTV C;  2YPR A;  1Q1H A;  4GGG A;  3OOP A;  3ZMU A;  5ICG A;  1FLI A;  2IPQ X;  1Z05 A;  1XD7 A;  2F5F A;  5DV5 A;  3L00 A;  3KP5 A;  5BQT A;  2HGC A;  1YS7 A;  4BH9 A;  3GFL A;  3WTY C;  1B59 A;  1RZ4 A;  4GXO A;  4A12 A;  1HXD A;  4LGW A;  1IRG A;  3BWG A;  2NS0 A;  4A2U A;  1XGM A;  5H20 A;  3N4M A;  3F22 A;  1FC3 A;  2YR2 A;  1YLF A;  1BN5 A;  1MJA A;  3Q5F A;  1R00 A;  1SD5 A;  1LEA A;  4LJZ F;  4HF1 A;  1MZB A;  5DD8 A;  3MZH A;  2FBI A;  4ESJ A;  2QZ8 A;  2IW5 A;  4EV0 A;  2M45 A;  2XV4 S;  5HLI A;  3FX3 A;  4Z2Y A;  3I59 A;  4HOB A;  3E6M A;  5KK1 A;  3WU1 B;  4O6J A;  2FML A;  1BJA A;  4LFU A;  1MGT A;  2K02 A;  1Z9C A;  2ZCW A;  4LLL A;  5JR3 A;  1W4M A;  3GYH X;  4I0A A;  4EMS A;  5IT9 Z;  1FZP B;  3V7R A;  2O3F A;  4UV8 A;  5FFX A;  1SD4 A;  3RDI A;  4CZZ A;  3F21 A;  3KLN A;  4KIC A;  1I5Z A;  3KP7 A;  3L7W A;  2EWN A;  5CVR A;  4OIP F;  1FSH A;  4KDP A;  2L4M A;  2A68 F;  2R7F A;  2W25 A;  3BPV A;  1FT9 A;  2D1H A;  5D8K B;  5BS6 A;  2P5L C;  1BI3 A;  4I7H A;  3KLO A;  1OPC A;  3HTS B;  1FBQ A;  2FRH A;  4RAZ A;  1OYW A;  3EET A;  3COA C;  3RYP A;  1ZAR A;  3H3Z A;  5HLG A;  4D0P A;  5AIP A;  1QPM A;  1ZRE A;  3CO7 C;  1OKR A;  5HDG A;  2EK5 A;  2LF7 A;  5DDG A;  4IF4 A;  2QBY A;  1J59 A;  1TQM A;  4KMU X;  1EH7 A;  4CHU A;  4IJA A;  2G7H A;  1P4A A;  3KZZ A;  3RI4 A;  5CVU A;  2OBP A;  2DPU A;  2XVC A;  2ZO4 A;  3IHU A;  1BBY A;  1GVJ A;  3FF5 A;  1IAW A;  1WI9 A;  1ZH5 A;  1S7A A;  2EFP A;  4EGZ A;  4DQ2 A;  2RN7 A;  3RTR A;  5JI6 A;  3TO9 A;  3MCZ A;  4OIN F;  1MDM A;  3FHZ A;  5ILU A;  2VON A;  4P9U A;  5E1X A;  1R36 A;  4CXF A;  4L9N A;  4IRG A;  3ECH A;  4S04 A;  1HBX G;  5HOO A;  1U5T A;  4CGZ A;  2YU3 A;  2DTR A;  4MTE A;  3FXR A;  3LST A;  4ESB A;  1KQ8 A;  1QZZ A;  2OA4 A;  1J5Y A;  2EJR A;  4OIR F;  2GZW A;  5CLS A;  4ESF A;  4XLP F;  2EA4 A;  3HSE A;  3EUH A;  3V7C A;  5F6F A;  3K9T A;  1O3S A;  4PDK A;  2IJL A;  2Z99 A;  2M1B A;  4LLN A;  4MQV A;  4RB2 C;  3WTW C;  3I59 B;  1Z6T A;  2M5W A;  2IA1 A;  4AWX B;  4P55 A;  5HLH A;  1AOY A;  2W24 A;  4L9V A;  1LDK B;  2EA2 A;  4EJV A;  3TDZ C;  2VBW A;  1O7F A;  1H9T A;  4ZYD A;  2FOK A;  3MFK A;  3K1P A;  5ILV A;  4MHG A;  2JZY A;  2OU2 A;  3J81 K;  2VBY A;  1YQA A;  1FBS A;  2PFB A;  4RGS A;  3NRV A;  3L2C A;  3V7S A;  1B1B A;  3FMR A;  2MH9 A;  5LEJ A;  1CF7 A;  1BOA A;  4HF0 A;  5D5X B;  1O7L A;  2LKP A;  3Q9S A;  2J5O A;  4M9Z A;  4LB6 B;  5FLX Z;  5BMZ A;  1HST A;  3BJO A;  3QPT A;  1UHM A;  2QQA A;  3H3U A;  3VEP A;  4FX0 A;  4FT8 A;  3ROU A;  1LQ1 A;  2Y0M A;  1JXS A;  4L5J A;  3AAF A;  3D5L A;  1E2X A;  3CUQ B;  3E5U A;  4WXD A;  1SMT A;  3HOS A;  1V3F A;  2B0L A;  1IXR C;  2EFQ A;  1ZRC A;  3ZMS A;  3DFG A;  3DPL C;  1K6O A;  1F5T A;  1QGP A;  3MAJ A;  2KRF A;  2ZFW A;  5D5U B;  2DAO A;  4G8X A;  2HEO A;  1J75 A;  2JPC A;  4XBF A;  1KU7 A;  3NQO A;  4GO1 A;  2WC2 A;  4GYG A;  1MDM B;  1KU2 A;  3WOD F;  2CO5 A;  5L3G A;  5LLQ A;  3I0T A;  3WTU C;  1TNS A;  1FBU A;  2RQP A;  3KEQ A;  1FYM A;  2O6G E;  1S6L A;  2CWE A;  1U5T B;  5K5Q A;  5HS7 A;  2Q2E A;  4YFK F;  1MJB A;  4RGU A;  2XRN A;  3GEZ A;  1X3U A;  3GF2 A;  3O3K A;  3DQV C;  4N0B A;  1ZHF A;  4M9S A;  1A04 A;  1XGS A;  3FWE A;  2V1U A;  1REP C;  4AD9 A;  4ETS A;  3TO6 A;  2YSR A;  2H27 A;  2LNB A;  1D5V A;  3I54 A;  1YYV A;  3F6O A;  1T2K A;  3G3Z A;  2G9W A;  4RGR A;  1B9M A;  2HTJ A;  2PQ8 A;  2FEZ A;  1D8K A;  4YG2 F;  3E5Q A;  1IN6 A;  2PG4 A;  4LD5 A;  4PGH A;  1I6X A;  3K0L A;  5J8C A;  4RB1 A;  3GWZ A;  2V1D A;  4U0Y A;  1IXC A;  1QNT A;  2HR3 A;  1TQI A;  5D6F A;  3QPH A;  4KN4 X;  2QQB A;  3C18 A;  3P9C A;  1XSX A;  3IRQ A;  4AIH A;  4HZF A;  2HQN A;  3K1M A;  3JSO A;  2AS5 F;  4KIB A;  5ICC A;  2PMH A;  5H6Q A;  1U2W A;  5FGM A;  5J8F A;  3F8N A;  1LDD A;  3CUO A;  4KUM A;  4I02 A;  1XGN A;  1RI7 A;  1QZY A;  3I5U A;  4ZYG A;  4L18 B;  1FP2 A;  1P92 A;  4EVI A;  1HKT A;  4MQ9 F;  4L0Z B;  4KFC A;  1W7P B;  4BQA A;  2ZNY A;  4WXC A;  3K69 A;  1ZG1 A;  3ML6 A;  2A69 F;  4R8H A;  1OMI A;  3P7N A;  2GAU A;  2JPB A;  3ULQ B;  2F5C A;  3HRM A;  3F8F A;  2Q0O A;  3J80 Z;  3BJ6 A;  4RAY A;  2UWM A;  2NNN A;  1PUE E;  4M71 A;  1TBX A;  4HLY A;  3LAJ A;  2M30 A;  5JHU A;  3ELK A;  1QO0 D;  2CG4 A;  5CVJ A;  5ERI A;  2RGV A;  1FOK A;  3DEU A;  2VOO A;  2AXL A;  1SFE A;  4EJT A;  1P4X A;  3ZMT A;  4ZZD A;  1OYY A;  1WWX A;  5BPD A;  4BNC A;  1O3Q A;  3SXY A;  1NHA A;  2ZBK A;  4N9I A;  4DNC A;  3GFJ A;  1BI2 A;  1G3Y A;  3E6C C;  3M7G A;  5E20 A;  3KP6 A;  3VOE A;  5D8L B;  3P9K A;  4JBA A;  1WQ2 A;  3BRO A;  2Z33 A;  1SFU A;  2CQK A;  5LHH A;  3TOB A;  2HFH A;  1SFX A;  2H6B A;  2P7C B;  3GLX A;  3RKY A;  4G6D A;  3TQN A;  1HW1 A;  1ODD A;  3QU6 A;  5DCM A;  4YFN F;  4U7B A;  2JSC A;  4E70 A;  1UHW A;  1GXP A;  5DUK A;  5ICF A;  4OMY A;  4L0Y B;  3LA7 A;  3U1D A;  5LHI A;  4PCQ A;  2ESN A;  1R1T A;  3Q9V A;  2CFX A;  4KIF A;  2VE9 A;  3FM5 A;  3WGG A;  1Z6R A;  2DQR A;  2NRA C;  3N97 A;  5FFZ A;  2L3D A;  2DQL A;  4UVA A;  3R4K A;  4GCV A;  1XSV A;  1EH6 A;  4U7D A;  2E7X A;  3VOD A;  2P5K A;  4FHT A;  1SMY F;  4NQW A;  2DW4 A;  5HS8 A;  2P6T A;  4MNU A;  1KGS A;  1J9I A;  1ON1 A;  3D0S A;  3B02 A;  4LLG F;  4OMZ A;  1W7P D;  5A2Q K;  3EDP A;  2GWR A;  2RV8 A;  4IRH A;  3W6K B;  1FY7 A;  3JTH A;  5DEQ A;  2H94 A;  2ZXJ A;  1K78 A;  2BEO A;  4GYI A;  2KIU A;  1J2X A;  3M1E A;  2W57 A;  3SQN A;  2VXZ A;  3LA2 A;  4HDU A;  4G6Q A;  2EV6 A;  1ZG5 A;  3E6D A;  1XGO A;  3WGI A;  3CUQ A;  1R7J A;  2QM3 A;  5D6E A;  2K27 A;  2YX7 A;  3CLO A;  4YIF A;  1GXQ A;  3LQR A;  1LEB A;  5DUI A;  4G94 A;  1T6S A;  1J7K A;  4A0Z A;  1FP1 D;  4KN7 X;  1BI0 A;  2HQR A;  3CTA A;  2LDU A;  3SHF A;  4A6D A;  2FNA A;  1BC7 C;  4Y17 A;  4EM0 B;  2XAJ A;  2G7U A;  5CVV A;  4A6E A;  1I1G A;  2EV5 A;  1UCR A;  2KKO A;  4G7H F;  4AIJ A;  4OOI A;  4R1H A;  3P9I A;  3QRF F;  3HIF A;  4G7O F;  1TW3 A;  4UVC A;  3FZV A;  5LGN A;  1ZN2 A;  2DU9 A;  5E8G A;  3EYI A;  1DPU A;  1G3S A;  2HZT A;  3IKT A;  3IC7 A;  1F9N A;  3KCC A;  1T98 A;  3ZP5 A;  5BPI A;  4WX9 A;  1FNN A;  2DT5 A;  2NNY A;  2L02 A;  3C7J A;  3RPQ A;  4I0B A;  2D45 A;  5DCM B;  1T38 A;  4QLC U;  4HX7 A;  2JT1 A;  2MA3 A;  5D4S A;  4LB5 A;  2CW0 F;  1L0O C;  1R5H A;  2VN2 A;  3OV8 A;  1IZ1 A;  1R1V A;  3CO6 C;  1T0F A;  3ERE D;  4PGG A;  2KIF A;  2XIG A;  1OR7 A;  1XN7 A;  4BAY A;  1KQ9 A;  1V4R A;  4RB0 A;  1UB9 A;  4WCG A;  2FBH A;  2V9V A;  5F64 A;  4RB3 C;  3I58 A;  1DUX C;  4UXN A;  4G7Z F;  2DPD A;  2PMU A;  3FMQ A;  1D8J A;  1HKQ A;  3J81 Z;  2XKO A;  3DKW A;  1L3L A;  1BC8 C;  5CVI A;  3LQQ A;  2QLZ A;  1QQI A;  3KE2 A;  3R6S A;  5LRS A;  1O3T A;  2D1V A;  2V1X A;  3FMS A;  3LA3 A;  1UST A;  2Z9O A;  4A5N A;  1HKS A;  1BI1 A;  3HTU A;  2WV0 A;  1TTY A;  1ON2 A;  2V6C A;  1R23 A;  1K78 B;  3V8J A;  2RKH A;  3HYI A;  3CUQ C;  3T8R A;  5JVT A;  1FPQ A;  2HOE A;  2XRO A;  5ILS A;  3DP7 A;  5HDK A;  4BXU A;  2ISY A;  4HBL A;  3I4P A;  4ZZL A;  6PAX A;  1R22 A;  4FX4 A;  1W7P A;  4F7Z A;  3GZ5 A;  3KP2 A;  3HHG A;  1VTN C;  4G9Y A;  3IWZ A;  2HS5 A;  2CYY A;  1ZLJ A;  3R0A A;  2TDX A;  5LGU A;  1G6N A;  3M8F A;  2PEX A;  2K7L A;  5D5V B;  3E3V A;  3SZP A;  1STZ A;  4ENM A;  1U5T C;  1MKM A;  1ONV A;  3BP8 A;  3QOP A;  4RS8 A;  3ZMZ A;  3O2P E;  1HW5 A;  4M72 A;  3H92 A;  2X0L A;  4UNO A;  2F5D A;  2EFO A;  1YFH A;  5IT3 A;  3GFM A;  1J0R A;  1U6G A;  2Z5U A;  2MC3 A;  3IKV A;  4R79 A;  2VE8 A;  3CJN A;  3E97 A;  3DV8 A;  4I01 A;  1YTY A;  2A3S A;  1FSE A;  2WWY A;  3GO5 A;  1IUY A;  3B73 A;  1ZYR F;  2VOP A;  4HF2 A;  1IN8 A;  3KZY A;  4O5V A;  2OZU A;  1YG2 A;  1I27 A;  2DFI A;  1F1Z A;  1G3T A;  1PDN C;  3DF8 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...