2UZKA

Crystal structure of the human foxo3a-dbd bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Crystal Structure of the Human Foxo3A-Dbd/DNA Complex Suggests the Effects of Post-Translational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
molecule keywords FORKHEAD BOX PROTEIN O3A
total genus 16
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2uzkA01
4ASNA 5ICEA 1I6XA 4U7BA 1REPC 5D8KB 1XMAA 2HOEA 2ACJA 3ECHA 1ZLKA 1BM9A 4N9IA 1IXSB 2NYXA 2D1VA 2HQNA 1SFXA 4MTDA 5KK1A 4N9HA 3ZN1A 1I1GA 1CGPA 3P7NA 1XSDA 3K0LA 4BHCA 3FXQA 3GUDA 2HWVA 1TQIA 1YS6A 4F7ZA 1HW1A 2STTA 4HF1A 1RI7A 2RKHA 3EYIA 1W4MA 2RVCA 3R60A 1XN7A 2XAQA 1MJ9A 1KU3A 5LGUA 4P9UA 2DAOA 3BY6A 3W6KB 5F6FA 2QYOA 2ELHA 4G8XA 4KIFA 2ISYA 3I4PA 5JR3A 1MDMA 2ZKZA 3O3KA 1IN7A 1HKTA 1HKQA 1ZYRF 1P6RA 4YFNF 2XKPA 2D1HA 3KP4A 2IA1A 4U0YA 1J7KA 1K7AA 1CF7A 1EH8A 3J81Z 3GFLA 3ML6A 2FNAA 2OD5A 5LRRA 1T38A 1Z6RA 2KIUA 2Y0MA 1D5VA 4IJAA 3N4MA 3LAPA 2Z99A 4A0YA 4CZZA 4LK1F 3E6CC 1LQ1A 2IA0A 4OOIA 2FBKA 3L7WA 2MC3A 3HIFA 1G6NA 2J5PA 2VC1A 2ZJ2A 2ZNYA 3OV8A 2W25A 3FMRA 4TV7A 1IF1A 4JQFA 3E6DA 5AIPA 1IRGA 4B09A 5L3BA 2EK5A 4JK1X 4CGZA 1XCBA 3L00A 4FHTA 4P9FA 3DKWA 3K9TA 2QBYA 1KQ9A 3QRFF 4ON0A 1O3QA 1ZREA 5HDNA 3KETA 3C3WA 2PMUA 3M8FA 2PFBA 1WSUA 1KYZA 2V6CA 4AWXB 2FMYA 4OIPF 3H92A 5TJJA 3DFGA 3KE2A 3BROA 5K5RA 4RAYA 4ETSA 1DUXC 4YFXF 4Q47A 4KMUX 3W6JB 2LNBA 2WWYA 1LDDA 4KT5C 2F5CA 4RB2C 2VT3A 1UFMA 4MQVA 2PG4A 3V7SA 2M30A 1KA8A 1SD5A 2KJCA 4H0EA 2UXNA 2JTVA 4XBFA 1Z1DA 6PAXA 4I01A 1TBXA 2VBXA 3HRMA 3WU0A 3TO9A 1O7LA 1XGOA 1KU2A 1EV7A 4AD9A 4HQEA 4IRHA 5F64A 3F3XA 1BJAA 3RJPA 3R0AA 1USTA 3MZHA 1HSJA 4Y15A 4EGZA 1FSHA 1FBSA 1U5TC 3BP8A 2XVCA 3ZMVA 5ILSA 5TRDA 5E8IA 3ZN0A 1PP7U 1B6AA 4HF0A 2XAGA 1FP1D 1B59A 3ECOA 2DK5A 3GFIA 2IW5A 4R8HA 5FFZA 1BOAA 1QGPA 2RV8A 3FF5A 5E17F 1UCRA 1LDJA 5LEJA 4L0ZB 3DEUA 2XV4S 4I2OA 4LG0A 3IRRA 2P5KA 1J9IA 1WQ2A 2A68F 3LA2A 4UVAA 3DP7A 3LQRA 2CYYA 1G3SA 1C0WA 4BXUA 3HHHA 3V8KA 4CYDA 3I59B 2UWMA 2DK8A 1LVAA 5D5XB 3BDDA 5LGTA 1D8JA 2YX4A 5A2QK 3O6BB 1ZG5A 4LLNA 3SZPA 3FXRA 3F8CA 4M9ZA 3P9CA 1MKMA 2W57A 4M73A 2EV5A 2DQLA 4QLCU 4G7HF 1U8RA 1IXCA 3KP2A 5E8GA 4ZYGA 4S04A 2IJLA 2OA4A 3QOPA 2VOOA 1GXQA 1LEAA 2QVOA 3L9FA 4K2EA 3BPVA 3PQKA 1E17A 5DUIA 2EJRA 1YYVA 4KIGA 4OMZA 3DF8A 4BAYA 1S29A 4LJZF 3GXOA 3ERED 1FY7A 1KU7A 1FNNA 4LB5A 4EVIA 5D8LB 1ONVA 3C1DA 1DDNA 2BV6A 3NRVA 1TW3A 5CVIA 1GHCA 1YW9A 3LQQA 2LF8A 3T0YA 3IL2A 3KEOA 1ZRFA 1HXDA 4AIJA 4KN4X 4M74A 1FBUA 2R7DA 2F5EA 1LEBA 3ZMSA 3BJ6A 2MH2A 3RKWA 3JTGA 3HYIA 4A5MA 1GXPA 2CSOA 1YW7A 2VC0A 5L3CA 3GX4X 2FEZA 1J59A 3TO6A 2PEXA 3L09A 2OU2A 2COMA 1R5GA 1IZ1A 2DI3A 4WX9A 4L5IA 2A61A 2CO5A 4HX8A 2EFPA 3SQNA 2P6TA 5LRSA 3HTUA 1Z7UA 4GGGA 3GFJA 2EV0A 4EJWA 3IHUA 2JRTA 3CTAA 2Y75A 4OIOF 2W24A 1XMKA 2P5LC 2PI0A 2VN2A 3G73A 5EEGA 3GF2A 3WGGA 2MH9A 1X3UA 4KA4A 1Z9CA 4RB1A 2PQ8A 3WGHA 5K5QA 2ZO4A 3FM5A 3B73A 2KKOA 2QBYB 2P5VA 2MLGA 4A12A 3KFWX 2QZ8A 2RDPA 3VEPA 1JXSA 2PN6A 4IVNA 2XHKA 3LWFA 1U5TA 4I02A 2FA5A 1S7OA 2O6GE 4L0YB 3GZ5A 2ADUA 1FP2A 4UV8A 3CUOA 2XUBA 5IT9K 4HV6A 4XSXF 1WWXA 1R58A 3K1MA 2VONA 1BIBA 4I0BA 3LA7A 3EETA 5AIQA 2Q8KA 4EJTA 5DD4A 5JI6A 2NS0A 4IPAA 1OPCA 3NEUA 2VXZA 1R1UA 3LAJA 5FLXK 1L0OC 2D2WA 4YG2F 2DLLA 1JGSA 1CF7B 5LGNA 2RQPA 2B0LA 4KNYA 4UUVA 3R4KA 4I0AA 3E5QA 3RKXA 3ISPA 4ZYEA 5EEHA 5DUKA 1BC7C 3CUQA 2MBFA 2OQRA 2FXAA 3V8LA 4Q48A 1MZBA 3CO6C 4ESJA 1BI3A 3L2CA 1BN5A 2BYVE 1U3EM 1H9TA 1KQ8A 1MD0A 5D4RA 3KEQA 2O61A 1F4KA 2M8EA 2MLKA 4U0VA 4E70A 1P4AA 2HS5A 2H27A 4O6JA 4CDGA 3I53A 3WTWC 2JPBA 4LFUA 1TQPA 1H0MA 2VBYA 1P92A 2E1NA 4N0BA 4BHPA 3GFMA 1YLFA 2A6EF 4RGUA 2C6YA 1ZG3A 2RNJA 1FYLA 4CO8A 3VB2A 2P7VB 3DPTA 2MD5A 4ESBA 3E5UA 3O2PE 2Y48A 2CWEA 3KCCA 2CFXA 3RKYA 3I58A 1J5YA 5FB2A 3IRQA 2P6SA 3FMSA 3V8JA 4RGSA 3ZMZA 3DXJF 5FD6A 1QQIA 1J0RA 2NNNA 1BI1A 2M45A 1S7AA 5HS8A 5HLHA 1J2XA 2HKXA 3P9IA 1ON1A 4Q5SF 3I0TA 3KLOA 4ZYDA 5D6FA 3ROUA 2F5FA 1HSTA 2ZMEB 4GO1A 4UVCA 1D8KA 2HDCA 3FHZA 3WTUC 3I71A 1PP8F 4GXOA 2LDUA 1IRFA 2DPUA 1Y0UA 3EQLF 1QZZA 4WXCA 1XSXA 1BC8C 2ISZA 4ENNA 2JSCA 3V7RA 4WXDA 2E1CA 4IRGA 2XAJA 5A2QZ 2GA2A 3E97A 4KUMA 2F2EA 2L54A 2XAHA 3C18A 1RZ4A 3CO7C 3QPHA 4I7HA 1MGTA 1O57A 4MTEA 1RUNA 1UHMA 2ESNA 1JHHA 2KJBA 1B4AA 1YIOA 2X0LA 1PDNC 5K1YA 4G7OF 3WU1B 3VOEA 5LEKA 5F1RA 1Z05A 2QLZA 3SHFA 1SD6A 3F6VA 1IAWA 3ZMDA 1KQ0A 2DBBA 4BQAA 3JTHA 4HAMA 1SMTA 4FX4A 1SAXA 5ED4A 2E7WA 4NB5A 5IT9Z 5H6QA 4HQMA 2K27A 1XDUA 3T5XA 2OBPA 1SFEA 5ICGA 2YX7A 5J6XA 2HYGD 1IN6A 1G3YA 2QENA 4XSZF 5DDGA 1T6SA 3RYRA 1IN4A 3KLNA 2XASA 2M1BA 2GIVA 2FSWA 1HQCA 3B02A 3F8FA 4PCQA 1RIOH 3E6BA 5LHGA 4GCVA 2FNPA 3WTXC 3GYHX 5DYMA 5E1XA 3ABUA 2P8TA 4R1HA 2O0YA 3JW4A 2BE5F 3F21A 4UV9A 2VODA 2K7LA 2CW0F 4QWQA 2EB7A 2WV0A 1W5TA 4KDPA 4EJOA 3BPXA 4RGXA 4HLYA 2V1DA 1E2XA 2IP2A 5D5VB 2F5DA 4L9NA 2WC2A 4LGWA 2IVMA 2ZNZA 4M9SA 4JBAA 3ULQB 2M5WA 2DTRA 3FX3A 3I59A 2ZFWA 2FF4A 4LK0F 1XB4A 1ZRCA 2RN7A 1V3FA 4MEXF 1XSVA 4I98B 4ZZLA 3QAHA 4XLPF 5CVRA 2Q2EA 3RTRA 2V79A 5CVUA 4EM1A 2RGVA 2O03A 4MEYF 4BNCA 5J8CA 2FRHA 3R0JA 2WTEA 3ZMUA 3R6SA 1U6GA 3IWZA 3WE3A 3BZ6A 1J75A 3LSTA 3CUQC 1D3YA 2E7XA 3MCZA 5CJ9A 3IWFA 4WCGA 4HYEA 3ZQ7A 4EM2A 3PFIA 2KIMA 3I5UA 2PBIA 2VT2A 2QWWA 5HDKA 3TQNA 5K5OA 3K1NA 4CXFA 1FSEA 4U0WA 1H9GA 3MWMA 4L9JA 5HLIA 2JPCA 2YPRA 2Q0OA 1FZPB 3K1PA 4RB3C 4GYGA 3F72A 5DV5A 3HUGA 5ICFA 1T2KA 5ILVA 3J80Z 2VBZA 3MZYA 1R1TA 4A0ZA 1KU9A 2IPQX 5ILUA 3KP6A 2X4HA 5CVVA 4OU0A 4ZH4F 4UHTA 3WTZA 1YQAA 2K4BA 1MJBA 2R7FA 5ICCA 3TKYA 1R00A 1W5SA 1LDKB 5D4SA 2H09A 1T39A 1R1VA 3I54A 4L18B 5FD5A 1TNTA 3RPQA 3EUHA 1T0FA 3LA3A 1FT9A 4BHBA 1SMYF 2LSOA 5LLQA 3HRTA 2L4AA 4ESFA 3ZP5A 3CDHA 5FLXZ 1IN8A 2OZUA 2A5YB 2M87A 2LF7A 1SFUA 3TO7A 4KFCA 3TDUC 3LFKA 3Q5FA 3ABTA 4PGGA 2EFWA 3GVAA 3IKTA 3T1BA 4CHUA 4EJVA 1ULYA 1O3TA 2HKOA 3VFZA 1B9NA 2BEOA 4OIQF 5DCMB 3D0SA 4A6DA 3I64A 2QQ9A 4HZFA 4P55A 3HRUA 2QQAA 3EDPA 4ENKA 1QZYA 4HLXA 2H94A 2EFNA 1Q1HA 1G3TA 3S2WA 3F6OA 4MGRA 3K69A 1LJ9A 3J81K 4YIFA 5BS6A 3T8RA 1MJAA 3QU3A 1YG2A 2AS5F 3WE2A 3HTSB 2HR3A 2DO7A 1T98A 2YSRA 2A6HF 4PZJA 1RNLA 4ZYHA 2DFIA 1B9MA 5J8FA 1XGNA 2EFOA 3NQOA 1I1SA 3TOBA 1I27A 1R23A 3R61A 4A2UA 2STWA 2JZYA 4HOBA 4RGRA 1K78B 2ETHA 1QBJA 4HF2A 1YTYA 1R7JA 5HS7A 4A6EA 3F8MA 3TDZC 2UXXA 1ZN2A 1VTNC 2CG4A 3F8BA 3IKVA 4LLLA 4L9VA 3WODF 3QU6A 3TGNA 3BWGA 1TW2A 2V1UA 4G6QA 2EFQA 2FBHA 1TTYA 5LHHA 1U2WA 2DU9A 4S05A 3FMQA 2LKPA 1ZHFA 2DT5A 2OAZA 3DV8A 1BI0A 5E20A 5BPDA 2VE8A 3RPUA 4HDUA 1OR7A 3FM3A 2L4MA 1K6OA 3JSOA 3PQJA 1B1BA 3F8NA 5D6EA 2NAZA 1SD7A 1G3WA 1U5TB 4HV5A 5BQTA 1S6LA 4M72A 1O3RA 2K02A 1G4DA 4Y13A 3KZYA 2A3SA 2HTJA 2UZKA 2V9VA 4RB0A 1JE8A 2XIGA 1TLHB 3HRSA 2H6CA 1K78A 4HA8A 3RIRA 2GXGA 5E1WA 1S8NA 1YO5C 4XRFA 3HSFA 5HDGA 2YR2A 4OMYA 1ZRDA 1W7PA 4M9XA 3WGIA 2K86A 3RYPA 1OYWA 5IT3A 1YW8A 4M6YA 2AXLA 4ENJA 4EQQA 1UHWA 1HW5A 2QM3A 5KVRA 4DNCA 1QNTA 3E3VA 4MNUA 5L3GA 2L3DA 1O7FA 5H6RA 1R22A 3JAMK 3U1DA 2Z33A 1OMIA 2GA1A 1HW2A 3N97A 3TOAA 1R5HA 2IT0A 3WTVC 3H3ZA 1K79A 3E6MA 2FOKA 1AWCA 3AAFA 1ZLJA 4A5NA 4KMFA 4O3MA 1Z6TA 5DCMA 2R3SA 5CYVA 4EGYA 4I09A 4LLGF 3OOPA 3GZ6A 2VOPA 2GXBA 1F5TA 1R36A 2PMHA 4PDKA 3GO5A 4L5JA 1XD7A 2FU4A 1IN5A 3P9KA 4G9YA 2TDXA 4U88A 3WTYC 5LHIA 4HDVA 2EA2A 4FT8A 2YU3A 2HEOA 2GZWA 4XLNF 3MEXA 1BI2A 1ZH5A 3DQVC 1IW7F 3QP5A 1FPQA 2W85A 2JT1A 3DPLC 2QUFA 2A69F 3GLXA 1NHAA 2EV6A 2QQBA 2RC4A 4IHTA 3Q9VA 3M1EA 2XRNA 1ZG1A 1OKRA 2NNYA 1DP7P 4HX4A 2EA4A 2GAUA 3M8EA 4HW0A 1A04A 3J80K 1P4WA 2DW4A 3BOQA 1KGSA 2G7HA 1YS7A 1ODDA 1IXRC 1DPUA 2Z5UA 2IRFG 2XGXA 5HLGA 1HBXG 1OYIA 4AVPA 4R79A 1S3JA 1SD4A 1ZGAA 2DPDA 4LG0B 2FE3A 5D5UB 4OIRF 4LMYA 4LB6B 3GWZA 2ZBKA 4RAZA 3EYYA 4YIIA 3JSPA 1F1ZA 4G94A 4P5OA 1UB9A 2Z3YA 3U9GA 2Z9OA 1ZGJA 5FFXA 4MHGA 1TNSA 3RDIA 5HOOA 2ZCWA 5BPIA 1F9NA 3KP7A 4BYYA 1FLIA 3BJAA 2HYFA 3VODA 2MA3A 3HOSA 5JHUA 3GEZA 1XCVA 4MQ9F 5FGMA 5ERIA 1XGSA 2P4WA 3BJOA 4EV0A 4A0XA 5LBQA 4PGHA 4UVBA 5FO5A 1P2FA 4LD5A 1Z91A 4GYIA 4WK8F 5DCFA 3RI4A 4YFKF 2HFHA 2D45A 3REOA 3C7JA 2VE9A 5E1ZB 4BH9A 1FOKA 4Y17A 4EM0B 2P7CB 4UNOA 4M71A 4IHSA 4KYWA 2OQGA 3H3UA 1WKMA 2J5OA 1I5ZA 2ZXJA 5BOXA 1U78A 1LNWA 2O8XA 5CLSA 3SFZA 3HHGA 3QP6A 3D5LA 4EJUA 5L3EA 3ZPLA 3ELKA 2KIFA 4FX0A 5JVTA 3KP5A 4OINF 2FQ3A 4G6DA 2A07F 4KIBA 3J7AO 2ZMEA 3COAC 1FYMA 2HQRA 3FXUA 2V1XA 5CVJA 1FYKA 4U7DA 1USSA 4L9TA 3MAJA 1GVJA 4Z2YA 4IXAA 3SXYA 4WWCA 4UXNA 2XKOA 1LB2A 5H20A 3FWEA 2GQQA 2BGCA 4NQWA 3GW2A 2G9WA 4DQ2A 2L01A 1FC3A 2G7UA 4M6XA 5D5WB 1IUYA 4NHJA 1FX7A 2FMLA 4AIKA 1BIAA 1V4RA 3Q9SA 3CLOA 4RS8A 1W7PD 1YFHA 2HGCA 5DD8A 5AONA 1WI9A 2VBWA 2NRAC 2XAFA 3HSRA 1DPRA 2W84A 4P96A 1O3SA 2EWNA 1XGMA 4HBLA 2FBIA 4EMSA 3HOTA 5BMZA 3WG9A 4WF2A 1QO0D 1ON2A 3KP3A 3V4GA 1JHFA 2DQRA 4Q4ZF 3K2ZA 3ZMTA 3KZZA 1MDMB 2XROA 3G3ZA 1ZARA 1FWZA 4HX7A 3SZTA 1W7PB 5JFRA 2HZTA 3CUQB 4KICA 3E5XA 2CQKA 1EH7A 4ENMA 2PLYA 5DEQA 1BBYA 3JAMZ 3FZVA 3M7GA 4D0PA 3F22A 5L3FA 1WRJA 1AOYA 3IC7A 1EH6A 2GWRA 5L3DA 5HVQC 2IA2A 3T8TA 2KRFA 5E18F 4B8XA 1KYWA 1RUOA 1ZAOA 4IRIA 2BBYA 4IF4A 3V7CA 3MFKA 3U2RA 3F23A 1L3LA 4G7ZF 3WTTC 4CICA 4AIHA 2CGPA 1STZA 2O3FA 4WXHA 3QPTA 1FBQA 2ESHA 4KN7X 5HS9A 1PUEE 1HKSA 2OZ6A 1OYYA 3M9AA 3WTSC 3MQ0A 3CJNA 4ZZDA 1TQMA 1P4XA 2HTSA 3HSEA 4O5VA 1XDSA 2H6BA 2L02A 2PJPA 2K4JA 1QPMA
chains in the Genus database with same CATH superfamily
5IOZA 4Z6YA 2DA6A 1DP3A 3CLQA 4ASNA 5ICEA 1I6XA 4B44A 3SDBA 1R71A 4U7BA 1REPC 5D8KB 1G59A 1XMAA 4XKCA 1SC7A 1YOVB 2HOEA 2ACJA 3ECHA 3LSIA 1ZLKA 3OSGA 1BM9A 4N9IA 1IXSB 3RCOA 1IO2A 2NYXA 1S7EA 2JN6A 4BS9A 2FX0A 2D1VA 2ME0A 2VKDA 2LK2A 2HQNA 1SFXA 4MTDA 2KRCA 5KK1A 4N9HA 2R7ZJ 2HXIA 3ZN1A 1I1GA 5FKLA 1TWAJ 1CGPA 3P7NA 1XSDA 3K0LA 4BHCA 3FXQA 3GUDA 5CPRB 2HWVA 1TQIA 1YS6A 4F7ZA 1T08B 1HW1A 2STTA 4HF1A 1VF9A 1LFBA 2MGQA 1RI7A 1UZCA 2RKHA 4F92B 5M5WJ 3AFHA 2BY0A 3EYIA 1W4MA 2M9HA 3JREA 4HNTA 1P7IA 3U21A 2RVCA 3R60A 4ZYAA 4IX7A 1XN7A 2XAQA 4BXFA 1MJ9A 1KU3A 1MMAA 2V4JC 2JA6J 5LGUA 1ETXA 4P9UA 2DAOA 3BY6A 2H1KA 4PSWA 4B48A 3JRDA 2F6CA 1G2HA 3W6KB 3OYIA 2F4MB 5F6FA 2R7RA 2QYOA 3S14J 1S5LC 2ELHA 4G8XA 1JTXA 4KIFA 2ZXHA 4CCLA 1YJNI 2ISYA 3I4PA 5JR3A 2KQRA 1MDMA 3KZIC 2ZKZA 3O3KA 4C3HJ 1IN7A 1XS9A 1HKTA 1UHSA 1HKQA 1ZYRF 1P6RA 4YFNF 4E7SA 5HLTA 2YUSA 2XKPA 2D1HA 3KP4A 2IA1A 4U0YA 1J7KA 3S16J 2DOFA 2A05A 2ZJQF 1WVRA 1K7AA 4GDFA 1CF7A 1EH8A 1D0ZA 4EEFG 3J81Z 1ETOA 3ASOH 3GFLA 4PJMA 3ML6A 2FNAA 3X2QH 2OF7A 2OD5A 5LRRA 1E3OC 1T38A 1Z6RA 2NVXJ 2KIUA 2Y0MA 1VQNI 4IO9F 1D5VA 1MBKA 4IJAA 3QOEA 3L1PA 3CCJI 3N4MA 3G71I 3LAPA 2Z99A 4A0YA 1BW5A 4II3A 4CZZA 4LK1F 3E6CC 1LQ1A 2IA0A 4OOIA 2FBKA 3L7WA 3OYAA 2ZC2A 1T56A 2EIKH 2MC3A 1G6NA 3CJQB 3HIFA 3U1KA 2J5PA 3OWTA 3CMAI 5FKKA 1FJLA 2VC1A 2ZJ2A 3OL4A 2ZNYA 3OV8A 2WY8Q 2W25A 3FMRA 3A2KA 4TV7A 3CCQI 2DT7B 1IF1A 4JQFA 3E6DA 5AIPA 4E7KA 1IRGA 4DBQA 1V5EA 2YU9J 2KT0A 4JYKA 2VKEA 4B09A 1K6YA 1Y1VJ 3TMOA 2E5ZA 4HG2A 5BNGA 2EK5A 4JK1X 5L3BA 4CGZA 1XCBA 2IS4A 1ERDA 3L00A 4FHTA 2V9PA 4P9FA 1AU7A 5EZHA 4UUTA 1LE8B 3DKWA 3K9TA 2QBYA 1KQ9A 1OCRH 1FOWA 1TT5B 1IGNA 1QVTA 3QRFF 4ON0A 3K7AJ 1ZGWA 1O3QA 2VJ5A 2EZIA 1ZREA 5HDNA 3KETA 3C3WA 2DYRH 2PMUA 4BJTA 3M8FA 5DTDA 3ZCOA 1MSEC 1MNDA 1E3HA 2PFBA 1WSUA 1IRZA 2BVLA 1KYZA 3I55I 2V6CA 2GXAA 4AWXB 2DA5A 2FMYA 1FMWA 2X6WA 2O9LA 4OIPF 4XK4A 2D5VA 2LC2A 1KZHA 3H92A 5TJJA 3DFGA 1PUFA 2KZVA 3KE2A 3FKJA 4PFOA 3BROA 2IEKA 5K5RA 4RAYA 3G2BA 4ETSA 3K4MA 3JRHA 1DUXC 2E1MC 3FBIB 2LKXA 4B47A 3PSFA 1RC9A 4YFXF 2W7NA 2WAFA 4DYQA 4Q47A 4ZDPA 3A4CA 4KMUX 3W6JB 2LNBA 2H8RA 3CP2A 2WWYA 1LDDA 3BC8A 4KT5C 2F5CA 2XDVA 4RB2C 2VT3A 3B6AA 4RLFA 2HU9A 3CP8A 3RSNA 1UFMA 4MQVA 4G6TB 3OR2C 2NVTJ 2PG4A 2VL8A 3V7SA 4CZCA 2M30A 1KA8A 1SD5A 3IH4A 2I5UA 4JX4A 5JLXA 1SEUA 1PJRA 2KJCA 2UXNA 4H0EA 2JTVA 4XBFA 1Z1DA 4U87A 4PFPA 3S8PA 1MIJA 6PAXA 2AO9A 4I01A 3K4JA 1TBXA 2JUCA 4UUSB 2VBXA 1ZQ3P 2PJRA 3HRMA 3WU0A 2HXOA 4D9JA 3TO9A 1LKXA 1O7LA 4E4HA 5H2FC 4C3JJ 1CQTA 3RZDJ 1XGOA 1KU2A 1EV7A 4XLHA 3MD2A 3PFYA 4AD9A 4HQEA 1TP4A 4IRHA 5F64A 3F3XA 1BJAA 3RJPA 4XM3A 3CCUI 3R0AA 1X1DA 3HGYA 2BHYA 1USTA 2HDWA 1JKQC 2X9DA 3MZHA 3OYHA 1HSJA 4Y15A 4EGZA 4XICA 5KNLA 1FSHA 2OTLI 1FBSA 1U5TC 3PO2J 2EIJH 3M3YJ 3BP8A 3MN2A 2XVCA 3ZMVA 3LSMA 1A31A 2BZTA 5ILSA 2BW3A 1VQ9I 1RR8C 3FISA 2HYJA 5TRDA 5E8IA 4HNVA 3ZN0A 3LSRA 2DYSH 1PP7U 1B6AA 4PUSA 4F55A 4HF0A 2XAGA 1FP1D 1B59A 1AKHA 3JRFA 3ECOA 3CZ6A 4C3IJ 2DK5A 3GFIA 2IW5A 4R8HA 5EYRA 5C4JJ 5FFZA 1DGWY 4C2TA 1BOAA 3SEZA 3BR5A 5HODA 1QGPA 2RV8A 3GZNB 4BACA 3FF5A 1VQ6I 1I50J 5E17F 1V54H 2R7XA 1UCRA 1JT0A 1LDJA 3WHCA 5LEJA 1MMGA 4L0ZB 2CUJA 3DEUA 2XV4S 4I2OA 4LG0A 2QQ8A 4YELA 3CC4I 3IRRA 2A6TA 1R4MB 3NWSA 2P5KA 1TZLA 1BR1A 2W00A 3S93A 1J9IA 1WQ2A 2A68F 3LA2A 4UVAA 2X1EA 2TRTA 2VB6A 1VQKI 3DP7A 3LQRA 2CYYA 2DT6A 1G3SA 1C0WA 1OQYA 4BXUA 4QIWN 3HHHA 3V8KA 4CYDA 3I59B 2UWMA 2DMPA 1YJWI 2DK8A 1LVAA 5D5XB 3BDDA 5LGTA 4BUPA 1D8JA 2YX4A 5A2QK 3A1YA 3O6BB 1ZG5A 2ZSHB 3CF5F 4LLNA 3SZPA 1YRNA 2XPUA 3FXRA 4MLOA 5GTHC 2R7UA 1I3QJ 1SFOJ 4DYCA 2KL4A 3F8CA 1DGRM 4M9ZA 3P9CA 5M3MJ 5DS9A 1MKMA 2W57A 3KEYA 2DA2A 2EV5A 4M73A 2DQLA 1YIJI 4QLCU 2B7EA 2CW7A 3MKWB 4G7HF 1U8RA 3O8HA 1IXCA 2VASA 4UY8I 4KITB 1T33A 3KP2A 1S9HA 2KP6A 5E8GA 4ZYGA 4S04A 2IJLA 4C2MJ 3FHNA 2PMZA 2E71A 2OA4A 3Q3SA 4PK4A 2DTZA 2RAEA 3QOPA 2VOOA 1D5YA 1BA5A 4PJNA 4A3EJ 1GXQA 4BE2A 1LEAA 5LFAA 3G1MA 2JMWA 2QSFX 2HVRA 3C2GA 2QVOA 2RQQA 1RR7A 3HPGA 3L9FA 4K2EA 3S15J 3BPVA 3BCAA 3PQKA 4A3DJ 2P81A 1E17A 5DM7F 5DUIA 2EJRA 5E3LA 1YYVA 4KIGA 3QYFA 4OMZA 1SAUA 1TWFJ 3DF8A 4BAYA 1Y56A 1S29A 4Y52J 2BVMA 4LJZF 3OYMA 3GXOA 3ERED 2BW3B 1FY7A 1KU7A 1FNNA 3BT9A 2DJNA 2O5RA 4LB5A 1MW7A 4EVIA 5D8LB 1Z3YA 5FJ8J 1ONVA 1X4OA 1QRYA 3C1DA 1DDNA 2BV6A 2CJJA 1N78A 3NRVA 1TW3A 2Z1DA 1EKEA 5CVIA 1GHCA 1YW9A 3J7YJ 3LQQA 2LF8A 3H0DA 1WH7A 3T0YA 3IL2A 1RESA 3KEOA 1ZRFA 3EPZA 3A03A 1HXDA 1A6IA 4AIJA 2M4KA 4KN4X 3TW6A 4M74A 1FBUA 5KAIC 2K9SA 2R7DA 3BTLA 2F5EA 2HOTA 2VQGA 2NS7A 3ZMSA 1LEBA 3BJ6A 2MH2A 1QHGA 3RKWA 3JTGA 3HYIA 4A5MA 1GXPA 1U9OA 2IS2A 2CSOA 4KT6A 1YW7A 2VC0A 5L3CA 3GX4X 2FEZA 1J59A 4XLCA 5GPCA 2V6EA 4A3GJ 3E7LA 3TO6A 2PEXA 3VSKA 3L09A 3OYEA 2OU2A 2COMA 2IGNA 2L7MP 3K4BA 1R5GA 1IZ1A 4YIRX 2DI3A 4WX9A 4L5IA 3PUBA 3S1RJ 2A61A 2ELKA 1HLVA 2CO5A 1FOYA 3D5SC 2R5YA 4HX8A 2ICWG 2EFPA 2IGKA 3SQNA 5IP7J 3L2WA 4XLAA 2P6TA 5LRSA 3HOWJ 3HTUA 3DU5A 3S1MJ 1Z7UA 4GGGA 3GFJA 1E3PA 2EV0A 1MNMC 4EJWA 3FXMA 3IHUA 2JRTA 3ZQLA 2Y9ZA 3CTAA 2Y30A 2Y75A 4OIOF 1OCCH 2EILH 2W24A 4XRSG 2LY2A 1XMKA 2P5LC 2PI0A 2VN2A 3G73A 2E34A 4MO7A 5EEGA 1WH5A 2E60A 2WBMA 3GF2A 1HOMA 3WGGA 2MH9A 4MFDA 3IP4B 2LOOA 1X3UA 1JKRC 2MSYA 1DQUA 4KA4A 1Z9CA 4IHWA 4JX6A 4RB1A 2PQ8A 2QSHX 4DZPA 3WGHA 4II2A 5K5QA 2ZO4A 3HM5A 3O8GA 1QPIA 3FM5A 2JA7J 3B73A 1JKPC 5HNFA 2KKOA 3L2UA 3HPHA 2QBYB 2P5VA 1TT0A 2MLGA 2CV0A 3LSKA 4A12A 2Z16A 3KFWX 2QZ8A 3LL7A 2RDPA 1VI0A 3VEPA 4BBSJ 1JXSA 5CQGA 2PN6A 3L2QA 4IVNA 2XHKA 1WZ2A 4W1UA 4IQJA 2L5QA 2HQAA 3LWFA 1U5TA 1A36A 1QZEA 4I02A 2FA5A 1MH4A 4FCYA 1V5FA 1S7OA 2O6GE 4L0YB 2LH9A 1VQ4I 3GZ5A 2ADUA 3OYGA 1FP2A 4UV8A 3CUOA 4BDZA 2XUBA 5IT9K 4HV6A 2ID6A 5JLWA 4FISA 4XSXF 1WWXA 2VKVA 4HEA2 1R58A 3K1MA 1MBGA 4B1RA 4AM3A 1HC8A 3H0GJ 2PMZN 2VONA 1BIBA 1X1AA 5M5XJ 4HPQA 2IBDA 3LA7A 3EETA 1MNEA 2KHMA 4I0BA 4PJ0C 3CCSI 5AIQA 2Q8KA 4EJTA 2XF7A 5DD4A 5JI6A 2NS0A 4IPAA 1OPCA 3NEUA 2VXZA 1OJLA 3HOZJ 2R7WA 1R1UA 3LAJA 2VJIA 5FLXK 3OYJA 1L0OC 2D2WA 4YG2F 2R7VA 4DGWB 2DLLA 1JGSA 3DLAA 2E36A 5LGNA 4D7NA 1CF7B 2ZXIA 2RQPA 2NOJB 2XSDC 2M3AA 4E7LA 2B0LA 4KNYA 3DTEA 3TP0A 4UUVA 3R4KA 4I0AA 3SYTA 3E5QA 2DA7A 3RKXA 2X6YA 1Y8RB 3ISPA 4MFEA 3DBHB 5EEHA 1D1BA 4ZYEA 5DUKA 1APLC 1BC7C 3CUQA 5JVGF 2MBFA 2OQRA 2K9QA 1SVLA 2FXAA 2JQ7A 2ELJA 3V8LA 4Q48A 5E3MA 2IAIA 4A3LJ 1HA8A 1MZBA 2IS6A 3CO6C 1YHQI 4ESJA 1BI3A 3H36A 4BQOA 3L2CA 1BN5A 2BYVE 1U3EM 1H9TA 4XKWA 1IDYA 1WJEA 1Z3XA 3HKZA 3CCVI 1OLTA 2L7KA 1KQ8A 1MD0A 2LD5A 5D4RA 3CQZJ 2KZGA 3M8JA 4IHYA 3KEQA 2O61A 1F4KA 2X6OA 2GOMA 2M8EA 2ZFUA 1FTZA 1BOBA 2AQFA 2MLKA 4U0VA 4E70A 1P4AA 2BY2A 2HS5A 1GV5A 2H27A 2EZLA 4M3GA 3JRGA 3HBLA 4O6JA 4CDGA 3I53A 3WTWC 2V9KA 2JPBA 4LFUA 1TQPA 3OIOA 1H0MA 3SZGA 1W36C 2VBYA 1P92A 4A69C 2E1NA 4OAYA 4XORA 1LPQA 4N0BA 3LNQA 4BHPA 3GFMA 1YLFA 4QPOA 2A6EF 5F1JA 2ME6A 4RGUA 2C6YA 1ZG3A 3AG1H 3JRBA 4BQNA 2RNJA 3I3LA 4NC8A 4B43A 1FYLA 4CO8A 3K70D 2R5ZA 3VB2A 3DPTA 2CH0A 2P7VB 3A0HC 3KYLA 4A3FJ 2MD5A 4M3BA 4ESBA 1NG7A 3ASNH 2HQ5A 4DW6A 4D7MA 3E5UA 1ZR4A 3LFUA 3O2PE 2Y48A 2CWEA 3KCCA 2CFXA 1ZKGA 3OS0A 2X48A 1W0UA 3RKYA 2DCEA 3I58A 4E7JA 3D1NI 2QCOA 2R92J 1J5YA 5FB2A 3IRQA 2P6SA 3FMSA 1QA6A 1VQ5I 3V8JA 4RGSA 3ZMZA 3DXJF 1XG1A 2R7QA 3DCFA 2JVGA 2M7BA 5FD6A 1MMSA 1QQIA 3GTPJ 1J0RA 2KMUA 1JKOC 1ETKA 5F27A 4ZDOA 3BG7A 2CU7A 2K40A 2NNNA 1R6RA 1BI1A 3ABKH 2XF6A 2B9SA 2M45A 4ZJZA 1S7AA 5HS8A 3HOXJ 5HLHA 3NWTA 1J2XA 5F0HA 2HKXA 3P9IA 3S2DJ 2V7FA 3HB9A 1ON1A 3E0JB 4Q5SF 5IYBJ 1VFCA 2KPMA 1ENHA 3I0TA 2MC4A 1ETYA 2EZKA 3CD6I 3KLOA 3H9QA 4ZYDA 4HNUA 1HCRA 2B63J 3HC7A 5D6FA 3ROUA 2F5FA 1HSTA 2ZMEB 2IGMA 2DMQA 1D8KA 4GO1A 4UVCA 2HDCA 3FHZA 3WTUC 3I71A 1PP8F 2ID3A 2MFZA 4GXOA 4V2GA 1QU3A 2LBFA 3SJMA 3S1QJ 2LDUA 3A02A 3F0CA 1IRFA 4BGDA 2DPUA 1Y0UA 3EQLF 1QZZA 1WPKA 2DXIA 3DKXA 4WXCA 2R5YB 1M1EB 1XSXA 4E7IA 3GTGJ 1WJDA 4BE0A 1ZK8A 1BC8C 2ISZA 4ENNA 2JSCA 3V7RA 2CMPA 2CS3A 4WXDA 2E1CA 3DPUA 4IRGA 2QGUA 2XAJA 3PUFA 5K7FA 5A2QZ 2GA2A 3FXKA 3NAUA 3WG7H 2K9MA 3E97A 4KUMA 1N77A 3PIPF 4FE7A 2OC6A 3M1CA 2WV1A 2Q1ZB 1X1BA 1YE9A 2F2EA 3IV5A 1VQPI 1N25A 3H5NA 2L54A 3ZQCA 2XAHA 3H9GA 3C18A 1RZ4A 3G4SI 1K4TA 3CO7C 3QPHA 5F0FA 4I7HA 2M34A 5EZGA 1MGTA 4XRMA 1O57A 4MTEA 1F43A 1RUNA 3QPSA 3TBIA 2KIQA 1DU6A 1UHMA 3ZQIA 4QSHA 5J1YA 5KCMA 4IHVA 2HVSA 4AYBN 2ESNA 3EUHC 1JHHA 2R93J 2KJBA 2L9NA 1B4AA 5F0CA 1YIOA 1IDZA 2X0LA 1PDNC 5K1YA 3J7ZI 3V42A 3KPHA 5B66C 4G7OF 5B1AH 3WU1B 3JRAA 3VOEA 2QSGX 2XF5A 4HRIA 3HOYJ 2P0WA 3HGGA 3QWLA 5LEKA 5F1RA 4X0GA 1Z05A 2QLZA 2XPWA 3GTKJ 3SHFA 1SD6A 1X2MA 3F6VA 1IAWA 3ZMDA 1KQ0A 2DBBA 4BQAA 3JTHA 4HAMA 1SMTA 3K4LA 4FX4A 1SAXA 5FKOA 2VQCA 4XN0A 5ED4A 2E7WA 2IS1A 4NB5A 5IT9Z 2Z2SB 1I39A 3S3MA 5H6QA 3G6EI 4HQMA 2K27A 4A3KJ 2R7OA 2FUG2 3A01B 4NNJA 3OYKA 2I8DA 5IP6A 1XDUA 3T5XA 2OBPA 1SFEA 3A0BC 3W2VA 5ICGA 2YX7A 5J6XA 2HYGD 3BQZA 1IN6A 3IH2A 1G3YA 2QENA 3PJRA 1IJWC 4FTHA 4XSZF 3IAM2 2L9RA 5DDGA 3KX2A 1T6SA 3RYRA 2LKSA 3ZXSA 1IN4A 1ZELA 3KLNA 2XASA 2M1BA 2DMUA 2GIVA 1SANA 3ZGKA 2FSWA 3MKYB 1NK3P 1HQCA 2E1MB 4XN3A 3B02A 4NDLA 3F8FA 4PCQA 4M3DA 1RIOH 1VQLI 4J00A 3FKIJ 1YX5A 3E6BA 2VQLA 3GMEA 4XOTA 2JWTA 5LHGA 1EA3A 4KJZA 2M4GA 5GPAA 4GCVA 2FNPA 5EGOA 3WTXC 3P5JA 3GYHX 5DYMA 5E1XA 4F91B 3ABUA 2P8TA 4R1HA 2X6XA 2O0YA 3JW4A 5GADJ 4D5FA 1BW6A 1R4NB 2BE5F 1JGGA 3F21A 2OUMA 4UV9A 2VODA 5HNHA 2OTJI 4BE1A 2K7LA 2CW0F 4QWQA 2EB7A 4CH7A 2DJIA 1Z0XA 2WV0A 1W5TA 3I9V2 4KDPA 4EJOA 3QYEA 3BPXA 4RGXA 4HLYA 2V1DA 1E2XA 2IP2A 2F5DA 1UG0A 4L9NA 5D5VB 1O4XA 1LFPA 4GRIA 4NC6A 2WC2A 3CDIA 3AL0B 3FK6A 2FD5A 4LGWA 2IVMA 1Q1VA 2ZNZA 1P7JA 4M9SA 5IP9J 4RM3A 4JBAA 4BEHA 3ULQB 1VQ8I 3GTMJ 2M5WA 9ANTA 3FX3A 2DTRA 3I59A 3OSFA 2ZFWA 2FF4A 1EF4A 2HVQA 4ABZA 4LK0F 1XB4A 2UUZA 2TCTA 2W1OA 3S2HJ 5J4YA 1ZRCA 2LR8A 2K3PA 2RN7A 3DTIA 1V3FA 4MEXF 1XSVA 4I98B 4ZZLA 3QAHA 4EATA 1DU0A 4XLPF 2EIMH 5CVRA 2XB5A 2Q2EA 1WJCA 1GT0C 4E7HA 5TGTA 3RTRA 4AU7A 2V79A 5CVUA 4EM1A 2LFBA 1YJ9I 2RGVA 3RQIA 2O03A 4X1EA 1TC3C 4MEYF 4F93B 2QKMB 3MZ8A 3HEFA 4BNCA 4S0HB 5J8CA 2FRHA 3R0JA 2WTEA 3ZMUA 3R6SA 1U6GA 3IWZA 3PNTA 3WE3A 3BZ6A 1J75A 4IQ4A 2JK3A 3BLYA 3LSTA 3M4OJ 3CUQC 1D3YA 1X3WB 2E7XA 3AG2H 4DJAA 4HSTA 3MCZA 5CJ9A 2PJRB 2WB1N 5GAGJ 3IWFA 4Y4RA 4F3QA 4WCGA 2OV7A 3HOVJ 4PJLA 3UR3C 4HYEA 1OFCX 2HOAA 3CMYA 3ZQ7A 1B8IA 4EM2A 3PFIA 5KHDA 2KIMA 2L7ZA 3I5UA 2PBIA 1GUUA 2VT2A 4BBRJ 2QWWA 1YX3A 5HDKA 4I6ZA 4YEJA 3SDGA 2A5WA 3TQNA 3BG6A 4LITA 5K5OA 3PO3J 3K1NA 4CXFA 2E2HJ 2DODA 1FSEA 4U0WA 1H9GA 3MWMA 4L9JA 1UELB 5EJCA 5HLIA 2Y0SN 3TP3A 2JPCA 2YPRA 4UUSA 3DEWA 2Q0OA 3VDXA 3IH3A 3ZQFA 1FZPB 3K1PA 4LIVA 4RB3C 4GYGA 4KISA 3F72A 1WJ5A 5DV5A 3HUGA 5EF6A 5IYCJ 5ICFA 1T2KA 3FXJA 5ILVA 3J80Z 2VBZA 5EDNA 3OYLA 3MZYA 4UB8C 1R1TA 2HOSA 4A0ZA 3TEDA 1KU9A 2IPQX 3DBRB 5ILUA 5M3FJ 1NH3A 3K4NA 3KP6A 2X4HA 2E19A 5CVVA 4OU0A 4ZH4F 2COBA 4UHTA 1WJBA 3WTZA 2ZJRF 1YQAA 2K4BA 4GFBA 3RPUD 1MJBA 2R7FA 3HG9A 4BEHB 5ICCA 2YS9A 1FMVA 3TKYA 3VYUB 2CV2A 1R00A 1W5SA 2LY1A 5IPAA 1LDKB 2MABA 4C30A 5D4SA 2H09A 1WCMJ 1T39A 3CF2A 5J3LA 2LLKA 2V1NA 3CJRB 1R1VA 4M3EA 3VYTB 3I54A 4L18B 3ERMA 1ZTRA 1HDPA 5FD5A 4BY7J 1TNTA 3RPQA 5JHFA 3EUHA 1T0FA 3LA3A 1FT9A 4BHBA 3Q0WA 3BR2A 2Y9YA 3BR6A 3K4CA 1SMYF 2LSOA 4XQFA 3PSIA 5LLQA 2XSJC 3OIQA 4OAZA 1W36D 3HRTA 3GTQJ 2X1CA 2L4AA 3PNVA 4ESFA 1IG7A 2XAUA 1FIAA 5EGOB 3ZP5A 3CDHA 5FLXZ 1IN8A 2DFHA 2OZUA 4CYCB 2E1OA 2A5YB 2VXDA 3CC7I 2M87A 2H8WA 4XOPA 2LF7A 3JRIA 1SFUA 2JA5J 1ETQA 5FROA 3TO7A 4KFCA 3TDUC 3LFKA 2X1DA 1JT6A 3ONQA 5FKMA 3Q5FA 2GLOA 3ABTA 3VSLA 4PGGA 1JUPA 2W82A 2EFWA 1K4SA 4RDUA 2VLAA 3GVAA 3IKTA 3G1OA 1F36A 1PVEA 2AHQA 3T1BA 4A3CJ 1GVDA 2G0EA 3CCLI 4AVZA 1LUJB 3H9JA 4CHUA 4EJVA 2XB0X 3BR0A 1ULYA 1NK2P 1O3TA 1Y8QB 2HKOA 3VFZA 1B9NA 2K9NA 4J01A 1OR7C 2BEOA 3SEQA 4OIQF 3A01A 5DCMB 3D0SA 3ABMH 2ZXWH 2KDOA 4A6DA 3I64A 2L9VA 4RM2A 1VNDA 2QQ9A 5CKTA 5KAFC 4HZFA 5K7HA 2HNHA 4P55A 1D0XA 3HRUA 2M8GX 2EPFA 2QQAA 3EDPA 4ENKA 2V26A 1QZYA 4HLXA 2H94A 2EFNA 3CCMI 1Q1HA 2M7AA 2NS8A 3OYNA 4NC7A 1G3TA 3UNGC 2R5ZB 3S2WA 3MKZA 4CCKA 3F6OA 4MGRA 3K69A 1LJ9A 3KYCB 1R9TJ 3J81K 3CESA 4FASD 2JJ7A 4OWRB 4YIFA 5BS6A 4N4OB 4AUXA 3T8RA 1MJAA 3QU3A 2R7TA 1YG2A 2FQ4A 4DYRA 2AS5F 2BY3A 3WE2A 3HTSB 2HR3A 2DO7A 1T98A 2YSRA 2UV1A 1B72B 2A6HF 2K9LA 3DTKA 1JUMA 2JA2A 3BR3A 4PZJA 1B72A 2Y2ZA 1JTYA 1RNLA 2DA1A 3HJEA 4ZYHA 2MYSA 2DFIA 5E3NA 1B9MA 5J8FA 3GBGA 3OS2A 1XGNA 2EFOA 3NQOA 1I1SA 1U0JA 1I27A 1R23A 3TOBA 1YITI 3R61A 1WFXA 4AC0A 4A2UA 2EZHA 2STWA 2JZYA 1G8XA 4HOBA 2NVQJ 4RGRA 1K78B 2ETHA 1QBJA 4HF2A 3BZKA 2XGCA 1TL8A 1YTYA 1R7JA 5HS7A 1Y1WJ 4A6EA 1S72I 1Y0NA 1XC5A 3RQ4A 3F8MA 1K83J 2M0CA 3TDZC 2BXZA 2VPLA 3TL4X 2UXXA 1ZN2A 1VTNC 5F04A 2CUFA 2CG4A 3D5RC 2F4IA 3OYCA 3OYDA 3QODA 3F8BA 3OOUA 2CQ7A 3IKVA 3LSJA 4LLLA 1ITYA 4JP0A 4L9VA 3WODF 3GTJJ 3QU6A 3TGNA 3BWGA 1GLNA 2LMDA 3K4KA 1TW2A 2HZDA 4BDYA 2V1UA 4G6QA 4LOCA 4IKFA 2EFQA 1KONA 1TWGJ 4H4KC 2FBHA 3DLLF 4C2UA 1TTYA 3K2AA 5EG0A 3BG5A 5J4VA 2VJJA 4IOCF 1MBEA 5LHHA 3FXLA 1U2WA 2DU9A 4S05A 3FMQA 2PX9A 2LKPA 1ZHFA 2DT5A 2FOWA 2OAZA 5J47A 3HKZN 3DV8A 1BI0A 5E20A 4Y33A 5GAEJ 2RNGA 2VE8A 4V2FA 3PIOF 2ECCA 3OR1C 4IZZA 3ZQQA 3RPUA 4HDUA 4XNFA 4QTRA 2GIZA 4BKXA 3S17J 3AG4H 1OR7A 3FM3A 4I99C 3LOCA 2ECBA 3AG3H 3Q0VA 1UJ8A 4ITVA 2L4MA 1K6OA 3JSOA 3WU2C 3VYSB 3L2RA 3PQJA 1B1BA 3F8NA 4CSWA 2QA4I 4Y3OA 1GV2A 1XX5A 5D6EA 2NAZA 1SD7A 1G3WA 1P9QC 4LG3A 2XGDA 1U5TB 4HV5A 1RPWA 5BQTA 1S6LA 4M72A 5FLVA 1O3RA 2K02A 1X1CA 3LSHA 1G4DA 4ANJA 3BCBA 4XL9A 1RETA 2LTPA 4Y13A 3I4NJ 3I56I 2L9SA 3Q0UA 4DZJA 3KZYA 2A3SA 5EG0B 2CW8A 2HTJA 2QEXI 2UZKA 2V9VA 4RB0A 4XKBA 2XIGA 1JE8A 1TLHB 3HRSA 3FBNB 2H6CA 1K78A 2EBIA 4HA8A 3RIRA 2GXGA 5E1WA 1S8NA 1YO5C 4XRFA 4N4NB 3HSFA 4CUGA 5HDGA 2YR2A 1H88C 4OMYA 1TWCJ 2DDBA 1ZRDA 5FRNA 1W7PA 4XR6A 4M9XA 3WGIA 4HSRA 3HZJA 2JVHA 2K86A 3RYPA 4E7ZA 1ETWA 1OYWA 3OL3A 5IT3A 2KDZA 1YW8A 4M6YA 1I3AA 2AXLA 3AKZA 1UAAA 4ENJA 1X1PA 2QF7A 2R7SA 4EQQA 1UHWA 1HW5A 1Z67A 2QM3A 5KVRA 3DU6A 4DNCA 1QNTA 3K6GA 3E3VA 1JJ6C 3M07A 4MNUA 5L3GA 2L3DA 1OCZH 3BTCA 1O7FA 5H6RA 2ZMEC 4W97A 1R22A 3JAMK 3U1DA 2Z33A 1OMIA 4CA0A 1FEXA 3W3CA 2K85A 4M6VA 2GA1A 1FIPA 2JSPA 4BJ6C 1SVMA 2VUMJ 1HW2A 3N97A 3TOAA 1R5HA 5LD2C 3WTVC 2IT0A 3H3ZA 2HI3A 2L0KA 2E2JJ 1K79A 5IOYA 3W2AA 3E6MA 1EJ9A 2FOKA 1AWCA 3AAFA 1ZLJA 4A5NA 4RMNA 4KMFA 4O3MA 1Z6TA 5DCMA 2R3SA 4DBRA 4B3XA 3BG3A 5CYVA 4EGYA 4B3AA 4I09A 3FDYA 2AXTC 4LLGF 3CDLA 4B4CA 3BZCA 2LY9A 2FJ1A 4ZDLA 3OOPA 4IHXA 3S1NJ 4IL6C 2X51A 3GZ6A 2VOPA 1H8AC 2GXBA 3ZRGA 1T95A 1F5TA 1R36A 2VQHA 2LRDA 2PMHA 1X58A 2VIXA 3E1SA 4PDKA 3GO5A 3BTIA 4L5JA 1XD7A 2FU4A 1JI8A 1IN5A 3P9KA 4G9YA 2TDXA 4U88A 3WTYC 5LHIA 4HDVA 2EA2A 2KFDA 4FT8A 2YU3A 2XC7A 1XMXA 2HEOA 1WI3A 2ZJPF 1HDDC 2GZWA 1IRXA 4XLNF 3MEXA 3JRCA 1BI2A 4CYCA 2DOAA 1ZH5A 3DQVC 1IW7F 2IXSA 2XPVA 3QP5A 1FPQA 2W85A 5B3SH 2JT1A 3VWBA 1X4PA 3HL2A 3LSPA 3CMMA 4PJJA 1R5ID 3BG9A 4AYBA 3DPLC 3BTJA 2QUFA 2A69F 3GLXA 1NHAA 2EV6A 5BPDA 2HPIA 2O8KA 2GBYA 5C44J 2QQBA 2RC4A 4IHTA 3Q9VA 3M1EA 4JOMA 2XRNA 1N75A 1ZG1A 2OPTA 4XRSA 3IAS2 1OKRA 2LP0A 3EUKL 4J19A 2NNYA 1DP7P 4HX4A 3ZQHA 2EA4A 2GAUA 3M8EA 4HW0A 1A04A 1D1AA 1P4WA 4NQWB 5TISC 3DWLE 3J80K 3GTOJ 1UMQA 2VJ4A 2DW4A 3BOQA 5F08A 3H35A 3N05A 2DN0A 2M0MA 1KGSA 1LVKA 2G7HA 1YS7A 1ODDA 1WGXA 1IXRC 3AL0C 1DPUA 2Z5UA 2IRFG 2Y69H 2XGXA 5HLGA 1HBXG 5FRMA 1OYIA 3S3NA 4AVPA 2OCCH 4R79A 1S3JA 4CCMA 4D5CA 3EUAA 4E6KG 1SD4A 2EQRA 4PSXA 1D0YA 1ZGAA 1YRNB 2DPDA 2F4OB 1H89C 3DEEA 4CCOA 2AQEA 4LG0B 4IEJA 2FE3A 1MBFA 4XLEA 5J40A 1W1WE 4OIRF 4JX5A 4LMYA 5D5UB 4A3JJ 4LB6B 3W6VA 2DA3A 2NVYJ 1MBJA 4C9YA 3GWZA 2CUZA 1U8BA 2ZBKA 2LVSA 4RAZA 2F5VA 3EYYA 2DFFA 5J1RA 3HDDA 2WY7Q 3DKYA 4YIIA 1F1ZA 1RKWA 3PNYA 4G94A 4P5OA 3JSPA 1UB9A 2EH3A 2Z3YA 3U9GA 2Z9OA 1W0TA 1ZGJA 3J7AY 2CUEA 1QVUA 1B8IB 5FFXA 2XRLA 1OCPA 3HUGB 4MHGA 1TNSA 3MKLA 3RDIA 5HOOA 2ZCWA 3ZR8X 5BPIA 1F9NA 3KP7A 4FETA 4P1WA 4BYYA 1A6QA 4ZC3A 1A35A 4ZTJA 1FLIA 2WAQN 3BJAA 2CRGA 2HYFA 3VODA 3QYBA 2MA3A 3CJTB 3HOSA 2BHZA 3GLLA 5JHUA 3GEZA 1XCVA 2GM4A 4MQ9F 5FGMA 2WAEA 5ERIA 1XGSA 1POGA 2CQQA 2P4WA 1FOXA 2MD0A 3BJOA 2K3FA 4EV0A 2VI6A 3S3OA 1VQ7I 4BXXJ 4A0XA 5CQEA 5LBQA 5E3OA 1K61A 3FXOA 4PGHA 4UVBA 4L5EA 5FO5A 4F52A 1AA7A 1P2FA 4LD5A 2HDDA 1UG2A 1Z91A 5EEAA 4GYIA 2DFEA 4V19K 3KYDB 4WK8F 4RA2A 1TWHJ 3CCEI 4NBQA 1WJFA 5DCFA 3RI4A 4YFKF 3IUOA 2DMNA 3OYFA 5IY5H 3ZOBA 5C4XJ 2HFHA 1T0FC 3I4MJ 1IV8A 1OCOH 1SVOA 3GCMA 3NARA 2D45A 1VZ0A 3REOA 3C7JA 1RKTA 4I76A 2VE9A 5E1ZB 4BH9A 1JJ8C 1Z77A 1A5JA 2WA0A 1FOKA 4Y17A 3S32A 2L2OA 4X6AJ 4RLQA 4G12A 4UB6C 2N8GA 5FLMJ 4EM0B 2P7CB 4UNOA 3B6CA 4M71A 3GTLJ 4IHSA 3PL8A 3QQAA 4XKVA 4ZTFA 4KYWA 2OQGA 3H3UA 4D1QA 1ACIA 1WKMA 2J5OA 1I5ZA 3G1LA 5C3EJ 1MSFC 2ZSIB 2ZXJA 5BOXA 2Q2EB 1U78A 1MMNA 1BR4A 1X3ZB 1LNWA 2O8XA 3C2BA 2CV1A 5CLSA 3SFZA 3HHGA 1X19A 3QP6A 3D5LA 4EJUA 1AHDP 5L3EA 3ZPLA 1ZR2A 1YI2I 3ELKA 4RAFA 1FTTA 2I10A 2KIFA 2JRMA 4FX0A 5JVTA 3KP5A 4OINF 4XMYA 1V55H 2FQ3A 3KIOA 4G6DA 2LBFB 1VQOI 3DBLB 2A07F 4KIBA 3J7AO 2KRHA 2ZMEA 3COAC 1FYMA 2GOXB 2F48A 2HQRA 1ETVA 2BOLA 3FXUA 1NG6A 1BL0A 3JR9A 2V1XA 5CVJA 1FYKA 4U7DA 3OY9A 1OCTC 2W48A 1USSA 1PUFB 4L9TA 3MAJA 2LG4A 1GVJA 1PYVA 4Z2YA 4Y7NJ 3FK7A 1W5CC 4IXAA 1MMDA 2RREA 1XTAA 3HOUJ 3K70C 3SXYA 4WWCA 2CFOA 4UXNA 3SFIA 3LMMA 4DOZA 2XKOA 1LB2A 3HXLA 2O7OA 3BR1A 5H20A 2BY1A 1MH3A 1WHUA 2CQNA 3FWEA 2GQQA 2BGCA 4NQWA 3GW2A 5J1UA 2WAQA 3OMYA 2G9WA 5GAHJ 2VPRA 3PM1A 2Y0SA 4DQ2A 2WADA 3C2HA 2E35A 4RBOA 2L01A 4A3IJ 2BXYA 2LYCA 2NVUB 1FC3A 2G7UA 2R0QC 4M6XA 3CCYA 5D5WB 1IUYA 4NHJA 3UKGA 1FX7A 4BJ5C 2FMLA 4AIKA 2H1LA 4A93J 1BIAA 4BY1J 4QPQA 1AKHB 1V4RA 3Q9SA 3CLOA 5GP9A 5IYDJ 2IGOA 4RS8A 1W7PD 3L2VA 1YFHA 4CCJA 2HGCA 5M5YJ 3TW7A 5GTIC 3JCUC 5DD8A 1LFUP 2EINH 3VYRB 5AONA 1WI9A 2R4GA 4XIDA 2VBWA 2K5CA 2NRAC 1U9NA 2XAFA 1RRJA 1IUFA 3HSRA 4XLFA 1DPRA 2W84A 2DOEA 4P96A 1O3SA 1IC8A 2EWNA 5B1BH 2XGEA 2M2EA 1XGMA 1VQMI 4HBLA 2FBIA 4EMSA 3RKQA 3HOTA 3W2WA 5BMZA 4BQQA 3F9KA 5FKNA 3WG9A 4WF2A 1QO0D 1ON2A 4IOAF 3KP3A 3V4GA 2CQXA 1JHFA 2DQRA 1V5GA 4Q4ZF 3K2ZA 3ZMTA 3H3VK 3KZZA 1MBHA 4NUBA 1MDMB 2XROA 3G3ZA 3ABLH 2W4SA 2ZB9A 3MMYB 3H5RA 3WHBA 1ZARA 1FWZA 4HX7A 3CCRI 3SZTA 1W7PB 2Y31A 2OJED 1Y6IA 5JFRA 1E0EA 2HZTA 2KLOA 3CUQB 4KICA 3VPRA 3E5XA 2CQKA 4M3FA 2MG4A 1EH7A 4ENMA 1R49A 2PLYA 5DEQA 1BBYA 5E79C 3OIPA 3JAMZ 3K10A 3H5AA 1T8IA 3FZVA 3M7GA 4D0PA 4YRVA 2JUGA 3LSGA 4BL0B 5L3FA 3F22A 1HF0A 1WRJA 3FIWA 1IV6A 2QKLB 4LIUA 1AOYA 3IC7A 4A3BJ 1EH6A 2GWRA 5L3DA 2NOGA 1GDTA 2VKHA 3CC2I 1J09A 5HVQC 2IA2A 3T8TA 1X2NA 2KRFA 5E18F 4B8XA 2HPMA 1KYWA 1RUOA 3QPLA 2E2IJ 2LREA 3CMEI 1XPXA 4RAGA 1ZAOA 1Y39A 4IRIA 2BBYA 4IF4A 5B5EC 2DMTA 3V7CA 3MFKA 3U2RA 3F23A 1NTCA 1L3LA 4G7ZF 1JUSA 1Z7LA 3WTTC 1OISA 4CICA 3ZQGA 4AIHA 2DA4A 1STZA 2CGPA 2O3FA 4BU2A 3OS1A 4WXHA 4FQGA 1LE8A 3QPTA 1FBQA 2ESHA 4KN7X 5HS9A 2OCEA 1PUEE 1HKSA 2OZ6A 1D1CA 5K7ZA 1OYYA 3M9AA 3WTSC 4DIQA 1I6HJ 3MQ0A 2NXNB 3CJNA 1QHHD 2E5NA 1TQMA 4XONA 4ZZDA 1P4XA 2HTSA 2L7FP 3HSEA 2X85A 4O5VA 4FE4A 1XDSA 2H6BA 3RZOJ 2L02A 2WB1A 3MVPA 1BJZA 3H1CA 4MIMA 1ORKA 2DDAA 4AIDA 2JA8J 4A3MJ 2PJPA 2K4JA 1WJAA 2MW8A 3OYBA 3ESWB 3BQYA 1Z21A 1BR2A 1QPMA 5DM6F 4CCNA 2KISA 1SFKA
chains in the Genus database with same CATH topology
4ASNA 5ICEA 1I6XA 4U7BA 1REPC 5D8KB 1XMAA 2HOEA 2ACJA 3ECHA 1ZLKA 1BM9A 4N9IA 1IXSB 2NYXA 2D1VA 2HQNA 1SFXA 4MTDA 5KK1A 4N9HA 3ZN1A 1I1GA 1CGPA 3P7NA 1XSDA 3K0LA 4BHCA 3FXQA 3GUDA 2HWVA 1TQIA 1YS6A 4F7ZA 1HW1A 2STTA 4HF1A 1RI7A 2RKHA 3EYIA 1W4MA 2RVCA 3R60A 1XN7A 2XAQA 1MJ9A 1KU3A 5LGUA 4P9UA 2DAOA 3BY6A 3W6KB 5F6FA 2QYOA 2ELHA 4G8XA 4KIFA 2ISYA 3I4PA 5JR3A 1MDMA 2ZKZA 3O3KA 1IN7A 1HKTA 1HKQA 1ZYRF 1P6RA 4YFNF 2XKPA 2D1HA 3KP4A 2IA1A 4U0YA 1J7KA 1K7AA 1CF7A 1EH8A 3J81Z 3GFLA 3ML6A 2FNAA 2OD5A 5LRRA 1T38A 1Z6RA 2KIUA 2Y0MA 1D5VA 4IJAA 3N4MA 3LAPA 2Z99A 4A0YA 4CZZA 4LK1F 3E6CC 1LQ1A 2IA0A 4OOIA 2FBKA 3L7WA 2MC3A 3HIFA 1G6NA 2J5PA 2VC1A 2ZJ2A 2ZNYA 3OV8A 2W25A 3FMRA 4TV7A 1IF1A 4JQFA 3E6DA 5AIPA 1IRGA 4B09A 5L3BA 2EK5A 4JK1X 4CGZA 1XCBA 3L00A 4FHTA 4P9FA 3DKWA 3K9TA 2QBYA 1KQ9A 3QRFF 4ON0A 1O3QA 1ZREA 5HDNA 3KETA 3C3WA 2PMUA 3M8FA 2PFBA 1WSUA 1KYZA 2V6CA 4AWXB 2FMYA 4OIPF 3H92A 5TJJA 3DFGA 3KE2A 3BROA 5K5RA 4RAYA 4ETSA 1DUXC 4YFXF 4Q47A 4KMUX 3W6JB 2LNBA 2WWYA 1LDDA 4KT5C 2F5CA 4RB2C 2VT3A 1UFMA 4MQVA 2PG4A 3V7SA 2M30A 1KA8A 1SD5A 2KJCA 4H0EA 2UXNA 2JTVA 4XBFA 1Z1DA 6PAXA 4I01A 1TBXA 2VBXA 3HRMA 3WU0A 3TO9A 1O7LA 1XGOA 1KU2A 1EV7A 4AD9A 4HQEA 4IRHA 5F64A 3F3XA 1BJAA 3RJPA 3R0AA 1USTA 3MZHA 1HSJA 4Y15A 4EGZA 1FSHA 1FBSA 1U5TC 3BP8A 2XVCA 3ZMVA 5ILSA 5TRDA 5E8IA 3ZN0A 1PP7U 1B6AA 4HF0A 2XAGA 1FP1D 1B59A 3ECOA 2DK5A 3GFIA 2IW5A 4R8HA 5FFZA 1BOAA 1QGPA 2RV8A 3FF5A 5E17F 1UCRA 1LDJA 5LEJA 4L0ZB 3DEUA 2XV4S 4I2OA 4LG0A 3IRRA 2P5KA 1J9IA 1WQ2A 2A68F 3LA2A 4UVAA 3DP7A 3LQRA 2CYYA 1G3SA 1C0WA 4BXUA 3HHHA 3V8KA 4CYDA 3I59B 2UWMA 2DK8A 1LVAA 5D5XB 3BDDA 5LGTA 1D8JA 2YX4A 5A2QK 3O6BB 1ZG5A 4LLNA 3SZPA 3FXRA 3F8CA 4M9ZA 3P9CA 1MKMA 2W57A 4M73A 2EV5A 2DQLA 4QLCU 4G7HF 1U8RA 1IXCA 3KP2A 5E8GA 4ZYGA 4S04A 2IJLA 2OA4A 3QOPA 2VOOA 1GXQA 1LEAA 2QVOA 3L9FA 4K2EA 3BPVA 3PQKA 1E17A 5DUIA 2EJRA 1YYVA 4KIGA 4OMZA 3DF8A 4BAYA 1S29A 4LJZF 3GXOA 3ERED 1FY7A 1KU7A 1FNNA 4LB5A 4EVIA 5D8LB 1ONVA 3C1DA 1DDNA 2BV6A 3NRVA 1TW3A 5CVIA 1GHCA 1YW9A 3LQQA 2LF8A 3T0YA 3IL2A 3KEOA 1ZRFA 1HXDA 4AIJA 4KN4X 4M74A 1FBUA 2R7DA 2F5EA 1LEBA 3ZMSA 3BJ6A 2MH2A 3RKWA 3JTGA 3HYIA 4A5MA 1GXPA 2CSOA 1YW7A 2VC0A 5L3CA 3GX4X 2FEZA 1J59A 3TO6A 2PEXA 3L09A 2OU2A 2COMA 1R5GA 1IZ1A 2DI3A 4WX9A 4L5IA 2A61A 2CO5A 4HX8A 2EFPA 3SQNA 2P6TA 5LRSA 3HTUA 1Z7UA 4GGGA 3GFJA 2EV0A 4EJWA 3IHUA 2JRTA 3CTAA 2Y75A 4OIOF 2W24A 1XMKA 2P5LC 2PI0A 2VN2A 3G73A 5EEGA 3GF2A 3WGGA 2MH9A 1X3UA 4KA4A 1Z9CA 4RB1A 2PQ8A 3WGHA 5K5QA 2ZO4A 3FM5A 3B73A 2KKOA 2QBYB 2P5VA 2MLGA 4A12A 3KFWX 2QZ8A 2RDPA 3VEPA 1JXSA 2PN6A 4IVNA 2XHKA 3LWFA 1U5TA 4I02A 2FA5A 1S7OA 2O6GE 4L0YB 3GZ5A 2ADUA 1FP2A 4UV8A 3CUOA 2XUBA 5IT9K 4HV6A 4XSXF 1WWXA 1R58A 3K1MA 2VONA 1BIBA 4I0BA 3LA7A 3EETA 5AIQA 2Q8KA 4EJTA 5DD4A 5JI6A 2NS0A 4IPAA 1OPCA 3NEUA 2VXZA 1R1UA 3LAJA 5FLXK 1L0OC 2D2WA 4YG2F 2DLLA 1JGSA 1CF7B 5LGNA 2RQPA 2B0LA 4KNYA 4UUVA 3R4KA 4I0AA 3E5QA 3RKXA 3ISPA 4ZYEA 5EEHA 5DUKA 1BC7C 3CUQA 2MBFA 2OQRA 2FXAA 3V8LA 4Q48A 1MZBA 3CO6C 4ESJA 1BI3A 3L2CA 1BN5A 2BYVE 1U3EM 1H9TA 1KQ8A 1MD0A 5D4RA 3KEQA 2O61A 1F4KA 2M8EA 2MLKA 4U0VA 4E70A 1P4AA 2HS5A 2H27A 4O6JA 4CDGA 3I53A 3WTWC 2JPBA 4LFUA 1TQPA 1H0MA 2VBYA 1P92A 2E1NA 4N0BA 4BHPA 3GFMA 1YLFA 2A6EF 4RGUA 2C6YA 1ZG3A 2RNJA 1FYLA 4CO8A 3VB2A 2P7VB 3DPTA 2MD5A 4ESBA 3E5UA 3O2PE 2Y48A 2CWEA 3KCCA 2CFXA 3RKYA 3I58A 1J5YA 5FB2A 3IRQA 2P6SA 3FMSA 3V8JA 4RGSA 3ZMZA 3DXJF 5FD6A 1QQIA 1J0RA 2NNNA 1BI1A 2M45A 1S7AA 5HS8A 5HLHA 1J2XA 2HKXA 3P9IA 1ON1A 4Q5SF 3I0TA 3KLOA 4ZYDA 5D6FA 3ROUA 2F5FA 1HSTA 2ZMEB 4GO1A 4UVCA 1D8KA 2HDCA 3FHZA 3WTUC 3I71A 1PP8F 4GXOA 2LDUA 1IRFA 2DPUA 1Y0UA 3EQLF 1QZZA 4WXCA 1XSXA 1BC8C 2ISZA 4ENNA 2JSCA 3V7RA 4WXDA 2E1CA 4IRGA 2XAJA 5A2QZ 2GA2A 3E97A 4KUMA 2F2EA 2L54A 2XAHA 3C18A 1RZ4A 3CO7C 3QPHA 4I7HA 1MGTA 1O57A 4MTEA 1RUNA 1UHMA 2ESNA 1JHHA 2KJBA 1B4AA 1YIOA 2X0LA 1PDNC 5K1YA 4G7OF 3WU1B 3VOEA 5LEKA 5F1RA 1Z05A 2QLZA 3SHFA 1SD6A 3F6VA 1IAWA 3ZMDA 1KQ0A 2DBBA 4BQAA 3JTHA 4HAMA 1SMTA 4FX4A 1SAXA 5ED4A 2E7WA 4NB5A 5IT9Z 5H6QA 4HQMA 2K27A 1XDUA 3T5XA 2OBPA 1SFEA 5ICGA 2YX7A 5J6XA 2HYGD 1IN6A 1G3YA 2QENA 4XSZF 5DDGA 1T6SA 3RYRA 1IN4A 3KLNA 2XASA 2M1BA 2GIVA 2FSWA 1HQCA 3B02A 3F8FA 4PCQA 1RIOH 3E6BA 5LHGA 4GCVA 2FNPA 3WTXC 3GYHX 5DYMA 5E1XA 3ABUA 2P8TA 4R1HA 2O0YA 3JW4A 2BE5F 3F21A 4UV9A 2VODA 2K7LA 2CW0F 4QWQA 2EB7A 2WV0A 1W5TA 4KDPA 4EJOA 3BPXA 4RGXA 4HLYA 2V1DA 1E2XA 2IP2A 5D5VB 2F5DA 4L9NA 2WC2A 4LGWA 2IVMA 2ZNZA 4M9SA 4JBAA 3ULQB 2M5WA 2DTRA 3FX3A 3I59A 2ZFWA 2FF4A 4LK0F 1XB4A 1ZRCA 2RN7A 1V3FA 4MEXF 1XSVA 4I98B 4ZZLA 3QAHA 4XLPF 5CVRA 2Q2EA 3RTRA 2V79A 5CVUA 4EM1A 2RGVA 2O03A 4MEYF 4BNCA 5J8CA 2FRHA 3R0JA 2WTEA 3ZMUA 3R6SA 1U6GA 3IWZA 3WE3A 3BZ6A 1J75A 3LSTA 3CUQC 1D3YA 2E7XA 3MCZA 5CJ9A 3IWFA 4WCGA 4HYEA 3ZQ7A 4EM2A 3PFIA 2KIMA 3I5UA 2PBIA 2VT2A 2QWWA 5HDKA 3TQNA 5K5OA 3K1NA 4CXFA 1FSEA 4U0WA 1H9GA 3MWMA 4L9JA 5HLIA 2JPCA 2YPRA 2Q0OA 1FZPB 3K1PA 4RB3C 4GYGA 3F72A 5DV5A 3HUGA 5ICFA 1T2KA 5ILVA 3J80Z 2VBZA 3MZYA 1R1TA 4A0ZA 1KU9A 2IPQX 5ILUA 3KP6A 2X4HA 5CVVA 4OU0A 4ZH4F 4UHTA 3WTZA 1YQAA 2K4BA 1MJBA 2R7FA 5ICCA 3TKYA 1R00A 1W5SA 1LDKB 5D4SA 2H09A 1T39A 1R1VA 3I54A 4L18B 5FD5A 1TNTA 3RPQA 3EUHA 1T0FA 3LA3A 1FT9A 4BHBA 1SMYF 2LSOA 5LLQA 3HRTA 2L4AA 4ESFA 3ZP5A 3CDHA 5FLXZ 1IN8A 2OZUA 2A5YB 2M87A 2LF7A 1SFUA 3TO7A 4KFCA 3TDUC 3LFKA 3Q5FA 3ABTA 4PGGA 2EFWA 3GVAA 3IKTA 3T1BA 4CHUA 4EJVA 1ULYA 1O3TA 2HKOA 3VFZA 1B9NA 2BEOA 4OIQF 5DCMB 3D0SA 4A6DA 3I64A 2QQ9A 4HZFA 4P55A 3HRUA 2QQAA 3EDPA 4ENKA 1QZYA 4HLXA 2H94A 2EFNA 1Q1HA 1G3TA 3S2WA 3F6OA 4MGRA 3K69A 1LJ9A 3J81K 4YIFA 5BS6A 3T8RA 1MJAA 3QU3A 1YG2A 2AS5F 3WE2A 3HTSB 2HR3A 2DO7A 1T98A 2YSRA 2A6HF 4PZJA 1RNLA 4ZYHA 2DFIA 1B9MA 5J8FA 1XGNA 2EFOA 3NQOA 1I1SA 3TOBA 1I27A 1R23A 3R61A 4A2UA 2STWA 2JZYA 4HOBA 4RGRA 1K78B 2ETHA 1QBJA 4HF2A 1YTYA 1R7JA 5HS7A 4A6EA 3F8MA 3TDZC 2UXXA 1ZN2A 1VTNC 2CG4A 3F8BA 3IKVA 4LLLA 4L9VA 3WODF 3QU6A 3TGNA 3BWGA 1TW2A 2V1UA 4G6QA 2EFQA 2FBHA 1TTYA 5LHHA 1U2WA 2DU9A 4S05A 3FMQA 2LKPA 1ZHFA 2DT5A 2OAZA 3DV8A 1BI0A 5E20A 5BPDA 2VE8A 3RPUA 4HDUA 1OR7A 3FM3A 2L4MA 1K6OA 3JSOA 3PQJA 1B1BA 3F8NA 5D6EA 2NAZA 1SD7A 1G3WA 1U5TB 4HV5A 5BQTA 1S6LA 4M72A 1O3RA 2K02A 1G4DA 4Y13A 3KZYA 2A3SA 2HTJA 2UZKA 2V9VA 4RB0A 1JE8A 2XIGA 1TLHB 3HRSA 2H6CA 1K78A 4HA8A 3RIRA 2GXGA 5E1WA 1S8NA 1YO5C 4XRFA 3HSFA 5HDGA 2YR2A 4OMYA 1ZRDA 1W7PA 4M9XA 3WGIA 2K86A 3RYPA 1OYWA 5IT3A 1YW8A 4M6YA 2AXLA 4ENJA 4EQQA 1UHWA 1HW5A 2QM3A 5KVRA 4DNCA 1QNTA 3E3VA 4MNUA 5L3GA 2L3DA 1O7FA 5H6RA 1R22A 3JAMK 3U1DA 2Z33A 1OMIA 2GA1A 1HW2A 3N97A 3TOAA 1R5HA 2IT0A 3WTVC 3H3ZA 1K79A 3E6MA 2FOKA 1AWCA 3AAFA 1ZLJA 4A5NA 4KMFA 4O3MA 1Z6TA 5DCMA 2R3SA 5CYVA 4EGYA 4I09A 4LLGF 3OOPA 3GZ6A 2VOPA 2GXBA 1F5TA 1R36A 2PMHA 4PDKA 3GO5A 4L5JA 1XD7A 2FU4A 1IN5A 3P9KA 4G9YA 2TDXA 4U88A 3WTYC 5LHIA 4HDVA 2EA2A 4FT8A 2YU3A 2HEOA 2GZWA 4XLNF 3MEXA 1BI2A 1ZH5A 3DQVC 1IW7F 3QP5A 1FPQA 2W85A 2JT1A 3DPLC 2QUFA 2A69F 3GLXA 1NHAA 2EV6A 2QQBA 2RC4A 4IHTA 3Q9VA 3M1EA 2XRNA 1ZG1A 1OKRA 2NNYA 1DP7P 4HX4A 2EA4A 2GAUA 3M8EA 4HW0A 1A04A 3J80K 1P4WA 2DW4A 3BOQA 1KGSA 2G7HA 1YS7A 1ODDA 1IXRC 1DPUA 2Z5UA 2IRFG 2XGXA 5HLGA 1HBXG 1OYIA 4AVPA 4R79A 1S3JA 1SD4A 1ZGAA 2DPDA 4LG0B 2FE3A 5D5UB 4OIRF 4LMYA 4LB6B 3GWZA 2ZBKA 4RAZA 3EYYA 4YIIA 3JSPA 1F1ZA 4G94A 4P5OA 1UB9A 2Z3YA 3U9GA 2Z9OA 1ZGJA 5FFXA 4MHGA 1TNSA 3RDIA 5HOOA 2ZCWA 5BPIA 1F9NA 3KP7A 4BYYA 1FLIA 3BJAA 2HYFA 3VODA 2MA3A 3HOSA 5JHUA 3GEZA 1XCVA 4MQ9F 5FGMA 5ERIA 1XGSA 2P4WA 3BJOA 4EV0A 4A0XA 5LBQA 4PGHA 4UVBA 5FO5A 1P2FA 4LD5A 1Z91A 4GYIA 4WK8F 5DCFA 3RI4A 4YFKF 2HFHA 2D45A 3REOA 3C7JA 2VE9A 5E1ZB 4BH9A 1FOKA 4Y17A 4EM0B 2P7CB 4UNOA 4M71A 4IHSA 4KYWA 2OQGA 3H3UA 1WKMA 2J5OA 1I5ZA 2ZXJA 5BOXA 1U78A 1LNWA 2O8XA 5CLSA 3SFZA 3HHGA 3QP6A 3D5LA 4EJUA 5L3EA 3ZPLA 3ELKA 2KIFA 4FX0A 5JVTA 3KP5A 4OINF 2FQ3A 4G6DA 2A07F 4KIBA 3J7AO 2ZMEA 3COAC 1FYMA 2HQRA 3FXUA 2V1XA 5CVJA 1FYKA 4U7DA 1USSA 4L9TA 3MAJA 1GVJA 4Z2YA 4IXAA 3SXYA 4WWCA 4UXNA 2XKOA 1LB2A 5H20A 3FWEA 2GQQA 2BGCA 4NQWA 3GW2A 2G9WA 4DQ2A 2L01A 1FC3A 2G7UA 4M6XA 5D5WB 1IUYA 4NHJA 1FX7A 2FMLA 4AIKA 1BIAA 1V4RA 3Q9SA 3CLOA 4RS8A 1W7PD 1YFHA 2HGCA 5DD8A 5AONA 1WI9A 2VBWA 2NRAC 2XAFA 3HSRA 1DPRA 2W84A 4P96A 1O3SA 2EWNA 1XGMA 4HBLA 2FBIA 4EMSA 3HOTA 5BMZA 3WG9A 4WF2A 1QO0D 1ON2A 3KP3A 3V4GA 1JHFA 2DQRA 4Q4ZF 3K2ZA 3ZMTA 3KZZA 1MDMB 2XROA 3G3ZA 1ZARA 1FWZA 4HX7A 3SZTA 1W7PB 5JFRA 2HZTA 3CUQB 4KICA 3E5XA 2CQKA 1EH7A 4ENMA 2PLYA 5DEQA 1BBYA 3JAMZ 3FZVA 3M7GA 4D0PA 3F22A 5L3FA 1WRJA 1AOYA 3IC7A 1EH6A 2GWRA 5L3DA 5HVQC 2IA2A 3T8TA 2KRFA 5E18F 4B8XA 1KYWA 1RUOA 1ZAOA 4IRIA 2BBYA 4IF4A 3V7CA 3MFKA 3U2RA 3F23A 1L3LA 4G7ZF 3WTTC 4CICA 4AIHA 2CGPA 1STZA 2O3FA 4WXHA 3QPTA 1FBQA 2ESHA 4KN7X 5HS9A 1PUEE 1HKSA 2OZ6A 1OYYA 3M9AA 3WTSC 3MQ0A 3CJNA 4ZZDA 1TQMA 1P4XA 2HTSA 3HSEA 4O5VA 1XDSA 2H6BA 2L02A 2PJPA 2K4JA 1QPMA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4ASN A;  5ICE A;  1I6X A;  4U7B A;  1REP C;  5D8K B;  1XMA A;  2HOE A;  2ACJ A;  3ECH A;  1ZLK A;  1BM9 A;  4N9I A;  1IXS B;  2NYX A;  2D1V A;  2HQN A;  1SFX A;  4MTD A;  5KK1 A;  4N9H A;  3ZN1 A;  1I1G A;  1CGP A;  3P7N A;  1XSD A;  3K0L A;  4BHC A;  3FXQ A;  3GUD A;  2HWV A;  1TQI A;  1YS6 A;  4F7Z A;  1HW1 A;  2STT A;  4HF1 A;  1RI7 A;  2RKH A;  3EYI A;  1W4M A;  2RVC A;  3R60 A;  1XN7 A;  2XAQ A;  1MJ9 A;  1KU3 A;  5LGU A;  4P9U A;  2DAO A;  3BY6 A;  3W6K B;  5F6F A;  2QYO A;  2ELH A;  4G8X A;  4KIF A;  2ISY A;  3I4P A;  5JR3 A;  1MDM A;  2ZKZ A;  3O3K A;  1IN7 A;  1HKT A;  1HKQ A;  1ZYR F;  1P6R A;  4YFN F;  2XKP A;  2D1H A;  3KP4 A;  2IA1 A;  4U0Y A;  1J7K A;  1K7A A;  1CF7 A;  1EH8 A;  3J81 Z;  3GFL A;  3ML6 A;  2FNA A;  2OD5 A;  5LRR A;  1T38 A;  1Z6R A;  2KIU A;  2Y0M A;  1D5V A;  4IJA A;  3N4M A;  3LAP A;  2Z99 A;  4A0Y A;  4CZZ A;  4LK1 F;  3E6C C;  1LQ1 A;  2IA0 A;  4OOI A;  2FBK A;  3L7W A;  2MC3 A;  3HIF A;  1G6N A;  2J5P A;  2VC1 A;  2ZJ2 A;  2ZNY A;  3OV8 A;  2W25 A;  3FMR A;  4TV7 A;  1IF1 A;  4JQF A;  3E6D A;  5AIP A;  1IRG A;  4B09 A;  5L3B A;  2EK5 A;  4JK1 X;  4CGZ A;  1XCB A;  3L00 A;  4FHT A;  4P9F A;  3DKW A;  3K9T A;  2QBY A;  1KQ9 A;  3QRF F;  4ON0 A;  1O3Q A;  1ZRE A;  5HDN A;  3KET A;  3C3W A;  2PMU A;  3M8F A;  2PFB A;  1WSU A;  1KYZ A;  2V6C A;  4AWX B;  2FMY A;  4OIP F;  3H92 A;  5TJJ A;  3DFG A;  3KE2 A;  3BRO A;  5K5R A;  4RAY A;  4ETS A;  1DUX C;  4YFX F;  4Q47 A;  4KMU X;  3W6J B;  2LNB A;  2WWY A;  1LDD A;  4KT5 C;  2F5C A;  4RB2 C;  2VT3 A;  1UFM A;  4MQV A;  2PG4 A;  3V7S A;  2M30 A;  1KA8 A;  1SD5 A;  2KJC A;  4H0E A;  2UXN A;  2JTV A;  4XBF A;  1Z1D A;  6PAX A;  4I01 A;  1TBX A;  2VBX A;  3HRM A;  3WU0 A;  3TO9 A;  1O7L A;  1XGO A;  1KU2 A;  1EV7 A;  4AD9 A;  4HQE A;  4IRH A;  5F64 A;  3F3X A;  1BJA A;  3RJP A;  3R0A A;  1UST A;  3MZH A;  1HSJ A;  4Y15 A;  4EGZ A;  1FSH A;  1FBS A;  1U5T C;  3BP8 A;  2XVC A;  3ZMV A;  5ILS A;  5TRD A;  5E8I A;  3ZN0 A;  1PP7 U;  1B6A A;  4HF0 A;  2XAG A;  1FP1 D;  1B59 A;  3ECO A;  2DK5 A;  3GFI A;  2IW5 A;  4R8H A;  5FFZ A;  1BOA A;  1QGP A;  2RV8 A;  3FF5 A;  5E17 F;  1UCR A;  1LDJ A;  5LEJ A;  4L0Z B;  3DEU A;  2XV4 S;  4I2O A;  4LG0 A;  3IRR A;  2P5K A;  1J9I A;  1WQ2 A;  2A68 F;  3LA2 A;  4UVA A;  3DP7 A;  3LQR A;  2CYY A;  1G3S A;  1C0W A;  4BXU A;  3HHH A;  3V8K A;  4CYD A;  3I59 B;  2UWM A;  2DK8 A;  1LVA A;  5D5X B;  3BDD A;  5LGT A;  1D8J A;  2YX4 A;  5A2Q K;  3O6B B;  1ZG5 A;  4LLN A;  3SZP A;  3FXR A;  3F8C A;  4M9Z A;  3P9C A;  1MKM A;  2W57 A;  4M73 A;  2EV5 A;  2DQL A;  4QLC U;  4G7H F;  1U8R A;  1IXC A;  3KP2 A;  5E8G A;  4ZYG A;  4S04 A;  2IJL A;  2OA4 A;  3QOP A;  2VOO A;  1GXQ A;  1LEA A;  2QVO A;  3L9F A;  4K2E A;  3BPV A;  3PQK A;  1E17 A;  5DUI A;  2EJR A;  1YYV A;  4KIG A;  4OMZ A;  3DF8 A;  4BAY A;  1S29 A;  4LJZ F;  3GXO A;  3ERE D;  1FY7 A;  1KU7 A;  1FNN A;  4LB5 A;  4EVI A;  5D8L B;  1ONV A;  3C1D A;  1DDN A;  2BV6 A;  3NRV A;  1TW3 A;  5CVI A;  1GHC A;  1YW9 A;  3LQQ A;  2LF8 A;  3T0Y A;  3IL2 A;  3KEO A;  1ZRF A;  1HXD A;  4AIJ A;  4KN4 X;  4M74 A;  1FBU A;  2R7D A;  2F5E A;  1LEB A;  3ZMS A;  3BJ6 A;  2MH2 A;  3RKW A;  3JTG A;  3HYI A;  4A5M A;  1GXP A;  2CSO A;  1YW7 A;  2VC0 A;  5L3C A;  3GX4 X;  2FEZ A;  1J59 A;  3TO6 A;  2PEX A;  3L09 A;  2OU2 A;  2COM A;  1R5G A;  1IZ1 A;  2DI3 A;  4WX9 A;  4L5I A;  2A61 A;  2CO5 A;  4HX8 A;  2EFP A;  3SQN A;  2P6T A;  5LRS A;  3HTU A;  1Z7U A;  4GGG A;  3GFJ A;  2EV0 A;  4EJW A;  3IHU A;  2JRT A;  3CTA A;  2Y75 A;  4OIO F;  2W24 A;  1XMK A;  2P5L C;  2PI0 A;  2VN2 A;  3G73 A;  5EEG A;  3GF2 A;  3WGG A;  2MH9 A;  1X3U A;  4KA4 A;  1Z9C A;  4RB1 A;  2PQ8 A;  3WGH A;  5K5Q A;  2ZO4 A;  3FM5 A;  3B73 A;  2KKO A;  2QBY B;  2P5V A;  2MLG A;  4A12 A;  3KFW X;  2QZ8 A;  2RDP A;  3VEP A;  1JXS A;  2PN6 A;  4IVN A;  2XHK A;  3LWF A;  1U5T A;  4I02 A;  2FA5 A;  1S7O A;  2O6G E;  4L0Y B;  3GZ5 A;  2ADU A;  1FP2 A;  4UV8 A;  3CUO A;  2XUB A;  5IT9 K;  4HV6 A;  4XSX F;  1WWX A;  1R58 A;  3K1M A;  2VON A;  1BIB A;  4I0B A;  3LA7 A;  3EET A;  5AIQ A;  2Q8K A;  4EJT A;  5DD4 A;  5JI6 A;  2NS0 A;  4IPA A;  1OPC A;  3NEU A;  2VXZ A;  1R1U A;  3LAJ A;  5FLX K;  1L0O C;  2D2W A;  4YG2 F;  2DLL A;  1JGS A;  1CF7 B;  5LGN A;  2RQP A;  2B0L A;  4KNY A;  4UUV A;  3R4K A;  4I0A A;  3E5Q A;  3RKX A;  3ISP A;  4ZYE A;  5EEH A;  5DUK A;  1BC7 C;  3CUQ A;  2MBF A;  2OQR A;  2FXA A;  3V8L A;  4Q48 A;  1MZB A;  3CO6 C;  4ESJ A;  1BI3 A;  3L2C A;  1BN5 A;  2BYV E;  1U3E M;  1H9T A;  1KQ8 A;  1MD0 A;  5D4R A;  3KEQ A;  2O61 A;  1F4K A;  2M8E A;  2MLK A;  4U0V A;  4E70 A;  1P4A A;  2HS5 A;  2H27 A;  4O6J A;  4CDG A;  3I53 A;  3WTW C;  2JPB A;  4LFU A;  1TQP A;  1H0M A;  2VBY A;  1P92 A;  2E1N A;  4N0B A;  4BHP A;  3GFM A;  1YLF A;  2A6E F;  4RGU A;  2C6Y A;  1ZG3 A;  2RNJ A;  1FYL A;  4CO8 A;  3VB2 A;  2P7V B;  3DPT A;  2MD5 A;  4ESB A;  3E5U A;  3O2P E;  2Y48 A;  2CWE A;  3KCC A;  2CFX A;  3RKY A;  3I58 A;  1J5Y A;  5FB2 A;  3IRQ A;  2P6S A;  3FMS A;  3V8J A;  4RGS A;  3ZMZ A;  3DXJ F;  5FD6 A;  1QQI A;  1J0R A;  2NNN A;  1BI1 A;  2M45 A;  1S7A A;  5HS8 A;  5HLH A;  1J2X A;  2HKX A;  3P9I A;  1ON1 A;  4Q5S F;  3I0T A;  3KLO A;  4ZYD A;  5D6F A;  3ROU A;  2F5F A;  1HST A;  2ZME B;  4GO1 A;  4UVC A;  1D8K A;  2HDC A;  3FHZ A;  3WTU C;  3I71 A;  1PP8 F;  4GXO A;  2LDU A;  1IRF A;  2DPU A;  1Y0U A;  3EQL F;  1QZZ A;  4WXC A;  1XSX A;  1BC8 C;  2ISZ A;  4ENN A;  2JSC A;  3V7R A;  4WXD A;  2E1C A;  4IRG A;  2XAJ A;  5A2Q Z;  2GA2 A;  3E97 A;  4KUM A;  2F2E A;  2L54 A;  2XAH A;  3C18 A;  1RZ4 A;  3CO7 C;  3QPH A;  4I7H A;  1MGT A;  1O57 A;  4MTE A;  1RUN A;  1UHM A;  2ESN A;  1JHH A;  2KJB A;  1B4A A;  1YIO A;  2X0L A;  1PDN C;  5K1Y A;  4G7O F;  3WU1 B;  3VOE A;  5LEK A;  5F1R A;  1Z05 A;  2QLZ A;  3SHF A;  1SD6 A;  3F6V A;  1IAW A;  3ZMD A;  1KQ0 A;  2DBB A;  4BQA A;  3JTH A;  4HAM A;  1SMT A;  4FX4 A;  1SAX A;  5ED4 A;  2E7W A;  4NB5 A;  5IT9 Z;  5H6Q A;  4HQM A;  2K27 A;  1XDU A;  3T5X A;  2OBP A;  1SFE A;  5ICG A;  2YX7 A;  5J6X A;  2HYG D;  1IN6 A;  1G3Y A;  2QEN A;  4XSZ F;  5DDG A;  1T6S A;  3RYR A;  1IN4 A;  3KLN A;  2XAS A;  2M1B A;  2GIV A;  2FSW A;  1HQC A;  3B02 A;  3F8F A;  4PCQ A;  1RIO H;  3E6B A;  5LHG A;  4GCV A;  2FNP A;  3WTX C;  3GYH X;  5DYM A;  5E1X A;  3ABU A;  2P8T A;  4R1H A;  2O0Y A;  3JW4 A;  2BE5 F;  3F21 A;  4UV9 A;  2VOD A;  2K7L A;  2CW0 F;  4QWQ A;  2EB7 A;  2WV0 A;  1W5T A;  4KDP A;  4EJO A;  3BPX A;  4RGX A;  4HLY A;  2V1D A;  1E2X A;  2IP2 A;  5D5V B;  2F5D A;  4L9N A;  2WC2 A;  4LGW A;  2IVM A;  2ZNZ A;  4M9S A;  4JBA A;  3ULQ B;  2M5W A;  2DTR A;  3FX3 A;  3I59 A;  2ZFW A;  2FF4 A;  4LK0 F;  1XB4 A;  1ZRC A;  2RN7 A;  1V3F A;  4MEX F;  1XSV A;  4I98 B;  4ZZL A;  3QAH A;  4XLP F;  5CVR A;  2Q2E A;  3RTR A;  2V79 A;  5CVU A;  4EM1 A;  2RGV A;  2O03 A;  4MEY F;  4BNC A;  5J8C A;  2FRH A;  3R0J A;  2WTE A;  3ZMU A;  3R6S A;  1U6G A;  3IWZ A;  3WE3 A;  3BZ6 A;  1J75 A;  3LST A;  3CUQ C;  1D3Y A;  2E7X A;  3MCZ A;  5CJ9 A;  3IWF A;  4WCG A;  4HYE A;  3ZQ7 A;  4EM2 A;  3PFI A;  2KIM A;  3I5U A;  2PBI A;  2VT2 A;  2QWW A;  5HDK A;  3TQN A;  5K5O A;  3K1N A;  4CXF A;  1FSE A;  4U0W A;  1H9G A;  3MWM A;  4L9J A;  5HLI A;  2JPC A;  2YPR A;  2Q0O A;  1FZP B;  3K1P A;  4RB3 C;  4GYG A;  3F72 A;  5DV5 A;  3HUG A;  5ICF A;  1T2K A;  5ILV A;  3J80 Z;  2VBZ A;  3MZY A;  1R1T A;  4A0Z A;  1KU9 A;  2IPQ X;  5ILU A;  3KP6 A;  2X4H A;  5CVV A;  4OU0 A;  4ZH4 F;  4UHT A;  3WTZ A;  1YQA A;  2K4B A;  1MJB A;  2R7F A;  5ICC A;  3TKY A;  1R00 A;  1W5S A;  1LDK B;  5D4S A;  2H09 A;  1T39 A;  1R1V A;  3I54 A;  4L18 B;  5FD5 A;  1TNT A;  3RPQ A;  3EUH A;  1T0F A;  3LA3 A;  1FT9 A;  4BHB A;  1SMY F;  2LSO A;  5LLQ A;  3HRT A;  2L4A A;  4ESF A;  3ZP5 A;  3CDH A;  5FLX Z;  1IN8 A;  2OZU A;  2A5Y B;  2M87 A;  2LF7 A;  1SFU A;  3TO7 A;  4KFC A;  3TDU C;  3LFK A;  3Q5F A;  3ABT A;  4PGG A;  2EFW A;  3GVA A;  3IKT A;  3T1B A;  4CHU A;  4EJV A;  1ULY A;  1O3T A;  2HKO A;  3VFZ A;  1B9N A;  2BEO A;  4OIQ F;  5DCM B;  3D0S A;  4A6D A;  3I64 A;  2QQ9 A;  4HZF A;  4P55 A;  3HRU A;  2QQA A;  3EDP A;  4ENK A;  1QZY A;  4HLX A;  2H94 A;  2EFN A;  1Q1H A;  1G3T A;  3S2W A;  3F6O A;  4MGR A;  3K69 A;  1LJ9 A;  3J81 K;  4YIF A;  5BS6 A;  3T8R A;  1MJA A;  3QU3 A;  1YG2 A;  2AS5 F;  3WE2 A;  3HTS B;  2HR3 A;  2DO7 A;  1T98 A;  2YSR A;  2A6H F;  4PZJ A;  1RNL A;  4ZYH A;  2DFI A;  1B9M A;  5J8F A;  1XGN A;  2EFO A;  3NQO A;  1I1S A;  3TOB A;  1I27 A;  1R23 A;  3R61 A;  4A2U A;  2STW A;  2JZY A;  4HOB A;  4RGR A;  1K78 B;  2ETH A;  1QBJ A;  4HF2 A;  1YTY A;  1R7J A;  5HS7 A;  4A6E A;  3F8M A;  3TDZ C;  2UXX A;  1ZN2 A;  1VTN C;  2CG4 A;  3F8B A;  3IKV A;  4LLL A;  4L9V A;  3WOD F;  3QU6 A;  3TGN A;  3BWG A;  1TW2 A;  2V1U A;  4G6Q A;  2EFQ A;  2FBH A;  1TTY A;  5LHH A;  1U2W A;  2DU9 A;  4S05 A;  3FMQ A;  2LKP A;  1ZHF A;  2DT5 A;  2OAZ A;  3DV8 A;  1BI0 A;  5E20 A;  5BPD A;  2VE8 A;  3RPU A;  4HDU A;  1OR7 A;  3FM3 A;  2L4M A;  1K6O A;  3JSO A;  3PQJ A;  1B1B A;  3F8N A;  5D6E A;  2NAZ A;  1SD7 A;  1G3W A;  1U5T B;  4HV5 A;  5BQT A;  1S6L A;  4M72 A;  1O3R A;  2K02 A;  1G4D A;  4Y13 A;  3KZY A;  2A3S A;  2HTJ A;  2UZK A;  2V9V A;  4RB0 A;  1JE8 A;  2XIG A;  1TLH B;  3HRS A;  2H6C A;  1K78 A;  4HA8 A;  3RIR A;  2GXG A;  5E1W A;  1S8N A;  1YO5 C;  4XRF A;  3HSF A;  5HDG A;  2YR2 A;  4OMY A;  1ZRD A;  1W7P A;  4M9X A;  3WGI A;  2K86 A;  3RYP A;  1OYW A;  5IT3 A;  1YW8 A;  4M6Y A;  2AXL A;  4ENJ A;  4EQQ A;  1UHW A;  1HW5 A;  2QM3 A;  5KVR A;  4DNC A;  1QNT A;  3E3V A;  4MNU A;  5L3G A;  2L3D A;  1O7F A;  5H6R A;  1R22 A;  3JAM K;  3U1D A;  2Z33 A;  1OMI A;  2GA1 A;  1HW2 A;  3N97 A;  3TOA A;  1R5H A;  2IT0 A;  3WTV C;  3H3Z A;  1K79 A;  3E6M A;  2FOK A;  1AWC A;  3AAF A;  1ZLJ A;  4A5N A;  4KMF A;  4O3M A;  1Z6T A;  5DCM A;  2R3S A;  5CYV A;  4EGY A;  4I09 A;  4LLG F;  3OOP A;  3GZ6 A;  2VOP A;  2GXB A;  1F5T A;  1R36 A;  2PMH A;  4PDK A;  3GO5 A;  4L5J A;  1XD7 A;  2FU4 A;  1IN5 A;  3P9K A;  4G9Y A;  2TDX A;  4U88 A;  3WTY C;  5LHI A;  4HDV A;  2EA2 A;  4FT8 A;  2YU3 A;  2HEO A;  2GZW A;  4XLN F;  3MEX A;  1BI2 A;  1ZH5 A;  3DQV C;  1IW7 F;  3QP5 A;  1FPQ A;  2W85 A;  2JT1 A;  3DPL C;  2QUF A;  2A69 F;  3GLX A;  1NHA A;  2EV6 A;  2QQB A;  2RC4 A;  4IHT A;  3Q9V A;  3M1E A;  2XRN A;  1ZG1 A;  1OKR A;  2NNY A;  1DP7 P;  4HX4 A;  2EA4 A;  2GAU A;  3M8E A;  4HW0 A;  1A04 A;  3J80 K;  1P4W A;  2DW4 A;  3BOQ A;  1KGS A;  2G7H A;  1YS7 A;  1ODD A;  1IXR C;  1DPU A;  2Z5U A;  2IRF G;  2XGX A;  5HLG A;  1HBX G;  1OYI A;  4AVP A;  4R79 A;  1S3J A;  1SD4 A;  1ZGA A;  2DPD A;  4LG0 B;  2FE3 A;  5D5U B;  4OIR F;  4LMY A;  4LB6 B;  3GWZ A;  2ZBK A;  4RAZ A;  3EYY A;  4YII A;  3JSP A;  1F1Z A;  4G94 A;  4P5O A;  1UB9 A;  2Z3Y A;  3U9G A;  2Z9O A;  1ZGJ A;  5FFX A;  4MHG A;  1TNS A;  3RDI A;  5HOO A;  2ZCW A;  5BPI A;  1F9N A;  3KP7 A;  4BYY A;  1FLI A;  3BJA A;  2HYF A;  3VOD A;  2MA3 A;  3HOS A;  5JHU A;  3GEZ A;  1XCV A;  4MQ9 F;  5FGM A;  5ERI A;  1XGS A;  2P4W A;  3BJO A;  4EV0 A;  4A0X A;  5LBQ A;  4PGH A;  4UVB A;  5FO5 A;  1P2F A;  4LD5 A;  1Z91 A;  4GYI A;  4WK8 F;  5DCF A;  3RI4 A;  4YFK F;  2HFH A;  2D45 A;  3REO A;  3C7J A;  2VE9 A;  5E1Z B;  4BH9 A;  1FOK A;  4Y17 A;  4EM0 B;  2P7C B;  4UNO A;  4M71 A;  4IHS A;  4KYW A;  2OQG A;  3H3U A;  1WKM A;  2J5O A;  1I5Z A;  2ZXJ A;  5BOX A;  1U78 A;  1LNW A;  2O8X A;  5CLS A;  3SFZ A;  3HHG A;  3QP6 A;  3D5L A;  4EJU A;  5L3E A;  3ZPL A;  3ELK A;  2KIF A;  4FX0 A;  5JVT A;  3KP5 A;  4OIN F;  2FQ3 A;  4G6D A;  2A07 F;  4KIB A;  3J7A O;  2ZME A;  3COA C;  1FYM A;  2HQR A;  3FXU A;  2V1X A;  5CVJ A;  1FYK A;  4U7D A;  1USS A;  4L9T A;  3MAJ A;  1GVJ A;  4Z2Y A;  4IXA A;  3SXY A;  4WWC A;  4UXN A;  2XKO A;  1LB2 A;  5H20 A;  3FWE A;  2GQQ A;  2BGC A;  4NQW A;  3GW2 A;  2G9W A;  4DQ2 A;  2L01 A;  1FC3 A;  2G7U A;  4M6X A;  5D5W B;  1IUY A;  4NHJ A;  1FX7 A;  2FML A;  4AIK A;  1BIA A;  1V4R A;  3Q9S A;  3CLO A;  4RS8 A;  1W7P D;  1YFH A;  2HGC A;  5DD8 A;  5AON A;  1WI9 A;  2VBW A;  2NRA C;  2XAF A;  3HSR A;  1DPR A;  2W84 A;  4P96 A;  1O3S A;  2EWN A;  1XGM A;  4HBL A;  2FBI A;  4EMS A;  3HOT A;  5BMZ A;  3WG9 A;  4WF2 A;  1QO0 D;  1ON2 A;  3KP3 A;  3V4G A;  1JHF A;  2DQR A;  4Q4Z F;  3K2Z A;  3ZMT A;  3KZZ A;  1MDM B;  2XRO A;  3G3Z A;  1ZAR A;  1FWZ A;  4HX7 A;  3SZT A;  1W7P B;  5JFR A;  2HZT A;  3CUQ B;  4KIC A;  3E5X A;  2CQK A;  1EH7 A;  4ENM A;  2PLY A;  5DEQ A;  1BBY A;  3JAM Z;  3FZV A;  3M7G A;  4D0P A;  3F22 A;  5L3F A;  1WRJ A;  1AOY A;  3IC7 A;  1EH6 A;  2GWR A;  5L3D A;  5HVQ C;  2IA2 A;  3T8T A;  2KRF A;  5E18 F;  4B8X A;  1KYW A;  1RUO A;  1ZAO A;  4IRI A;  2BBY A;  4IF4 A;  3V7C A;  3MFK A;  3U2R A;  3F23 A;  1L3L A;  4G7Z F;  3WTT C;  4CIC A;  4AIH A;  2CGP A;  1STZ A;  2O3F A;  4WXH A;  3QPT A;  1FBQ A;  2ESH A;  4KN7 X;  5HS9 A;  1PUE E;  1HKS A;  2OZ6 A;  1OYY A;  3M9A A;  3WTS C;  3MQ0 A;  3CJN A;  4ZZD A;  1TQM A;  1P4X A;  2HTS A;  3HSE A;  4O5V A;  1XDS A;  2H6B A;  2L02 A;  2PJP A;  2K4J A;  1QPM A; 
#chains in the Genus database with same CATH topology
 5IOZ A;  4Z6Y A;  2DA6 A;  1DP3 A;  3CLQ A;  4ASN A;  5ICE A;  1I6X A;  4B44 A;  3SDB A;  1R71 A;  4U7B A;  1REP C;  5D8K B;  1G59 A;  1XMA A;  4XKC A;  1SC7 A;  1YOV B;  2HOE A;  2ACJ A;  3ECH A;  3LSI A;  1ZLK A;  3OSG A;  1BM9 A;  4N9I A;  1IXS B;  3RCO A;  1IO2 A;  2NYX A;  1S7E A;  2JN6 A;  4BS9 A;  2FX0 A;  2D1V A;  2ME0 A;  2VKD A;  2LK2 A;  2HQN A;  1SFX A;  4MTD A;  2KRC A;  5KK1 A;  4N9H A;  2R7Z J;  2HXI A;  3ZN1 A;  1I1G A;  5FKL A;  1TWA J;  1CGP A;  3P7N A;  1XSD A;  3K0L A;  4BHC A;  3FXQ A;  3GUD A;  5CPR B;  2HWV A;  1TQI A;  1YS6 A;  4F7Z A;  1T08 B;  1HW1 A;  2STT A;  4HF1 A;  1VF9 A;  1LFB A;  2MGQ A;  1RI7 A;  1UZC A;  2RKH A;  4F92 B;  5M5W J;  3AFH A;  2BY0 A;  3EYI A;  1W4M A;  2M9H A;  3JRE A;  4HNT A;  1P7I A;  3U21 A;  2RVC A;  3R60 A;  4ZYA A;  4IX7 A;  1XN7 A;  2XAQ A;  4BXF A;  1MJ9 A;  1KU3 A;  1MMA A;  2V4J C;  2JA6 J;  5LGU A;  1ETX A;  4P9U A;  2DAO A;  3BY6 A;  2H1K A;  4PSW A;  4B48 A;  3JRD A;  2F6C A;  1G2H A;  3W6K B;  3OYI A;  2F4M B;  5F6F A;  2R7R A;  2QYO A;  3S14 J;  1S5L C;  2ELH A;  4G8X A;  1JTX A;  4KIF A;  2ZXH A;  4CCL A;  1YJN I;  2ISY A;  3I4P A;  5JR3 A;  2KQR A;  1MDM A;  3KZI C;  2ZKZ A;  3O3K A;  4C3H J;  1IN7 A;  1XS9 A;  1HKT A;  1UHS A;  1HKQ A;  1ZYR F;  1P6R A;  4YFN F;  4E7S A;  5HLT A;  2YUS A;  2XKP A;  2D1H A;  3KP4 A;  2IA1 A;  4U0Y A;  1J7K A;  3S16 J;  2DOF A;  2A05 A;  2ZJQ F;  1WVR A;  1K7A A;  4GDF A;  1CF7 A;  1EH8 A;  1D0Z A;  4EEF G;  3J81 Z;  1ETO A;  3ASO H;  3GFL A;  4PJM A;  3ML6 A;  2FNA A;  3X2Q H;  2OF7 A;  2OD5 A;  5LRR A;  1E3O C;  1T38 A;  1Z6R A;  2NVX J;  2KIU A;  2Y0M A;  1VQN I;  4IO9 F;  1D5V A;  1MBK A;  4IJA A;  3QOE A;  3L1P A;  3CCJ I;  3N4M A;  3G71 I;  3LAP A;  2Z99 A;  4A0Y A;  1BW5 A;  4II3 A;  4CZZ A;  4LK1 F;  3E6C C;  1LQ1 A;  2IA0 A;  4OOI A;  2FBK A;  3L7W A;  3OYA A;  2ZC2 A;  1T56 A;  2EIK H;  2MC3 A;  1G6N A;  3CJQ B;  3HIF A;  3U1K A;  2J5P A;  3OWT A;  3CMA I;  5FKK A;  1FJL A;  2VC1 A;  2ZJ2 A;  3OL4 A;  2ZNY A;  3OV8 A;  2WY8 Q;  2W25 A;  3FMR A;  3A2K A;  4TV7 A;  3CCQ I;  2DT7 B;  1IF1 A;  4JQF A;  3E6D A;  5AIP A;  4E7K A;  1IRG A;  4DBQ A;  1V5E A;  2YU9 J;  2KT0 A;  4JYK A;  2VKE A;  4B09 A;  1K6Y A;  1Y1V J;  3TMO A;  2E5Z A;  4HG2 A;  5BNG A;  2EK5 A;  4JK1 X;  5L3B A;  4CGZ A;  1XCB A;  2IS4 A;  1ERD A;  3L00 A;  4FHT A;  2V9P A;  4P9F A;  1AU7 A;  5EZH A;  4UUT A;  1LE8 B;  3DKW A;  3K9T A;  2QBY A;  1KQ9 A;  1OCR H;  1FOW A;  1TT5 B;  1IGN A;  1QVT A;  3QRF F;  4ON0 A;  3K7A J;  1ZGW A;  1O3Q A;  2VJ5 A;  2EZI A;  1ZRE A;  5HDN A;  3KET A;  3C3W A;  2DYR H;  2PMU A;  4BJT A;  3M8F A;  5DTD A;  3ZCO A;  1MSE C;  1MND A;  1E3H A;  2PFB A;  1WSU A;  1IRZ A;  2BVL A;  1KYZ A;  3I55 I;  2V6C A;  2GXA A;  4AWX B;  2DA5 A;  2FMY A;  1FMW A;  2X6W A;  2O9L A;  4OIP F;  4XK4 A;  2D5V A;  2LC2 A;  1KZH A;  3H92 A;  5TJJ A;  3DFG A;  1PUF A;  2KZV A;  3KE2 A;  3FKJ A;  4PFO A;  3BRO A;  2IEK A;  5K5R A;  4RAY A;  3G2B A;  4ETS A;  3K4M A;  3JRH A;  1DUX C;  2E1M C;  3FBI B;  2LKX A;  4B47 A;  3PSF A;  1RC9 A;  4YFX F;  2W7N A;  2WAF A;  4DYQ A;  4Q47 A;  4ZDP A;  3A4C A;  4KMU X;  3W6J B;  2LNB A;  2H8R A;  3CP2 A;  2WWY A;  1LDD A;  3BC8 A;  4KT5 C;  2F5C A;  2XDV A;  4RB2 C;  2VT3 A;  3B6A A;  4RLF A;  2HU9 A;  3CP8 A;  3RSN A;  1UFM A;  4MQV A;  4G6T B;  3OR2 C;  2NVT J;  2PG4 A;  2VL8 A;  3V7S A;  4CZC A;  2M30 A;  1KA8 A;  1SD5 A;  3IH4 A;  2I5U A;  4JX4 A;  5JLX A;  1SEU A;  1PJR A;  2KJC A;  2UXN A;  4H0E A;  2JTV A;  4XBF A;  1Z1D A;  4U87 A;  4PFP A;  3S8P A;  1MIJ A;  6PAX A;  2AO9 A;  4I01 A;  3K4J A;  1TBX A;  2JUC A;  4UUS B;  2VBX A;  1ZQ3 P;  2PJR A;  3HRM A;  3WU0 A;  2HXO A;  4D9J A;  3TO9 A;  1LKX A;  1O7L A;  4E4H A;  5H2F C;  4C3J J;  1CQT A;  3RZD J;  1XGO A;  1KU2 A;  1EV7 A;  4XLH A;  3MD2 A;  3PFY A;  4AD9 A;  4HQE A;  1TP4 A;  4IRH A;  5F64 A;  3F3X A;  1BJA A;  3RJP A;  4XM3 A;  3CCU I;  3R0A A;  1X1D A;  3HGY A;  2BHY A;  1UST A;  2HDW A;  1JKQ C;  2X9D A;  3MZH A;  3OYH A;  1HSJ A;  4Y15 A;  4EGZ A;  4XIC A;  5KNL A;  1FSH A;  2OTL I;  1FBS A;  1U5T C;  3PO2 J;  2EIJ H;  3M3Y J;  3BP8 A;  3MN2 A;  2XVC A;  3ZMV A;  3LSM A;  1A31 A;  2BZT A;  5ILS A;  2BW3 A;  1VQ9 I;  1RR8 C;  3FIS A;  2HYJ A;  5TRD A;  5E8I A;  4HNV A;  3ZN0 A;  3LSR A;  2DYS H;  1PP7 U;  1B6A A;  4PUS A;  4F55 A;  4HF0 A;  2XAG A;  1FP1 D;  1B59 A;  1AKH A;  3JRF A;  3ECO A;  3CZ6 A;  4C3I J;  2DK5 A;  3GFI A;  2IW5 A;  4R8H A;  5EYR A;  5C4J J;  5FFZ A;  1DGW Y;  4C2T A;  1BOA A;  3SEZ A;  3BR5 A;  5HOD A;  1QGP A;  2RV8 A;  3GZN B;  4BAC A;  3FF5 A;  1VQ6 I;  1I50 J;  5E17 F;  1V54 H;  2R7X A;  1UCR A;  1JT0 A;  1LDJ A;  3WHC A;  5LEJ A;  1MMG A;  4L0Z B;  2CUJ A;  3DEU A;  2XV4 S;  4I2O A;  4LG0 A;  2QQ8 A;  4YEL A;  3CC4 I;  3IRR A;  2A6T A;  1R4M B;  3NWS A;  2P5K A;  1TZL A;  1BR1 A;  2W00 A;  3S93 A;  1J9I A;  1WQ2 A;  2A68 F;  3LA2 A;  4UVA A;  2X1E A;  2TRT A;  2VB6 A;  1VQK I;  3DP7 A;  3LQR A;  2CYY A;  2DT6 A;  1G3S A;  1C0W A;  1OQY A;  4BXU A;  4QIW N;  3HHH A;  3V8K A;  4CYD A;  3I59 B;  2UWM A;  2DMP A;  1YJW I;  2DK8 A;  1LVA A;  5D5X B;  3BDD A;  5LGT A;  4BUP A;  1D8J A;  2YX4 A;  5A2Q K;  3A1Y A;  3O6B B;  1ZG5 A;  2ZSH B;  3CF5 F;  4LLN A;  3SZP A;  1YRN A;  2XPU A;  3FXR A;  4MLO A;  5GTH C;  2R7U A;  1I3Q J;  1SFO J;  4DYC A;  2KL4 A;  3F8C A;  1DGR M;  4M9Z A;  3P9C A;  5M3M J;  5DS9 A;  1MKM A;  2W57 A;  3KEY A;  2DA2 A;  2EV5 A;  4M73 A;  2DQL A;  1YIJ I;  4QLC U;  2B7E A;  2CW7 A;  3MKW B;  4G7H F;  1U8R A;  3O8H A;  1IXC A;  2VAS A;  4UY8 I;  4KIT B;  1T33 A;  3KP2 A;  1S9H A;  2KP6 A;  5E8G A;  4ZYG A;  4S04 A;  2IJL A;  4C2M J;  3FHN A;  2PMZ A;  2E71 A;  2OA4 A;  3Q3S A;  4PK4 A;  2DTZ A;  2RAE A;  3QOP A;  2VOO A;  1D5Y A;  1BA5 A;  4PJN A;  4A3E J;  1GXQ A;  4BE2 A;  1LEA A;  5LFA A;  3G1M A;  2JMW A;  2QSF X;  2HVR A;  3C2G A;  2QVO A;  2RQQ A;  1RR7 A;  3HPG A;  3L9F A;  4K2E A;  3S15 J;  3BPV A;  3BCA A;  3PQK A;  4A3D J;  2P81 A;  1E17 A;  5DM7 F;  5DUI A;  2EJR A;  5E3L A;  1YYV A;  4KIG A;  3QYF A;  4OMZ A;  1SAU A;  1TWF J;  3DF8 A;  4BAY A;  1Y56 A;  1S29 A;  4Y52 J;  2BVM A;  4LJZ F;  3OYM A;  3GXO A;  3ERE D;  2BW3 B;  1FY7 A;  1KU7 A;  1FNN A;  3BT9 A;  2DJN A;  2O5R A;  4LB5 A;  1MW7 A;  4EVI A;  5D8L B;  1Z3Y A;  5FJ8 J;  1ONV A;  1X4O A;  1QRY A;  3C1D A;  1DDN A;  2BV6 A;  2CJJ A;  1N78 A;  3NRV A;  1TW3 A;  2Z1D A;  1EKE A;  5CVI A;  1GHC A;  1YW9 A;  3J7Y J;  3LQQ A;  2LF8 A;  3H0D A;  1WH7 A;  3T0Y A;  3IL2 A;  1RES A;  3KEO A;  1ZRF A;  3EPZ A;  3A03 A;  1HXD A;  1A6I A;  4AIJ A;  2M4K A;  4KN4 X;  3TW6 A;  4M74 A;  1FBU A;  5KAI C;  2K9S A;  2R7D A;  3BTL A;  2F5E A;  2HOT A;  2VQG A;  2NS7 A;  3ZMS A;  1LEB A;  3BJ6 A;  2MH2 A;  1QHG A;  3RKW A;  3JTG A;  3HYI A;  4A5M A;  1GXP A;  1U9O A;  2IS2 A;  2CSO A;  4KT6 A;  1YW7 A;  2VC0 A;  5L3C A;  3GX4 X;  2FEZ A;  1J59 A;  4XLC A;  5GPC A;  2V6E A;  4A3G J;  3E7L A;  3TO6 A;  2PEX A;  3VSK A;  3L09 A;  3OYE A;  2OU2 A;  2COM A;  2IGN A;  2L7M P;  3K4B A;  1R5G A;  1IZ1 A;  4YIR X;  2DI3 A;  4WX9 A;  4L5I A;  3PUB A;  3S1R J;  2A61 A;  2ELK A;  1HLV A;  2CO5 A;  1FOY A;  3D5S C;  2R5Y A;  4HX8 A;  2ICW G;  2EFP A;  2IGK A;  3SQN A;  5IP7 J;  3L2W A;  4XLA A;  2P6T A;  5LRS A;  3HOW J;  3HTU A;  3DU5 A;  3S1M J;  1Z7U A;  4GGG A;  3GFJ A;  1E3P A;  2EV0 A;  1MNM C;  4EJW A;  3FXM A;  3IHU A;  2JRT A;  3ZQL A;  2Y9Z A;  3CTA A;  2Y30 A;  2Y75 A;  4OIO F;  1OCC H;  2EIL H;  2W24 A;  4XRS G;  2LY2 A;  1XMK A;  2P5L C;  2PI0 A;  2VN2 A;  3G73 A;  2E34 A;  4MO7 A;  5EEG A;  1WH5 A;  2E60 A;  2WBM A;  3GF2 A;  1HOM A;  3WGG A;  2MH9 A;  4MFD A;  3IP4 B;  2LOO A;  1X3U A;  1JKR C;  2MSY A;  1DQU A;  4KA4 A;  1Z9C A;  4IHW A;  4JX6 A;  4RB1 A;  2PQ8 A;  2QSH X;  4DZP A;  3WGH A;  4II2 A;  5K5Q A;  2ZO4 A;  3HM5 A;  3O8G A;  1QPI A;  3FM5 A;  2JA7 J;  3B73 A;  1JKP C;  5HNF A;  2KKO A;  3L2U A;  3HPH A;  2QBY B;  2P5V A;  1TT0 A;  2MLG A;  2CV0 A;  3LSK A;  4A12 A;  2Z16 A;  3KFW X;  2QZ8 A;  3LL7 A;  2RDP A;  1VI0 A;  3VEP A;  4BBS J;  1JXS A;  5CQG A;  2PN6 A;  3L2Q A;  4IVN A;  2XHK A;  1WZ2 A;  4W1U A;  4IQJ A;  2L5Q A;  2HQA A;  3LWF A;  1U5T A;  1A36 A;  1QZE A;  4I02 A;  2FA5 A;  1MH4 A;  4FCY A;  1V5F A;  1S7O A;  2O6G E;  4L0Y B;  2LH9 A;  1VQ4 I;  3GZ5 A;  2ADU A;  3OYG A;  1FP2 A;  4UV8 A;  3CUO A;  4BDZ A;  2XUB A;  5IT9 K;  4HV6 A;  2ID6 A;  5JLW A;  4FIS A;  4XSX F;  1WWX A;  2VKV A;  4HEA 2;  1R58 A;  3K1M A;  1MBG A;  4B1R A;  4AM3 A;  1HC8 A;  3H0G J;  2PMZ N;  2VON A;  1BIB A;  1X1A A;  5M5X J;  4HPQ A;  2IBD A;  3LA7 A;  3EET A;  1MNE A;  2KHM A;  4I0B A;  4PJ0 C;  3CCS I;  5AIQ A;  2Q8K A;  4EJT A;  2XF7 A;  5DD4 A;  5JI6 A;  2NS0 A;  4IPA A;  1OPC A;  3NEU A;  2VXZ A;  1OJL A;  3HOZ J;  2R7W A;  1R1U A;  3LAJ A;  2VJI A;  5FLX K;  3OYJ A;  1L0O C;  2D2W A;  4YG2 F;  2R7V A;  4DGW B;  2DLL A;  1JGS A;  3DLA A;  2E36 A;  5LGN A;  4D7N A;  1CF7 B;  2ZXI A;  2RQP A;  2NOJ B;  2XSD C;  2M3A A;  4E7L A;  2B0L A;  4KNY A;  3DTE A;  3TP0 A;  4UUV A;  3R4K A;  4I0A A;  3SYT A;  3E5Q A;  2DA7 A;  3RKX A;  2X6Y A;  1Y8R B;  3ISP A;  4MFE A;  3DBH B;  5EEH A;  1D1B A;  4ZYE A;  5DUK A;  1APL C;  1BC7 C;  3CUQ A;  5JVG F;  2MBF A;  2OQR A;  2K9Q A;  1SVL A;  2FXA A;  2JQ7 A;  2ELJ A;  3V8L A;  4Q48 A;  5E3M A;  2IAI A;  4A3L J;  1HA8 A;  1MZB A;  2IS6 A;  3CO6 C;  1YHQ I;  4ESJ A;  1BI3 A;  3H36 A;  4BQO A;  3L2C A;  1BN5 A;  2BYV E;  1U3E M;  1H9T A;  4XKW A;  1IDY A;  1WJE A;  1Z3X A;  3HKZ A;  3CCV I;  1OLT A;  2L7K A;  1KQ8 A;  1MD0 A;  2LD5 A;  5D4R A;  3CQZ J;  2KZG A;  3M8J A;  4IHY A;  3KEQ A;  2O61 A;  1F4K A;  2X6O A;  2GOM A;  2M8E A;  2ZFU A;  1FTZ A;  1BOB A;  2AQF A;  2MLK A;  4U0V A;  4E70 A;  1P4A A;  2BY2 A;  2HS5 A;  1GV5 A;  2H27 A;  2EZL A;  4M3G A;  3JRG A;  3HBL A;  4O6J A;  4CDG A;  3I53 A;  3WTW C;  2V9K A;  2JPB A;  4LFU A;  1TQP A;  3OIO A;  1H0M A;  3SZG A;  1W36 C;  2VBY A;  1P92 A;  4A69 C;  2E1N A;  4OAY A;  4XOR A;  1LPQ A;  4N0B A;  3LNQ A;  4BHP A;  3GFM A;  1YLF A;  4QPO A;  2A6E F;  5F1J A;  2ME6 A;  4RGU A;  2C6Y A;  1ZG3 A;  3AG1 H;  3JRB A;  4BQN A;  2RNJ A;  3I3L A;  4NC8 A;  4B43 A;  1FYL A;  4CO8 A;  3K70 D;  2R5Z A;  3VB2 A;  3DPT A;  2CH0 A;  2P7V B;  3A0H C;  3KYL A;  4A3F J;  2MD5 A;  4M3B A;  4ESB A;  1NG7 A;  3ASN H;  2HQ5 A;  4DW6 A;  4D7M A;  3E5U A;  1ZR4 A;  3LFU A;  3O2P E;  2Y48 A;  2CWE A;  3KCC A;  2CFX A;  1ZKG A;  3OS0 A;  2X48 A;  1W0U A;  3RKY A;  2DCE A;  3I58 A;  4E7J A;  3D1N I;  2QCO A;  2R92 J;  1J5Y A;  5FB2 A;  3IRQ A;  2P6S A;  3FMS A;  1QA6 A;  1VQ5 I;  3V8J A;  4RGS A;  3ZMZ A;  3DXJ F;  1XG1 A;  2R7Q A;  3DCF A;  2JVG A;  2M7B A;  5FD6 A;  1MMS A;  1QQI A;  3GTP J;  1J0R A;  2KMU A;  1JKO C;  1ETK A;  5F27 A;  4ZDO A;  3BG7 A;  2CU7 A;  2K40 A;  2NNN A;  1R6R A;  1BI1 A;  3ABK H;  2XF6 A;  2B9S A;  2M45 A;  4ZJZ A;  1S7A A;  5HS8 A;  3HOX J;  5HLH A;  3NWT A;  1J2X A;  5F0H A;  2HKX A;  3P9I A;  3S2D J;  2V7F A;  3HB9 A;  1ON1 A;  3E0J B;  4Q5S F;  5IYB J;  1VFC A;  2KPM A;  1ENH A;  3I0T A;  2MC4 A;  1ETY A;  2EZK A;  3CD6 I;  3KLO A;  3H9Q A;  4ZYD A;  4HNU A;  1HCR A;  2B63 J;  3HC7 A;  5D6F A;  3ROU A;  2F5F A;  1HST A;  2ZME B;  2IGM A;  2DMQ A;  1D8K A;  4GO1 A;  4UVC A;  2HDC A;  3FHZ A;  3WTU C;  3I71 A;  1PP8 F;  2ID3 A;  2MFZ A;  4GXO A;  4V2G A;  1QU3 A;  2LBF A;  3SJM A;  3S1Q J;  2LDU A;  3A02 A;  3F0C A;  1IRF A;  4BGD A;  2DPU A;  1Y0U A;  3EQL F;  1QZZ A;  1WPK A;  2DXI A;  3DKX A;  4WXC A;  2R5Y B;  1M1E B;  1XSX A;  4E7I A;  3GTG J;  1WJD A;  4BE0 A;  1ZK8 A;  1BC8 C;  2ISZ A;  4ENN A;  2JSC A;  3V7R A;  2CMP A;  2CS3 A;  4WXD A;  2E1C A;  3DPU A;  4IRG A;  2QGU A;  2XAJ A;  3PUF A;  5K7F A;  5A2Q Z;  2GA2 A;  3FXK A;  3NAU A;  3WG7 H;  2K9M A;  3E97 A;  4KUM A;  1N77 A;  3PIP F;  4FE7 A;  2OC6 A;  3M1C A;  2WV1 A;  2Q1Z B;  1X1B A;  1YE9 A;  2F2E A;  3IV5 A;  1VQP I;  1N25 A;  3H5N A;  2L54 A;  3ZQC A;  2XAH A;  3H9G A;  3C18 A;  1RZ4 A;  3G4S I;  1K4T A;  3CO7 C;  3QPH A;  5F0F A;  4I7H A;  2M34 A;  5EZG A;  1MGT A;  4XRM A;  1O57 A;  4MTE A;  1F43 A;  1RUN A;  3QPS A;  3TBI A;  2KIQ A;  1DU6 A;  1UHM A;  3ZQI A;  4QSH A;  5J1Y A;  5KCM A;  4IHV A;  2HVS A;  4AYB N;  2ESN A;  3EUH C;  1JHH A;  2R93 J;  2KJB A;  2L9N A;  1B4A A;  5F0C A;  1YIO A;  1IDZ A;  2X0L A;  1PDN C;  5K1Y A;  3J7Z I;  3V42 A;  3KPH A;  5B66 C;  4G7O F;  5B1A H;  3WU1 B;  3JRA A;  3VOE A;  2QSG X;  2XF5 A;  4HRI A;  3HOY J;  2P0W A;  3HGG A;  3QWL A;  5LEK A;  5F1R A;  4X0G A;  1Z05 A;  2QLZ A;  2XPW A;  3GTK J;  3SHF A;  1SD6 A;  1X2M A;  3F6V A;  1IAW A;  3ZMD A;  1KQ0 A;  2DBB A;  4BQA A;  3JTH A;  4HAM A;  1SMT A;  3K4L A;  4FX4 A;  1SAX A;  5FKO A;  2VQC A;  4XN0 A;  5ED4 A;  2E7W A;  2IS1 A;  4NB5 A;  5IT9 Z;  2Z2S B;  1I39 A;  3S3M A;  5H6Q A;  3G6E I;  4HQM A;  2K27 A;  4A3K J;  2R7O A;  2FUG 2;  3A01 B;  4NNJ A;  3OYK A;  2I8D A;  5IP6 A;  1XDU A;  3T5X A;  2OBP A;  1SFE A;  3A0B C;  3W2V A;  5ICG A;  2YX7 A;  5J6X A;  2HYG D;  3BQZ A;  1IN6 A;  3IH2 A;  1G3Y A;  2QEN A;  3PJR A;  1IJW C;  4FTH A;  4XSZ F;  3IAM 2;  2L9R A;  5DDG A;  3KX2 A;  1T6S A;  3RYR A;  2LKS A;  3ZXS A;  1IN4 A;  1ZEL A;  3KLN A;  2XAS A;  2M1B A;  2DMU A;  2GIV A;  1SAN A;  3ZGK A;  2FSW A;  3MKY B;  1NK3 P;  1HQC A;  2E1M B;  4XN3 A;  3B02 A;  4NDL A;  3F8F A;  4PCQ A;  4M3D A;  1RIO H;  1VQL I;  4J00 A;  3FKI J;  1YX5 A;  3E6B A;  2VQL A;  3GME A;  4XOT A;  2JWT A;  5LHG A;  1EA3 A;  4KJZ A;  2M4G A;  5GPA A;  4GCV A;  2FNP A;  5EGO A;  3WTX C;  3P5J A;  3GYH X;  5DYM A;  5E1X A;  4F91 B;  3ABU A;  2P8T A;  4R1H A;  2X6X A;  2O0Y A;  3JW4 A;  5GAD J;  4D5F A;  1BW6 A;  1R4N B;  2BE5 F;  1JGG A;  3F21 A;  2OUM A;  4UV9 A;  2VOD A;  5HNH A;  2OTJ I;  4BE1 A;  2K7L A;  2CW0 F;  4QWQ A;  2EB7 A;  4CH7 A;  2DJI A;  1Z0X A;  2WV0 A;  1W5T A;  3I9V 2;  4KDP A;  4EJO A;  3QYE A;  3BPX A;  4RGX A;  4HLY A;  2V1D A;  1E2X A;  2IP2 A;  2F5D A;  1UG0 A;  4L9N A;  5D5V B;  1O4X A;  1LFP A;  4GRI A;  4NC6 A;  2WC2 A;  3CDI A;  3AL0 B;  3FK6 A;  2FD5 A;  4LGW A;  2IVM A;  1Q1V A;  2ZNZ A;  1P7J A;  4M9S A;  5IP9 J;  4RM3 A;  4JBA A;  4BEH A;  3ULQ B;  1VQ8 I;  3GTM J;  2M5W A;  9ANT A;  3FX3 A;  2DTR A;  3I59 A;  3OSF A;  2ZFW A;  2FF4 A;  1EF4 A;  2HVQ A;  4ABZ A;  4LK0 F;  1XB4 A;  2UUZ A;  2TCT A;  2W1O A;  3S2H J;  5J4Y A;  1ZRC A;  2LR8 A;  2K3P A;  2RN7 A;  3DTI A;  1V3F A;  4MEX F;  1XSV A;  4I98 B;  4ZZL A;  3QAH A;  4EAT A;  1DU0 A;  4XLP F;  2EIM H;  5CVR A;  2XB5 A;  2Q2E A;  1WJC A;  1GT0 C;  4E7H A;  5TGT A;  3RTR A;  4AU7 A;  2V79 A;  5CVU A;  4EM1 A;  2LFB A;  1YJ9 I;  2RGV A;  3RQI A;  2O03 A;  4X1E A;  1TC3 C;  4MEY F;  4F93 B;  2QKM B;  3MZ8 A;  3HEF A;  4BNC A;  4S0H B;  5J8C A;  2FRH A;  3R0J A;  2WTE A;  3ZMU A;  3R6S A;  1U6G A;  3IWZ A;  3PNT A;  3WE3 A;  3BZ6 A;  1J75 A;  4IQ4 A;  2JK3 A;  3BLY A;  3LST A;  3M4O J;  3CUQ C;  1D3Y A;  1X3W B;  2E7X A;  3AG2 H;  4DJA A;  4HST A;  3MCZ A;  5CJ9 A;  2PJR B;  2WB1 N;  5GAG J;  3IWF A;  4Y4R A;  4F3Q A;  4WCG A;  2OV7 A;  3HOV J;  4PJL A;  3UR3 C;  4HYE A;  1OFC X;  2HOA A;  3CMY A;  3ZQ7 A;  1B8I A;  4EM2 A;  3PFI A;  5KHD A;  2KIM A;  2L7Z A;  3I5U A;  2PBI A;  1GUU A;  2VT2 A;  4BBR J;  2QWW A;  1YX3 A;  5HDK A;  4I6Z A;  4YEJ A;  3SDG A;  2A5W A;  3TQN A;  3BG6 A;  4LIT A;  5K5O A;  3PO3 J;  3K1N A;  4CXF A;  2E2H J;  2DOD A;  1FSE A;  4U0W A;  1H9G A;  3MWM A;  4L9J A;  1UEL B;  5EJC A;  5HLI A;  2Y0S N;  3TP3 A;  2JPC A;  2YPR A;  4UUS A;  3DEW A;  2Q0O A;  3VDX A;  3IH3 A;  3ZQF A;  1FZP B;  3K1P A;  4LIV A;  4RB3 C;  4GYG A;  4KIS A;  3F72 A;  1WJ5 A;  5DV5 A;  3HUG A;  5EF6 A;  5IYC J;  5ICF A;  1T2K A;  3FXJ A;  5ILV A;  3J80 Z;  2VBZ A;  5EDN A;  3OYL A;  3MZY A;  4UB8 C;  1R1T A;  2HOS A;  4A0Z A;  3TED A;  1KU9 A;  2IPQ X;  3DBR B;  5ILU A;  5M3F J;  1NH3 A;  3K4N A;  3KP6 A;  2X4H A;  2E19 A;  5CVV A;  4OU0 A;  4ZH4 F;  2COB A;  4UHT A;  1WJB A;  3WTZ A;  2ZJR F;  1YQA A;  2K4B A;  4GFB A;  3RPU D;  1MJB A;  2R7F A;  3HG9 A;  4BEH B;  5ICC A;  2YS9 A;  1FMV A;  3TKY A;  3VYU B;  2CV2 A;  1R00 A;  1W5S A;  2LY1 A;  5IPA A;  1LDK B;  2MAB A;  4C30 A;  5D4S A;  2H09 A;  1WCM J;  1T39 A;  3CF2 A;  5J3L A;  2LLK A;  2V1N A;  3CJR B;  1R1V A;  4M3E A;  3VYT B;  3I54 A;  4L18 B;  3ERM A;  1ZTR A;  1HDP A;  5FD5 A;  4BY7 J;  1TNT A;  3RPQ A;  5JHF A;  3EUH A;  1T0F A;  3LA3 A;  1FT9 A;  4BHB A;  3Q0W A;  3BR2 A;  2Y9Y A;  3BR6 A;  3K4C A;  1SMY F;  2LSO A;  4XQF A;  3PSI A;  5LLQ A;  2XSJ C;  3OIQ A;  4OAZ A;  1W36 D;  3HRT A;  3GTQ J;  2X1C A;  2L4A A;  3PNV A;  4ESF A;  1IG7 A;  2XAU A;  1FIA A;  5EGO B;  3ZP5 A;  3CDH A;  5FLX Z;  1IN8 A;  2DFH A;  2OZU A;  4CYC B;  2E1O A;  2A5Y B;  2VXD A;  3CC7 I;  2M87 A;  2H8W A;  4XOP A;  2LF7 A;  3JRI A;  1SFU A;  2JA5 J;  1ETQ A;  5FRO A;  3TO7 A;  4KFC A;  3TDU C;  3LFK A;  2X1D A;  1JT6 A;  3ONQ A;  5FKM A;  3Q5F A;  2GLO A;  3ABT A;  3VSL A;  4PGG A;  1JUP A;  2W82 A;  2EFW A;  1K4S A;  4RDU A;  2VLA A;  3GVA A;  3IKT A;  3G1O A;  1F36 A;  1PVE A;  2AHQ A;  3T1B A;  4A3C J;  1GVD A;  2G0E A;  3CCL I;  4AVZ A;  1LUJ B;  3H9J A;  4CHU A;  4EJV A;  2XB0 X;  3BR0 A;  1ULY A;  1NK2 P;  1O3T A;  1Y8Q B;  2HKO A;  3VFZ A;  1B9N A;  2K9N A;  4J01 A;  1OR7 C;  2BEO A;  3SEQ A;  4OIQ F;  3A01 A;  5DCM B;  3D0S A;  3ABM H;  2ZXW H;  2KDO A;  4A6D A;  3I64 A;  2L9V A;  4RM2 A;  1VND A;  2QQ9 A;  5CKT A;  5KAF C;  4HZF A;  5K7H A;  2HNH A;  4P55 A;  1D0X A;  3HRU A;  2M8G X;  2EPF A;  2QQA A;  3EDP A;  4ENK A;  2V26 A;  1QZY A;  4HLX A;  2H94 A;  2EFN A;  3CCM I;  1Q1H A;  2M7A A;  2NS8 A;  3OYN A;  4NC7 A;  1G3T A;  3UNG C;  2R5Z B;  3S2W A;  3MKZ A;  4CCK A;  3F6O A;  4MGR A;  3K69 A;  1LJ9 A;  3KYC B;  1R9T J;  3J81 K;  3CES A;  4FAS D;  2JJ7 A;  4OWR B;  4YIF A;  5BS6 A;  4N4O B;  4AUX A;  3T8R A;  1MJA A;  3QU3 A;  2R7T A;  1YG2 A;  2FQ4 A;  4DYR A;  2AS5 F;  2BY3 A;  3WE2 A;  3HTS B;  2HR3 A;  2DO7 A;  1T98 A;  2YSR A;  2UV1 A;  1B72 B;  2A6H F;  2K9L A;  3DTK A;  1JUM A;  2JA2 A;  3BR3 A;  4PZJ A;  1B72 A;  2Y2Z A;  1JTY A;  1RNL A;  2DA1 A;  3HJE A;  4ZYH A;  2MYS A;  2DFI A;  5E3N A;  1B9M A;  5J8F A;  3GBG A;  3OS2 A;  1XGN A;  2EFO A;  3NQO A;  1I1S A;  1U0J A;  1I27 A;  1R23 A;  3TOB A;  1YIT I;  3R61 A;  1WFX A;  4AC0 A;  4A2U A;  2EZH A;  2STW A;  2JZY A;  1G8X A;  4HOB A;  2NVQ J;  4RGR A;  1K78 B;  2ETH A;  1QBJ A;  4HF2 A;  3BZK A;  2XGC A;  1TL8 A;  1YTY A;  1R7J A;  5HS7 A;  1Y1W J;  4A6E A;  1S72 I;  1Y0N A;  1XC5 A;  3RQ4 A;  3F8M A;  1K83 J;  2M0C A;  3TDZ C;  2BXZ A;  2VPL A;  3TL4 X;  2UXX A;  1ZN2 A;  1VTN C;  5F04 A;  2CUF A;  2CG4 A;  3D5R C;  2F4I A;  3OYC A;  3OYD A;  3QOD A;  3F8B A;  3OOU A;  2CQ7 A;  3IKV A;  3LSJ A;  4LLL A;  1ITY A;  4JP0 A;  4L9V A;  3WOD F;  3GTJ J;  3QU6 A;  3TGN A;  3BWG A;  1GLN A;  2LMD A;  3K4K A;  1TW2 A;  2HZD A;  4BDY A;  2V1U A;  4G6Q A;  4LOC A;  4IKF A;  2EFQ A;  1KON A;  1TWG J;  4H4K C;  2FBH A;  3DLL F;  4C2U A;  1TTY A;  3K2A A;  5EG0 A;  3BG5 A;  5J4V A;  2VJJ A;  4IOC F;  1MBE A;  5LHH A;  3FXL A;  1U2W A;  2DU9 A;  4S05 A;  3FMQ A;  2PX9 A;  2LKP A;  1ZHF A;  2DT5 A;  2FOW A;  2OAZ A;  5J47 A;  3HKZ N;  3DV8 A;  1BI0 A;  5E20 A;  4Y33 A;  5GAE J;  2RNG A;  2VE8 A;  4V2F A;  3PIO F;  2ECC A;  3OR1 C;  4IZZ A;  3ZQQ A;  3RPU A;  4HDU A;  4XNF A;  4QTR A;  2GIZ A;  4BKX A;  3S17 J;  3AG4 H;  1OR7 A;  3FM3 A;  4I99 C;  3LOC A;  2ECB A;  3AG3 H;  3Q0V A;  1UJ8 A;  4ITV A;  2L4M A;  1K6O A;  3JSO A;  3WU2 C;  3VYS B;  3L2R A;  3PQJ A;  1B1B A;  3F8N A;  4CSW A;  2QA4 I;  4Y3O A;  1GV2 A;  1XX5 A;  5D6E A;  2NAZ A;  1SD7 A;  1G3W A;  1P9Q C;  4LG3 A;  2XGD A;  1U5T B;  4HV5 A;  1RPW A;  5BQT A;  1S6L A;  4M72 A;  5FLV A;  1O3R A;  2K02 A;  1X1C A;  3LSH A;  1G4D A;  4ANJ A;  3BCB A;  4XL9 A;  1RET A;  2LTP A;  4Y13 A;  3I4N J;  3I56 I;  2L9S A;  3Q0U A;  4DZJ A;  3KZY A;  2A3S A;  5EG0 B;  2CW8 A;  2HTJ A;  2QEX I;  2UZK A;  2V9V A;  4RB0 A;  4XKB A;  2XIG A;  1JE8 A;  1TLH B;  3HRS A;  3FBN B;  2H6C A;  1K78 A;  2EBI A;  4HA8 A;  3RIR A;  2GXG A;  5E1W A;  1S8N A;  1YO5 C;  4XRF A;  4N4N B;  3HSF A;  4CUG A;  5HDG A;  2YR2 A;  1H88 C;  4OMY A;  1TWC J;  2DDB A;  1ZRD A;  5FRN A;  1W7P A;  4XR6 A;  4M9X A;  3WGI A;  4HSR A;  3HZJ A;  2JVH A;  2K86 A;  3RYP A;  4E7Z A;  1ETW A;  1OYW A;  3OL3 A;  5IT3 A;  2KDZ A;  1YW8 A;  4M6Y A;  1I3A A;  2AXL A;  3AKZ A;  1UAA A;  4ENJ A;  1X1P A;  2QF7 A;  2R7S A;  4EQQ A;  1UHW A;  1HW5 A;  1Z67 A;  2QM3 A;  5KVR A;  3DU6 A;  4DNC A;  1QNT A;  3K6G A;  3E3V A;  1JJ6 C;  3M07 A;  4MNU A;  5L3G A;  2L3D A;  1OCZ H;  3BTC A;  1O7F A;  5H6R A;  2ZME C;  4W97 A;  1R22 A;  3JAM K;  3U1D A;  2Z33 A;  1OMI A;  4CA0 A;  1FEX A;  3W3C A;  2K85 A;  4M6V A;  2GA1 A;  1FIP A;  2JSP A;  4BJ6 C;  1SVM A;  2VUM J;  1HW2 A;  3N97 A;  3TOA A;  1R5H A;  5LD2 C;  3WTV C;  2IT0 A;  3H3Z A;  2HI3 A;  2L0K A;  2E2J J;  1K79 A;  5IOY A;  3W2A A;  3E6M A;  1EJ9 A;  2FOK A;  1AWC A;  3AAF A;  1ZLJ A;  4A5N A;  4RMN A;  4KMF A;  4O3M A;  1Z6T A;  5DCM A;  2R3S A;  4DBR A;  4B3X A;  3BG3 A;  5CYV A;  4EGY A;  4B3A A;  4I09 A;  3FDY A;  2AXT C;  4LLG F;  3CDL A;  4B4C A;  3BZC A;  2LY9 A;  2FJ1 A;  4ZDL A;  3OOP A;  4IHX A;  3S1N J;  4IL6 C;  2X51 A;  3GZ6 A;  2VOP A;  1H8A C;  2GXB A;  3ZRG A;  1T95 A;  1F5T A;  1R36 A;  2VQH A;  2LRD A;  2PMH A;  1X58 A;  2VIX A;  3E1S A;  4PDK A;  3GO5 A;  3BTI A;  4L5J A;  1XD7 A;  2FU4 A;  1JI8 A;  1IN5 A;  3P9K A;  4G9Y A;  2TDX A;  4U88 A;  3WTY C;  5LHI A;  4HDV A;  2EA2 A;  2KFD A;  4FT8 A;  2YU3 A;  2XC7 A;  1XMX A;  2HEO A;  1WI3 A;  2ZJP F;  1HDD C;  2GZW A;  1IRX A;  4XLN F;  3MEX A;  3JRC A;  1BI2 A;  4CYC A;  2DOA A;  1ZH5 A;  3DQV C;  1IW7 F;  2IXS A;  2XPV A;  3QP5 A;  1FPQ A;  2W85 A;  5B3S H;  2JT1 A;  3VWB A;  1X4P A;  3HL2 A;  3LSP A;  3CMM A;  4PJJ A;  1R5I D;  3BG9 A;  4AYB A;  3DPL C;  3BTJ A;  2QUF A;  2A69 F;  3GLX A;  1NHA A;  2EV6 A;  5BPD A;  2HPI A;  2O8K A;  2GBY A;  5C44 J;  2QQB A;  2RC4 A;  4IHT A;  3Q9V A;  3M1E A;  4JOM A;  2XRN A;  1N75 A;  1ZG1 A;  2OPT A;  4XRS A;  3IAS 2;  1OKR A;  2LP0 A;  3EUK L;  4J19 A;  2NNY A;  1DP7 P;  4HX4 A;  3ZQH A;  2EA4 A;  2GAU A;  3M8E A;  4HW0 A;  1A04 A;  1D1A A;  1P4W A;  4NQW B;  5TIS C;  3DWL E;  3J80 K;  3GTO J;  1UMQ A;  2VJ4 A;  2DW4 A;  3BOQ A;  5F08 A;  3H35 A;  3N05 A;  2DN0 A;  2M0M A;  1KGS A;  1LVK A;  2G7H A;  1YS7 A;  1ODD A;  1WGX A;  1IXR C;  3AL0 C;  1DPU A;  2Z5U A;  2IRF G;  2Y69 H;  2XGX A;  5HLG A;  1HBX G;  5FRM A;  1OYI A;  3S3N A;  4AVP A;  2OCC H;  4R79 A;  1S3J A;  4CCM A;  4D5C A;  3EUA A;  4E6K G;  1SD4 A;  2EQR A;  4PSX A;  1D0Y A;  1ZGA A;  1YRN B;  2DPD A;  2F4O B;  1H89 C;  3DEE A;  4CCO A;  2AQE A;  4LG0 B;  4IEJ A;  2FE3 A;  1MBF A;  4XLE A;  5J40 A;  1W1W E;  4OIR F;  4JX5 A;  4LMY A;  5D5U B;  4A3J J;  4LB6 B;  3W6V A;  2DA3 A;  2NVY J;  1MBJ A;  4C9Y A;  3GWZ A;  2CUZ A;  1U8B A;  2ZBK A;  2LVS A;  4RAZ A;  2F5V A;  3EYY A;  2DFF A;  5J1R A;  3HDD A;  2WY7 Q;  3DKY A;  4YII A;  1F1Z A;  1RKW A;  3PNY A;  4G94 A;  4P5O A;  3JSP A;  1UB9 A;  2EH3 A;  2Z3Y A;  3U9G A;  2Z9O A;  1W0T A;  1ZGJ A;  3J7A Y;  2CUE A;  1QVU A;  1B8I B;  5FFX A;  2XRL A;  1OCP A;  3HUG B;  4MHG A;  1TNS A;  3MKL A;  3RDI A;  5HOO A;  2ZCW A;  3ZR8 X;  5BPI A;  1F9N A;  3KP7 A;  4FET A;  4P1W A;  4BYY A;  1A6Q A;  4ZC3 A;  1A35 A;  4ZTJ A;  1FLI A;  2WAQ N;  3BJA A;  2CRG A;  2HYF A;  3VOD A;  3QYB A;  2MA3 A;  3CJT B;  3HOS A;  2BHZ A;  3GLL A;  5JHU A;  3GEZ A;  1XCV A;  2GM4 A;  4MQ9 F;  5FGM A;  2WAE A;  5ERI A;  1XGS A;  1POG A;  2CQQ A;  2P4W A;  1FOX A;  2MD0 A;  3BJO A;  2K3F A;  4EV0 A;  2VI6 A;  3S3O A;  1VQ7 I;  4BXX J;  4A0X A;  5CQE A;  5LBQ A;  5E3O A;  1K61 A;  3FXO A;  4PGH A;  4UVB A;  4L5E A;  5FO5 A;  4F52 A;  1AA7 A;  1P2F A;  4LD5 A;  2HDD A;  1UG2 A;  1Z91 A;  5EEA A;  4GYI A;  2DFE A;  4V19 K;  3KYD B;  4WK8 F;  4RA2 A;  1TWH J;  3CCE I;  4NBQ A;  1WJF A;  5DCF A;  3RI4 A;  4YFK F;  3IUO A;  2DMN A;  3OYF A;  5IY5 H;  3ZOB A;  5C4X J;  2HFH A;  1T0F C;  3I4M J;  1IV8 A;  1OCO H;  1SVO A;  3GCM A;  3NAR A;  2D45 A;  1VZ0 A;  3REO A;  3C7J A;  1RKT A;  4I76 A;  2VE9 A;  5E1Z B;  4BH9 A;  1JJ8 C;  1Z77 A;  1A5J A;  2WA0 A;  1FOK A;  4Y17 A;  3S32 A;  2L2O A;  4X6A J;  4RLQ A;  4G12 A;  4UB6 C;  2N8G A;  5FLM J;  4EM0 B;  2P7C B;  4UNO A;  3B6C A;  4M71 A;  3GTL J;  4IHS A;  3PL8 A;  3QQA A;  4XKV A;  4ZTF A;  4KYW A;  2OQG A;  3H3U A;  4D1Q A;  1ACI A;  1WKM A;  2J5O A;  1I5Z A;  3G1L A;  5C3E J;  1MSF C;  2ZSI B;  2ZXJ A;  5BOX A;  2Q2E B;  1U78 A;  1MMN A;  1BR4 A;  1X3Z B;  1LNW A;  2O8X A;  3C2B A;  2CV1 A;  5CLS A;  3SFZ A;  3HHG A;  1X19 A;  3QP6 A;  3D5L A;  4EJU A;  1AHD P;  5L3E A;  3ZPL A;  1ZR2 A;  1YI2 I;  3ELK A;  4RAF A;  1FTT A;  2I10 A;  2KIF A;  2JRM A;  4FX0 A;  5JVT A;  3KP5 A;  4OIN F;  4XMY A;  1V55 H;  2FQ3 A;  3KIO A;  4G6D A;  2LBF B;  1VQO I;  3DBL B;  2A07 F;  4KIB A;  3J7A O;  2KRH A;  2ZME A;  3COA C;  1FYM A;  2GOX B;  2F48 A;  2HQR A;  1ETV A;  2BOL A;  3FXU A;  1NG6 A;  1BL0 A;  3JR9 A;  2V1X A;  5CVJ A;  1FYK A;  4U7D A;  3OY9 A;  1OCT C;  2W48 A;  1USS A;  1PUF B;  4L9T A;  3MAJ A;  2LG4 A;  1GVJ A;  1PYV A;  4Z2Y A;  4Y7N J;  3FK7 A;  1W5C C;  4IXA A;  1MMD A;  2RRE A;  1XTA A;  3HOU J;  3K70 C;  3SXY A;  4WWC A;  2CFO A;  4UXN A;  3SFI A;  3LMM A;  4DOZ A;  2XKO A;  1LB2 A;  3HXL A;  2O7O A;  3BR1 A;  5H20 A;  2BY1 A;  1MH3 A;  1WHU A;  2CQN A;  3FWE A;  2GQQ A;  2BGC A;  4NQW A;  3GW2 A;  5J1U A;  2WAQ A;  3OMY A;  2G9W A;  5GAH J;  2VPR A;  3PM1 A;  2Y0S A;  4DQ2 A;  2WAD A;  3C2H A;  2E35 A;  4RBO A;  2L01 A;  4A3I J;  2BXY A;  2LYC A;  2NVU B;  1FC3 A;  2G7U A;  2R0Q C;  4M6X A;  3CCY A;  5D5W B;  1IUY A;  4NHJ A;  3UKG A;  1FX7 A;  4BJ5 C;  2FML A;  4AIK A;  2H1L A;  4A93 J;  1BIA A;  4BY1 J;  4QPQ A;  1AKH B;  1V4R A;  3Q9S A;  3CLO A;  5GP9 A;  5IYD J;  2IGO A;  4RS8 A;  1W7P D;  3L2V A;  1YFH A;  4CCJ A;  2HGC A;  5M5Y J;  3TW7 A;  5GTI C;  3JCU C;  5DD8 A;  1LFU P;  2EIN H;  3VYR B;  5AON A;  1WI9 A;  2R4G A;  4XID A;  2VBW A;  2K5C A;  2NRA C;  1U9N A;  2XAF A;  1RRJ A;  1IUF A;  3HSR A;  4XLF A;  1DPR A;  2W84 A;  2DOE A;  4P96 A;  1O3S A;  1IC8 A;  2EWN A;  5B1B H;  2XGE A;  2M2E A;  1XGM A;  1VQM I;  4HBL A;  2FBI A;  4EMS A;  3RKQ A;  3HOT A;  3W2W A;  5BMZ A;  4BQQ A;  3F9K A;  5FKN A;  3WG9 A;  4WF2 A;  1QO0 D;  1ON2 A;  4IOA F;  3KP3 A;  3V4G A;  2CQX A;  1JHF A;  2DQR A;  1V5G A;  4Q4Z F;  3K2Z A;  3ZMT A;  3H3V K;  3KZZ A;  1MBH A;  4NUB A;  1MDM B;  2XRO A;  3G3Z A;  3ABL H;  2W4S A;  2ZB9 A;  3MMY B;  3H5R A;  3WHB A;  1ZAR A;  1FWZ A;  4HX7 A;  3CCR I;  3SZT A;  1W7P B;  2Y31 A;  2OJE D;  1Y6I A;  5JFR A;  1E0E A;  2HZT A;  2KLO A;  3CUQ B;  4KIC A;  3VPR A;  3E5X A;  2CQK A;  4M3F A;  2MG4 A;  1EH7 A;  4ENM A;  1R49 A;  2PLY A;  5DEQ A;  1BBY A;  5E79 C;  3OIP A;  3JAM Z;  3K10 A;  3H5A A;  1T8I A;  3FZV A;  3M7G A;  4D0P A;  4YRV A;  2JUG A;  3LSG A;  4BL0 B;  5L3F A;  3F22 A;  1HF0 A;  1WRJ A;  3FIW A;  1IV6 A;  2QKL B;  4LIU A;  1AOY A;  3IC7 A;  4A3B J;  1EH6 A;  2GWR A;  5L3D A;  2NOG A;  1GDT A;  2VKH A;  3CC2 I;  1J09 A;  5HVQ C;  2IA2 A;  3T8T A;  1X2N A;  2KRF A;  5E18 F;  4B8X A;  2HPM A;  1KYW A;  1RUO A;  3QPL A;  2E2I J;  2LRE A;  3CME I;  1XPX A;  4RAG A;  1ZAO A;  1Y39 A;  4IRI A;  2BBY A;  4IF4 A;  5B5E C;  2DMT A;  3V7C A;  3MFK A;  3U2R A;  3F23 A;  1NTC A;  1L3L A;  4G7Z F;  1JUS A;  1Z7L A;  3WTT C;  1OIS A;  4CIC A;  3ZQG A;  4AIH A;  2DA4 A;  1STZ A;  2CGP A;  2O3F A;  4BU2 A;  3OS1 A;  4WXH A;  4FQG A;  1LE8 A;  3QPT A;  1FBQ A;  2ESH A;  4KN7 X;  5HS9 A;  2OCE A;  1PUE E;  1HKS A;  2OZ6 A;  1D1C A;  5K7Z A;  1OYY A;  3M9A A;  3WTS C;  4DIQ A;  1I6H J;  3MQ0 A;  2NXN B;  3CJN A;  1QHH D;  2E5N A;  1TQM A;  4XON A;  4ZZD A;  1P4X A;  2HTS A;  2L7F P;  3HSE A;  2X85 A;  4O5V A;  4FE4 A;  1XDS A;  2H6B A;  3RZO J;  2L02 A;  2WB1 A;  3MVP A;  1BJZ A;  3H1C A;  4MIM A;  1ORK A;  2DDA A;  4AID A;  2JA8 J;  4A3M J;  2PJP A;  2K4J A;  1WJA A;  2MW8 A;  3OYB A;  3ESW B;  3BQY A;  1Z21 A;  1BR2 A;  1QPM A;  5DM6 F;  4CCN A;  2KIS A;  1SFK A; 
#chains in the Genus database with same CATH homology
 4ASN A;  5ICE A;  1I6X A;  4U7B A;  1REP C;  5D8K B;  1XMA A;  2HOE A;  2ACJ A;  3ECH A;  1ZLK A;  1BM9 A;  4N9I A;  1IXS B;  2NYX A;  2D1V A;  2HQN A;  1SFX A;  4MTD A;  5KK1 A;  4N9H A;  3ZN1 A;  1I1G A;  1CGP A;  3P7N A;  1XSD A;  3K0L A;  4BHC A;  3FXQ A;  3GUD A;  2HWV A;  1TQI A;  1YS6 A;  4F7Z A;  1HW1 A;  2STT A;  4HF1 A;  1RI7 A;  2RKH A;  3EYI A;  1W4M A;  2RVC A;  3R60 A;  1XN7 A;  2XAQ A;  1MJ9 A;  1KU3 A;  5LGU A;  4P9U A;  2DAO A;  3BY6 A;  3W6K B;  5F6F A;  2QYO A;  2ELH A;  4G8X A;  4KIF A;  2ISY A;  3I4P A;  5JR3 A;  1MDM A;  2ZKZ A;  3O3K A;  1IN7 A;  1HKT A;  1HKQ A;  1ZYR F;  1P6R A;  4YFN F;  2XKP A;  2D1H A;  3KP4 A;  2IA1 A;  4U0Y A;  1J7K A;  1K7A A;  1CF7 A;  1EH8 A;  3J81 Z;  3GFL A;  3ML6 A;  2FNA A;  2OD5 A;  5LRR A;  1T38 A;  1Z6R A;  2KIU A;  2Y0M A;  1D5V A;  4IJA A;  3N4M A;  3LAP A;  2Z99 A;  4A0Y A;  4CZZ A;  4LK1 F;  3E6C C;  1LQ1 A;  2IA0 A;  4OOI A;  2FBK A;  3L7W A;  2MC3 A;  3HIF A;  1G6N A;  2J5P A;  2VC1 A;  2ZJ2 A;  2ZNY A;  3OV8 A;  2W25 A;  3FMR A;  4TV7 A;  1IF1 A;  4JQF A;  3E6D A;  5AIP A;  1IRG A;  4B09 A;  5L3B A;  2EK5 A;  4JK1 X;  4CGZ A;  1XCB A;  3L00 A;  4FHT A;  4P9F A;  3DKW A;  3K9T A;  2QBY A;  1KQ9 A;  3QRF F;  4ON0 A;  1O3Q A;  1ZRE A;  5HDN A;  3KET A;  3C3W A;  2PMU A;  3M8F A;  2PFB A;  1WSU A;  1KYZ A;  2V6C A;  4AWX B;  2FMY A;  4OIP F;  3H92 A;  5TJJ A;  3DFG A;  3KE2 A;  3BRO A;  5K5R A;  4RAY A;  4ETS A;  1DUX C;  4YFX F;  4Q47 A;  4KMU X;  3W6J B;  2LNB A;  2WWY A;  1LDD A;  4KT5 C;  2F5C A;  4RB2 C;  2VT3 A;  1UFM A;  4MQV A;  2PG4 A;  3V7S A;  2M30 A;  1KA8 A;  1SD5 A;  2KJC A;  4H0E A;  2UXN A;  2JTV A;  4XBF A;  1Z1D A;  6PAX A;  4I01 A;  1TBX A;  2VBX A;  3HRM A;  3WU0 A;  3TO9 A;  1O7L A;  1XGO A;  1KU2 A;  1EV7 A;  4AD9 A;  4HQE A;  4IRH A;  5F64 A;  3F3X A;  1BJA A;  3RJP A;  3R0A A;  1UST A;  3MZH A;  1HSJ A;  4Y15 A;  4EGZ A;  1FSH A;  1FBS A;  1U5T C;  3BP8 A;  2XVC A;  3ZMV A;  5ILS A;  5TRD A;  5E8I A;  3ZN0 A;  1PP7 U;  1B6A A;  4HF0 A;  2XAG A;  1FP1 D;  1B59 A;  3ECO A;  2DK5 A;  3GFI A;  2IW5 A;  4R8H A;  5FFZ A;  1BOA A;  1QGP A;  2RV8 A;  3FF5 A;  5E17 F;  1UCR A;  1LDJ A;  5LEJ A;  4L0Z B;  3DEU A;  2XV4 S;  4I2O A;  4LG0 A;  3IRR A;  2P5K A;  1J9I A;  1WQ2 A;  2A68 F;  3LA2 A;  4UVA A;  3DP7 A;  3LQR A;  2CYY A;  1G3S A;  1C0W A;  4BXU A;  3HHH A;  3V8K A;  4CYD A;  3I59 B;  2UWM A;  2DK8 A;  1LVA A;  5D5X B;  3BDD A;  5LGT A;  1D8J A;  2YX4 A;  5A2Q K;  3O6B B;  1ZG5 A;  4LLN A;  3SZP A;  3FXR A;  3F8C A;  4M9Z A;  3P9C A;  1MKM A;  2W57 A;  4M73 A;  2EV5 A;  2DQL A;  4QLC U;  4G7H F;  1U8R A;  1IXC A;  3KP2 A;  5E8G A;  4ZYG A;  4S04 A;  2IJL A;  2OA4 A;  3QOP A;  2VOO A;  1GXQ A;  1LEA A;  2QVO A;  3L9F A;  4K2E A;  3BPV A;  3PQK A;  1E17 A;  5DUI A;  2EJR A;  1YYV A;  4KIG A;  4OMZ A;  3DF8 A;  4BAY A;  1S29 A;  4LJZ F;  3GXO A;  3ERE D;  1FY7 A;  1KU7 A;  1FNN A;  4LB5 A;  4EVI A;  5D8L B;  1ONV A;  3C1D A;  1DDN A;  2BV6 A;  3NRV A;  1TW3 A;  5CVI A;  1GHC A;  1YW9 A;  3LQQ A;  2LF8 A;  3T0Y A;  3IL2 A;  3KEO A;  1ZRF A;  1HXD A;  4AIJ A;  4KN4 X;  4M74 A;  1FBU A;  2R7D A;  2F5E A;  1LEB A;  3ZMS A;  3BJ6 A;  2MH2 A;  3RKW A;  3JTG A;  3HYI A;  4A5M A;  1GXP A;  2CSO A;  1YW7 A;  2VC0 A;  5L3C A;  3GX4 X;  2FEZ A;  1J59 A;  3TO6 A;  2PEX A;  3L09 A;  2OU2 A;  2COM A;  1R5G A;  1IZ1 A;  2DI3 A;  4WX9 A;  4L5I A;  2A61 A;  2CO5 A;  4HX8 A;  2EFP A;  3SQN A;  2P6T A;  5LRS A;  3HTU A;  1Z7U A;  4GGG A;  3GFJ A;  2EV0 A;  4EJW A;  3IHU A;  2JRT A;  3CTA A;  2Y75 A;  4OIO F;  2W24 A;  1XMK A;  2P5L C;  2PI0 A;  2VN2 A;  3G73 A;  5EEG A;  3GF2 A;  3WGG A;  2MH9 A;  1X3U A;  4KA4 A;  1Z9C A;  4RB1 A;  2PQ8 A;  3WGH A;  5K5Q A;  2ZO4 A;  3FM5 A;  3B73 A;  2KKO A;  2QBY B;  2P5V A;  2MLG A;  4A12 A;  3KFW X;  2QZ8 A;  2RDP A;  3VEP A;  1JXS A;  2PN6 A;  4IVN A;  2XHK A;  3LWF A;  1U5T A;  4I02 A;  2FA5 A;  1S7O A;  2O6G E;  4L0Y B;  3GZ5 A;  2ADU A;  1FP2 A;  4UV8 A;  3CUO A;  2XUB A;  5IT9 K;  4HV6 A;  4XSX F;  1WWX A;  1R58 A;  3K1M A;  2VON A;  1BIB A;  4I0B A;  3LA7 A;  3EET A;  5AIQ A;  2Q8K A;  4EJT A;  5DD4 A;  5JI6 A;  2NS0 A;  4IPA A;  1OPC A;  3NEU A;  2VXZ A;  1R1U A;  3LAJ A;  5FLX K;  1L0O C;  2D2W A;  4YG2 F;  2DLL A;  1JGS A;  1CF7 B;  5LGN A;  2RQP A;  2B0L A;  4KNY A;  4UUV A;  3R4K A;  4I0A A;  3E5Q A;  3RKX A;  3ISP A;  4ZYE A;  5EEH A;  5DUK A;  1BC7 C;  3CUQ A;  2MBF A;  2OQR A;  2FXA A;  3V8L A;  4Q48 A;  1MZB A;  3CO6 C;  4ESJ A;  1BI3 A;  3L2C A;  1BN5 A;  2BYV E;  1U3E M;  1H9T A;  1KQ8 A;  1MD0 A;  5D4R A;  3KEQ A;  2O61 A;  1F4K A;  2M8E A;  2MLK A;  4U0V A;  4E70 A;  1P4A A;  2HS5 A;  2H27 A;  4O6J A;  4CDG A;  3I53 A;  3WTW C;  2JPB A;  4LFU A;  1TQP A;  1H0M A;  2VBY A;  1P92 A;  2E1N A;  4N0B A;  4BHP A;  3GFM A;  1YLF A;  2A6E F;  4RGU A;  2C6Y A;  1ZG3 A;  2RNJ A;  1FYL A;  4CO8 A;  3VB2 A;  2P7V B;  3DPT A;  2MD5 A;  4ESB A;  3E5U A;  3O2P E;  2Y48 A;  2CWE A;  3KCC A;  2CFX A;  3RKY A;  3I58 A;  1J5Y A;  5FB2 A;  3IRQ A;  2P6S A;  3FMS A;  3V8J A;  4RGS A;  3ZMZ A;  3DXJ F;  5FD6 A;  1QQI A;  1J0R A;  2NNN A;  1BI1 A;  2M45 A;  1S7A A;  5HS8 A;  5HLH A;  1J2X A;  2HKX A;  3P9I A;  1ON1 A;  4Q5S F;  3I0T A;  3KLO A;  4ZYD A;  5D6F A;  3ROU A;  2F5F A;  1HST A;  2ZME B;  4GO1 A;  4UVC A;  1D8K A;  2HDC A;  3FHZ A;  3WTU C;  3I71 A;  1PP8 F;  4GXO A;  2LDU A;  1IRF A;  2DPU A;  1Y0U A;  3EQL F;  1QZZ A;  4WXC A;  1XSX A;  1BC8 C;  2ISZ A;  4ENN A;  2JSC A;  3V7R A;  4WXD A;  2E1C A;  4IRG A;  2XAJ A;  5A2Q Z;  2GA2 A;  3E97 A;  4KUM A;  2F2E A;  2L54 A;  2XAH A;  3C18 A;  1RZ4 A;  3CO7 C;  3QPH A;  4I7H A;  1MGT A;  1O57 A;  4MTE A;  1RUN A;  1UHM A;  2ESN A;  1JHH A;  2KJB A;  1B4A A;  1YIO A;  2X0L A;  1PDN C;  5K1Y A;  4G7O F;  3WU1 B;  3VOE A;  5LEK A;  5F1R A;  1Z05 A;  2QLZ A;  3SHF A;  1SD6 A;  3F6V A;  1IAW A;  3ZMD A;  1KQ0 A;  2DBB A;  4BQA A;  3JTH A;  4HAM A;  1SMT A;  4FX4 A;  1SAX A;  5ED4 A;  2E7W A;  4NB5 A;  5IT9 Z;  5H6Q A;  4HQM A;  2K27 A;  1XDU A;  3T5X A;  2OBP A;  1SFE A;  5ICG A;  2YX7 A;  5J6X A;  2HYG D;  1IN6 A;  1G3Y A;  2QEN A;  4XSZ F;  5DDG A;  1T6S A;  3RYR A;  1IN4 A;  3KLN A;  2XAS A;  2M1B A;  2GIV A;  2FSW A;  1HQC A;  3B02 A;  3F8F A;  4PCQ A;  1RIO H;  3E6B A;  5LHG A;  4GCV A;  2FNP A;  3WTX C;  3GYH X;  5DYM A;  5E1X A;  3ABU A;  2P8T A;  4R1H A;  2O0Y A;  3JW4 A;  2BE5 F;  3F21 A;  4UV9 A;  2VOD A;  2K7L A;  2CW0 F;  4QWQ A;  2EB7 A;  2WV0 A;  1W5T A;  4KDP A;  4EJO A;  3BPX A;  4RGX A;  4HLY A;  2V1D A;  1E2X A;  2IP2 A;  5D5V B;  2F5D A;  4L9N A;  2WC2 A;  4LGW A;  2IVM A;  2ZNZ A;  4M9S A;  4JBA A;  3ULQ B;  2M5W A;  2DTR A;  3FX3 A;  3I59 A;  2ZFW A;  2FF4 A;  4LK0 F;  1XB4 A;  1ZRC A;  2RN7 A;  1V3F A;  4MEX F;  1XSV A;  4I98 B;  4ZZL A;  3QAH A;  4XLP F;  5CVR A;  2Q2E A;  3RTR A;  2V79 A;  5CVU A;  4EM1 A;  2RGV A;  2O03 A;  4MEY F;  4BNC A;  5J8C A;  2FRH A;  3R0J A;  2WTE A;  3ZMU A;  3R6S A;  1U6G A;  3IWZ A;  3WE3 A;  3BZ6 A;  1J75 A;  3LST A;  3CUQ C;  1D3Y A;  2E7X A;  3MCZ A;  5CJ9 A;  3IWF A;  4WCG A;  4HYE A;  3ZQ7 A;  4EM2 A;  3PFI A;  2KIM A;  3I5U A;  2PBI A;  2VT2 A;  2QWW A;  5HDK A;  3TQN A;  5K5O A;  3K1N A;  4CXF A;  1FSE A;  4U0W A;  1H9G A;  3MWM A;  4L9J A;  5HLI A;  2JPC A;  2YPR A;  2Q0O A;  1FZP B;  3K1P A;  4RB3 C;  4GYG A;  3F72 A;  5DV5 A;  3HUG A;  5ICF A;  1T2K A;  5ILV A;  3J80 Z;  2VBZ A;  3MZY A;  1R1T A;  4A0Z A;  1KU9 A;  2IPQ X;  5ILU A;  3KP6 A;  2X4H A;  5CVV A;  4OU0 A;  4ZH4 F;  4UHT A;  3WTZ A;  1YQA A;  2K4B A;  1MJB A;  2R7F A;  5ICC A;  3TKY A;  1R00 A;  1W5S A;  1LDK B;  5D4S A;  2H09 A;  1T39 A;  1R1V A;  3I54 A;  4L18 B;  5FD5 A;  1TNT A;  3RPQ A;  3EUH A;  1T0F A;  3LA3 A;  1FT9 A;  4BHB A;  1SMY F;  2LSO A;  5LLQ A;  3HRT A;  2L4A A;  4ESF A;  3ZP5 A;  3CDH A;  5FLX Z;  1IN8 A;  2OZU A;  2A5Y B;  2M87 A;  2LF7 A;  1SFU A;  3TO7 A;  4KFC A;  3TDU C;  3LFK A;  3Q5F A;  3ABT A;  4PGG A;  2EFW A;  3GVA A;  3IKT A;  3T1B A;  4CHU A;  4EJV A;  1ULY A;  1O3T A;  2HKO A;  3VFZ A;  1B9N A;  2BEO A;  4OIQ F;  5DCM B;  3D0S A;  4A6D A;  3I64 A;  2QQ9 A;  4HZF A;  4P55 A;  3HRU A;  2QQA A;  3EDP A;  4ENK A;  1QZY A;  4HLX A;  2H94 A;  2EFN A;  1Q1H A;  1G3T A;  3S2W A;  3F6O A;  4MGR A;  3K69 A;  1LJ9 A;  3J81 K;  4YIF A;  5BS6 A;  3T8R A;  1MJA A;  3QU3 A;  1YG2 A;  2AS5 F;  3WE2 A;  3HTS B;  2HR3 A;  2DO7 A;  1T98 A;  2YSR A;  2A6H F;  4PZJ A;  1RNL A;  4ZYH A;  2DFI A;  1B9M A;  5J8F A;  1XGN A;  2EFO A;  3NQO A;  1I1S A;  3TOB A;  1I27 A;  1R23 A;  3R61 A;  4A2U A;  2STW A;  2JZY A;  4HOB A;  4RGR A;  1K78 B;  2ETH A;  1QBJ A;  4HF2 A;  1YTY A;  1R7J A;  5HS7 A;  4A6E A;  3F8M A;  3TDZ C;  2UXX A;  1ZN2 A;  1VTN C;  2CG4 A;  3F8B A;  3IKV A;  4LLL A;  4L9V A;  3WOD F;  3QU6 A;  3TGN A;  3BWG A;  1TW2 A;  2V1U A;  4G6Q A;  2EFQ A;  2FBH A;  1TTY A;  5LHH A;  1U2W A;  2DU9 A;  4S05 A;  3FMQ A;  2LKP A;  1ZHF A;  2DT5 A;  2OAZ A;  3DV8 A;  1BI0 A;  5E20 A;  5BPD A;  2VE8 A;  3RPU A;  4HDU A;  1OR7 A;  3FM3 A;  2L4M A;  1K6O A;  3JSO A;  3PQJ A;  1B1B A;  3F8N A;  5D6E A;  2NAZ A;  1SD7 A;  1G3W A;  1U5T B;  4HV5 A;  5BQT A;  1S6L A;  4M72 A;  1O3R A;  2K02 A;  1G4D A;  4Y13 A;  3KZY A;  2A3S A;  2HTJ A;  2UZK A;  2V9V A;  4RB0 A;  1JE8 A;  2XIG A;  1TLH B;  3HRS A;  2H6C A;  1K78 A;  4HA8 A;  3RIR A;  2GXG A;  5E1W A;  1S8N A;  1YO5 C;  4XRF A;  3HSF A;  5HDG A;  2YR2 A;  4OMY A;  1ZRD A;  1W7P A;  4M9X A;  3WGI A;  2K86 A;  3RYP A;  1OYW A;  5IT3 A;  1YW8 A;  4M6Y A;  2AXL A;  4ENJ A;  4EQQ A;  1UHW A;  1HW5 A;  2QM3 A;  5KVR A;  4DNC A;  1QNT A;  3E3V A;  4MNU A;  5L3G A;  2L3D A;  1O7F A;  5H6R A;  1R22 A;  3JAM K;  3U1D A;  2Z33 A;  1OMI A;  2GA1 A;  1HW2 A;  3N97 A;  3TOA A;  1R5H A;  2IT0 A;  3WTV C;  3H3Z A;  1K79 A;  3E6M A;  2FOK A;  1AWC A;  3AAF A;  1ZLJ A;  4A5N A;  4KMF A;  4O3M A;  1Z6T A;  5DCM A;  2R3S A;  5CYV A;  4EGY A;  4I09 A;  4LLG F;  3OOP A;  3GZ6 A;  2VOP A;  2GXB A;  1F5T A;  1R36 A;  2PMH A;  4PDK A;  3GO5 A;  4L5J A;  1XD7 A;  2FU4 A;  1IN5 A;  3P9K A;  4G9Y A;  2TDX A;  4U88 A;  3WTY C;  5LHI A;  4HDV A;  2EA2 A;  4FT8 A;  2YU3 A;  2HEO A;  2GZW A;  4XLN F;  3MEX A;  1BI2 A;  1ZH5 A;  3DQV C;  1IW7 F;  3QP5 A;  1FPQ A;  2W85 A;  2JT1 A;  3DPL C;  2QUF A;  2A69 F;  3GLX A;  1NHA A;  2EV6 A;  2QQB A;  2RC4 A;  4IHT A;  3Q9V A;  3M1E A;  2XRN A;  1ZG1 A;  1OKR A;  2NNY A;  1DP7 P;  4HX4 A;  2EA4 A;  2GAU A;  3M8E A;  4HW0 A;  1A04 A;  3J80 K;  1P4W A;  2DW4 A;  3BOQ A;  1KGS A;  2G7H A;  1YS7 A;  1ODD A;  1IXR C;  1DPU A;  2Z5U A;  2IRF G;  2XGX A;  5HLG A;  1HBX G;  1OYI A;  4AVP A;  4R79 A;  1S3J A;  1SD4 A;  1ZGA A;  2DPD A;  4LG0 B;  2FE3 A;  5D5U B;  4OIR F;  4LMY A;  4LB6 B;  3GWZ A;  2ZBK A;  4RAZ A;  3EYY A;  4YII A;  3JSP A;  1F1Z A;  4G94 A;  4P5O A;  1UB9 A;  2Z3Y A;  3U9G A;  2Z9O A;  1ZGJ A;  5FFX A;  4MHG A;  1TNS A;  3RDI A;  5HOO A;  2ZCW A;  5BPI A;  1F9N A;  3KP7 A;  4BYY A;  1FLI A;  3BJA A;  2HYF A;  3VOD A;  2MA3 A;  3HOS A;  5JHU A;  3GEZ A;  1XCV A;  4MQ9 F;  5FGM A;  5ERI A;  1XGS A;  2P4W A;  3BJO A;  4EV0 A;  4A0X A;  5LBQ A;  4PGH A;  4UVB A;  5FO5 A;  1P2F A;  4LD5 A;  1Z91 A;  4GYI A;  4WK8 F;  5DCF A;  3RI4 A;  4YFK F;  2HFH A;  2D45 A;  3REO A;  3C7J A;  2VE9 A;  5E1Z B;  4BH9 A;  1FOK A;  4Y17 A;  4EM0 B;  2P7C B;  4UNO A;  4M71 A;  4IHS A;  4KYW A;  2OQG A;  3H3U A;  1WKM A;  2J5O A;  1I5Z A;  2ZXJ A;  5BOX A;  1U78 A;  1LNW A;  2O8X A;  5CLS A;  3SFZ A;  3HHG A;  3QP6 A;  3D5L A;  4EJU A;  5L3E A;  3ZPL A;  3ELK A;  2KIF A;  4FX0 A;  5JVT A;  3KP5 A;  4OIN F;  2FQ3 A;  4G6D A;  2A07 F;  4KIB A;  3J7A O;  2ZME A;  3COA C;  1FYM A;  2HQR A;  3FXU A;  2V1X A;  5CVJ A;  1FYK A;  4U7D A;  1USS A;  4L9T A;  3MAJ A;  1GVJ A;  4Z2Y A;  4IXA A;  3SXY A;  4WWC A;  4UXN A;  2XKO A;  1LB2 A;  5H20 A;  3FWE A;  2GQQ A;  2BGC A;  4NQW A;  3GW2 A;  2G9W A;  4DQ2 A;  2L01 A;  1FC3 A;  2G7U A;  4M6X A;  5D5W B;  1IUY A;  4NHJ A;  1FX7 A;  2FML A;  4AIK A;  1BIA A;  1V4R A;  3Q9S A;  3CLO A;  4RS8 A;  1W7P D;  1YFH A;  2HGC A;  5DD8 A;  5AON A;  1WI9 A;  2VBW A;  2NRA C;  2XAF A;  3HSR A;  1DPR A;  2W84 A;  4P96 A;  1O3S A;  2EWN A;  1XGM A;  4HBL A;  2FBI A;  4EMS A;  3HOT A;  5BMZ A;  3WG9 A;  4WF2 A;  1QO0 D;  1ON2 A;  3KP3 A;  3V4G A;  1JHF A;  2DQR A;  4Q4Z F;  3K2Z A;  3ZMT A;  3KZZ A;  1MDM B;  2XRO A;  3G3Z A;  1ZAR A;  1FWZ A;  4HX7 A;  3SZT A;  1W7P B;  5JFR A;  2HZT A;  3CUQ B;  4KIC A;  3E5X A;  2CQK A;  1EH7 A;  4ENM A;  2PLY A;  5DEQ A;  1BBY A;  3JAM Z;  3FZV A;  3M7G A;  4D0P A;  3F22 A;  5L3F A;  1WRJ A;  1AOY A;  3IC7 A;  1EH6 A;  2GWR A;  5L3D A;  5HVQ C;  2IA2 A;  3T8T A;  2KRF A;  5E18 F;  4B8X A;  1KYW A;  1RUO A;  1ZAO A;  4IRI A;  2BBY A;  4IF4 A;  3V7C A;  3MFK A;  3U2R A;  3F23 A;  1L3L A;  4G7Z F;  3WTT C;  4CIC A;  4AIH A;  2CGP A;  1STZ A;  2O3F A;  4WXH A;  3QPT A;  1FBQ A;  2ESH A;  4KN7 X;  5HS9 A;  1PUE E;  1HKS A;  2OZ6 A;  1OYY A;  3M9A A;  3WTS C;  3MQ0 A;  3CJN A;  4ZZD A;  1TQM A;  1P4X A;  2HTS A;  3HSE A;  4O5V A;  1XDS A;  2H6B A;  2L02 A;  2PJP A;  2K4J A;  1QPM A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...