2UZKA

Crystal structure of the human foxo3a-dbd bound to dna
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
97
structure length
97
Chain Sequence
b'MGNLSYADLITRAIESSPDKRLTLSQIYEWMVRCVPYFKDKGDSNSSAGWKNSIRHNLSLHSRFMRVQNEGTGKSSWWIINPDGGKSGKAPRRRAVS'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords FORKHEAD BOX PROTEIN O3A
publication title Crystal Structure of the Human Foxo3A-Dbd/DNA Complex Suggests the Effects of Post-Translational Modification.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription
total genus 16
structure length 97
sequence length 97
chains with identical sequence C
ec nomenclature
pdb deposition date 2007-04-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00250 Forkhead Forkhead domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2uzkA01
3I54A 3V7CA 1FOKA 1IRFA 4L9VA 5ED4A 1XMAA 4M6XA 2W57A 4KMFA 4IHTA 3ZMVA 4XSZF 2EWNA 3M7GA 1K7AA 5HS8A 2PN6A 3GFJA 5LGNA 3LQRA 5LRRA 4BHCA 3BDDA 4I0AA 4HF2A 3I59B 2NNYA 3J80Z 4P9FA 2M87A 3JW4A 1U78A 1YQAA 2LKPA 4YFXF 1XGMA 3H3ZA 2BGCA 3L9FA 3MZHA 5HS7A 2Z5UA 2ZMEA 1T98A 2NNNA 4ESBA 3C18A 3ZMZA 2EFPA 2PI0A 1O57A 1Z91A 2MLKA 5HDGA 4M74A 1F9NA 4A6DA 1QO0D 4Y13A 4EJVA 3BOQA 3REOA 4EMSA 1YLFA 5FGMA 4MGRA 1OYYA 3G3ZA 3WTYC 4HX4A 3Q9SA 4UHTA 3ML6A 3H3UA 2FNAA 2VBWA 2XAHA 3IWZA 1S6LA 5HDNA 1ZYRF 1DP7P 1E2XA 4AWXB 3T5XA 3F8BA 1BOAA 1TW3A 4HAMA 1HKSA 4PGGA 1XSDA 1K78B 1REPC 1SAXA 3IL2A 4WK8F 4YIIA 1K6OA 1MJBA 3T8TA 3WGGA 1JXSA 3BP8A 3GZ6A 1MKMA 2O6GE 1I27A 4UUVA 2LF7A 4HV6A 2BV6A 3IWFA 1I5ZA 1QGPA 2CWEA 2KIMA 1O3RA 1XDUA 4LGWA 3OV8A 3RPUA 2L01A 3M9AA 5LHHA 4KN7X 1BIBA 3WU0A 2P7CB 2IJLA 1S3JA 4A6EA 5E18F 3VOEA 4ENKA 4N9IA 1IXCA 2VONA 2QVOA 3TKYA 5L3EA 2FBIA 2P5VA 5CVRA 5TRDA 4M9ZA 2QYOA 4KT5C 2DTRA 2FMLA 1MDMA 3V7SA 3K1MA 2FU4A 3KP7A 5FFXA 2RQPA 2KIFA 5FO5A 1R7JA 2OQGA 3JSPA 1IXSB 1UFMA 1OKRA 4RGUA 2XROA 1H9TA 1TBXA 3F23A 1KU3A 4PDKA 1B4AA 1EH8A 2G9WA 2Z9OA 1KQ8A 4EGZA 1DDNA 2LSOA 1WQ2A 2A3SA 2ELHA 1ZH5A 4IPAA 2DQLA 2EFNA 4BQAA 4RGRA 2EK5A 2UZKA 4ZYGA 1FYMA 5IT3A 1U3EM 3P9CA 1R36A 3EUHA 2PMUA 5F1RA 3GFLA 1SD4A 2IVMA 3MWMA 4WXDA 1R23A 5E8IA 3RDIA 2IT0A 4RB2C 1ZAOA 2BEOA 3KP3A 4IRHA 4IRGA 2RV8A 1HXDA 1ONVA 2HDCA 4UV9A 2W24A 1Y0UA 5K5QA 2HKOA 2CO5A 2ZCWA 3KZZA 1FWZA 4KIFA 3F8NA 4G9YA 2DI3A 1RI7A 2KKOA 1QQIA 4I2OA 1ZLJA 1BN5A 2EFOA 5DUKA 3K0LA 3WE2A 2ISYA 4R8HA 1YTYA 1V4RA 1LDJA 5BOXA 4Y17A 3TO7A 5D4SA 4Q47A 4LFUA 5D4RA 1S7AA 3KE2A 1D8KA 5L3CA 1EH6A 3KP4A 1JE8A 4KIBA 5LHGA 4HV5A 3RKWA 1T6SA 4Q48A 2FOKA 5L3DA 4EVIA 2D45A 2YX7A 1J2XA 1JHHA 2JRTA 2YU3A 2XAJA 4FT8A 4PGHA 4IF4A 2P7VB 2ACJA 3CJNA 4BYYA 3D5LA 4LJZF 1R5HA 2GA1A 4WX9A 1RUNA 5BMZA 1ZRCA 1ZLKA 2X0LA 3QP6A 1XGOA 2LDUA 3I5UA 3QPTA 3GFMA 3SZTA 4LLLA 3GVAA 1WI9A 3SQNA 4KFCA 2UXXA 4XSXF 4KN4X 4M72A 4L5JA 3E6BA 3SHFA 3DEUA 4KNYA 1ZG3A 1HW5A 1ZN2A 1U8RA 5FB2A 2MBFA 4XLPF 1KGSA 1HSTA 1DPUA 1DPRA 1ZRDA 3CUQA 1FZPB 3C3WA 2PEXA 3QPHA 1XCBA 2FXAA 4Q4ZF 5F6FA 3BPVA 2XV4S 3WGIA 3SXYA 1MGTA 1BI0A 1KQ0A 3ABUA 5E1ZB 1BI1A 4G94A 2O3FA 3TOAA 1T38A 5DD8A 2ZFWA 1O7FA 2RDPA 2ZXJA 1SMTA 2ZMEB 3GYHX 4WF2A 3DV8A 1W5TA 2F5FA 1IUYA 1IRGA 4Q5SF 3I4PA 3TQNA 3V8JA 1XD7A 1HQCA 1HKTA 1OR7A 3I64A 2O03A 1FPQA 5D6EA 2EV6A 3CO6C 1MD0A 1ULYA 2QZ8A 3J7AO 3OOPA 1L0OC 2JPBA 3ISPA 5BPDA 1U6GA 3ROUA 4O3MA 4A2UA 4OIRF 5D5UB 3F8CA 2R7FA 3VODA 1JGSA 3HRTA 3ZMTA 1DUXC 5LGTA 1FC3A 1LDDA 2EA2A 4CZZA 3QU6A 3JAMZ 4FX4A 4RAZA 2A68F 3ZN1A 3P7NA 1YFHA 2X4HA 1W7PD 2HGCA 2J5OA 1P4AA 3GW2A 1FP1D 1Z6RA 1C0WA 1P92A 1QNTA 4HA8A 2MA3A 2E7WA 3O2PE 4ON0A 1USTA 1CF7B 2IP2A 4ZYHA 2QBYA 5E17F 3WTSC 1S8NA 5E20A 5LLQA 2L4MA 3VB2A 3F6OA 5KVRA 3FXUA 4YIFA 3LSTA 1ZHFA 2GWRA 1D3YA 4Y15A 1GVJA 5AIQA 2GQQA 5TJJA 1IXRC 3IKTA 1I1SA 4HDUA 2UXNA 1FY7A 3R0JA 4BAYA 2ADUA 2VC1A 2XKPA 2QQ9A 1CGPA 1B9NA 5HLGA 2EFWA 1G3YA 3HYIA 2WC2A 3BY6A 2VOOA 2IA1A 2GZWA 4EGYA 2B0LA 4OU0A 2F5EA 2ZNYA 3FM3A 2H6BA 4OMZA 3VEPA 2VE8A 3E5UA 4LG0A 4P5OA 4U88A 2XKOA 2DT5A 5FLXZ 3Q5FA 1ON2A 5CVVA 5DDGA 3JAMK 4GYIA 1KU2A 4RGXA 2OD5A 1XN7A 4A5NA 2DPUA 1OYIA 2JZYA 3CUOA 4BNCA 1IN7A 2Y48A 1QZZA 5ICFA 1BJAA 3IC7A 5DCMB 1ZREA 1OYWA 3DQVC 3ZMUA 4U0YA 5CVJA 3F3XA 2WTEA 3JTGA 2MD5A 2V6CA 1LNWA 3E5XA 4HQEA 4L0ZB 3EETA 2PMHA 5L3FA 1S7OA 3PFIA 4I09A 3QOPA 3SFZA 3ECHA 2FBHA 1IN4A 3WTZA 1LJ9A 3MFKA 5L3BA 2O8XA 3FMSA 2NRAC 4RS8A 3V8KA 1BM9A 3K9TA 4YFNF 3U9GA 2HR3A 3LWFA 2HYGD 2IPQX 4AIJA 3FMQA 5FLXK 3COAC 4XRFA 1IF1A 1TLHB 4AIHA 1BC7C 3L09A 4UNOA 3T8RA 2Z99A 2DFIA 3MQ0A 1BIAA 4M73A 3LA2A 3IRQA 2VBYA 2XHKA 3TGNA 1GXQA 2WWYA 2OBPA 3W6JB 2AS5F 3QAHA 4OINF 1WKMA 1XMKA 2ETHA 3CDHA 2QUFA 3PQKA 2OQRA 5DD4A 1F5TA 1U5TC 3CUQC 5HLIA 2HKXA 1XCVA 3WTUC 1TQMA 2D1VA 3AAFA 4MNUA 2FBKA 4EJOA 2CGPA 4PCQA 5J8CA 1AWCA 1IN6A 1SMYF 4MEXF 5D5VB 2OZUA 4CGZA 2M30A 4ENMA 4IHSA 4ZYEA 5HLHA 1R58A 5LHIA 2V9VA 2A69F 2RVCA 4L18B 2K7LA 4U0WA 1B6AA 3R61A 2FE3A 3BPXA 4N9HA 1JHFA 1VTNC 4CXFA 1G6NA 1OMIA 2IW5A 2R3SA 4IXAA 3N4MA 5J6XA 4R1HA 3T1BA 4JBAA 1W7PB 2DQRA 3E97A 3U2RA 5IT9Z 3FM5A 3P9KA 2W25A 3LQQA 2M1BA 4ENJA 2F2EA 5E8GA 4QWQA 1WSUA 1FBQA 2MC3A 5F64A 2Q8KA 2JPCA 4OIQF 3HTSB 2XASA 5ILVA 1IZ1A 4I02A 3HHGA 3J81Z 3ZQ7A 1T39A 3BJ6A 4LLGF 4HYEA 1P6RA 3H92A 2O61A 2GIVA 1YIOA 3PQJA 2RGVA 2PBIA 1GHCA 3HTUA 1XGNA 4YG2F 4G7HF 5DCFA 3R60A 3GFIA 2ISZA 1K78A 2ZKZA 1FYLA 3W6KB 4NB5A 1J59A 1KYZA 1A04A 3Q9VA 3N97A 1WRJA 1H0MA 1B9MA 2XRNA 1O7LA 1I1GA 4AVPA 3WE3A 2L3DA 4U7BA 3QRFF 1YG2A 1RIOH 5KK1A 3MEXA 2K02A 1W5SA 2LF8A 3DKWA 1B59A 2H6CA 1SD6A 5IT9K 5D5XB 1Z7UA 3GZ5A 3E6CC 2O0YA 1S29A 3HHHA 4MHGA 2VN2A 2XAGA 4I98B 4KA4A 1D8JA 3GO5A 2VT2A 3KETA 1Q1HA 2HFHA 3DP7A 4L9JA 2EA4A 4KMUX 3J81K 3IKVA 3WU1B 2KRFA 5JR3A 2YR2A 4G8XA 3KLNA 1Z9CA 3V4GA 4RB1A 2YX4A 2PQ8A 2QBYB 3RI4A 3FMRA 3E3VA 3I71A 4ASNA 2PJPA 1FBUA 3P9IA 3I53A 3F72A 3QU3A 2D2WA 2A07F 5ERIA 4HLYA 4MTEA 1UCRA 4G7ZF 3MZYA 2DBBA 2XUBA 4E70A 3RKXA 5CVUA 4HBLA 4FX0A 2XVCA 3RTRA 1L3LA 2CYYA 3L7WA 3ZP5A 5LRSA 4CICA 1ZG5A 1U5TA 1W4MA 4LLNA 2VOPA 1MJ9A 2R7DA 4L0YB 3WG9A 2VBZA 3TO9A 5FD6A 2H09A 4A0ZA 4JQFA 3MCZA 3WTTC 2FRHA 3EQLF 1SFUA 2A61A 2NAZA 2QM3A 5D6FA 1XDSA 3HSFA 1P2FA 4OOIA 4D0PA 3HOSA 2KJCA 2KIUA 3F22A 2K4BA 4GCVA 2K27A 5JHUA 3B02A 4A0YA 1KU9A 5FFZA 1YYVA 3KEOA 1OPCA 3DPLC 1LVAA 4ZYDA 2OU2A 5D8KB 2VODA 2JT1A 2UWMA 5K1YA 5EEHA 2HS5A 2AXLA 4O6JA 1ZRFA 4KIGA 2MLGA 3LA3A 2VC0A 3K69A 2NS0A 1IN8A 3WTWC 2V1XA 4EM2A 4RB0A 2STTA 2CQKA 3GXOA 5HS9A 4O5VA 1BI2A 3RYPA 1K79A 4RB3C 2MH2A 4OMYA 3RPQA 4YFKF 2EV5A 2DW4A 4MQVA 4JK1X 3M8EA 2ZBKA 4DQ2A 2J5PA 1FP2A 4HF1A 4CDGA 2DLLA 1XGSA 2P8TA 3S2WA 3U1DA 1PP8F 5CYVA 4NQWA 4CO8A 2ZO4A 1QBJA 4CYDA 3R4KA 2Q0OA 4CHUA 4EQQA 4LD5A 1KQ9A 4NHJA 1RZ4A 3GLXA 2DK8A 3F8MA 4H0EA 1RNLA 1J9IA 1O3SA 1MDMB 4HOBA 3MAJA 1KA8A 4ZH4F 1YW7A 2FQ3A 5DUIA 2GXBA 2V1UA 2EJRA 3V8LA 2L02A 4M9SA 2IRFG 3O6BB 4G7OF 4WWCA 5EEGA 4KDPA 5CLSA 2A6HF 4HDVA 1FSEA 2YPRA 3HSRA 3QP5A 3LA7A 3BWGA 3K1PA 3R6SA 3ELKA 1G3WA 3GF2A 2IA2A 1FBSA 2Q2EA 3DFGA 5JFRA 3FHZA 2V79A 3EYYA 4HF0A 4I0BA 1TW2A 4R79A 3IHUA 1TTYA 1G3SA 1J0RA 2L54A 3BZ6A 1RUOA 4GGGA 3WTXC 3DPTA 3KP6A 2DPDA 1HW2A 3HOTA 1ZGJA 2EB7A 4UVAA 2E1CA 1P4XA 4EJTA 4QLCU 3KP2A 4L9NA 2FNPA 3TOBA 4G6QA 3LAPA 4M71A 4MEYF 1T2KA 2GAUA 3WGHA 2HQNA 1TQPA 2PLYA 4P55A 5K5OA 5LGUA 1R1UA 1G3TA 5BPIA 1YO5C 3WTVC 5HDKA 2JTVA 5A2QZ 4EJUA 2Y0MA 3TDZC 1IAWA 2ESNA 3ECOA 1ZG1A 4GYGA 2DAOA 1TNSA 3T0YA 3RIRA 5ICCA 1HW1A 1LQ1A 3KZYA 6PAXA 3NQOA 1UHMA 2CSOA 2EFQA 1YS6A 2ZJ2A 2M8EA 1YW8A 3J80K 3GEZA 4GXOA 1LDKB 4L5IA 1MJAA 1FLIA 5BS6A 4M6YA 1Z6TA 3LAJA 1ZARA 4UVCA 2HTJA 2A6EF 3ABTA 1CF7A 2CW0F 2QQAA 5AIPA 2P6TA 2DK5A 4L9TA 1USSA 1EH7A 4FHTA 3LFKA 1J5YA 2W85A 1T0FA 2HQRA 3KP5A 4LK1F 5DEQA 4KYWA 1UHWA 1FNNA 5LBQA 2G7HA 2HTSA 2GA2A 1R1TA 4F7ZA 3GX4X 4BH9A 2H27A 3DF8A 5K5RA 1J75A 2RC4A 5A2QK 5D8LB 4UV8A 4K2EA 4HLXA 2W84A 3HIFA 3FXRA 2DU9A 4P96A 2HOEA 3C1DA 3I59A 2FSWA 4ESFA 3E5QA 2E7XA 2HZTA 3HSEA 1BBYA 3FWEA 3R0AA 1J7KA 1FSHA 4IJAA 4AIKA 1F4KA 1WWXA 3BJAA 1HSJA 3SZPA 1QZYA 1PDNC 1R22A 3M8FA 4EM0B 3EYIA 5HVQC 2CFXA 1U5TB 3CUQB 4KUMA 5LEJA 2OAZA 2STWA 5BQTA 2BYVE 5DCMA 4U0VA 3ZN0A 4ENNA 2Z3YA 2QQBA 4B8XA 4IRIA 5CVIA 1MZBA 4MTDA 4HX8A 4I01A 4HX7A 2E1NA 1XSVA 1XB4A 3G73A 1P4WA 4U7DA 3EDPA 4DNCA 5DYMA 2K4JA 2IA0A 5H20A 5H6RA 1FYKA 4G6DA 3WODF 3DXJF 4WXHA 1TQIA 2FMYA 2RN7A 2JSCA 1TNTA 4B09A 2OA4A 1I6XA 4RAYA 4HQMA 5DV5A 2F5CA 1H9GA 1LEBA 4BHPA 5E1XA 1KU7A 2YSRA 1IN5A 3CLOA 4LK0F 5ILSA 3CO7C 2M45A 1ODDA 1HBXG 3ERED 5JI6A 3KEQA 1BC8C 2KJBA 1Z05A 4I7HA 3D0SA 3TDUC 1O3TA 1G4DA 2CG4A 1V3FA 4WCGA 2P5LC 3F21A 3JTHA 4S05A 3F6VA 3I0TA 3FZVA 3K1NA 2FF4A 4A12A 2ESHA 4KICA 3CTAA 4OIOF 3KFWX 1AOYA 2D1HA 3E6DA 2MH9A 2FA5A 4ESJA 1U2WA 1PUEE 4A5MA 1D5VA 5L3GA 4GO1A 1GXPA 3I58A 1HKQA 2LNBA 5AONA 4UVBA 1R1VA 3ZMSA 2HEOA 2BBYA 3HRMA 2EV0A 4ZZDA 2RNJA 5ICEA 2GXGA 3BJOA 5J8FA 3HRUA 3ZPLA 5CJ9A 1F1ZA 1R5GA 3M1EA 1Z1DA 1UB9A 5ILUA 3RJPA 1LB2A 4OIPF 3VFZA 4A0XA 1E17A 2COMA 3FF5A 4WXCA 2HWVA 5FD5A 1SD7A 2Z33A 1ON1A 2F5DA 1SD5A 2ZNZA 2PG4A 4EV0A 1W7PA 2XAQA 4M9XA 4BXUA 3L2CA 1ZGAA 1YW9A 4P9UA 2QENA 5H6QA 3HRSA 2WV0A 4LG0B 4HZFA 2DO7A 4LB6B 4LB5A 2FEZA 4RGSA 3GWZA 2M5WA 2RKHA 1O3QA 2NYXA 5E1WA 1IW7F 2VE9A 4UXNA 3GUDA 4IVNA 3F8FA 3FX3A 3ULQB 3IRRA 3NEUA 3L00A 5LEKA 2XAFA 3KLOA 3K2ZA 1B1BA 1YS7A 5JVTA 2P4WA 3E6MA 3NRVA 4PZJA 1FX7A 4LMYA 5HOOA 4MQ9F 3BROA 2VBXA 4EJWA 2OZ6A 2H94A 2XIGA 1R00A 1SFEA 1XSXA 2V1DA 2HYFA 2L4AA 1STZA 2P5KA 2A5YB 4ZZLA 2K86A 3JSOA 3KCCA 1NHAA 4HW0A 1LEAA 4TV7A 3O3KA 2TDXA 2BE5F 4AD9A 1BI3A 4Z2YA 3HUGA 1X3UA 2P6SA 1SFXA 2VXZA 2G7UA 1FT9A 4XBFA 2VT3A 4N0BA 5ICGA 3B73A 4EM1A 2PFBA 1PP7U 2C6YA 2QLZA 4ETSA 3TO6A 4XLNF 1EV7A 2XGXA 3RKYA 1QPMA 3FXQA 3RYRA 4S04A 3V7RA 3C7JA 4BHBA 3ZMDA 1KYWA 5D5WB 2Y75A 2QWWA
chains in the Genus database with same CATH superfamily
3I54A 3BG3A 4PFOA 3V7CA 1FOKA 1IRFA 4L9VA 1MW7A 5ED4A 1XMAA 4AUXA 5FRMA 4M6XA 2W57A 4KMFA 4IHTA 3ZMVA 4XSZF 2EWNA 3M7GA 1K7AA 5HS8A 2PN6A 3GFJA 5LGNA 2UV1A 3LQRA 5LRRA 2M2EA 4BHCA 4D5CA 3BDDA 4I0AA 4HF2A 1QZEA 3I59B 1HLVA 1VQOI 2JA5J 2NNYA 3J80Z 2X6OA 4P9FA 3CCSI 1RESA 4BUPA 2M87A 3JW4A 3PNVA 2VKEA 4DIQA 1YQAA 2LKPA 3NAUA 1U78A 4H4KC 1XGMA 1WJDA 4YFXF 3CZ6A 2BGCA 3H3ZA 4E7JA 4DW6A 2JUGA 2Z1DA 3L9FA 3MZHA 5HS7A 1JJ6C 3S1QJ 3H5RA 3GTQJ 2Z5UA 1LVKA 2ZMEA 2F6CA 4MFEA 1T98A 2V1NA 2KL4A 2NNNA 4ESBA 1UELB 3C18A 2ELJA 3ZMZA 2EFPA 4DYRA 1O57A 1Z91A 2ZXIA 1T8IA 2PI0A 2MLKA 3VPRA 4A3GJ 5HDGA 4M74A 1F9NA 2KDOA 4XL9A 1WFXA 3OS1A 4A6DA 3PO2J 1QO0D 3OOUA 3MVPA 4Y13A 3OL3A 1WJBA 3BOQA 1G8XA 4EJVA 1IDYA 3H0GJ 3REOA 2Y0SA 4EMSA 1GV5A 1XMXA 2E1OA 1YLFA 3RKQA 5FGMA 1MSFC 4MGRA 1OYYA 3G3ZA 3WTYC 4HX4A 1UG0A 5FKNA 3Q9SA 4YRVA 3IAS2 2K9SA 4MO7A 3M4OJ 4UHTA 3ML6A 5JLXA 3H3UA 2FNAA 2VBWA 4PSXA 4XOPA 5EG0A 2R0QC 1K4SA 4BQOA 1EJ9A 3CC4I 1MMNA 2XAHA 2NVUB 2HNHA 3UR3C 1MMDA 3IWZA 2MFZA 4A3IJ 1JI8A 1E3PA 3RQ4A 1S6LA 2FX0A 1ZYRF 5HDNA 3DLAA 1E3HA 1DP7P 3BTCA 1E2XA 4AWXB 2E60A 3T5XA 3F8BA 1YRNB 1BOAA 1TW3A 2W7NA 4HAMA 1HKSA 3A01B 3CCMI 4PGGA 1XSDA 1K78B 1REPC 1ETYA 1SAXA 3S16J 3IL2A 1YOVB 1W36C 4WK8F 2DA3A 4YIIA 1K6OA 1MJBA 3PUBA 3T8TA 4F3QA 1Y56A 3WGGA 3BP8A 1JXSA 5M5WJ 4XNFA 3GZ6A 1MKMA 2O6GE 1MSEC 4FQGA 2IS6A 5EZGA 1I27A 4UUVA 2LF7A 4HV6A 1SANA 2BV6A 3IWFA 1I5ZA 1QGPA 4MLOA 2CWEA 2KIMA 3OWTA 3J7YJ 1O3RA 1XDUA 4LGWA 3I4MJ 3OV8A 3VWBA 2Q1ZB 4N4NB 1WH5A 2O7OA 3ASNH 3BTIA 1V5EA 2M4KA 3I3LA 3RPUA 1IG7A 3CF2A 2L01A 3CF5F 3M9AA 3DEWA 5LHHA 4KN7X 1VQ6I 1BIBA 3WU0A 2QSGX 2P7CB 1X2MA 1T08B 3S3OA 1RR7A 2IJLA 1VQNI 5FLVA 1S3JA 4A6EA 5F0FA 5E18F 3VOEA 4N9IA 4ENKA 1IXCA 3OIPA 4BBRJ 2VONA 2QVOA 1FIPA 3K4JA 3TKYA 2P0WA 2FBIA 3DBRB 5L3EA 1H8AC 2K40A 2JA7J 4A3LJ 2P5VA 5CVRA 5TRDA 4M9ZA 1NTCA 2BVMA 2XSDC 3HOVJ 2QYOA 3H5NA 1YJWI 1MIJA 4BJ6C 4B44A 1OCPA 4KT5C 3SFIA 2DTRA 2FMLA 1MDMA 3V7SA 3K1MA 2FU4A 3GTOJ 1WHUA 4W1UA 4YELA 4HG2A 4A3DJ 5F0HA 4BE1A 2QA4I 3KP7A 2JA2A 3C2GA 5FFXA 2RQPA 3KYCB 5DM6F 2KIFA 5FO5A 1JTYA 1R7JA 2OQGA 4XQFA 3JSPA 1IXSB 2NVXJ 1UFMA 1NK3P 3VYTB 1OKRA 1W5CC 4RGUA 2XROA 1H9TA 4LOCA 1TBXA 3F23A 4HSTA 2MG4A 2DDBA 1KU3A 4PDKA 2LRDA 1B4AA 1BW6A 3L2UA 1V55H 1EH8A 2WB1A 4I99C 2G9WA 2Z9OA 4I6ZA 3CD6I 4XORA 1S7EA 1KQ8A 4EGZA 2BY2A 3FISA 1MMSA 3K4NA 2VLAA 4GRIA 2DTZA 5CQGA 2EZHA 2PX9A 4RMNA 2MYSA 1DDNA 4ZDLA 2LSOA 4JX4A 1WQ2A 1HOMA 2A3SA 2ELHA 4II2A 4BL0B 1XTAA 4IPAA 1ZH5A 2GOXB 1LKXA 2ZJRF 2DQLA 3H36A 1OR7C 2EFNA 4QIWN 4RGRA 4BQAA 2K9LA 4QSHA 2X1DA 1ZR2A 2EK5A 2UZKA 4ZYGA 1FYMA 5IT3A 3S2HJ 3FBNB 1U3EM 1IO2A 1N75A 3P9CA 2LTPA 3OYDA 3QYEA 2Y31A 1R36A 4IHYA 3EUHA 4XOTA 3A0HC 3OIQA 4IQ4A 2PMUA 2BOLA 5F1RA 2BW3B 3GFLA 3TEDA 1MBHA 3C2BA 1SD4A 4NUBA 4A69C 2IVMA 2BXYA 3MWMA 1IDZA 5GTIC 2IGOA 2H1KA 3V42A 4WXDA 1R23A 2ZC2A 5F04A 1R49A 5E8IA 3RDIA 3H1CA 4E4HA 5EDNA 2IT0A 2B63J 3PM1A 3BR0A 4RB2C 3HDDA 1U8BA 1ZAOA 2BY1A 2BEOA 3KP3A 1SVLA 2DA1A 4IRHA 4IRGA 3GLLA 4NNJA 2RV8A 2KHMA 3HOZJ 3AG1H 1EA3A 2QGUA 1HXDA 1ONVA 2X85A 1VQLI 2HDCA 4J19A 1I3QJ 2Y0SN 4UV9A 2W24A 1UMQA 1Y0UA 2EH3A 5K5QA 4ABZA 2HKOA 2CO5A 1X2NA 2ZCWA 3KZZA 1FWZA 4KIFA 2IS2A 3F8NA 4G9YA 2DI3A 1RI7A 2KKOA 3OR1C 1QHGA 1QQIA 4I2OA 1ZLJA 2R7UA 1BN5A 2EFOA 2XF7A 2OV7A 5DUKA 5J4YA 3K7AJ 3K0LA 3K4BA 5GAEJ 1P7JA 3WE2A 2ISYA 1GVDA 2E1MB 4R8HA 3S1MJ 1YTYA 1V4RA 4IEJA 1LDJA 4XK4A 4FE7A 4B48A 5BOXA 3N05A 4Y17A 4A3MJ 3TO7A 5D4SA 4Q47A 1HDPA 4LFUA 3CQZJ 5D4RA 1S7AA 2AXTC 3KE2A 2WAQA 1ORKA 1OJLA 1D8KA 2LVSA 4DJAA 5L3CA 1EH6A 1D0XA 4BE2A 2EQRA 3KP4A 1FEXA 2IEKA 4A3CJ 2K5CA 4BQQA 1JE8A 2HYJA 3BR3A 4XLFA 4KIBA 2VXDA 2X1EA 5FKMA 5LHGA 3MKWB 3K4CA 4HV5A 3RKWA 1T6SA 4Q48A 2PMZA 2FOKA 5L3DA 2XGDA 3MD2A 4EVIA 1VZ0A 2K9QA 3FK7A 2D45A 3TBIA 1BL0A 2LKXA 2YX7A 1J2XA 1JHHA 2JRTA 2YU3A 2NS8A 2XAJA 4DBQA 4FT8A 4PGHA 2K9NA 3HEFA 4IF4A 5EGOA 1G59A 3CC7I 3FXOA 4HRIA 2P7VB 2ACJA 2LBFA 3CJNA 4BYYA 3D5LA 4LJZF 3S93A 2EPFA 4NQWB 2R7XA 1R5HA 2GA1A 4WX9A 4AIDA 1RUNA 1QVUA 1TWAJ 4D7NA 2A5WA 2OTJI 5BMZA 1ZRCA 1ZLKA 1FIAA 3JRBA 2X0LA 3QP6A 1XGOA 2LDUA 3I5UA 2W82A 3QPTA 2XAUA 3GFMA 4PJ0C 3SZTA 5FROA 1I39A 2E71A 2YS9A 2HQ5A 4LLLA 4UB6C 3GVAA 1WI9A 3LSHA 3SQNA 1ZR4A 1FMWA 4M3FA 4KFCA 2UXXA 4XSXF 1PUFB 4KN4X 4M72A 4L5JA 2ZSHB 3E6BA 2I10A 3SHFA 3DEUA 4Y3OA 3IP4B 3H5AA 4D5FA 4KNYA 1ZG3A 4XN0A 5K7FA 3H3VK 1HW5A 1Z0XA 1ZN2A 4RAGA 1U8RA 2CQ7A 1H88C 4HNUA 5FB2A 5CPRB 2OTLI 2HVQA 2MBFA 3M07A 1KGSA 1HSTA 1RC9A 2X1CA 3HPGA 4RM2A 4CCKA 4XLPF 1DPUA 2CS3A 1DPRA 3LNQA 4A3JJ 1ZRDA 3CUQA 1D0ZA 1FZPB 3C3WA 2PEXA 3HOXJ 3QPHA 1XCBA 4L5EA 4JX5A 4HSRA 1NG7A 2FXAA 4Q4ZF 5F6FA 3BPVA 2BY3A 2XV4S 3TW7A 2Q2EB 1OISA 2DMNA 3WGIA 3SXYA 1MGTA 5M3MJ 2H8RA 1BI0A 1KQ0A 2DFFA 5M5YJ 3TL4X 1YI2I 2DA7A 2B7EA 3ABUA 5HNHA 3RZOJ 3DTKA 3AL0C 2AQEA 3IH3A 5E1ZB 3B6AA 1BI1A 4G94A 2O3FA 2QKMB 3TOAA 1T38A 5IYBJ 4A3KJ 5DD8A 2ZFWA 2HVRA 2R4GA 1O7FA 2RDPA 1Y0NA 2ZXJA 1SMTA 2ZMEB 3GYHX 4WF2A 3DV8A 3I55I 1MBEA 1NG6A 4ZJZA 2NOGA 1W5TA 2XRLA 2F5FA 1IUYA 3OMYA 1IRGA 5F0CA 3NWTA 2KISA 4Q5SF 3GTGJ 3I4PA 1ACIA 3DBHB 3B6CA 3TQNA 1W1WE 5B1BH 3V8JA 2VASA 1XD7A 1HQCA 2DT7B 2BY0A 1HKTA 1DU6A 2EZLA 1OR7A 3I64A 2L0KA 2Z16A 2G0EA 3OS0A 1O4XA 1YJ9I 2M0CA 3HG9A 2O03A 4UB8C 3SDGA 2V9PA 1FPQA 4X1EA 2RNGA 3A03A 5D6EA 4IOCF 2EV6A 3UKGA 1JGGA 5EG0B 3BR5A 2HPMA 3CO6C 3OS2A 1MD0A 2KLOA 1ULYA 2QZ8A 2XF6A 4FISA 2TRTA 5GPCA 3CP8A 3J7AO 3TMOA 3OOPA 1L0OC 4FCYA 3W6VA 2IS1A 5M3FJ 1NK2P 2JPBA 3ISPA 5BPDA 2R7VA 1U6GA 1SVMA 3FXKA 2PJRA 4EEFG 3ROUA 4QPOA 3ONQA 1N25A 1X4OA 3HOWJ 4O3MA 4A2UA 4OIRF 5D5UB 3F8CA 1AHDP 2GOMA 3P5JA 2R7FA 3VODA 5FKLA 1JGSA 5GAHJ 3HRTA 3Q0VA 3ZRGA 3ZMTA 1B8IB 1DUXC 3G2BA 5LGTA 3CJTB 4C3HJ 1MBKA 2AHQA 3WU2C 1FC3A 2L5QA 1LDDA 5JLWA 2EA2A 4BDYA 4CZZA 3H9JA 3QU6A 5FRNA 3JAMZ 4FX4A 3ZQQA 4RAZA 3CMYA 2A68F 3ZN1A 1D1AA 2R7OA 2WY8Q 3DCFA 3P7NA 2R5YB 1YFHA 1AU7A 3A2KA 3W2AA 4XM3A 3PO3J 2R93J 2X4HA 1W7PD 2HGCA 1X1AA 2J5OA 1X58A 1P4AA 1ZTRA 5FKOA 3GW2A 1FP1D 1TP4A 1Z6RA 1C0WA 1P92A 1QNTA 4IQJA 1VQ5I 4HA8A 2MA3A 2E7WA 2RREA 3O2PE 4ON0A 1USTA 1CF7B 2IP2A 4HEA2 1I3AA 4ZYHA 2QBYA 4ZDOA 5E17F 4GFBA 3WTSC 2VQGA 1BOBA 1N77A 1A6IA 5F1JA 1S8NA 3HC7A 3LSJA 3I9V2 3KYLA 3OYLA 5E20A 5LLQA 2L4MA 3HKZA 3VB2A 3F6OA 5KVRA 3FXUA 2JA6J 5C4JJ 4YIFA 3MMYB 3Q0WA 2XPUA 4XLEA 3HB9A 3LSTA 1ZHFA 1JKOC 2GWRA 1D3YA 2WA0A 4Y15A 3GZNB 1GVJA 2VKDA 5AIQA 2GQQA 1TWHJ 5TJJA 1IXRC 3A1YA 3IKTA 1I1SA 4HDUA 2UXNA 3O8HA 1FOXA 1FY7A 2VJJA 3FXMA 3R0JA 1LE8B 2Y30A 2WAEA 3ZCOA 4BAYA 2ADUA 2VC1A 4FASD 2XKPA 2QQ9A 1WCMJ 1CGPA 1B9NA 5HLGA 2EFWA 1G3YA 1Z77A 2H8WA 2WC2A 3H9QA 3HYIA 3BY6A 2VOOA 2IA1A 2GZWA 4EGYA 2B0LA 2L2OA 4OU0A 2F5EA 2ZNYA 1BR4A 3FM3A 3KEYA 2H6BA 3IUOA 4OMZA 5B3SH 5CKTA 3PSFA 3PIOF 3K4LA 5LD2C 3VEPA 3CJQB 2VE8A 2AO9A 2VJIA 3E5UA 2WBMA 4LG0A 4P5OA 3LSRA 5J4VA 1DQUA 1YE9A 2HDWA 4BJ5C 4U88A 2XKOA 5J1YA 1OCOH 2DT5A 4IHXA 2DFHA 3EPZA 2JUCA 3LL7A 5FLXZ 3Q5FA 2B9SA 4XIDA 1ON2A 5CVVA 2V9KA 5DDGA 2F4OB 3JAMK 4GYIA 1VNDA 1KU2A 3FBIB 3LSGA 4RGXA 2OD5A 1XN7A 4A5NA 2DPUA 1OYIA 2JZYA 3CUOA 5K7ZA 2KT0A 3QODA 2IXSA 3I4NJ 4BNCA 1IN7A 2Y48A 4PFPA 1QZZA 3CLQA 5ICFA 1BJAA 3IC7A 4BE0A 5DCMB 2AQFA 1OYWA 4XRSG 2R7RA 1YIJI 1ZREA 2X6XA 4II3A 3DQVC 2XDVA 3ZMUA 4U0YA 5CVJA 1XPXA 1TC3C 3F3XA 2L7FP 2WTEA 3JTGA 3BCAA 2MD5A 2V6CA 4DYCA 3OYGA 2BHYA 1YX3A 1LNWA 2E2JJ 3E5XA 4HQEA 1JUMA 2MC4A 4L0ZB 3EETA 4YIRX 2PMHA 2I5UA 3OYAA 2E19A 1PJRA 3MZ8A 3RCOA 3U1KA 3PL8A 1S7OA 3PFIA 5L3FA 4I09A 4ITVA 3QOPA 3SFZA 3ECHA 1K6YA 2X9DA 2FBHA 1IN4A 2RAEA 3WTZA 1WJAA 1LJ9A 3MFKA 4G6TB 3GTLJ 1AKHA 4BXXJ 2OUMA 1Y8RB 5L3BA 2O8XA 3FMSA 2NRAC 5HLTA 2JK3A 4RS8A 3V8KA 1BM9A 3K9TA 4YFNF 1AA7A 3U9GA 2HR3A 2XGCA 3LWFA 2EIMH 3MKYB 5KNLA 1X19A 2HYGD 2IPQX 2VQLA 4AIJA 1IJWC 1RKWA 1VI0A 3DWLE 3FMQA 3KX2A 2LY9A 3AKZA 4XRMA 4J00A 5FLXK 3COAC 4AYBN 4XRFA 2OC6A 1IF1A 1TLHB 2VPRA 4BEHA 4AIHA 2HVSA 1BC7C 3L09A 4CH7A 3JRDA 4UNOA 3T8RA 1SAUA 2Z99A 2DFIA 3MQ0A 2X51A 4CCLA 3LSMA 2CQXA 1BIAA 1IRZA 4M73A 1QA6A 2DMQA 3LA2A 3IRQA 2VBYA 2XHKA 3TGNA 2DCEA 4XKWA 1GXQA 2WWYA 1IUFA 4PJJA 1BW5A 2OBPA 2I8DA 3W6JB 2JVHA 2AS5F 4E7LA 3QAHA 1VFCA 4OINF 4W97A 3WG7H 3AG2H 3IAM2 3ZGKA 2QSHX 1WKMA 1XMKA 2ETHA 3CDHA 2QUFA 3PQKA 2OQRA 2E35A 5DD4A 2A05A 3ZQHA 1F5TA 3Q0UA 1U5TC 3CUQC 5HLIA 2HKXA 1OCZH 1XCVA 4FE4A 3WTUC 2O8KA 1TQMA 2D1VA 3AAFA 2KMUA 4MNUA 1FJLA 3BR2A 2JMWA 4M6VA 1ETXA 4I76A 2FBKA 2MW8A 4EJOA 3CMEI 2CGPA 2CUJA 5J47A 1A5JA 4PCQA 5J8CA 1AWCA 3OSFA 4QTRA 4JX6A 1IN6A 2EIKH 1SMYF 4MEXF 2NOJB 2R7TA 5D5VB 2OZUA 2GBYA 4CGZA 2BVLA 2M30A 4ENMA 3HKZN 1K83J 4IHSA 3CJRB 3PNTA 4ZYEA 5HLHA 1R58A 4XLHA 2LC2A 1S9HA 5LHIA 3L2WA 1X3WB 2V9VA 1ZKGA 4BXFA 2A69F 2RVCA 4D9JA 4HNTA 4ZDPA 4F93B 3K70D 4L18B 2K7LA 4U0WA 3DKXA 5EF6A 2DT6A 1Z7LA 2DJIA 4ZYAA 1RR8C 1B6AA 3R61A 4RBOA 3PSIA 2FE3A 3BPXA 2L9SA 4N9HA 1VQ8I 2YU9J 1NH3A 4XR6A 1JHFA 1VTNC 2MGQA 2ME6A 4YEJA 1APLC 2HOSA 4CXFA 1G6NA 1OMIA 3HGYA 2IW5A 1POGA 2R3SA 2LY1A 1SFKA 4IXAA 3N4MA 1VQKI 5J6XA 3ZR8X 4R1HA 3T1BA 4LIVA 4JBAA 1W7PB 3RZDJ 2DQRA 3E97A 3U2RA 5IT9Z 3VYRB 3FM5A 2VKHA 3P9KA 3W2WA 2W25A 3LQQA 2CV2A 2M1BA 4ENJA 2F2EA 2W4SA 3DPUA 2ZXWH 5E8GA 3CP2A 4QWQA 1WSUA 1RRJA 1FBQA 2MC3A 2ZJQF 1B72B 4JYKA 5F64A 2R5ZB 1EF4A 3OSGA 3D5RC 2Q8KA 3GTMJ 3RPUD 1GDTA 2JPCA 4OIQF 3CDLA 3HTSB 2XASA 2LKSA 1GT0C 4F92B 5ILVA 1IZ1A 4I02A 3HHGA 5KHDA 3ZQ7A 3J81Z 5IPAA 1T39A 3BJ6A 4LLGF 5GAGJ 3L1PA 3HL2A 3ERMA 4HYEA 1P6RA 3LMMA 2KFDA 3H92A 3ABMH 4Y33A 1IV6A 2GIVA 1YIOA 2O61A 1V54H 2DOEA 1X1CA 2VJ4A 3PQJA 2RGVA 2PBIA 1JT0A 1OCCH 3G6EI 1GHCA 3HTUA 1XGNA 3JRIA 4YG2F 1A35A 4G7HF 5DCFA 3R60A 3GFIA 1YRNA 3S3NA 2OCCH 3GTKJ 4A93J 2ISZA 3OIOA 1K78A 2ZKZA 3JRCA 1FYLA 4E7IA 2GXAA 4BJTA 4NB5A 2KZVA 3W6KB 1J59A 1KYZA 1A04A 3Q9VA 3JRHA 3N97A 1G2HA 1WRJA 1H0MA 1B9MA 2XRNA 4XKBA 1O7LA 2V26A 1I1GA 4AVPA 5J3LA 3W3CA 3WE3A 5FJ8J 4KISA 3MN2A 1BR2A 3QPSA 3CCVI 2L3DA 4U7BA 3QRFF 3JCUC 1TWGJ 5FLMJ 1YG2A 1XX5A 1RIOH 5KK1A 3MEXA 2K02A 3I56I 1W5SA 1RPWA 2LF8A 3DKWA 1B59A 1WH7A 2DA6A 3G1LA 3LOCA 2H6CA 1SD6A 2R7WA 5IT9K 5D5XB 4DZPA 1Z3YA 1Z7UA 5KAIC 1H89C 3GZ5A 3D1NI 2LOOA 1S29A 2K85A 2O0YA 3E6CC 1ERDA 3HHHA 4MHGA 2VN2A 2XAGA 4I98B 2QKLB 4UUTA 1X1DA 4KA4A 1D8JA 3GO5A 1YHQI 2VT2A 3KETA 1Q1HA 4OWRB 2M34A 4B47A 5M5XJ 2HFHA 3LSKA 3BZKA 3DP7A 4L9JA 2QEXI 2EA4A 3PJRA 3HUGB 4KMUX 4AU7A 3CCUI 3J81K 3IKVA 3PNYA 1QVTA 1FOYA 3BG6A 3WU1B 2KRFA 5IP6A 5JR3A 3LFUA 2YR2A 4G8XA 1UZCA 2M8GX 3KLNA 5GPAA 1Z9CA 3V4GA 4PJMA 2JSPA 1JKQC 4RB1A 4UUSB 3UNGC 5J40A 2YX4A 2PQ8A 1OFCX 3RI4A 2QBYB 4FETA 3FMRA 3E3VA 3I71A 4ASNA 1LFUP 2PJPA 1FBUA 3FKIJ 3P9IA 3I53A 1ENHA 3F72A 3QU3A 2D2WA 2A07F 2VB6A 2Y9YA 5ERIA 1JUPA 4HLYA 3W2VA 2HOTA 3L2VA 3A4CA 2NVYJ 2LLKA 2KRHA 1UCRA 4MTEA 1W0UA 3ASOH 4G7ZF 3MZYA 4AC0A 4CUGA 2DBBA 1UJ8A 2K3PA 3G71I 2ZB9A 1U9NA 2XUBA 1V5FA 1Y1WJ 4E70A 3RKXA 5CVUA 1MBFA 4HBLA 4FX0A 3AG3H 2XVCA 2F48A 2DJNA 3RTRA 2DA5A 1P7IA 2WADA 1L3LA 2MD0A 2CYYA 3L7WA 3KYDB 3ZP5A 5LRSA 4CICA 1ZG5A 1U5TA 1VQ7I 2BZTA 2VJ5A 4D7MA 4XLAA 3JRGA 1W4MA 2R7SA 3BZCA 1FOWA 4LLNA 5E3LA 1MJ9A 2R7DA 2VOPA 4RLQA 4L0YB 3WG9A 4V2FA 3SEQA 5C3EJ 2VBZA 4NC6A 3TO9A 5IYDJ 3FK6A 3SZGA 4IL6C 5FD6A 2H09A 4A0ZA 4X0GA 4JQFA 3MCZA 2DMPA 1XG1A 3WTTC 2FRHA 1GLNA 2BW3A 3EQLF 4B3AA 2E34A 1SFUA 2A61A 2NAZA 2QM3A 5D6FA 1R71A 1IRXA 1UG2A 1XDSA 3HSFA 1P2FA 4OOIA 4BACA 4D0PA 2LMDA 5E3NA 2ME0A 3HOSA 2KJCA 4Y4RA 1WJEA 1E0EA 1T33A 2KIUA 3F0CA 3F22A 2K4BA 3HPHA 4GCVA 2K27A 5JHUA 4NDLA 3BG9A 3WHBA 3H0DA 3B02A 1HC8A 1X3ZB 4OAZA 4A0YA 3S3MA 1KU9A 4BS9A 5FFZA 4RDUA 1YYVA 3KEOA 1OPCA 3DPLC 1LVAA 1W36D 3M1CA 4ZYDA 1SFOJ 3A0BC 2OU2A 5D8KB 2VODA 3DEEA 1QRYA 2IS4A 2EBIA 3CCRI 5B1AH 2QSFX 4AYBA 2JT1A 1U9OA 1GV2A 4XICA 2UWMA 5K1YA 3BQYA 2DXIA 5EEHA 2HS5A 2AXLA 4O6JA 1ZRFA 4KIGA 2MLGA 3LA3A 2VC0A 4PSWA 3K69A 2NS0A 1IN8A 3VSLA 5H2FC 4IOAF 4M3GA 3WTWC 2XSJC 3EUKL 2VUMJ 4BBSJ 2V1XA 4LG3A 4EM2A 4RB0A 2STTA 2CQKA 3OY9A 1TWCJ 3GXOA 5HS9A 1A31A 4O5VA 1BI2A 3RYPA 5KAFC 3OYBA 1K79A 2LYCA 4RB3C 3HXLA 3BCBA 5E79C 2MH2A 4OMYA 3E7LA 3LSPA 3G1MA 5DM7F 3RPQA 1AKHB 1YITI 4YFKF 1U0JA 2EV5A 2V7FA 3AL0B 2DW4A 4MQVA 3VYSB 3HZJA 3M8EA 4JK1X 1MH4A 2CQNA 2ZBKA 4B1RA 4DQ2A 2J5PA 2JN6A 4QPQA 1IV8A 2JJ7A 1FP2A 4HF1A 4CDGA 2IGNA 2DLLA 1XGSA 3A02A 1IC8A 3QWLA 2IGMA 2P8TA 4XN3A 3S2WA 5KCMA 2E36A 3KZIC 3U1DA 2XPWA 1PP8F 4Z6YA 2DOFA 2HI3A 1ZQ3P 4C2MJ 2JVGA 4C2UA 4C9YA 5CYVA 4F52A 2V6EA 1WVRA 4NQWA 2EZKA 4CO8A 1M1EB 2NVTJ 2ZO4A 3FHNA 3BG7A 1QBJA 2DA2A 4CYDA 3R4KA 3HJEA 4F91B 3AG4H 2ECBA 2Q0OA 2VIXA 4CHUA 4M3EA 4EQQA 4LD5A 2OF7A 1R9TJ 2JQ7A 1KQ9A 4NHJA 1RZ4A 3GLXA 3F9KA 2DK8A 2E2IJ 3F8MA 4ZC3A 2M7BA 4H0EA 1PUFA 1RNLA 1J9IA 1O3SA 2DDAA 1MDMB 3BTLA 4HOBA 3MAJA 1KA8A 5B66C 3OYMA 4ZH4F 3CC2I 3DU6A 1YW7A 1R4MB 3M8JA 2FQ3A 2ZFUA 5DUIA 2ID6A 3H35A 3QQAA 3TP3A 3CCYA 1IGNA 2GXBA 3CDIA 4PUSA 2V1UA 2A6TA 2EJRA 3V8LA 2L02A 4M9SA 1Z3XA 4N4OB 2E5ZA 2IRFG 2DOAA 5CQEA 3O6BB 4G7OF 4WWCA 1ZK8A 2RQQA 3OYFA 5EEGA 4KDPA 5CLSA 4BU2A 2A6HF 2CRGA 4JOMA 4HDVA 1FSEA 3DLLF 3IV5A 3HBLA 2COBA 4DYQA 2YPRA 3HSRA 2HXIA 3LA7A 3QP5A 2X6YA 3GCMA 5JHFA 2LY2A 3BWGA 3K1PA 3R6SA 3ELKA 1G3WA 2XF5A 2R92J 4DOZA 2EILH 3GF2A 2IA2A 1FBSA 4G12A 1JTXA 2Q2EA 3DFGA 5JFRA 3FHZA 2V79A 3EYYA 4HF0A 4I0BA 4XRSA 3K10A 1TW2A 4CA0A 4R79A 3IHUA 2FUG2 1TTYA 1G3SA 5HODA 1J0RA 2L54A 3BZ6A 1RUOA 4GGGA 3WTXC 3DPTA 3KP6A 2L9NA 2VQHA 4CYCA 1VQMI 2DPDA 1HW2A 2QF7A 3HOTA 1ZGJA 3OYIA 2EB7A 4UVAA 4X6AJ 3PIPF 1X1PA 2O9LA 2L7MP 2E1CA 4RM3A 1P4XA 2M4GA 3BG5A 4EJTA 3GBGA 3CESA 3KP2A 4QLCU 4L9NA 1JUSA 2FNPA 3X2QH 3TOBA 2CFOA 4OAYA 3OYJA 3CCQI 1MMGA 4G6QA 3GTJJ 1Y1VJ 4RLFA 3LAPA 4M71A 4MEYF 1T2KA 2GAUA 3HM5A 3WGHA 3D5SC 2HOAA 2HQNA 1TQPA 1VQ4I 2PLYA 1FTZA 1MBJA 1WJ5A 1Z21A 4P55A 2X6WA 3GTPJ 1JJ8C 5K5OA 5LGUA 1R1UA 1XS9A 2IBDA 1G3TA 1MNEA 1ZELA 3OYKA 4HPQA 5BPIA 1YO5C 1LUJB 3L2QA 3WTVC 1TL8A 5HDKA 2JTVA 5A2QZ 3S1NJ 3E0JB 2DYSH 4EJUA 2Y0MA 3TDZC 1IAWA 2KP6A 2ESNA 5E3OA 2GM4A 1QU3A 3ECOA 2DMUA 1ZG1A 1X4PA 4GYGA 4BKXA 2DAOA 1TNSA 3T0YA 4A3BJ 3RIRA 5ICCA 3FIWA 1QHHD 5IOZA 1ETVA 1HW1A 4DBRA 1LQ1A 3KZYA 4M3DA 1OLTA 2LR8A 4ANJA 6PAXA 3NQOA 2MSYA 1UHMA 2XGEA 4M3BA 1B8IA 2CSOA 1MMAA 2DA4A 4XKCA 3VDXA 5C4XJ 4NC7A 2EFQA 3ZQFA 5IP9J 1YS6A 4HNVA 4S0HB 2ZJ2A 2M8EA 4B4CA 1E3OC 1DU0A 3S2DJ 1YW8A 3J80K 2JRMA 3GEZA 4E7HA 4GXOA 3GMEA 4BDZA 2R5YA 1LDKB 4C2TA 3QYBA 5FKKA 4L5IA 4V19K 1MJAA 2CV1A 1W0TA 2FQ4A 1FLIA 1S5LC 1WGXA 3BT9A 3NARA 2OPTA 4DGWB 5BS6A 4M6YA 1Z6TA 1ZARA 3LAJA 3ESWB 4UVCA 1HA8A 2HTJA 2A6EF 3ABTA 3K6GA 3QYFA 1CF7A 2CW0F 2QQAA 5AIPA 2P6TA 4BGDA 1OCRH 2DK5A 1TT0A 3TW6A 4L9TA 2L9VA 1USSA 1EH7A 4FHTA 2VKVA 2EZIA 2WAFA 1K61A 5GADJ 3LFKA 1J5YA 2W85A 1T0FA 2HQRA 4MIMA 3KP5A 2W48A 3DU5A 2F4IA 4LK1F 4F55A 1LPQA 5DEQA 4KYWA 3LSIA 1UHWA 1FNNA 5LBQA 2G7HA 5EGOB 2HTSA 2GA2A 1R1TA 4F7ZA 1R4NB 2LBFB 3GX4X 2D5VA 1ETOA 1LE8A 5E3MA 3DKYA 4LITA 4BH9A 5HNFA 4IZZA 3DF8A 5K5RA 1PYVA 2E2HJ 2H27A 3G4SI 1J75A 1LFPA 4E7SA 1UAAA 2RC4A 1D1CA 3U21A 5A2QK 5D8LB 2WV1A 4UV8A 4BY7J 2V4JC 3L2RA 4LIUA 4K2EA 4KT6A 4HLXA 4J01A 2W84A 2K9MA 3BC8A 3HIFA 2VL8A 2DU9A 3FXRA 1YJNI 4P96A 3BR1A 2HPIA 2HOEA 3C1DA 1DP3A 3I59A 2FSWA 2YUSA 4ESFA 3CCJI 4E7KA 3E5QA 2E7XA 2M9HA 2HZTA 3DTIA 5JVGF 2CJJA 3HSEA 1ETWA 1BBYA 4CCNA 3IH2A 3ZQIA 3CMMA 2ECCA 1F36A 3FWEA 2F5VA 3R0AA 3HOUJ 3O8GA 2KIQA 1J7KA 1CQTA 2CW7A 1FSHA 4IJAA 5F08A 4AIKA 3QPLA 2K3FA 1F4KA 3BLYA 1WWXA 2FJ1A 3BJAA 3DBLB 4V2GA 1HSJA 2L7ZA 9ANTA 3FKJA 1XC5A 2LH9A 2JA8J 3SZPA 1QZYA 4ZTJA 1PDNC 1R22A 3MKZA 2E1MC 2VQCA 2KDZA 3M8FA 4EM0B 3EYIA 1F43A 5HVQC 2CFXA 1U5TB 2L7KA 3CUQB 4KUMA 5LEJA 2OAZA 2STWA 5BQTA 2BXZA 2BYVE 5DCMA 2W1OA 2XPVA 3C2HA 4U0VA 2GIZA 5IYCJ 4PJNA 1X1BA 3ZN0A 2IAIA 5IP7J 4ENNA 2Z3YA 2QQBA 2H1LA 4B8XA 1BJZA 1DGRM 5J1UA 1MNMC 3OR2C 4IRIA 2NXNB 5CVIA 5EZHA 2Y9ZA 1MZBA 5LFAA 4MTDA 4HX8A 4I01A 4Y7NJ 1S72I 4HX7A 1HCRA 2E1NA 1XSVA 2W00A 4CCOA 1XB4A 2CMPA 3G73A 1P4WA 4XONA 4U7DA 3A01A 1TWFJ 3EDPA 4DNCA 5DYMA 2DYRH 2M7AA 2K4JA 4BQNA 1T95A 1VF9A 2IA0A 5EYRA 5H20A 2FD5A 3S1RJ 1PVEA 5H6RA 2OCEA 2L9RA 1FYKA 4G6DA 3WODF 4IO9F 3DXJF 4P1WA 4WXHA 3RSNA 1TQIA 2Y2ZA 2FMYA 2RN7A 2JSCA 4MFDA 1QPIA 1TNTA 4B43A 1TT5B 1RKTA 4B09A 3FXJA 2FOWA 2OA4A 2ZJPF 1I6XA 4RAYA 4UY8I 2ZXHA 3CCLI 4HQMA 5DV5A 3CMAI 1ZGWA 2F5CA 1H9GA 1LEBA 3IH4A 5C44J 4BHPA 5E1XA 1KU7A 2YSRA 3Q3SA 1IN5A 2QQ8A 3CLOA 2LG4A 2CQQA 3ZQLA 2O5RA 4LK0F 5ILSA 3OYHA 2LP0A 3CO7C 2M45A 2LK2A 1ODDA 4C3JJ 1HBXG 3ERED 3EUAA 2PJRB 5JI6A 3KEQA 5TGTA 2CV0A 1BC8C 5GP9A 5J1RA 2KJBA 1Z05A 2WY7Q 3FXLA 4I7HA 3JR9A 1MNDA 5IOYA 1D1BA 3D0SA 3TDUC 3WHCA 1O3TA 1G4DA 2CG4A 4E7ZA 1V3FA 4WCGA 2P5LC 3S17J 2DFEA 3F21A 4NBQA 3JTHA 2R7ZJ 3OYEA 4DZJA 3F6VA 4S05A 1A36A 3I0TA 4A3FJ 3ZQCA 2DMTA 3FZVA 3RQIA 3JREA 3K1NA 2FF4A 2LREA 4KJZA 1ITYA 2CU7A 3H9GA 3K4KA 4A12A 3PUFA 2ESHA 4KICA 3CTAA 2HU9A 4OIOF 3KFWX 4NC8A 1SVOA 3OYCA 1AOYA 2D1HA 3E6DA 3CCEI 3OL4A 2MH9A 3VYUB 3J7AY 2FA5A 2Y69H 4ESJA 4XLCA 5F27A 1U2WA 3JRAA 1PUEE 4A5MA 1WZ2A 1D5VA 1A6QA 2F4MB 5L3GA 3ABKH 2EIJH 2HZDA 4GO1A 1GXPA 1VQ9I 2R7QA 3I58A 1D0YA 1HKQA 2LNBA 5AONA 2XB0X 4UVBA 1R1VA 2KRCA 2CUZA 4B3XA 3ZMSA 2HEOA 1KZHA 2BBYA 3HRMA 2EV0A 2ZMEC 1SC7A 4ZZDA 2RNJA 1HDDC 5ICEA 2CW8A 1Y6IA 1EKEA 2GXGA 2NS7A 3BJOA 5J8FA 3HRUA 4FTHA 3ZPLA 5CJ9A 1F1ZA 1R5GA 3M1EA 1Z1DA 1T56A 1UB9A 2DODA 3PFYA 2CH0A 5ILUA 3S15J 3RJPA 1LB2A 1KONA 5BNGA 4OIPF 3VFZA 1OCTC 5EJCA 4A0XA 2COMA 3FF5A 3JRFA 1E17A 1R5ID 4PJLA 1BR1A 4WXCA 2HWVA 2M3AA 3SJMA 4EATA 1SEUA 5FD5A 3J7ZI 4CZCA 3OYNA 1SD7A 2Z33A 1ON1A 2F5DA 1SD5A 1MH3A 2VI6A 2ZNZA 2JWTA 2PG4A 3E1SA 4EV0A 1W7PA 1J09A 2XAQA 4M9XA 4BXUA 3L2CA 1ZGAA 1YW9A 2XB5A 3K4MA 5K7HA 3K70C 2TCTA 2ZSIB 3G1OA 4Y52J 4P9UA 3KIOA 2KPMA 2QENA 2UUZA 1WJCA 1WJFA 5DS9A 5H6QA 3HRSA 4C30A 2WV0A 3VSKA 4LG0B 1GUUA 2DO7A 4HZFA 5TISC 5B5EC 1B72A 2R5ZA 4LB6B 4LB5A 3M3YJ 2FEZA 2WB1N 1TZLA 2CUEA 4RGSA 3GWZA 3ZQGA 5GTHC 2M5WA 1Z67A 2KQRA 2Z2SB 2RKHA 1O3QA 2NYXA 2KZGA 3ZXSA 5IY5H 2LD5A 5E1WA 4IX7A 1IW7F 2VE9A 4UXNA 4D1QA 1LFBA 3GUDA 3AFHA 4IVNA 4RA2A 2HDDA 3F8FA 2HQAA 3FX3A 4GDFA 1Q1VA 3ULQB 4CYCB 4C3IJ 4ZTFA 3IRRA 2X48A 3NEUA 1UHSA 3L00A 5LEKA 2N8GA 2XAFA 3KLOA 3K2ZA 3S14J 1B1BA 1YS7A 2IGKA 3DTEA 1D5YA 2VPLA 5JVTA 2P4WA 1N78A 3E6MA 3NRVA 4PZJA 1FX7A 3KPHA 1FTTA 4LMYA 4XKVA 1K4TA 5HOOA 1JKPC 3BQZA 4MQ9F 4KITB 2GLOA 3MKLA 3NWSA 4CCJA 2HXOA 3BROA 2LFBA 1I6HJ 1Y8QB 4XMYA 3S32A 4IHWA 2EINH 2VBXA 4EJWA 4AM3A 1YX5A 2OZ6A 2ICWG 1T0FC 4RAFA 2H94A 2XIGA 1R00A 1SFEA 4BY1J 1XSXA 1VQPI 2V1DA 2HYFA 2L4AA 1STZA 2P5KA 1DGWY 2A5YB 3FDYA 4ZZLA 2CUFA 4E6KG 1BA5A 2K86A 2OJED 4CSWA 3JSOA 1JKRC 2MABA 3KCCA 1NHAA 2QCOA 4HW0A 1LEAA 4TV7A 4CCMA 3O3KA 2TDXA 2BE5F 5EEAA 1RETA 1MBGA 4AD9A 1V5GA 1I50J 1P9QC 1BI3A 2NVQJ 3QOEA 1JT6A 2ID3A 3SEZA 4Z2YA 3HUGA 4AVZA 3S8PA 4BEHB 3TP0A 1X3UA 3SYTA 1FMVA 2P6SA 1ETKA 1SFXA 4PK4A 4U87A 4IKFA 3BR6A 4JP0A 2VXZA 4A3EJ 2G7UA 2WAQN 2BHZA 1FT9A 2ELKA 4XBFA 3SDBA 2VT3A 3HOYJ 1HF0A 4N0BA 4IHVA 5ICGA 4UUSA 3B73A 4EM1A 2PFBA 1PP7U 2M0MA 2C6YA 1ETQA 2QLZA 4ETSA 3K2AA 2XC7A 3TO6A 4XLNF 5DTDA 1EV7A 3HGGA 2PMZN 2E5NA 2XGXA 2P81A 3RKYA 1QPMA 3FXQA 1OQYA 3RYRA 1WI3A 3BTJA 4S04A 3V7RA 3C7JA 4BHBA 3ZOBA 3ZMDA 1R6RA 1KYWA 3ABLH 1WPKA 1Y39A 2DN0A 5D5WB 3EUHC 2Y75A 2QWWA
chains in the Genus database with same CATH topology
3I54A 3V7CA 1FOKA 1IRFA 4L9VA 5ED4A 1XMAA 4M6XA 2W57A 4KMFA 4IHTA 3ZMVA 4XSZF 2EWNA 3M7GA 1K7AA 5HS8A 2PN6A 3GFJA 5LGNA 3LQRA 5LRRA 4BHCA 3BDDA 4I0AA 4HF2A 3I59B 2NNYA 3J80Z 4P9FA 2M87A 3JW4A 1U78A 1YQAA 2LKPA 4YFXF 1XGMA 3H3ZA 2BGCA 3L9FA 3MZHA 5HS7A 2Z5UA 2ZMEA 1T98A 2NNNA 4ESBA 3C18A 3ZMZA 2EFPA 2PI0A 1O57A 1Z91A 2MLKA 5HDGA 4M74A 1F9NA 4A6DA 1QO0D 4Y13A 4EJVA 3BOQA 3REOA 4EMSA 1YLFA 5FGMA 4MGRA 1OYYA 3G3ZA 3WTYC 4HX4A 3Q9SA 4UHTA 3ML6A 3H3UA 2FNAA 2VBWA 2XAHA 3IWZA 1S6LA 5HDNA 1ZYRF 1DP7P 1E2XA 4AWXB 3T5XA 3F8BA 1BOAA 1TW3A 4HAMA 1HKSA 4PGGA 1XSDA 1K78B 1REPC 1SAXA 3IL2A 4WK8F 4YIIA 1K6OA 1MJBA 3T8TA 3WGGA 1JXSA 3BP8A 3GZ6A 1MKMA 2O6GE 1I27A 4UUVA 2LF7A 4HV6A 2BV6A 3IWFA 1I5ZA 1QGPA 2CWEA 2KIMA 1O3RA 1XDUA 4LGWA 3OV8A 3RPUA 2L01A 3M9AA 5LHHA 4KN7X 1BIBA 3WU0A 2P7CB 2IJLA 1S3JA 4A6EA 5E18F 3VOEA 4ENKA 4N9IA 1IXCA 2VONA 2QVOA 3TKYA 5L3EA 2FBIA 2P5VA 5CVRA 5TRDA 4M9ZA 2QYOA 4KT5C 2DTRA 2FMLA 1MDMA 3V7SA 3K1MA 2FU4A 3KP7A 5FFXA 2RQPA 2KIFA 5FO5A 1R7JA 2OQGA 3JSPA 1IXSB 1UFMA 1OKRA 4RGUA 2XROA 1H9TA 1TBXA 3F23A 1KU3A 4PDKA 1B4AA 1EH8A 2G9WA 2Z9OA 1KQ8A 4EGZA 1DDNA 2LSOA 1WQ2A 2A3SA 2ELHA 1ZH5A 4IPAA 2DQLA 2EFNA 4BQAA 4RGRA 2EK5A 2UZKA 4ZYGA 1FYMA 5IT3A 1U3EM 3P9CA 1R36A 3EUHA 2PMUA 5F1RA 3GFLA 1SD4A 2IVMA 3MWMA 4WXDA 1R23A 5E8IA 3RDIA 2IT0A 4RB2C 1ZAOA 2BEOA 3KP3A 4IRHA 4IRGA 2RV8A 1HXDA 1ONVA 2HDCA 4UV9A 2W24A 1Y0UA 5K5QA 2HKOA 2CO5A 2ZCWA 3KZZA 1FWZA 4KIFA 3F8NA 4G9YA 2DI3A 1RI7A 2KKOA 1QQIA 4I2OA 1ZLJA 1BN5A 2EFOA 5DUKA 3K0LA 3WE2A 2ISYA 4R8HA 1YTYA 1V4RA 1LDJA 5BOXA 4Y17A 3TO7A 5D4SA 4Q47A 4LFUA 5D4RA 1S7AA 3KE2A 1D8KA 5L3CA 1EH6A 3KP4A 1JE8A 4KIBA 5LHGA 4HV5A 3RKWA 1T6SA 4Q48A 2FOKA 5L3DA 4EVIA 2D45A 2YX7A 1J2XA 1JHHA 2JRTA 2YU3A 2XAJA 4FT8A 4PGHA 4IF4A 2P7VB 2ACJA 3CJNA 4BYYA 3D5LA 4LJZF 1R5HA 2GA1A 4WX9A 1RUNA 5BMZA 1ZRCA 1ZLKA 2X0LA 3QP6A 1XGOA 2LDUA 3I5UA 3QPTA 3GFMA 3SZTA 4LLLA 3GVAA 1WI9A 3SQNA 4KFCA 2UXXA 4XSXF 4KN4X 4M72A 4L5JA 3E6BA 3SHFA 3DEUA 4KNYA 1ZG3A 1HW5A 1ZN2A 1U8RA 5FB2A 2MBFA 4XLPF 1KGSA 1HSTA 1DPUA 1DPRA 1ZRDA 3CUQA 1FZPB 3C3WA 2PEXA 3QPHA 1XCBA 2FXAA 4Q4ZF 5F6FA 3BPVA 2XV4S 3WGIA 3SXYA 1MGTA 1BI0A 1KQ0A 3ABUA 5E1ZB 1BI1A 4G94A 2O3FA 3TOAA 1T38A 5DD8A 2ZFWA 1O7FA 2RDPA 2ZXJA 1SMTA 2ZMEB 3GYHX 4WF2A 3DV8A 1W5TA 2F5FA 1IUYA 1IRGA 4Q5SF 3I4PA 3TQNA 3V8JA 1XD7A 1HQCA 1HKTA 1OR7A 3I64A 2O03A 1FPQA 5D6EA 2EV6A 3CO6C 1MD0A 1ULYA 2QZ8A 3J7AO 3OOPA 1L0OC 2JPBA 3ISPA 5BPDA 1U6GA 3ROUA 4O3MA 4A2UA 4OIRF 5D5UB 3F8CA 2R7FA 3VODA 1JGSA 3HRTA 3ZMTA 1DUXC 5LGTA 1FC3A 1LDDA 2EA2A 4CZZA 3QU6A 3JAMZ 4FX4A 4RAZA 2A68F 3ZN1A 3P7NA 1YFHA 2X4HA 1W7PD 2HGCA 2J5OA 1P4AA 3GW2A 1FP1D 1Z6RA 1C0WA 1P92A 1QNTA 4HA8A 2MA3A 2E7WA 3O2PE 4ON0A 1USTA 1CF7B 2IP2A 4ZYHA 2QBYA 5E17F 3WTSC 1S8NA 5E20A 5LLQA 2L4MA 3VB2A 3F6OA 5KVRA 3FXUA 4YIFA 3LSTA 1ZHFA 2GWRA 1D3YA 4Y15A 1GVJA 5AIQA 2GQQA 5TJJA 1IXRC 3IKTA 1I1SA 4HDUA 2UXNA 1FY7A 3R0JA 4BAYA 2ADUA 2VC1A 2XKPA 2QQ9A 1CGPA 1B9NA 5HLGA 2EFWA 1G3YA 3HYIA 2WC2A 3BY6A 2VOOA 2IA1A 2GZWA 4EGYA 2B0LA 4OU0A 2F5EA 2ZNYA 3FM3A 2H6BA 4OMZA 3VEPA 2VE8A 3E5UA 4LG0A 4P5OA 4U88A 2XKOA 2DT5A 5FLXZ 3Q5FA 1ON2A 5CVVA 5DDGA 3JAMK 4GYIA 1KU2A 4RGXA 2OD5A 1XN7A 4A5NA 2DPUA 1OYIA 2JZYA 3CUOA 4BNCA 1IN7A 2Y48A 1QZZA 5ICFA 1BJAA 3IC7A 5DCMB 1ZREA 1OYWA 3DQVC 3ZMUA 4U0YA 5CVJA 3F3XA 2WTEA 3JTGA 2MD5A 2V6CA 1LNWA 3E5XA 4HQEA 4L0ZB 3EETA 2PMHA 5L3FA 1S7OA 3PFIA 4I09A 3QOPA 3SFZA 3ECHA 2FBHA 1IN4A 3WTZA 1LJ9A 3MFKA 5L3BA 2O8XA 3FMSA 2NRAC 4RS8A 3V8KA 1BM9A 3K9TA 4YFNF 3U9GA 2HR3A 3LWFA 2HYGD 2IPQX 4AIJA 3FMQA 5FLXK 3COAC 4XRFA 1IF1A 1TLHB 4AIHA 1BC7C 3L09A 4UNOA 3T8RA 2Z99A 2DFIA 3MQ0A 1BIAA 4M73A 3LA2A 3IRQA 2VBYA 2XHKA 3TGNA 1GXQA 2WWYA 2OBPA 3W6JB 2AS5F 3QAHA 4OINF 1WKMA 1XMKA 2ETHA 3CDHA 2QUFA 3PQKA 2OQRA 5DD4A 1F5TA 1U5TC 3CUQC 5HLIA 2HKXA 1XCVA 3WTUC 1TQMA 2D1VA 3AAFA 4MNUA 2FBKA 4EJOA 2CGPA 4PCQA 5J8CA 1AWCA 1IN6A 1SMYF 4MEXF 5D5VB 2OZUA 4CGZA 2M30A 4ENMA 4IHSA 4ZYEA 5HLHA 1R58A 5LHIA 2V9VA 2A69F 2RVCA 4L18B 2K7LA 4U0WA 1B6AA 3R61A 2FE3A 3BPXA 4N9HA 1JHFA 1VTNC 4CXFA 1G6NA 1OMIA 2IW5A 2R3SA 4IXAA 3N4MA 5J6XA 4R1HA 3T1BA 4JBAA 1W7PB 2DQRA 3E97A 3U2RA 5IT9Z 3FM5A 3P9KA 2W25A 3LQQA 2M1BA 4ENJA 2F2EA 5E8GA 4QWQA 1WSUA 1FBQA 2MC3A 5F64A 2Q8KA 2JPCA 4OIQF 3HTSB 2XASA 5ILVA 1IZ1A 4I02A 3HHGA 3J81Z 3ZQ7A 1T39A 3BJ6A 4LLGF 4HYEA 1P6RA 3H92A 2O61A 2GIVA 1YIOA 3PQJA 2RGVA 2PBIA 1GHCA 3HTUA 1XGNA 4YG2F 4G7HF 5DCFA 3R60A 3GFIA 2ISZA 1K78A 2ZKZA 1FYLA 3W6KB 4NB5A 1J59A 1KYZA 1A04A 3Q9VA 3N97A 1WRJA 1H0MA 1B9MA 2XRNA 1O7LA 1I1GA 4AVPA 3WE3A 2L3DA 4U7BA 3QRFF 1YG2A 1RIOH 5KK1A 3MEXA 2K02A 1W5SA 2LF8A 3DKWA 1B59A 2H6CA 1SD6A 5IT9K 5D5XB 1Z7UA 3GZ5A 3E6CC 2O0YA 1S29A 3HHHA 4MHGA 2VN2A 2XAGA 4I98B 4KA4A 1D8JA 3GO5A 2VT2A 3KETA 1Q1HA 2HFHA 3DP7A 4L9JA 2EA4A 4KMUX 3J81K 3IKVA 3WU1B 2KRFA 5JR3A 2YR2A 4G8XA 3KLNA 1Z9CA 3V4GA 4RB1A 2YX4A 2PQ8A 2QBYB 3RI4A 3FMRA 3E3VA 3I71A 4ASNA 2PJPA 1FBUA 3P9IA 3I53A 3F72A 3QU3A 2D2WA 2A07F 5ERIA 4HLYA 4MTEA 1UCRA 4G7ZF 3MZYA 2DBBA 2XUBA 4E70A 3RKXA 5CVUA 4HBLA 4FX0A 2XVCA 3RTRA 1L3LA 2CYYA 3L7WA 3ZP5A 5LRSA 4CICA 1ZG5A 1U5TA 1W4MA 4LLNA 2VOPA 1MJ9A 2R7DA 4L0YB 3WG9A 2VBZA 3TO9A 5FD6A 2H09A 4A0ZA 4JQFA 3MCZA 3WTTC 2FRHA 3EQLF 1SFUA 2A61A 2NAZA 2QM3A 5D6FA 1XDSA 3HSFA 1P2FA 4OOIA 4D0PA 3HOSA 2KJCA 2KIUA 3F22A 2K4BA 4GCVA 2K27A 5JHUA 3B02A 4A0YA 1KU9A 5FFZA 1YYVA 3KEOA 1OPCA 3DPLC 1LVAA 4ZYDA 2OU2A 5D8KB 2VODA 2JT1A 2UWMA 5K1YA 5EEHA 2HS5A 2AXLA 4O6JA 1ZRFA 4KIGA 2MLGA 3LA3A 2VC0A 3K69A 2NS0A 1IN8A 3WTWC 2V1XA 4EM2A 4RB0A 2STTA 2CQKA 3GXOA 5HS9A 4O5VA 1BI2A 3RYPA 1K79A 4RB3C 2MH2A 4OMYA 3RPQA 4YFKF 2EV5A 2DW4A 4MQVA 4JK1X 3M8EA 2ZBKA 4DQ2A 2J5PA 1FP2A 4HF1A 4CDGA 2DLLA 1XGSA 2P8TA 3S2WA 3U1DA 1PP8F 5CYVA 4NQWA 4CO8A 2ZO4A 1QBJA 4CYDA 3R4KA 2Q0OA 4CHUA 4EQQA 4LD5A 1KQ9A 4NHJA 1RZ4A 3GLXA 2DK8A 3F8MA 4H0EA 1RNLA 1J9IA 1O3SA 1MDMB 4HOBA 3MAJA 1KA8A 4ZH4F 1YW7A 2FQ3A 5DUIA 2GXBA 2V1UA 2EJRA 3V8LA 2L02A 4M9SA 2IRFG 3O6BB 4G7OF 4WWCA 5EEGA 4KDPA 5CLSA 2A6HF 4HDVA 1FSEA 2YPRA 3HSRA 3QP5A 3LA7A 3BWGA 3K1PA 3R6SA 3ELKA 1G3WA 3GF2A 2IA2A 1FBSA 2Q2EA 3DFGA 5JFRA 3FHZA 2V79A 3EYYA 4HF0A 4I0BA 1TW2A 4R79A 3IHUA 1TTYA 1G3SA 1J0RA 2L54A 3BZ6A 1RUOA 4GGGA 3WTXC 3DPTA 3KP6A 2DPDA 1HW2A 3HOTA 1ZGJA 2EB7A 4UVAA 2E1CA 1P4XA 4EJTA 4QLCU 3KP2A 4L9NA 2FNPA 3TOBA 4G6QA 3LAPA 4M71A 4MEYF 1T2KA 2GAUA 3WGHA 2HQNA 1TQPA 2PLYA 4P55A 5K5OA 5LGUA 1R1UA 1G3TA 5BPIA 1YO5C 3WTVC 5HDKA 2JTVA 5A2QZ 4EJUA 2Y0MA 3TDZC 1IAWA 2ESNA 3ECOA 1ZG1A 4GYGA 2DAOA 1TNSA 3T0YA 3RIRA 5ICCA 1HW1A 1LQ1A 3KZYA 6PAXA 3NQOA 1UHMA 2CSOA 2EFQA 1YS6A 2ZJ2A 2M8EA 1YW8A 3J80K 3GEZA 4GXOA 1LDKB 4L5IA 1MJAA 1FLIA 5BS6A 4M6YA 1Z6TA 3LAJA 1ZARA 4UVCA 2HTJA 2A6EF 3ABTA 1CF7A 2CW0F 2QQAA 5AIPA 2P6TA 2DK5A 4L9TA 1USSA 1EH7A 4FHTA 3LFKA 1J5YA 2W85A 1T0FA 2HQRA 3KP5A 4LK1F 5DEQA 4KYWA 1UHWA 1FNNA 5LBQA 2G7HA 2HTSA 2GA2A 1R1TA 4F7ZA 3GX4X 4BH9A 2H27A 3DF8A 5K5RA 1J75A 2RC4A 5A2QK 5D8LB 4UV8A 4K2EA 4HLXA 2W84A 3HIFA 3FXRA 2DU9A 4P96A 2HOEA 3C1DA 3I59A 2FSWA 4ESFA 3E5QA 2E7XA 2HZTA 3HSEA 1BBYA 3FWEA 3R0AA 1J7KA 1FSHA 4IJAA 4AIKA 1F4KA 1WWXA 3BJAA 1HSJA 3SZPA 1QZYA 1PDNC 1R22A 3M8FA 4EM0B 3EYIA 5HVQC 2CFXA 1U5TB 3CUQB 4KUMA 5LEJA 2OAZA 2STWA 5BQTA 2BYVE 5DCMA 4U0VA 3ZN0A 4ENNA 2Z3YA 2QQBA 4B8XA 4IRIA 5CVIA 1MZBA 4MTDA 4HX8A 4I01A 4HX7A 2E1NA 1XSVA 1XB4A 3G73A 1P4WA 4U7DA 3EDPA 4DNCA 5DYMA 2K4JA 2IA0A 5H20A 5H6RA 1FYKA 4G6DA 3WODF 3DXJF 4WXHA 1TQIA 2FMYA 2RN7A 2JSCA 1TNTA 4B09A 2OA4A 1I6XA 4RAYA 4HQMA 5DV5A 2F5CA 1H9GA 1LEBA 4BHPA 5E1XA 1KU7A 2YSRA 1IN5A 3CLOA 4LK0F 5ILSA 3CO7C 2M45A 1ODDA 1HBXG 3ERED 5JI6A 3KEQA 1BC8C 2KJBA 1Z05A 4I7HA 3D0SA 3TDUC 1O3TA 1G4DA 2CG4A 1V3FA 4WCGA 2P5LC 3F21A 3JTHA 4S05A 3F6VA 3I0TA 3FZVA 3K1NA 2FF4A 4A12A 2ESHA 4KICA 3CTAA 4OIOF 3KFWX 1AOYA 2D1HA 3E6DA 2MH9A 2FA5A 4ESJA 1U2WA 1PUEE 4A5MA 1D5VA 5L3GA 4GO1A 1GXPA 3I58A 1HKQA 2LNBA 5AONA 4UVBA 1R1VA 3ZMSA 2HEOA 2BBYA 3HRMA 2EV0A 4ZZDA 2RNJA 5ICEA 2GXGA 3BJOA 5J8FA 3HRUA 3ZPLA 5CJ9A 1F1ZA 1R5GA 3M1EA 1Z1DA 1UB9A 5ILUA 3RJPA 1LB2A 4OIPF 3VFZA 4A0XA 1E17A 2COMA 3FF5A 4WXCA 2HWVA 5FD5A 1SD7A 2Z33A 1ON1A 2F5DA 1SD5A 2ZNZA 2PG4A 4EV0A 1W7PA 2XAQA 4M9XA 4BXUA 3L2CA 1ZGAA 1YW9A 4P9UA 2QENA 5H6QA 3HRSA 2WV0A 4LG0B 4HZFA 2DO7A 4LB6B 4LB5A 2FEZA 4RGSA 3GWZA 2M5WA 2RKHA 1O3QA 2NYXA 5E1WA 1IW7F 2VE9A 4UXNA 3GUDA 4IVNA 3F8FA 3FX3A 3ULQB 3IRRA 3NEUA 3L00A 5LEKA 2XAFA 3KLOA 3K2ZA 1B1BA 1YS7A 5JVTA 2P4WA 3E6MA 3NRVA 4PZJA 1FX7A 4LMYA 5HOOA 4MQ9F 3BROA 2VBXA 4EJWA 2OZ6A 2H94A 2XIGA 1R00A 1SFEA 1XSXA 2V1DA 2HYFA 2L4AA 1STZA 2P5KA 2A5YB 4ZZLA 2K86A 3JSOA 3KCCA 1NHAA 4HW0A 1LEAA 4TV7A 3O3KA 2TDXA 2BE5F 4AD9A 1BI3A 4Z2YA 3HUGA 1X3UA 2P6SA 1SFXA 2VXZA 2G7UA 1FT9A 4XBFA 2VT3A 4N0BA 5ICGA 3B73A 4EM1A 2PFBA 1PP7U 2C6YA 2QLZA 4ETSA 3TO6A 4XLNF 1EV7A 2XGXA 3RKYA 1QPMA 3FXQA 3RYRA 4S04A 3V7RA 3C7JA 4BHBA 3ZMDA 1KYWA 5D5WB 2Y75A 2QWWA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3I54 A;  3V7C A;  1FOK A;  1IRF A;  4L9V A;  5ED4 A;  1XMA A;  4M6X A;  2W57 A;  4KMF A;  4IHT A;  3ZMV A;  4XSZ F;  2EWN A;  3M7G A;  1K7A A;  5HS8 A;  2PN6 A;  3GFJ A;  5LGN A;  3LQR A;  5LRR A;  4BHC A;  3BDD A;  4I0A A;  4HF2 A;  3I59 B;  2NNY A;  3J80 Z;  4P9F A;  2M87 A;  3JW4 A;  1U78 A;  1YQA A;  2LKP A;  4YFX F;  1XGM A;  3H3Z A;  2BGC A;  3L9F A;  3MZH A;  5HS7 A;  2Z5U A;  2ZME A;  1T98 A;  2NNN A;  4ESB A;  3C18 A;  3ZMZ A;  2EFP A;  2PI0 A;  1O57 A;  1Z91 A;  2MLK A;  5HDG A;  4M74 A;  1F9N A;  4A6D A;  1QO0 D;  4Y13 A;  4EJV A;  3BOQ A;  3REO A;  4EMS A;  1YLF A;  5FGM A;  4MGR A;  1OYY A;  3G3Z A;  3WTY C;  4HX4 A;  3Q9S A;  4UHT A;  3ML6 A;  3H3U A;  2FNA A;  2VBW A;  2XAH A;  3IWZ A;  1S6L A;  5HDN A;  1ZYR F;  1DP7 P;  1E2X A;  4AWX B;  3T5X A;  3F8B A;  1BOA A;  1TW3 A;  4HAM A;  1HKS A;  4PGG A;  1XSD A;  1K78 B;  1REP C;  1SAX A;  3IL2 A;  4WK8 F;  4YII A;  1K6O A;  1MJB A;  3T8T A;  3WGG A;  1JXS A;  3BP8 A;  3GZ6 A;  1MKM A;  2O6G E;  1I27 A;  4UUV A;  2LF7 A;  4HV6 A;  2BV6 A;  3IWF A;  1I5Z A;  1QGP A;  2CWE A;  2KIM A;  1O3R A;  1XDU A;  4LGW A;  3OV8 A;  3RPU A;  2L01 A;  3M9A A;  5LHH A;  4KN7 X;  1BIB A;  3WU0 A;  2P7C B;  2IJL A;  1S3J A;  4A6E A;  5E18 F;  3VOE A;  4ENK A;  4N9I A;  1IXC A;  2VON A;  2QVO A;  3TKY A;  5L3E A;  2FBI A;  2P5V A;  5CVR A;  5TRD A;  4M9Z A;  2QYO A;  4KT5 C;  2DTR A;  2FML A;  1MDM A;  3V7S A;  3K1M A;  2FU4 A;  3KP7 A;  5FFX A;  2RQP A;  2KIF A;  5FO5 A;  1R7J A;  2OQG A;  3JSP A;  1IXS B;  1UFM A;  1OKR A;  4RGU A;  2XRO A;  1H9T A;  1TBX A;  3F23 A;  1KU3 A;  4PDK A;  1B4A A;  1EH8 A;  2G9W A;  2Z9O A;  1KQ8 A;  4EGZ A;  1DDN A;  2LSO A;  1WQ2 A;  2A3S A;  2ELH A;  1ZH5 A;  4IPA A;  2DQL A;  2EFN A;  4BQA A;  4RGR A;  2EK5 A;  2UZK A;  4ZYG A;  1FYM A;  5IT3 A;  1U3E M;  3P9C A;  1R36 A;  3EUH A;  2PMU A;  5F1R A;  3GFL A;  1SD4 A;  2IVM A;  3MWM A;  4WXD A;  1R23 A;  5E8I A;  3RDI A;  2IT0 A;  4RB2 C;  1ZAO A;  2BEO A;  3KP3 A;  4IRH A;  4IRG A;  2RV8 A;  1HXD A;  1ONV A;  2HDC A;  4UV9 A;  2W24 A;  1Y0U A;  5K5Q A;  2HKO A;  2CO5 A;  2ZCW A;  3KZZ A;  1FWZ A;  4KIF A;  3F8N A;  4G9Y A;  2DI3 A;  1RI7 A;  2KKO A;  1QQI A;  4I2O A;  1ZLJ A;  1BN5 A;  2EFO A;  5DUK A;  3K0L A;  3WE2 A;  2ISY A;  4R8H A;  1YTY A;  1V4R A;  1LDJ A;  5BOX A;  4Y17 A;  3TO7 A;  5D4S A;  4Q47 A;  4LFU A;  5D4R A;  1S7A A;  3KE2 A;  1D8K A;  5L3C A;  1EH6 A;  3KP4 A;  1JE8 A;  4KIB A;  5LHG A;  4HV5 A;  3RKW A;  1T6S A;  4Q48 A;  2FOK A;  5L3D A;  4EVI A;  2D45 A;  2YX7 A;  1J2X A;  1JHH A;  2JRT A;  2YU3 A;  2XAJ A;  4FT8 A;  4PGH A;  4IF4 A;  2P7V B;  2ACJ A;  3CJN A;  4BYY A;  3D5L A;  4LJZ F;  1R5H A;  2GA1 A;  4WX9 A;  1RUN A;  5BMZ A;  1ZRC A;  1ZLK A;  2X0L A;  3QP6 A;  1XGO A;  2LDU A;  3I5U A;  3QPT A;  3GFM A;  3SZT A;  4LLL A;  3GVA A;  1WI9 A;  3SQN A;  4KFC A;  2UXX A;  4XSX F;  4KN4 X;  4M72 A;  4L5J A;  3E6B A;  3SHF A;  3DEU A;  4KNY A;  1ZG3 A;  1HW5 A;  1ZN2 A;  1U8R A;  5FB2 A;  2MBF A;  4XLP F;  1KGS A;  1HST A;  1DPU A;  1DPR A;  1ZRD A;  3CUQ A;  1FZP B;  3C3W A;  2PEX A;  3QPH A;  1XCB A;  2FXA A;  4Q4Z F;  5F6F A;  3BPV A;  2XV4 S;  3WGI A;  3SXY A;  1MGT A;  1BI0 A;  1KQ0 A;  3ABU A;  5E1Z B;  1BI1 A;  4G94 A;  2O3F A;  3TOA A;  1T38 A;  5DD8 A;  2ZFW A;  1O7F A;  2RDP A;  2ZXJ A;  1SMT A;  2ZME B;  3GYH X;  4WF2 A;  3DV8 A;  1W5T A;  2F5F A;  1IUY A;  1IRG A;  4Q5S F;  3I4P A;  3TQN A;  3V8J A;  1XD7 A;  1HQC A;  1HKT A;  1OR7 A;  3I64 A;  2O03 A;  1FPQ A;  5D6E A;  2EV6 A;  3CO6 C;  1MD0 A;  1ULY A;  2QZ8 A;  3J7A O;  3OOP A;  1L0O C;  2JPB A;  3ISP A;  5BPD A;  1U6G A;  3ROU A;  4O3M A;  4A2U A;  4OIR F;  5D5U B;  3F8C A;  2R7F A;  3VOD A;  1JGS A;  3HRT A;  3ZMT A;  1DUX C;  5LGT A;  1FC3 A;  1LDD A;  2EA2 A;  4CZZ A;  3QU6 A;  3JAM Z;  4FX4 A;  4RAZ A;  2A68 F;  3ZN1 A;  3P7N A;  1YFH A;  2X4H A;  1W7P D;  2HGC A;  2J5O A;  1P4A A;  3GW2 A;  1FP1 D;  1Z6R A;  1C0W A;  1P92 A;  1QNT A;  4HA8 A;  2MA3 A;  2E7W A;  3O2P E;  4ON0 A;  1UST A;  1CF7 B;  2IP2 A;  4ZYH A;  2QBY A;  5E17 F;  3WTS C;  1S8N A;  5E20 A;  5LLQ A;  2L4M A;  3VB2 A;  3F6O A;  5KVR A;  3FXU A;  4YIF A;  3LST A;  1ZHF A;  2GWR A;  1D3Y A;  4Y15 A;  1GVJ A;  5AIQ A;  2GQQ A;  5TJJ A;  1IXR C;  3IKT A;  1I1S A;  4HDU A;  2UXN A;  1FY7 A;  3R0J A;  4BAY A;  2ADU A;  2VC1 A;  2XKP A;  2QQ9 A;  1CGP A;  1B9N A;  5HLG A;  2EFW A;  1G3Y A;  3HYI A;  2WC2 A;  3BY6 A;  2VOO A;  2IA1 A;  2GZW A;  4EGY A;  2B0L A;  4OU0 A;  2F5E A;  2ZNY A;  3FM3 A;  2H6B A;  4OMZ A;  3VEP A;  2VE8 A;  3E5U A;  4LG0 A;  4P5O A;  4U88 A;  2XKO A;  2DT5 A;  5FLX Z;  3Q5F A;  1ON2 A;  5CVV A;  5DDG A;  3JAM K;  4GYI A;  1KU2 A;  4RGX A;  2OD5 A;  1XN7 A;  4A5N A;  2DPU A;  1OYI A;  2JZY A;  3CUO A;  4BNC A;  1IN7 A;  2Y48 A;  1QZZ A;  5ICF A;  1BJA A;  3IC7 A;  5DCM B;  1ZRE A;  1OYW A;  3DQV C;  3ZMU A;  4U0Y A;  5CVJ A;  3F3X A;  2WTE A;  3JTG A;  2MD5 A;  2V6C A;  1LNW A;  3E5X A;  4HQE A;  4L0Z B;  3EET A;  2PMH A;  5L3F A;  1S7O A;  3PFI A;  4I09 A;  3QOP A;  3SFZ A;  3ECH A;  2FBH A;  1IN4 A;  3WTZ A;  1LJ9 A;  3MFK A;  5L3B A;  2O8X A;  3FMS A;  2NRA C;  4RS8 A;  3V8K A;  1BM9 A;  3K9T A;  4YFN F;  3U9G A;  2HR3 A;  3LWF A;  2HYG D;  2IPQ X;  4AIJ A;  3FMQ A;  5FLX K;  3COA C;  4XRF A;  1IF1 A;  1TLH B;  4AIH A;  1BC7 C;  3L09 A;  4UNO A;  3T8R A;  2Z99 A;  2DFI A;  3MQ0 A;  1BIA A;  4M73 A;  3LA2 A;  3IRQ A;  2VBY A;  2XHK A;  3TGN A;  1GXQ A;  2WWY A;  2OBP A;  3W6J B;  2AS5 F;  3QAH A;  4OIN F;  1WKM A;  1XMK A;  2ETH A;  3CDH A;  2QUF A;  3PQK A;  2OQR A;  5DD4 A;  1F5T A;  1U5T C;  3CUQ C;  5HLI A;  2HKX A;  1XCV A;  3WTU C;  1TQM A;  2D1V A;  3AAF A;  4MNU A;  2FBK A;  4EJO A;  2CGP A;  4PCQ A;  5J8C A;  1AWC A;  1IN6 A;  1SMY F;  4MEX F;  5D5V B;  2OZU A;  4CGZ A;  2M30 A;  4ENM A;  4IHS A;  4ZYE A;  5HLH A;  1R58 A;  5LHI A;  2V9V A;  2A69 F;  2RVC A;  4L18 B;  2K7L A;  4U0W A;  1B6A A;  3R61 A;  2FE3 A;  3BPX A;  4N9H A;  1JHF A;  1VTN C;  4CXF A;  1G6N A;  1OMI A;  2IW5 A;  2R3S A;  4IXA A;  3N4M A;  5J6X A;  4R1H A;  3T1B A;  4JBA A;  1W7P B;  2DQR A;  3E97 A;  3U2R A;  5IT9 Z;  3FM5 A;  3P9K A;  2W25 A;  3LQQ A;  2M1B A;  4ENJ A;  2F2E A;  5E8G A;  4QWQ A;  1WSU A;  1FBQ A;  2MC3 A;  5F64 A;  2Q8K A;  2JPC A;  4OIQ F;  3HTS B;  2XAS A;  5ILV A;  1IZ1 A;  4I02 A;  3HHG A;  3J81 Z;  3ZQ7 A;  1T39 A;  3BJ6 A;  4LLG F;  4HYE A;  1P6R A;  3H92 A;  2O61 A;  2GIV A;  1YIO A;  3PQJ A;  2RGV A;  2PBI A;  1GHC A;  3HTU A;  1XGN A;  4YG2 F;  4G7H F;  5DCF A;  3R60 A;  3GFI A;  2ISZ A;  1K78 A;  2ZKZ A;  1FYL A;  3W6K B;  4NB5 A;  1J59 A;  1KYZ A;  1A04 A;  3Q9V A;  3N97 A;  1WRJ A;  1H0M A;  1B9M A;  2XRN A;  1O7L A;  1I1G A;  4AVP A;  3WE3 A;  2L3D A;  4U7B A;  3QRF F;  1YG2 A;  1RIO H;  5KK1 A;  3MEX A;  2K02 A;  1W5S A;  2LF8 A;  3DKW A;  1B59 A;  2H6C A;  1SD6 A;  5IT9 K;  5D5X B;  1Z7U A;  3GZ5 A;  3E6C C;  2O0Y A;  1S29 A;  3HHH A;  4MHG A;  2VN2 A;  2XAG A;  4I98 B;  4KA4 A;  1D8J A;  3GO5 A;  2VT2 A;  3KET A;  1Q1H A;  2HFH A;  3DP7 A;  4L9J A;  2EA4 A;  4KMU X;  3J81 K;  3IKV A;  3WU1 B;  2KRF A;  5JR3 A;  2YR2 A;  4G8X A;  3KLN A;  1Z9C A;  3V4G A;  4RB1 A;  2YX4 A;  2PQ8 A;  2QBY B;  3RI4 A;  3FMR A;  3E3V A;  3I71 A;  4ASN A;  2PJP A;  1FBU A;  3P9I A;  3I53 A;  3F72 A;  3QU3 A;  2D2W A;  2A07 F;  5ERI A;  4HLY A;  4MTE A;  1UCR A;  4G7Z F;  3MZY A;  2DBB A;  2XUB A;  4E70 A;  3RKX A;  5CVU A;  4HBL A;  4FX0 A;  2XVC A;  3RTR A;  1L3L A;  2CYY A;  3L7W A;  3ZP5 A;  5LRS A;  4CIC A;  1ZG5 A;  1U5T A;  1W4M A;  4LLN A;  2VOP A;  1MJ9 A;  2R7D A;  4L0Y B;  3WG9 A;  2VBZ A;  3TO9 A;  5FD6 A;  2H09 A;  4A0Z A;  4JQF A;  3MCZ A;  3WTT C;  2FRH A;  3EQL F;  1SFU A;  2A61 A;  2NAZ A;  2QM3 A;  5D6F A;  1XDS A;  3HSF A;  1P2F A;  4OOI A;  4D0P A;  3HOS A;  2KJC A;  2KIU A;  3F22 A;  2K4B A;  4GCV A;  2K27 A;  5JHU A;  3B02 A;  4A0Y A;  1KU9 A;  5FFZ A;  1YYV A;  3KEO A;  1OPC A;  3DPL C;  1LVA A;  4ZYD A;  2OU2 A;  5D8K B;  2VOD A;  2JT1 A;  2UWM A;  5K1Y A;  5EEH A;  2HS5 A;  2AXL A;  4O6J A;  1ZRF A;  4KIG A;  2MLG A;  3LA3 A;  2VC0 A;  3K69 A;  2NS0 A;  1IN8 A;  3WTW C;  2V1X A;  4EM2 A;  4RB0 A;  2STT A;  2CQK A;  3GXO A;  5HS9 A;  4O5V A;  1BI2 A;  3RYP A;  1K79 A;  4RB3 C;  2MH2 A;  4OMY A;  3RPQ A;  4YFK F;  2EV5 A;  2DW4 A;  4MQV A;  4JK1 X;  3M8E A;  2ZBK A;  4DQ2 A;  2J5P A;  1FP2 A;  4HF1 A;  4CDG A;  2DLL A;  1XGS A;  2P8T A;  3S2W A;  3U1D A;  1PP8 F;  5CYV A;  4NQW A;  4CO8 A;  2ZO4 A;  1QBJ A;  4CYD A;  3R4K A;  2Q0O A;  4CHU A;  4EQQ A;  4LD5 A;  1KQ9 A;  4NHJ A;  1RZ4 A;  3GLX A;  2DK8 A;  3F8M A;  4H0E A;  1RNL A;  1J9I A;  1O3S A;  1MDM B;  4HOB A;  3MAJ A;  1KA8 A;  4ZH4 F;  1YW7 A;  2FQ3 A;  5DUI A;  2GXB A;  2V1U A;  2EJR A;  3V8L A;  2L02 A;  4M9S A;  2IRF G;  3O6B B;  4G7O F;  4WWC A;  5EEG A;  4KDP A;  5CLS A;  2A6H F;  4HDV A;  1FSE A;  2YPR A;  3HSR A;  3QP5 A;  3LA7 A;  3BWG A;  3K1P A;  3R6S A;  3ELK A;  1G3W A;  3GF2 A;  2IA2 A;  1FBS A;  2Q2E A;  3DFG A;  5JFR A;  3FHZ A;  2V79 A;  3EYY A;  4HF0 A;  4I0B A;  1TW2 A;  4R79 A;  3IHU A;  1TTY A;  1G3S A;  1J0R A;  2L54 A;  3BZ6 A;  1RUO A;  4GGG A;  3WTX C;  3DPT A;  3KP6 A;  2DPD A;  1HW2 A;  3HOT A;  1ZGJ A;  2EB7 A;  4UVA A;  2E1C A;  1P4X A;  4EJT A;  4QLC U;  3KP2 A;  4L9N A;  2FNP A;  3TOB A;  4G6Q A;  3LAP A;  4M71 A;  4MEY F;  1T2K A;  2GAU A;  3WGH A;  2HQN A;  1TQP A;  2PLY A;  4P55 A;  5K5O A;  5LGU A;  1R1U A;  1G3T A;  5BPI A;  1YO5 C;  3WTV C;  5HDK A;  2JTV A;  5A2Q Z;  4EJU A;  2Y0M A;  3TDZ C;  1IAW A;  2ESN A;  3ECO A;  1ZG1 A;  4GYG A;  2DAO A;  1TNS A;  3T0Y A;  3RIR A;  5ICC A;  1HW1 A;  1LQ1 A;  3KZY A;  6PAX A;  3NQO A;  1UHM A;  2CSO A;  2EFQ A;  1YS6 A;  2ZJ2 A;  2M8E A;  1YW8 A;  3J80 K;  3GEZ A;  4GXO A;  1LDK B;  4L5I A;  1MJA A;  1FLI A;  5BS6 A;  4M6Y A;  1Z6T A;  3LAJ A;  1ZAR A;  4UVC A;  2HTJ A;  2A6E F;  3ABT A;  1CF7 A;  2CW0 F;  2QQA A;  5AIP A;  2P6T A;  2DK5 A;  4L9T A;  1USS A;  1EH7 A;  4FHT A;  3LFK A;  1J5Y A;  2W85 A;  1T0F A;  2HQR A;  3KP5 A;  4LK1 F;  5DEQ A;  4KYW A;  1UHW A;  1FNN A;  5LBQ A;  2G7H A;  2HTS A;  2GA2 A;  1R1T A;  4F7Z A;  3GX4 X;  4BH9 A;  2H27 A;  3DF8 A;  5K5R A;  1J75 A;  2RC4 A;  5A2Q K;  5D8L B;  4UV8 A;  4K2E A;  4HLX A;  2W84 A;  3HIF A;  3FXR A;  2DU9 A;  4P96 A;  2HOE A;  3C1D A;  3I59 A;  2FSW A;  4ESF A;  3E5Q A;  2E7X A;  2HZT A;  3HSE A;  1BBY A;  3FWE A;  3R0A A;  1J7K A;  1FSH A;  4IJA A;  4AIK A;  1F4K A;  1WWX A;  3BJA A;  1HSJ A;  3SZP A;  1QZY A;  1PDN C;  1R22 A;  3M8F A;  4EM0 B;  3EYI A;  5HVQ C;  2CFX A;  1U5T B;  3CUQ B;  4KUM A;  5LEJ A;  2OAZ A;  2STW A;  5BQT A;  2BYV E;  5DCM A;  4U0V A;  3ZN0 A;  4ENN A;  2Z3Y A;  2QQB A;  4B8X A;  4IRI A;  5CVI A;  1MZB A;  4MTD A;  4HX8 A;  4I01 A;  4HX7 A;  2E1N A;  1XSV A;  1XB4 A;  3G73 A;  1P4W A;  4U7D A;  3EDP A;  4DNC A;  5DYM A;  2K4J A;  2IA0 A;  5H20 A;  5H6R A;  1FYK A;  4G6D A;  3WOD F;  3DXJ F;  4WXH A;  1TQI A;  2FMY A;  2RN7 A;  2JSC A;  1TNT A;  4B09 A;  2OA4 A;  1I6X A;  4RAY A;  4HQM A;  5DV5 A;  2F5C A;  1H9G A;  1LEB A;  4BHP A;  5E1X A;  1KU7 A;  2YSR A;  1IN5 A;  3CLO A;  4LK0 F;  5ILS A;  3CO7 C;  2M45 A;  1ODD A;  1HBX G;  3ERE D;  5JI6 A;  3KEQ A;  1BC8 C;  2KJB A;  1Z05 A;  4I7H A;  3D0S A;  3TDU C;  1O3T A;  1G4D A;  2CG4 A;  1V3F A;  4WCG A;  2P5L C;  3F21 A;  3JTH A;  4S05 A;  3F6V A;  3I0T A;  3FZV A;  3K1N A;  2FF4 A;  4A12 A;  2ESH A;  4KIC A;  3CTA A;  4OIO F;  3KFW X;  1AOY A;  2D1H A;  3E6D A;  2MH9 A;  2FA5 A;  4ESJ A;  1U2W A;  1PUE E;  4A5M A;  1D5V A;  5L3G A;  4GO1 A;  1GXP A;  3I58 A;  1HKQ A;  2LNB A;  5AON A;  4UVB A;  1R1V A;  3ZMS A;  2HEO A;  2BBY A;  3HRM A;  2EV0 A;  4ZZD A;  2RNJ A;  5ICE A;  2GXG A;  3BJO A;  5J8F A;  3HRU A;  3ZPL A;  5CJ9 A;  1F1Z A;  1R5G A;  3M1E A;  1Z1D A;  1UB9 A;  5ILU A;  3RJP A;  1LB2 A;  4OIP F;  3VFZ A;  4A0X A;  1E17 A;  2COM A;  3FF5 A;  4WXC A;  2HWV A;  5FD5 A;  1SD7 A;  2Z33 A;  1ON1 A;  2F5D A;  1SD5 A;  2ZNZ A;  2PG4 A;  4EV0 A;  1W7P A;  2XAQ A;  4M9X A;  4BXU A;  3L2C A;  1ZGA A;  1YW9 A;  4P9U A;  2QEN A;  5H6Q A;  3HRS A;  2WV0 A;  4LG0 B;  4HZF A;  2DO7 A;  4LB6 B;  4LB5 A;  2FEZ A;  4RGS A;  3GWZ A;  2M5W A;  2RKH A;  1O3Q A;  2NYX A;  5E1W A;  1IW7 F;  2VE9 A;  4UXN A;  3GUD A;  4IVN A;  3F8F A;  3FX3 A;  3ULQ B;  3IRR A;  3NEU A;  3L00 A;  5LEK A;  2XAF A;  3KLO A;  3K2Z A;  1B1B A;  1YS7 A;  5JVT A;  2P4W A;  3E6M A;  3NRV A;  4PZJ A;  1FX7 A;  4LMY A;  5HOO A;  4MQ9 F;  3BRO A;  2VBX A;  4EJW A;  2OZ6 A;  2H94 A;  2XIG A;  1R00 A;  1SFE A;  1XSX A;  2V1D A;  2HYF A;  2L4A A;  1STZ A;  2P5K A;  2A5Y B;  4ZZL A;  2K86 A;  3JSO A;  3KCC A;  1NHA A;  4HW0 A;  1LEA A;  4TV7 A;  3O3K A;  2TDX A;  2BE5 F;  4AD9 A;  1BI3 A;  4Z2Y A;  3HUG A;  1X3U A;  2P6S A;  1SFX A;  2VXZ A;  2G7U A;  1FT9 A;  4XBF A;  2VT3 A;  4N0B A;  5ICG A;  3B73 A;  4EM1 A;  2PFB A;  1PP7 U;  2C6Y A;  2QLZ A;  4ETS A;  3TO6 A;  4XLN F;  1EV7 A;  2XGX A;  3RKY A;  1QPM A;  3FXQ A;  3RYR A;  4S04 A;  3V7R A;  3C7J A;  4BHB A;  3ZMD A;  1KYW A;  5D5W B;  2Y75 A;  2QWW A; 
#chains in the Genus database with same CATH topology
 3I54 A;  3BG3 A;  4PFO A;  3V7C A;  1FOK A;  1IRF A;  4L9V A;  1MW7 A;  5ED4 A;  1XMA A;  4AUX A;  5FRM A;  4M6X A;  2W57 A;  4KMF A;  4IHT A;  3ZMV A;  4XSZ F;  2EWN A;  3M7G A;  1K7A A;  5HS8 A;  2PN6 A;  3GFJ A;  5LGN A;  2UV1 A;  3LQR A;  5LRR A;  2M2E A;  4BHC A;  4D5C A;  3BDD A;  4I0A A;  4HF2 A;  1QZE A;  3I59 B;  1HLV A;  1VQO I;  2JA5 J;  2NNY A;  3J80 Z;  2X6O A;  4P9F A;  3CCS I;  1RES A;  4BUP A;  2M87 A;  3JW4 A;  3PNV A;  2VKE A;  4DIQ A;  1YQA A;  2LKP A;  3NAU A;  1U78 A;  4H4K C;  1XGM A;  1WJD A;  4YFX F;  3CZ6 A;  2BGC A;  3H3Z A;  4E7J A;  4DW6 A;  2JUG A;  2Z1D A;  3L9F A;  3MZH A;  5HS7 A;  1JJ6 C;  3S1Q J;  3H5R A;  3GTQ J;  2Z5U A;  1LVK A;  2ZME A;  2F6C A;  4MFE A;  1T98 A;  2V1N A;  2KL4 A;  2NNN A;  4ESB A;  1UEL B;  3C18 A;  2ELJ A;  3ZMZ A;  2EFP A;  4DYR A;  1O57 A;  1Z91 A;  2ZXI A;  1T8I A;  2PI0 A;  2MLK A;  3VPR A;  4A3G J;  5HDG A;  4M74 A;  1F9N A;  2KDO A;  4XL9 A;  1WFX A;  3OS1 A;  4A6D A;  3PO2 J;  1QO0 D;  3OOU A;  3MVP A;  4Y13 A;  3OL3 A;  1WJB A;  3BOQ A;  1G8X A;  4EJV A;  1IDY A;  3H0G J;  3REO A;  2Y0S A;  4EMS A;  1GV5 A;  1XMX A;  2E1O A;  1YLF A;  3RKQ A;  5FGM A;  1MSF C;  4MGR A;  1OYY A;  3G3Z A;  3WTY C;  4HX4 A;  1UG0 A;  5FKN A;  3Q9S A;  4YRV A;  3IAS 2;  2K9S A;  4MO7 A;  3M4O J;  4UHT A;  3ML6 A;  5JLX A;  3H3U A;  2FNA A;  2VBW A;  4PSX A;  4XOP A;  5EG0 A;  2R0Q C;  1K4S A;  4BQO A;  1EJ9 A;  3CC4 I;  1MMN A;  2XAH A;  2NVU B;  2HNH A;  3UR3 C;  1MMD A;  3IWZ A;  2MFZ A;  4A3I J;  1JI8 A;  1E3P A;  3RQ4 A;  1S6L A;  2FX0 A;  1ZYR F;  5HDN A;  3DLA A;  1E3H A;  1DP7 P;  3BTC A;  1E2X A;  4AWX B;  2E60 A;  3T5X A;  3F8B A;  1YRN B;  1BOA A;  1TW3 A;  2W7N A;  4HAM A;  1HKS A;  3A01 B;  3CCM I;  4PGG A;  1XSD A;  1K78 B;  1REP C;  1ETY A;  1SAX A;  3S16 J;  3IL2 A;  1YOV B;  1W36 C;  4WK8 F;  2DA3 A;  4YII A;  1K6O A;  1MJB A;  3PUB A;  3T8T A;  4F3Q A;  1Y56 A;  3WGG A;  3BP8 A;  1JXS A;  5M5W J;  4XNF A;  3GZ6 A;  1MKM A;  2O6G E;  1MSE C;  4FQG A;  2IS6 A;  5EZG A;  1I27 A;  4UUV A;  2LF7 A;  4HV6 A;  1SAN A;  2BV6 A;  3IWF A;  1I5Z A;  1QGP A;  4MLO A;  2CWE A;  2KIM A;  3OWT A;  3J7Y J;  1O3R A;  1XDU A;  4LGW A;  3I4M J;  3OV8 A;  3VWB A;  2Q1Z B;  4N4N B;  1WH5 A;  2O7O A;  3ASN H;  3BTI A;  1V5E A;  2M4K A;  3I3L A;  3RPU A;  1IG7 A;  3CF2 A;  2L01 A;  3CF5 F;  3M9A A;  3DEW A;  5LHH A;  4KN7 X;  1VQ6 I;  1BIB A;  3WU0 A;  2QSG X;  2P7C B;  1X2M A;  1T08 B;  3S3O A;  1RR7 A;  2IJL A;  1VQN I;  5FLV A;  1S3J A;  4A6E A;  5F0F A;  5E18 F;  3VOE A;  4N9I A;  4ENK A;  1IXC A;  3OIP A;  4BBR J;  2VON A;  2QVO A;  1FIP A;  3K4J A;  3TKY A;  2P0W A;  2FBI A;  3DBR B;  5L3E A;  1H8A C;  2K40 A;  2JA7 J;  4A3L J;  2P5V A;  5CVR A;  5TRD A;  4M9Z A;  1NTC A;  2BVM A;  2XSD C;  3HOV J;  2QYO A;  3H5N A;  1YJW I;  1MIJ A;  4BJ6 C;  4B44 A;  1OCP A;  4KT5 C;  3SFI A;  2DTR A;  2FML A;  1MDM A;  3V7S A;  3K1M A;  2FU4 A;  3GTO J;  1WHU A;  4W1U A;  4YEL A;  4HG2 A;  4A3D J;  5F0H A;  4BE1 A;  2QA4 I;  3KP7 A;  2JA2 A;  3C2G A;  5FFX A;  2RQP A;  3KYC B;  5DM6 F;  2KIF A;  5FO5 A;  1JTY A;  1R7J A;  2OQG A;  4XQF A;  3JSP A;  1IXS B;  2NVX J;  1UFM A;  1NK3 P;  3VYT B;  1OKR A;  1W5C C;  4RGU A;  2XRO A;  1H9T A;  4LOC A;  1TBX A;  3F23 A;  4HST A;  2MG4 A;  2DDB A;  1KU3 A;  4PDK A;  2LRD A;  1B4A A;  1BW6 A;  3L2U A;  1V55 H;  1EH8 A;  2WB1 A;  4I99 C;  2G9W A;  2Z9O A;  4I6Z A;  3CD6 I;  4XOR A;  1S7E A;  1KQ8 A;  4EGZ A;  2BY2 A;  3FIS A;  1MMS A;  3K4N A;  2VLA A;  4GRI A;  2DTZ A;  5CQG A;  2EZH A;  2PX9 A;  4RMN A;  2MYS A;  1DDN A;  4ZDL A;  2LSO A;  4JX4 A;  1WQ2 A;  1HOM A;  2A3S A;  2ELH A;  4II2 A;  4BL0 B;  1XTA A;  4IPA A;  1ZH5 A;  2GOX B;  1LKX A;  2ZJR F;  2DQL A;  3H36 A;  1OR7 C;  2EFN A;  4QIW N;  4RGR A;  4BQA A;  2K9L A;  4QSH A;  2X1D A;  1ZR2 A;  2EK5 A;  2UZK A;  4ZYG A;  1FYM A;  5IT3 A;  3S2H J;  3FBN B;  1U3E M;  1IO2 A;  1N75 A;  3P9C A;  2LTP A;  3OYD A;  3QYE A;  2Y31 A;  1R36 A;  4IHY A;  3EUH A;  4XOT A;  3A0H C;  3OIQ A;  4IQ4 A;  2PMU A;  2BOL A;  5F1R A;  2BW3 B;  3GFL A;  3TED A;  1MBH A;  3C2B A;  1SD4 A;  4NUB A;  4A69 C;  2IVM A;  2BXY A;  3MWM A;  1IDZ A;  5GTI C;  2IGO A;  2H1K A;  3V42 A;  4WXD A;  1R23 A;  2ZC2 A;  5F04 A;  1R49 A;  5E8I A;  3RDI A;  3H1C A;  4E4H A;  5EDN A;  2IT0 A;  2B63 J;  3PM1 A;  3BR0 A;  4RB2 C;  3HDD A;  1U8B A;  1ZAO A;  2BY1 A;  2BEO A;  3KP3 A;  1SVL A;  2DA1 A;  4IRH A;  4IRG A;  3GLL A;  4NNJ A;  2RV8 A;  2KHM A;  3HOZ J;  3AG1 H;  1EA3 A;  2QGU A;  1HXD A;  1ONV A;  2X85 A;  1VQL I;  2HDC A;  4J19 A;  1I3Q J;  2Y0S N;  4UV9 A;  2W24 A;  1UMQ A;  1Y0U A;  2EH3 A;  5K5Q A;  4ABZ A;  2HKO A;  2CO5 A;  1X2N A;  2ZCW A;  3KZZ A;  1FWZ A;  4KIF A;  2IS2 A;  3F8N A;  4G9Y A;  2DI3 A;  1RI7 A;  2KKO A;  3OR1 C;  1QHG A;  1QQI A;  4I2O A;  1ZLJ A;  2R7U A;  1BN5 A;  2EFO A;  2XF7 A;  2OV7 A;  5DUK A;  5J4Y A;  3K7A J;  3K0L A;  3K4B A;  5GAE J;  1P7J A;  3WE2 A;  2ISY A;  1GVD A;  2E1M B;  4R8H A;  3S1M J;  1YTY A;  1V4R A;  4IEJ A;  1LDJ A;  4XK4 A;  4FE7 A;  4B48 A;  5BOX A;  3N05 A;  4Y17 A;  4A3M J;  3TO7 A;  5D4S A;  4Q47 A;  1HDP A;  4LFU A;  3CQZ J;  5D4R A;  1S7A A;  2AXT C;  3KE2 A;  2WAQ A;  1ORK A;  1OJL A;  1D8K A;  2LVS A;  4DJA A;  5L3C A;  1EH6 A;  1D0X A;  4BE2 A;  2EQR A;  3KP4 A;  1FEX A;  2IEK A;  4A3C J;  2K5C A;  4BQQ A;  1JE8 A;  2HYJ A;  3BR3 A;  4XLF A;  4KIB A;  2VXD A;  2X1E A;  5FKM A;  5LHG A;  3MKW B;  3K4C A;  4HV5 A;  3RKW A;  1T6S A;  4Q48 A;  2PMZ A;  2FOK A;  5L3D A;  2XGD A;  3MD2 A;  4EVI A;  1VZ0 A;  2K9Q A;  3FK7 A;  2D45 A;  3TBI A;  1BL0 A;  2LKX A;  2YX7 A;  1J2X A;  1JHH A;  2JRT A;  2YU3 A;  2NS8 A;  2XAJ A;  4DBQ A;  4FT8 A;  4PGH A;  2K9N A;  3HEF A;  4IF4 A;  5EGO A;  1G59 A;  3CC7 I;  3FXO A;  4HRI A;  2P7V B;  2ACJ A;  2LBF A;  3CJN A;  4BYY A;  3D5L A;  4LJZ F;  3S93 A;  2EPF A;  4NQW B;  2R7X A;  1R5H A;  2GA1 A;  4WX9 A;  4AID A;  1RUN A;  1QVU A;  1TWA J;  4D7N A;  2A5W A;  2OTJ I;  5BMZ A;  1ZRC A;  1ZLK A;  1FIA A;  3JRB A;  2X0L A;  3QP6 A;  1XGO A;  2LDU A;  3I5U A;  2W82 A;  3QPT A;  2XAU A;  3GFM A;  4PJ0 C;  3SZT A;  5FRO A;  1I39 A;  2E71 A;  2YS9 A;  2HQ5 A;  4LLL A;  4UB6 C;  3GVA A;  1WI9 A;  3LSH A;  3SQN A;  1ZR4 A;  1FMW A;  4M3F A;  4KFC A;  2UXX A;  4XSX F;  1PUF B;  4KN4 X;  4M72 A;  4L5J A;  2ZSH B;  3E6B A;  2I10 A;  3SHF A;  3DEU A;  4Y3O A;  3IP4 B;  3H5A A;  4D5F A;  4KNY A;  1ZG3 A;  4XN0 A;  5K7F A;  3H3V K;  1HW5 A;  1Z0X A;  1ZN2 A;  4RAG A;  1U8R A;  2CQ7 A;  1H88 C;  4HNU A;  5FB2 A;  5CPR B;  2OTL I;  2HVQ A;  2MBF A;  3M07 A;  1KGS A;  1HST A;  1RC9 A;  2X1C A;  3HPG A;  4RM2 A;  4CCK A;  4XLP F;  1DPU A;  2CS3 A;  1DPR A;  3LNQ A;  4A3J J;  1ZRD A;  3CUQ A;  1D0Z A;  1FZP B;  3C3W A;  2PEX A;  3HOX J;  3QPH A;  1XCB A;  4L5E A;  4JX5 A;  4HSR A;  1NG7 A;  2FXA A;  4Q4Z F;  5F6F A;  3BPV A;  2BY3 A;  2XV4 S;  3TW7 A;  2Q2E B;  1OIS A;  2DMN A;  3WGI A;  3SXY A;  1MGT A;  5M3M J;  2H8R A;  1BI0 A;  1KQ0 A;  2DFF A;  5M5Y J;  3TL4 X;  1YI2 I;  2DA7 A;  2B7E A;  3ABU A;  5HNH A;  3RZO J;  3DTK A;  3AL0 C;  2AQE A;  3IH3 A;  5E1Z B;  3B6A A;  1BI1 A;  4G94 A;  2O3F A;  2QKM B;  3TOA A;  1T38 A;  5IYB J;  4A3K J;  5DD8 A;  2ZFW A;  2HVR A;  2R4G A;  1O7F A;  2RDP A;  1Y0N A;  2ZXJ A;  1SMT A;  2ZME B;  3GYH X;  4WF2 A;  3DV8 A;  3I55 I;  1MBE A;  1NG6 A;  4ZJZ A;  2NOG A;  1W5T A;  2XRL A;  2F5F A;  1IUY A;  3OMY A;  1IRG A;  5F0C A;  3NWT A;  2KIS A;  4Q5S F;  3GTG J;  3I4P A;  1ACI A;  3DBH B;  3B6C A;  3TQN A;  1W1W E;  5B1B H;  3V8J A;  2VAS A;  1XD7 A;  1HQC A;  2DT7 B;  2BY0 A;  1HKT A;  1DU6 A;  2EZL A;  1OR7 A;  3I64 A;  2L0K A;  2Z16 A;  2G0E A;  3OS0 A;  1O4X A;  1YJ9 I;  2M0C A;  3HG9 A;  2O03 A;  4UB8 C;  3SDG A;  2V9P A;  1FPQ A;  4X1E A;  2RNG A;  3A03 A;  5D6E A;  4IOC F;  2EV6 A;  3UKG A;  1JGG A;  5EG0 B;  3BR5 A;  2HPM A;  3CO6 C;  3OS2 A;  1MD0 A;  2KLO A;  1ULY A;  2QZ8 A;  2XF6 A;  4FIS A;  2TRT A;  5GPC A;  3CP8 A;  3J7A O;  3TMO A;  3OOP A;  1L0O C;  4FCY A;  3W6V A;  2IS1 A;  5M3F J;  1NK2 P;  2JPB A;  3ISP A;  5BPD A;  2R7V A;  1U6G A;  1SVM A;  3FXK A;  2PJR A;  4EEF G;  3ROU A;  4QPO A;  3ONQ A;  1N25 A;  1X4O A;  3HOW J;  4O3M A;  4A2U A;  4OIR F;  5D5U B;  3F8C A;  1AHD P;  2GOM A;  3P5J A;  2R7F A;  3VOD A;  5FKL A;  1JGS A;  5GAH J;  3HRT A;  3Q0V A;  3ZRG A;  3ZMT A;  1B8I B;  1DUX C;  3G2B A;  5LGT A;  3CJT B;  4C3H J;  1MBK A;  2AHQ A;  3WU2 C;  1FC3 A;  2L5Q A;  1LDD A;  5JLW A;  2EA2 A;  4BDY A;  4CZZ A;  3H9J A;  3QU6 A;  5FRN A;  3JAM Z;  4FX4 A;  3ZQQ A;  4RAZ A;  3CMY A;  2A68 F;  3ZN1 A;  1D1A A;  2R7O A;  2WY8 Q;  3DCF A;  3P7N A;  2R5Y B;  1YFH A;  1AU7 A;  3A2K A;  3W2A A;  4XM3 A;  3PO3 J;  2R93 J;  2X4H A;  1W7P D;  2HGC A;  1X1A A;  2J5O A;  1X58 A;  1P4A A;  1ZTR A;  5FKO A;  3GW2 A;  1FP1 D;  1TP4 A;  1Z6R A;  1C0W A;  1P92 A;  1QNT A;  4IQJ A;  1VQ5 I;  4HA8 A;  2MA3 A;  2E7W A;  2RRE A;  3O2P E;  4ON0 A;  1UST A;  1CF7 B;  2IP2 A;  4HEA 2;  1I3A A;  4ZYH A;  2QBY A;  4ZDO A;  5E17 F;  4GFB A;  3WTS C;  2VQG A;  1BOB A;  1N77 A;  1A6I A;  5F1J A;  1S8N A;  3HC7 A;  3LSJ A;  3I9V 2;  3KYL A;  3OYL A;  5E20 A;  5LLQ A;  2L4M A;  3HKZ A;  3VB2 A;  3F6O A;  5KVR A;  3FXU A;  2JA6 J;  5C4J J;  4YIF A;  3MMY B;  3Q0W A;  2XPU A;  4XLE A;  3HB9 A;  3LST A;  1ZHF A;  1JKO C;  2GWR A;  1D3Y A;  2WA0 A;  4Y15 A;  3GZN B;  1GVJ A;  2VKD A;  5AIQ A;  2GQQ A;  1TWH J;  5TJJ A;  1IXR C;  3A1Y A;  3IKT A;  1I1S A;  4HDU A;  2UXN A;  3O8H A;  1FOX A;  1FY7 A;  2VJJ A;  3FXM A;  3R0J A;  1LE8 B;  2Y30 A;  2WAE A;  3ZCO A;  4BAY A;  2ADU A;  2VC1 A;  4FAS D;  2XKP A;  2QQ9 A;  1WCM J;  1CGP A;  1B9N A;  5HLG A;  2EFW A;  1G3Y A;  1Z77 A;  2H8W A;  2WC2 A;  3H9Q A;  3HYI A;  3BY6 A;  2VOO A;  2IA1 A;  2GZW A;  4EGY A;  2B0L A;  2L2O A;  4OU0 A;  2F5E A;  2ZNY A;  1BR4 A;  3FM3 A;  3KEY A;  2H6B A;  3IUO A;  4OMZ A;  5B3S H;  5CKT A;  3PSF A;  3PIO F;  3K4L A;  5LD2 C;  3VEP A;  3CJQ B;  2VE8 A;  2AO9 A;  2VJI A;  3E5U A;  2WBM A;  4LG0 A;  4P5O A;  3LSR A;  5J4V A;  1DQU A;  1YE9 A;  2HDW A;  4BJ5 C;  4U88 A;  2XKO A;  5J1Y A;  1OCO H;  2DT5 A;  4IHX A;  2DFH A;  3EPZ A;  2JUC A;  3LL7 A;  5FLX Z;  3Q5F A;  2B9S A;  4XID A;  1ON2 A;  5CVV A;  2V9K A;  5DDG A;  2F4O B;  3JAM K;  4GYI A;  1VND A;  1KU2 A;  3FBI B;  3LSG A;  4RGX A;  2OD5 A;  1XN7 A;  4A5N A;  2DPU A;  1OYI A;  2JZY A;  3CUO A;  5K7Z A;  2KT0 A;  3QOD A;  2IXS A;  3I4N J;  4BNC A;  1IN7 A;  2Y48 A;  4PFP A;  1QZZ A;  3CLQ A;  5ICF A;  1BJA A;  3IC7 A;  4BE0 A;  5DCM B;  2AQF A;  1OYW A;  4XRS G;  2R7R A;  1YIJ I;  1ZRE A;  2X6X A;  4II3 A;  3DQV C;  2XDV A;  3ZMU A;  4U0Y A;  5CVJ A;  1XPX A;  1TC3 C;  3F3X A;  2L7F P;  2WTE A;  3JTG A;  3BCA A;  2MD5 A;  2V6C A;  4DYC A;  3OYG A;  2BHY A;  1YX3 A;  1LNW A;  2E2J J;  3E5X A;  4HQE A;  1JUM A;  2MC4 A;  4L0Z B;  3EET A;  4YIR X;  2PMH A;  2I5U A;  3OYA A;  2E19 A;  1PJR A;  3MZ8 A;  3RCO A;  3U1K A;  3PL8 A;  1S7O A;  3PFI A;  5L3F A;  4I09 A;  4ITV A;  3QOP A;  3SFZ A;  3ECH A;  1K6Y A;  2X9D A;  2FBH A;  1IN4 A;  2RAE A;  3WTZ A;  1WJA A;  1LJ9 A;  3MFK A;  4G6T B;  3GTL J;  1AKH A;  4BXX J;  2OUM A;  1Y8R B;  5L3B A;  2O8X A;  3FMS A;  2NRA C;  5HLT A;  2JK3 A;  4RS8 A;  3V8K A;  1BM9 A;  3K9T A;  4YFN F;  1AA7 A;  3U9G A;  2HR3 A;  2XGC A;  3LWF A;  2EIM H;  3MKY B;  5KNL A;  1X19 A;  2HYG D;  2IPQ X;  2VQL A;  4AIJ A;  1IJW C;  1RKW A;  1VI0 A;  3DWL E;  3FMQ A;  3KX2 A;  2LY9 A;  3AKZ A;  4XRM A;  4J00 A;  5FLX K;  3COA C;  4AYB N;  4XRF A;  2OC6 A;  1IF1 A;  1TLH B;  2VPR A;  4BEH A;  4AIH A;  2HVS A;  1BC7 C;  3L09 A;  4CH7 A;  3JRD A;  4UNO A;  3T8R A;  1SAU A;  2Z99 A;  2DFI A;  3MQ0 A;  2X51 A;  4CCL A;  3LSM A;  2CQX A;  1BIA A;  1IRZ A;  4M73 A;  1QA6 A;  2DMQ A;  3LA2 A;  3IRQ A;  2VBY A;  2XHK A;  3TGN A;  2DCE A;  4XKW A;  1GXQ A;  2WWY A;  1IUF A;  4PJJ A;  1BW5 A;  2OBP A;  2I8D A;  3W6J B;  2JVH A;  2AS5 F;  4E7L A;  3QAH A;  1VFC A;  4OIN F;  4W97 A;  3WG7 H;  3AG2 H;  3IAM 2;  3ZGK A;  2QSH X;  1WKM A;  1XMK A;  2ETH A;  3CDH A;  2QUF A;  3PQK A;  2OQR A;  2E35 A;  5DD4 A;  2A05 A;  3ZQH A;  1F5T A;  3Q0U A;  1U5T C;  3CUQ C;  5HLI A;  2HKX A;  1OCZ H;  1XCV A;  4FE4 A;  3WTU C;  2O8K A;  1TQM A;  2D1V A;  3AAF A;  2KMU A;  4MNU A;  1FJL A;  3BR2 A;  2JMW A;  4M6V A;  1ETX A;  4I76 A;  2FBK A;  2MW8 A;  4EJO A;  3CME I;  2CGP A;  2CUJ A;  5J47 A;  1A5J A;  4PCQ A;  5J8C A;  1AWC A;  3OSF A;  4QTR A;  4JX6 A;  1IN6 A;  2EIK H;  1SMY F;  4MEX F;  2NOJ B;  2R7T A;  5D5V B;  2OZU A;  2GBY A;  4CGZ A;  2BVL A;  2M30 A;  4ENM A;  3HKZ N;  1K83 J;  4IHS A;  3CJR B;  3PNT A;  4ZYE A;  5HLH A;  1R58 A;  4XLH A;  2LC2 A;  1S9H A;  5LHI A;  3L2W A;  1X3W B;  2V9V A;  1ZKG A;  4BXF A;  2A69 F;  2RVC A;  4D9J A;  4HNT A;  4ZDP A;  4F93 B;  3K70 D;  4L18 B;  2K7L A;  4U0W A;  3DKX A;  5EF6 A;  2DT6 A;  1Z7L A;  2DJI A;  4ZYA A;  1RR8 C;  1B6A A;  3R61 A;  4RBO A;  3PSI A;  2FE3 A;  3BPX A;  2L9S A;  4N9H A;  1VQ8 I;  2YU9 J;  1NH3 A;  4XR6 A;  1JHF A;  1VTN C;  2MGQ A;  2ME6 A;  4YEJ A;  1APL C;  2HOS A;  4CXF A;  1G6N A;  1OMI A;  3HGY A;  2IW5 A;  1POG A;  2R3S A;  2LY1 A;  1SFK A;  4IXA A;  3N4M A;  1VQK I;  5J6X A;  3ZR8 X;  4R1H A;  3T1B A;  4LIV A;  4JBA A;  1W7P B;  3RZD J;  2DQR A;  3E97 A;  3U2R A;  5IT9 Z;  3VYR B;  3FM5 A;  2VKH A;  3P9K A;  3W2W A;  2W25 A;  3LQQ A;  2CV2 A;  2M1B A;  4ENJ A;  2F2E A;  2W4S A;  3DPU A;  2ZXW H;  5E8G A;  3CP2 A;  4QWQ A;  1WSU A;  1RRJ A;  1FBQ A;  2MC3 A;  2ZJQ F;  1B72 B;  4JYK A;  5F64 A;  2R5Z B;  1EF4 A;  3OSG A;  3D5R C;  2Q8K A;  3GTM J;  3RPU D;  1GDT A;  2JPC A;  4OIQ F;  3CDL A;  3HTS B;  2XAS A;  2LKS A;  1GT0 C;  4F92 B;  5ILV A;  1IZ1 A;  4I02 A;  3HHG A;  5KHD A;  3ZQ7 A;  3J81 Z;  5IPA A;  1T39 A;  3BJ6 A;  4LLG F;  5GAG J;  3L1P A;  3HL2 A;  3ERM A;  4HYE A;  1P6R A;  3LMM A;  2KFD A;  3H92 A;  3ABM H;  4Y33 A;  1IV6 A;  2GIV A;  1YIO A;  2O61 A;  1V54 H;  2DOE A;  1X1C A;  2VJ4 A;  3PQJ A;  2RGV A;  2PBI A;  1JT0 A;  1OCC H;  3G6E I;  1GHC A;  3HTU A;  1XGN A;  3JRI A;  4YG2 F;  1A35 A;  4G7H F;  5DCF A;  3R60 A;  3GFI A;  1YRN A;  3S3N A;  2OCC H;  3GTK J;  4A93 J;  2ISZ A;  3OIO A;  1K78 A;  2ZKZ A;  3JRC A;  1FYL A;  4E7I A;  2GXA A;  4BJT A;  4NB5 A;  2KZV A;  3W6K B;  1J59 A;  1KYZ A;  1A04 A;  3Q9V A;  3JRH A;  3N97 A;  1G2H A;  1WRJ A;  1H0M A;  1B9M A;  2XRN A;  4XKB A;  1O7L A;  2V26 A;  1I1G A;  4AVP A;  5J3L A;  3W3C A;  3WE3 A;  5FJ8 J;  4KIS A;  3MN2 A;  1BR2 A;  3QPS A;  3CCV I;  2L3D A;  4U7B A;  3QRF F;  3JCU C;  1TWG J;  5FLM J;  1YG2 A;  1XX5 A;  1RIO H;  5KK1 A;  3MEX A;  2K02 A;  3I56 I;  1W5S A;  1RPW A;  2LF8 A;  3DKW A;  1B59 A;  1WH7 A;  2DA6 A;  3G1L A;  3LOC A;  2H6C A;  1SD6 A;  2R7W A;  5IT9 K;  5D5X B;  4DZP A;  1Z3Y A;  1Z7U A;  5KAI C;  1H89 C;  3GZ5 A;  3D1N I;  2LOO A;  1S29 A;  2K85 A;  2O0Y A;  3E6C C;  1ERD A;  3HHH A;  4MHG A;  2VN2 A;  2XAG A;  4I98 B;  2QKL B;  4UUT A;  1X1D A;  4KA4 A;  1D8J A;  3GO5 A;  1YHQ I;  2VT2 A;  3KET A;  1Q1H A;  4OWR B;  2M34 A;  4B47 A;  5M5X J;  2HFH A;  3LSK A;  3BZK A;  3DP7 A;  4L9J A;  2QEX I;  2EA4 A;  3PJR A;  3HUG B;  4KMU X;  4AU7 A;  3CCU I;  3J81 K;  3IKV A;  3PNY A;  1QVT A;  1FOY A;  3BG6 A;  3WU1 B;  2KRF A;  5IP6 A;  5JR3 A;  3LFU A;  2YR2 A;  4G8X A;  1UZC A;  2M8G X;  3KLN A;  5GPA A;  1Z9C A;  3V4G A;  4PJM A;  2JSP A;  1JKQ C;  4RB1 A;  4UUS B;  3UNG C;  5J40 A;  2YX4 A;  2PQ8 A;  1OFC X;  3RI4 A;  2QBY B;  4FET A;  3FMR A;  3E3V A;  3I71 A;  4ASN A;  1LFU P;  2PJP A;  1FBU A;  3FKI J;  3P9I A;  3I53 A;  1ENH A;  3F72 A;  3QU3 A;  2D2W A;  2A07 F;  2VB6 A;  2Y9Y A;  5ERI A;  1JUP A;  4HLY A;  3W2V A;  2HOT A;  3L2V A;  3A4C A;  2NVY J;  2LLK A;  2KRH A;  1UCR A;  4MTE A;  1W0U A;  3ASO H;  4G7Z F;  3MZY A;  4AC0 A;  4CUG A;  2DBB A;  1UJ8 A;  2K3P A;  3G71 I;  2ZB9 A;  1U9N A;  2XUB A;  1V5F A;  1Y1W J;  4E70 A;  3RKX A;  5CVU A;  1MBF A;  4HBL A;  4FX0 A;  3AG3 H;  2XVC A;  2F48 A;  2DJN A;  3RTR A;  2DA5 A;  1P7I A;  2WAD A;  1L3L A;  2MD0 A;  2CYY A;  3L7W A;  3KYD B;  3ZP5 A;  5LRS A;  4CIC A;  1ZG5 A;  1U5T A;  1VQ7 I;  2BZT A;  2VJ5 A;  4D7M A;  4XLA A;  3JRG A;  1W4M A;  2R7S A;  3BZC A;  1FOW A;  4LLN A;  5E3L A;  1MJ9 A;  2R7D A;  2VOP A;  4RLQ A;  4L0Y B;  3WG9 A;  4V2F A;  3SEQ A;  5C3E J;  2VBZ A;  4NC6 A;  3TO9 A;  5IYD J;  3FK6 A;  3SZG A;  4IL6 C;  5FD6 A;  2H09 A;  4A0Z A;  4X0G A;  4JQF A;  3MCZ A;  2DMP A;  1XG1 A;  3WTT C;  2FRH A;  1GLN A;  2BW3 A;  3EQL F;  4B3A A;  2E34 A;  1SFU A;  2A61 A;  2NAZ A;  2QM3 A;  5D6F A;  1R71 A;  1IRX A;  1UG2 A;  1XDS A;  3HSF A;  1P2F A;  4OOI A;  4BAC A;  4D0P A;  2LMD A;  5E3N A;  2ME0 A;  3HOS A;  2KJC A;  4Y4R A;  1WJE A;  1E0E A;  1T33 A;  2KIU A;  3F0C A;  3F22 A;  2K4B A;  3HPH A;  4GCV A;  2K27 A;  5JHU A;  4NDL A;  3BG9 A;  3WHB A;  3H0D A;  3B02 A;  1HC8 A;  1X3Z B;  4OAZ A;  4A0Y A;  3S3M A;  1KU9 A;  4BS9 A;  5FFZ A;  4RDU A;  1YYV A;  3KEO A;  1OPC A;  3DPL C;  1LVA A;  1W36 D;  3M1C A;  4ZYD A;  1SFO J;  3A0B C;  2OU2 A;  5D8K B;  2VOD A;  3DEE A;  1QRY A;  2IS4 A;  2EBI A;  3CCR I;  5B1A H;  2QSF X;  4AYB A;  2JT1 A;  1U9O A;  1GV2 A;  4XIC A;  2UWM A;  5K1Y A;  3BQY A;  2DXI A;  5EEH A;  2HS5 A;  2AXL A;  4O6J A;  1ZRF A;  4KIG A;  2MLG A;  3LA3 A;  2VC0 A;  4PSW A;  3K69 A;  2NS0 A;  1IN8 A;  3VSL A;  5H2F C;  4IOA F;  4M3G A;  3WTW C;  2XSJ C;  3EUK L;  2VUM J;  4BBS J;  2V1X A;  4LG3 A;  4EM2 A;  4RB0 A;  2STT A;  2CQK A;  3OY9 A;  1TWC J;  3GXO A;  5HS9 A;  1A31 A;  4O5V A;  1BI2 A;  3RYP A;  5KAF C;  3OYB A;  1K79 A;  2LYC A;  4RB3 C;  3HXL A;  3BCB A;  5E79 C;  2MH2 A;  4OMY A;  3E7L A;  3LSP A;  3G1M A;  5DM7 F;  3RPQ A;  1AKH B;  1YIT I;  4YFK F;  1U0J A;  2EV5 A;  2V7F A;  3AL0 B;  2DW4 A;  4MQV A;  3VYS B;  3HZJ A;  3M8E A;  4JK1 X;  1MH4 A;  2CQN A;  2ZBK A;  4B1R A;  4DQ2 A;  2J5P A;  2JN6 A;  4QPQ A;  1IV8 A;  2JJ7 A;  1FP2 A;  4HF1 A;  4CDG A;  2IGN A;  2DLL A;  1XGS A;  3A02 A;  1IC8 A;  3QWL A;  2IGM A;  2P8T A;  4XN3 A;  3S2W A;  5KCM A;  2E36 A;  3KZI C;  3U1D A;  2XPW A;  1PP8 F;  4Z6Y A;  2DOF A;  2HI3 A;  1ZQ3 P;  4C2M J;  2JVG A;  4C2U A;  4C9Y A;  5CYV A;  4F52 A;  2V6E A;  1WVR A;  4NQW A;  2EZK A;  4CO8 A;  1M1E B;  2NVT J;  2ZO4 A;  3FHN A;  3BG7 A;  1QBJ A;  2DA2 A;  4CYD A;  3R4K A;  3HJE A;  4F91 B;  3AG4 H;  2ECB A;  2Q0O A;  2VIX A;  4CHU A;  4M3E A;  4EQQ A;  4LD5 A;  2OF7 A;  1R9T J;  2JQ7 A;  1KQ9 A;  4NHJ A;  1RZ4 A;  3GLX A;  3F9K A;  2DK8 A;  2E2I J;  3F8M A;  4ZC3 A;  2M7B A;  4H0E A;  1PUF A;  1RNL A;  1J9I A;  1O3S A;  2DDA A;  1MDM B;  3BTL A;  4HOB A;  3MAJ A;  1KA8 A;  5B66 C;  3OYM A;  4ZH4 F;  3CC2 I;  3DU6 A;  1YW7 A;  1R4M B;  3M8J A;  2FQ3 A;  2ZFU A;  5DUI A;  2ID6 A;  3H35 A;  3QQA A;  3TP3 A;  3CCY A;  1IGN A;  2GXB A;  3CDI A;  4PUS A;  2V1U A;  2A6T A;  2EJR A;  3V8L A;  2L02 A;  4M9S A;  1Z3X A;  4N4O B;  2E5Z A;  2IRF G;  2DOA A;  5CQE A;  3O6B B;  4G7O F;  4WWC A;  1ZK8 A;  2RQQ A;  3OYF A;  5EEG A;  4KDP A;  5CLS A;  4BU2 A;  2A6H F;  2CRG A;  4JOM A;  4HDV A;  1FSE A;  3DLL F;  3IV5 A;  3HBL A;  2COB A;  4DYQ A;  2YPR A;  3HSR A;  2HXI A;  3LA7 A;  3QP5 A;  2X6Y A;  3GCM A;  5JHF A;  2LY2 A;  3BWG A;  3K1P A;  3R6S A;  3ELK A;  1G3W A;  2XF5 A;  2R92 J;  4DOZ A;  2EIL H;  3GF2 A;  2IA2 A;  1FBS A;  4G12 A;  1JTX A;  2Q2E A;  3DFG A;  5JFR A;  3FHZ A;  2V79 A;  3EYY A;  4HF0 A;  4I0B A;  4XRS A;  3K10 A;  1TW2 A;  4CA0 A;  4R79 A;  3IHU A;  2FUG 2;  1TTY A;  1G3S A;  5HOD A;  1J0R A;  2L54 A;  3BZ6 A;  1RUO A;  4GGG A;  3WTX C;  3DPT A;  3KP6 A;  2L9N A;  2VQH A;  4CYC A;  1VQM I;  2DPD A;  1HW2 A;  2QF7 A;  3HOT A;  1ZGJ A;  3OYI A;  2EB7 A;  4UVA A;  4X6A J;  3PIP F;  1X1P A;  2O9L A;  2L7M P;  2E1C A;  4RM3 A;  1P4X A;  2M4G A;  3BG5 A;  4EJT A;  3GBG A;  3CES A;  3KP2 A;  4QLC U;  4L9N A;  1JUS A;  2FNP A;  3X2Q H;  3TOB A;  2CFO A;  4OAY A;  3OYJ A;  3CCQ I;  1MMG A;  4G6Q A;  3GTJ J;  1Y1V J;  4RLF A;  3LAP A;  4M71 A;  4MEY F;  1T2K A;  2GAU A;  3HM5 A;  3WGH A;  3D5S C;  2HOA A;  2HQN A;  1TQP A;  1VQ4 I;  2PLY A;  1FTZ A;  1MBJ A;  1WJ5 A;  1Z21 A;  4P55 A;  2X6W A;  3GTP J;  1JJ8 C;  5K5O A;  5LGU A;  1R1U A;  1XS9 A;  2IBD A;  1G3T A;  1MNE A;  1ZEL A;  3OYK A;  4HPQ A;  5BPI A;  1YO5 C;  1LUJ B;  3L2Q A;  3WTV C;  1TL8 A;  5HDK A;  2JTV A;  5A2Q Z;  3S1N J;  3E0J B;  2DYS H;  4EJU A;  2Y0M A;  3TDZ C;  1IAW A;  2KP6 A;  2ESN A;  5E3O A;  2GM4 A;  1QU3 A;  3ECO A;  2DMU A;  1ZG1 A;  1X4P A;  4GYG A;  4BKX A;  2DAO A;  1TNS A;  3T0Y A;  4A3B J;  3RIR A;  5ICC A;  3FIW A;  1QHH D;  5IOZ A;  1ETV A;  1HW1 A;  4DBR A;  1LQ1 A;  3KZY A;  4M3D A;  1OLT A;  2LR8 A;  4ANJ A;  6PAX A;  3NQO A;  2MSY A;  1UHM A;  2XGE A;  4M3B A;  1B8I A;  2CSO A;  1MMA A;  2DA4 A;  4XKC A;  3VDX A;  5C4X J;  4NC7 A;  2EFQ A;  3ZQF A;  5IP9 J;  1YS6 A;  4HNV A;  4S0H B;  2ZJ2 A;  2M8E A;  4B4C A;  1E3O C;  1DU0 A;  3S2D J;  1YW8 A;  3J80 K;  2JRM A;  3GEZ A;  4E7H A;  4GXO A;  3GME A;  4BDZ A;  2R5Y A;  1LDK B;  4C2T A;  3QYB A;  5FKK A;  4L5I A;  4V19 K;  1MJA A;  2CV1 A;  1W0T A;  2FQ4 A;  1FLI A;  1S5L C;  1WGX A;  3BT9 A;  3NAR A;  2OPT A;  4DGW B;  5BS6 A;  4M6Y A;  1Z6T A;  1ZAR A;  3LAJ A;  3ESW B;  4UVC A;  1HA8 A;  2HTJ A;  2A6E F;  3ABT A;  3K6G A;  3QYF A;  1CF7 A;  2CW0 F;  2QQA A;  5AIP A;  2P6T A;  4BGD A;  1OCR H;  2DK5 A;  1TT0 A;  3TW6 A;  4L9T A;  2L9V A;  1USS A;  1EH7 A;  4FHT A;  2VKV A;  2EZI A;  2WAF A;  1K61 A;  5GAD J;  3LFK A;  1J5Y A;  2W85 A;  1T0F A;  2HQR A;  4MIM A;  3KP5 A;  2W48 A;  3DU5 A;  2F4I A;  4LK1 F;  4F55 A;  1LPQ A;  5DEQ A;  4KYW A;  3LSI A;  1UHW A;  1FNN A;  5LBQ A;  2G7H A;  5EGO B;  2HTS A;  2GA2 A;  1R1T A;  4F7Z A;  1R4N B;  2LBF B;  3GX4 X;  2D5V A;  1ETO A;  1LE8 A;  5E3M A;  3DKY A;  4LIT A;  4BH9 A;  5HNF A;  4IZZ A;  3DF8 A;  5K5R A;  1PYV A;  2E2H J;  2H27 A;  3G4S I;  1J75 A;  1LFP A;  4E7S A;  1UAA A;  2RC4 A;  1D1C A;  3U21 A;  5A2Q K;  5D8L B;  2WV1 A;  4UV8 A;  4BY7 J;  2V4J C;  3L2R A;  4LIU A;  4K2E A;  4KT6 A;  4HLX A;  4J01 A;  2W84 A;  2K9M A;  3BC8 A;  3HIF A;  2VL8 A;  2DU9 A;  3FXR A;  1YJN I;  4P96 A;  3BR1 A;  2HPI A;  2HOE A;  3C1D A;  1DP3 A;  3I59 A;  2FSW A;  2YUS A;  4ESF A;  3CCJ I;  4E7K A;  3E5Q A;  2E7X A;  2M9H A;  2HZT A;  3DTI A;  5JVG F;  2CJJ A;  3HSE A;  1ETW A;  1BBY A;  4CCN A;  3IH2 A;  3ZQI A;  3CMM A;  2ECC A;  1F36 A;  3FWE A;  2F5V A;  3R0A A;  3HOU J;  3O8G A;  2KIQ A;  1J7K A;  1CQT A;  2CW7 A;  1FSH A;  4IJA A;  5F08 A;  4AIK A;  3QPL A;  2K3F A;  1F4K A;  3BLY A;  1WWX A;  2FJ1 A;  3BJA A;  3DBL B;  4V2G A;  1HSJ A;  2L7Z A;  9ANT A;  3FKJ A;  1XC5 A;  2LH9 A;  2JA8 J;  3SZP A;  1QZY A;  4ZTJ A;  1PDN C;  1R22 A;  3MKZ A;  2E1M C;  2VQC A;  2KDZ A;  3M8F A;  4EM0 B;  3EYI A;  1F43 A;  5HVQ C;  2CFX A;  1U5T B;  2L7K A;  3CUQ B;  4KUM A;  5LEJ A;  2OAZ A;  2STW A;  5BQT A;  2BXZ A;  2BYV E;  5DCM A;  2W1O A;  2XPV A;  3C2H A;  4U0V A;  2GIZ A;  5IYC J;  4PJN A;  1X1B A;  3ZN0 A;  2IAI A;  5IP7 J;  4ENN A;  2Z3Y A;  2QQB A;  2H1L A;  4B8X A;  1BJZ A;  1DGR M;  5J1U A;  1MNM C;  3OR2 C;  4IRI A;  2NXN B;  5CVI A;  5EZH A;  2Y9Z A;  1MZB A;  5LFA A;  4MTD A;  4HX8 A;  4I01 A;  4Y7N J;  1S72 I;  4HX7 A;  1HCR A;  2E1N A;  1XSV A;  2W00 A;  4CCO A;  1XB4 A;  2CMP A;  3G73 A;  1P4W A;  4XON A;  4U7D A;  3A01 A;  1TWF J;  3EDP A;  4DNC A;  5DYM A;  2DYR H;  2M7A A;  2K4J A;  4BQN A;  1T95 A;  1VF9 A;  2IA0 A;  5EYR A;  5H20 A;  2FD5 A;  3S1R J;  1PVE A;  5H6R A;  2OCE A;  2L9R A;  1FYK A;  4G6D A;  3WOD F;  4IO9 F;  3DXJ F;  4P1W A;  4WXH A;  3RSN A;  1TQI A;  2Y2Z A;  2FMY A;  2RN7 A;  2JSC A;  4MFD A;  1QPI A;  1TNT A;  4B43 A;  1TT5 B;  1RKT A;  4B09 A;  3FXJ A;  2FOW A;  2OA4 A;  2ZJP F;  1I6X A;  4RAY A;  4UY8 I;  2ZXH A;  3CCL I;  4HQM A;  5DV5 A;  3CMA I;  1ZGW A;  2F5C A;  1H9G A;  1LEB A;  3IH4 A;  5C44 J;  4BHP A;  5E1X A;  1KU7 A;  2YSR A;  3Q3S A;  1IN5 A;  2QQ8 A;  3CLO A;  2LG4 A;  2CQQ A;  3ZQL A;  2O5R A;  4LK0 F;  5ILS A;  3OYH A;  2LP0 A;  3CO7 C;  2M45 A;  2LK2 A;  1ODD A;  4C3J J;  1HBX G;  3ERE D;  3EUA A;  2PJR B;  5JI6 A;  3KEQ A;  5TGT A;  2CV0 A;  1BC8 C;  5GP9 A;  5J1R A;  2KJB A;  1Z05 A;  2WY7 Q;  3FXL A;  4I7H A;  3JR9 A;  1MND A;  5IOY A;  1D1B A;  3D0S A;  3TDU C;  3WHC A;  1O3T A;  1G4D A;  2CG4 A;  4E7Z A;  1V3F A;  4WCG A;  2P5L C;  3S17 J;  2DFE A;  3F21 A;  4NBQ A;  3JTH A;  2R7Z J;  3OYE A;  4DZJ A;  3F6V A;  4S05 A;  1A36 A;  3I0T A;  4A3F J;  3ZQC A;  2DMT A;  3FZV A;  3RQI A;  3JRE A;  3K1N A;  2FF4 A;  2LRE A;  4KJZ A;  1ITY A;  2CU7 A;  3H9G A;  3K4K A;  4A12 A;  3PUF A;  2ESH A;  4KIC A;  3CTA A;  2HU9 A;  4OIO F;  3KFW X;  4NC8 A;  1SVO A;  3OYC A;  1AOY A;  2D1H A;  3E6D A;  3CCE I;  3OL4 A;  2MH9 A;  3VYU B;  3J7A Y;  2FA5 A;  2Y69 H;  4ESJ A;  4XLC A;  5F27 A;  1U2W A;  3JRA A;  1PUE E;  4A5M A;  1WZ2 A;  1D5V A;  1A6Q A;  2F4M B;  5L3G A;  3ABK H;  2EIJ H;  2HZD A;  4GO1 A;  1GXP A;  1VQ9 I;  2R7Q A;  3I58 A;  1D0Y A;  1HKQ A;  2LNB A;  5AON A;  2XB0 X;  4UVB A;  1R1V A;  2KRC A;  2CUZ A;  4B3X A;  3ZMS A;  2HEO A;  1KZH A;  2BBY A;  3HRM A;  2EV0 A;  2ZME C;  1SC7 A;  4ZZD A;  2RNJ A;  1HDD C;  5ICE A;  2CW8 A;  1Y6I A;  1EKE A;  2GXG A;  2NS7 A;  3BJO A;  5J8F A;  3HRU A;  4FTH A;  3ZPL A;  5CJ9 A;  1F1Z A;  1R5G A;  3M1E A;  1Z1D A;  1T56 A;  1UB9 A;  2DOD A;  3PFY A;  2CH0 A;  5ILU A;  3S15 J;  3RJP A;  1LB2 A;  1KON A;  5BNG A;  4OIP F;  3VFZ A;  1OCT C;  5EJC A;  4A0X A;  2COM A;  3FF5 A;  3JRF A;  1E17 A;  1R5I D;  4PJL A;  1BR1 A;  4WXC A;  2HWV A;  2M3A A;  3SJM A;  4EAT A;  1SEU A;  5FD5 A;  3J7Z I;  4CZC A;  3OYN A;  1SD7 A;  2Z33 A;  1ON1 A;  2F5D A;  1SD5 A;  1MH3 A;  2VI6 A;  2ZNZ A;  2JWT A;  2PG4 A;  3E1S A;  4EV0 A;  1W7P A;  1J09 A;  2XAQ A;  4M9X A;  4BXU A;  3L2C A;  1ZGA A;  1YW9 A;  2XB5 A;  3K4M A;  5K7H A;  3K70 C;  2TCT A;  2ZSI B;  3G1O A;  4Y52 J;  4P9U A;  3KIO A;  2KPM A;  2QEN A;  2UUZ A;  1WJC A;  1WJF A;  5DS9 A;  5H6Q A;  3HRS A;  4C30 A;  2WV0 A;  3VSK A;  4LG0 B;  1GUU A;  2DO7 A;  4HZF A;  5TIS C;  5B5E C;  1B72 A;  2R5Z A;  4LB6 B;  4LB5 A;  3M3Y J;  2FEZ A;  2WB1 N;  1TZL A;  2CUE A;  4RGS A;  3GWZ A;  3ZQG A;  5GTH C;  2M5W A;  1Z67 A;  2KQR A;  2Z2S B;  2RKH A;  1O3Q A;  2NYX A;  2KZG A;  3ZXS A;  5IY5 H;  2LD5 A;  5E1W A;  4IX7 A;  1IW7 F;  2VE9 A;  4UXN A;  4D1Q A;  1LFB A;  3GUD A;  3AFH A;  4IVN A;  4RA2 A;  2HDD A;  3F8F A;  2HQA A;  3FX3 A;  4GDF A;  1Q1V A;  3ULQ B;  4CYC B;  4C3I J;  4ZTF A;  3IRR A;  2X48 A;  3NEU A;  1UHS A;  3L00 A;  5LEK A;  2N8G A;  2XAF A;  3KLO A;  3K2Z A;  3S14 J;  1B1B A;  1YS7 A;  2IGK A;  3DTE A;  1D5Y A;  2VPL A;  5JVT A;  2P4W A;  1N78 A;  3E6M A;  3NRV A;  4PZJ A;  1FX7 A;  3KPH A;  1FTT A;  4LMY A;  4XKV A;  1K4T A;  5HOO A;  1JKP C;  3BQZ A;  4MQ9 F;  4KIT B;  2GLO A;  3MKL A;  3NWS A;  4CCJ A;  2HXO A;  3BRO A;  2LFB A;  1I6H J;  1Y8Q B;  4XMY A;  3S32 A;  4IHW A;  2EIN H;  2VBX A;  4EJW A;  4AM3 A;  1YX5 A;  2OZ6 A;  2ICW G;  1T0F C;  4RAF A;  2H94 A;  2XIG A;  1R00 A;  1SFE A;  4BY1 J;  1XSX A;  1VQP I;  2V1D A;  2HYF A;  2L4A A;  1STZ A;  2P5K A;  1DGW Y;  2A5Y B;  3FDY A;  4ZZL A;  2CUF A;  4E6K G;  1BA5 A;  2K86 A;  2OJE D;  4CSW A;  3JSO A;  1JKR C;  2MAB A;  3KCC A;  1NHA A;  2QCO A;  4HW0 A;  1LEA A;  4TV7 A;  4CCM A;  3O3K A;  2TDX A;  2BE5 F;  5EEA A;  1RET A;  1MBG A;  4AD9 A;  1V5G A;  1I50 J;  1P9Q C;  1BI3 A;  2NVQ J;  3QOE A;  1JT6 A;  2ID3 A;  3SEZ A;  4Z2Y A;  3HUG A;  4AVZ A;  3S8P A;  4BEH B;  3TP0 A;  1X3U A;  3SYT A;  1FMV A;  2P6S A;  1ETK A;  1SFX A;  4PK4 A;  4U87 A;  4IKF A;  3BR6 A;  4JP0 A;  2VXZ A;  4A3E J;  2G7U A;  2WAQ N;  2BHZ A;  1FT9 A;  2ELK A;  4XBF A;  3SDB A;  2VT3 A;  3HOY J;  1HF0 A;  4N0B A;  4IHV A;  5ICG A;  4UUS A;  3B73 A;  4EM1 A;  2PFB A;  1PP7 U;  2M0M A;  2C6Y A;  1ETQ A;  2QLZ A;  4ETS A;  3K2A A;  2XC7 A;  3TO6 A;  4XLN F;  5DTD A;  1EV7 A;  3HGG A;  2PMZ N;  2E5N A;  2XGX A;  2P81 A;  3RKY A;  1QPM A;  3FXQ A;  1OQY A;  3RYR A;  1WI3 A;  3BTJ A;  4S04 A;  3V7R A;  3C7J A;  4BHB A;  3ZOB A;  3ZMD A;  1R6R A;  1KYW A;  3ABL H;  1WPK A;  1Y39 A;  2DN0 A;  5D5W B;  3EUH C;  2Y75 A;  2QWW A; 
#chains in the Genus database with same CATH homology
 3I54 A;  3V7C A;  1FOK A;  1IRF A;  4L9V A;  5ED4 A;  1XMA A;  4M6X A;  2W57 A;  4KMF A;  4IHT A;  3ZMV A;  4XSZ F;  2EWN A;  3M7G A;  1K7A A;  5HS8 A;  2PN6 A;  3GFJ A;  5LGN A;  3LQR A;  5LRR A;  4BHC A;  3BDD A;  4I0A A;  4HF2 A;  3I59 B;  2NNY A;  3J80 Z;  4P9F A;  2M87 A;  3JW4 A;  1U78 A;  1YQA A;  2LKP A;  4YFX F;  1XGM A;  3H3Z A;  2BGC A;  3L9F A;  3MZH A;  5HS7 A;  2Z5U A;  2ZME A;  1T98 A;  2NNN A;  4ESB A;  3C18 A;  3ZMZ A;  2EFP A;  2PI0 A;  1O57 A;  1Z91 A;  2MLK A;  5HDG A;  4M74 A;  1F9N A;  4A6D A;  1QO0 D;  4Y13 A;  4EJV A;  3BOQ A;  3REO A;  4EMS A;  1YLF A;  5FGM A;  4MGR A;  1OYY A;  3G3Z A;  3WTY C;  4HX4 A;  3Q9S A;  4UHT A;  3ML6 A;  3H3U A;  2FNA A;  2VBW A;  2XAH A;  3IWZ A;  1S6L A;  5HDN A;  1ZYR F;  1DP7 P;  1E2X A;  4AWX B;  3T5X A;  3F8B A;  1BOA A;  1TW3 A;  4HAM A;  1HKS A;  4PGG A;  1XSD A;  1K78 B;  1REP C;  1SAX A;  3IL2 A;  4WK8 F;  4YII A;  1K6O A;  1MJB A;  3T8T A;  3WGG A;  1JXS A;  3BP8 A;  3GZ6 A;  1MKM A;  2O6G E;  1I27 A;  4UUV A;  2LF7 A;  4HV6 A;  2BV6 A;  3IWF A;  1I5Z A;  1QGP A;  2CWE A;  2KIM A;  1O3R A;  1XDU A;  4LGW A;  3OV8 A;  3RPU A;  2L01 A;  3M9A A;  5LHH A;  4KN7 X;  1BIB A;  3WU0 A;  2P7C B;  2IJL A;  1S3J A;  4A6E A;  5E18 F;  3VOE A;  4ENK A;  4N9I A;  1IXC A;  2VON A;  2QVO A;  3TKY A;  5L3E A;  2FBI A;  2P5V A;  5CVR A;  5TRD A;  4M9Z A;  2QYO A;  4KT5 C;  2DTR A;  2FML A;  1MDM A;  3V7S A;  3K1M A;  2FU4 A;  3KP7 A;  5FFX A;  2RQP A;  2KIF A;  5FO5 A;  1R7J A;  2OQG A;  3JSP A;  1IXS B;  1UFM A;  1OKR A;  4RGU A;  2XRO A;  1H9T A;  1TBX A;  3F23 A;  1KU3 A;  4PDK A;  1B4A A;  1EH8 A;  2G9W A;  2Z9O A;  1KQ8 A;  4EGZ A;  1DDN A;  2LSO A;  1WQ2 A;  2A3S A;  2ELH A;  1ZH5 A;  4IPA A;  2DQL A;  2EFN A;  4BQA A;  4RGR A;  2EK5 A;  2UZK A;  4ZYG A;  1FYM A;  5IT3 A;  1U3E M;  3P9C A;  1R36 A;  3EUH A;  2PMU A;  5F1R A;  3GFL A;  1SD4 A;  2IVM A;  3MWM A;  4WXD A;  1R23 A;  5E8I A;  3RDI A;  2IT0 A;  4RB2 C;  1ZAO A;  2BEO A;  3KP3 A;  4IRH A;  4IRG A;  2RV8 A;  1HXD A;  1ONV A;  2HDC A;  4UV9 A;  2W24 A;  1Y0U A;  5K5Q A;  2HKO A;  2CO5 A;  2ZCW A;  3KZZ A;  1FWZ A;  4KIF A;  3F8N A;  4G9Y A;  2DI3 A;  1RI7 A;  2KKO A;  1QQI A;  4I2O A;  1ZLJ A;  1BN5 A;  2EFO A;  5DUK A;  3K0L A;  3WE2 A;  2ISY A;  4R8H A;  1YTY A;  1V4R A;  1LDJ A;  5BOX A;  4Y17 A;  3TO7 A;  5D4S A;  4Q47 A;  4LFU A;  5D4R A;  1S7A A;  3KE2 A;  1D8K A;  5L3C A;  1EH6 A;  3KP4 A;  1JE8 A;  4KIB A;  5LHG A;  4HV5 A;  3RKW A;  1T6S A;  4Q48 A;  2FOK A;  5L3D A;  4EVI A;  2D45 A;  2YX7 A;  1J2X A;  1JHH A;  2JRT A;  2YU3 A;  2XAJ A;  4FT8 A;  4PGH A;  4IF4 A;  2P7V B;  2ACJ A;  3CJN A;  4BYY A;  3D5L A;  4LJZ F;  1R5H A;  2GA1 A;  4WX9 A;  1RUN A;  5BMZ A;  1ZRC A;  1ZLK A;  2X0L A;  3QP6 A;  1XGO A;  2LDU A;  3I5U A;  3QPT A;  3GFM A;  3SZT A;  4LLL A;  3GVA A;  1WI9 A;  3SQN A;  4KFC A;  2UXX A;  4XSX F;  4KN4 X;  4M72 A;  4L5J A;  3E6B A;  3SHF A;  3DEU A;  4KNY A;  1ZG3 A;  1HW5 A;  1ZN2 A;  1U8R A;  5FB2 A;  2MBF A;  4XLP F;  1KGS A;  1HST A;  1DPU A;  1DPR A;  1ZRD A;  3CUQ A;  1FZP B;  3C3W A;  2PEX A;  3QPH A;  1XCB A;  2FXA A;  4Q4Z F;  5F6F A;  3BPV A;  2XV4 S;  3WGI A;  3SXY A;  1MGT A;  1BI0 A;  1KQ0 A;  3ABU A;  5E1Z B;  1BI1 A;  4G94 A;  2O3F A;  3TOA A;  1T38 A;  5DD8 A;  2ZFW A;  1O7F A;  2RDP A;  2ZXJ A;  1SMT A;  2ZME B;  3GYH X;  4WF2 A;  3DV8 A;  1W5T A;  2F5F A;  1IUY A;  1IRG A;  4Q5S F;  3I4P A;  3TQN A;  3V8J A;  1XD7 A;  1HQC A;  1HKT A;  1OR7 A;  3I64 A;  2O03 A;  1FPQ A;  5D6E A;  2EV6 A;  3CO6 C;  1MD0 A;  1ULY A;  2QZ8 A;  3J7A O;  3OOP A;  1L0O C;  2JPB A;  3ISP A;  5BPD A;  1U6G A;  3ROU A;  4O3M A;  4A2U A;  4OIR F;  5D5U B;  3F8C A;  2R7F A;  3VOD A;  1JGS A;  3HRT A;  3ZMT A;  1DUX C;  5LGT A;  1FC3 A;  1LDD A;  2EA2 A;  4CZZ A;  3QU6 A;  3JAM Z;  4FX4 A;  4RAZ A;  2A68 F;  3ZN1 A;  3P7N A;  1YFH A;  2X4H A;  1W7P D;  2HGC A;  2J5O A;  1P4A A;  3GW2 A;  1FP1 D;  1Z6R A;  1C0W A;  1P92 A;  1QNT A;  4HA8 A;  2MA3 A;  2E7W A;  3O2P E;  4ON0 A;  1UST A;  1CF7 B;  2IP2 A;  4ZYH A;  2QBY A;  5E17 F;  3WTS C;  1S8N A;  5E20 A;  5LLQ A;  2L4M A;  3VB2 A;  3F6O A;  5KVR A;  3FXU A;  4YIF A;  3LST A;  1ZHF A;  2GWR A;  1D3Y A;  4Y15 A;  1GVJ A;  5AIQ A;  2GQQ A;  5TJJ A;  1IXR C;  3IKT A;  1I1S A;  4HDU A;  2UXN A;  1FY7 A;  3R0J A;  4BAY A;  2ADU A;  2VC1 A;  2XKP A;  2QQ9 A;  1CGP A;  1B9N A;  5HLG A;  2EFW A;  1G3Y A;  3HYI A;  2WC2 A;  3BY6 A;  2VOO A;  2IA1 A;  2GZW A;  4EGY A;  2B0L A;  4OU0 A;  2F5E A;  2ZNY A;  3FM3 A;  2H6B A;  4OMZ A;  3VEP A;  2VE8 A;  3E5U A;  4LG0 A;  4P5O A;  4U88 A;  2XKO A;  2DT5 A;  5FLX Z;  3Q5F A;  1ON2 A;  5CVV A;  5DDG A;  3JAM K;  4GYI A;  1KU2 A;  4RGX A;  2OD5 A;  1XN7 A;  4A5N A;  2DPU A;  1OYI A;  2JZY A;  3CUO A;  4BNC A;  1IN7 A;  2Y48 A;  1QZZ A;  5ICF A;  1BJA A;  3IC7 A;  5DCM B;  1ZRE A;  1OYW A;  3DQV C;  3ZMU A;  4U0Y A;  5CVJ A;  3F3X A;  2WTE A;  3JTG A;  2MD5 A;  2V6C A;  1LNW A;  3E5X A;  4HQE A;  4L0Z B;  3EET A;  2PMH A;  5L3F A;  1S7O A;  3PFI A;  4I09 A;  3QOP A;  3SFZ A;  3ECH A;  2FBH A;  1IN4 A;  3WTZ A;  1LJ9 A;  3MFK A;  5L3B A;  2O8X A;  3FMS A;  2NRA C;  4RS8 A;  3V8K A;  1BM9 A;  3K9T A;  4YFN F;  3U9G A;  2HR3 A;  3LWF A;  2HYG D;  2IPQ X;  4AIJ A;  3FMQ A;  5FLX K;  3COA C;  4XRF A;  1IF1 A;  1TLH B;  4AIH A;  1BC7 C;  3L09 A;  4UNO A;  3T8R A;  2Z99 A;  2DFI A;  3MQ0 A;  1BIA A;  4M73 A;  3LA2 A;  3IRQ A;  2VBY A;  2XHK A;  3TGN A;  1GXQ A;  2WWY A;  2OBP A;  3W6J B;  2AS5 F;  3QAH A;  4OIN F;  1WKM A;  1XMK A;  2ETH A;  3CDH A;  2QUF A;  3PQK A;  2OQR A;  5DD4 A;  1F5T A;  1U5T C;  3CUQ C;  5HLI A;  2HKX A;  1XCV A;  3WTU C;  1TQM A;  2D1V A;  3AAF A;  4MNU A;  2FBK A;  4EJO A;  2CGP A;  4PCQ A;  5J8C A;  1AWC A;  1IN6 A;  1SMY F;  4MEX F;  5D5V B;  2OZU A;  4CGZ A;  2M30 A;  4ENM A;  4IHS A;  4ZYE A;  5HLH A;  1R58 A;  5LHI A;  2V9V A;  2A69 F;  2RVC A;  4L18 B;  2K7L A;  4U0W A;  1B6A A;  3R61 A;  2FE3 A;  3BPX A;  4N9H A;  1JHF A;  1VTN C;  4CXF A;  1G6N A;  1OMI A;  2IW5 A;  2R3S A;  4IXA A;  3N4M A;  5J6X A;  4R1H A;  3T1B A;  4JBA A;  1W7P B;  2DQR A;  3E97 A;  3U2R A;  5IT9 Z;  3FM5 A;  3P9K A;  2W25 A;  3LQQ A;  2M1B A;  4ENJ A;  2F2E A;  5E8G A;  4QWQ A;  1WSU A;  1FBQ A;  2MC3 A;  5F64 A;  2Q8K A;  2JPC A;  4OIQ F;  3HTS B;  2XAS A;  5ILV A;  1IZ1 A;  4I02 A;  3HHG A;  3J81 Z;  3ZQ7 A;  1T39 A;  3BJ6 A;  4LLG F;  4HYE A;  1P6R A;  3H92 A;  2O61 A;  2GIV A;  1YIO A;  3PQJ A;  2RGV A;  2PBI A;  1GHC A;  3HTU A;  1XGN A;  4YG2 F;  4G7H F;  5DCF A;  3R60 A;  3GFI A;  2ISZ A;  1K78 A;  2ZKZ A;  1FYL A;  3W6K B;  4NB5 A;  1J59 A;  1KYZ A;  1A04 A;  3Q9V A;  3N97 A;  1WRJ A;  1H0M A;  1B9M A;  2XRN A;  1O7L A;  1I1G A;  4AVP A;  3WE3 A;  2L3D A;  4U7B A;  3QRF F;  1YG2 A;  1RIO H;  5KK1 A;  3MEX A;  2K02 A;  1W5S A;  2LF8 A;  3DKW A;  1B59 A;  2H6C A;  1SD6 A;  5IT9 K;  5D5X B;  1Z7U A;  3GZ5 A;  3E6C C;  2O0Y A;  1S29 A;  3HHH A;  4MHG A;  2VN2 A;  2XAG A;  4I98 B;  4KA4 A;  1D8J A;  3GO5 A;  2VT2 A;  3KET A;  1Q1H A;  2HFH A;  3DP7 A;  4L9J A;  2EA4 A;  4KMU X;  3J81 K;  3IKV A;  3WU1 B;  2KRF A;  5JR3 A;  2YR2 A;  4G8X A;  3KLN A;  1Z9C A;  3V4G A;  4RB1 A;  2YX4 A;  2PQ8 A;  2QBY B;  3RI4 A;  3FMR A;  3E3V A;  3I71 A;  4ASN A;  2PJP A;  1FBU A;  3P9I A;  3I53 A;  3F72 A;  3QU3 A;  2D2W A;  2A07 F;  5ERI A;  4HLY A;  4MTE A;  1UCR A;  4G7Z F;  3MZY A;  2DBB A;  2XUB A;  4E70 A;  3RKX A;  5CVU A;  4HBL A;  4FX0 A;  2XVC A;  3RTR A;  1L3L A;  2CYY A;  3L7W A;  3ZP5 A;  5LRS A;  4CIC A;  1ZG5 A;  1U5T A;  1W4M A;  4LLN A;  2VOP A;  1MJ9 A;  2R7D A;  4L0Y B;  3WG9 A;  2VBZ A;  3TO9 A;  5FD6 A;  2H09 A;  4A0Z A;  4JQF A;  3MCZ A;  3WTT C;  2FRH A;  3EQL F;  1SFU A;  2A61 A;  2NAZ A;  2QM3 A;  5D6F A;  1XDS A;  3HSF A;  1P2F A;  4OOI A;  4D0P A;  3HOS A;  2KJC A;  2KIU A;  3F22 A;  2K4B A;  4GCV A;  2K27 A;  5JHU A;  3B02 A;  4A0Y A;  1KU9 A;  5FFZ A;  1YYV A;  3KEO A;  1OPC A;  3DPL C;  1LVA A;  4ZYD A;  2OU2 A;  5D8K B;  2VOD A;  2JT1 A;  2UWM A;  5K1Y A;  5EEH A;  2HS5 A;  2AXL A;  4O6J A;  1ZRF A;  4KIG A;  2MLG A;  3LA3 A;  2VC0 A;  3K69 A;  2NS0 A;  1IN8 A;  3WTW C;  2V1X A;  4EM2 A;  4RB0 A;  2STT A;  2CQK A;  3GXO A;  5HS9 A;  4O5V A;  1BI2 A;  3RYP A;  1K79 A;  4RB3 C;  2MH2 A;  4OMY A;  3RPQ A;  4YFK F;  2EV5 A;  2DW4 A;  4MQV A;  4JK1 X;  3M8E A;  2ZBK A;  4DQ2 A;  2J5P A;  1FP2 A;  4HF1 A;  4CDG A;  2DLL A;  1XGS A;  2P8T A;  3S2W A;  3U1D A;  1PP8 F;  5CYV A;  4NQW A;  4CO8 A;  2ZO4 A;  1QBJ A;  4CYD A;  3R4K A;  2Q0O A;  4CHU A;  4EQQ A;  4LD5 A;  1KQ9 A;  4NHJ A;  1RZ4 A;  3GLX A;  2DK8 A;  3F8M A;  4H0E A;  1RNL A;  1J9I A;  1O3S A;  1MDM B;  4HOB A;  3MAJ A;  1KA8 A;  4ZH4 F;  1YW7 A;  2FQ3 A;  5DUI A;  2GXB A;  2V1U A;  2EJR A;  3V8L A;  2L02 A;  4M9S A;  2IRF G;  3O6B B;  4G7O F;  4WWC A;  5EEG A;  4KDP A;  5CLS A;  2A6H F;  4HDV A;  1FSE A;  2YPR A;  3HSR A;  3QP5 A;  3LA7 A;  3BWG A;  3K1P A;  3R6S A;  3ELK A;  1G3W A;  3GF2 A;  2IA2 A;  1FBS A;  2Q2E A;  3DFG A;  5JFR A;  3FHZ A;  2V79 A;  3EYY A;  4HF0 A;  4I0B A;  1TW2 A;  4R79 A;  3IHU A;  1TTY A;  1G3S A;  1J0R A;  2L54 A;  3BZ6 A;  1RUO A;  4GGG A;  3WTX C;  3DPT A;  3KP6 A;  2DPD A;  1HW2 A;  3HOT A;  1ZGJ A;  2EB7 A;  4UVA A;  2E1C A;  1P4X A;  4EJT A;  4QLC U;  3KP2 A;  4L9N A;  2FNP A;  3TOB A;  4G6Q A;  3LAP A;  4M71 A;  4MEY F;  1T2K A;  2GAU A;  3WGH A;  2HQN A;  1TQP A;  2PLY A;  4P55 A;  5K5O A;  5LGU A;  1R1U A;  1G3T A;  5BPI A;  1YO5 C;  3WTV C;  5HDK A;  2JTV A;  5A2Q Z;  4EJU A;  2Y0M A;  3TDZ C;  1IAW A;  2ESN A;  3ECO A;  1ZG1 A;  4GYG A;  2DAO A;  1TNS A;  3T0Y A;  3RIR A;  5ICC A;  1HW1 A;  1LQ1 A;  3KZY A;  6PAX A;  3NQO A;  1UHM A;  2CSO A;  2EFQ A;  1YS6 A;  2ZJ2 A;  2M8E A;  1YW8 A;  3J80 K;  3GEZ A;  4GXO A;  1LDK B;  4L5I A;  1MJA A;  1FLI A;  5BS6 A;  4M6Y A;  1Z6T A;  3LAJ A;  1ZAR A;  4UVC A;  2HTJ A;  2A6E F;  3ABT A;  1CF7 A;  2CW0 F;  2QQA A;  5AIP A;  2P6T A;  2DK5 A;  4L9T A;  1USS A;  1EH7 A;  4FHT A;  3LFK A;  1J5Y A;  2W85 A;  1T0F A;  2HQR A;  3KP5 A;  4LK1 F;  5DEQ A;  4KYW A;  1UHW A;  1FNN A;  5LBQ A;  2G7H A;  2HTS A;  2GA2 A;  1R1T A;  4F7Z A;  3GX4 X;  4BH9 A;  2H27 A;  3DF8 A;  5K5R A;  1J75 A;  2RC4 A;  5A2Q K;  5D8L B;  4UV8 A;  4K2E A;  4HLX A;  2W84 A;  3HIF A;  3FXR A;  2DU9 A;  4P96 A;  2HOE A;  3C1D A;  3I59 A;  2FSW A;  4ESF A;  3E5Q A;  2E7X A;  2HZT A;  3HSE A;  1BBY A;  3FWE A;  3R0A A;  1J7K A;  1FSH A;  4IJA A;  4AIK A;  1F4K A;  1WWX A;  3BJA A;  1HSJ A;  3SZP A;  1QZY A;  1PDN C;  1R22 A;  3M8F A;  4EM0 B;  3EYI A;  5HVQ C;  2CFX A;  1U5T B;  3CUQ B;  4KUM A;  5LEJ A;  2OAZ A;  2STW A;  5BQT A;  2BYV E;  5DCM A;  4U0V A;  3ZN0 A;  4ENN A;  2Z3Y A;  2QQB A;  4B8X A;  4IRI A;  5CVI A;  1MZB A;  4MTD A;  4HX8 A;  4I01 A;  4HX7 A;  2E1N A;  1XSV A;  1XB4 A;  3G73 A;  1P4W A;  4U7D A;  3EDP A;  4DNC A;  5DYM A;  2K4J A;  2IA0 A;  5H20 A;  5H6R A;  1FYK A;  4G6D A;  3WOD F;  3DXJ F;  4WXH A;  1TQI A;  2FMY A;  2RN7 A;  2JSC A;  1TNT A;  4B09 A;  2OA4 A;  1I6X A;  4RAY A;  4HQM A;  5DV5 A;  2F5C A;  1H9G A;  1LEB A;  4BHP A;  5E1X A;  1KU7 A;  2YSR A;  1IN5 A;  3CLO A;  4LK0 F;  5ILS A;  3CO7 C;  2M45 A;  1ODD A;  1HBX G;  3ERE D;  5JI6 A;  3KEQ A;  1BC8 C;  2KJB A;  1Z05 A;  4I7H A;  3D0S A;  3TDU C;  1O3T A;  1G4D A;  2CG4 A;  1V3F A;  4WCG A;  2P5L C;  3F21 A;  3JTH A;  4S05 A;  3F6V A;  3I0T A;  3FZV A;  3K1N A;  2FF4 A;  4A12 A;  2ESH A;  4KIC A;  3CTA A;  4OIO F;  3KFW X;  1AOY A;  2D1H A;  3E6D A;  2MH9 A;  2FA5 A;  4ESJ A;  1U2W A;  1PUE E;  4A5M A;  1D5V A;  5L3G A;  4GO1 A;  1GXP A;  3I58 A;  1HKQ A;  2LNB A;  5AON A;  4UVB A;  1R1V A;  3ZMS A;  2HEO A;  2BBY A;  3HRM A;  2EV0 A;  4ZZD A;  2RNJ A;  5ICE A;  2GXG A;  3BJO A;  5J8F A;  3HRU A;  3ZPL A;  5CJ9 A;  1F1Z A;  1R5G A;  3M1E A;  1Z1D A;  1UB9 A;  5ILU A;  3RJP A;  1LB2 A;  4OIP F;  3VFZ A;  4A0X A;  1E17 A;  2COM A;  3FF5 A;  4WXC A;  2HWV A;  5FD5 A;  1SD7 A;  2Z33 A;  1ON1 A;  2F5D A;  1SD5 A;  2ZNZ A;  2PG4 A;  4EV0 A;  1W7P A;  2XAQ A;  4M9X A;  4BXU A;  3L2C A;  1ZGA A;  1YW9 A;  4P9U A;  2QEN A;  5H6Q A;  3HRS A;  2WV0 A;  4LG0 B;  4HZF A;  2DO7 A;  4LB6 B;  4LB5 A;  2FEZ A;  4RGS A;  3GWZ A;  2M5W A;  2RKH A;  1O3Q A;  2NYX A;  5E1W A;  1IW7 F;  2VE9 A;  4UXN A;  3GUD A;  4IVN A;  3F8F A;  3FX3 A;  3ULQ B;  3IRR A;  3NEU A;  3L00 A;  5LEK A;  2XAF A;  3KLO A;  3K2Z A;  1B1B A;  1YS7 A;  5JVT A;  2P4W A;  3E6M A;  3NRV A;  4PZJ A;  1FX7 A;  4LMY A;  5HOO A;  4MQ9 F;  3BRO A;  2VBX A;  4EJW A;  2OZ6 A;  2H94 A;  2XIG A;  1R00 A;  1SFE A;  1XSX A;  2V1D A;  2HYF A;  2L4A A;  1STZ A;  2P5K A;  2A5Y B;  4ZZL A;  2K86 A;  3JSO A;  3KCC A;  1NHA A;  4HW0 A;  1LEA A;  4TV7 A;  3O3K A;  2TDX A;  2BE5 F;  4AD9 A;  1BI3 A;  4Z2Y A;  3HUG A;  1X3U A;  2P6S A;  1SFX A;  2VXZ A;  2G7U A;  1FT9 A;  4XBF A;  2VT3 A;  4N0B A;  5ICG A;  3B73 A;  4EM1 A;  2PFB A;  1PP7 U;  2C6Y A;  2QLZ A;  4ETS A;  3TO6 A;  4XLN F;  1EV7 A;  2XGX A;  3RKY A;  1QPM A;  3FXQ A;  3RYR A;  4S04 A;  3V7R A;  3C7J A;  4BHB A;  3ZMD A;  1KYW A;  5D5W B;  2Y75 A;  2QWW A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...