2VOOA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
b'MAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDY'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vooA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vooA02
3IWFA 2YTCA 1FP2A 1Z9CA 2DLLA 1DDNA 2YU3A 1JHFA 4YIIA 3GW2A 4UUVA 2EWNA 2P7VB 5LGTA 1ULYA 1U5TA 1R1TA 5D4RA 3WTUC 1JJHA 2DTRA 1SD4A 5E8GA 2MD5A 2EVZA 3NNHA 2HTSA 4A12A 3HRSA 2JZYA 4OIPF 3NNCA 2N3OA 1U2FA 2ACJA 5HS9A 1RKJA 1ZZFA 4KUMA 2DK2A 3REOA 2Q8KA 1AWCA 2LKPA 3I59B 1D8ZA 4IO9Q 2CQ0A 2DB1A 2VOOA 2MYFA 2G4BA 2L4MA 4ZYDA 1LDDA 4R8HA 1PDNC 3BO2A 1Q1HA 1WRJA 3SFZA 3CF5Q 3MUTP 1P4AA 2MKHA 1LEAA 2DI3A 2WTEA 1ON2A 4BS2A 2KYXA 1XB4A 3DV8A 3LSTA 3CXCR 1K6OA 3V4MA 2F5CA 2H27A 4KT5C 4JBAA 4H0EA 2LQ5A 1YO5C 4OIRF 3ISPA 2VC0A 3FF5A 2PG4A 2XIGA 1EH8A 3KETA 2R7DA 4BXUA 3LAPA 2LNBA 5D8KB 2AYEA 1YFHA 1G3SA 1YIOA 4YG2F 4HW0A 1XSVA 2DHXA 3E6MA 4I7HA 1YJNS 3L7WA 2GXBA 1WWXA 5DDRC 3HTSB 4TV7A 5GAHU 2VXZA 2EFQA 2FMYA 2DHSA 2YSRA 3FWEA 2F3JA 2PQ8A 3NNAA 4CH0S 4HLYA 1OIAA 3BZ6A 2RVCA 4WXHA 5BJRA 2J0SD 3EYYA 1SJ3P 5IM0B 1W7PA 2J76E 4A6EA 3E5QA 1ZGJA 4MQVA 4A5MA 3BO3A 3ZZYA 2HOEA 1C0WA 3RIRA 1X5SA 2WBRA 2QUFA 3BP8A 2FA5A 2IJLA 3TP2A 1T6SA 2CQHA 3MI7X 1QZYA 3F6OA 2LDUA 2VE9A 3VAMA 1R22A 3TDUC 2L4AA 3MAJA 2RNEA 2EFPA 4U0WA 5L3GA 5CYJA 2GWRA 2XAFA 4WCGA 3K0JA 1H2UX 1WEZA 2MKSA 1UHWA 1TW3A 4GGGA 4HF1A 2F5FA 5HVQC 1SFUA 4GCVA 3C7JA 2IRFG 3M8EA 4A6DA 2A3SA 4CQ1A 3K1MA 1BI3A 3JAMZ 3VALA 2LECA 2KIUA 2XAHA 2U2FA 3MD1A 3GFJA 5E1ZB 3DPLC 1G3WA 2CQ1A 1IN4A 3LQVA 4WXDA 1XGMA 3M8FA 1TQIA 3I54A 3V7SA 1Z7UA 2X1AA 1K9MT 3KLNA 2L3DA 1X4BA 1X4HA 1U78A 4HX7A 5JVTA 3MD3A 5CVJA 4CIOA 4MEYF 4KIGA 2E7WA 4KIBA 1K7AA 4LJMA 5K1YA 1DRZA 3FM3A 2DQRA 1HD0A 2FEZA 2X1FA 2GIVA 5J8CA 1X4FA 3GFIA 4W90B 3THPA 3PQJA 4RB0A 4MEXF 2YH0A 1Y0UA 3HYIA 3L00A 4LK1F 2DHAA 1ZARA 5LLQA 4UNOA 4A0YA 3P49B 4PZJA 4L9TA 1RK8A 1R36A 2EV5A 1H6KX 3M7GA 3F23A 3CCJS 5A2QK 2CQ2A 4CXFA 5AONA 3ECOA 1A9NB 4YB1P 1UFMA 2DNGA 5LRSA 3F8FA 1W7PB 2V6CA 1O0PA 2LMIA 2M0GB 3KE2A 5E1WA 3MUVP 3BEGB 1ZRCA 1REPC 4QU7A 5IQQA 2ESNA 1R5HA 4Z2YA 3JB9k 3HUGA 3CCRS 2CPXA 2P6TA 3KCCA 4UV9A 2CQKA 2OTJS 2XASA 2CPDA 3WG9A 1ZN2A 4K2EA 4P9FA 5FB2A 2DGWA 4AIHA 4EJUA 5AIPA 3UWTA 3U1DA 2Y48A 3EETA 3FHZA 5LJ3Y 5DM6Q 2FQ3A 2DGXA 4E70A 1JJ2R 4A0ZA 2R7FA 5DEQA 1FO1A 5D5VB 2Z3YA 4IVNA 3F3XA 1HSJA 4OZ1A 1TQMA 3GFLA 1U1LA 4KYWA 1ZLJA 3FXRA 4FXWA 3VOEA 1L0OC 2J0QD 2HVZA 4LB6B 2V9VA 5JHUA 1WI9A 2G1DA 3F8BA 1F5TA 4F25A 2LSOA 4G7ZF 5KK1A 2NAZA 3RPUA 4KFCA 2MHNA 4B8XA 1M1KT 1S7OA 2RQ4A 1YLFA 2IW5A 2PE8A 4ZH4F 1H2VZ 4HQEA 1YS7A 4F26A 1RNLA 1HBXG 1X3UA 2M30A 3E5XA 3QRFF 2KM8C 2VT2A 1NJIT 1LDKB 1WKMA 3VAKA 3I5UA 3LAJA 4KN7X 1IN8A 2OA4A 5D4SA 5DD4A 4UY8T 2ZMEA 2M1BA 2MBFA 2M45A 1IF1A 1M5OC 2HKOA 3ZN0A 3R1HA 2DPUA 2CQ4A 2LYVA 1N88A 2V94A 2KM8B 1IN5A 1S79A 5FLXK 5CVVA 3FEYB 5HL7Q 2LA4A 4WIIA 2PFBA 3UCUP 3VF0B 2VOPA 3R61A 3E6DA 1R58A 3JSOA 3IWNC 1I27A 2Z9OA 5LXRA 5GMKa 3J7YU 5FGMA 3T8TA 2DISA 3BWGA 3CMES 4IHTA 3EGNA 4WWCA 1V3FA 4L18B 2G7HA 5DDPC 4JQFA 1E17A 2MH2A 2ZBKA 3H3ZA 3CUNA 4A8XA 2LEBA 1EV7A 3RW6A 2EK6A 4U88A 5ED4A 5ERIA 2WV0A 4I01A 3TO7A 2HEOA 3RKYA 2D9PA 2E1NA 2RS8A 2N82B 2HZCA 5H6QA 4F02A 1MJ9A 5HDGA 3RI4A 3S2WA 1QBJA 1IAWA 4ENJA 1N52B 1WQ2A 1HW2A 2DBBA 2V1UA 4YIFA 3LWFA 1FBUA 2DO4A 3NQOA 3HHNB 4ZZLA 3I0TA 1KD1T 4F7ZA 2OD5A 2DT5A 1BBYA 4ENMA 2FNPA 5FD5A 3UCGA 5GAGU 3DPTA 1YG2A 1ON1A 1QZZA 3COAC 1P27B 3ABUA 2K3KA 1ZG3A 1ZRFA 2IP2A 2L54A 3DP7A 3J7AO 1N8RT 4U0YA 2HYFA 1WG4A 1H9GA 2CG4A 2FMLA 3KP5A 1P2FA 4Q4ZF 3TYTA 1U1KA 5D78A 2FC9A 2RUGA 2K7LA 4C0OC 2FF4A 3V4GA 1BJAA 2RVJA 1BIBA 1M5VC 3MFKA 2LKZA 2CQDA 1MZBA 4CGZA 1UAWA 1R1UA 4LLNA 5FO5A 5L3EA 1USSA 5DYMA 1K8AT 2XB2D 5ICEA 4AD9A 2PN6A 4WKRA 1SJRA 1J0RA 4U0VA 3GVAA 3CC4S 1FT9A 1U6FA 3RPQA 3Q2TC 2CO5A 2ESHA 4RB1A 5JVGQ 1XCVA 1XDSA 1QO0D 3C1DA 4CZZA 3GLXA 2O3DA 4WX9A 1ZH5A 2A3JA 5D77A 3CO7C 3GZ6A 1DZ5A 2E5JA 2HKXA 3CCES 4OIOF 4C7QA 4MTDA 2ZXJA 4IRIA 1X4AA 1XSDA 2CWEA 2SXLA 1SJFA 2CQ3A 1YW8A 2DH8A 2QQ9A 3I55S 2HGNA 5BQTA 5J8FA 3VAGA 3CO6C 4HV5A 5E8IA 3SHFA 1JE8A 2OZUA 2ZJPQ 2DQLA 2ELHA 2F9DA 1YIJS 4W92B 1WEXA 2PMUA 2V1DA 4PGGA 3HI9A 1YJWS 3L2CA 1MKMA 4FX4A 2KG0A 4QU6A 4BH9A 3V7RA 2HFHA 2FY1A 1D3YA 1EH6A 1NO8A 3SXLA 3WTXC 4WFBQ 3KP7A 2EFNA 3I53A 2MB0B 4FXVA 1D8KA 3P9CA 5LRRA 3HRUA 1KQ9A 4ESBA 4LMYA 2MZQA 3K2ZA 3NS6A 2BBYA 4CDGA 1B59A 2DO7A 3J81Z 4RAYA 1PP7U 3S8SA 5JFRA 1U1NA 2DNYA 1VQNS 5ICFA 1Z1DA 2C6YA 1LJ9A 3CPWR 1R23A 3C18A 1BY9A 5LHIA 2VC1A 3BS9A 4GYGA 1D5VA 5H6RA 2A61A 2CSOA 1HXDA 3TGNA 2QBYB 1L3KA 1FBQA 4ZKAA 3DXBA 3G8TA 1F9NA 3J80K 2Y75A 5ILUA 2LA6A 3R27A 1TLHB 5JR3A 2OSRA 2A5YB 3GF2A 1B1BA 2RC4A 3LPYA 3WTZA 4Y00A 3PIOQ 1QQIA 1K78A 5BOXA 3KLOA 1I1SA 1H0MA 1ZLKA 1URNA 2FSWA 3T0YA 3SZPA 3FMQA 2EV0A 3G9CA 1B9MA 2M8DB 5DUIA 3HIFA 1NHAA 1ZG1A 3M1EA 1XSXA 1XGOA 2VONA 1G2EA 2BGCA 1VC5A 3CC2S 1VQLS 5L3FA 4LB5A 1LEBA 3S6EA 2RU3A 1KYWA 3FX3A 3J7ZT 2VBXA 2VBYA 3ZMTA 2VODA 4LFUA 2VBZA 2QM3A 3ZMDA 3PFIA 4EJTA 1XDUA 3T8RA 1PO6A 4OIQF 3S01A 4RGRA 2DNMA 4MHGA 5E20A 4FT8A 2OQRA 4CYDA 3P5TL 4ENNA 2OSQA 3JTHA 1G4DA 3E97A 2RT3A 2DGTA 3SQNA 2DO0A 1FNXH 1WSUA 4O3MA 2F5EA 1SAXA 2HQNA 1XCBA 3GX4X 3DFGA 2A6HF 1U5TC 4HA8A 3MXHP 3IHUA 2KRRA 5BS6A 1BC7C 1SJQA 1T98A 2KXFA 3ECHA 3RKWA 2Q79A 1DBDA 4KMUX 2YR2A 1JHHA 5K5RA 3RJPA 2DNPA 2P5KA 2O0YA 4ENKA 1U6BA 3HTUA 4LIRA 3T1BA 5E1XA 5GAEU 2ZJQQ 3GWZA 1U5TB 1STZA 4DNCA 1S7AA 1JGSA 3MCZA 3N97A 4GXOA 3VAJA 3IRRA 4OMYA 3PQKA 2GQQA 3LA2A 4M9XA 2ZNYA 4KIFA 2DIVA 5IT9K 1K78B 1ONVA 3MDFA 4PDKA 1YW7A 1FJ7A 2KI2A 1WI8A 2NLWA 2JT1A 1TBXA 1IN6A 4LG0A 4MGRA 1YTYA 4TU7A 2ZJRQ 1GVJA 3HHGA 1ZHFA 5GVQA 2H6BA 1PUEE 1MGTA 2CJKA 1KOOA 4BYYA 5E17F 2M8EA 2G0CA 1KA8A 4Y17A 1RUNA 3P6YC 4O5VA 3B4MA 1VTNC 2CFXA 5H1SV 2W57A 1YQAA 2PMHA 2AXLA 2DK8A 5ITHA 2AYMA 2QFJA 2PBIA 1Q82T 5K5QA 4LD5A 2A07F 2RV8A 1FSHA 1X4DA 4RB2C 3P9IA 5LEJA 3WTSC 2KXHA 2DNHA 1IZ1A 2KKOA 1U1OA 1M5KC 2JPBA 2XKPA 2MKJA 1WHWA 2KXNB 5HLIA 1R5GA 1XN9A 2IPQX 4R1HA 1SJ4P 2N7CA 2O03A 3RYRA 4PR6A 1W4MA 4OOIA 4I0BA 1IW7F 3TOAA 1WWHA 2M87A 3LQQA 2ADUA 2HYGD 3HHHA 1Z6RA 4ASNA 4LLGF 2X4HA 1MDMA 4HF2A 1W2BR 2GHPA 3U1LA 1VQOS 3TQNA 4HX4A 3IKVA 2RGVA 3N4MA 3R1LA 2MY7A 2EK5A 2F2EA 1P1TA 1YI2S 2FPHX 3EGZA 2AYBA 1OR7A 4Q5SF 2QVOA 2A69F 1T39A 2MY8A 3NMRA 4O6JA 4LMZA 1QPMA 2OTLS 3I71A 4EQQA 1LVAA 1IUYA 3BDDA 4NQWA 2JWNA 3IRQA 2JPCA 2XAQA 4TU8A 4IJAA 2XS5A 1R7JA 3CTAA 2QYOA 3SDEA 2OBPA 2UZKA 2A68F 4IOAQ 3DKWA 2MZJA 1Z05A 2JVRA 4ED5A 4XSZF 2CYYA 1G3TA 2DH9A 1OO0B 1IN7A 2DNLA 3NEUA 4LJZF 1WELA 1I1GA 4M72A 2CPYA 2RQCA 5F1RA 2D1HA 3BY6A 3UD4P 3B4DA 4L5IA 4C4WA 4U67Q 1FX7A 3MOJB 4YUDA 4Q48A 3TDZC 2FC8A 3G4SS 4KDPA 3QU6A 1U6GA 5D5UB 4M6XA 4LK0F 1X5PA 1WTBA 3FZVA 1R1VA 2FBHA 2JSCA 1PP8F 2ISYA 2YX4A 3SZTA 5FFXA 3G6ES 1F1ZA 2XGXA 4BQAA 4Y0FA 2GXGA 1X5TA 5DCMA 1LNWA 2J8AA 3IWZA 1W5SA 5CVUA 3KEQA 2CQGA 4PCQA 1J2XA 4UVBA 4S04A 1P6RA 2HWVA 1WF2A 1MDMB 3U1MA 4BAYA 4NHJA 1WHVA 1VQ5S 1WI6A 4L0ZB 2K4BA 3CCSS 4MQ9F 3QOPA 2DITA 2D3OR 3JTGA 2MGZA 5CYVA 4LLLA 2KVIA 3CCLS 3CUQA 1FJCA 3MZHA 5GADU 1O7LA 2M8HA 2G7UA 2YWKA 2PEHA 2OZ6A 1LDJA 1KYZA 1Z6TA 2QWWA 4YFKF 2HGLA 1S3JA 2HZTA 5DCFA 2X0LA 5LSOA 2XUBA 5HOOA 3ERED 2P5LC 1U1QA 3CCQS 3CLOA 3Q2SC 4L0YB 2GA1A 5E18F 2O61A 2MQMA 2FHOB 3V8KA 5L3CA 1F9FA 1W5TA 1F4KA 3K0LA 5ILSA 4Y13A 1SMTA 5LSLA 4HZFA 4HDVA 4FX0A 3VAFA 4P5OA 3EYIA 2D45A 3DEUA 5K5OA 2AYGA 4N9IA 2CPZA 5CXTA 1QGPA 2IA2A 5IFMA 2XS7A 2CW0F 2M70A 2DNZA 1HKQA 5ICCA 4EJWA 1X4CA 1X4GA 3RKXA 2LF8A 4HOBA 1VBZA 3R0AA 1U2WA 4XLNF 3F21A 4EJOA 4XSXF 1DPUA 4U7BA 2MLGA 4BNCA 5AIQA 2B0LA 2ZMEB 2ZCWA 3ABTA 3KP3A 3OOPA 4CH1A 1WEYA 1T38A 2XAGA 2RRBA 3HOSA 4RGSA 4EV0A 1FNNA 2X1GA 2LF7A 1SFXA 3E6BA 2YX7A 2MKKA 2TDXA 1BI2A 3BJAA 4UVAA 2F5DA 1J59A 4PRFA 2VN2A 3JAMK 1FP1D 2CPIA 2HTJA 3MZYA 3DQVC 2GAUA 4L5JA 1NU4A 3FXUA 4NB5A 5BMZA 2R3SA 3DLLQ 1RI7A 4IRHA 2UXXA 4LGWA 2RN7A 3HRTA 3TO9A 3EUHA 1DP7P 4OMZA 1YHQS 2ZFWA 2KJCA 2P8TA 1SD5A 2E7XA 3C3WA 4RGUA 2MQQA 2MQOA 3ELKA 2P6SA 1FOKA 3WGGA 5ILVA 2JVOA 5DDGA 3IKTA 4KNYA 2ZO4A 3MWMA 2MGZB 1MD0A 3I59A 4M74A 5FD6A 4M9SA 3F8CA 2FE3A 5A2QZ 2DNOA 3CCVS 3G8SA 1DUXC 5CVIA 4B09A 1RIOH 3WGHA 3O2PE 1O3QA 1BI0A 4G7HF 2O6GE 2OQGA 1QVGR 2HQRA 1U1PA 1FC3A 5CLSA 1U8RA 1BI1A 1HW1A 4AVPA 5DETA 3B02A 4M5DB 4Z2XA 2KU7A 3US5A 2KFYA 3VODA 3ZP5A 3NS5A 5KVRA 5D6EA 2STWA 2MXYA 1S8NA 2DGOA 5F64A 1IRGA 1HQCA 1X4EA 3WGIA 1O3TA 3U9GA 3V8LA 1QNTA 2CPJA 1S72S 4JK1X 3WTTC 1BM9A 3GYHX 1SMYF 1FJEB 3UD3P 4D0PA 1VBYA 2G9WA 3L9FA 3V7CA 2GA2A 3PIPQ 3CDHA 2PJPA 3SXYA 1R8HA 1IQTA 1HKTA 3CC7S 2CPHA 2M4MA 4HLXA 3AAFA 4PGHA 2K27A 2RQPA 4HDUA 3EX7B 2KHCA 4BHCA 2FBKA 3T5XA 4BHBA 2HS5A 2HGMA 1WHXA 2A6EF 3QPHA 1HL6A 4V19X 5LJ5Y 1JJ4A 2NZ4A 2LXIA 4HYEA 5D8LB 1SXLA 3FEXB 3DF8A 1S6LA 3CMAS 2WC2A 2EFWA 1EH7A 3IRWP 1XMAA 1CF7A 3TO8A 2L9WA 4QQBA 1BOAA 2HR3A 2MZ1A 1VQ6S 5F6FA 2MZRA 3FMSA 1TTYA 3IL2A 2BOPA 2UWMA 3TO6A 2VBWA 2JRTA 4IF4A 3KP4A 5JI6A 3L3CA 2EA4A 4YOEA 4RU2A 3QP6A 1PGZA 1BIAA 3VFZA 2XVCA 3FMRA 1UB9A 2MZSA 2BZ2A 1L3LA 4G94A 3ZPLA 3V8JA 2GZWA 1VQ7S 3K69A 1GHCA 1OYWA 4ZYHA 1SFEA 4ZZDA 1FXLA 4CO8A 2ZKZA 2E5HA 1JMTA 5FLXZ 1O3SA 2IA0A 2VT3A 2KRFA 1TQPA 3KP6A 1OKRA 1HA1A 2P4WA 3R60A 4UHTA 1DPRA 4R79A 2DNNA 1FBSA 2XS2A 1RUOA 1UHMA 3WTYC 1OPIA 1B9NA 4WF9Q 2DHGA 2UP1A 2Q0OA 3E3VA 1FZPB 1N54B 2ISZA 1QVFR 5J6XA 2FU4A 2DU9A 2U1AA 1X5OA 3WTVC 3F8NA 4G7OF 4EJVA 5ICGA 2NRAC 2M52A 2K02A 2MLKA 3GEZA 2MZTA 2D2WA 3ZZZA 2ETHA 3Q9SA 4RS8A 5HLGA 3G73A 4ERDA 1Q81T 5HS7A 4PKDB 2RS2A 2DGSA 4WFNQ 3F72A 3HSRA 5DDQC 2DK5A 4ZYEA 3CJNA 1WF1A 2CQCA 2COMA 4HBLA 4J5OA 4ESJA 2Z99A 4N9HA 4UV8A 3K9TA 1X0FA 2EFOA 4IXAA 1TW2A 1U3EM 2QLZA 2XNRA 1E2XA 3G3ZA 3ULHA 1Z91A 2KIFA 2FRHA 1IXRC 3EQLF 2UXNA 4KN4X 3ULQB 3IC7A 4HV6A 1UFWA 4RGXA 5EEHA 4HF0A 4HQMA 2XV4S 3HRMA 1CF7B 2XKOA 5DM7Q 1D9AA 3ZMVA 4P96A 1P4XA 4L9VA 2DAOA 1G6NA 2J5PA 2XHKA 4P6QA 3JSPA 4I09A 1J7KA 3S7RA 3WE2A 3E6CC 5DUKA 1O3RA 2K86A 2OIHA 1RZ4A 1HW5A 2MMYA 1KQSR 1J75A 2M2BA 3VEPA 3M9AA 3UCZP 2QENA 2IVMA 2JX2A 3SMZA 1AOYA 3F6VA 1OMIA 2AD9A 3CUOA 3VB2A 2I38A 1JXSA 2W24A 3WE3A 2HDCA 2BE5F 4RB3C 4KA4A 2GO9A 3NRVA 4AWXB 2XAJA 1K79A 2E5IA 2MJNA 3ROUA 3UE2A 1VQKS 1V4RA 3KFWX 2QEXS 3BO4A 2KT5A 4A5NA 4HX8A 1UCRA 1SD6A 2EA2A 1M90T 3FXQA 1SD7A 4YFXF 1KC8T 4RAZA 4Y15A 2N3LA 1KU7A 4XRFA 2MJUA 3BJOA 3KZYA 4A2UA 2BYVE 4M71A 3P9KA 4IRGA 1FY7A 4UVCA 2KIMA 2P7CB 1KQ0A 3RW7A 1ZREA 6PAXA 5IT3A 3MUMP 4EGZA 1J9IA 2Z5UA 1HKSA 1OPCA 2VE8A 3HSEA 1R00A 2BEOA 1FYMA 2RDPA 1Q86T 2NNYA 4BHPA 3QPTA 5TJJA 1VC6A 3WODF 3F8MA 3TKYA 4FHTA 4S05A 1U1MA 3BROA 1M5PC 3ML6A 5CA5A 5DDOC 5HDKA 2XROA 1HD1A 2MQNA 4IUFA 1KU3A 4EM2A 3W6JB 1B7FA 4GYIA 3VAHA 5JVHQ 2ERRA 2EB7A 4IPAA 1VC0A 1IXCA 4N0BA 5DD8A 2M7SA 1KU9A 4M9ZA 2FNAA 2RNJA 3K1NA 2LCWA 4XLPF 5LXYA 4QPTA 1B6AA 3GUDA 1HSTA 1DHMA 4CHUA 1T0FA 4UQTA 5EN1A 2DGVA 2KN4A 2QA4S 3MQ0A 4G8XA 2DNQA 1GXQA 4A0XA 2V79A 3I64A 3H92A 2L02A 1QM9A 2YH1A 4P9UA 4LG0B 5D5WB 1H9TA 3D2WA 5HS8A 3J80Z 2MQLA 3BPXA 3JW4A 2EK1A 3J81K 2MSSA 1KOHA 5LEKA 1UW4A 1D8JA 2DW4A 4OINF 4IHSA 2D9OA 2HGCA 4KICA 2CQPA 2ADCA 4OZ0A 5MLCV 1A04A 1TNTA 1FT8A 2PEXA 3P3DA 1IXSB 2DGUA 1ZZNA 1I5ZA 2CGPA 3U2RA 3G71S 5L3DA 3KZZA 4WXCA 3Q5FA 2KG1A 4QLCU 3HOTA 2L41A 1LQ1A 3RYPA 5BPDA 2X1BA 3BPVA 1MJAA 2QZ8A 1FPQA 4P55A 4GO1A 4EM0B 3WTWC 3VAIA 2DPDA 3LQRA 5CVRA 1OYIA 5H20A 4ZYGA 3R4KA 4L9JA 3OW2R 2CQIA 1VQMS 5BPIA 5D6FA 3I56S 3CCMS 4G9YA 1A7GE 1MJBA 1ODDA 1T2KA 2RRAA 1WHYA 2V1XA 1FYLA 3F22A 3QAHA 1W7PD 2MA3A 2ZNZA 1Q7YT 1YYVA 3N9UC 4MNUA 2IA1A 4AIKA 4KMFA 3R6SA 1S29A 1ZG5A 3DXJF 1LB2A 1FWZA 2QQBA 3R0JA 2DFIA 3Q9VA 4ETSA 1YS6A 2JTVA 2KRBA 4TU9A 2MKCA 1XD7A 4G6DA 2QQAA 1WG1A 2M5WA 3KP2A 3I58A 1YWXA 1OWXA 2OJ3A 4XBFA 3GFMA 2XRNA 5L3BA 2Z33A 3SDEB 3HSFA 3QP5A 1XMKA 5DV5A 1P4WA 5LHGA 2Q2EA 2KJBA 1VQ4S 1XGSA 5EEGA 5LHHA 3MEXA 2P5VA 4M6YA 5D5XB 4MTEA 2NYXA 4ESFA 2BV6A 2EV6A 5FJ4A 3FM5A 3O3KA 5LGNA 5IT9Z 2D1VA 2IT0A 2E5GA 4Q47A 1CGPA 3KEOA 1FSEA 4U7DA 2MSTA 1VQPS 2NS0A 3E5UA 2E44A 4DQ2A 3ZQ7A 3ZN1A 2NNNA 4TLQA 3H2UB 3K1PA 4OU0A 2DNRA 2WWYA 1G3YA 2MKIA 4IOCQ 3RTRA 3THTA 2KH9A 3GXOA 1O57A 1WF0A 2L01A 1B4AA 2F9JA 3LA7A 4YFNF 2CQBA 1GXPA 1AUDA 1OYYA 1YITS 2M9KA 3WU0A 2LEAA 2ZJ2A 3OV8A 4I0AA 2ADBA 1UP1A 3CULA 5DCMB 1ZAOA 2JRSA 1CVJA 3LFKA 1BN5A 3CUQC 2QBYA 1ZRDA 2XNQA 1YW9A 4AIJA 3CTRA 2MC3A 3EDPA 1H2TZ 4L9NA 3BOQA 2FBIA 2AS5F 1FYKA 1XGNA 1VQ8S 1ZGAA 2I2YA 3ZMZA 2FOKA 2PLYA 3BJ6A 1K73T 4CICA 1TNSA 2W25A 1ZYRF 4G6QA 4WCEQ 3CUQB 2J5OA 2K4JA 3TOBA 5HLHA 4I98B 1I6XA 1KU2A 3D5LA 2MQPA 3LA3A 1WG5A 2L08A 2Y0MA 2H09A 1IRFA 5CJ9A 2HYIB 4QWQA 4EM1A 2W84A 2H94A 3QU3A 2STTA 4WF2A 3RDIA 5LBQA 3P7NA 1FHTA 3WU1B 4WFAQ 2PI0A 2DNKA 4I2OA 1FLIA 4I02A 5HO4A 5HDNA 2W85A 1KGSA 1YJ9S 1J5YA 2M88A 2RKHA 3O6BB 2OU2A 3GO5A 1BC8C 2XSFA 1R8PA 3GZ5A 2O8XA 4EGYA 1U1RA 2CPEA 4EGLA 2DIUA 1VQ9S 4ON0A 3CCUS 1VBXA 5FFZA 3MURP 1O7FA 4EVIA 1P92A 4M73A 3D0SA 2FXAA 3ZMUA 1USTA 1KQ8A 2K8GA 2DGQA 3H3UA 3L09A 3H2VE 2E1CA 2MH9A 2B0GA 3B73A 2H6CA 4WK8F 3W6KB 2LXUA 1XN7A 3G96A 2EJRA 4HAMA 5IM0A 2OAZA 4UXNA 2CPFA 2YPRA 2MPUA 3I4PA 5LGUA 3CD6S 2DH7A 3ZMSA 2YKAA 2O3FA 5TRDA 4EMSA
chains in the Genus database with same CATH superfamily
1FOWA 1FP2A 2NSCA 1KVIA 2YU3A 4YIIA 1OQ6A 2VLAA 2W1OA 3BTJA 1QUVA 2P7VB 1IJWC 1JJHA 4RM3A 1B72B 1ENHA 4WU2A 1MN9A 2Y0BB 3OTOF 4FF2A 3CWJA 2BV3A 4J7CA 1JKHA 1JQGA 2N3OA 2WB1D 3EE3A 4ECTA 3DRRB 1QAYA 1RHUB 2RAEA 1AWCA 2LKPA 1D8ZA 1K83J 4IO9Q 2DB1A 2BJ8A 3J81j 2N8GA 5CYQA 3M30B 4R0JA 4RUCA 4CWBA 1VGYA 3QQCD 2CQQA 2WVFA 3DLAA 1JI8A 2V5HG 4J19A 1WDDA 3SFZA 2W9CA 1P4AA 4A8KA 3LFUA 1LEAA 4LVOP 2L7KA 4II3A 3MN2A 1BR2A 3OL9A 2OV7A 2HBRB 3LSTA 2CW7A 4USUA 2F5CA 4KT5C 5KFLA 2KO1A 2XIGA 1EH8A 3C15A 2R7DA 1IRZA 1RDRA 2XTJP 1BUXA 3NCRA 1XPXA 3KLHA 2LDIA 2HPIA 1YFHA 1KDNA 1XSVA 2ACMA 1SC7A 4PUSA 1QTMA 3CJQA 2OO4A 3H1CA 4M5JA 3PVXA 1NKEA 5DDRC 1GMWA 1UG2A 3HC7A 1GXTA 2EFQA 4FF1A 4DV4J 5FDLA 2XC7A 2TRTA 3RZOJ 1UWBA 2PQ8A 5KFZA 1OIAA 4CLTA 2RVCA 4WXHA 5JMNA 4F7VA 3EYYA 1SJ3P 2XSJA 5IM0B 1W7PA 4RM2A 1C0TB 3E5QA 1M1EB 1E6VB 4A5MA 3BO3A 2DDBA 5IYCJ 4ECUA 2HOEA 2V34A 2NXEA 1IR2A 3OSGA 3GIIA 3BP8A 5EG0A 3DTKA 3BTCA 3OD2A 2M7AA 3GFZA 3P45B 1LQ9A 1KQGB 5C7PA 1TL4A 4DZ6A 3MAJA 5KFNA 1MWZA 2GWRA 2XAFA 3K0JA 1UHWA 3OR2C 1JUMA 2IPOB 3RRGA 3EUAA 4KGXB 2R7QA 3UVJB 1H89C 2YNFA 1V3RA 4LF7F 1BI3A 2KLOA 2V4QA 3FMBA 1HBNB 4JI1F 3VALA 1H88C 2ASLA 3I9V2 2KIUA 3HVAA 2AMCB 2J8SA 3WHBA 4KSEB 4P7VA 2IBKA 1G3WA 3M8FA 5GAEJ 1IUJA 3I54A 1TUGB 2BYCA 3A02A 1Z7UA 1K9MT 1RA7A 4QIGA 2L3DA 3QODA 1X4BA 1X4HA 2I0XA 2BKOA 4HX7A 5CVJA 3G71I 4USKA 4H4MA 2K7KA 2Z4PA 2E7WA 2XMAA 4QWEA 1T94A 3T6BA 1X1AA 5K1YA 5EGOB 2FB0A 3OFHA 1D1UA 1FVSA 1TFYA 2C3YA 3BG5A 3THPA 1WGXA 4MEXF 2BRKA 1KEKA 1Y3JA 3D6TB 1GEHA 2CH0A 4A0YA 1TL7B 1T9VA 1TK5A 4L9TA 1RK8A 4OHXA 2EV5A 2UXBJ 2G0IA 2YXLA 3F23A 1BJZA 4XPEA 2QV6A 4YDDB 3ECOA 2QQ8A 4F3MA 2DNGA 1AB8A 2FJXA 2QRRA 3PX6A 2V6CA 1O0PA 1SIZA 1U25A 5E1WA 3MUVP 4DQQA 2APOA 3FDSA 3FZBA 5IQQA 1U4BA 1RB0A 4E7LA 3HUGA 3KCCA 5JVGF 4H4KA 2V4JC 2CPDA 2DA5A 4M6VA 2DGWA 4C3HJ 1UVLA 1HI1A 4MAKA 2V2VA 3EETA 1UFLA 3QLHB 1RP5A 4E70A 3QT8A 4USMA 1H7XA 4OHYA 3JSRA 3FVYA 1KQFB 3U7JA 5J2MA 4OZ1A 1TQMA 3M8PA 1Z21A 3GFLA 4KYWA 3FQKA 1ZTWA 1ZLJA 4F3QA 3PW7A 4C8NA 4RWWA 2AGQA 3D3BJ 4NX9A 3T1HF 1L0OC 3MTKA 3TWZA 2V9VA 1GV5A 1IO2A 5JHUA 1NRKA 3WIUA 2CNNB 1WKJA 2HHQA 1N77A 1F5TA 2DMPA 1TK8A 4F25A 4G7ZF 1DGRM 3ZQLA 4DR3J 2NAZA 2ZH7A 4Y33A 2XC9A 3BN4A 1M1KT 1S7OA 4I2QA 2IW5A 4ZH4F 1NG7A 4HQEA 4GMKA 4F26A 2GCFA 4DSEA 3DM2A 2YKMA 1TZLA 1S6QA 2BOAA 3E5XA 1DTQB 3VAKA 2BQRA 4CH7A 2IGNA 3I5UA 3LAJA 3OL4A 2ZE2B 3QSIA 3TL4X 3LH2S 1HNWF 2RILA 2LTPA 3CJ3A 2W2MP 1T0FC 3F73A 1FEHA 2HKOA 3Q0WA 4E7KA 4FNHA 2WADA 2PC6A 3DU5A 1MN7A 2X6WA 4LF4F 1N88A 4ZJLA 2KM8B 1S79A 3CCZA 4QPOA 3FEYB 3KK1A 1HWUA 1BLUA 3OYIA 3P8BB 4BL0B 3NBPB 3IAM9 4JI7F 1K0TA 4PXEA 2F4OB 4MT1A 3TP0A 3IWNC 1I27A 2F4MB 2Z9OA 5GMKa 4RJVA 3T8TA 4PWWA 1R8AA 1U8SA 1KRPA 3BCAA 1WJCA 1V3FA 3JSBA 4JQFA 1E17A 2MH2A 1LNQA 2VKDA 1MH3A 1B0VA 2PGCA 2ZBKA 3H3ZA 5B0DA 4BXXJ 3BGRB 2LEBA 1AZSB 2J7UA 3BR6A 3RW6A 2UUCF 1P6TA 4U88A 4XKCA 5ERIA 1NSPA 4WE1B 4I01A 4M94A 3FEZA 3J7A1 2HS0A 2W4DA 2EPFA 2RS8A 2E7VA 5H6QA 2XY7A 3G6YA 4CTAB 1IKYB 3DBHB 2BX6A 4M5DA 1QBJA 2NS7A 5KFUA 2FZKB 1CJUB 2EC0A 4U8YA 2OFGX 1CC7A 1WQ2A 1HW2A 1PJ6A 1RT4A 4O3SA 3LWFA 2DO4A 5DO2A 1RT1B 4JYAJ 3RG6A 5GAEI 2ZITA 5L1JA 3V4IA 2GIFA 4J9KA 1EETA 5FD5A 1ON1A 3COAC 1W36D 2R5ZB 1JKRC 1FFWB 3I5BA 1ZRFA 4D9JA 4C8ZA 1RTJB 3M8SA 4P2SA 3J7AO 1N8RT 5GMDA 2IS6A 2NVUB 1WZ2A 3KP5A 1P2FA 4Q4ZF 3TYTA 3QRRA 2LC2A 4JI8F 2VQGA 4CM2A 3KJFB 3M6UA 1HQEB 4PZVA 2F7VA 2FF4A 1N6QB 2O7OA 2CQDA 4CGZA 2DA1A 2IGKA 4MH8A 5FO5A 4GO7X 1IBCB 1A35A 5L8RC 5DYMA 1K8AT 7AT1B 4AD9A 2PN6A 1SJRA 2FX0A 2BY3A 3VVTA 1JX4A 3OYBA 2HSEB 3GVAA 2X6YA 3TARA 2IDEA 3CC4S 4FS1A 3SZ2A 3LANA 4BQOA 2YKOA 2CO5A 1LW0B 1JT0A 4BE0A 5D0GA 5K20B 4O3OA 3RB0A 3C1DA 1EZZB 3GLXA 1TWCJ 3PEHA 4PUOA 2XB0X 2FTRA 2Z58B 2A3JA 2BMBA 3CO7C 5D77A 2DEIA 4DL0C 3ZC4A 3GZ6A 3J7AN 3JSMB 4C7QA 4IRIA 2Z1DA 2CWEA 3ABLH 5E3NA 2C2OB 1SJFA 4I4BA 3I55S 1CS4B 2HGNA 3R7NB 3CO6C 4JI2J 3PCOB 1JE8A 3VYUB 4IQ4A 2ELHA 2F9DA 1LPQA 3UD5A 2JEFA 3HI9A 3BSOA 1NJYA 4FX4A 4QU6A 2OLWA 4BH9A 3V7RA 4BACA 2FY1A 3GMEA 1D3YA 4BEHA 1FX4A 3L7UA 4DU7A 1CG2A 1ZR2A 2L7ZA 1W1WE 3S1TA 1D8KA 2C3UA 3MAAB 2OMLA 1Y0HA 3HRUA 1KQ9A 3OYAA 4CO3A 2MZQA 3JRCA 1B59A 2DO7A 3J81Z 3EVOA 1BQXA 1PP7U 3JSYA 1NM2A 2OAUA 2CQXA 1R23A 4NLQA 1BY9A 3DWLE 2VA2A 3GFXA 3CJTB 1R89A 2CSOA 4F4YA 3ZQFA 1WC0A 5KCMA 3MCOA 2GMLA 4A93J 5KFXA 3HFKA 1F9NA 3J80K 2Y9HA 2Y75A 5IP9J 1FMVA 3LSJA 5T41A 5JR3A 2A5YB 5D3GA 1B1BA 3ZCOA 3MPVA 2XQCA 2KDZA 4DR4J 3PIOQ 3BYPA 3FBNB 5BOXA 1I1SA 1O51A 1URNA 3MPYA 4EFAC 3FMQA 2F48A 5C25A 4J01A 2RF2B 3PRDA 4C98A 4L6V3 5BYRA 4K4ZA 2UXCJ 3JYTA 1ERDA 2YX1A 1NLKL 3DLKB 1UW9A 5K8PA 5G4DA 1L3SA 1C1CA 1MSEC 3OSNA 4IHWA 4K0KF 3CDBA 4PJJA 2NXNA 2JEJA 5A8KA 3W6VA 1X31C 1LEBA 1RWOB 2C2ZB 4KO0B 2XGCA 3ABKH 3BG6A 2VBYA 2VUGA 3ZTRA 2VBZA 3PFIA 3ZMDA 4ZPTR 1PO6A 4OIQF 3S01A 4DV1J 1XR6A 4JV1A 1OPZA 5E20A 3W1YC 1YLXA 4FT8A 4CYDA 2D1CA 4ENNA 4J91A 1IXKA 2XDVA 5KT7A 3MKWB 4QIEA 3SQNA 4JBCA 4DPTA 1FKPB 4O3MA 2F5EA 1SAXA 4CLYA 3GX4X 3ZQCA 3A03A 3PKMA 4LT6A 3CJKB 2HG4A 2A6HF 4F67A 2CJXB 2EFVA 4ZHRB 3KIOA 1Q8BA 1HOMA 3M1VA 4RNOA 3WG7H 2KRRA 5KFGA 5BS6A 1Q5VA 2RU9A 1K1QA 2R2SA 5LFAA 3W9HA 1ZK8A 2Q79A 5J1NA 4DWIA 5E3OA 2H48B 3K4LA 4P7TA 2P5KA 2O0YA 1Y5IB 3L4BC 4UTGA 2QTWA 3PW2A 1Y0NA 2DODA 2RMLA 3EZ5A 3M2RB 4CLFA 4YY3J 4DNCA 1S9GB 3KLFB 4ZMMA 1S7AA 1HQUB 4Q5VA 4MIMA 3GYGA 2ZNYA 2DIVA 1K78B 2CRLA 4MFBB 2CFOA 1YW7A 4JI0J 3POTB 4DYQA 1JKOC 3IR7B 4B3TJ 5E3CA 1IN6A 1WUUA 3M2UB 5HI7A 3FRYA 1DURA 2WCXA 1GVJA 3NWGA 4F4XA 3A4TA 5E17F 3HP6A 2GA7A 5EWFA 3FBFA 1KA8A 4NCAA 5EZGA 3M6WA 1WC4A 5J2PA 3CJRA 4H4OB 1DLOB 3P6YC 4O5VA 2BACA 4OYZA 1MMAA 3Q8QB 5H1SV 4I6ZA 2VFVA 2OUMA 2KZMA 2FVCA 2OC6A 3SI8A 2IGMA 2X48A 5KFFA 1BA5A 2K40A 2AYMA 3JRHA 4X4OA 5HVGA 1DY3A 2FJ1A 1Q82T 4BS9A 1FESA 3KDOA 4OJGA 3DDKA 1SCJB 3RKQA 4O44B 4ITVA 3P9IA 3WTSC 1T33A 4O3NA 3UW1A 3IP0A 2CXEA 3O44A 4ELTA 2CG8A 4ECYA 1T9YA 2X1EA 4R1HA 3G6EI 2W9BA 2O03A 4HR2A 3RYRA 1D0EA 3Q8RB 1UHSA 1DTTA 5A76A 3TOAA 2VJUA 1WWHA 2KIQA 1YJTA 1NKCA 4ASNA 1UETA 3MPWA 3U1LA 3Q0UA 2D3ZA 3GZ7A 1RXOB 4MO7A 3R1LA 2DTJA 4M3FA 2MY7A 2F2EA 4A8QA 2O01C 2LBFB 5IP6A 5AE2A 3NMRA 1MBHA 2R8KA 5C4XJ 3D9BA 1WSVA 1NH3A 3CCLI 4HKQA 3OL8A 5IT9U 1VK3A 2HDWA 4EQQA 2CV1A 1IUYA 3BDDA 3IRQA 2W48A 1F5CA 4XOTA 5HBMB 2XS5A 1R7JA 2QYOA 2OBPA 2CNLB 1MWYA 2ZC2A 4IHVA 1Q8IA 4Y2CA 3LWLA 2MZJA 2JVRA 1SJ1A 3PDNA 2RUSA 4RW9A 2CJYB 1WELA 4J9LA 4M72A 5F1RA 4O4GB 2Y0SN 3B4DA 2JMWA 5EX3A 4KHMA 4U67Q 4ZPBA 4HNTA 4YUDA 1ORKA 4C6AA 3IH2A 4OX7A 3G4SS 3VGSA 4MK8A 4O3RA 2K9MA 2XGQA 3I96A 1U6GA 2VUMJ 4TXSA 1YX2A 2FQ4A 1X5PA 2CNKB 1R1VA 1TL1B 3QO9B 5L38A 1WC5A 4L73A 3KLEB 1PG5B 4MIAA 3QGHA 2RRNA 5DCMA 1LNWA 1W5SA 1KVJA 3NCQA 1FDNA 2LFVA 4BWJA 2DJNA 2NOGA 1KLMB 2LQ8A 1U48A 2HWVA 4P52A 1RT7B 4ECQA 1SL0A 1ZM4A 3CC4I 3U1MA 4BAYA 2ZM6J 4G12A 5BR8J 6FD1A 1IDYA 1VQ5S 4YIRX 1AKHB 4NLYA 4LFAF 1RESA 3PNVA 3EICA 4RMNA 4L0ZB 4MQ9F 1Y9OA 3GCMA 2GHWA 4IFYB 4FQGA 5HODA 3RB3A 1RTZA 3W9IA 1LFPA 3M8QB 2UUZA 1UVNA 3EYZA 1U47A 4QTRA 4FCYA 1C0UA 3I55I 1WJ9A 4WFYA 4YFKF 3UNGC 4KGMA 5LMUJ 2FJBB 5LSOA 4B3XA 1S1VB 1Q53A 5B1BH 4R8UA 2V8DA 3BQZA 2B63J 3GTGJ 3S3MA 2XPVA 1VOMA 2QO3A 3KUGA 2H3EB 5F0FA 2VJ4A 2NXUA 2ZH1A 1JXVA 2IAIA 4F4WA 4HZFA 4HDVA 3J81U 1S72I 4BWMA 3ZFVA 1SH3A 4OMFG 3OYFA 3NL0A 5CXTA 4D5FA 4NDLA 3E51A 4B3RJ 1HKQA 1FIAA 3JQKA 1X4GA 5HROA 2LF8A 3CDAA 2OEJA 1VBZA 1U2WA 4XLNF 3F21A 2JA6J 3H36A 5F3TA 2POKA 4U7BA 2R7RA 2HXIA 1ZGWA 3NGSA 1HQ2A 3HOWJ 3BG3A 1ZM2A 2BJEA 3RUBL 4TQSA 1IKWB 3GJTB 3PV8A 4XORA 3ENWA 3IS9B 4F4AA 4RW4B 3ABTA 5FLXY 2R7WA 4X4QA 4RBOA 1HWKA 1R0AB 3CIZA 3OR1A 5ETLA 4EV0A 1KFSA 2VHGA 2X1GA 2LF7A 1SFXA 3E6BA 3FXKA 4UUXA 2TDXA 1W0TA 4C3MA 5FKOA 1PYVA 4CCLA 3P5JA 1TWAJ 2VN2A 1FP1D 2CPIA 3MZYA 2RHQB 3DI6B 3DQVC 4ER8A 4L5JA 1XJWB 4NB5A 2R3SA 3DLLQ 3PUBA 3MFIA 2UXXA 4NZ7A 2D74B 4UF4A 3EUHA 2C22A 4I6WA 5DLGA 3HHLD 3PXGa 3MAQA 2KJCA 2P8TA 3KUEA 1HI8A 4RGUA 3TA0A 5E3PA 3BF4A 2VJVA 1HMVB 3JTOA 4Y3OA 1GVDA 3MWMA 2MGZB 3F8CA 3KHRA 4ZDNA 3LP1A 5CVIA 4B09A 5L9XA 2XZDB 3HM5A 2M5YA 2VFRA 5CAAA 1U1PA 5I3UA 1FTZA 3FFIA 1HW1A 4AVPA 5DETA 3B02A 4Z2XA 2KFYA 2JK3A 3NS5A 2STWA 2I6WA 3FSYA 4NMLA 2DGOA 2FLOA 1X4EA 4C3JJ 2RE1A 1BM9A 2B4PA 2G9WA 2H5JB 1VBKA 5ETVA 3PIPQ 4X4TA 3CDHA 1BGXT 3A13A 2I5JA 3QWLA 4WPAA 5DZ7A 2FJDB 1HKTA 2AX1A 2VKHA 4PGHA 1B8IA 4AYBD 4PG4A 3IUOA 2CZVC 2KHCA 2B7EA 3T5XA 4XKBA 4BHBA 1RAIB 2HGMA 1WHXA 3G1MA 2VPLA 2A6EF 2DMTA 1DQUA 4DPYA 4B44A 2EFWA 3IRWP 1V5VA 3VR1A 5HNHA 3FK6A 3GG1A 3PW5A 2L9WA 3KK3A 1ROFA 4LFBF 1D09B 1BOAA 1VQ6S 4GVBB 2QLWA 2VI6A 1B7YB 4XO0A 2VBWA 1LOUA 2JRTA 4IF4A 5BXIA 2HOAA 3I5AA 4YOEA 3VFZA 1IKXA 4MYUA 2BZ2A 4U95A 4Y2KA 1L3LA 4G94A 2LMDA 2VG6B 3CMQA 1OYWA 1MBGA 4ZZDA 4ZDOA 2ZKZA 4DSFA 3PJ9A 1GT8A 1WC6A 1ZA2B 3WBZA 5KFOA 1Z0XA 1RUOA 2IS1A 3WTYC 1UVMA 3HHEA 3H5RA 1YOVB 2Q0OA 2CIMA 2HRYA 3QQAA 2ZVIA 3GR1A 1VZ0A 2ISZA 1QVFR 2BVLA 4RNHA 2FU4A 2DU9A 3VYTB 2DD8S 2UUAF 5ICGA 1RAGB 4IHXA 3A01A 3Q8YA 4IG3B 3HFVA 2MZTA 3DHXA 3Q9SA 5IXUA 1JWWA 1Q81T 2EZLA 4IDKA 4PKDB 1NTCA 4DUYJ 1S9EA 1NB7A 1WF1A 1SUQA 2CQCA 2COMA 1RTDB 1DARA 4HBLA 4XDDA 1T05B 2A6OA 1QAJA 2QSFA 1Q5YA 2Z99A 4N9HA 2JFDA 1X0FA 4IXAA 1U26A 5B0AA 2QLZA 4ZLLA 1E2XA 3G3ZA 3ULHA 2FRHA 3W8GA 3NLCA 1FKAF 4WFZA 4HV6A 1UFWA 1KR4A 3HXLA 2YKQA 4IH7A 2LLZA 2XV4S 5F9LA 2FLPA 2BXZA 1XMOF 1R4MB 2W9AA 2XKOA 4URSA 1TVRB 1LVKA 3LL7A 1G6NA 4RNFA 3AA8A 1CJVA 2XPWA 3JSPA 2FLNA 3H4BA 3S7RA 2HMIA 3E6CC 5DUKA 2OIHA 2K86A 1RZ4A 1FE4A 1FRXA 1J2VA 4RX6A 2X85A 2VJIA 1B3TA 2FVRA 3AXMA 4C97A 1NK8A 4R25A 3WE3A 2OCCH 4OFZA 2GO9A 2M34A 2VQHA 5D15A 3HSJA 2V4JA 3BPSP 1Z2ZA 4TKTA 4A3FJ 5AJ3J 4A5NA 4HX8A 1SD6A 3FXQA 3G2XA 1CPZA 2GX8A 1KKHA 2GAHC 4RAZA 4Y15A 4W1UA 3C8YA 3BJOA 4RW7A 1JTXA 4A2UA 1S76D 2E1MC 2KIMA 1KQ0A 3RW7A 4C48A 6PAXA 3MUMP 3ASOH 1MMNA 3TR5A 1OPCA 1PAUB 1RLDA 4N8NA 4PFPA 1QD1A 2NNYA 4QW8A 3LALA 4DS5A 5TJJA 2BXYA 5DDOC 3HDDA 1XNQJ 1N5VA 1KU3A 4EM2A 3Q22A 2EH3A 4IH6A 3D4JA 3A1YA 3DLGB 4DR5J 2YWGA 3NGTA 2AO9A 4IPAA 3GCWP 1YX3A 4DUTA 5DD8A 2E5LF 4M9ZA 2RNJA 1RTHA 1WJBA 2H9ZA 1XQIA 3KXDA 2F5VA 4Y2MA 5CPRB 2YNHB 3HOYJ 1DHMA 4CHUA 1T0FA 5EN1A 2XF7A 4LF7J 2KN4A 2HFSA 2M0CA 1TV6A 3MQ0A 4PG7A 3LGMA 3OUYA 1HDDC 4DL6A 2VQLA 5B0BA 1E3OC 4LRDA 2L02A 2O9LA 2CDRB 3CP8A 3E7LA 4WZMA 2YH1A 5D5WB 1H9TA 1IV6A 4DPOA 4BXFA 3A12A 3J80Z 3K58A 1HLVA 3F41A 3OYEA 2WSEC 2MQLA 1W36C 3E01A 4OI4A 2EK1A 1TKXA 3LP0B 5LEKA 5D6GA 1D8JA 2DA7A 2K1RA 2R7ZJ 1FIPA 2D9OA 3LOCA 1NNDA 4E7SA 2B9EA 4ZCKA 3LAKA 4OYPA 4KICA 1R0BG 1QA6A 4CI0B 5HLFA 4E7ZA 3BC8A 1EHWA 3AQPA 1UA0A 1A04A 2OF7A 3UR0A 1IXSB 3I0SB 1I5ZA 2HWTA 4ES2A 1VJWA 3MMAA 3U2RA 1UVJA 1PUFB 1LXNA 3KZZA 4WXCA 4DF4A 2QMWA 2HK2A 3TZWA 2H4YB 1NUEA 3DKYA 4PSWA 3A8EA 5D0EA 2F65A 2KTQA 3D5RC 3CJ2A 1MJAA 3OQ2A 1YITI 2QZ8A 4BQNA 2GO8A 3H9QA 4M5IA 4GO1A 3KK2B 2BJ7A 3N28A 3ILJA 1OYIA 3R4KA 2L2OA 3L95X 3CCMS 4G9YA 2VL1A 2RRAA 2QA4G 3BH6B 4KISA 3H5AA 3H5UA 2ZNZA 4XR6A 3CD7A 1YBTA 4Q0BA 2FJWA 3R6SA 1R27B 2B9SA 2NS1B 1ZG5A 2MKYA 4PYAA 1RU1A 3G6VA 3R0JA 3Q9VA 3GFYA 4WFXA 4FYXB 4IO9F 3OYLA 4B43A 3BTIA 4DR2J 3DBLB 2XF6A 3KP2A 1YWXA 2HHHJ 4BBYA 3T19A 2F4VF 3ISND 1FTCA 2XRNA 2ZC3A 2DEJA 4RR5A 3G1LA 1P4WA 2Z2SB 1RKTA 1SC4B 1XGSA 5EEGA 3R7BB 1YRUA 3OSPA 4UW2A 4M6YA 5M5YJ 4MTEA 4OYMA 2BV6A 4DR6F 2EV6A 3PR5B 5FJ4A 4DR1J 1LWXA 5LGNA 2E5GA 1DQ8A 4TYAA 3E5UA 1OFCX 4WXOA 3PTWA 3GTMJ 3ZN1A 3R5AA 1FRLA 4CCKA 3FISA 1SV5B 5L1LA 4UB8C 1OYEA 2MKIA 2C1EB 1CLFA 3THTA 2KH9A 1RHJB 3MMJA 1UPMB 2CUYA 2CQBA 1AUDA 4DUZJ 4DV5F 1KVKA 1MBFA 1PCAA 3AHPA 2LEAA 4XL9A 2Y3YA 2AWZA 3IBWA 5AE3A 1VQ6I 3EDPA 4X4UA 4NC7A 3ZTOA 1OCPA 2PT0A 1QLNA 1XGNA 2NXCA 5F8IA 5K7ZA 5HLTA 3ZMZA 3PW4A 2HQCA 2VQFF 4B3SJ 3NEKA 2HPUA 2P9GA 1TNSA 3CDIA 2XMMA 3DRRA 2HWIA 1ZYRF 1WKLA 3OIQA 3CUQB 2J5OA 1PVEA 3M30A 2WW4A 3R5DA 3W7BA 2E60A 2K9SA 3KYDB 2MQPA 3O8HA 2LVSA 3LA3A 1WG5A 3HZGA 4OZLA 3IH4A 2J5AA 4IFVA 3A2KA 2DXDA 3ZZUA 2H94A 3QU3A 1IJFB 4ICLB 4G1QB 1S1WB 3P7NA 5FLMJ 1KBRA 4I2OA 1FLIA 2FGCA 4CNZA 1WSRA 4DEZA 2EI5A 3HJFA 1XMBA 1YJ9S 2ABYA 2M88A 2EWHA 4RAGA 2HQIA 3B6BA 3F0NA 3GO5A 2N7YA 2OJED 2HQAA 1R8PA 5KG3A 4Q2LA 4MFDA 4ZVGA 4OHWA 4DSIA 5I4MA 2CPEA 4EGLA 4ON0A 3CCUS 1Y56A 3VWSA 2PMWA 2XSDC 2BW3B 5LT5A 1P92A 3LUYA 4M73A 2KZZA 2NUHA 3H3UA 4KPCA 1V6HA 2B0GA 1RRJA 5EDNA 2H6CA 1PYSB 1XN7A 5K8OA 1ETWA 3BR1A 1RT6B 2YWHA 4BQQA 2EJRA 2XPUA 5IM0A 3HOXJ 4DFKA 2Y9YA 2H8RA 3QPLA 1BHNA 3I4PA 5LGUA 3WHIA 1C0TA 1VJQA 3CJ8A 1QZEA 4CYUA 3S3OA 2H1KA 2FY8A 2HBQB 3BSAA 2YTCA 4FTHA 4GKJJ 2N4CA 3GW2A 2YNGA 1R1TA 3AG3H 2E1RA 3S1MJ 3H2LA 3JCUC 1SD4A 2MD5A 2IYGA 1ZAXA 5HATA 2M3AA 4ED8A 1U2FA 3H90A 1Z4UA 3DFEA 1RKJA 3WIVA 1RAJA 3D5MA 1ZZFA 2DK2A 2Q8KA 1HBNA 1J09A 1WHUA 2L4MA 5DGBA 2BE9B 4AIDA 1PDNC 3KEYA 1T9XA 4C0HA 2V9WA 3BGLA 3CF5Q 3MUTP 4ELVA 5EZHA 5J1YA 2VH7A 1YRTA 3OYNA 3RAXA 1C1BA 1ON2A 4BS2A 4X84A 3DV8A 2IVFB 2L9DA 3V4MA 1YO5C 2AP6A 2GIRA 1X1PA 1DQ9A 5LL6d 1UG0A 4XRSA 3KETA 3BN7A 3DTIA 4XQFA 4BXUA 3LAPA 2OFHX 2IXSA 3C2GA 1YIOA 3K59A 3TMOA 3E6MA 4I7HA 2VFSA 2YKPA 1WWXA 4ID5B 3M32B 1M1HA 4I69A 2DMNA 3DC2A 3FQLA 3M2VB 1SQEA 2QA1A 4YR3A 3HZEA 2Y0SA 4HLYA 2CUFA 4KT6A 5L1IA 2JNJA 4ZVPB 1M0SA 2VKRA 3M8ZA 4B9UA 3ZZYA 1ZAVA 3RIRA 1X5SA 2WBRA 3DOLA 2IJLA 5LSRA 1FXRA 3GIMA 2NVQJ 1QZYA 3F6OA 4E7HA 2LDUA 1TKTA 9ANTA 1HCRA 2OPPB 1W26A 1XC5A 3AT1B 4DX8H 3TDUC 2L4AA 2HDDA 5FD1A 5CYJA 1YRNA 4P2FA 1WEZA 2Q6CA 2JH3A 2IM1A 5B66C 5HVQC 4A3LJ 3R6GB 3K2YA 2A3SA 2ZBRA 4CQ1A 3D0IE 4M3DA 1JLEB 4OV6A 2IVYA 3PY8A 1GMVA 2BKPA 2EIJH 3GFJA 3DPLC 1HDPA 4RWXA 1IN4A 4WXDA 1XGMA 2DXEA 1QSLA 4B08A 3VDXA 4E8UA 2P2CB 2IJFA 3KLNA 3ZGKA 4PXCA 2BQUA 3MVPA 2DFHA 4CIOA 2ZH8A 2WY7Q 1XC9A 2HHVA 4KIGA 5JLWA 3ITHA 1DTQA 4LJMA 2HXOA 5KFKA 2UUBJ 4LSNB 1XK8A 2JA8J 3FMWA 1LWEB 4USJC 2JWTA 5J8CA 1SC1B 2EZHA 1FE0A 3PQJA 4RB0A 4UUSB 2YH0A 4A8OA 1VRUB 3OJUA 2DHAA 1ZARA 5LLQA 4CYCB 4AQYJ 3P49B 3GIRA 4DR3F 4PZJA 3CCMI 5J40A 1H6KX 3M7GA 2QL5B 2M7BA 1MIJA 4KKOB 2CQ2A 3V81B 5AONA 1WJFA 4HTJA 4YB1P 2V8GA 1UFMA 5LRSA 4NEZA 3F8FA 3KE2A 2XLIA 3Q8PB 1NH7A 2ESNA 3QATA 3K5MA 2VPYB 2CPXA 1XEZA 3OS2A 4P9FA 1G2HA 1R6RA 3ZQGA 2HAIA 5B08A 3IAS2 2ZKUA 4NRTA 3U1DA 5LJ3Y 5DM6Q 2FQ3A 2DGXA 3FZ2A 1JJ2R 2R7FA 3U27A 2Z3YA 4IVNA 1FI4A 2OCEA 3TVKA 3GYNA 3GIKA 2B9YA 3FXRA 1MROB 4HNVA 1CJUA 2UV8A 2HVEA 3BSNA 3HF5A 2CKWA 2HVZA 3OFFA 2XYPB 3NAHA 1RT1A 1P9YA 4UUWA 1GXUA 1RQ0A 3F8BA 2V4RA 3S1QJ 3FHNA 4EATA 2XHWA 1F2GA 4DPWA 4EBCA 2RQ4A 1YLFA 2PE8A 2R5ZA 1H2VZ 1YS7A 2IFXA 1WJAA 2YKNA 4DV0J 1RNLA 4N7TA 1X3UA 3DRSB 4KFBB 2VT2A 1WKMA 3A8JA 5KFDA 2J7WA 3CLQA 3GIJA 3FSXA 4OAYA 1IN8A 5D4SA 2KYZA 3HHLC 1HKAA 3CJ5A 2MBFA 2BE2A 4JYAF 1RAOA 4WP3A 3OYGA 1HBUB 3R1HA 5IT0A 2WAQD 3QGPA 4U7UD 4QW9A 4TN2A 1IN5A 1GNKA 3BB5A 5HL7Q 3MMCB 4E7JA 3PIOF 3BREA 1CSJA 5GPAA 4XLFA 3E6DA 1CULA 1R58A 3F44A 2DY9A 2LQ9A 3M9OB 4NXNF 3PX0A 2L9NA 4IHTA 3EGNA 3WZ0A 4WWCA 2EQRA 2ROPA 1LEOA 4WBFA 3MECB 3JSMA 1HNZJ 4C2MA 3KTQA 3J81Y 2NR0A 2KKHA 3IO1A 1S6PB 5ED4A 4QWDA 2WV0A 3TO7A 1K61A 3CDEA 4DV7J 2B56A 2WV1A 4MJKA 2XCAA 2N82B 1LE8B 4HHUA 3S2WA 5J4VA 3D3CJ 2L7MP 1ZM3A 4LF8J 3P5BP 2K9NA 1DU0A 5JJBA 2CAJA 4KC5A 2DBBA 3ICLA 1EARA 1MBKA 1AU7A 2W7OA 1RAFB 4HH1A 1J5OB 1Y1VJ 3RBDA 4CP5A 3CCUI 1JT6A 1KD1T 2FHKA 2IC3A 3FDYA 2HLUA 1BBYA 3PHEA 4C8MA 2ILZA 2EBGA 3GV5B 5KFAA 3MEKA 4U0YA 2HYFA 2CG4A 2XF5A 5A8RA 5K14A 2YY3A 5IWAJ 1W2IA 3PSIA 2GM4A 4QWAA 1OJ4A 3CJTA 3V4GA 4RKUC 4EU0A 1U9NA 2RVJA 1M5VC 2LKZA 1MZBA 1LWCB 3L2QA 3C16B 1QY7A 3IFEA 2HQDA 4HSTA 3BV8A 2ZZNA 5KG6A 3D0HE 3KYLA 5E3MA 4ZCMA 5ICEA 5C44J 2EKYA 3HD1A 2X51A 4YHHJ 3IGNA 5HP1B 2YNIA 1SKSA 2BANB 1FT9A 3G2BA 2RF2A 3W2WA 2DKOB 1Y6IA 2ESHA 1XCVA 1RWNB 2ZHBA 4DBRA 1ZH5A 1I50J 2IM3A 3PG9A 1DZ5A 1RJJA 2E5JA 4P2MA 4ZVOB 3CCES 4OIOF 2MFZA 3IRXA 4XDCA 4DR4F 2CQ3A 4J9NA 1YW8A 4WYWA 3DGVA 3H4DA 2WTFA 5J8FA 3S3NA 4AYBN 1DGWY 4XM3A 5E8IA 3BH7B 4KHPJ 2OZUA 4ZCLA 4EEFG 2YWEA 4A3EJ 3UN3A 1YIJS 1WEXA 2UXCF 1S7IA 1HFEL 3MMBB 3TBIA 3JTNA 2XGEA 2DYSH 1RKIA 3CZ6A 1AA1B 3EPGA 4M3BA 4IZZA 1EH6A 3S1NJ 3WTXC 4HTIA 4ZTJA 2EFNA 2JVGA 4BE2A 4NI2A 2HEKA 3CCWA 1X8DA 2GJFA 4AC0A 4Y28C 2F1FA 3NS6A 4RAYA 4ED3A 3B6CA 5JFRA 2D3O1 1VQNS 4GFBA 4N8OA 3K70C 3CPWR 4LIVA 1PBUA 4RNMA 3N6NA 1NB2A 4RBUA 3MTJA 2VC1A 3RR8A 4NCGB 3HD2A 1HWLA 1PJ5A 1HXDA 9ATCB 1FBQA 4ZKAA 3DXBA 3G8TA 5ILUA 2LA6A 4A8MP 3M2RA 2V8PA 1WKKA 5G0RA 1O8BA 3KLFA 1TLHB 1W0UA 4B3MJ 4EUVA 3FXOA 4LF6J 1HQUA 1RWWB 3R3TA 1K78A 2V9KA 1XNRJ 1H0MA 4E7IA 1ZLKA 2FSWA 5F9NA 3W60A 4CA0A 3DOMB 1QSSA 2VPZB 3G9CA 4BBSJ 3MR2A 1SKRA 2VFUA 5BYQA 3M2UA 3GILA 1ZG1A 2J0WA 1KQKA 2HLTA 1DQAA 3GTPJ 3M1EA 4X1EA 1XGOA 2FOWA 5CKTA 4YY3F 2BGCA 1VC5A 4WZQA 5L3FA 4MK7A 1HBMB 1JLBA 3SDBA 3MM5B 1DLOA 3MM8B 3S6EA 3FX3A 3J7ZT 4JI0F 3ZMTA 2VODA 3C2HA 3OIPA 5TISC 2BUNA 3DPUA 4B3TF 3T8RA 4GO5X 1HC8A 1T8EA 2JJ4D 3LO3A 3CJ4A 4HEA2 4IKFA 1JTYA 3RAQA 2OQRA 1NPPA 3P5TL 5KFVA 3JTHA 1X3ZB 4KPYA 2PO4A 3BSCA 4QR1A 3K57A 1FRMA 5HK4A 2DO0A 3NWRA 2RDIA 5DQGA 1NDLA 1WJEA 5T7LA 4JOMA 5IT4A 1U5TC 1TKZB 4X4NA 2JA2A 3IHUA 5DG7A 4ZPVR 2F8MA 4CNYA 3KX2A 3KHHA 2LVWA 1YSJA 2KXFA 3NY0A 1HARA 2UVUA 3OTCA 1ETQA 1YZ7A 2I1RA 5C2CA 2YR2A 3OL7A 1JHHA 3RJPA 4ZIVA 3OL3A 3JXOA 4KAIA 1U6BA 3SZGA 2MGQA 3UFCX 4DL2A 2IAJA 1LUJB 3T1BA 2R2UA 2ZJQQ 3HL2A 1STZA 2KPMA 1YI2I 2R7VA 4GXOA 4OMYA 2IBOA 4U9RA 2GQQA 3LA2A 4KIFA 1JKHB 5IT9K 3DMJA 4ZJOA 1ONVA 2X6XA 4PDKA 3TUZC 2D69A 3G1OA 1FJ7A 3JQJA 5CYQB 1OCOH 5M2PA 3AOAA 3KLIA 2H6BA 4BYYA 2I8EA 5IYDJ 3M4XA 2M8EA 4A69C 3K7AJ 2HVRA 1N75A 2CVEA 4HI1A 2VL8A 4IHYA 5D4PA 2HNHA 1VTNC 4KH0B 1NHKL 2W57A 2PMHA 1G7CB 2AXLA 4NLVA 1D9FA 2A05A 3W64A 3C15B 1FJGJ 2QFJA 2AV5A 5JUMA 3KLHB 3OYHA 3HSDA 5LEJA 2HQ3A 3QO9A 1X4PA 4PWUA 2OI2A 2KKOA 4HL9A 5CD4H 1U1OA 1M5KC 3C3LA 2XKPA 1MG7A 4G3IA 3G86A 5HLIA 2VDHA 1R5GA 5CD4A 1XN9A 1NK4A 4ZP6A 2IPQX 4CZCA 5FDLB 2I10A 4PR6A 4X4SA 4OOIA 2O8KA 2XSJB 2HYGD 5IV4A 3ISNC 1N5TA 5AT1B 4GC6A 2HFNA 4HF2A 1W2BR 2UU9J 4ELUA 3DLLF 3PO5A 4HX4A 1I6JA 3K4KA 1P1TA 3EGZA 2AYBA 1OR7A 2QVOA 2A69F 2MY8A 2BY2A 4O6JA 2QA2A 2DJWA 3M8QA 2GIZA 2VKEA 2IIHA 2X9DA 4K4SA 4BDZA 4MFEA 4J9MA 2C3PA 2YNFB 1IJEB 2XAQA 3FXLA 5FKLA 1R9TJ 5KOXA 2OPSA 5BR8F 2DR8A 3BG9A 3GE9A 2UZKA 4LIUA 4K7QA 3CCQI 2PMZD 3G8QA 3PKYA 2E1PA 2DHHA 4ED5A 2CYYA 2V1NA 2AIRB 4XN3A 3VSLA 5HSPA 3W2VA 1U24A 4JYKA 1OO0B 3TAPA 4ILLA 1NK7A 1IG7A 1I1GA 2CPYA 3T9ZA 1N34J 2KFZA 3EDRB 3C6TB 1FFGB 3A0BC 2H4WB 4H4MB 2G0EA 4Q48A 2LOOA 5LMUF 2FC8A 2BE7D 3FJ2A 3W5ZA 3H0DA 1Q1VA 4KDPA 1IKWA 5D5UB 3IS9A 1XTZA 4LK0F 1HYSA 3FZVA 2FBHA 4ENOA 2JSCA 1PP8F 4RUHA 3QYYA 2BA9A 1WTFA 3SZTA 1IBMJ 2K06A 4NC6A 4Y0FA 3RYLA 4CO5A 4B3RF 4PCQA 1J2XA 3EXYA 1JXEA 1U8BA 1T08B 2W2OP 2QYCA 5C24A 3PEJA 5F8MA 1D1CA 1WF2A 3MKYB 1MDMB 2BABA 2AHOB 2EW9A 5J2NA 4GRIA 3AG4H 1WHVA 2IJNA 1WI6A 3HUGB 1YHQI 3J7Z5 1RBOB 3QOPA 3CO9A 1K1SA 2ASJA 2MGZA 5CYVA 4LLLA 1APSA 3NAIA 5GADU 2RQKA 3BZQA 2M8HA 3ZZ0A 2EBIA 2G9OA 1FWKA 2G7UA 1LDJA 2JSPA 2R0QC 1Z6TA 4NLPA 3M8PB 2FYXA 1S3JA 4RBVA 2XMUA 5C3EJ 5FKKA 1A6LA 3TEDA 3Q2SC 1VHFA 2GA1A 1ZS6A 2CMPA 4GDFA 1NDCA 4Y52J 2O61A 4KQZA 3C66A 4KH1B 2MQMA 2FHOB 3V8KA 1BC6A 1F9FA 1F4KA 1BMQB 3MMYB 5ILSA 2ZMEC 3IXQA 4Y13A 1NSQA 1AXQA 5LSLA 4DQIA 4FE7A 4M5HA 1X9MA 2D45A 5ETMA 4F0HA 4ED7A 5K5OA 2X6OA 3WU2C 5GADJ 4I2QB 1WJ5A 2EPIA 1QGPA 2HVDA 2DNZA 1S6QB 2XO6A 3RKXA 2JRMA 1D1AA 3QSYB 4EJOA 1VQNI 4XSXF 2E9ZA 1DPUA 5B7WA 5KFSA 2MLGA 4BNCA 5AIQA 5E3RA 2PFDA 1XERA 4LIWA 2LREA 3GCXP 4L76A 2WVCA 3BDEA 1CJTA 4RGSA 3HB9A 3EDQB 1MWQA 3LA0A 5A6WA 1BI2A 3U1NA 2GQ2A 1L5UA 3PM9A 2HOSA 4LREA 4FBUA 3RR7A 3KK1B 2HHSA 2WA0A 2RKIA 4KGKA 2GAUA 4NA3A 3FXUA 1RI7A 4GC7A 1H72C 2QLXA 2P9CA 2RN7A 2GHVC 3DLJA 2NQPA 1BQNA 2R8JA 1X58A 5ETOA 2COBA 3QPIA 1U8WA 1K47A 2E7XA 3MPUB 2BKNA 2DOAA 3ELKA 2VG6A 1FOKA 3IGVA 5E3AA 4RPFA 5DDGA 2RHSB 3IKTA 3SEZA 4ABZA 1Y39A 2EBEA 3VV2B 3I59A 2DA2A 4M74A 5FD6A 3ZTPA 3RZDJ 3G8SA 1V5IB 4ZPDA 2M4KA 1T0TV 1U49A 4BGDA 3IBFB 4XLHA 1O3QA 4FS2A 1BI0A 4B48A 2O6GE 2GJIA 2RIJA 3QT7A 1EKSA 4M5GA 3L1PA 4M5DB 4DIQA 3JRFA 3US5A 1FWPA 2WHOA 3GMGA 5D6EA 3B78A 1RT4B 1HHSA 4IG3A 4PJNA 1HQCA 1SC6A 1GFWB 2IJRA 1VQYA 3BKUA 2W8LA 3TVYA 4RW8A 3ENAA 3WTTC 1N48A 3QT5A 4J9OA 1C4CA 3CDUA 1XMQF 3V4IB 4IQMA 3MWBA 2ACYA 3V7CA 2VG5B 2IMWP 2MLZA 1EETB 3AD9C 1TR0A 3QAEA 1RTDA 3SXYA 2GNKA 1T05A 4A3CJ 1R8HA 4BY1J 4UOCA 4Q2MA 3AAFA 1C2PA 2ZXIA 2RQPA 1JLQA 2CADA 5HVFA 2HHPA 2HS5A 2HQGA 1RT3B 1F3VA 4V19X 1TL8A 1JJ4A 3TZZA 5K7HA 2PI5A 4HYEA 1SXLA 2A6TA 3FEXB 1I5OB 4Y34A 4JX6A 2ZOMA 4CO1A 4DUYF 1L3TA 3SYZA 3AL0B 4LBIA 1G8XA 2R8IA 4JOUA 1ETOA 3FMSA 4ES3A 2ZVSA 3IL2A 3NKYA 3ZZRA 3PYFA 4OI0A 3QFHA 3L3CA 2Y30A 2A0FB 2EA4A 3TZXA 4RU2A 3C6UA 3QP6A 3QGIA 1UB9A 2LD5A 2MZSA 3UO0A 4NYOA 4PUOB 4AL6A 2GZWA 1GHCA 1SFEA 3N5FA 1FXLA 2MLYA 4F50A 5J3LA 3NS7B 3UN2A 2VT3A 2IA0A 2KRFA 1TQPA 3OYJA 4HLBA 1HA1A 2G2YA 4R79A 2XS2A 4DV2J 3TAQA 2E9TA 1B9NA 4HDHA 5M2RA 1KHVA 2DHGA 2UP1A 5FJ8J 5FKMA 3TNVA 4UZCA 1MNEA 4PK4A 2AJFE 2U1AA 4B9SA 3F8NA 2V0NA 3R5JB 4G7OF 1RISA 4HG2A 4JI5J 2NRAC 2R7SA 4BEHB 2K02A 3MM9A 3GEZA 1FEEA 4DJAA 2PEBA 3S15J 1F0XA 2ETHA 2AZ3A 2EFGA 3G73A 4WWSA 3CMMA 5HS7A 4YDXA 2ROEA 3VGTA 3HSRA 1I3OB 5DDQC 3D6FB 4K59A 2DK5A 4ZN3A 3CJNA 4ETZA 5GADI 5AJ3F 4TY8B 4DX7A 4J5OA 4ESJA 3R2DJ 3H8YA 4P73A 4WU3A 3H9GA 1M5SA 4LQ3A 3J80Y 1GMUA 5KTQA 1RETA 1XMXA 1IM6A 3DLGA 3ZRGA 1JLGA 4S0MA 4ZLNA 1OCTC 4LR8A 1NK0A 4FE4A 1ZA1B 3HRMA 2ASYA 4XICA 5D3GB 5DM7Q 2ZBPA 3R6LB 3TW0A 4RO0A 4L9VA 3WC2A 2J5PA 4F92B 2W7NA 2QA4I 1XNQF 2L48A 1J7KA 3QNWB 5C25B 4PEOA 5AXNA 1O3RA 1HW5A 1KQSR 4DR5F 2K3FA 5KFCA 2QENA 2JJ7A 1QAXA 3UQSA 1FTTA 5ADZA 3VB2A 2HKEA 3PX4A 5A8KB 2HDCA 1JLAA 1HPZB 4M5LA 3NRVA 3MEEB 3OTEA 2LKXA 2XWXA 2E5ZA 2E5IA 2MJNA 1BL0A 1VQKS 3MR7A 2LXFA 3KFWX 3NWSA 4PJLA 4CO2A 2XGDA 1R43A 4NUBA 1LFUP 1BE4A 2WVBA 5CCLA 1S1TB 2OHDA 2EA2A 1M90T 3Q89A 3FK7A 2HHTA 2UXDJ 1SD7A 3M8WA 1PUFA 4LF5J 1KU7A 4XRFA 2MJUA 5HANA 4MTPA 2BYVE 4I0WA 3S1RJ 4FNIA 1EP4A 4IRGA 2ALZA 1FY7A 4UVCA 1NZ8A 4EZ6A 1FVQA 4KHRA 3K4BA 4EGZA 3DCAA 1J9IA 2Z5UA 1HKSA 1X3WB 1Q7LB 4IH5A 4UZBA 1E0EA 4ZPWR 4NE9C 4WP9A 2GZOA 3D1HA 3BROA 2LP4A 5CA5A 5HDKA 2XROA 2MQNA 3VAHA 1VLOA 3AJ2A 2EB7A 4LR7A 4Y4RA 3CJSA 4JB8B 4B1RA 1FTRA 2HVHA 2XMVA 4XLPF 4KIAA 2KJVA 3HHLA 3T41A 3Q8SB 2VG7A 2HI3A 5KFWA 2AJ2A 4XLCA 1POGA 4Q8EA 2K9QA 1MMGA 1REVA 4KR0B 3L2VA 5EWEA 3IWXA 2HNZA 5IS2A 2W8KA 1UJ8A 2E1OA 1QM9A 4KYZA 1K6YA 4X64F 4CRJA 2HAFA 2OELA 3CSKA 4CLWA 2WSFC 1U0HA 4CCHA 1UJ6A 3D2WA 1K44A 2NREA 3IAM2 1NXIA 3N05A 1SVMA 5F08A 1N0UA 2XY5A 1VNDA 2MSSA 3GB0A 1KOHA 3RB4A 5LMNJ 5J2PB 3CJRB 3TX8A 2DW4A 1UZDA 1RBLA 3K5LA 4NA2A 4RA2A 1FDBA 4DR2F 2HGCA 2XM3A 2JLFA 1LW2A 1FERA 2DR5A 2HHHF 4N5SA 4DV3J 4XIDA 2WAQN 2PEXA 2NSBA 3AD8C 3KLGB 1SV5A 1ZZNA 1BXNA 5L3DA 1A5JA 3HULA 4ZVSB 4P2XA 1PIEA 4LRBA 2KG1A 4AYBA 4B9NA 3HOTA 2C42A 2DT9A 2LP0A 4DR1F 3RYPA 5F8LA 5ETKA 4N41A 1T3NA 4YR0A 3NP5A 2W9BB 4X66J 5EWGA 4RU9A 2DPDA 3LQRA 4L9JA 3AH6A 1VQMS 3ZTSA 1MJBA 1T2KA 2CUJA 2V1XA 2XULA 2DOFA 1YYVA 4DJBA 1S7HA 1P9QC 1VQ8I 1LWFB 5IQ6A 1S29A 4DUZF 3LSHA 4D3HA 3GSIA 1FWZA 2DRAA 4GKKJ 2DFIA 5KG1A 5DG8A 2ZDPA 1RWXB 5J1RA 1JKPC 2MKCA 4IQXA 4QPXA 2R9LA 4G6DA 1WG1A 3HVWA 4RLQA 2M5WA 3I58A 3O3LA 2R93J 2QKMB 3EVWA 3DOKA 3EZOA 4C3LA 4D3GA 4G1QA 2Q2EA 5LHGA 2KJBA 1VQ4S 2GW8A 3TJ9A 1DAXA 2RJZA 3MEXA 4B3SF 1DFDA 3CP2A 5B1AH 3FCWA 2WK4A 4YR2A 2CRGA 4QSHA 5IT9Z 2IT0A 1QE1A 4Q8FA 3RCOA 1RAAB 3Q24A 4OX9J 4I67A 1IBKJ 4U7DA 1VQPS 2NS0A 4IR9A 4CSWA 1TP4A 3ZQ7A 2ZBQA 2BW3A 4BU2A 4OU0A 2DNRA 1VQ9I 3BR0A 1WD6A 4IOCQ 2QGFB 1N33J 3LMMA 4WKYA 2A18A 3M7VA 1B4AA 1RT6A 1GXPA 2LH9A 1U09A 2GMJA 4PXDA 4XKWA 4NC8A 3V2UC 3KJVA 1BR4A 1U6ZA 3WU0A 2ZWOA 1S10A 4I0AA 4LOCA 3K4MA 4YEAA 2ADBA 3CULA 5DCMB 1ZAOA 3FXJA 2V2KA 5DJBA 1BN5A 3IR5B 3CD6I 4NXNJ 2QBYA 1ZRDA 3N5BA 1AA7A 1YW9A 1RT5A 4EYIB 3CTRA 1H2TZ 5KOWA 4A3DJ 2E35A 3DEEA 2L9SA 2V2ZA 3WX4A 1HNVB 2FOKA 3BJ6A 1K73T 3BDPA 4CICA 2W25A 4NEYA 1VFJA 4L75A 2VXDA 1WPKA 3IR6B 2K4JA 5HMWA 4KE5A 2MG4A 4GKJF 2HBYB 4M95A 4D7NA 5T14A 4U6PA 3GBGA 2HYIB 1S57A 3KUHA 1RR8C 2WONA 1RACB 5EDWA 3D67A 4PPDA 2KFDA 5LBQA 1FHTA 3WU1B 1TQLA 4KITB 4WFAQ 2PI0A 2DNKA 5HO4A 4LG3A 1FRIA 3GWCA 2W85A 4DQPA 2Y2ZA 3HX9A 1J5YA 1X0PA 3BJYA 2RKHA 2ZXWH 3O6BB 3KG0A 2OU2A 2XSFA 3GZ5A 3EGWB 3ET6B 4EGYA 3CD0A 1JK9B 2DT6A 5EYRA 4ZC3A 1IQZA 3PYDA 1V54H 2V26A 1O7FA 1T8IA 4YP3A 3D0SA 3ZMUA 1USTA 2K8GA 2HOTA 3GTKJ 3M2VA 2MH9A 3B73A 3E1SA 1VISA 3W6KB 2LXUA 1Y8RB 2ZSHB 1NPRA 3OR1B 4XONA 2OAZA 2ZOFA 4IG0A 4J9RA 4V2FA 2MPUA 2CPFA 3VGUA 1W5CC 2DH7A 3ZMSA 2LDYA 5TRDA 3PNTA 2F63A 1R6YA 5KG7A 3IWFA 4B9VA 2ZKTA 4BCAA 2ME6A 1Z9CA 2DLLA 1DDNA 1V55H 1RWPB 4UOFA 4F52A 1ULYA 1U5TA 5D4RA 1RA6A 2RD5C 3WTUC 3VTIA 1S1UA 4OZ5A 3U02A 1RABB 4OLPA 2EVZA 2R7OA 4A12A 5BNGA 3HRSA 2DCLA 2JZYA 2RDJA 4I2PA 4OIPF 3H25A 3SV3A 5DM6F 5B3SH 2ACJA 4KUMA 4AUXA 3H5NA 4ZLJA 1JLEA 4BC7A 1FNMA 5K5MA 2ZZTA 3LP1B 3OYMA 2MQ8A 3IM8A 8AT1B 4L3KA 5DQHA 1FKOA 3PR4A 4R8HA 3BO2A 3T1YF 1Q1HA 1WRJA 4IOAF 2MKHA 2DI3A 4J9PA 2WTEA 4A48A 3DLBA 1XB4A 3HM9A 5F04A 5CZVA 3CXCR 3QAUA 2ECBA 2H27A 2F5GA 3EPIA 4JBAA 4H0EA 4MMOA 4OIRF 3ISPA 2VC0A 3FF5A 3PRVA 4PWDA 4LSNA 3D28A 1LWEA 5J1PA 2LNBA 5D8KB 2I5JB 5IY5H 2AYEA 4R5PA 1G3SA 1MSWD 2WSCC 1VRUA 2OPQB 2H8WA 4HW0A 2DHXA 1YJNS 3L7WA 5IYBJ 4U8VA 1B8IB 4CYCA 3TAMA 1ZAWA 3HTSB 4TV7A 5GAHU 2BM0A 5A0YA 2F3JA 1N36J 4KKOA 3NNAA 2LK2A 3BZ6A 2AEFA 3I87A 2UUBF 5BJRA 4CLUA 4ED4A 2NYIA 2B7CB 2J76E 3RBZA 4A6EA 1P7JA 3KK3B 4XKVA 2K3IA 5D4LA 1HNIB 4YMEA 2DMQA 1VS3A 1T3OA 2CQHA 4P10A 4N47A 2ZZMA 1YKWA 4AQYF 5H9FK 2VE9A 4OYBA 1R22A 2RNEA 2EFPA 3TA2A 4U0WA 5L3GA 3KHLA 1KNZA 1KP6A 1IKXB 3V5RA 5GAHJ 1TW3A 4GGGA 2F5FA 5DTDA 4GCVA 2JL9A 2HIQA 5FRMA 4K5RA 1T03B 1PBAA 3H5SA 4FP9A 3K1MA 4W98A 2E71A 1ZM9A 1MROA 2DR9A 3IG1A 2V68A 3EMTA 4OZ3A 1F3FA 3SSQA 3GJSB 4C3KA 2JHEA 2U2FA 2A1BA 4JI4J 2ATLA 3HVTA 2XHCA 3LQVA 2J6SA 4OHZA 3OR2B 4NA1A 3V7SA 2FHJD 1NK3P 2QG9B 4K2JA 3J7AY 1WACA 3MD3A 3A01B 2BY0A 1U2CA 3SFIA 4CCOA 4JP8A 4MEYF 2B8QA 2AXTC 4KIBA 2CJ9A 1K7AA 3DRSA 4KFBA 1DRZA 2A5WA 1HD0A 3DLEB 1S9EB 1S7EA 2C2NA 2X1FA 3CESA 2ZD1A 2GIVA 1D8YA 3HT0A 1X4FA 3GFIA 3LPEA 1Y10A 2QE5A 1TKDA 4K4VA 3UPFA 3L00A 3C14A 2W4CA 4LITA 4LF9J 1HBUA 1QHGA 1SEUA 2X1CA 2KB2A 2EC2A 2HNYA 1S48A 3H59A 2F4FA 1VHIA 3CCJS 5A2QK 4BHQA 4B9MA 4DV0F 2D3UA 4CXFA 4ALZA 2CU7A 2ZFHA 1LFBA 3VPRA 4FYYB 5M2UA 2LMIA 2M0GB 4A8WA 2R7XA 2MABA 3FBIB 2DCEA 4QU7A 3DU6A 3GJQB 1Q4RA 1H98A 1R5HA 4F91B 3JB9k 2ZUAA 3CCRS 4UV9A 2OTJS 3GZNB 1CJVB 2XASA 4YRVA 3WG9A 4HNUA 3AJ1A 4AIHA 4HT5A 1CQMA 4EJUA 5AIPA 3WC0A 3NWTA 1WNEA 4ZVUB 2YVSA 5M3MJ 2O1PA 4A0ZA 4UQGA 3HHDA 1NMEB 5DEQA 2E2IJ 1FO1A 5D5VB 1V3ZA 4I1TA 1X4OA 2DT7B 1OLTA 2VPWB 2HVQA 4DMZA 4OYIA 3VOEA 4MKBA 1GLNA 3AODA 4ES1A 3C2BA 2V4JB 2XLKA 2HBZB 2J0QD 4NZ6A 5K8MA 3BPDA 1WI9A 1R71A 5H9EK 1HNZF 4DV6J 3CVKA 3MEGA 5KK1A 4FYVB 3T3FA 3RPUA 3AAWB 3T5LA 4QIWN 4DV7F 4OIXA 1VMBA 4HT7A 1HBXG 3PRBA 2KM8C 3QRFF 1IGNA 3BGFA 1NJIT 1LDKB 3J7ZI 1ITYA 4LF8F 3ABMH 3QYBA 4UY8T 1MU2A 4OJ1A 1UVIA 3LP2B 2ZMEA 1YZ6A 1ZTTA 2M45A 2W4PA 1M5OC 3HK2A 1NZAA 1LWCA 2ICWG 2Y0SD 2CV2A 2DPUA 2CQ4A 2LYVA 2PFFB 2AQEA 1N5YA 1SAUA 1RTHB 3QJLA 3ENQA 3UCUP 2BANA 2VOPA 3R61A 3VF0B 5IWAF 4XAKA 5EEAA 2XY6A 1OJLA 5LXRA 2HQ5A 2HWHA 3SCKE 5FGMA 3A3PB 1SI9A 4WYLA 3LSIA 2DISA 3BWGA 5L39A 1TWHJ 1UCNA 3PO2J 3OUYB 1FA0A 1S99A 4M5MA 2G7HA 5DDPC 3GPAA 1UAAA 3KG1A 1U45A 1SC3B 3CUNA 3EPZA 3OHBA 1CJKB 5GAHI 1VI7A