2VOOA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
MAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vooA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vooA02
4CZZA 4G6QA 3J80K 2JRSA 2N3OA 5JI6A 2CQIA 1USTA 1UFMA 4CGZA 2OZ6A 1DZ5A 2OQRA 5CLSA 3C18A 2MH2A 2DNRA 5DDOC 1IXSB 3FF5A 1PP7U 2LEBA 5CXTA 2HOEA 2EJRA 4KNYA 1RIOH 2ZO4A 2ZXJA 2P7VB 4A0YA 2JX2A 2G7UA 1SJQA 5LEKA 1QNTA 4GGGA 3KLNA 5D4RA 2ZJRQ 4Y15A 2V79A 5BOXA 3JB9k 3BPXA 4KA4A 4BAYA 5D6EA 4J5OA 3TYTA 3COAC 1BC8C 5EN1A 1FZPB 3BWGA 3ZPLA 2QQ9A 4RB1A 2DNLA 2LECA 3B02A 3B4MA 2AYEA 2FBIA 5HOOA 2HYIB 3FXUA 4PRFA 3WGHA 2CQ0A 3LQRA 2DFIA 1O0PA 4JBAA 4KN4X 3FXRA 1I6XA 4I02A 1XCVA 2BZ2A 2O03A 1MD0A 5E18F 1WHWA 5DCMB 2MKSA 5EEGA 1SXLA 4LB6B 2MD5A 2OSRA 5LJ5Y 2VOPA 4TLQA 3ZMZA 1F5TA 1LVAA 1X4CA 2VONA 3RTRA 3MOJB 1N8RT 2J5PA 1YLFA 2K4JA 2TDXA 5LXRA 3I58A 5HLHA 3CO7C 1YYVA 2DK8A 3CCLS 2XGXA 2RKHA 2MZQA 2LXUA 2QVOA 4ETSA 1J9IA 1VQ7S 1VTNC 2BOPA 5JVHQ 3E5QA 1PDNC 2A6EF 3SHFA 2AD9A 2HTJA 1HKSA 3KP2A 4OIOF 3NRVA 3DLLQ 2Q8KA 3IC7A 3SDEA 2MZRA 2KM8B 3GZ6A 4L5IA 3GVAA 1OWXA 2MHNA 2PBIA 1F9FA 4RAYA 2ISYA 3J7YU 3ABUA 3RJPA 1I1SA 1X4EA 1STZA 1U1NA 2O61A 2KXHA 3SZPA 4W92B 4RB2C 4B8XA 3CCSS 4KMFA 3G71S 4U0VA 3IL2A 2VC0A 2MMYA 5LXYA 4GYIA 2J8AA 3CCUS 1BI0A 3WU1B 3US5A 3R27A 2ESNA 3CC2S 4HF1A 1LEBA 1VQ9S 3WTVC 2DGTA 2J0SD 3F8CA 2CQDA 1MDMA 3HSFA 4KFCA 2PEXA 2DNHA 5AONA 3VB2A 1KQ0A 5LGTA 2MSTA 2IA1A 3U2RA 2WV0A 2Y0MA 2DGWA 1YJ9S 2DGOA 3P6YC 2V9VA 3GXOA 1M90T 3H92A 3J7ZT 2RGVA 2VT2A 2V94A 5GADU 1FT9A 5HVQC 3M8FA 4U0WA 5HS8A 3LAJA 2Z99A 4AD9A 5D77A 4OU0A 2JRTA 3TDZC 4WXCA 1YJWS 4ZKAA 3RW7A 4DQ2A 2HDCA 2L08A 4CH1A 4QWQA 2DGQA 1U1RA 1YQAA 1FSEA 4BS2A 4LD5A 2FC8A 4EGZA 3MUTP 5EEHA 5E20A 3IKTA 5BPDA 1IQTA 4M9XA 4CDGA 1W5SA 4XRFA 4LMZA 2NS0A 2CFXA 1WWXA 1ZAOA 3HTSB 3GEZA 2IW5A 1U1LA 5DDPC 2YSRA 2A07F 2WTEA 4EQQA 2DITA 3TO6A 1PGZA 4RGXA 1FYMA 3HRSA 4OIPF 1IXCA 4ENKA 1OR7A 5MLCV 3DFGA 2IRFG 5GMKa 1LQ1A 4HQEA 3SXYA 2CQHA 3V7CA 3LQVA 2XV4S 4Y13A 3G73A 1OPCA 1J2XA 1R8PA 1FP1D 3DKWA 3C7JA 4CHUA 3MEXA 1KQSR 4ZZDA 1C0WA 3ZZZA 2G4BA 1NHAA 2L3DA 5L3EA 3S8SA 1VBXA 1XGMA 2JSCA 5DCFA 2RRAA 1FJ7A 5KK1A 1KGSA 4ESJA 2WBRA 3HTUA 3HHHA 1H6KX 3G9CA 4KICA 5HS7A 4G7ZF 4A8XA 1AOYA 4O5VA 1QZYA 2GIVA 1JJHA 1CVJA 2EWNA 1BC7C 1FC3A 2QWWA 2EK5A 3SMZA 2DGUA 3REOA 3CDHA 3G3ZA 1X4BA 4LK0F 2F9JA 2WWYA 2EA2A 1X4FA 2ZJQQ 1T98A 5JVTA 1ZARA 5CVRA 1T0FA 4B09A 3F22A 1S6LA 1WF2A 3UCGA 3LFKA 1YJNS 5LBQA 2ADUA 1KOHA 2MZTA 4RB3C 2D2WA 1WEYA 1XDSA 5JR3A 1U1MA 1SD4A 4M6YA 2N7CA 2MC3A 3TP2A 2YR2A 3DV8A 2EFQA 3QP5A 1XGSA 4FXVA 3BO4A 4C4WA 2ZJ2A 1VQKS 2M88A 2EK6A 1W7PD 1JJ4A 2JVRA 1JJ2R 1GHCA 2CQKA 4P5OA 4KIBA 4I01A 4BYYA 1M5OC 3T8RA 2MKHA 1UAWA 3FM5A 2GZWA 1Q1HA 1ODDA 2CO5A 5IFMA 4EGYA 1Q7YT 3MXHP 2ADCA 3OV8A 3CTRA 4HX4A 2I38A 3ULHA 1F1ZA 1O7FA 4IPAA 4YOEA 2K7LA 4XSZF 1J7KA 4YFKF 4IRGA 3CC4S 4PR6A 4FXWA 1SJ4P 2RT3A 1U6GA 1YW7A 4BHBA 3E3VA 2A69F 4AIHA 2A5YB 3CUQA 1HXDA 4M9SA 1M5VC 1XDUA 3G4SS 4OOIA 4WIIA 4JK1X 4HAMA 2PJPA 4I09A 1H9GA 3S7RA 2XKOA 1WI6A 2X1GA 2FQ3A 2HYFA 3FWEA 5E1WA 3G8TA 3TOAA 3TO7A 3EQLF 4Y0FA 3R1LA 5J8FA 3K1MA 1V4RA 2RNEA 4UQTA 4QU7A 2DIVA 4M73A 4HYEA 4I2OA 3CC7S 1ZRFA 2ZMEB 2VBZA 4M72A 2AYBA 3S01A 4QLCU 4XLNF 1QQIA 2EFWA 2FY1A 2KJBA 2MQOA 5L3DA 1H2VZ 3HIFA 4CXFA 2DNPA 4UNOA 2XUBA 2MQLA 1O3TA 1SD6A 3F8FA 2D45A 1X5OA 1BIAA 2M8DB 4LFUA 2GWRA 3MZYA 2FNPA 3SZTA 4Q47A 3B4DA 4KIFA 3ZMUA 2NNNA 4LJZF 3K0LA 3CCRS 2W84A 3HRMA 1QGPA 4A5NA 2P7CB 4L9JA 1XSVA 1HSTA 4ZYEA 2KIUA 2CW0F 1LDDA 4F25A 3MDFA 3MD1A 1X5TA 2DGVA 4ON0A 2W24A 2QUFA 1HA1A 3FEXB 3ZQ7A 3EYIA 4A2UA 4EMSA 3LQQA 3F23A 4IVNA 1P2FA 2MGZA 2GA1A 4C7QA 4HLXA 3E97A 3WU0A 4NQWA 3QP6A 2DH8A 3R60A 1SFXA 2DAOA 1FP2A 1HW1A 1VQOS 2IA2A 5CVVA 3DPLC 2F3JA 2K86A 1RK8A 5L3FA 2BV6A 5FFZA 2DO7A 4EV0A 4N9HA 2E1CA 2CPHA 1SJRA 2JZYA 5E8IA 1ZLKA 2GAUA 2KG0A 2NNYA 1WG1A 1CF7A 1KYWA 2P5LC 1T38A 4MHGA 2KH9A 3DXJF 2G9WA 3OOPA 1ZYRF 2BE5F 2H94A 2HVZA 4L0ZB 2MQPA 5H6RA 4LG0B 2F5CA 1WKMA 2CQGA 5IM0B 3G8SA 4ENMA 2FRHA 2AYGA 2KYXA 4HF0A 3KZYA 3U9GA 3SXLA 4OIRF 2H09A 3UE2A 1U1PA 4WXDA 2JVOA 3I55S 3R1HA 1HSJA 4ZYHA 1HL6A 3V7SA 2LNBA 1YWXA 1IN8A 1KU3A 1OIAA 2M30A 1Q81T 2YH1A 2ETHA 2L9WA 1IZ1A 4WFAQ 1FHTA 3HUGA 3BY6A 1ZRDA 1KU9A 3GUDA 2ACJA 2RQ4A 4L5JA 4G9YA 3J7AO 2R3SA 3M8EA 2FEZA 2MKIA 3BO2A 2LEAA 5D6FA 1J5YA 1LNWA 1K9MT 3GFLA 4YUDA 3VAFA 1MJAA 1W7PB 3RIRA 4U7BA 1BM9A 1OYWA 5GAEU 2PG4A 5IT9Z 1FSHA 2MKKA 4BH9A 4TU7A 3O3KA 3RPUA 3S6EA 4KT5C 3P9IA 2M7SA 1U1QA 1SD7A 4IO9Q 2OTJS 1QBJA 5LGUA 1XGNA 1FJEB 2GQQA 1IXRC 2RN7A 2DW4A 5A2QK 1S8NA 2VT3A 1KYZA 2EFPA 2ISZA 1S3JA 3KEQA 4A0XA 3CLOA 3GF2A 5DV5A 1VQLS 3MURP 2DHSA 2CGPA 4OZ0A 3MZHA 4WKRA 1HBXG 3SQNA 3F8NA 3RDIA 3RKYA 5BMZA 1YIOA 5E8GA 5ILVA 2L01A 3DXBA 1XD7A 2FOKA 1ON2A 3WE2A 2PN6A 1U8RA 3PQJA 4N9IA 3KCCA 4L9NA 1TW2A 1MJ9A 3KP5A 3TGNA 3I4PA 4C0OC 2EB7A 2P8TA 1XN7A 3H2VE 3THPA 2RS8A 2DBBA 3WTSC 1IUYA 1OKRA 5LHGA 3WTZA 1U78A 3CUQC 2G0CA 1IN7A 4KN7X 3HOSA 3L09A 1X5PA 5HDKA 4ZZLA 1S72S 4WK8F 1M5PC 2V1DA 3GZ5A 1DBDA 1U1KA 2KU7A 1R36A 5ICCA 2XNQA 2KIFA 2JPBA 4RB0A 1DP7P 3F8MA 4BNCA 1A9NB 1L3LA 1R1UA 4ASNA 5ICEA 1HD1A 4HF2A 1FLIA 4UV8A 2RS2A 3KFWX 2KRRA 1Z9CA 1TNTA 4GCVA 1K78A 1SJ3P 2QA4S 2W57A 3N9UC 2KG1A 2RQPA 4P6QA 4G6DA 2M0GB 3Q2TC 2FE3A 2LA6A 2W25A 1YHQS 4ENJA 2M52A 5DUKA 4L18B 2XAHA 5H1SV 2Z5UA 3I59A 2EV0A 4FX0A 3CD6S 3DEUA 2OAZA 3K1NA 3L9FA 1UCRA 2CPIA 4HX7A 4MNUA 3HOTA 4DNCA 1Z7UA 2VOOA 2J5OA 1SAXA 1Q86T 2XAQA 3CCQS 4RAZA 4UXNA 2G1DA 1EV7A 1P92A 2COMA 2VXZA 1ZG3A 2XAGA 4S04A 1VBYA 2SXLA 3N97A 2EFNA 3WGGA 4HV6A 2LF8A 3V4MA 3ZMTA 2KRFA 2HZCA 5FJ4A 3BEGB 1GXQA 1U1OA 1K7AA 3CCVS 4HW0A 1UP1A 2U1AA 3IHUA 5L3BA 1Z1DA 1B59A 4FHTA 3TDUC 3HSEA 5DD4A 2QENA 5D8LB 2MPUA 2LYVA 3ZP5A 5K5QA 5A2QZ 1UW4A 1BIBA 3ROUA 1HD0A 2O0YA 2DHGA 3E5XA 1Z6RA 4F26A 2YPRA 2D1HA 2YKAA 2MY8A 5D5XB 2LF7A 3I0TA 4FT8A 3WTUC 3EETA 3H3ZA 3WG9A 2KIMA 3ULQB 1HQCA 2FHOB 1M1KT 1R8HA 1P4XA 4CIOA 3QOPA 2GA2A 2LDUA 3BDDA 3MFKA 3IWFA 1B9MA 2LCWA 1TQMA 1G6NA 4YFNF 1DRZA 4IRHA 1KD1T 1ZREA 4WCEQ 5FB2A 3IRRA 4L9VA 3DQVC 3E6MA 4ESBA 4CO8A 2WC2A 1KOOA 2QM3A 4P55A 2HGNA 2ZBKA 2KHCA 5LRSA 3FM3A 5KVRA 3S2WA 3ZMVA 4WX9A 3E5UA 2D3OR 2HS5A 1ZHFA 2EV6A 3TQNA 3L2CA 1IN6A 2MJUA 2K3KA 3WTWC 3TO9A 1REPC 1Z6TA 5E17F 3KP3A 4UVAA 4RS8A 2JTVA 4A0ZA 3ZN0A 5BS6A 3NEUA 2DGXA 3M9AA 4LLGF 3CJNA 5GAGU 3VFZA 2JT1A 3I56S 1YG2A 2VE8A 3LWFA 1WI8A 2CPYA 2DNKA 1QPMA 2QBYB 3R0AA 1FBUA 2IJLA 2H6BA 4EM2A 1WI9A 2CYYA 1SJFA 1VQMS 2L4MA 4V19X 1S79A 1JHHA 2Z9OA 2LSOA 1R1TA 1X4DA 3PIPQ 4UV9A 3EX7B 2XS5A 3I54A 2JPCA 2GXGA 2CPDA 3CUNA 4R1HA 4UY8T 3CULA 1TQPA 2E1NA 1HW5A 1EH6A 1R7JA 1GVJA 1N54B 4M71A 4XSXF 2CQBA 2X1BA 2DNMA 3HHNB 1FNXH 2B0GA 1R22A 2A3JA 2MZJA 2KM8C 1BY9A 1KU2A 1W7PA 2CQPA 4I0BA 4IRIA 3RYPA 3JTHA 5AIPA 2P6TA 2NZ4A 5DD8A 3LA7A 2XHKA 1DDNA 2GHPA 3VOEA 5J8CA 3VEPA 3QU6A 3QAHA 2FMYA 4WXHA 3HRTA 3F21A 2M8HA 2KJCA 4MEYF 1AWCA 2EFOA 5CYVA 3J81Z 1XCBA 3NQOA 5GVQA 3FEYB 1IW7F 4LLLA 3IRWP 2HGCA 3J80Z 3MUVP 2N82B 2MH9A 3IRQA 1KQ9A 2Y48A 3VAJA 3V8JA 2R7FA 2M45A 3K0JA 1Z05A 1WF0A 3I53A 2OZUA 2ZFWA 1TTYA 2CQ2A 3MD3A 1RUOA 1P1TA 1FNNA 1FO1A 3T5XA 2M2BA 3NNAA 4JQFA 1WHYA 4M6XA 4AVPA 4E70A 1I1GA 3IWZA 1VC6A 2J0QD 3DPTA 3P9CA 4ZYDA 2STWA 4LB5A 2XAJA 4EM0B 2LA4A 2G7HA 3CTAA 5FLXK 1SMTA 4MEXF 2DHAA 1OMIA 3ABTA 1XGOA 3CMES 2MB0B 4U67Q 2M4MA 5D78A 3FHZA 3FMSA 1MDMB 2FC9A 3V7RA 1ZG5A 4Q48A 3TOBA 2V1XA 3L7WA 2STTA 1K79A 3R6SA 1R5GA 1FX7A 1V3FA 1KQ8A 2AYMA 2K4BA 4EM1A 4O6JA 2ZJPQ 5CVIA 3CPWR 1FY7A 3N4MA 5BPIA 5BJRA 3C3WA 3K2ZA 5CYJA 4P9UA 1X4GA 2XIGA 4U88A 4EJUA 2F2EA 2XASA 3FX3A 2N3LA 4MTDA 2DGSA 1F9NA 2GXBA 1ONVA 2DO0A 3ZZYA 4MQ9F 4R79A 1X0FA 4Q4ZF 2X1AA 3PFIA 2PMHA 1FYLA 4IHTA 1XSDA 1SMYF 3THTA 3GWZA 2CQ1A 1KA8A 3CCJS 2V1UA 1UHMA 1H2TZ 3QPTA 2YWKA 4R8HA 2VE9A 3Q2SC 4XLPF 1U5TA 3E6DA 2E44A 4U7DA 1FPQA 5ICGA 5ED4A 4Z2YA 3DP7A 6PAXA 3GFMA 3SFZA 5LGNA 1WTBA 4QU6A 2DHXA 2YU3A 2DI3A 3BJAA 1K73T 2MQMA 4RGRA 2HR3A 2RVJA 1VQ5S 2D1VA 3H2UB 3K1PA 3U1LA 3MQ0A 1BI2A 1RKJA 2CSOA 5HLGA 2EVZA 3RW6A 4FX4A 1MJBA 4PGHA 3VAKA 2QFJA 2RVCA 2GO9A 2VODA 4PCQA 5IT3A 2E5JA 1B7FA 1FT8A 3KE2A 2XS2A 1K8AT 2VBYA 1U5TC 5LSOA 1J59A 1XB4A 3VAIA 1GXPA 5ITHA 3UCUP 3UD3P 4HLYA 2E5GA 3P9KA 3UWTA 1LDJA 1D8KA 4L9TA 2RRBA 4QPTA 5AIQA 3GFIA 2CJKA 4EVIA 3T1BA 1BJAA 2HWVA 3UCZP 1IN4A 3P7NA 2Q0OA 2C6YA 2AS5F 2QYOA 4NHJA 4CQ1A 3R4KA 3VODA 4D0PA 2E5HA 1G3TA 1Z91A 1A7GE 2JWNA 4IOAQ 2PQ8A 1Y0UA 2DLLA 1H9TA 3L00A 5HS9A 1MGTA 4I0AA 1D3YA 2MKCA 4LG0A 5D5WB 3VAHA 3ML6A 1VBZA 2M8EA 1QM9A 3U1DA 3QPHA 1WHXA 4A5MA 2DNGA 4RGUA 3K69A 1FJCA 3GFJA 2HFHA 5FD6A 2J76E 3RPQA 1R5HA 4G7HF 4GYGA 5K5OA 5CVJA 1S29A 5HO4A 2BYVE 3RKWA 2W85A 1WELA 3CCMS 3AAFA 3Q9SA 4BHCA 1ON1A 5TRDA 2XRNA 4Y00A 5ERIA 3CF5Q 3BZ6A 2KKOA 1IRFA 3HSRA 3VAGA 3WODF 1MZBA 4LJMA 1NO8A 2O8XA 1F4KA 3V4GA 4UUVA 2PEHA 1U6BA 4IJAA 3GO5A 2ADBA 1R00A 4UVCA 1WG4A 1L3KA 2QQBA 3R0JA 2MY7A 2QBYA 1Q82T 2OU2A 3RI4A 1WF1A 2LQ5A 4EJTA 1ZZFA 2D9PA 5JFRA 3D2WA 2BEOA 2P4WA 3EDPA 1JHFA 3NS6A 1OO0B 4PGGA 4KYWA 1R1VA 3ELKA 5DM6Q 1I5ZA 5H6QA 1ZG1A 1U2WA 2PLYA 2OSQA 5TJJA 1ZLJA 2RDPA 4BQAA 3U1MA 2LKZA 1RI7A 4AIKA 3ZN1A 3E6BA 1XSXA 3BROA 2PI0A 2CPJA 2ERRA 4KIGA 1O3SA 1WWHA 5DCMA 1L0OC 5F1RA 1G3WA 1IAWA 4TU8A 3CXCR 3OW2R 4G94A 1FYKA 2EK1A 2IT0A 4S05A 1D8ZA 1JMTA 2RUGA 2DB1A 2DQRA 2XAFA 3MCZA 3KP7A 2NLWA 1W4MA 5CVUA 3VF0B 1O3RA 2NYXA 1UFWA 1O57A 4HV5A 4A6EA 2YTCA 1JGSA 1LEAA 3ERED 2CQ3A 2FBKA 1KU7A 1G2EA 1UB9A 2EA4A 2MBFA 4GO1A 1X4AA 4Z2XA 3FXQA 3F8BA 1EH7A 2HQNA 5H20A 5K1YA 5J6XA 1WEXA 3I59B 2B0LA 2MKJA 3E6CC 3KLOA 4L0YB 2M9KA 2M5WA 5HLIA 4YIIA 5FGMA 2E7WA 3CUOA 4HDUA 5E1ZB 2NAZA 4CICA 4WF2A 2QZ8A 4LMYA 4UVBA 2YX7A 5F64A 2VC1A 4AIJA 4MQVA 1PUEE 2ZMEA 2BGCA 3WGIA 3MUMP 3LA2A 2CWEA 3FMRA 5FD5A 1DHMA 3WE3A 3CCES 3JW4A 2HEOA 2VBXA 5IM0A 5LJ3Y 2QEXS 2HGLA 3LSTA 4OMYA 3FMQA 1TNSA 4ENNA 2RQCA 3BP8A 1DPRA 2V6CA 3CMAS 2XROA 2MZSA 1WG5A 2KT5A 1J0RA 3TO8A 3KZZA 4HOBA 1U2FA 4P96A 1B9NA 1IF1A 1EH8A 1XMAA 4NB5A 2DH9A 2L02A 2MZ1A 1YITS 5DM7Q 3JSPA 1XMKA 4OIQF 4EJOA 3JSOA 4OINF 2CPZA 2MLKA 1S7OA 1AUDA 5K5RA 4P9FA 2HYGD 1D9AA 2PE8A 1E17A 2BBYA 4U0YA 2KN4A 1TLHB 1CGPA 1D5VA 4WF9Q 1U3EM 3KP4A 4PZJA 2P6SA 1ZGAA 2E7XA 3M1EA 5JVGQ 3JTGA 3H3UA 5DETA 2D9OA 3SDEB 1ZN2A 1FOKA 2A3SA 3I5UA 3ISPA 4XBFA 1H2UX 2OIHA 2DNQA 4KMUX 2OA4A 4PDKA 2I2YA 1RZ4A 1WQ2A 1WSUA 2XSFA 5CA5A 4WWCA 2O3DA 3I64A 1U6FA 4TV7A 2X1FA 2A68F 2L4AA 5HL7Q 2L41A 1ZGJA 4ERDA 2K27A 3HYIA 2NRAC 3PIOQ 1S7AA 3P3DA 1URNA 4A6DA 4GXOA 2DPDA 4YIFA 1FBQA 3F6VA 2CQCA 4Q5SF 1IRGA 2VBWA 2CG4A 3F3XA 1CF7B 3W6JB 1YW8A 3ZMSA 2UXXA 3ECOA 4CYDA 3JAMK 1BN5A 3D5LA 4I98B 3BS9A 2L54A 2ZNYA 4BXUA 3WTYC 1H0MA 3ECHA 2Q2EA 2R7DA 2RC4A 1HKQA 4HX8A 2HZTA 5JHUA 2DIUA 4M74A 2KI2A 4PKDB 3EGNA 1YS7A 1OYIA 2O3FA 3Q5FA 5DDQC 5D5VB 2FPHX 1R23A 3J81K 1A04A 4HDVA 2IVMA 4IHSA 4YG2F 1FWZA 1BI1A 1BI3A 4ED5A 4N0BA 4EJWA 4HQMA 5IT9K 4A12A 2HQRA 1YW9A 2DNNA 2DISA 3BPVA 2HKXA 1P6RA 2LMIA 3O2PE 1IN5A 2HGMA 3IKVA 1DPUA 3QRFF 2OJ3A 4IF4A 5LRRA 3I71A 5CJ9A 3D0SA 2DK5A 3W6KB 1T39A 4LLNA 1VQNS 1LDKB 2IA0A 1E2XA 3V8KA 2OD5A 1PO6A 2H27A 1HW2A 1RNLA 4IUFA 1VC0A 4K2EA 3P49B 5BQTA 4YB1P 5L3GA 3BJOA 5FFXA 2OQGA 3TKYA 2XVCA 4ZH4F 1NU4A 1YTYA 2A6HF 3GLXA 3PQKA 4KUMA 3G96A 3HHGA 5ICFA 1O3QA 3CO6C 2OTLS 3UD4P 2RV8A 3KEOA 2DU9A 3B73A 1W2BR 1N52B 1ZH5A 1K78B 2KRBA 1O7LA 2IPQX 2XS7A 1SFUA 4W90B 1U5TB 3P5TL 2DTRA 5D4SA 4MGRA 1I27A 3MWMA 3V8LA 1G4DA 3L3CA 4HZFA 5F6FA 5GAHU 4EJVA 2KXNB 3LPYA 2FMLA 2F5DA 4F7ZA 3T8TA 2U2FA 2M1BA 2M87A 3M7GA 2KVIA 2A61A 5LEJA 3KP6A 1QZZA 3O6BB 3QU3A 1JE8A 1QVGR 4ZYGA 3MAJA 2Q79A 1B1BA 5DDRC 1QO0D 5E1XA 3Q9VA 2FXAA 2OBPA 1JXSA 2ZKZA 1OYYA 1SD5A 1WRJA 5D8KB 5DUIA 3RYRA 2DQLA 4QQBA 4OMZA 3NNHA 1NJIT 3NMRA 2MJNA 4IXAA 2QQAA 2DH7A 2RNJA 3GX4X 4F02A 2FU4A 2P5KA 1P4WA 1YS6A 2DT5A 2DK2A 1QVFR 2YH0A 1B4AA 2Z33A 4UHTA 1VQPS 1W5TA 4I7HA 3KETA 1FBSA 5D5UB 2UZKA 1WEZA 2FA5A 4CH0S 4M9ZA 3T0YA 1MKMA 4LIRA 2CPFA 4HBLA 4M5DB 2X4HA 2RU3A 2PMUA 3RKXA 2UXNA 3MI7X 4LGWA 3ZMDA 2FBHA 1OPIA 4G7OF 5FO5A 1WHVA 1R58A 1YFHA 2FNAA 2X0LA 1P27B 2MYFA 4Y17A 5DEQA 3VAMA 1YO5C 2MQNA 3LAPA 5HDNA 1TBXA 2ZNZA 3G6ES 2DNYA 3EGZA 5LSLA 2F9DA 2DO4A 2DNZA 2K8GA 1P4AA 3GW2A 2HKOA 1X3UA 2Y75A 1G3YA 1LJ9A 2XNRA 1SFEA 3DF8A 1VQ6S 3HRUA 2ELHA 1HKTA 3BJ6A 3BO3A 3EUHA 2CPXA 2EV5A 1VQ8S 1PP8F 4EGLA 5ILUA 5HDGA 3EYYA 1G3SA 2QLZA 5DDGA 2LKPA 4HA8A 4LK1F 4KDPA 2P5VA 3F6OA 3LA3A 1X4HA 2YX4A 3HI9A 2KFYA 4ESFA 1VQ4S 1K6OA 1T6SA 3CUQB 2FF4A 3C1DA 4WFNQ 5L3CA 2VN2A 2O6GE 2MA3A 4WCGA 2CQ4A 1VC5A 2XKPA 4OZ1A 2IP2A 3R61A 3GYHX 1XN9A 2LXIA 2FSWA 1M5KC 5ILSA 2CPEA 5LLQA 2H6CA 4RU2A 1FXLA 1D8JA 4G8XA 3WTXC 1ZZNA 1BBYA 2ESHA 3F72A 4H0EA 2F5EA 2ZCWA 2MGZB 5LHIA 2UWMA 1X5SA 4AWXB 3JAMZ 4IOCQ 2AXLA 5DYMA 1J75A 3NNCA 2K02A 4WFBQ 4TU9A 3BOQA 3VALA 4RGSA 1UHWA 1DUXC 2PFBA 2MLGA 2HTSA 1LB2A 1USSA 1YIJS 2KXFA 1TQIA 4YFXF 1N88A 2XB2D 2UP1A 2MXYA 2Z3YA 3K9TA 3WTTC 1KC8T 2E5IA 1T2KA 1TW3A 5FLXZ 3IWNC 4MTEA 1RUNA 5IQQA 2MQQA 4O3MA 5LHHA 3FZVA 3NS5A 2F5FA 2MSSA 1ZRCA 2M70A 2DNOA 1BOAA 1YI2S 4BHPA 1ULYA 2DPUA 1B6AA
chains in the Genus database with same CATH superfamily
1G7CB 2DR9A 3J80K 2JRSA 1S6PB 3SYTA 5J1RA 4J00A 4CGZA 5CLSA 4AUKA 4HEA9 1PP7U 1ZQ3P 3D6HB 5CXTA 2HOEA 1RIOH 1Y56A 2YPYA 3RAQA 4ZPTR 2FVPA 2QLJB 5LEKA 4K4TA 4GGGA 3KLNA 1TL3A 2ZJRQ 5FKOA 4Y15A 2HHTA 1S0MA 4BAYA 1EF4A 4X62J 3S3MA 3TYTA 4ZVGA 4ZK7M 4X64J 4RB1A 2DNLA 2E7VA 2LECA 3B02A 1HYSB 4ZCKA 4A3GJ 1S9GB 4URGA 4H4MA 4PRFA 2DFIA 1O0PA 4U6PA 4X4NA 4DZDA 4I02A 1XCVA 3KJFB 1MD0A 4DV4F 1WHWA 1OCZH 3OVBA 3U02A 2AJ4A 5GPAA 1VQYA 3ASOH 2AEJA 4L73A 1JLCA 2XHCA 3M8YA 4RW7A 3VHQA 5LJ5Y 2N8GA 1MSEC 4LSLA 2IBDA 3VVTA 2C42A 3N6MA 4D5FA 2J5PA 3PFOA 5LXRA 3I58A 3H59A 1B72B 3R9LA 3CO7C 4KHMA 2XGXA 2RKHA 3GIIA 1VF9A 3QIPB 1N32F 4EK2A 3E5QA 3BDPA 1PDNC 2HHSA 2KT3A 1L3TA 4O3NA 2K85A 3SSRA 4OJGA 4DX7A 4Z6YA 3QT7A 1RHKB 2HNYA 1Q95G 5DQHA 2PC6A 1VMBA 3VZHA 1FXRA 1WJEA 5JMNA 4C9DA 4P2XA 2R5ZA 3J7YU 1S0NA 3KJVB 3OL3A 1I1SA 2F4FA 5CHCB 2DA6A 1P7JA 4X1EA 5M3MJ 3QRPA 1STZA 1QD1A 2O61A 4W92B 2MW8A 5JHFA 4F4YA 2OPSA 3E2EA 4ER8A 1NAQA 4L6V3 4HPQA 3M8ZA 5KFGA 3G71S 3IL2A 4BCAA 2IRUA 2Y1LB 3R27A 2AT1B 5EUHA 4HF1A 1SKUB 3F8CA 4WJBA 2PEXA 1UMJA 1JLQA 3MHYA 4LF9J 3MM6A 2DGWA 5E3OA 1EA3A 1U0HB 2ECBA 1RWNB 2W4SA 3GXOA 2UUCF 4B17A 3O3LA 3HVAA 2AZ3A 4DR7J 2FYXA 2RGVA 2KZGA 2VT2A 5GADU 2H8WA 1RT3B 2V7FA 2ZBQA 4B48A 1J27A 2P0WA 3M8FA 5HS8A 1YX5A 3LAJA 2Z99A 3ET6A 5IC6B 4DZJA 3LL7A 4DU8A 4OU0A 3JRIA 3FSYA 3TDZC 1SVMA 3K4JA 2QFIA 3RW7A 4J9QA 3HXLA 4YY3J 5IT9U 4P52A 4QWQA 4BS2A 5SZTA 1SUQB 5F08A 5EEHA 1WDDA 4M9XA 4D7NA 3R2DJ 4MKBA 2RRNA 1W5SA 1Z3YA 2WAQN 4G6TB 2ZH6A 1WWXA 3H20A 2HWTA 2R93J 3OL6A 3GLLA 2ZD1A 2IW5A 3OTDA 2H51B 1APLC 1AXQA 1LW2A 1S1TA 1S1VB 2NPIA 2F65A 2DITA 4V2FA 3TO6A 1IQZA 2UZAA 3GZ7A 2NXNA 4DR1J 3FGVA 5GMKa 5IV4A 1S76D 1MLAA 1UFKA 1FOXA 3P45B 3SXYA 4DF8A 3V7CA 1KLNA 1MMLA 2XWXA 3PFYA 1J2XA 2NUHA 3DKWA 2VIHA 4FYYB 4ANCA 3M1VB 1S9GA 1UVLA 4ZZDA 1AKHB 1IBLJ 1NH3A 2QE5A 2G4BA 2X48A 4V2GA 4D1QA 1F2GA 1XGMA 2NVYJ 2Z2ZA 2VJ5A 3G86A 2A5WA 2HFOA 1R4NB 4E7JA 4NLVA 2I1RA 2L5QA 2WBRA 4BDZA 3BN7A 3HHHA 3PACA 1AOYA 1N75A 4O5VA 4O4GB 4ID5B 4NI2A 3JTOA 4NCBA 4H4KA 4LF5J 3B78A 1HHQA 1FC3A 1RT5A 3EUNA 2QWWA 4UW2A 4LFCF 1U49A 2D5VA 3IS9B 3SYZA 4LK0F 3BBCA 3PCOB 4M5DA 2ZH2A 5A6WA 2PMZD 1Q1VA 3HOUJ 5CVRA 1T0FA 4B09A 3F22A 1SKSA 3ET6B 3LFKA 2BQRA 1KOHA 4RB3C 2WONA 1WACA 2KHDA 1MW7A 2MC3A 5FROA 2LEPA 2UUCJ 4AL7A 2EFQA 4B47A 3BO4A 4C4WA 3RSNA 3GPAA 2ZJ2A 4LF7J 2WAEA 1FRXA 2EK6A 3MM6B 2Z16A 3CGIA 5J2MB 1JJ4A 1WDTA 5C3EJ 4I01A 4BYYA 2FD5A 1WOPA 4N7TA 1TK5A 3FM5A 1UG2A 4U87A 3SI8A 2JFDA 1ODDA 3KPHA 1WD6A 3I55I 2LMDA 3GV8B 2HNZB 3ZZPA 2VDHA 2QKMB 2FJWA 3SSSA 2YKPA 4IPAA 2K7LA 1J7KA 3HKZN 4YFKF 4IRGA 3W1YC 1SJ4P 3P4UB 3A8KA 1Y5LB 3VDXA 4BHBA 2DXDA 3E3VA 2A69F 2FJXA 4NXMJ 3EXYA 5HK4A 1XDUA 5CQGA 3FXOA 4WIIA 2XF6A 2PJPA 3JSBA 1H9GA 3IBCB 1WI6A 1NPPA 2X1GA 1AKHA 2HYFA 2CUEA 1WUUA 2XAUA 4PAAA 5AE3A 1IBMJ 2IFXA 4C0BA 5J8FA 2Y1JA 5C4XJ 1V4RA 4BBSJ 2XLIA 1V5VA 4M73A 1DU6A 4RUHA 4WP8A 1EHWA 1CQMA 3WX8A 4I2OA 7FD1A 1U24A 2UUAJ 2DR7A 3S01A 1IGNA 2KJBA 2AGPA 4Q8EA 3HK2A 4B3AA 4QZVB 2HXOA 2DHHA 3HIFA 2DNPA 1W25A 2XUBA 3Q83A 5CYMA 4KPYA 1PUFA 4ZVQB 1VQSA 2FNPA 3MZYA 3SZTA 3UN5A 2CXEA 3B4DA 3ZMUA 2NNNA 4LJZF 1FRLA 1RTIB 3K0LA 3MM5A 4ZA1A 2OMOA 3D0GE 3A0BC 3GILA 2P7CB 2FY8A 1MWYA 1SH0A 3DBHB 4KT0C 2YNFB 2IGNA 1LDDA 3MD1A 3CMQA 2QC3A 4ED4A 4FBTA 1H89C 2QN6B 1RGVA 4C8OA 2W24A 3L2WA 1HA1A 2MEWA 1IM6A 3BB5A 3ZQ7A 4PQUB 3LGNA 4A2UA 4EMSA 3F23A 3K8WA 2Z58B 2X9DA 2HNZA 2OUMA 3W65A 2G2ZA 1ULRA 1ZA1B 4N76A 5BXIA 3WU0A 1QTNB 3QP6A 3UPFA 2DH8A 3PXGa 2DAOA 1WFXA 2JL9A 4OI2A 3LFUA 3OYJA 3CCVI 4EV0A 1S99A 2CPHA 2V8GA 1UAAA 1RTDA 4NPOA 3HGYA 3KJNB 3T1YJ 4ED0A 1KYWA 2K9LA 5CYQA 4I6AA 2E35A 2ALYB 4KAIA 4IKAA 2G9WA 3NGUA 3G1LA 2C1EB 1XS9A 2BE5F 2H94A 2MQPA 1JKQC 2QEXI 4F7VA 2CQGA 3GTKJ 4ENMA 2FRHA 2K9MA 4ANDA 1WC3A 1V6HA 3CJQA 4KPCA 4DL2A 1N6QB 3I55S 4YMEA 2IGOA 2KP6A 3U1KA 1YWXA 1IN8A 3JTPA 1WJBA 3JSMB 5ETTA 1Q81T 3RBDA 4ILRA 3HBLA 3PO3J 2W7PA 5GADJ 1FFGB 4PG8A 5KOXA 2CRLA 3DDIA 1NKCA 1ZRDA 4M6VA 3IWLA 3GUDA 2ACJA 1FFWB 4DUYJ 1X0PA 2R3SA 2X6YA 3DMJB 3K58A 2MKIA 3BO2A 3HZEA 2J5AA 3VSLA 4OLOA 1S4FA 2LREA 3GFLA 4YUDA 1WCMJ 3ENQA 1N5SA 1A5JA 4B44A 2L9DA 1BM9A 2J7KA 2PG4A 3DRPA 2NXUA 2J6TA 1MBKA 3S6EA 2C2NA 2CA9A 3G82B 1MSWD 2BXYA 5GTIC 4MIWA 5B0CA 3FQLA 3QIDA 3UO0A 5LGUA 1XGNA 3PUFA 1UZDA 1KTVA 2DW4A 1RLDA 1JLEB 4OZNA 2CQNA 3VV2B 2IM2A 6AT1B 2DOAA 4FASD 4O3RA 2ISZA 2KISA 2BA9A 3KEQA 1QE1A 3HXMA 1LWFB 3MURP 4M95A 1YOVB 2BKNA 3NWSA 5I3UB 3MZHA 3SQNA 5F0HA 5BMZA 1TU0B 3VYSB 5E8GA 1Q78A 2BOLA 3OSGA 5HSPA 2FOKA 1ON2A 5A8RA 2PN6A 4FCYA 1U8RA 3PQJA 3RZDJ 4J9LA 3KP5A 1BQXA 3I4PA 3DM2B 3ZTSA 2UUBJ 2EB7A 1NMEB 3THPA 4CO3A 1H3DA 2DBBA 3WTSC 3GU0A 1IUYA 2Z2LA 3P96A 4GC6A 3S1QJ 5FD1A 2G0CA 2OPPB 5KCMA 1IN7A 3EVMA 3L09A 4ZZLA 4DW6A 4WK8F 4KYZA 5CKTA 4QPQA 3OY9A 2WONB 2X1DA 3LOUA 5ICCA 3IGNA 2XNQA 3FBCA 1X1BA 2WOMB 2VFSA 2VUMJ 2JPBA 3OYHA 1YJRA 3GIJA 4BNCA 3ZTPA 1L3LA 5E7OB 4ASNA 1F6TA 2E9RX 1Y3KA 4HF2A 3BN4A 2QSFA 4UV8A 3AXMA 2IDEA 4DL4A 2M4GA 4NEYA 4J9RA 2EZKA 1YBTA 3OPKA 2QA4S 4OI4A 2W57A 3ZQFA 1TT5B 1F3FA 3FBNB 2M3DA 4P6QA 2CH0A 4G6DA 3Q2TC 2WAFA 2E34A 1NPKA 2W25A 2NPFA 4ENJA 2EBIA 5DUKA 2M52A 3QJLA 4FPIA 1SIZA 2YU9J 1F60B 3VYTB 2EV0A 4RJVA 4FX0A 3CD6S 1C0TB 3L9FA 3ZQGA 1UCRA 3QYBA 2XPVA 2R5ZB 4HSTA 2BW2A 3S3NA 2H3EB 2J5OA 3MVPA 4BQQA 3M9MB 3LALA 1LE8B 2ZH8A 3TAMB 1S1VA 1UEVA 4RL1A 4Y28C 4Q0BB 2ZFHA 2EFNA 4CCHA 5THWA 1DGRM 2C3UA 2NXJA 3ZMTA 2GJIA 1A6LA 4PJNA 1FF2A 4X4OA 3MR6A 3GR1A 4JV0A 4DV5J 1U1OA 3GCXP 3DLEB 3TP3A 4JYKA 3KHRA 1JLBA 1FKPB 4I67A 3HSEA 5DD4A 5D8LB 3M32B 2MPUA 4AM3A 2OPQA 2LYVA 1YJUA 4RNMA 1UW4A 1NCLA 1N48A 2I10A 2LDYA 4PWUA 2A18A 2O0YA 3QGHA 3MKZA 1C0TA 4MKAA 2YPRA 4KH0B 5D0GA 5DG7A 2DA4A 5CZVA 3WG9A 2PI4A 2KIMA 1HQCA 4E7LA 4DUTA 3KHHA 4OYWA 3D6MB 1MMAA 3DLKB 4MYUA 2LDUA 3LANA 3JS9A 2DVIA 3MFKA 1F9HA 3DRXA 5KFSA 3GG1A 2QLFB 2XO6A 3MCNA 1HI8A 3CMAI 5FB2A 1U25A 3IRRA 4XRSA 4M5LA 3E6MA 1VYAA 3BTIA 3RRKA 2ID3A 2WC2A 1HW9A 2KJWA 3FM3A 4CO5A 2HS5A 3TQNA 2VJ4A 4C2UA 3QGGA 2CUYA 2E5LJ 4JV5F 2OEMA 3WTWC 4LF5F 1DQUA 1E6YA 5J47A 1PAUB 4XNFA 5BS6A 3NEUA 1ZAXA 1RCOB 3CJNA 1H38A 3I56S 1V5IB 2HHVA 2VE8A 1D0ZA 2VPRA 3J7Z5 4EM2A 4K2JA 4UUWA 1WKLA 2L4MA 4YQWA 4PWDA 3GTJJ 4EMDA 1JHHA 4ZN3A 1F1BB 3W5XA 2Z9OA 2LSOA 5HMWA 4ZCIA 2XWYA 3CD5A 4J9OA 2XHWA 4X66F 1NK8A 4XN3A 1G2HA 2Y9HA 2VKHA 2KRHA 2JPCA 3IGVA 2B7EA 4R1HA 3PG9A 4HL9A 3MEGA 3CULA 2DEIA 3TJ8A 1TQPA 4QIWN 1EH6A 3DCFA 4RW7B 1HARA 3TZWA 4M71A 2GOXB 2EBGA 1X1AA 2CMPA 2CQBA 2VKRA 5C42B 4CO1A 3K5LA 2QYCA 1S1UB 3P5BP 1QZEA 3KLGA 4MFBA 1EKRA 4CYUB 3W5YA 2WV1A 2GIFA 4DR2F 2HMIA 2WSEC 2KM8C 4CI0B 2GMJA 2ZH5A 3V6KA 4ED2A 3CJTB 3MCSA 1KU2A 3FK4A 1UVJA 2L9VA 2AJ2A 3RYPA 2L0KA 3JTHA 2F40A 3ZGKA 3AFGA 2C3PA 6FD1A 1JLCB 1T9VA 2XHKA 3OT9A 5DO2A 2GHPA 3VOEA 2C2EA 5HMXA 2ZOFA 4WXHA 4GVBB 4B3SF 3HRTA 2COBA 1N5VA 2RMLA 3FUYA 4MEYF 3VGUA 1AWCA 2EFOA 3ZC4A 4FS2A 2VQEF 3QOEA 4CDIA 3J80Z 1Y4ZB 4OFZA 4USHA 1JT0A 4ZDLA 1MBJA 1KQ9A 4IO1A 4A3CJ 5MAOA 4DDFA 1WF0A 3I53A 1HIYA 2OZUA 3MM7B 3TZYA 1Z2LA 2YWGA 5HMYA 1EJ9A 2M2BA 3NNAA 2W7AA 5J2NA 1IDZA 3M4OJ 3DN9A 2NVTJ 4E70A 4JI6F 3DPTA 1RYSA 2XAJA 3ZQLA 1BGXT 2HIQA 2VASA 4QYZJ 1UA0A 3CCRI 1SMTA 3PTWA 4BHQA 2DHAA 4NX9A 3HKZA 3HB9A 3QQAA 4JV5J 2CQ7A 3OWTA 1T8EA 2B9SA 1JLQB 2M4MA 3TX8A 4FF4A 1ZG5A 2ELJA 3TOBA 3G2XA 3K70C 2W01A 4OHXA 3KG1A 3EZOA 3R6SA 2PD1A 1FX7A 1RBAA 2AYMA 3DPUA 5F41A 4JX6A 5J1NA 3LSGA 2ZH3A 1FY7A 5BPIA 2KHMA 2XIGA 4NLWA 2BZTA 2F2EA 3FX3A 4AXIA 1M1EB 2N3LA 4MTDA 4NRTA 4X4SA 1B0TA 5M2RA 1WI3A 3ESWB 4R79A 4JI7J 2XPWA 2YQ3A 3TA2A 2XF7A 4NNJA 3PFIA 4IHTA 3DOKA 5KFTA 3THTA 3H4DA 3GTLJ 2CQ1A 4OHZA 3W2VB 4F0HA 4DGWB 4DL7A 4ENOA 1MROA 2YWKA 1U5TA 3QT6A 4NOHA 5ICGA 4P1WA 3QT5A 3ZXSA 2XG8A 4Z2YA 3DP7A 2HVDA 6PAXA 3GFMA 2XMAA 3SFZA 4QU6A 2YU3A 2DI3A 3DLGB 4OZLA 4BXFA 4QR1A 4BS9A 2D1VA 3H2UB 1VQOI 4C11B 3U1LA 2CSOA 1MBHA 2L7ZA 2X6WA 4LF4J 2ACYA 4OJ3A 1IBMF 1FCAA 2BJ9A 4KY3A 5KT7A 1IG7A 3Q8VA 1U7LA 2E5JA 4A8KA 2HDWA 1QHGA 2XS2A 4DUYF 5LOQA 2HQDA 1HDPA 2VBYA 4QSHA 5M3FJ 4G65A 5LSOA 1J59A 3VAIA 5ITHA 3UCUP 2VF3A 3UD3P 3D1NI 2E5GA 1LDJA 4B1RA 4QPTA 1RLCL 2CJKA 2HMIB 4XPCA 2HWVA 4CCMA 2NSBA 5JLWA 2C6YA 2FHJD 1SFKA 2HVIA 2QL9B 1YZ7A 3QRQA 4D0PA 5KG0A 3RJMB 1G3TA 1Z91A 2PQ8A 2AZ1A 4MK9A 1P7IA 3O44A 3VTIA 2E5NA 4QIWD 2N7YA 2PSZA 3VAHA 2HWHA 1SL1A 1VBZA 2KYZA 4Y34A 3S15J 3HHDA 2WBMA 2DNGA 5J4VA 3GJRB 1BJZA 4ED7A 1QRYA 4G7HF 4J91A 4WXOA 1K61A 2AEFA 1DQAA 1MU2B 2W85A 1JLAB 1Q7LB 4Y00A 4FKXA 3FJ2A 2EZLA 1IRFA 3KG4A 5LT5A 3W8GA 2DA1A 4UUVA 2PEHA 4B3TJ 3B6AA 1K6YA 2FVSA 1HBUB 4UVCA 4DJBA 2W9AA 4ED8A 4LIUA 1WF1A 2D9PA 1ZZFA 3BGOP 3CIMA 3TMOA 4ANJA 4RW4B 1Y3JA 2V4QA 1S1WA 1P8GA 3R2CJ 3EDPA 3RU0A 3NS6A 3M1CA 4PGGA 4KYWA 5CD4A 3BZCA 4BACA 1ZG1A 1SQGA 2ABYA 4MJKA 2PLYA 5TJJA 4EATA 4OI6A 3U1MA 3W62A 3GJQB 1HBOA 3H9QA 3G6YA 2RDDA 3E6BA 2XO7A 3R7BB 1VDHA 1YRUA 2OTJI 3BTLA 2ERRA 4KIGA 1WWHA 2KKHA 4MYTA 4Y2IA 1TWCJ 1TK8A 1G3WA 3DGPB 1ZM3A 3CXCR 1EKEA 3DU5A 5K8NA 2F7VA 1ZM9A 2E29A 3ENWA 5A8RB 1NH7A 2DB1A 2IVYA 3MCZA 1N77A 1IV8A 1W4MA 5CVUA 4CLYA 2L48A 1UFWA 3QWLA 1O57A 4HV5A 4YHHF 1TAUA 2H1LA 2ZDOA 4DL6A 2CQ3A 4IDKA 2FBKA 3FXKA 4O3QA 4HG2A 2W2QP 3I87A 2EA4A 4BLGA 5K14A 4O3OA 1L3VA 5GAHI 3PNIA 2AGQA 3V6DB 4JI0F 3BKTA 4PYAA 2HQNA 2UXCJ 2R7WA 2CG8A 5K1YA 5J6XA 3IAM9 5EYRA 2V69A 3MR2A 5CYMB 2MKJA 3E6CC 3HKZD 3VSKA 4EZ6A 5AE2A 2HI3A 2A6OA 5E1ZB 1WJCA 1PIEA 2YX7A 1PUEE 3TUPA 1U2CA 2BGCA 3WGIA 1I3OB 4MH8A 3LAKA 4OYMA 1VCTA 2PT0A 3FMRA 4EI2A 3TP0A 5LJ3Y 1YRXA 3CF2A 1IJFB 1HQUA 1W36C 1OSDA 2QEXS 1DAXA 2JWTA 2YNGA 3HHKA 1RACB 2HQCA 4A46A 3BP8A 2LH9A 2NYHA 3QJPA 2V6CA 2UV8G 2KT5A 3TO8A 4HTJA 3KZZA 1IRZA 4KJIA 1VIOA 1ACIA 1U2RA 1TWFJ 4F04B 2AJ0A 4XLEA 1HYSA 1U0HA 5DM7Q 3JSPA 3SSQA 1XMKA 4C9YA 4OIQF 1T02A 1TL4A 2CPZA 1Y8RB 4DPWA 1S1WB 2QYGA 1AUDA 4P9FA 3HCXA 3PIPF 3CMMA 3PRDA 2ZMEC 1RWOB 1TLHB 4R0JA 4J37A 4A8OA 1TKXB 4XLFA 2JRMA 4IH5A 1S9EA 2PA8D 3V81A 4YIRX 3EMTA 4MTPA 5KT3A 4Y3CA 3H0GJ 1PC5A 3A3OB 3H3UA 4FF3A 4LQ9A 5F8HA 2A3SA 4O4RA 3G6EI 4KMUX 2OPSB 2I2YA 4G6VB 1RZ4A 1WQ2A 1R6YA 2XSFA 3CP8A 4WWCA 4NLRA 2W2NP 4TV7A 2F8HA 2L4AA 2L41A 1LWEB 1H72C 3KOAA 2V2QA 2NRAC 3TJAA 3PIOQ 5HJYA 1ETWA 1O6XA 1SAUA 1URNA 2Y30A 1FTCA 4K4ZA 1U8SA 4GXOA 3GQCA 4XKVA 2AMCB 1N36J 2XF5A 3NRBA 4ZDOA 3MAAB 1X3ZB 2RUSA 3IFEA 3MM9B 1MMGA 1CF7B 3PYFA 5I42A 1RKTA 2LK2A 2VQGA 2VJIA 4DV4J 3H5UA 1DTQB 3AG3H 3JAMK 2BE2A 3BS9A 4IZZA 1B4SA 4XO0A 2Q1LA 1XWLA 2V50A 3M8QA 3OYAA 1HNZF 2FLPA 2LQ8A 4USIA 1WHUA 2BQUA 2KI2A 2BM1A 1YS7A 5T41A 3OSFA 2XYPB 2DPJA 2OGUA 1UL3A 1R71A 1KLMA 4DSKA 1I94J 4IHSA 4FQGA 3T1HF 1LXNA 1BI3A 4K4SA 3ILIA 1KVKA 4N0BA 3ICLA 1NJYA 1PUFB 5IT9K 1XR7A 4A12A 3CDUA 1X9WA 1YW9A 2DNNA 3POTA 2HKXA 1WSVA 1TR0A 2R2TA 4QPOA 1YE9A 1IN5A 1DPUA 2B51A 4U95A 2JA2A 2ACMA 2CUJA 4C8ZA 2DK5A 1EP4B 2XZDB 4LLNA 1VQNS 1C1BB 2HFZA 1UJ5A 3CJ5A 1LDKB 4DN0A 3V8KA 2H27A 2RILA 3T3FA 5D4LA 4PXBA 3TW7A 3QYFA 4XICA 2QJ3A 1TWGJ 5L3GA 3GTOJ 1D8YA 1N5YB 4XORA 4MFEA 5JUMA 1V3ZA 4ZCMA 1ACMB 2FJEB 3RG6A 3MFHA 3M7VA 2DMUA 3G96A 1AB8A 2RV8A 3B6CA 4DR4F 2W9CB 3Q8UA 1N52B 4WXWA 1K78B 1G6BA 4Y2KA 1SFUA 3OYCA 1KR4A 3P5TL 1NK2P 3V8LA 2K06A 8RUCA 1Z4UA 5F6FA 4DPOA 2Z2MA 1T0TV 4C3IJ 3PKMA 3L7UA 3T8TA 4P9SA 2M1BA 2M87A 1PAEX 2DR6A 1JXVA 4OX7A 3Q8SB 3BT9A 5LL6d 1QZZA 3O6BB 4BC9A 3MAJA 2V2KA 3MM9A 4EWTA 5IY5H 4YDXA 1B1BA 1QO0D 5E1XA 5J2NB 2FXAA 2OBPA 1RESA 4AUXA 5DUIA 3CZ6A 3RYRA 2V8DA 2ZH1A 4IXAA 3DLJA 1CULB 2NUUG 3GX4X 4F02A 2DDBA 2FHMA 4CCKA 2PMZN 5KFZA 3IH4A 1IJEB 3MOZA 2A6MA 3CD6I 2Z33A 5KG5A 4UHTA 3N01A 3WIVA 3POTB 3W8PA 3PSIA 2R7OA 1YRTA 3CJKB 1XERA 4G12A 2CPFA 3FBIB 3ZZTA 2FVQA 3Q89A 3ILLA 4U8VA 2PMUA 3IAS2 4LGWA 1G59A 5DG8A 1OPIA 2E1PA 1O51A 4G7OF 3ITHB 1JTYA 5EDNA 1R58A 1YFHA 2FNAA 1GFWB 2NS8A 1H98A 2MYFA 3E7LA 3NXZA 5DEQA 2G2OA 3FMBA 1XNRF 2OPRB 2CKWA 4F8RA 1LUJB 1Z7LA 1QA6A 3OJSA 2RE1A 3EGZA 1SBRA 3DOMB 5C25B 1BR4A 3R5JB 2VL1A 2UUBF 3T5JA 3L2UA 5D0RA 3UNYA 2HKOA 4DCOB 2RD5C 1SFEA 3HRUA 3DRYA 2RJZA 3EUHA 2CPXA 2H48B 2EV5A 1PP8F 5KFJA 2O1PA 2YKNA 2QLZA 2Y0SN 3PJ9A 3L7PA 4LK1F 4AD6A 2YNHB 1Y9OA 2HS0A 5K7HA 3O5TB 1YHQI 2DPIA 1KSPA 4YS2A 4A8QA 3N6NA 4H4OA 1NDLA 4WFNQ 4L74A 3DBLB 2MLXA 3D28A 3I4MJ 5HP1A 1H74A 3R61A 1M5KC 5E79C 2FSWA 2LXIA 5ILSA 2JEJA 3VGVA 2A10A 2MKYA 4YEJA 4XKBA 4I69A 2LFBA 1GH8A 1BBYA 2F5EA 3K4MA 3U7JA 5LHIA 2MGZB 4LFAJ 4DR6F 3OQ2A 3A4TA 4PXCA 1PYSB 4WFBQ 1R9TJ 4TY9A 2B5JB 4E98A 4NE9C 2MLGA 2HTSA 3OMYA 4GFBA 1YIJS 2KXFA 1N88A 1RC9A 2BVLA 4O23A 3ILOA 2Z3YA 1K44A 5KT2A 5KAFC 2HIYA 3OUYA 1T2KA 1D0YA 1ETXA 1T94A 3CJRA 1C1CB 4MTEA 4OYOA 4JV2A 5IQQA 2OAUA 2HPIA 1APSA 4G1IA 1LK7A 2EW9A 2F5FA 2F4VF 1WH5A 2EIJH 2DNOA 2M70A 3E01A 5KFCA 1JLGA 1JI8A 3C6TA 1YI2S 4BHPA 1ULYA 1NUEA 1LWFA 2DPUA 1W26A 4O0IA 1B6AA 4CZZA 2M2EA 4HNTA 3RAMA 1RABB 5JI6A 3K7AJ 4WTYA 1UFMA 1ZELA 3AG1H 4UT4A 2OZ6A 2HPUA 4C8LA 3C18A 2IC3A 5B08A 3PW5A 3TVYA 3FF5A 2LEBA 1RT7B 1NK5A 1BW5A 1F5CA 2IJFA 3PR4A 4A0YA 4BE2A 1ETYA 4H4OB 3OXFA 2AF6A 3BG7A 2CVIA 1M0SA 1B7YB 1S6OA 3MTKA 3G1OA 2UVVA 2JA8J 5B0AA 1FZPB 3BWGA 5KNLA 2WRMA 5L46A 2I5JA 2HVEA 2IAIA 4MK8A 2FBIA 2MLZA 3FXUA 4DV6F 3UVJA 2CQQA 3LQRA 1OQ6A 4NRUA 3AG2H 3TUZC 4JBAA 4KN4X 1NHKL 1I6XA 5E18F 2ZXHA 3NCRA 1REVA 1OCRH 5EEGA 1SXLA 4LB6B 1EJ7L 4LR8A 5IS2A 2EQRA 5E2QA 4TLQA 1NRKA 4ZPVR 1X4CA 2Z1DA 3F0NA 2VU5A 5L8RC 1YKWA 1N8RT 3S1TA 2B8PA 3GJTB 1HNWF 4RUCA 3CCLS 4DR3F 4WE1B 2LXUA 1RAOA 2QVOA 5A8KB 2HNDA 2DYAA 2BOPA 4OMFG 1MG7A 5JVHQ 3Q8QB 2A6EF 2HTJA 2R9LA 2R2SA 3NRVA 3DLLQ 1HNIB 2B9EA 3IC7A 2Z2YB 1VQPI 3SDEA 2MZRA 3GZ6A 3GVAA 2IC3B 3BSCA 4AIDA 5CYQB 2FIUA 1QDUB 1MBFA 1LWCA 5H2FC 3MCMA 3ABUA 1TKTB 1ETKA 2EZHA 3RJPA 3C2GA 4YHHJ 1X4EA 1N4LA 3M8QB 2OD4A 1U1NA 1S6UA 3K70D 2KXHA 3SZPA 4HSRA 3J81U 4OX6A 4RB2C 4B8XA 2ZZTA 3LP0A 4ECVA 5LXYA 2J8AA 1BI0A 3ZFVA 2C2ZB 2IBKA 2J0SD 1N25A 5K8MA 1AHDP 1MDMA 3HSFA 4ZMMA 2J0WA 2IA1A 2H4YB 3M2UB 2Y0MA 1YJ9S 2VQFJ 2BM0A 5H9FK 3P6YC 4D7MA 4QTRA 2EPIA 5I3QA 2V9VA 4QIGA 3UD5A 1JUSA 3J7ZT 2V94A 4NI2B 2QLXA 1UVKA 5DZ6A 4ZVRB 4RPFA 4LIWA 4N4OB 5B5EC 2DDAA 2FJBB 3HG9A 3QYYA 1RETA 3MTJA 5LMNJ 2V6EA 1YJWS 4WXCA 4B9LA 2CJAA 4ZKAA 3MPVA 4DQ2A 3K89A 4CH1A 1NK7A 1YQAA 2POKA 2FC8A 3MUTP 3DRPB 4K5RA 5BPDA 1IQTA 4LSLB 5IZHA 2IYGA 1JB0C 4L76A 2GC8A 3S1RJ 3N28A 1U1LA 2XZTB 5DDPC 2YSRA 3AT1B 5FJ8J 1CJKA 4EQQA 3BREA 1TKDA 1I94F 4KB7A 3D6TB 2AHQA 1FYMA 4OIPF 4AU7A 1QAJA 4NZ6A 4H4MB 2IRFG 3HHEA 4IQXA 4B3OA 2XV4S 1HNXF 1LWXA 5HLFA 3IO1A 1FP1D 3EVWA 3C7JA 3RZOJ 3JR9A 3TR5A 2VFUA 1D09B 2WW4A 3KMQA 3OYFA 2VG6B 2L3DA 5HVGA 2DA2A 3QBCA 1VBXA 1IBKJ 3DKYA 1KGSA 4ZJLA 5A0YB 2BW3A 3CNQP 3H9JA 1R6RA 2GNKA 3HTUA 3NGTA 1IR1A 3R6LB 1H6KX 4IR1A 2XMUA 5HS7A 4A8XA 4D9JA 5HJXA 3HSJA 4NXNJ 1JJHA 3C14B 5KT5A 1CS4A 3T19A 2EWNA 2IAJB 2EZIA 1VS3A 3D3BJ 3SMZA 3PV8A 4QWDA 1FTTA 1C4CA 4GKKF 3G3ZA 2BRLA 3M07A 2F9JA 2EA2A 1X4FA 1TL8A 1IM4A 2Q3PA 1ZARA 4C97A 1A35A 2WB4A 1T0FC 2A0FB 3BR2A 3MAQA 1WF2A 4RLEA 4E6KG 1HBOB 3PSFA 2ADUA 3K5NA 2D7SA 1SANA 1RTHB 4DX8H 2YQ1A 1AFIA 4M6YA 2Q66A 2N7CA 3TP2A 3PRBA 7FDRA 3MMCB 3A2KA 3M6VA 1A6QA 2YNFA 1XGSA 3CDBA 2BW3B 1RT6B 3PO5A 1VQKS 1RTIA 2M88A 3MM5B 2HK3A 4A3MJ 1GHCA 4IG0A 2OTLI 2CQKA 1M5OC 4FTHA 4QR0A 3J80U 5E3NA 3LO3A 5BR8F 2VA2A 2HVHA 5IFMA 4ZJOA 2KDZA 2F48A 4MMOA 3OV8A 4HX4A 1GDTA 4TY8B 3ULHA 1F1ZA 2GVDB 1O7FA 1EIYB 4PK4A 4PR6A 2L2OA 4FXWA 2DA7A 2RT3A 3V2UC 1K0VA 4CSWA 3CUQA 4M9SA 3BCAA 4OOIA 3PJRA 2K3FA 1BQNB 5L9NA 2B4UA 4I09A 3TOAA 1H73A 2VV5A 3IUOA 3TO7A 3MEKA 1XIQA 3AOCA 3R1LA 3T9NA 3K1MA 2XPUA 4MAKA 4UQTA 4Z7YA 1WC5A 2FDNA 3OR2A 3L1PA 2FHKA 2BJDA 1UJ4A 3HVTA 1ZRFA 2VBZA 4M72A 1V3SA 4QLCU 1ZTRA 2EFWA 3ZTQA 2FY1A 4BWJA 1N56A 4G1QA 1DLOA 5FKKA 1R4MB 2PA3A 2HQAA 2MQLA 3CEDA 1YBUA 1X3WB 3OR1C 3ZQQA 1X5OA 4DXLA 1VR6A 4LFUA 2GWRA 5IPAA 2GHWA 2KB2A 4KIFA 1YJTA 1HQ2A 3HRMA 1S10A 1AUSL 5KG7A 4DBQA 1VQ5I 1FD2A 1QY7A 3PEHA 1KFDA 4XMYA 3HPHA 4WFYA 3DRRB 3MN2A 3KDOA 3PKYA 4L9JA 2HSEB 3E01B 4AE5A 1XSVA 1HSTA 5ETMA 2CW0F 1YITI 2IM0A 1S6PA 4ON0A 3JRCA 4B02A 5KFKA 4XRMA 5AJ3F 1U02A 4II3A 4PUOA 3UN2A 2XY6A 4K0KJ 2AWZA 4X66J 2GA1A 3W3CA 3KYDB 1SKWA 4HLXA 3E97A 2IHR1 3A8EA 5F8GA 1PYTA 4TQRA 4F0KA 5FLXY 5DTDA 4NQWA 1OCOH 4NLSA 4ZVEA 3R60A 4AQYF 1MROB 1FP2A 4LREA 1HW1A 1TMJA 3D54A 1CC8A 5KG1A 4A8MP 3S3OA 2Q43A 2Y3YA 1RK8A 3K17A 2E1CA 9ANTA 1QE1B 3U27A 4PYDA 1CJVB 2GAUA 3ZO7A 2KG0A 1WG1A 4LITA 3DWLE 3H40A 2P5LC 3SZGA 2LVWA 1S9FA 3PRVA 1FVSA 3FBBA 5LMNF 3DXJF 1NK0A 4IFYB 2B9YA 2OCEA 1I5OB 1ZYRF 3OV7A 2CZVC 2HVZA 4NA2A 2IRYA 5H6RA 1ZS6A 3SFUA 2YKOA 5B0FA 2ID6A 2IS4A 3KLHA 5L1JA 4TQSA 4LBPA 4DSFA 5B1AH 3SXLA 1IRXA 1FWPA 4LF4F 1G8XA 2DR8A 3UE2A 2JNJA 4WXDA 2JVOA 2NVUB 3I31A 3KNGA 4BJTA 1HL6A 2BQ3A 4B3RF 4QIVA 2M30A 4WFZA 3QZ8A 4Q43A 4EBDA 2YH1A 1POGA 2X3GA 4C3JJ 3BY6A 3CJ2A 3LP2A 2RQ4A 3ISNC 4L5JA 4DV0F 4N47A 2ASYA 2LEAA 4IFVA 1J5YA 1LNWA 1BQNA 2XGEA 1T9WA 2OC6A 1ITPA 3ASNH 1W7PB 4DSLA 5ETVA 1OYWA 5GAEU 2V67A 5E3LA 1FDDA 4UZBA 3PVXA 5A8WB 4M8LA 1IR2A 1IV6A 3P9IA 1FERA 2M7SA 3I9V2 1M1HA 3MMAA 1U1QA 3HP6A 3EUHC 2C3YA 1JLEA 1QBJA 3LH2S 1FJEB 4N8OA 3CW2C 2RQQA 2I6WA 1IXRC 5C7PA 3TUJC 2RN7A 5A2QK 3EXCX 1S8NA 2VT3A 1Y39A 2LBFB 2CADA 4J9KA 3W60A 2EFPA 5F8LA 4CRJA 3RRHA 1S3JA 3CLOA 3RKQA 5DV5A 5KFMA 1KNZA 2N4CA 2DA3A 1HNVB 2GZOA 3F8NA 4K4UA 3FCHA 4JI8F 1UPMB 2NYIA 3FXMA 2I0XA 4E0DA 5EEAA 3CMEI 3JRAA 3KK2A 4L9NA 3RTVA 2OV7A 3TGNA 3PHTA 4C0OC 2P2CB 1TWHJ 1E3HA 1XN7A 4LFBJ 2W2MP 1VLOA 2KIQA 1MNEA 4RWWA 5LHGA 3WTZA 4OHWA 1J5OA 3HOSA 2OHDA 1X5PA 2HEKA 1T33A 1S72S 4RW9A 3B6BA 4JV1A 3DOKB 2VPWB 2XC7A 2P9EA 1DBDA 4K2XA 2H9ZA 4ZOSA 1XMBA 3MEGB 2DRAA 4RKUC 1SC4B 2W2PP 4ED3A 1DP7P 1BOBA 3AHPA 4IH6A 4AYBD 4QWCA 4LF2A 2FTRA 1FXDA 3SCLE 2KRRA 1Z9CA 1RWKB 3H5SA 3BZKA 1K78A 4F4WA 2YKMA 2H54B 3AQPA 1IBLF 3Q8PB 5IP9J 1RAEB 3DLAA 2M0GB 2LA6A 1VFJA 2MC4A 1YHQS 2XEXA 4IOCF 2XAHA 1B72A 1VRTA 4PFPA 2YNHA 5H1SV 3JXOA 2Z5UA 1WC1A 1N5YA 3HVRA 3I59A 1W36D 2C2DA 3PNTA 1FA0A 4HX7A 3HOTA 4BXXJ 4AT1B 3G71I 4DNCA 1SL0A 4Y2MA 3CCQS 1AROP 1VI0A 1LKXA 5LMUJ 1CJKB 1P92A 2EPFA 2VXZA 4P73A 5HANA 2XAGA 4S04A 2QT7A 4HV6A 2QA2A 3PW2A 4NLTA 1Z0XA 5A8WA 4RA2A 3ITHA 4C0HA 1OJLA 4X62F 1TELA 1K7AA 4HW0A 1J5EF 2Z0GA 3IHUA 1JT6A 1B59A 4LRCA 2FOWA 4O44A 5A2QZ 4CLTA 3EJMA 1BIBA 3JRHA 2VG7A 1HD0A 2DHGA 3E5XA 1V5GA 5ETNA 2JMWA 4LF7F 4P2FA 3WTUC 2R4FA 4M3FA 5B0EA 2DJIA 2FHOB 2LRDA 3C8YA 5J1PA 4BY1J 1R8HA 2DYSH 4IG3B 3SJMA 4CIOA 3HC7A 1FNOA 4YB7A 4F50A 3BDDA 3GCWP 1B9MA 4QR2A 3FDSA 1TQMA 5IQ6A 3BG3A 2HS3A 2LP4A 2ATCB 4BGDA 1Z67A 3VWSA 4KISA 1S97A 4DBRA 2ZD1B 1KOOA 4P55A 2HGNA 2ZBKA 3ZMVA 3S2WA 2CW7A 2K9NA 5KG3A 5FRMA 2H5EA 1ZHFA 5J3LA 1IN6A 1JKHB 1K83J 1FIPA 2K3KA 3TO9A 5K8OA 4RW6A 1O5JA 3ELHA 5E17F 4UVAA 4R5PB 4IR9A 3BCBA 4KBIA 5KFLA 2DT9A 2X85A 3BYRA 4LLGF 4KGXB 4UOCA 3LWFA 2AP6A 1QPMA 1C0UA 3SV3A 2QBYB 1KQKA 1WI9A 4NASA 4ECUA 1QAYA 2RHSB 1L5UA 1F2HA 4KKOB 2BY2A 3P8BB 3VQSA 4JI1J 1X4DA 1DFDA 3EX7B 5HNFA 4IO9F 3I54A 1OY9A 2AJQA 1X4PA 1X7VA 5EGOA 2CPDA 1TAQA 3LSIA 4UY8T 2OLWA 2QLWA 2R8GA 2RIJA 1N54B 4KFBB 2KZZA 2HW3A 3FVYA 1C1BA 2V4JB 4XSXF 2EC2A 2Q6CA 4F52A 4LFCJ 1T03B 1UG0A 2B0GA 1R22A 3QFHA 4ATNA 5T14A 2CU7A 3ABKH 2LDIA 3T9ZA 1RT5B 2MZJA 3MAHA 4EO8A 5DG9A 5C4JJ 2HBZB 3TA0A 3OTOF 4I0BA 5IV3A 1SH2A 3RBXA 2P6TA 1R0CB 2R7XA 3OTBA 2JDJA 3RB4A 5K14B 3ERMA 4JI3F 3VEPA 4LR9A 3HX9A 1IKXA 2L9SA 1TL7B 5J40A 2BDPA 3VQTA 3HPOA 3CQZJ 4FYDA 3JQMA 3UDLA 4ZIWA 2HHUA 1XCBA 3NQOA 5GVQA 3FEYB 2HGCA 2F1FA 1KVJA 1RA6A 1UFLA 3OYBA 2J7UA 3I5BA 1A31A 1ETOA 4FE7A 4JI2F 5IWAF 4ZIVA 3VAJA 4HDHA 2ZUGA 3K0JA 5EG0A 3CDAA 1LVKA 3BR3A 1RWUA 2ZFWA 4DV2J 3FBFA 3HZGA 5F27A 1Z2ZA 1P1TA 1FO1A 1TZLA 1NZAA 4DQSA 1HQEA 1BQMA 3HKWA 4AVPA 5C44J 3EVOA 1I1GA 2EIMH 2VJUA 5DLFA 1RCXB 3P9CA 4ZYDA 5J2QB 2G7HA 2FB0A 3VPRA 2GHVC 1MWQA 1ZOTA 3ISND 3GTGJ 2XYHB 3AD7C 5KAKA 1TQLA 2E1MB 1OMIA 1XGOA 3CMES 4BU2A 1FOWA 3E51A 3BYPA 2BHYA 2ZM6F 2UXCF 2FC9A 2XCPA 2XSJC 2V1XA 2STTA 3OD2A 4DYRA 1K79A 5F9NA 1V3FA 2V2VA 4JX4A 2K4BA 4O6JA 3QLHB 2HBYB 4RNFA 2F4IA 3I0RB 1N32J 3JSRA 5GMEA 5CYJA 4U88A 2HVSA 2XASA 3I3LA 4E2FB 2B63J 2GXBA 1MN7A 2HNHA 4MQ9F 1SPBP 3MR7A 1X0FA 1TUGB 2E71A 2PMHA 5F3TA 1FYLA 3UI3A 1HNVA 1KA8A 1GX5A 3CCJS 3CCQI 1UHMA 3BTCA 3QPTA 4P72A 2NZCA 4XIDA 4R8HA 5A0YA 3E6DA 1WJ5A 2LR8A 3CC4I 3PDNA 5GAEI 5ED4A 4F2SA 4GKJJ 3RQIA 5LGNA 4LSZB 1JJ6C 1RAJA 3HM9A 2MQMA 1N0VC 4GVLA 4RGRA 4I7FB 2HR3A 2RVJA 1IXKA 4IOAF 2LYCA 4B3RJ 1TC3C 3KK1B 4DYQA 3MD2A 3MQ0A 1UZCA 3OXGA 1R8CA 1RKJA 5I3UA 3RW6A 5HLGA 5IYBJ 1U9NA 1O8BA 1ZYQA 2QG9B 5F0WA 2FQQB 2GX8A 5AXKA 2GO9A 3A8IA 5F1JA 3R5CA 2DKOB 5IT3A 1FT8A 2YKQA 1U5TC 1RWVB 1XB4A 1TL5A 1WZ2A 3A3NB 4I6WA 2E2IJ 3P9KA 2A6TA 2QMUB 3P5JA 3BG6A 1CLFA 1NG7A 3A1YA 4ID8A 1KP6A 4RBVA 1RHJB 1BJAA 3W9HA 3UCZP 1G1XA 4Q0BA 3ADAC 2M7BA 2QYOA 4K5SA 3K6GA 4XRSG 4B3XA 3R4KA 3VODA 2B6AA 2IMWP 3JCUC 2E2JJ 2R7QA 1ZR4A 1H9TA 1RT1A 1T95A 3D0HE 4LG0A 5D5WB 4O3PA 2RQKA 3ML6A 4LRFA 3AD8C 4NLUA 3GZNB 1NTCA 1WHXA 4A5MA 4OIXA 4RGUA 3K69A 1FJCA 3GFJA 4CO2A 4UUXA 2HFHA 5E0OA 3RPQA 4LF6F 3NCQA 1WGXA 1RTJA 4GYGA 2E2HJ 2X1EA 4B9SA 1S29A 2QL7B 2BYVE 2DOFA 3RKWA 1WELA 3CCMS 4KHPF 4BHCA 1IWAA 4Q7AA 2W00A 2V9PA 3BZ6A 3HSRA 4I0WA 4USWA 4OX8A 1ZTTA 1NO8A 1EAYC 4NYZA 1AFJA 2BBEA 3N0VA 1XC5A 3H5NA 1Q8BA 4IJAA 3GO5A 2ADBA 3KZIC 1U9OA 1Q79A 3MMCA 2QQBA 3R0JA 3V6HA 2HVQA 3OUYB 2I9SA 1S5LC 5D3GA 4TYBA 3BG9A 1JHFA 3ZQCA 3M8RA 4BJ6C 1R1VA 5DM6Q 1QJHA 1ZLJA 4ZP7A 1DU0A 4BQAA 4KGZB 3HOVJ 2IAJA 1RT4A 4TKTA 3ZN1A 2O7OA 3BROA 1VQLI 2CPJA 1U4BA 2UVWA 2VXDA 1O3SA 5J1YA 3LW5C 3S14J 5F1RA 1IKYB 4TLRA 4TU8A 3QGPA 1FYKA 1RP5A 3GFYA 2RUGA 3MPDA 4USTA 2DQRA 2XAFA 2APOA 3M8PA 3PEJA 1S7HA 1RR7A 2W48A 2M8GX 4A6EA 2YTCA 4DPUA 1JGSA 1LEAA 4O4GA 5KFHA 3ERED 4DQIA 1ORKA 1HBMA 2FD2A 2HRYA 1UB9A 2PX9A 4Z2XA 1NB2A 2UUTA 2HFVA 1EH7A 5H20A 2LOOA 2XB0X 2ZJRF 3I59B 2B0LA 3DCAA 1MH3A 4L0YB 4JI4F 2B6AB 2W4CA 3S1NJ 4IL6C 2R5YA 2IA6A 4WF2A 2UUAF 3KTQA 5F64A 4M3BA 4MQVA 2ZMEA 3CCEI 1SQEA 1DHMA 4HKQA 4F3OA 2CJXB 2HEOA 5IM0A 3KYLA 4EBEA 3FKJA 2XM3A 3AQOA 3FMQA 1TNSA 1EB0A 4ENNA 4RUBA 1ZBTA 1JTXA 2XROA 2MZSA 2IEKA 2X1CA 1WG5A 5KG2A 1K4TA 1EQ0A 4HOBA 1A36A 2JN6A 1B9NA 4P96A 1IF1A 1HMVB 1OCTC 4XK8C 2DH9A 3G6VA 2MZ1A 4JI4J 2ZBRA 1YITS 4USJC 1XNQJ 1MNDA 4EJOA 3JSOA 4OINF 3VYRB 1E17A 2BBYA 1M1GA 4U0YA 2KN4A 4NQWB 1D5VA 2BV3A 3A1YG 1U3EM 1N33F 3KP4A 5HI7A 3WHBA 3FCVA 5HNHA 5K7ZA 3T6JA 1ZGAA 3M1EA 4B3MF 3KX2A 1RAIB 5JVGQ 2VD3A 2Y8YA 5DETA 5A2QU 3KLFA 4DN9A 3CD0A 3ISPA 4XBFA 2OIHA 2PJRA 3LA0A 5A2QY 1S5ZA 2O3DA 1ERDA 1R3NA 2BE9B 3M6WA 4B08A 3I64A 2PGCA 2W7OA 5B66C 2WTFA 4C30A 1ZGJA 4ERDA 4WZQA 2VG5B 1S7AA 4OI3A 4TXSA 2JH3A 4X65J 3K4NA 1C1CA 3F6VA 2CQCA 1Y11A 4Q5SF 4RNNA 4DZ6A 4JB8B 3H98A 2CG4A 3W6JB 1RU1A 3DLKA 2L7MP 4CNZA 4OZ3A 1FKOB 2OF7A 2RNGA 3KLIA 2P9GA 2XGQA 4ICLA 3R5DA 4FYWB 3QPSA 3D5LA 4I98B 4R5PA 4LT6A 1U0SA 2L54A 1RAFB 4WPAA 3WTYC 1S6QA 2ZITA 1JKPC 4RBOA 4Y52J 1VGYA 3MZIA 2DIUA 5ETPA 4GC7A 3BGFA 4RLQA 3L9ZA 1HMVA 1RQ0A 5F8MA 1NK9A 1OYIA 2O3FA 4L3KA 1F3VA 2OKQA 3RBZA 5LMUF 5DDQC 5D5VB 3DRSB 1HHTP 1FFSB 2VPYB 3HF5A 1HFEL 3JRDA 5C24B 1K47A 3OYEA 4HDVA 3I56I 2M5YA 3B8HA 3HLUA 2JHEA 5HMZA 1JKRC 3FK6A 4HQMA 2IPOB 4HACA 3MWBA 2DMNA 1OJ4A 4ABZA 1HW8A 1IWGA 2E36A 4JYAJ 4JI8J 3QIPA 1S0VA 2HRTA 3BPVA 5EGOB 1P6RA 2YWHA 3DOMA 5C25A 2DODA 3NG8A 2HGMA 3IKVA 1L3SA 5HN0A 4CLPA 4IF4A 3LP2B 5CJ9A 3MCOA 4HRIA 3D0SA 3W6KB 3H1CA 1T39A 5G4DA 3TZXA 2KFDA 1E2XA 3AODA 1RNLA 4ZVFA 2F4OB 3P49B 3O6QA 3AA8A 4YB1P 1VRUA 4DFPA 3BJOA 2XTJP 3EGWB 2Y31A 2XVCA 4ZH4F 3CJKA 3BH6B 5D4OA 4CCLA 2VQEJ 4NLYA 1YTYA 4OL8A 4ZS6A 4IHXA 4XKCA 1FKOA 3PQKA 4BJ5C 3QT8A 1ZAVA 1XMOF 1X31C 1ENHA 1O3QA 1TL1B 3CO6C 3ZTRA 2K3IA 3F9KA 4PUSA 4ILLA 2KRBA 1NJZA 1O7LA 1TFWA 3A02A 2J9CA 2QGFB 2O8KA 4P10A 3SCIE 3PL8A 4A8SA 1U5TB 3JAMY 1F9EB 3RB0A 2ZDPA 4PXDA 2DTRA 2WOMA 1GT8A 1I27A 3J81Y 2N4DA 1TV6A 4EJVA 4KR0B 2ZFUA 1TWAJ 3LPYA 5TISC 2JQ7A 2MGQA 4F7ZA 3LUYA 1GXLA 4DR5J 4L3NA 2U2FA 3NBPB 3M7GA 2KVIA 5LEJA 4J9PA 2HQ3A 4XN0A 3IS9A 4X65F 3Q9VA 1TKZA 2YUSA 2ZKZA 1OYYA 4O44B 2DQLA 4QQBA 3NNHA 1JXEA 2DH7A 1RWMB 2NOGA 5IWAJ 3GMGA 2ZH9A 4JI2J 3RCOA 1P4WA 3JRGA 2WVBA 5D15A 5H9EK 2DT5A 1XTZA 1BXNA 2YH0A 5M2PA 3NS7B 1VQPS 3OFGA 1QTMA 5D5UB 5M5YJ 4DG1B 4ED6A 2BKPA 4CH0S 2ZKUA 3GJSB 1IVZA 1MKMA 4DEZA 2V5HG 4HBLA 3H36A 2QRRA 5BYRA 4CLZA 2ZH4A 3MZ8A 2X4HA 1RKIA 1OCCH 3RKXA 2VQLA 3UN3A 3BV8A 4ZPWR 1UJ8A 3HHLB 5H9FJ 1P27B 2RAEA 3NGRA 1REVB 4JYAF 4USUA 2ZNZA 1X1DA 1KZHA 3PYEA 3DLGA 2F9DA 3B82A 2R5YB 3AAWB 3HPGA 3X2QH 3O8WA 1R43A 2K7JA 1SFOJ 3EUKL 1GV2A 1X3UA 2Y75A 4HT5A 4YN3B 4ZVPB 2IRXA 2VUGA 2XNRA 4ZPAA 3I0SB 1R49A 1YZ6A 4B9MA 1HKTA 2OO4A 2UUZA 1FE0A 1X2MA 3J80Y 5HDGA 1CJTB 3OHBA 5DDGA 2LKPA 4KDPA 1U48A 4ECQA 4DR2J 3QRRA 4EEFG 4CNYA 4ESFA 2H5JB 1VQ4S 1SUQA 3GTPJ 3K7RA 2FF4A 3K2YA 4P2MA 1W0TA 2VN2A 2ME6A 4P7TA 4URQU 4EO6A 2P8IA 4WCGA 5KG4A 5L39A 2YWWA 4EYIB 1J5OB 1ZA2B 2NQPA 2IP2A 3BQZA 1N0UA 1P9YA 2H6CA 2QF7A 1FXLA 2BHZA 4Y65A 4G8XA 3QAUA 3WTXC 3PX0A 3RPUD 2AXLA 3NNCA 1VNDA 2YWEA 4Y2AA 2CUZA 4E7SA 1Q16B 4FS1A 1WOSA 2MDAA 3PYDA 2PFBA 5B0BA 3L7OA 1USSA 4DOZA 2X51A 3ILJA 4YR2A 1VHFA 2D3UA 3GONA 4Y6IA 4C48A 3NEKA 3JQKA 3ZCOA 4ES1A 2MXYA 3SQGB 3V6JA 4U8YA 5IOZA 5F8IA 2E5IA 3EDQB 4S0MA 1CQTA 2WZ1A 3FRZA 2EEYA 2M3AA 3S2HJ 4IFYA 3BGUA 1RUNA 5ETLA 2MQQA 2V8VA 5HROB 3HEFA 2XLKA 1O4XA 3CWJA 2AX1A 2KQRA 2JSXA 4BEHA 4L72B 2CQIA 4LSNA 4ZC3A 3QSIA 1YJ7A 2AX0A 2F63A 4DL3A 2D1CA 2OFHX 2PI5A 3TEHB 1DZ5A 2VQCA 3S2DJ 1IXSB 3ONQA 1FWKA 3ZQIA 4KNYA 4IFVB 2ZO4A 2ZXJA 1X19A 2P7VB 4JP0A 2E5ZA 1VI7A 4UOFA 2BXJA 5D4RA 3BM7A 3ABMH 1WKJA 2V79A 1CJUA 3PYGA 5D6EA 3S93A 3NOGA 3IR5B 1UA1A 3COAC 2ZSHB 1BC8C 4KHPJ 2QQ9A 5EX3A 5FKLA 4NLXA 3WDOA 1M5HA 5HOOA 2HYIB 2CQ0A 1A0OB 2K2PA 5KT4A 4XR6A 3BGLA 3HHLA 2BZ2A 4RW8B 2MQ8A 3Q3SA 4ZJQA 4OX9J 2MKSA 2YNGB 1K1QA 4KV8A 2I8DA 5IXUA 2M34A 1HBMB 2CZ4A 2MD5A 2OSRA 3OTCA 3PHEA 1TTHB 1F5TA 1OLTA 1W2IA 3CCWA 3NGKA 1VLYA 3RTRA 4WTOB 3JYTA 3HDSA 1W1WE 2JFKA 2VFVA 1DLOB 1YLFA 2K4JA 2Y0SA 5HLHA 2OELA 3DOLB 1SC3B 3ZNUA 2B4OA 4ETSA 1J9IA 1VQ7S 3EZUA 3OHAA 3PJWA 1RU2A 4YR0A 4JOUA 3AXKA 4OIOF 1Q1KA 4USMA 1WC6A 1RT4B 1V54H 1WVRA 2Q8KA 2KM8B 5DLGA 3ZZOA 3R6GB 1VZ0A 4OAYA 5DQIA 2KVQE 3KLIB 1OWXA 4FN5A 1SL2A 2H65B 2MHNA 2JSPA 2PBIA 2L7KA 1F9FA 5F8NA 2JJ7A 4RAYA 4OZ5A 2ISYA 4UY85 4LVOP 1DTQA 3DFEA 4KRWA 2J9EA 3IH2A 5L1KA 3CCSS 4MIBA 4ZVUB 4I99C 3M3YJ 2MMYA 2YNIB 1MMSA 4E7HA 5E3RA 3WU1B 4YRVA 3T5LA 4MKYA 1LEBA 3WTVC 3OS2A 1WJDA 1PBAA 4IQMA 3RB3A 3LP0B 3OFHA 3K4LA 3WHCA 1SVOA 3VB2A 3UNGC 2WV0A 2R0QC 2BJ7A 4N8NA 2DGOA 4FXDA 1DY3A 2UVUA 3C6TB 3EDRB 1M90T 2NXEA 2G0EA 1SB6A 2B9WA 3M2VB 2F6CA 3Q86A 3OOUA 1FT9A 4NL5A 3CT9A 2GIZA 5CABA 2Y9YA 4HR2A 3DNCA 4U0WA 1HQUB 4AD9A 5D77A 3CDWA 3D1OA 1JGGA 3LNQA 4UY8I 4M3EA 2L08A 4HHJA 3W64A 2DGQA 2GA7A 1U1RA 3E8OA 1FOYA 4J19A 4GKKJ 1RBOB 1K0TA 2L9NA 3NBPA 1FVQA 4J9VA 4DQQA 2XI3A 3ZZ0A 4CDGA 1FWLA 4XRFA 4ZLJA 1Q5VA 2NS0A 2CFXA 3FDYA 3TX0A 1NB7A 3EZ5A 3H90A 3GEZA 4R25A 4DFMA 5KG6A 4XM3A 4RX6A 4LF8J 4IEJA 4AQYJ 4WP9A 2A07F 2WTEA 3UW1A 2BKOA 4I6ZA 3C6UA 1PGZA 4RGXA 1IXCA 4ENKA 1OR7A 5MLCV 3DFGA 3DLHA 2PDAA 2AXTC 4RLFA 2HYJA 2JLEA 5DQGA 3LQVA 1XMOJ 2YWFA 4C98A 1HWJA 3G73A 1SC7A 1S6QB 1WOOA 1R8PA 3FSIA 2GGPA 2VDIA 2W9BA 2QA4G 4CHUA 1PCAA 3E3XA 2DTZA 1KQSR 1OQYA 2OJED 1C0WA 3JYTB 5FDLB 3NARA 3ZZZA 3OSNA 3J7AY 2DY1A 3GMEA 1LFUP 3B54A 1VQMI 1Q4RA 5L3EA 1YJWI 3FFIB 1FJ7A 4JP8A