2VOOA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
MAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vooA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vooA02
2M4MA 2KVIA 5MLCV 4UVCA 2I2YA 4CXFA 1S7AA 2E7WA 2HKXA 1RI7A 4EM1A 3GFJA 4IRIA 1MZBA 5FLXK 2B0GA 4MNUA 2MXYA 3KP3A 2CWEA 1L3KA 4D0PA 1ZLJA 2XVCA 4GXOA 4EMSA 1KA8A 1JHHA 1XCVA 4FX4A 3T0YA 3CD6S 1K73T 3FF5A 2DBBA 1PUEE 3CCSS 3WTVC 5EN1A 1LNWA 4U7BA 1LQ1A 3NNCA 2FE3A 3IWNC 1FXLA 3TOBA 3RI4A 3H3UA 1KQ8A 2RNEA 2V9VA 3G9CA 2M1BA 1TQMA 2DNKA 4H0EA 2GO9A 3ZMTA 4EM2A 4HF1A 1W4MA 5CJ9A 5BS6A 1A7GE 1VQ5S 3EETA 3E6CC 3HTUA 5H1SV 2MJUA 2HDCA 2AYMA 3E3VA 1QBJA 1UP1A 1FP1D 2XAQA 4O6JA 3Q2SC 1HW1A 1IXCA 4I0AA 4KT5C 2HTJA 3E5XA 2H6CA 2L54A 2DISA 1DDNA 2X0LA 2QYOA 3ZQ7A 2EFNA 1UB9A 2RQ4A 1Y0UA 1K6OA 5D6FA 3H2UB 1VQ4S 2HTSA 3NNAA 3M7GA 1CF7B 2YWKA 3CF5Q 3HI9A 4EJOA 4M74A 1BI3A 3GZ6A 1DP7P 2Z33A 1M90T 2EFOA 3KP7A 1PDNC 3HRUA 1QGPA 4JK1X 4YFNF 4HBLA 2FOKA 1L3LA 3BP8A 1WHXA 3I0TA 3U1LA 2L3DA 1V3FA 1D8JA 2DTRA 2C6YA 3DPLC 3ZZZA 5LRRA 1U2WA 3KP6A 1TQIA 2MMYA 2QENA 2LXIA 3WU0A 1XD7A 5DUKA 3VAIA 1P4AA 4EGLA 5ITHA 1ZRDA 1SJQA 2DI3A 4N9HA 2FMLA 3TYTA 3I71A 1SMYF 2W57A 2VE8A 2F3JA 4WFBQ 2MKIA 3BROA 5DD4A 1DRZA 3Q9VA 3O2PE 5J6XA 4UVBA 2EWNA 3GYHX 3MOJB 2GXGA 2XAGA 1TW3A 1O3TA 2DGXA 4ZYHA 4LB5A 5K1YA 1XN9A 2KKOA 2CQHA 1FHTA 3RW7A 5CA5A 5HDNA 2MGZA 3N97A 1K7AA 2MQNA 4I01A 1ODDA 5ILSA 2FY1A 1TLHB 3EGNA 2K4BA 3H92A 1HA1A 5J8CA 2FBKA 3E5UA 4XSZF 1P4WA 4RGRA 2O3DA 2QQAA 4MEYF 2MYFA 2ZJRQ 2JX2A 2LKPA 1DPUA 5DM7Q 1V4RA 4HLXA 5D8LB 1WWXA 4LLLA 2RRBA 1SJFA 4OINF 1G3WA 4EV0A 2M8EA 1J2XA 1KD1T 4L9NA 5H6RA 1XCBA 4I2OA 3LAJA 1SFUA 2CQCA 2U2FA 2KM8C 2XROA 1FNNA 2O61A 2NAZA 4G6QA 1EV7A 2O03A 5D8KB 1S72S 3R61A 1G3TA 2LA4A 4WF9Q 4CYDA 2EA2A 2PQ8A 2Z99A 2KM8B 4KUMA 4YOEA 4KN4X 3SQNA 1KQSR 3HUGA 2P5LC 1VC5A 2CO5A 1MDMA 1X4BA 3MUTP 3GFLA 1G3SA 3I5UA 2DNOA 1IRFA 2LCWA 2BBYA 2CSOA 4MHGA 2KIFA 1SXLA 2AYGA 1KQ9A 4IRGA 2OQRA 2MZQA 2JVOA 4QPTA 3I56S 2CQDA 3PIOQ 1K79A 3LA3A 4NQWA 2HYIB 2DAOA 2XGXA 3DXBA 1SJRA 2EJRA 5JVHQ 3E6BA 2WWYA 2MKHA 1FT8A 2DK2A 4IPAA 2MLKA 2DGTA 3UCGA 4WWCA 1YG2A 3WTYC 3SXLA 3BY6A 4YIFA 4IRHA 1QZYA 2K27A 3MQ0A 2KH9A 2MBFA 4YFXF 4K2EA 1S29A 3SDEA 2PJPA 3DLLQ 5EEHA 1FBSA 4BS2A 3BJOA 4U7DA 1C0WA 1N54B 1AUDA 2XS5A 5BJRA 2CJKA 1YTYA 3FM5A 1KOOA 2BZ2A 1FJEB 3E6DA 1IQTA 4OU0A 2HGCA 2QQ9A 3HOTA 1WEYA 1WTBA 1IN6A 3M8EA 5GADU 1WG5A 2A07F 1YYVA 4LD5A 2BYVE 1K78A 4TU8A 4EJUA 2DT5A 2VT2A 2DK8A 3B4DA 1Z7UA 5CXTA 3ZZYA 3ELKA 5F64A 3ZMSA 3HSEA 3LAPA 3I55S 2RC4A 2DPUA 2PE8A 2A3JA 2EV5A 3P5TL 2RKHA 2PI0A 3DF8A 5LHHA 2BOPA 1YO5C 1MDMB 4WKRA 2MH9A 1SJ3P 3TP2A 3R27A 2Q8KA 3QOPA 2FXAA 3SMZA 4ENKA 2K8GA 1XMAA 2YU3A 4WF2A 1BM9A 4EJVA 3GVAA 1VC0A 4DQ2A 4LB6B 1I1GA 2V1XA 2CPJA 1FJ7A 2P7VB 3ULQB 4BYYA 4KA4A 1B9MA 1O3QA 2DGOA 1RKJA 4EGZA 1P2FA 4CIOA 5K5QA 1E17A 4AD9A 1U2FA 4WX9A 1JHFA 5HS8A 2MKJA 4F7ZA 5GAEU 1XN7A 5ICFA 4G7ZF 4IHSA 3S7RA 5LRSA 2J76E 3MD3A 2NNNA 4IXAA 3RIRA 1B4AA 3CCUS 2FPHX 3JB9k 2VBYA 3NS5A 2OQGA 5BQTA 4Y13A 3P49B 4TLQA 2DQLA 3DV8A 2L02A 2M0GB 1UW4A 2DNQA 4HX8A 1JGSA 1IN5A 3U9GA 1X4AA 2IPQX 1YITS 5ICGA 4NB5A 1WI9A 3TGNA 4W90B 3KFWX 4XRFA 4OIQF 1G3YA 4M9ZA 2F9DA 3WE2A 1J7KA 3COAC 2XS2A 2FA5A 3RPUA 1SFEA 1IN7A 2DH7A 2CW0F 4G7OF 3VFZA 5LHIA 1XGSA 1PP7U 1UAWA 3D5LA 1H9GA 3L09A 1LB2A 3GWZA 5A2QK 3ERED 4M9SA 1U1LA 3FM3A 1QPMA 2RQPA 2FNPA 2BEOA 4ZH4F 2OJ3A 1BY9A 2FC9A 1W7PB 2XAFA 1JE8A 2ZNZA 5ICCA 3QP6A 3VEPA 2VBZA 3ZMUA 3SZTA 4HF2A 4AIJA 3F3XA 4G9YA 3G96A 2DIVA 1Z6TA 4LG0A 3OV8A 2W24A 3UD4P 1I6XA 1OYWA 1R23A 3F21A 3TDZC 4L9VA 4F02A 1OWXA 4ESBA 2ZKZA 4HQMA 1MGTA 4U88A 1QO0D 3R1LA 1STZA 1U5TA 2DFIA 2PMUA 1QQIA 4M9XA 4FT8A 4A8XA 1VQOS 4HV6A 2M9KA 3ZPLA 3IL2A 5CYVA 1XSVA 2OBPA 3U2RA 2GZWA 2LF8A 1U1PA 4BAYA 2N7CA 4Z2YA 1NJIT 1X4GA 2MA3A 3VAFA 5DDGA 3F22A 3C3WA 3F6OA 2RDPA 2QUFA 3I4PA 3VAMA 1G6NA 3MURP 4CH0S 4Y0FA 2Q79A 5K5OA 3IC7A 3GEZA 3P9IA 4IOCQ 3ULHA 1FO1A 3NNHA 3I64A 2GIVA 1WRJA 3F8BA 1BC7C 2Z9OA 2PFBA 4BNCA 3S01A 5LXRA 3K0JA 1FY7A 5FGMA 3R0AA 1U1OA 2G7UA 2LYVA 2R7DA 2NYXA 3GLXA 4RGXA 4UUVA 1DPRA 4G7HF 2MZ1A 3MI7X 1W7PA 4R79A 4LLNA 5IFMA 4Q5SF 2Z3YA 1Q86T 3F8FA 4A6EA 1NU4A 2N82B 4WFNQ 4ENNA 3K69A 3V7RA 5ERIA 4UHTA 2D1HA 4IUFA 5JFRA 4TV7A 4E70A 2M52A 2HKOA 3IRQA 1YLFA 3F72A 4R8HA 1BI2A 2UP1A 2OTJS 1HL6A 4RB1A 3GFIA 1WF2A 3L3CA 3EX7B 3IWFA 1G4DA 4XBFA 4A12A 2W84A 4L9JA 1VQMS 1R22A 4EJWA 1FYKA 1OMIA 1NO8A 3V4GA 5CYJA 1HXDA 5GAGU 5L3DA 3RYPA 4RU2A 3VAHA 5IT9K 3WGHA 2JRTA 3MZHA 2HZTA 2XV4S 1FBQA 2YX7A 2OA4A 2IW5A 4L18B 2E1NA 3FMRA 2KRBA 2HFHA 1E2XA 1F9FA 4I09A 2MZRA 1TQPA 4N9IA 3ML6A 4GCVA 4HDUA 1X4FA 4WXCA 2JVRA 2L01A 4ENMA 2HGNA 5EEGA 3KCCA 4JBAA 3MUMP 2Y0MA 1KYZA 3QU6A 5GMKa 1X4HA 1YW7A 1SMTA 2XUBA 3P6YC 3ZMZA 1JMTA 3VAJA 5HLIA 2LNBA 1OYYA 1ZGJA 2LXUA 3CCRS 3CMES 3UD3P 3RW6A 4M6YA 1ULYA 5LHGA 3KETA 3DFGA 3Q9SA 3TDUC 5D4SA 4FXVA 1QNTA 2X1BA 1U5TC 4L0YB 1IAWA 2HYFA 1EH7A 1XGNA 3I54A 2CFXA 3CCLS 2EK5A 1URNA 2VODA 1JJ2R 1VBYA 3S8SA 1D8ZA 5DUIA 2FHOB 5ICEA 3ROUA 3V8JA 3BDDA 2PEXA 2LECA 4RAZA 1DUXC 4Q47A 1W5SA 5H20A 5IT3A 2LMIA 4ZYDA 1T98A 1ZN2A 1TNSA 3V8LA 3C1DA 4U0WA 2LF7A 2HYGD 2MC3A 4BH9A 2ESHA 1FBUA 3WU1B 1FPQA 5K5RA 3VF0B 1D8KA 1S3JA 3H3ZA 2DITA 4QQBA 1OO0B 2VE9A 4OIRF 4UV8A 2GWRA 1UCRA 4CICA 5DDQC 3R60A 2DU9A 3LSTA 1HSTA 2QBYB 2MGZB 2P6TA 2LEAA 1Q7YT 2K7LA 1ZG1A 4BQAA 3W6KB 2A6EF 1ZAOA 3R1HA 3ISPA 4KMUX 2ZFWA 3CUQB 3M8FA 2MKSA 3BS9A 2X1GA 1B7FA 1I5ZA 4AIHA 3T8TA 2F5EA 2QA4S 5CVJA 1UHMA 4L0ZB 3J7AO 1YW9A 3SDEB 4RS8A 2FU4A 2NZ4A 1B6AA 4HOBA 3S2WA 5TRDA 4N0BA 4PZJA 4LMYA 1VQPS 2DPDA 3SHFA 4WCEQ 1RK8A 5HDGA 2Z5UA 3BJ6A 1H9TA 4HW0A 2MD5A 3G8TA 1O57A 2FBHA 3P9KA 2BGCA 1T2KA 3UCUP 3E5QA 4BHPA 4U0VA 2HEOA 2E44A 2CPEA 4AIKA 5LJ5Y 2B0LA 3UWTA 5HOOA 1T38A 3E97A 1RZ4A 5KK1A 2U1AA 3WTXC 4UY8T 3KE2A 3IKTA 2G7HA 3SXYA 4OIPF 3R6SA 2AXLA 3R4KA 3K1MA 2UWMA 1O0PA 2L9WA 3IRWP 5F6FA 2PLYA 5JI6A 3HSRA 4EJTA 5GVQA 3PIPQ 4LLGF 3S6EA 3KP5A 2J8AA 4IOAQ 1USSA 1WQ2A 1WWHA 1R7JA 1Q81T 3THTA 3MDFA 2MHNA 1FT9A 3WGGA 2HQNA 1BI0A 4RGSA 1OYIA 3HHHA 2ZCWA 2GQQA 2JZYA 3ZMVA 2WV0A 2LEBA 3J81K 2DO7A 2HR3A 1R8PA 1LEBA 2O6GE 2EK6A 5FB2A 2DNNA 2V1DA 4A5NA 2CPYA 2MQOA 1FJCA 1R5HA 1U8RA 2G9WA 4KFCA 2ADCA 4TU7A 1TBXA 3QP5A 1HKSA 5GAHU 1KYWA 1IXSB 3WE3A 1PP8F 2DO4A 4A6DA 3EGZA 1U6GA 4CGZA 2OTLS 2VBWA 2CGPA 1X5OA 4KIFA 2VONA 1UFWA 1W2BR 3OW2R 2A3SA 2VXZA 1O3SA 1U3EM 3WTZA 4G6DA 4A5MA 3FEXB 4PKDB 5E20A 4HYEA 4ETSA 1U1QA 4KN7X 3CTRA 2HWVA 5E17F 3HHGA 2CPFA 1FWZA 3MEXA 4CQ1A 1LJ9A 3IWZA 1U1KA 1WSUA 2MSTA 2QWWA 2X4HA 3FXRA 1QZZA 2VOOA 1RIOH 1PGZA 1X0FA 2JPCA 5D78A 5D5VB 2G0CA 1U1RA 4ENJA 1KQ0A 3SZPA 2CQ1A 3DKWA 2QFJA 4IF4A 2N3OA 2M88A 3K9TA 2FF4A 2ISZA 3MFKA 2EV0A 4UVAA 2M2BA 4G8XA 1N52B 2DH9A 2VN2A 1YJNS 3N4MA 3THPA 3RKXA 4HX7A 3CCQS 1M5VC 1IZ1A 2VC0A 2CPDA 4HF0A 4UNOA 3UCZP 1TW2A 2XSFA 3V8KA 3T8RA 3PQJA 1HSJA 4M72A 2AYBA 3CJNA 1USTA 1PO6A 3RPQA 2HOEA 4GYIA 1QVFR 2XRNA 1H6KX 2MB0B 2VT3A 5IT9Z 2HGMA 4UXNA 2CPIA 4PDKA 1JXSA 2DQRA 1U6FA 2V79A 2ETHA 3WGIA 2ZJQQ 1B1BA 3FZVA 2J5OA 1LDKB 1VTNC 1J5YA 1FLIA 4PCQA 1YS7A 1Z1DA 3LPYA 2M8HA 1L0OC 2OU2A 3CUQA 3RTRA 2R7FA 1MJ9A 2Q0OA 4L5JA 1HD1A 1XSDA 1X3UA 1YS6A 4M71A 2YX4A 1BOAA 3GZ5A 4M5DB 3CC4S 3TO6A 3L7WA 2P5KA 5LGTA 1IF1A 4RB3C 2HZCA 2L4AA 4IJAA 2RS8A 4I98B 1AOYA 5ILUA 3GFMA 5JVTA 2NRAC 2YR2A 1FNXH 4KYWA 2JSCA 3PFIA 1U1MA 1ON1A 2XNQA 5L3GA 1U5TB 1S7OA 2KXNB 1FP2A 2MLGA 2M45A 1F4KA 3E6MA 3V4MA 1O7LA 1WF0A 2HGLA 3TOAA 1GVJA 2M8DB 1G2EA 4Y15A 4CZZA 2K02A 4RB2C 1HW2A 3NS6A 4IHTA 3IHUA 3TO8A 4PGGA 2AD9A 2IA1A 1WHVA 4LFUA 1S8NA 4B8XA 2CQ3A 4PR6A 3WG9A 1K78B 3KZZA 4MGRA 5JR3A 5DDOC 5ED4A 1X5PA 1XSXA 3ABUA 2JPBA 2KN4A 3CXCR 2D9PA 1BIBA 4IO9Q 1BC8C 2E7XA 2OZUA 3KP4A 2PMHA 3ECOA 1Z05A 4HX4A 3TQNA 5FLXZ 1P92A 4ZYGA 4ZKAA 1A9NB 3D0SA 1H2UX 1X4CA 4JQFA 5AIPA 2XNRA 2NNYA 1YIOA 6PAXA 1M5KC 2V6CA 4F26A 2M30A 2GHPA 4EVIA 1JJ4A 2OZ6A 3NQOA 1VBZA 4HV5A 4WFAQ 3ABTA 1FX7A 2CG4A 5D6EA 4WK8F 1S79A 2P7CB 5LEKA 3GW2A 3HRSA 1YI2S 3DXJF 2J5PA 1O3RA 5HL7Q 2KJBA 5CVRA 3DPTA 1R58A 2E5JA 1R00A 1TTYA 2MQLA 2YH0A 3C18A 1EH6A 2P5VA 2OAZA 4MQ9F 3U1MA 3CCES 1MKMA 1Z91A 3BEGB 2DNLA 5CLSA 2H27A 4BHBA 1P6RA 5LSLA 3G73A 1WG4A 3ZN1A 1BN5A 1R36A 2DHAA 1RUNA 3HTSB 2WC2A 2QZ8A 3RYRA 1FSHA 3K2ZA 5CVVA 5LSOA 2CPXA 3FHZA 3BPVA 4CO8A 1OR7A 4LJMA 2HS5A 2X1AA 2RVJA 4OIOF 1H0MA 2XS7A 5FFZA 2ZJPQ 2DK5A 3JW4A 3L9FA 2QM3A 2G4BA 2M5WA 2MJNA 4KIBA 4MTEA 1OKRA 2DNMA 4YIIA 5HO4A 3WODF 3NEUA 5BPIA 3GX4X 2MKKA 2KU7A 1WG1A 5BPDA 1VQ6S 2MZTA 1T6SA 2EB7A 3J81Z 1GXPA 3EYIA 1IRGA 1R1TA 1R1VA 1U1NA 2OSQA 2P4WA 3O3KA 3G71S 1T39A 5LJ3Y 1FSEA 1XGOA 1KU9A 2R3SA 3J80Z 1BJAA 4M73A 2WTEA 1ZRCA 3J7ZT 1FYLA 2F5CA 1XDUA 3CPWR 4L9TA 5L3CA 5LXYA 4Q4ZF 1HW5A 1Q1HA 2WBRA 1N88A 1Q82T 2MZJA 3EQLF 1BBYA 2AYEA 3IKVA 1TNTA 5DCMA 1H2VZ 1VBXA 4ED5A 1M5PC 1REPC 4TU9A 4PGHA 2JWNA 3O6BB 5DV5A 1MJAA 2L4MA 1SD6A 2QQBA 2K86A 2H6BA 4XLPF 4P96A 5TJJA 2DNYA 1OPCA 1J9IA 1P27B 1Z6RA 2RS2A 4PRFA 2M87A 2ZMEB 3BWGA 3ECHA 1YFHA 2DNGA 5LLQA 2KXHA 3F6VA 2F9JA 3VODA 4Y00A 4Q48A 2DGVA 1BI1A 2X1FA 2A61A 4RGUA 4OMZA 4F25A 3LQQA 4OZ0A 1D3YA 4A2UA 4HA8A 3MXHP 3US5A 1YJWS 5FD6A 1CGPA 4WIIA 3CDHA 5HDKA 3K0LA 2ADUA 3CMAS 1VQNS 4I0BA 2GA1A 3REOA 2FSWA 5FD5A 1R5GA 3F8CA 3HHNB 3HYIA 5FFXA 3K1NA 4GYGA 3KEOA 1XGMA 5H6QA 4LIRA 4W92B 1KU2A 4UV9A 2CQ4A 2GAUA 2PBIA 2TDXA 2E5IA 1X4EA 3BO2A 2DLLA 1W5TA 1OIAA 4I7HA 5E8GA 1ZG3A 2MQPA 1SD5A 2EK1A 3KP2A 1T0FA 2W85A 3V7CA 1UHWA 4P6QA 5HVQC 4M6XA 1ZG5A 3B4MA 1N8RT 2V94A 1DBDA 2ESNA 3PQKA 1WKMA 5J8FA 2I38A 3I59A 3W6JB 3EDPA 3P9CA 2F5DA 2PEHA 3LFKA 2XAJA 1ZRFA 5IM0B 4OOIA 1J0RA 1HQCA 2A68F 3OOPA 3F8NA 4QU7A 5KVRA 5IM0A 2JTVA 1WEXA 3LWFA 3M1EA 1XMKA 2EV6A 3HOSA 1MJBA 3L2CA 2CPZA 4ZZDA 2DNRA 3MAJA 3CULA 2MH2A 4FX0A 4P9UA 4GGGA 1ZARA 4P9FA 1U78A 2K3KA 4B09A 1SFXA 3I53A 1LDDA 3J80K 1DHMA 1R8HA 4DNCA 2ZO4A 3DEUA 4GO1A 1HBXG 2RUGA 4A0XA 3HRTA 5E8IA 2RQCA 2JT1A 1IN8A 3GF2A 3B02A 4WCGA 1X5SA 2LDUA 3RJPA 2DW4A 2RU3A 2KRRA 3JAMZ 1AWCA 2P6SA 2DGQA 2FC8A 2VC1A 2O3FA 2NLWA 4ZYEA 4ZZLA 1KU7A 3KZYA 3BO4A 1U6BA 1HKTA 2DB1A 1LDJA 2E5HA 4WXDA 2EA4A 4U0YA 3MZYA 3D2WA 5LGNA 2STWA 4HLYA 2KRFA 3KLOA 3CO6C 2IRFG 1W7PD 1RNLA 3GXOA 3TKYA 2FEZA 2EVZA 3N9UC 2H09A 4ESFA 5LBQA 4BHCA 3V7SA 2F5FA 1YW8A 2KJCA 5DDPC 3F23A 4CDGA 3L00A 4BXUA 5CVUA 3Q5FA 2KG1A 4LK0F 1F9NA 4QLCU 2OSRA 4FXWA 5AIQA 1SJ4P 2OIHA 4OMYA 2M70A 1P4XA 1JJHA 1ZH5A 2ADBA 1B9NA 2NS0A 3LQVA 2HVZA 2D1VA 5DM6Q 1ZZNA 3TO7A 5L3EA 4C4WA 4LJZF 3F8MA 5JHUA 2D45A 3R0JA 1VC6A 2Q2EA 4ERDA 5E1XA 4QU6A 1QVGR 2ACJA 1GXQA 1IW7F 2CQBA 2KFYA 3G4SS 2RT3A 2RN7A 4OZ1A 1WEZA 4ESJA 2E5GA 2COMA 2KIUA 3P7NA 2IT0A 3CC7S 3IRRA 4I02A 3SFZA 4YFKF 1ZREA 3LA2A 1IN4A 1KU3A 4KDPA 4Z2XA 2UXXA 1VQ9S 2CQIA 5BMZA 3CTAA 4MEXF 1ZGAA 4KIGA 3QPHA 1WHWA 3CUNA 2ZBKA 2OD5A 5CVIA 4RB0A 2A5YB 1D5VA 2JRSA 1I27A 3B73A 1WELA 2F2EA 5D4RA 4MQVA 3KEQA 2ZNYA 1J75A 2W25A 2KIMA 3AAFA 3HIFA 1FYMA 2DHXA 2Y48A 2IVMA 3UE2A 4U67Q 4FHTA 1YWXA 1VQ7S 3VB2A 3P3DA 1SD7A 3LQRA 2VOPA 3MD1A 1VQKS 3JAMK 2IP2A 4QWQA 2VBXA 1P1TA 5DDRC 3CUOA 1XDSA 1GHCA 2MSSA 4XSXF 2KI2A 2XHKA 5DCFA 2YSRA 2KT5A 2DO0A 2L41A 3MUVP 2E1CA 1M5OC 1A04A 4LK1F 2QEXS 2KG0A 4YG2F 1I1SA 4C0OC 5D5UB 2DGWA 2DHSA 3EUHA 5HLHA 2J0QD 4C7QA 4LMZA 1UFMA 2ZXJA 4HQEA 3CCVS 5DD8A 3MWMA 1K9MT 3Q2TC 1XB4A 3BOQA 1Z9CA 5D5WB 2O0YA 4MTDA 2YTCA 1ONVA 2MPUA 3VAKA 2QVOA 4WXHA 1ZYRF 4XLNF 2EFQA 2CQKA 5D5XB 4HZFA 1D9AA 3ZP5A 2MQMA 2ISYA 4L5IA 2XKPA 3EYYA 3BZ6A 4HAMA 2H94A 4EM0B 2XIGA 5ILVA 1YIJS 5DEQA 1FC3A 3WTUC 2CQ0A 4KMFA 2P8TA 3VAGA 2BE5F 2IA2A 2LA6A 2CPHA 4ON0A 1KGSA 5FJ4A 4P5OA 2SXLA 4YB1P 3QRFF 2EFPA 4V19X 2FQ3A 2CQGA 4A0ZA 4J5OA 4Y17A 1M1KT 2ZJ2A 5E1WA 1HKQA 2RV8A 2DNHA 1RUOA 2V1UA 3CUQC 2FNAA 2DGUA 5JVGQ 3JSOA 5DETA 1OPIA 2ELHA 4S04A 1HD0A 2KXFA 2G1DA 1NHAA 4ASNA 1YHQS 3CLOA 2ZMEA 3JTHA 1YJ9S 4O5VA 3CCMS 3LA7A 3GUDA 1VQ8S 5DCMB 1ZZFA 3KLNA 2DIUA 1WF1A 3JSPA 2GXBA 2PG4A 2MY8A 2BV6A 3MCZA 3WTWC 3FMSA 1LEAA 1B59A 3H2VE 2RVCA 3FMQA 4IVNA 2DGSA 2XB2D 2PN6A 1FZPB 3NMRA 3T5XA 2D3OR 3HRMA 5D77A 2O8XA 4AWXB 4HDVA 2UXNA 5AONA 3QU3A 5L3FA 1DZ5A 2DH8A 2YPRA 1CF7A 2XASA 2AS5F 2HQRA 4NHJA 3T1BA 3VALA 4RAYA 5L3BA 4LG0B 3J7YU 3RKYA 3QAHA 1X4DA 3DP7A 4CH1A 4KNYA 3GO5A 1J59A 2IJLA 1S6LA 2D9OA 3JTGA 3CCJS 2MKCA 4S05A 4YUDA 5BOXA 1F5TA 4CHUA 4P55A 5F1RA 3FXQA 1BIAA 2FRHA 2Y75A 3I59B 1LVAA 1IUYA 3TO9A 4O3MA 3BJAA 3VOEA 2XKOA 2XAHA 3BPXA 2DNPA 1CVJA 1QM9A 2RGVA 3K1PA 2YKAA 3G8SA 4R1HA 1KOHA 2RNJA 2CQ2A 3NRVA 5A2QZ 3BO3A 2D2WA 3FX3A 2MY7A 2L08A 1SAXA 1IXRC 3FWEA 3RKWA 5HS7A 1ZHFA 2DHGA 3G6ES 3FXUA 1H2TZ 1X5TA 3CO7C 2ERRA 2A6HF 1R1UA 3QPTA 2K4JA 1K8AT 2FBIA 2GA2A 1KC8T 3C7JA 2MQQA 1WI6A 1EH8A 2LKZA 5LGUA 2M7SA 4EQQA 4AVPA 3ZMDA 2UZKA 3U1DA 4G94A 2QLZA 4LGWA 2KYXA 3WTTC 2EFWA 3FEYB 4KICA 2FMYA 2MZSA 4UQTA 3CC2S 2DNZA 1YQAA 3I58A 2RRAA 1WI8A 1F1ZA 1VQLS 5LEJA 2J0SD 4A0YA 3WTSC 2QBYA 2KHCA 5IQQA 1WHYA 5HLGA 3HSFA 3RDIA 1SD4A 4EGYA 1ZLKA 2IA0A 2CQPA 5HS9A 3ZN0A 2STTA 3M9AA 2CYYA 2N3LA 2YH1A 1MD0A 5E1ZB 5DYMA 2LQ5A 1FOKA 2LSOA 5FO5A 3G3ZA 3DQVC 1O7FA 5E18F 1ON2A 2A69F
chains in the Genus database with same CATH superfamily
3X1LB 2M4MA 3QQAA 3NS7B 1AA7A 3O5TB 1UFKA 1JGGA 5MLCV 1S1TB 2E7WA 2F8HA 1B72A 4IRIA 3QYYA 4PXDA 3WC0A 2R8HA 3VSKA 4P1WA 1VQ9I 2C2RA 2QEXI 1S49A 2QCOA 2MXYA 1K0TA 5DTDA 4D0PA 3RKQA 4JBCA 1X1PA 2EZLA 5FKOA 1X3WB 2LVWA 2XVCA 1Y7PA 4GXOA 4A3DJ 1HBUB 1KA8A 3M8YA 5IT9Y 4FX4A 1QY7A 1K73T 3FF5A 3SQGB 2DBBA 3MMJA 1GMUA 2XMAA 2Q6CA 1LNWA 1JLFB 4TXSA 1HOMA 2IM0A 4U7BA 1LQ1A 3NNCA 3W3SA 3G9CA 2M1BA 1IV8A 2AMCB 3PDNA 2CIMA 4H0EA 2B7EA 2GO9A 3ZMTA 2F4FA 2F4IA 1A7GE 1VQ5S 3ESWB 3ZZPA 5H1SV 2MJUA 2HDCA 4P2FA 1QBJA 1UP1A 4NXMF 2E1AA 1FP1D 2VIHA 4RUAA 4I0AA 1BA5A 3E5XA 3GMEA 1DQ9A 3QIPB 2DXFA 2XHWA 3K5LA 2RQ4A 4RMNA 5D6FA 1DQ8A 1QE1B 1RBLA 3M7GA 2GVDA 4X4UA 1YITI 4DHVA 1BI3A 5KFTA 3GZ6A 5B0EA 1DP7P 2Z33A 5HVFA 2DA1A 1L3SA 1Q1VA 3OPKA 1JXEA 1M90T 2LFVA 1QGPA 5HNHA 4YFNF 1YX5A 3FXMA 1L3LA 4OYPA 4PZVA 4DFJA 1WHXA 2F5GA 3LH2S 3GJSB 4NI2B 5B0FA 1V3FA 1CC8A 3G71I 2XLKA 2Z0GA 2OF7A 1D9DA 2OHDA 1TQIA 2QENA 2IRYA 1Y1WJ 1XD7A 5DUKA 3D7SB 3VAIA 2V8HA 2KZVA 1ZRDA 2Q3PA 2FMLA 1RAHB 3I71A 2GLOA 4DR5F 5E3LA 3J7Z5 2CNOB 3M9MB 2F3JA 5FKKA 1TTHB 3DLAA 3Q9VA 3O2PE 4UVBA 3S1QJ 1RTHA 3GYHX 2GXGA 2W2MP 4DV0J 5D0GA 1TW3A 1O3TA 2AGOA 2EFVA 4LVOP 2LD5A 3PV8A 1XN9A 2MLXA 2WSCC 2CQHA 4CTAA 2CQ7A 2E1OA 1Q95G 4H54A 1F36A 3WG7H 3LUYA 5EGYA 2QMXA 3V5RA 1HNWF 2MQNA 1ODDA 1TLHB 3EGNA 1DFDA 2I1RA 2QIFA 4LFBJ 1PBAA 2ZJRQ 2LKPA 2W2PP 4HLXA 2RRBA 5HJXA 3IAM2 2M8EA 3AA8A 3CGIA 5K20B 1S1WA 4J9QA 2HS3A 4I2OA 3UI3A 1MROA 2CAJA 1FNNA 2FLLA 2KT0A 1SL1A 2E1MB 1EV7A 1GAOA 4OYAA 1N25A 4WF9Q 3OR1A 3SIPB 3OOUA 1CG2A 2P5LC 3AHPA 2X51A 1FEHA 5HK4A 2AXTC 1G3SA 3I5UA 1MNEA 3KK3A 4FBUA 1ROFA 4WFZA 1IRFA 3TA1A 3HP6A 2R42A 3DLJA 4DR3F 3PX0A 4IRGA 1FNMA 3I56S 5B1BH 2CQDA 2X7IA 3GTOJ 1OYDA 4NQWA 2DAOA 2XGXA 1X7VA 1SJRA 2MKYA 4E7JA 3E6BA 5ETVA 3UCGA 1ENHA 3AA9A 4LSLB 3WTYC 3J80U 4YIFA 1RHKB 2K27A 2RAQA 3I5CA 1G8XA 2APOA 4K2EA 2VPYB 2PJPA 3S93A 2ZBQA 1TVRB 3MEGA 5HATA 3BJOA 4U7DA 2RHQB 3HEFA 3A8KA 5BJRA 2VZ9A 1A35A 1H73A 2IAIA 4ID5B 1MWYA 2KKHA 2W7NA 5GADU 1WG5A 3RB6A 2A07F 1F0XA 1F9EB 4LD5A 1K78A 3C2BA 2J9CA 3Q22A 3B4DA 1TK8A 2ZOGA 3C6TB 3ZZYA 3ZMSA 3LAPA 2RC4A 2DOFA 1ERDA 1MMGA 4DPXA 3A4CA 3P5TL 2I6WA 2HBRB 4DF4A 2BZTA 1Y4ZB 2GVZB 2BOPA 1MDMB 1VHFA 2X6OA 3LP2A 4AM3A 1WJ5A 3T5LA 3IC1A 4UUWA 4M5LA 1GXUA 2YU3A 2RQQA 1F43A 3GJRB 1VC0A 4DN9A 4BHQA 1VQKI 2FLPA 4XKWA 4DQ2A 1HCRA 3AOCA 3WC2A 2CPJA 4U7UK 4GDFA 2YKMA 2MGQA 1NKCA 2EIJH 4KA4A 5IYDJ 4N7TA 3CJKB 1P2FA 4Q2LA 2NCKL 1JHFA 2MKJA 4OJ1A 5D0HA 4ITVA 2J76E 3MD3A 4IXAA 4QCLA 3I4HX 3RIRA 3CCUS 3JB9k 2OQGA 4Y13A 2RMLA 2DQLA 2L02A 2M0GB 4L73A 3JRFA 1M5HA 3S1MJ 1MROB 1YITS 5ICGA 2AT1B 2IGMA 3RRGA 4M9ZA 1U0SA 5K14A 1QVUA 2QA4I 2MSYA 2B56A 2OPRA 4BWJA 4K4SA 2Y9ZA 1B4SA 1P9YA 5LHIA 1UAWA 2LDIA 3GLLA 4CCMA 1LB2A 1NK7A 2WY7Q 1JKHA 4DZPA 1ZOTA 4B9LA 2RQPA 2FNPA 4DR3J 1W2IA 2XMWA 2XO7A 2FC9A 2BY1A 1OCRH 2PJRA 3QP6A 4IOCF 2J8SA 3SZTA 3GYGA 5L9NA 4HF2A 5AXLA 4M5DA 4NLDA 2XMTA 4G9YA 2ZM6F 2M7BA 1SBRA 4LG0A 1FDDA 3PNYA 5IC6B 3AODA 4ATNA 1WKLA 4HQMA 3RZDJ 3R1LA 1STZA 1U5TA 1VQOS 1XPXA 3DNCA 4A8XA 3C16A 1IKVA 2E60A 2AF6A 1YBUA 3ZPLA 3IL2A 5J1UA 2LU2A 3IV5A 1EKSA 4QR0A 1FK9B 3QT5A 3BREA 2JUGA 2PSZA 2HHHF 4Z2YA 2XSJB 1IM4A 4ZA1A 2J9DE 2QSWA 1EP4B 4CCNA 2RDPA 1WJCA 1G6NA 4Y7NJ 2DDAA 4Y0FA 2Q79A 2GIVA 4NLWA 4JI5J 1RDRA 2PFBA 4KHRA 3OYBA 1FY7A 5FGMA 4PEOA 3HSJA 1MWZA 4IH5A 2D74B 4PPDA 1U1OA 2DFHA 4XN0A 4E7KA 2R7DA 3GLXA 1OCPA 2AQFA 2CJQA 4G7HF 2W7AA 3LWLA 1BOBA 4RDUA 4LF8F 4CCLA 3CJ3A 3FRYA 5IFMA 4Q5SF 2FX0A 3VR1A 3A0BC 2JEIA 4GKJJ 2Z3YA 3R5DA 2W9CB 4WFNQ 3V7RA 4DWIA 1HPZB 1Y5IB 4IUFA 5JFRA 3P4UB 1YLFA 2XHCA 1HL6A 4RPFA 4USKA 3SSQA 3EVWA 2CRLA 5FRNA 4UUSA 2DT7B 3PYFA 2BBEA 2W9AA 1VR6A 2DYRH 3EX7B 4PG7A 5KFXA 3J80Y 1OMIA 1V5FA 1U0JA 1HXDA 5GAGU 2FJVA 3RYPA 4OYOA 4ZVGA 1NJXA 3D54A 1R0AA 1NK8A 4X64J 4CO0A 4L18B 2KRBA 2ID6A 3HSGA 2AW0A 4N76A 3UR3C 4HDUA 3FK6A 3DKXA 4CA0A 4R8UA 5AXNA 3MUMP 1H74A 1KYZA 4AVZA 5IOZA 4ZIVA 2HZAA 2CQQA 5IS2A 2LNBA 4IH7A 2WRMA 1VQNI 3CMES 2NREA 4M6YA 5LHGA 5B09A 3MEGB 1XMOF 4KPYA 1S6OA 3Q9SA 4IQ4A 3QAEA 3UDEA 1QNTA 2X1BA 4C9DA 2R5ZB 4C6AA 1X1AA 3ONQA 2DEJA 2X85A 1URNA 2GM4A 3BGRA 1NPKA 1RETA 3JR9A 3R7BB 1IC8A 4Q47A 1W5SA 5H20A 3CDUA 2OPSA 4IO1A 1ZN2A 4P2SA 4U0WA 1K47A 1YSJA 4BY1J 3CDWA 3WU1B 2A1BA 5H9EJ 3AG2H 3MEEA 5KG4A 4QQBA 4IX7A 4B3RF 2F48A 1BXNA 2GWRA 4CICA 2XBPA 5DS7A 3ITHB 3LP0A 2OLWA 3B82A 3RGIA 5E5NA 1R8BA 4QWBA 3UNGC 4K5SA 1JLQA 3FNNA 4OJ3A 2EI5A 1ZG1A 3RRHA 2A6EF 2PMZA 4ZC3A 4DUTA 2MKSA 5AXKA 1L3VA 1I5ZA 3A3OB 5KFYA 3BQYA 3T8TA 2F5EA 2QA4S 2EKNA 3FRZA 2OPQA 2BM0A 1N33F 1UVMA 4FASD 3J7AO 4LF8J 3SDEB 4RS8A 2FU4A 1ZAWA 2XC7A 1QHHD 5TRDA 1K4TA 3G1LA 1VQPS 4BE0A 1RK8A 3R6LB 1SANA 1H9TA 4UF4A 1FK9A 3UO0A 5TISC 3PW5A 4OV6A 2HFNA 3AXMA 2C3OA 5KFZA 3WHCA 4ZMMA 3DRSB 3P9KA 4ZP9A 5F8HA 2HFUA 1IBLF 3DGPB 3E5QA 2OD6A 2W8LA 1HNIA 2UUCF 4BHPA 2HEOA 2UUWA 2P0WA 4O3NA 2BYCA 1HQUA 2CPEA 4AIKA 3GV7B 3OYNA 1JIHA 2G7HA 5A8KB 2ALYB 1Y3KA 4IEJA 2UWMA 4R0JA 4CO5A 3V42A 3DOMB 2V4QA 5CD4A 4U87A 1CJKB 3HSRA 3DDNA 5GVQA 3PIPQ 2B8QA 3HHLB 4XK8C 1AHDP 1WWHA 1VQSA 4CLKA 4DR7J 2OI2A 1C0TA 1F5CA 1EKRA 4QYZK 2HQNA 1BI0A 1OCTC 5DM6F 2GQQA 2JZYA 5F41A 2XMVA 2LEBA 2DO7A 2C3PA 1RWUA 2YNIA 1AROP 5F8GA 2B5JA 2JFDA 1APSA 2VA3A 1KS2A 4PABA 1KYWA 3WE3A 4NE9C 2DO4A 5D4NA 3EGZA 2VBWA 1MNDA 4WWSA 3HD2A 2JK3A 2R7VA 4FNHA 2VONA 2B9YA 1W2BR 3V4IB 3V81B 1RBAA 3FEXB 1SB6A 5E20A 1AKHB 4HYEA 3I0RA 1U1QA 3TX8A 2UXCF 1NDCA 3M1VB 1OISA 2K3FA 1FWZA 4KH1B 5E3AA 3IWZA 3TVYA 4OI6A 1WSUA 3F0CA 2MSTA 2X4HA 3FXRA 1E6VB 1QE1A 2VOOA 1HC8A 1WDTA 2HOAA 3VZHA 1RIOH 1PGZA 4YIRX 1TU0B 5D78A 5D5VB 1LWCB 4KISA 3ZR8X 5IP7J 3TZWA 5A6WA 5A8RA 4QOTA 2HWTA 2OPPA 4IF4A 3N5FA 1B64A 2CDRB 2DR5A 2O5DA 1XNQF 1MU2A 4IG3B 4G8XA 3M8SA 3MMCA 4EFAC 4N8OA 2O9LA 1YJNS 3PHTA 4BJ6C 1QA6A 1IZ1A 5L1LA 3HD1A 2CPDA 4HF0A 4UNOA 3UCZP 2YKPA 1WJEA 3PQJA 3BGLA 1HSJA 1YX2A 4FVMA 2EC0A 4ZJQA 5BYSA 2WW8A 1QVFR 2IDLA 2MB0B 4NC6A 4OHZA 2VT3A 2C3MA 4OWRB 1RT3A 5IT9Z 1HBOB 1JUSA 1R0AB 4Y2AA 1FTCA 4V1Ak 4RW9A 3WGIA 2WVFA 4ED6A 2J5OA 2E34A 3JRBA 3LPYA 2OP5A 3JQMA 2X6YA 1GX6A 3A0HC 4Y2KA 3CUQA 3RTRA 3KK2A 2PEBA 1MJ9A 2Q0OA 1HD1A 1TKXB 1XSDA 1X3UA 1XTZA 2HHSA 1ETWA 1YLXA 5KAIC 1IF1A 2BVLA 3ETOA 3ASOH 4XLAA 2WZ1A 4IJAA 2RS8A 4FBTA 4I98B 5C42A 1HFEL 1M1HA 4F8RA 5JVTA 2YR2A 1HLWA 1WFXA 4X4QA 2EWHA 2KHMA 2G0EA 2F6CA 3HSZA 4IG0B 5HQMA 8AT1B 2V34A 4RLEA 1N32F 1F4KA 2XC9A 3NBPA 1N0VC 3TOAA 1SH3A 1GVJA 1G2EA 4DUZJ 4Y15A 2PA3A 4BEHB 4RU9A 2HNYB 2MW8A 4IHTA 4PFOA 1P9QC 4DL6A 3IAS2 3ISZA 4OZNA 2IA1A 1KTVA 4B8XA 2NSCA 3H0GJ 4PR6A 3WQPA 3BSCA 1JNZB 1S5ZA 1PBUA 1NJZA 4KH0B 3DYAB 2K9QA 1NDPA 2HRTA 3DOMA 1BC8C 1K44A 2OZUA 3KP4A 4FYXB 5BR8J 2Y2ZA 3DDIA 3R8YA 3CIMA 2EZIA 4HX4A 3TQNA 3T1AA 2HWHA 4ZKAA 2VHGA 1A9NB 4JOMA 3VGUA 4F92B 1FKPA 1X4CA 1ZA2B 2V0NA 4CM0A 3D0HE 2KZZA 2YNFB 3JTPA 1D0XA 2UU9F 1M1EB 2E1RA 5BXIA 2GHPA 4EVIA 2HXOA 2OZ6A 4WFAQ 2WK4A 1FX7A 3GW2A 3K7RA 3ABMH 4WK3A 2K06A 1E0EA 5A2QU 3HHKA 4HHHA 4BQNA 3HFZB 3K4NA 2KJBA 3DPTA 2XY7A 4DUYJ 1R58A 3CCJI 3OR2A 4OHYA 1RHMB 4I99C 4AC0A 1R00A 2YH0A 1S5LC 4EUVA 2DOAA 5GADI 2P5VA 2OAZA 1MKMA 1Z91A 5CLSA 2C3UA 2H27A 3GLJA 3G73A 2AJQA 1BN5A 4GVBA 1R36A 5KFUA 2KJWA 5EEAA 4I0WA 3OHBA 3K2ZA 4ZN3A 4RW8B 2ZH1A 1HHSA 1F6TA 1LUJB 4B3OA 2CPXA 1DTQA 2ECBA 2KT3A 3CCLI 4RX6A 4LF7J 5EDWA 3A4TA 2ZJPQ 2AQ4A 3ZQLA 1KONA 3ZTOA 2G4BA 4DV6F 4PYAA 2NXNB 4V19J 1AW0A 4DR2F 4KFBB 3KTQA 3WODF 1GDTA 4HRIA 1QPIA 4OHWA 3D0IE 4UZBA 4Q45A 3FC9A 2A6OA 3J81Z 4CP5A 4C97A 4JYAJ 1NB2A 3NXZA 4C11B 3R5JB 1EF4A 4A3BJ 3T1HF 1R1VA 2OSQA 2P4WA 4JI2J 3G71S 2EIKH 4QR2A 3U1NA 3BH7B 1XGOA 4URQU 4ELTA 2D5VA 4E7ZA 1VRTB 2WTEA 3J7ZT 4MKBA 1N34F 2LKXA 1FYLA 1XDUA 3CPWR 1F9HA 3BG9A 1N56A 3BZQA 5LXYA 3GJTB 3PO3J 1HI0P 3FXLA 4L74A 2WBRA 1JT0A 2MZJA 1JLBA 3BKUA 3I0RB 1S0MA 3B6BA 5DCMA 1H2VZ 3M2RA 1IKWA 4PGHA 2L9VA 1TQLA 4B9SA 3O6BB 4NQWB 3CD6I 1NTCA 1PUFA 5DV5A 2WW4A 4I56A 2CJBA 3IFEA 1SD6A 2QQBA 2R2SA 5B66C 1X19A 5J1RA 3BWGA 3ECHA 5K9FA 3VV2B 5LLQA 4Y00A 3MM8A 2RF2B 5EJCA 1BI1A 1S9EB 4EK2A 1JLCB 3L2VA 4RGUA 4M5NA 2BXYA 1T0TV 5K7HA 3F73A 4YRVA 5M5XJ 1FKPB 5FD6A 4QBUA 2IA6A 4JI7J 1CGPA 5HDKA 3CMAS 1VQNS 5EG0B 2JA5J 5B08A 1ZTWA 3F8CA 3EM1A 3NARA 3HYIA 5FFXA 3K1NA 4GYGA 4USWA 3RBEA 2F4OB 1SPBP 1XGMA 5G0RA 4QWEA 1KU2A 4UV9A 4RW6A 2GAUA 2WOMB 1X4EA 2W9CA 2DLLA 1W5TA 3DTEA 2OFHX 3QT6A 1ZG3A 2MQPA 1SUQB 2EK1A 4OHXA 3VPRA 4EBEA 1LKXA 1RISA 3V7CA 2BW3A 1UHWA 1XIQA 3O3LA 1ZG5A 3B4MA 4BEHA 3PIPF 3PQKA 4KC5A 2I38A 3I59A 1G2HA 2M7AA 3EZUA 3P9CA 2PEHA 3EZOA 3UQSA 3LFKA 3CJ8A 2XAJA 2JOQA 2QQ8A 1ZRFA 4TYAA 1J0RA 3DI6B 3BR1A 1VQPI 5GMEA 5C4XJ 4QU7A 1KN6A 5IM0A 1WEXA 3LWFA 3M1EA 1XMKA 3ABKH 2RKIB 1MJBA 3DTIA 1LW2A 2R8IA 3L2CA 2WSEC 3OIQA 2DNRA 3MAJA 4AE5A 3SFUA 2XMUA 2C3YA 4IFVB 4GGGA 3VGSA 3TAPA 1U78A 4QIVA 4B09A 1LW0A 4ZLPA 3J80K 1R8HA 3ENAA 2PT0A 5CKTA 2ZO4A 2DKOB 4DNCA 5J1EB 2DDBA 3HRTA 3OYIA 3KZIC 4PQUB 4U8VA 3CZ6A 1BWVA 3TZZA 2H5JB 2LDUA 1QZEA 3DKDA 4PJMA 2VC1A 4DU7A 2ZJPF 3M3YJ 4CYUB 3PSFA 2ZB9A 1SCJB 1VHIA 3AY0A 2J9DA 1Q7LB 3LA0A 4LFCF 3BO4A 4QPQA 1HKTA 2DB1A 3SJMA 2UV8G 1UVLA 2E5HA 2EA4A 3FVYA 4U0YA 4ICLA 5HSPA 1GT8A 1RT5A 2UV1A 1UZCA 4N56A 2DN0A 1QTMA 4RW4B 3G6XA 4NCAA 2FEZA 2EVZA 4USIA 5KFLA 5LBQA 2F5FA 1YW8A 3DEEA 4IG0A 1KQKA 3Q5FA 4HI1A 3VYTB 4LK0F 1YRNA 1RKIA 2OSRA 5F1JA 4FXWA 1F3FA 1JLCA 2RD5C 2C2DA 3T5HA 2OIHA 1PYSB 5HNFA 5T41A 3H40A 2VQHA 4ZDOA 4J9OA 4OYWA 3MCMA 5KG1A 1S0NA 4KSEB 2LQ8A 2ILZA 2ADBA 5DM6Q 1ZZNA 4LT6A 5CYMB 1GFWB 1GXLA 3KMQA 1GNKA 4QU6A 4X4TA 3PFYA 2ACJA 1UEKA 4NOHA 2CQBA 1S1UA 2OEKA 1WEZA 3KMSA 4ESJA 2L9RA 2COMA 4MK7A 4WP9A 4XLEA 2QJ3A 4F2RA 3EICA 4RNMA 1HBMB 1IN4A 1RCOB 3HOZJ 1ZAVA 1XK8A 2CV2A 1D5YA 2KO1A 1ZGAA 1W26A 1RT7B 4PSXA 4ES2A 3CC7I 3CUNA 3QJJA 3QFHA 2OD5A 1R8AA 2IRUA 3LFUA 2C42A 2NXCA 2KZGA 2JRSA 3CQZJ 1WELA 3P45B 3IS9A 2F2EA 4EU0A 4MQVA 1BW6A 2YQ1A 4L3KA 1J75A 4O44A 2W25A 1FYMA 4PG8A 1I94J 1KEKA 1YWXA 3A1YG 1VQ7S 2UUAF 4DUZF 2YWWA 3VQSA 3G4SI 1GTHA 3P3DA 3LQRA 4KQZA 4X2BA 1RWWB 3CCZA 2VBXA 2QV6A 5DDRC 3PKMA 2BE7D 3LP1A 4CCOA 1YG0A 4YR2A 5DCFA 2YSRA 1TKTB 2L41A 5GP9A 2E1CA 3LGNA 1S7EA 1JNRB 1YZ6A 3M1CA 4LK1F 5FLXY 2A18A 1U8SA 5D5UB 3EUHA 5KAFC 3D1NI 2XGDA 4CNYA 5DLFA 3JRAA 3C2GA 5KFQA 2IEKA 3DI6A 4OI0A 3DRPA 1IO2A 3CJTA 3KXDA 3BOQA 1Z9CA 5D5WB 4MTDA 2YTCA 1X2NA 1ZYRF 5F8NA 1KKHA 3ZP5A 3H5RA 4NYPA 2MQMA 2L7FP 2GS8A 4UY85 1MBGA 2H51B 1RT2A 4CLLA 3C2HA 4KB7A 3A3NB 1CQNA 4RAGA 5DEQA 5D4PA 1XX5A 3RAXA 2CQ0A 3T5KA 5LFAA 2BE5F 5IZHA 2CPHA 4A8QA 1KGSA 4P5OA 2JJ4D 4YB1P 1RADB 1X1DA 1RXOB 3TL4X 2HG4A 2L7ZA 4A8OA 5C24A 4B02A 4DV1F 4HYKA 2FNAA 2BW3B 2OELA 3MM6A 1D0EA 3AFGA 3JSOA 5FIIA 4D5CA 2YU9J 4S04A 2HI3A 1N78A 2NS8A 3SI8A 2WB1A 2VUMJ 1YJ9S 1RHUB 3GUDA 4C3IJ 4UOCA 3JYTB 3QWLA 1OQ6A 1ZZFA 2DIUA 3PW7A 1WF1A 2RE1A 3JSPA 1RHQB 4O0NA 4HI2A 1FIPA 3EJMA 3MCZA 1HYSA 2GGPA 2RVCA 5IV3A 5BR8F 3CP8A 1VGYA 2V4JC 5DZ6A 2PN6A 2E71A 1FZPB 3FSIA 3ZOBA 1M5SA 3T5XA 3UDLA 4UTGA 3W2WB 3BR2A 4AWXB 3HL2A 4BWMA 3QU3A 5L3FA 4ED3A 2DH8A 3MM5B 4WE1B 2L7KA 2FJXA 3LSPA 3K70D 2ZUAA 3RKYA 5IC4B 4KNYA 2ID3A 2IJLA 3M8ZA 1S6LA 3FSXA 2WVDA 5C44J 4P2MA 2D9OA 4OX9F 2MDAA 1JT6A 1WORA 2B6AB 3H42A 3HPOA 1GLNA 4JI6J 3D9BA 5BOXA 2YNHA 4CHUA 1T03B 5F1RA 1DTTB 5F0FA 1IUYA 2ZJQF 3TO9A 4P9SA 3OSNA 1X4PA 2XKOA 4C8NA 3S3NA 4LIVA 3G8SA 2UUZA 2IAJB 3Q86A 1FKAF 2D2WA 1HBMA 2GJIA 1XMXA 4J90A 3RKWA 1ZHFA 3GCMA 3BQ2A 3G1MA 4F0HA 5LMUJ 3W8PA 1NHVA 1X5TA 2A6HF 3QPTA 4PXBA 4Y34A 5HMWA 4PWWA 3R2CJ 2V8GA 4BCAA 2BV3A 2ZBPA 1ACMB 3QZ7A 1KC8T 4RBVA 4I6YA 2B5JB 2LKZA 1FRIA 2N7YA 1OY6A 4EQQA 3ZMDA 1CSJA 2RJZA 4PWDA 2VG5B 2KYXA 5J1NA 5T7LA 3JSMB 4KICA 3CIZA 4RLFA 2FMYA 4K5RA 2MZSA 1H7WA 3R5BA 4HTIA 4TNOA 1RT1A 5GMDA 4DMZA 3D6TB 3FCVA 1BJZA 5H2FC 2LP4A 5LEJA 5C24B 2J0SD 3LSKA 3SSRA 3AD9C 1V5GA 5IQQA 4EGYA 3HSFA 2CDQA 2IA0A 2CQPA 3NEKA 3IA0A 2CYYA 5HROB 5B5EC 5DQHA 4BGDA 1TAQA 4AFFA 5FLMJ 4ES1A 3FK4A 4MLOA 1GEHA 1IRXA 4RNFA 1U9NA 3NMAA 4JI1J 3PACA 3LPEA 5A0YA 1XERA 1FVQA 3KWMA 3CP2A 1RKTA 3SCJE 4CXFA 3JCUC 1NZAA 2HKXA 1RI7A 2HNHA 4NLOA 3QGGA 4MNUA 1XTAA 2EG2A 5IT4A 2Q2EB 3A13A 1FJGF 2CW7A 2YWEA 3QRQA 3CCVI 3UD5A 1RU1A 2RDDA 4HDGA 5E41A 1SV5B 2L48A 1T33A 3T0YA 3MGJA 1N32J 3QFWA 3IR5B 2W48A 4P10A 1UHSA 3KLEA 4XLCA 2FE3A 3H3UA 3H3VK 4IR1A 3FJ2A 4D7MA 4KGXB 1WVRA 5CJ9A 5BS6A 1VQ6I 3CJRA 3E6CC 2HHUA 4I1TA 1NK6A 2AYMA 1TK5A 1CJTB 1FF2A 3U27A 1IXCA 1FRXA 3KUHA 3J81Y 3L2QA 4QZVB 2DISA 2VQFF 1MH4A 2O1PA 2X0LA 3EGVA 3JS9A 4JP0A 1K6OA 3QIPA 2HTSA 1MBFA 3NNAA 1CF7B 5GPCA 2YWKA 1L5UA 4KTQA 2H4YB 2XQCA 1U47A 1HNZF 2DODA 4KAIA 5A0YB 3MZ8A 4JK1X 3FFIA 3L95X 4HBLA 2I9SA 3IAM9 2FOKA 2Y30A 3I0TA 3EVOA 1RABB 1W25A 1N36F 2GA7A 4J7CA 1UCNA 2Y31A 3ZZZA 5LRRA 4IKAA 1N6QA 1U2WA 1HW9A 3KP6A 5EG0A 2RREA 3A8IA 1RQ0A 3WU0A 1S4EA 1NSKL 2AGQA 4ANJA 4MFEA 1UA0A 2O8KA 4O3OA 2DI3A 5SZTA 1DURA 4ZJZA 3TYTA 2WVCA 2W57A 4I76A 4KHMA 2VA2A 2VE8A 5E2QA 5A6PA 3I0SB 3M8JA 1XJWB 2DMPA 4EBDA 1ZELA 3IG1B 4K0KF 3CF5F 2HVQA 4LF7F 4XMYA 2JA7J 1I6JA 1RHRB 5FDLA 4CLUA 2DR6A 4R8UB 5K1YA 3TOQA 3RW7A 2IS1A 2NXNA 1SIZA 3M2UA 2MGZA 3CJKA 5A8WA 2E5NA 5THWA 3C15B 3H8YA 1HA1A 1KDNA 4XSZF 1P4WA 4RGRA 2MYFA 4OI4A 2JX2A 1DPUA 5DM7Q 1V4RA 2OKQA 2HFZA 2V67A 1MW7A 3HX9A 5M2RA 2VG5A 1LXNA 1CS4A 1B3TA 3FXKA 4UUSB 1RA6A 1XCBA 3LAJA 1SFUA 2KM8C 3LSJA 4G6QA 4J9KA 3G86A 3I87A 2X1DA 3R61A 1G3TA 2OAUA 4C8LA 4JI3F 2UXBF 3NAHA 4FE7A 2Z99A 2KM8B 2QE5A 3X2QH 4YOEA 3SQNA 4DYRA 4ILLA 4DYQA 3HUGA 2ASJA 4DS5A 1BL0A 1A6IA 2BJ3A 2KB2A 1BGXT 4DZ6A 3MUTP 5IWAJ 2IBOA 1OPZA 2GGPB 4PJNA 1VFCA 1DTQB 2Q6BA 4DV3J 2LCWA 3QGIA 3DU5A 1SXLA 2DJNA 2GJ2A 3ZC4A 5J2NA 3C6TA 4J19A 2H1LA 3QYFA 1KVIA 2L0KA 2OQRA 2HQDA 3HVAA 4UUXA 2JVOA 4QPTA 4D1QA 3HCXA 1SL0A 2E66A 4LSNA 2HYIB 2E29A 5JVHQ 2D7SA 3OFHA 2Y0SA 1FT8A 2R3VA 1Y8QB 2DGTA 2FY8A 4Y3CA 4EZ9A 3SXLA 3BY6A 4BQOA 4IRHA 1QZYA 2K7KA 3MQ0A 2FD5A 2MBFA 4YFXF 3R97A 1S29A 3SSSA 3PUFA 4ZP6A 4RZRA 5E3RA 5F3ZA 2FVSA 1FBSA 2K3IA 1SEUA 4DR6F 4JP8A 1C0WA 3ZGKA 4C98A 4RLQA 4ECZA 1FJEB 2JA8J 3FKJA 2J9EA 2QQ9A 5M2PA 4ECXA 3HXMA 5D3GA 3H36A 4EJUA 2DT5A 1FTZA 2VT2A 1MSWD 5CXTA 1IKYB 1KHVA 2XWXA 3I55S 1REVB 1QUPA 5H9EK 2BJ1A 4DV0F 4LF5F 2IIHA 4MK8A 3TZXA 4NA2A 4QYRA 3MKLA 2V2QA 4ECYA 5LHHA 2IS6A 3G82B 2EIMH 2MH9A 3TBIA 3R27A 3QOPA 1DLOB 2FXAA 4DJAA 2Y3YA 2PI5A 3CJ4A 2PFFB 4ENKA 1XMAA 1D0YA 3K17A 4WF2A 4WKYA 4EJVA 4JI4J 5HLTA 1V9OA 3QPSA 1ETVA 2BKPA 2R7QA 4LB6B 2ZOFA 5IOLA 2QLXA 1ETKA 1FJ7A 4BYYA 2UVVA 2FZGB 4X4VA 4CIOA 3FXJA 2DPJA 2J6TA 4RBOA 4EZ6A 1HW8A 3I5BA 1TMJA 4IHSA 3NCRA 2LY2A 1EAYC 1Y0HA 1RR8C 3PSIA 2NNNA 3QGHA 4A3IJ 2FPHX 3CCTA 2A2CA 2VBYA 4ZTJA 5BYQA 3EPZA 3ENWA 4FKYA 3P49B 5FRMA 4HX8A 5F8MA 3DCAA 3TEHB 4DR1J 4ZLNA 3U9GA 1FD2A 1X4AA 2IPQX 2HK2A 1RWOB 4NB5A 4ALZA 5F0UA 4OIQF 2XYPB 1J7KA 2XS2A 2IYIA 1JXVA 3RPUA 1FDNA 4TLRA 2QGFB 2CW8A 1FTTA 4G7OF 1RBOB 3R6GB 1PP7U 2VFRA 3HUGB 3CNQP 1MWQA 2CUEA 1VQ7I 3ERED 4M9SA 1U1LA 3FM3A 2C28A 1DGRM 1VBKA 4X1EA 4QIFA 3GTMJ 1XC5A 2XAFA 2CUFA 1GT0C 3GB0A 3OJUA 4YR3A 2XI3A 5I3UB 3UN2A 3Q89A 4BXXJ 3K57A 1C1BA 3ISNC 2L9DA 3HHLD 3VTIA 1IBMF 1YRXA 1WKKA 1TL4A 4FISA 3OV8A 4KGMA 4XICA 4H4KA 2RQMA 3UD4P 3IR6B 1I6XA 1OYWA 3KX2A 3F21A 4L9VA 1LFWA 4ZHRB 3BT9A 4H4OB 3A03A 3L9ZA 1FEXA 3I96A 4U88A 3HOXJ 1QO0D 1UJ6A 3PRDA 1VQ8I 2DFIA 2PMUA 4M9XA 2HU9A 4HV6A 1HQ2A 1V5IB 1IR0A 1QTNB 1RRJA 4RL1A 3KPHA 4U6PA 2IM3A 3KK1A 4BAYA 3V4IA 3V81A 1MH3A 3VAFA 2FUG2 3F22A 3I0SA 4X66F 1UWBA 3S17J 4YDXA 3F6OA 5K8OA 2DCLA 3I4PA 4H4KC 2JHEA 4ZLJA 3VAMA 3MURP 3GIRA 1YJNI 2NPIA 5K5OA 4XKVA 4MKVA 2E19A 2FLNA 1QDUB 4L3NA 2IVFB 1UETA 3I64A 3QQCD 2ZE2B 5F0HA 4FETA 1WRJA 3F8BA 4F91B 3FFIB 2A0FB 2DA3A 1QU3A 4GVBB 3R0AA 2W7PA 1RYRA 9ANTA 4DBRA 4KITB 1VNDA 2FJDB 3J7YI 3GE9A 4RGXA 4FYWB 4UUVA 2VF3A 4E98A 3KYLA 1UTAA 4KHPJ 2MZ1A 1I94F 3MI7X 3W2VB 4FQGA 4R79A 4KFBA 2ZC3A 3F8FA 3PO2J 2N82B 4ENNA 5KFEA 2M52A 5F04A 2XB5A 4N77A 1LWFA 3F72A 4KKOB 4XDDA 1DQAA 2UP1A 1BI2A 2OTJS 3GFIA 2NVUB 3GU0A 1PAUB 4URGA 3L3CA 2RIJA 5LM7E 3W61A 3IWFA 4A12A 2W84A 2CNLB 3LALA 4FKXA 1R4NB 5CYJA 2ZBIA 5L3DA 2BX6A 2QC3A 1XMQJ 1XQIA 4L6V3 1Y39A 1LE8B 2DD8S 4M95A 2E1NA 3FMRA 1H88C 1OSCA 2HFHA 3RJMB 2GAGC 1YHQI 1WUUA 3CO0P 4XAKA 1X4FA 1SKSA 4O4GB 1QSSA 2ILYA 1U8WA 1Z67A 1TL1B 5EEGA 4QIWN 4ZCMA 2K9NA 2Y0MA 3J7AN 5GMKa 3LWMA 1SKWA 1X4HA 2B8PA 2I10A 3QMQA 1SMTA 1JI8A 4IH6A 3VAJA 1N36J 1WSRA 4I2QA 3J7AY 5KFVA 4ECSA 3UD3P 4OZ2A 3DLLF 1TZLA 3KETA 1B8IA 1C1CB 3TDUC 5D4SA 2XGQA 4A3FJ 1KWMA 1JWWA 5KFJA 4S0HB 4WFYA 5HLFB 2EK5A 3S8SA 1WHUA 5DUIA 4DV2F 1UMJA 4Q2MA 1UMQA 3SV3A 1I51B 3V8JA 2OV7A 4ZVPB 4GC6A 3GILA 1DUXC 3FXOA 2ZXHA 1KSPA 1PIEA 4P71A 1S9HA 3OY9A 3V8LA 4EEYA 3JSMA 3CJQA 4BH9A 1FPQA 5K5RA 2LC2A 1S3JA 3W9HA 3VYRB 4AXJA 4TY8A 1P1LA 4OIRF 2XI2A 4RUHA 5DM7F 4HTJA 4ITSA 3OSPA 5DDQC 3R60A 2DU9A 3LSTA 2EG1A 4PG5A 1FDBA 3GFYA 2M0CA 3CMMA 1Z3YA 1Q7YT 3TMOA 3HHEA 4X4SA 5DRKA 3K89A 3KG1A 2FGCA 3KUEA 3CDBA 3G2BA 1HWIA 2VJVA 2ZFWA 1MMDA 3M8FA 2X1GA 1B7FA 1G1XA 2E5LF 4A8SA 2DEIA 5HAOA 4L0ZB 5DG9A 1NH8A 1YW9A 2GIFA 4OLPA 1B6AA 3S2WA 3R5AA 2Z1DA 4PZJA 1E3OC 5KFGA 1RTJB 4JI7F 1PCAA 1UJ4A 3S14J 4HW0A 4FF4A 1O57A 4PXCA 1SVDA 4ED4A 4BE2A 1UELB 5TGTA 4WP8A 3H25A 2BGCA 1UVNA 1RT7A 2DA7A 4X6AJ 4DLEA 1IWGA 4U0VA 4RJVA 2E44A 3V2UC 4TYBA 3ZZTA 1KNZA 3QOEA 2YQ3A 5HOOA 1T38A 2PMZD 3E97A 3HULA 2U1AA 3WTXC 3IKTA 1RWMB 4OIPF 3R6SA 4MT1A 1LV5A 4K7QA 1TKZA 4E6KG 4YY3F 1S72I 1C1BB 2HMIA 3ZTQA 4EJTA 5I4MA 3PZPA 3KP5A 2NVXJ 1FX2A 4HNTA 4P2XA 1Q81T 1URRA 3WGGA 2E5ZA 1OYIA 2ZCWA 1NZ8A 3PEJA 2WV0A 4BY7J 5FB2A 1JLFA 3W8GA 2PGCA 2MQOA 4LQ3A 1R5HA 3R5CA 4FDFA 4NCGA 1KFSA 2G9WA 4KFCA 4CO4A 3QP5A 1IBCB 1OFCX 2AJ1A 2MD0A 2P9CA 2FJEB 4A6DA 5AXMA 4DG1B 4IDKB 4YDDB 5HLFA 1NM2A 4KIFA 2FQQB 4QIWD 4YELA 3OW2R 1B0VA 5DZ7A 2HHWA 3OBIA 2VXZA 2QMUB 1O3SA 2DT9A 2YNGB 4QW8A 4OAYA 3K4BA 3CJQB 1RACB 3IBWA 2GIZA 1IBKF 3H5XA 5E17F 3P5BP 3TQ1A 2CPFA 1HQUB 4A3MJ 1EARA 4WYLA 2W8KA 2LOOA 5JLWA 1SFOJ 3KHLA 1Y6IA 2JPCA 4Q0BA 2HEKA 2M3AA 3BGUA 3GG1A 1Y8RB 3BSAA 1NJWA 3L1PA 3M6UA 4W4MA 4M5GA 1ZR4A 4AYBN 1EIYB 1G6BA 2P81A 2FF4A 2E2JJ 5EHHA 3EUAA 2EV0A 4UVAA 4I2QB 3ZTSA 1N52B 2DH9A 2VN2A 2F4VF 4DR1F 4ZDLA 2G0IA 3N79A 3QODA 2TCTA 3LSGA 4HX7A 1R71A 4I7FB 4Z7YA 5M2UA 1M5VC 2ZZMA 1QAYA 3V8KA 4ELVA 3N4WA 2AYBA 2GMLA 3CJNA 1USTA 4WJBA 3RPQA 1LQ9A 4CLPA 1H6KX 1R9TJ 4NDLA 3LGMA 2Y0SD 4TY9A 2LR8A 2V5HG 3H1CA 4C2MJ 5F8LA 3OVBA 4PDKA 4JV1A 3R7SB 4C3JJ 3C14B 2DQRA 1T3NA 4LG3A 3LOUA 3HKZN 1FLIA 5KFBA 2KRCA 5KFAA 1HWKA 1LPQA 1V5VA 3VWSA 3AJ1A 1E3PA 2V7FA 4WU3A 2HNZB 7FD1A 4DV7F 2QFIA 1QSYA 2DY1A 1TL1A 1EB0A 4J9MA 2EH3A 2IS2A 3HB9A 1KLMA 4RB3C 4C0HA 2EBGA 4AIDA 2L4AA 1MNMC 2PJRB 2GOMA 5GAEJ 5ILUA 1HWJA 3GFMA 4C9YA 3K4CA 3OTOF 3C46A 3OYLA 1ON1A 3M6VA 1OY8A 2VPZB 2Z2ZA 5J2QB 1WH5A 1RAAB 1H7XA 1WJAA 1WC5A 2R0QC 3W9IA 2MLGA 3QYBA 4ED8A 1SUQA 5HANA 2LY1A 3E6MA 1O7LA 3S32A 2M8DB 4CZZA 4Y52J 4RB2C 1HW2A 4WBFA 4LFUA 1N0UA 2B63J 4RAFA 1FFWB 2GVZA 4TKTA 2K85A 2JUCA 5DG8A 2W4DA 1PJ5A 1SAUA 3KZZA 1S9GB 2Y8WA 5JR3A 5DDOC 5ED4A 1X5PA 2XY6A 4PFPA 2KN4A 2D9PA 2E7XA 1LFPA 1IBKJ 5B3SH 3K5OA 4UOFA 3MF5A 3PY8A 2QL5B 2E9TA 3BG6A 4ZYGA 1P92A 5FLXZ 5ETMA 5HJYA 4DL4A 3MEDA 2COBA 4BBYA 2D3UA 4B08A 4O44B 1X9MA 5AIPA 1PILA 5F0WA 1FX4A 2XNRA 2NNYA 4NXMJ 1YIOA 6PAXA 1Q53A 1ETXA 1MG7A 4F26A 1JJ4A 2BJ9A 4HV5A 1T11A 2CG4A 4C8OA 4WK8F 4XR6A 2P7CB 5LEKA 1TMMA 3I9ZA 3CCMI 3K4MA 3H5UA 3D66A 3DXJF 2D41A 3DRRA 2ASLA 3Q8PB 4J9SA 1OR7C 5D4LA 3LSMA 3BR5A 1JX4A 5CVRA 2O01C 2XPVA 1J5EJ 2W4SA 1D8YA 3VGVA 3GIMA 2FJBB 2DA2A 4A8MP 3G8QA 1TTYA 3KNGA 4GRIA 1EH6A 3CCES 1UW9A 4BHBA 3CMYA 1YBTA 3E51A 5LSLA 1WG4A 3ZN1A 5LMNJ 5IWAF 2W82A 4FP9A 4DV4J 2DHAA 2Y1JA 2VIXA 1Q4RA 3HTSB 2HQFA 2WC2A 3BR3A 2ZD1B 3RYRA 5CVVA 4NZ6A 1OR7A 1HNVA 4ILMA 4OIOF 1T03A 1BLUA 2XS7A 5FFZA 2OTJI 3JW4A 2EW9A 2OH2A 2M5WA 3EWGA 4KIBA 2ME6A 1OKRA 1RWXB 5KNLA 4JI0F 5HO4A 2DOEA 3NEUA 4CLYA 4K8RA 3H9QA 3GX4X 3GR1A 2RUSA 1T6SA 3K8VA 4C3LA 4DQPA 3T3FA 3EYIA 1Z4UA 1IRGA 1R1TA 3TARA 1U1NA 3JSYA 3K5NA 5CYQA 2N8GA 3M4OJ 3J80Z 4B9MA 3DRSA 4GMKA 5KFDA 4FYYB 2F5CA 4CLSA 3MM6B 4E7HA 3HKZD 2OEJA 4ECTA 3KK3B 2PC6A 2ZBRA 2R93J 3OUYB 3T6JA 4RO0A 1N88A 4DL3A 2AGPA 1Q82T 3JQKA 1PAEX 3K59A 3ZQFA 1H72C 1K83J 3EQLF 2ICWG 5HVGA 3E0JB 2DMQA 1REPC 2CUZA 4TU9A 1ETOA 2HRUA 3M9OB 4M3BA 4L75A 4OX9J 2E1MC 1OJLA 4GKKJ 4PUSA 2VJUA 2NUHA 3W64A 1MJAA 2L4MA 3QAUA 5F3TA 3BV8A 1TT0A 2HHXA 2H6BA 2KL4A 3H98A 2FHJA 2DNYA 4C48A 1OPCA 1YRTA 1J9IA 2B7BB 4ZTFA 4QWDA 4PRFA 3JRIA 4JI4F 1I3AA 2ZMEB 1YFHA 4ZPDA 4DOZA 3F6VA 4Q48A 4WZQA 1RT2B 1ZPVA 2X1FA 2A61A 1VQLI 2V9WA 3OIOA 3JRGA 4ECWA 5CQEA 3MXHP 3US5A 2LMDA 2EBIA 3MAAA 3CDHA 4F3QA 3MPVA 4Y33A 4I0BA 2GA1A 3DM2B 4CLZA 5GTIC 3HHNB 1D0ZA 3PX6A 1MBKA 4B3MJ 2R5ZA 3CMQA 5BNGA 4A3CJ 1RGVA 1H0HB 2H3EB 4I68A 5H6QA 1IWAA 2CQ4A 2JLFA 2TDXA 3MN2A 1XBWA 2L2OA 1OIAA 3OYFA 2VICA 2RAEA 4I7HA 3D1HA 5E8GA 4FE4A 1YVFA 1DY3A 1FNOA 4CLFA 3JQJA 3KP2A 4JV2A 1T0FA 2WAQN 1KLNA 3Q83A 2VPLA 5HVQC 1DBDA 3EUNA 2ZVIA 3KG4A 3W6JB 2Y9HA 2BE2B 1FXDA 3DHWC 2F5DA 4MIAA 1JJ8C 1JLBB 4HDHA 2G2ZA 2RDIA 4NEYA 2G1HA 1U2CA 2C2KB 1HQCA 1ZK8A 2A68F 2BXZA 2UV8A 3F8NA 2JTVA 1HDDC 3S15J 3H5NA 1ZM4A 3E8OA 4RBUA 3PIOF 3QNWB 4J37A 2R4GA 4IRDA 2NXJA 1VI0A 3NCQA 2CPZA 5A2QY 4WP3A 3NAUA 1IDYA 2NOGA 2MH2A 3FEZA 5KFHA 4P9UA 1D3WA 3PX4A 1NPPA 1ZARA 2XLIA 1BD6A 4KYZA 1SFXA 3I53A 2KHDA 4JYAF 3H9GA 1DHMA 3DEUA 4A3KJ 2RUGA 4A0XA 3RQIA 5E8IA 2M34A 2RQCA 2JEGA 1S6QA 5AE3A 1P7IA 1X5SA 2KRRA 1UKUA 4M6VA 4J9LA 1AWCA 5KFSA 3VSLA 2NLWA 2VFVA 3KHGA 3BM7A 3SZ2A 1ITPA 4ZZLA 1B0TA 1AB8A 2YKQA 2O5RA 3SEOA 4A8YA 1N4LA 4F4WA 4RW8A 1SVLA 4Z7CA 5C4JJ 3OYAA 4X66J 1LDJA 1DGWY 3TW0A 1KQGB 4F52A 2G13A 3D2WA 5LGNA 4HLYA 4WU2A 1UA1A 2I8DA 3R7NB 5KT5A 1RESA 1W36C 2LH9A 1SI9A 2J6SA 4XRMA 2ZFUA 3CO6C 3V6KA 1RNLA 3GXOA 1VJQA 1RWPB 3N9UC 2CUJA 4BHCA 3MZIA 5DDPC 4BXUA 2KG1A 3U1KA 4X4OA 1SJ4P 5IOYA 3F44A 4OMYA 1V5EA 1KZHA 2W1OA 1HKAA 1ZBTA 4B9VA 3CMEI 1RT6A 5FLVA 2OMOA 1ZH5A 2DRBA 3FBNB 1B9NA 1SV5A 3LQVA 2HVZA 2D1VA 5IP9J 4G65A 4B4CA 4LR8A 5AE1A 1T9YA 3F8MA 2DXDA 3E01B 3BDEA 1VC6A 3GFXA 2BM1A 3SCLE 5D0EA 5HP1A 2IFXA 4ERDA 3TNVA 1U24A 3ICLA 5E3PA 2VL8A 2RN7A 2RH3A 2C2ZB 2EINH 2IYGA 1MLAA 4ZCIA 4Q5VA 3DOKA 4I02A 5FD1A 1WD6A 3GTQJ 4YFKF 5JXSA 4NASA 4KDPA 1WNEA 4MK9A 5K14B 5BMZA 2CWKA 3CTAA 4DW6A 4NYOA 3QPHA 2HVHA 3HT0A 1LK7A 5D6GA 3TAQA 5G4DA 5CVIA 4RB0A 1D5VA 1XMOJ 1FKOB 1B70B 3HHLA 4CNZA 4BDYA 4I4BA 5D4RA 1ETQA 4ZOSA 2W1BA 3AAFA 2EPFA 2J7WA 2IVMA 3KDOA 4U67Q 5ETKA 4B3SF 1H89C 2E1PA 3PR5B 1FA0A 5IYBJ 2AQEA 4DX6A 4DGWB 1N5YA 5IYCJ 2LP0A 2OJED 2DCUB 1DARA 1VQKS 2C2EA 3T41A 4UUTA 3JAMK 2IP2A 3R5GA 1XDSA 3IM8A 1LXJA 2Z30B 3FK7A 1NUEA 1XWLA 2KT5A 3SYZA 5LL6d 3P5JA 3HM9A 1M5OC 4NCGB 2KRHA 4MFBA 4LRBA 4B3TJ 5IPAA 2QEXS 2KG0A 2UXBJ 2R5YA 2AHOB 4LMZA 1BMQB 3CCUI 2NYHA 3UDCA 1UFMA 3CJ0A 2YNGA 1S1UB 5DD8A 1S76D 1HQEB 3FQLA 3S1RJ 4C2UA 3ZZ0A 3MWMA 3C8YA 1K9MT 4DSKA 3VAKA 4FF1A 2MTLA 3PM9A 3UN5A 1UPPA 1NK9A 2CQKA 3GWCA 5KG6A 1FWLA 4DV3F 3GTLJ 1PYVA 2W9BB 4L5IA 2JA6J 4EM0B 1BQXA 2XIGA 2DY9A 2LG4A 5ILVA 5L8RC 2Y1IA 5EDNA 3BBCA 4RNHA 4XIUA 1OQYA 1CBKA 3DHXA 3G2XA 5ETSA 1C2PA 2V4JB 5FKMA 1X9WA 2P8TA 3VAGA 3DLEB 2VQGA 2IA2A 2LA6A 3K4KA 1S6QB 4F2SA 1TP4A 3VQTA 2CVEA 3NOGA 3QRFF 1GV5A 2EFPA 1CJVB 4V19X 5KG5A 1RT1B 3IH4A 1DP3A 2CQGA 2XO6A 4Y17A 2B4OA 2ZJ2A 5E1WA 4LF2A 4CLTA 3MM5A 5EWEA 1NHKL 3C6UB 2B9EA 3MPDA 4PUOA 1X4OA 2GIRA 3M8QB 4PK4A 1RA7A 1WC4A 3GBGA 5KT2A 2BE2A 1GQEA 2G1DA 1NHAA 4HPQA 2ZMEA 3JTHA 2RDJA 4O5VA 3CCMS 3LA7A 3SCIE 3NGSA 3CEDA 2FVPA 4XKCA 1IN0A 2BABA 4WXOA 1FOYA 5L46A 1K1SA 6FDRA 3CLQA 1UJ5A 2GXBA 2BV6A 5IP6A 4ED2A 3WTWC 4ZK7M 1LEAA 4NCBA 3GTPJ 2DGSA 2V8VA 3NMRA 2D3OR 3TUIC 1F2HA 3HRMA 4HDVA 5EGOB 2UXNA 2AZ3A 2VJ4A 1B72B 3SCKE 1DZ5A 2HQCA 4ILRA 3ETMA 3D1QA 5F0CA 4DFMA 3MMBB 4XNFA 4NHJA 5KT4A 3VALA 4LG0B 2Z57B 2HNDA 3J7YU 1CC7A 4O0IA 3DP7A 4AYBA 2ACMA 2YY3A 3GO5A 4P74A 5J2QA 4HH0A 3DOLB 3GTGJ 1UJ8A 2AV5A 4MO7A 2MKCA 4S05A 1WTFA 1F5TA 4ZPTR 3ZTPA 1VZ0A 2Y75A 1FERA 3DXSX 4R25A 1F2GA 2HNYA 3GTKJ 1FEEA 2WB1N 3DDKA 4DV4F 5MAOA 4IFYA 1BQNA 2XAHA 2DXIA 1QM9A 1NAQA 3DOKB 2RGVA 3K1PA 2RU9A 2BQRA 4PSWA 1W1WE 4XL9A 1GMWA 3BO3A 3FX3A 3PJ9A 2MABA 2FYXA 1LEOA 3RAMA 3FWEA 5HROA 2F7VA 4CYCA 2DHGA 2R9LA 2JDJA 2ZKUA 2ERRA 3RB0A 1R1UA 3SDGA 3MTJA 3HJFA 1REGX 3NWGA 1K8AT 2PIIA 1GK8A 2FBIA 3GSIA 4EBCA 2LY9A 4O23A 3IH3A 2V26A 2DMUA 2M7SA 4JI2F 1ZYQA 3U1DA 3CD5A 2J0WA 2ZDOA 3V6DA 3O8HA 2QSFX 3TAMB 3IRXA 3UW1A 3FEYB 4ZJOA 3PVXA 4LF6J 4AYBD 2Y8YA 3GIIA 1PKUA 3S16J 2LKSA 2GW8A 1SC6A 5G0RB 1WI8A 2RRAA 4XPCA 3MM7A 4B9NA 3RUBL 2IJRA 1VQLS 2QX0A 3BQ0A 1B7YB 1YJTA 4A0YA 4RM3A 2ALZA 3M2RB 3WTSC 2ME0A 2KHCA 4RBTA 1ZLKA 3AOAA 3RDIA 1SD4A 3CCSI 4BACA 4XDCA 1XR5A 5HS9A 1V6HA 3M9AA 1NG6A 3OYJA 3KHHA 2YH1A 5E1ZB 2K3PA 5DYMA 4OHVA 2LSOA 2ZE2A 2ZJRF 3KIOA 3G3ZA 3ISND 4ZP8A 5E18F 1ON2A 2A69F 2H65B 1RWNB 4I64A 2KVIA 2VB6A 3J81j 2FQ4A 4MIMA 4IQJA 1S7AA 1G3OA 1JLQB 3UKGA 2YVSA 4EM1A 3GFJA 5FLXK 1MZBA 2B0GA 3GQCA 2QKLB 3GSDA 4ZVHA 3QPLA 4X84A 4UB8C 2LEPA 2OUGA 4CT9A 4EMSA 2K40A 2PFDA 2W00A 1RHJB 1GTEA 3RZAA 3CCSS 3WTVC 5EN1A 1VRTA 3UN3A 4DEZA 3N01A 1XS9A 1FMVA 1MMSA 3GV8B 3IWNC 1FXLA 3TOBA 3RRKA 3JAMY 4IKFA 1KQ8A 2BE9B 1A0OB 1TR0A 1FRJA 4D5FA 1TQMA 2DNKA 1Z1ZA 3H5YA 4AL6A 2IC3A 3E3VA 3OL9A 2Z2MA 2XAQA 4O6JA 4YB7A 1HW1A 2VG7A 4KT5C 4ZDPA 1CLFA 2L54A 3PXGa 3MECB 3JRHA 2EILH 1OSDA 2XM3A 3M7VA 2CUYA 1VQ4S 3WHBA 2ZBCA 4D7NA 3Q8SB 1WJFA 4HEA9 5HMYA 4CO1A 3KEYA 4EJOA 4M74A 5A76A 5I42B 2EFOA 3KP7A 1PDNC 4ES3A 2Q1ZB 5CPRB 4HACB 3BP8A 3D67A 2L3DA 4RA2A 2ZH9A 5A8RB 1D8JA 2DTRA 4DUYF 1SKRA 4PQUA 1RP5A 2JWTA 4YEAA 3DM2A 3CB4A 2MMYA 2LXIA 1C0UB 2XSJA 4MFBB 4F55A 2AJ0A 5D8HB 2CXEA 2CJJA 1P4AA 4EO8A 1SJQA 4Q43A 3V6DB 4N9HA 1LWXA 4M1KA 4II2A 1EETA 2NVYJ 1BQNB 2MKIA 3ENVA 2YPYA 4M8LA 2HQ3A 1XR7A 1DRZA 5J6XA 1IGNA 3EMTA 2EWNA 1BUXA 1HYSB 3MOJB 1Y0NA 2XAGA 4BJ5C 2DGXA 2XSDC 4OFZA 5DLGA 4CZCA 2VLAA 3OXFA 3KLGB 1NHUA 4OZLA 2Z56B 3M30A 5CA5A 1CJKA 5HN0A 3Q8QB 3KYDB 3DU6A 4ZVQB 1K7AA 1ZM3A 2KFZA 4YS2A 2FY1A 3H92A 2F40A 2FBKA 3E5UA 3E01A 2WONA 2O3DA 1UZDA 2GMHA 2YNIB 5D8LB 1WWXA 4LLLA 4EWTA 1SJFA 1G3WA 4EV0A 4A3JJ 1T9WA 2XMKA 4KGVB 2B51A 5DGBA 1V3SA 4QTRA 4IHVA 2B43A 1KD1T 4L9NA 5H6RA 2U2FA 4HHUA 3QWUA 2XROA 2O61A 3LF0A 4KKOA 4LF4F 2NAZA 2Y69H 4N5SA 4CYDA 2EA2A 2PQ8A 3DOLA 3PO5A 2VD3A 1HNIB 4KUMA 4KN4X 1N77A 1KQSR 3BG5A 1MN9A 3EE3A 1VC5A 2CO5A 3NGTA 4J01A 3MEEB 3TJ8A 1IJFB 1U02A 4GKKF 3TA2A 1KFDA 2VQFJ 4LF9F 1SC1B 2IC3B 2XPWA 1S1VA 1JKQC 4DL2A 4BBSJ 3OR2C 1VK3A 2NZCA 2C22A 3EDQB 5KG7A 1K79A 1TL5A 3CJTB 3LA3A 4UY8I 2EJRA 2WWYA 2MKHA 3BCBA 2DK2A 2MLKA 3OS2A 4ZPWR 4X65J 3AD7C 3M8PA 1YG2A 4M5KA 5KFIA 2VFSA 5KCMA 3O6QA 3SDEA 4IL6C 4M5IA 1SC4B 4GO7X 2OPQB 2AJ2A 3DLLQ 3CT9A 3NY0A 3S1TA 3TRGA 2M4KA 5C3EJ 4ER8A 3QGPA 1AUDA 5L1IA 2XS5A 2CJKA 1YTYA 4J9RA 3GP9A 1IQTA 3BTJA 2YWHA 4OU0A 2HGCA 5I3PA 4CH7A 1X31C 3HOTA 1WTBA 2WOMA 1IN6A 4OI3A 1YYVA 4ZVUB 3NP5A 2ELKA 2JVHA 1IUFA 2CS3A 5B0GA 2DK8A 1X0PA 4WTOB 4LQ9A 2P9GA 4ANEA 3HSEA 2M5YA 4Z37A 2PE8A 2A3JA 2EV5A 1JLEA 3GZNB 1GVDA 2RKHA 3VHQA 3CCQI 4XIDA 1UEUA 3OSGA 1YO5C 2OO4A 1SQEA 3MECA 1W0TA 4TY8B 4OZ5A 4WKRA 2RF2A 2UUTA 3TP2A 4O3QA 2Q8KA 1NJYA 5A8WB 2BACA 2V4JA 2K8GA 3G6YA 2C2NA 3F9KA 4LRFA 4DS4A 3RU0A 1BM9A 4RNOA 4LFBF 4NWBA 3PHEA 2VKDA 4OYIA 1I1GA 2E2IJ 4JYKA 1QRYA 2V1NA 4II3A 4DPUA 4XRSA 3ULQB 1TVRA 4LITA 1B9MA 1RKJA 4TVAB