2VOOA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
MAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vooA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vooA02
1L0OC 3WGHA 2MZJA 2PI0A 1HL6A 4HYEA 2O8XA 3DLLQ 2FNAA 3EUHA 3Q9VA 5E18F 1BI3A 2EK5A 4G7OF 5CYJA 3GVAA 3CCJS 5JVTA 2HQRA 2VBYA 5FLXK 3P6YC 1VQKS 4HLXA 3F3XA 1Q7YT 1X5SA 2CSOA 5ICGA 3QP6A 3C7JA 2Z33A 2CQDA 1VQPS 2Y0MA 5CA5A 4RAZA 1ON2A 1WG1A 1X4DA 3F6VA 1U1KA 1GHCA 4ERDA 2QLZA 2J0SD 4M72A 1W2BR 1K8AT 4U0YA 2L41A 2CQCA 4WIIA 1W4MA 1QPMA 1DRZA 2OTLS 3BROA 2M70A 2Z5UA 5DCMA 2Q2EA 2GZWA 4A5MA 5E20A 1W7PB 2YPRA 3I58A 1R5HA 3JAMZ 2KJBA 4EM0B 1FWZA 3ERED 2NYXA 1QO0D 3WTUC 1Q81T 4LLLA 4BH9A 3WTVC 2CPFA 1OPIA 3WTSC 4UV9A 1KA8A 3F21A 2KXNB 2OSRA 1WF1A 3UD3P 3VAFA 1O0PA 2BOPA 3E5UA 3V7SA 3VOEA 1J75A 3F23A 1WTBA 2JX2A 1YW7A 4F25A 1HW1A 2HGLA 5DUKA 4ZYDA 4I09A 2GA2A 2Z99A 4JBAA 2J0QD 5BPIA 1R58A 4RGSA 5A2QK 4W90B 4M5DB 3TO8A 2D9OA 4OZ0A 1Z9CA 2OSQA 1XMKA 2E44A 2Q0OA 2DGXA 1TQMA 1D8JA 2DO4A 3HTUA 4RS8A 3I71A 5ICFA 5H6RA 3F8MA 4C7QA 4EQQA 1W5TA 3FHZA 2RC4A 3ML6A 3WODF 3BY6A 3L7WA 3G6ES 2X1GA 2RDPA 3FWEA 2CO5A 1TQIA 5HO4A 2M30A 1XGNA 3F8CA 2KT5A 4P9UA 1U1MA 2HS5A 2ZJPQ 1KD1T 1B9MA 4MTDA 1ODDA 4N9HA 1YWXA 3J81K 2CPHA 4Q4ZF 2DQRA 3CC7S 4I98B 1BC7C 2VC1A 5ERIA 1RNLA 3BOQA 4ENKA 3VFZA 5TJJA 2A3SA 3DXJF 4Z2XA 4GCVA 1Z6RA 1Z7UA 3RKXA 1SD4A 1WKMA 4HA8A 3E6CC 1WHVA 2X4HA 2RVCA 3PIOQ 2EV0A 4TU7A 3MD3A 4N9IA 2MD5A 1ZAOA 3ZMVA 3NMRA 3ZP5A 2M52A 4UUVA 3FF5A 2HVZA 2MKJA 2MA3A 1YS6A 4UVCA 1SXLA 2RKHA 1R1UA 4EMSA 4C0OC 1G3SA 2F5DA 4UVBA 1STZA 3HSEA 2WWYA 4ENMA 1WHWA 2CQ3A 4OZ1A 3J7ZT 5D4RA 3ZMZA 4MTEA 2N7CA 3T8RA 5ILSA 2OU2A 1T6SA 1M5PC 3AAFA 1QZYA 2YX7A 4BHBA 4Y17A 3LA7A 5ILUA 1YS7A 1FJ7A 2D1VA 3E6MA 1FYMA 1VQ8S 2DHGA 2P5LC 4LB6B 4OIPF 2V79A 5JR3A 1NJIT 1LDDA 2EB7A 4LFUA 2HFHA 3WU1B 1H9TA 1MDMA 1VBZA 2HYGD 2EV6A 2A6EF 2HZTA 2XNQA 4GYIA 1AOYA 2HQNA 5FD6A 2KXHA 2MQPA 1HSTA 4I02A 2HGNA 3CMES 2EFWA 2DNOA 2IVMA 4WXCA 3UE2A 1K73T 2LMIA 2RQ4A 1D3YA 1XMAA 4IVNA 3GEZA 4QPTA 3P5TL 2P4WA 1TW2A 2LA6A 1VQOS 1DPRA 1IZ1A 3QPTA 1KOOA 3S01A 2CPEA 1G2EA 4XLPF 1K7AA 4MEXF 2HGMA 2DPUA 1CVJA 1LNWA 1RUOA 2W85A 1YW8A 3CO7C 1K79A 3I53A 2DGOA 2FC9A 3M7GA 4QU6A 1P4XA 3TOAA 2ZNZA 3HOSA 1RZ4A 2N82B 2AXLA 3D5LA 2ZJRQ 1DP7P 1YITS 2VODA 5DUIA 1U78A 2IA2A 3EDPA 1BOAA 3VAMA 1KQ9A 5D5VB 1ZG1A 3FM3A 3QRFF 4EJUA 2X1FA 4IRGA 1WF0A 4KT5C 1KU2A 1WELA 3KETA 1UB9A 4L5JA 1PP7U 5J8FA 2CQ4A 2IT0A 3R6SA 2PBIA 3RKYA 1WG5A 3I64A 2KYXA 2V94A 4PR6A 1VQ5S 2LQ5A 2QQAA 1K78A 1M5OC 1M1KT 3HYIA 1FX7A 3FXRA 4HW0A 4LG0B 2LKPA 1S72S 1VC0A 2F9DA 2HEOA 4IO9Q 1QM9A 3MURP 1R36A 2XIGA 3TDUC 4O3MA 2FC8A 3PQKA 1H2UX 2PEXA 5J8CA 1VQ6S 2FOKA 3DF8A 4NHJA 1H2VZ 5FFZA 1C0WA 2O0YA 1QVGR 3WTWC 1S3JA 3DPLC 1X0FA 3D2WA 2ZMEB 2DGVA 2LXUA 4EJTA 3Q2TC 2P5VA 3B02A 5DD4A 1TBXA 4CO8A 3MUMP 2MB0B 2MGZB 2IJLA 5EEHA 1R7JA 2YU3A 3ZMTA 5GMKa 4E70A 3EGNA 4TU8A 3ECHA 3FZVA 3HOTA 4EM2A 5BJRA 2VE8A 2RNJA 2VONA 2JPBA 2PLYA 2IA1A 1NHAA 5ICEA 2COMA 4KFCA 3ULQB 1A9NB 2MJUA 2DGSA 1WHYA 1DBDA 3EYIA 1YTYA 1UP1A 4DNCA 3NNCA 4U7BA 1XGMA 3LAPA 1CF7A 3WTTC 2A5YB 3U1DA 2M45A 4CHUA 2YH1A 4BHPA 4CH1A 1MZBA 2PMUA 2O61A 2FBKA 1HXDA 5DD8A 3KCCA 4PGHA 2VE9A 1P92A 2NRAC 2KRBA 2DHXA 5DDRC 3NNHA 4HX7A 3V7RA 3LFKA 1REPC 2STTA 1WF2A 2VT2A 2L54A 2F9JA 2MHNA 3BS9A 5D6FA 5D8LB 5HS9A 3I4PA 2Z9OA 3U1MA 4TV7A 3WE2A 1ON1A 4PDKA 4ZH4F 2R7DA 3V7CA 3WTZA 1SJ4P 1KQ0A 2FA5A 3TO7A 1QQIA 1J7KA 4LJMA 2DIVA 4UY8T 3VF0B 1SJQA 4IRHA 3N97A 3LA3A 2XAJA 3P9KA 1A7GE 3GZ6A 1ULYA 4JK1X 2CG4A 2V1DA 2LNBA 5DV5A 2AYMA 3LSTA 2E5IA 3US5A 1Z1DA 3IWZA 3CTRA 2DHAA 5D5UB 1ZH5A 3I0TA 1HKQA 1X4HA 1VC6A 2XHKA 3DEUA 1UHMA 2CPZA 5DDPC 4KDPA 1J2XA 3Q9SA 2MKCA 1G3YA 4KIBA 5BOXA 2P6TA 3GLXA 5DDGA 4YIIA 4IUFA 1OMIA 1WG4A 3BJ6A 5HLGA 5LHGA 4RB0A 3KEQA 3R27A 3KEOA 1FXLA 1WI9A 2AD9A 1X5PA 3C1DA 2MZTA 5DCMB 3R4KA 1LEAA 1MKMA 2P8TA 3THTA 2ETHA 1I1GA 5IM0A 3E5XA 2JTVA 5HDNA 1T98A 3BEGB 5LRSA 4RB1A 1SJ3P 4A0YA 3W6JB 1JJHA 2VT3A 4KNYA 1G4DA 5LXRA 1X4GA 1IXSB 1PDNC 5E1ZB 3KZYA 1BJAA 2ZBKA 2M87A 1O57A 1P1TA 3S6EA 4IPAA 3FMQA 4AIJA 5FJ4A 2MH9A 3IHUA 4IHSA 1SFUA 5D5XB 4XBFA 4IXAA 3V8LA 1F5TA 4OMZA 3B73A 2STWA 4D0PA 3LAJA 1IW7F 1UAWA 1O7FA 5HLHA 2ZXJA 1IAWA 4RAYA 1F9FA 2EFNA 2VOOA 5KK1A 2O3FA 5LEJA 2VC0A 2AYBA 2MZRA 1VBXA 3IC7A 3KP7A 3K1NA 4RGRA 2G9WA 1URNA 3QPHA 2UXXA 3HRMA 1J5YA 1MJBA 3VODA 3L2CA 3T8TA 4BS2A 2UXNA 2OBPA 3WTXC 1HW2A 3SHFA 2DHSA 2VBXA 2JZYA 4EJVA 1XCVA 2F3JA 2DGQA 2P7VB 4R79A 3TO9A 4P6QA 1IXRC 2HKOA 4IJAA 2RS2A 2DNLA 4M9ZA 3M1EA 3BO4A 5ITHA 1A04A 5LRRA 1ZN2A 1ZG5A 2XS7A 2O3DA 3G9CA 1SD5A 3K0LA 3TYTA 1ONVA 4IOCQ 1FNNA 3VAGA 4AD9A 1S79A 3G8SA 1KU3A 3TDZC 2CPIA 5CVIA 3GYHX 1JHFA 3LWFA 1X4CA 3CLOA 2DNKA 1MGTA 2PFBA 4OU0A 3DXBA 5FGMA 3FXUA 2EFQA 5BPDA 2JPCA 1UFMA 3REOA 1YG2A 1XN9A 1L3KA 2ISYA 4M9SA 4MHGA 2UZKA 3CMAS 2DNGA 2KI2A 1BI2A 5DDOC 2DBBA 5F64A 5K1YA 3V4MA 1FC3A 2DK2A 4BXUA 4NB5A 3NNAA 5CLSA 2F2EA 1JGSA 3E6DA 1FLIA 2XAQA 2WC2A 4ZYHA 1J0RA 2R3SA 1FBUA 1XGOA 1WEYA 4HOBA 3DP7A 3MWMA 1MDMB 1BBYA 1FJCA 4ZKAA 5ILVA 1D8ZA 2M8EA 1FO1A 1J59A 1SJRA 5FFXA 2CPDA 4CXFA 3F8BA 2FF4A 3C18A 5CJ9A 4PKDB 5LBQA 1SMYF 1YJWS 4HF2A 5IQQA 3CDHA 2E5JA 2U2FA 1U2WA 4UV8A 3HUGA 6PAXA 2ADCA 3V8KA 1XN7A 4N0BA 1LJ9A 4ESFA 2J5OA 1USSA 2RUGA 3LQRA 4C4WA 3MUVP 1YJ9S 1IQTA 2CJKA 1WEXA 1IN6A 3L00A 4LK1F 4P5OA 1FBSA 2XVCA 2LECA 2OZUA 1U8RA 2YSRA 2M2BA 5JFRA 1RIOH 2EFOA 4HF1A 1U5TC 2EFPA 2XAFA 1FT8A 2DI3A 2XASA 2FBIA 1X5TA 2Q8KA 3NS6A 2EK1A 3KZZA 5E8IA 2A3JA 4A0ZA 2M4MA 1BN5A 2PE8A 4LB5A 1X4EA 1D5VA 3ZMSA 3KP5A 1XD7A 3U2RA 2ZKZA 2MZ1A 1F9NA 2P6SA 1U2FA 2LYVA 1K78B 3VAJA 5KVRA 2W24A 2L02A 4ZZDA 1TNTA 1I27A 2CQIA 2FBHA 3OV8A 1G3WA 4EVIA 3UCZP 3PIPQ 4A0XA 3BPVA 4K2EA 2JSCA 4LMZA 5FLXZ 1YLFA 1R23A 3IKVA 4OOIA 1R8HA 3VB2A 2DH7A 4LIRA 3QP5A 4FT8A 1YW9A 3B4MA 3MCZA 3KP3A 1PUEE 2JRSA 2RGVA 4J5OA 4BQAA 2K4BA 3P3DA 3ELKA 5HVQC 3TOBA 4F7ZA 2YTCA 2XAGA 4GXOA 2F5CA 4QU7A 4RB3C 1OPCA 2FNPA 3ZMDA 1S29A 3FEYB 2FEZA 4KICA 3MEXA 5HL7Q 1U6GA 2DITA 4EGYA 3CCVS 2GWRA 1U3EM 1VQNS 5MLCV 1CF7B 4HF0A 3DKWA 1IN4A 5GAGU 5A2QZ 2KN4A 1YHQS 5D4SA 3J80K 4B8XA 1LVAA 3FEXB 3CCMS 3MZYA 4CDGA 2AS5F 4B09A 4F26A 2DO0A 2QBYA 3EYYA 2XROA 1HKTA 1EV7A 5LXYA 4A6DA 2DK8A 4M74A 1W5SA 4LK0F 3SZPA 1OIAA 2A61A 5DEQA 4YG2F 2ERRA 3T0YA 1JJ2R 1BI1A 4A2UA 1Q86T 1P4AA 4YFNF 1O3TA 4G7ZF 1U1PA 1KU7A 5JVGQ 3E3VA 3J81Z 2PG4A 2G7HA 1BIAA 4WK8F 4BHCA 2V1UA 3P9IA 5D77A 2R7FA 1B9NA 1BIBA 1KYWA 2FSWA 4AIKA 3SFZA 3RPQA 1B59A 1Y0UA 4U0VA 2NLWA 3K9TA 3KLNA 2PJPA 2ADUA 1U1OA 1T39A 2DLLA 4UQTA 2MXYA 4G6DA 1DZ5A 2JVRA 5DM7Q 1WRJA 3M8EA 1X5OA 5HLIA 3DFGA 2GAUA 2HOEA 2ZJ2A 2M7SA 5LGTA 1XB4A 4HDUA 3SXLA 1RKJA 1KQ8A 1R1VA 1PP8F 4CZZA 1R8PA 3JSPA 1XSDA 3UCUP 1SFEA 4UXNA 2BZ2A 3K1PA 2ISZA 2V1XA 2M5WA 5IM0B 1FZPB 2HR3A 5FD5A 4LD5A 2C6YA 4OMYA 3WGIA 3CCES 4HDVA 3NQOA 4UHTA 2F5EA 1U5TA 1XGSA 3MFKA 4HBLA 1OKRA 3Q5FA 3TQNA 1Z6TA 2OJ3A 3I55S 1F1ZA 5HDGA 1FHTA 3RTRA 2OIHA 2J76E 4MQ9F 3WTYC 2KG1A 1FP1D 5LHHA 3I59B 2M8HA 3UD4P 1KGSA 5LGNA 3MOJB 4YFXF 4A8XA 2HKXA 3CXCR 1Q1HA 2XB2D 2OAZA 5CVRA 4Y0FA 3SMZA 4EJWA 1FT9A 2XKPA 3FM5A 3J80Z 2LA4A 3T5XA 1MJ9A 3CUQC 4L0ZB 3IL2A 3GZ5A 1MD0A 2L4MA 5DDQC 3P49B 2HYIB 1GXPA 2DW4A 5E8GA 1GVJA 5D5WB 3KFWX 1XSVA 4OIOF 4PZJA 2MJNA 3DQVC 2I2YA 3VEPA 4AVPA 4MNUA 5DCFA 3TP2A 2MQOA 2EA2A 3LQVA 2MLGA 2CQGA 4WFAQ 4RGXA 1P27B 4KMFA 3K2ZA 2E1NA 3CJNA 1KOHA 3GFJA 2PN6A 5J6XA 3E5QA 1ZG3A 5IT3A 3KLOA 3ZN1A 1FYKA 3FMRA 3VAHA 4L9TA 5FB2A 2LDUA 4M73A 3SXYA 2RN7A 5LEKA 3TO6A 4FXWA 2KH9A 3MXHP 4R8HA 2DGWA 5HS8A 1QNTA 3SDEA 2K8GA 4L9VA 2G7UA 2MQMA 1DHMA 4MEYF 1D8KA 2CQ1A 4HLYA 2E7XA 3P7NA 4OINF 4HV6A 2A68F 3CCQS 1FNXH 2RS8A 3R0JA 2A07F 3WU0A 1KYZA 1P6RA 2K27A 2YR2A 3D0SA 3IRRA 2D3OR 2L01A 1JXSA 2VBZA 1VC5A 2B0GA 3ABTA 3U1LA 5IFMA 1P4WA 4PCQA 1S7OA 2D1HA 1JMTA 2CYYA 5GADU 2RT3A 1V4RA 3RJPA 4RGUA 2SXLA 2EWNA 2NAZA 4S05A 2CPYA 2DNQA 2QYOA 1FJEB 4Y13A 3CPWR 2KU7A 2BYVE 4EGZA 2L3DA 3L9FA 1VTNC 2DH9A 1BY9A 2LCWA 1TTYA 3UCGA 3ZN0A 3CC2S 4RU2A 3CUOA 1B4AA 2OQRA 1H9GA 3FMSA 5L3CA 2N3LA 4XSZF 2ADBA 3S2WA 5D78A 3J7YU 1PGZA 1X4BA 4QLCU 3RI4A 2DAOA 1B7FA 2YX4A 3QU6A 5JHUA 3VAKA 2V6CA 2CPXA 5L3DA 2GHPA 3E97A 4HX8A 3SZTA 2DB1A 3BJOA 4KA4A 2CQBA 1QBJA 3CCRS 2YH0A 2HZCA 5CXTA 2LKZA 2JRTA 2DGUA 2JVOA 4I2OA 4KYWA 2NNYA 2DIUA 3HRTA 1EH7A 4G8XA 4TLQA 4A5NA 2CW0F 1SFXA 2J8AA 2QZ8A 1WWXA 3ECOA 1YO5C 2RVJA 3MI7X 2MC3A 4ESBA 1FOKA 2XV4S 4M9XA 3E6BA 2DH8A 1R22A 3BWGA 4GGGA 2DNYA 1WHXA 2OD5A 2DPDA 1SD6A 2DK5A 1HA1A 5GVQA 1WI6A 2DT5A 2KIFA 2KIMA 4WCEQ 1FYLA 4ED5A 1IXCA 4TU9A 3V4GA 5AONA 5JVHQ 1D9AA 2BGCA 2RV8A 4MGRA 1DPUA 3WE3A 5BQTA 3HHGA 5EEGA 3CCUS 2AYGA 2QQBA 3DV8A 1GXQA 3CCSS 1B1BA 4ETSA 4QQBA 3CUQA 2NNNA 1IF1A 1UFWA 3BPXA 4BAYA 2BEOA 3G3ZA 2LEAA 1NO8A 4ENNA 4CIOA 4ZYEA 3RW6A 1JHHA 4YOEA 2E1CA 2F5FA 2ZNYA 1M5VC 3LA2A 2KXFA 2EVZA 4ZZLA 3O2PE 3GFMA 2FRHA 2Y75A 3L3CA 1T2KA 1FPQA 1HD0A 2CQ0A 2E7WA 1OYWA 2J5PA 5D8KB 4UNOA 4KIFA 2M1BA 5F1RA 2DFIA 3EGZA 3CF5Q 2KVIA 2M88A 2O03A 1IRGA 2M8DB 2MQQA 2RQCA 3ZPLA 1O3SA 2P7CB 2QA4S 5JI6A 1T38A 4WFNQ 2FU4A 2ZJQQ 2FHOB 2MKKA 5E17F 2KM8C 1BI0A 2M0GB 3WGGA 2QBYB 5LJ3Y 1AWCA 3THPA 4KN4X 4W92B 4ASNA 2XRNA 5DYMA 2MH2A 4FX4A 2MSTA 3RIRA 2KRFA 4CICA 3P9CA 3F22A 4LLNA 1VQ7S 2WBRA 2L08A 1LDJA 1TNSA 4CYDA 3JW4A 1O7LA 1H2TZ 4BNCA 4OIQF 1HQCA 3GXOA 2N3OA 1W7PD 2FMYA 1I5ZA 4WX9A 4A6EA 2XAHA 1X4FA 5GAHU 3F6OA 2MSSA 3R0AA 4U0WA 2RNEA 2VBWA 3NEUA 1P2FA 2JWNA 4WCGA 2MQNA 2D2WA 4M6YA 3V8JA 2YKAA 5IT9K 1SD7A 3MZHA 1N88A 2FMLA 5F6FA 2XSFA 2KM8B 1VQLS 4G9YA 3H2VE 2G4BA 1SJFA 3M8FA 2K7LA 4WKRA 3I54A 1G6NA 1OYIA 3S7RA 1JE8A 2OTJS 1VBYA 2FPHX 1R1TA 5CVJA 4F02A 2RRAA 3KP2A 3M9AA 5K5OA 3H3ZA 1N52B 1BM9A 4WF2A 1AUDA 2VOPA 2HYFA 3KE2A 2RQPA 1U1NA 2XUBA 4IF4A 1VQMS 1BC8C 1YJNS 4HAMA 5ICCA 1RK8A 4HZFA 4CQ1A 4Q48A 3GF2A 4EV0A 2K02A 4Y15A 2NS0A 4FX0A 5E1XA 2DO7A 4PRFA 4L9NA 1B6AA 3R61A 3IWFA 2TDXA 4BYYA 4EM1A 2CPJA 1NU4A 2ZCWA 5H6QA 1U5TB 4FHTA 2LXIA 3LPYA 4I0BA 2MPUA 2XGXA 3COAC 3G96A 2UP1A 3GW2A 2Q79A 1ZHFA 1SAXA 3G8TA 3CTAA 2H6BA 1DDNA 1H6KX 5H1SV 4KMUX 4G6QA 5D6EA 2MQLA 2LF8A 5LSLA 1QVFR 2ACJA 3FXQA 2ZFWA 5L3BA 2MKHA 2DNZA 1ZZFA 5LHIA 2LSOA 3WG9A 1USTA 1SMTA 4LLGF 5CVVA 3BJAA 1TLHB 2L9WA 1M90T 2DNPA 1W7PA 3RKWA 4ON0A 2G0CA 1ZRFA 1OR7A 1U6BA 2L4AA 2HGCA 2QENA 1UHWA 4WF9Q 3IKTA 1LB2A 2KIUA 2GA1A 3EETA 3JTGA 3F8FA 2DTRA 3BDDA 2BE5F 3HTSB 1ZGJA 4QWQA 2EA4A 2CFXA 4L9JA 3QAHA 4PGGA 1IN5A 3TKYA 2JT1A 3N9UC 5LLQA 3MD1A 1ZLJA 4U88A 3OOPA 1YFHA 3FX3A 4G7HF 2HDCA 2H94A 4U7DA 3SDEB 1YIOA 2RRBA 2LEBA 2IW5A 2HTJA 4XSXF 2MYFA 2AYEA 3ISPA 2QVOA 3VALA 1FSEA 3I5UA 5IT9Z 5BS6A 4IOAQ 3EX7B 1YYVA 5AIPA 1S6LA 3HIFA 3BZ6A 2HTSA 2QM3A 2O6GE 4L0YB 2H09A 4NQWA 2U1AA 3F8NA 1RUNA 5LSOA 4LMYA 1F4KA 1X4AA 3ULHA 3JB9k 3GFLA 1VQ9S 2QEXS 2NZ4A 3B4DA 5H20A 3O3KA 3ROUA 2FE3A 2FXAA 3L09A 3JSOA 3BO3A 4UVAA 2B0LA 2DISA 5EN1A 3HRUA 3GWZA 4ZYGA 3BO2A 2A6HF 4YB1P 4P55A 4AIHA 2E5HA 4I01A 3PQJA 4YFKF 3SQNA 2GXBA 3TGNA 1KU9A 4RB2C 1IN8A 2YWKA 3CD6S 1R00A 2OZ6A 4Q5SF 2ESHA 5K5QA 1I1SA 2QQ9A 1Z05A 2CGPA 4GO1A 2E5GA 2H27A 1N8RT 2Y48A 1I6XA 4KUMA 4ESJA 4YIFA 5L3FA 2DNRA 2MMYA 1XCBA 5BMZA 2GIVA 3HSRA 4ENJA 1KC8T 2X0LA 4DQ2A 2PMHA 1HW5A 1UCRA 3QOPA 2XKOA 5L3GA 2G1DA 2FQ3A 5E1WA 1LDKB 1ZARA 2DNHA 3U9GA 3R1LA 4EGLA 2EV5A 2WV0A 3H3UA 1E2XA 2DQLA 3GX4X 2CQPA 1ZRCA 3KP4A 5FO5A 4GYGA 5CVUA 2XS2A 1E17A 2KG0A 2GQQA 4O6JA 2DU9A 4M6XA 4H0EA 1O3RA 3ZZZA 1U1QA 2X1BA 2MBFA 3ZQ7A 1FY7A 2IPQX 4I7HA 2K4JA 2IRFG 2P5KA 4S04A 1J9IA 1JJ4A 5CYVA 2X1AA 4IRIA 2QWWA 3DPTA 2CQ2A 1FBQA 5LGUA 2EK6A 4R1HA 5DETA 4LJZF 2OQGA 1U1RA 1DUXC 3I56S 3S8SA 4HQEA 2BV6A 3MAJA 1Z91A 2M9KA 3G4SS 5TRDA 3CC4S 1ZRDA 3G71S 3GO5A 3RYRA 2VXZA 1UW4A 4FXVA 2K86A 4Z2YA 3K69A 2KRRA 4V19X 3J7AO 1MJAA 2KKOA 1WWHA 5HDKA 1IN7A 3CUNA 4AWXB 5ED4A 4YUDA 4G94A 1OO0B 1RI7A 3HHHA 2I38A 3C3WA 2CQHA 2ELHA 1HBXG 3CUQB 2DNMA 3NRVA 2MKIA 5L3EA 4P9FA 2GO9A 5DM6Q 2XNRA 1G3TA 3W6KB 2HWVA 3GUDA 4XRFA 3Q2SC 1HD1A 4CGZA 3IRQA 1M5KC 1YQAA 1EH6A 2VN2A 4OIRF 2MLKA 1YI2S 3BP8A 2Z3YA 3KP6A 2W57A 4EJOA 1S7AA 2ZO4A 1N54B 3VAIA 4L18B 3R1HA 1QZZA 3K1MA 2DNNA 2IP2A 2KJCA 3MQ0A 1O3QA 2MY7A 1HSJA 2D45A 2MZSA 1FSHA 1R5GA 3R60A 4LG0A 5K5RA 3EQLF 2MZQA 1OYYA 1Q82T 4M71A 2BBYA 3GFIA 1XDUA 4XLNF 2XS5A 3NS5A 3H92A 3RW7A 2W25A 2K3KA 1TW3A 1K6OA 2PEHA 1XDSA 1ZREA 4P96A 3RYPA 3F72A 4HQMA 5AIQA 4O5VA 1ZGAA 1VQ4S 3JAMK 2W84A 2KFYA 2ZMEA 3N4MA 2OA4A 1ZLKA 3CCLS 4WWCA 4Y00A 2H6CA 2QFJA 4KN7X 2MGZA 1KQSR 2GXGA 3H2UB 3QU3A 3HI9A 3OW2R 1OWXA 5HOOA 1LQ1A 4WFBQ 3UWTA 1EH8A 1WSUA 4KIGA 1IRFA 3I59A 2DGTA 3K0JA 1CGPA 4WXHA 3MUTP 4HX4A 4A12A 2LF7A 1S8NA 1XSXA 2D9PA 2IA0A 4I0AA 3JTHA 2UWMA 5GAEU 4JQFA 1TQPA 1ZYRF 3O6BB 4IHTA 1HKSA 3IRWP 3HRSA 2MKSA 4MQVA 1WI8A 1X3UA 3IWNC 1QGPA 3MDFA 3PFIA 2QUFA 1ZZNA 1T0FA 3T1BA 1U1LA 2EJRA 2PQ8A 4LGWA 4WXDA 4CH0S 3ABUA 2WTEA 1WQ2A 3G73A 1WEZA 1H0MA 3CO6C 3HSFA 2ESNA 2CWEA 2A69F 2RU3A 1K9MT 2KHCA 4Q47A 3RDIA 2MY8A 4U67Q 5LJ5Y 4L5IA 3RPUA 1IUYA 3LQQA 3ZZYA 1FP2A 4HV5A 2V9VA 1U6FA 1YIJS 1V3FA 3HHNB 2CQKA 2FY1A 3CULA 5HS7A 1L3LA 1PO6A 3ZMUA 1LEBA
chains in the Genus database with same CATH superfamily
1L0OC 1HL6A 1DQ9A 2O8XA 5B0DA 3PM9A 3Q9VA 1J5OA 5E18F 3QGHA 2EK5A 3A03A 3CCJS 1NH7A 3W63A 2VASA 1S6PA 3BB5A 1VQKS 3LGMA 4HLXA 3W6VA 3VGSA 4DSIA 5ICGA 5J1UA 3C7JA 4DLEA 1VQPS 3RRGA 4IRKA 1ETVA 3K4BA 1U1KA 1GHCA 3LW5C 3Q83A 1X9SA 4QIVA 2J0SD 1W4MA 5D0GA 2OTLS 2XBPA 5M2RA 4RW9B 3U1NA 1TK8A 4CLPA 2IIHA 3W61A 1W7PB 3I58A 5B5EC 1R5HA 3T19A 4EM0B 1LWEB 1QO0D 4LLLA 1IKWB 4FZVA 5HLFB 4LIVA 1OPIA 4QWEA 3CDUA 4UV9A 1X1PA 2OSRA 3UD3P 1TL1B 4C3MA 4PXBA 1FE0A 1RB0A 3OFFA 3EYZA 1I6JA 1LKZA 3VOEA 1J75A 1RTIA 2JX2A 4YFUA 3KLIB 3RRKA 5KG1A 3CEDA 1FERA 1RUSA 3MKYB 5GADJ 4LRDA 5A2QK 4RGSA 4WZMA 4OZ0A 3R2DJ 3LALA 1W0TA 1KFDA 3PO3J 2A1BA 2Q0OA 2DGXA 1TQMA 3GMGA 2VQGA 4V1Ak 2YKNA 2PT0A 5ICFA 1KFSA 5H6RA 3KJVA 4RO0A 5KTQA 5HLTA 4NQWB 1MROA 3ML6A 1ZPVA 3G6ES 5D0EA 1NM2A 3FWEA 1U8SA 1XS9A 3V6HA 3LTOA 2RU9A 4F4WA 4F7VA 2W4PA 4K0KJ 1VNDA 2M4GA 3F8CA 1KD1T 2XTJP 1REVA 4S0HB 1YWXA 2E5LF 2V68A 2DQRA 3TWZA 3HJVA 2LR8A 3CC7S 3I82A 1BC7C 3BKTA 4ZPDA 4PG4A 3PYEA 2VICA 1R0AA 1YJ7A 1T33A 2FVCA 3H8YA 5LMUJ 2RIJA 3BOQA 3N6NA 2QSWA 2A6MA 4MK9A 3M07A 3M8ZA 1Z7UA 2ZDPA 5H9EJ 3IWXA 1WKMA 4HA8A 1K44A 1HF0A 2RVCA 1PIEA 2ZH1A 5IXUA 2OH2A 4F36A 3C2PA 1JNZB 3H5AA 2PO4A 4EBCA 1JK9B 3C6TA 4UVCA 1R1UA 4ECWA 2W7NA 4EMSA 3MMYB 3A8EA 2Z8QA 4WBFA 3ZMZA 4P10A 4R8UA 3T8RA 2OU2A 4Q2MA 3DLBA 2MC4A 3AAFA 1CULB 4DJAA 2YX7A 1TU0B 4DR1F 3KLGB 5B66C 1YS7A 2CFOA 4J19A 3CJ3A 1VQ8S 1IJFB 2LYCA 5B0BA 4OX9F 3V81A 1CS4B 4I1TA 2KFZA 3D0HE 4HVZA 2DVIA 1VBZA 2EV6A 2A6EF 3CCYA 2FDNA 2VKRA 4DN0A 1AOYA 2WAEA 4DR3J 5T41A 2EFWA 2AQFA 1N6QB 5ADZA 4TY8A 3D5RC 3UE2A 2LMIA 3CCSI 2AGQA 4DL5A 1TWAJ 3AJ1A 3VV2B 5EGYA 1R0CB 5E3QA 3TZYA 1IZ1A 4B3MJ 1G2EA 3C8YA 2IRUA 1K7AA 3EDRB 4MEXF 4QIEA 4AUKA 4K4XA 4DGWB 1LNWA 2W85A 1YW8A 4IKAA 2GMHA 3M9NB 2F4OB 2BA9A 3AJ2A 3I53A 2DGOA 1P4XA 3K6GA 1RZ4A 2XULA 1OYDA 3FXLA 2ZJRQ 1YITS 2VODA 5DUIA 3SFUA 2M0MA 1RHJB 1FI4A 4RX6A 4ZJZA 2XAUA 3NWGA 1UCNA 3VAMA 3NARA 1ORKA 3D68A 4IRGA 4KT5C 3W3CA 1KU2A 4DHVA 3OYDA 1UB9A 1PP7U 3R6SA 2VV5A 3J7Z5 2PBIA 1WG5A 4OYZA 3I64A 1IM6A 3RJMB 1HBUA 2QQAA 3HYIA 1LFBA 2DT6A 1EHWA 2LKPA 1PG5B 2UUZA 2PEBA 4IDKA 1QM9A 3DBHB 1R36A 1QVTA 3A01B 2XGDA 2FC8A 5C2GA 2COLA 2CAJA 2WV1A 2A05A 3HVWA 3DLJA 3DF8A 4NHJA 2N8GA 2R2TA 3K4KA 1QVGR 4RW4A 3MR2A 4FF2A 1S7HA 2KDOA 2RD5C 2CZ9A 1JLFA 4EJTA 3Q2TC 2P5VA 5H2FC 3OL6A 4HH0A 2K1RB 1PJ5A 3QPSA 3MUMP 1DURA 3NBPA 2MGZB 5LSRA 3O44A 4AD6A 3ZMTA 1LW0B 2V0NA 3FZVA 4OX6A 4B47A 2V4JC 3DOKA 2DMNA 2VFVA 1VF9A 2IS1A 2EG1A 4BL0B 4CCNA 2MJUA 2DGSA 4DS4A 1UP1A 4B9SA 1HNVB 4DNCA 3NNCA 1XGMA 1IUJA 4G1PA 3FBBA 2P0WA 1VHFA 3JTOA 2R2UA 4OYMA 4RBOA 4YHHF 1ZGWA 4CH1A 4DBQA 1AA1B 4HNUA 2OTJI 3DRPB 5CPRB 2O61A 1HXDA 3KCCA 1P92A 1Z1ZA 4L73A 3Q0AA 3GU0A 2OGUA 3PW0A 3GCWP 2ECBA 2WVBA 2QL7B 3UD5A 4C3HJ 2Z9OA 2HOTA 2NVTJ 1T94A 1V5GA 1VIXA 1K4SA 3BZQA 2IS2A 4ZH4F 1IRZA 1S1UB 3TO7A 2F48A 5KT4A 1J7KA 4LJMA 2DIVA 4UY8T 3MCMA 1GVDA 1HNZF 1A7GE 1JLQA 1ULYA 3VZIA 4NC7A 4MK7A 2V1DA 2MQ8A 3LSTA 3R7BB 1T03B 5KFGA 1TC3C 3TUZC 2KDZA 3DRRA 4BY7J 2XPUA 4R0JA 3DEUA 2Q1LA 4CCLA 1UHMA 3IN5A 4KYZA 1L3VA 4M5GA 4XM3A 3MAHA 1J2XA 1G3YA 2B4OA 1U7LA 5B0CA 4KIBA 2XWXA 2P6TA 3CZ6A 4YIIA 1SC1B 4UUSB 4C8OA 5KFYA 3BJ6A 3FSXA 4C8LA 4X4NA 3W9IA 2UXDF 4GKKJ 1QSYA 3R27A 2DR9A 1FXLA 3S1RJ 3C1DA 4LSNA 1BQMA 3QYFA 4A3EJ 2W9CB 5KG6A 1VMBA 4NMXA 1OY9A 3I4HX 3TQ1A 1VRUA 3BR2A 4B3TF 2YNIA 2WAQA 4LFAJ 4TLRA 3D6FB 5LRSA 4GVBB 2RILA 4FN5A 1VQOI 4RB1A 4ZJOA 4A0YA 4X66F 1JJCB 1YRNA 3OLAA 2VT3A 2HHPA 1XPXA 3DKYA 3PO5A 5K9FA 3QLHB 2M87A 3S6EA 2OPRA 4IPAA 2LLZA 5LD2C 2MH9A 4X64F 2I1RA 1SFUA 3BBFA 4IXAA 3V8LA 5CYMA 5KT3A 3CLQA 1RT1A 4KKOA 7AT1B 2CWKA 2EKNA 1UAWA 3CP2A 2VPRA 3W2VB 3VYRB 1HBMA 1D5YA 1TKTB 3PR4A 5KK1A 2FD5A 2EKYA 2O3FA 2AYBA 1VBXA 5I3UA 1XJWB 4V2GA 3KP7A 3B6CA 2L7KA 2G9WA 4OYAA 1URNA 1J5YA 4NXMJ 1VR6A 2DHSA 4P73A 3KLHA 3AD8C 1WCMJ 2DGQA 2P7VB 3N4WA 4IJAA 1MBJA 3ADAC 2UV1A 2DNLA 1BLUA 4ZLJA 4M9ZA 2HPUA 5ITHA 1ZG5A 3GSDA 5EZGA 3JQKA 1BD6A 1SD5A 1XBWA 3TYTA 4ILLA 3JAMY 4NCGB 3VAGA 3EPGA 3NLCA 5CVIA 5E79C 4CLUA 1X4CA 2UV8G 3CLOA 1MGTA 2PFBA 4OU0A 3RBZA 2H51B 1G3OA 1PC4A 1XEZA 5D4OA 3OSPA 1XN9A 1QHHD 3OMYA 2CJAA 2B6AA 1SH2A 4F67A 1TKXB 4U7UD 1D3WA 3SDBA 4IFVB 2DK2A 3BR8A 5CLSA 2B9WA 4BJ6C 3HHLD 2WC2A 1TP4A 1J0RA 1FBUA 3DP7A 3A4CA 1MDMB 5AJ3F 4HKQA 2NXUA 4ZKAA 1HDPA 1S1VB 3KK2B 3OL9A 4A4JA 1SJRA 3R6LB 1KKHA 4DDFA 2CJ9A 5FFXA 4IHVA 3N5FA 5I42B 2G9OA 3J7ZI 3C18A 5CJ9A 5KFUA 2ZFHA 1VIOA 1SMYF 5K7FA 5IWAF 2GJIA 4HF2A 3Q0VA 2I0XA 2PA3A 6PAXA 2ADCA 3V8KA 1S6UA 4CM2A 1TFWA 4JUZA 3LQRA 4C4WA 1J27A 1U8BA 1IQTA 1RT2A 1N0VC 1WEXA 4LF4J 2BANA 1MSFC 5GADI 3DLGA 3AH6A 2FZCB 5D3GA 4CWBA 3V6DB 2DT7B 3D6TB 2LECA 2YSRA 2ROGA 5JFRA 5FLXY 1EJ9A 3KLEB 3FBNB 1U5TC 3C16B 3DGPB 3TA0A 5KT6A 4MT1A 2FBIA 3NS6A 2EK1A 2B43A 3KZZA 2VQEJ 2A3JA 4CM0A 4A0ZA 4JYAJ 5EG0A 1BUXA 1FMWA 1X4EA 2YNHA 3MEKA 4DEZA 1UL3A 5SZTA 2XGCA 1F9NA 3OXFA 2MZ1A 3GLJA 5BR8F 3W7BA 5DQHA 5KVRA 2L02A 4ZZDA 3H40A 2CQIA 4EATA 3S3NA 4EVIA 4E2FB 1VQ4I 3LNQA 2E1RA 3BPVA 4M5HA 4CLZA 4K2EA 4LMZA 1Y3JA 3CCLI 3IKVA 4A8SA 4ECVA 3GFHA 2HW3A 3TL4X 2XMJA 1EAYC 4DFMA 4NC6A 4DCJB 3GV7B 5EGOA 1VOMA 4CNZA 3OPKA 3B4MA 1X3ZB 4ZLPA 4BQAA 3FFIB 4IO1A 1WJDA 4AFFA 4Z6YA 2YTCA 3EZOA 3MM8B 2JFDA 2BACA 2AEJA 2HRTA 2VFRA 1SBRA 1ZTTA 3NEKA 3RUBL 2AX1A 4QU7A 5DS9A 4PJ0C 1V3ZA 2IC3B 3UN3A 3ZRGA 1HWJA 2GIFA 1MSWD 4MMOA 3CSKA 1X3WB 3MEGB 1CF7B 2DYAA 4HF0A 4IFYB 1J5EF 3DKWA 2RKIA 5A2QZ 2KN4A 4I7FA 5A8KA 1SIWB 5HN0A 2ZZNA 3MZYA 4CDGA 2HFSA 4B09A 5I3PA 3J81Y 1Z67A 1F36A 2P8IA 1HKTA 5MAOA 2VXDA 1HNIA 4LK0F 3WQPA 5ETVA 3M30B 3QWUA 3BGOP 2AO9A 3BGRB 2ZBRA 3WHCA 1NK0A 1Z77A 3UI3A 2NXEA 4MIMA 2MLZA 4ZP6A 4X4UA 5A6PA 3JQJA 4I4BA 4K7QA 1BI1A 4A2UA 3CCJI 1QUVA 1Q86T 1X7VA 4C3JJ 4LSLB 1U0SA 4KGZB 2IMOA 1UVJA 5JVGQ 2PG4A 1VQPI 5KFCA 1BIAA 4E7SA 2Y9HA 3U21A 2QA4G 4LF5F 2K9MA 2R7FA 3HK2A 1NK2P 3QATA 2FGOA 2VPYB 2OTLI 3DMJA 4OYPA 4II2A 3K9TA 2XCAA 3DYAA 1U1OA 3DDIA 3UO0A 2DLLA 3MM5B 4UQTA 2OPPA 1MMNA 5DM7Q 2K9SA 6FDRA 4RNHA 1EP4A 5F0HA 2GAUA 2HOEA 4O4GA 2E2JJ 1IKXA 1NSAA 4FCYA 1RU2A 4WTYA 3K70D 1OYEA 4KT0C 2KRHA 3OVAA 3K5NA 1IBKJ 1MNEA 1JLAA 4YR2A 3BJYA 3KK1B 3DEEA 1GMVA 1NZ8A 3HX9A 2RF2B 2C6YA 4DX5A 3WGIA 2LOOA 3I0RA 4HDVA 3C6UB 1FWPA 3NQOA 2GGPA 3HXMA 3Q5FA 3W9HA 4Q7AA 1C0TB 1REGX 5F8IA 2WSEC 3L2WA 4BC9A 5KT5A 3UD4P 1E3PA 5LGNA 4WYLA 3T5KA 3G6EI 4A8XA 2UUAF 3DKXA 2DCLA 2OAZA 5CVRA 1I3AA 3HJEA 1SUQA 2BW3B 2LA4A 3ET6B 3PRBA 4ZPVR 4ZVOB 2Y0BB 3T5XA 3CUQC 4J9PA 4FKYA 3DHWC 3CMQA 3T5LA 1YJVA 4ECTA 1XSVA 4KV8B 3HPOA 2C3PA 4BHQA 3RRHA 3TP2A 1VGYA 2EA2A 2CQGA 3F56A 2HDDA 1Q1VA 5EWGA 4KMFA 2RDJA 3CJNA 1KOHA 4RZRA 2CRLA 5J6XA 2Y2ZA 3E5QA 5IT3A 3O5TB 4QR0A 3FMRA 1R43A 3VAHA 4DX7A 4B9LA 3SXYA 2RN7A 4O0IA 4JI3J 2KH9A 3FK4A 1S1TB 5ETPA 4ECQA 5T7LA 3BDEA 2G7UA 2DT9A 3VYTB 3PHTA 4OHXA 2CQ1A 2JUCA 3CCQS 1FNXH 2ZD1A 2YR2A 3D0SA 1JXSA 1KP6A 4IG0B 1ULRA 2JVGA 1MN7A 4PCQA 5U47A 3PJ9A 2CYYA 1FWKA 4Q0BA 1UEVA 1VQ8I 3KMSA 5FKMA 3DRSA 3NMAA 4XL9A 1GV2A 2ZUAA 1UWAA 3H20A 5GAGI 1JNRB 1RR7A 3D28A 4ZPCA 3Q3SA 2L7FP 1SQEA 4YR3A 2HVQA 4EGZA 1UVIA 2L3DA 4K4ZA 3UCGA 3BR3A 4RM2A 3ZN0A 2XMUA 1T8IA 2X1DA 3CUOA 2VFTA 4QPXA 2OQRA 5EWFA 1Y10A 4LFCJ 1VBKA 2NOJB 2N3LA 4PUOA 3J7YU 4HYKA 1X4BA 4QLCU 3RI4A 4DJBA 1B7FA 3AOBA 1CBKA 5HSPA 3QU6A 2B51A 3VAKA 2LFVA 4KBIA 2IPOB 3GZNB 4FYWB 2BM0A 4KA4A 2CQBA 1QBJA 1ACIA 2GJ2A 2YH0A 4RUHA 1YITI 5HQLA 1U2CA 2ZSHB 3QRPA 4KYWA 3K4LA 1LQ9A 1DY3A 1AKHA 4ZVGA 3TX8A 3KKFA 3V4IA 4G8XA 1ZK8A 3D4JA 3PKYA 4A5NA 1BW6A 2J8AA 4ED4A 3CJQB 3ECOA 2WB4A 2MC3A 1FOKA 1QLNA 1XNRF 1FFGB 4LR7A 3TVYA 3T1YF 1NJXA 1J09A 2GHWA 1HA8A 1R22A 3BWGA 4RDUA 1FOXA 3Q0WA 3RZOJ 5GVQA 4U8VA 2KIMA 5J1PA 2YNFA 5CQEA 2B7CB 1SL0A 2JNJA 3WE3A 1SH0A 2BV3A 3JS9A 2QQBA 1MNMC 3ZO7A 2MFZA 2E2HJ 2IHR1 4FBTA 1Y39A 2HS3A 2FJVA 4IG3B 5IS2A 1IBCB 1XMQF 4PG6A 4OX8A 4BAYA 5FRMA 2VPLA 3DOMB 3IAS2 2O66A 2OD4A 3HVTA 4ZDOA 4ENNA 1CJUA 1R8CA 1NPKA 1FD8A 3IA0A 1VHIA 2ZNYA 5E3AA 2QFIA 1ROFA 1NHVA 2EVZA 4DYQA 4ZHRB 1SL2A 2HURA 1FPQA 2IBOA 2BRKA 2CQ0A 3CO0P 2CNLB 1Q5VA 3GJTB 2M1BA 5F1RA 2DFIA 3EGZA 3CF5Q 4OX7A 2KVIA 2M88A 3R5GA 2WVFA 4DV6F 1TVRA 4YB7A 1TL4A 2MQQA 2RQCA 1K6YA 1O51A 5JI6A 1TK0A 4KT6A 4GDFA 3A12A 2L48A 3GILA 2FHOB 7FD1A 2WONB 4F2SA 4CZCA 2M0GB 4IR1A 3LP2A 4HNVA 1AWCA 2Y1RI 4KN4X 3OHAA 2XRNA 4DCOB 3RIRA 3P9CA 4OLOA 5EYRA 1R5ID 4LLNA 3KHRA 5EDWA 1YBTA 3CWJA 4DX8H 3T41A 2XSJC 4IHXA 1FJGF 2B9EA 1JIHA 1W7PD 5E3CA 2X6YA 2FMYA 2XYPB 1P9YA 1OLTA 3TEGA 3FEZA 2UXCF 1XMOJ 2KRCA 2G2ZA 2O9LA 4DPUA 1IR0A 2VBWA 3NEUA 2AJFE 2MQNA 3V8JA 3PYGA 1W1WE 2X9DA 4LREA 4YEAA 2HDWA 4RM3A 1AYEA 1DGWY 4KR0B 2DMQA 2ZJQF 4TXSA 4A3MJ 2P81A 4TYAA 5F6FA 2XSFA 5IPAA 3H2VE 4F3OA 3M8FA 1TT5B 2K7LA 1G6NA 4CCMA 3PO4A 1JJ6C 1I94J 2DCEA 4F02A 3M9AA 4WF2A 2N4CA 2IJFA 5C44J 1NG7A 1LWXA 2HYFA 2XUBA 1WC6A 5HQMA 3ESWB 3M2UB 1RAHB 4HAMA 1PJ7A 2B3TB 1H8AC 2JUGA 4HZFA 4CQ1A 1W36C 3GF2A 1MWQA 1NLKL 4Y15A 2DO7A 2NYHA 1B6AA 1MBEA 5A8RB 4B9UA 5J2PB 4BYYA 3VPRA 4AU7A 4EM1A 2VU5A 4XNFA 4F91B 2IS6A 5H6QA 2LXIA 1VCTA 2X3DA 4JI2F 4I0BA 2FLNA 3QJPA 3G96A 1MWYA 3HOUJ 1ZHFA 4D5CA 3CCWA 3G8TA 2YWHA 3CTAA 1DDNA 4NYOA 4C30A 1ZM4A 1WORA 2ZFWA 1ZZFA 4RW9A 1SMTA 4LLGF 2WW8A 3IS9B 2LTPA 2DNPA 1W7PA 1LE8B 1MH4A 1RTZA 2G0CA 1LWEA 1AFIA 1IKWA 1OR7A 5HLFA 4P74A 4AL6A 1UHWA 3IKTA 1TL1A 1FTTA 2V2ZA 4OHYA 3OL4A 4B02A 3JTGA 4E7KA 4A3JJ 4OZ3A 2BE5F 2I8EA 1SKSA 1UJ6A 1ZGJA 3DXSX 3KLIA 2B7BB 4DR6J 2PJRA 3LWMA 1L3UA 4CDIA 2LBFB 3N9UC 2XMVA 4G6TB 3CMYA 3OOPA 3GPAA 5J1EA 3H0PA 4U7DA 2LG4A 3W9JA 2HFUA 2LEBA 5ETRA 3LMMA 2AYEA 3ISPA 2QVOA 1FSEA 4HTJA 5BS6A 1M5SA 1RDRA 3QPLA 1YYVA 3PUBA 4IOAQ 2NR0A 2R3VA 3MM6B 4U87A 2QM3A 4NQWA 2U1AA 2V34A 3F8NA 1F4KA 3ULHA 5A0YB 3JB9k 1AUSL 4F04B 3I9V2 2Y0SA 2HS0A 3E01B 5J2NA 2A6OA 4A47A 3BGUA 4RNOA 3ITHB 1VZ0A 3ROUA 3BGFA 3BO3A 1RWKB 4H4KA 1NPPA 1TWGJ 1HPZA 1KHWA 1ZS6A 4K2XA 2DA4A 2CU7A 3M8QB 2WHOA 4HACB 1QSLA 1N75A 3Q8RB 4NRTA 4BUPA 2HG4A 4Q5SF 1TL3B 1YX5A 1Z05A 1K61A 3J80Y 3H5NA 4HL9A 1CEZA 1HBOB 1I6XA 4XIDA 4YIFA 1E3OC 2LLKA 1YJUA 5CCMA 5GTIC 5JVGF 2IGNA 1APLC 5IC6B 2ZM6F 2ROPA 1HCRA 2PMHA 1UCRA 2XKOA 5L3GA 4OYWA 4AT1B 3R9LA 1LDKB 2HK3A 3U9GA 2V50A 4UB6C 2L9NA 2QQ8A 3K8VA 1E2XA 5DM7F 4DZPA 1S9GB 1EQMA 5H9FK 4NLDA 1P7IA 1CULA 2CIMA 5CVUA 3KLGA 1HOMA 2KG0A 2ECCA 3OVBA 3IBCB 2GQQA 2DU9A 2X1CA 1CS4A 4NZ0A 4OHVA 4FNHA 1K47A 5D0HA 2MBFA 1FY7A 1IKVA 4AIDA 2VFUA 4D3HA 3H98A 1G4CA 1XERA 2KFNA 3DHXA 1J9IA 4DV1F 5KG7A 4TN2A 3ISNC 5CYVA 2X1AA 4IRIA 3PFOA 1FBQA 2K85A 2OQGA 1U1RA 5FLMJ 3RCOA 4ZVTB 3HHEA 2BV6A 4WP8A 3AG2H 1Z91A 2LY9A 3G4SS 2PFDA 3OS1A 3SCJE 3CC4S 1TTHB 3GO5A 4B9VA 4DU8A 2K86A 3K69A 3HFKA 3E0JB 1FMVA 3CJ2A 2KKOA 4ZPTR 3FZ2A 4K4TA 1HMVB 3CUNA 1T56A 4G94A 1AROP 3HHHA 2YKPA 2CQHA 1HBXG 2DNMA 3NRVA 2XC9A 2B63J 4P9FA 4DV0J 1TAQA 2XNRA 1G3TA 1ZBTA 2IJRA 1HD1A 3IRQA 1M5KC 4OIRF 2VJUA 2DMPA 3ILLA 2W57A 4LG3A 2ZO4A 1ETQA 1I5OB 3OTOJ 2ASJA 3O8WA 3R1HA 1R0BG 1OJ4A 4KB7A 3MQ0A 4DL4A 3FRZA 3RPUD 2XF6A 1R5GA 2MZQA 2VKDA 3BPSP 5IQ6A 4LUBA 1Q82T 4IQ4A 5CD4H 2XY7A 4J00A 1N5VA 3A01A 4A3DJ 3EICA 2BE2B 2XI2A 3H92A 2PEHA 5JXSA 1V3RA 1ZTRA 1RHKB 4GKJJ 1UVNA 4IL6C 2J0WA 2E5NA 3IXQA 3H90A 3UDCA 4O3OA 5AIQA 4O5VA 1AT1B 2VKEA 3JAMK 4KSEB 2O67A 4BWJA 4U95A 1S1XB 4NZ6A 4WWCA 4WE1B 2IM0A 1SAUA 1F0XA 2MGZA 2XB0X 1KTVA 3HI9A 4ENOA 4UUTA 4WFBQ 3UWTA 3GE9A 3H35A 4AYBA 3AQOA 3BG6A 2K40A 4HX4A 4F2RA 1S8NA 3BPDA 2D9PA 2IA0A 4RNMA 4MKYA 4XLCA 1ZYRF 1HNVA 4I6ZA 3HSGA 1Z2LA 1PSDA 4PG7A 3HRSA 3DFEA 3HSJA 2NUUG 4ZVHA 3GIKA 3S93A 4HLBA 3IWNC 4ITSA 4N4OB 1KLMA 1WTFA 3MDFA 6FD1A 2QUFA 3OSNA 3QNWB 1RWPB 1U1LA 2EJRA 3PSFA 4CH0S 3TJ8A 1WPKA 3G8QA 3OJSA 1TL8A 1YDLA 3QIDA 4ZCLA 2V8HA 2CWEA 3T9ZA 2RU3A 3LSGA 4OHZA 1OR7C 3RPUA 1S1UA 1S4EA 1IUYA 2RB7A 5C42B 3EDQB 2D3UA 2V9VA 1U6FA 1YIJS 2HWHA 3HHNB 4YIRX 3CULA 4LFBF 5HS7A 1JXEA 3JSBA 2Y9ZA 3ENQA 1PAEX 4O44B 1UMQA 1HNWJ 1T03A 2FNAA 2OEMA 1U45A 2VD3A 1BI3A 5JVTA 4DQPA 2HQRA 2VBYA 2QA1A 1TP7A 3F73A 5FLXK 2V63A 4PWDB 4C2MJ 4OQJA 1SKRA 2CSOA 3BR6A 4KRWA 3QQCD 4ZLLA 4UUSA 1KVJA 4RAZA 1WG1A 3GYNA 3F6VA 4IQMA 2QLZA 4M72A 4AXIA 1DRZA 3BROA 1RYSA 2M70A 2DRDA 1M1GA 2W9CA 2BVLA 3VGVA 4A5MA 2LP0A 2YPRA 1S6QB 2KJBA 4LF7F 1FWZA 3ERED 2NYXA 3WTUC 1Q81T 4BEHB 2WA0A 4BH9A 1OS5A 2RSQA 1QZEA 3EXCX 3WTVC 4EFAC 4Y2AA 3WTSC 2KXNB 1KA8A 4CT9A 3T1HJ 1XMXA 4GVBA 3VAFA 3W1YC 1H72C 3PIOF 3V7SA 2FJXA 5F8JA 3F23A 2PC6A 2L2OA 1RTHB 2M0CA 3ZTPA 3BG9A 3GR0A 2W8KA 2E9ZA 3T6JA 2HGLA 5DUKA 3QLHA 2AQ4A 2GA2A 3BZCA 3AOCA 2GA7A 1R58A 3H7HB 1IBMJ 3QT8A 4M5DB 1GK8A 3TO8A 5DGBA 2NXJA 2VG6B 5CYQB 3B54A 3CCTA 4MJKA 2ATLA 2DO4A 3HTUA 2HHHJ 2NOGA 3I71A 3W2VA 1NG6A 4ZVSB 3BLYA 1TKTA 3LSKA 5KFOA 3QWPA 1D8YA 5K8NA 2RAQA 3FHZA 4PZVA 1B70B 3BY6A 4A8OA 1HYSB 2HYJA 3QJJA 2RDPA 4ER8A 4IKFA 9RUBA 4ANJA 3R3TA 5HO4A 3J7YJ 1C4CA 3GG0A 2C2OB 1U1MA 2HS5A 4NLUA 3W62A 4P1WA 4NLOA 1B9MA 4MTDA 4W97A 5E3LA 2Y0SN 3J81K 2HK2A 1V5VA 2ZOFA 4JP8A 2W8LA 1UEUA 4I98B 5M5XJ 1TMMA 3UFCX 4Q44A 1URRA 4RW8B 2XLIA 3I9V9 3AKZA 4ENKA 1G6BA 5TJJA 2A3SA 4QPOA 4Z2XA 4MKAA 1Z6RA 3RKXA 1SD4A 3MFHA 3E6CC 1WHVA 1T3OA 2M3AA 1PJ6A 4NCGA 2GIZA 3L7UA 3MD3A 4N9IA 2MD5A 1ZAOA 2OLWA 3NMRA 2M52A 5KAFC 4V19K 3OR2A 3C66A 4A3LJ 3AA8A 2VJJA 2JJ4D 3PRVA 2Y31A 2QLWA 2HVZA 4DV3J 2ZH2A 1U9OA 3CCZA 1YS6A 1XC5A 2HSEB 1FESA 5GAEI 4C0OC 2F5DA 3NGSA 2ZH6A 4DFJA 2HBYB 4BGDA 4ENMA 5CABA 2XMMA 3AAWB 4CLFA 3ZZ0A 4ICLA 2ACMA 2EH3A 1DGRM 1TKXA 5ILSA 2IS4A 4OI3A 3JSYA 1V55H 2HQ3A 1LXNA 4IFVA 3LA7A 4FF1A 1FJ7A 4MKBA 3E6MA 1FYMA 1H0HB 1Y00A 3WIUA 5B0EA 4X62F 4LB6B 4OIPF 1NJIT 1LDDA 4LFUA 1H9TA 1R9TJ 1MDMA 1L3SA 2HYGD 2KZMA 2HZTA 2CW8A 3KDOA 2XNQA 4USJC 3ZR8X 3CJKB 4CLKA 3ENVA 1PUFB 2HQNA 1Q1KA 1S1VA 2VG5B 3KK2A 2MQPA 3VVTA 1VQSA 4I02A 3ABMH 5I42A 2DNOA 2J9CA 2IVMA 1T3NA 4O3QA 1K73T 3BT9A 4IVNA 1KQKA 3P5TL 2P4WA 3M6UA 1TW2A 2LA6A 4AL5A 2C2NA 2J6UA 2HQAA 5AE1A 1F5AA 2HHSA 3S01A 3NWTA 4LF9J 4XLPF 4ZVEA 5KOWA 2ZZMA 2HGMA 3Q24A 3CO7C 3GSIA 1K79A 3V6DA 3TOAA 2ZNZA 3UNYA 4IH5A 3D5LA 3PV8A 3CDIA 3H42A 5F0WA 3VWSA 2IA2A 3C16A 3OFEA 3DGPA 2V2KA 1BOAA 5D5VB 1ZG1A 2HXOA 2PGCA 2X1FA 2L0KA 5AXLA 1WELA 2GZOA 1SI9A 3LL7A 4E8UA 5J8FA 2V4RA 3WIVA 2JFKA 1XNQJ 4HEA9 4K4WA 7FDRA 3I3LA 1IV6A 2V94A 1N48A 4PR6A 4NNJA 3QYBA 3CJTB 2LQ5A 1TL7B 1M5OC 2L9VA 5J2QA 2Z0GA 2YQ3A 2UU9F 3F41A 4YN3B 3FK7A 2GQ2A 3MURP 4NPOA 3TDUC 2QYCA 3BF4A 4ATNA 3IMQJ 3H5RA 3QIPB 2A10A 3FMWA 2AKWB 1H2UX 3A1YG 4RW7B 4QYZJ 1S77D 2YNGA 1VQ6S 4B3OA 2FJDB 1BMQB 1VISA 1DTTB 3FFIA 1WJ9A 3ILOA 4B48A 1F9HA 4O3PA 3IBWA 3D2WA 1D9DA 3QFHA 3HVRA 2GW8A 2DGVA 2DD8S 4RPFA 1RCXB 4CO8A 1CSJA 2MB0B 1RC9A 4FPIA 4Q8EA 4P9SA 1R7JA 2YU3A 4CLLA 4NXNJ 4E70A 4UF4A 2VE8A 2RNJA 2VONA 1KHVA 2JPBA 1VFCA 4NE9C 2QGFB 4JX6A 1L5UA 3KZIC 1NHAA 4B3XA 2COMA 2CADA 4KFCA 1IVZA 3G2XA 1A9NB 4E98A 3H9GA 4E7LA 5C24B 1YG0A 2EIMH 4M8LA 1UPPA 4FETA 3PNIA 3QSIA 3JTPA 1CF7A 1SV5A 2BJ1A 4AYBN 2YH1A 4BHPA 2KL4A 4DYRA 2PMUA 1QHGA 3NAHA 5DD8A 3EE3A 2KRBA 2XQCA 1FX4A 5DDRC 3NNHA 2MHNA 5D6FA 3DLAA 1GT0C 4KHPF 3M30A 3Q8QB 3I4PA 4I6YA 3SDGA 3U1MA 4F4AA 3TP3A 4PDKA 2YVSA 3ZQGA 2R7DA 3V7CA 1Y7PA 3K89A 2ZXIA 5F3TA 3VF0B 1SJQA 4LSLA 3N97A 1IJEB 3GJRB 1RWXB 4JK1X 2CG4A 4PFPA 2R7VA 4PSXA 3VYUB 1KBRA 4O3RA 3IWZA 3MPYA 1G1XA 2DPIA 5D5UB 3I0TA 2TCTA 1RQ0A 2XHKA 3TRGA 1A35A 1N5QA 1JLCA 5KG0A 5DDPC 4KDPA 2MKCA 2YXLA 4DF8A 3MM5A 5B0GA 5BOXA 2BOAA 5L8RC 4ZCIA 1OMIA 4P2XA 1WG4A 1H74A 5HLGA 5LHGA 3IH2A 5J3LA 3TAMB 1Y56A 3BTIA 1RT5B 3SCLE 2AD9A 4RW6B 1X5PA 3QZ8A 4WFXA 2Q2EB 1LEAA 5EDNA 5DG7A 2DY9A 3KK1A 4F3MA 1YOVB 2RHQB 4MK8A 1HQEB 2JTVA 1BR1A 5DG8A 3IGVA 2M5YA 3OVSA 3C6UA 2I10A 1SJ3P 3SI8A 1JJHA 4KNYA 1SB6A 4DL0C 2MW8A 5F41A 3NWSA 1F5BA 1B8IB 1M5HA 1C0TA 4DR2J 4M5LA 1X1BA 3QWLA 4YY3J 1B72B 3SCKE 5IYDJ 3IHUA 4X4VA 4MIWA 2EW9A 4LIWA 1YLXA 2G0JA 4OZJA 4YDDB 4C8MA 1F5TA 4UY85 1NZAA 5AXNA 4OMZA 1V5EA 2GX8A 2HKEA 3B73A 4JYKA 3TANA 2BW3A 1FEXA 3LAJA 3ET6A 3H25A 1YRTA 2ZXJA 3OR2C 1IAWA 1B99A 3C2BA 2VOOA 1MWZA 1KQFB 3BCAA 3C2GA 5LEJA 4H54A 2LXFA 3W3SA 1ZR2A 4CT8A 3IC7A 3NG8A 4RGRA 2YKQA 4C6AA 2IGKA 4PAAA 5AXMA 3LH2S 4J9SA 4RMNA 1RCOB 4XICA 5F1JA 4BS2A 2UXNA 3BKFA 4WPAA 2OBPA 3BN4A 1WC1A 1HW2A 2XMTA 4WIQA 2BY2A 2VBXA 2JZYA 4EJVA 1FTZA 2F3JA 4ES2A 2Z2YB 3M8JA 5FKKA 4R79A 2XB5A 1S1TA 4FYDA 4P6QA 3O1LA 1HNXJ 4G6VB 2BRLA 3QRRA 1ZN2A 4LF1A 2HAIA 2OKQA 1DQ8A 4OJGA 1H3DA 2HZVA 3BYRA 3HKZD 3SFGA 2DN0A 4AD9A 2CNNB 2KT3A 4HR2A 4IG0A 2CPIA 3LWFA 2CUEA 1B64A 2HQIA 1SC4B 1NDKA 3UVJB 2DNKA 4X4RA 2YS9A 3DXBA 5FGMA 2XZTB 3ZQCA 2JPCA 3DLHA 4ZPWR 1TKZB 4PUSA 2ISYA 4X65J 3HOWJ 4HT7A 4YEJA 1CJTB 3AHPA 5K1YA 4UZCA 2RAEA 2ASYA 3PX6A 1FRLA 4PWUA 3VSKA 2R7RA 4ELVA 4QTRA 2R3SA 1Y5IB 1BBYA 1X2MA 4ED1A 4DL3A 3G4SI 3CC4I 4EUVA 2YPZA 2JLFA 1J59A 2LDIA 1N33F 4KY3A 3UNGC 2ZUGA 4PKDB 2JN6A 4X4PA 2FX0A 1XQIA 1YJWS 5IQQA 3KK3A 3BN7A 2HAFA 4UV8A 4E0DA 2EBEA 2D3O1 3GTGJ 2QX0A 2J5OA 1Q8IA 5KFAA 5M3MJ 1USSA 2BY3A 1JKHB 3MPUB 3JYTB 2CJKA 2FVPA 5F8HA 1IN6A 3CDEA 1MMGA 3L00A 2HZDA 2NVUB 1O6XA 4P5OA 5D4LA 1FBSA 3LFUA 2EFVA 3CJQA 2OZUA 5H9FJ 2M2BA 1XK8A 1WC5A 3KG1A 2EFOA 4HF1A 2JVHA 2KJVA 2IM2A 3I87A 3HKZA 2EFPA 1QAXA 2OD6A 2Q8KA 2Y30A 2C2MB 1DFDA 2C22A 5E8IA 4LBPA 4L72B 4LB5A 1JLBB 3K10A 2HLUA 1D5VA 3BREA 3W65A 1XD7A 3U2RA 2IAJB 2P6SA 2DJNA 1LFPA 1U8WA 3G1OA 2RQQA 4M3DA 2FBHA 3OV8A 1LVKA 1G3WA 4DS5A 4A3KJ 3PIPQ 3LAKA 2JSCA 4Y4RA 3IR6B 5FLXZ 1YLFA 3VB2A 4IG3A 2DH7A 3GCMA 4LIRA 3KHGA 3A4TA 5BYRA 4FT8A 2ZKUA 5A76A 3DOMA 1YW9A 1NK5A 1FIPA 2CA9A 3KP3A 1PUEE 2RGVA 2JDJA 1H88C 3KUHA 3TOBA 4HI2A 4JI7J 4F7ZA 4CCKA 2XAGA 4ZHRA 1BC6A 3U1KA 4P7TA 4ECSA 2DRAA 4WYWA 1OPCA 4ZOSA 3W5XA 4FYXB 2VIXA 3FEYB 2FEZA 2V6AA 1RT6B 4HPQA 2JMWA 4EGYA 3CCVS 4DF4A 1VQYA 1VQNS 3OQ2A 5MLCV 2JRMA 4M5MA 1X4OA 5GPAA 5FJ8J 3DI6B 3EZUA 3HDSA 5GAGU 1C0UB 1EJ7L 3I6PA 2ZH7A 1YHQS 3J80K 3FEXB 1PVEA 2B9XA 2WONA 3EYYA 4JP0A 3KUEA 2XROA 2BQUA 3L95X 2M34A 5LXYA 4M3GA 5B1AH 4B3AA 3AY0A 2EI5A 4K0KF 4HHJA 4ED0A 2DK8A 1I3OB 1YIJI 5IT9U 3TP0A 3KYLA 5IZHA 4C3IJ 2JA8J 2A61A 5DEQA 3W5YA 3OTCA 3TZXA 2G2YA 1MIJA 3KWMA 1QE1A 4EEYA 1SQGA 2I9SA 1FWLA 5LMUF 3PX0A 3JR9A 4E7HA 2QSGX 2EC2A 1ENHA 3C15B 2DDAA 1JUSA 4OMFG 3J81Z 4C0BA 2G7HA 3CD7A 2OI2A 3R97A 2V1UA 5KFKA 5D77A 3MEEB 1B9NA 1JLEB 3NS7B 4J90A 3QO9B 2OO4A 3TA1A 4RAGA 4C8KA 2XGPA 1RBAA 2Z4PA 4J9UE 3TUPA 1T39A 3PACA 3TOQA 4L5EA 3M8EA 1X5OA 1N78A 3BM7A 4NLTA 4QWAA 3DFGA 2M7SA 1DLOB 2GBYA 2JZ5A 2CVEA 3KJNB 3NWRA 4OWRB 2ZKTA 3KDNA 4JOMA 1RKJA 3JREA 3ETMA 1R1VA 3M2UA 2GFFA 3NY0A 4KO0A 4U8YA 4Y7NJ 2ISZA 4N76A 2V1XA 4OMYA 5A8RA 5J2PA 4DSLA 4WZQA 1IDZA 5KG2A 2F5EA 4DR3F 3JRDA 1W25A 4UTGA 3MFKA 5B0AA 4ZDLA 3TQNA 4ZCKA 2CH0A 1T9VA 2OEJA 2OJ3A 3EUNA 3K7RA 1JUMA 3OR1C 1BR2A 1F1ZA 2FHKA 3DCFA 4OYOA 4OIXA 1FP1D 2M8HA 3TW7A 4B3MF 2HKXA 3VR1A 2XB2D 4DUYJ 4DR5J 4Y0FA 3H0DA 2CV2A 2XKPA 1KONA 4J9RA 4L0ZB 3SQGB 3BYPA 1LE8A 9ATCB 3BCBA 3IV5A 3P49B 2CNOB 2HYIB 3CJRB 3W8GA 2DW4A 5E8GA 3S1TA 4UUWA 2HBRB 4A8WA 4L76A 4OIOF 4PZJA 3LAMA 2MJNA 4FVMA 4MNUA 3I4NJ 3MEDA 3HZGA 2MQOA 2HWIA 2HOSA 3G1LA 1VLYA 4RGXA 2LU2A 3K2ZA 2E1NA 1VFJA 2HMIB 3NP5A 3VHQA 3GFJA 3ONQA 4L74A 2PN6A 3QMQA 3FBIB 2XF5A 4Y2IA 2ID3A 3KLOA 3ZN1A 2H5EA 3QGPA 5LEKA 3MXHP 5JMNA 2DGWA 2IYIA 5HS8A 2V4JB 3QOEA 2NS7A 4L9VA 4EBDA 3QRQA 4MEYF 2C42A 4PG5A 4ED7A 2LQ9A 4TYBA 4HV6A 2A68F 1OCTC 3MM6A 2MGQA 2RS8A 1IDYA 5A8WB 1P6RA 2K27A 1MMSA 4PPDA 1TWHJ 1SC7A 2HPIA 5A0YA 2B0GA 5IFMA 2D1HA 4RUCA 3UDLA 3E01A 1RESA 4CLTA 1S6PB 3ITHA 4BY1J 5J2MB 4HDGA 5B1BH 2C3UA 5C4JJ 2NAZA 4S05A 3LWLA 3M8QA 2QYOA 4HACA 2AU0A 4JV5J 3GR1A 3ISZA 3DTIA 4DFKA 3RZDJ 4AUXA 4BE2A 1VTNC 3D1QA 2LCWA 3TUJC 3CC2S 1QU3A 4JI0J 3M1CA 5L3CA 3IAM9 4WWSA 1HBOA 3OY9A 4XSZF 2DR5A 5HVFA 5C2CA 2RMLA 3S2WA 5ETNA 5D78A 1JKOC 4ZN3A 1Z21A 3FGVA 3CGIA 2FVSA 1RTIB 2V6CA 5B08A 1UVKA 2QA2A 1KQGB 4ES1A 2GHPA 4JX5A 1W26A 2HFOA 2ZVSA 2DB1A 4LF6F 3HUGB 2FJ1A 1N77A 4USWA 2XGQA 1S9GA 2ATCB 5HMWA 2JVOA 2VJVA 3RZAA 2W7OA 4I2OA 4K4SA 1Y11A 3HRTA 2EILH 2CW0F 1SFXA 4FS1A 3FCVA 2QZ8A 1WWXA 2E35A 3KEYA 1UETA 1HKAA 3EVWA 1ZAWA 4HT5A 3DRYA 4WU2A 2XV4S 3I0SB 1WH5A 2GO8A 4ZA1A 1HHSA 1WHXA 2BJ7A 1LW2A 2DPDA 1MU2B 1REVB 2UUTA 2VDIA 4LVNP 2F4FA 2DK5A 1V3SA 1WI6A 4CP5A 4WCEQ 3HT3A 3UN5A 3HKZN 1FRXA 4CLYA 4TU9A 1RT7B 3LF0A 2RV8A 4MGRA 1DPUA 4NUBA 1MBGA 4K4VA 3D1NI 5BQTA 3X1LB 1DU0A 2AYGA 4GKKF 2UXBJ 5F8GA 4XONA 3LSJA 1HMVA 3D3BJ 4W98A 2B9YA 4ECRA 4CH7A 3UN2A 1YQHA 4ABZA 2JHEA 1UFWA 3BPXA 1RGVA 4BC7A 5EEAA 4EO6A 4XN0A 1IV8A 1N34J 4LFAF 3RYLA 3JQMA 5KFTA 5CD4A 3RW6A 4YOEA 3JRGA 2E1CA 4S0MA 3O8GA 1M5VC 3LA2A 4R8UB 3J7AY 1FKPB 4FF3A 2FRHA 3L3CA 1R7IA 1W5CC 2R7XA 1Q95G 4NLRA 2DCUB 5ETLA 2KVQE 4G1QA 3FMBA 3V81B 3X3UA 4Z7YA 1OYWA 2J5PA 1FRKA 1XTAA 4KIFA 3GTYX 2BE2A 2O03A 1NRKA 3CMMA 2CVIA 3R6GB 3ZPLA 2QA4S 1T38A 4WFNQ 1K1QA 2HS4A 4TY8B 2FQ4A 2MKKA 1KNZA 1NKCA 1R49A 3THPA 2QTWA 4W92B 2MH2A 1S1XA 4WE1A 4PFOA 3E2EA 3FZBA 4CICA 2BVMA 4NXMF 2HZAA 1VQ7S 3GTLJ 3F0CA 2L08A 1TNSA 3JW4A 4DV5J 1H2TZ 4OIQF 4GMKA 2DXFA 2DMUA 4C9DA 1UJ8A 1SPBP 4IRDA 4RWXA 4FDFA 3Q22A 3BTJA 2W1OA 2XAHA 2V7FA 4LRCA 2ZBIA 1HW8A 1JT6A 3PUFA 3TEHB 4NLSA 3NRBA 1O5JA 1VI0A 2PSZA 3IWLA 3R5AA 4JI5J 1N88A 3K57A 3AD7C 2DA5A 1HBUB 2KM8B 1VQLS 4G9YA 2G4BA 4N47A 1SJFA 4WKRA 2ZHOA 4ECXA 2YQ1A 3K8WA 1AUDA 2VOPA 4ZPBA 2V2VA 4IF4A 2UVWA 2JSXA 1BC8C 5ICCA 1RTJA 4YB5A 3MAQA 3KUGA 2K02A 2NS0A 4FX0A 2Q6BA 1LEOA 1E0EA 4L9NA 4O44A 3BGLA 4BE1A 1C1CB 4PRFA 2DRBA 2UZAA 3D1OA 1ACMB 1VS3A 3SV4A 2ZCWA 3CCRI 1U5TB 4FHTA 3HEFA 3NBPB 2MPUA 2GMJA 2XGXA 4DUZJ 2E36A 2FB0A 2UP1A 3RQ4A 4PWDA 2I6WA 2J7KA 3PRDA 5LM7E 3VQTA 4HHHA 2RQMA 2IGOA 1OCRH 4CO0A 2OFHX 1FEHA 3LGHA 2ACJA 1QVFR 3I5CA 5L1JA 5L3BA 4DR7J 4Y65A 1UPMB 3TBIA 3RBDA 5A2QU 2F8MA 2L9WA 2VB6A 4LF4F 4CYCB 1M90T 3PIPF 2J9DE 3RKWA 1S6QA 3KIOA 4QW8A 2OCEA 2HQDA 3DLEB 4ZVUB 4K50A 4BEHA 2DHHA 4ILRA 2JA2A 2HGCA 2MLXA 2Q66A 4P72A 1LB2A 2KIUA 2F5VA 1Y0NA 2EXUA 2IM3A 2CV1A 5IOYA 4I64A 3F8FA 2PI5A 2DTRA 4A8YA 3PYDA 3HTSB 3OS0A 4KE5A 1RTHA 4XO0A 1JXVA 2BY0A 2VQEF 1GTEA 4L9JA 3P4UB 1U9NA 4PGGA 2BJ8A 4JYAF 1IN5A 4DPXA 4M5DA 2W2MP 4U88A 1T9XA 1YFHA 2VG6A 4OFZA 5CYQA 1UFLA 2Q3PA 2H94A 1YIOA 2RRBA 2YU9J 1ZYQA 3PVXA 4E4HA 3ZQIA 5IT9Z 3UDVA 2FHMA 3EX7B 2VHGA 2GS8A 1S6LA 4M3BA 4NBQA 2VH7A 1RUNA 3MGJA 1R8BA 1FXRA 1X4AA 1VQ9S 1HYSA 2ZMEC 1NSQA 2RRNA 2QEXS 2NZ4A 3WDOA 4O0NA 3KNGA 3L09A 5LL6d 3P8BB 4UVAA 4CYUB 2AJ4A 4ZYGA 2A6HF 2YWGA 1YBUA 4I01A 1QJHA 3PQJA 4YFKF 2JEGA 4OYBA 5IOLA 1UEKA 3TGNA 5RUBA 4U7UK 3CD6S 4HDHA 1R00A 4RW8A 2ESHA 5K5QA 5F9LA 3C19A 2HHTA 2VG7A 2H54B 1YJWI 2CGPA 4DMZA 2QLXA 1RA6A 4KITB 5L3FA 5D4NA 5BMZA 4ENJA 1KC8T 3RAQA 3KHLA 5E41A 2KISA 3DBLB 1H7XA 5I3QA 3QAUA 1IWGA 2G1DA 4FNIA 5J4VA 4XPEA 2NZCA 4H4OB 5GAHI 2OPRB 2DNHA 4PJNA 1AHDP 1RJJA 3MM7B 2WV0A 3H3UA 1T9WA 2CQPA 5F0UA 5FO5A 1LOUA 5LFAA 3BDPA 1TL5A 2QO3A 3D9BA 1HBMB 4OAYA 4RLQA 1YJRA 1RTDB 5IYBJ 3W2AA 2W9BB 1B3TA 4ZVRB 4N4NB 3U7JA 3NOGA 3QBCA 3KNAA 3F9KA 1B0VA 3CJKA 4G12A 4DSFA 1PUFA 3K5LA 2HVIA 2V2QA 3R2CJ 1FEEA 1WKKA 2QWWA 2V4QA 5C4XJ 3OUYB 2E34A 4BQOA 5LGUA 4LSZB 1NK3P 1J2VA 1U02A 4P75A 4RLEA 3TZWA 5DETA 2EFGA 3ENAA 3PX4A 3I56S 3S8SA 5KG5A 4ZTFA 5H9EK 2MABA 3BR0A 1IM4A 4CO4A 4IHWA 2CJQA 1ZRDA 3RBXA 3G71S 1NPRA 1U26A 1DAXA 5AXKA 1SKWA 2EPFA 4IYQA 4V19X 4Y6IA 2ZC4A 1WWHA 4USKA 1IN7A 1IO2A 4XOTA 4QWDA 4NX9A 3GBGA 3C2HA 1RI7A 1IBKF 3Q8UA 3CUQB 2MKIA 2HFVA 1EIYB 2FVRA 2WK4A 1NJWA 3V2UC 3GIIA 1UKUA 3GUDA 4CA0A 1S5ZA 4CGZA 3S14J 2F7VA 5F8LA 3MR7A 1VLOA 1SVOA 1YQAA 1H89C 1EH6A 2CMPA 3IRXA 2MLKA 1YI2S 2HHUA 5GAGJ 3V6JA 3JSMA 3QODA 3ZZRA 4HRIA 2DXEA 2UVUA 3VAIA 3CCVI 4L18B 3N6MA 1QZZA 1VQNI 3K1MA 2L5QA 2L9SA 1YVFA 2DNNA 1GV5A 1NH3A 4XRSA 1O3QA 3CJTA 2D45A 1FF2A 1TL7A 2ID6A 4LQ9A 1YHQI 3H59A 1RBOB 3OL8A 4M71A 2QN6B 1NKEA 3DM2A 2L9DA 3S2HJ 2XS5A 2QL9B 4RW7A 2WVCA 2F4VJ 4I76A 4HG2A 5IOZA 1PJRA 4NLYA 4DSJA 2D5VA 4HQMA 3WC2A 1DTTA 1JUPA 1OCOH 1ZGAA 5DM6F 1VK8A 3SFIA 2IDLA 4UOGA 5HQ8A 1BW5A 2QFJA 4J9KA 4KN7X 1KQSR 3H2UB 1CQMA 3L7PA 1EH8A 3HJFA 2CZ4A 4JI3F 1JI8A 4QIWN 3AB2B 3I59A 2QL5B 3K0JA 4W4MA 4A3FJ 5HJYA 1X1CA 4IQJA 2BE7D 3AODA 4BBRJ 3M2VA 1FCAA 1Y0HA 2LU1A 4XAKA 5C24A 4J91A 2F8EX 3JTHA 5GAEU 1X9WA 1ZR4A 4P52A 1WSRA 3ZCOA 3K2YA 3O6BB 2EQRA 3LSRA 1DJ0A 1RWNB 4Y28C 2V67A 3L2VA 3M8PB 2CJJA 1FK9B 5FRNA 1WI8A 2W7PA 2I5JA 1QGPA 4ED2A 3MAAB 4J9LA 2X3GA 1ZZNA 1T0FA 5EG0B 3DRXA 2WTFA 2R8HA 4OZNA 1WC4A 1HQUB 4N5SA 1WJCA 5LT5A 3EZ5A 5L1KA 3KJFB 3ABUA 3G73A 3OS2A 1WEZA 1H0MA 3CO6C 2TRTA 3NAIA 3PJWA 1BL0A 1JLGB 2KLOA 3RDIA 2MY8A 3W66A 1MG7A 2CS3A 4L5IA 5DZ7A 1NMEB 3ZZYA 1FP2A 4KH1B 5EX3A 2NQPA 4HV5A 3TR5A 2EINH 4W1UA 4B9NA 2FY1A 3H3VK 2B56A 4WP3A 4LFCF 3UPFA 4A48A 5HROB 2MZJA 4HYEA 4JI4J 3DLLQ 3EUHA 4G7OF 5CYJA 2HVRA 2DY1A 2IMWP 1UJ5A 3IH3A 3GG1A 3DGVA 3AXKA 3F3XA 1Q7YT 1D0EA 1X5SA 2CQDA 4Y52J 1ON2A 1X4DA 2BJEA 3AA9A 4AL7A 1F5CA 4ERDA 4PSWA 4QYRA 1W2BR 1K8AT 3TAMA 3ASOH 2L41A 2CQCA 4WIIA 1A0OB 1QPMA 2VJ4A 2R93J 4RW6A 3ZQLA 1HBNB 2WZ1A 4USTA 2Q2EA 1Q8KA 1WZ2A 1FXDA 3A02A 5E20A 5A8KB 1IRXA 3RTVA 1N5SA 4ANDA 1A5JA 1HQEA 1U2RA 3QYEA 2HVSA 3EWGA 1T9YA 1WF1A 4DR4J 1O0PA 1JTXA 2BOPA 4JOUA 5G0RA 1HI0P 2RDDA 3DKDA 2HWTA 2E9TA 4F25A 3PDNA 1QAIA 1HW1A 4DZJA 2Q6CA 2BHZA 4I09A 1PILA 3FVYA 4M3FA 1E6YA 2HU9A 1DTQB 2D9OA 3JTNA 2LH9A 1EZZB 4X62J 1Z9CA 1RT4B 1Z3YA 2OSQA 5IT0A 1OJLA 2R7WA 5J40A 1D8JA 2NPFA 4RS8A 4MO7A 2IVYA 3F8MA 3QGGA 4C48A 2CDRB 4ITVA 1WDTA 4ZIVA 2MDAA 4NI2B 1Y1WJ 2RC4A 1RAFB 3L7WA 2UUBF 1BE4A 1X1DA 2CO5A 2IAIA 3DYAB 3LP1B 1XGNA 4WXOA 2KT5A 2NCKL 2OPSB 2MLYA 2ZJPQ 4WFZA 1N36F 2ZEJA 4KHRA 1ODDA 5KG4A 4QWCA 4FE4A 3IFEA 2HNDB 4ZJQA 2VC1A 5BNGA 3IBFB 2ZFUA 2LC2A 5ERIA 1XWLA 5KFEA 1NK4A 2YWWA 1JLAB 1I50J 1NAQA 2XSJB 1LWCA 2EPIA 3VFZA 2LY2A 1X8DA 3K4MA 3SYTA 1AB8A 3I0RB 4O3NA 2EV0A 4TU7A 1I6HJ 2QMWA 3ZP5A 3HHLA 1ETWA 4UUVA 3PEJA 3UVJA 2E1PA 2VQLA 4UOCA 4ZCMA 5IP7J 2WOMB 2AX0A 4UVBA 1STZA 2WWYA 1WHWA 1IG7A 3CD5A 4KISA 2CQ3A 5C7PA 1TKZA 5KFWA 5F3ZA 5D4RA 2WVEA 3HPHA 2N7CA 2K9QA 1T08B 5JHFA 3I9ZA 4KPCA 1T6SA 1M5PC 4LRFA 1FKAF 1QZYA 1NB2A 1RT3B 4Y17A 5ILUA 4NCAA 4B3RJ 2D1VA 1KRPA 2P5LC 1T9UA 4YB6A 2HFHA 3WU1B 3IH4A 4TQRA 1XMOF 5GTHC 4OI0A 2R8KA 3Q8PB 5FD6A 1KEKA 4ED3A 3TJAA 4B3SJ 1D1BA 3DDKA 1PYTA 3ZQHA 2GAHC 3POTA 3L1PA 2HGNA 3CMES 2HLTA 4WXCA 2MHEA 2JC0A 1KZHA 2Z2ZA 2LK2A 2RQ4A 1XMAA 3OYAA 1VRQC 5K20B 3GTQJ 3KLFA 1VQOS 3ELHA 3CJ0A 1FKOA 1DPRA 2XEXA 3AQPA 1KOOA 2CPEA 4D1QA 1KDNA 3E1SA 1JKHA 3JYTA 2DPUA 1EKSA 1I94F 1CVJA 4P2MA 2V6EA 2RUSA 3KMQA 1RUOA 4ETZA 3HO1A 3LSHA 4OZLA 3MPDA 4QU6A 4J9MA 3HOSA 5K7HA 4OJ3A 1U47A 2AXLA 2W9AA 5DGAA 4DPOA 1RACB 2CWXA 2I5UA 1VQKI 4WU3A 3GIJA 1U78A 3EDPA 4Q0BB 1U24A 1G2HA 1OFCX 3QRFF 4EJUA 3OL7A 1WF0A 2NS8A 1TMJA 2XI3A 3PFYA 4URQU 3KETA 2IT0A 3MM9B 5HNFA 1HI1A 1JLBA 4C0HA 2O1PA 1ETYA 2KYXA 2VQFJ 2IAJA 2CW7A 1S10A 1VQ5S 2C3MA 4R5PA 2QA4I 2DR8A 1M1KT 1FX7A 2IY5B 4LG0B 1S72S 3MMCB 1VC0A 2HEOA 4IO9Q 1D0YA 1BA5A 3LGNA 4O3MA 1CJVB 2HPMA 3JCUC 2R8IA 3CVKA 2HHQA 4M3EA 1VQ7I 1A6QA 2FOKA 3A13A 1UZDA 2VA2A 1H2VZ 1NJZA 1C0WA 2ZJRF 4KTQA 5E0OA 4OL8A 1S3JA 3DPLC 1X0FA 2QLFB 1Z2ZA 3PNVA 5B0FA 1A36A 1QD1A 5DD4A 1ZAXA 1TBXA 3S15J 5E2QA 3AL0C 2IJLA 4DR6F 5GMKa 3HD2A 3FBEA 1OY6A 1K83J 4TU8A 3P96A 1Q78A 3WZ0A 4XPCA 3M3YJ 2A6TA 2PLYA 4NLXA 3OYIA 5ICEA 2HVHA 3RR8A 1ETOA 2EBIA 3ULQB 1RT6A 1X31C 1F43A 1DBDA 3EYIA 3EUHC 1YTYA 5KFRA 4WTOB 3QQAA 3LAPA 1VQLI 3WTTC 1MMLA 2XMAA 2A5YB 3U1DA 3DI6A 4CHUA 1C0UA 2DOFA 3HOVJ 3D0IE 2FBKA