2VOOA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
MAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vooA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vooA02
4HDVA 3M8EA 2FBIA 1WRJA 3F8NA 2M8DB 3J81Z 2CO5A 1YIJS 2E5GA 2IT0A 2CQ2A 2CPEA 3FXUA 4IHTA 1M5PC 3BJ6A 4OZ0A 3DP7A 3MZHA 2JT1A 2JPBA 4PKDB 5LBQA 2KJCA 1Q86T 2E7WA 4U0WA 4RU2A 5HLIA 1DZ5A 1VQMS 1SMTA 2D1HA 5JFRA 2J5OA 1U1PA 5LEJA 2KRBA 2XIGA 1R1UA 1WHWA 2QFJA 2FPHX 3W6JB 3PIOQ 1O3QA 1FC3A 2ZJQQ 3DEUA 3MEXA 1D5VA 3VOEA 1LVAA 4RGXA 1ULYA 4AVPA 3CUQB 4ZZLA 2LSOA 2VT2A 5BQTA 2K3KA 2KM8B 1J7KA 1JJ2R 5HL7Q 5DETA 3CO7C 2DO0A 2D9PA 2CQHA 4HZFA 1IXRC 3R27A 1ZGJA 3RYRA 3LQVA 4HV6A 1Q1HA 1XB4A 4O6JA 5BJRA 2CPZA 3LAPA 4Q5SF 2LXIA 2HR3A 4KNYA 4TLQA 2MLKA 4G6QA 3GFLA 1G4DA 3CMES 3WODF 1ZRFA 3LPYA 1SFEA 4QWQA 2Z99A 4IUFA 4L18B 2PFBA 1AOYA 1ONVA 4C4WA 2Q8KA 1T98A 2RQPA 4A8XA 2FEZA 2XV4S 2PI0A 2FE3A 4IRGA 4G94A 5D6FA 2RVJA 1FT8A 4LK1F 2P6SA 2L3DA 3WGIA 3FHZA 3H3ZA 3TO6A 4HX8A 1UP1A 4MGRA 3Q9VA 1TQMA 2CPFA 4KICA 3KP6A 2C6YA 5E8GA 2KU7A 1A7GE 1M90T 3MCZA 1U5TA 3BOQA 4U7BA 1WF1A 1KYWA 4XLPF 1IXSB 1LQ1A 2PMHA 4PGHA 1B7FA 1KGSA 5HS7A 5JI6A 2HGNA 4IOCQ 3GFJA 3G6ES 1R22A 2H6BA 3QPHA 5ILSA 4G8XA 3IWFA 4GYIA 2J8AA 2NYXA 2ETHA 1VQLS 2N82B 1RUOA 2J5PA 4MTDA 3VALA 5IT9K 2KN4A 3RKXA 3R0AA 5H1SV 2FU4A 3NRVA 3SZTA 2DIUA 1RI7A 3CPWR 5TJJA 2O61A 1KQ8A 5D5VB 2RUGA 3ZN1A 1P4WA 1F1ZA 3REOA 5D4SA 2VE9A 2BV6A 4U7DA 3RDIA 2EV0A 4A0XA 5JVGQ 2BOPA 1VQ4S 2TDXA 2GZWA 1SAXA 5LRRA 2KRFA 4KFCA 5DM6Q 1UAWA 2MKKA 2Q79A 3PQJA 2HVZA 3RW6A 5L3BA 1M1KT 3SXYA 2FBKA 1FWZA 1USSA 3FXQA 2RQCA 1WTBA 1QQIA 3HOTA 1FSHA 4Y13A 3DXBA 1P27B 1W7PA 5L3GA 4ASNA 5D8LB 4OZ1A 3EUHA 3P9KA 2FHOB 4HF0A 1O7LA 3HRUA 4HQEA 1IN7A 3CUQC 1W5TA 4BXUA 2BEOA 3ZPLA 1VQ7S 2D1VA 1HQCA 2XAFA 3HIFA 2X1GA 1R36A 2SXLA 4WIIA 2IA1A 3TYTA 1AWCA 5FD5A 1YITS 3LSTA 3E5XA 4M74A 2P5LC 1KU7A 2ZNYA 2XKOA 1LDJA 2CPDA 1EH6A 3Q9SA 4CQ1A 3CO6C 3ZQ7A 3G8TA 3CLOA 3SDEA 4WXDA 2P4WA 4P6QA 4MTEA 3TP2A 2RS8A 1TQIA 1KC8T 2QQ9A 3NNHA 1OYYA 3JAMZ 3ZN0A 4QQBA 2MKJA 4WXCA 2JPCA 1OIAA 4IJAA 4ZH4F 1VTNC 3L2CA 3KCCA 1X4AA 5LGTA 5LSOA 4U88A 2H6CA 2VC0A 2HTJA 1BIAA 2NRAC 2ZKZA 3I54A 4UHTA 1GXPA 3L00A 4KIGA 4M6YA 2ISZA 2JZYA 4Q4ZF 5IM0A 1ZGAA 2WV0A 1DDNA 3R0JA 1G3TA 3EYIA 1T2KA 4F26A 2KT5A 3TQNA 1B1BA 2LEAA 1TTYA 3KFWX 1DP7P 2DNLA 2DNGA 4A6DA 1LDKB 1ZARA 1S72S 3FWEA 1FBUA 2ZO4A 1JXSA 1XGNA 1P4XA 4ETSA 2FMYA 3WTSC 3LWFA 4Q47A 1MD0A 2MQMA 2ADUA 4LGWA 2V1DA 4FXVA 2F5CA 2R7FA 3PFIA 2DTRA 5LXRA 3GXOA 5D78A 4M6XA 4HLYA 2DGUA 4IO9Q 1FJEB 2CPYA 3SXLA 4LD5A 2CQ3A 5GAGU 3VAMA 2CPJA 2DQLA 3EGZA 5KVRA 1Q81T 3CC7S 2OD5A 2E7XA 1F4KA 2DGXA 3QP6A 2QENA 1L3KA 2X1FA 3UE2A 2RRBA 5DCMB 4AIJA 3HRTA 5F6FA 3PIPQ 2MGZB 4QLCU 3J81K 4U67Q 1HXDA 1SJQA 5DUIA 2EWNA 2DGTA 2G4BA 3EGNA 2E5HA 1G3YA 3T5XA 5CVRA 1K6OA 2VODA 2DHXA 1ZG5A 4L9JA 2STTA 2HYFA 3ULQB 2K86A 2DHAA 1LNWA 3HRSA 3BJAA 1Z6RA 4ZYHA 3VAKA 4HYEA 4L9VA 1BI2A 4IPAA 5LGNA 1PP7U 2HFHA 2ZXJA 4D0PA 1NO8A 2PEHA 2VBZA 1VQ6S 1FNXH 2MZJA 3WGHA 4MEXF 2K4JA 2XAHA 2CQBA 2HKXA 5BS6A 1U6GA 1I5ZA 2OQRA 3U9GA 3FM5A 2DK8A 3N97A 5KK1A 2K8GA 3BZ6A 3DFGA 1DRZA 4IVNA 4LJMA 5FLXK 1WG4A 2PE8A 2P7CB 5E1ZB 3GUDA 5L3FA 2J76E 4KT5C 2Q0OA 4PCQA 3K0LA 3GX4X 1ZZFA 3RW7A 3CC2S 2MQPA 3P6YC 4FX0A 1YO5C 1L0OC 3CD6S 1YG2A 4G7ZF 4RGRA 5DM7Q 2N7CA 2HGMA 2ERRA 1FXLA 3T1BA 2VBXA 2ADCA 1VC5A 4EMSA 4ZKAA 1D8KA 2DGWA 1WEYA 3ZMTA 2MH2A 4R79A 4W90B 2X4HA 1KOOA 1TLHB 3ABTA 1IQTA 1QPMA 3U2RA 4ZZDA 1UFMA 1TNSA 4YG2F 1U8RA 4CIOA 1NU4A 3FZVA 2DO4A 5CVJA 4KN7X 3MI7X 1HD1A 4KA4A 4I0AA 2OZUA 4KDPA 3MUMP 1X5TA 3BS9A 4F02A 3GWZA 1VBZA 3HI9A 1VC6A 1O0PA 3UCUP 2CG4A 5FFZA 1S6LA 1PP8F 3I71A 1G3SA 3NEUA 2V94A 2ZMEA 3M7GA 4WCEQ 2XGXA 3RKWA 3BEGB 2EFWA 2DHSA 2LCWA 2GXGA 3CUOA 4F7ZA 4U0YA 3CCRS 2NAZA 1X4FA 2VN2A 3ML6A 2YPRA 1RKJA 2E1NA 3LA7A 4CDGA 2L01A 3BPXA 3MURP 1YJNS 3CULA 4G6DA 4A5MA 4BH9A 4GXOA 2ISYA 1EH7A 4UVCA 4B8XA 3B02A 2PEXA 3SFZA 2HTSA 1N54B 2H09A 3JTHA 2KM8C 2A61A 3CMAS 1HW2A 3E97A 2G7HA 4CXFA 1TNTA 2DNPA 2MJUA 3BP8A 3V8JA 2Q2EA 2D9OA 2I38A 3HTSB 3G9CA 1YFHA 3CCJS 3CCQS 3F8FA 2QWWA 1WELA 1X5OA 3R1LA 1D8JA 3I5UA 5HDKA 1R1VA 2DI3A 3DKWA 2OJ3A 2HYGD 1YTYA 4Q48A 3ECHA 5LSLA 1Q82T 1CF7A 4HOBA 2XASA 2ZBKA 1FHTA 5LRSA 2KHCA 1OMIA 3O2PE 1WWHA 2QBYA 4PRFA 2CQCA 2O3DA 4A6EA 2GA2A 1T6SA 4V19X 4LG0A 3C18A 3WTZA 1JMTA 2YWKA 1IN5A 2Y0MA 2MPUA 5TRDA 2MYFA 3RJPA 4KIFA 3B4DA 2AYBA 1ZLJA 1OPIA 1KYZA 3US5A 3CCVS 1HA1A 1XSXA 4UY8T 1YI2S 3K0JA 3OW2R 3L7WA 3CXCR 3CUNA 1Y0UA 2ZFWA 1WHXA 4LIRA 3WE2A 1H2UX 3I58A 1DPRA 3E6CC 2LNBA 3RI4A 1MKMA 4I09A 1YJ9S 5JHUA 2QVOA 5DDRC 3KZZA 1S8NA 4UVBA 1SD6A 1HW1A 1T38A 2EFPA 3ZMUA 5HO4A 4EJOA 3IRRA 2X1AA 3O3KA 1UB9A 3BO3A 2M52A 3FEXB 4WK8F 2ZJPQ 2ADBA 2JX2A 3CJNA 1WG5A 3QPTA 4AIKA 1VQNS 4EQQA 2HGCA 1OYWA 2MC3A 1SD7A 1E17A 4LB6B 3VAIA 2A6HF 2MB0B 3KZYA 2HQRA 3LFKA 2UP1A 2YX7A 1FBSA 1ZREA 1JHFA 1IZ1A 3KP4A 4PR6A 2GHPA 1VQKS 5HLHA 5HDGA 3WG9A 4RAYA 5AONA 5ICGA 4Y0FA 1R1TA 3K1PA 5D5WB 3DLLQ 1P6RA 1ZN2A 3RYPA 2N3LA 5FD6A 3NQOA 2NS0A 3IC7A 1C0WA 2EK6A 4WFNQ 4WX9A 1J0RA 2H94A 3HSEA 3MQ0A 5HS8A 2MQNA 5E20A 5ICEA 5CJ9A 3I64A 3OV8A 1KQ9A 3GF2A 1R7JA 4ESBA 1WF2A 1FSEA 3VAJA 3DQVC 2OZ6A 4WF2A 3UCGA 1QZZA 4HW0A 2JVRA 2DH7A 1YJWS 2I2YA 2O0YA 2YH0A 3H92A 2XAGA 4A0YA 1SD4A 2EFQA 3SHFA 5JR3A 1UFWA 1TBXA 5BOXA 2W85A 2GO9A 1XMKA 4CYDA 2L02A 2DGOA 3EETA 3THPA 2WTEA 5A2QZ 4IHSA 3F3XA 2XAQA 5J8FA 5DDPC 1DPUA 5CXTA 1F9NA 2HQNA 3SDEB 3F8CA 2CQIA 4N0BA 3KP3A 3LA2A 3BO4A 2X1BA 4EV0A 1KD1T 4BHCA 2M45A 3FMSA 3F6VA 4RGSA 2Z3YA 1VC0A 2OA4A 3CCMS 3TOBA 2JTVA 2VBYA 5D5UB 3WGGA 4LK0F 3FF5A 5GAHU 3I59B 3ELKA 1VQ9S 2IPQX 2XNQA 4L5JA 3TO7A 1Z05A 1X4HA 2M88A 5IM0B 1AUDA 3LQQA 2K4BA 2DNHA 3KLOA 3TGNA 2HEOA 3ZMSA 5D8KB 2RT3A 2GQQA 3FXRA 1ZAOA 3S6EA 5CVIA 3F8MA 4CZZA 2HZCA 2MZQA 3Q2SC 4BHBA 2XRNA 3S8SA 1BBYA 2D45A 2LA4A 1W2BR 2EA4A 3MD3A 3WU1B 4EM0B 5FLXZ 1WKMA 1PO6A 1O7FA 5D5XB 5HS9A 3M8FA 3G71S 1XSVA 1UHWA 4DNCA 5DDOC 2YR2A 1FNNA 4HQMA 2F5DA 5LXYA 3OOPA 1B6AA 1J9IA 2A68F 1WHVA 2M5WA 2KG0A 1CF7B 2F9DA 1SXLA 1QNTA 2FRHA 5E1XA 2WC2A 2ZNZA 2CSOA 1IXCA 1WEZA 4OOIA 1EV7A 2QBYB 1P92A 2RGVA 3R60A 3RPUA 3ERED 2FXAA 4NHJA 1WF0A 2MH9A 2DPDA 2LDUA 5EN1A 1B9NA 2MZSA 2IRFG 4LG0B 5ED4A 1X5SA 2KKOA 2VOOA 2FSWA 1Z91A 2K27A 1H9GA 1KU3A 4KYWA 3F23A 5LHGA 3IKVA 4LLLA 3GO5A 1HKQA 1MJ9A 4S04A 4ENKA 1REPC 4KIBA 1M5OC 3LAJA 2ZJ2A 2Z5UA 5CLSA 2QYOA 3F22A 2BE5F 2G7UA 2P5VA 2M0GB 3WTUC 4U0VA 3L09A 1X4GA 1BC8C 1G3WA 2OBPA 1BM9A 3I55S 3MOJB 1KA8A 1W5SA 1YW9A 2VONA 4ED5A 5H6RA 3C1DA 1FPQA 1JJHA 3WTTC 2F5EA 2DW4A 2MQQA 3MDFA 3P9CA 5DD4A 1SFXA 3HSFA 3UD4P 2JRTA 4PGGA 3V4GA 4M73A 2CQ0A 4HX4A 2MSTA 2XS7A 1X5PA 4G9YA 1URNA 1KU2A 1FZPB 3TOAA 5LHHA 4HV5A 2A6EF 1RZ4A 4NQWA 2GXBA 2LYVA 3ULHA 3P3DA 5CA5A 4EM2A 1BJAA 5AIQA 5L3CA 2IA0A 1ZHFA 5FFXA 1B59A 3ZMZA 5LLQA 3KE2A 4I0BA 2KI2A 2ZCWA 2BZ2A 4BQAA 4RB2C 2MXYA 2QZ8A 2V6CA 3EYYA 3T8RA 1XN9A 4Y17A 2LECA 1SD5A 2E1CA 1QZYA 5BPDA 3E6DA 3WTVC 3MUTP 3F72A 4EVIA 4EJTA 2XSFA 2PG4A 2V9VA 4XSXF 3NS6A 1YW8A 3VF0B 1SJRA 1IUYA 5DCFA 1QBJA 3QRFF 5GMKa 1U1KA 3THTA 3CTRA 3IHUA 3IWZA 5DD8A 2EJRA 1P1TA 4MEYF 3U1MA 2W84A 3UWTA 1IN6A 2AYEA 2MA3A 2PN6A 4TU9A 5FJ4A 2AD9A 3QP5A 4HDUA 1U1OA 4HBLA 2DFIA 4IRIA 4WCGA 3J7YU 3MZYA 5A2QK 5HDNA 4A2UA 2QA4S 1KOHA 2B0LA 2YKAA 4ZYGA 4ENNA 1FYKA 4YFNF 3I0TA 4A5NA 1LEBA 1A04A 2CQKA 3CCSS 2PJPA 4BYYA 4YOEA 5LGUA 5ICCA 3JTGA 4M9SA 4Y00A 4NB5A 3I59A 3IKTA 3J7AO 3T8TA 3L9FA 3LQRA 1W7PB 1CGPA 4EJWA 3R6SA 3QU3A 3AAFA 4C7QA 1HL6A 2AYMA 2CPXA 1WG1A 1QO0D 1XGOA 2DNNA 5JVHQ 1FYLA 2FQ3A 2RNEA 1VQ8S 5ITHA 1BOAA 2HKOA 1KQ0A 2QM3A 4EM1A 2YTCA 2V1UA 2RN7A 1R8HA 1SJFA 1U78A 5H20A 3L3CA 2LKZA 1YQAA 2DGSA 2MKIA 1IAWA 3KP7A 3HHNB 2RQ4A 1JGSA 3MAJA 5FB2A 2J0QD 1SJ4P 4WWCA 2IVMA 5E17F 2FMLA 5H6QA 4GO1A 1VQOS 2XB2D 5CYVA 2FBHA 5DDQC 4MQ9F 2MQLA 3DXJF 1X4DA 2DNMA 2B0GA 4XLNF 2KRRA 1J75A 2DISA 2JWNA 4M72A 1QGPA 3BROA 2G1DA 3HYIA 4L9TA 2EA2A 3TO8A 4WKRA 1MDMA 3SMZA 1YIOA 3S2WA 2MZ1A 2DH9A 4AWXB 2LXUA 3V4MA 1BI1A 1B4AA 1HSTA 1PDNC 2NNNA 2L54A 1X3UA 1OPCA 1STZA 2VE8A 3J7ZT 1DHMA 1N8RT 3D5LA 5D6EA 1D9AA 2WWYA 2QUFA 1OR7A 3MXHP 5BPIA 4LJZF 2H27A 2PLYA 1I6XA 1DBDA 3VAHA 1G2EA 3J80Z 3P5TL 1TQPA 4TV7A 2HDCA 2DGQA 4ERDA 1I1SA 1U6BA 1YHQS 5CVVA 1BI3A 2GA1A 4UV8A 2DO7A 1U1NA 4LLGF 1U3EM 2CJKA 4ZYEA 4FT8A 4EGLA 2FNAA 4OINF 3ROUA 2JVOA 1JJ4A 3FMRA 3H3UA 2L9WA 2M7SA 3VAGA 3ABUA 4YUDA 3E5QA 2DNYA 5L3DA 2DB1A 3HSRA 2ELHA 4RAZA 4L9NA 2CQ1A 2J0SD 2A3SA 3RKYA 3SQNA 2DNRA 4GYGA 1I1GA 3U1LA 3NNCA 3HHGA 4MQVA 1K73T 1E2XA 2JSCA 5D4RA 1HBXG 4BAYA 3NNAA 2HZTA 4P96A 3K1NA 3DV8A 3VODA 3BO2A 3FMQA 2KXFA 4BHPA 2O6GE 2ESHA 1I27A 1PUEE 2QEXS 1ZH5A 4MHGA 3GLXA 3K1MA 2FC9A 5LJ5Y 1QVFR 2F2EA 2MHNA 2XS5A 1D3YA 2RNJA 2KVIA 5DV5A 3ZZZA 4UVAA 2L4MA 2RS2A 4BNCA 2A07F 4KMFA 2OSRA 2AS5F 3JAMK 2DNZA 4Z2XA 1CVJA 4IRHA 5LJ3Y 4WFAQ 1S7AA 3E6MA 3I53A 2VOPA 1S79A 1HW5A 1YS6A 2U2FA 1XCBA 3DPLC 1U6FA 3MFKA 2LEBA 3M9AA 5D77A 1WEXA 1GXQA 1X0FA 1J59A 4UV9A 3R4KA 3G4SS 2RVCA 2OSQA 1YWXA 1ZG1A 4BS2A 1P2FA 3G3ZA 4I01A 2QQBA 4EJVA 1U1LA 2STWA 1K9MT 1IW7F 5MLCV 3SZPA 4I2OA 2AYGA 2DNOA 1S3JA 3D0SA 2L4AA 4FX4A 3CC4S 3IRWP 3QU6A 5GVQA 4IF4A 5HLGA 1O57A 4FHTA 2GIVA 3I56S 1FOKA 4I02A 3CTAA 2BGCA 1U2WA 2CYYA 3WU0A 1IF1A 3N4MA 1M5KC 1MJBA 2A5YB 2CQGA 2CPHA 3KETA 2HGLA 1S29A 2FY1A 2K02A 1RUNA 1ZZNA 2CQDA 4XRFA 2U1AA 1U1MA 2DU9A 4OU0A 1LB2A 2O03A 3BWGA 5DYMA 2M8HA 1K79A 3U1DA 1FY7A 3V8LA 2DHGA 2R3SA 3BDDA 4A12A 2DK5A 3CCUS 2DIVA 3TDUC 2CWEA 1IN8A 4L0YB 2R7DA 3FEYB 4J5OA 2PMUA 4O3MA 1KQSR 2E5JA 5LHIA 4OMZA 1R23A 3E5UA 2MGZA 4QU6A 3JW4A 1WI9A 2IA2A 4AD9A 2DLLA 2MY8A 1M5VC 5L3EA 5F1RA 5HOOA 4YIIA 1ZLKA 2W25A 1HD0A 2DBBA 5E8IA 4CICA 2F9JA 1USTA 3VEPA 1LEAA 1H0MA 3VFZA 3C7JA 3GYHX 2RDPA 1X4CA 2M70A 1LJ9A 2X0LA 1DUXC 3K69A 1WSUA 2VXZA 4XSZF 4EJUA 3KP2A 3TKYA 3K9TA 2L41A 4C0OC 4TU8A 2E44A 2ZMEB 4QU7A 1D8ZA 2FF4A 2HWVA 4JK1X 3WTWC 4P9FA 5GADU 2CQ4A 2Y48A 3I4PA 3ZMDA 1QM9A 1MDMB 4JBAA 4DQ2A 2M2BA 3CCLS 4R1HA 1F9FA 2YH1A 1A9NB 2KYXA 2DQRA 4PDKA 2M30A 2KIFA 2DH8A 1ODDA 3DF8A 2KIMA 1Z1DA 1N52B 3V8KA 1YLFA 2QLZA 4CO8A 1T0FA 4A0ZA 1RNLA 1Z9CA 3NS5A 5FGMA 3EX7B 4TU7A 3WE3A 3HRMA 1SFUA 1K8AT 2Z9OA 3IL2A 2MJNA 2D3OR 5EEGA 3MWMA 2DT5A 3GW2A 2W24A 3G8SA 3QAHA 3KP5A 2EK5A 2IW5A 4OIPF 2MKHA 1FT9A 2RC4A 4B09A 3GFIA 2KJBA 4S05A 2LKPA 2PBIA 5IQQA 1O3RA 3LA3A 2EFNA 5ERIA 1VBYA 2M8EA 2E5IA 4L5IA 2EV6A 4HLXA 1XGMA 2MKSA 4AIHA 5F64A 1IRGA 2COMA 3G96A 1FO1A 1K78A 1BC7C 2MMYA 2P5KA 2IP2A 2AXLA 5IT9Z 3RIRA 4K2EA 1U2FA 4KN4X 4P5OA 3COAC 1WI6A 1BN5A 2MBFA 2DNQA 2K7LA 5ICFA 2V79A 1EH8A 3IWNC 2DK2A 1Q7YT 2O3FA 4CGZA 2VC1A 3B73A 1R58A 3TO9A 2OTJS 1HSJA 4HF1A 3G73A 1XD7A 4OMYA 2FNPA 5DDGA 2RRAA 3H2VE 5DUKA 4N9HA 1HKTA 1GHCA 4YIFA 1WI8A 2O8XA 3F8BA 1IRFA 3RTRA 4EGZA 1R00A 2PQ8A 1JHHA 3FX3A 1L3LA 1HKSA 1H2TZ 2P6TA 4OIQF 1W4MA 3JSPA 3ZP5A 1IN4A 4M9ZA 3B4MA 6PAXA 1SMYF 4RB1A 4EGYA 4YFXF 2DNKA 4Y15A 4P9UA 4KUMA 4Z2YA 2LF7A 4OIOF 1GVJA 3ISPA 2YX4A 2Z33A 2DITA 1J5YA 1UHMA 3D2WA 2NZ4A 1U1QA 4GCVA 2LMIA 1OKRA 2FOKA 3C3WA 2UXNA 3R61A 1K7AA 3V7SA 2XNRA 2HOEA 1G6NA 1R8PA 2KG1A 3O6BB 3HTUA 2HS5A 3GZ5A 1N88A 1H9TA 3CCES 5AIPA 1SJ3P 4LFUA 2XROA 1MJAA 4N9IA 4R8HA 3VB2A 1ZRCA 5CYJA 2A69F 3F6OA 1OWXA 1ON2A 2ESNA 4P55A 3RPQA 2DAOA 2EB7A 3CF5Q 3TDZC 2V1XA 1UCRA 4YFKF 1XCVA 2MKCA 3WTYC 2N3OA 1RK8A 1XN7A 4I7HA 1FYMA 4RB3C 2EV5A 1VBXA 3N9UC 1UW4A 2UXXA 2XKPA 3W6KB 2W57A 3S7RA 3UD3P 1ON1A 1KU9A 5ILVA 3GEZA 3JB9k 4LLNA 2G9WA 1JE8A 1VQ5S 2LQ5A 1RIOH 1V3FA 5IFMA 1R5HA 1FX7A 3CDHA 3GVAA 4E70A 1XSDA 2NLWA 1XMAA 1MZBA 5ILUA 4XBFA 4HF2A 2YSRA 2KH9A 4F25A 4M71A 4YB1P 2LF8A 1FJCA 3R1HA 3HOSA 4HAMA 3T0YA 2HYIB 1X4EA 4ENMA 5LEKA 2EFOA 1ZRDA 2CGPA 3ZZYA 2VBWA 4OIRF 4RB0A 3BPVA 4GGGA 4L0ZB 1FP1D 3VAFA 2OAZA 4ESFA 2DGVA 4CHUA 3M1EA 2CPIA 1XDUA 1FLIA 2OQGA 2RKHA 2UZKA 1ZYRF 3BJOA 3JSOA 2XAJA 1Z6TA 2FA5A 2MZTA 1XGSA 2MLGA 5BMZA 1OYIA 3E6BA 3P7NA 1H6KX 2KXNB 2OIHA 1WHYA 2F3JA 3S01A 2Y75A 1K78B 4WXHA 4M5DB 4WFBQ 1YYVA 2EK1A 3UCZP 1U5TC 3KLNA 1YS7A 1F5TA 1J2XA 5GAEU 1BY9A 4CH1A 1P4AA 4LB5A 3CUQA 3E3VA 2M1BA 1LDDA 4MNUA 4JQFA 4ENJA 2KFYA 4IOAQ 4PZJA 3GFMA 2MD5A 3P9IA 1O3TA 3GZ6A 2UWMA 1U5TB 1T39A 5DCMA 3QOPA 1TW3A 5CVUA 3EQLF 3MD1A 2ACJA 5K5OA 2XS2A 4W92B 3ZMVA 1ZG3A 3KEOA 1Z7UA 2BBYA 1TW2A 2XVCA 1H2VZ 2MZRA 4M9XA 4HX7A 1X4BA 5EEHA 5JVTA 3F21A 4WF9Q 2YU3A 2LA6A 4LMZA 4G7OF 3BY6A 1O3SA 3P49B 1YW7A 4KMUX 4CH0S 1NHAA 3ECOA 4UUVA 2NNYA 5HVQC 3V7RA 5K5RA 4UNOA 1FBQA 3KEQA 2DPUA 1V4RA 1BI0A 2GAUA 3IRQA 4G7HF 1FJ7A 1FP2A 4QPTA 3Q5FA 1MGTA 2VT3A 1VQPS 2KXHA 2GWRA 2WBRA 2A3JA 1OO0B 4O5VA 5K5QA 3Q2TC 4ZYDA 4RGUA 5K1YA 4I98B 4ON0A 2M9KA 1WQ2A 1NJIT 2CQPA 3HUGA 2G0CA 3EDPA 3H2UB 2P7VB 4FXWA 3WTXC 2JRSA 2M4MA 1W7PD 1WWXA 3J80K 2MY7A 5J8CA 2CFXA 1QVGR 2L08A 5DEQA 1BIBA 1R5GA 2RU3A 5E1WA 1S7OA 2KIUA 3PQKA 4LMYA 2XUBA 5J6XA 5IT3A 2BYVE 5FO5A 1XDSA 2XHKA 3DPTA 3V7CA 2P8TA 2EVZA 2OU2A 3HHHA 2QQAA 3FM3A 2CW0F 2ZJRQ 4UQTA 3K2ZA 2MQOA 4IXAA 4H0EA 3MUVP 4UXNA 4ESJA 2IJLA 2RV8A 2M87A 4HA8A 2D2WA 2MSSA 4RS8A 1PGZA 1B9MA 5E18F 2F5FA 2OTLS 2FC8A 1U1RA 3NMRA
chains in the Genus database with same CATH superfamily
3M8EA 4RNFA 1WRJA 5DLFA 1IUFA 4DZJA 2X1CA 2BHZA 4Q44A 4F93B 2CQ2A 3FXUA 4IKAA 2H5JB 1M5PC 2QQ8A 4OZ0A 3DP7A 5EWFA 2JPBA 5LBQA 3GP9A 3OTEA 3ILLA 2O5RA 3QGGA 1VQMS 1SMTA 5TISC 1DQAA 3ILOA 3VSKA 5LEJA 2KRBA 4ALZA 4KH1B 3KLVA 3SEQA 3G8QA 1EQMA 3Q89A 4AQYF 3TANA 2ZJQQ 2HFUA 3DEUA 1GXUA 3KLGA 3IV5A 2ZH4A 1R4NB 1VLOA 2VH7A 4QR1A 2BXZA 2ZD1A 3V6KA 2VT2A 5B0EA 4O4GB 4JYAJ 5BQTA 2F4VF 1IQZA 1KKHA 1T11A 2BRLA 2AMCB 3PUFA 3JAMY 2GIQA 3WIVA 5EWEA 3OVBA 1LW2B 3PO2J 2D9PA 3QIPB 5DG7A 3R27A 1W7WA 4MLOA 3I0RA 1XB4A 1G2HA 3SQGB 4CYUA 4C8KA 2V8PA 4KNYA 1H8AC 2OHDA 2EQRA 3H5RA 4DU7A 3M9NB 1ZRFA 3E7LA 1SFEA 1R6VA 1D0ZA 1Y11A 1RTHA 3FHNA 1MW7A 1S1TA 2XMUA 4W97A 3GPAA 1T98A 1RTJB 4A8XA 4QYZJ 2PI0A 3FRZA 1MU2A 2CVEA 2AW0A 4KHPJ 5D6FA 1SC3B 1T33A 5EZGA 3PM1A 3L2VA 3C6TB 4L72B 4EZ6A 2P6SA 1U09A 3WGIA 3AD7C 4I2PB 5K9FA 2QC3A 4HX8A 3DKXA 4MGRA 1UP1A 1Y9OA 4U95A 3DHXA 1UA0A 3LGMA 2L9SA 5E8GA 3TP0A 3MCZA 2BM1A 4WWSA 1WF1A 1Y8RB 4XLPF 4ZJLA 2PMHA 1FOWA 4RNMA 4K0KJ 2DD8S 3GFZA 4E0DA 4ZOSA 3CMAI 1NH8A 2W2PP 1GX6A 4I64A 1JLAB 4JI1F 5ILSA 4Y52J 3IWFA 1K4TA 4BXFA 5HK4A 1R0BG 3DLLF 1RUOA 2J5PA 3I6PA 4U6PA 3R0AA 1RT2A 4U87A 5DZ7A 4CCNA 3BGOP 1RI7A 3K58A 4Q5VA 1A5JA 5KT2A 3IAS2 2ATCB 1R6RA 1MH3A 3RQ4A 1HNWJ 3ZN1A 2FZCB 1RWUA 4M3FA 2UU9F 4USUA 2VE9A 4N8NA 3RDIA 2QSWA 2EV0A 2XLIA 1TKTB 2HNDB 2GZWA 5LRRA 2KRFA 3L2RA 2I5JA 4F0MA 1UAWA 5DM6Q 4PEOA 1OMSA 1DURA 2Q79A 2E2HJ 4BLGA 1M1KT 3VDXA 1SI9A 2FBKA 4I6YA 3FXQA 1N36J 2WVCA 3LOCA 1FSHA 4PQUB 1P27B 5ETPA 2HSEB 2GIFA 2ZB9A 2BJDA 4OZ1A 4YB6A 4OI0A 4KYZA 2VQLA 2WVDA 2FHOB 3OBIA 3HRUA 1IN7A 2G2ZA 4C8LA 2GVDA 3H9JA 3K57A 3HSJA 1HQCA 3HIFA 2SXLA 2BA9A 4JI6J 3B6AA 3DLEA 2JHEA 3VGVA 3FDYA 3PRDA 5HLFA 2LKSA 1NK3P 1UJ4A 1CS4B 3Q9SA 1E6VA 2JA6J 4Q2MA 3K4NA 4OZJA 1VNDA 3SQGA 2WAEA 1VQ4I 4LRDA 5HQLA 4M3EA 3SDGA 1G59A 4MFBA 1YJ9I 2DCLA 2RS8A 1TQIA 4MIBA 3A02A 1G3OA 5FLMJ 2OI2A 3TQ1A 3NNHA 3S17J 4QQBA 3OSNA 4WXCA 2WW4A 4ZLPA 4JI1J 2L7ZA 1OIAA 4IJAA 4ZH4F 4X66F 1S0NA 3KCCA 2HBZB 2VC0A 3IUOA 2ZKZA 1ACMB 1XTZA 1HW9A 4UHTA 1GXPA 3SSQA 3UW1A 4DPXA 2HVEA 4M6YA 3W9JA 4Q4ZF 3MR2A 1IBCB 1UETA 4MKYA 1G3TA 3EYIA 3T5KA 1C0UA 4DWIA 9RUBA 4O4GA 1R3NA 4F26A 3TQNA 1R6YA 2XMTA 4A6DA 2VQGA 1BW6A 2D3UA 1ZARA 2M0CA 2FLOA 4ZCMA 2OUMA 3GJTB 3QIPA 1HYSB 4B9LA 3MZIA 2ZO4A 2IYGA 2KMUA 1KTQA 1OFCX 4HH1A 5FROA 4ETSA 2FMYA 3WTSC 3LWFA 2AJ0A 4X62J 1QD1A 1OJLA 4X4SA 2YQ3A 1NLKL 3DCAA 3DOLA 2V1DA 2XYHB 2BKNA 2X6OA 3M8JA 2DTRA 2KT2A 4M6XA 3SXLA 1PBUA 3VAMA 3T1HJ 2ZOMA 2DQLA 3EGZA 1Q81T 3OR1A 3O1LA 2ZC4A 4J9MA 3CC7S 2LY9A 2MD0A 1F4KA 2J0XA 4X4QA 2RRBA 4WP9A 4AIJA 5F6FA 1HWJA 1EZZB 4FYVB 4F4YA 1S7EA 3KLFB 5FLXU 4UOCA 4AFFA 5EWGA 4U67Q 4H54A 2M0MA 3BR0A 4WFYA 2RHQB 4HKQA 4X4PA 2BANA 1DTQA 5AJ3F 3EGNA 4JI6F 4G1QB 3H7HB 5CVRA 3TVYA 4OYZA 1ZG5A 3PCOB 2HYFA 4HHUA 3IG1B 1LNWA 3K17A 3BJAA 1Z6RA 4HYEA 4IPAA 2VJIA 3TMOA 1SCJB 1RT2B 3VHQA 4DL3A 2PEHA 1VQ6S 2PFFB 2XAHA 3KOAA 3DYAB 3KJQB 1NK6A 3N97A 3FBFA 5DTDA 3HBLA 3N05A 5ADZA 2CXEA 2HNDA 2WA0A 3MMCB 3MM8A 4IVNA 3MKWB 2ZH3A 4Q8FA 4ZA1A 5F9LA 2PE8A 4G12A 2P7CB 4FS1A 2K3IA 2OKQA 1XWLA 5L3FA 1FD8A 4RKUC 3C2HA 2MDAA 3GX4X 2W2QP 4WZQA 4R5PA 3RW7A 4C97A 1YO5C 3M8ZA 4W98A 5D6GA 3CD6S 4CNYA 3TW7A 3FBNB 2G0EA 1QVUA 1RAEB 3M9MB 5HROB 1BUXA 3CNQP 3DLGA 1FXLA 3OOUA 2L2OA 3LF0A 2ADCA 4XOPA 1UWBA 1X1PA 4KHMA 3V4IB 4WFZA 1WEYA 1IWAA 1ETXA 3ZMTA 1AUSL 3EDQB 4W90B 1Q95G 4DV0F 1TLHB 2X48A 1IQTA 1VQKI 2HVHA 2AP6A 1U8RA 2HNYA 1NU4A 1RADB 1JQGA 1KEKA 3MI7X 4KA4A 3D5MA 4I0AA 4QOTA 5HNFA 5KFVA 3HI9A 1O0PA 1RKWA 1YJRA 2FJBB 2HKEA 2KJVA 5A76A 5FFZA 5A6PA 4CTAA 1PP8F 3CJQB 1ICEB 2WB4A 1T8EA 3I71A 4UB6C 2BJ8A 1JLBB 3JSRA 5D0EA 2ZMEA 2XGXA 3BEGB 1FVQA 2DHSA 4EMDA 2IBKA 1VGYA 2NREA 1U26A 4OYOA 2JQ7A 3CUOA 4KHPF 2VN2A 3R5GA 2YKNA 4F4KA 1RKJA 1BMQB 2ME6A 3FBEA 2DA5A 2XO7A 3FXJA 3ZZTA 4I2QA 4H4MA 3BPXA 3D6MB 2ASJA 5E3AA 5IWAJ 2ISYA 1EH7A 2DY1A 2ZE2A 3D0HE 4B8XA 4ZVPB 4IFYA 5ETOA 4X4TA 2QMWA 3G82A 3BKUA 1M1EB 3NGDA 2XB0X 2G7HA 1IUJA 4CXFA 4FETA 2EIKH 1RGVA 2D9OA 4R8UB 3CE8A 2KRCA 2QGFB 5GAEI 5GADI 1YTYA 2GX8A 1Q82T 1CF7A 2XSJC 2XASA 2ZBKA 1FHTA 1JLQB 3Q24A 1SQFA 4BL0B 4HDHA 3KKFA 1OMIA 4LF6J 1V6HA 3O6QA 3OR1B 2X85A 4XKWA 1WWHA 3PY8A 3EDRB 1TR0A 3DI6B 4I2PA 4PRFA 5CABA 2CQCA 3KMQA 5CHCB 4A6EA 2CW8A 3OYHA 1V5VA 2UXCJ 3WTZA 4RA2A 1REVA 4HL9A 2V50A 2NUUG 3P5BP 2HXIA 4C2UA 4KIFA 1KN6A 1I51B 4DL5A 1ZLJA 3T19A 3KLFA 3G71I 3HVAA 1HA1A 1XSXA 4UY8T 2QLFB 3K0JA 3OW2R 4O44B 2YNIA 4LIRA 5T7LA 3WE2A 3OSPA 2HLTA 1DPRA 4I99C 2UVUA 1S6PB 4QPQA 2XGCA 3KZZA 1S8NA 2ZJQF 1UWBB 3IM8A 2LREA 2OPPA 1C1BB 3LA0A 4ZDNA 1U47A 3KJNB 4EJOA 4K2JA 2HS3A 3AB2B 1D0EA 2HQAA 3BO3A 2B4OA 1RKIA 3IGVA 2B9XA 4AIKA 3GV7B 5IOYA 3CJKB 5IP6A 1XNQJ 4QW9A 2HGCA 1TKTA 5DG9A 3VAIA 2MB0B 2A6HF 4LRBA 3LFKA 2Y9HA 2E1PA 1FBSA 4F0KA 1UEUA 1JHFA 1IZ1A 4N56A 5HVHA 2E19A 1VQKS 4F55A 2HRTA 5IT9Y 1Q16B 5KFCA 5HDGA 5AONA 5H2FC 2JSXA 2OEKA 3VGSA 5ICGA 1IC8A 1ZN2A 3RYPA 3TX8A 2C3OA 4WK1A 5L1IA 2Z8QA 4AXJA 4RPFA 3CJ2A 3MM5B 2NS0A 1YGYA 2Q43A 2EK6A 4DJAA 4BJTA 4HHJA 4WX9A 1J0RA 2H94A 3BTCA 5HS8A 5E20A 4ABZA 3BN4A 5CJ9A 3O5TB 3UDEA 1RHMB 3V81B 3OV8A 1Z77A 3GF2A 1QA6A 3V6DB 1UJ5A 2JRMA 1N78A 2OZ6A 3UCGA 1KVJA 4F4XA 2FUG9 2DH7A 3NWGA 3FQKA 3LP1A 4XKVA 1BA5A 2EZLA 4J9NA 1UFWA 2K85A 2F63A 1TBXA 5BOXA 2NVTJ 2ZHBA 4M3BA 2W85A 4IFYB 2MC4A 2L02A 3CGIA 1NSAA 2WY8Q 4G1IA 1KONA 2HNHA 4IHSA 3F3XA 2Y9ZA 4CCOA 1DPUA 4C3IJ 2ALZA 2HQNA 2ILYA 4N76A 4CTAB 4MKVA 3KP3A 4R8UA 1VRTA 3MPUB 2X1BA 4QWEA 3H3VK 1SFOJ 2Z3YA 4BDPA 2HS0A 3Q8VA 3TOBA 2JTVA 3IAM2 2VBYA 4HNUA 5D5UB 1F5CA 3EXCX 3BR5A 5ETLA 3PM9A 4ETXA 4ZS6A 2MGQA 3QRRA 3HJEA 1FWPA 1Z05A 1X4HA 2D41A 4XN0A 2C2KB 1MBGA 5IM0B 4RAFA 1AUDA 3LQQA 4H4MB 3TGNA 1YRUA 5D8KB 1SC4B 1EB0A 4XDDA 4QW8A 3DRSA 5M2PA 2MZQA 5AXLA 3SFUA 3M8QB 2D45A 2LA4A 2EA4A 1H88C 3MD3A 5I3UB 2RU9A 1PO6A 1BJZA 1O7FA 1TZLA 1F2HA 3G71S 4J9PA 4DNCA 5FLVA 3QJJA 1FNNA 2F5DA 1S6PA 2AEMA 4K50A 1B6AA 2A68F 1T9TA 1NSKL 4HACA 1RT5A 2KG0A 1CF7B 1RAFB 2F9DA 5EDWA 1QTNB 1HBUA 3QJPA 3TARA 1AZSB 3W5XA 2WC2A 3MMBA 3X3UA 4ZPTR 2XB5A 2HQDA 1IXCA 2QBYB 1NK2P 2DJWA 2RGVA 3R60A 1P7JA 2MH9A 2DPDA 2MZSA 2YWFA 4RNOA 1X5SA 2J8SA 3IH2A 5FJ8J 3GIRA 1UTAA 1Z91A 1KU3A 4FNIA 3TJAA 3F23A 4RM3A 4U7CA 5LHGA 5LT5A 4JI0F 4P10A 1TL4A 1HKQA 1MJ9A 4S04A 3TRGA 4KIBA 1K44A 4DV1F 1S9EB 2ZJ2A 2QYOA 4QIWN 2HZVA 2BE5F 1S72I 4C3JJ 2XCPA 3WTUC 5CPRB 2F5GA 1KA8A 4N8OA 1XMQJ 3C1DA 4ICLA 1FPQA 1JJHA 2UUAF 2F5EA 2DW4A 2MQQA 1Q78A 4PYAA 3UD4P 1IR1A 3FFIB 4KGKA 4PGGA 4EBEA 2BW7A 1CQNA 2V0NA 4HX4A 2MSTA 1RTJA 1X5PA 4G9YA 3MM8B 1HFEL 5LHHA 4HV5A 5D0GA 4K8RA 2GXBA 3KLEA 2OLWA 5CA5A 3HPOA 3BZCA 2QL5B 4XL9A 4HT7A 4Y3CA 2QV6A 2EC2A 2COBA 1XQIA 1IVZA 3H1CA 2KI2A 3PDNA 2ZCWA 4BQAA 4RB2C 2VPXB 1VRTB 4N41A 3DLGB 3Q22A 3T8RA 5FD1A 5KFDA 3V4IA 2JA2A 2LECA 2YKMB 1GMWD 4ANDA 1Q7LB 1QZYA 1NH3A 3E6DA 3BZQA 3QFHA 4YB7A 2XSFA 2GGPA 4N77A 2JNJA 3K5PA 3G6XA 3PIOF 2HPIA 4TN2A 2KYZA 3PRBA 3OR2A 1XC5A 3T1YF 1P1TA 3U1MA 5JVGF 1IN6A 3H5XA 2M4GA 2MA3A 4W1UA 4TU9A 1U8SA 5GMEA 1SVMA 3U7JA 2WADA 1VRUB 4E7ZA 4WCGA 4MKBA 4M5LA 2GCFA 4FYDA 2BY3A 3IBWA 2YKAA 1FYKA 3A3NB 4A5NA 4BQNA 1A04A 2NSCA 4NYZA 4DV5J 3KYDB 4BYYA 2G0JA 3DLKB 4HACB 1ZS6A 2IGMA 4XOTA 2JC0A 4Y00A 4NB5A 1W26A 3I59A 3IKTA 3T8TA 4DS4A 3LSPA 1MBFA 4B02A 1IGNA 1K1QA 4EJWA 3M07A 3LH2S 3QU3A 3TWZA 2CPXA 4FBUA 1VQ8S 2DNNA 1FYLA 2FQ3A 5ITHA 1VR6A 3MAAB 1TL1B 1DGRM 3AG1H 2QM3A 3DRSB 1GEHA 1AKHA 4JBCA 2IBDA 1RRJA 3KPHA 4B3OB 3FJ2A 3QAEA 2W9BB 2V1UA 1R8HA 9ATCB 1SJFA 3MHYA 3L3CA 4IHXA 1T02A 4DU8A 2MKIA 1IAWA 4M94A 1MWQA 1U49A 4MAKA 5KFIA 3HOVJ 1VOMA 2QFIA 2J0QD 4II3A 3QLHA 2VG7B 1DAXA 2IVMA 1DQUA 4B3SF 3F56A 4EI2A 2DY9A 5KFOA 4MQ9F 2MQLA 3H5UA 1J75A 3C14B 4M72A 2G1DA 2YWWA 1SVOA 1QSSA 3SMZA 3FCVA 2R7ZJ 4JX4A 2A6MA 4JOMA 4P73A 3NOGA 3V4MA 3RAQA 3OYJA 1PYTA 1HSTA 2NNNA 3OYLA 2HVDA 3J7ZT 1DHMA 4ZVEA 4B3MJ 1S59A 1DTTA 4P7VA 1A35A 1OSCA 2NXCA 2QKMB 1NK9A 3GTKJ 2XSDC 2PLYA 3ET6A 4DR3F 3DDIA 1DBDA 4YQWA 3IS9A 2L9VA 3MCSA 1PBAA 1G2EA 3J80Z 2ZH5A 4USJC 3VYSB 4CLLA 4PABA 2HDCA 3I4HX 3CJRB 1BI3A 2QIFA 1D9FA 2Y3YA 1YJ7A 3L9ZA 4ZYEA 4FT8A 1A6LA 4C6AA 2XGPA 3FMRA 2VQEF 2A1BA 3E5QA 3N4WA 3HSRA 3PYFA 4GO5X 2ELHA 3NMAA 1W36C 2J0SD 1HBNA 3TW0A 5CQGA 1ULRA 1I1GA 2NYHA 2BRKA 4OMFG 4IHVA 3LW5C 2AT1B 2WZ1A 3LSJA 2IC3A 1I27A 2QEXI 1CLFA 2MHNA 4OX6A 3O44A 1D3YA 4PXEA 5DV5A 4DBRA 2L4MA 1RXOB 1OCCH 3JAMK 1RA7A 2DNZA 4TXSA 1TV6B 4GC6A 3EZOA 3TEDA 4BJ5C 4YY3F 1FXDA 1S7AA 3HC7A 3I53A 2M3DA 1FRMA 3VGTA 4X0GA 3V6DA 2AHQA 3MPWA 1XCBA 1MMLA 3UDVA 2LP4A 2M2EA 2A2CA 2LEBA 2PT0A 3W2VA 2B9WA 2CIMA 4RLEA 1WEXA 1N0UA 1NZAA 2KRHA 3R4KA 3G4SS 2RVCA 1M5SA 2B8PA 2VF3A 1Y00A 4BS2A 5HVGA 2LBFA 3BGRB 3G3ZA 4YIRX 2XMAA 4EJVA 3A4CA 2ZXIA 3MAAA 3SZPA 3S1QJ 2AYGA 1EKEA 2DNOA 1AKHB 2DHHA 4QJVA 4NL5A 4DJBA 3I5CA 3IRWP 1QU3A 4CI0B 5GVQA 4LF6F 5BYQA 4ILLA 5HLGA 2QMXA 3A8IA 4KBIA 2AZ1A 4B3AA 2DFHA 2CYYA 3WU0A 3BCBA 4RWWA 2CQGA 2CPHA 3JQJA 2HGLA 5F04A 1R8AA 2IA6A 1QUPA 1RUNA 3J7YJ 2BW3A 3BC8A 2U1AA 1SQEA 1YG0A 1LB2A 1YBUA 2M8HA 3W7BA 1HNVB 1FY7A 3BKTA 3G1LA 3NG8A 3ZNUA 2DHGA 3BDDA 2KT0A 3W65A 1IN8A 3UR3C 4L0YB 3UVJA 1R89A 1VIOA 4KITB 3ENWA 2K7JA 3OXGA 2MGZA 2V2VA 1WC1A 2VKDA 2DLLA 3GTJJ 2A0FB 4OL8A 5L3EA 3RBEA 4YIIA 1DTTB 3SSRA 2W25A 2J7UA 5E8IA 4CICA 2F9JA 1USTA 3C3LA 2QT7A 4LSNB 3TP3A 3AODA 2HOSA 3VFZA 3C7JA 1W1WE 1ZR4A 3THVA 1X4CA 4J9QA 4CT8A 3K69A 1YX2A 2Y1RI 5K5MA 1HBOB 2VXZA 4EJUA 4DUYF 1WC4A 1RBAA 2L41A 1CJKA 4MMOA 1L3TA 2ZMEB 3M6WA 2FF4A 3DRYA 2RILA 2VJ5A 4LRAA 1CC8A 2F4IA 3OTCA 2VG5B 2D7SA 2Y48A 5KFEA 1LKZA 2M2BA 3CCLS 3DOKB 3RCOA 1F9FA 2YH1A 1LWXA 2KYXA 4PDKA 2CJXB 4C11B 3H25A 4OIXA 2KIFA 4X64J 2HHUA 1MIJA 3S32A 4ZVQB 4O4RA 1Z1DA 3OY9A 3ZTSA 2PMWA 1VI7A 5B08A 4C3KA 1E3OC 1WD6A 1SVDA 4DV1J 5FGMA 1TUWA 3U21A 2Z9OA 3DBRB 3PYGA 2F8EX 2D3OR 4USVA 4LF4J 1NDCA 2HHTA 4OJ1A 3HOUJ 2OPQA 3GW2A 1TQLA 5I3PA 1HNXJ 1BOBA 4OIPF 2KO1A 3HHLD 3LSMA 2KJBA 1HA8A 3I5AA 2DXFA 2YNGB 1NPKA 2XMMA 2BZTA 4CLWA 2PBIA 3DLAA 1NNDA 3BR8A 4ED3A 2VL8A 4F92B 4IQXA 3D67A 2VB6A 2YWGA 4DX6A 2KZVA 3PIPF 2IHR1 3G96A 2EFGA 2OJED 1S97A 1SL0A 3ZTRA 3DM2A 1AFIA 2Z30B 1I6JA 2IC3B 4F50A 4KN4X 1RWMB 3PXGa 4I7FA 4MO7A 4IDKB 4EFAC 2I5UA 5KFSA 2VC1A 3B73A 1RDRA 2OTJS 4HF1A 1XD7A 2R7UA 4OMYA 2YKMA 4GRSA 5DDGA 4UUWA 5CYMA 3MCNA 4N9HA 4YIFA 1BQNB 2M7BA 2O8XA 4DV7F 2LFVA 3RTRA 4EGZA 5F08A 2PQ8A 4DI6A 3K7RA 1E3PA 1VCTA 3N5FA 2GOXB 4KT0C 3GYNA 3OR1C 1PC5A 2P6TA 4OIQF 1W4MA 1NDKA 1RHJB 4D5FA 1VBKA 2B5JB 3BCAA 4B3XA 4FS2A 4ZLLA 2YPZA 3BGRA 4IG3B 2H4YB 3HDSA 2DITA 1RAJA 2NZ4A 3M2RB 2IYIA 4CO3A 2XC7A 3JTPA 3CJKA 2FGCA 5KFBA 3C3WA 2C28A 1K7AA 4ZP9A 2XNRA 4FYYB 1IO2A 1VRUA 2ID3A 5EF6A 4M5JA 4NZ0A 1R8PA 3E8OA 2Q2EB 3W3CA 5D3GA 3GZ5A 1N88A 1Q8KA 1FTRA 3MM7B 1RC9A 4LFUA 1MJAA 3DLEB 4R8HA 3H8YA 3VB2A 1W0TA 5L1JA 4IOCF 2A69F 4D9JA 4UT4A 1OWXA 5F3ZA 2HEKA 1ON2A 3AL0C 3C2PA 4I76A 1WOOA 4C30A 2VPZB 2VASA 3CF5Q 4YFKF 2MKCA 3PTWA 3WTYC 1RK8A 1SEUA 5KFAA 3WBZA 2JH3A 1XN7A 2P9EA 1FYMA 1VBXA 3N9UC 1UW4A 1D5YA 2R8GA 3PV8A 1H74A 4OI2A 3PHTA 5GAGJ 2E29A 3GEZA 2HVQA 4S0MA 3ZQGA 3PNYA 1VQ5S 2LQ5A 1RIOH 5IFMA 4PUOB 4F2RA 2QSFA 2XPUA 1OYDA 2H4WB 4NMLA 4B3RF 3CDHA 3GVAA 4E70A 3DLBA 2P81A 1XMAA 4W4MA 1I5OB 1RAIB 3M6XA 4HF2A 3CP8A 2Y0SA 5K7ZA 4ZMMA 4EO8A 2F6CA 5FKMA 3W63A 1XTAA 4HNTA 4YB1P 1RCXB 2FDNA 5KG4A 5H9EK 3Q0UA 5B7WA 5DS7A 2PJRB 2W4CA 1X4EA 2HDWA 4NCGA 2EFOA 2CGPA 3F73A 2YNGA 4RB0A 4GGGA 2L7KA 1OQ3A 1PJRA 4ZPVR 1VFCA 2RKHA 4EYHB 2ME0A 4KTQA 1Z6TA 4DV6F 1YQHA 1TP7A 2GAHC 3BG6A 1H6KX 5H9EJ 3DOKA 1JUSA 2Y75A 1X2MA 1JKQC 3AY0A 2BVMA 2VJJA 1U5TC 1WJDA 3OJSA 1J2XA 4XLCA 1S1VB 1BY9A 2PEBA 3W8GA 1FFWB 3CUQA 3E3VA 1H72C 2YQ1A 2M1BA 2GBYA 1LDDA 3FKJA 4JQFA 2IFXA 2WONB 2KFYA 3GFMA 4AXIA 3P9IA 5J2PB 2DPIA 4IRCA 5KAKA 3MN2A 1XBWA 1ROFA 3EQLF 3FSXA 3MD1A 4OJHA 3QMQA 2ACJA 2K9QA 5K5OA 2XS2A 4W92B 2W2MP 3I9ZA 4CYUB 5IV4A 4ZDOA 2BBYA 2MZRA 4M9XA 5JVTA 2GM4A 1BD6A 1MWZA 5B5EC 1IJEB 3TX0A 4KMUX 1NHAA 4EATA 1FDBA 3K5NA 4C2MA 4JI4F 1FA0A 2K9MA 1TMJA 1FBQA 5LMNF 3ENVA 4V2FA 1WC3A 3S2DJ 3AJDA 4G7HF 3GFXA 1HBUB 1UAAA 5ETNA 2H8RA 2CW7A 3MEKA 2VT3A 1VQPS 3DM2B 3ZXWA 2W9CA 3H5YA 4UUTA 4WU3A 4PUSA 1DQ9A 2A3JA 2PD1A 3TQEA 3SFGA 1Q4RA 5K1YA 4O0NA 2CJQA 4I98B 1VIXA 1FK9B 3DPUA 1TFYA 5HLTA 3SBMA 5T14A 4OX9J 2M9KA 4PSWA 2CQPA 2C2ZB 3HUGA 4E98A 1F3FA 2G0CA 5ETRA 2K9LA 3DDKA 4R5PB 3J80K 2CJBA 3O2IA 4IHWA 2L08A 5E33A 2DDBA 3K6GA 2KHMA 3GIJA 3K8WA 1S7OA 1UG2A 4B9VA 2R7VA 5IT3A 2UUWA 1V9OA 4LSZB 4MT1A 4GMKA 3VV2B 5KOWA 2XHKA 3MKYB 2P8TA 1KFDA 3HPGA 3HHHA 1SJ1A 1HWUA 2K7KA 4M63A 3TAMB 3L7OA 3ITHA 2GVDB 2FLLA 1V5GA 4XICA 4ESJA 3F9KA 2IJLA 1VQ6I 4HA8A 2HNYB 2D2WA 4DPYA 1B9MA 2F5FA 3DEWA 8ATCB 1NRKA 1FMWA 1HOMA 2UUCF 2R2SA 2FBIA 3D4JA 3FCHA 3F8NA 2OD4A 3AD8C 1YIJS 2IT0A 2ZJPF 4WKYA 4IHTA 3SV3A 4UUSB 1VZ0A 1DFDA 2KJCA 5HAOA 3LSRA 2J6UA 2E7WA 1HMVB 1DZ5A 4CO4A 4PQUA 3TVKA 2FJ1A 1LK7A 3NWRA 2J5OA 2CZ9A 2C3MA 1OISA 1VJWA 4BHQA 4JI2F 3RR7A 3W6JB 4XTTA 2GMJA 3ZRGA 2KDZA 2GGPB 1FC3A 2QLJB 1RHUB 2KB2A 4OHYA 1PYOB 1F1BB 2DRAA 3IN5A 3EJMA 3MR5A 3OUYA 1XMQF 1D5VA 3NLCA 1OY8A 3OSFA 4UOGA 1LVAA 1IKWB 3CUQB 4ZZLA 3UPFA 2DOFA 3IA0A 3QGPA 3LAMA 1J7KA 2ZE2B 4WP3A 3I3LA 5HL7Q 2UUZA 5DETA 2ZZMA 1VQYA 4UY85 2DO0A 4NA3A 3RB4A 2CQHA 3OYGA 1RTZA 4WTYA 1OPZA 3PX0A 3RYRA 4HV6A 2PJRA 4WJBA 1ZM9A 1EHWA 3LAPA 2LXIA 2MLKA 4XQFA 1SFKA 2YQ0A 3CMES 3X2QH 2R7OA 2Z99A 4QWQA 4IUFA 3OYKA 1MNEA 4L18B 1N6QA 3HP6A 1IG7A 2HLUA 3GIIA 1NUEA 1Q53A 1ONVA 3L2WA 2Q8KA 4D7NA 4RX6A 1XPXA 4ANEA 1M5HA 2FE3A 4IRGA 2DT7B 4G94A 3D1HA 2GIRA 2HQ5A 2W9CB 4LK1F 3P4UB 1TK5A 3R2CJ 3H3ZA 1NDPA 5JXSA 1J5EJ 1NG6A 1TQMA 3CCJI 3H9GA 4KICA 3TW6A 2WONA 1H38A 2C6YA 3T6BA 5J2PA 4PJJA 1FD2A 4ZVTB 1K0VA 4U7BA 2NS1B 1LQ1A 2BANB 3M8PB 2FJXA 1DQ8A 5JI6A 2COLA 1LWFB 2HGNA 4NZ7A 3R7SB 3G6ES 1R22A 1UPPA 3ZQCA 4HR2A 3JRIA 4GYIA 2J8AA 2NYXA 1VQLS 2IJRA 2BKOA 4MTDA 4YEAA 3CEDA 1YJWI 5IWAF 1UG0A 2D1CA 4H4OA 4KE5A 1TC3C 3NRVA 4LR8A 1Q1KA 2L5QA 2ZM6J 2V9PA 3CPWR 5TJJA 2O61A 5C5JA 3QJLA 2BACA 3LTOA 3TAMA 2OV7A 2XWXA 3C14A 1SKUB 2OPRA 3DRXA 1F1ZA 2QSFX 1JIHA 4NLQA 1Y8QB 5D4SA 2XG8A 1SAXA 2NYIA 4HSTA 4HTJA 2DR6A 3R5JB 1ZAVA 5KG0A 1FK9A 2RKIB 1BQNA 1G1XA 1TWCJ 4DR6J 2HVZA 1FTCA 3KX2A 1K47A 3BBBA 3IS9B 4HVZA 2A6OA 1FWZA 1USSA 4Y34A 3Q0VA 1WJBA 1VK3A 1WTBA 1QQIA 4C3HJ 1RT3B 3GLLA 3S8PA 3IG1A 2NXJA 1W7PA 5L3GA 4ASNA 1FOYA 4D1QA 1YK9A 5D8LB 1NXIA 4RNHA 4L75A 5E3PA 3FK4A 4ZYAA 1O7LA 3HCXA 4HQEA 4J37A 2W1OA 3DOMB 3ZPLA 3HL2A 3OUYB 2JZ5A 1VQ7S 1X4OA 2DJIA 4RR5A 2D1VA 2RQQA 2D3ZA 2V6AA 3ZCOA 3DTKA 3QYFA 4ZCKA 5JLXA 5B0AA 5IY5H 3H0DA 3KK2B 3LSTA 1TT5B 4M74A 2P5LC 2ZNYA 5E5NA 2XKOA 1LDJA 5GPCA 3W6VA 3CJQA 2CJJA 2MLYA 2JEGA 3TOQA 3SDBA 4TVAB 1RHKB 3CLOA 3G8TA 3SDEA 4GO7X 4B3MF 1RQ0A 3H90A 3TP2A 2K06A 2BXYA 1X1CA 2D69A 1X9MA 3N0VA 2QQ9A 1QTMA 1OYYA 3ZC4A 2MKJA 3BQ1A 4LF4F 4PZVA 3EE3A 4XKBA 1IDYA 4DV0J 2BHYA 1VTNC 3CMEI 3CDWA 2CDQA 1A36A 4LIVA 3JTNA 2KJWA 3BTJA 4QIGA 3L00A 4KIGA 2LH9A 2R8KA 5IM0A 1ZGAA 2IAJB 1DDNA 1KQKA 2Y30A 3C8YA 4IG0B 1T2KA 2E71A 3HVRA 2OCEA 1U45A 1TTYA 1DP7P 1FRXA 2DNGA 2CV2A 1RESA 5KG3A 3GTMJ 1S72S 2LXFA 3Q86A 1JXVA 3J81Y 1QAXA 1FBUA 4C0HA 2HHXA 4BBYA 3OHAA 1P4XA 2OAUA 4I6ZA 2NS8A 3FCWA 3F41A 1FI4A 4X4VA 4YB5A 2ECBA 2MQMA 3KZIC 3BH6B 3RGIA 4LGWA 2F5CA 3BYRA 2R7FA 3HD2A 3FK7A 1UJ8A 4A3BJ 4IO9Q 1YI2I 5GAGU 2CPJA 2FZKB 2BW3B 1X7VA 5HBMB 5H9FJ 3TR5A 3K4MA 1Z21A 1XIQA 1JJ6C 4HPQA 4CT9A 2DGXA 4K0KF 2N4DA 3MMBB 4CO2A 4OAYA 1VRQC 3M6UA 4PWDB 1L3KA 4E8UA 5F8LA 3RAMA 3UE2A 4FPIA 1FESA 3HRTA 3PIPQ 3G82B 3OFGA 2CH0A 3I9V9 2MGZB 3ZZPA 1T7PA 5F0HA 1SH2A 3OQ2A 3J7AN 1RYRA 4MJKA 3KUHA 3QFWA 1HNIA 2EWNA 2DGTA 2G4BA 2E5HA 1HDDC 1I6HJ 2CFOA 4CCLA 1JJ8C 4J9SA 2STTA 4URGA 3HM5A 3ULQB 1D3WA 2XGEA 3M32A 1PJ5A 3HRSA 3VYUB 3PG9A 1WDTA 4ZYHA 4L9VA 2VQCA 1BI2A 2AKWB 1C4CA 5LGNA 4R0EA 1PP7U 2ZXJA 1UMJA 1WNEA 2Z4PA 2VBZA 4NRUA 1Q8LA 4DBQA 3WGHA 3AOAA 2BJEA 3G2BA 4FZVA 4KH0B 3CJTB 5KAIC 4D7MA 2GV1A 5BS6A 1U6GA 1JT0A 5A8RB 3FM5A 2UXBJ 3KLIA 2JSPA 2K3FA 1FX2A 2K8GA 4QIWD 2XO6A 1DRZA 3T41A 2WOMB 2WSEC 5FLXK 5D0HA 2D3O1 2IIHA 4EK2A 4ZDPA 1C1CA 3HUGB 1EJ7L 4YDXA 3OTBA 1U0HB 2Q0OA 1TL8A 2K5CA 4PCQA 4A93J 1HF0A 4ANJA 2V8GA 4GVBA 3MM5A 3CC2S 1UA1A 3Q0AA 4FX0A 1WSRA 4BDYA 2YKOA 2WRMA 2WW8A 3OTDA 4G7ZF 1OSDA 3K10A 4C3LA 4OYWA 4OWRB 5A6WA 4G65A 2ERRA 4Y2MA 1XMOF 9ANTA 1VC5A 1T56A 2FD5A 5C42A 4EMSA 4XPCA 1C1BA 1D8KA 2BJ1A 5B1BH 4DR2F 4LBIA 1YJTA 1RBLA 3RKQA 2XHWA 2I8DA 3C6UA 2J5AA 1UFMA 2HFNA 2E2JJ 5M2UA 1JKPC 1YBAA 2BUNA 5I4MA 1HD1A 4IG0A 1Y10A 3HHDA 2ZH9A 3H20A 5C25B 2YY3A 4IRDA 3K4CA 3BS9A 3GWZA 2W48A 4XRMA 1APSA 5KFFA 1TVRA 1T8IA 3UCUP 2CG4A 2PMZA 4G6TB 1SL1A 4O3RA 2RF2A 2UUAJ 3B6BA 3NEUA 2GW8A 3ZQHA 4RW7B 1JUMA 3MR7A 1NPPA 2O7OA 1RAGB 2Y1IA 3U1NA 2UUCJ 2GXGA 3V2UC 1X4FA 3OYMA 3ML6A 3H59A 3AAWB 1GK8A 5JUMA 3LP1B 3CCVI 4CDGA 4NXMF 1IKWA 2HPMA 5B0CA 4G6DA 4MFEA 3PEHA 1F36A 3MEGB 2MG4A 3B02A 2BYCA 2H1KA 1ZA2B 4J90A 2H09A 5LMUJ 3JTHA 4ZP7A 1WJCA 2A61A 3CMAS 3CMYA 1IKVB 1VQ9I 1HW2A 5G4DA 3HOXJ 4YFUA 4URQU 3BP8A 2Q2EA 1PILA 3HTSB 1YFHA 1RWVB 3CCQS 3F8FA 2QWWA 1WELA 1X5OA 5J1EB 3GG1A 1RTDA 2FVRA 3HDDA 1D8JA 1N6QB 4RUHA 2OJ3A 2RIJA 2HYGD 3VWBA 3M4OJ 4HOBA 1HI8A 1FEHA 4X65J 3OYCA 4F4WA 2WAFA 1S57A 1IR0A 1WUUA 1L3UA 1HPZB 2QBYA 1S6UA 4K5SA 2O3DA 3NEKA 1TK8A 4BWMA 1NMEB 2JUCA 2XLJA 5LMNJ 2E34A 2Y0MA 1P7IA 1MBKA 4E2FB 2KFDA 2HHPA 2VFSA 3W2WB 4XPEA 4G6VB 1KYZA 4ED6A 1BE4A 2XCAA 2HFOA 3CCTA 4L5EA 4GVBB 4QZVB 2C2RA 2ZJRF 2EBGA 3I58A 1T08B 5E0OA 3OSGA 2LNBA 2N8GA 3PO4A 2VJUA 3M6VA 3AJ2A 5IOZA 3NCRA 4OYXA 4NWBA 1I39A 3S15J 1UKUA 1T38A 1U9OA 4JX5A 1N25A 2E9TA 2G13A 1N34F 1YSJA 1N56A 1X1AA 3S3MA 4WK8F 1F3VA 3SCIE 2JX2A 3QPTA 3C6UB 1VQNS 1ZTRA 4KO0B 5DM7F 3TEGA 3UFCX 1KFSA 1OYWA 2MC3A 4LB6B 3KZYA 4ZVSB 2OEMA 5A8RA 2UP1A 2KHDA 4X4OA 4ES1A 3KP4A 1ORKA 2I8EA 4UZBA 4PR6A 4LRFA 3RB6A 5IV3A 3WG9A 5J3LA 1Y7PA 4USMA 4Y0FA 2KT3A 1R1TA 3DLLQ 2N3LA 4LOCA 1RAAB 4MTPA 5FD6A 4ELTA 5EJCA 1C0WA 2I9SA 2BY2A 4LVOP 3MCMA 5ICEA 3I64A 2FHJA 3RBDA 1R7JA 2VV5A 2JA8J 3ISZA 2N7YA 1P9QC 1XK8A 4HW0A 4BC9A 4FE4A 2Y8YA 2R42A 2ZXWH 4QTRA 3S3OA 3H92A 2DPJA 1T3OA 3SHFA 4M3DA 5JR3A 2LMDA 2AXTC 3LP0A 1XMKA 1B99A 4UZCA 3D3CJ 3IAS9 3EUKL 4ZPBA 3BQ2A 4BE1A 4P2MA 3BG3A 3HZJA 3NAIA 1IKVA 5A2QZ 5D4PA 3CF5F 1IKXA 2MLZA 4DW6A 5DDPC 3QPSA 1HQEB 1P6TA 1WKJA 4LQ3A 1Z7LA 1U8BA 3SDEB 2CQIA 2BX6A 4N0BA 4A3CJ 3LA2A 1X3WB 4FF1A 3JRHA 4BHCA 3FMSA 3HSGA 1LK5A 4OZLA 4B3SJ 3T1AA 3D3BJ 1VC0A 2XI3A 3CCMS 4NPOA 1IM6A 2PDAA 1KHWA 2XRLA 2AJFE 1JLFA 3WGGA 1R0CB 1WJ9A 3FF5A 4JP0A 4A8KA 1GV5A 2XY7A 3TZWA 1SV5B 1YBTA 3I59B 4CLUA 3PEJA 4IYQA 5E3MA 1NEEA 2UU9J 5KT7A 2HWTA 3ZMSA 2RT3A 4ECSA 1PYVA 2GQQA 4DFMA 4K4ZA 5CVIA 3OLAA 3TI0A 4D3HA 4CZZA 2QYGA 4B3OA 3Q2SC 1I94F 2ZXHA 2XRNA 5E3QA 1N5QA 3S8SA 1W2BR 4DV2F 2XPWA 1RWWB 4EM0B 4TQSA 4DFKA 4I67A 5D5XB 3CZ6A 1ZR2A 3ZZUA 2QA2A 2UV8G 2V2KA 2B7BB 3M8FA 2QCOA 1HQUB 4MIWA 2VQFF 2V34A 3GTPJ 3BBCA 3QLHB 1UW9A 2HQFA 2DA4A 2YR2A 4KKOA 3OOPA 2UVWA 2NS7A 1J9IA 2M5WA 4UUSA 3JR9A 2XEXA 5AXMA 3HOYJ 1M1HA 2Y1LB 1SXLA 1QNTA 2FRHA 5E1XA 2TCTA 3FMWA 1FDDA 3DLHA 3QT8A 2G2OA 2IM0A 4RZRA 1WOPA 2JEFA 1P92A 4LFCF 4MK8A 2RQKA 2FXAA 4IL6C 5B0FA 5T41A 3CLQA 5EN1A 4LFCJ 2KKOA 2BV3A 3GCMA 2JA5J 2R5ZA 1I94J 2PFDA 5GADJ 4DQQA 1ETOA 2LD5A 4LLLA 5BR8J 3GO5A 1K1SA 1QAIA 4QSHA 1M5OC 4ENKA 5E7OB 4QR2A 2R3VA 3CJRA 3F22A 4CLKA 5IC6B 4F2SA 2P5VA 2KIQA 8AT1B 2KTQA 1BC8C 2CJYB 3MOJB 1W5SA 4ED5A 4FP9A 2EWHA 1XR5A 2TRTA 3M30B 3OYIA 2FGOA 5IS2A 1FKPB 1GTEA 2M4KA 2ASLA 4NLDA 5EGOB 4QIEA 3CCEI 4A69C 5ETMA 1KLNA 2CQ0A 1AA1B 3A2KA 1WTFA 4RAGA 1URNA 1FZPB 1MU2B 2OFHX 1C1CB 4X6AJ 2A6EF 1RZ4A 2NOJB 4NQWA 3ISNC 3FBIB 3P8BB 3ULHA 1BR4A 4DSJA 4F3QA 4JV5J 3IGNA 4O3OA 1BW5A 4A3GJ 1Z2LA 1ZHFA 3FC9A 3KE2A 1O51A 2MXYA 2WVFA 2QZ8A 2V6CA 3ETMA 4DX8H 3UQSA 3I96A 1EIYB 2LFBA 1WDDA 2DA6A 1S99A 3GIMA 1U02A 1ZAWA 3JSMB 4LQ9A 1NJZA 5ETQA 2LDIA 4EJTA 3O8WA 2PG4A 1VK8A 2V9VA 4XSXF 3IWXA 3NS6A 1YW8A 3UI3A 1RUSA 3GLJA 3OS2A 1S5LC 4KGZB 4QYRA 1FE0A 5GMKa 3VQSA 3QSYB 4A4JA 2R2TA 1FTZA 3UWTA 2AYEA 1IKYA 3WHIA 2RF2B 3QPIA 3WC0A 3PJ9A 5FJ4A 4XR6A 4HDUA 1U1OA 5EDNA 3IFEA 4HBLA 2IS2A 4TY9A 5EYRA 1A31A 5A2QK 5HDNA 4ED1A 4A2UA 2Z0GA 1KOHA 2B0LA 3GZNB 2JWTA 3SCKE 1P8GA 3JYTA 2H1LA 3CCSS 2FUG2 2PJPA 3TUPA 5LGUA 5HODA 4M9SA 1LW0A 1JK9B 2OD6A 1V3SA 1HNVA 3GFYA 4ZTFA 4ED8A 1AHDP 1W7PB 4RW6A 3I0SA 1FFGB 1RSCA 4C7QA 1WG1A 3K89A 5M5WJ 2RNEA 1A6QA 3NBPA 2HKOA 2Q1ZB 3JAMU 2XZWA 1KQ0A 1UEKA 4DR5J 1NHKL 3NARA 2W9AA 1VFJA 2YTCA 2RN7A 2RJZA 1U78A 2CJ9A 2XF7A 3KP7A 2EKNA 1IBMF 2E5NA 3TZYA 2JFDA 2RQ4A 1Y56A 3SFIA 3DBHB 3SQOP 2NQPA 2GNKA 1AFJA 3MAJA 4Y2AA 2K3PA 3FXOA 3CDIA 2PX9A 1SJ4P 4BDZA 2E1MB 2MYSA 4HSRA 2VJVA 5E17F 2FMLA 4C8OA 1DGWY 1LOUA 1F2GA 2B3TB 5CYVA 2FBHA 4DR3J 3FZ2A 1KRPA 1WSVA 3W5ZA 1NJXA 1FRIA 1HPZA 1XR7A 4WXWA 2JEJA 3W61A 3DRRB 2KRRA 5E3LA 4A3KJ 2DISA 2HK3A 1VS3A 3MPYA 4X66J 1HI0P 5GTIC 3S2WA 1RWNB 4OJ3A 3UVJB 2CUJA 1ZM3A 1FMVA 2L3MA 3V6HA 4AWXB 3MR3A 3TUJC 3DKYA 2LXUA 3PX4A 1EKRA 1TUVA 1AT1B 2E2IJ 1PDNC 4NQWB 2VE8A 1JXEA 2FLNA 5D6EA 4UY8I 1L3VA 1HBMB 2QUFA 2VXDA 1V54H 1ZPWX 3MXHP 1D1BA 2HRYA 3D6TB 1NJWA 5BPIA 2H27A 2A2DA 1I6XA 4LSNA 3OL3A 4AD6A 3G87A 3N5BA 2EG2A 2OPQB 2OUGA 1TQPA 1SKSA 3S1TA 4TV7A 2BVZA 2DGQA 5IQ6A 1I1SA 1HBOA 3A1YG 5CVVA 2ZVSA 4UV8A 2OC6A 2H54B 1U1NA 1U3EM 1JJ4A 3ROUA 4OJGA 4ENOA 4YUDA 3HHLB 2BXJA 3DOLB 2DB1A 3MPDA 4PJNA 2JN6A 4L9NA 2CQ1A 4P2FA 2A3SA 2GA7A 2ZSIB 5THWA 3I56I 3NNCA 1SIWB 3HHGA 5I42B 1T95A 1E2XA 1X1DA 3DWLE 4JV1A 3K1NA 3DV8A 3BO2A 4DOZA 3UN5A 2ESHA 1PUEE 2QEXS 1ZH5A 4MHGA 3GLXA 1VQMI 4I7FB 3MAHA 1FRKA 4XLFA 2F2EA 1VHIA 1V5IB 1XNRJ 2XS5A 3ZZZA 3ENAA 4ELUA 4UVAA 2RS2A 2AS5F 1CVJA 3LP2B 1LUJB 3G6YA 1HW5A 1YS6A 3CMMA 3PJRA 2V69A 1MSFC 1U6FA 1DTQB 2CNKB 3MM9A 2W2OP 3BJYA 1JTXA 1GXQA 1NKBA 1X0FA 3KK3A 4UV9A 4JV0A 4OYIA 2OTJI 3I0SB 4FKYA 5KG2A 2HVIA 4P7TA 5CZXA 2STWA 1OQ6A 2C3YA 5IZHA 2Z2ZA 4IR9A 4PPDA 1ZOTA 2PA8D 3D0SA 2DA2A 4FX4A 2MHEA 5HATA 5KTQA 3QU6A 3CC4S 2FYXA 2HW3A 1ETKA 3IO1A 4FHTA 2HOAA 2GQCA 1LFPA 3CTAA 3MMCA 3HGGA 5J2NA 3A8EA 1U2WA 5F3TA 4XK8C 2YKQA 4X1EA 3N4MA 5CYMB 5J1NA 1N5SA 3KJVA 1ITYA 3KUEA 3KTQA 2JJ4D 2JJ7A 1B3TA 3MECB 5KCMA 1ZZNA 1FKAF 3EPGA 2JC1A 4OQJA 2O03A 3BZKA 4DPWA 1K79A 3U1DA 1TFWA 4UF4A 4DFPA 3C2GA 4A12A 5JMNA 2K9NA 2EW9A 4OHVA 3BBFA 3RAXA 2PMUA 4O3MA 3NL0A 2IDLA 2E5JA 4C9DA 1TZ0A 3E5UA 4J9VA 2ZFUA 3WHCA 1AYEA 5DGBA 2XYGB 5BR8F 3HVWA 4AD9A 2MY8A 3SYZA 1M5VC 4RLFA 2DBBA 4NYOA 5GMDA 5CCMA 4WE1A 1LEAA 1H0MA 2H51B 3KG0A 3MM7A 2AHOB 1N77A 4JI4J 4CP5A 2M70A 1LJ9A 1DUXC 4ZVGA 5U47A 2XC9A 3QT6A 2DMTA 4Y6IA 3TKYA 1OLTA 4LF1A 4NZ6A 3K9TA 4OZ5A 1J5EF 2DVIA 4ZHRB 2UV8A 5K7FA 4NOHA 4TU8A 2UVRA 1NHVA 4QU7A 3PR4A 1D8ZA 4II2A 3BG9A 3OTOF 2YNFB 2B4VA 3WG7H 3ZOBA 3WTWC 2ZZNA 1H73A 3DEEA 2YKNB 1TAQA 4JBAA 4JYAF 3OIOA 1JT6A 4R1HA 4CZCA 1A9NB 5I42A 2DQRA 1T9YA 4PUOA 3OT9A 1TL7A 1Q8BA 4I2QB 2KIMA 4B3TJ 1NK8A 1VQOI 4UUXA 4CO8A 3TZXA 1T0FA 4A0ZA 1Z9CA 3NS5A 2CZ4A 4OHXA 4TU7A 3PKYA 5F1JA 1K8AT 3IL2A 3ABKH 3I87A 4OHZA 1B72A 4NXMJ 3H4BA 2IW5A 1RLCL 2Q66A 2H48B 4A8QA 1HIYA 2RC4A 2PGCA 5KT5A 4NCGB 3GFIA 4DV3F 3EUNA 3HXMA 4KJZA 1H3DA 1BHNA 3MM9B 1FKPA 1LWFA 1XMOJ 2ILZA 5ERIA 5EGOA 1VBYA 2M8EA 2E5IA 3LO3A 1X2NA 1X3ZB 2EIJH 2MKSA 4DSLA 4F52A 1V55H 2RDJA 2K1RB 1FO1A 1EF4A 4NDLA 2M7AA 3CJ3A 3AL0B 3RIRA 3E3XA 1U2FA 3CC7I 1FVSA 3COAC 1WI6A 2WVBA 3CESA 4P74A 1REVB 1Q7YT 2QL7B 3CCLI 4FKXA 1WFXA 5KAFC 1R58A 2W82A 2CKWA 5C44J 1JKOC 2EFVA 3RYLA 2RRAA 3H2VE 2E36A 1HKTA 5CKTA 1WI8A 4XMYA 4NXNJ 4NLVA 2X1DA 1HCRA 2EBEA 3MECA 4JP8A 4XLHA 4F7VA 3A4TA 3ESWB 1L3LA 1HKSA 2HMIA 1H2TZ 4H4KA 3TAQA 1IN4A 1D0YA 3DGPB 3B4MA 3GQCA 4YFXF 1KZHA 2DNKA 2IGKA 4Y15A 4P9UA 4KUMA 1RT7A 2AIRB 4OFZA 1XG1A 1J5YA 3CDEA 3OYBA 3BYPA 1FJLA 1U1QA 1JTYA 4GCVA 3CF2A 5B3SH 4FXDA 3ZTPA 2G2YA 2UXNA 3R61A 3V7SA 2JLEA 2KDOA 2W8KA 2QTWA 4WE1B 1S1XB 1IJWC 4ECYA 3CCES 1FIAA 4F0HA 3JYTB 1MSWD 5J2NB 5EZHA 4A3EJ 3PHEA 1XMBA 3OV7A 1JI8A 3F6OA 3RPQA 4ZTJA 2DAOA 2V67A 2OCCH 3QZ8A 3G1MA 3ZZ0A 2HIQA 4N5SA 1HNZJ 4FVCA 4KPYA 3GYGA 1HHSA 4TY8B 4DZPA 4LF9J 4RB3C 2EV5A 4BEHB 4UTGA 5KFZA 1EETB 3UD3P 3K5MA 3E0JB 2E35A 3H5AA 3I9V2 5CD4H 1ZETA 2R7QA 1FX7A 5JLWA 4DL4A 2PIIA 1XSDA 2NLWA 1S6OA 2J9EA 3B6CA 1MZBA 3FZBA 2BR0A 2NXEA 5F8MA 4GKKF 2UVVA 4XBFA 2YSRA 2LRDA 3N6NA 5DM6F 3LP0B 2AQEA 1LQ9A 1S5ZA 3JQKA 1D0XA 1EX8A 1S1WA 1FJGF 4USKA 3HOSA 3IC1A 3FSIA 4HAMA 1DU0A 3I55I 3WZ0A 1GMWA 3CW2C 3R5DA 1I3AA 4JI7F 4HI2A 5LEKA 4N7TA 3Q23A 4YR0A 3NCQA 3BPVA 4L0ZB 3PW4A 1J2VA 4BBRJ 1DP3A 3M1EA 1XDUA 3BR6A 4AIDA 3JSOA 1TK0A 1CEZA 2XAJA 3PW2A 3PO3J 2RAQA 2QF7A 1XGSA 2DMNA 2MLGA 1OYIA 3E6BA 4FQGA 2KXNB 2BMBA 4NI2B 1RBOB 4DR4F 3S01A 4XRSG 4LF2A 1NCLA 1WC0A 4WFBQ 3UCZP 3M1VB 1F5TA 4ZP8A 2IMWP 4GKKJ 4CH1A 1P4AA 1AW0A 4MNUA 4IOAQ 4PWDA 2MD5A 1WKLA 4RW4B 4RW9B 1T39A 3TAPA 4HHHA 1QJHA 4DX7A 3PYDA 4HDGA 1SIZA 2HOTA 5BYSA 1A0OB 3KEOA 1Z7UA 5KFJA 1TW2A 2FLPA 2CQQA 2QLBB 2XVCA 3HHLA 2VKHA 5GTHC 2ZC3A 4YHHF 1W5CC 3SEOA 4FE7A 3H42A 2LA6A 2V4RA 4LMZA 4G7OF 5JJBA 4CH0S 1LNQA 1JUPA 1AA7A 5HVQC 5F41A 3ABMH 4HH0A 3KEQA 2HAIA 3IRQA 4LBPA 2CQNA 4F3OA 2OPRB 3Q5FA 1UVMA 4FF3A 2BVLA 3T9NA 4DQRA 1YLXA 5A8WB 3O8GA 4FYWB 3OWTA 5K5QA 3Q2TC 4OI3A 2YWEA 2RKIA 2GJIA 4DHVA 2W01A 1YZ7A 2ZBCA 4K7QA 3KHLA 3G1OA 2OP5A 3Q83A 3H2UB 4OZ2A 3WTXC 5J2QA 4RBVA 3OIQA 3K5OA 2MY7A 5J40A 1QVGR 1S9EA 2IRUA 1BIBA 3BTIA 4NEYA 3QODA 3AB4B 4TY8A 5FO5A 1F9HA 3DPTA 3E01A 5EGYA 3BLYA 1QHGA 2LG4A 2QQAA 1U0SA 3PYEA 1LE8B 2DT9A 1T05A 1OCPA 5A0YA 1F0XA 3MUVP 3DRPA 1UMQA 2M87A 1QUVA 4DS5A 3Q8QB 2VA3A 1PGZA 5E18F 2OTLS 2FC8A 3KLEB 3NMRA 3LUYA 1EKSA 5K20B 4RBOA 2V2QA 1RU1A 3FBCA 2CPEA 2GVZA 1MSEC 4PKDB 1DJ0A 1ZTWA 1Q86T 3PW5A 4U0WA 3LMMA 4RU2A 5HLIA 4RW7A 5EUHA 5D0RA 3K4LA 2V4JB 1U1PA 5F0UA 1R1UA 3JSMA 2RQMA 3PIOQ 3NGTA 4TQRA 1O3QA 4BU2A 2A05A 2J0WA 2OEJA 5MAOA 4EEYA 4BGDA 4B9TA 4EO6A 3DOMA 3MAQA 1R27B 3OFFA 4NLUA 4DXLA 2ZC2A 1MN9A 1ULYA 4ANCA 2QJ3A 5I3QA 3K59A 4ELVA 4R0JA 1VMBA 4LSLB 7AT1B 2MQ8A 5GAHI 3PX6A 4HZFA 1UFLA 1IKYB 2XMKA 1ZGJA 3LQVA 4WFXA 1JKHA 1Q1HA 4O6JA 3JXOA 3MM6A 2VQEJ 3DCFA 2HR3A 4RLQA 2ZITA 5FRMA 4TLQA 5IT4A 2HG4A 4G6QA 2VIXA 3GFLA 3WODF 1N33F 4N4OB 4QPOA 3LPYA 5J1EA 1RTDB 1B4SA 4LF5J 5FDLB 2F4OB 4ZIWA 3NXZA 3OMYA 1AOYA 3SIPB 2L9NA 1RACB 2RQPA 5HBMA 4AE5A 2XV4S 3T5JA 3DTIA 3HOWJ 2I1RA 2RVJA 4M5DA 2L3DA 5HSPA 4XRSA 3KDOA 4LRCA 4ID5B 4J9RA 5H9FK 3Q9VA 2GMLA 5KOXA 1S6QA 3KIOA 2CPFA 2CUEA 5DQIA 1TL1A 3D54A 1SB6A 3JSYA 2F4FA 3KP6A 4CA0A 1VHFA 6AT1B 5KFNA 2KU7A 1A7GE 1UVKA 1M90T 4LFBF 3BOQA 3FISA 3W2WA 5LL6d 3GJQB 2KP6A 1KYWA 5GAEJ 2Q6CA 1B7FA 1KGSA 2J9DA 4OV6A 3N01A 4I6AA 3GFJA 1DLOA 4PG7A 1YRXA 4G8XA 1FEEA 3M2VB 2BE2B 4OX7A 5AE3A 2N82B 3IMQJ 2VI6A 2H8WA 5IT9K 3OR2C 2KN4A 3HK2A 3RKXA 4USTA 2DIUA 4BKXA 1RWKB 2ZBPA 4YRVA 2DRDA 5KFQA 5KT3A 4ZN3A 3MWBA 4BQOA 1P4WA 4USIA 2V68A 1M0SA 3REOA 4U7DA 4XO0A 5F8JA 1RT1B 2BOPA 2TDXA 2R7RA 3EM1A 1UVJA 1QRYA 2X9DA 4KFCA 4F04B 2MKKA 4V1Ak 2NXNB 3PQJA 1ZKGA 2ZOGA 5EX0A 5BXIA 1GAOA 4CCJA 2IGOA 4JV5F 4P9SA 4LF9F 2HMIB 2FIUA 3IXQA 1JKRC 3HOTA 3PRVA 3M32B 4ZPDA 3DXBA 3TJ8A 4NLPA 5C42B 4Q7AA 1GXTA 3ZQIA 3FXMA 3EUHA 1BXNA 1QVTA 3C46A 4D3GA 5GAHJ 4HF0A 3M8WA 4E7LA 3A0HC 4PFPA 3NP5A 1ZM4A 1U4BA 1T05B 1W5TA 2BEOA 4DSEA 2KPMA 2RUSA 1IBLF 1PYSB 1RLDA 2R8JA 5CZVA 3KLIB 3QGIA 2XAFA 4DR5F 2X1GA 1Z3YA 2IA1A 5FD5A 4LSLA 3J7A1 2WOMA 1YITS 3E5XA 4QWCA 5BYRA