2VOOA

Crystal structure of n-terminal domains of human la protein complexed with rna oligomer uuuuuuuu
Total Genus 51
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
51
sequence length
179
structure length
179
Chain Sequence
MAALEAKICHQIEYYFGDFNLPRDKFLKEQIKLDEGWVPLEIMIKFNRLNRLTTDFNVIVEALSKSKAELMEISEDKTKIRRSPSKPLPEVTDEYKNDVKNRSVYIKGFPTDATLDDIKEWLEDKGQVLNIQMRRTLHKAFKGSIFVVFDSIESAKKFVETPGQKYKETDLLILFKDDY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Rna binding protein
molecule keywords LUPUS LA PROTEIN
publication title Structural Analysis Reveals Conformational Plasticity in the Recognition of RNA 3' Ends by the Human La Protein.
pubmed doi rcsb
source organism Homo sapiens
total genus 51
structure length 179
sequence length 179
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-02-19

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00076 RRM_1 RNA recognition motif. (a.k.a. RRM, RBD, or RNP domain)
A PF05383 La La domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2vooA01
3.30.70.330 Alpha Beta 2-Layer Sandwich Alpha-Beta Plaits Alpha-Beta Plaits 2vooA02
4AIJA 2FF4A 5L3FA 5GAHU 3CC4S 2OZUA 3LQRA 2KIMA 1MGTA 5D4SA 3TO8A 1VBYA 3SXLA 4HLXA 4ZYHA 1JHHA 2VBWA 1YJ9S 2V1DA 2WTEA 5E18F 3QPTA 1SAXA 1PP7U 1GXQA 2MZ1A 2VT2A 2CQCA 2P7VB 1FZPB 1OKRA 2Q2EA 2QYOA 1HW1A 4HBLA 3T0YA 4Q48A 3RKXA 2DNLA 3CD6S 5JHUA 1H9TA 2VOPA 4M71A 1WHXA 2HGCA 3F6OA 2OQRA 4ENJA 2HOEA 3MUTP 1FPQA 3CCJS 1TW2A 2HGLA 2JT1A 5FGMA 1WQ2A 2ZBKA 4JK1X 2CPDA 4BXUA 4HX7A 2CPFA 4MHGA 1C0WA 4G6QA 1FYKA 1AWCA 2WWYA 3R6SA 3GLXA 2MSTA 2CQHA 3D0SA 3Q5FA 3BPXA 3MURP 1DRZA 2DFIA 1IN6A 1R58A 3REOA 4ZZDA 2XRNA 2J5PA 1KQ9A 2ZKZA 2H27A 2M1BA 4HLYA 2ZO4A 5FFZA 2PE8A 3D2WA 2M70A 2D1VA 2XASA 1VQ6S 2JWNA 1W5SA 2Y48A 3GFLA 5IM0B 1S7AA 2DU9A 2DH9A 1VQOS 3THPA 1BJAA 3SHFA 2PG4A 3P9CA 5D5WB 3WTUC 4NHJA 4F25A 2B0GA 1LDJA 3TQNA 3WE2A 1FSHA 3BP8A 2E7XA 5J8CA 2MD5A 1OR7A 2ZMEA 2ACJA 3MOJB 2OZ6A 2MZTA 2IP2A 2Z3YA 4E70A 1HW2A 5CVVA 2MQMA 5LGTA 2G0CA 2L01A 1K7AA 4W92B 1SJ3P 3LA7A 5H1SV 2HVZA 4RU2A 4N9HA 5D5XB 4YUDA 1X4GA 2ZJQQ 2J76E 4CH0S 2VBZA 3JW4A 3ZN0A 4WFNQ 3CPWR 1ZREA 4ESFA 1O57A 2PMUA 4WFBQ 2KJBA 5H20A 3I55S 2LKPA 2ZFWA 2DGSA 2F5CA 4L9JA 2MQQA 2MSSA 4I09A 4IOAQ 2DK2A 2FA5A 2HYGD 4P96A 5HL7Q 3DPTA 2L54A 3WE3A 4S05A 2MC3A 3EGNA 2XUBA 5FFXA 2IPQX 4OIRF 1U8RA 3E6CC 2MA3A 3SFZA 5CJ9A 2D3OR 1M90T 5JVTA 3FXQA 2BZ2A 4WF2A 1P92A 3LA2A 3AAFA 1U1RA 4HF0A 4HDUA 2A68F 2FC8A 2FBKA 4EJVA 3KCCA 3DF8A 1K78B 1QBJA 1Q82T 1K9MT 2EVZA 1Z1DA 1FOKA 1S3JA 2MKSA 3CUNA 1YW7A 4WIIA 3QP6A 3I71A 4P9UA 3ZMSA 3NS6A 2HZTA 5K5OA 2C6YA 3L3CA 1OYIA 4G6DA 2Z33A 3VAGA 2JVRA 3UCGA 2OA4A 4J5OA 1HD1A 4M9XA 4WF9Q 2OBPA 1IN7A 1JHFA 3EX7B 5H6RA 1OMIA 2RRBA 4LG0B 3B4DA 1R1VA 2CQ0A 3D5LA 3DXJF 5DD4A 4IRGA 3RTRA 3V8KA 3JSPA 3L09A 5CXTA 2CQ1A 2YH1A 5MLCV 3V8JA 3E5UA 1R1TA 4ON0A 1UFWA 4A5NA 4IOCQ 5AONA 2MH2A 4KFCA 1USSA 1YW9A 5ILSA 2QEXS 3FZVA 1O3RA 1MJAA 1SFUA 1S79A 4Q5SF 3L9FA 4M9SA 3V4MA 2VONA 3G8SA 4LK0F 5JFRA 1MZBA 3PIPQ 3Q2TC 2JPBA 2FOKA 2XKOA 2F5FA 4OZ0A 3HSEA 2OU2A 4EQQA 4LMZA 5HDNA 2E5HA 2NRAC 1G3WA 3BO2A 1TQPA 4LB5A 4HOBA 5HS8A 1HKTA 1XSDA 2RRAA 1Z6RA 1ZZNA 4MEXF 4CZZA 3GFMA 4ENKA 3WG9A 5A2QZ 2MPUA 5BJRA 2G9WA 3RW6A 2LYVA 2ZXJA 1J2XA 4BHCA 2EB7A 2LEBA 2XV4S 2CPZA 1EV7A 2X1AA 3J81Z 2DNPA 4XLPF 3R4KA 2Z9OA 5D5VB 5DDOC 3CJNA 1W7PB 2R7FA 2JPCA 2RU3A 5ICFA 3F21A 1WF2A 4P55A 2MB0B 2DTRA 4AIKA 5LHIA 1QZYA 4IPAA 2DGTA 2FHOB 3BDDA 4IUFA 4BNCA 3I56S 1DUXC 5ICEA 1PP8F 2LQ5A 4P6QA 4PRFA 5HOOA 1R23A 2PMHA 1WSUA 3WU0A 1I1SA 2E5GA 2RS2A 4UVBA 4EVIA 2IA1A 2EK1A 1OPCA 2FBHA 4OIPF 1YFHA 1F4KA 1P1TA 1QO0D 3S8SA 2BEOA 3IWZA 2NAZA 1BIAA 5BQTA 2RN7A 3V4GA 1H6KX 2GWRA 2PEHA 2ELHA 3ZQ7A 2QVOA 1U6BA 3EQLF 4UQTA 4HQEA 2VBXA 2VE8A 1ZGJA 3TYTA 5L3DA 4QLCU 5IFMA 1RKJA 4LJZF 1REPC 3FEXB 1F1ZA 1SD6A 1DZ5A 3UD3P 2AS5F 2J8AA 4MQVA 3P6YC 2HEOA 3HUGA 2G1DA 4RGSA 5IT3A 3OV8A 1O3QA 1ZAOA 3VALA 2A6EF 3WU1B 3TOBA 1P4AA 2QUFA 2KFYA 4FX4A 2L4MA 3O6BB 2A07F 1OO0B 4R79A 3ROUA 5CA5A 1AUDA 2O3DA 1XDUA 2E1NA 1P4WA 1GXPA 4N0BA 1WRJA 3QPHA 2K3KA 2MJNA 2UP1A 3I59A 2RKHA 2CFXA 3DPLC 5A2QK 2EFWA 4KMUX 3G3ZA 3F8BA 3O3KA 3DEUA 4Z2YA 3OW2R 5D77A 1D8ZA 3KEQA 1DP7P 3CC7S 1U1KA 3MFKA 1VQ4S 4IRIA 5D5UB 3LFKA 5LHGA 2H6BA 5IT9K 3MCZA 3J81K 1N54B 2DPUA 2H94A 3RYRA 4YOEA 4ENMA 4Y17A 2Y0MA 4U7DA 3U9GA 3THTA 2P5VA 4ASNA 3KETA 2D9OA 5L3BA 5HVQC 3SQNA 4EV0A 1IXRC 1R22A 3IKTA 2RQPA 2CJKA 3E6BA 1X4CA 3H3ZA 1BC7C 4Y15A 5CLSA 3PQJA 1VQKS 3IRRA 1LB2A 2KHCA 3DLLQ 2NYXA 3KP3A 1HA1A 2DHSA 4EMSA 5HDGA 1X5TA 3I5UA 3CCMS 5H6QA 1U6GA 4XSXF 1DDNA 1VQLS 1LEBA 2DQRA 2MKIA 1O7FA 2BV6A 1HKQA 4YG2F 1YW8A 3KP5A 2M87A 1HQCA 2KU7A 3P49B 1ON1A 1VBZA 4QWQA 3HRTA 3S6EA 3HYIA 2IT0A 2AYGA 3MQ0A 4HF2A 4TV7A 2MGZB 2JRSA 4I98B 2A5YB 2DITA 2WBRA 1FX7A 2M9KA 4H0EA 4U7BA 3RJPA 4MGRA 2CQ4A 2M8DB 5ILVA 4U0WA 4WWCA 4HF1A 1SJFA 2GQQA 4XSZF 3IC7A 3N9UC 3DKWA 2DO0A 2HS5A 4EM1A 3NNAA 3G73A 3RW7A 3GW2A 4TU7A 4A0YA 5HDKA 5FD6A 4GXOA 4BYYA 3MEXA 3ULQB 3FM3A 3K1MA 2M30A 1S7OA 3NQOA 2VOOA 3VAFA 3E6MA 1Q1HA 3E97A 4L5JA 1S29A 5FLXZ 1IAWA 2YTCA 1IRGA 2CO5A 3SZTA 2ZCWA 2NLWA 3I58A 5BPDA 2QFJA 1MDMA 3Q2SC 1LNWA 3IRQA 4EM0B 4DQ2A 2MH9A 2OTJS 2AYEA 2JSCA 2MZQA 5E1ZB 4YFNF 5GAGU 2DGVA 2V9VA 3BY6A 1IZ1A 2DH8A 1W4MA 2GIVA 1K6OA 1V4RA 3LPYA 5GVQA 3J7YU 5ITHA 2KG1A 5JR3A 5L3GA 2N3LA 2RV8A 2YX4A 4Y13A 2K8GA 5F64A 3IWFA 4TU9A 3WGHA 2GXBA 5L3EA 4BQAA 3N97A 2KKOA 5AIQA 3EGZA 3U2RA 2EA4A 4CXFA 1WF1A 2HGNA 2E5IA 3V7CA 2MLKA 1O3TA 5HLIA 4L0YB 4F02A 2GAUA 1NU4A 1MJ9A 4UVCA 1WF0A 1N88A 2KJCA 4F26A 1JMTA 2CWEA 4NB5A 3MXHP 4EJTA 3K0LA 3RIRA 3P5TL 2QM3A 1IXCA 1UCRA 4WK8F 2YKAA 2MKCA 2PI0A 4KIBA 3RPQA 1TQMA 2DH7A 1BOAA 3R61A 2P4WA 2ADUA 2O61A 5LRSA 1XN9A 5D4RA 3JTHA 1P6RA 4IF4A 1WTBA 2P6SA 3FM5A 4RB2C 1WWHA 4CHUA 3J7AO 2W57A 2W84A 1U1MA 5LLQA 4Q47A 4RB0A 2YSRA 2CPHA 1ZN2A 1VTNC 4LLGF 2F5EA 3HSFA 1U5TB 3BEGB 4ZZLA 1S72S 2BOPA 3BZ6A 2OTLS 1WELA 1A04A 1X4FA 3ZZYA 5LJ3Y 3E3VA 1JXSA 1NO8A 1ZHFA 3SXYA 3QP5A 1FYMA 5E1XA 2QBYB 2RT3A 3UE2A 2NS0A 2PFBA 2XS5A 1JJHA 2IW5A 2ZJRQ 3R1LA 1J59A 3VF0B 4Y0FA 1A7GE 3K69A 2CQIA 2EV5A 2DBBA 3CUQB 5HS9A 2BBYA 1BC8C 3ZMZA 4EJWA 2CQPA 2M0GB 2DI3A 1BIBA 5DCMA 1U2FA 2F5DA 3ZMDA 1TBXA 3J80Z 1FP2A 3VOEA 1J75A 2GA1A 3HHHA 3ZN1A 1B6AA 3GWZA 1RNLA 2W24A 1LVAA 3ERED 4WXCA 2QQ9A 5EN1A 1B4AA 3L00A 1XGMA 2OAZA 4A6EA 4OMZA 4ZKAA 3G96A 2V94A 3H2UB 2JTVA 1W2BR 1I6XA 3QU3A 4CO8A 4P9FA 2F9JA 2CQ3A 2CGPA 1X5OA 2YX7A 5BPIA 1XB4A 3HRUA 1KYZA 5HLHA 2MHNA 2KRRA 1IN4A 2DISA 2H6CA 3CCQS 3UCZP 3NNHA 3V7SA 1ONVA 3GUDA 2D9PA 3O2PE 1BI3A 4ZYDA 2HWVA 2MY8A 1FT9A 2PLYA 1XGOA 2RGVA 3ZMUA 3WTYC 4KDPA 2HKOA 2YH0A 3FEYB 1DPRA 2IJLA 2KN4A 3H2VE 1FJEB 2CSOA 5DUKA 2XHKA 1VQNS 3Q9SA 1SMYF 1PO6A 2RQCA 4GCVA 3JSOA 2FNPA 5D8LB 2O8XA 3WTWC 4O3MA 2MYFA 2KM8B 4UXNA 4RGRA 4ERDA 3ML6A 3RPUA 5TJJA 1X3UA 1G4DA 2XSFA 3UWTA 4G7HF 1G2EA 1DBDA 3BWGA 1G6NA 1STZA 3F8CA 1IXSB 1O0PA 5LGNA 1L0OC 1FNNA 4HA8A 2D1HA 3G6ES 4GYIA 3FMRA 1E2XA 2DGUA 1Y0UA 3BO4A 1KD1T 2R7DA 1B9MA 2EWNA 1BN5A 4IHSA 2I2YA 2RDPA 4PGHA 2K7LA 4PZJA 3DP7A 1YIOA 3U1LA 2O03A 5KK1A 3VAIA 2XGXA 1XCVA 2UXNA 1KOOA 3JTGA 1R1UA 1WHVA 2FRHA 3VFZA 5CYJA 3CMES 3HSRA 1T38A 4RS8A 3M8FA 3V8LA 2FU4A 3MZYA 2V1XA 1LJ9A 4LIRA 2STWA 1M5PC 1KQ8A 1JJ4A 1X4AA 3C7JA 1ZYRF 4GGGA 3HOTA 5GADU 3SDEA 2DHAA 4A8XA 3TO7A 2JZYA 2DO4A 2HGMA 2SXLA 4M6YA 2XAQA 5DETA 3BJ6A 2CQDA 1RI7A 4ESJA 1K79A 1R5GA 3CLOA 3F23A 2RC4A 1RUOA 4HYEA 2CQKA 1X0FA 2EK6A 3R0JA 4KIFA 5E20A 3F8FA 1SD5A 1WHWA 1IUYA 1KU3A 2HYIB 4RAYA 5E8GA 4IO9Q 2RNJA 1QZZA 1KGSA 2OSRA 4G94A 4A0XA 2GZWA 2O6GE 3GEZA 3COAC 2VODA 1KU7A 2ZNYA 1IN5A 1ZLJA 2E5JA 1N8RT 3TO9A 3K0JA 1Q7YT 2MKJA 2K4JA 5F6FA 1VQ8S 3C1DA 3I53A 3NRVA 1R8HA 1NJIT 5DDPC 1LDDA 3KP7A 3VB2A 5TRDA 4HV6A 3TGNA 4BHPA 1N52B 1ZGAA 4ESBA 1PGZA 3IHUA 4IRHA 4CICA 2WV0A 3FXRA 2V1UA 4UNOA 3HTSB 2DW4A 3KE2A 1HKSA 2DIUA 4OIQF 2MY7A 4LB6B 1YJWS 1CVJA 2KIUA 3ZMTA 2DGXA 3GX4X 3UD4P 2DAOA 4M6XA 4HV5A 4KYWA 4EJUA 5GMKa 1HXDA 5IM0A 2N3OA 1U1LA 1IQTA 1CF7A 4I0AA 2LXUA 2JRTA 4UHTA 5D6EA 1WG4A 2OQGA 1FXLA 1H9GA 1KC8T 3OOPA 2J0SD 1XMKA 4CQ1A 4AIHA 2KT5A 3GYHX 4HDVA 3G9CA 2DB1A 2EFNA 4MQ9F 4G9YA 1UP1A 3ZZZA 3L7WA 3I0TA 4U0VA 1FO1A 1VC5A 2D45A 1F5TA 5GAEU 1MD0A 3K1NA 3N4MA 3GFIA 2DGQA 1XDSA 3ISPA 2O3FA 5LEKA 4S04A 3NS5A 1HL6A 3ELKA 4Z2XA 1R8PA 1WHYA 1T6SA 2ZMEB 1Z05A 1OWXA 3KZYA 2A69F 2X1GA 4WXDA 3LA3A 4I2OA 1IN8A 2MLGA 4KN7X 3CCVS 3CTAA 1K8AT 2FMLA 5BOXA 3M9AA 4GO1A 4LK1F 5L3CA 4TLQA 3GO5A 2OJ3A 1G3TA 3LAPA 1SJRA 1X4HA 2K02A 4C7QA 3PFIA 3IL2A 1Z6TA 2XS2A 4QU6A 3F72A 2HKXA 5J8FA 3B73A 1KYWA 1FT8A 1K78A 3LSTA 2PBIA 1R7JA 3TKYA 2UWMA 4G8XA 5J6XA 3CULA 1SMTA 2EJRA 1WWXA 2HYFA 4M73A 1WI8A 2A61A 2HTSA 3R1HA 4PCQA 1ZRFA 1U2WA 4L9VA 3DFGA 5DDQC 3MZHA 1VQ7S 1U1OA 3WTSC 1VC0A 3K2ZA 1WI6A 3WGGA 1OIAA 4LG0A 1MJBA 1ZRCA 1QPMA 3BPVA 2DK5A 4BS2A 4CH1A 3FF5A 1YO5C 1O7LA 1L3LA 1M1KT 4LLLA 2DNQA 1O3SA 4M5DB 1RIOH 5JVGQ 3HOSA 1T39A 2KIFA 3BJAA 5ICGA 3RKYA 4ED5A 3MDFA 3CDHA 3CCUS 1ZG5A 4HX8A 3VAHA 3DV8A 2LF7A 4B09A 2DNYA 1KU2A 3ULHA 2ESNA 1SJ4P 3ECHA 1JJ2R 2XVCA 4HQMA 3MI7X 4OIOF 2RNEA 5LSLA 3P3DA 4FXWA 1Z91A 1RUNA 2M8HA 2E44A 3C18A 2DO7A 1S8NA 3VAJA 2J0QD 1FY7A 2PJPA 3G8TA 5D6FA 5LXYA 1KA8A 1M5VC 2FMYA 2AD9A 1UB9A 2XB2D 2NZ4A 2H09A 1QNTA 2DGWA 2W85A 2ISZA 1YIJS 1WEXA 1JE8A 4LGWA 3HI9A 2CPJA 3QRFF 2LEAA 3CTRA 2FE3A 3TOAA 4OOIA 2FXAA 2KI2A 4A0ZA 4LMYA 3F22A 1W7PA 1PDNC 3F8NA 1LEAA 4Q4ZF 3DXBA 2E7WA 2TDXA 4TU8A 1W5TA 3CCSS 3IKVA 3JAMZ 2AYMA 2X1BA 2XIGA 5FO5A 4YFXF 1M5OC 2Z5UA 1KU9A 4O5VA 1FYLA 2M88A 3MD3A 3V7RA 1JGSA 1R00A 3L2CA 1U78A 1DHMA 4B8XA 2G4BA 1I27A 1TQIA 3T5XA 4JQFA 2MKKA 2MXYA 1BBYA 2LMIA 3LWFA 2LA4A 2K4BA 2D2WA 2ERRA 4JBAA 1Z7UA 4UVAA 3ABTA 2R3SA 2IA2A 3ABUA 2HQRA 2M5WA 4RAZA 1ODDA 2M2BA 4ZYGA 2EV6A 3LQQA 3GXOA 4LFUA 2LF8A 1HBXG 2KRFA 5HS7A 1ZARA 1CGPA 5FLXK 1ON2A 2F9DA 3T1BA 1YS6A 4FHTA 3IRWP 1WG1A 3KP6A 2HQNA 1YS7A 2DNRA 2M45A 3BJOA 3WTXC 2VXZA 4PDKA 3ZP5A 2YR2A 2GO9A 5LEJA 2XAFA 5LXRA 4I7HA 1FJ7A 3E5QA 1X5SA 2AYBA 5DCFA 1BI0A 2DGOA 2MKHA 4AVPA 4G7ZF 4QPTA 3SMZA 1VBXA 1HSTA 1TTYA 5CVRA 3ZMVA 4YB1P 2O0YA 2GHPA 1RZ4A 5DDGA 2EFPA 2XAHA 1X4BA 2ADCA 3CC2S 1YITS 3PQKA 3S7RA 3TDUC 3CO7C 3Q9VA 2VE9A 4M74A 4O6JA 5DUIA 1VC6A 4N9IA 2ZJ2A 1FC3A 2FSWA 5D78A 5FJ4A 2MQNA 3CCRS 2UZKA 2L02A 1P27B 4HW0A 1CF7B 3FMQA 3CMAS 4V19X 2DQLA 3EUHA 2XS7A 2M7SA 2CW0F 3TP2A 2FNAA 2QZ8A 2MZSA 3I59B 3RDIA 3M7GA 5D8KB 1I5ZA 4MNUA 3JAMK 4RGUA 1UFMA 1YI2S 1FBSA 2F2EA 3F6VA 5LSOA 1LDKB 1BY9A 1BM9A 3RI4A 1OYYA 4WKRA 1EH6A 4OMYA 2X4HA 3KP4A 2OIHA 5E8IA 3KEOA 1H2TZ 2Z99A 4ZYEA 1T98A 2QWWA 4EJOA 1U1QA 3WTZA 4IHTA 3DQVC 1VQPS 4C0OC 3FX3A 4CIOA 4KUMA 1ULYA 4LJMA 1BI1A 5DD8A 4RGXA 2HZCA 1UW4A 5LGUA 5DYMA 1YYVA 2CPIA 4L0ZB 5CVIA 3M1EA 2RS8A 3WGIA 5BMZA 1U6FA 1LQ1A 2M52A 2MGZA 2QLZA 1G3SA 2G7UA 1VQMS 2CG4A 4OINF 1ZH5A 2N7CA 3S2WA 3US5A 2JVOA 3NNCA 2N82B 3C3WA 2YPRA 2DNHA 1URNA 4D0PA 3E5XA 4I0BA 5EEHA 3T8RA 1Q81T 4EGZA 2MMYA 3B02A 5DM7Q 4FT8A 3K1PA 5E1WA 3J80K 3BROA 1KQ0A 2RUGA 3MAJA 1MKMA 2LKZA 3HRMA 2PEXA 3BOQA 2Q79A 3TDZC 3ZPLA 4L9NA 4NQWA 5IQQA 1XMAA 4DNCA 2DHGA 3CF5Q 1XSVA 1ZLKA 4QQBA 3WTTC 1YJNS 4GYGA 3VAMA 3R60A 2DNKA 3EYYA 1XGNA 3MUMP 2EFOA 4KMFA 2Y75A 5E17F 2DNOA 4I01A 1FNXH 1P2FA 5LJ5Y 4EM2A 3GF2A 3CCLS 5CVUA 1J7KA 2E1CA 4CGZA 2COMA 2DPDA 4KN4X 2YU3A 4OU0A 2RQ4A 3R27A 3T8TA 4A12A 2MJUA 4XBFA 5DDRC 2EFQA 1MDMB 4BHBA 1FJCA 1D9AA 2KXHA 1XGSA 5DEQA 4KNYA 5FD5A 2FEZA 3HHGA 3RYPA 4LD5A 3MD1A 3KP2A 1QVGR 1YLFA 4FX0A 1WG5A 4L9TA 2OSQA 3I4PA 4UV9A 3HRSA 3E6DA 2VT3A 4M9ZA 2M4MA 2MQPA 1SD7A 1YHQS 2M8EA 5BS6A 2NNNA 2P5KA 4EGYA 2STTA 2QQBA 2HTJA 5ICCA 2IRFG 5AIPA 3H3UA 2CPXA 4MTEA 1F9FA 1FLIA 2YWKA 5JI6A 2HDCA 3WTVC 4KIGA 3JB9k 1YQAA 2FPHX 3VODA 1F9NA 1XD7A 1QQIA 5K5QA 2P8TA 1YWXA 3G71S 2IA0A 2LXIA 2VC1A 2XKPA 3FWEA 2I38A 2LNBA 3BS9A 5IT9Z 4WX9A 2CPEA 1OYWA 1A9NB 1FSEA 4UV8A 2XNQA 1X4EA 2MZJA 2G7HA 4AD9A 1NHAA 3HTUA 2KRBA 4OZ1A 3U1MA 1OPIA 1U1PA 4A5MA 1QVFR 1D3YA 1I1GA 3KZZA 5LHHA 3FXUA 1J9IA 4G7OF 2LCWA 2VC0A 1SXLA 2HR3A 4R8HA 1FHTA 4I02A 1U3EM 1ZG3A 2K27A 3UCUP 1D5VA 1B1BA 2MBFA 2DNNA 1EH8A 2QENA 1U5TA 1U5TC 2LA6A 3G4SS 2J5OA 4YFKF 3QOPA 2KYXA 3NMRA 1GVJA 4PKDB 4XLNF 2LECA 4WFAQ 4CYDA 2EK5A 2DT5A 3I64A 3B4MA 2QBYA 1KQSR 2BE5F 3GZ6A 4A6DA 2DK8A 1P4XA 1IW7F 4ZH4F 4U67Q 1TLHB 2FY1A 2WC2A 5DV5A 3U1DA 1G3YA 3CUQC 3CUQA 2UXXA 3PIOQ 5FB2A 2ADBA 4WXHA 2P5LC 2Q8KA 2V79A 4MTDA 2CYYA 5LRRA 5ILUA 2F3JA 1BI2A 1S6LA 4C4WA 2PQ8A 2XROA 5F1RA 2U2FA 3CCES 1RK8A 1WI9A 3P7NA 2XAJA 4KICA 1XSXA 1D8KA 4HZFA 3KLOA 1M5KC 5KVRA 3SZPA 1H2UX 2L9WA 3R0AA 3EDPA 2ETHA 3LAJA 1TNSA 1SFXA 3P9KA 5DCMB 1HD0A 2BGCA 1EH7A 2LSOA 2XAGA 1X4DA 1VQ5S 2ESHA 4BAYA 5K1YA 2KH9A 1J5YA 3IWNC 1USTA 3J7ZT 3F3XA 2DNMA 2BYVE 1X5PA 4AWXB 1UHWA 5CVJA 4IXAA 4KA4A 4XRFA 4L5IA 1TW3A 1SD4A 3CXCR 3K9TA 3BO3A 4LLNA 1IF1A 1WEYA 1XN7A 2LDUA 3I54A 4RB1A 1UAWA 3TO6A 3KFWX 2L41A 2DHXA 4YIFA 1B59A 3W6KB 4IJAA 4HAMA 3NEUA 1XCBA 4Y00A 2QQAA 4QU7A 4ETSA 3EYIA 3FHZA 2GA2A 3S01A 2KM8C 1J0RA 1SFEA 1K73T 1L3KA 2DNGA 2A3SA 3HHNB 4WCEQ 1FBUA 4ENNA 1TNTA 1VQ9S 1SJQA 2FC9A 3LQVA 2A6HF 4PR6A 4W90B 3RKWA 2JX2A 3FMSA 4HX4A 5JVHQ 2CQBA 1QGPA 2MZRA 1PUEE 1DPUA 1YG2A 3QAHA 5HO4A 2Q0OA 2KXFA 3QU6A 1ZZFA 2W25A 1V3FA 2K86A 4YIIA 4KT5C 4CDGA 2DLLA 1GHCA 4P5OA 2QA4S 2ZNZA 5CYVA 1W7PD 1T2KA 3GZ5A 1H0MA 2RVCA 2DIVA 3KLNA 3MUVP 2CQ2A 2XNRA 2P7CB 2PN6A 1UHMA 2HFHA 5LBQA 4U88A 3W6JB 4M72A 5K5RA 1FP1D 2P6TA 2X0LA 1ZG1A 3GFJA 1ZRDA 4BH9A 4R1HA 4K2EA 3HIFA 2KVIA 2DNZA 2EV0A 3P9IA 1E17A 1HSJA 2EA2A 3GVAA 6PAXA 2L08A 2V6CA 4F7ZA 1H2VZ 2MQLA 3MWMA 3CUOA 4PGGA 3VEPA 4U0YA 2NNYA 3WODF 3VAKA 2X1FA 2B0LA 2GXGA 1WKMA 4FXVA 4EGLA 5ERIA 5HLGA 2A3JA 5DM6Q 4A2UA 3H92A 1Q86T 1YTYA 2MQOA 3SDEB 1D8JA 3ECOA 2ISYA 2L4AA 1FWZA 2OD5A 1U1NA 4UY8T 2CQGA 1B9NA 2L3DA 2VBYA 2VN2A 1HW5A 4MEYF 2RVJA 4WCGA 3EETA 5EEGA 2CPYA 2FBIA 4RB3C 2U1AA 1Z9CA 1FBQA 1T0FA 4IVNA 2IVMA 1B7FA 1QM9A 1IRFA 1AOYA 2AXLA 1R5HA 3M8EA 5ED4A 3CO6C 4L18B 4UUVA 1KOHA 3F8MA 1WEZA 2KG0A 2ZJPQ 2KXNB 1R36A 2FQ3A
chains in the Genus database with same CATH superfamily
3MM6A 4AIJA 1N5SA 3QO9B 1LV5A 4DCPB 4USMA 2LQJA 5A8WA 2IGNA 4XMYA 3CIZA 2QLXA 3KJVA 3LP1B 1V5VA 2XPVA 3KLEB 1JHHA 1YJ9S 4FP9A 1DQ9A 3QPTA 5KFPA 1DARA 1GXQA 3M8SA 2RD5C 4DOZA 2AEMA 1FJLA 2QYOA 1RBLA 3EZOA 3T0YA 4Q48A 4QR1A 4DR2F 2VOPA 3HOWJ 1WHXA 2HGCA 3ASNH 3MUTP 2HOEA 1FPQA 1UPMB 4NLDA 4ZS6A 2F65A 4U8YA 5FRNA 1PAUB 1TR0A 2CPDA 3LGMA 4TKTA 2CPFA 4MHGA 2DCEA 3OYFA 1C0WA 2JC0A 4G6QA 1AWCA 5BXIA 2DR5A 2FJ1A 3R6SA 3GLXA 3S1TA 4NXNF 1HNXF 5E3AA 2OTLI 3G82A 4DPUA 1C4AA 3OR2B 2DHHA 1QPIA 4F4XA 1KQ9A 1TL8A 2YXLA 1QTNB 2ZKZA 2V4JB 3KK1A 2P9GA 2J6UA 4CLKA 5EX0A 1XR5A 1PYOB 3VPRA 1SEUA 2E1RA 2C2ZB 2XZDB 2ZVSA 1X58A 2BW2A 2UUBF 4OLOA 2OUMA 4PUOB 1TTHB 2FTRA 3AG3H 1AB8A 4EMDA 2M5YA 5HK4A 1NZAA 1BMQB 3WTUC 1LDJA 2F7VA 4E7LA 2E7XA 4HSTA 1OR7C 1OR7A 2ZMEA 2ZMEC 1RHJB 1P9YA 3H5NA 3GG0A 1TK8A 2IM0A 1NK8A 1QD1A 2MQMA 1HF0A 2C3MA 4ZVUB 1UW9A 4P74A 4YUDA 3NXZA 4LSZB 1K47A 3KG0A 1VF9A 3C2HA 3CPWR 4WFNQ 2PMUA 4U9RA 2OV7A 4UB6C 3OTOJ 5K14B 1F9EB 3DGPB 2MSSA 4I09A 4P96A 3W9IA 2R8HA 3DPTA 2MC3A 1H38A 5EGOA 2H4WB 2XUBA 3GTKJ 2IPQX 1MNMC 3TI0A 2MA3A 3HOXJ 3K4JA 5JVTA 4WF2A 2VA2A 3ILJA 1I3AA 3VGVA 4QWAA 1K6YA 3ILIA 1N25A 3K89A 2DRDA 4HDUA 5C2CA 1EQ0A 4KH1B 1AFJA 3D4JA 1K78B 2EVZA 1Z1DA 1T08B 1FOKA 5F0CA 4DFJA 3D6MB 3RZAA 2CV2A 3I71A 4I2PA 1RWVB 4GRIA 2JLFA 1NRKA 3K70C 2O1PA 4G6DA 3VAGA 5J4YA 2OA4A 5T7LB 2C2MB 4PG8A 5L1IA 1HQ2A 3OSPA 4R25A 3OYJA 3EX7B 1OMIA 2RRBA 4FPRA 2CA9A 2NXJA 2DPIA 2GJ2A 1QAXA 1JNZB 4DR1F 2KZGA 3AKZA 3S2DJ 1LQ9A 2YH1A 3FQKA 3KHGA 5KFYA 5KFKA 4KHMA 1KN6A 2IHR1 1ERDA 3BGRB 3D1OA 5ETVA 2QEXS 1URRA 1O3RA 3CE8A 3PNIA 1QHGA 2I10A 4Q0BA 3EUNA 3JRIA 2HIYA 3PIPQ 4ID5B 2FOKA 2F5FA 2HSEB 2WVEA 2OEKA 1AT1B 4FISA 3LOCA 3JYTB 2B9EA 4LMZA 5F08A 5HDNA 2DA1A 2E5HA 2NRAC 1G3WA 1C4CA 3QT5A 3UNGC 1YRXA 1BQNA 3H7HB 4ECUA 4DL6A 2XEXA 3WG9A 3G1LA 2KYZA 2LYVA 4JI2F 2ZXJA 1RT7B 2YNFB 4JI7F 4BHCA 2LEBA 4YR0A 3M8RA 3BDPA 1YE9A 2JK3A 3C6UB 1H98A 1Y39A 2HHQA 2DNPA 4OHZA 4ECYA 3JXOA 2JPCA 1HQUA 2RU3A 1IV8A 4F4WA 1WF2A 2FZKB 4OX9F 1TUWA 5IZHA 1ZTWA 5LHIA 4IPAA 2MG4A 3SSQA 3BPSP 3R5CA 4WXOA 2Y69H 4JX5A 3I56S 4E0DA 2OGUA 2EBGA 2W48A 2H5IB 2GIRA 2DJIA 1U0SA 4YHHJ 2LQ8A 1OPCA 2F8HA 1F4KA 1P1TA 2DY1A 2BEOA 5KFHA 3ZC4A 3IWZA 3Q8RB 2DXFA 5IC4B 2OUGA 2PIIA 3V4GA 2ELHA 1U6BA 3EQLF 2GHVC 5CCMA 1WC4A 4LVNP 4QLCU 4QJVA 4PEOA 1F1ZA 2H4YB 1JIHA 1SKRA 1DZ5A 3R5JB 1IJWC 4EK2A 4MQVA 1OY6A 4ELTA 3OR2C 3FBEA 3AJ2A 5IT4A 3V6DA 3N01A 2HEOA 1DTQB 3IAS9 4ZN3A 2OPQB 3D1HA 2V4JC 1CJVA 3PNYA 1OPZA 5IT3A 1RT1A 2V4RA 5GPCA 3WU1B 1U2RA 3TOBA 1SC3B 2JEGA 3HK2A 2FLPA 3MZ8A 2L4MA 3KG4A 4R79A 3HD2A 2GO8A 3KWMA 2O3DA 2BMBA 4LFBJ 2JDJA 4HT7A 1LE8B 2MJNA 3R5DA 2XI2A 3D28A 4KMUX 1BWEA 3G3ZA 3PUBA 2B9YA 3DEUA 5D77A 2E2IJ 1ZKGA 1EAYC 2KB2A 2E5LJ 3G6VA 4IRIA 5D5UB 2BJEA 4IO1A 4KE5A 3Q8QB 3J81K 2DPUA 3D1QA 4ENMA 4Y17A 1JKHB 2OD4A 3M6VA 4U7DA 3ZZPA 3V6KA 5L3BA 1A36A 2W2NP 2XF5A 5HVQC 4G1QA 3IKTA 3OVBA 1BR2A 3J7AY 1DGRM 3H3ZA 3BBBA 5CLSA 1TWGJ 3HT3A 4MK9A 3KLFA 2ASJA 3ISZA 2RKIB 1HA1A 3HHLD 2KZZA 1S6UA 5HDGA 3F9KA 3I5UA 4UY8I 3A2KA 2GOXB 4XSXF 1DDNA 2ZB9A 2JUGA 2DQRA 4IOBA 4YG2F 1YW8A 3KP5A 2Y31A 1C0UB 2CJ9A 2M87A 4DPOA 3GTQJ 4XKCA 1HQCA 4RBTA 1R0AB 3JRCA 1D1CA 2BY1A 2HQAA 1SUQB 2KU7A 2VUMJ 4F91B 3S6EA 1FDNA 5EX3A 2DA5A 2N4CA 2IT0A 2NVQJ 4RW8A 2V2ZA 3H0PA 2AQ4A 2JRSA 3LTOA 3ZGKA 1U25A 3GLJA 4DPYA 4OHVA 1NPRA 5ILVA 1WKLA 4ECTA 2AEJA 4B3XA 1SJFA 2GQQA 4XICA 5ETSA 3QZ8A 2J0XA 3JRDA 4Y28C 2HFNA 4TU7A 5L8RC 3OFHA 3MPVA 4JX6A 1WVRA 4XRSG 3T5KA 1JTXA 3BC8A 2CJAA 2M30A 3NQOA 4GVBA 3VAFA 1HBUA 3E6MA 1Q1HA 4L5JA 4U87A 5FLXZ 1IAWA 4B9TA 3GTOJ 4NQWB 4RNNA 2CO5A 2Q43A 4DR5F 2AHOB 1A35A 2IBOA 3AD7C 4N8NA 2QFJA 3CCUI 3DCAA 3IRQA 4LQ3A 4EM0B 2KZVA 3VSLA 4FF2A 4DV6F 1WH5A 3BY6A 1IZ1A 2DH8A 5C25A 2B9SA 2GIVA 1K6OA 2VFVA 3GIJA 3KEYA 5GVQA 4DV3J 2WTFA 3GIMA 5L3GA 2XLIA 4DIQA 4ZDNA 1Y7PA 3ZZRA 3VGSA 1T94A 5F64A 2F40A 3GSDA 2W01A 2L3MA 4TU9A 2ZC2A 2YQ3A 1S10A 1H72C 2HHHF 4NZ0A 4V1Ak 2YKOA 1EP4A 2JWTA 2GXBA 3OFGA 3MMCA 2K1RB 2HGNA 3ENWA 4EUVA 1RTIB 4ED6A 2PJRB 2CUFA 2EW9A 4F02A 1QU3A 2GAUA 1NU4A 1L3TA 1RKWA 1S5LC 2ZBRA 1Q78A 1N88A 2KJCA 3VDXA 4H54A 2YUSA 2QM3A 5KT5A 2YKAA 4USWA 1SC1B 4KIBA 3RPQA 2DH7A 3M1VB 1BOAA 5C5JA 3R61A 4XKVA 2EFVA 4ES3A 4ZVQB 2ADUA 2M34A 4JYKA 4OJ3A 3JTHA 2M8GX 4IF4A 4A3LJ 2DEIA 3N79A 4NLTA 4OFZA 1WTBA 2BVZA 4HSRA 3A8KA 3J7AO 4JI5F 2HS4A 5KFLA 4RB0A 4EEYA 3MMBB 2I8EA 3PR5B 1UJ5A 3UR3C 3BZ6A 2ZITA 2OTLS 1A04A 4L74A 3ZZYA 3E3VA 1RAHB 4ECRA 3BCBA 2WW8A 3SXYA 2LEPA 2IM2A 5E1XA 2FOWA 1KQKA 2PFBA 3ERMA 2W9CB 2V63A 3VF0B 4Y0FA 4BJ5C 1A7GE 3A0BC 2E1PA 2EV5A 2LU1A 2B6AB 5HS9A 4MAKA 3ZMZA 1RWOB 4UUSA 2M0GB 2DI3A 2ZE2B 4DU7A 5M5XJ 1CG2A 3MR3A 3VOEA 2GMLA 1FXRA 2HRTA 4ZK7M 1J27A 3D6FB 2HQ5A 2JVHA 4FYWB 2C2NA 4WU2A 1BGXT 3OFEA 1D0EA 1EHWA 3HVTA 2OAZA 2R7ZJ 1TK5A 4ZKAA 1RKIA 2CQ3A 1T11A 4M5IA 3UI3A 5IYBJ 4G6VB 1X5OA 2DPJA 2W2PP 5BPIA 4ES2A 4QOTA 4ILMA 4P9SA 3Q86A 4CWBA 4BDPA 1IN4A 2DISA 2H6CA 2LREA 2BACA 3NMAA 5KFCA 3NNHA 5B1BH 3V7SA 1RTJB 2N7YA 2D9PA 3O2PE 4MH8A 4KDPA 3ZMUA 2YH0A 3NS7B 4IOAF 3MR6A 4QYZK 5I42B 1TFWA 4ANCA 3H2VE 2L5QA 1YK9A 2BOLA 4DF8A 3D0HE 5DUKA 1SQGA 3BKUA 1I6JA 2RQCA 3JSOA 1JKQC 1N33F 1FFSB 1Y4ZB 2GIZA 3I0RB 3LSJA 2L7FP 3S1NJ 3RPUA 5TJJA 1X3UA 3FEZA 4DX7A 2CG8A 1WFXA 4I0WA 3UWTA 1G2EA 1T03A 4W4MA 5K8OA 4AXJA 1FNNA 4ZA1A 5B0GA 1K83J 1FKPA 3A01B 4L3KA 1RT2B 3T1AA 3QATA 2CNOB 4WJBA 4YY3J 5KT2A 2D1HA 3BZQA 4MFBA 4I6YA 3FMRA 5M2UA 1XEZA 1UVLA 4ZTFA 1B9MA 2EWNA 2AJQA 2NPIA 3IMQJ 4AL5A 2HEKA 3FFIA 1CULA 3P5BP 4PZJA 3DP7A 2O03A 5KK1A 1DU0A 1WUUA 2FUG9 1IKYB 3VAIA 2VFTA 3HFVA 3VVUA 2AGOA 5D8HB 3DMJB 1EJ7L 2QLWA 1WHVA 2FRHA 3OWTA 2CQNA 3BB5A 1Q8LA 2EZKA 5D3GA 1QZEA 1BL0A 1WJEA 2QIFA 5G0RA 5ETRA 1S0MA 5HMYA 1CJTA 3PJRA 4LIRA 1KQ8A 3CJTA 2AU0A 2DHAA 4HPQA 5LMUJ 3OXFA 4NMXA 5DETA 5E2QA 2IY5B 2C3PA 5DS9A 4DQIA 2RC4A 1Z21A 1RR8C 3TQEA 2R7UA 1FIPA 5KOXA 4QYZJ 1X0PA 1VJWA 4B44A 1PJ6A 5E20A 4F93B 2GJIA 1X4OA 3F8FA 5IYCJ 5C24A 1WHWA 3M05A 4RW9B 2HYIB 4RAYA 3LL7A 1AKHB 3KKFA 3FKJA 2F1FA 1WSRA 4IO9F 4XORA 5CD4A 2HZAA 3GEZA 2VODA 4B3SF 2C2RA 3LSMA 3ZOBA 2E5JA 1XMQJ 3TBIA 5GAGJ 4LITA 1MMLA 4PG4A 2JA2A 5DTDA 4ZIVA 5F6FA 3C1DA 3KDOA 4A3CJ 4ZVRB 3EWGA 1N0UA 1R8HA 3AB2B 5DDPC 1LDDA 2CKWA 1RPWA 3UDEA 4CM2A 4E7KA 4HV6A 1RA6A 3MM7A 1YJ7A 1U8WA 2CUEA 3FNNA 2LTPA 2HAFA 2Q2EB 3K4LA 2PGCA 2V1UA 4UNOA 4XLAA 3HTSB 4R0JA 3KE2A 1HKSA 4RJVA 5E3CA 2DIUA 4N76A 3HHDA 5F8MA 4LB6B 1YJWS 2NXNA 4NASA 3TZYA 2PI5A 4QTRA 1T3OA 3JRBA 2HHPA 3GX4X 3UD4P 1ORKA 4HV5A 4RBVA 3MR2A 5GMKa 4Z7CA 3AA8A 4X4QA 1P6TA 2IYIA 2FDNA 3DRRB 4JB8B 3L1PA 4IRKA 1ROFA 3FC9A 2JRTA 2ZH5A 3C6TB 1WG4A 4M5LA 2OQGA 2EG1A 1NPKA 3OOPA 4AIHA 1HDPA 3ISNC 3UR0A 3OYDA 4PFPA 1FTCA 2QSFX 2RMLA 3PFYA 4J19A 4HDVA 3G9CA 2DB1A 2VG6A 1UEVA 3S32A 2XHCA 2Z0GA 4CCMA 1ZK8A 1SVMA 3K1NA 4V2FA 3GFIA 2DGQA 2YNHB 1XDSA 2IVYA 4EEFG 2O9LA 4CO2A 3ISPA 2O3FA 5LEKA 3BGFA 4S04A 4CYCA 1RAFB 2DT7B 3ELKA 4Z2XA 3H5RA 4BBYA 1WTFA 2X1CA 2CZVC 4DLEA 4I2OA 3SEQA 3ITHB 3C19A 3GFXA 4LF9F 1S0VA 1A6IA 2FMLA 2MSYA 1QLNA 5A76A 5IWAF 5D4OA 4JI4J 5C42B 3DM2A 3GE9A 5CCLA 5L3CA 2ZBQA 3MFHA 4TVAB 2K02A 4C7QA 3PFIA 4OYOA 1EF4A 4DFPA 5G4DA 4OYXA 4I76A 4JOMA 2CQ7A 4QU6A 5B1AH 4ZDOA 2HKXA 3CDBA 3S3NA 5J8FA 4I7FB 3J7A1 3B73A 1EKEA 2ZOGA 1KYWA 3K5PA 3Q24A 1Y1VJ 5BYQA 4S0MA 3S1MJ 1UWAA 1NJXA 4U95A 4ILRA 5J2MA 2UWMA 2H5JB 3RU0A 2BY2A 4XOPA 2HBRB 3AOCA 2J6SA 4O3SA 1IWAA 1U8SA 4J9RA 2AJ0A 4D5FA 5M5WJ 1X3WB 1O8BA 4KHRA 1R6YA 2IRYA 4NLVA 1JJ8C 1T9WA 3X3UA 3S14J 3V6JA 3NAHA 1WJBA 1ZAWA 3QZ7A 3AHPA 4IFYA 1UETA 2F8MA 1OIAA 2EKYA 1HWUA 2ZUAA 2KMUA 3DN9A 1O4XA 2DA4A 2E19A 4LF4F 3ETOA 1QPMA 4PSWA 1LUJB 2H8RA 5A8RA 4DV7J 1IM4A 3FMWA 1O7LA 2DNQA 4M5DB 3QPLA 5JVGQ 3IH3A 1T39A 2ME0A 2KIFA 3PW0A 3MDFA 4NLGA 3PTWA 3CCUS 2D1CA 2CJQA 5ETOA 1SPBP 3EZUA 1FVQA 2K5CA 1F2GA 2FHMA 3ECHA 2OTJI 4G65A 3ENQA 2CNLB 2VU5A 4OIOF 4FXWA 5D0EA 1Z91A 3U1KA 1HI1A 2E44A 2PD1A 2DO7A 1U02A 1FRXA 1FY7A 2PJPA 4G1PA 4ZCLA 2F4MB 1KA8A 1RXOB 3G87A 4AUKA 1IM6A 5LMNJ 5ETQA 1Z2ZA 2QA1A 2HIQA 3MR7A 1EKSA 2B7BB 1I39A 2KT0A 4DR3F 4O3QA 5IV4A 1HWKA 2FE3A 2QCOA 2KI2A 3K4CA 3GONA 3F22A 2F4OB 5H9FK 4RA2A 3HDSA 3F8NA 1OSDA 1LEAA 2TDXA 2WY8Q 2X1BA 2XIGA 4F36A 5FO5A 3M8PB 3MD3A 2LP4A 1VBKA 3V7RA 1RAAB 1R00A 1JLBA 3T1YJ 3DBLB 3MTKA 1N5YA 1DHMA 1EB0A 1R6VA 1I27A 1RRJA 2VG5A 2OCEA 2MXYA 1Q95G 2LVWA 3LWFA 2PEBA 2K4BA 4RUAA 3KK2A 1RT3A 1Q0NA 2ASLA 2ERRA 1Z7UA 2XAUA 4HACA 2M5WA 2GVZA 3SV4A 3LQQA 4LFUA 2KRFA 3TRGA 2H65B 5KAFC 3MVPA 1ON2A 3KJQB 4FHTA 2D41A 4H4OB 2FJXA 5CYQA 1N6QA 2E60A 3OXLA 1YS7A 4ICLA 1RT6B 4PDKA 1JLGB 3ZP5A 3CCZA 2FJWA 1U7LA 4P10A 4J9MA 2RDDA 3E5QA 2LDIA 1X5SA 2ROEA 3AJDA 3OYAA 5HBMB 2MKHA 2DGOA 2DCUB 2AJFE 1OCOH 4NA1A 4ZMMA 1VBXA 1HSTA 5CVRA 3W8GA 3H9GA 3T6BA 1QSSA 3LP2A 4QCLA 2BE2B 5AXKA 2EFPA 3GJTB 2ADCA 1CC8A 2OFGX 5B0FA 2YKMA 2JLEA 3DLKA 3CD5A 5AT1B 4M74A 3EUKL 2VE9A 2HQ3A 1FC3A 4LF5F 2FSWA 3JTNA 2NXEA 2ECCA 1WDTA 4MIAA 4FYYB 1CF7B 5C4XJ 3FMQA 2XS7A 3M07A 2M7SA 3TP2A 2FNAA 4URSA 3I59B 3W6VA 3NGSA 5D8KB 1I5ZA 3JAMK 2XPUA 1M1HA 3H59A 3BBFA 4HG2A 2PX9A 5H9FJ 4UY85 1EH6A 2ME6A 2IBDA 3SEZA 2LP0A 4JYAJ 1H2TZ 3RUBL 4LF6J 1FI4A 2AW0A 2YKQA 1G4CA 2YNIA 4ZPWR 4CYUB 3JSMA 4BXFA 4EJOA 4K50A 3P45B 2VG7B 3MM8B 3WTZA 1RTZA 4Z37A 3M2UB 4U7CA 3MECB 4X4UA 3FX3A 4A47A 3QYYA 4YB5A 1PIEA 4HDHA 2OP5A 4LJMA 1BI1A 4QZVB 4NCGA 5DYMA 2DJWA 3LMMA 1R0BG 4L0ZB 5CVIA 5IP9J 1OISA 1FERA 4J9NA 2RS8A 3CZ6A 4DV0J 3E8OA 2WVBA 2M52A 2MGZA 2QLZA 1G3SA 4OINF 4XR6A 2C42A 2VQFF 5C4JJ 5GAEJ 1ZH5A 3OY9A 4O4GB 2XB0X 3B82A 2N82B 4JI0J 2DNHA 5CKTA 1URNA 3M8YA 5C2GA 4MIMA 2G13A 2JL9A 4I0BA 2MMYA 1MROA 4NPOA 5DM7Q 3MEKA 4FT8A 3POTB 3Q8VA 4NC7A 1KQ0A 4C11A 2PSZA 3MAJA 1MKMA 3JCUC 3BOQA 2JHEA 4X65J 3QRPA 5IQQA 4X66J 5AXLA 3T5HA 3CF5Q 5HNFA 4AYBA 3PSIA 4H4MA 2ZXIA 2OPRA 3EYYA 4P73A 3RQIA 2L9DA 4QWDA 2Y75A 5E17F 2DNOA 5J1PA 2ZH6A 2LLZA 3W2VA 4A3DJ 3WX4A 5CVUA 2X1DA 5HNHA 2E1CA 3HCXA 3NGKA 2DPDA 1ZBTA 5K8NA 2C3OA 3T8TA 3GV5B 2C2DA 4XBFA 1D09B 3O5TB 4QIWD 1D9AA 2EPFA 2ACYA 5LL6d 2UXDJ 3BT9A 4AQYJ 3H3VK 2IJNA 3NBPA 4FE4A 3SI8A 3AT1B 2VT3A 2W00A 4X4SA 3RBEA 2M8EA 2NNNA 2QQBA 1X2NA 4WFXA 3FCHA 5AIPA 5E5NA 4QWCA 1QAYA 2GS8A 3FXLA 4Y3CA 1HFEL 1F9FA 1FLIA 2EWHA 4KKOB 3MM5B 2EZIA 4GC7A 3OYCA 4XLEA 2HWHA 3HZEA 1YQAA 3T6JA 1NG7A 4OHXA 3LAMA 1QQIA 2HLTA 2NS8A 2XKPA 2RF2B 3V81A 2FZCB 4DR2J 3BS9A 2CPEA 2B8PA 1A9NB 4UV8A 1BLUA 2XNQA 5LD2C 3KOAA 3ENAA 4MIWA 2RDJA 2ZKUA 3FJ2A 4XPCA 1YGYA 3KHRA 1N5TA 4OZ1A 3OL8A 1S1TA 2VB6A 4A5MA 3CMQA 1D3YA 4P71A 4LFCF 2Z1DA 1J9IA 1B0VA 1A31A 2VC0A 3VQTA 4ZHRB 1TV6A 2MBFA 2F8EX 2QENA 3QOPA 4WTOB 1GVJA 2RRNA 2RB7A 2LECA 4EU0A 4WFAQ 4C8MA 1HC8A 2EK5A 1S1UA 4TY8B 3DKYA 2EZLA 5F8JA 3I64A 2O5RA 1D0YA 1T0TV 1D1AA 4A6DA 4G3IA 4U8VA 2R7XA 2FY1A 5JUMA 2WC2A 1JLQB 1S1XB 3W1YC 1VRUB 2UXXA 3PIOQ 5FB2A 4P1WA 2ADBA 1RT5B 2Q8KA 1RETA 4MTDA 1IV6A 3FBCA 1BI2A 1IR2A 2XROA 2BKPA 5F27A 2E34A 3CCES 5J1EA 5E3PA 1BHNA 4ITVA 4KICA 1O5JA 1IKXA 4LR7A 1RACB 1WOOA 2L9WA 2ETHA 3PM1A 1TNSA 3DYAA 4A3EJ 1TKZA 2XCAA 1RTDA 4NRUA 2LSOA 3NWTA 2KH9A 1C1BB 1ZELA 1J5YA 2P9EA 3MMAB 3IWNC 3N6LA 3H20A 3CC7I 2HMIA 3LP0B 3F3XA 2NSBA 3MAAA 1WJFA 4WU3A 3UDCA 1LWCB 4IXAA 4KA4A 1RU1A 3PRDA 3PHEA 3J7AN 1D3WA 4ENOA 4KYZA 1NJYA 2VA3A 3G1MA 1P9QC 1XN7A 3UN2A 5FKKA 3QNWB 1EETB 4LF8F 4B3MJ 3TP3A 4KPYA 2DCLA 2ZH7A 4N77A 1Y11A 2VPRA 3A13A 2BEFA 2VL1A 1HQEB 3W6KB 1NSPA 4DGWB 3IN5A 3CCMI 4B48A 1QSLA 1NG6A 1Z0XA 4CLSA 2DNGA 4WP8A 1U6ZA 4WCEQ 2V6EA 1TNTA 4OI6A 1I6HJ 1SJQA 3TVKA 3BV8A 4UOFA 4W90B 1HKAA 1J5EF 1YJUA 2LRDA 4C2MJ 2BKOA 5F0WA 4OZLA 3EVMA 4KRWA 4HX4A 2LY9A 1LOUA 2GQCA 3MEEA 3S3OA 1DPUA 2DFHA 1XNRJ 2X9DA 1SH0A 5KG1A 5ADZA 1ZZFA 2W25A 3CESA 1JLFA 1V3FA 2QN6B 3JAMY 2J6TA 1WZ2A 3H40A 3ZNUA 1LNQA 3N4WA 3OLBA 2EH3A 2DLLA 5A8KA 1RISA 3OR1B 4LT6A 2TRTA 3R7SB 2DXDA 3M32B 2IS2A 4ANEA 3QFWA 4DCJB 1NK9A 2JEIA 2HXIA 4O23A 1Y3KA 4OV1A 1FRIA 2X1EA 5M2PA 2CQ2A 2J9DA 3OHBA 1UHMA 2BVLA 4DG1B 1NHKL 2DOEA 2R8GA 4U88A 3IBFB 1V54H 1FFGB 2JSXA 4AD6A 2K9MA 4FDFA 2ZH3A 1BJZA 3L7OA 2WVCA 1FX4A 4M72A 2X0LA 1ZG1A 1FDBA 4UZCA 4BH9A 5B3SH 2JJ7A 2ZHAA 1YJVA 1S97A 4JI2J 1FFWB 3GTGJ 1Q5VA 1GT0C 1H2VZ 1MSWD 4PGGA 4DHVA 1ZS6A 4NWBA 2CFOA 2Y30A 2XMVA 2VDHA 2DXEA 4KT6A 4OX9J 1UVNA 4CSWA 1LFBA 2A3JA 3TEHB 1IDZA 1YTYA 1L3SA 2HZVA 4OIXA 3GIIA 3AJ1A 4NYZA 5K5MA 1U1NA 3KXDA 4C3KA 4RM3A 2L3DA 2XLKA 3WU2C 2QL9B 3RQ4A 4Z7YA 2HVDA 3RG6A 4J37A 3BSNA 1ZTTA 3QGIA 3BBCA 4K0KJ 1AOYA 1DU6A 5BR8J 1R5HA 3A1YG 2KXNB 1R36A 4LVOP 1RWKB 3LQRA 2KIMA 1MGTA 4CO3A 5D4SA 3TZWA 1UZCA 2WHOA 3HSGA 3HSDA 4L3NA 5E18F 2VH7A 1SAXA 4XIUA 4LRCA 4CCNA 2BX6A 1Q4RA 2WOMB 4X62J 3UN3A 1FZPB 2EBIA 2AMCB 1HW1A 3HEFA 2DNLA 4TY9A 1H9TA 2DEJA 4M71A 3F6OA 5D0HA 4NLYA 1TW2A 2HGLA 2GZOA 1WQ2A 4CUGA 2ZBKA 1JUSA 4C9YA 4BXUA 2R0QC 1M1GA 1PVEA 4WWSA 1JQGA 4UOHA 1AYEA 3MURP 3BPXA 1T9XA 1PILA 1VIOA 1IN6A 3REOA 4ZZDA 3RBZA 2HPMA 2M1BA 2UUAF 1QVTA 2VQEF 4UW2A 2ZO4A 2FJDB 2PE8A 1CS4A 3D2WA 2P81A 3LGNA 1TAUA 1HI0P 5KAKA 3B6CA 1LW2A 4MFEA 1KKHA 2HFSA 4KT0C 2YS9A 4V19J 2PFFB 1S7AA 4O4RA 5KFFA 1IKWB 1RESA 4DR7F 1ACMB 2Q6BA 3SHFA 4IHWA 4FBUA 2RU9A 2B0GA 3WE2A 7AT1B 3GPAA 3PYFA 2MD5A 1IVZA 2MZTA 4HH1A 2BE7D 3AL0C 2B43A 1WCMJ 3Q22A 2R7QA 3NWGA 5I4MA 2BV3A 1ZR4A 5HROA 1SV5B 5H1SV 4RU2A 2BYCA 4DZ6A 1X4GA 2ZJQQ 5IYDJ 2J76E 4CH0S 2VBZA 3JW4A 3RJMB 4ESFA 1YJRA 5H20A 2XWYA 3UFCX 5LT5A 2LKPA 1XS9A 2DGSA 2F5CA 1NB7A 3EDQB 2MQQA 3K10A 1BQMB 3IH2A 2DK2A 2FA5A 5E3MA 2XGPA 1SUQA 3WE3A 4J9QA 3E3XA 3PX6A 5C7PA 3E01B 5KFOA 2UXCJ 1YX3A 2LBFA 5FFXA 2GXAA 4OIRF 4UB8C 3QWPA 3JRGA 1U1RA 3IUOA 2QC3A 2A68F 4Y2CA 2NPFA 3KCCA 2IS1A 1K0TA 3W9HA 1S7HA 3G1OA 2RREA 1SIZA 5E7OB 3DOKA 5ETPA 4IHVA 3TOQA 2JN6A 5F8IA 1HBNB 4OYPA 3QP6A 3ZMSA 4DWIA 2YVSA 5IT9Y 3L3CA 4MO7A 3KK3A 1OYIA 2Z33A 2JVRA 3UCGA 3G6EI 4M5HA 2OBPA 3W63A 4XO0A 2M7BA 2QYCA 4LG0B 3B4DA 1R1VA 2O67A 2PMZA 3SBMA 2AF6A 2E9RX 4IRGA 3DRSA 4PWUA 3L09A 1NPPA 1OJ4A 1SB6A 3ESWB 2QMUB 4CZCA 1TT5B 3E5UA 3W62A 2RQKA 5CQEA 1UFWA 2JEFA 1HPZA 5AONA 1X1CA 1RAOA 1YW9A 2F6CA 2HHHJ 3OYHA 4IX7A 2H1KA 2B4OA 4IOCF 1L3UA 5IC6B 1VR6A 3RB3A 1MJAA 2Z2LA 4OYZA 2A6TA 2TCTA 3TQ1A 2W1BA 1X19A 1S79A 1YKWA 2VONA 5CYMA 1NKBA 1ZA2B 2R5ZB 3W2WA 2B7CB 3Q2TC 4ZDLA 1LK7A 3QIPA 4OZ0A 1KTVA 3KLHB 2KT2A 1N5VA 5IOLA 4EQQA 3BO2A 4LB5A 5HS8A 1HKTA 1XSDA 1MMDA 3VZHA 2RRAA 1F9HA 1ZZNA 4MEXF 2PJRA 4CZZA 4ENKA 3ICLA 5L39A 4R8UB 3OOUA 2G9WA 1Y1WJ 1XK8A 4C8ZA 1RWPB 4ZVEA 1ZM3A 3M9OB 2EB7A 2CWKA 2FVQA 3DI6A 2FVCA 2WY7Q 2CPZA 2IVFB 4PK4A 2JA5J 1QDUB 1S5ZA 2LOOA 4XLPF 3CJNA 1W0TA 1HIYA 3LALA 5ICFA 4IL6C 2ZD1B 1B4SA 4NLSA 2MB0B 3NWSA 2MW8A 1HYSA 4JI8J 5D6GA 2HURA 4IYQA 4F0MA 4PXDA 1YOVB 4QBUA 3BR9A 1S6QB 1PP8F 2LQ5A 3M8QA 2W1OA 1R23A 4ZCIA 3WU0A 2UVRA 4A8FA 1I1SA 2E5GA 1T05A 2XI3A 4J9SA 2FBHA 4AC0A 1Q8IA 3Q89A 2ZXWH 1WSVA 3S8SA 5JXSA 3CWJA 4OYAA 2NAZA 1BIAA 2RN7A 7FD1A 4ILLA 3AG4H 4WZQA 3ZQ7A 2PDAA 4KHPF 2WCXA 1REPC 3RRKA 2XTJP 1SD6A 1HNWF 2ZBCA 1IDYA 1RAIB 3OSGA 1G7CB 3ELHA 5DO2A 1E6VA 2QG9B 2RSQA 3KMQA 2HYJA 2BRLA 2E36A 5A0YB 3GTPJ 3SQOP 2XY7A 3R5AA 2R8IA 3D6HB 1O3QA 2A6EF 3H4DA 3SV3A 4D7NA 3LSGA 2IEKA 2ABYA 2QUFA 1TP7A 3DRXA 4FX4A 3PCOB 3PNVA 2VKRA 1ZOTA 3ROUA 2Y9ZA 1FNMA 2WB1A 1S9GB 4C8LA 2L7KA 1AUDA 1CJUB 3K6GA 1P4WA 1XJWB 4N0BA 4DV5F 2JH3A 2UP1A 2RKHA 2CFXA 3DPLC 3CJ3A 3BYRA 3GSIA 4I99C 2VQLA 3O3KA 2D5VA 1F1BB 3HKWA 2JC1A 2VKZG 2KZMA 1B8IA 2AO9A 5J2NA 1DP7P 5L38A 1QVUA 1YSJA 3MEDB 4TQSA 3CC7S 2IIHA 2FJEB 3M8WA 3DNCA 2H6BA 1KLMB 4ZLPA 1R31A 1FRJA 4OHYA 4YOEA 1NM2A 1ELOA 3THTA 2VV5A 4PJMA 3KETA 2D9OA 3UD5A 1WDDA 3DOLA 1N33J 3S1RJ 5HVHA 4KGXB 4EV0A 1FEEA 2RQPA 4Y15A 3PQJA 2XWXA 3CCVI 5DG8A 3KLGA 5DG9A 3PW4A 1R4MB 2VLAA 4ECWA 5I3UA 2M3AA 4GO5X 3DLLF 2OHDA 4ZP8A 4FVMA 3CCMS 4WK1A 2X51A 3FSYA 3FCVA 2VZ9A 5EDNA 4Q45A 3I4MJ 2X6OA 1F5BA 1UVIA 2BR0A 3OQ2A 4DSIA 3QWUA 4LBPA 5H9EK 5F3ZA 2DYRH 4CI0B 1S12A 1FDDA 2AYGA 3MQ0A 3H5XA 4HF2A 4TV7A 3QAEA 4LFAF 2A5YB 2WBRA 1FX7A 1FOWA 1Z77A 3GYXB 3RJPA 3EGVA 3BH6B 3KYCB 2I1RA 4U0WA 3VR1A 1WC6A 4UUWA 4B9MA 4PG5A 1LWEB 3N9UC 4I2QB 1IO2A 3G73A 3RW7A 3GW2A 5E3LA 4A0YA 3RR7A 4BYYA 4J90A 2G2OA 1XMOJ 2IMWP 4XKWA 3K1MA 3IR6B 2NCKL 2NS1B 4YN3B 1S29A 4OI3A 3Q8PB 1S9EB 1D9FA 2AZ1A 3IS9A 4RW4A 2W4SA 2NLWA 2K9LA 4E7SA 3Q2SC 2EFGA 2VF3A 3V42A 1E0EA 2NYHA 2MH9A 2AYEA 3SSRA 2WAQD 2JSCA 5KOWA 1TFYA 5GAGU 5EUHA 3M6UA 4IG3A 2HS3A 1NB2A 2WV1A 1W4MA 3IR7B 1B99A 2V67A 3C46A 3QODA 2RIJA 3BR5A 3LSRA 5J1RA 4MYTA 1FMWA 5DM6F 1R4NB 2LKXA 4Y13A 3A03A 3AAWB 1QAJA 1QHHD 1GNKA 4KFBB 3ZQIA 2XMAA 5M3MJ 4JX4A 1PC5A 1YIJI 3KG1A 5L3EA 4BQAA 3T9ZA 2KKOA 5KFVA 4R0EA 3C8YA 1VCTA 4CXFA 2CVIA 3VTIA 1D1UA 3OIQA 4DV2J 3LO3A 4ECQA 4XK4A 2NSCA 1O3TA 1XBWA 1BC6A 2DA2A 4UVCA 3FXMA 2CDQA 2GGPA 1S1WB 1T9VA 3RB4A 3MXHP 2WAQA 3BR2A 3RIRA 1U47A 2ZH9A 3QT7A 5KG3A 2DVIA 1UCRA 1AZSA 2Z30B 4LSLB 1AU7A 5J2QB 2PI0A 1V5IB 1IQZA 1FE4A 2VD3A 3CJSA 2GV1A 4KGZB 2W2QP 2XHWA 2B7EA 1CJKB 3C14B 2P4WA 4KJIA 3OL6A 3VCDA 3ZQLA 4FBTA 1LVKA 3FM5A 4RB2C 3JQMA 3C3LA 1U1MA 1ITYA 4B3TJ 1VISA 2MLZA 4TXSA 2OKQA 1VTNC 3HHKA 4DUZF 3BEGB 1U5TB 4ZZLA 4BEHA 4A8YA 2RDIA 2BW3B 1WELA 1X9MA 1X4FA 3CJKA 5LJ3Y 1JXSA 3I5BA 4DN9A 2FVSA 1JTYA 3R9LA 3QYFA 2NS0A 4IZZA 1TT0A 3R1LA 2HPIA 1IUFA 4OJGA 3HD1A 5CH7B 3QQCD 1RBAA 4NMLA 2XDVA 2BBYA 3EICA 3D1NI 1UL3A 4JV5F 1BIBA 3GBGA 2M3DA 1MBKA 4XTTA 1TBXA 1XTZA 4OZ5A 2GA1A 3FDSA 2YKNB 3HHHA 3EZ5A 1B6AA 3GWZA 3TW6A 1RC9A 1LVAA 2W24A 3ERED 5IWAJ 1Q7LB 2N8GA 1B4AA 4IQJA 4A6EA 1HMVA 4N56A 4KPCA 4OAYA 2XC7A 2JTVA 3ET6B 3V4IA 3VQSA 2WSFC 1MMNA 8AT1B 2A6OA 4F3OA 2FD2A 1V5FA 1JLAB 4USUA 1KYZA 1H7XA 3SQGB 2KFDA 3UCZP 2C28A 5EZHA 1C1CA 1PBUA 4HVZA 3K8WA 1H0HB 2HWVA 5F9LA 4JBCA 2MY8A 4QPQA 1XGOA 2RGVA 3WTYC 1DPRA 1VQPI 2WZ1A 1OCCH 5M2RA 2NVXJ 3NGRA 2JFDA 1FJEB 1JLCA 4NI2A 3HJVA 1R43A 2OH2A 1ZR2A 3TEDA 3EUAA 1ETYA 5D8LB 2V1NA 4NXMF 4II3A 3C66A 4BS9A 4UXNA 4RGRA 1I50J 3AA9A 1F3VA 3GCWP 4DR6J 1ETWA 2XO6A 2XSFA 1OQ6A 4G7HF 4D9JA 1OCTC 1BE4A 3D6TB 3W5XA 2VQCA 2VQHA 5E3NA 2XF7A 1KQFB 3QGGA 3CJQA 3C15A 2UVVA 1W36C 2FJVA 1N32F 2L9VA 2HQCA 3VWBA 1GV2A 2LXFA 2UU9J 1X1AA 3ZQQA 3G6ES 4GYIA 1BR4A 2DGUA 1Y0UA 2Y2ZA 3BO4A 1ETOA 2R7DA 1D5YA 1BN5A 1MWYA 1VQYA 4G6TB 4PGHA 4RPFA 4GVLA 3PRVA 3GFYA 4BQQA 2XGXA 3HHEA 3N28A 2CMPA 4M3GA 1KOOA 4K4YA 1R1UA 3GV7B 1LFUP 5CYJA 3M2RA 3PIPF 2QEXI 1QA6A 4UT4A 2FU4A 2V1XA 2STWA 3I5CA 3OYLA 3CVKA 1S76D 3BZKA 3C7JA 3RGIA 4GGGA 3D67A 2JZYA 1VJQA 3VWSA 2DO4A 3CNQP 1WC5A 5EWEA 2XAQA 1PJRA 1NMEB 1RI7A 1R5GA 1MSEC 5ETNA 3F23A 3W61A 1RUOA 2O5DA 2CQKA 1X0FA 1YRTA 2CQQA 3DHWC 3TEGA 3F41A 1NKEA 4IH6A 3VVTA 1NTCA 1Y8QB 4KIFA 4MT1A 1JNRB 5RUBA 3G6YA 1SFKA 1RZMA 1IUYA 3MEGB 4IO9Q 2K9SA 3MF5A 1QZZA 3OSNA 1KGSA 5K7HA 2ZHOA 2HNZB 4RZRA 3V2UC 4G94A 2CZ9A 4A0XA 3TAMB 2WONA 1GK8A 1APLC 1KU7A 2O01C 2ZNYA 1IN5A 4PJ0C 4PWDB 2KHMA 2CWXA 3QFHA 2YKPA 2GHWA 1F6TA 2K4JA 4JI1F 3FQLA 2E1MC 1TAQA 2C2EA 9RUBA 5AJ3J 2AEFA 3I53A 3J7YJ 5A8WB 1RCOB 4N4NB 3KP7A 3KJVB 5HMXA 5TRDA 2X7IA 3G4SI 5GPAA 1NK6A 4CICA 5B0EA 1FJGJ 3OT9A 1VI0A 4ETXA 5IOYA 2QSFA 3PEJA 2W9AA 2MY7A 1CVJA 1F0XA 4IDKA 2UUWA 3ZMTA 1IC8A 3HKZD 2J0WA 5KFGA 1XX5A 4KYWA 4EJUA 3G82B 4USTA 3W2AA 2MLYA 4DEZA 2JEJA 1K1QA 2Z8QA 5IM0A 1U1LA 2DY9A 2PMWA 1CF7A 4I0AA 2P8IA 3GTJJ 1S59A 4IHXA 2FGOA 2RE1A 1FXLA 1QE1A 3KK1B 2V9KA 1KC8T 1XMKA 4CQ1A 1I94J 4OYIA 2NVTJ 1R8AA 2KT5A 2IGMA 3F0CA 1Q8KA 4PXBA 1TMJA 1SCJB 5KCMA 4XLFA 3JRAA 4K4UA 1R71A 2JRMA 4G9YA 1CBKA 1F5AA 1UKUA 2MD0A 3I0TA 1HBOA 2FVRA 1IG7A 2Q3PA 2D45A 1ZGWA 3IBWA 1MD0A 4KV8A 5GAEU 4DF4A 3N4MA 4OLPA 2QSGX 1NK5A 1GH8A 3NS5A 1HL6A 5FLXY 1Z2LA 1NJWA 4A69C 2DJNA 2ZMEB 1Z05A 1OWXA 4Q2MA 3KZYA 3ZQFA 2A69F 2OD6A 2QFIA 4WXDA 2D3O1 4BBRJ 2CXEA 4HEA2 4N7TA 5FROA 3HKZA 4RWXA 4DV4J 4DFMA 4L5EA 3GFZA 3CCVS 3CTAA 2IC3A 3LPEA 4J9KA 2ZZNA 2WAEA 5KFUA 1MMGA 3M9AA 3OUYA 2EIKH 4CLUA 2YWEA 2DMPA 3H5AA 3LAPA 3IL2A 1Z6TA 3AB4B 5FDLA 5DZ6A 4MKYA 2KHDA 2QL7B 2A1BA 1X1DA 3LSKA 1FOYA 4FCYA 1YRNA 2VASA 1PJ5A 2HK2A 2JLGA 4XKBA 1FDAA 2D3ZA 5EGOB 4RUCA 1VMBA 3R3TA 1R7JA 1E6YA 3G8QA 3TKYA 4RDUA 4G8XA 4KY3A 1U26A 3VGTA 2NVUB 5IT0A 1GAOA 1VLOA 4KGKA 4M73A 2HTSA 4X4TA 2W82A 3OS0A 2AT1B 4PCQA 1U49A 4ZVFA 2XMUA 3DFGA 3FBFA 3MZHA 2PMZN 3S15J 2ZOMA 4QW8A 2LR8A 4I2PB 2DOAA 1YZ6A 2DTZA 1N4LA 4IR9A 3IM8A 5KFRA 1XMBA 3N5FA 3BPVA 1RE1B 1M1KT 4LLLA 2ATCB 4U6PA 1A5JA 2E29A 4M5NA 2UVUA 3BJAA 3RSNA 3RKYA 4ED5A 4F4ZA 2OPSA 2ZEJA 4E4HA 5HMWA 4GKKF 1LPQA 2VJUA 4HX8A 1HOMA 5J40A 4EZ9A 2NUUG 2LF7A 4B09A 4F55A 1P1LA 3ULHA 2ESNA 4JI6J 1SJ4P 2KQRA 2HDWA 4HQMA 2JZ5A 3MI7X 2RNEA 3H2LA 4JV1A 5U47A 2GBYA 3DEEA 3QSIA 4HKQA 3VAJA 4Q0BB 3G8TA 4YR2A 1KFDA 3L7UA 2AD9A 4IH7A 1UB9A 1R8BA 2XB2D 4LRFA 3PO4A 2H09A 1QNTA 2LFVA 5F0HA 2ZC3A 1XMXA 2ISZA 1YIJS 4P2XA 4K5RA 3H9QA 1JE8A 4LGWA 1V6HA 4P2FA 1BA5A 2LEAA 2Y1IA 1HLWA 3TOAA 4LFCJ 5ETTA 4A0ZA 1KEKA 1W7PA 2LY2A 3DDIA 5K7ZA 4BE1A 4Q4ZF 3DXBA 3PM9A 1W5TA 4WZMA 1VLYA 2AYMA 1JWWA 3R5BA 1M5OC 2Z5UA 1NXIA 4O5VA 3HDDA 1DQAA 2R7TA 1TC3C 3MKZA 2G9OA 1JGSA 3N05A 2QKMB 2RAEA 1MU2A 4GO7X 1KWMA 4B8XA 2RHSB 3T5XA 1HQUB 1BBYA 2UV8G 2D2WA 3H1CA 4UVAA 2R3SA 2IA2A 2HQRA 1HHSA 1RBOB 2IA6A 4RAZA 1C0TA 2HNHA 2M2BA 3NWRA 3GXOA 4XN0A 5GADJ 5HS7A 1ZARA 4RKUC 2F9DA 3O6QA 5BYRA 3N6MA 3PYDA 4EZ6A 2IJRA 3MZIA 4ZYAA 5LEJA 1UG0A 1B7YB 2LK2A 4PUSA 4I7HA 1FJ7A 2ZVIA 3L2UA 4YHHF 2AYBA 5DCFA 2R2UA 3ABMH 3D68A 5J2PA 1I5OB 4NA2A 2WB1N 4XIDA 1UCNA 2HDDA 4URGA 4E6KG 1WHUA 2BY3A 1FK9A 5HLFA 3V6DB 2YQ1A 1JJCB 2CUJA 2W4CA 1H74A 1SKSA 2IDEA 1CJVB 1Z4UA 4FYDA 2IS4A 1VQ6I 1FWKA 3TDUC 3DCFA 3CO7C 1RT1B 3Q9VA 3K17A 2ZJ2A 3SDGA 4JP8A 1N5QA 1RAJA 3UDVA 2JA7J 2QMWA 2L02A 1P27B 4HW0A 5DS7A 3GP9A 1VQOI 4PXCA 4TQRA 5F1JA 3QGHA 2A18A 2QGUA 4QIFA 2OJED 2MZSA 2R2TA 2ILZA 3RDIA 3Q8SB 2I9SA 4YIRX 3CJRA 1F36A 2CW8A 1DQ8A 3B8HA 4Y34A 1YX2A 1FBSA 5LSOA 3ASOH 3QT8A 5L46A 4WKRA 4DX6A 1AROP 2X4HA 2OIHA 2J5AA 3TW7A 2PA3A 3GWCA 3KEOA 1B64A 5CABA 5IP6A 3LWMA 4C3LA 1Z3YA 2GAHC 1PG5B 4ZYEA 2E5LF 5E3RA 3I55I 3KNGA 4G1QB 2K3IA 4CLTA 1VQPS 1S6OA 3FXJA 5DD8A 4OYMA 3KLFB 4FS2A 3KYDB 4C2TA 1PYTA 4CP5A 4B02A 3M1EA 5FKMA 4PABA 1RLCL 5BMZA 5KHDA 1U6FA 5HAOA 3MD2A 3CJ4A 5FKLA 3OJSA 1SC6A 3O1LA 2V26A 5KFAA 3NKYA 5L9NA 2N7CA 2QF7A 2J7UA 2JVOA 3HB9A 1ZM4A 5E41A 1P8GA 4YFUA 2DTJA 1HWLA 1S7IA 3FRZA 2ZUGA 3E5XA 1GXLA 4RW8B 2R93J 3R6LB 2LFBA 3J80K 3BROA 1PBAA 4U7UK 3FISA 4CA0A 2HFVA 2AQFA 3TA1A 2DHGA 1XSVA 3I9V2 4QQBA 2CUZA 3WTTC 5CZXA 2XSJA 2EEYA 2XGDA 4K8RA 5HN0A 3GR1A 2EFOA 3DXSX 4RBUA 3UN5A 4PSXA 2GNKA 4RAGA 2R8JA 1Q8BA 4F50A 4GVBB 1P2FA 3DTIA 1HA8A 2W8KA 5LJ5Y 1UHSA 4ATNA 2POKA 3GF2A 1HBUB 2BHYA 5JLWA 4KN4X 4KR0B 2YU3A 5F0FA 4CLPA 5FLVA 2AQEA 1M0SA 2CV0A 3HG9A 2MJUA 3L9ZA 5DDRC 3LSIA 1S57A 3HHGA 1BR1A 4MMOA 1YLFA 4DUYJ 5ETKA 1Y9OA 5C25B 3H36A 4N8OA 3THVA 2QLFB 1UEUA 3HRSA 1FKOA 3SZGA 1O51A 4K4TA 1YHQS 2P5KA 4PJNA 2IRFG 2VKEA 3H3UA 2CPXA 4MTEA 5GAGI 1S49A 3DLEA 2F4IA 2HDCA 3NGTA 3I6PA 1NSKL 3GJRB 1KQGB 1EP4B 3J7ZI 2WAQN 4NC6A 2FPHX 2P8TA 5B0DA 3MMCB 2IA0A 3MGJA 4PZVA 4B3RJ 2BM1A 4DL5A 2XSDC 2VC1A 2I38A 4QSHA 2LNBA 2IRXA 4WX9A 3LGHA 3OYIA 4BDZA 4HHJA 1FD2A 2BXZA 1X4EA 2MZJA 4DFKA 1HW8A 1RKTA 2W9BA 4OI2A 1OPIA 3SFGA 3HXLA 4AXIA 3QJJA 2AHQA 4BQNA 2EINH 3JSBA 2UUAJ 1ZG3A 2K27A 2HBYB 3H5YA 2QGFB 4NE9C 2DNNA 1EH8A 4IG0A 3G4SS 2LA6A 2CJBA 5H2FC 4YFKF 1LK5A 2KYXA 2QLBB 4PKDB 4XLNF 2F4FA 3PY8A 4LF7F 1MLAA 2XM3A 2QBYA 3HT0A 1RHUB 3JS9A 1P4XA 3BN4A 4J9PA 1NUEA 2WVFA 5DV5A 1YJWI 3U1DA 1EJ9A 3DRPA 3CUQC 3CUQA 3AD9C 4K5SA 4Y2MA 2ZH2A 5LRRA 1S6LA 1S9HA 2PQ8A 1DTTA 1OY9A 5F1RA 1IBLJ 3BR8A 1WI9A 5GTIC 1I51B 3FKIJ 3HL2A 3PO3J 2WSEC 3HGGA 3P7NA 1IGNA 3A12A 2B9WA 4HR2A 4X64J 5KVRA 3DKXA 4C48A 1OLTA 3R0AA 3EDPA 5FKNA 4DR4J 3LAJA 3A0HC 4XM3A 1SFXA 4P52A 2UVWA 2VJJA 2OLWA 3P9KA 1HD0A 2BGCA 2V8VA 2XAGA 1X4DA 2ESHA 4C2UA 1CQNA 4ZPTR 1USTA 3QRQA 4FKYA 5FRMA 3DPUA 2DNMA 4QIEA 1B0PA 1X5PA 4C30A 4RL1A 4O3NA 1UHWA 5CVJA 4RAFA 2XCPA 1U0HA 2W8LA 3HVTB 4MKVA 1HNVA 2JMWA 2J9DE 2NS7A 1J5OA 2ZM6J 3FCWA 2X6WA 4RB1A 2W4DA 4Y2IA 3IBCB 2VL8A 2LKSA 3LFUA 3ZTRA 3T5JA 1F43A 2HNDA 1VQKI 1B59A 1C2PA 4IJAA 5DGBA 5EG0A 1RTHA 4QU7A 4ETSA 2OF7A 2G2ZA 3BG7A 1I3OB 3PW5A 1VQLI 3IC1A 2DR8A 2KM8C 1TUGB 2RAQA 1SFEA 3CCYA 3BSCA 5E33A 3GTMJ 2QTWA 3BTJA 3NAUA 4NA3A 3PW7A 3HHNB 1FBUA 4ENNA 4I6ZA 3SEOA 1LW0A 2UV1A 3IRXA 2CUYA 3RB6A 2BA9A 3PX4A 2JX2A 3FMSA 1N77A 2F48A 2CQBA 2V8DA 3BKFA 5D0RA 4OMFG 5KFQA 1PUEE 4NZ6A 5HO4A 1KLNA 2PA8D 3AFHA 2KXFA 2HHSA 1MN9A 1KP6A 3L7PA 2Y0SD 1T03B 4BWMA 3MPWA 2DRAA 1GHCA 4JV0A 2DRBA 3ZZTA 1FKPB 1T2KA 2MHEA 1RLDA 2RVCA 2DIVA 2JA6J 1JT6A 4MFBB 3MUVP 1U2CA 4YS2A 3S16J 2PN6A 5JVGF 3M9MB 4FNHA 3UVJA 3HHLA 3HHLC 3ZQGA 3MAHA 2CDRB 4YY3F 3FFIB 1CULB 3W6JB 1ICEB 3FXOA 4HT5A 1XWLA 4B9NA 3GFJA 3IO1A 1OYEA 4B9UA 2KVIA 3D7SB 3NARA 2EV0A 1E17A 1LFPA 2L08A 1N56A 3D3BJ 3FK6A 2V6CA 2I5JA 2MQLA 4XK8C 3MWMA 4B3OA 2MABA 1T8EA 1TKTB 3ONQA 3TMOA 5D3GB 2B0LA 1W1WE 1SKUB 1D8YA 4FXVA 5G0RB 3TA0A 2R9LA 5ERIA 2NOGA 1CJTB 2Y0SA 3MMJA 1S77D 1H3DA 4U96A 3CJTB 3H92A 2MQOA 2OPPA 4ECVA 3AH6A 4BQOA 2ISYA 1FWZA 2OD5A 3CF2A 3W60A 3BH7B 1FXDA 2VBYA 2VN2A 2D7SA 4WCGA 2A2CA 2Z58B 3PUFA 2BXJA 4G12A 4RB3C 2CNNB 1HNZJ 1FBQA 1T0FC 1T0FA 1X3ZB 2WADA 2BE9B 5LMUF 1QM9A 2AV5A 3D5MA 1N48A 3O3LA 5ED4A 2HOSA 2QA2A 4L18B 1KOHA 2HFZA 4CNYA 5C24B 4GFBA 1WEZA 4J00A 2KG0A 2Y0BB 1LWFA 4FTHA 2FQ3A 4B9VA 2FF4A 5L3FA 1HBMA 4OZJA 2JNJA 2OZUA 4F52A 4ZIWA 3TO8A 1T3NA 4BHQA 4HLXA 1UWBA 2VBWA 2V1DA 2WTEA 3ZFVA 3VYUB 1PP7U 2MZ1A 2VT2A 2CQCA 1A0OB 4WE1A 3RKXA 5JHUA 4XRMA 4ENJA 1TL7A 4JK1X 3MM7B 1S72I 2WWYA 1T56A 1NSQA 2CQHA 3Q5FA 3M8ZA 2KKHA 3GQCA 3OYMA 2J5PA 2WB4A 4MKBA 1S48A 2H27A 5DRKA 1JLEA 1W26A 2NXNB 4FQGA 4FF3A 3EVWA 2BJ7A 4M5GA 3WZ0A 3BR3A 2D1VA 4Q8FA 1MMSA 4KSEB 1VQ6S 4YR3A 2JWNA 4NYOA 1W5SA 4BU2A 4IKFA 3PFOA 2ILYA 4LRBA 2E9TA 2J9CA 2DH9A 1VQOS 2PG4A 4BL0B 3P9CA 1B72A 2ACMA 3IP0A 3J81j 4NHJA 4F25A 1UJ8A 4DQRA 3TQNA 2K40A 2R3VA 1FSHA 3BP8A 2KDZA 3X1LB 4FETA 5J8CA 2VG6B 2RNGA 2ACJA 2HLUA 3MOJB 4QPOA 4MK8A 3HKZN 2IP2A 2Z3YA 3NL0A 1SIWB 1HW2A 2YY3A 4XDDA 2ZDPA 4RO0A 3LANA 5LGTA 2YWFA 1EIYB 4LUBA 3SIPB 4W92B 1NKCA 4LR8A 4CYCB 5D5XB 1FKAF 5GP9A 4RNMA 4DV1F 3ZN0A 4AFFA 3A8EA 1ZREA 1RWNB 1O57A 2KJBA 4F0KA 3I55S 2FQ4A 4V2GA 2Q6CA 4J9UE 4L9JA 5GAEI 2DYSH 5HJXA 2YNGA 1DY3A 2HYGD 5HL7Q 3UO0A 2L54A 4S05A 3EGNA 4ZVSB 3DM2B 3U7JA 1P7IA 3ABLH 4TYBA 3Q0UA 2XBPA 1UVJA 1SAUA 3E6CC 3SFZA 5CJ9A 3LA2A 3AAFA 4E7JA 4X6AJ 2CQXA 5CPRB 4HF0A 4BE0A 2CAJA 2HHXA 4EJVA 4JI4F 3DF8A 1NEEA 2HK3A 1QBJA 1Q82T 2LVSA 1S3JA 4WIIA 4C3IJ 2MGQA 2HFUA 4P9UA 3F56A 3I0SA 1DFDA 3C2PA 3Q0AA 5K5OA 3J81Y 4AM3A 4YP3A 1NZ8A 1G8XA 2QV6A 1BD6A 3HPOA 4J5OA 1HD1A 4M9XA 4A3GJ 2GMHA 1IN7A 3S8PA 1JHFA 2ZXHA 4M3FA 4IFYB 5L1KA 3PJ9A 2Z56B 4LRDA 4KITB 2BXYA 2CQ0A 3D5LA 3DXJF 5DD4A 4U7UD 3A8IA 2FZGB 3WIUA 5MLCV 4ZVPB 3GB0A 2CH0A 2IPOB 3TUIC 1R1TA 2Q1ZB 4A5NA 5A8RB 3N5BA 1KHWA 4AL6A 4IOCQ 1LXJA 2IJFA 4KFCA 5ILSA 4F92B 1RHQB 4IQ4A 3FZVA 1KTQA 4BJ6C 3CMEI 3V4MA 4CDIA 4M8LA 3CCTA 4LK0F 2EZHA 5JFRA 4A3FJ 3PO2J 3GMGA 4L73A 3SJMA 4HTIA 2R7VA 4HEA9 1Y5LB 2FD5A 3HSEA 3ZTOA 4M3EA 2AX0A 4S0HB 3IR5B 4WP3A 1BWVA 1Q79A 4HOBA 4C6AA 3WQPA 5A2QZ 4CLZA 2DMTA 2XMMA 5BJRA 3RW6A 4LSNA 1HHQA 1J2XA 2UXBJ 1N36J 2E7VA 3U27A 4F4YA 1XTAA 1EV7A 5C3EJ 1BOBA 2Z9OA 5LMNF 1ITPA 2HVHA 2R7FA 3D5RC 4P55A 2E71A 4PPZA 2OCCH 5CD4H 2HQIA 4AIKA 1QZYA 1K1SA 2FHOB 3BDDA 4KAIA 4IUFA 4DUZJ 2RH3A 4BNCA 1DUXC 2KVQE