1QPMA

Nmr structure of the mu bacteriophage repressor dna-binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title NMR structure and functional studies of the Mu repressor DNA-binding domain.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Viral protein
molecule keywords PROTEIN (MU BACTERIOPHAGE C REPRESSOR PROTEIN)
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qpmA00
3ECHA 1U3EM 4P55A 2O8XA 4EJVA 1LVAA 2M87A 5KK1A 1FZPB 4FT8A 3WE3A 2HKXA 2Q2EA 2G7HA 1B6AA 1BI1A 2G7UA 5ICFA 5HVQC 2UWMA 3CTAA 2HDCA 2XAHA 3TQNA 4F7ZA 3KEOA 5DCFA 3DF8A 2Y75A 3SFZA 2R3SA 2VBWA 2EFQA 2WV0A 4R79A 3ECOA 2VOPA 2CQKA 1SD7A 4BAYA 1BI0A 3WTWC 4YG2F 5LGUA 1ZH5A 3WE2A 3GO5A 2XKOA 4RB3C 1BN5A 2O0YA 3EQLF 4MQ9F 4MHGA 1KU9A 1D5VA 1IF1A 4OINF 1SD6A 1KGSA 3ISPA 1IN8A 2P7VB 1AWCA 4LG0B 3I53A 1FYMA 3SZTA 4UNOA 2QYOA 2IP2A 3BROA 5K5RA 2FA5A 4HF0A 3FHZA 1SMTA 4L9JA 3O2PE 3LWFA 2EFNA 3COAC 3LFKA 5J6XA 5BQTA 4I98B 2XV4S 2IJLA 3LQRA 4EV0A 3WTVC 5CJ9A 4KYWA 2W57A 2ELHA 4M73A 4PDKA 1MJBA 2QQBA 4G7ZF 1KU7A 5FLXZ 4A12A 2DO7A 2CG4A 4YIIA 2OU2A 5BPIA 2OZUA 1XB4A 5K5QA 3ZPLA 2PBIA 2Z99A 3TOAA 4A5NA 5CVUA 2XASA 3ZN1A 4EM2A 2M30A 3HYIA 3QP6A 1TQPA 2M1BA 3MWMA 2K7LA 3GVAA 4P9UA 2RV8A 3BY6A 2ISYA 3MCZA 4KN7X 3F6OA 4KMFA 2B0LA 1IXCA 1LB2A 2UXXA 1U2WA 2VOOA 1HKTA 1JHHA 3GW2A 1UCRA 2GIVA 1EH7A 4HBLA 4HLXA 2P5LC 1BJAA 4AIKA 4PGHA 3GF2A 1FLIA 4LK1F 3Q9SA 5JR3A 2MLGA 3KFWX 4A2UA 2RKHA 3F8CA 1FNNA 1F1ZA 1FSEA 1I27A 2PQ8A 1WRJA 4YIFA 1ZRFA 5IT3A 4NHJA 1B9MA 3F3XA 3ZMDA 4Q4ZF 3RKWA 5LGTA 1ON1A 3I5UA 4KIFA 4OMYA 1S6LA 4IPAA 4CYDA 4U7BA 3C18A 3PQJA 1AOYA 3ABUA 3BJAA 1YS7A 4OIPF 4L5IA 5E17F 2HTJA 3ZN0A 3QPHA 4TV7A 3CUQA 1J2XA 4L18B 2K86A 4S05A 1DDNA 3R0JA 1RUNA 1FSHA 2EA4A 1W5SA 5JFRA 3HRSA 1JGSA 1E17A 1WI9A 2JT1A 1MJAA 3GX4X 3DFGA 2F5DA 4OMZA 2BGCA 4ZZLA 3GYHX 2YX4A 5CYVA 3WTXC 1ZGJA 2O03A 3ZMUA 5IT9K 3G73A 3U9GA 1YTYA 4N0BA 1I1SA 2OD5A 1ZAOA 3DEUA 3REOA 3T0YA 5D5UB 1P6RA 2OAZA 3GFMA 3QAHA 3J81Z 2FMLA 3RIRA 3TO6A 5L3GA 5FLXK 3OOPA 2XAFA 4IVNA 5LHIA 4ZYDA 1IZ1A 5J8FA 1KQ9A 1XCBA 2HZTA 3JTHA 1R36A 2VXZA 1G3SA 2DTRA 1U78A 3MZYA 3IKTA 5HDKA 3ERED 2JPCA 5E1WA 3WG9A 3ULQB 1ZHFA 3LQQA 3KP6A 4P5OA 2EFWA 3J81K 2FBKA 3HTSB 3RDIA 1O57A 1R5GA 2VONA 2CO5A 3HIFA 3K1PA 1BIAA 1T39A 2XIGA 3GLXA 3WGHA 4RAZA 4CGZA 2FBHA 3JTGA 2IRFG 2H6BA 2VC0A 1R1TA 3J80Z 2BV6A 4LMYA 3EYIA 3NEUA 1T98A 3BZ6A 2O3FA 4NB5A 2QBYB 2QVOA 4M9ZA 2DK8A 4XRFA 5LRRA 1G4DA 4AVPA 4KMUX 2M5WA 4MGRA 4XLNF 1W7PD 5AONA 5FB2A 5DD8A 4HDUA 2Q8KA 3IC7A 2L01A 1LEAA 4EJUA 2Z5UA 1U5TC 3J7AO 1I1GA 3WTSC 1J5YA 1YW9A 4I0BA 5LHHA 1D3YA 2GA2A 4IF4A 2X0LA 4HV6A 1USTA 4GGGA 5BOXA 3GZ5A 2QENA 4U7DA 3F22A 2E7WA 2A69F 4UHTA 3IRRA 4B8XA 1RUOA 3RJPA 1J0RA 2P8TA 2ESNA 2LKPA 4I0AA 4HX7A 1XGMA 3V7SA 3MAJA 4ESFA 2HKOA 1IN4A 4ESJA 2QQ9A 2ISZA 2LNBA 4BHCA 3V7CA 3QU3A 4AWXB 1TBXA 4XBFA 1P4AA 3I71A 4IRIA 5F64A 3SHFA 4N9HA 3TDZC 3E97A 3FF5A 2V9VA 1ZRCA 2NRAC 4ZZDA 5LRSA 4BYYA 1CF7B 3KE2A 2FF4A 2PMHA 1FC3A 1XGSA 3E6DA 2XHKA 2BYVE 3M1EA 2KKOA 1IW7F 1IAWA 2E1NA 4KUMA 3P9KA 3E6MA 2ACJA 3M7GA 2F5EA 1O7FA 1GXPA 3BPVA 1U8RA 2A6EF 3C3WA 4IRHA 4U88A 2ZBKA 2HS5A 2IVMA 1ZG5A 3C7JA 4HAMA 3VODA 4IXAA 5HS9A 4R1HA 2P5KA 3WGIA 1QPMA 4JQFA 4LFUA 4LG0A 3KCCA 3T8TA 4RGXA 1L3LA 5FGMA 3EDPA 4H0EA 2JRTA 4MEYF 1P4WA 4EJWA 1XSVA 2V1XA 2A07F 2BEOA 4KNYA 1IXRC 5H6RA 1B59A 1B1BA 2FRHA 4XSXF 4OIRF 1P4XA 1VTNC 1ZREA 1QQIA 2DU9A 3LAJA 3WGGA 2PJPA 4YFXF 2MLKA 3K0LA 4ZYGA 4KDPA 4CO8A 1L0OC 1S7AA 3E6BA 5D5VB 4EGZA 5LEJA 3R60A 1BM9A 1LEBA 1ZG1A 4GCVA 1H9TA 2RDPA 3HOSA 2EFPA 4WWCA 1J75A 3GFIA 3CUQB 4KIGA 3N97A 1FOKA 2A61A 4L9NA 1U5TA 2AXLA 3IWZA 4LB5A 3ELKA 1TQMA 1I6XA 4OU0A 1CGPA 2KRFA 4KA4A 2VBXA 2HOEA 1ZRDA 1RIOH 4A0ZA 1YIOA 2GQQA 1YW7A 1B4AA 1PUEE 2OQRA 1SFXA 1LDJA 2CGPA 2DK5A 2HQNA 2DT5A 2VC1A 3JSOA 2CFXA 3M8FA 3Q9VA 3I0TA 3CO7C 4HF1A 4WK8F 5E1XA 4U0VA 3RPUA 1DPRA 2ZKZA 3RTRA 3H3ZA 1YS6A 2A68F 4WXDA 5L3BA 3CLOA 4YFNF 3K1MA 1XDUA 1KQ8A 2P6TA 3TO9A 2FU4A 3W6KB 2YPRA 1YQAA 3K69A 1OPCA 1JXSA 4EM1A 2HGCA 1MJ9A 3GEZA 5BMZA 1J7KA 3BDDA 4O5VA 2ZMEA 3MFKA 2KJBA 1HQCA 2QUFA 3O3KA 4EMSA 2EV6A 3FXRA 3IL2A 2NS0A 1XGOA 3WU0A 4DNCA 2D2WA 4WF2A 5ICCA 1HSJA 4WX9A 1XDSA 5JHUA 4XLPF 4EJTA 1FT9A 4A0YA 2FNAA 4YFKF 2P6SA 2UXNA 4ENMA 2O6GE 5AIPA 2PN6A 1Z1DA 3FX3A 1T38A 1ZG3A 2VT3A 1EV7A 3U1DA 2C6YA 4CZZA 2FSWA 1BI3A 1W4MA 3KP7A 4BQAA 1K79A 2DLLA 2PMUA 4ZH4F 2K4BA 3SXYA 5DUKA 3M8EA 1OKRA 1U5TB 1ODDA 1LQ1A 1NHAA 1KA8A 1EH8A 1I5ZA 4P96A 4RB2C 2DFIA 2JSCA 5EEGA 1O3SA 2TDXA 2MC3A 5ILVA 1QNTA 2XAJA 4AIHA 4ENNA 1YO5C 3G3ZA 1ULYA 5E1ZB 5HS7A 3L9FA 1FX7A 1D8JA 3F8MA 1PP8F 1KQ0A 4G7OF 1J9IA 3LSTA 2LSOA 2QBYA 2XAQA 1DUXC 1S3JA 1H9GA 1T6SA 2OQGA 1PDNC 1QBJA 3E6CC 2DQLA 1R1UA 3KP3A 2PI0A 5D4RA 4HF2A 4M6XA 4BHBA 1QZZA 1K78B 4BHPA 2J5PA 4I09A 1JHFA 2FOKA 1MGTA 2P4WA 2ZXJA 3IKVA 4M6YA 1ZGAA 1IN6A 2IPQX 1UHWA 5ILSA 4HA8A 3F21A 4L5JA 3HSRA 2NAZA 2PLYA 4RB0A 4EVIA 5TJJA 1OYIA 4HZFA 2IA2A 4D0PA 3F23A 1BOAA 4A5MA 3EUHA 5DUIA 2XVCA 4FHTA 1XD7A 4PCQA 5BS6A 4HQEA 2EFOA 2M45A 4M72A 5D6FA 4I01A 5DV5A 4LLNA 2M8EA 1G3WA 4EQQA 3BP8A 4HX8A 5F6FA 4GYIA 1WKMA 4LLGF 1FYLA 3RYRA 2EV5A 2FMYA 2L02A 4MNUA 5CVIA 1YG2A 1OYWA 5JVTA 3KETA 4R8HA 2DQRA 2KIUA 5ERIA 1R7JA 1XSXA 2MH9A 4RGUA 4UXNA 4G6DA 1KYWA 3ML6A 1XCVA 2X4HA 4P9FA 3LAPA 2IA0A 3FM3A 4HOBA 1IXSB 3E5XA 1YYVA 2ESHA 5E20A 3NQOA 3R4KA 3RPQA 3CDHA 3ROUA 3HHGA 4LJZF 1Q1HA 2Y48A 2ZMEB 3KZZA 2GAUA 2Z9OA 4CXFA 1XGNA 1SMYF 1B9NA 3V8JA 4RGSA 5D5XB 5LEKA 2YU3A 1QGPA 1ZLKA 1REPC 3PFIA 3WODF 5D4SA 1TW3A 1QZYA 2DPUA 1XMAA 3R6SA 3P9IA 3WTUC 4U0YA 3BJOA 5DCMA 1QO0D 1O7LA 2DW4A 4GO1A 5FO5A 5ICEA 3TO7A 1H0MA 2ZFWA 2VBYA 3JSPA 2LDUA 2IA1A 3ZMZA 1RI7A 3K2ZA 1SFEA 2GWRA 2WWYA 3BOQA 3IRQA 4UV8A 4Q47A 1F9NA 5DCMB 2EV0A 1C0WA 2HTSA 3N4MA 2WC2A 3SZPA 3RYPA 4M9XA 5CVRA 2FNPA 1FBUA 4XSZF 1S8NA 2MH2A 3B02A 5LBQA 2VE9A 5DDGA 3LA7A 3WTYC 3U2RA 4M74A 2D1VA 2OBPA 4LLLA 4L9TA 2CW0F 1YW8A 4MTEA 2GXBA 1Y0UA 1LJ9A 1YLFA 2ETHA 1O3QA 3V8KA 4WXHA 1R22A 1BBYA 4CICA 2P7CB 2QQAA 2W85A 4Y13A 4MTDA 3HRTA 5E18F 4QWQA 4Y17A 1GXQA 3F8NA 4I2OA 1O3RA 3WTZA 3K9TA 3GXOA 4BXUA 4E70A 2NNYA 5BPDA 3T1BA 3RI4A 4OOIA 2NNNA 5L3EA 5LGNA 4HX4A 4KT5C 3ABTA 3MZHA 2KIFA 3W6JB 2XROA 4GYGA 4OIOF 4FX4A 1RNLA 5LLQA 4UVBA 1TNSA 4L0ZB 2XGXA 1ZARA 4M9SA 2L4MA 1XMKA 4L0YB 2D45A 5J8CA 2QZ8A 1BC8C 1T0FA 1TLHB 4N9IA 4GXOA 3CO6C 4IJAA 4ENJA 1R58A 3RKXA 3V4GA 1Z91A 2Y0MA 2V6CA 2A5YB 1S7OA 2CSOA 5ED4A 2L3DA 3CJNA 2QWWA 5HLIA 2V1UA 2OZ6A 3P9CA 2ZNZA 1LDKB 2QM3A 3HSEA 1K78A 4RS8A 4I02A 5D8KB 5EEHA 1T2KA 2AS5F 3V7RA 1STZA 4HV5A 3DKWA 3QP5A 1Z7UA 2RQPA 2V79A 2YSRA 2RNJA 4K2EA 1LDDA 5E8GA 5ICGA 4O6JA 3PQKA 4HLYA 4MQVA 2RC4A 2HQRA 3LA2A 2MBFA 2GZWA 3HSFA 3KP2A 1X3UA 2V1DA 1J59A 5HDNA 1D8KA 2ZNYA 4A6DA 1HXDA 3L7WA 1FBSA 3T8RA 1MDMA 5DYMA 3LA3A 4IRGA 5DEQA 2VODA 6PAXA 3Q5FA 1R00A 2HR3A 1SD4A 3CUQC 2G9WA 1TTYA 2H27A 3ZMVA 4WXCA 2K4JA 4S04A 3HUGA 5L3DA 3KP5A 1DPUA 4CHUA 4M71A 3FZVA 5D5WB 1KU2A 2ZJ2A 2RVCA 3FWEA 3BJ6A 5F1RA 1ONVA 1BC7C 5ILUA 2K27A 2DPDA 2L54A 1G6NA 4KN4X 5D6EA 4B09A 1JE8A 1GHCA 5H6QA 3J80K 4RAYA 3DPLC 2F5FA 3OV8A 3KP4A 4Z2YA 2VT2A 1V3FA 3KLOA 2BBYA 4ENKA 4UVCA 2H94A 1R1VA 1IN7A 3JW4A 3F8FA 2JPBA 3WU1B 2EK5A 1DP7P 2F5CA 4AIJA 2PG4A 3T5XA 2P5VA 3HHHA 1UFMA 1WWXA 2XAGA 3WTTC 2EJRA 3O6BB 5H20A 4DQ2A 1R5HA 3KLNA 3C1DA 1K7AA 3VOEA 4WCGA 1WSUA 3HOTA 1YFHA 4BNCA 4ZYHA 2EA2A 1XN7A 3FXQA 2NYXA 5IT9Z 4Y15A 3QOPA 4ETSA 2E1CA 1RZ4A 4AD9A 1SD5A 1G3YA 3DQVC 4ESBA 2ADUA 5JI6A 3HRUA 2QLZA 3M9AA 2FXAA 3R61A 3HTUA 2IT0A 1MD0A 5K1YA 3E5QA 3RKYA 2A6HF 5FD5A 4RB1A 4O3MA 3H3UA 3BWGA 1HW1A 2DAOA 2K02A 2O61A 3TGNA 1K6OA 4UUVA 5HDGA 1O3TA 2RN7A 1P92A 3IHUA 2L4AA 1Z9CA 3FXUA 1E2XA 2Z33A 3D0SA 1V4RA 2F2EA 1W7PB 1MDMB 3GUDA 4ASNA 2W24A 1FYKA 3GWZA 2MD5A 3QU6A 4G7HF 3E3VA 3R0AA 1SFUA 2FBIA 2HFHA 1FP1D 2GXGA 4EJOA 1TW2A 1HKQA 4L9VA 2HYGD 2R7DA 4HQMA 3I59A 5CLSA 1F5TA 3BPXA 2BE5F 3TKYA 2VBZA 5L3FA 2XRNA 3ZMSA 3ZP5A 5HLHA 2LF8A 3I58A 1U6GA 5HLGA 4LB6B 1ZLJA 2VN2A 4KICA 3VB2A 2D1HA 1OR7A 2E7XA 3I59B 1XSDA 1IRGA 5FD6A 3NRVA 5KVRA 4HYEA 1FY7A 2KIMA 4UV9A 4FX0A 2W25A 5TRDA 1W7PA 3D5LA 2STWA 1UHMA 5AIQA 2STTA 1HKSA 3HRMA 3DPTA 4LGWA 1A04A 3ZQ7A 4LD5A 1F4KA 4KIBA 2Q0OA 4QLCU 2LF7A 3EETA 3TDUC 2GA1A 3E5UA 1IN5A 1USSA 2RGVA 3GZ6A 3P7NA 1CF7A 3H92A 3KEQA 1OYYA 1MKMA 4PZJA 5FFXA 3FMRA 2CYYA 1W5TA 1HW5A 4U0WA 3MEXA 3FMSA 4IHTA 2YR2A 1HSTA 1PP7U 1Z6RA 1Z05A 1SAXA 2A3SA 1P2FA 2HEOA 4G94A 5HS8A 5K5OA 5A2QZ 3F8BA 4IHSA 2MA3A 2VE8A 4G6QA 2JZYA 3GFLA 1OMIA 4UVAA 2HWVA 2HYFA 1FPQA 4A0XA 2DBBA 2EB7A 3MQ0A 3FM5A 1IRFA 3CUOA 3L2CA 1LNWA 2H6CA 5A2QK 2WTEA 4RGRA 1HBXG 1MZBA 2ZCWA 2H09A 3GFJA 4BH9A 2DI3A 1HW2A 2ZO4A 1ZN2A 3QPTA 4I7HA 4NQWA 1G3TA 3DV8A 3DXJF 4EM0B 2PFBA 3S2WA 3F6VA 1FP2A 1GVJA 5D8LB 3V8LA 3JAMK 2W84A 1ON2A 3I54A 2FQ3A 2EWNA 3VFZA 4OIQF 1EH6A 4CDGA 1FWZA 4ON0A 2KJCA 3L00A 1TQIA 4ZYEA 3F72A 3K1NA 2UZKA 3AAFA 2PEXA 3KZYA 2XUBA 2JTVA 3SQNA 1IUYA 3FMQA 1WQ2A 2FEZA 4JK1X 4EGYA 3IWFA 3B73A 3L09A 5FFZA 5LHGA 1TNTA 2XKPA 3DP7A 4HDVA 2YX7A 3I4PA 1ZYRF 3JAMZ 1KYZA 2OA4A 4G9YA 2FE3A 1BI2A 1Z6TA 4PGGA 4HW0A 2IW5A 5L3CA 4LK0F 1UB9A 3I64A 4KFCA 5E8IA 2J5OA 4A6EA 3QRFF 5HOOA 2CWEA 4Q48A 3VEPA 1R23A 2COMA 4G8XA 5CVVA 3EYYA 3TOBA 3ZMTA 2R7FA 4MEXF 1S29A 2Z3YA 1KU3A 5CVJA 1FBQA 4Q5SF 1BIBA 4JBAA 5DD4A
chains in the Genus database with same CATH superfamily
2ZJQF 3DCFA 4RDUA 3ECHA 2NVXJ 1S72I 2Y9YA 4P55A 1U3EM 1K83J 1OFCX 1EF4A 2LC2A 2O8XA 4EJVA 3CJRB 3OYGA 1TT0A 4RMNA 1LVAA 2M87A 5KK1A 2IAIA 1FZPB 4FT8A 3WE3A 2HKXA 5GAGJ 2Q2EA 2G7HA 1X4OA 2VQHA 2VJ4A 1B6AA 1IRZA 2BHYA 3GTKJ 4ITVA 1BI1A 4XN0A 1VF9A 2K9LA 1FMVA 2X6OA 1YX5A 4AC0A 3J7YJ 3ZQLA 1F36A 1WHUA 2G7UA 5ICFA 5HVQC 2UWMA 5DM7F 5GPCA 1VQMI 4FCYA 4DJAA 3CTAA 2JJ7A 2HDCA 1HA8A 1GV2A 2VLAA 1SEUA 2XAHA 5FKOA 3TQNA 4F7ZA 3KEOA 5DCFA 3IAM2 3DF8A 2BXZA 2DMQA 2Y75A 3N05A 3SFZA 2R3SA 2VBWA 2EFQA 2EZIA 2LYCA 2WV0A 4RM3A 4R79A 2R7SA 3ECOA 5EEAA 2VOPA 2CV0A 2DJIA 3BQZA 2CQKA 1SD7A 3S15J 4BAYA 1BI0A 3WTWC 4YG2F 5LGUA 2B63J 1ZH5A 3WE2A 2BY1A 3GO5A 3SDBA 2ZB9A 3FHNA 2XKOA 4RB3C 1BN5A 2EIJH 3K4NA 2O0YA 3EQLF 4UB8C 1V54H 4MQ9F 2VKHA 4MHGA 1KU9A 2V26A 3S3NA 3CC4I 4F52A 1D5VA 3AL0B 1UG2A 1IF1A 4OINF 1SD6A 1OJLA 1VQNI 1KGSA 3ISPA 1IN8A 2WB1A 3L1PA 3K4MA 2P7VB 2VPRA 1AWCA 4DBRA 2WAQA 3FDYA 4LG0B 5J4VA 3I53A 1FYMA 3SZTA 4UNOA 1ZTRA 2QYOA 5F0FA 2IP2A 3BROA 3MMYB 4XLCA 4IZZA 5K5RA 2FA5A 4HF0A 3FHZA 1SMTA 1U8BA 4IOAF 4AIDA 5E3LA 1POGA 3D1NI 2EIMH 4L9JA 3O2PE 2DOEA 4XR6A 3LWFA 1VZ0A 1MMNA 1Y0NA 2EFNA 3COAC 4A3GJ 3LFKA 4FISA 5J6XA 5BQTA 4I98B 4ZYAA 2XV4S 2IJLA 1CQTA 1I3QJ 3LQRA 2XDVA 4EV0A 5CJ9A 3WTVC 4KYWA 1A5JA 2W57A 2NOGA 3FXMA 2ELHA 1LFUP 4M73A 1JJ6C 4PDKA 1MJBA 2DA7A 1FOWA 2QQBA 5J1UA 4G7ZF 4MO7A 1KU7A 3BCAA 2DFHA 2E60A 4HPQA 5IPAA 5FLXZ 4A12A 3F9KA 4M3DA 2V9PA 2DO7A 2R5ZA 2HOSA 2CG4A 4YIIA 4KITB 3B6AA 3BT9A 4E7IA 2OU2A 5BPIA 2OZUA 1XB4A 2I5UA 5K5QA 5EYRA 2PBIA 2Z99A 3ZPLA 3TOAA 2JK3A 4A5NA 5CVUA 2XASA 3ZN1A 3HPGA 4EM2A 1RKTA 1W0TA 3QYEA 3ZR8X 2M30A 3HYIA 1A6IA 3S2HJ 1K4TA 1HDPA 4BXFA 4V19K 2R5ZB 3QP6A 1TQPA 2M1BA 3MWMA 3OR1C 1TC3C 2K7LA 3GVAA 4P9UA 1MMSA 2X9DA 2ZFUA 1IV6A 1X1CA 2RV8A 3BY6A 5JVGF 3H0DA 2ISYA 4FTHA 3MCZA 1RPWA 3E1SA 4KN7X 3F6OA 3RKQA 2ME0A 4X0GA 4PFPA 1G8XA 2OTLI 3OYEA 4KMFA 1YHQI 2B0LA 2IEKA 1IXCA 3Q0VA 3I55I 1LB2A 2LH9A 3M8JA 2BW3A 2KL4A 2CFOA 4HRIA 2UXXA 1SFOJ 1I3AA 4U87A 4ZDLA 1U2WA 3L2UA 2VOOA 1HKTA 1OLTA 3OYDA 1E3PA 1JHHA 1UZCA 3W2AA 2CQXA 3GW2A 1UCRA 2IS4A 2GIVA 2WADA 4XRMA 1EH7A 1MH3A 3HBLA 4HBLA 4XLHA 4HLXA 2P5LC 1BJAA 4AIKA 4D1QA 4PGHA 1Z67A 3GF2A 1FLIA 3BG7A 4XORA 4LK1F 1UJ8A 3Q9SA 4BUPA 5JR3A 2MLGA 3KFWX 4A2UA 2RKHA 3FISA 3F8CA 5EG0A 1FNNA 2DMNA 1F1ZA 3ZQCA 1FSEA 1X2NA 3BR2A 2NVUB 5KNLA 3A4CA 1I27A 4B3XA 5EDNA 4BEHA 2O7OA 2PQ8A 3CJTB 3BR5A 1IV8A 1U9NA 1WRJA 4DYQA 3ZRGA 4YIFA 1D1CA 5IT3A 3CCMI 1RESA 1ZRFA 2PJRA 4NHJA 1B9MA 4F55A 3CCRI 4A93J 3BG5A 3F3XA 3ZMDA 3BTJA 2TRTA 4Q4ZF 3RKWA 5LGTA 3PSIA 4L5EA 3S17J 3HGGA 1ON1A 5J40A 4HG2A 3PUBA 1GLNA 3I5UA 4Y7NJ 4C30A 4KIFA 4OMYA 1S6LA 2QCOA 4IPAA 3OYJA 4CYDA 4U7BA 3C18A 4IHVA 1IRXA 3PQJA 1AOYA 3ABUA 3BJAA 4BQOA 4B47A 1YS7A 5GTHC 1XTAA 4AM3A 4OIPF 4L5IA 5E17F 2HTJA 4B48A 1RETA 3ZN0A 1RR8C 3QPHA 4TV7A 1JUMA 2I8DA 2PX9A 2LR8A 1MBGA 3CUQA 2LP0A 3PIOF 1ORKA 1J2XA 4L18B 2K86A 3G1MA 4S05A 1DDNA 3TBIA 4IKFA 3BTLA 3R0JA 1RUNA 1FSHA 3K4LA 1UAAA 2EA4A 1W5SA 3C2HA 5JFRA 4CCNA 2XRLA 4QPQA 3HRSA 1JGSA 1E17A 1WI9A 2JT1A 2QEXI 1MJAA 2Z2SB 3GX4X 3DFGA 5E79C 2F5DA 3CDLA 3FBNB 4OMZA 2BGCA 1T8IA 4ZZLA 3GYHX 4IQJA 2YX4A 5CYVA 3WTXC 1ZGJA 5H2FC 1YRNA 1Z3YA 2O03A 3H9JA 3DTIA 4BU2A 3J7AY 1QRYA 3ZMUA 3BC8A 5IT9K 5B1BH 3HGYA 3G73A 2IGMA 4JBAA 2FD5A 2DODA 3DKXA 2BHZA 3FXJA 1R6RA 1MBKA 3U9GA 4HNUA 2M7BA 2R7WA 1YTYA 4N0BA 1I1SA 3QOEA 4KJZA 2CW7A 4E7ZA 2OD5A 1ZAOA 2DYRH 1OISA 1TWFJ 1APLC 2W4SA 3FBIB 3DEUA 3REOA 3T0YA 5D5UB 1P6RA 4RLFA 2OAZA 4ANJA 2L7KA 2DDAA 5EG0B 2FOWA 3OIOA 2XGEA 3CCUI 3GFMA 3OR2C 2M8GX 3F0CA 3QAHA 3J81Z 4LIVA 4E7LA 1FJLA 2FMLA 3RIRA 3TO6A 3VYTB 5L3GA 3CMAI 3OOPA 4XNFA 5FLXK 2XAFA 4BDYA 2M0MA 4KISA 1N25A 4YELA 3D5RC 4IVNA 5LHIA 1YI2I 3VYSB 4ZYDA 1IZ1A 2ELKA 1WZ2A 5J8FA 1KQ9A 1XCBA 2HZTA 3JTHA 1R36A 2VXZA 3OS2A 1G3SA 2DTRA 2M4GA 1U78A 1FOXA 3MZYA 5KAFC 1MBHA 3QPLA 3IKTA 1I50J 5HDKA 3ERED 2JPCA 1I6HJ 3W2VA 5E1WA 3WG9A 4BQNA 3ULQB 1ZHFA 3OYMA 3LQQA 5E3NA 4D7NA 3KP6A 3VYUB 2ID6A 1A35A 2GXAA 9ANTA 4P5OA 3K2AA 2EFWA 5CPRB 3J81K 2FBKA 3HTSB 3RDIA 1O57A 1R5GA 2VONA 3OS1A 2CO5A 3HZJA 2L9NA 1TWCJ 3HIFA 3K1PA 1BIAA 3IP4B 1T39A 2DMPA 2XIGA 3GLXA 3K10A 3WGHA 4RAZA 3JRFA 1ZELA 4BBSJ 4CGZA 4BGDA 2FBHA 2OCEA 3JTGA 2IRFG 2H6BA 1Y1WJ 2VC0A 1R1TA 2BV6A 1FIAA 4LMYA 4B1RA 3J80Z 3EYIA 3NEUA 4YIRX 3HJEA 1T98A 1ETOA 3BZ6A 3JRBA 4D9JA 2O3FA 1P9QC 4NB5A 2QBYB 2QVOA 2KPMA 4M9ZA 2DK8A 4XRFA 5LRRA 4I99C 2R7QA 1G4DA 3K4KA 4AVPA 4BJ5C 2HVRA 4KMUX 2K9SA 4QTRA 2M5WA 4MGRA 4XLNF 1W7PD 5AONA 5FB2A 1HCRA 5DD8A 4HDUA 2Q8KA 1ETVA 2LREA 5DD4A 3IC7A 1WJCA 2L01A 4PJNA 4A3MJ 1LEAA 4EJUA 3DLAA 2Z5UA 1U5TC 3CESA 3J7AO 3AL0C 5TGTA 1I1GA 4A3BJ 1TWAJ 3WTSC 3LOCA 1J5YA 2X48A 2EZLA 1YW9A 4I0BA 5LHHA 1D3YA 2E1OA 2GA2A 4IF4A 5EZHA 2X0LA 4HV6A 3C2GA 1USTA 4GGGA 5BOXA 3GZ5A 2QENA 5GADJ 3MKYB 4U7DA 3F22A 3S1NJ 1WI3A 1W36D 3PIPF 4IO9F 2E7WA 2A69F 4UHTA 3ZQQA 3IRRA 3BTIA 4B8XA 1RUOA 2DA5A 3RJPA 1Y8QB 1J0RA 2P8TA 3JRDA 2XB5A 1X3WB 2ZXIA 2ESNA 2LKPA 5HODA 4I0AA 1H89C 4BACA 4HX7A 1XGMA 2QSFX 3V7SA 1GT0C 3MAJA 4ESFA 2HKOA 2QQ8A 4NC8A 1VQ9I 1IN4A 3VYRB 3KEYA 2JA6J 2DA6A 4ESJA 2QQ9A 2UV1A 2ISZA 2L0KA 2LNBA 2KQRA 4BHCA 4M3GA 4A3JJ 3V7CA 3QU3A 4AWXB 1TBXA 3MVPA 4XBFA 1P4AA 1NG7A 3KX2A 3HOYJ 3I71A 4M6VA 4IRIA 5F64A 2DN0A 4M3FA 4N9HA 3SHFA 1WVRA 3OWTA 1V55H 3TDZC 1D5YA 1MBFA 3E97A 3FF5A 2V9VA 1ZRCA 2NRAC 2XPUA 3IH2A 2Y0SN 3LSJA 4X1EA 1MSEC 4ZZDA 1JT0A 2IS6A 5LRSA 1WH5A 4BYYA 4XM3A 2BOLA 1CF7B 1LKXA 2R7UA 1UMQA 4JOMA 3KE2A 1ERDA 2FF4A 4XLFA 1ZR4A 2AQFA 2PMHA 1FC3A 2L7ZA 1XGSA 2CH0A 3CD6I 3E6DA 2XHKA 2BYVE 4XOTA 1R4MB 3M1EA 4HSRA 3NWSA 2KKOA 3HDDA 4BXXJ 1IW7F 1PJRA 2OV7A 2VI6A 1JTYA 1IAWA 2E1NA 2R4GA 4KUMA 3P9KA 1VFCA 3E6MA 4NBQA 2E5NA 2ACJA 3M7GA 2F5EA 2ECBA 3SEQA 1O7FA 1UG0A 1GXPA 1G59A 3BPVA 1YJWI 1U8RA 5JHFA 1Z0XA 2A6EF 5DM6F 3C3WA 3VWBA 4IRHA 3HOUJ 1Z77A 3ZCOA 1JKRC 4U88A 2ZBKA 2HS5A 2IVMA 1ZG5A 3C7JA 4HAMA 4A3FJ 3VODA 4IXAA 1HC8A 1X3ZB 5HS9A 4R1HA 3ONQA 2P5KA 2X6YA 4IQ4A 4YEJA 3WGIA 3OYFA 1QPMA 2HXOA 5J3LA 4JQFA 4LFUA 4LG0A 1Y39A 4H4KC 2DMTA 1OCTC 1DU6A 1SC7A 3KCCA 2IS2A 3T8TA 2KHMA 4RGXA 1L3LA 3MKLA 5FGMA 3EDPA 4H0EA 4DZJA 4A3IJ 2JRTA 4MEYF 1BR2A 1P4WA 1IG7A 4EJWA 1E3HA 1TZLA 1XX5A 5EF6A 2M2EA 1XSVA 3ABKH 4GDFA 3CCVI 2V1XA 1XPXA 2AO9A 1BW5A 2A07F 4ZTFA 2BEOA 2ID3A 4KNYA 1IXRC 5H6RA 1U9OA 1B59A 1B1BA 2FRHA 2DA4A 4XSXF 3RPUD 4OIRF 4JYKA 1P4XA 3CP2A 1VTNC 3RSNA 2BY0A 2E36A 4HNTA 3Q0UA 1ZREA 3KYLA 1QQIA 4RA2A 2DU9A 3BQYA 3LAJA 3WGGA 2PJPA 1H88C 4YFXF 2JA5J 3H3VK 2MLKA 3K0LA 4ZYGA 3G1LA 2R5YB 4KDPA 4CO8A 1L0OC 2VL8A 1S7AA 3E6BA 3L2WA 3G71I 2K3FA 5D5VB 2GIZA 3E7LA 5LEJA 4EGZA 1B72B 3M4OJ 3R60A 3I9V2 4XLAA 1BM9A 1LUJB 3PO2J 1LEBA 3D5SC 1ZG1A 4GCVA 1S9HA 5IP9J 1JUPA 1H9TA 2RDPA 3HOSA 2EFPA 4WWCA 3BZKA 1J75A 3GFIA 1MNDA 3CUQB 2DDBA 3ESWB 4KIGA 2KDZA 3N97A 2ECCA 2XGDA 1QU3A 1FOKA 2A61A 3S1MJ 4L9NA 4DIQA 1U5TA 2AXLA 3H5RA 3IWZA 4F3QA 4LB5A 3K70D 1BOBA 5LD2C 5K7HA 3ELKA 3GLLA 1TQMA 1I6XA 4OU0A 2BY3A 1CGPA 3A0HC 1P7IA 2KRFA 4KA4A 4FETA 2VBXA 4YRVA 2R7OA 2HOEA 1J09A 2TCTA 3DWLE 5IOZA 1ETYA 4A0ZA 3OYCA 1YIOA 1RIOH 1ZRDA 3FXKA 3PM1A 3HOXJ 2GQQA 1YW7A 2W82A 2EILH 1B4AA 3NWTA 1PUEE 3S1RJ 3CCJI 2OQRA 1SFXA 5HNHA 5IYBJ 1LDJA 3ZOBA 2CJJA 3M07A 2CGPA 4BBRJ 2DK5A 2HQNA 2DT5A 2VC1A 1MH4A 3JSOA 3DEWA 2CFXA 3M8FA 3Q9VA 2HDWA 2M3AA 3I0TA 5KAIC 3CO7C 2QF7A 2ME6A 1NH3A 2Y2ZA 4HF1A 4WK8F 2IGNA 2GOXB 5E1XA 4U0VA 2EQRA 3RPUA 3WHCA 3SYTA 3HB9A 1DPRA 1X58A 2ZKZA 2ZXHA 4C9YA 3RTRA 1BW6A 1YS6A 2A68F 3H3ZA 4WXDA 5L3BA 4C2UA 3CLOA 4YFNF 1OR7C 3OIPA 3K1MA 1IDYA 1XDUA 1KQ8A 3GTJJ 2LVSA 2CW8A 2P6TA 3TO9A 2FU4A 4BQQA 5C4XJ 3W6KB 4AUXA 2YPRA 1YQAA 3JRIA 3HEFA 2OUMA 3K69A 1NG6A 1OPCA 4I76A 2JWTA 2HVSA 4AYBA 2YU9J 1JXSA 2OC6A 4EM1A 2HGCA 1MJ9A 3GEZA 5BMZA 1J7KA 1HLVA 3AG1H 3BDDA 1N78A 4O5VA 3BG3A 1AHDP 1JKOC 3DBHB 4PJMA 2ZMEA 1X1PA 3MFKA 2KJBA 5GAEJ 4IX7A 2LG4A 1OCZH 1HQCA 4UB6C 1WPKA 4Y33A 2QUFA 4PUSA 4XKVA 3UR3C 3O3KA 2W48A 4EMSA 1WJ5A 2E35A 2HOAA 2EV6A 3FXRA 4AU7A 3JRCA 3IL2A 3OS0A 2NS0A 1XGOA 2IGOA 3WU0A 2D2WA 4DNCA 3FKIJ 2OTJI 2JMWA 4WF2A 1NTCA 5ICCA 4Y4RA 1HSJA 4CYCB 4WX9A 4BDZA 1XDSA 2E5ZA 5JHUA 4XLPF 4EJTA 2XC7A 3OSFA 2Z1DA 1UELB 1FT9A 2FJ1A 4IHYA 4A0YA 2FNAA 2WBMA 2JA7J 4YFKF 2P6SA 2UXNA 1PVEA 3ZGKA 4ENMA 2O6GE 5AIPA 3OYKA 1MBEA 2W1OA 2LKSA 2PN6A 4EATA 1Z1DA 3FX3A 1T38A 1ZG3A 2VT3A 1QVUA 2IBDA 1IGNA 2MW8A 1EV7A 4DOZA 3KZIC 3AKZA 3U1DA 3UKGA 2C6YA 4CZZA 2VJIA 2FSWA 1BI3A 1R4NB 2AQEA 1Y56A 2JA2A 2V7FA 1W4MA 3KP7A 4BQAA 1K79A 3GTPJ 1V5GA 2DLLA 2PMUA 4CH7A 1VQ6I 4ZH4F 2K4BA 5F0HA 3SXYA 5DUKA 2R7XA 3M8EA 1OKRA 5IOYA 1U5TB 1ODDA 2ZMEC 1LQ1A 1NHAA 1KA8A 1W5CC 2R5YA 1EH8A 5B1AH 1I5ZA 5BNGA 1FOYA 4P96A 4RB2C 4MIMA 2DFIA 3PO3J 2JSCA 5EEGA 3JRGA 1O3SA 2OPTA 2TDXA 2MC3A 5ILVA 2H8WA 2F5VA 4G12A 2X51A 1QNTA 2XAJA 1SVOA 4AIHA 4ENNA 1YO5C 2IS1A 3G3ZA 1ULYA 5E1ZB 5HS7A 3L9FA 1FX7A 1GVDA 3CZ6A 1D8JA 3F8MA 1PP8F 1KQ0A 5CKTA 4G7OF 4RM2A 2BY2A 3OY9A 4CZCA 3A0BC 2UUZA 3VPRA 4Z6YA 1J9IA 3LSTA 4C2MJ 3DKYA 3X2QH 3O8HA 2ICWG 1TWHJ 2LSOA 2QBYA 2XAQA 1DUXC 1S3JA 1H9GA 5LFAA 1H8AC 4MFDA 1T6SA 5B3SH 2OQGA 1EA3A 1VQPI 1OQYA 4J01A 1PDNC 2M9HA 2DMUA 1OCPA 4XL9A 3LFUA 1QBJA 3E6CC 2DQLA 1R1UA 3G2BA 1Y1VJ 2HQ5A 3KP3A 4CYCA 2PI0A 3S32A 5D4RA 1AKHA 4HF2A 2F6CA 4IL6C 3W6VA 3H9QA 3H0GJ 2Y9ZA 4M6XA 4BHBA 2EIKH 1QZZA 4RAGA 4UUSA 2EBIA 1K78B 4BHPA 2J5PA 4FASD 2EINH 4I09A 3HPHA 1JHFA 4QSHA 1Y6IA 2FOKA 4E6KG 2RNGA 1MGTA 2P4WA 1LE8B 2ZXJA 3DPUA 3ZQIA 5M3MJ 3AG4H 4N4OB 3IKVA 2KMUA 4M6YA 1ZGAA 1IN6A 2IPQX 1UHWA 2HPIA 3FIWA 4HA8A 1BJZA 5ILSA 3EUHC 3A01B 3F21A 4L5JA 2E2HJ 2R93J 3HSRA 1FTTA 2NAZA 2PLYA 4A3LJ 2GLOA 4RB0A 4EVIA 1JTXA 5TJJA 1OYIA 4HZFA 5FRMA 3ABLH 2IA2A 1RRJA 4D0PA 3F23A 2MC4A 3OL4A 3CLQA 1BOAA 4A5MA 3EUHA 5KCMA 5DUIA 2NS7A 2Q1ZB 2VPLA 1OCCH 3H9GA 2WA0A 1F43A 2XVCA 2E19A 4FHTA 1XD7A 1WJEA 4PCQA 3LL7A 2LY9A 5BS6A 4HQEA 2EFOA 3RZDJ 3JR9A 2M45A 4M72A 5D6FA 5CQGA 4I01A 4AYBN 3CMYA 1T33A 5DV5A 4LLNA 2M8EA 1G3WA 4EQQA 4N4NB 3BP8A 1T0FC 4HX8A 5F6FA 1VQ8I 4GYIA 3S14J 5GAHJ 4XK4A 3HKZN 5J1RA 1WKMA 1IJWC 3Q0WA 3LSGA 4FE4A 3FXLA 3LMMA 4LLGF 1A6QA 4Y3OA 1FYLA 1IDZA 2L7MP 3RYRA 1YE9A 2EV5A 2FMYA 2L02A 4C2TA 4MNUA 3PNTA 2Y31A 5CVIA 1YG2A 1OYWA 1QHGA 3GZNB 3H5NA 1AKHB 2JA8J 5JVTA 4QPOA 3KETA 1QVTA 2I10A 2DQRA 4R8HA 2A5WA 2L2OA 4A3CJ 3S93A 4XONA 2KIUA 3RQIA 5ERIA 1LFBA 3GBGA 1R7JA 2M34A 1XSXA 2MH9A 1K6YA 3BR3A 4RGUA 4ZTJA 2PJRB 4UXNA 1MNMC 2JUCA 4C3HJ 2P81A 4G6DA 1KYWA 2EPFA 3ML6A 3S1QJ 3MD2A 1XCVA 2X4HA 4P9FA 3LAPA 2IA0A 3FM3A 4HOBA 1HF0A 1IXSB 1VQ5I 3E5XA 4II3A 2LBFB 1YYVA 2ESHA 5E20A 2VIXA 3NQOA 3R4KA 5F0CA 1TT5B 1X1DA 3RPQA 3GTLJ 4II2A 2RQQA 4NC6A 3GTQJ 2WV1A 2JVGA 2NVTJ 3CDHA 3ROUA 2M4KA 4OWRB 3HHGA 3SEZA 4LJZF 1LVKA 1T08B 1SVMA 1IC8A 1Q1HA 2Y48A 2ZMEB 2HYJA 3KZZA 2V1NA 3EPZA 2GAUA 3NAUA 4E7SA 2Z9OA 4CXFA 1YX3A 2WAEA 5IP6A 1XGNA 1SMYF 1B9NA 3V8JA 3KYDB 4RGSA 2CUEA 4E7JA 5D5XB 2FX0A 1YOVB 5LEKA 5EGOA 2YU3A 1E0EA 4CCKA 4F93B 1QGPA 1YJNI 1QPIA 3K70C 1ZLKA 1REPC 2HZDA 3DEEA 3PFIA 3CMMA 3WODF 3PNYA 2JVHA 2N8GA 5D4SA 3HM5A 1TW3A 2RREA 1QZYA 3DBLB 3QWLA 3OOUA 2DPUA 1ZK8A 1XMAA 2VKDA 3ERMA 3R6SA 3P9IA 4XMYA 3WTUC 3SDGA 4U0YA 3BJOA 3I4MJ 5DCMA 3BLYA 1QO0D 1O7LA 2DW4A 4GO1A 1BL0A 1JI8A 5FO5A 1TL8A 3HL2A 2F4OB 2DT6A 5ICEA 3U21A 3TO7A 2GBYA 3I4NJ 1H0MA 1RR7A 2ZFWA 2PMZN 1MSFC 1LE8A 2VBYA 3JSPA 2LDUA 2IA1A 3ABMH 3BCBA 3ZMZA 2IXSA 4E7HA 5GTIC 1RI7A 3K6GA 3DTKA 4NDLA 3K2ZA 1SFEA 2GWRA 2CRGA 4J00A 2WWYA 1PUFB 3CCYA 2ZSHB 1ZKGA 3BOQA 3CMEI 3IRQA 4UV8A 3L2VA 3M1CA 4Q47A 5FKMA 5M5XJ 1XS9A 4BY1J 4B3AA 1F9NA 5DCMB 2EV0A 2BVLA 4X6AJ 3A1YA 1C0WA 2HTSA 3N4MA 1B8IB 3GTOJ 2WC2A 5IY5H 1I39A 3S8PA 4XOPA 2E34A 3SZPA 3RYPA 3S2DJ 4C3JJ 1ETWA 2V9KA 4M9XA 5CVRA 2FNPA 1FBUA 4XSZF 1S8NA 2F4IA 2MH2A 3B02A 5LBQA 2VE9A 5DDGA 1ETQA 3LA7A 3WTYC 3U2RA 2HU9A 4M74A 2D1VA 2OBPA 1EJ9A 1JKQC 4GFBA 2VQGA 2E1MB 4LLLA 4BS9A 3FXOA 2K3PA 4L9TA 2CW0F 1YW8A 4MTEA 2ZJRF 2GXBA 1Y0UA 1LJ9A 1YLFA 2JUGA 5F27A 2ETHA 3KIOA 3OYBA 1O3QA 3V8KA 2XB0X 4WXHA 1R22A 1BBYA 2DYSH 4V2GA 4CICA 2QQAA 2W85A 3FK6A 4BY7J 4Y13A 5B5EC 4MTDA 3HRTA 4IHXA 1BR4A 3B6CA 5E18F 4QWQA 4Y17A 2H8RA 1GXQA 5FRNA 2K9MA 3F8NA 4I2OA 1O3RA 3WTZA 5HNFA 1MMDA 3VSKA 3K9TA 3GXOA 4BXUA 4E70A 4ZC3A 1JKPC 2NNYA 5BPDA 3T1BA 4MLOA 3RI4A 1VNDA 4OOIA 2QSGX 2KIQA 2NNNA 4J19A 3GTGJ 5L3EA 1NK3P 2CV2A 5LGNA 4HX4A 3HOZJ 1ETXA 4KT5C 3ABTA 5C44J 3MZHA 3S3OA 3KYCB 5DTDA 2KIFA 3W6JB 2XROA 3TW7A 1V5EA 4GYGA 4JX5A 2DOFA 4OIOF 1U0JA 4FX4A 1RNLA 1D0YA 4DYCA 2K9QA 3C2BA 5LLQA 4UVBA 1TNSA 4LG3A 4L0ZB 2XGXA 2Y69H 1ZARA 2DT7B 4M9SA 1TWGJ 2YS9A 1M1EB 1D0XA 2M0CA 2L4MA 3S3MA 4DZPA 1XMKA 4L0YB 3A2KA 2D45A 5J8CA 2QZ8A 1BC8C 1T0FA 4IEJA 1TLHB 1Q1VA 1XG1A 4N9IA 1XMXA 3DTEA 4XKCA 4GXOA 3CO6C 4IJAA 4ENJA 1R58A 2MABA 3QQAA 3EUAA 3IH4A 2CQQA 5JLWA 1JGGA 3RKXA 3V4GA 1Z91A 2Y0MA 3A02A 4S0HB 2V6CA 2A5YB 3ZQFA 1YJ9I 1S7OA 2CSOA 5ED4A 2L3DA 3CJNA 2QWWA 2X6WA 2ZSIB 4GRIA 3M3YJ 5M3FJ 3E0JB 3BR1A 5HLIA 2V1UA 3WHBA 2R7RA 2OZ6A 3P9CA 3TW6A 2ZNZA 1LDKB 4UUTA 3S16J 2HNHA 4BE1A 4G6TB 2QM3A 3HSEA 1K78A 4RS8A 4I02A 3L2RA 5D8KB 5EEHA 1T2KA 3AG2H 5CQEA 2AS5F 1DGWY 3V7RA 2MG4A 1STZA 2DJNA 1QZEA 1O4XA 2CMPA 4UY8I 4HV5A 3DKWA 2LK2A 3ZQHA 3QP5A 5J1YA 4XRSA 1S7EA 1Z7UA 2RQPA 2CQ7A 2V79A 2YSRA 2Z16A 2RNJA 2MYSA 4Y52J 4K2EA 1LDDA 5E8GA 2KZVA 5ICGA 1X4PA 4O6JA 1W36C 3LSHA 3PQKA 3LSIA 2O9LA 3PUFA 3RCOA 4HLYA 4BE0A 4MQVA 2K5CA 2RC4A 2HQRA 3LA2A 2MBFA 2GZWA 3LSKA 3HSFA 3KP2A 2EZKA 3CCEI 1VQKI 1Y8RB 3CCLI 2E2JJ 1X3UA 2V1DA 2DTZA 5E3OA 4B44A 1X19A 2NOJB 1P7JA 2K40A 2HXIA 1J59A 5HDNA 1D8KA 2ZNYA 4PJJA 4A6DA 2A05A 5DS9A 1HXDA 3L7WA 2DXIA 2V6EA 1FBSA 3GTMJ 2KRCA 3T8RA 1W0UA 1MDMA 2D5VA 5DYMA 3PL8A 3LA3A 4IRGA 5DEQA 2VODA 4MFEA 6PAXA 1S5LC 3Q5FA 1R00A 2WY8Q 4XLEA 2K85A 4XN3A 3QPSA 2HR3A 1SD4A 3CUQC 1ZR2A 2G9WA 1TTYA 3PSFA 3MKWB 2H27A 2LTPA 1SAUA 4M3BA 3ZMVA 1UHSA 4WXCA 1A36A 2K4JA 2WAFA 4S04A 3HUGA 5IP7J 1Z3XA 5L3DA 3QODA 2BVMA 3KP5A 4F92B 3CP8A 1DPUA 1R5ID 4CHUA 4M71A 3O8GA 1V5FA 3FZVA 3G4SI 5D5WB 1KU2A 2HDDA 3AG3H 2ZJ2A 3WG7H 5FROA 4HEA2 4D5CA 4HNVA 2NVYJ 2RVCA 2MGQA 3FWEA 5EJCA 1RC9A 1FIPA 4XRSG 2JRMA 3BJ6A 5F1RA 1PUFA 1ONVA 2B7EA 1BC7C 5ILUA 2K27A 2DPDA 2L54A 1G6NA 4KN4X 5D6EA 5F04A 5FKNA 4B09A 1JE8A 1GHCA 5H6QA 4P1WA 4RBOA 3J80K 2MFZA 4RAYA 3DPLC 4DW6A 2F5FA 2OCCH 3OV8A 2X1EA 3KP4A 3VSLA 1K61A 1ZGWA 4Z2YA 2R0QC 1GUUA 2VT2A 3LSRA 2GM4A 1V3FA 3QYBA 1WJBA 3KLOA 2BBYA 3JREA 4ENKA 2P7CB 4LIUA 3HC7A 4UVCA 2G0EA 4D7MA 2H94A 2BZTA 4ABZA 1E3OC 3JCUC 1R1VA 1VQ7I 1IN7A 3HUGB 1YIJI 3JW4A 3F8FA 2JPBA 3LSPA 3FK7A 1VQ4I 3WU1B 2EK5A 4PSXA 1DP7P 2F5CA 4AIJA 2NVQJ 2PG4A 2CUZA 3T5XA 2P5VA 3RQ4A 3K4CA 3MN2A 3HHHA 2R92J 1UFMA 2YUSA 1WWXA 2XAGA 3WTTC 2EJRA 3O6BB 1MMAA 2B9SA 2KRHA 2LLKA 5H20A 4XKBA 4DQ2A 2Y30A 3HXLA 3OMYA 1R5HA 3IH3A 3C1DA 3KLNA 3VOEA 4WCGA 1K7AA 1WSUA 3HOTA 1YFHA 1PYVA 4ZYHA 2EA2A 4BNCA 1XN7A 3FXQA 2NYXA 2VJJA 5B66C 1RKWA 5IT9Z 2VKVA 4Y15A 3QOPA 4ZDPA 4ETSA 3LSMA 2DFEA 3LNQA 2E1CA 1RZ4A 2O5RA 5J4YA 2QSHX 5FKKA 3OYAA 4LOCA 4NQWB 4PSWA 5FKLA 3MKZA 2QA4I 3TL4X 5FLVA 4AD9A 1SD5A 1G3YA 1YRNB 4B4CA 4NUBA 1X1AA 3DQVC 2XSJC 1D1AA 2ADUA 4ESBA 5JI6A 3HRUA 4BEHB 2HI3A 4BL0B 2QLZA 3DU6A 3M9AA 2FXAA 2VQCA 3R61A 3HTUA 5F1JA 2IT0A 1MD0A 2LOOA 2DFFA 5K1YA 1R9TJ 2KFDA 3E5QA 4RAFA 3RKYA 3CF2A 3HG9A 2A6HF 5FD5A 3CJQB 3WU2C 4RB1A 4O3MA 4BJTA 2FUG2 3H3UA 1Z21A 3Q3SA 3BWGA 1HW1A 2DAOA 1BR1A 1IO2A 2ZC2A 2K02A 3EUKL 2LMDA 3HOWJ 2O61A 3TGNA 2WB1N 4E4HA 2HOTA 1K6OA 4UUVA 3JRHA 5HDGA 3PFYA 1O3TA 2FQ4A 1P92A 2RN7A 2KZGA 4XICA 3IHUA 2L4AA 1Z9CA 2QKLB 3FXUA 3W2WA 2JQ7A 1E2XA 5HLTA 2Z33A 3D0SA 1V4RA 2F2EA 3OYNA 2NXNB 4OAYA 1W7PB 3FKJA 4LITA 1MDMB 3GUDA 4ASNA 4F91B 1R71A 2W24A 1JT6A 5KHDA 1FYKA 3CC2I 2CUJA 3GWZA 2VJ5A 3G1OA 1MW7A 2MD5A 2X85A 3U1KA 1HOMA 3QU6A 4BE2A 4G7HF 2XF7A 3E3VA 5E3MA 3SJMA 3ZXSA 1MBJA 5K7ZA 1TP4A 3BR0A 3R0AA 1SFUA 1SVLA 1AU7A 3H35A 2DOAA 2FBIA 2HFHA 1FP1D 2GXGA 4CSWA 4EJOA 1TW2A 1LFPA 2XF6A 2L9RA 3OYHA 1KONA 3K4BA 5M5YJ 1HKQA 4CCLA 1D0ZA 4L9VA 3DU5A 2HYGD 2R7DA 3KPHA 1GV5A 3I59A 4HQMA 5J47A 5CLSA 1F5TA 3BPXA 2LBFA 2BE5F 3TKYA 2VBZA 5L3FA 2O8KA 2XRNA 2PMZA 2L9VA 4KT6A 4D5FA 3ZMSA 3ZP5A 1MNEA 2VUMJ 2P0WA 1FTZA 1WJAA 5HLHA 2LF8A 2ZJPF 3SFIA 3I58A 1U6GA 4CCJA 5HLGA 3RZOJ 2CUFA 4LB6B 1ZLJA 1DU0A 2VN2A 4W1UA 4KICA 4PK4A 3VB2A 1WH7A 2XPWA 1MIJA 2D1HA 1OR7A 2E7XA 4ZJZA 3I59B 5TISC 2V4JC 4E7KA 1FMWA 1XSDA 4JP0A 2LKXA 2R7TA 2KDOA 4DYRA 1IRGA 5FD6A 3NRVA 5KVRA 4HYEA 1VI0A 3MZ8A 1FY7A 2KIMA 2X6XA 2LY2A 4OAZA 3OSGA 4PFOA 4UV9A 4FX0A 2W25A 3CF5F 1W7PA 3TP0A 5TRDA 3D5LA 2STWA 3CC7I 1UHMA 5AIQA 3GMEA 2XSDC 2STTA 4BJ6C 1HKSA 3HRMA 3DPTA 3OYLA 4LGWA 5GPAA 2L9SA 1A04A 1ENHA 2AXTC 2DA3A 3ZQ7A 3CCSI 4LD5A 1F4KA 4KIBA 1T56A 2Q0OA 3NARA 3V42A 3IAS2 4I6ZA 4QLCU 3I56I 2LF7A 3EETA 3TDUC 2XAUA 2HPMA 2GA1A 1K4SA 3E5UA 1IN5A 1USSA 2RGVA 4IOCF 3GZ6A 2WAQN 3HOVJ 2OF7A 3P7NA 4EEFG 1CF7A 3K4JA 3H92A 2RAEA 3KEQA 1OYYA 1MKMA 2VXDA 4PZJA 5FFXA 3FMRA 2CYYA 3G6EI 1W5TA 1HW5A 1XC5A 4U0WA 4A3EJ 2WY7Q 3MEXA 3FMSA 4CA0A 4IHTA 2YR2A 1HSTA 3IV5A 2EZHA 1PP7U 2HVQA 4XQFA 1Z6RA 4A3KJ 1Z05A 2CQNA 2R7VA 1SAXA 2A3SA 2VASA 1P2FA 2HEOA 4G94A 5HS8A 4QIWN 5K5OA 1ACIA 5A2QZ 3F8BA 1OCRH 1N77A 3P5JA 3BZCA 4IHSA 2AHQA 2K9NA 4ZDOA 2MA3A 4M3EA 2VE8A 1Z7LA 4G6QA 2CU7A 2JZYA 1AA7A 1LPQA 3GFLA 1HDDC 1BA5A 2H1KA 1OMIA 4UVAA 1FEXA 2HWVA 4V2FA 1B72A 3TEDA 1WCMJ 2DCEA 3OYIA 1A31A 3BG9A 2BXYA 2HYFA 1FPQA 3H1CA 3OIQA 2KLOA 2VB6A 2W00A 3J7ZI 4JX4A 4A0XA 2DBBA 2EB7A 4CCMA 3MQ0A 3FM5A 3BTCA 4XKWA 1IRFA 3CUOA 2LD5A 2F4MB 1ZQ3P 5C4JJ 2Q2EB 2HQAA 5F08A 3L2CA 1LNWA 2H6CA 5A2QK 4PJ0C 2WTEA 4NC7A 1DQUA 4RGRA 1GDTA 1HBXG 3PNVA 4B43A 3ZQGA 1WJFA 3GFJA 1MZBA 2ZCWA 2H09A 3TMOA 1N75A 3PJRA 4BH9A 2BW3B 3QYFA 4BKXA 4JX6A 2E71A 2DI3A 1IUFA 1VQOI 4A69C 1HW2A 4A3DJ 1JUSA 5GP9A 2ZO4A 3SZGA 1ZN2A 3A03A 4NNJA 3QPTA 4I7HA 3L2QA 3JRAA 3TP3A 4NQWA 1ETKA 2L5QA 1G3TA 2EH3A 2ZXWH 3DV8A 1SFKA 3DXJF 2VQLA 4EM0B 2PFBA 2X1CA 5IYCJ 3S2WA 3F6VA 1G2HA 2KT0A 3ASOH 1SANA 5FJ8J 1OCOH 1FP2A 1GVJA 5D8LB 4DBQA 4W97A 3V8LA 2LFBA 3VDXA 3JAMK 1VQLI 2W84A 2GOMA 2KP6A 1ON2A 3I54A 2FQ3A 2KISA 2EWNA 2H1LA 2IGKA 1WFXA 4AVZA 3VFZA 1MMGA 3CCQI 2JN6A 4OIQF 1D1BA 1EH6A 4CDGA 1FWZA 4ON0A 2KJCA 3L00A 1TQIA 3DLLF 3H36A 4ZYEA 3F72A 3K1NA 4XIDA 2CV1A 2MSYA 2UZKA 3AAFA 1WGXA 2PEXA 3KZYA 2XF5A 4IHWA 2XUBA 2JTVA 1DP3A 1T95A 3AFHA 3W3CA 3SQNA 5C3EJ 1IUYA 3FMQA 1KZHA 1YITI 1WQ2A 2FEZA 5FLMJ 3OL3A 3GCMA 3BG6A 3H5AA 3HKZA 1ITYA 1QHHD 4JK1X 2L7FP 2M7AA 4EGYA 1W1WE 3IWFA 2VKEA 3B73A 4CUGA 3L09A 5EGOB 1DGRM 5FFZA 5LHGA 1TNTA 2XKPA 3DP7A 3CDIA 4HDVA 3CQZJ 2COBA 2DA1A 2YX7A 5M5WJ 3I4PA 1ZYRF 1JJ8C 1X1BA 1KYZA 2OA4A 2Y0SA 3ASNH 2DA2A 2FE3A 4G9YA 3JAMZ 3A01A 1BI2A 1Z6TA 4PGGA 4HW0A 1X2MA 2OJED 2X1DA 1QA6A 2IW5A 3IUOA 5L3CA 4FE7A 2ELJA 4LK0F 2CS3A 1B8IA 2NS8A 5K7FA 1UB9A 2W7NA 3I64A 4KFCA 3UNGC 5E8IA 2J5OA 4UUSB 2LY1A 2JSPA 2E2IJ 4C3IJ 4HSTA 4A6EA 3QRFF 2QKMB 5HOOA 1EKEA 4DGWB 4CCOA 2F48A 2CWEA 4Q48A 3VEPA 1R23A 2MD0A 2COMA 5IYDJ 4FQGA 3K7AJ 1R49A 2XGCA 3DBRB 2R7ZJ 3BR6A 4G8XA 5CVVA 3I3LA 1WJDA 5JLXA 4PJLA 3EYYA 3TOBA 3ZMTA 2R7FA 4RLQA 4MEXF 5EZGA 1S29A 2Z3YA 1NK2P 1KU3A 5CVJA 1FBQA 2E1MC 2QGUA 4Q5SF 1BIBA 2XPVA 2LRDA 2A6TA
chains in the Genus database with same CATH topology
3ECHA 1U3EM 4P55A 2O8XA 4EJVA 1LVAA 2M87A 5KK1A 1FZPB 4FT8A 3WE3A 2HKXA 2Q2EA 2G7HA 1B6AA 1BI1A 2G7UA 5ICFA 5HVQC 2UWMA 3CTAA 2HDCA 2XAHA 3TQNA 4F7ZA 3KEOA 5DCFA 3DF8A 2Y75A 3SFZA 2R3SA 2VBWA 2EFQA 2WV0A 4R79A 3ECOA 2VOPA 2CQKA 1SD7A 4BAYA 1BI0A 3WTWC 4YG2F 5LGUA 1ZH5A 3WE2A 3GO5A 2XKOA 4RB3C 1BN5A 2O0YA 3EQLF 4MQ9F 4MHGA 1KU9A 1D5VA 1IF1A 4OINF 1SD6A 1KGSA 3ISPA 1IN8A 2P7VB 1AWCA 4LG0B 3I53A 1FYMA 3SZTA 4UNOA 2QYOA 2IP2A 3BROA 5K5RA 2FA5A 4HF0A 3FHZA 1SMTA 4L9JA 3O2PE 3LWFA 2EFNA 3COAC 3LFKA 5J6XA 5BQTA 4I98B 2XV4S 2IJLA 3LQRA 4EV0A 3WTVC 5CJ9A 4KYWA 2W57A 2ELHA 4M73A 4PDKA 1MJBA 2QQBA 4G7ZF 1KU7A 5FLXZ 4A12A 2DO7A 2CG4A 4YIIA 2OU2A 5BPIA 2OZUA 1XB4A 5K5QA 3ZPLA 2PBIA 2Z99A 3TOAA 4A5NA 5CVUA 2XASA 3ZN1A 4EM2A 2M30A 3HYIA 3QP6A 1TQPA 2M1BA 3MWMA 2K7LA 3GVAA 4P9UA 2RV8A 3BY6A 2ISYA 3MCZA 4KN7X 3F6OA 4KMFA 2B0LA 1IXCA 1LB2A 2UXXA 1U2WA 2VOOA 1HKTA 1JHHA 3GW2A 1UCRA 2GIVA 1EH7A 4HBLA 4HLXA 2P5LC 1BJAA 4AIKA 4PGHA 3GF2A 1FLIA 4LK1F 3Q9SA 5JR3A 2MLGA 3KFWX 4A2UA 2RKHA 3F8CA 1FNNA 1F1ZA 1FSEA 1I27A 2PQ8A 1WRJA 4YIFA 1ZRFA 5IT3A 4NHJA 1B9MA 3F3XA 3ZMDA 4Q4ZF 3RKWA 5LGTA 1ON1A 3I5UA 4KIFA 4OMYA 1S6LA 4IPAA 4CYDA 4U7BA 3C18A 3PQJA 1AOYA 3ABUA 3BJAA 1YS7A 4OIPF 4L5IA 5E17F 2HTJA 3ZN0A 3QPHA 4TV7A 3CUQA 1J2XA 4L18B 2K86A 4S05A 1DDNA 3R0JA 1RUNA 1FSHA 2EA4A 1W5SA 5JFRA 3HRSA 1JGSA 1E17A 1WI9A 2JT1A 1MJAA 3GX4X 3DFGA 2F5DA 4OMZA 2BGCA 4ZZLA 3GYHX 2YX4A 5CYVA 3WTXC 1ZGJA 2O03A 3ZMUA 5IT9K 3G73A 3U9GA 1YTYA 4N0BA 1I1SA 2OD5A 1ZAOA 3DEUA 3REOA 3T0YA 5D5UB 1P6RA 2OAZA 3GFMA 3QAHA 3J81Z 2FMLA 3RIRA 3TO6A 5L3GA 5FLXK 3OOPA 2XAFA 4IVNA 5LHIA 4ZYDA 1IZ1A 5J8FA 1KQ9A 1XCBA 2HZTA 3JTHA 1R36A 2VXZA 1G3SA 2DTRA 1U78A 3MZYA 3IKTA 5HDKA 3ERED 2JPCA 5E1WA 3WG9A 3ULQB 1ZHFA 3LQQA 3KP6A 4P5OA 2EFWA 3J81K 2FBKA 3HTSB 3RDIA 1O57A 1R5GA 2VONA 2CO5A 3HIFA 3K1PA 1BIAA 1T39A 2XIGA 3GLXA 3WGHA 4RAZA 4CGZA 2FBHA 3JTGA 2IRFG 2H6BA 2VC0A 1R1TA 3J80Z 2BV6A 4LMYA 3EYIA 3NEUA 1T98A 3BZ6A 2O3FA 4NB5A 2QBYB 2QVOA 4M9ZA 2DK8A 4XRFA 5LRRA 1G4DA 4AVPA 4KMUX 2M5WA 4MGRA 4XLNF 1W7PD 5AONA 5FB2A 5DD8A 4HDUA 2Q8KA 3IC7A 2L01A 1LEAA 4EJUA 2Z5UA 1U5TC 3J7AO 1I1GA 3WTSC 1J5YA 1YW9A 4I0BA 5LHHA 1D3YA 2GA2A 4IF4A 2X0LA 4HV6A 1USTA 4GGGA 5BOXA 3GZ5A 2QENA 4U7DA 3F22A 2E7WA 2A69F 4UHTA 3IRRA 4B8XA 1RUOA 3RJPA 1J0RA 2P8TA 2ESNA 2LKPA 4I0AA 4HX7A 1XGMA 3V7SA 3MAJA 4ESFA 2HKOA 1IN4A 4ESJA 2QQ9A 2ISZA 2LNBA 4BHCA 3V7CA 3QU3A 4AWXB 1TBXA 4XBFA 1P4AA 3I71A 4IRIA 5F64A 3SHFA 4N9HA 3TDZC 3E97A 3FF5A 2V9VA 1ZRCA 2NRAC 4ZZDA 5LRSA 4BYYA 1CF7B 3KE2A 2FF4A 2PMHA 1FC3A 1XGSA 3E6DA 2XHKA 2BYVE 3M1EA 2KKOA 1IW7F 1IAWA 2E1NA 4KUMA 3P9KA 3E6MA 2ACJA 3M7GA 2F5EA 1O7FA 1GXPA 3BPVA 1U8RA 2A6EF 3C3WA 4IRHA 4U88A 2ZBKA 2HS5A 2IVMA 1ZG5A 3C7JA 4HAMA 3VODA 4IXAA 5HS9A 4R1HA 2P5KA 3WGIA 1QPMA 4JQFA 4LFUA 4LG0A 3KCCA 3T8TA 4RGXA 1L3LA 5FGMA 3EDPA 4H0EA 2JRTA 4MEYF 1P4WA 4EJWA 1XSVA 2V1XA 2A07F 2BEOA 4KNYA 1IXRC 5H6RA 1B59A 1B1BA 2FRHA 4XSXF 4OIRF 1P4XA 1VTNC 1ZREA 1QQIA 2DU9A 3LAJA 3WGGA 2PJPA 4YFXF 2MLKA 3K0LA 4ZYGA 4KDPA 4CO8A 1L0OC 1S7AA 3E6BA 5D5VB 4EGZA 5LEJA 3R60A 1BM9A 1LEBA 1ZG1A 4GCVA 1H9TA 2RDPA 3HOSA 2EFPA 4WWCA 1J75A 3GFIA 3CUQB 4KIGA 3N97A 1FOKA 2A61A 4L9NA 1U5TA 2AXLA 3IWZA 4LB5A 3ELKA 1TQMA 1I6XA 4OU0A 1CGPA 2KRFA 4KA4A 2VBXA 2HOEA 1ZRDA 1RIOH 4A0ZA 1YIOA 2GQQA 1YW7A 1B4AA 1PUEE 2OQRA 1SFXA 1LDJA 2CGPA 2DK5A 2HQNA 2DT5A 2VC1A 3JSOA 2CFXA 3M8FA 3Q9VA 3I0TA 3CO7C 4HF1A 4WK8F 5E1XA 4U0VA 3RPUA 1DPRA 2ZKZA 3RTRA 3H3ZA 1YS6A 2A68F 4WXDA 5L3BA 3CLOA 4YFNF 3K1MA 1XDUA 1KQ8A 2P6TA 3TO9A 2FU4A 3W6KB 2YPRA 1YQAA 3K69A 1OPCA 1JXSA 4EM1A 2HGCA 1MJ9A 3GEZA 5BMZA 1J7KA 3BDDA 4O5VA 2ZMEA 3MFKA 2KJBA 1HQCA 2QUFA 3O3KA 4EMSA 2EV6A 3FXRA 3IL2A 2NS0A 1XGOA 3WU0A 4DNCA 2D2WA 4WF2A 5ICCA 1HSJA 4WX9A 1XDSA 5JHUA 4XLPF 4EJTA 1FT9A 4A0YA 2FNAA 4YFKF 2P6SA 2UXNA 4ENMA 2O6GE 5AIPA 2PN6A 1Z1DA 3FX3A 1T38A 1ZG3A 2VT3A 1EV7A 3U1DA 2C6YA 4CZZA 2FSWA 1BI3A 1W4MA 3KP7A 4BQAA 1K79A 2DLLA 2PMUA 4ZH4F 2K4BA 3SXYA 5DUKA 3M8EA 1OKRA 1U5TB 1ODDA 1LQ1A 1NHAA 1KA8A 1EH8A 1I5ZA 4P96A 4RB2C 2DFIA 2JSCA 5EEGA 1O3SA 2TDXA 2MC3A 5ILVA 1QNTA 2XAJA 4AIHA 4ENNA 1YO5C 3G3ZA 1ULYA 5E1ZB 5HS7A 3L9FA 1FX7A 1D8JA 3F8MA 1PP8F 1KQ0A 4G7OF 1J9IA 3LSTA 2LSOA 2QBYA 2XAQA 1DUXC 1S3JA 1H9GA 1T6SA 2OQGA 1PDNC 1QBJA 3E6CC 2DQLA 1R1UA 3KP3A 2PI0A 5D4RA 4HF2A 4M6XA 4BHBA 1QZZA 1K78B 4BHPA 2J5PA 4I09A 1JHFA 2FOKA 1MGTA 2P4WA 2ZXJA 3IKVA 4M6YA 1ZGAA 1IN6A 2IPQX 1UHWA 5ILSA 4HA8A 3F21A 4L5JA 3HSRA 2NAZA 2PLYA 4RB0A 4EVIA 5TJJA 1OYIA 4HZFA 2IA2A 4D0PA 3F23A 1BOAA 4A5MA 3EUHA 5DUIA 2XVCA 4FHTA 1XD7A 4PCQA 5BS6A 4HQEA 2EFOA 2M45A 4M72A 5D6FA 4I01A 5DV5A 4LLNA 2M8EA 1G3WA 4EQQA 3BP8A 4HX8A 5F6FA 4GYIA 1WKMA 4LLGF 1FYLA 3RYRA 2EV5A 2FMYA 2L02A 4MNUA 5CVIA 1YG2A 1OYWA 5JVTA 3KETA 4R8HA 2DQRA 2KIUA 5ERIA 1R7JA 1XSXA 2MH9A 4RGUA 4UXNA 4G6DA 1KYWA 3ML6A 1XCVA 2X4HA 4P9FA 3LAPA 2IA0A 3FM3A 4HOBA 1IXSB 3E5XA 1YYVA 2ESHA 5E20A 3NQOA 3R4KA 3RPQA 3CDHA 3ROUA 3HHGA 4LJZF 1Q1HA 2Y48A 2ZMEB 3KZZA 2GAUA 2Z9OA 4CXFA 1XGNA 1SMYF 1B9NA 3V8JA 4RGSA 5D5XB 5LEKA 2YU3A 1QGPA 1ZLKA 1REPC 3PFIA 3WODF 5D4SA 1TW3A 1QZYA 2DPUA 1XMAA 3R6SA 3P9IA 3WTUC 4U0YA 3BJOA 5DCMA 1QO0D 1O7LA 2DW4A 4GO1A 5FO5A 5ICEA 3TO7A 1H0MA 2ZFWA 2VBYA 3JSPA 2LDUA 2IA1A 3ZMZA 1RI7A 3K2ZA 1SFEA 2GWRA 2WWYA 3BOQA 3IRQA 4UV8A 4Q47A 1F9NA 5DCMB 2EV0A 1C0WA 2HTSA 3N4MA 2WC2A 3SZPA 3RYPA 4M9XA 5CVRA 2FNPA 1FBUA 4XSZF 1S8NA 2MH2A 3B02A 5LBQA 2VE9A 5DDGA 3LA7A 3WTYC 3U2RA 4M74A 2D1VA 2OBPA 4LLLA 4L9TA 2CW0F 1YW8A 4MTEA 2GXBA 1Y0UA 1LJ9A 1YLFA 2ETHA 1O3QA 3V8KA 4WXHA 1R22A 1BBYA 4CICA 2P7CB 2QQAA 2W85A 4Y13A 4MTDA 3HRTA 5E18F 4QWQA 4Y17A 1GXQA 3F8NA 4I2OA 1O3RA 3WTZA 3K9TA 3GXOA 4BXUA 4E70A 2NNYA 5BPDA 3T1BA 3RI4A 4OOIA 2NNNA 5L3EA 5LGNA 4HX4A 4KT5C 3ABTA 3MZHA 2KIFA 3W6JB 2XROA 4GYGA 4OIOF 4FX4A 1RNLA 5LLQA 4UVBA 1TNSA 4L0ZB 2XGXA 1ZARA 4M9SA 2L4MA 1XMKA 4L0YB 2D45A 5J8CA 2QZ8A 1BC8C 1T0FA 1TLHB 4N9IA 4GXOA 3CO6C 4IJAA 4ENJA 1R58A 3RKXA 3V4GA 1Z91A 2Y0MA 2V6CA 2A5YB 1S7OA 2CSOA 5ED4A 2L3DA 3CJNA 2QWWA 5HLIA 2V1UA 2OZ6A 3P9CA 2ZNZA 1LDKB 2QM3A 3HSEA 1K78A 4RS8A 4I02A 5D8KB 5EEHA 1T2KA 2AS5F 3V7RA 1STZA 4HV5A 3DKWA 3QP5A 1Z7UA 2RQPA 2V79A 2YSRA 2RNJA 4K2EA 1LDDA 5E8GA 5ICGA 4O6JA 3PQKA 4HLYA 4MQVA 2RC4A 2HQRA 3LA2A 2MBFA 2GZWA 3HSFA 3KP2A 1X3UA 2V1DA 1J59A 5HDNA 1D8KA 2ZNYA 4A6DA 1HXDA 3L7WA 1FBSA 3T8RA 1MDMA 5DYMA 3LA3A 4IRGA 5DEQA 2VODA 6PAXA 3Q5FA 1R00A 2HR3A 1SD4A 3CUQC 2G9WA 1TTYA 2H27A 3ZMVA 4WXCA 2K4JA 4S04A 3HUGA 5L3DA 3KP5A 1DPUA 4CHUA 4M71A 3FZVA 5D5WB 1KU2A 2ZJ2A 2RVCA 3FWEA 3BJ6A 5F1RA 1ONVA 1BC7C 5ILUA 2K27A 2DPDA 2L54A 1G6NA 4KN4X 5D6EA 4B09A 1JE8A 1GHCA 5H6QA 3J80K 4RAYA 3DPLC 2F5FA 3OV8A 3KP4A 4Z2YA 2VT2A 1V3FA 3KLOA 2BBYA 4ENKA 4UVCA 2H94A 1R1VA 1IN7A 3JW4A 3F8FA 2JPBA 3WU1B 2EK5A 1DP7P 2F5CA 4AIJA 2PG4A 3T5XA 2P5VA 3HHHA 1UFMA 1WWXA 2XAGA 3WTTC 2EJRA 3O6BB 5H20A 4DQ2A 1R5HA 3KLNA 3C1DA 1K7AA 3VOEA 4WCGA 1WSUA 3HOTA 1YFHA 4BNCA 4ZYHA 2EA2A 1XN7A 3FXQA 2NYXA 5IT9Z 4Y15A 3QOPA 4ETSA 2E1CA 1RZ4A 4AD9A 1SD5A 1G3YA 3DQVC 4ESBA 2ADUA 5JI6A 3HRUA 2QLZA 3M9AA 2FXAA 3R61A 3HTUA 2IT0A 1MD0A 5K1YA 3E5QA 3RKYA 2A6HF 5FD5A 4RB1A 4O3MA 3H3UA 3BWGA 1HW1A 2DAOA 2K02A 2O61A 3TGNA 1K6OA 4UUVA 5HDGA 1O3TA 2RN7A 1P92A 3IHUA 2L4AA 1Z9CA 3FXUA 1E2XA 2Z33A 3D0SA 1V4RA 2F2EA 1W7PB 1MDMB 3GUDA 4ASNA 2W24A 1FYKA 3GWZA 2MD5A 3QU6A 4G7HF 3E3VA 3R0AA 1SFUA 2FBIA 2HFHA 1FP1D 2GXGA 4EJOA 1TW2A 1HKQA 4L9VA 2HYGD 2R7DA 4HQMA 3I59A 5CLSA 1F5TA 3BPXA 2BE5F 3TKYA 2VBZA 5L3FA 2XRNA 3ZMSA 3ZP5A 5HLHA 2LF8A 3I58A 1U6GA 5HLGA 4LB6B 1ZLJA 2VN2A 4KICA 3VB2A 2D1HA 1OR7A 2E7XA 3I59B 1XSDA 1IRGA 5FD6A 3NRVA 5KVRA 4HYEA 1FY7A 2KIMA 4UV9A 4FX0A 2W25A 5TRDA 1W7PA 3D5LA 2STWA 1UHMA 5AIQA 2STTA 1HKSA 3HRMA 3DPTA 4LGWA 1A04A 3ZQ7A 4LD5A 1F4KA 4KIBA 2Q0OA 4QLCU 2LF7A 3EETA 3TDUC 2GA1A 3E5UA 1IN5A 1USSA 2RGVA 3GZ6A 3P7NA 1CF7A 3H92A 3KEQA 1OYYA 1MKMA 4PZJA 5FFXA 3FMRA 2CYYA 1W5TA 1HW5A 4U0WA 3MEXA 3FMSA 4IHTA 2YR2A 1HSTA 1PP7U 1Z6RA 1Z05A 1SAXA 2A3SA 1P2FA 2HEOA 4G94A 5HS8A 5K5OA 5A2QZ 3F8BA 4IHSA 2MA3A 2VE8A 4G6QA 2JZYA 3GFLA 1OMIA 4UVAA 2HWVA 2HYFA 1FPQA 4A0XA 2DBBA 2EB7A 3MQ0A 3FM5A 1IRFA 3CUOA 3L2CA 1LNWA 2H6CA 5A2QK 2WTEA 4RGRA 1HBXG 1MZBA 2ZCWA 2H09A 3GFJA 4BH9A 2DI3A 1HW2A 2ZO4A 1ZN2A 3QPTA 4I7HA 4NQWA 1G3TA 3DV8A 3DXJF 4EM0B 2PFBA 3S2WA 3F6VA 1FP2A 1GVJA 5D8LB 3V8LA 3JAMK 2W84A 1ON2A 3I54A 2FQ3A 2EWNA 3VFZA 4OIQF 1EH6A 4CDGA 1FWZA 4ON0A 2KJCA 3L00A 1TQIA 4ZYEA 3F72A 3K1NA 2UZKA 3AAFA 2PEXA 3KZYA 2XUBA 2JTVA 3SQNA 1IUYA 3FMQA 1WQ2A 2FEZA 4JK1X 4EGYA 3IWFA 3B73A 3L09A 5FFZA 5LHGA 1TNTA 2XKPA 3DP7A 4HDVA 2YX7A 3I4PA 1ZYRF 3JAMZ 1KYZA 2OA4A 4G9YA 2FE3A 1BI2A 1Z6TA 4PGGA 4HW0A 2IW5A 5L3CA 4LK0F 1UB9A 3I64A 4KFCA 5E8IA 2J5OA 4A6EA 3QRFF 5HOOA 2CWEA 4Q48A 3VEPA 1R23A 2COMA 4G8XA 5CVVA 3EYYA 3TOBA 3ZMTA 2R7FA 4MEXF 1S29A 2Z3YA 1KU3A 5CVJA 1FBQA 4Q5SF 1BIBA 4JBAA 5DD4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ECH A;  1U3E M;  4P55 A;  2O8X A;  4EJV A;  1LVA A;  2M87 A;  5KK1 A;  1FZP B;  4FT8 A;  3WE3 A;  2HKX A;  2Q2E A;  2G7H A;  1B6A A;  1BI1 A;  2G7U A;  5ICF A;  5HVQ C;  2UWM A;  3CTA A;  2HDC A;  2XAH A;  3TQN A;  4F7Z A;  3KEO A;  5DCF A;  3DF8 A;  2Y75 A;  3SFZ A;  2R3S A;  2VBW A;  2EFQ A;  2WV0 A;  4R79 A;  3ECO A;  2VOP A;  2CQK A;  1SD7 A;  4BAY A;  1BI0 A;  3WTW C;  4YG2 F;  5LGU A;  1ZH5 A;  3WE2 A;  3GO5 A;  2XKO A;  4RB3 C;  1BN5 A;  2O0Y A;  3EQL F;  4MQ9 F;  4MHG A;  1KU9 A;  1D5V A;  1IF1 A;  4OIN F;  1SD6 A;  1KGS A;  3ISP A;  1IN8 A;  2P7V B;  1AWC A;  4LG0 B;  3I53 A;  1FYM A;  3SZT A;  4UNO A;  2QYO A;  2IP2 A;  3BRO A;  5K5R A;  2FA5 A;  4HF0 A;  3FHZ A;  1SMT A;  4L9J A;  3O2P E;  3LWF A;  2EFN A;  3COA C;  3LFK A;  5J6X A;  5BQT A;  4I98 B;  2XV4 S;  2IJL A;  3LQR A;  4EV0 A;  3WTV C;  5CJ9 A;  4KYW A;  2W57 A;  2ELH A;  4M73 A;  4PDK A;  1MJB A;  2QQB A;  4G7Z F;  1KU7 A;  5FLX Z;  4A12 A;  2DO7 A;  2CG4 A;  4YII A;  2OU2 A;  5BPI A;  2OZU A;  1XB4 A;  5K5Q A;  3ZPL A;  2PBI A;  2Z99 A;  3TOA A;  4A5N A;  5CVU A;  2XAS A;  3ZN1 A;  4EM2 A;  2M30 A;  3HYI A;  3QP6 A;  1TQP A;  2M1B A;  3MWM A;  2K7L A;  3GVA A;  4P9U A;  2RV8 A;  3BY6 A;  2ISY A;  3MCZ A;  4KN7 X;  3F6O A;  4KMF A;  2B0L A;  1IXC A;  1LB2 A;  2UXX A;  1U2W A;  2VOO A;  1HKT A;  1JHH A;  3GW2 A;  1UCR A;  2GIV A;  1EH7 A;  4HBL A;  4HLX A;  2P5L C;  1BJA A;  4AIK A;  4PGH A;  3GF2 A;  1FLI A;  4LK1 F;  3Q9S A;  5JR3 A;  2MLG A;  3KFW X;  4A2U A;  2RKH A;  3F8C A;  1FNN A;  1F1Z A;  1FSE A;  1I27 A;  2PQ8 A;  1WRJ A;  4YIF A;  1ZRF A;  5IT3 A;  4NHJ A;  1B9M A;  3F3X A;  3ZMD A;  4Q4Z F;  3RKW A;  5LGT A;  1ON1 A;  3I5U A;  4KIF A;  4OMY A;  1S6L A;  4IPA A;  4CYD A;  4U7B A;  3C18 A;  3PQJ A;  1AOY A;  3ABU A;  3BJA A;  1YS7 A;  4OIP F;  4L5I A;  5E17 F;  2HTJ A;  3ZN0 A;  3QPH A;  4TV7 A;  3CUQ A;  1J2X A;  4L18 B;  2K86 A;  4S05 A;  1DDN A;  3R0J A;  1RUN A;  1FSH A;  2EA4 A;  1W5S A;  5JFR A;  3HRS A;  1JGS A;  1E17 A;  1WI9 A;  2JT1 A;  1MJA A;  3GX4 X;  3DFG A;  2F5D A;  4OMZ A;  2BGC A;  4ZZL A;  3GYH X;  2YX4 A;  5CYV A;  3WTX C;  1ZGJ A;  2O03 A;  3ZMU A;  5IT9 K;  3G73 A;  3U9G A;  1YTY A;  4N0B A;  1I1S A;  2OD5 A;  1ZAO A;  3DEU A;  3REO A;  3T0Y A;  5D5U B;  1P6R A;  2OAZ A;  3GFM A;  3QAH A;  3J81 Z;  2FML A;  3RIR A;  3TO6 A;  5L3G A;  5FLX K;  3OOP A;  2XAF A;  4IVN A;  5LHI A;  4ZYD A;  1IZ1 A;  5J8F A;  1KQ9 A;  1XCB A;  2HZT A;  3JTH A;  1R36 A;  2VXZ A;  1G3S A;  2DTR A;  1U78 A;  3MZY A;  3IKT A;  5HDK A;  3ERE D;  2JPC A;  5E1W A;  3WG9 A;  3ULQ B;  1ZHF A;  3LQQ A;  3KP6 A;  4P5O A;  2EFW A;  3J81 K;  2FBK A;  3HTS B;  3RDI A;  1O57 A;  1R5G A;  2VON A;  2CO5 A;  3HIF A;  3K1P A;  1BIA A;  1T39 A;  2XIG A;  3GLX A;  3WGH A;  4RAZ A;  4CGZ A;  2FBH A;  3JTG A;  2IRF G;  2H6B A;  2VC0 A;  1R1T A;  3J80 Z;  2BV6 A;  4LMY A;  3EYI A;  3NEU A;  1T98 A;  3BZ6 A;  2O3F A;  4NB5 A;  2QBY B;  2QVO A;  4M9Z A;  2DK8 A;  4XRF A;  5LRR A;  1G4D A;  4AVP A;  4KMU X;  2M5W A;  4MGR A;  4XLN F;  1W7P D;  5AON A;  5FB2 A;  5DD8 A;  4HDU A;  2Q8K A;  3IC7 A;  2L01 A;  1LEA A;  4EJU A;  2Z5U A;  1U5T C;  3J7A O;  1I1G A;  3WTS C;  1J5Y A;  1YW9 A;  4I0B A;  5LHH A;  1D3Y A;  2GA2 A;  4IF4 A;  2X0L A;  4HV6 A;  1UST A;  4GGG A;  5BOX A;  3GZ5 A;  2QEN A;  4U7D A;  3F22 A;  2E7W A;  2A69 F;  4UHT A;  3IRR A;  4B8X A;  1RUO A;  3RJP A;  1J0R A;  2P8T A;  2ESN A;  2LKP A;  4I0A A;  4HX7 A;  1XGM A;  3V7S A;  3MAJ A;  4ESF A;  2HKO A;  1IN4 A;  4ESJ A;  2QQ9 A;  2ISZ A;  2LNB A;  4BHC A;  3V7C A;  3QU3 A;  4AWX B;  1TBX A;  4XBF A;  1P4A A;  3I71 A;  4IRI A;  5F64 A;  3SHF A;  4N9H A;  3TDZ C;  3E97 A;  3FF5 A;  2V9V A;  1ZRC A;  2NRA C;  4ZZD A;  5LRS A;  4BYY A;  1CF7 B;  3KE2 A;  2FF4 A;  2PMH A;  1FC3 A;  1XGS A;  3E6D A;  2XHK A;  2BYV E;  3M1E A;  2KKO A;  1IW7 F;  1IAW A;  2E1N A;  4KUM A;  3P9K A;  3E6M A;  2ACJ A;  3M7G A;  2F5E A;  1O7F A;  1GXP A;  3BPV A;  1U8R A;  2A6E F;  3C3W A;  4IRH A;  4U88 A;  2ZBK A;  2HS5 A;  2IVM A;  1ZG5 A;  3C7J A;  4HAM A;  3VOD A;  4IXA A;  5HS9 A;  4R1H A;  2P5K A;  3WGI A;  1QPM A;  4JQF A;  4LFU A;  4LG0 A;  3KCC A;  3T8T A;  4RGX A;  1L3L A;  5FGM A;  3EDP A;  4H0E A;  2JRT A;  4MEY F;  1P4W A;  4EJW A;  1XSV A;  2V1X A;  2A07 F;  2BEO A;  4KNY A;  1IXR C;  5H6R A;  1B59 A;  1B1B A;  2FRH A;  4XSX F;  4OIR F;  1P4X A;  1VTN C;  1ZRE A;  1QQI A;  2DU9 A;  3LAJ A;  3WGG A;  2PJP A;  4YFX F;  2MLK A;  3K0L A;  4ZYG A;  4KDP A;  4CO8 A;  1L0O C;  1S7A A;  3E6B A;  5D5V B;  4EGZ A;  5LEJ A;  3R60 A;  1BM9 A;  1LEB A;  1ZG1 A;  4GCV A;  1H9T A;  2RDP A;  3HOS A;  2EFP A;  4WWC A;  1J75 A;  3GFI A;  3CUQ B;  4KIG A;  3N97 A;  1FOK A;  2A61 A;  4L9N A;  1U5T A;  2AXL A;  3IWZ A;  4LB5 A;  3ELK A;  1TQM A;  1I6X A;  4OU0 A;  1CGP A;  2KRF A;  4KA4 A;  2VBX A;  2HOE A;  1ZRD A;  1RIO H;  4A0Z A;  1YIO A;  2GQQ A;  1YW7 A;  1B4A A;  1PUE E;  2OQR A;  1SFX A;  1LDJ A;  2CGP A;  2DK5 A;  2HQN A;  2DT5 A;  2VC1 A;  3JSO A;  2CFX A;  3M8F A;  3Q9V A;  3I0T A;  3CO7 C;  4HF1 A;  4WK8 F;  5E1X A;  4U0V A;  3RPU A;  1DPR A;  2ZKZ A;  3RTR A;  3H3Z A;  1YS6 A;  2A68 F;  4WXD A;  5L3B A;  3CLO A;  4YFN F;  3K1M A;  1XDU A;  1KQ8 A;  2P6T A;  3TO9 A;  2FU4 A;  3W6K B;  2YPR A;  1YQA A;  3K69 A;  1OPC A;  1JXS A;  4EM1 A;  2HGC A;  1MJ9 A;  3GEZ A;  5BMZ A;  1J7K A;  3BDD A;  4O5V A;  2ZME A;  3MFK A;  2KJB A;  1HQC A;  2QUF A;  3O3K A;  4EMS A;  2EV6 A;  3FXR A;  3IL2 A;  2NS0 A;  1XGO A;  3WU0 A;  4DNC A;  2D2W A;  4WF2 A;  5ICC A;  1HSJ A;  4WX9 A;  1XDS A;  5JHU A;  4XLP F;  4EJT A;  1FT9 A;  4A0Y A;  2FNA A;  4YFK F;  2P6S A;  2UXN A;  4ENM A;  2O6G E;  5AIP A;  2PN6 A;  1Z1D A;  3FX3 A;  1T38 A;  1ZG3 A;  2VT3 A;  1EV7 A;  3U1D A;  2C6Y A;  4CZZ A;  2FSW A;  1BI3 A;  1W4M A;  3KP7 A;  4BQA A;  1K79 A;  2DLL A;  2PMU A;  4ZH4 F;  2K4B A;  3SXY A;  5DUK A;  3M8E A;  1OKR A;  1U5T B;  1ODD A;  1LQ1 A;  1NHA A;  1KA8 A;  1EH8 A;  1I5Z A;  4P96 A;  4RB2 C;  2DFI A;  2JSC A;  5EEG A;  1O3S A;  2TDX A;  2MC3 A;  5ILV A;  1QNT A;  2XAJ A;  4AIH A;  4ENN A;  1YO5 C;  3G3Z A;  1ULY A;  5E1Z B;  5HS7 A;  3L9F A;  1FX7 A;  1D8J A;  3F8M A;  1PP8 F;  1KQ0 A;  4G7O F;  1J9I A;  3LST A;  2LSO A;  2QBY A;  2XAQ A;  1DUX C;  1S3J A;  1H9G A;  1T6S A;  2OQG A;  1PDN C;  1QBJ A;  3E6C C;  2DQL A;  1R1U A;  3KP3 A;  2PI0 A;  5D4R A;  4HF2 A;  4M6X A;  4BHB A;  1QZZ A;  1K78 B;  4BHP A;  2J5P A;  4I09 A;  1JHF A;  2FOK A;  1MGT A;  2P4W A;  2ZXJ A;  3IKV A;  4M6Y A;  1ZGA A;  1IN6 A;  2IPQ X;  1UHW A;  5ILS A;  4HA8 A;  3F21 A;  4L5J A;  3HSR A;  2NAZ A;  2PLY A;  4RB0 A;  4EVI A;  5TJJ A;  1OYI A;  4HZF A;  2IA2 A;  4D0P A;  3F23 A;  1BOA A;  4A5M A;  3EUH A;  5DUI A;  2XVC A;  4FHT A;  1XD7 A;  4PCQ A;  5BS6 A;  4HQE A;  2EFO A;  2M45 A;  4M72 A;  5D6F A;  4I01 A;  5DV5 A;  4LLN A;  2M8E A;  1G3W A;  4EQQ A;  3BP8 A;  4HX8 A;  5F6F A;  4GYI A;  1WKM A;  4LLG F;  1FYL A;  3RYR A;  2EV5 A;  2FMY A;  2L02 A;  4MNU A;  5CVI A;  1YG2 A;  1OYW A;  5JVT A;  3KET A;  4R8H A;  2DQR A;  2KIU A;  5ERI A;  1R7J A;  1XSX A;  2MH9 A;  4RGU A;  4UXN A;  4G6D A;  1KYW A;  3ML6 A;  1XCV A;  2X4H A;  4P9F A;  3LAP A;  2IA0 A;  3FM3 A;  4HOB A;  1IXS B;  3E5X A;  1YYV A;  2ESH A;  5E20 A;  3NQO A;  3R4K A;  3RPQ A;  3CDH A;  3ROU A;  3HHG A;  4LJZ F;  1Q1H A;  2Y48 A;  2ZME B;  3KZZ A;  2GAU A;  2Z9O A;  4CXF A;  1XGN A;  1SMY F;  1B9N A;  3V8J A;  4RGS A;  5D5X B;  5LEK A;  2YU3 A;  1QGP A;  1ZLK A;  1REP C;  3PFI A;  3WOD F;  5D4S A;  1TW3 A;  1QZY A;  2DPU A;  1XMA A;  3R6S A;  3P9I A;  3WTU C;  4U0Y A;  3BJO A;  5DCM A;  1QO0 D;  1O7L A;  2DW4 A;  4GO1 A;  5FO5 A;  5ICE A;  3TO7 A;  1H0M A;  2ZFW A;  2VBY A;  3JSP A;  2LDU A;  2IA1 A;  3ZMZ A;  1RI7 A;  3K2Z A;  1SFE A;  2GWR A;  2WWY A;  3BOQ A;  3IRQ A;  4UV8 A;  4Q47 A;  1F9N A;  5DCM B;  2EV0 A;  1C0W A;  2HTS A;  3N4M A;  2WC2 A;  3SZP A;  3RYP A;  4M9X A;  5CVR A;  2FNP A;  1FBU A;  4XSZ F;  1S8N A;  2MH2 A;  3B02 A;  5LBQ A;  2VE9 A;  5DDG A;  3LA7 A;  3WTY C;  3U2R A;  4M74 A;  2D1V A;  2OBP A;  4LLL A;  4L9T A;  2CW0 F;  1YW8 A;  4MTE A;  2GXB A;  1Y0U A;  1LJ9 A;  1YLF A;  2ETH A;  1O3Q A;  3V8K A;  4WXH A;  1R22 A;  1BBY A;  4CIC A;  2P7C B;  2QQA A;  2W85 A;  4Y13 A;  4MTD A;  3HRT A;  5E18 F;  4QWQ A;  4Y17 A;  1GXQ A;  3F8N A;  4I2O A;  1O3R A;  3WTZ A;  3K9T A;  3GXO A;  4BXU A;  4E70 A;  2NNY A;  5BPD A;  3T1B A;  3RI4 A;  4OOI A;  2NNN A;  5L3E A;  5LGN A;  4HX4 A;  4KT5 C;  3ABT A;  3MZH A;  2KIF A;  3W6J B;  2XRO A;  4GYG A;  4OIO F;  4FX4 A;  1RNL A;  5LLQ A;  4UVB A;  1TNS A;  4L0Z B;  2XGX A;  1ZAR A;  4M9S A;  2L4M A;  1XMK A;  4L0Y B;  2D45 A;  5J8C A;  2QZ8 A;  1BC8 C;  1T0F A;  1TLH B;  4N9I A;  4GXO A;  3CO6 C;  4IJA A;  4ENJ A;  1R58 A;  3RKX A;  3V4G A;  1Z91 A;  2Y0M A;  2V6C A;  2A5Y B;  1S7O A;  2CSO A;  5ED4 A;  2L3D A;  3CJN A;  2QWW A;  5HLI A;  2V1U A;  2OZ6 A;  3P9C A;  2ZNZ A;  1LDK B;  2QM3 A;  3HSE A;  1K78 A;  4RS8 A;  4I02 A;  5D8K B;  5EEH A;  1T2K A;  2AS5 F;  3V7R A;  1STZ A;  4HV5 A;  3DKW A;  3QP5 A;  1Z7U A;  2RQP A;  2V79 A;  2YSR A;  2RNJ A;  4K2E A;  1LDD A;  5E8G A;  5ICG A;  4O6J A;  3PQK A;  4HLY A;  4MQV A;  2RC4 A;  2HQR A;  3LA2 A;  2MBF A;  2GZW A;  3HSF A;  3KP2 A;  1X3U A;  2V1D A;  1J59 A;  5HDN A;  1D8K A;  2ZNY A;  4A6D A;  1HXD A;  3L7W A;  1FBS A;  3T8R A;  1MDM A;  5DYM A;  3LA3 A;  4IRG A;  5DEQ A;  2VOD A;  6PAX A;  3Q5F A;  1R00 A;  2HR3 A;  1SD4 A;  3CUQ C;  2G9W A;  1TTY A;  2H27 A;  3ZMV A;  4WXC A;  2K4J A;  4S04 A;  3HUG A;  5L3D A;  3KP5 A;  1DPU A;  4CHU A;  4M71 A;  3FZV A;  5D5W B;  1KU2 A;  2ZJ2 A;  2RVC A;  3FWE A;  3BJ6 A;  5F1R A;  1ONV A;  1BC7 C;  5ILU A;  2K27 A;  2DPD A;  2L54 A;  1G6N A;  4KN4 X;  5D6E A;  4B09 A;  1JE8 A;  1GHC A;  5H6Q A;  3J80 K;  4RAY A;  3DPL C;  2F5F A;  3OV8 A;  3KP4 A;  4Z2Y A;  2VT2 A;  1V3F A;  3KLO A;  2BBY A;  4ENK A;  4UVC A;  2H94 A;  1R1V A;  1IN7 A;  3JW4 A;  3F8F A;  2JPB A;  3WU1 B;  2EK5 A;  1DP7 P;  2F5C A;  4AIJ A;  2PG4 A;  3T5X A;  2P5V A;  3HHH A;  1UFM A;  1WWX A;  2XAG A;  3WTT C;  2EJR A;  3O6B B;  5H20 A;  4DQ2 A;  1R5H A;  3KLN A;  3C1D A;  1K7A A;  3VOE A;  4WCG A;  1WSU A;  3HOT A;  1YFH A;  4BNC A;  4ZYH A;  2EA2 A;  1XN7 A;  3FXQ A;  2NYX A;  5IT9 Z;  4Y15 A;  3QOP A;  4ETS A;  2E1C A;  1RZ4 A;  4AD9 A;  1SD5 A;  1G3Y A;  3DQV C;  4ESB A;  2ADU A;  5JI6 A;  3HRU A;  2QLZ A;  3M9A A;  2FXA A;  3R61 A;  3HTU A;  2IT0 A;  1MD0 A;  5K1Y A;  3E5Q A;  3RKY A;  2A6H F;  5FD5 A;  4RB1 A;  4O3M A;  3H3U A;  3BWG A;  1HW1 A;  2DAO A;  2K02 A;  2O61 A;  3TGN A;  1K6O A;  4UUV A;  5HDG A;  1O3T A;  2RN7 A;  1P92 A;  3IHU A;  2L4A A;  1Z9C A;  3FXU A;  1E2X A;  2Z33 A;  3D0S A;  1V4R A;  2F2E A;  1W7P B;  1MDM B;  3GUD A;  4ASN A;  2W24 A;  1FYK A;  3GWZ A;  2MD5 A;  3QU6 A;  4G7H F;  3E3V A;  3R0A A;  1SFU A;  2FBI A;  2HFH A;  1FP1 D;  2GXG A;  4EJO A;  1TW2 A;  1HKQ A;  4L9V A;  2HYG D;  2R7D A;  4HQM A;  3I59 A;  5CLS A;  1F5T A;  3BPX A;  2BE5 F;  3TKY A;  2VBZ A;  5L3F A;  2XRN A;  3ZMS A;  3ZP5 A;  5HLH A;  2LF8 A;  3I58 A;  1U6G A;  5HLG A;  4LB6 B;  1ZLJ A;  2VN2 A;  4KIC A;  3VB2 A;  2D1H A;  1OR7 A;  2E7X A;  3I59 B;  1XSD A;  1IRG A;  5FD6 A;  3NRV A;  5KVR A;  4HYE A;  1FY7 A;  2KIM A;  4UV9 A;  4FX0 A;  2W25 A;  5TRD A;  1W7P A;  3D5L A;  2STW A;  1UHM A;  5AIQ A;  2STT A;  1HKS A;  3HRM A;  3DPT A;  4LGW A;  1A04 A;  3ZQ7 A;  4LD5 A;  1F4K A;  4KIB A;  2Q0O A;  4QLC U;  2LF7 A;  3EET A;  3TDU C;  2GA1 A;  3E5U A;  1IN5 A;  1USS A;  2RGV A;  3GZ6 A;  3P7N A;  1CF7 A;  3H92 A;  3KEQ A;  1OYY A;  1MKM A;  4PZJ A;  5FFX A;  3FMR A;  2CYY A;  1W5T A;  1HW5 A;  4U0W A;  3MEX A;  3FMS A;  4IHT A;  2YR2 A;  1HST A;  1PP7 U;  1Z6R A;  1Z05 A;  1SAX A;  2A3S A;  1P2F A;  2HEO A;  4G94 A;  5HS8 A;  5K5O A;  5A2Q Z;  3F8B A;  4IHS A;  2MA3 A;  2VE8 A;  4G6Q A;  2JZY A;  3GFL A;  1OMI A;  4UVA A;  2HWV A;  2HYF A;  1FPQ A;  4A0X A;  2DBB A;  2EB7 A;  3MQ0 A;  3FM5 A;  1IRF A;  3CUO A;  3L2C A;  1LNW A;  2H6C A;  5A2Q K;  2WTE A;  4RGR A;  1HBX G;  1MZB A;  2ZCW A;  2H09 A;  3GFJ A;  4BH9 A;  2DI3 A;  1HW2 A;  2ZO4 A;  1ZN2 A;  3QPT A;  4I7H A;  4NQW A;  1G3T A;  3DV8 A;  3DXJ F;  4EM0 B;  2PFB A;  3S2W A;  3F6V A;  1FP2 A;  1GVJ A;  5D8L B;  3V8L A;  3JAM K;  2W84 A;  1ON2 A;  3I54 A;  2FQ3 A;  2EWN A;  3VFZ A;  4OIQ F;  1EH6 A;  4CDG A;  1FWZ A;  4ON0 A;  2KJC A;  3L00 A;  1TQI A;  4ZYE A;  3F72 A;  3K1N A;  2UZK A;  3AAF A;  2PEX A;  3KZY A;  2XUB A;  2JTV A;  3SQN A;  1IUY A;  3FMQ A;  1WQ2 A;  2FEZ A;  4JK1 X;  4EGY A;  3IWF A;  3B73 A;  3L09 A;  5FFZ A;  5LHG A;  1TNT A;  2XKP A;  3DP7 A;  4HDV A;  2YX7 A;  3I4P A;  1ZYR F;  3JAM Z;  1KYZ A;  2OA4 A;  4G9Y A;  2FE3 A;  1BI2 A;  1Z6T A;  4PGG A;  4HW0 A;  2IW5 A;  5L3C A;  4LK0 F;  1UB9 A;  3I64 A;  4KFC A;  5E8I A;  2J5O A;  4A6E A;  3QRF F;  5HOO A;  2CWE A;  4Q48 A;  3VEP A;  1R23 A;  2COM A;  4G8X A;  5CVV A;  3EYY A;  3TOB A;  3ZMT A;  2R7F A;  4MEX F;  1S29 A;  2Z3Y A;  1KU3 A;  5CVJ A;  1FBQ A;  4Q5S F;  1BIB A;  4JBA A;  5DD4 A; 
#chains in the Genus database with same CATH topology
 2ZJQ F;  3DCF A;  4RDU A;  3ECH A;  2NVX J;  1S72 I;  2Y9Y A;  4P55 A;  1U3E M;  1K83 J;  1OFC X;  1EF4 A;  2LC2 A;  2O8X A;  4EJV A;  3CJR B;  3OYG A;  1TT0 A;  4RMN A;  1LVA A;  2M87 A;  5KK1 A;  2IAI A;  1FZP B;  4FT8 A;  3WE3 A;  2HKX A;  5GAG J;  2Q2E A;  2G7H A;  1X4O A;  2VQH A;  2VJ4 A;  1B6A A;  1IRZ A;  2BHY A;  3GTK J;  4ITV A;  1BI1 A;  4XN0 A;  1VF9 A;  2K9L A;  1FMV A;  2X6O A;  1YX5 A;  4AC0 A;  3J7Y J;  3ZQL A;  1F36 A;  1WHU A;  2G7U A;  5ICF A;  5HVQ C;  2UWM A;  5DM7 F;  5GPC A;  1VQM I;  4FCY A;  4DJA A;  3CTA A;  2JJ7 A;  2HDC A;  1HA8 A;  1GV2 A;  2VLA A;  1SEU A;  2XAH A;  5FKO A;  3TQN A;  4F7Z A;  3KEO A;  5DCF A;  3IAM 2;  3DF8 A;  2BXZ A;  2DMQ A;  2Y75 A;  3N05 A;  3SFZ A;  2R3S A;  2VBW A;  2EFQ A;  2EZI A;  2LYC A;  2WV0 A;  4RM3 A;  4R79 A;  2R7S A;  3ECO A;  5EEA A;  2VOP A;  2CV0 A;  2DJI A;  3BQZ A;  2CQK A;  1SD7 A;  3S15 J;  4BAY A;  1BI0 A;  3WTW C;  4YG2 F;  5LGU A;  2B63 J;  1ZH5 A;  3WE2 A;  2BY1 A;  3GO5 A;  3SDB A;  2ZB9 A;  3FHN A;  2XKO A;  4RB3 C;  1BN5 A;  2EIJ H;  3K4N A;  2O0Y A;  3EQL F;  4UB8 C;  1V54 H;  4MQ9 F;  2VKH A;  4MHG A;  1KU9 A;  2V26 A;  3S3N A;  3CC4 I;  4F52 A;  1D5V A;  3AL0 B;  1UG2 A;  1IF1 A;  4OIN F;  1SD6 A;  1OJL A;  1VQN I;  1KGS A;  3ISP A;  1IN8 A;  2WB1 A;  3L1P A;  3K4M A;  2P7V B;  2VPR A;  1AWC A;  4DBR A;  2WAQ A;  3FDY A;  4LG0 B;  5J4V A;  3I53 A;  1FYM A;  3SZT A;  4UNO A;  1ZTR A;  2QYO A;  5F0F A;  2IP2 A;  3BRO A;  3MMY B;  4XLC A;  4IZZ A;  5K5R A;  2FA5 A;  4HF0 A;  3FHZ A;  1SMT A;  1U8B A;  4IOA F;  4AID A;  5E3L A;  1POG A;  3D1N I;  2EIM H;  4L9J A;  3O2P E;  2DOE A;  4XR6 A;  3LWF A;  1VZ0 A;  1MMN A;  1Y0N A;  2EFN A;  3COA C;  4A3G J;  3LFK A;  4FIS A;  5J6X A;  5BQT A;  4I98 B;  4ZYA A;  2XV4 S;  2IJL A;  1CQT A;  1I3Q J;  3LQR A;  2XDV A;  4EV0 A;  5CJ9 A;  3WTV C;  4KYW A;  1A5J A;  2W57 A;  2NOG A;  3FXM A;  2ELH A;  1LFU P;  4M73 A;  1JJ6 C;  4PDK A;  1MJB A;  2DA7 A;  1FOW A;  2QQB A;  5J1U A;  4G7Z F;  4MO7 A;  1KU7 A;  3BCA A;  2DFH A;  2E60 A;  4HPQ A;  5IPA A;  5FLX Z;  4A12 A;  3F9K A;  4M3D A;  2V9P A;  2DO7 A;  2R5Z A;  2HOS A;  2CG4 A;  4YII A;  4KIT B;  3B6A A;  3BT9 A;  4E7I A;  2OU2 A;  5BPI A;  2OZU A;  1XB4 A;  2I5U A;  5K5Q A;  5EYR A;  2PBI A;  2Z99 A;  3ZPL A;  3TOA A;  2JK3 A;  4A5N A;  5CVU A;  2XAS A;  3ZN1 A;  3HPG A;  4EM2 A;  1RKT A;  1W0T A;  3QYE A;  3ZR8 X;  2M30 A;  3HYI A;  1A6I A;  3S2H J;  1K4T A;  1HDP A;  4BXF A;  4V19 K;  2R5Z B;  3QP6 A;  1TQP A;  2M1B A;  3MWM A;  3OR1 C;  1TC3 C;  2K7L A;  3GVA A;  4P9U A;  1MMS A;  2X9D A;  2ZFU A;  1IV6 A;  1X1C A;  2RV8 A;  3BY6 A;  5JVG F;  3H0D A;  2ISY A;  4FTH A;  3MCZ A;  1RPW A;  3E1S A;  4KN7 X;  3F6O A;  3RKQ A;  2ME0 A;  4X0G A;  4PFP A;  1G8X A;  2OTL I;  3OYE A;  4KMF A;  1YHQ I;  2B0L A;  2IEK A;  1IXC A;  3Q0V A;  3I55 I;  1LB2 A;  2LH9 A;  3M8J A;  2BW3 A;  2KL4 A;  2CFO A;  4HRI A;  2UXX A;  1SFO J;  1I3A A;  4U87 A;  4ZDL A;  1U2W A;  3L2U A;  2VOO A;  1HKT A;  1OLT A;  3OYD A;  1E3P A;  1JHH A;  1UZC A;  3W2A A;  2CQX A;  3GW2 A;  1UCR A;  2IS4 A;  2GIV A;  2WAD A;  4XRM A;  1EH7 A;  1MH3 A;  3HBL A;  4HBL A;  4XLH A;  4HLX A;  2P5L C;  1BJA A;  4AIK A;  4D1Q A;  4PGH A;  1Z67 A;  3GF2 A;  1FLI A;  3BG7 A;  4XOR A;  4LK1 F;  1UJ8 A;  3Q9S A;  4BUP A;  5JR3 A;  2MLG A;  3KFW X;  4A2U A;  2RKH A;  3FIS A;  3F8C A;  5EG0 A;  1FNN A;  2DMN A;  1F1Z A;  3ZQC A;  1FSE A;  1X2N A;  3BR2 A;  2NVU B;  5KNL A;  3A4C A;  1I27 A;  4B3X A;  5EDN A;  4BEH A;  2O7O A;  2PQ8 A;  3CJT B;  3BR5 A;  1IV8 A;  1U9N A;  1WRJ A;  4DYQ A;  3ZRG A;  4YIF A;  1D1C A;  5IT3 A;  3CCM I;  1RES A;  1ZRF A;  2PJR A;  4NHJ A;  1B9M A;  4F55 A;  3CCR I;  4A93 J;  3BG5 A;  3F3X A;  3ZMD A;  3BTJ A;  2TRT A;  4Q4Z F;  3RKW A;  5LGT A;  3PSI A;  4L5E A;  3S17 J;  3HGG A;  1ON1 A;  5J40 A;  4HG2 A;  3PUB A;  1GLN A;  3I5U A;  4Y7N J;  4C30 A;  4KIF A;  4OMY A;  1S6L A;  2QCO A;  4IPA A;  3OYJ A;  4CYD A;  4U7B A;  3C18 A;  4IHV A;  1IRX A;  3PQJ A;  1AOY A;  3ABU A;  3BJA A;  4BQO A;  4B47 A;  1YS7 A;  5GTH C;  1XTA A;  4AM3 A;  4OIP F;  4L5I A;  5E17 F;  2HTJ A;  4B48 A;  1RET A;  3ZN0 A;  1RR8 C;  3QPH A;  4TV7 A;  1JUM A;  2I8D A;  2PX9 A;  2LR8 A;  1MBG A;  3CUQ A;  2LP0 A;  3PIO F;  1ORK A;  1J2X A;  4L18 B;  2K86 A;  3G1M A;  4S05 A;  1DDN A;  3TBI A;  4IKF A;  3BTL A;  3R0J A;  1RUN A;  1FSH A;  3K4L A;  1UAA A;  2EA4 A;  1W5S A;  3C2H A;  5JFR A;  4CCN A;  2XRL A;  4QPQ A;  3HRS A;  1JGS A;  1E17 A;  1WI9 A;  2JT1 A;  2QEX I;  1MJA A;  2Z2S B;  3GX4 X;  3DFG A;  5E79 C;  2F5D A;  3CDL A;  3FBN B;  4OMZ A;  2BGC A;  1T8I A;  4ZZL A;  3GYH X;  4IQJ A;  2YX4 A;  5CYV A;  3WTX C;  1ZGJ A;  5H2F C;  1YRN A;  1Z3Y A;  2O03 A;  3H9J A;  3DTI A;  4BU2 A;  3J7A Y;  1QRY A;  3ZMU A;  3BC8 A;  5IT9 K;  5B1B H;  3HGY A;  3G73 A;  2IGM A;  4JBA A;  2FD5 A;  2DOD A;  3DKX A;  2BHZ A;  3FXJ A;  1R6R A;  1MBK A;  3U9G A;  4HNU A;  2M7B A;  2R7W A;  1YTY A;  4N0B A;  1I1S A;  3QOE A;  4KJZ A;  2CW7 A;  4E7Z A;  2OD5 A;  1ZAO A;  2DYR H;  1OIS A;  1TWF J;  1APL C;  2W4S A;  3FBI B;  3DEU A;  3REO A;  3T0Y A;  5D5U B;  1P6R A;  4RLF A;  2OAZ A;  4ANJ A;  2L7K A;  2DDA A;  5EG0 B;  2FOW A;  3OIO A;  2XGE A;  3CCU I;  3GFM A;  3OR2 C;  2M8G X;  3F0C A;  3QAH A;  3J81 Z;  4LIV A;  4E7L A;  1FJL A;  2FML A;  3RIR A;  3TO6 A;  3VYT B;  5L3G A;  3CMA I;  3OOP A;  4XNF A;  5FLX K;  2XAF A;  4BDY A;  2M0M A;  4KIS A;  1N25 A;  4YEL A;  3D5R C;  4IVN A;  5LHI A;  1YI2 I;  3VYS B;  4ZYD A;  1IZ1 A;  2ELK A;  1WZ2 A;  5J8F A;  1KQ9 A;  1XCB A;  2HZT A;  3JTH A;  1R36 A;  2VXZ A;  3OS2 A;  1G3S A;  2DTR A;  2M4G A;  1U78 A;  1FOX A;  3MZY A;  5KAF C;  1MBH A;  3QPL A;  3IKT A;  1I50 J;  5HDK A;  3ERE D;  2JPC A;  1I6H J;  3W2V A;  5E1W A;  3WG9 A;  4BQN A;  3ULQ B;  1ZHF A;  3OYM A;  3LQQ A;  5E3N A;  4D7N A;  3KP6 A;  3VYU B;  2ID6 A;  1A35 A;  2GXA A;  9ANT A;  4P5O A;  3K2A A;  2EFW A;  5CPR B;  3J81 K;  2FBK A;  3HTS B;  3RDI A;  1O57 A;  1R5G A;  2VON A;  3OS1 A;  2CO5 A;  3HZJ A;  2L9N A;  1TWC J;  3HIF A;  3K1P A;  1BIA A;  3IP4 B;  1T39 A;  2DMP A;  2XIG A;  3GLX A;  3K10 A;  3WGH A;  4RAZ A;  3JRF A;  1ZEL A;  4BBS J;  4CGZ A;  4BGD A;  2FBH A;  2OCE A;  3JTG A;  2IRF G;  2H6B A;  1Y1W J;  2VC0 A;  1R1T A;  2BV6 A;  1FIA A;  4LMY A;  4B1R A;  3J80 Z;  3EYI A;  3NEU A;  4YIR X;  3HJE A;  1T98 A;  1ETO A;  3BZ6 A;  3JRB A;  4D9J A;  2O3F A;  1P9Q C;  4NB5 A;  2QBY B;  2QVO A;  2KPM A;  4M9Z A;  2DK8 A;  4XRF A;  5LRR A;  4I99 C;  2R7Q A;  1G4D A;  3K4K A;  4AVP A;  4BJ5 C;  2HVR A;  4KMU X;  2K9S A;  4QTR A;  2M5W A;  4MGR A;  4XLN F;  1W7P D;  5AON A;  5FB2 A;  1HCR A;  5DD8 A;  4HDU A;  2Q8K A;  1ETV A;  2LRE A;  5DD4 A;  3IC7 A;  1WJC A;  2L01 A;  4PJN A;  4A3M J;  1LEA A;  4EJU A;  3DLA A;  2Z5U A;  1U5T C;  3CES A;  3J7A O;  3AL0 C;  5TGT A;  1I1G A;  4A3B J;  1TWA J;  3WTS C;  3LOC A;  1J5Y A;  2X48 A;  2EZL A;  1YW9 A;  4I0B A;  5LHH A;  1D3Y A;  2E1O A;  2GA2 A;  4IF4 A;  5EZH A;  2X0L A;  4HV6 A;  3C2G A;  1UST A;  4GGG A;  5BOX A;  3GZ5 A;  2QEN A;  5GAD J;  3MKY B;  4U7D A;  3F22 A;  3S1N J;  1WI3 A;  1W36 D;  3PIP F;  4IO9 F;  2E7W A;  2A69 F;  4UHT A;  3ZQQ A;  3IRR A;  3BTI A;  4B8X A;  1RUO A;  2DA5 A;  3RJP A;  1Y8Q B;  1J0R A;  2P8T A;  3JRD A;  2XB5 A;  1X3W B;  2ZXI A;  2ESN A;  2LKP A;  5HOD A;  4I0A A;  1H89 C;  4BAC A;  4HX7 A;  1XGM A;  2QSF X;  3V7S A;  1GT0 C;  3MAJ A;  4ESF A;  2HKO A;  2QQ8 A;  4NC8 A;  1VQ9 I;  1IN4 A;  3VYR B;  3KEY A;  2JA6 J;  2DA6 A;  4ESJ A;  2QQ9 A;  2UV1 A;  2ISZ A;  2L0K A;  2LNB A;  2KQR A;  4BHC A;  4M3G A;  4A3J J;  3V7C A;  3QU3 A;  4AWX B;  1TBX A;  3MVP A;  4XBF A;  1P4A A;  1NG7 A;  3KX2 A;  3HOY J;  3I71 A;  4M6V A;  4IRI A;  5F64 A;  2DN0 A;  4M3F A;  4N9H A;  3SHF A;  1WVR A;  3OWT A;  1V55 H;  3TDZ C;  1D5Y A;  1MBF A;  3E97 A;  3FF5 A;  2V9V A;  1ZRC A;  2NRA C;  2XPU A;  3IH2 A;  2Y0S N;  3LSJ A;  4X1E A;  1MSE C;  4ZZD A;  1JT0 A;  2IS6 A;  5LRS A;  1WH5 A;  4BYY A;  4XM3 A;  2BOL A;  1CF7 B;  1LKX A;  2R7U A;  1UMQ A;  4JOM A;  3KE2 A;  1ERD A;  2FF4 A;  4XLF A;  1ZR4 A;  2AQF A;  2PMH A;  1FC3 A;  2L7Z A;  1XGS A;  2CH0 A;  3CD6 I;  3E6D A;  2XHK A;  2BYV E;  4XOT A;  1R4M B;  3M1E A;  4HSR A;  3NWS A;  2KKO A;  3HDD A;  4BXX J;  1IW7 F;  1PJR A;  2OV7 A;  2VI6 A;  1JTY A;  1IAW A;  2E1N A;  2R4G A;  4KUM A;  3P9K A;  1VFC A;  3E6M A;  4NBQ A;  2E5N A;  2ACJ A;  3M7G A;  2F5E A;  2ECB A;  3SEQ A;  1O7F A;  1UG0 A;  1GXP A;  1G59 A;  3BPV A;  1YJW I;  1U8R A;  5JHF A;  1Z0X A;  2A6E F;  5DM6 F;  3C3W A;  3VWB A;  4IRH A;  3HOU J;  1Z77 A;  3ZCO A;  1JKR C;  4U88 A;  2ZBK A;  2HS5 A;  2IVM A;  1ZG5 A;  3C7J A;  4HAM A;  4A3F J;  3VOD A;  4IXA A;  1HC8 A;  1X3Z B;  5HS9 A;  4R1H A;  3ONQ A;  2P5K A;  2X6Y A;  4IQ4 A;  4YEJ A;  3WGI A;  3OYF A;  1QPM A;  2HXO A;  5J3L A;  4JQF A;  4LFU A;  4LG0 A;  1Y39 A;  4H4K C;  2DMT A;  1OCT C;  1DU6 A;  1SC7 A;  3KCC A;  2IS2 A;  3T8T A;  2KHM A;  4RGX A;  1L3L A;  3MKL A;  5FGM A;  3EDP A;  4H0E A;  4DZJ A;  4A3I J;  2JRT A;  4MEY F;  1BR2 A;  1P4W A;  1IG7 A;  4EJW A;  1E3H A;  1TZL A;  1XX5 A;  5EF6 A;  2M2E A;  1XSV A;  3ABK H;  4GDF A;  3CCV I;  2V1X A;  1XPX A;  2AO9 A;  1BW5 A;  2A07 F;  4ZTF A;  2BEO A;  2ID3 A;  4KNY A;  1IXR C;  5H6R A;  1U9O A;  1B59 A;  1B1B A;  2FRH A;  2DA4 A;  4XSX F;  3RPU D;  4OIR F;  4JYK A;  1P4X A;  3CP2 A;  1VTN C;  3RSN A;  2BY0 A;  2E36 A;  4HNT A;  3Q0U A;  1ZRE A;  3KYL A;  1QQI A;  4RA2 A;  2DU9 A;  3BQY A;  3LAJ A;  3WGG A;  2PJP A;  1H88 C;  4YFX F;  2JA5 J;  3H3V K;  2MLK A;  3K0L A;  4ZYG A;  3G1L A;  2R5Y B;  4KDP A;  4CO8 A;  1L0O C;  2VL8 A;  1S7A A;  3E6B A;  3L2W A;  3G71 I;  2K3F A;  5D5V B;  2GIZ A;  3E7L A;  5LEJ A;  4EGZ A;  1B72 B;  3M4O J;  3R60 A;  3I9V 2;  4XLA A;  1BM9 A;  1LUJ B;  3PO2 J;  1LEB A;  3D5S C;  1ZG1 A;  4GCV A;  1S9H A;  5IP9 J;  1JUP A;  1H9T A;  2RDP A;  3HOS A;  2EFP A;  4WWC A;  3BZK A;  1J75 A;  3GFI A;  1MND A;  3CUQ B;  2DDB A;  3ESW B;  4KIG A;  2KDZ A;  3N97 A;  2ECC A;  2XGD A;  1QU3 A;  1FOK A;  2A61 A;  3S1M J;  4L9N A;  4DIQ A;  1U5T A;  2AXL A;  3H5R A;  3IWZ A;  4F3Q A;  4LB5 A;  3K70 D;  1BOB A;  5LD2 C;  5K7H A;  3ELK A;  3GLL A;  1TQM A;  1I6X A;  4OU0 A;  2BY3 A;  1CGP A;  3A0H C;  1P7I A;  2KRF A;  4KA4 A;  4FET A;  2VBX A;  4YRV A;  2R7O A;  2HOE A;  1J09 A;  2TCT A;  3DWL E;  5IOZ A;  1ETY A;  4A0Z A;  3OYC A;  1YIO A;  1RIO H;  1ZRD A;  3FXK A;  3PM1 A;  3HOX J;  2GQQ A;  1YW7 A;  2W82 A;  2EIL H;  1B4A A;  3NWT A;  1PUE E;  3S1R J;  3CCJ I;  2OQR A;  1SFX A;  5HNH A;  5IYB J;  1LDJ A;  3ZOB A;  2CJJ A;  3M07 A;  2CGP A;  4BBR J;  2DK5 A;  2HQN A;  2DT5 A;  2VC1 A;  1MH4 A;  3JSO A;  3DEW A;  2CFX A;  3M8F A;  3Q9V A;  2HDW A;  2M3A A;  3I0T A;  5KAI C;  3CO7 C;  2QF7 A;  2ME6 A;  1NH3 A;  2Y2Z A;  4HF1 A;  4WK8 F;  2IGN A;  2GOX B;  5E1X A;  4U0V A;  2EQR A;  3RPU A;  3WHC A;  3SYT A;  3HB9 A;  1DPR A;  1X58 A;  2ZKZ A;  2ZXH A;  4C9Y A;  3RTR A;  1BW6 A;  1YS6 A;  2A68 F;  3H3Z A;  4WXD A;  5L3B A;  4C2U A;  3CLO A;  4YFN F;  1OR7 C;  3OIP A;  3K1M A;  1IDY A;  1XDU A;  1KQ8 A;  3GTJ J;  2LVS A;  2CW8 A;  2P6T A;  3TO9 A;  2FU4 A;  4BQQ A;  5C4X J;  3W6K B;  4AUX A;  2YPR A;  1YQA A;  3JRI A;  3HEF A;  2OUM A;  3K69 A;  1NG6 A;  1OPC A;  4I76 A;  2JWT A;  2HVS A;  4AYB A;  2YU9 J;  1JXS A;  2OC6 A;  4EM1 A;  2HGC A;  1MJ9 A;  3GEZ A;  5BMZ A;  1J7K A;  1HLV A;  3AG1 H;  3BDD A;  1N78 A;  4O5V A;  3BG3 A;  1AHD P;  1JKO C;  3DBH B;  4PJM A;  2ZME A;  1X1P A;  3MFK A;  2KJB A;  5GAE J;  4IX7 A;  2LG4 A;  1OCZ H;  1HQC A;  4UB6 C;  1WPK A;  4Y33 A;  2QUF A;  4PUS A;  4XKV A;  3UR3 C;  3O3K A;  2W48 A;  4EMS A;  1WJ5 A;  2E35 A;  2HOA A;  2EV6 A;  3FXR A;  4AU7 A;  3JRC A;  3IL2 A;  3OS0 A;  2NS0 A;  1XGO A;  2IGO A;  3WU0 A;  2D2W A;  4DNC A;  3FKI J;  2OTJ I;  2JMW A;  4WF2 A;  1NTC A;  5ICC A;  4Y4R A;  1HSJ A;  4CYC B;  4WX9 A;  4BDZ A;  1XDS A;  2E5Z A;  5JHU A;  4XLP F;  4EJT A;  2XC7 A;  3OSF A;  2Z1D A;  1UEL B;  1FT9 A;  2FJ1 A;  4IHY A;  4A0Y A;  2FNA A;  2WBM A;  2JA7 J;  4YFK F;  2P6S A;  2UXN A;  1PVE A;  3ZGK A;  4ENM A;  2O6G E;  5AIP A;  3OYK A;  1MBE A;  2W1O A;  2LKS A;  2PN6 A;  4EAT A;  1Z1D A;  3FX3 A;  1T38 A;  1ZG3 A;  2VT3 A;  1QVU A;  2IBD A;  1IGN A;  2MW8 A;  1EV7 A;  4DOZ A;  3KZI C;  3AKZ A;  3U1D A;  3UKG A;  2C6Y A;  4CZZ A;  2VJI A;  2FSW A;  1BI3 A;  1R4N B;  2AQE A;  1Y56 A;  2JA2 A;  2V7F A;  1W4M A;  3KP7 A;  4BQA A;  1K79 A;  3GTP J;  1V5G A;  2DLL A;  2PMU A;  4CH7 A;  1VQ6 I;  4ZH4 F;  2K4B A;  5F0H A;  3SXY A;  5DUK A;  2R7X A;  3M8E A;  1OKR A;  5IOY A;  1U5T B;  1ODD A;  2ZME C;  1LQ1 A;  1NHA A;  1KA8 A;  1W5C C;  2R5Y A;  1EH8 A;  5B1A H;  1I5Z A;  5BNG A;  1FOY A;  4P96 A;  4RB2 C;  4MIM A;  2DFI A;  3PO3 J;  2JSC A;  5EEG A;  3JRG A;  1O3S A;  2OPT A;  2TDX A;  2MC3 A;  5ILV A;  2H8W A;  2F5V A;  4G12 A;  2X51 A;  1QNT A;  2XAJ A;  1SVO A;  4AIH A;  4ENN A;  1YO5 C;  2IS1 A;  3G3Z A;  1ULY A;  5E1Z B;  5HS7 A;  3L9F A;  1FX7 A;  1GVD A;  3CZ6 A;  1D8J A;  3F8M A;  1PP8 F;  1KQ0 A;  5CKT A;  4G7O F;  4RM2 A;  2BY2 A;  3OY9 A;  4CZC A;  3A0B C;  2UUZ A;  3VPR A;  4Z6Y A;  1J9I A;  3LST A;  4C2M J;  3DKY A;  3X2Q H;  3O8H A;  2ICW G;  1TWH J;  2LSO A;  2QBY A;  2XAQ A;  1DUX C;  1S3J A;  1H9G A;  5LFA A;  1H8A C;  4MFD A;  1T6S A;  5B3S H;  2OQG A;  1EA3 A;  1VQP I;  1OQY A;  4J01 A;  1PDN C;  2M9H A;  2DMU A;  1OCP A;  4XL9 A;  3LFU A;  1QBJ A;  3E6C C;  2DQL A;  1R1U A;  3G2B A;  1Y1V J;  2HQ5 A;  3KP3 A;  4CYC A;  2PI0 A;  3S32 A;  5D4R A;  1AKH A;  4HF2 A;  2F6C A;  4IL6 C;  3W6V A;  3H9Q A;  3H0G J;  2Y9Z A;  4M6X A;  4BHB A;  2EIK H;  1QZZ A;  4RAG A;  4UUS A;  2EBI A;  1K78 B;  4BHP A;  2J5P A;  4FAS D;  2EIN H;  4I09 A;  3HPH A;  1JHF A;  4QSH A;  1Y6I A;  2FOK A;  4E6K G;  2RNG A;  1MGT A;  2P4W A;  1LE8 B;  2ZXJ A;  3DPU A;  3ZQI A;  5M3M J;  3AG4 H;  4N4O B;  3IKV A;  2KMU A;  4M6Y A;  1ZGA A;  1IN6 A;  2IPQ X;  1UHW A;  2HPI A;  3FIW A;  4HA8 A;  1BJZ A;  5ILS A;  3EUH C;  3A01 B;  3F21 A;  4L5J A;  2E2H J;  2R93 J;  3HSR A;  1FTT A;  2NAZ A;  2PLY A;  4A3L J;  2GLO A;  4RB0 A;  4EVI A;  1JTX A;  5TJJ A;  1OYI A;  4HZF A;  5FRM A;  3ABL H;  2IA2 A;  1RRJ A;  4D0P A;  3F23 A;  2MC4 A;  3OL4 A;  3CLQ A;  1BOA A;  4A5M A;  3EUH A;  5KCM A;  5DUI A;  2NS7 A;  2Q1Z B;  2VPL A;  1OCC H;  3H9G A;  2WA0 A;  1F43 A;  2XVC A;  2E19 A;  4FHT A;  1XD7 A;  1WJE A;  4PCQ A;  3LL7 A;  2LY9 A;  5BS6 A;  4HQE A;  2EFO A;  3RZD J;  3JR9 A;  2M45 A;  4M72 A;  5D6F A;  5CQG A;  4I01 A;  4AYB N;  3CMY A;  1T33 A;  5DV5 A;  4LLN A;  2M8E A;  1G3W A;  4EQQ A;  4N4N B;  3BP8 A;  1T0F C;  4HX8 A;  5F6F A;  1VQ8 I;  4GYI A;  3S14 J;  5GAH J;  4XK4 A;  3HKZ N;  5J1R A;  1WKM A;  1IJW C;  3Q0W A;  3LSG A;  4FE4 A;  3FXL A;  3LMM A;  4LLG F;  1A6Q A;  4Y3O A;  1FYL A;  1IDZ A;  2L7M P;  3RYR A;  1YE9 A;  2EV5 A;  2FMY A;  2L02 A;  4C2T A;  4MNU A;  3PNT A;  2Y31 A;  5CVI A;  1YG2 A;  1OYW A;  1QHG A;  3GZN B;  3H5N A;  1AKH B;  2JA8 J;  5JVT A;  4QPO A;  3KET A;  1QVT A;  2I10 A;  2DQR A;  4R8H A;  2A5W A;  2L2O A;  4A3C J;  3S93 A;  4XON A;  2KIU A;  3RQI A;  5ERI A;  1LFB A;  3GBG A;  1R7J A;  2M34 A;  1XSX A;  2MH9 A;  1K6Y A;  3BR3 A;  4RGU A;  4ZTJ A;  2PJR B;  4UXN A;  1MNM C;  2JUC A;  4C3H J;  2P81 A;  4G6D A;  1KYW A;  2EPF A;  3ML6 A;  3S1Q J;  3MD2 A;  1XCV A;  2X4H A;  4P9F A;  3LAP A;  2IA0 A;  3FM3 A;  4HOB A;  1HF0 A;  1IXS B;  1VQ5 I;  3E5X A;  4II3 A;  2LBF B;  1YYV A;  2ESH A;  5E20 A;  2VIX A;  3NQO A;  3R4K A;  5F0C A;  1TT5 B;  1X1D A;  3RPQ A;  3GTL J;  4II2 A;  2RQQ A;  4NC6 A;  3GTQ J;  2WV1 A;  2JVG A;  2NVT J;  3CDH A;  3ROU A;  2M4K A;  4OWR B;  3HHG A;  3SEZ A;  4LJZ F;  1LVK A;  1T08 B;  1SVM A;  1IC8 A;  1Q1H A;  2Y48 A;  2ZME B;  2HYJ A;  3KZZ A;  2V1N A;  3EPZ A;  2GAU A;  3NAU A;  4E7S A;  2Z9O A;  4CXF A;  1YX3 A;  2WAE A;  5IP6 A;  1XGN A;  1SMY F;  1B9N A;  3V8J A;  3KYD B;  4RGS A;  2CUE A;  4E7J A;  5D5X B;  2FX0 A;  1YOV B;  5LEK A;  5EGO A;  2YU3 A;  1E0E A;  4CCK A;  4F93 B;  1QGP A;  1YJN I;  1QPI A;  3K70 C;  1ZLK A;  1REP C;  2HZD A;  3DEE A;  3PFI A;  3CMM A;  3WOD F;  3PNY A;  2JVH A;  2N8G A;  5D4S A;  3HM5 A;  1TW3 A;  2RRE A;  1QZY A;  3DBL B;  3QWL A;  3OOU A;  2DPU A;  1ZK8 A;  1XMA A;  2VKD A;  3ERM A;  3R6S A;  3P9I A;  4XMY A;  3WTU C;  3SDG A;  4U0Y A;  3BJO A;  3I4M J;  5DCM A;  3BLY A;  1QO0 D;  1O7L A;  2DW4 A;  4GO1 A;  1BL0 A;  1JI8 A;  5FO5 A;  1TL8 A;  3HL2 A;  2F4O B;  2DT6 A;  5ICE A;  3U21 A;  3TO7 A;  2GBY A;  3I4N J;  1H0M A;  1RR7 A;  2ZFW A;  2PMZ N;  1MSF C;  1LE8 A;  2VBY A;  3JSP A;  2LDU A;  2IA1 A;  3ABM H;  3BCB A;  3ZMZ A;  2IXS A;  4E7H A;  5GTI C;  1RI7 A;  3K6G A;  3DTK A;  4NDL A;  3K2Z A;  1SFE A;  2GWR A;  2CRG A;  4J00 A;  2WWY A;  1PUF B;  3CCY A;  2ZSH B;  1ZKG A;  3BOQ A;  3CME I;  3IRQ A;  4UV8 A;  3L2V A;  3M1C A;  4Q47 A;  5FKM A;  5M5X J;  1XS9 A;  4BY1 J;  4B3A A;  1F9N A;  5DCM B;  2EV0 A;  2BVL A;  4X6A J;  3A1Y A;  1C0W A;  2HTS A;  3N4M A;  1B8I B;  3GTO J;  2WC2 A;  5IY5 H;  1I39 A;  3S8P A;  4XOP A;  2E34 A;  3SZP A;  3RYP A;  3S2D J;  4C3J J;  1ETW A;  2V9K A;  4M9X A;  5CVR A;  2FNP A;  1FBU A;  4XSZ F;  1S8N A;  2F4I A;  2MH2 A;  3B02 A;  5LBQ A;  2VE9 A;  5DDG A;  1ETQ A;  3LA7 A;  3WTY C;  3U2R A;  2HU9 A;  4M74 A;  2D1V A;  2OBP A;  1EJ9 A;  1JKQ C;  4GFB A;  2VQG A;  2E1M B;  4LLL A;  4BS9 A;  3FXO A;  2K3P A;  4L9T A;  2CW0 F;  1YW8 A;  4MTE A;  2ZJR F;  2GXB A;  1Y0U A;  1LJ9 A;  1YLF A;  2JUG A;  5F27 A;  2ETH A;  3KIO A;  3OYB A;  1O3Q A;  3V8K A;  2XB0 X;  4WXH A;  1R22 A;  1BBY A;  2DYS H;  4V2G A;  4CIC A;  2QQA A;  2W85 A;  3FK6 A;  4BY7 J;  4Y13 A;  5B5E C;  4MTD A;  3HRT A;  4IHX A;  1BR4 A;  3B6C A;  5E18 F;  4QWQ A;  4Y17 A;  2H8R A;  1GXQ A;  5FRN A;  2K9M A;  3F8N A;  4I2O A;  1O3R A;  3WTZ A;  5HNF A;  1MMD A;  3VSK A;  3K9T A;  3GXO A;  4BXU A;  4E70 A;  4ZC3 A;  1JKP C;  2NNY A;  5BPD A;  3T1B A;  4MLO A;  3RI4 A;  1VND A;  4OOI A;  2QSG X;  2KIQ A;  2NNN A;  4J19 A;  3GTG J;  5L3E A;  1NK3 P;  2CV2 A;  5LGN A;  4HX4 A;  3HOZ J;  1ETX A;  4KT5 C;  3ABT A;  5C44 J;  3MZH A;  3S3O A;  3KYC B;  5DTD A;  2KIF A;  3W6J B;  2XRO A;  3TW7 A;  1V5E A;  4GYG A;  4JX5 A;  2DOF A;  4OIO F;  1U0J A;  4FX4 A;  1RNL A;  1D0Y A;  4DYC A;  2K9Q A;  3C2B A;  5LLQ A;  4UVB A;  1TNS A;  4LG3 A;  4L0Z B;  2XGX A;  2Y69 H;  1ZAR A;  2DT7 B;  4M9S A;  1TWG J;  2YS9 A;  1M1E B;  1D0X A;  2M0C A;  2L4M A;  3S3M A;  4DZP A;  1XMK A;  4L0Y B;  3A2K A;  2D45 A;  5J8C A;  2QZ8 A;  1BC8 C;  1T0F A;  4IEJ A;  1TLH B;  1Q1V A;  1XG1 A;  4N9I A;  1XMX A;  3DTE A;  4XKC A;  4GXO A;  3CO6 C;  4IJA A;  4ENJ A;  1R58 A;  2MAB A;  3QQA A;  3EUA A;  3IH4 A;  2CQQ A;  5JLW A;  1JGG A;  3RKX A;  3V4G A;  1Z91 A;  2Y0M A;  3A02 A;  4S0H B;  2V6C A;  2A5Y B;  3ZQF A;  1YJ9 I;  1S7O A;  2CSO A;  5ED4 A;  2L3D A;  3CJN A;  2QWW A;  2X6W A;  2ZSI B;  4GRI A;  3M3Y J;  5M3F J;  3E0J B;  3BR1 A;  5HLI A;  2V1U A;  3WHB A;  2R7R A;  2OZ6 A;  3P9C A;  3TW6 A;  2ZNZ A;  1LDK B;  4UUT A;  3S16 J;  2HNH A;  4BE1 A;  4G6T B;  2QM3 A;  3HSE A;  1K78 A;  4RS8 A;  4I02 A;  3L2R A;  5D8K B;  5EEH A;  1T2K A;  3AG2 H;  5CQE A;  2AS5 F;  1DGW Y;  3V7R A;  2MG4 A;  1STZ A;  2DJN A;  1QZE A;  1O4X A;  2CMP A;  4UY8 I;  4HV5 A;  3DKW A;  2LK2 A;  3ZQH A;  3QP5 A;  5J1Y A;  4XRS A;  1S7E A;  1Z7U A;  2RQP A;  2CQ7 A;  2V79 A;  2YSR A;  2Z16 A;  2RNJ A;  2MYS A;  4Y52 J;  4K2E A;  1LDD A;  5E8G A;  2KZV A;  5ICG A;  1X4P A;  4O6J A;  1W36 C;  3LSH A;  3PQK A;  3LSI A;  2O9L A;  3PUF A;  3RCO A;  4HLY A;  4BE0 A;  4MQV A;  2K5C A;  2RC4 A;  2HQR A;  3LA2 A;  2MBF A;  2GZW A;  3LSK A;  3HSF A;  3KP2 A;  2EZK A;  3CCE I;  1VQK I;  1Y8R B;  3CCL I;  2E2J J;  1X3U A;  2V1D A;  2DTZ A;  5E3O A;  4B44 A;  1X19 A;  2NOJ B;  1P7J A;  2K40 A;  2HXI A;  1J59 A;  5HDN A;  1D8K A;  2ZNY A;  4PJJ A;  4A6D A;  2A05 A;  5DS9 A;  1HXD A;  3L7W A;  2DXI A;  2V6E A;  1FBS A;  3GTM J;  2KRC A;  3T8R A;  1W0U A;  1MDM A;  2D5V A;  5DYM A;  3PL8 A;  3LA3 A;  4IRG A;  5DEQ A;  2VOD A;  4MFE A;  6PAX A;  1S5L C;  3Q5F A;  1R00 A;  2WY8 Q;  4XLE A;  2K85 A;  4XN3 A;  3QPS A;  2HR3 A;  1SD4 A;  3CUQ C;  1ZR2 A;  2G9W A;  1TTY A;  3PSF A;  3MKW B;  2H27 A;  2LTP A;  1SAU A;  4M3B A;  3ZMV A;  1UHS A;  4WXC A;  1A36 A;  2K4J A;  2WAF A;  4S04 A;  3HUG A;  5IP7 J;  1Z3X A;  5L3D A;  3QOD A;  2BVM A;  3KP5 A;  4F92 B;  3CP8 A;  1DPU A;  1R5I D;  4CHU A;  4M71 A;  3O8G A;  1V5F A;  3FZV A;  3G4S I;  5D5W B;  1KU2 A;  2HDD A;  3AG3 H;  2ZJ2 A;  3WG7 H;  5FRO A;  4HEA 2;  4D5C A;  4HNV A;  2NVY J;  2RVC A;  2MGQ A;  3FWE A;  5EJC A;  1RC9 A;  1FIP A;  4XRS G;  2JRM A;  3BJ6 A;  5F1R A;  1PUF A;  1ONV A;  2B7E A;  1BC7 C;  5ILU A;  2K27 A;  2DPD A;  2L54 A;  1G6N A;  4KN4 X;  5D6E A;  5F04 A;  5FKN A;  4B09 A;  1JE8 A;  1GHC A;  5H6Q A;  4P1W A;  4RBO A;  3J80 K;  2MFZ A;  4RAY A;  3DPL C;  4DW6 A;  2F5F A;  2OCC H;  3OV8 A;  2X1E A;  3KP4 A;  3VSL A;  1K61 A;  1ZGW A;  4Z2Y A;  2R0Q C;  1GUU A;  2VT2 A;  3LSR A;  2GM4 A;  1V3F A;  3QYB A;  1WJB A;  3KLO A;  2BBY A;  3JRE A;  4ENK A;  2P7C B;  4LIU A;  3HC7 A;  4UVC A;  2G0E A;  4D7M A;  2H94 A;  2BZT A;  4ABZ A;  1E3O C;  3JCU C;  1R1V A;  1VQ7 I;  1IN7 A;  3HUG B;  1YIJ I;  3JW4 A;  3F8F A;  2JPB A;  3LSP A;  3FK7 A;  1VQ4 I;  3WU1 B;  2EK5 A;  4PSX A;  1DP7 P;  2F5C A;  4AIJ A;  2NVQ J;  2PG4 A;  2CUZ A;  3T5X A;  2P5V A;  3RQ4 A;  3K4C A;  3MN2 A;  3HHH A;  2R92 J;  1UFM A;  2YUS A;  1WWX A;  2XAG A;  3WTT C;  2EJR A;  3O6B B;  1MMA A;  2B9S A;  2KRH A;  2LLK A;  5H20 A;  4XKB A;  4DQ2 A;  2Y30 A;  3HXL A;  3OMY A;  1R5H A;  3IH3 A;  3C1D A;  3KLN A;  3VOE A;  4WCG A;  1K7A A;  1WSU A;  3HOT A;  1YFH A;  1PYV A;  4ZYH A;  2EA2 A;  4BNC A;  1XN7 A;  3FXQ A;  2NYX A;  2VJJ A;  5B66 C;  1RKW A;  5IT9 Z;  2VKV A;  4Y15 A;  3QOP A;  4ZDP A;  4ETS A;  3LSM A;  2DFE A;  3LNQ A;  2E1C A;  1RZ4 A;  2O5R A;  5J4Y A;  2QSH X;  5FKK A;  3OYA A;  4LOC A;  4NQW B;  4PSW A;  5FKL A;  3MKZ A;  2QA4 I;  3TL4 X;  5FLV A;  4AD9 A;  1SD5 A;  1G3Y A;  1YRN B;  4B4C A;  4NUB A;  1X1A A;  3DQV C;  2XSJ C;  1D1A A;  2ADU A;  4ESB A;  5JI6 A;  3HRU A;  4BEH B;  2HI3 A;  4BL0 B;  2QLZ A;  3DU6 A;  3M9A A;  2FXA A;  2VQC A;  3R61 A;  3HTU A;  5F1J A;  2IT0 A;  1MD0 A;  2LOO A;  2DFF A;  5K1Y A;  1R9T J;  2KFD A;  3E5Q A;  4RAF A;  3RKY A;  3CF2 A;  3HG9 A;  2A6H F;  5FD5 A;  3CJQ B;  3WU2 C;  4RB1 A;  4O3M A;  4BJT A;  2FUG 2;  3H3U A;  1Z21 A;  3Q3S A;  3BWG A;  1HW1 A;  2DAO A;  1BR1 A;  1IO2 A;  2ZC2 A;  2K02 A;  3EUK L;  2LMD A;  3HOW J;  2O61 A;  3TGN A;  2WB1 N;  4E4H A;  2HOT A;  1K6O A;  4UUV A;  3JRH A;  5HDG A;  3PFY A;  1O3T A;  2FQ4 A;  1P92 A;  2RN7 A;  2KZG A;  4XIC A;  3IHU A;  2L4A A;  1Z9C A;  2QKL B;  3FXU A;  3W2W A;  2JQ7 A;  1E2X A;  5HLT A;  2Z33 A;  3D0S A;  1V4R A;  2F2E A;  3OYN A;  2NXN B;  4OAY A;  1W7P B;  3FKJ A;  4LIT A;  1MDM B;  3GUD A;  4ASN A;  4F91 B;  1R71 A;  2W24 A;  1JT6 A;  5KHD A;  1FYK A;  3CC2 I;  2CUJ A;  3GWZ A;  2VJ5 A;  3G1O A;  1MW7 A;  2MD5 A;  2X85 A;  3U1K A;  1HOM A;  3QU6 A;  4BE2 A;  4G7H F;  2XF7 A;  3E3V A;  5E3M A;  3SJM A;  3ZXS A;  1MBJ A;  5K7Z A;  1TP4 A;  3BR0 A;  3R0A A;  1SFU A;  1SVL A;  1AU7 A;  3H35 A;  2DOA A;  2FBI A;  2HFH A;  1FP1 D;  2GXG A;  4CSW A;  4EJO A;  1TW2 A;  1LFP A;  2XF6 A;  2L9R A;  3OYH A;  1KON A;  3K4B A;  5M5Y J;  1HKQ A;  4CCL A;  1D0Z A;  4L9V A;  3DU5 A;  2HYG D;  2R7D A;  3KPH A;  1GV5 A;  3I59 A;  4HQM A;  5J47 A;  5CLS A;  1F5T A;  3BPX A;  2LBF A;  2BE5 F;  3TKY A;  2VBZ A;  5L3F A;  2O8K A;  2XRN A;  2PMZ A;  2L9V A;  4KT6 A;  4D5F A;  3ZMS A;  3ZP5 A;  1MNE A;  2VUM J;  2P0W A;  1FTZ A;  1WJA A;  5HLH A;  2LF8 A;  2ZJP F;  3SFI A;  3I58 A;  1U6G A;  4CCJ A;  5HLG A;  3RZO J;  2CUF A;  4LB6 B;  1ZLJ A;  1DU0 A;  2VN2 A;  4W1U A;  4KIC A;  4PK4 A;  3VB2 A;  1WH7 A;  2XPW A;  1MIJ A;  2D1H A;  1OR7 A;  2E7X A;  4ZJZ A;  3I59 B;  5TIS C;  2V4J C;  4E7K A;  1FMW A;  1XSD A;  4JP0 A;  2LKX A;  2R7T A;  2KDO A;  4DYR A;  1IRG A;  5FD6 A;  3NRV A;  5KVR A;  4HYE A;  1VI0 A;  3MZ8 A;  1FY7 A;  2KIM A;  2X6X A;  2LY2 A;  4OAZ A;  3OSG A;  4PFO A;  4UV9 A;  4FX0 A;  2W25 A;  3CF5 F;  1W7P A;  3TP0 A;  5TRD A;  3D5L A;  2STW A;  3CC7 I;  1UHM A;  5AIQ A;  3GME A;  2XSD C;  2STT A;  4BJ6 C;  1HKS A;  3HRM A;  3DPT A;  3OYL A;  4LGW A;  5GPA A;  2L9S A;  1A04 A;  1ENH A;  2AXT C;  2DA3 A;  3ZQ7 A;  3CCS I;  4LD5 A;  1F4K A;  4KIB A;  1T56 A;  2Q0O A;  3NAR A;  3V42 A;  3IAS 2;  4I6Z A;  4QLC U;  3I56 I;  2LF7 A;  3EET A;  3TDU C;  2XAU A;  2HPM A;  2GA1 A;  1K4S A;  3E5U A;  1IN5 A;  1USS A;  2RGV A;  4IOC F;  3GZ6 A;  2WAQ N;  3HOV J;  2OF7 A;  3P7N A;  4EEF G;  1CF7 A;  3K4J A;  3H92 A;  2RAE A;  3KEQ A;  1OYY A;  1MKM A;  2VXD A;  4PZJ A;  5FFX A;  3FMR A;  2CYY A;  3G6E I;  1W5T A;  1HW5 A;  1XC5 A;  4U0W A;  4A3E J;  2WY7 Q;  3MEX A;  3FMS A;  4CA0 A;  4IHT A;  2YR2 A;  1HST A;  3IV5 A;  2EZH A;  1PP7 U;  2HVQ A;  4XQF A;  1Z6R A;  4A3K J;  1Z05 A;  2CQN A;  2R7V A;  1SAX A;  2A3S A;  2VAS A;  1P2F A;  2HEO A;  4G94 A;  5HS8 A;  4QIW N;  5K5O A;  1ACI A;  5A2Q Z;  3F8B A;  1OCR H;  1N77 A;  3P5J A;  3BZC A;  4IHS A;  2AHQ A;  2K9N A;  4ZDO A;  2MA3 A;  4M3E A;  2VE8 A;  1Z7L A;  4G6Q A;  2CU7 A;  2JZY A;  1AA7 A;  1LPQ A;  3GFL A;  1HDD C;  1BA5 A;  2H1K A;  1OMI A;  4UVA A;  1FEX A;  2HWV A;  4V2F A;  1B72 A;  3TED A;  1WCM J;  2DCE A;  3OYI A;  1A31 A;  3BG9 A;  2BXY A;  2HYF A;  1FPQ A;  3H1C A;  3OIQ A;  2KLO A;  2VB6 A;  2W00 A;  3J7Z I;  4JX4 A;  4A0X A;  2DBB A;  2EB7 A;  4CCM A;  3MQ0 A;  3FM5 A;  3BTC A;  4XKW A;  1IRF A;  3CUO A;  2LD5 A;  2F4M B;  1ZQ3 P;  5C4J J;  2Q2E B;  2HQA A;  5F08 A;  3L2C A;  1LNW A;  2H6C A;  5A2Q K;  4PJ0 C;  2WTE A;  4NC7 A;  1DQU A;  4RGR A;  1GDT A;  1HBX G;  3PNV A;  4B43 A;  3ZQG A;  1WJF A;  3GFJ A;  1MZB A;  2ZCW A;  2H09 A;  3TMO A;  1N75 A;  3PJR A;  4BH9 A;  2BW3 B;  3QYF A;  4BKX A;  4JX6 A;  2E71 A;  2DI3 A;  1IUF A;  1VQO I;  4A69 C;  1HW2 A;  4A3D J;  1JUS A;  5GP9 A;  2ZO4 A;  3SZG A;  1ZN2 A;  3A03 A;  4NNJ A;  3QPT A;  4I7H A;  3L2Q A;  3JRA A;  3TP3 A;  4NQW A;  1ETK A;  2L5Q A;  1G3T A;  2EH3 A;  2ZXW H;  3DV8 A;  1SFK A;  3DXJ F;  2VQL A;  4EM0 B;  2PFB A;  2X1C A;  5IYC J;  3S2W A;  3F6V A;  1G2H A;  2KT0 A;  3ASO H;  1SAN A;  5FJ8 J;  1OCO H;  1FP2 A;  1GVJ A;  5D8L B;  4DBQ A;  4W97 A;  3V8L A;  2LFB A;  3VDX A;  3JAM K;  1VQL I;  2W84 A;  2GOM A;  2KP6 A;  1ON2 A;  3I54 A;  2FQ3 A;  2KIS A;  2EWN A;  2H1L A;  2IGK A;  1WFX A;  4AVZ A;  3VFZ A;  1MMG A;  3CCQ I;  2JN6 A;  4OIQ F;  1D1B A;  1EH6 A;  4CDG A;  1FWZ A;  4ON0 A;  2KJC A;  3L00 A;  1TQI A;  3DLL F;  3H36 A;  4ZYE A;  3F72 A;  3K1N A;  4XID A;  2CV1 A;  2MSY A;  2UZK A;  3AAF A;  1WGX A;  2PEX A;  3KZY A;  2XF5 A;  4IHW A;  2XUB A;  2JTV A;  1DP3 A;  1T95 A;  3AFH A;  3W3C A;  3SQN A;  5C3E J;  1IUY A;  3FMQ A;  1KZH A;  1YIT I;  1WQ2 A;  2FEZ A;  5FLM J;  3OL3 A;  3GCM A;  3BG6 A;  3H5A A;  3HKZ A;  1ITY A;  1QHH D;  4JK1 X;  2L7F P;  2M7A A;  4EGY A;  1W1W E;  3IWF A;  2VKE A;  3B73 A;  4CUG A;  3L09 A;  5EGO B;  1DGR M;  5FFZ A;  5LHG A;  1TNT A;  2XKP A;  3DP7 A;  3CDI A;  4HDV A;  3CQZ J;  2COB A;  2DA1 A;  2YX7 A;  5M5W J;  3I4P A;  1ZYR F;  1JJ8 C;  1X1B A;  1KYZ A;  2OA4 A;  2Y0S A;  3ASN H;  2DA2 A;  2FE3 A;  4G9Y A;  3JAM Z;  3A01 A;  1BI2 A;  1Z6T A;  4PGG A;  4HW0 A;  1X2M A;  2OJE D;  2X1D A;  1QA6 A;  2IW5 A;  3IUO A;  5L3C A;  4FE7 A;  2ELJ A;  4LK0 F;  2CS3 A;  1B8I A;  2NS8 A;  5K7F A;  1UB9 A;  2W7N A;  3I64 A;  4KFC A;  3UNG C;  5E8I A;  2J5O A;  4UUS B;  2LY1 A;  2JSP A;  2E2I J;  4C3I J;  4HST A;  4A6E A;  3QRF F;  2QKM B;  5HOO A;  1EKE A;  4DGW B;  4CCO A;  2F48 A;  2CWE A;  4Q48 A;  3VEP A;  1R23 A;  2MD0 A;  2COM A;  5IYD J;  4FQG A;  3K7A J;  1R49 A;  2XGC A;  3DBR B;  2R7Z J;  3BR6 A;  4G8X A;  5CVV A;  3I3L A;  1WJD A;  5JLX A;  4PJL A;  3EYY A;  3TOB A;  3ZMT A;  2R7F A;  4RLQ A;  4MEX F;  5EZG A;  1S29 A;  2Z3Y A;  1NK2 P;  1KU3 A;  5CVJ A;  1FBQ A;  2E1M C;  2QGU A;  4Q5S F;  1BIB A;  2XPV A;  2LRD A;  2A6T A; 
#chains in the Genus database with same CATH homology
 3ECH A;  1U3E M;  4P55 A;  2O8X A;  4EJV A;  1LVA A;  2M87 A;  5KK1 A;  1FZP B;  4FT8 A;  3WE3 A;  2HKX A;  2Q2E A;  2G7H A;  1B6A A;  1BI1 A;  2G7U A;  5ICF A;  5HVQ C;  2UWM A;  3CTA A;  2HDC A;  2XAH A;  3TQN A;  4F7Z A;  3KEO A;  5DCF A;  3DF8 A;  2Y75 A;  3SFZ A;  2R3S A;  2VBW A;  2EFQ A;  2WV0 A;  4R79 A;  3ECO A;  2VOP A;  2CQK A;  1SD7 A;  4BAY A;  1BI0 A;  3WTW C;  4YG2 F;  5LGU A;  1ZH5 A;  3WE2 A;  3GO5 A;  2XKO A;  4RB3 C;  1BN5 A;  2O0Y A;  3EQL F;  4MQ9 F;  4MHG A;  1KU9 A;  1D5V A;  1IF1 A;  4OIN F;  1SD6 A;  1KGS A;  3ISP A;  1IN8 A;  2P7V B;  1AWC A;  4LG0 B;  3I53 A;  1FYM A;  3SZT A;  4UNO A;  2QYO A;  2IP2 A;  3BRO A;  5K5R A;  2FA5 A;  4HF0 A;  3FHZ A;  1SMT A;  4L9J A;  3O2P E;  3LWF A;  2EFN A;  3COA C;  3LFK A;  5J6X A;  5BQT A;  4I98 B;  2XV4 S;  2IJL A;  3LQR A;  4EV0 A;  3WTV C;  5CJ9 A;  4KYW A;  2W57 A;  2ELH A;  4M73 A;  4PDK A;  1MJB A;  2QQB A;  4G7Z F;  1KU7 A;  5FLX Z;  4A12 A;  2DO7 A;  2CG4 A;  4YII A;  2OU2 A;  5BPI A;  2OZU A;  1XB4 A;  5K5Q A;  3ZPL A;  2PBI A;  2Z99 A;  3TOA A;  4A5N A;  5CVU A;  2XAS A;  3ZN1 A;  4EM2 A;  2M30 A;  3HYI A;  3QP6 A;  1TQP A;  2M1B A;  3MWM A;  2K7L A;  3GVA A;  4P9U A;  2RV8 A;  3BY6 A;  2ISY A;  3MCZ A;  4KN7 X;  3F6O A;  4KMF A;  2B0L A;  1IXC A;  1LB2 A;  2UXX A;  1U2W A;  2VOO A;  1HKT A;  1JHH A;  3GW2 A;  1UCR A;  2GIV A;  1EH7 A;  4HBL A;  4HLX A;  2P5L C;  1BJA A;  4AIK A;  4PGH A;  3GF2 A;  1FLI A;  4LK1 F;  3Q9S A;  5JR3 A;  2MLG A;  3KFW X;  4A2U A;  2RKH A;  3F8C A;  1FNN A;  1F1Z A;  1FSE A;  1I27 A;  2PQ8 A;  1WRJ A;  4YIF A;  1ZRF A;  5IT3 A;  4NHJ A;  1B9M A;  3F3X A;  3ZMD A;  4Q4Z F;  3RKW A;  5LGT A;  1ON1 A;  3I5U A;  4KIF A;  4OMY A;  1S6L A;  4IPA A;  4CYD A;  4U7B A;  3C18 A;  3PQJ A;  1AOY A;  3ABU A;  3BJA A;  1YS7 A;  4OIP F;  4L5I A;  5E17 F;  2HTJ A;  3ZN0 A;  3QPH A;  4TV7 A;  3CUQ A;  1J2X A;  4L18 B;  2K86 A;  4S05 A;  1DDN A;  3R0J A;  1RUN A;  1FSH A;  2EA4 A;  1W5S A;  5JFR A;  3HRS A;  1JGS A;  1E17 A;  1WI9 A;  2JT1 A;  1MJA A;  3GX4 X;  3DFG A;  2F5D A;  4OMZ A;  2BGC A;  4ZZL A;  3GYH X;  2YX4 A;  5CYV A;  3WTX C;  1ZGJ A;  2O03 A;  3ZMU A;  5IT9 K;  3G73 A;  3U9G A;  1YTY A;  4N0B A;  1I1S A;  2OD5 A;  1ZAO A;  3DEU A;  3REO A;  3T0Y A;  5D5U B;  1P6R A;  2OAZ A;  3GFM A;  3QAH A;  3J81 Z;  2FML A;  3RIR A;  3TO6 A;  5L3G A;  5FLX K;  3OOP A;  2XAF A;  4IVN A;  5LHI A;  4ZYD A;  1IZ1 A;  5J8F A;  1KQ9 A;  1XCB A;  2HZT A;  3JTH A;  1R36 A;  2VXZ A;  1G3S A;  2DTR A;  1U78 A;  3MZY A;  3IKT A;  5HDK A;  3ERE D;  2JPC A;  5E1W A;  3WG9 A;  3ULQ B;  1ZHF A;  3LQQ A;  3KP6 A;  4P5O A;  2EFW A;  3J81 K;  2FBK A;  3HTS B;  3RDI A;  1O57 A;  1R5G A;  2VON A;  2CO5 A;  3HIF A;  3K1P A;  1BIA A;  1T39 A;  2XIG A;  3GLX A;  3WGH A;  4RAZ A;  4CGZ A;  2FBH A;  3JTG A;  2IRF G;  2H6B A;  2VC0 A;  1R1T A;  3J80 Z;  2BV6 A;  4LMY A;  3EYI A;  3NEU A;  1T98 A;  3BZ6 A;  2O3F A;  4NB5 A;  2QBY B;  2QVO A;  4M9Z A;  2DK8 A;  4XRF A;  5LRR A;  1G4D A;  4AVP A;  4KMU X;  2M5W A;  4MGR A;  4XLN F;  1W7P D;  5AON A;  5FB2 A;  5DD8 A;  4HDU A;  2Q8K A;  3IC7 A;  2L01 A;  1LEA A;  4EJU A;  2Z5U A;  1U5T C;  3J7A O;  1I1G A;  3WTS C;  1J5Y A;  1YW9 A;  4I0B A;  5LHH A;  1D3Y A;  2GA2 A;  4IF4 A;  2X0L A;  4HV6 A;  1UST A;  4GGG A;  5BOX A;  3GZ5 A;  2QEN A;  4U7D A;  3F22 A;  2E7W A;  2A69 F;  4UHT A;  3IRR A;  4B8X A;  1RUO A;  3RJP A;  1J0R A;  2P8T A;  2ESN A;  2LKP A;  4I0A A;  4HX7 A;  1XGM A;  3V7S A;  3MAJ A;  4ESF A;  2HKO A;  1IN4 A;  4ESJ A;  2QQ9 A;  2ISZ A;  2LNB A;  4BHC A;  3V7C A;  3QU3 A;  4AWX B;  1TBX A;  4XBF A;  1P4A A;  3I71 A;  4IRI A;  5F64 A;  3SHF A;  4N9H A;  3TDZ C;  3E97 A;  3FF5 A;  2V9V A;  1ZRC A;  2NRA C;  4ZZD A;  5LRS A;  4BYY A;  1CF7 B;  3KE2 A;  2FF4 A;  2PMH A;  1FC3 A;  1XGS A;  3E6D A;  2XHK A;  2BYV E;  3M1E A;  2KKO A;  1IW7 F;  1IAW A;  2E1N A;  4KUM A;  3P9K A;  3E6M A;  2ACJ A;  3M7G A;  2F5E A;  1O7F A;  1GXP A;  3BPV A;  1U8R A;  2A6E F;  3C3W A;  4IRH A;  4U88 A;  2ZBK A;  2HS5 A;  2IVM A;  1ZG5 A;  3C7J A;  4HAM A;  3VOD A;  4IXA A;  5HS9 A;  4R1H A;  2P5K A;  3WGI A;  1QPM A;  4JQF A;  4LFU A;  4LG0 A;  3KCC A;  3T8T A;  4RGX A;  1L3L A;  5FGM A;  3EDP A;  4H0E A;  2JRT A;  4MEY F;  1P4W A;  4EJW A;  1XSV A;  2V1X A;  2A07 F;  2BEO A;  4KNY A;  1IXR C;  5H6R A;  1B59 A;  1B1B A;  2FRH A;  4XSX F;  4OIR F;  1P4X A;  1VTN C;  1ZRE A;  1QQI A;  2DU9 A;  3LAJ A;  3WGG A;  2PJP A;  4YFX F;  2MLK A;  3K0L A;  4ZYG A;  4KDP A;  4CO8 A;  1L0O C;  1S7A A;  3E6B A;  5D5V B;  4EGZ A;  5LEJ A;  3R60 A;  1BM9 A;  1LEB A;  1ZG1 A;  4GCV A;  1H9T A;  2RDP A;  3HOS A;  2EFP A;  4WWC A;  1J75 A;  3GFI A;  3CUQ B;  4KIG A;  3N97 A;  1FOK A;  2A61 A;  4L9N A;  1U5T A;  2AXL A;  3IWZ A;  4LB5 A;  3ELK A;  1TQM A;  1I6X A;  4OU0 A;  1CGP A;  2KRF A;  4KA4 A;  2VBX A;  2HOE A;  1ZRD A;  1RIO H;  4A0Z A;  1YIO A;  2GQQ A;  1YW7 A;  1B4A A;  1PUE E;  2OQR A;  1SFX A;  1LDJ A;  2CGP A;  2DK5 A;  2HQN A;  2DT5 A;  2VC1 A;  3JSO A;  2CFX A;  3M8F A;  3Q9V A;  3I0T A;  3CO7 C;  4HF1 A;  4WK8 F;  5E1X A;  4U0V A;  3RPU A;  1DPR A;  2ZKZ A;  3RTR A;  3H3Z A;  1YS6 A;  2A68 F;  4WXD A;  5L3B A;  3CLO A;  4YFN F;  3K1M A;  1XDU A;  1KQ8 A;  2P6T A;  3TO9 A;  2FU4 A;  3W6K B;  2YPR A;  1YQA A;  3K69 A;  1OPC A;  1JXS A;  4EM1 A;  2HGC A;  1MJ9 A;  3GEZ A;  5BMZ A;  1J7K A;  3BDD A;  4O5V A;  2ZME A;  3MFK A;  2KJB A;  1HQC A;  2QUF A;  3O3K A;  4EMS A;  2EV6 A;  3FXR A;  3IL2 A;  2NS0 A;  1XGO A;  3WU0 A;  4DNC A;  2D2W A;  4WF2 A;  5ICC A;  1HSJ A;  4WX9 A;  1XDS A;  5JHU A;  4XLP F;  4EJT A;  1FT9 A;  4A0Y A;  2FNA A;  4YFK F;  2P6S A;  2UXN A;  4ENM A;  2O6G E;  5AIP A;  2PN6 A;  1Z1D A;  3FX3 A;  1T38 A;  1ZG3 A;  2VT3 A;  1EV7 A;  3U1D A;  2C6Y A;  4CZZ A;  2FSW A;  1BI3 A;  1W4M A;  3KP7 A;  4BQA A;  1K79 A;  2DLL A;  2PMU A;  4ZH4 F;  2K4B A;  3SXY A;  5DUK A;  3M8E A;  1OKR A;  1U5T B;  1ODD A;  1LQ1 A;  1NHA A;  1KA8 A;  1EH8 A;  1I5Z A;  4P96 A;  4RB2 C;  2DFI A;  2JSC A;  5EEG A;  1O3S A;  2TDX A;  2MC3 A;  5ILV A;  1QNT A;  2XAJ A;  4AIH A;  4ENN A;  1YO5 C;  3G3Z A;  1ULY A;  5E1Z B;  5HS7 A;  3L9F A;  1FX7 A;  1D8J A;  3F8M A;  1PP8 F;  1KQ0 A;  4G7O F;  1J9I A;  3LST A;  2LSO A;  2QBY A;  2XAQ A;  1DUX C;  1S3J A;  1H9G A;  1T6S A;  2OQG A;  1PDN C;  1QBJ A;  3E6C C;  2DQL A;  1R1U A;  3KP3 A;  2PI0 A;  5D4R A;  4HF2 A;  4M6X A;  4BHB A;  1QZZ A;  1K78 B;  4BHP A;  2J5P A;  4I09 A;  1JHF A;  2FOK A;  1MGT A;  2P4W A;  2ZXJ A;  3IKV A;  4M6Y A;  1ZGA A;  1IN6 A;  2IPQ X;  1UHW A;  5ILS A;  4HA8 A;  3F21 A;  4L5J A;  3HSR A;  2NAZ A;  2PLY A;  4RB0 A;  4EVI A;  5TJJ A;  1OYI A;  4HZF A;  2IA2 A;  4D0P A;  3F23 A;  1BOA A;  4A5M A;  3EUH A;  5DUI A;  2XVC A;  4FHT A;  1XD7 A;  4PCQ A;  5BS6 A;  4HQE A;  2EFO A;  2M45 A;  4M72 A;  5D6F A;  4I01 A;  5DV5 A;  4LLN A;  2M8E A;  1G3W A;  4EQQ A;  3BP8 A;  4HX8 A;  5F6F A;  4GYI A;  1WKM A;  4LLG F;  1FYL A;  3RYR A;  2EV5 A;  2FMY A;  2L02 A;  4MNU A;  5CVI A;  1YG2 A;  1OYW A;  5JVT A;  3KET A;  4R8H A;  2DQR A;  2KIU A;  5ERI A;  1R7J A;  1XSX A;  2MH9 A;  4RGU A;  4UXN A;  4G6D A;  1KYW A;  3ML6 A;  1XCV A;  2X4H A;  4P9F A;  3LAP A;  2IA0 A;  3FM3 A;  4HOB A;  1IXS B;  3E5X A;  1YYV A;  2ESH A;  5E20 A;  3NQO A;  3R4K A;  3RPQ A;  3CDH A;  3ROU A;  3HHG A;  4LJZ F;  1Q1H A;  2Y48 A;  2ZME B;  3KZZ A;  2GAU A;  2Z9O A;  4CXF A;  1XGN A;  1SMY F;  1B9N A;  3V8J A;  4RGS A;  5D5X B;  5LEK A;  2YU3 A;  1QGP A;  1ZLK A;  1REP C;  3PFI A;  3WOD F;  5D4S A;  1TW3 A;  1QZY A;  2DPU A;  1XMA A;  3R6S A;  3P9I A;  3WTU C;  4U0Y A;  3BJO A;  5DCM A;  1QO0 D;  1O7L A;  2DW4 A;  4GO1 A;  5FO5 A;  5ICE A;  3TO7 A;  1H0M A;  2ZFW A;  2VBY A;  3JSP A;  2LDU A;  2IA1 A;  3ZMZ A;  1RI7 A;  3K2Z A;  1SFE A;  2GWR A;  2WWY A;  3BOQ A;  3IRQ A;  4UV8 A;  4Q47 A;  1F9N A;  5DCM B;  2EV0 A;  1C0W A;  2HTS A;  3N4M A;  2WC2 A;  3SZP A;  3RYP A;  4M9X A;  5CVR A;  2FNP A;  1FBU A;  4XSZ F;  1S8N A;  2MH2 A;  3B02 A;  5LBQ A;  2VE9 A;  5DDG A;  3LA7 A;  3WTY C;  3U2R A;  4M74 A;  2D1V A;  2OBP A;  4LLL A;  4L9T A;  2CW0 F;  1YW8 A;  4MTE A;  2GXB A;  1Y0U A;  1LJ9 A;  1YLF A;  2ETH A;  1O3Q A;  3V8K A;  4WXH A;  1R22 A;  1BBY A;  4CIC A;  2P7C B;  2QQA A;  2W85 A;  4Y13 A;  4MTD A;  3HRT A;  5E18 F;  4QWQ A;  4Y17 A;  1GXQ A;  3F8N A;  4I2O A;  1O3R A;  3WTZ A;  3K9T A;  3GXO A;  4BXU A;  4E70 A;  2NNY A;  5BPD A;  3T1B A;  3RI4 A;  4OOI A;  2NNN A;  5L3E A;  5LGN A;  4HX4 A;  4KT5 C;  3ABT A;  3MZH A;  2KIF A;  3W6J B;  2XRO A;  4GYG A;  4OIO F;  4FX4 A;  1RNL A;  5LLQ A;  4UVB A;  1TNS A;  4L0Z B;  2XGX A;  1ZAR A;  4M9S A;  2L4M A;  1XMK A;  4L0Y B;  2D45 A;  5J8C A;  2QZ8 A;  1BC8 C;  1T0F A;  1TLH B;  4N9I A;  4GXO A;  3CO6 C;  4IJA A;  4ENJ A;  1R58 A;  3RKX A;  3V4G A;  1Z91 A;  2Y0M A;  2V6C A;  2A5Y B;  1S7O A;  2CSO A;  5ED4 A;  2L3D A;  3CJN A;  2QWW A;  5HLI A;  2V1U A;  2OZ6 A;  3P9C A;  2ZNZ A;  1LDK B;  2QM3 A;  3HSE A;  1K78 A;  4RS8 A;  4I02 A;  5D8K B;  5EEH A;  1T2K A;  2AS5 F;  3V7R A;  1STZ A;  4HV5 A;  3DKW A;  3QP5 A;  1Z7U A;  2RQP A;  2V79 A;  2YSR A;  2RNJ A;  4K2E A;  1LDD A;  5E8G A;  5ICG A;  4O6J A;  3PQK A;  4HLY A;  4MQV A;  2RC4 A;  2HQR A;  3LA2 A;  2MBF A;  2GZW A;  3HSF A;  3KP2 A;  1X3U A;  2V1D A;  1J59 A;  5HDN A;  1D8K A;  2ZNY A;  4A6D A;  1HXD A;  3L7W A;  1FBS A;  3T8R A;  1MDM A;  5DYM A;  3LA3 A;  4IRG A;  5DEQ A;  2VOD A;  6PAX A;  3Q5F A;  1R00 A;  2HR3 A;  1SD4 A;  3CUQ C;  2G9W A;  1TTY A;  2H27 A;  3ZMV A;  4WXC A;  2K4J A;  4S04 A;  3HUG A;  5L3D A;  3KP5 A;  1DPU A;  4CHU A;  4M71 A;  3FZV A;  5D5W B;  1KU2 A;  2ZJ2 A;  2RVC A;  3FWE A;  3BJ6 A;  5F1R A;  1ONV A;  1BC7 C;  5ILU A;  2K27 A;  2DPD A;  2L54 A;  1G6N A;  4KN4 X;  5D6E A;  4B09 A;  1JE8 A;  1GHC A;  5H6Q A;  3J80 K;  4RAY A;  3DPL C;  2F5F A;  3OV8 A;  3KP4 A;  4Z2Y A;  2VT2 A;  1V3F A;  3KLO A;  2BBY A;  4ENK A;  4UVC A;  2H94 A;  1R1V A;  1IN7 A;  3JW4 A;  3F8F A;  2JPB A;  3WU1 B;  2EK5 A;  1DP7 P;  2F5C A;  4AIJ A;  2PG4 A;  3T5X A;  2P5V A;  3HHH A;  1UFM A;  1WWX A;  2XAG A;  3WTT C;  2EJR A;  3O6B B;  5H20 A;  4DQ2 A;  1R5H A;  3KLN A;  3C1D A;  1K7A A;  3VOE A;  4WCG A;  1WSU A;  3HOT A;  1YFH A;  4BNC A;  4ZYH A;  2EA2 A;  1XN7 A;  3FXQ A;  2NYX A;  5IT9 Z;  4Y15 A;  3QOP A;  4ETS A;  2E1C A;  1RZ4 A;  4AD9 A;  1SD5 A;  1G3Y A;  3DQV C;  4ESB A;  2ADU A;  5JI6 A;  3HRU A;  2QLZ A;  3M9A A;  2FXA A;  3R61 A;  3HTU A;  2IT0 A;  1MD0 A;  5K1Y A;  3E5Q A;  3RKY A;  2A6H F;  5FD5 A;  4RB1 A;  4O3M A;  3H3U A;  3BWG A;  1HW1 A;  2DAO A;  2K02 A;  2O61 A;  3TGN A;  1K6O A;  4UUV A;  5HDG A;  1O3T A;  2RN7 A;  1P92 A;  3IHU A;  2L4A A;  1Z9C A;  3FXU A;  1E2X A;  2Z33 A;  3D0S A;  1V4R A;  2F2E A;  1W7P B;  1MDM B;  3GUD A;  4ASN A;  2W24 A;  1FYK A;  3GWZ A;  2MD5 A;  3QU6 A;  4G7H F;  3E3V A;  3R0A A;  1SFU A;  2FBI A;  2HFH A;  1FP1 D;  2GXG A;  4EJO A;  1TW2 A;  1HKQ A;  4L9V A;  2HYG D;  2R7D A;  4HQM A;  3I59 A;  5CLS A;  1F5T A;  3BPX A;  2BE5 F;  3TKY A;  2VBZ A;  5L3F A;  2XRN A;  3ZMS A;  3ZP5 A;  5HLH A;  2LF8 A;  3I58 A;  1U6G A;  5HLG A;  4LB6 B;  1ZLJ A;  2VN2 A;  4KIC A;  3VB2 A;  2D1H A;  1OR7 A;  2E7X A;  3I59 B;  1XSD A;  1IRG A;  5FD6 A;  3NRV A;  5KVR A;  4HYE A;  1FY7 A;  2KIM A;  4UV9 A;  4FX0 A;  2W25 A;  5TRD A;  1W7P A;  3D5L A;  2STW A;  1UHM A;  5AIQ A;  2STT A;  1HKS A;  3HRM A;  3DPT A;  4LGW A;  1A04 A;  3ZQ7 A;  4LD5 A;  1F4K A;  4KIB A;  2Q0O A;  4QLC U;  2LF7 A;  3EET A;  3TDU C;  2GA1 A;  3E5U A;  1IN5 A;  1USS A;  2RGV A;  3GZ6 A;  3P7N A;  1CF7 A;  3H92 A;  3KEQ A;  1OYY A;  1MKM A;  4PZJ A;  5FFX A;  3FMR A;  2CYY A;  1W5T A;  1HW5 A;  4U0W A;  3MEX A;  3FMS A;  4IHT A;  2YR2 A;  1HST A;  1PP7 U;  1Z6R A;  1Z05 A;  1SAX A;  2A3S A;  1P2F A;  2HEO A;  4G94 A;  5HS8 A;  5K5O A;  5A2Q Z;  3F8B A;  4IHS A;  2MA3 A;  2VE8 A;  4G6Q A;  2JZY A;  3GFL A;  1OMI A;  4UVA A;  2HWV A;  2HYF A;  1FPQ A;  4A0X A;  2DBB A;  2EB7 A;  3MQ0 A;  3FM5 A;  1IRF A;  3CUO A;  3L2C A;  1LNW A;  2H6C A;  5A2Q K;  2WTE A;  4RGR A;  1HBX G;  1MZB A;  2ZCW A;  2H09 A;  3GFJ A;  4BH9 A;  2DI3 A;  1HW2 A;  2ZO4 A;  1ZN2 A;  3QPT A;  4I7H A;  4NQW A;  1G3T A;  3DV8 A;  3DXJ F;  4EM0 B;  2PFB A;  3S2W A;  3F6V A;  1FP2 A;  1GVJ A;  5D8L B;  3V8L A;  3JAM K;  2W84 A;  1ON2 A;  3I54 A;  2FQ3 A;  2EWN A;  3VFZ A;  4OIQ F;  1EH6 A;  4CDG A;  1FWZ A;  4ON0 A;  2KJC A;  3L00 A;  1TQI A;  4ZYE A;  3F72 A;  3K1N A;  2UZK A;  3AAF A;  2PEX A;  3KZY A;  2XUB A;  2JTV A;  3SQN A;  1IUY A;  3FMQ A;  1WQ2 A;  2FEZ A;  4JK1 X;  4EGY A;  3IWF A;  3B73 A;  3L09 A;  5FFZ A;  5LHG A;  1TNT A;  2XKP A;  3DP7 A;  4HDV A;  2YX7 A;  3I4P A;  1ZYR F;  3JAM Z;  1KYZ A;  2OA4 A;  4G9Y A;  2FE3 A;  1BI2 A;  1Z6T A;  4PGG A;  4HW0 A;  2IW5 A;  5L3C A;  4LK0 F;  1UB9 A;  3I64 A;  4KFC A;  5E8I A;  2J5O A;  4A6E A;  3QRF F;  5HOO A;  2CWE A;  4Q48 A;  3VEP A;  1R23 A;  2COM A;  4G8X A;  5CVV A;  3EYY A;  3TOB A;  3ZMT A;  2R7F A;  4MEX F;  1S29 A;  2Z3Y A;  1KU3 A;  5CVJ A;  1FBQ A;  4Q5S F;  1BIB A;  4JBA A;  5DD4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...