1QPMA

Nmr structure of the mu bacteriophage repressor dna-binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MU BACTERIOPHAGE C REPRESSOR PROTEIN)
publication title NMR structure and functional studies of the Mu repressor DNA-binding domain.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Viral protein
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qpmA00
1P4XA 2Z99A 3HTUA 3I53A 4P9UA 1TTYA 1C0WA 2UXNA 1KGSA 1K78A 4FT8A 4EM1A 4EJTA 4M72A 1W4MA 1R22A 2R3SA 2EA2A 2HKXA 4NQWA 5ERIA 4HDVA 3EDPA 1G4DA 2O61A 3CUOA 3BJAA 3O3KA 1WSUA 3DEUA 3HSEA 3C18A 4OIQF 4UNOA 3ELKA 2L54A 4ZZLA 4M6XA 1O3RA 4NB5A 2ZNYA 5CVUA 3C7JA 1MDMB 5CYVA 1J7KA 4OMYA 1Z1DA 5E8IA 2H94A 2VT3A 4RGXA 2JPBA 5CLSA 1YFHA 2QYOA 3HOTA 2JRTA 3GEZA 5L3DA 1MJBA 2KJBA 4FX0A 1XCBA 4KMUX 3JTHA 5ILUA 1U2WA 4U0VA 4CXFA 2XIGA 1SD7A 4MEXF 3R0JA 2F5DA 3QOPA 3FM5A 4PGHA 1LDJA 1S3JA 1W7PB 4XRFA 1U78A 5E1XA 2EFPA 2OU2A 4WK8F 4KUMA 1MD0A 1V3FA 2F5CA 1IN6A 4N0BA 2Z9OA 2P6TA 4UHTA 1YO5C 5DV5A 4I98B 1ONVA 3D5LA 1K6OA 1XDUA 2NRAC 2K4BA 3BROA 4QLCU 4U0WA 4L9NA 3V8LA 2DT5A 2ZNZA 5IT3A 4CYDA 2R7DA 4ZYGA 3FF5A 2E1NA 1BC8C 1OR7A 3IL2A 1U5TC 3FMQA 4P9FA 3RKWA 1ZRDA 1LDDA 1G3SA 5ILSA 3ABUA 2Z5UA 1HBXG 3GVAA 1T98A 3W6JB 3L00A 1F9NA 2B0LA 3KLOA 2XROA 4KICA 5ICGA 4HX7A 1OMIA 2LF7A 2LNBA 1STZA 1UB9A 4KFCA 1CF7B 2LSOA 1FBQA 5LLQA 1LQ1A 1IF1A 4IPAA 4ASNA 4MTDA 1FNNA 4OIRF 1DUXC 4KNYA 3PQJA 5IT9Z 4CZZA 1H9TA 2XHKA 1KU9A 3DKWA 4Y13A 2FNAA 2LKPA 2MBFA 2NS0A 2L01A 5K5QA 2XV4S 2CGPA 4CICA 2JSCA 3CDHA 2YR2A 3E6CC 2CQKA 4AIKA 4HW0A 4PCQA 2M30A 4HV6A 1H0MA 2FU4A 5DUKA 3JSPA 3REOA 3K1NA 3HHHA 2OBPA 2IRFG 2XAJA 2P7VB 2P5VA 4ESBA 3GFIA 4RB3C 2ISZA 1HKQA 2VBZA 2JTVA 2HQRA 2HS5A 3HSFA 2X0LA 3E6MA 1R5GA 4RB2C 3FXRA 2K7LA 3FZVA 3IRQA 5BMZA 1T0FA 1MDMA 1R58A 2RN7A 3FMRA 4MQVA 5KVRA 1FPQA 2CFXA 1BM9A 4H0EA 1G3WA 3KFWX 1P4WA 4M9ZA 3ZMUA 4BH9A 1IN7A 3P9IA 2K4JA 1LB2A 1BI2A 3ZN0A 3W6KB 1BBYA 3T1BA 5HLHA 4LLNA 1BC7C 5JR3A 4PDKA 1L0OC 2EFQA 2V79A 3ZMDA 5FO5A 1ZYRF 1W7PA 1R1TA 3KE2A 4LGWA 1EH6A 1E2XA 4LLLA 3SHFA 3ZP5A 2GQQA 4JK1X 4WWCA 3HRMA 2VBYA 3P9CA 5BQTA 1T6SA 5LHIA 2A68F 4HF2A 1QQIA 3BJ6A 3ECOA 2HTSA 5JHUA 1DDNA 2IPQX 1RZ4A 2HEOA 3V4GA 5L3FA 2Q2EA 2Y48A 1I27A 5K1YA 5D5VB 3LAJA 4KT5C 2Y0MA 1FBUA 3K69A 5L3EA 3JAMZ 4KYWA 1Z91A 2E7XA 3IRRA 4L9TA 4ENJA 5DEQA 3E97A 3CO6C 4O5VA 3V7CA 1BI1A 2DFIA 3VODA 3H3ZA 4BAYA 1R23A 2WV0A 3R61A 5FB2A 1XMKA 4LK1F 3PQKA 1DP7P 1LEAA 1DPRA 2ZCWA 4Q4ZF 3GW2A 1OYWA 4HX4A 1W5TA 2HR3A 2K27A 1IN8A 2FBHA 4LK0F 5ILVA 1JE8A 2ESHA 3E6BA 2DK8A 1CF7A 2J5OA 1GVJA 3TO7A 3WGHA 3L7WA 5DD8A 5J8CA 3WU0A 3CUQB 4M71A 4MNUA 1SD4A 5FLXZ 1ZHFA 1BOAA 2A69F 5JI6A 4EJVA 4YFNF 4BNCA 2H6CA 3U2RA 3WTYC 3F8NA 2X4HA 3J7AO 2OQGA 3FX3A 1YLFA 3JTGA 2D45A 4EVIA 3DXJF 4LMYA 5LGUA 5J8FA 4CHUA 1REPC 1KYZA 3U9GA 3GX4X 1FSEA 3WTWC 2CYYA 2VE8A 1F5TA 4BXUA 2A5YB 2DO7A 3R60A 4ZYDA 3BOQA 1L3LA 4L0YB 1FYLA 2HYFA 4I09A 4IF4A 3MEXA 1T2KA 2FMLA 2UWMA 1J2XA 1J0RA 4G7OF 1WI9A 1RUOA 4L5JA 1Z7UA 1XSDA 3I4PA 3ABTA 1MKMA 1R00A 5DCFA 5FD5A 5DCMB 1KA8A 3F8FA 2HYGD 1UCRA 5BS6A 3JAMK 2H09A 2HKOA 2VODA 3RYRA 3MQ0A 1TNTA 3LQRA 3M7GA 3ZMVA 1O3QA 2FE3A 4ENMA 2FBIA 3K1MA 1PP7U 3TO9A 1FT9A 3J80Z 4L18B 3NQOA 1HW1A 5D8LB 5L3CA 1BIBA 1QGPA 2KRFA 1U8RA 4KIFA 2KIUA 4LG0B 4RGRA 4A0ZA 4I02A 4IRIA 1DPUA 1KYWA 4A12A 3GFJA 3IWZA 4M74A 3Q9VA 1YYVA 1RI7A 1RUNA 2L4AA 3GUDA 4G6DA 1TW3A 3QU6A 4M73A 3TKYA 5AIPA 1XMAA 1K7AA 2GXGA 4XSZF 3I5UA 2G7UA 4A5NA 1USTA 4RS8A 5FLXK 4HZFA 4P5OA 6PAXA 1UHMA 3LA7A 2BYVE 3BY6A 4P55A 1ZARA 5LRRA 3RTRA 5AONA 2YU3A 5D8KB 2F5FA 2EFOA 1IXRC 1B9MA 2OQRA 5H6RA 5HOOA 4HQEA 1XGNA 3HYIA 1IW7F 1KQ8A 2PG4A 2IT0A 1XGSA 3D0SA 2MC3A 3RJPA 3V8JA 1ZREA 1YS7A 4G94A 1XGMA 3HSRA 4E70A 1ZH5A 5CVIA 3GZ6A 4PGGA 1IXCA 2RDPA 4LB5A 2ZFWA 1O7FA 4ETSA 1O57A 3CLOA 1EV7A 1PDNC 3QPHA 3R6SA 4UV9A 2AS5F 2FEZA 2E1CA 4DQ2A 4Q5SF 1S6LA 4Z2YA 5K5OA 3DPTA 4ON0A 2HDCA 3CUQA 2P6SA 3K9TA 2FOKA 4G6QA 4ENKA 4CDGA 1H9GA 3TQNA 1XCVA 4IXAA 3J81Z 3B02A 3QRFF 2EA4A 5DDGA 3LWFA 3J80K 2ZMEB 3GFLA 3PFIA 4EGZA 2ETHA 3C3WA 3KETA 4WXHA 1LEBA 3IHUA 5F1RA 2MH9A 4HF1A 3M1EA 2D1VA 3GWZA 3H3UA 5FFXA 1J75A 1LVAA 1EH7A 2IA0A 1WWXA 3F6OA 1IN4A 3P9KA 1HXDA 2XVCA 3R4KA 2EK5A 4JQFA 2PLYA 1O3SA 2W84A 5HLIA 4IHTA 2RV8A 3ZN1A 5E17F 4AD9A 4G9YA 2QENA 3SZPA 4HLXA 5TRDA 4ESFA 3RKXA 2Z3YA 1SMTA 1SD6A 3KZYA 4CGZA 5HDGA 4U7DA 3IC7A 4WX9A 5DCMA 1U3EM 2D2WA 2RVCA 3WGIA 3N97A 4UXNA 4HA8A 1FWZA 3BZ6A 4U7BA 3ISPA 2RC4A 2DI3A 1A04A 4UVAA 1NHAA 1TQIA 1RNLA 1JGSA 1KU3A 4M6YA 3K1PA 1HKTA 3DP7A 4Y15A 1YIOA 2PJPA 4MGRA 2O8XA 5JFRA 2PFBA 3HRUA 3I64A 3O2PE 2J5PA 5EEGA 1Z6TA 2VOPA 4I01A 3VB2A 2NYXA 3IWFA 4Q47A 5ICFA 4UVCA 3KP4A 1BJAA 4UVBA 2STWA 4LG0A 4S04A 5EEHA 3IKTA 3LA2A 1Z9CA 2CW0F 3F21A 2OAZA 5HDKA 3M9AA 2VN2A 2M5WA 2G9WA 2VONA 4GYIA 1BN5A 2OZUA 4G7ZF 1FBSA 4D0PA 5ICEA 2DLLA 1IRGA 2PMUA 4QWQA 2M8EA 5ED4A 3TOAA 3LQQA 3J81K 2HQNA 3EETA 2XAQA 3WTUC 2IA1A 2A07F 4RGUA 1OYIA 2MA3A 4LFUA 3R0AA 2OD5A 4EGYA 4IVNA 2BEOA 1XB4A 1FP2A 2ISYA 2R7FA 3RKYA 1OPCA 2WC2A 3JW4A 2PQ8A 4LLGF 2STTA 3RYPA 1S29A 3P7NA 5BOXA 2DW4A 3KLNA 3O6BB 5KK1A 5E8GA 3T8TA 3KP7A 2QQBA 4WF2A 1EH8A 3KEQA 2DTRA 3FM3A 5LEKA 2DPDA 5J6XA 2PN6A 5A2QZ 4Q48A 4I0BA 3QP6A 5LBQA 1YW9A 3COAC 2EFWA 1SAXA 2VBWA 2K86A 5H6QA 4EMSA 3ML6A 5LHGA 3KCCA 4HYEA 2W57A 2W24A 1TW2A 4LD5A 1SMYF 3RPUA 4U88A 3E5UA 3KEOA 1QZZA 2QQ9A 3E3VA 4XLPF 2L3DA 2XAHA 3FXQA 1HW2A 3F8CA 3V8KA 1T39A 2VT2A 3U1DA 2XAFA 4KDPA 2ZMEA 4FHTA 1PP8F 2IW5A 5D6EA 4F7ZA 3B73A 1ZLKA 4CO8A 5D5UB 3EYYA 1LJ9A 3F3XA 1MJ9A 2QWWA 4HV5A 3H92A 2FQ3A 2HTJA 2ZJ2A 5TJJA 2QBYB 3F8MA 1UFMA 5E20A 2WTEA 3G3ZA 2QUFA 3Q9SA 4ENNA 1PUEE 4HF0A 4A0XA 1Y0UA 2F5EA 3CO7C 2EV6A 1FY7A 4EM0B 5D5XB 2XKPA 3F8BA 2UZKA 1ULYA 5JVTA 1BI3A 2PEXA 1YTYA 4KMFA 2GZWA 3OOPA 1FP1D 3C1DA 4XBFA 3HRSA 5BPDA 2QQAA 1X3UA 2XAGA 3ZQ7A 1W7PD 5K5RA 3EQLF 3ROUA 3TDZC 5F64A 1I6XA 3WE3A 4S05A 4NHJA 1HKSA 1I5ZA 2VXZA 2DAOA 1OYYA 4M9XA 1MZBA 2FRHA 2CO5A 3BPVA 5L3GA 3F6VA 1CGPA 2FBKA 1ON2A 2H27A 4OIPF 2FA5A 1YQAA 4ESJA 5CJ9A 4ZYEA 2D1HA 1FZPB 3GO5A 2XKOA 1TQMA 1XGOA 2CWEA 1IRFA 4YFXF 3FMSA 2VC0A 2NNNA 4XSXF 3KP5A 4G8XA 5A2QK 2EB7A 2ZKZA 1J5YA 2GXBA 4HQMA 5CVRA 3RIRA 2IP2A 3ZMTA 1ZRCA 1MGTA 3ERED 2ZBKA 3LFKA 3RI4A 2V1XA 3QP5A 1WRJA 3DPLC 2ACJA 4IRHA 2Z33A 4IJAA 1D5VA 2P8TA 2BV6A 4AIJA 5D5WB 1ON1A 3BDDA 4KN7X 2YSRA 5HS8A 3TGNA 2IJLA 4I2OA 2BBYA 1QNTA 2GA2A 3BPXA 3MZYA 4WXDA 1WQ2A 2XUBA 1UHWA 1Z6RA 3M8EA 3ULQB 1HW5A 3F72A 4EJUA 2C6YA 4RB0A 3T0YA 3MZHA 3I59B 3WTTC 4R1HA 4I0AA 4WXCA 2HGCA 3ZPLA 2IVMA 3FWEA 1IN5A 2M45A 1VTNC 1ZAOA 3LSTA 5BPIA 1R1UA 5H20A 5LRSA 1D8KA 3KP3A 2ELHA 3GF2A 1E17A 2Y75A 4GCVA 2LDUA 4A5MA 1ZGAA 4B8XA 4OINF 5L3BA 2V6CA 1FSHA 4GXOA 2FNPA 2NAZA 3V7RA 4K2EA 4HAMA 3E5XA 2K02A 3L9FA 2OA4A 1SFUA 3K0LA 2H6BA 4FX4A 3GXOA 4M9SA 3I0TA 3MFKA 4YFKF 2FXAA 3Q5FA 2PBIA 1ZG1A 2KIFA 4BQAA 3I58A 2QBYA 1TNSA 1FOKA 5LEJA 2MH2A 4G7HF 3KP6A 2DK5A 1S8NA 2AXLA 4RB1A 4KA4A 3HRTA 1JXSA 2XASA 3LAPA 1ZRFA 2O03A 3ZMSA 1W5SA 1B9NA 3WTZA 1GHCA 4RGSA 1O7LA 1KU7A 3RDIA 1QPMA 2PI0A 1JHHA 1XN7A 1S7AA 2GIVA 3KP2A 3TOBA 4BHCA 2GA1A 1Z05A 3SZTA 4I7HA 2A61A 3K2ZA 2P4WA 2HFHA 1AOYA 3WU1B 1TLHB 4L0ZB 2ESNA 3CTAA 2JZYA 3DF8A 2IA2A 4B09A 3I54A 5FGMA 2Q8KA 3SFZA 2QZ8A 3HOSA 5E1ZB 4IRGA 2RKHA 2P7CB 1I1GA 5CVJA 1O3TA 1J59A 2G7HA 1QZYA 4ZYHA 2HWVA 1B4AA 4BHPA 4U0YA 4EV0A 5DUIA 2F2EA 4R79A 1IAWA 4OU0A 5LGTA 4LJZF 5FD6A 3AAFA 2DQLA 2RGVA 5HVQC 4HLYA 1V4RA 3EUHA 2EWNA 2PMHA 2XRNA 4AIHA 1XSVA 1IXSB 1LNWA 1QO0D 2O6GE 4AWXB 1P4AA 1FX7A 2YPRA 3F23A 2YX4A 2MLGA 4PZJA 4A6DA 4EJOA 2OZ6A 2DQRA 4O3MA 3HIFA 3ZMZA 1ODDA 1G3TA 3MWMA 3I59A 3WE2A 4UUVA 1U5TB 1XDSA 4BYYA 3I71A 4EM2A 1ZLJA 1USSA 5HS7A 5AIQA 1IZ1A 1F4KA 1D8JA 1ZGJA 3CJNA 3NEUA 2W85A 4MTEA 2COMA 2QVOA 3WG9A 4XLNF 2Q0OA 2A6HF 5DYMA 2VOOA 1ZN2A 4L5IA 4YIIA 2QM3A 1LDKB 1FLIA 1QBJA 4GGGA 3LA3A 4OMZA 3N4MA 3NRVA 2A3SA 1TQPA 3SQNA 4YG2F 2M1BA 1HSJA 2EV5A 2YX7A 2QLZA 2KJCA 3M8FA 2UXXA 3HTSB 1YS6A 3BP8A 3IKVA 3DV8A 3GZ5A 1P92A 4KIBA 3JSOA 3BJOA 1AWCA 2VE9A 3WODF 3VEPA 2A6EF 2L4MA 1BIAA 2NNYA 4RAYA 4GYGA 4KN4X 3WGGA 1FC3A 4RAZA 2HZTA 4A6EA 2VC1A 5F6FA 4UV8A 4TV7A 3FXUA 3MCZA 1FYMA 1KQ0A 5DD4A 1K78B 3VFZA 3GFMA 4HOBA 2O3FA 3ECHA 5HLGA 4JBAA 2V9VA 1P6RA 3SXYA 1Q1HA 3QPTA 4O6JA 1TBXA 3DFGA 3EYIA 2MD5A 3T5XA 4N9HA 4Y17A 3CUQC 5E1WA 4IHSA 2FMYA 5LGNA 3G73A 1HQCA 2V1DA 2TDXA 1J9IA 2HOEA 1BI0A 5IT9K 1S7OA 1R1VA 1U6GA 2RQPA 3RPQA 5D4RA 4A0YA 3GYHX 1K79A 4OIOF 2V1UA 3T8RA 5CVVA 4ZH4F 2DPUA 1B59A 4R8HA 4L9JA 1R5HA 2E7WA 4BHBA 1T38A 4MQ9F 3L09A 2VBXA 1ZG5A 4GO1A 1KU2A 2LF8A 2CSOA 1ZG3A 3WTVC 1OKRA 4HDUA 4YIFA 1SD5A 3QAHA 5HDNA 3E5QA 5FFZA 4EJWA 1FYKA 2M87A 4HX8A 2ZXJA 2GWRA 2DU9A 2BGCA 3KZZA 1B1BA 5E18F 4DNCA 3V7SA 1IUYA 1YW8A 1SFEA 2W25A 1HSTA 1U5TA 2EV0A 1YW7A 1GXQA 4MEYF 2KKOA 1MJAA 1I1SA 1GXPA 2ZO4A 3HUGA 1D3YA 4AVPA 2P5LC 2CG4A 2KIMA 3MAJA 1R36A 3F22A 1P2FA 3E6DA 4OOIA 1F1ZA 1WKMA 5D4SA 2FF4A 4MHGA 5HS9A 1B6AA 4L9VA 3L2CA 3QU3A 3FHZA 1YG2A 3TDUC 2P5KA 1SFXA 2GAUA 2EFNA 5D6FA 2BE5F 4N9IA 3BWGA 4A2UA 2MLKA 1G3YA 4HBLA 2EJRA 3HHGA 4KIGA 2WWYA 2L02A 4WCGA 1R7JA 3VOEA 1RIOH 3GLXA 2JPCA 4P96A 2FSWA 1JHFA 1KQ9A 4LB6B 2JT1A 3DQVC 3TO6A 5ICCA 1G6NA 5LHHA 4EQQA 2O0YA 1XSXA 2DBBA 2XGXA 3WTXC 2RNJA 2ADUA 4ZZDA 3WTSC 1XD7A 3OV8A 3S2WA
chains in the Genus database with same CATH superfamily
3GBGA 1P4XA 2Z99A 3C2HA 5K7ZA 4DW6A 1Z0XA 3HTUA 3I53A 1VQMI 4PJLA 4P9UA 4NC7A 1Y8RB 2DA1A 2VUMJ 2V6EA 2CUEA 2QGUA 2O8KA 1TTYA 1C0WA 2UXNA 5FKNA 4XORA 4AYBN 4RDUA 1K83J 2VJJA 1KGSA 3LSGA 3OWTA 4IHYA 3BR2A 1K78A 2BXZA 4FT8A 2K9LA 4ZTJA 4EM1A 5EJCA 4E6KG 3OSGA 4BKXA 1N78A 4RM2A 4AUXA 4EJTA 4D7MA 1RC9A 4M72A 1JKPC 1VQ4I 1W4MA 1R22A 2M8GX 1QHHD 2R3SA 5IYDJ 3K4CA 2EA2A 2HKXA 1BR4A 1X1BA 3BR5A 4NQWA 5ERIA 4HDVA 1MNMC 2DCEA 3BG5A 3EDPA 1G4DA 2O61A 2M4GA 3CUOA 3BJAA 3O3KA 1WSUA 2LP0A 3HGGA 3DEUA 3HSEA 2M0MA 2XSJC 4OAYA 4B44A 3C18A 4OIQF 4UNOA 3ELKA 4IO9F 1FTTA 2L54A 4ZZLA 5GTHC 4M6XA 1QRYA 4AC0A 1O3RA 4NB5A 4CYCA 2DODA 2HVQA 2ZNYA 4M6VA 3I3LA 5CVUA 3C7JA 1LFBA 4NDLA 1MDMB 3JRHA 3DEWA 5CYVA 1J7KA 4RMNA 1B72B 3RKQA 4OMYA 1Z1DA 5E8IA 2VQCA 2H94A 2VT3A 4RGXA 2JPBA 5CLSA 2KRHA 2VKDA 3CCRI 3A2KA 1YFHA 5F0FA 2CRGA 1FEXA 3H5AA 5F0CA 3DKYA 2LD5A 1UMQA 4FTHA 3AFHA 2QYOA 3CDIA 2JRTA 3HOTA 3S16J 3GEZA 5L3DA 1MJBA 4BJTA 3ZXSA 1XPXA 2KJBA 1YX3A 4FX0A 1XCBA 3SEQA 4KMUX 3JTHA 4BE0A 2ME0A 2Y9YA 3HOZJ 5ILUA 1U2WA 4U0VA 4CXFA 2XIGA 4BUPA 1SD7A 2WAQA 4MEXF 3R0JA 2F5DA 3QOPA 1SVLA 2AQEA 3FM5A 4PGHA 3BR3A 1LDJA 1S3JA 1W7PB 2IBDA 4XRFA 2ZSIB 2EQRA 3E7LA 1U78A 2VQGA 5E1XA 1EKEA 2EFPA 2OU2A 4WK8F 3BZKA 2VPRA 4KUMA 1MD0A 3CD6I 4F93B 1V3FA 2F5CA 1IN6A 3EPZA 2HZDA 3P5JA 5EG0A 1MBHA 4N0BA 2Z9OA 5FKLA 3GTLJ 2P6TA 4UHTA 4BS9A 1ZK8A 4I98B 5DV5A 4D9JA 1YO5C 1ONVA 2NVQJ 3D5LA 3HJEA 1IRZA 4BQNA 1K6OA 4UY8I 1XDUA 4ZDLA 2NRAC 2K4BA 2ME6A 3BROA 3A1YA 3Q0UA 4Y33A 4QLCU 4U0WA 3C2GA 4L9NA 4I76A 4IQ4A 4UUSB 3VPRA 1JT6A 3V8LA 4I99C 2DT5A 1AKHB 2BY3A 1IGNA 2ZNZA 5IT3A 2R7DA 4CYDA 1X1DA 3KYDB 2VIXA 4ZYGA 3FF5A 4HEA2 2ZSHB 3IH2A 1FOXA 2E1NA 1BC8C 1HA8A 2DA6A 1SC7A 1OR7A 2BVMA 3BR1A 4DYCA 3IL2A 3TP0A 1U5TC 3GZNB 3FMQA 1BR1A 4P9FA 2L7FP 3HPGA 3F9KA 2CQ7A 2K40A 3CF2A 3CCLI 2X9DA 1A35A 3RKWA 1ZRDA 1OLTA 4X6AJ 1LDDA 1KZHA 3BG3A 4A3FJ 1G3SA 1T8IA 5ILSA 3ABUA 2Z5UA 1HBXG 2VXDA 3GVAA 1T98A 1WJAA 3OYJA 3OSFA 2KP6A 1WJ5A 3W6JB 2QKMB 3K70C 3ZQGA 2NVYJ 3BLYA 4M3GA 3U1KA 1U0JA 3L00A 2R5YB 1F9NA 1WH5A 2B0LA 3KLOA 3AL0B 1X1PA 2XROA 4KICA 2WBMA 3CMYA 2ID6A 5ICGA 4CCMA 1R49A 4HX7A 2JVHA 4BY1J 4QTRA 1V54H 1OMIA 3EUKL 1D0XA 4DOZA 2LF7A 1OCPA 2LNBA 1GT0C 1XC5A 5J1YA 2R7UA 2F5VA 2CQNA 1STZA 1UB9A 1FMWA 3SDGA 3DBHB 3FBIB 1QHGA 3CCEI 4KFCA 1AU7A 1CF7B 3GTMJ 2LSOA 3A02A 2F6CA 1RETA 2DDAA 2ZC2A 2HDDA 4A3GJ 4B47A 1FBQA 5LLQA 1LQ1A 1IF1A 4IPAA 3S1QJ 2L7ZA 3LMMA 4ASNA 4MTDA 1Y39A 1FNNA 3BC8A 2VPLA 4OIRF 1DUXC 4KNYA 3PQJA 1B8IB 1X1AA 4N4NB 2LC2A 2ZXHA 3A01B 2HXOA 3S8PA 4CZZA 1H9TA 5IT9Z 2Z2SB 5DTDA 1QA6A 2DA3A 1Z77A 2XHKA 1KU9A 3UNGC 2VJIA 3DKWA 4Y13A 2GM4A 2FNAA 2LKPA 2MBFA 2NS0A 1O4XA 4YELA 2L01A 5K5QA 1WJDA 2XV4S 2CGPA 1Y6IA 4KISA 4CICA 3BTCA 2JSCA 3CDHA 5KCMA 1SANA 2VKEA 2YR2A 3FXMA 3TW6A 3PIOF 3E6CC 1HDDC 2CQKA 1XX5A 4AIKA 4HW0A 4PCQA 2AO9A 2M30A 4HV6A 1H0MA 3M1CA 2FU4A 4C9YA 1WJBA 5DUKA 3JSPA 3REOA 3K1NA 2L9NA 3HHHA 3OYBA 2OBPA 2V1NA 2XAJA 2P7VB 2P5VA 4ESBA 1ETYA 1VQ7I 2IRFG 2JA2A 4BEHB 1VQLI 3GFIA 4RB3C 1MBFA 2ISZA 3OYLA 1HKQA 2VBZA 2WAEA 3VSLA 2JTVA 3HZJA 1H89C 3OR1C 2VLAA 2HQRA 3BCBA 2HS5A 3HSFA 1TWFJ 2X0LA 3E6MA 1R5GA 4RB2C 5JLWA 3FXRA 1UG2A 2K7LA 3FZVA 3HOUJ 2N8GA 5M5XJ 3IRQA 5BMZA 1T0FA 1MDMA 1R58A 2RN7A 3FMRA 5J47A 4MQVA 3G1MA 3DKXA 1FPQA 5KVRA 1B72A 2CFXA 2V26A 4LIVA 1BM9A 2WV1A 3PUFA 4H0EA 1S9HA 1G3WA 3ASOH 3KFWX 1IV6A 1P4WA 2MFZA 4M9ZA 3G2BA 3ZMUA 1MIJA 4BH9A 2W1OA 1SVOA 1DGRM 1IN7A 3P9IA 3F0CA 2K4JA 4CCNA 1LB2A 1RESA 2HU9A 2K5CA 1BI2A 1RR7A 3ZN0A 4XKCA 3OYNA 2HDWA 3H0DA 2OJED 1HF0A 3W6KB 2HI3A 2K9QA 1BBYA 3T1BA 3V42A 5HLHA 1BC7C 4LLNA 2R7ZJ 2VASA 3RCOA 2XGCA 4ZJZA 4KITB 5JR3A 2HPIA 4PDKA 2QEXI 2XSDC 1L0OC 2EFQA 2V79A 3OYKA 2R7VA 3ZMDA 5FO5A 4BDZA 3HB9A 1ZYRF 2NVTJ 1W7PA 1R1TA 3LSKA 3KE2A 4LGWA 1EH6A 1E2XA 5M3MJ 4LLLA 3SHFA 3ZP5A 2GQQA 4JK1X 4WWCA 3HRMA 2VBYA 3P9CA 2DOAA 4NUBA 5BQTA 1T6SA 4D5CA 5LHIA 2BHZA 2A68F 3ABKH 1VQPI 4HF2A 1QQIA 3A4CA 3BJ6A 3CMMA 2OV7A 3ECOA 2HTSA 5JHUA 1YJ9I 5F27A 1DDNA 2IPQX 3BTLA 3CC2I 1RZ4A 2HEOA 4QIWN 2Y31A 3HG9A 3SYTA 5FROA 1IV8A 3V4GA 4M3BA 3FXOA 5L3FA 2Q2EA 2Y48A 1I27A 5K1YA 4RBOA 5D5VB 4IHXA 3LAJA 5IOZA 4KT5C 4UUSA 2Y0MA 2M3AA 1FBUA 4B48A 3CCJI 1SFOJ 3K69A 2XGDA 2E1OA 1AKHA 4Y3OA 5L3EA 2ZJRF 3JAMZ 2CU7A 2WB1A 4KYWA 1ETQA 3M8JA 5EF6A 2PJRB 1Z91A 2E7XA 2EIMH 2QSFX 3CJTB 4HRIA 3IRRA 1MMGA 4L9TA 4ENJA 5DEQA 2F4IA 5B5EC 4W1UA 4XRMA 3E97A 3CO6C 3CCSI 4O5VA 3V7CA 3H36A 3CDLA 1BI1A 2DFIA 3BQZA 1JTYA 3VODA 5C4JJ 3H3ZA 9ANTA 4BAYA 3H9QA 1R23A 2WV0A 3R61A 3LFUA 5J4YA 2BY0A 5FB2A 4J19A 4C2UA 4E7ZA 1XMKA 4LK1F 3PQKA 4CH7A 2R5YA 1TL8A 1DP7P 3PFYA 1OR7C 3DWLE 1LEAA 1DPRA 2E5NA 2ZCWA 4RAFA 4Q4ZF 4DBQA 3GW2A 3IAS2 1OYWA 4HX4A 1W5TA 2HR3A 2K27A 1IN8A 1WVRA 2FBHA 3FHNA 4LK0F 3ZQHA 1IJWC 2DFEA 3G4SI 4IOAF 5ILVA 1JE8A 2ESHA 1ITYA 3ZR8X 5BNGA 3E6BA 2DK8A 3ZQFA 1W5CC 1ORKA 1MBEA 1RPWA 3K6GA 1CF7A 2J5OA 1LUJB 1BJZA 1GVJA 3TO7A 1X58A 3WGHA 3JREA 2CFOA 2TCTA 3L7WA 3OYCA 3M3YJ 2DTZA 4UB8C 4EEFG 1FOYA 2LR8A 5DD8A 3QPSA 2L7KA 5J8CA 3WU0A 3CUQB 4M71A 4MNUA 1SD4A 1K61A 3K7AJ 1ENHA 3K10A 2DA7A 4BU2A 5FLXZ 1ZHFA 1IRXA 1BOAA 2R0QC 1LPQA 5B1BH 2A69F 1B8IA 4DYQA 4EJVA 1JUSA 4YFNF 5JI6A 1ZKGA 4BNCA 4XIDA 3B6CA 2H6CA 3U2RA 3WTYC 3GTGJ 3F8NA 2X4HA 2GOMA 4YIRX 3CF5F 2KIQA 1FTZA 3J7AO 1Z7LA 5K7HA 4BL0B 2OQGA 1AHDP 3FX3A 2M2EA 5JLXA 3FXJA 4MFDA 5J1UA 1YLFA 4IKFA 2DDBA 3JTGA 2D45A 1FJLA 2FOWA 4RM3A 3DXJF 4EVIA 3PJRA 4LMYA 5LGUA 5J8FA 4CHUA 3PNVA 3ZGKA 2F48A 1REPC 1KYZA 3FXLA 3U9GA 3S15J 3GX4X 3O8GA 1FSEA 5FKKA 3WTWC 2UUZA 1CQTA 2DYRH 4JX6A 5C4XJ 2CYYA 2H1LA 2VE8A 1ETOA 1X4OA 1F5TA 4BXUA 2HVRA 2LLKA 2A5YB 2DO7A 2IGMA 2E35A 3R60A 4FETA 4ZYDA 3BOQA 4AM3A 1L3LA 4L0YB 2K3FA 1N25A 4Y4RA 2OUMA 2EILH 3ZQCA 1FYLA 3G1OA 2HYFA 2IGKA 3OYFA 2EIKH 4I09A 2MGQA 4D7NA 4IF4A 3D1NI 4BEHA 1WGXA 1NG7A 3ABLH 3MEXA 5HNFA 1T2KA 1TP4A 4G12A 4A3BJ 2DA2A 2FMLA 2XRLA 3B6AA 4XLHA 2UWMA 1J2XA 1X4PA 5EDNA 2I10A 1J0RA 4G7OF 1QVUA 1WI9A 1RUOA 4L5JA 2BHYA 1Z7UA 1XSDA 3K4MA 3I4PA 2KHMA 3ABTA 1IC8A 5GPAA 1MKMA 1R00A 5DCFA 5FD5A 1XMXA 3KYCB 5DCMB 1KA8A 3HXLA 4HNTA 3S14J 3F8FA 2HYGD 1N75A 1UCRA 2MG4A 5BS6A 4DZPA 3JAMK 2DT7B 2H09A 2HKOA 4QPOA 5IYBJ 3CJRB 2KDZA 2VODA 3RYRA 3MQ0A 2PX9A 1TNTA 3LQRA 3JRAA 3I4NJ 2JVGA 3OR2C 3M7GA 2JA5J 3HKZA 1UZCA 3ZMVA 1O3QA 2WA0A 2VKHA 1P9QC 2FE3A 4ENMA 5HLTA 1FIAA 2FBIA 1P7JA 1WI3A 3K1MA 5FLMJ 3K4NA 4GFBA 2DFHA 1PP7U 3TO9A 4F92B 1FT9A 1QVTA 3J80Z 3VYTB 4A3EJ 4L18B 1R6RA 3NQOA 1HW1A 2DMNA 4HPQA 1LKXA 5D8LB 5J3LA 2VL8A 2L5QA 4PSWA 1D5YA 5L3CA 1UG0A 3BG6A 2H8RA 3H5NA 1BIBA 4DIQA 2FQ4A 2VJ4A 1QGPA 2KRFA 3K70D 1U8RA 4KIFA 2KIUA 4LG0B 4RGRA 3PNYA 4I02A 4A0ZA 4IRIA 1DPUA 3VYUB 4U87A 1KYWA 1WJFA 3GFJA 3IWZA 4A12A 4M74A 3Q9VA 3H0GJ 2YU9J 1YYVA 1RI7A 2XPUA 1RUNA 2L4AA 3GUDA 4G6DA 1TW3A 2KRCA 3EUAA 3QU6A 4M73A 2R7QA 5AIPA 3TKYA 1XMAA 4XM3A 4ZC3A 1K7AA 2GXGA 4XSZF 3I5UA 4CCOA 2G7UA 4A5NA 1USTA 4RS8A 3H9JA 4ABZA 4HZFA 1T08B 5FLXK 5E3LA 3M07A 2DN0A 4AIDA 2ECBA 3Q0WA 2BXYA 3MZ8A 4P5OA 6PAXA 2Y0SN 1UHMA 3LA7A 3KX2A 4D1QA 3QODA 2BYVE 1XG1A 3BY6A 2YS9A 4P55A 1ZARA 3FDYA 5LRRA 1H88C 3RTRA 5AONA 5GAHJ 2YU3A 1IDZA 3ESWB 3LSJA 5D8KB 2FUG2 3DPUA 2F5FA 2IS1A 2EFOA 1IXRC 4A3IJ 1B9MA 1VF9A 1Y0NA 2ICWG 4EATA 2OQRA 5H6RA 5HOOA 3IV5A 2PJRA 4HQEA 3MMYB 1XGNA 2E2JJ 3HYIA 4XOPA 2KDOA 4HNVA 2QA4I 1IW7F 3CZ6A 1KQ8A 1X1CA 2PG4A 1VQ5I 2IT0A 4XKVA 1XGSA 3D0SA 3L2VA 4F52A 2MC3A 4PSXA 3RJPA 2XDVA 1MMSA 3V8JA 2L0KA 1ZREA 4DGWB 2CUJA 4PFPA 1YS7A 3FIWA 2R7WA 1JT0A 2TRTA 4G94A 4ITVA 1XGMA 3HSRA 3H5RA 2VKVA 3ASNH 3Q3SA 4E70A 4A3LJ 3S93A 1ZH5A 5CVIA 2E36A 3GZ6A 4PGGA 1IXCA 1TWCJ 2RDPA 4LB5A 5EYRA 2ZFWA 1HLVA 3WU2C 2W4SA 1HOMA 2XGEA 1O7FA 2X1DA 1O57A 4ETSA 1SVMA 3CLOA 1EV7A 1PDNC 2W00A 4C3HJ 3LSIA 4LOCA 3QPHA 3TP3A 2QF7A 3R6SA 1GVDA 3OMYA 4UV9A 2AS5F 2FEZA 3LSRA 4DQ2A 2E1CA 3AL0C 4Q5SF 1OJLA 1S6LA 4Z2YA 5K5OA 3DPTA 4ON0A 1E3OC 3I4MJ 3CCMI 4ANJA 2HDCA 3DLLF 3CUQA 2HOAA 2P6SA 3K9TA 5CPRB 2FOKA 4G6QA 2LY1A 3DTKA 2D5VA 2R7SA 2VQHA 4ENKA 3QYEA 3KYLA 2Q2EB 4BY7J 1DU0A 2CJJA 4CDGA 1H9GA 3TQNA 2O5RA 1XCVA 3HOXJ 3ZQQA 4XN3A 1UELB 2QKLB 4IXAA 5HODA 2MSYA 3BQYA 3J81Z 4IL6C 3B02A 4M3FA 3QRFF 4X1EA 2JQ7A 4RLFA 1ERDA 2EA4A 5DDGA 2E5ZA 3LWFA 4C2MJ 3J80K 4E7KA 2CUZA 1F36A 2OF7A 1JUPA 2ZMEB 5M3FJ 3GFLA 3PFIA 4EGZA 4Z6YA 2XC7A 1QPIA 4A3DJ 2ETHA 1I3QJ 3C3WA 3KETA 1ZGWA 1YOVB 2QSHX 4XLFA 3JCUC 4WXHA 2E71A 1TWGJ 2WAQN 3S1RJ 4BACA 1I50J 1MNDA 3VYSB 1MSFC 1LEBA 4D5FA 2V7FA 3IHUA 5F1RA 4XLEA 2MH9A 4HF1A 3OIQA 3M1EA 4LITA 2D1VA 2WY7Q 1X3WB 2DT6A 3GWZA 3H3UA 5FFXA 4E7LA 1RRJA 1LVAA 1N77A 1EH7A 1J75A 1D0ZA 2IA0A 3VWBA 4A3JJ 3ZOBA 1WWXA 3F6OA 1IN4A 1VNDA 3P9KA 1HXDA 5GAGJ 1P7IA 2XVCA 3R4KA 1W0UA 2NVUB 2EK5A 4JQFA 4XICA 2PLYA 4ZDPA 1O3SA 2LY2A 2W84A 5HLIA 4IHTA 1OCTC 2RV8A 3HDDA 3ZN1A 5E17F 4AD9A 4G9YA 2Y30A 2LH9A 2QENA 4HLXA 5GP9A 3SZPA 5TRDA 4ESFA 2Z3YA 3RKXA 1SMTA 1SD6A 3KZYA 1A31A 4CGZA 1VQOI 5B1AH 2DXIA 5HDGA 2LOOA 5TGTA 4U7DA 3IC7A 3FK7A 4WX9A 5DCMA 2PMZA 1U3EM 4J00A 1V55H 4A69C 2QSGX 2D2WA 4PJMA 2RVCA 3LOCA 2BOLA 3WGIA 3HPHA 3N97A 4UXNA 1APLC 3SDBA 4HA8A 1FWZA 3BZ6A 4U7BA 3ISPA 2RC4A 2DI3A 1A04A 3DBLB 3KIOA 4UVAA 1NHAA 4B1RA 1OCOH 1TQIA 1NH3A 1RNLA 1JGSA 2XF7A 2O7OA 1JJ6C 1KU3A 1TZLA 4M6YA 3W3CA 3OS0A 4XOTA 5FJ8J 2R93J 3K1PA 1HKTA 3DP7A 4Y15A 1YIOA 5J1RA 2PJPA 3PNTA 1PUFB 4MGRA 1A6QA 5DS9A 2O8XA 5JFRA 2PFBA 3HRUA 3GTOJ 3I64A 3O2PE 2J5PA 5EEGA 1Z6TA 3L1PA 2VOPA 4I01A 1MH4A 2KLOA 3VB2A 4B3XA 2NYXA 1WPKA 3IWFA 4Q47A 3BG9A 5ICFA 4F55A 2HOTA 2L9RA 3MD2A 4UVCA 2L9SA 2ELKA 1S7EA 5KHDA 4XK4A 1WH7A 3KP4A 1BJAA 4UVBA 2STWA 4LG0A 4S04A 2CW7A 5EEHA 3RZOJ 3IKTA 3W2WA 3LA2A 1Z9CA 1MBKA 2CW0F 3F21A 4YEJA 4LIUA 3IH4A 1I3AA 5FLVA 3PIPF 2X48A 3OYAA 3JRDA 2OAZA 3DU6A 5HDKA 3M9AA 2K9NA 2VN2A 2CH0A 2I8DA 2M5WA 2G9WA 1IUFA 1WJCA 2VONA 1T95A 2BZTA 1BN5A 4GYIA 4V2GA 5GTIC 5IOYA 3AG2H 3OY9A 1X19A 3L2QA 2OZUA 4G7ZF 1SFKA 4B43A 1FBSA 2R92J 3FKIJ 4RLQA 4D0PA 4A93J 3DCFA 2DLLA 5ICEA 1IRGA 2PMUA 4QWQA 3ERMA 2M8EA 5ED4A 3TOAA 3GTKJ 3LQQA 3CMAI 4E7SA 3J81K 2HQNA 2NXNB 2KL4A 3EETA 4XONA 2XAQA 5B66C 3WTUC 2IA1A 2A07F 1MBJA 2NS8A 1HDPA 4RGUA 3I9V2 1OYIA 2MA3A 3D5RC 4LFUA 3S1MJ 2XF6A 4HSTA 1MMAA 2B63J 3ABMH 3R0AA 2YUSA 2OD5A 4EGYA 3CQZJ 4IVNA 2BEOA 1XB4A 4GDFA 1FP2A 2ISYA 2B9SA 3W6VA 1R4NB 2R7FA 3J7YJ 5CQGA 3RKYA 1OPCA 2WC2A 3JW4A 2PQ8A 4JYKA 4LLGF 3E0JB 3HGYA 5J4VA 4B4CA 2STTA 4KJZA 2R5ZB 3RYPA 1S29A 3S2HJ 2E1MB 3P7NA 1S5LC 3W2AA 5BOXA 3CESA 2DW4A 3PO3J 1OISA 2V9PA 3KLNA 3O6BB 5KK1A 4GRIA 5J40A 5E8GA 3GTPJ 2KQRA 3TW7A 4FE7A 3T8TA 3KP7A 2QQBA 4WF2A 1EH8A 3KEQA 2DTRA 3FM3A 3GTQJ 5LEKA 1GLNA 1VQ9I 2DPDA 2X51A 4G6TB 5J6XA 2PN6A 5A2QZ 3JR9A 4Q48A 4I0BA 3QP6A 5LBQA 1YW9A 3COAC 2EFWA 1SAXA 2VBWA 4A3MJ 3NWSA 2K86A 5H6QA 4EMSA 3ML6A 1VFCA 5LHGA 1OCCH 3KCCA 4HYEA 2W57A 3G1LA 2W24A 1TW2A 2LMDA 4LD5A 4E7HA 1SMYF 3H9GA 5B3SH 3RPUA 4U88A 1MW7A 2HQ5A 3OS2A 3E5UA 3H3VK 5EGOB 3KEOA 2DJNA 1S72I 1QZZA 2X6OA 2QQ9A 3E3VA 4XLPF 2L3DA 1R4MB 2XAHA 3FXQA 2CMPA 2HNHA 2UV1A 1HW2A 2GBYA 3F8CA 3V8KA 1T39A 5JVGF 2KPMA 1Y8QB 4E4HA 2VT2A 1Q1VA 3U1DA 2XAFA 2X1CA 4KDPA 2Y2ZA 2ZMEA 2XPVA 4FHTA 1PP8F 2XB0X 2IW5A 5D6EA 4F7ZA 2A6TA 3B73A 1ZLKA 3NAUA 1D1CA 2P0WA 4CO8A 5M5YJ 5D5UB 1SAUA 3EYYA 1ETKA 4II2A 1LJ9A 3F3XA 3H35A 1W1WE 1MJ9A 2QWWA 4HV5A 4LG3A 5EZGA 1EA3A 3H92A 2KT0A 1TWAJ 2FQ3A 2HTJA 2ZJ2A 5TJJA 2QBYB 3F8MA 1UFMA 2DMTA 3AG1H 5E20A 5FRNA 2WTEA 3G3ZA 2QUFA 3Q9SA 4ENNA 5JHFA 4HF0A 4A0XA 2W7NA 1PUEE 1RR8C 4JOMA 1Y0UA 1VQKI 4PK4A 2F5EA 1UJ8A 4JX5A 3GCMA 3CO7C 2EV6A 1FY7A 4EM0B 3MVPA 5D5XB 2XKPA 3F8BA 1IG7A 2UZKA 2X6XA 2E2HJ 2JJ7A 1ULYA 4I6ZA 3MN2A 4YRVA 5JVTA 1BI3A 5F0HA 2PEXA 2CQXA 1ETWA 1YTYA 4KMFA 3OS1A 1R71A 2DA5A 2GZWA 3OOPA 1OCZH 1NK2P 1FP1D 3C1DA 4XBFA 3HRSA 5BPDA 2QQAA 1X3UA 2XAGA 2IGOA 1W7PD 3ZQ7A 4DYRA 5K5RA 3QOEA 3EQLF 1K4TA 3CP8A 3ROUA 1TC3C 2K9MA 3TDZC 2KZGA 5F64A 2H1KA 1I6XA 3WE3A 4S05A 4NHJA 1I6HJ 1HKSA 1I5ZA 2VXZA 1QU3A 2X85A 2DAOA 1OYYA 3RZDJ 1T33A 4M9XA 1YJNI 1MZBA 5E79C 2FRHA 2CO5A 2EZHA 3BPVA 5L3GA 3F6VA 4PJJA 3IP4B 1CGPA 2FBKA 1BOBA 1JKRC 1YRNB 1ON2A 1PUFA 2H27A 2LKXA 4H4KC 4OIPF 3PSFA 4M3DA 5KAIC 1IDYA 2FA5A 1SEUA 1YQAA 4UUTA 4ESJA 2LVSA 2JUCA 5CJ9A 3N05A 2JA8J 4ZYEA 2D1HA 1GUUA 3RQ4A 5F04A 4PJNA 1FZPB 1VI0A 2EINH 3GO5A 2XKOA 3X2QH 3AKZA 1TQMA 1XGOA 3HOWJ 2CWEA 3QWLA 5EEAA 3IH3A 1ZTRA 1IRFA 2OCCH 3LNQA 2Y69H 2LFBA 1JTXA 1MBGA 1V5FA 4YFXF 3JRBA 3FMSA 3G6EI 4C3IJ 2VC0A 2FD5A 2NNNA 3DTIA 1MSEC 4XSXF 3PL8A 3KP5A 4G8XA 5A2QK 3CC7I 2BY2A 2EB7A 2ZKZA 3HM5A 2JK3A 4CCJA 4M3EA 2IS2A 2E34A 1J5YA 2GXBA 4HQMA 5CVRA 3RIRA 4DZJA 2IP2A 3ZMTA 1ZRCA 4IHWA 3AG4H 1MGTA 3ERED 2ZBKA 3LFKA 4FASD 4JX4A 1YHQI 3RI4A 5IP7J 1BW5A 1DP3A 3QPLA 2V1XA 3QP5A 3BZCA 4NNJA 2LTPA 1Z3XA 1WRJA 3BT9A 3DPLC 3J7ZI 3JRGA 3NARA 2ACJA 4IRHA 4AYBA 2Z33A 4IJAA 3RQIA 1D5VA 2P8TA 2BV6A 3SZGA 4AIJA 1I39A 3E1SA 5D5WB 1ON1A 2BVLA 3BDDA 3BR0A 2DMPA 4XRSA 3HL2A 2KMUA 1A5JA 1ETXA 2YSRA 4KN7X 5HS8A 3I56I 3TGNA 2IJLA 3DEEA 4I2OA 3CCUI 2DA4A 2G0EA 3K4BA 2BBYA 3S2WA 1QNTA 2AXTC 2WAFA 3QQAA 2GA2A 3BPXA 3MZYA 4DBRA 1LFPA 4WXDA 1WQ2A 1HC8A 2XUBA 1DGWY 1UHWA 1Z6RA 5LFAA 3RSNA 1T0FC 3M8EA 3ULQB 5E3MA 1DQUA 1HW5A 2A05A 2EH3A 3F72A 4RB0A 3T0YA 4EJUA 3I59B 2R5ZA 3MZHA 2C6YA 3WTTC 1D1BA 4R1HA 4I0AA 4WXCA 4ZYAA 2HQAA 2EZIA 1Z21A 3GLLA 4FISA 2HGCA 2ZFUA 1JUMA 3MKYB 1OFCX 3ZPLA 1NG6A 2IVMA 3FWEA 1IN5A 1YE9A 1MH3A 2M45A 1VTNC 1ZAOA 5F1JA 3LSTA 5BPIA 1R1UA 5H20A 5LRSA 5KNLA 2EIJH 1VQNI 2RREA 3BTIA 2JA7J 1D8KA 2W48A 2BW3B 3Q0VA 3KP3A 3L2RA 2ELHA 4HG2A 2OC6A 3GF2A 1E17A 2Y75A 1TT0A 2L7MP 2IGNA 1GDTA 2LDUA 4A5MA 1ZGAA 1GV5A 4B8XA 3ZCOA 5EGOA 5CKTA 2CV0A 4OINF 5L3BA 2V6CA 1FSHA 3DLAA 4GXOA 1D1AA 2FNPA 2NAZA 3HKZN 3V7RA 4K2EA 4HAMA 1G59A 3E5XA 3U21A 1Z67A 2K02A 3L9FA 2JA6J 2EPFA 1A6IA 2OA4A 1UHSA 5M5WJ 1U9OA 2L2OA 1SFUA 3UR3C 2P81A 3K0LA 2H6BA 2VB6A 4FX4A 1MMNA 3GXOA 4F91B 4M9SA 3I0TA 3MFKA 4YFKF 2FXAA 1VQ6I 4BE1A 3Q5FA 1HCRA 4HNUA 2PBIA 1ZG1A 2OTJI 3OYGA 1V5GA 4BGDA 4L5EA 2HOSA 5E3OA 1YIJI 1RKWA 2KIFA 3IAM2 4BQAA 1F43A 3I58A 4S0HB 2QBYA 1TNSA 2COBA 3TL4X 1ZQ3P 1FOKA 2CV1A 5LEJA 2NOGA 2E2IJ 2MH2A 1G2HA 4G7HF 2LBFB 1XS9A 4OAZA 2ZMEC 4IZZA 3KP6A 4FQGA 2DK5A 1S8NA 2AXLA 4RB1A 4KA4A 1WZ2A 3HRTA 1JXSA 2XASA 1J09A 2E19A 4MLOA 2W82A 3LAPA 2JN6A 1JKOC 1ZRFA 2LRDA 4C30A 1T56A 2O03A 3ZMSA 2HXIA 1W5SA 4QSHA 4E7IA 1W0TA 2Q1ZB 2DOFA 3CCYA 2IS6A 4CSWA 3MKLA 1R5ID 2FJ1A 1B9NA 4XKBA 1ZELA 3WTZA 3M4OJ 1GHCA 4RGSA 1O7LA 1KU7A 2AHQA 3RDIA 1QPMA 2MD0A 4IX7A 3LL7A 2ZJPF 2PI0A 2X6YA 1JHHA 1W36C 1XN7A 4BE2A 1S7AA 2GIVA 3K4JA 3KP2A 3TOBA 1U9NA 2NS7A 4BHCA 2GA1A 1Z05A 2DMUA 5C44J 1VZ0A 3SZTA 4IHVA 3LSMA 4I7HA 2A61A 4C3JJ 3TEDA 3K2ZA 3VYRB 1YRNA 2P4WA 4AVZA 2HFHA 2MC4A 1NTCA 3K4LA 3CCVI 5C3EJ 1AOYA 3WU1B 1TLHB 2RAEA 2WY8Q 4L0ZB 1WFXA 2ESNA 2JZYA 3CTAA 1FIPA 3DF8A 3OYEA 2IA2A 2JWTA 4B09A 3I54A 5FGMA 3HBLA 1ZR4A 2Q8KA 4JP0A 3SFZA 4F3QA 2QZ8A 3HOSA 5E1ZB 4IRGA 2RKHA 4N4OB 2P7CB 1I1GA 5CVJA 1O3TA 1J59A 3AG3H 2IEKA 4IEJA 2G7HA 4BJ5C 4AU7A 1QZYA 4ZYHA 2JUGA 2RQQA 3BR6A 2HWVA 2K85A 3CCQI 1MNEA 1B4AA 3CP2A 4BHPA 4U0YA 4XN0A 4EV0A 5DUIA 2F2EA 4XLCA 4R79A 1IAWA 1PYVA 2HYJA 2LY9A 4OU0A 4IOCF 5LGTA 4LJZF 5FD6A 3AAFA 2DQLA 2RGVA 5HVQC 4HLYA 1V4RA 3EUHA 2EWNA 2PMHA 5GADJ 4CZCA 2XRNA 2LYCA 3FK6A 3OYHA 4AIHA 1XSVA 3PO2J 2R7TA 3H1CA 2M7AA 1IXSB 1LNWA 1QO0D 3BCAA 2O6GE 3K4KA 5KAFC 1G8XA 4OWRB 1OCRH 1U8BA 4AWXB 1P4AA 1FX7A 2YPRA 3A0HC 3K2AA 4BQQA 1A36A 3F23A 2H8WA 3WHBA 5K7FA 4Y52J 2IXSA 4XMYA 2YX4A 2MLGA 4PZJA 4B3AA 4A6DA 3OIOA 4EJOA 3S3OA 2OZ6A 5LD2C 2DQRA 2LG4A 1ETVA 3J7AY 4O3MA 1AA7A 1BR2A 2XF5A 4PJ0C 1XTAA 3HIFA 2ID3A 3ZMZA 1YJWI 4CA0A 4XR6A 1ODDA 3LSHA 1G3TA 3MKZA 2FX0A 3MWMA 3G71I 3I59A 1Y1VJ 3WE2A 4UUVA 1U5TB 2XB5A 1XDSA 4A3KJ 2V9KA 2CQQA 2K3PA 3VSKA 4BYYA 3O8HA 3I71A 4EM2A 1ZLJA 5FRMA 2M0CA 2KFDA 3JRIA 3HUGB 2QQ8A 1BW6A 2OPTA 1USSA 5HS7A 5AIQA 1POGA 1IZ1A 1F4KA 1D8JA 1ZGJA 3CJNA 3NEUA 3SFIA 3S17J 2BW3A 3C2BA 1FOWA 2CS3A 2E1MC 2E60A 2W85A 4MTEA 1BL0A 2COMA 2PMZN 2QVOA 4XKWA 1VQ8I 1WCMJ 4BBSJ 3WG9A 2ZXWH 2R7XA 1X3ZB 4XLNF 2R4GA 1H8AC 2Q0OA 1Z3YA 2A6HF 1JKQC 2MABA 5DYMA 2VOOA 1ZN2A 2F4OB 4L5IA 3OYIA 4YIIA 1LE8B 2QM3A 1LDKB 3WHCA 1FLIA 1QBJA 4GGGA 3LA3A 2NVXJ 4OMZA 1E3PA 3N4MA 3NRVA 3L2WA 3PSIA 2A3SA 3L2UA 1TQPA 3OIPA 4V19K 3SQNA 4YG2F 2ELJA 2M1BA 1HSJA 2EV5A 2YX7A 5GAEJ 3MKWB 2QLZA 2IAIA 2OCEA 1R9TJ 2KJCA 3M8FA 5HNHA 4FCYA 2UXXA 3HTSB 3S3NA 1YS6A 5TISC 3BP8A 3IKVA 4BQOA 3DV8A 4BBRJ 2VI6A 3A03A 3GZ5A 4FE4A 1P92A 4KIBA 3JSOA 3DBRB 5DM6F 3BJOA 1AWCA 4E7JA 1BA5A 2VE9A 3WODF 2WADA 1ACIA 4UB6C 3VEPA 2LBFA 2A6EF 2L4MA 4HSRA 1BIAA 1Y1WJ 3DTEA 3HEFA 2NNYA 4RAYA 3PUBA 4GYGA 2CV2A 4KN4X 3WGGA 1IO2A 2EZKA 2XAUA 5IYCJ 1X2MA 1FC3A 4ZTFA 1RKTA 4RAZA 4RAGA 4Y7NJ 2V4JC 2HZTA 2RNGA 4A6EA 3PM1A 1TWHJ 4NC6A 2VC1A 5F6FA 4UV8A 4TV7A 4IQJA 2R7RA 4X0GA 1MMDA 3FXUA 3MCZA 1FYMA 2NOJB 1KQ0A 3QYFA 2R7OA 5DD4A 3BG7A 2MYSA 2GIZA 2M4KA 2LKSA 1K78B 2KZVA 3VFZA 3GFMA 4HOBA 2O3FA 1YITI 3ECHA 5HLGA 4JBAA 2DMQA 2V9VA 1OQYA 2LREA 3D5SC 1V5EA 1JJ8C 3HOYJ 3S32A 1P6RA 3SXYA 1Q1HA 2M9HA 2Z16A 3OYMA 2ECCA 3QPTA 4O6JA 4NQWB 5IP6A 3SJMA 1TBXA 3DFGA 4QPQA 3S2DJ 2GLOA 1QZEA 3EYIA 2MD5A 3T5XA 4N9HA 2EBIA 4Y17A 1NK3P 4RA2A 3CUQC 5E1WA 4IHSA 4A3CJ 2FMYA 2ZJQF 5LGNA 2I5UA 4XLAA 4P1WA 3G73A 4CYCB 1HQCA 2V1DA 2JSPA 2TDXA 1J9IA 2KISA 2HOEA 3CC4I 1BI0A 5IT9K 1S7OA 1R1VA 1U6GA 2ZXIA 4BDYA 4J01A 2RQPA 2ZB9A 3RPQA 3S3MA 5D4RA 1KONA 2F4MB 4A0YA 3IUOA 3GYHX 2VJ5A 1D0YA 1K79A 2DFFA 4OIOF 2V1UA 3ZRGA 4XRSG 3T8RA 3JRFA 5CVVA 2JMWA 3FXKA 4ZH4F 2DPUA 3ZQLA 1TT5B 1LFUP 1M1EB 5IY5H 1B59A 4CCKA 4R8HA 5E3NA 4L9JA 1R5HA 2E7WA 5H2FC 4BHBA 1T38A 2CW8A 4MQ9F 2M7BA 3QYBA 4BJ6C 3L09A 3SEZA 3ONQA 2VBXA 2O9LA 1ZG5A 4GO1A 5DM7F 1KU2A 2AQFA 4CCLA 2LF8A 2XPWA 2CSOA 1YI2I 1ZG3A 1GV2A 1K4SA 4PFOA 3WTVC 1OKRA 4HDUA 4YIFA 1SD5A 3QAHA 5HDNA 3E5QA 5FFZA 4EJWA 1FYKA 3EUHC 2M87A 2WB1N 4HX8A 5FKMA 2ZXJA 3NWTA 2GWRA 2DU9A 2BGCA 3KZZA 4PUSA 1JGGA 1B1BA 5CQEA 5E18F 4MIMA 2DJIA 2B7EA 1ZR2A 4II3A 4DNCA 3V7SA 3W2VA 1E3HA 5EG0B 1IUYA 3RPUD 1YW8A 1SFEA 2W25A 1HSTA 1U5TA 1UAAA 2EV0A 2DOEA 1YW7A 2M34A 1GXQA 4MEYF 2KKOA 1DU6A 4MFEA 1MJAA 2X6WA 5FKOA 2CUFA 1GXPA 1I1SA 2GOXB 3A01A 2ZO4A 3HUGA 1D3YA 3OL4A 3TBIA 4AVPA 2Y9ZA 1LVKA 2P5LC 2CG4A 2BY1A 2EZLA 2KIMA 3CLQA 3TMOA 1PJRA 1R36A 3MAJA 3F22A 1P2FA 3BTJA 2IS4A 3E6DA 4OOIA 3FISA 3CMEI 1F1ZA 1WKMA 3LSPA 5D4SA 3JRCA 2JRMA 2FF4A 4NC8A 4C2TA 1EF4A 4MHGA 4XL9A 5HS9A 1B6AA 4L9VA 3L2CA 2L9VA 4NBQA 1WJEA 3QU3A 1YG2A 3FHZA 3HOVJ 3TDUC 2P5KA 1EJ9A 1SFXA 5F08A 1WHUA 2GAUA 2EFNA 2LK2A 1K6YA 5D6FA 2VQLA 1JI8A 1PVEA 2BE5F 4MO7A 4N9IA 1LE8A 3GTJJ 3BWGA 1E0EA 3OYDA 4BXFA 2K9SA 1W36D 2HPMA 4A2UA 2MLKA 1G3YA 3WG7H 4HBLA 2EJRA 2QCOA 3HHGA 4KIGA 4DJAA 1FMVA 2WWYA 2L02A 3OL3A 4KT6A 4WCGA 1R7JA 3DU5A 3CJQB 3VOEA 2HVSA 4ZDOA 3KZIC 1RIOH 3GLXA 2JPCA 4P96A 3S1NJ 5EZHA 5GPCA 2FSWA 5IP9J 2Z1DA 1JHFA 1KQ9A 4V2FA 4LB6B 1X2NA 2JT1A 2X1EA 4CUGA 2A5WA 3GMEA 1YX5A 3DQVC 3FBNB 3TO6A 5ICCA 3I55I 3UKGA 1G6NA 3ZQIA 5LHHA 3KEYA 4XNFA 4EQQA 4XQFA 3A0BC 2O0YA 4W97A 2Y0SA 1XSXA 2DBBA 3KPHA 4BXXJ 2OTLI 2XGXA 2DYSH 3OOUA 3HC7A 3WTXC 2RNJA 2GXAA 2ADUA 3VDXA 4ZZDA 3WTSC 3FKJA 1XD7A 2MW8A 1Y56A 3OV8A 5IPAA 4GCVA
chains in the Genus database with same CATH topology
1P4XA 2Z99A 3HTUA 3I53A 4P9UA 1TTYA 1C0WA 2UXNA 1KGSA 1K78A 4FT8A 4EM1A 4EJTA 4M72A 1W4MA 1R22A 2R3SA 2EA2A 2HKXA 4NQWA 5ERIA 4HDVA 3EDPA 1G4DA 2O61A 3CUOA 3BJAA 3O3KA 1WSUA 3DEUA 3HSEA 3C18A 4OIQF 4UNOA 3ELKA 2L54A 4ZZLA 4M6XA 1O3RA 4NB5A 2ZNYA 5CVUA 3C7JA 1MDMB 5CYVA 1J7KA 4OMYA 1Z1DA 5E8IA 2H94A 2VT3A 4RGXA 2JPBA 5CLSA 1YFHA 2QYOA 3HOTA 2JRTA 3GEZA 5L3DA 1MJBA 2KJBA 4FX0A 1XCBA 4KMUX 3JTHA 5ILUA 1U2WA 4U0VA 4CXFA 2XIGA 1SD7A 4MEXF 3R0JA 2F5DA 3QOPA 3FM5A 4PGHA 1LDJA 1S3JA 1W7PB 4XRFA 1U78A 5E1XA 2EFPA 2OU2A 4WK8F 4KUMA 1MD0A 1V3FA 2F5CA 1IN6A 4N0BA 2Z9OA 2P6TA 4UHTA 1YO5C 5DV5A 4I98B 1ONVA 3D5LA 1K6OA 1XDUA 2NRAC 2K4BA 3BROA 4QLCU 4U0WA 4L9NA 3V8LA 2DT5A 2ZNZA 5IT3A 4CYDA 2R7DA 4ZYGA 3FF5A 2E1NA 1BC8C 1OR7A 3IL2A 1U5TC 3FMQA 4P9FA 3RKWA 1ZRDA 1LDDA 1G3SA 5ILSA 3ABUA 2Z5UA 1HBXG 3GVAA 1T98A 3W6JB 3L00A 1F9NA 2B0LA 3KLOA 2XROA 4KICA 5ICGA 4HX7A 1OMIA 2LF7A 2LNBA 1STZA 1UB9A 4KFCA 1CF7B 2LSOA 1FBQA 5LLQA 1LQ1A 1IF1A 4IPAA 4ASNA 4MTDA 1FNNA 4OIRF 1DUXC 4KNYA 3PQJA 5IT9Z 4CZZA 1H9TA 2XHKA 1KU9A 3DKWA 4Y13A 2FNAA 2LKPA 2MBFA 2NS0A 2L01A 5K5QA 2XV4S 2CGPA 4CICA 2JSCA 3CDHA 2YR2A 3E6CC 2CQKA 4AIKA 4HW0A 4PCQA 2M30A 4HV6A 1H0MA 2FU4A 5DUKA 3JSPA 3REOA 3K1NA 3HHHA 2OBPA 2IRFG 2XAJA 2P7VB 2P5VA 4ESBA 3GFIA 4RB3C 2ISZA 1HKQA 2VBZA 2JTVA 2HQRA 2HS5A 3HSFA 2X0LA 3E6MA 1R5GA 4RB2C 3FXRA 2K7LA 3FZVA 3IRQA 5BMZA 1T0FA 1MDMA 1R58A 2RN7A 3FMRA 4MQVA 5KVRA 1FPQA 2CFXA 1BM9A 4H0EA 1G3WA 3KFWX 1P4WA 4M9ZA 3ZMUA 4BH9A 1IN7A 3P9IA 2K4JA 1LB2A 1BI2A 3ZN0A 3W6KB 1BBYA 3T1BA 5HLHA 4LLNA 1BC7C 5JR3A 4PDKA 1L0OC 2EFQA 2V79A 3ZMDA 5FO5A 1ZYRF 1W7PA 1R1TA 3KE2A 4LGWA 1EH6A 1E2XA 4LLLA 3SHFA 3ZP5A 2GQQA 4JK1X 4WWCA 3HRMA 2VBYA 3P9CA 5BQTA 1T6SA 5LHIA 2A68F 4HF2A 1QQIA 3BJ6A 3ECOA 2HTSA 5JHUA 1DDNA 2IPQX 1RZ4A 2HEOA 3V4GA 5L3FA 2Q2EA 2Y48A 1I27A 5K1YA 5D5VB 3LAJA 4KT5C 2Y0MA 1FBUA 3K69A 5L3EA 3JAMZ 4KYWA 1Z91A 2E7XA 3IRRA 4L9TA 4ENJA 5DEQA 3E97A 3CO6C 4O5VA 3V7CA 1BI1A 2DFIA 3VODA 3H3ZA 4BAYA 1R23A 2WV0A 3R61A 5FB2A 1XMKA 4LK1F 3PQKA 1DP7P 1LEAA 1DPRA 2ZCWA 4Q4ZF 3GW2A 1OYWA 4HX4A 1W5TA 2HR3A 2K27A 1IN8A 2FBHA 4LK0F 5ILVA 1JE8A 2ESHA 3E6BA 2DK8A 1CF7A 2J5OA 1GVJA 3TO7A 3WGHA 3L7WA 5DD8A 5J8CA 3WU0A 3CUQB 4M71A 4MNUA 1SD4A 5FLXZ 1ZHFA 1BOAA 2A69F 5JI6A 4EJVA 4YFNF 4BNCA 2H6CA 3U2RA 3WTYC 3F8NA 2X4HA 3J7AO 2OQGA 3FX3A 1YLFA 3JTGA 2D45A 4EVIA 3DXJF 4LMYA 5LGUA 5J8FA 4CHUA 1REPC 1KYZA 3U9GA 3GX4X 1FSEA 3WTWC 2CYYA 2VE8A 1F5TA 4BXUA 2A5YB 2DO7A 3R60A 4ZYDA 3BOQA 1L3LA 4L0YB 1FYLA 2HYFA 4I09A 4IF4A 3MEXA 1T2KA 2FMLA 2UWMA 1J2XA 1J0RA 4G7OF 1WI9A 1RUOA 4L5JA 1Z7UA 1XSDA 3I4PA 3ABTA 1MKMA 1R00A 5DCFA 5FD5A 5DCMB 1KA8A 3F8FA 2HYGD 1UCRA 5BS6A 3JAMK 2H09A 2HKOA 2VODA 3RYRA 3MQ0A 1TNTA 3LQRA 3M7GA 3ZMVA 1O3QA 2FE3A 4ENMA 2FBIA 3K1MA 1PP7U 3TO9A 1FT9A 3J80Z 4L18B 3NQOA 1HW1A 5D8LB 5L3CA 1BIBA 1QGPA 2KRFA 1U8RA 4KIFA 2KIUA 4LG0B 4RGRA 4A0ZA 4I02A 4IRIA 1DPUA 1KYWA 4A12A 3GFJA 3IWZA 4M74A 3Q9VA 1YYVA 1RI7A 1RUNA 2L4AA 3GUDA 4G6DA 1TW3A 3QU6A 4M73A 3TKYA 5AIPA 1XMAA 1K7AA 2GXGA 4XSZF 3I5UA 2G7UA 4A5NA 1USTA 4RS8A 5FLXK 4HZFA 4P5OA 6PAXA 1UHMA 3LA7A 2BYVE 3BY6A 4P55A 1ZARA 5LRRA 3RTRA 5AONA 2YU3A 5D8KB 2F5FA 2EFOA 1IXRC 1B9MA 2OQRA 5H6RA 5HOOA 4HQEA 1XGNA 3HYIA 1IW7F 1KQ8A 2PG4A 2IT0A 1XGSA 3D0SA 2MC3A 3RJPA 3V8JA 1ZREA 1YS7A 4G94A 1XGMA 3HSRA 4E70A 1ZH5A 5CVIA 3GZ6A 4PGGA 1IXCA 2RDPA 4LB5A 2ZFWA 1O7FA 4ETSA 1O57A 3CLOA 1EV7A 1PDNC 3QPHA 3R6SA 4UV9A 2AS5F 2FEZA 2E1CA 4DQ2A 4Q5SF 1S6LA 4Z2YA 5K5OA 3DPTA 4ON0A 2HDCA 3CUQA 2P6SA 3K9TA 2FOKA 4G6QA 4ENKA 4CDGA 1H9GA 3TQNA 1XCVA 4IXAA 3J81Z 3B02A 3QRFF 2EA4A 5DDGA 3LWFA 3J80K 2ZMEB 3GFLA 3PFIA 4EGZA 2ETHA 3C3WA 3KETA 4WXHA 1LEBA 3IHUA 5F1RA 2MH9A 4HF1A 3M1EA 2D1VA 3GWZA 3H3UA 5FFXA 1J75A 1LVAA 1EH7A 2IA0A 1WWXA 3F6OA 1IN4A 3P9KA 1HXDA 2XVCA 3R4KA 2EK5A 4JQFA 2PLYA 1O3SA 2W84A 5HLIA 4IHTA 2RV8A 3ZN1A 5E17F 4AD9A 4G9YA 2QENA 3SZPA 4HLXA 5TRDA 4ESFA 3RKXA 2Z3YA 1SMTA 1SD6A 3KZYA 4CGZA 5HDGA 4U7DA 3IC7A 4WX9A 5DCMA 1U3EM 2D2WA 2RVCA 3WGIA 3N97A 4UXNA 4HA8A 1FWZA 3BZ6A 4U7BA 3ISPA 2RC4A 2DI3A 1A04A 4UVAA 1NHAA 1TQIA 1RNLA 1JGSA 1KU3A 4M6YA 3K1PA 1HKTA 3DP7A 4Y15A 1YIOA 2PJPA 4MGRA 2O8XA 5JFRA 2PFBA 3HRUA 3I64A 3O2PE 2J5PA 5EEGA 1Z6TA 2VOPA 4I01A 3VB2A 2NYXA 3IWFA 4Q47A 5ICFA 4UVCA 3KP4A 1BJAA 4UVBA 2STWA 4LG0A 4S04A 5EEHA 3IKTA 3LA2A 1Z9CA 2CW0F 3F21A 2OAZA 5HDKA 3M9AA 2VN2A 2M5WA 2G9WA 2VONA 4GYIA 1BN5A 2OZUA 4G7ZF 1FBSA 4D0PA 5ICEA 2DLLA 1IRGA 2PMUA 4QWQA 2M8EA 5ED4A 3TOAA 3LQQA 3J81K 2HQNA 3EETA 2XAQA 3WTUC 2IA1A 2A07F 4RGUA 1OYIA 2MA3A 4LFUA 3R0AA 2OD5A 4EGYA 4IVNA 2BEOA 1XB4A 1FP2A 2ISYA 2R7FA 3RKYA 1OPCA 2WC2A 3JW4A 2PQ8A 4LLGF 2STTA 3RYPA 1S29A 3P7NA 5BOXA 2DW4A 3KLNA 3O6BB 5KK1A 5E8GA 3T8TA 3KP7A 2QQBA 4WF2A 1EH8A 3KEQA 2DTRA 3FM3A 5LEKA 2DPDA 5J6XA 2PN6A 5A2QZ 4Q48A 4I0BA 3QP6A 5LBQA 1YW9A 3COAC 2EFWA 1SAXA 2VBWA 2K86A 5H6QA 4EMSA 3ML6A 5LHGA 3KCCA 4HYEA 2W57A 2W24A 1TW2A 4LD5A 1SMYF 3RPUA 4U88A 3E5UA 3KEOA 1QZZA 2QQ9A 3E3VA 4XLPF 2L3DA 2XAHA 3FXQA 1HW2A 3F8CA 3V8KA 1T39A 2VT2A 3U1DA 2XAFA 4KDPA 2ZMEA 4FHTA 1PP8F 2IW5A 5D6EA 4F7ZA 3B73A 1ZLKA 4CO8A 5D5UB 3EYYA 1LJ9A 3F3XA 1MJ9A 2QWWA 4HV5A 3H92A 2FQ3A 2HTJA 2ZJ2A 5TJJA 2QBYB 3F8MA 1UFMA 5E20A 2WTEA 3G3ZA 2QUFA 3Q9SA 4ENNA 1PUEE 4HF0A 4A0XA 1Y0UA 2F5EA 3CO7C 2EV6A 1FY7A 4EM0B 5D5XB 2XKPA 3F8BA 2UZKA 1ULYA 5JVTA 1BI3A 2PEXA 1YTYA 4KMFA 2GZWA 3OOPA 1FP1D 3C1DA 4XBFA 3HRSA 5BPDA 2QQAA 1X3UA 2XAGA 3ZQ7A 1W7PD 5K5RA 3EQLF 3ROUA 3TDZC 5F64A 1I6XA 3WE3A 4S05A 4NHJA 1HKSA 1I5ZA 2VXZA 2DAOA 1OYYA 4M9XA 1MZBA 2FRHA 2CO5A 3BPVA 5L3GA 3F6VA 1CGPA 2FBKA 1ON2A 2H27A 4OIPF 2FA5A 1YQAA 4ESJA 5CJ9A 4ZYEA 2D1HA 1FZPB 3GO5A 2XKOA 1TQMA 1XGOA 2CWEA 1IRFA 4YFXF 3FMSA 2VC0A 2NNNA 4XSXF 3KP5A 4G8XA 5A2QK 2EB7A 2ZKZA 1J5YA 2GXBA 4HQMA 5CVRA 3RIRA 2IP2A 3ZMTA 1ZRCA 1MGTA 3ERED 2ZBKA 3LFKA 3RI4A 2V1XA 3QP5A 1WRJA 3DPLC 2ACJA 4IRHA 2Z33A 4IJAA 1D5VA 2P8TA 2BV6A 4AIJA 5D5WB 1ON1A 3BDDA 4KN7X 2YSRA 5HS8A 3TGNA 2IJLA 4I2OA 2BBYA 1QNTA 2GA2A 3BPXA 3MZYA 4WXDA 1WQ2A 2XUBA 1UHWA 1Z6RA 3M8EA 3ULQB 1HW5A 3F72A 4EJUA 2C6YA 4RB0A 3T0YA 3MZHA 3I59B 3WTTC 4R1HA 4I0AA 4WXCA 2HGCA 3ZPLA 2IVMA 3FWEA 1IN5A 2M45A 1VTNC 1ZAOA 3LSTA 5BPIA 1R1UA 5H20A 5LRSA 1D8KA 3KP3A 2ELHA 3GF2A 1E17A 2Y75A 4GCVA 2LDUA 4A5MA 1ZGAA 4B8XA 4OINF 5L3BA 2V6CA 1FSHA 4GXOA 2FNPA 2NAZA 3V7RA 4K2EA 4HAMA 3E5XA 2K02A 3L9FA 2OA4A 1SFUA 3K0LA 2H6BA 4FX4A 3GXOA 4M9SA 3I0TA 3MFKA 4YFKF 2FXAA 3Q5FA 2PBIA 1ZG1A 2KIFA 4BQAA 3I58A 2QBYA 1TNSA 1FOKA 5LEJA 2MH2A 4G7HF 3KP6A 2DK5A 1S8NA 2AXLA 4RB1A 4KA4A 3HRTA 1JXSA 2XASA 3LAPA 1ZRFA 2O03A 3ZMSA 1W5SA 1B9NA 3WTZA 1GHCA 4RGSA 1O7LA 1KU7A 3RDIA 1QPMA 2PI0A 1JHHA 1XN7A 1S7AA 2GIVA 3KP2A 3TOBA 4BHCA 2GA1A 1Z05A 3SZTA 4I7HA 2A61A 3K2ZA 2P4WA 2HFHA 1AOYA 3WU1B 1TLHB 4L0ZB 2ESNA 3CTAA 2JZYA 3DF8A 2IA2A 4B09A 3I54A 5FGMA 2Q8KA 3SFZA 2QZ8A 3HOSA 5E1ZB 4IRGA 2RKHA 2P7CB 1I1GA 5CVJA 1O3TA 1J59A 2G7HA 1QZYA 4ZYHA 2HWVA 1B4AA 4BHPA 4U0YA 4EV0A 5DUIA 2F2EA 4R79A 1IAWA 4OU0A 5LGTA 4LJZF 5FD6A 3AAFA 2DQLA 2RGVA 5HVQC 4HLYA 1V4RA 3EUHA 2EWNA 2PMHA 2XRNA 4AIHA 1XSVA 1IXSB 1LNWA 1QO0D 2O6GE 4AWXB 1P4AA 1FX7A 2YPRA 3F23A 2YX4A 2MLGA 4PZJA 4A6DA 4EJOA 2OZ6A 2DQRA 4O3MA 3HIFA 3ZMZA 1ODDA 1G3TA 3MWMA 3I59A 3WE2A 4UUVA 1U5TB 1XDSA 4BYYA 3I71A 4EM2A 1ZLJA 1USSA 5HS7A 5AIQA 1IZ1A 1F4KA 1D8JA 1ZGJA 3CJNA 3NEUA 2W85A 4MTEA 2COMA 2QVOA 3WG9A 4XLNF 2Q0OA 2A6HF 5DYMA 2VOOA 1ZN2A 4L5IA 4YIIA 2QM3A 1LDKB 1FLIA 1QBJA 4GGGA 3LA3A 4OMZA 3N4MA 3NRVA 2A3SA 1TQPA 3SQNA 4YG2F 2M1BA 1HSJA 2EV5A 2YX7A 2QLZA 2KJCA 3M8FA 2UXXA 3HTSB 1YS6A 3BP8A 3IKVA 3DV8A 3GZ5A 1P92A 4KIBA 3JSOA 3BJOA 1AWCA 2VE9A 3WODF 3VEPA 2A6EF 2L4MA 1BIAA 2NNYA 4RAYA 4GYGA 4KN4X 3WGGA 1FC3A 4RAZA 2HZTA 4A6EA 2VC1A 5F6FA 4UV8A 4TV7A 3FXUA 3MCZA 1FYMA 1KQ0A 5DD4A 1K78B 3VFZA 3GFMA 4HOBA 2O3FA 3ECHA 5HLGA 4JBAA 2V9VA 1P6RA 3SXYA 1Q1HA 3QPTA 4O6JA 1TBXA 3DFGA 3EYIA 2MD5A 3T5XA 4N9HA 4Y17A 3CUQC 5E1WA 4IHSA 2FMYA 5LGNA 3G73A 1HQCA 2V1DA 2TDXA 1J9IA 2HOEA 1BI0A 5IT9K 1S7OA 1R1VA 1U6GA 2RQPA 3RPQA 5D4RA 4A0YA 3GYHX 1K79A 4OIOF 2V1UA 3T8RA 5CVVA 4ZH4F 2DPUA 1B59A 4R8HA 4L9JA 1R5HA 2E7WA 4BHBA 1T38A 4MQ9F 3L09A 2VBXA 1ZG5A 4GO1A 1KU2A 2LF8A 2CSOA 1ZG3A 3WTVC 1OKRA 4HDUA 4YIFA 1SD5A 3QAHA 5HDNA 3E5QA 5FFZA 4EJWA 1FYKA 2M87A 4HX8A 2ZXJA 2GWRA 2DU9A 2BGCA 3KZZA 1B1BA 5E18F 4DNCA 3V7SA 1IUYA 1YW8A 1SFEA 2W25A 1HSTA 1U5TA 2EV0A 1YW7A 1GXQA 4MEYF 2KKOA 1MJAA 1I1SA 1GXPA 2ZO4A 3HUGA 1D3YA 4AVPA 2P5LC 2CG4A 2KIMA 3MAJA 1R36A 3F22A 1P2FA 3E6DA 4OOIA 1F1ZA 1WKMA 5D4SA 2FF4A 4MHGA 5HS9A 1B6AA 4L9VA 3L2CA 3QU3A 3FHZA 1YG2A 3TDUC 2P5KA 1SFXA 2GAUA 2EFNA 5D6FA 2BE5F 4N9IA 3BWGA 4A2UA 2MLKA 1G3YA 4HBLA 2EJRA 3HHGA 4KIGA 2WWYA 2L02A 4WCGA 1R7JA 3VOEA 1RIOH 3GLXA 2JPCA 4P96A 2FSWA 1JHFA 1KQ9A 4LB6B 2JT1A 3DQVC 3TO6A 5ICCA 1G6NA 5LHHA 4EQQA 2O0YA 1XSXA 2DBBA 2XGXA 3WTXC 2RNJA 2ADUA 4ZZDA 3WTSC 1XD7A 3OV8A 3S2WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1P4X A;  2Z99 A;  3HTU A;  3I53 A;  4P9U A;  1TTY A;  1C0W A;  2UXN A;  1KGS A;  1K78 A;  4FT8 A;  4EM1 A;  4EJT A;  4M72 A;  1W4M A;  1R22 A;  2R3S A;  2EA2 A;  2HKX A;  4NQW A;  5ERI A;  4HDV A;  3EDP A;  1G4D A;  2O61 A;  3CUO A;  3BJA A;  3O3K A;  1WSU A;  3DEU A;  3HSE A;  3C18 A;  4OIQ F;  4UNO A;  3ELK A;  2L54 A;  4ZZL A;  4M6X A;  1O3R A;  4NB5 A;  2ZNY A;  5CVU A;  3C7J A;  1MDM B;  5CYV A;  1J7K A;  4OMY A;  1Z1D A;  5E8I A;  2H94 A;  2VT3 A;  4RGX A;  2JPB A;  5CLS A;  1YFH A;  2QYO A;  3HOT A;  2JRT A;  3GEZ A;  5L3D A;  1MJB A;  2KJB A;  4FX0 A;  1XCB A;  4KMU X;  3JTH A;  5ILU A;  1U2W A;  4U0V A;  4CXF A;  2XIG A;  1SD7 A;  4MEX F;  3R0J A;  2F5D A;  3QOP A;  3FM5 A;  4PGH A;  1LDJ A;  1S3J A;  1W7P B;  4XRF A;  1U78 A;  5E1X A;  2EFP A;  2OU2 A;  4WK8 F;  4KUM A;  1MD0 A;  1V3F A;  2F5C A;  1IN6 A;  4N0B A;  2Z9O A;  2P6T A;  4UHT A;  1YO5 C;  5DV5 A;  4I98 B;  1ONV A;  3D5L A;  1K6O A;  1XDU A;  2NRA C;  2K4B A;  3BRO A;  4QLC U;  4U0W A;  4L9N A;  3V8L A;  2DT5 A;  2ZNZ A;  5IT3 A;  4CYD A;  2R7D A;  4ZYG A;  3FF5 A;  2E1N A;  1BC8 C;  1OR7 A;  3IL2 A;  1U5T C;  3FMQ A;  4P9F A;  3RKW A;  1ZRD A;  1LDD A;  1G3S A;  5ILS A;  3ABU A;  2Z5U A;  1HBX G;  3GVA A;  1T98 A;  3W6J B;  3L00 A;  1F9N A;  2B0L A;  3KLO A;  2XRO A;  4KIC A;  5ICG A;  4HX7 A;  1OMI A;  2LF7 A;  2LNB A;  1STZ A;  1UB9 A;  4KFC A;  1CF7 B;  2LSO A;  1FBQ A;  5LLQ A;  1LQ1 A;  1IF1 A;  4IPA A;  4ASN A;  4MTD A;  1FNN A;  4OIR F;  1DUX C;  4KNY A;  3PQJ A;  5IT9 Z;  4CZZ A;  1H9T A;  2XHK A;  1KU9 A;  3DKW A;  4Y13 A;  2FNA A;  2LKP A;  2MBF A;  2NS0 A;  2L01 A;  5K5Q A;  2XV4 S;  2CGP A;  4CIC A;  2JSC A;  3CDH A;  2YR2 A;  3E6C C;  2CQK A;  4AIK A;  4HW0 A;  4PCQ A;  2M30 A;  4HV6 A;  1H0M A;  2FU4 A;  5DUK A;  3JSP A;  3REO A;  3K1N A;  3HHH A;  2OBP A;  2IRF G;  2XAJ A;  2P7V B;  2P5V A;  4ESB A;  3GFI A;  4RB3 C;  2ISZ A;  1HKQ A;  2VBZ A;  2JTV A;  2HQR A;  2HS5 A;  3HSF A;  2X0L A;  3E6M A;  1R5G A;  4RB2 C;  3FXR A;  2K7L A;  3FZV A;  3IRQ A;  5BMZ A;  1T0F A;  1MDM A;  1R58 A;  2RN7 A;  3FMR A;  4MQV A;  5KVR A;  1FPQ A;  2CFX A;  1BM9 A;  4H0E A;  1G3W A;  3KFW X;  1P4W A;  4M9Z A;  3ZMU A;  4BH9 A;  1IN7 A;  3P9I A;  2K4J A;  1LB2 A;  1BI2 A;  3ZN0 A;  3W6K B;  1BBY A;  3T1B A;  5HLH A;  4LLN A;  1BC7 C;  5JR3 A;  4PDK A;  1L0O C;  2EFQ A;  2V79 A;  3ZMD A;  5FO5 A;  1ZYR F;  1W7P A;  1R1T A;  3KE2 A;  4LGW A;  1EH6 A;  1E2X A;  4LLL A;  3SHF A;  3ZP5 A;  2GQQ A;  4JK1 X;  4WWC A;  3HRM A;  2VBY A;  3P9C A;  5BQT A;  1T6S A;  5LHI A;  2A68 F;  4HF2 A;  1QQI A;  3BJ6 A;  3ECO A;  2HTS A;  5JHU A;  1DDN A;  2IPQ X;  1RZ4 A;  2HEO A;  3V4G A;  5L3F A;  2Q2E A;  2Y48 A;  1I27 A;  5K1Y A;  5D5V B;  3LAJ A;  4KT5 C;  2Y0M A;  1FBU A;  3K69 A;  5L3E A;  3JAM Z;  4KYW A;  1Z91 A;  2E7X A;  3IRR A;  4L9T A;  4ENJ A;  5DEQ A;  3E97 A;  3CO6 C;  4O5V A;  3V7C A;  1BI1 A;  2DFI A;  3VOD A;  3H3Z A;  4BAY A;  1R23 A;  2WV0 A;  3R61 A;  5FB2 A;  1XMK A;  4LK1 F;  3PQK A;  1DP7 P;  1LEA A;  1DPR A;  2ZCW A;  4Q4Z F;  3GW2 A;  1OYW A;  4HX4 A;  1W5T A;  2HR3 A;  2K27 A;  1IN8 A;  2FBH A;  4LK0 F;  5ILV A;  1JE8 A;  2ESH A;  3E6B A;  2DK8 A;  1CF7 A;  2J5O A;  1GVJ A;  3TO7 A;  3WGH A;  3L7W A;  5DD8 A;  5J8C A;  3WU0 A;  3CUQ B;  4M71 A;  4MNU A;  1SD4 A;  5FLX Z;  1ZHF A;  1BOA A;  2A69 F;  5JI6 A;  4EJV A;  4YFN F;  4BNC A;  2H6C A;  3U2R A;  3WTY C;  3F8N A;  2X4H A;  3J7A O;  2OQG A;  3FX3 A;  1YLF A;  3JTG A;  2D45 A;  4EVI A;  3DXJ F;  4LMY A;  5LGU A;  5J8F A;  4CHU A;  1REP C;  1KYZ A;  3U9G A;  3GX4 X;  1FSE A;  3WTW C;  2CYY A;  2VE8 A;  1F5T A;  4BXU A;  2A5Y B;  2DO7 A;  3R60 A;  4ZYD A;  3BOQ A;  1L3L A;  4L0Y B;  1FYL A;  2HYF A;  4I09 A;  4IF4 A;  3MEX A;  1T2K A;  2FML A;  2UWM A;  1J2X A;  1J0R A;  4G7O F;  1WI9 A;  1RUO A;  4L5J A;  1Z7U A;  1XSD A;  3I4P A;  3ABT A;  1MKM A;  1R00 A;  5DCF A;  5FD5 A;  5DCM B;  1KA8 A;  3F8F A;  2HYG D;  1UCR A;  5BS6 A;  3JAM K;  2H09 A;  2HKO A;  2VOD A;  3RYR A;  3MQ0 A;  1TNT A;  3LQR A;  3M7G A;  3ZMV A;  1O3Q A;  2FE3 A;  4ENM A;  2FBI A;  3K1M A;  1PP7 U;  3TO9 A;  1FT9 A;  3J80 Z;  4L18 B;  3NQO A;  1HW1 A;  5D8L B;  5L3C A;  1BIB A;  1QGP A;  2KRF A;  1U8R A;  4KIF A;  2KIU A;  4LG0 B;  4RGR A;  4A0Z A;  4I02 A;  4IRI A;  1DPU A;  1KYW A;  4A12 A;  3GFJ A;  3IWZ A;  4M74 A;  3Q9V A;  1YYV A;  1RI7 A;  1RUN A;  2L4A A;  3GUD A;  4G6D A;  1TW3 A;  3QU6 A;  4M73 A;  3TKY A;  5AIP A;  1XMA A;  1K7A A;  2GXG A;  4XSZ F;  3I5U A;  2G7U A;  4A5N A;  1UST A;  4RS8 A;  5FLX K;  4HZF A;  4P5O A;  6PAX A;  1UHM A;  3LA7 A;  2BYV E;  3BY6 A;  4P55 A;  1ZAR A;  5LRR A;  3RTR A;  5AON A;  2YU3 A;  5D8K B;  2F5F A;  2EFO A;  1IXR C;  1B9M A;  2OQR A;  5H6R A;  5HOO A;  4HQE A;  1XGN A;  3HYI A;  1IW7 F;  1KQ8 A;  2PG4 A;  2IT0 A;  1XGS A;  3D0S A;  2MC3 A;  3RJP A;  3V8J A;  1ZRE A;  1YS7 A;  4G94 A;  1XGM A;  3HSR A;  4E70 A;  1ZH5 A;  5CVI A;  3GZ6 A;  4PGG A;  1IXC A;  2RDP A;  4LB5 A;  2ZFW A;  1O7F A;  4ETS A;  1O57 A;  3CLO A;  1EV7 A;  1PDN C;  3QPH A;  3R6S A;  4UV9 A;  2AS5 F;  2FEZ A;  2E1C A;  4DQ2 A;  4Q5S F;  1S6L A;  4Z2Y A;  5K5O A;  3DPT A;  4ON0 A;  2HDC A;  3CUQ A;  2P6S A;  3K9T A;  2FOK A;  4G6Q A;  4ENK A;  4CDG A;  1H9G A;  3TQN A;  1XCV A;  4IXA A;  3J81 Z;  3B02 A;  3QRF F;  2EA4 A;  5DDG A;  3LWF A;  3J80 K;  2ZME B;  3GFL A;  3PFI A;  4EGZ A;  2ETH A;  3C3W A;  3KET A;  4WXH A;  1LEB A;  3IHU A;  5F1R A;  2MH9 A;  4HF1 A;  3M1E A;  2D1V A;  3GWZ A;  3H3U A;  5FFX A;  1J75 A;  1LVA A;  1EH7 A;  2IA0 A;  1WWX A;  3F6O A;  1IN4 A;  3P9K A;  1HXD A;  2XVC A;  3R4K A;  2EK5 A;  4JQF A;  2PLY A;  1O3S A;  2W84 A;  5HLI A;  4IHT A;  2RV8 A;  3ZN1 A;  5E17 F;  4AD9 A;  4G9Y A;  2QEN A;  3SZP A;  4HLX A;  5TRD A;  4ESF A;  3RKX A;  2Z3Y A;  1SMT A;  1SD6 A;  3KZY A;  4CGZ A;  5HDG A;  4U7D A;  3IC7 A;  4WX9 A;  5DCM A;  1U3E M;  2D2W A;  2RVC A;  3WGI A;  3N97 A;  4UXN A;  4HA8 A;  1FWZ A;  3BZ6 A;  4U7B A;  3ISP A;  2RC4 A;  2DI3 A;  1A04 A;  4UVA A;  1NHA A;  1TQI A;  1RNL A;  1JGS A;  1KU3 A;  4M6Y A;  3K1P A;  1HKT A;  3DP7 A;  4Y15 A;  1YIO A;  2PJP A;  4MGR A;  2O8X A;  5JFR A;  2PFB A;  3HRU A;  3I64 A;  3O2P E;  2J5P A;  5EEG A;  1Z6T A;  2VOP A;  4I01 A;  3VB2 A;  2NYX A;  3IWF A;  4Q47 A;  5ICF A;  4UVC A;  3KP4 A;  1BJA A;  4UVB A;  2STW A;  4LG0 A;  4S04 A;  5EEH A;  3IKT A;  3LA2 A;  1Z9C A;  2CW0 F;  3F21 A;  2OAZ A;  5HDK A;  3M9A A;  2VN2 A;  2M5W A;  2G9W A;  2VON A;  4GYI A;  1BN5 A;  2OZU A;  4G7Z F;  1FBS A;  4D0P A;  5ICE A;  2DLL A;  1IRG A;  2PMU A;  4QWQ A;  2M8E A;  5ED4 A;  3TOA A;  3LQQ A;  3J81 K;  2HQN A;  3EET A;  2XAQ A;  3WTU C;  2IA1 A;  2A07 F;  4RGU A;  1OYI A;  2MA3 A;  4LFU A;  3R0A A;  2OD5 A;  4EGY A;  4IVN A;  2BEO A;  1XB4 A;  1FP2 A;  2ISY A;  2R7F A;  3RKY A;  1OPC A;  2WC2 A;  3JW4 A;  2PQ8 A;  4LLG F;  2STT A;  3RYP A;  1S29 A;  3P7N A;  5BOX A;  2DW4 A;  3KLN A;  3O6B B;  5KK1 A;  5E8G A;  3T8T A;  3KP7 A;  2QQB A;  4WF2 A;  1EH8 A;  3KEQ A;  2DTR A;  3FM3 A;  5LEK A;  2DPD A;  5J6X A;  2PN6 A;  5A2Q Z;  4Q48 A;  4I0B A;  3QP6 A;  5LBQ A;  1YW9 A;  3COA C;  2EFW A;  1SAX A;  2VBW A;  2K86 A;  5H6Q A;  4EMS A;  3ML6 A;  5LHG A;  3KCC A;  4HYE A;  2W57 A;  2W24 A;  1TW2 A;  4LD5 A;  1SMY F;  3RPU A;  4U88 A;  3E5U A;  3KEO A;  1QZZ A;  2QQ9 A;  3E3V A;  4XLP F;  2L3D A;  2XAH A;  3FXQ A;  1HW2 A;  3F8C A;  3V8K A;  1T39 A;  2VT2 A;  3U1D A;  2XAF A;  4KDP A;  2ZME A;  4FHT A;  1PP8 F;  2IW5 A;  5D6E A;  4F7Z A;  3B73 A;  1ZLK A;  4CO8 A;  5D5U B;  3EYY A;  1LJ9 A;  3F3X A;  1MJ9 A;  2QWW A;  4HV5 A;  3H92 A;  2FQ3 A;  2HTJ A;  2ZJ2 A;  5TJJ A;  2QBY B;  3F8M A;  1UFM A;  5E20 A;  2WTE A;  3G3Z A;  2QUF A;  3Q9S A;  4ENN A;  1PUE E;  4HF0 A;  4A0X A;  1Y0U A;  2F5E A;  3CO7 C;  2EV6 A;  1FY7 A;  4EM0 B;  5D5X B;  2XKP A;  3F8B A;  2UZK A;  1ULY A;  5JVT A;  1BI3 A;  2PEX A;  1YTY A;  4KMF A;  2GZW A;  3OOP A;  1FP1 D;  3C1D A;  4XBF A;  3HRS A;  5BPD A;  2QQA A;  1X3U A;  2XAG A;  3ZQ7 A;  1W7P D;  5K5R A;  3EQL F;  3ROU A;  3TDZ C;  5F64 A;  1I6X A;  3WE3 A;  4S05 A;  4NHJ A;  1HKS A;  1I5Z A;  2VXZ A;  2DAO A;  1OYY A;  4M9X A;  1MZB A;  2FRH A;  2CO5 A;  3BPV A;  5L3G A;  3F6V A;  1CGP A;  2FBK A;  1ON2 A;  2H27 A;  4OIP F;  2FA5 A;  1YQA A;  4ESJ A;  5CJ9 A;  4ZYE A;  2D1H A;  1FZP B;  3GO5 A;  2XKO A;  1TQM A;  1XGO A;  2CWE A;  1IRF A;  4YFX F;  3FMS A;  2VC0 A;  2NNN A;  4XSX F;  3KP5 A;  4G8X A;  5A2Q K;  2EB7 A;  2ZKZ A;  1J5Y A;  2GXB A;  4HQM A;  5CVR A;  3RIR A;  2IP2 A;  3ZMT A;  1ZRC A;  1MGT A;  3ERE D;  2ZBK A;  3LFK A;  3RI4 A;  2V1X A;  3QP5 A;  1WRJ A;  3DPL C;  2ACJ A;  4IRH A;  2Z33 A;  4IJA A;  1D5V A;  2P8T A;  2BV6 A;  4AIJ A;  5D5W B;  1ON1 A;  3BDD A;  4KN7 X;  2YSR A;  5HS8 A;  3TGN A;  2IJL A;  4I2O A;  2BBY A;  1QNT A;  2GA2 A;  3BPX A;  3MZY A;  4WXD A;  1WQ2 A;  2XUB A;  1UHW A;  1Z6R A;  3M8E A;  3ULQ B;  1HW5 A;  3F72 A;  4EJU A;  2C6Y A;  4RB0 A;  3T0Y A;  3MZH A;  3I59 B;  3WTT C;  4R1H A;  4I0A A;  4WXC A;  2HGC A;  3ZPL A;  2IVM A;  3FWE A;  1IN5 A;  2M45 A;  1VTN C;  1ZAO A;  3LST A;  5BPI A;  1R1U A;  5H20 A;  5LRS A;  1D8K A;  3KP3 A;  2ELH A;  3GF2 A;  1E17 A;  2Y75 A;  4GCV A;  2LDU A;  4A5M A;  1ZGA A;  4B8X A;  4OIN F;  5L3B A;  2V6C A;  1FSH A;  4GXO A;  2FNP A;  2NAZ A;  3V7R A;  4K2E A;  4HAM A;  3E5X A;  2K02 A;  3L9F A;  2OA4 A;  1SFU A;  3K0L A;  2H6B A;  4FX4 A;  3GXO A;  4M9S A;  3I0T A;  3MFK A;  4YFK F;  2FXA A;  3Q5F A;  2PBI A;  1ZG1 A;  2KIF A;  4BQA A;  3I58 A;  2QBY A;  1TNS A;  1FOK A;  5LEJ A;  2MH2 A;  4G7H F;  3KP6 A;  2DK5 A;  1S8N A;  2AXL A;  4RB1 A;  4KA4 A;  3HRT A;  1JXS A;  2XAS A;  3LAP A;  1ZRF A;  2O03 A;  3ZMS A;  1W5S A;  1B9N A;  3WTZ A;  1GHC A;  4RGS A;  1O7L A;  1KU7 A;  3RDI A;  1QPM A;  2PI0 A;  1JHH A;  1XN7 A;  1S7A A;  2GIV A;  3KP2 A;  3TOB A;  4BHC A;  2GA1 A;  1Z05 A;  3SZT A;  4I7H A;  2A61 A;  3K2Z A;  2P4W A;  2HFH A;  1AOY A;  3WU1 B;  1TLH B;  4L0Z B;  2ESN A;  3CTA A;  2JZY A;  3DF8 A;  2IA2 A;  4B09 A;  3I54 A;  5FGM A;  2Q8K A;  3SFZ A;  2QZ8 A;  3HOS A;  5E1Z B;  4IRG A;  2RKH A;  2P7C B;  1I1G A;  5CVJ A;  1O3T A;  1J59 A;  2G7H A;  1QZY A;  4ZYH A;  2HWV A;  1B4A A;  4BHP A;  4U0Y A;  4EV0 A;  5DUI A;  2F2E A;  4R79 A;  1IAW A;  4OU0 A;  5LGT A;  4LJZ F;  5FD6 A;  3AAF A;  2DQL A;  2RGV A;  5HVQ C;  4HLY A;  1V4R A;  3EUH A;  2EWN A;  2PMH A;  2XRN A;  4AIH A;  1XSV A;  1IXS B;  1LNW A;  1QO0 D;  2O6G E;  4AWX B;  1P4A A;  1FX7 A;  2YPR A;  3F23 A;  2YX4 A;  2MLG A;  4PZJ A;  4A6D A;  4EJO A;  2OZ6 A;  2DQR A;  4O3M A;  3HIF A;  3ZMZ A;  1ODD A;  1G3T A;  3MWM A;  3I59 A;  3WE2 A;  4UUV A;  1U5T B;  1XDS A;  4BYY A;  3I71 A;  4EM2 A;  1ZLJ A;  1USS A;  5HS7 A;  5AIQ A;  1IZ1 A;  1F4K A;  1D8J A;  1ZGJ A;  3CJN A;  3NEU A;  2W85 A;  4MTE A;  2COM A;  2QVO A;  3WG9 A;  4XLN F;  2Q0O A;  2A6H F;  5DYM A;  2VOO A;  1ZN2 A;  4L5I A;  4YII A;  2QM3 A;  1LDK B;  1FLI A;  1QBJ A;  4GGG A;  3LA3 A;  4OMZ A;  3N4M A;  3NRV A;  2A3S A;  1TQP A;  3SQN A;  4YG2 F;  2M1B A;  1HSJ A;  2EV5 A;  2YX7 A;  2QLZ A;  2KJC A;  3M8F A;  2UXX A;  3HTS B;  1YS6 A;  3BP8 A;  3IKV A;  3DV8 A;  3GZ5 A;  1P92 A;  4KIB A;  3JSO A;  3BJO A;  1AWC A;  2VE9 A;  3WOD F;  3VEP A;  2A6E F;  2L4M A;  1BIA A;  2NNY A;  4RAY A;  4GYG A;  4KN4 X;  3WGG A;  1FC3 A;  4RAZ A;  2HZT A;  4A6E A;  2VC1 A;  5F6F A;  4UV8 A;  4TV7 A;  3FXU A;  3MCZ A;  1FYM A;  1KQ0 A;  5DD4 A;  1K78 B;  3VFZ A;  3GFM A;  4HOB A;  2O3F A;  3ECH A;  5HLG A;  4JBA A;  2V9V A;  1P6R A;  3SXY A;  1Q1H A;  3QPT A;  4O6J A;  1TBX A;  3DFG A;  3EYI A;  2MD5 A;  3T5X A;  4N9H A;  4Y17 A;  3CUQ C;  5E1W A;  4IHS A;  2FMY A;  5LGN A;  3G73 A;  1HQC A;  2V1D A;  2TDX A;  1J9I A;  2HOE A;  1BI0 A;  5IT9 K;  1S7O A;  1R1V A;  1U6G A;  2RQP A;  3RPQ A;  5D4R A;  4A0Y A;  3GYH X;  1K79 A;  4OIO F;  2V1U A;  3T8R A;  5CVV A;  4ZH4 F;  2DPU A;  1B59 A;  4R8H A;  4L9J A;  1R5H A;  2E7W A;  4BHB A;  1T38 A;  4MQ9 F;  3L09 A;  2VBX A;  1ZG5 A;  4GO1 A;  1KU2 A;  2LF8 A;  2CSO A;  1ZG3 A;  3WTV C;  1OKR A;  4HDU A;  4YIF A;  1SD5 A;  3QAH A;  5HDN A;  3E5Q A;  5FFZ A;  4EJW A;  1FYK A;  2M87 A;  4HX8 A;  2ZXJ A;  2GWR A;  2DU9 A;  2BGC A;  3KZZ A;  1B1B A;  5E18 F;  4DNC A;  3V7S A;  1IUY A;  1YW8 A;  1SFE A;  2W25 A;  1HST A;  1U5T A;  2EV0 A;  1YW7 A;  1GXQ A;  4MEY F;  2KKO A;  1MJA A;  1I1S A;  1GXP A;  2ZO4 A;  3HUG A;  1D3Y A;  4AVP A;  2P5L C;  2CG4 A;  2KIM A;  3MAJ A;  1R36 A;  3F22 A;  1P2F A;  3E6D A;  4OOI A;  1F1Z A;  1WKM A;  5D4S A;  2FF4 A;  4MHG A;  5HS9 A;  1B6A A;  4L9V A;  3L2C A;  3QU3 A;  3FHZ A;  1YG2 A;  3TDU C;  2P5K A;  1SFX A;  2GAU A;  2EFN A;  5D6F A;  2BE5 F;  4N9I A;  3BWG A;  4A2U A;  2MLK A;  1G3Y A;  4HBL A;  2EJR A;  3HHG A;  4KIG A;  2WWY A;  2L02 A;  4WCG A;  1R7J A;  3VOE A;  1RIO H;  3GLX A;  2JPC A;  4P96 A;  2FSW A;  1JHF A;  1KQ9 A;  4LB6 B;  2JT1 A;  3DQV C;  3TO6 A;  5ICC A;  1G6N A;  5LHH A;  4EQQ A;  2O0Y A;  1XSX A;  2DBB A;  2XGX A;  3WTX C;  2RNJ A;  2ADU A;  4ZZD A;  3WTS C;  1XD7 A;  3OV8 A;  3S2W A; 
#chains in the Genus database with same CATH topology
 3GBG A;  1P4X A;  2Z99 A;  3C2H A;  5K7Z A;  4DW6 A;  1Z0X A;  3HTU A;  3I53 A;  1VQM I;  4PJL A;  4P9U A;  4NC7 A;  1Y8R B;  2DA1 A;  2VUM J;  2V6E A;  2CUE A;  2QGU A;  2O8K A;  1TTY A;  1C0W A;  2UXN A;  5FKN A;  4XOR A;  4AYB N;  4RDU A;  1K83 J;  2VJJ A;  1KGS A;  3LSG A;  3OWT A;  4IHY A;  3BR2 A;  1K78 A;  2BXZ A;  4FT8 A;  2K9L A;  4ZTJ A;  4EM1 A;  5EJC A;  4E6K G;  3OSG A;  4BKX A;  1N78 A;  4RM2 A;  4AUX A;  4EJT A;  4D7M A;  1RC9 A;  4M72 A;  1JKP C;  1VQ4 I;  1W4M A;  1R22 A;  2M8G X;  1QHH D;  2R3S A;  5IYD J;  3K4C A;  2EA2 A;  2HKX A;  1BR4 A;  1X1B A;  3BR5 A;  4NQW A;  5ERI A;  4HDV A;  1MNM C;  2DCE A;  3BG5 A;  3EDP A;  1G4D A;  2O61 A;  2M4G A;  3CUO A;  3BJA A;  3O3K A;  1WSU A;  2LP0 A;  3HGG A;  3DEU A;  3HSE A;  2M0M A;  2XSJ C;  4OAY A;  4B44 A;  3C18 A;  4OIQ F;  4UNO A;  3ELK A;  4IO9 F;  1FTT A;  2L54 A;  4ZZL A;  5GTH C;  4M6X A;  1QRY A;  4AC0 A;  1O3R A;  4NB5 A;  4CYC A;  2DOD A;  2HVQ A;  2ZNY A;  4M6V A;  3I3L A;  5CVU A;  3C7J A;  1LFB A;  4NDL A;  1MDM B;  3JRH A;  3DEW A;  5CYV A;  1J7K A;  4RMN A;  1B72 B;  3RKQ A;  4OMY A;  1Z1D A;  5E8I A;  2VQC A;  2H94 A;  2VT3 A;  4RGX A;  2JPB A;  5CLS A;  2KRH A;  2VKD A;  3CCR I;  3A2K A;  1YFH A;  5F0F A;  2CRG A;  1FEX A;  3H5A A;  5F0C A;  3DKY A;  2LD5 A;  1UMQ A;  4FTH A;  3AFH A;  2QYO A;  3CDI A;  2JRT A;  3HOT A;  3S16 J;  3GEZ A;  5L3D A;  1MJB A;  4BJT A;  3ZXS A;  1XPX A;  2KJB A;  1YX3 A;  4FX0 A;  1XCB A;  3SEQ A;  4KMU X;  3JTH A;  4BE0 A;  2ME0 A;  2Y9Y A;  3HOZ J;  5ILU A;  1U2W A;  4U0V A;  4CXF A;  2XIG A;  4BUP A;  1SD7 A;  2WAQ A;  4MEX F;  3R0J A;  2F5D A;  3QOP A;  1SVL A;  2AQE A;  3FM5 A;  4PGH A;  3BR3 A;  1LDJ A;  1S3J A;  1W7P B;  2IBD A;  4XRF A;  2ZSI B;  2EQR A;  3E7L A;  1U78 A;  2VQG A;  5E1X A;  1EKE A;  2EFP A;  2OU2 A;  4WK8 F;  3BZK A;  2VPR A;  4KUM A;  1MD0 A;  3CD6 I;  4F93 B;  1V3F A;  2F5C A;  1IN6 A;  3EPZ A;  2HZD A;  3P5J A;  5EG0 A;  1MBH A;  4N0B A;  2Z9O A;  5FKL A;  3GTL J;  2P6T A;  4UHT A;  4BS9 A;  1ZK8 A;  4I98 B;  5DV5 A;  4D9J A;  1YO5 C;  1ONV A;  2NVQ J;  3D5L A;  3HJE A;  1IRZ A;  4BQN A;  1K6O A;  4UY8 I;  1XDU A;  4ZDL A;  2NRA C;  2K4B A;  2ME6 A;  3BRO A;  3A1Y A;  3Q0U A;  4Y33 A;  4QLC U;  4U0W A;  3C2G A;  4L9N A;  4I76 A;  4IQ4 A;  4UUS B;  3VPR A;  1JT6 A;  3V8L A;  4I99 C;  2DT5 A;  1AKH B;  2BY3 A;  1IGN A;  2ZNZ A;  5IT3 A;  2R7D A;  4CYD A;  1X1D A;  3KYD B;  2VIX A;  4ZYG A;  3FF5 A;  4HEA 2;  2ZSH B;  3IH2 A;  1FOX A;  2E1N A;  1BC8 C;  1HA8 A;  2DA6 A;  1SC7 A;  1OR7 A;  2BVM A;  3BR1 A;  4DYC A;  3IL2 A;  3TP0 A;  1U5T C;  3GZN B;  3FMQ A;  1BR1 A;  4P9F A;  2L7F P;  3HPG A;  3F9K A;  2CQ7 A;  2K40 A;  3CF2 A;  3CCL I;  2X9D A;  1A35 A;  3RKW A;  1ZRD A;  1OLT A;  4X6A J;  1LDD A;  1KZH A;  3BG3 A;  4A3F J;  1G3S A;  1T8I A;  5ILS A;  3ABU A;  2Z5U A;  1HBX G;  2VXD A;  3GVA A;  1T98 A;  1WJA A;  3OYJ A;  3OSF A;  2KP6 A;  1WJ5 A;  3W6J B;  2QKM B;  3K70 C;  3ZQG A;  2NVY J;  3BLY A;  4M3G A;  3U1K A;  1U0J A;  3L00 A;  2R5Y B;  1F9N A;  1WH5 A;  2B0L A;  3KLO A;  3AL0 B;  1X1P A;  2XRO A;  4KIC A;  2WBM A;  3CMY A;  2ID6 A;  5ICG A;  4CCM A;  1R49 A;  4HX7 A;  2JVH A;  4BY1 J;  4QTR A;  1V54 H;  1OMI A;  3EUK L;  1D0X A;  4DOZ A;  2LF7 A;  1OCP A;  2LNB A;  1GT0 C;  1XC5 A;  5J1Y A;  2R7U A;  2F5V A;  2CQN A;  1STZ A;  1UB9 A;  1FMW A;  3SDG A;  3DBH B;  3FBI B;  1QHG A;  3CCE I;  4KFC A;  1AU7 A;  1CF7 B;  3GTM J;  2LSO A;  3A02 A;  2F6C A;  1RET A;  2DDA A;  2ZC2 A;  2HDD A;  4A3G J;  4B47 A;  1FBQ A;  5LLQ A;  1LQ1 A;  1IF1 A;  4IPA A;  3S1Q J;  2L7Z A;  3LMM A;  4ASN A;  4MTD A;  1Y39 A;  1FNN A;  3BC8 A;  2VPL A;  4OIR F;  1DUX C;  4KNY A;  3PQJ A;  1B8I B;  1X1A A;  4N4N B;  2LC2 A;  2ZXH A;  3A01 B;  2HXO A;  3S8P A;  4CZZ A;  1H9T A;  5IT9 Z;  2Z2S B;  5DTD A;  1QA6 A;  2DA3 A;  1Z77 A;  2XHK A;  1KU9 A;  3UNG C;  2VJI A;  3DKW A;  4Y13 A;  2GM4 A;  2FNA A;  2LKP A;  2MBF A;  2NS0 A;  1O4X A;  4YEL A;  2L01 A;  5K5Q A;  1WJD A;  2XV4 S;  2CGP A;  1Y6I A;  4KIS A;  4CIC A;  3BTC A;  2JSC A;  3CDH A;  5KCM A;  1SAN A;  2VKE A;  2YR2 A;  3FXM A;  3TW6 A;  3PIO F;  3E6C C;  1HDD C;  2CQK A;  1XX5 A;  4AIK A;  4HW0 A;  4PCQ A;  2AO9 A;  2M30 A;  4HV6 A;  1H0M A;  3M1C A;  2FU4 A;  4C9Y A;  1WJB A;  5DUK A;  3JSP A;  3REO A;  3K1N A;  2L9N A;  3HHH A;  3OYB A;  2OBP A;  2V1N A;  2XAJ A;  2P7V B;  2P5V A;  4ESB A;  1ETY A;  1VQ7 I;  2IRF G;  2JA2 A;  4BEH B;  1VQL I;  3GFI A;  4RB3 C;  1MBF A;  2ISZ A;  3OYL A;  1HKQ A;  2VBZ A;  2WAE A;  3VSL A;  2JTV A;  3HZJ A;  1H89 C;  3OR1 C;  2VLA A;  2HQR A;  3BCB A;  2HS5 A;  3HSF A;  1TWF J;  2X0L A;  3E6M A;  1R5G A;  4RB2 C;  5JLW A;  3FXR A;  1UG2 A;  2K7L A;  3FZV A;  3HOU J;  2N8G A;  5M5X J;  3IRQ A;  5BMZ A;  1T0F A;  1MDM A;  1R58 A;  2RN7 A;  3FMR A;  5J47 A;  4MQV A;  3G1M A;  3DKX A;  1FPQ A;  5KVR A;  1B72 A;  2CFX A;  2V26 A;  4LIV A;  1BM9 A;  2WV1 A;  3PUF A;  4H0E A;  1S9H A;  1G3W A;  3ASO H;  3KFW X;  1IV6 A;  1P4W A;  2MFZ A;  4M9Z A;  3G2B A;  3ZMU A;  1MIJ A;  4BH9 A;  2W1O A;  1SVO A;  1DGR M;  1IN7 A;  3P9I A;  3F0C A;  2K4J A;  4CCN A;  1LB2 A;  1RES A;  2HU9 A;  2K5C A;  1BI2 A;  1RR7 A;  3ZN0 A;  4XKC A;  3OYN A;  2HDW A;  3H0D A;  2OJE D;  1HF0 A;  3W6K B;  2HI3 A;  2K9Q A;  1BBY A;  3T1B A;  3V42 A;  5HLH A;  1BC7 C;  4LLN A;  2R7Z J;  2VAS A;  3RCO A;  2XGC A;  4ZJZ A;  4KIT B;  5JR3 A;  2HPI A;  4PDK A;  2QEX I;  2XSD C;  1L0O C;  2EFQ A;  2V79 A;  3OYK A;  2R7V A;  3ZMD A;  5FO5 A;  4BDZ A;  3HB9 A;  1ZYR F;  2NVT J;  1W7P A;  1R1T A;  3LSK A;  3KE2 A;  4LGW A;  1EH6 A;  1E2X A;  5M3M J;  4LLL A;  3SHF A;  3ZP5 A;  2GQQ A;  4JK1 X;  4WWC A;  3HRM A;  2VBY A;  3P9C A;  2DOA A;  4NUB A;  5BQT A;  1T6S A;  4D5C A;  5LHI A;  2BHZ A;  2A68 F;  3ABK H;  1VQP I;  4HF2 A;  1QQI A;  3A4C A;  3BJ6 A;  3CMM A;  2OV7 A;  3ECO A;  2HTS A;  5JHU A;  1YJ9 I;  5F27 A;  1DDN A;  2IPQ X;  3BTL A;  3CC2 I;  1RZ4 A;  2HEO A;  4QIW N;  2Y31 A;  3HG9 A;  3SYT A;  5FRO A;  1IV8 A;  3V4G A;  4M3B A;  3FXO A;  5L3F A;  2Q2E A;  2Y48 A;  1I27 A;  5K1Y A;  4RBO A;  5D5V B;  4IHX A;  3LAJ A;  5IOZ A;  4KT5 C;  4UUS A;  2Y0M A;  2M3A A;  1FBU A;  4B48 A;  3CCJ I;  1SFO J;  3K69 A;  2XGD A;  2E1O A;  1AKH A;  4Y3O A;  5L3E A;  2ZJR F;  3JAM Z;  2CU7 A;  2WB1 A;  4KYW A;  1ETQ A;  3M8J A;  5EF6 A;  2PJR B;  1Z91 A;  2E7X A;  2EIM H;  2QSF X;  3CJT B;  4HRI A;  3IRR A;  1MMG A;  4L9T A;  4ENJ A;  5DEQ A;  2F4I A;  5B5E C;  4W1U A;  4XRM A;  3E97 A;  3CO6 C;  3CCS I;  4O5V A;  3V7C A;  3H36 A;  3CDL A;  1BI1 A;  2DFI A;  3BQZ A;  1JTY A;  3VOD A;  5C4J J;  3H3Z A;  9ANT A;  4BAY A;  3H9Q A;  1R23 A;  2WV0 A;  3R61 A;  3LFU A;  5J4Y A;  2BY0 A;  5FB2 A;  4J19 A;  4C2U A;  4E7Z A;  1XMK A;  4LK1 F;  3PQK A;  4CH7 A;  2R5Y A;  1TL8 A;  1DP7 P;  3PFY A;  1OR7 C;  3DWL E;  1LEA A;  1DPR A;  2E5N A;  2ZCW A;  4RAF A;  4Q4Z F;  4DBQ A;  3GW2 A;  3IAS 2;  1OYW A;  4HX4 A;  1W5T A;  2HR3 A;  2K27 A;  1IN8 A;  1WVR A;  2FBH A;  3FHN A;  4LK0 F;  3ZQH A;  1IJW C;  2DFE A;  3G4S I;  4IOA F;  5ILV A;  1JE8 A;  2ESH A;  1ITY A;  3ZR8 X;  5BNG A;  3E6B A;  2DK8 A;  3ZQF A;  1W5C C;  1ORK A;  1MBE A;  1RPW A;  3K6G A;  1CF7 A;  2J5O A;  1LUJ B;  1BJZ A;  1GVJ A;  3TO7 A;  1X58 A;  3WGH A;  3JRE A;  2CFO A;  2TCT A;  3L7W A;  3OYC A;  3M3Y J;  2DTZ A;  4UB8 C;  4EEF G;  1FOY A;  2LR8 A;  5DD8 A;  3QPS A;  2L7K A;  5J8C A;  3WU0 A;  3CUQ B;  4M71 A;  4MNU A;  1SD4 A;  1K61 A;  3K7A J;  1ENH A;  3K10 A;  2DA7 A;  4BU2 A;  5FLX Z;  1ZHF A;  1IRX A;  1BOA A;  2R0Q C;  1LPQ A;  5B1B H;  2A69 F;  1B8I A;  4DYQ A;  4EJV A;  1JUS A;  4YFN F;  5JI6 A;  1ZKG A;  4BNC A;  4XID A;  3B6C A;  2H6C A;  3U2R A;  3WTY C;  3GTG J;  3F8N A;  2X4H A;  2GOM A;  4YIR X;  3CF5 F;  2KIQ A;  1FTZ A;  3J7A O;  1Z7L A;  5K7H A;  4BL0 B;  2OQG A;  1AHD P;  3FX3 A;  2M2E A;  5JLX A;  3FXJ A;  4MFD A;  5J1U A;  1YLF A;  4IKF A;  2DDB A;  3JTG A;  2D45 A;  1FJL A;  2FOW A;  4RM3 A;  3DXJ F;  4EVI A;  3PJR A;  4LMY A;  5LGU A;  5J8F A;  4CHU A;  3PNV A;  3ZGK A;  2F48 A;  1REP C;  1KYZ A;  3FXL A;  3U9G A;  3S15 J;  3GX4 X;  3O8G A;  1FSE A;  5FKK A;  3WTW C;  2UUZ A;  1CQT A;  2DYR H;  4JX6 A;  5C4X J;  2CYY A;  2H1L A;  2VE8 A;  1ETO A;  1X4O A;  1F5T A;  4BXU A;  2HVR A;  2LLK A;  2A5Y B;  2DO7 A;  2IGM A;  2E35 A;  3R60 A;  4FET A;  4ZYD A;  3BOQ A;  4AM3 A;  1L3L A;  4L0Y B;  2K3F A;  1N25 A;  4Y4R A;  2OUM A;  2EIL H;  3ZQC A;  1FYL A;  3G1O A;  2HYF A;  2IGK A;  3OYF A;  2EIK H;  4I09 A;  2MGQ A;  4D7N A;  4IF4 A;  3D1N I;  4BEH A;  1WGX A;  1NG7 A;  3ABL H;  3MEX A;  5HNF A;  1T2K A;  1TP4 A;  4G12 A;  4A3B J;  2DA2 A;  2FML A;  2XRL A;  3B6A A;  4XLH A;  2UWM A;  1J2X A;  1X4P A;  5EDN A;  2I10 A;  1J0R A;  4G7O F;  1QVU A;  1WI9 A;  1RUO A;  4L5J A;  2BHY A;  1Z7U A;  1XSD A;  3K4M A;  3I4P A;  2KHM A;  3ABT A;  1IC8 A;  5GPA A;  1MKM A;  1R00 A;  5DCF A;  5FD5 A;  1XMX A;  3KYC B;  5DCM B;  1KA8 A;  3HXL A;  4HNT A;  3S14 J;  3F8F A;  2HYG D;  1N75 A;  1UCR A;  2MG4 A;  5BS6 A;  4DZP A;  3JAM K;  2DT7 B;  2H09 A;  2HKO A;  4QPO A;  5IYB J;  3CJR B;  2KDZ A;  2VOD A;  3RYR A;  3MQ0 A;  2PX9 A;  1TNT A;  3LQR A;  3JRA A;  3I4N J;  2JVG A;  3OR2 C;  3M7G A;  2JA5 J;  3HKZ A;  1UZC A;  3ZMV A;  1O3Q A;  2WA0 A;  2VKH A;  1P9Q C;  2FE3 A;  4ENM A;  5HLT A;  1FIA A;  2FBI A;  1P7J A;  1WI3 A;  3K1M A;  5FLM J;  3K4N A;  4GFB A;  2DFH A;  1PP7 U;  3TO9 A;  4F92 B;  1FT9 A;  1QVT A;  3J80 Z;  3VYT B;  4A3E J;  4L18 B;  1R6R A;  3NQO A;  1HW1 A;  2DMN A;  4HPQ A;  1LKX A;  5D8L B;  5J3L A;  2VL8 A;  2L5Q A;  4PSW A;  1D5Y A;  5L3C A;  1UG0 A;  3BG6 A;  2H8R A;  3H5N A;  1BIB A;  4DIQ A;  2FQ4 A;  2VJ4 A;  1QGP A;  2KRF A;  3K70 D;  1U8R A;  4KIF A;  2KIU A;  4LG0 B;  4RGR A;  3PNY A;  4I02 A;  4A0Z A;  4IRI A;  1DPU A;  3VYU B;  4U87 A;  1KYW A;  1WJF A;  3GFJ A;  3IWZ A;  4A12 A;  4M74 A;  3Q9V A;  3H0G J;  2YU9 J;  1YYV A;  1RI7 A;  2XPU A;  1RUN A;  2L4A A;  3GUD A;  4G6D A;  1TW3 A;  2KRC A;  3EUA A;  3QU6 A;  4M73 A;  2R7Q A;  5AIP A;  3TKY A;  1XMA A;  4XM3 A;  4ZC3 A;  1K7A A;  2GXG A;  4XSZ F;  3I5U A;  4CCO A;  2G7U A;  4A5N A;  1UST A;  4RS8 A;  3H9J A;  4ABZ A;  4HZF A;  1T08 B;  5FLX K;  5E3L A;  3M07 A;  2DN0 A;  4AID A;  2ECB A;  3Q0W A;  2BXY A;  3MZ8 A;  4P5O A;  6PAX A;  2Y0S N;  1UHM A;  3LA7 A;  3KX2 A;  4D1Q A;  3QOD A;  2BYV E;  1XG1 A;  3BY6 A;  2YS9 A;  4P55 A;  1ZAR A;  3FDY A;  5LRR A;  1H88 C;  3RTR A;  5AON A;  5GAH J;  2YU3 A;  1IDZ A;  3ESW B;  3LSJ A;  5D8K B;  2FUG 2;  3DPU A;  2F5F A;  2IS1 A;  2EFO A;  1IXR C;  4A3I J;  1B9M A;  1VF9 A;  1Y0N A;  2ICW G;  4EAT A;  2OQR A;  5H6R A;  5HOO A;  3IV5 A;  2PJR A;  4HQE A;  3MMY B;  1XGN A;  2E2J J;  3HYI A;  4XOP A;  2KDO A;  4HNV A;  2QA4 I;  1IW7 F;  3CZ6 A;  1KQ8 A;  1X1C A;  2PG4 A;  1VQ5 I;  2IT0 A;  4XKV A;  1XGS A;  3D0S A;  3L2V A;  4F52 A;  2MC3 A;  4PSX A;  3RJP A;  2XDV A;  1MMS A;  3V8J A;  2L0K A;  1ZRE A;  4DGW B;  2CUJ A;  4PFP A;  1YS7 A;  3FIW A;  2R7W A;  1JT0 A;  2TRT A;  4G94 A;  4ITV A;  1XGM A;  3HSR A;  3H5R A;  2VKV A;  3ASN H;  3Q3S A;  4E70 A;  4A3L J;  3S93 A;  1ZH5 A;  5CVI A;  2E36 A;  3GZ6 A;  4PGG A;  1IXC A;  1TWC J;  2RDP A;  4LB5 A;  5EYR A;  2ZFW A;  1HLV A;  3WU2 C;  2W4S A;  1HOM A;  2XGE A;  1O7F A;  2X1D A;  1O57 A;  4ETS A;  1SVM A;  3CLO A;  1EV7 A;  1PDN C;  2W00 A;  4C3H J;  3LSI A;  4LOC A;  3QPH A;  3TP3 A;  2QF7 A;  3R6S A;  1GVD A;  3OMY A;  4UV9 A;  2AS5 F;  2FEZ A;  3LSR A;  4DQ2 A;  2E1C A;  3AL0 C;  4Q5S F;  1OJL A;  1S6L A;  4Z2Y A;  5K5O A;  3DPT A;  4ON0 A;  1E3O C;  3I4M J;  3CCM I;  4ANJ A;  2HDC A;  3DLL F;  3CUQ A;  2HOA A;  2P6S A;  3K9T A;  5CPR B;  2FOK A;  4G6Q A;  2LY1 A;  3DTK A;  2D5V A;  2R7S A;  2VQH A;  4ENK A;  3QYE A;  3KYL A;  2Q2E B;  4BY7 J;  1DU0 A;  2CJJ A;  4CDG A;  1H9G A;  3TQN A;  2O5R A;  1XCV A;  3HOX J;  3ZQQ A;  4XN3 A;  1UEL B;  2QKL B;  4IXA A;  5HOD A;  2MSY A;  3BQY A;  3J81 Z;  4IL6 C;  3B02 A;  4M3F A;  3QRF F;  4X1E A;  2JQ7 A;  4RLF A;  1ERD A;  2EA4 A;  5DDG A;  2E5Z A;  3LWF A;  4C2M J;  3J80 K;  4E7K A;  2CUZ A;  1F36 A;  2OF7 A;  1JUP A;  2ZME B;  5M3F J;  3GFL A;  3PFI A;  4EGZ A;  4Z6Y A;  2XC7 A;  1QPI A;  4A3D J;  2ETH A;  1I3Q J;  3C3W A;  3KET A;  1ZGW A;  1YOV B;  2QSH X;  4XLF A;  3JCU C;  4WXH A;  2E71 A;  1TWG J;  2WAQ N;  3S1R J;  4BAC A;  1I50 J;  1MND A;  3VYS B;  1MSF C;  1LEB A;  4D5F A;  2V7F A;  3IHU A;  5F1R A;  4XLE A;  2MH9 A;  4HF1 A;  3OIQ A;  3M1E A;  4LIT A;  2D1V A;  2WY7 Q;  1X3W B;  2DT6 A;  3GWZ A;  3H3U A;  5FFX A;  4E7L A;  1RRJ A;  1LVA A;  1N77 A;  1EH7 A;  1J75 A;  1D0Z A;  2IA0 A;  3VWB A;  4A3J J;  3ZOB A;  1WWX A;  3F6O A;  1IN4 A;  1VND A;  3P9K A;  1HXD A;  5GAG J;  1P7I A;  2XVC A;  3R4K A;  1W0U A;  2NVU B;  2EK5 A;  4JQF A;  4XIC A;  2PLY A;  4ZDP A;  1O3S A;  2LY2 A;  2W84 A;  5HLI A;  4IHT A;  1OCT C;  2RV8 A;  3HDD A;  3ZN1 A;  5E17 F;  4AD9 A;  4G9Y A;  2Y30 A;  2LH9 A;  2QEN A;  4HLX A;  5GP9 A;  3SZP A;  5TRD A;  4ESF A;  2Z3Y A;  3RKX A;  1SMT A;  1SD6 A;  3KZY A;  1A31 A;  4CGZ A;  1VQO I;  5B1A H;  2DXI A;  5HDG A;  2LOO A;  5TGT A;  4U7D A;  3IC7 A;  3FK7 A;  4WX9 A;  5DCM A;  2PMZ A;  1U3E M;  4J00 A;  1V55 H;  4A69 C;  2QSG X;  2D2W A;  4PJM A;  2RVC A;  3LOC A;  2BOL A;  3WGI A;  3HPH A;  3N97 A;  4UXN A;  1APL C;  3SDB A;  4HA8 A;  1FWZ A;  3BZ6 A;  4U7B A;  3ISP A;  2RC4 A;  2DI3 A;  1A04 A;  3DBL B;  3KIO A;  4UVA A;  1NHA A;  4B1R A;  1OCO H;  1TQI A;  1NH3 A;  1RNL A;  1JGS A;  2XF7 A;  2O7O A;  1JJ6 C;  1KU3 A;  1TZL A;  4M6Y A;  3W3C A;  3OS0 A;  4XOT A;  5FJ8 J;  2R93 J;  3K1P A;  1HKT A;  3DP7 A;  4Y15 A;  1YIO A;  5J1R A;  2PJP A;  3PNT A;  1PUF B;  4MGR A;  1A6Q A;  5DS9 A;  2O8X A;  5JFR A;  2PFB A;  3HRU A;  3GTO J;  3I64 A;  3O2P E;  2J5P A;  5EEG A;  1Z6T A;  3L1P A;  2VOP A;  4I01 A;  1MH4 A;  2KLO A;  3VB2 A;  4B3X A;  2NYX A;  1WPK A;  3IWF A;  4Q47 A;  3BG9 A;  5ICF A;  4F55 A;  2HOT A;  2L9R A;  3MD2 A;  4UVC A;  2L9S A;  2ELK A;  1S7E A;  5KHD A;  4XK4 A;  1WH7 A;  3KP4 A;  1BJA A;  4UVB A;  2STW A;  4LG0 A;  4S04 A;  2CW7 A;  5EEH A;  3RZO J;  3IKT A;  3W2W A;  3LA2 A;  1Z9C A;  1MBK A;  2CW0 F;  3F21 A;  4YEJ A;  4LIU A;  3IH4 A;  1I3A A;  5FLV A;  3PIP F;  2X48 A;  3OYA A;  3JRD A;  2OAZ A;  3DU6 A;  5HDK A;  3M9A A;  2K9N A;  2VN2 A;  2CH0 A;  2I8D A;  2M5W A;  2G9W A;  1IUF A;  1WJC A;  2VON A;  1T95 A;  2BZT A;  1BN5 A;  4GYI A;  4V2G A;  5GTI C;  5IOY A;  3AG2 H;  3OY9 A;  1X19 A;  3L2Q A;  2OZU A;  4G7Z F;  1SFK A;  4B43 A;  1FBS A;  2R92 J;  3FKI J;  4RLQ A;  4D0P A;  4A93 J;  3DCF A;  2DLL A;  5ICE A;  1IRG A;  2PMU A;  4QWQ A;  3ERM A;  2M8E A;  5ED4 A;  3TOA A;  3GTK J;  3LQQ A;  3CMA I;  4E7S A;  3J81 K;  2HQN A;  2NXN B;  2KL4 A;  3EET A;  4XON A;  2XAQ A;  5B66 C;  3WTU C;  2IA1 A;  2A07 F;  1MBJ A;  2NS8 A;  1HDP A;  4RGU A;  3I9V 2;  1OYI A;  2MA3 A;  3D5R C;  4LFU A;  3S1M J;  2XF6 A;  4HST A;  1MMA A;  2B63 J;  3ABM H;  3R0A A;  2YUS A;  2OD5 A;  4EGY A;  3CQZ J;  4IVN A;  2BEO A;  1XB4 A;  4GDF A;  1FP2 A;  2ISY A;  2B9S A;  3W6V A;  1R4N B;  2R7F A;  3J7Y J;  5CQG A;  3RKY A;  1OPC A;  2WC2 A;  3JW4 A;  2PQ8 A;  4JYK A;  4LLG F;  3E0J B;  3HGY A;  5J4V A;  4B4C A;  2STT A;  4KJZ A;  2R5Z B;  3RYP A;  1S29 A;  3S2H J;  2E1M B;  3P7N A;  1S5L C;  3W2A A;  5BOX A;  3CES A;  2DW4 A;  3PO3 J;  1OIS A;  2V9P A;  3KLN A;  3O6B B;  5KK1 A;  4GRI A;  5J40 A;  5E8G A;  3GTP J;  2KQR A;  3TW7 A;  4FE7 A;  3T8T A;  3KP7 A;  2QQB A;  4WF2 A;  1EH8 A;  3KEQ A;  2DTR A;  3FM3 A;  3GTQ J;  5LEK A;  1GLN A;  1VQ9 I;  2DPD A;  2X51 A;  4G6T B;  5J6X A;  2PN6 A;  5A2Q Z;  3JR9 A;  4Q48 A;  4I0B A;  3QP6 A;  5LBQ A;  1YW9 A;  3COA C;  2EFW A;  1SAX A;  2VBW A;  4A3M J;  3NWS A;  2K86 A;  5H6Q A;  4EMS A;  3ML6 A;  1VFC A;  5LHG A;  1OCC H;  3KCC A;  4HYE A;  2W57 A;  3G1L A;  2W24 A;  1TW2 A;  2LMD A;  4LD5 A;  4E7H A;  1SMY F;  3H9G A;  5B3S H;  3RPU A;  4U88 A;  1MW7 A;  2HQ5 A;  3OS2 A;  3E5U A;  3H3V K;  5EGO B;  3KEO A;  2DJN A;  1S72 I;  1QZZ A;  2X6O A;  2QQ9 A;  3E3V A;  4XLP F;  2L3D A;  1R4M B;  2XAH A;  3FXQ A;  2CMP A;  2HNH A;  2UV1 A;  1HW2 A;  2GBY A;  3F8C A;  3V8K A;  1T39 A;  5JVG F;  2KPM A;  1Y8Q B;  4E4H A;  2VT2 A;  1Q1V A;  3U1D A;  2XAF A;  2X1C A;  4KDP A;  2Y2Z A;  2ZME A;  2XPV A;  4FHT A;  1PP8 F;  2XB0 X;  2IW5 A;  5D6E A;  4F7Z A;  2A6T A;  3B73 A;  1ZLK A;  3NAU A;  1D1C A;  2P0W A;  4CO8 A;  5M5Y J;  5D5U B;  1SAU A;  3EYY A;  1ETK A;  4II2 A;  1LJ9 A;  3F3X A;  3H35 A;  1W1W E;  1MJ9 A;  2QWW A;  4HV5 A;  4LG3 A;  5EZG A;  1EA3 A;  3H92 A;  2KT0 A;  1TWA J;  2FQ3 A;  2HTJ A;  2ZJ2 A;  5TJJ A;  2QBY B;  3F8M A;  1UFM A;  2DMT A;  3AG1 H;  5E20 A;  5FRN A;  2WTE A;  3G3Z A;  2QUF A;  3Q9S A;  4ENN A;  5JHF A;  4HF0 A;  4A0X A;  2W7N A;  1PUE E;  1RR8 C;  4JOM A;  1Y0U A;  1VQK I;  4PK4 A;  2F5E A;  1UJ8 A;  4JX5 A;  3GCM A;  3CO7 C;  2EV6 A;  1FY7 A;  4EM0 B;  3MVP A;  5D5X B;  2XKP A;  3F8B A;  1IG7 A;  2UZK A;  2X6X A;  2E2H J;  2JJ7 A;  1ULY A;  4I6Z A;  3MN2 A;  4YRV A;  5JVT A;  1BI3 A;  5F0H A;  2PEX A;  2CQX A;  1ETW A;  1YTY A;  4KMF A;  3OS1 A;  1R71 A;  2DA5 A;  2GZW A;  3OOP A;  1OCZ H;  1NK2 P;  1FP1 D;  3C1D A;  4XBF A;  3HRS A;  5BPD A;  2QQA A;  1X3U A;  2XAG A;  2IGO A;  1W7P D;  3ZQ7 A;  4DYR A;  5K5R A;  3QOE A;  3EQL F;  1K4T A;  3CP8 A;  3ROU A;  1TC3 C;  2K9M A;  3TDZ C;  2KZG A;  5F64 A;  2H1K A;  1I6X A;  3WE3 A;  4S05 A;  4NHJ A;  1I6H J;  1HKS A;  1I5Z A;  2VXZ A;  1QU3 A;  2X85 A;  2DAO A;  1OYY A;  3RZD J;  1T33 A;  4M9X A;  1YJN I;  1MZB A;  5E79 C;  2FRH A;  2CO5 A;  2EZH A;  3BPV A;  5L3G A;  3F6V A;  4PJJ A;  3IP4 B;  1CGP A;  2FBK A;  1BOB A;  1JKR C;  1YRN B;  1ON2 A;  1PUF A;  2H27 A;  2LKX A;  4H4K C;  4OIP F;  3PSF A;  4M3D A;  5KAI C;  1IDY A;  2FA5 A;  1SEU A;  1YQA A;  4UUT A;  4ESJ A;  2LVS A;  2JUC A;  5CJ9 A;  3N05 A;  2JA8 J;  4ZYE A;  2D1H A;  1GUU A;  3RQ4 A;  5F04 A;  4PJN A;  1FZP B;  1VI0 A;  2EIN H;  3GO5 A;  2XKO A;  3X2Q H;  3AKZ A;  1TQM A;  1XGO A;  3HOW J;  2CWE A;  3QWL A;  5EEA A;  3IH3 A;  1ZTR A;  1IRF A;  2OCC H;  3LNQ A;  2Y69 H;  2LFB A;  1JTX A;  1MBG A;  1V5F A;  4YFX F;  3JRB A;  3FMS A;  3G6E I;  4C3I J;  2VC0 A;  2FD5 A;  2NNN A;  3DTI A;  1MSE C;  4XSX F;  3PL8 A;  3KP5 A;  4G8X A;  5A2Q K;  3CC7 I;  2BY2 A;  2EB7 A;  2ZKZ A;  3HM5 A;  2JK3 A;  4CCJ A;  4M3E A;  2IS2 A;  2E34 A;  1J5Y A;  2GXB A;  4HQM A;  5CVR A;  3RIR A;  4DZJ A;  2IP2 A;  3ZMT A;  1ZRC A;  4IHW A;  3AG4 H;  1MGT A;  3ERE D;  2ZBK A;  3LFK A;  4FAS D;  4JX4 A;  1YHQ I;  3RI4 A;  5IP7 J;  1BW5 A;  1DP3 A;  3QPL A;  2V1X A;  3QP5 A;  3BZC A;  4NNJ A;  2LTP A;  1Z3X A;  1WRJ A;  3BT9 A;  3DPL C;  3J7Z I;  3JRG A;  3NAR A;  2ACJ A;  4IRH A;  4AYB A;  2Z33 A;  4IJA A;  3RQI A;  1D5V A;  2P8T A;  2BV6 A;  3SZG A;  4AIJ A;  1I39 A;  3E1S A;  5D5W B;  1ON1 A;  2BVL A;  3BDD A;  3BR0 A;  2DMP A;  4XRS A;  3HL2 A;  2KMU A;  1A5J A;  1ETX A;  2YSR A;  4KN7 X;  5HS8 A;  3I56 I;  3TGN A;  2IJL A;  3DEE A;  4I2O A;  3CCU I;  2DA4 A;  2G0E A;  3K4B A;  2BBY A;  3S2W A;  1QNT A;  2AXT C;  2WAF A;  3QQA A;  2GA2 A;  3BPX A;  3MZY A;  4DBR A;  1LFP A;  4WXD A;  1WQ2 A;  1HC8 A;  2XUB A;  1DGW Y;  1UHW A;  1Z6R A;  5LFA A;  3RSN A;  1T0F C;  3M8E A;  3ULQ B;  5E3M A;  1DQU A;  1HW5 A;  2A05 A;  2EH3 A;  3F72 A;  4RB0 A;  3T0Y A;  4EJU A;  3I59 B;  2R5Z A;  3MZH A;  2C6Y A;  3WTT C;  1D1B A;  4R1H A;  4I0A A;  4WXC A;  4ZYA A;  2HQA A;  2EZI A;  1Z21 A;  3GLL A;  4FIS A;  2HGC A;  2ZFU A;  1JUM A;  3MKY B;  1OFC X;  3ZPL A;  1NG6 A;  2IVM A;  3FWE A;  1IN5 A;  1YE9 A;  1MH3 A;  2M45 A;  1VTN C;  1ZAO A;  5F1J A;  3LST A;  5BPI A;  1R1U A;  5H20 A;  5LRS A;  5KNL A;  2EIJ H;  1VQN I;  2RRE A;  3BTI A;  2JA7 J;  1D8K A;  2W48 A;  2BW3 B;  3Q0V A;  3KP3 A;  3L2R A;  2ELH A;  4HG2 A;  2OC6 A;  3GF2 A;  1E17 A;  2Y75 A;  1TT0 A;  2L7M P;  2IGN A;  1GDT A;  2LDU A;  4A5M A;  1ZGA A;  1GV5 A;  4B8X A;  3ZCO A;  5EGO A;  5CKT A;  2CV0 A;  4OIN F;  5L3B A;  2V6C A;  1FSH A;  3DLA A;  4GXO A;  1D1A A;  2FNP A;  2NAZ A;  3HKZ N;  3V7R A;  4K2E A;  4HAM A;  1G59 A;  3E5X A;  3U21 A;  1Z67 A;  2K02 A;  3L9F A;  2JA6 J;  2EPF A;  1A6I A;  2OA4 A;  1UHS A;  5M5W J;  1U9O A;  2L2O A;  1SFU A;  3UR3 C;  2P81 A;  3K0L A;  2H6B A;  2VB6 A;  4FX4 A;  1MMN A;  3GXO A;  4F91 B;  4M9S A;  3I0T A;  3MFK A;  4YFK F;  2FXA A;  1VQ6 I;  4BE1 A;  3Q5F A;  1HCR A;  4HNU A;  2PBI A;  1ZG1 A;  2OTJ I;  3OYG A;  1V5G A;  4BGD A;  4L5E A;  2HOS A;  5E3O A;  1YIJ I;  1RKW A;  2KIF A;  3IAM 2;  4BQA A;  1F43 A;  3I58 A;  4S0H B;  2QBY A;  1TNS A;  2COB A;  3TL4 X;  1ZQ3 P;  1FOK A;  2CV1 A;  5LEJ A;  2NOG A;  2E2I J;  2MH2 A;  1G2H A;  4G7H F;  2LBF B;  1XS9 A;  4OAZ A;  2ZME C;  4IZZ A;  3KP6 A;  4FQG A;  2DK5 A;  1S8N A;  2AXL A;  4RB1 A;  4KA4 A;  1WZ2 A;  3HRT A;  1JXS A;  2XAS A;  1J09 A;  2E19 A;  4MLO A;  2W82 A;  3LAP A;  2JN6 A;  1JKO C;  1ZRF A;  2LRD A;  4C30 A;  1T56 A;  2O03 A;  3ZMS A;  2HXI A;  1W5S A;  4QSH A;  4E7I A;  1W0T A;  2Q1Z B;  2DOF A;  3CCY A;  2IS6 A;  4CSW A;  3MKL A;  1R5I D;  2FJ1 A;  1B9N A;  4XKB A;  1ZEL A;  3WTZ A;  3M4O J;  1GHC A;  4RGS A;  1O7L A;  1KU7 A;  2AHQ A;  3RDI A;  1QPM A;  2MD0 A;  4IX7 A;  3LL7 A;  2ZJP F;  2PI0 A;  2X6Y A;  1JHH A;  1W36 C;  1XN7 A;  4BE2 A;  1S7A A;  2GIV A;  3K4J A;  3KP2 A;  3TOB A;  1U9N A;  2NS7 A;  4BHC A;  2GA1 A;  1Z05 A;  2DMU A;  5C44 J;  1VZ0 A;  3SZT A;  4IHV A;  3LSM A;  4I7H A;  2A61 A;  4C3J J;  3TED A;  3K2Z A;  3VYR B;  1YRN A;  2P4W A;  4AVZ A;  2HFH A;  2MC4 A;  1NTC A;  3K4L A;  3CCV I;  5C3E J;  1AOY A;  3WU1 B;  1TLH B;  2RAE A;  2WY8 Q;  4L0Z B;  1WFX A;  2ESN A;  2JZY A;  3CTA A;  1FIP A;  3DF8 A;  3OYE A;  2IA2 A;  2JWT A;  4B09 A;  3I54 A;  5FGM A;  3HBL A;  1ZR4 A;  2Q8K A;  4JP0 A;  3SFZ A;  4F3Q A;  2QZ8 A;  3HOS A;  5E1Z B;  4IRG A;  2RKH A;  4N4O B;  2P7C B;  1I1G A;  5CVJ A;  1O3T A;  1J59 A;  3AG3 H;  2IEK A;  4IEJ A;  2G7H A;  4BJ5 C;  4AU7 A;  1QZY A;  4ZYH A;  2JUG A;  2RQQ A;  3BR6 A;  2HWV A;  2K85 A;  3CCQ I;  1MNE A;  1B4A A;  3CP2 A;  4BHP A;  4U0Y A;  4XN0 A;  4EV0 A;  5DUI A;  2F2E A;  4XLC A;  4R79 A;  1IAW A;  1PYV A;  2HYJ A;  2LY9 A;  4OU0 A;  4IOC F;  5LGT A;  4LJZ F;  5FD6 A;  3AAF A;  2DQL A;  2RGV A;  5HVQ C;  4HLY A;  1V4R A;  3EUH A;  2EWN A;  2PMH A;  5GAD J;  4CZC A;  2XRN A;  2LYC A;  3FK6 A;  3OYH A;  4AIH A;  1XSV A;  3PO2 J;  2R7T A;  3H1C A;  2M7A A;  1IXS B;  1LNW A;  1QO0 D;  3BCA A;  2O6G E;  3K4K A;  5KAF C;  1G8X A;  4OWR B;  1OCR H;  1U8B A;  4AWX B;  1P4A A;  1FX7 A;  2YPR A;  3A0H C;  3K2A A;  4BQQ A;  1A36 A;  3F23 A;  2H8W A;  3WHB A;  5K7F A;  4Y52 J;  2IXS A;  4XMY A;  2YX4 A;  2MLG A;  4PZJ A;  4B3A A;  4A6D A;  3OIO A;  4EJO A;  3S3O A;  2OZ6 A;  5LD2 C;  2DQR A;  2LG4 A;  1ETV A;  3J7A Y;  4O3M A;  1AA7 A;  1BR2 A;  2XF5 A;  4PJ0 C;  1XTA A;  3HIF A;  2ID3 A;  3ZMZ A;  1YJW I;  4CA0 A;  4XR6 A;  1ODD A;  3LSH A;  1G3T A;  3MKZ A;  2FX0 A;  3MWM A;  3G71 I;  3I59 A;  1Y1V J;  3WE2 A;  4UUV A;  1U5T B;  2XB5 A;  1XDS A;  4A3K J;  2V9K A;  2CQQ A;  2K3P A;  3VSK A;  4BYY A;  3O8H A;  3I71 A;  4EM2 A;  1ZLJ A;  5FRM A;  2M0C A;  2KFD A;  3JRI A;  3HUG B;  2QQ8 A;  1BW6 A;  2OPT A;  1USS A;  5HS7 A;  5AIQ A;  1POG A;  1IZ1 A;  1F4K A;  1D8J A;  1ZGJ A;  3CJN A;  3NEU A;  3SFI A;  3S17 J;  2BW3 A;  3C2B A;  1FOW A;  2CS3 A;  2E1M C;  2E60 A;  2W85 A;  4MTE A;  1BL0 A;  2COM A;  2PMZ N;  2QVO A;  4XKW A;  1VQ8 I;  1WCM J;  4BBS J;  3WG9 A;  2ZXW H;  2R7X A;  1X3Z B;  4XLN F;  2R4G A;  1H8A C;  2Q0O A;  1Z3Y A;  2A6H F;  1JKQ C;  2MAB A;  5DYM A;  2VOO A;  1ZN2 A;  2F4O B;  4L5I A;  3OYI A;  4YII A;  1LE8 B;  2QM3 A;  1LDK B;  3WHC A;  1FLI A;  1QBJ A;  4GGG A;  3LA3 A;  2NVX J;  4OMZ A;  1E3P A;  3N4M A;  3NRV A;  3L2W A;  3PSI A;  2A3S A;  3L2U A;  1TQP A;  3OIP A;  4V19 K;  3SQN A;  4YG2 F;  2ELJ A;  2M1B A;  1HSJ A;  2EV5 A;  2YX7 A;  5GAE J;  3MKW B;  2QLZ A;  2IAI A;  2OCE A;  1R9T J;  2KJC A;  3M8F A;  5HNH A;  4FCY A;  2UXX A;  3HTS B;  3S3N A;  1YS6 A;  5TIS C;  3BP8 A;  3IKV A;  4BQO A;  3DV8 A;  4BBR J;  2VI6 A;  3A03 A;  3GZ5 A;  4FE4 A;  1P92 A;  4KIB A;  3JSO A;  3DBR B;  5DM6 F;  3BJO A;  1AWC A;  4E7J A;  1BA5 A;  2VE9 A;  3WOD F;  2WAD A;  1ACI A;  4UB6 C;  3VEP A;  2LBF A;  2A6E F;  2L4M A;  4HSR A;  1BIA A;  1Y1W J;  3DTE A;  3HEF A;  2NNY A;  4RAY A;  3PUB A;  4GYG A;  2CV2 A;  4KN4 X;  3WGG A;  1IO2 A;  2EZK A;  2XAU A;  5IYC J;  1X2M A;  1FC3 A;  4ZTF A;  1RKT A;  4RAZ A;  4RAG A;  4Y7N J;  2V4J C;  2HZT A;  2RNG A;  4A6E A;  3PM1 A;  1TWH J;  4NC6 A;  2VC1 A;  5F6F A;  4UV8 A;  4TV7 A;  4IQJ A;  2R7R A;  4X0G A;  1MMD A;  3FXU A;  3MCZ A;  1FYM A;  2NOJ B;  1KQ0 A;  3QYF A;  2R7O A;  5DD4 A;  3BG7 A;  2MYS A;  2GIZ A;  2M4K A;  2LKS A;  1K78 B;  2KZV A;  3VFZ A;  3GFM A;  4HOB A;  2O3F A;  1YIT I;  3ECH A;  5HLG A;  4JBA A;  2DMQ A;  2V9V A;  1OQY A;  2LRE A;  3D5S C;  1V5E A;  1JJ8 C;  3HOY J;  3S32 A;  1P6R A;  3SXY A;  1Q1H A;  2M9H A;  2Z16 A;  3OYM A;  2ECC A;  3QPT A;  4O6J A;  4NQW B;  5IP6 A;  3SJM A;  1TBX A;  3DFG A;  4QPQ A;  3S2D J;  2GLO A;  1QZE A;  3EYI A;  2MD5 A;  3T5X A;  4N9H A;  2EBI A;  4Y17 A;  1NK3 P;  4RA2 A;  3CUQ C;  5E1W A;  4IHS A;  4A3C J;  2FMY A;  2ZJQ F;  5LGN A;  2I5U A;  4XLA A;  4P1W A;  3G73 A;  4CYC B;  1HQC A;  2V1D A;  2JSP A;  2TDX A;  1J9I A;  2KIS A;  2HOE A;  3CC4 I;  1BI0 A;  5IT9 K;  1S7O A;  1R1V A;  1U6G A;  2ZXI A;  4BDY A;  4J01 A;  2RQP A;  2ZB9 A;  3RPQ A;  3S3M A;  5D4R A;  1KON A;  2F4M B;  4A0Y A;  3IUO A;  3GYH X;  2VJ5 A;  1D0Y A;  1K79 A;  2DFF A;  4OIO F;  2V1U A;  3ZRG A;  4XRS G;  3T8R A;  3JRF A;  5CVV A;  2JMW A;  3FXK A;  4ZH4 F;  2DPU A;  3ZQL A;  1TT5 B;  1LFU P;  1M1E B;  5IY5 H;  1B59 A;  4CCK A;  4R8H A;  5E3N A;  4L9J A;  1R5H A;  2E7W A;  5H2F C;  4BHB A;  1T38 A;  2CW8 A;  4MQ9 F;  2M7B A;  3QYB A;  4BJ6 C;  3L09 A;  3SEZ A;  3ONQ A;  2VBX A;  2O9L A;  1ZG5 A;  4GO1 A;  5DM7 F;  1KU2 A;  2AQF A;  4CCL A;  2LF8 A;  2XPW A;  2CSO A;  1YI2 I;  1ZG3 A;  1GV2 A;  1K4S A;  4PFO A;  3WTV C;  1OKR A;  4HDU A;  4YIF A;  1SD5 A;  3QAH A;  5HDN A;  3E5Q A;  5FFZ A;  4EJW A;  1FYK A;  3EUH C;  2M87 A;  2WB1 N;  4HX8 A;  5FKM A;  2ZXJ A;  3NWT A;  2GWR A;  2DU9 A;  2BGC A;  3KZZ A;  4PUS A;  1JGG A;  1B1B A;  5CQE A;  5E18 F;  4MIM A;  2DJI A;  2B7E A;  1ZR2 A;  4II3 A;  4DNC A;  3V7S A;  3W2V A;  1E3H A;  5EG0 B;  1IUY A;  3RPU D;  1YW8 A;  1SFE A;  2W25 A;  1HST A;  1U5T A;  1UAA A;  2EV0 A;  2DOE A;  1YW7 A;  2M34 A;  1GXQ A;  4MEY F;  2KKO A;  1DU6 A;  4MFE A;  1MJA A;  2X6W A;  5FKO A;  2CUF A;  1GXP A;  1I1S A;  2GOX B;  3A01 A;  2ZO4 A;  3HUG A;  1D3Y A;  3OL4 A;  3TBI A;  4AVP A;  2Y9Z A;  1LVK A;  2P5L C;  2CG4 A;  2BY1 A;  2EZL A;  2KIM A;  3CLQ A;  3TMO A;  1PJR A;  1R36 A;  3MAJ A;  3F22 A;  1P2F A;  3BTJ A;  2IS4 A;  3E6D A;  4OOI A;  3FIS A;  3CME I;  1F1Z A;  1WKM A;  3LSP A;  5D4S A;  3JRC A;  2JRM A;  2FF4 A;  4NC8 A;  4C2T A;  1EF4 A;  4MHG A;  4XL9 A;  5HS9 A;  1B6A A;  4L9V A;  3L2C A;  2L9V A;  4NBQ A;  1WJE A;  3QU3 A;  1YG2 A;  3FHZ A;  3HOV J;  3TDU C;  2P5K A;  1EJ9 A;  1SFX A;  5F08 A;  1WHU A;  2GAU A;  2EFN A;  2LK2 A;  1K6Y A;  5D6F A;  2VQL A;  1JI8 A;  1PVE A;  2BE5 F;  4MO7 A;  4N9I A;  1LE8 A;  3GTJ J;  3BWG A;  1E0E A;  3OYD A;  4BXF A;  2K9S A;  1W36 D;  2HPM A;  4A2U A;  2MLK A;  1G3Y A;  3WG7 H;  4HBL A;  2EJR A;  2QCO A;  3HHG A;  4KIG A;  4DJA A;  1FMV A;  2WWY A;  2L02 A;  3OL3 A;  4KT6 A;  4WCG A;  1R7J A;  3DU5 A;  3CJQ B;  3VOE A;  2HVS A;  4ZDO A;  3KZI C;  1RIO H;  3GLX A;  2JPC A;  4P96 A;  3S1N J;  5EZH A;  5GPC A;  2FSW A;  5IP9 J;  2Z1D A;  1JHF A;  1KQ9 A;  4V2F A;  4LB6 B;  1X2N A;  2JT1 A;  2X1E A;  4CUG A;  2A5W A;  3GME A;  1YX5 A;  3DQV C;  3FBN B;  3TO6 A;  5ICC A;  3I55 I;  3UKG A;  1G6N A;  3ZQI A;  5LHH A;  3KEY A;  4XNF A;  4EQQ A;  4XQF A;  3A0B C;  2O0Y A;  4W97 A;  2Y0S A;  1XSX A;  2DBB A;  3KPH A;  4BXX J;  2OTL I;  2XGX A;  2DYS H;  3OOU A;  3HC7 A;  3WTX C;  2RNJ A;  2GXA A;  2ADU A;  3VDX A;  4ZZD A;  3WTS C;  3FKJ A;  1XD7 A;  2MW8 A;  1Y56 A;  3OV8 A;  5IPA A;  4GCV A; 
#chains in the Genus database with same CATH homology
 1P4X A;  2Z99 A;  3HTU A;  3I53 A;  4P9U A;  1TTY A;  1C0W A;  2UXN A;  1KGS A;  1K78 A;  4FT8 A;  4EM1 A;  4EJT A;  4M72 A;  1W4M A;  1R22 A;  2R3S A;  2EA2 A;  2HKX A;  4NQW A;  5ERI A;  4HDV A;  3EDP A;  1G4D A;  2O61 A;  3CUO A;  3BJA A;  3O3K A;  1WSU A;  3DEU A;  3HSE A;  3C18 A;  4OIQ F;  4UNO A;  3ELK A;  2L54 A;  4ZZL A;  4M6X A;  1O3R A;  4NB5 A;  2ZNY A;  5CVU A;  3C7J A;  1MDM B;  5CYV A;  1J7K A;  4OMY A;  1Z1D A;  5E8I A;  2H94 A;  2VT3 A;  4RGX A;  2JPB A;  5CLS A;  1YFH A;  2QYO A;  3HOT A;  2JRT A;  3GEZ A;  5L3D A;  1MJB A;  2KJB A;  4FX0 A;  1XCB A;  4KMU X;  3JTH A;  5ILU A;  1U2W A;  4U0V A;  4CXF A;  2XIG A;  1SD7 A;  4MEX F;  3R0J A;  2F5D A;  3QOP A;  3FM5 A;  4PGH A;  1LDJ A;  1S3J A;  1W7P B;  4XRF A;  1U78 A;  5E1X A;  2EFP A;  2OU2 A;  4WK8 F;  4KUM A;  1MD0 A;  1V3F A;  2F5C A;  1IN6 A;  4N0B A;  2Z9O A;  2P6T A;  4UHT A;  1YO5 C;  5DV5 A;  4I98 B;  1ONV A;  3D5L A;  1K6O A;  1XDU A;  2NRA C;  2K4B A;  3BRO A;  4QLC U;  4U0W A;  4L9N A;  3V8L A;  2DT5 A;  2ZNZ A;  5IT3 A;  4CYD A;  2R7D A;  4ZYG A;  3FF5 A;  2E1N A;  1BC8 C;  1OR7 A;  3IL2 A;  1U5T C;  3FMQ A;  4P9F A;  3RKW A;  1ZRD A;  1LDD A;  1G3S A;  5ILS A;  3ABU A;  2Z5U A;  1HBX G;  3GVA A;  1T98 A;  3W6J B;  3L00 A;  1F9N A;  2B0L A;  3KLO A;  2XRO A;  4KIC A;  5ICG A;  4HX7 A;  1OMI A;  2LF7 A;  2LNB A;  1STZ A;  1UB9 A;  4KFC A;  1CF7 B;  2LSO A;  1FBQ A;  5LLQ A;  1LQ1 A;  1IF1 A;  4IPA A;  4ASN A;  4MTD A;  1FNN A;  4OIR F;  1DUX C;  4KNY A;  3PQJ A;  5IT9 Z;  4CZZ A;  1H9T A;  2XHK A;  1KU9 A;  3DKW A;  4Y13 A;  2FNA A;  2LKP A;  2MBF A;  2NS0 A;  2L01 A;  5K5Q A;  2XV4 S;  2CGP A;  4CIC A;  2JSC A;  3CDH A;  2YR2 A;  3E6C C;  2CQK A;  4AIK A;  4HW0 A;  4PCQ A;  2M30 A;  4HV6 A;  1H0M A;  2FU4 A;  5DUK A;  3JSP A;  3REO A;  3K1N A;  3HHH A;  2OBP A;  2IRF G;  2XAJ A;  2P7V B;  2P5V A;  4ESB A;  3GFI A;  4RB3 C;  2ISZ A;  1HKQ A;  2VBZ A;  2JTV A;  2HQR A;  2HS5 A;  3HSF A;  2X0L A;  3E6M A;  1R5G A;  4RB2 C;  3FXR A;  2K7L A;  3FZV A;  3IRQ A;  5BMZ A;  1T0F A;  1MDM A;  1R58 A;  2RN7 A;  3FMR A;  4MQV A;  5KVR A;  1FPQ A;  2CFX A;  1BM9 A;  4H0E A;  1G3W A;  3KFW X;  1P4W A;  4M9Z A;  3ZMU A;  4BH9 A;  1IN7 A;  3P9I A;  2K4J A;  1LB2 A;  1BI2 A;  3ZN0 A;  3W6K B;  1BBY A;  3T1B A;  5HLH A;  4LLN A;  1BC7 C;  5JR3 A;  4PDK A;  1L0O C;  2EFQ A;  2V79 A;  3ZMD A;  5FO5 A;  1ZYR F;  1W7P A;  1R1T A;  3KE2 A;  4LGW A;  1EH6 A;  1E2X A;  4LLL A;  3SHF A;  3ZP5 A;  2GQQ A;  4JK1 X;  4WWC A;  3HRM A;  2VBY A;  3P9C A;  5BQT A;  1T6S A;  5LHI A;  2A68 F;  4HF2 A;  1QQI A;  3BJ6 A;  3ECO A;  2HTS A;  5JHU A;  1DDN A;  2IPQ X;  1RZ4 A;  2HEO A;  3V4G A;  5L3F A;  2Q2E A;  2Y48 A;  1I27 A;  5K1Y A;  5D5V B;  3LAJ A;  4KT5 C;  2Y0M A;  1FBU A;  3K69 A;  5L3E A;  3JAM Z;  4KYW A;  1Z91 A;  2E7X A;  3IRR A;  4L9T A;  4ENJ A;  5DEQ A;  3E97 A;  3CO6 C;  4O5V A;  3V7C A;  1BI1 A;  2DFI A;  3VOD A;  3H3Z A;  4BAY A;  1R23 A;  2WV0 A;  3R61 A;  5FB2 A;  1XMK A;  4LK1 F;  3PQK A;  1DP7 P;  1LEA A;  1DPR A;  2ZCW A;  4Q4Z F;  3GW2 A;  1OYW A;  4HX4 A;  1W5T A;  2HR3 A;  2K27 A;  1IN8 A;  2FBH A;  4LK0 F;  5ILV A;  1JE8 A;  2ESH A;  3E6B A;  2DK8 A;  1CF7 A;  2J5O A;  1GVJ A;  3TO7 A;  3WGH A;  3L7W A;  5DD8 A;  5J8C A;  3WU0 A;  3CUQ B;  4M71 A;  4MNU A;  1SD4 A;  5FLX Z;  1ZHF A;  1BOA A;  2A69 F;  5JI6 A;  4EJV A;  4YFN F;  4BNC A;  2H6C A;  3U2R A;  3WTY C;  3F8N A;  2X4H A;  3J7A O;  2OQG A;  3FX3 A;  1YLF A;  3JTG A;  2D45 A;  4EVI A;  3DXJ F;  4LMY A;  5LGU A;  5J8F A;  4CHU A;  1REP C;  1KYZ A;  3U9G A;  3GX4 X;  1FSE A;  3WTW C;  2CYY A;  2VE8 A;  1F5T A;  4BXU A;  2A5Y B;  2DO7 A;  3R60 A;  4ZYD A;  3BOQ A;  1L3L A;  4L0Y B;  1FYL A;  2HYF A;  4I09 A;  4IF4 A;  3MEX A;  1T2K A;  2FML A;  2UWM A;  1J2X A;  1J0R A;  4G7O F;  1WI9 A;  1RUO A;  4L5J A;  1Z7U A;  1XSD A;  3I4P A;  3ABT A;  1MKM A;  1R00 A;  5DCF A;  5FD5 A;  5DCM B;  1KA8 A;  3F8F A;  2HYG D;  1UCR A;  5BS6 A;  3JAM K;  2H09 A;  2HKO A;  2VOD A;  3RYR A;  3MQ0 A;  1TNT A;  3LQR A;  3M7G A;  3ZMV A;  1O3Q A;  2FE3 A;  4ENM A;  2FBI A;  3K1M A;  1PP7 U;  3TO9 A;  1FT9 A;  3J80 Z;  4L18 B;  3NQO A;  1HW1 A;  5D8L B;  5L3C A;  1BIB A;  1QGP A;  2KRF A;  1U8R A;  4KIF A;  2KIU A;  4LG0 B;  4RGR A;  4A0Z A;  4I02 A;  4IRI A;  1DPU A;  1KYW A;  4A12 A;  3GFJ A;  3IWZ A;  4M74 A;  3Q9V A;  1YYV A;  1RI7 A;  1RUN A;  2L4A A;  3GUD A;  4G6D A;  1TW3 A;  3QU6 A;  4M73 A;  3TKY A;  5AIP A;  1XMA A;  1K7A A;  2GXG A;  4XSZ F;  3I5U A;  2G7U A;  4A5N A;  1UST A;  4RS8 A;  5FLX K;  4HZF A;  4P5O A;  6PAX A;  1UHM A;  3LA7 A;  2BYV E;  3BY6 A;  4P55 A;  1ZAR A;  5LRR A;  3RTR A;  5AON A;  2YU3 A;  5D8K B;  2F5F A;  2EFO A;  1IXR C;  1B9M A;  2OQR A;  5H6R A;  5HOO A;  4HQE A;  1XGN A;  3HYI A;  1IW7 F;  1KQ8 A;  2PG4 A;  2IT0 A;  1XGS A;  3D0S A;  2MC3 A;  3RJP A;  3V8J A;  1ZRE A;  1YS7 A;  4G94 A;  1XGM A;  3HSR A;  4E70 A;  1ZH5 A;  5CVI A;  3GZ6 A;  4PGG A;  1IXC A;  2RDP A;  4LB5 A;  2ZFW A;  1O7F A;  4ETS A;  1O57 A;  3CLO A;  1EV7 A;  1PDN C;  3QPH A;  3R6S A;  4UV9 A;  2AS5 F;  2FEZ A;  2E1C A;  4DQ2 A;  4Q5S F;  1S6L A;  4Z2Y A;  5K5O A;  3DPT A;  4ON0 A;  2HDC A;  3CUQ A;  2P6S A;  3K9T A;  2FOK A;  4G6Q A;  4ENK A;  4CDG A;  1H9G A;  3TQN A;  1XCV A;  4IXA A;  3J81 Z;  3B02 A;  3QRF F;  2EA4 A;  5DDG A;  3LWF A;  3J80 K;  2ZME B;  3GFL A;  3PFI A;  4EGZ A;  2ETH A;  3C3W A;  3KET A;  4WXH A;  1LEB A;  3IHU A;  5F1R A;  2MH9 A;  4HF1 A;  3M1E A;  2D1V A;  3GWZ A;  3H3U A;  5FFX A;  1J75 A;  1LVA A;  1EH7 A;  2IA0 A;  1WWX A;  3F6O A;  1IN4 A;  3P9K A;  1HXD A;  2XVC A;  3R4K A;  2EK5 A;  4JQF A;  2PLY A;  1O3S A;  2W84 A;  5HLI A;  4IHT A;  2RV8 A;  3ZN1 A;  5E17 F;  4AD9 A;  4G9Y A;  2QEN A;  3SZP A;  4HLX A;  5TRD A;  4ESF A;  3RKX A;  2Z3Y A;  1SMT A;  1SD6 A;  3KZY A;  4CGZ A;  5HDG A;  4U7D A;  3IC7 A;  4WX9 A;  5DCM A;  1U3E M;  2D2W A;  2RVC A;  3WGI A;  3N97 A;  4UXN A;  4HA8 A;  1FWZ A;  3BZ6 A;  4U7B A;  3ISP A;  2RC4 A;  2DI3 A;  1A04 A;  4UVA A;  1NHA A;  1TQI A;  1RNL A;  1JGS A;  1KU3 A;  4M6Y A;  3K1P A;  1HKT A;  3DP7 A;  4Y15 A;  1YIO A;  2PJP A;  4MGR A;  2O8X A;  5JFR A;  2PFB A;  3HRU A;  3I64 A;  3O2P E;  2J5P A;  5EEG A;  1Z6T A;  2VOP A;  4I01 A;  3VB2 A;  2NYX A;  3IWF A;  4Q47 A;  5ICF A;  4UVC A;  3KP4 A;  1BJA A;  4UVB A;  2STW A;  4LG0 A;  4S04 A;  5EEH A;  3IKT A;  3LA2 A;  1Z9C A;  2CW0 F;  3F21 A;  2OAZ A;  5HDK A;  3M9A A;  2VN2 A;  2M5W A;  2G9W A;  2VON A;  4GYI A;  1BN5 A;  2OZU A;  4G7Z F;  1FBS A;  4D0P A;  5ICE A;  2DLL A;  1IRG A;  2PMU A;  4QWQ A;  2M8E A;  5ED4 A;  3TOA A;  3LQQ A;  3J81 K;  2HQN A;  3EET A;  2XAQ A;  3WTU C;  2IA1 A;  2A07 F;  4RGU A;  1OYI A;  2MA3 A;  4LFU A;  3R0A A;  2OD5 A;  4EGY A;  4IVN A;  2BEO A;  1XB4 A;  1FP2 A;  2ISY A;  2R7F A;  3RKY A;  1OPC A;  2WC2 A;  3JW4 A;  2PQ8 A;  4LLG F;  2STT A;  3RYP A;  1S29 A;  3P7N A;  5BOX A;  2DW4 A;  3KLN A;  3O6B B;  5KK1 A;  5E8G A;  3T8T A;  3KP7 A;  2QQB A;  4WF2 A;  1EH8 A;  3KEQ A;  2DTR A;  3FM3 A;  5LEK A;  2DPD A;  5J6X A;  2PN6 A;  5A2Q Z;  4Q48 A;  4I0B A;  3QP6 A;  5LBQ A;  1YW9 A;  3COA C;  2EFW A;  1SAX A;  2VBW A;  2K86 A;  5H6Q A;  4EMS A;  3ML6 A;  5LHG A;  3KCC A;  4HYE A;  2W57 A;  2W24 A;  1TW2 A;  4LD5 A;  1SMY F;  3RPU A;  4U88 A;  3E5U A;  3KEO A;  1QZZ A;  2QQ9 A;  3E3V A;  4XLP F;  2L3D A;  2XAH A;  3FXQ A;  1HW2 A;  3F8C A;  3V8K A;  1T39 A;  2VT2 A;  3U1D A;  2XAF A;  4KDP A;  2ZME A;  4FHT A;  1PP8 F;  2IW5 A;  5D6E A;  4F7Z A;  3B73 A;  1ZLK A;  4CO8 A;  5D5U B;  3EYY A;  1LJ9 A;  3F3X A;  1MJ9 A;  2QWW A;  4HV5 A;  3H92 A;  2FQ3 A;  2HTJ A;  2ZJ2 A;  5TJJ A;  2QBY B;  3F8M A;  1UFM A;  5E20 A;  2WTE A;  3G3Z A;  2QUF A;  3Q9S A;  4ENN A;  1PUE E;  4HF0 A;  4A0X A;  1Y0U A;  2F5E A;  3CO7 C;  2EV6 A;  1FY7 A;  4EM0 B;  5D5X B;  2XKP A;  3F8B A;  2UZK A;  1ULY A;  5JVT A;  1BI3 A;  2PEX A;  1YTY A;  4KMF A;  2GZW A;  3OOP A;  1FP1 D;  3C1D A;  4XBF A;  3HRS A;  5BPD A;  2QQA A;  1X3U A;  2XAG A;  3ZQ7 A;  1W7P D;  5K5R A;  3EQL F;  3ROU A;  3TDZ C;  5F64 A;  1I6X A;  3WE3 A;  4S05 A;  4NHJ A;  1HKS A;  1I5Z A;  2VXZ A;  2DAO A;  1OYY A;  4M9X A;  1MZB A;  2FRH A;  2CO5 A;  3BPV A;  5L3G A;  3F6V A;  1CGP A;  2FBK A;  1ON2 A;  2H27 A;  4OIP F;  2FA5 A;  1YQA A;  4ESJ A;  5CJ9 A;  4ZYE A;  2D1H A;  1FZP B;  3GO5 A;  2XKO A;  1TQM A;  1XGO A;  2CWE A;  1IRF A;  4YFX F;  3FMS A;  2VC0 A;  2NNN A;  4XSX F;  3KP5 A;  4G8X A;  5A2Q K;  2EB7 A;  2ZKZ A;  1J5Y A;  2GXB A;  4HQM A;  5CVR A;  3RIR A;  2IP2 A;  3ZMT A;  1ZRC A;  1MGT A;  3ERE D;  2ZBK A;  3LFK A;  3RI4 A;  2V1X A;  3QP5 A;  1WRJ A;  3DPL C;  2ACJ A;  4IRH A;  2Z33 A;  4IJA A;  1D5V A;  2P8T A;  2BV6 A;  4AIJ A;  5D5W B;  1ON1 A;  3BDD A;  4KN7 X;  2YSR A;  5HS8 A;  3TGN A;  2IJL A;  4I2O A;  2BBY A;  1QNT A;  2GA2 A;  3BPX A;  3MZY A;  4WXD A;  1WQ2 A;  2XUB A;  1UHW A;  1Z6R A;  3M8E A;  3ULQ B;  1HW5 A;  3F72 A;  4EJU A;  2C6Y A;  4RB0 A;  3T0Y A;  3MZH A;  3I59 B;  3WTT C;  4R1H A;  4I0A A;  4WXC A;  2HGC A;  3ZPL A;  2IVM A;  3FWE A;  1IN5 A;  2M45 A;  1VTN C;  1ZAO A;  3LST A;  5BPI A;  1R1U A;  5H20 A;  5LRS A;  1D8K A;  3KP3 A;  2ELH A;  3GF2 A;  1E17 A;  2Y75 A;  4GCV A;  2LDU A;  4A5M A;  1ZGA A;  4B8X A;  4OIN F;  5L3B A;  2V6C A;  1FSH A;  4GXO A;  2FNP A;  2NAZ A;  3V7R A;  4K2E A;  4HAM A;  3E5X A;  2K02 A;  3L9F A;  2OA4 A;  1SFU A;  3K0L A;  2H6B A;  4FX4 A;  3GXO A;  4M9S A;  3I0T A;  3MFK A;  4YFK F;  2FXA A;  3Q5F A;  2PBI A;  1ZG1 A;  2KIF A;  4BQA A;  3I58 A;  2QBY A;  1TNS A;  1FOK A;  5LEJ A;  2MH2 A;  4G7H F;  3KP6 A;  2DK5 A;  1S8N A;  2AXL A;  4RB1 A;  4KA4 A;  3HRT A;  1JXS A;  2XAS A;  3LAP A;  1ZRF A;  2O03 A;  3ZMS A;  1W5S A;  1B9N A;  3WTZ A;  1GHC A;  4RGS A;  1O7L A;  1KU7 A;  3RDI A;  1QPM A;  2PI0 A;  1JHH A;  1XN7 A;  1S7A A;  2GIV A;  3KP2 A;  3TOB A;  4BHC A;  2GA1 A;  1Z05 A;  3SZT A;  4I7H A;  2A61 A;  3K2Z A;  2P4W A;  2HFH A;  1AOY A;  3WU1 B;  1TLH B;  4L0Z B;  2ESN A;  3CTA A;  2JZY A;  3DF8 A;  2IA2 A;  4B09 A;  3I54 A;  5FGM A;  2Q8K A;  3SFZ A;  2QZ8 A;  3HOS A;  5E1Z B;  4IRG A;  2RKH A;  2P7C B;  1I1G A;  5CVJ A;  1O3T A;  1J59 A;  2G7H A;  1QZY A;  4ZYH A;  2HWV A;  1B4A A;  4BHP A;  4U0Y A;  4EV0 A;  5DUI A;  2F2E A;  4R79 A;  1IAW A;  4OU0 A;  5LGT A;  4LJZ F;  5FD6 A;  3AAF A;  2DQL A;  2RGV A;  5HVQ C;  4HLY A;  1V4R A;  3EUH A;  2EWN A;  2PMH A;  2XRN A;  4AIH A;  1XSV A;  1IXS B;  1LNW A;  1QO0 D;  2O6G E;  4AWX B;  1P4A A;  1FX7 A;  2YPR A;  3F23 A;  2YX4 A;  2MLG A;  4PZJ A;  4A6D A;  4EJO A;  2OZ6 A;  2DQR A;  4O3M A;  3HIF A;  3ZMZ A;  1ODD A;  1G3T A;  3MWM A;  3I59 A;  3WE2 A;  4UUV A;  1U5T B;  1XDS A;  4BYY A;  3I71 A;  4EM2 A;  1ZLJ A;  1USS A;  5HS7 A;  5AIQ A;  1IZ1 A;  1F4K A;  1D8J A;  1ZGJ A;  3CJN A;  3NEU A;  2W85 A;  4MTE A;  2COM A;  2QVO A;  3WG9 A;  4XLN F;  2Q0O A;  2A6H F;  5DYM A;  2VOO A;  1ZN2 A;  4L5I A;  4YII A;  2QM3 A;  1LDK B;  1FLI A;  1QBJ A;  4GGG A;  3LA3 A;  4OMZ A;  3N4M A;  3NRV A;  2A3S A;  1TQP A;  3SQN A;  4YG2 F;  2M1B A;  1HSJ A;  2EV5 A;  2YX7 A;  2QLZ A;  2KJC A;  3M8F A;  2UXX A;  3HTS B;  1YS6 A;  3BP8 A;  3IKV A;  3DV8 A;  3GZ5 A;  1P92 A;  4KIB A;  3JSO A;  3BJO A;  1AWC A;  2VE9 A;  3WOD F;  3VEP A;  2A6E F;  2L4M A;  1BIA A;  2NNY A;  4RAY A;  4GYG A;  4KN4 X;  3WGG A;  1FC3 A;  4RAZ A;  2HZT A;  4A6E A;  2VC1 A;  5F6F A;  4UV8 A;  4TV7 A;  3FXU A;  3MCZ A;  1FYM A;  1KQ0 A;  5DD4 A;  1K78 B;  3VFZ A;  3GFM A;  4HOB A;  2O3F A;  3ECH A;  5HLG A;  4JBA A;  2V9V A;  1P6R A;  3SXY A;  1Q1H A;  3QPT A;  4O6J A;  1TBX A;  3DFG A;  3EYI A;  2MD5 A;  3T5X A;  4N9H A;  4Y17 A;  3CUQ C;  5E1W A;  4IHS A;  2FMY A;  5LGN A;  3G73 A;  1HQC A;  2V1D A;  2TDX A;  1J9I A;  2HOE A;  1BI0 A;  5IT9 K;  1S7O A;  1R1V A;  1U6G A;  2RQP A;  3RPQ A;  5D4R A;  4A0Y A;  3GYH X;  1K79 A;  4OIO F;  2V1U A;  3T8R A;  5CVV A;  4ZH4 F;  2DPU A;  1B59 A;  4R8H A;  4L9J A;  1R5H A;  2E7W A;  4BHB A;  1T38 A;  4MQ9 F;  3L09 A;  2VBX A;  1ZG5 A;  4GO1 A;  1KU2 A;  2LF8 A;  2CSO A;  1ZG3 A;  3WTV C;  1OKR A;  4HDU A;  4YIF A;  1SD5 A;  3QAH A;  5HDN A;  3E5Q A;  5FFZ A;  4EJW A;  1FYK A;  2M87 A;  4HX8 A;  2ZXJ A;  2GWR A;  2DU9 A;  2BGC A;  3KZZ A;  1B1B A;  5E18 F;  4DNC A;  3V7S A;  1IUY A;  1YW8 A;  1SFE A;  2W25 A;  1HST A;  1U5T A;  2EV0 A;  1YW7 A;  1GXQ A;  4MEY F;  2KKO A;  1MJA A;  1I1S A;  1GXP A;  2ZO4 A;  3HUG A;  1D3Y A;  4AVP A;  2P5L C;  2CG4 A;  2KIM A;  3MAJ A;  1R36 A;  3F22 A;  1P2F A;  3E6D A;  4OOI A;  1F1Z A;  1WKM A;  5D4S A;  2FF4 A;  4MHG A;  5HS9 A;  1B6A A;  4L9V A;  3L2C A;  3QU3 A;  3FHZ A;  1YG2 A;  3TDU C;  2P5K A;  1SFX A;  2GAU A;  2EFN A;  5D6F A;  2BE5 F;  4N9I A;  3BWG A;  4A2U A;  2MLK A;  1G3Y A;  4HBL A;  2EJR A;  3HHG A;  4KIG A;  2WWY A;  2L02 A;  4WCG A;  1R7J A;  3VOE A;  1RIO H;  3GLX A;  2JPC A;  4P96 A;  2FSW A;  1JHF A;  1KQ9 A;  4LB6 B;  2JT1 A;  3DQV C;  3TO6 A;  5ICC A;  1G6N A;  5LHH A;  4EQQ A;  2O0Y A;  1XSX A;  2DBB A;  2XGX A;  3WTX C;  2RNJ A;  2ADU A;  4ZZD A;  3WTS C;  1XD7 A;  3OV8 A;  3S2W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...