1QPMA

Nmr structure of the mu bacteriophage repressor dna-binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
b'KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MU BACTERIOPHAGE C REPRESSOR PROTEIN)
publication title NMR structure and functional studies of the Mu repressor DNA-binding domain.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Viral protein
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qpmA00
4UV9A 1SFUA 3B02A 1TW3A 4LB5A 5LGTA 3KP2A 1TQPA 3ZMVA 3REOA 1IAWA 4OIOF 4LK1F 1P4AA 5CJ9A 5FLXZ 2FA5A 3QP5A 1OKRA 2L3DA 1F1ZA 2VT3A 3ZN0A 5K5RA 2OBPA 2RN7A 2X4HA 4RB2C 1STZA 2K4BA 5DD8A 3Q5FA 3TDZC 2YU3A 1IXSB 3I5UA 3TO7A 3SZTA 2EWNA 3IC7A 2VOOA 2CFXA 2P4WA 3ABTA 4EV0A 2X0LA 5D6EA 1HXDA 2BE5F 3WTVC 3EUHA 5D5UB 5FD6A 1RI7A 2W84A 1LB2A 3R60A 1QNTA 4YFKF 3F72A 4ENJA 3C1DA 3FWEA 2VONA 5D5VB 3IWFA 1O7LA 1YQAA 2ZBKA 5BQTA 3LAPA 3TO6A 2P7CB 1JXSA 3I4PA 1R22A 1SFEA 3VOEA 2A07F 3V7RA 3LWFA 3KEQA 4LFUA 1HW5A 2E1CA 2JT1A 5DCMB 3K0LA 2STWA 1Z91A 3KZZA 3GX4X 4OMZA 2XUBA 2FF4A 1P2FA 2M45A 5E1XA 3LA2A 2LDUA 3F8CA 5L3GA 2NNYA 2PBIA 1X3UA 3DV8A 3QOPA 3HSEA 3COAC 1D3YA 3WTZA 3HRUA 4G6QA 4ZZDA 3QU3A 4BNCA 4H0EA 3HRSA 1P4XA 2V1DA 2AS5F 2DLLA 5DUIA 4L18B 3T0YA 2NAZA 4O6JA 1WWXA 2KRFA 3EYIA 2QZ8A 2P6SA 4YIFA 4U0YA 2UXNA 1MD0A 2TDXA 5DV5A 2HTJA 5LEJA 4G7ZF 4D0PA 3DFGA 2DK5A 4EM1A 4Y15A 4RB1A 2WTEA 2PJPA 4YG2F 3FF5A 4CYDA 3BP8A 4BHCA 1YLFA 1MZBA 5DCMA 1DDNA 1I6XA 1Z05A 3KP5A 2COMA 5CVJA 3IRRA 2IJLA 1J9IA 2DQLA 1U5TB 4IRGA 2XIGA 4L9NA 1G3YA 3ZMZA 1QBJA 3HSFA 1K7AA 2CW0F 1FZPB 5F6FA 4U88A 2VOPA 1ZARA 1QGPA 4XLNF 1ON2A 3WGIA 3RTRA 3F23A 4U7DA 3L2CA 1U3EM 5D4RA 4HQMA 2MA3A 3NRVA 2EJRA 1LEBA 4KMFA 2O03A 4UV8A 3D5LA 3H3UA 2BV6A 4LK0F 2GIVA 3GFIA 4YFXF 3V8JA 4B8XA 3LA3A 4XLPF 3DPTA 1Z9CA 4I01A 1XCVA 5D6FA 3V8LA 2CSOA 1T98A 2MLKA 2G9WA 1YW8A 1JE8A 3WG9A 3F6VA 3GZ6A 1I5ZA 1BI3A 1XMKA 3K1NA 4CXFA 2AXLA 1TBXA 5H6QA 3Q9VA 3LQRA 1O3RA 3G3ZA 3TOAA 3FZVA 2ESNA 3GO5A 2F2EA 2GWRA 4WXDA 4A2UA 1B9MA 5FB2A 5AIPA 5CVIA 1O3TA 4L0ZB 4CZZA 3WTYC 3WTXC 4XSZF 4WF2A 3FXUA 1SAXA 2GQQA 4FX0A 4BHBA 4N0BA 4YIIA 2VODA 3DF8A 1YS7A 3BWGA 4EM0B 1Q1HA 4BXUA 2XASA 2VE8A 2V9VA 2UXXA 3MAJA 3E5QA 3M7GA 5EEHA 4GYGA 1LEAA 4AVPA 5LHIA 4HLYA 2CWEA 1P6RA 4M9SA 2V79A 2RQPA 1FBUA 4WWCA 4HX8A 5E18F 5FLXK 5HDKA 1AWCA 1FNNA 1JHFA 3TOBA 4OIRF 3I64A 1ZG1A 3HUGA 2B0LA 3KP3A 4JBAA 4GO1A 5ICFA 1QPMA 4RGUA 1BJAA 4AIKA 3FHZA 4L9JA 4M6XA 1DP7P 1W5TA 2K02A 2DBBA 3IKVA 1LQ1A 1IN6A 1IUYA 1A04A 4K2EA 3LQQA 4HF0A 5HS7A 4G7HF 1U78A 1OMIA 1HBXG 3P9KA 2HEOA 3SXYA 1ZRCA 3FMRA 3EYYA 3E6MA 3E6CC 1YG2A 1WKMA 1KYWA 1XGNA 3RPUA 1C0WA 3QPHA 4Z2YA 4F7ZA 4IHSA 5HS8A 1O3QA 2GA2A 4G94A 3TDUC 1R36A 2PQ8A 3WU1B 4HX4A 2R7FA 1MJ9A 1GVJA 5CYVA 3ZMUA 1HKTA 1BI2A 3TQNA 4M73A 3HOSA 2L02A 5LRSA 2ACJA 3MZYA 4IRHA 3RKXA 1IXRC 4JK1X 4OOIA 3DEUA 2LSOA 1BI1A 2Y0MA 3MFKA 4PCQA 4RB0A 1P4WA 5F1RA 4ASNA 4LB6B 5FD5A 4OIPF 3WTSC 3OOPA 4HF1A 2W25A 5LEKA 2HYFA 1HW2A 1FBSA 3RYPA 3O2PE 1D8JA 1AOYA 5J8FA 2ELHA 4B09A 2HYGD 3BJOA 1QZZA 2F5CA 3WGGA 1FP1D 1DPUA 3WTWC 2F5EA 4ZH4F 5L3DA 5E8GA 4KMUX 3C3WA 4FX4A 3I54A 4MNUA 2OQRA 2FBHA 2HDCA 4UVBA 1JGSA 5HVQC 3ML6A 2A5YB 3KETA 4IPAA 4UNOA 2YX7A 3GFJA 1TW2A 4G8XA 3SQNA 3W6KB 2W57A 5AIQA 1GXQA 2EFOA 1YW7A 4A0ZA 5EEGA 2WWYA 5JI6A 3JSPA 1R00A 2V1UA 3GWZA 1L3LA 3QAHA 2MD5A 4A5NA 1Z6TA 3EQLF 4U0WA 3GEZA 3R61A 1R1UA 3ZQ7A 2K7LA 2GAUA 2HOEA 1SFXA 4HZFA 4DNCA 3CLOA 1G3SA 1XGOA 4FT8A 4KNYA 4HF2A 4PDKA 1FWZA 2Z33A 2XVCA 4ON0A 5CVRA 1TLHB 3KLNA 5IT9K 4HDUA 1IF1A 3HYIA 1KU7A 1SD5A 1GXPA 3T8RA 2GZWA 2F5FA 2PMUA 2HWVA 2QQBA 1RZ4A 2RC4A 3MCZA 1S6LA 3JAMK 1U6GA 5LHHA 4A0XA 2OQGA 5L3FA 1UCRA 2BBYA 5BS6A 3HTSB 3ZP5A 1EH7A 3HRMA 2D1VA 2PEXA 5KK1A 4L5IA 1MGTA 4ZYGA 4LLLA 2DFIA 3FXRA 1KQ0A 2L4MA 2IW5A 4ENMA 1XB4A 5CVVA 1IN4A 3E5UA 3F21A 1K79A 1T0FA 5BOXA 3F8NA 3LAJA 2HQRA 4M71A 1U8RA 3NQOA 4HA8A 1FYLA 4UHTA 1O57A 5ILSA 4Q5SF 4MEXF 4ENNA 1BM9A 2QM3A 3BPVA 3GZ5A 4LLGF 2Y48A 5J8CA 2M5WA 1T6SA 4ZYEA 2D45A 2EV0A 3HHHA 2P5VA 3FXQA 1JHHA 4LD5A 3DXJF 4WXHA 5D8LB 2C6YA 4O5VA 1V4RA 1WI9A 3M8FA 3CJNA 4BHPA 1K6OA 2M87A 1EV7A 4KDPA 4Y13A 2DAOA 2JPBA 3FX3A 5KVRA 2Z3YA 3F8MA 2M1BA 3IL2A 2KKOA 4AIJA 6PAXA 2OD5A 2MC3A 1R5HA 2NRAC 1HW1A 4MQ9F 3DKWA 4HYEA 4A5MA 3CTAA 4NB5A 1Z7UA 5E8IA 2VXZA 4R79A 1Z1DA 2VC0A 1XCBA 1MDMB 3F8BA 4P9FA 1B9NA 3GVAA 4GYIA 5F64A 1OYWA 3HRTA 2A6HF 2KIUA 1G3WA 4RGSA 5LBQA 1F5TA 2H09A 4OIQF 3FMQA 3HOTA 1FPQA 2QWWA 4U0VA 2VBXA 4Y17A 3ZMSA 5E17F 1Z6RA 3CDHA 2FE3A 2XKPA 3KP4A 2PG4A 1S7OA 3GUDA 1F9NA 3N4MA 3PFIA 2V6CA 2XHKA 2ESHA 4AD9A 4YFNF 1KU2A 5TJJA 3B73A 4OINF 1TTYA 2L54A 3IRQA 3WE2A 3U1DA 2ZXJA 3P7NA 2D2WA 1SD4A 1ZG5A 1ZHFA 1V3FA 2RGVA 4PGGA 2YX4A 5LGNA 3ELKA 1ZGJA 4KYWA 1TNSA 4EJWA 2HFHA 4HDVA 2Z9OA 1FBQA 4L9TA 1SMYF 3I58A 2QBYB 1MDMA 1ULYA 3C18A 4CDGA 4E70A 5CVUA 1TQIA 5E1ZB 1S3JA 4R8HA 2L01A 3R6SA 2XAGA 1KA8A 2FSWA 3I71A 1J5YA 3K2ZA 3RIRA 2LKPA 4RB3C 4EGZA 1S8NA 2CYYA 2CO5A 3WE3A 2HGCA 2MLGA 2DO7A 1HSJA 4KT5C 1CF7B 4I02A 3WU0A 5A2QZ 2O6GE 3S2WA 3ULQB 3L9FA 3QRFF 2J5OA 3QPTA 1USTA 4I0BA 5HLIA 3RPQA 5D8KB 3CO6C 3HTUA 1NHAA 4AWXB 1ZAOA 3U2RA 1FSHA 2BYVE 2P5KA 3BJ6A 3H92A 3M8EA 4FHTA 2KJBA 3I0TA 2R3SA 4HX7A 4NHJA 2NYXA 5D5WB 3RYRA 1FP2A 1FX7A 2O3FA 5LGUA 4GGGA 1KQ9A 1MJBA 2QBYA 2EFQA 1T2KA 2EFNA 3VEPA 1BC7C 1ZN2A 2HTSA 1YFHA 2DPUA 4KN4X 4LJZF 3ZN1A 2VBZA 5FFXA 4I09A 1KU9A 4P9UA 2GXGA 4GXOA 4CO8A 2A3SA 1FT9A 5ICGA 5DEQA 1WQ2A 2EV6A 3PQKA 2G7UA 3IKTA 2MH2A 4WCGA 1OR7A 2FXAA 1CF7A 2XGXA 2E7WA 1J2XA 4MTEA 2RV8A 4I0AA 3T5XA 3BZ6A 5DD4A 1F4KA 1ZH5A 3F6OA 4ESJA 3EDPA 1E2XA 4GCVA 1J75A 3TKYA 5DCFA 1H0MA 1XDUA 3K1MA 1FC3A 2YSRA 1QZYA 2ZMEB 4Q48A 4P55A 4UVAA 3KLOA 1KQ8A 5H6RA 2XKOA 4DQ2A 5DUKA 2XROA 3V7SA 3J80Z 2DU9A 2H6CA 3MEXA 1XSXA 4L9VA 2CGPA 1B4AA 5D4SA 3JSOA 3CO7C 2PLYA 3BPXA 2EFWA 1B59A 3DPLC 2QLZA 1DPRA 3H3ZA 1KU3A 1UFMA 4CHUA 1W4MA 5JVTA 1FYMA 2OZUA 1PP8F 5HS9A 4XSXF 2DW4A 1T39A 4PGHA 2IT0A 4M72A 2WV0A 3BDDA 4NQWA 3L7WA 5HDGA 2IA2A 4IVNA 5HDNA 1FOKA 1R1TA 3T1BA 2QQ9A 1LJ9A 2FU4A 3IHUA 3LSTA 3KCCA 4M6YA 5DYMA 2OAZA 2DTRA 5LRRA 3TO9A 4LMYA 2ZMEA 2ADUA 1KGSA 2A61A 1IZ1A 3LA7A 2FNPA 4A6EA 4HAMA 4IHTA 1W7PB 2NS0A 1XGMA 3J7AO 2M30A 2Q0OA 4CGZA 2KJCA 2KIFA 2H94A 3BROA 3L09A 1TNTA 2FNAA 2EV5A 4KFCA 3J81Z 1ZLKA 2QQAA 4L0YB 1K78B 1IXCA 1R58A 2HZTA 2QUFA 1ZRFA 1SD7A 1FLIA 1QO0D 1ZRDA 4U7BA 2PI0A 1OPCA 2JZYA 2K86A 1B1BA 2UWMA 1ZYRF 2PN6A 4MEYF 1TQMA 3N97A 3GFLA 3WTTC 4KIGA 4OU0A 2DQRA 1MKMA 4EMSA 3RJPA 2VE9A 3QP6A 5ICEA 3JTHA 3GF2A 2XAJA 2E1NA 3K69A 3WODF 1OYIA 1XN7A 2K4JA 3T8TA 4LG0B 4G7OF 1ONVA 1W7PA 2W85A 1R1VA 2ETHA 3MQ0A 3RKWA 1J0RA 3O3KA 4WXCA 2E7XA 1HSTA 2XRNA 4RS8A 2XAQA 1K78A 3ECHA 2XV4S 4UXNA 2ZJ2A 5IT3A 5E20A 2O8XA 2RKHA 2LF8A 5LLQA 2M8EA 3ERED 3K9TA 1LDDA 3F22A 4L5JA 1HQCA 3FM5A 3SFZA 3GW2A 3G73A 5A2QK 3M1EA 2HR3A 1YS6A 3W6JB 1D8KA 2PMHA 5HLHA 2IA1A 1T38A 1YYVA 2PFBA 1ZGAA 5D5XB 4S05A 1PUEE 4WK8F 1HKSA 3VFZA 5ERIA 3IWZA 5BPDA 4A12A 3ROUA 1EH8A 3CUQC 2QENA 2DK8A 2Z5UA 4HQEA 1J59A 2ZCWA 3F3XA 4LG0A 2Y75A 2CQKA 3I53A 3RI4A 1G3TA 1S7AA 1YW9A 2ZKZA 1IRFA 2RNJA 3KP6A 1XGSA 3MZHA 3E6BA 2P6TA 2FMYA 5BPIA 2IA0A 1PP7U 1S29A 4RAYA 2IVMA 3ZMDA 2ZNZA 2VBWA 5HOOA 4S04A 5AONA 3ISPA 4A0YA 2FEZA 2STTA 4MGRA 3VODA 4MTDA 2FMLA 4RAZA 4HLXA 4KA4A 1KYZA 4HW0A 5FFZA 4HV5A 1W5SA 4HBLA 4IRIA 4EJUA 3LFKA 4UVCA 4EVIA 2UZKA 4XBFA 1HKQA 2EFPA 1LNWA 2FQ3A 2VBYA 4MHGA 5JFRA 4EQQA 2A69F 2WC2A 1BIAA 2P7VB 4CICA 1LDJA 1IW7F 5HLGA 4P5OA 2HKXA 2O61A 3ZMTA 1P92A 2W24A 3KFWX 3KEOA 2D1HA 1L0OC 4P96A 3J80K 3ABUA 4XRFA 4EJVA 2O0YA 1ZG3A 4TV7A 3V4GA 2GXBA 5IT9Z 3JW4A 1ZLJA 1LVAA 5H20A 4BQAA 1EH6A 1I1SA 4KICA 1BBYA 2OZ6A 4EM2A 5K1YA 2Z99A 3GXOA 3BJAA 4RGXA 3I59B 5ED4A 3JAMZ 4KN7X 5L3BA 3AAFA 1YTYA 2EK5A 1U2WA 2JTVA 1QQIA 1USSA 4M9ZA 1ODDA 4BH9A 1I27A 3HHGA 1R23A 3M9AA 1Y0UA 1XD7A 4G6DA 3HSRA 2DT5A 3E3VA 2YPRA 5ILVA 2P8TA 3MWMA 1H9TA 2XAHA 2G7HA 3GFMA 3K1PA 1U5TA 5LHGA 2FBKA 3R0AA 4A6DA 1YO5C 1R7JA 3TGNA 2RVCA 2OA4A 3KP7A 3NEUA 1PDNC 2ZNYA 2IP2A 3QU6A 1IRGA 1J7KA 4HV6A 4ETSA 4IXAA 2ZFWA 1RIOH 3J81K 5DDGA 1W7PD 2DI3A 4M74A 2QYOA 1BIBA 4G9YA 1FY7A 2P5LC 5BMZA 3VB2A 4PZJA 3WGHA 1I1GA 4BAYA 2J5PA 1E17A 3WTUC 1O3SA 2JPCA 3Q9SA 1ZREA 3I59A 1R5GA 1MJAA 4QLCU 2EB7A 4ZYDA 1YIOA 3FMSA 2XAFA 1LDKB 4M9XA 3RDIA 2VN2A 3DQVC 5K5OA 2HQNA 1G4DA 3E5XA 2H6BA 2JSCA 1WSUA 2LF7A 5JHUA 4OMYA 2MBFA 3SZPA 4I7HA 4ENKA 4ZZLA 3CUQB 3O6BB 2LNBA 5JR3A 3PQJA 4N9IA 5J6XA 4Q47A 1UB9A 2A68F 2MH9A 1IN5A 1B6AA 1BOAA 3KE2A 4EJOA 1GHCA 2QVOA 2ZO4A 2IPQX 3SHFA 2RDPA 4EGYA 4I2OA 1BC8C 1XDSA 5ICCA 2Q2EA 2FRHA 3ZPLA 2BEOA 2V1XA 3E6DA 3EETA 2FOKA 4KUMA 3BY6A 2CG4A 2R7DA 2OU2A 4JQFA 3CUOA 1SD6A 4ZYHA 1IN8A 2HS5A 1FYKA 2ISYA 3P9IA 4ESFA 2JRTA 2A6EF 3E97A 4KIFA 3OV8A 3RKYA 1D5VA 3P9CA 1WRJA 5FO5A 2GA1A 2KIMA 3ECOA 5FGMA 1RUOA 3GLXA 5E1WA 4N9HA 5CLSA 1BI0A 2K27A 1O7FA 1UHMA 4RGRA 2Q8KA 2DPDA 4R1HA 3CUQA 4ESBA 3F8FA 3JTGA 2F5DA 2ISZA 2EA2A 2IRFG 4MQVA 2VT2A 4IF4A 4I98B 4UUVA 1G6NA 3HIFA 4IJAA 1VTNC 2BGCA 3V8KA 3R0JA 3D0SA 1RUNA 2HKOA 1RNLA 1DUXC 1U5TC 1CGPA 4LGWA 1IN7A 3GYHX 1OYYA 4KIBA 2VC1A 2EA4A 4HOBA 2YR2A 1XSDA 3BOQA 3DP7A 1BN5A 4EJTA 3L00A 2L4AA 1XMAA 4Q4ZF 5TRDA 1H9GA 1FSEA 3V7CA 4BYYA 3U9GA 2NNNA 5ILUA 1XSVA 1SMTA 3C7JA 4LLNA 4AIHA 3R4KA 3KZYA 5K5QA 4O3MA 4QWQA 5L3CA 1ON1A 2FBIA 3FM3A 1REPC 4WX9A 1UHWA 5L3EA 2H27A
chains in the Genus database with same CATH superfamily
2W7NA 4UV9A 3L2VA 2Y0SA 5HNFA 1SFUA 4NDLA 3B02A 1TW3A 2QKMB 1B8IA 1ZQ3P 4LB5A 5GTHC 5LGTA 3KP2A 3M4OJ 3ESWB 1TQPA 3ZMVA 3REOA 1GV5A 1IAWA 4OIOF 5F08A 5CKTA 4C3IJ 2HVRA 4HSTA 4LK1F 1P4AA 1OCTC 1X1BA 5CJ9A 2CS3A 1VQ9I 1PVEA 5FLXZ 2E19A 5CQEA 2FA5A 3QP5A 4XICA 1AHDP 3JRHA 4HSRA 1IG7A 4KJZA 2H1KA 1OKRA 1W0UA 1R9TJ 3K4KA 2AO9A 1Z3XA 2L3DA 3CF5F 2XB5A 3J7AY 4IHYA 1F1ZA 2VJJA 2VT3A 3WHBA 1ETXA 3ZN0A 5K5RA 2OBPA 2RN7A 2X4HA 4RB2C 1STZA 3MN2A 2K4BA 5DD8A 3S93A 3Q5FA 3TDZC 2YU3A 1IXSB 3I5UA 3TO7A 1Z67A 4XLAA 1IGNA 1Z21A 3SZTA 2EWNA 4DOZA 3UNGC 5HLTA 3IC7A 2VOOA 3AL0C 2ELJA 2CFXA 2P4WA 3ABTA 4EV0A 2X0LA 5D6EA 3TW6A 2OC6A 2DJNA 3OYIA 1HXDA 2BE5F 3WTVC 2V9PA 4AM3A 2JMWA 3OYEA 2IEKA 3DEWA 3EUHA 5D5UB 2GOXB 5FD6A 1RI7A 2W84A 2LBFA 3S3NA 3R60A 1LB2A 1QNTA 9ANTA 4YFKF 3F72A 3BCAA 1Y6IA 4JYKA 1ZGWA 4ENJA 3L2UA 2L9VA 3C1DA 1QHHD 3FWEA 2VONA 5D5VB 3S2HJ 2HPMA 1X1CA 3IWFA 4BY1J 1O7LA 1WJBA 3A03A 1YQAA 4PJNA 4AYBN 2Y9YA 2ZBKA 5BQTA 3LAPA 3TO6A 2P7CB 1JXSA 3I4PA 1R22A 1SFEA 3VOEA 1TP4A 1IRXA 1TWFJ 2Y0SN 3K4CA 3V7RA 2A07F 3QYBA 4UB6C 2M0MA 1G2HA 3LWFA 3KEQA 4LFUA 4J19A 3ZQQA 1HW5A 3ZQGA 2E1CA 3HKZA 2JT1A 4II2A 5DCMB 2OPTA 3RZOJ 4BQOA 3K0LA 2GLOA 5B3SH 5KAFC 2ME0A 4QPOA 2STWA 1Z91A 3KZZA 3GX4X 1W5CC 3W2AA 4OMZA 2O7OA 1WH7A 2FF4A 2XUBA 2BXYA 1P2FA 2M45A 5J4YA 5E1XA 3LA2A 2NXNB 3CCSI 2LDUA 3F8CA 4BGDA 5L3GA 2NNYA 4IX7A 2PBIA 3S32A 3H35A 1X3UA 1X3WB 1R4NB 3DV8A 3QOPA 1OCCH 3HSEA 3QYEA 4F92B 3COAC 3OSGA 3PO3J 1D3YA 3K4MA 3WTZA 3HRUA 2HDDA 3LSRA 3ZQLA 4G6QA 2RAEA 3C2HA 3BG6A 4ZZDA 2BOLA 2V9KA 3QU3A 5IPAA 5JLWA 4BNCA 4H0EA 3HRSA 1P4XA 2W48A 5E3OA 4HRIA 2V1DA 2V7FA 1OCOH 2AS5F 2DLLA 3FDYA 1RPWA 2DYRH 4CCNA 4B3AA 3G71I 5DUIA 1SVMA 3DU5A 5J1YA 4L18B 3T0YA 2CUZA 4IL6C 2NAZA 4O6JA 1WWXA 2KRFA 1WJAA 3EYIA 5J40A 2QZ8A 2P6SA 1MW7A 4YIFA 1APLC 4U0YA 2UXNA 2E1MC 3DKYA 1MD0A 2RQQA 1RKTA 2TDXA 5DV5A 2HTJA 5LEJA 4G7ZF 2F5VA 4D0PA 3DFGA 2VQLA 2DK5A 1LUJB 4EM1A 4Y15A 4RB1A 2WTEA 2PJPA 3BQYA 4YG2F 1MSEC 3FF5A 4QIWN 3H5NA 1PUFB 5TGTA 3ZXSA 3BP8A 3LSMA 4CYDA 4BHCA 3HKZN 1YLFA 1MZBA 4E7JA 5DCMA 5IYBJ 1DDNA 3PNTA 1I6XA 2QA4I 3PSIA 5FKNA 2CW7A 2HVQA 2BY2A 4LITA 3JR9A 1Z05A 3KP5A 2COMA 5CVJA 3SEZA 1EKEA 2OUMA 3IRRA 2IJLA 1QA6A 3PSFA 2QQ8A 1J9IA 3QPLA 2BY3A 2DQLA 1SC7A 3DCFA 4DBQA 1U5TB 2FD5A 4IRGA 4ABZA 1XTAA 5GPAA 5E3LA 2XIGA 2CUJA 4L9NA 1G3YA 3ZMZA 1QBJA 3HSFA 3QQAA 1K7AA 2CW0F 1FZPB 3IH4A 3BR3A 2Z16A 5F6FA 4I76A 4U88A 4IEJA 3LOCA 2F4MB 2VOPA 1TWAJ 1ZARA 1QGPA 4XLNF 1ON2A 2DA3A 3WGIA 3G4SI 3RTRA 3ASOH 3F23A 4U7DA 3MKWB 3L2CA 1U3EM 2LY1A 3FBNB 5D4RA 4HQMA 2MA3A 4A93J 3OYFA 4ZTJA 4BL0B 4W97A 3NRVA 2CMPA 2EJRA 3BG7A 3KEYA 2M2EA 3V42A 1LEBA 4RDUA 2O03A 4KMFA 3GBGA 4UV8A 4XOTA 1FTZA 1BL0A 3D5LA 3H3UA 3DBLB 2BV6A 1JJ6C 3HGYA 4LK0F 4D1QA 2GIVA 1W0TA 3GFIA 4YFXF 3V8JA 2R93J 2H27A 4B8XA 3LA3A 5EGOB 4XLPF 1QPIA 3GTLJ 3DPTA 3EUHC 3B6CA 1Z9CA 4I01A 1XCVA 3GMEA 5D6FA 4PSXA 3V8LA 2CSOA 2DOAA 5HNHA 1T98A 3S1RJ 2MLKA 2G9WA 1ETVA 1Y39A 4A3KJ 1YW8A 1A31A 1JE8A 2WAQA 5F0CA 3WG9A 1MMGA 4IO9F 2L7KA 2E2IJ 1ZTRA 3F6VA 3MZ8A 3GZ6A 1I5ZA 3HOVJ 1BI3A 1XMKA 2M0CA 3HUGB 3LL7A 3K1NA 4A3IJ 1S9HA 4CXFA 2AXLA 3HDDA 1TBXA 5H6QA 1FJLA 3Q9VA 4PFPA 1JGGA 1VFCA 1GDTA 3LQRA 1O3RA 1IV6A 1PJRA 3W2WA 3G3ZA 5FRMA 3TOAA 3FZVA 2ESNA 4BY7J 1MNMC 2ZB9A 2DXIA 1ETOA 3GO5A 4IHWA 2F2EA 4YEJA 2GWRA 4WXDA 4A2UA 1B9MA 5FB2A 5AIPA 3KX2A 5CVIA 1O3TA 4L0ZB 4CZZA 2A6TA 4X1EA 3WTYC 4B3XA 3WTXC 3FK6A 4XSZF 5E79C 4WF2A 3FXUA 3TBIA 1SAXA 4PUSA 3I55I 2GQQA 3CLQA 4FX0A 1GV2A 4BHBA 4N0BA 4YIIA 2VODA 2VB6A 3Q0WA 2DA6A 1XS9A 1S7EA 3DF8A 1JUMA 3OOUA 1YS7A 2LKXA 4BJTA 2BZTA 3BWGA 4RA2A 1OFCX 3PUFA 2XPUA 4EM0B 1Q1HA 4BXUA 1A6QA 2XASA 2GXAA 2VE8A 1M1EB 2V9VA 2K3FA 2UXXA 4BS9A 4E7IA 3MAJA 3LSGA 3E5QA 3M7GA 5EEHA 4GYGA 2DT7B 1LEAA 5EGOA 4AVPA 3CD6I 5LHIA 4HLYA 4XKWA 4E4HA 2CWEA 2DA1A 1P6RA 4M9SA 2V79A 4Z6YA 2X85A 2RQPA 3E1SA 3OYLA 1FBUA 4WWCA 2IGMA 4HX8A 5GTIC 2NVYJ 5E18F 2KISA 2FUG2 5FLXK 2KFDA 2EZIA 5HDKA 1D5YA 2BW3B 1AWCA 2WAQN 1FNNA 4XM3A 1JHFA 3OYKA 3SFIA 3TOBA 4OIRF 3I64A 1ZG1A 2H8RA 1TZLA 2BVMA 2CU7A 3Q0UA 4N4NB 3HUGA 1A6IA 2B0LA 3KP3A 1V54H 4JBAA 2EBIA 4GO1A 2Y31A 2CQNA 5ICFA 1QPMA 4RGUA 3PJRA 1BJAA 2DMUA 4RLQA 3PIPF 4L9JA 3FHZA 1XX5A 4AIKA 1ZR4A 5GAHJ 1SFOJ 4M6XA 2B63J 2V4JC 1LPQA 1DP7P 1D1CA 1W5TA 1MMAA 1Z3YA 2DBBA 2K02A 3IKVA 1LQ1A 1IN6A 2JA6J 1IUYA 1A04A 4K2EA 3LQQA 3QYFA 4HF0A 4CCOA 5HS7A 3TL4X 4G7HF 1U78A 1OMIA 1HBXG 3HOYJ 3P9KA 2KLOA 3OS0A 3SXYA 1ZRCA 2HEOA 3FMRA 1VQNI 3A1YA 3EYYA 3CCQI 3E6MA 4C30A 1YG2A 1WKMA 3E6CC 4PK4A 1KYWA 3CMAI 1XG1A 1XGNA 3I3LA 3RPUA 2E71A 1C0WA 1FIPA 2KRCA 2WB1N 2CQXA 2H1LA 3QPHA 4Z2YA 4F7ZA 1ZELA 4IHSA 4JX5A 5HS8A 1O3QA 2GA2A 4G94A 3TDUC 1R36A 2Y2ZA 3HPHA 2XPWA 1YIJI 2PQ8A 1GUUA 4HX4A 2R7FA 3WU1B 2X6YA 3H0GJ 1MJ9A 1GVJA 3GTOJ 5CYVA 3HOWJ 5IP9J 1FMWA 4A3EJ 4F55A 1R5ID 1YJ9I 1BJZA 3ZMUA 1QVTA 2VPRA 4AU7A 1OLTA 1HKTA 1WVRA 2JA7J 1BI2A 3TQNA 4M73A 3HOSA 2DDAA 2BW3A 2L02A 3FKJA 5LRSA 2ACJA 3K70C 3MZYA 1WJFA 1VQLI 4EATA 4IRHA 3RKXA 3ZQFA 1IXRC 4JK1X 4OOIA 3DEUA 2LSOA 1BI1A 2Y0MA 3MFKA 2JA5J 4YRVA 4PCQA 1GT0C 3CCUI 5B5EC 4RB0A 1P4WA 5F1RA 2ELKA 4ASNA 4LB6B 5FD5A 4OIPF 2ECBA 3WTSC 3OOPA 4HF1A 3BR2A 2W25A 1JT6A 4PFOA 2HYFA 5LEKA 1HW2A 1OQYA 1FBSA 3RYPA 2IBDA 3O2PE 1D8JA 1AOYA 4BJ6C 5J8FA 2ELHA 4B09A 2HYGD 2M8GX 3BJOA 1YI2I 2L9NA 1QZZA 2F5CA 3HG9A 3WGGA 1FP1D 5KAIC 1DPUA 2B9SA 3WTWC 1HDDC 2F5EA 3IH3A 4ZH4F 5FLMJ 2EIMH 5L3DA 4FETA 2LR8A 3S3OA 5E8GA 4KMUX 2R0QC 1DGWY 2LLKA 5GAGJ 2ID3A 3C3WA 4FX4A 4KISA 1X58A 3I54A 4MNUA 1N25A 2OQRA 2FBHA 2HDCA 4UVBA 2KQRA 1JGSA 5HVQC 3ML6A 2HI3A 1VI0A 2A5YB 1R4MB 3KETA 2R7WA 1IRZA 4IPAA 1V5FA 4D7NA 4UNOA 1QHGA 3WU2C 2YX7A 3GFJA 1TW2A 4G8XA 2LK2A 3SQNA 3W6KB 4UY8I 2L0KA 2W57A 1RR8C 5AIQA 1GXQA 2EFOA 2WV1A 1YW7A 4A0ZA 5EEGA 1KZHA 3CESA 4IQJA 2BHYA 2WWYA 2QCOA 5JI6A 2VI6A 2EZKA 4RAGA 3JSPA 2VJ4A 1A36A 3GLLA 1R00A 3DU6A 1X4OA 3FBIB 1Y8RB 5GADJ 2V1UA 4C2MJ 3FKIJ 3GWZA 1R49A 3HZJA 3QAHA 2MD5A 3CJRB 4UUSB 1L3LA 1JUSA 2BVLA 1RESA 4A5NA 3MKLA 1Z6TA 2QGUA 3EQLF 2LFBA 4U0WA 3GEZA 3SYTA 2E2HJ 3R61A 1R1UA 4IQ4A 2K7LA 3ZQ7A 2GAUA 2HOEA 4LIUA 1SFXA 3KYDB 4HZFA 2ZXIA 3BQZA 3PNVA 4DNCA 4FTHA 2WY7Q 3CLOA 4Y4RA 1G3SA 1MBEA 4BQQA 1YITI 1XGOA 3DBRB 3ABMH 3SDGA 2LG4A 2NVUB 4FT8A 4KNYA 4HF2A 4PDKA 1FWZA 2Z33A 3ZR8X 3VYRB 1FIAA 2XVCA 2MD0A 1TWGJ 3AG3H 4ON0A 1OJLA 5CVRA 3U21A 3FXKA 1VQMI 1TLHB 3KLNA 4JX4A 1LE8B 5IT9K 3PL8A 4HDUA 5IOYA 1POGA 2DMPA 1IF1A 3HYIA 1KU7A 1SD5A 1GXPA 2AXTC 3WHCA 3ZRGA 3T8RA 3DWLE 2WY8Q 1BOBA 3HL2A 2GZWA 2F5FA 2PMUA 2HWVA 4BBRJ 1S72I 2QQBA 2HDWA 4QSHA 1RZ4A 2RC4A 3MCZA 1S6LA 5B66C 1BR1A 2OF7A 3JAMK 1U6GA 5LHHA 4A0XA 2OQGA 1MBKA 5L3FA 1UCRA 2BBYA 4XLFA 5BS6A 3HTSB 2QSFX 3ZP5A 1EH7A 2VQCA 3HRMA 2D1VA 2HOSA 2PEXA 5KK1A 4L5IA 3G2BA 2IS2A 2VJIA 2E34A 1MGTA 4ZYGA 4LLLA 2R5YB 2DFIA 3FXRA 3X2QH 2R7ZJ 5IP6A 2JSPA 1ZK8A 4EEFG 1KQ0A 2NOGA 2DFHA 2L4MA 2IW5A 3BG9A 4ENMA 1K4TA 4IZZA 3QWLA 4UUSA 1WJDA 1XB4A 5CVVA 3GTPJ 1IN4A 4M3FA 1WCMJ 4B43A 4BE0A 3E5UA 3F21A 3RQIA 1K79A 1T0FA 5BOXA 3F8NA 3DEEA 1YX3A 4IHVA 1TWHJ 3LAJA 2NVQJ 2ME6A 2HQRA 4M71A 4B4CA 1U8RA 3IV5A 1QZEA 4A3CJ 2A05A 4Y3OA 4ZC3A 3KIOA 3NQOA 4XL9A 4HA8A 1FYLA 4UHTA 3BZCA 2IGOA 4FE7A 1YHQI 3M1CA 2OTLI 1Q1VA 1O57A 5ILSA 3HEFA 3VYSB 4Q5SF 4MEXF 2UV1A 4ENNA 2QKLB 4XMYA 3BLYA 4RMNA 1B72B 2CJJA 1BM9A 3BCBA 2QM3A 3AKZA 2K3PA 3BPVA 3GZ5A 1LE8A 3DLAA 4RLFA 4LLGF 1E3PA 2FX0A 2XB0X 2Y48A 4L5EA 1RR7A 2M5WA 2DA4A 5J8CA 1JI8A 1T6SA 2Y9ZA 4ZYEA 2D45A 3VSLA 2EV0A 1G8XA 4YIRX 3CMEI 1LFUP 2LY9A 3HHHA 2P5VA 2EZLA 3FXQA 4JX6A 1JHHA 4LD5A 4DYRA 1TC3C 1FEXA 3RQ4A 5IY5H 3RCOA 3DXJF 4WXHA 3RPUD 5D8LB 2C6YA 3K6GA 4O5VA 2X6WA 1V4RA 1WI9A 2QF7A 3M8FA 1WZ2A 1SEUA 3S2DJ 4M3DA 3CJNA 3RSNA 4BHPA 1BA5A 1VNDA 3HBLA 2XGDA 1K6OA 2M87A 1H89C 1EV7A 2MW8A 3UR3C 2VKEA 2A5WA 4KDPA 1U8BA 4Y13A 2R5YA 2R7UA 2DAOA 2JPBA 3FX3A 1LVKA 2Z3YA 3F8MA 5KVRA 1ITYA 2M1BA 2K9SA 3IL2A 2KKOA 4NBQA 4AIJA 2HQAA 2P0WA 4HNUA 3S3MA 3LSKA 6PAXA 1O4XA 2OD5A 2MC3A 1R5HA 2NRAC 4PJLA 1HW1A 2JUCA 1DP3A 4ZJZA 3JRFA 1NK3P 3D1NI 3CCLI 4MQ9F 3DKWA 4HYEA 3BG5A 4A5MA 3CTAA 4NB5A 3BT9A 4UUTA 1Z7UA 3FXJA 4GDFA 5E8IA 2X1DA 3TMOA 2VXZA 3H1CA 4R79A 1NH3A 1MIJA 2M7AA 4D9JA 4XOPA 1Z1DA 2VC0A 1HA8A 2E1OA 2E5ZA 5EDNA 1XCBA 1MDMB 1VQ4I 3F8BA 4P9FA 1B9NA 3HXLA 3GVAA 2LVSA 2COBA 1WH5A 4GYIA 5F64A 1OYWA 3HRTA 3OIOA 2A6HF 2KIUA 1G3WA 4RGSA 5LBQA 1F5TA 2L7FP 1OCPA 3HC7A 4C9YA 1Z7LA 2H09A 4OIQF 3FHNA 1B72A 3CC2I 2R4GA 2YS9A 5M5WJ 3H9GA 3FMQA 4A3GJ 2DOFA 4M6VA 3HOTA 2HPIA 3CCEI 1FPQA 2QWWA 1D0XA 1X1AA 4A3BJ 4U0VA 2VBXA 4Y17A 3ZMSA 5E17F 1Z6RA 3CDHA 2HOAA 2FE3A 4A69C 2XKPA 4MIMA 3KP4A 2PG4A 3JRDA 1WJ5A 4XONA 1S7OA 3DPUA 1K6YA 2E2JJ 2X6OA 3GUDA 1F9NA 3N4MA 3IAM2 3K4JA 1MBJA 3PFIA 3OMYA 3MMYB 1K83J 4E7SA 3OYNA 3D5SC 2V6CA 2XHKA 2ESHA 4AD9A 4YFNF 1KU2A 2MSYA 5TJJA 3B73A 4OINF 1DU0A 1TTYA 2LY2A 2L54A 3IRQA 1YJNI 2DN0A 3WE2A 3U1DA 1YJWI 5KCMA 2ZXJA 1X2MA 3P7NA 2D2WA 4I99C 2LH9A 2XSJC 1SD4A 3K2AA 1RRJA 1ZG5A 1MBHA 1WGXA 2ICWG 5GP9A 3BTCA 1ZHFA 1V3FA 2RGVA 4PGGA 5KNLA 2YX4A 5LGNA 3ELKA 1ZGJA 4KYWA 2HZDA 5FKOA 2R7VA 1TNSA 4EJWA 3G1MA 2HFHA 4HDVA 2Z9OA 2D5VA 1FBQA 1N77A 2DA2A 2X9DA 4NNJA 4L9TA 4BE2A 4OAYA 1SMYF 1YE9A 3PIOF 3OIQA 3KYCB 3DKXA 3H5AA 3I58A 2I8DA 2QBYB 1MDMA 2QEXI 1EF4A 2E60A 2Y69H 2GOMA 4LG3A 2V6EA 1ULYA 2FQ4A 1MMNA 3C18A 4CDGA 3UKGA 4E70A 5CVUA 1TQIA 5E1ZB 1S3JA 4R8HA 2L01A 2W82A 3R6SA 2XAGA 1JKOC 4DYQA 1HOMA 1KA8A 1T0FC 1G59A 2FSWA 3I71A 1J5YA 1Z0XA 3MD2A 1H8AC 4DGWB 3M07A 3K2ZA 3RIRA 1MBGA 1I3QJ 2LKPA 2XGEA 4RB3C 3BZKA 4EGZA 1S8NA 1MMSA 2H8WA 2CYYA 2JJ7A 2CO5A 3ABKH 3ZOBA 3F9KA 2JA2A 2K9LA 3WE3A 2L9SA 2HGCA 4XNFA 4DIQA 5GAEJ 1HF0A 4BUPA 2MLGA 2EQRA 1IUFA 2DO7A 1HSJA 2X51A 4KT5C 1CF7B 2KZVA 1P9QC 4I02A 3WU0A 4BXFA 2IXSA 5A2QZ 3S14J 2O6GE 3E7LA 3L2QA 2VASA 3S2WA 4XLHA 3ULQB 4PSWA 3L9FA 3QRFF 2J5OA 2PX9A 3DTIA 1K4SA 3QPTA 1USTA 4I0BA 5HLIA 3RPQA 2XAUA 4CZCA 5D8KB 3CO6C 3HTUA 1NHAA 4AWXB 1ZAOA 2DMNA 2R7RA 4DZPA 3U2RA 1FSHA 2BYVE 2P5KA 3BJ6A 3CCYA 3OR1C 3H92A 3M8EA 4FHTA 4XLEA 2KJBA 2AHQA 4RAFA 3I0TA 2E35A 3LSIA 1JKPC 1NK2P 2R3SA 2L5QA 4HX7A 3EUAA 5EJCA 4NHJA 3CP8A 2RREA 2NYXA 2IS6A 5D5WB 2CQ7A 3RYRA 1FP2A 3JRAA 1FX7A 1FTTA 2O3FA 4X0GA 3O8HA 5LGUA 1F43A 4GGGA 1KQ9A 1MJBA 2K9QA 2WAFA 1HCRA 2QBYA 3FXLA 1V55H 2EFQA 4NC8A 1VQPI 1T2KA 1WJCA 2EFNA 3VEPA 4JOMA 1BC7C 1ZN2A 2HTSA 1YFHA 2XC7A 1H88C 2LD5A 2DPUA 4S0HB 4KN4X 4LJZF 1X2NA 3ZN1A 2VBZA 3A02A 5FFXA 2HYJA 3IUOA 3EPZA 4IHXA 4NC7A 4I09A 1KU9A 2BHZA 3K7AJ 4P9UA 2GXGA 1OCRH 4GXOA 4CO8A 5B1AH 2A3SA 2HXIA 2LKSA 2DFFA 5C4JJ 1FT9A 5EZHA 4B47A 5ICGA 4IOAF 5DEQA 1WQ2A 1YOVB 2EV6A 1UJ8A 3PQKA 2G7UA 3IKTA 2MH2A 2F6CA 4WCGA 3GTKJ 1OR7A 2FXAA 1CF7A 2XGXA 4W1UA 2E7WA 3PO2J 1J2XA 3P5JA 4MTEA 2X48A 4NQWB 2RV8A 4I0AA 4CSWA 3E0JB 5JHFA 4B48A 2VKHA 1KONA 4V2FA 4A3JJ 2R92J 2MGQA 2R7OA 3T5XA 3BZ6A 5DD4A 5FLVA 1F4KA 2JUGA 1ZH5A 3F6OA 4ESJA 2L9RA 3H0DA 3EDPA 4RM2A 1E2XA 1VQ5I 4GCVA 2CH0A 1J75A 3TKYA 1HC8A 2LP0A 5DCFA 3CCJI 2ZJRF 1H0MA 1XDUA 3K1MA 3S1NJ 1FC3A 2YSRA 1RC9A 1MSFC 1QZYA 2ZMEB 4Q48A 3TW7A 5FROA 4CCMA 4P55A 5C4XJ 4UVAA 1AA7A 3C2GA 3CMYA 1VQ6I 2L7ZA 3CF2A 2WAEA 3QPSA 5DS9A 3KLOA 5FKMA 1KQ8A 3FISA 2NOJB 1AU7A 4GFBA 3H9QA 5C3EJ 4M3EA 5H6RA 2CRGA 2XKOA 4DQ2A 5DUKA 2XROA 3V7SA 3J80Z 1V5GA 3JRCA 3HOXJ 2DU9A 3Q0VA 2H6CA 3MEXA 4II3A 2P81A 1XSXA 4L9VA 3L2WA 2CGPA 4MFEA 1B4AA 3VPRA 4XIDA 1X1DA 5D4SA 1LKXA 2VPLA 1VQKI 4XN3A 3JSOA 1UZCA 3CO7C 2PLYA 5J1RA 2CW8A 4J01A 2R7XA 3BPXA 2W4SA 2EFWA 2ZSHB 3CDIA 1B59A 3DPLC 2EINH 2QLZA 3K10A 1DPRA 3MVPA 3RKQA 3H3ZA 1KU3A 1UFMA 2W00A 4CHUA 1MH3A 4DW6A 1W4MA 5JVTA 1FYMA 2OZUA 5M5YJ 4A3MJ 1PP8F 5HS9A 1D1AA 4XSXF 2NVTJ 2DW4A 4JP0A 1T39A 4C2TA 3CQZJ 4PGHA 1OCZH 1E3HA 2IT0A 3GZNB 4M72A 4PJ0C 3HOZJ 2WV0A 3BDDA 4NQWA 3L7WA 5HDGA 2IA2A 4IVNA 1RETA 3SZGA 4NC6A 5HDNA 1FOKA 1I50J 2CFOA 1R1TA 3T1BA 3JRBA 5CPRB 1Y0NA 2QQ9A 1LJ9A 1DGRM 2FU4A 3IHUA 2M34A 5DM7F 3LSTA 1Z77A 5EYRA 2R7QA 3KCCA 4M6YA 5F0FA 5DYMA 2OAZA 2XF5A 1JKQC 3CZ6A 1SAUA 3TEDA 2CV1A 3I56I 2VXDA 2G0EA 2DTRA 5LRRA 2QSHX 3GTGJ 4C3HJ 2DMTA 2K9MA 3TO9A 2DT6A 2Z2SB 4LMYA 2ZMEA 2Q1ZB 2ADUA 1KGSA 2A61A 1A5JA 1IZ1A 3LA7A 1GVDA 2FNPA 4A6EA 4HPQA 2OTJI 4XKVA 4HAMA 3B6AA 1YX5A 3JRGA 2OCCH 4IHTA 1W7PB 2LMDA 1PYVA 2NS0A 1XGMA 2IS1A 3J7AO 2M30A 3VDXA 4FISA 2Q0OA 4CGZA 2KJCA 2KIFA 2H94A 3WG7H 3OYAA 3IAS2 3BROA 3LFUA 4E6KG 3L09A 4A3FJ 4HEA2 1TNTA 2F4OB 2EV5A 2FNAA 4KFCA 2DA7A 3J81Z 1ZLKA 1UG0A 2QQAA 2B7EA 1K78B 1J09A 1IXCA 4L0YB 2VLAA 5JLXA 4DBRA 1R58A 2HZTA 1V5EA 2PJRB 2R7SA 3PM1A 3J7ZI 2KDOA 3BR0A 2X1CA 2QUFA 2DODA 4XKBA 3ZQHA 1ZRFA 1SD7A 1MNDA 1NG6A 1FLIA 1IDZA 1WFXA 2ECCA 1QO0D 1ZRDA 4I6ZA 1LFBA 4U7BA 3OWTA 2WA0A 2PI0A 1OPCA 2JZYA 1R71A 4Y33A 4AYBA 3PUBA 2K86A 4XORA 2HXOA 1B1BA 3BC8A 2UWMA 1ZYRF 1ETKA 4HNTA 1VZ0A 2PN6A 4MEYF 4AIDA 1ETWA 5BNGA 1TQMA 4F3QA 4Y7NJ 3OSFA 1FOXA 3CCMI 3N97A 4RBOA 3GFLA 3WTTC 4KIGA 3CP2A 2XGCA 4OU0A 2DQRA 1MKMA 2DMQA 4LIVA 4ZDLA 2DDBA 2NS8A 2MC4A 2OV7A 1MBFA 4EMSA 4ZDOA 1OISA 3RJPA 2VE9A 3QP6A 5ICEA 3OY9A 3JTHA 3CJTB 2M4KA 3GF2A 1OR7C 2M3AA 1T33A 2XAJA 2E1NA 2VJ5A 1GLNA 1X19A 3K69A 3WODF 4XLCA 3OS1A 3K4BA 1OYIA 1P7IA 3K4NA 2EILH 4E7KA 1XN7A 2K4JA 3T8TA 3L1PA 4LG0B 4G7OF 2WBMA 1ONVA 2K9NA 1W7PA 2MG4A 2KIQA 2W85A 5J4VA 5IYDJ 4BJ5C 1R1VA 2ETHA 3KZIC 5J1UA 2ZXHA 3MQ0A 3RKWA 1J0RA 3O3KA 3GTMJ 3HJEA 4WXCA 2E7XA 3AG2H 1HSTA 1LFPA 2CV0A 2XRNA 3CC4I 3I9V2 4RS8A 3KYLA 2XAQA 1ENHA 1K78A 3ECHA 2XV4S 2LRDA 2EPFA 1JTXA 2ZJ2A 4UXNA 2PJRA 5IT3A 2VIXA 5E20A 1IJWC 2O8XA 2RKHA 2LF8A 5LLQA 1ERDA 2M8EA 3ERED 3K9TA 1LDDA 3F22A 1XMXA 4XR6A 1AKHA 4L5JA 1HQCA 4E7LA 1I3AA 3FM5A 3SFZA 3OYCA 3L2RA 3GW2A 3G73A 5A2QK 1Y1WJ 2R7TA 3M1EA 2HR3A 1QRYA 1YS6A 2XF7A 2Z1DA 1VQ7I 4XQFA 3VSKA 3S15J 2HOTA 3QODA 2JN6A 4J00A 3W6JB 4A3LJ 1D8KA 4E7HA 4CYCB 2PMHA 1TWCJ 2IA1A 5HLHA 1T38A 3FXOA 1YYVA 2V1NA 2PFBA 3S1MJ 3A0HC 1SVOA 5F27A 1ZGAA 2JRMA 2KPMA 5D5XB 4S05A 1PUEE 4WK8F 4N4OB 2FOWA 4HG2A 1HKSA 3VFZA 4CCKA 5ERIA 3ZCOA 3IWZA 2EZHA 2ZC2A 1MH4A 4LOCA 1Y56A 1BW6A 2X6XA 5BPDA 3CCRI 2KRHA 3ROUA 4A12A 2ID6A 2M4GA 1EH8A 3CUQC 2QENA 4OAZA 3OL3A 3OYDA 3ZQIA 2DK8A 1FMVA 2Z5UA 4HQEA 1NG7A 1J59A 2ZCWA 3F3XA 4LG0A 5K7FA 2Y75A 3OS2A 2CQKA 3I53A 4MO7A 3BR1A 3RI4A 2OJED 1IDYA 3ASNH 1S7AA 1G3TA 2GBYA 1YW9A 2ZKZA 1IRFA 2RNJA 1BR4A 3KP6A 4MFDA 1XGSA 3MZHA 3E6BA 4CA0A 2P6TA 2F48A 2W1OA 1I39A 2FMYA 5BPIA 2IA0A 5E3MA 1PP7U 1S29A 4RAYA 2IVMA 5EG0B 3CDLA 2BY1A 2ZMEC 3ZMDA 5FJ8J 2ZNZA 3S16J 4QTRA 2VBWA 1TT0A 1IO2A 2ZFUA 1E0EA 2IGNA 1IC8A 4BU2A 5HOOA 3ABLH 3LMMA 4S04A 1SANA 5AONA 3OYJA 2JK3A 3ISPA 4A0YA 2JVGA 2FEZA 2XSDC 2TCTA 5HODA 2STTA 1IV8A 2F4IA 3DTKA 4Y52J 4MGRA 3NARA 3VODA 4MTDA 2FMLA 4RAZA 1RKWA 3AG1H 4HLXA 4KA4A 1KYZA 4BBSJ 4HW0A 2X1EA 2HVSA 5FFZA 2EIKH 3G1LA 4HV5A 4CYCA 1W5SA 1HLVA 4HBLA 4IRIA 4EJUA 1BR2A 2KP6A 2Y30A 3LFKA 4UVCA 4EVIA 5EEAA 2UZKA 4XBFA 2TRTA 1I6HJ 1HKQA 2EFPA 2HNHA 1LNWA 4BDYA 2FQ3A 2VBYA 2KDZA 4MHGA 5JFRA 4BACA 5IP7J 2O5RA 2DA5A 3HGGA 4EQQA 2A69F 3LSPA 2WC2A 1BIAA 3O8GA 4BXXJ 1MMDA 2P7VB 3D5RC 4ANJA 4CICA 2BY0A 1LDJA 1N75A 1IW7F 5F1JA 2BXZA 4IKFA 3AFHA 2I5UA 1W36C 2XRLA 5HLGA 4P5OA 2DFEA 2HKXA 2O61A 4UB8C 4YELA 2JVHA 3ZMTA 1P92A 4XKCA 1CQTA 2W24A 3KFWX 4B1RA 3KEOA 2D1HA 1L0OC 4P96A 3J80K 3ABUA 4XRFA 3A01B 4EJVA 3OYGA 2VQGA 1EJ9A 2O0YA 5CQGA 1ZG3A 1DU6A 2M9HA 4TV7A 3ONQA 2DJIA 3V4GA 3OL4A 2GXBA 2N8GA 3GCMA 5LD2C 4U87A 1NTCA 5DTDA 4M3GA 4GRIA 2ZSIB 5IT9Z 5EG0A 2IAIA 2WADA 1W1WE 3DTEA 2V26A 1T56A 1U9OA 3JW4A 4FCYA 1ZLJA 1LVAA 5H20A 4CCJA 4BQAA 1EH6A 4F91B 1I1SA 4KICA 1ORKA 1WJEA 1BBYA 2OZ6A 1WPKA 3HPGA 4EM2A 5K1YA 2Z99A 1ZKGA 2DYSH 3GXOA 3BJAA 4FE4A 4RGXA 3I59B 5ED4A 4XRSA 3JAMZ 4CH7A 5M3MJ 4KN7X 5L3BA 2VKVA 3FIWA 1T8IA 4PJMA 4F52A 1SFKA 3TP0A 3BG3A 2CQQA 3AAFA 2ZJPF 1YTYA 2EK5A 1U2WA 2JTVA 3W6VA 2IGKA 3CMMA 1FOYA 3Q3SA 3C2BA 1YRNB 4DYCA 1QQIA 2EH3A 3J7YJ 1PUFA 1USSA 4M9ZA 1ODDA 2I10A 2HU9A 4BH9A 4FASD 3S17J 1I27A 3A2KA 1S5LC 1R23A 3HHGA 2MYSA 1Y0UA 3M9AA 1W36D 4X6AJ 2VL8A 1U0JA 2LTPA 1XD7A 4G6DA 2NVXJ 5EF6A 3HSRA 2DT5A 2QSGX 3E3VA 2YPRA 5ILVA 2K85A 2P8TA 4CUGA 1JT0A 3MWMA 1H9TA 4PJJA 4HNVA 2XAHA 2G7HA 4D7MA 3GFMA 4M3BA 3CC7I 1BW5A 3K1PA 1U5TA 3BR5A 4A3DJ 3H36A 5LHGA 1MNEA 4F93B 3TP3A 2HQ5A 2FBKA 4G12A 4ZDPA 4KITB 3R0AA 4A6DA 3W2VA 1YO5C 1R7JA 3TGNA 3NWTA 2RVCA 3IP4B 2OA4A 3KP7A 3N05A 3NEUA 1XPXA 1JKRC 2ZNYA 1PDNC 1VQ8I 1F36A 2IP2A 2VUMJ 2OCEA 5C44J 2MFZA 3QU6A 3A01A 1N78A 1XC5A 3AL0B 1IRGA 3CCVI 4NUBA 1J7KA 5M5XJ 4HV6A 4ETSA 4IXAA 4KT6A 2ZFWA 1RIOH 1EA3A 2UUZA 3J81K 5DDGA 1W7PD 2DI3A 4M74A 2QYOA 1BIBA 3ERMA 2L7MP 4DZJA 2JQ7A 4G9YA 1FY7A 2P5LC 5BMZA 3VB2A 3LSJA 2Q2EB 2XPVA 3H3VK 2WB1A 4D5FA 4G6TB 2MABA 4PZJA 3WGHA 1I1GA 4BAYA 4DJAA 3OR2C 1D0ZA 2J5PA 1E17A 3WTUC 1O3SA 2JPCA 3Q9SA 1ZREA 3FXMA 3I59A 1R5GA 4XRMA 1UMQA 1E3OC 1MJAA 2KZGA 4QLCU 2KHMA 2EB7A 4ZYDA 1YIOA 2GM4A 3FMSA 2O9LA 2XAFA 1UELB 4AC0A 2CUEA 5J3LA 5F0HA 1LDKB 3DLLF 5IOZA 1UAAA 4M9XA 2ZJQF 1YRNA 3RDIA 2VN2A 3DQVC 5K5OA 2HQNA 1G4DA 1Y1VJ 1T08B 3E5XA 2H6BA 1UG2A 2JSCA 3A4CA 2VQHA 1WSUA 2LF7A 5JVGF 5JHUA 4OMYA 2MBFA 5F04A 3SZPA 4V19K 2E5NA 1VQOI 2KT0A 4AUXA 4I7HA 4C3JJ 3OYMA 3BTLA 2PMZA 2LC2A 1D0YA 1VF9A 2LOOA 4ENKA 2EIJH 5FKKA 4ZZLA 3ZQCA 3CUQB 3O6BB 2ZXWH 2XF6A 1QVUA 5EZGA 2LNBA 4XN0A 5JR3A 2IS4A 1ETQA 3PQJA 4E7ZA 4N9IA 5J6XA 2R5ZB 4RM3A 5K7HA 4Q47A 1UB9A 2A68F 2MH9A 3JRIA 5FKLA 2VKDA 1IN5A 3I4MJ 1B6AA 1BOAA 3KE2A 4EJOA 1GHCA 2QVOA 2ZO4A 2IPQX 3S8PA 2KL4A 3SEQA 2DOEA 1TT5B 4H4KC 3SHFA 2YU9J 4B44A 3M8JA 2RDPA 2LREA 4EGYA 4I2OA 3OIPA 4AVZA 1BC8C 1XDSA 3H5RA 5ICCA 2Q2EA 2FRHA 1ACIA 2JWTA 3ZPLA 5K7ZA 2BEOA 3LSHA 1P7JA 2V1XA 2L2OA 3E6DA 3EETA 2FOKA 4KUMA 3BY6A 1UHSA 2CG4A 2R7DA 4BDZA 2OU2A 5B1BH 1K61A 4JQFA 4BQNA 5E3NA 2JA8J 2E1MB 4CCLA 4ZTFA 3KPHA 3CUOA 1SD6A 4ZYHA 1IN8A 2HS5A 4MLOA 3JREA 1FYKA 4OWRB 5TISC 2ISYA 3P9IA 1HDPA 4ESFA 2JRTA 2A6EF 3E97A 4KIFA 3OV8A 3RKYA 3NWSA 3ZGKA 1JTYA 3CJQB 3P9CA 1D5VA 1WRJA 3S1QJ 3MKYB 4D5CA 5FO5A 2GA1A 2KIMA 2CV2A 3GTQJ 3G6EI 3NAUA 2YUSA 3HM5A 3PNYA 4V2GA 3ECOA 4ZYAA 4BEHB 5FGMA 2CUFA 1SVLA 4XK4A 1RUOA 1TL8A 2DCEA 3GLXA 2E36A 5E1WA 2PMZN 3RZDJ 1T95A 4N9HA 5CLSA 1BI0A 2K27A 1O7FA 1UHMA 4RGRA 3M3YJ 2Q8KA 2K5CA 1R6RA 2KMUA 2DPDA 4R1HA 3CUQA 4ESBA 2K40A 3F8FA 3JTGA 2F5DA 4ITVA 2ISZA 2EA2A 2IRFG 1B8IB 1ETYA 2AQEA 2VT2A 4IF4A 4MQVA 2R5ZA 4I98B 4UUVA 5GPCA 5FRNA 3DBHB 5LFAA 3BTIA 5IYCJ 5M3FJ 2AQFA 1G6NA 3MKZA 3HIFA 3VYTB 2FJ1A 5J47A 4IJAA 2DTZA 1QU3A 1VTNC 3SJMA 2BGCA 3V8KA 4QPQA 3R0JA 3D0SA 1RUNA 3U1KA 2HKOA 1RNLA 1DUXC 1WHUA 2XDVA 3VWBA 1FOWA 4C2UA 1U5TC 3AG4H 1A35A 1CGPA 1X1PA 2LYCA 1ZR2A 2M7BA 3A0BC 1X4PA 4LGWA 1IN7A 1Y8QB 3GYHX 5KHDA 1OYYA 4KIBA 4BKXA 2NS7A 2VC1A 3QOEA 4IOCF 2EA4A 4HOBA 2YR2A 1XSDA 3BOQA 1X3ZB 3DP7A 1BN5A 1D1BA 4EJTA 3L00A 3PFYA 2L4AA 3EUKL 1XMAA 3SDBA 3FK7A 4Q4ZF 3G1OA 5TRDA 1JJ8C 3F0CA 1H9GA 1DQUA 1FSEA 5H2FC 3LNQA 3V7CA 4BYYA 4BE1A 4P1WA 2GIZA 3K70D 2LBFB 3U9GA 3OYBA 3JCUC 3I4NJ 2NNNA 3BR6A 5ILUA 3HB9A 3HOUJ 1XSVA 2RNGA 1SMTA 1WI3A 3OYHA 3C7JA 1AKHB 4LLNA 3BTJA 4AIHA 3R4KA 3KZYA 4BEHA 5K5QA 4O3MA 3VYUB 4QWQA 5DM6F 3IH2A 5L3CA 1ON1A 3W3CA 2O8KA 3K4LA 4XRSG 2FBIA 3FM3A 3H9JA 1JUPA 1REPC 1U9NA 4WX9A 1UHWA 4FQGA 5L3EA 3GTJJ
chains in the Genus database with same CATH topology
4UV9A 1SFUA 3B02A 1TW3A 4LB5A 5LGTA 3KP2A 1TQPA 3ZMVA 3REOA 1IAWA 4OIOF 4LK1F 1P4AA 5CJ9A 5FLXZ 2FA5A 3QP5A 1OKRA 2L3DA 1F1ZA 2VT3A 3ZN0A 5K5RA 2OBPA 2RN7A 2X4HA 4RB2C 1STZA 2K4BA 5DD8A 3Q5FA 3TDZC 2YU3A 1IXSB 3I5UA 3TO7A 3SZTA 2EWNA 3IC7A 2VOOA 2CFXA 2P4WA 3ABTA 4EV0A 2X0LA 5D6EA 1HXDA 2BE5F 3WTVC 3EUHA 5D5UB 5FD6A 1RI7A 2W84A 1LB2A 3R60A 1QNTA 4YFKF 3F72A 4ENJA 3C1DA 3FWEA 2VONA 5D5VB 3IWFA 1O7LA 1YQAA 2ZBKA 5BQTA 3LAPA 3TO6A 2P7CB 1JXSA 3I4PA 1R22A 1SFEA 3VOEA 2A07F 3V7RA 3LWFA 3KEQA 4LFUA 1HW5A 2E1CA 2JT1A 5DCMB 3K0LA 2STWA 1Z91A 3KZZA 3GX4X 4OMZA 2XUBA 2FF4A 1P2FA 2M45A 5E1XA 3LA2A 2LDUA 3F8CA 5L3GA 2NNYA 2PBIA 1X3UA 3DV8A 3QOPA 3HSEA 3COAC 1D3YA 3WTZA 3HRUA 4G6QA 4ZZDA 3QU3A 4BNCA 4H0EA 3HRSA 1P4XA 2V1DA 2AS5F 2DLLA 5DUIA 4L18B 3T0YA 2NAZA 4O6JA 1WWXA 2KRFA 3EYIA 2QZ8A 2P6SA 4YIFA 4U0YA 2UXNA 1MD0A 2TDXA 5DV5A 2HTJA 5LEJA 4G7ZF 4D0PA 3DFGA 2DK5A 4EM1A 4Y15A 4RB1A 2WTEA 2PJPA 4YG2F 3FF5A 4CYDA 3BP8A 4BHCA 1YLFA 1MZBA 5DCMA 1DDNA 1I6XA 1Z05A 3KP5A 2COMA 5CVJA 3IRRA 2IJLA 1J9IA 2DQLA 1U5TB 4IRGA 2XIGA 4L9NA 1G3YA 3ZMZA 1QBJA 3HSFA 1K7AA 2CW0F 1FZPB 5F6FA 4U88A 2VOPA 1ZARA 1QGPA 4XLNF 1ON2A 3WGIA 3RTRA 3F23A 4U7DA 3L2CA 1U3EM 5D4RA 4HQMA 2MA3A 3NRVA 2EJRA 1LEBA 4KMFA 2O03A 4UV8A 3D5LA 3H3UA 2BV6A 4LK0F 2GIVA 3GFIA 4YFXF 3V8JA 4B8XA 3LA3A 4XLPF 3DPTA 1Z9CA 4I01A 1XCVA 5D6FA 3V8LA 2CSOA 1T98A 2MLKA 2G9WA 1YW8A 1JE8A 3WG9A 3F6VA 3GZ6A 1I5ZA 1BI3A 1XMKA 3K1NA 4CXFA 2AXLA 1TBXA 5H6QA 3Q9VA 3LQRA 1O3RA 3G3ZA 3TOAA 3FZVA 2ESNA 3GO5A 2F2EA 2GWRA 4WXDA 4A2UA 1B9MA 5FB2A 5AIPA 5CVIA 1O3TA 4L0ZB 4CZZA 3WTYC 3WTXC 4XSZF 4WF2A 3FXUA 1SAXA 2GQQA 4FX0A 4BHBA 4N0BA 4YIIA 2VODA 3DF8A 1YS7A 3BWGA 4EM0B 1Q1HA 4BXUA 2XASA 2VE8A 2V9VA 2UXXA 3MAJA 3E5QA 3M7GA 5EEHA 4GYGA 1LEAA 4AVPA 5LHIA 4HLYA 2CWEA 1P6RA 4M9SA 2V79A 2RQPA 1FBUA 4WWCA 4HX8A 5E18F 5FLXK 5HDKA 1AWCA 1FNNA 1JHFA 3TOBA 4OIRF 3I64A 1ZG1A 3HUGA 2B0LA 3KP3A 4JBAA 4GO1A 5ICFA 1QPMA 4RGUA 1BJAA 4AIKA 3FHZA 4L9JA 4M6XA 1DP7P 1W5TA 2K02A 2DBBA 3IKVA 1LQ1A 1IN6A 1IUYA 1A04A 4K2EA 3LQQA 4HF0A 5HS7A 4G7HF 1U78A 1OMIA 1HBXG 3P9KA 2HEOA 3SXYA 1ZRCA 3FMRA 3EYYA 3E6MA 3E6CC 1YG2A 1WKMA 1KYWA 1XGNA 3RPUA 1C0WA 3QPHA 4Z2YA 4F7ZA 4IHSA 5HS8A 1O3QA 2GA2A 4G94A 3TDUC 1R36A 2PQ8A 3WU1B 4HX4A 2R7FA 1MJ9A 1GVJA 5CYVA 3ZMUA 1HKTA 1BI2A 3TQNA 4M73A 3HOSA 2L02A 5LRSA 2ACJA 3MZYA 4IRHA 3RKXA 1IXRC 4JK1X 4OOIA 3DEUA 2LSOA 1BI1A 2Y0MA 3MFKA 4PCQA 4RB0A 1P4WA 5F1RA 4ASNA 4LB6B 5FD5A 4OIPF 3WTSC 3OOPA 4HF1A 2W25A 5LEKA 2HYFA 1HW2A 1FBSA 3RYPA 3O2PE 1D8JA 1AOYA 5J8FA 2ELHA 4B09A 2HYGD 3BJOA 1QZZA 2F5CA 3WGGA 1FP1D 1DPUA 3WTWC 2F5EA 4ZH4F 5L3DA 5E8GA 4KMUX 3C3WA 4FX4A 3I54A 4MNUA 2OQRA 2FBHA 2HDCA 4UVBA 1JGSA 5HVQC 3ML6A 2A5YB 3KETA 4IPAA 4UNOA 2YX7A 3GFJA 1TW2A 4G8XA 3SQNA 3W6KB 2W57A 5AIQA 1GXQA 2EFOA 1YW7A 4A0ZA 5EEGA 2WWYA 5JI6A 3JSPA 1R00A 2V1UA 3GWZA 1L3LA 3QAHA 2MD5A 4A5NA 1Z6TA 3EQLF 4U0WA 3GEZA 3R61A 1R1UA 3ZQ7A 2K7LA 2GAUA 2HOEA 1SFXA 4HZFA 4DNCA 3CLOA 1G3SA 1XGOA 4FT8A 4KNYA 4HF2A 4PDKA 1FWZA 2Z33A 2XVCA 4ON0A 5CVRA 1TLHB 3KLNA 5IT9K 4HDUA 1IF1A 3HYIA 1KU7A 1SD5A 1GXPA 3T8RA 2GZWA 2F5FA 2PMUA 2HWVA 2QQBA 1RZ4A 2RC4A 3MCZA 1S6LA 3JAMK 1U6GA 5LHHA 4A0XA 2OQGA 5L3FA 1UCRA 2BBYA 5BS6A 3HTSB 3ZP5A 1EH7A 3HRMA 2D1VA 2PEXA 5KK1A 4L5IA 1MGTA 4ZYGA 4LLLA 2DFIA 3FXRA 1KQ0A 2L4MA 2IW5A 4ENMA 1XB4A 5CVVA 1IN4A 3E5UA 3F21A 1K79A 1T0FA 5BOXA 3F8NA 3LAJA 2HQRA 4M71A 1U8RA 3NQOA 4HA8A 1FYLA 4UHTA 1O57A 5ILSA 4Q5SF 4MEXF 4ENNA 1BM9A 2QM3A 3BPVA 3GZ5A 4LLGF 2Y48A 5J8CA 2M5WA 1T6SA 4ZYEA 2D45A 2EV0A 3HHHA 2P5VA 3FXQA 1JHHA 4LD5A 3DXJF 4WXHA 5D8LB 2C6YA 4O5VA 1V4RA 1WI9A 3M8FA 3CJNA 4BHPA 1K6OA 2M87A 1EV7A 4KDPA 4Y13A 2DAOA 2JPBA 3FX3A 5KVRA 2Z3YA 3F8MA 2M1BA 3IL2A 2KKOA 4AIJA 6PAXA 2OD5A 2MC3A 1R5HA 2NRAC 1HW1A 4MQ9F 3DKWA 4HYEA 4A5MA 3CTAA 4NB5A 1Z7UA 5E8IA 2VXZA 4R79A 1Z1DA 2VC0A 1XCBA 1MDMB 3F8BA 4P9FA 1B9NA 3GVAA 4GYIA 5F64A 1OYWA 3HRTA 2A6HF 2KIUA 1G3WA 4RGSA 5LBQA 1F5TA 2H09A 4OIQF 3FMQA 3HOTA 1FPQA 2QWWA 4U0VA 2VBXA 4Y17A 3ZMSA 5E17F 1Z6RA 3CDHA 2FE3A 2XKPA 3KP4A 2PG4A 1S7OA 3GUDA 1F9NA 3N4MA 3PFIA 2V6CA 2XHKA 2ESHA 4AD9A 4YFNF 1KU2A 5TJJA 3B73A 4OINF 1TTYA 2L54A 3IRQA 3WE2A 3U1DA 2ZXJA 3P7NA 2D2WA 1SD4A 1ZG5A 1ZHFA 1V3FA 2RGVA 4PGGA 2YX4A 5LGNA 3ELKA 1ZGJA 4KYWA 1TNSA 4EJWA 2HFHA 4HDVA 2Z9OA 1FBQA 4L9TA 1SMYF 3I58A 2QBYB 1MDMA 1ULYA 3C18A 4CDGA 4E70A 5CVUA 1TQIA 5E1ZB 1S3JA 4R8HA 2L01A 3R6SA 2XAGA 1KA8A 2FSWA 3I71A 1J5YA 3K2ZA 3RIRA 2LKPA 4RB3C 4EGZA 1S8NA 2CYYA 2CO5A 3WE3A 2HGCA 2MLGA 2DO7A 1HSJA 4KT5C 1CF7B 4I02A 3WU0A 5A2QZ 2O6GE 3S2WA 3ULQB 3L9FA 3QRFF 2J5OA 3QPTA 1USTA 4I0BA 5HLIA 3RPQA 5D8KB 3CO6C 3HTUA 1NHAA 4AWXB 1ZAOA 3U2RA 1FSHA 2BYVE 2P5KA 3BJ6A 3H92A 3M8EA 4FHTA 2KJBA 3I0TA 2R3SA 4HX7A 4NHJA 2NYXA 5D5WB 3RYRA 1FP2A 1FX7A 2O3FA 5LGUA 4GGGA 1KQ9A 1MJBA 2QBYA 2EFQA 1T2KA 2EFNA 3VEPA 1BC7C 1ZN2A 2HTSA 1YFHA 2DPUA 4KN4X 4LJZF 3ZN1A 2VBZA 5FFXA 4I09A 1KU9A 4P9UA 2GXGA 4GXOA 4CO8A 2A3SA 1FT9A 5ICGA 5DEQA 1WQ2A 2EV6A 3PQKA 2G7UA 3IKTA 2MH2A 4WCGA 1OR7A 2FXAA 1CF7A 2XGXA 2E7WA 1J2XA 4MTEA 2RV8A 4I0AA 3T5XA 3BZ6A 5DD4A 1F4KA 1ZH5A 3F6OA 4ESJA 3EDPA 1E2XA 4GCVA 1J75A 3TKYA 5DCFA 1H0MA 1XDUA 3K1MA 1FC3A 2YSRA 1QZYA 2ZMEB 4Q48A 4P55A 4UVAA 3KLOA 1KQ8A 5H6RA 2XKOA 4DQ2A 5DUKA 2XROA 3V7SA 3J80Z 2DU9A 2H6CA 3MEXA 1XSXA 4L9VA 2CGPA 1B4AA 5D4SA 3JSOA 3CO7C 2PLYA 3BPXA 2EFWA 1B59A 3DPLC 2QLZA 1DPRA 3H3ZA 1KU3A 1UFMA 4CHUA 1W4MA 5JVTA 1FYMA 2OZUA 1PP8F 5HS9A 4XSXF 2DW4A 1T39A 4PGHA 2IT0A 4M72A 2WV0A 3BDDA 4NQWA 3L7WA 5HDGA 2IA2A 4IVNA 5HDNA 1FOKA 1R1TA 3T1BA 2QQ9A 1LJ9A 2FU4A 3IHUA 3LSTA 3KCCA 4M6YA 5DYMA 2OAZA 2DTRA 5LRRA 3TO9A 4LMYA 2ZMEA 2ADUA 1KGSA 2A61A 1IZ1A 3LA7A 2FNPA 4A6EA 4HAMA 4IHTA 1W7PB 2NS0A 1XGMA 3J7AO 2M30A 2Q0OA 4CGZA 2KJCA 2KIFA 2H94A 3BROA 3L09A 1TNTA 2FNAA 2EV5A 4KFCA 3J81Z 1ZLKA 2QQAA 4L0YB 1K78B 1IXCA 1R58A 2HZTA 2QUFA 1ZRFA 1SD7A 1FLIA 1QO0D 1ZRDA 4U7BA 2PI0A 1OPCA 2JZYA 2K86A 1B1BA 2UWMA 1ZYRF 2PN6A 4MEYF 1TQMA 3N97A 3GFLA 3WTTC 4KIGA 4OU0A 2DQRA 1MKMA 4EMSA 3RJPA 2VE9A 3QP6A 5ICEA 3JTHA 3GF2A 2XAJA 2E1NA 3K69A 3WODF 1OYIA 1XN7A 2K4JA 3T8TA 4LG0B 4G7OF 1ONVA 1W7PA 2W85A 1R1VA 2ETHA 3MQ0A 3RKWA 1J0RA 3O3KA 4WXCA 2E7XA 1HSTA 2XRNA 4RS8A 2XAQA 1K78A 3ECHA 2XV4S 4UXNA 2ZJ2A 5IT3A 5E20A 2O8XA 2RKHA 2LF8A 5LLQA 2M8EA 3ERED 3K9TA 1LDDA 3F22A 4L5JA 1HQCA 3FM5A 3SFZA 3GW2A 3G73A 5A2QK 3M1EA 2HR3A 1YS6A 3W6JB 1D8KA 2PMHA 5HLHA 2IA1A 1T38A 1YYVA 2PFBA 1ZGAA 5D5XB 4S05A 1PUEE 4WK8F 1HKSA 3VFZA 5ERIA 3IWZA 5BPDA 4A12A 3ROUA 1EH8A 3CUQC 2QENA 2DK8A 2Z5UA 4HQEA 1J59A 2ZCWA 3F3XA 4LG0A 2Y75A 2CQKA 3I53A 3RI4A 1G3TA 1S7AA 1YW9A 2ZKZA 1IRFA 2RNJA 3KP6A 1XGSA 3MZHA 3E6BA 2P6TA 2FMYA 5BPIA 2IA0A 1PP7U 1S29A 4RAYA 2IVMA 3ZMDA 2ZNZA 2VBWA 5HOOA 4S04A 5AONA 3ISPA 4A0YA 2FEZA 2STTA 4MGRA 3VODA 4MTDA 2FMLA 4RAZA 4HLXA 4KA4A 1KYZA 4HW0A 5FFZA 4HV5A 1W5SA 4HBLA 4IRIA 4EJUA 3LFKA 4UVCA 4EVIA 2UZKA 4XBFA 1HKQA 2EFPA 1LNWA 2FQ3A 2VBYA 4MHGA 5JFRA 4EQQA 2A69F 2WC2A 1BIAA 2P7VB 4CICA 1LDJA 1IW7F 5HLGA 4P5OA 2HKXA 2O61A 3ZMTA 1P92A 2W24A 3KFWX 3KEOA 2D1HA 1L0OC 4P96A 3J80K 3ABUA 4XRFA 4EJVA 2O0YA 1ZG3A 4TV7A 3V4GA 2GXBA 5IT9Z 3JW4A 1ZLJA 1LVAA 5H20A 4BQAA 1EH6A 1I1SA 4KICA 1BBYA 2OZ6A 4EM2A 5K1YA 2Z99A 3GXOA 3BJAA 4RGXA 3I59B 5ED4A 3JAMZ 4KN7X 5L3BA 3AAFA 1YTYA 2EK5A 1U2WA 2JTVA 1QQIA 1USSA 4M9ZA 1ODDA 4BH9A 1I27A 3HHGA 1R23A 3M9AA 1Y0UA 1XD7A 4G6DA 3HSRA 2DT5A 3E3VA 2YPRA 5ILVA 2P8TA 3MWMA 1H9TA 2XAHA 2G7HA 3GFMA 3K1PA 1U5TA 5LHGA 2FBKA 3R0AA 4A6DA 1YO5C 1R7JA 3TGNA 2RVCA 2OA4A 3KP7A 3NEUA 1PDNC 2ZNYA 2IP2A 3QU6A 1IRGA 1J7KA 4HV6A 4ETSA 4IXAA 2ZFWA 1RIOH 3J81K 5DDGA 1W7PD 2DI3A 4M74A 2QYOA 1BIBA 4G9YA 1FY7A 2P5LC 5BMZA 3VB2A 4PZJA 3WGHA 1I1GA 4BAYA 2J5PA 1E17A 3WTUC 1O3SA 2JPCA 3Q9SA 1ZREA 3I59A 1R5GA 1MJAA 4QLCU 2EB7A 4ZYDA 1YIOA 3FMSA 2XAFA 1LDKB 4M9XA 3RDIA 2VN2A 3DQVC 5K5OA 2HQNA 1G4DA 3E5XA 2H6BA 2JSCA 1WSUA 2LF7A 5JHUA 4OMYA 2MBFA 3SZPA 4I7HA 4ENKA 4ZZLA 3CUQB 3O6BB 2LNBA 5JR3A 3PQJA 4N9IA 5J6XA 4Q47A 1UB9A 2A68F 2MH9A 1IN5A 1B6AA 1BOAA 3KE2A 4EJOA 1GHCA 2QVOA 2ZO4A 2IPQX 3SHFA 2RDPA 4EGYA 4I2OA 1BC8C 1XDSA 5ICCA 2Q2EA 2FRHA 3ZPLA 2BEOA 2V1XA 3E6DA 3EETA 2FOKA 4KUMA 3BY6A 2CG4A 2R7DA 2OU2A 4JQFA 3CUOA 1SD6A 4ZYHA 1IN8A 2HS5A 1FYKA 2ISYA 3P9IA 4ESFA 2JRTA 2A6EF 3E97A 4KIFA 3OV8A 3RKYA 1D5VA 3P9CA 1WRJA 5FO5A 2GA1A 2KIMA 3ECOA 5FGMA 1RUOA 3GLXA 5E1WA 4N9HA 5CLSA 1BI0A 2K27A 1O7FA 1UHMA 4RGRA 2Q8KA 2DPDA 4R1HA 3CUQA 4ESBA 3F8FA 3JTGA 2F5DA 2ISZA 2EA2A 2IRFG 4MQVA 2VT2A 4IF4A 4I98B 4UUVA 1G6NA 3HIFA 4IJAA 1VTNC 2BGCA 3V8KA 3R0JA 3D0SA 1RUNA 2HKOA 1RNLA 1DUXC 1U5TC 1CGPA 4LGWA 1IN7A 3GYHX 1OYYA 4KIBA 2VC1A 2EA4A 4HOBA 2YR2A 1XSDA 3BOQA 3DP7A 1BN5A 4EJTA 3L00A 2L4AA 1XMAA 4Q4ZF 5TRDA 1H9GA 1FSEA 3V7CA 4BYYA 3U9GA 2NNNA 5ILUA 1XSVA 1SMTA 3C7JA 4LLNA 4AIHA 3R4KA 3KZYA 5K5QA 4O3MA 4QWQA 5L3CA 1ON1A 2FBIA 3FM3A 1REPC 4WX9A 1UHWA 5L3EA 2H27A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4UV9 A;  1SFU A;  3B02 A;  1TW3 A;  4LB5 A;  5LGT A;  3KP2 A;  1TQP A;  3ZMV A;  3REO A;  1IAW A;  4OIO F;  4LK1 F;  1P4A A;  5CJ9 A;  5FLX Z;  2FA5 A;  3QP5 A;  1OKR A;  2L3D A;  1F1Z A;  2VT3 A;  3ZN0 A;  5K5R A;  2OBP A;  2RN7 A;  2X4H A;  4RB2 C;  1STZ A;  2K4B A;  5DD8 A;  3Q5F A;  3TDZ C;  2YU3 A;  1IXS B;  3I5U A;  3TO7 A;  3SZT A;  2EWN A;  3IC7 A;  2VOO A;  2CFX A;  2P4W A;  3ABT A;  4EV0 A;  2X0L A;  5D6E A;  1HXD A;  2BE5 F;  3WTV C;  3EUH A;  5D5U B;  5FD6 A;  1RI7 A;  2W84 A;  1LB2 A;  3R60 A;  1QNT A;  4YFK F;  3F72 A;  4ENJ A;  3C1D A;  3FWE A;  2VON A;  5D5V B;  3IWF A;  1O7L A;  1YQA A;  2ZBK A;  5BQT A;  3LAP A;  3TO6 A;  2P7C B;  1JXS A;  3I4P A;  1R22 A;  1SFE A;  3VOE A;  2A07 F;  3V7R A;  3LWF A;  3KEQ A;  4LFU A;  1HW5 A;  2E1C A;  2JT1 A;  5DCM B;  3K0L A;  2STW A;  1Z91 A;  3KZZ A;  3GX4 X;  4OMZ A;  2XUB A;  2FF4 A;  1P2F A;  2M45 A;  5E1X A;  3LA2 A;  2LDU A;  3F8C A;  5L3G A;  2NNY A;  2PBI A;  1X3U A;  3DV8 A;  3QOP A;  3HSE A;  3COA C;  1D3Y A;  3WTZ A;  3HRU A;  4G6Q A;  4ZZD A;  3QU3 A;  4BNC A;  4H0E A;  3HRS A;  1P4X A;  2V1D A;  2AS5 F;  2DLL A;  5DUI A;  4L18 B;  3T0Y A;  2NAZ A;  4O6J A;  1WWX A;  2KRF A;  3EYI A;  2QZ8 A;  2P6S A;  4YIF A;  4U0Y A;  2UXN A;  1MD0 A;  2TDX A;  5DV5 A;  2HTJ A;  5LEJ A;  4G7Z F;  4D0P A;  3DFG A;  2DK5 A;  4EM1 A;  4Y15 A;  4RB1 A;  2WTE A;  2PJP A;  4YG2 F;  3FF5 A;  4CYD A;  3BP8 A;  4BHC A;  1YLF A;  1MZB A;  5DCM A;  1DDN A;  1I6X A;  1Z05 A;  3KP5 A;  2COM A;  5CVJ A;  3IRR A;  2IJL A;  1J9I A;  2DQL A;  1U5T B;  4IRG A;  2XIG A;  4L9N A;  1G3Y A;  3ZMZ A;  1QBJ A;  3HSF A;  1K7A A;  2CW0 F;  1FZP B;  5F6F A;  4U88 A;  2VOP A;  1ZAR A;  1QGP A;  4XLN F;  1ON2 A;  3WGI A;  3RTR A;  3F23 A;  4U7D A;  3L2C A;  1U3E M;  5D4R A;  4HQM A;  2MA3 A;  3NRV A;  2EJR A;  1LEB A;  4KMF A;  2O03 A;  4UV8 A;  3D5L A;  3H3U A;  2BV6 A;  4LK0 F;  2GIV A;  3GFI A;  4YFX F;  3V8J A;  4B8X A;  3LA3 A;  4XLP F;  3DPT A;  1Z9C A;  4I01 A;  1XCV A;  5D6F A;  3V8L A;  2CSO A;  1T98 A;  2MLK A;  2G9W A;  1YW8 A;  1JE8 A;  3WG9 A;  3F6V A;  3GZ6 A;  1I5Z A;  1BI3 A;  1XMK A;  3K1N A;  4CXF A;  2AXL A;  1TBX A;  5H6Q A;  3Q9V A;  3LQR A;  1O3R A;  3G3Z A;  3TOA A;  3FZV A;  2ESN A;  3GO5 A;  2F2E A;  2GWR A;  4WXD A;  4A2U A;  1B9M A;  5FB2 A;  5AIP A;  5CVI A;  1O3T A;  4L0Z B;  4CZZ A;  3WTY C;  3WTX C;  4XSZ F;  4WF2 A;  3FXU A;  1SAX A;  2GQQ A;  4FX0 A;  4BHB A;  4N0B A;  4YII A;  2VOD A;  3DF8 A;  1YS7 A;  3BWG A;  4EM0 B;  1Q1H A;  4BXU A;  2XAS A;  2VE8 A;  2V9V A;  2UXX A;  3MAJ A;  3E5Q A;  3M7G A;  5EEH A;  4GYG A;  1LEA A;  4AVP A;  5LHI A;  4HLY A;  2CWE A;  1P6R A;  4M9S A;  2V79 A;  2RQP A;  1FBU A;  4WWC A;  4HX8 A;  5E18 F;  5FLX K;  5HDK A;  1AWC A;  1FNN A;  1JHF A;  3TOB A;  4OIR F;  3I64 A;  1ZG1 A;  3HUG A;  2B0L A;  3KP3 A;  4JBA A;  4GO1 A;  5ICF A;  1QPM A;  4RGU A;  1BJA A;  4AIK A;  3FHZ A;  4L9J A;  4M6X A;  1DP7 P;  1W5T A;  2K02 A;  2DBB A;  3IKV A;  1LQ1 A;  1IN6 A;  1IUY A;  1A04 A;  4K2E A;  3LQQ A;  4HF0 A;  5HS7 A;  4G7H F;  1U78 A;  1OMI A;  1HBX G;  3P9K A;  2HEO A;  3SXY A;  1ZRC A;  3FMR A;  3EYY A;  3E6M A;  3E6C C;  1YG2 A;  1WKM A;  1KYW A;  1XGN A;  3RPU A;  1C0W A;  3QPH A;  4Z2Y A;  4F7Z A;  4IHS A;  5HS8 A;  1O3Q A;  2GA2 A;  4G94 A;  3TDU C;  1R36 A;  2PQ8 A;  3WU1 B;  4HX4 A;  2R7F A;  1MJ9 A;  1GVJ A;  5CYV A;  3ZMU A;  1HKT A;  1BI2 A;  3TQN A;  4M73 A;  3HOS A;  2L02 A;  5LRS A;  2ACJ A;  3MZY A;  4IRH A;  3RKX A;  1IXR C;  4JK1 X;  4OOI A;  3DEU A;  2LSO A;  1BI1 A;  2Y0M A;  3MFK A;  4PCQ A;  4RB0 A;  1P4W A;  5F1R A;  4ASN A;  4LB6 B;  5FD5 A;  4OIP F;  3WTS C;  3OOP A;  4HF1 A;  2W25 A;  5LEK A;  2HYF A;  1HW2 A;  1FBS A;  3RYP A;  3O2P E;  1D8J A;  1AOY A;  5J8F A;  2ELH A;  4B09 A;  2HYG D;  3BJO A;  1QZZ A;  2F5C A;  3WGG A;  1FP1 D;  1DPU A;  3WTW C;  2F5E A;  4ZH4 F;  5L3D A;  5E8G A;  4KMU X;  3C3W A;  4FX4 A;  3I54 A;  4MNU A;  2OQR A;  2FBH A;  2HDC A;  4UVB A;  1JGS A;  5HVQ C;  3ML6 A;  2A5Y B;  3KET A;  4IPA A;  4UNO A;  2YX7 A;  3GFJ A;  1TW2 A;  4G8X A;  3SQN A;  3W6K B;  2W57 A;  5AIQ A;  1GXQ A;  2EFO A;  1YW7 A;  4A0Z A;  5EEG A;  2WWY A;  5JI6 A;  3JSP A;  1R00 A;  2V1U A;  3GWZ A;  1L3L A;  3QAH A;  2MD5 A;  4A5N A;  1Z6T A;  3EQL F;  4U0W A;  3GEZ A;  3R61 A;  1R1U A;  3ZQ7 A;  2K7L A;  2GAU A;  2HOE A;  1SFX A;  4HZF A;  4DNC A;  3CLO A;  1G3S A;  1XGO A;  4FT8 A;  4KNY A;  4HF2 A;  4PDK A;  1FWZ A;  2Z33 A;  2XVC A;  4ON0 A;  5CVR A;  1TLH B;  3KLN A;  5IT9 K;  4HDU A;  1IF1 A;  3HYI A;  1KU7 A;  1SD5 A;  1GXP A;  3T8R A;  2GZW A;  2F5F A;  2PMU A;  2HWV A;  2QQB A;  1RZ4 A;  2RC4 A;  3MCZ A;  1S6L A;  3JAM K;  1U6G A;  5LHH A;  4A0X A;  2OQG A;  5L3F A;  1UCR A;  2BBY A;  5BS6 A;  3HTS B;  3ZP5 A;  1EH7 A;  3HRM A;  2D1V A;  2PEX A;  5KK1 A;  4L5I A;  1MGT A;  4ZYG A;  4LLL A;  2DFI A;  3FXR A;  1KQ0 A;  2L4M A;  2IW5 A;  4ENM A;  1XB4 A;  5CVV A;  1IN4 A;  3E5U A;  3F21 A;  1K79 A;  1T0F A;  5BOX A;  3F8N A;  3LAJ A;  2HQR A;  4M71 A;  1U8R A;  3NQO A;  4HA8 A;  1FYL A;  4UHT A;  1O57 A;  5ILS A;  4Q5S F;  4MEX F;  4ENN A;  1BM9 A;  2QM3 A;  3BPV A;  3GZ5 A;  4LLG F;  2Y48 A;  5J8C A;  2M5W A;  1T6S A;  4ZYE A;  2D45 A;  2EV0 A;  3HHH A;  2P5V A;  3FXQ A;  1JHH A;  4LD5 A;  3DXJ F;  4WXH A;  5D8L B;  2C6Y A;  4O5V A;  1V4R A;  1WI9 A;  3M8F A;  3CJN A;  4BHP A;  1K6O A;  2M87 A;  1EV7 A;  4KDP A;  4Y13 A;  2DAO A;  2JPB A;  3FX3 A;  5KVR A;  2Z3Y A;  3F8M A;  2M1B A;  3IL2 A;  2KKO A;  4AIJ A;  6PAX A;  2OD5 A;  2MC3 A;  1R5H A;  2NRA C;  1HW1 A;  4MQ9 F;  3DKW A;  4HYE A;  4A5M A;  3CTA A;  4NB5 A;  1Z7U A;  5E8I A;  2VXZ A;  4R79 A;  1Z1D A;  2VC0 A;  1XCB A;  1MDM B;  3F8B A;  4P9F A;  1B9N A;  3GVA A;  4GYI A;  5F64 A;  1OYW A;  3HRT A;  2A6H F;  2KIU A;  1G3W A;  4RGS A;  5LBQ A;  1F5T A;  2H09 A;  4OIQ F;  3FMQ A;  3HOT A;  1FPQ A;  2QWW A;  4U0V A;  2VBX A;  4Y17 A;  3ZMS A;  5E17 F;  1Z6R A;  3CDH A;  2FE3 A;  2XKP A;  3KP4 A;  2PG4 A;  1S7O A;  3GUD A;  1F9N A;  3N4M A;  3PFI A;  2V6C A;  2XHK A;  2ESH A;  4AD9 A;  4YFN F;  1KU2 A;  5TJJ A;  3B73 A;  4OIN F;  1TTY A;  2L54 A;  3IRQ A;  3WE2 A;  3U1D A;  2ZXJ A;  3P7N A;  2D2W A;  1SD4 A;  1ZG5 A;  1ZHF A;  1V3F A;  2RGV A;  4PGG A;  2YX4 A;  5LGN A;  3ELK A;  1ZGJ A;  4KYW A;  1TNS A;  4EJW A;  2HFH A;  4HDV A;  2Z9O A;  1FBQ A;  4L9T A;  1SMY F;  3I58 A;  2QBY B;  1MDM A;  1ULY A;  3C18 A;  4CDG A;  4E70 A;  5CVU A;  1TQI A;  5E1Z B;  1S3J A;  4R8H A;  2L01 A;  3R6S A;  2XAG A;  1KA8 A;  2FSW A;  3I71 A;  1J5Y A;  3K2Z A;  3RIR A;  2LKP A;  4RB3 C;  4EGZ A;  1S8N A;  2CYY A;  2CO5 A;  3WE3 A;  2HGC A;  2MLG A;  2DO7 A;  1HSJ A;  4KT5 C;  1CF7 B;  4I02 A;  3WU0 A;  5A2Q Z;  2O6G E;  3S2W A;  3ULQ B;  3L9F A;  3QRF F;  2J5O A;  3QPT A;  1UST A;  4I0B A;  5HLI A;  3RPQ A;  5D8K B;  3CO6 C;  3HTU A;  1NHA A;  4AWX B;  1ZAO A;  3U2R A;  1FSH A;  2BYV E;  2P5K A;  3BJ6 A;  3H92 A;  3M8E A;  4FHT A;  2KJB A;  3I0T A;  2R3S A;  4HX7 A;  4NHJ A;  2NYX A;  5D5W B;  3RYR A;  1FP2 A;  1FX7 A;  2O3F A;  5LGU A;  4GGG A;  1KQ9 A;  1MJB A;  2QBY A;  2EFQ A;  1T2K A;  2EFN A;  3VEP A;  1BC7 C;  1ZN2 A;  2HTS A;  1YFH A;  2DPU A;  4KN4 X;  4LJZ F;  3ZN1 A;  2VBZ A;  5FFX A;  4I09 A;  1KU9 A;  4P9U A;  2GXG A;  4GXO A;  4CO8 A;  2A3S A;  1FT9 A;  5ICG A;  5DEQ A;  1WQ2 A;  2EV6 A;  3PQK A;  2G7U A;  3IKT A;  2MH2 A;  4WCG A;  1OR7 A;  2FXA A;  1CF7 A;  2XGX A;  2E7W A;  1J2X A;  4MTE A;  2RV8 A;  4I0A A;  3T5X A;  3BZ6 A;  5DD4 A;  1F4K A;  1ZH5 A;  3F6O A;  4ESJ A;  3EDP A;  1E2X A;  4GCV A;  1J75 A;  3TKY A;  5DCF A;  1H0M A;  1XDU A;  3K1M A;  1FC3 A;  2YSR A;  1QZY A;  2ZME B;  4Q48 A;  4P55 A;  4UVA A;  3KLO A;  1KQ8 A;  5H6R A;  2XKO A;  4DQ2 A;  5DUK A;  2XRO A;  3V7S A;  3J80 Z;  2DU9 A;  2H6C A;  3MEX A;  1XSX A;  4L9V A;  2CGP A;  1B4A A;  5D4S A;  3JSO A;  3CO7 C;  2PLY A;  3BPX A;  2EFW A;  1B59 A;  3DPL C;  2QLZ A;  1DPR A;  3H3Z A;  1KU3 A;  1UFM A;  4CHU A;  1W4M A;  5JVT A;  1FYM A;  2OZU A;  1PP8 F;  5HS9 A;  4XSX F;  2DW4 A;  1T39 A;  4PGH A;  2IT0 A;  4M72 A;  2WV0 A;  3BDD A;  4NQW A;  3L7W A;  5HDG A;  2IA2 A;  4IVN A;  5HDN A;  1FOK A;  1R1T A;  3T1B A;  2QQ9 A;  1LJ9 A;  2FU4 A;  3IHU A;  3LST A;  3KCC A;  4M6Y A;  5DYM A;  2OAZ A;  2DTR A;  5LRR A;  3TO9 A;  4LMY A;  2ZME A;  2ADU A;  1KGS A;  2A61 A;  1IZ1 A;  3LA7 A;  2FNP A;  4A6E A;  4HAM A;  4IHT A;  1W7P B;  2NS0 A;  1XGM A;  3J7A O;  2M30 A;  2Q0O A;  4CGZ A;  2KJC A;  2KIF A;  2H94 A;  3BRO A;  3L09 A;  1TNT A;  2FNA A;  2EV5 A;  4KFC A;  3J81 Z;  1ZLK A;  2QQA A;  4L0Y B;  1K78 B;  1IXC A;  1R58 A;  2HZT A;  2QUF A;  1ZRF A;  1SD7 A;  1FLI A;  1QO0 D;  1ZRD A;  4U7B A;  2PI0 A;  1OPC A;  2JZY A;  2K86 A;  1B1B A;  2UWM A;  1ZYR F;  2PN6 A;  4MEY F;  1TQM A;  3N97 A;  3GFL A;  3WTT C;  4KIG A;  4OU0 A;  2DQR A;  1MKM A;  4EMS A;  3RJP A;  2VE9 A;  3QP6 A;  5ICE A;  3JTH A;  3GF2 A;  2XAJ A;  2E1N A;  3K69 A;  3WOD F;  1OYI A;  1XN7 A;  2K4J A;  3T8T A;  4LG0 B;  4G7O F;  1ONV A;  1W7P A;  2W85 A;  1R1V A;  2ETH A;  3MQ0 A;  3RKW A;  1J0R A;  3O3K A;  4WXC A;  2E7X A;  1HST A;  2XRN A;  4RS8 A;  2XAQ A;  1K78 A;  3ECH A;  2XV4 S;  4UXN A;  2ZJ2 A;  5IT3 A;  5E20 A;  2O8X A;  2RKH A;  2LF8 A;  5LLQ A;  2M8E A;  3ERE D;  3K9T A;  1LDD A;  3F22 A;  4L5J A;  1HQC A;  3FM5 A;  3SFZ A;  3GW2 A;  3G73 A;  5A2Q K;  3M1E A;  2HR3 A;  1YS6 A;  3W6J B;  1D8K A;  2PMH A;  5HLH A;  2IA1 A;  1T38 A;  1YYV A;  2PFB A;  1ZGA A;  5D5X B;  4S05 A;  1PUE E;  4WK8 F;  1HKS A;  3VFZ A;  5ERI A;  3IWZ A;  5BPD A;  4A12 A;  3ROU A;  1EH8 A;  3CUQ C;  2QEN A;  2DK8 A;  2Z5U A;  4HQE A;  1J59 A;  2ZCW A;  3F3X A;  4LG0 A;  2Y75 A;  2CQK A;  3I53 A;  3RI4 A;  1G3T A;  1S7A A;  1YW9 A;  2ZKZ A;  1IRF A;  2RNJ A;  3KP6 A;  1XGS A;  3MZH A;  3E6B A;  2P6T A;  2FMY A;  5BPI A;  2IA0 A;  1PP7 U;  1S29 A;  4RAY A;  2IVM A;  3ZMD A;  2ZNZ A;  2VBW A;  5HOO A;  4S04 A;  5AON A;  3ISP A;  4A0Y A;  2FEZ A;  2STT A;  4MGR A;  3VOD A;  4MTD A;  2FML A;  4RAZ A;  4HLX A;  4KA4 A;  1KYZ A;  4HW0 A;  5FFZ A;  4HV5 A;  1W5S A;  4HBL A;  4IRI A;  4EJU A;  3LFK A;  4UVC A;  4EVI A;  2UZK A;  4XBF A;  1HKQ A;  2EFP A;  1LNW A;  2FQ3 A;  2VBY A;  4MHG A;  5JFR A;  4EQQ A;  2A69 F;  2WC2 A;  1BIA A;  2P7V B;  4CIC A;  1LDJ A;  1IW7 F;  5HLG A;  4P5O A;  2HKX A;  2O61 A;  3ZMT A;  1P92 A;  2W24 A;  3KFW X;  3KEO A;  2D1H A;  1L0O C;  4P96 A;  3J80 K;  3ABU A;  4XRF A;  4EJV A;  2O0Y A;  1ZG3 A;  4TV7 A;  3V4G A;  2GXB A;  5IT9 Z;  3JW4 A;  1ZLJ A;  1LVA A;  5H20 A;  4BQA A;  1EH6 A;  1I1S A;  4KIC A;  1BBY A;  2OZ6 A;  4EM2 A;  5K1Y A;  2Z99 A;  3GXO A;  3BJA A;  4RGX A;  3I59 B;  5ED4 A;  3JAM Z;  4KN7 X;  5L3B A;  3AAF A;  1YTY A;  2EK5 A;  1U2W A;  2JTV A;  1QQI A;  1USS A;  4M9Z A;  1ODD A;  4BH9 A;  1I27 A;  3HHG A;  1R23 A;  3M9A A;  1Y0U A;  1XD7 A;  4G6D A;  3HSR A;  2DT5 A;  3E3V A;  2YPR A;  5ILV A;  2P8T A;  3MWM A;  1H9T A;  2XAH A;  2G7H A;  3GFM A;  3K1P A;  1U5T A;  5LHG A;  2FBK A;  3R0A A;  4A6D A;  1YO5 C;  1R7J A;  3TGN A;  2RVC A;  2OA4 A;  3KP7 A;  3NEU A;  1PDN C;  2ZNY A;  2IP2 A;  3QU6 A;  1IRG A;  1J7K A;  4HV6 A;  4ETS A;  4IXA A;  2ZFW A;  1RIO H;  3J81 K;  5DDG A;  1W7P D;  2DI3 A;  4M74 A;  2QYO A;  1BIB A;  4G9Y A;  1FY7 A;  2P5L C;  5BMZ A;  3VB2 A;  4PZJ A;  3WGH A;  1I1G A;  4BAY A;  2J5P A;  1E17 A;  3WTU C;  1O3S A;  2JPC A;  3Q9S A;  1ZRE A;  3I59 A;  1R5G A;  1MJA A;  4QLC U;  2EB7 A;  4ZYD A;  1YIO A;  3FMS A;  2XAF A;  1LDK B;  4M9X A;  3RDI A;  2VN2 A;  3DQV C;  5K5O A;  2HQN A;  1G4D A;  3E5X A;  2H6B A;  2JSC A;  1WSU A;  2LF7 A;  5JHU A;  4OMY A;  2MBF A;  3SZP A;  4I7H A;  4ENK A;  4ZZL A;  3CUQ B;  3O6B B;  2LNB A;  5JR3 A;  3PQJ A;  4N9I A;  5J6X A;  4Q47 A;  1UB9 A;  2A68 F;  2MH9 A;  1IN5 A;  1B6A A;  1BOA A;  3KE2 A;  4EJO A;  1GHC A;  2QVO A;  2ZO4 A;  2IPQ X;  3SHF A;  2RDP A;  4EGY A;  4I2O A;  1BC8 C;  1XDS A;  5ICC A;  2Q2E A;  2FRH A;  3ZPL A;  2BEO A;  2V1X A;  3E6D A;  3EET A;  2FOK A;  4KUM A;  3BY6 A;  2CG4 A;  2R7D A;  2OU2 A;  4JQF A;  3CUO A;  1SD6 A;  4ZYH A;  1IN8 A;  2HS5 A;  1FYK A;  2ISY A;  3P9I A;  4ESF A;  2JRT A;  2A6E F;  3E97 A;  4KIF A;  3OV8 A;  3RKY A;  1D5V A;  3P9C A;  1WRJ A;  5FO5 A;  2GA1 A;  2KIM A;  3ECO A;  5FGM A;  1RUO A;  3GLX A;  5E1W A;  4N9H A;  5CLS A;  1BI0 A;  2K27 A;  1O7F A;  1UHM A;  4RGR A;  2Q8K A;  2DPD A;  4R1H A;  3CUQ A;  4ESB A;  3F8F A;  3JTG A;  2F5D A;  2ISZ A;  2EA2 A;  2IRF G;  4MQV A;  2VT2 A;  4IF4 A;  4I98 B;  4UUV A;  1G6N A;  3HIF A;  4IJA A;  1VTN C;  2BGC A;  3V8K A;  3R0J A;  3D0S A;  1RUN A;  2HKO A;  1RNL A;  1DUX C;  1U5T C;  1CGP A;  4LGW A;  1IN7 A;  3GYH X;  1OYY A;  4KIB A;  2VC1 A;  2EA4 A;  4HOB A;  2YR2 A;  1XSD A;  3BOQ A;  3DP7 A;  1BN5 A;  4EJT A;  3L00 A;  2L4A A;  1XMA A;  4Q4Z F;  5TRD A;  1H9G A;  1FSE A;  3V7C A;  4BYY A;  3U9G A;  2NNN A;  5ILU A;  1XSV A;  1SMT A;  3C7J A;  4LLN A;  4AIH A;  3R4K A;  3KZY A;  5K5Q A;  4O3M A;  4QWQ A;  5L3C A;  1ON1 A;  2FBI A;  3FM3 A;  1REP C;  4WX9 A;  1UHW A;  5L3E A;  2H27 A; 
#chains in the Genus database with same CATH topology
 2W7N A;  4UV9 A;  3L2V A;  2Y0S A;  5HNF A;  1SFU A;  4NDL A;  3B02 A;  1TW3 A;  2QKM B;  1B8I A;  1ZQ3 P;  4LB5 A;  5GTH C;  5LGT A;  3KP2 A;  3M4O J;  3ESW B;  1TQP A;  3ZMV A;  3REO A;  1GV5 A;  1IAW A;  4OIO F;  5F08 A;  5CKT A;  4C3I J;  2HVR A;  4HST A;  4LK1 F;  1P4A A;  1OCT C;  1X1B A;  5CJ9 A;  2CS3 A;  1VQ9 I;  1PVE A;  5FLX Z;  2E19 A;  5CQE A;  2FA5 A;  3QP5 A;  4XIC A;  1AHD P;  3JRH A;  4HSR A;  1IG7 A;  4KJZ A;  2H1K A;  1OKR A;  1W0U A;  1R9T J;  3K4K A;  2AO9 A;  1Z3X A;  2L3D A;  3CF5 F;  2XB5 A;  3J7A Y;  4IHY A;  1F1Z A;  2VJJ A;  2VT3 A;  3WHB A;  1ETX A;  3ZN0 A;  5K5R A;  2OBP A;  2RN7 A;  2X4H A;  4RB2 C;  1STZ A;  3MN2 A;  2K4B A;  5DD8 A;  3S93 A;  3Q5F A;  3TDZ C;  2YU3 A;  1IXS B;  3I5U A;  3TO7 A;  1Z67 A;  4XLA A;  1IGN A;  1Z21 A;  3SZT A;  2EWN A;  4DOZ A;  3UNG C;  5HLT A;  3IC7 A;  2VOO A;  3AL0 C;  2ELJ A;  2CFX A;  2P4W A;  3ABT A;  4EV0 A;  2X0L A;  5D6E A;  3TW6 A;  2OC6 A;  2DJN A;  3OYI A;  1HXD A;  2BE5 F;  3WTV C;  2V9P A;  4AM3 A;  2JMW A;  3OYE A;  2IEK A;  3DEW A;  3EUH A;  5D5U B;  2GOX B;  5FD6 A;  1RI7 A;  2W84 A;  2LBF A;  3S3N A;  3R60 A;  1LB2 A;  1QNT A;  9ANT A;  4YFK F;  3F72 A;  3BCA A;  1Y6I A;  4JYK A;  1ZGW A;  4ENJ A;  3L2U A;  2L9V A;  3C1D A;  1QHH D;  3FWE A;  2VON A;  5D5V B;  3S2H J;  2HPM A;  1X1C A;  3IWF A;  4BY1 J;  1O7L A;  1WJB A;  3A03 A;  1YQA A;  4PJN A;  4AYB N;  2Y9Y A;  2ZBK A;  5BQT A;  3LAP A;  3TO6 A;  2P7C B;  1JXS A;  3I4P A;  1R22 A;  1SFE A;  3VOE A;  1TP4 A;  1IRX A;  1TWF J;  2Y0S N;  3K4C A;  3V7R A;  2A07 F;  3QYB A;  4UB6 C;  2M0M A;  1G2H A;  3LWF A;  3KEQ A;  4LFU A;  4J19 A;  3ZQQ A;  1HW5 A;  3ZQG A;  2E1C A;  3HKZ A;  2JT1 A;  4II2 A;  5DCM B;  2OPT A;  3RZO J;  4BQO A;  3K0L A;  2GLO A;  5B3S H;  5KAF C;  2ME0 A;  4QPO A;  2STW A;  1Z91 A;  3KZZ A;  3GX4 X;  1W5C C;  3W2A A;  4OMZ A;  2O7O A;  1WH7 A;  2FF4 A;  2XUB A;  2BXY A;  1P2F A;  2M45 A;  5J4Y A;  5E1X A;  3LA2 A;  2NXN B;  3CCS I;  2LDU A;  3F8C A;  4BGD A;  5L3G A;  2NNY A;  4IX7 A;  2PBI A;  3S32 A;  3H35 A;  1X3U A;  1X3W B;  1R4N B;  3DV8 A;  3QOP A;  1OCC H;  3HSE A;  3QYE A;  4F92 B;  3COA C;  3OSG A;  3PO3 J;  1D3Y A;  3K4M A;  3WTZ A;  3HRU A;  2HDD A;  3LSR A;  3ZQL A;  4G6Q A;  2RAE A;  3C2H A;  3BG6 A;  4ZZD A;  2BOL A;  2V9K A;  3QU3 A;  5IPA A;  5JLW A;  4BNC A;  4H0E A;  3HRS A;  1P4X A;  2W48 A;  5E3O A;  4HRI A;  2V1D A;  2V7F A;  1OCO H;  2AS5 F;  2DLL A;  3FDY A;  1RPW A;  2DYR H;  4CCN A;  4B3A A;  3G71 I;  5DUI A;  1SVM A;  3DU5 A;  5J1Y A;  4L18 B;  3T0Y A;  2CUZ A;  4IL6 C;  2NAZ A;  4O6J A;  1WWX A;  2KRF A;  1WJA A;  3EYI A;  5J40 A;  2QZ8 A;  2P6S A;  1MW7 A;  4YIF A;  1APL C;  4U0Y A;  2UXN A;  2E1M C;  3DKY A;  1MD0 A;  2RQQ A;  1RKT A;  2TDX A;  5DV5 A;  2HTJ A;  5LEJ A;  4G7Z F;  2F5V A;  4D0P A;  3DFG A;  2VQL A;  2DK5 A;  1LUJ B;  4EM1 A;  4Y15 A;  4RB1 A;  2WTE A;  2PJP A;  3BQY A;  4YG2 F;  1MSE C;  3FF5 A;  4QIW N;  3H5N A;  1PUF B;  5TGT A;  3ZXS A;  3BP8 A;  3LSM A;  4CYD A;  4BHC A;  3HKZ N;  1YLF A;  1MZB A;  4E7J A;  5DCM A;  5IYB J;  1DDN A;  3PNT A;  1I6X A;  2QA4 I;  3PSI A;  5FKN A;  2CW7 A;  2HVQ A;  2BY2 A;  4LIT A;  3JR9 A;  1Z05 A;  3KP5 A;  2COM A;  5CVJ A;  3SEZ A;  1EKE A;  2OUM A;  3IRR A;  2IJL A;  1QA6 A;  3PSF A;  2QQ8 A;  1J9I A;  3QPL A;  2BY3 A;  2DQL A;  1SC7 A;  3DCF A;  4DBQ A;  1U5T B;  2FD5 A;  4IRG A;  4ABZ A;  1XTA A;  5GPA A;  5E3L A;  2XIG A;  2CUJ A;  4L9N A;  1G3Y A;  3ZMZ A;  1QBJ A;  3HSF A;  3QQA A;  1K7A A;  2CW0 F;  1FZP B;  3IH4 A;  3BR3 A;  2Z16 A;  5F6F A;  4I76 A;  4U88 A;  4IEJ A;  3LOC A;  2F4M B;  2VOP A;  1TWA J;  1ZAR A;  1QGP A;  4XLN F;  1ON2 A;  2DA3 A;  3WGI A;  3G4S I;  3RTR A;  3ASO H;  3F23 A;  4U7D A;  3MKW B;  3L2C A;  1U3E M;  2LY1 A;  3FBN B;  5D4R A;  4HQM A;  2MA3 A;  4A93 J;  3OYF A;  4ZTJ A;  4BL0 B;  4W97 A;  3NRV A;  2CMP A;  2EJR A;  3BG7 A;  3KEY A;  2M2E A;  3V42 A;  1LEB A;  4RDU A;  2O03 A;  4KMF A;  3GBG A;  4UV8 A;  4XOT A;  1FTZ A;  1BL0 A;  3D5L A;  3H3U A;  3DBL B;  2BV6 A;  1JJ6 C;  3HGY A;  4LK0 F;  4D1Q A;  2GIV A;  1W0T A;  3GFI A;  4YFX F;  3V8J A;  2R93 J;  2H27 A;  4B8X A;  3LA3 A;  5EGO B;  4XLP F;  1QPI A;  3GTL J;  3DPT A;  3EUH C;  3B6C A;  1Z9C A;  4I01 A;  1XCV A;  3GME A;  5D6F A;  4PSX A;  3V8L A;  2CSO A;  2DOA A;  5HNH A;  1T98 A;  3S1R J;  2MLK A;  2G9W A;  1ETV A;  1Y39 A;  4A3K J;  1YW8 A;  1A31 A;  1JE8 A;  2WAQ A;  5F0C A;  3WG9 A;  1MMG A;  4IO9 F;  2L7K A;  2E2I J;  1ZTR A;  3F6V A;  3MZ8 A;  3GZ6 A;  1I5Z A;  3HOV J;  1BI3 A;  1XMK A;  2M0C A;  3HUG B;  3LL7 A;  3K1N A;  4A3I J;  1S9H A;  4CXF A;  2AXL A;  3HDD A;  1TBX A;  5H6Q A;  1FJL A;  3Q9V A;  4PFP A;  1JGG A;  1VFC A;  1GDT A;  3LQR A;  1O3R A;  1IV6 A;  1PJR A;  3W2W A;  3G3Z A;  5FRM A;  3TOA A;  3FZV A;  2ESN A;  4BY7 J;  1MNM C;  2ZB9 A;  2DXI A;  1ETO A;  3GO5 A;  4IHW A;  2F2E A;  4YEJ A;  2GWR A;  4WXD A;  4A2U A;  1B9M A;  5FB2 A;  5AIP A;  3KX2 A;  5CVI A;  1O3T A;  4L0Z B;  4CZZ A;  2A6T A;  4X1E A;  3WTY C;  4B3X A;  3WTX C;  3FK6 A;  4XSZ F;  5E79 C;  4WF2 A;  3FXU A;  3TBI A;  1SAX A;  4PUS A;  3I55 I;  2GQQ A;  3CLQ A;  4FX0 A;  1GV2 A;  4BHB A;  4N0B A;  4YII A;  2VOD A;  2VB6 A;  3Q0W A;  2DA6 A;  1XS9 A;  1S7E A;  3DF8 A;  1JUM A;  3OOU A;  1YS7 A;  2LKX A;  4BJT A;  2BZT A;  3BWG A;  4RA2 A;  1OFC X;  3PUF A;  2XPU A;  4EM0 B;  1Q1H A;  4BXU A;  1A6Q A;  2XAS A;  2GXA A;  2VE8 A;  1M1E B;  2V9V A;  2K3F A;  2UXX A;  4BS9 A;  4E7I A;  3MAJ A;  3LSG A;  3E5Q A;  3M7G A;  5EEH A;  4GYG A;  2DT7 B;  1LEA A;  5EGO A;  4AVP A;  3CD6 I;  5LHI A;  4HLY A;  4XKW A;  4E4H A;  2CWE A;  2DA1 A;  1P6R A;  4M9S A;  2V79 A;  4Z6Y A;  2X85 A;  2RQP A;  3E1S A;  3OYL A;  1FBU A;  4WWC A;  2IGM A;  4HX8 A;  5GTI C;  2NVY J;  5E18 F;  2KIS A;  2FUG 2;  5FLX K;  2KFD A;  2EZI A;  5HDK A;  1D5Y A;  2BW3 B;  1AWC A;  2WAQ N;  1FNN A;  4XM3 A;  1JHF A;  3OYK A;  3SFI A;  3TOB A;  4OIR F;  3I64 A;  1ZG1 A;  2H8R A;  1TZL A;  2BVM A;  2CU7 A;  3Q0U A;  4N4N B;  3HUG A;  1A6I A;  2B0L A;  3KP3 A;  1V54 H;  4JBA A;  2EBI A;  4GO1 A;  2Y31 A;  2CQN A;  5ICF A;  1QPM A;  4RGU A;  3PJR A;  1BJA A;  2DMU A;  4RLQ A;  3PIP F;  4L9J A;  3FHZ A;  1XX5 A;  4AIK A;  1ZR4 A;  5GAH J;  1SFO J;  4M6X A;  2B63 J;  2V4J C;  1LPQ A;  1DP7 P;  1D1C A;  1W5T A;  1MMA A;  1Z3Y A;  2DBB A;  2K02 A;  3IKV A;  1LQ1 A;  1IN6 A;  2JA6 J;  1IUY A;  1A04 A;  4K2E A;  3LQQ A;  3QYF A;  4HF0 A;  4CCO A;  5HS7 A;  3TL4 X;  4G7H F;  1U78 A;  1OMI A;  1HBX G;  3HOY J;  3P9K A;  2KLO A;  3OS0 A;  3SXY A;  1ZRC A;  2HEO A;  3FMR A;  1VQN I;  3A1Y A;  3EYY A;  3CCQ I;  3E6M A;  4C30 A;  1YG2 A;  1WKM A;  3E6C C;  4PK4 A;  1KYW A;  3CMA I;  1XG1 A;  1XGN A;  3I3L A;  3RPU A;  2E71 A;  1C0W A;  1FIP A;  2KRC A;  2WB1 N;  2CQX A;  2H1L A;  3QPH A;  4Z2Y A;  4F7Z A;  1ZEL A;  4IHS A;  4JX5 A;  5HS8 A;  1O3Q A;  2GA2 A;  4G94 A;  3TDU C;  1R36 A;  2Y2Z A;  3HPH A;  2XPW A;  1YIJ I;  2PQ8 A;  1GUU A;  4HX4 A;  2R7F A;  3WU1 B;  2X6Y A;  3H0G J;  1MJ9 A;  1GVJ A;  3GTO J;  5CYV A;  3HOW J;  5IP9 J;  1FMW A;  4A3E J;  4F55 A;  1R5I D;  1YJ9 I;  1BJZ A;  3ZMU A;  1QVT A;  2VPR A;  4AU7 A;  1OLT A;  1HKT A;  1WVR A;  2JA7 J;  1BI2 A;  3TQN A;  4M73 A;  3HOS A;  2DDA A;  2BW3 A;  2L02 A;  3FKJ A;  5LRS A;  2ACJ A;  3K70 C;  3MZY A;  1WJF A;  1VQL I;  4EAT A;  4IRH A;  3RKX A;  3ZQF A;  1IXR C;  4JK1 X;  4OOI A;  3DEU A;  2LSO A;  1BI1 A;  2Y0M A;  3MFK A;  2JA5 J;  4YRV A;  4PCQ A;  1GT0 C;  3CCU I;  5B5E C;  4RB0 A;  1P4W A;  5F1R A;  2ELK A;  4ASN A;  4LB6 B;  5FD5 A;  4OIP F;  2ECB A;  3WTS C;  3OOP A;  4HF1 A;  3BR2 A;  2W25 A;  1JT6 A;  4PFO A;  2HYF A;  5LEK A;  1HW2 A;  1OQY A;  1FBS A;  3RYP A;  2IBD A;  3O2P E;  1D8J A;  1AOY A;  4BJ6 C;  5J8F A;  2ELH A;  4B09 A;  2HYG D;  2M8G X;  3BJO A;  1YI2 I;  2L9N A;  1QZZ A;  2F5C A;  3HG9 A;  3WGG A;  1FP1 D;  5KAI C;  1DPU A;  2B9S A;  3WTW C;  1HDD C;  2F5E A;  3IH3 A;  4ZH4 F;  5FLM J;  2EIM H;  5L3D A;  4FET A;  2LR8 A;  3S3O A;  5E8G A;  4KMU X;  2R0Q C;  1DGW Y;  2LLK A;  5GAG J;  2ID3 A;  3C3W A;  4FX4 A;  4KIS A;  1X58 A;  3I54 A;  4MNU A;  1N25 A;  2OQR A;  2FBH A;  2HDC A;  4UVB A;  2KQR A;  1JGS A;  5HVQ C;  3ML6 A;  2HI3 A;  1VI0 A;  2A5Y B;  1R4M B;  3KET A;  2R7W A;  1IRZ A;  4IPA A;  1V5F A;  4D7N A;  4UNO A;  1QHG A;  3WU2 C;  2YX7 A;  3GFJ A;  1TW2 A;  4G8X A;  2LK2 A;  3SQN A;  3W6K B;  4UY8 I;  2L0K A;  2W57 A;  1RR8 C;  5AIQ A;  1GXQ A;  2EFO A;  2WV1 A;  1YW7 A;  4A0Z A;  5EEG A;  1KZH A;  3CES A;  4IQJ A;  2BHY A;  2WWY A;  2QCO A;  5JI6 A;  2VI6 A;  2EZK A;  4RAG A;  3JSP A;  2VJ4 A;  1A36 A;  3GLL A;  1R00 A;  3DU6 A;  1X4O A;  3FBI B;  1Y8R B;  5GAD J;  2V1U A;  4C2M J;  3FKI J;  3GWZ A;  1R49 A;  3HZJ A;  3QAH A;  2MD5 A;  3CJR B;  4UUS B;  1L3L A;  1JUS A;  2BVL A;  1RES A;  4A5N A;  3MKL A;  1Z6T A;  2QGU A;  3EQL F;  2LFB A;  4U0W A;  3GEZ A;  3SYT A;  2E2H J;  3R61 A;  1R1U A;  4IQ4 A;  2K7L A;  3ZQ7 A;  2GAU A;  2HOE A;  4LIU A;  1SFX A;  3KYD B;  4HZF A;  2ZXI A;  3BQZ A;  3PNV A;  4DNC A;  4FTH A;  2WY7 Q;  3CLO A;  4Y4R A;  1G3S A;  1MBE A;  4BQQ A;  1YIT I;  1XGO A;  3DBR B;  3ABM H;  3SDG A;  2LG4 A;  2NVU B;  4FT8 A;  4KNY A;  4HF2 A;  4PDK A;  1FWZ A;  2Z33 A;  3ZR8 X;  3VYR B;  1FIA A;  2XVC A;  2MD0 A;  1TWG J;  3AG3 H;  4ON0 A;  1OJL A;  5CVR A;  3U21 A;  3FXK A;  1VQM I;  1TLH B;  3KLN A;  4JX4 A;  1LE8 B;  5IT9 K;  3PL8 A;  4HDU A;  5IOY A;  1POG A;  2DMP A;  1IF1 A;  3HYI A;  1KU7 A;  1SD5 A;  1GXP A;  2AXT C;  3WHC A;  3ZRG A;  3T8R A;  3DWL E;  2WY8 Q;  1BOB A;  3HL2 A;  2GZW A;  2F5F A;  2PMU A;  2HWV A;  4BBR J;  1S72 I;  2QQB A;  2HDW A;  4QSH A;  1RZ4 A;  2RC4 A;  3MCZ A;  1S6L A;  5B66 C;  1BR1 A;  2OF7 A;  3JAM K;  1U6G A;  5LHH A;  4A0X A;  2OQG A;  1MBK A;  5L3F A;  1UCR A;  2BBY A;  4XLF A;  5BS6 A;  3HTS B;  2QSF X;  3ZP5 A;  1EH7 A;  2VQC A;  3HRM A;  2D1V A;  2HOS A;  2PEX A;  5KK1 A;  4L5I A;  3G2B A;  2IS2 A;  2VJI A;  2E34 A;  1MGT A;  4ZYG A;  4LLL A;  2R5Y B;  2DFI A;  3FXR A;  3X2Q H;  2R7Z J;  5IP6 A;  2JSP A;  1ZK8 A;  4EEF G;  1KQ0 A;  2NOG A;  2DFH A;  2L4M A;  2IW5 A;  3BG9 A;  4ENM A;  1K4T A;  4IZZ A;  3QWL A;  4UUS A;  1WJD A;  1XB4 A;  5CVV A;  3GTP J;  1IN4 A;  4M3F A;  1WCM J;  4B43 A;  4BE0 A;  3E5U A;  3F21 A;  3RQI A;  1K79 A;  1T0F A;  5BOX A;  3F8N A;  3DEE A;  1YX3 A;  4IHV A;  1TWH J;  3LAJ A;  2NVQ J;  2ME6 A;  2HQR A;  4M71 A;  4B4C A;  1U8R A;  3IV5 A;  1QZE A;  4A3C J;  2A05 A;  4Y3O A;  4ZC3 A;  3KIO A;  3NQO A;  4XL9 A;  4HA8 A;  1FYL A;  4UHT A;  3BZC A;  2IGO A;  4FE7 A;  1YHQ I;  3M1C A;  2OTL I;  1Q1V A;  1O57 A;  5ILS A;  3HEF A;  3VYS B;  4Q5S F;  4MEX F;  2UV1 A;  4ENN A;  2QKL B;  4XMY A;  3BLY A;  4RMN A;  1B72 B;  2CJJ A;  1BM9 A;  3BCB A;  2QM3 A;  3AKZ A;  2K3P A;  3BPV A;  3GZ5 A;  1LE8 A;  3DLA A;  4RLF A;  4LLG F;  1E3P A;  2FX0 A;  2XB0 X;  2Y48 A;  4L5E A;  1RR7 A;  2M5W A;  2DA4 A;  5J8C A;  1JI8 A;  1T6S A;  2Y9Z A;  4ZYE A;  2D45 A;  3VSL A;  2EV0 A;  1G8X A;  4YIR X;  3CME I;  1LFU P;  2LY9 A;  3HHH A;  2P5V A;  2EZL A;  3FXQ A;  4JX6 A;  1JHH A;  4LD5 A;  4DYR A;  1TC3 C;  1FEX A;  3RQ4 A;  5IY5 H;  3RCO A;  3DXJ F;  4WXH A;  3RPU D;  5D8L B;  2C6Y A;  3K6G A;  4O5V A;  2X6W A;  1V4R A;  1WI9 A;  2QF7 A;  3M8F A;  1WZ2 A;  1SEU A;  3S2D J;  4M3D A;  3CJN A;  3RSN A;  4BHP A;  1BA5 A;  1VND A;  3HBL A;  2XGD A;  1K6O A;  2M87 A;  1H89 C;  1EV7 A;  2MW8 A;  3UR3 C;  2VKE A;  2A5W A;  4KDP A;  1U8B A;  4Y13 A;  2R5Y A;  2R7U A;  2DAO A;  2JPB A;  3FX3 A;  1LVK A;  2Z3Y A;  3F8M A;  5KVR A;  1ITY A;  2M1B A;  2K9S A;  3IL2 A;  2KKO A;  4NBQ A;  4AIJ A;  2HQA A;  2P0W A;  4HNU A;  3S3M A;  3LSK A;  6PAX A;  1O4X A;  2OD5 A;  2MC3 A;  1R5H A;  2NRA C;  4PJL A;  1HW1 A;  2JUC A;  1DP3 A;  4ZJZ A;  3JRF A;  1NK3 P;  3D1N I;  3CCL I;  4MQ9 F;  3DKW A;  4HYE A;  3BG5 A;  4A5M A;  3CTA A;  4NB5 A;  3BT9 A;  4UUT A;  1Z7U A;  3FXJ A;  4GDF A;  5E8I A;  2X1D A;  3TMO A;  2VXZ A;  3H1C A;  4R79 A;  1NH3 A;  1MIJ A;  2M7A A;  4D9J A;  4XOP A;  1Z1D A;  2VC0 A;  1HA8 A;  2E1O A;  2E5Z A;  5EDN A;  1XCB A;  1MDM B;  1VQ4 I;  3F8B A;  4P9F A;  1B9N A;  3HXL A;  3GVA A;  2LVS A;  2COB A;  1WH5 A;  4GYI A;  5F64 A;  1OYW A;  3HRT A;  3OIO A;  2A6H F;  2KIU A;  1G3W A;  4RGS A;  5LBQ A;  1F5T A;  2L7F P;  1OCP A;  3HC7 A;  4C9Y A;  1Z7L A;  2H09 A;  4OIQ F;  3FHN A;  1B72 A;  3CC2 I;  2R4G A;  2YS9 A;  5M5W J;  3H9G A;  3FMQ A;  4A3G J;  2DOF A;  4M6V A;  3HOT A;  2HPI A;  3CCE I;  1FPQ A;  2QWW A;  1D0X A;  1X1A A;  4A3B J;  4U0V A;  2VBX A;  4Y17 A;  3ZMS A;  5E17 F;  1Z6R A;  3CDH A;  2HOA A;  2FE3 A;  4A69 C;  2XKP A;  4MIM A;  3KP4 A;  2PG4 A;  3JRD A;  1WJ5 A;  4XON A;  1S7O A;  3DPU A;  1K6Y A;  2E2J J;  2X6O A;  3GUD A;  1F9N A;  3N4M A;  3IAM 2;  3K4J A;  1MBJ A;  3PFI A;  3OMY A;  3MMY B;  1K83 J;  4E7S A;  3OYN A;  3D5S C;  2V6C A;  2XHK A;  2ESH A;  4AD9 A;  4YFN F;  1KU2 A;  2MSY A;  5TJJ A;  3B73 A;  4OIN F;  1DU0 A;  1TTY A;  2LY2 A;  2L54 A;  3IRQ A;  1YJN I;  2DN0 A;  3WE2 A;  3U1D A;  1YJW I;  5KCM A;  2ZXJ A;  1X2M A;  3P7N A;  2D2W A;  4I99 C;  2LH9 A;  2XSJ C;  1SD4 A;  3K2A A;  1RRJ A;  1ZG5 A;  1MBH A;  1WGX A;  2ICW G;  5GP9 A;  3BTC A;  1ZHF A;  1V3F A;  2RGV A;  4PGG A;  5KNL A;  2YX4 A;  5LGN A;  3ELK A;  1ZGJ A;  4KYW A;  2HZD A;  5FKO A;  2R7V A;  1TNS A;  4EJW A;  3G1M A;  2HFH A;  4HDV A;  2Z9O A;  2D5V A;  1FBQ A;  1N77 A;  2DA2 A;  2X9D A;  4NNJ A;  4L9T A;  4BE2 A;  4OAY A;  1SMY F;  1YE9 A;  3PIO F;  3OIQ A;  3KYC B;  3DKX A;  3H5A A;  3I58 A;  2I8D A;  2QBY B;  1MDM A;  2QEX I;  1EF4 A;  2E60 A;  2Y69 H;  2GOM A;  4LG3 A;  2V6E A;  1ULY A;  2FQ4 A;  1MMN A;  3C18 A;  4CDG A;  3UKG A;  4E70 A;  5CVU A;  1TQI A;  5E1Z B;  1S3J A;  4R8H A;  2L01 A;  2W82 A;  3R6S A;  2XAG A;  1JKO C;  4DYQ A;  1HOM A;  1KA8 A;  1T0F C;  1G59 A;  2FSW A;  3I71 A;  1J5Y A;  1Z0X A;  3MD2 A;  1H8A C;  4DGW B;  3M07 A;  3K2Z A;  3RIR A;  1MBG A;  1I3Q J;  2LKP A;  2XGE A;  4RB3 C;  3BZK A;  4EGZ A;  1S8N A;  1MMS A;  2H8W A;  2CYY A;  2JJ7 A;  2CO5 A;  3ABK H;  3ZOB A;  3F9K A;  2JA2 A;  2K9L A;  3WE3 A;  2L9S A;  2HGC A;  4XNF A;  4DIQ A;  5GAE J;  1HF0 A;  4BUP A;  2MLG A;  2EQR A;  1IUF A;  2DO7 A;  1HSJ A;  2X51 A;  4KT5 C;  1CF7 B;  2KZV A;  1P9Q C;  4I02 A;  3WU0 A;  4BXF A;  2IXS A;  5A2Q Z;  3S14 J;  2O6G E;  3E7L A;  3L2Q A;  2VAS A;  3S2W A;  4XLH A;  3ULQ B;  4PSW A;  3L9F A;  3QRF F;  2J5O A;  2PX9 A;  3DTI A;  1K4S A;  3QPT A;  1UST A;  4I0B A;  5HLI A;  3RPQ A;  2XAU A;  4CZC A;  5D8K B;  3CO6 C;  3HTU A;  1NHA A;  4AWX B;  1ZAO A;  2DMN A;  2R7R A;  4DZP A;  3U2R A;  1FSH A;  2BYV E;  2P5K A;  3BJ6 A;  3CCY A;  3OR1 C;  3H92 A;  3M8E A;  4FHT A;  4XLE A;  2KJB A;  2AHQ A;  4RAF A;  3I0T A;  2E35 A;  3LSI A;  1JKP C;  1NK2 P;  2R3S A;  2L5Q A;  4HX7 A;  3EUA A;  5EJC A;  4NHJ A;  3CP8 A;  2RRE A;  2NYX A;  2IS6 A;  5D5W B;  2CQ7 A;  3RYR A;  1FP2 A;  3JRA A;  1FX7 A;  1FTT A;  2O3F A;  4X0G A;  3O8H A;  5LGU A;  1F43 A;  4GGG A;  1KQ9 A;  1MJB A;  2K9Q A;  2WAF A;  1HCR A;  2QBY A;  3FXL A;  1V55 H;  2EFQ A;  4NC8 A;  1VQP I;  1T2K A;  1WJC A;  2EFN A;  3VEP A;  4JOM A;  1BC7 C;  1ZN2 A;  2HTS A;  1YFH A;  2XC7 A;  1H88 C;  2LD5 A;  2DPU A;  4S0H B;  4KN4 X;  4LJZ F;  1X2N A;  3ZN1 A;  2VBZ A;  3A02 A;  5FFX A;  2HYJ A;  3IUO A;  3EPZ A;  4IHX A;  4NC7 A;  4I09 A;  1KU9 A;  2BHZ A;  3K7A J;  4P9U A;  2GXG A;  1OCR H;  4GXO A;  4CO8 A;  5B1A H;  2A3S A;  2HXI A;  2LKS A;  2DFF A;  5C4J J;  1FT9 A;  5EZH A;  4B47 A;  5ICG A;  4IOA F;  5DEQ A;  1WQ2 A;  1YOV B;  2EV6 A;  1UJ8 A;  3PQK A;  2G7U A;  3IKT A;  2MH2 A;  2F6C A;  4WCG A;  3GTK J;  1OR7 A;  2FXA A;  1CF7 A;  2XGX A;  4W1U A;  2E7W A;  3PO2 J;  1J2X A;  3P5J A;  4MTE A;  2X48 A;  4NQW B;  2RV8 A;  4I0A A;  4CSW A;  3E0J B;  5JHF A;  4B48 A;  2VKH A;  1KON A;  4V2F A;  4A3J J;  2R92 J;  2MGQ A;  2R7O A;  3T5X A;  3BZ6 A;  5DD4 A;  5FLV A;  1F4K A;  2JUG A;  1ZH5 A;  3F6O A;  4ESJ A;  2L9R A;  3H0D A;  3EDP A;  4RM2 A;  1E2X A;  1VQ5 I;  4GCV A;  2CH0 A;  1J75 A;  3TKY A;  1HC8 A;  2LP0 A;  5DCF A;  3CCJ I;  2ZJR F;  1H0M A;  1XDU A;  3K1M A;  3S1N J;  1FC3 A;  2YSR A;  1RC9 A;  1MSF C;  1QZY A;  2ZME B;  4Q48 A;  3TW7 A;  5FRO A;  4CCM A;  4P55 A;  5C4X J;  4UVA A;  1AA7 A;  3C2G A;  3CMY A;  1VQ6 I;  2L7Z A;  3CF2 A;  2WAE A;  3QPS A;  5DS9 A;  3KLO A;  5FKM A;  1KQ8 A;  3FIS A;  2NOJ B;  1AU7 A;  4GFB A;  3H9Q A;  5C3E J;  4M3E A;  5H6R A;  2CRG A;  2XKO A;  4DQ2 A;  5DUK A;  2XRO A;  3V7S A;  3J80 Z;  1V5G A;  3JRC A;  3HOX J;  2DU9 A;  3Q0V A;  2H6C A;  3MEX A;  4II3 A;  2P81 A;  1XSX A;  4L9V A;  3L2W A;  2CGP A;  4MFE A;  1B4A A;  3VPR A;  4XID A;  1X1D A;  5D4S A;  1LKX A;  2VPL A;  1VQK I;  4XN3 A;  3JSO A;  1UZC A;  3CO7 C;  2PLY A;  5J1R A;  2CW8 A;  4J01 A;  2R7X A;  3BPX A;  2W4S A;  2EFW A;  2ZSH B;  3CDI A;  1B59 A;  3DPL C;  2EIN H;  2QLZ A;  3K10 A;  1DPR A;  3MVP A;  3RKQ A;  3H3Z A;  1KU3 A;  1UFM A;  2W00 A;  4CHU A;  1MH3 A;  4DW6 A;  1W4M A;  5JVT A;  1FYM A;  2OZU A;  5M5Y J;  4A3M J;  1PP8 F;  5HS9 A;  1D1A A;  4XSX F;  2NVT J;  2DW4 A;  4JP0 A;  1T39 A;  4C2T A;  3CQZ J;  4PGH A;  1OCZ H;  1E3H A;  2IT0 A;  3GZN B;  4M72 A;  4PJ0 C;  3HOZ J;  2WV0 A;  3BDD A;  4NQW A;  3L7W A;  5HDG A;  2IA2 A;  4IVN A;  1RET A;  3SZG A;  4NC6 A;  5HDN A;  1FOK A;  1I50 J;  2CFO A;  1R1T A;  3T1B A;  3JRB A;  5CPR B;  1Y0N A;  2QQ9 A;  1LJ9 A;  1DGR M;  2FU4 A;  3IHU A;  2M34 A;  5DM7 F;  3LST A;  1Z77 A;  5EYR A;  2R7Q A;  3KCC A;  4M6Y A;  5F0F A;  5DYM A;  2OAZ A;  2XF5 A;  1JKQ C;  3CZ6 A;  1SAU A;  3TED A;  2CV1 A;  3I56 I;  2VXD A;  2G0E A;  2DTR A;  5LRR A;  2QSH X;  3GTG J;  4C3H J;  2DMT A;  2K9M A;  3TO9 A;  2DT6 A;  2Z2S B;  4LMY A;  2ZME A;  2Q1Z B;  2ADU A;  1KGS A;  2A61 A;  1A5J A;  1IZ1 A;  3LA7 A;  1GVD A;  2FNP A;  4A6E A;  4HPQ A;  2OTJ I;  4XKV A;  4HAM A;  3B6A A;  1YX5 A;  3JRG A;  2OCC H;  4IHT A;  1W7P B;  2LMD A;  1PYV A;  2NS0 A;  1XGM A;  2IS1 A;  3J7A O;  2M30 A;  3VDX A;  4FIS A;  2Q0O A;  4CGZ A;  2KJC A;  2KIF A;  2H94 A;  3WG7 H;  3OYA A;  3IAS 2;  3BRO A;  3LFU A;  4E6K G;  3L09 A;  4A3F J;  4HEA 2;  1TNT A;  2F4O B;  2EV5 A;  2FNA A;  4KFC A;  2DA7 A;  3J81 Z;  1ZLK A;  1UG0 A;  2QQA A;  2B7E A;  1K78 B;  1J09 A;  1IXC A;  4L0Y B;  2VLA A;  5JLX A;  4DBR A;  1R58 A;  2HZT A;  1V5E A;  2PJR B;  2R7S A;  3PM1 A;  3J7Z I;  2KDO A;  3BR0 A;  2X1C A;  2QUF A;  2DOD A;  4XKB A;  3ZQH A;  1ZRF A;  1SD7 A;  1MND A;  1NG6 A;  1FLI A;  1IDZ A;  1WFX A;  2ECC A;  1QO0 D;  1ZRD A;  4I6Z A;  1LFB A;  4U7B A;  3OWT A;  2WA0 A;  2PI0 A;  1OPC A;  2JZY A;  1R71 A;  4Y33 A;  4AYB A;  3PUB A;  2K86 A;  4XOR A;  2HXO A;  1B1B A;  3BC8 A;  2UWM A;  1ZYR F;  1ETK A;  4HNT A;  1VZ0 A;  2PN6 A;  4MEY F;  4AID A;  1ETW A;  5BNG A;  1TQM A;  4F3Q A;  4Y7N J;  3OSF A;  1FOX A;  3CCM I;  3N97 A;  4RBO A;  3GFL A;  3WTT C;  4KIG A;  3CP2 A;  2XGC A;  4OU0 A;  2DQR A;  1MKM A;  2DMQ A;  4LIV A;  4ZDL A;  2DDB A;  2NS8 A;  2MC4 A;  2OV7 A;  1MBF A;  4EMS A;  4ZDO A;  1OIS A;  3RJP A;  2VE9 A;  3QP6 A;  5ICE A;  3OY9 A;  3JTH A;  3CJT B;  2M4K A;  3GF2 A;  1OR7 C;  2M3A A;  1T33 A;  2XAJ A;  2E1N A;  2VJ5 A;  1GLN A;  1X19 A;  3K69 A;  3WOD F;  4XLC A;  3OS1 A;  3K4B A;  1OYI A;  1P7I A;  3K4N A;  2EIL H;  4E7K A;  1XN7 A;  2K4J A;  3T8T A;  3L1P A;  4LG0 B;  4G7O F;  2WBM A;  1ONV A;  2K9N A;  1W7P A;  2MG4 A;  2KIQ A;  2W85 A;  5J4V A;  5IYD J;  4BJ5 C;  1R1V A;  2ETH A;  3KZI C;  5J1U A;  2ZXH A;  3MQ0 A;  3RKW A;  1J0R A;  3O3K A;  3GTM J;  3HJE A;  4WXC A;  2E7X A;  3AG2 H;  1HST A;  1LFP A;  2CV0 A;  2XRN A;  3CC4 I;  3I9V 2;  4RS8 A;  3KYL A;  2XAQ A;  1ENH A;  1K78 A;  3ECH A;  2XV4 S;  2LRD A;  2EPF A;  1JTX A;  2ZJ2 A;  4UXN A;  2PJR A;  5IT3 A;  2VIX A;  5E20 A;  1IJW C;  2O8X A;  2RKH A;  2LF8 A;  5LLQ A;  1ERD A;  2M8E A;  3ERE D;  3K9T A;  1LDD A;  3F22 A;  1XMX A;  4XR6 A;  1AKH A;  4L5J A;  1HQC A;  4E7L A;  1I3A A;  3FM5 A;  3SFZ A;  3OYC A;  3L2R A;  3GW2 A;  3G73 A;  5A2Q K;  1Y1W J;  2R7T A;  3M1E A;  2HR3 A;  1QRY A;  1YS6 A;  2XF7 A;  2Z1D A;  1VQ7 I;  4XQF A;  3VSK A;  3S15 J;  2HOT A;  3QOD A;  2JN6 A;  4J00 A;  3W6J B;  4A3L J;  1D8K A;  4E7H A;  4CYC B;  2PMH A;  1TWC J;  2IA1 A;  5HLH A;  1T38 A;  3FXO A;  1YYV A;  2V1N A;  2PFB A;  3S1M J;  3A0H C;  1SVO A;  5F27 A;  1ZGA A;  2JRM A;  2KPM A;  5D5X B;  4S05 A;  1PUE E;  4WK8 F;  4N4O B;  2FOW A;  4HG2 A;  1HKS A;  3VFZ A;  4CCK A;  5ERI A;  3ZCO A;  3IWZ A;  2EZH A;  2ZC2 A;  1MH4 A;  4LOC A;  1Y56 A;  1BW6 A;  2X6X A;  5BPD A;  3CCR I;  2KRH A;  3ROU A;  4A12 A;  2ID6 A;  2M4G A;  1EH8 A;  3CUQ C;  2QEN A;  4OAZ A;  3OL3 A;  3OYD A;  3ZQI A;  2DK8 A;  1FMV A;  2Z5U A;  4HQE A;  1NG7 A;  1J59 A;  2ZCW A;  3F3X A;  4LG0 A;  5K7F A;  2Y75 A;  3OS2 A;  2CQK A;  3I53 A;  4MO7 A;  3BR1 A;  3RI4 A;  2OJE D;  1IDY A;  3ASN H;  1S7A A;  1G3T A;  2GBY A;  1YW9 A;  2ZKZ A;  1IRF A;  2RNJ A;  1BR4 A;  3KP6 A;  4MFD A;  1XGS A;  3MZH A;  3E6B A;  4CA0 A;  2P6T A;  2F48 A;  2W1O A;  1I39 A;  2FMY A;  5BPI A;  2IA0 A;  5E3M A;  1PP7 U;  1S29 A;  4RAY A;  2IVM A;  5EG0 B;  3CDL A;  2BY1 A;  2ZME C;  3ZMD A;  5FJ8 J;  2ZNZ A;  3S16 J;  4QTR A;  2VBW A;  1TT0 A;  1IO2 A;  2ZFU A;  1E0E A;  2IGN A;  1IC8 A;  4BU2 A;  5HOO A;  3ABL H;  3LMM A;  4S04 A;  1SAN A;  5AON A;  3OYJ A;  2JK3 A;  3ISP A;  4A0Y A;  2JVG A;  2FEZ A;  2XSD C;  2TCT A;  5HOD A;  2STT A;  1IV8 A;  2F4I A;  3DTK A;  4Y52 J;  4MGR A;  3NAR A;  3VOD A;  4MTD A;  2FML A;  4RAZ A;  1RKW A;  3AG1 H;  4HLX A;  4KA4 A;  1KYZ A;  4BBS J;  4HW0 A;  2X1E A;  2HVS A;  5FFZ A;  2EIK H;  3G1L A;  4HV5 A;  4CYC A;  1W5S A;  1HLV A;  4HBL A;  4IRI A;  4EJU A;  1BR2 A;  2KP6 A;  2Y30 A;  3LFK A;  4UVC A;  4EVI A;  5EEA A;  2UZK A;  4XBF A;  2TRT A;  1I6H J;  1HKQ A;  2EFP A;  2HNH A;  1LNW A;  4BDY A;  2FQ3 A;  2VBY A;  2KDZ A;  4MHG A;  5JFR A;  4BAC A;  5IP7 J;  2O5R A;  2DA5 A;  3HGG A;  4EQQ A;  2A69 F;  3LSP A;  2WC2 A;  1BIA A;  3O8G A;  4BXX J;  1MMD A;  2P7V B;  3D5R C;  4ANJ A;  4CIC A;  2BY0 A;  1LDJ A;  1N75 A;  1IW7 F;  5F1J A;  2BXZ A;  4IKF A;  3AFH A;  2I5U A;  1W36 C;  2XRL A;  5HLG A;  4P5O A;  2DFE A;  2HKX A;  2O61 A;  4UB8 C;  4YEL A;  2JVH A;  3ZMT A;  1P92 A;  4XKC A;  1CQT A;  2W24 A;  3KFW X;  4B1R A;  3KEO A;  2D1H A;  1L0O C;  4P96 A;  3J80 K;  3ABU A;  4XRF A;  3A01 B;  4EJV A;  3OYG A;  2VQG A;  1EJ9 A;  2O0Y A;  5CQG A;  1ZG3 A;  1DU6 A;  2M9H A;  4TV7 A;  3ONQ A;  2DJI A;  3V4G A;  3OL4 A;  2GXB A;  2N8G A;  3GCM A;  5LD2 C;  4U87 A;  1NTC A;  5DTD A;  4M3G A;  4GRI A;  2ZSI B;  5IT9 Z;  5EG0 A;  2IAI A;  2WAD A;  1W1W E;  3DTE A;  2V26 A;  1T56 A;  1U9O A;  3JW4 A;  4FCY A;  1ZLJ A;  1LVA A;  5H20 A;  4CCJ A;  4BQA A;  1EH6 A;  4F91 B;  1I1S A;  4KIC A;  1ORK A;  1WJE A;  1BBY A;  2OZ6 A;  1WPK A;  3HPG A;  4EM2 A;  5K1Y A;  2Z99 A;  1ZKG A;  2DYS H;  3GXO A;  3BJA A;  4FE4 A;  4RGX A;  3I59 B;  5ED4 A;  4XRS A;  3JAM Z;  4CH7 A;  5M3M J;  4KN7 X;  5L3B A;  2VKV A;  3FIW A;  1T8I A;  4PJM A;  4F52 A;  1SFK A;  3TP0 A;  3BG3 A;  2CQQ A;  3AAF A;  2ZJP F;  1YTY A;  2EK5 A;  1U2W A;  2JTV A;  3W6V A;  2IGK A;  3CMM A;  1FOY A;  3Q3S A;  3C2B A;  1YRN B;  4DYC A;  1QQI A;  2EH3 A;  3J7Y J;  1PUF A;  1USS A;  4M9Z A;  1ODD A;  2I10 A;  2HU9 A;  4BH9 A;  4FAS D;  3S17 J;  1I27 A;  3A2K A;  1S5L C;  1R23 A;  3HHG A;  2MYS A;  1Y0U A;  3M9A A;  1W36 D;  4X6A J;  2VL8 A;  1U0J A;  2LTP A;  1XD7 A;  4G6D A;  2NVX J;  5EF6 A;  3HSR A;  2DT5 A;  2QSG X;  3E3V A;  2YPR A;  5ILV A;  2K85 A;  2P8T A;  4CUG A;  1JT0 A;  3MWM A;  1H9T A;  4PJJ A;  4HNV A;  2XAH A;  2G7H A;  4D7M A;  3GFM A;  4M3B A;  3CC7 I;  1BW5 A;  3K1P A;  1U5T A;  3BR5 A;  4A3D J;  3H36 A;  5LHG A;  1MNE A;  4F93 B;  3TP3 A;  2HQ5 A;  2FBK A;  4G12 A;  4ZDP A;  4KIT B;  3R0A A;  4A6D A;  3W2V A;  1YO5 C;  1R7J A;  3TGN A;  3NWT A;  2RVC A;  3IP4 B;  2OA4 A;  3KP7 A;  3N05 A;  3NEU A;  1XPX A;  1JKR C;  2ZNY A;  1PDN C;  1VQ8 I;  1F36 A;  2IP2 A;  2VUM J;  2OCE A;  5C44 J;  2MFZ A;  3QU6 A;  3A01 A;  1N78 A;  1XC5 A;  3AL0 B;  1IRG A;  3CCV I;  4NUB A;  1J7K A;  5M5X J;  4HV6 A;  4ETS A;  4IXA A;  4KT6 A;  2ZFW A;  1RIO H;  1EA3 A;  2UUZ A;  3J81 K;  5DDG A;  1W7P D;  2DI3 A;  4M74 A;  2QYO A;  1BIB A;  3ERM A;  2L7M P;  4DZJ A;  2JQ7 A;  4G9Y A;  1FY7 A;  2P5L C;  5BMZ A;  3VB2 A;  3LSJ A;  2Q2E B;  2XPV A;  3H3V K;  2WB1 A;  4D5F A;  4G6T B;  2MAB A;  4PZJ A;  3WGH A;  1I1G A;  4BAY A;  4DJA A;  3OR2 C;  1D0Z A;  2J5P A;  1E17 A;  3WTU C;  1O3S A;  2JPC A;  3Q9S A;  1ZRE A;  3FXM A;  3I59 A;  1R5G A;  4XRM A;  1UMQ A;  1E3O C;  1MJA A;  2KZG A;  4QLC U;  2KHM A;  2EB7 A;  4ZYD A;  1YIO A;  2GM4 A;  3FMS A;  2O9L A;  2XAF A;  1UEL B;  4AC0 A;  2CUE A;  5J3L A;  5F0H A;  1LDK B;  3DLL F;  5IOZ A;  1UAA A;  4M9X A;  2ZJQ F;  1YRN A;  3RDI A;  2VN2 A;  3DQV C;  5K5O A;  2HQN A;  1G4D A;  1Y1V J;  1T08 B;  3E5X A;  2H6B A;  1UG2 A;  2JSC A;  3A4C A;  2VQH A;  1WSU A;  2LF7 A;  5JVG F;  5JHU A;  4OMY A;  2MBF A;  5F04 A;  3SZP A;  4V19 K;  2E5N A;  1VQO I;  2KT0 A;  4AUX A;  4I7H A;  4C3J J;  3OYM A;  3BTL A;  2PMZ A;  2LC2 A;  1D0Y A;  1VF9 A;  2LOO A;  4ENK A;  2EIJ H;  5FKK A;  4ZZL A;  3ZQC A;  3CUQ B;  3O6B B;  2ZXW H;  2XF6 A;  1QVU A;  5EZG A;  2LNB A;  4XN0 A;  5JR3 A;  2IS4 A;  1ETQ A;  3PQJ A;  4E7Z A;  4N9I A;  5J6X A;  2R5Z B;  4RM3 A;  5K7H A;  4Q47 A;  1UB9 A;  2A68 F;  2MH9 A;  3JRI A;  5FKL A;  2VKD A;  1IN5 A;  3I4M J;  1B6A A;  1BOA A;  3KE2 A;  4EJO A;  1GHC A;  2QVO A;  2ZO4 A;  2IPQ X;  3S8P A;  2KL4 A;  3SEQ A;  2DOE A;  1TT5 B;  4H4K C;  3SHF A;  2YU9 J;  4B44 A;  3M8J A;  2RDP A;  2LRE A;  4EGY A;  4I2O A;  3OIP A;  4AVZ A;  1BC8 C;  1XDS A;  3H5R A;  5ICC A;  2Q2E A;  2FRH A;  1ACI A;  2JWT A;  3ZPL A;  5K7Z A;  2BEO A;  3LSH A;  1P7J A;  2V1X A;  2L2O A;  3E6D A;  3EET A;  2FOK A;  4KUM A;  3BY6 A;  1UHS A;  2CG4 A;  2R7D A;  4BDZ A;  2OU2 A;  5B1B H;  1K61 A;  4JQF A;  4BQN A;  5E3N A;  2JA8 J;  2E1M B;  4CCL A;  4ZTF A;  3KPH A;  3CUO A;  1SD6 A;  4ZYH A;  1IN8 A;  2HS5 A;  4MLO A;  3JRE A;  1FYK A;  4OWR B;  5TIS C;  2ISY A;  3P9I A;  1HDP A;  4ESF A;  2JRT A;  2A6E F;  3E97 A;  4KIF A;  3OV8 A;  3RKY A;  3NWS A;  3ZGK A;  1JTY A;  3CJQ B;  3P9C A;  1D5V A;  1WRJ A;  3S1Q J;  3MKY B;  4D5C A;  5FO5 A;  2GA1 A;  2KIM A;  2CV2 A;  3GTQ J;  3G6E I;  3NAU A;  2YUS A;  3HM5 A;  3PNY A;  4V2G A;  3ECO A;  4ZYA A;  4BEH B;  5FGM A;  2CUF A;  1SVL A;  4XK4 A;  1RUO A;  1TL8 A;  2DCE A;  3GLX A;  2E36 A;  5E1W A;  2PMZ N;  3RZD J;  1T95 A;  4N9H A;  5CLS A;  1BI0 A;  2K27 A;  1O7F A;  1UHM A;  4RGR A;  3M3Y J;  2Q8K A;  2K5C A;  1R6R A;  2KMU A;  2DPD A;  4R1H A;  3CUQ A;  4ESB A;  2K40 A;  3F8F A;  3JTG A;  2F5D A;  4ITV A;  2ISZ A;  2EA2 A;  2IRF G;  1B8I B;  1ETY A;  2AQE A;  2VT2 A;  4IF4 A;  4MQV A;  2R5Z A;  4I98 B;  4UUV A;  5GPC A;  5FRN A;  3DBH B;  5LFA A;  3BTI A;  5IYC J;  5M3F J;  2AQF A;  1G6N A;  3MKZ A;  3HIF A;  3VYT B;  2FJ1 A;  5J47 A;  4IJA A;  2DTZ A;  1QU3 A;  1VTN C;  3SJM A;  2BGC A;  3V8K A;  4QPQ A;  3R0J A;  3D0S A;  1RUN A;  3U1K A;  2HKO A;  1RNL A;  1DUX C;  1WHU A;  2XDV A;  3VWB A;  1FOW A;  4C2U A;  1U5T C;  3AG4 H;  1A35 A;  1CGP A;  1X1P A;  2LYC A;  1ZR2 A;  2M7B A;  3A0B C;  1X4P A;  4LGW A;  1IN7 A;  1Y8Q B;  3GYH X;  5KHD A;  1OYY A;  4KIB A;  4BKX A;  2NS7 A;  2VC1 A;  3QOE A;  4IOC F;  2EA4 A;  4HOB A;  2YR2 A;  1XSD A;  3BOQ A;  1X3Z B;  3DP7 A;  1BN5 A;  1D1B A;  4EJT A;  3L00 A;  3PFY A;  2L4A A;  3EUK L;  1XMA A;  3SDB A;  3FK7 A;  4Q4Z F;  3G1O A;  5TRD A;  1JJ8 C;  3F0C A;  1H9G A;  1DQU A;  1FSE A;  5H2F C;  3LNQ A;  3V7C A;  4BYY A;  4BE1 A;  4P1W A;  2GIZ A;  3K70 D;  2LBF B;  3U9G A;  3OYB A;  3JCU C;  3I4N J;  2NNN A;  3BR6 A;  5ILU A;  3HB9 A;  3HOU J;  1XSV A;  2RNG A;  1SMT A;  1WI3 A;  3OYH A;  3C7J A;  1AKH B;  4LLN A;  3BTJ A;  4AIH A;  3R4K A;  3KZY A;  4BEH A;  5K5Q A;  4O3M A;  3VYU B;  4QWQ A;  5DM6 F;  3IH2 A;  5L3C A;  1ON1 A;  3W3C A;  2O8K A;  3K4L A;  4XRS G;  2FBI A;  3FM3 A;  3H9J A;  1JUP A;  1REP C;  1U9N A;  4WX9 A;  1UHW A;  4FQG A;  5L3E A;  3GTJ J; 
#chains in the Genus database with same CATH homology
 4UV9 A;  1SFU A;  3B02 A;  1TW3 A;  4LB5 A;  5LGT A;  3KP2 A;  1TQP A;  3ZMV A;  3REO A;  1IAW A;  4OIO F;  4LK1 F;  1P4A A;  5CJ9 A;  5FLX Z;  2FA5 A;  3QP5 A;  1OKR A;  2L3D A;  1F1Z A;  2VT3 A;  3ZN0 A;  5K5R A;  2OBP A;  2RN7 A;  2X4H A;  4RB2 C;  1STZ A;  2K4B A;  5DD8 A;  3Q5F A;  3TDZ C;  2YU3 A;  1IXS B;  3I5U A;  3TO7 A;  3SZT A;  2EWN A;  3IC7 A;  2VOO A;  2CFX A;  2P4W A;  3ABT A;  4EV0 A;  2X0L A;  5D6E A;  1HXD A;  2BE5 F;  3WTV C;  3EUH A;  5D5U B;  5FD6 A;  1RI7 A;  2W84 A;  1LB2 A;  3R60 A;  1QNT A;  4YFK F;  3F72 A;  4ENJ A;  3C1D A;  3FWE A;  2VON A;  5D5V B;  3IWF A;  1O7L A;  1YQA A;  2ZBK A;  5BQT A;  3LAP A;  3TO6 A;  2P7C B;  1JXS A;  3I4P A;  1R22 A;  1SFE A;  3VOE A;  2A07 F;  3V7R A;  3LWF A;  3KEQ A;  4LFU A;  1HW5 A;  2E1C A;  2JT1 A;  5DCM B;  3K0L A;  2STW A;  1Z91 A;  3KZZ A;  3GX4 X;  4OMZ A;  2XUB A;  2FF4 A;  1P2F A;  2M45 A;  5E1X A;  3LA2 A;  2LDU A;  3F8C A;  5L3G A;  2NNY A;  2PBI A;  1X3U A;  3DV8 A;  3QOP A;  3HSE A;  3COA C;  1D3Y A;  3WTZ A;  3HRU A;  4G6Q A;  4ZZD A;  3QU3 A;  4BNC A;  4H0E A;  3HRS A;  1P4X A;  2V1D A;  2AS5 F;  2DLL A;  5DUI A;  4L18 B;  3T0Y A;  2NAZ A;  4O6J A;  1WWX A;  2KRF A;  3EYI A;  2QZ8 A;  2P6S A;  4YIF A;  4U0Y A;  2UXN A;  1MD0 A;  2TDX A;  5DV5 A;  2HTJ A;  5LEJ A;  4G7Z F;  4D0P A;  3DFG A;  2DK5 A;  4EM1 A;  4Y15 A;  4RB1 A;  2WTE A;  2PJP A;  4YG2 F;  3FF5 A;  4CYD A;  3BP8 A;  4BHC A;  1YLF A;  1MZB A;  5DCM A;  1DDN A;  1I6X A;  1Z05 A;  3KP5 A;  2COM A;  5CVJ A;  3IRR A;  2IJL A;  1J9I A;  2DQL A;  1U5T B;  4IRG A;  2XIG A;  4L9N A;  1G3Y A;  3ZMZ A;  1QBJ A;  3HSF A;  1K7A A;  2CW0 F;  1FZP B;  5F6F A;  4U88 A;  2VOP A;  1ZAR A;  1QGP A;  4XLN F;  1ON2 A;  3WGI A;  3RTR A;  3F23 A;  4U7D A;  3L2C A;  1U3E M;  5D4R A;  4HQM A;  2MA3 A;  3NRV A;  2EJR A;  1LEB A;  4KMF A;  2O03 A;  4UV8 A;  3D5L A;  3H3U A;  2BV6 A;  4LK0 F;  2GIV A;  3GFI A;  4YFX F;  3V8J A;  4B8X A;  3LA3 A;  4XLP F;  3DPT A;  1Z9C A;  4I01 A;  1XCV A;  5D6F A;  3V8L A;  2CSO A;  1T98 A;  2MLK A;  2G9W A;  1YW8 A;  1JE8 A;  3WG9 A;  3F6V A;  3GZ6 A;  1I5Z A;  1BI3 A;  1XMK A;  3K1N A;  4CXF A;  2AXL A;  1TBX A;  5H6Q A;  3Q9V A;  3LQR A;  1O3R A;  3G3Z A;  3TOA A;  3FZV A;  2ESN A;  3GO5 A;  2F2E A;  2GWR A;  4WXD A;  4A2U A;  1B9M A;  5FB2 A;  5AIP A;  5CVI A;  1O3T A;  4L0Z B;  4CZZ A;  3WTY C;  3WTX C;  4XSZ F;  4WF2 A;  3FXU A;  1SAX A;  2GQQ A;  4FX0 A;  4BHB A;  4N0B A;  4YII A;  2VOD A;  3DF8 A;  1YS7 A;  3BWG A;  4EM0 B;  1Q1H A;  4BXU A;  2XAS A;  2VE8 A;  2V9V A;  2UXX A;  3MAJ A;  3E5Q A;  3M7G A;  5EEH A;  4GYG A;  1LEA A;  4AVP A;  5LHI A;  4HLY A;  2CWE A;  1P6R A;  4M9S A;  2V79 A;  2RQP A;  1FBU A;  4WWC A;  4HX8 A;  5E18 F;  5FLX K;  5HDK A;  1AWC A;  1FNN A;  1JHF A;  3TOB A;  4OIR F;  3I64 A;  1ZG1 A;  3HUG A;  2B0L A;  3KP3 A;  4JBA A;  4GO1 A;  5ICF A;  1QPM A;  4RGU A;  1BJA A;  4AIK A;  3FHZ A;  4L9J A;  4M6X A;  1DP7 P;  1W5T A;  2K02 A;  2DBB A;  3IKV A;  1LQ1 A;  1IN6 A;  1IUY A;  1A04 A;  4K2E A;  3LQQ A;  4HF0 A;  5HS7 A;  4G7H F;  1U78 A;  1OMI A;  1HBX G;  3P9K A;  2HEO A;  3SXY A;  1ZRC A;  3FMR A;  3EYY A;  3E6M A;  3E6C C;  1YG2 A;  1WKM A;  1KYW A;  1XGN A;  3RPU A;  1C0W A;  3QPH A;  4Z2Y A;  4F7Z A;  4IHS A;  5HS8 A;  1O3Q A;  2GA2 A;  4G94 A;  3TDU C;  1R36 A;  2PQ8 A;  3WU1 B;  4HX4 A;  2R7F A;  1MJ9 A;  1GVJ A;  5CYV A;  3ZMU A;  1HKT A;  1BI2 A;  3TQN A;  4M73 A;  3HOS A;  2L02 A;  5LRS A;  2ACJ A;  3MZY A;  4IRH A;  3RKX A;  1IXR C;  4JK1 X;  4OOI A;  3DEU A;  2LSO A;  1BI1 A;  2Y0M A;  3MFK A;  4PCQ A;  4RB0 A;  1P4W A;  5F1R A;  4ASN A;  4LB6 B;  5FD5 A;  4OIP F;  3WTS C;  3OOP A;  4HF1 A;  2W25 A;  5LEK A;  2HYF A;  1HW2 A;  1FBS A;  3RYP A;  3O2P E;  1D8J A;  1AOY A;  5J8F A;  2ELH A;  4B09 A;  2HYG D;  3BJO A;  1QZZ A;  2F5C A;  3WGG A;  1FP1 D;  1DPU A;  3WTW C;  2F5E A;  4ZH4 F;  5L3D A;  5E8G A;  4KMU X;  3C3W A;  4FX4 A;  3I54 A;  4MNU A;  2OQR A;  2FBH A;  2HDC A;  4UVB A;  1JGS A;  5HVQ C;  3ML6 A;  2A5Y B;  3KET A;  4IPA A;  4UNO A;  2YX7 A;  3GFJ A;  1TW2 A;  4G8X A;  3SQN A;  3W6K B;  2W57 A;  5AIQ A;  1GXQ A;  2EFO A;  1YW7 A;  4A0Z A;  5EEG A;  2WWY A;  5JI6 A;  3JSP A;  1R00 A;  2V1U A;  3GWZ A;  1L3L A;  3QAH A;  2MD5 A;  4A5N A;  1Z6T A;  3EQL F;  4U0W A;  3GEZ A;  3R61 A;  1R1U A;  3ZQ7 A;  2K7L A;  2GAU A;  2HOE A;  1SFX A;  4HZF A;  4DNC A;  3CLO A;  1G3S A;  1XGO A;  4FT8 A;  4KNY A;  4HF2 A;  4PDK A;  1FWZ A;  2Z33 A;  2XVC A;  4ON0 A;  5CVR A;  1TLH B;  3KLN A;  5IT9 K;  4HDU A;  1IF1 A;  3HYI A;  1KU7 A;  1SD5 A;  1GXP A;  3T8R A;  2GZW A;  2F5F A;  2PMU A;  2HWV A;  2QQB A;  1RZ4 A;  2RC4 A;  3MCZ A;  1S6L A;  3JAM K;  1U6G A;  5LHH A;  4A0X A;  2OQG A;  5L3F A;  1UCR A;  2BBY A;  5BS6 A;  3HTS B;  3ZP5 A;  1EH7 A;  3HRM A;  2D1V A;  2PEX A;  5KK1 A;  4L5I A;  1MGT A;  4ZYG A;  4LLL A;  2DFI A;  3FXR A;  1KQ0 A;  2L4M A;  2IW5 A;  4ENM A;  1XB4 A;  5CVV A;  1IN4 A;  3E5U A;  3F21 A;  1K79 A;  1T0F A;  5BOX A;  3F8N A;  3LAJ A;  2HQR A;  4M71 A;  1U8R A;  3NQO A;  4HA8 A;  1FYL A;  4UHT A;  1O57 A;  5ILS A;  4Q5S F;  4MEX F;  4ENN A;  1BM9 A;  2QM3 A;  3BPV A;  3GZ5 A;  4LLG F;  2Y48 A;  5J8C A;  2M5W A;  1T6S A;  4ZYE A;  2D45 A;  2EV0 A;  3HHH A;  2P5V A;  3FXQ A;  1JHH A;  4LD5 A;  3DXJ F;  4WXH A;  5D8L B;  2C6Y A;  4O5V A;  1V4R A;  1WI9 A;  3M8F A;  3CJN A;  4BHP A;  1K6O A;  2M87 A;  1EV7 A;  4KDP A;  4Y13 A;  2DAO A;  2JPB A;  3FX3 A;  5KVR A;  2Z3Y A;  3F8M A;  2M1B A;  3IL2 A;  2KKO A;  4AIJ A;  6PAX A;  2OD5 A;  2MC3 A;  1R5H A;  2NRA C;  1HW1 A;  4MQ9 F;  3DKW A;  4HYE A;  4A5M A;  3CTA A;  4NB5 A;  1Z7U A;  5E8I A;  2VXZ A;  4R79 A;  1Z1D A;  2VC0 A;  1XCB A;  1MDM B;  3F8B A;  4P9F A;  1B9N A;  3GVA A;  4GYI A;  5F64 A;  1OYW A;  3HRT A;  2A6H F;  2KIU A;  1G3W A;  4RGS A;  5LBQ A;  1F5T A;  2H09 A;  4OIQ F;  3FMQ A;  3HOT A;  1FPQ A;  2QWW A;  4U0V A;  2VBX A;  4Y17 A;  3ZMS A;  5E17 F;  1Z6R A;  3CDH A;  2FE3 A;  2XKP A;  3KP4 A;  2PG4 A;  1S7O A;  3GUD A;  1F9N A;  3N4M A;  3PFI A;  2V6C A;  2XHK A;  2ESH A;  4AD9 A;  4YFN F;  1KU2 A;  5TJJ A;  3B73 A;  4OIN F;  1TTY A;  2L54 A;  3IRQ A;  3WE2 A;  3U1D A;  2ZXJ A;  3P7N A;  2D2W A;  1SD4 A;  1ZG5 A;  1ZHF A;  1V3F A;  2RGV A;  4PGG A;  2YX4 A;  5LGN A;  3ELK A;  1ZGJ A;  4KYW A;  1TNS A;  4EJW A;  2HFH A;  4HDV A;  2Z9O A;  1FBQ A;  4L9T A;  1SMY F;  3I58 A;  2QBY B;  1MDM A;  1ULY A;  3C18 A;  4CDG A;  4E70 A;  5CVU A;  1TQI A;  5E1Z B;  1S3J A;  4R8H A;  2L01 A;  3R6S A;  2XAG A;  1KA8 A;  2FSW A;  3I71 A;  1J5Y A;  3K2Z A;  3RIR A;  2LKP A;  4RB3 C;  4EGZ A;  1S8N A;  2CYY A;  2CO5 A;  3WE3 A;  2HGC A;  2MLG A;  2DO7 A;  1HSJ A;  4KT5 C;  1CF7 B;  4I02 A;  3WU0 A;  5A2Q Z;  2O6G E;  3S2W A;  3ULQ B;  3L9F A;  3QRF F;  2J5O A;  3QPT A;  1UST A;  4I0B A;  5HLI A;  3RPQ A;  5D8K B;  3CO6 C;  3HTU A;  1NHA A;  4AWX B;  1ZAO A;  3U2R A;  1FSH A;  2BYV E;  2P5K A;  3BJ6 A;  3H92 A;  3M8E A;  4FHT A;  2KJB A;  3I0T A;  2R3S A;  4HX7 A;  4NHJ A;  2NYX A;  5D5W B;  3RYR A;  1FP2 A;  1FX7 A;  2O3F A;  5LGU A;  4GGG A;  1KQ9 A;  1MJB A;  2QBY A;  2EFQ A;  1T2K A;  2EFN A;  3VEP A;  1BC7 C;  1ZN2 A;  2HTS A;  1YFH A;  2DPU A;  4KN4 X;  4LJZ F;  3ZN1 A;  2VBZ A;  5FFX A;  4I09 A;  1KU9 A;  4P9U A;  2GXG A;  4GXO A;  4CO8 A;  2A3S A;  1FT9 A;  5ICG A;  5DEQ A;  1WQ2 A;  2EV6 A;  3PQK A;  2G7U A;  3IKT A;  2MH2 A;  4WCG A;  1OR7 A;  2FXA A;  1CF7 A;  2XGX A;  2E7W A;  1J2X A;  4MTE A;  2RV8 A;  4I0A A;  3T5X A;  3BZ6 A;  5DD4 A;  1F4K A;  1ZH5 A;  3F6O A;  4ESJ A;  3EDP A;  1E2X A;  4GCV A;  1J75 A;  3TKY A;  5DCF A;  1H0M A;  1XDU A;  3K1M A;  1FC3 A;  2YSR A;  1QZY A;  2ZME B;  4Q48 A;  4P55 A;  4UVA A;  3KLO A;  1KQ8 A;  5H6R A;  2XKO A;  4DQ2 A;  5DUK A;  2XRO A;  3V7S A;  3J80 Z;  2DU9 A;  2H6C A;  3MEX A;  1XSX A;  4L9V A;  2CGP A;  1B4A A;  5D4S A;  3JSO A;  3CO7 C;  2PLY A;  3BPX A;  2EFW A;  1B59 A;  3DPL C;  2QLZ A;  1DPR A;  3H3Z A;  1KU3 A;  1UFM A;  4CHU A;  1W4M A;  5JVT A;  1FYM A;  2OZU A;  1PP8 F;  5HS9 A;  4XSX F;  2DW4 A;  1T39 A;  4PGH A;  2IT0 A;  4M72 A;  2WV0 A;  3BDD A;  4NQW A;  3L7W A;  5HDG A;  2IA2 A;  4IVN A;  5HDN A;  1FOK A;  1R1T A;  3T1B A;  2QQ9 A;  1LJ9 A;  2FU4 A;  3IHU A;  3LST A;  3KCC A;  4M6Y A;  5DYM A;  2OAZ A;  2DTR A;  5LRR A;  3TO9 A;  4LMY A;  2ZME A;  2ADU A;  1KGS A;  2A61 A;  1IZ1 A;  3LA7 A;  2FNP A;  4A6E A;  4HAM A;  4IHT A;  1W7P B;  2NS0 A;  1XGM A;  3J7A O;  2M30 A;  2Q0O A;  4CGZ A;  2KJC A;  2KIF A;  2H94 A;  3BRO A;  3L09 A;  1TNT A;  2FNA A;  2EV5 A;  4KFC A;  3J81 Z;  1ZLK A;  2QQA A;  4L0Y B;  1K78 B;  1IXC A;  1R58 A;  2HZT A;  2QUF A;  1ZRF A;  1SD7 A;  1FLI A;  1QO0 D;  1ZRD A;  4U7B A;  2PI0 A;  1OPC A;  2JZY A;  2K86 A;  1B1B A;  2UWM A;  1ZYR F;  2PN6 A;  4MEY F;  1TQM A;  3N97 A;  3GFL A;  3WTT C;  4KIG A;  4OU0 A;  2DQR A;  1MKM A;  4EMS A;  3RJP A;  2VE9 A;  3QP6 A;  5ICE A;  3JTH A;  3GF2 A;  2XAJ A;  2E1N A;  3K69 A;  3WOD F;  1OYI A;  1XN7 A;  2K4J A;  3T8T A;  4LG0 B;  4G7O F;  1ONV A;  1W7P A;  2W85 A;  1R1V A;  2ETH A;  3MQ0 A;  3RKW A;  1J0R A;  3O3K A;  4WXC A;  2E7X A;  1HST A;  2XRN A;  4RS8 A;  2XAQ A;  1K78 A;  3ECH A;  2XV4 S;  4UXN A;  2ZJ2 A;  5IT3 A;  5E20 A;  2O8X A;  2RKH A;  2LF8 A;  5LLQ A;  2M8E A;  3ERE D;  3K9T A;  1LDD A;  3F22 A;  4L5J A;  1HQC A;  3FM5 A;  3SFZ A;  3GW2 A;  3G73 A;  5A2Q K;  3M1E A;  2HR3 A;  1YS6 A;  3W6J B;  1D8K A;  2PMH A;  5HLH A;  2IA1 A;  1T38 A;  1YYV A;  2PFB A;  1ZGA A;  5D5X B;  4S05 A;  1PUE E;  4WK8 F;  1HKS A;  3VFZ A;  5ERI A;  3IWZ A;  5BPD A;  4A12 A;  3ROU A;  1EH8 A;  3CUQ C;  2QEN A;  2DK8 A;  2Z5U A;  4HQE A;  1J59 A;  2ZCW A;  3F3X A;  4LG0 A;  2Y75 A;  2CQK A;  3I53 A;  3RI4 A;  1G3T A;  1S7A A;  1YW9 A;  2ZKZ A;  1IRF A;  2RNJ A;  3KP6 A;  1XGS A;  3MZH A;  3E6B A;  2P6T A;  2FMY A;  5BPI A;  2IA0 A;  1PP7 U;  1S29 A;  4RAY A;  2IVM A;  3ZMD A;  2ZNZ A;  2VBW A;  5HOO A;  4S04 A;  5AON A;  3ISP A;  4A0Y A;  2FEZ A;  2STT A;  4MGR A;  3VOD A;  4MTD A;  2FML A;  4RAZ A;  4HLX A;  4KA4 A;  1KYZ A;  4HW0 A;  5FFZ A;  4HV5 A;  1W5S A;  4HBL A;  4IRI A;  4EJU A;  3LFK A;  4UVC A;  4EVI A;  2UZK A;  4XBF A;  1HKQ A;  2EFP A;  1LNW A;  2FQ3 A;  2VBY A;  4MHG A;  5JFR A;  4EQQ A;  2A69 F;  2WC2 A;  1BIA A;  2P7V B;  4CIC A;  1LDJ A;  1IW7 F;  5HLG A;  4P5O A;  2HKX A;  2O61 A;  3ZMT A;  1P92 A;  2W24 A;  3KFW X;  3KEO A;  2D1H A;  1L0O C;  4P96 A;  3J80 K;  3ABU A;  4XRF A;  4EJV A;  2O0Y A;  1ZG3 A;  4TV7 A;  3V4G A;  2GXB A;  5IT9 Z;  3JW4 A;  1ZLJ A;  1LVA A;  5H20 A;  4BQA A;  1EH6 A;  1I1S A;  4KIC A;  1BBY A;  2OZ6 A;  4EM2 A;  5K1Y A;  2Z99 A;  3GXO A;  3BJA A;  4RGX A;  3I59 B;  5ED4 A;  3JAM Z;  4KN7 X;  5L3B A;  3AAF A;  1YTY A;  2EK5 A;  1U2W A;  2JTV A;  1QQI A;  1USS A;  4M9Z A;  1ODD A;  4BH9 A;  1I27 A;  3HHG A;  1R23 A;  3M9A A;  1Y0U A;  1XD7 A;  4G6D A;  3HSR A;  2DT5 A;  3E3V A;  2YPR A;  5ILV A;  2P8T A;  3MWM A;  1H9T A;  2XAH A;  2G7H A;  3GFM A;  3K1P A;  1U5T A;  5LHG A;  2FBK A;  3R0A A;  4A6D A;  1YO5 C;  1R7J A;  3TGN A;  2RVC A;  2OA4 A;  3KP7 A;  3NEU A;  1PDN C;  2ZNY A;  2IP2 A;  3QU6 A;  1IRG A;  1J7K A;  4HV6 A;  4ETS A;  4IXA A;  2ZFW A;  1RIO H;  3J81 K;  5DDG A;  1W7P D;  2DI3 A;  4M74 A;  2QYO A;  1BIB A;  4G9Y A;  1FY7 A;  2P5L C;  5BMZ A;  3VB2 A;  4PZJ A;  3WGH A;  1I1G A;  4BAY A;  2J5P A;  1E17 A;  3WTU C;  1O3S A;  2JPC A;  3Q9S A;  1ZRE A;  3I59 A;  1R5G A;  1MJA A;  4QLC U;  2EB7 A;  4ZYD A;  1YIO A;  3FMS A;  2XAF A;  1LDK B;  4M9X A;  3RDI A;  2VN2 A;  3DQV C;  5K5O A;  2HQN A;  1G4D A;  3E5X A;  2H6B A;  2JSC A;  1WSU A;  2LF7 A;  5JHU A;  4OMY A;  2MBF A;  3SZP A;  4I7H A;  4ENK A;  4ZZL A;  3CUQ B;  3O6B B;  2LNB A;  5JR3 A;  3PQJ A;  4N9I A;  5J6X A;  4Q47 A;  1UB9 A;  2A68 F;  2MH9 A;  1IN5 A;  1B6A A;  1BOA A;  3KE2 A;  4EJO A;  1GHC A;  2QVO A;  2ZO4 A;  2IPQ X;  3SHF A;  2RDP A;  4EGY A;  4I2O A;  1BC8 C;  1XDS A;  5ICC A;  2Q2E A;  2FRH A;  3ZPL A;  2BEO A;  2V1X A;  3E6D A;  3EET A;  2FOK A;  4KUM A;  3BY6 A;  2CG4 A;  2R7D A;  2OU2 A;  4JQF A;  3CUO A;  1SD6 A;  4ZYH A;  1IN8 A;  2HS5 A;  1FYK A;  2ISY A;  3P9I A;  4ESF A;  2JRT A;  2A6E F;  3E97 A;  4KIF A;  3OV8 A;  3RKY A;  1D5V A;  3P9C A;  1WRJ A;  5FO5 A;  2GA1 A;  2KIM A;  3ECO A;  5FGM A;  1RUO A;  3GLX A;  5E1W A;  4N9H A;  5CLS A;  1BI0 A;  2K27 A;  1O7F A;  1UHM A;  4RGR A;  2Q8K A;  2DPD A;  4R1H A;  3CUQ A;  4ESB A;  3F8F A;  3JTG A;  2F5D A;  2ISZ A;  2EA2 A;  2IRF G;  4MQV A;  2VT2 A;  4IF4 A;  4I98 B;  4UUV A;  1G6N A;  3HIF A;  4IJA A;  1VTN C;  2BGC A;  3V8K A;  3R0J A;  3D0S A;  1RUN A;  2HKO A;  1RNL A;  1DUX C;  1U5T C;  1CGP A;  4LGW A;  1IN7 A;  3GYH X;  1OYY A;  4KIB A;  2VC1 A;  2EA4 A;  4HOB A;  2YR2 A;  1XSD A;  3BOQ A;  3DP7 A;  1BN5 A;  4EJT A;  3L00 A;  2L4A A;  1XMA A;  4Q4Z F;  5TRD A;  1H9G A;  1FSE A;  3V7C A;  4BYY A;  3U9G A;  2NNN A;  5ILU A;  1XSV A;  1SMT A;  3C7J A;  4LLN A;  4AIH A;  3R4K A;  3KZY A;  5K5Q A;  4O3M A;  4QWQ A;  5L3C A;  1ON1 A;  2FBI A;  3FM3 A;  1REP C;  4WX9 A;  1UHW A;  5L3E A;  2H27 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...