1QPMA

Nmr structure of the mu bacteriophage repressor dna-binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords PROTEIN (MU BACTERIOPHAGE C REPRESSOR PROTEIN)
publication title NMR structure and functional studies of the Mu repressor DNA-binding domain.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Viral protein
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qpmA00
2CG4A 1UB9A 1HXDA 4HF1A 1WQ2A 3FM5A 1K6OA 4R79A 3PQJA 4EVIA 1J0RA 1I27A 4U7BA 2DBBA 2GWRA 3SZPA 1J9IA 2XAQA 4M6YA 4JK1X 3ZQ7A 3V4GA 5L3FA 3K69A 5K1YA 2ZCWA 3GO5A 5A2QK 4RB1A 1Y0UA 2H27A 1XDUA 2XAFA 4FT8A 3H92A 1KU2A 4UVBA 3F72A 1W7PA 3F3XA 3BJ6A 1F9NA 1B9MA 5DUIA 3EYYA 3V7RA 3R61A 3MZYA 4RGSA 5F6FA 2KIUA 5DEQA 4Q47A 4U0YA 4WXCA 4YIIA 1YW8A 2CFXA 2WWYA 1QQIA 1TQPA 3I64A 3WU1B 2KKOA 2PMUA 1FX7A 1XN7A 4O3MA 4RGUA 2O6GE 2ZJ2A 2JSCA 4GCVA 3WTYC 5DCMB 1XB4A 3WGHA 2L54A 4TV7A 3SHFA 3ZMSA 1ZG5A 5LRSA 1F5TA 2K27A 5IT9K 1D8KA 1O57A 2F5DA 3FMSA 3FWEA 3Q5FA 5D8KB 1WWXA 1KYWA 4U88A 1UHWA 1BI1A 4PDKA 2CSOA 2VN2A 3VEPA 4OIOF 3I53A 3QPTA 5LEKA 3P7NA 3V7CA 4KIFA 2A07F 1RUOA 4I0AA 3KZYA 4B09A 4L9TA 2UZKA 3EDPA 2HEOA 4M9SA 1EH7A 3QP5A 4OMZA 3HTSB 4GGGA 1IRFA 3M7GA 5D6FA 1FBSA 3RYRA 1XCVA 2RKHA 5LBQA 2O03A 4IXAA 2VONA 1AOYA 2LNBA 1P6RA 3C1DA 1J75A 4RB3C 2COMA 4PGGA 4LB6B 4G7HF 2QQ9A 2XAHA 3QRFF 4E70A 2GAUA 2OBPA 3KETA 3EETA 4LK1F 5D5XB 3HOTA 2ETHA 3ZPLA 4IHTA 4YFKF 4G8XA 1WKMA 3IWFA 5FD5A 4HF2A 3K1NA 2H09A 2CQKA 3MFKA 2BE5F 4WXDA 2XIGA 4U0WA 2E1CA 1FZPB 4KMFA 3GFJA 2F5FA 5E8IA 1O3SA 2NS0A 4RAYA 3HRSA 4Y13A 1LDDA 2VBYA 3QOPA 4Q5SF 4ZYGA 2P5VA 2OD5A 5CVVA 5DD4A 4L5JA 2L01A 2Z9OA 3T5XA 2WTEA 3L09A 5FFXA 1FP1D 2P8TA 5ICCA 4L0ZB 6PAXA 3TO9A 2A6EF 3HHGA 1SD6A 2VODA 2IPQX 1BC8C 1XSDA 4N9IA 3DFGA 3WE3A 4MNUA 2A61A 4MTEA 4NB5A 1IN7A 2EFPA 2LKPA 3KEOA 1U8RA 3DPTA 1W5SA 2D2WA 1R1VA 1P2FA 4R8HA 2K4JA 4BHPA 2ZMEA 4AVPA 1QO0D 3I54A 1Z9CA 2KIFA 1ZGJA 3O3KA 2UXNA 3E6BA 4EM0B 2MBFA 1P4XA 5HDKA 5TRDA 1BOAA 2MC3A 1YQAA 2HTSA 1G4DA 4M6XA 4DQ2A 2QQBA 2Y75A 2BV6A 3G3ZA 2W57A 1PUEE 2FXAA 2XGXA 4OMYA 4S05A 3OOPA 5A2QZ 3IKTA 1X3UA 5J6XA 1R5HA 3VFZA 5JFRA 3ISPA 2Z3YA 1OPCA 5L3BA 5JR3A 2AXLA 4CGZA 2P5LC 4XSXF 3ZMZA 1YW9A 1JGSA 2IA2A 2P5KA 3GF2A 4PZJA 1W5TA 2ZFWA 3N4MA 1LDKB 1YLFA 5ILVA 2PN6A 2OA4A 2V9VA 4N0BA 1IXSB 1Q1HA 3QAHA 3GZ6A 1XGOA 2FNPA 4XBFA 5CLSA 3REOA 2HYFA 4KICA 1MZBA 3RIRA 2BEOA 1FP2A 1LQ1A 3HHHA 3TOBA 3ROUA 3J80K 4A0ZA 4LB5A 3T1BA 1SMYF 3CO7C 1Z7UA 1T38A 5IT9Z 2V1DA 5FFZA 5L3GA 3FXUA 3WTUC 3GFIA 4NHJA 1I1SA 3E5UA 2Z99A 4KN4X 5LGTA 5HLHA 1GXQA 2M87A 2QBYB 1P92A 1O3QA 1IW7F 1DPRA 3R6SA 2P7CB 2ACJA 2ISYA 3WTWC 2K7LA 2O3FA 1OYIA 2XASA 2ZNYA 4H0EA 2MA3A 1S7AA 3BJAA 2FNAA 1XGSA 2E1NA 5K5RA 1TW3A 3L7WA 2V1UA 2DK8A 1KQ0A 4IPAA 2ZKZA 3KLOA 1MJAA 3RPQA 2VT2A 5L3EA 4CHUA 2G7HA 2HFHA 3ZN0A 3V8LA 2ZBKA 1SAXA 4EQQA 2MH2A 4A2UA 4OINF 2GXBA 5JVTA 1Z6TA 3J81K 4MTDA 3TO6A 3QP6A 3T8RA 1I5ZA 3LSTA 4L9VA 2A6HF 2IJLA 3ZP5A 3C18A 3JSOA 2WV0A 4XRFA 2QYOA 4I0BA 1U5TB 3VOEA 1R23A 1OR7A 4HQMA 3TKYA 1KQ9A 2Q0OA 2V1XA 3BOQA 2O8XA 2TDXA 2ADUA 1B6AA 3E97A 3BZ6A 4MHGA 3CUQB 3VODA 4ZYDA 5D8LB 2OZ6A 1P4AA 4LLNA 3E6CC 1CF7B 3KLNA 5FO5A 1FOKA 4MQVA 1YS7A 5TJJA 1YS6A 1B9NA 3RPUA 3BY6A 3E5QA 1RI7A 2H6CA 2XRNA 3R4KA 3COAC 4LK0F 4EJWA 1DUXC 4XLNF 4M9XA 4O5VA 4HOBA 1BBYA 2W24A 4Y15A 3EUHA 2PFBA 1SD5A 1A04A 3R60A 5CVJA 2EFQA 4HDUA 3E3VA 1H0MA 2NAZA 4ZYEA 3I4PA 4AIHA 2XUBA 1XSVA 3RI4A 3KP3A 1S6LA 1L3LA 5K5OA 1JXSA 2FE3A 1W4MA 4AWXB 1KYZA 2QBYA 4ESFA 1GVJA 3BPVA 2EV5A 4QWQA 1STZA 3Q9VA 3BJOA 1XGNA 5LEJA 1B59A 5E1XA 4CYDA 5BPDA 1AWCA 2EV0A 2W84A 3TO7A 3HRTA 4Y17A 2Y48A 3DPLC 1KGSA 2P6SA 2GA2A 2HKOA 1XDSA 2XHKA 3IL2A 2CYYA 2RGVA 2W25A 1WSUA 2LSOA 3KFWX 3HRMA 4AD9A 2A68F 3E5XA 3F6VA 4F7ZA 3J80Z 3D5LA 3I58A 5J8CA 1Z91A 5LGNA 1ONVA 4M71A 1RUNA 1IXCA 2O0YA 4IVNA 2E7XA 3K1PA 3HOSA 1ZAOA 3RTRA 4KIBA 2IT0A 5E18F 2NRAC 5HS7A 4G6QA 1FBUA 2DLLA 3CDHA 2RDPA 5DD8A 2JRTA 2YSRA 1YG2A 1PP7U 2K86A 2FA5A 5IT3A 1ZN2A 3BWGA 1S7OA 2VBZA 2NYXA 1IRGA 4I02A 4WK8F 1MD0A 3IRQA 3CUQA 5FLXK 1W7PD 4XLPF 1EH8A 3LA3A 1T6SA 2FOKA 2M45A 2PQ8A 2F2EA 1HBXG 2PEXA 1I1GA 4U0VA 2VT3A 2GXGA 4A12A 2ZNZA 3FMRA 1SFXA 5HVQC 5H20A 3GXOA 2DPUA 5AONA 3BDDA 2M1BA 4WCGA 3ABUA 1IN5A 1YFHA 1IN6A 2X4HA 1KU9A 2HDCA 5HLIA 3J81Z 3I0TA 2XAJA 5CVRA 3HSFA 4XSZF 2LF8A 2H94A 2DAOA 4GYGA 3LA7A 3K9TA 4QLCU 1GXPA 1FSHA 5ILUA 1V3FA 2EA4A 4BXUA 2C6YA 3KP6A 1QGPA 1MKMA 2F5EA 4I2OA 2XKPA 4GYIA 3GFMA 3K1MA 3M9AA 4WX9A 1E2XA 2MLKA 3M8FA 3VB2A 1IUYA 1B4AA 2FBKA 2STTA 4I7HA 3KCCA 5E1WA 1Z6RA 4FX0A 3QU3A 1USSA 2DQRA 4MGRA 3F6OA 4L18B 5CYVA 4KN7X 2EWNA 2FBHA 2EFWA 5EEHA 2QWWA 4ENKA 1LB2A 4P55A 3I59B 2UWMA 1BIAA 4P96A 4LG0B 1TQIA 1UFMA 1BI2A 2DQLA 4Q48A 3HTUA 1FYKA 2EK5A 5D4SA 5DCMA 1ZRCA 3RKWA 3MAJA 3C7JA 2DTRA 3IKVA 5HDNA 4ENJA 4LD5A 1G3YA 5AIQA 2XAGA 3O6BB 4Q4ZF 3F21A 2Q2EA 4EGYA 1S29A 2FU4A 1KQ8A 5E20A 2QQAA 1D5VA 5BOXA 3E6MA 1ZHFA 3LAJA 1GHCA 1J5YA 4KIGA 2HZTA 1JHFA 3RKXA 1SD4A 3IHUA 2A69F 5JHUA 1SMTA 3R0JA 4ENMA 2IVMA 2YX4A 4YFNF 3V8KA 3WG9A 3DQVC 1KA8A 2J5OA 5LGUA 1QPMA 5ICEA 4JBAA 4EGZA 2RNJA 4LLGF 4AIKA 3IC7A 1CGPA 4P9UA 2OAZA 5ICGA 5E17F 3L9FA 1D3YA 3CO6C 1XSXA 3ZMUA 4KYWA 2EJRA 1ZLJA 2VC0A 1DDNA 2HTJA 3ECHA 2FMLA 4HX4A 3NRVA 4UVCA 2ZXJA 4BAYA 1VTNC 2DFIA 1FSEA 4UNOA 3FF5A 3F8CA 2KRFA 4KMUX 1F4KA 1SFUA 1U2WA 3CJNA 3JSPA 1PP8F 5CVIA 1BN5A 1ZG1A 1NHAA 4WWCA 5HLGA 3GLXA 3C3WA 1WRJA 1YTYA 4Z2YA 3WTXC 3CUOA 4BNCA 1S3JA 5DCFA 5FLXZ 2VBWA 2HQRA 3R0AA 4EV0A 2RQPA 1K78B 2PG4A 1TW2A 4LJZF 2LDUA 2D1HA 4EMSA 1H9GA 4YG2F 1P4WA 3KE2A 3ABTA 3GEZA 2YPRA 4EJOA 4KA4A 5FB2A 2BBYA 5EEGA 4IRHA 1DP7P 3LA2A 3SQNA 2HS5A 4AIJA 3RYPA 2G9WA 1Z05A 1PDNC 3I59A 3T0YA 1IZ1A 2M30A 2OZUA 4ON0A 4LG0A 2MH9A 5F1RA 1V4RA 3B02A 1R22A 2HGCA 3LAPA 1MJBA 2FSWA 4RGXA 5DYMA 2D1VA 3IWZA 3WGIA 2A5YB 1O3RA 3MZHA 4P9FA 4IRIA 4K2EA 1YO5C 5H6RA 1KU3A 3U2RA 5JI6A 4EM2A 4YFXF 3JAMK 1G3WA 3IRRA 2CO5A 4FHTA 4HW0A 1LNWA 4KNYA 4WF2A 3JTGA 3J7AO 3N97A 2OQRA 4U7DA 3SXYA 1FLIA 2DW4A 5H6QA 5D5UB 3ZMVA 4L9JA 3LQQA 2HR3A 4HX8A 2ZO4A 4LFUA 2P7VB 3WODF 3OV8A 4RGRA 2ELHA 2M8EA 2G7UA 4JQFA 4KDPA 5LHGA 2OU2A 4CDGA 3LFKA 1LVAA 2L4AA 3NEUA 2ESHA 1LEAA 2JPCA 1IAWA 3GX4X 2HOEA 2JZYA 2QUFA 2IA1A 4NQWA 1G6NA 2CWEA 2IP2A 3P9IA 5BS6A 1C0WA 1HW5A 5DUKA 4HAMA 1ZLKA 1ZYRF 1HSTA 3I5UA 1ZREA 4RS8A 2PLYA 2E7WA 2CW0F 1ZGAA 1IXRC 1YW7A 2R7DA 1T39A 3DP7A 4ETSA 2HYGD 4HA8A 5LHIA 1HQCA 3E6DA 1B1BA 1JE8A 2QM3A 4GXOA 4HX7A 3FMQA 4RB0A 3S2WA 3O2PE 3P9KA 1S8NA 2VE9A 4P5OA 3P9CA 1BI0A 2RVCA 3RJPA 2DI3A 4KT5C 2FQ3A 3WTZA 2CGPA 1TNSA 4MEYF 1LJ9A 2D45A 1OYWA 3SZTA 4HBLA 2P6TA 4ASNA 1ZRFA 1K78A 5BPIA 1R1TA 2L4MA 3DEUA 2Z5UA 3TGNA 1RIOH 3KP7A 2ZMEB 2GIVA 5HS9A 4A6DA 3Q9SA 2NNNA 5CJ9A 1K7AA 1HKQA 4EJTA 2QVOA 1XMKA 3F23A 2HQNA 1FYMA 1RNLA 4OU0A 1ZRDA 1USTA 4G9YA 1R00A 1J59A 2L3DA 2KJCA 1HSJA 4N9HA 1U5TA 1BJAA 1T98A 1ZARA 3EYIA 4EM1A 3B73A 3JTHA 2GZWA 3ELKA 3KP4A 1FWZA 5FGMA 2FMYA 3ECOA 2DO7A 2VXZA 3V7SA 3ML6A 2PI0A 3F8NA 1L0OC 4CICA 1O7FA 2YX7A 1CF7A 4EJUA 5F64A 4B8XA 5D6EA 3ZMTA 4ZZDA 2XVCA 4I01A 1SD7A 2O61A 1YIOA 3BP8A 2AS5F 1T0FA 2FEZA 4PGHA 4ESJA 3HUGA 4LGWA 1R36A 3DXJF 3U1DA 4UUVA 3GFLA 2PBIA 5HS8A 3FX3A 3TDUC 2K02A 2YR2A 5L3CA 3H3ZA 2YU3A 3HIFA 5LLQA 3DV8A 3GUDA 3W6JB 2H6BA 2LF7A 1FT9A 4ZYHA 1TQMA 3QU6A 4CZZA 2RN7A 3AAFA 2Z33A 2XKOA 3KZZA 4UXNA 2EA2A 2EV6A 5ED4A 1BC7C 3EQLF 5E8GA 3FZVA 1D8JA 2ISZA 1O3TA 1G3TA 2Y0MA 3JAMZ 5L3DA 2KIMA 4I09A 4FX4A 3GWZA 4OIPF 4BQAA 2HKXA 4M73A 5ERIA 2QLZA 3D0SA 1SFEA 3ZN1A 3F8MA 1UCRA 3TDZC 2VBXA 4HDVA 5DDGA 1MDMB 3WGGA 1EV7A 4HV6A 1OMIA 4WXHA 2VOOA 4CXFA 4RB2C 2B0LA 2IW5A 1ODDA 3GZ5A 4GO1A 4RAZA 1K79A 2X0LA 4ENNA 2JTVA 4BYYA 2JT1A 1BI3A 2K4BA 1R58A 1IN8A 1QZYA 4ZH4F 3PFIA 1J2XA 4UV9A 2RC4A 2F5CA 4IRGA 1LDJA 1JHHA 1TBXA 1J7KA 4L9NA 3WU0A 5D5VB 3LQRA 3QPHA 5D4RA 5ICFA 3U9GA 1E17A 1TNTA 4M72A 3CLOA 1KU7A 4A6EA 1MGTA 4HZFA 1DPUA 3JW4A 2DT5A 2RV8A 4OIQF 2VE8A 1QBJA 3HSEA 3ULQB 3GW2A 3I71A 2JPBA 1REPC 4BHBA 2W85A 3F8BA 3KP5A 4IF4A 4O6JA 5CVUA 1FNNA 5DV5A 2STWA 3SFZA 5HDGA 1R7JA 4M9ZA 4YIFA 1BIBA 1WI9A 4HLYA 3MEXA 3CTAA 3L00A 4EJVA 1ULYA 2L02A 1MJ9A 1R1UA 1ON1A 2R7FA 3K2ZA 4LMYA 2VC1A 3BPXA 1T2KA 3ZMDA 4KUMA 5J8FA 1FPQA 5HOOA 4L5IA 4A5MA 3ERED 1G3SA 1FBQA 3FXRA 5FD6A 2Q8KA 2UXXA 1UHMA 2MD5A 3PQKA 1OYYA 4OOIA 4MQ9F 1LEBA 1XD7A 3TQNA 2P4WA 2PMHA 1HKSA 3HYIA 1IF1A 1TTYA 1Z1DA 2PJPA 1YYVA 3M8EA 2VOPA 3MCZA 4DNCA 5KVRA 3FXQA 4PCQA 1ZH5A 4A5NA 4HF0A 3K0LA 1QNTA 2HWVA 5BQTA 2FF4A 1W7PB 1U78A 3GVAA 2DU9A 2FBIA 4BHCA 1FC3A 2QENA 1ZG3A 3V8JA 5K5QA 5E1ZB 1EH6A 1U6GA 4OIRF 5D5WB 3LWFA 1IN4A 1HW2A 4CO8A 1I6XA 4ESBA 2GQQA 3FHZA 2OQGA 1QZZA 4L0YB 1HW1A 2XROA 4IJAA 1MDMA 1XGMA 4IHSA 4KFCA 1U5TC 2XV4S 2IRFG 5BMZA 3G73A 4G7ZF 4A0XA 4M74A 2DK5A 3CUQC 3WTSC 2BGCA 5ILSA 3RDIA 1XMAA 2KJBA 1TLHB 2M5WA 1XCBA 1FY7A 3WTVC 3FM3A 3RKYA 4UVAA 2ESNA 1FYLA 2FRHA 3T8TA 2A3SA 4UV8A 2MLGA 1O7LA 1H9TA 5LHHA 3KP2A 3WE2A 2BYVE 3F22A 2WC2A 3DF8A 4G7OF 4I98B 3BROA 2EB7A 4D0PA 3MQ0A 2J5PA 3M1EA 3MWMA 4LLLA 4BH9A 2R3SA 3TOAA 3WTTC 5KK1A 1R5GA 2EFNA 3KEQA 4ZZLA 2QZ8A 3F8FA 4HV5A 2IA0A 3HSRA 4MEXF 4G6DA 5AIPA 1ON2A 1BM9A 1OKRA 2V79A 1F1ZA 4R1HA 2NNYA 4HYEA 3DKWA 2GA1A 3HRUA 2DPDA 4HQEA 3NQOA 3W6KB 5LRRA 4UHTA 2EFOA 4HLXA 1U3EM 1RZ4A 4A0YA 4S04A 3H3UA 4G94A 3GYHX 1HKTA 2V6CA 3L2CA
chains in the Genus database with same CATH superfamily
2OC6A 2CG4A 2K9MA 1UB9A 1HXDA 4MFDA 2I10A 5KNLA 2YU9J 4HF1A 1WQ2A 4A3EJ 3FM5A 3BT9A 1K6OA 4R79A 3PIOF 3PQJA 4EVIA 4AU7A 3I56I 1J0RA 5DS9A 1I27A 3DU6A 3ONQA 4U7BA 1XG1A 2LY9A 5J4VA 2DBBA 2GWRA 1BOBA 3SZPA 1J9IA 2XAQA 4M6YA 4JK1X 1MH4A 3ZQ7A 2M9HA 2GBYA 3BQYA 3V4GA 5L3FA 2R5YB 3K69A 1B8IB 5K1YA 2ZCWA 3HOYJ 3GO5A 5A2QK 2XB5A 4B4CA 4RB1A 1VQ5I 2LVSA 2M0MA 1Y0UA 2AQEA 2O7OA 1XDUA 2XAFA 4FT8A 2DMUA 3H92A 3L1PA 2QA4I 2H27A 3OL3A 1OISA 3UNGC 2WAQN 1XC5A 1BA5A 1KU2A 2KP6A 4C2UA 2CRGA 2EZKA 2ZXWH 3F72A 4UVBA 1XX5A 1W7PA 2K3FA 3F3XA 4E7KA 2KZGA 3OIPA 4I99C 3BJ6A 1F9NA 3JRFA 3A01A 2AQFA 1B9MA 5DUIA 5EDNA 4CYCB 3CQZJ 3EYYA 2MC4A 1H8AC 3V7RA 1OCCH 3R61A 1OCZH 3MZYA 2LRDA 4RGSA 1FJLA 3AG1H 4PUSA 1X2MA 5F6FA 1IV8A 2YS9A 3S1MJ 4LIVA 2EPFA 2KIUA 4F3QA 5DEQA 3H9QA 4Q47A 1TC3C 4U0YA 4WXCA 4BXXJ 4YIIA 1YW8A 2CFXA 2WWYA 4BUPA 3DBRB 2NVQJ 2MABA 1QQIA 1TQPA 1MBFA 5B5EC 3IAS2 3I64A 1A5JA 3WU1B 1Y8RB 2KKOA 2R7QA 4BQQA 2PMUA 1FX7A 2JSPA 3RZOJ 2X9DA 2NVUB 1XN7A 4O3MA 4UUSA 4RGUA 4W97A 1JJ6C 2R93J 4FETA 4BBSJ 1IDZA 2JK3A 3IV5A 2O6GE 4X6AJ 1AA7A 2ZJ2A 1GLNA 1JTXA 2JSCA 4GCVA 3WTYC 5DCMB 2L7ZA 5GTHC 1XB4A 3WGHA 2L54A 3AG4H 4TV7A 3SHFA 3ZMSA 1ZG5A 5LRSA 1F5TA 1U8BA 2E36A 2K27A 5IT9K 2HQ5A 3L2UA 2VQLA 2DN0A 1SANA 1D8KA 2XGEA 1O57A 2F5DA 5M5YJ 1YJ9I 3FMSA 1V54H 3FWEA 3Q5FA 2D5VA 5D8KB 2H1LA 2CQ7A 4XOPA 1WWXA 4CUGA 1KYWA 2VJ5A 4U88A 1YX3A 1UHWA 3U21A 1BI1A 4KJZA 4PDKA 2CSOA 2BXZA 2DA4A 2VN2A 2LMDA 2EZHA 3VEPA 3GTQJ 4OIOF 3I53A 2K5CA 3QPTA 4II3A 1BR2A 4CSWA 5LEKA 2LBFA 1LE8A 2VB6A 4V19K 3JRHA 3HPHA 1X58A 3G71I 3P7NA 3IH4A 3S1NJ 3V7CA 4KIFA 2A07F 4IQ4A 1ZR4A 4J00A 3BR3A 1RUOA 4I0AA 1QRYA 4UUTA 3KZYA 4B09A 4L9TA 2UZKA 3EDPA 2BVMA 2M7AA 2LYCA 2HEOA 2DMTA 4M9SA 1Y1WJ 3HOXJ 2HPIA 1X1BA 1EH7A 3QP5A 4OMZA 3HTSB 4GGGA 1IRFA 3M7GA 2K3PA 5D6FA 4AM3A 1FBSA 3RYRA 1JTYA 1XCVA 3OYCA 2RKHA 5LBQA 2O03A 1VQ4I 5GADJ 4UB8C 2ME0A 2Y0SA 4IXAA 2VONA 1AOYA 2LNBA 4XONA 3CCSI 1P6RA 1Y8QB 3C1DA 2XC7A 3KYDB 1J75A 4RB3C 5FKKA 2COMA 4PGGA 4LB6B 2R7OA 4G7HF 2QQ9A 4LG3A 2ID3A 3HGGA 2MW8A 2XAHA 2JA2A 1KZHA 1P7IA 2GAUA 2OBPA 3KPHA 4E70A 5M5XJ 3KETA 3QRFF 2HPMA 2IAIA 3FHNA 3N05A 3EETA 4LK1F 4HSRA 5D5XB 3HOTA 2ETHA 4AIDA 2MYSA 3ZPLA 4IHTA 4YFKF 4G8XA 2E19A 1WKMA 2K9LA 3IWFA 4M3FA 4C2TA 5FD5A 4HF2A 3K1NA 2H09A 2CQKA 2XF5A 3MFKA 2BE5F 4WXDA 2XIGA 4U0WA 2E1CA 3KX2A 1A35A 1FZPB 4KMFA 4X1EA 3GFJA 2F5FA 1FOWA 4LIUA 5E8IA 1O3SA 3JR9A 1Y6IA 3G1OA 2NS0A 4RAYA 3CDLA 3LSRA 3HRSA 1VI0A 4Y13A 2IS6A 1U9NA 1LDDA 2VBYA 3QOPA 5FKMA 2DMQA 4ZYGA 2P5VA 2OD5A 5CVVA 5HODA 3X2QH 5DD4A 4L5JA 2L01A 3H36A 2E5NA 4E7IA 3K4BA 2Z9OA 3T5XA 3H3VK 2WTEA 2VQGA 2R5YA 1MW7A 3ESWB 3L09A 1WFXA 5FFXA 1FP1D 4FTHA 2W82A 2P8TA 3H9JA 5ICCA 4L0ZB 6PAXA 2LTPA 3TO9A 3H5NA 3I4NJ 1X2NA 2A6EF 3HHGA 4IO9F 1SD6A 2Q1ZB 2QF7A 1Z21A 2VODA 1RR8C 1Y0NA 4AUXA 2IPQX 4KISA 1BC8C 2I8DA 1XSDA 4BE1A 2WA0A 4N9IA 2BVLA 3DFGA 3WE3A 3KEYA 4BJTA 2HOTA 4MNUA 2A61A 1G8XA 1W5CC 4MTEA 4NB5A 1IN7A 2EFPA 1JKOC 1YRNA 2LKPA 2DA2A 3KEOA 1U8RA 2V26A 3DPTA 1W5SA 2K9NA 1IO2A 2D2WA 2IBDA 1ZELA 2LY1A 1R1VA 4IHYA 4DBRA 2EQRA 1P2FA 3DWLE 3M07A 2KT0A 4B48A 1FMVA 4R8HA 2K4JA 3FK6A 5J47A 4BHPA 2ZMEA 4AVPA 3D1NI 2K85A 1QO0D 3I54A 4C2MJ 1Z9CA 2KIFA 1ZGWA 1ZGJA 1E0EA 2VKVA 3O3KA 2UXNA 2WY8Q 3E6BA 4A3FJ 4EM0B 2R0QC 2MBFA 1P4XA 5HDKA 3SYTA 3PIPF 5TRDA 3K10A 1BOAA 2MC3A 3EPZA 1G59A 1YQAA 2DJIA 3HKZA 2HTSA 2JQ7A 1LKXA 5H2FC 4BJ5C 2BHYA 3IUOA 4DIQA 1G4DA 3SEQA 4M6XA 1BL0A 4DQ2A 2QQBA 2CQXA 3VYRB 1OFCX 3PL8A 3NWSA 2Y75A 1WJFA 2L5QA 2BV6A 2LK2A 3G3ZA 1E3HA 1S7EA 3ZXSA 3QQAA 2W57A 1PUEE 2P0WA 2FXAA 2LC2A 2XGXA 3M8JA 4OMYA 4S05A 3GTKJ 3OOPA 5A2QZ 3IKTA 1X3UA 5J6XA 1R5HA 3VFZA 1LUJB 5JFRA 3ISPA 2Z3YA 2IS2A 4MIMA 1OPCA 5L3BA 5JR3A 2AXLA 2LFBA 4XN3A 3S14J 4CGZA 3FISA 2P5LC 4XSXF 1S9HA 3S3NA 3VYSB 3ZMZA 2HZDA 1YW9A 3KYCB 2FJ1A 1JGSA 2IA2A 3C2GA 3B6CA 3HC7A 2E1MC 3L2RA 2P5KA 3VSLA 2H1KA 2BHZA 2OTLI 3EUKL 5E3OA 4Q5SF 3GF2A 4JYKA 3DU5A 4UB6C 4PZJA 3OYGA 1W5TA 1D1BA 2VLAA 2ZFWA 3N4MA 1LDKB 1YLFA 3OWTA 2R5ZB 1QU3A 5ILVA 2X6WA 2PN6A 3S1RJ 2OA4A 2V9VA 3BG6A 1IXSB 1Q1HA 4N0BA 3QAHA 3GZ6A 2ZSHB 4QIWN 1XGOA 3H5AA 3FXJA 2FNPA 3W6VA 4XBFA 1IRZA 5CLSA 3REOA 2HYFA 4KICA 2DA5A 1MZBA 3RIRA 4DYQA 2BEOA 2BY1A 1FP2A 3S32A 1K83J 4BACA 2IGOA 1LQ1A 3FKJA 3HHHA 1WH7A 3TOBA 1Y39A 3ROUA 3CMMA 3J80K 4A0ZA 4LB5A 3T1BA 4L5EA 1SMYF 1Z3YA 1VQ8I 3CO7C 1CQTA 3HPGA 1Z7UA 4JX5A 3JRAA 2XGDA 1T38A 5IT9Z 2V1DA 5FFZA 5L3GA 3FXUA 3MKZA 4XLCA 2IS1A 3MVPA 2ZC2A 1ZTRA 3K7AJ 3WTUC 4IQJA 3GFIA 2NVTJ 2GOMA 3OYLA 4NHJA 1I1SA 4KT6A 2DA6A 2EIJH 3CMYA 1IJWC 3E5UA 2IEKA 2Z99A 1DGWY 4KN4X 2OCEA 5LGTA 5HLHA 4Y3OA 2JRMA 4XMYA 1GXQA 3GMEA 1Z7LA 2M87A 2QBYB 2M4KA 1P92A 3SDBA 3F9KA 4PJJA 1IW7F 1O3QA 1JKQC 1DPRA 3R6SA 2P7CB 2ACJA 1RETA 1XPXA 2ISYA 2NVYJ 3WTWC 2CW8A 2HU9A 2K7LA 2O3FA 1VQ9I 4ZC3A 1OYIA 4OAZA 2XF6A 2XASA 2ZNYA 4H0EA 2HI3A 2MA3A 1S7AA 3BJAA 4JOMA 2FNAA 2EZLA 1XGSA 3CMAI 5E79C 2E1NA 5K5RA 3HBLA 4C3HJ 1TW3A 3L7WA 2V1UA 3QYBA 2DK8A 2M4GA 1KQ0A 2JUGA 2ZKZA 4IPAA 2V9KA 3CCQI 2OTJI 3KLOA 5M3FJ 1MJAA 2E35A 1HLVA 3RPQA 3CCLI 2EIMH 1QVTA 2UUZA 2F4IA 2VT2A 4BDYA 5L3EA 1SVOA 4CHUA 2VPLA 2KFDA 2G7HA 2HFHA 2O5RA 3V8LA 2ZBKA 3ZN0A 5DM6F 3FXKA 1D0XA 1SAXA 4EQQA 3CCEI 2MH2A 4A2UA 4OINF 2GXBA 5JVTA 3VDXA 1LFUP 1Z6TA 2MSYA 3J81K 4MTDA 2ZFUA 3TO6A 3QP6A 3T8RA 5KAFC 3IAM2 1I5ZA 3LSTA 2K40A 4L9VA 4D9JA 1NG6A 3TMOA 1V5FA 2A6HF 2IJLA 3ZP5A 1T0FC 1Y1VJ 3GCMA 4ITVA 3C18A 3JSOA 2WV0A 1POGA 2W48A 3JRBA 4XRFA 5K7HA 2QYOA 1P9QC 1I6HJ 4I0BA 1U5TB 3K4KA 4II2A 3E1SA 3VOEA 1R23A 1UELB 1OR7A 4HQMA 1D0ZA 1KQ9A 3TKYA 2Q0OA 2V1XA 2V4JC 4I76A 3BOQA 4AYBA 2O8XA 2TDXA 2XSDC 3CCUI 2ADUA 4BY1J 1B6AA 2KIQA 3E97A 5J40A 3BZ6A 4MHGA 3CUQB 3VODA 4ZYDA 5D8LB 2OZ6A 4BKXA 3OSGA 3MKYB 1P4AA 4IKFA 2CMPA 2DCEA 4LLNA 3RQ4A 3PO2J 4FE4A 3E6CC 3H1CA 3ZQHA 3KLNA 5FO5A 1CF7B 1FOKA 2DFEA 3HOVJ 4XKCA 2XPVA 1TT5B 4BGDA 4MQVA 1YS7A 9ANTA 5TJJA 1YS6A 4DJAA 2WAFA 1VQMI 1B9NA 3RPUA 2AO9A 3BY6A 2B63J 3E5QA 4IHXA 3BC8A 1E3OC 1OLTA 1RI7A 3OMYA 2H6CA 2XRNA 2DA7A 2VIXA 1GV2A 2R7VA 4CCMA 3NAUA 3R4KA 2GLOA 4QSHA 2WADA 4C3IJ 3COAC 4LK0F 4EJWA 1DUXC 2ZJQF 4XLNF 3M4OJ 2R5ZA 4M9XA 4O5VA 2IGNA 3OOUA 5JHFA 3OYAA 2OCCH 1BBYA 4HOBA 4BJ6C 3PJRA 2W24A 5C3EJ 3PO3J 2VXDA 2DOEA 4Y15A 2V1NA 4IEJA 1WJCA 4BU2A 1MBJA 4XIDA 2Y9ZA 2W1OA 3W2AA 3EUHA 2PFBA 4RAFA 2GOXB 3DBLB 1SD5A 2NOGA 1QA6A 5IP7J 2ID6A 2CJJA 1MSEC 1A6QA 4PJLA 1JKPC 3LSPA 1A04A 1MBKA 3R60A 5CVJA 2EFQA 2JA7J 1A36A 2JVGA 4E6KG 4HDUA 3E3VA 2A5WA 1H0MA 2NAZA 1Z77A 3OL4A 4ZYEA 3I4PA 4AIHA 2XUBA 2CUZA 1P7JA 1IUFA 1XSVA 3RI4A 2R7RA 3KP3A 1E3PA 1AKHB 1S6LA 2DYRH 5K5OA 1L3LA 5JLWA 1JXSA 2FE3A 1W4MA 1LPQA 4GFBA 3G1MA 2ZMEC 2NVXJ 4AWXB 1ETQA 2Z2SB 1MMNA 1G2HA 4OAYA 1RESA 1KYZA 2QQ8A 2QBYA 4ESFA 5FLVA 1BW5A 1GVJA 3BPVA 4BE0A 2EV5A 1WVRA 4QWQA 2LKXA 1STZA 4NDLA 5DM7F 3SFIA 3Q9VA 2VPRA 3BJOA 2VJIA 1XGNA 5LEJA 1B59A 5E1XA 4CYDA 5BPDA 5FLMJ 2DODA 1O4XA 3LSIA 1AWCA 4F52A 2EV0A 3J7AY 2DDBA 2W84A 3TO7A 2P81A 3HRTA 4QPOA 2HDDA 2L0KA 4Y17A 1EA3A 5FJ8J 4A3CJ 3RQIA 3FIWA 2Y48A 3DPLC 4CH7A 1KGSA 2P6SA 5JLXA 1SVLA 2GA2A 2HKOA 1XDSA 2XHKA 3PNVA 1W0UA 4XLAA 3IL2A 2CYYA 1MBEA 3PUBA 3VWBA 3LSGA 1LVKA 2RGVA 2W25A 3HOUJ 2A6TA 1WSUA 4DW6A 3HJEA 3P5JA 2LSOA 3OR2C 3KFWX 3HRMA 2EILH 4AD9A 3ZR8X 1NK3P 1MMDA 3GTMJ 4MLOA 2A68F 3E5XA 3LFUA 1HOMA 3F6VA 4F7ZA 3J80Z 2HXOA 3D5LA 3I58A 4H4KC 5J8CA 5EGOA 1R9TJ 1Z91A 1PJRA 2Q2EB 2W00A 4JX4A 4D5CA 4MO7A 5LGNA 1ONVA 4M71A 4G12A 3O8GA 1RUNA 3BCBA 1IXCA 2O0YA 2PMZA 4IVNA 1MH3A 2E7XA 3K1PA 3HOSA 1ZAOA 3RTRA 2NOJB 4KIBA 1SEUA 2IT0A 4A93J 5E18F 2NRAC 5HS7A 4RM3A 4G6QA 3UKGA 4B3AA 5IP9J 1FBUA 3JRDA 3BLYA 2DLLA 1R5ID 2EH3A 3CDHA 2RDPA 5DD8A 2JRTA 2YSRA 1YG2A 3G6EI 1PP7U 1T56A 2K86A 2FA5A 3F0CA 1X1DA 5IT3A 1RKWA 1ZN2A 3BWGA 2M3AA 1S7OA 1R4NB 1FOXA 2VBZA 2NYXA 1IRGA 2WAEA 3BR5A 1WJBA 4I02A 4B1RA 4WK8F 1MD0A 3IRQA 3CUQA 2VJJA 2L7FP 4BXFA 5F04A 3TBIA 5FLXK 4XLFA 1W7PD 3D5RC 4XLPF 2BZTA 2DMNA 4RBOA 1EH8A 3LA3A 1T6SA 1JKRC 1LFPA 1FTTA 2FOKA 2M45A 4QPQA 2PQ8A 4B44A 2F2EA 2E34A 1HBXG 2PEXA 1I1GA 2KLOA 2JA5J 4U0VA 2JN6A 1R49A 4ZDOA 2VT3A 2GXGA 3KZIC 1YE9A 1R71A 1K4TA 2DT6A 1JI8A 2DYSH 5GAHJ 4HPQA 4A12A 2ZNZA 3BG3A 2HVRA 3FMRA 1SFXA 5HVQC 5H20A 3GXOA 2DPUA 5AONA 2VUMJ 1TZLA 1QHHD 2AXTC 2UV1A 2CH0A 5J4YA 4Z6YA 5HNFA 1TWHJ 3BDDA 2GIZA 2M1BA 4BS9A 4WCGA 3ABUA 4ZJZA 2X48A 1IN5A 2RQQA 1IN6A 3CP2A 2X4HA 1YFHA 1KU9A 1B72A 2HDCA 5HLIA 3J81Z 3A4CA 1SFOJ 2VJ4A 1TT0A 3PM1A 3I0TA 1A6IA 3DKXA 2XAJA 4HG2A 4IL6C 5CVRA 3ZQCA 3AKZA 3BR6A 4BQOA 1M1EB 2XRLA 3AG3H 2CUEA 4EEFG 2JA6J 3HSFA 2CW7A 4XSZF 3BR1A 2LF8A 2V9PA 2H94A 2DAOA 4GYGA 3ASOH 4DOZA 4NUBA 3Q0WA 3LA7A 3K9TA 1WCMJ 4QLCU 1GXPA 1FSHA 3PSIA 5ILUA 1V3FA 2KRHA 3TP3A 2EA4A 2JA8J 2K9QA 1Z0XA 1FIAA 4BXUA 2XF7A 5J1UA 2YUSA 3MMYB 2C6YA 3KP6A 3K70C 1B8IA 1QGPA 3PNYA 1MKMA 3DTEA 1SFKA 2F5EA 2XAUA 1OCTC 4I2OA 3OS0A 3AG2H 2XKPA 4GYIA 5FRMA 1AHDP 1ERDA 2DDAA 1N77A 1H89C 3GFMA 1X1CA 3K1MA 4BL0B 2X51A 3M9AA 4XOTA 2CV2A 4WX9A 2PX9A 1H88C 2M8GX 1JJ8C 1E2XA 3HXLA 2QSHX 2R7UA 4CZCA 1JUMA 2MLKA 2ZXIA 3M8FA 3S16J 3VB2A 1ZQ3P 1X19A 4HSTA 1IUYA 1B4AA 2NS7A 2FBKA 2STTA 4XL9A 3GZNB 4CYCA 3OY9A 5F0HA 4I7HA 4S0HB 3KCCA 5E1WA 1Z6RA 1I39A 3M1CA 4FX0A 5B66C 3QU3A 1USSA 3HDDA 2O8KA 2DQRA 4MGRA 3F6OA 4L18B 5CYVA 4KN7X 2EWNA 2FBHA 2JJ7A 2LLKA 3HL2A 3BTIA 2R7TA 2OUMA 2EFWA 1OR7C 5EEHA 2QWWA 4ENKA 2WAQA 1F43A 4B43A 1LB2A 1Q1VA 4P55A 1NK2P 3I59B 2UWMA 1BIAA 3HM5A 3HOZJ 2WB1N 2M0CA 4P96A 4LG0B 1TQIA 1UFMA 4BDZA 1BI2A 2DQLA 4PK4A 2WBMA 5IYBJ 4Q48A 1RRJA 1EKEA 3RCOA 3HTUA 4A3DJ 3HZJA 1FYKA 3HG9A 2EK5A 5D4SA 5DCMA 2GXAA 4NC7A 1ZRCA 3RKWA 3FBIB 3MAJA 4CCJA 2DTZA 3C7JA 4FCYA 5E3LA 3QODA 2DTRA 3IKVA 5HDNA 1ETKA 2KL4A 4ENJA 1DQUA 4LD5A 4E4HA 1G3YA 5AIQA 1MBHA 2H8WA 4CCLA 2XAGA 3O6BB 4Q4ZF 2B9SA 3F21A 2Q2EA 1X4PA 4EGYA 1S29A 2Y31A 2R4GA 2FU4A 1KQ8A 5E20A 2QQAA 1D5VA 5BOXA 3LSKA 2ZB9A 3E6MA 1T08B 1ZHFA 2CS3A 1UZCA 1PVEA 5CKTA 3LAJA 4XKBA 2BW3B 3S2DJ 1GHCA 3ABLH 1VNDA 1WJDA 2CQNA 1GVDA 1J5YA 4KIGA 2HZTA 1JHFA 4RM2A 2RAEA 3RKXA 4AVZA 1SD4A 3IHUA 2A69F 5JHUA 3BZKA 1SMTA 1ETVA 2DA1A 3R0JA 4X0GA 4ENMA 1WJAA 2IVMA 3OYMA 2BY0A 2YX4A 2BY3A 4YFNF 3V8KA 1MNDA 5FROA 3S2HJ 2HVQA 3WG9A 3OS2A 3TL4X 1MNMC 3PUFA 3DQVC 2K9SA 1KA8A 2XPWA 2J5OA 3KIOA 5LGUA 1QPMA 1S5LC 3ERMA 1EJ9A 2DXIA 3CC4I 5ICEA 2KRCA 4JBAA 2MFZA 5B1AH 3GTJJ 3G4SI 4EGZA 2RNJA 4LLGF 1TWFJ 4AIKA 4NQWB 3IC7A 3AL0C 1CGPA 4M3EA 4P9UA 2OAZA 4N4OB 3JRGA 5ICGA 3FKIJ 4GRIA 5E17F 4XRSA 3L9FA 1OCPA 3G1LA 1D3YA 3CO6C 5CPRB 2QGUA 1XSXA 3I4MJ 3ZMUA 4KYWA 2EJRA 1ZLJA 1N75A 2VC0A 3W3CA 1DGRM 5LD2C 1DDNA 2HTJA 4HNUA 4NNJA 2L7KA 2ECBA 4QTRA 3ECHA 2E1MB 2FMLA 5F0CA 5F1JA 4HX4A 3NRVA 4XKVA 3J7YJ 2HYJA 3WG7H 4UVCA 4DYCA 3BZCA 2ZXJA 4CCNA 1U9OA 3OYBA 4BAYA 1VTNC 1FEXA 2DFIA 3OYIA 1FSEA 4UNOA 3OYHA 2LOOA 3FF5A 1SVMA 1Z67A 3F8CA 2KRFA 2JUCA 4KMUX 4PJMA 3OS1A 1F4KA 1SFUA 1I3QJ 3TEDA 1U2WA 3CJNA 3JSPA 1PP8F 5CVIA 4YELA 3OYDA 1BN5A 1YJWI 2IGKA 4ZTFA 1ZG1A 2OJED 1NHAA 1IRXA 3K4CA 3CJRB 4WWCA 5HLGA 3MD2A 2ELJA 3GLXA 1VQPI 1ZK8A 2F4OB 4BY7J 3C3WA 1WRJA 4NBQA 4Z2YA 1YTYA 5EJCA 3WTXC 3CUOA 5B3SH 3M3YJ 2VI6A 4BNCA 1S3JA 5DCFA 1OCRH 5FLXZ 2VBWA 2HQRA 4DZJA 1X1PA 3R0AA 4EV0A 4F91B 5K7ZA 2RQPA 1K78B 2PG4A 3CCVI 2DFFA 1TW2A 3BTLA 1GUUA 4LJZF 2LDUA 2D1HA 4EMSA 1WPKA 1H9GA 4YG2F 1P4WA 1WHUA 3KE2A 1QVUA 3ABTA 3GEZA 2YPRA 2M7BA 4EJOA 4KA4A 3ZQLA 5FB2A 4JX6A 2BBYA 5EEGA 4IRHA 1DP7P 1N78A 4F92B 1QZEA 3LA2A 3BG9A 3OYNA 3SQNA 4V2GA 4RLQA 3ZQIA 2HS5A 3HGYA 4UUSB 4AIJA 3RYPA 4PJ0C 5TGTA 2G9WA 4C30A 1Z05A 1PDNC 2XDVA 3I59A 4A3MJ 2BY2A 3J7ZI 3S3OA 1A31A 3T0YA 1IZ1A 3A0BC 3TP0A 2M30A 2OZUA 4ON0A 3ZGKA 4LG0A 2MH9A 5F1RA 2EBIA 1S72I 4BEHB 1W0TA 3DTKA 1V4RA 2FX0A 3B02A 5C44J 1R22A 2HGCA 2L9NA 3GBGA 3CMEI 3JRIA 1JUPA 1U0JA 3LAPA 3H9GA 4FASD 1MJBA 1WH5A 2FSWA 4RGXA 3OR1C 2R7ZJ 5DYMA 3OYFA 2D1VA 3IWZA 3WGIA 3HOWJ 4A3BJ 4NC6A 4XN0A 4MFEA 5EYRA 2A5YB 1O3RA 1IDYA 3DLAA 3MZHA 3QOEA 4P9FA 3GTPJ 3ABMH 2F5VA 2CQQA 2N8GA 3CCMI 4IRIA 4K2EA 3CC2I 4A3GJ 1YO5C 2R7XA 3CC7I 5H6RA 2PJRB 1KU3A 5IOYA 3U2RA 2WB1A 2LBFB 5JI6A 3FXMA 5F27A 1LE8B 4EM2A 4Y52J 3W2WA 3MN2A 4YFXF 3JAMK 1G3WA 4E7ZA 3IRRA 2CO5A 4FHTA 2L9RA 4HW0A 1AU7A 1LNWA 5GPAA 4KNYA 5IPAA 4WF2A 3JTGA 3J7AO 3N97A 1IC8A 3BQZA 3Q3SA 1DU6A 2OQRA 4U7DA 5E3MA 4PFPA 5FKNA 1TWAJ 4XKWA 3SXYA 1FLIA 3AFHA 4Y33A 1SC7A 2DW4A 5H6QA 2EZIA 5D5UB 3ZMVA 4L9JA 2Y9YA 3HUGB 3LQQA 5M3MJ 2HR3A 4HX8A 4D1QA 2ZO4A 4LFUA 2P7VB 3WODF 5GAEJ 3OV8A 3GLLA 4RGRA 5J1YA 2ELHA 2M8EA 2G7UA 4JQFA 4KDPA 5LHGA 2OU2A 4Y7NJ 2HOAA 4CDGA 3LFKA 3OSFA 1LVAA 2L4AA 3VSKA 3NEUA 5IYDJ 2ESHA 3A1YA 1LEAA 2JPCA 3W2VA 1IAWA 2E2IJ 3GX4X 2HOEA 2NS8A 4E7JA 5TISC 2JZYA 2QUFA 1V55H 3K70D 3TW7A 5IY5H 3S1QJ 1RC9A 4XNFA 2IA1A 4NQWA 4NC8A 3ZQQA 2B7EA 3OIOA 2X6XA 1T33A 1G6NA 2CWEA 3UR3C 4ABZA 2IP2A 5EG0B 3CD6I 3SDGA 3P9IA 5BS6A 3VYUB 1C0WA 1HW5A 4XR6A 1KONA 5C4XJ 5DUKA 2L9VA 1VQKI 4HAMA 4LITA 4XICA 1ZLKA 1ZYRF 1HSTA 3I5UA 1UJ8A 1ZREA 4RS8A 2PLYA 3LL7A 2E7WA 4XORA 1N25A 2CW0F 5GP9A 2E2HJ 1ZGAA 1IXRC 1YW7A 2R7DA 3ZQGA 1T39A 3DP7A 4ETSA 2HYGD 2XB0X 4HA8A 3FBNB 5LHIA 4PSXA 1HQCA 5J3LA 3E6DA 1B1BA 1JE8A 3H5RA 2QM3A 2BXYA 4HEA2 4GXOA 2Y2ZA 4HX7A 3FMQA 4RB0A 3S2WA 3PSFA 4YIRX 3O2PE 2DFHA 2LY2A 1S8NA 3G2BA 3P9KA 1WZ2A 2JVHA 2VE9A 2E71A 4P5OA 3P9CA 3L2VA 3BR2A 1BI0A 2RVCA 3RJPA 1X1AA 2DI3A 4KT5C 2FQ3A 3WTZA 2CGPA 1TNSA 5KAIC 4MEYF 1ITYA 3OYKA 1UMQA 2ME6A 1LJ9A 5FRNA 2D45A 3MKLA 2ZXHA 2KZVA 1OYWA 3C2BA 3ZCOA 4ZTJA 4DYRA 2H8RA 3SZTA 2ICWG 1W1WE 4HBLA 2L7MP 4M6VA 2P6TA 4ASNA 1YRNB 1ZRFA 3RPUD 2OF7A 1K78A 5BPIA 2LREA 1R1TA 2L4MA 1EF4A 3HKZN 3DEUA 2Z5UA 5LFAA 2XSJC 3TGNA 4A69C 1YITI 3KP7A 2ZMEB 3IH2A 1RIOH 5F08A 2DT7B 1MNEA 4RDUA 3QYFA 3WHCA 2GIVA 3DEWA 5HS9A 2VQHA 4A6DA 1K6YA 3Q9SA 2NNNA 5CJ9A 4M3BA 4C3JJ 1K7AA 1HKQA 2VKHA 4EJTA 2QVOA 2BOLA 1MIJA 5GPCA 1XMKA 2QKLB 3F23A 4XQFA 1NTCA 2HQNA 3V42A 1FYMA 1RNLA 1DU0A 4OU0A 1ZRDA 1XTAA 1USTA 4BEHA 2COBA 1OQYA 4G9YA 3PNTA 1R00A 1IGNA 1NG7A 1J59A 3BTJA 2L3DA 4IOCF 2KJCA 4PFOA 4HNVA 1HSJA 4N9HA 2KQRA 1U5TA 1BJAA 2HQAA 1T98A 1ZARA 3EYIA 4EM1A 3B73A 3JTHA 2G0EA 3S3MA 2GZWA 3ELKA 2X85A 1MMGA 1BW6A 2DJNA 3KP4A 1FWZA 5FGMA 3CDIA 2FMYA 3ECOA 2DO7A 2VXZA 3V7SA 2FD5A 2PJRA 3DEEA 4V2FA 3ML6A 1WGXA 1TWGJ 1Z3XA 3TW6A 2E1OA 3S17J 2PI0A 3F8NA 3WU2C 1YI2I 1L0OC 3IH3A 3VYTB 4CICA 1HF0A 1O7FA 2YX7A 1F36A 1HCRA 1CF7A 2KHMA 4IZZA 5F64A 3DTIA 3K2AA 4B8XA 4EJUA 5D6EA 3DLLF 2EIKH 3FXOA 4A3IJ 3ZMTA 4RAGA 4ZZDA 2XVCA 3CCJI 4D5FA 3CF5F 5EZHA 2NXNB 1X4OA 4I01A 4RLFA 1SD7A 2QEXI 1ETYA 2O61A 1YIOA 3BP8A 1K61A 2AS5F 1T0FA 2Y69H 2DOFA 2FEZA 3LOCA 4PGHA 3HUGA 4ZDLA 4LGWA 1R36A 3DXJF 4ESJA 3U1DA 4UUVA 3GFLA 3NWTA 1TP4A 2PBIA 5HS8A 5GAGJ 3LMMA 3FX3A 3TDUC 3QYEA 2HXIA 2K02A 1WJ5A 5IP6A 3ZRGA 2YR2A 2X1CA 5L3CA 3H0DA 1YOVB 3H3ZA 2YU3A 2LR8A 3S8PA 3HIFA 2F6CA 2R7WA 4A3KJ 5LLQA 3DV8A 3GUDA 3Q0UA 3W6JB 1D1AA 2E60A 4FE7A 2H6BA 2LF7A 1FT9A 4ZYHA 1TQMA 2V6EA 4BQNA 3QU6A 4CZZA 3QWLA 2RN7A 3AAFA 2Z33A 2KPMA 4UY8I 3SJMA 3A03A 2XKOA 2HVSA 2OPTA 3KZZA 3K4MA 5EG0A 4UXNA 1TL8A 2EA2A 3CJQB 3CF2A 2W7NA 2CU7A 2EV6A 5ED4A 1W36C 1BC7C 3EQLF 5E8GA 2L9SA 4FISA 3FZVA 2DMPA 4W1UA 2MG4A 2HOSA 1D8JA 4DZPA 4IHVA 3ASNH 2V7FA 2ISZA 4J01A 3HB9A 1O3TA 1G3TA 1AKHA 2IGMA 3OIQA 2Y0MA 3JAMZ 5L3DA 2KIMA 2DA3A 4I09A 5IOZA 5GTIC 4FX4A 3GWZA 4OIPF 1LFBA 1UHSA 1GT0C 3CESA 4BQAA 2HKXA 3CCYA 4M73A 5ERIA 1D1CA 2QLZA 4M3GA 3D0SA 1SFEA 1ORKA 3ZN1A 3F8MA 3K6GA 1APLC 4F55A 1UCRA 2ZJPF 3TDZC 2MD0A 1ENHA 2CUFA 4PJNA 2VBXA 4HDVA 5DDGA 4D7NA 3JRCA 1MDMB 3WGGA 1EV7A 4HV6A 1OMIA 1K4SA 1UG0A 4E7SA 1V5GA 4WXHA 2VOOA 4CXFA 4RB2C 1BR1A 2B0LA 5FKOA 3WHBA 1VQ6I 2A05A 3IP4B 5BNGA 2IW5A 1ODDA 3GZ5A 4GO1A 2Z1DA 4RAZA 1K79A 1OJLA 2X0LA 5C4JJ 4ENNA 2JTVA 4BYYA 1D0YA 1MBGA 2JT1A 1GDTA 1JT0A 1BI3A 2K4BA 1R58A 1IN8A 2TRTA 3FDYA 1VFCA 1QZYA 3SEZA 4ZH4F 4XRMA 3QPLA 3PFIA 1J2XA 4UV9A 4CA0A 4CCOA 2RC4A 2F5CA 4AYBN 3KYLA 4IRGA 1PUFB 4J19A 1LDJA 2VQCA 1JHHA 3BR0A 1TBXA 3DPUA 1J7KA 1R6RA 1QHGA 3JREA 4HRIA 4L9NA 3OYEA 3WU0A 5D5VB 4IX7A 3LQRA 4AC0A 3QPHA 5D4RA 5ICFA 3PFYA 1YX5A 3MKWB 4A3LJ 3U9GA 1E17A 3NARA 1TNTA 2LH9A 2VL8A 4M72A 3CLOA 3O8HA 3ABKH 1KU7A 4A6EA 2WY7Q 1FIPA 4HNTA 1ETWA 1MGTA 1MMSA 4HZFA 1X3WB 3E7LA 5FKLA 1DPUA 2HNHA 2R7SA 1GV5A 3JW4A 1FOYA 2DT5A 2KISA 1XS9A 2RV8A 2X6YA 4B3XA 4U87A 4OIQF 1T95A 2X1EA 3BG5A 2VE8A 3EUAA 1QBJA 3HSEA 3EUHC 1R4MB 5KCMA 3ULQB 3GW2A 3I71A 2JPBA 1REPC 4D7MA 4BHBA 2W85A 3CP8A 3F8BA 3K4JA 3RZDJ 3KP5A 1ETOA 4IF4A 1VQ7I 1I50J 2FUG2 4O6JA 4E7LA 4RA2A 5DTDA 2IS4A 5CVUA 3RKQA 3CJTB 1JGGA 4BBRJ 1UAAA 2Z16A 1FNNA 5DV5A 1MMAA 4C9YA 2LP0A 2CV1A 2F48A 4N4NB 2STWA 4DBQA 3SFZA 5HDGA 1R7JA 3JCUC 4M9ZA 3Q0VA 1BIBA 4YIFA 2QSFX 1WI9A 4HLYA 3MEXA 2ELKA 3CTAA 3L00A 1ZR2A 2LG4A 2CFOA 4EJVA 1ULYA 4OWRB 5HNHA 2L02A 5M5WJ 1MJ9A 1R1UA 1ON1A 2R7FA 3K2ZA 4I6ZA 3L2WA 4LMYA 2VC1A 3BPXA 5HLTA 1MSFC 5CQGA 1T2KA 3ZMDA 4KUMA 5J8FA 1FPQA 5HOOA 4L5IA 4GDFA 2FOWA 4A5MA 3ERED 2QSGX 1G3SA 1FBQA 2X1DA 3FXRA 4F93B 5FD6A 2Q8KA 2UXXA 1UHMA 3QPSA 2MD5A 3BCAA 3PQKA 4FQGA 1OYYA 1VZ0A 4MQ9F 4OOIA 2ZJRF 1HA8A 1LEBA 2VASA 1XD7A 2KMUA 3TQNA 5EZGA 3VPRA 1NH3A 2P4WA 3A02A 4XRSG 1OCOH 2PMHA 1HKSA 3HYIA 1IF1A 1BJZA 1TTYA 1Z1DA 2PJPA 1SAUA 2KDZA 1YYVA 3M8EA 5KHDA 2VOPA 2RNGA 3MCZA 3AL0B 4DNCA 5KVRA 3FXQA 2WV1A 1FMWA 4PCQA 2O9LA 1ZH5A 4Y4RA 4A5NA 4HF0A 3K0LA 1QNTA 2HWVA 5BQTA 2FF4A 1W7PB 1U78A 5JVGF 1YJNI 2W4SA 3GVAA 2DU9A 4ZDPA 2FBIA 4BHCA 1FC3A 4BE2A 3RSNA 3A01B 4XM3A 3I55I 2QENA 1ZG3A 3V8JA 5K5QA 3L2QA 1IV6A 5E1ZB 1EH6A 1U6GA 3GTLJ 1HDDC 4OIRF 1RKTA 4XLHA 5D5WB 3LWFA 3A2KA 4P1WA 1VQLI 1IN4A 1T8IA 1HW2A 3ZOBA 2AHQA 4CO8A 1I6XA 3BG7A 1BR4A 1HDPA 4ESBA 2GQQA 3FHZA 2E5ZA 1IG7A 1TWCJ 2OQGA 1QZZA 4M3DA 4IHWA 4L0YB 1HW1A 3ZQFA 2JMWA 5E3NA 5CQEA 2ECCA 2XROA 2IXSA 4IJAA 3LSHA 2M34A 1MDMA 2TCTA 1XGMA 2XPUA 1VQOI 2E2JJ 4IHSA 4KFCA 1U5TC 1V5EA 2XV4S 4IOAF 2DOAA 3DKYA 2IRFG 2PMZN 5BMZA 3G73A 3FXLA 1QPIA 1D5YA 4G7ZF 4G6TB 3E0JB 4A0XA 4M74A 1RPWA 2DK5A 2L2OA 2OV7A 3CUQC 1JT6A 3WTSC 2BGCA 5ILSA 3RDIA 1XMAA 4B47A 2KJBA 4E7HA 1VQNI 3I3LA 1TLHB 2CV0A 5EGOB 3BTCA 2M5WA 4KITB 1YHQI 1XCBA 3A0HC 2EINH 1PUFA 1HC8A 3OYJA 1FY7A 3WTVC 4PSWA 3FM3A 3RKYA 1I3AA 4UVAA 2ESNA 1FYLA 2FRHA 3H35A 3T8TA 2A3SA 3CLQA 4JP0A 3U1KA 4UV8A 2X6OA 3H0GJ 3FK7A 3C2HA 2MLGA 3K4NA 5EEAA 1DP3A 2MGQA 1JUSA 1O7LA 2Y0SN 1H9TA 1J09A 5LHHA 3KP2A 3WE2A 2VKEA 2BYVE 3I9V2 3LNQA 3F22A 1VF9A 3D5SC 5EF6A 2WC2A 3DF8A 3K4LA 4RMNA 4G7OF 1Y56A 2BW3A 4ANJA 5K7FA 2HDWA 3DCFA 4I98B 3BROA 2EB7A 3S93A 4D0PA 3LSJA 5F0FA 1YIJI 3MQ0A 1ZKGA 2J5PA 1PYVA 3M1EA 3MWMA 4LLLA 3S15J 4BH9A 2R92J 1ACIA 2R3SA 3TOAA 3GTOJ 3WTTC 5KK1A 1UG2A 3HEFA 2GM4A 1FTZA 1R5GA 2QCOA 3DBHB 1X3ZB 4XLEA 2EFNA 3KEQA 1WJEA 3CZ6A 4ZZLA 2JWTA 2QZ8A 3F8FA 4HV5A 2IA0A 3SZGA 3HSRA 1WI3A 1ETXA 4YEJA 5J1RA 4EATA 4MEXF 2ZSIB 4DGWB 2VKDA 4G6DA 5AIPA 2KDOA 1ON2A 1W36D 2RREA 1BM9A 2XGCA 1OKRA 2V79A 4LOCA 1F1ZA 4YRVA 4R1HA 2I5UA 2NNYA 4HYEA 3DKWA 4XK4A 2CUJA 2GA1A 5IYCJ 3HRUA 5B1BH 2DPDA 4HQEA 3NQOA 2FQ4A 2F4MB 4ZYAA 3W6KB 5LRRA 4UHTA 2EFOA 4A3JJ 3GTGJ 4HLXA 4CCKA 2LD5A 1U3EM 1RZ4A 3B6AA 4A0YA 1RR7A 4S04A 3CCRI 1B72B 2LKSA 3H3UA 3LSMA 4G94A 3GYHX 2Y30A 1HKTA 2M2EA 3MZ8A 2V6CA 1XMXA 3L2CA 2QKMB
chains in the Genus database with same CATH topology
2CG4A 1UB9A 1HXDA 4HF1A 1WQ2A 3FM5A 1K6OA 4R79A 3PQJA 4EVIA 1J0RA 1I27A 4U7BA 2DBBA 2GWRA 3SZPA 1J9IA 2XAQA 4M6YA 4JK1X 3ZQ7A 3V4GA 5L3FA 3K69A 5K1YA 2ZCWA 3GO5A 5A2QK 4RB1A 1Y0UA 2H27A 1XDUA 2XAFA 4FT8A 3H92A 1KU2A 4UVBA 3F72A 1W7PA 3F3XA 3BJ6A 1F9NA 1B9MA 5DUIA 3EYYA 3V7RA 3R61A 3MZYA 4RGSA 5F6FA 2KIUA 5DEQA 4Q47A 4U0YA 4WXCA 4YIIA 1YW8A 2CFXA 2WWYA 1QQIA 1TQPA 3I64A 3WU1B 2KKOA 2PMUA 1FX7A 1XN7A 4O3MA 4RGUA 2O6GE 2ZJ2A 2JSCA 4GCVA 3WTYC 5DCMB 1XB4A 3WGHA 2L54A 4TV7A 3SHFA 3ZMSA 1ZG5A 5LRSA 1F5TA 2K27A 5IT9K 1D8KA 1O57A 2F5DA 3FMSA 3FWEA 3Q5FA 5D8KB 1WWXA 1KYWA 4U88A 1UHWA 1BI1A 4PDKA 2CSOA 2VN2A 3VEPA 4OIOF 3I53A 3QPTA 5LEKA 3P7NA 3V7CA 4KIFA 2A07F 1RUOA 4I0AA 3KZYA 4B09A 4L9TA 2UZKA 3EDPA 2HEOA 4M9SA 1EH7A 3QP5A 4OMZA 3HTSB 4GGGA 1IRFA 3M7GA 5D6FA 1FBSA 3RYRA 1XCVA 2RKHA 5LBQA 2O03A 4IXAA 2VONA 1AOYA 2LNBA 1P6RA 3C1DA 1J75A 4RB3C 2COMA 4PGGA 4LB6B 4G7HF 2QQ9A 2XAHA 3QRFF 4E70A 2GAUA 2OBPA 3KETA 3EETA 4LK1F 5D5XB 3HOTA 2ETHA 3ZPLA 4IHTA 4YFKF 4G8XA 1WKMA 3IWFA 5FD5A 4HF2A 3K1NA 2H09A 2CQKA 3MFKA 2BE5F 4WXDA 2XIGA 4U0WA 2E1CA 1FZPB 4KMFA 3GFJA 2F5FA 5E8IA 1O3SA 2NS0A 4RAYA 3HRSA 4Y13A 1LDDA 2VBYA 3QOPA 4Q5SF 4ZYGA 2P5VA 2OD5A 5CVVA 5DD4A 4L5JA 2L01A 2Z9OA 3T5XA 2WTEA 3L09A 5FFXA 1FP1D 2P8TA 5ICCA 4L0ZB 6PAXA 3TO9A 2A6EF 3HHGA 1SD6A 2VODA 2IPQX 1BC8C 1XSDA 4N9IA 3DFGA 3WE3A 4MNUA 2A61A 4MTEA 4NB5A 1IN7A 2EFPA 2LKPA 3KEOA 1U8RA 3DPTA 1W5SA 2D2WA 1R1VA 1P2FA 4R8HA 2K4JA 4BHPA 2ZMEA 4AVPA 1QO0D 3I54A 1Z9CA 2KIFA 1ZGJA 3O3KA 2UXNA 3E6BA 4EM0B 2MBFA 1P4XA 5HDKA 5TRDA 1BOAA 2MC3A 1YQAA 2HTSA 1G4DA 4M6XA 4DQ2A 2QQBA 2Y75A 2BV6A 3G3ZA 2W57A 1PUEE 2FXAA 2XGXA 4OMYA 4S05A 3OOPA 5A2QZ 3IKTA 1X3UA 5J6XA 1R5HA 3VFZA 5JFRA 3ISPA 2Z3YA 1OPCA 5L3BA 5JR3A 2AXLA 4CGZA 2P5LC 4XSXF 3ZMZA 1YW9A 1JGSA 2IA2A 2P5KA 3GF2A 4PZJA 1W5TA 2ZFWA 3N4MA 1LDKB 1YLFA 5ILVA 2PN6A 2OA4A 2V9VA 4N0BA 1IXSB 1Q1HA 3QAHA 3GZ6A 1XGOA 2FNPA 4XBFA 5CLSA 3REOA 2HYFA 4KICA 1MZBA 3RIRA 2BEOA 1FP2A 1LQ1A 3HHHA 3TOBA 3ROUA 3J80K 4A0ZA 4LB5A 3T1BA 1SMYF 3CO7C 1Z7UA 1T38A 5IT9Z 2V1DA 5FFZA 5L3GA 3FXUA 3WTUC 3GFIA 4NHJA 1I1SA 3E5UA 2Z99A 4KN4X 5LGTA 5HLHA 1GXQA 2M87A 2QBYB 1P92A 1O3QA 1IW7F 1DPRA 3R6SA 2P7CB 2ACJA 2ISYA 3WTWC 2K7LA 2O3FA 1OYIA 2XASA 2ZNYA 4H0EA 2MA3A 1S7AA 3BJAA 2FNAA 1XGSA 2E1NA 5K5RA 1TW3A 3L7WA 2V1UA 2DK8A 1KQ0A 4IPAA 2ZKZA 3KLOA 1MJAA 3RPQA 2VT2A 5L3EA 4CHUA 2G7HA 2HFHA 3ZN0A 3V8LA 2ZBKA 1SAXA 4EQQA 2MH2A 4A2UA 4OINF 2GXBA 5JVTA 1Z6TA 3J81K 4MTDA 3TO6A 3QP6A 3T8RA 1I5ZA 3LSTA 4L9VA 2A6HF 2IJLA 3ZP5A 3C18A 3JSOA 2WV0A 4XRFA 2QYOA 4I0BA 1U5TB 3VOEA 1R23A 1OR7A 4HQMA 3TKYA 1KQ9A 2Q0OA 2V1XA 3BOQA 2O8XA 2TDXA 2ADUA 1B6AA 3E97A 3BZ6A 4MHGA 3CUQB 3VODA 4ZYDA 5D8LB 2OZ6A 1P4AA 4LLNA 3E6CC 1CF7B 3KLNA 5FO5A 1FOKA 4MQVA 1YS7A 5TJJA 1YS6A 1B9NA 3RPUA 3BY6A 3E5QA 1RI7A 2H6CA 2XRNA 3R4KA 3COAC 4LK0F 4EJWA 1DUXC 4XLNF 4M9XA 4O5VA 4HOBA 1BBYA 2W24A 4Y15A 3EUHA 2PFBA 1SD5A 1A04A 3R60A 5CVJA 2EFQA 4HDUA 3E3VA 1H0MA 2NAZA 4ZYEA 3I4PA 4AIHA 2XUBA 1XSVA 3RI4A 3KP3A 1S6LA 1L3LA 5K5OA 1JXSA 2FE3A 1W4MA 4AWXB 1KYZA 2QBYA 4ESFA 1GVJA 3BPVA 2EV5A 4QWQA 1STZA 3Q9VA 3BJOA 1XGNA 5LEJA 1B59A 5E1XA 4CYDA 5BPDA 1AWCA 2EV0A 2W84A 3TO7A 3HRTA 4Y17A 2Y48A 3DPLC 1KGSA 2P6SA 2GA2A 2HKOA 1XDSA 2XHKA 3IL2A 2CYYA 2RGVA 2W25A 1WSUA 2LSOA 3KFWX 3HRMA 4AD9A 2A68F 3E5XA 3F6VA 4F7ZA 3J80Z 3D5LA 3I58A 5J8CA 1Z91A 5LGNA 1ONVA 4M71A 1RUNA 1IXCA 2O0YA 4IVNA 2E7XA 3K1PA 3HOSA 1ZAOA 3RTRA 4KIBA 2IT0A 5E18F 2NRAC 5HS7A 4G6QA 1FBUA 2DLLA 3CDHA 2RDPA 5DD8A 2JRTA 2YSRA 1YG2A 1PP7U 2K86A 2FA5A 5IT3A 1ZN2A 3BWGA 1S7OA 2VBZA 2NYXA 1IRGA 4I02A 4WK8F 1MD0A 3IRQA 3CUQA 5FLXK 1W7PD 4XLPF 1EH8A 3LA3A 1T6SA 2FOKA 2M45A 2PQ8A 2F2EA 1HBXG 2PEXA 1I1GA 4U0VA 2VT3A 2GXGA 4A12A 2ZNZA 3FMRA 1SFXA 5HVQC 5H20A 3GXOA 2DPUA 5AONA 3BDDA 2M1BA 4WCGA 3ABUA 1IN5A 1YFHA 1IN6A 2X4HA 1KU9A 2HDCA 5HLIA 3J81Z 3I0TA 2XAJA 5CVRA 3HSFA 4XSZF 2LF8A 2H94A 2DAOA 4GYGA 3LA7A 3K9TA 4QLCU 1GXPA 1FSHA 5ILUA 1V3FA 2EA4A 4BXUA 2C6YA 3KP6A 1QGPA 1MKMA 2F5EA 4I2OA 2XKPA 4GYIA 3GFMA 3K1MA 3M9AA 4WX9A 1E2XA 2MLKA 3M8FA 3VB2A 1IUYA 1B4AA 2FBKA 2STTA 4I7HA 3KCCA 5E1WA 1Z6RA 4FX0A 3QU3A 1USSA 2DQRA 4MGRA 3F6OA 4L18B 5CYVA 4KN7X 2EWNA 2FBHA 2EFWA 5EEHA 2QWWA 4ENKA 1LB2A 4P55A 3I59B 2UWMA 1BIAA 4P96A 4LG0B 1TQIA 1UFMA 1BI2A 2DQLA 4Q48A 3HTUA 1FYKA 2EK5A 5D4SA 5DCMA 1ZRCA 3RKWA 3MAJA 3C7JA 2DTRA 3IKVA 5HDNA 4ENJA 4LD5A 1G3YA 5AIQA 2XAGA 3O6BB 4Q4ZF 3F21A 2Q2EA 4EGYA 1S29A 2FU4A 1KQ8A 5E20A 2QQAA 1D5VA 5BOXA 3E6MA 1ZHFA 3LAJA 1GHCA 1J5YA 4KIGA 2HZTA 1JHFA 3RKXA 1SD4A 3IHUA 2A69F 5JHUA 1SMTA 3R0JA 4ENMA 2IVMA 2YX4A 4YFNF 3V8KA 3WG9A 3DQVC 1KA8A 2J5OA 5LGUA 1QPMA 5ICEA 4JBAA 4EGZA 2RNJA 4LLGF 4AIKA 3IC7A 1CGPA 4P9UA 2OAZA 5ICGA 5E17F 3L9FA 1D3YA 3CO6C 1XSXA 3ZMUA 4KYWA 2EJRA 1ZLJA 2VC0A 1DDNA 2HTJA 3ECHA 2FMLA 4HX4A 3NRVA 4UVCA 2ZXJA 4BAYA 1VTNC 2DFIA 1FSEA 4UNOA 3FF5A 3F8CA 2KRFA 4KMUX 1F4KA 1SFUA 1U2WA 3CJNA 3JSPA 1PP8F 5CVIA 1BN5A 1ZG1A 1NHAA 4WWCA 5HLGA 3GLXA 3C3WA 1WRJA 1YTYA 4Z2YA 3WTXC 3CUOA 4BNCA 1S3JA 5DCFA 5FLXZ 2VBWA 2HQRA 3R0AA 4EV0A 2RQPA 1K78B 2PG4A 1TW2A 4LJZF 2LDUA 2D1HA 4EMSA 1H9GA 4YG2F 1P4WA 3KE2A 3ABTA 3GEZA 2YPRA 4EJOA 4KA4A 5FB2A 2BBYA 5EEGA 4IRHA 1DP7P 3LA2A 3SQNA 2HS5A 4AIJA 3RYPA 2G9WA 1Z05A 1PDNC 3I59A 3T0YA 1IZ1A 2M30A 2OZUA 4ON0A 4LG0A 2MH9A 5F1RA 1V4RA 3B02A 1R22A 2HGCA 3LAPA 1MJBA 2FSWA 4RGXA 5DYMA 2D1VA 3IWZA 3WGIA 2A5YB 1O3RA 3MZHA 4P9FA 4IRIA 4K2EA 1YO5C 5H6RA 1KU3A 3U2RA 5JI6A 4EM2A 4YFXF 3JAMK 1G3WA 3IRRA 2CO5A 4FHTA 4HW0A 1LNWA 4KNYA 4WF2A 3JTGA 3J7AO 3N97A 2OQRA 4U7DA 3SXYA 1FLIA 2DW4A 5H6QA 5D5UB 3ZMVA 4L9JA 3LQQA 2HR3A 4HX8A 2ZO4A 4LFUA 2P7VB 3WODF 3OV8A 4RGRA 2ELHA 2M8EA 2G7UA 4JQFA 4KDPA 5LHGA 2OU2A 4CDGA 3LFKA 1LVAA 2L4AA 3NEUA 2ESHA 1LEAA 2JPCA 1IAWA 3GX4X 2HOEA 2JZYA 2QUFA 2IA1A 4NQWA 1G6NA 2CWEA 2IP2A 3P9IA 5BS6A 1C0WA 1HW5A 5DUKA 4HAMA 1ZLKA 1ZYRF 1HSTA 3I5UA 1ZREA 4RS8A 2PLYA 2E7WA 2CW0F 1ZGAA 1IXRC 1YW7A 2R7DA 1T39A 3DP7A 4ETSA 2HYGD 4HA8A 5LHIA 1HQCA 3E6DA 1B1BA 1JE8A 2QM3A 4GXOA 4HX7A 3FMQA 4RB0A 3S2WA 3O2PE 3P9KA 1S8NA 2VE9A 4P5OA 3P9CA 1BI0A 2RVCA 3RJPA 2DI3A 4KT5C 2FQ3A 3WTZA 2CGPA 1TNSA 4MEYF 1LJ9A 2D45A 1OYWA 3SZTA 4HBLA 2P6TA 4ASNA 1ZRFA 1K78A 5BPIA 1R1TA 2L4MA 3DEUA 2Z5UA 3TGNA 1RIOH 3KP7A 2ZMEB 2GIVA 5HS9A 4A6DA 3Q9SA 2NNNA 5CJ9A 1K7AA 1HKQA 4EJTA 2QVOA 1XMKA 3F23A 2HQNA 1FYMA 1RNLA 4OU0A 1ZRDA 1USTA 4G9YA 1R00A 1J59A 2L3DA 2KJCA 1HSJA 4N9HA 1U5TA 1BJAA 1T98A 1ZARA 3EYIA 4EM1A 3B73A 3JTHA 2GZWA 3ELKA 3KP4A 1FWZA 5FGMA 2FMYA 3ECOA 2DO7A 2VXZA 3V7SA 3ML6A 2PI0A 3F8NA 1L0OC 4CICA 1O7FA 2YX7A 1CF7A 4EJUA 5F64A 4B8XA 5D6EA 3ZMTA 4ZZDA 2XVCA 4I01A 1SD7A 2O61A 1YIOA 3BP8A 2AS5F 1T0FA 2FEZA 4PGHA 4ESJA 3HUGA 4LGWA 1R36A 3DXJF 3U1DA 4UUVA 3GFLA 2PBIA 5HS8A 3FX3A 3TDUC 2K02A 2YR2A 5L3CA 3H3ZA 2YU3A 3HIFA 5LLQA 3DV8A 3GUDA 3W6JB 2H6BA 2LF7A 1FT9A 4ZYHA 1TQMA 3QU6A 4CZZA 2RN7A 3AAFA 2Z33A 2XKOA 3KZZA 4UXNA 2EA2A 2EV6A 5ED4A 1BC7C 3EQLF 5E8GA 3FZVA 1D8JA 2ISZA 1O3TA 1G3TA 2Y0MA 3JAMZ 5L3DA 2KIMA 4I09A 4FX4A 3GWZA 4OIPF 4BQAA 2HKXA 4M73A 5ERIA 2QLZA 3D0SA 1SFEA 3ZN1A 3F8MA 1UCRA 3TDZC 2VBXA 4HDVA 5DDGA 1MDMB 3WGGA 1EV7A 4HV6A 1OMIA 4WXHA 2VOOA 4CXFA 4RB2C 2B0LA 2IW5A 1ODDA 3GZ5A 4GO1A 4RAZA 1K79A 2X0LA 4ENNA 2JTVA 4BYYA 2JT1A 1BI3A 2K4BA 1R58A 1IN8A 1QZYA 4ZH4F 3PFIA 1J2XA 4UV9A 2RC4A 2F5CA 4IRGA 1LDJA 1JHHA 1TBXA 1J7KA 4L9NA 3WU0A 5D5VB 3LQRA 3QPHA 5D4RA 5ICFA 3U9GA 1E17A 1TNTA 4M72A 3CLOA 1KU7A 4A6EA 1MGTA 4HZFA 1DPUA 3JW4A 2DT5A 2RV8A 4OIQF 2VE8A 1QBJA 3HSEA 3ULQB 3GW2A 3I71A 2JPBA 1REPC 4BHBA 2W85A 3F8BA 3KP5A 4IF4A 4O6JA 5CVUA 1FNNA 5DV5A 2STWA 3SFZA 5HDGA 1R7JA 4M9ZA 4YIFA 1BIBA 1WI9A 4HLYA 3MEXA 3CTAA 3L00A 4EJVA 1ULYA 2L02A 1MJ9A 1R1UA 1ON1A 2R7FA 3K2ZA 4LMYA 2VC1A 3BPXA 1T2KA 3ZMDA 4KUMA 5J8FA 1FPQA 5HOOA 4L5IA 4A5MA 3ERED 1G3SA 1FBQA 3FXRA 5FD6A 2Q8KA 2UXXA 1UHMA 2MD5A 3PQKA 1OYYA 4OOIA 4MQ9F 1LEBA 1XD7A 3TQNA 2P4WA 2PMHA 1HKSA 3HYIA 1IF1A 1TTYA 1Z1DA 2PJPA 1YYVA 3M8EA 2VOPA 3MCZA 4DNCA 5KVRA 3FXQA 4PCQA 1ZH5A 4A5NA 4HF0A 3K0LA 1QNTA 2HWVA 5BQTA 2FF4A 1W7PB 1U78A 3GVAA 2DU9A 2FBIA 4BHCA 1FC3A 2QENA 1ZG3A 3V8JA 5K5QA 5E1ZB 1EH6A 1U6GA 4OIRF 5D5WB 3LWFA 1IN4A 1HW2A 4CO8A 1I6XA 4ESBA 2GQQA 3FHZA 2OQGA 1QZZA 4L0YB 1HW1A 2XROA 4IJAA 1MDMA 1XGMA 4IHSA 4KFCA 1U5TC 2XV4S 2IRFG 5BMZA 3G73A 4G7ZF 4A0XA 4M74A 2DK5A 3CUQC 3WTSC 2BGCA 5ILSA 3RDIA 1XMAA 2KJBA 1TLHB 2M5WA 1XCBA 1FY7A 3WTVC 3FM3A 3RKYA 4UVAA 2ESNA 1FYLA 2FRHA 3T8TA 2A3SA 4UV8A 2MLGA 1O7LA 1H9TA 5LHHA 3KP2A 3WE2A 2BYVE 3F22A 2WC2A 3DF8A 4G7OF 4I98B 3BROA 2EB7A 4D0PA 3MQ0A 2J5PA 3M1EA 3MWMA 4LLLA 4BH9A 2R3SA 3TOAA 3WTTC 5KK1A 1R5GA 2EFNA 3KEQA 4ZZLA 2QZ8A 3F8FA 4HV5A 2IA0A 3HSRA 4MEXF 4G6DA 5AIPA 1ON2A 1BM9A 1OKRA 2V79A 1F1ZA 4R1HA 2NNYA 4HYEA 3DKWA 2GA1A 3HRUA 2DPDA 4HQEA 3NQOA 3W6KB 5LRRA 4UHTA 2EFOA 4HLXA 1U3EM 1RZ4A 4A0YA 4S04A 3H3UA 4G94A 3GYHX 1HKTA 2V6CA 3L2CA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2CG4 A;  1UB9 A;  1HXD A;  4HF1 A;  1WQ2 A;  3FM5 A;  1K6O A;  4R79 A;  3PQJ A;  4EVI A;  1J0R A;  1I27 A;  4U7B A;  2DBB A;  2GWR A;  3SZP A;  1J9I A;  2XAQ A;  4M6Y A;  4JK1 X;  3ZQ7 A;  3V4G A;  5L3F A;  3K69 A;  5K1Y A;  2ZCW A;  3GO5 A;  5A2Q K;  4RB1 A;  1Y0U A;  2H27 A;  1XDU A;  2XAF A;  4FT8 A;  3H92 A;  1KU2 A;  4UVB A;  3F72 A;  1W7P A;  3F3X A;  3BJ6 A;  1F9N A;  1B9M A;  5DUI A;  3EYY A;  3V7R A;  3R61 A;  3MZY A;  4RGS A;  5F6F A;  2KIU A;  5DEQ A;  4Q47 A;  4U0Y A;  4WXC A;  4YII A;  1YW8 A;  2CFX A;  2WWY A;  1QQI A;  1TQP A;  3I64 A;  3WU1 B;  2KKO A;  2PMU A;  1FX7 A;  1XN7 A;  4O3M A;  4RGU A;  2O6G E;  2ZJ2 A;  2JSC A;  4GCV A;  3WTY C;  5DCM B;  1XB4 A;  3WGH A;  2L54 A;  4TV7 A;  3SHF A;  3ZMS A;  1ZG5 A;  5LRS A;  1F5T A;  2K27 A;  5IT9 K;  1D8K A;  1O57 A;  2F5D A;  3FMS A;  3FWE A;  3Q5F A;  5D8K B;  1WWX A;  1KYW A;  4U88 A;  1UHW A;  1BI1 A;  4PDK A;  2CSO A;  2VN2 A;  3VEP A;  4OIO F;  3I53 A;  3QPT A;  5LEK A;  3P7N A;  3V7C A;  4KIF A;  2A07 F;  1RUO A;  4I0A A;  3KZY A;  4B09 A;  4L9T A;  2UZK A;  3EDP A;  2HEO A;  4M9S A;  1EH7 A;  3QP5 A;  4OMZ A;  3HTS B;  4GGG A;  1IRF A;  3M7G A;  5D6F A;  1FBS A;  3RYR A;  1XCV A;  2RKH A;  5LBQ A;  2O03 A;  4IXA A;  2VON A;  1AOY A;  2LNB A;  1P6R A;  3C1D A;  1J75 A;  4RB3 C;  2COM A;  4PGG A;  4LB6 B;  4G7H F;  2QQ9 A;  2XAH A;  3QRF F;  4E70 A;  2GAU A;  2OBP A;  3KET A;  3EET A;  4LK1 F;  5D5X B;  3HOT A;  2ETH A;  3ZPL A;  4IHT A;  4YFK F;  4G8X A;  1WKM A;  3IWF A;  5FD5 A;  4HF2 A;  3K1N A;  2H09 A;  2CQK A;  3MFK A;  2BE5 F;  4WXD A;  2XIG A;  4U0W A;  2E1C A;  1FZP B;  4KMF A;  3GFJ A;  2F5F A;  5E8I A;  1O3S A;  2NS0 A;  4RAY A;  3HRS A;  4Y13 A;  1LDD A;  2VBY A;  3QOP A;  4Q5S F;  4ZYG A;  2P5V A;  2OD5 A;  5CVV A;  5DD4 A;  4L5J A;  2L01 A;  2Z9O A;  3T5X A;  2WTE A;  3L09 A;  5FFX A;  1FP1 D;  2P8T A;  5ICC A;  4L0Z B;  6PAX A;  3TO9 A;  2A6E F;  3HHG A;  1SD6 A;  2VOD A;  2IPQ X;  1BC8 C;  1XSD A;  4N9I A;  3DFG A;  3WE3 A;  4MNU A;  2A61 A;  4MTE A;  4NB5 A;  1IN7 A;  2EFP A;  2LKP A;  3KEO A;  1U8R A;  3DPT A;  1W5S A;  2D2W A;  1R1V A;  1P2F A;  4R8H A;  2K4J A;  4BHP A;  2ZME A;  4AVP A;  1QO0 D;  3I54 A;  1Z9C A;  2KIF A;  1ZGJ A;  3O3K A;  2UXN A;  3E6B A;  4EM0 B;  2MBF A;  1P4X A;  5HDK A;  5TRD A;  1BOA A;  2MC3 A;  1YQA A;  2HTS A;  1G4D A;  4M6X A;  4DQ2 A;  2QQB A;  2Y75 A;  2BV6 A;  3G3Z A;  2W57 A;  1PUE E;  2FXA A;  2XGX A;  4OMY A;  4S05 A;  3OOP A;  5A2Q Z;  3IKT A;  1X3U A;  5J6X A;  1R5H A;  3VFZ A;  5JFR A;  3ISP A;  2Z3Y A;  1OPC A;  5L3B A;  5JR3 A;  2AXL A;  4CGZ A;  2P5L C;  4XSX F;  3ZMZ A;  1YW9 A;  1JGS A;  2IA2 A;  2P5K A;  3GF2 A;  4PZJ A;  1W5T A;  2ZFW A;  3N4M A;  1LDK B;  1YLF A;  5ILV A;  2PN6 A;  2OA4 A;  2V9V A;  4N0B A;  1IXS B;  1Q1H A;  3QAH A;  3GZ6 A;  1XGO A;  2FNP A;  4XBF A;  5CLS A;  3REO A;  2HYF A;  4KIC A;  1MZB A;  3RIR A;  2BEO A;  1FP2 A;  1LQ1 A;  3HHH A;  3TOB A;  3ROU A;  3J80 K;  4A0Z A;  4LB5 A;  3T1B A;  1SMY F;  3CO7 C;  1Z7U A;  1T38 A;  5IT9 Z;  2V1D A;  5FFZ A;  5L3G A;  3FXU A;  3WTU C;  3GFI A;  4NHJ A;  1I1S A;  3E5U A;  2Z99 A;  4KN4 X;  5LGT A;  5HLH A;  1GXQ A;  2M87 A;  2QBY B;  1P92 A;  1O3Q A;  1IW7 F;  1DPR A;  3R6S A;  2P7C B;  2ACJ A;  2ISY A;  3WTW C;  2K7L A;  2O3F A;  1OYI A;  2XAS A;  2ZNY A;  4H0E A;  2MA3 A;  1S7A A;  3BJA A;  2FNA A;  1XGS A;  2E1N A;  5K5R A;  1TW3 A;  3L7W A;  2V1U A;  2DK8 A;  1KQ0 A;  4IPA A;  2ZKZ A;  3KLO A;  1MJA A;  3RPQ A;  2VT2 A;  5L3E A;  4CHU A;  2G7H A;  2HFH A;  3ZN0 A;  3V8L A;  2ZBK A;  1SAX A;  4EQQ A;  2MH2 A;  4A2U A;  4OIN F;  2GXB A;  5JVT A;  1Z6T A;  3J81 K;  4MTD A;  3TO6 A;  3QP6 A;  3T8R A;  1I5Z A;  3LST A;  4L9V A;  2A6H F;  2IJL A;  3ZP5 A;  3C18 A;  3JSO A;  2WV0 A;  4XRF A;  2QYO A;  4I0B A;  1U5T B;  3VOE A;  1R23 A;  1OR7 A;  4HQM A;  3TKY A;  1KQ9 A;  2Q0O A;  2V1X A;  3BOQ A;  2O8X A;  2TDX A;  2ADU A;  1B6A A;  3E97 A;  3BZ6 A;  4MHG A;  3CUQ B;  3VOD A;  4ZYD A;  5D8L B;  2OZ6 A;  1P4A A;  4LLN A;  3E6C C;  1CF7 B;  3KLN A;  5FO5 A;  1FOK A;  4MQV A;  1YS7 A;  5TJJ A;  1YS6 A;  1B9N A;  3RPU A;  3BY6 A;  3E5Q A;  1RI7 A;  2H6C A;  2XRN A;  3R4K A;  3COA C;  4LK0 F;  4EJW A;  1DUX C;  4XLN F;  4M9X A;  4O5V A;  4HOB A;  1BBY A;  2W24 A;  4Y15 A;  3EUH A;  2PFB A;  1SD5 A;  1A04 A;  3R60 A;  5CVJ A;  2EFQ A;  4HDU A;  3E3V A;  1H0M A;  2NAZ A;  4ZYE A;  3I4P A;  4AIH A;  2XUB A;  1XSV A;  3RI4 A;  3KP3 A;  1S6L A;  1L3L A;  5K5O A;  1JXS A;  2FE3 A;  1W4M A;  4AWX B;  1KYZ A;  2QBY A;  4ESF A;  1GVJ A;  3BPV A;  2EV5 A;  4QWQ A;  1STZ A;  3Q9V A;  3BJO A;  1XGN A;  5LEJ A;  1B59 A;  5E1X A;  4CYD A;  5BPD A;  1AWC A;  2EV0 A;  2W84 A;  3TO7 A;  3HRT A;  4Y17 A;  2Y48 A;  3DPL C;  1KGS A;  2P6S A;  2GA2 A;  2HKO A;  1XDS A;  2XHK A;  3IL2 A;  2CYY A;  2RGV A;  2W25 A;  1WSU A;  2LSO A;  3KFW X;  3HRM A;  4AD9 A;  2A68 F;  3E5X A;  3F6V A;  4F7Z A;  3J80 Z;  3D5L A;  3I58 A;  5J8C A;  1Z91 A;  5LGN A;  1ONV A;  4M71 A;  1RUN A;  1IXC A;  2O0Y A;  4IVN A;  2E7X A;  3K1P A;  3HOS A;  1ZAO A;  3RTR A;  4KIB A;  2IT0 A;  5E18 F;  2NRA C;  5HS7 A;  4G6Q A;  1FBU A;  2DLL A;  3CDH A;  2RDP A;  5DD8 A;  2JRT A;  2YSR A;  1YG2 A;  1PP7 U;  2K86 A;  2FA5 A;  5IT3 A;  1ZN2 A;  3BWG A;  1S7O A;  2VBZ A;  2NYX A;  1IRG A;  4I02 A;  4WK8 F;  1MD0 A;  3IRQ A;  3CUQ A;  5FLX K;  1W7P D;  4XLP F;  1EH8 A;  3LA3 A;  1T6S A;  2FOK A;  2M45 A;  2PQ8 A;  2F2E A;  1HBX G;  2PEX A;  1I1G A;  4U0V A;  2VT3 A;  2GXG A;  4A12 A;  2ZNZ A;  3FMR A;  1SFX A;  5HVQ C;  5H20 A;  3GXO A;  2DPU A;  5AON A;  3BDD A;  2M1B A;  4WCG A;  3ABU A;  1IN5 A;  1YFH A;  1IN6 A;  2X4H A;  1KU9 A;  2HDC A;  5HLI A;  3J81 Z;  3I0T A;  2XAJ A;  5CVR A;  3HSF A;  4XSZ F;  2LF8 A;  2H94 A;  2DAO A;  4GYG A;  3LA7 A;  3K9T A;  4QLC U;  1GXP A;  1FSH A;  5ILU A;  1V3F A;  2EA4 A;  4BXU A;  2C6Y A;  3KP6 A;  1QGP A;  1MKM A;  2F5E A;  4I2O A;  2XKP A;  4GYI A;  3GFM A;  3K1M A;  3M9A A;  4WX9 A;  1E2X A;  2MLK A;  3M8F A;  3VB2 A;  1IUY A;  1B4A A;  2FBK A;  2STT A;  4I7H A;  3KCC A;  5E1W A;  1Z6R A;  4FX0 A;  3QU3 A;  1USS A;  2DQR A;  4MGR A;  3F6O A;  4L18 B;  5CYV A;  4KN7 X;  2EWN A;  2FBH A;  2EFW A;  5EEH A;  2QWW A;  4ENK A;  1LB2 A;  4P55 A;  3I59 B;  2UWM A;  1BIA A;  4P96 A;  4LG0 B;  1TQI A;  1UFM A;  1BI2 A;  2DQL A;  4Q48 A;  3HTU A;  1FYK A;  2EK5 A;  5D4S A;  5DCM A;  1ZRC A;  3RKW A;  3MAJ A;  3C7J A;  2DTR A;  3IKV A;  5HDN A;  4ENJ A;  4LD5 A;  1G3Y A;  5AIQ A;  2XAG A;  3O6B B;  4Q4Z F;  3F21 A;  2Q2E A;  4EGY A;  1S29 A;  2FU4 A;  1KQ8 A;  5E20 A;  2QQA A;  1D5V A;  5BOX A;  3E6M A;  1ZHF A;  3LAJ A;  1GHC A;  1J5Y A;  4KIG A;  2HZT A;  1JHF A;  3RKX A;  1SD4 A;  3IHU A;  2A69 F;  5JHU A;  1SMT A;  3R0J A;  4ENM A;  2IVM A;  2YX4 A;  4YFN F;  3V8K A;  3WG9 A;  3DQV C;  1KA8 A;  2J5O A;  5LGU A;  1QPM A;  5ICE A;  4JBA A;  4EGZ A;  2RNJ A;  4LLG F;  4AIK A;  3IC7 A;  1CGP A;  4P9U A;  2OAZ A;  5ICG A;  5E17 F;  3L9F A;  1D3Y A;  3CO6 C;  1XSX A;  3ZMU A;  4KYW A;  2EJR A;  1ZLJ A;  2VC0 A;  1DDN A;  2HTJ A;  3ECH A;  2FML A;  4HX4 A;  3NRV A;  4UVC A;  2ZXJ A;  4BAY A;  1VTN C;  2DFI A;  1FSE A;  4UNO A;  3FF5 A;  3F8C A;  2KRF A;  4KMU X;  1F4K A;  1SFU A;  1U2W A;  3CJN A;  3JSP A;  1PP8 F;  5CVI A;  1BN5 A;  1ZG1 A;  1NHA A;  4WWC A;  5HLG A;  3GLX A;  3C3W A;  1WRJ A;  1YTY A;  4Z2Y A;  3WTX C;  3CUO A;  4BNC A;  1S3J A;  5DCF A;  5FLX Z;  2VBW A;  2HQR A;  3R0A A;  4EV0 A;  2RQP A;  1K78 B;  2PG4 A;  1TW2 A;  4LJZ F;  2LDU A;  2D1H A;  4EMS A;  1H9G A;  4YG2 F;  1P4W A;  3KE2 A;  3ABT A;  3GEZ A;  2YPR A;  4EJO A;  4KA4 A;  5FB2 A;  2BBY A;  5EEG A;  4IRH A;  1DP7 P;  3LA2 A;  3SQN A;  2HS5 A;  4AIJ A;  3RYP A;  2G9W A;  1Z05 A;  1PDN C;  3I59 A;  3T0Y A;  1IZ1 A;  2M30 A;  2OZU A;  4ON0 A;  4LG0 A;  2MH9 A;  5F1R A;  1V4R A;  3B02 A;  1R22 A;  2HGC A;  3LAP A;  1MJB A;  2FSW A;  4RGX A;  5DYM A;  2D1V A;  3IWZ A;  3WGI A;  2A5Y B;  1O3R A;  3MZH A;  4P9F A;  4IRI A;  4K2E A;  1YO5 C;  5H6R A;  1KU3 A;  3U2R A;  5JI6 A;  4EM2 A;  4YFX F;  3JAM K;  1G3W A;  3IRR A;  2CO5 A;  4FHT A;  4HW0 A;  1LNW A;  4KNY A;  4WF2 A;  3JTG A;  3J7A O;  3N97 A;  2OQR A;  4U7D A;  3SXY A;  1FLI A;  2DW4 A;  5H6Q A;  5D5U B;  3ZMV A;  4L9J A;  3LQQ A;  2HR3 A;  4HX8 A;  2ZO4 A;  4LFU A;  2P7V B;  3WOD F;  3OV8 A;  4RGR A;  2ELH A;  2M8E A;  2G7U A;  4JQF A;  4KDP A;  5LHG A;  2OU2 A;  4CDG A;  3LFK A;  1LVA A;  2L4A A;  3NEU A;  2ESH A;  1LEA A;  2JPC A;  1IAW A;  3GX4 X;  2HOE A;  2JZY A;  2QUF A;  2IA1 A;  4NQW A;  1G6N A;  2CWE A;  2IP2 A;  3P9I A;  5BS6 A;  1C0W A;  1HW5 A;  5DUK A;  4HAM A;  1ZLK A;  1ZYR F;  1HST A;  3I5U A;  1ZRE A;  4RS8 A;  2PLY A;  2E7W A;  2CW0 F;  1ZGA A;  1IXR C;  1YW7 A;  2R7D A;  1T39 A;  3DP7 A;  4ETS A;  2HYG D;  4HA8 A;  5LHI A;  1HQC A;  3E6D A;  1B1B A;  1JE8 A;  2QM3 A;  4GXO A;  4HX7 A;  3FMQ A;  4RB0 A;  3S2W A;  3O2P E;  3P9K A;  1S8N A;  2VE9 A;  4P5O A;  3P9C A;  1BI0 A;  2RVC A;  3RJP A;  2DI3 A;  4KT5 C;  2FQ3 A;  3WTZ A;  2CGP A;  1TNS A;  4MEY F;  1LJ9 A;  2D45 A;  1OYW A;  3SZT A;  4HBL A;  2P6T A;  4ASN A;  1ZRF A;  1K78 A;  5BPI A;  1R1T A;  2L4M A;  3DEU A;  2Z5U A;  3TGN A;  1RIO H;  3KP7 A;  2ZME B;  2GIV A;  5HS9 A;  4A6D A;  3Q9S A;  2NNN A;  5CJ9 A;  1K7A A;  1HKQ A;  4EJT A;  2QVO A;  1XMK A;  3F23 A;  2HQN A;  1FYM A;  1RNL A;  4OU0 A;  1ZRD A;  1UST A;  4G9Y A;  1R00 A;  1J59 A;  2L3D A;  2KJC A;  1HSJ A;  4N9H A;  1U5T A;  1BJA A;  1T98 A;  1ZAR A;  3EYI A;  4EM1 A;  3B73 A;  3JTH A;  2GZW A;  3ELK A;  3KP4 A;  1FWZ A;  5FGM A;  2FMY A;  3ECO A;  2DO7 A;  2VXZ A;  3V7S A;  3ML6 A;  2PI0 A;  3F8N A;  1L0O C;  4CIC A;  1O7F A;  2YX7 A;  1CF7 A;  4EJU A;  5F64 A;  4B8X A;  5D6E A;  3ZMT A;  4ZZD A;  2XVC A;  4I01 A;  1SD7 A;  2O61 A;  1YIO A;  3BP8 A;  2AS5 F;  1T0F A;  2FEZ A;  4PGH A;  4ESJ A;  3HUG A;  4LGW A;  1R36 A;  3DXJ F;  3U1D A;  4UUV A;  3GFL A;  2PBI A;  5HS8 A;  3FX3 A;  3TDU C;  2K02 A;  2YR2 A;  5L3C A;  3H3Z A;  2YU3 A;  3HIF A;  5LLQ A;  3DV8 A;  3GUD A;  3W6J B;  2H6B A;  2LF7 A;  1FT9 A;  4ZYH A;  1TQM A;  3QU6 A;  4CZZ A;  2RN7 A;  3AAF A;  2Z33 A;  2XKO A;  3KZZ A;  4UXN A;  2EA2 A;  2EV6 A;  5ED4 A;  1BC7 C;  3EQL F;  5E8G A;  3FZV A;  1D8J A;  2ISZ A;  1O3T A;  1G3T A;  2Y0M A;  3JAM Z;  5L3D A;  2KIM A;  4I09 A;  4FX4 A;  3GWZ A;  4OIP F;  4BQA A;  2HKX A;  4M73 A;  5ERI A;  2QLZ A;  3D0S A;  1SFE A;  3ZN1 A;  3F8M A;  1UCR A;  3TDZ C;  2VBX A;  4HDV A;  5DDG A;  1MDM B;  3WGG A;  1EV7 A;  4HV6 A;  1OMI A;  4WXH A;  2VOO A;  4CXF A;  4RB2 C;  2B0L A;  2IW5 A;  1ODD A;  3GZ5 A;  4GO1 A;  4RAZ A;  1K79 A;  2X0L A;  4ENN A;  2JTV A;  4BYY A;  2JT1 A;  1BI3 A;  2K4B A;  1R58 A;  1IN8 A;  1QZY A;  4ZH4 F;  3PFI A;  1J2X A;  4UV9 A;  2RC4 A;  2F5C A;  4IRG A;  1LDJ A;  1JHH A;  1TBX A;  1J7K A;  4L9N A;  3WU0 A;  5D5V B;  3LQR A;  3QPH A;  5D4R A;  5ICF A;  3U9G A;  1E17 A;  1TNT A;  4M72 A;  3CLO A;  1KU7 A;  4A6E A;  1MGT A;  4HZF A;  1DPU A;  3JW4 A;  2DT5 A;  2RV8 A;  4OIQ F;  2VE8 A;  1QBJ A;  3HSE A;  3ULQ B;  3GW2 A;  3I71 A;  2JPB A;  1REP C;  4BHB A;  2W85 A;  3F8B A;  3KP5 A;  4IF4 A;  4O6J A;  5CVU A;  1FNN A;  5DV5 A;  2STW A;  3SFZ A;  5HDG A;  1R7J A;  4M9Z A;  4YIF A;  1BIB A;  1WI9 A;  4HLY A;  3MEX A;  3CTA A;  3L00 A;  4EJV A;  1ULY A;  2L02 A;  1MJ9 A;  1R1U A;  1ON1 A;  2R7F A;  3K2Z A;  4LMY A;  2VC1 A;  3BPX A;  1T2K A;  3ZMD A;  4KUM A;  5J8F A;  1FPQ A;  5HOO A;  4L5I A;  4A5M A;  3ERE D;  1G3S A;  1FBQ A;  3FXR A;  5FD6 A;  2Q8K A;  2UXX A;  1UHM A;  2MD5 A;  3PQK A;  1OYY A;  4OOI A;  4MQ9 F;  1LEB A;  1XD7 A;  3TQN A;  2P4W A;  2PMH A;  1HKS A;  3HYI A;  1IF1 A;  1TTY A;  1Z1D A;  2PJP A;  1YYV A;  3M8E A;  2VOP A;  3MCZ A;  4DNC A;  5KVR A;  3FXQ A;  4PCQ A;  1ZH5 A;  4A5N A;  4HF0 A;  3K0L A;  1QNT A;  2HWV A;  5BQT A;  2FF4 A;  1W7P B;  1U78 A;  3GVA A;  2DU9 A;  2FBI A;  4BHC A;  1FC3 A;  2QEN A;  1ZG3 A;  3V8J A;  5K5Q A;  5E1Z B;  1EH6 A;  1U6G A;  4OIR F;  5D5W B;  3LWF A;  1IN4 A;  1HW2 A;  4CO8 A;  1I6X A;  4ESB A;  2GQQ A;  3FHZ A;  2OQG A;  1QZZ A;  4L0Y B;  1HW1 A;  2XRO A;  4IJA A;  1MDM A;  1XGM A;  4IHS A;  4KFC A;  1U5T C;  2XV4 S;  2IRF G;  5BMZ A;  3G73 A;  4G7Z F;  4A0X A;  4M74 A;  2DK5 A;  3CUQ C;  3WTS C;  2BGC A;  5ILS A;  3RDI A;  1XMA A;  2KJB A;  1TLH B;  2M5W A;  1XCB A;  1FY7 A;  3WTV C;  3FM3 A;  3RKY A;  4UVA A;  2ESN A;  1FYL A;  2FRH A;  3T8T A;  2A3S A;  4UV8 A;  2MLG A;  1O7L A;  1H9T A;  5LHH A;  3KP2 A;  3WE2 A;  2BYV E;  3F22 A;  2WC2 A;  3DF8 A;  4G7O F;  4I98 B;  3BRO A;  2EB7 A;  4D0P A;  3MQ0 A;  2J5P A;  3M1E A;  3MWM A;  4LLL A;  4BH9 A;  2R3S A;  3TOA A;  3WTT C;  5KK1 A;  1R5G A;  2EFN A;  3KEQ A;  4ZZL A;  2QZ8 A;  3F8F A;  4HV5 A;  2IA0 A;  3HSR A;  4MEX F;  4G6D A;  5AIP A;  1ON2 A;  1BM9 A;  1OKR A;  2V79 A;  1F1Z A;  4R1H A;  2NNY A;  4HYE A;  3DKW A;  2GA1 A;  3HRU A;  2DPD A;  4HQE A;  3NQO A;  3W6K B;  5LRR A;  4UHT A;  2EFO A;  4HLX A;  1U3E M;  1RZ4 A;  4A0Y A;  4S04 A;  3H3U A;  4G94 A;  3GYH X;  1HKT A;  2V6C A;  3L2C A; 
#chains in the Genus database with same CATH topology
 2OC6 A;  2CG4 A;  2K9M A;  1UB9 A;  1HXD A;  4MFD A;  2I10 A;  5KNL A;  2YU9 J;  4HF1 A;  1WQ2 A;  4A3E J;  3FM5 A;  3BT9 A;  1K6O A;  4R79 A;  3PIO F;  3PQJ A;  4EVI A;  4AU7 A;  3I56 I;  1J0R A;  5DS9 A;  1I27 A;  3DU6 A;  3ONQ A;  4U7B A;  1XG1 A;  2LY9 A;  5J4V A;  2DBB A;  2GWR A;  1BOB A;  3SZP A;  1J9I A;  2XAQ A;  4M6Y A;  4JK1 X;  1MH4 A;  3ZQ7 A;  2M9H A;  2GBY A;  3BQY A;  3V4G A;  5L3F A;  2R5Y B;  3K69 A;  1B8I B;  5K1Y A;  2ZCW A;  3HOY J;  3GO5 A;  5A2Q K;  2XB5 A;  4B4C A;  4RB1 A;  1VQ5 I;  2LVS A;  2M0M A;  1Y0U A;  2AQE A;  2O7O A;  1XDU A;  2XAF A;  4FT8 A;  2DMU A;  3H92 A;  3L1P A;  2QA4 I;  2H27 A;  3OL3 A;  1OIS A;  3UNG C;  2WAQ N;  1XC5 A;  1BA5 A;  1KU2 A;  2KP6 A;  4C2U A;  2CRG A;  2EZK A;  2ZXW H;  3F72 A;  4UVB A;  1XX5 A;  1W7P A;  2K3F A;  3F3X A;  4E7K A;  2KZG A;  3OIP A;  4I99 C;  3BJ6 A;  1F9N A;  3JRF A;  3A01 A;  2AQF A;  1B9M A;  5DUI A;  5EDN A;  4CYC B;  3CQZ J;  3EYY A;  2MC4 A;  1H8A C;  3V7R A;  1OCC H;  3R61 A;  1OCZ H;  3MZY A;  2LRD A;  4RGS A;  1FJL A;  3AG1 H;  4PUS A;  1X2M A;  5F6F A;  1IV8 A;  2YS9 A;  3S1M J;  4LIV A;  2EPF A;  2KIU A;  4F3Q A;  5DEQ A;  3H9Q A;  4Q47 A;  1TC3 C;  4U0Y A;  4WXC A;  4BXX J;  4YII A;  1YW8 A;  2CFX A;  2WWY A;  4BUP A;  3DBR B;  2NVQ J;  2MAB A;  1QQI A;  1TQP A;  1MBF A;  5B5E C;  3IAS 2;  3I64 A;  1A5J A;  3WU1 B;  1Y8R B;  2KKO A;  2R7Q A;  4BQQ A;  2PMU A;  1FX7 A;  2JSP A;  3RZO J;  2X9D A;  2NVU B;  1XN7 A;  4O3M A;  4UUS A;  4RGU A;  4W97 A;  1JJ6 C;  2R93 J;  4FET A;  4BBS J;  1IDZ A;  2JK3 A;  3IV5 A;  2O6G E;  4X6A J;  1AA7 A;  2ZJ2 A;  1GLN A;  1JTX A;  2JSC A;  4GCV A;  3WTY C;  5DCM B;  2L7Z A;  5GTH C;  1XB4 A;  3WGH A;  2L54 A;  3AG4 H;  4TV7 A;  3SHF A;  3ZMS A;  1ZG5 A;  5LRS A;  1F5T A;  1U8B A;  2E36 A;  2K27 A;  5IT9 K;  2HQ5 A;  3L2U A;  2VQL A;  2DN0 A;  1SAN A;  1D8K A;  2XGE A;  1O57 A;  2F5D A;  5M5Y J;  1YJ9 I;  3FMS A;  1V54 H;  3FWE A;  3Q5F A;  2D5V A;  5D8K B;  2H1L A;  2CQ7 A;  4XOP A;  1WWX A;  4CUG A;  1KYW A;  2VJ5 A;  4U88 A;  1YX3 A;  1UHW A;  3U21 A;  1BI1 A;  4KJZ A;  4PDK A;  2CSO A;  2BXZ A;  2DA4 A;  2VN2 A;  2LMD A;  2EZH A;  3VEP A;  3GTQ J;  4OIO F;  3I53 A;  2K5C A;  3QPT A;  4II3 A;  1BR2 A;  4CSW A;  5LEK A;  2LBF A;  1LE8 A;  2VB6 A;  4V19 K;  3JRH A;  3HPH A;  1X58 A;  3G71 I;  3P7N A;  3IH4 A;  3S1N J;  3V7C A;  4KIF A;  2A07 F;  4IQ4 A;  1ZR4 A;  4J00 A;  3BR3 A;  1RUO A;  4I0A A;  1QRY A;  4UUT A;  3KZY A;  4B09 A;  4L9T A;  2UZK A;  3EDP A;  2BVM A;  2M7A A;  2LYC A;  2HEO A;  2DMT A;  4M9S A;  1Y1W J;  3HOX J;  2HPI A;  1X1B A;  1EH7 A;  3QP5 A;  4OMZ A;  3HTS B;  4GGG A;  1IRF A;  3M7G A;  2K3P A;  5D6F A;  4AM3 A;  1FBS A;  3RYR A;  1JTY A;  1XCV A;  3OYC A;  2RKH A;  5LBQ A;  2O03 A;  1VQ4 I;  5GAD J;  4UB8 C;  2ME0 A;  2Y0S A;  4IXA A;  2VON A;  1AOY A;  2LNB A;  4XON A;  3CCS I;  1P6R A;  1Y8Q B;  3C1D A;  2XC7 A;  3KYD B;  1J75 A;  4RB3 C;  5FKK A;  2COM A;  4PGG A;  4LB6 B;  2R7O A;  4G7H F;  2QQ9 A;  4LG3 A;  2ID3 A;  3HGG A;  2MW8 A;  2XAH A;  2JA2 A;  1KZH A;  1P7I A;  2GAU A;  2OBP A;  3KPH A;  4E70 A;  5M5X J;  3KET A;  3QRF F;  2HPM A;  2IAI A;  3FHN A;  3N05 A;  3EET A;  4LK1 F;  4HSR A;  5D5X B;  3HOT A;  2ETH A;  4AID A;  2MYS A;  3ZPL A;  4IHT A;  4YFK F;  4G8X A;  2E19 A;  1WKM A;  2K9L A;  3IWF A;  4M3F A;  4C2T A;  5FD5 A;  4HF2 A;  3K1N A;  2H09 A;  2CQK A;  2XF5 A;  3MFK A;  2BE5 F;  4WXD A;  2XIG A;  4U0W A;  2E1C A;  3KX2 A;  1A35 A;  1FZP B;  4KMF A;  4X1E A;  3GFJ A;  2F5F A;  1FOW A;  4LIU A;  5E8I A;  1O3S A;  3JR9 A;  1Y6I A;  3G1O A;  2NS0 A;  4RAY A;  3CDL A;  3LSR A;  3HRS A;  1VI0 A;  4Y13 A;  2IS6 A;  1U9N A;  1LDD A;  2VBY A;  3QOP A;  5FKM A;  2DMQ A;  4ZYG A;  2P5V A;  2OD5 A;  5CVV A;  5HOD A;  3X2Q H;  5DD4 A;  4L5J A;  2L01 A;  3H36 A;  2E5N A;  4E7I A;  3K4B A;  2Z9O A;  3T5X A;  3H3V K;  2WTE A;  2VQG A;  2R5Y A;  1MW7 A;  3ESW B;  3L09 A;  1WFX A;  5FFX A;  1FP1 D;  4FTH A;  2W82 A;  2P8T A;  3H9J A;  5ICC A;  4L0Z B;  6PAX A;  2LTP A;  3TO9 A;  3H5N A;  3I4N J;  1X2N A;  2A6E F;  3HHG A;  4IO9 F;  1SD6 A;  2Q1Z B;  2QF7 A;  1Z21 A;  2VOD A;  1RR8 C;  1Y0N A;  4AUX A;  2IPQ X;  4KIS A;  1BC8 C;  2I8D A;  1XSD A;  4BE1 A;  2WA0 A;  4N9I A;  2BVL A;  3DFG A;  3WE3 A;  3KEY A;  4BJT A;  2HOT A;  4MNU A;  2A61 A;  1G8X A;  1W5C C;  4MTE A;  4NB5 A;  1IN7 A;  2EFP A;  1JKO C;  1YRN A;  2LKP A;  2DA2 A;  3KEO A;  1U8R A;  2V26 A;  3DPT A;  1W5S A;  2K9N A;  1IO2 A;  2D2W A;  2IBD A;  1ZEL A;  2LY1 A;  1R1V A;  4IHY A;  4DBR A;  2EQR A;  1P2F A;  3DWL E;  3M07 A;  2KT0 A;  4B48 A;  1FMV A;  4R8H A;  2K4J A;  3FK6 A;  5J47 A;  4BHP A;  2ZME A;  4AVP A;  3D1N I;  2K85 A;  1QO0 D;  3I54 A;  4C2M J;  1Z9C A;  2KIF A;  1ZGW A;  1ZGJ A;  1E0E A;  2VKV A;  3O3K A;  2UXN A;  2WY8 Q;  3E6B A;  4A3F J;  4EM0 B;  2R0Q C;  2MBF A;  1P4X A;  5HDK A;  3SYT A;  3PIP F;  5TRD A;  3K10 A;  1BOA A;  2MC3 A;  3EPZ A;  1G59 A;  1YQA A;  2DJI A;  3HKZ A;  2HTS A;  2JQ7 A;  1LKX A;  5H2F C;  4BJ5 C;  2BHY A;  3IUO A;  4DIQ A;  1G4D A;  3SEQ A;  4M6X A;  1BL0 A;  4DQ2 A;  2QQB A;  2CQX A;  3VYR B;  1OFC X;  3PL8 A;  3NWS A;  2Y75 A;  1WJF A;  2L5Q A;  2BV6 A;  2LK2 A;  3G3Z A;  1E3H A;  1S7E A;  3ZXS A;  3QQA A;  2W57 A;  1PUE E;  2P0W A;  2FXA A;  2LC2 A;  2XGX A;  3M8J A;  4OMY A;  4S05 A;  3GTK J;  3OOP A;  5A2Q Z;  3IKT A;  1X3U A;  5J6X A;  1R5H A;  3VFZ A;  1LUJ B;  5JFR A;  3ISP A;  2Z3Y A;  2IS2 A;  4MIM A;  1OPC A;  5L3B A;  5JR3 A;  2AXL A;  2LFB A;  4XN3 A;  3S14 J;  4CGZ A;  3FIS A;  2P5L C;  4XSX F;  1S9H A;  3S3N A;  3VYS B;  3ZMZ A;  2HZD A;  1YW9 A;  3KYC B;  2FJ1 A;  1JGS A;  2IA2 A;  3C2G A;  3B6C A;  3HC7 A;  2E1M C;  3L2R A;  2P5K A;  3VSL A;  2H1K A;  2BHZ A;  2OTL I;  3EUK L;  5E3O A;  4Q5S F;  3GF2 A;  4JYK A;  3DU5 A;  4UB6 C;  4PZJ A;  3OYG A;  1W5T A;  1D1B A;  2VLA A;  2ZFW A;  3N4M A;  1LDK B;  1YLF A;  3OWT A;  2R5Z B;  1QU3 A;  5ILV A;  2X6W A;  2PN6 A;  3S1R J;  2OA4 A;  2V9V A;  3BG6 A;  1IXS B;  1Q1H A;  4N0B A;  3QAH A;  3GZ6 A;  2ZSH B;  4QIW N;  1XGO A;  3H5A A;  3FXJ A;  2FNP A;  3W6V A;  4XBF A;  1IRZ A;  5CLS A;  3REO A;  2HYF A;  4KIC A;  2DA5 A;  1MZB A;  3RIR A;  4DYQ A;  2BEO A;  2BY1 A;  1FP2 A;  3S32 A;  1K83 J;  4BAC A;  2IGO A;  1LQ1 A;  3FKJ A;  3HHH A;  1WH7 A;  3TOB A;  1Y39 A;  3ROU A;  3CMM A;  3J80 K;  4A0Z A;  4LB5 A;  3T1B A;  4L5E A;  1SMY F;  1Z3Y A;  1VQ8 I;  3CO7 C;  1CQT A;  3HPG A;  1Z7U A;  4JX5 A;  3JRA A;  2XGD A;  1T38 A;  5IT9 Z;  2V1D A;  5FFZ A;  5L3G A;  3FXU A;  3MKZ A;  4XLC A;  2IS1 A;  3MVP A;  2ZC2 A;  1ZTR A;  3K7A J;  3WTU C;  4IQJ A;  3GFI A;  2NVT J;  2GOM A;  3OYL A;  4NHJ A;  1I1S A;  4KT6 A;  2DA6 A;  2EIJ H;  3CMY A;  1IJW C;  3E5U A;  2IEK A;  2Z99 A;  1DGW Y;  4KN4 X;  2OCE A;  5LGT A;  5HLH A;  4Y3O A;  2JRM A;  4XMY A;  1GXQ A;  3GME A;  1Z7L A;  2M87 A;  2QBY B;  2M4K A;  1P92 A;  3SDB A;  3F9K A;  4PJJ A;  1IW7 F;  1O3Q A;  1JKQ C;  1DPR A;  3R6S A;  2P7C B;  2ACJ A;  1RET A;  1XPX A;  2ISY A;  2NVY J;  3WTW C;  2CW8 A;  2HU9 A;  2K7L A;  2O3F A;  1VQ9 I;  4ZC3 A;  1OYI A;  4OAZ A;  2XF6 A;  2XAS A;  2ZNY A;  4H0E A;  2HI3 A;  2MA3 A;  1S7A A;  3BJA A;  4JOM A;  2FNA A;  2EZL A;  1XGS A;  3CMA I;  5E79 C;  2E1N A;  5K5R A;  3HBL A;  4C3H J;  1TW3 A;  3L7W A;  2V1U A;  3QYB A;  2DK8 A;  2M4G A;  1KQ0 A;  2JUG A;  2ZKZ A;  4IPA A;  2V9K A;  3CCQ I;  2OTJ I;  3KLO A;  5M3F J;  1MJA A;  2E35 A;  1HLV A;  3RPQ A;  3CCL I;  2EIM H;  1QVT A;  2UUZ A;  2F4I A;  2VT2 A;  4BDY A;  5L3E A;  1SVO A;  4CHU A;  2VPL A;  2KFD A;  2G7H A;  2HFH A;  2O5R A;  3V8L A;  2ZBK A;  3ZN0 A;  5DM6 F;  3FXK A;  1D0X A;  1SAX A;  4EQQ A;  3CCE I;  2MH2 A;  4A2U A;  4OIN F;  2GXB A;  5JVT A;  3VDX A;  1LFU P;  1Z6T A;  2MSY A;  3J81 K;  4MTD A;  2ZFU A;  3TO6 A;  3QP6 A;  3T8R A;  5KAF C;  3IAM 2;  1I5Z A;  3LST A;  2K40 A;  4L9V A;  4D9J A;  1NG6 A;  3TMO A;  1V5F A;  2A6H F;  2IJL A;  3ZP5 A;  1T0F C;  1Y1V J;  3GCM A;  4ITV A;  3C18 A;  3JSO A;  2WV0 A;  1POG A;  2W48 A;  3JRB A;  4XRF A;  5K7H A;  2QYO A;  1P9Q C;  1I6H J;  4I0B A;  1U5T B;  3K4K A;  4II2 A;  3E1S A;  3VOE A;  1R23 A;  1UEL B;  1OR7 A;  4HQM A;  1D0Z A;  1KQ9 A;  3TKY A;  2Q0O A;  2V1X A;  2V4J C;  4I76 A;  3BOQ A;  4AYB A;  2O8X A;  2TDX A;  2XSD C;  3CCU I;  2ADU A;  4BY1 J;  1B6A A;  2KIQ A;  3E97 A;  5J40 A;  3BZ6 A;  4MHG A;  3CUQ B;  3VOD A;  4ZYD A;  5D8L B;  2OZ6 A;  4BKX A;  3OSG A;  3MKY B;  1P4A A;  4IKF A;  2CMP A;  2DCE A;  4LLN A;  3RQ4 A;  3PO2 J;  4FE4 A;  3E6C C;  3H1C A;  3ZQH A;  3KLN A;  5FO5 A;  1CF7 B;  1FOK A;  2DFE A;  3HOV J;  4XKC A;  2XPV A;  1TT5 B;  4BGD A;  4MQV A;  1YS7 A;  9ANT A;  5TJJ A;  1YS6 A;  4DJA A;  2WAF A;  1VQM I;  1B9N A;  3RPU A;  2AO9 A;  3BY6 A;  2B63 J;  3E5Q A;  4IHX A;  3BC8 A;  1E3O C;  1OLT A;  1RI7 A;  3OMY A;  2H6C A;  2XRN A;  2DA7 A;  2VIX A;  1GV2 A;  2R7V A;  4CCM A;  3NAU A;  3R4K A;  2GLO A;  4QSH A;  2WAD A;  4C3I J;  3COA C;  4LK0 F;  4EJW A;  1DUX C;  2ZJQ F;  4XLN F;  3M4O J;  2R5Z A;  4M9X A;  4O5V A;  2IGN A;  3OOU A;  5JHF A;  3OYA A;  2OCC H;  1BBY A;  4HOB A;  4BJ6 C;  3PJR A;  2W24 A;  5C3E J;  3PO3 J;  2VXD A;  2DOE A;  4Y15 A;  2V1N A;  4IEJ A;  1WJC A;  4BU2 A;  1MBJ A;  4XID A;  2Y9Z A;  2W1O A;  3W2A A;  3EUH A;  2PFB A;  4RAF A;  2GOX B;  3DBL B;  1SD5 A;  2NOG A;  1QA6 A;  5IP7 J;  2ID6 A;  2CJJ A;  1MSE C;  1A6Q A;  4PJL A;  1JKP C;  3LSP A;  1A04 A;  1MBK A;  3R60 A;  5CVJ A;  2EFQ A;  2JA7 J;  1A36 A;  2JVG A;  4E6K G;  4HDU A;  3E3V A;  2A5W A;  1H0M A;  2NAZ A;  1Z77 A;  3OL4 A;  4ZYE A;  3I4P A;  4AIH A;  2XUB A;  2CUZ A;  1P7J A;  1IUF A;  1XSV A;  3RI4 A;  2R7R A;  3KP3 A;  1E3P A;  1AKH B;  1S6L A;  2DYR H;  5K5O A;  1L3L A;  5JLW A;  1JXS A;  2FE3 A;  1W4M A;  1LPQ A;  4GFB A;  3G1M A;  2ZME C;  2NVX J;  4AWX B;  1ETQ A;  2Z2S B;  1MMN A;  1G2H A;  4OAY A;  1RES A;  1KYZ A;  2QQ8 A;  2QBY A;  4ESF A;  5FLV A;  1BW5 A;  1GVJ A;  3BPV A;  4BE0 A;  2EV5 A;  1WVR A;  4QWQ A;  2LKX A;  1STZ A;  4NDL A;  5DM7 F;  3SFI A;  3Q9V A;  2VPR A;  3BJO A;  2VJI A;  1XGN A;  5LEJ A;  1B59 A;  5E1X A;  4CYD A;  5BPD A;  5FLM J;  2DOD A;  1O4X A;  3LSI A;  1AWC A;  4F52 A;  2EV0 A;  3J7A Y;  2DDB A;  2W84 A;  3TO7 A;  2P81 A;  3HRT A;  4QPO A;  2HDD A;  2L0K A;  4Y17 A;  1EA3 A;  5FJ8 J;  4A3C J;  3RQI A;  3FIW A;  2Y48 A;  3DPL C;  4CH7 A;  1KGS A;  2P6S A;  5JLX A;  1SVL A;  2GA2 A;  2HKO A;  1XDS A;  2XHK A;  3PNV A;  1W0U A;  4XLA A;  3IL2 A;  2CYY A;  1MBE A;  3PUB A;  3VWB A;  3LSG A;  1LVK A;  2RGV A;  2W25 A;  3HOU J;  2A6T A;  1WSU A;  4DW6 A;  3HJE A;  3P5J A;  2LSO A;  3OR2 C;  3KFW X;  3HRM A;  2EIL H;  4AD9 A;  3ZR8 X;  1NK3 P;  1MMD A;  3GTM J;  4MLO A;  2A68 F;  3E5X A;  3LFU A;  1HOM A;  3F6V A;  4F7Z A;  3J80 Z;  2HXO A;  3D5L A;  3I58 A;  4H4K C;  5J8C A;  5EGO A;  1R9T J;  1Z91 A;  1PJR A;  2Q2E B;  2W00 A;  4JX4 A;  4D5C A;  4MO7 A;  5LGN A;  1ONV A;  4M71 A;  4G12 A;  3O8G A;  1RUN A;  3BCB A;  1IXC A;  2O0Y A;  2PMZ A;  4IVN A;  1MH3 A;  2E7X A;  3K1P A;  3HOS A;  1ZAO A;  3RTR A;  2NOJ B;  4KIB A;  1SEU A;  2IT0 A;  4A93 J;  5E18 F;  2NRA C;  5HS7 A;  4RM3 A;  4G6Q A;  3UKG A;  4B3A A;  5IP9 J;  1FBU A;  3JRD A;  3BLY A;  2DLL A;  1R5I D;  2EH3 A;  3CDH A;  2RDP A;  5DD8 A;  2JRT A;  2YSR A;  1YG2 A;  3G6E I;  1PP7 U;  1T56 A;  2K86 A;  2FA5 A;  3F0C A;  1X1D A;  5IT3 A;  1RKW A;  1ZN2 A;  3BWG A;  2M3A A;  1S7O A;  1R4N B;  1FOX A;  2VBZ A;  2NYX A;  1IRG A;  2WAE A;  3BR5 A;  1WJB A;  4I02 A;  4B1R A;  4WK8 F;  1MD0 A;  3IRQ A;  3CUQ A;  2VJJ A;  2L7F P;  4BXF A;  5F04 A;  3TBI A;  5FLX K;  4XLF A;  1W7P D;  3D5R C;  4XLP F;  2BZT A;  2DMN A;  4RBO A;  1EH8 A;  3LA3 A;  1T6S A;  1JKR C;  1LFP A;  1FTT A;  2FOK A;  2M45 A;  4QPQ A;  2PQ8 A;  4B44 A;  2F2E A;  2E34 A;  1HBX G;  2PEX A;  1I1G A;  2KLO A;  2JA5 J;  4U0V A;  2JN6 A;  1R49 A;  4ZDO A;  2VT3 A;  2GXG A;  3KZI C;  1YE9 A;  1R71 A;  1K4T A;  2DT6 A;  1JI8 A;  2DYS H;  5GAH J;  4HPQ A;  4A12 A;  2ZNZ A;  3BG3 A;  2HVR A;  3FMR A;  1SFX A;  5HVQ C;  5H20 A;  3GXO A;  2DPU A;  5AON A;  2VUM J;  1TZL A;  1QHH D;  2AXT C;  2UV1 A;  2CH0 A;  5J4Y A;  4Z6Y A;  5HNF A;  1TWH J;  3BDD A;  2GIZ A;  2M1B A;  4BS9 A;  4WCG A;  3ABU A;  4ZJZ A;  2X48 A;  1IN5 A;  2RQQ A;  1IN6 A;  3CP2 A;  2X4H A;  1YFH A;  1KU9 A;  1B72 A;  2HDC A;  5HLI A;  3J81 Z;  3A4C A;  1SFO J;  2VJ4 A;  1TT0 A;  3PM1 A;  3I0T A;  1A6I A;  3DKX A;  2XAJ A;  4HG2 A;  4IL6 C;  5CVR A;  3ZQC A;  3AKZ A;  3BR6 A;  4BQO A;  1M1E B;  2XRL A;  3AG3 H;  2CUE A;  4EEF G;  2JA6 J;  3HSF A;  2CW7 A;  4XSZ F;  3BR1 A;  2LF8 A;  2V9P A;  2H94 A;  2DAO A;  4GYG A;  3ASO H;  4DOZ A;  4NUB A;  3Q0W A;  3LA7 A;  3K9T A;  1WCM J;  4QLC U;  1GXP A;  1FSH A;  3PSI A;  5ILU A;  1V3F A;  2KRH A;  3TP3 A;  2EA4 A;  2JA8 J;  2K9Q A;  1Z0X A;  1FIA A;  4BXU A;  2XF7 A;  5J1U A;  2YUS A;  3MMY B;  2C6Y A;  3KP6 A;  3K70 C;  1B8I A;  1QGP A;  3PNY A;  1MKM A;  3DTE A;  1SFK A;  2F5E A;  2XAU A;  1OCT C;  4I2O A;  3OS0 A;  3AG2 H;  2XKP A;  4GYI A;  5FRM A;  1AHD P;  1ERD A;  2DDA A;  1N77 A;  1H89 C;  3GFM A;  1X1C A;  3K1M A;  4BL0 B;  2X51 A;  3M9A A;  4XOT A;  2CV2 A;  4WX9 A;  2PX9 A;  1H88 C;  2M8G X;  1JJ8 C;  1E2X A;  3HXL A;  2QSH X;  2R7U A;  4CZC A;  1JUM A;  2MLK A;  2ZXI A;  3M8F A;  3S16 J;  3VB2 A;  1ZQ3 P;  1X19 A;  4HST A;  1IUY A;  1B4A A;  2NS7 A;  2FBK A;  2STT A;  4XL9 A;  3GZN B;  4CYC A;  3OY9 A;  5F0H A;  4I7H A;  4S0H B;  3KCC A;  5E1W A;  1Z6R A;  1I39 A;  3M1C A;  4FX0 A;  5B66 C;  3QU3 A;  1USS A;  3HDD A;  2O8K A;  2DQR A;  4MGR A;  3F6O A;  4L18 B;  5CYV A;  4KN7 X;  2EWN A;  2FBH A;  2JJ7 A;  2LLK A;  3HL2 A;  3BTI A;  2R7T A;  2OUM A;  2EFW A;  1OR7 C;  5EEH A;  2QWW A;  4ENK A;  2WAQ A;  1F43 A;  4B43 A;  1LB2 A;  1Q1V A;  4P55 A;  1NK2 P;  3I59 B;  2UWM A;  1BIA A;  3HM5 A;  3HOZ J;  2WB1 N;  2M0C A;  4P96 A;  4LG0 B;  1TQI A;  1UFM A;  4BDZ A;  1BI2 A;  2DQL A;  4PK4 A;  2WBM A;  5IYB J;  4Q48 A;  1RRJ A;  1EKE A;  3RCO A;  3HTU A;  4A3D J;  3HZJ A;  1FYK A;  3HG9 A;  2EK5 A;  5D4S A;  5DCM A;  2GXA A;  4NC7 A;  1ZRC A;  3RKW A;  3FBI B;  3MAJ A;  4CCJ A;  2DTZ A;  3C7J A;  4FCY A;  5E3L A;  3QOD A;  2DTR A;  3IKV A;  5HDN A;  1ETK A;  2KL4 A;  4ENJ A;  1DQU A;  4LD5 A;  4E4H A;  1G3Y A;  5AIQ A;  1MBH A;  2H8W A;  4CCL A;  2XAG A;  3O6B B;  4Q4Z F;  2B9S A;  3F21 A;  2Q2E A;  1X4P A;  4EGY A;  1S29 A;  2Y31 A;  2R4G A;  2FU4 A;  1KQ8 A;  5E20 A;  2QQA A;  1D5V A;  5BOX A;  3LSK A;  2ZB9 A;  3E6M A;  1T08 B;  1ZHF A;  2CS3 A;  1UZC A;  1PVE A;  5CKT A;  3LAJ A;  4XKB A;  2BW3 B;  3S2D J;  1GHC A;  3ABL H;  1VND A;  1WJD A;  2CQN A;  1GVD A;  1J5Y A;  4KIG A;  2HZT A;  1JHF A;  4RM2 A;  2RAE A;  3RKX A;  4AVZ A;  1SD4 A;  3IHU A;  2A69 F;  5JHU A;  3BZK A;  1SMT A;  1ETV A;  2DA1 A;  3R0J A;  4X0G A;  4ENM A;  1WJA A;  2IVM A;  3OYM A;  2BY0 A;  2YX4 A;  2BY3 A;  4YFN F;  3V8K A;  1MND A;  5FRO A;  3S2H J;  2HVQ A;  3WG9 A;  3OS2 A;  3TL4 X;  1MNM C;  3PUF A;  3DQV C;  2K9S A;  1KA8 A;  2XPW A;  2J5O A;  3KIO A;  5LGU A;  1QPM A;  1S5L C;  3ERM A;  1EJ9 A;  2DXI A;  3CC4 I;  5ICE A;  2KRC A;  4JBA A;  2MFZ A;  5B1A H;  3GTJ J;  3G4S I;  4EGZ A;  2RNJ A;  4LLG F;  1TWF J;  4AIK A;  4NQW B;  3IC7 A;  3AL0 C;  1CGP A;  4M3E A;  4P9U A;  2OAZ A;  4N4O B;  3JRG A;  5ICG A;  3FKI J;  4GRI A;  5E17 F;  4XRS A;  3L9F A;  1OCP A;  3G1L A;  1D3Y A;  3CO6 C;  5CPR B;  2QGU A;  1XSX A;  3I4M J;  3ZMU A;  4KYW A;  2EJR A;  1ZLJ A;  1N75 A;  2VC0 A;  3W3C A;  1DGR M;  5LD2 C;  1DDN A;  2HTJ A;  4HNU A;  4NNJ A;  2L7K A;  2ECB A;  4QTR A;  3ECH A;  2E1M B;  2FML A;  5F0C A;  5F1J A;  4HX4 A;  3NRV A;  4XKV A;  3J7Y J;  2HYJ A;  3WG7 H;  4UVC A;  4DYC A;  3BZC A;  2ZXJ A;  4CCN A;  1U9O A;  3OYB A;  4BAY A;  1VTN C;  1FEX A;  2DFI A;  3OYI A;  1FSE A;  4UNO A;  3OYH A;  2LOO A;  3FF5 A;  1SVM A;  1Z67 A;  3F8C A;  2KRF A;  2JUC A;  4KMU X;  4PJM A;  3OS1 A;  1F4K A;  1SFU A;  1I3Q J;  3TED A;  1U2W A;  3CJN A;  3JSP A;  1PP8 F;  5CVI A;  4YEL A;  3OYD A;  1BN5 A;  1YJW I;  2IGK A;  4ZTF A;  1ZG1 A;  2OJE D;  1NHA A;  1IRX A;  3K4C A;  3CJR B;  4WWC A;  5HLG A;  3MD2 A;  2ELJ A;  3GLX A;  1VQP I;  1ZK8 A;  2F4O B;  4BY7 J;  3C3W A;  1WRJ A;  4NBQ A;  4Z2Y A;  1YTY A;  5EJC A;  3WTX C;  3CUO A;  5B3S H;  3M3Y J;  2VI6 A;  4BNC A;  1S3J A;  5DCF A;  1OCR H;  5FLX Z;  2VBW A;  2HQR A;  4DZJ A;  1X1P A;  3R0A A;  4EV0 A;  4F91 B;  5K7Z A;  2RQP A;  1K78 B;  2PG4 A;  3CCV I;  2DFF A;  1TW2 A;  3BTL A;  1GUU A;  4LJZ F;  2LDU A;  2D1H A;  4EMS A;  1WPK A;  1H9G A;  4YG2 F;  1P4W A;  1WHU A;  3KE2 A;  1QVU A;  3ABT A;  3GEZ A;  2YPR A;  2M7B A;  4EJO A;  4KA4 A;  3ZQL A;  5FB2 A;  4JX6 A;  2BBY A;  5EEG A;  4IRH A;  1DP7 P;  1N78 A;  4F92 B;  1QZE A;  3LA2 A;  3BG9 A;  3OYN A;  3SQN A;  4V2G A;  4RLQ A;  3ZQI A;  2HS5 A;  3HGY A;  4UUS B;  4AIJ A;  3RYP A;  4PJ0 C;  5TGT A;  2G9W A;  4C30 A;  1Z05 A;  1PDN C;  2XDV A;  3I59 A;  4A3M J;  2BY2 A;  3J7Z I;  3S3O A;  1A31 A;  3T0Y A;  1IZ1 A;  3A0B C;  3TP0 A;  2M30 A;  2OZU A;  4ON0 A;  3ZGK A;  4LG0 A;  2MH9 A;  5F1R A;  2EBI A;  1S72 I;  4BEH B;  1W0T A;  3DTK A;  1V4R A;  2FX0 A;  3B02 A;  5C44 J;  1R22 A;  2HGC A;  2L9N A;  3GBG A;  3CME I;  3JRI A;  1JUP A;  1U0J A;  3LAP A;  3H9G A;  4FAS D;  1MJB A;  1WH5 A;  2FSW A;  4RGX A;  3OR1 C;  2R7Z J;  5DYM A;  3OYF A;  2D1V A;  3IWZ A;  3WGI A;  3HOW J;  4A3B J;  4NC6 A;  4XN0 A;  4MFE A;  5EYR A;  2A5Y B;  1O3R A;  1IDY A;  3DLA A;  3MZH A;  3QOE A;  4P9F A;  3GTP J;  3ABM H;  2F5V A;  2CQQ A;  2N8G A;  3CCM I;  4IRI A;  4K2E A;  3CC2 I;  4A3G J;  1YO5 C;  2R7X A;  3CC7 I;  5H6R A;  2PJR B;  1KU3 A;  5IOY A;  3U2R A;  2WB1 A;  2LBF B;  5JI6 A;  3FXM A;  5F27 A;  1LE8 B;  4EM2 A;  4Y52 J;  3W2W A;  3MN2 A;  4YFX F;  3JAM K;  1G3W A;  4E7Z A;  3IRR A;  2CO5 A;  4FHT A;  2L9R A;  4HW0 A;  1AU7 A;  1LNW A;  5GPA A;  4KNY A;  5IPA A;  4WF2 A;  3JTG A;  3J7A O;  3N97 A;  1IC8 A;  3BQZ A;  3Q3S A;  1DU6 A;  2OQR A;  4U7D A;  5E3M A;  4PFP A;  5FKN A;  1TWA J;  4XKW A;  3SXY A;  1FLI A;  3AFH A;  4Y33 A;  1SC7 A;  2DW4 A;  5H6Q A;  2EZI A;  5D5U B;  3ZMV A;  4L9J A;  2Y9Y A;  3HUG B;  3LQQ A;  5M3M J;  2HR3 A;  4HX8 A;  4D1Q A;  2ZO4 A;  4LFU A;  2P7V B;  3WOD F;  5GAE J;  3OV8 A;  3GLL A;  4RGR A;  5J1Y A;  2ELH A;  2M8E A;  2G7U A;  4JQF A;  4KDP A;  5LHG A;  2OU2 A;  4Y7N J;  2HOA A;  4CDG A;  3LFK A;  3OSF A;  1LVA A;  2L4A A;  3VSK A;  3NEU A;  5IYD J;  2ESH A;  3A1Y A;  1LEA A;  2JPC A;  3W2V A;  1IAW A;  2E2I J;  3GX4 X;  2HOE A;  2NS8 A;  4E7J A;  5TIS C;  2JZY A;  2QUF A;  1V55 H;  3K70 D;  3TW7 A;  5IY5 H;  3S1Q J;  1RC9 A;  4XNF A;  2IA1 A;  4NQW A;  4NC8 A;  3ZQQ A;  2B7E A;  3OIO A;  2X6X A;  1T33 A;  1G6N A;  2CWE A;  3UR3 C;  4ABZ A;  2IP2 A;  5EG0 B;  3CD6 I;  3SDG A;  3P9I A;  5BS6 A;  3VYU B;  1C0W A;  1HW5 A;  4XR6 A;  1KON A;  5C4X J;  5DUK A;  2L9V A;  1VQK I;  4HAM A;  4LIT A;  4XIC A;  1ZLK A;  1ZYR F;  1HST A;  3I5U A;  1UJ8 A;  1ZRE A;  4RS8 A;  2PLY A;  3LL7 A;  2E7W A;  4XOR A;  1N25 A;  2CW0 F;  5GP9 A;  2E2H J;  1ZGA A;  1IXR C;  1YW7 A;  2R7D A;  3ZQG A;  1T39 A;  3DP7 A;  4ETS A;  2HYG D;  2XB0 X;  4HA8 A;  3FBN B;  5LHI A;  4PSX A;  1HQC A;  5J3L A;  3E6D A;  1B1B A;  1JE8 A;  3H5R A;  2QM3 A;  2BXY A;  4HEA 2;  4GXO A;  2Y2Z A;  4HX7 A;  3FMQ A;  4RB0 A;  3S2W A;  3PSF A;  4YIR X;  3O2P E;  2DFH A;  2LY2 A;  1S8N A;  3G2B A;  3P9K A;  1WZ2 A;  2JVH A;  2VE9 A;  2E71 A;  4P5O A;  3P9C A;  3L2V A;  3BR2 A;  1BI0 A;  2RVC A;  3RJP A;  1X1A A;  2DI3 A;  4KT5 C;  2FQ3 A;  3WTZ A;  2CGP A;  1TNS A;  5KAI C;  4MEY F;  1ITY A;  3OYK A;  1UMQ A;  2ME6 A;  1LJ9 A;  5FRN A;  2D45 A;  3MKL A;  2ZXH A;  2KZV A;  1OYW A;  3C2B A;  3ZCO A;  4ZTJ A;  4DYR A;  2H8R A;  3SZT A;  2ICW G;  1W1W E;  4HBL A;  2L7M P;  4M6V A;  2P6T A;  4ASN A;  1YRN B;  1ZRF A;  3RPU D;  2OF7 A;  1K78 A;  5BPI A;  2LRE A;  1R1T A;  2L4M A;  1EF4 A;  3HKZ N;  3DEU A;  2Z5U A;  5LFA A;  2XSJ C;  3TGN A;  4A69 C;  1YIT I;  3KP7 A;  2ZME B;  3IH2 A;  1RIO H;  5F08 A;  2DT7 B;  1MNE A;  4RDU A;  3QYF A;  3WHC A;  2GIV A;  3DEW A;  5HS9 A;  2VQH A;  4A6D A;  1K6Y A;  3Q9S A;  2NNN A;  5CJ9 A;  4M3B A;  4C3J J;  1K7A A;  1HKQ A;  2VKH A;  4EJT A;  2QVO A;  2BOL A;  1MIJ A;  5GPC A;  1XMK A;  2QKL B;  3F23 A;  4XQF A;  1NTC A;  2HQN A;  3V42 A;  1FYM A;  1RNL A;  1DU0 A;  4OU0 A;  1ZRD A;  1XTA A;  1UST A;  4BEH A;  2COB A;  1OQY A;  4G9Y A;  3PNT A;  1R00 A;  1IGN A;  1NG7 A;  1J59 A;  3BTJ A;  2L3D A;  4IOC F;  2KJC A;  4PFO A;  4HNV A;  1HSJ A;  4N9H A;  2KQR A;  1U5T A;  1BJA A;  2HQA A;  1T98 A;  1ZAR A;  3EYI A;  4EM1 A;  3B73 A;  3JTH A;  2G0E A;  3S3M A;  2GZW A;  3ELK A;  2X85 A;  1MMG A;  1BW6 A;  2DJN A;  3KP4 A;  1FWZ A;  5FGM A;  3CDI A;  2FMY A;  3ECO A;  2DO7 A;  2VXZ A;  3V7S A;  2FD5 A;  2PJR A;  3DEE A;  4V2F A;  3ML6 A;  1WGX A;  1TWG J;  1Z3X A;  3TW6 A;  2E1O A;  3S17 J;  2PI0 A;  3F8N A;  3WU2 C;  1YI2 I;  1L0O C;  3IH3 A;  3VYT B;  4CIC A;  1HF0 A;  1O7F A;  2YX7 A;  1F36 A;  1HCR A;  1CF7 A;  2KHM A;  4IZZ A;  5F64 A;  3DTI A;  3K2A A;  4B8X A;  4EJU A;  5D6E A;  3DLL F;  2EIK H;  3FXO A;  4A3I J;  3ZMT A;  4RAG A;  4ZZD A;  2XVC A;  3CCJ I;  4D5F A;  3CF5 F;  5EZH A;  2NXN B;  1X4O A;  4I01 A;  4RLF A;  1SD7 A;  2QEX I;  1ETY A;  2O61 A;  1YIO A;  3BP8 A;  1K61 A;  2AS5 F;  1T0F A;  2Y69 H;  2DOF A;  2FEZ A;  3LOC A;  4PGH A;  3HUG A;  4ZDL A;  4LGW A;  1R36 A;  3DXJ F;  4ESJ A;  3U1D A;  4UUV A;  3GFL A;  3NWT A;  1TP4 A;  2PBI A;  5HS8 A;  5GAG J;  3LMM A;  3FX3 A;  3TDU C;  3QYE A;  2HXI A;  2K02 A;  1WJ5 A;  5IP6 A;  3ZRG A;  2YR2 A;  2X1C A;  5L3C A;  3H0D A;  1YOV B;  3H3Z A;  2YU3 A;  2LR8 A;  3S8P A;  3HIF A;  2F6C A;  2R7W A;  4A3K J;  5LLQ A;  3DV8 A;  3GUD A;  3Q0U A;  3W6J B;  1D1A A;  2E60 A;  4FE7 A;  2H6B A;  2LF7 A;  1FT9 A;  4ZYH A;  1TQM A;  2V6E A;  4BQN A;  3QU6 A;  4CZZ A;  3QWL A;  2RN7 A;  3AAF A;  2Z33 A;  2KPM A;  4UY8 I;  3SJM A;  3A03 A;  2XKO A;  2HVS A;  2OPT A;  3KZZ A;  3K4M A;  5EG0 A;  4UXN A;  1TL8 A;  2EA2 A;  3CJQ B;  3CF2 A;  2W7N A;  2CU7 A;  2EV6 A;  5ED4 A;  1W36 C;  1BC7 C;  3EQL F;  5E8G A;  2L9S A;  4FIS A;  3FZV A;  2DMP A;  4W1U A;  2MG4 A;  2HOS A;  1D8J A;  4DZP A;  4IHV A;  3ASN H;  2V7F A;  2ISZ A;  4J01 A;  3HB9 A;  1O3T A;  1G3T A;  1AKH A;  2IGM A;  3OIQ A;  2Y0M A;  3JAM Z;  5L3D A;  2KIM A;  2DA3 A;  4I09 A;  5IOZ A;  5GTI C;  4FX4 A;  3GWZ A;  4OIP F;  1LFB A;  1UHS A;  1GT0 C;  3CES A;  4BQA A;  2HKX A;  3CCY A;  4M73 A;  5ERI A;  1D1C A;  2QLZ A;  4M3G A;  3D0S A;  1SFE A;  1ORK A;  3ZN1 A;  3F8M A;  3K6G A;  1APL C;  4F55 A;  1UCR A;  2ZJP F;  3TDZ C;  2MD0 A;  1ENH A;  2CUF A;  4PJN A;  2VBX A;  4HDV A;  5DDG A;  4D7N A;  3JRC A;  1MDM B;  3WGG A;  1EV7 A;  4HV6 A;  1OMI A;  1K4S A;  1UG0 A;  4E7S A;  1V5G A;  4WXH A;  2VOO A;  4CXF A;  4RB2 C;  1BR1 A;  2B0L A;  5FKO A;  3WHB A;  1VQ6 I;  2A05 A;  3IP4 B;  5BNG A;  2IW5 A;  1ODD A;  3GZ5 A;  4GO1 A;  2Z1D A;  4RAZ A;  1K79 A;  1OJL A;  2X0L A;  5C4J J;  4ENN A;  2JTV A;  4BYY A;  1D0Y A;  1MBG A;  2JT1 A;  1GDT A;  1JT0 A;  1BI3 A;  2K4B A;  1R58 A;  1IN8 A;  2TRT A;  3FDY A;  1VFC A;  1QZY A;  3SEZ A;  4ZH4 F;  4XRM A;  3QPL A;  3PFI A;  1J2X A;  4UV9 A;  4CA0 A;  4CCO A;  2RC4 A;  2F5C A;  4AYB N;  3KYL A;  4IRG A;  1PUF B;  4J19 A;  1LDJ A;  2VQC A;  1JHH A;  3BR0 A;  1TBX A;  3DPU A;  1J7K A;  1R6R A;  1QHG A;  3JRE A;  4HRI A;  4L9N A;  3OYE A;  3WU0 A;  5D5V B;  4IX7 A;  3LQR A;  4AC0 A;  3QPH A;  5D4R A;  5ICF A;  3PFY A;  1YX5 A;  3MKW B;  4A3L J;  3U9G A;  1E17 A;  3NAR A;  1TNT A;  2LH9 A;  2VL8 A;  4M72 A;  3CLO A;  3O8H A;  3ABK H;  1KU7 A;  4A6E A;  2WY7 Q;  1FIP A;  4HNT A;  1ETW A;  1MGT A;  1MMS A;  4HZF A;  1X3W B;  3E7L A;  5FKL A;  1DPU A;  2HNH A;  2R7S A;  1GV5 A;  3JW4 A;  1FOY A;  2DT5 A;  2KIS A;  1XS9 A;  2RV8 A;  2X6Y A;  4B3X A;  4U87 A;  4OIQ F;  1T95 A;  2X1E A;  3BG5 A;  2VE8 A;  3EUA A;  1QBJ A;  3HSE A;  3EUH C;  1R4M B;  5KCM A;  3ULQ B;  3GW2 A;  3I71 A;  2JPB A;  1REP C;  4D7M A;  4BHB A;  2W85 A;  3CP8 A;  3F8B A;  3K4J A;  3RZD J;  3KP5 A;  1ETO A;  4IF4 A;  1VQ7 I;  1I50 J;  2FUG 2;  4O6J A;  4E7L A;  4RA2 A;  5DTD A;  2IS4 A;  5CVU A;  3RKQ A;  3CJT B;  1JGG A;  4BBR J;  1UAA A;  2Z16 A;  1FNN A;  5DV5 A;  1MMA A;  4C9Y A;  2LP0 A;  2CV1 A;  2F48 A;  4N4N B;  2STW A;  4DBQ A;  3SFZ A;  5HDG A;  1R7J A;  3JCU C;  4M9Z A;  3Q0V A;  1BIB A;  4YIF A;  2QSF X;  1WI9 A;  4HLY A;  3MEX A;  2ELK A;  3CTA A;  3L00 A;  1ZR2 A;  2LG4 A;  2CFO A;  4EJV A;  1ULY A;  4OWR B;  5HNH A;  2L02 A;  5M5W J;  1MJ9 A;  1R1U A;  1ON1 A;  2R7F A;  3K2Z A;  4I6Z A;  3L2W A;  4LMY A;  2VC1 A;  3BPX A;  5HLT A;  1MSF C;  5CQG A;  1T2K A;  3ZMD A;  4KUM A;  5J8F A;  1FPQ A;  5HOO A;  4L5I A;  4GDF A;  2FOW A;  4A5M A;  3ERE D;  2QSG X;  1G3S A;  1FBQ A;  2X1D A;  3FXR A;  4F93 B;  5FD6 A;  2Q8K A;  2UXX A;  1UHM A;  3QPS A;  2MD5 A;  3BCA A;  3PQK A;  4FQG A;  1OYY A;  1VZ0 A;  4MQ9 F;  4OOI A;  2ZJR F;  1HA8 A;  1LEB A;  2VAS A;  1XD7 A;  2KMU A;  3TQN A;  5EZG A;  3VPR A;  1NH3 A;  2P4W A;  3A02 A;  4XRS G;  1OCO H;  2PMH A;  1HKS A;  3HYI A;  1IF1 A;  1BJZ A;  1TTY A;  1Z1D A;  2PJP A;  1SAU A;  2KDZ A;  1YYV A;  3M8E A;  5KHD A;  2VOP A;  2RNG A;  3MCZ A;  3AL0 B;  4DNC A;  5KVR A;  3FXQ A;  2WV1 A;  1FMW A;  4PCQ A;  2O9L A;  1ZH5 A;  4Y4R A;  4A5N A;  4HF0 A;  3K0L A;  1QNT A;  2HWV A;  5BQT A;  2FF4 A;  1W7P B;  1U78 A;  5JVG F;  1YJN I;  2W4S A;  3GVA A;  2DU9 A;  4ZDP A;  2FBI A;  4BHC A;  1FC3 A;  4BE2 A;  3RSN A;  3A01 B;  4XM3 A;  3I55 I;  2QEN A;  1ZG3 A;  3V8J A;  5K5Q A;  3L2Q A;  1IV6 A;  5E1Z B;  1EH6 A;  1U6G A;  3GTL J;  1HDD C;  4OIR F;  1RKT A;  4XLH A;  5D5W B;  3LWF A;  3A2K A;  4P1W A;  1VQL I;  1IN4 A;  1T8I A;  1HW2 A;  3ZOB A;  2AHQ A;  4CO8 A;  1I6X A;  3BG7 A;  1BR4 A;  1HDP A;  4ESB A;  2GQQ A;  3FHZ A;  2E5Z A;  1IG7 A;  1TWC J;  2OQG A;  1QZZ A;  4M3D A;  4IHW A;  4L0Y B;  1HW1 A;  3ZQF A;  2JMW A;  5E3N A;  5CQE A;  2ECC A;  2XRO A;  2IXS A;  4IJA A;  3LSH A;  2M34 A;  1MDM A;  2TCT A;  1XGM A;  2XPU A;  1VQO I;  2E2J J;  4IHS A;  4KFC A;  1U5T C;  1V5E A;  2XV4 S;  4IOA F;  2DOA A;  3DKY A;  2IRF G;  2PMZ N;  5BMZ A;  3G73 A;  3FXL A;  1QPI A;  1D5Y A;  4G7Z F;  4G6T B;  3E0J B;  4A0X A;  4M74 A;  1RPW A;  2DK5 A;  2L2O A;  2OV7 A;  3CUQ C;  1JT6 A;  3WTS C;  2BGC A;  5ILS A;  3RDI A;  1XMA A;  4B47 A;  2KJB A;  4E7H A;  1VQN I;  3I3L A;  1TLH B;  2CV0 A;  5EGO B;  3BTC A;  2M5W A;  4KIT B;  1YHQ I;  1XCB A;  3A0H C;  2EIN H;  1PUF A;  1HC8 A;  3OYJ A;  1FY7 A;  3WTV C;  4PSW A;  3FM3 A;  3RKY A;  1I3A A;  4UVA A;  2ESN A;  1FYL A;  2FRH A;  3H35 A;  3T8T A;  2A3S A;  3CLQ A;  4JP0 A;  3U1K A;  4UV8 A;  2X6O A;  3H0G J;  3FK7 A;  3C2H A;  2MLG A;  3K4N A;  5EEA A;  1DP3 A;  2MGQ A;  1JUS A;  1O7L A;  2Y0S N;  1H9T A;  1J09 A;  5LHH A;  3KP2 A;  3WE2 A;  2VKE A;  2BYV E;  3I9V 2;  3LNQ A;  3F22 A;  1VF9 A;  3D5S C;  5EF6 A;  2WC2 A;  3DF8 A;  3K4L A;  4RMN A;  4G7O F;  1Y56 A;  2BW3 A;  4ANJ A;  5K7F A;  2HDW A;  3DCF A;  4I98 B;  3BRO A;  2EB7 A;  3S93 A;  4D0P A;  3LSJ A;  5F0F A;  1YIJ I;  3MQ0 A;  1ZKG A;  2J5P A;  1PYV A;  3M1E A;  3MWM A;  4LLL A;  3S15 J;  4BH9 A;  2R92 J;  1ACI A;  2R3S A;  3TOA A;  3GTO J;  3WTT C;  5KK1 A;  1UG2 A;  3HEF A;  2GM4 A;  1FTZ A;  1R5G A;  2QCO A;  3DBH B;  1X3Z B;  4XLE A;  2EFN A;  3KEQ A;  1WJE A;  3CZ6 A;  4ZZL A;  2JWT A;  2QZ8 A;  3F8F A;  4HV5 A;  2IA0 A;  3SZG A;  3HSR A;  1WI3 A;  1ETX A;  4YEJ A;  5J1R A;  4EAT A;  4MEX F;  2ZSI B;  4DGW B;  2VKD A;  4G6D A;  5AIP A;  2KDO A;  1ON2 A;  1W36 D;  2RRE A;  1BM9 A;  2XGC A;  1OKR A;  2V79 A;  4LOC A;  1F1Z A;  4YRV A;  4R1H A;  2I5U A;  2NNY A;  4HYE A;  3DKW A;  4XK4 A;  2CUJ A;  2GA1 A;  5IYC J;  3HRU A;  5B1B H;  2DPD A;  4HQE A;  3NQO A;  2FQ4 A;  2F4M B;  4ZYA A;  3W6K B;  5LRR A;  4UHT A;  2EFO A;  4A3J J;  3GTG J;  4HLX A;  4CCK A;  2LD5 A;  1U3E M;  1RZ4 A;  3B6A A;  4A0Y A;  1RR7 A;  4S04 A;  3CCR I;  1B72 B;  2LKS A;  3H3U A;  3LSM A;  4G94 A;  3GYH X;  2Y30 A;  1HKT A;  2M2E A;  3MZ8 A;  2V6C A;  1XMX A;  3L2C A;  2QKM B; 
#chains in the Genus database with same CATH homology
 2CG4 A;  1UB9 A;  1HXD A;  4HF1 A;  1WQ2 A;  3FM5 A;  1K6O A;  4R79 A;  3PQJ A;  4EVI A;  1J0R A;  1I27 A;  4U7B A;  2DBB A;  2GWR A;  3SZP A;  1J9I A;  2XAQ A;  4M6Y A;  4JK1 X;  3ZQ7 A;  3V4G A;  5L3F A;  3K69 A;  5K1Y A;  2ZCW A;  3GO5 A;  5A2Q K;  4RB1 A;  1Y0U A;  2H27 A;  1XDU A;  2XAF A;  4FT8 A;  3H92 A;  1KU2 A;  4UVB A;  3F72 A;  1W7P A;  3F3X A;  3BJ6 A;  1F9N A;  1B9M A;  5DUI A;  3EYY A;  3V7R A;  3R61 A;  3MZY A;  4RGS A;  5F6F A;  2KIU A;  5DEQ A;  4Q47 A;  4U0Y A;  4WXC A;  4YII A;  1YW8 A;  2CFX A;  2WWY A;  1QQI A;  1TQP A;  3I64 A;  3WU1 B;  2KKO A;  2PMU A;  1FX7 A;  1XN7 A;  4O3M A;  4RGU A;  2O6G E;  2ZJ2 A;  2JSC A;  4GCV A;  3WTY C;  5DCM B;  1XB4 A;  3WGH A;  2L54 A;  4TV7 A;  3SHF A;  3ZMS A;  1ZG5 A;  5LRS A;  1F5T A;  2K27 A;  5IT9 K;  1D8K A;  1O57 A;  2F5D A;  3FMS A;  3FWE A;  3Q5F A;  5D8K B;  1WWX A;  1KYW A;  4U88 A;  1UHW A;  1BI1 A;  4PDK A;  2CSO A;  2VN2 A;  3VEP A;  4OIO F;  3I53 A;  3QPT A;  5LEK A;  3P7N A;  3V7C A;  4KIF A;  2A07 F;  1RUO A;  4I0A A;  3KZY A;  4B09 A;  4L9T A;  2UZK A;  3EDP A;  2HEO A;  4M9S A;  1EH7 A;  3QP5 A;  4OMZ A;  3HTS B;  4GGG A;  1IRF A;  3M7G A;  5D6F A;  1FBS A;  3RYR A;  1XCV A;  2RKH A;  5LBQ A;  2O03 A;  4IXA A;  2VON A;  1AOY A;  2LNB A;  1P6R A;  3C1D A;  1J75 A;  4RB3 C;  2COM A;  4PGG A;  4LB6 B;  4G7H F;  2QQ9 A;  2XAH A;  3QRF F;  4E70 A;  2GAU A;  2OBP A;  3KET A;  3EET A;  4LK1 F;  5D5X B;  3HOT A;  2ETH A;  3ZPL A;  4IHT A;  4YFK F;  4G8X A;  1WKM A;  3IWF A;  5FD5 A;  4HF2 A;  3K1N A;  2H09 A;  2CQK A;  3MFK A;  2BE5 F;  4WXD A;  2XIG A;  4U0W A;  2E1C A;  1FZP B;  4KMF A;  3GFJ A;  2F5F A;  5E8I A;  1O3S A;  2NS0 A;  4RAY A;  3HRS A;  4Y13 A;  1LDD A;  2VBY A;  3QOP A;  4Q5S F;  4ZYG A;  2P5V A;  2OD5 A;  5CVV A;  5DD4 A;  4L5J A;  2L01 A;  2Z9O A;  3T5X A;  2WTE A;  3L09 A;  5FFX A;  1FP1 D;  2P8T A;  5ICC A;  4L0Z B;  6PAX A;  3TO9 A;  2A6E F;  3HHG A;  1SD6 A;  2VOD A;  2IPQ X;  1BC8 C;  1XSD A;  4N9I A;  3DFG A;  3WE3 A;  4MNU A;  2A61 A;  4MTE A;  4NB5 A;  1IN7 A;  2EFP A;  2LKP A;  3KEO A;  1U8R A;  3DPT A;  1W5S A;  2D2W A;  1R1V A;  1P2F A;  4R8H A;  2K4J A;  4BHP A;  2ZME A;  4AVP A;  1QO0 D;  3I54 A;  1Z9C A;  2KIF A;  1ZGJ A;  3O3K A;  2UXN A;  3E6B A;  4EM0 B;  2MBF A;  1P4X A;  5HDK A;  5TRD A;  1BOA A;  2MC3 A;  1YQA A;  2HTS A;  1G4D A;  4M6X A;  4DQ2 A;  2QQB A;  2Y75 A;  2BV6 A;  3G3Z A;  2W57 A;  1PUE E;  2FXA A;  2XGX A;  4OMY A;  4S05 A;  3OOP A;  5A2Q Z;  3IKT A;  1X3U A;  5J6X A;  1R5H A;  3VFZ A;  5JFR A;  3ISP A;  2Z3Y A;  1OPC A;  5L3B A;  5JR3 A;  2AXL A;  4CGZ A;  2P5L C;  4XSX F;  3ZMZ A;  1YW9 A;  1JGS A;  2IA2 A;  2P5K A;  3GF2 A;  4PZJ A;  1W5T A;  2ZFW A;  3N4M A;  1LDK B;  1YLF A;  5ILV A;  2PN6 A;  2OA4 A;  2V9V A;  4N0B A;  1IXS B;  1Q1H A;  3QAH A;  3GZ6 A;  1XGO A;  2FNP A;  4XBF A;  5CLS A;  3REO A;  2HYF A;  4KIC A;  1MZB A;  3RIR A;  2BEO A;  1FP2 A;  1LQ1 A;  3HHH A;  3TOB A;  3ROU A;  3J80 K;  4A0Z A;  4LB5 A;  3T1B A;  1SMY F;  3CO7 C;  1Z7U A;  1T38 A;  5IT9 Z;  2V1D A;  5FFZ A;  5L3G A;  3FXU A;  3WTU C;  3GFI A;  4NHJ A;  1I1S A;  3E5U A;  2Z99 A;  4KN4 X;  5LGT A;  5HLH A;  1GXQ A;  2M87 A;  2QBY B;  1P92 A;  1O3Q A;  1IW7 F;  1DPR A;  3R6S A;  2P7C B;  2ACJ A;  2ISY A;  3WTW C;  2K7L A;  2O3F A;  1OYI A;  2XAS A;  2ZNY A;  4H0E A;  2MA3 A;  1S7A A;  3BJA A;  2FNA A;  1XGS A;  2E1N A;  5K5R A;  1TW3 A;  3L7W A;  2V1U A;  2DK8 A;  1KQ0 A;  4IPA A;  2ZKZ A;  3KLO A;  1MJA A;  3RPQ A;  2VT2 A;  5L3E A;  4CHU A;  2G7H A;  2HFH A;  3ZN0 A;  3V8L A;  2ZBK A;  1SAX A;  4EQQ A;  2MH2 A;  4A2U A;  4OIN F;  2GXB A;  5JVT A;  1Z6T A;  3J81 K;  4MTD A;  3TO6 A;  3QP6 A;  3T8R A;  1I5Z A;  3LST A;  4L9V A;  2A6H F;  2IJL A;  3ZP5 A;  3C18 A;  3JSO A;  2WV0 A;  4XRF A;  2QYO A;  4I0B A;  1U5T B;  3VOE A;  1R23 A;  1OR7 A;  4HQM A;  3TKY A;  1KQ9 A;  2Q0O A;  2V1X A;  3BOQ A;  2O8X A;  2TDX A;  2ADU A;  1B6A A;  3E97 A;  3BZ6 A;  4MHG A;  3CUQ B;  3VOD A;  4ZYD A;  5D8L B;  2OZ6 A;  1P4A A;  4LLN A;  3E6C C;  1CF7 B;  3KLN A;  5FO5 A;  1FOK A;  4MQV A;  1YS7 A;  5TJJ A;  1YS6 A;  1B9N A;  3RPU A;  3BY6 A;  3E5Q A;  1RI7 A;  2H6C A;  2XRN A;  3R4K A;  3COA C;  4LK0 F;  4EJW A;  1DUX C;  4XLN F;  4M9X A;  4O5V A;  4HOB A;  1BBY A;  2W24 A;  4Y15 A;  3EUH A;  2PFB A;  1SD5 A;  1A04 A;  3R60 A;  5CVJ A;  2EFQ A;  4HDU A;  3E3V A;  1H0M A;  2NAZ A;  4ZYE A;  3I4P A;  4AIH A;  2XUB A;  1XSV A;  3RI4 A;  3KP3 A;  1S6L A;  1L3L A;  5K5O A;  1JXS A;  2FE3 A;  1W4M A;  4AWX B;  1KYZ A;  2QBY A;  4ESF A;  1GVJ A;  3BPV A;  2EV5 A;  4QWQ A;  1STZ A;  3Q9V A;  3BJO A;  1XGN A;  5LEJ A;  1B59 A;  5E1X A;  4CYD A;  5BPD A;  1AWC A;  2EV0 A;  2W84 A;  3TO7 A;  3HRT A;  4Y17 A;  2Y48 A;  3DPL C;  1KGS A;  2P6S A;  2GA2 A;  2HKO A;  1XDS A;  2XHK A;  3IL2 A;  2CYY A;  2RGV A;  2W25 A;  1WSU A;  2LSO A;  3KFW X;  3HRM A;  4AD9 A;  2A68 F;  3E5X A;  3F6V A;  4F7Z A;  3J80 Z;  3D5L A;  3I58 A;  5J8C A;  1Z91 A;  5LGN A;  1ONV A;  4M71 A;  1RUN A;  1IXC A;  2O0Y A;  4IVN A;  2E7X A;  3K1P A;  3HOS A;  1ZAO A;  3RTR A;  4KIB A;  2IT0 A;  5E18 F;  2NRA C;  5HS7 A;  4G6Q A;  1FBU A;  2DLL A;  3CDH A;  2RDP A;  5DD8 A;  2JRT A;  2YSR A;  1YG2 A;  1PP7 U;  2K86 A;  2FA5 A;  5IT3 A;  1ZN2 A;  3BWG A;  1S7O A;  2VBZ A;  2NYX A;  1IRG A;  4I02 A;  4WK8 F;  1MD0 A;  3IRQ A;  3CUQ A;  5FLX K;  1W7P D;  4XLP F;  1EH8 A;  3LA3 A;  1T6S A;  2FOK A;  2M45 A;  2PQ8 A;  2F2E A;  1HBX G;  2PEX A;  1I1G A;  4U0V A;  2VT3 A;  2GXG A;  4A12 A;  2ZNZ A;  3FMR A;  1SFX A;  5HVQ C;  5H20 A;  3GXO A;  2DPU A;  5AON A;  3BDD A;  2M1B A;  4WCG A;  3ABU A;  1IN5 A;  1YFH A;  1IN6 A;  2X4H A;  1KU9 A;  2HDC A;  5HLI A;  3J81 Z;  3I0T A;  2XAJ A;  5CVR A;  3HSF A;  4XSZ F;  2LF8 A;  2H94 A;  2DAO A;  4GYG A;  3LA7 A;  3K9T A;  4QLC U;  1GXP A;  1FSH A;  5ILU A;  1V3F A;  2EA4 A;  4BXU A;  2C6Y A;  3KP6 A;  1QGP A;  1MKM A;  2F5E A;  4I2O A;  2XKP A;  4GYI A;  3GFM A;  3K1M A;  3M9A A;  4WX9 A;  1E2X A;  2MLK A;  3M8F A;  3VB2 A;  1IUY A;  1B4A A;  2FBK A;  2STT A;  4I7H A;  3KCC A;  5E1W A;  1Z6R A;  4FX0 A;  3QU3 A;  1USS A;  2DQR A;  4MGR A;  3F6O A;  4L18 B;  5CYV A;  4KN7 X;  2EWN A;  2FBH A;  2EFW A;  5EEH A;  2QWW A;  4ENK A;  1LB2 A;  4P55 A;  3I59 B;  2UWM A;  1BIA A;  4P96 A;  4LG0 B;  1TQI A;  1UFM A;  1BI2 A;  2DQL A;  4Q48 A;  3HTU A;  1FYK A;  2EK5 A;  5D4S A;  5DCM A;  1ZRC A;  3RKW A;  3MAJ A;  3C7J A;  2DTR A;  3IKV A;  5HDN A;  4ENJ A;  4LD5 A;  1G3Y A;  5AIQ A;  2XAG A;  3O6B B;  4Q4Z F;  3F21 A;  2Q2E A;  4EGY A;  1S29 A;  2FU4 A;  1KQ8 A;  5E20 A;  2QQA A;  1D5V A;  5BOX A;  3E6M A;  1ZHF A;  3LAJ A;  1GHC A;  1J5Y A;  4KIG A;  2HZT A;  1JHF A;  3RKX A;  1SD4 A;  3IHU A;  2A69 F;  5JHU A;  1SMT A;  3R0J A;  4ENM A;  2IVM A;  2YX4 A;  4YFN F;  3V8K A;  3WG9 A;  3DQV C;  1KA8 A;  2J5O A;  5LGU A;  1QPM A;  5ICE A;  4JBA A;  4EGZ A;  2RNJ A;  4LLG F;  4AIK A;  3IC7 A;  1CGP A;  4P9U A;  2OAZ A;  5ICG A;  5E17 F;  3L9F A;  1D3Y A;  3CO6 C;  1XSX A;  3ZMU A;  4KYW A;  2EJR A;  1ZLJ A;  2VC0 A;  1DDN A;  2HTJ A;  3ECH A;  2FML A;  4HX4 A;  3NRV A;  4UVC A;  2ZXJ A;  4BAY A;  1VTN C;  2DFI A;  1FSE A;  4UNO A;  3FF5 A;  3F8C A;  2KRF A;  4KMU X;  1F4K A;  1SFU A;  1U2W A;  3CJN A;  3JSP A;  1PP8 F;  5CVI A;  1BN5 A;  1ZG1 A;  1NHA A;  4WWC A;  5HLG A;  3GLX A;  3C3W A;  1WRJ A;  1YTY A;  4Z2Y A;  3WTX C;  3CUO A;  4BNC A;  1S3J A;  5DCF A;  5FLX Z;  2VBW A;  2HQR A;  3R0A A;  4EV0 A;  2RQP A;  1K78 B;  2PG4 A;  1TW2 A;  4LJZ F;  2LDU A;  2D1H A;  4EMS A;  1H9G A;  4YG2 F;  1P4W A;  3KE2 A;  3ABT A;  3GEZ A;  2YPR A;  4EJO A;  4KA4 A;  5FB2 A;  2BBY A;  5EEG A;  4IRH A;  1DP7 P;  3LA2 A;  3SQN A;  2HS5 A;  4AIJ A;  3RYP A;  2G9W A;  1Z05 A;  1PDN C;  3I59 A;  3T0Y A;  1IZ1 A;  2M30 A;  2OZU A;  4ON0 A;  4LG0 A;  2MH9 A;  5F1R A;  1V4R A;  3B02 A;  1R22 A;  2HGC A;  3LAP A;  1MJB A;  2FSW A;  4RGX A;  5DYM A;  2D1V A;  3IWZ A;  3WGI A;  2A5Y B;  1O3R A;  3MZH A;  4P9F A;  4IRI A;  4K2E A;  1YO5 C;  5H6R A;  1KU3 A;  3U2R A;  5JI6 A;  4EM2 A;  4YFX F;  3JAM K;  1G3W A;  3IRR A;  2CO5 A;  4FHT A;  4HW0 A;  1LNW A;  4KNY A;  4WF2 A;  3JTG A;  3J7A O;  3N97 A;  2OQR A;  4U7D A;  3SXY A;  1FLI A;  2DW4 A;  5H6Q A;  5D5U B;  3ZMV A;  4L9J A;  3LQQ A;  2HR3 A;  4HX8 A;  2ZO4 A;  4LFU A;  2P7V B;  3WOD F;  3OV8 A;  4RGR A;  2ELH A;  2M8E A;  2G7U A;  4JQF A;  4KDP A;  5LHG A;  2OU2 A;  4CDG A;  3LFK A;  1LVA A;  2L4A A;  3NEU A;  2ESH A;  1LEA A;  2JPC A;  1IAW A;  3GX4 X;  2HOE A;  2JZY A;  2QUF A;  2IA1 A;  4NQW A;  1G6N A;  2CWE A;  2IP2 A;  3P9I A;  5BS6 A;  1C0W A;  1HW5 A;  5DUK A;  4HAM A;  1ZLK A;  1ZYR F;  1HST A;  3I5U A;  1ZRE A;  4RS8 A;  2PLY A;  2E7W A;  2CW0 F;  1ZGA A;  1IXR C;  1YW7 A;  2R7D A;  1T39 A;  3DP7 A;  4ETS A;  2HYG D;  4HA8 A;  5LHI A;  1HQC A;  3E6D A;  1B1B A;  1JE8 A;  2QM3 A;  4GXO A;  4HX7 A;  3FMQ A;  4RB0 A;  3S2W A;  3O2P E;  3P9K A;  1S8N A;  2VE9 A;  4P5O A;  3P9C A;  1BI0 A;  2RVC A;  3RJP A;  2DI3 A;  4KT5 C;  2FQ3 A;  3WTZ A;  2CGP A;  1TNS A;  4MEY F;  1LJ9 A;  2D45 A;  1OYW A;  3SZT A;  4HBL A;  2P6T A;  4ASN A;  1ZRF A;  1K78 A;  5BPI A;  1R1T A;  2L4M A;  3DEU A;  2Z5U A;  3TGN A;  1RIO H;  3KP7 A;  2ZME B;  2GIV A;  5HS9 A;  4A6D A;  3Q9S A;  2NNN A;  5CJ9 A;  1K7A A;  1HKQ A;  4EJT A;  2QVO A;  1XMK A;  3F23 A;  2HQN A;  1FYM A;  1RNL A;  4OU0 A;  1ZRD A;  1UST A;  4G9Y A;  1R00 A;  1J59 A;  2L3D A;  2KJC A;  1HSJ A;  4N9H A;  1U5T A;  1BJA A;  1T98 A;  1ZAR A;  3EYI A;  4EM1 A;  3B73 A;  3JTH A;  2GZW A;  3ELK A;  3KP4 A;  1FWZ A;  5FGM A;  2FMY A;  3ECO A;  2DO7 A;  2VXZ A;  3V7S A;  3ML6 A;  2PI0 A;  3F8N A;  1L0O C;  4CIC A;  1O7F A;  2YX7 A;  1CF7 A;  4EJU A;  5F64 A;  4B8X A;  5D6E A;  3ZMT A;  4ZZD A;  2XVC A;  4I01 A;  1SD7 A;  2O61 A;  1YIO A;  3BP8 A;  2AS5 F;  1T0F A;  2FEZ A;  4PGH A;  4ESJ A;  3HUG A;  4LGW A;  1R36 A;  3DXJ F;  3U1D A;  4UUV A;  3GFL A;  2PBI A;  5HS8 A;  3FX3 A;  3TDU C;  2K02 A;  2YR2 A;  5L3C A;  3H3Z A;  2YU3 A;  3HIF A;  5LLQ A;  3DV8 A;  3GUD A;  3W6J B;  2H6B A;  2LF7 A;  1FT9 A;  4ZYH A;  1TQM A;  3QU6 A;  4CZZ A;  2RN7 A;  3AAF A;  2Z33 A;  2XKO A;  3KZZ A;  4UXN A;  2EA2 A;  2EV6 A;  5ED4 A;  1BC7 C;  3EQL F;  5E8G A;  3FZV A;  1D8J A;  2ISZ A;  1O3T A;  1G3T A;  2Y0M A;  3JAM Z;  5L3D A;  2KIM A;  4I09 A;  4FX4 A;  3GWZ A;  4OIP F;  4BQA A;  2HKX A;  4M73 A;  5ERI A;  2QLZ A;  3D0S A;  1SFE A;  3ZN1 A;  3F8M A;  1UCR A;  3TDZ C;  2VBX A;  4HDV A;  5DDG A;  1MDM B;  3WGG A;  1EV7 A;  4HV6 A;  1OMI A;  4WXH A;  2VOO A;  4CXF A;  4RB2 C;  2B0L A;  2IW5 A;  1ODD A;  3GZ5 A;  4GO1 A;  4RAZ A;  1K79 A;  2X0L A;  4ENN A;  2JTV A;  4BYY A;  2JT1 A;  1BI3 A;  2K4B A;  1R58 A;  1IN8 A;  1QZY A;  4ZH4 F;  3PFI A;  1J2X A;  4UV9 A;  2RC4 A;  2F5C A;  4IRG A;  1LDJ A;  1JHH A;  1TBX A;  1J7K A;  4L9N A;  3WU0 A;  5D5V B;  3LQR A;  3QPH A;  5D4R A;  5ICF A;  3U9G A;  1E17 A;  1TNT A;  4M72 A;  3CLO A;  1KU7 A;  4A6E A;  1MGT A;  4HZF A;  1DPU A;  3JW4 A;  2DT5 A;  2RV8 A;  4OIQ F;  2VE8 A;  1QBJ A;  3HSE A;  3ULQ B;  3GW2 A;  3I71 A;  2JPB A;  1REP C;  4BHB A;  2W85 A;  3F8B A;  3KP5 A;  4IF4 A;  4O6J A;  5CVU A;  1FNN A;  5DV5 A;  2STW A;  3SFZ A;  5HDG A;  1R7J A;  4M9Z A;  4YIF A;  1BIB A;  1WI9 A;  4HLY A;  3MEX A;  3CTA A;  3L00 A;  4EJV A;  1ULY A;  2L02 A;  1MJ9 A;  1R1U A;  1ON1 A;  2R7F A;  3K2Z A;  4LMY A;  2VC1 A;  3BPX A;  1T2K A;  3ZMD A;  4KUM A;  5J8F A;  1FPQ A;  5HOO A;  4L5I A;  4A5M A;  3ERE D;  1G3S A;  1FBQ A;  3FXR A;  5FD6 A;  2Q8K A;  2UXX A;  1UHM A;  2MD5 A;  3PQK A;  1OYY A;  4OOI A;  4MQ9 F;  1LEB A;  1XD7 A;  3TQN A;  2P4W A;  2PMH A;  1HKS A;  3HYI A;  1IF1 A;  1TTY A;  1Z1D A;  2PJP A;  1YYV A;  3M8E A;  2VOP A;  3MCZ A;  4DNC A;  5KVR A;  3FXQ A;  4PCQ A;  1ZH5 A;  4A5N A;  4HF0 A;  3K0L A;  1QNT A;  2HWV A;  5BQT A;  2FF4 A;  1W7P B;  1U78 A;  3GVA A;  2DU9 A;  2FBI A;  4BHC A;  1FC3 A;  2QEN A;  1ZG3 A;  3V8J A;  5K5Q A;  5E1Z B;  1EH6 A;  1U6G A;  4OIR F;  5D5W B;  3LWF A;  1IN4 A;  1HW2 A;  4CO8 A;  1I6X A;  4ESB A;  2GQQ A;  3FHZ A;  2OQG A;  1QZZ A;  4L0Y B;  1HW1 A;  2XRO A;  4IJA A;  1MDM A;  1XGM A;  4IHS A;  4KFC A;  1U5T C;  2XV4 S;  2IRF G;  5BMZ A;  3G73 A;  4G7Z F;  4A0X A;  4M74 A;  2DK5 A;  3CUQ C;  3WTS C;  2BGC A;  5ILS A;  3RDI A;  1XMA A;  2KJB A;  1TLH B;  2M5W A;  1XCB A;  1FY7 A;  3WTV C;  3FM3 A;  3RKY A;  4UVA A;  2ESN A;  1FYL A;  2FRH A;  3T8T A;  2A3S A;  4UV8 A;  2MLG A;  1O7L A;  1H9T A;  5LHH A;  3KP2 A;  3WE2 A;  2BYV E;  3F22 A;  2WC2 A;  3DF8 A;  4G7O F;  4I98 B;  3BRO A;  2EB7 A;  4D0P A;  3MQ0 A;  2J5P A;  3M1E A;  3MWM A;  4LLL A;  4BH9 A;  2R3S A;  3TOA A;  3WTT C;  5KK1 A;  1R5G A;  2EFN A;  3KEQ A;  4ZZL A;  2QZ8 A;  3F8F A;  4HV5 A;  2IA0 A;  3HSR A;  4MEX F;  4G6D A;  5AIP A;  1ON2 A;  1BM9 A;  1OKR A;  2V79 A;  1F1Z A;  4R1H A;  2NNY A;  4HYE A;  3DKW A;  2GA1 A;  3HRU A;  2DPD A;  4HQE A;  3NQO A;  3W6K B;  5LRR A;  4UHT A;  2EFO A;  4HLX A;  1U3E M;  1RZ4 A;  4A0Y A;  4S04 A;  3H3U A;  4G94 A;  3GYH X;  1HKT A;  2V6C A;  3L2C A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...