1QPMA

Nmr structure of the mu bacteriophage repressor dna-binding domain
Total Genus 10
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
10
sequence length
69
structure length
69
Chain Sequence
KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein
molecule keywords PROTEIN (MU BACTERIOPHAGE C REPRESSOR PROTEIN)
publication title NMR structure and functional studies of the Mu repressor DNA-binding domain.
pubmed doi rcsb
source organism Enterobacteria phage mu
total genus 10
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 1999-05-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1qpmA00
3ZN1A 2DQLA 2KKOA 2D45A 4A5MA 4M6YA 4S05A 3DFGA 2XGXA 4RGXA 1LQ1A 1FWZA 4OIRF 2CFXA 3BJOA 3K69A 4EM0B 2J5OA 5LGNA 1U5TC 2ZNYA 1YW7A 3OV8A 4OOIA 3R0AA 1FSEA 2DT5A 1XGOA 2LKPA 4G94A 1YW8A 2G9WA 5DD4A 4UHTA 3LAJA 1DP7P 5K1YA 3HIFA 2OA4A 1ZG3A 1SD5A 3CO6C 1ZHFA 1SD7A 1BI0A 3QRFF 4LG0B 1BI1A 4RB2C 4L0ZB 2VC1A 2QYOA 5BPIA 2XVCA 3HOTA 1IXCA 4WCGA 2JTVA 3T8TA 5E8GA 3B02A 4KIBA 5FLXZ 1R58A 4L9TA 3CLOA 2R7DA 1IW7F 1J2XA 3O2PE 3C7JA 3ISPA 2X4HA 4GGGA 2EB7A 5JFRA 1PDNC 4I0BA 3TO7A 4QWQA 3P9KA 2FNPA 4KUMA 2XAGA 3V7SA 3H3ZA 1LDKB 4LB6B 4EMSA 3ULQB 1USTA 4M9XA 3TDUC 4HDUA 4D0PA 2MBFA 3PFIA 3V8LA 5D8KB 5DDGA 5LHHA 1T98A 2GIVA 3T8RA 3F22A 2XRNA 1HSJA 2OAZA 4HF2A 2PMUA 2WV0A 4IRHA 3K0LA 5JHUA 2JZYA 4F7ZA 3P9CA 4K2EA 4A6DA 2FMLA 4CICA 2W84A 4ESBA 2FSWA 3ZN0A 4LMYA 1YQAA 4GO1A 4P9FA 3LSTA 3QU6A 1UHWA 5DUKA 4ZZDA 2P6SA 4Q47A 2NYXA 1G3SA 5D4RA 2RN7A 3CUQB 1U6GA 1W7PD 5LGUA 1R1UA 4Q5SF 3GVAA 2NS0A 2DLLA 2ETHA 4OMYA 1GHCA 1FC3A 3ZMUA 3F72A 2DFIA 2GXGA 2HGCA 4M6XA 1BIAA 4N0BA 1S6LA 1RI7A 4IRGA 1LB2A 1QNTA 2Z99A 2JSCA 2ZNZA 4WXCA 5L3CA 4WXDA 2XUBA 3EUHA 3GUDA 2XASA 4PGGA 4PGHA 5ILUA 3K9TA 3WU0A 3GO5A 1B9NA 1YYVA 3JAMZ 3FXRA 1AOYA 5H6QA 1S8NA 5HDGA 3CTAA 1ZRCA 3NQOA 2DU9A 3K1MA 4KA4A 3ZMTA 3SQNA 4HLXA 5EEHA 2K4BA 1B4AA 2ISYA 5HDNA 1IN6A 3SZPA 4E70A 3F6OA 4NHJA 2P6TA 2BGCA 4XRFA 2QUFA 2L3DA 3FX3A 3NRVA 1SFEA 2KJCA 1Z91A 2BE5F 3G73A 4LK0F 5ICFA 1DUXC 1STZA 2LDUA 2QQAA 2ISZA 5FB2A 2FU4A 3GX4X 4RAZA 5LBQA 1NHAA 3H3UA 1ZRFA 3F8CA 1GXPA 3I53A 4G7ZF 2WTEA 3E5QA 1A04A 4YIFA 4HAMA 5ICEA 4I09A 4EGYA 3KLNA 5E17F 3RKYA 3W6KB 4NB5A 3HOSA 2KIUA 2Z3YA 2HQNA 2H09A 2IT0A 5D6EA 4KMUX 2KJBA 3WTSC 1U78A 2GWRA 3JTHA 1LDDA 5ILSA 5JVTA 3MZYA 5CYVA 1W5TA 3I5UA 4U7BA 5ED4A 4M71A 1TW2A 4YIIA 1K6OA 1KQ9A 3T5XA 4DNCA 3WE2A 3HYIA 4ENJA 2ZJ2A 3GFLA 1QGPA 3NEUA 3WTVC 2EV0A 3L7WA 1XMKA 5FLXK 4HYEA 4WX9A 3VFZA 1ONVA 1XDUA 1ULYA 1O57A 4EV0A 2RV8A 1ZAOA 3PQJA 2K02A 5IT3A 1HW5A 4Q48A 5ILVA 3W6JB 5LLQA 2OQGA 3P9IA 3GXOA 1J5YA 1MJ9A 2DI3A 5LHGA 3WTYC 2FQ3A 2RNJA 5A2QK 4CXFA 3K1NA 3TO6A 5L3BA 4IRIA 1R1VA 4HW0A 1LNWA 1MGTA 1YIOA 2W57A 4AWXB 4YFKF 4GXOA 4UV9A 4NQWA 1DPUA 5J8FA 4MGRA 5FD5A 4G8XA 2P8TA 2Q8KA 1Y0UA 2XAFA 5D5WB 4ESJA 1FNNA 3KP3A 2HTSA 3WU1B 2FBKA 5L3FA 3DPLC 1W5SA 3BDDA 4HLYA 2MA3A 4KIFA 1XB4A 1BOAA 2L54A 3JW4A 2PLYA 2K7LA 5E1ZB 3RYPA 4XLPF 5IT9Z 2VXZA 2VOOA 4N9HA 2CSOA 2IA2A 2ZXJA 3BPXA 1RUOA 2BV6A 2R7FA 3MAJA 3QPTA 3J80Z 3OOPA 1FBSA 2PJPA 1IXRC 3IWFA 1XSVA 1U5TA 3J81K 3GFIA 1MJAA 1WQ2A 3ERED 3S2WA 3V7RA 3TGNA 3V7CA 3D0SA 4HQMA 1WWXA 2F5DA 5FFXA 1JHHA 2RQPA 3B73A 3I4PA 3LFKA 1GXQA 3WG9A 4LGWA 2UXXA 3CUOA 3BPVA 2O6GE 4B8XA 1R7JA 2FMYA 3ZP5A 2MLGA 3L9FA 1KYWA 1OR7A 3IL2A 2QVOA 5E1XA 4P5OA 5H20A 4R1HA 4I7HA 1H9TA 4FX0A 1G3TA 2P7VB 5L3DA 4O3MA 4ZYGA 1RIOH 5E18F 2RGVA 3KE2A 1BC7C 1O7FA 4L5IA 3LQRA 2A68F 3CO7C 1BJAA 2L4AA 2GA1A 2UWMA 2HWVA 1HW1A 4UVAA 2D1VA 1USSA 1L0OC 2VBWA 3FM5A 3MCZA 2V79A 2IW5A 5KK1A 3I59A 1B1BA 5LGTA 4N9IA 2P7CB 3E6CC 2DPUA 2NNNA 3JSPA 2CQKA 2J5PA 4EJUA 1S7AA 2FF4A 2ESHA 5BPDA 1UHMA 1V4RA 2ELHA 2XKOA 5D4SA 2ZBKA 4GYGA 3F6VA 1D3YA 2V6CA 1I1SA 3Q5FA 2RKHA 3RYRA 1IXSB 4A6EA 1BN5A 4Y17A 4IHTA 2K27A 1Z6RA 4OMZA 1MD0A 4RS8A 2EA4A 2YPRA 2AS5F 4FT8A 3RPUA 1IRFA 1XD7A 4IPAA 4OIPF 2VC0A 1UB9A 3V8KA 4L9NA 1R1TA 4HX7A 2OQRA 1BBYA 1IZ1A 2QBYA 4BYYA 4HX4A 1KU7A 5CVIA 1HQCA 2DK5A 4HV6A 1SFUA 2CWEA 4WWCA 2IA0A 1OYYA 3DF8A 3U2RA 2TDXA 3GWZA 5HLIA 5DV5A 1JHFA 4YG2F 1RUNA 2XHKA 3BOQA 2EFPA 4L18B 3HRUA 2DW4A 1U5TB 2P4WA 5L3GA 1Z9CA 1B59A 2QENA 3CUQC 2RDPA 4P96A 3LA2A 5A2QZ 1L3LA 4YFNF 3AAFA 2H6BA 5FO5A 3M8EA 3I0TA 2EFWA 3RPQA 2V9VA 3IC7A 3REOA 3KP4A 3WE3A 2CGPA 1G6NA 1DDNA 5HOOA 2HFHA 2O03A 3WTTC 2E7XA 4B09A 4I2OA 2DPDA 3QAHA 1TQPA 4KYWA 1S29A 2GQQA 1R36A 4BHPA 1Z05A 5CVRA 5E1WA 1SAXA 3F8FA 5DUIA 4U88A 2G7HA 2EV6A 3FHZA 4JK1X 3ABTA 5IT9K 2DAOA 2IJLA 4H0EA 4O5VA 5ICCA 2VONA 4EQQA 2GA2A 1MZBA 3J80K 5BS6A 3I59B 3LA3A 4U0YA 3U9GA 2PN6A 2O3FA 3E97A 5FD6A 3J81Z 2KIFA 4GCVA 2FA5A 3ZPLA 3E5UA 1QO0D 3EETA 3LAPA 2M8EA 3EDPA 2JT1A 4P55A 2FRHA 5F64A 1LVAA 1LJ9A 2ZKZA 3F8BA 3SFZA 3N97A 2FE3A 3C1DA 5KVRA 2HR3A 1FSHA 2M5WA 1ZN2A 4ASNA 2OZ6A 4OU0A 2RC4A 1GVJA 4LJZF 3SXYA 2STTA 3V4GA 1JE8A 1F1ZA 2MLKA 3ABUA 3FM3A 3G3ZA 1IF1A 1PP8F 2ADUA 4WF2A 4L0YB 3L2CA 1LDJA 2QBYB 1YTYA 3KP7A 4FHTA 3TKYA 3DKWA 2EFNA 2F2EA 3COAC 1YS7A 2A3SA 2HTJA 1IRGA 2NRAC 1P92A 4XLNF 3BJ6A 1QQIA 5TRDA 1FYKA 2UZKA 1ZG1A 4M72A 4BQAA 1OYWA 1EV7A 2EJRA 2LNBA 1WKMA 2VBXA 3QOPA 5F1RA 1HSTA 4R79A 4KN4X 2FEZA 3IWZA 1K78A 3TOAA 1I1GA 3IHUA 1RZ4A 3KETA 2JRTA 4A2UA 2Z5UA 2HYFA 5CVVA 1V3FA 2OZUA 1Z1DA 3WTZA 1XDSA 4ENMA 2PEXA 3FXUA 1PUEE 3Q9SA 3GW2A 1YW9A 2YR2A 2W25A 2OD5A 3F23A 3KCCA 3VB2A 3DQVC 5FFZA 3GZ6A 1D5VA 1Z6TA 1BI3A 1UCRA 2LSOA 4ESFA 5DYMA 2DBBA 3DXJF 4ZH4F 1Z7UA 5LRRA 1W4MA 4KN7X 2ACJA 3RJPA 1O3TA 5DD8A 5LEJA 3IKVA 2VT2A 4LK1F 4LFUA 3FZVA 1BIBA 1ZH5A 4HX8A 4ENKA 3F21A 2V1XA 2P5LC 5D5VB 3T0YA 4EGZA 3ECOA 2Y48A 3FF5A 4BHBA 1XSXA 5D6FA 2XAQA 5DCMA 1P4XA 1BM9A 2H6CA 3ECHA 2JPCA 1BI2A 3GZ5A 3BY6A 4CHUA 1H9GA 4ZYDA 1HKQA 1QBJA 3WTUC 4UVBA 1I27A 2VOPA 3RIRA 4DQ2A 3CJNA 3QPHA 3DV8A 2PG4A 3WODF 4EJWA 5K5OA 1P4AA 2FBIA 1JGSA 3K2ZA 5BOXA 4ZZLA 4I01A 4HA8A 5HS8A 3E3VA 4L9JA 2IP2A 4QLCU 4EM1A 4MTDA 1KQ8A 4KNYA 2FOKA 1U3EM 4WXHA 3SZTA 3GFJA 4MQVA 3MWMA 4UNOA 1X3UA 4HOBA 1R5HA 5D5UB 1FLIA 1OPCA 3KP5A 3KP2A 1FPQA 2M1BA 3KLOA 4G9YA 4I0AA 1KQ0A 2WWYA 3TOBA 2MD5A 1QZYA 2ESNA 2ZCWA 1K78B 5ERIA 3WTXC 2STWA 2QLZA 2O8XA 2H94A 1J9IA 3MQ0A 4RGSA 1S3JA 1IUYA 3E5XA 1XGMA 1ZRDA 2EFOA 3DP7A 4AD9A 1IN8A 3VODA 4I02A 2WC2A 1REPC 2L4MA 2BBYA 4CGZA 5HDKA 1P4WA 2GZWA 2GAUA 1MDMA 3BJAA 1T2KA 3GFMA 2R3SA 3HSFA 1IN7A 2QZ8A 1B9MA 1E2XA 4MHGA 2M87A 3ZQ7A 2K86A 3IKTA 4JQFA 1PP7U 1G4DA 5CLSA 5J8CA 3ZMDA 3R61A 3HTSB 1H0MA 2O0YA 4U0WA 5CVUA 1YG2A 3N4MA 3WGHA 1KU9A 1G3YA 1TQMA 5FGMA 5BMZA 2A6EF 2XIGA 4A0ZA 2K4JA 4UXNA 1FBUA 1T6SA 2DQRA 4M73A 4LB5A 2C6YA 2XROA 2VODA 3KZYA 4A12A 3CUQA 5DCMB 2E1NA 3JSOA 2G7UA 2PQ8A 1SMYF 4KMFA 4HZFA 2HOEA 5LRSA 4RB3C 5TJJA 4TV7A 4OINF 3M8FA 1D8KA 4FX4A 3ML6A 1ZARA 2E1CA 1JXSA 4Z2YA 5JI6A 2A69F 1KU2A 4U7DA 1XSDA 3I64A 2FXAA 4HF0A 1F4KA 2COMA 1D8JA 4AIKA 3CDHA 2F5EA 3WGIA 1SD6A 2HYGD 4R8HA 3IRRA 4JBAA 4CDGA 2FBHA 4HDVA 3R0JA 4M9ZA 3I58A 2QWWA 2MC3A 3KEOA 1ODDA 1OKRA 1EH7A 3I54A 2NAZA 2P5VA 4ENNA 4OIOF 2ZMEA 3WGGA 3QU3A 1P6RA 3EQLF 3FMRA 5JR3A 1FZPB 1YFHA 1ZREA 1FOKA 3BP8A 4O6JA 1IN5A 5D8LB 5J6XA 3HSRA 3HTUA 3M9AA 4IF4A 3DPTA 4CO8A 2X0LA 2BEOA 1O3QA 4A5NA 2A5YB 3KEQA 2D2WA 3ROUA 4BH9A 2VN2A 3RTRA 4KDPA 3VEPA 5HS7A 2F5FA 4KIGA 2QQBA 4G6DA 2Z33A 1I5ZA 3WTWC 4ON0A 4BHCA 3GEZA 1MDMB 2MH9A 3JTGA 1HBXG 4M74A 4UVCA 3M1EA 3LQQA 2MH2A 2H27A 4G7HF 2DK8A 2CW0F 1XCVA 1TTYA 1C0WA 5LEKA 1I6XA 4EJTA 1J75A 1TW3A 1R22A 1U2WA 3MFKA 2CO5A 2D1HA 3GF2A 3FWEA 4AIHA 2RVCA 3M7GA 4Y15A 3EYIA 1W7PA 5ICGA 4A0XA 2PI0A 3TQNA 1FYLA 3F3XA 3F8MA 3HRTA 1TNSA 1HW2A 3J7AO 1EH8A 3R60A 4KICA 2HEOA 3KZZA 2KIMA 4M9SA 2B0LA 2YU3A 4XBFA 3QP5A 2HKOA 2Q0OA 1FYMA 2VBZA 1IAWA 4WK8F 4Y13A 2EK5A 3F8NA 4GYIA 4ZYHA 2OBPA 5CVJA 3H92A 1MJBA 3E6BA 3EYYA 4U0VA 3I71A 2XAJA 1XCBA 3FMSA 2ZO4A 4Q4ZF 1IN4A 3FMQA 4EJOA 2LF8A 3KP6A 4AVPA 1P2FA 3ZMSA 1J0RA 2FNAA 4RGRA 2JPBA 3TO9A 4RGUA 1DPRA 1ZLJA 5DEQA 3HSEA 1KGSA 1T39A 1ZG5A 4LLLA 2HKXA 3RDIA 2HZTA 1HXDA 5HLGA 1R23A 5HVQC 3BZ6A 1TQIA 1O7LA 4IJAA 2V1UA 1KU3A 5D5XB 4BAYA 4S04A 4HQEA 1QPMA 1KYZA 1WSUA 2CYYA 5E20A 2W85A 1YS6A 2ZMEB 1ZYRF 1ON2A 3QP6A 2IA1A 3D5LA 3HRSA 5DCFA 1VTNC 1XGNA 3DEUA 3GYHX 4HBLA 1TNTA 3C3WA 3FXQA 2Q2EA 3BWGA 1CF7A 5AIPA 4MEXF 1TBXA 4MQ9F 2EWNA 1MKMA 2Y75A 1OMIA 1XMAA 1FBQA 4KFCA 2P5KA 1ZLKA 5HS9A 2PMHA 1G3WA 4XSZF 3IRQA 2A6HF 4EJVA 4LLGF 4CZZA 5K5RA 1R00A 2W24A 2M30A 2XKPA 5EEGA 3P7NA 4PDKA 3U1DA 1F5TA 4RB1A 3MZHA 3GLXA 2VT3A 2HDCA 4ZYEA 3K1PA 5F6FA 1O3RA 1Q1HA 2DTRA 2YSRA 4MTEA 2EA2A 2QQ9A 4KT5C 2Y0MA 1J7KA 1ZGJA 1W7PB 2DO7A 4EM2A 3HHHA 1AWCA 4L5JA 5L3EA 2UXNA 1SD4A 4IVNA 4PZJA 1FP1D 3HHGA 5E8IA 2LF7A 4RB0A 1SFXA 1T38A 2M45A 2F5CA 1FT9A 4PCQA 2VE9A 1YO5C 4HV5A 2YX7A 4MEYF 4UV8A 1U8RA 2EFQA 1OYIA 3RKWA 4G6QA 4UUVA 3HUGA 1ON1A 3LA7A 3T1BA 1F9NA 4IXAA 4L9VA 1UFMA 3VOEA 4ETSA 4IHSA 3ELKA 4RAYA 6PAXA 1WI9A 3ZMVA 3R6SA 1EH6A 3KFWX 5AIQA 2O61A 2Z9OA 4HF1A 2A07F 1S7OA 3SHFA 4LD5A 1E17A 1BC8C 4I98B 3E6DA 4LLNA 2QM3A 3MEXA 2EV5A 3PQKA 4LG0A 1K79A 2IVMA 1QZZA 1KA8A 1WRJA 2L02A 4G7OF 3LWFA 1RNLA 2HQRA 2XV4S 1R5GA 1K7AA 2VBYA 2CG4A 4A0YA 3HRMA 3O3KA 3BROA 4CYDA 1T0FA 5CJ9A 5HLHA 2OU2A 2VE8A 1ZGAA 4P9UA 2IPQX 3V8JA 2V1DA 1HKTA 4AIJA 1CF7B 2L01A 1B6AA 1XGSA 5K5QA 2BYVE 2HS5A 3R4KA 2ZFWA 3L00A 1LEAA 1O3SA 2XAHA 2IRFG 3ZMZA 3RKXA 5H6RA 2YX4A 2NNYA 2E7WA 1LEBA 4YFXF 3Q9VA 4EVIA 3TDZC 5LHIA 3JAMK 4MNUA 3O6BB 3C18A 4BXUA 1SMTA 1FX7A 1HKSA 1CGPA 2PBIA 1FY7A 5BQTA 3L09A 2KRFA 2GXBA 1J59A 2AXLA 5AONA 4XSXF 1XN7A 1FP2A 4BNCA 3RI4A 2A61A 2PFBA 1TLHB 1YLFA 3E6MA 4OIQF
chains in the Genus database with same CATH superfamily
3JRDA 4BY1J 4NC8A 3ZN1A 3ERMA 2DA7A 3FKIJ 2DQLA 2K85A 3PM1A 4IEJA 4PJLA 2DN0A 2KKOA 2HVQA 1WJCA 2NS7A 4A5MA 2D45A 4M6YA 2OF7A 4DOZA 4S05A 3DFGA 4Y52J 1TWHJ 2XGXA 3VWBA 4B4CA 2NOJB 2VPRA 4RGXA 2E2IJ 5B3SH 3HKZA 2QKMB 1FWZA 2MFZA 1LQ1A 2LC2A 2W48A 4OIRF 5KNLA 2CFXA 1OCRH 1LFBA 3BG7A 3BG3A 4IKFA 3BJOA 3K69A 1YOVB 1D0ZA 4LIVA 4EM0B 1VQOI 3CESA 2J5OA 3HXLA 5LGNA 1U5TC 2ZNYA 1YW7A 1LPQA 3OV8A 3H1CA 4PJJA 1LFPA 4OOIA 1YJWI 1LKXA 3R0AA 2EIJH 1FSEA 3LSKA 2DT5A 1XGOA 2HXIA 2B63J 3PSFA 5EGOB 2LKPA 3HUGB 3LSHA 4G94A 4C3IJ 1BL0A 1YW8A 3AG4H 2G9WA 2L9RA 5DD4A 4UHTA 3ZXSA 3I55I 3LAJA 3S32A 3Q0VA 3UR3C 2X51A 2KT0A 3G1OA 1DP7P 3QYBA 1VQ4I 4RM2A 4PJNA 1E3OC 1UELB 2DDAA 3S1RJ 2JWTA 5K1YA 1S9HA 4CYCB 3HIFA 2OA4A 3JRGA 1ZG3A 4DGWB 5HNFA 1SD5A 1OR7C 4X0GA 4DIQA 3CO6C 1ZHFA 2M2EA 4RDUA 2A6TA 4FTHA 2TCTA 2O5RA 1SD7A 1BI0A 1XC5A 3LSGA 3HOXJ 4BJ6C 2GXAA 3QRFF 4LG0B 1XX5A 1BI1A 4RB2C 4L0ZB 1K6YA 1QHHD 2VC1A 1LE8B 2QYOA 4D7NA 5BPIA 1UMQA 2XVCA 4D7MA 3HOTA 1IXCA 4AVZA 2EZLA 4QSHA 2DA4A 5DS9A 4WCGA 3I4NJ 1X4PA 1PUFA 2L7ZA 2KRHA 2JTVA 4Y33A 1I50J 3T8TA 5E8GA 3B02A 5C4JJ 2X6OA 4KIBA 5FLXZ 1U0JA 1JJ6C 1R58A 1UG0A 3FXKA 3MZ8A 4L9TA 3JRBA 1X3WB 3CLOA 2R7DA 3WHCA 4DYCA 1IW7F 1YRNB 3QWLA 1J2XA 4W97A 3O2PE 3C7JA 1PJRA 1ZTRA 3ISPA 2X4HA 4GGGA 2K9QA 4HSRA 4D9JA 1V54H 3H0GJ 2EB7A 3CZ6A 4XNFA 3GMEA 1A36A 2YU9J 4XM3A 4XR6A 1TWGJ 5JFRA 3CCJI 1PDNC 1SAUA 4I0BA 4C9YA 1H88C 1D0XA 3TO7A 3FKJA 2R7QA 4F93B 4QWQA 1A6IA 3P9KA 1DQUA 2FNPA 4KUMA 4IQJA 2E2HJ 4CCMA 2Y30A 2XAGA 2ME6A 3V7SA 3H3ZA 5K7ZA 1LDKB 4LB6B 1VI0A 4KITB 4EMSA 3ULQB 4M3FA 1QU3A 4YRVA 2LKSA 1USTA 4M9XA 3TDUC 4HDUA 4D0PA 1BR4A 1W1WE 2R5YB 2MBFA 3KZIC 3FIWA 1WJAA 2FQ4A 3PFIA 3V8LA 3VYUB 5D8KB 5DDGA 5LHHA 2WB1A 1T98A 2ZXHA 2GIVA 4DYQA 3SYTA 3T8RA 4CCLA 3F22A 3GTQJ 2XRNA 1HSJA 2K40A 2OAZA 2LY2A 2Z2SB 2XSDC 4HF2A 2PMUA 4XN3A 4Z6YA 2WV0A 3S2HJ 4IRHA 3BTIA 3K0LA 2XPWA 4BXXJ 5JHUA 2JZYA 4A3JJ 2R7ZJ 2JVHA 2VJIA 4F7ZA 3P9CA 4K2EA 4A6DA 4A3KJ 4BE0A 2LFBA 2FMLA 3OIQA 3RQ4A 1EKEA 1Y6IA 4CICA 2W84A 4ESBA 2FSWA 3ZN0A 4XLAA 4LMYA 1YQAA 4GO1A 4P9FA 3ZGKA 1ZGWA 3S14J 3CP2A 3LSTA 3ZQGA 2VQCA 3QU6A 4XN0A 1T56A 1JTYA 1A31A 1UHWA 5DUKA 1KZHA 2P6SA 4Q47A 4ZZDA 2O9LA 2NYXA 4A3IJ 1G3SA 5D4RA 2K9NA 2RN7A 2LMDA 2M0MA 4FE4A 3CUQB 3BCBA 1DU6A 1U6GA 1W7PD 3C2GA 4L5EA 5LGUA 1VQMI 1R1UA 1MSEC 4Q5SF 3GVAA 2NS0A 2KP6A 2FUG2 3CCQI 1R4NB 2HDWA 1GV5A 2DLLA 2ETHA 4MLOA 4OMYA 3BG9A 1GHCA 2L7MP 3A1YA 1FC3A 3ZMUA 3F72A 3DBHB 2DFIA 3BTJA 3W3CA 2GXGA 2HGCA 3DLAA 4M6XA 1BIAA 4GFBA 2CMPA 5B1AH 4N0BA 1S6LA 1RI7A 4IRGA 2DFFA 3G71I 3VYTB 2NVTJ 2HPIA 1LB2A 1QNTA 3HDDA 2Z99A 2JSCA 2ZNZA 4WXCA 1TWFJ 2M7AA 3KPHA 5L3CA 4M3DA 4WXDA 2XUBA 3EUHA 3GUDA 5JLWA 2XGCA 1T33A 3BTCA 4Y4RA 2XASA 1EJ9A 4PGGA 4PGHA 5ILUA 3TBIA 2VJJA 3K9TA 3WU0A 3GO5A 1B9NA 1X1BA 1YYVA 4NC6A 3JAMZ 3TP3A 3DKYA 3FXRA 3S15J 1AOYA 5H6QA 2R7UA 1S8NA 5HDGA 1WI3A 3CTAA 3F9KA 1ZRCA 2BHZA 2KRCA 3NQOA 1X19A 2V26A 5FJ8J 3VDXA 2DU9A 5EEAA 3K1MA 4KA4A 1AKHA 3H5AA 3ZMTA 3SQNA 4HLXA 1QVTA 5EEHA 4UUSA 2K4BA 1B4AA 2ISYA 4G6TB 5HDNA 1WJDA 1YITI 1IN6A 3SZPA 2LH9A 4E70A 3F6OA 3CC2I 4NHJA 2P6TA 2BGCA 4XRFA 2QUFA 2L3DA 1PUFB 2XB0X 3FX3A 3NRVA 1SFEA 2KJCA 3TW6A 1X2MA 1Z91A 4AM3A 4II3A 3CCSI 2BE5F 3CF2A 5IYCJ 3G73A 4LK0F 5ICFA 1MNMC 1MMGA 2BXZA 5H2FC 1DUXC 2CFOA 1STZA 3L2WA 2LDUA 4A3CJ 2QQAA 2Y9YA 3CCMI 3O8HA 2VXDA 5M3MJ 4E7HA 3TP0A 2ISZA 1JTXA 5FB2A 1XS9A 4BE1A 3IH2A 2FU4A 3ZRGA 3GX4X 4RAZA 5LBQA 4OAZA 1G8XA 1NHAA 3HG9A 1JUMA 3H3UA 4LIUA 1UHSA 1ZRFA 3OL3A 3F8CA 1D1BA 2HDDA 3VYSB 2EIMH 1GXPA 3I53A 1IO2A 4G7ZF 4BJTA 4LOCA 2WTEA 3E5QA 3QPSA 1A04A 1POGA 4YIFA 4HAMA 5ICEA 5GADJ 2EZIA 4I09A 3HGYA 4AIDA 3LNQA 4EGYA 3KLNA 5E17F 3RKYA 3W6KB 4NB5A 3HOSA 3M4OJ 2KIUA 2HNHA 2Z3YA 1BOBA 4XK4A 2HQNA 1IRXA 2H09A 2R7VA 2LTPA 2VJ4A 2IT0A 1Z0XA 2XGDA 2LOOA 5D6EA 4KMUX 2KJBA 3WTSC 2IGOA 1U78A 2GWRA 1BR2A 2HI3A 4LG3A 3JTHA 4A3BJ 1LDDA 1SVLA 5ILSA 5LD2C 3OOUA 2Y9ZA 4BKXA 3EPZA 1Y8RB 2ZJQF 3S3NA 2QQ8A 2Y31A 3MZYA 5JVTA 2CH0A 5CYVA 2DA3A 1SEUA 1W5TA 4V19K 3I5UA 4U7BA 2KDZA 5ED4A 3PIOF 4M71A 1TW2A 4RA2A 4YIIA 2QGUA 1K6OA 1KQ9A 3T5XA 4DNCA 3L2VA 2MC4A 1XG1A 3S1MJ 2DOEA 3WE2A 2OTJI 3FK7A 3QYEA 3HYIA 4ENJA 2ZJ2A 3GFLA 3CMEI 1QGPA 1FIPA 3ZQLA 3D5RC 2WAQN 3NEUA 5M5XJ 3WTVC 2EV0A 1ACIA 3L7WA 1XMKA 5FLXK 1ETVA 4HYEA 4BQNA 2HXOA 1MMSA 4IZZA 4WX9A 5CKTA 3VFZA 1ONVA 5FKOA 2ELKA 1HC8A 1FTTA 1XDUA 3MKWB 3W2VA 1Y8QB 4NUBA 1ULYA 5F0FA 2XDVA 1O57A 4EV0A 2QSGX 2RV8A 4N4OB 3G1LA 4JYKA 4CZCA 1ZAOA 3H5NA 4BY7J 3PQJA 2K02A 1YX3A 3OYNA 5IT3A 1HW5A 4Q48A 5ILVA 4XRMA 3W6JB 1Y0NA 3EUAA 5LLQA 2OQGA 3P9IA 2Z1DA 3ESWB 3DBLB 3GXOA 1J5YA 4E7LA 1JT0A 4I6ZA 1WH5A 4XKVA 1MJ9A 1PVEA 2DI3A 2R93J 5LHGA 5E3MA 3WTYC 1YX5A 2FQ3A 2RNJA 3HM5A 2JA2A 2BHYA 5A2QK 4CXFA 3AL0C 5IP6A 3K1NA 3TO6A 4P1WA 5L3BA 4IRIA 1R1VA 3B6AA 4HW0A 1LNWA 1MGTA 5F27A 4UUTA 1YIOA 2W57A 4AWXB 4YFKF 2CQ7A 4GXOA 2H8RA 5FRMA 2QA4I 4UV9A 4NQWA 4QPQA 1DPUA 1JKQC 2ELJA 5J8FA 4MGRA 2QSHX 1T08B 5FD5A 1A5JA 1VQ5I 3K2AA 4G8XA 2P8TA 2WB1N 1ZKGA 2Q8KA 2MSYA 1Y0UA 2XAFA 3N05A 2DT6A 2NOGA 5D5WB 1AKHB 2UV1A 4ESJA 1FNNA 3KP3A 3AFHA 2HTSA 5HNHA 5FKKA 5C44J 3A0BC 2ZB9A 3WU1B 2FBKA 5L3FA 3CDIA 2O7OA 3DPLC 1W5SA 4D5CA 3BDDA 4F3QA 2CQXA 2FJ1A 4HLYA 2MA3A 4KIFA 1XB4A 4HPQA 2F4OB 1BOAA 4G12A 2L54A 1G59A 1GUUA 1WJ5A 2XPVA 3OIOA 5F1JA 1Z21A 3JW4A 4BBSJ 2PLYA 2K7LA 1HF0A 3DU6A 5E1ZB 3RYPA 3QQAA 3S8PA 4XLPF 3FXOA 3BR3A 5IT9Z 2VXZA 2VOOA 2FX0A 3CJQB 4N9HA 3PIPF 2GLOA 2CSOA 2IA2A 2ZXJA 3BPXA 2DOAA 1RUOA 3M07A 2HOTA 3PJRA 2BV6A 2R7FA 3MAJA 1W36C 3QPTA 3J80Z 4XLFA 3OOPA 1FBSA 5KHDA 3HC7A 2PJPA 1IXRC 3IWFA 1XSVA 1U5TA 3ZOBA 3J81K 2BY0A 3U21A 3GFIA 3UNGC 2VPLA 2L9SA 1MJAA 4KJZA 1WQ2A 3ERED 2NVQJ 3S2WA 1Y56A 3V7RA 3CF5F 3TGNA 2K9SA 5CQGA 2R92J 3V7CA 2IGMA 3D0SA 4HQMA 1TT0A 1WWXA 2CUFA 2OJED 2F5DA 5FFXA 1UZCA 4YEJA 1JHHA 2RQPA 3B73A 3I4PA 3K4NA 3LFKA 1GXQA 1YE9A 3WG9A 1OCOH 4AYBN 4LGWA 3TL4X 2UXXA 3HOWJ 3CUOA 2KQRA 1P7IA 3BPVA 1FEXA 2O6GE 5K7FA 4XQFA 1S7EA 4J00A 4B8XA 1R7JA 2FMYA 3ZP5A 2MLGA 1TZLA 3L9FA 3A4CA 3C2BA 3S1QJ 1ETKA 1D1AA 2OCCH 2CV0A 1KYWA 1OR7A 1HLVA 3OY9A 1FMWA 3IL2A 1VQNI 3WU2C 2QVOA 1ORKA 2VIXA 3A03A 4P5OA 5E1XA 5H20A 2RNGA 3E0JB 5GAEJ 4IL6C 4PJ0C 4R1HA 3CCUI 4I7HA 3SZGA 1H9TA 1T95A 4FX0A 1BR1A 1G3TA 2P7VB 5L3DA 5TGTA 4O3MA 4ZYGA 3JREA 3JRCA 1RIOH 5E18F 2W82A 3ZCOA 2RGVA 3KE2A 1IUFA 1BC7C 1TL8A 2X6WA 1O7FA 4L5IA 3ZQCA 3LQRA 2HVSA 2A68F 3CO7C 1BJAA 2L4AA 2GA1A 2UWMA 2VI6A 4CCOA 2HWVA 2DYSH 3MKZA 3S3OA 1HW1A 5GPCA 4UVAA 2D1VA 1USSA 5GP9A 4YELA 1L0OC 2VBWA 3FM5A 1PYVA 3SDBA 3MCZA 5FLVA 2VKDA 3H9QA 3BZCA 2DODA 2V79A 2IW5A 5KK1A 3I59A 4IX7A 3OS2A 1B1BA 2LBFA 3G6EI 5LGTA 1ZR4A 1NH3A 4N9IA 2P7CB 2KISA 2V1NA 3E6CC 1IC8A 2DPUA 2MABA 2NNNA 3JSPA 2CQKA 2J5PA 3V42A 2FD5A 5IP9J 4EJUA 1S7AA 2CRGA 2FF4A 2ESHA 2M8GX 5BPDA 1WVRA 1I6HJ 1UHMA 1V4RA 2ELHA 2XKOA 3RCOA 3HJEA 5D4SA 2JA7J 3GCMA 5M5WJ 2EPFA 1F43A 2ZBKA 3DEWA 4GYGA 3F6VA 1D3YA 4C30A 2F6CA 2V6CA 1IGNA 5E79C 1I1SA 1WPKA 3B6CA 4JX6A 2XC7A 1TC3C 3Q5FA 2VQLA 2RKHA 1RC9A 4NQWB 3BQZA 3OYIA 4ZTFA 1HA8A 3K4CA 3RYRA 1W0TA 1IXSB 1D5YA 4A6EA 1BN5A 4Y17A 4IHTA 1MIJA 2K27A 3K4JA 1G2HA 3WG7H 1Z6RA 4OMZA 1MD0A 5IYDJ 3OMYA 4XICA 1EF4A 4RS8A 3CQZJ 2EA4A 1IV8A 1KONA 2CUZA 2YPRA 1WGXA 2AS5F 4FT8A 5EYRA 3PNVA 4C3JJ 5J1RA 3RPUA 4A3LJ 1IRFA 1XD7A 4IPAA 3K10A 4OIPF 3ZQIA 5HODA 2VC0A 1TT5B 1UB9A 3OYDA 5JVGF 3V8KA 2E1MB 5F0HA 3J7ZI 3KIOA 2EIKH 4L9NA 3K70D 2WAQA 2LYCA 1R1TA 4HX7A 5EZGA 1JUSA 2X6YA 4Y7NJ 2OQRA 1BBYA 5IOYA 5KAIC 1IZ1A 2QBYA 4BYYA 2AQFA 2X48A 4HX4A 1KU7A 5CVIA 3L2QA 4XLCA 1HQCA 2DK5A 4HV6A 2WAEA 1SFUA 4DZJA 2CWEA 2R0QC 2DMQA 4WWCA 2IA0A 1XPXA 1OYYA 1WJEA 2V6EA 2Y0SA 1MBKA 1BW5A 1EA3A 3DF8A 4FE7A 3U2RA 2TDXA 3GWZA 5JHFA 5HLIA 5DV5A 1JHFA 4YG2F 1RUNA 3OYKA 2XHKA 3BOQA 3AKZA 4MFEA 1P9QC 2EFPA 4L18B 3HRUA 4HNTA 2DW4A 1U5TB 2P4WA 5L3GA 1BW6A 3JCUC 3OS0A 1E0EA 1I3AA 1Z9CA 1B59A 2LK2A 2QENA 3CUQC 2RDPA 3IAM2 2DMTA 4P96A 3LA2A 2X1DA 4E7KA 4AU7A 4BDZA 5A2QZ 1JUPA 4IOAF 1L3LA 4YFNF 3AAFA 2H6BA 5FO5A 2WADA 1VQ8I 3CMMA 5EDNA 3M8EA 3I0TA 2EFWA 2DOFA 3RPQA 2DMUA 2V9VA 3IC7A 4A3GJ 3VYRB 4Y3OA 5EG0A 3JRHA 3FISA 1JJ8C 2VKEA 1WJBA 3REOA 3KP4A 3WE3A 4ZDOA 2CGPA 2K3PA 1G6NA 3J7AY 3H36A 5IPAA 1DDNA 5HOOA 2BVLA 2HFHA 2O03A 3GTMJ 4DW6A 3WTTC 2E7XA 4B09A 2H1KA 4I2OA 2IXSA 3PUFA 2DPDA 3Q3SA 3L1PA 3CJTB 3QAHA 1JT6A 1TQPA 3HPHA 2JRMA 1S29A 4DBRA 4KYWA 2GQQA 1R36A 1MH4A 4BHPA 1Z05A 5CVRA 3HGGA 5E1WA 1SAXA 3CCLI 3GTLJ 2R7WA 4BQOA 1ERDA 3F8FA 2F4IA 5DUIA 4U88A 2G7HA 3BLYA 2UUZA 2EV6A 3FHZA 4JK1X 3ABTA 5IT9K 2DAOA 2R7TA 1VQ9I 2IJLA 4H0EA 4O5VA 5ICCA 1QPIA 2DMPA 2VONA 4EQQA 2CW7A 1GT0C 3RZOJ 4DJAA 3W6VA 4XMYA 2GA2A 3CCVI 1MZBA 3J80K 1K4TA 5BS6A 3I59B 2VUMJ 2Q1ZB 2BZTA 3LA3A 5E3OA 4U0YA 3IUOA 2LBFB 1MNEA 2CV1A 1DP3A 2L0KA 4F52A 4ZTJA 2XAUA 3U9GA 3KX2A 3L2RA 1N75A 2PN6A 3HB9A 3BR1A 2O3FA 3E97A 5FD6A 3J81Z 2ZMEC 2KIFA 4GCVA 4CCKA 2JUGA 1R5ID 2FA5A 3OYGA 3ZPLA 3E5UA 1QO0D 3EETA 4XORA 1WH7A 3LAPA 2M8EA 3EDPA 5J4YA 2JT1A 4P55A 1FMVA 2FRHA 4CUGA 1I3QJ 5F64A 1LVAA 1NG6A 1QA6A 1LJ9A 2NVUB 2ZKZA 3F8BA 1FOWA 3SFZA 4AYBA 4D5FA 3N97A 3DBRB 3EUKL 2IBDA 2FE3A 2KIQA 4JOMA 3PUBA 3C1DA 1ZK8A 5KVRA 2HR3A 3ZQQA 5BNGA 2E71A 3BR2A 1FSHA 3OSFA 1JKRC 1IV6A 2ZSIB 2M5WA 4C3HJ 4NDLA 2F4MB 1ZN2A 4DZPA 4ASNA 2OZ6A 4OU0A 3OS1A 5IY5H 2RC4A 2B9SA 1GVJA 4LJZF 3SXYA 2STTA 3V4GA 2AO9A 5GTIC 4RLQA 1JE8A 1F1ZA 3ABUA 2MLKA 1OQYA 2CUEA 3FM3A 3G3ZA 1IF1A 1PP8F 1N78A 2HPMA 1RPWA 3MMYB 5EF6A 3CD6I 4C2TA 2DXIA 2ADUA 4WF2A 4I76A 1GV2A 2G0EA 4L0YB 3K7AJ 2I5UA 5J1YA 3L2CA 1LDJA 3AG3H 2JSPA 2X1EA 2QBYB 2M9HA 1YTYA 3KP7A 2XRLA 3IH3A 4FHTA 3TKYA 4PFOA 4BJ5C 2EFNA 3DKWA 2F2EA 2BY3A 1HDDC 3COAC 1YS7A 2GOXB 2A3SA 2B7EA 2HTJA 1IRGA 2NRAC 1ETYA 1P92A 4XLNF 3BJ6A 5E3LA 1VF9A 3OIPA 5E3NA 3CCRI 4C2MJ 1QQIA 1WHUA 4XLEA 5TRDA 3H9GA 1FYKA 3AG1H 4IO9F 3DPUA 2UZKA 1OCCH 1YIJI 1ZG1A 4M72A 2M4GA 2M3AA 3CMYA 1N77A 1OYWA 2ZC2A 4BQAA 2LRDA 1EV7A 2EJRA 2LNBA 1WKMA 2V9PA 2VBXA 2XF7A 1HSTA 3QOPA 4R79A 5F1RA 3S16J 1TP4A 2R5ZA 4KN4X 2FEZA 3IWZA 1K78A 3SFIA 3TOAA 1DGRM 4HNUA 3ABLH 3K4BA 1ITYA 2CQQA 1OISA 2XF5A 1MMDA 1I1GA 1FJLA 2GBYA 3IHUA 2NVXJ 5IYBJ 2OC6A 1RZ4A 3KETA 2JRTA 4A2UA 2Z5UA 2HYFA 5CVVA 4E7JA 2VJ5A 3RQIA 4QTRA 2E1OA 4OAYA 2L7KA 1V3FA 3DU5A 3GTJJ 3OYBA 2OZUA 1V55H 2DCEA 5EZHA 5EG0B 4F55A 1Z1DA 5IOZA 2EZHA 5J1UA 3WTZA 1XDSA 3CCYA 4ENMA 2M4KA 2PEXA 3FXUA 1PUEE 2IEKA 3Q9SA 3GW2A 1YW9A 2YR2A 1HDPA 3FHNA 2W25A 2VL8A 2KL4A 1TWAJ 4BL0B 2OD5A 3F23A 3KCCA 3VB2A 3KYDB 2HU9A 3DQVC 3K4MA 5FFZA 3GZ6A 1D5VA 1Z6TA 3K4LA 1BI3A 1UCRA 2LSOA 5J47A 4PSWA 4ESFA 5DYMA 2DBBA 2FOWA 3DXJF 4ZH4F 1Z7UA 5LRRA 1W4MA 2LY9A 5FROA 2KMUA 4KN7X 2ACJA 4M3BA 3RJPA 1WCMJ 1O3TA 5DD8A 5LEJA 2DTZA 3IKVA 2VT2A 4II2A 4LK1F 4W1UA 4LFUA 3FZVA 1IG7A 1BIBA 4A3DJ 2CQNA 1ZH5A 4HX8A 4ENKA 1CQTA 2ME0A 2Y0SN 3F21A 2V1XA 5CQEA 2P5LC 3PNYA 5D5VB 1VQPI 3T0YA 4EGZA 3ECOA 2Y48A 3FF5A 4M6VA 4BHBA 4E7IA 2H1LA 2V9KA 1W36D 1XSXA 5D6FA 2XAQA 3TEDA 5DCMA 1P4XA 1BM9A 1IJWC 3LOCA 4FETA 2H6CA 5KAFC 2ZJPF 2MGQA 1H89C 3ECHA 2JPCA 4BBRJ 2RAEA 1BI2A 3DEEA 3DTEA 1MMAA 3GZ5A 1M1EB 3BY6A 1SANA 4CHUA 1H9GA 4PUSA 4ZYDA 1HKQA 1QBJA 2DA2A 3WTUC 3OYMA 4IOCF 4UVBA 1I27A 2VOPA 3RIRA 2JN6A 4DQ2A 4LITA 3E1SA 1X1CA 3CJNA 2HZDA 3QPHA 3DV8A 2PG4A 3WODF 4EJWA 3LMMA 5K5OA 3AG2H 3MD2A 1P4AA 2FBIA 3J7YJ 1JGSA 1JGGA 1Y1VJ 3K2ZA 5BOXA 4ZZLA 4UUSB 3S2DJ 4I01A 4HA8A 1K4SA 2OV7A 4PK4A 2IS1A 5HS8A 3E3VA 4L9JA 2ZJRF 3S17J 2YS9A 2IP2A 4QLCU 1LUJB 3IH4A 3FXLA 2W7NA 3OYCA 2Z16A 2EH3A 3GTPJ 4EM1A 4MTDA 1KQ8A 3ZQHA 4KNYA 5DM7F 2FOKA 1SVOA 4FQGA 2XSJC 1N25A 2IAIA 2F5VA 4XL9A 1U3EM 1ZR2A 4WXHA 3SZTA 3GFJA 1A35A 4MQVA 4AUXA 1W0UA 3MWMA 4UNOA 1X3UA 3JRAA 3K4KA 4HOBA 3HOVJ 1R5HA 4IHXA 5D5UB 3BR0A 1FLIA 1OPCA 3IAS2 3G2BA 3KP5A 4NC7A 4HG2A 4PJMA 3KP2A 1FPQA 2M1BA 3ASOH 3KLOA 3W2WA 4G9YA 4I0AA 1GDTA 2BW3A 3TMOA 1KQ0A 1OLTA 3ASNH 3PFYA 3MKLA 2WWYA 2IS2A 3TOBA 3H0DA 2MD5A 2R5ZB 3HEFA 2PMZN 3OYFA 1QZYA 3RKQA 2ESNA 2ZCWA 1K78B 2WY7Q 3LSIA 5ERIA 3TW7A 3WTXC 2STWA 2DFHA 2NVYJ 2LY1A 2QLZA 3AL0B 2O8XA 2H94A 1J9IA 3MQ0A 4RAFA 4RGSA 1S3JA 1IUYA 5F04A 2WAFA 2LVSA 3E5XA 1D0YA 2XGEA 2L9VA 1XGMA 1ZRDA 4QPOA 2EFOA 3DP7A 4MFDA 4EEFG 3ONQA 2X85A 4AD9A 4DBQA 2OPTA 1IN8A 9ANTA 3VODA 4I02A 3QYFA 1JKOC 2WC2A 3G1MA 5FKLA 1VQ6I 1REPC 1ENHA 2D5VA 3H35A 3HOZJ 4ZJZA 2L4MA 3HZJA 2DDBA 3F0CA 2BBYA 2VASA 4CGZA 5HDKA 1R9TJ 1X58A 1P4WA 2GZWA 2GAUA 2VLAA 1MDMA 3BJAA 1T2KA 3GFMA 2R3SA 2PX9A 4EATA 2ZXWH 3HSFA 1IN7A 2QZ8A 1UJ8A 1B9MA 1E2XA 4MHGA 2M87A 3ZQ7A 2K86A 2W4SA 3Q0WA 2OTLI 4F91B 2X6XA 3IKTA 3I3LA 4JQFA 1MBHA 1PP7U 1G4DA 3I4MJ 4BE2A 5CLSA 3PNTA 2MW8A 5J8CA 3ZMDA 3R61A 3HTSB 4XOPA 2DA5A 1H0MA 2O0YA 4U0WA 5CVUA 4ITVA 1YG2A 1RRJA 5FKMA 3N4MA 3WGHA 2Y69H 1V5FA 1KU9A 3QOEA 1G3YA 4X1EA 2PJRA 1TQMA 1GLNA 5FGMA 5BMZA 3OYHA 2A6EF 2XIGA 3OL4A 4A0ZA 2K4JA 3A01A 4UXNA 1FBUA 1T6SA 2DQRA 4M73A 4LB5A 2C6YA 2XROA 1T0FC 1B8IA 4HSTA 4HNVA 2VODA 4XONA 3KZYA 4A12A 3CUQA 5DCMB 2IGNA 1MSFC 4H4KC 1UG2A 3G4SI 3CJRB 3DTIA 2E1NA 1OCZH 5CPRB 3OR1C 3HBLA 3BG5A 2KZVA 3JSOA 4GRIA 3LSJA 2G7UA 4RAGA 3IV5A 2PQ8A 1SMYF 4KMFA 3NWSA 1MW7A 4HZFA 2HOEA 2ECCA 4XIDA 5LRSA 4BEHA 4E7ZA 1SC7A 4RB3C 1RETA 4B3XA 5TJJA 4TV7A 2TRTA 5GPAA 2JQ7A 4OINF 3M8FA 5GAHJ 1D8KA 2CU7A 4B48A 4FX4A 4DYRA 1JKPC 2OCEA 3C2HA 2DJIA 3ML6A 2EBIA 1ZARA 4IHWA 3WHBA 2E1CA 1JXSA 4Z2YA 1AHDP 4BXFA 1MMNA 2A69F 5JI6A 2HQ5A 1KU2A 4U7DA 1XSDA 1V5GA 2M0CA 3Q0UA 3I64A 2FXAA 4HF0A 3X2QH 5C3EJ 1F4KA 1K83J 3RSNA 1B72A 2E60A 4FASD 2COMA 1IRZA 1D8JA 4AIKA 2L5QA 2MD0A 2DFEA 3CDHA 2E5NA 3OR2C 3RPUD 2DYRH 2F5EA 1YI2I 2AQEA 3WGIA 4IQ4A 1SD6A 3LFUA 2HYGD 2JJ7A 4R8HA 3D1NI 3IRRA 1TWCJ 3BCAA 4JBAA 4CDGA 2FBHA 5GTHC 4HDVA 3R0JA 4M9ZA 4UB6C 3I58A 1U8BA 1V5EA 1RESA 2QWWA 4ZDLA 4CA0A 2MC3A 3KEOA 1ODDA 2E5ZA 2KLOA 3KYCB 1OKRA 1EH7A 1E3HA 2M34A 3I54A 4D1QA 3A2KA 2NAZA 2P5VA 3H5RA 1MBGA 1Q1VA 2BW3B 1F36A 4ENNA 4OIOF 2R7SA 2ZMEA 1ETQA 5J4VA 3WGGA 3QU3A 1P6RA 3EQLF 4V2FA 1X2NA 3FMRA 5JR3A 1FZPB 2LR8A 1YFHA 2QF7A 4KISA 4CCJA 1JI8A 1ZREA 3NWTA 1W5CC 2QSFX 1HCRA 1FOKA 2LREA 3BP8A 4O6JA 1FTZA 2R7XA 1IN5A 4HEA2 5D8LB 1R4MB 4ZDPA 5J6XA 3HSRA 3HTUA 3M9AA 4IF4A 4NNJA 3DPTA 4CO8A 3GZNB 2X0LA 2BEOA 3JR9A 1O3QA 1QZEA 2ID6A 1NG7A 4A5NA 2JA5J 5HLTA 2A5YB 3KEQA 2D2WA 3ROUA 4BH9A 2VN2A 3RTRA 2CJJA 3LSPA 4FCYA 4KDPA 3VEPA 2RQQA 3ABMH 3OYJA 4OWRB 5HS7A 2F5FA 4KIGA 2QQBA 4G6DA 4RM3A 1XMXA 2Z33A 1I5ZA 3WTWC 4ON0A 4BHCA 4YIRX 2I8DA 3GEZA 1MDMB 2MH9A 3M8JA 4FISA 3JTGA 1HBXG 2L2OA 4UB8C 2XB5A 4M74A 4UVCA 3M1EA 4V2GA 3LQQA 2EQRA 2MH2A 2H27A 4G7HF 4JP0A 5JLXA 2DK8A 2CW0F 2LG4A 1X4OA 2WBMA 1XCVA 1TTYA 3K70C 4BUPA 1C0WA 5LEKA 3BG6A 1I6XA 1T8IA 1Z7LA 4EJTA 1J75A 1TW3A 1R22A 1MBFA 1X3ZB 1R71A 2ICWG 2QEXI 3BZKA 1U2WA 3MFKA 5M3FJ 2CO5A 1U9OA 2D1HA 3GF2A 2I10A 3FWEA 4AIHA 2A5WA 2RVCA 2K3FA 2BXYA 1OFCX 3M7GA 4Y15A 2KPMA 2K5CA 2L7FP 2PJRB 3EYIA 4PFPA 1W7PA 5ICGA 4A0XA 2PI0A 2JK3A 3TQNA 3MVPA 4JX5A 3A01B 1FYLA 3F3XA 3F8MA 3HRTA 2COBA 1TNSA 3L2UA 2VQHA 1IDZA 2LP0A 2LKXA 1HW2A 3J7AO 1B8IB 2ZSHB 3UKGA 1EH8A 2PMZA 3R60A 4KICA 2HEOA 1FIAA 4HRIA 3KZZA 2KIMA 4M9SA 4XKWA 2E35A 2B0LA 3I56I 4XKCA 4XRSG 2YU3A 3BR6A 3QODA 2HQAA 3KEYA 4XBFA 3QP5A 2HKOA 2Q0OA 3JRFA 5FLMJ 3FBIB 1QHGA 1ETOA 3CP8A 3GBGA 2DT7B 4M3GA 2LLKA 5FKNA 4RMNA 1FYMA 4BACA 2VBZA 4BEHB 1IAWA 4WK8F 1VQKI 4Y13A 2NS8A 2EK5A 3F8NA 1NTCA 4ABZA 1AA7A 4GYIA 4ZYHA 2OBPA 5CVJA 3H92A 5B5EC 3FBNB 2VKHA 4GDFA 4I99C 1MJBA 3E6BA 3EYYA 4U0VA 3I71A 1P7JA 2XAJA 1XCBA 3FMSA 4NBQA 2GM4A 2EZKA 2ZO4A 3SDGA 4Q4ZF 1IN4A 3FMQA 2IS4A 4EJOA 2LF8A 3KP6A 3VSKA 4MIMA 4AVPA 1P2FA 3ZMSA 1J0RA 2FNAA 4RGRA 3H3VK 2MG4A 2JPBA 1VNDA 4N4NB 4RGUA 4XOTA 1DPRA 1ZLJA 5DEQA 3TO9A 2F48A 1OCPA 4A3FJ 3HSEA 1B72B 1VZ0A 2ZFUA 1KGSA 1T39A 1ZG5A 4LLLA 2AXTC 5LFAA 2HKXA 3DKXA 3RDIA 2HZTA 1HXDA 3HOYJ 2BOLA 2XF6A 1A6QA 2HYJA 5HLGA 1R23A 3A02A 1RKTA 5HVQC 2K9MA 3BZ6A 3K6GA 2JUCA 4CSWA 1NK2P 1TQIA 1O7LA 3FXJA 3P5JA 4IJAA 5F08A 4BGDA 2V1UA 1O4XA 4B47A 1KU3A 5D5XB 4BAYA 4S04A 4HQEA 1Y1WJ 3BC8A 1QPMA 1KYZA 1R6RA 1WSUA 1ZELA 3DLLF 4J01A 2CYYA 2WA0A 2KFDA 5E20A 1APLC 2W85A 3SJMA 1YS6A 4X6AJ 2ZMEB 4BQQA 1ZYRF 4MO7A 1ON2A 3QP6A 2H8WA 2IA1A 3D5LA 1YHQI 3HRSA 4PSXA 2DA1A 2HOSA 2M7BA 2JVGA 5DCFA 1XGNA 1VTNC 3MN2A 4E4HA 5F0CA 3GTOJ 3HKZN 3DEUA 3GYHX 2MYSA 3RZDJ 2GIZA 4HBLA 1TNTA 5B1BH 3C3WA 1QRYA 3FXMA 2X9DA 5M5YJ 3HOUJ 4ZYAA 3FXQA 3S1NJ 1RKWA 2Q2EA 4RBOA 3BWGA 2GOMA 3DCFA 1S5LC 2JMWA 1CF7A 5AIPA 4MEXF 1TBXA 4MQ9F 3W2AA 4B43A 2IGKA 2EWNA 1Z77A 2K9LA 2BVMA 1MKMA 1LFUP 2Y75A 1OMIA 1XMAA 1FBQA 3NARA 4KFCA 4KT6A 3VSLA 2P5KA 1ZLKA 5HS9A 3PO3J 2E19A 2PMHA 1Y39A 4S0HB 1G3WA 3EUHC 4XSZF 3IRQA 2A6HF 4LLGF 4CZZA 4EJVA 5K5RA 1WZ2A 1R00A 2W24A 2M30A 5FRNA 2XKPA 5EEGA 3P7NA 4PDKA 2R7RA 1BJZA 3U1DA 1F5TA 1J09A 4RB1A 3GLXA 3MZHA 3ZQFA 1GVDA 2VT3A 2HDCA 1ETWA 4ZYEA 3K1PA 2XPUA 1VQ7I 5F6FA 1O3RA 2JA8J 3O8GA 1Q1HA 2DTRA 4XRSA 2YSRA 1OCTC 1UAAA 1SFOJ 3CLQA 1K61A 2R7OA 4MTEA 3ABKH 3BTLA 5B66C 1SVMA 1RR8C 1MBJA 3QPLA 2EA2A 3CDLA 2QQ9A 4KT5C 2CW8A 4ZC3A 2Y0MA 3SEZA 3KYLA 4CH7A 1J7KA 3M1CA 3ZR8X 1HOMA 1ZGJA 4A3EJ 1DU0A 4CCNA 2A05A 2X1CA 1W7PB 4QIWN 4A93J 1AU7A 3PSIA 1X1AA 4F92B 3OWTA 3HL2A 2DO7A 2E2JJ 4EM2A 2DMNA 3HHHA 1AWCA 3SEQA 4L5JA 4IHYA 3S3MA 5L3EA 2UXNA 1SD4A 2DA6A 4IVNA 4PZJA 1FP1D 3HHGA 5E8IA 2LF7A 3OSGA 4RB0A 1SFXA 2HVRA 1T38A 2M45A 2F5CA 3GTKJ 1FT9A 3E7LA 4U87A 3CCEI 4PCQA 4J19A 2VE9A 1YO5C 4HV5A 2YX7A 2EILH 4M3EA 4MEYF 4UV8A 4ANJA 1U8RA 1VQLI 1RR7A 1YJNI 2IS6A 1OJLA 2EFQA 2KZGA 1OYIA 3S93A 2VKVA 3RKWA 5J40A 2WY8Q 4G6QA 1MBEA 4UUVA 5EGOA 3HUGA 1ON1A 3LA7A 3T1BA 1XTAA 1F9NA 4IXAA 2R4GA 1NK3P 4L9VA 5DTDA 1UFMA 3VOEA 4ETSA 4IHSA 4UY8I 2QKLB 5DM6F 4A69C 3ELKA 3I9V2 4RAYA 3FDYA 2L9NA 4IHVA 1FOYA 6PAXA 1WI9A 3ZMVA 3BR5A 2NXNB 3R6SA 1EH6A 4CYCA 1WFXA 3KFWX 2CUJA 2N8GA 5AIQA 2KHMA 2O61A 4B3AA 3CMAI 1X1PA 3A0HC 2P81A 2Z9OA 4HF1A 2A07F 2DJNA 1S7OA 3D5SC 1WJFA 3SHFA 4LD5A 1FOXA 1E17A 2E36A 2KDOA 1BC8C 3GTGJ 4I98B 3E6DA 4LLNA 2QM3A 3LL7A 3MEXA 2EV5A 3PQKA 4LG0A 1K79A 2IVMA 2O8KA 1QZZA 3OYLA 1KA8A 1WRJA 1LE8A 4BS9A 1VFCA 5C4XJ 2L02A 4G7OF 4E6KG 1Z67A 2VB6A 3LWFA 1RNLA 2HQRA 3OYEA 2XV4S 5IP7J 1R5GA 1K7AA 2VBYA 4AC0A 3LSRA 5K7HA 3NAUA 2CG4A 4A0YA 3HRMA 2Y2ZA 3O3KA 5KCMA 3CC7I 3BROA 4CYDA 1S72I 1BA5A 2EINH 3BT9A 2W1OA 4C2UA 1T0FA 5CJ9A 1YRNA 2CS3A 4BU2A 5HLHA 2OU2A 2VE8A 1ZGAA 4JX4A 4P9UA 3BQYA 3H9JA 4B44A 3OYAA 2ECBA 2IPQX 1E3PA 3V8JA 4A3MJ 2W00A 4RLFA 2E34A 3M3YJ 2V7FA 2Q2EB 2V1DA 4B1RA 1HKTA 1YJ9I 4AIJA 2OUMA 1DGWY 3FK6A 2L01A 1CF7B 5J3LA 4E7SA 1B6AA 1XGSA 5K5QA 2BYVE 2HOAA 2HS5A 3R4KA 1SFKA 2ZFWA 3PL8A 3L00A 1ETXA 1LEAA 1O3SA 2AHQA 4XLHA 2XAHA 2WV1A 3MKYB 2IRFG 3ZMZA 3IP4B 3RKXA 2LD5A 5H6RA 1IDYA 3LSMA 4BDYA 5EJCA 2YX4A 3DWLE 2V4JC 2NNYA 2E7WA 1LEBA 4YFXF 3Q9VA 1D1CA 1QVUA 1MNDA 4EVIA 1LVKA 3U1KA 2CV2A 2R5YA 3VPRA 2BY2A 3TDZC 5LHIA 1Z3YA 3JAMK 1I39A 1Z3XA 3O6BB 4MNUA 1X1DA 2ID3A 3C18A 3CC4I 2QCOA 4BXUA 1SMTA 5TISC 2BY1A 1FX7A 1HKSA 3GLLA 1CGPA 2PBIA 2JA6J 3HPGA 1FY7A 5BQTA 3PO2J 2ZXIA 3L09A 2KRFA 2GXBA 1J59A 2AXLA 5GAGJ 5AONA 4XSXF 1U9NA 1H8AC 3JRIA 1XN7A 1R49A 1MH3A 1FP2A 4BNCA 4XKBA 3RI4A 2VQGA 3DTKA 1ZQ3P 2E1MC 2A61A 2PFBA 1TLHB 1YLFA 3E6MA 2RREA 2YUSA 2P0WA 4OIQF
chains in the Genus database with same CATH topology
3ZN1A 2DQLA 2KKOA 2D45A 4A5MA 4M6YA 4S05A 3DFGA 2XGXA 4RGXA 1LQ1A 1FWZA 4OIRF 2CFXA 3BJOA 3K69A 4EM0B 2J5OA 5LGNA 1U5TC 2ZNYA 1YW7A 3OV8A 4OOIA 3R0AA 1FSEA 2DT5A 1XGOA 2LKPA 4G94A 1YW8A 2G9WA 5DD4A 4UHTA 3LAJA 1DP7P 5K1YA 3HIFA 2OA4A 1ZG3A 1SD5A 3CO6C 1ZHFA 1SD7A 1BI0A 3QRFF 4LG0B 1BI1A 4RB2C 4L0ZB 2VC1A 2QYOA 5BPIA 2XVCA 3HOTA 1IXCA 4WCGA 2JTVA 3T8TA 5E8GA 3B02A 4KIBA 5FLXZ 1R58A 4L9TA 3CLOA 2R7DA 1IW7F 1J2XA 3O2PE 3C7JA 3ISPA 2X4HA 4GGGA 2EB7A 5JFRA 1PDNC 4I0BA 3TO7A 4QWQA 3P9KA 2FNPA 4KUMA 2XAGA 3V7SA 3H3ZA 1LDKB 4LB6B 4EMSA 3ULQB 1USTA 4M9XA 3TDUC 4HDUA 4D0PA 2MBFA 3PFIA 3V8LA 5D8KB 5DDGA 5LHHA 1T98A 2GIVA 3T8RA 3F22A 2XRNA 1HSJA 2OAZA 4HF2A 2PMUA 2WV0A 4IRHA 3K0LA 5JHUA 2JZYA 4F7ZA 3P9CA 4K2EA 4A6DA 2FMLA 4CICA 2W84A 4ESBA 2FSWA 3ZN0A 4LMYA 1YQAA 4GO1A 4P9FA 3LSTA 3QU6A 1UHWA 5DUKA 4ZZDA 2P6SA 4Q47A 2NYXA 1G3SA 5D4RA 2RN7A 3CUQB 1U6GA 1W7PD 5LGUA 1R1UA 4Q5SF 3GVAA 2NS0A 2DLLA 2ETHA 4OMYA 1GHCA 1FC3A 3ZMUA 3F72A 2DFIA 2GXGA 2HGCA 4M6XA 1BIAA 4N0BA 1S6LA 1RI7A 4IRGA 1LB2A 1QNTA 2Z99A 2JSCA 2ZNZA 4WXCA 5L3CA 4WXDA 2XUBA 3EUHA 3GUDA 2XASA 4PGGA 4PGHA 5ILUA 3K9TA 3WU0A 3GO5A 1B9NA 1YYVA 3JAMZ 3FXRA 1AOYA 5H6QA 1S8NA 5HDGA 3CTAA 1ZRCA 3NQOA 2DU9A 3K1MA 4KA4A 3ZMTA 3SQNA 4HLXA 5EEHA 2K4BA 1B4AA 2ISYA 5HDNA 1IN6A 3SZPA 4E70A 3F6OA 4NHJA 2P6TA 2BGCA 4XRFA 2QUFA 2L3DA 3FX3A 3NRVA 1SFEA 2KJCA 1Z91A 2BE5F 3G73A 4LK0F 5ICFA 1DUXC 1STZA 2LDUA 2QQAA 2ISZA 5FB2A 2FU4A 3GX4X 4RAZA 5LBQA 1NHAA 3H3UA 1ZRFA 3F8CA 1GXPA 3I53A 4G7ZF 2WTEA 3E5QA 1A04A 4YIFA 4HAMA 5ICEA 4I09A 4EGYA 3KLNA 5E17F 3RKYA 3W6KB 4NB5A 3HOSA 2KIUA 2Z3YA 2HQNA 2H09A 2IT0A 5D6EA 4KMUX 2KJBA 3WTSC 1U78A 2GWRA 3JTHA 1LDDA 5ILSA 5JVTA 3MZYA 5CYVA 1W5TA 3I5UA 4U7BA 5ED4A 4M71A 1TW2A 4YIIA 1K6OA 1KQ9A 3T5XA 4DNCA 3WE2A 3HYIA 4ENJA 2ZJ2A 3GFLA 1QGPA 3NEUA 3WTVC 2EV0A 3L7WA 1XMKA 5FLXK 4HYEA 4WX9A 3VFZA 1ONVA 1XDUA 1ULYA 1O57A 4EV0A 2RV8A 1ZAOA 3PQJA 2K02A 5IT3A 1HW5A 4Q48A 5ILVA 3W6JB 5LLQA 2OQGA 3P9IA 3GXOA 1J5YA 1MJ9A 2DI3A 5LHGA 3WTYC 2FQ3A 2RNJA 5A2QK 4CXFA 3K1NA 3TO6A 5L3BA 4IRIA 1R1VA 4HW0A 1LNWA 1MGTA 1YIOA 2W57A 4AWXB 4YFKF 4GXOA 4UV9A 4NQWA 1DPUA 5J8FA 4MGRA 5FD5A 4G8XA 2P8TA 2Q8KA 1Y0UA 2XAFA 5D5WB 4ESJA 1FNNA 3KP3A 2HTSA 3WU1B 2FBKA 5L3FA 3DPLC 1W5SA 3BDDA 4HLYA 2MA3A 4KIFA 1XB4A 1BOAA 2L54A 3JW4A 2PLYA 2K7LA 5E1ZB 3RYPA 4XLPF 5IT9Z 2VXZA 2VOOA 4N9HA 2CSOA 2IA2A 2ZXJA 3BPXA 1RUOA 2BV6A 2R7FA 3MAJA 3QPTA 3J80Z 3OOPA 1FBSA 2PJPA 1IXRC 3IWFA 1XSVA 1U5TA 3J81K 3GFIA 1MJAA 1WQ2A 3ERED 3S2WA 3V7RA 3TGNA 3V7CA 3D0SA 4HQMA 1WWXA 2F5DA 5FFXA 1JHHA 2RQPA 3B73A 3I4PA 3LFKA 1GXQA 3WG9A 4LGWA 2UXXA 3CUOA 3BPVA 2O6GE 4B8XA 1R7JA 2FMYA 3ZP5A 2MLGA 3L9FA 1KYWA 1OR7A 3IL2A 2QVOA 5E1XA 4P5OA 5H20A 4R1HA 4I7HA 1H9TA 4FX0A 1G3TA 2P7VB 5L3DA 4O3MA 4ZYGA 1RIOH 5E18F 2RGVA 3KE2A 1BC7C 1O7FA 4L5IA 3LQRA 2A68F 3CO7C 1BJAA 2L4AA 2GA1A 2UWMA 2HWVA 1HW1A 4UVAA 2D1VA 1USSA 1L0OC 2VBWA 3FM5A 3MCZA 2V79A 2IW5A 5KK1A 3I59A 1B1BA 5LGTA 4N9IA 2P7CB 3E6CC 2DPUA 2NNNA 3JSPA 2CQKA 2J5PA 4EJUA 1S7AA 2FF4A 2ESHA 5BPDA 1UHMA 1V4RA 2ELHA 2XKOA 5D4SA 2ZBKA 4GYGA 3F6VA 1D3YA 2V6CA 1I1SA 3Q5FA 2RKHA 3RYRA 1IXSB 4A6EA 1BN5A 4Y17A 4IHTA 2K27A 1Z6RA 4OMZA 1MD0A 4RS8A 2EA4A 2YPRA 2AS5F 4FT8A 3RPUA 1IRFA 1XD7A 4IPAA 4OIPF 2VC0A 1UB9A 3V8KA 4L9NA 1R1TA 4HX7A 2OQRA 1BBYA 1IZ1A 2QBYA 4BYYA 4HX4A 1KU7A 5CVIA 1HQCA 2DK5A 4HV6A 1SFUA 2CWEA 4WWCA 2IA0A 1OYYA 3DF8A 3U2RA 2TDXA 3GWZA 5HLIA 5DV5A 1JHFA 4YG2F 1RUNA 2XHKA 3BOQA 2EFPA 4L18B 3HRUA 2DW4A 1U5TB 2P4WA 5L3GA 1Z9CA 1B59A 2QENA 3CUQC 2RDPA 4P96A 3LA2A 5A2QZ 1L3LA 4YFNF 3AAFA 2H6BA 5FO5A 3M8EA 3I0TA 2EFWA 3RPQA 2V9VA 3IC7A 3REOA 3KP4A 3WE3A 2CGPA 1G6NA 1DDNA 5HOOA 2HFHA 2O03A 3WTTC 2E7XA 4B09A 4I2OA 2DPDA 3QAHA 1TQPA 4KYWA 1S29A 2GQQA 1R36A 4BHPA 1Z05A 5CVRA 5E1WA 1SAXA 3F8FA 5DUIA 4U88A 2G7HA 2EV6A 3FHZA 4JK1X 3ABTA 5IT9K 2DAOA 2IJLA 4H0EA 4O5VA 5ICCA 2VONA 4EQQA 2GA2A 1MZBA 3J80K 5BS6A 3I59B 3LA3A 4U0YA 3U9GA 2PN6A 2O3FA 3E97A 5FD6A 3J81Z 2KIFA 4GCVA 2FA5A 3ZPLA 3E5UA 1QO0D 3EETA 3LAPA 2M8EA 3EDPA 2JT1A 4P55A 2FRHA 5F64A 1LVAA 1LJ9A 2ZKZA 3F8BA 3SFZA 3N97A 2FE3A 3C1DA 5KVRA 2HR3A 1FSHA 2M5WA 1ZN2A 4ASNA 2OZ6A 4OU0A 2RC4A 1GVJA 4LJZF 3SXYA 2STTA 3V4GA 1JE8A 1F1ZA 2MLKA 3ABUA 3FM3A 3G3ZA 1IF1A 1PP8F 2ADUA 4WF2A 4L0YB 3L2CA 1LDJA 2QBYB 1YTYA 3KP7A 4FHTA 3TKYA 3DKWA 2EFNA 2F2EA 3COAC 1YS7A 2A3SA 2HTJA 1IRGA 2NRAC 1P92A 4XLNF 3BJ6A 1QQIA 5TRDA 1FYKA 2UZKA 1ZG1A 4M72A 4BQAA 1OYWA 1EV7A 2EJRA 2LNBA 1WKMA 2VBXA 3QOPA 5F1RA 1HSTA 4R79A 4KN4X 2FEZA 3IWZA 1K78A 3TOAA 1I1GA 3IHUA 1RZ4A 3KETA 2JRTA 4A2UA 2Z5UA 2HYFA 5CVVA 1V3FA 2OZUA 1Z1DA 3WTZA 1XDSA 4ENMA 2PEXA 3FXUA 1PUEE 3Q9SA 3GW2A 1YW9A 2YR2A 2W25A 2OD5A 3F23A 3KCCA 3VB2A 3DQVC 5FFZA 3GZ6A 1D5VA 1Z6TA 1BI3A 1UCRA 2LSOA 4ESFA 5DYMA 2DBBA 3DXJF 4ZH4F 1Z7UA 5LRRA 1W4MA 4KN7X 2ACJA 3RJPA 1O3TA 5DD8A 5LEJA 3IKVA 2VT2A 4LK1F 4LFUA 3FZVA 1BIBA 1ZH5A 4HX8A 4ENKA 3F21A 2V1XA 2P5LC 5D5VB 3T0YA 4EGZA 3ECOA 2Y48A 3FF5A 4BHBA 1XSXA 5D6FA 2XAQA 5DCMA 1P4XA 1BM9A 2H6CA 3ECHA 2JPCA 1BI2A 3GZ5A 3BY6A 4CHUA 1H9GA 4ZYDA 1HKQA 1QBJA 3WTUC 4UVBA 1I27A 2VOPA 3RIRA 4DQ2A 3CJNA 3QPHA 3DV8A 2PG4A 3WODF 4EJWA 5K5OA 1P4AA 2FBIA 1JGSA 3K2ZA 5BOXA 4ZZLA 4I01A 4HA8A 5HS8A 3E3VA 4L9JA 2IP2A 4QLCU 4EM1A 4MTDA 1KQ8A 4KNYA 2FOKA 1U3EM 4WXHA 3SZTA 3GFJA 4MQVA 3MWMA 4UNOA 1X3UA 4HOBA 1R5HA 5D5UB 1FLIA 1OPCA 3KP5A 3KP2A 1FPQA 2M1BA 3KLOA 4G9YA 4I0AA 1KQ0A 2WWYA 3TOBA 2MD5A 1QZYA 2ESNA 2ZCWA 1K78B 5ERIA 3WTXC 2STWA 2QLZA 2O8XA 2H94A 1J9IA 3MQ0A 4RGSA 1S3JA 1IUYA 3E5XA 1XGMA 1ZRDA 2EFOA 3DP7A 4AD9A 1IN8A 3VODA 4I02A 2WC2A 1REPC 2L4MA 2BBYA 4CGZA 5HDKA 1P4WA 2GZWA 2GAUA 1MDMA 3BJAA 1T2KA 3GFMA 2R3SA 3HSFA 1IN7A 2QZ8A 1B9MA 1E2XA 4MHGA 2M87A 3ZQ7A 2K86A 3IKTA 4JQFA 1PP7U 1G4DA 5CLSA 5J8CA 3ZMDA 3R61A 3HTSB 1H0MA 2O0YA 4U0WA 5CVUA 1YG2A 3N4MA 3WGHA 1KU9A 1G3YA 1TQMA 5FGMA 5BMZA 2A6EF 2XIGA 4A0ZA 2K4JA 4UXNA 1FBUA 1T6SA 2DQRA 4M73A 4LB5A 2C6YA 2XROA 2VODA 3KZYA 4A12A 3CUQA 5DCMB 2E1NA 3JSOA 2G7UA 2PQ8A 1SMYF 4KMFA 4HZFA 2HOEA 5LRSA 4RB3C 5TJJA 4TV7A 4OINF 3M8FA 1D8KA 4FX4A 3ML6A 1ZARA 2E1CA 1JXSA 4Z2YA 5JI6A 2A69F 1KU2A 4U7DA 1XSDA 3I64A 2FXAA 4HF0A 1F4KA 2COMA 1D8JA 4AIKA 3CDHA 2F5EA 3WGIA 1SD6A 2HYGD 4R8HA 3IRRA 4JBAA 4CDGA 2FBHA 4HDVA 3R0JA 4M9ZA 3I58A 2QWWA 2MC3A 3KEOA 1ODDA 1OKRA 1EH7A 3I54A 2NAZA 2P5VA 4ENNA 4OIOF 2ZMEA 3WGGA 3QU3A 1P6RA 3EQLF 3FMRA 5JR3A 1FZPB 1YFHA 1ZREA 1FOKA 3BP8A 4O6JA 1IN5A 5D8LB 5J6XA 3HSRA 3HTUA 3M9AA 4IF4A 3DPTA 4CO8A 2X0LA 2BEOA 1O3QA 4A5NA 2A5YB 3KEQA 2D2WA 3ROUA 4BH9A 2VN2A 3RTRA 4KDPA 3VEPA 5HS7A 2F5FA 4KIGA 2QQBA 4G6DA 2Z33A 1I5ZA 3WTWC 4ON0A 4BHCA 3GEZA 1MDMB 2MH9A 3JTGA 1HBXG 4M74A 4UVCA 3M1EA 3LQQA 2MH2A 2H27A 4G7HF 2DK8A 2CW0F 1XCVA 1TTYA 1C0WA 5LEKA 1I6XA 4EJTA 1J75A 1TW3A 1R22A 1U2WA 3MFKA 2CO5A 2D1HA 3GF2A 3FWEA 4AIHA 2RVCA 3M7GA 4Y15A 3EYIA 1W7PA 5ICGA 4A0XA 2PI0A 3TQNA 1FYLA 3F3XA 3F8MA 3HRTA 1TNSA 1HW2A 3J7AO 1EH8A 3R60A 4KICA 2HEOA 3KZZA 2KIMA 4M9SA 2B0LA 2YU3A 4XBFA 3QP5A 2HKOA 2Q0OA 1FYMA 2VBZA 1IAWA 4WK8F 4Y13A 2EK5A 3F8NA 4GYIA 4ZYHA 2OBPA 5CVJA 3H92A 1MJBA 3E6BA 3EYYA 4U0VA 3I71A 2XAJA 1XCBA 3FMSA 2ZO4A 4Q4ZF 1IN4A 3FMQA 4EJOA 2LF8A 3KP6A 4AVPA 1P2FA 3ZMSA 1J0RA 2FNAA 4RGRA 2JPBA 3TO9A 4RGUA 1DPRA 1ZLJA 5DEQA 3HSEA 1KGSA 1T39A 1ZG5A 4LLLA 2HKXA 3RDIA 2HZTA 1HXDA 5HLGA 1R23A 5HVQC 3BZ6A 1TQIA 1O7LA 4IJAA 2V1UA 1KU3A 5D5XB 4BAYA 4S04A 4HQEA 1QPMA 1KYZA 1WSUA 2CYYA 5E20A 2W85A 1YS6A 2ZMEB 1ZYRF 1ON2A 3QP6A 2IA1A 3D5LA 3HRSA 5DCFA 1VTNC 1XGNA 3DEUA 3GYHX 4HBLA 1TNTA 3C3WA 3FXQA 2Q2EA 3BWGA 1CF7A 5AIPA 4MEXF 1TBXA 4MQ9F 2EWNA 1MKMA 2Y75A 1OMIA 1XMAA 1FBQA 4KFCA 2P5KA 1ZLKA 5HS9A 2PMHA 1G3WA 4XSZF 3IRQA 2A6HF 4EJVA 4LLGF 4CZZA 5K5RA 1R00A 2W24A 2M30A 2XKPA 5EEGA 3P7NA 4PDKA 3U1DA 1F5TA 4RB1A 3MZHA 3GLXA 2VT3A 2HDCA 4ZYEA 3K1PA 5F6FA 1O3RA 1Q1HA 2DTRA 2YSRA 4MTEA 2EA2A 2QQ9A 4KT5C 2Y0MA 1J7KA 1ZGJA 1W7PB 2DO7A 4EM2A 3HHHA 1AWCA 4L5JA 5L3EA 2UXNA 1SD4A 4IVNA 4PZJA 1FP1D 3HHGA 5E8IA 2LF7A 4RB0A 1SFXA 1T38A 2M45A 2F5CA 1FT9A 4PCQA 2VE9A 1YO5C 4HV5A 2YX7A 4MEYF 4UV8A 1U8RA 2EFQA 1OYIA 3RKWA 4G6QA 4UUVA 3HUGA 1ON1A 3LA7A 3T1BA 1F9NA 4IXAA 4L9VA 1UFMA 3VOEA 4ETSA 4IHSA 3ELKA 4RAYA 6PAXA 1WI9A 3ZMVA 3R6SA 1EH6A 3KFWX 5AIQA 2O61A 2Z9OA 4HF1A 2A07F 1S7OA 3SHFA 4LD5A 1E17A 1BC8C 4I98B 3E6DA 4LLNA 2QM3A 3MEXA 2EV5A 3PQKA 4LG0A 1K79A 2IVMA 1QZZA 1KA8A 1WRJA 2L02A 4G7OF 3LWFA 1RNLA 2HQRA 2XV4S 1R5GA 1K7AA 2VBYA 2CG4A 4A0YA 3HRMA 3O3KA 3BROA 4CYDA 1T0FA 5CJ9A 5HLHA 2OU2A 2VE8A 1ZGAA 4P9UA 2IPQX 3V8JA 2V1DA 1HKTA 4AIJA 1CF7B 2L01A 1B6AA 1XGSA 5K5QA 2BYVE 2HS5A 3R4KA 2ZFWA 3L00A 1LEAA 1O3SA 2XAHA 2IRFG 3ZMZA 3RKXA 5H6RA 2YX4A 2NNYA 2E7WA 1LEBA 4YFXF 3Q9VA 4EVIA 3TDZC 5LHIA 3JAMK 4MNUA 3O6BB 3C18A 4BXUA 1SMTA 1FX7A 1HKSA 1CGPA 2PBIA 1FY7A 5BQTA 3L09A 2KRFA 2GXBA 1J59A 2AXLA 5AONA 4XSXF 1XN7A 1FP2A 4BNCA 3RI4A 2A61A 2PFBA 1TLHB 1YLFA 3E6MA 4OIQF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZN1 A;  2DQL A;  2KKO A;  2D45 A;  4A5M A;  4M6Y A;  4S05 A;  3DFG A;  2XGX A;  4RGX A;  1LQ1 A;  1FWZ A;  4OIR F;  2CFX A;  3BJO A;  3K69 A;  4EM0 B;  2J5O A;  5LGN A;  1U5T C;  2ZNY A;  1YW7 A;  3OV8 A;  4OOI A;  3R0A A;  1FSE A;  2DT5 A;  1XGO A;  2LKP A;  4G94 A;  1YW8 A;  2G9W A;  5DD4 A;  4UHT A;  3LAJ A;  1DP7 P;  5K1Y A;  3HIF A;  2OA4 A;  1ZG3 A;  1SD5 A;  3CO6 C;  1ZHF A;  1SD7 A;  1BI0 A;  3QRF F;  4LG0 B;  1BI1 A;  4RB2 C;  4L0Z B;  2VC1 A;  2QYO A;  5BPI A;  2XVC A;  3HOT A;  1IXC A;  4WCG A;  2JTV A;  3T8T A;  5E8G A;  3B02 A;  4KIB A;  5FLX Z;  1R58 A;  4L9T A;  3CLO A;  2R7D A;  1IW7 F;  1J2X A;  3O2P E;  3C7J A;  3ISP A;  2X4H A;  4GGG A;  2EB7 A;  5JFR A;  1PDN C;  4I0B A;  3TO7 A;  4QWQ A;  3P9K A;  2FNP A;  4KUM A;  2XAG A;  3V7S A;  3H3Z A;  1LDK B;  4LB6 B;  4EMS A;  3ULQ B;  1UST A;  4M9X A;  3TDU C;  4HDU A;  4D0P A;  2MBF A;  3PFI A;  3V8L A;  5D8K B;  5DDG A;  5LHH A;  1T98 A;  2GIV A;  3T8R A;  3F22 A;  2XRN A;  1HSJ A;  2OAZ A;  4HF2 A;  2PMU A;  2WV0 A;  4IRH A;  3K0L A;  5JHU A;  2JZY A;  4F7Z A;  3P9C A;  4K2E A;  4A6D A;  2FML A;  4CIC A;  2W84 A;  4ESB A;  2FSW A;  3ZN0 A;  4LMY A;  1YQA A;  4GO1 A;  4P9F A;  3LST A;  3QU6 A;  1UHW A;  5DUK A;  4ZZD A;  2P6S A;  4Q47 A;  2NYX A;  1G3S A;  5D4R A;  2RN7 A;  3CUQ B;  1U6G A;  1W7P D;  5LGU A;  1R1U A;  4Q5S F;  3GVA A;  2NS0 A;  2DLL A;  2ETH A;  4OMY A;  1GHC A;  1FC3 A;  3ZMU A;  3F72 A;  2DFI A;  2GXG A;  2HGC A;  4M6X A;  1BIA A;  4N0B A;  1S6L A;  1RI7 A;  4IRG A;  1LB2 A;  1QNT A;  2Z99 A;  2JSC A;  2ZNZ A;  4WXC A;  5L3C A;  4WXD A;  2XUB A;  3EUH A;  3GUD A;  2XAS A;  4PGG A;  4PGH A;  5ILU A;  3K9T A;  3WU0 A;  3GO5 A;  1B9N A;  1YYV A;  3JAM Z;  3FXR A;  1AOY A;  5H6Q A;  1S8N A;  5HDG A;  3CTA A;  1ZRC A;  3NQO A;  2DU9 A;  3K1M A;  4KA4 A;  3ZMT A;  3SQN A;  4HLX A;  5EEH A;  2K4B A;  1B4A A;  2ISY A;  5HDN A;  1IN6 A;  3SZP A;  4E70 A;  3F6O A;  4NHJ A;  2P6T A;  2BGC A;  4XRF A;  2QUF A;  2L3D A;  3FX3 A;  3NRV A;  1SFE A;  2KJC A;  1Z91 A;  2BE5 F;  3G73 A;  4LK0 F;  5ICF A;  1DUX C;  1STZ A;  2LDU A;  2QQA A;  2ISZ A;  5FB2 A;  2FU4 A;  3GX4 X;  4RAZ A;  5LBQ A;  1NHA A;  3H3U A;  1ZRF A;  3F8C A;  1GXP A;  3I53 A;  4G7Z F;  2WTE A;  3E5Q A;  1A04 A;  4YIF A;  4HAM A;  5ICE A;  4I09 A;  4EGY A;  3KLN A;  5E17 F;  3RKY A;  3W6K B;  4NB5 A;  3HOS A;  2KIU A;  2Z3Y A;  2HQN A;  2H09 A;  2IT0 A;  5D6E A;  4KMU X;  2KJB A;  3WTS C;  1U78 A;  2GWR A;  3JTH A;  1LDD A;  5ILS A;  5JVT A;  3MZY A;  5CYV A;  1W5T A;  3I5U A;  4U7B A;  5ED4 A;  4M71 A;  1TW2 A;  4YII A;  1K6O A;  1KQ9 A;  3T5X A;  4DNC A;  3WE2 A;  3HYI A;  4ENJ A;  2ZJ2 A;  3GFL A;  1QGP A;  3NEU A;  3WTV C;  2EV0 A;  3L7W A;  1XMK A;  5FLX K;  4HYE A;  4WX9 A;  3VFZ A;  1ONV A;  1XDU A;  1ULY A;  1O57 A;  4EV0 A;  2RV8 A;  1ZAO A;  3PQJ A;  2K02 A;  5IT3 A;  1HW5 A;  4Q48 A;  5ILV A;  3W6J B;  5LLQ A;  2OQG A;  3P9I A;  3GXO A;  1J5Y A;  1MJ9 A;  2DI3 A;  5LHG A;  3WTY C;  2FQ3 A;  2RNJ A;  5A2Q K;  4CXF A;  3K1N A;  3TO6 A;  5L3B A;  4IRI A;  1R1V A;  4HW0 A;  1LNW A;  1MGT A;  1YIO A;  2W57 A;  4AWX B;  4YFK F;  4GXO A;  4UV9 A;  4NQW A;  1DPU A;  5J8F A;  4MGR A;  5FD5 A;  4G8X A;  2P8T A;  2Q8K A;  1Y0U A;  2XAF A;  5D5W B;  4ESJ A;  1FNN A;  3KP3 A;  2HTS A;  3WU1 B;  2FBK A;  5L3F A;  3DPL C;  1W5S A;  3BDD A;  4HLY A;  2MA3 A;  4KIF A;  1XB4 A;  1BOA A;  2L54 A;  3JW4 A;  2PLY A;  2K7L A;  5E1Z B;  3RYP A;  4XLP F;  5IT9 Z;  2VXZ A;  2VOO A;  4N9H A;  2CSO A;  2IA2 A;  2ZXJ A;  3BPX A;  1RUO A;  2BV6 A;  2R7F A;  3MAJ A;  3QPT A;  3J80 Z;  3OOP A;  1FBS A;  2PJP A;  1IXR C;  3IWF A;  1XSV A;  1U5T A;  3J81 K;  3GFI A;  1MJA A;  1WQ2 A;  3ERE D;  3S2W A;  3V7R A;  3TGN A;  3V7C A;  3D0S A;  4HQM A;  1WWX A;  2F5D A;  5FFX A;  1JHH A;  2RQP A;  3B73 A;  3I4P A;  3LFK A;  1GXQ A;  3WG9 A;  4LGW A;  2UXX A;  3CUO A;  3BPV A;  2O6G E;  4B8X A;  1R7J A;  2FMY A;  3ZP5 A;  2MLG A;  3L9F A;  1KYW A;  1OR7 A;  3IL2 A;  2QVO A;  5E1X A;  4P5O A;  5H20 A;  4R1H A;  4I7H A;  1H9T A;  4FX0 A;  1G3T A;  2P7V B;  5L3D A;  4O3M A;  4ZYG A;  1RIO H;  5E18 F;  2RGV A;  3KE2 A;  1BC7 C;  1O7F A;  4L5I A;  3LQR A;  2A68 F;  3CO7 C;  1BJA A;  2L4A A;  2GA1 A;  2UWM A;  2HWV A;  1HW1 A;  4UVA A;  2D1V A;  1USS A;  1L0O C;  2VBW A;  3FM5 A;  3MCZ A;  2V79 A;  2IW5 A;  5KK1 A;  3I59 A;  1B1B A;  5LGT A;  4N9I A;  2P7C B;  3E6C C;  2DPU A;  2NNN A;  3JSP A;  2CQK A;  2J5P A;  4EJU A;  1S7A A;  2FF4 A;  2ESH A;  5BPD A;  1UHM A;  1V4R A;  2ELH A;  2XKO A;  5D4S A;  2ZBK A;  4GYG A;  3F6V A;  1D3Y A;  2V6C A;  1I1S A;  3Q5F A;  2RKH A;  3RYR A;  1IXS B;  4A6E A;  1BN5 A;  4Y17 A;  4IHT A;  2K27 A;  1Z6R A;  4OMZ A;  1MD0 A;  4RS8 A;  2EA4 A;  2YPR A;  2AS5 F;  4FT8 A;  3RPU A;  1IRF A;  1XD7 A;  4IPA A;  4OIP F;  2VC0 A;  1UB9 A;  3V8K A;  4L9N A;  1R1T A;  4HX7 A;  2OQR A;  1BBY A;  1IZ1 A;  2QBY A;  4BYY A;  4HX4 A;  1KU7 A;  5CVI A;  1HQC A;  2DK5 A;  4HV6 A;  1SFU A;  2CWE A;  4WWC A;  2IA0 A;  1OYY A;  3DF8 A;  3U2R A;  2TDX A;  3GWZ A;  5HLI A;  5DV5 A;  1JHF A;  4YG2 F;  1RUN A;  2XHK A;  3BOQ A;  2EFP A;  4L18 B;  3HRU A;  2DW4 A;  1U5T B;  2P4W A;  5L3G A;  1Z9C A;  1B59 A;  2QEN A;  3CUQ C;  2RDP A;  4P96 A;  3LA2 A;  5A2Q Z;  1L3L A;  4YFN F;  3AAF A;  2H6B A;  5FO5 A;  3M8E A;  3I0T A;  2EFW A;  3RPQ A;  2V9V A;  3IC7 A;  3REO A;  3KP4 A;  3WE3 A;  2CGP A;  1G6N A;  1DDN A;  5HOO A;  2HFH A;  2O03 A;  3WTT C;  2E7X A;  4B09 A;  4I2O A;  2DPD A;  3QAH A;  1TQP A;  4KYW A;  1S29 A;  2GQQ A;  1R36 A;  4BHP A;  1Z05 A;  5CVR A;  5E1W A;  1SAX A;  3F8F A;  5DUI A;  4U88 A;  2G7H A;  2EV6 A;  3FHZ A;  4JK1 X;  3ABT A;  5IT9 K;  2DAO A;  2IJL A;  4H0E A;  4O5V A;  5ICC A;  2VON A;  4EQQ A;  2GA2 A;  1MZB A;  3J80 K;  5BS6 A;  3I59 B;  3LA3 A;  4U0Y A;  3U9G A;  2PN6 A;  2O3F A;  3E97 A;  5FD6 A;  3J81 Z;  2KIF A;  4GCV A;  2FA5 A;  3ZPL A;  3E5U A;  1QO0 D;  3EET A;  3LAP A;  2M8E A;  3EDP A;  2JT1 A;  4P55 A;  2FRH A;  5F64 A;  1LVA A;  1LJ9 A;  2ZKZ A;  3F8B A;  3SFZ A;  3N97 A;  2FE3 A;  3C1D A;  5KVR A;  2HR3 A;  1FSH A;  2M5W A;  1ZN2 A;  4ASN A;  2OZ6 A;  4OU0 A;  2RC4 A;  1GVJ A;  4LJZ F;  3SXY A;  2STT A;  3V4G A;  1JE8 A;  1F1Z A;  2MLK A;  3ABU A;  3FM3 A;  3G3Z A;  1IF1 A;  1PP8 F;  2ADU A;  4WF2 A;  4L0Y B;  3L2C A;  1LDJ A;  2QBY B;  1YTY A;  3KP7 A;  4FHT A;  3TKY A;  3DKW A;  2EFN A;  2F2E A;  3COA C;  1YS7 A;  2A3S A;  2HTJ A;  1IRG A;  2NRA C;  1P92 A;  4XLN F;  3BJ6 A;  1QQI A;  5TRD A;  1FYK A;  2UZK A;  1ZG1 A;  4M72 A;  4BQA A;  1OYW A;  1EV7 A;  2EJR A;  2LNB A;  1WKM A;  2VBX A;  3QOP A;  5F1R A;  1HST A;  4R79 A;  4KN4 X;  2FEZ A;  3IWZ A;  1K78 A;  3TOA A;  1I1G A;  3IHU A;  1RZ4 A;  3KET A;  2JRT A;  4A2U A;  2Z5U A;  2HYF A;  5CVV A;  1V3F A;  2OZU A;  1Z1D A;  3WTZ A;  1XDS A;  4ENM A;  2PEX A;  3FXU A;  1PUE E;  3Q9S A;  3GW2 A;  1YW9 A;  2YR2 A;  2W25 A;  2OD5 A;  3F23 A;  3KCC A;  3VB2 A;  3DQV C;  5FFZ A;  3GZ6 A;  1D5V A;  1Z6T A;  1BI3 A;  1UCR A;  2LSO A;  4ESF A;  5DYM A;  2DBB A;  3DXJ F;  4ZH4 F;  1Z7U A;  5LRR A;  1W4M A;  4KN7 X;  2ACJ A;  3RJP A;  1O3T A;  5DD8 A;  5LEJ A;  3IKV A;  2VT2 A;  4LK1 F;  4LFU A;  3FZV A;  1BIB A;  1ZH5 A;  4HX8 A;  4ENK A;  3F21 A;  2V1X A;  2P5L C;  5D5V B;  3T0Y A;  4EGZ A;  3ECO A;  2Y48 A;  3FF5 A;  4BHB A;  1XSX A;  5D6F A;  2XAQ A;  5DCM A;  1P4X A;  1BM9 A;  2H6C A;  3ECH A;  2JPC A;  1BI2 A;  3GZ5 A;  3BY6 A;  4CHU A;  1H9G A;  4ZYD A;  1HKQ A;  1QBJ A;  3WTU C;  4UVB A;  1I27 A;  2VOP A;  3RIR A;  4DQ2 A;  3CJN A;  3QPH A;  3DV8 A;  2PG4 A;  3WOD F;  4EJW A;  5K5O A;  1P4A A;  2FBI A;  1JGS A;  3K2Z A;  5BOX A;  4ZZL A;  4I01 A;  4HA8 A;  5HS8 A;  3E3V A;  4L9J A;  2IP2 A;  4QLC U;  4EM1 A;  4MTD A;  1KQ8 A;  4KNY A;  2FOK A;  1U3E M;  4WXH A;  3SZT A;  3GFJ A;  4MQV A;  3MWM A;  4UNO A;  1X3U A;  4HOB A;  1R5H A;  5D5U B;  1FLI A;  1OPC A;  3KP5 A;  3KP2 A;  1FPQ A;  2M1B A;  3KLO A;  4G9Y A;  4I0A A;  1KQ0 A;  2WWY A;  3TOB A;  2MD5 A;  1QZY A;  2ESN A;  2ZCW A;  1K78 B;  5ERI A;  3WTX C;  2STW A;  2QLZ A;  2O8X A;  2H94 A;  1J9I A;  3MQ0 A;  4RGS A;  1S3J A;  1IUY A;  3E5X A;  1XGM A;  1ZRD A;  2EFO A;  3DP7 A;  4AD9 A;  1IN8 A;  3VOD A;  4I02 A;  2WC2 A;  1REP C;  2L4M A;  2BBY A;  4CGZ A;  5HDK A;  1P4W A;  2GZW A;  2GAU A;  1MDM A;  3BJA A;  1T2K A;  3GFM A;  2R3S A;  3HSF A;  1IN7 A;  2QZ8 A;  1B9M A;  1E2X A;  4MHG A;  2M87 A;  3ZQ7 A;  2K86 A;  3IKT A;  4JQF A;  1PP7 U;  1G4D A;  5CLS A;  5J8C A;  3ZMD A;  3R61 A;  3HTS B;  1H0M A;  2O0Y A;  4U0W A;  5CVU A;  1YG2 A;  3N4M A;  3WGH A;  1KU9 A;  1G3Y A;  1TQM A;  5FGM A;  5BMZ A;  2A6E F;  2XIG A;  4A0Z A;  2K4J A;  4UXN A;  1FBU A;  1T6S A;  2DQR A;  4M73 A;  4LB5 A;  2C6Y A;  2XRO A;  2VOD A;  3KZY A;  4A12 A;  3CUQ A;  5DCM B;  2E1N A;  3JSO A;  2G7U A;  2PQ8 A;  1SMY F;  4KMF A;  4HZF A;  2HOE A;  5LRS A;  4RB3 C;  5TJJ A;  4TV7 A;  4OIN F;  3M8F A;  1D8K A;  4FX4 A;  3ML6 A;  1ZAR A;  2E1C A;  1JXS A;  4Z2Y A;  5JI6 A;  2A69 F;  1KU2 A;  4U7D A;  1XSD A;  3I64 A;  2FXA A;  4HF0 A;  1F4K A;  2COM A;  1D8J A;  4AIK A;  3CDH A;  2F5E A;  3WGI A;  1SD6 A;  2HYG D;  4R8H A;  3IRR A;  4JBA A;  4CDG A;  2FBH A;  4HDV A;  3R0J A;  4M9Z A;  3I58 A;  2QWW A;  2MC3 A;  3KEO A;  1ODD A;  1OKR A;  1EH7 A;  3I54 A;  2NAZ A;  2P5V A;  4ENN A;  4OIO F;  2ZME A;  3WGG A;  3QU3 A;  1P6R A;  3EQL F;  3FMR A;  5JR3 A;  1FZP B;  1YFH A;  1ZRE A;  1FOK A;  3BP8 A;  4O6J A;  1IN5 A;  5D8L B;  5J6X A;  3HSR A;  3HTU A;  3M9A A;  4IF4 A;  3DPT A;  4CO8 A;  2X0L A;  2BEO A;  1O3Q A;  4A5N A;  2A5Y B;  3KEQ A;  2D2W A;  3ROU A;  4BH9 A;  2VN2 A;  3RTR A;  4KDP A;  3VEP A;  5HS7 A;  2F5F A;  4KIG A;  2QQB A;  4G6D A;  2Z33 A;  1I5Z A;  3WTW C;  4ON0 A;  4BHC A;  3GEZ A;  1MDM B;  2MH9 A;  3JTG A;  1HBX G;  4M74 A;  4UVC A;  3M1E A;  3LQQ A;  2MH2 A;  2H27 A;  4G7H F;  2DK8 A;  2CW0 F;  1XCV A;  1TTY A;  1C0W A;  5LEK A;  1I6X A;  4EJT A;  1J75 A;  1TW3 A;  1R22 A;  1U2W A;  3MFK A;  2CO5 A;  2D1H A;  3GF2 A;  3FWE A;  4AIH A;  2RVC A;  3M7G A;  4Y15 A;  3EYI A;  1W7P A;  5ICG A;  4A0X A;  2PI0 A;  3TQN A;  1FYL A;  3F3X A;  3F8M A;  3HRT A;  1TNS A;  1HW2 A;  3J7A O;  1EH8 A;  3R60 A;  4KIC A;  2HEO A;  3KZZ A;  2KIM A;  4M9S A;  2B0L A;  2YU3 A;  4XBF A;  3QP5 A;  2HKO A;  2Q0O A;  1FYM A;  2VBZ A;  1IAW A;  4WK8 F;  4Y13 A;  2EK5 A;  3F8N A;  4GYI A;  4ZYH A;  2OBP A;  5CVJ A;  3H92 A;  1MJB A;  3E6B A;  3EYY A;  4U0V A;  3I71 A;  2XAJ A;  1XCB A;  3FMS A;  2ZO4 A;  4Q4Z F;  1IN4 A;  3FMQ A;  4EJO A;  2LF8 A;  3KP6 A;  4AVP A;  1P2F A;  3ZMS A;  1J0R A;  2FNA A;  4RGR A;  2JPB A;  3TO9 A;  4RGU A;  1DPR A;  1ZLJ A;  5DEQ A;  3HSE A;  1KGS A;  1T39 A;  1ZG5 A;  4LLL A;  2HKX A;  3RDI A;  2HZT A;  1HXD A;  5HLG A;  1R23 A;  5HVQ C;  3BZ6 A;  1TQI A;  1O7L A;  4IJA A;  2V1U A;  1KU3 A;  5D5X B;  4BAY A;  4S04 A;  4HQE A;  1QPM A;  1KYZ A;  1WSU A;  2CYY A;  5E20 A;  2W85 A;  1YS6 A;  2ZME B;  1ZYR F;  1ON2 A;  3QP6 A;  2IA1 A;  3D5L A;  3HRS A;  5DCF A;  1VTN C;  1XGN A;  3DEU A;  3GYH X;  4HBL A;  1TNT A;  3C3W A;  3FXQ A;  2Q2E A;  3BWG A;  1CF7 A;  5AIP A;  4MEX F;  1TBX A;  4MQ9 F;  2EWN A;  1MKM A;  2Y75 A;  1OMI A;  1XMA A;  1FBQ A;  4KFC A;  2P5K A;  1ZLK A;  5HS9 A;  2PMH A;  1G3W A;  4XSZ F;  3IRQ A;  2A6H F;  4EJV A;  4LLG F;  4CZZ A;  5K5R A;  1R00 A;  2W24 A;  2M30 A;  2XKP A;  5EEG A;  3P7N A;  4PDK A;  3U1D A;  1F5T A;  4RB1 A;  3MZH A;  3GLX A;  2VT3 A;  2HDC A;  4ZYE A;  3K1P A;  5F6F A;  1O3R A;  1Q1H A;  2DTR A;  2YSR A;  4MTE A;  2EA2 A;  2QQ9 A;  4KT5 C;  2Y0M A;  1J7K A;  1ZGJ A;  1W7P B;  2DO7 A;  4EM2 A;  3HHH A;  1AWC A;  4L5J A;  5L3E A;  2UXN A;  1SD4 A;  4IVN A;  4PZJ A;  1FP1 D;  3HHG A;  5E8I A;  2LF7 A;  4RB0 A;  1SFX A;  1T38 A;  2M45 A;  2F5C A;  1FT9 A;  4PCQ A;  2VE9 A;  1YO5 C;  4HV5 A;  2YX7 A;  4MEY F;  4UV8 A;  1U8R A;  2EFQ A;  1OYI A;  3RKW A;  4G6Q A;  4UUV A;  3HUG A;  1ON1 A;  3LA7 A;  3T1B A;  1F9N A;  4IXA A;  4L9V A;  1UFM A;  3VOE A;  4ETS A;  4IHS A;  3ELK A;  4RAY A;  6PAX A;  1WI9 A;  3ZMV A;  3R6S A;  1EH6 A;  3KFW X;  5AIQ A;  2O61 A;  2Z9O A;  4HF1 A;  2A07 F;  1S7O A;  3SHF A;  4LD5 A;  1E17 A;  1BC8 C;  4I98 B;  3E6D A;  4LLN A;  2QM3 A;  3MEX A;  2EV5 A;  3PQK A;  4LG0 A;  1K79 A;  2IVM A;  1QZZ A;  1KA8 A;  1WRJ A;  2L02 A;  4G7O F;  3LWF A;  1RNL A;  2HQR A;  2XV4 S;  1R5G A;  1K7A A;  2VBY A;  2CG4 A;  4A0Y A;  3HRM A;  3O3K A;  3BRO A;  4CYD A;  1T0F A;  5CJ9 A;  5HLH A;  2OU2 A;  2VE8 A;  1ZGA A;  4P9U A;  2IPQ X;  3V8J A;  2V1D A;  1HKT A;  4AIJ A;  1CF7 B;  2L01 A;  1B6A A;  1XGS A;  5K5Q A;  2BYV E;  2HS5 A;  3R4K A;  2ZFW A;  3L00 A;  1LEA A;  1O3S A;  2XAH A;  2IRF G;  3ZMZ A;  3RKX A;  5H6R A;  2YX4 A;  2NNY A;  2E7W A;  1LEB A;  4YFX F;  3Q9V A;  4EVI A;  3TDZ C;  5LHI A;  3JAM K;  4MNU A;  3O6B B;  3C18 A;  4BXU A;  1SMT A;  1FX7 A;  1HKS A;  1CGP A;  2PBI A;  1FY7 A;  5BQT A;  3L09 A;  2KRF A;  2GXB A;  1J59 A;  2AXL A;  5AON A;  4XSX F;  1XN7 A;  1FP2 A;  4BNC A;  3RI4 A;  2A61 A;  2PFB A;  1TLH B;  1YLF A;  3E6M A;  4OIQ F; 
#chains in the Genus database with same CATH topology
 3JRD A;  4BY1 J;  4NC8 A;  3ZN1 A;  3ERM A;  2DA7 A;  3FKI J;  2DQL A;  2K85 A;  3PM1 A;  4IEJ A;  4PJL A;  2DN0 A;  2KKO A;  2HVQ A;  1WJC A;  2NS7 A;  4A5M A;  2D45 A;  4M6Y A;  2OF7 A;  4DOZ A;  4S05 A;  3DFG A;  4Y52 J;  1TWH J;  2XGX A;  3VWB A;  4B4C A;  2NOJ B;  2VPR A;  4RGX A;  2E2I J;  5B3S H;  3HKZ A;  2QKM B;  1FWZ A;  2MFZ A;  1LQ1 A;  2LC2 A;  2W48 A;  4OIR F;  5KNL A;  2CFX A;  1OCR H;  1LFB A;  3BG7 A;  3BG3 A;  4IKF A;  3BJO A;  3K69 A;  1YOV B;  1D0Z A;  4LIV A;  4EM0 B;  1VQO I;  3CES A;  2J5O A;  3HXL A;  5LGN A;  1U5T C;  2ZNY A;  1YW7 A;  1LPQ A;  3OV8 A;  3H1C A;  4PJJ A;  1LFP A;  4OOI A;  1YJW I;  1LKX A;  3R0A A;  2EIJ H;  1FSE A;  3LSK A;  2DT5 A;  1XGO A;  2HXI A;  2B63 J;  3PSF A;  5EGO B;  2LKP A;  3HUG B;  3LSH A;  4G94 A;  4C3I J;  1BL0 A;  1YW8 A;  3AG4 H;  2G9W A;  2L9R A;  5DD4 A;  4UHT A;  3ZXS A;  3I55 I;  3LAJ A;  3S32 A;  3Q0V A;  3UR3 C;  2X51 A;  2KT0 A;  3G1O A;  1DP7 P;  3QYB A;  1VQ4 I;  4RM2 A;  4PJN A;  1E3O C;  1UEL B;  2DDA A;  3S1R J;  2JWT A;  5K1Y A;  1S9H A;  4CYC B;  3HIF A;  2OA4 A;  3JRG A;  1ZG3 A;  4DGW B;  5HNF A;  1SD5 A;  1OR7 C;  4X0G A;  4DIQ A;  3CO6 C;  1ZHF A;  2M2E A;  4RDU A;  2A6T A;  4FTH A;  2TCT A;  2O5R A;  1SD7 A;  1BI0 A;  1XC5 A;  3LSG A;  3HOX J;  4BJ6 C;  2GXA A;  3QRF F;  4LG0 B;  1XX5 A;  1BI1 A;  4RB2 C;  4L0Z B;  1K6Y A;  1QHH D;  2VC1 A;  1LE8 B;  2QYO A;  4D7N A;  5BPI A;  1UMQ A;  2XVC A;  4D7M A;  3HOT A;  1IXC A;  4AVZ A;  2EZL A;  4QSH A;  2DA4 A;  5DS9 A;  4WCG A;  3I4N J;  1X4P A;  1PUF A;  2L7Z A;  2KRH A;  2JTV A;  4Y33 A;  1I50 J;  3T8T A;  5E8G A;  3B02 A;  5C4J J;  2X6O A;  4KIB A;  5FLX Z;  1U0J A;  1JJ6 C;  1R58 A;  1UG0 A;  3FXK A;  3MZ8 A;  4L9T A;  3JRB A;  1X3W B;  3CLO A;  2R7D A;  3WHC A;  4DYC A;  1IW7 F;  1YRN B;  3QWL A;  1J2X A;  4W97 A;  3O2P E;  3C7J A;  1PJR A;  1ZTR A;  3ISP A;  2X4H A;  4GGG A;  2K9Q A;  4HSR A;  4D9J A;  1V54 H;  3H0G J;  2EB7 A;  3CZ6 A;  4XNF A;  3GME A;  1A36 A;  2YU9 J;  4XM3 A;  4XR6 A;  1TWG J;  5JFR A;  3CCJ I;  1PDN C;  1SAU A;  4I0B A;  4C9Y A;  1H88 C;  1D0X A;  3TO7 A;  3FKJ A;  2R7Q A;  4F93 B;  4QWQ A;  1A6I A;  3P9K A;  1DQU A;  2FNP A;  4KUM A;  4IQJ A;  2E2H J;  4CCM A;  2Y30 A;  2XAG A;  2ME6 A;  3V7S A;  3H3Z A;  5K7Z A;  1LDK B;  4LB6 B;  1VI0 A;  4KIT B;  4EMS A;  3ULQ B;  4M3F A;  1QU3 A;  4YRV A;  2LKS A;  1UST A;  4M9X A;  3TDU C;  4HDU A;  4D0P A;  1BR4 A;  1W1W E;  2R5Y B;  2MBF A;  3KZI C;  3FIW A;  1WJA A;  2FQ4 A;  3PFI A;  3V8L A;  3VYU B;  5D8K B;  5DDG A;  5LHH A;  2WB1 A;  1T98 A;  2ZXH A;  2GIV A;  4DYQ A;  3SYT A;  3T8R A;  4CCL A;  3F22 A;  3GTQ J;  2XRN A;  1HSJ A;  2K40 A;  2OAZ A;  2LY2 A;  2Z2S B;  2XSD C;  4HF2 A;  2PMU A;  4XN3 A;  4Z6Y A;  2WV0 A;  3S2H J;  4IRH A;  3BTI A;  3K0L A;  2XPW A;  4BXX J;  5JHU A;  2JZY A;  4A3J J;  2R7Z J;  2JVH A;  2VJI A;  4F7Z A;  3P9C A;  4K2E A;  4A6D A;  4A3K J;  4BE0 A;  2LFB A;  2FML A;  3OIQ A;  3RQ4 A;  1EKE A;  1Y6I A;  4CIC A;  2W84 A;  4ESB A;  2FSW A;  3ZN0 A;  4XLA A;  4LMY A;  1YQA A;  4GO1 A;  4P9F A;  3ZGK A;  1ZGW A;  3S14 J;  3CP2 A;  3LST A;  3ZQG A;  2VQC A;  3QU6 A;  4XN0 A;  1T56 A;  1JTY A;  1A31 A;  1UHW A;  5DUK A;  1KZH A;  2P6S A;  4Q47 A;  4ZZD A;  2O9L A;  2NYX A;  4A3I J;  1G3S A;  5D4R A;  2K9N A;  2RN7 A;  2LMD A;  2M0M A;  4FE4 A;  3CUQ B;  3BCB A;  1DU6 A;  1U6G A;  1W7P D;  3C2G A;  4L5E A;  5LGU A;  1VQM I;  1R1U A;  1MSE C;  4Q5S F;  3GVA A;  2NS0 A;  2KP6 A;  2FUG 2;  3CCQ I;  1R4N B;  2HDW A;  1GV5 A;  2DLL A;  2ETH A;  4MLO A;  4OMY A;  3BG9 A;  1GHC A;  2L7M P;  3A1Y A;  1FC3 A;  3ZMU A;  3F72 A;  3DBH B;  2DFI A;  3BTJ A;  3W3C A;  2GXG A;  2HGC A;  3DLA A;  4M6X A;  1BIA A;  4GFB A;  2CMP A;  5B1A H;  4N0B A;  1S6L A;  1RI7 A;  4IRG A;  2DFF A;  3G71 I;  3VYT B;  2NVT J;  2HPI A;  1LB2 A;  1QNT A;  3HDD A;  2Z99 A;  2JSC A;  2ZNZ A;  4WXC A;  1TWF J;  2M7A A;  3KPH A;  5L3C A;  4M3D A;  4WXD A;  2XUB A;  3EUH A;  3GUD A;  5JLW A;  2XGC A;  1T33 A;  3BTC A;  4Y4R A;  2XAS A;  1EJ9 A;  4PGG A;  4PGH A;  5ILU A;  3TBI A;  2VJJ A;  3K9T A;  3WU0 A;  3GO5 A;  1B9N A;  1X1B A;  1YYV A;  4NC6 A;  3JAM Z;  3TP3 A;  3DKY A;  3FXR A;  3S15 J;  1AOY A;  5H6Q A;  2R7U A;  1S8N A;  5HDG A;  1WI3 A;  3CTA A;  3F9K A;  1ZRC A;  2BHZ A;  2KRC A;  3NQO A;  1X19 A;  2V26 A;  5FJ8 J;  3VDX A;  2DU9 A;  5EEA A;  3K1M A;  4KA4 A;  1AKH A;  3H5A A;  3ZMT A;  3SQN A;  4HLX A;  1QVT A;  5EEH A;  4UUS A;  2K4B A;  1B4A A;  2ISY A;  4G6T B;  5HDN A;  1WJD A;  1YIT I;  1IN6 A;  3SZP A;  2LH9 A;  4E70 A;  3F6O A;  3CC2 I;  4NHJ A;  2P6T A;  2BGC A;  4XRF A;  2QUF A;  2L3D A;  1PUF B;  2XB0 X;  3FX3 A;  3NRV A;  1SFE A;  2KJC A;  3TW6 A;  1X2M A;  1Z91 A;  4AM3 A;  4II3 A;  3CCS I;  2BE5 F;  3CF2 A;  5IYC J;  3G73 A;  4LK0 F;  5ICF A;  1MNM C;  1MMG A;  2BXZ A;  5H2F C;  1DUX C;  2CFO A;  1STZ A;  3L2W A;  2LDU A;  4A3C J;  2QQA A;  2Y9Y A;  3CCM I;  3O8H A;  2VXD A;  5M3M J;  4E7H A;  3TP0 A;  2ISZ A;  1JTX A;  5FB2 A;  1XS9 A;  4BE1 A;  3IH2 A;  2FU4 A;  3ZRG A;  3GX4 X;  4RAZ A;  5LBQ A;  4OAZ A;  1G8X A;  1NHA A;  3HG9 A;  1JUM A;  3H3U A;  4LIU A;  1UHS A;  1ZRF A;  3OL3 A;  3F8C A;  1D1B A;  2HDD A;  3VYS B;  2EIM H;  1GXP A;  3I53 A;  1IO2 A;  4G7Z F;  4BJT A;  4LOC A;  2WTE A;  3E5Q A;  3QPS A;  1A04 A;  1POG A;  4YIF A;  4HAM A;  5ICE A;  5GAD J;  2EZI A;  4I09 A;  3HGY A;  4AID A;  3LNQ A;  4EGY A;  3KLN A;  5E17 F;  3RKY A;  3W6K B;  4NB5 A;  3HOS A;  3M4O J;  2KIU A;  2HNH A;  2Z3Y A;  1BOB A;  4XK4 A;  2HQN A;  1IRX A;  2H09 A;  2R7V A;  2LTP A;  2VJ4 A;  2IT0 A;  1Z0X A;  2XGD A;  2LOO A;  5D6E A;  4KMU X;  2KJB A;  3WTS C;  2IGO A;  1U78 A;  2GWR A;  1BR2 A;  2HI3 A;  4LG3 A;  3JTH A;  4A3B J;  1LDD A;  1SVL A;  5ILS A;  5LD2 C;  3OOU A;  2Y9Z A;  4BKX A;  3EPZ A;  1Y8R B;  2ZJQ F;  3S3N A;  2QQ8 A;  2Y31 A;  3MZY A;  5JVT A;  2CH0 A;  5CYV A;  2DA3 A;  1SEU A;  1W5T A;  4V19 K;  3I5U A;  4U7B A;  2KDZ A;  5ED4 A;  3PIO F;  4M71 A;  1TW2 A;  4RA2 A;  4YII A;  2QGU A;  1K6O A;  1KQ9 A;  3T5X A;  4DNC A;  3L2V A;  2MC4 A;  1XG1 A;  3S1M J;  2DOE A;  3WE2 A;  2OTJ I;  3FK7 A;  3QYE A;  3HYI A;  4ENJ A;  2ZJ2 A;  3GFL A;  3CME I;  1QGP A;  1FIP A;  3ZQL A;  3D5R C;  2WAQ N;  3NEU A;  5M5X J;  3WTV C;  2EV0 A;  1ACI A;  3L7W A;  1XMK A;  5FLX K;  1ETV A;  4HYE A;  4BQN A;  2HXO A;  1MMS A;  4IZZ A;  4WX9 A;  5CKT A;  3VFZ A;  1ONV A;  5FKO A;  2ELK A;  1HC8 A;  1FTT A;  1XDU A;  3MKW B;  3W2V A;  1Y8Q B;  4NUB A;  1ULY A;  5F0F A;  2XDV A;  1O57 A;  4EV0 A;  2QSG X;  2RV8 A;  4N4O B;  3G1L A;  4JYK A;  4CZC A;  1ZAO A;  3H5N A;  4BY7 J;  3PQJ A;  2K02 A;  1YX3 A;  3OYN A;  5IT3 A;  1HW5 A;  4Q48 A;  5ILV A;  4XRM A;  3W6J B;  1Y0N A;  3EUA A;  5LLQ A;  2OQG A;  3P9I A;  2Z1D A;  3ESW B;  3DBL B;  3GXO A;  1J5Y A;  4E7L A;  1JT0 A;  4I6Z A;  1WH5 A;  4XKV A;  1MJ9 A;  1PVE A;  2DI3 A;  2R93 J;  5LHG A;  5E3M A;  3WTY C;  1YX5 A;  2FQ3 A;  2RNJ A;  3HM5 A;  2JA2 A;  2BHY A;  5A2Q K;  4CXF A;  3AL0 C;  5IP6 A;  3K1N A;  3TO6 A;  4P1W A;  5L3B A;  4IRI A;  1R1V A;  3B6A A;  4HW0 A;  1LNW A;  1MGT A;  5F27 A;  4UUT A;  1YIO A;  2W57 A;  4AWX B;  4YFK F;  2CQ7 A;  4GXO A;  2H8R A;  5FRM A;  2QA4 I;  4UV9 A;  4NQW A;  4QPQ A;  1DPU A;  1JKQ C;  2ELJ A;  5J8F A;  4MGR A;  2QSH X;  1T08 B;  5FD5 A;  1A5J A;  1VQ5 I;  3K2A A;  4G8X A;  2P8T A;  2WB1 N;  1ZKG A;  2Q8K A;  2MSY A;  1Y0U A;  2XAF A;  3N05 A;  2DT6 A;  2NOG A;  5D5W B;  1AKH B;  2UV1 A;  4ESJ A;  1FNN A;  3KP3 A;  3AFH A;  2HTS A;  5HNH A;  5FKK A;  5C44 J;  3A0B C;  2ZB9 A;  3WU1 B;  2FBK A;  5L3F A;  3CDI A;  2O7O A;  3DPL C;  1W5S A;  4D5C A;  3BDD A;  4F3Q A;  2CQX A;  2FJ1 A;  4HLY A;  2MA3 A;  4KIF A;  1XB4 A;  4HPQ A;  2F4O B;  1BOA A;  4G12 A;  2L54 A;  1G59 A;  1GUU A;  1WJ5 A;  2XPV A;  3OIO A;  5F1J A;  1Z21 A;  3JW4 A;  4BBS J;  2PLY A;  2K7L A;  1HF0 A;  3DU6 A;  5E1Z B;  3RYP A;  3QQA A;  3S8P A;  4XLP F;  3FXO A;  3BR3 A;  5IT9 Z;  2VXZ A;  2VOO A;  2FX0 A;  3CJQ B;  4N9H A;  3PIP F;  2GLO A;  2CSO A;  2IA2 A;  2ZXJ A;  3BPX A;  2DOA A;  1RUO A;  3M07 A;  2HOT A;  3PJR A;  2BV6 A;  2R7F A;  3MAJ A;  1W36 C;  3QPT A;  3J80 Z;  4XLF A;  3OOP A;  1FBS A;  5KHD A;  3HC7 A;  2PJP A;  1IXR C;  3IWF A;  1XSV A;  1U5T A;  3ZOB A;  3J81 K;  2BY0 A;  3U21 A;  3GFI A;  3UNG C;  2VPL A;  2L9S A;  1MJA A;  4KJZ A;  1WQ2 A;  3ERE D;  2NVQ J;  3S2W A;  1Y56 A;  3V7R A;  3CF5 F;  3TGN A;  2K9S A;  5CQG A;  2R92 J;  3V7C A;  2IGM A;  3D0S A;  4HQM A;  1TT0 A;  1WWX A;  2CUF A;  2OJE D;  2F5D A;  5FFX A;  1UZC A;  4YEJ A;  1JHH A;  2RQP A;  3B73 A;  3I4P A;  3K4N A;  3LFK A;  1GXQ A;  1YE9 A;  3WG9 A;  1OCO H;  4AYB N;  4LGW A;  3TL4 X;  2UXX A;  3HOW J;  3CUO A;  2KQR A;  1P7I A;  3BPV A;  1FEX A;  2O6G E;  5K7F A;  4XQF A;  1S7E A;  4J00 A;  4B8X A;  1R7J A;  2FMY A;  3ZP5 A;  2MLG A;  1TZL A;  3L9F A;  3A4C A;  3C2B A;  3S1Q J;  1ETK A;  1D1A A;  2OCC H;  2CV0 A;  1KYW A;  1OR7 A;  1HLV A;  3OY9 A;  1FMW A;  3IL2 A;  1VQN I;  3WU2 C;  2QVO A;  1ORK A;  2VIX A;  3A03 A;  4P5O A;  5E1X A;  5H20 A;  2RNG A;  3E0J B;  5GAE J;  4IL6 C;  4PJ0 C;  4R1H A;  3CCU I;  4I7H A;  3SZG A;  1H9T A;  1T95 A;  4FX0 A;  1BR1 A;  1G3T A;  2P7V B;  5L3D A;  5TGT A;  4O3M A;  4ZYG A;  3JRE A;  3JRC A;  1RIO H;  5E18 F;  2W82 A;  3ZCO A;  2RGV A;  3KE2 A;  1IUF A;  1BC7 C;  1TL8 A;  2X6W A;  1O7F A;  4L5I A;  3ZQC A;  3LQR A;  2HVS A;  2A68 F;  3CO7 C;  1BJA A;  2L4A A;  2GA1 A;  2UWM A;  2VI6 A;  4CCO A;  2HWV A;  2DYS H;  3MKZ A;  3S3O A;  1HW1 A;  5GPC A;  4UVA A;  2D1V A;  1USS A;  5GP9 A;  4YEL A;  1L0O C;  2VBW A;  3FM5 A;  1PYV A;  3SDB A;  3MCZ A;  5FLV A;  2VKD A;  3H9Q A;  3BZC A;  2DOD A;  2V79 A;  2IW5 A;  5KK1 A;  3I59 A;  4IX7 A;  3OS2 A;  1B1B A;  2LBF A;  3G6E I;  5LGT A;  1ZR4 A;  1NH3 A;  4N9I A;  2P7C B;  2KIS A;  2V1N A;  3E6C C;  1IC8 A;  2DPU A;  2MAB A;  2NNN A;  3JSP A;  2CQK A;  2J5P A;  3V42 A;  2FD5 A;  5IP9 J;  4EJU A;  1S7A A;  2CRG A;  2FF4 A;  2ESH A;  2M8G X;  5BPD A;  1WVR A;  1I6H J;  1UHM A;  1V4R A;  2ELH A;  2XKO A;  3RCO A;  3HJE A;  5D4S A;  2JA7 J;  3GCM A;  5M5W J;  2EPF A;  1F43 A;  2ZBK A;  3DEW A;  4GYG A;  3F6V A;  1D3Y A;  4C30 A;  2F6C A;  2V6C A;  1IGN A;  5E79 C;  1I1S A;  1WPK A;  3B6C A;  4JX6 A;  2XC7 A;  1TC3 C;  3Q5F A;  2VQL A;  2RKH A;  1RC9 A;  4NQW B;  3BQZ A;  3OYI A;  4ZTF A;  1HA8 A;  3K4C A;  3RYR A;  1W0T A;  1IXS B;  1D5Y A;  4A6E A;  1BN5 A;  4Y17 A;  4IHT A;  1MIJ A;  2K27 A;  3K4J A;  1G2H A;  3WG7 H;  1Z6R A;  4OMZ A;  1MD0 A;  5IYD J;  3OMY A;  4XIC A;  1EF4 A;  4RS8 A;  3CQZ J;  2EA4 A;  1IV8 A;  1KON A;  2CUZ A;  2YPR A;  1WGX A;  2AS5 F;  4FT8 A;  5EYR A;  3PNV A;  4C3J J;  5J1R A;  3RPU A;  4A3L J;  1IRF A;  1XD7 A;  4IPA A;  3K10 A;  4OIP F;  3ZQI A;  5HOD A;  2VC0 A;  1TT5 B;  1UB9 A;  3OYD A;  5JVG F;  3V8K A;  2E1M B;  5F0H A;  3J7Z I;  3KIO A;  2EIK H;  4L9N A;  3K70 D;  2WAQ A;  2LYC A;  1R1T A;  4HX7 A;  5EZG A;  1JUS A;  2X6Y A;  4Y7N J;  2OQR A;  1BBY A;  5IOY A;  5KAI C;  1IZ1 A;  2QBY A;  4BYY A;  2AQF A;  2X48 A;  4HX4 A;  1KU7 A;  5CVI A;  3L2Q A;  4XLC A;  1HQC A;  2DK5 A;  4HV6 A;  2WAE A;  1SFU A;  4DZJ A;  2CWE A;  2R0Q C;  2DMQ A;  4WWC A;  2IA0 A;  1XPX A;  1OYY A;  1WJE A;  2V6E A;  2Y0S A;  1MBK A;  1BW5 A;  1EA3 A;  3DF8 A;  4FE7 A;  3U2R A;  2TDX A;  3GWZ A;  5JHF A;  5HLI A;  5DV5 A;  1JHF A;  4YG2 F;  1RUN A;  3OYK A;  2XHK A;  3BOQ A;  3AKZ A;  4MFE A;  1P9Q C;  2EFP A;  4L18 B;  3HRU A;  4HNT A;  2DW4 A;  1U5T B;  2P4W A;  5L3G A;  1BW6 A;  3JCU C;  3OS0 A;  1E0E A;  1I3A A;  1Z9C A;  1B59 A;  2LK2 A;  2QEN A;  3CUQ C;  2RDP A;  3IAM 2;  2DMT A;  4P96 A;  3LA2 A;  2X1D A;  4E7K A;  4AU7 A;  4BDZ A;  5A2Q Z;  1JUP A;  4IOA F;  1L3L A;  4YFN F;  3AAF A;  2H6B A;  5FO5 A;  2WAD A;  1VQ8 I;  3CMM A;  5EDN A;  3M8E A;  3I0T A;  2EFW A;  2DOF A;  3RPQ A;  2DMU A;  2V9V A;  3IC7 A;  4A3G J;  3VYR B;  4Y3O A;  5EG0 A;  3JRH A;  3FIS A;  1JJ8 C;  2VKE A;  1WJB A;  3REO A;  3KP4 A;  3WE3 A;  4ZDO A;  2CGP A;  2K3P A;  1G6N A;  3J7A Y;  3H36 A;  5IPA A;  1DDN A;  5HOO A;  2BVL A;  2HFH A;  2O03 A;  3GTM J;  4DW6 A;  3WTT C;  2E7X A;  4B09 A;  2H1K A;  4I2O A;  2IXS A;  3PUF A;  2DPD A;  3Q3S A;  3L1P A;  3CJT B;  3QAH A;  1JT6 A;  1TQP A;  3HPH A;  2JRM A;  1S29 A;  4DBR A;  4KYW A;  2GQQ A;  1R36 A;  1MH4 A;  4BHP A;  1Z05 A;  5CVR A;  3HGG A;  5E1W A;  1SAX A;  3CCL I;  3GTL J;  2R7W A;  4BQO A;  1ERD A;  3F8F A;  2F4I A;  5DUI A;  4U88 A;  2G7H A;  3BLY A;  2UUZ A;  2EV6 A;  3FHZ A;  4JK1 X;  3ABT A;  5IT9 K;  2DAO A;  2R7T A;  1VQ9 I;  2IJL A;  4H0E A;  4O5V A;  5ICC A;  1QPI A;  2DMP A;  2VON A;  4EQQ A;  2CW7 A;  1GT0 C;  3RZO J;  4DJA A;  3W6V A;  4XMY A;  2GA2 A;  3CCV I;  1MZB A;  3J80 K;  1K4T A;  5BS6 A;  3I59 B;  2VUM J;  2Q1Z B;  2BZT A;  3LA3 A;  5E3O A;  4U0Y A;  3IUO A;  2LBF B;  1MNE A;  2CV1 A;  1DP3 A;  2L0K A;  4F52 A;  4ZTJ A;  2XAU A;  3U9G A;  3KX2 A;  3L2R A;  1N75 A;  2PN6 A;  3HB9 A;  3BR1 A;  2O3F A;  3E97 A;  5FD6 A;  3J81 Z;  2ZME C;  2KIF A;  4GCV A;  4CCK A;  2JUG A;  1R5I D;  2FA5 A;  3OYG A;  3ZPL A;  3E5U A;  1QO0 D;  3EET A;  4XOR A;  1WH7 A;  3LAP A;  2M8E A;  3EDP A;  5J4Y A;  2JT1 A;  4P55 A;  1FMV A;  2FRH A;  4CUG A;  1I3Q J;  5F64 A;  1LVA A;  1NG6 A;  1QA6 A;  1LJ9 A;  2NVU B;  2ZKZ A;  3F8B A;  1FOW A;  3SFZ A;  4AYB A;  4D5F A;  3N97 A;  3DBR B;  3EUK L;  2IBD A;  2FE3 A;  2KIQ A;  4JOM A;  3PUB A;  3C1D A;  1ZK8 A;  5KVR A;  2HR3 A;  3ZQQ A;  5BNG A;  2E71 A;  3BR2 A;  1FSH A;  3OSF A;  1JKR C;  1IV6 A;  2ZSI B;  2M5W A;  4C3H J;  4NDL A;  2F4M B;  1ZN2 A;  4DZP A;  4ASN A;  2OZ6 A;  4OU0 A;  3OS1 A;  5IY5 H;  2RC4 A;  2B9S A;  1GVJ A;  4LJZ F;  3SXY A;  2STT A;  3V4G A;  2AO9 A;  5GTI C;  4RLQ A;  1JE8 A;  1F1Z A;  3ABU A;  2MLK A;  1OQY A;  2CUE A;  3FM3 A;  3G3Z A;  1IF1 A;  1PP8 F;  1N78 A;  2HPM A;  1RPW A;  3MMY B;  5EF6 A;  3CD6 I;  4C2T A;  2DXI A;  2ADU A;  4WF2 A;  4I76 A;  1GV2 A;  2G0E A;  4L0Y B;  3K7A J;  2I5U A;  5J1Y A;  3L2C A;  1LDJ A;  3AG3 H;  2JSP A;  2X1E A;  2QBY B;  2M9H A;  1YTY A;  3KP7 A;  2XRL A;  3IH3 A;  4FHT A;  3TKY A;  4PFO A;  4BJ5 C;  2EFN A;  3DKW A;  2F2E A;  2BY3 A;  1HDD C;  3COA C;  1YS7 A;  2GOX B;  2A3S A;  2B7E A;  2HTJ A;  1IRG A;  2NRA C;  1ETY A;  1P92 A;  4XLN F;  3BJ6 A;  5E3L A;  1VF9 A;  3OIP A;  5E3N A;  3CCR I;  4C2M J;  1QQI A;  1WHU A;  4XLE A;  5TRD A;  3H9G A;  1FYK A;  3AG1 H;  4IO9 F;  3DPU A;  2UZK A;  1OCC H;  1YIJ I;  1ZG1 A;  4M72 A;  2M4G A;  2M3A A;  3CMY A;  1N77 A;  1OYW A;  2ZC2 A;  4BQA A;  2LRD A;  1EV7 A;  2EJR A;  2LNB A;  1WKM A;  2V9P A;  2VBX A;  2XF7 A;  1HST A;  3QOP A;  4R79 A;  5F1R A;  3S16 J;  1TP4 A;  2R5Z A;  4KN4 X;  2FEZ A;  3IWZ A;  1K78 A;  3SFI A;  3TOA A;  1DGR M;  4HNU A;  3ABL H;  3K4B A;  1ITY A;  2CQQ A;  1OIS A;  2XF5 A;  1MMD A;  1I1G A;  1FJL A;  2GBY A;  3IHU A;  2NVX J;  5IYB J;  2OC6 A;  1RZ4 A;  3KET A;  2JRT A;  4A2U A;  2Z5U A;  2HYF A;  5CVV A;  4E7J A;  2VJ5 A;  3RQI A;  4QTR A;  2E1O A;  4OAY A;  2L7K A;  1V3F A;  3DU5 A;  3GTJ J;  3OYB A;  2OZU A;  1V55 H;  2DCE A;  5EZH A;  5EG0 B;  4F55 A;  1Z1D A;  5IOZ A;  2EZH A;  5J1U A;  3WTZ A;  1XDS A;  3CCY A;  4ENM A;  2M4K A;  2PEX A;  3FXU A;  1PUE E;  2IEK A;  3Q9S A;  3GW2 A;  1YW9 A;  2YR2 A;  1HDP A;  3FHN A;  2W25 A;  2VL8 A;  2KL4 A;  1TWA J;  4BL0 B;  2OD5 A;  3F23 A;  3KCC A;  3VB2 A;  3KYD B;  2HU9 A;  3DQV C;  3K4M A;  5FFZ A;  3GZ6 A;  1D5V A;  1Z6T A;  3K4L A;  1BI3 A;  1UCR A;  2LSO A;  5J47 A;  4PSW A;  4ESF A;  5DYM A;  2DBB A;  2FOW A;  3DXJ F;  4ZH4 F;  1Z7U A;  5LRR A;  1W4M A;  2LY9 A;  5FRO A;  2KMU A;  4KN7 X;  2ACJ A;  4M3B A;  3RJP A;  1WCM J;  1O3T A;  5DD8 A;  5LEJ A;  2DTZ A;  3IKV A;  2VT2 A;  4II2 A;  4LK1 F;  4W1U A;  4LFU A;  3FZV A;  1IG7 A;  1BIB A;  4A3D J;  2CQN A;  1ZH5 A;  4HX8 A;  4ENK A;  1CQT A;  2ME0 A;  2Y0S N;  3F21 A;  2V1X A;  5CQE A;  2P5L C;  3PNY A;  5D5V B;  1VQP I;  3T0Y A;  4EGZ A;  3ECO A;  2Y48 A;  3FF5 A;  4M6V A;  4BHB A;  4E7I A;  2H1L A;  2V9K A;  1W36 D;  1XSX A;  5D6F A;  2XAQ A;  3TED A;  5DCM A;  1P4X A;  1BM9 A;  1IJW C;  3LOC A;  4FET A;  2H6C A;  5KAF C;  2ZJP F;  2MGQ A;  1H89 C;  3ECH A;  2JPC A;  4BBR J;  2RAE A;  1BI2 A;  3DEE A;  3DTE A;  1MMA A;  3GZ5 A;  1M1E B;  3BY6 A;  1SAN A;  4CHU A;  1H9G A;  4PUS A;  4ZYD A;  1HKQ A;  1QBJ A;  2DA2 A;  3WTU C;  3OYM A;  4IOC F;  4UVB A;  1I27 A;  2VOP A;  3RIR A;  2JN6 A;  4DQ2 A;  4LIT A;  3E1S A;  1X1C A;  3CJN A;  2HZD A;  3QPH A;  3DV8 A;  2PG4 A;  3WOD F;  4EJW A;  3LMM A;  5K5O A;  3AG2 H;  3MD2 A;  1P4A A;  2FBI A;  3J7Y J;  1JGS A;  1JGG A;  1Y1V J;  3K2Z A;  5BOX A;  4ZZL A;  4UUS B;  3S2D J;  4I01 A;  4HA8 A;  1K4S A;  2OV7 A;  4PK4 A;  2IS1 A;  5HS8 A;  3E3V A;  4L9J A;  2ZJR F;  3S17 J;  2YS9 A;  2IP2 A;  4QLC U;  1LUJ B;  3IH4 A;  3FXL A;  2W7N A;  3OYC A;  2Z16 A;  2EH3 A;  3GTP J;  4EM1 A;  4MTD A;  1KQ8 A;  3ZQH A;  4KNY A;  5DM7 F;  2FOK A;  1SVO A;  4FQG A;  2XSJ C;  1N25 A;  2IAI A;  2F5V A;  4XL9 A;  1U3E M;  1ZR2 A;  4WXH A;  3SZT A;  3GFJ A;  1A35 A;  4MQV A;  4AUX A;  1W0U A;  3MWM A;  4UNO A;  1X3U A;  3JRA A;  3K4K A;  4HOB A;  3HOV J;  1R5H A;  4IHX A;  5D5U B;  3BR0 A;  1FLI A;  1OPC A;  3IAS 2;  3G2B A;  3KP5 A;  4NC7 A;  4HG2 A;  4PJM A;  3KP2 A;  1FPQ A;  2M1B A;  3ASO H;  3KLO A;  3W2W A;  4G9Y A;  4I0A A;  1GDT A;  2BW3 A;  3TMO A;  1KQ0 A;  1OLT A;  3ASN H;  3PFY A;  3MKL A;  2WWY A;  2IS2 A;  3TOB A;  3H0D A;  2MD5 A;  2R5Z B;  3HEF A;  2PMZ N;  3OYF A;  1QZY A;  3RKQ A;  2ESN A;  2ZCW A;  1K78 B;  2WY7 Q;  3LSI A;  5ERI A;  3TW7 A;  3WTX C;  2STW A;  2DFH A;  2NVY J;  2LY1 A;  2QLZ A;  3AL0 B;  2O8X A;  2H94 A;  1J9I A;  3MQ0 A;  4RAF A;  4RGS A;  1S3J A;  1IUY A;  5F04 A;  2WAF A;  2LVS A;  3E5X A;  1D0Y A;  2XGE A;  2L9V A;  1XGM A;  1ZRD A;  4QPO A;  2EFO A;  3DP7 A;  4MFD A;  4EEF G;  3ONQ A;  2X85 A;  4AD9 A;  4DBQ A;  2OPT A;  1IN8 A;  9ANT A;  3VOD A;  4I02 A;  3QYF A;  1JKO C;  2WC2 A;  3G1M A;  5FKL A;  1VQ6 I;  1REP C;  1ENH A;  2D5V A;  3H35 A;  3HOZ J;  4ZJZ A;  2L4M A;  3HZJ A;  2DDB A;  3F0C A;  2BBY A;  2VAS A;  4CGZ A;  5HDK A;  1R9T J;  1X58 A;  1P4W A;  2GZW A;  2GAU A;  2VLA A;  1MDM A;  3BJA A;  1T2K A;  3GFM A;  2R3S A;  2PX9 A;  4EAT A;  2ZXW H;  3HSF A;  1IN7 A;  2QZ8 A;  1UJ8 A;  1B9M A;  1E2X A;  4MHG A;  2M87 A;  3ZQ7 A;  2K86 A;  2W4S A;  3Q0W A;  2OTL I;  4F91 B;  2X6X A;  3IKT A;  3I3L A;  4JQF A;  1MBH A;  1PP7 U;  1G4D A;  3I4M J;  4BE2 A;  5CLS A;  3PNT A;  2MW8 A;  5J8C A;  3ZMD A;  3R61 A;  3HTS B;  4XOP A;  2DA5 A;  1H0M A;  2O0Y A;  4U0W A;  5CVU A;  4ITV A;  1YG2 A;  1RRJ A;  5FKM A;  3N4M A;  3WGH A;  2Y69 H;  1V5F A;  1KU9 A;  3QOE A;  1G3Y A;  4X1E A;  2PJR A;  1TQM A;  1GLN A;  5FGM A;  5BMZ A;  3OYH A;  2A6E F;  2XIG A;  3OL4 A;  4A0Z A;  2K4J A;  3A01 A;  4UXN A;  1FBU A;  1T6S A;  2DQR A;  4M73 A;  4LB5 A;  2C6Y A;  2XRO A;  1T0F C;  1B8I A;  4HST A;  4HNV A;  2VOD A;  4XON A;  3KZY A;  4A12 A;  3CUQ A;  5DCM B;  2IGN A;  1MSF C;  4H4K C;  1UG2 A;  3G4S I;  3CJR B;  3DTI A;  2E1N A;  1OCZ H;  5CPR B;  3OR1 C;  3HBL A;  3BG5 A;  2KZV A;  3JSO A;  4GRI A;  3LSJ A;  2G7U A;  4RAG A;  3IV5 A;  2PQ8 A;  1SMY F;  4KMF A;  3NWS A;  1MW7 A;  4HZF A;  2HOE A;  2ECC A;  4XID A;  5LRS A;  4BEH A;  4E7Z A;  1SC7 A;  4RB3 C;  1RET A;  4B3X A;  5TJJ A;  4TV7 A;  2TRT A;  5GPA A;  2JQ7 A;  4OIN F;  3M8F A;  5GAH J;  1D8K A;  2CU7 A;  4B48 A;  4FX4 A;  4DYR A;  1JKP C;  2OCE A;  3C2H A;  2DJI A;  3ML6 A;  2EBI A;  1ZAR A;  4IHW A;  3WHB A;  2E1C A;  1JXS A;  4Z2Y A;  1AHD P;  4BXF A;  1MMN A;  2A69 F;  5JI6 A;  2HQ5 A;  1KU2 A;  4U7D A;  1XSD A;  1V5G A;  2M0C A;  3Q0U A;  3I64 A;  2FXA A;  4HF0 A;  3X2Q H;  5C3E J;  1F4K A;  1K83 J;  3RSN A;  1B72 A;  2E60 A;  4FAS D;  2COM A;  1IRZ A;  1D8J A;  4AIK A;  2L5Q A;  2MD0 A;  2DFE A;  3CDH A;  2E5N A;  3OR2 C;  3RPU D;  2DYR H;  2F5E A;  1YI2 I;  2AQE A;  3WGI A;  4IQ4 A;  1SD6 A;  3LFU A;  2HYG D;  2JJ7 A;  4R8H A;  3D1N I;  3IRR A;  1TWC J;  3BCA A;  4JBA A;  4CDG A;  2FBH A;  5GTH C;  4HDV A;  3R0J A;  4M9Z A;  4UB6 C;  3I58 A;  1U8B A;  1V5E A;  1RES A;  2QWW A;  4ZDL A;  4CA0 A;  2MC3 A;  3KEO A;  1ODD A;  2E5Z A;  2KLO A;  3KYC B;  1OKR A;  1EH7 A;  1E3H A;  2M34 A;  3I54 A;  4D1Q A;  3A2K A;  2NAZ A;  2P5V A;  3H5R A;  1MBG A;  1Q1V A;  2BW3 B;  1F36 A;  4ENN A;  4OIO F;  2R7S A;  2ZME A;  1ETQ A;  5J4V A;  3WGG A;  3QU3 A;  1P6R A;  3EQL F;  4V2F A;  1X2N A;  3FMR A;  5JR3 A;  1FZP B;  2LR8 A;  1YFH A;  2QF7 A;  4KIS A;  4CCJ A;  1JI8 A;  1ZRE A;  3NWT A;  1W5C C;  2QSF X;  1HCR A;  1FOK A;  2LRE A;  3BP8 A;  4O6J A;  1FTZ A;  2R7X A;  1IN5 A;  4HEA 2;  5D8L B;  1R4M B;  4ZDP A;  5J6X A;  3HSR A;  3HTU A;  3M9A A;  4IF4 A;  4NNJ A;  3DPT A;  4CO8 A;  3GZN B;  2X0L A;  2BEO A;  3JR9 A;  1O3Q A;  1QZE A;  2ID6 A;  1NG7 A;  4A5N A;  2JA5 J;  5HLT A;  2A5Y B;  3KEQ A;  2D2W A;  3ROU A;  4BH9 A;  2VN2 A;  3RTR A;  2CJJ A;  3LSP A;  4FCY A;  4KDP A;  3VEP A;  2RQQ A;  3ABM H;  3OYJ A;  4OWR B;  5HS7 A;  2F5F A;  4KIG A;  2QQB A;  4G6D A;  4RM3 A;  1XMX A;  2Z33 A;  1I5Z A;  3WTW C;  4ON0 A;  4BHC A;  4YIR X;  2I8D A;  3GEZ A;  1MDM B;  2MH9 A;  3M8J A;  4FIS A;  3JTG A;  1HBX G;  2L2O A;  4UB8 C;  2XB5 A;  4M74 A;  4UVC A;  3M1E A;  4V2G A;  3LQQ A;  2EQR A;  2MH2 A;  2H27 A;  4G7H F;  4JP0 A;  5JLX A;  2DK8 A;  2CW0 F;  2LG4 A;  1X4O A;  2WBM A;  1XCV A;  1TTY A;  3K70 C;  4BUP A;  1C0W A;  5LEK A;  3BG6 A;  1I6X A;  1T8I A;  1Z7L A;  4EJT A;  1J75 A;  1TW3 A;  1R22 A;  1MBF A;  1X3Z B;  1R71 A;  2ICW G;  2QEX I;  3BZK A;  1U2W A;  3MFK A;  5M3F J;  2CO5 A;  1U9O A;  2D1H A;  3GF2 A;  2I10 A;  3FWE A;  4AIH A;  2A5W A;  2RVC A;  2K3F A;  2BXY A;  1OFC X;  3M7G A;  4Y15 A;  2KPM A;  2K5C A;  2L7F P;  2PJR B;  3EYI A;  4PFP A;  1W7P A;  5ICG A;  4A0X A;  2PI0 A;  2JK3 A;  3TQN A;  3MVP A;  4JX5 A;  3A01 B;  1FYL A;  3F3X A;  3F8M A;  3HRT A;  2COB A;  1TNS A;  3L2U A;  2VQH A;  1IDZ A;  2LP0 A;  2LKX A;  1HW2 A;  3J7A O;  1B8I B;  2ZSH B;  3UKG A;  1EH8 A;  2PMZ A;  3R60 A;  4KIC A;  2HEO A;  1FIA A;  4HRI A;  3KZZ A;  2KIM A;  4M9S A;  4XKW A;  2E35 A;  2B0L A;  3I56 I;  4XKC A;  4XRS G;  2YU3 A;  3BR6 A;  3QOD A;  2HQA A;  3KEY A;  4XBF A;  3QP5 A;  2HKO A;  2Q0O A;  3JRF A;  5FLM J;  3FBI B;  1QHG A;  1ETO A;  3CP8 A;  3GBG A;  2DT7 B;  4M3G A;  2LLK A;  5FKN A;  4RMN A;  1FYM A;  4BAC A;  2VBZ A;  4BEH B;  1IAW A;  4WK8 F;  1VQK I;  4Y13 A;  2NS8 A;  2EK5 A;  3F8N A;  1NTC A;  4ABZ A;  1AA7 A;  4GYI A;  4ZYH A;  2OBP A;  5CVJ A;  3H92 A;  5B5E C;  3FBN B;  2VKH A;  4GDF A;  4I99 C;  1MJB A;  3E6B A;  3EYY A;  4U0V A;  3I71 A;  1P7J A;  2XAJ A;  1XCB A;  3FMS A;  4NBQ A;  2GM4 A;  2EZK A;  2ZO4 A;  3SDG A;  4Q4Z F;  1IN4 A;  3FMQ A;  2IS4 A;  4EJO A;  2LF8 A;  3KP6 A;  3VSK A;  4MIM A;  4AVP A;  1P2F A;  3ZMS A;  1J0R A;  2FNA A;  4RGR A;  3H3V K;  2MG4 A;  2JPB A;  1VND A;  4N4N B;  4RGU A;  4XOT A;  1DPR A;  1ZLJ A;  5DEQ A;  3TO9 A;  2F48 A;  1OCP A;  4A3F J;  3HSE A;  1B72 B;  1VZ0 A;  2ZFU A;  1KGS A;  1T39 A;  1ZG5 A;  4LLL A;  2AXT C;  5LFA A;  2HKX A;  3DKX A;  3RDI A;  2HZT A;  1HXD A;  3HOY J;  2BOL A;  2XF6 A;  1A6Q A;  2HYJ A;  5HLG A;  1R23 A;  3A02 A;  1RKT A;  5HVQ C;  2K9M A;  3BZ6 A;  3K6G A;  2JUC A;  4CSW A;  1NK2 P;  1TQI A;  1O7L A;  3FXJ A;  3P5J A;  4IJA A;  5F08 A;  4BGD A;  2V1U A;  1O4X A;  4B47 A;  1KU3 A;  5D5X B;  4BAY A;  4S04 A;  4HQE A;  1Y1W J;  3BC8 A;  1QPM A;  1KYZ A;  1R6R A;  1WSU A;  1ZEL A;  3DLL F;  4J01 A;  2CYY A;  2WA0 A;  2KFD A;  5E20 A;  1APL C;  2W85 A;  3SJM A;  1YS6 A;  4X6A J;  2ZME B;  4BQQ A;  1ZYR F;  4MO7 A;  1ON2 A;  3QP6 A;  2H8W A;  2IA1 A;  3D5L A;  1YHQ I;  3HRS A;  4PSX A;  2DA1 A;  2HOS A;  2M7B A;  2JVG A;  5DCF A;  1XGN A;  1VTN C;  3MN2 A;  4E4H A;  5F0C A;  3GTO J;  3HKZ N;  3DEU A;  3GYH X;  2MYS A;  3RZD J;  2GIZ A;  4HBL A;  1TNT A;  5B1B H;  3C3W A;  1QRY A;  3FXM A;  2X9D A;  5M5Y J;  3HOU J;  4ZYA A;  3FXQ A;  3S1N J;  1RKW A;  2Q2E A;  4RBO A;  3BWG A;  2GOM A;  3DCF A;  1S5L C;  2JMW A;  1CF7 A;  5AIP A;  4MEX F;  1TBX A;  4MQ9 F;  3W2A A;  4B43 A;  2IGK A;  2EWN A;  1Z77 A;  2K9L A;  2BVM A;  1MKM A;  1LFU P;  2Y75 A;  1OMI A;  1XMA A;  1FBQ A;  3NAR A;  4KFC A;  4KT6 A;  3VSL A;  2P5K A;  1ZLK A;  5HS9 A;  3PO3 J;  2E19 A;  2PMH A;  1Y39 A;  4S0H B;  1G3W A;  3EUH C;  4XSZ F;  3IRQ A;  2A6H F;  4LLG F;  4CZZ A;  4EJV A;  5K5R A;  1WZ2 A;  1R00 A;  2W24 A;  2M30 A;  5FRN A;  2XKP A;  5EEG A;  3P7N A;  4PDK A;  2R7R A;  1BJZ A;  3U1D A;  1F5T A;  1J09 A;  4RB1 A;  3GLX A;  3MZH A;  3ZQF A;  1GVD A;  2VT3 A;  2HDC A;  1ETW A;  4ZYE A;  3K1P A;  2XPU A;  1VQ7 I;  5F6F A;  1O3R A;  2JA8 J;  3O8G A;  1Q1H A;  2DTR A;  4XRS A;  2YSR A;  1OCT C;  1UAA A;  1SFO J;  3CLQ A;  1K61 A;  2R7O A;  4MTE A;  3ABK H;  3BTL A;  5B66 C;  1SVM A;  1RR8 C;  1MBJ A;  3QPL A;  2EA2 A;  3CDL A;  2QQ9 A;  4KT5 C;  2CW8 A;  4ZC3 A;  2Y0M A;  3SEZ A;  3KYL A;  4CH7 A;  1J7K A;  3M1C A;  3ZR8 X;  1HOM A;  1ZGJ A;  4A3E J;  1DU0 A;  4CCN A;  2A05 A;  2X1C A;  1W7P B;  4QIW N;  4A93 J;  1AU7 A;  3PSI A;  1X1A A;  4F92 B;  3OWT A;  3HL2 A;  2DO7 A;  2E2J J;  4EM2 A;  2DMN A;  3HHH A;  1AWC A;  3SEQ A;  4L5J A;  4IHY A;  3S3M A;  5L3E A;  2UXN A;  1SD4 A;  2DA6 A;  4IVN A;  4PZJ A;  1FP1 D;  3HHG A;  5E8I A;  2LF7 A;  3OSG A;  4RB0 A;  1SFX A;  2HVR A;  1T38 A;  2M45 A;  2F5C A;  3GTK J;  1FT9 A;  3E7L A;  4U87 A;  3CCE I;  4PCQ A;  4J19 A;  2VE9 A;  1YO5 C;  4HV5 A;  2YX7 A;  2EIL H;  4M3E A;  4MEY F;  4UV8 A;  4ANJ A;  1U8R A;  1VQL I;  1RR7 A;  1YJN I;  2IS6 A;  1OJL A;  2EFQ A;  2KZG A;  1OYI A;  3S93 A;  2VKV A;  3RKW A;  5J40 A;  2WY8 Q;  4G6Q A;  1MBE A;  4UUV A;  5EGO A;  3HUG A;  1ON1 A;  3LA7 A;  3T1B A;  1XTA A;  1F9N A;  4IXA A;  2R4G A;  1NK3 P;  4L9V A;  5DTD A;  1UFM A;  3VOE A;  4ETS A;  4IHS A;  4UY8 I;  2QKL B;  5DM6 F;  4A69 C;  3ELK A;  3I9V 2;  4RAY A;  3FDY A;  2L9N A;  4IHV A;  1FOY A;  6PAX A;  1WI9 A;  3ZMV A;  3BR5 A;  2NXN B;  3R6S A;  1EH6 A;  4CYC A;  1WFX A;  3KFW X;  2CUJ A;  2N8G A;  5AIQ A;  2KHM A;  2O61 A;  4B3A A;  3CMA I;  1X1P A;  3A0H C;  2P81 A;  2Z9O A;  4HF1 A;  2A07 F;  2DJN A;  1S7O A;  3D5S C;  1WJF A;  3SHF A;  4LD5 A;  1FOX A;  1E17 A;  2E36 A;  2KDO A;  1BC8 C;  3GTG J;  4I98 B;  3E6D A;  4LLN A;  2QM3 A;  3LL7 A;  3MEX A;  2EV5 A;  3PQK A;  4LG0 A;  1K79 A;  2IVM A;  2O8K A;  1QZZ A;  3OYL A;  1KA8 A;  1WRJ A;  1LE8 A;  4BS9 A;  1VFC A;  5C4X J;  2L02 A;  4G7O F;  4E6K G;  1Z67 A;  2VB6 A;  3LWF A;  1RNL A;  2HQR A;  3OYE A;  2XV4 S;  5IP7 J;  1R5G A;  1K7A A;  2VBY A;  4AC0 A;  3LSR A;  5K7H A;  3NAU A;  2CG4 A;  4A0Y A;  3HRM A;  2Y2Z A;  3O3K A;  5KCM A;  3CC7 I;  3BRO A;  4CYD A;  1S72 I;  1BA5 A;  2EIN H;  3BT9 A;  2W1O A;  4C2U A;  1T0F A;  5CJ9 A;  1YRN A;  2CS3 A;  4BU2 A;  5HLH A;  2OU2 A;  2VE8 A;  1ZGA A;  4JX4 A;  4P9U A;  3BQY A;  3H9J A;  4B44 A;  3OYA A;  2ECB A;  2IPQ X;  1E3P A;  3V8J A;  4A3M J;  2W00 A;  4RLF A;  2E34 A;  3M3Y J;  2V7F A;  2Q2E B;  2V1D A;  4B1R A;  1HKT A;  1YJ9 I;  4AIJ A;  2OUM A;  1DGW Y;  3FK6 A;  2L01 A;  1CF7 B;  5J3L A;  4E7S A;  1B6A A;  1XGS A;  5K5Q A;  2BYV E;  2HOA A;  2HS5 A;  3R4K A;  1SFK A;  2ZFW A;  3PL8 A;  3L00 A;  1ETX A;  1LEA A;  1O3S A;  2AHQ A;  4XLH A;  2XAH A;  2WV1 A;  3MKY B;  2IRF G;  3ZMZ A;  3IP4 B;  3RKX A;  2LD5 A;  5H6R A;  1IDY A;  3LSM A;  4BDY A;  5EJC A;  2YX4 A;  3DWL E;  2V4J C;  2NNY A;  2E7W A;  1LEB A;  4YFX F;  3Q9V A;  1D1C A;  1QVU A;  1MND A;  4EVI A;  1LVK A;  3U1K A;  2CV2 A;  2R5Y A;  3VPR A;  2BY2 A;  3TDZ C;  5LHI A;  1Z3Y A;  3JAM K;  1I39 A;  1Z3X A;  3O6B B;  4MNU A;  1X1D A;  2ID3 A;  3C18 A;  3CC4 I;  2QCO A;  4BXU A;  1SMT A;  5TIS C;  2BY1 A;  1FX7 A;  1HKS A;  3GLL A;  1CGP A;  2PBI A;  2JA6 J;  3HPG A;  1FY7 A;  5BQT A;  3PO2 J;  2ZXI A;  3L09 A;  2KRF A;  2GXB A;  1J59 A;  2AXL A;  5GAG J;  5AON A;  4XSX F;  1U9N A;  1H8A C;  3JRI A;  1XN7 A;  1R49 A;  1MH3 A;  1FP2 A;  4BNC A;  4XKB A;  3RI4 A;  2VQG A;  3DTK A;  1ZQ3 P;  2E1M C;  2A61 A;  2PFB A;  1TLH B;  1YLF A;  3E6M A;  2RRE A;  2YUS A;  2P0W A;  4OIQ F; 
#chains in the Genus database with same CATH homology
 3ZN1 A;  2DQL A;  2KKO A;  2D45 A;  4A5M A;  4M6Y A;  4S05 A;  3DFG A;  2XGX A;  4RGX A;  1LQ1 A;  1FWZ A;  4OIR F;  2CFX A;  3BJO A;  3K69 A;  4EM0 B;  2J5O A;  5LGN A;  1U5T C;  2ZNY A;  1YW7 A;  3OV8 A;  4OOI A;  3R0A A;  1FSE A;  2DT5 A;  1XGO A;  2LKP A;  4G94 A;  1YW8 A;  2G9W A;  5DD4 A;  4UHT A;  3LAJ A;  1DP7 P;  5K1Y A;  3HIF A;  2OA4 A;  1ZG3 A;  1SD5 A;  3CO6 C;  1ZHF A;  1SD7 A;  1BI0 A;  3QRF F;  4LG0 B;  1BI1 A;  4RB2 C;  4L0Z B;  2VC1 A;  2QYO A;  5BPI A;  2XVC A;  3HOT A;  1IXC A;  4WCG A;  2JTV A;  3T8T A;  5E8G A;  3B02 A;  4KIB A;  5FLX Z;  1R58 A;  4L9T A;  3CLO A;  2R7D A;  1IW7 F;  1J2X A;  3O2P E;  3C7J A;  3ISP A;  2X4H A;  4GGG A;  2EB7 A;  5JFR A;  1PDN C;  4I0B A;  3TO7 A;  4QWQ A;  3P9K A;  2FNP A;  4KUM A;  2XAG A;  3V7S A;  3H3Z A;  1LDK B;  4LB6 B;  4EMS A;  3ULQ B;  1UST A;  4M9X A;  3TDU C;  4HDU A;  4D0P A;  2MBF A;  3PFI A;  3V8L A;  5D8K B;  5DDG A;  5LHH A;  1T98 A;  2GIV A;  3T8R A;  3F22 A;  2XRN A;  1HSJ A;  2OAZ A;  4HF2 A;  2PMU A;  2WV0 A;  4IRH A;  3K0L A;  5JHU A;  2JZY A;  4F7Z A;  3P9C A;  4K2E A;  4A6D A;  2FML A;  4CIC A;  2W84 A;  4ESB A;  2FSW A;  3ZN0 A;  4LMY A;  1YQA A;  4GO1 A;  4P9F A;  3LST A;  3QU6 A;  1UHW A;  5DUK A;  4ZZD A;  2P6S A;  4Q47 A;  2NYX A;  1G3S A;  5D4R A;  2RN7 A;  3CUQ B;  1U6G A;  1W7P D;  5LGU A;  1R1U A;  4Q5S F;  3GVA A;  2NS0 A;  2DLL A;  2ETH A;  4OMY A;  1GHC A;  1FC3 A;  3ZMU A;  3F72 A;  2DFI A;  2GXG A;  2HGC A;  4M6X A;  1BIA A;  4N0B A;  1S6L A;  1RI7 A;  4IRG A;  1LB2 A;  1QNT A;  2Z99 A;  2JSC A;  2ZNZ A;  4WXC A;  5L3C A;  4WXD A;  2XUB A;  3EUH A;  3GUD A;  2XAS A;  4PGG A;  4PGH A;  5ILU A;  3K9T A;  3WU0 A;  3GO5 A;  1B9N A;  1YYV A;  3JAM Z;  3FXR A;  1AOY A;  5H6Q A;  1S8N A;  5HDG A;  3CTA A;  1ZRC A;  3NQO A;  2DU9 A;  3K1M A;  4KA4 A;  3ZMT A;  3SQN A;  4HLX A;  5EEH A;  2K4B A;  1B4A A;  2ISY A;  5HDN A;  1IN6 A;  3SZP A;  4E70 A;  3F6O A;  4NHJ A;  2P6T A;  2BGC A;  4XRF A;  2QUF A;  2L3D A;  3FX3 A;  3NRV A;  1SFE A;  2KJC A;  1Z91 A;  2BE5 F;  3G73 A;  4LK0 F;  5ICF A;  1DUX C;  1STZ A;  2LDU A;  2QQA A;  2ISZ A;  5FB2 A;  2FU4 A;  3GX4 X;  4RAZ A;  5LBQ A;  1NHA A;  3H3U A;  1ZRF A;  3F8C A;  1GXP A;  3I53 A;  4G7Z F;  2WTE A;  3E5Q A;  1A04 A;  4YIF A;  4HAM A;  5ICE A;  4I09 A;  4EGY A;  3KLN A;  5E17 F;  3RKY A;  3W6K B;  4NB5 A;  3HOS A;  2KIU A;  2Z3Y A;  2HQN A;  2H09 A;  2IT0 A;  5D6E A;  4KMU X;  2KJB A;  3WTS C;  1U78 A;  2GWR A;  3JTH A;  1LDD A;  5ILS A;  5JVT A;  3MZY A;  5CYV A;  1W5T A;  3I5U A;  4U7B A;  5ED4 A;  4M71 A;  1TW2 A;  4YII A;  1K6O A;  1KQ9 A;  3T5X A;  4DNC A;  3WE2 A;  3HYI A;  4ENJ A;  2ZJ2 A;  3GFL A;  1QGP A;  3NEU A;  3WTV C;  2EV0 A;  3L7W A;  1XMK A;  5FLX K;  4HYE A;  4WX9 A;  3VFZ A;  1ONV A;  1XDU A;  1ULY A;  1O57 A;  4EV0 A;  2RV8 A;  1ZAO A;  3PQJ A;  2K02 A;  5IT3 A;  1HW5 A;  4Q48 A;  5ILV A;  3W6J B;  5LLQ A;  2OQG A;  3P9I A;  3GXO A;  1J5Y A;  1MJ9 A;  2DI3 A;  5LHG A;  3WTY C;  2FQ3 A;  2RNJ A;  5A2Q K;  4CXF A;  3K1N A;  3TO6 A;  5L3B A;  4IRI A;  1R1V A;  4HW0 A;  1LNW A;  1MGT A;  1YIO A;  2W57 A;  4AWX B;  4YFK F;  4GXO A;  4UV9 A;  4NQW A;  1DPU A;  5J8F A;  4MGR A;  5FD5 A;  4G8X A;  2P8T A;  2Q8K A;  1Y0U A;  2XAF A;  5D5W B;  4ESJ A;  1FNN A;  3KP3 A;  2HTS A;  3WU1 B;  2FBK A;  5L3F A;  3DPL C;  1W5S A;  3BDD A;  4HLY A;  2MA3 A;  4KIF A;  1XB4 A;  1BOA A;  2L54 A;  3JW4 A;  2PLY A;  2K7L A;  5E1Z B;  3RYP A;  4XLP F;  5IT9 Z;  2VXZ A;  2VOO A;  4N9H A;  2CSO A;  2IA2 A;  2ZXJ A;  3BPX A;  1RUO A;  2BV6 A;  2R7F A;  3MAJ A;  3QPT A;  3J80 Z;  3OOP A;  1FBS A;  2PJP A;  1IXR C;  3IWF A;  1XSV A;  1U5T A;  3J81 K;  3GFI A;  1MJA A;  1WQ2 A;  3ERE D;  3S2W A;  3V7R A;  3TGN A;  3V7C A;  3D0S A;  4HQM A;  1WWX A;  2F5D A;  5FFX A;  1JHH A;  2RQP A;  3B73 A;  3I4P A;  3LFK A;  1GXQ A;  3WG9 A;  4LGW A;  2UXX A;  3CUO A;  3BPV A;  2O6G E;  4B8X A;  1R7J A;  2FMY A;  3ZP5 A;  2MLG A;  3L9F A;  1KYW A;  1OR7 A;  3IL2 A;  2QVO A;  5E1X A;  4P5O A;  5H20 A;  4R1H A;  4I7H A;  1H9T A;  4FX0 A;  1G3T A;  2P7V B;  5L3D A;  4O3M A;  4ZYG A;  1RIO H;  5E18 F;  2RGV A;  3KE2 A;  1BC7 C;  1O7F A;  4L5I A;  3LQR A;  2A68 F;  3CO7 C;  1BJA A;  2L4A A;  2GA1 A;  2UWM A;  2HWV A;  1HW1 A;  4UVA A;  2D1V A;  1USS A;  1L0O C;  2VBW A;  3FM5 A;  3MCZ A;  2V79 A;  2IW5 A;  5KK1 A;  3I59 A;  1B1B A;  5LGT A;  4N9I A;  2P7C B;  3E6C C;  2DPU A;  2NNN A;  3JSP A;  2CQK A;  2J5P A;  4EJU A;  1S7A A;  2FF4 A;  2ESH A;  5BPD A;  1UHM A;  1V4R A;  2ELH A;  2XKO A;  5D4S A;  2ZBK A;  4GYG A;  3F6V A;  1D3Y A;  2V6C A;  1I1S A;  3Q5F A;  2RKH A;  3RYR A;  1IXS B;  4A6E A;  1BN5 A;  4Y17 A;  4IHT A;  2K27 A;  1Z6R A;  4OMZ A;  1MD0 A;  4RS8 A;  2EA4 A;  2YPR A;  2AS5 F;  4FT8 A;  3RPU A;  1IRF A;  1XD7 A;  4IPA A;  4OIP F;  2VC0 A;  1UB9 A;  3V8K A;  4L9N A;  1R1T A;  4HX7 A;  2OQR A;  1BBY A;  1IZ1 A;  2QBY A;  4BYY A;  4HX4 A;  1KU7 A;  5CVI A;  1HQC A;  2DK5 A;  4HV6 A;  1SFU A;  2CWE A;  4WWC A;  2IA0 A;  1OYY A;  3DF8 A;  3U2R A;  2TDX A;  3GWZ A;  5HLI A;  5DV5 A;  1JHF A;  4YG2 F;  1RUN A;  2XHK A;  3BOQ A;  2EFP A;  4L18 B;  3HRU A;  2DW4 A;  1U5T B;  2P4W A;  5L3G A;  1Z9C A;  1B59 A;  2QEN A;  3CUQ C;  2RDP A;  4P96 A;  3LA2 A;  5A2Q Z;  1L3L A;  4YFN F;  3AAF A;  2H6B A;  5FO5 A;  3M8E A;  3I0T A;  2EFW A;  3RPQ A;  2V9V A;  3IC7 A;  3REO A;  3KP4 A;  3WE3 A;  2CGP A;  1G6N A;  1DDN A;  5HOO A;  2HFH A;  2O03 A;  3WTT C;  2E7X A;  4B09 A;  4I2O A;  2DPD A;  3QAH A;  1TQP A;  4KYW A;  1S29 A;  2GQQ A;  1R36 A;  4BHP A;  1Z05 A;  5CVR A;  5E1W A;  1SAX A;  3F8F A;  5DUI A;  4U88 A;  2G7H A;  2EV6 A;  3FHZ A;  4JK1 X;  3ABT A;  5IT9 K;  2DAO A;  2IJL A;  4H0E A;  4O5V A;  5ICC A;  2VON A;  4EQQ A;  2GA2 A;  1MZB A;  3J80 K;  5BS6 A;  3I59 B;  3LA3 A;  4U0Y A;  3U9G A;  2PN6 A;  2O3F A;  3E97 A;  5FD6 A;  3J81 Z;  2KIF A;  4GCV A;  2FA5 A;  3ZPL A;  3E5U A;  1QO0 D;  3EET A;  3LAP A;  2M8E A;  3EDP A;  2JT1 A;  4P55 A;  2FRH A;  5F64 A;  1LVA A;  1LJ9 A;  2ZKZ A;  3F8B A;  3SFZ A;  3N97 A;  2FE3 A;  3C1D A;  5KVR A;  2HR3 A;  1FSH A;  2M5W A;  1ZN2 A;  4ASN A;  2OZ6 A;  4OU0 A;  2RC4 A;  1GVJ A;  4LJZ F;  3SXY A;  2STT A;  3V4G A;  1JE8 A;  1F1Z A;  2MLK A;  3ABU A;  3FM3 A;  3G3Z A;  1IF1 A;  1PP8 F;  2ADU A;  4WF2 A;  4L0Y B;  3L2C A;  1LDJ A;  2QBY B;  1YTY A;  3KP7 A;  4FHT A;  3TKY A;  3DKW A;  2EFN A;  2F2E A;  3COA C;  1YS7 A;  2A3S A;  2HTJ A;  1IRG A;  2NRA C;  1P92 A;  4XLN F;  3BJ6 A;  1QQI A;  5TRD A;  1FYK A;  2UZK A;  1ZG1 A;  4M72 A;  4BQA A;  1OYW A;  1EV7 A;  2EJR A;  2LNB A;  1WKM A;  2VBX A;  3QOP A;  5F1R A;  1HST A;  4R79 A;  4KN4 X;  2FEZ A;  3IWZ A;  1K78 A;  3TOA A;  1I1G A;  3IHU A;  1RZ4 A;  3KET A;  2JRT A;  4A2U A;  2Z5U A;  2HYF A;  5CVV A;  1V3F A;  2OZU A;  1Z1D A;  3WTZ A;  1XDS A;  4ENM A;  2PEX A;  3FXU A;  1PUE E;  3Q9S A;  3GW2 A;  1YW9 A;  2YR2 A;  2W25 A;  2OD5 A;  3F23 A;  3KCC A;  3VB2 A;  3DQV C;  5FFZ A;  3GZ6 A;  1D5V A;  1Z6T A;  1BI3 A;  1UCR A;  2LSO A;  4ESF A;  5DYM A;  2DBB A;  3DXJ F;  4ZH4 F;  1Z7U A;  5LRR A;  1W4M A;  4KN7 X;  2ACJ A;  3RJP A;  1O3T A;  5DD8 A;  5LEJ A;  3IKV A;  2VT2 A;  4LK1 F;  4LFU A;  3FZV A;  1BIB A;  1ZH5 A;  4HX8 A;  4ENK A;  3F21 A;  2V1X A;  2P5L C;  5D5V B;  3T0Y A;  4EGZ A;  3ECO A;  2Y48 A;  3FF5 A;  4BHB A;  1XSX A;  5D6F A;  2XAQ A;  5DCM A;  1P4X A;  1BM9 A;  2H6C A;  3ECH A;  2JPC A;  1BI2 A;  3GZ5 A;  3BY6 A;  4CHU A;  1H9G A;  4ZYD A;  1HKQ A;  1QBJ A;  3WTU C;  4UVB A;  1I27 A;  2VOP A;  3RIR A;  4DQ2 A;  3CJN A;  3QPH A;  3DV8 A;  2PG4 A;  3WOD F;  4EJW A;  5K5O A;  1P4A A;  2FBI A;  1JGS A;  3K2Z A;  5BOX A;  4ZZL A;  4I01 A;  4HA8 A;  5HS8 A;  3E3V A;  4L9J A;  2IP2 A;  4QLC U;  4EM1 A;  4MTD A;  1KQ8 A;  4KNY A;  2FOK A;  1U3E M;  4WXH A;  3SZT A;  3GFJ A;  4MQV A;  3MWM A;  4UNO A;  1X3U A;  4HOB A;  1R5H A;  5D5U B;  1FLI A;  1OPC A;  3KP5 A;  3KP2 A;  1FPQ A;  2M1B A;  3KLO A;  4G9Y A;  4I0A A;  1KQ0 A;  2WWY A;  3TOB A;  2MD5 A;  1QZY A;  2ESN A;  2ZCW A;  1K78 B;  5ERI A;  3WTX C;  2STW A;  2QLZ A;  2O8X A;  2H94 A;  1J9I A;  3MQ0 A;  4RGS A;  1S3J A;  1IUY A;  3E5X A;  1XGM A;  1ZRD A;  2EFO A;  3DP7 A;  4AD9 A;  1IN8 A;  3VOD A;  4I02 A;  2WC2 A;  1REP C;  2L4M A;  2BBY A;  4CGZ A;  5HDK A;  1P4W A;  2GZW A;  2GAU A;  1MDM A;  3BJA A;  1T2K A;  3GFM A;  2R3S A;  3HSF A;  1IN7 A;  2QZ8 A;  1B9M A;  1E2X A;  4MHG A;  2M87 A;  3ZQ7 A;  2K86 A;  3IKT A;  4JQF A;  1PP7 U;  1G4D A;  5CLS A;  5J8C A;  3ZMD A;  3R61 A;  3HTS B;  1H0M A;  2O0Y A;  4U0W A;  5CVU A;  1YG2 A;  3N4M A;  3WGH A;  1KU9 A;  1G3Y A;  1TQM A;  5FGM A;  5BMZ A;  2A6E F;  2XIG A;  4A0Z A;  2K4J A;  4UXN A;  1FBU A;  1T6S A;  2DQR A;  4M73 A;  4LB5 A;  2C6Y A;  2XRO A;  2VOD A;  3KZY A;  4A12 A;  3CUQ A;  5DCM B;  2E1N A;  3JSO A;  2G7U A;  2PQ8 A;  1SMY F;  4KMF A;  4HZF A;  2HOE A;  5LRS A;  4RB3 C;  5TJJ A;  4TV7 A;  4OIN F;  3M8F A;  1D8K A;  4FX4 A;  3ML6 A;  1ZAR A;  2E1C A;  1JXS A;  4Z2Y A;  5JI6 A;  2A69 F;  1KU2 A;  4U7D A;  1XSD A;  3I64 A;  2FXA A;  4HF0 A;  1F4K A;  2COM A;  1D8J A;  4AIK A;  3CDH A;  2F5E A;  3WGI A;  1SD6 A;  2HYG D;  4R8H A;  3IRR A;  4JBA A;  4CDG A;  2FBH A;  4HDV A;  3R0J A;  4M9Z A;  3I58 A;  2QWW A;  2MC3 A;  3KEO A;  1ODD A;  1OKR A;  1EH7 A;  3I54 A;  2NAZ A;  2P5V A;  4ENN A;  4OIO F;  2ZME A;  3WGG A;  3QU3 A;  1P6R A;  3EQL F;  3FMR A;  5JR3 A;  1FZP B;  1YFH A;  1ZRE A;  1FOK A;  3BP8 A;  4O6J A;  1IN5 A;  5D8L B;  5J6X A;  3HSR A;  3HTU A;  3M9A A;  4IF4 A;  3DPT A;  4CO8 A;  2X0L A;  2BEO A;  1O3Q A;  4A5N A;  2A5Y B;  3KEQ A;  2D2W A;  3ROU A;  4BH9 A;  2VN2 A;  3RTR A;  4KDP A;  3VEP A;  5HS7 A;  2F5F A;  4KIG A;  2QQB A;  4G6D A;  2Z33 A;  1I5Z A;  3WTW C;  4ON0 A;  4BHC A;  3GEZ A;  1MDM B;  2MH9 A;  3JTG A;  1HBX G;  4M74 A;  4UVC A;  3M1E A;  3LQQ A;  2MH2 A;  2H27 A;  4G7H F;  2DK8 A;  2CW0 F;  1XCV A;  1TTY A;  1C0W A;  5LEK A;  1I6X A;  4EJT A;  1J75 A;  1TW3 A;  1R22 A;  1U2W A;  3MFK A;  2CO5 A;  2D1H A;  3GF2 A;  3FWE A;  4AIH A;  2RVC A;  3M7G A;  4Y15 A;  3EYI A;  1W7P A;  5ICG A;  4A0X A;  2PI0 A;  3TQN A;  1FYL A;  3F3X A;  3F8M A;  3HRT A;  1TNS A;  1HW2 A;  3J7A O;  1EH8 A;  3R60 A;  4KIC A;  2HEO A;  3KZZ A;  2KIM A;  4M9S A;  2B0L A;  2YU3 A;  4XBF A;  3QP5 A;  2HKO A;  2Q0O A;  1FYM A;  2VBZ A;  1IAW A;  4WK8 F;  4Y13 A;  2EK5 A;  3F8N A;  4GYI A;  4ZYH A;  2OBP A;  5CVJ A;  3H92 A;  1MJB A;  3E6B A;  3EYY A;  4U0V A;  3I71 A;  2XAJ A;  1XCB A;  3FMS A;  2ZO4 A;  4Q4Z F;  1IN4 A;  3FMQ A;  4EJO A;  2LF8 A;  3KP6 A;  4AVP A;  1P2F A;  3ZMS A;  1J0R A;  2FNA A;  4RGR A;  2JPB A;  3TO9 A;  4RGU A;  1DPR A;  1ZLJ A;  5DEQ A;  3HSE A;  1KGS A;  1T39 A;  1ZG5 A;  4LLL A;  2HKX A;  3RDI A;  2HZT A;  1HXD A;  5HLG A;  1R23 A;  5HVQ C;  3BZ6 A;  1TQI A;  1O7L A;  4IJA A;  2V1U A;  1KU3 A;  5D5X B;  4BAY A;  4S04 A;  4HQE A;  1QPM A;  1KYZ A;  1WSU A;  2CYY A;  5E20 A;  2W85 A;  1YS6 A;  2ZME B;  1ZYR F;  1ON2 A;  3QP6 A;  2IA1 A;  3D5L A;  3HRS A;  5DCF A;  1VTN C;  1XGN A;  3DEU A;  3GYH X;  4HBL A;  1TNT A;  3C3W A;  3FXQ A;  2Q2E A;  3BWG A;  1CF7 A;  5AIP A;  4MEX F;  1TBX A;  4MQ9 F;  2EWN A;  1MKM A;  2Y75 A;  1OMI A;  1XMA A;  1FBQ A;  4KFC A;  2P5K A;  1ZLK A;  5HS9 A;  2PMH A;  1G3W A;  4XSZ F;  3IRQ A;  2A6H F;  4EJV A;  4LLG F;  4CZZ A;  5K5R A;  1R00 A;  2W24 A;  2M30 A;  2XKP A;  5EEG A;  3P7N A;  4PDK A;  3U1D A;  1F5T A;  4RB1 A;  3MZH A;  3GLX A;  2VT3 A;  2HDC A;  4ZYE A;  3K1P A;  5F6F A;  1O3R A;  1Q1H A;  2DTR A;  2YSR A;  4MTE A;  2EA2 A;  2QQ9 A;  4KT5 C;  2Y0M A;  1J7K A;  1ZGJ A;  1W7P B;  2DO7 A;  4EM2 A;  3HHH A;  1AWC A;  4L5J A;  5L3E A;  2UXN A;  1SD4 A;  4IVN A;  4PZJ A;  1FP1 D;  3HHG A;  5E8I A;  2LF7 A;  4RB0 A;  1SFX A;  1T38 A;  2M45 A;  2F5C A;  1FT9 A;  4PCQ A;  2VE9 A;  1YO5 C;  4HV5 A;  2YX7 A;  4MEY F;  4UV8 A;  1U8R A;  2EFQ A;  1OYI A;  3RKW A;  4G6Q A;  4UUV A;  3HUG A;  1ON1 A;  3LA7 A;  3T1B A;  1F9N A;  4IXA A;  4L9V A;  1UFM A;  3VOE A;  4ETS A;  4IHS A;  3ELK A;  4RAY A;  6PAX A;  1WI9 A;  3ZMV A;  3R6S A;  1EH6 A;  3KFW X;  5AIQ A;  2O61 A;  2Z9O A;  4HF1 A;  2A07 F;  1S7O A;  3SHF A;  4LD5 A;  1E17 A;  1BC8 C;  4I98 B;  3E6D A;  4LLN A;  2QM3 A;  3MEX A;  2EV5 A;  3PQK A;  4LG0 A;  1K79 A;  2IVM A;  1QZZ A;  1KA8 A;  1WRJ A;  2L02 A;  4G7O F;  3LWF A;  1RNL A;  2HQR A;  2XV4 S;  1R5G A;  1K7A A;  2VBY A;  2CG4 A;  4A0Y A;  3HRM A;  3O3K A;  3BRO A;  4CYD A;  1T0F A;  5CJ9 A;  5HLH A;  2OU2 A;  2VE8 A;  1ZGA A;  4P9U A;  2IPQ X;  3V8J A;  2V1D A;  1HKT A;  4AIJ A;  1CF7 B;  2L01 A;  1B6A A;  1XGS A;  5K5Q A;  2BYV E;  2HS5 A;  3R4K A;  2ZFW A;  3L00 A;  1LEA A;  1O3S A;  2XAH A;  2IRF G;  3ZMZ A;  3RKX A;  5H6R A;  2YX4 A;  2NNY A;  2E7W A;  1LEB A;  4YFX F;  3Q9V A;  4EVI A;  3TDZ C;  5LHI A;  3JAM K;  4MNU A;  3O6B B;  3C18 A;  4BXU A;  1SMT A;  1FX7 A;  1HKS A;  1CGP A;  2PBI A;  1FY7 A;  5BQT A;  3L09 A;  2KRF A;  2GXB A;  1J59 A;  2AXL A;  5AON A;  4XSX F;  1XN7 A;  1FP2 A;  4BNC A;  3RI4 A;  2A61 A;  2PFB A;  1TLH B;  1YLF A;  3E6M A;  4OIQ F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...