5IYDJ

Human core-pic in the initial transcribing state (no iis)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iydJ00
5M5XJ 2DA7A 1LFBA 4A3EJ 5JLXA 5FKMA 2K9NA 4ABZA 2EQRA 2ME6A 4XK4A 2ZB9A 3JR9A 1MBFA 3G1LA 2XGEA 3HM5A 4XRSA 4IHWA 1SFOJ 2TRTA 2K40A 3MN2A 5F0HA 2X9DA 4DZJA 2HQ5A 4NDLA 3FISA 3IH4A 3NARA 3TP3A 3HBLA 5EEAA 1QPIA 2DA3A 4JP0A 2R7ZJ 2XRLA 3QQAA 2XSDC 3OIOA 1AHDP 4C2MJ 1BW5A 2YU9J 2ME0A 5FKLA 5EYRA 1RETA 1LE8B 4IHYA 3BR6A 1MBHA 2R5ZA 3HGGA 2ID6A 2G0EA 2OF7A 5C3EJ 1Z0XA 4XRSG 5F04A 1B8IA 1U9OA 4DYQA 5IP7J 3S14J 5IPAA 3RZOJ 1F43A 4W1UA 4BXXJ 2MW8A 1JTXA 4A3CJ 2JJ7A 5EF6A 4M3BA 2VUMJ 2R5YA 2DA1A 2MSYA 2CU7A 1T33A 2HOAA 5K7HA 2JA8J 2DA2A 4DZPA 2B63J 3SFIA 5IOZA 1ETYA 4UUSA 2NVTJ 3Q3SA 1IRZA 1OCPA 1HDPA 5F0CA 1T56A 5E3MA 1JTYA 3BR2A 2EZIA 4B4CA 3MKLA 1QVTA 2H1KA 2XGCA 4JX4A 2DMNA 4JYKA 1Y1WJ 3A01B 2L9RA 2M34A 2L7MP 2E2IJ 5F08A 1JKQC 2L0KA 2LD5A 2COBA 1VNDA 2NS7A 1NK3P 4Y52J 2DMTA 1E3OC 4JX5A 5E3LA 4V2FA 2IEKA 3E7LA 4A69C 3VPRA 1Z77A 1OJLA 2LVSA 5J1YA 1QVUA 1QRYA 3BT9A 3C2BA 3LSGA 3WHBA 1SANA 4X6AJ 3L1PA 1W0TA 4XRMA 2FQ4A 3A02A 2JWTA 2XPWA 2EH3A 3FKIJ 3QPSA 2CUEA 1S7EA 3JRBA 3BTIA 1WH7A 3WHCA 4QSHA 1K61A 2ECBA 3IH2A 3FK6A 1B72B 5IYDJ 3BR5A 1H89C 2NVYJ 3BQYA 5EG0A 1ZQ3P 1P7IA 2DA6A 2WAQN 1AKHB 2K9QA 1FTZA 5FLMJ 4FE4A 1F36A 1G2HA 1AKHA 3S2HJ 1LE8A 4BBSJ 4A3FJ 5IYCJ 4FISA 3HOYJ 2KT0A 2PMZN 1ZK8A 1B72A 3OOUA 3BG5A 2KDZA 4DW6A 1X2NA 1JUPA 3LSRA 3S15J 5E3NA 5M5WJ 1HCRA 3S2DJ 2Y9YA 2N8GA 2R0QC 4GFBA 2YUSA 1WPKA 2DA4A 2WV1A 4A3JJ 4C3JJ 3Q0UA 3S1MJ 2LY9A 1NTCA 2JMWA 2Y31A 1ETWA 2ELKA 3ZQGA 2DN0A 2R92J 1POGA 2JA5J 3M4OJ 1CQTA 1ETKA 5GP9A 2R93J 1I3QJ 5IOYA 1ETVA 2DA5A 4BY7J 4A3GJ 3D1NI 5FKKA 4A3MJ 1IGNA 5E3OA 2Y0SN 3I4MJ 4UUSB 1FTTA 2M9HA 3SDGA 1VI0A 1AU7A 1FIPA 4A3LJ 2L7FP 3ZQHA 2Y30A 4AUXA 3NAUA 5EDNA 5DS9A 3FIWA 1RKTA 4IHXA 1O4XA 4A3BJ 1VFCA 2AHQA 1W0UA 2JN6A 3B6CA 4FCYA 4A93J 3ZOBA 1D5YA 3DCFA 5JLWA 5FKNA 2XB0X 1ORKA 1MNMC 2HOSA 1GUUA 2DJNA 1JGGA 3GBGA 2TCTA 3BTJA 5F1JA 1ZGWA 1HOMA 4V2GA 3GTGJ 1I50J 4A3DJ 4RDUA 1APLC 1TWFJ 3O8GA 4M3DA 3LNQA 1BL0A 4J19A 3GTJJ 3BTCA 2CUFA 1MSFC 1X58A 3JRGA 2EBIA 4B3AA 5FLVA 1IUFA 2X6OA 2NOGA 5FKOA 2HYJA 3HEFA 1ZKGA 1XC5A 3BTLA 2JA6J 3CMYA 2HXOA 3K7AJ 1VF9A 3O8HA 2H8RA 2HDDA 1WCMJ 1K83J 3TW6A 2XPVA 5GPAA 1JJ6C 4MLOA 3HOXJ 5J1RA 2HI3A 1IDZA 3CQZJ 4G12A 3JRAA 4X1EA 5F27A 1XS9A 1MBGA 3S16J 1A6IA 5EGOB 3TW7A 2XB5A 5IYBJ 2EZKA 5K7ZA 5IP6A 3S1RJ 2QCOA 1OFCX 3LSJA 2Y2ZA 4EEFG 1XG1A 2LTPA 1BA5A 5J1UA 3Q0VA 2FD5A 1JKOC 3HB9A 1TWCJ 1TC3C 2IAIA 4BKXA 2AO9A 3GTOJ 2P81A 3BR0A 3GTMJ 3BR3A 1I6HJ 1ETOA 3ZQIA 9ANTA 4DYCA 2IBDA 2NS8A 1TWHJ 1YRNA 3S1NJ 3DEWA 1B8IB 1MH3A 1JT6A 1ZTRA 3IH3A 5BNGA 2LFBA 5M3FJ 4IEJA 1JJ8C 3BG3A 2NVQJ 5DTDA 1JKRC 2R5YB 1Q1VA 2ECCA 4QIWN 5C44J 5J3LA 4MIMA 4HNVA 2JK3A 1DU0A 3A03A 1IDYA 3HOWJ 3GTPJ 4M3EA 2HXIA 1GDTA 2O8KA 1WH5A 3ZQCA 3QPLA 1P7JA 3S17J 5F0FA 4D7MA 2ID3A 1TWAJ 2VKVA 1MH4A 1BJZA 4CYCA 3HOUJ 2VKEA 2XPUA 4XICA 4QTRA 4BBRJ 2EZLA 3PM1A 4W97A 5FJ8J 3IV5A 1HDDC 3Q0WA 2GBYA 4I76A 3JRDA 3BQZA 3SJMA 1ZR4A 2XGDA 2CJJA 3GTLJ 1U78A 2E1OA 4MFEA 2E2JJ 4XIDA 1JKPC 1RR7A 5K7FA 1H8AC 1Y1VJ 2NVXJ 4BY1J 4FE7A 3UKGA 1MBJA 4S0HB 1U8BA 1X2MA 1NK2P 3JREA 2R5ZB 3HGYA 5C4XJ 2X48A 1GV2A 2CQXA 4Y7NJ 5EG0B 1PUFB 3JRIA 3G1OA 3I4NJ 1RKWA 2W48A 5EZGA 1TWGJ 1EF4A 2L7ZA 3LSPA 2M8GX 5GPCA 3H0GJ 1FJLA 3FK7A 1JT0A 4FTHA 3HOZJ 3GTKJ 4AC0A 1MBEA 4D5FA 3GTQJ 3LOCA 5IP9J 1RPWA 3CCYA 1ZR2A 2VI6A 4RBOA 3HKZN 3TEDA 1BW6A 3JRHA 2JA7J 3BG9A 3BR1A 1LFUP 4A3IJ 1GV5A 3OSGA 4CYCB 2GM4A 3S1QJ 3HOVJ 5EZHA 4AYBN 1PUFA 1R9TJ 3K2AA 3ZQLA 2OPTA 1UHSA 2GLOA 3OSFA 1MBKA 1IJWC 4UUTA 4L5EA 2VPRA 4MFDA 3MVPA 3A01A 1YRNB 2QF7A 1DU6A 3PO3J 3B6AA 2DTZA 5M3MJ 3F0CA 1IC8A 3M3YJ 1OCTC 1A5JA 2CRGA 4I6ZA 2YS9A 1WI3A 1HF0A 2DMPA 4C3IJ 1JUMA 2HOTA 1GVDA 3RZDJ 2O7OA 2LK2A 4D7NA 1WGXA 3G1MA 2I10A 2EZHA 3RKQA 3H3VK 5HODA 1UG2A 4DYRA 4M3FA 2O9LA 2WB1N 4MO7A 2DMQA 1FIAA 1MSEC 1FEXA 2CQQA 1U9NA 4C3HJ 3RQIA 5C4JJ 4IHVA 3W6VA 3TP0A 4A3KJ 2MGQA 1UMQA 2LLKA 2M0CA 2LP0A 5M5YJ 5EGOA 2M2EA 2DMUA 2K9SA 3CDLA 1ETQA 2D5VA 2MG4A 2LKXA 1ENHA 4JX6A 2E2HJ 4D5CA 4M3GA 1H88C 2E19A 1IG7A 2LR8A 3JRFA 3HDDA 1JUSA 1HLVA 3PO2J 1ETXA 4M6VA 2RAEA 1RESA 2FJ1A 2FX0A 1ITYA 3ZQFA 4B1RA 2Y9ZA 1IV6A 4LOCA 1GT0C 3JRCA
chains in the Genus database with same CATH superfamily
1RR8C 5M5XJ 2ELJA 2Q2EB 2HPMA 3ZN0A 5D5WB 2K9NA 4ABZA 1LDKB 4UB6C 3JR9A 3AL0B 4AWXB 3G1LA 2XGEA 1YI2I 1UZCA 3HG9A 2W4SA 2A5YB 5F0HA 3WE3A 2E1CA 3I4PA 2HQ5A 1UAAA 4I01A 4MHGA 4NDLA 2EIMH 2DPDA 3FISA 5EEAA 3I71A 2FBIA 2M8EA 3REOA 4S05A 2R7ZJ 2XRLA 2X1DA 4JQFA 5A2QZ 1AWCA 1E0EA 3LA3A 1AHDP 4C2MJ 1DGWY 2CQNA 1IN5A 2CW7A 1RETA 4IHYA 2PJPA 3HHHA 3H5AA 3K1NA 3HOTA 4RA2A 3CCEI 1Z0XA 2DYRH 3R60A 3TQNA 2K4BA 5F04A 2QSHX 1FP2A 2CMPA 3RZOJ 2ZXIA 3W6JB 3NEUA 2K7LA 4DJAA 1H9TA 2WY7Q 5ICGA 2HEOA 2Z1DA 2CO5A 1Z3YA 2GIZA 3KEQA 2HDWA 1NG7A 1LDJA 1E17A 3FF5A 1MMAA 2XAUA 1W1WE 4OWRB 1XGNA 3QOEA 1J75A 4CGZA 1V5FA 3I53A 4P1WA 2DA2A 4DZPA 2MD5A 3Q3SA 3OV8A 1OCPA 1IN6A 1HDPA 2GQQA 2KZVA 3K69A 1Y56A 3EQLF 5F0CA 1BC7C 2XUBA 5BOXA 2XV4S 2K86A 4E6KG 3MKLA 1QVTA 2H1KA 3PNTA 4MEYF 4OINF 5GAEJ 4CCMA 4JYKA 1VQKI 2PBIA 4EJWA 2M34A 2L7MP 2KIMA 1LVKA 5F08A 1Y39A 1JKQC 3V8LA 4I99C 1IRXA 2K02A 2NS7A 3H1CA 3WTUC 2H94A 3MKYB 1B9MA 1NK3P 4Y52J 3J7ZI 5CVUA 1T39A 2IEKA 3W3CA 2QUFA 4F93B 1IN4A 4C2TA 1OISA 1Z77A 2WWYA 3BZKA 2V1UA 2RKHA 2DQRA 3C2BA 4WXHA 3F72A 4LLLA 3WHBA 4A0YA 1H0MA 3UNGC 2BV6A 4X6AJ 2LYCA 4XRMA 3CC4I 2FQ4A 2WBMA 2EH3A 3LQQA 3RQ4A 1ZG3A 3BTIA 4M9XA 3WHCA 2EFNA 2ECBA 3JTGA 3OR1C 3FK6A 4NC6A 1SMTA 2K4JA 4XKVA 1G3YA 3BR5A 1ZQ3P 1P7IA 2R7QA 5FFXA 2WAQN 2A6TA 4C2UA 1ULYA 2DOFA 4PJ0C 1LE8A 2KIFA 4HA8A 3GX4X 1D8JA 2BW3B 1YFHA 1E3PA 2JA2A 4II3A 2B7EA 1ZK8A 2PMZN 1B72A 1H9GA 3CC7I 1M1EB 3CMAI 3BJ6A 3BG5A 4L9VA 4DW6A 3SZPA 3IKVA 2M0MA 3S15J 5E3NA 4F91B 3LWFA 3X2QH 4HQEA 3S2DJ 2R7UA 4A6DA 2JPCA 4OMYA 2BHYA 3NWTA 1WPKA 2K3PA 3E97A 1TP4A 2XIGA 2FBKA 2BY0A 2LY9A 1NTCA 2JMWA 1ETWA 3E5QA 4J01A 2R92J 2L3DA 2HQNA 1O7LA 1QQIA 1CQTA 4MGRA 2BXYA 1ETKA 1Z6RA 2MC4A 4RS8A 5TGTA 4BACA 2Z9OA 2BW3A 4ENKA 4KDPA 2BY3A 3RYRA 1U8RA 1ETVA 1BBYA 2DA5A 2HYGD 4IHSA 5FKKA 1YW7A 4O3MA 4EMSA 4LB5A 3V7SA 2LREA 2ZBKA 3CCMI 1MDMB 3ZQHA 3G71I 2VL8A 5ICCA 2QQ8A 4ESBA 1FY7A 3GZ6A 1R5HA 3COAC 3ERMA 3QYEA 4U0YA 2V7FA 3BZ6A 3DKWA 3JW4A 4IHXA 1J59A 1LDDA 2DI3A 3MMYB 2IS4A 5FLXZ 1W0UA 3F8FA 1B9NA 4G6TB 1F1ZA 3CF5F 4U0VA 2R7FA 1TL8A 2X1CA 4PZJA 5JLWA 3AAFA 1MNMC 2HOSA 3JSPA 3K1PA 2DJNA 2TDXA 1XX5A 3V8KA 2ESHA 3HJEA 2BY1A 3T8TA 4V2GA 3K10A 2FOWA 4KITB 4A3DJ 1WWXA 1TWFJ 1Z67A 2FUG2 2GOXB 4M3DA 3LNQA 1BL0A 3GTJJ 3BTCA 1MSFC 1SFUA 1XMKA 5KNLA 3JRGA 4B3AA 4AM3A 2ZJPF 5CVRA 5DUKA 2L5QA 5LRRA 5FLVA 2X6OA 1I1GA 2NOGA 3T5XA 3CC2I 2XAHA 4E4HA 2KKOA 2CWEA 2F4IA 4AYBA 1V3FA 3C1DA 4A12A 2VT3A 2HU9A 4HOBA 2CH0A 5E1ZB 1FNNA 3A1YA 5FLXK 2K9LA 1MNEA 5J1RA 1OQYA 1IDZA 3I56I 2BOLA 4R1HA 4RLQA 4EM1A 4BXFA 4L0YB 3S16J 1A6IA 3HSEA 4UY8I 2XB5A 1EKEA 4AIDA 1I39A 5IP6A 3S1RJ 3I3LA 5LRSA 2Y2ZA 2RNGA 3L2QA 1XG1A 4M71A 4BDZA 4WF2A 5J1UA 3Q0VA 5BQTA 1WZ2A 2KP6A 1JKOC 2XSJC 4D0PA 1TC3C 4BJ5C 2HPIA 4X0GA 1ZAOA 4ZDPA 2HR3A 3GTOJ 3ZMUA 2P81A 3HXLA 3E6DA 1I6HJ 2C6YA 5D5VB 1TTYA 4PGGA 1K78B 3H9QA 5H6RA 3O2PE 2OJED 4XBFA 3OYMA 2BGCA 3FHNA 2Z5UA 2H6CA 3BG3A 3IHUA 3DBHB 1JKRC 1WKMA 4ZYHA 3FBIB 4Y17A 2WA0A 1OYIA 3VOEA 4HLXA 4IVNA 2FOKA 2BZTA 3Q5FA 3V42A 5C44J 1R36A 4RGXA 1YW8A 4U7BA 4B48A 1R1UA 1BI1A 3GWZA 4ENNA 1TQIA 3DQVC 1D1CA 1J9IA 4WX9A 2IA0A 3FBNB 3GTPJ 1W4MA 2HXIA 1Y0UA 5LGNA 5F64A 2JPBA 2VBXA 3DU6A 3QPLA 3I54A 4P55A 1I6XA 1LUJB 1XDUA 2HOEA 2R3SA 3RPUD 2VKEA 3ZMTA 2O03A 3H3UA 4BQQA 1XD7A 3EUKL 4RB3C 4QTRA 3FX3A 4I09A 3PM1A 2DU9A 3DXJF 1I5ZA 2CQ7A 2IW5A 5DYMA 5HS7A 1O3RA 2H27A 1VQNI 3HRSA 2P7CB 4L9JA 3JAMK 2CJJA 4EJTA 2E1OA 4E7JA 2E2JJ 1EH7A 3ZMVA 5KHDA 4ITVA 1JKPC 3OIPA 3CO6C 1FSEA 2BVMA 2DTRA 4XSXF 4FE7A 3UKGA 4HV6A 2VKHA 3G3ZA 3OOPA 1TBXA 2PMZA 3TGNA 3FXRA 2AXLA 3D5RC 2Y75A 2XAFA 4Y7NJ 4KN4X 2Y48A 2LNBA 2XF5A 4OAYA 1B4AA 4GRIA 2W48A 4GYGA 3BJAA 5LGTA 1G3TA 4KN7X 5DCMA 5GPCA 1V4RA 1Y0NA 3H36A 1FJLA 4FTHA 3BCBA 1XMAA 4UV8A 4AC0A 4MNUA 4D5FA 3OWTA 3GTQJ 2G9WA 4HAMA 5FB2A 2KZGA 3I59A 1BW6A 2OUMA 3CCQI 1G6NA 4ETSA 1LFUP 1QNTA 2CFOA 2GM4A 3SXYA 4NHJA 3S1QJ 2E5NA 2V9VA 3DFGA 3OYAA 3A4CA 5EZHA 1K6YA 1PVEA 1R9TJ 2QQBA 1TNSA 2GLOA 3OSFA 1FZPB 3K4NA 1MBKA 1XGSA 3S32A 1IJWC 3SFZA 2I8DA 5CQEA 3M8EA 2LH9A 3MVPA 3TL4X 2LBFB 3A01A 2QF7A 4DOZA 1LVAA 1J0RA 3B6AA 3PFIA 5JR3A 3PJRA 4CDGA 2FE3A 1OCTC 2YX7A 4IO9F 2FQ3A 1A5JA 2GAUA 2COMA 3F3XA 5J4YA 1S5LC 3GFLA 2CRGA 4LK0F 2M4KA 4I6ZA 2IRFG 5FGMA 3HRMA 1JUMA 2XRNA 4XM3A 1BIAA 1GVDA 2DCEA 3HC7A 4WXDA 1Y6IA 2O7OA 5B1AH 2LK2A 4D7NA 4UVAA 1W36C 2QA4I 4HX8A 3RKQA 3DKYA 4PK4A 1K79A 3CCRI 1G4DA 2O9LA 5HS9A 3R6SA 1MSEC 1TNTA 2CQQA 3H5RA 3OL3A 4L9NA 2VC1A 4YFNF 4YG2F 3RQIA 2W1OA 2M30A 3L9FA 3F6VA 4DIQA 3TP0A 3F8NA 5EJCA 1E3HA 4B43A 3WGHA 4G9YA 1Z91A 2H6BA 2M2EA 2O5RA 2Z3YA 4B3XA 2A07F 2LKXA 1ENHA 3E1SA 3B02A 4M3GA 2XGXA 1IG7A 1SD4A 3ZPLA 3OMYA 4IZZA 4M6XA 3W6KB 3E6CC 3PO2J 1XN7A 5F6FA 1YYVA 1ETXA 3MCZA 3L00A 1T0FA 2QKMB 2FX0A 3BC8A 1C0WA 2R7XA 1X1AA 1D0YA 2Q8KA 3L7WA 2CS3A 2A69F 2Y9ZA 3HTSB 2EV6A 1VQMI 4YEJA 4XOPA 3ZQQA 1UG0A 2ISZA 2VOOA 1JXSA 1LJ9A 3DLLF 5FKMA 4EGZA 4MEXF 2NYXA 2ME6A 5K5QA 4KA4A 4IHWA 3J81Z 3O3KA 2ZO4A 4PJJA 3GYHX 1SFOJ 2TRTA 5TJJA 1NG6A 2BVLA 4DZJA 3OR2C 3P5JA 1O3SA 3LAJA 3TP3A 3HBLA 1QPIA 2PG4A 2DA3A 4JP0A 3ABUA 1ZN2A 3QQAA 3WU0A 2M45A 2EA4A 3OY9A 4IOAF 2ME0A 4ZZDA 2XVCA 2W57A 4BJ6C 2ID6A 1GLNA 2OF7A 1TZLA 1QZYA 2JUCA 1B8IA 1U9OA 4DYQA 1IF1A 4W1UA 4BXXJ 2MW8A 2HVSA 4I2OA 1K78A 3LMMA 1JTXA 4A6EA 3R4KA 2CU7A 1JE8A 3IC7A 2E5ZA 2VQLA 3KP5A 4UXNA 2FNAA 3SFIA 5IOZA 3QPHA 1R1TA 3PUFA 2RNJA 1IRZA 3SYTA 1GHCA 5GAHJ 4BDYA 1G59A 1S3JA 1MJAA 3BR2A 1PJRA 2YR2A 4Z6YA 1KYWA 4RM3A 5L3DA 3HRUA 3GFJA 2J5PA 2LBFA 5FROA 3A01B 2CV1A 3GZ5A 4BJTA 1PP8F 4BH9A 2EFQA 2LD5A 4BEHA 1VNDA 2GWRA 4JX5A 2K9MA 2UUZA 4B44A 3L2VA 4CHUA 3MZYA 2F5DA 3WTVC 4A69C 2DXIA 2OBPA 1S8NA 2ZNYA 1U5TA 3MEXA 2K5CA 3TOBA 3J7YJ 2A6HF 3LSGA 4II2A 2HDCA 4CCKA 2V6EA 1OMIA 4XKWA 3BPXA 1TW2A 3A02A 3PSFA 3TO9A 1P92A 2XPWA 3FKIJ 3BJOA 1AA7A 1SVOA 2HVQA 3OYDA 3VWBA 4HX4A 2PQ8A 1S7EA 4QSHA 1V55H 2W82A 3IH2A 3OS2A 1FT9A 4N0BA 1B72B 4QWQA 5IYDJ 6PAXA 2O61A 1IZ1A 2DFEA 3D0SA 3FMSA 2JUGA 2LDUA 3BQYA 3CDIA 2OQRA 4BE0A 4BU2A 3K1MA 4HLYA 5KVRA 1FTZA 3DV8A 3I5UA 1BM9A 2WAQA 1F36A 2WV0A 3U9GA 1AKHA 3S2HJ 4M9SA 1DPUA 2ZKZA 4A3FJ 1X19A 2MA3A 2MBFA 3ONQA 3U1KA 1ZHFA 3HHGA 3DTIA 3GLXA 4FISA 4OMZA 3H0DA 3WODF 3E5UA 1X4PA 2ELHA 2X4HA 1X2NA 4P9UA 3LSRA 4JBAA 2LKPA 5M5WJ 1HCRA 2M4GA 1P4AA 4IPAA 1K4SA 2O0YA 2XAGA 2HZDA 1X1BA 1R22A 2DYSH 1QGPA 3G6EI 4GFBA 5LBQA 3O6BB 1B6AA 3IRRA 4A3JJ 2VXZA 3Q0UA 1R4NB 4PUSA 3S1MJ 3PIOF 2Y31A 2MLGA 5LD2C 4OIRF 2VJJA 3A2KA 2QBYB 2CG4A 3BLYA 4KUMA 4HNUA 3N97A 2KRCA 5J40A 3T1BA 1I3QJ 3C18A 1JHFA 3C7JA 3ZQ7A 5IOYA 4BY7J 2WB1A 3S93A 3OYEA 4HRIA 1X3WB 5E1WA 1HXDA 4F7ZA 2L01A 1SVLA 3H9JA 4AIKA 3SDGA 1VI0A 3QODA 1FIPA 3VB2A 4A3LJ 5B1BH 3RDIA 2XDVA 3CCSI 4AUXA 2VOPA 3GFIA 1IRGA 3SDBA 1WFXA 3NAUA 4FQGA 3OS0A 2LKSA 3HYIA 2RN7A 5DS9A 1O57A 3CCJI 4UV9A 3L2RA 1T38A 3TMOA 4BQNA 1ON1A 1VFCA 2QGUA 1OCZH 3VSKA 4OIQF 4QPOA 4FCYA 3ZOBA 1D5YA 1RC9A 3L09A 2HGCA 1ZRFA 1W7PA 1KA8A 4M9ZA 5FKNA 1KYZA 5JFRA 1GUUA 1JGGA 3GBGA 5F1JA 3J81K 2X6XA 2OTLI 1IO2A 3OYGA 3QWLA 3QRFF 4WWCA 4HNTA 2FBHA 2KPMA 4LLNA 1I27A 2ZSHB 3E6MA 2EBIA 2NXNB 3FXQA 3M1EA 2IS2A 2IGMA 1IUFA 4AIHA 5FKOA 3RKYA 2HYJA 5JI6A 3HEFA 2DPUA 2NAZA 4U0WA 3BTLA 2B9SA 2GXBA 2VJIA 3G73A 2HXOA 1PUEE 4BXUA 2OV7A 1J2XA 3CUQC 4I0AA 4S04A 3R0JA 5FRNA 2XPVA 1JJ6C 5HNHA 1W7PD 3WTYC 1K7AA 4NBQA 4CA0A 1KONA 1XTAA 2F4OB 4KIFA 4G12A 5F27A 5B5EC 1MBGA 2RDPA 1P9QC 3RI4A 2EA2A 4QLCU 3TW7A 2JT1A 5IYBJ 3HOSA 3ASOH 3FMQA 3HPGA 2KRHA 2QCOA 4CICA 2LTPA 4BS9A 2VC0A 3GFMA 3HB9A 4N4OB 4XKBA 4ZYAA 4I02A 2IAIA 2L9SA 4BKXA 2V6CA 3ASNH 1LEAA 4O5VA 1W7PB 4NC8A 5ED4A 3GTMJ 4FASD 3BR3A 5DCMB 4LG3A 2FSWA 3MFKA 2HVRA 1BI0A 1ETOA 3BY6A 1R1VA 4LK1F 2IBDA 2H09A 2YPRA 5ICEA 3KLOA 1S7AA 2VN2A 2DJIA 4RM2A 3MZHA 1B8IB 1QU3A 1MH3A 4XONA 3IH3A 4BGDA 4IEJA 4NNJA 4XNFA 3GXOA 1FBSA 4ENJA 1OR7A 5H20A 5DTDA 5E1XA 3CJTB 2JVHA 2GZWA 3PNVA 1MJ9A 1Q1VA 3T8RA 5CVIA 5D6FA 2XF6A 5IT3A 2X6WA 4CZCA 3E6BA 1HSTA 4E7LA 3PIPF 4HZFA 1SD7A 2IA1A 1WI9A 2YU3A 2LF8A 3A03A 3VSLA 1D3YA 3HOWJ 1VQPI 4RGSA 1VQ4I 1YO5C 2O8KA 1WH5A 3TKYA 1LEBA 3ABMH 3WTSC 3RCOA 3CMEI 3CCUI 3S17J 4D7MA 3DU5A 3VFZA 3L2CA 2JRTA 1BJZA 4CYCA 3KP2A 1NHAA 2XPUA 3G2BA 4PJMA 4BBRJ 3PFYA 3OYKA 3VDXA 4EJVA 4RMNA 4IOCF 1XDSA 1BIBA 2GBYA 3SJMA 2XGDA 1U5TB 5EEHA 4N9IA 4NQWB 1U78A 4XLCA 2DQLA 2ZC2A 1WJBA 3GW2A 4CZZA 4XIDA 1RR7A 5DD8A 1QZEA 1Y1VJ 1DQUA 3ZXSA 1U0JA 5A2QK 2NVXJ 3VYTB 1YJNI 2LC2A 1MBJA 1K6OA 2OU2A 1X2MA 1NK2P 4LMYA 4GDFA 3EUHA 1N75A 3CLOA 2VQGA 1USSA 3E3VA 2IGNA 2QVOA 4AU7A 5C4XJ 2VPLA 1PUFB 2E7XA 3QU3A 3I4NJ 5EZGA 2UXXA 3ABTA 3KYDB 4AVZA 4ZYDA 2AXTC 3LSPA 1CF7B 4GGGA 3HOZJ 3GTKJ 4HDUA 1O3QA 4U87A 3RTRA 3ECHA 5IP9J 2Y0MA 2ZXHA 5L3CA 1J5YA 2VI6A 3HSFA 2G7HA 3IL2A 3HKZN 1W5CC 3TEDA 5CJ9A 1NH3A 1SMYF 3DWLE 3LA7A 3M1CA 3CP8A 3BR1A 3KFWX 3S3MA 5AIQA 4NC7A 3EYIA 4CYCB 3A0BC 1UJ8A 3HOVJ 4PSWA 1PUFA 3K2AA 1WJEA 3RKWA 1FOKA 1Z05A 3F8CA 1WSUA 4IX7A 2CYYA 3P9CA 5D6EA 4MFDA 4L0ZB 2OCEA 5DEQA 1DU6A 1SC7A 1VQOI 5M3MJ 4BE2A 4G6QA 2OD5A 2IS1A 3F0CA 3H5NA 3RPQA 4XKCA 2E35A 2P4WA 3DEEA 1IC8A 3J7AO 3D5SC 3S2WA 1FP1D 2E7WA 5DD4A 3R0AA 1XGMA 5ERIA 2ESNA 5D5UB 2HOTA 1XMXA 3ERED 4KMFA 3RZDJ 3IRQA 1IV8A 2HS5A 1MMSA 1WGXA 4FETA 3K0LA 5AIPA 3BOQA 1QA6A 2EV0A 4ZJZA 2JZYA 4LD5A 5JVTA 1BOAA 1FIAA 3KCCA 2ICWG 4V19K 1G3WA 2BE5F 4RAYA 1FOXA 2RQPA 4PFPA 1KU3A 4XSZF 1BC8C 1FWZA 2OQGA 4BNCA 2PJRB 1FC3A 5AONA 3F9KA 5HDNA 3RPUA 3GCMA 4NQWA 2LLKA 3LL7A 2QQAA 2E1MC 2Z33A 5EGOA 2M3AA 1YX5A 2R7TA 1R49A 4JX6A 4HW0A 3KLNA 4D5CA 1GXQA 2P6SA 3WTWC 5FRMA 1UCRA 2MC3A 1FBQA 2EV5A 2BBYA 3K70D 3U21A 1RESA 1ACIA 1N77A 4XN3A 4PGHA 4GO1A 5DV5A 1GT0C 3JRCA 4KICA 4B47A 2DA7A 4E7IA 1LFBA 1USTA 2Q0OA 2KL4A 4R79A 5JLXA 1O7FA 2BY2A 2L9VA 3IWZA 4F52A 4M72A 2DDBA 2IVMA 3K4BA 1G3SA 2D1VA 2K27A 2EQRA 2E60A 1UFMA 3H9GA 4BQAA 1MBFA 4XRSA 2P0WA 2X9DA 2XKOA 2KIUA 3GMEA 5D4RA 1YTYA 4F3QA 3AG4H 2F5FA 4YELA 2EK5A 4ZTFA 2QLZA 1A6QA 3H35A 3DPUA 5B3SH 3IH4A 3NARA 1D0ZA 2K85A 4OIPF 1S72I 2OAZA 1R58A 4KISA 4EM0B 2XSDC 4UNOA 2RC4A 3OIOA 4FHTA 1F5TA 4EM2A 1A04A 3OYBA 2KIQA 5FKLA 5EYRA 1LE8B 2R7VA 2R5ZA 3HGGA 3K4CA 4P9FA 4JOMA 5C3EJ 1RNLA 3VODA 3S14J 3LQRA 4DNCA 2CQKA 5HLTA 5IPAA 1XB4A 3QAHA 3QPTA 1QPMA 1XGOA 4ESJA 2HQAA 1T2KA 2JRMA 5EF6A 3NWSA 1Z1DA 2R5YA 2DA1A 2KRFA 2VKDA 1T33A 2HOAA 5LFAA 5KAFC 3DP7A 2JA8J 2AQFA 4KMUX 4AVPA 4I0BA 1ETYA 4UUSA 1YQAA 4WK8F 1S29A 2NVTJ 1IUYA 2QWWA 1T56A 3IP4B 2IT0A 1JTYA 1CF7A 4B4CA 4PJLA 4NB5A 1LB2A 1MMGA 2EILH 2XGCA 3DLAA 4JX4A 1J7KA 1P2FA 2XAQA 3N05A 3GUDA 3MZ8A 1DP3A 4HQMA 2L9RA 4L5JA 3CCVI 2E2IJ 2V1XA 2L0KA 1EH8A 1KQ9A 2W24A 2COBA 4BEHB 1E3OC 4TV7A 4D1QA 2NNNA 3E7LA 5J1YA 2R7WA 4Y33A 3J80Z 1QVUA 3QOPA 1HBXG 2JSCA 1QRYA 3ABKH 3BT9A 1KU7A 3J7AY 2L4AA 1HKSA 2I5UA 1D8KA 3L1PA 1W0TA 4IRHA 2KISA 2JWTA 3DTKA 4LJZF 2DW4A 3WTZA 2QZ8A 2A61A 2KHMA 2QBYA 1DGRM 2RREA 2UXNA 5DM7F 1VQ8I 4RGUA 2PEXA 3PNYA 3CLQA 4YFKF 2BEOA 3ROUA 5DCFA 1YHQI 5EG0A 4J00A 2HTJA 4PSXA 1OYWA 2K9QA 2O8XA 5ILVA 4FE4A 2VQCA 2IXSA 4M6YA 3VYSB 1FOYA 3F22A 3BP8A 3MAJA 4EGYA 1FYLA 1WJFA 4CXFA 5JVGF 1FMWA 2CGPA 3HOYJ 2KT0A 1YLFA 5CVJA 3WGGA 5K5RA 1QHHD 2KDZA 1ON2A 2FMYA 2VIXA 1ONVA 1FYKA 4Q47A 1FLIA 1Y8RB 2CW0F 3W2AA 1D1AA 2CSOA 1QBJA 4KIBA 1YG2A 3ZR8X 2N8GA 1I1SA 2WV1A 4C3JJ 3EUHC 4L9TA 4YRVA 2HQRA 3CMMA 3DEUA 3PSIA 1OR7C 2EJRA 3ZQGA 2DN0A 1KU9A 1POGA 2K3FA 4N9HA 2JA5J 2L2OA 3M4OJ 4XN0A 2GXAA 5DUIA 4YIIA 3CUQB 5GP9A 3MKWB 1V54H 4AD9A 2VBWA 2R93J 4XRFA 1ZRDA 4A3GJ 2IS6A 4A3MJ 1IGNA 3CCLI 3OYJA 1R5ID 3FXJA 3WTTC 4UUSB 1FTTA 2M9HA 1N25A 3K4LA 2UV1A 4LIUA 2ZSIB 2FF4A 2L7FP 3TDZC 2Y30A 3WG9A 4C9YA 5EDNA 1RUNA 3FM5A 1YJ9I 2A68F 4IL6C 1W5TA 3FIWA 3SZGA 3ZCOA 1SFEA 1MNDA 2NS0A 1RKTA 2FRHA 2Z2SB 4N4NB 2CV0A 5HOOA 3MWMA 4HF1A 3CTAA 2CUJA 2JN6A 2P7VB 3B6CA 4A93J 1FPQA 5H2FC 1Z9CA 2IGKA 1IXRC 4IF4A 5L3BA 2V1DA 4RLFA 3FXLA 1WQ2A 4UVBA 1IW7F 1R7JA 1V5GA 2Y0SA 4RGRA 1ZGWA 1HOMA 1JGSA 3VYRB 1LFPA 1I50J 1SFXA 3W2WA 2FU4A 1B1BA 2OZUA 1APLC 4J19A 1SFKA 2CUFA 3CUQA 2XF7A 2O3FA 4PJNA 3F8BA 1PYVA 2FEZA 4E7HA 4I98B 3SQNA 3LSHA 3KZYA 4Q48A 1YJWI 1R23A 1D1BA 2DODA 2CFXA 5TISC 3CMYA 3KPHA 3ML6A 2DFFA 2KFDA 3GLLA 1VF9A 3O8HA 4GYIA 2H8RA 3DPTA 4Y13A 1WCMJ 1VQ5I 1S9HA 1K83J 3BWGA 3TW6A 5GPAA 5ILSA 2PX9A 4O6JA 4MLOA 3HOXJ 4FT8A 4ZZLA 3FM3A 2AS5F 3VEPA 1UB9A 3JRAA 2ZXJA 1XS9A 1BOBA 5H6QA 2IP2A 5EGOB 3ISPA 5K7ZA 1DPRA 3ZRGA 2D2WA 2D45A 5J4VA 1OFCX 3LSJA 2MH9A 3I59B 3CD6I 4CUGA 3MQ0A 1BA5A 3I55I 2B0LA 2FD5A 1TWCJ 4U88A 4EV0A 5LHIA 2EIJH 2ZJQF 2KMUA 5J8CA 2AO9A 5LLQA 3BR0A 3FXOA 2E1MB 3QYBA 5HLGA 1OKRA 3RSNA 2ZJRF 4G7OF 9ANTA 2XHKA 4CH7A 4PFOA 3KP7A 1BR4A 1YRNA 1ZTRA 4ZC3A 5BNGA 2DT5A 1EV7A 3DF8A 1OCOH 2DFIA 3HTUA 3SEQA 5LEKA 1JJ8C 2ZCWA 2NVQJ 3CF2A 1AOYA 2R5YB 4LG0A 2W00A 1QZZA 1UELB 2KLOA 1MDMA 3M8JA 4Y15A 3VYUB 3ABLH 5JHUA 1ZLJA 2HKXA 5J3LA 2L4MA 2WADA 4F92B 3RIRA 3ELKA 1OYYA 2IJLA 2JK3A 2YSRA 2Q1ZB 2P8TA 1IDYA 2BYVE 2JVGA 4XR6A 4M3EA 5HS8A 1ZYRF 4AIJA 2XROA 1GDTA 1S7OA 2W85A 2WY8Q 2ETHA 2L02A 4HSRA 2LG4A 2XKPA 1DDNA 2VONA 3M8FA 4UB8C 4XLEA 5E8IA 2O6GE 2Q2EA 5F0FA 1WRJA 1KZHA 2VKVA 1SEUA 4ESFA 1MMDA 2WTEA 2IA2A 1SVMA 5FJ8J 1HDDC 4W97A 3IV5A 4I76A 1YX3A 2E36A 4MFEA 1HQCA 1H8AC 3GO5A 1FBUA 1PP7U 2MH2A 2KJBA 1IN8A 3I58A 1Z6TA 4S0HB 1U8BA 4JK1X 2UWMA 1P4XA 4B8XA 5BS6A 5DM6F 3HGYA 1UHMA 2MD0A 2R5ZB 2NOJB 3S3NA 5J6XA 4A0XA 2CQXA 2HYFA 3HL2A 5CLSA 1S6LA 5E79C 3OYLA 1X1CA 2A6EF 5K5OA 1BR2A 2ZJ2A 1EH6A 4PDKA 1EF4A 2L7ZA 2YX4A 1WJDA 2M8GX 2PLYA 1N78A 3E5XA 1JT0A 2LRDA 2CV2A 2F6CA 4KIGA 1REPC 1MBEA 5LEJA 2NRAC 3C2HA 4HF2A 1ERDA 2LMDA 1RPWA 1STZA 4E70A 2FXAA 4RBOA 2Y69H 5KAIC 3JRHA 2JA7J 3KZZA 2GXGA 4A3IJ 1GV5A 4DQ2A 1Y8QB 5LGUA 2FMLA 3EUAA 2RQQA 3SZTA 3TO7A 5LHHA 3ZQLA 3V7RA 1UHSA 3KP4A 3JAMZ 1BI3A 3CZ6A 1IXSB 1T95A 2WAFA 3FHZA 5D8KB 4CCLA 1ZLKA 2GA2A 4UUTA 3JTHA 4L5EA 3TOAA 2VPRA 4M74A 3ZMSA 4L18B 2DTZA 2LF7A 2VASA 3LSIA 4G8XA 2E71A 1RRJA 5K1YA 1E2XA 4LB6B 3M3YJ 3V7CA 2DOAA 4IRGA 4A2UA 4EQQA 3K2ZA 3C2GA 1G8XA 3LFKA 1A36A 1HF0A 4XOTA 2F2EA 3TO6A 5FFZA 3CJRB 2JSPA 2AQEA 3ECOA 3G1MA 3LA2A 2XC7A 3QU6A 2QKLB 4RB0A 5KCMA 3LSKA 1ZARA 4A5NA 4ZH4F 1UG2A 3KZIC 4M3FA 4LG0B 3H3VK 2JTVA 4MO7A 2EB7A 3MKZA 1IRFA 3BZCA 1P6RA 4C3HJ 5C4JJ 3K4JA 1MZBA 3LSTA 2NVUB 3W6VA 2HZTA 2L7KA 2FNPA 4M73A 1D0XA 4RAFA 1UMQA 2LSOA 4LFUA 2M0CA 4CYDA 3FXUA 5M5YJ 2HTSA 2EINH 3FZVA 3CDLA 4RB2C 3LFUA 1ETQA 5HNFA 3G4SI 4A5MA 4Z2YA 4RB1A 4GCVA 2MYSA 2LR8A 3JRFA 4YIFA 1JUSA 1HLVA 4H0EA 2STWA 2KDOA 1MMNA 4M6VA 3R61A 1ZG5A 2EIKH 3HSRA 3ZQFA 1IV6A 1SAUA 1TLHB 4LOCA 2ZMEB 2VE8A 3M07A 3WE2A 2ZNZA 4A3EJ 2R7OA 3P9IA 3H3ZA 3HUGA 4XK4A 2ZB9A 3HM5A 3KP3A 3QYFA 1LQ1A 1RUOA 2K40A 3MN2A 4MQ9F 2M5WA 1MJBA 4HV5A 3HKZA 2VT2A 2ZFWA 4YFXF 2OZ6A 2MLKA 1Z7UA 3H92A 4Q4ZF 5E8GA 2KJCA 3C3WA 2YU9J 1BW5A 4ANJA 4LLGF 3DTEA 3BR6A 1UHWA 1FMVA 1MBHA 3OIQA 5F1RA 2G0EA 3CESA 2QQ9A 2XAJA 2G7UA 4XRSG 4CO8A 3KE2A 4WCGA 5IP7J 2ACJA 2VJ4A 4UHTA 1F4KA 1F43A 1HKTA 5TRDA 4A3CJ 2JJ7A 4DGWB 1A31A 3K9TA 4IHTA 1VZ0A 4M3BA 2VUMJ 1O3TA 2MSYA 5CPRB 3E0JB 5K7HA 4OOIA 2IPQX 3KYCB 5LHGA 1L3LA 3KIOA 2B63J 1KGSA 1U6GA 4OU0A 2VXDA 5E3MA 2DT6A 2EZIA 3GEZA 3AFHA 2UZKA 3IAS2 1TT0A 2DMNA 3GF2A 1Y1WJ 5BPIA 2HWVA 2EFWA 5FO5A 1X1PA 1Z7LA 2DMTA 2A3SA 1RIOH 1D5VA 5E3LA 3MD2A 4V2FA 4BHCA 2DBBA 2M1BA 1VQ7I 5IT9K 3P9KA 3IWFA 2D1HA 2ZFUA 4Y3OA 1R4MB 3VPRA 1OJLA 2LVSA 3CJNA 1TT5B 3LSMA 4WXCA 3L2WA 1R5GA 5HDKA 1SD6A 4HX7A 2F5VA 1JI8A 3EDPA 4KT5C 3ZP5A 4HDVA 4HSTA 4XL9A 4ENMA 1SANA 4CCNA 4ON0A 1EA3A 2HKOA 2E34A 3FMRA 3QPSA 3BCAA 1W5SA 2CUEA 4L5IA 1ZH5A 3JRBA 3RKXA 1WH7A 1K61A 4IRIA 5L3GA 1SD5A 1TQPA 1LPQA 4CCJA 1H89C 2X1EA 2NVYJ 1T0FC 4EJOA 2DA6A 4HF0A 1AKHB 1FSHA 5FLMJ 2OTJI 2OCCH 1G2HA 3TDUC 4LITA 1HKQA 2CUZA 2WAEA 3OL4A 2W7NA 4UVCA 1I3AA 4BBSJ 5IYCJ 5KK1A 1BN5A 2H1LA 3NQOA 3FDYA 1OLTA 1OPCA 5IT9Z 3OOUA 1PDNC 1JUPA 3UR3C 1MIJA 1RZ4A 4B09A 3KEOA 5GADJ 2Y9YA 5D8LB 4DBQA 2R0QC 4XLHA 4MTDA 5E17F 2YUSA 2DA4A 4HEA2 4E7KA 1GXPA 2F4MB 2VB6A 2ELKA 5ILUA 3HPHA 5BPDA 4MQVA 3ULQB 2FA5A 4G94A 3OYNA 1ODDA 2DFHA 1ZG1A 3EETA 2JQ7A 1YE9A 3M7GA 2PFBA 3P7NA 2QM3A 4K2EA 3D1NI 2M7BA 1J09A 2P5KA 1Q1HA 2Y0SN 3DBRB 3U1DA 5E3OA 3I4MJ 2EPFA 3FKJA 1XSVA 1AU7A 4R8HA 2OC6A 2RVCA 3DBLB 4IJAA 4IQJA 5E20A 4ZYEA 4G7HF 4ZDOA 4CCOA 1OCCH 2LY2A 2OA4A 1O4XA 1T6SA 4CSWA 4A3BJ 1TW3A 2AHQA 5HLIA 1BJAA 2VJ5A 4KFCA 3OYIA 4P5OA 2F5EA 3DPLC 3CJQB 3WG7H 4F55A 3V8JA 3BDDA 3DCFA 1YOVB 4BAYA 3QP5A 2ZMEA 2XB0X 3W2VA 3KX2A 1ORKA 4IQ4A 1VQ9I 3F8MA 1HW2A 1HA8A 4HYEA 4BE1A 2V1NA 2TCTA 3BTJA 1MD0A 1R00A 1VQLI 3HRTA 1ZGJA 3CO7C 1FOWA 3GTGJ 1KQ0A 2P5VA 2PMHA 4RDUA 1RI7A 3O8GA 1U5TC 3K70C 2VLAA 4ZDLA 4HBLA 3D5LA 2DO7A 2VE9A 1YW9A 1X58A 4Y4RA 3WU1B 2X51A 3RJPA 3T0YA 3PQKA 2R7RA 1SAXA 1KU2A 3Q9SA 2X0LA 2DOEA 5JHFA 1YITI 1ZKGA 3KYLA 1XC5A 2JA6J 2RGVA 3ZMZA 3ZGKA 5L3EA 2IGOA 3K7AJ 2QSGX 2HNHA 1K4TA 4IKFA 2HDDA 2EWNA 2V9PA 4EATA 5HLHA 4E7ZA 2PN6A 2HI3A 4ASNA 2LY1A 3ZN1A 3CQZJ 1WJ5A 4HG2A 3K4KA 3FXMA 4X1EA 3B73A 3EYYA 3V4GA 5ICFA 2EZKA 1FX7A 3SEZA 4KYWA 1IAWA 1LKXA 1HW5A 4EEFG 3IKTA 1KQ8A 4FX0A 2R7DA 2V79A 2X85A 1T98A 4QPQA 4A0ZA 1XCBA 3F23A 1LNWA 3F21A 2GA1A 3TBIA 2W84A 3WGIA 3WU2C 2QYOA 3I64A 1HC8A 1BI2A 3ZQIA 2GIVA 4DYCA 4XQFA 4MTEA 4ZTJA 4BHBA 1XCVA 2NS8A 1TWHJ 3I9V2 3S1NJ 3DEWA 2R4GA 4BHPA 2L54A 2VBYA 1JT6A 2Z16A 3HZJA 5M3FJ 2LFBA 4FX4A 1YIJI 5CVVA 2NNYA 2MFZA 2A05A 4KT6A 1YS6A 3HIFA 4NUBA 2ZMEC 4U7DA 4ZYGA 2ECCA 4QIWN 1VTNC 4OAZA 4BYYA 5EEGA 4MIMA 4HNVA 3AG3H 1XPXA 1EJ9A 4OIOF 3HUGB 3OYHA 5BMZA 4XLPF 1DU0A 2F5CA 2STTA 3IAM2 2L9NA 3ZQCA 2ZXWH 3I0TA 4KNYA 1U2WA 3CUOA 3PUBA 2PI0A 1GVJA 1P7JA 5L3FA 1HW1A 2ID3A 1TWAJ 1MH4A 5CQGA 3S8PA 3HOUJ 2M87A 1X3ZB 1WVRA 4XICA 2EZLA 2QEXI 3Q0WA 2KQRA 3RYPA 2E1NA 2DT7B 1WHUA 2DLLA 3BQZA 3JRDA 1ZR4A 3BG6A 3WTXC 3GTLJ 2QENA 1L0OC 5FD5A 1DUXC 4GXOA 5K7FA 3N4MA 3PQJA 1MKMA 1ZRCA 4BY1J 1B59A 1R6RA 3QP6A 4KJZA 3JREA 4Q5SF 3AKZA 4H4KC 5GTHC 1VQ6I 1ZGAA 2F48A 2X48A 1GV2A 3A0HC 5CKTA 1U3EM 3U2RA 2P5LC 5EG0B 3JRIA 1XSXA 3G1OA 2GOMA 1R71A 1FYMA 4HPQA 1RKWA 1TWGJ 3OYCA 3BG7A 5CYVA 1HSJA 4EJUA 3H0GJ 3FK7A 4P96A 2MABA 2BXZA 3EPZA 5GAGJ 3LOCA 4YIRX 2ISYA 1X3UA 2QSFX 3CCYA 4I7HA 4E7SA 2HFHA 1WJCA 4BUPA 3LAPA 1ZR2A 1CGPA 2M7AA 1A35A 2H8WA 3GVAA 2V26A 1YS7A 3BG9A 3GZNB 4BQOA 4D9JA 2V4JC 4DBRA 3OSGA 5HVQC 1F9NA 2R7SA 2PJRA 4BL0B 4LGWA 4AYBN 4G6DA 2CW8A 2OPTA 4RAZA 2LOOA 4G7ZF 3K4MA 2RV8A 5D4SA 2BHZA 3PL8A 1DP7P 2J5OA 4XLNF 3JSOA 1QHGA 1OCRH 1YRNB 4EVIA 2A5WA 5IY5H 3DKXA 3PO3J 3S3OA 4XMYA 2Z99A 3FWEA 1IN7A 1MGTA 1ZREA 5J47A 2ADUA 2DAOA 4C30A 1P4WA 2VBZA 2XASA 2YS9A 1WI3A 3IUOA 2VODA 2DMPA 3NRVA 4C3IJ 3ESWB 5E18F 5J8FA 1JHHA 2EFPA 4UUVA 3AG2H 1Z3XA 4LIVA 4PCQA 1WJAA 3AL0C 1X1DA 2DK8A 2I10A 1YIOA 2EZHA 3Q9VA 5HODA 1Z21A 4DYRA 1IXCA 2VQHA 2WB1N 3K6GA 2DMQA 3F6OA 1FEXA 2P6TA 3J80K 3ZMDA 1U9NA 1W36D 3OYFA 1QO0D 3OS1A 1XSDA 4XLFA 4IXAA 4IHVA 5HDGA 2WC2A 4A3KJ 1T8IA 3L2UA 1V5EA 1BR1A 3KEYA 4RAGA 1T08B 2MGQA 3KP6A 2LP0A 3FXKA 1TQMA 5B66C 2DMUA 2K9SA 2DK5A 2D5VA 2MG4A 2E2HJ 5FD6A 2EFOA 1H88C 2DDAA 5GTIC 4XLAA 3KETA 3M9AA 2E19A 5DDGA 2V9KA 5D5XB 3HDDA 2W25A 3BPVA 3JCUC 2RAEA 1X4OA 2PMUA 2FJ1A 4XORA 3BROA 1MW7A 3CDHA 4B1RA 1ITYA 1ZELA 3AG1H 3SHFA 2X6YA 3CP2A
chains in the Genus database with same CATH topology
5M5XJ 2DA7A 1LFBA 4A3EJ 5JLXA 5FKMA 2K9NA 4ABZA 2EQRA 2ME6A 4XK4A 2ZB9A 3JR9A 1MBFA 3G1LA 2XGEA 3HM5A 4XRSA 4IHWA 1SFOJ 2TRTA 2K40A 3MN2A 5F0HA 2X9DA 4DZJA 2HQ5A 4NDLA 3FISA 3IH4A 3NARA 3TP3A 3HBLA 5EEAA 1QPIA 2DA3A 4JP0A 2R7ZJ 2XRLA 3QQAA 2XSDC 3OIOA 1AHDP 4C2MJ 1BW5A 2YU9J 2ME0A 5FKLA 5EYRA 1RETA 1LE8B 4IHYA 3BR6A 1MBHA 2R5ZA 3HGGA 2ID6A 2G0EA 2OF7A 5C3EJ 1Z0XA 4XRSG 5F04A 1B8IA 1U9OA 4DYQA 5IP7J 3S14J 5IPAA 3RZOJ 1F43A 4W1UA 4BXXJ 2MW8A 1JTXA 4A3CJ 2JJ7A 5EF6A 4M3BA 2VUMJ 2R5YA 2DA1A 2MSYA 2CU7A 1T33A 2HOAA 5K7HA 2JA8J 2DA2A 4DZPA 2B63J 3SFIA 5IOZA 1ETYA 4UUSA 2NVTJ 3Q3SA 1IRZA 1OCPA 1HDPA 5F0CA 1T56A 5E3MA 1JTYA 3BR2A 2EZIA 4B4CA 3MKLA 1QVTA 2H1KA 2XGCA 4JX4A 2DMNA 4JYKA 1Y1WJ 3A01B 2L9RA 2M34A 2L7MP 2E2IJ 5F08A 1JKQC 2L0KA 2LD5A 2COBA 1VNDA 2NS7A 1NK3P 4Y52J 2DMTA 1E3OC 4JX5A 5E3LA 4V2FA 2IEKA 3E7LA 4A69C 3VPRA 1Z77A 1OJLA 2LVSA 5J1YA 1QVUA 1QRYA 3BT9A 3C2BA 3LSGA 3WHBA 1SANA 4X6AJ 3L1PA 1W0TA 4XRMA 2FQ4A 3A02A 2JWTA 2XPWA 2EH3A 3FKIJ 3QPSA 2CUEA 1S7EA 3JRBA 3BTIA 1WH7A 3WHCA 4QSHA 1K61A 2ECBA 3IH2A 3FK6A 1B72B 5IYDJ 3BR5A 1H89C 2NVYJ 3BQYA 5EG0A 1ZQ3P 1P7IA 2DA6A 2WAQN 1AKHB 2K9QA 1FTZA 5FLMJ 4FE4A 1F36A 1G2HA 1AKHA 3S2HJ 1LE8A 4BBSJ 4A3FJ 5IYCJ 4FISA 3HOYJ 2KT0A 2PMZN 1ZK8A 1B72A 3OOUA 3BG5A 2KDZA 4DW6A 1X2NA 1JUPA 3LSRA 3S15J 5E3NA 5M5WJ 1HCRA 3S2DJ 2Y9YA 2N8GA 2R0QC 4GFBA 2YUSA 1WPKA 2DA4A 2WV1A 4A3JJ 4C3JJ 3Q0UA 3S1MJ 2LY9A 1NTCA 2JMWA 2Y31A 1ETWA 2ELKA 3ZQGA 2DN0A 2R92J 1POGA 2JA5J 3M4OJ 1CQTA 1ETKA 5GP9A 2R93J 1I3QJ 5IOYA 1ETVA 2DA5A 4BY7J 4A3GJ 3D1NI 5FKKA 4A3MJ 1IGNA 5E3OA 2Y0SN 3I4MJ 4UUSB 1FTTA 2M9HA 3SDGA 1VI0A 1AU7A 1FIPA 4A3LJ 2L7FP 3ZQHA 2Y30A 4AUXA 3NAUA 5EDNA 5DS9A 3FIWA 1RKTA 4IHXA 1O4XA 4A3BJ 1VFCA 2AHQA 1W0UA 2JN6A 3B6CA 4FCYA 4A93J 3ZOBA 1D5YA 3DCFA 5JLWA 5FKNA 2XB0X 1ORKA 1MNMC 2HOSA 1GUUA 2DJNA 1JGGA 3GBGA 2TCTA 3BTJA 5F1JA 1ZGWA 1HOMA 4V2GA 3GTGJ 1I50J 4A3DJ 4RDUA 1APLC 1TWFJ 3O8GA 4M3DA 3LNQA 1BL0A 4J19A 3GTJJ 3BTCA 2CUFA 1MSFC 1X58A 3JRGA 2EBIA 4B3AA 5FLVA 1IUFA 2X6OA 2NOGA 5FKOA 2HYJA 3HEFA 1ZKGA 1XC5A 3BTLA 2JA6J 3CMYA 2HXOA 3K7AJ 1VF9A 3O8HA 2H8RA 2HDDA 1WCMJ 1K83J 3TW6A 2XPVA 5GPAA 1JJ6C 4MLOA 3HOXJ 5J1RA 2HI3A 1IDZA 3CQZJ 4G12A 3JRAA 4X1EA 5F27A 1XS9A 1MBGA 3S16J 1A6IA 5EGOB 3TW7A 2XB5A 5IYBJ 2EZKA 5K7ZA 5IP6A 3S1RJ 2QCOA 1OFCX 3LSJA 2Y2ZA 4EEFG 1XG1A 2LTPA 1BA5A 5J1UA 3Q0VA 2FD5A 1JKOC 3HB9A 1TWCJ 1TC3C 2IAIA 4BKXA 2AO9A 3GTOJ 2P81A 3BR0A 3GTMJ 3BR3A 1I6HJ 1ETOA 3ZQIA 9ANTA 4DYCA 2IBDA 2NS8A 1TWHJ 1YRNA 3S1NJ 3DEWA 1B8IB 1MH3A 1JT6A 1ZTRA 3IH3A 5BNGA 2LFBA 5M3FJ 4IEJA 1JJ8C 3BG3A 2NVQJ 5DTDA 1JKRC 2R5YB 1Q1VA 2ECCA 4QIWN 5C44J 5J3LA 4MIMA 4HNVA 2JK3A 1DU0A 3A03A 1IDYA 3HOWJ 3GTPJ 4M3EA 2HXIA 1GDTA 2O8KA 1WH5A 3ZQCA 3QPLA 1P7JA 3S17J 5F0FA 4D7MA 2ID3A 1TWAJ 2VKVA 1MH4A 1BJZA 4CYCA 3HOUJ 2VKEA 2XPUA 4XICA 4QTRA 4BBRJ 2EZLA 3PM1A 4W97A 5FJ8J 3IV5A 1HDDC 3Q0WA 2GBYA 4I76A 3JRDA 3BQZA 3SJMA 1ZR4A 2XGDA 2CJJA 3GTLJ 1U78A 2E1OA 4MFEA 2E2JJ 4XIDA 1JKPC 1RR7A 5K7FA 1H8AC 1Y1VJ 2NVXJ 4BY1J 4FE7A 3UKGA 1MBJA 4S0HB 1U8BA 1X2MA 1NK2P 3JREA 2R5ZB 3HGYA 5C4XJ 2X48A 1GV2A 2CQXA 4Y7NJ 5EG0B 1PUFB 3JRIA 3G1OA 3I4NJ 1RKWA 2W48A 5EZGA 1TWGJ 1EF4A 2L7ZA 3LSPA 2M8GX 5GPCA 3H0GJ 1FJLA 3FK7A 1JT0A 4FTHA 3HOZJ 3GTKJ 4AC0A 1MBEA 4D5FA 3GTQJ 3LOCA 5IP9J 1RPWA 3CCYA 1ZR2A 2VI6A 4RBOA 3HKZN 3TEDA 1BW6A 3JRHA 2JA7J 3BG9A 3BR1A 1LFUP 4A3IJ 1GV5A 3OSGA 4CYCB 2GM4A 3S1QJ 3HOVJ 5EZHA 4AYBN 1PUFA 1R9TJ 3K2AA 3ZQLA 2OPTA 1UHSA 2GLOA 3OSFA 1MBKA 1IJWC 4UUTA 4L5EA 2VPRA 4MFDA 3MVPA 3A01A 1YRNB 2QF7A 1DU6A 3PO3J 3B6AA 2DTZA 5M3MJ 3F0CA 1IC8A 3M3YJ 1OCTC 1A5JA 2CRGA 4I6ZA 2YS9A 1WI3A 1HF0A 2DMPA 4C3IJ 1JUMA 2HOTA 1GVDA 3RZDJ 2O7OA 2LK2A 4D7NA 1WGXA 3G1MA 2I10A 2EZHA 3RKQA 3H3VK 5HODA 1UG2A 4DYRA 4M3FA 2O9LA 2WB1N 4MO7A 2DMQA 1FIAA 1MSEC 1FEXA 2CQQA 1U9NA 4C3HJ 3RQIA 5C4JJ 4IHVA 3W6VA 3TP0A 4A3KJ 2MGQA 1UMQA 2LLKA 2M0CA 2LP0A 5M5YJ 5EGOA 2M2EA 2DMUA 2K9SA 3CDLA 1ETQA 2D5VA 2MG4A 2LKXA 1ENHA 4JX6A 2E2HJ 4D5CA 4M3GA 1H88C 2E19A 1IG7A 2LR8A 3JRFA 3HDDA 1JUSA 1HLVA 3PO2J 1ETXA 4M6VA 2RAEA 1RESA 2FJ1A 2FX0A 1ITYA 3ZQFA 4B1RA 2Y9ZA 1IV6A 4LOCA 1GT0C 3JRCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5X J;  2DA7 A;  1LFB A;  4A3E J;  5JLX A;  5FKM A;  2K9N A;  4ABZ A;  2EQR A;  2ME6 A;  4XK4 A;  2ZB9 A;  3JR9 A;  1MBF A;  3G1L A;  2XGE A;  3HM5 A;  4XRS A;  4IHW A;  1SFO J;  2TRT A;  2K40 A;  3MN2 A;  5F0H A;  2X9D A;  4DZJ A;  2HQ5 A;  4NDL A;  3FIS A;  3IH4 A;  3NAR A;  3TP3 A;  3HBL A;  5EEA A;  1QPI A;  2DA3 A;  4JP0 A;  2R7Z J;  2XRL A;  3QQA A;  2XSD C;  3OIO A;  1AHD P;  4C2M J;  1BW5 A;  2YU9 J;  2ME0 A;  5FKL A;  5EYR A;  1RET A;  1LE8 B;  4IHY A;  3BR6 A;  1MBH A;  2R5Z A;  3HGG A;  2ID6 A;  2G0E A;  2OF7 A;  5C3E J;  1Z0X A;  4XRS G;  5F04 A;  1B8I A;  1U9O A;  4DYQ A;  5IP7 J;  3S14 J;  5IPA A;  3RZO J;  1F43 A;  4W1U A;  4BXX J;  2MW8 A;  1JTX A;  4A3C J;  2JJ7 A;  5EF6 A;  4M3B A;  2VUM J;  2R5Y A;  2DA1 A;  2MSY A;  2CU7 A;  1T33 A;  2HOA A;  5K7H A;  2JA8 J;  2DA2 A;  4DZP A;  2B63 J;  3SFI A;  5IOZ A;  1ETY A;  4UUS A;  2NVT J;  3Q3S A;  1IRZ A;  1OCP A;  1HDP A;  5F0C A;  1T56 A;  5E3M A;  1JTY A;  3BR2 A;  2EZI A;  4B4C A;  3MKL A;  1QVT A;  2H1K A;  2XGC A;  4JX4 A;  2DMN A;  4JYK A;  1Y1W J;  3A01 B;  2L9R A;  2M34 A;  2L7M P;  2E2I J;  5F08 A;  1JKQ C;  2L0K A;  2LD5 A;  2COB A;  1VND A;  2NS7 A;  1NK3 P;  4Y52 J;  2DMT A;  1E3O C;  4JX5 A;  5E3L A;  4V2F A;  2IEK A;  3E7L A;  4A69 C;  3VPR A;  1Z77 A;  1OJL A;  2LVS A;  5J1Y A;  1QVU A;  1QRY A;  3BT9 A;  3C2B A;  3LSG A;  3WHB A;  1SAN A;  4X6A J;  3L1P A;  1W0T A;  4XRM A;  2FQ4 A;  3A02 A;  2JWT A;  2XPW A;  2EH3 A;  3FKI J;  3QPS A;  2CUE A;  1S7E A;  3JRB A;  3BTI A;  1WH7 A;  3WHC A;  4QSH A;  1K61 A;  2ECB A;  3IH2 A;  3FK6 A;  1B72 B;  5IYD J;  3BR5 A;  1H89 C;  2NVY J;  3BQY A;  5EG0 A;  1ZQ3 P;  1P7I A;  2DA6 A;  2WAQ N;  1AKH B;  2K9Q A;  1FTZ A;  5FLM J;  4FE4 A;  1F36 A;  1G2H A;  1AKH A;  3S2H J;  1LE8 A;  4BBS J;  4A3F J;  5IYC J;  4FIS A;  3HOY J;  2KT0 A;  2PMZ N;  1ZK8 A;  1B72 A;  3OOU A;  3BG5 A;  2KDZ A;  4DW6 A;  1X2N A;  1JUP A;  3LSR A;  3S15 J;  5E3N A;  5M5W J;  1HCR A;  3S2D J;  2Y9Y A;  2N8G A;  2R0Q C;  4GFB A;  2YUS A;  1WPK A;  2DA4 A;  2WV1 A;  4A3J J;  4C3J J;  3Q0U A;  3S1M J;  2LY9 A;  1NTC A;  2JMW A;  2Y31 A;  1ETW A;  2ELK A;  3ZQG A;  2DN0 A;  2R92 J;  1POG A;  2JA5 J;  3M4O J;  1CQT A;  1ETK A;  5GP9 A;  2R93 J;  1I3Q J;  5IOY A;  1ETV A;  2DA5 A;  4BY7 J;  4A3G J;  3D1N I;  5FKK A;  4A3M J;  1IGN A;  5E3O A;  2Y0S N;  3I4M J;  4UUS B;  1FTT A;  2M9H A;  3SDG A;  1VI0 A;  1AU7 A;  1FIP A;  4A3L J;  2L7F P;  3ZQH A;  2Y30 A;  4AUX A;  3NAU A;  5EDN A;  5DS9 A;  3FIW A;  1RKT A;  4IHX A;  1O4X A;  4A3B J;  1VFC A;  2AHQ A;  1W0U A;  2JN6 A;  3B6C A;  4FCY A;  4A93 J;  3ZOB A;  1D5Y A;  3DCF A;  5JLW A;  5FKN A;  2XB0 X;  1ORK A;  1MNM C;  2HOS A;  1GUU A;  2DJN A;  1JGG A;  3GBG A;  2TCT A;  3BTJ A;  5F1J A;  1ZGW A;  1HOM A;  4V2G A;  3GTG J;  1I50 J;  4A3D J;  4RDU A;  1APL C;  1TWF J;  3O8G A;  4M3D A;  3LNQ A;  1BL0 A;  4J19 A;  3GTJ J;  3BTC A;  2CUF A;  1MSF C;  1X58 A;  3JRG A;  2EBI A;  4B3A A;  5FLV A;  1IUF A;  2X6O A;  2NOG A;  5FKO A;  2HYJ A;  3HEF A;  1ZKG A;  1XC5 A;  3BTL A;  2JA6 J;  3CMY A;  2HXO A;  3K7A J;  1VF9 A;  3O8H A;  2H8R A;  2HDD A;  1WCM J;  1K83 J;  3TW6 A;  2XPV A;  5GPA A;  1JJ6 C;  4MLO A;  3HOX J;  5J1R A;  2HI3 A;  1IDZ A;  3CQZ J;  4G12 A;  3JRA A;  4X1E A;  5F27 A;  1XS9 A;  1MBG A;  3S16 J;  1A6I A;  5EGO B;  3TW7 A;  2XB5 A;  5IYB J;  2EZK A;  5K7Z A;  5IP6 A;  3S1R J;  2QCO A;  1OFC X;  3LSJ A;  2Y2Z A;  4EEF G;  1XG1 A;  2LTP A;  1BA5 A;  5J1U A;  3Q0V A;  2FD5 A;  1JKO C;  3HB9 A;  1TWC J;  1TC3 C;  2IAI A;  4BKX A;  2AO9 A;  3GTO J;  2P81 A;  3BR0 A;  3GTM J;  3BR3 A;  1I6H J;  1ETO A;  3ZQI A;  9ANT A;  4DYC A;  2IBD A;  2NS8 A;  1TWH J;  1YRN A;  3S1N J;  3DEW A;  1B8I B;  1MH3 A;  1JT6 A;  1ZTR A;  3IH3 A;  5BNG A;  2LFB A;  5M3F J;  4IEJ A;  1JJ8 C;  3BG3 A;  2NVQ J;  5DTD A;  1JKR C;  2R5Y B;  1Q1V A;  2ECC A;  4QIW N;  5C44 J;  5J3L A;  4MIM A;  4HNV A;  2JK3 A;  1DU0 A;  3A03 A;  1IDY A;  3HOW J;  3GTP J;  4M3E A;  2HXI A;  1GDT A;  2O8K A;  1WH5 A;  3ZQC A;  3QPL A;  1P7J A;  3S17 J;  5F0F A;  4D7M A;  2ID3 A;  1TWA J;  2VKV A;  1MH4 A;  1BJZ A;  4CYC A;  3HOU J;  2VKE A;  2XPU A;  4XIC A;  4QTR A;  4BBR J;  2EZL A;  3PM1 A;  4W97 A;  5FJ8 J;  3IV5 A;  1HDD C;  3Q0W A;  2GBY A;  4I76 A;  3JRD A;  3BQZ A;  3SJM A;  1ZR4 A;  2XGD A;  2CJJ A;  3GTL J;  1U78 A;  2E1O A;  4MFE A;  2E2J J;  4XID A;  1JKP C;  1RR7 A;  5K7F A;  1H8A C;  1Y1V J;  2NVX J;  4BY1 J;  4FE7 A;  3UKG A;  1MBJ A;  4S0H B;  1U8B A;  1X2M A;  1NK2 P;  3JRE A;  2R5Z B;  3HGY A;  5C4X J;  2X48 A;  1GV2 A;  2CQX A;  4Y7N J;  5EG0 B;  1PUF B;  3JRI A;  3G1O A;  3I4N J;  1RKW A;  2W48 A;  5EZG A;  1TWG J;  1EF4 A;  2L7Z A;  3LSP A;  2M8G X;  5GPC A;  3H0G J;  1FJL A;  3FK7 A;  1JT0 A;  4FTH A;  3HOZ J;  3GTK J;  4AC0 A;  1MBE A;  4D5F A;  3GTQ J;  3LOC A;  5IP9 J;  1RPW A;  3CCY A;  1ZR2 A;  2VI6 A;  4RBO A;  3HKZ N;  3TED A;  1BW6 A;  3JRH A;  2JA7 J;  3BG9 A;  3BR1 A;  1LFU P;  4A3I J;  1GV5 A;  3OSG A;  4CYC B;  2GM4 A;  3S1Q J;  3HOV J;  5EZH A;  4AYB N;  1PUF A;  1R9T J;  3K2A A;  3ZQL A;  2OPT A;  1UHS A;  2GLO A;  3OSF A;  1MBK A;  1IJW C;  4UUT A;  4L5E A;  2VPR A;  4MFD A;  3MVP A;  3A01 A;  1YRN B;  2QF7 A;  1DU6 A;  3PO3 J;  3B6A A;  2DTZ A;  5M3M J;  3F0C A;  1IC8 A;  3M3Y J;  1OCT C;  1A5J A;  2CRG A;  4I6Z A;  2YS9 A;  1WI3 A;  1HF0 A;  2DMP A;  4C3I J;  1JUM A;  2HOT A;  1GVD A;  3RZD J;  2O7O A;  2LK2 A;  4D7N A;  1WGX A;  3G1M A;  2I10 A;  2EZH A;  3RKQ A;  3H3V K;  5HOD A;  1UG2 A;  4DYR A;  4M3F A;  2O9L A;  2WB1 N;  4MO7 A;  2DMQ A;  1FIA A;  1MSE C;  1FEX A;  2CQQ A;  1U9N A;  4C3H J;  3RQI A;  5C4J J;  4IHV A;  3W6V A;  3TP0 A;  4A3K J;  2MGQ A;  1UMQ A;  2LLK A;  2M0C A;  2LP0 A;  5M5Y J;  5EGO A;  2M2E A;  2DMU A;  2K9S A;  3CDL A;  1ETQ A;  2D5V A;  2MG4 A;  2LKX A;  1ENH A;  4JX6 A;  2E2H J;  4D5C A;  4M3G A;  1H88 C;  2E19 A;  1IG7 A;  2LR8 A;  3JRF A;  3HDD A;  1JUS A;  1HLV A;  3PO2 J;  1ETX A;  4M6V A;  2RAE A;  1RES A;  2FJ1 A;  2FX0 A;  1ITY A;  3ZQF A;  4B1R A;  2Y9Z A;  1IV6 A;  4LOC A;  1GT0 C;  3JRC A; 
#chains in the Genus database with same CATH topology
 1RR8 C;  5M5X J;  2ELJ A;  2Q2E B;  2HPM A;  3ZN0 A;  5D5W B;  2K9N A;  4ABZ A;  1LDK B;  4UB6 C;  3JR9 A;  3AL0 B;  4AWX B;  3G1L A;  2XGE A;  1YI2 I;  1UZC A;  3HG9 A;  2W4S A;  2A5Y B;  5F0H A;  3WE3 A;  2E1C A;  3I4P A;  2HQ5 A;  1UAA A;  4I01 A;  4MHG A;  4NDL A;  2EIM H;  2DPD A;  3FIS A;  5EEA A;  3I71 A;  2FBI A;  2M8E A;  3REO A;  4S05 A;  2R7Z J;  2XRL A;  2X1D A;  4JQF A;  5A2Q Z;  1AWC A;  1E0E A;  3LA3 A;  1AHD P;  4C2M J;  1DGW Y;  2CQN A;  1IN5 A;  2CW7 A;  1RET A;  4IHY A;  2PJP A;  3HHH A;  3H5A A;  3K1N A;  3HOT A;  4RA2 A;  3CCE I;  1Z0X A;  2DYR H;  3R60 A;  3TQN A;  2K4B A;  5F04 A;  2QSH X;  1FP2 A;  2CMP A;  3RZO J;  2ZXI A;  3W6J B;  3NEU A;  2K7L A;  4DJA A;  1H9T A;  2WY7 Q;  5ICG A;  2HEO A;  2Z1D A;  2CO5 A;  1Z3Y A;  2GIZ A;  3KEQ A;  2HDW A;  1NG7 A;  1LDJ A;  1E17 A;  3FF5 A;  1MMA A;  2XAU A;  1W1W E;  4OWR B;  1XGN A;  3QOE A;  1J75 A;  4CGZ A;  1V5F A;  3I53 A;  4P1W A;  2DA2 A;  4DZP A;  2MD5 A;  3Q3S A;  3OV8 A;  1OCP A;  1IN6 A;  1HDP A;  2GQQ A;  2KZV A;  3K69 A;  1Y56 A;  3EQL F;  5F0C A;  1BC7 C;  2XUB A;  5BOX A;  2XV4 S;  2K86 A;  4E6K G;  3MKL A;  1QVT A;  2H1K A;  3PNT A;  4MEY F;  4OIN F;  5GAE J;  4CCM A;  4JYK A;  1VQK I;  2PBI A;  4EJW A;  2M34 A;  2L7M P;  2KIM A;  1LVK A;  5F08 A;  1Y39 A;  1JKQ C;  3V8L A;  4I99 C;  1IRX A;  2K02 A;  2NS7 A;  3H1C A;  3WTU C;  2H94 A;  3MKY B;  1B9M A;  1NK3 P;  4Y52 J;  3J7Z I;  5CVU A;  1T39 A;  2IEK A;  3W3C A;  2QUF A;  4F93 B;  1IN4 A;  4C2T A;  1OIS A;  1Z77 A;  2WWY A;  3BZK A;  2V1U A;  2RKH A;  2DQR A;  3C2B A;  4WXH A;  3F72 A;  4LLL A;  3WHB A;  4A0Y A;  1H0M A;  3UNG C;  2BV6 A;  4X6A J;  2LYC A;  4XRM A;  3CC4 I;  2FQ4 A;  2WBM A;  2EH3 A;  3LQQ A;  3RQ4 A;  1ZG3 A;  3BTI A;  4M9X A;  3WHC A;  2EFN A;  2ECB A;  3JTG A;  3OR1 C;  3FK6 A;  4NC6 A;  1SMT A;  2K4J A;  4XKV A;  1G3Y A;  3BR5 A;  1ZQ3 P;  1P7I A;  2R7Q A;  5FFX A;  2WAQ N;  2A6T A;  4C2U A;  1ULY A;  2DOF A;  4PJ0 C;  1LE8 A;  2KIF A;  4HA8 A;  3GX4 X;  1D8J A;  2BW3 B;  1YFH A;  1E3P A;  2JA2 A;  4II3 A;  2B7E A;  1ZK8 A;  2PMZ N;  1B72 A;  1H9G A;  3CC7 I;  1M1E B;  3CMA I;  3BJ6 A;  3BG5 A;  4L9V A;  4DW6 A;  3SZP A;  3IKV A;  2M0M A;  3S15 J;  5E3N A;  4F91 B;  3LWF A;  3X2Q H;  4HQE A;  3S2D J;  2R7U A;  4A6D A;  2JPC A;  4OMY A;  2BHY A;  3NWT A;  1WPK A;  2K3P A;  3E97 A;  1TP4 A;  2XIG A;  2FBK A;  2BY0 A;  2LY9 A;  1NTC A;  2JMW A;  1ETW A;  3E5Q A;  4J01 A;  2R92 J;  2L3D A;  2HQN A;  1O7L A;  1QQI A;  1CQT A;  4MGR A;  2BXY A;  1ETK A;  1Z6R A;  2MC4 A;  4RS8 A;  5TGT A;  4BAC A;  2Z9O A;  2BW3 A;  4ENK A;  4KDP A;  2BY3 A;  3RYR A;  1U8R A;  1ETV A;  1BBY A;  2DA5 A;  2HYG D;  4IHS A;  5FKK A;  1YW7 A;  4O3M A;  4EMS A;  4LB5 A;  3V7S A;  2LRE A;  2ZBK A;  3CCM I;  1MDM B;  3ZQH A;  3G71 I;  2VL8 A;  5ICC A;  2QQ8 A;  4ESB A;  1FY7 A;  3GZ6 A;  1R5H A;  3COA C;  3ERM A;  3QYE A;  4U0Y A;  2V7F A;  3BZ6 A;  3DKW A;  3JW4 A;  4IHX A;  1J59 A;  1LDD A;  2DI3 A;  3MMY B;  2IS4 A;  5FLX Z;  1W0U A;  3F8F A;  1B9N A;  4G6T B;  1F1Z A;  3CF5 F;  4U0V A;  2R7F A;  1TL8 A;  2X1C A;  4PZJ A;  5JLW A;  3AAF A;  1MNM C;  2HOS A;  3JSP A;  3K1P A;  2DJN A;  2TDX A;  1XX5 A;  3V8K A;  2ESH A;  3HJE A;  2BY1 A;  3T8T A;  4V2G A;  3K10 A;  2FOW A;  4KIT B;  4A3D J;  1WWX A;  1TWF J;  1Z67 A;  2FUG 2;  2GOX B;  4M3D A;  3LNQ A;  1BL0 A;  3GTJ J;  3BTC A;  1MSF C;  1SFU A;  1XMK A;  5KNL A;  3JRG A;  4B3A A;  4AM3 A;  2ZJP F;  5CVR A;  5DUK A;  2L5Q A;  5LRR A;  5FLV A;  2X6O A;  1I1G A;  2NOG A;  3T5X A;  3CC2 I;  2XAH A;  4E4H A;  2KKO A;  2CWE A;  2F4I A;  4AYB A;  1V3F A;  3C1D A;  4A12 A;  2VT3 A;  2HU9 A;  4HOB A;  2CH0 A;  5E1Z B;  1FNN A;  3A1Y A;  5FLX K;  2K9L A;  1MNE A;  5J1R A;  1OQY A;  1IDZ A;  3I56 I;  2BOL A;  4R1H A;  4RLQ A;  4EM1 A;  4BXF A;  4L0Y B;  3S16 J;  1A6I A;  3HSE A;  4UY8 I;  2XB5 A;  1EKE A;  4AID A;  1I39 A;  5IP6 A;  3S1R J;  3I3L A;  5LRS A;  2Y2Z A;  2RNG A;  3L2Q A;  1XG1 A;  4M71 A;  4BDZ A;  4WF2 A;  5J1U A;  3Q0V A;  5BQT A;  1WZ2 A;  2KP6 A;  1JKO C;  2XSJ C;  4D0P A;  1TC3 C;  4BJ5 C;  2HPI A;  4X0G A;  1ZAO A;  4ZDP A;  2HR3 A;  3GTO J;  3ZMU A;  2P81 A;  3HXL A;  3E6D A;  1I6H J;  2C6Y A;  5D5V B;  1TTY A;  4PGG A;  1K78 B;  3H9Q A;  5H6R A;  3O2P E;  2OJE D;  4XBF A;  3OYM A;  2BGC A;  3FHN A;  2Z5U A;  2H6C A;  3BG3 A;  3IHU A;  3DBH B;  1JKR C;  1WKM A;  4ZYH A;  3FBI B;  4Y17 A;  2WA0 A;  1OYI A;  3VOE A;  4HLX A;  4IVN A;  2FOK A;  2BZT A;  3Q5F A;  3V42 A;  5C44 J;  1R36 A;  4RGX A;  1YW8 A;  4U7B A;  4B48 A;  1R1U A;  1BI1 A;  3GWZ A;  4ENN A;  1TQI A;  3DQV C;  1D1C A;  1J9I A;  4WX9 A;  2IA0 A;  3FBN B;  3GTP J;  1W4M A;  2HXI A;  1Y0U A;  5LGN A;  5F64 A;  2JPB A;  2VBX A;  3DU6 A;  3QPL A;  3I54 A;  4P55 A;  1I6X A;  1LUJ B;  1XDU A;  2HOE A;  2R3S A;  3RPU D;  2VKE A;  3ZMT A;  2O03 A;  3H3U A;  4BQQ A;  1XD7 A;  3EUK L;  4RB3 C;  4QTR A;  3FX3 A;  4I09 A;  3PM1 A;  2DU9 A;  3DXJ F;  1I5Z A;  2CQ7 A;  2IW5 A;  5DYM A;  5HS7 A;  1O3R A;  2H27 A;  1VQN I;  3HRS A;  2P7C B;  4L9J A;  3JAM K;  2CJJ A;  4EJT A;  2E1O A;  4E7J A;  2E2J J;  1EH7 A;  3ZMV A;  5KHD A;  4ITV A;  1JKP C;  3OIP A;  3CO6 C;  1FSE A;  2BVM A;  2DTR A;  4XSX F;  4FE7 A;  3UKG A;  4HV6 A;  2VKH A;  3G3Z A;  3OOP A;  1TBX A;  2PMZ A;  3TGN A;  3FXR A;  2AXL A;  3D5R C;  2Y75 A;  2XAF A;  4Y7N J;  4KN4 X;  2Y48 A;  2LNB A;  2XF5 A;  4OAY A;  1B4A A;  4GRI A;  2W48 A;  4GYG A;  3BJA A;  5LGT A;  1G3T A;  4KN7 X;  5DCM A;  5GPC A;  1V4R A;  1Y0N A;  3H36 A;  1FJL A;  4FTH A;  3BCB A;  1XMA A;  4UV8 A;  4AC0 A;  4MNU A;  4D5F A;  3OWT A;  3GTQ J;  2G9W A;  4HAM A;  5FB2 A;  2KZG A;  3I59 A;  1BW6 A;  2OUM A;  3CCQ I;  1G6N A;  4ETS A;  1LFU P;  1QNT A;  2CFO A;  2GM4 A;  3SXY A;  4NHJ A;  3S1Q J;  2E5N A;  2V9V A;  3DFG A;  3OYA A;  3A4C A;  5EZH A;  1K6Y A;  1PVE A;  1R9T J;  2QQB A;  1TNS A;  2GLO A;  3OSF A;  1FZP B;  3K4N A;  1MBK A;  1XGS A;  3S32 A;  1IJW C;  3SFZ A;  2I8D A;  5CQE A;  3M8E A;  2LH9 A;  3MVP A;  3TL4 X;  2LBF B;  3A01 A;  2QF7 A;  4DOZ A;  1LVA A;  1J0R A;  3B6A A;  3PFI A;  5JR3 A;  3PJR A;  4CDG A;  2FE3 A;  1OCT C;  2YX7 A;  4IO9 F;  2FQ3 A;  1A5J A;  2GAU A;  2COM A;  3F3X A;  5J4Y A;  1S5L C;  3GFL A;  2CRG A;  4LK0 F;  2M4K A;  4I6Z A;  2IRF G;  5FGM A;  3HRM A;  1JUM A;  2XRN A;  4XM3 A;  1BIA A;  1GVD A;  2DCE A;  3HC7 A;  4WXD A;  1Y6I A;  2O7O A;  5B1A H;  2LK2 A;  4D7N A;  4UVA A;  1W36 C;  2QA4 I;  4HX8 A;  3RKQ A;  3DKY A;  4PK4 A;  1K79 A;  3CCR I;  1G4D A;  2O9L A;  5HS9 A;  3R6S A;  1MSE C;  1TNT A;  2CQQ A;  3H5R A;  3OL3 A;  4L9N A;  2VC1 A;  4YFN F;  4YG2 F;  3RQI A;  2W1O A;  2M30 A;  3L9F A;  3F6V A;  4DIQ A;  3TP0 A;  3F8N A;  5EJC A;  1E3H A;  4B43 A;  3WGH A;  4G9Y A;  1Z91 A;  2H6B A;  2M2E A;  2O5R A;  2Z3Y A;  4B3X A;  2A07 F;  2LKX A;  1ENH A;  3E1S A;  3B02 A;  4M3G A;  2XGX A;  1IG7 A;  1SD4 A;  3ZPL A;  3OMY A;  4IZZ A;  4M6X A;  3W6K B;  3E6C C;  3PO2 J;  1XN7 A;  5F6F A;  1YYV A;  1ETX A;  3MCZ A;  3L00 A;  1T0F A;  2QKM B;  2FX0 A;  3BC8 A;  1C0W A;  2R7X A;  1X1A A;  1D0Y A;  2Q8K A;  3L7W A;  2CS3 A;  2A69 F;  2Y9Z A;  3HTS B;  2EV6 A;  1VQM I;  4YEJ A;  4XOP A;  3ZQQ A;  1UG0 A;  2ISZ A;  2VOO A;  1JXS A;  1LJ9 A;  3DLL F;  5FKM A;  4EGZ A;  4MEX F;  2NYX A;  2ME6 A;  5K5Q A;  4KA4 A;  4IHW A;  3J81 Z;  3O3K A;  2ZO4 A;  4PJJ A;  3GYH X;  1SFO J;  2TRT A;  5TJJ A;  1NG6 A;  2BVL A;  4DZJ A;  3OR2 C;  3P5J A;  1O3S A;  3LAJ A;  3TP3 A;  3HBL A;  1QPI A;  2PG4 A;  2DA3 A;  4JP0 A;  3ABU A;  1ZN2 A;  3QQA A;  3WU0 A;  2M45 A;  2EA4 A;  3OY9 A;  4IOA F;  2ME0 A;  4ZZD A;  2XVC A;  2W57 A;  4BJ6 C;  2ID6 A;  1GLN A;  2OF7 A;  1TZL A;  1QZY A;  2JUC A;  1B8I A;  1U9O A;  4DYQ A;  1IF1 A;  4W1U A;  4BXX J;  2MW8 A;  2HVS A;  4I2O A;  1K78 A;  3LMM A;  1JTX A;  4A6E A;  3R4K A;  2CU7 A;  1JE8 A;  3IC7 A;  2E5Z A;  2VQL A;  3KP5 A;  4UXN A;  2FNA A;  3SFI A;  5IOZ A;  3QPH A;  1R1T A;  3PUF A;  2RNJ A;  1IRZ A;  3SYT A;  1GHC A;  5GAH J;  4BDY A;  1G59 A;  1S3J A;  1MJA A;  3BR2 A;  1PJR A;  2YR2 A;  4Z6Y A;  1KYW A;  4RM3 A;  5L3D A;  3HRU A;  3GFJ A;  2J5P A;  2LBF A;  5FRO A;  3A01 B;  2CV1 A;  3GZ5 A;  4BJT A;  1PP8 F;  4BH9 A;  2EFQ A;  2LD5 A;  4BEH A;  1VND A;  2GWR A;  4JX5 A;  2K9M A;  2UUZ A;  4B44 A;  3L2V A;  4CHU A;  3MZY A;  2F5D A;  3WTV C;  4A69 C;  2DXI A;  2OBP A;  1S8N A;  2ZNY A;  1U5T A;  3MEX A;  2K5C A;  3TOB A;  3J7Y J;  2A6H F;  3LSG A;  4II2 A;  2HDC A;  4CCK A;  2V6E A;  1OMI A;  4XKW A;  3BPX A;  1TW2 A;  3A02 A;  3PSF A;  3TO9 A;  1P92 A;  2XPW A;  3FKI J;  3BJO A;  1AA7 A;  1SVO A;  2HVQ A;  3OYD A;  3VWB A;  4HX4 A;  2PQ8 A;  1S7E A;  4QSH A;  1V55 H;  2W82 A;  3IH2 A;  3OS2 A;  1FT9 A;  4N0B A;  1B72 B;  4QWQ A;  5IYD J;  6PAX A;  2O61 A;  1IZ1 A;  2DFE A;  3D0S A;  3FMS A;  2JUG A;  2LDU A;  3BQY A;  3CDI A;  2OQR A;  4BE0 A;  4BU2 A;  3K1M A;  4HLY A;  5KVR A;  1FTZ A;  3DV8 A;  3I5U A;  1BM9 A;  2WAQ A;  1F36 A;  2WV0 A;  3U9G A;  1AKH A;  3S2H J;  4M9S A;  1DPU A;  2ZKZ A;  4A3F J;  1X19 A;  2MA3 A;  2MBF A;  3ONQ A;  3U1K A;  1ZHF A;  3HHG A;  3DTI A;  3GLX A;  4FIS A;  4OMZ A;  3H0D A;  3WOD F;  3E5U A;  1X4P A;  2ELH A;  2X4H A;  1X2N A;  4P9U A;  3LSR A;  4JBA A;  2LKP A;  5M5W J;  1HCR A;  2M4G A;  1P4A A;  4IPA A;  1K4S A;  2O0Y A;  2XAG A;  2HZD A;  1X1B A;  1R22 A;  2DYS H;  1QGP A;  3G6E I;  4GFB A;  5LBQ A;  3O6B B;  1B6A A;  3IRR A;  4A3J J;  2VXZ A;  3Q0U A;  1R4N B;  4PUS A;  3S1M J;  3PIO F;  2Y31 A;  2MLG A;  5LD2 C;  4OIR F;  2VJJ A;  3A2K A;  2QBY B;  2CG4 A;  3BLY A;  4KUM A;  4HNU A;  3N97 A;  2KRC A;  5J40 A;  3T1B A;  1I3Q J;  3C18 A;  1JHF A;  3C7J A;  3ZQ7 A;  5IOY A;  4BY7 J;  2WB1 A;  3S93 A;  3OYE A;  4HRI A;  1X3W B;  5E1W A;  1HXD A;  4F7Z A;  2L01 A;  1SVL A;  3H9J A;  4AIK A;  3SDG A;  1VI0 A;  3QOD A;  1FIP A;  3VB2 A;  4A3L J;  5B1B H;  3RDI A;  2XDV A;  3CCS I;  4AUX A;  2VOP A;  3GFI A;  1IRG A;  3SDB A;  1WFX A;  3NAU A;  4FQG A;  3OS0 A;  2LKS A;  3HYI A;  2RN7 A;  5DS9 A;  1O57 A;  3CCJ I;  4UV9 A;  3L2R A;  1T38 A;  3TMO A;  4BQN A;  1ON1 A;  1VFC A;  2QGU A;  1OCZ H;  3VSK A;  4OIQ F;  4QPO A;  4FCY A;  3ZOB A;  1D5Y A;  1RC9 A;  3L09 A;  2HGC A;  1ZRF A;  1W7P A;  1KA8 A;  4M9Z A;  5FKN A;  1KYZ A;  5JFR A;  1GUU A;  1JGG A;  3GBG A;  5F1J A;  3J81 K;  2X6X A;  2OTL I;  1IO2 A;  3OYG A;  3QWL A;  3QRF F;  4WWC A;  4HNT A;  2FBH A;  2KPM A;  4LLN A;  1I27 A;  2ZSH B;  3E6M A;  2EBI A;  2NXN B;  3FXQ A;  3M1E A;  2IS2 A;  2IGM A;  1IUF A;  4AIH A;  5FKO A;  3RKY A;  2HYJ A;  5JI6 A;  3HEF A;  2DPU A;  2NAZ A;  4U0W A;  3BTL A;  2B9S A;  2GXB A;  2VJI A;  3G73 A;  2HXO A;  1PUE E;  4BXU A;  2OV7 A;  1J2X A;  3CUQ C;  4I0A A;  4S04 A;  3R0J A;  5FRN A;  2XPV A;  1JJ6 C;  5HNH A;  1W7P D;  3WTY C;  1K7A A;  4NBQ A;  4CA0 A;  1KON A;  1XTA A;  2F4O B;  4KIF A;  4G12 A;  5F27 A;  5B5E C;  1MBG A;  2RDP A;  1P9Q C;  3RI4 A;  2EA2 A;  4QLC U;  3TW7 A;  2JT1 A;  5IYB J;  3HOS A;  3ASO H;  3FMQ A;  3HPG A;  2KRH A;  2QCO A;  4CIC A;  2LTP A;  4BS9 A;  2VC0 A;  3GFM A;  3HB9 A;  4N4O B;  4XKB A;  4ZYA A;  4I02 A;  2IAI A;  2L9S A;  4BKX A;  2V6C A;  3ASN H;  1LEA A;  4O5V A;  1W7P B;  4NC8 A;  5ED4 A;  3GTM J;  4FAS D;  3BR3 A;  5DCM B;  4LG3 A;  2FSW A;  3MFK A;  2HVR A;  1BI0 A;  1ETO A;  3BY6 A;  1R1V A;  4LK1 F;  2IBD A;  2H09 A;  2YPR A;  5ICE A;  3KLO A;  1S7A A;  2VN2 A;  2DJI A;  4RM2 A;  3MZH A;  1B8I B;  1QU3 A;  1MH3 A;  4XON A;  3IH3 A;  4BGD A;  4IEJ A;  4NNJ A;  4XNF A;  3GXO A;  1FBS A;  4ENJ A;  1OR7 A;  5H20 A;  5DTD A;  5E1X A;  3CJT B;  2JVH A;  2GZW A;  3PNV A;  1MJ9 A;  1Q1V A;  3T8R A;  5CVI A;  5D6F A;  2XF6 A;  5IT3 A;  2X6W A;  4CZC A;  3E6B A;  1HST A;  4E7L A;  3PIP F;  4HZF A;  1SD7 A;  2IA1 A;  1WI9 A;  2YU3 A;  2LF8 A;  3A03 A;  3VSL A;  1D3Y A;  3HOW J;  1VQP I;  4RGS A;  1VQ4 I;  1YO5 C;  2O8K A;  1WH5 A;  3TKY A;  1LEB A;  3ABM H;  3WTS C;  3RCO A;  3CME I;  3CCU I;  3S17 J;  4D7M A;  3DU5 A;  3VFZ A;  3L2C A;  2JRT A;  1BJZ A;  4CYC A;  3KP2 A;  1NHA A;  2XPU A;  3G2B A;  4PJM A;  4BBR J;  3PFY A;  3OYK A;  3VDX A;  4EJV A;  4RMN A;  4IOC F;  1XDS A;  1BIB A;  2GBY A;  3SJM A;  2XGD A;  1U5T B;  5EEH A;  4N9I A;  4NQW B;  1U78 A;  4XLC A;  2DQL A;  2ZC2 A;  1WJB A;  3GW2 A;  4CZZ A;  4XID A;  1RR7 A;  5DD8 A;  1QZE A;  1Y1V J;  1DQU A;  3ZXS A;  1U0J A;  5A2Q K;  2NVX J;  3VYT B;  1YJN I;  2LC2 A;  1MBJ A;  1K6O A;  2OU2 A;  1X2M A;  1NK2 P;  4LMY A;  4GDF A;  3EUH A;  1N75 A;  3CLO A;  2VQG A;  1USS A;  3E3V A;  2IGN A;  2QVO A;  4AU7 A;  5C4X J;  2VPL A;  1PUF B;  2E7X A;  3QU3 A;  3I4N J;  5EZG A;  2UXX A;  3ABT A;  3KYD B;  4AVZ A;  4ZYD A;  2AXT C;  3LSP A;  1CF7 B;  4GGG A;  3HOZ J;  3GTK J;  4HDU A;  1O3Q A;  4U87 A;  3RTR A;  3ECH A;  5IP9 J;  2Y0M A;  2ZXH A;  5L3C A;  1J5Y A;  2VI6 A;  3HSF A;  2G7H A;  3IL2 A;  3HKZ N;  1W5C C;  3TED A;  5CJ9 A;  1NH3 A;  1SMY F;  3DWL E;  3LA7 A;  3M1C A;  3CP8 A;  3BR1 A;  3KFW X;  3S3M A;  5AIQ A;  4NC7 A;  3EYI A;  4CYC B;  3A0B C;  1UJ8 A;  3HOV J;  4PSW A;  1PUF A;  3K2A A;  1WJE A;  3RKW A;  1FOK A;  1Z05 A;  3F8C A;  1WSU A;  4IX7 A;  2CYY A;  3P9C A;  5D6E A;  4MFD A;  4L0Z B;  2OCE A;  5DEQ A;  1DU6 A;  1SC7 A;  1VQO I;  5M3M J;  4BE2 A;  4G6Q A;  2OD5 A;  2IS1 A;  3F0C A;  3H5N A;  3RPQ A;  4XKC A;  2E35 A;  2P4W A;  3DEE A;  1IC8 A;  3J7A O;  3D5S C;  3S2W A;  1FP1 D;  2E7W A;  5DD4 A;  3R0A A;  1XGM A;  5ERI A;  2ESN A;  5D5U B;  2HOT A;  1XMX A;  3ERE D;  4KMF A;  3RZD J;  3IRQ A;  1IV8 A;  2HS5 A;  1MMS A;  1WGX A;  4FET A;  3K0L A;  5AIP A;  3BOQ A;  1QA6 A;  2EV0 A;  4ZJZ A;  2JZY A;  4LD5 A;  5JVT A;  1BOA A;  1FIA A;  3KCC A;  2ICW G;  4V19 K;  1G3W A;  2BE5 F;  4RAY A;  1FOX A;  2RQP A;  4PFP A;  1KU3 A;  4XSZ F;  1BC8 C;  1FWZ A;  2OQG A;  4BNC A;  2PJR B;  1FC3 A;  5AON A;  3F9K A;  5HDN A;  3RPU A;  3GCM A;  4NQW A;  2LLK A;  3LL7 A;  2QQA A;  2E1M C;  2Z33 A;  5EGO A;  2M3A A;  1YX5 A;  2R7T A;  1R49 A;  4JX6 A;  4HW0 A;  3KLN A;  4D5C A;  1GXQ A;  2P6S A;  3WTW C;  5FRM A;  1UCR A;  2MC3 A;  1FBQ A;  2EV5 A;  2BBY A;  3K70 D;  3U21 A;  1RES A;  1ACI A;  1N77 A;  4XN3 A;  4PGH A;  4GO1 A;  5DV5 A;  1GT0 C;  3JRC A;  4KIC A;  4B47 A;  2DA7 A;  4E7I A;  1LFB A;  1UST A;  2Q0O A;  2KL4 A;  4R79 A;  5JLX A;  1O7F A;  2BY2 A;  2L9V A;  3IWZ A;  4F52 A;  4M72 A;  2DDB A;  2IVM A;  3K4B A;  1G3S A;  2D1V A;  2K27 A;  2EQR A;  2E60 A;  1UFM A;  3H9G A;  4BQA A;  1MBF A;  4XRS A;  2P0W A;  2X9D A;  2XKO A;  2KIU A;  3GME A;  5D4R A;  1YTY A;  4F3Q A;  3AG4 H;  2F5F A;  4YEL A;  2EK5 A;  4ZTF A;  2QLZ A;  1A6Q A;  3H35 A;  3DPU A;  5B3S H;  3IH4 A;  3NAR A;  1D0Z A;  2K85 A;  4OIP F;  1S72 I;  2OAZ A;  1R58 A;  4KIS A;  4EM0 B;  2XSD C;  4UNO A;  2RC4 A;  3OIO A;  4FHT A;  1F5T A;  4EM2 A;  1A04 A;  3OYB A;  2KIQ A;  5FKL A;  5EYR A;  1LE8 B;  2R7V A;  2R5Z A;  3HGG A;  3K4C A;  4P9F A;  4JOM A;  5C3E J;  1RNL A;  3VOD A;  3S14 J;  3LQR A;  4DNC A;  2CQK A;  5HLT A;  5IPA A;  1XB4 A;  3QAH A;  3QPT A;  1QPM A;  1XGO A;  4ESJ A;  2HQA A;  1T2K A;  2JRM A;  5EF6 A;  3NWS A;  1Z1D A;  2R5Y A;  2DA1 A;  2KRF A;  2VKD A;  1T33 A;  2HOA A;  5LFA A;  5KAF C;  3DP7 A;  2JA8 J;  2AQF A;  4KMU X;  4AVP A;  4I0B A;  1ETY A;  4UUS A;  1YQA A;  4WK8 F;  1S29 A;  2NVT J;  1IUY A;  2QWW A;  1T56 A;  3IP4 B;  2IT0 A;  1JTY A;  1CF7 A;  4B4C A;  4PJL A;  4NB5 A;  1LB2 A;  1MMG A;  2EIL H;  2XGC A;  3DLA A;  4JX4 A;  1J7K A;  1P2F A;  2XAQ A;  3N05 A;  3GUD A;  3MZ8 A;  1DP3 A;  4HQM A;  2L9R A;  4L5J A;  3CCV I;  2E2I J;  2V1X A;  2L0K A;  1EH8 A;  1KQ9 A;  2W24 A;  2COB A;  4BEH B;  1E3O C;  4TV7 A;  4D1Q A;  2NNN A;  3E7L A;  5J1Y A;  2R7W A;  4Y33 A;  3J80 Z;  1QVU A;  3QOP A;  1HBX G;  2JSC A;  1QRY A;  3ABK H;  3BT9 A;  1KU7 A;  3J7A Y;  2L4A A;  1HKS A;  2I5U A;  1D8K A;  3L1P A;  1W0T A;  4IRH A;  2KIS A;  2JWT A;  3DTK A;  4LJZ F;  2DW4 A;  3WTZ A;  2QZ8 A;  2A61 A;  2KHM A;  2QBY A;  1DGR M;  2RRE A;  2UXN A;  5DM7 F;  1VQ8 I;  4RGU A;  2PEX A;  3PNY A;  3CLQ A;  4YFK F;  2BEO A;  3ROU A;  5DCF A;  1YHQ I;  5EG0 A;  4J00 A;  2HTJ A;  4PSX A;  1OYW A;  2K9Q A;  2O8X A;  5ILV A;  4FE4 A;  2VQC A;  2IXS A;  4M6Y A;  3VYS B;  1FOY A;  3F22 A;  3BP8 A;  3MAJ A;  4EGY A;  1FYL A;  1WJF A;  4CXF A;  5JVG F;  1FMW A;  2CGP A;  3HOY J;  2KT0 A;  1YLF A;  5CVJ A;  3WGG A;  5K5R A;  1QHH D;  2KDZ A;  1ON2 A;  2FMY A;  2VIX A;  1ONV A;  1FYK A;  4Q47 A;  1FLI A;  1Y8R B;  2CW0 F;  3W2A A;  1D1A A;  2CSO A;  1QBJ A;  4KIB A;  1YG2 A;  3ZR8 X;  2N8G A;  1I1S A;  2WV1 A;  4C3J J;  3EUH C;  4L9T A;  4YRV A;  2HQR A;  3CMM A;  3DEU A;  3PSI A;  1OR7 C;  2EJR A;  3ZQG A;  2DN0 A;  1KU9 A;  1POG A;  2K3F A;  4N9H A;  2JA5 J;  2L2O A;  3M4O J;  4XN0 A;  2GXA A;  5DUI A;  4YII A;  3CUQ B;  5GP9 A;  3MKW B;  1V54 H;  4AD9 A;  2VBW A;  2R93 J;  4XRF A;  1ZRD A;  4A3G J;  2IS6 A;  4A3M J;  1IGN A;  3CCL I;  3OYJ A;  1R5I D;  3FXJ A;  3WTT C;  4UUS B;  1FTT A;  2M9H A;  1N25 A;  3K4L A;  2UV1 A;  4LIU A;  2ZSI B;  2FF4 A;  2L7F P;  3TDZ C;  2Y30 A;  3WG9 A;  4C9Y A;  5EDN A;  1RUN A;  3FM5 A;  1YJ9 I;  2A68 F;  4IL6 C;  1W5T A;  3FIW A;  3SZG A;  3ZCO A;  1SFE A;  1MND A;  2NS0 A;  1RKT A;  2FRH A;  2Z2S B;  4N4N B;  2CV0 A;  5HOO A;  3MWM A;  4HF1 A;  3CTA A;  2CUJ A;  2JN6 A;  2P7V B;  3B6C A;  4A93 J;  1FPQ A;  5H2F C;  1Z9C A;  2IGK A;  1IXR C;  4IF4 A;  5L3B A;  2V1D A;  4RLF A;  3FXL A;  1WQ2 A;  4UVB A;  1IW7 F;  1R7J A;  1V5G A;  2Y0S A;  4RGR A;  1ZGW A;  1HOM A;  1JGS A;  3VYR B;  1LFP A;  1I50 J;  1SFX A;  3W2W A;  2FU4 A;  1B1B A;  2OZU A;  1APL C;  4J19 A;  1SFK A;  2CUF A;  3CUQ A;  2XF7 A;  2O3F A;  4PJN A;  3F8B A;  1PYV A;  2FEZ A;  4E7H A;  4I98 B;  3SQN A;  3LSH A;  3KZY A;  4Q48 A;  1YJW I;  1R23 A;  1D1B A;  2DOD A;  2CFX A;  5TIS C;  3CMY A;  3KPH A;  3ML6 A;  2DFF A;  2KFD A;  3GLL A;  1VF9 A;  3O8H A;  4GYI A;  2H8R A;  3DPT A;  4Y13 A;  1WCM J;  1VQ5 I;  1S9H A;  1K83 J;  3BWG A;  3TW6 A;  5GPA A;  5ILS A;  2PX9 A;  4O6J A;  4MLO A;  3HOX J;  4FT8 A;  4ZZL A;  3FM3 A;  2AS5 F;  3VEP A;  1UB9 A;  3JRA A;  2ZXJ A;  1XS9 A;  1BOB A;  5H6Q A;  2IP2 A;  5EGO B;  3ISP A;  5K7Z A;  1DPR A;  3ZRG A;  2D2W A;  2D45 A;  5J4V A;  1OFC X;  3LSJ A;  2MH9 A;  3I59 B;  3CD6 I;  4CUG A;  3MQ0 A;  1BA5 A;  3I55 I;  2B0L A;  2FD5 A;  1TWC J;  4U88 A;  4EV0 A;  5LHI A;  2EIJ H;  2ZJQ F;  2KMU A;  5J8C A;  2AO9 A;  5LLQ A;  3BR0 A;  3FXO A;  2E1M B;  3QYB A;  5HLG A;  1OKR A;  3RSN A;  2ZJR F;  4G7O F;  9ANT A;  2XHK A;  4CH7 A;  4PFO A;  3KP7 A;  1BR4 A;  1YRN A;  1ZTR A;  4ZC3 A;  5BNG A;  2DT5 A;  1EV7 A;  3DF8 A;  1OCO H;  2DFI A;  3HTU A;  3SEQ A;  5LEK A;  1JJ8 C;  2ZCW A;  2NVQ J;  3CF2 A;  1AOY A;  2R5Y B;  4LG0 A;  2W00 A;  1QZZ A;  1UEL B;  2KLO A;  1MDM A;  3M8J A;  4Y15 A;  3VYU B;  3ABL H;  5JHU A;  1ZLJ A;  2HKX A;  5J3L A;  2L4M A;  2WAD A;  4F92 B;  3RIR A;  3ELK A;  1OYY A;  2IJL A;  2JK3 A;  2YSR A;  2Q1Z B;  2P8T A;  1IDY A;  2BYV E;  2JVG A;  4XR6 A;  4M3E A;  5HS8 A;  1ZYR F;  4AIJ A;  2XRO A;  1GDT A;  1S7O A;  2W85 A;  2WY8 Q;  2ETH A;  2L02 A;  4HSR A;  2LG4 A;  2XKP A;  1DDN A;  2VON A;  3M8F A;  4UB8 C;  4XLE A;  5E8I A;  2O6G E;  2Q2E A;  5F0F A;  1WRJ A;  1KZH A;  2VKV A;  1SEU A;  4ESF A;  1MMD A;  2WTE A;  2IA2 A;  1SVM A;  5FJ8 J;  1HDD C;  4W97 A;  3IV5 A;  4I76 A;  1YX3 A;  2E36 A;  4MFE A;  1HQC A;  1H8A C;  3GO5 A;  1FBU A;  1PP7 U;  2MH2 A;  2KJB A;  1IN8 A;  3I58 A;  1Z6T A;  4S0H B;  1U8B A;  4JK1 X;  2UWM A;  1P4X A;  4B8X A;  5BS6 A;  5DM6 F;  3HGY A;  1UHM A;  2MD0 A;  2R5Z B;  2NOJ B;  3S3N A;  5J6X A;  4A0X A;  2CQX A;  2HYF A;  3HL2 A;  5CLS A;  1S6L A;  5E79 C;  3OYL A;  1X1C A;  2A6E F;  5K5O A;  1BR2 A;  2ZJ2 A;  1EH6 A;  4PDK A;  1EF4 A;  2L7Z A;  2YX4 A;  1WJD A;  2M8G X;  2PLY A;  1N78 A;  3E5X A;  1JT0 A;  2LRD A;  2CV2 A;  2F6C A;  4KIG A;  1REP C;  1MBE A;  5LEJ A;  2NRA C;  3C2H A;  4HF2 A;  1ERD A;  2LMD A;  1RPW A;  1STZ A;  4E70 A;  2FXA A;  4RBO A;  2Y69 H;  5KAI C;  3JRH A;  2JA7 J;  3KZZ A;  2GXG A;  4A3I J;  1GV5 A;  4DQ2 A;  1Y8Q B;  5LGU A;  2FML A;  3EUA A;  2RQQ A;  3SZT A;  3TO7 A;  5LHH A;  3ZQL A;  3V7R A;  1UHS A;  3KP4 A;  3JAM Z;  1BI3 A;  3CZ6 A;  1IXS B;  1T95 A;  2WAF A;  3FHZ A;  5D8K B;  4CCL A;  1ZLK A;  2GA2 A;  4UUT A;  3JTH A;  4L5E A;  3TOA A;  2VPR A;  4M74 A;  3ZMS A;  4L18 B;  2DTZ A;  2LF7 A;  2VAS A;  3LSI A;  4G8X A;  2E71 A;  1RRJ A;  5K1Y A;  1E2X A;  4LB6 B;  3M3Y J;  3V7C A;  2DOA A;  4IRG A;  4A2U A;  4EQQ A;  3K2Z A;  3C2G A;  1G8X A;  3LFK A;  1A36 A;  1HF0 A;  4XOT A;  2F2E A;  3TO6 A;  5FFZ A;  3CJR B;  2JSP A;  2AQE A;  3ECO A;  3G1M A;  3LA2 A;  2XC7 A;  3QU6 A;  2QKL B;  4RB0 A;  5KCM A;  3LSK A;  1ZAR A;  4A5N A;  4ZH4 F;  1UG2 A;  3KZI C;  4M3F A;  4LG0 B;  3H3V K;  2JTV A;  4MO7 A;  2EB7 A;  3MKZ A;  1IRF A;  3BZC A;  1P6R A;  4C3H J;  5C4J J;  3K4J A;  1MZB A;  3LST A;  2NVU B;  3W6V A;  2HZT A;  2L7K A;  2FNP A;  4M73 A;  1D0X A;  4RAF A;  1UMQ A;  2LSO A;  4LFU A;  2M0C A;  4CYD A;  3FXU A;  5M5Y J;  2HTS A;  2EIN H;  3FZV A;  3CDL A;  4RB2 C;  3LFU A;  1ETQ A;  5HNF A;  3G4S I;  4A5M A;  4Z2Y A;  4RB1 A;  4GCV A;  2MYS A;  2LR8 A;  3JRF A;  4YIF A;  1JUS A;  1HLV A;  4H0E A;  2STW A;  2KDO A;  1MMN A;  4M6V A;  3R61 A;  1ZG5 A;  2EIK H;  3HSR A;  3ZQF A;  1IV6 A;  1SAU A;  1TLH B;  4LOC A;  2ZME B;  2VE8 A;  3M07 A;  3WE2 A;  2ZNZ A;  4A3E J;  2R7O A;  3P9I A;  3H3Z A;  3HUG A;  4XK4 A;  2ZB9 A;  3HM5 A;  3KP3 A;  3QYF A;  1LQ1 A;  1RUO A;  2K40 A;  3MN2 A;  4MQ9 F;  2M5W A;  1MJB A;  4HV5 A;  3HKZ A;  2VT2 A;  2ZFW A;  4YFX F;  2OZ6 A;  2MLK A;  1Z7U A;  3H92 A;  4Q4Z F;  5E8G A;  2KJC A;  3C3W A;  2YU9 J;  1BW5 A;  4ANJ A;  4LLG F;  3DTE A;  3BR6 A;  1UHW A;  1FMV A;  1MBH A;  3OIQ A;  5F1R A;  2G0E A;  3CES A;  2QQ9 A;  2XAJ A;  2G7U A;  4XRS G;  4CO8 A;  3KE2 A;  4WCG A;  5IP7 J;  2ACJ A;  2VJ4 A;  4UHT A;  1F4K A;  1F43 A;  1HKT A;  5TRD A;  4A3C J;  2JJ7 A;  4DGW B;  1A31 A;  3K9T A;  4IHT A;  1VZ0 A;  4M3B A;  2VUM J;  1O3T A;  2MSY A;  5CPR B;  3E0J B;  5K7H A;  4OOI A;  2IPQ X;  3KYC B;  5LHG A;  1L3L A;  3KIO A;  2B63 J;  1KGS A;  1U6G A;  4OU0 A;  2VXD A;  5E3M A;  2DT6 A;  2EZI A;  3GEZ A;  3AFH A;  2UZK A;  3IAS 2;  1TT0 A;  2DMN A;  3GF2 A;  1Y1W J;  5BPI A;  2HWV A;  2EFW A;  5FO5 A;  1X1P A;  1Z7L A;  2DMT A;  2A3S A;  1RIO H;  1D5V A;  5E3L A;  3MD2 A;  4V2F A;  4BHC A;  2DBB A;  2M1B A;  1VQ7 I;  5IT9 K;  3P9K A;  3IWF A;  2D1H A;  2ZFU A;  4Y3O A;  1R4M B;  3VPR A;  1OJL A;  2LVS A;  3CJN A;  1TT5 B;  3LSM A;  4WXC A;  3L2W A;  1R5G A;  5HDK A;  1SD6 A;  4HX7 A;  2F5V A;  1JI8 A;  3EDP A;  4KT5 C;  3ZP5 A;  4HDV A;  4HST A;  4XL9 A;  4ENM A;  1SAN A;  4CCN A;  4ON0 A;  1EA3 A;  2HKO A;  2E34 A;  3FMR A;  3QPS A;  3BCA A;  1W5S A;  2CUE A;  4L5I A;  1ZH5 A;  3JRB A;  3RKX A;  1WH7 A;  1K61 A;  4IRI A;  5L3G A;  1SD5 A;  1TQP A;  1LPQ A;  4CCJ A;  1H89 C;  2X1E A;  2NVY J;  1T0F C;  4EJO A;  2DA6 A;  4HF0 A;  1AKH B;  1FSH A;  5FLM J;  2OTJ I;  2OCC H;  1G2H A;  3TDU C;  4LIT A;  1HKQ A;  2CUZ A;  2WAE A;  3OL4 A;  2W7N A;  4UVC A;  1I3A A;  4BBS J;  5IYC J;  5KK1 A;  1BN5 A;  2H1L A;  3NQO A;  3FDY A;  1OLT A;  1OPC A;  5IT9 Z;  3OOU A;  1PDN C;  1JUP A;  3UR3 C;  1MIJ A;  1RZ4 A;  4B09 A;  3KEO A;  5GAD J;  2Y9Y A;  5D8L B;  4DBQ A;  2R0Q C;  4XLH A;  4MTD A;  5E17 F;  2YUS A;  2DA4 A;  4HEA 2;  4E7K A;  1GXP A;  2F4M B;  2VB6 A;  2ELK A;  5ILU A;  3HPH A;  5BPD A;  4MQV A;  3ULQ B;  2FA5 A;  4G94 A;  3OYN A;  1ODD A;  2DFH A;  1ZG1 A;  3EET A;  2JQ7 A;  1YE9 A;  3M7G A;  2PFB A;  3P7N A;  2QM3 A;  4K2E A;  3D1N I;  2M7B A;  1J09 A;  2P5K A;  1Q1H A;  2Y0S N;  3DBR B;  3U1D A;  5E3O A;  3I4M J;  2EPF A;  3FKJ A;  1XSV A;  1AU7 A;  4R8H A;  2OC6 A;  2RVC A;  3DBL B;  4IJA A;  4IQJ A;  5E20 A;  4ZYE A;  4G7H F;  4ZDO A;  4CCO A;  1OCC H;  2LY2 A;  2OA4 A;  1O4X A;  1T6S A;  4CSW A;  4A3B J;  1TW3 A;  2AHQ A;  5HLI A;  1BJA A;  2VJ5 A;  4KFC A;  3OYI A;  4P5O A;  2F5E A;  3DPL C;  3CJQ B;  3WG7 H;  4F55 A;  3V8J A;  3BDD A;  3DCF A;  1YOV B;  4BAY A;  3QP5 A;  2ZME A;  2XB0 X;  3W2V A;  3KX2 A;  1ORK A;  4IQ4 A;  1VQ9 I;  3F8M A;  1HW2 A;  1HA8 A;  4HYE A;  4BE1 A;  2V1N A;  2TCT A;  3BTJ A;  1MD0 A;  1R00 A;  1VQL I;  3HRT A;  1ZGJ A;  3CO7 C;  1FOW A;  3GTG J;  1KQ0 A;  2P5V A;  2PMH A;  4RDU A;  1RI7 A;  3O8G A;  1U5T C;  3K70 C;  2VLA A;  4ZDL A;  4HBL A;  3D5L A;  2DO7 A;  2VE9 A;  1YW9 A;  1X58 A;  4Y4R A;  3WU1 B;  2X51 A;  3RJP A;  3T0Y A;  3PQK A;  2R7R A;  1SAX A;  1KU2 A;  3Q9S A;  2X0L A;  2DOE A;  5JHF A;  1YIT I;  1ZKG A;  3KYL A;  1XC5 A;  2JA6 J;  2RGV A;  3ZMZ A;  3ZGK A;  5L3E A;  2IGO A;  3K7A J;  2QSG X;  2HNH A;  1K4T A;  4IKF A;  2HDD A;  2EWN A;  2V9P A;  4EAT A;  5HLH A;  4E7Z A;  2PN6 A;  2HI3 A;  4ASN A;  2LY1 A;  3ZN1 A;  3CQZ J;  1WJ5 A;  4HG2 A;  3K4K A;  3FXM A;  4X1E A;  3B73 A;  3EYY A;  3V4G A;  5ICF A;  2EZK A;  1FX7 A;  3SEZ A;  4KYW A;  1IAW A;  1LKX A;  1HW5 A;  4EEF G;  3IKT A;  1KQ8 A;  4FX0 A;  2R7D A;  2V79 A;  2X85 A;  1T98 A;  4QPQ A;  4A0Z A;  1XCB A;  3F23 A;  1LNW A;  3F21 A;  2GA1 A;  3TBI A;  2W84 A;  3WGI A;  3WU2 C;  2QYO A;  3I64 A;  1HC8 A;  1BI2 A;  3ZQI A;  2GIV A;  4DYC A;  4XQF A;  4MTE A;  4ZTJ A;  4BHB A;  1XCV A;  2NS8 A;  1TWH J;  3I9V 2;  3S1N J;  3DEW A;  2R4G A;  4BHP A;  2L54 A;  2VBY A;  1JT6 A;  2Z16 A;  3HZJ A;  5M3F J;  2LFB A;  4FX4 A;  1YIJ I;  5CVV A;  2NNY A;  2MFZ A;  2A05 A;  4KT6 A;  1YS6 A;  3HIF A;  4NUB A;  2ZME C;  4U7D A;  4ZYG A;  2ECC A;  4QIW N;  1VTN C;  4OAZ A;  4BYY A;  5EEG A;  4MIM A;  4HNV A;  3AG3 H;  1XPX A;  1EJ9 A;  4OIO F;  3HUG B;  3OYH A;  5BMZ A;  4XLP F;  1DU0 A;  2F5C A;  2STT A;  3IAM 2;  2L9N A;  3ZQC A;  2ZXW H;  3I0T A;  4KNY A;  1U2W A;  3CUO A;  3PUB A;  2PI0 A;  1GVJ A;  1P7J A;  5L3F A;  1HW1 A;  2ID3 A;  1TWA J;  1MH4 A;  5CQG A;  3S8P A;  3HOU J;  2M87 A;  1X3Z B;  1WVR A;  4XIC A;  2EZL A;  2QEX I;  3Q0W A;  2KQR A;  3RYP A;  2E1N A;  2DT7 B;  1WHU A;  2DLL A;  3BQZ A;  3JRD A;  1ZR4 A;  3BG6 A;  3WTX C;  3GTL J;  2QEN A;  1L0O C;  5FD5 A;  1DUX C;  4GXO A;  5K7F A;  3N4M A;  3PQJ A;  1MKM A;  1ZRC A;  4BY1 J;  1B59 A;  1R6R A;  3QP6 A;  4KJZ A;  3JRE A;  4Q5S F;  3AKZ A;  4H4K C;  5GTH C;  1VQ6 I;  1ZGA A;  2F48 A;  2X48 A;  1GV2 A;  3A0H C;  5CKT A;  1U3E M;  3U2R A;  2P5L C;  5EG0 B;  3JRI A;  1XSX A;  3G1O A;  2GOM A;  1R71 A;  1FYM A;  4HPQ A;  1RKW A;  1TWG J;  3OYC A;  3BG7 A;  5CYV A;  1HSJ A;  4EJU A;  3H0G J;  3FK7 A;  4P96 A;  2MAB A;  2BXZ A;  3EPZ A;  5GAG J;  3LOC A;  4YIR X;  2ISY A;  1X3U A;  2QSF X;  3CCY A;  4I7H A;  4E7S A;  2HFH A;  1WJC A;  4BUP A;  3LAP A;  1ZR2 A;  1CGP A;  2M7A A;  1A35 A;  2H8W A;  3GVA A;  2V26 A;  1YS7 A;  3BG9 A;  3GZN B;  4BQO A;  4D9J A;  2V4J C;  4DBR A;  3OSG A;  5HVQ C;  1F9N A;  2R7S A;  2PJR A;  4BL0 B;  4LGW A;  4AYB N;  4G6D A;  2CW8 A;  2OPT A;  4RAZ A;  2LOO A;  4G7Z F;  3K4M A;  2RV8 A;  5D4S A;  2BHZ A;  3PL8 A;  1DP7 P;  2J5O A;  4XLN F;  3JSO A;  1QHG A;  1OCR H;  1YRN B;  4EVI A;  2A5W A;  5IY5 H;  3DKX A;  3PO3 J;  3S3O A;  4XMY A;  2Z99 A;  3FWE A;  1IN7 A;  1MGT A;  1ZRE A;  5J47 A;  2ADU A;  2DAO A;  4C30 A;  1P4W A;  2VBZ A;  2XAS A;  2YS9 A;  1WI3 A;  3IUO A;  2VOD A;  2DMP A;  3NRV A;  4C3I J;  3ESW B;  5E18 F;  5J8F A;  1JHH A;  2EFP A;  4UUV A;  3AG2 H;  1Z3X A;  4LIV A;  4PCQ A;  1WJA A;  3AL0 C;  1X1D A;  2DK8 A;  2I10 A;  1YIO A;  2EZH A;  3Q9V A;  5HOD A;  1Z21 A;  4DYR A;  1IXC A;  2VQH A;  2WB1 N;  3K6G A;  2DMQ A;  3F6O A;  1FEX A;  2P6T A;  3J80 K;  3ZMD A;  1U9N A;  1W36 D;  3OYF A;  1QO0 D;  3OS1 A;  1XSD A;  4XLF A;  4IXA A;  4IHV A;  5HDG A;  2WC2 A;  4A3K J;  1T8I A;  3L2U A;  1V5E A;  1BR1 A;  3KEY A;  4RAG A;  1T08 B;  2MGQ A;  3KP6 A;  2LP0 A;  3FXK A;  1TQM A;  5B66 C;  2DMU A;  2K9S A;  2DK5 A;  2D5V A;  2MG4 A;  2E2H J;  5FD6 A;  2EFO A;  1H88 C;  2DDA A;  5GTI C;  4XLA A;  3KET A;  3M9A A;  2E19 A;  5DDG A;  2V9K A;  5D5X B;  3HDD A;  2W25 A;  3BPV A;  3JCU C;  2RAE A;  1X4O A;  2PMU A;  2FJ1 A;  4XOR A;  3BRO A;  1MW7 A;  3CDH A;  4B1R A;  1ITY A;  1ZEL A;  3AG1 H;  3SHF A;  2X6Y A;  3CP2 A; 
#chains in the Genus database with same CATH homology
 5M5X J;  2DA7 A;  1LFB A;  4A3E J;  5JLX A;  5FKM A;  2K9N A;  4ABZ A;  2EQR A;  2ME6 A;  4XK4 A;  2ZB9 A;  3JR9 A;  1MBF A;  3G1L A;  2XGE A;  3HM5 A;  4XRS A;  4IHW A;  1SFO J;  2TRT A;  2K40 A;  3MN2 A;  5F0H A;  2X9D A;  4DZJ A;  2HQ5 A;  4NDL A;  3FIS A;  3IH4 A;  3NAR A;  3TP3 A;  3HBL A;  5EEA A;  1QPI A;  2DA3 A;  4JP0 A;  2R7Z J;  2XRL A;  3QQA A;  2XSD C;  3OIO A;  1AHD P;  4C2M J;  1BW5 A;  2YU9 J;  2ME0 A;  5FKL A;  5EYR A;  1RET A;  1LE8 B;  4IHY A;  3BR6 A;  1MBH A;  2R5Z A;  3HGG A;  2ID6 A;  2G0E A;  2OF7 A;  5C3E J;  1Z0X A;  4XRS G;  5F04 A;  1B8I A;  1U9O A;  4DYQ A;  5IP7 J;  3S14 J;  5IPA A;  3RZO J;  1F43 A;  4W1U A;  4BXX J;  2MW8 A;  1JTX A;  4A3C J;  2JJ7 A;  5EF6 A;  4M3B A;  2VUM J;  2R5Y A;  2DA1 A;  2MSY A;  2CU7 A;  1T33 A;  2HOA A;  5K7H A;  2JA8 J;  2DA2 A;  4DZP A;  2B63 J;  3SFI A;  5IOZ A;  1ETY A;  4UUS A;  2NVT J;  3Q3S A;  1IRZ A;  1OCP A;  1HDP A;  5F0C A;  1T56 A;  5E3M A;  1JTY A;  3BR2 A;  2EZI A;  4B4C A;  3MKL A;  1QVT A;  2H1K A;  2XGC A;  4JX4 A;  2DMN A;  4JYK A;  1Y1W J;  3A01 B;  2L9R A;  2M34 A;  2L7M P;  2E2I J;  5F08 A;  1JKQ C;  2L0K A;  2LD5 A;  2COB A;  1VND A;  2NS7 A;  1NK3 P;  4Y52 J;  2DMT A;  1E3O C;  4JX5 A;  5E3L A;  4V2F A;  2IEK A;  3E7L A;  4A69 C;  3VPR A;  1Z77 A;  1OJL A;  2LVS A;  5J1Y A;  1QVU A;  1QRY A;  3BT9 A;  3C2B A;  3LSG A;  3WHB A;  1SAN A;  4X6A J;  3L1P A;  1W0T A;  4XRM A;  2FQ4 A;  3A02 A;  2JWT A;  2XPW A;  2EH3 A;  3FKI J;  3QPS A;  2CUE A;  1S7E A;  3JRB A;  3BTI A;  1WH7 A;  3WHC A;  4QSH A;  1K61 A;  2ECB A;  3IH2 A;  3FK6 A;  1B72 B;  5IYD J;  3BR5 A;  1H89 C;  2NVY J;  3BQY A;  5EG0 A;  1ZQ3 P;  1P7I A;  2DA6 A;  2WAQ N;  1AKH B;  2K9Q A;  1FTZ A;  5FLM J;  4FE4 A;  1F36 A;  1G2H A;  1AKH A;  3S2H J;  1LE8 A;  4BBS J;  4A3F J;  5IYC J;  4FIS A;  3HOY J;  2KT0 A;  2PMZ N;  1ZK8 A;  1B72 A;  3OOU A;  3BG5 A;  2KDZ A;  4DW6 A;  1X2N A;  1JUP A;  3LSR A;  3S15 J;  5E3N A;  5M5W J;  1HCR A;  3S2D J;  2Y9Y A;  2N8G A;  2R0Q C;  4GFB A;  2YUS A;  1WPK A;  2DA4 A;  2WV1 A;  4A3J J;  4C3J J;  3Q0U A;  3S1M J;  2LY9 A;  1NTC A;  2JMW A;  2Y31 A;  1ETW A;  2ELK A;  3ZQG A;  2DN0 A;  2R92 J;  1POG A;  2JA5 J;  3M4O J;  1CQT A;  1ETK A;  5GP9 A;  2R93 J;  1I3Q J;  5IOY A;  1ETV A;  2DA5 A;  4BY7 J;  4A3G J;  3D1N I;  5FKK A;  4A3M J;  1IGN A;  5E3O A;  2Y0S N;  3I4M J;  4UUS B;  1FTT A;  2M9H A;  3SDG A;  1VI0 A;  1AU7 A;  1FIP A;  4A3L J;  2L7F P;  3ZQH A;  2Y30 A;  4AUX A;  3NAU A;  5EDN A;  5DS9 A;  3FIW A;  1RKT A;  4IHX A;  1O4X A;  4A3B J;  1VFC A;  2AHQ A;  1W0U A;  2JN6 A;  3B6C A;  4FCY A;  4A93 J;  3ZOB A;  1D5Y A;  3DCF A;  5JLW A;  5FKN A;  2XB0 X;  1ORK A;  1MNM C;  2HOS A;  1GUU A;  2DJN A;  1JGG A;  3GBG A;  2TCT A;  3BTJ A;  5F1J A;  1ZGW A;  1HOM A;  4V2G A;  3GTG J;  1I50 J;  4A3D J;  4RDU A;  1APL C;  1TWF J;  3O8G A;  4M3D A;  3LNQ A;  1BL0 A;  4J19 A;  3GTJ J;  3BTC A;  2CUF A;  1MSF C;  1X58 A;  3JRG A;  2EBI A;  4B3A A;  5FLV A;  1IUF A;  2X6O A;  2NOG A;  5FKO A;  2HYJ A;  3HEF A;  1ZKG A;  1XC5 A;  3BTL A;  2JA6 J;  3CMY A;  2HXO A;  3K7A J;  1VF9 A;  3O8H A;  2H8R A;  2HDD A;  1WCM J;  1K83 J;  3TW6 A;  2XPV A;  5GPA A;  1JJ6 C;  4MLO A;  3HOX J;  5J1R A;  2HI3 A;  1IDZ A;  3CQZ J;  4G12 A;  3JRA A;  4X1E A;  5F27 A;  1XS9 A;  1MBG A;  3S16 J;  1A6I A;  5EGO B;  3TW7 A;  2XB5 A;  5IYB J;  2EZK A;  5K7Z A;  5IP6 A;  3S1R J;  2QCO A;  1OFC X;  3LSJ A;  2Y2Z A;  4EEF G;  1XG1 A;  2LTP A;  1BA5 A;  5J1U A;  3Q0V A;  2FD5 A;  1JKO C;  3HB9 A;  1TWC J;  1TC3 C;  2IAI A;  4BKX A;  2AO9 A;  3GTO J;  2P81 A;  3BR0 A;  3GTM J;  3BR3 A;  1I6H J;  1ETO A;  3ZQI A;  9ANT A;  4DYC A;  2IBD A;  2NS8 A;  1TWH J;  1YRN A;  3S1N J;  3DEW A;  1B8I B;  1MH3 A;  1JT6 A;  1ZTR A;  3IH3 A;  5BNG A;  2LFB A;  5M3F J;  4IEJ A;  1JJ8 C;  3BG3 A;  2NVQ J;  5DTD A;  1JKR C;  2R5Y B;  1Q1V A;  2ECC A;  4QIW N;  5C44 J;  5J3L A;  4MIM A;  4HNV A;  2JK3 A;  1DU0 A;  3A03 A;  1IDY A;  3HOW J;  3GTP J;  4M3E A;  2HXI A;  1GDT A;  2O8K A;  1WH5 A;  3ZQC A;  3QPL A;  1P7J A;  3S17 J;  5F0F A;  4D7M A;  2ID3 A;  1TWA J;  2VKV A;  1MH4 A;  1BJZ A;  4CYC A;  3HOU J;  2VKE A;  2XPU A;  4XIC A;  4QTR A;  4BBR J;  2EZL A;  3PM1 A;  4W97 A;  5FJ8 J;  3IV5 A;  1HDD C;  3Q0W A;  2GBY A;  4I76 A;  3JRD A;  3BQZ A;  3SJM A;  1ZR4 A;  2XGD A;  2CJJ A;  3GTL J;  1U78 A;  2E1O A;  4MFE A;  2E2J J;  4XID A;  1JKP C;  1RR7 A;  5K7F A;  1H8A C;  1Y1V J;  2NVX J;  4BY1 J;  4FE7 A;  3UKG A;  1MBJ A;  4S0H B;  1U8B A;  1X2M A;  1NK2 P;  3JRE A;  2R5Z B;  3HGY A;  5C4X J;  2X48 A;  1GV2 A;  2CQX A;  4Y7N J;  5EG0 B;  1PUF B;  3JRI A;  3G1O A;  3I4N J;  1RKW A;  2W48 A;  5EZG A;  1TWG J;  1EF4 A;  2L7Z A;  3LSP A;  2M8G X;  5GPC A;  3H0G J;  1FJL A;  3FK7 A;  1JT0 A;  4FTH A;  3HOZ J;  3GTK J;  4AC0 A;  1MBE A;  4D5F A;  3GTQ J;  3LOC A;  5IP9 J;  1RPW A;  3CCY A;  1ZR2 A;  2VI6 A;  4RBO A;  3HKZ N;  3TED A;  1BW6 A;  3JRH A;  2JA7 J;  3BG9 A;  3BR1 A;  1LFU P;  4A3I J;  1GV5 A;  3OSG A;  4CYC B;  2GM4 A;  3S1Q J;  3HOV J;  5EZH A;  4AYB N;  1PUF A;  1R9T J;  3K2A A;  3ZQL A;  2OPT A;  1UHS A;  2GLO A;  3OSF A;  1MBK A;  1IJW C;  4UUT A;  4L5E A;  2VPR A;  4MFD A;  3MVP A;  3A01 A;  1YRN B;  2QF7 A;  1DU6 A;  3PO3 J;  3B6A A;  2DTZ A;  5M3M J;  3F0C A;  1IC8 A;  3M3Y J;  1OCT C;  1A5J A;  2CRG A;  4I6Z A;  2YS9 A;  1WI3 A;  1HF0 A;  2DMP A;  4C3I J;  1JUM A;  2HOT A;  1GVD A;  3RZD J;  2O7O A;  2LK2 A;  4D7N A;  1WGX A;  3G1M A;  2I10 A;  2EZH A;  3RKQ A;  3H3V K;  5HOD A;  1UG2 A;  4DYR A;  4M3F A;  2O9L A;  2WB1 N;  4MO7 A;  2DMQ A;  1FIA A;  1MSE C;  1FEX A;  2CQQ A;  1U9N A;  4C3H J;  3RQI A;  5C4J J;  4IHV A;  3W6V A;  3TP0 A;  4A3K J;  2MGQ A;  1UMQ A;  2LLK A;  2M0C A;  2LP0 A;  5M5Y J;  5EGO A;  2M2E A;  2DMU A;  2K9S A;  3CDL A;  1ETQ A;  2D5V A;  2MG4 A;  2LKX A;  1ENH A;  4JX6 A;  2E2H J;  4D5C A;  4M3G A;  1H88 C;  2E19 A;  1IG7 A;  2LR8 A;  3JRF A;  3HDD A;  1JUS A;  1HLV A;  3PO2 J;  1ETX A;  4M6V A;  2RAE A;  1RES A;  2FJ1 A;  2FX0 A;  1ITY A;  3ZQF A;  4B1R A;  2Y9Z A;  1IV6 A;  4LOC A;  1GT0 C;  3JRC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...