5IYDJ

Human core-pic in the initial transcribing state (no iis)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iydJ00
2M34A 2O7OA 3G1MA 3A01B 1GVDA 3LSPA 4MLOA 3OSGA 1P7IA 3GTLJ 4RDUA 2FQ4A 4V2GA 5F0HA 4AYBN 2EQRA 3FIWA 4FTHA 5DTDA 2JN6A 2YS9A 3LSGA 1TWAJ 1IV6A 3HGGA 3IH2A 1FIPA 4B1RA 5IOYA 2DTZA 2QCOA 3HM5A 1IC8A 1ETQA 5FLMJ 1A5JA 3A02A 1JTYA 1WI3A 3CQZJ 1ZTRA 5GPCA 2ELKA 2MW8A 2OPTA 4A3KJ 2DA5A 1JKRC 4GFBA 3ZOBA 5FKMA 5FKNA 3HOWJ 4LOCA 2FD5A 1GV2A 1P7JA 4G12A 2R93J 3JR9A 4W1UA 5E3OA 2HI3A 1U9NA 2DN0A 1GUUA 2G0EA 2TCTA 2JWTA 3CMYA 1JKOC 1XC5A 2E1OA 3O8HA 2EZIA 2HQ5A 3LOCA 2L9RA 5GP9A 4DYCA 2YU9J 5FLVA 3ZQCA 4JX5A 2LP0A 3HB9A 2CJJA 4QSHA 1BW6A 3S1RJ 5EZHA 4M3FA 1RKWA 2DA4A 2QF7A 4FE4A 2DMQA 3FK6A 1ZGWA 2DMPA 4JP0A 5GPAA 3L1PA 2MG4A 4FISA 4XICA 2YUSA 3G1LA 2R92J 3CCYA 2NVXJ 2O8KA 4ABZA 2EH3A 3LNQA 1IUFA 4D5CA 1IG7A 4A3DJ 1WH5A 1RETA 1JUPA 3B6AA 1Y1VJ 5IP6A 1WPKA 2DA7A 5C4JJ 4XRSG 1IGNA 1MBKA 1X2MA 1K83J 4A3LJ 2FX0A 1YRNA 1JJ8C 1Y1WJ 1IJWC 5FKKA 4C2MJ 1K61A 4MFDA 1OCPA 2JA6J 5E3MA 1PUFA 2VKEA 2NVYJ 2R5YA 3FK7A 1HDDC 4RBOA 3BR5A 1ITYA 3ZQFA 1JUSA 2AO9A 2JJ7A 3TW7A 3RKQA 1W0UA 4I6ZA 4IHWA 2LLKA 1TWFJ 4MIMA 5M5XJ 4D5FA 1UHSA 4CYCB 3D1NI 1AHDP 2XB5A 1MBFA 2DMTA 5BNGA 1TWGJ 5EYRA 1WH7A 4V2FA 3PO3J 3S1MJ 4A3FJ 1E3OC 5M3MJ 2E2HJ 1ETYA 1QPIA 3HOYJ 2Y0SN 2ECCA 5EEAA 2E2IJ 1YRNB 2X9DA 3SFIA 2XGEA 3WHCA 2NOGA 1B72B 1F43A 1T33A 1ZR2A 1FTZA 3BTLA 1Z77A 2M2EA 4J19A 3GTMJ 2ID3A 1T56A 3S1NJ 1MNMC 2IBDA 3BG5A 2Y31A 2D5VA 4QTRA 3S2DJ 1BA5A 1BW5A 2MGQA 1Q1VA 4Y52J 1FTTA 4S0HB 3HOVJ 3BR0A 3BTIA 2XPWA 3ZQIA 5K7HA 1LFUP 1MBEA 4HNVA 3BQYA 4DZPA 1ORKA 1JJ6C 2HDDA 1MH3A 4Y7NJ 1FJLA 3MKLA 3M3YJ 2HOTA 1VI0A 3S14J 1AU7A 1S7EA 3BG3A 3JRBA 4C3HJ 4A3CJ 3BT9A 2DA1A 4BBRJ 2GM4A 1A6IA 1ENHA 1RR7A 1Z0XA 3Q3SA 3HOUJ 5M3FJ 4XRSA 5EGOA 2JA5J 2Y9YA 3GTJJ 5E3LA 1HDPA 1R9TJ 3GTPJ 3JRDA 5FJ8J 2KT0A 4D7MA 3Q0VA 1LE8A 2LD5A 1XS9A 4JX6A 2OF7A 2FJ1A 5E3NA 4A3MJ 2PMZN 1MBGA 5EG0B 3SDGA 5EF6A 1MSEC 1U9OA 3HDDA 4M3BA 2B63J 1OCTC 3C2BA 1BJZA 2EZHA 5DS9A 5IOZA 5F04A 4XRMA 1QVUA 4B4CA 1DU0A 1FIAA 4IHXA 3HBLA 4JX4A 1GV5A 3BR6A 2VUMJ 1TWHJ 2K9QA 4L5EA 2ID6A 2L0KA 5K7ZA 3BR1A 1ETKA 2TRTA 2Y30A 4DZJA 1NK3P 1POGA 4IEJA 1TC3C 4M6VA 1QRYA 3HOZJ 3OIOA 5EGOB 5EDNA 5EZGA 2R5YB 2DMNA 3K2AA 2XPUA 3TEDA 2HXIA 3HKZN 3JRAA 3A01A 2DA6A 1HF0A 2AHQA 1F36A 5HODA 1VF9A 1HLVA 4M3DA 3H3VK 3H0GJ 2ME0A 1U78A 3BR3A 2XRLA 5IPAA 1HOMA 5M5WJ 1OJLA 1VNDA 1CQTA 4NDLA 3IV5A 2CUFA 3OOUA 4JYKA 1H89C 3DCFA 5F0FA 1UG2A 2E2JJ 3JRCA 3HEFA 2HOSA 1WGXA 2K9NA 5IYDJ 3K7AJ 3Q0UA 4DYQA 5IYCJ 2DJNA 1RESA 2JA8J 1ETXA 2ZB9A 2IEKA 2K40A 4BBSJ 2IAIA 3NARA 3I4MJ 5J1RA 3S15J 1RPWA 3GTQJ 5J1UA 3RZDJ 3FKIJ 1ZR4A 2LTPA 4UUTA 4C3JJ 2WV1A 3ZQLA 1IDYA 2VPRA 3S16J 1IDZA 1LFBA 3SJMA 3MVPA 4MFEA 3G1OA 3QPSA 3JRHA 3Q0WA 4X1EA 2EZKA 3S17J 1I6HJ 2ME6A 5F27A 2NS8A 4QIWN 2GLOA 3W6VA 2VKVA 1SANA 5C44J 4I76A 1B8IA 5JLWA 1DU6A 9ANTA 2LKXA 1GT0C 2EBIA 2VI6A 1I3QJ 1H8AC 2M0CA 2DA2A 1G2HA 3RZOJ 5J1YA 1IRZA 4A3BJ 4A93J 5FKOA 4FCYA 2DMUA 1ZK8A 4CYCA 2H1KA 2NS7A 2XPVA 4M3GA 4IHVA 3RQIA 3PM1A 5C4XJ 5F08A 1AKHB 2R5ZA 1WCMJ 3B6CA 1JGGA 2MSYA 2JK3A 5EG0A 2E19A 1FEXA 2M8GX 2XB0X 3DEWA 1B8IB 1JT0A 3MN2A 4DW6A 4BY7J 4B3AA 2L7FP 3VPRA 3NAUA 3ZQGA 3HGYA 3A03A 1X2NA 3BG9A 2LK2A 5IP9J 2XSDC 4BXXJ 3ZQHA 1GDTA 2CU7A 1H88C 3GTKJ 3TW6A 4A69C 2NVTJ 2EZLA 3UKGA 2WAQN 4EEFG 3IH4A 2K9SA 2Y2ZA 2COBA 4XIDA 4A3IJ 4AUXA 5F1JA 3GTOJ 1MBJA 2RAEA 3BTCA 2CRGA 1BL0A 4A3EJ 2NVQJ 2HYJA 2L7ZA 1JKPC 2LVSA 2GBYA 3I4NJ 3GBGA 5M5YJ 2R5ZB 1ZKGA 1U8BA 4UUSA 3WHBA 3HOXJ 3M4OJ 1B72A 3S2HJ 4A3GJ 1ETOA 3BR2A 2WB1N 3JRIA 3S1QJ 2JMWA 3OSFA 1ETVA 3LSJA 4MO7A 3QPLA 4D7NA 1HCRA 2LR8A 1TWCJ 2R0QC 3JREA 1JTXA 1MSFC 2KDZA 5IYBJ 1MH4A 1NTCA 1ZQ3P 2O9LA 2N8GA 3E7LA 2L7MP 5J3LA 1SFOJ 2XGDA 2H8RA 4A3JJ 4C3IJ 2LFBA 1JT6A 3IH3A 1W0TA 2M9HA 3TP3A 2CQXA 1JUMA 5C3EJ 3CDLA 3QQAA 3PO2J 1UMQA 4UUSB 2HOAA 4AC0A 2X48A 1EF4A 1NK2P 5FKLA 4DYRA 5JLXA 2CQQA 4FE7A 1D5YA 3BQZA 4W97A 3JRFA 2CUEA 3O8GA 3GTGJ 1PUFB 1OFCX 5IP7J 1QVTA 1ETWA 1APLC 4IHYA 2LY9A 1X58A 2X6OA 2I10A 2P81A 2R7ZJ 3F0CA 5K7FA 2ECBA 2JA7J 2Y9ZA 3FISA 4X6AJ 1LE8B 5F0CA 2W48A 1AKHA 4XK4A 1RKTA 4BY1J 2DA3A 3JRGA 1VFCA 3TP0A 4BKXA 3LSRA 2XGCA 1XG1A 3BTJA 2HXOA 1MBHA 1I50J 1O4XA 1JKQC 4M3EA
chains in the Genus database with same CATH superfamily
1G6NA 3G1MA 1GVDA 4HSRA 3LSPA 4N9IA 4ESFA 3OSGA 4RDUA 5ICCA 2EFWA 2EQRA 2XRNA 1Y0NA 3GZNB 3VYTB 3LAJA 4EJUA 3ONQA 3EPZA 4B1RA 1R36A 2DTZA 2CV1A 5HDKA 3QU6A 3ASNH 3QYFA 3GCMA 3QAHA 1DPUA 2VBXA 1BOBA 2QGUA 2VB6A 3CJNA 1JTYA 2M4KA 3FHZA 3J7AO 3EDPA 1P4XA 5LHIA 3WTUC 1VQ7I 2BY3A 5GTIC 4LOCA 1Z67A 3GWZA 2M45A 4EJOA 1GV2A 2V1DA 1O3TA 4G12A 3Q5FA 3ZXSA 3MKYB 1LVAA 1IRFA 2MLKA 2PMZA 1T0FC 1D8KA 3TO9A 2HI3A 4G8XA 1U9NA 1GUUA 2QZ8A 2TCTA 2BHYA 3CUQB 2L4AA 1JKOC 4M72A 1XC5A 3BY6A 3RQ4A 2E1OA 3EETA 1LB2A 4EGYA 1KZHA 2OZUA 3LOCA 1KYWA 4DYCA 2YU9J 1RZ4A 2I5UA 3ZQCA 1J7KA 4RGXA 3EUHC 3HB9A 2CJJA 4EJTA 2IA2A 3QP5A 3TOAA 3GFIA 5ICGA 2ZO4A 2CQ7A 3KLOA 2JPBA 4EMSA 3FK6A 1YTYA 3DXJF 1ZGWA 1HSJA 3ZMTA 1EV7A 4FISA 2CUJA 3JAMK 2AXTC 1ZG5A 2K4BA 2H6BA 1IUFA 1N25A 1ZRDA 1FYMA 3LA7A 1JUPA 2XAJA 4HLXA 2RDPA 4BU2A 1WPKA 3HUGA 5C4JJ 5D5UB 1WJDA 3KYCB 2FX0A 1MMNA 1NHAA 1K61A 2ZFWA 2ISYA 3CCMI 1LFPA 3OYAA 4XLCA 2VKEA 3HPGA 4L5JA 4HOBA 1B4AA 1CGPA 4BJ6C 2LMDA 3NRVA 1ITYA 3VFZA 3ZQFA 2VLAA 2E5NA 3MZ8A 4II3A 2IS1A 5KCMA 4DBQA 3OYCA 2L2OA 3HXLA 2J5OA 3SFZA 4BQOA 3ECHA 4CYCB 1AHDP 1UHSA 2JVGA 2M87A 2JVHA 3D0SA 2HQRA 2HPMA 2M8EA 2NXNB 1EH8A 4BEHA 2QM3A 5M3MJ 3BZKA 1FZPB 2FE3A 2M4GA 2ZNYA 3DPUA 5EEAA 2IVMA 1IXCA 1Y8QB 3SFIA 3JW4A 4DJAA 2XAGA 3AFHA 2XAFA 4NQWB 3S3NA 1SVMA 1G8XA 1FTZA 1KQ9A 3EQLF 4RLQA 5HS8A 3K70C 2BY2A 2ZMEB 5CVJA 2VOPA 1T56A 2CMPA 4WCGA 1MNMC 1I6XA 2DQLA 3RKXA 2CYYA 4QTRA 3KPHA 3CD6I 2P4WA 1WWXA 3OYBA 4XKBA 3H9JA 2PLYA 4HX4A 4RAZA 4B8XA 1LVKA 2Z2SB 3HOVJ 3BTIA 3WTTC 5K7HA 2OTLI 1USSA 3VODA 3ZMZA 1HKQA 4HNVA 3G73A 2H6CA 5L3FA 2MH9A 4Y15A 1TLHB 1YW7A 4PSWA 2EINH 3JRBA 2MH2A 2JRMA 3DWLE 1FWZA 1D1AA 1ZG3A 4RB1A 1I39A 4UV9A 1IAWA 1UELB 4U0VA 3CO7C 4I01A 1F5TA 4A0XA 3FX3A 2VXDA 3E3VA 2PI0A 3C1DA 3CDIA 1TNSA 3HTSB 2X0LA 4S05A 2FBIA 3AL0B 3E6MA 5M3FJ 3N05A 2LBFA 5EGOA 3RYPA 4ZDLA 2JA5J 2XV4S 1VTNC 2W7NA 4JBAA 2BV6A 3GTPJ 4CGZA 3DU5A 2WY8Q 3EUKL 3JSOA 4XMYA 1FLIA 3HIFA 2HYFA 4YFKF 1WJBA 1O3RA 1RIOH 1A31A 2CW0F 2PMZN 2G7HA 3SDGA 5EF6A 1MSEC 1U9OA 2L3DA 3HDDA 2W85A 4L0YB 3C2BA 2IGMA 5CLSA 2EWNA 5D8KB 2Y69H 1E3PA 2MC4A 1TTYA 5F04A 4XRMA 5E8GA 1SAUA 3CMEI 3H36A 4PDKA 1FIAA 5FD5A 1I1GA 3HBLA 1DU0A 1UAAA 4JX4A 1HSTA 3KFWX 4O5VA 4R1HA 2VQCA 4L5EA 3MZYA 3MFKA 2L0KA 5K7ZA 2QSHX 1ETKA 1H9GA 2Y30A 3GMEA 4PSXA 1POGA 1UG0A 3ZQ7A 3KETA 1S72I 4IEJA 2CFXA 2DXIA 1QRYA 4ENMA 3H9QA 4ESJA 4LB5A 1O3QA 4BYYA 4BE0A 3FXUA 2DCEA 1V5GA 2WTEA 3V8KA 2R5YB 3HKZA 3DKXA 4XQFA 1AA7A 4E7KA 4G6QA 1MDMB 3ZGKA 1YJNI 2XPUA 3OYFA 2ACJA 3JRAA 4ZTFA 1WKMA 1VQLI 4M3DA 5DCMA 3SDBA 1A6QA 1U78A 2K9MA 5IPAA 1J5YA 1HOMA 2Y0MA 4HQEA 5M5WJ 4A0YA 4M9SA 3QPHA 3I5UA 3IAM2 3KYDB 3DFGA 2Z3YA 3J7AY 3HSFA 5CVRA 3QRFF 4B48A 1CF7A 5F0FA 3C3WA 1Z3YA 2E2JJ 1S9HA 3KCCA 3DPLC 2IA0A 1IZ1A 2CWEA 4RGRA 3WE2A 2HZTA 4FASD 1K7AA 2HVRA 2O0YA 1X1CA 2NNNA 4B43A 3KLNA 2K40A 4BQQA 2VJ5A 5TJJA 2FUG2 4BGDA 6PAXA 1R5ID 3LA2A 3QYEA 5A2QZ 1X3WB 3ABKH 4BBSJ 1SFUA 3FBNB 1DP3A 5DCFA 3I4MJ 1U5TA 1RPWA 1IRGA 5FLXK 3T1BA 3T8TA 3KP5A 2Q8KA 4MQ9F 5B3SH 3TQNA 3PIPF 1Z9CA 3ZMVA 3PNYA 1ZR4A 2LTPA 2NRAC 2VODA 1HKTA 2WV1A 3PUBA 3W2VA 1R22A 2MD5A 4LK1F 1IDZA 1LFBA 5LRRA 5AIPA 3MVPA 3F6OA 3QPSA 1J2XA 2D1HA 2XF7A 2EFQA 4L0ZB 3AG4H 2RQPA 2VC1A 4CCJA 2E1MB 5K5OA 3S17J 1KU9A 2NS8A 3ULQB 2ZMEC 4ZZDA 3F8FA 2MA3A 1SANA 1V4RA 1LQ1A 3DEEA 3FXQA 4I76A 1B8IA 5JLWA 2ZJ2A 3RKYA 1DU6A 3W3CA 4HF2A 2VI6A 2HKOA 4KIGA 1XX5A 4AU7A 4PCQA 1NG6A 3RZOJ 3KZIC 1B9MA 4A3BJ 4ZYGA 1V3FA 4IRHA 4FCYA 1XMAA 2DMUA 1KGSA 3N4MA 2H27A 1U5TC 4DOZA 2Z33A 3KE2A 4KUMA 5C4XJ 5F08A 3IAS2 2ZNZA 2E19A 4XM3A 1FEXA 1TBXA 5E1WA 5DYMA 1JT0A 4L9TA 3I3LA 3KP7A 1P4WA 2XF6A 3CP2A 4BY7J 1DPRA 4AIKA 3TMOA 2VJJA 1BI0A 3BOQA 4YFNF 2UXXA 3ZQGA 4M9XA 4F93B 1F4KA 4IQ4A 1Z7UA 2LK2A 4R79A 4YFXF 3L2QA 2DO7A 2FA5A 2V4JC 5BQTA 1GDTA 1FY7A 2F5FA 1JHFA 3E6CC 1H88C 3GTKJ 4LITA 3TW6A 2BYVE 2OA4A 1FBQA 5CVIA 1TZLA 3S32A 1J9IA 4AUXA 1ZARA 2PN6A 3K4KA 3G4SI 2CRGA 4B44A 3L2VA 2QVOA 1WI9A 2HYJA 3QPTA 2HU9A 1RUNA 4FX4A 4O6JA 1PP7U 1ZKGA 3HTUA 3K4BA 5IY5H 2KMUA 1VQNI 4XOPA 1B72A 2DFEA 4A3GJ 2P5VA 4PGGA 4LLLA 3T0YA 4LIVA 4KFCA 4XKCA 1IRXA 5HS9A 4YEJA 1X19A 2HFHA 1ETVA 1T0FA 2Z1DA 2JT1A 2PBIA 1W5CC 2ZFUA 3H5RA 5FGMA 2DLLA 2ZKZA 4CZZA 1N77A 2R0QC 3AG1H 3JREA 1W1WE 3WU1B 2KDOA 3CCLI 1X1AA 1YE9A 2O9LA 2EFPA 2N8GA 3P9IA 5KK1A 2P0WA 4G9YA 1SFOJ 3H3UA 4FT8A 4A3JJ 1JT6A 3W2WA 2RKHA 2XF5A 2JUCA 2H94A 3VSLA 2WC2A 3CDLA 3U2RA 2QQAA 3QQAA 4UUSB 5TRDA 1QU3A 1D0ZA 1FPQA 1QBJA 3OR2C 5AIQA 5DV5A 2EA4A 3CMMA 4IL6C 5B5EC 3T5XA 1XCBA 4PZJA 1FNNA 3O8GA 2EILH 3GTGJ 1QVTA 3FXOA 2XVCA 4IQJA 2QKMB 2BXZA 3UNGC 4UV8A 1XTAA 2DT7B 4RA2A 1S29A 3CF5F 2Y9ZA 4RLFA 3E1SA 1LNWA 3LSKA 2R7VA 1Y6IA 2XASA 5DD8A 2KHMA 2W48A 4E7SA 5L3EA 1RKTA 4XK4A 1SC7A 2DA3A 4BY1J 1VFCA 3LSRA 4BKXA 3H5AA 2X4HA 5ERIA 4AVZA 2WB1A 1I50J 1KU2A 1P6RA 3BJOA 1P7IA 3GTLJ 1X3ZB 3T8RA 4BHBA 3F21A 4V2GA 3TDUC 1ZELA 3RTRA 2JN6A 2YS9A 4BJTA 2Z99A 1FIPA 3MZHA 3OL3A 5IOYA 1R5GA 2NAZA 2O61A 3R0AA 3DBHB 4UB8C 4P9UA 3HOSA 5DCMB 1YS6A 4UVBA 1K78B 3GZ5A 4IVNA 2DW4A 1G3SA 3KEOA 3RDIA 4EV0A 5FLMJ 1A5JA 3A02A 1N75A 1WI3A 5GPCA 2WA0A 2CUZA 1JKRC 3A1YA 5FKMA 3ZOBA 3HOWJ 2FD5A 2R4GA 1P7JA 2R93J 4W1UA 5E3OA 2CS3A 4P5OA 1MNDA 3MCZA 4NUBA 1GLNA 4FETA 3FZVA 5K5QA 3ZMDA 2OD5A 2JWTA 3ZQQA 4RS8A 4ZYHA 3O2PE 3K1MA 1FMVA 2HQ5A 2KIQA 2KRFA 4CH7A 4P55A 1ZGJA 2EIMH 3I54A 1O3SA 1LPQA 1Z6TA 3Q9VA 2W00A 4BACA 2MYSA 2OC6A 4FE4A 4AD9A 4JP0A 3K1PA 3NQOA 2F2EA 2LF8A 4HRIA 3DEUA 3HRTA 1KQ0A 3VDXA 5LGTA 2R92J 1ZG1A 1PDNC 1HXDA 3LNQA 4D5CA 3VYRB 4A3DJ 1WH5A 4MHGA 4XONA 3VB2A 5D6EA 1IGNA 1K83J 2YX4A 1R7JA 3OIQA 1YRNA 2R7TA 3OIPA 5FKKA 1WSUA 4BXUA 3LMMA 2KQRA 1XDUA 1IN5A 3WTSC 5HLGA 3CCJI 4I7HA 4XLEA 1TNTA 2V1NA 4GCVA 1TQIA 2EJRA 2NVYJ 5B1AH 1X4OA 4QPOA 4XLNF 2OUMA 2QQ8A 4RBOA 1TQPA 4BL0B 4CCNA 3AAFA 1W36D 1WJEA 3RKQA 4IHWA 1T98A 4NC6A 2IJLA 2WAQA 2XB5A 5H6RA 1SD7A 3QP6A 2DMTA 4CICA 5E18F 1A35A 1A36A 5BNGA 2PJRA 3J80K 4V2FA 5KAFC 2A5YB 2BOLA 1FBUA 2VBWA 3FHNA 3PQKA 3PUFA 1E3OC 2E2HJ 1IF1A 2MBFA 3H35A 1R23A 3G71I 3FKJA 4BDZA 4N4NB 4BNCA 3O6BB 4E7JA 2X9DA 3BPVA 5LD2C 4J01A 2CV2A 3AL0C 4CSWA 1T33A 3PFIA 2V9PA 1ZR2A 3CDHA 4A12A 3BTLA 2F5DA 1U6GA 2R7QA 3DBRB 4XNFA 1S6LA 1V5FA 5IT9K 2ID3A 5D5VB 1YW9A 4K2EA 4NHJA 2FNAA 2D5VA 3S2DJ 1BW5A 3COAC 2MGQA 2I8DA 3CJTB 1STZA 1U2WA 2UV1A 3I59B 4S0HB 3J80Z 4A6DA 2HGCA 2W82A 4FQGA 1ZYRF 2CV0A 1MH3A 1NG7A 1BM9A 3MKLA 1VI0A 4OWRB 3S14J 1QQIA 1JXSA 3QOPA 4FX0A 4C2UA 2E7WA 1TT5B 5A2QK 3NWSA 1HW5A 1MKMA 1Y8RB 2E60A 2DA1A 4BBRJ 2K27A 4PFOA 1HBXG 3ERMA 1ENHA 1Z0XA 1OCOH 4CCOA 1IN7A 3ZR8X 2IS6A 4XRSA 1WJCA 1IN8A 3ELKA 2XC7A 1K78A 5E3LA 2WY7Q 2FOWA 4RAYA 2M0MA 1V54H 3DP7A 4A0ZA 3OYMA 2KT0A 2GZWA 2QUFA 2LD5A 5FB2A 3RJPA 4ANJA 2DPDA 4J00A 5E3NA 4A3MJ 3K10A 1MBGA 3OS0A 5JVGF 4Y33A 5ED4A 1BC8C 2A05A 2VC0A 1VZ0A 3ISPA 2EZHA 3RSNA 3TO7A 5DS9A 2EIKH 2RNJA 2R7RA 3BPXA 2L01A 2UWMA 4IJAA 2UZKA 2NVUB 2DTRA 3BR6A 1TWHJ 3HUGB 3TGNA 3WGHA 5F1RA 2K9QA 2B7EA 4ZJZA 3SYTA 4YIIA 2JSPA 3KZYA 3OYLA 1IN4A 4M6VA 1FYLA 3CCEI 3OIOA 2OV7A 3MEXA 5EDNA 3M9AA 4PJ0C 5EZGA 4S04A 2DMNA 3L2CA 1UJ8A 4XKVA 3K2AA 3OS1A 2DYRH 1QO0D 1Y56A 3I64A 3TO6A 1X3UA 2E71A 2AHQA 1F36A 1WFXA 3H0GJ 2V1UA 1VNDA 2DAOA 2VBZA 5J4VA 3CUQA 2CUFA 3ZP5A 4JYKA 3DCFA 5IT3A 4HG2A 1YOVB 2HOSA 1WGXA 1YW8A 2K9NA 4G7ZF 4ITVA 3TKYA 2Y0SA 4XRFA 4BQAA 2DJNA 2LKSA 4CUGA 2JA8J 1R4MB 3L09A 3NEUA 2ZB9A 2F4MB 3WTZA 2QSFX 3LSMA 2STTA 3LSTA 3QWLA 4Z2YA 5HS7A 4UXNA 3OY9A 1T95A 2IAIA 4ZTJA 2XAUA 5AONA 1P9QC 2O6GE 4GGGA 2DJIA 5ILVA 2KZGA 2GIZA 3M8EA 5CQEA 2A07F 1AWCA 4UUTA 3SEZA 2PMHA 1IDYA 2VPRA 2E36A 4B3XA 2VQGA 4WF2A 2FBKA 4NC8A 5D4RA 4F55A 4OIOF 3D5LA 4MFEA 2XROA 4HDVA 3G1OA 3JRHA 1PVEA 1Z05A 3Q0WA 2DK8A 1QPMA 5BMZA 1XGSA 3CLQA 3PSIA 1I6HJ 2ME6A 2R7XA 4LD5A 2V9VA 5F27A 2B9SA 4QIWN 3GFJA 3FDYA 2GLOA 1ZHFA 4MTEA 4EM2A 4RGSA 1QA6A 3QOEA 4RM2A 1D0YA 3RCOA 1YJWI 3IL2A 2EBIA 1U8RA 1H8AC 2M0CA 2DA2A 2KISA 4WXHA 1G3TA 3JTHA 4QLCU 2CGPA 1Z7LA 4Q48A 5CJ9A 1WVRA 3OR1C 1BI2A 3ROUA 3VWBA 3FWEA 5FLXZ 2XSJC 1VQ4I 4M3GA 2KIUA 1AKHB 2YR2A 2R5ZA 2KZVA 2HS5A 2KP6A 2P6TA 1JGGA 2JK3A 2NOJB 1BC7C 4ASNA 2XB0X 3DEWA 4U7DA 1IN6A 2IGKA 2ZMEA 2HYGD 3FXKA 4E7ZA 2ISZA 1L3LA 5LHGA 4JK1X 3NAUA 3HGYA 3A03A 3ECOA 3OYHA 5IP9J 4XKWA 2QSGX 2VJIA 4KIFA 4OIPF 3CF2A 4IO9F 4B09A 2K85A 3KEQA 2MLGA 1MGTA 2WAQN 3HRMA 3GFMA 2K9SA 3MKZA 1ZH5A 2CQNA 2M30A 5F1JA 1B59A 1BI1A 3F8MA 2AQFA 3V4GA 2EB7A 5K5RA 5CVUA 1B9NA 1JKPC 1X4PA 2FSWA 4GXOA 3KIOA 3MWMA 2BVMA 4DGWB 3GBGA 5FFZA 2DT5A 4ESBA 1U8BA 4IHSA 2Q0OA 1YFHA 3WODF 2H1LA 2E34A 3HOXJ 2KL4A 4NQWA 3BG6A 1DQUA 4E7HA 4QWQA 2GWRA 3SHFA 4LFUA 3GXOA 2A6EF 3QODA 1U5TB 3SZPA 1UHMA 3KX2A 3VOEA 4MO7A 1PP8F 2DPUA 1NH3A 2K5CA 2CW8A 3E6BA 4UVCA 4OMYA 4DQ2A 1HKSA 3JCUC 4HX7A 5EEHA 3OYNA 3HSRA 2M1BA 1MSFC 2IRFG 5DUKA 2E35A 1MH4A 1NTCA 3S3OA 1KONA 3K9TA 3WTVC 1R71A 1HA8A 2XGDA 3D5RC 4M74A 1QZZA 2Z16A 4C3IJ 1SMYF 3H9GA 4KMUX 1YIJI 5CKTA 4AWXB 1W0TA 2M9HA 3TP3A 2GAUA 4XBFA 2M7BA 3EUHA 5C3EJ 1DDNA 4UY8I 2OCEA 3W6JB 1UMQA 2XKPA 2DOAA 2HOAA 2ESHA 2LBFB 2P5LC 2HTSA 2W4SA 5DM6F 2L02A 5FKLA 5JLXA 2Y48A 2CQQA 2LSOA 1D5YA 2GOMA 2DK5A 1UB9A 5L3CA 4M9ZA 3W6KB 4BH9A 1PUFB 1OFCX 2DOEA 5IP7J 2J5PA 2X6OA 2XIGA 4M6XA 2GOXB 1JGSA 1WJFA 3LFUA 5HDGA 1AOYA 3F0CA 5K7FA 4HLYA 2X6WA 2UUZA 3LSHA 4B47A 1LE8B 1AKHA 3S2WA 4G6TB 3JRGA 1W4MA 3CCUI 4CCMA 1XG1A 1LKXA 2E1NA 2BHZA 2QWWA 1BJAA 3RPQA 1T8IA 1JKQC 2NVQJ 4M3EA 3B73A 2M34A 2O7OA 4KMFA 3MAJA 4R8HA 2ZJPF 2O8XA 2XAHA 2V7FA 3LSGA 1TWAJ 3CC4I 1YG2A 3DBLB 3HGGA 4WWCA 4HAMA 1VQ5I 2IW5A 2IGNA 5IT9Z 3WE3A 4BXFA 4LG3A 2QCOA 3HM5A 1DGRM 4KT5C 1KU7A 4IOAF 3HRSA 2KLOA 3IRRA 3L9FA 2X1EA 1ZTRA 2ELKA 2MW8A 4I09A 2OPTA 4A3KJ 1S3JA 1YIOA 3NWTA 2VE9A 1XPXA 2F6CA 5FKNA 1DP7P 4ZYEA 3BLYA 4I2OA 2LRDA 4ZC3A 5GAGJ 4UUVA 2IGOA 3GUDA 5FO5A 2DFIA 5D5XB 1FT9A 1MNEA 2ESNA 3D5SC 2GQQA 2G0EA 4EVIA 2ZJQF 1VQPI 4D1QA 5KVRA 1SEUA 1MZBA 3CMYA 4PUSA 4H0EA 3L7WA 4CCKA 3CP8A 3O8HA 4AIDA 2EZIA 2QBYA 1BOAA 4N4OB 2CFOA 2WV0A 4JX5A 4MNUA 2LP0A 4QSHA 1BW6A 3S1RJ 2RREA 3MD2A 2BXYA 1RKWA 2QF7A 5D4SA 3RI4A 3L1PA 1R1TA 3K4CA 3U9GA 3FF5A 3G1LA 3E6DA 3CCYA 4ABZA 4MEXF 2EH3A 1QNTA 3FXJA 4EJVA 4BE1A 2QYOA 1IG7A 4ZYDA 3K69A 1X1BA 1RETA 5HVQC 3B6AA 3IC7A 2DA7A 4HPQA 4ETSA 1X2MA 4A3LJ 5E17F 3ZPLA 1JJ8C 2GXAA 1KA8A 1IJWC 2JA6J 4C2MJ 4CZCA 4MFDA 2K86A 5E3MA 3DV8A 3ERED 1PUFA 2DDAA 5DM7F 3V8JA 4PJLA 1YQAA 3FK7A 3U21A 4D0PA 4GYIA 3HPHA 4C2TA 2WADA 3GX4X 1TL8A 2R7SA 3TBIA 4HW0A 3TW7A 1W0UA 4RGUA 5HOOA 2LLKA 5JR3A 2VIXA 3OS2A 5ILSA 5E79C 1WH7A 3HG9A 3S1MJ 4ON0A 3KEYA 4L18B 1ETYA 2Y0SN 4I0BA 2NYXA 4NNJA 2CSOA 4H4KC 3PIOF 2VQHA 3BCBA 1BI3A 3H1CA 4KDPA 2A61A 3GFLA 4IRGA 2RQQA 2XGEA 3WHCA 1MMGA 4G7HF 4HNUA 1U0JA 1H0MA 1YI2I 2PX9A 1IW7F 2KFDA 3U1KA 4FHTA 1R1UA 1EA3A 2PJPA 4ZDOA 1OPCA 1S7OA 1OMIA 3VEPA 3WTYC 1K6YA 2Y31A 1BA5A 4E7LA 1Q1VA 1FTTA 2HNHA 4YRVA 3DKYA 1XGMA 1FBSA 2B0LA 2RGVA 4F52A 4L9JA 4IRIA 4LB6B 3HC7A 2VJ4A 3BQYA 2M7AA 4I0AA 3CC2I 1ORKA 2HDDA 1FJLA 4Y7NJ 3DLAA 4NC7A 2BW3A 4MGRA 5L3BA 2HOTA 2FQ3A 2ZXWH 2K4JA 4DIQA 2M5WA 1VQ8I 5GTHC 2VQLA 3CCQI 2ZXHA 1VQKI 1Z1DA 1UFMA 3DU6A 1FYKA 4A3CJ 2BE5F 4BUPA 2GA2A 2XAQA 4AM3A 3AG3H 1U3EM 4OINF 2A69F 1RRJA 1SVOA 2XKOA 5DEQA 5EJCA 4BDYA 3V7SA 2Y9YA 5LFAA 4A2UA 2WAFA 1HDPA 2LYCA 4XLAA 3GLXA 5LLQA 1MDMA 3CUOA 1BR4A 1DGWY 1QZYA 4D7MA 3Q0VA 2COMA 4JX6A 5HNFA 2KRHA 2OF7A 1R00A 4OIQF 4LMYA 3HJEA 3FMQA 3VSKA 2GXGA 5EG0B 1W7PD 2BGCA 3AG2H 1QHGA 4M3BA 1XGNA 3DQVC 3FM5A 5ICFA 1YYVA 2L9NA 2ELHA 3CESA 4HSTA 3L2WA 2ELJA 2VN2A 4IHXA 4RB0A 4CXFA 2NNYA 1GV5A 1RUOA 2YSRA 3HZJA 5JVTA 2W25A 3BR1A 2TRTA 3F23A 1NK3P 4E70A 3A4CA 2ADUA 1WJ5A 2L9SA 1TC3C 1SD6A 2RN7A 3V8LA 2UXNA 2A3SA 1D0XA 5EGOB 3IP4B 4F92B 3IWZA 3M1CA 2HXIA 2F5EA 3HKZN 3CO6C 1XD7A 2L4MA 3SXYA 1BIAA 4HQMA 2CG4A 1WHUA 2DA6A 2LDUA 1HF0A 5LEJA 5HODA 3H3VK 3BR3A 2XRLA 1RR8C 4P1WA 4XOTA 1OJLA 1CQTA 4NDLA 1BR1A 3IV5A 5L3DA 2AS5F 1T6SA 1USTA 5ICEA 4KA4A 3SEQA 1T38A 1D3YA 3RIRA 2EPFA 3JRCA 5IYDJ 3CJRB 1W36C 3K7AJ 1H9TA 2BZTA 1OR7C 1C0WA 1R58A 3Q0UA 3SZGA 2H09A 2FF4A 2HQNA 2X1CA 1RESA 2DDBA 2IP2A 3O3KA 2IEKA 2ZCWA 4I02A 2IPQX 1FSEA 1OCRH 3ABLH 2PG4A 4BJ5C 3NARA 1X1DA 2CO5A 5J1RA 3GTQJ 1R6RA 3RPUA 5DUIA 2DOFA 3RZDJ 4Q4ZF 3BZCA 3KP4A 3BP8A 3J7YJ 1CF7B 3H3ZA 3ZQLA 3IKTA 3LWFA 3CCSI 1XCVA 3JAMZ 4A5NA 3FM3A 4E4HA 3ZMSA 2NS0A 1LDJA 2HDCA 2L7KA 1BN5A 4HV5A 4X1EA 5H20A 1YJ9I 3R6SA 3WG7H 4X0GA 5B1BH 2FOKA 5TGTA 1IO2A 5HLTA 1HC8A 2VKVA 4XLHA 3KP3A 1F9NA 2F5CA 2IXSA 2HVSA 4CYDA 3RYRA 5C44J 1I5ZA 4TV7A 4LG0A 9ANTA 2LKXA 1GT0C 1L0OC 3G3ZA 2HDWA 1I3QJ 2MC3A 3CZ6A 5J1YA 2JQ7A 4G6DA 2YX7A 4OIRF 5FKOA 2V79A 4CDGA 4U0YA 1S8NA 4IKFA 4Q5SF 3WTXC 2NS7A 2XPVA 2X85A 2K02A 1FSHA 4IHVA 3RQIA 3PM1A 1YO5C 2E1CA 3B6CA 3I55I 5EG0A 4GYGA 2M8GX 2QA4I 1B8IB 3I56I 3MN2A 2OJED 4WXDA 2EA2A 4B3AA 1W7PA 2IS4A 1GVJA 1G3YA 4DBRA 3IKVA 2XSDC 2EK5A 1I27A 3HHGA 4BXXJ 3F22A 3H0DA 1Y0UA 3E5XA 3ZQHA 1FX7A 3ABTA 3TL4X 4XR6A 3ABMH 4A69C 2EZLA 4EEFG 1JI8A 1EJ9A 3IH4A 5HNHA 2FU4A 3ABUA 2Y2ZA 2COBA 1Z21A 2M3AA 3ZMUA 4G7OF 4A3IJ 2OZ6A 3GTOJ 4KJZA 1MBJA 2RAEA 2HPIA 4A3EJ 2DU9A 4KN4X 1IXRC 2L7ZA 3IHUA 2OQRA 5K1YA 2P7VB 1FOXA 4UVAA 2E1MC 2LKPA 5M5YJ 1QGPA 3KP2A 3V7RA 2P7CB 2MFZA 2HEOA 4RB2C 1T08B 4UUSA 3IRQA 1O57A 3I58A 1ZRCA 3WHBA 1PYVA 4I98B 3S2HJ 1XB4A 2QQBA 3I71A 5HDNA 3BR2A 2W57A 2WB1N 3JRIA 4Y17A 4PJJA 3PFYA 2JMWA 2XUBA 3OV8A 1J0RA 1W7PB 5H2FC 3W2AA 3DF8A 2YU3A 2JSCA 3OYKA 3LSJA 1ACIA 1JHHA 4U88A 3QPLA 4D7NA 4IOCF 2BEOA 1ZN2A 1HCRA 3CUQC 1J09A 2LR8A 1TWCJ 2BY1A 3OYGA 4G94A 1JTXA 1YX5A 3WGIA 5IYBJ 5HLIA 4EQQA 4EATA 5B66C 3E7LA 1FP1D 1R5HA 3FXLA 2LY2A 5GAHJ 2FRHA 1EKEA 2DYSH 2VKDA 2QLZA 4LLGF 2LFBA 4E6KG 5LGNA 3OYJA 3PNVA 4HX8A 3CJQB 2CQXA 1JUMA 5CPRB 1ZGAA 4ENJA 4E7IA 2MABA 1E3HA 5J4YA 3EYYA 3BDDA 3H92A 1Z6RA 4LLNA 1NK2P 2VKHA 4IX7A 1Y39A 3VYUB 2X1DA 3IWFA 4FE7A 3BQZA 4W97A 3JRFA 2DI3A 5LHHA 2CUEA 2G7UA 4BE2A 3OYIA 4EJWA 1APLC 2EV6A 3BROA 3HHHA 2LNBA 2LY9A 5JFRA 4IHYA 4RMNA 4BEHB 4A6EA 3DKWA 3DLLF 2ZJRF 3EYIA 2ECBA 2JA7J 1LEBA 2VL8A 2R7FA 1MJBA 2R7WA 5F0CA 3RPUD 3TP0A 2XGCA 1FP2A 2LOOA 2QENA 1K4SA 2KRCA 1MBHA 2F4OB 3I0TA 1O4XA 4AYBA 4C9YA 5KNLA 5GADJ 3A01B 1TP4A 3OWTA 4MLOA 2RC4A 2FQ4A 3MQ0A 2F5VA 3JSPA 5F0HA 4HDUA 5CYVA 1TW3A 4AYBN 1Z3XA 2GA1A 2KIFA 3FIWA 5DTDA 3K70D 2FMLA 4FTHA 2GXBA 4ZYAA 1IV6A 3IH2A 2VBYA 3EUAA 2HR3A 5TISC 1TQMA 2FNPA 2VT3A 1I3AA 1TT0A 2EFNA 4XORA 1IC8A 3PL8A 4LG0B 3GYHX 1ETQA 4NB5A 3K4MA 4IF4A 5E1XA 1IUYA 4YIFA 3CQZJ 2DA5A 4GFBA 2WBMA 2RV8A 4HEA2 1SFEA 2FEZA 5J40A 3JR9A 4LIUA 1GXQA 1W5TA 2ETHA 1OYIA 3E5UA 5D5WB 2EIJH 4DNCA 3CCRI 4HYEA 1OISA 2VONA 2DN0A 3KP6A 1MJAA 3E5QA 2OU2A 2RVCA 3E0JB 3K4LA 1ERDA 2YPRA 3L2RA 2Z9OA 1FOYA 1PJRA 3VYSB 5GP9A 2L9RA 2PEXA 5FLVA 4XLPF 3C7JA 4GDFA 5EZHA 3LFKA 2IT0A 4M3FA 5KAIC 3BJAA 2A5WA 1B1BA 1OLTA 2DA4A 5LRSA 1VQ9I 1EH6A 2DMQA 1DUXC 1HQCA 2DMPA 5GPAA 4YG2F 2MG4A 3JTGA 1R49A 1REPC 4XICA 2YUSA 2NVXJ 2O8KA 1YS7A 3HYIA 1KYZA 3AKZA 2CH0A 1OQYA 1Y1VJ 5IP6A 5GAEJ 1R1VA 4XRSG 1MBKA 2KJBA 1LEAA 3CTAA 1YLFA 3LL7A 1S7AA 3A0HC 1T2KA 4AIJA 1Y1WJ 5J8CA 1OCPA 1S5LC 5E8IA 4P9FA 4YIRX 2OBPA 2ICWG 5JI6A 5KHDA 4F91B 2PQ8A 2HTJA 2HZDA 4JQFA 2R5YA 1HDDC 1F1ZA 3BR5A 4EM0B 4WK8F 1JUSA 1V5EA 2AO9A 2JJ7A 3BC8A 5F6FA 3TDZC 4I6ZA 2DFHA 1TWFJ 4MIMA 5M5XJ 4D5FA 4A5MA 3D1NI 1MBFA 2DQRA 4BQNA 1G59A 1YX3A 4IPAA 1TWGJ 2H8WA 5EYRA 4L9NA 3PO3J 3LQRA 3GO5A 4EM1A 2R7UA 4A3FJ 2KKOA 4XSZF 2VOOA 1E17A 2JUGA 2VASA 2F48A 3ZCOA 3I59A 5CVVA 3M07A 1QPIA 2PFBA 3HOYJ 2VPLA 4HF1A 2ECCA 1WZ2A 1SFXA 1LJ9A 1ZREA 4U87A 2E2IJ 1YRNB 4Y3OA 3R4KA 3LA3A 2X6YA 4XSXF 2L5QA 2NOGA 2AXLA 5J6XA 1B72B 3SQNA 3BZ6A 1F43A 2HVQA 2LG4A 1X1PA 5BS6A 4M71A 2ZBKA 4M73A 3OL4A 1Z77A 2M2EA 4J19A 2QKLB 3GTMJ 3S1NJ 1T39A 1Q1HA 2PJRB 4PJMA 2IBDA 3BG5A 3FBIB 2JRTA 3R60A 4CA0A 4Y52J 1ZAOA 4EGZA 2K7LA 2A6HF 2V9KA 5J47A 3BR0A 1FC3A 1WJAA 2XPWA 2X51A 3ZQIA 1XMKA 1LFUP 1MBEA 4WX9A 4DZPA 1MW7A 1HW2A 1JJ6C 3HSEA 2K3PA 4PGHA 3WU0A 4XN3A 3M3YJ 2Q2EB 3V42A 1AU7A 2MD0A 2Q1ZB 2ZSIB 1S7EA 3Q9SA 3WTWC 3BG3A 3X2QH 1ODDA 4C3HJ 3ASOH 5LEKA 1D5VA 3ZRGA 4I99C 3OOPA 1TW2A 3I4PA 3BT9A 5BPIA 1XSDA 2JTVA 1G4DA 2GM4A 1A6IA 4AIHA 1RR7A 3SZTA 5FROA 3Q3SA 4U7BA 3HOUJ 3I9V2 2KPMA 5JHUA 1A04A 4OMZA 3FXRA 3K4JA 3GTJJ 1OCCH 3M7GA 2W1OA 1R9TJ 1Z91A 4WXCA 2VXZA 1J75A 4PJNA 3JRDA 5FJ8J 3F3XA 4LK0F 2ZC2A 2E7XA 2EV0A 4BHPA 1XS9A 1LE8A 2V6EA 3C2GA 4KN7X 2WWYA 5BPDA 3CCVI 2FJ1A 3N97A 3WGGA 3J81Z 1MMSA 2L54A 4OU0A 1XGOA 2B63J 1OCTC 1UZCA 2Q2EA 3L2UA 1BJZA 5F64A 1FMWA 1IV8A 5IOZA 1QVUA 2V26A 2DODA 1IXSB 1OR7A 2Y75A 4NBQA 4B4CA 3G2BA 1YHQI 3OYDA 1QZEA 2VUMJ 1V55H 2ID6A 3K6GA 4Y4RA 2D2WA 4DZJA 2FMYA 4Y13A 4HA8A 5LBQA 2STWA 1MMAA 4UHTA 4PFPA 3K0LA 3HOZJ 2DBBA 3R61A 2RNGA 3ZN0A 2W24A 3REOA 3PQJA 4CCLA 4OAYA 5DDGA 3TEDA 3HRUA 3QU3A 4KYWA 2AQEA 1D1CA 3A01A 1XN7A 4KITB 5BOXA 1VQOI 1VF9A 4XL9A 1HLVA 2ME0A 5J8FA 1SFKA 3S93A 2V1XA 2LY1A 4ZZLA 1P2FA 2K3FA 3OOUA 3MMYB 2R7DA 3ZN1A 2FXAA 1H89C 3MKWB 1B6AA 1YITI 1UG2A 3HEFA 2QBYB 1RC9A 3P5JA 5D6FA 5FRNA 5IYCJ 3BJ6A 4DYQA 1E2XA 3J7ZI 2LC2A 4BAYA 1OCZH 3CC7I 1ETXA 2BBYA 2G9WA 2PMUA 5H6QA 3S8PA 5ILUA 4ENKA 2DT6A 2DFFA 3PSFA 3IUOA 2D1VA 4RM3A 3K2ZA 3F8NA 3OMYA 3S15J 2ZSHB 3B02A 4QPQA 5J1UA 2K9LA 3FKIJ 3GF2A 4BS9A 4IHTA 1SVLA 2LREA 4C3JJ 3S16J 3GW2A 4XN0A 3C18A 3HL2A 3SJMA 2E5ZA 3E97A 1J59A 4HNTA 4UNOA 1GXPA 1ON1A 3FMSA 4BHCA 4D9JA 4KT6A 2BW3B 1K6OA 5DD4A 1VQMI 2OQGA 1KQ8A 3F8BA 3FXMA 2EZKA 3LSIA 3DTKA 5CQGA 4F3QA 3OYEA 3RKWA 2P5KA 3W6VA 2HQAA 2HOEA 3K1NA 3KYLA 3I53A 3QYBA 1MMDA 2BY0A 3P7NA 5E1ZB 1QHHD 3FMRA 3U1DA 1G2HA 2OAZA 1W5SA 1D8JA 1IRZA 4A93J 3F9KA 5E20A 4C30A 2ZXIA 2JA2A 1ZK8A 4CYCA 1OYYA 2H1KA 5FD6A 3KZZA 4U0WA 3WU2C 1SMTA 1WCMJ 4UB6C 2KIMA 3DPTA 1P92A 1XMXA 1SD4A 2MSYA 4GRIA 4CHUA 1XSVA 1OKRA 1SD5A 3F6VA 2R7OA 4AVPA 4DW6A 1P4AA 2JZYA 4IZZA 3BCAA 2O3FA 2L7FP 3CLOA 3VPRA 5JHFA 4PK4A 2TDXA 1X2NA 2X6XA 3BG9A 2C6YA 4II2A 3LQQA 4GO1A 1O7FA 1WQ2A 4Z6YA 2CU7A 4L5IA 1MD0A 4HBLA 3GEZA 2NVTJ 3UKGA 1D1BA 2VT2A 1MIJA 1OYWA 4M6YA 4Q47A 4XIDA 3ESWB 1BIBA 3BTCA 3L00A 4KICA 1BL0A 4ZH4F 1E0EA 1EH7A 3WG9A 3BWGA 2CQKA 2LVSA 3F8CA 1FOWA 3A0BC 4RAFA 1RNLA 2A6TA 3BG7A 2GBYA 4OOIA 4F7ZA 3I4NJ 1FOKA 1XDSA 2R5ZB 3UR3C 1K79A 2HWVA 2R3SA 4RAGA 2IS2A 1LDKB 3F72A 3M8FA 3M4OJ 1LUJB 1ULYA 1ETOA 3HOTA 3GZ6A 2OCCH 2LH9A 1K4TA 4RB3C 2GIVA 3M8JA 3S1QJ 4KNYA 4HZFA 3K4NA 1ZLJA 2KJCA 3P9CA 3OSFA 1BR2A 1N78A 1HW1A 3PNTA 5D8LB 4N9HA 2XHKA 2P8TA 5HLHA 2O5RA 2F4IA 2P6SA 5FFXA 2OTJI 1XSXA 2EV5A 2KDZA 1G3WA 4HV6A 1UHWA 3ML6A 1UCRA 1PUEE 4YELA 1ZQ3P 2Z5UA 2WAEA 4HF0A 2L7MP 5J3LA 1GHCA 3S3MA 4P96A 2V6CA 3C2HA 1ONVA 2O03A 1JE8A 2A68F 3J81K 2H8RA 1VQ6I 4KISA 2W84A 3G6EI 4O3MA 3IH3A 4L9VA 1ON2A 4N0BA 2VE8A 2XDVA 5EEGA 4V19K 1WRJA 2IA1A 4MEYF 5FRMA 3A2KA 3PO2J 1BBYA 4AC0A 2X48A 2QEXI 4KIBA 2L9VA 1EF4A 1ZRFA 3P9KA 4CO8A 4MTDA 3H5NA 4DYRA 3LAPA 3CMAI 1ZLKA 3DTEA 1R4NB 3GLLA 2BVLA 4LJZF 3R0JA 4XLFA 1ETWA 1M1EB 4JOMA 3TOBA 4IXAA 1X58A 2I10A 2CW7A 4OAZA 2P81A 3GVAA 4ENNA 4MQVA 2R7ZJ 2FBHA 1MJ9A 2XGXA 3FISA 2QQ9A 5L3GA 3PJRA 1KU3A 4X6AJ 1SAXA 2HKXA 1O7LA 2EFOA 2LF7A 2D45A 2JPCA 3BTJA 1LDDA 2HXOA 3V7CA 3DTIA 4LGWA 3M1EA 2ZXJA 1I1SA 1RI7A 5LGUA 4ZDPA
chains in the Genus database with same CATH topology
2M34A 2O7OA 3G1MA 3A01B 1GVDA 3LSPA 4MLOA 3OSGA 1P7IA 3GTLJ 4RDUA 2FQ4A 4V2GA 5F0HA 4AYBN 2EQRA 3FIWA 4FTHA 5DTDA 2JN6A 2YS9A 3LSGA 1TWAJ 1IV6A 3HGGA 3IH2A 1FIPA 4B1RA 5IOYA 2DTZA 2QCOA 3HM5A 1IC8A 1ETQA 5FLMJ 1A5JA 3A02A 1JTYA 1WI3A 3CQZJ 1ZTRA 5GPCA 2ELKA 2MW8A 2OPTA 4A3KJ 2DA5A 1JKRC 4GFBA 3ZOBA 5FKMA 5FKNA 3HOWJ 4LOCA 2FD5A 1GV2A 1P7JA 4G12A 2R93J 3JR9A 4W1UA 5E3OA 2HI3A 1U9NA 2DN0A 1GUUA 2G0EA 2TCTA 2JWTA 3CMYA 1JKOC 1XC5A 2E1OA 3O8HA 2EZIA 2HQ5A 3LOCA 2L9RA 5GP9A 4DYCA 2YU9J 5FLVA 3ZQCA 4JX5A 2LP0A 3HB9A 2CJJA 4QSHA 1BW6A 3S1RJ 5EZHA 4M3FA 1RKWA 2DA4A 2QF7A 4FE4A 2DMQA 3FK6A 1ZGWA 2DMPA 4JP0A 5GPAA 3L1PA 2MG4A 4FISA 4XICA 2YUSA 3G1LA 2R92J 3CCYA 2NVXJ 2O8KA 4ABZA 2EH3A 3LNQA 1IUFA 4D5CA 1IG7A 4A3DJ 1WH5A 1RETA 1JUPA 3B6AA 1Y1VJ 5IP6A 1WPKA 2DA7A 5C4JJ 4XRSG 1IGNA 1MBKA 1X2MA 1K83J 4A3LJ 2FX0A 1YRNA 1JJ8C 1Y1WJ 1IJWC 5FKKA 4C2MJ 1K61A 4MFDA 1OCPA 2JA6J 5E3MA 1PUFA 2VKEA 2NVYJ 2R5YA 3FK7A 1HDDC 4RBOA 3BR5A 1ITYA 3ZQFA 1JUSA 2AO9A 2JJ7A 3TW7A 3RKQA 1W0UA 4I6ZA 4IHWA 2LLKA 1TWFJ 4MIMA 5M5XJ 4D5FA 1UHSA 4CYCB 3D1NI 1AHDP 2XB5A 1MBFA 2DMTA 5BNGA 1TWGJ 5EYRA 1WH7A 4V2FA 3PO3J 3S1MJ 4A3FJ 1E3OC 5M3MJ 2E2HJ 1ETYA 1QPIA 3HOYJ 2Y0SN 2ECCA 5EEAA 2E2IJ 1YRNB 2X9DA 3SFIA 2XGEA 3WHCA 2NOGA 1B72B 1F43A 1T33A 1ZR2A 1FTZA 3BTLA 1Z77A 2M2EA 4J19A 3GTMJ 2ID3A 1T56A 3S1NJ 1MNMC 2IBDA 3BG5A 2Y31A 2D5VA 4QTRA 3S2DJ 1BA5A 1BW5A 2MGQA 1Q1VA 4Y52J 1FTTA 4S0HB 3HOVJ 3BR0A 3BTIA 2XPWA 3ZQIA 5K7HA 1LFUP 1MBEA 4HNVA 3BQYA 4DZPA 1ORKA 1JJ6C 2HDDA 1MH3A 4Y7NJ 1FJLA 3MKLA 3M3YJ 2HOTA 1VI0A 3S14J 1AU7A 1S7EA 3BG3A 3JRBA 4C3HJ 4A3CJ 3BT9A 2DA1A 4BBRJ 2GM4A 1A6IA 1ENHA 1RR7A 1Z0XA 3Q3SA 3HOUJ 5M3FJ 4XRSA 5EGOA 2JA5J 2Y9YA 3GTJJ 5E3LA 1HDPA 1R9TJ 3GTPJ 3JRDA 5FJ8J 2KT0A 4D7MA 3Q0VA 1LE8A 2LD5A 1XS9A 4JX6A 2OF7A 2FJ1A 5E3NA 4A3MJ 2PMZN 1MBGA 5EG0B 3SDGA 5EF6A 1MSEC 1U9OA 3HDDA 4M3BA 2B63J 1OCTC 3C2BA 1BJZA 2EZHA 5DS9A 5IOZA 5F04A 4XRMA 1QVUA 4B4CA 1DU0A 1FIAA 4IHXA 3HBLA 4JX4A 1GV5A 3BR6A 2VUMJ 1TWHJ 2K9QA 4L5EA 2ID6A 2L0KA 5K7ZA 3BR1A 1ETKA 2TRTA 2Y30A 4DZJA 1NK3P 1POGA 4IEJA 1TC3C 4M6VA 1QRYA 3HOZJ 3OIOA 5EGOB 5EDNA 5EZGA 2R5YB 2DMNA 3K2AA 2XPUA 3TEDA 2HXIA 3HKZN 3JRAA 3A01A 2DA6A 1HF0A 2AHQA 1F36A 5HODA 1VF9A 1HLVA 4M3DA 3H3VK 3H0GJ 2ME0A 1U78A 3BR3A 2XRLA 5IPAA 1HOMA 5M5WJ 1OJLA 1VNDA 1CQTA 4NDLA 3IV5A 2CUFA 3OOUA 4JYKA 1H89C 3DCFA 5F0FA 1UG2A 2E2JJ 3JRCA 3HEFA 2HOSA 1WGXA 2K9NA 5IYDJ 3K7AJ 3Q0UA 4DYQA 5IYCJ 2DJNA 1RESA 2JA8J 1ETXA 2ZB9A 2IEKA 2K40A 4BBSJ 2IAIA 3NARA 3I4MJ 5J1RA 3S15J 1RPWA 3GTQJ 5J1UA 3RZDJ 3FKIJ 1ZR4A 2LTPA 4UUTA 4C3JJ 2WV1A 3ZQLA 1IDYA 2VPRA 3S16J 1IDZA 1LFBA 3SJMA 3MVPA 4MFEA 3G1OA 3QPSA 3JRHA 3Q0WA 4X1EA 2EZKA 3S17J 1I6HJ 2ME6A 5F27A 2NS8A 4QIWN 2GLOA 3W6VA 2VKVA 1SANA 5C44J 4I76A 1B8IA 5JLWA 1DU6A 9ANTA 2LKXA 1GT0C 2EBIA 2VI6A 1I3QJ 1H8AC 2M0CA 2DA2A 1G2HA 3RZOJ 5J1YA 1IRZA 4A3BJ 4A93J 5FKOA 4FCYA 2DMUA 1ZK8A 4CYCA 2H1KA 2NS7A 2XPVA 4M3GA 4IHVA 3RQIA 3PM1A 5C4XJ 5F08A 1AKHB 2R5ZA 1WCMJ 3B6CA 1JGGA 2MSYA 2JK3A 5EG0A 2E19A 1FEXA 2M8GX 2XB0X 3DEWA 1B8IB 1JT0A 3MN2A 4DW6A 4BY7J 4B3AA 2L7FP 3VPRA 3NAUA 3ZQGA 3HGYA 3A03A 1X2NA 3BG9A 2LK2A 5IP9J 2XSDC 4BXXJ 3ZQHA 1GDTA 2CU7A 1H88C 3GTKJ 3TW6A 4A69C 2NVTJ 2EZLA 3UKGA 2WAQN 4EEFG 3IH4A 2K9SA 2Y2ZA 2COBA 4XIDA 4A3IJ 4AUXA 5F1JA 3GTOJ 1MBJA 2RAEA 3BTCA 2CRGA 1BL0A 4A3EJ 2NVQJ 2HYJA 2L7ZA 1JKPC 2LVSA 2GBYA 3I4NJ 3GBGA 5M5YJ 2R5ZB 1ZKGA 1U8BA 4UUSA 3WHBA 3HOXJ 3M4OJ 1B72A 3S2HJ 4A3GJ 1ETOA 3BR2A 2WB1N 3JRIA 3S1QJ 2JMWA 3OSFA 1ETVA 3LSJA 4MO7A 3QPLA 4D7NA 1HCRA 2LR8A 1TWCJ 2R0QC 3JREA 1JTXA 1MSFC 2KDZA 5IYBJ 1MH4A 1NTCA 1ZQ3P 2O9LA 2N8GA 3E7LA 2L7MP 5J3LA 1SFOJ 2XGDA 2H8RA 4A3JJ 4C3IJ 2LFBA 1JT6A 3IH3A 1W0TA 2M9HA 3TP3A 2CQXA 1JUMA 5C3EJ 3CDLA 3QQAA 3PO2J 1UMQA 4UUSB 2HOAA 4AC0A 2X48A 1EF4A 1NK2P 5FKLA 4DYRA 5JLXA 2CQQA 4FE7A 1D5YA 3BQZA 4W97A 3JRFA 2CUEA 3O8GA 3GTGJ 1PUFB 1OFCX 5IP7J 1QVTA 1ETWA 1APLC 4IHYA 2LY9A 1X58A 2X6OA 2I10A 2P81A 2R7ZJ 3F0CA 5K7FA 2ECBA 2JA7J 2Y9ZA 3FISA 4X6AJ 1LE8B 5F0CA 2W48A 1AKHA 4XK4A 1RKTA 4BY1J 2DA3A 3JRGA 1VFCA 3TP0A 4BKXA 3LSRA 2XGCA 1XG1A 3BTJA 2HXOA 1MBHA 1I50J 1O4XA 1JKQC 4M3EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M34 A;  2O7O A;  3G1M A;  3A01 B;  1GVD A;  3LSP A;  4MLO A;  3OSG A;  1P7I A;  3GTL J;  4RDU A;  2FQ4 A;  4V2G A;  5F0H A;  4AYB N;  2EQR A;  3FIW A;  4FTH A;  5DTD A;  2JN6 A;  2YS9 A;  3LSG A;  1TWA J;  1IV6 A;  3HGG A;  3IH2 A;  1FIP A;  4B1R A;  5IOY A;  2DTZ A;  2QCO A;  3HM5 A;  1IC8 A;  1ETQ A;  5FLM J;  1A5J A;  3A02 A;  1JTY A;  1WI3 A;  3CQZ J;  1ZTR A;  5GPC A;  2ELK A;  2MW8 A;  2OPT A;  4A3K J;  2DA5 A;  1JKR C;  4GFB A;  3ZOB A;  5FKM A;  5FKN A;  3HOW J;  4LOC A;  2FD5 A;  1GV2 A;  1P7J A;  4G12 A;  2R93 J;  3JR9 A;  4W1U A;  5E3O A;  2HI3 A;  1U9N A;  2DN0 A;  1GUU A;  2G0E A;  2TCT A;  2JWT A;  3CMY A;  1JKO C;  1XC5 A;  2E1O A;  3O8H A;  2EZI A;  2HQ5 A;  3LOC A;  2L9R A;  5GP9 A;  4DYC A;  2YU9 J;  5FLV A;  3ZQC A;  4JX5 A;  2LP0 A;  3HB9 A;  2CJJ A;  4QSH A;  1BW6 A;  3S1R J;  5EZH A;  4M3F A;  1RKW A;  2DA4 A;  2QF7 A;  4FE4 A;  2DMQ A;  3FK6 A;  1ZGW A;  2DMP A;  4JP0 A;  5GPA A;  3L1P A;  2MG4 A;  4FIS A;  4XIC A;  2YUS A;  3G1L A;  2R92 J;  3CCY A;  2NVX J;  2O8K A;  4ABZ A;  2EH3 A;  3LNQ A;  1IUF A;  4D5C A;  1IG7 A;  4A3D J;  1WH5 A;  1RET A;  1JUP A;  3B6A A;  1Y1V J;  5IP6 A;  1WPK A;  2DA7 A;  5C4J J;  4XRS G;  1IGN A;  1MBK A;  1X2M A;  1K83 J;  4A3L J;  2FX0 A;  1YRN A;  1JJ8 C;  1Y1W J;  1IJW C;  5FKK A;  4C2M J;  1K61 A;  4MFD A;  1OCP A;  2JA6 J;  5E3M A;  1PUF A;  2VKE A;  2NVY J;  2R5Y A;  3FK7 A;  1HDD C;  4RBO A;  3BR5 A;  1ITY A;  3ZQF A;  1JUS A;  2AO9 A;  2JJ7 A;  3TW7 A;  3RKQ A;  1W0U A;  4I6Z A;  4IHW A;  2LLK A;  1TWF J;  4MIM A;  5M5X J;  4D5F A;  1UHS A;  4CYC B;  3D1N I;  1AHD P;  2XB5 A;  1MBF A;  2DMT A;  5BNG A;  1TWG J;  5EYR A;  1WH7 A;  4V2F A;  3PO3 J;  3S1M J;  4A3F J;  1E3O C;  5M3M J;  2E2H J;  1ETY A;  1QPI A;  3HOY J;  2Y0S N;  2ECC A;  5EEA A;  2E2I J;  1YRN B;  2X9D A;  3SFI A;  2XGE A;  3WHC A;  2NOG A;  1B72 B;  1F43 A;  1T33 A;  1ZR2 A;  1FTZ A;  3BTL A;  1Z77 A;  2M2E A;  4J19 A;  3GTM J;  2ID3 A;  1T56 A;  3S1N J;  1MNM C;  2IBD A;  3BG5 A;  2Y31 A;  2D5V A;  4QTR A;  3S2D J;  1BA5 A;  1BW5 A;  2MGQ A;  1Q1V A;  4Y52 J;  1FTT A;  4S0H B;  3HOV J;  3BR0 A;  3BTI A;  2XPW A;  3ZQI A;  5K7H A;  1LFU P;  1MBE A;  4HNV A;  3BQY A;  4DZP A;  1ORK A;  1JJ6 C;  2HDD A;  1MH3 A;  4Y7N J;  1FJL A;  3MKL A;  3M3Y J;  2HOT A;  1VI0 A;  3S14 J;  1AU7 A;  1S7E A;  3BG3 A;  3JRB A;  4C3H J;  4A3C J;  3BT9 A;  2DA1 A;  4BBR J;  2GM4 A;  1A6I A;  1ENH A;  1RR7 A;  1Z0X A;  3Q3S A;  3HOU J;  5M3F J;  4XRS A;  5EGO A;  2JA5 J;  2Y9Y A;  3GTJ J;  5E3L A;  1HDP A;  1R9T J;  3GTP J;  3JRD A;  5FJ8 J;  2KT0 A;  4D7M A;  3Q0V A;  1LE8 A;  2LD5 A;  1XS9 A;  4JX6 A;  2OF7 A;  2FJ1 A;  5E3N A;  4A3M J;  2PMZ N;  1MBG A;  5EG0 B;  3SDG A;  5EF6 A;  1MSE C;  1U9O A;  3HDD A;  4M3B A;  2B63 J;  1OCT C;  3C2B A;  1BJZ A;  2EZH A;  5DS9 A;  5IOZ A;  5F04 A;  4XRM A;  1QVU A;  4B4C A;  1DU0 A;  1FIA A;  4IHX A;  3HBL A;  4JX4 A;  1GV5 A;  3BR6 A;  2VUM J;  1TWH J;  2K9Q A;  4L5E A;  2ID6 A;  2L0K A;  5K7Z A;  3BR1 A;  1ETK A;  2TRT A;  2Y30 A;  4DZJ A;  1NK3 P;  1POG A;  4IEJ A;  1TC3 C;  4M6V A;  1QRY A;  3HOZ J;  3OIO A;  5EGO B;  5EDN A;  5EZG A;  2R5Y B;  2DMN A;  3K2A A;  2XPU A;  3TED A;  2HXI A;  3HKZ N;  3JRA A;  3A01 A;  2DA6 A;  1HF0 A;  2AHQ A;  1F36 A;  5HOD A;  1VF9 A;  1HLV A;  4M3D A;  3H3V K;  3H0G J;  2ME0 A;  1U78 A;  3BR3 A;  2XRL A;  5IPA A;  1HOM A;  5M5W J;  1OJL A;  1VND A;  1CQT A;  4NDL A;  3IV5 A;  2CUF A;  3OOU A;  4JYK A;  1H89 C;  3DCF A;  5F0F A;  1UG2 A;  2E2J J;  3JRC A;  3HEF A;  2HOS A;  1WGX A;  2K9N A;  5IYD J;  3K7A J;  3Q0U A;  4DYQ A;  5IYC J;  2DJN A;  1RES A;  2JA8 J;  1ETX A;  2ZB9 A;  2IEK A;  2K40 A;  4BBS J;  2IAI A;  3NAR A;  3I4M J;  5J1R A;  3S15 J;  1RPW A;  3GTQ J;  5J1U A;  3RZD J;  3FKI J;  1ZR4 A;  2LTP A;  4UUT A;  4C3J J;  2WV1 A;  3ZQL A;  1IDY A;  2VPR A;  3S16 J;  1IDZ A;  1LFB A;  3SJM A;  3MVP A;  4MFE A;  3G1O A;  3QPS A;  3JRH A;  3Q0W A;  4X1E A;  2EZK A;  3S17 J;  1I6H J;  2ME6 A;  5F27 A;  2NS8 A;  4QIW N;  2GLO A;  3W6V A;  2VKV A;  1SAN A;  5C44 J;  4I76 A;  1B8I A;  5JLW A;  1DU6 A;  9ANT A;  2LKX A;  1GT0 C;  2EBI A;  2VI6 A;  1I3Q J;  1H8A C;  2M0C A;  2DA2 A;  1G2H A;  3RZO J;  5J1Y A;  1IRZ A;  4A3B J;  4A93 J;  5FKO A;  4FCY A;  2DMU A;  1ZK8 A;  4CYC A;  2H1K A;  2NS7 A;  2XPV A;  4M3G A;  4IHV A;  3RQI A;  3PM1 A;  5C4X J;  5F08 A;  1AKH B;  2R5Z A;  1WCM J;  3B6C A;  1JGG A;  2MSY A;  2JK3 A;  5EG0 A;  2E19 A;  1FEX A;  2M8G X;  2XB0 X;  3DEW A;  1B8I B;  1JT0 A;  3MN2 A;  4DW6 A;  4BY7 J;  4B3A A;  2L7F P;  3VPR A;  3NAU A;  3ZQG A;  3HGY A;  3A03 A;  1X2N A;  3BG9 A;  2LK2 A;  5IP9 J;  2XSD C;  4BXX J;  3ZQH A;  1GDT A;  2CU7 A;  1H88 C;  3GTK J;  3TW6 A;  4A69 C;  2NVT J;  2EZL A;  3UKG A;  2WAQ N;  4EEF G;  3IH4 A;  2K9S A;  2Y2Z A;  2COB A;  4XID A;  4A3I J;  4AUX A;  5F1J A;  3GTO J;  1MBJ A;  2RAE A;  3BTC A;  2CRG A;  1BL0 A;  4A3E J;  2NVQ J;  2HYJ A;  2L7Z A;  1JKP C;  2LVS A;  2GBY A;  3I4N J;  3GBG A;  5M5Y J;  2R5Z B;  1ZKG A;  1U8B A;  4UUS A;  3WHB A;  3HOX J;  3M4O J;  1B72 A;  3S2H J;  4A3G J;  1ETO A;  3BR2 A;  2WB1 N;  3JRI A;  3S1Q J;  2JMW A;  3OSF A;  1ETV A;  3LSJ A;  4MO7 A;  3QPL A;  4D7N A;  1HCR A;  2LR8 A;  1TWC J;  2R0Q C;  3JRE A;  1JTX A;  1MSF C;  2KDZ A;  5IYB J;  1MH4 A;  1NTC A;  1ZQ3 P;  2O9L A;  2N8G A;  3E7L A;  2L7M P;  5J3L A;  1SFO J;  2XGD A;  2H8R A;  4A3J J;  4C3I J;  2LFB A;  1JT6 A;  3IH3 A;  1W0T A;  2M9H A;  3TP3 A;  2CQX A;  1JUM A;  5C3E J;  3CDL A;  3QQA A;  3PO2 J;  1UMQ A;  4UUS B;  2HOA A;  4AC0 A;  2X48 A;  1EF4 A;  1NK2 P;  5FKL A;  4DYR A;  5JLX A;  2CQQ A;  4FE7 A;  1D5Y A;  3BQZ A;  4W97 A;  3JRF A;  2CUE A;  3O8G A;  3GTG J;  1PUF B;  1OFC X;  5IP7 J;  1QVT A;  1ETW A;  1APL C;  4IHY A;  2LY9 A;  1X58 A;  2X6O A;  2I10 A;  2P81 A;  2R7Z J;  3F0C A;  5K7F A;  2ECB A;  2JA7 J;  2Y9Z A;  3FIS A;  4X6A J;  1LE8 B;  5F0C A;  2W48 A;  1AKH A;  4XK4 A;  1RKT A;  4BY1 J;  2DA3 A;  3JRG A;  1VFC A;  3TP0 A;  4BKX A;  3LSR A;  2XGC A;  1XG1 A;  3BTJ A;  2HXO A;  1MBH A;  1I50 J;  1O4X A;  1JKQ C;  4M3E A; 
#chains in the Genus database with same CATH topology
 1G6N A;  3G1M A;  1GVD A;  4HSR A;  3LSP A;  4N9I A;  4ESF A;  3OSG A;  4RDU A;  5ICC A;  2EFW A;  2EQR A;  2XRN A;  1Y0N A;  3GZN B;  3VYT B;  3LAJ A;  4EJU A;  3ONQ A;  3EPZ A;  4B1R A;  1R36 A;  2DTZ A;  2CV1 A;  5HDK A;  3QU6 A;  3ASN H;  3QYF A;  3GCM A;  3QAH A;  1DPU A;  2VBX A;  1BOB A;  2QGU A;  2VB6 A;  3CJN A;  1JTY A;  2M4K A;  3FHZ A;  3J7A O;  3EDP A;  1P4X A;  5LHI A;  3WTU C;  1VQ7 I;  2BY3 A;  5GTI C;  4LOC A;  1Z67 A;  3GWZ A;  2M45 A;  4EJO A;  1GV2 A;  2V1D A;  1O3T A;  4G12 A;  3Q5F A;  3ZXS A;  3MKY B;  1LVA A;  1IRF A;  2MLK A;  2PMZ A;  1T0F C;  1D8K A;  3TO9 A;  2HI3 A;  4G8X A;  1U9N A;  1GUU A;  2QZ8 A;  2TCT A;  2BHY A;  3CUQ B;  2L4A A;  1JKO C;  4M72 A;  1XC5 A;  3BY6 A;  3RQ4 A;  2E1O A;  3EET A;  1LB2 A;  4EGY A;  1KZH A;  2OZU A;  3LOC A;  1KYW A;  4DYC A;  2YU9 J;  1RZ4 A;  2I5U A;  3ZQC A;  1J7K A;  4RGX A;  3EUH C;  3HB9 A;  2CJJ A;  4EJT A;  2IA2 A;  3QP5 A;  3TOA A;  3GFI A;  5ICG A;  2ZO4 A;  2CQ7 A;  3KLO A;  2JPB A;  4EMS A;  3FK6 A;  1YTY A;  3DXJ F;  1ZGW A;  1HSJ A;  3ZMT A;  1EV7 A;  4FIS A;  2CUJ A;  3JAM K;  2AXT C;  1ZG5 A;  2K4B A;  2H6B A;  1IUF A;  1N25 A;  1ZRD A;  1FYM A;  3LA7 A;  1JUP A;  2XAJ A;  4HLX A;  2RDP A;  4BU2 A;  1WPK A;  3HUG A;  5C4J J;  5D5U B;  1WJD A;  3KYC B;  2FX0 A;  1MMN A;  1NHA A;  1K61 A;  2ZFW A;  2ISY A;  3CCM I;  1LFP A;  3OYA A;  4XLC A;  2VKE A;  3HPG A;  4L5J A;  4HOB A;  1B4A A;  1CGP A;  4BJ6 C;  2LMD A;  3NRV A;  1ITY A;  3VFZ A;  3ZQF A;  2VLA A;  2E5N A;  3MZ8 A;  4II3 A;  2IS1 A;  5KCM A;  4DBQ A;  3OYC A;  2L2O A;  3HXL A;  2J5O A;  3SFZ A;  4BQO A;  3ECH A;  4CYC B;  1AHD P;  1UHS A;  2JVG A;  2M87 A;  2JVH A;  3D0S A;  2HQR A;  2HPM A;  2M8E A;  2NXN B;  1EH8 A;  4BEH A;  2QM3 A;  5M3M J;  3BZK A;  1FZP B;  2FE3 A;  2M4G A;  2ZNY A;  3DPU A;  5EEA A;  2IVM A;  1IXC A;  1Y8Q B;  3SFI A;  3JW4 A;  4DJA A;  2XAG A;  3AFH A;  2XAF A;  4NQW B;  3S3N A;  1SVM A;  1G8X A;  1FTZ A;  1KQ9 A;  3EQL F;  4RLQ A;  5HS8 A;  3K70 C;  2BY2 A;  2ZME B;  5CVJ A;  2VOP A;  1T56 A;  2CMP A;  4WCG A;  1MNM C;  1I6X A;  2DQL A;  3RKX A;  2CYY A;  4QTR A;  3KPH A;  3CD6 I;  2P4W A;  1WWX A;  3OYB A;  4XKB A;  3H9J A;  2PLY A;  4HX4 A;  4RAZ A;  4B8X A;  1LVK A;  2Z2S B;  3HOV J;  3BTI A;  3WTT C;  5K7H A;  2OTL I;  1USS A;  3VOD A;  3ZMZ A;  1HKQ A;  4HNV A;  3G73 A;  2H6C A;  5L3F A;  2MH9 A;  4Y15 A;  1TLH B;  1YW7 A;  4PSW A;  2EIN H;  3JRB A;  2MH2 A;  2JRM A;  3DWL E;  1FWZ A;  1D1A A;  1ZG3 A;  4RB1 A;  1I39 A;  4UV9 A;  1IAW A;  1UEL B;  4U0V A;  3CO7 C;  4I01 A;  1F5T A;  4A0X A;  3FX3 A;  2VXD A;  3E3V A;  2PI0 A;  3C1D A;  3CDI A;  1TNS A;  3HTS B;  2X0L A;  4S05 A;  2FBI A;  3AL0 B;  3E6M A;  5M3F J;  3N05 A;  2LBF A;  5EGO A;  3RYP A;  4ZDL A;  2JA5 J;  2XV4 S;  1VTN C;  2W7N A;  4JBA A;  2BV6 A;  3GTP J;  4CGZ A;  3DU5 A;  2WY8 Q;  3EUK L;  3JSO A;  4XMY A;  1FLI A;  3HIF A;  2HYF A;  4YFK F;  1WJB A;  1O3R A;  1RIO H;  1A31 A;  2CW0 F;  2PMZ N;  2G7H A;  3SDG A;  5EF6 A;  1MSE C;  1U9O A;  2L3D A;  3HDD A;  2W85 A;  4L0Y B;  3C2B A;  2IGM A;  5CLS A;  2EWN A;  5D8K B;  2Y69 H;  1E3P A;  2MC4 A;  1TTY A;  5F04 A;  4XRM A;  5E8G A;  1SAU A;  3CME I;  3H36 A;  4PDK A;  1FIA A;  5FD5 A;  1I1G A;  3HBL A;  1DU0 A;  1UAA A;  4JX4 A;  1HST A;  3KFW X;  4O5V A;  4R1H A;  2VQC A;  4L5E A;  3MZY A;  3MFK A;  2L0K A;  5K7Z A;  2QSH X;  1ETK A;  1H9G A;  2Y30 A;  3GME A;  4PSX A;  1POG A;  1UG0 A;  3ZQ7 A;  3KET A;  1S72 I;  4IEJ A;  2CFX A;  2DXI A;  1QRY A;  4ENM A;  3H9Q A;  4ESJ A;  4LB5 A;  1O3Q A;  4BYY A;  4BE0 A;  3FXU A;  2DCE A;  1V5G A;  2WTE A;  3V8K A;  2R5Y B;  3HKZ A;  3DKX A;  4XQF A;  1AA7 A;  4E7K A;  4G6Q A;  1MDM B;  3ZGK A;  1YJN I;  2XPU A;  3OYF A;  2ACJ A;  3JRA A;  4ZTF A;  1WKM A;  1VQL I;  4M3D A;  5DCM A;  3SDB A;  1A6Q A;  1U78 A;  2K9M A;  5IPA A;  1J5Y A;  1HOM A;  2Y0M A;  4HQE A;  5M5W J;  4A0Y A;  4M9S A;  3QPH A;  3I5U A;  3IAM 2;  3KYD B;  3DFG A;  2Z3Y A;  3J7A Y;  3HSF A;  5CVR A;  3QRF F;  4B48 A;  1CF7 A;  5F0F A;  3C3W A;  1Z3Y A;  2E2J J;  1S9H A;  3KCC A;  3DPL C;  2IA0 A;  1IZ1 A;  2CWE A;  4RGR A;  3WE2 A;  2HZT A;  4FAS D;  1K7A A;  2HVR A;  2O0Y A;  1X1C A;  2NNN A;  4B43 A;  3KLN A;  2K40 A;  4BQQ A;  2VJ5 A;  5TJJ A;  2FUG 2;  4BGD A;  6PAX A;  1R5I D;  3LA2 A;  3QYE A;  5A2Q Z;  1X3W B;  3ABK H;  4BBS J;  1SFU A;  3FBN B;  1DP3 A;  5DCF A;  3I4M J;  1U5T A;  1RPW A;  1IRG A;  5FLX K;  3T1B A;  3T8T A;  3KP5 A;  2Q8K A;  4MQ9 F;  5B3S H;  3TQN A;  3PIP F;  1Z9C A;  3ZMV A;  3PNY A;  1ZR4 A;  2LTP A;  2NRA C;  2VOD A;  1HKT A;  2WV1 A;  3PUB A;  3W2V A;  1R22 A;  2MD5 A;  4LK1 F;  1IDZ A;  1LFB A;  5LRR A;  5AIP A;  3MVP A;  3F6O A;  3QPS A;  1J2X A;  2D1H A;  2XF7 A;  2EFQ A;  4L0Z B;  3AG4 H;  2RQP A;  2VC1 A;  4CCJ A;  2E1M B;  5K5O A;  3S17 J;  1KU9 A;  2NS8 A;  3ULQ B;  2ZME C;  4ZZD A;  3F8F A;  2MA3 A;  1SAN A;  1V4R A;  1LQ1 A;  3DEE A;  3FXQ A;  4I76 A;  1B8I A;  5JLW A;  2ZJ2 A;  3RKY A;  1DU6 A;  3W3C A;  4HF2 A;  2VI6 A;  2HKO A;  4KIG A;  1XX5 A;  4AU7 A;  4PCQ A;  1NG6 A;  3RZO J;  3KZI C;  1B9M A;  4A3B J;  4ZYG A;  1V3F A;  4IRH A;  4FCY A;  1XMA A;  2DMU A;  1KGS A;  3N4M A;  2H27 A;  1U5T C;  4DOZ A;  2Z33 A;  3KE2 A;  4KUM A;  5C4X J;  5F08 A;  3IAS 2;  2ZNZ A;  2E19 A;  4XM3 A;  1FEX A;  1TBX A;  5E1W A;  5DYM A;  1JT0 A;  4L9T A;  3I3L A;  3KP7 A;  1P4W A;  2XF6 A;  3CP2 A;  4BY7 J;  1DPR A;  4AIK A;  3TMO A;  2VJJ A;  1BI0 A;  3BOQ A;  4YFN F;  2UXX A;  3ZQG A;  4M9X A;  4F93 B;  1F4K A;  4IQ4 A;  1Z7U A;  2LK2 A;  4R79 A;  4YFX F;  3L2Q A;  2DO7 A;  2FA5 A;  2V4J C;  5BQT A;  1GDT A;  1FY7 A;  2F5F A;  1JHF A;  3E6C C;  1H88 C;  3GTK J;  4LIT A;  3TW6 A;  2BYV E;  2OA4 A;  1FBQ A;  5CVI A;  1TZL A;  3S32 A;  1J9I A;  4AUX A;  1ZAR A;  2PN6 A;  3K4K A;  3G4S I;  2CRG A;  4B44 A;  3L2V A;  2QVO A;  1WI9 A;  2HYJ A;  3QPT A;  2HU9 A;  1RUN A;  4FX4 A;  4O6J A;  1PP7 U;  1ZKG A;  3HTU A;  3K4B A;  5IY5 H;  2KMU A;  1VQN I;  4XOP A;  1B72 A;  2DFE A;  4A3G J;  2P5V A;  4PGG A;  4LLL A;  3T0Y A;  4LIV A;  4KFC A;  4XKC A;  1IRX A;  5HS9 A;  4YEJ A;  1X19 A;  2HFH A;  1ETV A;  1T0F A;  2Z1D A;  2JT1 A;  2PBI A;  1W5C C;  2ZFU A;  3H5R A;  5FGM A;  2DLL A;  2ZKZ A;  4CZZ A;  1N77 A;  2R0Q C;  3AG1 H;  3JRE A;  1W1W E;  3WU1 B;  2KDO A;  3CCL I;  1X1A A;  1YE9 A;  2O9L A;  2EFP A;  2N8G A;  3P9I A;  5KK1 A;  2P0W A;  4G9Y A;  1SFO J;  3H3U A;  4FT8 A;  4A3J J;  1JT6 A;  3W2W A;  2RKH A;  2XF5 A;  2JUC A;  2H94 A;  3VSL A;  2WC2 A;  3CDL A;  3U2R A;  2QQA A;  3QQA A;  4UUS B;  5TRD A;  1QU3 A;  1D0Z A;  1FPQ A;  1QBJ A;  3OR2 C;  5AIQ A;  5DV5 A;  2EA4 A;  3CMM A;  4IL6 C;  5B5E C;  3T5X A;  1XCB A;  4PZJ A;  1FNN A;  3O8G A;  2EIL H;  3GTG J;  1QVT A;  3FXO A;  2XVC A;  4IQJ A;  2QKM B;  2BXZ A;  3UNG C;  4UV8 A;  1XTA A;  2DT7 B;  4RA2 A;  1S29 A;  3CF5 F;  2Y9Z A;  4RLF A;  3E1S A;  1LNW A;  3LSK A;  2R7V A;  1Y6I A;  2XAS A;  5DD8 A;  2KHM A;  2W48 A;  4E7S A;  5L3E A;  1RKT A;  4XK4 A;  1SC7 A;  2DA3 A;  4BY1 J;  1VFC A;  3LSR A;  4BKX A;  3H5A A;  2X4H A;  5ERI A;  4AVZ A;  2WB1 A;  1I50 J;  1KU2 A;  1P6R A;  3BJO A;  1P7I A;  3GTL J;  1X3Z B;  3T8R A;  4BHB A;  3F21 A;  4V2G A;  3TDU C;  1ZEL A;  3RTR A;  2JN6 A;  2YS9 A;  4BJT A;  2Z99 A;  1FIP A;  3MZH A;  3OL3 A;  5IOY A;  1R5G A;  2NAZ A;  2O61 A;  3R0A A;  3DBH B;  4UB8 C;  4P9U A;  3HOS A;  5DCM B;  1YS6 A;  4UVB A;  1K78 B;  3GZ5 A;  4IVN A;  2DW4 A;  1G3S A;  3KEO A;  3RDI A;  4EV0 A;  5FLM J;  1A5J A;  3A02 A;  1N75 A;  1WI3 A;  5GPC A;  2WA0 A;  2CUZ A;  1JKR C;  3A1Y A;  5FKM A;  3ZOB A;  3HOW J;  2FD5 A;  2R4G A;  1P7J A;  2R93 J;  4W1U A;  5E3O A;  2CS3 A;  4P5O A;  1MND A;  3MCZ A;  4NUB A;  1GLN A;  4FET A;  3FZV A;  5K5Q A;  3ZMD A;  2OD5 A;  2JWT A;  3ZQQ A;  4RS8 A;  4ZYH A;  3O2P E;  3K1M A;  1FMV A;  2HQ5 A;  2KIQ A;  2KRF A;  4CH7 A;  4P55 A;  1ZGJ A;  2EIM H;  3I54 A;  1O3S A;  1LPQ A;  1Z6T A;  3Q9V A;  2W00 A;  4BAC A;  2MYS A;  2OC6 A;  4FE4 A;  4AD9 A;  4JP0 A;  3K1P A;  3NQO A;  2F2E A;  2LF8 A;  4HRI A;  3DEU A;  3HRT A;  1KQ0 A;  3VDX A;  5LGT A;  2R92 J;  1ZG1 A;  1PDN C;  1HXD A;  3LNQ A;  4D5C A;  3VYR B;  4A3D J;  1WH5 A;  4MHG A;  4XON A;  3VB2 A;  5D6E A;  1IGN A;  1K83 J;  2YX4 A;  1R7J A;  3OIQ A;  1YRN A;  2R7T A;  3OIP A;  5FKK A;  1WSU A;  4BXU A;  3LMM A;  2KQR A;  1XDU A;  1IN5 A;  3WTS C;  5HLG A;  3CCJ I;  4I7H A;  4XLE A;  1TNT A;  2V1N A;  4GCV A;  1TQI A;  2EJR A;  2NVY J;  5B1A H;  1X4O A;  4QPO A;  4XLN F;  2OUM A;  2QQ8 A;  4RBO A;  1TQP A;  4BL0 B;  4CCN A;  3AAF A;  1W36 D;  1WJE A;  3RKQ A;  4IHW A;  1T98 A;  4NC6 A;  2IJL A;  2WAQ A;  2XB5 A;  5H6R A;  1SD7 A;  3QP6 A;  2DMT A;  4CIC A;  5E18 F;  1A35 A;  1A36 A;  5BNG A;  2PJR A;  3J80 K;  4V2F A;  5KAF C;  2A5Y B;  2BOL A;  1FBU A;  2VBW A;  3FHN A;  3PQK A;  3PUF A;  1E3O C;  2E2H J;  1IF1 A;  2MBF A;  3H35 A;  1R23 A;  3G71 I;  3FKJ A;  4BDZ A;  4N4N B;  4BNC A;  3O6B B;  4E7J A;  2X9D A;  3BPV A;  5LD2 C;  4J01 A;  2CV2 A;  3AL0 C;  4CSW A;  1T33 A;  3PFI A;  2V9P A;  1ZR2 A;  3CDH A;  4A12 A;  3BTL A;  2F5D A;  1U6G A;  2R7Q A;  3DBR B;  4XNF A;  1S6L A;  1V5F A;  5IT9 K;  2ID3 A;  5D5V B;  1YW9 A;  4K2E A;  4NHJ A;  2FNA A;  2D5V A;  3S2D J;  1BW5 A;  3COA C;  2MGQ A;  2I8D A;  3CJT B;  1STZ A;  1U2W A;  2UV1 A;  3I59 B;  4S0H B;  3J80 Z;  4A6D A;  2HGC A;  2W82 A;  4FQG A;  1ZYR F;  2CV0 A;  1MH3 A;  1NG7 A;  1BM9 A;  3MKL A;  1VI0 A;  4OWR B;  3S14 J;  1QQI A;  1JXS A;  3QOP A;  4FX0 A;  4C2U A;  2E7W A;  1TT5 B;  5A2Q K;  3NWS A;  1HW5 A;  1MKM A;  1Y8R B;  2E60 A;  2DA1 A;  4BBR J;  2K27 A;  4PFO A;  1HBX G;  3ERM A;  1ENH A;  1Z0X A;  1OCO H;  4CCO A;  1IN7 A;  3ZR8 X;  2IS6 A;  4XRS A;  1WJC A;  1IN8 A;  3ELK A;  2XC7 A;  1K78 A;  5E3L A;  2WY7 Q;  2FOW A;  4RAY A;  2M0M A;  1V54 H;  3DP7 A;  4A0Z A;  3OYM A;  2KT0 A;  2GZW A;  2QUF A;  2LD5 A;  5FB2 A;  3RJP A;  4ANJ A;  2DPD A;  4J00 A;  5E3N A;  4A3M J;  3K10 A;  1MBG A;  3OS0 A;  5JVG F;  4Y33 A;  5ED4 A;  1BC8 C;  2A05 A;  2VC0 A;  1VZ0 A;  3ISP A;  2EZH A;  3RSN A;  3TO7 A;  5DS9 A;  2EIK H;  2RNJ A;  2R7R A;  3BPX A;  2L01 A;  2UWM A;  4IJA A;  2UZK A;  2NVU B;  2DTR A;  3BR6 A;  1TWH J;  3HUG B;  3TGN A;  3WGH A;  5F1R A;  2K9Q A;  2B7E A;  4ZJZ A;  3SYT A;  4YII A;  2JSP A;  3KZY A;  3OYL A;  1IN4 A;  4M6V A;  1FYL A;  3CCE I;  3OIO A;  2OV7 A;  3MEX A;  5EDN A;  3M9A A;  4PJ0 C;  5EZG A;  4S04 A;  2DMN A;  3L2C A;  1UJ8 A;  4XKV A;  3K2A A;  3OS1 A;  2DYR H;  1QO0 D;  1Y56 A;  3I64 A;  3TO6 A;  1X3U A;  2E71 A;  2AHQ A;  1F36 A;  1WFX A;  3H0G J;  2V1U A;  1VND A;  2DAO A;  2VBZ A;  5J4V A;  3CUQ A;  2CUF A;  3ZP5 A;  4JYK A;  3DCF A;  5IT3 A;  4HG2 A;  1YOV B;  2HOS A;  1WGX A;  1YW8 A;  2K9N A;  4G7Z F;  4ITV A;  3TKY A;  2Y0S A;  4XRF A;  4BQA A;  2DJN A;  2LKS A;  4CUG A;  2JA8 J;  1R4M B;  3L09 A;  3NEU A;  2ZB9 A;  2F4M B;  3WTZ A;  2QSF X;  3LSM A;  2STT A;  3LST A;  3QWL A;  4Z2Y A;  5HS7 A;  4UXN A;  3OY9 A;  1T95 A;  2IAI A;  4ZTJ A;  2XAU A;  5AON A;  1P9Q C;  2O6G E;  4GGG A;  2DJI A;  5ILV A;  2KZG A;  2GIZ A;  3M8E A;  5CQE A;  2A07 F;  1AWC A;  4UUT A;  3SEZ A;  2PMH A;  1IDY A;  2VPR A;  2E36 A;  4B3X A;  2VQG A;  4WF2 A;  2FBK A;  4NC8 A;  5D4R A;  4F55 A;  4OIO F;  3D5L A;  4MFE A;  2XRO A;  4HDV A;  3G1O A;  3JRH A;  1PVE A;  1Z05 A;  3Q0W A;  2DK8 A;  1QPM A;  5BMZ A;  1XGS A;  3CLQ A;  3PSI A;  1I6H J;  2ME6 A;  2R7X A;  4LD5 A;  2V9V A;  5F27 A;  2B9S A;  4QIW N;  3GFJ A;  3FDY A;  2GLO A;  1ZHF A;  4MTE A;  4EM2 A;  4RGS A;  1QA6 A;  3QOE A;  4RM2 A;  1D0Y A;  3RCO A;  1YJW I;  3IL2 A;  2EBI A;  1U8R A;  1H8A C;  2M0C A;  2DA2 A;  2KIS A;  4WXH A;  1G3T A;  3JTH A;  4QLC U;  2CGP A;  1Z7L A;  4Q48 A;  5CJ9 A;  1WVR A;  3OR1 C;  1BI2 A;  3ROU A;  3VWB A;  3FWE A;  5FLX Z;  2XSJ C;  1VQ4 I;  4M3G A;  2KIU A;  1AKH B;  2YR2 A;  2R5Z A;  2KZV A;  2HS5 A;  2KP6 A;  2P6T A;  1JGG A;  2JK3 A;  2NOJ B;  1BC7 C;  4ASN A;  2XB0 X;  3DEW A;  4U7D A;  1IN6 A;  2IGK A;  2ZME A;  2HYG D;  3FXK A;  4E7Z A;  2ISZ A;  1L3L A;  5LHG A;  4JK1 X;  3NAU A;  3HGY A;  3A03 A;  3ECO A;  3OYH A;  5IP9 J;  4XKW A;  2QSG X;  2VJI A;  4KIF A;  4OIP F;  3CF2 A;  4IO9 F;  4B09 A;  2K85 A;  3KEQ A;  2MLG A;  1MGT A;  2WAQ N;  3HRM A;  3GFM A;  2K9S A;  3MKZ A;  1ZH5 A;  2CQN A;  2M30 A;  5F1J A;  1B59 A;  1BI1 A;  3F8M A;  2AQF A;  3V4G A;  2EB7 A;  5K5R A;  5CVU A;  1B9N A;  1JKP C;  1X4P A;  2FSW A;  4GXO A;  3KIO A;  3MWM A;  2BVM A;  4DGW B;  3GBG A;  5FFZ A;  2DT5 A;  4ESB A;  1U8B A;  4IHS A;  2Q0O A;  1YFH A;  3WOD F;  2H1L A;  2E34 A;  3HOX J;  2KL4 A;  4NQW A;  3BG6 A;  1DQU A;  4E7H A;  4QWQ A;  2GWR A;  3SHF A;  4LFU A;  3GXO A;  2A6E F;  3QOD A;  1U5T B;  3SZP A;  1UHM A;  3KX2 A;  3VOE A;  4MO7 A;  1PP8 F;  2DPU A;  1NH3 A;  2K5C A;  2CW8 A;  3E6B A;  4UVC A;  4OMY A;  4DQ2 A;  1HKS A;  3JCU C;  4HX7 A;  5EEH A;  3OYN A;  3HSR A;  2M1B A;  1MSF C;  2IRF G;  5DUK A;  2E35 A;  1MH4 A;  1NTC A;  3S3O A;  1KON A;  3K9T A;  3WTV C;  1R71 A;  1HA8 A;  2XGD A;  3D5R C;  4M74 A;  1QZZ A;  2Z16 A;  4C3I J;  1SMY F;  3H9G A;  4KMU X;  1YIJ I;  5CKT A;  4AWX B;  1W0T A;  2M9H A;  3TP3 A;  2GAU A;  4XBF A;  2M7B A;  3EUH A;  5C3E J;  1DDN A;  4UY8 I;  2OCE A;  3W6J B;  1UMQ A;  2XKP A;  2DOA A;  2HOA A;  2ESH A;  2LBF B;  2P5L C;  2HTS A;  2W4S A;  5DM6 F;  2L02 A;  5FKL A;  5JLX A;  2Y48 A;  2CQQ A;  2LSO A;  1D5Y A;  2GOM A;  2DK5 A;  1UB9 A;  5L3C A;  4M9Z A;  3W6K B;  4BH9 A;  1PUF B;  1OFC X;  2DOE A;  5IP7 J;  2J5P A;  2X6O A;  2XIG A;  4M6X A;  2GOX B;  1JGS A;  1WJF A;  3LFU A;  5HDG A;  1AOY A;  3F0C A;  5K7F A;  4HLY A;  2X6W A;  2UUZ A;  3LSH A;  4B47 A;  1LE8 B;  1AKH A;  3S2W A;  4G6T B;  3JRG A;  1W4M A;  3CCU I;  4CCM A;  1XG1 A;  1LKX A;  2E1N A;  2BHZ A;  2QWW A;  1BJA A;  3RPQ A;  1T8I A;  1JKQ C;  2NVQ J;  4M3E A;  3B73 A;  2M34 A;  2O7O A;  4KMF A;  3MAJ A;  4R8H A;  2ZJP F;  2O8X A;  2XAH A;  2V7F A;  3LSG A;  1TWA J;  3CC4 I;  1YG2 A;  3DBL B;  3HGG A;  4WWC A;  4HAM A;  1VQ5 I;  2IW5 A;  2IGN A;  5IT9 Z;  3WE3 A;  4BXF A;  4LG3 A;  2QCO A;  3HM5 A;  1DGR M;  4KT5 C;  1KU7 A;  4IOA F;  3HRS A;  2KLO A;  3IRR A;  3L9F A;  2X1E A;  1ZTR A;  2ELK A;  2MW8 A;  4I09 A;  2OPT A;  4A3K J;  1S3J A;  1YIO A;  3NWT A;  2VE9 A;  1XPX A;  2F6C A;  5FKN A;  1DP7 P;  4ZYE A;  3BLY A;  4I2O A;  2LRD A;  4ZC3 A;  5GAG J;  4UUV A;  2IGO A;  3GUD A;  5FO5 A;  2DFI A;  5D5X B;  1FT9 A;  1MNE A;  2ESN A;  3D5S C;  2GQQ A;  2G0E A;  4EVI A;  2ZJQ F;  1VQP I;  4D1Q A;  5KVR A;  1SEU A;  1MZB A;  3CMY A;  4PUS A;  4H0E A;  3L7W A;  4CCK A;  3CP8 A;  3O8H A;  4AID A;  2EZI A;  2QBY A;  1BOA A;  4N4O B;  2CFO A;  2WV0 A;  4JX5 A;  4MNU A;  2LP0 A;  4QSH A;  1BW6 A;  3S1R J;  2RRE A;  3MD2 A;  2BXY A;  1RKW A;  2QF7 A;  5D4S A;  3RI4 A;  3L1P A;  1R1T A;  3K4C A;  3U9G A;  3FF5 A;  3G1L A;  3E6D A;  3CCY A;  4ABZ A;  4MEX F;  2EH3 A;  1QNT A;  3FXJ A;  4EJV A;  4BE1 A;  2QYO A;  1IG7 A;  4ZYD A;  3K69 A;  1X1B A;  1RET A;  5HVQ C;  3B6A A;  3IC7 A;  2DA7 A;  4HPQ A;  4ETS A;  1X2M A;  4A3L J;  5E17 F;  3ZPL A;  1JJ8 C;  2GXA A;  1KA8 A;  1IJW C;  2JA6 J;  4C2M J;  4CZC A;  4MFD A;  2K86 A;  5E3M A;  3DV8 A;  3ERE D;  1PUF A;  2DDA A;  5DM7 F;  3V8J A;  4PJL A;  1YQA A;  3FK7 A;  3U21 A;  4D0P A;  4GYI A;  3HPH A;  4C2T A;  2WAD A;  3GX4 X;  1TL8 A;  2R7S A;  3TBI A;  4HW0 A;  3TW7 A;  1W0U A;  4RGU A;  5HOO A;  2LLK A;  5JR3 A;  2VIX A;  3OS2 A;  5ILS A;  5E79 C;  1WH7 A;  3HG9 A;  3S1M J;  4ON0 A;  3KEY A;  4L18 B;  1ETY A;  2Y0S N;  4I0B A;  2NYX A;  4NNJ A;  2CSO A;  4H4K C;  3PIO F;  2VQH A;  3BCB A;  1BI3 A;  3H1C A;  4KDP A;  2A61 A;  3GFL A;  4IRG A;  2RQQ A;  2XGE A;  3WHC A;  1MMG A;  4G7H F;  4HNU A;  1U0J A;  1H0M A;  1YI2 I;  2PX9 A;  1IW7 F;  2KFD A;  3U1K A;  4FHT A;  1R1U A;  1EA3 A;  2PJP A;  4ZDO A;  1OPC A;  1S7O A;  1OMI A;  3VEP A;  3WTY C;  1K6Y A;  2Y31 A;  1BA5 A;  4E7L A;  1Q1V A;  1FTT A;  2HNH A;  4YRV A;  3DKY A;  1XGM A;  1FBS A;  2B0L A;  2RGV A;  4F52 A;  4L9J A;  4IRI A;  4LB6 B;  3HC7 A;  2VJ4 A;  3BQY A;  2M7A A;  4I0A A;  3CC2 I;  1ORK A;  2HDD A;  1FJL A;  4Y7N J;  3DLA A;  4NC7 A;  2BW3 A;  4MGR A;  5L3B A;  2HOT A;  2FQ3 A;  2ZXW H;  2K4J A;  4DIQ A;  2M5W A;  1VQ8 I;  5GTH C;  2VQL A;  3CCQ I;  2ZXH A;  1VQK I;  1Z1D A;  1UFM A;  3DU6 A;  1FYK A;  4A3C J;  2BE5 F;  4BUP A;  2GA2 A;  2XAQ A;  4AM3 A;  3AG3 H;  1U3E M;  4OIN F;  2A69 F;  1RRJ A;  1SVO A;  2XKO A;  5DEQ A;  5EJC A;  4BDY A;  3V7S A;  2Y9Y A;  5LFA A;  4A2U A;  2WAF A;  1HDP A;  2LYC A;  4XLA A;  3GLX A;  5LLQ A;  1MDM A;  3CUO A;  1BR4 A;  1DGW Y;  1QZY A;  4D7M A;  3Q0V A;  2COM A;  4JX6 A;  5HNF A;  2KRH A;  2OF7 A;  1R00 A;  4OIQ F;  4LMY A;  3HJE A;  3FMQ A;  3VSK A;  2GXG A;  5EG0 B;  1W7P D;  2BGC A;  3AG2 H;  1QHG A;  4M3B A;  1XGN A;  3DQV C;  3FM5 A;  5ICF A;  1YYV A;  2L9N A;  2ELH A;  3CES A;  4HST A;  3L2W A;  2ELJ A;  2VN2 A;  4IHX A;  4RB0 A;  4CXF A;  2NNY A;  1GV5 A;  1RUO A;  2YSR A;  3HZJ A;  5JVT A;  2W25 A;  3BR1 A;  2TRT A;  3F23 A;  1NK3 P;  4E70 A;  3A4C A;  2ADU A;  1WJ5 A;  2L9S A;  1TC3 C;  1SD6 A;  2RN7 A;  3V8L A;  2UXN A;  2A3S A;  1D0X A;  5EGO B;  3IP4 B;  4F92 B;  3IWZ A;  3M1C A;  2HXI A;  2F5E A;  3HKZ N;  3CO6 C;  1XD7 A;  2L4M A;  3SXY A;  1BIA A;  4HQM A;  2CG4 A;  1WHU A;  2DA6 A;  2LDU A;  1HF0 A;  5LEJ A;  5HOD A;  3H3V K;  3BR3 A;  2XRL A;  1RR8 C;  4P1W A;  4XOT A;  1OJL A;  1CQT A;  4NDL A;  1BR1 A;  3IV5 A;  5L3D A;  2AS5 F;  1T6S A;  1UST A;  5ICE A;  4KA4 A;  3SEQ A;  1T38 A;  1D3Y A;  3RIR A;  2EPF A;  3JRC A;  5IYD J;  3CJR B;  1W36 C;  3K7A J;  1H9T A;  2BZT A;  1OR7 C;  1C0W A;  1R58 A;  3Q0U A;  3SZG A;  2H09 A;  2FF4 A;  2HQN A;  2X1C A;  1RES A;  2DDB A;  2IP2 A;  3O3K A;  2IEK A;  2ZCW A;  4I02 A;  2IPQ X;  1FSE A;  1OCR H;  3ABL H;  2PG4 A;  4BJ5 C;  3NAR A;  1X1D A;  2CO5 A;  5J1R A;  3GTQ J;  1R6R A;  3RPU A;  5DUI A;  2DOF A;  3RZD J;  4Q4Z F;  3BZC A;  3KP4 A;  3BP8 A;  3J7Y J;  1CF7 B;  3H3Z A;  3ZQL A;  3IKT A;  3LWF A;  3CCS I;  1XCV A;  3JAM Z;  4A5N A;  3FM3 A;  4E4H A;  3ZMS A;  2NS0 A;  1LDJ A;  2HDC A;  2L7K A;  1BN5 A;  4HV5 A;  4X1E A;  5H20 A;  1YJ9 I;  3R6S A;  3WG7 H;  4X0G A;  5B1B H;  2FOK A;  5TGT A;  1IO2 A;  5HLT A;  1HC8 A;  2VKV A;  4XLH A;  3KP3 A;  1F9N A;  2F5C A;  2IXS A;  2HVS A;  4CYD A;  3RYR A;  5C44 J;  1I5Z A;  4TV7 A;  4LG0 A;  9ANT A;  2LKX A;  1GT0 C;  1L0O C;  3G3Z A;  2HDW A;  1I3Q J;  2MC3 A;  3CZ6 A;  5J1Y A;  2JQ7 A;  4G6D A;  2YX7 A;  4OIR F;  5FKO A;  2V79 A;  4CDG A;  4U0Y A;  1S8N A;  4IKF A;  4Q5S F;  3WTX C;  2NS7 A;  2XPV A;  2X85 A;  2K02 A;  1FSH A;  4IHV A;  3RQI A;  3PM1 A;  1YO5 C;  2E1C A;  3B6C A;  3I55 I;  5EG0 A;  4GYG A;  2M8G X;  2QA4 I;  1B8I B;  3I56 I;  3MN2 A;  2OJE D;  4WXD A;  2EA2 A;  4B3A A;  1W7P A;  2IS4 A;  1GVJ A;  1G3Y A;  4DBR A;  3IKV A;  2XSD C;  2EK5 A;  1I27 A;  3HHG A;  4BXX J;  3F22 A;  3H0D A;  1Y0U A;  3E5X A;  3ZQH A;  1FX7 A;  3ABT A;  3TL4 X;  4XR6 A;  3ABM H;  4A69 C;  2EZL A;  4EEF G;  1JI8 A;  1EJ9 A;  3IH4 A;  5HNH A;  2FU4 A;  3ABU A;  2Y2Z A;  2COB A;  1Z21 A;  2M3A A;  3ZMU A;  4G7O F;  4A3I J;  2OZ6 A;  3GTO J;  4KJZ A;  1MBJ A;  2RAE A;  2HPI A;  4A3E J;  2DU9 A;  4KN4 X;  1IXR C;  2L7Z A;  3IHU A;  2OQR A;  5K1Y A;  2P7V B;  1FOX A;  4UVA A;  2E1M C;  2LKP A;  5M5Y J;  1QGP A;  3KP2 A;  3V7R A;  2P7C B;  2MFZ A;  2HEO A;  4RB2 C;  1T08 B;  4UUS A;  3IRQ A;  1O57 A;  3I58 A;  1ZRC A;  3WHB A;  1PYV A;  4I98 B;  3S2H J;  1XB4 A;  2QQB A;  3I71 A;  5HDN A;  3BR2 A;  2W57 A;  2WB1 N;  3JRI A;  4Y17 A;  4PJJ A;  3PFY A;  2JMW A;  2XUB A;  3OV8 A;  1J0R A;  1W7P B;  5H2F C;  3W2A A;  3DF8 A;  2YU3 A;  2JSC A;  3OYK A;  3LSJ A;  1ACI A;  1JHH A;  4U88 A;  3QPL A;  4D7N A;  4IOC F;  2BEO A;  1ZN2 A;  1HCR A;  3CUQ C;  1J09 A;  2LR8 A;  1TWC J;  2BY1 A;  3OYG A;  4G94 A;  1JTX A;  1YX5 A;  3WGI A;  5IYB J;  5HLI A;  4EQQ A;  4EAT A;  5B66 C;  3E7L A;  1FP1 D;  1R5H A;  3FXL A;  2LY2 A;  5GAH J;  2FRH A;  1EKE A;  2DYS H;  2VKD A;  2QLZ A;  4LLG F;  2LFB A;  4E6K G;  5LGN A;  3OYJ A;  3PNV A;  4HX8 A;  3CJQ B;  2CQX A;  1JUM A;  5CPR B;  1ZGA A;  4ENJ A;  4E7I A;  2MAB A;  1E3H A;  5J4Y A;  3EYY A;  3BDD A;  3H92 A;  1Z6R A;  4LLN A;  1NK2 P;  2VKH A;  4IX7 A;  1Y39 A;  3VYU B;  2X1D A;  3IWF A;  4FE7 A;  3BQZ A;  4W97 A;  3JRF A;  2DI3 A;  5LHH A;  2CUE A;  2G7U A;  4BE2 A;  3OYI A;  4EJW A;  1APL C;  2EV6 A;  3BRO A;  3HHH A;  2LNB A;  2LY9 A;  5JFR A;  4IHY A;  4RMN A;  4BEH B;  4A6E A;  3DKW A;  3DLL F;  2ZJR F;  3EYI A;  2ECB A;  2JA7 J;  1LEB A;  2VL8 A;  2R7F A;  1MJB A;  2R7W A;  5F0C A;  3RPU D;  3TP0 A;  2XGC A;  1FP2 A;  2LOO A;  2QEN A;  1K4S A;  2KRC A;  1MBH A;  2F4O B;  3I0T A;  1O4X A;  4AYB A;  4C9Y A;  5KNL A;  5GAD J;  3A01 B;  1TP4 A;  3OWT A;  4MLO A;  2RC4 A;  2FQ4 A;  3MQ0 A;  2F5V A;  3JSP A;  5F0H A;  4HDU A;  5CYV A;  1TW3 A;  4AYB N;  1Z3X A;  2GA1 A;  2KIF A;  3FIW A;  5DTD A;  3K70 D;  2FML A;  4FTH A;  2GXB A;  4ZYA A;  1IV6 A;  3IH2 A;  2VBY A;  3EUA A;  2HR3 A;  5TIS C;  1TQM A;  2FNP A;  2VT3 A;  1I3A A;  1TT0 A;  2EFN A;  4XOR A;  1IC8 A;  3PL8 A;  4LG0 B;  3GYH X;  1ETQ A;  4NB5 A;  3K4M A;  4IF4 A;  5E1X A;  1IUY A;  4YIF A;  3CQZ J;  2DA5 A;  4GFB A;  2WBM A;  2RV8 A;  4HEA 2;  1SFE A;  2FEZ A;  5J40 A;  3JR9 A;  4LIU A;  1GXQ A;  1W5T A;  2ETH A;  1OYI A;  3E5U A;  5D5W B;  2EIJ H;  4DNC A;  3CCR I;  4HYE A;  1OIS A;  2VON A;  2DN0 A;  3KP6 A;  1MJA A;  3E5Q A;  2OU2 A;  2RVC A;  3E0J B;  3K4L A;  1ERD A;  2YPR A;  3L2R A;  2Z9O A;  1FOY A;  1PJR A;  3VYS B;  5GP9 A;  2L9R A;  2PEX A;  5FLV A;  4XLP F;  3C7J A;  4GDF A;  5EZH A;  3LFK A;  2IT0 A;  4M3F A;  5KAI C;  3BJA A;  2A5W A;  1B1B A;  1OLT A;  2DA4 A;  5LRS A;  1VQ9 I;  1EH6 A;  2DMQ A;  1DUX C;  1HQC A;  2DMP A;  5GPA A;  4YG2 F;  2MG4 A;  3JTG A;  1R49 A;  1REP C;  4XIC A;  2YUS A;  2NVX J;  2O8K A;  1YS7 A;  3HYI A;  1KYZ A;  3AKZ A;  2CH0 A;  1OQY A;  1Y1V J;  5IP6 A;  5GAE J;  1R1V A;  4XRS G;  1MBK A;  2KJB A;  1LEA A;  3CTA A;  1YLF A;  3LL7 A;  1S7A A;  3A0H C;  1T2K A;  4AIJ A;  1Y1W J;  5J8C A;  1OCP A;  1S5L C;  5E8I A;  4P9F A;  4YIR X;  2OBP A;  2ICW G;  5JI6 A;  5KHD A;  4F91 B;  2PQ8 A;  2HTJ A;  2HZD A;  4JQF A;  2R5Y A;  1HDD C;  1F1Z A;  3BR5 A;  4EM0 B;  4WK8 F;  1JUS A;  1V5E A;  2AO9 A;  2JJ7 A;  3BC8 A;  5F6F A;  3TDZ C;  4I6Z A;  2DFH A;  1TWF J;  4MIM A;  5M5X J;  4D5F A;  4A5M A;  3D1N I;  1MBF A;  2DQR A;  4BQN A;  1G59 A;  1YX3 A;  4IPA A;  1TWG J;  2H8W A;  5EYR A;  4L9N A;  3PO3 J;  3LQR A;  3GO5 A;  4EM1 A;  2R7U A;  4A3F J;  2KKO A;  4XSZ F;  2VOO A;  1E17 A;  2JUG A;  2VAS A;  2F48 A;  3ZCO A;  3I59 A;  5CVV A;  3M07 A;  1QPI A;  2PFB A;  3HOY J;  2VPL A;  4HF1 A;  2ECC A;  1WZ2 A;  1SFX A;  1LJ9 A;  1ZRE A;  4U87 A;  2E2I J;  1YRN B;  4Y3O A;  3R4K A;  3LA3 A;  2X6Y A;  4XSX F;  2L5Q A;  2NOG A;  2AXL A;  5J6X A;  1B72 B;  3SQN A;  3BZ6 A;  1F43 A;  2HVQ A;  2LG4 A;  1X1P A;  5BS6 A;  4M71 A;  2ZBK A;  4M73 A;  3OL4 A;  1Z77 A;  2M2E A;  4J19 A;  2QKL B;  3GTM J;  3S1N J;  1T39 A;  1Q1H A;  2PJR B;  4PJM A;  2IBD A;  3BG5 A;  3FBI B;  2JRT A;  3R60 A;  4CA0 A;  4Y52 J;  1ZAO A;  4EGZ A;  2K7L A;  2A6H F;  2V9K A;  5J47 A;  3BR0 A;  1FC3 A;  1WJA A;  2XPW A;  2X51 A;  3ZQI A;  1XMK A;  1LFU P;  1MBE A;  4WX9 A;  4DZP A;  1MW7 A;  1HW2 A;  1JJ6 C;  3HSE A;  2K3P A;  4PGH A;  3WU0 A;  4XN3 A;  3M3Y J;  2Q2E B;  3V42 A;  1AU7 A;  2MD0 A;  2Q1Z B;  2ZSI B;  1S7E A;  3Q9S A;  3WTW C;  3BG3 A;  3X2Q H;  1ODD A;  4C3H J;  3ASO H;  5LEK A;  1D5V A;  3ZRG A;  4I99 C;  3OOP A;  1TW2 A;  3I4P A;  3BT9 A;  5BPI A;  1XSD A;  2JTV A;  1G4D A;  2GM4 A;  1A6I A;  4AIH A;  1RR7 A;  3SZT A;  5FRO A;  3Q3S A;  4U7B A;  3HOU J;  3I9V 2;  2KPM A;  5JHU A;  1A04 A;  4OMZ A;  3FXR A;  3K4J A;  3GTJ J;  1OCC H;  3M7G A;  2W1O A;  1R9T J;  1Z91 A;  4WXC A;  2VXZ A;  1J75 A;  4PJN A;  3JRD A;  5FJ8 J;  3F3X A;  4LK0 F;  2ZC2 A;  2E7X A;  2EV0 A;  4BHP A;  1XS9 A;  1LE8 A;  2V6E A;  3C2G A;  4KN7 X;  2WWY A;  5BPD A;  3CCV I;  2FJ1 A;  3N97 A;  3WGG A;  3J81 Z;  1MMS A;  2L54 A;  4OU0 A;  1XGO A;  2B63 J;  1OCT C;  1UZC A;  2Q2E A;  3L2U A;  1BJZ A;  5F64 A;  1FMW A;  1IV8 A;  5IOZ A;  1QVU A;  2V26 A;  2DOD A;  1IXS B;  1OR7 A;  2Y75 A;  4NBQ A;  4B4C A;  3G2B A;  1YHQ I;  3OYD A;  1QZE A;  2VUM J;  1V55 H;  2ID6 A;  3K6G A;  4Y4R A;  2D2W A;  4DZJ A;  2FMY A;  4Y13 A;  4HA8 A;  5LBQ A;  2STW A;  1MMA A;  4UHT A;  4PFP A;  3K0L A;  3HOZ J;  2DBB A;  3R61 A;  2RNG A;  3ZN0 A;  2W24 A;  3REO A;  3PQJ A;  4CCL A;  4OAY A;  5DDG A;  3TED A;  3HRU A;  3QU3 A;  4KYW A;  2AQE A;  1D1C A;  3A01 A;  1XN7 A;  4KIT B;  5BOX A;  1VQO I;  1VF9 A;  4XL9 A;  1HLV A;  2ME0 A;  5J8F A;  1SFK A;  3S93 A;  2V1X A;  2LY1 A;  4ZZL A;  1P2F A;  2K3F A;  3OOU A;  3MMY B;  2R7D A;  3ZN1 A;  2FXA A;  1H89 C;  3MKW B;  1B6A A;  1YIT I;  1UG2 A;  3HEF A;  2QBY B;  1RC9 A;  3P5J A;  5D6F A;  5FRN A;  5IYC J;  3BJ6 A;  4DYQ A;  1E2X A;  3J7Z I;  2LC2 A;  4BAY A;  1OCZ H;  3CC7 I;  1ETX A;  2BBY A;  2G9W A;  2PMU A;  5H6Q A;  3S8P A;  5ILU A;  4ENK A;  2DT6 A;  2DFF A;  3PSF A;  3IUO A;  2D1V A;  4RM3 A;  3K2Z A;  3F8N A;  3OMY A;  3S15 J;  2ZSH B;  3B02 A;  4QPQ A;  5J1U A;  2K9L A;  3FKI J;  3GF2 A;  4BS9 A;  4IHT A;  1SVL A;  2LRE A;  4C3J J;  3S16 J;  3GW2 A;  4XN0 A;  3C18 A;  3HL2 A;  3SJM A;  2E5Z A;  3E97 A;  1J59 A;  4HNT A;  4UNO A;  1GXP A;  1ON1 A;  3FMS A;  4BHC A;  4D9J A;  4KT6 A;  2BW3 B;  1K6O A;  5DD4 A;  1VQM I;  2OQG A;  1KQ8 A;  3F8B A;  3FXM A;  2EZK A;  3LSI A;  3DTK A;  5CQG A;  4F3Q A;  3OYE A;  3RKW A;  2P5K A;  3W6V A;  2HQA A;  2HOE A;  3K1N A;  3KYL A;  3I53 A;  3QYB A;  1MMD A;  2BY0 A;  3P7N A;  5E1Z B;  1QHH D;  3FMR A;  3U1D A;  1G2H A;  2OAZ A;  1W5S A;  1D8J A;  1IRZ A;  4A93 J;  3F9K A;  5E20 A;  4C30 A;  2ZXI A;  2JA2 A;  1ZK8 A;  4CYC A;  1OYY A;  2H1K A;  5FD6 A;  3KZZ A;  4U0W A;  3WU2 C;  1SMT A;  1WCM J;  4UB6 C;  2KIM A;  3DPT A;  1P92 A;  1XMX A;  1SD4 A;  2MSY A;  4GRI A;  4CHU A;  1XSV A;  1OKR A;  1SD5 A;  3F6V A;  2R7O A;  4AVP A;  4DW6 A;  1P4A A;  2JZY A;  4IZZ A;  3BCA A;  2O3F A;  2L7F P;  3CLO A;  3VPR A;  5JHF A;  4PK4 A;  2TDX A;  1X2N A;  2X6X A;  3BG9 A;  2C6Y A;  4II2 A;  3LQQ A;  4GO1 A;  1O7F A;  1WQ2 A;  4Z6Y A;  2CU7 A;  4L5I A;  1MD0 A;  4HBL A;  3GEZ A;  2NVT J;  3UKG A;  1D1B A;  2VT2 A;  1MIJ A;  1OYW A;  4M6Y A;  4Q47 A;  4XID A;  3ESW B;  1BIB A;  3BTC A;  3L00 A;  4KIC A;  1BL0 A;  4ZH4 F;  1E0E A;  1EH7 A;  3WG9 A;  3BWG A;  2CQK A;  2LVS A;  3F8C A;  1FOW A;  3A0B C;  4RAF A;  1RNL A;  2A6T A;  3BG7 A;  2GBY A;  4OOI A;  4F7Z A;  3I4N J;  1FOK A;  1XDS A;  2R5Z B;  3UR3 C;  1K79 A;  2HWV A;  2R3S A;  4RAG A;  2IS2 A;  1LDK B;  3F72 A;  3M8F A;  3M4O J;  1LUJ B;  1ULY A;  1ETO A;  3HOT A;  3GZ6 A;  2OCC H;  2LH9 A;  1K4T A;  4RB3 C;  2GIV A;  3M8J A;  3S1Q J;  4KNY A;  4HZF A;  3K4N A;  1ZLJ A;  2KJC A;  3P9C A;  3OSF A;  1BR2 A;  1N78 A;  1HW1 A;  3PNT A;  5D8L B;  4N9H A;  2XHK A;  2P8T A;  5HLH A;  2O5R A;  2F4I A;  2P6S A;  5FFX A;  2OTJ I;  1XSX A;  2EV5 A;  2KDZ A;  1G3W A;  4HV6 A;  1UHW A;  3ML6 A;  1UCR A;  1PUE E;  4YEL A;  1ZQ3 P;  2Z5U A;  2WAE A;  4HF0 A;  2L7M P;  5J3L A;  1GHC A;  3S3M A;  4P96 A;  2V6C A;  3C2H A;  1ONV A;  2O03 A;  1JE8 A;  2A68 F;  3J81 K;  2H8R A;  1VQ6 I;  4KIS A;  2W84 A;  3G6E I;  4O3M A;  3IH3 A;  4L9V A;  1ON2 A;  4N0B A;  2VE8 A;  2XDV A;  5EEG A;  4V19 K;  1WRJ A;  2IA1 A;  4MEY F;  5FRM A;  3A2K A;  3PO2 J;  1BBY A;  4AC0 A;  2X48 A;  2QEX I;  4KIB A;  2L9V A;  1EF4 A;  1ZRF A;  3P9K A;  4CO8 A;  4MTD A;  3H5N A;  4DYR A;  3LAP A;  3CMA I;  1ZLK A;  3DTE A;  1R4N B;  3GLL A;  2BVL A;  4LJZ F;  3R0J A;  4XLF A;  1ETW A;  1M1E B;  4JOM A;  3TOB A;  4IXA A;  1X58 A;  2I10 A;  2CW7 A;  4OAZ A;  2P81 A;  3GVA A;  4ENN A;  4MQV A;  2R7Z J;  2FBH A;  1MJ9 A;  2XGX A;  3FIS A;  2QQ9 A;  5L3G A;  3PJR A;  1KU3 A;  4X6A J;  1SAX A;  2HKX A;  1O7L A;  2EFO A;  2LF7 A;  2D45 A;  2JPC A;  3BTJ A;  1LDD A;  2HXO A;  3V7C A;  3DTI A;  4LGW A;  3M1E A;  2ZXJ A;  1I1S A;  1RI7 A;  5LGU A;  4ZDP A; 
#chains in the Genus database with same CATH homology
 2M34 A;  2O7O A;  3G1M A;  3A01 B;  1GVD A;  3LSP A;  4MLO A;  3OSG A;  1P7I A;  3GTL J;  4RDU A;  2FQ4 A;  4V2G A;  5F0H A;  4AYB N;  2EQR A;  3FIW A;  4FTH A;  5DTD A;  2JN6 A;  2YS9 A;  3LSG A;  1TWA J;  1IV6 A;  3HGG A;  3IH2 A;  1FIP A;  4B1R A;  5IOY A;  2DTZ A;  2QCO A;  3HM5 A;  1IC8 A;  1ETQ A;  5FLM J;  1A5J A;  3A02 A;  1JTY A;  1WI3 A;  3CQZ J;  1ZTR A;  5GPC A;  2ELK A;  2MW8 A;  2OPT A;  4A3K J;  2DA5 A;  1JKR C;  4GFB A;  3ZOB A;  5FKM A;  5FKN A;  3HOW J;  4LOC A;  2FD5 A;  1GV2 A;  1P7J A;  4G12 A;  2R93 J;  3JR9 A;  4W1U A;  5E3O A;  2HI3 A;  1U9N A;  2DN0 A;  1GUU A;  2G0E A;  2TCT A;  2JWT A;  3CMY A;  1JKO C;  1XC5 A;  2E1O A;  3O8H A;  2EZI A;  2HQ5 A;  3LOC A;  2L9R A;  5GP9 A;  4DYC A;  2YU9 J;  5FLV A;  3ZQC A;  4JX5 A;  2LP0 A;  3HB9 A;  2CJJ A;  4QSH A;  1BW6 A;  3S1R J;  5EZH A;  4M3F A;  1RKW A;  2DA4 A;  2QF7 A;  4FE4 A;  2DMQ A;  3FK6 A;  1ZGW A;  2DMP A;  4JP0 A;  5GPA A;  3L1P A;  2MG4 A;  4FIS A;  4XIC A;  2YUS A;  3G1L A;  2R92 J;  3CCY A;  2NVX J;  2O8K A;  4ABZ A;  2EH3 A;  3LNQ A;  1IUF A;  4D5C A;  1IG7 A;  4A3D J;  1WH5 A;  1RET A;  1JUP A;  3B6A A;  1Y1V J;  5IP6 A;  1WPK A;  2DA7 A;  5C4J J;  4XRS G;  1IGN A;  1MBK A;  1X2M A;  1K83 J;  4A3L J;  2FX0 A;  1YRN A;  1JJ8 C;  1Y1W J;  1IJW C;  5FKK A;  4C2M J;  1K61 A;  4MFD A;  1OCP A;  2JA6 J;  5E3M A;  1PUF A;  2VKE A;  2NVY J;  2R5Y A;  3FK7 A;  1HDD C;  4RBO A;  3BR5 A;  1ITY A;  3ZQF A;  1JUS A;  2AO9 A;  2JJ7 A;  3TW7 A;  3RKQ A;  1W0U A;  4I6Z A;  4IHW A;  2LLK A;  1TWF J;  4MIM A;  5M5X J;  4D5F A;  1UHS A;  4CYC B;  3D1N I;  1AHD P;  2XB5 A;  1MBF A;  2DMT A;  5BNG A;  1TWG J;  5EYR A;  1WH7 A;  4V2F A;  3PO3 J;  3S1M J;  4A3F J;  1E3O C;  5M3M J;  2E2H J;  1ETY A;  1QPI A;  3HOY J;  2Y0S N;  2ECC A;  5EEA A;  2E2I J;  1YRN B;  2X9D A;  3SFI A;  2XGE A;  3WHC A;  2NOG A;  1B72 B;  1F43 A;  1T33 A;  1ZR2 A;  1FTZ A;  3BTL A;  1Z77 A;  2M2E A;  4J19 A;  3GTM J;  2ID3 A;  1T56 A;  3S1N J;  1MNM C;  2IBD A;  3BG5 A;  2Y31 A;  2D5V A;  4QTR A;  3S2D J;  1BA5 A;  1BW5 A;  2MGQ A;  1Q1V A;  4Y52 J;  1FTT A;  4S0H B;  3HOV J;  3BR0 A;  3BTI A;  2XPW A;  3ZQI A;  5K7H A;  1LFU P;  1MBE A;  4HNV A;  3BQY A;  4DZP A;  1ORK A;  1JJ6 C;  2HDD A;  1MH3 A;  4Y7N J;  1FJL A;  3MKL A;  3M3Y J;  2HOT A;  1VI0 A;  3S14 J;  1AU7 A;  1S7E A;  3BG3 A;  3JRB A;  4C3H J;  4A3C J;  3BT9 A;  2DA1 A;  4BBR J;  2GM4 A;  1A6I A;  1ENH A;  1RR7 A;  1Z0X A;  3Q3S A;  3HOU J;  5M3F J;  4XRS A;  5EGO A;  2JA5 J;  2Y9Y A;  3GTJ J;  5E3L A;  1HDP A;  1R9T J;  3GTP J;  3JRD A;  5FJ8 J;  2KT0 A;  4D7M A;  3Q0V A;  1LE8 A;  2LD5 A;  1XS9 A;  4JX6 A;  2OF7 A;  2FJ1 A;  5E3N A;  4A3M J;  2PMZ N;  1MBG A;  5EG0 B;  3SDG A;  5EF6 A;  1MSE C;  1U9O A;  3HDD A;  4M3B A;  2B63 J;  1OCT C;  3C2B A;  1BJZ A;  2EZH A;  5DS9 A;  5IOZ A;  5F04 A;  4XRM A;  1QVU A;  4B4C A;  1DU0 A;  1FIA A;  4IHX A;  3HBL A;  4JX4 A;  1GV5 A;  3BR6 A;  2VUM J;  1TWH J;  2K9Q A;  4L5E A;  2ID6 A;  2L0K A;  5K7Z A;  3BR1 A;  1ETK A;  2TRT A;  2Y30 A;  4DZJ A;  1NK3 P;  1POG A;  4IEJ A;  1TC3 C;  4M6V A;  1QRY A;  3HOZ J;  3OIO A;  5EGO B;  5EDN A;  5EZG A;  2R5Y B;  2DMN A;  3K2A A;  2XPU A;  3TED A;  2HXI A;  3HKZ N;  3JRA A;  3A01 A;  2DA6 A;  1HF0 A;  2AHQ A;  1F36 A;  5HOD A;  1VF9 A;  1HLV A;  4M3D A;  3H3V K;  3H0G J;  2ME0 A;  1U78 A;  3BR3 A;  2XRL A;  5IPA A;  1HOM A;  5M5W J;  1OJL A;  1VND A;  1CQT A;  4NDL A;  3IV5 A;  2CUF A;  3OOU A;  4JYK A;  1H89 C;  3DCF A;  5F0F A;  1UG2 A;  2E2J J;  3JRC A;  3HEF A;  2HOS A;  1WGX A;  2K9N A;  5IYD J;  3K7A J;  3Q0U A;  4DYQ A;  5IYC J;  2DJN A;  1RES A;  2JA8 J;  1ETX A;  2ZB9 A;  2IEK A;  2K40 A;  4BBS J;  2IAI A;  3NAR A;  3I4M J;  5J1R A;  3S15 J;  1RPW A;  3GTQ J;  5J1U A;  3RZD J;  3FKI J;  1ZR4 A;  2LTP A;  4UUT A;  4C3J J;  2WV1 A;  3ZQL A;  1IDY A;  2VPR A;  3S16 J;  1IDZ A;  1LFB A;  3SJM A;  3MVP A;  4MFE A;  3G1O A;  3QPS A;  3JRH A;  3Q0W A;  4X1E A;  2EZK A;  3S17 J;  1I6H J;  2ME6 A;  5F27 A;  2NS8 A;  4QIW N;  2GLO A;  3W6V A;  2VKV A;  1SAN A;  5C44 J;  4I76 A;  1B8I A;  5JLW A;  1DU6 A;  9ANT A;  2LKX A;  1GT0 C;  2EBI A;  2VI6 A;  1I3Q J;  1H8A C;  2M0C A;  2DA2 A;  1G2H A;  3RZO J;  5J1Y A;  1IRZ A;  4A3B J;  4A93 J;  5FKO A;  4FCY A;  2DMU A;  1ZK8 A;  4CYC A;  2H1K A;  2NS7 A;  2XPV A;  4M3G A;  4IHV A;  3RQI A;  3PM1 A;  5C4X J;  5F08 A;  1AKH B;  2R5Z A;  1WCM J;  3B6C A;  1JGG A;  2MSY A;  2JK3 A;  5EG0 A;  2E19 A;  1FEX A;  2M8G X;  2XB0 X;  3DEW A;  1B8I B;  1JT0 A;  3MN2 A;  4DW6 A;  4BY7 J;  4B3A A;  2L7F P;  3VPR A;  3NAU A;  3ZQG A;  3HGY A;  3A03 A;  1X2N A;  3BG9 A;  2LK2 A;  5IP9 J;  2XSD C;  4BXX J;  3ZQH A;  1GDT A;  2CU7 A;  1H88 C;  3GTK J;  3TW6 A;  4A69 C;  2NVT J;  2EZL A;  3UKG A;  2WAQ N;  4EEF G;  3IH4 A;  2K9S A;  2Y2Z A;  2COB A;  4XID A;  4A3I J;  4AUX A;  5F1J A;  3GTO J;  1MBJ A;  2RAE A;  3BTC A;  2CRG A;  1BL0 A;  4A3E J;  2NVQ J;  2HYJ A;  2L7Z A;  1JKP C;  2LVS A;  2GBY A;  3I4N J;  3GBG A;  5M5Y J;  2R5Z B;  1ZKG A;  1U8B A;  4UUS A;  3WHB A;  3HOX J;  3M4O J;  1B72 A;  3S2H J;  4A3G J;  1ETO A;  3BR2 A;  2WB1 N;  3JRI A;  3S1Q J;  2JMW A;  3OSF A;  1ETV A;  3LSJ A;  4MO7 A;  3QPL A;  4D7N A;  1HCR A;  2LR8 A;  1TWC J;  2R0Q C;  3JRE A;  1JTX A;  1MSF C;  2KDZ A;  5IYB J;  1MH4 A;  1NTC A;  1ZQ3 P;  2O9L A;  2N8G A;  3E7L A;  2L7M P;  5J3L A;  1SFO J;  2XGD A;  2H8R A;  4A3J J;  4C3I J;  2LFB A;  1JT6 A;  3IH3 A;  1W0T A;  2M9H A;  3TP3 A;  2CQX A;  1JUM A;  5C3E J;  3CDL A;  3QQA A;  3PO2 J;  1UMQ A;  4UUS B;  2HOA A;  4AC0 A;  2X48 A;  1EF4 A;  1NK2 P;  5FKL A;  4DYR A;  5JLX A;  2CQQ A;  4FE7 A;  1D5Y A;  3BQZ A;  4W97 A;  3JRF A;  2CUE A;  3O8G A;  3GTG J;  1PUF B;  1OFC X;  5IP7 J;  1QVT A;  1ETW A;  1APL C;  4IHY A;  2LY9 A;  1X58 A;  2X6O A;  2I10 A;  2P81 A;  2R7Z J;  3F0C A;  5K7F A;  2ECB A;  2JA7 J;  2Y9Z A;  3FIS A;  4X6A J;  1LE8 B;  5F0C A;  2W48 A;  1AKH A;  4XK4 A;  1RKT A;  4BY1 J;  2DA3 A;  3JRG A;  1VFC A;  3TP0 A;  4BKX A;  3LSR A;  2XGC A;  1XG1 A;  3BTJ A;  2HXO A;  1MBH A;  1I50 J;  1O4X A;  1JKQ C;  4M3E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...