5IYDJ

Human core-pic in the initial transcribing state (no iis)
Total Genus 14
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
14
sequence length
67
structure length
67
Chain Sequence
MIIPVRCFTCGKIVGNKWEAYLGLLQAEYTEGDALDALGLKRYCCRRMLLAHVDLIEKLLNYAPLEK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription, transferase/dna/rna
molecule keywords DNA-directed RNA polymerase II subunit RPB1
publication title Near-atomic resolution visualization of human transcription promoter opening.
pubmed doi rcsb
source organism Homo sapiens
total genus 14
structure length 67
sequence length 67
ec nomenclature
pdb deposition date 2016-03-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 5iydJ00
3GTJJ 4D7NA 1NK3P 3HOVJ 4XRSA 2CUEA 1D5YA 2XGEA 2OPTA 4A3KJ 3S1RJ 3M3YJ 2VUMJ 2DTZA 5FKLA 1LFUP 1H8AC 3TP3A 3JRIA 3ZQHA 1CQTA 3HGGA 3S15J 5F0FA 2Y9ZA 3Q0WA 3WHCA 1MH3A 5J3LA 3G1MA 3UKGA 5GPCA 2ME6A 3Q0VA 2IEKA 1B72B 3S2HJ 2M8GX 2NS7A 1PUFB 3O8HA 5FLMJ 1IGNA 2JA6J 1TWGJ 5IP6A 1A5JA 1U8BA 2XGCA 3MKLA 3MVPA 4BBRJ 1Y1WJ 3Q3SA 3S1NJ 2P81A 4S0HB 1HOMA 3MN2A 3LOCA 3HOZJ 2E19A 3CDLA 1RR7A 5IP7J 2R93J 2CRGA 1AHDP 3HEFA 2QCOA 4XRSG 1AKHA 3I4MJ 4A69C 3IH2A 2JA7J 2JN6A 1OCPA 3CMYA 3GTPJ 1JT0A 1BL0A 1GDTA 2GM4A 3WHBA 4MFEA 1ITYA 3HB9A 4MFDA 2KDZA 1JKQC 1RETA 2MW8A 1YRNB 4B4CA 2HOAA 5E3LA 3S2DJ 1JTYA 2AO9A 2FQ4A 2NVQJ 3PO3J 1Z0XA 3RQIA 2OF7A 3CCYA 5C3EJ 2YU9J 1B8IA 1TWHJ 5F0HA 1LE8B 3JRBA 2LP0A 2XB0X 1QRYA 4D7MA 1IDYA 1XG1A 4A3EJ 3A03A 2LK2A 4L5EA 4QSHA 1WH5A 1RKWA 4Y7NJ 3HBLA 2O9LA 4QIWN 3W6VA 5EDNA 3QQAA 4XICA 2R7ZJ 1JUMA 1JUSA 5C4JJ 4EEFG 2CUFA 4IHXA 2M2EA 3LSPA 3GBGA 5M3FJ 4FE4A 1ETYA 3F0CA 2L9RA 1U78A 3G1OA 4A3CJ 1GV5A 4CYCB 3HOXJ 9ANTA 1MBJA 2R0QC 2NVTJ 5F0CA 5FKKA 5J1RA 2M9HA 2TRTA 2R5ZA 4I76A 4BY1J 4FCYA 2H1KA 5DTDA 1IG7A 1HDDC 1VI0A 5E3MA 2DMUA 2YS9A 3LSJA 5M3MJ 4J19A 4XIDA 1ETVA 3LNQA 1GV2A 2R92J 1O4XA 2X6OA 5EGOB 2L7ZA 1QVTA 5EG0A 1JUPA 2ECBA 3BQZA 3HGYA 2EZKA 4A3FJ 4XRMA 2DMQA 5EZGA 1QVUA 5F08A 2ZB9A 5IP9J 1JJ8C 4A3IJ 1MSFC 4QTRA 2DA4A 3CQZJ 1IRZA 2O8KA 4DW6A 3HKZN 3GTKJ 3HOYJ 1NTCA 4C3IJ 1ORKA 1HDPA 5E3OA 1ZKGA 3O8GA 3ZQLA 2HOTA 3JR9A 2EH3A 5GP9A 2DA3A 1F43A 1WCMJ 3OOUA 3IH3A 1H88C 2K40A 2R5YA 1SFOJ 1H89C 4C3HJ 5M5WJ 1I6HJ 5E3NA 4UUSB 4DZPA 2JJ7A 1BW5A 2M34A 3SFIA 1MBKA 5JLWA 4FISA 1G2HA 2XSDC 3L1PA 4W1UA 1FTZA 2DA2A 1TWCJ 3I4NJ 2L7MP 2DA5A 5FKNA 1IC8A 1B72A 1Z77A 4X6AJ 3BTLA 2JK3A 2NVXJ 1PUFA 5FKOA 1JT6A 1S7EA 1GUUA 2LR8A 3OSGA 3K7AJ 1JKPC 2XPVA 1X2MA 3A02A 1FJLA 1NK2P 5IYBJ 4A3BJ 4IEJA 4DYCA 4NDLA 1X58A 5C44J 2ECCA 3BTCA 1MNMC 1UG2A 1K61A 3S1QJ 1TWAJ 1JTXA 1JKOC 3BT9A 3DCFA 1ZR4A 2HDDA 1BW6A 1K83J 2EBIA 2LVSA 2HOSA 1R9TJ 1IJWC 3ZQIA 3K2AA 1SANA 2IAIA 5HODA 4G12A 3HOWJ 1YRNA 1FIPA 1TC3C 1MBFA 2L7FP 4MO7A 2H8RA 3FIWA 3BTIA 3JRGA 4M3DA 2W48A 3S17J 2JA5J 4IHYA 4LOCA 1RESA 5IPAA 2DN0A 3IH4A 1LE8A 4A3GJ 1T33A 4UUTA 5M5XJ 4HNVA 3FK7A 4BXXJ 2K9SA 1ZR2A 1XS9A 1HCRA 3ZQFA 5C4XJ 2MG4A 2XB5A 4GFBA 4JX5A 4M3BA 1ZK8A 4M3GA 2HI3A 2DJNA 4DYRA 4FE7A 4ABZA 1ETWA 3S16J 5M5YJ 1ETQA 1MH4A 2Y30A 5EEAA 1HF0A 1VNDA 3NARA 4CYCA 5EF6A 5DS9A 3OSFA 2NOGA 2EQRA 3ZOBA 5IYCJ 3RZDJ 5IOYA 1F36A 3BR5A 3PM1A 3QPLA 4C2MJ 3LSRA 3BR2A 3BG5A 2KT0A 1MSEC 3BG9A 3G1LA 2NS8A 4B3AA 5EGOA 1I50J 2EZIA 3LSGA 4RDUA 2DA7A 2JWTA 2X9DA 2N8GA 5J1UA 4IHWA 2COBA 3GTGJ 1A6IA 3H0GJ 5JLXA 3FK6A 3A01B 3JRAA 1IUFA 1GVDA 1ETXA 2HYJA 4DYQA 1BJZA 2DMTA 3GTLJ 1EF4A 1GT0C 2QF7A 4A3JJ 3BR6A 3OIOA 4MIMA 3D1NI 2EZLA 2CQXA 2LFBA 3JRDA 2XGDA 1BA5A 4I6ZA 2ELKA 3S14J 2VKVA 2Y0SN 3JRCA 2WAQN 5J1YA 3PO2J 1P7JA 2L0KA 2DMNA 2Y9YA 3TW6A 3FKIJ 2ID6A 4X1EA 2I10A 3QPSA 1ZTRA 2HXIA 1U9NA 4Y52J 4UUSA 1TWFJ 1HLVA 5FKMA 5K7HA 2JA8J 4JX4A 2WV1A 2CU7A 3C2BA 1MBEA 1WI3A 2Y2ZA 4AC0A 4M3EA 5FLVA 1T56A 5EZHA 4IHVA 4D5FA 3GTOJ 1MBHA 3B6CA 3RZOJ 2D5VA 2TCTA 2WB1N 1IV6A 2LLKA 3TP0A 2E2HJ 1UHSA 3SJMA 1POGA 2O7OA 1ETOA 1W0UA 5IYDJ 2VI6A 1ZQ3P 2CQQA 5F04A 1JKRC 3Q0UA 1WPKA 2XRLA 1VFCA 4JX6A 1W0TA 2JMWA 4XK4A 3GTQJ 2VPRA 3ZQGA 3IV5A 2HXOA 1DU0A 2YUSA 1AU7A 3JRHA 3HOUJ 1UMQA 5BNGA 2E2IJ 3BR1A 1AKHB 2PMZN 1OCTC 4A3MJ 2HQ5A 4MLOA 1MBGA 2E2JJ 1JJ6C 2VKEA 2DA1A 1ETKA 4BY7J 1RPWA 2GBYA 3BG3A 1DU6A 4A3LJ 4FTHA 4A3DJ 5EYRA 4C3JJ 1P7IA 2MGQA 2M0CA 2G0EA 1FTTA 4W97A 5F1JA 1FIAA 2FX0A 2ID3A 1WH7A 3JREA 2FJ1A 1ENHA 3HDDA 2X48A 1B8IB 3VPRA 5GPAA 2LKXA 2AHQA 1LFBA 1APLC 1Y1VJ 4AYBN 3FISA 1IDZA 2MSYA 4B1RA 3DEWA 4AUXA 2IBDA 1QPIA 2Y31A 3E7LA 1XC5A 2LTPA 3JRFA 5K7ZA 2EZHA 2E1OA 1I3QJ 1OFCX 3NAUA 2DA6A 2R5ZB 1X2NA 2GLOA 2RAEA 3GTMJ 4DZJA 2XPWA 3HM5A 5FJ8J 1FEXA 1JGGA 1VF9A 1ZGWA 5EG0B 2XPUA 2K9NA 4M3FA 4BKXA 3BR3A 4D5CA 3SDGA 3S1MJ 4JYKA 3BR0A 4RBOA 1RKTA 3A01A 2K9QA 3BQYA 4JP0A 5F27A 3M4OJ 3RKQA 2CJJA 2DMPA 1E3OC 1OJLA 3B6AA 4M6VA 1Q1VA 3TEDA 5IOZA 4BBSJ 1WGXA 3TW7A 2B63J 2LY9A 2NVYJ 4V2FA 2R5YB 2LD5A 2ME0A 2FD5A 3ZQCA 1U9OA 4A93J 5K7FA 3H3VK 4V2GA 3BTJA
chains in the Genus database with same CATH superfamily
2IRFG 1TLHB 3CUOA 3HOVJ 2F5EA 4YIRX 4CCLA 1QNTA 5DM7F 1QU3A 3EUKL 4KIFA 5KAFC 3CCEI 3S3OA 2PEXA 4OIPF 3J7AY 1V5FA 4A3KJ 2KFDA 5H6QA 1X3UA 2VUMJ 2QLZA 2DTZA 3H5AA 4N4OB 1X1CA 1FYMA 3C2HA 4TV7A 2NVUB 1H8AC 1QO0D 3K4CA 1YW7A 3DTKA 3KP3A 5F0FA 4CZCA 5KHDA 3S15J 4WK8F 5J3LA 3RKWA 1TQPA 4CO8A 2ME6A 1IUYA 1USTA 3S2HJ 3MD2A 1K6OA 3L2RA 1K4SA 3O8HA 3K70D 2OU2A 1ZELA 3V8JA 2VJIA 3OWTA 3ZXSA 3QAHA 4ENMA 2DI3A 3FBNB 1IZ1A 1GLNA 1Y1WJ 4OIQF 2NAZA 2M5WA 4S0HB 1YQAA 3TO9A 2CW7A 4XNFA 2A05A 2MH9A 2W84A 3OR2C 3DU5A 2R93J 5CQGA 3I4MJ 2WAQA 2JN6A 1OCPA 1T0FA 3KP4A 1DQUA 1BBYA 1BL0A 1VQ5I 1SFUA 5J6XA 3EUAA 4M9XA 4MFDA 2KDZA 1OLTA 1RETA 2MW8A 2LMDA 4EJOA 2QGUA 1KU2A 4BE0A 4G7ZF 2F4MB 5HS8A 2NVQJ 4HV5A 4I7HA 1R5ID 1SFKA 3CCYA 1FWZA 2MABA 4UVAA 3F8NA 1SD6A 2YU9J 2DPDA 4PSWA 1B8IA 1TQMA 5F0HA 3DQVC 1CF7B 5LRRA 1LE8B 3S8PA 1QRYA 4A3EJ 3A03A 2LK2A 3PNTA 4QSHA 3KETA 4Y7NJ 1KQ9A 4HDVA 1MKMA 3HBLA 4BUPA 4QIWN 3ASOH 2CUJA 1R49A 2CUFA 4IHXA 4YIIA 5D5UB 2Y69H 4YELA 1YS6A 3D5SC 2HZTA 5LFAA 2XF6A 3F0CA 4I99C 1U78A 4U7BA 4CYCB 3HOXJ 4PFPA 3SHFA 1XGNA 2GOMA 1BM9A 2R0QC 5F0CA 5FKKA 4MNUA 1T8IA 2NVTJ 1FLIA 2M9HA 1FOYA 2TRTA 3ZMDA 2VODA 4HLXA 5L3EA 1HDDC 4UV9A 5BS6A 2YS9A 2H94A 3I59B 2QA4I 3BP8A 1ETVA 1QPMA 3LL7A 2HDCA 3QP5A 2X6OA 2V1DA 3DBRB 3FF5A 2L7ZA 4L0YB 5LGTA 4PJLA 3CUQA 1JUPA 2ECBA 3BQZA 4L5IA 4UV8A 1L0OC 2EZKA 3RI4A 3PQKA 1QVUA 2IGOA 1OR7C 4FHTA 5K1YA 3CUQC 2VKDA 4KUMA 3BJOA 2LKPA 2A68F 3PIOF 4EGZA 2CFXA 1WHUA 2O8KA 2JVGA 4KMUX 3U21A 1KU9A 2CO5A 3CC7I 3G4SI 4H0EA 4BXUA 4AYBA 3DLAA 4I09A 5E3OA 1V5GA 2JPCA 1Y0UA 2DA3A 5DV5A 2EB7A 2IA2A 1XDUA 5AIPA 1SFOJ 1H89C 1RUNA 2X85A 3BOQA 2L5QA 1ZH5A 3K70C 4CICA 4U7DA 4HDUA 4XMYA 2DPUA 2VQGA 3S3NA 1BW5A 3K4LA 3OYHA 3HOTA 2M34A 2K9LA 3FDYA 2K7LA 2MLKA 3SFZA 5D5VB 5JLWA 1S7OA 4BHCA 3AG2H 3S32A 3LFUA 3OL4A 2B0LA 1R1UA 4NC8A 2EIMH 2DA2A 2EV6A 2UXXA 2KKOA 3COAC 2QQAA 4MGRA 3L09A 2DA5A 1WVRA 5CVIA 4ESBA 2HKXA 4QPOA 1B72A 4HSRA 2QBYA 2YPRA 4CXFA 4AIDA 2JK3A 2JPBA 3RQ4A 4N4NB 3EYYA 1J7KA 1GUUA 2LR8A 5FO5A 1K6YA 1JKPC 3VOEA 2DOAA 2XAHA 1X2MA 1G59A 4Y3OA 2ZMEA 5IYBJ 1YO5C 3FXOA 3HRMA 4NDLA 4EJTA 1JI8A 2VQLA 3BTCA 3QOPA 1MNMC 3AG1H 1BR4A 1EH7A 2E35A 2ZMEC 1A04A 5L3CA 1UG0A 3H36A 2ICWG 1Z21A 3IAM2 2JT1A 1W5SA 4M6XA 1JKOC 3BT9A 4IQ4A 1Z67A 4RB2C 3WE3A 2KRCA 5CJ9A 5LBQA 2EBIA 3LQQA 1SANA 3KX2A 1X3ZB 1XMKA 3HOWJ 5E8IA 3GLXA 5JR3A 2CFOA 3OMYA 1ON2A 1BOAA 3EUHC 2QKMB 3GX4X 1G6NA 2V9KA 1MBFA 3HUGA 2L7FP 3PNYA 2H8RA 3R60A 4GO1A 4OIRF 2BY2A 3S17J 2R7UA 2H6BA 3CO7C 4L18B 4RGUA 1I1GA 2QKLB 3QU3A 3IH4A 3KP2A 1KONA 1QQIA 3HHHA 4RB1A 2K9SA 3SEZA 3W6JB 1SVLA 2MG4A 2ZCWA 2Y0MA 4GFBA 4B44A 3WTUC 2RKHA 4DYRA 4FE7A 4ABZA 1D8JA 4ASNA 1XGMA 4XLCA 3OYDA 3S16J 2MC3A 3QYEA 3LSTA 3ZMSA 2V9VA 1VNDA 1WJAA 3E0JB 5EF6A 3OSFA 2Z33A 1P92A 4L5JA 5IOYA 1F36A 2P7VB 1D1CA 3PL8A 3LWFA 3S93A 3BR2A 2BW3B 4LG0A 4RLFA 3TDUC 4FX0A 3G1LA 1IRFA 3CO6C 2NS8A 1BR1A 4O6JA 5EGOA 1D0YA 3LSGA 3SZTA 2CW0F 3K4NA 2ACJA 1HA8A 1J09A 2COBA 3P7NA 4I98B 4OAYA 1SC7A 3LSIA 2LG4A 3MMYB 3PSFA 4P9FA 1VQ9I 4ZDOA 3ERED 4K2EA 4PDKA 1GVDA 4IX7A 3B02A 1F4KA 1YX5A 2WTEA 3Q9VA 4OAZA 4LK1F 3VYSB 3D1NI 4MTEA 3AFHA 4ZDPA 2ZXJA 3BCAA 1U5TB 2XGDA 1ZRFA 2LF7A 3G73A 3S14J 3IHUA 4BGDA 3IAS2 3WODF 4DNCA 1R1TA 3JAMZ 1P7JA 3ONQA 2OCEA 3FKIJ 2ID6A 5H2FC 2I10A 5TISC 3CESA 4UUSA 2CU7A 1WI3A 2Y2ZA 3DV8A 1RR8C 4ON0A 3HYIA 2DT5A 3JAMK 3BPXA 2JRTA 2XKOA 1MDMA 5DYMA 5LHHA 2KHMA 2Q2EB 4IHVA 3EYIA 3GTOJ 2IS1A 1E0EA 4B8XA 2W82A 3P5JA 4G7HF 1MBHA 1F9NA 2GA1A 4F3QA 2KP6A 5BQTA 2PJRA 1NHAA 2D5VA 1X19A 3RZOJ 2HKOA 4NUBA 2WB1N 3OYAA 2GXBA 1IV6A 4UVBA 4BH9A 3TP0A 5K5RA 2VI6A 2HYGD 1OCRH 1HKTA 2P6SA 1GVJA 1OYIA 1WPKA 2W25A 3KP6A 4JX6A 1IN8A 1FYLA 1S7AA 2JMWA 4II2A 2RNGA 3AKZA 3GTQJ 5CLSA 1ULYA 4WX9A 2HPMA 2HZDA 2HXOA 4RB3C 1DU0A 2YUSA 2BE5F 4F91B 5JHFA 1N77A 2A6HF 5J8CA 4P96A 5BNGA 2E2IJ 3BR1A 3ZN0A 1WWXA 3GO5A 5DUKA 3TL4X 5D8KB 4RS8A 2HQ5A 2EPFA 2XGXA 1MBGA 1JJ6C 2DA1A 1ETKA 2OQRA 1RPWA 3LMMA 5ICEA 2VBZA 5EYRA 4C3JJ 2FBHA 3HIFA 2MGQA 5KCMA 4WXHA 2DOFA 5JFRA 5HDKA 2FX0A 3LSMA 1DUXC 3RKYA 1IRXA 4PCQA 2X6XA 1D1BA 4LLLA 4E7SA 2J5PA 1EH6A 2LKXA 1LB2A 3R4KA 1S6LA 3H9QA 5D5XB 1LFBA 3OYNA 4HBLA 2CQ7A 5J40A 3FISA 2QUFA 2ZXWH 2GWRA 2VJ4A 3ERMA 4U0YA 4ZZLA 2CQNA 3F8MA 4CDGA 5LHIA 3T5XA 1P6RA 3E7LA 1VQOI 5HOOA 1XC5A 3OIQA 3QU6A 3JRFA 5K7ZA 2EZHA 3HXLA 1OFCX 4XKBA 3QPHA 3NAUA 2DA6A 2BY1A 5K5OA 4OOIA 1X2NA 2GLOA 2BEOA 2RAEA 3BROA 4PJJA 4ZYDA 5HLTA 1W7PA 1MJ9A 2LH9A 1IXCA 2PN6A 2XPWA 5FJ8J 4XLEA 4D9JA 3LA7A 1VF9A 3DTEA 4ENJA 2HDWA 3IWZA 3CCLI 3MKYB 3HTSB 3QOEA 4M3FA 2M0MA 1S9HA 2ZNZA 1F5TA 3TO6A 1J5YA 2GZWA 2COMA 5D6EA 3V8KA 5FB2A 3BR0A 2DJIA 1U0JA 5IT9Z 5F27A 3U1KA 5EJCA 2Y48A 3FMQA 4KICA 3IP4B 4FETA 1IXSB 1T39A 1JGSA 4YFKF 4P1WA 1OJLA 2WAEA 1SMTA 4RMNA 5LEKA 1RC9A 2X6YA 5AONA 3WU1B 2FBKA 2W7NA 3TEDA 5IOZA 1O3RA 2VB6A 5TGTA 2LY9A 5CQEA 2Z99A 4PGGA 2R5YB 2LD5A 5IT9K 2ME0A 5BOXA 3H35A 3H3VK 4LK0F 2KJCA 3GTJJ 4D7NA 4IOCF 1XCBA 2DFFA 1P4WA 2CUEA 3MQ0A 3UNGC 3OV8A 5GAGJ 2KISA 3ISPA 2VQCA 4YFNF 4HX7A 1W36D 3M3YJ 3GFLA 4I0AA 3R6SA 1MJBA 2EA2A 4CZZA 3TP3A 3JRIA 1U2WA 3ZQHA 1CQTA 2Y9ZA 2STWA 3WHCA 2DODA 2P0WA 1NH3A 3DEEA 3FM3A 3UKGA 2WAFA 2IEKA 1OPCA 2JRMA 1RZ4A 3JCUC 1PUFB 2W1OA 2VL8A 1TWGJ 4UB8C 2RQQA 2EIKH 2LOOA 1A5JA 1NG6A 1ZGJA 1U8BA 1SFEA 2L2OA 3E6DA 3CTAA 3V42A 3Q3SA 3DKYA 4XSZF 1HOMA 4WXDA 3KZIC 2JZYA 1B59A 4G9YA 4BQAA 1YJ9I 3HOZJ 4MTDA 3CDLA 1XN7A 4ESFA 2F5VA 2Y0SA 2CRGA 2CGPA 4XRSG 2QCOA 1FP1D 4PGHA 1AKHA 1IRGA 2O3FA 2DCEA 3D5RC 3IH2A 4L9VA 2R7TA 3CMMA 4PJMA 1OYWA 1OKRA 3DTIA 3FXRA 4HPQA 3CMYA 4XL9A 2LRDA 2QVOA 4RGXA 5GAEJ 1YIJI 2PFBA 2P7CB 3IWFA 3I58A 1YRNB 3ZCOA 5F6FA 4E4HA 2AO9A 1IXRC 1Z0XA 3CJQB 2LF8A 1YIOA 1ZG1A 3PJRA 3W2VA 2V6CA 5C3EJ 2F2EA 3B73A 3GLLA 3T0YA 5KVRA 2XB0X 4D7MA 1R5HA 1WH5A 4WF2A 1YHQI 1VQ7I 4CH7A 1EV7A 2C6YA 1K79A 3AL0B 2G7HA 5EDNA 3QQAA 4XICA 3J81Z 1JUSA 4CCNA 2UZKA 3SZGA 4ZZDA 2IXSA 3EDPA 3IKVA 2XAQA 4FE4A 5HDNA 4E7HA 2P5KA 2RC4A 3OY9A 1ETYA 2BY3A 3F22A 3K1NA 2EFQA 3I0TA 1KQ0A 2L9RA 3ABMH 3G1OA 4RM2A 2F5DA 5DD4A 1V55H 3J81K 2Q0OA 4BY1J 1REPC 4FCYA 2M1BA 3K4KA 3TDZC 4NQWB 1FY7A 5FFXA 2VE8A 1J75A 3L2WA 2CV2A 4BHBA 3M1EA 4M6YA 1P4AA 2R92J 1OQYA 1O4XA 2A3SA 4XORA 3I9V2 2HTSA 2OV7A 4NC7A 4XRMA 2DMQA 2KZGA 3F8BA 4NC6A 5F08A 5FROA 2DYSH 1Y8QB 5ILUA 2DDAA 2STTA 5CKTA 1R71A 2DA4A 5DCMB 3ZMTA 2Z2SB 1IRZA 2V1NA 4Z2YA 2DFHA 3M1CA 1ODDA 1W36C 5HLHA 4HZFA 3TOBA 3GTKJ 5KK1A 3I54A 1ORKA 5H20A 4KT5C 2JSPA 3O8GA 1WRJA 3FHNA 3RCOA 1JHHA 2HOTA 2EH3A 2FOWA 2EFNA 5GP9A 3I3LA 1XD7A 1LVAA 3OOUA 2O8XA 4A0ZA 3IH3A 1LPQA 1QA6A 2XF7A 1A36A 1YFHA 3VYTB 5TJJA 1I6HJ 3U2RA 2NXNB 1O3TA 4DZPA 1XTAA 2JJ7A 4AVPA 3C18A 3KP5A 3J80Z 1J59A 1MBKA 5HLIA 2HR3A 3PNVA 5CVUA 1YOVB 4LG3A 1BC8C 2KIFA 2XSDC 5ICGA 4W1UA 1FTZA 3BY6A 2X51A 3J80K 5ERIA 2A61A 4RAGA 3ZPLA 1LDJA 3PFYA 4XOTA 5EEGA 4E70A 1IC8A 4XSXF 3VEPA 1XSVA 1ONVA 4Y15A 2NVXJ 2GXGA 1JT6A 1S7EA 1W5CC 5E1ZB 1R7JA 1TBXA 1O57A 1D0ZA 5ICCA 4DYCA 2ETHA 3CP8A 3FXLA 4ZYGA 1K61A 4Y33A 3S1QJ 2KRHA 2E1MB 2F5CA 4QPQA 1PVEA 2RVCA 4E6KG 3BZCA 2IPQX 2LC2A 4CCMA 2QWWA 3V4GA 3ZMZA 1I39A 1WSUA 2YSRA 4G6TB 3HSFA 2HDDA 1EJ9A 2R7QA 4OMZA 4UNOA 2H1LA 3Q9SA 2LVSA 2V4JC 3E6MA 1G4DA 3K2AA 2IAIA 4LFUA 5HODA 1XPXA 5AIQA 3F8FA 2D45A 3IRRA 2VQHA 3DKWA 3CLOA 3CF5F 2MA3A 1FC3A 3BTIA 4ZYHA 3JRGA 4M3DA 3VYRB 4KMFA 2JA5J 3MWMA 4FQGA 4LOCA 2D2WA 4BEHB 1HW1A 1T33A 1YE9A 4HNVA 2QQ8A 4B3XA 3HTUA 3FK7A 3OYIA 4BXXJ 2HEOA 3EPZA 2BBYA 3ZQFA 1OCCH 1YX3A 5C4XJ 3R0AA 1DPUA 4M3BA 4M9ZA 4M3GA 4RAYA 2W4SA 2F48A 4CCJA 2IP2A 3BJAA 2QSFX 2I8DA 1VZ0A 3ZMUA 4BQOA 2IA1A 5DS9A 2V26A 3K4JA 4EV0A 3K6GA 1VQNI 4LGWA 5HDGA 2XAJA 3WTTC 3DPUA 3A2KA 1OR7A 4A0YA 4GXOA 3FXKA 1XCVA 2FU4A 3WTYC 3BG5A 1MSEC 1P9QC 4FX4A 4B3AA 3GZ6A 1I50J 1U6GA 3OYMA 2N8GA 3DF8A 5J1UA 2AQEA 1GXPA 1UELB 3H0GJ 4DOZA 3N05A 2QSHX 5E79C 4DBQA 1R1VA 2HGCA 3P9CA 3WU0A 2HYJA 4DYQA 3F9KA 2K85A 2P5VA 3GTLJ 1LFPA 1TNSA 4A3JJ 4LMYA 4MIMA 2PBIA 3OS1A 2CQXA 2LFBA 5HS9A 1BC7C 2V79A 1R6RA 4YIFA 4I6ZA 2CS3A 1BA5A 1LEBA 2E60A 3G2BA 4EJWA 3A0HC 2K27A 2EFOA 4B48A 2WAQN 2L0KA 2DMNA 4F52A 4Q48A 1MMSA 3OR1C 1R00A 2VE9A 2GIZA 1BI2A 3ZMVA 4Y52J 4KT6A 1IN7A 1MNEA 5LLQA 2NNYA 4YFXF 1S8NA 1TWFJ 2JA8J 3ZQ7A 4AC0A 3HPHA 1WKMA 1T56A 1U5TC 2HQAA 4A5MA 1H9TA 3JW4A 2XAGA 2HS5A 3K69A 2FA5A 3CMEI 3V8LA 2B9SA 3B6CA 1OMIA 3VSKA 1X1AA 4C9YA 3M9AA 1BI1A 2BZTA 2AQFA 2LREA 1UHSA 4PZJA 3SJMA 4V19K 3M8FA 1POGA 1HQCA 1SAXA 1ETOA 2FNPA 5IYDJ 2YX7A 2QYOA 3E3VA 2CV0A 3SEQA 1VFCA 4EVIA 1W0TA 4XK4A 3BG6A 3HKZA 2ISYA 2VPRA 1J0RA 2HFHA 1SAUA 3WTWC 2GXAA 4MQVA 2KZVA 2XC7A 2JA2A 2ADUA 2H8WA 3DLLF 2X1DA 3EUHA 1FT9A 2CWEA 2L4MA 3CP2A 5LEJA 4A3MJ 4RGSA 2EA4A 3QWLA 2E2JJ 2FSWA 2KIUA 5DEQA 3ECHA 3K9TA 2E5ZA 3BG3A 5DCFA 4EQQA 1V4RA 4L9NA 2FOKA 1QHHD 2XAUA 2IJLA 1KA8A 4W97A 2L02A 1USSA 2MFZA 4AIKA 2V9PA 1YTYA 3HDDA 3W6KB 1B8IB 1A31A 2AS5F 4ESJA 2EIJH 5GPAA 3FMRA 1PYVA 3L7WA 2QEXI 1Y0NA 3L2CA 4NHJA 2OC6A 5J4YA 3GUDA 2MD0A 1APLC 5ILVA 3O3KA 1N78A 4AYBN 4HSTA 1X1BA 4LIVA 3BPVA 3F6VA 2KQRA 1YJNI 2O61A 1QPIA 4XKVA 2K86A 2OAZA 2Y31A 2DDBA 4HNTA 3KEYA 2OTJI 3ZRGA 2LTPA 4PJNA 3LA2A 5H6RA 4AU7A 3O6BB 1P2FA 5B1AH 2JUCA 1X1DA 2W00A 3RDIA 1D5VA 3GTMJ 4DZJA 2DK5A 1LKXA 4OU0A 2HVRA 3HRSA 2IS4A 1FEXA 1JGGA 2EFPA 4IZZA 2LKSA 2AXLA 1G8XA 3RYPA 1ZGWA 3CUQB 2VASA 4C30A 4PJ0C 1BR2A 1KYZA 2X0LA 4HX8A 4CSWA 2KRFA 1G3SA 3TGNA 3BR3A 4D5CA 3KEOA 2DXIA 2BHZA 3SDGA 4HAMA 3S1MJ 3K1MA 4O5VA 4RBOA 2F4IA 1RKTA 3A01A 4X0GA 3BQYA 2QM3A 1YW9A 3C1DA 1LQ1A 2CSOA 4N9IA 2FMYA 1MZBA 2PMUA 1I27A 1ZHFA 3QP6A 3VODA 4IKFA 3MEXA 4M6VA 1Q1VA 3RSNA 4BBSJ 1MMDA 2B63J 3LFKA 1I5ZA 2NVYJ 4R79A 2XAFA 2KIQA 4A93J 1FNNA 5LHGA 3RPUD 4LLGF 2HNHA 2Z16A 4XRSA 3NRVA 1D5YA 4ZTJA 2DU9A 1K7AA 1QZZA 3DP7A 2XROA 1Y39A 3PUFA 4P9UA 5FLXZ 4HRIA 1LFUP 4XLFA 3Q0WA 1MH3A 3ULQB 1RNLA 5GPCA 4B43A 2BYVE 5KNLA 2KDOA 1FX7A 2ESHA 2LBFA 3Q0VA 1B72B 2QBYB 5FLXK 5DD8A 3JSPA 4H4KC 3E97A 2K4BA 2PLYA 1ZG3A 4MEXF 3V7CA 2L01A 2ZMEB 3H3ZA 5LD2C 4L9JA 2E36A 3V7RA 4G6DA 2WWYA 3MKLA 1PP8F 3MVPA 4HF2A 3CCMI 1RUOA 1VQ4I 4U0WA 3MN2A 2VT2A 1DPRA 3LOCA 3M7GA 4P55A 4XRFA 4FT8A 1XSXA 2E19A 4II3A 5IP7J 1MMGA 2ZSIB 4GDFA 2YX4A 4IXAA 1FP2A 1HKSA 1WJCA 2VKHA 4M72A 2LYCA 2PX9A 3GTPJ 3PIPF 4LITA 3WHBA 5IY5H 2DOEA 5HLGA 1ZAOA 1L3LA 3HB9A 1JKQC 5EEHA 4B4CA 2HOAA 4HEA2 5E3LA 3S2DJ 2MBFA 3HUGB 1JTYA 4HQMA 3L2VA 3PQJA 3PO3J 2HPIA 5A2QZ 2OF7A 3M8EA 1PP7U 2FEZA 1UCRA 3GVAA 3MFKA 4RGRA 3H3UA 1WJBA 1FMVA 3EETA 1TZLA 1S29A 2LP0A 5TRDA 5B3SH 1IDYA 1XG1A 1G3WA 1X4PA 1RKWA 1WI9A 3KE2A 1FPQA 4CCOA 5A2QK 2O9LA 3W6VA 1BN5A 4D1QA 2W57A 4L9TA 4ZYEA 3OYKA 3OYLA 3LSPA 2L54A 1IN5A 2F5FA 1SVMA 1JXSA 2MYSA 2M30A 1GV5A 3W3CA 3E5UA 3CDHA 3A1YA 2HOEA 3J7AO 2RDPA 1HBXG 3CJTB 4BJ6C 4YEJA 1D8KA 2R5ZA 3AL0C 3K0LA 4I76A 5DTDA 2LY2A 1IG7A 1WJFA 1VI0A 5E3MA 3CF2A 2DMUA 5E8GA 4J19A 3OYBA 3FZVA 4LG0B 2X4HA 3LNQA 1GV2A 4BJTA 5EGOB 1QVTA 2XUBA 5HNHA 1UB9A 4ZJZA 5EG0A 2D1HA 1IN6A 5IT3A 4KJZA 4EMSA 3LAJA 5FRMA 5LGNA 3ABKH 4UVCA 1U3EM 2K3PA 3N4MA 4IRIA 1QZEA 4ZDLA 3GFIA 1JJ8C 1TL8A 1MSFC 5CVRA 2DBBA 4A0XA 5BPIA 4KIBA 1WJ5A 4XLPF 1FOXA 3HG9A 1NTCA 1MIJA 2EK5A 2K5CA 1DP3A 1HDPA 4I01A 1ZKGA 3ZQLA 3JR9A 1YI2I 4FASD 1RRJA 5HVQC 5LRSA 1H88C 4G7OF 5B1BH 2K40A 2NRAC 4C3HJ 2R4GA 3ECOA 1YW8A 2DTRA 4F7ZA 2FE3A 5E3NA 1WJDA 3NWTA 4KITB 5M5WJ 4UUSB 2X1CA 4RAZA 4HLYA 1UHMA 2CMPA 2M4GA 2M7AA 1LDKB 2FF4A 3BWGA 2L3DA 1IW7F 1IV8A 3I5UA 1MDMB 2HYFA 4FISA 2ZJQF 3KLNA 1G2HA 3REOA 4XKCA 2WY7Q 2PJRB 3F23A 1VQPI 2BXYA 2ZSHB 2CG4A 2VONA 4HW0A 1TWCJ 3I4NJ 2R3SA 2L7MP 2RGVA 5FKNA 1FBQA 2EFWA 2NNNA 2ZFUA 3Q5FA 4AM3A 5FKOA 1O7FA 3OSGA 2IW5A 2XPVA 1PDNC 3A02A 1XMXA 1BOBA 1NK2P 5GAHJ 1XDSA 5GTIC 1FZPB 4IEJA 3KZYA 2ECCA 1T6SA 1VQ6I 4Y4RA 3HZJA 3DPTA 1QGPA 1UG2A 1TT0A 3VDXA 4ANJA 4YG2F 3D5LA 1W4MA 2FQ3A 1U8RA 2BOLA 4BDYA 1TWAJ 2R7OA 1ZR4A 1WFXA 2XKPA 1BW6A 4XQFA 2H6CA 2HOSA 1R9TJ 2VN2A 4BJ5C 3L9FA 4OMYA 1Z7LA 4G12A 3DFGA 2Y75A 3CMAI 4M71A 3KZZA 3F6OA 1TC3C 1IN4A 2E34A 2KLOA 3KLOA 3FIWA 1TT5B 5D4RA 2OA4A 3FMSA 2W48A 2P4WA 1H0MA 1FSHA 1E3PA 2JTVA 1RESA 1CF7A 5IPAA 4HQEA 1LE8A 4A3GJ 3ASNH 2WA0A 5B5EC 5M5XJ 3DXJF 4MEYF 3FXUA 3WGHA 1VQLI 1ZR2A 1XS9A 1HCRA 1E3HA 2HI3A 3BJ6A 2GAUA 2DJNA 5FD6A 4HV6A 1ETWA 2EINH 3HC7A 2PMZA 2K02A 4XKWA 3IKTA 2ZNYA 2Y30A 1HF0A 2M87A 1BI3A 3WTXC 1MGTA 4CYCA 2RNJA 2DW4A 5L3BA 2Q1ZB 3ZOBA 4BE1A 2IGMA 1W7PB 3RZDJ 1JE8A 3BR5A 3E1SA 3KPHA 3PM1A 3LSRA 1Z9CA 2R7SA 2OCCH 1X4OA 4XOPA 2VLAA 5E20A 3I59A 2ZC2A 1V5EA 3CLQA 5B66C 4WWCA 1N25A 2CW8A 2EZIA 4E7ZA 3VSLA 4RDUA 2JWTA 3CCUI 2VXZA 2X9DA 3K4BA 4BQNA 4IHWA 4Q47A 2OZ6A 4ZH4F 3GTGJ 1I3AA 4XLHA 1E2XA 2UWMA 1WJEA 1MJAA 2KL4A 4JBAA 1IUFA 1ETXA 4CA0A 1DGWY 1BJZA 2DMTA 4PFOA 1T08B 1GT0C 3BR6A 2D1VA 2W85A 2EZLA 2R7DA 3JRDA 2VIXA 1Z1DA 5ILSA 1D3YA 3OOPA 4XLAA 1EKEA 2CQKA 2IS2A 2Y0SN 3H5RA 3JRCA 5J1YA 2IGNA 3PO2J 1VQMI 2Y9YA 4X1EA 3PFIA 2EV0A 4Q5SF 3QPSA 1ZTRA 2HXIA 3FKJA 1U9NA 5DDGA 3FXMA 2UXNA 2PJPA 5FKMA 5K7HA 1UJ8A 3C2BA 5E17F 4M3EA 5FLVA 5EZHA 3EQLF 4P5OA 4Q4ZF 3BZKA 3I71A 1J2XA 4CUGA 1S72I 2EILH 1ZGAA 2R7FA 1HW2A 3KYLA 2WY8Q 3OYGA 2E7WA 2V7FA 2LLKA 2O7OA 3UR3C 5LGUA 3OYJA 1W0UA 1ACIA 4DJAA 4O3MA 2HWVA 2E71A 3DBHB 2X6WA 4DIQA 2XV4S 3BC8A 3Q0UA 1KYWA 1F1ZA 2DLLA 2V1UA 2KMUA 5D8LB 3NEUA 1O3QA 2XIGA 1IAWA 3RKXA 2ZBKA 2OJED 3IV5A 1BIBA 4OIOF 1AU7A 3JRHA 3DWLE 3TO7A 2OD5A 3VWBA 1UMQA 2Z5UA 1T2KA 3T8TA 1AKHB 1ZN2A 4XN0A 2PMZN 4RAFA 1RI7A 3BLYA 1IO2A 1OCTC 1ZRCA 1YYVA 4CCKA 5J8FA 3WTSC 2BVMA 2VKEA 3KYDB 4GYIA 2YR2A 2GBYA 1AA7A 4BNCA 4F92B 3MZYA 5CPRB 4BS9A 4A3LJ 1DU6A 3I55I 4FTHA 4A3DJ 1P7IA 3HRUA 2PI0A 2M0CA 2G0EA 1FTTA 4XR6A 4HOBA 5F1JA 1K78B 2ID3A 2P6TA 3JREA 2FJ1A 1ENHA 3I53A 2X48A 5D6FA 1T0FC 3P9IA 4ENNA 4I0BA 3F21A 3BG7A 3IC7A 1R22A 1UAAA 3OYFA 4IPAA 1Z91A 3BZ6A 4JQFA 1Y1VJ 4D0PA 1IDZA 4E7JA 2VOOA 2B7EA 2J5OA 1T38A 4B1RA 4GRIA 3DEWA 4IF4A 4GCVA 1ZYRF 5D4SA 1LNWA 5DUIA 2YU3A 2DO7A 5GADJ 1T98A 2L4AA 3GXOA 3GZNB 2VBXA 2MH2A 2E1OA 1XSDA 1I3QJ 3HOSA 2K9MA 2P5LC 2CYYA 1EA3A 4IRHA 1MW7A 4IRGA 3U1DA 4BHPA 1FBUA 3ZN1A 2LSOA 2PQ8A 4RB0A 2UUZA 1Y6IA 3A0BC 4BXFA 2ZFWA 2BV6A 2GA2A 6PAXA 2XF5A 1MNDA 1O3SA 3C3WA 5L3GA 2BW3A 1MMAA 3E6BA 3G6EI 1SFXA 2R7RA 2G9WA 2XPUA 2OQGA 1BIAA 4AIHA 4S05A 4IHTA 3J7YJ 3JTGA 2M8EA 1B9NA 4JYKA 2K9QA 2DQLA 5KAIC 4KNYA 3M4OJ 4UUVA 4Z6YA 3RKQA 1XGSA 2CJJA 4XONA 4PK4A 3CCSI 1E3OC 2XVCA 3CCVI 1SVOA 2G7UA 5FFZA 3B6AA 1PUEE 1WGXA 1U5TA 3DKXA 2NYXA 1S3JA 3LQRA 2FD5A 2GOXB 1GXQA 1U9OA 4RLQA 5ICFA 4V2GA 2XHKA 3CD6I 1GHCA 5ED4A 1NK3P 2KIMA 2GQQA 3NWSA 4MQ9F 2ZJRF 4B09A 3NQOA 3P9KA 2XGEA 2GIVA 2OPTA 2CV1A 3ABUA 3LAPA 3R0JA 2FMLA 3GMEA 4G6QA 3S1RJ 4QWQA 1E17A 5FKLA 2Q2EA 2FNAA 3HGGA 3KIOA 1V3FA 3G1MA 1ZREA 1Q1HA 5JVGF 3RJPA 2M8GX 2QSGX 2NS7A 3TKYA 5FLMJ 4E7LA 1IGNA 2JA6J 4LD5A 2I5UA 5IP6A 4BL0B 1OYYA 1AOYA 1JHFA 2XGCA 1OISA 2M45A 2MC4A 3LSKA 4HF1A 4KFCA 4BBRJ 1DGRM 3IL2A 1XMAA 3FWEA 3S1NJ 2P81A 4F55A 1AWCA 3L2QA 2X1EA 1RR7A 1AHDP 3HEFA 2HQNA 4YRVA 4XLNF 1X1PA 4A69C 5BPDA 4LB5A 2JA7J 2JSCA 3MKWB 1G3TA 1JT0A 4OWRB 1CGPA 2Z3YA 1GDTA 2GM4A 4MFEA 1ITYA 4BACA 4A5NA 4J00A 4OINF 3JTHA 4WXCA 2BVLA 2DT7B 4CGZA 3I64A 1K4TA 3QYBA 4F93B 2FQ4A 5JHUA 3RQIA 3KFWX 4PUSA 4ZTFA 3CCJI 2OZUA 3GZ5A 3ZGKA 1HXDA 3BCBA 3CCQI 4KISA 1Y8RB 3E5XA 1M1EB 3HSEA 3TQNA 3OYEA 1TWHJ 2WB1A 3MZHA 2VJJA 3JRBA 1TW3A 1SMYF 4L5EA 1LDDA 2ELHA 2NOJB 3G71I 5GTHC 2A5YB 1LEAA 1JUMA 2R7ZJ 5C4JJ 4EEFG 2M2EA 3JSOA 3GBGA 2EV5A 3RTRA 3U9GA 3HL2A 4LIUA 5M3FJ 1ON1A 1WQ2A 4IL6C 2ESNA 4C2TA 4HF0A 3K2ZA 1TTYA 3MZ8A 4A3CJ 1Y56A 1SD4A 1MBJA 4IQJA 1P4XA 4NB5A 9ANTA 5J1RA 1N75A 4GGGA 3H9JA 1Z05A 3PSIA 2H1KA 2DFEA 5BMZA 2A6EF 2IT0A 2XASA 1RIOH 3LSJA 5M3MJ 1ZRDA 3TBIA 4XIDA 3WTVC 4ETSA 2IA0A 1YG2A 3LA3A 3HGYA 4E7KA 4G94A 2ZO4A 4XBFA 3H5NA 3WE2A 4A3FJ 3FBIB 1R4MB 1QZYA 1HW5A 5EZGA 2ZB9A 5IP9J 4A3IJ 1D1AA 1DDNA 2QQBA 3E6CC 4QTRA 1VQKI 3CJRB 1QHGA 4A6EA 4EJVA 3CQZJ 2VT3A 1YLFA 2F6CA 2M4KA 4DW6A 3HKZN 3ESWB 3HOYJ 4C3IJ 3K4MA 2V1XA 3CC2I 1I6XA 3H9GA 4BAYA 2RN7A 4M9SA 3HSRA 2E1NA 2UV1A 1F43A 3GCMA 1WCMJ 2V6EA 2RQPA 2R5YA 5CVJA 3KP7A 4UXNA 3RYRA 1W7PD 4DGWB 4A6DA 2OBPA 2BGCA 3PUBA 1FSEA 4IJAA 4WCGA 3ZR8X 4KDPA 3SFIA 1YS7A 3OL3A 3ABLH 3OS0A 2ZXHA 4BDZA 3AG4H 3DEUA 1YITI 2M7BA 3L1PA 4L0ZB 1LVKA 5JVTA 3H1CA 1HKQA 3SYTA 5E1WA 1MD0A 2ZXIA 5D5WB 1Z77A 4X6AJ 3BTLA 3DU6A 2PMHA 1PUFA 4I2OA 5F64A 3K7AJ 5HS7A 4BYYA 3GW2A 1FJLA 1MMNA 1TQIA 4A3BJ 3KCCA 1X58A 5C44J 4HA8A 3ABTA 1R5GA 1KGSA 2K3FA 2L9VA 3SZPA 2ZKZA 1DP7P 2JUGA 2PG4A 3M8JA 3DBLB 2XRNA 2Z9OA 1JTXA 4LJZF 1BI0A 2HU9A 3DCFA 4G8XA 1TW2A 3K1PA 3IRQA 3E5QA 2RV8A 4N9HA 3CJNA 1K83J 2MLGA 1XGOA 4ENKA 1IJWC 3ZQIA 3SXYA 3S3MA 2QZ8A 2JVHA 1YRNA 1FIPA 1R36A 2CUZA 4MO7A 5E1XA 1FYKA 2BHYA 3HPGA 3VYUB 1R4NB 2A6TA 3L00A 1EH8A 3X2QH 3OS2A 3SQNA 2R7WA 4IHYA 2A69F 3GWZA 1FOWA 2DN0A 1IF1A 4KA4A 5F1RA 4UUTA 1ZLJA 2NS0A 1KU7A 2OUMA 1B4AA 2E7XA 1I1SA 3CDIA 3F72A 1B1BA 5K5QA 2XB5A 3I4PA 1C0WA 4JX5A 2VBWA 1ZK8A 3H92A 4QLCU 2JQ7A 1H9GA 5M5YJ 1ETQA 1MH4A 2RREA 4N0BA 3QODA 4DBRA 5EEAA 2L9NA 4S04A 4JOMA 3NARA 3M07A 3OYCA 2EJRA 4DQ2A 2NOGA 2EQRA 2LDUA 3QPTA 3CZ6A 4ZYAA 5IYCJ 3RPUA 3QPLA 4AWXB 4C2MJ 2L7KA 1ZG5A 3GF2A 2KT0A 4NQWA 1Z3XA 3BG9A 4M74A 2H09A 1Z3YA 3AG3H 4U0VA 3I56I 2DA7A 3MCZA 2O0YA 3H0DA 4A2UA 1W5TA 2ZJ2A 4HNUA 1A6IA 5JLXA 4Y17A 4CHUA 3FK6A 2KJBA 3A01B 2VC1A 1STZA 3JRAA 3FHZA 1FMWA 2BXZA 2Z1DA 5DCMA 3KYCB 3ROUA 1EF4A 1VQ8I 2QF7A 3OIOA 1ZARA 2QQ9A 3T8RA 4E7IA 1LJ9A 1TP4A 3TMOA 1XX5A 1HSTA 4J01A 2ELKA 2O03A 2VKVA 1Z6TA 4KN4X 4AVZA 3C7JA 3CCRI 3TW6A 3IUOA 5J4VA 4KYWA 3MAJA 2ZJPF 1FOKA 1Z7UA 4IO9F 4RA2A 3TOAA 3A4CA 1HLVA 4JX4A 1R23A 2WV1A 3WTZA 1MBEA 3BDDA 4NBQA 2R7VA 2VBYA 3RPQA 3FM5A 4U87A 3RIRA 4XM3A 4D5FA 3K10A 1VTNC 1KQ8A 3HHGA 2TCTA 2BY0A 4ZC3A 3F8CA 2LBFB 2E2HJ 2WBMA 2A07F 3L2UA 2P8TA 2VC0A 5FRNA 2HVSA 1ZQ3P 2CQQA 5F04A 3DPLC 3HJEA 4NNJA 3ZP5A 1JKRC 3N97A 3D0SA 2XRLA 2EWNA 1UHWA 4R1HA 2HQRA 1HSJA 4M73A 5DM6F 1A35A 3ZQGA 5L3DA 1QBJA 1X3WB 2E1CA 3R61A 3HOUJ 3S2WA 4C2UA 5E18F 4HX4A 2O5RA 4B47A 3AAFA 2WADA 4MHGA 2MD5A 4MLOA 4RM3A 2E5NA 2XSJC 4PSXA 2DFIA 1D0XA 4BY7J 3GFJA 4GYGA 5HNFA 1YJWI 2W24A 1FBSA 2Q8KA 4EM1A 3W2AA 2DQRA 4U88A 3FX3A 3OIPA 2E1MC 3VFZA 1NG7A 4UB6C 4Y13A 5FGMA 2L9SA 3SDBA 3WGIA 2FBIA 1FIAA 1WH7A 4KIGA 2F4OB 4XN3A 1KU3A 3FXJA 4KN7X 4HYEA 3VPRA 4EM0B 4CYDA 2R7XA 3GYHX 1O7LA 1K78A 4UY8I 1Z6RA 2AHQA 2OTLI 5CYVA 1UFMA 4HG2A 4BEHA 3CC4I 3O2PE 3W2WA 2HTJA 4BQQA 2WC2A 4R8HA 1OCZH 1J9IA 2MSYA 2IGKA 3GFMA 2IS6A 1KZHA 1V54H 4AUXA 5J47A 2IBDA 4LB6B 1A6QA 4EGYA 2ISZA 2HVQA 4IVNA 2QENA 1UZCA 5FD5A 1SEUA 2H27A 3MKZA 2VXDA 2DYRH 3F3XA 4UHTA 3QRFF 3J7ZI 2AXTC 3WG7H 2VPLA 1HC8A 1S5LC 1ERDA 2FUG2 2R5ZB 1BJAA 2DK8A 4IOAF 4EM2A 1OCOH 1WZ2A 3HM5A 3WG9A 4ITVA 3ELKA 3WGGA 1B9MA 3VB2A 3WU2C 4I02A 4EJUA 5EG0B 2FXAA 4JK1X 5JI6A 2A5WA 1SD7A 3ML6A 2LNBA 2K9NA 3GEZA 3KEQA 3FXQA 5CVVA 4BKXA 3V7SA 4AIJA 1LUJB 3T1BA 2ELJA 1TNTA 1T95A 2IVMA 3ZQQA 3C2GA 2DAOA 1G3YA 2VJ5A 2WV0A 2K4JA 2TDXA 4JP0A 4IHSA 2KPMA 4BU2A 2DT6A 5L3FA 1SD5A 2FRHA 2DMPA 1R58A 1B6AA 4LLNA 1W1WE 3G3ZA 4A12A 2CH0A 2LY1A 3LSHA 4BE2A 1PJRA 3HRTA 4EATA 3TW7A 4AD9A 2VOPA 4V2FA 2M3AA 3ZQCA 3QYFA 1XB4A 2XDVA 5K7FA 1ZLKA 2O6GE 3BTJA
chains in the Genus database with same CATH topology
3GTJJ 4D7NA 1NK3P 3HOVJ 4XRSA 2CUEA 1D5YA 2XGEA 2OPTA 4A3KJ 3S1RJ 3M3YJ 2VUMJ 2DTZA 5FKLA 1LFUP 1H8AC 3TP3A 3JRIA 3ZQHA 1CQTA 3HGGA 3S15J 5F0FA 2Y9ZA 3Q0WA 3WHCA 1MH3A 5J3LA 3G1MA 3UKGA 5GPCA 2ME6A 3Q0VA 2IEKA 1B72B 3S2HJ 2M8GX 2NS7A 1PUFB 3O8HA 5FLMJ 1IGNA 2JA6J 1TWGJ 5IP6A 1A5JA 1U8BA 2XGCA 3MKLA 3MVPA 4BBRJ 1Y1WJ 3Q3SA 3S1NJ 2P81A 4S0HB 1HOMA 3MN2A 3LOCA 3HOZJ 2E19A 3CDLA 1RR7A 5IP7J 2R93J 2CRGA 1AHDP 3HEFA 2QCOA 4XRSG 1AKHA 3I4MJ 4A69C 3IH2A 2JA7J 2JN6A 1OCPA 3CMYA 3GTPJ 1JT0A 1BL0A 1GDTA 2GM4A 3WHBA 4MFEA 1ITYA 3HB9A 4MFDA 2KDZA 1JKQC 1RETA 2MW8A 1YRNB 4B4CA 2HOAA 5E3LA 3S2DJ 1JTYA 2AO9A 2FQ4A 2NVQJ 3PO3J 1Z0XA 3RQIA 2OF7A 3CCYA 5C3EJ 2YU9J 1B8IA 1TWHJ 5F0HA 1LE8B 3JRBA 2LP0A 2XB0X 1QRYA 4D7MA 1IDYA 1XG1A 4A3EJ 3A03A 2LK2A 4L5EA 4QSHA 1WH5A 1RKWA 4Y7NJ 3HBLA 2O9LA 4QIWN 3W6VA 5EDNA 3QQAA 4XICA 2R7ZJ 1JUMA 1JUSA 5C4JJ 4EEFG 2CUFA 4IHXA 2M2EA 3LSPA 3GBGA 5M3FJ 4FE4A 1ETYA 3F0CA 2L9RA 1U78A 3G1OA 4A3CJ 1GV5A 4CYCB 3HOXJ 9ANTA 1MBJA 2R0QC 2NVTJ 5F0CA 5FKKA 5J1RA 2M9HA 2TRTA 2R5ZA 4I76A 4BY1J 4FCYA 2H1KA 5DTDA 1IG7A 1HDDC 1VI0A 5E3MA 2DMUA 2YS9A 3LSJA 5M3MJ 4J19A 4XIDA 1ETVA 3LNQA 1GV2A 2R92J 1O4XA 2X6OA 5EGOB 2L7ZA 1QVTA 5EG0A 1JUPA 2ECBA 3BQZA 3HGYA 2EZKA 4A3FJ 4XRMA 2DMQA 5EZGA 1QVUA 5F08A 2ZB9A 5IP9J 1JJ8C 4A3IJ 1MSFC 4QTRA 2DA4A 3CQZJ 1IRZA 2O8KA 4DW6A 3HKZN 3GTKJ 3HOYJ 1NTCA 4C3IJ 1ORKA 1HDPA 5E3OA 1ZKGA 3O8GA 3ZQLA 2HOTA 3JR9A 2EH3A 5GP9A 2DA3A 1F43A 1WCMJ 3OOUA 3IH3A 1H88C 2K40A 2R5YA 1SFOJ 1H89C 4C3HJ 5M5WJ 1I6HJ 5E3NA 4UUSB 4DZPA 2JJ7A 1BW5A 2M34A 3SFIA 1MBKA 5JLWA 4FISA 1G2HA 2XSDC 3L1PA 4W1UA 1FTZA 2DA2A 1TWCJ 3I4NJ 2L7MP 2DA5A 5FKNA 1IC8A 1B72A 1Z77A 4X6AJ 3BTLA 2JK3A 2NVXJ 1PUFA 5FKOA 1JT6A 1S7EA 1GUUA 2LR8A 3OSGA 3K7AJ 1JKPC 2XPVA 1X2MA 3A02A 1FJLA 1NK2P 5IYBJ 4A3BJ 4IEJA 4DYCA 4NDLA 1X58A 5C44J 2ECCA 3BTCA 1MNMC 1UG2A 1K61A 3S1QJ 1TWAJ 1JTXA 1JKOC 3BT9A 3DCFA 1ZR4A 2HDDA 1BW6A 1K83J 2EBIA 2LVSA 2HOSA 1R9TJ 1IJWC 3ZQIA 3K2AA 1SANA 2IAIA 5HODA 4G12A 3HOWJ 1YRNA 1FIPA 1TC3C 1MBFA 2L7FP 4MO7A 2H8RA 3FIWA 3BTIA 3JRGA 4M3DA 2W48A 3S17J 2JA5J 4IHYA 4LOCA 1RESA 5IPAA 2DN0A 3IH4A 1LE8A 4A3GJ 1T33A 4UUTA 5M5XJ 4HNVA 3FK7A 4BXXJ 2K9SA 1ZR2A 1XS9A 1HCRA 3ZQFA 5C4XJ 2MG4A 2XB5A 4GFBA 4JX5A 4M3BA 1ZK8A 4M3GA 2HI3A 2DJNA 4DYRA 4FE7A 4ABZA 1ETWA 3S16J 5M5YJ 1ETQA 1MH4A 2Y30A 5EEAA 1HF0A 1VNDA 3NARA 4CYCA 5EF6A 5DS9A 3OSFA 2NOGA 2EQRA 3ZOBA 5IYCJ 3RZDJ 5IOYA 1F36A 3BR5A 3PM1A 3QPLA 4C2MJ 3LSRA 3BR2A 3BG5A 2KT0A 1MSEC 3BG9A 3G1LA 2NS8A 4B3AA 5EGOA 1I50J 2EZIA 3LSGA 4RDUA 2DA7A 2JWTA 2X9DA 2N8GA 5J1UA 4IHWA 2COBA 3GTGJ 1A6IA 3H0GJ 5JLXA 3FK6A 3A01B 3JRAA 1IUFA 1GVDA 1ETXA 2HYJA 4DYQA 1BJZA 2DMTA 3GTLJ 1EF4A 1GT0C 2QF7A 4A3JJ 3BR6A 3OIOA 4MIMA 3D1NI 2EZLA 2CQXA 2LFBA 3JRDA 2XGDA 1BA5A 4I6ZA 2ELKA 3S14J 2VKVA 2Y0SN 3JRCA 2WAQN 5J1YA 3PO2J 1P7JA 2L0KA 2DMNA 2Y9YA 3TW6A 3FKIJ 2ID6A 4X1EA 2I10A 3QPSA 1ZTRA 2HXIA 1U9NA 4Y52J 4UUSA 1TWFJ 1HLVA 5FKMA 5K7HA 2JA8J 4JX4A 2WV1A 2CU7A 3C2BA 1MBEA 1WI3A 2Y2ZA 4AC0A 4M3EA 5FLVA 1T56A 5EZHA 4IHVA 4D5FA 3GTOJ 1MBHA 3B6CA 3RZOJ 2D5VA 2TCTA 2WB1N 1IV6A 2LLKA 3TP0A 2E2HJ 1UHSA 3SJMA 1POGA 2O7OA 1ETOA 1W0UA 5IYDJ 2VI6A 1ZQ3P 2CQQA 5F04A 1JKRC 3Q0UA 1WPKA 2XRLA 1VFCA 4JX6A 1W0TA 2JMWA 4XK4A 3GTQJ 2VPRA 3ZQGA 3IV5A 2HXOA 1DU0A 2YUSA 1AU7A 3JRHA 3HOUJ 1UMQA 5BNGA 2E2IJ 3BR1A 1AKHB 2PMZN 1OCTC 4A3MJ 2HQ5A 4MLOA 1MBGA 2E2JJ 1JJ6C 2VKEA 2DA1A 1ETKA 4BY7J 1RPWA 2GBYA 3BG3A 1DU6A 4A3LJ 4FTHA 4A3DJ 5EYRA 4C3JJ 1P7IA 2MGQA 2M0CA 2G0EA 1FTTA 4W97A 5F1JA 1FIAA 2FX0A 2ID3A 1WH7A 3JREA 2FJ1A 1ENHA 3HDDA 2X48A 1B8IB 3VPRA 5GPAA 2LKXA 2AHQA 1LFBA 1APLC 1Y1VJ 4AYBN 3FISA 1IDZA 2MSYA 4B1RA 3DEWA 4AUXA 2IBDA 1QPIA 2Y31A 3E7LA 1XC5A 2LTPA 3JRFA 5K7ZA 2EZHA 2E1OA 1I3QJ 1OFCX 3NAUA 2DA6A 2R5ZB 1X2NA 2GLOA 2RAEA 3GTMJ 4DZJA 2XPWA 3HM5A 5FJ8J 1FEXA 1JGGA 1VF9A 1ZGWA 5EG0B 2XPUA 2K9NA 4M3FA 4BKXA 3BR3A 4D5CA 3SDGA 3S1MJ 4JYKA 3BR0A 4RBOA 1RKTA 3A01A 2K9QA 3BQYA 4JP0A 5F27A 3M4OJ 3RKQA 2CJJA 2DMPA 1E3OC 1OJLA 3B6AA 4M6VA 1Q1VA 3TEDA 5IOZA 4BBSJ 1WGXA 3TW7A 2B63J 2LY9A 2NVYJ 4V2FA 2R5YB 2LD5A 2ME0A 2FD5A 3ZQCA 1U9OA 4A93J 5K7FA 3H3VK 4V2GA 3BTJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ J;  4D7N A;  1NK3 P;  3HOV J;  4XRS A;  2CUE A;  1D5Y A;  2XGE A;  2OPT A;  4A3K J;  3S1R J;  3M3Y J;  2VUM J;  2DTZ A;  5FKL A;  1LFU P;  1H8A C;  3TP3 A;  3JRI A;  3ZQH A;  1CQT A;  3HGG A;  3S15 J;  5F0F A;  2Y9Z A;  3Q0W A;  3WHC A;  1MH3 A;  5J3L A;  3G1M A;  3UKG A;  5GPC A;  2ME6 A;  3Q0V A;  2IEK A;  1B72 B;  3S2H J;  2M8G X;  2NS7 A;  1PUF B;  3O8H A;  5FLM J;  1IGN A;  2JA6 J;  1TWG J;  5IP6 A;  1A5J A;  1U8B A;  2XGC A;  3MKL A;  3MVP A;  4BBR J;  1Y1W J;  3Q3S A;  3S1N J;  2P81 A;  4S0H B;  1HOM A;  3MN2 A;  3LOC A;  3HOZ J;  2E19 A;  3CDL A;  1RR7 A;  5IP7 J;  2R93 J;  2CRG A;  1AHD P;  3HEF A;  2QCO A;  4XRS G;  1AKH A;  3I4M J;  4A69 C;  3IH2 A;  2JA7 J;  2JN6 A;  1OCP A;  3CMY A;  3GTP J;  1JT0 A;  1BL0 A;  1GDT A;  2GM4 A;  3WHB A;  4MFE A;  1ITY A;  3HB9 A;  4MFD A;  2KDZ A;  1JKQ C;  1RET A;  2MW8 A;  1YRN B;  4B4C A;  2HOA A;  5E3L A;  3S2D J;  1JTY A;  2AO9 A;  2FQ4 A;  2NVQ J;  3PO3 J;  1Z0X A;  3RQI A;  2OF7 A;  3CCY A;  5C3E J;  2YU9 J;  1B8I A;  1TWH J;  5F0H A;  1LE8 B;  3JRB A;  2LP0 A;  2XB0 X;  1QRY A;  4D7M A;  1IDY A;  1XG1 A;  4A3E J;  3A03 A;  2LK2 A;  4L5E A;  4QSH A;  1WH5 A;  1RKW A;  4Y7N J;  3HBL A;  2O9L A;  4QIW N;  3W6V A;  5EDN A;  3QQA A;  4XIC A;  2R7Z J;  1JUM A;  1JUS A;  5C4J J;  4EEF G;  2CUF A;  4IHX A;  2M2E A;  3LSP A;  3GBG A;  5M3F J;  4FE4 A;  1ETY A;  3F0C A;  2L9R A;  1U78 A;  3G1O A;  4A3C J;  1GV5 A;  4CYC B;  3HOX J;  9ANT A;  1MBJ A;  2R0Q C;  2NVT J;  5F0C A;  5FKK A;  5J1R A;  2M9H A;  2TRT A;  2R5Z A;  4I76 A;  4BY1 J;  4FCY A;  2H1K A;  5DTD A;  1IG7 A;  1HDD C;  1VI0 A;  5E3M A;  2DMU A;  2YS9 A;  3LSJ A;  5M3M J;  4J19 A;  4XID A;  1ETV A;  3LNQ A;  1GV2 A;  2R92 J;  1O4X A;  2X6O A;  5EGO B;  2L7Z A;  1QVT A;  5EG0 A;  1JUP A;  2ECB A;  3BQZ A;  3HGY A;  2EZK A;  4A3F J;  4XRM A;  2DMQ A;  5EZG A;  1QVU A;  5F08 A;  2ZB9 A;  5IP9 J;  1JJ8 C;  4A3I J;  1MSF C;  4QTR A;  2DA4 A;  3CQZ J;  1IRZ A;  2O8K A;  4DW6 A;  3HKZ N;  3GTK J;  3HOY J;  1NTC A;  4C3I J;  1ORK A;  1HDP A;  5E3O A;  1ZKG A;  3O8G A;  3ZQL A;  2HOT A;  3JR9 A;  2EH3 A;  5GP9 A;  2DA3 A;  1F43 A;  1WCM J;  3OOU A;  3IH3 A;  1H88 C;  2K40 A;  2R5Y A;  1SFO J;  1H89 C;  4C3H J;  5M5W J;  1I6H J;  5E3N A;  4UUS B;  4DZP A;  2JJ7 A;  1BW5 A;  2M34 A;  3SFI A;  1MBK A;  5JLW A;  4FIS A;  1G2H A;  2XSD C;  3L1P A;  4W1U A;  1FTZ A;  2DA2 A;  1TWC J;  3I4N J;  2L7M P;  2DA5 A;  5FKN A;  1IC8 A;  1B72 A;  1Z77 A;  4X6A J;  3BTL A;  2JK3 A;  2NVX J;  1PUF A;  5FKO A;  1JT6 A;  1S7E A;  1GUU A;  2LR8 A;  3OSG A;  3K7A J;  1JKP C;  2XPV A;  1X2M A;  3A02 A;  1FJL A;  1NK2 P;  5IYB J;  4A3B J;  4IEJ A;  4DYC A;  4NDL A;  1X58 A;  5C44 J;  2ECC A;  3BTC A;  1MNM C;  1UG2 A;  1K61 A;  3S1Q J;  1TWA J;  1JTX A;  1JKO C;  3BT9 A;  3DCF A;  1ZR4 A;  2HDD A;  1BW6 A;  1K83 J;  2EBI A;  2LVS A;  2HOS A;  1R9T J;  1IJW C;  3ZQI A;  3K2A A;  1SAN A;  2IAI A;  5HOD A;  4G12 A;  3HOW J;  1YRN A;  1FIP A;  1TC3 C;  1MBF A;  2L7F P;  4MO7 A;  2H8R A;  3FIW A;  3BTI A;  3JRG A;  4M3D A;  2W48 A;  3S17 J;  2JA5 J;  4IHY A;  4LOC A;  1RES A;  5IPA A;  2DN0 A;  3IH4 A;  1LE8 A;  4A3G J;  1T33 A;  4UUT A;  5M5X J;  4HNV A;  3FK7 A;  4BXX J;  2K9S A;  1ZR2 A;  1XS9 A;  1HCR A;  3ZQF A;  5C4X J;  2MG4 A;  2XB5 A;  4GFB A;  4JX5 A;  4M3B A;  1ZK8 A;  4M3G A;  2HI3 A;  2DJN A;  4DYR A;  4FE7 A;  4ABZ A;  1ETW A;  3S16 J;  5M5Y J;  1ETQ A;  1MH4 A;  2Y30 A;  5EEA A;  1HF0 A;  1VND A;  3NAR A;  4CYC A;  5EF6 A;  5DS9 A;  3OSF A;  2NOG A;  2EQR A;  3ZOB A;  5IYC J;  3RZD J;  5IOY A;  1F36 A;  3BR5 A;  3PM1 A;  3QPL A;  4C2M J;  3LSR A;  3BR2 A;  3BG5 A;  2KT0 A;  1MSE C;  3BG9 A;  3G1L A;  2NS8 A;  4B3A A;  5EGO A;  1I50 J;  2EZI A;  3LSG A;  4RDU A;  2DA7 A;  2JWT A;  2X9D A;  2N8G A;  5J1U A;  4IHW A;  2COB A;  3GTG J;  1A6I A;  3H0G J;  5JLX A;  3FK6 A;  3A01 B;  3JRA A;  1IUF A;  1GVD A;  1ETX A;  2HYJ A;  4DYQ A;  1BJZ A;  2DMT A;  3GTL J;  1EF4 A;  1GT0 C;  2QF7 A;  4A3J J;  3BR6 A;  3OIO A;  4MIM A;  3D1N I;  2EZL A;  2CQX A;  2LFB A;  3JRD A;  2XGD A;  1BA5 A;  4I6Z A;  2ELK A;  3S14 J;  2VKV A;  2Y0S N;  3JRC A;  2WAQ N;  5J1Y A;  3PO2 J;  1P7J A;  2L0K A;  2DMN A;  2Y9Y A;  3TW6 A;  3FKI J;  2ID6 A;  4X1E A;  2I10 A;  3QPS A;  1ZTR A;  2HXI A;  1U9N A;  4Y52 J;  4UUS A;  1TWF J;  1HLV A;  5FKM A;  5K7H A;  2JA8 J;  4JX4 A;  2WV1 A;  2CU7 A;  3C2B A;  1MBE A;  1WI3 A;  2Y2Z A;  4AC0 A;  4M3E A;  5FLV A;  1T56 A;  5EZH A;  4IHV A;  4D5F A;  3GTO J;  1MBH A;  3B6C A;  3RZO J;  2D5V A;  2TCT A;  2WB1 N;  1IV6 A;  2LLK A;  3TP0 A;  2E2H J;  1UHS A;  3SJM A;  1POG A;  2O7O A;  1ETO A;  1W0U A;  5IYD J;  2VI6 A;  1ZQ3 P;  2CQQ A;  5F04 A;  1JKR C;  3Q0U A;  1WPK A;  2XRL A;  1VFC A;  4JX6 A;  1W0T A;  2JMW A;  4XK4 A;  3GTQ J;  2VPR A;  3ZQG A;  3IV5 A;  2HXO A;  1DU0 A;  2YUS A;  1AU7 A;  3JRH A;  3HOU J;  1UMQ A;  5BNG A;  2E2I J;  3BR1 A;  1AKH B;  2PMZ N;  1OCT C;  4A3M J;  2HQ5 A;  4MLO A;  1MBG A;  2E2J J;  1JJ6 C;  2VKE A;  2DA1 A;  1ETK A;  4BY7 J;  1RPW A;  2GBY A;  3BG3 A;  1DU6 A;  4A3L J;  4FTH A;  4A3D J;  5EYR A;  4C3J J;  1P7I A;  2MGQ A;  2M0C A;  2G0E A;  1FTT A;  4W97 A;  5F1J A;  1FIA A;  2FX0 A;  2ID3 A;  1WH7 A;  3JRE A;  2FJ1 A;  1ENH A;  3HDD A;  2X48 A;  1B8I B;  3VPR A;  5GPA A;  2LKX A;  2AHQ A;  1LFB A;  1APL C;  1Y1V J;  4AYB N;  3FIS A;  1IDZ A;  2MSY A;  4B1R A;  3DEW A;  4AUX A;  2IBD A;  1QPI A;  2Y31 A;  3E7L A;  1XC5 A;  2LTP A;  3JRF A;  5K7Z A;  2EZH A;  2E1O A;  1I3Q J;  1OFC X;  3NAU A;  2DA6 A;  2R5Z B;  1X2N A;  2GLO A;  2RAE A;  3GTM J;  4DZJ A;  2XPW A;  3HM5 A;  5FJ8 J;  1FEX A;  1JGG A;  1VF9 A;  1ZGW A;  5EG0 B;  2XPU A;  2K9N A;  4M3F A;  4BKX A;  3BR3 A;  4D5C A;  3SDG A;  3S1M J;  4JYK A;  3BR0 A;  4RBO A;  1RKT A;  3A01 A;  2K9Q A;  3BQY A;  4JP0 A;  5F27 A;  3M4O J;  3RKQ A;  2CJJ A;  2DMP A;  1E3O C;  1OJL A;  3B6A A;  4M6V A;  1Q1V A;  3TED A;  5IOZ A;  4BBS J;  1WGX A;  3TW7 A;  2B63 J;  2LY9 A;  2NVY J;  4V2F A;  2R5Y B;  2LD5 A;  2ME0 A;  2FD5 A;  3ZQC A;  1U9O A;  4A93 J;  5K7F A;  3H3V K;  4V2G A;  3BTJ A; 
#chains in the Genus database with same CATH topology
 2IRF G;  1TLH B;  3CUO A;  3HOV J;  2F5E A;  4YIR X;  4CCL A;  1QNT A;  5DM7 F;  1QU3 A;  3EUK L;  4KIF A;  5KAF C;  3CCE I;  3S3O A;  2PEX A;  4OIP F;  3J7A Y;  1V5F A;  4A3K J;  2KFD A;  5H6Q A;  1X3U A;  2VUM J;  2QLZ A;  2DTZ A;  3H5A A;  4N4O B;  1X1C A;  1FYM A;  3C2H A;  4TV7 A;  2NVU B;  1H8A C;  1QO0 D;  3K4C A;  1YW7 A;  3DTK A;  3KP3 A;  5F0F A;  4CZC A;  5KHD A;  3S15 J;  4WK8 F;  5J3L A;  3RKW A;  1TQP A;  4CO8 A;  2ME6 A;  1IUY A;  1UST A;  3S2H J;  3MD2 A;  1K6O A;  3L2R A;  1K4S A;  3O8H A;  3K70 D;  2OU2 A;  1ZEL A;  3V8J A;  2VJI A;  3OWT A;  3ZXS A;  3QAH A;  4ENM A;  2DI3 A;  3FBN B;  1IZ1 A;  1GLN A;  1Y1W J;  4OIQ F;  2NAZ A;  2M5W A;  4S0H B;  1YQA A;  3TO9 A;  2CW7 A;  4XNF A;  2A05 A;  2MH9 A;  2W84 A;  3OR2 C;  3DU5 A;  2R93 J;  5CQG A;  3I4M J;  2WAQ A;  2JN6 A;  1OCP A;  1T0F A;  3KP4 A;  1DQU A;  1BBY A;  1BL0 A;  1VQ5 I;  1SFU A;  5J6X A;  3EUA A;  4M9X A;  4MFD A;  2KDZ A;  1OLT A;  1RET A;  2MW8 A;  2LMD A;  4EJO A;  2QGU A;  1KU2 A;  4BE0 A;  4G7Z F;  2F4M B;  5HS8 A;  2NVQ J;  4HV5 A;  4I7H A;  1R5I D;  1SFK A;  3CCY A;  1FWZ A;  2MAB A;  4UVA A;  3F8N A;  1SD6 A;  2YU9 J;  2DPD A;  4PSW A;  1B8I A;  1TQM A;  5F0H A;  3DQV C;  1CF7 B;  5LRR A;  1LE8 B;  3S8P A;  1QRY A;  4A3E J;  3A03 A;  2LK2 A;  3PNT A;  4QSH A;  3KET A;  4Y7N J;  1KQ9 A;  4HDV A;  1MKM A;  3HBL A;  4BUP A;  4QIW N;  3ASO H;  2CUJ A;  1R49 A;  2CUF A;  4IHX A;  4YII A;  5D5U B;  2Y69 H;  4YEL A;  1YS6 A;  3D5S C;  2HZT A;  5LFA A;  2XF6 A;  3F0C A;  4I99 C;  1U78 A;  4U7B A;  4CYC B;  3HOX J;  4PFP A;  3SHF A;  1XGN A;  2GOM A;  1BM9 A;  2R0Q C;  5F0C A;  5FKK A;  4MNU A;  1T8I A;  2NVT J;  1FLI A;  2M9H A;  1FOY A;  2TRT A;  3ZMD A;  2VOD A;  4HLX A;  5L3E A;  1HDD C;  4UV9 A;  5BS6 A;  2YS9 A;  2H94 A;  3I59 B;  2QA4 I;  3BP8 A;  1ETV A;  1QPM A;  3LL7 A;  2HDC A;  3QP5 A;  2X6O A;  2V1D A;  3DBR B;  3FF5 A;  2L7Z A;  4L0Y B;  5LGT A;  4PJL A;  3CUQ A;  1JUP A;  2ECB A;  3BQZ A;  4L5I A;  4UV8 A;  1L0O C;  2EZK A;  3RI4 A;  3PQK A;  1QVU A;  2IGO A;  1OR7 C;  4FHT A;  5K1Y A;  3CUQ C;  2VKD A;  4KUM A;  3BJO A;  2LKP A;  2A68 F;  3PIO F;  4EGZ A;  2CFX A;  1WHU A;  2O8K A;  2JVG A;  4KMU X;  3U21 A;  1KU9 A;  2CO5 A;  3CC7 I;  3G4S I;  4H0E A;  4BXU A;  4AYB A;  3DLA A;  4I09 A;  5E3O A;  1V5G A;  2JPC A;  1Y0U A;  2DA3 A;  5DV5 A;  2EB7 A;  2IA2 A;  1XDU A;  5AIP A;  1SFO J;  1H89 C;  1RUN A;  2X85 A;  3BOQ A;  2L5Q A;  1ZH5 A;  3K70 C;  4CIC A;  4U7D A;  4HDU A;  4XMY A;  2DPU A;  2VQG A;  3S3N A;  1BW5 A;  3K4L A;  3OYH A;  3HOT A;  2M34 A;  2K9L A;  3FDY A;  2K7L A;  2MLK A;  3SFZ A;  5D5V B;  5JLW A;  1S7O A;  4BHC A;  3AG2 H;  3S32 A;  3LFU A;  3OL4 A;  2B0L A;  1R1U A;  4NC8 A;  2EIM H;  2DA2 A;  2EV6 A;  2UXX A;  2KKO A;  3COA C;  2QQA A;  4MGR A;  3L09 A;  2DA5 A;  1WVR A;  5CVI A;  4ESB A;  2HKX A;  4QPO A;  1B72 A;  4HSR A;  2QBY A;  2YPR A;  4CXF A;  4AID A;  2JK3 A;  2JPB A;  3RQ4 A;  4N4N B;  3EYY A;  1J7K A;  1GUU A;  2LR8 A;  5FO5 A;  1K6Y A;  1JKP C;  3VOE A;  2DOA A;  2XAH A;  1X2M A;  1G59 A;  4Y3O A;  2ZME A;  5IYB J;  1YO5 C;  3FXO A;  3HRM A;  4NDL A;  4EJT A;  1JI8 A;  2VQL A;  3BTC A;  3QOP A;  1MNM C;  3AG1 H;  1BR4 A;  1EH7 A;  2E35 A;  2ZME C;  1A04 A;  5L3C A;  1UG0 A;  3H36 A;  2ICW G;  1Z21 A;  3IAM 2;  2JT1 A;  1W5S A;  4M6X A;  1JKO C;  3BT9 A;  4IQ4 A;  1Z67 A;  4RB2 C;  3WE3 A;  2KRC A;  5CJ9 A;  5LBQ A;  2EBI A;  3LQQ A;  1SAN A;  3KX2 A;  1X3Z B;  1XMK A;  3HOW J;  5E8I A;  3GLX A;  5JR3 A;  2CFO A;  3OMY A;  1ON2 A;  1BOA A;  3EUH C;  2QKM B;  3GX4 X;  1G6N A;  2V9K A;  1MBF A;  3HUG A;  2L7F P;  3PNY A;  2H8R A;  3R60 A;  4GO1 A;  4OIR F;  2BY2 A;  3S17 J;  2R7U A;  2H6B A;  3CO7 C;  4L18 B;  4RGU A;  1I1G A;  2QKL B;  3QU3 A;  3IH4 A;  3KP2 A;  1KON A;  1QQI A;  3HHH A;  4RB1 A;  2K9S A;  3SEZ A;  3W6J B;  1SVL A;  2MG4 A;  2ZCW A;  2Y0M A;  4GFB A;  4B44 A;  3WTU C;  2RKH A;  4DYR A;  4FE7 A;  4ABZ A;  1D8J A;  4ASN A;  1XGM A;  4XLC A;  3OYD A;  3S16 J;  2MC3 A;  3QYE A;  3LST A;  3ZMS A;  2V9V A;  1VND A;  1WJA A;  3E0J B;  5EF6 A;  3OSF A;  2Z33 A;  1P92 A;  4L5J A;  5IOY A;  1F36 A;  2P7V B;  1D1C A;  3PL8 A;  3LWF A;  3S93 A;  3BR2 A;  2BW3 B;  4LG0 A;  4RLF A;  3TDU C;  4FX0 A;  3G1L A;  1IRF A;  3CO6 C;  2NS8 A;  1BR1 A;  4O6J A;  5EGO A;  1D0Y A;  3LSG A;  3SZT A;  2CW0 F;  3K4N A;  2ACJ A;  1HA8 A;  1J09 A;  2COB A;  3P7N A;  4I98 B;  4OAY A;  1SC7 A;  3LSI A;  2LG4 A;  3MMY B;  3PSF A;  4P9F A;  1VQ9 I;  4ZDO A;  3ERE D;  4K2E A;  4PDK A;  1GVD A;  4IX7 A;  3B02 A;  1F4K A;  1YX5 A;  2WTE A;  3Q9V A;  4OAZ A;  4LK1 F;  3VYS B;  3D1N I;  4MTE A;  3AFH A;  4ZDP A;  2ZXJ A;  3BCA A;  1U5T B;  2XGD A;  1ZRF A;  2LF7 A;  3G73 A;  3S14 J;  3IHU A;  4BGD A;  3IAS 2;  3WOD F;  4DNC A;  1R1T A;  3JAM Z;  1P7J A;  3ONQ A;  2OCE A;  3FKI J;  2ID6 A;  5H2F C;  2I10 A;  5TIS C;  3CES A;  4UUS A;  2CU7 A;  1WI3 A;  2Y2Z A;  3DV8 A;  1RR8 C;  4ON0 A;  3HYI A;  2DT5 A;  3JAM K;  3BPX A;  2JRT A;  2XKO A;  1MDM A;  5DYM A;  5LHH A;  2KHM A;  2Q2E B;  4IHV A;  3EYI A;  3GTO J;  2IS1 A;  1E0E A;  4B8X A;  2W82 A;  3P5J A;  4G7H F;  1MBH A;  1F9N A;  2GA1 A;  4F3Q A;  2KP6 A;  5BQT A;  2PJR A;  1NHA A;  2D5V A;  1X19 A;  3RZO J;  2HKO A;  4NUB A;  2WB1 N;  3OYA A;  2GXB A;  1IV6 A;  4UVB A;  4BH9 A;  3TP0 A;  5K5R A;  2VI6 A;  2HYG D;  1OCR H;  1HKT A;  2P6S A;  1GVJ A;  1OYI A;  1WPK A;  2W25 A;  3KP6 A;  4JX6 A;  1IN8 A;  1FYL A;  1S7A A;  2JMW A;  4II2 A;  2RNG A;  3AKZ A;  3GTQ J;  5CLS A;  1ULY A;  4WX9 A;  2HPM A;  2HZD A;  2HXO A;  4RB3 C;  1DU0 A;  2YUS A;  2BE5 F;  4F91 B;  5JHF A;  1N77 A;  2A6H F;  5J8C A;  4P96 A;  5BNG A;  2E2I J;  3BR1 A;  3ZN0 A;  1WWX A;  3GO5 A;  5DUK A;  3TL4 X;  5D8K B;  4RS8 A;  2HQ5 A;  2EPF A;  2XGX A;  1MBG A;  1JJ6 C;  2DA1 A;  1ETK A;  2OQR A;  1RPW A;  3LMM A;  5ICE A;  2VBZ A;  5EYR A;  4C3J J;  2FBH A;  3HIF A;  2MGQ A;  5KCM A;  4WXH A;  2DOF A;  5JFR A;  5HDK A;  2FX0 A;  3LSM A;  1DUX C;  3RKY A;  1IRX A;  4PCQ A;  2X6X A;  1D1B A;  4LLL A;  4E7S A;  2J5P A;  1EH6 A;  2LKX A;  1LB2 A;  3R4K A;  1S6L A;  3H9Q A;  5D5X B;  1LFB A;  3OYN A;  4HBL A;  2CQ7 A;  5J40 A;  3FIS A;  2QUF A;  2ZXW H;  2GWR A;  2VJ4 A;  3ERM A;  4U0Y A;  4ZZL A;  2CQN A;  3F8M A;  4CDG A;  5LHI A;  3T5X A;  1P6R A;  3E7L A;  1VQO I;  5HOO A;  1XC5 A;  3OIQ A;  3QU6 A;  3JRF A;  5K7Z A;  2EZH A;  3HXL A;  1OFC X;  4XKB A;  3QPH A;  3NAU A;  2DA6 A;  2BY1 A;  5K5O A;  4OOI A;  1X2N A;  2GLO A;  2BEO A;  2RAE A;  3BRO A;  4PJJ A;  4ZYD A;  5HLT A;  1W7P A;  1MJ9 A;  2LH9 A;  1IXC A;  2PN6 A;  2XPW A;  5FJ8 J;  4XLE A;  4D9J A;  3LA7 A;  1VF9 A;  3DTE A;  4ENJ A;  2HDW A;  3IWZ A;  3CCL I;  3MKY B;  3HTS B;  3QOE A;  4M3F A;  2M0M A;  1S9H A;  2ZNZ A;  1F5T A;  3TO6 A;  1J5Y A;  2GZW A;  2COM A;  5D6E A;  3V8K A;  5FB2 A;  3BR0 A;  2DJI A;  1U0J A;  5IT9 Z;  5F27 A;  3U1K A;  5EJC A;  2Y48 A;  3FMQ A;  4KIC A;  3IP4 B;  4FET A;  1IXS B;  1T39 A;  1JGS A;  4YFK F;  4P1W A;  1OJL A;  2WAE A;  1SMT A;  4RMN A;  5LEK A;  1RC9 A;  2X6Y A;  5AON A;  3WU1 B;  2FBK A;  2W7N A;  3TED A;  5IOZ A;  1O3R A;  2VB6 A;  5TGT A;  2LY9 A;  5CQE A;  2Z99 A;  4PGG A;  2R5Y B;  2LD5 A;  5IT9 K;  2ME0 A;  5BOX A;  3H35 A;  3H3V K;  4LK0 F;  2KJC A;  3GTJ J;  4D7N A;  4IOC F;  1XCB A;  2DFF A;  1P4W A;  2CUE A;  3MQ0 A;  3UNG C;  3OV8 A;  5GAG J;  2KIS A;  3ISP A;  2VQC A;  4YFN F;  4HX7 A;  1W36 D;  3M3Y J;  3GFL A;  4I0A A;  3R6S A;  1MJB A;  2EA2 A;  4CZZ A;  3TP3 A;  3JRI A;  1U2W A;  3ZQH A;  1CQT A;  2Y9Z A;  2STW A;  3WHC A;  2DOD A;  2P0W A;  1NH3 A;  3DEE A;  3FM3 A;  3UKG A;  2WAF A;  2IEK A;  1OPC A;  2JRM A;  1RZ4 A;  3JCU C;  1PUF B;  2W1O A;  2VL8 A;  1TWG J;  4UB8 C;  2RQQ A;  2EIK H;  2LOO A;  1A5J A;  1NG6 A;  1ZGJ A;  1U8B A;  1SFE A;  2L2O A;  3E6D A;  3CTA A;  3V42 A;  3Q3S A;  3DKY A;  4XSZ F;  1HOM A;  4WXD A;  3KZI C;  2JZY A;  1B59 A;  4G9Y A;  4BQA A;  1YJ9 I;  3HOZ J;  4MTD A;  3CDL A;  1XN7 A;  4ESF A;  2F5V A;  2Y0S A;  2CRG A;  2CGP A;  4XRS G;  2QCO A;  1FP1 D;  4PGH A;  1AKH A;  1IRG A;  2O3F A;  2DCE A;  3D5R C;  3IH2 A;  4L9V A;  2R7T A;  3CMM A;  4PJM A;  1OYW A;  1OKR A;  3DTI A;  3FXR A;  4HPQ A;  3CMY A;  4XL9 A;  2LRD A;  2QVO A;  4RGX A;  5GAE J;  1YIJ I;  2PFB A;  2P7C B;  3IWF A;  3I58 A;  1YRN B;  3ZCO A;  5F6F A;  4E4H A;  2AO9 A;  1IXR C;  1Z0X A;  3CJQ B;  2LF8 A;  1YIO A;  1ZG1 A;  3PJR A;  3W2V A;  2V6C A;  5C3E J;  2F2E A;  3B73 A;  3GLL A;  3T0Y A;  5KVR A;  2XB0 X;  4D7M A;  1R5H A;  1WH5 A;  4WF2 A;  1YHQ I;  1VQ7 I;  4CH7 A;  1EV7 A;  2C6Y A;  1K79 A;  3AL0 B;  2G7H A;  5EDN A;  3QQA A;  4XIC A;  3J81 Z;  1JUS A;  4CCN A;  2UZK A;  3SZG A;  4ZZD A;  2IXS A;  3EDP A;  3IKV A;  2XAQ A;  4FE4 A;  5HDN A;  4E7H A;  2P5K A;  2RC4 A;  3OY9 A;  1ETY A;  2BY3 A;  3F22 A;  3K1N A;  2EFQ A;  3I0T A;  1KQ0 A;  2L9R A;  3ABM H;  3G1O A;  4RM2 A;  2F5D A;  5DD4 A;  1V55 H;  3J81 K;  2Q0O A;  4BY1 J;  1REP C;  4FCY A;  2M1B A;  3K4K A;  3TDZ C;  4NQW B;  1FY7 A;  5FFX A;  2VE8 A;  1J75 A;  3L2W A;  2CV2 A;  4BHB A;  3M1E A;  4M6Y A;  1P4A A;  2R92 J;  1OQY A;  1O4X A;  2A3S A;  4XOR A;  3I9V 2;  2HTS A;  2OV7 A;  4NC7 A;  4XRM A;  2DMQ A;  2KZG A;  3F8B A;  4NC6 A;  5F08 A;  5FRO A;  2DYS H;  1Y8Q B;  5ILU A;  2DDA A;  2STT A;  5CKT A;  1R71 A;  2DA4 A;  5DCM B;  3ZMT A;  2Z2S B;  1IRZ A;  2V1N A;  4Z2Y A;  2DFH A;  3M1C A;  1ODD A;  1W36 C;  5HLH A;  4HZF A;  3TOB A;  3GTK J;  5KK1 A;  3I54 A;  1ORK A;  5H20 A;  4KT5 C;  2JSP A;  3O8G A;  1WRJ A;  3FHN A;  3RCO A;  1JHH A;  2HOT A;  2EH3 A;  2FOW A;  2EFN A;  5GP9 A;  3I3L A;  1XD7 A;  1LVA A;  3OOU A;  2O8X A;  4A0Z A;  3IH3 A;  1LPQ A;  1QA6 A;  2XF7 A;  1A36 A;  1YFH A;  3VYT B;  5TJJ A;  1I6H J;  3U2R A;  2NXN B;  1O3T A;  4DZP A;  1XTA A;  2JJ7 A;  4AVP A;  3C18 A;  3KP5 A;  3J80 Z;  1J59 A;  1MBK A;  5HLI A;  2HR3 A;  3PNV A;  5CVU A;  1YOV B;  4LG3 A;  1BC8 C;  2KIF A;  2XSD C;  5ICG A;  4W1U A;  1FTZ A;  3BY6 A;  2X51 A;  3J80 K;  5ERI A;  2A61 A;  4RAG A;  3ZPL A;  1LDJ A;  3PFY A;  4XOT A;  5EEG A;  4E70 A;  1IC8 A;  4XSX F;  3VEP A;  1XSV A;  1ONV A;  4Y15 A;  2NVX J;  2GXG A;  1JT6 A;  1S7E A;  1W5C C;  5E1Z B;  1R7J A;  1TBX A;  1O57 A;  1D0Z A;  5ICC A;  4DYC A;  2ETH A;  3CP8 A;  3FXL A;  4ZYG A;  1K61 A;  4Y33 A;  3S1Q J;  2KRH A;  2E1M B;  2F5C A;  4QPQ A;  1PVE A;  2RVC A;  4E6K G;  3BZC A;  2IPQ X;  2LC2 A;  4CCM A;  2QWW A;  3V4G A;  3ZMZ A;  1I39 A;  1WSU A;  2YSR A;  4G6T B;  3HSF A;  2HDD A;  1EJ9 A;  2R7Q A;  4OMZ A;  4UNO A;  2H1L A;  3Q9S A;  2LVS A;  2V4J C;  3E6M A;  1G4D A;  3K2A A;  2IAI A;  4LFU A;  5HOD A;  1XPX A;  5AIQ A;  3F8F A;  2D45 A;  3IRR A;  2VQH A;  3DKW A;  3CLO A;  3CF5 F;  2MA3 A;  1FC3 A;  3BTI A;  4ZYH A;  3JRG A;  4M3D A;  3VYR B;  4KMF A;  2JA5 J;  3MWM A;  4FQG A;  4LOC A;  2D2W A;  4BEH B;  1HW1 A;  1T33 A;  1YE9 A;  4HNV A;  2QQ8 A;  4B3X A;  3HTU A;  3FK7 A;  3OYI A;  4BXX J;  2HEO A;  3EPZ A;  2BBY A;  3ZQF A;  1OCC H;  1YX3 A;  5C4X J;  3R0A A;  1DPU A;  4M3B A;  4M9Z A;  4M3G A;  4RAY A;  2W4S A;  2F48 A;  4CCJ A;  2IP2 A;  3BJA A;  2QSF X;  2I8D A;  1VZ0 A;  3ZMU A;  4BQO A;  2IA1 A;  5DS9 A;  2V26 A;  3K4J A;  4EV0 A;  3K6G A;  1VQN I;  4LGW A;  5HDG A;  2XAJ A;  3WTT C;  3DPU A;  3A2K A;  1OR7 A;  4A0Y A;  4GXO A;  3FXK A;  1XCV A;  2FU4 A;  3WTY C;  3BG5 A;  1MSE C;  1P9Q C;  4FX4 A;  4B3A A;  3GZ6 A;  1I50 J;  1U6G A;  3OYM A;  2N8G A;  3DF8 A;  5J1U A;  2AQE A;  1GXP A;  1UEL B;  3H0G J;  4DOZ A;  3N05 A;  2QSH X;  5E79 C;  4DBQ A;  1R1V A;  2HGC A;  3P9C A;  3WU0 A;  2HYJ A;  4DYQ A;  3F9K A;  2K85 A;  2P5V A;  3GTL J;  1LFP A;  1TNS A;  4A3J J;  4LMY A;  4MIM A;  2PBI A;  3OS1 A;  2CQX A;  2LFB A;  5HS9 A;  1BC7 C;  2V79 A;  1R6R A;  4YIF A;  4I6Z A;  2CS3 A;  1BA5 A;  1LEB A;  2E60 A;  3G2B A;  4EJW A;  3A0H C;  2K27 A;  2EFO A;  4B48 A;  2WAQ N;  2L0K A;  2DMN A;  4F52 A;  4Q48 A;  1MMS A;  3OR1 C;  1R00 A;  2VE9 A;  2GIZ A;  1BI2 A;  3ZMV A;  4Y52 J;  4KT6 A;  1IN7 A;  1MNE A;  5LLQ A;  2NNY A;  4YFX F;  1S8N A;  1TWF J;  2JA8 J;  3ZQ7 A;  4AC0 A;  3HPH A;  1WKM A;  1T56 A;  1U5T C;  2HQA A;  4A5M A;  1H9T A;  3JW4 A;  2XAG A;  2HS5 A;  3K69 A;  2FA5 A;  3CME I;  3V8L A;  2B9S A;  3B6C A;  1OMI A;  3VSK A;  1X1A A;  4C9Y A;  3M9A A;  1BI1 A;  2BZT A;  2AQF A;  2LRE A;  1UHS A;  4PZJ A;  3SJM A;  4V19 K;  3M8F A;  1POG A;  1HQC A;  1SAX A;  1ETO A;  2FNP A;  5IYD J;  2YX7 A;  2QYO A;  3E3V A;  2CV0 A;  3SEQ A;  1VFC A;  4EVI A;  1W0T A;  4XK4 A;  3BG6 A;  3HKZ A;  2ISY A;  2VPR A;  1J0R A;  2HFH A;  1SAU A;  3WTW C;  2GXA A;  4MQV A;  2KZV A;  2XC7 A;  2JA2 A;  2ADU A;  2H8W A;  3DLL F;  2X1D A;  3EUH A;  1FT9 A;  2CWE A;  2L4M A;  3CP2 A;  5LEJ A;  4A3M J;  4RGS A;  2EA4 A;  3QWL A;  2E2J J;  2FSW A;  2KIU A;  5DEQ A;  3ECH A;  3K9T A;  2E5Z A;  3BG3 A;  5DCF A;  4EQQ A;  1V4R A;  4L9N A;  2FOK A;  1QHH D;  2XAU A;  2IJL A;  1KA8 A;  4W97 A;  2L02 A;  1USS A;  2MFZ A;  4AIK A;  2V9P A;  1YTY A;  3HDD A;  3W6K B;  1B8I B;  1A31 A;  2AS5 F;  4ESJ A;  2EIJ H;  5GPA A;  3FMR A;  1PYV A;  3L7W A;  2QEX I;  1Y0N A;  3L2C A;  4NHJ A;  2OC6 A;  5J4Y A;  3GUD A;  2MD0 A;  1APL C;  5ILV A;  3O3K A;  1N78 A;  4AYB N;  4HST A;  1X1B A;  4LIV A;  3BPV A;  3F6V A;  2KQR A;  1YJN I;  2O61 A;  1QPI A;  4XKV A;  2K86 A;  2OAZ A;  2Y31 A;  2DDB A;  4HNT A;  3KEY A;  2OTJ I;  3ZRG A;  2LTP A;  4PJN A;  3LA2 A;  5H6R A;  4AU7 A;  3O6B B;  1P2F A;  5B1A H;  2JUC A;  1X1D A;  2W00 A;  3RDI A;  1D5V A;  3GTM J;  4DZJ A;  2DK5 A;  1LKX A;  4OU0 A;  2HVR A;  3HRS A;  2IS4 A;  1FEX A;  1JGG A;  2EFP A;  4IZZ A;  2LKS A;  2AXL A;  1G8X A;  3RYP A;  1ZGW A;  3CUQ B;  2VAS A;  4C30 A;  4PJ0 C;  1BR2 A;  1KYZ A;  2X0L A;  4HX8 A;  4CSW A;  2KRF A;  1G3S A;  3TGN A;  3BR3 A;  4D5C A;  3KEO A;  2DXI A;  2BHZ A;  3SDG A;  4HAM A;  3S1M J;  3K1M A;  4O5V A;  4RBO A;  2F4I A;  1RKT A;  3A01 A;  4X0G A;  3BQY A;  2QM3 A;  1YW9 A;  3C1D A;  1LQ1 A;  2CSO A;  4N9I A;  2FMY A;  1MZB A;  2PMU A;  1I27 A;  1ZHF A;  3QP6 A;  3VOD A;  4IKF A;  3MEX A;  4M6V A;  1Q1V A;  3RSN A;  4BBS J;  1MMD A;  2B63 J;  3LFK A;  1I5Z A;  2NVY J;  4R79 A;  2XAF A;  2KIQ A;  4A93 J;  1FNN A;  5LHG A;  3RPU D;  4LLG F;  2HNH A;  2Z16 A;  4XRS A;  3NRV A;  1D5Y A;  4ZTJ A;  2DU9 A;  1K7A A;  1QZZ A;  3DP7 A;  2XRO A;  1Y39 A;  3PUF A;  4P9U A;  5FLX Z;  4HRI A;  1LFU P;  4XLF A;  3Q0W A;  1MH3 A;  3ULQ B;  1RNL A;  5GPC A;  4B43 A;  2BYV E;  5KNL A;  2KDO A;  1FX7 A;  2ESH A;  2LBF A;  3Q0V A;  1B72 B;  2QBY B;  5FLX K;  5DD8 A;  3JSP A;  4H4K C;  3E97 A;  2K4B A;  2PLY A;  1ZG3 A;  4MEX F;  3V7C A;  2L01 A;  2ZME B;  3H3Z A;  5LD2 C;  4L9J A;  2E36 A;  3V7R A;  4G6D A;  2WWY A;  3MKL A;  1PP8 F;  3MVP A;  4HF2 A;  3CCM I;  1RUO A;  1VQ4 I;  4U0W A;  3MN2 A;  2VT2 A;  1DPR A;  3LOC A;  3M7G A;  4P55 A;  4XRF A;  4FT8 A;  1XSX A;  2E19 A;  4II3 A;  5IP7 J;  1MMG A;  2ZSI B;  4GDF A;  2YX4 A;  4IXA A;  1FP2 A;  1HKS A;  1WJC A;  2VKH A;  4M72 A;  2LYC A;  2PX9 A;  3GTP J;  3PIP F;  4LIT A;  3WHB A;  5IY5 H;  2DOE A;  5HLG A;  1ZAO A;  1L3L A;  3HB9 A;  1JKQ C;  5EEH A;  4B4C A;  2HOA A;  4HEA 2;  5E3L A;  3S2D J;  2MBF A;  3HUG B;  1JTY A;  4HQM A;  3L2V A;  3PQJ A;  3PO3 J;  2HPI A;  5A2Q Z;  2OF7 A;  3M8E A;  1PP7 U;  2FEZ A;  1UCR A;  3GVA A;  3MFK A;  4RGR A;  3H3U A;  1WJB A;  1FMV A;  3EET A;  1TZL A;  1S29 A;  2LP0 A;  5TRD A;  5B3S H;  1IDY A;  1XG1 A;  1G3W A;  1X4P A;  1RKW A;  1WI9 A;  3KE2 A;  1FPQ A;  4CCO A;  5A2Q K;  2O9L A;  3W6V A;  1BN5 A;  4D1Q A;  2W57 A;  4L9T A;  4ZYE A;  3OYK A;  3OYL A;  3LSP A;  2L54 A;  1IN5 A;  2F5F A;  1SVM A;  1JXS A;  2MYS A;  2M30 A;  1GV5 A;  3W3C A;  3E5U A;  3CDH A;  3A1Y A;  2HOE A;  3J7A O;  2RDP A;  1HBX G;  3CJT B;  4BJ6 C;  4YEJ A;  1D8K A;  2R5Z A;  3AL0 C;  3K0L A;  4I76 A;  5DTD A;  2LY2 A;  1IG7 A;  1WJF A;  1VI0 A;  5E3M A;  3CF2 A;  2DMU A;  5E8G A;  4J19 A;  3OYB A;  3FZV A;  4LG0 B;  2X4H A;  3LNQ A;  1GV2 A;  4BJT A;  5EGO B;  1QVT A;  2XUB A;  5HNH A;  1UB9 A;  4ZJZ A;  5EG0 A;  2D1H A;  1IN6 A;  5IT3 A;  4KJZ A;  4EMS A;  3LAJ A;  5FRM A;  5LGN A;  3ABK H;  4UVC A;  1U3E M;  2K3P A;  3N4M A;  4IRI A;  1QZE A;  4ZDL A;  3GFI A;  1JJ8 C;  1TL8 A;  1MSF C;  5CVR A;  2DBB A;  4A0X A;  5BPI A;  4KIB A;  1WJ5 A;  4XLP F;  1FOX A;  3HG9 A;  1NTC A;  1MIJ A;  2EK5 A;  2K5C A;  1DP3 A;  1HDP A;  4I01 A;  1ZKG A;  3ZQL A;  3JR9 A;  1YI2 I;  4FAS D;  1RRJ A;  5HVQ C;  5LRS A;  1H88 C;  4G7O F;  5B1B H;  2K40 A;  2NRA C;  4C3H J;  2R4G A;  3ECO A;  1YW8 A;  2DTR A;  4F7Z A;  2FE3 A;  5E3N A;  1WJD A;  3NWT A;  4KIT B;  5M5W J;  4UUS B;  2X1C A;  4RAZ A;  4HLY A;  1UHM A;  2CMP A;  2M4G A;  2M7A A;  1LDK B;  2FF4 A;  3BWG A;  2L3D A;  1IW7 F;  1IV8 A;  3I5U A;  1MDM B;  2HYF A;  4FIS A;  2ZJQ F;  3KLN A;  1G2H A;  3REO A;  4XKC A;  2WY7 Q;  2PJR B;  3F23 A;  1VQP I;  2BXY A;  2ZSH B;  2CG4 A;  2VON A;  4HW0 A;  1TWC J;  3I4N J;  2R3S A;  2L7M P;  2RGV A;  5FKN A;  1FBQ A;  2EFW A;  2NNN A;  2ZFU A;  3Q5F A;  4AM3 A;  5FKO A;  1O7F A;  3OSG A;  2IW5 A;  2XPV A;  1PDN C;  3A02 A;  1XMX A;  1BOB A;  1NK2 P;  5GAH J;  1XDS A;  5GTI C;  1FZP B;  4IEJ A;  3KZY A;  2ECC A;  1T6S A;  1VQ6 I;  4Y4R A;  3HZJ A;  3DPT A;  1QGP A;  1UG2 A;  1TT0 A;  3VDX A;  4ANJ A;  4YG2 F;  3D5L A;  1W4M A;  2FQ3 A;  1U8R A;  2BOL A;  4BDY A;  1TWA J;  2R7O A;  1ZR4 A;  1WFX A;  2XKP A;  1BW6 A;  4XQF A;  2H6C A;  2HOS A;  1R9T J;  2VN2 A;  4BJ5 C;  3L9F A;  4OMY A;  1Z7L A;  4G12 A;  3DFG A;  2Y75 A;  3CMA I;  4M71 A;  3KZZ A;  3F6O A;  1TC3 C;  1IN4 A;  2E34 A;  2KLO A;  3KLO A;  3FIW A;  1TT5 B;  5D4R A;  2OA4 A;  3FMS A;  2W48 A;  2P4W A;  1H0M A;  1FSH A;  1E3P A;  2JTV A;  1RES A;  1CF7 A;  5IPA A;  4HQE A;  1LE8 A;  4A3G J;  3ASN H;  2WA0 A;  5B5E C;  5M5X J;  3DXJ F;  4MEY F;  3FXU A;  3WGH A;  1VQL I;  1ZR2 A;  1XS9 A;  1HCR A;  1E3H A;  2HI3 A;  3BJ6 A;  2GAU A;  2DJN A;  5FD6 A;  4HV6 A;  1ETW A;  2EIN H;  3HC7 A;  2PMZ A;  2K02 A;  4XKW A;  3IKT A;  2ZNY A;  2Y30 A;  1HF0 A;  2M87 A;  1BI3 A;  3WTX C;  1MGT A;  4CYC A;  2RNJ A;  2DW4 A;  5L3B A;  2Q1Z B;  3ZOB A;  4BE1 A;  2IGM A;  1W7P B;  3RZD J;  1JE8 A;  3BR5 A;  3E1S A;  3KPH A;  3PM1 A;  3LSR A;  1Z9C A;  2R7S A;  2OCC H;  1X4O A;  4XOP A;  2VLA A;  5E20 A;  3I59 A;  2ZC2 A;  1V5E A;  3CLQ A;  5B66 C;  4WWC A;  1N25 A;  2CW8 A;  2EZI A;  4E7Z A;  3VSL A;  4RDU A;  2JWT A;  3CCU I;  2VXZ A;  2X9D A;  3K4B A;  4BQN A;  4IHW A;  4Q47 A;  2OZ6 A;  4ZH4 F;  3GTG J;  1I3A A;  4XLH A;  1E2X A;  2UWM A;  1WJE A;  1MJA A;  2KL4 A;  4JBA A;  1IUF A;  1ETX A;  4CA0 A;  1DGW Y;  1BJZ A;  2DMT A;  4PFO A;  1T08 B;  1GT0 C;  3BR6 A;  2D1V A;  2W85 A;  2EZL A;  2R7D A;  3JRD A;  2VIX A;  1Z1D A;  5ILS A;  1D3Y A;  3OOP A;  4XLA A;  1EKE A;  2CQK A;  2IS2 A;  2Y0S N;  3H5R A;  3JRC A;  5J1Y A;  2IGN A;  3PO2 J;  1VQM I;  2Y9Y A;  4X1E A;  3PFI A;  2EV0 A;  4Q5S F;  3QPS A;  1ZTR A;  2HXI A;  3FKJ A;  1U9N A;  5DDG A;  3FXM A;  2UXN A;  2PJP A;  5FKM A;  5K7H A;  1UJ8 A;  3C2B A;  5E17 F;  4M3E A;  5FLV A;  5EZH A;  3EQL F;  4P5O A;  4Q4Z F;  3BZK A;  3I71 A;  1J2X A;  4CUG A;  1S72 I;  2EIL H;  1ZGA A;  2R7F A;  1HW2 A;  3KYL A;  2WY8 Q;  3OYG A;  2E7W A;  2V7F A;  2LLK A;  2O7O A;  3UR3 C;  5LGU A;  3OYJ A;  1W0U A;  1ACI A;  4DJA A;  4O3M A;  2HWV A;  2E71 A;  3DBH B;  2X6W A;  4DIQ A;  2XV4 S;  3BC8 A;  3Q0U A;  1KYW A;  1F1Z A;  2DLL A;  2V1U A;  2KMU A;  5D8L B;  3NEU A;  1O3Q A;  2XIG A;  1IAW A;  3RKX A;  2ZBK A;  2OJE D;  3IV5 A;  1BIB A;  4OIO F;  1AU7 A;  3JRH A;  3DWL E;  3TO7 A;  2OD5 A;  3VWB A;  1UMQ A;  2Z5U A;  1T2K A;  3T8T A;  1AKH B;  1ZN2 A;  4XN0 A;  2PMZ N;  4RAF A;  1RI7 A;  3BLY A;  1IO2 A;  1OCT C;  1ZRC A;  1YYV A;  4CCK A;  5J8F A;  3WTS C;  2BVM A;  2VKE A;  3KYD B;  4GYI A;  2YR2 A;  2GBY A;  1AA7 A;  4BNC A;  4F92 B;  3MZY A;  5CPR B;  4BS9 A;  4A3L J;  1DU6 A;  3I55 I;  4FTH A;  4A3D J;  1P7I A;  3HRU A;  2PI0 A;  2M0C A;  2G0E A;  1FTT A;  4XR6 A;  4HOB A;  5F1J A;  1K78 B;  2ID3 A;  2P6T A;  3JRE A;  2FJ1 A;  1ENH A;  3I53 A;  2X48 A;  5D6F A;  1T0F C;  3P9I A;  4ENN A;  4I0B A;  3F21 A;  3BG7 A;  3IC7 A;  1R22 A;  1UAA A;  3OYF A;  4IPA A;  1Z91 A;  3BZ6 A;  4JQF A;  1Y1V J;  4D0P A;  1IDZ A;  4E7J A;  2VOO A;  2B7E A;  2J5O A;  1T38 A;  4B1R A;  4GRI A;  3DEW A;  4IF4 A;  4GCV A;  1ZYR F;  5D4S A;  1LNW A;  5DUI A;  2YU3 A;  2DO7 A;  5GAD J;  1T98 A;  2L4A A;  3GXO A;  3GZN B;  2VBX A;  2MH2 A;  2E1O A;  1XSD A;  1I3Q J;  3HOS A;  2K9M A;  2P5L C;  2CYY A;  1EA3 A;  4IRH A;  1MW7 A;  4IRG A;  3U1D A;  4BHP A;  1FBU A;  3ZN1 A;  2LSO A;  2PQ8 A;  4RB0 A;  2UUZ A;  1Y6I A;  3A0B C;  4BXF A;  2ZFW A;  2BV6 A;  2GA2 A;  6PAX A;  2XF5 A;  1MND A;  1O3S A;  3C3W A;  5L3G A;  2BW3 A;  1MMA A;  3E6B A;  3G6E I;  1SFX A;  2R7R A;  2G9W A;  2XPU A;  2OQG A;  1BIA A;  4AIH A;  4S05 A;  4IHT A;  3J7Y J;  3JTG A;  2M8E A;  1B9N A;  4JYK A;  2K9Q A;  2DQL A;  5KAI C;  4KNY A;  3M4O J;  4UUV A;  4Z6Y A;  3RKQ A;  1XGS A;  2CJJ A;  4XON A;  4PK4 A;  3CCS I;  1E3O C;  2XVC A;  3CCV I;  1SVO A;  2G7U A;  5FFZ A;  3B6A A;  1PUE E;  1WGX A;  1U5T A;  3DKX A;  2NYX A;  1S3J A;  3LQR A;  2FD5 A;  2GOX B;  1GXQ A;  1U9O A;  4RLQ A;  5ICF A;  4V2G A;  2XHK A;  3CD6 I;  1GHC A;  5ED4 A;  1NK3 P;  2KIM A;  2GQQ A;  3NWS A;  4MQ9 F;  2ZJR F;  4B09 A;  3NQO A;  3P9K A;  2XGE A;  2GIV A;  2OPT A;  2CV1 A;  3ABU A;  3LAP A;  3R0J A;  2FML A;  3GME A;  4G6Q A;  3S1R J;  4QWQ A;  1E17 A;  5FKL A;  2Q2E A;  2FNA A;  3HGG A;  3KIO A;  1V3F A;  3G1M A;  1ZRE A;  1Q1H A;  5JVG F;  3RJP A;  2M8G X;  2QSG X;  2NS7 A;  3TKY A;  5FLM J;  4E7L A;  1IGN A;  2JA6 J;  4LD5 A;  2I5U A;  5IP6 A;  4BL0 B;  1OYY A;  1AOY A;  1JHF A;  2XGC A;  1OIS A;  2M45 A;  2MC4 A;  3LSK A;  4HF1 A;  4KFC A;  4BBR J;  1DGR M;  3IL2 A;  1XMA A;  3FWE A;  3S1N J;  2P81 A;  4F55 A;  1AWC A;  3L2Q A;  2X1E A;  1RR7 A;  1AHD P;  3HEF A;  2HQN A;  4YRV A;  4XLN F;  1X1P A;  4A69 C;  5BPD A;  4LB5 A;  2JA7 J;  2JSC A;  3MKW B;  1G3T A;  1JT0 A;  4OWR B;  1CGP A;  2Z3Y A;  1GDT A;  2GM4 A;  4MFE A;  1ITY A;  4BAC A;  4A5N A;  4J00 A;  4OIN F;  3JTH A;  4WXC A;  2BVL A;  2DT7 B;  4CGZ A;  3I64 A;  1K4T A;  3QYB A;  4F93 B;  2FQ4 A;  5JHU A;  3RQI A;  3KFW X;  4PUS A;  4ZTF A;  3CCJ I;  2OZU A;  3GZ5 A;  3ZGK A;  1HXD A;  3BCB A;  3CCQ I;  4KIS A;  1Y8R B;  3E5X A;  1M1E B;  3HSE A;  3TQN A;  3OYE A;  1TWH J;  2WB1 A;  3MZH A;  2VJJ A;  3JRB A;  1TW3 A;  1SMY F;  4L5E A;  1LDD A;  2ELH A;  2NOJ B;  3G71 I;  5GTH C;  2A5Y B;  1LEA A;  1JUM A;  2R7Z J;  5C4J J;  4EEF G;  2M2E A;  3JSO A;  3GBG A;  2EV5 A;  3RTR A;  3U9G A;  3HL2 A;  4LIU A;  5M3F J;  1ON1 A;  1WQ2 A;  4IL6 C;  2ESN A;  4C2T A;  4HF0 A;  3K2Z A;  1TTY A;  3MZ8 A;  4A3C J;  1Y56 A;  1SD4 A;  1MBJ A;  4IQJ A;  1P4X A;  4NB5 A;  9ANT A;  5J1R A;  1N75 A;  4GGG A;  3H9J A;  1Z05 A;  3PSI A;  2H1K A;  2DFE A;  5BMZ A;  2A6E F;  2IT0 A;  2XAS A;  1RIO H;  3LSJ A;  5M3M J;  1ZRD A;  3TBI A;  4XID A;  3WTV C;  4ETS A;  2IA0 A;  1YG2 A;  3LA3 A;  3HGY A;  4E7K A;  4G94 A;  2ZO4 A;  4XBF A;  3H5N A;  3WE2 A;  4A3F J;  3FBI B;  1R4M B;  1QZY A;  1HW5 A;  5EZG A;  2ZB9 A;  5IP9 J;  4A3I J;  1D1A A;  1DDN A;  2QQB A;  3E6C C;  4QTR A;  1VQK I;  3CJR B;  1QHG A;  4A6E A;  4EJV A;  3CQZ J;  2VT3 A;  1YLF A;  2F6C A;  2M4K A;  4DW6 A;  3HKZ N;  3ESW B;  3HOY J;  4C3I J;  3K4M A;  2V1X A;  3CC2 I;  1I6X A;  3H9G A;  4BAY A;  2RN7 A;  4M9S A;  3HSR A;  2E1N A;  2UV1 A;  1F43 A;  3GCM A;  1WCM J;  2V6E A;  2RQP A;  2R5Y A;  5CVJ A;  3KP7 A;  4UXN A;  3RYR A;  1W7P D;  4DGW B;  4A6D A;  2OBP A;  2BGC A;  3PUB A;  1FSE A;  4IJA A;  4WCG A;  3ZR8 X;  4KDP A;  3SFI A;  1YS7 A;  3OL3 A;  3ABL H;  3OS0 A;  2ZXH A;  4BDZ A;  3AG4 H;  3DEU A;  1YIT I;  2M7B A;  3L1P A;  4L0Z B;  1LVK A;  5JVT A;  3H1C A;  1HKQ A;  3SYT A;  5E1W A;  1MD0 A;  2ZXI A;  5D5W B;  1Z77 A;  4X6A J;  3BTL A;  3DU6 A;  2PMH A;  1PUF A;  4I2O A;  5F64 A;  3K7A J;  5HS7 A;  4BYY A;  3GW2 A;  1FJL A;  1MMN A;  1TQI A;  4A3B J;  3KCC A;  1X58 A;  5C44 J;  4HA8 A;  3ABT A;  1R5G A;  1KGS A;  2K3F A;  2L9V A;  3SZP A;  2ZKZ A;  1DP7 P;  2JUG A;  2PG4 A;  3M8J A;  3DBL B;  2XRN A;  2Z9O A;  1JTX A;  4LJZ F;  1BI0 A;  2HU9 A;  3DCF A;  4G8X A;  1TW2 A;  3K1P A;  3IRQ A;  3E5Q A;  2RV8 A;  4N9H A;  3CJN A;  1K83 J;  2MLG A;  1XGO A;  4ENK A;  1IJW C;  3ZQI A;  3SXY A;  3S3M A;  2QZ8 A;  2JVH A;  1YRN A;  1FIP A;  1R36 A;  2CUZ A;  4MO7 A;  5E1X A;  1FYK A;  2BHY A;  3HPG A;  3VYU B;  1R4N B;  2A6T A;  3L00 A;  1EH8 A;  3X2Q H;  3OS2 A;  3SQN A;  2R7W A;  4IHY A;  2A69 F;  3GWZ A;  1FOW A;  2DN0 A;  1IF1 A;  4KA4 A;  5F1R A;  4UUT A;  1ZLJ A;  2NS0 A;  1KU7 A;  2OUM A;  1B4A A;  2E7X A;  1I1S A;  3CDI A;  3F72 A;  1B1B A;  5K5Q A;  2XB5 A;  3I4P A;  1C0W A;  4JX5 A;  2VBW A;  1ZK8 A;  3H92 A;  4QLC U;  2JQ7 A;  1H9G A;  5M5Y J;  1ETQ A;  1MH4 A;  2RRE A;  4N0B A;  3QOD A;  4DBR A;  5EEA A;  2L9N A;  4S04 A;  4JOM A;  3NAR A;  3M07 A;  3OYC A;  2EJR A;  4DQ2 A;  2NOG A;  2EQR A;  2LDU A;  3QPT A;  3CZ6 A;  4ZYA A;  5IYC J;  3RPU A;  3QPL A;  4AWX B;  4C2M J;  2L7K A;  1ZG5 A;  3GF2 A;  2KT0 A;  4NQW A;  1Z3X A;  3BG9 A;  4M74 A;  2H09 A;  1Z3Y A;  3AG3 H;  4U0V A;  3I56 I;  2DA7 A;  3MCZ A;  2O0Y A;  3H0D A;  4A2U A;  1W5T A;  2ZJ2 A;  4HNU A;  1A6I A;  5JLX A;  4Y17 A;  4CHU A;  3FK6 A;  2KJB A;  3A01 B;  2VC1 A;  1STZ A;  3JRA A;  3FHZ A;  1FMW A;  2BXZ A;  2Z1D A;  5DCM A;  3KYC B;  3ROU A;  1EF4 A;  1VQ8 I;  2QF7 A;  3OIO A;  1ZAR A;  2QQ9 A;  3T8R A;  4E7I A;  1LJ9 A;  1TP4 A;  3TMO A;  1XX5 A;  1HST A;  4J01 A;  2ELK A;  2O03 A;  2VKV A;  1Z6T A;  4KN4 X;  4AVZ A;  3C7J A;  3CCR I;  3TW6 A;  3IUO A;  5J4V A;  4KYW A;  3MAJ A;  2ZJP F;  1FOK A;  1Z7U A;  4IO9 F;  4RA2 A;  3TOA A;  3A4C A;  1HLV A;  4JX4 A;  1R23 A;  2WV1 A;  3WTZ A;  1MBE A;  3BDD A;  4NBQ A;  2R7V A;  2VBY A;  3RPQ A;  3FM5 A;  4U87 A;  3RIR A;  4XM3 A;  4D5F A;  3K10 A;  1VTN C;  1KQ8 A;  3HHG A;  2TCT A;  2BY0 A;  4ZC3 A;  3F8C A;  2LBF B;  2E2H J;  2WBM A;  2A07 F;  3L2U A;  2P8T A;  2VC0 A;  5FRN A;  2HVS A;  1ZQ3 P;  2CQQ A;  5F04 A;  3DPL C;  3HJE A;  4NNJ A;  3ZP5 A;  1JKR C;  3N97 A;  3D0S A;  2XRL A;  2EWN A;  1UHW A;  4R1H A;  2HQR A;  1HSJ A;  4M73 A;  5DM6 F;  1A35 A;  3ZQG A;  5L3D A;  1QBJ A;  1X3W B;  2E1C A;  3R61 A;  3HOU J;  3S2W A;  4C2U A;  5E18 F;  4HX4 A;  2O5R A;  4B47 A;  3AAF A;  2WAD A;  4MHG A;  2MD5 A;  4MLO A;  4RM3 A;  2E5N A;  2XSJ C;  4PSX A;  2DFI A;  1D0X A;  4BY7 J;  3GFJ A;  4GYG A;  5HNF A;  1YJW I;  2W24 A;  1FBS A;  2Q8K A;  4EM1 A;  3W2A A;  2DQR A;  4U88 A;  3FX3 A;  3OIP A;  2E1M C;  3VFZ A;  1NG7 A;  4UB6 C;  4Y13 A;  5FGM A;  2L9S A;  3SDB A;  3WGI A;  2FBI A;  1FIA A;  1WH7 A;  4KIG A;  2F4O B;  4XN3 A;  1KU3 A;  3FXJ A;  4KN7 X;  4HYE A;  3VPR A;  4EM0 B;  4CYD A;  2R7X A;  3GYH X;  1O7L A;  1K78 A;  4UY8 I;  1Z6R A;  2AHQ A;  2OTL I;  5CYV A;  1UFM A;  4HG2 A;  4BEH A;  3CC4 I;  3O2P E;  3W2W A;  2HTJ A;  4BQQ A;  2WC2 A;  4R8H A;  1OCZ H;  1J9I A;  2MSY A;  2IGK A;  3GFM A;  2IS6 A;  1KZH A;  1V54 H;  4AUX A;  5J47 A;  2IBD A;  4LB6 B;  1A6Q A;  4EGY A;  2ISZ A;  2HVQ A;  4IVN A;  2QEN A;  1UZC A;  5FD5 A;  1SEU A;  2H27 A;  3MKZ A;  2VXD A;  2DYR H;  3F3X A;  4UHT A;  3QRF F;  3J7Z I;  2AXT C;  3WG7 H;  2VPL A;  1HC8 A;  1S5L C;  1ERD A;  2FUG 2;  2R5Z B;  1BJA A;  2DK8 A;  4IOA F;  4EM2 A;  1OCO H;  1WZ2 A;  3HM5 A;  3WG9 A;  4ITV A;  3ELK A;  3WGG A;  1B9M A;  3VB2 A;  3WU2 C;  4I02 A;  4EJU A;  5EG0 B;  2FXA A;  4JK1 X;  5JI6 A;  2A5W A;  1SD7 A;  3ML6 A;  2LNB A;  2K9N A;  3GEZ A;  3KEQ A;  3FXQ A;  5CVV A;  4BKX A;  3V7S A;  4AIJ A;  1LUJ B;  3T1B A;  2ELJ A;  1TNT A;  1T95 A;  2IVM A;  3ZQQ A;  3C2G A;  2DAO A;  1G3Y A;  2VJ5 A;  2WV0 A;  2K4J A;  2TDX A;  4JP0 A;  4IHS A;  2KPM A;  4BU2 A;  2DT6 A;  5L3F A;  1SD5 A;  2FRH A;  2DMP A;  1R58 A;  1B6A A;  4LLN A;  1W1W E;  3G3Z A;  4A12 A;  2CH0 A;  2LY1 A;  3LSH A;  4BE2 A;  1PJR A;  3HRT A;  4EAT A;  3TW7 A;  4AD9 A;  2VOP A;  4V2F A;  2M3A A;  3ZQC A;  3QYF A;  1XB4 A;  2XDV A;  5K7F A;  1ZLK A;  2O6G E;  3BTJ A; 
#chains in the Genus database with same CATH homology
 3GTJ J;  4D7N A;  1NK3 P;  3HOV J;  4XRS A;  2CUE A;  1D5Y A;  2XGE A;  2OPT A;  4A3K J;  3S1R J;  3M3Y J;  2VUM J;  2DTZ A;  5FKL A;  1LFU P;  1H8A C;  3TP3 A;  3JRI A;  3ZQH A;  1CQT A;  3HGG A;  3S15 J;  5F0F A;  2Y9Z A;  3Q0W A;  3WHC A;  1MH3 A;  5J3L A;  3G1M A;  3UKG A;  5GPC A;  2ME6 A;  3Q0V A;  2IEK A;  1B72 B;  3S2H J;  2M8G X;  2NS7 A;  1PUF B;  3O8H A;  5FLM J;  1IGN A;  2JA6 J;  1TWG J;  5IP6 A;  1A5J A;  1U8B A;  2XGC A;  3MKL A;  3MVP A;  4BBR J;  1Y1W J;  3Q3S A;  3S1N J;  2P81 A;  4S0H B;  1HOM A;  3MN2 A;  3LOC A;  3HOZ J;  2E19 A;  3CDL A;  1RR7 A;  5IP7 J;  2R93 J;  2CRG A;  1AHD P;  3HEF A;  2QCO A;  4XRS G;  1AKH A;  3I4M J;  4A69 C;  3IH2 A;  2JA7 J;  2JN6 A;  1OCP A;  3CMY A;  3GTP J;  1JT0 A;  1BL0 A;  1GDT A;  2GM4 A;  3WHB A;  4MFE A;  1ITY A;  3HB9 A;  4MFD A;  2KDZ A;  1JKQ C;  1RET A;  2MW8 A;  1YRN B;  4B4C A;  2HOA A;  5E3L A;  3S2D J;  1JTY A;  2AO9 A;  2FQ4 A;  2NVQ J;  3PO3 J;  1Z0X A;  3RQI A;  2OF7 A;  3CCY A;  5C3E J;  2YU9 J;  1B8I A;  1TWH J;  5F0H A;  1LE8 B;  3JRB A;  2LP0 A;  2XB0 X;  1QRY A;  4D7M A;  1IDY A;  1XG1 A;  4A3E J;  3A03 A;  2LK2 A;  4L5E A;  4QSH A;  1WH5 A;  1RKW A;  4Y7N J;  3HBL A;  2O9L A;  4QIW N;  3W6V A;  5EDN A;  3QQA A;  4XIC A;  2R7Z J;  1JUM A;  1JUS A;  5C4J J;  4EEF G;  2CUF A;  4IHX A;  2M2E A;  3LSP A;  3GBG A;  5M3F J;  4FE4 A;  1ETY A;  3F0C A;  2L9R A;  1U78 A;  3G1O A;  4A3C J;  1GV5 A;  4CYC B;  3HOX J;  9ANT A;  1MBJ A;  2R0Q C;  2NVT J;  5F0C A;  5FKK A;  5J1R A;  2M9H A;  2TRT A;  2R5Z A;  4I76 A;  4BY1 J;  4FCY A;  2H1K A;  5DTD A;  1IG7 A;  1HDD C;  1VI0 A;  5E3M A;  2DMU A;  2YS9 A;  3LSJ A;  5M3M J;  4J19 A;  4XID A;  1ETV A;  3LNQ A;  1GV2 A;  2R92 J;  1O4X A;  2X6O A;  5EGO B;  2L7Z A;  1QVT A;  5EG0 A;  1JUP A;  2ECB A;  3BQZ A;  3HGY A;  2EZK A;  4A3F J;  4XRM A;  2DMQ A;  5EZG A;  1QVU A;  5F08 A;  2ZB9 A;  5IP9 J;  1JJ8 C;  4A3I J;  1MSF C;  4QTR A;  2DA4 A;  3CQZ J;  1IRZ A;  2O8K A;  4DW6 A;  3HKZ N;  3GTK J;  3HOY J;  1NTC A;  4C3I J;  1ORK A;  1HDP A;  5E3O A;  1ZKG A;  3O8G A;  3ZQL A;  2HOT A;  3JR9 A;  2EH3 A;  5GP9 A;  2DA3 A;  1F43 A;  1WCM J;  3OOU A;  3IH3 A;  1H88 C;  2K40 A;  2R5Y A;  1SFO J;  1H89 C;  4C3H J;  5M5W J;  1I6H J;  5E3N A;  4UUS B;  4DZP A;  2JJ7 A;  1BW5 A;  2M34 A;  3SFI A;  1MBK A;  5JLW A;  4FIS A;  1G2H A;  2XSD C;  3L1P A;  4W1U A;  1FTZ A;  2DA2 A;  1TWC J;  3I4N J;  2L7M P;  2DA5 A;  5FKN A;  1IC8 A;  1B72 A;  1Z77 A;  4X6A J;  3BTL A;  2JK3 A;  2NVX J;  1PUF A;  5FKO A;  1JT6 A;  1S7E A;  1GUU A;  2LR8 A;  3OSG A;  3K7A J;  1JKP C;  2XPV A;  1X2M A;  3A02 A;  1FJL A;  1NK2 P;  5IYB J;  4A3B J;  4IEJ A;  4DYC A;  4NDL A;  1X58 A;  5C44 J;  2ECC A;  3BTC A;  1MNM C;  1UG2 A;  1K61 A;  3S1Q J;  1TWA J;  1JTX A;  1JKO C;  3BT9 A;  3DCF A;  1ZR4 A;  2HDD A;  1BW6 A;  1K83 J;  2EBI A;  2LVS A;  2HOS A;  1R9T J;  1IJW C;  3ZQI A;  3K2A A;  1SAN A;  2IAI A;  5HOD A;  4G12 A;  3HOW J;  1YRN A;  1FIP A;  1TC3 C;  1MBF A;  2L7F P;  4MO7 A;  2H8R A;  3FIW A;  3BTI A;  3JRG A;  4M3D A;  2W48 A;  3S17 J;  2JA5 J;  4IHY A;  4LOC A;  1RES A;  5IPA A;  2DN0 A;  3IH4 A;  1LE8 A;  4A3G J;  1T33 A;  4UUT A;  5M5X J;  4HNV A;  3FK7 A;  4BXX J;  2K9S A;  1ZR2 A;  1XS9 A;  1HCR A;  3ZQF A;  5C4X J;  2MG4 A;  2XB5 A;  4GFB A;  4JX5 A;  4M3B A;  1ZK8 A;  4M3G A;  2HI3 A;  2DJN A;  4DYR A;  4FE7 A;  4ABZ A;  1ETW A;  3S16 J;  5M5Y J;  1ETQ A;  1MH4 A;  2Y30 A;  5EEA A;  1HF0 A;  1VND A;  3NAR A;  4CYC A;  5EF6 A;  5DS9 A;  3OSF A;  2NOG A;  2EQR A;  3ZOB A;  5IYC J;  3RZD J;  5IOY A;  1F36 A;  3BR5 A;  3PM1 A;  3QPL A;  4C2M J;  3LSR A;  3BR2 A;  3BG5 A;  2KT0 A;  1MSE C;  3BG9 A;  3G1L A;  2NS8 A;  4B3A A;  5EGO A;  1I50 J;  2EZI A;  3LSG A;  4RDU A;  2DA7 A;  2JWT A;  2X9D A;  2N8G A;  5J1U A;  4IHW A;  2COB A;  3GTG J;  1A6I A;  3H0G J;  5JLX A;  3FK6 A;  3A01 B;  3JRA A;  1IUF A;  1GVD A;  1ETX A;  2HYJ A;  4DYQ A;  1BJZ A;  2DMT A;  3GTL J;  1EF4 A;  1GT0 C;  2QF7 A;  4A3J J;  3BR6 A;  3OIO A;  4MIM A;  3D1N I;  2EZL A;  2CQX A;  2LFB A;  3JRD A;  2XGD A;  1BA5 A;  4I6Z A;  2ELK A;  3S14 J;  2VKV A;  2Y0S N;  3JRC A;  2WAQ N;  5J1Y A;  3PO2 J;  1P7J A;  2L0K A;  2DMN A;  2Y9Y A;  3TW6 A;  3FKI J;  2ID6 A;  4X1E A;  2I10 A;  3QPS A;  1ZTR A;  2HXI A;  1U9N A;  4Y52 J;  4UUS A;  1TWF J;  1HLV A;  5FKM A;  5K7H A;  2JA8 J;  4JX4 A;  2WV1 A;  2CU7 A;  3C2B A;  1MBE A;  1WI3 A;  2Y2Z A;  4AC0 A;  4M3E A;  5FLV A;  1T56 A;  5EZH A;  4IHV A;  4D5F A;  3GTO J;  1MBH A;  3B6C A;  3RZO J;  2D5V A;  2TCT A;  2WB1 N;  1IV6 A;  2LLK A;  3TP0 A;  2E2H J;  1UHS A;  3SJM A;  1POG A;  2O7O A;  1ETO A;  1W0U A;  5IYD J;  2VI6 A;  1ZQ3 P;  2CQQ A;  5F04 A;  1JKR C;  3Q0U A;  1WPK A;  2XRL A;  1VFC A;  4JX6 A;  1W0T A;  2JMW A;  4XK4 A;  3GTQ J;  2VPR A;  3ZQG A;  3IV5 A;  2HXO A;  1DU0 A;  2YUS A;  1AU7 A;  3JRH A;  3HOU J;  1UMQ A;  5BNG A;  2E2I J;  3BR1 A;  1AKH B;  2PMZ N;  1OCT C;  4A3M J;  2HQ5 A;  4MLO A;  1MBG A;  2E2J J;  1JJ6 C;  2VKE A;  2DA1 A;  1ETK A;  4BY7 J;  1RPW A;  2GBY A;  3BG3 A;  1DU6 A;  4A3L J;  4FTH A;  4A3D J;  5EYR A;  4C3J J;  1P7I A;  2MGQ A;  2M0C A;  2G0E A;  1FTT A;  4W97 A;  5F1J A;  1FIA A;  2FX0 A;  2ID3 A;  1WH7 A;  3JRE A;  2FJ1 A;  1ENH A;  3HDD A;  2X48 A;  1B8I B;  3VPR A;  5GPA A;  2LKX A;  2AHQ A;  1LFB A;  1APL C;  1Y1V J;  4AYB N;  3FIS A;  1IDZ A;  2MSY A;  4B1R A;  3DEW A;  4AUX A;  2IBD A;  1QPI A;  2Y31 A;  3E7L A;  1XC5 A;  2LTP A;  3JRF A;  5K7Z A;  2EZH A;  2E1O A;  1I3Q J;  1OFC X;  3NAU A;  2DA6 A;  2R5Z B;  1X2N A;  2GLO A;  2RAE A;  3GTM J;  4DZJ A;  2XPW A;  3HM5 A;  5FJ8 J;  1FEX A;  1JGG A;  1VF9 A;  1ZGW A;  5EG0 B;  2XPU A;  2K9N A;  4M3F A;  4BKX A;  3BR3 A;  4D5C A;  3SDG A;  3S1M J;  4JYK A;  3BR0 A;  4RBO A;  1RKT A;  3A01 A;  2K9Q A;  3BQY A;  4JP0 A;  5F27 A;  3M4O J;  3RKQ A;  2CJJ A;  2DMP A;  1E3O C;  1OJL A;  3B6A A;  4M6V A;  1Q1V A;  3TED A;  5IOZ A;  4BBS J;  1WGX A;  3TW7 A;  2B63 J;  2LY9 A;  2NVY J;  4V2F A;  2R5Y B;  2LD5 A;  2ME0 A;  2FD5 A;  3ZQC A;  1U9O A;  4A93 J;  5K7F A;  3H3V K;  4V2G A;  3BTJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...