3E3VA

Crystal structure of recx from lactobacillus salivarius
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
154
structure length
154
Chain Sequence
LADDISKGYNAALNYLSYQLRTRKEVEDKLRSLDIHEDYISEIINKLIDLDLINDKNYAESYVRTMMNTSDKGPKVIKLNLSKKGIDDNIAEDALILYTDKLQVEKGVTLAEKLANRYSHDSYRNKQNKIKQSLLTKGFSYDIIDTIIQELDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein recX
publication title Crystal structure of RecX
rcsb
source organism Lactobacillus salivarius
molecule tags Recombination
total genus 61
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA02
5IT9Z 4ESBA 3J81K 2ZMEB 4EJWA 4AIKA 3TOAA 3WTYC 2OBPA 1J0RA 2EV6A 3CUQC 3RYPA 2A68F 5J8CA 1SMYF 3SFZA 4L18B 4ENMA 3LFKA 1U6GA 1QO0D 3FXUA 5HS9A 4WXHA 1O3TA 1MJ9A 4AWXB 2P4WA 3K1MA 4LLNA 2BV6A 1WI9A 2RDPA 4GGGA 4KFCA 3ZN1A 3F8BA 1ZRCA 1BM9A 1I6XA 1K7AA 1R1UA 4I0BA 2KIFA 1P92A 2LF7A 2KRFA 4A2UA 4O5VA 1ZH5A 1BI1A 5E8GA 4EJTA 5JVTA 4P55A 4Z2YA 4CO8A 4OMZA 1FYKA 1SAXA 5J6XA 1OYYA 3BROA 4AIHA 1QZZA 2HQRA 2H09A 2M45A 5JHUA 2VXZA 3TO9A 3WTWC 2VBWA 2K86A 2FBIA 3SZPA 2EV0A 1YS6A 1EV7A 2O6GE 3KP2A 2Z5UA 4EM2A 3GF2A 3M7GA 3P9CA 1W4MA 5ERIA 1C0WA 4I98B 2BGCA 3FF5A 3WTVC 4PCQA 1BI3A 4E70A 2LKPA 4ZYDA 1YO5C 3JSOA 1IXRC 4EJUA 4EM1A 2UXXA 3VB2A 1XGOA 1D3YA 1SMTA 1YTYA 5LBQA 4A5NA 2XV4S 2FNAA 5HDKA 1TQPA 2IP2A 1TQMA 4WXCA 1Z7UA 5TJJA 4U0WA 5FGMA 3ZMSA 4O6JA 5FD6A 4EQQA 2DAOA 2ZCWA 3WTSC 4HX8A 1X3UA 1T0FA 1O7FA 2WC2A 1KQ0A 3CDHA 3PQJA 4XLNF 5L3EA 2L54A 2BBYA 2O61A 2AS5F 1RNLA 2VOPA 3FXQA 3ECOA 3F6OA 1ZRDA 3F6VA 2VONA 3IHUA 3H92A 1TQIA 4P9UA 2D45A 1E2XA 1WSUA 4GO1A 3IWZA 2DI3A 3WE2A 3G73A 5H6RA 4LB5A 3LSTA 5LHIA 4IF4A 3QPHA 5HDGA 2FF4A 2EB7A 3RKYA 1B9MA 4CGZA 2JPCA 2H94A 3B02A 2V1UA 1UFMA 3KP5A 5E20A 3J81Z 2QWWA 3QU6A 3VFZA 3WTTC 1OYWA 4BAYA 1T98A 4XSXF 4HLXA 2MH2A 2XAQA 1I5ZA 2GA2A 3C3WA 2F5FA 1R23A 2EFWA 4IXAA 1J75A 1GXPA 1U2WA 2FQ3A 3CTAA 4OMYA 4UVBA 1U3EM 2JZYA 3MWMA 4MEXF 2XRNA 1KGSA 3ELKA 3L09A 4Q5SF 2DFIA 2L4AA 2XGXA 1ON1A 3DEUA 4OIRF 1HKSA 5F64A 4XRFA 4GCVA 1FX7A 5D5VB 2BEOA 2FBHA 1H9TA 1BN5A 2STWA 4KDPA 2J5PA 5CVVA 3QP5A 3WG9A 4R79A 2ZBKA 3HYIA 2CG4A 3K0LA 3S2WA 1G3TA 1YLFA 2VOOA 5D4RA 1FOKA 3KEOA 4FX0A 3I59A 1MGTA 2CW0F 4KIFA 2KIUA 3R61A 4CHUA 4OOIA 4UHTA 4U88A 3KZZA 1O3SA 4K2EA 4MGRA 1S6LA 3CUQA 1YIOA 3FMQA 2XAFA 3LAPA 2NNNA 3ULQB 4Y17A 5LGUA 3NQOA 2X0LA 4I02A 2L3DA 2H6BA 1ONVA 3V7SA 5HVQC 3HOSA 3V8KA 2HZTA 3CO7C 3Q9VA 2ACJA 2CWEA 4RGRA 4A6DA 4PGGA 2GXGA 1BIAA 1IN7A 4RGXA 4BHBA 2DW4A 4L9NA 3G3ZA 4PGHA 4ON0A 3JTGA 4LK0F 2JPBA 3ZPLA 1W7PB 1AOYA 1B1BA 1QGPA 2RN7A 4L0ZB 2PMUA 5E8IA 3V4GA 4ENKA 1J9IA 1P4WA 5LRSA 4WF2A 1PP8F 1TW3A 2OZ6A 2DU9A 4CDGA 2XAGA 1XSXA 3E6MA 5ICGA 3NEUA 4KN7X 2QLZA 1KU7A 1XDSA 1LDJA 3KCCA 4G94A 2O3FA 3QOPA 1Y0UA 1FZPB 1IZ1A 2A6HF 2FU4A 1KU3A 3F8MA 3R4KA 3HRTA 3LA2A 3RYRA 4HW0A 2ETHA 4KYWA 3JAMK 3H3ZA 3RPQA 2GZWA 1JGSA 1MZBA 3K2ZA 4A0ZA 3KP7A 3KFWX 2EWNA 1XN7A 2ISYA 4HF0A 4P96A 4UV9A 4HOBA 1HSTA 2VN2A 4HV5A 3LAJA 4EV0A 4QLCU 2XROA 2PEXA 1UB9A 2Z33A 2ZMEA 1ZLJA 1S29A 1HW1A 3I59B 3BJ6A 3MZHA 2CSOA 3ZMUA 1SD6A 2NRAC 3SXYA 5BQTA 4YIFA 2RC4A 4A5MA 1O3QA 3IRQA 5AONA 5E17F 2C6YA 2E1CA 3E97A 3ABTA 3L00A 4P5OA 1G3WA 2J5OA 1T38A 2P5LC 3V8JA 1ZREA 2OQRA 5L3DA 4HZFA 4S05A 1YYVA 2WTEA 4HDUA 1ZLKA 3ML6A 1R00A 4OINF 2A61A 1LDKB 1HW2A 4U7BA 1ZG5A 1XMAA 1BI0A 3ECHA 4Q47A 1XGSA 5D8LB 3HTUA 5F6FA 3TKYA 4CYDA 4I09A 2VE8A 2L02A 4LFUA 4L9TA 2QUFA 3O3KA 2VT3A 2OQGA 1ZRFA 4G9YA 4EM0B 3T5XA 4RAZA 3DFGA 2E1NA 3HSFA 2HDCA 4PZJA 1W5TA 4KIBA 3TDUC 3EETA 4LGWA 2GQQA 3AAFA 1LNWA 2VBZA 2FXAA 3E5XA 2A69F 2DQRA 2QVOA 4R1HA 1IW7F 5ILSA 1D5VA 1HXDA 2PQ8A 5D5WB 3WGGA 5DYMA 3BY6A 1K78B 2B0LA 3GFJA 2EJRA 3BPXA 2EFQA 4L9VA 2D1HA 5K5RA 2QENA 3FXRA 2OAZA 4HYEA 5E18F 2PLYA 2BYVE 3U9GA 1PP7U 2VC0A 2HR3A 1STZA 5CVRA 3JW4A 2IPQX 3FM5A 2E7XA 1ULYA 3I71A 1IXSB 2ISZA 4L5JA 4OU0A 1U5TB 4N9IA 3ISPA 3VEPA 2DLLA 2V1XA 3LA3A 1FP2A 5DV5A 3IC7A 3JAMZ 1F4KA 1S7OA 3FMRA 1CF7A 3C18A 1USTA 2R7FA 1OYIA 3DPTA 3DKWA 3KE2A 1PUEE 2W84A 5BPIA 4KICA 2DO7A 2IA2A 4JQFA 4XBFA 1IAWA 1HKTA 3M8FA 1GXQA 2HOEA 3DF8A 3CJNA 2QBYB 5CLSA 2JRTA 4IJAA 1XCBA 5CVUA 3GFLA 3MZYA 1FWZA 5L3CA 2OD5A 4RGUA 4ZYGA 4N9HA 5HS8A 4Y13A 5E1WA 4ESFA 2HTSA 1RUOA 2OU2A 4UXNA 2K4JA 3RDIA 1EH6A 3RJPA 3MAJA 4YIIA 3COAC 2P6TA 4I0AA 2Z3YA 4I2OA 2GAUA 4IRIA 2ESHA 4L9JA 1JHHA 4OIPF 2FOKA 1FPQA 4HAMA 1Z91A 1KQ9A 3U2RA 5BOXA 3RPUA 3VOEA 5LHGA 4L5IA 1IF1A 3F72A 1KQ8A 5LEJA 4LK1F 1IN4A 4EGZA 1RI7A 2W85A 1FLIA 2D1VA 4HF1A 2DK8A 5LRRA 5E1XA 2H6CA 1CGPA 1FBSA 1EH8A 5D6EA 3LA7A 2IRFG 1U5TC 4BXUA 4IHTA 1OPCA 1RIOH 2RKHA 2CO5A 1GHCA 2ZJ2A 1DPRA 2O03A 3HHHA 1IN6A 2V6CA 1W7PD 1SD4A 1CF7B 4MHGA 2FSWA 5ICCA 1LJ9A 2P8TA 1TW2A 4FT8A 1MJBA 1WRJA 2F5EA 4ZZLA 4GYGA 5L3GA 2DPUA 4G7HF 1W7PA 3RI4A 3E6CC 5LHHA 1L3LA 4BHPA 1FP1D 2K27A 2MH9A 6PAXA 2EFPA 3EQLF 4M6XA 1QQIA 2HKXA 1QNTA 3V8LA 5FLXK 1Z6RA 1KA8A 3TDZC 2HS5A 2YU3A 1XCVA 2DT5A 1FBUA 4UVAA 2F5CA 2XHKA 2M87A 2P7VB 3DV8A 1BOAA 3WTUC 1XMKA 1XSDA 1OMIA 3U1DA 3DPLC 2Z9OA 1QBJA 3GO5A 4LJZF 2QZ8A 2A5YB 3GYHX 4MEYF 3WE3A 3ZMVA 4LB6B 1WWXA 1SD5A 3J7AO 3ERED 4KNYA 3KETA 3B73A 1V4RA 3BP8A 3I54A 1EH7A 3ZN0A 2IT0A 1RUNA 3F8CA 4EGYA 4OIQF 2XUBA 2O0YA 2W57A 2V9VA 1K79A 3BOQA 3M1EA 3F22A 4ESJA 3J80Z 3WODF 4RB2C 3WTXC 2MD5A 2PG4A 4GXOA 1B59A 1DPUA 3SHFA 1YW9A 2EV5A 4M74A 1YG2A 1I1SA 2UXNA 3MEXA 1FYLA 3F23A 1O3RA 1ZHFA 2Y48A 1U78A 4MQ9F 3IKTA 4R8HA 1R5GA 3OV8A 1BC8C 1IRFA 2VE9A 3I5UA 3C7JA 1ZN2A 3BPVA 4KT5C 2Y0MA 1K6OA 1BI2A 3K1PA 1Z6TA 1LQ1A 3PFIA 2RNJA 4P9FA 4HLYA 2MLKA 3HHGA 2A3SA 1A04A 2E7WA 3ZMZA 2QQBA 1UCRA 5FFZA 1F5TA 3RTRA 3EUHA 5FO5A 2P7CB 4Q4ZF 2GA1A 3GW2A 5K1YA 3E3VA 5ED4A 4BYYA 2NYXA 4B8XA 2K02A 2V79A 1FYMA 3D0SA 3E5QA 2YX7A 2HYGD 5DEQA 2A07F 5JI6A 2XKOA 1WQ2A 4M6YA 5CVJA 1J59A 4Y15A 1K78A 4I01A 5F1RA 1IXCA 2LSOA 3TQNA 4UNOA 1Z1DA 4ZYEA 3K69A 3DQVC 2L4MA 1LEAA 3GWZA 1B4AA 4MQVA 3BWGA 5L3FA 1BBYA 1UHMA 2LDUA 4A0YA 1HSJA 5FLXZ 2M8EA 2CQKA 1ZGJA 3BDDA 1FC3A 1R5HA 3E6BA 1U5TA 3GFIA 2UZKA 4HX7A 1P6RA 4HX4A 4G8XA 1R58A 4DQ2A 4A6EA 1PDNC 3P9KA 4KA4A 3BJAA 4JK1X 3QU3A 1YW7A 4D0PA 5ICEA 4B09A 3HTSB 5K5QA 5CVIA 3K1NA 4IHSA 1ZG1A 2MBFA 2Q0OA 4G7OF 3I64A 5KVRA 5D5XB 4YFNF 3V7CA 2QBYA 1YS7A 4FX4A 4G6QA 5EEGA 3ZMTA 3F8NA 3HSRA 5BPDA 2ELHA 4HA8A 5J8FA 4ETSA 1FT9A 3F21A 1T2KA 1KYWA 1SD7A 2BE5F 4G6DA 5HS7A 1DP7P 4LD5A 1T6SA 4I7HA 2IJLA 4HQEA 1DUXC 2M30A 2HEOA 4XSZF 4AVPA 2RGVA 3CO6C 1E17A 2COMA 1DDNA 2CYYA 4ENNA 4IPAA 4KMFA 5LGNA 1JHFA 1F1ZA 2YX4A 2HWVA 2XIGA 1LEBA 3E6DA 2W25A 1P4XA 2STTA 4HBLA 4AD9A 1L0OC 4WK8F 1KU9A 1D8JA 2YSRA 2X4HA 1O7LA 1FY7A 2HGCA 3M9AA 5A2QK 4UUVA 3KLOA 3CLOA 5HLGA 4U7DA 2WWYA 3VODA 3HRUA 2VT2A 2IA0A 2RVCA 4KIGA 3SQNA 2ZKZA 2DBBA 5CYVA 3W6KB 1W5SA 3BJOA 1UHWA 4BNCA 2Q8KA 2LF8A 3W6JB 5D8KB 5EEHA 1YW8A 2P6SA 3FWEA 2JSCA 1FSEA 4AIJA 4EVIA 4M71A 1U8RA 1Q1HA 5DDGA 3QP6A 2ZNZA 3I0TA 1FNNA 4RGSA 3WU0A 3LQRA 1B6AA 4LG0B 2NAZA 3ABUA 4ENJA 3WU1B 5ILVA 2R3SA 1RZ4A 2HKOA 4UV8A 2RQPA 2Q2EA 2IA1A 3HUGA 2IVMA 1R22A 2MA3A 2KKOA 4A12A 2VBXA 1IUYA 1HKQA 2PJPA 2ZXJA 3SZTA 3REOA 2LNBA 4M9XA 1JXSA 3M8EA 3J80K 2KJCA 3PQKA 3GZ5A 3HOTA 5ICFA 3IL2A 3L9FA 1GVJA 1R1VA 1MKMA 3R0JA 1HW5A 2PBIA 2CFXA 3E5UA 4BH9A 2JTVA 3EYYA 3QAHA 2D2WA 3I4PA 3MFKA 2ESNA 1J7KA 3P9IA 1G3SA 3TGNA 3GEZA 3QRFF 3FX3A 1KYZA 4RB3C 3HIFA 4NQWA 5HLIA 3KP6A 1OR7A 3ROUA 4BHCA 3RKWA 2XVCA 3L7WA 2Z99A 4RB1A 4NB5A 1S3JA 3GVAA 4OIOF 2H27A 4HDVA 3KZYA 2G7UA 2WV0A 2Y75A 3C1DA 4RS8A 2KJBA 4WXDA 5DD8A 1FSHA 3GZ6A 1G4DA 5FFXA 5FB2A 2ADUA 3FM3A 5LGTA 3DP7A 3FZVA 3JTHA 3FHZA 1XB4A 2ZFWA 2O8XA 1V3FA 4HQMA 2XKPA 4LLLA 3V7RA 4S04A 3LQQA 4MTDA 2PN6A 5D5UB 1J2XA 1IN5A 1SFUA 4YG2F 5A2QZ 1BIBA 3TO7A 3JSPA 4KMUX 4XLPF 2R7DA 2PFBA 4EJOA 4H0EA 2PMHA 4IVNA 1Z9CA 4M9ZA 3N97A 4HV6A 4NHJA 3Q5FA 5DUKA 3RIRA 3LWFA 2XAHA 3KP3A 1ZYRF 4JBAA 1NHAA 2YR2A 1KU2A 1R36A 5TRDA 2HTJA 1F9NA 4EJVA 1VTNC 1G6NA 1I1GA 4RAYA 4ZZDA 2XAJA 1MD0A 5FD5A 4M73A 1BC7C 3GFMA 1YFHA 3KP4A 2OZUA 2IW5A 5HLHA 2MC3A 5L3BA 3ZMDA 2P5VA 3HSEA 1R1TA 4DNCA 2TDXA 3T8TA 4WWCA 4CXFA 2XASA 2VODA 2EA4A 1HQCA 1LDDA 3MCZA 2KIMA 1P4AA 2K4BA 3BZ6A 3NRVA 4IRGA 4U0VA 1FBQA 2QM3A 5AIQA 2PI0A 2DTRA 2FRHA 1B9NA 2M5WA 2OA4A 4O3MA 1BJAA 5KK1A 1D8KA 3TO6A 3ZP5A 2RV8A 2G7HA 2FMYA 4TV7A 2A6EF 2GWRA 2NS0A 1TBXA 2AXLA 4MNUA 3T8RA 3IWFA 1HBXG 3FMSA 1XGNA 1Z05A 1JE8A 3WGHA 2HFHA 3T0YA 3T1BA 5HDNA 1ZGAA 4HF2A 3HRMA 1T39A 1TTYA 4QWQA 1I27A 2VBYA 4N0BA 5IT9K 3D5LA 4CICA 4KN4X 2V1DA 2FA5A 4F7ZA 1XDUA 1YQAA 3GXOA 3CUOA 3EDPA 3TOBA 3R6SA 3GX4X 3L2CA 1QZYA 1IRGA 4IRHA 1AWCA 1SFEA 1MDMA 3K9TA 1MJAA 4FHTA 4WCGA 3MQ0A 1H0MA 4Q48A 1ZAOA 4EMSA 2CGPA 2K7LA 4G7ZF 4M72A 4LMYA 4ZH4F 2DPDA 2MLGA 1ZG3A 1J5YA 4ASNA 4YFXF 1LVAA 5DUIA 2G9WA 5D6FA 2M1BA 3I53A 5DCMA 5H20A 2EFNA 4A0XA 3I58A 5DCFA 5HOOA 3KLNA 1IN8A 3F8FA 4MTEA 3R60A 3IRRA 2EK5A 1REPC 2GIVA 4PDKA 3QPTA 3GUDA 2DQLA 4U0YA 1ON2A 3ZQ7A 5ILUA 5LEKA 2ZNYA 1O57A 3HRSA 2F5DA 3H3UA 3CUQB 3O2PE 2P5KA 5DD4A 2QQ9A 2GXBA 1SFXA 4M9SA 2FNPA 3OOPA 1LB2A 5JFRA 2QYOA 2YPRA 1TLHB 4LG0A 5CJ9A 1S7AA 2EA2A 2QQAA 3DXJF 2HYFA 5IT3A 4WX9A 2EFOA 2UWMA 1USSA 2FE3A 5D4SA 4YFKF 2FMLA 5E1ZB 3N4MA 3EYIA 5BMZA 2L01A 1P2FA 1TNSA 1ODDA 1ZARA 1H9GA 5JR3A 4CZZA 3Q9SA 4BQAA 5H6QA 2NNYA 2FEZA 3O6BB 1MDMB 2W24A 1TNTA 2VC1A 4RB0A 1WKMA 3WGIA 1XSVA 3R0AA 1XD7A 4GYIA 2F2EA 4UVCA 5AIPA 3IKVA 3GLXA 1QPMA 3RKXA 4LLGF 1G3YA 5K5OA 1S8NA 1OKRA 2JT1A 4L0YB 5DCMB 2HQNA 4ZYHA 3P7NA 4KUMA 5BS6A 3KEQA 2ZO4A 3F3XA 1XGMA 1R7JA 3WTZA 2DK5A 2FBKA 5LLQA
chains in the Genus database with same CATH superfamily
5IT9Z 4ESBA 2GBYA 2ZMEB 3J81K 2A5WA 4V19K 4EJWA 4AIKA 4PFOA 2R7QA 3TOAA 3WTYC 1I6HJ 3ZQFA 2OBPA 3C2HA 4YRVA 2MC4A 3MMYB 4LIUA 3GTLJ 3HOYJ 1FOXA 3E0JB 1J0RA 2EV6A 1SVOA 2CW7A 1LE8B 2PMZA 4BQNA 3BR3A 3CUQC 5DM6F 3RYPA 4A3BJ 2A68F 2OC6A 5J8CA 4UUSA 1W36C 1SMYF 3SFZA 4L18B 4ENMA 1VF9A 3LFKA 1U6GA 1QO0D 3FXUA 5HS9A 4WXHA 3OYKA 1JT0A 1O3TA 1MJ9A 4AWXB 1FEXA 2P4WA 3K1MA 2HOSA 4LLNA 2BV6A 2CUZA 1WI9A 2VKVA 2HI3A 2RDPA 3AKZA 2BY0A 4GGGA 1WJDA 1FIAA 4KFCA 3ZN1A 1QU3A 1K4TA 4I76A 3F8BA 1ZRCA 1BM9A 3K2AA 1I6XA 3ZGKA 5GAEJ 1U8BA 1K7AA 1SVLA 2DYSH 4XKCA 1R1UA 3JRFA 4I0BA 3H0DA 1WJ5A 1BR1A 2KIFA 1P92A 2EQRA 2LF7A 2KRFA 4A2UA 4O5VA 1ZH5A 1A36A 1BI1A 5HNFA 4UY8I 5E8GA 4EJTA 5JVTA 2KIQA 4P55A 3W2VA 4ZDOA 4Z2YA 1VNDA 4CO8A 4OMZA 3ASNH 1FYKA 1SAXA 1BR4A 5J6XA 1OYYA 3BROA 4AIHA 4PJMA 1QZZA 4I6ZA 2HQRA 1JUSA 2H09A 2M45A 3H0GJ 5JHUA 2VXZA 3S93A 3LFUA 5E3MA 4GFBA 3TO9A 4JX5A 3WU2C 3WTWC 1VQ8I 4RLFA 2QKMB 2K86A 2VBWA 3JRCA 2DDBA 1SC7A 4X1EA 3BG5A 2E71A 2WY7Q 2KT0A 2ZXHA 2FBIA 3SZPA 4JYKA 2EV0A 1YS6A 3CCVI 1EV7A 3I55I 2O6GE 3KP2A 2DA4A 3PFYA 2E35A 2LBFB 3DKXA 2Z5UA 1TWHJ 4EM2A 3OYFA 3GF2A 2Y30A 3M7GA 3P9CA 1YX3A 1JTYA 1W4MA 5ERIA 2DA3A 1C0WA 2CV2A 1OQYA 4I98B 4XORA 2BGCA 1WH5A 3FF5A 4IHWA 3WTVC 2WA0A 4PCQA 4BE2A 1BI3A 1N75A 4E70A 3CF5F 3S3NA 4O3MA 1J09A 3S2DJ 2WBMA 2LKPA 4ZYDA 4MFEA 4J19A 1YO5C 1X1PA 3JSOA 3HPGA 1X3WB 1TT0A 1IXRC 4EJUA 2D5VA 2V6EA 4EM1A 3M3YJ 2UXXA 3S8PA 3HG9A 2PMZN 1Y39A 1DGWY 3KYCB 3VB2A 1XGOA 2HXIA 1D3YA 5IP6A 5EGOB 3CCLI 2BOLA 4PK4A 1JJ6C 3IAM2 1SMTA 1YTYA 4J01A 5LBQA 2MFZA 5TGTA 2ZMEC 4A5NA 2XV4S 2FNAA 2WV1A 3CDIA 5HDKA 3S16J 1VQ6I 2LK2A 1TQPA 3FIWA 2IP2A 4YEJA 3SEZA 1TQMA 4RLQA 4WXCA 3S15J 1Z7UA 3A1YA 5TJJA 4U0WA 3CC4I 5FGMA 2JRMA 4ZDLA 3ZMSA 4O6JA 2R7OA 3LOCA 5FD6A 4EQQA 2DAOA 5IYCJ 5FRMA 2ZCWA 4NNJA 4RMNA 2VJJA 3NARA 3WTSC 3DEWA 3GZNB 1YJWI 4V2GA 3CJRB 4HX8A 2XDVA 2DJIA 1X3UA 2O5RA 2F5VA 5JLXA 4QTRA 1T0FA 1O7FA 2WC2A 1KQ0A 3CDHA 3PQJA 4XLNF 1WGXA 2CUEA 2DA2A 2LOOA 3BTCA 4FQGA 5L3EA 2K85A 1BW5A 2L54A 4XIDA 2BBYA 1MMSA 4PJJA 2O61A 2AS5F 1RNLA 2JWTA 2VOPA 3FXQA 2E5ZA 3ECOA 3F6OA 1ZRDA 2O9LA 3PL8A 4ZTJA 3ERMA 3F6VA 2VONA 3IHUA 2JA5J 3H92A 2I8DA 1X1CA 1SFOJ 1TQIA 2HYJA 4P9UA 5M5YJ 2D45A 1E2XA 4AVZA 1WSUA 3DTKA 4GO1A 3HOZJ 2X6YA 3IWZA 3OOUA 1TP4A 4Y33A 5C4XJ 2DI3A 3WE2A 4CCNA 3G73A 2H1LA 3CLQA 3DTIA 5H6RA 4LB5A 4XL9A 2XPVA 4BUPA 3LSTA 5LHIA 4IF4A 3LSRA 3QPHA 5HDGA 2PX9A 2EILH 2FF4A 4XQFA 2EB7A 2AXTC 3GMEA 3RKYA 1B9MA 3OYDA 2JPCA 2H94A 1X2NA 2X6OA 3B02A 3SDBA 2ID3A 4CGZA 5M5XJ 2V1UA 1UFMA 3TMOA 3KP5A 3U1KA 3PSFA 4BKXA 3S1QJ 5E20A 3J81Z 2QWWA 3D5SC 3G1LA 3QU6A 3VFZA 3WTTC 2Y31A 2LH9A 1OYWA 3ZQQA 4BAYA 3ASOH 4E7SA 4LIVA 1T98A 4XSXF 4HLXA 2MH2A 2XAQA 5C3EJ 1I5ZA 2GA2A 3C3WA 1IDYA 1E3HA 2F5FA 1R23A 2VPRA 2EFWA 4IXAA 1F43A 3QYFA 4MO7A 1GXPA 1J75A 1U2WA 3UR3C 2FQ3A 3CTAA 3S1RJ 4A69C 4OMYA 5IY5H 2XC7A 4UVBA 1U3EM 2JZYA 3MWMA 4MEXF 1QHGA 5EEAA 2XRNA 1KGSA 5HODA 2E1OA 1G59A 3ELKA 3L09A 4Q5SF 2EIKH 1G8XA 2DFIA 2L4AA 2XGXA 5FKMA 1ON1A 3DEUA 4OIRF 4YIRX 1HKSA 5F64A 4XRFA 3BZKA 4GCVA 1HOMA 1FX7A 1WJEA 2A05A 1UJ8A 5D5VB 1BJZA 2BEOA 2F48A 2WAQA 1RR8C 4MIMA 1H9TA 2LP0A 2COBA 1BN5A 1IUFA 3C2GA 2STWA 4KDPA 2J5PA 2WAEA 5CVVA 1GV2A 2Q1ZB 3QP5A 3KZIC 4BGDA 3WG9A 3P5JA 4R79A 3TW6A 2ZBKA 2XRLA 4CZCA 3G1OA 2NOGA 3OSFA 3HYIA 2ID6A 2CG4A 3H5AA 5J40A 3K0LA 5IYBJ 2LKSA 3S2WA 2R7XA 1G3TA 1YLFA 2VOOA 2KRHA 5D4RA 2WADA 1FOKA 2LFBA 2P0WA 3CMAI 1W36D 1S7EA 3KEOA 4FX0A 2I5UA 3I59A 1AKHA 3OL3A 4I99C 2HNHA 4CUGA 1HC8A 1MGTA 2CW0F 4KIFA 2KIUA 3R61A 3EUAA 4CHUA 3VDXA 4OOIA 4UHTA 4U88A 3CCSI 1H88C 2DCEA 3KZZA 2FUG2 1O3SA 1XS9A 2DODA 4K2EA 4MGRA 4HSRA 1S6LA 3BT9A 1UHSA 3CUQA 1YIOA 3FMQA 4QPOA 5IPAA 1GT0C 2L7KA 2XAFA 3LAPA 2NNNA 4MFDA 3CP8A 3ULQB 2JN6A 3K70C 4Y17A 5LGUA 3NQOA 2X0LA 4I02A 2L3DA 2VIXA 3JRAA 1LKXA 2H6BA 1ONVA 3V7SA 5HVQC 1MIJA 3HZJA 3HOSA 3V8KA 3H9QA 2HZTA 2DMUA 2ZB9A 2FX0A 3CO7C 2E2JJ 1GV5A 3Q9VA 1IGNA 2ACJA 2CWEA 4RGRA 4A6DA 3OIPA 3UNGC 3GTQJ 4PGGA 2GXGA 1BIAA 1IN7A 1FMWA 2JK3A 3K6GA 4RGXA 2JMWA 4BHBA 2DW4A 4L9NA 3B6CA 2GIZA 3G3ZA 1XX5A 4IZZA 4PGHA 1Q1VA 4ON0A 3JTGA 4LK0F 2ZXIA 3MKYB 2JPBA 3ZPLA 1W7PB 1AOYA 2CH0A 1B1BA 1QGPA 1OFCX 2RN7A 1LVKA 2PMUA 2E2IJ 4L0ZB 3HBLA 3H5NA 2R4GA 5E8IA 3RQ4A 3V4GA 3S2HJ 1D1CA 4ENKA 1WFXA 1B8IB 3W2AA 1J9IA 2K9NA 4D5CA 2DN0A 3S14J 4XR6A 1P4WA 5LRSA 4WF2A 2TRTA 2WAQN 4A3GJ 2CS3A 3FBNB 3TP3A 1PP8F 1TW3A 2KDOA 2OZ6A 2DU9A 2XAGA 4CDGA 1XSXA 3E6MA 5ICGA 5JLWA 1S72I 3NEUA 4KN7X 2R5YA 2IGNA 2QLZA 2K9QA 1KU7A 2WAFA 1XDSA 1LDJA 2WY8Q 3KCCA 4G94A 5E3OA 2O3FA 3GLLA 4V2FA 2DXIA 3QOPA 1OCZH 1Y0UA 1FZPB 1IZ1A 3ESWB 2A6HF 2HDDA 2FU4A 1KU3A 2XSDC 3F8MA 1X1BA 3R4KA 4E7IA 3HRTA 3LA2A 2VLAA 1YX5A 1Z3YA 3RYRA 4A3IJ 4HW0A 2ETHA 4KYWA 3VPRA 4BACA 3JAMK 3H3ZA 4IKFA 3RPQA 3BZCA 2GZWA 1JGSA 2OJED 3H9JA 4E7HA 1MZBA 3K2ZA 4A0ZA 3KP7A 3KFWX 2EWNA 1XN7A 1A6QA 2LD5A 2ISYA 3BR2A 2R5ZB 3DTEA 2KPMA 3ABLH 2JVHA 4HF0A 4P96A 4UV9A 4HOBA 1GUUA 5GTHC 1HSTA 2K9SA 1WPKA 2HOTA 2ELJA 2VN2A 4HV5A 3CP2A 3FXOA 4EV0A 4NC8A 3LAJA 4QLCU 1FTZA 2XROA 2PEXA 1UB9A 2DFEA 4C3HJ 1TWCJ 2Z33A 2ZMEA 1MNDA 1ZLJA 1S29A 1VQNI 1HW1A 3I59B 2YU9J 2RAEA 3BJ6A 3AFHA 3H5RA 3MZHA 2CSOA 3ZMUA 3KYLA 1SD6A 2NRAC 3SXYA 5BQTA 4PSWA 4YIFA 2RC4A 4A5MA 1O3QA 3IRQA 5AONA 2LG4A 5E17F 1ZGWA 2ZXWH 3M07A 2C6YA 4Y7NJ 2E1CA 2OPTA 3BC8A 3OYHA 3E97A 3ABTA 3W6VA 2HVSA 3L00A 4P5OA 1G3WA 2J5OA 1T38A 1K4SA 2P5LC 3DBLB 1GLNA 4DW6A 3V8JA 2W1OA 2OQRA 1ZREA 3CESA 3DBHB 5L3DA 4HZFA 4S05A 1YYVA 2WTEA 4HDUA 1ZLKA 3F0CA 4F91B 3ML6A 1QVUA 1R00A 4OINF 1ZELA 4F52A 2A61A 2X9DA 1LDKB 2BY2A 4DYCA 1HW2A 4U7BA 4BBSJ 4F93B 1SAUA 1ZG5A 3OL4A 3HGYA 5C4JJ 1XMAA 1BI0A 3ECHA 2VPLA 3FXJA 3TW7A 2OF7A 4Q47A 3GTMJ 1XGSA 5D8LB 2AQEA 3HTUA 1BW6A 5F6FA 3A01B 3TKYA 4CYDA 1QRYA 4I09A 4AUXA 2VE8A 2L02A 2HPMA 4LFUA 2DOAA 4L9TA 2QUFA 3O3KA 1X3ZB 3JRHA 4BXXJ 3SFIA 2VT3A 2OQGA 1ZRFA 1V54H 4G9YA 3HDDA 1V5GA 2OCCH 4EM0B 3FXKA 4B4CA 3T5XA 3S1MJ 4RAZA 3JRGA 3DFGA 2R5YB 5K7ZA 1MW7A 2UV1A 3HEFA 2E1NA 2HOAA 3HSFA 1UMQA 2HDCA 3Q0WA 2DFFA 3OYNA 2VASA 4PZJA 1W5TA 3LSJA 1MBHA 3G6EI 3F9KA 4KIBA 3IAS2 1OCOH 1HCRA 3TDUC 3A0HC 3G4SI 3EETA 4LGWA 2XB0X 2Y69H 2GQQA 3AAFA 1LNWA 3I4MJ 3A4CA 4XN0A 2VBZA 2DJNA 1RKTA 2EIJH 4IQJA 2GXAA 1MSFC 2FXAA 3E5XA 3SJMA 4BY7J 2A69F 2VUMJ 2CMPA 2IBDA 2DQRA 2KMUA 3VYRB 2QVOA 4R1HA 5EGOA 1IW7F 5ILSA 1EA3A 1HXDA 1Z67A 2P81A 3CZ6A 4C3JJ 4OAZA 4XN3A 5EF6A 2PQ8A 1OCRH 5D5WB 1XMXA 3WGGA 5DYMA 3BY6A 2JA2A 1K78B 2B0LA 3AG2H 3GFJA 2XB5A 1YIJI 2EJRA 3BPXA 1I39A 2EFQA 2HZDA 2VJ5A 4L9VA 2D1HA 1N25A 5K5RA 2QENA 3FXRA 3QQAA 2OAZA 2XF7A 4HYEA 5HNHA 5E18F 1UZCA 2PLYA 2BYVE 2K5CA 3K70D 3U9GA 1PP7U 2VC0A 3CMYA 4DBQA 1IJWC 3DKYA 2HR3A 3QODA 3K4JA 4AM3A 1STZA 5CVRA 3JW4A 3H35A 2IPQX 3JRIA 1ETVA 3FM5A 2E7XA 5DTDA 1ULYA 3I71A 2QSGX 1TZLA 1IXSB 1G2HA 2ISZA 4L5JA 4H4KC 4OU0A 2LREA 4PFPA 1U5TB 3W3CA 4N9IA 3ISPA 4IX7A 3UKGA 3HKZN 4HRIA 3VEPA 1YE9A 2DLLA 2B9SA 2V1XA 3LA3A 1FMVA 3L1PA 1FP2A 5DV5A 3IC7A 2X1EA 2WB1A 3JAMZ 1HA8A 1F4KA 1S7OA 3HOWJ 3FMRA 2ZSIB 1MBKA 3FKJA 1CF7A 3C18A 3H9GA 3RSNA 2IGOA 1USTA 1Y1VJ 2R7FA 3ZRGA 1OYIA 3DPTA 3H1CA 2KL4A 3DKWA 3KE2A 1MBEA 4BJ6C 1BOBA 2DYRH 4CCMA 5K7FA 1PUEE 1JUPA 1H8AC 2W84A 2NS8A 2M34A 5BPIA 4KICA 2DO7A 2IA2A 4JQFA 4XBFA 1IAWA 1HKTA 3M8FA 3BCBA 1GXQA 2HOEA 3PIOF 4IOAF 3DF8A 3K4LA 2BXYA 5CQGA 4XRSA 2LRDA 3CJNA 5F1JA 3LSGA 2CQ7A 2EIMH 2VQLA 3FK7A 2QBYB 5CLSA 2W00A 2IEKA 1RESA 2JRTA 4IJAA 1XCBA 3GFLA 4RAFA 5CVUA 3OYLA 2DMNA 3KYDB 3MZYA 3K4CA 1FWZA 2NS7A 2DA6A 1P7IA 5L3CA 1LUJB 2OD5A 4RGUA 4ZYGA 1OLTA 4QIWN 4ITVA 4N9HA 2QSFX 4XNFA 1V5EA 3OSGA 3KEYA 5HS8A 4Y13A 2BY3A 3WG7H 5E1WA 2L7MP 2HTSA 4ESFA 1RUOA 2V1NA 2OU2A 4UXNA 1KZHA 3FBIB 1TWGJ 2K4JA 3E7LA 3RDIA 2O8KA 1EH6A 3EUHC 3RJPA 1DQUA 5E3NA 3RPUD 3MAJA 3D5RC 4YIIA 3COAC 3DCFA 2K9MA 3TEDA 2P6TA 4I0AA 2Z3YA 4I2OA 3RQIA 2GAUA 2Z1DA 4IRIA 2ESHA 2MGQA 4RA2A 4L9JA 1HDPA 5M5WJ 1JHHA 1XTAA 1H89C 4OIPF 1ITYA 2FOKA 3CQZJ 1FPQA 1FIPA 2M4KA 4HAMA 1Z91A 1KQ9A 4JP0A 1MMNA 3U2RA 5BOXA 3RPUA 5E79C 3M1CA 4A3JJ 3EUKL 1ETXA 1ZTRA 3NAUA 3VOEA 5LHGA 2IS4A 4L5IA 1IF1A 1TC3C 3F72A 1KQ8A 4BEHB 1V5FA 1JGGA 5LEJA 2L5QA 4LK1F 1IN4A 2EINH 4XK4A 2HQ5A 2WB1N 3I4NJ 2HPIA 2QQ8A 4EGZA 1RI7A 1EKEA 2W85A 2D1VA 1FLIA 4HF1A 2DK8A 5LRRA 5E1XA 2FQ4A 2H6CA 3W2WA 2IS2A 1CGPA 1X19A 1FBSA 3OYJA 1EH8A 3CMMA 5D6EA 1VI0A 3I9V2 1A5JA 1WVRA 3LA7A 1VQLI 2IRFG 2FOWA 1U5TC 1ACIA 4BXUA 4IHTA 1YRNB 3MZ8A 2BVMA 1OPCA 1RIOH 2RKHA 2CO5A 1GHCA 2ZJ2A 1DPRA 2JJ7A 2O03A 4ZTFA 2NVXJ 3HHHA 2QCOA 1F36A 1Z3XA 4NDLA 2ZJRF 1IN6A 3O8HA 2M2EA 3MVPA 5J1UA 2V6CA 1W7PD 1SD4A 1CF7B 4MHGA 2FSWA 1CQTA 5ICCA 2E5NA 1W1WE 2MYSA 4DGWB 1LJ9A 4J00A 2P8TA 3CCUI 1TW2A 4FT8A 1MJBA 1WRJA 3BCAA 2F5EA 2VQGA 3PNYA 4AYBA 4ZZLA 2HU9A 4GYGA 5L3GA 2DPUA 4M3EA 1VZ0A 3CC2I 4G7HF 3BG6A 2VQHA 2XPWA 1W7PA 2H1KA 2OTJI 2Y9YA 4E7LA 3RI4A 3E6CC 2Q2EB 5LHHA 2CRGA 3ONQA 5EG0B 2XGCA 2DA7A 3ZQGA 1L3LA 1B8IA 4LITA 3AG1H 1FP1D 3HJEA 2K27A 2MH9A 2NVYJ 4NC7A 4P1WA 4BHPA 4BQOA 1POGA 5CQEA 6PAXA 2EFPA 3EQLF 1DU6A 3BG9A 3JCUC 2EZKA 1BA5A 3RZDJ 4M6XA 1QPIA 1W0TA 1QQIA 2HXOA 2X6WA 2HKXA 3HPHA 1QNTA 3V8LA 2X85A 5FLXK 1Z6RA 5LFAA 1KA8A 3TDZC 2HS5A 3A03A 2YU3A 2FJ1A 1XCVA 2CFOA 1MMDA 2DT5A 3PUFA 4HNVA 1DU0A 1FBUA 1R4NB 4UVAA 3LSPA 2DTZA 2F5CA 2XHKA 4Y3OA 4M3BA 4CSWA 2M87A 3LL7A 2P7VB 3HXLA 3DV8A 1JUMA 1BOAA 3WTUC 1Y8QB 1O4XA 1XMKA 3VSKA 1R6RA 1XSDA 1OMIA 2R5ZA 3U1DA 3DPLC 4DIQA 2Z9OA 1NG6A 2EPFA 1LPQA 5B66C 1QBJA 3GTGJ 3GO5A 4LJZF 3HL2A 1TWFJ 1V55H 2QZ8A 2JA6J 2A5YB 3M4OJ 5FRNA 3SYTA 3GYHX 4MEYF 3WE3A 3ZMVA 1JKPC 2HDWA 4LB6B 1WWXA 4IQ4A 1SD5A 4FETA 3JREA 4PJLA 3IH4A 3VSLA 3J7AO 3ERED 4KNYA 5F0HA 1MBFA 1T08B 1QVTA 1MH3A 3KETA 4UB8C 3B73A 1V4RA 1Y56A 3BP8A 2QSHX 3I54A 4BJTA 1LFPA 4D5FA 1EH7A 3GTKJ 3ZN0A 2M7AA 2MD0A 3RZOJ 5J3LA 2IT0A 1RUNA 3F8CA 4EGYA 4CYCB 5M3FJ 4OIQF 2BW3B 2XUBA 3TL4X 2O0YA 2KQRA 4AYBN 1IRZA 2W57A 4PSXA 2HVQA 2V9VA 3OYEA 1K79A 3BOQA 3M1EA 4KT6A 2NVQJ 3F22A 4ESJA 1ZR2A 3J80Z 3WODF 1LFBA 2B7EA 4RM3A 4RB2C 3SDGA 4B44A 3WTXC 4LG3A 2MD5A 1Z21A 3OMYA 1Z77A 1N77A 3VWBA 4EATA 2PG4A 1IG7A 4GXOA 1B59A 4B48A 1DPUA 2H8RA 3SHFA 2M9HA 1KONA 1YW9A 2V26A 1MBJA 2EV5A 3QOEA 4M74A 3PO2J 1YG2A 1I1SA 2GLOA 4BS9A 2UXNA 3MEXA 1FYLA 3F23A 2VJ4A 3PNTA 3CF2A 1O3RA 2RNGA 1ZHFA 2Y48A 3DU5A 4MQ9F 1U78A 3IKTA 4UUTA 3U21A 1WJAA 2V9KA 4R8HA 3A01A 1R5GA 3OV8A 1BC8C 4FASD 2V9PA 1IRFA 4IEJA 3IH2A 2VE9A 2DMQA 2BZTA 4A3EJ 3I5UA 4D1QA 4A3LJ 3C7JA 1FTTA 1ZN2A 3MKWB 1IRXA 3BPVA 4KT5C 3PM1A 3QYEA 1FJLA 2Y0MA 1K6OA 1NK2P 5EYRA 1BI2A 3K1PA 2BVLA 1Z6TA 2DT6A 4C9YA 4A3MJ 1LQ1A 1OISA 3PFIA 2RNJA 3CDLA 4XKVA 4P9FA 1ZQ3P 2MSYA 4HLYA 4MLOA 2LY2A 2MLKA 4XLAA 3HHGA 1A04A 2A3SA 2E7WA 4AC0A 1IV6A 5DM7F 3ZMZA 4E4HA 2QQBA 1UCRA 5FFZA 1F5TA 3RTRA 3EUHA 5FO5A 2P7CB 2M7BA 2JA8J 3PUBA 4Q4ZF 2GA1A 3GW2A 1I3QJ 4D7MA 3OY9A 5K1YA 1PUFA 1BR2A 3E3VA 5ED4A 4BYYA 2NYXA 4B8XA 2K02A 1TL8A 2V79A 2AO9A 3J7ZI 2MABA 1FYMA 3D0SA 3E5QA 2YX7A 2HYGD 1X4PA 5DEQA 2ICWG 2A07F 5JI6A 2KHMA 2M3AA 2XKOA 1WQ2A 5IP9J 4M6YA 4N4OB 5CVJA 1A35A 1D1AA 2L9NA 2IXSA 1J59A 4DYQA 1YOVB 4Y15A 1K78A 1IO2A 2I10A 2QKLB 4B3AA 2HQAA 4I01A 5F1RA 3LMMA 1IXCA 2A6TA 1E3OC 1T56A 1UG2A 1JKQC 3PO3J 1HDDC 2LSOA 3TQNA 4UNOA 1Z1DA 1OCTC 4ZYEA 3K69A 1W5CC 3DQVC 2L4MA 1LEAA 2O7OA 3GWZA 1S9HA 3BQZA 1B4AA 1R49A 1U9NA 2IGKA 3HOUJ 4MQVA 2X51A 3BWGA 4XOPA 5L3FA 1BBYA 2DA5A 4ZYAA 1UHMA 1M1EB 5GPAA 3LSKA 2LDUA 4A0YA 3BTIA 2KISA 1HSJA 5EJCA 2ME6A 5FLXZ 2M8EA 1VQ7I 2CQKA 1XPXA 1ZGJA 2Z16A 3BDDA 4A3CJ 1FC3A 1R5HA 3E6BA 1U5TA 3GFIA 2UZKA 4HX7A 1P6RA 4HX4A 4ZDPA 2L0KA 4G8XA 1R58A 1OCPA 1K83J 2QF7A 4DQ2A 4A6EA 3OS1A 3S17J 4PUSA 4FISA 2K3FA 3BR5A 1PDNC 3B6AA 2CV0A 3P9KA 4F92B 3JRBA 3ABMH 2LR8A 2ECCA 4KA4A 4DJAA 4C2UA 3O8GA 4RM2A 2X1DA 3RKQA 3BJAA 4JK1X 4Z6YA 3QU3A 1YW7A 4D0PA 5ICEA 4B09A 2OCEA 3GTPJ 3HTSB 5K5QA 5CVIA 3K1NA 5FKOA 1X1AA 4IHSA 3BLYA 3A02A 1ZG1A 3OYGA 2MBFA 2Q0OA 2JSPA 4G7OF 3QYBA 3I64A 5KVRA 5B1BH 5D5XB 4ZJZA 4YFNF 1WJBA 3OWTA 3V7CA 2QBYA 1YS7A 4FX4A 5F0FA 4G6QA 5EEGA 2BY1A 3ZMTA 1DP3A 3F8NA 3HSRA 5BPDA 2ELHA 4HA8A 5CPRB 5J8FA 4ETSA 1FT9A 3F21A 1S5LC 2F4MB 1T2KA 1KYWA 2X1CA 5IOZA 1SD7A 1QHHD 3HC7A 2VKEA 2BE5F 4G6DA 1MMAA 5GAHJ 3CCJI 1R9TJ 5HS7A 1DP7P 1TWAJ 2MG4A 3SZGA 4LD5A 4C2TA 1T6SA 1YJ9I 4I7HA 2IJLA 4HQEA 3NWTA 1DUXC 2M30A 1X2MA 3C2BA 1PUFB 2HEOA 1E3PA 4XSZF 1MMGA 4AVPA 2RGVA 3CO6C 2JVGA 3FXMA 2RREA 1E17A 4XONA 2COMA 1DDNA 2CYYA 4ENNA 4IPAA 4KMFA 4NC6A 2W4SA 1JHFA 5LGNA 5E3LA 4BDZA 1F1ZA 2GOXB 2LMDA 2YX4A 2QGUA 4D7NA 2HWVA 2XIGA 4M3FA 1LEBA 3E6DA 2L9VA 2W25A 1P4XA 2EBIA 5IP7J 4AU7A 2STTA 4HBLA 9ANTA 4AD9A 2ZC2A 4E7KA 2ECBA 1A31A 3EPZA 1L0OC 4WK8F 2CUJA 3CCEI 1KU9A 1D8JA 2YSRA 2X4HA 4BEHA 1O7LA 4ZC3A 1FY7A 2HGCA 3M9AA 5A2QK 4DYRA 3KX2A 1U0JA 4B1RA 4UUVA 3KLOA 4IO9F 1GDTA 3CLOA 5HLGA 3BQYA 1UAAA 1Z7LA 4U7DA 2WWYA 3VODA 2R7WA 3HRUA 1ZR4A 5F04A 2VT2A 1P9QC 2IA0A 1JKRC 2RVCA 4KIGA 5FLVA 3SQNA 2ZKZA 2R7RA 1FOYA 1B72A 3DWLE 4JOMA 5EZGA 2DBBA 3CCQI 5CYVA 3W6KB 4BU2A 1W5SA 3BJOA 1UHWA 1T95A 4BNCA 4DOZA 2DOFA 2Q8KA 1YRNA 1JJ8C 2LF8A 3HB9A 3W6JB 5D8KB 5EEHA 2LYCA 1HLVA 4JX4A 1YW8A 3FXLA 5KAFC 1JT6A 2P6SA 5B1AH 3G1MA 2G0EA 3FWEA 2JSCA 4M3DA 1Y8RB 4BQQA 1FSEA 4C3IJ 4CCKA 4AIJA 4CA0A 2R7UA 3GCMA 4EVIA 4M71A 2E2HJ 1U8RA 1QA6A 2KDZA 1Q1HA 1K61A 4FE4A 5DDGA 2BHZA 4IHYA 3QP6A 2ZNZA 3I0TA 1FNNA 2GM4A 4RGSA 3WU0A 3I3LA 3SEQA 2W7NA 1ETKA 3LQRA 1B6AA 1RETA 1VQ9I 4LG0B 3PNVA 2NAZA 1D5VA 3ABUA 1ETQA 5C44J 2GOMA 4ENJA 3WU1B 5ILVA 2R3SA 1R71A 1IC8A 1X4OA 1RZ4A 2HKOA 4UV8A 2RQPA 2Q2EA 2IA1A 4RBOA 1RC9A 3AL0B 1MNEA 3HUGA 5JHFA 3OR1C 1D0ZA 1SVMA 2IVMA 5EG0A 4E7JA 1VQ4I 1R22A 3L2RA 4S0HB 3BR1A 2MA3A 4GRIA 3D1NI 1VQPI 3V42A 1U9OA 4JX6A 1XG1A 4XLHA 1P7JA 4PJ0C 2EH3A 2KKOA 4A12A 3MKZA 2VBXA 4C30A 1IUYA 4PJNA 1HKQA 5F27A 2M8GX 3ZR8X 2PJPA 2ZXJA 3G2BA 2DOEA 3SZTA 2YS9A 1IDZA 3REOA 2LNBA 5JVGF 4A93J 4M9XA 1JXSA 4KITB 1RRJA 3M8EA 2BXZA 2KJCA 3FISA 2XAUA 4HEA2 3J80K 2KFDA 2JQ7A 2CW8A 2CQNA 4B3XA 5KHDA 3PQKA 5J4VA 2VKHA 3GZ5A 3OYCA 3HOTA 5ICFA 3IL2A 3L9FA 1GVJA 2ZJQF 4F55A 2CJJA 4E6KG 1R1VA 1MKMA 4A3FJ 3R0JA 4IL6C 1HW5A 2PBIA 3VYSB 4IHXA 3K10A 2CFXA 2F4IA 3E5UA 4BH9A 2JTVA 3EYYA 5FJ8J 3QAHA 2D2WA 3I4PA 2ESNA 3MFKA 1AA7A 1J7KA 3P9IA 1MSEC 1N78A 1G3SA 2E19A 2LY9A 2L7ZA 3TGNA 4XRMA 3GEZA 3QRFF 3FX3A 1KYZA 5GAGJ 4RB3C 1UELB 3HIFA 1Z0XA 4NQWA 4XRSG 3DLAA 5J4YA 1RKWA 2E36A 5HLIA 1OR7A 3KP6A 4BE1A 3ROUA 4BHCA 2QA4I 2IGMA 1NG7A 1PVEA 3RKWA 2XVCA 3L7WA 1SEUA 2R7ZJ 3LSHA 2Z99A 3ZOBA 4RB1A 4NB5A 1S3JA 4RDUA 3GVAA 4OIOF 4CYCA 1B72B 2BW3A 2H27A 4N4NB 4HDVA 3KZYA 4M3GA 2G7UA 3JRDA 2WV0A 2Y75A 3C1DA 3WHBA 4RS8A 2KJBA 4WXDA 5DD8A 4KISA 4QPQA 4HNUA 4L5EA 1FSHA 2VB6A 4UUSB 4IHVA 3G71I 3GZ6A 1G4DA 3K4NA 5FFXA 1Y1WJ 4NBQA 1ZKGA 5FB2A 5IOYA 2H8WA 1WZ2A 3PJRA 2ADUA 2M0MA 3FM3A 5LGTA 5J1YA 1IV8A 3ZXSA 4B43A 2MW8A 3DP7A 3FZVA 3JTHA 3FHZA 2W82A 1XB4A 3ZQLA 2ZFWA 2DMTA 1V3FA 2O8XA 4XLEA 3HM5A 5GADJ 5EZHA 2F4OB 4HQMA 1I50J 2XKPA 1OJLA 4LLLA 4DZPA 3V7RA 4S04A 3L2WA 3LQQA 4BXFA 4E7ZA 3Q0VA 4MTDA 1MH4A 2E60A 3AL0C 5GPCA 2PN6A 2Y0SA 5D5UB 1J2XA 1IN5A 3HUGB 1SFUA 2ZFUA 4YG2F 5A2QZ 1BIBA 3TO7A 3JSPA 3VYUB 4KMUX 4XLPF 2R7DA 1NH3A 2PFBA 3K4BA 4EJOA 4H0EA 2ME0A 2PMHA 2JUGA 4IVNA 1K6YA 3ZQHA 3CJTB 1QZEA 1TT5B 3FKIJ 1EJ9A 1Z9CA 4M9ZA 3N97A 2BHYA 4HV6A 4NHJA 3Q5FA 5EDNA 5DUKA 3RIRA 3LWFA 2XAHA 3KP3A 1ZYRF 4JBAA 1NHAA 4BDYA 2YR2A 2XGEA 4ABZA 5F0CA 3ABKH 3S1NJ 1KU2A 4DBRA 1R36A 5TRDA 3AG3H 2HTJA 1F9NA 3BTJA 2PJRA 1WH7A 4EJVA 1VTNC 1G6NA 1I1GA 4RAYA 4BJ5C 1BL0A 4ZZDA 2VXDA 1VQ5I 1ETWA 2XAJA 5F08A 2LKXA 1MD0A 4XLFA 2LTPA 5FD5A 1W0UA 2XSJC 4M73A 1BC7C 3GTOJ 3NWSA 3GFMA 5M3MJ 4UB6C 1YFHA 4OAYA 4HNTA 3MN2A 3KP4A 5KAIC 2OZUA 4NUBA 2JUCA 2IW5A 5HLHA 2E1MB 2EZIA 1VQOI 4X6AJ 2MC3A 3ZQCA 3MD2A 2DFHA 5L3BA 5LD2C 4NQWB 3ZMDA 2P5VA 3DU6A 3HSEA 3Q0UA 1R1TA 1ORKA 2W48A 4DNCA 4HG2A 3RCOA 4FTHA 2TDXA 2NXNB 1OCCH 3T8TA 1VFCA 3S3OA 4WWCA 4CXFA 1YHQI 2XASA 2VODA 2EA4A 1HQCA 1ZK8A 2CV1A 1LDDA 3IV5A 5LLQA 3CCYA 1MNMC 2NVUB 3MCZA 5IYDJ 2KIMA 1P4AA 3BZ6A 2K4BA 4CCOA 2L9RA 3CMEI 2K40A 3NRVA 4IRGA 1D0XA 2K9LA 3CCRI 4U0VA 2XF5A 1YI2I 1FBQA 2LVSA 4X0GA 4YELA 4U87A 2QM3A 2N8GA 5B5EC 1R5ID 5AIQA 1SANA 2PI0A 3K4KA 2Y0SN 1WJCA 2DTRA 1B9NA 2FRHA 2M5WA 2OA4A 1BJAA 3S32A 4F3QA 5J1RA 5KK1A 1D8KA 3TO6A 3L2QA 3ZP5A 2RV8A 2G7HA 3VYTB 2LC2A 2FMYA 3X2QH 4TV7A 3MKLA 2A6EF 2GWRA 2NS0A 1TBXA 2AXLA 2CU7A 4MNUA 1YITI 1WJFA 3T8RA 3S3MA 2V4JC 3QPLA 4XLCA 1LFUP 3OR2C 3IWFA 3OYMA 3H3VK 2RQQA 3OIQA 1ETOA 1HBXG 2Z2SB 1T8IA 1JTXA 3FMSA 1XGNA 1Z05A 2R93J 1JE8A 2DMPA 3WGHA 2HFHA 2NVTJ 1WHUA 2EZLA 3T0YA 3FK6A 3T1BA 2OUMA 5HDNA 1ZGAA 4HF2A 3BR0A 1WI3A 2CUFA 2AQFA 4OWRB 3HRMA 1T39A 1TTYA 4QWQA 5GTIC 1I27A 4B47A 4CCLA 2VBYA 5FROA 4N0BA 4G12A 3LSMA 5IT9K 2IS1A 3E1SA 2NOJB 2R92J 2VQCA 3D5LA 4CICA 4XICA 4KN4X 2V1DA 2FA5A 4F7ZA 3H36A 1XDUA 5GP9A 1YQAA 2JA7J 3GXOA 3TBIA 3CUOA 1VQMI 4CCJA 5H2FC 1Y6IA 3EDPA 4KJZA 3TOBA 3R6SA 4D9JA 3DEEA 3GX4X 3TP0A 3L2CA 1QZYA 1IRGA 4IRHA 1AWCA 2PJRB 1SFEA 2R7TA 2X6XA 5HLTA 5FLMJ 4Y52J 2IAIA 3K4MA 4XKWA 1X1DA 2XGDA 1MDMA 3K9TA 4LOCA 2KLOA 1MJAA 4FHTA 4WCGA 4EEFG 2HVRA 3MQ0A 1PYVA 1H0MA 4Q48A 2L9SA 3HOXJ 1ZAOA 4EMSA 3OS2A 1I3AA 2LY1A 2CGPA 3BG3A 2K7LA 2ZSHB 4M72A 5FKNA 5BNGA 4G7ZF 5FKKA 4LMYA 4ZH4F 2DPDA 1GVDA 2MLGA 1ZG3A 1J5YA 2XPUA 4ASNA 2Y2ZA 3CD6I 4YFXF 5J47A 2E1MC 1LVAA 2VKDA 4XOTA 5DUIA 4QSHA 2G9WA 4BE0A 2TCTA 5D6FA 3FDYA 3KIOA 1OR7C 4BY1J 2M1BA 2Y9ZA 4DZJA 3I53A 5DCMA 5H20A 1HF0A 2EFNA 4A0XA 1E0EA 4ANJA 1AU7A 3I58A 5DCFA 5HOOA 3KLNA 4FE7A 3DLLF 1D1BA 4G6TB 4CH7A 3OIOA 2F6CA 4II2A 3FHNA 5DS9A 1IN8A 1A6IA 3F8FA 2L7FP 1WCMJ 4MTEA 3R60A 2YUSA 1JI8A 3IRRA 2EK5A 1REPC 1AHDP 2GIVA 4PDKA 3PIPF 1AKHB 3QPTA 3GUDA 2DQLA 4U0YA 1ON2A 2CQXA 3ZQ7A 1T0FC 3OYBA 2KZGA 5ILUA 3KPHA 5KNLA 5LEKA 3OS0A 1FOWA 4II3A 1LE8A 3LSIA 1EF4A 2ZNYA 3A2KA 3Q3SA 1O57A 3WHCA 2ZJPF 3HRSA 2F5DA 3H3UA 3CUQB 2LLKA 3O2PE 1SFKA 2P5KA 4XM3A 5DD4A 2QQ9A 1XC5A 4BBRJ 4FCYA 2GXBA 2IS6A 1SFXA 4M9SA 3I56I 2FNPA 3OOPA 1LB2A 2VI6A 2FD5A 5JFRA 3PSIA 1RR7A 2QYOA 4W97A 3IH3A 2YPRA 4Y4RA 5KCMA 3CCMI 2DA1A 1TLHB 4LG0A 2AHQA 5CJ9A 1JKOC 2X48A 3J7YJ 4A3DJ 1S7AA 3M8JA 3JR9A 2EA2A 2QQAA 4HSTA 2KP6A 4AIDA 3DXJF 3K7AJ 2HYFA 4M6VA 5IT3A 5CKTA 4WX9A 2EFOA 3L2UA 2UWMA 1USSA 1T33A 2ELKA 2UUZA 2FE3A 1D5YA 5D4SA 1R4MB 4YFKF 2FMLA 5E1ZB 3N4MA 1NTCA 5B3SH 3HGGA 2VJIA 3OYAA 3HKZA 3EYIA 5FKLA 2L2OA 5BMZA 2OTLI 2L01A 4GDFA 1YJNI 2B63J 1P2FA 1TNSA 3N05A 3CJQB 2XF6A 3GBGA 1ODDA 3DBRB 1ZARA 2E34A 1Y0NA 1H9GA 2EZHA 3CC7I 5JR3A 1NK3P 2M4GA 4CZZA 3A0BC 3Q9SA 2R7VA 3DPUA 4BQAA 1RPWA 3BR6A 5H6QA 5K7HA 2NNYA 1PJRA 2FEZA 3O6BB 3IUOA 4A3KJ 1MDMB 2W24A 1DGRM 1TNTA 1VQKI 2M0CA 2R0QC 1ETYA 2VC1A 3BG7A 4RB0A 1MBGA 1WKMA 2OV7A 2LBFA 5TISC 2KRCA 3WGIA 3HOVJ 1ENHA 4XKBA 1XSVA 3R0AA 1ERDA 1XD7A 4GYIA 2K3PA 3LNQA 3ZCOA 2F2EA 3J7AY 3QWLA 4UVCA 3ZQIA 4RAGA 5AIPA 4HPQA 1UG0A 1APLC 3IKVA 3IP4B 3GLXA 1QPMA 3RKXA 2DDAA 4LLGF 1G3YA 2QEXI 5K5OA 1S8NA 1OKRA 2JT1A 3GTJJ 2DT7B 4L0YB 2R7SA 4W1UA 4IOCF 1X58A 5DCMB 3BTLA 2HQNA 4ZYHA 2KZVA 3QPSA 4C2MJ 3OYIA 4BL0B 2V7FA 3P7NA 4KUMA 3AG4H 3L2VA 5BS6A 3KEQA 2ZO4A 3F3XA 2VL8A 1XGMA 1R7JA 3WTZA 1D0YA 2DK5A 4XMYA 2FBKA 2CQQA 2FBHA
chains in the Genus database with same CATH topology
5IT9Z 4ESBA 3J81K 2ZMEB 4EJWA 4AIKA 3TOAA 3WTYC 2OBPA 1J0RA 2EV6A 3CUQC 3RYPA 2A68F 5J8CA 1SMYF 3SFZA 4L18B 4ENMA 3LFKA 1U6GA 1QO0D 3FXUA 5HS9A 4WXHA 1O3TA 1MJ9A 4AWXB 2P4WA 3K1MA 4LLNA 2BV6A 1WI9A 2RDPA 4GGGA 4KFCA 3ZN1A 3F8BA 1ZRCA 1BM9A 1I6XA 1K7AA 1R1UA 4I0BA 2KIFA 1P92A 2LF7A 2KRFA 4A2UA 4O5VA 1ZH5A 1BI1A 5E8GA 4EJTA 5JVTA 4P55A 4Z2YA 4CO8A 4OMZA 1FYKA 1SAXA 5J6XA 1OYYA 3BROA 4AIHA 1QZZA 2HQRA 2H09A 2M45A 5JHUA 2VXZA 3TO9A 3WTWC 2VBWA 2K86A 2FBIA 3SZPA 2EV0A 1YS6A 1EV7A 2O6GE 3KP2A 2Z5UA 4EM2A 3GF2A 3M7GA 3P9CA 1W4MA 5ERIA 1C0WA 4I98B 2BGCA 3FF5A 3WTVC 4PCQA 1BI3A 4E70A 2LKPA 4ZYDA 1YO5C 3JSOA 1IXRC 4EJUA 4EM1A 2UXXA 3VB2A 1XGOA 1D3YA 1SMTA 1YTYA 5LBQA 4A5NA 2XV4S 2FNAA 5HDKA 1TQPA 2IP2A 1TQMA 4WXCA 1Z7UA 5TJJA 4U0WA 5FGMA 3ZMSA 4O6JA 5FD6A 4EQQA 2DAOA 2ZCWA 3WTSC 4HX8A 1X3UA 1T0FA 1O7FA 2WC2A 1KQ0A 3CDHA 3PQJA 4XLNF 5L3EA 2L54A 2BBYA 2O61A 2AS5F 1RNLA 2VOPA 3FXQA 3ECOA 3F6OA 1ZRDA 3F6VA 2VONA 3IHUA 3H92A 1TQIA 4P9UA 2D45A 1E2XA 1WSUA 4GO1A 3IWZA 2DI3A 3WE2A 3G73A 5H6RA 4LB5A 3LSTA 5LHIA 4IF4A 3QPHA 5HDGA 2FF4A 2EB7A 3RKYA 1B9MA 4CGZA 2JPCA 2H94A 3B02A 2V1UA 1UFMA 3KP5A 5E20A 3J81Z 2QWWA 3QU6A 3VFZA 3WTTC 1OYWA 4BAYA 1T98A 4XSXF 4HLXA 2MH2A 2XAQA 1I5ZA 2GA2A 3C3WA 2F5FA 1R23A 2EFWA 4IXAA 1J75A 1GXPA 1U2WA 2FQ3A 3CTAA 4OMYA 4UVBA 1U3EM 2JZYA 3MWMA 4MEXF 2XRNA 1KGSA 3ELKA 3L09A 4Q5SF 2DFIA 2L4AA 2XGXA 1ON1A 3DEUA 4OIRF 1HKSA 5F64A 4XRFA 4GCVA 1FX7A 5D5VB 2BEOA 2FBHA 1H9TA 1BN5A 2STWA 4KDPA 2J5PA 5CVVA 3QP5A 3WG9A 4R79A 2ZBKA 3HYIA 2CG4A 3K0LA 3S2WA 1G3TA 1YLFA 2VOOA 5D4RA 1FOKA 3KEOA 4FX0A 3I59A 1MGTA 2CW0F 4KIFA 2KIUA 3R61A 4CHUA 4OOIA 4UHTA 4U88A 3KZZA 1O3SA 4K2EA 4MGRA 1S6LA 3CUQA 1YIOA 3FMQA 2XAFA 3LAPA 2NNNA 3ULQB 4Y17A 5LGUA 3NQOA 2X0LA 4I02A 2L3DA 2H6BA 1ONVA 3V7SA 5HVQC 3HOSA 3V8KA 2HZTA 3CO7C 3Q9VA 2ACJA 2CWEA 4RGRA 4A6DA 4PGGA 2GXGA 1BIAA 1IN7A 4RGXA 4BHBA 2DW4A 4L9NA 3G3ZA 4PGHA 4ON0A 3JTGA 4LK0F 2JPBA 3ZPLA 1W7PB 1AOYA 1B1BA 1QGPA 2RN7A 4L0ZB 2PMUA 5E8IA 3V4GA 4ENKA 1J9IA 1P4WA 5LRSA 4WF2A 1PP8F 1TW3A 2OZ6A 2DU9A 4CDGA 2XAGA 1XSXA 3E6MA 5ICGA 3NEUA 4KN7X 2QLZA 1KU7A 1XDSA 1LDJA 3KCCA 4G94A 2O3FA 3QOPA 1Y0UA 1FZPB 1IZ1A 2A6HF 2FU4A 1KU3A 3F8MA 3R4KA 3HRTA 3LA2A 3RYRA 4HW0A 2ETHA 4KYWA 3JAMK 3H3ZA 3RPQA 2GZWA 1JGSA 1MZBA 3K2ZA 4A0ZA 3KP7A 3KFWX 2EWNA 1XN7A 2ISYA 4HF0A 4P96A 4UV9A 4HOBA 1HSTA 2VN2A 4HV5A 3LAJA 4EV0A 4QLCU 2XROA 2PEXA 1UB9A 2Z33A 2ZMEA 1ZLJA 1S29A 1HW1A 3I59B 3BJ6A 3MZHA 2CSOA 3ZMUA 1SD6A 2NRAC 3SXYA 5BQTA 4YIFA 2RC4A 4A5MA 1O3QA 3IRQA 5AONA 5E17F 2C6YA 2E1CA 3E97A 3ABTA 3L00A 4P5OA 1G3WA 2J5OA 1T38A 2P5LC 3V8JA 1ZREA 2OQRA 5L3DA 4HZFA 4S05A 1YYVA 2WTEA 4HDUA 1ZLKA 3ML6A 1R00A 4OINF 2A61A 1LDKB 1HW2A 4U7BA 1ZG5A 1XMAA 1BI0A 3ECHA 4Q47A 1XGSA 5D8LB 3HTUA 5F6FA 3TKYA 4CYDA 4I09A 2VE8A 2L02A 4LFUA 4L9TA 2QUFA 3O3KA 2VT3A 2OQGA 1ZRFA 4G9YA 4EM0B 3T5XA 4RAZA 3DFGA 2E1NA 3HSFA 2HDCA 4PZJA 1W5TA 4KIBA 3TDUC 3EETA 4LGWA 2GQQA 3AAFA 1LNWA 2VBZA 2FXAA 3E5XA 2A69F 2DQRA 2QVOA 4R1HA 1IW7F 5ILSA 1D5VA 1HXDA 2PQ8A 5D5WB 3WGGA 5DYMA 3BY6A 1K78B 2B0LA 3GFJA 2EJRA 3BPXA 2EFQA 4L9VA 2D1HA 5K5RA 2QENA 3FXRA 2OAZA 4HYEA 5E18F 2PLYA 2BYVE 3U9GA 1PP7U 2VC0A 2HR3A 1STZA 5CVRA 3JW4A 2IPQX 3FM5A 2E7XA 1ULYA 3I71A 1IXSB 2ISZA 4L5JA 4OU0A 1U5TB 4N9IA 3ISPA 3VEPA 2DLLA 2V1XA 3LA3A 1FP2A 5DV5A 3IC7A 3JAMZ 1F4KA 1S7OA 3FMRA 1CF7A 3C18A 1USTA 2R7FA 1OYIA 3DPTA 3DKWA 3KE2A 1PUEE 2W84A 5BPIA 4KICA 2DO7A 2IA2A 4JQFA 4XBFA 1IAWA 1HKTA 3M8FA 1GXQA 2HOEA 3DF8A 3CJNA 2QBYB 5CLSA 2JRTA 4IJAA 1XCBA 5CVUA 3GFLA 3MZYA 1FWZA 5L3CA 2OD5A 4RGUA 4ZYGA 4N9HA 5HS8A 4Y13A 5E1WA 4ESFA 2HTSA 1RUOA 2OU2A 4UXNA 2K4JA 3RDIA 1EH6A 3RJPA 3MAJA 4YIIA 3COAC 2P6TA 4I0AA 2Z3YA 4I2OA 2GAUA 4IRIA 2ESHA 4L9JA 1JHHA 4OIPF 2FOKA 1FPQA 4HAMA 1Z91A 1KQ9A 3U2RA 5BOXA 3RPUA 3VOEA 5LHGA 4L5IA 1IF1A 3F72A 1KQ8A 5LEJA 4LK1F 1IN4A 4EGZA 1RI7A 2W85A 1FLIA 2D1VA 4HF1A 2DK8A 5LRRA 5E1XA 2H6CA 1CGPA 1FBSA 1EH8A 5D6EA 3LA7A 2IRFG 1U5TC 4BXUA 4IHTA 1OPCA 1RIOH 2RKHA 2CO5A 1GHCA 2ZJ2A 1DPRA 2O03A 3HHHA 1IN6A 2V6CA 1W7PD 1SD4A 1CF7B 4MHGA 2FSWA 5ICCA 1LJ9A 2P8TA 1TW2A 4FT8A 1MJBA 1WRJA 2F5EA 4ZZLA 4GYGA 5L3GA 2DPUA 4G7HF 1W7PA 3RI4A 3E6CC 5LHHA 1L3LA 4BHPA 1FP1D 2K27A 2MH9A 6PAXA 2EFPA 3EQLF 4M6XA 1QQIA 2HKXA 1QNTA 3V8LA 5FLXK 1Z6RA 1KA8A 3TDZC 2HS5A 2YU3A 1XCVA 2DT5A 1FBUA 4UVAA 2F5CA 2XHKA 2M87A 2P7VB 3DV8A 1BOAA 3WTUC 1XMKA 1XSDA 1OMIA 3U1DA 3DPLC 2Z9OA 1QBJA 3GO5A 4LJZF 2QZ8A 2A5YB 3GYHX 4MEYF 3WE3A 3ZMVA 4LB6B 1WWXA 1SD5A 3J7AO 3ERED 4KNYA 3KETA 3B73A 1V4RA 3BP8A 3I54A 1EH7A 3ZN0A 2IT0A 1RUNA 3F8CA 4EGYA 4OIQF 2XUBA 2O0YA 2W57A 2V9VA 1K79A 3BOQA 3M1EA 3F22A 4ESJA 3J80Z 3WODF 4RB2C 3WTXC 2MD5A 2PG4A 4GXOA 1B59A 1DPUA 3SHFA 1YW9A 2EV5A 4M74A 1YG2A 1I1SA 2UXNA 3MEXA 1FYLA 3F23A 1O3RA 1ZHFA 2Y48A 1U78A 4MQ9F 3IKTA 4R8HA 1R5GA 3OV8A 1BC8C 1IRFA 2VE9A 3I5UA 3C7JA 1ZN2A 3BPVA 4KT5C 2Y0MA 1K6OA 1BI2A 3K1PA 1Z6TA 1LQ1A 3PFIA 2RNJA 4P9FA 4HLYA 2MLKA 3HHGA 2A3SA 1A04A 2E7WA 3ZMZA 2QQBA 1UCRA 5FFZA 1F5TA 3RTRA 3EUHA 5FO5A 2P7CB 4Q4ZF 2GA1A 3GW2A 5K1YA 3E3VA 5ED4A 4BYYA 2NYXA 4B8XA 2K02A 2V79A 1FYMA 3D0SA 3E5QA 2YX7A 2HYGD 5DEQA 2A07F 5JI6A 2XKOA 1WQ2A 4M6YA 5CVJA 1J59A 4Y15A 1K78A 4I01A 5F1RA 1IXCA 2LSOA 3TQNA 4UNOA 1Z1DA 4ZYEA 3K69A 3DQVC 2L4MA 1LEAA 3GWZA 1B4AA 4MQVA 3BWGA 5L3FA 1BBYA 1UHMA 2LDUA 4A0YA 1HSJA 5FLXZ 2M8EA 2CQKA 1ZGJA 3BDDA 1FC3A 1R5HA 3E6BA 1U5TA 3GFIA 2UZKA 4HX7A 1P6RA 4HX4A 4G8XA 1R58A 4DQ2A 4A6EA 1PDNC 3P9KA 4KA4A 3BJAA 4JK1X 3QU3A 1YW7A 4D0PA 5ICEA 4B09A 3HTSB 5K5QA 5CVIA 3K1NA 4IHSA 1ZG1A 2MBFA 2Q0OA 4G7OF 3I64A 5KVRA 5D5XB 4YFNF 3V7CA 2QBYA 1YS7A 4FX4A 4G6QA 5EEGA 3ZMTA 3F8NA 3HSRA 5BPDA 2ELHA 4HA8A 5J8FA 4ETSA 1FT9A 3F21A 1T2KA 1KYWA 1SD7A 2BE5F 4G6DA 5HS7A 1DP7P 4LD5A 1T6SA 4I7HA 2IJLA 4HQEA 1DUXC 2M30A 2HEOA 4XSZF 4AVPA 2RGVA 3CO6C 1E17A 2COMA 1DDNA 2CYYA 4ENNA 4IPAA 4KMFA 5LGNA 1JHFA 1F1ZA 2YX4A 2HWVA 2XIGA 1LEBA 3E6DA 2W25A 1P4XA 2STTA 4HBLA 4AD9A 1L0OC 4WK8F 1KU9A 1D8JA 2YSRA 2X4HA 1O7LA 1FY7A 2HGCA 3M9AA 5A2QK 4UUVA 3KLOA 3CLOA 5HLGA 4U7DA 2WWYA 3VODA 3HRUA 2VT2A 2IA0A 2RVCA 4KIGA 3SQNA 2ZKZA 2DBBA 5CYVA 3W6KB 1W5SA 3BJOA 1UHWA 4BNCA 2Q8KA 2LF8A 3W6JB 5D8KB 5EEHA 1YW8A 2P6SA 3FWEA 2JSCA 1FSEA 4AIJA 4EVIA 4M71A 1U8RA 1Q1HA 5DDGA 3QP6A 2ZNZA 3I0TA 1FNNA 4RGSA 3WU0A 3LQRA 1B6AA 4LG0B 2NAZA 3ABUA 4ENJA 3WU1B 5ILVA 2R3SA 1RZ4A 2HKOA 4UV8A 2RQPA 2Q2EA 2IA1A 3HUGA 2IVMA 1R22A 2MA3A 2KKOA 4A12A 2VBXA 1IUYA 1HKQA 2PJPA 2ZXJA 3SZTA 3REOA 2LNBA 4M9XA 1JXSA 3M8EA 3J80K 2KJCA 3PQKA 3GZ5A 3HOTA 5ICFA 3IL2A 3L9FA 1GVJA 1R1VA 1MKMA 3R0JA 1HW5A 2PBIA 2CFXA 3E5UA 4BH9A 2JTVA 3EYYA 3QAHA 2D2WA 3I4PA 3MFKA 2ESNA 1J7KA 3P9IA 1G3SA 3TGNA 3GEZA 3QRFF 3FX3A 1KYZA 4RB3C 3HIFA 4NQWA 5HLIA 3KP6A 1OR7A 3ROUA 4BHCA 3RKWA 2XVCA 3L7WA 2Z99A 4RB1A 4NB5A 1S3JA 3GVAA 4OIOF 2H27A 4HDVA 3KZYA 2G7UA 2WV0A 2Y75A 3C1DA 4RS8A 2KJBA 4WXDA 5DD8A 1FSHA 3GZ6A 1G4DA 5FFXA 5FB2A 2ADUA 3FM3A 5LGTA 3DP7A 3FZVA 3JTHA 3FHZA 1XB4A 2ZFWA 2O8XA 1V3FA 4HQMA 2XKPA 4LLLA 3V7RA 4S04A 3LQQA 4MTDA 2PN6A 5D5UB 1J2XA 1IN5A 1SFUA 4YG2F 5A2QZ 1BIBA 3TO7A 3JSPA 4KMUX 4XLPF 2R7DA 2PFBA 4EJOA 4H0EA 2PMHA 4IVNA 1Z9CA 4M9ZA 3N97A 4HV6A 4NHJA 3Q5FA 5DUKA 3RIRA 3LWFA 2XAHA 3KP3A 1ZYRF 4JBAA 1NHAA 2YR2A 1KU2A 1R36A 5TRDA 2HTJA 1F9NA 4EJVA 1VTNC 1G6NA 1I1GA 4RAYA 4ZZDA 2XAJA 1MD0A 5FD5A 4M73A 1BC7C 3GFMA 1YFHA 3KP4A 2OZUA 2IW5A 5HLHA 2MC3A 5L3BA 3ZMDA 2P5VA 3HSEA 1R1TA 4DNCA 2TDXA 3T8TA 4WWCA 4CXFA 2XASA 2VODA 2EA4A 1HQCA 1LDDA 3MCZA 2KIMA 1P4AA 2K4BA 3BZ6A 3NRVA 4IRGA 4U0VA 1FBQA 2QM3A 5AIQA 2PI0A 2DTRA 2FRHA 1B9NA 2M5WA 2OA4A 4O3MA 1BJAA 5KK1A 1D8KA 3TO6A 3ZP5A 2RV8A 2G7HA 2FMYA 4TV7A 2A6EF 2GWRA 2NS0A 1TBXA 2AXLA 4MNUA 3T8RA 3IWFA 1HBXG 3FMSA 1XGNA 1Z05A 1JE8A 3WGHA 2HFHA 3T0YA 3T1BA 5HDNA 1ZGAA 4HF2A 3HRMA 1T39A 1TTYA 4QWQA 1I27A 2VBYA 4N0BA 5IT9K 3D5LA 4CICA 4KN4X 2V1DA 2FA5A 4F7ZA 1XDUA 1YQAA 3GXOA 3CUOA 3EDPA 3TOBA 3R6SA 3GX4X 3L2CA 1QZYA 1IRGA 4IRHA 1AWCA 1SFEA 1MDMA 3K9TA 1MJAA 4FHTA 4WCGA 3MQ0A 1H0MA 4Q48A 1ZAOA 4EMSA 2CGPA 2K7LA 4G7ZF 4M72A 4LMYA 4ZH4F 2DPDA 2MLGA 1ZG3A 1J5YA 4ASNA 4YFXF 1LVAA 5DUIA 2G9WA 5D6FA 2M1BA 3I53A 5DCMA 5H20A 2EFNA 4A0XA 3I58A 5DCFA 5HOOA 3KLNA 1IN8A 3F8FA 4MTEA 3R60A 3IRRA 2EK5A 1REPC 2GIVA 4PDKA 3QPTA 3GUDA 2DQLA 4U0YA 1ON2A 3ZQ7A 5ILUA 5LEKA 2ZNYA 1O57A 3HRSA 2F5DA 3H3UA 3CUQB 3O2PE 2P5KA 5DD4A 2QQ9A 2GXBA 1SFXA 4M9SA 2FNPA 3OOPA 1LB2A 5JFRA 2QYOA 2YPRA 1TLHB 4LG0A 5CJ9A 1S7AA 2EA2A 2QQAA 3DXJF 2HYFA 5IT3A 4WX9A 2EFOA 2UWMA 1USSA 2FE3A 5D4SA 4YFKF 2FMLA 5E1ZB 3N4MA 3EYIA 5BMZA 2L01A 1P2FA 1TNSA 1ODDA 1ZARA 1H9GA 5JR3A 4CZZA 3Q9SA 4BQAA 5H6QA 2NNYA 2FEZA 3O6BB 1MDMB 2W24A 1TNTA 2VC1A 4RB0A 1WKMA 3WGIA 1XSVA 3R0AA 1XD7A 4GYIA 2F2EA 4UVCA 5AIPA 3IKVA 3GLXA 1QPMA 3RKXA 4LLGF 1G3YA 5K5OA 1S8NA 1OKRA 2JT1A 4L0YB 5DCMB 2HQNA 4ZYHA 3P7NA 4KUMA 5BS6A 3KEQA 2ZO4A 3F3XA 1XGMA 1R7JA 3WTZA 2DK5A 2FBKA 5LLQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT9 Z;  4ESB A;  3J81 K;  2ZME B;  4EJW A;  4AIK A;  3TOA A;  3WTY C;  2OBP A;  1J0R A;  2EV6 A;  3CUQ C;  3RYP A;  2A68 F;  5J8C A;  1SMY F;  3SFZ A;  4L18 B;  4ENM A;  3LFK A;  1U6G A;  1QO0 D;  3FXU A;  5HS9 A;  4WXH A;  1O3T A;  1MJ9 A;  4AWX B;  2P4W A;  3K1M A;  4LLN A;  2BV6 A;  1WI9 A;  2RDP A;  4GGG A;  4KFC A;  3ZN1 A;  3F8B A;  1ZRC A;  1BM9 A;  1I6X A;  1K7A A;  1R1U A;  4I0B A;  2KIF A;  1P92 A;  2LF7 A;  2KRF A;  4A2U A;  4O5V A;  1ZH5 A;  1BI1 A;  5E8G A;  4EJT A;  5JVT A;  4P55 A;  4Z2Y A;  4CO8 A;  4OMZ A;  1FYK A;  1SAX A;  5J6X A;  1OYY A;  3BRO A;  4AIH A;  1QZZ A;  2HQR A;  2H09 A;  2M45 A;  5JHU A;  2VXZ A;  3TO9 A;  3WTW C;  2VBW A;  2K86 A;  2FBI A;  3SZP A;  2EV0 A;  1YS6 A;  1EV7 A;  2O6G E;  3KP2 A;  2Z5U A;  4EM2 A;  3GF2 A;  3M7G A;  3P9C A;  1W4M A;  5ERI A;  1C0W A;  4I98 B;  2BGC A;  3FF5 A;  3WTV C;  4PCQ A;  1BI3 A;  4E70 A;  2LKP A;  4ZYD A;  1YO5 C;  3JSO A;  1IXR C;  4EJU A;  4EM1 A;  2UXX A;  3VB2 A;  1XGO A;  1D3Y A;  1SMT A;  1YTY A;  5LBQ A;  4A5N A;  2XV4 S;  2FNA A;  5HDK A;  1TQP A;  2IP2 A;  1TQM A;  4WXC A;  1Z7U A;  5TJJ A;  4U0W A;  5FGM A;  3ZMS A;  4O6J A;  5FD6 A;  4EQQ A;  2DAO A;  2ZCW A;  3WTS C;  4HX8 A;  1X3U A;  1T0F A;  1O7F A;  2WC2 A;  1KQ0 A;  3CDH A;  3PQJ A;  4XLN F;  5L3E A;  2L54 A;  2BBY A;  2O61 A;  2AS5 F;  1RNL A;  2VOP A;  3FXQ A;  3ECO A;  3F6O A;  1ZRD A;  3F6V A;  2VON A;  3IHU A;  3H92 A;  1TQI A;  4P9U A;  2D45 A;  1E2X A;  1WSU A;  4GO1 A;  3IWZ A;  2DI3 A;  3WE2 A;  3G73 A;  5H6R A;  4LB5 A;  3LST A;  5LHI A;  4IF4 A;  3QPH A;  5HDG A;  2FF4 A;  2EB7 A;  3RKY A;  1B9M A;  4CGZ A;  2JPC A;  2H94 A;  3B02 A;  2V1U A;  1UFM A;  3KP5 A;  5E20 A;  3J81 Z;  2QWW A;  3QU6 A;  3VFZ A;  3WTT C;  1OYW A;  4BAY A;  1T98 A;  4XSX F;  4HLX A;  2MH2 A;  2XAQ A;  1I5Z A;  2GA2 A;  3C3W A;  2F5F A;  1R23 A;  2EFW A;  4IXA A;  1J75 A;  1GXP A;  1U2W A;  2FQ3 A;  3CTA A;  4OMY A;  4UVB A;  1U3E M;  2JZY A;  3MWM A;  4MEX F;  2XRN A;  1KGS A;  3ELK A;  3L09 A;  4Q5S F;  2DFI A;  2L4A A;  2XGX A;  1ON1 A;  3DEU A;  4OIR F;  1HKS A;  5F64 A;  4XRF A;  4GCV A;  1FX7 A;  5D5V B;  2BEO A;  2FBH A;  1H9T A;  1BN5 A;  2STW A;  4KDP A;  2J5P A;  5CVV A;  3QP5 A;  3WG9 A;  4R79 A;  2ZBK A;  3HYI A;  2CG4 A;  3K0L A;  3S2W A;  1G3T A;  1YLF A;  2VOO A;  5D4R A;  1FOK A;  3KEO A;  4FX0 A;  3I59 A;  1MGT A;  2CW0 F;  4KIF A;  2KIU A;  3R61 A;  4CHU A;  4OOI A;  4UHT A;  4U88 A;  3KZZ A;  1O3S A;  4K2E A;  4MGR A;  1S6L A;  3CUQ A;  1YIO A;  3FMQ A;  2XAF A;  3LAP A;  2NNN A;  3ULQ B;  4Y17 A;  5LGU A;  3NQO A;  2X0L A;  4I02 A;  2L3D A;  2H6B A;  1ONV A;  3V7S A;  5HVQ C;  3HOS A;  3V8K A;  2HZT A;  3CO7 C;  3Q9V A;  2ACJ A;  2CWE A;  4RGR A;  4A6D A;  4PGG A;  2GXG A;  1BIA A;  1IN7 A;  4RGX A;  4BHB A;  2DW4 A;  4L9N A;  3G3Z A;  4PGH A;  4ON0 A;  3JTG A;  4LK0 F;  2JPB A;  3ZPL A;  1W7P B;  1AOY A;  1B1B A;  1QGP A;  2RN7 A;  4L0Z B;  2PMU A;  5E8I A;  3V4G A;  4ENK A;  1J9I A;  1P4W A;  5LRS A;  4WF2 A;  1PP8 F;  1TW3 A;  2OZ6 A;  2DU9 A;  4CDG A;  2XAG A;  1XSX A;  3E6M A;  5ICG A;  3NEU A;  4KN7 X;  2QLZ A;  1KU7 A;  1XDS A;  1LDJ A;  3KCC A;  4G94 A;  2O3F A;  3QOP A;  1Y0U A;  1FZP B;  1IZ1 A;  2A6H F;  2FU4 A;  1KU3 A;  3F8M A;  3R4K A;  3HRT A;  3LA2 A;  3RYR A;  4HW0 A;  2ETH A;  4KYW A;  3JAM K;  3H3Z A;  3RPQ A;  2GZW A;  1JGS A;  1MZB A;  3K2Z A;  4A0Z A;  3KP7 A;  3KFW X;  2EWN A;  1XN7 A;  2ISY A;  4HF0 A;  4P96 A;  4UV9 A;  4HOB A;  1HST A;  2VN2 A;  4HV5 A;  3LAJ A;  4EV0 A;  4QLC U;  2XRO A;  2PEX A;  1UB9 A;  2Z33 A;  2ZME A;  1ZLJ A;  1S29 A;  1HW1 A;  3I59 B;  3BJ6 A;  3MZH A;  2CSO A;  3ZMU A;  1SD6 A;  2NRA C;  3SXY A;  5BQT A;  4YIF A;  2RC4 A;  4A5M A;  1O3Q A;  3IRQ A;  5AON A;  5E17 F;  2C6Y A;  2E1C A;  3E97 A;  3ABT A;  3L00 A;  4P5O A;  1G3W A;  2J5O A;  1T38 A;  2P5L C;  3V8J A;  1ZRE A;  2OQR A;  5L3D A;  4HZF A;  4S05 A;  1YYV A;  2WTE A;  4HDU A;  1ZLK A;  3ML6 A;  1R00 A;  4OIN F;  2A61 A;  1LDK B;  1HW2 A;  4U7B A;  1ZG5 A;  1XMA A;  1BI0 A;  3ECH A;  4Q47 A;  1XGS A;  5D8L B;  3HTU A;  5F6F A;  3TKY A;  4CYD A;  4I09 A;  2VE8 A;  2L02 A;  4LFU A;  4L9T A;  2QUF A;  3O3K A;  2VT3 A;  2OQG A;  1ZRF A;  4G9Y A;  4EM0 B;  3T5X A;  4RAZ A;  3DFG A;  2E1N A;  3HSF A;  2HDC A;  4PZJ A;  1W5T A;  4KIB A;  3TDU C;  3EET A;  4LGW A;  2GQQ A;  3AAF A;  1LNW A;  2VBZ A;  2FXA A;  3E5X A;  2A69 F;  2DQR A;  2QVO A;  4R1H A;  1IW7 F;  5ILS A;  1D5V A;  1HXD A;  2PQ8 A;  5D5W B;  3WGG A;  5DYM A;  3BY6 A;  1K78 B;  2B0L A;  3GFJ A;  2EJR A;  3BPX A;  2EFQ A;  4L9V A;  2D1H A;  5K5R A;  2QEN A;  3FXR A;  2OAZ A;  4HYE A;  5E18 F;  2PLY A;  2BYV E;  3U9G A;  1PP7 U;  2VC0 A;  2HR3 A;  1STZ A;  5CVR A;  3JW4 A;  2IPQ X;  3FM5 A;  2E7X A;  1ULY A;  3I71 A;  1IXS B;  2ISZ A;  4L5J A;  4OU0 A;  1U5T B;  4N9I A;  3ISP A;  3VEP A;  2DLL A;  2V1X A;  3LA3 A;  1FP2 A;  5DV5 A;  3IC7 A;  3JAM Z;  1F4K A;  1S7O A;  3FMR A;  1CF7 A;  3C18 A;  1UST A;  2R7F A;  1OYI A;  3DPT A;  3DKW A;  3KE2 A;  1PUE E;  2W84 A;  5BPI A;  4KIC A;  2DO7 A;  2IA2 A;  4JQF A;  4XBF A;  1IAW A;  1HKT A;  3M8F A;  1GXQ A;  2HOE A;  3DF8 A;  3CJN A;  2QBY B;  5CLS A;  2JRT A;  4IJA A;  1XCB A;  5CVU A;  3GFL A;  3MZY A;  1FWZ A;  5L3C A;  2OD5 A;  4RGU A;  4ZYG A;  4N9H A;  5HS8 A;  4Y13 A;  5E1W A;  4ESF A;  2HTS A;  1RUO A;  2OU2 A;  4UXN A;  2K4J A;  3RDI A;  1EH6 A;  3RJP A;  3MAJ A;  4YII A;  3COA C;  2P6T A;  4I0A A;  2Z3Y A;  4I2O A;  2GAU A;  4IRI A;  2ESH A;  4L9J A;  1JHH A;  4OIP F;  2FOK A;  1FPQ A;  4HAM A;  1Z91 A;  1KQ9 A;  3U2R A;  5BOX A;  3RPU A;  3VOE A;  5LHG A;  4L5I A;  1IF1 A;  3F72 A;  1KQ8 A;  5LEJ A;  4LK1 F;  1IN4 A;  4EGZ A;  1RI7 A;  2W85 A;  1FLI A;  2D1V A;  4HF1 A;  2DK8 A;  5LRR A;  5E1X A;  2H6C A;  1CGP A;  1FBS A;  1EH8 A;  5D6E A;  3LA7 A;  2IRF G;  1U5T C;  4BXU A;  4IHT A;  1OPC A;  1RIO H;  2RKH A;  2CO5 A;  1GHC A;  2ZJ2 A;  1DPR A;  2O03 A;  3HHH A;  1IN6 A;  2V6C A;  1W7P D;  1SD4 A;  1CF7 B;  4MHG A;  2FSW A;  5ICC A;  1LJ9 A;  2P8T A;  1TW2 A;  4FT8 A;  1MJB A;  1WRJ A;  2F5E A;  4ZZL A;  4GYG A;  5L3G A;  2DPU A;  4G7H F;  1W7P A;  3RI4 A;  3E6C C;  5LHH A;  1L3L A;  4BHP A;  1FP1 D;  2K27 A;  2MH9 A;  6PAX A;  2EFP A;  3EQL F;  4M6X A;  1QQI A;  2HKX A;  1QNT A;  3V8L A;  5FLX K;  1Z6R A;  1KA8 A;  3TDZ C;  2HS5 A;  2YU3 A;  1XCV A;  2DT5 A;  1FBU A;  4UVA A;  2F5C A;  2XHK A;  2M87 A;  2P7V B;  3DV8 A;  1BOA A;  3WTU C;  1XMK A;  1XSD A;  1OMI A;  3U1D A;  3DPL C;  2Z9O A;  1QBJ A;  3GO5 A;  4LJZ F;  2QZ8 A;  2A5Y B;  3GYH X;  4MEY F;  3WE3 A;  3ZMV A;  4LB6 B;  1WWX A;  1SD5 A;  3J7A O;  3ERE D;  4KNY A;  3KET A;  3B73 A;  1V4R A;  3BP8 A;  3I54 A;  1EH7 A;  3ZN0 A;  2IT0 A;  1RUN A;  3F8C A;  4EGY A;  4OIQ F;  2XUB A;  2O0Y A;  2W57 A;  2V9V A;  1K79 A;  3BOQ A;  3M1E A;  3F22 A;  4ESJ A;  3J80 Z;  3WOD F;  4RB2 C;  3WTX C;  2MD5 A;  2PG4 A;  4GXO A;  1B59 A;  1DPU A;  3SHF A;  1YW9 A;  2EV5 A;  4M74 A;  1YG2 A;  1I1S A;  2UXN A;  3MEX A;  1FYL A;  3F23 A;  1O3R A;  1ZHF A;  2Y48 A;  1U78 A;  4MQ9 F;  3IKT A;  4R8H A;  1R5G A;  3OV8 A;  1BC8 C;  1IRF A;  2VE9 A;  3I5U A;  3C7J A;  1ZN2 A;  3BPV A;  4KT5 C;  2Y0M A;  1K6O A;  1BI2 A;  3K1P A;  1Z6T A;  1LQ1 A;  3PFI A;  2RNJ A;  4P9F A;  4HLY A;  2MLK A;  3HHG A;  2A3S A;  1A04 A;  2E7W A;  3ZMZ A;  2QQB A;  1UCR A;  5FFZ A;  1F5T A;  3RTR A;  3EUH A;  5FO5 A;  2P7C B;  4Q4Z F;  2GA1 A;  3GW2 A;  5K1Y A;  3E3V A;  5ED4 A;  4BYY A;  2NYX A;  4B8X A;  2K02 A;  2V79 A;  1FYM A;  3D0S A;  3E5Q A;  2YX7 A;  2HYG D;  5DEQ A;  2A07 F;  5JI6 A;  2XKO A;  1WQ2 A;  4M6Y A;  5CVJ A;  1J59 A;  4Y15 A;  1K78 A;  4I01 A;  5F1R A;  1IXC A;  2LSO A;  3TQN A;  4UNO A;  1Z1D A;  4ZYE A;  3K69 A;  3DQV C;  2L4M A;  1LEA A;  3GWZ A;  1B4A A;  4MQV A;  3BWG A;  5L3F A;  1BBY A;  1UHM A;  2LDU A;  4A0Y A;  1HSJ A;  5FLX Z;  2M8E A;  2CQK A;  1ZGJ A;  3BDD A;  1FC3 A;  1R5H A;  3E6B A;  1U5T A;  3GFI A;  2UZK A;  4HX7 A;  1P6R A;  4HX4 A;  4G8X A;  1R58 A;  4DQ2 A;  4A6E A;  1PDN C;  3P9K A;  4KA4 A;  3BJA A;  4JK1 X;  3QU3 A;  1YW7 A;  4D0P A;  5ICE A;  4B09 A;  3HTS B;  5K5Q A;  5CVI A;  3K1N A;  4IHS A;  1ZG1 A;  2MBF A;  2Q0O A;  4G7O F;  3I64 A;  5KVR A;  5D5X B;  4YFN F;  3V7C A;  2QBY A;  1YS7 A;  4FX4 A;  4G6Q A;  5EEG A;  3ZMT A;  3F8N A;  3HSR A;  5BPD A;  2ELH A;  4HA8 A;  5J8F A;  4ETS A;  1FT9 A;  3F21 A;  1T2K A;  1KYW A;  1SD7 A;  2BE5 F;  4G6D A;  5HS7 A;  1DP7 P;  4LD5 A;  1T6S A;  4I7H A;  2IJL A;  4HQE A;  1DUX C;  2M30 A;  2HEO A;  4XSZ F;  4AVP A;  2RGV A;  3CO6 C;  1E17 A;  2COM A;  1DDN A;  2CYY A;  4ENN A;  4IPA A;  4KMF A;  5LGN A;  1JHF A;  1F1Z A;  2YX4 A;  2HWV A;  2XIG A;  1LEB A;  3E6D A;  2W25 A;  1P4X A;  2STT A;  4HBL A;  4AD9 A;  1L0O C;  4WK8 F;  1KU9 A;  1D8J A;  2YSR A;  2X4H A;  1O7L A;  1FY7 A;  2HGC A;  3M9A A;  5A2Q K;  4UUV A;  3KLO A;  3CLO A;  5HLG A;  4U7D A;  2WWY A;  3VOD A;  3HRU A;  2VT2 A;  2IA0 A;  2RVC A;  4KIG A;  3SQN A;  2ZKZ A;  2DBB A;  5CYV A;  3W6K B;  1W5S A;  3BJO A;  1UHW A;  4BNC A;  2Q8K A;  2LF8 A;  3W6J B;  5D8K B;  5EEH A;  1YW8 A;  2P6S A;  3FWE A;  2JSC A;  1FSE A;  4AIJ A;  4EVI A;  4M71 A;  1U8R A;  1Q1H A;  5DDG A;  3QP6 A;  2ZNZ A;  3I0T A;  1FNN A;  4RGS A;  3WU0 A;  3LQR A;  1B6A A;  4LG0 B;  2NAZ A;  3ABU A;  4ENJ A;  3WU1 B;  5ILV A;  2R3S A;  1RZ4 A;  2HKO A;  4UV8 A;  2RQP A;  2Q2E A;  2IA1 A;  3HUG A;  2IVM A;  1R22 A;  2MA3 A;  2KKO A;  4A12 A;  2VBX A;  1IUY A;  1HKQ A;  2PJP A;  2ZXJ A;  3SZT A;  3REO A;  2LNB A;  4M9X A;  1JXS A;  3M8E A;  3J80 K;  2KJC A;  3PQK A;  3GZ5 A;  3HOT A;  5ICF A;  3IL2 A;  3L9F A;  1GVJ A;  1R1V A;  1MKM A;  3R0J A;  1HW5 A;  2PBI A;  2CFX A;  3E5U A;  4BH9 A;  2JTV A;  3EYY A;  3QAH A;  2D2W A;  3I4P A;  3MFK A;  2ESN A;  1J7K A;  3P9I A;  1G3S A;  3TGN A;  3GEZ A;  3QRF F;  3FX3 A;  1KYZ A;  4RB3 C;  3HIF A;  4NQW A;  5HLI A;  3KP6 A;  1OR7 A;  3ROU A;  4BHC A;  3RKW A;  2XVC A;  3L7W A;  2Z99 A;  4RB1 A;  4NB5 A;  1S3J A;  3GVA A;  4OIO F;  2H27 A;  4HDV A;  3KZY A;  2G7U A;  2WV0 A;  2Y75 A;  3C1D A;  4RS8 A;  2KJB A;  4WXD A;  5DD8 A;  1FSH A;  3GZ6 A;  1G4D A;  5FFX A;  5FB2 A;  2ADU A;  3FM3 A;  5LGT A;  3DP7 A;  3FZV A;  3JTH A;  3FHZ A;  1XB4 A;  2ZFW A;  2O8X A;  1V3F A;  4HQM A;  2XKP A;  4LLL A;  3V7R A;  4S04 A;  3LQQ A;  4MTD A;  2PN6 A;  5D5U B;  1J2X A;  1IN5 A;  1SFU A;  4YG2 F;  5A2Q Z;  1BIB A;  3TO7 A;  3JSP A;  4KMU X;  4XLP F;  2R7D A;  2PFB A;  4EJO A;  4H0E A;  2PMH A;  4IVN A;  1Z9C A;  4M9Z A;  3N97 A;  4HV6 A;  4NHJ A;  3Q5F A;  5DUK A;  3RIR A;  3LWF A;  2XAH A;  3KP3 A;  1ZYR F;  4JBA A;  1NHA A;  2YR2 A;  1KU2 A;  1R36 A;  5TRD A;  2HTJ A;  1F9N A;  4EJV A;  1VTN C;  1G6N A;  1I1G A;  4RAY A;  4ZZD A;  2XAJ A;  1MD0 A;  5FD5 A;  4M73 A;  1BC7 C;  3GFM A;  1YFH A;  3KP4 A;  2OZU A;  2IW5 A;  5HLH A;  2MC3 A;  5L3B A;  3ZMD A;  2P5V A;  3HSE A;  1R1T A;  4DNC A;  2TDX A;  3T8T A;  4WWC A;  4CXF A;  2XAS A;  2VOD A;  2EA4 A;  1HQC A;  1LDD A;  3MCZ A;  2KIM A;  1P4A A;  2K4B A;  3BZ6 A;  3NRV A;  4IRG A;  4U0V A;  1FBQ A;  2QM3 A;  5AIQ A;  2PI0 A;  2DTR A;  2FRH A;  1B9N A;  2M5W A;  2OA4 A;  4O3M A;  1BJA A;  5KK1 A;  1D8K A;  3TO6 A;  3ZP5 A;  2RV8 A;  2G7H A;  2FMY A;  4TV7 A;  2A6E F;  2GWR A;  2NS0 A;  1TBX A;  2AXL A;  4MNU A;  3T8R A;  3IWF A;  1HBX G;  3FMS A;  1XGN A;  1Z05 A;  1JE8 A;  3WGH A;  2HFH A;  3T0Y A;  3T1B A;  5HDN A;  1ZGA A;  4HF2 A;  3HRM A;  1T39 A;  1TTY A;  4QWQ A;  1I27 A;  2VBY A;  4N0B A;  5IT9 K;  3D5L A;  4CIC A;  4KN4 X;  2V1D A;  2FA5 A;  4F7Z A;  1XDU A;  1YQA A;  3GXO A;  3CUO A;  3EDP A;  3TOB A;  3R6S A;  3GX4 X;  3L2C A;  1QZY A;  1IRG A;  4IRH A;  1AWC A;  1SFE A;  1MDM A;  3K9T A;  1MJA A;  4FHT A;  4WCG A;  3MQ0 A;  1H0M A;  4Q48 A;  1ZAO A;  4EMS A;  2CGP A;  2K7L A;  4G7Z F;  4M72 A;  4LMY A;  4ZH4 F;  2DPD A;  2MLG A;  1ZG3 A;  1J5Y A;  4ASN A;  4YFX F;  1LVA A;  5DUI A;  2G9W A;  5D6F A;  2M1B A;  3I53 A;  5DCM A;  5H20 A;  2EFN A;  4A0X A;  3I58 A;  5DCF A;  5HOO A;  3KLN A;  1IN8 A;  3F8F A;  4MTE A;  3R60 A;  3IRR A;  2EK5 A;  1REP C;  2GIV A;  4PDK A;  3QPT A;  3GUD A;  2DQL A;  4U0Y A;  1ON2 A;  3ZQ7 A;  5ILU A;  5LEK A;  2ZNY A;  1O57 A;  3HRS A;  2F5D A;  3H3U A;  3CUQ B;  3O2P E;  2P5K A;  5DD4 A;  2QQ9 A;  2GXB A;  1SFX A;  4M9S A;  2FNP A;  3OOP A;  1LB2 A;  5JFR A;  2QYO A;  2YPR A;  1TLH B;  4LG0 A;  5CJ9 A;  1S7A A;  2EA2 A;  2QQA A;  3DXJ F;  2HYF A;  5IT3 A;  4WX9 A;  2EFO A;  2UWM A;  1USS A;  2FE3 A;  5D4S A;  4YFK F;  2FML A;  5E1Z B;  3N4M A;  3EYI A;  5BMZ A;  2L01 A;  1P2F A;  1TNS A;  1ODD A;  1ZAR A;  1H9G A;  5JR3 A;  4CZZ A;  3Q9S A;  4BQA A;  5H6Q A;  2NNY A;  2FEZ A;  3O6B B;  1MDM B;  2W24 A;  1TNT A;  2VC1 A;  4RB0 A;  1WKM A;  3WGI A;  1XSV A;  3R0A A;  1XD7 A;  4GYI A;  2F2E A;  4UVC A;  5AIP A;  3IKV A;  3GLX A;  1QPM A;  3RKX A;  4LLG F;  1G3Y A;  5K5O A;  1S8N A;  1OKR A;  2JT1 A;  4L0Y B;  5DCM B;  2HQN A;  4ZYH A;  3P7N A;  4KUM A;  5BS6 A;  3KEQ A;  2ZO4 A;  3F3X A;  1XGM A;  1R7J A;  3WTZ A;  2DK5 A;  2FBK A;  5LLQ A; 
#chains in the Genus database with same CATH topology
 5IT9 Z;  4ESB A;  2GBY A;  2ZME B;  3J81 K;  2A5W A;  4V19 K;  4EJW A;  4AIK A;  4PFO A;  2R7Q A;  3TOA A;  3WTY C;  1I6H J;  3ZQF A;  2OBP A;  3C2H A;  4YRV A;  2MC4 A;  3MMY B;  4LIU A;  3GTL J;  3HOY J;  1FOX A;  3E0J B;  1J0R A;  2EV6 A;  1SVO A;  2CW7 A;  1LE8 B;  2PMZ A;  4BQN A;  3BR3 A;  3CUQ C;  5DM6 F;  3RYP A;  4A3B J;  2A68 F;  2OC6 A;  5J8C A;  4UUS A;  1W36 C;  1SMY F;  3SFZ A;  4L18 B;  4ENM A;  1VF9 A;  3LFK A;  1U6G A;  1QO0 D;  3FXU A;  5HS9 A;  4WXH A;  3OYK A;  1JT0 A;  1O3T A;  1MJ9 A;  4AWX B;  1FEX A;  2P4W A;  3K1M A;  2HOS A;  4LLN A;  2BV6 A;  2CUZ A;  1WI9 A;  2VKV A;  2HI3 A;  2RDP A;  3AKZ A;  2BY0 A;  4GGG A;  1WJD A;  1FIA A;  4KFC A;  3ZN1 A;  1QU3 A;  1K4T A;  4I76 A;  3F8B A;  1ZRC A;  1BM9 A;  3K2A A;  1I6X A;  3ZGK A;  5GAE J;  1U8B A;  1K7A A;  1SVL A;  2DYS H;  4XKC A;  1R1U A;  3JRF A;  4I0B A;  3H0D A;  1WJ5 A;  1BR1 A;  2KIF A;  1P92 A;  2EQR A;  2LF7 A;  2KRF A;  4A2U A;  4O5V A;  1ZH5 A;  1A36 A;  1BI1 A;  5HNF A;  4UY8 I;  5E8G A;  4EJT A;  5JVT A;  2KIQ A;  4P55 A;  3W2V A;  4ZDO A;  4Z2Y A;  1VND A;  4CO8 A;  4OMZ A;  3ASN H;  1FYK A;  1SAX A;  1BR4 A;  5J6X A;  1OYY A;  3BRO A;  4AIH A;  4PJM A;  1QZZ A;  4I6Z A;  2HQR A;  1JUS A;  2H09 A;  2M45 A;  3H0G J;  5JHU A;  2VXZ A;  3S93 A;  3LFU A;  5E3M A;  4GFB A;  3TO9 A;  4JX5 A;  3WU2 C;  3WTW C;  1VQ8 I;  4RLF A;  2QKM B;  2K86 A;  2VBW A;  3JRC A;  2DDB A;  1SC7 A;  4X1E A;  3BG5 A;  2E71 A;  2WY7 Q;  2KT0 A;  2ZXH A;  2FBI A;  3SZP A;  4JYK A;  2EV0 A;  1YS6 A;  3CCV I;  1EV7 A;  3I55 I;  2O6G E;  3KP2 A;  2DA4 A;  3PFY A;  2E35 A;  2LBF B;  3DKX A;  2Z5U A;  1TWH J;  4EM2 A;  3OYF A;  3GF2 A;  2Y30 A;  3M7G A;  3P9C A;  1YX3 A;  1JTY A;  1W4M A;  5ERI A;  2DA3 A;  1C0W A;  2CV2 A;  1OQY A;  4I98 B;  4XOR A;  2BGC A;  1WH5 A;  3FF5 A;  4IHW A;  3WTV C;  2WA0 A;  4PCQ A;  4BE2 A;  1BI3 A;  1N75 A;  4E70 A;  3CF5 F;  3S3N A;  4O3M A;  1J09 A;  3S2D J;  2WBM A;  2LKP A;  4ZYD A;  4MFE A;  4J19 A;  1YO5 C;  1X1P A;  3JSO A;  3HPG A;  1X3W B;  1TT0 A;  1IXR C;  4EJU A;  2D5V A;  2V6E A;  4EM1 A;  3M3Y J;  2UXX A;  3S8P A;  3HG9 A;  2PMZ N;  1Y39 A;  1DGW Y;  3KYC B;  3VB2 A;  1XGO A;  2HXI A;  1D3Y A;  5IP6 A;  5EGO B;  3CCL I;  2BOL A;  4PK4 A;  1JJ6 C;  3IAM 2;  1SMT A;  1YTY A;  4J01 A;  5LBQ A;  2MFZ A;  5TGT A;  2ZME C;  4A5N A;  2XV4 S;  2FNA A;  2WV1 A;  3CDI A;  5HDK A;  3S16 J;  1VQ6 I;  2LK2 A;  1TQP A;  3FIW A;  2IP2 A;  4YEJ A;  3SEZ A;  1TQM A;  4RLQ A;  4WXC A;  3S15 J;  1Z7U A;  3A1Y A;  5TJJ A;  4U0W A;  3CC4 I;  5FGM A;  2JRM A;  4ZDL A;  3ZMS A;  4O6J A;  2R7O A;  3LOC A;  5FD6 A;  4EQQ A;  2DAO A;  5IYC J;  5FRM A;  2ZCW A;  4NNJ A;  4RMN A;  2VJJ A;  3NAR A;  3WTS C;  3DEW A;  3GZN B;  1YJW I;  4V2G A;  3CJR B;  4HX8 A;  2XDV A;  2DJI A;  1X3U A;  2O5R A;  2F5V A;  5JLX A;  4QTR A;  1T0F A;  1O7F A;  2WC2 A;  1KQ0 A;  3CDH A;  3PQJ A;  4XLN F;  1WGX A;  2CUE A;  2DA2 A;  2LOO A;  3BTC A;  4FQG A;  5L3E A;  2K85 A;  1BW5 A;  2L54 A;  4XID A;  2BBY A;  1MMS A;  4PJJ A;  2O61 A;  2AS5 F;  1RNL A;  2JWT A;  2VOP A;  3FXQ A;  2E5Z A;  3ECO A;  3F6O A;  1ZRD A;  2O9L A;  3PL8 A;  4ZTJ A;  3ERM A;  3F6V A;  2VON A;  3IHU A;  2JA5 J;  3H92 A;  2I8D A;  1X1C A;  1SFO J;  1TQI A;  2HYJ A;  4P9U A;  5M5Y J;  2D45 A;  1E2X A;  4AVZ A;  1WSU A;  3DTK A;  4GO1 A;  3HOZ J;  2X6Y A;  3IWZ A;  3OOU A;  1TP4 A;  4Y33 A;  5C4X J;  2DI3 A;  3WE2 A;  4CCN A;  3G73 A;  2H1L A;  3CLQ A;  3DTI A;  5H6R A;  4LB5 A;  4XL9 A;  2XPV A;  4BUP A;  3LST A;  5LHI A;  4IF4 A;  3LSR A;  3QPH A;  5HDG A;  2PX9 A;  2EIL H;  2FF4 A;  4XQF A;  2EB7 A;  2AXT C;  3GME A;  3RKY A;  1B9M A;  3OYD A;  2JPC A;  2H94 A;  1X2N A;  2X6O A;  3B02 A;  3SDB A;  2ID3 A;  4CGZ A;  5M5X J;  2V1U A;  1UFM A;  3TMO A;  3KP5 A;  3U1K A;  3PSF A;  4BKX A;  3S1Q J;  5E20 A;  3J81 Z;  2QWW A;  3D5S C;  3G1L A;  3QU6 A;  3VFZ A;  3WTT C;  2Y31 A;  2LH9 A;  1OYW A;  3ZQQ A;  4BAY A;  3ASO H;  4E7S A;  4LIV A;  1T98 A;  4XSX F;  4HLX A;  2MH2 A;  2XAQ A;  5C3E J;  1I5Z A;  2GA2 A;  3C3W A;  1IDY A;  1E3H A;  2F5F A;  1R23 A;  2VPR A;  2EFW A;  4IXA A;  1F43 A;  3QYF A;  4MO7 A;  1GXP A;  1J75 A;  1U2W A;  3UR3 C;  2FQ3 A;  3CTA A;  3S1R J;  4A69 C;  4OMY A;  5IY5 H;  2XC7 A;  4UVB A;  1U3E M;  2JZY A;  3MWM A;  4MEX F;  1QHG A;  5EEA A;  2XRN A;  1KGS A;  5HOD A;  2E1O A;  1G59 A;  3ELK A;  3L09 A;  4Q5S F;  2EIK H;  1G8X A;  2DFI A;  2L4A A;  2XGX A;  5FKM A;  1ON1 A;  3DEU A;  4OIR F;  4YIR X;  1HKS A;  5F64 A;  4XRF A;  3BZK A;  4GCV A;  1HOM A;  1FX7 A;  1WJE A;  2A05 A;  1UJ8 A;  5D5V B;  1BJZ A;  2BEO A;  2F48 A;  2WAQ A;  1RR8 C;  4MIM A;  1H9T A;  2LP0 A;  2COB A;  1BN5 A;  1IUF A;  3C2G A;  2STW A;  4KDP A;  2J5P A;  2WAE A;  5CVV A;  1GV2 A;  2Q1Z B;  3QP5 A;  3KZI C;  4BGD A;  3WG9 A;  3P5J A;  4R79 A;  3TW6 A;  2ZBK A;  2XRL A;  4CZC A;  3G1O A;  2NOG A;  3OSF A;  3HYI A;  2ID6 A;  2CG4 A;  3H5A A;  5J40 A;  3K0L A;  5IYB J;  2LKS A;  3S2W A;  2R7X A;  1G3T A;  1YLF A;  2VOO A;  2KRH A;  5D4R A;  2WAD A;  1FOK A;  2LFB A;  2P0W A;  3CMA I;  1W36 D;  1S7E A;  3KEO A;  4FX0 A;  2I5U A;  3I59 A;  1AKH A;  3OL3 A;  4I99 C;  2HNH A;  4CUG A;  1HC8 A;  1MGT A;  2CW0 F;  4KIF A;  2KIU A;  3R61 A;  3EUA A;  4CHU A;  3VDX A;  4OOI A;  4UHT A;  4U88 A;  3CCS I;  1H88 C;  2DCE A;  3KZZ A;  2FUG 2;  1O3S A;  1XS9 A;  2DOD A;  4K2E A;  4MGR A;  4HSR A;  1S6L A;  3BT9 A;  1UHS A;  3CUQ A;  1YIO A;  3FMQ A;  4QPO A;  5IPA A;  1GT0 C;  2L7K A;  2XAF A;  3LAP A;  2NNN A;  4MFD A;  3CP8 A;  3ULQ B;  2JN6 A;  3K70 C;  4Y17 A;  5LGU A;  3NQO A;  2X0L A;  4I02 A;  2L3D A;  2VIX A;  3JRA A;  1LKX A;  2H6B A;  1ONV A;  3V7S A;  5HVQ C;  1MIJ A;  3HZJ A;  3HOS A;  3V8K A;  3H9Q A;  2HZT A;  2DMU A;  2ZB9 A;  2FX0 A;  3CO7 C;  2E2J J;  1GV5 A;  3Q9V A;  1IGN A;  2ACJ A;  2CWE A;  4RGR A;  4A6D A;  3OIP A;  3UNG C;  3GTQ J;  4PGG A;  2GXG A;  1BIA A;  1IN7 A;  1FMW A;  2JK3 A;  3K6G A;  4RGX A;  2JMW A;  4BHB A;  2DW4 A;  4L9N A;  3B6C A;  2GIZ A;  3G3Z A;  1XX5 A;  4IZZ A;  4PGH A;  1Q1V A;  4ON0 A;  3JTG A;  4LK0 F;  2ZXI A;  3MKY B;  2JPB A;  3ZPL A;  1W7P B;  1AOY A;  2CH0 A;  1B1B A;  1QGP A;  1OFC X;  2RN7 A;  1LVK A;  2PMU A;  2E2I J;  4L0Z B;  3HBL A;  3H5N A;  2R4G A;  5E8I A;  3RQ4 A;  3V4G A;  3S2H J;  1D1C A;  4ENK A;  1WFX A;  1B8I B;  3W2A A;  1J9I A;  2K9N A;  4D5C A;  2DN0 A;  3S14 J;  4XR6 A;  1P4W A;  5LRS A;  4WF2 A;  2TRT A;  2WAQ N;  4A3G J;  2CS3 A;  3FBN B;  3TP3 A;  1PP8 F;  1TW3 A;  2KDO A;  2OZ6 A;  2DU9 A;  2XAG A;  4CDG A;  1XSX A;  3E6M A;  5ICG A;  5JLW A;  1S72 I;  3NEU A;  4KN7 X;  2R5Y A;  2IGN A;  2QLZ A;  2K9Q A;  1KU7 A;  2WAF A;  1XDS A;  1LDJ A;  2WY8 Q;  3KCC A;  4G94 A;  5E3O A;  2O3F A;  3GLL A;  4V2F A;  2DXI A;  3QOP A;  1OCZ H;  1Y0U A;  1FZP B;  1IZ1 A;  3ESW B;  2A6H F;  2HDD A;  2FU4 A;  1KU3 A;  2XSD C;  3F8M A;  1X1B A;  3R4K A;  4E7I A;  3HRT A;  3LA2 A;  2VLA A;  1YX5 A;  1Z3Y A;  3RYR A;  4A3I J;  4HW0 A;  2ETH A;  4KYW A;  3VPR A;  4BAC A;  3JAM K;  3H3Z A;  4IKF A;  3RPQ A;  3BZC A;  2GZW A;  1JGS A;  2OJE D;  3H9J A;  4E7H A;  1MZB A;  3K2Z A;  4A0Z A;  3KP7 A;  3KFW X;  2EWN A;  1XN7 A;  1A6Q A;  2LD5 A;  2ISY A;  3BR2 A;  2R5Z B;  3DTE A;  2KPM A;  3ABL H;  2JVH A;  4HF0 A;  4P96 A;  4UV9 A;  4HOB A;  1GUU A;  5GTH C;  1HST A;  2K9S A;  1WPK A;  2HOT A;  2ELJ A;  2VN2 A;  4HV5 A;  3CP2 A;  3FXO A;  4EV0 A;  4NC8 A;  3LAJ A;  4QLC U;  1FTZ A;  2XRO A;  2PEX A;  1UB9 A;  2DFE A;  4C3H J;  1TWC J;  2Z33 A;  2ZME A;  1MND A;  1ZLJ A;  1S29 A;  1VQN I;  1HW1 A;  3I59 B;  2YU9 J;  2RAE A;  3BJ6 A;  3AFH A;  3H5R A;  3MZH A;  2CSO A;  3ZMU A;  3KYL A;  1SD6 A;  2NRA C;  3SXY A;  5BQT A;  4PSW A;  4YIF A;  2RC4 A;  4A5M A;  1O3Q A;  3IRQ A;  5AON A;  2LG4 A;  5E17 F;  1ZGW A;  2ZXW H;  3M07 A;  2C6Y A;  4Y7N J;  2E1C A;  2OPT A;  3BC8 A;  3OYH A;  3E97 A;  3ABT A;  3W6V A;  2HVS A;  3L00 A;  4P5O A;  1G3W A;  2J5O A;  1T38 A;  1K4S A;  2P5L C;  3DBL B;  1GLN A;  4DW6 A;  3V8J A;  2W1O A;  2OQR A;  1ZRE A;  3CES A;  3DBH B;  5L3D A;  4HZF A;  4S05 A;  1YYV A;  2WTE A;  4HDU A;  1ZLK A;  3F0C A;  4F91 B;  3ML6 A;  1QVU A;  1R00 A;  4OIN F;  1ZEL A;  4F52 A;  2A61 A;  2X9D A;  1LDK B;  2BY2 A;  4DYC A;  1HW2 A;  4U7B A;  4BBS J;  4F93 B;  1SAU A;  1ZG5 A;  3OL4 A;  3HGY A;  5C4J J;  1XMA A;  1BI0 A;  3ECH A;  2VPL A;  3FXJ A;  3TW7 A;  2OF7 A;  4Q47 A;  3GTM J;  1XGS A;  5D8L B;  2AQE A;  3HTU A;  1BW6 A;  5F6F A;  3A01 B;  3TKY A;  4CYD A;  1QRY A;  4I09 A;  4AUX A;  2VE8 A;  2L02 A;  2HPM A;  4LFU A;  2DOA A;  4L9T A;  2QUF A;  3O3K A;  1X3Z B;  3JRH A;  4BXX J;  3SFI A;  2VT3 A;  2OQG A;  1ZRF A;  1V54 H;  4G9Y A;  3HDD A;  1V5G A;  2OCC H;  4EM0 B;  3FXK A;  4B4C A;  3T5X A;  3S1M J;  4RAZ A;  3JRG A;  3DFG A;  2R5Y B;  5K7Z A;  1MW7 A;  2UV1 A;  3HEF A;  2E1N A;  2HOA A;  3HSF A;  1UMQ A;  2HDC A;  3Q0W A;  2DFF A;  3OYN A;  2VAS A;  4PZJ A;  1W5T A;  3LSJ A;  1MBH A;  3G6E I;  3F9K A;  4KIB A;  3IAS 2;  1OCO H;  1HCR A;  3TDU C;  3A0H C;  3G4S I;  3EET A;  4LGW A;  2XB0 X;  2Y69 H;  2GQQ A;  3AAF A;  1LNW A;  3I4M J;  3A4C A;  4XN0 A;  2VBZ A;  2DJN A;  1RKT A;  2EIJ H;  4IQJ A;  2GXA A;  1MSF C;  2FXA A;  3E5X A;  3SJM A;  4BY7 J;  2A69 F;  2VUM J;  2CMP A;  2IBD A;  2DQR A;  2KMU A;  3VYR B;  2QVO A;  4R1H A;  5EGO A;  1IW7 F;  5ILS A;  1EA3 A;  1HXD A;  1Z67 A;  2P81 A;  3CZ6 A;  4C3J J;  4OAZ A;  4XN3 A;  5EF6 A;  2PQ8 A;  1OCR H;  5D5W B;  1XMX A;  3WGG A;  5DYM A;  3BY6 A;  2JA2 A;  1K78 B;  2B0L A;  3AG2 H;  3GFJ A;  2XB5 A;  1YIJ I;  2EJR A;  3BPX A;  1I39 A;  2EFQ A;  2HZD A;  2VJ5 A;  4L9V A;  2D1H A;  1N25 A;  5K5R A;  2QEN A;  3FXR A;  3QQA A;  2OAZ A;  2XF7 A;  4HYE A;  5HNH A;  5E18 F;  1UZC A;  2PLY A;  2BYV E;  2K5C A;  3K70 D;  3U9G A;  1PP7 U;  2VC0 A;  3CMY A;  4DBQ A;  1IJW C;  3DKY A;  2HR3 A;  3QOD A;  3K4J A;  4AM3 A;  1STZ A;  5CVR A;  3JW4 A;  3H35 A;  2IPQ X;  3JRI A;  1ETV A;  3FM5 A;  2E7X A;  5DTD A;  1ULY A;  3I71 A;  2QSG X;  1TZL A;  1IXS B;  1G2H A;  2ISZ A;  4L5J A;  4H4K C;  4OU0 A;  2LRE A;  4PFP A;  1U5T B;  3W3C A;  4N9I A;  3ISP A;  4IX7 A;  3UKG A;  3HKZ N;  4HRI A;  3VEP A;  1YE9 A;  2DLL A;  2B9S A;  2V1X A;  3LA3 A;  1FMV A;  3L1P A;  1FP2 A;  5DV5 A;  3IC7 A;  2X1E A;  2WB1 A;  3JAM Z;  1HA8 A;  1F4K A;  1S7O A;  3HOW J;  3FMR A;  2ZSI B;  1MBK A;  3FKJ A;  1CF7 A;  3C18 A;  3H9G A;  3RSN A;  2IGO A;  1UST A;  1Y1V J;  2R7F A;  3ZRG A;  1OYI A;  3DPT A;  3H1C A;  2KL4 A;  3DKW A;  3KE2 A;  1MBE A;  4BJ6 C;  1BOB A;  2DYR H;  4CCM A;  5K7F A;  1PUE E;  1JUP A;  1H8A C;  2W84 A;  2NS8 A;  2M34 A;  5BPI A;  4KIC A;  2DO7 A;  2IA2 A;  4JQF A;  4XBF A;  1IAW A;  1HKT A;  3M8F A;  3BCB A;  1GXQ A;  2HOE A;  3PIO F;  4IOA F;  3DF8 A;  3K4L A;  2BXY A;  5CQG A;  4XRS A;  2LRD A;  3CJN A;  5F1J A;  3LSG A;  2CQ7 A;  2EIM H;  2VQL A;  3FK7 A;  2QBY B;  5CLS A;  2W00 A;  2IEK A;  1RES A;  2JRT A;  4IJA A;  1XCB A;  3GFL A;  4RAF A;  5CVU A;  3OYL A;  2DMN A;  3KYD B;  3MZY A;  3K4C A;  1FWZ A;  2NS7 A;  2DA6 A;  1P7I A;  5L3C A;  1LUJ B;  2OD5 A;  4RGU A;  4ZYG A;  1OLT A;  4QIW N;  4ITV A;  4N9H A;  2QSF X;  4XNF A;  1V5E A;  3OSG A;  3KEY A;  5HS8 A;  4Y13 A;  2BY3 A;  3WG7 H;  5E1W A;  2L7M P;  2HTS A;  4ESF A;  1RUO A;  2V1N A;  2OU2 A;  4UXN A;  1KZH A;  3FBI B;  1TWG J;  2K4J A;  3E7L A;  3RDI A;  2O8K A;  1EH6 A;  3EUH C;  3RJP A;  1DQU A;  5E3N A;  3RPU D;  3MAJ A;  3D5R C;  4YII A;  3COA C;  3DCF A;  2K9M A;  3TED A;  2P6T A;  4I0A A;  2Z3Y A;  4I2O A;  3RQI A;  2GAU A;  2Z1D A;  4IRI A;  2ESH A;  2MGQ A;  4RA2 A;  4L9J A;  1HDP A;  5M5W J;  1JHH A;  1XTA A;  1H89 C;  4OIP F;  1ITY A;  2FOK A;  3CQZ J;  1FPQ A;  1FIP A;  2M4K A;  4HAM A;  1Z91 A;  1KQ9 A;  4JP0 A;  1MMN A;  3U2R A;  5BOX A;  3RPU A;  5E79 C;  3M1C A;  4A3J J;  3EUK L;  1ETX A;  1ZTR A;  3NAU A;  3VOE A;  5LHG A;  2IS4 A;  4L5I A;  1IF1 A;  1TC3 C;  3F72 A;  1KQ8 A;  4BEH B;  1V5F A;  1JGG A;  5LEJ A;  2L5Q A;  4LK1 F;  1IN4 A;  2EIN H;  4XK4 A;  2HQ5 A;  2WB1 N;  3I4N J;  2HPI A;  2QQ8 A;  4EGZ A;  1RI7 A;  1EKE A;  2W85 A;  2D1V A;  1FLI A;  4HF1 A;  2DK8 A;  5LRR A;  5E1X A;  2FQ4 A;  2H6C A;  3W2W A;  2IS2 A;  1CGP A;  1X19 A;  1FBS A;  3OYJ A;  1EH8 A;  3CMM A;  5D6E A;  1VI0 A;  3I9V 2;  1A5J A;  1WVR A;  3LA7 A;  1VQL I;  2IRF G;  2FOW A;  1U5T C;  1ACI A;  4BXU A;  4IHT A;  1YRN B;  3MZ8 A;  2BVM A;  1OPC A;  1RIO H;  2RKH A;  2CO5 A;  1GHC A;  2ZJ2 A;  1DPR A;  2JJ7 A;  2O03 A;  4ZTF A;  2NVX J;  3HHH A;  2QCO A;  1F36 A;  1Z3X A;  4NDL A;  2ZJR F;  1IN6 A;  3O8H A;  2M2E A;  3MVP A;  5J1U A;  2V6C A;  1W7P D;  1SD4 A;  1CF7 B;  4MHG A;  2FSW A;  1CQT A;  5ICC A;  2E5N A;  1W1W E;  2MYS A;  4DGW B;  1LJ9 A;  4J00 A;  2P8T A;  3CCU I;  1TW2 A;  4FT8 A;  1MJB A;  1WRJ A;  3BCA A;  2F5E A;  2VQG A;  3PNY A;  4AYB A;  4ZZL A;  2HU9 A;  4GYG A;  5L3G A;  2DPU A;  4M3E A;  1VZ0 A;  3CC2 I;  4G7H F;  3BG6 A;  2VQH A;  2XPW A;  1W7P A;  2H1K A;  2OTJ I;  2Y9Y A;  4E7L A;  3RI4 A;  3E6C C;  2Q2E B;  5LHH A;  2CRG A;  3ONQ A;  5EG0 B;  2XGC A;  2DA7 A;  3ZQG A;  1L3L A;  1B8I A;  4LIT A;  3AG1 H;  1FP1 D;  3HJE A;  2K27 A;  2MH9 A;  2NVY J;  4NC7 A;  4P1W A;  4BHP A;  4BQO A;  1POG A;  5CQE A;  6PAX A;  2EFP A;  3EQL F;  1DU6 A;  3BG9 A;  3JCU C;  2EZK A;  1BA5 A;  3RZD J;  4M6X A;  1QPI A;  1W0T A;  1QQI A;  2HXO A;  2X6W A;  2HKX A;  3HPH A;  1QNT A;  3V8L A;  2X85 A;  5FLX K;  1Z6R A;  5LFA A;  1KA8 A;  3TDZ C;  2HS5 A;  3A03 A;  2YU3 A;  2FJ1 A;  1XCV A;  2CFO A;  1MMD A;  2DT5 A;  3PUF A;  4HNV A;  1DU0 A;  1FBU A;  1R4N B;  4UVA A;  3LSP A;  2DTZ A;  2F5C A;  2XHK A;  4Y3O A;  4M3B A;  4CSW A;  2M87 A;  3LL7 A;  2P7V B;  3HXL A;  3DV8 A;  1JUM A;  1BOA A;  3WTU C;  1Y8Q B;  1O4X A;  1XMK A;  3VSK A;  1R6R A;  1XSD A;  1OMI A;  2R5Z A;  3U1D A;  3DPL C;  4DIQ A;  2Z9O A;  1NG6 A;  2EPF A;  1LPQ A;  5B66 C;  1QBJ A;  3GTG J;  3GO5 A;  4LJZ F;  3HL2 A;  1TWF J;  1V55 H;  2QZ8 A;  2JA6 J;  2A5Y B;  3M4O J;  5FRN A;  3SYT A;  3GYH X;  4MEY F;  3WE3 A;  3ZMV A;  1JKP C;  2HDW A;  4LB6 B;  1WWX A;  4IQ4 A;  1SD5 A;  4FET A;  3JRE A;  4PJL A;  3IH4 A;  3VSL A;  3J7A O;  3ERE D;  4KNY A;  5F0H A;  1MBF A;  1T08 B;  1QVT A;  1MH3 A;  3KET A;  4UB8 C;  3B73 A;  1V4R A;  1Y56 A;  3BP8 A;  2QSH X;  3I54 A;  4BJT A;  1LFP A;  4D5F A;  1EH7 A;  3GTK J;  3ZN0 A;  2M7A A;  2MD0 A;  3RZO J;  5J3L A;  2IT0 A;  1RUN A;  3F8C A;  4EGY A;  4CYC B;  5M3F J;  4OIQ F;  2BW3 B;  2XUB A;  3TL4 X;  2O0Y A;  2KQR A;  4AYB N;  1IRZ A;  2W57 A;  4PSX A;  2HVQ A;  2V9V A;  3OYE A;  1K79 A;  3BOQ A;  3M1E A;  4KT6 A;  2NVQ J;  3F22 A;  4ESJ A;  1ZR2 A;  3J80 Z;  3WOD F;  1LFB A;  2B7E A;  4RM3 A;  4RB2 C;  3SDG A;  4B44 A;  3WTX C;  4LG3 A;  2MD5 A;  1Z21 A;  3OMY A;  1Z77 A;  1N77 A;  3VWB A;  4EAT A;  2PG4 A;  1IG7 A;  4GXO A;  1B59 A;  4B48 A;  1DPU A;  2H8R A;  3SHF A;  2M9H A;  1KON A;  1YW9 A;  2V26 A;  1MBJ A;  2EV5 A;  3QOE A;  4M74 A;  3PO2 J;  1YG2 A;  1I1S A;  2GLO A;  4BS9 A;  2UXN A;  3MEX A;  1FYL A;  3F23 A;  2VJ4 A;  3PNT A;  3CF2 A;  1O3R A;  2RNG A;  1ZHF A;  2Y48 A;  3DU5 A;  4MQ9 F;  1U78 A;  3IKT A;  4UUT A;  3U21 A;  1WJA A;  2V9K A;  4R8H A;  3A01 A;  1R5G A;  3OV8 A;  1BC8 C;  4FAS D;  2V9P A;  1IRF A;  4IEJ A;  3IH2 A;  2VE9 A;  2DMQ A;  2BZT A;  4A3E J;  3I5U A;  4D1Q A;  4A3L J;  3C7J A;  1FTT A;  1ZN2 A;  3MKW B;  1IRX A;  3BPV A;  4KT5 C;  3PM1 A;  3QYE A;  1FJL A;  2Y0M A;  1K6O A;  1NK2 P;  5EYR A;  1BI2 A;  3K1P A;  2BVL A;  1Z6T A;  2DT6 A;  4C9Y A;  4A3M J;  1LQ1 A;  1OIS A;  3PFI A;  2RNJ A;  3CDL A;  4XKV A;  4P9F A;  1ZQ3 P;  2MSY A;  4HLY A;  4MLO A;  2LY2 A;  2MLK A;  4XLA A;  3HHG A;  1A04 A;  2A3S A;  2E7W A;  4AC0 A;  1IV6 A;  5DM7 F;  3ZMZ A;  4E4H A;  2QQB A;  1UCR A;  5FFZ A;  1F5T A;  3RTR A;  3EUH A;  5FO5 A;  2P7C B;  2M7B A;  2JA8 J;  3PUB A;  4Q4Z F;  2GA1 A;  3GW2 A;  1I3Q J;  4D7M A;  3OY9 A;  5K1Y A;  1PUF A;  1BR2 A;  3E3V A;  5ED4 A;  4BYY A;  2NYX A;  4B8X A;  2K02 A;  1TL8 A;  2V79 A;  2AO9 A;  3J7Z I;  2MAB A;  1FYM A;  3D0S A;  3E5Q A;  2YX7 A;  2HYG D;  1X4P A;  5DEQ A;  2ICW G;  2A07 F;  5JI6 A;  2KHM A;  2M3A A;  2XKO A;  1WQ2 A;  5IP9 J;  4M6Y A;  4N4O B;  5CVJ A;  1A35 A;  1D1A A;  2L9N A;  2IXS A;  1J59 A;  4DYQ A;  1YOV B;  4Y15 A;  1K78 A;  1IO2 A;  2I10 A;  2QKL B;  4B3A A;  2HQA A;  4I01 A;  5F1R A;  3LMM A;  1IXC A;  2A6T A;  1E3O C;  1T56 A;  1UG2 A;  1JKQ C;  3PO3 J;  1HDD C;  2LSO A;  3TQN A;  4UNO A;  1Z1D A;  1OCT C;  4ZYE A;  3K69 A;  1W5C C;  3DQV C;  2L4M A;  1LEA A;  2O7O A;  3GWZ A;  1S9H A;  3BQZ A;  1B4A A;  1R49 A;  1U9N A;  2IGK A;  3HOU J;  4MQV A;  2X51 A;  3BWG A;  4XOP A;  5L3F A;  1BBY A;  2DA5 A;  4ZYA A;  1UHM A;  1M1E B;  5GPA A;  3LSK A;  2LDU A;  4A0Y A;  3BTI A;  2KIS A;  1HSJ A;  5EJC A;  2ME6 A;  5FLX Z;  2M8E A;  1VQ7 I;  2CQK A;  1XPX A;  1ZGJ A;  2Z16 A;  3BDD A;  4A3C J;  1FC3 A;  1R5H A;  3E6B A;  1U5T A;  3GFI A;  2UZK A;  4HX7 A;  1P6R A;  4HX4 A;  4ZDP A;  2L0K A;  4G8X A;  1R58 A;  1OCP A;  1K83 J;  2QF7 A;  4DQ2 A;  4A6E A;  3OS1 A;  3S17 J;  4PUS A;  4FIS A;  2K3F A;  3BR5 A;  1PDN C;  3B6A A;  2CV0 A;  3P9K A;  4F92 B;  3JRB A;  3ABM H;  2LR8 A;  2ECC A;  4KA4 A;  4DJA A;  4C2U A;  3O8G A;  4RM2 A;  2X1D A;  3RKQ A;  3BJA A;  4JK1 X;  4Z6Y A;  3QU3 A;  1YW7 A;  4D0P A;  5ICE A;  4B09 A;  2OCE A;  3GTP J;  3HTS B;  5K5Q A;  5CVI A;  3K1N A;  5FKO A;  1X1A A;  4IHS A;  3BLY A;  3A02 A;  1ZG1 A;  3OYG A;  2MBF A;  2Q0O A;  2JSP A;  4G7O F;  3QYB A;  3I64 A;  5KVR A;  5B1B H;  5D5X B;  4ZJZ A;  4YFN F;  1WJB A;  3OWT A;  3V7C A;  2QBY A;  1YS7 A;  4FX4 A;  5F0F A;  4G6Q A;  5EEG A;  2BY1 A;  3ZMT A;  1DP3 A;  3F8N A;  3HSR A;  5BPD A;  2ELH A;  4HA8 A;  5CPR B;  5J8F A;  4ETS A;  1FT9 A;  3F21 A;  1S5L C;  2F4M B;  1T2K A;  1KYW A;  2X1C A;  5IOZ A;  1SD7 A;  1QHH D;  3HC7 A;  2VKE A;  2BE5 F;  4G6D A;  1MMA A;  5GAH J;  3CCJ I;  1R9T J;  5HS7 A;  1DP7 P;  1TWA J;  2MG4 A;  3SZG A;  4LD5 A;  4C2T A;  1T6S A;  1YJ9 I;  4I7H A;  2IJL A;  4HQE A;  3NWT A;  1DUX C;  2M30 A;  1X2M A;  3C2B A;  1PUF B;  2HEO A;  1E3P A;  4XSZ F;  1MMG A;  4AVP A;  2RGV A;  3CO6 C;  2JVG A;  3FXM A;  2RRE A;  1E17 A;  4XON A;  2COM A;  1DDN A;  2CYY A;  4ENN A;  4IPA A;  4KMF A;  4NC6 A;  2W4S A;  1JHF A;  5LGN A;  5E3L A;  4BDZ A;  1F1Z A;  2GOX B;  2LMD A;  2YX4 A;  2QGU A;  4D7N A;  2HWV A;  2XIG A;  4M3F A;  1LEB A;  3E6D A;  2L9V A;  2W25 A;  1P4X A;  2EBI A;  5IP7 J;  4AU7 A;  2STT A;  4HBL A;  9ANT A;  4AD9 A;  2ZC2 A;  4E7K A;  2ECB A;  1A31 A;  3EPZ A;  1L0O C;  4WK8 F;  2CUJ A;  3CCE I;  1KU9 A;  1D8J A;  2YSR A;  2X4H A;  4BEH A;  1O7L A;  4ZC3 A;  1FY7 A;  2HGC A;  3M9A A;  5A2Q K;  4DYR A;  3KX2 A;  1U0J A;  4B1R A;  4UUV A;  3KLO A;  4IO9 F;  1GDT A;  3CLO A;  5HLG A;  3BQY A;  1UAA A;  1Z7L A;  4U7D A;  2WWY A;  3VOD A;  2R7W A;  3HRU A;  1ZR4 A;  5F04 A;  2VT2 A;  1P9Q C;  2IA0 A;  1JKR C;  2RVC A;  4KIG A;  5FLV A;  3SQN A;  2ZKZ A;  2R7R A;  1FOY A;  1B72 A;  3DWL E;  4JOM A;  5EZG A;  2DBB A;  3CCQ I;  5CYV A;  3W6K B;  4BU2 A;  1W5S A;  3BJO A;  1UHW A;  1T95 A;  4BNC A;  4DOZ A;  2DOF A;  2Q8K A;  1YRN A;  1JJ8 C;  2LF8 A;  3HB9 A;  3W6J B;  5D8K B;  5EEH A;  2LYC A;  1HLV A;  4JX4 A;  1YW8 A;  3FXL A;  5KAF C;  1JT6 A;  2P6S A;  5B1A H;  3G1M A;  2G0E A;  3FWE A;  2JSC A;  4M3D A;  1Y8R B;  4BQQ A;  1FSE A;  4C3I J;  4CCK A;  4AIJ A;  4CA0 A;  2R7U A;  3GCM A;  4EVI A;  4M71 A;  2E2H J;  1U8R A;  1QA6 A;  2KDZ A;  1Q1H A;  1K61 A;  4FE4 A;  5DDG A;  2BHZ A;  4IHY A;  3QP6 A;  2ZNZ A;  3I0T A;  1FNN A;  2GM4 A;  4RGS A;  3WU0 A;  3I3L A;  3SEQ A;  2W7N A;  1ETK A;  3LQR A;  1B6A A;  1RET A;  1VQ9 I;  4LG0 B;  3PNV A;  2NAZ A;  1D5V A;  3ABU A;  1ETQ A;  5C44 J;  2GOM A;  4ENJ A;  3WU1 B;  5ILV A;  2R3S A;  1R71 A;  1IC8 A;  1X4O A;  1RZ4 A;  2HKO A;  4UV8 A;  2RQP A;  2Q2E A;  2IA1 A;  4RBO A;  1RC9 A;  3AL0 B;  1MNE A;  3HUG A;  5JHF A;  3OR1 C;  1D0Z A;  1SVM A;  2IVM A;  5EG0 A;  4E7J A;  1VQ4 I;  1R22 A;  3L2R A;  4S0H B;  3BR1 A;  2MA3 A;  4GRI A;  3D1N I;  1VQP I;  3V42 A;  1U9O A;  4JX6 A;  1XG1 A;  4XLH A;  1P7J A;  4PJ0 C;  2EH3 A;  2KKO A;  4A12 A;  3MKZ A;  2VBX A;  4C30 A;  1IUY A;  4PJN A;  1HKQ A;  5F27 A;  2M8G X;  3ZR8 X;  2PJP A;  2ZXJ A;  3G2B A;  2DOE A;  3SZT A;  2YS9 A;  1IDZ A;  3REO A;  2LNB A;  5JVG F;  4A93 J;  4M9X A;  1JXS A;  4KIT B;  1RRJ A;  3M8E A;  2BXZ A;  2KJC A;  3FIS A;  2XAU A;  4HEA 2;  3J80 K;  2KFD A;  2JQ7 A;  2CW8 A;  2CQN A;  4B3X A;  5KHD A;  3PQK A;  5J4V A;  2VKH A;  3GZ5 A;  3OYC A;  3HOT A;  5ICF A;  3IL2 A;  3L9F A;  1GVJ A;  2ZJQ F;  4F55 A;  2CJJ A;  4E6K G;  1R1V A;  1MKM A;  4A3F J;  3R0J A;  4IL6 C;  1HW5 A;  2PBI A;  3VYS B;  4IHX A;  3K10 A;  2CFX A;  2F4I A;  3E5U A;  4BH9 A;  2JTV A;  3EYY A;  5FJ8 J;  3QAH A;  2D2W A;  3I4P A;  2ESN A;  3MFK A;  1AA7 A;  1J7K A;  3P9I A;  1MSE C;  1N78 A;  1G3S A;  2E19 A;  2LY9 A;  2L7Z A;  3TGN A;  4XRM A;  3GEZ A;  3QRF F;  3FX3 A;  1KYZ A;  5GAG J;  4RB3 C;  1UEL B;  3HIF A;  1Z0X A;  4NQW A;  4XRS G;  3DLA A;  5J4Y A;  1RKW A;  2E36 A;  5HLI A;  1OR7 A;  3KP6 A;  4BE1 A;  3ROU A;  4BHC A;  2QA4 I;  2IGM A;  1NG7 A;  1PVE A;  3RKW A;  2XVC A;  3L7W A;  1SEU A;  2R7Z J;  3LSH A;  2Z99 A;  3ZOB A;  4RB1 A;  4NB5 A;  1S3J A;  4RDU A;  3GVA A;  4OIO F;  4CYC A;  1B72 B;  2BW3 A;  2H27 A;  4N4N B;  4HDV A;  3KZY A;  4M3G A;  2G7U A;  3JRD A;  2WV0 A;  2Y75 A;  3C1D A;  3WHB A;  4RS8 A;  2KJB A;  4WXD A;  5DD8 A;  4KIS A;  4QPQ A;  4HNU A;  4L5E A;  1FSH A;  2VB6 A;  4UUS B;  4IHV A;  3G71 I;  3GZ6 A;  1G4D A;  3K4N A;  5FFX A;  1Y1W J;  4NBQ A;  1ZKG A;  5FB2 A;  5IOY A;  2H8W A;  1WZ2 A;  3PJR A;  2ADU A;  2M0M A;  3FM3 A;  5LGT A;  5J1Y A;  1IV8 A;  3ZXS A;  4B43 A;  2MW8 A;  3DP7 A;  3FZV A;  3JTH A;  3FHZ A;  2W82 A;  1XB4 A;  3ZQL A;  2ZFW A;  2DMT A;  1V3F A;  2O8X A;  4XLE A;  3HM5 A;  5GAD J;  5EZH A;  2F4O B;  4HQM A;  1I50 J;  2XKP A;  1OJL A;  4LLL A;  4DZP A;  3V7R A;  4S04 A;  3L2W A;  3LQQ A;  4BXF A;  4E7Z A;  3Q0V A;  4MTD A;  1MH4 A;  2E60 A;  3AL0 C;  5GPC A;  2PN6 A;  2Y0S A;  5D5U B;  1J2X A;  1IN5 A;  3HUG B;  1SFU A;  2ZFU A;  4YG2 F;  5A2Q Z;  1BIB A;  3TO7 A;  3JSP A;  3VYU B;  4KMU X;  4XLP F;  2R7D A;  1NH3 A;  2PFB A;  3K4B A;  4EJO A;  4H0E A;  2ME0 A;  2PMH A;  2JUG A;  4IVN A;  1K6Y A;  3ZQH A;  3CJT B;  1QZE A;  1TT5 B;  3FKI J;  1EJ9 A;  1Z9C A;  4M9Z A;  3N97 A;  2BHY A;  4HV6 A;  4NHJ A;  3Q5F A;  5EDN A;  5DUK A;  3RIR A;  3LWF A;  2XAH A;  3KP3 A;  1ZYR F;  4JBA A;  1NHA A;  4BDY A;  2YR2 A;  2XGE A;  4ABZ A;  5F0C A;  3ABK H;  3S1N J;  1KU2 A;  4DBR A;  1R36 A;  5TRD A;  3AG3 H;  2HTJ A;  1F9N A;  3BTJ A;  2PJR A;  1WH7 A;  4EJV A;  1VTN C;  1G6N A;  1I1G A;  4RAY A;  4BJ5 C;  1BL0 A;  4ZZD A;  2VXD A;  1VQ5 I;  1ETW A;  2XAJ A;  5F08 A;  2LKX A;  1MD0 A;  4XLF A;  2LTP A;  5FD5 A;  1W0U A;  2XSJ C;  4M73 A;  1BC7 C;  3GTO J;  3NWS A;  3GFM A;  5M3M J;  4UB6 C;  1YFH A;  4OAY A;  4HNT A;  3MN2 A;  3KP4 A;  5KAI C;  2OZU A;  4NUB A;  2JUC A;  2IW5 A;  5HLH A;  2E1M B;  2EZI A;  1VQO I;  4X6A J;  2MC3 A;  3ZQC A;  3MD2 A;  2DFH A;  5L3B A;  5LD2 C;  4NQW B;  3ZMD A;  2P5V A;  3DU6 A;  3HSE A;  3Q0U A;  1R1T A;  1ORK A;  2W48 A;  4DNC A;  4HG2 A;  3RCO A;  4FTH A;  2TDX A;  2NXN B;  1OCC H;  3T8T A;  1VFC A;  3S3O A;  4WWC A;  4CXF A;  1YHQ I;  2XAS A;  2VOD A;  2EA4 A;  1HQC A;  1ZK8 A;  2CV1 A;  1LDD A;  3IV5 A;  5LLQ A;  3CCY A;  1MNM C;  2NVU B;  3MCZ A;  5IYD J;  2KIM A;  1P4A A;  3BZ6 A;  2K4B A;  4CCO A;  2L9R A;  3CME I;  2K40 A;  3NRV A;  4IRG A;  1D0X A;  2K9L A;  3CCR I;  4U0V A;  2XF5 A;  1YI2 I;  1FBQ A;  2LVS A;  4X0G A;  4YEL A;  4U87 A;  2QM3 A;  2N8G A;  5B5E C;  1R5I D;  5AIQ A;  1SAN A;  2PI0 A;  3K4K A;  2Y0S N;  1WJC A;  2DTR A;  1B9N A;  2FRH A;  2M5W A;  2OA4 A;  1BJA A;  3S32 A;  4F3Q A;  5J1R A;  5KK1 A;  1D8K A;  3TO6 A;  3L2Q A;  3ZP5 A;  2RV8 A;  2G7H A;  3VYT B;  2LC2 A;  2FMY A;  3X2Q H;  4TV7 A;  3MKL A;  2A6E F;  2GWR A;  2NS0 A;  1TBX A;  2AXL A;  2CU7 A;  4MNU A;  1YIT I;  1WJF A;  3T8R A;  3S3M A;  2V4J C;  3QPL A;  4XLC A;  1LFU P;  3OR2 C;  3IWF A;  3OYM A;  3H3V K;  2RQQ A;  3OIQ A;  1ETO A;  1HBX G;  2Z2S B;  1T8I A;  1JTX A;  3FMS A;  1XGN A;  1Z05 A;  2R93 J;  1JE8 A;  2DMP A;  3WGH A;  2HFH A;  2NVT J;  1WHU A;  2EZL A;  3T0Y A;  3FK6 A;  3T1B A;  2OUM A;  5HDN A;  1ZGA A;  4HF2 A;  3BR0 A;  1WI3 A;  2CUF A;  2AQF A;  4OWR B;  3HRM A;  1T39 A;  1TTY A;  4QWQ A;  5GTI C;  1I27 A;  4B47 A;  4CCL A;  2VBY A;  5FRO A;  4N0B A;  4G12 A;  3LSM A;  5IT9 K;  2IS1 A;  3E1S A;  2NOJ B;  2R92 J;  2VQC A;  3D5L A;  4CIC A;  4XIC A;  4KN4 X;  2V1D A;  2FA5 A;  4F7Z A;  3H36 A;  1XDU A;  5GP9 A;  1YQA A;  2JA7 J;  3GXO A;  3TBI A;  3CUO A;  1VQM I;  4CCJ A;  5H2F C;  1Y6I A;  3EDP A;  4KJZ A;  3TOB A;  3R6S A;  4D9J A;  3DEE A;  3GX4 X;  3TP0 A;  3L2C A;  1QZY A;  1IRG A;  4IRH A;  1AWC A;  2PJR B;  1SFE A;  2R7T A;  2X6X A;  5HLT A;  5FLM J;  4Y52 J;  2IAI A;  3K4M A;  4XKW A;  1X1D A;  2XGD A;  1MDM A;  3K9T A;  4LOC A;  2KLO A;  1MJA A;  4FHT A;  4WCG A;  4EEF G;  2HVR A;  3MQ0 A;  1PYV A;  1H0M A;  4Q48 A;  2L9S A;  3HOX J;  1ZAO A;  4EMS A;  3OS2 A;  1I3A A;  2LY1 A;  2CGP A;  3BG3 A;  2K7L A;  2ZSH B;  4M72 A;  5FKN A;  5BNG A;  4G7Z F;  5FKK A;  4LMY A;  4ZH4 F;  2DPD A;  1GVD A;  2MLG A;  1ZG3 A;  1J5Y A;  2XPU A;  4ASN A;  2Y2Z A;  3CD6 I;  4YFX F;  5J47 A;  2E1M C;  1LVA A;  2VKD A;  4XOT A;  5DUI A;  4QSH A;  2G9W A;  4BE0 A;  2TCT A;  5D6F A;  3FDY A;  3KIO A;  1OR7 C;  4BY1 J;  2M1B A;  2Y9Z A;  4DZJ A;  3I53 A;  5DCM A;  5H20 A;  1HF0 A;  2EFN A;  4A0X A;  1E0E A;  4ANJ A;  1AU7 A;  3I58 A;  5DCF A;  5HOO A;  3KLN A;  4FE7 A;  3DLL F;  1D1B A;  4G6T B;  4CH7 A;  3OIO A;  2F6C A;  4II2 A;  3FHN A;  5DS9 A;  1IN8 A;  1A6I A;  3F8F A;  2L7F P;  1WCM J;  4MTE A;  3R60 A;  2YUS A;  1JI8 A;  3IRR A;  2EK5 A;  1REP C;  1AHD P;  2GIV A;  4PDK A;  3PIP F;  1AKH B;  3QPT A;  3GUD A;  2DQL A;  4U0Y A;  1ON2 A;  2CQX A;  3ZQ7 A;  1T0F C;  3OYB A;  2KZG A;  5ILU A;  3KPH A;  5KNL A;  5LEK A;  3OS0 A;  1FOW A;  4II3 A;  1LE8 A;  3LSI A;  1EF4 A;  2ZNY A;  3A2K A;  3Q3S A;  1O57 A;  3WHC A;  2ZJP F;  3HRS A;  2F5D A;  3H3U A;  3CUQ B;  2LLK A;  3O2P E;  1SFK A;  2P5K A;  4XM3 A;  5DD4 A;  2QQ9 A;  1XC5 A;  4BBR J;  4FCY A;  2GXB A;  2IS6 A;  1SFX A;  4M9S A;  3I56 I;  2FNP A;  3OOP A;  1LB2 A;  2VI6 A;  2FD5 A;  5JFR A;  3PSI A;  1RR7 A;  2QYO A;  4W97 A;  3IH3 A;  2YPR A;  4Y4R A;  5KCM A;  3CCM I;  2DA1 A;  1TLH B;  4LG0 A;  2AHQ A;  5CJ9 A;  1JKO C;  2X48 A;  3J7Y J;  4A3D J;  1S7A A;  3M8J A;  3JR9 A;  2EA2 A;  2QQA A;  4HST A;  2KP6 A;  4AID A;  3DXJ F;  3K7A J;  2HYF A;  4M6V A;  5IT3 A;  5CKT A;  4WX9 A;  2EFO A;  3L2U A;  2UWM A;  1USS A;  1T33 A;  2ELK A;  2UUZ A;  2FE3 A;  1D5Y A;  5D4S A;  1R4M B;  4YFK F;  2FML A;  5E1Z B;  3N4M A;  1NTC A;  5B3S H;  3HGG A;  2VJI A;  3OYA A;  3HKZ A;  3EYI A;  5FKL A;  2L2O A;  5BMZ A;  2OTL I;  2L01 A;  4GDF A;  1YJN I;  2B63 J;  1P2F A;  1TNS A;  3N05 A;  3CJQ B;  2XF6 A;  3GBG A;  1ODD A;  3DBR B;  1ZAR A;  2E34 A;  1Y0N A;  1H9G A;  2EZH A;  3CC7 I;  5JR3 A;  1NK3 P;  2M4G A;  4CZZ A;  3A0B C;  3Q9S A;  2R7V A;  3DPU A;  4BQA A;  1RPW A;  3BR6 A;  5H6Q A;  5K7H A;  2NNY A;  1PJR A;  2FEZ A;  3O6B B;  3IUO A;  4A3K J;  1MDM B;  2W24 A;  1DGR M;  1TNT A;  1VQK I;  2M0C A;  2R0Q C;  1ETY A;  2VC1 A;  3BG7 A;  4RB0 A;  1MBG A;  1WKM A;  2OV7 A;  2LBF A;  5TIS C;  2KRC A;  3WGI A;  3HOV J;  1ENH A;  4XKB A;  1XSV A;  3R0A A;  1ERD A;  1XD7 A;  4GYI A;  2K3P A;  3LNQ A;  3ZCO A;  2F2E A;  3J7A Y;  3QWL A;  4UVC A;  3ZQI A;  4RAG A;  5AIP A;  4HPQ A;  1UG0 A;  1APL C;  3IKV A;  3IP4 B;  3GLX A;  1QPM A;  3RKX A;  2DDA A;  4LLG F;  1G3Y A;  2QEX I;  5K5O A;  1S8N A;  1OKR A;  2JT1 A;  3GTJ J;  2DT7 B;  4L0Y B;  2R7S A;  4W1U A;  4IOC F;  1X58 A;  5DCM B;  3BTL A;  2HQN A;  4ZYH A;  2KZV A;  3QPS A;  4C2M J;  3OYI A;  4BL0 B;  2V7F A;  3P7N A;  4KUM A;  3AG4 H;  3L2V A;  5BS6 A;  3KEQ A;  2ZO4 A;  3F3X A;  2VL8 A;  1XGM A;  1R7J A;  3WTZ A;  1D0Y A;  2DK5 A;  4XMY A;  2FBK A;  2CQQ A;  2FBH A; 
#chains in the Genus database with same CATH homology
 5IT9 Z;  4ESB A;  3J81 K;  2ZME B;  4EJW A;  4AIK A;  3TOA A;  3WTY C;  2OBP A;  1J0R A;  2EV6 A;  3CUQ C;  3RYP A;  2A68 F;  5J8C A;  1SMY F;  3SFZ A;  4L18 B;  4ENM A;  3LFK A;  1U6G A;  1QO0 D;  3FXU A;  5HS9 A;  4WXH A;  1O3T A;  1MJ9 A;  4AWX B;  2P4W A;  3K1M A;  4LLN A;  2BV6 A;  1WI9 A;  2RDP A;  4GGG A;  4KFC A;  3ZN1 A;  3F8B A;  1ZRC A;  1BM9 A;  1I6X A;  1K7A A;  1R1U A;  4I0B A;  2KIF A;  1P92 A;  2LF7 A;  2KRF A;  4A2U A;  4O5V A;  1ZH5 A;  1BI1 A;  5E8G A;  4EJT A;  5JVT A;  4P55 A;  4Z2Y A;  4CO8 A;  4OMZ A;  1FYK A;  1SAX A;  5J6X A;  1OYY A;  3BRO A;  4AIH A;  1QZZ A;  2HQR A;  2H09 A;  2M45 A;  5JHU A;  2VXZ A;  3TO9 A;  3WTW C;  2VBW A;  2K86 A;  2FBI A;  3SZP A;  2EV0 A;  1YS6 A;  1EV7 A;  2O6G E;  3KP2 A;  2Z5U A;  4EM2 A;  3GF2 A;  3M7G A;  3P9C A;  1W4M A;  5ERI A;  1C0W A;  4I98 B;  2BGC A;  3FF5 A;  3WTV C;  4PCQ A;  1BI3 A;  4E70 A;  2LKP A;  4ZYD A;  1YO5 C;  3JSO A;  1IXR C;  4EJU A;  4EM1 A;  2UXX A;  3VB2 A;  1XGO A;  1D3Y A;  1SMT A;  1YTY A;  5LBQ A;  4A5N A;  2XV4 S;  2FNA A;  5HDK A;  1TQP A;  2IP2 A;  1TQM A;  4WXC A;  1Z7U A;  5TJJ A;  4U0W A;  5FGM A;  3ZMS A;  4O6J A;  5FD6 A;  4EQQ A;  2DAO A;  2ZCW A;  3WTS C;  4HX8 A;  1X3U A;  1T0F A;  1O7F A;  2WC2 A;  1KQ0 A;  3CDH A;  3PQJ A;  4XLN F;  5L3E A;  2L54 A;  2BBY A;  2O61 A;  2AS5 F;  1RNL A;  2VOP A;  3FXQ A;  3ECO A;  3F6O A;  1ZRD A;  3F6V A;  2VON A;  3IHU A;  3H92 A;  1TQI A;  4P9U A;  2D45 A;  1E2X A;  1WSU A;  4GO1 A;  3IWZ A;  2DI3 A;  3WE2 A;  3G73 A;  5H6R A;  4LB5 A;  3LST A;  5LHI A;  4IF4 A;  3QPH A;  5HDG A;  2FF4 A;  2EB7 A;  3RKY A;  1B9M A;  4CGZ A;  2JPC A;  2H94 A;  3B02 A;  2V1U A;  1UFM A;  3KP5 A;  5E20 A;  3J81 Z;  2QWW A;  3QU6 A;  3VFZ A;  3WTT C;  1OYW A;  4BAY A;  1T98 A;  4XSX F;  4HLX A;  2MH2 A;  2XAQ A;  1I5Z A;  2GA2 A;  3C3W A;  2F5F A;  1R23 A;  2EFW A;  4IXA A;  1J75 A;  1GXP A;  1U2W A;  2FQ3 A;  3CTA A;  4OMY A;  4UVB A;  1U3E M;  2JZY A;  3MWM A;  4MEX F;  2XRN A;  1KGS A;  3ELK A;  3L09 A;  4Q5S F;  2DFI A;  2L4A A;  2XGX A;  1ON1 A;  3DEU A;  4OIR F;  1HKS A;  5F64 A;  4XRF A;  4GCV A;  1FX7 A;  5D5V B;  2BEO A;  2FBH A;  1H9T A;  1BN5 A;  2STW A;  4KDP A;  2J5P A;  5CVV A;  3QP5 A;  3WG9 A;  4R79 A;  2ZBK A;  3HYI A;  2CG4 A;  3K0L A;  3S2W A;  1G3T A;  1YLF A;  2VOO A;  5D4R A;  1FOK A;  3KEO A;  4FX0 A;  3I59 A;  1MGT A;  2CW0 F;  4KIF A;  2KIU A;  3R61 A;  4CHU A;  4OOI A;  4UHT A;  4U88 A;  3KZZ A;  1O3S A;  4K2E A;  4MGR A;  1S6L A;  3CUQ A;  1YIO A;  3FMQ A;  2XAF A;  3LAP A;  2NNN A;  3ULQ B;  4Y17 A;  5LGU A;  3NQO A;  2X0L A;  4I02 A;  2L3D A;  2H6B A;  1ONV A;  3V7S A;  5HVQ C;  3HOS A;  3V8K A;  2HZT A;  3CO7 C;  3Q9V A;  2ACJ A;  2CWE A;  4RGR A;  4A6D A;  4PGG A;  2GXG A;  1BIA A;  1IN7 A;  4RGX A;  4BHB A;  2DW4 A;  4L9N A;  3G3Z A;  4PGH A;  4ON0 A;  3JTG A;  4LK0 F;  2JPB A;  3ZPL A;  1W7P B;  1AOY A;  1B1B A;  1QGP A;  2RN7 A;  4L0Z B;  2PMU A;  5E8I A;  3V4G A;  4ENK A;  1J9I A;  1P4W A;  5LRS A;  4WF2 A;  1PP8 F;  1TW3 A;  2OZ6 A;  2DU9 A;  4CDG A;  2XAG A;  1XSX A;  3E6M A;  5ICG A;  3NEU A;  4KN7 X;  2QLZ A;  1KU7 A;  1XDS A;  1LDJ A;  3KCC A;  4G94 A;  2O3F A;  3QOP A;  1Y0U A;  1FZP B;  1IZ1 A;  2A6H F;  2FU4 A;  1KU3 A;  3F8M A;  3R4K A;  3HRT A;  3LA2 A;  3RYR A;  4HW0 A;  2ETH A;  4KYW A;  3JAM K;  3H3Z A;  3RPQ A;  2GZW A;  1JGS A;  1MZB A;  3K2Z A;  4A0Z A;  3KP7 A;  3KFW X;  2EWN A;  1XN7 A;  2ISY A;  4HF0 A;  4P96 A;  4UV9 A;  4HOB A;  1HST A;  2VN2 A;  4HV5 A;  3LAJ A;  4EV0 A;  4QLC U;  2XRO A;  2PEX A;  1UB9 A;  2Z33 A;  2ZME A;  1ZLJ A;  1S29 A;  1HW1 A;  3I59 B;  3BJ6 A;  3MZH A;  2CSO A;  3ZMU A;  1SD6 A;  2NRA C;  3SXY A;  5BQT A;  4YIF A;  2RC4 A;  4A5M A;  1O3Q A;  3IRQ A;  5AON A;  5E17 F;  2C6Y A;  2E1C A;  3E97 A;  3ABT A;  3L00 A;  4P5O A;  1G3W A;  2J5O A;  1T38 A;  2P5L C;  3V8J A;  1ZRE A;  2OQR A;  5L3D A;  4HZF A;  4S05 A;  1YYV A;  2WTE A;  4HDU A;  1ZLK A;  3ML6 A;  1R00 A;  4OIN F;  2A61 A;  1LDK B;  1HW2 A;  4U7B A;  1ZG5 A;  1XMA A;  1BI0 A;  3ECH A;  4Q47 A;  1XGS A;  5D8L B;  3HTU A;  5F6F A;  3TKY A;  4CYD A;  4I09 A;  2VE8 A;  2L02 A;  4LFU A;  4L9T A;  2QUF A;  3O3K A;  2VT3 A;  2OQG A;  1ZRF A;  4G9Y A;  4EM0 B;  3T5X A;  4RAZ A;  3DFG A;  2E1N A;  3HSF A;  2HDC A;  4PZJ A;  1W5T A;  4KIB A;  3TDU C;  3EET A;  4LGW A;  2GQQ A;  3AAF A;  1LNW A;  2VBZ A;  2FXA A;  3E5X A;  2A69 F;  2DQR A;  2QVO A;  4R1H A;  1IW7 F;  5ILS A;  1D5V A;  1HXD A;  2PQ8 A;  5D5W B;  3WGG A;  5DYM A;  3BY6 A;  1K78 B;  2B0L A;  3GFJ A;  2EJR A;  3BPX A;  2EFQ A;  4L9V A;  2D1H A;  5K5R A;  2QEN A;  3FXR A;  2OAZ A;  4HYE A;  5E18 F;  2PLY A;  2BYV E;  3U9G A;  1PP7 U;  2VC0 A;  2HR3 A;  1STZ A;  5CVR A;  3JW4 A;  2IPQ X;  3FM5 A;  2E7X A;  1ULY A;  3I71 A;  1IXS B;  2ISZ A;  4L5J A;  4OU0 A;  1U5T B;  4N9I A;  3ISP A;  3VEP A;  2DLL A;  2V1X A;  3LA3 A;  1FP2 A;  5DV5 A;  3IC7 A;  3JAM Z;  1F4K A;  1S7O A;  3FMR A;  1CF7 A;  3C18 A;  1UST A;  2R7F A;  1OYI A;  3DPT A;  3DKW A;  3KE2 A;  1PUE E;  2W84 A;  5BPI A;  4KIC A;  2DO7 A;  2IA2 A;  4JQF A;  4XBF A;  1IAW A;  1HKT A;  3M8F A;  1GXQ A;  2HOE A;  3DF8 A;  3CJN A;  2QBY B;  5CLS A;  2JRT A;  4IJA A;  1XCB A;  5CVU A;  3GFL A;  3MZY A;  1FWZ A;  5L3C A;  2OD5 A;  4RGU A;  4ZYG A;  4N9H A;  5HS8 A;  4Y13 A;  5E1W A;  4ESF A;  2HTS A;  1RUO A;  2OU2 A;  4UXN A;  2K4J A;  3RDI A;  1EH6 A;  3RJP A;  3MAJ A;  4YII A;  3COA C;  2P6T A;  4I0A A;  2Z3Y A;  4I2O A;  2GAU A;  4IRI A;  2ESH A;  4L9J A;  1JHH A;  4OIP F;  2FOK A;  1FPQ A;  4HAM A;  1Z91 A;  1KQ9 A;  3U2R A;  5BOX A;  3RPU A;  3VOE A;  5LHG A;  4L5I A;  1IF1 A;  3F72 A;  1KQ8 A;  5LEJ A;  4LK1 F;  1IN4 A;  4EGZ A;  1RI7 A;  2W85 A;  1FLI A;  2D1V A;  4HF1 A;  2DK8 A;  5LRR A;  5E1X A;  2H6C A;  1CGP A;  1FBS A;  1EH8 A;  5D6E A;  3LA7 A;  2IRF G;  1U5T C;  4BXU A;  4IHT A;  1OPC A;  1RIO H;  2RKH A;  2CO5 A;  1GHC A;  2ZJ2 A;  1DPR A;  2O03 A;  3HHH A;  1IN6 A;  2V6C A;  1W7P D;  1SD4 A;  1CF7 B;  4MHG A;  2FSW A;  5ICC A;  1LJ9 A;  2P8T A;  1TW2 A;  4FT8 A;  1MJB A;  1WRJ A;  2F5E A;  4ZZL A;  4GYG A;  5L3G A;  2DPU A;  4G7H F;  1W7P A;  3RI4 A;  3E6C C;  5LHH A;  1L3L A;  4BHP A;  1FP1 D;  2K27 A;  2MH9 A;  6PAX A;  2EFP A;  3EQL F;  4M6X A;  1QQI A;  2HKX A;  1QNT A;  3V8L A;  5FLX K;  1Z6R A;  1KA8 A;  3TDZ C;  2HS5 A;  2YU3 A;  1XCV A;  2DT5 A;  1FBU A;  4UVA A;  2F5C A;  2XHK A;  2M87 A;  2P7V B;  3DV8 A;  1BOA A;  3WTU C;  1XMK A;  1XSD A;  1OMI A;  3U1D A;  3DPL C;  2Z9O A;  1QBJ A;  3GO5 A;  4LJZ F;  2QZ8 A;  2A5Y B;  3GYH X;  4MEY F;  3WE3 A;  3ZMV A;  4LB6 B;  1WWX A;  1SD5 A;  3J7A O;  3ERE D;  4KNY A;  3KET A;  3B73 A;  1V4R A;  3BP8 A;  3I54 A;  1EH7 A;  3ZN0 A;  2IT0 A;  1RUN A;  3F8C A;  4EGY A;  4OIQ F;  2XUB A;  2O0Y A;  2W57 A;  2V9V A;  1K79 A;  3BOQ A;  3M1E A;  3F22 A;  4ESJ A;  3J80 Z;  3WOD F;  4RB2 C;  3WTX C;  2MD5 A;  2PG4 A;  4GXO A;  1B59 A;  1DPU A;  3SHF A;  1YW9 A;  2EV5 A;  4M74 A;  1YG2 A;  1I1S A;  2UXN A;  3MEX A;  1FYL A;  3F23 A;  1O3R A;  1ZHF A;  2Y48 A;  1U78 A;  4MQ9 F;  3IKT A;  4R8H A;  1R5G A;  3OV8 A;  1BC8 C;  1IRF A;  2VE9 A;  3I5U A;  3C7J A;  1ZN2 A;  3BPV A;  4KT5 C;  2Y0M A;  1K6O A;  1BI2 A;  3K1P A;  1Z6T A;  1LQ1 A;  3PFI A;  2RNJ A;  4P9F A;  4HLY A;  2MLK A;  3HHG A;  2A3S A;  1A04 A;  2E7W A;  3ZMZ A;  2QQB A;  1UCR A;  5FFZ A;  1F5T A;  3RTR A;  3EUH A;  5FO5 A;  2P7C B;  4Q4Z F;  2GA1 A;  3GW2 A;  5K1Y A;  3E3V A;  5ED4 A;  4BYY A;  2NYX A;  4B8X A;  2K02 A;  2V79 A;  1FYM A;  3D0S A;  3E5Q A;  2YX7 A;  2HYG D;  5DEQ A;  2A07 F;  5JI6 A;  2XKO A;  1WQ2 A;  4M6Y A;  5CVJ A;  1J59 A;  4Y15 A;  1K78 A;  4I01 A;  5F1R A;  1IXC A;  2LSO A;  3TQN A;  4UNO A;  1Z1D A;  4ZYE A;  3K69 A;  3DQV C;  2L4M A;  1LEA A;  3GWZ A;  1B4A A;  4MQV A;  3BWG A;  5L3F A;  1BBY A;  1UHM A;  2LDU A;  4A0Y A;  1HSJ A;  5FLX Z;  2M8E A;  2CQK A;  1ZGJ A;  3BDD A;  1FC3 A;  1R5H A;  3E6B A;  1U5T A;  3GFI A;  2UZK A;  4HX7 A;  1P6R A;  4HX4 A;  4G8X A;  1R58 A;  4DQ2 A;  4A6E A;  1PDN C;  3P9K A;  4KA4 A;  3BJA A;  4JK1 X;  3QU3 A;  1YW7 A;  4D0P A;  5ICE A;  4B09 A;  3HTS B;  5K5Q A;  5CVI A;  3K1N A;  4IHS A;  1ZG1 A;  2MBF A;  2Q0O A;  4G7O F;  3I64 A;  5KVR A;  5D5X B;  4YFN F;  3V7C A;  2QBY A;  1YS7 A;  4FX4 A;  4G6Q A;  5EEG A;  3ZMT A;  3F8N A;  3HSR A;  5BPD A;  2ELH A;  4HA8 A;  5J8F A;  4ETS A;  1FT9 A;  3F21 A;  1T2K A;  1KYW A;  1SD7 A;  2BE5 F;  4G6D A;  5HS7 A;  1DP7 P;  4LD5 A;  1T6S A;  4I7H A;  2IJL A;  4HQE A;  1DUX C;  2M30 A;  2HEO A;  4XSZ F;  4AVP A;  2RGV A;  3CO6 C;  1E17 A;  2COM A;  1DDN A;  2CYY A;  4ENN A;  4IPA A;  4KMF A;  5LGN A;  1JHF A;  1F1Z A;  2YX4 A;  2HWV A;  2XIG A;  1LEB A;  3E6D A;  2W25 A;  1P4X A;  2STT A;  4HBL A;  4AD9 A;  1L0O C;  4WK8 F;  1KU9 A;  1D8J A;  2YSR A;  2X4H A;  1O7L A;  1FY7 A;  2HGC A;  3M9A A;  5A2Q K;  4UUV A;  3KLO A;  3CLO A;  5HLG A;  4U7D A;  2WWY A;  3VOD A;  3HRU A;  2VT2 A;  2IA0 A;  2RVC A;  4KIG A;  3SQN A;  2ZKZ A;  2DBB A;  5CYV A;  3W6K B;  1W5S A;  3BJO A;  1UHW A;  4BNC A;  2Q8K A;  2LF8 A;  3W6J B;  5D8K B;  5EEH A;  1YW8 A;  2P6S A;  3FWE A;  2JSC A;  1FSE A;  4AIJ A;  4EVI A;  4M71 A;  1U8R A;  1Q1H A;  5DDG A;  3QP6 A;  2ZNZ A;  3I0T A;  1FNN A;  4RGS A;  3WU0 A;  3LQR A;  1B6A A;  4LG0 B;  2NAZ A;  3ABU A;  4ENJ A;  3WU1 B;  5ILV A;  2R3S A;  1RZ4 A;  2HKO A;  4UV8 A;  2RQP A;  2Q2E A;  2IA1 A;  3HUG A;  2IVM A;  1R22 A;  2MA3 A;  2KKO A;  4A12 A;  2VBX A;  1IUY A;  1HKQ A;  2PJP A;  2ZXJ A;  3SZT A;  3REO A;  2LNB A;  4M9X A;  1JXS A;  3M8E A;  3J80 K;  2KJC A;  3PQK A;  3GZ5 A;  3HOT A;  5ICF A;  3IL2 A;  3L9F A;  1GVJ A;  1R1V A;  1MKM A;  3R0J A;  1HW5 A;  2PBI A;  2CFX A;  3E5U A;  4BH9 A;  2JTV A;  3EYY A;  3QAH A;  2D2W A;  3I4P A;  3MFK A;  2ESN A;  1J7K A;  3P9I A;  1G3S A;  3TGN A;  3GEZ A;  3QRF F;  3FX3 A;  1KYZ A;  4RB3 C;  3HIF A;  4NQW A;  5HLI A;  3KP6 A;  1OR7 A;  3ROU A;  4BHC A;  3RKW A;  2XVC A;  3L7W A;  2Z99 A;  4RB1 A;  4NB5 A;  1S3J A;  3GVA A;  4OIO F;  2H27 A;  4HDV A;  3KZY A;  2G7U A;  2WV0 A;  2Y75 A;  3C1D A;  4RS8 A;  2KJB A;  4WXD A;  5DD8 A;  1FSH A;  3GZ6 A;  1G4D A;  5FFX A;  5FB2 A;  2ADU A;  3FM3 A;  5LGT A;  3DP7 A;  3FZV A;  3JTH A;  3FHZ A;  1XB4 A;  2ZFW A;  2O8X A;  1V3F A;  4HQM A;  2XKP A;  4LLL A;  3V7R A;  4S04 A;  3LQQ A;  4MTD A;  2PN6 A;  5D5U B;  1J2X A;  1IN5 A;  1SFU A;  4YG2 F;  5A2Q Z;  1BIB A;  3TO7 A;  3JSP A;  4KMU X;  4XLP F;  2R7D A;  2PFB A;  4EJO A;  4H0E A;  2PMH A;  4IVN A;  1Z9C A;  4M9Z A;  3N97 A;  4HV6 A;  4NHJ A;  3Q5F A;  5DUK A;  3RIR A;  3LWF A;  2XAH A;  3KP3 A;  1ZYR F;  4JBA A;  1NHA A;  2YR2 A;  1KU2 A;  1R36 A;  5TRD A;  2HTJ A;  1F9N A;  4EJV A;  1VTN C;  1G6N A;  1I1G A;  4RAY A;  4ZZD A;  2XAJ A;  1MD0 A;  5FD5 A;  4M73 A;  1BC7 C;  3GFM A;  1YFH A;  3KP4 A;  2OZU A;  2IW5 A;  5HLH A;  2MC3 A;  5L3B A;  3ZMD A;  2P5V A;  3HSE A;  1R1T A;  4DNC A;  2TDX A;  3T8T A;  4WWC A;  4CXF A;  2XAS A;  2VOD A;  2EA4 A;  1HQC A;  1LDD A;  3MCZ A;  2KIM A;  1P4A A;  2K4B A;  3BZ6 A;  3NRV A;  4IRG A;  4U0V A;  1FBQ A;  2QM3 A;  5AIQ A;  2PI0 A;  2DTR A;  2FRH A;  1B9N A;  2M5W A;  2OA4 A;  4O3M A;  1BJA A;  5KK1 A;  1D8K A;  3TO6 A;  3ZP5 A;  2RV8 A;  2G7H A;  2FMY A;  4TV7 A;  2A6E F;  2GWR A;  2NS0 A;  1TBX A;  2AXL A;  4MNU A;  3T8R A;  3IWF A;  1HBX G;  3FMS A;  1XGN A;  1Z05 A;  1JE8 A;  3WGH A;  2HFH A;  3T0Y A;  3T1B A;  5HDN A;  1ZGA A;  4HF2 A;  3HRM A;  1T39 A;  1TTY A;  4QWQ A;  1I27 A;  2VBY A;  4N0B A;  5IT9 K;  3D5L A;  4CIC A;  4KN4 X;  2V1D A;  2FA5 A;  4F7Z A;  1XDU A;  1YQA A;  3GXO A;  3CUO A;  3EDP A;  3TOB A;  3R6S A;  3GX4 X;  3L2C A;  1QZY A;  1IRG A;  4IRH A;  1AWC A;  1SFE A;  1MDM A;  3K9T A;  1MJA A;  4FHT A;  4WCG A;  3MQ0 A;  1H0M A;  4Q48 A;  1ZAO A;  4EMS A;  2CGP A;  2K7L A;  4G7Z F;  4M72 A;  4LMY A;  4ZH4 F;  2DPD A;  2MLG A;  1ZG3 A;  1J5Y A;  4ASN A;  4YFX F;  1LVA A;  5DUI A;  2G9W A;  5D6F A;  2M1B A;  3I53 A;  5DCM A;  5H20 A;  2EFN A;  4A0X A;  3I58 A;  5DCF A;  5HOO A;  3KLN A;  1IN8 A;  3F8F A;  4MTE A;  3R60 A;  3IRR A;  2EK5 A;  1REP C;  2GIV A;  4PDK A;  3QPT A;  3GUD A;  2DQL A;  4U0Y A;  1ON2 A;  3ZQ7 A;  5ILU A;  5LEK A;  2ZNY A;  1O57 A;  3HRS A;  2F5D A;  3H3U A;  3CUQ B;  3O2P E;  2P5K A;  5DD4 A;  2QQ9 A;  2GXB A;  1SFX A;  4M9S A;  2FNP A;  3OOP A;  1LB2 A;  5JFR A;  2QYO A;  2YPR A;  1TLH B;  4LG0 A;  5CJ9 A;  1S7A A;  2EA2 A;  2QQA A;  3DXJ F;  2HYF A;  5IT3 A;  4WX9 A;  2EFO A;  2UWM A;  1USS A;  2FE3 A;  5D4S A;  4YFK F;  2FML A;  5E1Z B;  3N4M A;  3EYI A;  5BMZ A;  2L01 A;  1P2F A;  1TNS A;  1ODD A;  1ZAR A;  1H9G A;  5JR3 A;  4CZZ A;  3Q9S A;  4BQA A;  5H6Q A;  2NNY A;  2FEZ A;  3O6B B;  1MDM B;  2W24 A;  1TNT A;  2VC1 A;  4RB0 A;  1WKM A;  3WGI A;  1XSV A;  3R0A A;  1XD7 A;  4GYI A;  2F2E A;  4UVC A;  5AIP A;  3IKV A;  3GLX A;  1QPM A;  3RKX A;  4LLG F;  1G3Y A;  5K5O A;  1S8N A;  1OKR A;  2JT1 A;  4L0Y B;  5DCM B;  2HQN A;  4ZYH A;  3P7N A;  4KUM A;  5BS6 A;  3KEQ A;  2ZO4 A;  3F3X A;  1XGM A;  1R7J A;  3WTZ A;  2DK5 A;  2FBK A;  5LLQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...