3E3VA

Crystal structure of recx from lactobacillus salivarius
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
154
structure length
154
Chain Sequence
LADDISKGYNAALNYLSYQLRTRKEVEDKLRSLDIHEDYISEIINKLIDLDLINDKNYAESYVRTMMNTSDKGPKVIKLNLSKKGIDDNIAEDALILYTDKLQVEKGVTLAEKLANRYSHDSYRNKQNKIKQSLLTKGFSYDIIDTIIQELDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein recX
publication title Crystal structure of RecX
rcsb
source organism Lactobacillus salivarius
molecule tags Recombination
total genus 61
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA02
3KLOA 3JSPA 5A2QK 4ZYGA 5ILVA 3M9AA 1RI7A 2L54A 2PFBA 1KQ8A 2H94A 3V8LA 4TV7A 4YFKF 4ENNA 2EA2A 1XSXA 5HOOA 2P6SA 1WI9A 4N9IA 4BHCA 1ZG1A 2EV0A 2ZNZA 5E1XA 3D5LA 1XB4A 4AVPA 4KN7X 2F5FA 3ZQ7A 4HX8A 4HW0A 4OINF 5TJJA 1ODDA 5D6EA 1QZZA 3C7JA 3CJNA 3RKYA 1K78B 3FF5A 2WWYA 4CZZA 1IAWA 4EJTA 3WTUC 3ZMTA 2VE8A 1W7PD 4BHBA 2JPBA 5FD6A 1IXRC 5JFRA 3IC7A 2M30A 3R60A 1F5TA 1FP2A 1UFMA 4OOIA 3IRRA 4BQAA 4AIJA 4LB6B 2IJLA 4P5OA 5TRDA 2P5KA 2FU4A 1ULYA 3WE3A 1P4WA 4MTDA 4YIFA 4A5MA 5K1YA 3BPXA 3T8RA 3L00A 3WG9A 1O57A 3HRSA 3JTHA 3SZPA 4KFCA 2OBPA 5DCMA 2D45A 1ZRCA 3FMQA 1YIOA 3HIFA 1FYMA 3B73A 4E70A 3IWFA 5F64A 4LG0A 2R7FA 3Q9VA 2LF7A 2PLYA 2LKPA 3MZHA 1L0OC 2HYFA 2YPRA 3F6VA 4KMFA 3CUQC 3Q9SA 3J7AO 4WXDA 2HQRA 2IP2A 5BPIA 3K2ZA 2VOPA 1ZRDA 2H27A 2IW5A 1XMAA 1ZG5A 2XAJA 1SD4A 3HTSB 4NQWA 4A0ZA 4Q47A 2D1HA 2RV8A 2E1CA 4O5VA 4PGHA 4M6YA 1IUYA 3WTWC 3REOA 4RGRA 3TOAA 2FRHA 3J81K 2FNAA 2IA0A 4PGGA 3WGIA 2J5PA 2W57A 1LNWA 2X0LA 2PJPA 2OU2A 4KDPA 4R1HA 2MBFA 3IL2A 1I1SA 1IXCA 1P2FA 2HGCA 2XRNA 3CO6C 1BM9A 3KP3A 4LK0F 3E6BA 1R1TA 1PP8F 1REPC 5IT3A 3PQJA 2K86A 3MZYA 1YS6A 5FB2A 1SFEA 2PI0A 1Q1HA 4ON0A 2RN7A 5E1WA 2ZFWA 3J80Z 3MAJA 2XIGA 1R5GA 2A69F 4O3MA 2RKHA 5H6RA 5LRRA 2GIVA 4YFNF 1I6XA 2W25A 4IPAA 2Q2EA 1ON1A 2FXAA 3F8BA 1NHAA 2ESHA 1YW8A 4R8HA 1IXSB 1TW3A 2Q0OA 4I0AA 2OQRA 3I59A 1YG2A 4EMSA 2ISZA 1G3WA 5FGMA 4HA8A 5AIQA 1KU7A 3K1NA 3LAPA 1SD7A 5DDGA 5BS6A 2ETHA 1HXDA 2DQLA 4MTEA 3G3ZA 3PQKA 1UHMA 5FLXZ 1HW1A 2HS5A 3LQQA 1G3SA 2HQNA 5HDKA 2HDCA 2MH2A 5E18F 2YX7A 4BNCA 5D8LB 5D4SA 5E17F 1MJAA 1FY7A 1ZAOA 1HKTA 4NHJA 2M45A 3C3WA 5BMZA 3QOPA 2NNYA 4HOBA 2WC2A 3DPTA 5CVIA 1SD5A 2XAHA 2FE3A 4LFUA 3WGHA 3WODF 1FYLA 1LDKB 1QO0D 1U5TA 1R7JA 1S29A 1XGNA 1FYKA 4D0PA 5L3FA 3EYYA 2Z5UA 5L3GA 1B4AA 1XGMA 1F4KA 5ICEA 1ON2A 1S3JA 3I0TA 5DCFA 4DQ2A 2V1DA 5EEHA 2IPQX 3HRMA 1HKSA 5IT9Z 5D6FA 1W7PA 1BC7C 4LLNA 1B9NA 1H9GA 2HYGD 1XSVA 6PAXA 4I09A 5H20A 2RQPA 3GW2A 5HLHA 4BHPA 3FWEA 3EUHA 1O3SA 2IVMA 3COAC 3Q5FA 3RKXA 4UXNA 5KVRA 3KETA 1TNSA 4I98B 3SFZA 2QQ9A 1T0FA 4HBLA 5F6FA 3PFIA 4KICA 4G7OF 2K7LA 2FA5A 2VBXA 2W84A 4RB3C 3V4GA 2FBIA 2HKOA 4I7HA 1IRFA 3QPHA 1J0RA 3CTAA 4M9XA 2V79A 1BJAA 1OR7A 2EV5A 2BGCA 1IW7F 5AONA 1I5ZA 3F22A 3GVAA 4H0EA 2L4AA 4G8XA 2XUBA 5HS7A 3T0YA 4QLCU 4Y15A 3FXUA 3R61A 3RI4A 4FT8A 3ZMUA 1I27A 2PQ8A 3I5UA 1YFHA 4KYWA 3FX3A 2G7HA 2EFWA 3NEUA 4A2UA 1CF7A 3MCZA 4HZFA 2PMUA 3RPQA 3EDPA 1C0WA 4UVBA 1Z91A 2A6EF 1FC3A 3CUOA 1SMYF 2EFQA 1MGTA 1MZBA 4WXHA 2DBBA 2VBYA 2MC3A 1FT9A 5ILUA 5EEGA 1FP1D 1BN5A 3JW4A 2GA2A 1F1ZA 2VODA 2Z33A 1HKQA 4ZYDA 1AOYA 2TDXA 1ZLKA 5DD4A 1SMTA 2O61A 3F8CA 1IN4A 3TO7A 5JHUA 2UZKA 2DW4A 2EFNA 4CO8A 3BJAA 1G4DA 2H6BA 1S7AA 2QBYB 5E1ZB 2VC1A 2EV6A 1KYZA 4L5JA 3ECOA 4B8XA 3KEQA 2NAZA 5LLQA 2O0YA 4KUMA 1LDDA 3LWFA 5CVUA 2QUFA 3HSRA 5K5OA 1K7AA 2CGPA 2NRAC 4OIQF 1FZPB 1WWXA 3V7SA 5J8FA 5D5XB 2L01A 1A04A 3HUGA 2Z9OA 4F7ZA 3WTTC 1XD7A 3BY6A 1MDMA 1UB9A 2E7XA 4GYIA 3FMSA 1HSTA 3ERED 3MEXA 2UWMA 4P55A 2ESNA 4UV9A 2JRTA 1LEBA 4LGWA 4AWXB 1R1VA 4I02A 2FQ3A 2Y48A 4CHUA 3F3XA 3KCCA 2KIUA 4XBFA 1KQ9A 4ENJA 4PCQA 3ZMVA 1B9MA 1QNTA 1KU2A 3W6JB 3ZMSA 4HLYA 2KIFA 3O6BB 4KNYA 1BIAA 2DO7A 1UHWA 1XSDA 3DV8A 3ELKA 4L9JA 4U7BA 3OOPA 3GO5A 1OYWA 4ZYEA 2FF4A 2V9VA 3ROUA 1MJBA 1B6AA 2ACJA 2JZYA 2D2WA 2V1UA 1AWCA 3HYIA 2EA4A 4M9ZA 4WXCA 2RNJA 2Z99A 4Q48A 4U7DA 2OA4A 3M8FA 5L3CA 1T39A 1O7FA 4RGXA 1R00A 1W5SA 3ZN0A 1PDNC 1QZYA 5K5RA 5CVJA 3V7RA 4P9UA 4FX0A 2A3SA 3ZPLA 4BAYA 2P4WA 3VFZA 3T8TA 3U9GA 4PZJA 3I71A 4UVCA 1HBXG 4JQFA 2QWWA 1WKMA 1LDJA 3ULQB 2A68F 2HTSA 1RUNA 2PMHA 2STTA 3RPUA 3WU1B 2HEOA 4M74A 2K4JA 3QRFF 3E6DA 3NRVA 1ZN2A 4MGRA 1D8KA 2VT3A 1T2KA 2XROA 4JK1X 5D5WB 3V8KA 2GA1A 2M8EA 3W6KB 4FX4A 1HW5A 4GYGA 1Z7UA 3JAMZ 4U88A 4ASNA 2FSWA 1HW2A 3L09A 3R6SA 3TDUC 1EV7A 3T5XA 3GZ6A 4RGSA 1HSJA 4RB0A 2BE5F 1WSUA 1E17A 1H9TA 4M72A 1RZ4A 2DFIA 3M8EA 1FBSA 3GZ5A 4KMUX 4LLGF 4CGZA 3WGGA 5LHHA 4HF0A 5HVQC 2VXZA 2H6CA 1H0MA 2COMA 4L9VA 1TQMA 1WQ2A 4GCVA 2GQQA 3E5XA 4CXFA 3JSOA 5A2QZ 2UXNA 1G3YA 1LVAA 2M1BA 5J8CA 3QU6A 1W4MA 2EWNA 4ESFA 2L02A 1FSHA 4A6EA 4P96A 2QZ8A 3WTXC 2VOOA 4IHSA 1D5VA 3GFIA 1KGSA 1OYIA 2VC0A 3FM5A 4A12A 5FFZA 4HQMA 2A5YB 5D5UB 4XLNF 3BROA 4BXUA 2YR2A 1TNTA 1ZRFA 1U6GA 1USSA 2E7WA 5BOXA 1X3UA 3LA2A 2JT1A 2PG4A 1J2XA 4MHGA 2D1VA 4OMZA 3GUDA 3BDDA 2OQGA 1ZH5A 3WE2A 4UV8A 3RJPA 1K78A 4UVAA 3K0LA 2DU9A 4M9SA 4HX4A 1BC8C 5AIPA 3ZMDA 1ZREA 2O6GE 2OAZA 1Z9CA 2CW0F 3VB2A 4L0ZB 4XSXF 4KT5C 3DP7A 1ZHFA 2W24A 4EJVA 5ICFA 5CLSA 2HFHA 3MQ0A 3TDZC 3LAJA 5DV5A 1LB2A 1E2XA 3TO9A 3EETA 3BZ6A 1O7LA 3DEUA 3KP6A 1PP7U 5ICGA 3SHFA 2IT0A 2ZJ2A 4HF1A 2B0LA 4DNCA 3GFJA 2PEXA 2ZO4A 4M6XA 2DAOA 2J5OA 4MQ9F 3CUQB 3I54A 3DF8A 4RB2C 5ED4A 4MEXF 2CYYA 3KZZA 3D0SA 5FD5A 3VODA 5CVRA 1R23A 4MNUA 5D4RA 4HV6A 1J59A 4L9TA 4WCGA 1DDNA 3IHUA 4XLPF 2VONA 2BV6A 2P8TA 3M1EA 3K1PA 2CG4A 3J81Z 5LGUA 4OIRF 4L18B 1EH6A 3KP2A 2OZUA 1OMIA 1GHCA 1XCBA 4I01A 5DCMB 3U2RA 2QLZA 1YW7A 2XKOA 1BI0A 1LEAA 4KIFA 2A6HF 2F2EA 2RC4A 1FWZA 4LK1F 3CLOA 1USTA 4MQVA 1U5TC 2W85A 4CYDA 2EB7A 2QQBA 4G94A 2LNBA 1Z6TA 2GZWA 1J9IA 3CO7C 2VBWA 3ML6A 1D3YA 1XGOA 4XSZF 1XDSA 3F8NA 2F5EA 4B09A 4RAZA 1G6NA 3E5QA 2ISYA 1WRJA 4L0YB 3DQVC 1RNLA 4LMYA 4RB1A 2GXBA 2WTEA 1S6LA 2BYVE 4EM0B 4UUVA 1B59A 1IN8A 3SZTA 4GGGA 5E8GA 3FMRA 2M5WA 5HLGA 3L9FA 1SFUA 1O3TA 2WV0A 5HDGA 1JE8A 3KP7A 1TLHB 1KA8A 2DK8A 2Z3YA 4ESJA 1D8JA 3AAFA 4EM1A 4MEYF 3KZYA 3P9IA 1LJ9A 1ZARA 1S7OA 3CDHA 3P9CA 2QYOA 3FM3A 4U0VA 4YFXF 4OIOF 3LA3A 1DPRA 2ZMEB 3HRUA 4HV5A 1SAXA 1ZLJA 3F72A 2RDPA 5CVVA 2HWVA 4N9HA 1GVJA 3ZP5A 2K02A 5LHIA 3V8JA 3L2CA 3WTZA 4EJWA 3FXQA 1ZYRF 3I53A 1TQPA 3JTGA 1STZA 2K4BA 2IA1A 5H6QA 5FFXA 3GFMA 4IRGA 1QGPA 2ZNYA 3J80K 3DKWA 4EM2A 2OD5A 4UHTA 3E97A 3KFWX 1SFXA 3T1BA 1DP7P 4Q4ZF 3ISPA 2VN2A 5ERIA 3BWGA 4PDKA 1BOAA 4KIGA 5HS9A 3RIRA 2LDUA 3I59B 2HOEA 4ZH4F 1T6SA 1JHHA 3RTRA 1QQIA 2R3SA 1P92A 1GXQA 3SQNA 5DYMA 2HR3A 3CUQA 2Q8KA 1O3RA 4XRFA 2DPDA 4O6JA 4CDGA 1JHFA 1FBUA 3IRQA 3QP6A 3ABUA 2F5DA 1KU9A 5D8KB 1IF1A 2GWRA 3K9TA 5JVTA 3BJOA 3MWMA 5FLXK 3KP4A 1FSEA 1R1UA 1FNNA 1V4RA 5LEJA 1BIBA 3P9KA 5ICCA 1V3FA 1U78A 2K27A 5LHGA 3GXOA 4UNOA 1J7KA 4HDUA 3F6OA 3I64A 3V7CA 1T98A 1XMKA 1TW2A 4HF2A 2VBZA 1K79A 4HDVA 4G6DA 1U3EM 2JPCA 3R0JA 1P4XA 3TQNA 3GYHX 1PUEE 2QM3A 4N0BA 2FNPA 3WTSC 4G7HF 1U5TB 1MKMA 4ESBA 5HDNA 4LLLA 1B1BA 3TO6A 1IN6A 3QPTA 1XN7A 1YYVA 3G73A 2NS0A 4JBAA 2FEZA 3QU3A 5K5QA 2G9WA 5DEQA 1BI3A 3LQRA 4BH9A 3LFKA 1O3QA 1FX7A 2ZBKA 4WF2A 1LQ1A 2P6TA 1W7PB 1R5HA 5IT9K 3C1DA 4OMYA 3QP5A 3RDIA 4IF4A 2IA2A 2ZXJA 3DXJF 4EGYA 1L3LA 3TKYA 1U2WA 1KYWA 1I1GA 2F5CA 1ZG3A 4Y17A 3IKTA 3GX4X 2V1XA 3S2WA 3L7WA 4P9FA 2ZCWA 2XASA 4G7ZF 3OV8A 2KKOA 2PN6A 2Y0MA 4OU0A 4LB5A 1XCVA 1FOKA 3O2PE 4CICA 5DUIA 5BQTA 3BP8A 2HTJA 1T38A 4RAYA 1U8RA 3BJ6A 5LGNA 1S8NA 2XGXA 4WX9A 1EH7A 2DI3A 5E20A 5L3DA 2QBYA 2A07F 2JTVA 3H3ZA 2ZMEA 3E6CC 2HZTA 4GO1A 2L4MA 1IN5A 1XGSA 2MD5A 1OYYA 3I4PA 1SD6A 3EYIA 4RGUA 5L3BA 1CF7B 5E8IA 2YU3A 1K6OA 2QENA 4NB5A 5LBQA 2ADUA 2V6CA 3M7GA 3SXYA 1YLFA 1Z05A 3N4MA 2O8XA 2AS5F 1FLIA 1BI1A 2MA3A 4EJUA 1OKRA 1OPCA 5CYVA 2DLLA 2PBIA 1P4AA 2R7DA 2L3DA 4HAMA 3K1MA 1JXSA 2ELHA 4HLXA 1MJ9A 5FO5A 1ZGAA 2NNNA 2XHKA 4U0WA 4G6QA 1TTYA 2YX4A 1P6RA 3R4KA 2OZ6A 2XV4S 1DPUA 3ZMZA 1ONVA 5BPDA 3DPLC 3H3UA 2KIMA 3B02A 3E6MA 1IN7A 4K2EA 2X4HA 4RS8A 4M73A 1TQIA 1J75A 3LSTA 4EV0A 3RKWA 3HSFA 4A0XA 2O03A 2CFXA 1IZ1A 4KIBA 5DUKA 2MLKA 2P7VB 4Q5SF 2DT5A 2GAUA 2A61A 4L5IA 1EH8A 4AD9A 3P7NA 3HOSA 1R36A 3KLNA 3ZN1A 2XAQA 1MDMB 1RUOA 2KJCA 4L9NA 4GXOA 3BPVA 3GEZA 1BBYA 1UCRA 3HSEA 5ILSA 5L3EA 4KA4A 5KK1A 3E3VA 3U1DA 2DPUA 2LF8A 2VT2A 4G9YA 3GLXA 4AIKA 3KE2A 2RVCA 2CO5A 3FXRA 4WWCA 3N97A 2KJBA 2FMYA 3FHZA 4LJZF 4YG2F 5F1RA 2EK5A 2EFPA 3F8MA 5JR3A 2VE9A 1KQ0A 1YW9A 3HHGA 2JSCA 4ETSA 1G3TA 2QQAA 2EFOA 2RGVA 4A6DA 4ENMA 3EQLF 3KEOA 4WK8F 4EGZA 4OIPF 4EQQA 4HX7A 1GXPA 3RYPA 4LD5A 3F23A 4IHTA 3F8FA 3H92A 4ENKA 2BEOA 3IKVA 2FBKA 3MFKA 2MLGA 1IRGA 2UXXA 1QBJA 2STWA 4IJAA 5D5VB 2ZKZA 1YTYA 2HKXA 1Y0UA 5DD8A 2M87A 1YS7A 3RYRA 5CJ9A 2E1NA 1Z1DA 2DTRA 3WTVC 4IRIA 1FBQA 3GWZA 1VTNC 3HOTA 4QWQA 3NQOA 3ECHA 1RIOH 2C6YA 1R58A 2IRFG 3O3KA 2XKPA 4LG0B 1DUXC 2XAFA 3IWZA 2CQKA 4S05A 3C18A 3WTYC 2DK5A 3HRTA 4ZZLA 2QVOA 1R22A 4Y13A 1FPQA 3BOQA 2MH9A 4FHTA 4KN4X 2LSOA 4HQEA 2CSOA 5HLIA 4I2OA 3R0AA 3TGNA 3HTUA 1TBXA 1CGPA 3HHHA 3GF2A 1YO5C 4EVIA 4I0BA 3DFGA 2EJRA 4AIHA 4IVNA 3K69A 3QAHA 1YQAA 2CWEA 5HS8A 1MD0A 4S04A 4A0YA 3WU0A 4A5NA 1JGSA 2FMLA 4IXAA 2FBHA 3TOBA 1HQCA 1QPMA 5LEKA 2P5LC 4IRHA 2DQRA 2XAGA 4Z2YA 3GFLA 4M71A 2Y75A 2GXGA 5JI6A 2P7CB 3JAMK 2H09A 1BI2A 3KP5A 4ZYHA 2P5VA 4YIIA 3E5UA 5J6XA 3ABTA 2AXLA 3I58A 4BYYA 1KU3A 1ZGJA 1F9NA 3F21A 1J5YA 5LGTA 3VOEA 3LA7A 2O3FA 2XVCA 5LRSA 2NYXA 4EJOA 4R79A 2FOKA 1Z6RA 2KRFA 2YSRA 4HYEA 1XDUA 4U0YA 3VEPA 4ZZDA 2BBYA 1W5TA 2G7UA 3FZVA
chains in the Genus database with same CATH superfamily
5C3EJ 3KLOA 5EZHA 2EPFA 3JSPA 5FLMJ 1N75A 4XMYA 5A2QK 1MSEC 1PUFB 4BJ6C 4BEHB 1X1PA 4ZYGA 5ILVA 2I8DA 5CPRB 1SVOA 3M9AA 3ZQCA 3WU2C 3A0HC 1RI7A 3ZQFA 1UG0A 1EKEA 2L54A 2PFBA 3W2WA 1I6HJ 4XLEA 3LSPA 1KQ8A 2H94A 3S93A 1BW5A 4B47A 5HNHA 2VKVA 2DN0A 2NVXJ 4DOZA 1A35A 2DFHA 1Q1VA 3V8LA 2V1NA 4TV7A 4YFKF 4ENNA 2EA2A 1XSXA 5HOOA 2P6SA 1WI9A 2B7EA 4N9IA 4BHCA 2BOLA 2IEKA 1ZG1A 2OTLI 2EV0A 3DBRB 2ZNZA 5E1XA 1WHUA 2Y9YA 3D5LA 3PNVA 1EA3A 1XB4A 2KQRA 5J3LA 3ZOBA 4AVPA 4KN7X 3OS1A 2F5FA 3ZQ7A 4HX8A 2V6EA 4JYKA 4HW0A 4OINF 3DTKA 4M3FA 5TJJA 2LC2A 1ODDA 3DKYA 5D6EA 3BR3A 4FQGA 1QZZA 3HM5A 1LUJB 3C7JA 3CJNA 3RKYA 2VL8A 1K78B 3FF5A 2X48A 2WWYA 4CZZA 2X51A 3U21A 5DS9A 1IAWA 1XS9A 4EJTA 3WTUC 3ZMTA 2VE8A 1W7PD 4DYCA 1G2HA 4BHBA 2Y30A 2R7VA 2JPBA 5FD6A 4PSWA 3OSGA 1IXRC 5JFRA 3IC7A 1BW6A 2M30A 3R60A 1F5TA 3W2AA 1FP2A 1UFMA 2TRTA 4OOIA 4LIUA 1T8IA 1FMWA 3IRRA 4XOTA 4BQAA 4AIJA 3VWBA 1SVLA 4B4CA 4LB6B 2IJLA 4P5OA 5TRDA 2P5KA 2FU4A 2E1OA 4X1EA 4KISA 1B8IB 1ULYA 3WE3A 1V5FA 3K6GA 1P4WA 2R7QA 4MTDA 4YIFA 2W00A 3GCMA 4A5MA 5K1YA 1VQMI 3BPXA 3T8RA 1IV6A 1VQLI 3L00A 3H3VK 2HZDA 3HKZA 3WG9A 3ZGKA 3S17J 1X19A 2HNHA 1O57A 3OYBA 3HRSA 1OQYA 3JTHA 4IQJA 1W36D 2VUMJ 3SZPA 4KFCA 2OBPA 3OIOA 5DCMA 2VPRA 2D45A 1ZRCA 1YI2I 3CCJI 3FMQA 1YIOA 3ZQIA 1Z77A 3HIFA 1E3OC 3K4BA 1FYMA 4CYCA 3B73A 2G0EA 4E70A 3IWFA 5F64A 4BE2A 2M0CA 3CCQI 2K9LA 4LG0A 2CH0A 2R7FA 5EGOA 3GTPJ 2ICWG 4XN0A 3Q9VA 5IPAA 2LF7A 3PUBA 2EIJH 2V26A 2PLYA 2LKPA 5H2FC 3MZHA 1L0OC 2HYFA 2IGOA 2YPRA 1VQ4I 2EZIA 4FASD 3ZQLA 3F6VA 1GV5A 3OIPA 1WVRA 4KMFA 3CUQC 3Q9SA 4ZC3A 3J7AO 4WXDA 1OCZH 2X6XA 5B1AH 2HQRA 2IP2A 5BPIA 5F1JA 3K2ZA 3FXJA 2VOPA 1ZRDA 1U0JA 3J7ZI 4IOCF 1BA5A 2H27A 2IS1A 1ZR2A 2IW5A 1XMAA 1ZG5A 2XAJA 1TT0A 1I39A 4HG2A 5DM7F 2ZXWH 2H1KA 1SD4A 3S16J 3CC7I 4BY1J 1GV2A 3HTSB 4NQWA 4A0ZA 1ITYA 4Q47A 3SZGA 2BHYA 2D1HA 2RV8A 3S1RJ 3Q0VA 2JRMA 2E1CA 3CCMI 4O5VA 4PGHA 4M6YA 1QVTA 1IUYA 4B3AA 3WTWC 4II3A 2V7FA 3REOA 4RGRA 3TOAA 3QOEA 2FRHA 3J81K 2WBMA 4C2MJ 2FNAA 1JKPC 2IA0A 1SFKA 3BZCA 4PGGA 1IUFA 3WGIA 2J5PA 2W57A 1PJRA 1LNWA 3DTEA 2X0LA 2PJPA 3L2RA 2OU2A 2ZXIA 4R1HA 4KDPA 2LK2A 2LMDA 3DU6A 5F27A 3N05A 2VJIA 1T56A 3OYNA 2MBFA 3LSKA 3IL2A 1I1SA 3SEZA 2ME0A 1IXCA 1P2FA 3OY9A 2HGCA 2LBFA 2XRNA 1ZGWA 2B9SA 3CO6C 1BM9A 3KP3A 2Y0SN 4LK0F 2ECCA 3E6BA 1MNMC 3JR9A 1R1TA 2QKMB 5F0HA 1PP8F 1XG1A 1REPC 5IT3A 2NS7A 2KDZA 3AG3H 4B3XA 3CD6I 2VQHA 2E2HJ 1U8BA 3PQJA 4P1WA 2K86A 3MZYA 2GOXB 1YS6A 2KRCA 5FB2A 1H89C 4C9YA 2L7MP 1SFOJ 1SFEA 1WJ5A 2PI0A 1Q1HA 4ON0A 2RN7A 5E1WA 5TISC 5B5EC 2ZFWA 2L9NA 3J80Z 3MAJA 1QHHD 3FXKA 2XIGA 3CC2I 5EG0A 1R5GA 1X1AA 2A69F 1FJLA 4O3MA 4BXXJ 2RKHA 5H6RA 3JRCA 5LRRA 1WJEA 2GIVA 4YFNF 1I6XA 2W25A 4IPAA 2Q2EA 1ON1A 3VSKA 2L7KA 2FXAA 3F8BA 1PUFA 1NHAA 2ESHA 4ZDLA 4BE0A 1YW8A 4R8HA 1IXSB 1TW3A 4I2OA 2Q0OA 2H8RA 1AKHB 3W3CA 1KZHA 2PX9A 4F55A 2KIQA 4I0AA 1YOVB 1RESA 3H1CA 4NC7A 1G59A 2BHZA 2OQRA 3I59A 1YG2A 3LL7A 4AYBA 4EMSA 5IY5H 2ISZA 2R7WA 2E5ZA 1G3WA 5FGMA 1QPIA 4HA8A 4F3QA 3QPLA 5AIQA 2CQXA 4BU2A 1S7EA 1KU7A 1MH3A 3MMYB 4G12A 3K1NA 1YX5A 3S1MJ 3LAPA 2AQFA 1V55H 1B72B 2X1CA 3J7YJ 1SD7A 5DDGA 5M5XJ 1HCRA 4ITVA 5BS6A 2A6TA 2NVYJ 5IYBJ 2ETHA 1HXDA 1FTZA 2R7RA 1D0XA 2DQLA 4MTEA 3G3ZA 3PQKA 1UHMA 2VQGA 2QF7A 2X6WA 3ZCOA 5J4VA 1HW1A 5FLXZ 2GXAA 2HS5A 3LQQA 1G3SA 1Z3YA 2HQNA 2IS4A 5HDKA 2HDCA 1R4MB 2JJ7A 2MH2A 3BG9A 2YX7A 4LIVA 5E18F 3I3LA 1BJZA 2M4GA 5D8LB 4BNCA 3TW6A 3BG5A 5D4SA 5E17F 3AFHA 1MJAA 1FY7A 3OYEA 1ZAOA 3GTJJ 1HKTA 4NHJA 2M45A 3C3WA 3IH2A 5BMZA 3QOPA 4B48A 2H8WA 3A2KA 1X4PA 2NNYA 4HOBA 4XRMA 2K40A 4PJJA 2WC2A 1POGA 4V2GA 3DPTA 2DA5A 2DFFA 5CVIA 4IEJA 5EF6A 4HNUA 3JRDA 2EZLA 1SD5A 1B8IA 2ELJA 1LVKA 2XAHA 5GP9A 2FE3A 4BS9A 2ME6A 3OYDA 2UV1A 4LFUA 3WGHA 2DOAA 2LVSA 3WODF 4XLHA 1FYLA 1LDKB 1LFPA 1QO0D 2R7XA 1U5TA 3D5RC 4D1QA 1R7JA 1S29A 2A05A 2WB1A 4RLFA 1QRYA 1XGNA 3BTIA 3CCRI 1FYKA 4BE1A 1VZ0A 2RAEA 3PFYA 4D0PA 5L3FA 1BR1A 3EYYA 2Z5UA 3VYUB 5KHDA 5L3GA 1B4AA 2V4JC 1XGMA 2ID3A 1F4KA 1X3WB 3MKZA 1LFBA 5FKOA 2KHMA 5ICEA 1ON2A 2YU9J 1S3JA 1WJDA 5JHFA 3I0TA 5DCFA 3CMEI 3AKZA 4DQ2A 4JX5A 3FKIJ 2HPMA 4XL9A 1DGRM 2PMZN 4MFEA 3CDIA 2V1DA 5EEHA 2FUG2 2IPQX 3DWLE 5FKNA 2XAUA 3HRMA 1HKSA 3RPUD 2XF6A 5IT9Z 2XB5A 5D6FA 2HVSA 1W7PA 1BC7C 4LLNA 2HI3A 1B9NA 1H9GA 3DBHB 2IS2A 3DTIA 2HYGD 5FKKA 1XSVA 4NDLA 6PAXA 4XM3A 2MG4A 4I09A 3LSMA 5H20A 2RQPA 1WJBA 2VKEA 3ZQGA 1N78A 1G8XA 3LMMA 1FIPA 2NOJB 3GW2A 2HYJA 4NUBA 4CZCA 5HLHA 4BHPA 3FWEA 4BACA 1FOYA 3EUHA 1O3SA 2EIMH 2IVMA 3COAC 3Q5FA 3CF2A 3RKXA 2A5WA 2WAEA 4UXNA 2GIZA 5KVRA 3KETA 1TNSA 1MBGA 4I98B 3S14J 1MH4A 2QQ9A 3SFZA 1T0FA 2QGUA 4HBLA 5F6FA 4DBQA 2MSYA 2OCEA 2TCTA 2WY8Q 2WV1A 3PFIA 4A3KJ 1UHSA 4KICA 2JA6J 3VYTB 4G7OF 2VKHA 5BNGA 2K7LA 2FA5A 3HG9A 2BXZA 1SANA 2VBXA 1Y0NA 2W84A 2R7TA 3A02A 2CU7A 4RB3C 3MD2A 3V4GA 1M1EB 2NVQJ 2FBIA 1E3PA 2HKOA 1UELB 2HPIA 2DOEA 1IRFA 3QPHA 1J0RA 4I7HA 1DP3A 5K7HA 3CTAA 3HEFA 2E36A 4M9XA 2V79A 1BJAA 4N4OB 2CQ7A 1OR7A 2EV5A 2HDWA 2BGCA 1IW7F 5AONA 2ELKA 1I5ZA 3L2VA 3KX2A 4AIDA 1WJCA 3F22A 3LSGA 1IG7A 3AL0B 3GVAA 4H0EA 2L4AA 4G8XA 2XUBA 5HS7A 3T0YA 4QLCU 4Y15A 3FXUA 3EPZA 3DLAA 3WHBA 3R61A 3RI4A 4FT8A 3ZMUA 1I27A 1N25A 2FJ1A 1JKOC 2PQ8A 4Y7NJ 4RA2A 4XRSG 3I5UA 2R5ZB 1YFHA 2Y69H 4KYWA 3FX3A 2DA3A 2HXIA 3Q3SA 2E5NA 3PIPF 3H0DA 2XSJC 2G7HA 2EFWA 1QHGA 3NEUA 5IP9J 4A2UA 5C4JJ 1CF7A 1T08B 3MCZA 4HZFA 2EBIA 4XORA 2PMUA 4XNFA 1W1WE 2ZFUA 4D9JA 3M1CA 3O8HA 3G6EI 1K61A 3QODA 3RPQA 4PFOA 3EDPA 4UB8C 1D5YA 4FE4A 1C0WA 4UVBA 1Z91A 2A6EF 3BLYA 1FC3A 2CS3A 2MFZA 3CUOA 1Z0XA 1SMYF 3JREA 2IGMA 1MBKA 4XLCA 1MGTA 2EFQA 1MZBA 4WXHA 2DBBA 3K4KA 2VBYA 4BQOA 1GUUA 2HVQA 2MC3A 2XC7A 1FT9A 1UZCA 5ILUA 5EEGA 1Z3XA 3KPHA 2JN6A 1FP1D 1BN5A 3TMOA 3JW4A 3OYFA 2GA2A 3H5AA 3SFIA 3CP2A 2P0WA 3DU5A 5CQEA 1F1ZA 1JT0A 4OAYA 2VODA 4FE7A 2Z33A 1HKQA 4ZYDA 1AOYA 2R4GA 2CV2A 2TDXA 3K4CA 5LD2C 1UJ8A 1ETXA 1ZLKA 4DIQA 4IO9F 3H5NA 5DD4A 1SMTA 3RQIA 2O61A 3F8CA 1IN4A 3TO7A 5JHUA 2UZKA 3VYRB 3MKWB 4QTRA 2DW4A 3OR2C 2DJNA 2EFNA 4CCLA 4CO8A 3BJAA 1G4DA 4CCOA 4D7NA 2H6BA 3OIQA 1S7AA 3NARA 2QBYB 5E1ZB 2VC1A 3JRAA 4IQ4A 2KZVA 2EV6A 1KYZA 4L5JA 3ECOA 4B44A 3BR6A 3KEQA 4B8XA 5LFAA 3LNQA 3K70C 2NAZA 5LLQA 1OLTA 2O0YA 4KUMA 1LDDA 3LWFA 1XC5A 3PNYA 5CVUA 2QUFA 3HSRA 5K5OA 1K7AA 2CGPA 2NRAC 4OIQF 1FZPB 1WWXA 3QQAA 3V7SA 5D5XB 5J8FA 1JKQC 2F4MB 1ETWA 3BG6A 3HGYA 4A3BJ 2BZTA 2L01A 3CMYA 5B3SH 1XX5A 4OAZA 3FIWA 1A04A 3HUGA 3PJRA 4HPQA 1MNEA 2PJRA 4C3IJ 2Z9OA 1MMDA 4E7IA 4DYRA 2QQ8A 4A3EJ 1D0YA 4F7ZA 3WTTC 1XD7A 4QPQA 2VASA 3BY6A 3BTLA 3K2AA 1MDMA 2L9VA 1UB9A 4M3DA 4ZDPA 4XK4A 2NVTJ 2E7XA 4GYIA 4BJTA 1VQOI 1XPXA 3FMSA 2LFBA 1HSTA 1JJ6C 3ERED 3MEXA 2UWMA 1ENHA 2ESNA 4P55A 4UV9A 2VLAA 2JRTA 1LEBA 4J00A 4A3FJ 4LGWA 4AWXB 1R1VA 4I02A 2LP0A 2FQ3A 2Y48A 2XDVA 2R7SA 4CHUA 3RZOJ 4C3JJ 3F3XA 3KCCA 1E0EA 2KIUA 2M4KA 2KRHA 4XBFA 1XMXA 4D5CA 4IHXA 1AU7A 1KQ9A 4ENJA 4PCQA 3ZMVA 2KLOA 1B9MA 1QNTA 4XKBA 1KU2A 3W6JB 3ZMSA 4UUSB 4DYQA 5C44J 4HLYA 2KIFA 2KMUA 3O6BB 4Y3OA 4KNYA 1BIAA 2DO7A 4F92B 1UHWA 3H35A 1APLC 1XSDA 3DV8A 2M7BA 3ELKA 4L9JA 4G6TB 4U7BA 1RPWA 1ZKGA 3OOPA 1NK2P 3GO5A 1OYWA 1VQPI 4ZYEA 1BOBA 2FF4A 2V9VA 3ROUA 2ZSHB 3GTKJ 1MJBA 3C2BA 5J1YA 1WJAA 1B6AA 2ACJA 1IDZA 2JZYA 2D2WA 2V1UA 2OUMA 3D5SC 2E60A 1AWCA 3GTQJ 2BW3B 3HYIA 4B1RA 2EA4A 4M9ZA 4XOPA 2KFDA 4WXCA 2RNJA 2Z99A 2K9NA 4Q48A 4U7DA 2KPMA 4BXFA 2F5VA 2CV1A 1LE8A 4CSWA 4I76A 2OA4A 1BR4A 3TEDA 3M8FA 2VQCA 3V42A 3QWLA 5L3CA 1T39A 1VQ7I 1R5ID 1GVDA 4AUXA 1O7FA 3PUFA 5E3LA 4RGXA 1R00A 1W5SA 1OCTC 3ZN0A 1IDYA 1PDNC 1QZYA 5K5RA 1S5LC 4AC0A 5CVJA 1JI8A 3V7RA 3D1NI 1TWHJ 1VQNI 1Z7LA 3M4OJ 2ECBA 4P9UA 4ZTFA 4RM2A 5M3MJ 3U1KA 4FX0A 3RQ4A 1F36A 2A3SA 3ZPLA 4BAYA 2P4WA 1IGNA 3VFZA 1FTTA 2E2JJ 3T8TA 4BDZA 4OWRB 2ZSIB 3U9GA 4PZJA 3I71A 4UVCA 4LOCA 1HBXG 2CMPA 4JQFA 3I56I 2QWWA 1WKMA 4FCYA 1LDJA 3NWTA 3ULQB 2L9RA 2A68F 2HTSA 3HC7A 2WADA 3EUKL 3VDXA 1MBHA 4DJAA 1HLVA 3RSNA 1RUNA 4FISA 1TWCJ 1OISA 2PMHA 2STTA 3RPUA 1IRZA 3WU1B 3ZR8X 4ANJA 2HEOA 1VQ8I 4M74A 4MLOA 4E7JA 2K4JA 3QRFF 5B1BH 3E6DA 3NRVA 2JWTA 4Z6YA 3SJMA 1P9QC 1ZN2A 2P81A 2M2EA 2ZXHA 4MGRA 1ORKA 1D8KA 4XLAA 2VJJA 2VT3A 5K7ZA 1T2KA 2XROA 4JK1X 1U9NA 5D5WB 3MN2A 3OOUA 3V8KA 4QIWN 2K3FA 2GA1A 2M8EA 3W6KB 4W1UA 4HEA2 4FX4A 1HW5A 4GYGA 1Z7UA 4RLQA 3JAMZ 1EJ9A 4U88A 1VNDA 3A0BC 4ASNA 1RR8C 2FSWA 1JJ8C 1HW2A 3L09A 3HJEA 3IH4A 3RKQA 2HOSA 1NG7A 4UUTA 3R6SA 3TDUC 1EV7A 3OYGA 1BL0A 3AG2H 3VSLA 3T5XA 3GZ6A 5E3NA 1CQTA 4RGSA 1HSJA 4PJMA 1Y8QB 5IYDJ 4N4NB 4RB0A 1OCOH 4M6VA 1GT0C 2BE5F 1WSUA 1E17A 2WAQN 3L1PA 3S32A 1H9TA 1OCRH 2XF7A 3ERMA 4M3EA 4M72A 5GAHJ 4A3LJ 1RZ4A 2OPTA 1JTXA 3M3YJ 2DFIA 3M8EA 3FK7A 1FBSA 3GZ5A 4KMUX 4LLGF 4X0GA 1VFCA 4CGZA 3WGGA 5LHHA 4HF0A 5HVQC 2JSPA 1P7IA 4Y52J 5GPAA 2VXZA 4RDUA 2WAFA 2CJJA 2H6CA 3DCFA 1WFXA 1H0MA 2COMA 3BR1A 3E1SA 4L9VA 1TQMA 1WQ2A 4GCVA 1OJLA 2GQQA 3E5XA 4CXFA 2L0KA 3JSOA 5A2QZ 2UXNA 1G3YA 1LVAA 2M1BA 3G1MA 4JP0A 5FKMA 4FTHA 2W7NA 5J8CA 3QU6A 2MW8A 3CMMA 1WH7A 1W4MA 2EWNA 1S9HA 1HF0A 4ESFA 4BEHA 3S3NA 2XRLA 4A3GJ 2VPLA 2L02A 2OTJI 2KT0A 3UNGC 2IS6A 2YS9A 4A6EA 3G4SI 4P96A 3WHCA 2QZ8A 1FSHA 1VQ9I 3WTXC 2VOOA 2JQ7A 4IHSA 4I99C 1GDTA 1D5VA 3GFIA 3NWSA 1KGSA 1OYIA 2BVLA 2VC0A 3FM5A 4YRVA 1NG6A 4A12A 5FFZA 1MBFA 2M0MA 1TT5B 4HQMA 2O8KA 1VQ5I 2A5YB 5D5UB 4XLNF 3K4JA 3SDGA 3BROA 4BXUA 2YR2A 1GLNA 1TNTA 1ZRFA 2HU9A 2K3PA 3OYLA 1U6GA 2DMQA 5F08A 3PO2J 5K7FA 1USSA 2E7WA 3DEEA 2GM4A 5BOXA 1TP4A 5M5YJ 1X3UA 3LA2A 2K5CA 2JT1A 2PG4A 1J2XA 1Y1VJ 4II2A 3OSFA 4GFBA 4MHGA 4IHWA 2D1VA 2LTPA 4XONA 1X4OA 2NOGA 4OMZA 3KYDB 4M3BA 3GUDA 3MZ8A 3HDDA 3BDDA 5EJCA 1LPQA 2OQGA 2LY1A 4BKXA 2ZB9A 2LKXA 1R9TJ 2Z2SB 1ZH5A 3WE2A 4UV8A 3RJPA 3C2HA 1K78A 4UVAA 3K0LA 2DU9A 4C30A 4M9SA 4HX4A 2ZMEC 3CLQA 5AIPA 1BC8C 1FIAA 3ZMDA 5IOYA 1ZREA 3FBIB 2O6GE 2OAZA 1Z9CA 2CW0F 2DA6A 1SVMA 3VB2A 4L0ZB 4XSXF 3X2QH 3GLLA 4KT5C 3HOUJ 3DP7A 2M8GX 5GAEJ 2JA5J 3ZQHA 2Z16A 2QEXI 5JVGF 1ZHFA 2E2IJ 2W24A 4EJVA 5ICFA 2BY2A 2L9SA 1ETYA 1X3ZB 3CZ6A 1MBJA 2JVHA 1Z67A 5CLSA 3RCOA 4H4KC 2LD5A 2BY1A 2HFHA 2R5YB 3MQ0A 1FOWA 3PIOF 4XLFA 3IH3A 3TDZC 3LAJA 5DV5A 2K85A 4HSRA 1E2XA 4NC6A 3TO9A 1LB2A 3ASOH 3EETA 3BZ6A 1O7LA 3DEUA 3KP6A 1VQKI 2DMTA 1PP7U 5J1RA 2Z1DA 5ICGA 3SHFA 1Y6IA 3S1QJ 2IT0A 2ZJ2A 4HF1A 5KCMA 5EEAA 3OYCA 2B0LA 4DNCA 1W0TA 3GFJA 3K7AJ 2PEXA 2ZO4A 2DTZA 2JUCA 2DAOA 3BTCA 4M6XA 4BL0B 1A6IA 2J5OA 4MQ9F 3CUQB 3H0GJ 3E0JB 3SEQA 3H9QA 4MO7A 2COBA 2CUZA 2OCCH 3CF5F 3I54A 2I5UA 3DF8A 1IJWC 4M3GA 4PSXA 3ASNH 5J1UA 4RB2C 2BY0A 5ED4A 4MEXF 2CYYA 1QA6A 3H9JA 3KZZA 2E34A 1JUSA 3D0SA 5DM6F 3ABLH 1V54H 5FD5A 4ZDOA 3OYKA 3HKZN 3VODA 5CVRA 2EH3A 4FETA 1R23A 2AQEA 1QVUA 4MNUA 4L5EA 5D4RA 4HV6A 1O4XA 1J59A 2JA7J 2DXIA 4L9TA 1HOMA 4WCGA 2DT7B 4NC8A 1X58A 1QU3A 1DDNA 3IHUA 4XLPF 2VONA 2DMNA 2BV6A 3DKXA 2P8TA 3CCSI 1HA8A 1TZLA 4JX4A 3SDBA 3M1EA 3K1PA 2CG4A 3J81Z 1RKWA 5LGUA 3OYAA 4OIRF 4L18B 1EH6A 4BY7J 3CCYA 3CDLA 1PVEA 3KP2A 1Y8RB 2OZUA 3ZXSA 1OMIA 1GHCA 1JT6A 1XCBA 3DEWA 2LREA 2QA4I 4KT6A 3CCVI 3BQYA 4XN3A 3CESA 4I01A 4AM3A 5DCMB 1JTYA 3U2RA 2QLZA 1YW7A 2XKOA 2O9LA 1BI0A 1LEAA 1RRJA 5FROA 2DJIA 4KIFA 1RKTA 2FD5A 4A93J 4X6AJ 2A6HF 2F2EA 2RC4A 1FWZA 1U9OA 4LK1F 3CLOA 4E7LA 1USTA 4BDYA 4MQVA 1U5TC 3S8PA 1A36A 3JRIA 5EGOB 2W85A 3BQZA 4CYDA 2EB7A 3GTOJ 2QQBA 1VF9A 4G94A 2QSGX 2LNBA 2MYSA 4QPOA 1Z6TA 3OYJA 3QYBA 2GZWA 1J9IA 3CO7C 2VBWA 4EEFG 5EDNA 3ML6A 1D3YA 1A5JA 1AHDP 1XGOA 4XSZF 1XDSA 3F8NA 3OMYA 2F5EA 2NVUB 4RAZA 4B09A 1G6NA 3E5QA 2X85A 2ISYA 4IHVA 1FMVA 1WRJA 4L0YB 4KJZA 2CUEA 3DQVC 1UAAA 3Q0WA 1I50J 1RNLA 4LMYA 1YRNB 2Y0SA 2KL4A 3LSIA 1S72I 4RB1A 5B66C 2GXBA 2M9HA 2WTEA 1S6LA 2XSDC 2HQ5A 3TL4X 3H9GA 2X6YA 3MKLA 4F52A 2IXSA 2M3AA 2BYVE 3NAUA 2DCEA 4EM0B 3M07A 4UB6C 4UUVA 1B59A 2JA2A 1K4SA 1DU0A 1HDDC 1IN8A 1AKHA 2CFOA 4D5FA 3SZTA 4GGGA 1IV8A 5E8GA 3FMRA 2QCOA 3EUHC 3GTGJ 2M5WA 5HLGA 3L9FA 1SFUA 1O3TA 2WV0A 5HDGA 4CUGA 1JE8A 2F4OB 2IBDA 1T0FC 3KP7A 2EQRA 1TLHB 1KA8A 2DK8A 2Z3YA 4ESJA 1D8JA 3AAFA 4EM1A 4MEYF 3KZYA 3P9IA 1LJ9A 1ZARA 1HC8A 4XICA 1J09A 3BG3A 1WI3A 3GTMJ 1B72A 1S7OA 1W36C 3CDHA 3P9CA 2QYOA 3FM3A 2L2OA 1I3QJ 4U0VA 4YFXF 4BGDA 4OIOF 9ANTA 3B6AA 3HOVJ 2FOWA 1DPRA 2ZMEB 3HRUA 3LA3A 4HV5A 1SAXA 4AU7A 2UUZA 1MNDA 1ZLJA 3F72A 4YELA 2RDPA 5CVVA 2HWVA 2VIXA 1UG2A 4N9HA 3HPGA 1GVJA 1OR7C 3ZP5A 2K02A 5LHIA 4IKFA 3V8JA 1VQ6I 1TWGJ 3SYTA 3L2CA 3WTZA 2NS8A 3LSJA 3G2BA 4EJWA 2QSFX 1OCCH 3W6VA 3FXQA 3A4CA 1ZYRF 1JKRC 3I53A 1TQPA 3C2GA 4AYBN 3BR0A 2JMWA 3JTGA 1STZA 2K4BA 2HQAA 2IA1A 3KYLA 3CCLI 3ABMH 2LR8A 5H6QA 5FFXA 3JRFA 3GFMA 4IRGA 5JLWA 2IGNA 1QGPA 1KONA 2ZNYA 3LSRA 2VJ5A 5M5WJ 3J80K 1D1CA 4NBQA 1WJFA 3DKWA 3OL3A 4EM2A 2OD5A 3PSIA 4UHTA 2EZHA 3E97A 3KFWX 1SFXA 2WY7Q 2XPVA 3T1BA 2Q2EB 1DP7P 4Q4ZF 2F6CA 3ISPA 2VN2A 3S2DJ 5ERIA 1MBEA 1NTCA 3BWGA 3I4MJ 2R5YA 4PDKA 1BOAA 4KIGA 2Y31A 5HS9A 3DBLB 5KAFC 3RIRA 3O8GA 1EF4A 4BQNA 3FXLA 3CJQB 1Y1WJ 2MGQA 2F48A 4W97A 2LDUA 2RQQA 3I59B 2XGEA 1P7JA 2LLKA 2HOEA 4ZH4F 1RC9A 1T6SA 1OCPA 1JHHA 3RTRA 1QQIA 2R3SA 1P92A 1GXQA 3LSHA 3SQNA 5DYMA 2CUFA 2HR3A 3CUQA 3BZKA 2RNGA 3H5RA 2Y9ZA 2Q8KA 4ZJZA 1O3RA 2IGKA 4XRFA 2DPDA 4O6JA 4CDGA 4GRIA 1JHFA 1FBUA 3A03A 3IRQA 5HNFA 2KISA 3QP6A 3ABUA 2F5DA 1N77A 2X1EA 2W4SA 1KU9A 3PSFA 5D8KB 2ZJQF 1IF1A 2GWRA 1FOXA 3K9TA 4CCNA 3L2QA 2V9PA 4IL6C 5JVTA 3BJOA 3MWMA 4DZJA 1YITI 5FLXK 3KP4A 1WH5A 1FSEA 1R1UA 1FNNA 3S15J 1V4RA 5LEJA 1BIBA 1MSFC 3P9KA 5ICCA 1X1DA 2WB1N 1V3FA 5F0FA 1U78A 2K27A 5LHGA 3GXOA 2H1LA 1D0ZA 4UNOA 1J7KA 4HDUA 3F6OA 1DQUA 3I64A 3V7CA 1JUMA 1T98A 5F0CA 4A3DJ 1XMKA 2LRDA 4A69C 1TW2A 4HF2A 2VBZA 2DA7A 4DBRA 3LOCA 3S1NJ 2FX0A 4Y4RA 1A31A 2PMZA 2F4IA 2CUJA 4QSHA 1OFCX 1K79A 4HDVA 4G6DA 3TP3A 3UKGA 1U3EM 1K4TA 2JPCA 3R0JA 1P4XA 4JX6A 3TQNA 4KITB 4RAGA 3GYHX 2O5RA 1ERDA 4GDFA 2K9QA 5J40A 1PUEE 2QM3A 4N0BA 2FNPA 3WTSC 4G7HF 1YJ9I 1E3HA 1U5TB 1MKMA 1UMQA 1X1BA 4ESBA 5HDNA 4LLLA 1D1BA 1B1BA 1T95A 3TO6A 2ZJPF 2VB6A 1IN6A 2E35A 2QKLB 1K6YA 1A6QA 5M3FJ 5IP7J 2KZGA 2HVRA 2GLOA 3QPTA 1XN7A 1YYVA 3FHNA 3K70D 3W2VA 4ZTJA 3G73A 2NS0A 4JBAA 2FEZA 4ZYAA 2D5VA 3QU3A 4YEJA 3BCBA 4V19K 5K5QA 2G9WA 5DEQA 1BI3A 2CW8A 3LQRA 1MMSA 2OF7A 4BH9A 4DW6A 3LFKA 1O3QA 2R5ZA 4NNJA 2DDBA 2LH9A 5J4YA 1FX7A 3IAM2 4E6KG 2ZBKA 4WF2A 1LQ1A 2CQQA 1W5CC 2P6TA 5FJ8J 1W7PB 1R5HA 1RETA 5IT9K 3BCAA 1JGGA 3CCEI 2AHQA 3HXLA 3RZDJ 3C1DA 4OMYA 3QP5A 3RDIA 4IF4A 2IA2A 2ZXJA 3DXJF 4UY8I 3MKYB 4JOMA 4EGYA 2XGCA 3HPHA 1L3LA 3TKYA 2X9DA 1YRNA 4IZZA 1U2WA 1KYWA 1ACIA 3HB9A 1I1GA 2F5CA 3UR3C 3GZNB 2AO9A 1ZG3A 2OJED 4Y17A 3IKTA 3KIOA 3GX4X 2V1XA 2DMUA 3S2WA 3L7WA 4P9FA 3WG7H 4A3MJ 2ZCWA 2K9MA 2LOOA 2XASA 4G7ZF 3OV8A 1TWAJ 2KKOA 2PN6A 3AG4H 2Y0MA 2LY9A 3BTJA 4OU0A 4LB5A 2AXTC 1XCVA 5F04A 1FOKA 3O2PE 4CCMA 4CICA 1X1CA 5DUIA 3BG7A 5BQTA 1BR2A 3BP8A 2HTJA 1IC8A 1T38A 4RAYA 5GADJ 1WGXA 1U8RA 1ETKA 3BJ6A 4V2FA 5LGNA 1S8NA 2XGXA 2DA2A 4WX9A 2IAIA 1EH7A 1R71A 2VXDA 3L2UA 5HODA 2DI3A 2VKDA 5E20A 1SC7A 3HOYJ 5L3DA 3L2WA 3IAS2 2MABA 4A3IJ 2DT6A 2A07F 2QBYA 2JTVA 3H3ZA 1K83J 2ZMEA 3E6CC 2HZTA 4GO1A 2L4MA 3F9KA 2ZJRF 4PJLA 1IN5A 1ZTRA 4YIRX 1XGSA 3DPUA 2MD5A 5E3OA 2OC6A 3CQZJ 1D1AA 1OYYA 3I4PA 1SD6A 3LFUA 1LFUP 5JLXA 3EYIA 3FK6A 3GMEA 4RGUA 3AL0C 3G1LA 2RREA 3AG1H 5L3BA 1CF7B 5E8IA 2YU3A 2R93J 4CCJA 1K6OA 2QENA 4NB5A 2L5QA 5LBQA 2ADUA 2V6CA 1H88C 3M7GA 2DMPA 1ETQA 4CA0A 3CP8A 4RAFA 3SXYA 3VPRA 4AVZA 1YLFA 3HOXJ 3PL8A 1Z05A 3N4MA 1WPKA 3HL2A 2O8XA 3K4NA 2AS5F 5TGTA 3OR1C 1FLIA 1BI1A 3G71I 2MA3A 4EJUA 3OWTA 1OKRA 2BVMA 1OPCA 5CYVA 2LKSA 4MFDA 2BXYA 2DLLA 2PBIA 1P4AA 2R7DA 2L3DA 3GBGA 4HAMA 3K1MA 2OV7A 5EZGA 4E7ZA 5E3MA 5J47A 1JXSA 1ZK8A 2ELHA 4HLXA 4PJNA 1Y39A 1MJ9A 5FO5A 1ZGAA 2L7FP 2E1MC 2NNNA 1H8AC 1MW7A 3OL4A 2XHKA 4U0WA 4G6QA 3QYFA 4C3HJ 1TTYA 2YX4A 1P6RA 3R4KA 2CQNA 2OZ6A 2XV4S 2MD0A 1DPUA 3CJRB 4UUSA 3ZMZA 1TL8A 4DGWB 2VQLA 1ONVA 5BPDA 3HOWJ 2XF5A 1MMAA 1MMGA 3DPLC 3M8JA 4LITA 3H3UA 2KIMA 3B02A 3E6MA 1IN7A 1V5GA 3EUAA 5DTDA 3TW7A 2R92J 2KP6A 4K2EA 2R7UA 2X4HA 4RS8A 4RBOA 5IOZA 4M73A 1TWFJ 2DYRH 3A01B 1ZQ3P 1TQIA 1J75A 4E7KA 2JUGA 3LSTA 3FISA 3KZIC 4EV0A 3PO3J 4Y33A 3RKWA 3HSFA 4A0XA 2R7ZJ 2O03A 2CFXA 1IZ1A 4KIBA 5DUKA 2MLKA 1SEUA 3CC4I 2M7AA 5CKTA 1WZ2A 2EIKH 2BW3A 2P7VB 2DODA 1YHQI 4Q5SF 2DT5A 3HUGB 2VJ4A 2GAUA 2A61A 2DFEA 4L5IA 2PJRB 3MVPA 1EH8A 2XPWA 5IYCJ 4AD9A 3P7NA 1HDPA 1MIJA 3HOSA 1R36A 3KLNA 4RM3A 3ZN1A 2XAQA 1MDMB 1RUOA 2KJCA 3JRHA 4L9NA 2DDAA 2DOFA 4GXOA 3OYHA 3BPVA 2CW7A 3GEZA 4ABZA 1BBYA 1UCRA 2QSHX 3HSEA 1R49A 1R4NB 5ILSA 5L3EA 4KA4A 2BY3A 5KK1A 3G1OA 3BT9A 4IHYA 1DGWY 3S3MA 3E3VA 2ZC2A 3BC8A 3OYMA 3U1DA 2V9KA 1TC3C 2DPUA 2HOTA 2LF8A 2I10A 2Y2ZA 2VT2A 4G9YA 3I4NJ 3GLXA 1AA7A 4AIKA 3KE2A 2RVCA 1W0UA 2CO5A 5CQGA 5GTHC 3FXRA 1X2NA 4WWCA 3N97A 2CV0A 2KJBA 2FMYA 2LG4A 2YUSA 4HNTA 3FHZA 5KAIC 4LJZF 1FEXA 4YG2F 5F1RA 2EK5A 2EFPA 3F8MA 5JR3A 2VE9A 1YIJI 4F93B 4PK4A 1KQ0A 1YW9A 4BQQA 4HNVA 3HHGA 2JSCA 4ETSA 1G3TA 2QQAA 2EFOA 2RGVA 3ESWB 2ID6A 4A6DA 4ENMA 3S3OA 4U87A 3DLLF 3EQLF 3KEOA 5E79C 1IO2A 4WK8F 4EGZA 2N8GA 4OIPF 4EQQA 4HX7A 2KDOA 3IUOA 2MC4A 3P5JA 3CJTB 3TP0A 1GXPA 3VYSB 3RYPA 4IOAF 4B43A 5GPCA 4LD5A 4XKCA 3F23A 4HRIA 4I6ZA 4IHTA 2VI6A 2M34A 3F8FA 3H92A 3ZQQA 4ENKA 2K9SA 3FXOA 2B63J 4RMNA 2BEOA 3IKVA 5FRMA 2FBKA 5GAGJ 1I3AA 2MLGA 3MFKA 3FDYA 2UXXA 1IRGA 1QBJA 2STWA 1VI0A 3BR5A 2LYCA 4IJAA 1LE8B 4MIMA 1YE9A 1T33A 5D5VB 3IP4B 2ZKZA 1YTYA 4A3JJ 2HKXA 1Y0UA 5DD8A 3E7LA 2M87A 1YS7A 2EINH 4J19A 2CRGA 3RYRA 5CJ9A 2E1NA 1Z1DA 2DTRA 4XKVA 1IRXA 3WTVC 4IRIA 2NXNB 1XTAA 1ZELA 1FBQA 2E71A 3HZJA 3GWZA 1Z21A 1VTNC 4BBRJ 4CYCB 4QWQA 3HOTA 3NQOA 3ECHA 3JRBA 1RIOH 2C6YA 1R58A 2IRFG 3O3KA 2XKPA 3PNTA 5HLTA 1DU6A 4E7SA 1YX3A 2WA0A 2JVGA 4LG0B 1DUXC 2XAFA 3IWZA 2CQKA 2DA1A 2EZKA 4S05A 3B6CA 3FKJA 1YJNI 3HOZJ 3C18A 2W82A 3WTYC 2DK5A 3HRTA 4DZPA 4ZZLA 1SAUA 1R22A 2QVOA 3IV5A 3QYEA 2R0QC 3HBLA 4Y13A 5FLVA 1YJWI 1FPQA 3BOQA 2MH9A 4FHTA 4KN4X 2W48A 4J01A 4A3CJ 2LSOA 4CCKA 1V5EA 2CSOA 5HLIA 3K4LA 3R0AA 3PM1A 2O7OA 4HQEA 4E7HA 3TGNA 3HTUA 5IP6A 1TBXA 4XR6A 1F43A 1CGPA 3HHHA 3GF2A 1YO5C 4EVIA 4I0BA 3DFGA 2EJRA 3CMAI 4AIHA 4IVNA 2JA8J 3K69A 3QAHA 1YQAA 3Q0UA 2CWEA 2HDDA 5HS8A 1ZR4A 3ZRGA 4NQWB 4HSTA 1MD0A 4S04A 4A0YA 4LG3A 3WU0A 4C2UA 4A5NA 1PYVA 1JGSA 2XGDA 2FMLA 3K10A 2FBHA 3F0CA 4IXAA 3I55I 3FBNB 3JRGA 3TOBA 1HQCA 2WAQA 4XQFA 4S0HB 5GTIC 2L7ZA 1QPMA 1R6RA 1NH3A 5LEKA 2P5LC 3HGGA 3TBIA 5EYRA 5KNLA 3OS0A 3ABKH 4IRHA 1RR7A 2HXOA 2DQRA 2XAGA 1QZEA 5FRNA 4Z2YA 3GFLA 4M71A 1ETVA 2DYSH 2Y75A 4PJ0C 4PUSA 4BJ5C 2E1MB 2GXGA 3H36A 5JI6A 1LKXA 4BBSJ 1NK3P 2X1DA 2P7CB 3GTLJ 3JAMK 2GBYA 4C2TA 2H09A 3QPSA 1BI2A 3KYCB 3KP5A 5FKLA 4ZYHA 1WCMJ 4F91B 1ETOA 3S2HJ 5C4XJ 2P5VA 2R7OA 2X6OA 4YIIA 3KEYA 3E5UA 2LBFB 5J6XA 2GOMA 4XIDA 3A1YA 3ABTA 3ONQA 2AXLA 2FQ4A 3I58A 2E19A 4BYYA 4CH7A 4IX7A 1KU3A 1X2MA 2XB0X 4PFPA 2HOAA 1ZGJA 1F9NA 2W1OA 3F21A 1MMNA 1J5YA 5LGTA 3FXMA 3K4MA 3VOEA 2LY2A 4BUPA 3LA7A 4D7MA 3J7AY 2O3FA 3JCUC 2DA4A 2JK3A 2XVCA 4XRSA 1Y56A 5LRSA 2NYXA 4EJOA 4EATA 4R79A 2FOKA 3OS2A 1Z6RA 2KRFA 2YSRA 4XKWA 4HYEA 1XDUA 4U0YA 3VEPA 3A01A 3I9V2 4ZZDA 3BR2A 3OYIA 2Q1ZB 5EG0B 2BBYA 3CCUI 4E4HA 1W5TA 2XPUA 1JUPA 2G7UA 2EILH 3FZVA
chains in the Genus database with same CATH topology
3KLOA 3JSPA 5A2QK 4ZYGA 5ILVA 3M9AA 1RI7A 2L54A 2PFBA 1KQ8A 2H94A 3V8LA 4TV7A 4YFKF 4ENNA 2EA2A 1XSXA 5HOOA 2P6SA 1WI9A 4N9IA 4BHCA 1ZG1A 2EV0A 2ZNZA 5E1XA 3D5LA 1XB4A 4AVPA 4KN7X 2F5FA 3ZQ7A 4HX8A 4HW0A 4OINF 5TJJA 1ODDA 5D6EA 1QZZA 3C7JA 3CJNA 3RKYA 1K78B 3FF5A 2WWYA 4CZZA 1IAWA 4EJTA 3WTUC 3ZMTA 2VE8A 1W7PD 4BHBA 2JPBA 5FD6A 1IXRC 5JFRA 3IC7A 2M30A 3R60A 1F5TA 1FP2A 1UFMA 4OOIA 3IRRA 4BQAA 4AIJA 4LB6B 2IJLA 4P5OA 5TRDA 2P5KA 2FU4A 1ULYA 3WE3A 1P4WA 4MTDA 4YIFA 4A5MA 5K1YA 3BPXA 3T8RA 3L00A 3WG9A 1O57A 3HRSA 3JTHA 3SZPA 4KFCA 2OBPA 5DCMA 2D45A 1ZRCA 3FMQA 1YIOA 3HIFA 1FYMA 3B73A 4E70A 3IWFA 5F64A 4LG0A 2R7FA 3Q9VA 2LF7A 2PLYA 2LKPA 3MZHA 1L0OC 2HYFA 2YPRA 3F6VA 4KMFA 3CUQC 3Q9SA 3J7AO 4WXDA 2HQRA 2IP2A 5BPIA 3K2ZA 2VOPA 1ZRDA 2H27A 2IW5A 1XMAA 1ZG5A 2XAJA 1SD4A 3HTSB 4NQWA 4A0ZA 4Q47A 2D1HA 2RV8A 2E1CA 4O5VA 4PGHA 4M6YA 1IUYA 3WTWC 3REOA 4RGRA 3TOAA 2FRHA 3J81K 2FNAA 2IA0A 4PGGA 3WGIA 2J5PA 2W57A 1LNWA 2X0LA 2PJPA 2OU2A 4KDPA 4R1HA 2MBFA 3IL2A 1I1SA 1IXCA 1P2FA 2HGCA 2XRNA 3CO6C 1BM9A 3KP3A 4LK0F 3E6BA 1R1TA 1PP8F 1REPC 5IT3A 3PQJA 2K86A 3MZYA 1YS6A 5FB2A 1SFEA 2PI0A 1Q1HA 4ON0A 2RN7A 5E1WA 2ZFWA 3J80Z 3MAJA 2XIGA 1R5GA 2A69F 4O3MA 2RKHA 5H6RA 5LRRA 2GIVA 4YFNF 1I6XA 2W25A 4IPAA 2Q2EA 1ON1A 2FXAA 3F8BA 1NHAA 2ESHA 1YW8A 4R8HA 1IXSB 1TW3A 2Q0OA 4I0AA 2OQRA 3I59A 1YG2A 4EMSA 2ISZA 1G3WA 5FGMA 4HA8A 5AIQA 1KU7A 3K1NA 3LAPA 1SD7A 5DDGA 5BS6A 2ETHA 1HXDA 2DQLA 4MTEA 3G3ZA 3PQKA 1UHMA 5FLXZ 1HW1A 2HS5A 3LQQA 1G3SA 2HQNA 5HDKA 2HDCA 2MH2A 5E18F 2YX7A 4BNCA 5D8LB 5D4SA 5E17F 1MJAA 1FY7A 1ZAOA 1HKTA 4NHJA 2M45A 3C3WA 5BMZA 3QOPA 2NNYA 4HOBA 2WC2A 3DPTA 5CVIA 1SD5A 2XAHA 2FE3A 4LFUA 3WGHA 3WODF 1FYLA 1LDKB 1QO0D 1U5TA 1R7JA 1S29A 1XGNA 1FYKA 4D0PA 5L3FA 3EYYA 2Z5UA 5L3GA 1B4AA 1XGMA 1F4KA 5ICEA 1ON2A 1S3JA 3I0TA 5DCFA 4DQ2A 2V1DA 5EEHA 2IPQX 3HRMA 1HKSA 5IT9Z 5D6FA 1W7PA 1BC7C 4LLNA 1B9NA 1H9GA 2HYGD 1XSVA 6PAXA 4I09A 5H20A 2RQPA 3GW2A 5HLHA 4BHPA 3FWEA 3EUHA 1O3SA 2IVMA 3COAC 3Q5FA 3RKXA 4UXNA 5KVRA 3KETA 1TNSA 4I98B 3SFZA 2QQ9A 1T0FA 4HBLA 5F6FA 3PFIA 4KICA 4G7OF 2K7LA 2FA5A 2VBXA 2W84A 4RB3C 3V4GA 2FBIA 2HKOA 4I7HA 1IRFA 3QPHA 1J0RA 3CTAA 4M9XA 2V79A 1BJAA 1OR7A 2EV5A 2BGCA 1IW7F 5AONA 1I5ZA 3F22A 3GVAA 4H0EA 2L4AA 4G8XA 2XUBA 5HS7A 3T0YA 4QLCU 4Y15A 3FXUA 3R61A 3RI4A 4FT8A 3ZMUA 1I27A 2PQ8A 3I5UA 1YFHA 4KYWA 3FX3A 2G7HA 2EFWA 3NEUA 4A2UA 1CF7A 3MCZA 4HZFA 2PMUA 3RPQA 3EDPA 1C0WA 4UVBA 1Z91A 2A6EF 1FC3A 3CUOA 1SMYF 2EFQA 1MGTA 1MZBA 4WXHA 2DBBA 2VBYA 2MC3A 1FT9A 5ILUA 5EEGA 1FP1D 1BN5A 3JW4A 2GA2A 1F1ZA 2VODA 2Z33A 1HKQA 4ZYDA 1AOYA 2TDXA 1ZLKA 5DD4A 1SMTA 2O61A 3F8CA 1IN4A 3TO7A 5JHUA 2UZKA 2DW4A 2EFNA 4CO8A 3BJAA 1G4DA 2H6BA 1S7AA 2QBYB 5E1ZB 2VC1A 2EV6A 1KYZA 4L5JA 3ECOA 4B8XA 3KEQA 2NAZA 5LLQA 2O0YA 4KUMA 1LDDA 3LWFA 5CVUA 2QUFA 3HSRA 5K5OA 1K7AA 2CGPA 2NRAC 4OIQF 1FZPB 1WWXA 3V7SA 5J8FA 5D5XB 2L01A 1A04A 3HUGA 2Z9OA 4F7ZA 3WTTC 1XD7A 3BY6A 1MDMA 1UB9A 2E7XA 4GYIA 3FMSA 1HSTA 3ERED 3MEXA 2UWMA 4P55A 2ESNA 4UV9A 2JRTA 1LEBA 4LGWA 4AWXB 1R1VA 4I02A 2FQ3A 2Y48A 4CHUA 3F3XA 3KCCA 2KIUA 4XBFA 1KQ9A 4ENJA 4PCQA 3ZMVA 1B9MA 1QNTA 1KU2A 3W6JB 3ZMSA 4HLYA 2KIFA 3O6BB 4KNYA 1BIAA 2DO7A 1UHWA 1XSDA 3DV8A 3ELKA 4L9JA 4U7BA 3OOPA 3GO5A 1OYWA 4ZYEA 2FF4A 2V9VA 3ROUA 1MJBA 1B6AA 2ACJA 2JZYA 2D2WA 2V1UA 1AWCA 3HYIA 2EA4A 4M9ZA 4WXCA 2RNJA 2Z99A 4Q48A 4U7DA 2OA4A 3M8FA 5L3CA 1T39A 1O7FA 4RGXA 1R00A 1W5SA 3ZN0A 1PDNC 1QZYA 5K5RA 5CVJA 3V7RA 4P9UA 4FX0A 2A3SA 3ZPLA 4BAYA 2P4WA 3VFZA 3T8TA 3U9GA 4PZJA 3I71A 4UVCA 1HBXG 4JQFA 2QWWA 1WKMA 1LDJA 3ULQB 2A68F 2HTSA 1RUNA 2PMHA 2STTA 3RPUA 3WU1B 2HEOA 4M74A 2K4JA 3QRFF 3E6DA 3NRVA 1ZN2A 4MGRA 1D8KA 2VT3A 1T2KA 2XROA 4JK1X 5D5WB 3V8KA 2GA1A 2M8EA 3W6KB 4FX4A 1HW5A 4GYGA 1Z7UA 3JAMZ 4U88A 4ASNA 2FSWA 1HW2A 3L09A 3R6SA 3TDUC 1EV7A 3T5XA 3GZ6A 4RGSA 1HSJA 4RB0A 2BE5F 1WSUA 1E17A 1H9TA 4M72A 1RZ4A 2DFIA 3M8EA 1FBSA 3GZ5A 4KMUX 4LLGF 4CGZA 3WGGA 5LHHA 4HF0A 5HVQC 2VXZA 2H6CA 1H0MA 2COMA 4L9VA 1TQMA 1WQ2A 4GCVA 2GQQA 3E5XA 4CXFA 3JSOA 5A2QZ 2UXNA 1G3YA 1LVAA 2M1BA 5J8CA 3QU6A 1W4MA 2EWNA 4ESFA 2L02A 1FSHA 4A6EA 4P96A 2QZ8A 3WTXC 2VOOA 4IHSA 1D5VA 3GFIA 1KGSA 1OYIA 2VC0A 3FM5A 4A12A 5FFZA 4HQMA 2A5YB 5D5UB 4XLNF 3BROA 4BXUA 2YR2A 1TNTA 1ZRFA 1U6GA 1USSA 2E7WA 5BOXA 1X3UA 3LA2A 2JT1A 2PG4A 1J2XA 4MHGA 2D1VA 4OMZA 3GUDA 3BDDA 2OQGA 1ZH5A 3WE2A 4UV8A 3RJPA 1K78A 4UVAA 3K0LA 2DU9A 4M9SA 4HX4A 1BC8C 5AIPA 3ZMDA 1ZREA 2O6GE 2OAZA 1Z9CA 2CW0F 3VB2A 4L0ZB 4XSXF 4KT5C 3DP7A 1ZHFA 2W24A 4EJVA 5ICFA 5CLSA 2HFHA 3MQ0A 3TDZC 3LAJA 5DV5A 1LB2A 1E2XA 3TO9A 3EETA 3BZ6A 1O7LA 3DEUA 3KP6A 1PP7U 5ICGA 3SHFA 2IT0A 2ZJ2A 4HF1A 2B0LA 4DNCA 3GFJA 2PEXA 2ZO4A 4M6XA 2DAOA 2J5OA 4MQ9F 3CUQB 3I54A 3DF8A 4RB2C 5ED4A 4MEXF 2CYYA 3KZZA 3D0SA 5FD5A 3VODA 5CVRA 1R23A 4MNUA 5D4RA 4HV6A 1J59A 4L9TA 4WCGA 1DDNA 3IHUA 4XLPF 2VONA 2BV6A 2P8TA 3M1EA 3K1PA 2CG4A 3J81Z 5LGUA 4OIRF 4L18B 1EH6A 3KP2A 2OZUA 1OMIA 1GHCA 1XCBA 4I01A 5DCMB 3U2RA 2QLZA 1YW7A 2XKOA 1BI0A 1LEAA 4KIFA 2A6HF 2F2EA 2RC4A 1FWZA 4LK1F 3CLOA 1USTA 4MQVA 1U5TC 2W85A 4CYDA 2EB7A 2QQBA 4G94A 2LNBA 1Z6TA 2GZWA 1J9IA 3CO7C 2VBWA 3ML6A 1D3YA 1XGOA 4XSZF 1XDSA 3F8NA 2F5EA 4B09A 4RAZA 1G6NA 3E5QA 2ISYA 1WRJA 4L0YB 3DQVC 1RNLA 4LMYA 4RB1A 2GXBA 2WTEA 1S6LA 2BYVE 4EM0B 4UUVA 1B59A 1IN8A 3SZTA 4GGGA 5E8GA 3FMRA 2M5WA 5HLGA 3L9FA 1SFUA 1O3TA 2WV0A 5HDGA 1JE8A 3KP7A 1TLHB 1KA8A 2DK8A 2Z3YA 4ESJA 1D8JA 3AAFA 4EM1A 4MEYF 3KZYA 3P9IA 1LJ9A 1ZARA 1S7OA 3CDHA 3P9CA 2QYOA 3FM3A 4U0VA 4YFXF 4OIOF 3LA3A 1DPRA 2ZMEB 3HRUA 4HV5A 1SAXA 1ZLJA 3F72A 2RDPA 5CVVA 2HWVA 4N9HA 1GVJA 3ZP5A 2K02A 5LHIA 3V8JA 3L2CA 3WTZA 4EJWA 3FXQA 1ZYRF 3I53A 1TQPA 3JTGA 1STZA 2K4BA 2IA1A 5H6QA 5FFXA 3GFMA 4IRGA 1QGPA 2ZNYA 3J80K 3DKWA 4EM2A 2OD5A 4UHTA 3E97A 3KFWX 1SFXA 3T1BA 1DP7P 4Q4ZF 3ISPA 2VN2A 5ERIA 3BWGA 4PDKA 1BOAA 4KIGA 5HS9A 3RIRA 2LDUA 3I59B 2HOEA 4ZH4F 1T6SA 1JHHA 3RTRA 1QQIA 2R3SA 1P92A 1GXQA 3SQNA 5DYMA 2HR3A 3CUQA 2Q8KA 1O3RA 4XRFA 2DPDA 4O6JA 4CDGA 1JHFA 1FBUA 3IRQA 3QP6A 3ABUA 2F5DA 1KU9A 5D8KB 1IF1A 2GWRA 3K9TA 5JVTA 3BJOA 3MWMA 5FLXK 3KP4A 1FSEA 1R1UA 1FNNA 1V4RA 5LEJA 1BIBA 3P9KA 5ICCA 1V3FA 1U78A 2K27A 5LHGA 3GXOA 4UNOA 1J7KA 4HDUA 3F6OA 3I64A 3V7CA 1T98A 1XMKA 1TW2A 4HF2A 2VBZA 1K79A 4HDVA 4G6DA 1U3EM 2JPCA 3R0JA 1P4XA 3TQNA 3GYHX 1PUEE 2QM3A 4N0BA 2FNPA 3WTSC 4G7HF 1U5TB 1MKMA 4ESBA 5HDNA 4LLLA 1B1BA 3TO6A 1IN6A 3QPTA 1XN7A 1YYVA 3G73A 2NS0A 4JBAA 2FEZA 3QU3A 5K5QA 2G9WA 5DEQA 1BI3A 3LQRA 4BH9A 3LFKA 1O3QA 1FX7A 2ZBKA 4WF2A 1LQ1A 2P6TA 1W7PB 1R5HA 5IT9K 3C1DA 4OMYA 3QP5A 3RDIA 4IF4A 2IA2A 2ZXJA 3DXJF 4EGYA 1L3LA 3TKYA 1U2WA 1KYWA 1I1GA 2F5CA 1ZG3A 4Y17A 3IKTA 3GX4X 2V1XA 3S2WA 3L7WA 4P9FA 2ZCWA 2XASA 4G7ZF 3OV8A 2KKOA 2PN6A 2Y0MA 4OU0A 4LB5A 1XCVA 1FOKA 3O2PE 4CICA 5DUIA 5BQTA 3BP8A 2HTJA 1T38A 4RAYA 1U8RA 3BJ6A 5LGNA 1S8NA 2XGXA 4WX9A 1EH7A 2DI3A 5E20A 5L3DA 2QBYA 2A07F 2JTVA 3H3ZA 2ZMEA 3E6CC 2HZTA 4GO1A 2L4MA 1IN5A 1XGSA 2MD5A 1OYYA 3I4PA 1SD6A 3EYIA 4RGUA 5L3BA 1CF7B 5E8IA 2YU3A 1K6OA 2QENA 4NB5A 5LBQA 2ADUA 2V6CA 3M7GA 3SXYA 1YLFA 1Z05A 3N4MA 2O8XA 2AS5F 1FLIA 1BI1A 2MA3A 4EJUA 1OKRA 1OPCA 5CYVA 2DLLA 2PBIA 1P4AA 2R7DA 2L3DA 4HAMA 3K1MA 1JXSA 2ELHA 4HLXA 1MJ9A 5FO5A 1ZGAA 2NNNA 2XHKA 4U0WA 4G6QA 1TTYA 2YX4A 1P6RA 3R4KA 2OZ6A 2XV4S 1DPUA 3ZMZA 1ONVA 5BPDA 3DPLC 3H3UA 2KIMA 3B02A 3E6MA 1IN7A 4K2EA 2X4HA 4RS8A 4M73A 1TQIA 1J75A 3LSTA 4EV0A 3RKWA 3HSFA 4A0XA 2O03A 2CFXA 1IZ1A 4KIBA 5DUKA 2MLKA 2P7VB 4Q5SF 2DT5A 2GAUA 2A61A 4L5IA 1EH8A 4AD9A 3P7NA 3HOSA 1R36A 3KLNA 3ZN1A 2XAQA 1MDMB 1RUOA 2KJCA 4L9NA 4GXOA 3BPVA 3GEZA 1BBYA 1UCRA 3HSEA 5ILSA 5L3EA 4KA4A 5KK1A 3E3VA 3U1DA 2DPUA 2LF8A 2VT2A 4G9YA 3GLXA 4AIKA 3KE2A 2RVCA 2CO5A 3FXRA 4WWCA 3N97A 2KJBA 2FMYA 3FHZA 4LJZF 4YG2F 5F1RA 2EK5A 2EFPA 3F8MA 5JR3A 2VE9A 1KQ0A 1YW9A 3HHGA 2JSCA 4ETSA 1G3TA 2QQAA 2EFOA 2RGVA 4A6DA 4ENMA 3EQLF 3KEOA 4WK8F 4EGZA 4OIPF 4EQQA 4HX7A 1GXPA 3RYPA 4LD5A 3F23A 4IHTA 3F8FA 3H92A 4ENKA 2BEOA 3IKVA 2FBKA 3MFKA 2MLGA 1IRGA 2UXXA 1QBJA 2STWA 4IJAA 5D5VB 2ZKZA 1YTYA 2HKXA 1Y0UA 5DD8A 2M87A 1YS7A 3RYRA 5CJ9A 2E1NA 1Z1DA 2DTRA 3WTVC 4IRIA 1FBQA 3GWZA 1VTNC 3HOTA 4QWQA 3NQOA 3ECHA 1RIOH 2C6YA 1R58A 2IRFG 3O3KA 2XKPA 4LG0B 1DUXC 2XAFA 3IWZA 2CQKA 4S05A 3C18A 3WTYC 2DK5A 3HRTA 4ZZLA 2QVOA 1R22A 4Y13A 1FPQA 3BOQA 2MH9A 4FHTA 4KN4X 2LSOA 4HQEA 2CSOA 5HLIA 4I2OA 3R0AA 3TGNA 3HTUA 1TBXA 1CGPA 3HHHA 3GF2A 1YO5C 4EVIA 4I0BA 3DFGA 2EJRA 4AIHA 4IVNA 3K69A 3QAHA 1YQAA 2CWEA 5HS8A 1MD0A 4S04A 4A0YA 3WU0A 4A5NA 1JGSA 2FMLA 4IXAA 2FBHA 3TOBA 1HQCA 1QPMA 5LEKA 2P5LC 4IRHA 2DQRA 2XAGA 4Z2YA 3GFLA 4M71A 2Y75A 2GXGA 5JI6A 2P7CB 3JAMK 2H09A 1BI2A 3KP5A 4ZYHA 2P5VA 4YIIA 3E5UA 5J6XA 3ABTA 2AXLA 3I58A 4BYYA 1KU3A 1ZGJA 1F9NA 3F21A 1J5YA 5LGTA 3VOEA 3LA7A 2O3FA 2XVCA 5LRSA 2NYXA 4EJOA 4R79A 2FOKA 1Z6RA 2KRFA 2YSRA 4HYEA 1XDUA 4U0YA 3VEPA 4ZZDA 2BBYA 1W5TA 2G7UA 3FZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3KLO A;  3JSP A;  5A2Q K;  4ZYG A;  5ILV A;  3M9A A;  1RI7 A;  2L54 A;  2PFB A;  1KQ8 A;  2H94 A;  3V8L A;  4TV7 A;  4YFK F;  4ENN A;  2EA2 A;  1XSX A;  5HOO A;  2P6S A;  1WI9 A;  4N9I A;  4BHC A;  1ZG1 A;  2EV0 A;  2ZNZ A;  5E1X A;  3D5L A;  1XB4 A;  4AVP A;  4KN7 X;  2F5F A;  3ZQ7 A;  4HX8 A;  4HW0 A;  4OIN F;  5TJJ A;  1ODD A;  5D6E A;  1QZZ A;  3C7J A;  3CJN A;  3RKY A;  1K78 B;  3FF5 A;  2WWY A;  4CZZ A;  1IAW A;  4EJT A;  3WTU C;  3ZMT A;  2VE8 A;  1W7P D;  4BHB A;  2JPB A;  5FD6 A;  1IXR C;  5JFR A;  3IC7 A;  2M30 A;  3R60 A;  1F5T A;  1FP2 A;  1UFM A;  4OOI A;  3IRR A;  4BQA A;  4AIJ A;  4LB6 B;  2IJL A;  4P5O A;  5TRD A;  2P5K A;  2FU4 A;  1ULY A;  3WE3 A;  1P4W A;  4MTD A;  4YIF A;  4A5M A;  5K1Y A;  3BPX A;  3T8R A;  3L00 A;  3WG9 A;  1O57 A;  3HRS A;  3JTH A;  3SZP A;  4KFC A;  2OBP A;  5DCM A;  2D45 A;  1ZRC A;  3FMQ A;  1YIO A;  3HIF A;  1FYM A;  3B73 A;  4E70 A;  3IWF A;  5F64 A;  4LG0 A;  2R7F A;  3Q9V A;  2LF7 A;  2PLY A;  2LKP A;  3MZH A;  1L0O C;  2HYF A;  2YPR A;  3F6V A;  4KMF A;  3CUQ C;  3Q9S A;  3J7A O;  4WXD A;  2HQR A;  2IP2 A;  5BPI A;  3K2Z A;  2VOP A;  1ZRD A;  2H27 A;  2IW5 A;  1XMA A;  1ZG5 A;  2XAJ A;  1SD4 A;  3HTS B;  4NQW A;  4A0Z A;  4Q47 A;  2D1H A;  2RV8 A;  2E1C A;  4O5V A;  4PGH A;  4M6Y A;  1IUY A;  3WTW C;  3REO A;  4RGR A;  3TOA A;  2FRH A;  3J81 K;  2FNA A;  2IA0 A;  4PGG A;  3WGI A;  2J5P A;  2W57 A;  1LNW A;  2X0L A;  2PJP A;  2OU2 A;  4KDP A;  4R1H A;  2MBF A;  3IL2 A;  1I1S A;  1IXC A;  1P2F A;  2HGC A;  2XRN A;  3CO6 C;  1BM9 A;  3KP3 A;  4LK0 F;  3E6B A;  1R1T A;  1PP8 F;  1REP C;  5IT3 A;  3PQJ A;  2K86 A;  3MZY A;  1YS6 A;  5FB2 A;  1SFE A;  2PI0 A;  1Q1H A;  4ON0 A;  2RN7 A;  5E1W A;  2ZFW A;  3J80 Z;  3MAJ A;  2XIG A;  1R5G A;  2A69 F;  4O3M A;  2RKH A;  5H6R A;  5LRR A;  2GIV A;  4YFN F;  1I6X A;  2W25 A;  4IPA A;  2Q2E A;  1ON1 A;  2FXA A;  3F8B A;  1NHA A;  2ESH A;  1YW8 A;  4R8H A;  1IXS B;  1TW3 A;  2Q0O A;  4I0A A;  2OQR A;  3I59 A;  1YG2 A;  4EMS A;  2ISZ A;  1G3W A;  5FGM A;  4HA8 A;  5AIQ A;  1KU7 A;  3K1N A;  3LAP A;  1SD7 A;  5DDG A;  5BS6 A;  2ETH A;  1HXD A;  2DQL A;  4MTE A;  3G3Z A;  3PQK A;  1UHM A;  5FLX Z;  1HW1 A;  2HS5 A;  3LQQ A;  1G3S A;  2HQN A;  5HDK A;  2HDC A;  2MH2 A;  5E18 F;  2YX7 A;  4BNC A;  5D8L B;  5D4S A;  5E17 F;  1MJA A;  1FY7 A;  1ZAO A;  1HKT A;  4NHJ A;  2M45 A;  3C3W A;  5BMZ A;  3QOP A;  2NNY A;  4HOB A;  2WC2 A;  3DPT A;  5CVI A;  1SD5 A;  2XAH A;  2FE3 A;  4LFU A;  3WGH A;  3WOD F;  1FYL A;  1LDK B;  1QO0 D;  1U5T A;  1R7J A;  1S29 A;  1XGN A;  1FYK A;  4D0P A;  5L3F A;  3EYY A;  2Z5U A;  5L3G A;  1B4A A;  1XGM A;  1F4K A;  5ICE A;  1ON2 A;  1S3J A;  3I0T A;  5DCF A;  4DQ2 A;  2V1D A;  5EEH A;  2IPQ X;  3HRM A;  1HKS A;  5IT9 Z;  5D6F A;  1W7P A;  1BC7 C;  4LLN A;  1B9N A;  1H9G A;  2HYG D;  1XSV A;  6PAX A;  4I09 A;  5H20 A;  2RQP A;  3GW2 A;  5HLH A;  4BHP A;  3FWE A;  3EUH A;  1O3S A;  2IVM A;  3COA C;  3Q5F A;  3RKX A;  4UXN A;  5KVR A;  3KET A;  1TNS A;  4I98 B;  3SFZ A;  2QQ9 A;  1T0F A;  4HBL A;  5F6F A;  3PFI A;  4KIC A;  4G7O F;  2K7L A;  2FA5 A;  2VBX A;  2W84 A;  4RB3 C;  3V4G A;  2FBI A;  2HKO A;  4I7H A;  1IRF A;  3QPH A;  1J0R A;  3CTA A;  4M9X A;  2V79 A;  1BJA A;  1OR7 A;  2EV5 A;  2BGC A;  1IW7 F;  5AON A;  1I5Z A;  3F22 A;  3GVA A;  4H0E A;  2L4A A;  4G8X A;  2XUB A;  5HS7 A;  3T0Y A;  4QLC U;  4Y15 A;  3FXU A;  3R61 A;  3RI4 A;  4FT8 A;  3ZMU A;  1I27 A;  2PQ8 A;  3I5U A;  1YFH A;  4KYW A;  3FX3 A;  2G7H A;  2EFW A;  3NEU A;  4A2U A;  1CF7 A;  3MCZ A;  4HZF A;  2PMU A;  3RPQ A;  3EDP A;  1C0W A;  4UVB A;  1Z91 A;  2A6E F;  1FC3 A;  3CUO A;  1SMY F;  2EFQ A;  1MGT A;  1MZB A;  4WXH A;  2DBB A;  2VBY A;  2MC3 A;  1FT9 A;  5ILU A;  5EEG A;  1FP1 D;  1BN5 A;  3JW4 A;  2GA2 A;  1F1Z A;  2VOD A;  2Z33 A;  1HKQ A;  4ZYD A;  1AOY A;  2TDX A;  1ZLK A;  5DD4 A;  1SMT A;  2O61 A;  3F8C A;  1IN4 A;  3TO7 A;  5JHU A;  2UZK A;  2DW4 A;  2EFN A;  4CO8 A;  3BJA A;  1G4D A;  2H6B A;  1S7A A;  2QBY B;  5E1Z B;  2VC1 A;  2EV6 A;  1KYZ A;  4L5J A;  3ECO A;  4B8X A;  3KEQ A;  2NAZ A;  5LLQ A;  2O0Y A;  4KUM A;  1LDD A;  3LWF A;  5CVU A;  2QUF A;  3HSR A;  5K5O A;  1K7A A;  2CGP A;  2NRA C;  4OIQ F;  1FZP B;  1WWX A;  3V7S A;  5J8F A;  5D5X B;  2L01 A;  1A04 A;  3HUG A;  2Z9O A;  4F7Z A;  3WTT C;  1XD7 A;  3BY6 A;  1MDM A;  1UB9 A;  2E7X A;  4GYI A;  3FMS A;  1HST A;  3ERE D;  3MEX A;  2UWM A;  4P55 A;  2ESN A;  4UV9 A;  2JRT A;  1LEB A;  4LGW A;  4AWX B;  1R1V A;  4I02 A;  2FQ3 A;  2Y48 A;  4CHU A;  3F3X A;  3KCC A;  2KIU A;  4XBF A;  1KQ9 A;  4ENJ A;  4PCQ A;  3ZMV A;  1B9M A;  1QNT A;  1KU2 A;  3W6J B;  3ZMS A;  4HLY A;  2KIF A;  3O6B B;  4KNY A;  1BIA A;  2DO7 A;  1UHW A;  1XSD A;  3DV8 A;  3ELK A;  4L9J A;  4U7B A;  3OOP A;  3GO5 A;  1OYW A;  4ZYE A;  2FF4 A;  2V9V A;  3ROU A;  1MJB A;  1B6A A;  2ACJ A;  2JZY A;  2D2W A;  2V1U A;  1AWC A;  3HYI A;  2EA4 A;  4M9Z A;  4WXC A;  2RNJ A;  2Z99 A;  4Q48 A;  4U7D A;  2OA4 A;  3M8F A;  5L3C A;  1T39 A;  1O7F A;  4RGX A;  1R00 A;  1W5S A;  3ZN0 A;  1PDN C;  1QZY A;  5K5R A;  5CVJ A;  3V7R A;  4P9U A;  4FX0 A;  2A3S A;  3ZPL A;  4BAY A;  2P4W A;  3VFZ A;  3T8T A;  3U9G A;  4PZJ A;  3I71 A;  4UVC A;  1HBX G;  4JQF A;  2QWW A;  1WKM A;  1LDJ A;  3ULQ B;  2A68 F;  2HTS A;  1RUN A;  2PMH A;  2STT A;  3RPU A;  3WU1 B;  2HEO A;  4M74 A;  2K4J A;  3QRF F;  3E6D A;  3NRV A;  1ZN2 A;  4MGR A;  1D8K A;  2VT3 A;  1T2K A;  2XRO A;  4JK1 X;  5D5W B;  3V8K A;  2GA1 A;  2M8E A;  3W6K B;  4FX4 A;  1HW5 A;  4GYG A;  1Z7U A;  3JAM Z;  4U88 A;  4ASN A;  2FSW A;  1HW2 A;  3L09 A;  3R6S A;  3TDU C;  1EV7 A;  3T5X A;  3GZ6 A;  4RGS A;  1HSJ A;  4RB0 A;  2BE5 F;  1WSU A;  1E17 A;  1H9T A;  4M72 A;  1RZ4 A;  2DFI A;  3M8E A;  1FBS A;  3GZ5 A;  4KMU X;  4LLG F;  4CGZ A;  3WGG A;  5LHH A;  4HF0 A;  5HVQ C;  2VXZ A;  2H6C A;  1H0M A;  2COM A;  4L9V A;  1TQM A;  1WQ2 A;  4GCV A;  2GQQ A;  3E5X A;  4CXF A;  3JSO A;  5A2Q Z;  2UXN A;  1G3Y A;  1LVA A;  2M1B A;  5J8C A;  3QU6 A;  1W4M A;  2EWN A;  4ESF A;  2L02 A;  1FSH A;  4A6E A;  4P96 A;  2QZ8 A;  3WTX C;  2VOO A;  4IHS A;  1D5V A;  3GFI A;  1KGS A;  1OYI A;  2VC0 A;  3FM5 A;  4A12 A;  5FFZ A;  4HQM A;  2A5Y B;  5D5U B;  4XLN F;  3BRO A;  4BXU A;  2YR2 A;  1TNT A;  1ZRF A;  1U6G A;  1USS A;  2E7W A;  5BOX A;  1X3U A;  3LA2 A;  2JT1 A;  2PG4 A;  1J2X A;  4MHG A;  2D1V A;  4OMZ A;  3GUD A;  3BDD A;  2OQG A;  1ZH5 A;  3WE2 A;  4UV8 A;  3RJP A;  1K78 A;  4UVA A;  3K0L A;  2DU9 A;  4M9S A;  4HX4 A;  1BC8 C;  5AIP A;  3ZMD A;  1ZRE A;  2O6G E;  2OAZ A;  1Z9C A;  2CW0 F;  3VB2 A;  4L0Z B;  4XSX F;  4KT5 C;  3DP7 A;  1ZHF A;  2W24 A;  4EJV A;  5ICF A;  5CLS A;  2HFH A;  3MQ0 A;  3TDZ C;  3LAJ A;  5DV5 A;  1LB2 A;  1E2X A;  3TO9 A;  3EET A;  3BZ6 A;  1O7L A;  3DEU A;  3KP6 A;  1PP7 U;  5ICG A;  3SHF A;  2IT0 A;  2ZJ2 A;  4HF1 A;  2B0L A;  4DNC A;  3GFJ A;  2PEX A;  2ZO4 A;  4M6X A;  2DAO A;  2J5O A;  4MQ9 F;  3CUQ B;  3I54 A;  3DF8 A;  4RB2 C;  5ED4 A;  4MEX F;  2CYY A;  3KZZ A;  3D0S A;  5FD5 A;  3VOD A;  5CVR A;  1R23 A;  4MNU A;  5D4R A;  4HV6 A;  1J59 A;  4L9T A;  4WCG A;  1DDN A;  3IHU A;  4XLP F;  2VON A;  2BV6 A;  2P8T A;  3M1E A;  3K1P A;  2CG4 A;  3J81 Z;  5LGU A;  4OIR F;  4L18 B;  1EH6 A;  3KP2 A;  2OZU A;  1OMI A;  1GHC A;  1XCB A;  4I01 A;  5DCM B;  3U2R A;  2QLZ A;  1YW7 A;  2XKO A;  1BI0 A;  1LEA A;  4KIF A;  2A6H F;  2F2E A;  2RC4 A;  1FWZ A;  4LK1 F;  3CLO A;  1UST A;  4MQV A;  1U5T C;  2W85 A;  4CYD A;  2EB7 A;  2QQB A;  4G94 A;  2LNB A;  1Z6T A;  2GZW A;  1J9I A;  3CO7 C;  2VBW A;  3ML6 A;  1D3Y A;  1XGO A;  4XSZ F;  1XDS A;  3F8N A;  2F5E A;  4B09 A;  4RAZ A;  1G6N A;  3E5Q A;  2ISY A;  1WRJ A;  4L0Y B;  3DQV C;  1RNL A;  4LMY A;  4RB1 A;  2GXB A;  2WTE A;  1S6L A;  2BYV E;  4EM0 B;  4UUV A;  1B59 A;  1IN8 A;  3SZT A;  4GGG A;  5E8G A;  3FMR A;  2M5W A;  5HLG A;  3L9F A;  1SFU A;  1O3T A;  2WV0 A;  5HDG A;  1JE8 A;  3KP7 A;  1TLH B;  1KA8 A;  2DK8 A;  2Z3Y A;  4ESJ A;  1D8J A;  3AAF A;  4EM1 A;  4MEY F;  3KZY A;  3P9I A;  1LJ9 A;  1ZAR A;  1S7O A;  3CDH A;  3P9C A;  2QYO A;  3FM3 A;  4U0V A;  4YFX F;  4OIO F;  3LA3 A;  1DPR A;  2ZME B;  3HRU A;  4HV5 A;  1SAX A;  1ZLJ A;  3F72 A;  2RDP A;  5CVV A;  2HWV A;  4N9H A;  1GVJ A;  3ZP5 A;  2K02 A;  5LHI A;  3V8J A;  3L2C A;  3WTZ A;  4EJW A;  3FXQ A;  1ZYR F;  3I53 A;  1TQP A;  3JTG A;  1STZ A;  2K4B A;  2IA1 A;  5H6Q A;  5FFX A;  3GFM A;  4IRG A;  1QGP A;  2ZNY A;  3J80 K;  3DKW A;  4EM2 A;  2OD5 A;  4UHT A;  3E97 A;  3KFW X;  1SFX A;  3T1B A;  1DP7 P;  4Q4Z F;  3ISP A;  2VN2 A;  5ERI A;  3BWG A;  4PDK A;  1BOA A;  4KIG A;  5HS9 A;  3RIR A;  2LDU A;  3I59 B;  2HOE A;  4ZH4 F;  1T6S A;  1JHH A;  3RTR A;  1QQI A;  2R3S A;  1P92 A;  1GXQ A;  3SQN A;  5DYM A;  2HR3 A;  3CUQ A;  2Q8K A;  1O3R A;  4XRF A;  2DPD A;  4O6J A;  4CDG A;  1JHF A;  1FBU A;  3IRQ A;  3QP6 A;  3ABU A;  2F5D A;  1KU9 A;  5D8K B;  1IF1 A;  2GWR A;  3K9T A;  5JVT A;  3BJO A;  3MWM A;  5FLX K;  3KP4 A;  1FSE A;  1R1U A;  1FNN A;  1V4R A;  5LEJ A;  1BIB A;  3P9K A;  5ICC A;  1V3F A;  1U78 A;  2K27 A;  5LHG A;  3GXO A;  4UNO A;  1J7K A;  4HDU A;  3F6O A;  3I64 A;  3V7C A;  1T98 A;  1XMK A;  1TW2 A;  4HF2 A;  2VBZ A;  1K79 A;  4HDV A;  4G6D A;  1U3E M;  2JPC A;  3R0J A;  1P4X A;  3TQN A;  3GYH X;  1PUE E;  2QM3 A;  4N0B A;  2FNP A;  3WTS C;  4G7H F;  1U5T B;  1MKM A;  4ESB A;  5HDN A;  4LLL A;  1B1B A;  3TO6 A;  1IN6 A;  3QPT A;  1XN7 A;  1YYV A;  3G73 A;  2NS0 A;  4JBA A;  2FEZ A;  3QU3 A;  5K5Q A;  2G9W A;  5DEQ A;  1BI3 A;  3LQR A;  4BH9 A;  3LFK A;  1O3Q A;  1FX7 A;  2ZBK A;  4WF2 A;  1LQ1 A;  2P6T A;  1W7P B;  1R5H A;  5IT9 K;  3C1D A;  4OMY A;  3QP5 A;  3RDI A;  4IF4 A;  2IA2 A;  2ZXJ A;  3DXJ F;  4EGY A;  1L3L A;  3TKY A;  1U2W A;  1KYW A;  1I1G A;  2F5C A;  1ZG3 A;  4Y17 A;  3IKT A;  3GX4 X;  2V1X A;  3S2W A;  3L7W A;  4P9F A;  2ZCW A;  2XAS A;  4G7Z F;  3OV8 A;  2KKO A;  2PN6 A;  2Y0M A;  4OU0 A;  4LB5 A;  1XCV A;  1FOK A;  3O2P E;  4CIC A;  5DUI A;  5BQT A;  3BP8 A;  2HTJ A;  1T38 A;  4RAY A;  1U8R A;  3BJ6 A;  5LGN A;  1S8N A;  2XGX A;  4WX9 A;  1EH7 A;  2DI3 A;  5E20 A;  5L3D A;  2QBY A;  2A07 F;  2JTV A;  3H3Z A;  2ZME A;  3E6C C;  2HZT A;  4GO1 A;  2L4M A;  1IN5 A;  1XGS A;  2MD5 A;  1OYY A;  3I4P A;  1SD6 A;  3EYI A;  4RGU A;  5L3B A;  1CF7 B;  5E8I A;  2YU3 A;  1K6O A;  2QEN A;  4NB5 A;  5LBQ A;  2ADU A;  2V6C A;  3M7G A;  3SXY A;  1YLF A;  1Z05 A;  3N4M A;  2O8X A;  2AS5 F;  1FLI A;  1BI1 A;  2MA3 A;  4EJU A;  1OKR A;  1OPC A;  5CYV A;  2DLL A;  2PBI A;  1P4A A;  2R7D A;  2L3D A;  4HAM A;  3K1M A;  1JXS A;  2ELH A;  4HLX A;  1MJ9 A;  5FO5 A;  1ZGA A;  2NNN A;  2XHK A;  4U0W A;  4G6Q A;  1TTY A;  2YX4 A;  1P6R A;  3R4K A;  2OZ6 A;  2XV4 S;  1DPU A;  3ZMZ A;  1ONV A;  5BPD A;  3DPL C;  3H3U A;  2KIM A;  3B02 A;  3E6M A;  1IN7 A;  4K2E A;  2X4H A;  4RS8 A;  4M73 A;  1TQI A;  1J75 A;  3LST A;  4EV0 A;  3RKW A;  3HSF A;  4A0X A;  2O03 A;  2CFX A;  1IZ1 A;  4KIB A;  5DUK A;  2MLK A;  2P7V B;  4Q5S F;  2DT5 A;  2GAU A;  2A61 A;  4L5I A;  1EH8 A;  4AD9 A;  3P7N A;  3HOS A;  1R36 A;  3KLN A;  3ZN1 A;  2XAQ A;  1MDM B;  1RUO A;  2KJC A;  4L9N A;  4GXO A;  3BPV A;  3GEZ A;  1BBY A;  1UCR A;  3HSE A;  5ILS A;  5L3E A;  4KA4 A;  5KK1 A;  3E3V A;  3U1D A;  2DPU A;  2LF8 A;  2VT2 A;  4G9Y A;  3GLX A;  4AIK A;  3KE2 A;  2RVC A;  2CO5 A;  3FXR A;  4WWC A;  3N97 A;  2KJB A;  2FMY A;  3FHZ A;  4LJZ F;  4YG2 F;  5F1R A;  2EK5 A;  2EFP A;  3F8M A;  5JR3 A;  2VE9 A;  1KQ0 A;  1YW9 A;  3HHG A;  2JSC A;  4ETS A;  1G3T A;  2QQA A;  2EFO A;  2RGV A;  4A6D A;  4ENM A;  3EQL F;  3KEO A;  4WK8 F;  4EGZ A;  4OIP F;  4EQQ A;  4HX7 A;  1GXP A;  3RYP A;  4LD5 A;  3F23 A;  4IHT A;  3F8F A;  3H92 A;  4ENK A;  2BEO A;  3IKV A;  2FBK A;  3MFK A;  2MLG A;  1IRG A;  2UXX A;  1QBJ A;  2STW A;  4IJA A;  5D5V B;  2ZKZ A;  1YTY A;  2HKX A;  1Y0U A;  5DD8 A;  2M87 A;  1YS7 A;  3RYR A;  5CJ9 A;  2E1N A;  1Z1D A;  2DTR A;  3WTV C;  4IRI A;  1FBQ A;  3GWZ A;  1VTN C;  3HOT A;  4QWQ A;  3NQO A;  3ECH A;  1RIO H;  2C6Y A;  1R58 A;  2IRF G;  3O3K A;  2XKP A;  4LG0 B;  1DUX C;  2XAF A;  3IWZ A;  2CQK A;  4S05 A;  3C18 A;  3WTY C;  2DK5 A;  3HRT A;  4ZZL A;  2QVO A;  1R22 A;  4Y13 A;  1FPQ A;  3BOQ A;  2MH9 A;  4FHT A;  4KN4 X;  2LSO A;  4HQE A;  2CSO A;  5HLI A;  4I2O A;  3R0A A;  3TGN A;  3HTU A;  1TBX A;  1CGP A;  3HHH A;  3GF2 A;  1YO5 C;  4EVI A;  4I0B A;  3DFG A;  2EJR A;  4AIH A;  4IVN A;  3K69 A;  3QAH A;  1YQA A;  2CWE A;  5HS8 A;  1MD0 A;  4S04 A;  4A0Y A;  3WU0 A;  4A5N A;  1JGS A;  2FML A;  4IXA A;  2FBH A;  3TOB A;  1HQC A;  1QPM A;  5LEK A;  2P5L C;  4IRH A;  2DQR A;  2XAG A;  4Z2Y A;  3GFL A;  4M71 A;  2Y75 A;  2GXG A;  5JI6 A;  2P7C B;  3JAM K;  2H09 A;  1BI2 A;  3KP5 A;  4ZYH A;  2P5V A;  4YII A;  3E5U A;  5J6X A;  3ABT A;  2AXL A;  3I58 A;  4BYY A;  1KU3 A;  1ZGJ A;  1F9N A;  3F21 A;  1J5Y A;  5LGT A;  3VOE A;  3LA7 A;  2O3F A;  2XVC A;  5LRS A;  2NYX A;  4EJO A;  4R79 A;  2FOK A;  1Z6R A;  2KRF A;  2YSR A;  4HYE A;  1XDU A;  4U0Y A;  3VEP A;  4ZZD A;  2BBY A;  1W5T A;  2G7U A;  3FZV A; 
#chains in the Genus database with same CATH topology
 5C3E J;  3KLO A;  5EZH A;  2EPF A;  3JSP A;  5FLM J;  1N75 A;  4XMY A;  5A2Q K;  1MSE C;  1PUF B;  4BJ6 C;  4BEH B;  1X1P A;  4ZYG A;  5ILV A;  2I8D A;  5CPR B;  1SVO A;  3M9A A;  3ZQC A;  3WU2 C;  3A0H C;  1RI7 A;  3ZQF A;  1UG0 A;  1EKE A;  2L54 A;  2PFB A;  3W2W A;  1I6H J;  4XLE A;  3LSP A;  1KQ8 A;  2H94 A;  3S93 A;  1BW5 A;  4B47 A;  5HNH A;  2VKV A;  2DN0 A;  2NVX J;  4DOZ A;  1A35 A;  2DFH A;  1Q1V A;  3V8L A;  2V1N A;  4TV7 A;  4YFK F;  4ENN A;  2EA2 A;  1XSX A;  5HOO A;  2P6S A;  1WI9 A;  2B7E A;  4N9I A;  4BHC A;  2BOL A;  2IEK A;  1ZG1 A;  2OTL I;  2EV0 A;  3DBR B;  2ZNZ A;  5E1X A;  1WHU A;  2Y9Y A;  3D5L A;  3PNV A;  1EA3 A;  1XB4 A;  2KQR A;  5J3L A;  3ZOB A;  4AVP A;  4KN7 X;  3OS1 A;  2F5F A;  3ZQ7 A;  4HX8 A;  2V6E A;  4JYK A;  4HW0 A;  4OIN F;  3DTK A;  4M3F A;  5TJJ A;  2LC2 A;  1ODD A;  3DKY A;  5D6E A;  3BR3 A;  4FQG A;  1QZZ A;  3HM5 A;  1LUJ B;  3C7J A;  3CJN A;  3RKY A;  2VL8 A;  1K78 B;  3FF5 A;  2X48 A;  2WWY A;  4CZZ A;  2X51 A;  3U21 A;  5DS9 A;  1IAW A;  1XS9 A;  4EJT A;  3WTU C;  3ZMT A;  2VE8 A;  1W7P D;  4DYC A;  1G2H A;  4BHB A;  2Y30 A;  2R7V A;  2JPB A;  5FD6 A;  4PSW A;  3OSG A;  1IXR C;  5JFR A;  3IC7 A;  1BW6 A;  2M30 A;  3R60 A;  1F5T A;  3W2A A;  1FP2 A;  1UFM A;  2TRT A;  4OOI A;  4LIU A;  1T8I A;  1FMW A;  3IRR A;  4XOT A;  4BQA A;  4AIJ A;  3VWB A;  1SVL A;  4B4C A;  4LB6 B;  2IJL A;  4P5O A;  5TRD A;  2P5K A;  2FU4 A;  2E1O A;  4X1E A;  4KIS A;  1B8I B;  1ULY A;  3WE3 A;  1V5F A;  3K6G A;  1P4W A;  2R7Q A;  4MTD A;  4YIF A;  2W00 A;  3GCM A;  4A5M A;  5K1Y A;  1VQM I;  3BPX A;  3T8R A;  1IV6 A;  1VQL I;  3L00 A;  3H3V K;  2HZD A;  3HKZ A;  3WG9 A;  3ZGK A;  3S17 J;  1X19 A;  2HNH A;  1O57 A;  3OYB A;  3HRS A;  1OQY A;  3JTH A;  4IQJ A;  1W36 D;  2VUM J;  3SZP A;  4KFC A;  2OBP A;  3OIO A;  5DCM A;  2VPR A;  2D45 A;  1ZRC A;  1YI2 I;  3CCJ I;  3FMQ A;  1YIO A;  3ZQI A;  1Z77 A;  3HIF A;  1E3O C;  3K4B A;  1FYM A;  4CYC A;  3B73 A;  2G0E A;  4E70 A;  3IWF A;  5F64 A;  4BE2 A;  2M0C A;  3CCQ I;  2K9L A;  4LG0 A;  2CH0 A;  2R7F A;  5EGO A;  3GTP J;  2ICW G;  4XN0 A;  3Q9V A;  5IPA A;  2LF7 A;  3PUB A;  2EIJ H;  2V26 A;  2PLY A;  2LKP A;  5H2F C;  3MZH A;  1L0O C;  2HYF A;  2IGO A;  2YPR A;  1VQ4 I;  2EZI A;  4FAS D;  3ZQL A;  3F6V A;  1GV5 A;  3OIP A;  1WVR A;  4KMF A;  3CUQ C;  3Q9S A;  4ZC3 A;  3J7A O;  4WXD A;  1OCZ H;  2X6X A;  5B1A H;  2HQR A;  2IP2 A;  5BPI A;  5F1J A;  3K2Z A;  3FXJ A;  2VOP A;  1ZRD A;  1U0J A;  3J7Z I;  4IOC F;  1BA5 A;  2H27 A;  2IS1 A;  1ZR2 A;  2IW5 A;  1XMA A;  1ZG5 A;  2XAJ A;  1TT0 A;  1I39 A;  4HG2 A;  5DM7 F;  2ZXW H;  2H1K A;  1SD4 A;  3S16 J;  3CC7 I;  4BY1 J;  1GV2 A;  3HTS B;  4NQW A;  4A0Z A;  1ITY A;  4Q47 A;  3SZG A;  2BHY A;  2D1H A;  2RV8 A;  3S1R J;  3Q0V A;  2JRM A;  2E1C A;  3CCM I;  4O5V A;  4PGH A;  4M6Y A;  1QVT A;  1IUY A;  4B3A A;  3WTW C;  4II3 A;  2V7F A;  3REO A;  4RGR A;  3TOA A;  3QOE A;  2FRH A;  3J81 K;  2WBM A;  4C2M J;  2FNA A;  1JKP C;  2IA0 A;  1SFK A;  3BZC A;  4PGG A;  1IUF A;  3WGI A;  2J5P A;  2W57 A;  1PJR A;  1LNW A;  3DTE A;  2X0L A;  2PJP A;  3L2R A;  2OU2 A;  2ZXI A;  4R1H A;  4KDP A;  2LK2 A;  2LMD A;  3DU6 A;  5F27 A;  3N05 A;  2VJI A;  1T56 A;  3OYN A;  2MBF A;  3LSK A;  3IL2 A;  1I1S A;  3SEZ A;  2ME0 A;  1IXC A;  1P2F A;  3OY9 A;  2HGC A;  2LBF A;  2XRN A;  1ZGW A;  2B9S A;  3CO6 C;  1BM9 A;  3KP3 A;  2Y0S N;  4LK0 F;  2ECC A;  3E6B A;  1MNM C;  3JR9 A;  1R1T A;  2QKM B;  5F0H A;  1PP8 F;  1XG1 A;  1REP C;  5IT3 A;  2NS7 A;  2KDZ A;  3AG3 H;  4B3X A;  3CD6 I;  2VQH A;  2E2H J;  1U8B A;  3PQJ A;  4P1W A;  2K86 A;  3MZY A;  2GOX B;  1YS6 A;  2KRC A;  5FB2 A;  1H89 C;  4C9Y A;  2L7M P;  1SFO J;  1SFE A;  1WJ5 A;  2PI0 A;  1Q1H A;  4ON0 A;  2RN7 A;  5E1W A;  5TIS C;  5B5E C;  2ZFW A;  2L9N A;  3J80 Z;  3MAJ A;  1QHH D;  3FXK A;  2XIG A;  3CC2 I;  5EG0 A;  1R5G A;  1X1A A;  2A69 F;  1FJL A;  4O3M A;  4BXX J;  2RKH A;  5H6R A;  3JRC A;  5LRR A;  1WJE A;  2GIV A;  4YFN F;  1I6X A;  2W25 A;  4IPA A;  2Q2E A;  1ON1 A;  3VSK A;  2L7K A;  2FXA A;  3F8B A;  1PUF A;  1NHA A;  2ESH A;  4ZDL A;  4BE0 A;  1YW8 A;  4R8H A;  1IXS B;  1TW3 A;  4I2O A;  2Q0O A;  2H8R A;  1AKH B;  3W3C A;  1KZH A;  2PX9 A;  4F55 A;  2KIQ A;  4I0A A;  1YOV B;  1RES A;  3H1C A;  4NC7 A;  1G59 A;  2BHZ A;  2OQR A;  3I59 A;  1YG2 A;  3LL7 A;  4AYB A;  4EMS A;  5IY5 H;  2ISZ A;  2R7W A;  2E5Z A;  1G3W A;  5FGM A;  1QPI A;  4HA8 A;  4F3Q A;  3QPL A;  5AIQ A;  2CQX A;  4BU2 A;  1S7E A;  1KU7 A;  1MH3 A;  3MMY B;  4G12 A;  3K1N A;  1YX5 A;  3S1M J;  3LAP A;  2AQF A;  1V55 H;  1B72 B;  2X1C A;  3J7Y J;  1SD7 A;  5DDG A;  5M5X J;  1HCR A;  4ITV A;  5BS6 A;  2A6T A;  2NVY J;  5IYB J;  2ETH A;  1HXD A;  1FTZ A;  2R7R A;  1D0X A;  2DQL A;  4MTE A;  3G3Z A;  3PQK A;  1UHM A;  2VQG A;  2QF7 A;  2X6W A;  3ZCO A;  5J4V A;  1HW1 A;  5FLX Z;  2GXA A;  2HS5 A;  3LQQ A;  1G3S A;  1Z3Y A;  2HQN A;  2IS4 A;  5HDK A;  2HDC A;  1R4M B;  2JJ7 A;  2MH2 A;  3BG9 A;  2YX7 A;  4LIV A;  5E18 F;  3I3L A;  1BJZ A;  2M4G A;  5D8L B;  4BNC A;  3TW6 A;  3BG5 A;  5D4S A;  5E17 F;  3AFH A;  1MJA A;  1FY7 A;  3OYE A;  1ZAO A;  3GTJ J;  1HKT A;  4NHJ A;  2M45 A;  3C3W A;  3IH2 A;  5BMZ A;  3QOP A;  4B48 A;  2H8W A;  3A2K A;  1X4P A;  2NNY A;  4HOB A;  4XRM A;  2K40 A;  4PJJ A;  2WC2 A;  1POG A;  4V2G A;  3DPT A;  2DA5 A;  2DFF A;  5CVI A;  4IEJ A;  5EF6 A;  4HNU A;  3JRD A;  2EZL A;  1SD5 A;  1B8I A;  2ELJ A;  1LVK A;  2XAH A;  5GP9 A;  2FE3 A;  4BS9 A;  2ME6 A;  3OYD A;  2UV1 A;  4LFU A;  3WGH A;  2DOA A;  2LVS A;  3WOD F;  4XLH A;  1FYL A;  1LDK B;  1LFP A;  1QO0 D;  2R7X A;  1U5T A;  3D5R C;  4D1Q A;  1R7J A;  1S29 A;  2A05 A;  2WB1 A;  4RLF A;  1QRY A;  1XGN A;  3BTI A;  3CCR I;  1FYK A;  4BE1 A;  1VZ0 A;  2RAE A;  3PFY A;  4D0P A;  5L3F A;  1BR1 A;  3EYY A;  2Z5U A;  3VYU B;  5KHD A;  5L3G A;  1B4A A;  2V4J C;  1XGM A;  2ID3 A;  1F4K A;  1X3W B;  3MKZ A;  1LFB A;  5FKO A;  2KHM A;  5ICE A;  1ON2 A;  2YU9 J;  1S3J A;  1WJD A;  5JHF A;  3I0T A;  5DCF A;  3CME I;  3AKZ A;  4DQ2 A;  4JX5 A;  3FKI J;  2HPM A;  4XL9 A;  1DGR M;  2PMZ N;  4MFE A;  3CDI A;  2V1D A;  5EEH A;  2FUG 2;  2IPQ X;  3DWL E;  5FKN A;  2XAU A;  3HRM A;  1HKS A;  3RPU D;  2XF6 A;  5IT9 Z;  2XB5 A;  5D6F A;  2HVS A;  1W7P A;  1BC7 C;  4LLN A;  2HI3 A;  1B9N A;  1H9G A;  3DBH B;  2IS2 A;  3DTI A;  2HYG D;  5FKK A;  1XSV A;  4NDL A;  6PAX A;  4XM3 A;  2MG4 A;  4I09 A;  3LSM A;  5H20 A;  2RQP A;  1WJB A;  2VKE A;  3ZQG A;  1N78 A;  1G8X A;  3LMM A;  1FIP A;  2NOJ B;  3GW2 A;  2HYJ A;  4NUB A;  4CZC A;  5HLH A;  4BHP A;  3FWE A;  4BAC A;  1FOY A;  3EUH A;  1O3S A;  2EIM H;  2IVM A;  3COA C;  3Q5F A;  3CF2 A;  3RKX A;  2A5W A;  2WAE A;  4UXN A;  2GIZ A;  5KVR A;  3KET A;  1TNS A;  1MBG A;  4I98 B;  3S14 J;  1MH4 A;  2QQ9 A;  3SFZ A;  1T0F A;  2QGU A;  4HBL A;  5F6F A;  4DBQ A;  2MSY A;  2OCE A;  2TCT A;  2WY8 Q;  2WV1 A;  3PFI A;  4A3K J;  1UHS A;  4KIC A;  2JA6 J;  3VYT B;  4G7O F;  2VKH A;  5BNG A;  2K7L A;  2FA5 A;  3HG9 A;  2BXZ A;  1SAN A;  2VBX A;  1Y0N A;  2W84 A;  2R7T A;  3A02 A;  2CU7 A;  4RB3 C;  3MD2 A;  3V4G A;  1M1E B;  2NVQ J;  2FBI A;  1E3P A;  2HKO A;  1UEL B;  2HPI A;  2DOE A;  1IRF A;  3QPH A;  1J0R A;  4I7H A;  1DP3 A;  5K7H A;  3CTA A;  3HEF A;  2E36 A;  4M9X A;  2V79 A;  1BJA A;  4N4O B;  2CQ7 A;  1OR7 A;  2EV5 A;  2HDW A;  2BGC A;  1IW7 F;  5AON A;  2ELK A;  1I5Z A;  3L2V A;  3KX2 A;  4AID A;  1WJC A;  3F22 A;  3LSG A;  1IG7 A;  3AL0 B;  3GVA A;  4H0E A;  2L4A A;  4G8X A;  2XUB A;  5HS7 A;  3T0Y A;  4QLC U;  4Y15 A;  3FXU A;  3EPZ A;  3DLA A;  3WHB A;  3R61 A;  3RI4 A;  4FT8 A;  3ZMU A;  1I27 A;  1N25 A;  2FJ1 A;  1JKO C;  2PQ8 A;  4Y7N J;  4RA2 A;  4XRS G;  3I5U A;  2R5Z B;  1YFH A;  2Y69 H;  4KYW A;  3FX3 A;  2DA3 A;  2HXI A;  3Q3S A;  2E5N A;  3PIP F;  3H0D A;  2XSJ C;  2G7H A;  2EFW A;  1QHG A;  3NEU A;  5IP9 J;  4A2U A;  5C4J J;  1CF7 A;  1T08 B;  3MCZ A;  4HZF A;  2EBI A;  4XOR A;  2PMU A;  4XNF A;  1W1W E;  2ZFU A;  4D9J A;  3M1C A;  3O8H A;  3G6E I;  1K61 A;  3QOD A;  3RPQ A;  4PFO A;  3EDP A;  4UB8 C;  1D5Y A;  4FE4 A;  1C0W A;  4UVB A;  1Z91 A;  2A6E F;  3BLY A;  1FC3 A;  2CS3 A;  2MFZ A;  3CUO A;  1Z0X A;  1SMY F;  3JRE A;  2IGM A;  1MBK A;  4XLC A;  1MGT A;  2EFQ A;  1MZB A;  4WXH A;  2DBB A;  3K4K A;  2VBY A;  4BQO A;  1GUU A;  2HVQ A;  2MC3 A;  2XC7 A;  1FT9 A;  1UZC A;  5ILU A;  5EEG A;  1Z3X A;  3KPH A;  2JN6 A;  1FP1 D;  1BN5 A;  3TMO A;  3JW4 A;  3OYF A;  2GA2 A;  3H5A A;  3SFI A;  3CP2 A;  2P0W A;  3DU5 A;  5CQE A;  1F1Z A;  1JT0 A;  4OAY A;  2VOD A;  4FE7 A;  2Z33 A;  1HKQ A;  4ZYD A;  1AOY A;  2R4G A;  2CV2 A;  2TDX A;  3K4C A;  5LD2 C;  1UJ8 A;  1ETX A;  1ZLK A;  4DIQ A;  4IO9 F;  3H5N A;  5DD4 A;  1SMT A;  3RQI A;  2O61 A;  3F8C A;  1IN4 A;  3TO7 A;  5JHU A;  2UZK A;  3VYR B;  3MKW B;  4QTR A;  2DW4 A;  3OR2 C;  2DJN A;  2EFN A;  4CCL A;  4CO8 A;  3BJA A;  1G4D A;  4CCO A;  4D7N A;  2H6B A;  3OIQ A;  1S7A A;  3NAR A;  2QBY B;  5E1Z B;  2VC1 A;  3JRA A;  4IQ4 A;  2KZV A;  2EV6 A;  1KYZ A;  4L5J A;  3ECO A;  4B44 A;  3BR6 A;  3KEQ A;  4B8X A;  5LFA A;  3LNQ A;  3K70 C;  2NAZ A;  5LLQ A;  1OLT A;  2O0Y A;  4KUM A;  1LDD A;  3LWF A;  1XC5 A;  3PNY A;  5CVU A;  2QUF A;  3HSR A;  5K5O A;  1K7A A;  2CGP A;  2NRA C;  4OIQ F;  1FZP B;  1WWX A;  3QQA A;  3V7S A;  5D5X B;  5J8F A;  1JKQ C;  2F4M B;  1ETW A;  3BG6 A;  3HGY A;  4A3B J;  2BZT A;  2L01 A;  3CMY A;  5B3S H;  1XX5 A;  4OAZ A;  3FIW A;  1A04 A;  3HUG A;  3PJR A;  4HPQ A;  1MNE A;  2PJR A;  4C3I J;  2Z9O A;  1MMD A;  4E7I A;  4DYR A;  2QQ8 A;  4A3E J;  1D0Y A;  4F7Z A;  3WTT C;  1XD7 A;  4QPQ A;  2VAS A;  3BY6 A;  3BTL A;  3K2A A;  1MDM A;  2L9V A;  1UB9 A;  4M3D A;  4ZDP A;  4XK4 A;  2NVT J;  2E7X A;  4GYI A;  4BJT A;  1VQO I;  1XPX A;  3FMS A;  2LFB A;  1HST A;  1JJ6 C;  3ERE D;  3MEX A;  2UWM A;  1ENH A;  2ESN A;  4P55 A;  4UV9 A;  2VLA A;  2JRT A;  1LEB A;  4J00 A;  4A3F J;  4LGW A;  4AWX B;  1R1V A;  4I02 A;  2LP0 A;  2FQ3 A;  2Y48 A;  2XDV A;  2R7S A;  4CHU A;  3RZO J;  4C3J J;  3F3X A;  3KCC A;  1E0E A;  2KIU A;  2M4K A;  2KRH A;  4XBF A;  1XMX A;  4D5C A;  4IHX A;  1AU7 A;  1KQ9 A;  4ENJ A;  4PCQ A;  3ZMV A;  2KLO A;  1B9M A;  1QNT A;  4XKB A;  1KU2 A;  3W6J B;  3ZMS A;  4UUS B;  4DYQ A;  5C44 J;  4HLY A;  2KIF A;  2KMU A;  3O6B B;  4Y3O A;  4KNY A;  1BIA A;  2DO7 A;  4F92 B;  1UHW A;  3H35 A;  1APL C;  1XSD A;  3DV8 A;  2M7B A;  3ELK A;  4L9J A;  4G6T B;  4U7B A;  1RPW A;  1ZKG A;  3OOP A;  1NK2 P;  3GO5 A;  1OYW A;  1VQP I;  4ZYE A;  1BOB A;  2FF4 A;  2V9V A;  3ROU A;  2ZSH B;  3GTK J;  1MJB A;  3C2B A;  5J1Y A;  1WJA A;  1B6A A;  2ACJ A;  1IDZ A;  2JZY A;  2D2W A;  2V1U A;  2OUM A;  3D5S C;  2E60 A;  1AWC A;  3GTQ J;  2BW3 B;  3HYI A;  4B1R A;  2EA4 A;  4M9Z A;  4XOP A;  2KFD A;  4WXC A;  2RNJ A;  2Z99 A;  2K9N A;  4Q48 A;  4U7D A;  2KPM A;  4BXF A;  2F5V A;  2CV1 A;  1LE8 A;  4CSW A;  4I76 A;  2OA4 A;  1BR4 A;  3TED A;  3M8F A;  2VQC A;  3V42 A;  3QWL A;  5L3C A;  1T39 A;  1VQ7 I;  1R5I D;  1GVD A;  4AUX A;  1O7F A;  3PUF A;  5E3L A;  4RGX A;  1R00 A;  1W5S A;  1OCT C;  3ZN0 A;  1IDY A;  1PDN C;  1QZY A;  5K5R A;  1S5L C;  4AC0 A;  5CVJ A;  1JI8 A;  3V7R A;  3D1N I;  1TWH J;  1VQN I;  1Z7L A;  3M4O J;  2ECB A;  4P9U A;  4ZTF A;  4RM2 A;  5M3M J;  3U1K A;  4FX0 A;  3RQ4 A;  1F36 A;  2A3S A;  3ZPL A;  4BAY A;  2P4W A;  1IGN A;  3VFZ A;  1FTT A;  2E2J J;  3T8T A;  4BDZ A;  4OWR B;  2ZSI B;  3U9G A;  4PZJ A;  3I71 A;  4UVC A;  4LOC A;  1HBX G;  2CMP A;  4JQF A;  3I56 I;  2QWW A;  1WKM A;  4FCY A;  1LDJ A;  3NWT A;  3ULQ B;  2L9R A;  2A68 F;  2HTS A;  3HC7 A;  2WAD A;  3EUK L;  3VDX A;  1MBH A;  4DJA A;  1HLV A;  3RSN A;  1RUN A;  4FIS A;  1TWC J;  1OIS A;  2PMH A;  2STT A;  3RPU A;  1IRZ A;  3WU1 B;  3ZR8 X;  4ANJ A;  2HEO A;  1VQ8 I;  4M74 A;  4MLO A;  4E7J A;  2K4J A;  3QRF F;  5B1B H;  3E6D A;  3NRV A;  2JWT A;  4Z6Y A;  3SJM A;  1P9Q C;  1ZN2 A;  2P81 A;  2M2E A;  2ZXH A;  4MGR A;  1ORK A;  1D8K A;  4XLA A;  2VJJ A;  2VT3 A;  5K7Z A;  1T2K A;  2XRO A;  4JK1 X;  1U9N A;  5D5W B;  3MN2 A;  3OOU A;  3V8K A;  4QIW N;  2K3F A;  2GA1 A;  2M8E A;  3W6K B;  4W1U A;  4HEA 2;  4FX4 A;  1HW5 A;  4GYG A;  1Z7U A;  4RLQ A;  3JAM Z;  1EJ9 A;  4U88 A;  1VND A;  3A0B C;  4ASN A;  1RR8 C;  2FSW A;  1JJ8 C;  1HW2 A;  3L09 A;  3HJE A;  3IH4 A;  3RKQ A;  2HOS A;  1NG7 A;  4UUT A;  3R6S A;  3TDU C;  1EV7 A;  3OYG A;  1BL0 A;  3AG2 H;  3VSL A;  3T5X A;  3GZ6 A;  5E3N A;  1CQT A;  4RGS A;  1HSJ A;  4PJM A;  1Y8Q B;  5IYD J;  4N4N B;  4RB0 A;  1OCO H;  4M6V A;  1GT0 C;  2BE5 F;  1WSU A;  1E17 A;  2WAQ N;  3L1P A;  3S32 A;  1H9T A;  1OCR H;  2XF7 A;  3ERM A;  4M3E A;  4M72 A;  5GAH J;  4A3L J;  1RZ4 A;  2OPT A;  1JTX A;  3M3Y J;  2DFI A;  3M8E A;  3FK7 A;  1FBS A;  3GZ5 A;  4KMU X;  4LLG F;  4X0G A;  1VFC A;  4CGZ A;  3WGG A;  5LHH A;  4HF0 A;  5HVQ C;  2JSP A;  1P7I A;  4Y52 J;  5GPA A;  2VXZ A;  4RDU A;  2WAF A;  2CJJ A;  2H6C A;  3DCF A;  1WFX A;  1H0M A;  2COM A;  3BR1 A;  3E1S A;  4L9V A;  1TQM A;  1WQ2 A;  4GCV A;  1OJL A;  2GQQ A;  3E5X A;  4CXF A;  2L0K A;  3JSO A;  5A2Q Z;  2UXN A;  1G3Y A;  1LVA A;  2M1B A;  3G1M A;  4JP0 A;  5FKM A;  4FTH A;  2W7N A;  5J8C A;  3QU6 A;  2MW8 A;  3CMM A;  1WH7 A;  1W4M A;  2EWN A;  1S9H A;  1HF0 A;  4ESF A;  4BEH A;  3S3N A;  2XRL A;  4A3G J;  2VPL A;  2L02 A;  2OTJ I;  2KT0 A;  3UNG C;  2IS6 A;  2YS9 A;  4A6E A;  3G4S I;  4P96 A;  3WHC A;  2QZ8 A;  1FSH A;  1VQ9 I;  3WTX C;  2VOO A;  2JQ7 A;  4IHS A;  4I99 C;  1GDT A;  1D5V A;  3GFI A;  3NWS A;  1KGS A;  1OYI A;  2BVL A;  2VC0 A;  3FM5 A;  4YRV A;  1NG6 A;  4A12 A;  5FFZ A;  1MBF A;  2M0M A;  1TT5 B;  4HQM A;  2O8K A;  1VQ5 I;  2A5Y B;  5D5U B;  4XLN F;  3K4J A;  3SDG A;  3BRO A;  4BXU A;  2YR2 A;  1GLN A;  1TNT A;  1ZRF A;  2HU9 A;  2K3P A;  3OYL A;  1U6G A;  2DMQ A;  5F08 A;  3PO2 J;  5K7F A;  1USS A;  2E7W A;  3DEE A;  2GM4 A;  5BOX A;  1TP4 A;  5M5Y J;  1X3U A;  3LA2 A;  2K5C A;  2JT1 A;  2PG4 A;  1J2X A;  1Y1V J;  4II2 A;  3OSF A;  4GFB A;  4MHG A;  4IHW A;  2D1V A;  2LTP A;  4XON A;  1X4O A;  2NOG A;  4OMZ A;  3KYD B;  4M3B A;  3GUD A;  3MZ8 A;  3HDD A;  3BDD A;  5EJC A;  1LPQ A;  2OQG A;  2LY1 A;  4BKX A;  2ZB9 A;  2LKX A;  1R9T J;  2Z2S B;  1ZH5 A;  3WE2 A;  4UV8 A;  3RJP A;  3C2H A;  1K78 A;  4UVA A;  3K0L A;  2DU9 A;  4C30 A;  4M9S A;  4HX4 A;  2ZME C;  3CLQ A;  5AIP A;  1BC8 C;  1FIA A;  3ZMD A;  5IOY A;  1ZRE A;  3FBI B;  2O6G E;  2OAZ A;  1Z9C A;  2CW0 F;  2DA6 A;  1SVM A;  3VB2 A;  4L0Z B;  4XSX F;  3X2Q H;  3GLL A;  4KT5 C;  3HOU J;  3DP7 A;  2M8G X;  5GAE J;  2JA5 J;  3ZQH A;  2Z16 A;  2QEX I;  5JVG F;  1ZHF A;  2E2I J;  2W24 A;  4EJV A;  5ICF A;  2BY2 A;  2L9S A;  1ETY A;  1X3Z B;  3CZ6 A;  1MBJ A;  2JVH A;  1Z67 A;  5CLS A;  3RCO A;  4H4K C;  2LD5 A;  2BY1 A;  2HFH A;  2R5Y B;  3MQ0 A;  1FOW A;  3PIO F;  4XLF A;  3IH3 A;  3TDZ C;  3LAJ A;  5DV5 A;  2K85 A;  4HSR A;  1E2X A;  4NC6 A;  3TO9 A;  1LB2 A;  3ASO H;  3EET A;  3BZ6 A;  1O7L A;  3DEU A;  3KP6 A;  1VQK I;  2DMT A;  1PP7 U;  5J1R A;  2Z1D A;  5ICG A;  3SHF A;  1Y6I A;  3S1Q J;  2IT0 A;  2ZJ2 A;  4HF1 A;  5KCM A;  5EEA A;  3OYC A;  2B0L A;  4DNC A;  1W0T A;  3GFJ A;  3K7A J;  2PEX A;  2ZO4 A;  2DTZ A;  2JUC A;  2DAO A;  3BTC A;  4M6X A;  4BL0 B;  1A6I A;  2J5O A;  4MQ9 F;  3CUQ B;  3H0G J;  3E0J B;  3SEQ A;  3H9Q A;  4MO7 A;  2COB A;  2CUZ A;  2OCC H;  3CF5 F;  3I54 A;  2I5U A;  3DF8 A;  1IJW C;  4M3G A;  4PSX A;  3ASN H;  5J1U A;  4RB2 C;  2BY0 A;  5ED4 A;  4MEX F;  2CYY A;  1QA6 A;  3H9J A;  3KZZ A;  2E34 A;  1JUS A;  3D0S A;  5DM6 F;  3ABL H;  1V54 H;  5FD5 A;  4ZDO A;  3OYK A;  3HKZ N;  3VOD A;  5CVR A;  2EH3 A;  4FET A;  1R23 A;  2AQE A;  1QVU A;  4MNU A;  4L5E A;  5D4R A;  4HV6 A;  1O4X A;  1J59 A;  2JA7 J;  2DXI A;  4L9T A;  1HOM A;  4WCG A;  2DT7 B;  4NC8 A;  1X58 A;  1QU3 A;  1DDN A;  3IHU A;  4XLP F;  2VON A;  2DMN A;  2BV6 A;  3DKX A;  2P8T A;  3CCS I;  1HA8 A;  1TZL A;  4JX4 A;  3SDB A;  3M1E A;  3K1P A;  2CG4 A;  3J81 Z;  1RKW A;  5LGU A;  3OYA A;  4OIR F;  4L18 B;  1EH6 A;  4BY7 J;  3CCY A;  3CDL A;  1PVE A;  3KP2 A;  1Y8R B;  2OZU A;  3ZXS A;  1OMI A;  1GHC A;  1JT6 A;  1XCB A;  3DEW A;  2LRE A;  2QA4 I;  4KT6 A;  3CCV I;  3BQY A;  4XN3 A;  3CES A;  4I01 A;  4AM3 A;  5DCM B;  1JTY A;  3U2R A;  2QLZ A;  1YW7 A;  2XKO A;  2O9L A;  1BI0 A;  1LEA A;  1RRJ A;  5FRO A;  2DJI A;  4KIF A;  1RKT A;  2FD5 A;  4A93 J;  4X6A J;  2A6H F;  2F2E A;  2RC4 A;  1FWZ A;  1U9O A;  4LK1 F;  3CLO A;  4E7L A;  1UST A;  4BDY A;  4MQV A;  1U5T C;  3S8P A;  1A36 A;  3JRI A;  5EGO B;  2W85 A;  3BQZ A;  4CYD A;  2EB7 A;  3GTO J;  2QQB A;  1VF9 A;  4G94 A;  2QSG X;  2LNB A;  2MYS A;  4QPO A;  1Z6T A;  3OYJ A;  3QYB A;  2GZW A;  1J9I A;  3CO7 C;  2VBW A;  4EEF G;  5EDN A;  3ML6 A;  1D3Y A;  1A5J A;  1AHD P;  1XGO A;  4XSZ F;  1XDS A;  3F8N A;  3OMY A;  2F5E A;  2NVU B;  4RAZ A;  4B09 A;  1G6N A;  3E5Q A;  2X85 A;  2ISY A;  4IHV A;  1FMV A;  1WRJ A;  4L0Y B;  4KJZ A;  2CUE A;  3DQV C;  1UAA A;  3Q0W A;  1I50 J;  1RNL A;  4LMY A;  1YRN B;  2Y0S A;  2KL4 A;  3LSI A;  1S72 I;  4RB1 A;  5B66 C;  2GXB A;  2M9H A;  2WTE A;  1S6L A;  2XSD C;  2HQ5 A;  3TL4 X;  3H9G A;  2X6Y A;  3MKL A;  4F52 A;  2IXS A;  2M3A A;  2BYV E;  3NAU A;  2DCE A;  4EM0 B;  3M07 A;  4UB6 C;  4UUV A;  1B59 A;  2JA2 A;  1K4S A;  1DU0 A;  1HDD C;  1IN8 A;  1AKH A;  2CFO A;  4D5F A;  3SZT A;  4GGG A;  1IV8 A;  5E8G A;  3FMR A;  2QCO A;  3EUH C;  3GTG J;  2M5W A;  5HLG A;  3L9F A;  1SFU A;  1O3T A;  2WV0 A;  5HDG A;  4CUG A;  1JE8 A;  2F4O B;  2IBD A;  1T0F C;  3KP7 A;  2EQR A;  1TLH B;  1KA8 A;  2DK8 A;  2Z3Y A;  4ESJ A;  1D8J A;  3AAF A;  4EM1 A;  4MEY F;  3KZY A;  3P9I A;  1LJ9 A;  1ZAR A;  1HC8 A;  4XIC A;  1J09 A;  3BG3 A;  1WI3 A;  3GTM J;  1B72 A;  1S7O A;  1W36 C;  3CDH A;  3P9C A;  2QYO A;  3FM3 A;  2L2O A;  1I3Q J;  4U0V A;  4YFX F;  4BGD A;  4OIO F;  9ANT A;  3B6A A;  3HOV J;  2FOW A;  1DPR A;  2ZME B;  3HRU A;  3LA3 A;  4HV5 A;  1SAX A;  4AU7 A;  2UUZ A;  1MND A;  1ZLJ A;  3F72 A;  4YEL A;  2RDP A;  5CVV A;  2HWV A;  2VIX A;  1UG2 A;  4N9H A;  3HPG A;  1GVJ A;  1OR7 C;  3ZP5 A;  2K02 A;  5LHI A;  4IKF A;  3V8J A;  1VQ6 I;  1TWG J;  3SYT A;  3L2C A;  3WTZ A;  2NS8 A;  3LSJ A;  3G2B A;  4EJW A;  2QSF X;  1OCC H;  3W6V A;  3FXQ A;  3A4C A;  1ZYR F;  1JKR C;  3I53 A;  1TQP A;  3C2G A;  4AYB N;  3BR0 A;  2JMW A;  3JTG A;  1STZ A;  2K4B A;  2HQA A;  2IA1 A;  3KYL A;  3CCL I;  3ABM H;  2LR8 A;  5H6Q A;  5FFX A;  3JRF A;  3GFM A;  4IRG A;  5JLW A;  2IGN A;  1QGP A;  1KON A;  2ZNY A;  3LSR A;  2VJ5 A;  5M5W J;  3J80 K;  1D1C A;  4NBQ A;  1WJF A;  3DKW A;  3OL3 A;  4EM2 A;  2OD5 A;  3PSI A;  4UHT A;  2EZH A;  3E97 A;  3KFW X;  1SFX A;  2WY7 Q;  2XPV A;  3T1B A;  2Q2E B;  1DP7 P;  4Q4Z F;  2F6C A;  3ISP A;  2VN2 A;  3S2D J;  5ERI A;  1MBE A;  1NTC A;  3BWG A;  3I4M J;  2R5Y A;  4PDK A;  1BOA A;  4KIG A;  2Y31 A;  5HS9 A;  3DBL B;  5KAF C;  3RIR A;  3O8G A;  1EF4 A;  4BQN A;  3FXL A;  3CJQ B;  1Y1W J;  2MGQ A;  2F48 A;  4W97 A;  2LDU A;  2RQQ A;  3I59 B;  2XGE A;  1P7J A;  2LLK A;  2HOE A;  4ZH4 F;  1RC9 A;  1T6S A;  1OCP A;  1JHH A;  3RTR A;  1QQI A;  2R3S A;  1P92 A;  1GXQ A;  3LSH A;  3SQN A;  5DYM A;  2CUF A;  2HR3 A;  3CUQ A;  3BZK A;  2RNG A;  3H5R A;  2Y9Z A;  2Q8K A;  4ZJZ A;  1O3R A;  2IGK A;  4XRF A;  2DPD A;  4O6J A;  4CDG A;  4GRI A;  1JHF A;  1FBU A;  3A03 A;  3IRQ A;  5HNF A;  2KIS A;  3QP6 A;  3ABU A;  2F5D A;  1N77 A;  2X1E A;  2W4S A;  1KU9 A;  3PSF A;  5D8K B;  2ZJQ F;  1IF1 A;  2GWR A;  1FOX A;  3K9T A;  4CCN A;  3L2Q A;  2V9P A;  4IL6 C;  5JVT A;  3BJO A;  3MWM A;  4DZJ A;  1YIT I;  5FLX K;  3KP4 A;  1WH5 A;  1FSE A;  1R1U A;  1FNN A;  3S15 J;  1V4R A;  5LEJ A;  1BIB A;  1MSF C;  3P9K A;  5ICC A;  1X1D A;  2WB1 N;  1V3F A;  5F0F A;  1U78 A;  2K27 A;  5LHG A;  3GXO A;  2H1L A;  1D0Z A;  4UNO A;  1J7K A;  4HDU A;  3F6O A;  1DQU A;  3I64 A;  3V7C A;  1JUM A;  1T98 A;  5F0C A;  4A3D J;  1XMK A;  2LRD A;  4A69 C;  1TW2 A;  4HF2 A;  2VBZ A;  2DA7 A;  4DBR A;  3LOC A;  3S1N J;  2FX0 A;  4Y4R A;  1A31 A;  2PMZ A;  2F4I A;  2CUJ A;  4QSH A;  1OFC X;  1K79 A;  4HDV A;  4G6D A;  3TP3 A;  3UKG A;  1U3E M;  1K4T A;  2JPC A;  3R0J A;  1P4X A;  4JX6 A;  3TQN A;  4KIT B;  4RAG A;  3GYH X;  2O5R A;  1ERD A;  4GDF A;  2K9Q A;  5J40 A;  1PUE E;  2QM3 A;  4N0B A;  2FNP A;  3WTS C;  4G7H F;  1YJ9 I;  1E3H A;  1U5T B;  1MKM A;  1UMQ A;  1X1B A;  4ESB A;  5HDN A;  4LLL A;  1D1B A;  1B1B A;  1T95 A;  3TO6 A;  2ZJP F;  2VB6 A;  1IN6 A;  2E35 A;  2QKL B;  1K6Y A;  1A6Q A;  5M3F J;  5IP7 J;  2KZG A;  2HVR A;  2GLO A;  3QPT A;  1XN7 A;  1YYV A;  3FHN A;  3K70 D;  3W2V A;  4ZTJ A;  3G73 A;  2NS0 A;  4JBA A;  2FEZ A;  4ZYA A;  2D5V A;  3QU3 A;  4YEJ A;  3BCB A;  4V19 K;  5K5Q A;  2G9W A;  5DEQ A;  1BI3 A;  2CW8 A;  3LQR A;  1MMS A;  2OF7 A;  4BH9 A;  4DW6 A;  3LFK A;  1O3Q A;  2R5Z A;  4NNJ A;  2DDB A;  2LH9 A;  5J4Y A;  1FX7 A;  3IAM 2;  4E6K G;  2ZBK A;  4WF2 A;  1LQ1 A;  2CQQ A;  1W5C C;  2P6T A;  5FJ8 J;  1W7P B;  1R5H A;  1RET A;  5IT9 K;  3BCA A;  1JGG A;  3CCE I;  2AHQ A;  3HXL A;  3RZD J;  3C1D A;  4OMY A;  3QP5 A;  3RDI A;  4IF4 A;  2IA2 A;  2ZXJ A;  3DXJ F;  4UY8 I;  3MKY B;  4JOM A;  4EGY A;  2XGC A;  3HPH A;  1L3L A;  3TKY A;  2X9D A;  1YRN A;  4IZZ A;  1U2W A;  1KYW A;  1ACI A;  3HB9 A;  1I1G A;  2F5C A;  3UR3 C;  3GZN B;  2AO9 A;  1ZG3 A;  2OJE D;  4Y17 A;  3IKT A;  3KIO A;  3GX4 X;  2V1X A;  2DMU A;  3S2W A;  3L7W A;  4P9F A;  3WG7 H;  4A3M J;  2ZCW A;  2K9M A;  2LOO A;  2XAS A;  4G7Z F;  3OV8 A;  1TWA J;  2KKO A;  2PN6 A;  3AG4 H;  2Y0M A;  2LY9 A;  3BTJ A;  4OU0 A;  4LB5 A;  2AXT C;  1XCV A;  5F04 A;  1FOK A;  3O2P E;  4CCM A;  4CIC A;  1X1C A;  5DUI A;  3BG7 A;  5BQT A;  1BR2 A;  3BP8 A;  2HTJ A;  1IC8 A;  1T38 A;  4RAY A;  5GAD J;  1WGX A;  1U8R A;  1ETK A;  3BJ6 A;  4V2F A;  5LGN A;  1S8N A;  2XGX A;  2DA2 A;  4WX9 A;  2IAI A;  1EH7 A;  1R71 A;  2VXD A;  3L2U A;  5HOD A;  2DI3 A;  2VKD A;  5E20 A;  1SC7 A;  3HOY J;  5L3D A;  3L2W A;  3IAS 2;  2MAB A;  4A3I J;  2DT6 A;  2A07 F;  2QBY A;  2JTV A;  3H3Z A;  1K83 J;  2ZME A;  3E6C C;  2HZT A;  4GO1 A;  2L4M A;  3F9K A;  2ZJR F;  4PJL A;  1IN5 A;  1ZTR A;  4YIR X;  1XGS A;  3DPU A;  2MD5 A;  5E3O A;  2OC6 A;  3CQZ J;  1D1A A;  1OYY A;  3I4P A;  1SD6 A;  3LFU A;  1LFU P;  5JLX A;  3EYI A;  3FK6 A;  3GME A;  4RGU A;  3AL0 C;  3G1L A;  2RRE A;  3AG1 H;  5L3B A;  1CF7 B;  5E8I A;  2YU3 A;  2R93 J;  4CCJ A;  1K6O A;  2QEN A;  4NB5 A;  2L5Q A;  5LBQ A;  2ADU A;  2V6C A;  1H88 C;  3M7G A;  2DMP A;  1ETQ A;  4CA0 A;  3CP8 A;  4RAF A;  3SXY A;  3VPR A;  4AVZ A;  1YLF A;  3HOX J;  3PL8 A;  1Z05 A;  3N4M A;  1WPK A;  3HL2 A;  2O8X A;  3K4N A;  2AS5 F;  5TGT A;  3OR1 C;  1FLI A;  1BI1 A;  3G71 I;  2MA3 A;  4EJU A;  3OWT A;  1OKR A;  2BVM A;  1OPC A;  5CYV A;  2LKS A;  4MFD A;  2BXY A;  2DLL A;  2PBI A;  1P4A A;  2R7D A;  2L3D A;  3GBG A;  4HAM A;  3K1M A;  2OV7 A;  5EZG A;  4E7Z A;  5E3M A;  5J47 A;  1JXS A;  1ZK8 A;  2ELH A;  4HLX A;  4PJN A;  1Y39 A;  1MJ9 A;  5FO5 A;  1ZGA A;  2L7F P;  2E1M C;  2NNN A;  1H8A C;  1MW7 A;  3OL4 A;  2XHK A;  4U0W A;  4G6Q A;  3QYF A;  4C3H J;  1TTY A;  2YX4 A;  1P6R A;  3R4K A;  2CQN A;  2OZ6 A;  2XV4 S;  2MD0 A;  1DPU A;  3CJR B;  4UUS A;  3ZMZ A;  1TL8 A;  4DGW B;  2VQL A;  1ONV A;  5BPD A;  3HOW J;  2XF5 A;  1MMA A;  1MMG A;  3DPL C;  3M8J A;  4LIT A;  3H3U A;  2KIM A;  3B02 A;  3E6M A;  1IN7 A;  1V5G A;  3EUA A;  5DTD A;  3TW7 A;  2R92 J;  2KP6 A;  4K2E A;  2R7U A;  2X4H A;  4RS8 A;  4RBO A;  5IOZ A;  4M73 A;  1TWF J;  2DYR H;  3A01 B;  1ZQ3 P;  1TQI A;  1J75 A;  4E7K A;  2JUG A;  3LST A;  3FIS A;  3KZI C;  4EV0 A;  3PO3 J;  4Y33 A;  3RKW A;  3HSF A;  4A0X A;  2R7Z J;  2O03 A;  2CFX A;  1IZ1 A;  4KIB A;  5DUK A;  2MLK A;  1SEU A;  3CC4 I;  2M7A A;  5CKT A;  1WZ2 A;  2EIK H;  2BW3 A;  2P7V B;  2DOD A;  1YHQ I;  4Q5S F;  2DT5 A;  3HUG B;  2VJ4 A;  2GAU A;  2A61 A;  2DFE A;  4L5I A;  2PJR B;  3MVP A;  1EH8 A;  2XPW A;  5IYC J;  4AD9 A;  3P7N A;  1HDP A;  1MIJ A;  3HOS A;  1R36 A;  3KLN A;  4RM3 A;  3ZN1 A;  2XAQ A;  1MDM B;  1RUO A;  2KJC A;  3JRH A;  4L9N A;  2DDA A;  2DOF A;  4GXO A;  3OYH A;  3BPV A;  2CW7 A;  3GEZ A;  4ABZ A;  1BBY A;  1UCR A;  2QSH X;  3HSE A;  1R49 A;  1R4N B;  5ILS A;  5L3E A;  4KA4 A;  2BY3 A;  5KK1 A;  3G1O A;  3BT9 A;  4IHY A;  1DGW Y;  3S3M A;  3E3V A;  2ZC2 A;  3BC8 A;  3OYM A;  3U1D A;  2V9K A;  1TC3 C;  2DPU A;  2HOT A;  2LF8 A;  2I10 A;  2Y2Z A;  2VT2 A;  4G9Y A;  3I4N J;  3GLX A;  1AA7 A;  4AIK A;  3KE2 A;  2RVC A;  1W0U A;  2CO5 A;  5CQG A;  5GTH C;  3FXR A;  1X2N A;  4WWC A;  3N97 A;  2CV0 A;  2KJB A;  2FMY A;  2LG4 A;  2YUS A;  4HNT A;  3FHZ A;  5KAI C;  4LJZ F;  1FEX A;  4YG2 F;  5F1R A;  2EK5 A;  2EFP A;  3F8M A;  5JR3 A;  2VE9 A;  1YIJ I;  4F93 B;  4PK4 A;  1KQ0 A;  1YW9 A;  4BQQ A;  4HNV A;  3HHG A;  2JSC A;  4ETS A;  1G3T A;  2QQA A;  2EFO A;  2RGV A;  3ESW B;  2ID6 A;  4A6D A;  4ENM A;  3S3O A;  4U87 A;  3DLL F;  3EQL F;  3KEO A;  5E79 C;  1IO2 A;  4WK8 F;  4EGZ A;  2N8G A;  4OIP F;  4EQQ A;  4HX7 A;  2KDO A;  3IUO A;  2MC4 A;  3P5J A;  3CJT B;  3TP0 A;  1GXP A;  3VYS B;  3RYP A;  4IOA F;  4B43 A;  5GPC A;  4LD5 A;  4XKC A;  3F23 A;  4HRI A;  4I6Z A;  4IHT A;  2VI6 A;  2M34 A;  3F8F A;  3H92 A;  3ZQQ A;  4ENK A;  2K9S A;  3FXO A;  2B63 J;  4RMN A;  2BEO A;  3IKV A;  5FRM A;  2FBK A;  5GAG J;  1I3A A;  2MLG A;  3MFK A;  3FDY A;  2UXX A;  1IRG A;  1QBJ A;  2STW A;  1VI0 A;  3BR5 A;  2LYC A;  4IJA A;  1LE8 B;  4MIM A;  1YE9 A;  1T33 A;  5D5V B;  3IP4 B;  2ZKZ A;  1YTY A;  4A3J J;  2HKX A;  1Y0U A;  5DD8 A;  3E7L A;  2M87 A;  1YS7 A;  2EIN H;  4J19 A;  2CRG A;  3RYR A;  5CJ9 A;  2E1N A;  1Z1D A;  2DTR A;  4XKV A;  1IRX A;  3WTV C;  4IRI A;  2NXN B;  1XTA A;  1ZEL A;  1FBQ A;  2E71 A;  3HZJ A;  3GWZ A;  1Z21 A;  1VTN C;  4BBR J;  4CYC B;  4QWQ A;  3HOT A;  3NQO A;  3ECH A;  3JRB A;  1RIO H;  2C6Y A;  1R58 A;  2IRF G;  3O3K A;  2XKP A;  3PNT A;  5HLT A;  1DU6 A;  4E7S A;  1YX3 A;  2WA0 A;  2JVG A;  4LG0 B;  1DUX C;  2XAF A;  3IWZ A;  2CQK A;  2DA1 A;  2EZK A;  4S05 A;  3B6C A;  3FKJ A;  1YJN I;  3HOZ J;  3C18 A;  2W82 A;  3WTY C;  2DK5 A;  3HRT A;  4DZP A;  4ZZL A;  1SAU A;  1R22 A;  2QVO A;  3IV5 A;  3QYE A;  2R0Q C;  3HBL A;  4Y13 A;  5FLV A;  1YJW I;  1FPQ A;  3BOQ A;  2MH9 A;  4FHT A;  4KN4 X;  2W48 A;  4J01 A;  4A3C J;  2LSO A;  4CCK A;  1V5E A;  2CSO A;  5HLI A;  3K4L A;  3R0A A;  3PM1 A;  2O7O A;  4HQE A;  4E7H A;  3TGN A;  3HTU A;  5IP6 A;  1TBX A;  4XR6 A;  1F43 A;  1CGP A;  3HHH A;  3GF2 A;  1YO5 C;  4EVI A;  4I0B A;  3DFG A;  2EJR A;  3CMA I;  4AIH A;  4IVN A;  2JA8 J;  3K69 A;  3QAH A;  1YQA A;  3Q0U A;  2CWE A;  2HDD A;  5HS8 A;  1ZR4 A;  3ZRG A;  4NQW B;  4HST A;  1MD0 A;  4S04 A;  4A0Y A;  4LG3 A;  3WU0 A;  4C2U A;  4A5N A;  1PYV A;  1JGS A;  2XGD A;  2FML A;  3K10 A;  2FBH A;  3F0C A;  4IXA A;  3I55 I;  3FBN B;  3JRG A;  3TOB A;  1HQC A;  2WAQ A;  4XQF A;  4S0H B;  5GTI C;  2L7Z A;  1QPM A;  1R6R A;  1NH3 A;  5LEK A;  2P5L C;  3HGG A;  3TBI A;  5EYR A;  5KNL A;  3OS0 A;  3ABK H;  4IRH A;  1RR7 A;  2HXO A;  2DQR A;  2XAG A;  1QZE A;  5FRN A;  4Z2Y A;  3GFL A;  4M71 A;  1ETV A;  2DYS H;  2Y75 A;  4PJ0 C;  4PUS A;  4BJ5 C;  2E1M B;  2GXG A;  3H36 A;  5JI6 A;  1LKX A;  4BBS J;  1NK3 P;  2X1D A;  2P7C B;  3GTL J;  3JAM K;  2GBY A;  4C2T A;  2H09 A;  3QPS A;  1BI2 A;  3KYC B;  3KP5 A;  5FKL A;  4ZYH A;  1WCM J;  4F91 B;  1ETO A;  3S2H J;  5C4X J;  2P5V A;  2R7O A;  2X6O A;  4YII A;  3KEY A;  3E5U A;  2LBF B;  5J6X A;  2GOM A;  4XID A;  3A1Y A;  3ABT A;  3ONQ A;  2AXL A;  2FQ4 A;  3I58 A;  2E19 A;  4BYY A;  4CH7 A;  4IX7 A;  1KU3 A;  1X2M A;  2XB0 X;  4PFP A;  2HOA A;  1ZGJ A;  1F9N A;  2W1O A;  3F21 A;  1MMN A;  1J5Y A;  5LGT A;  3FXM A;  3K4M A;  3VOE A;  2LY2 A;  4BUP A;  3LA7 A;  4D7M A;  3J7A Y;  2O3F A;  3JCU C;  2DA4 A;  2JK3 A;  2XVC A;  4XRS A;  1Y56 A;  5LRS A;  2NYX A;  4EJO A;  4EAT A;  4R79 A;  2FOK A;  3OS2 A;  1Z6R A;  2KRF A;  2YSR A;  4XKW A;  4HYE A;  1XDU A;  4U0Y A;  3VEP A;  3A01 A;  3I9V 2;  4ZZD A;  3BR2 A;  3OYI A;  2Q1Z B;  5EG0 B;  2BBY A;  3CCU I;  4E4H A;  1W5T A;  2XPU A;  1JUP A;  2G7U A;  2EIL H;  3FZV A; 
#chains in the Genus database with same CATH homology
 3KLO A;  3JSP A;  5A2Q K;  4ZYG A;  5ILV A;  3M9A A;  1RI7 A;  2L54 A;  2PFB A;  1KQ8 A;  2H94 A;  3V8L A;  4TV7 A;  4YFK F;  4ENN A;  2EA2 A;  1XSX A;  5HOO A;  2P6S A;  1WI9 A;  4N9I A;  4BHC A;  1ZG1 A;  2EV0 A;  2ZNZ A;  5E1X A;  3D5L A;  1XB4 A;  4AVP A;  4KN7 X;  2F5F A;  3ZQ7 A;  4HX8 A;  4HW0 A;  4OIN F;  5TJJ A;  1ODD A;  5D6E A;  1QZZ A;  3C7J A;  3CJN A;  3RKY A;  1K78 B;  3FF5 A;  2WWY A;  4CZZ A;  1IAW A;  4EJT A;  3WTU C;  3ZMT A;  2VE8 A;  1W7P D;  4BHB A;  2JPB A;  5FD6 A;  1IXR C;  5JFR A;  3IC7 A;  2M30 A;  3R60 A;  1F5T A;  1FP2 A;  1UFM A;  4OOI A;  3IRR A;  4BQA A;  4AIJ A;  4LB6 B;  2IJL A;  4P5O A;  5TRD A;  2P5K A;  2FU4 A;  1ULY A;  3WE3 A;  1P4W A;  4MTD A;  4YIF A;  4A5M A;  5K1Y A;  3BPX A;  3T8R A;  3L00 A;  3WG9 A;  1O57 A;  3HRS A;  3JTH A;  3SZP A;  4KFC A;  2OBP A;  5DCM A;  2D45 A;  1ZRC A;  3FMQ A;  1YIO A;  3HIF A;  1FYM A;  3B73 A;  4E70 A;  3IWF A;  5F64 A;  4LG0 A;  2R7F A;  3Q9V A;  2LF7 A;  2PLY A;  2LKP A;  3MZH A;  1L0O C;  2HYF A;  2YPR A;  3F6V A;  4KMF A;  3CUQ C;  3Q9S A;  3J7A O;  4WXD A;  2HQR A;  2IP2 A;  5BPI A;  3K2Z A;  2VOP A;  1ZRD A;  2H27 A;  2IW5 A;  1XMA A;  1ZG5 A;  2XAJ A;  1SD4 A;  3HTS B;  4NQW A;  4A0Z A;  4Q47 A;  2D1H A;  2RV8 A;  2E1C A;  4O5V A;  4PGH A;  4M6Y A;  1IUY A;  3WTW C;  3REO A;  4RGR A;  3TOA A;  2FRH A;  3J81 K;  2FNA A;  2IA0 A;  4PGG A;  3WGI A;  2J5P A;  2W57 A;  1LNW A;  2X0L A;  2PJP A;  2OU2 A;  4KDP A;  4R1H A;  2MBF A;  3IL2 A;  1I1S A;  1IXC A;  1P2F A;  2HGC A;  2XRN A;  3CO6 C;  1BM9 A;  3KP3 A;  4LK0 F;  3E6B A;  1R1T A;  1PP8 F;  1REP C;  5IT3 A;  3PQJ A;  2K86 A;  3MZY A;  1YS6 A;  5FB2 A;  1SFE A;  2PI0 A;  1Q1H A;  4ON0 A;  2RN7 A;  5E1W A;  2ZFW A;  3J80 Z;  3MAJ A;  2XIG A;  1R5G A;  2A69 F;  4O3M A;  2RKH A;  5H6R A;  5LRR A;  2GIV A;  4YFN F;  1I6X A;  2W25 A;  4IPA A;  2Q2E A;  1ON1 A;  2FXA A;  3F8B A;  1NHA A;  2ESH A;  1YW8 A;  4R8H A;  1IXS B;  1TW3 A;  2Q0O A;  4I0A A;  2OQR A;  3I59 A;  1YG2 A;  4EMS A;  2ISZ A;  1G3W A;  5FGM A;  4HA8 A;  5AIQ A;  1KU7 A;  3K1N A;  3LAP A;  1SD7 A;  5DDG A;  5BS6 A;  2ETH A;  1HXD A;  2DQL A;  4MTE A;  3G3Z A;  3PQK A;  1UHM A;  5FLX Z;  1HW1 A;  2HS5 A;  3LQQ A;  1G3S A;  2HQN A;  5HDK A;  2HDC A;  2MH2 A;  5E18 F;  2YX7 A;  4BNC A;  5D8L B;  5D4S A;  5E17 F;  1MJA A;  1FY7 A;  1ZAO A;  1HKT A;  4NHJ A;  2M45 A;  3C3W A;  5BMZ A;  3QOP A;  2NNY A;  4HOB A;  2WC2 A;  3DPT A;  5CVI A;  1SD5 A;  2XAH A;  2FE3 A;  4LFU A;  3WGH A;  3WOD F;  1FYL A;  1LDK B;  1QO0 D;  1U5T A;  1R7J A;  1S29 A;  1XGN A;  1FYK A;  4D0P A;  5L3F A;  3EYY A;  2Z5U A;  5L3G A;  1B4A A;  1XGM A;  1F4K A;  5ICE A;  1ON2 A;  1S3J A;  3I0T A;  5DCF A;  4DQ2 A;  2V1D A;  5EEH A;  2IPQ X;  3HRM A;  1HKS A;  5IT9 Z;  5D6F A;  1W7P A;  1BC7 C;  4LLN A;  1B9N A;  1H9G A;  2HYG D;  1XSV A;  6PAX A;  4I09 A;  5H20 A;  2RQP A;  3GW2 A;  5HLH A;  4BHP A;  3FWE A;  3EUH A;  1O3S A;  2IVM A;  3COA C;  3Q5F A;  3RKX A;  4UXN A;  5KVR A;  3KET A;  1TNS A;  4I98 B;  3SFZ A;  2QQ9 A;  1T0F A;  4HBL A;  5F6F A;  3PFI A;  4KIC A;  4G7O F;  2K7L A;  2FA5 A;  2VBX A;  2W84 A;  4RB3 C;  3V4G A;  2FBI A;  2HKO A;  4I7H A;  1IRF A;  3QPH A;  1J0R A;  3CTA A;  4M9X A;  2V79 A;  1BJA A;  1OR7 A;  2EV5 A;  2BGC A;  1IW7 F;  5AON A;  1I5Z A;  3F22 A;  3GVA A;  4H0E A;  2L4A A;  4G8X A;  2XUB A;  5HS7 A;  3T0Y A;  4QLC U;  4Y15 A;  3FXU A;  3R61 A;  3RI4 A;  4FT8 A;  3ZMU A;  1I27 A;  2PQ8 A;  3I5U A;  1YFH A;  4KYW A;  3FX3 A;  2G7H A;  2EFW A;  3NEU A;  4A2U A;  1CF7 A;  3MCZ A;  4HZF A;  2PMU A;  3RPQ A;  3EDP A;  1C0W A;  4UVB A;  1Z91 A;  2A6E F;  1FC3 A;  3CUO A;  1SMY F;  2EFQ A;  1MGT A;  1MZB A;  4WXH A;  2DBB A;  2VBY A;  2MC3 A;  1FT9 A;  5ILU A;  5EEG A;  1FP1 D;  1BN5 A;  3JW4 A;  2GA2 A;  1F1Z A;  2VOD A;  2Z33 A;  1HKQ A;  4ZYD A;  1AOY A;  2TDX A;  1ZLK A;  5DD4 A;  1SMT A;  2O61 A;  3F8C A;  1IN4 A;  3TO7 A;  5JHU A;  2UZK A;  2DW4 A;  2EFN A;  4CO8 A;  3BJA A;  1G4D A;  2H6B A;  1S7A A;  2QBY B;  5E1Z B;  2VC1 A;  2EV6 A;  1KYZ A;  4L5J A;  3ECO A;  4B8X A;  3KEQ A;  2NAZ A;  5LLQ A;  2O0Y A;  4KUM A;  1LDD A;  3LWF A;  5CVU A;  2QUF A;  3HSR A;  5K5O A;  1K7A A;  2CGP A;  2NRA C;  4OIQ F;  1FZP B;  1WWX A;  3V7S A;  5J8F A;  5D5X B;  2L01 A;  1A04 A;  3HUG A;  2Z9O A;  4F7Z A;  3WTT C;  1XD7 A;  3BY6 A;  1MDM A;  1UB9 A;  2E7X A;  4GYI A;  3FMS A;  1HST A;  3ERE D;  3MEX A;  2UWM A;  4P55 A;  2ESN A;  4UV9 A;  2JRT A;  1LEB A;  4LGW A;  4AWX B;  1R1V A;  4I02 A;  2FQ3 A;  2Y48 A;  4CHU A;  3F3X A;  3KCC A;  2KIU A;  4XBF A;  1KQ9 A;  4ENJ A;  4PCQ A;  3ZMV A;  1B9M A;  1QNT A;  1KU2 A;  3W6J B;  3ZMS A;  4HLY A;  2KIF A;  3O6B B;  4KNY A;  1BIA A;  2DO7 A;  1UHW A;  1XSD A;  3DV8 A;  3ELK A;  4L9J A;  4U7B A;  3OOP A;  3GO5 A;  1OYW A;  4ZYE A;  2FF4 A;  2V9V A;  3ROU A;  1MJB A;  1B6A A;  2ACJ A;  2JZY A;  2D2W A;  2V1U A;  1AWC A;  3HYI A;  2EA4 A;  4M9Z A;  4WXC A;  2RNJ A;  2Z99 A;  4Q48 A;  4U7D A;  2OA4 A;  3M8F A;  5L3C A;  1T39 A;  1O7F A;  4RGX A;  1R00 A;  1W5S A;  3ZN0 A;  1PDN C;  1QZY A;  5K5R A;  5CVJ A;  3V7R A;  4P9U A;  4FX0 A;  2A3S A;  3ZPL A;  4BAY A;  2P4W A;  3VFZ A;  3T8T A;  3U9G A;  4PZJ A;  3I71 A;  4UVC A;  1HBX G;  4JQF A;  2QWW A;  1WKM A;  1LDJ A;  3ULQ B;  2A68 F;  2HTS A;  1RUN A;  2PMH A;  2STT A;  3RPU A;  3WU1 B;  2HEO A;  4M74 A;  2K4J A;  3QRF F;  3E6D A;  3NRV A;  1ZN2 A;  4MGR A;  1D8K A;  2VT3 A;  1T2K A;  2XRO A;  4JK1 X;  5D5W B;  3V8K A;  2GA1 A;  2M8E A;  3W6K B;  4FX4 A;  1HW5 A;  4GYG A;  1Z7U A;  3JAM Z;  4U88 A;  4ASN A;  2FSW A;  1HW2 A;  3L09 A;  3R6S A;  3TDU C;  1EV7 A;  3T5X A;  3GZ6 A;  4RGS A;  1HSJ A;  4RB0 A;  2BE5 F;  1WSU A;  1E17 A;  1H9T A;  4M72 A;  1RZ4 A;  2DFI A;  3M8E A;  1FBS A;  3GZ5 A;  4KMU X;  4LLG F;  4CGZ A;  3WGG A;  5LHH A;  4HF0 A;  5HVQ C;  2VXZ A;  2H6C A;  1H0M A;  2COM A;  4L9V A;  1TQM A;  1WQ2 A;  4GCV A;  2GQQ A;  3E5X A;  4CXF A;  3JSO A;  5A2Q Z;  2UXN A;  1G3Y A;  1LVA A;  2M1B A;  5J8C A;  3QU6 A;  1W4M A;  2EWN A;  4ESF A;  2L02 A;  1FSH A;  4A6E A;  4P96 A;  2QZ8 A;  3WTX C;  2VOO A;  4IHS A;  1D5V A;  3GFI A;  1KGS A;  1OYI A;  2VC0 A;  3FM5 A;  4A12 A;  5FFZ A;  4HQM A;  2A5Y B;  5D5U B;  4XLN F;  3BRO A;  4BXU A;  2YR2 A;  1TNT A;  1ZRF A;  1U6G A;  1USS A;  2E7W A;  5BOX A;  1X3U A;  3LA2 A;  2JT1 A;  2PG4 A;  1J2X A;  4MHG A;  2D1V A;  4OMZ A;  3GUD A;  3BDD A;  2OQG A;  1ZH5 A;  3WE2 A;  4UV8 A;  3RJP A;  1K78 A;  4UVA A;  3K0L A;  2DU9 A;  4M9S A;  4HX4 A;  1BC8 C;  5AIP A;  3ZMD A;  1ZRE A;  2O6G E;  2OAZ A;  1Z9C A;  2CW0 F;  3VB2 A;  4L0Z B;  4XSX F;  4KT5 C;  3DP7 A;  1ZHF A;  2W24 A;  4EJV A;  5ICF A;  5CLS A;  2HFH A;  3MQ0 A;  3TDZ C;  3LAJ A;  5DV5 A;  1LB2 A;  1E2X A;  3TO9 A;  3EET A;  3BZ6 A;  1O7L A;  3DEU A;  3KP6 A;  1PP7 U;  5ICG A;  3SHF A;  2IT0 A;  2ZJ2 A;  4HF1 A;  2B0L A;  4DNC A;  3GFJ A;  2PEX A;  2ZO4 A;  4M6X A;  2DAO A;  2J5O A;  4MQ9 F;  3CUQ B;  3I54 A;  3DF8 A;  4RB2 C;  5ED4 A;  4MEX F;  2CYY A;  3KZZ A;  3D0S A;  5FD5 A;  3VOD A;  5CVR A;  1R23 A;  4MNU A;  5D4R A;  4HV6 A;  1J59 A;  4L9T A;  4WCG A;  1DDN A;  3IHU A;  4XLP F;  2VON A;  2BV6 A;  2P8T A;  3M1E A;  3K1P A;  2CG4 A;  3J81 Z;  5LGU A;  4OIR F;  4L18 B;  1EH6 A;  3KP2 A;  2OZU A;  1OMI A;  1GHC A;  1XCB A;  4I01 A;  5DCM B;  3U2R A;  2QLZ A;  1YW7 A;  2XKO A;  1BI0 A;  1LEA A;  4KIF A;  2A6H F;  2F2E A;  2RC4 A;  1FWZ A;  4LK1 F;  3CLO A;  1UST A;  4MQV A;  1U5T C;  2W85 A;  4CYD A;  2EB7 A;  2QQB A;  4G94 A;  2LNB A;  1Z6T A;  2GZW A;  1J9I A;  3CO7 C;  2VBW A;  3ML6 A;  1D3Y A;  1XGO A;  4XSZ F;  1XDS A;  3F8N A;  2F5E A;  4B09 A;  4RAZ A;  1G6N A;  3E5Q A;  2ISY A;  1WRJ A;  4L0Y B;  3DQV C;  1RNL A;  4LMY A;  4RB1 A;  2GXB A;  2WTE A;  1S6L A;  2BYV E;  4EM0 B;  4UUV A;  1B59 A;  1IN8 A;  3SZT A;  4GGG A;  5E8G A;  3FMR A;  2M5W A;  5HLG A;  3L9F A;  1SFU A;  1O3T A;  2WV0 A;  5HDG A;  1JE8 A;  3KP7 A;  1TLH B;  1KA8 A;  2DK8 A;  2Z3Y A;  4ESJ A;  1D8J A;  3AAF A;  4EM1 A;  4MEY F;  3KZY A;  3P9I A;  1LJ9 A;  1ZAR A;  1S7O A;  3CDH A;  3P9C A;  2QYO A;  3FM3 A;  4U0V A;  4YFX F;  4OIO F;  3LA3 A;  1DPR A;  2ZME B;  3HRU A;  4HV5 A;  1SAX A;  1ZLJ A;  3F72 A;  2RDP A;  5CVV A;  2HWV A;  4N9H A;  1GVJ A;  3ZP5 A;  2K02 A;  5LHI A;  3V8J A;  3L2C A;  3WTZ A;  4EJW A;  3FXQ A;  1ZYR F;  3I53 A;  1TQP A;  3JTG A;  1STZ A;  2K4B A;  2IA1 A;  5H6Q A;  5FFX A;  3GFM A;  4IRG A;  1QGP A;  2ZNY A;  3J80 K;  3DKW A;  4EM2 A;  2OD5 A;  4UHT A;  3E97 A;  3KFW X;  1SFX A;  3T1B A;  1DP7 P;  4Q4Z F;  3ISP A;  2VN2 A;  5ERI A;  3BWG A;  4PDK A;  1BOA A;  4KIG A;  5HS9 A;  3RIR A;  2LDU A;  3I59 B;  2HOE A;  4ZH4 F;  1T6S A;  1JHH A;  3RTR A;  1QQI A;  2R3S A;  1P92 A;  1GXQ A;  3SQN A;  5DYM A;  2HR3 A;  3CUQ A;  2Q8K A;  1O3R A;  4XRF A;  2DPD A;  4O6J A;  4CDG A;  1JHF A;  1FBU A;  3IRQ A;  3QP6 A;  3ABU A;  2F5D A;  1KU9 A;  5D8K B;  1IF1 A;  2GWR A;  3K9T A;  5JVT A;  3BJO A;  3MWM A;  5FLX K;  3KP4 A;  1FSE A;  1R1U A;  1FNN A;  1V4R A;  5LEJ A;  1BIB A;  3P9K A;  5ICC A;  1V3F A;  1U78 A;  2K27 A;  5LHG A;  3GXO A;  4UNO A;  1J7K A;  4HDU A;  3F6O A;  3I64 A;  3V7C A;  1T98 A;  1XMK A;  1TW2 A;  4HF2 A;  2VBZ A;  1K79 A;  4HDV A;  4G6D A;  1U3E M;  2JPC A;  3R0J A;  1P4X A;  3TQN A;  3GYH X;  1PUE E;  2QM3 A;  4N0B A;  2FNP A;  3WTS C;  4G7H F;  1U5T B;  1MKM A;  4ESB A;  5HDN A;  4LLL A;  1B1B A;  3TO6 A;  1IN6 A;  3QPT A;  1XN7 A;  1YYV A;  3G73 A;  2NS0 A;  4JBA A;  2FEZ A;  3QU3 A;  5K5Q A;  2G9W A;  5DEQ A;  1BI3 A;  3LQR A;  4BH9 A;  3LFK A;  1O3Q A;  1FX7 A;  2ZBK A;  4WF2 A;  1LQ1 A;  2P6T A;  1W7P B;  1R5H A;  5IT9 K;  3C1D A;  4OMY A;  3QP5 A;  3RDI A;  4IF4 A;  2IA2 A;  2ZXJ A;  3DXJ F;  4EGY A;  1L3L A;  3TKY A;  1U2W A;  1KYW A;  1I1G A;  2F5C A;  1ZG3 A;  4Y17 A;  3IKT A;  3GX4 X;  2V1X A;  3S2W A;  3L7W A;  4P9F A;  2ZCW A;  2XAS A;  4G7Z F;  3OV8 A;  2KKO A;  2PN6 A;  2Y0M A;  4OU0 A;  4LB5 A;  1XCV A;  1FOK A;  3O2P E;  4CIC A;  5DUI A;  5BQT A;  3BP8 A;  2HTJ A;  1T38 A;  4RAY A;  1U8R A;  3BJ6 A;  5LGN A;  1S8N A;  2XGX A;  4WX9 A;  1EH7 A;  2DI3 A;  5E20 A;  5L3D A;  2QBY A;  2A07 F;  2JTV A;  3H3Z A;  2ZME A;  3E6C C;  2HZT A;  4GO1 A;  2L4M A;  1IN5 A;  1XGS A;  2MD5 A;  1OYY A;  3I4P A;  1SD6 A;  3EYI A;  4RGU A;  5L3B A;  1CF7 B;  5E8I A;  2YU3 A;  1K6O A;  2QEN A;  4NB5 A;  5LBQ A;  2ADU A;  2V6C A;  3M7G A;  3SXY A;  1YLF A;  1Z05 A;  3N4M A;  2O8X A;  2AS5 F;  1FLI A;  1BI1 A;  2MA3 A;  4EJU A;  1OKR A;  1OPC A;  5CYV A;  2DLL A;  2PBI A;  1P4A A;  2R7D A;  2L3D A;  4HAM A;  3K1M A;  1JXS A;  2ELH A;  4HLX A;  1MJ9 A;  5FO5 A;  1ZGA A;  2NNN A;  2XHK A;  4U0W A;  4G6Q A;  1TTY A;  2YX4 A;  1P6R A;  3R4K A;  2OZ6 A;  2XV4 S;  1DPU A;  3ZMZ A;  1ONV A;  5BPD A;  3DPL C;  3H3U A;  2KIM A;  3B02 A;  3E6M A;  1IN7 A;  4K2E A;  2X4H A;  4RS8 A;  4M73 A;  1TQI A;  1J75 A;  3LST A;  4EV0 A;  3RKW A;  3HSF A;  4A0X A;  2O03 A;  2CFX A;  1IZ1 A;  4KIB A;  5DUK A;  2MLK A;  2P7V B;  4Q5S F;  2DT5 A;  2GAU A;  2A61 A;  4L5I A;  1EH8 A;  4AD9 A;  3P7N A;  3HOS A;  1R36 A;  3KLN A;  3ZN1 A;  2XAQ A;  1MDM B;  1RUO A;  2KJC A;  4L9N A;  4GXO A;  3BPV A;  3GEZ A;  1BBY A;  1UCR A;  3HSE A;  5ILS A;  5L3E A;  4KA4 A;  5KK1 A;  3E3V A;  3U1D A;  2DPU A;  2LF8 A;  2VT2 A;  4G9Y A;  3GLX A;  4AIK A;  3KE2 A;  2RVC A;  2CO5 A;  3FXR A;  4WWC A;  3N97 A;  2KJB A;  2FMY A;  3FHZ A;  4LJZ F;  4YG2 F;  5F1R A;  2EK5 A;  2EFP A;  3F8M A;  5JR3 A;  2VE9 A;  1KQ0 A;  1YW9 A;  3HHG A;  2JSC A;  4ETS A;  1G3T A;  2QQA A;  2EFO A;  2RGV A;  4A6D A;  4ENM A;  3EQL F;  3KEO A;  4WK8 F;  4EGZ A;  4OIP F;  4EQQ A;  4HX7 A;  1GXP A;  3RYP A;  4LD5 A;  3F23 A;  4IHT A;  3F8F A;  3H92 A;  4ENK A;  2BEO A;  3IKV A;  2FBK A;  3MFK A;  2MLG A;  1IRG A;  2UXX A;  1QBJ A;  2STW A;  4IJA A;  5D5V B;  2ZKZ A;  1YTY A;  2HKX A;  1Y0U A;  5DD8 A;  2M87 A;  1YS7 A;  3RYR A;  5CJ9 A;  2E1N A;  1Z1D A;  2DTR A;  3WTV C;  4IRI A;  1FBQ A;  3GWZ A;  1VTN C;  3HOT A;  4QWQ A;  3NQO A;  3ECH A;  1RIO H;  2C6Y A;  1R58 A;  2IRF G;  3O3K A;  2XKP A;  4LG0 B;  1DUX C;  2XAF A;  3IWZ A;  2CQK A;  4S05 A;  3C18 A;  3WTY C;  2DK5 A;  3HRT A;  4ZZL A;  2QVO A;  1R22 A;  4Y13 A;  1FPQ A;  3BOQ A;  2MH9 A;  4FHT A;  4KN4 X;  2LSO A;  4HQE A;  2CSO A;  5HLI A;  4I2O A;  3R0A A;  3TGN A;  3HTU A;  1TBX A;  1CGP A;  3HHH A;  3GF2 A;  1YO5 C;  4EVI A;  4I0B A;  3DFG A;  2EJR A;  4AIH A;  4IVN A;  3K69 A;  3QAH A;  1YQA A;  2CWE A;  5HS8 A;  1MD0 A;  4S04 A;  4A0Y A;  3WU0 A;  4A5N A;  1JGS A;  2FML A;  4IXA A;  2FBH A;  3TOB A;  1HQC A;  1QPM A;  5LEK A;  2P5L C;  4IRH A;  2DQR A;  2XAG A;  4Z2Y A;  3GFL A;  4M71 A;  2Y75 A;  2GXG A;  5JI6 A;  2P7C B;  3JAM K;  2H09 A;  1BI2 A;  3KP5 A;  4ZYH A;  2P5V A;  4YII A;  3E5U A;  5J6X A;  3ABT A;  2AXL A;  3I58 A;  4BYY A;  1KU3 A;  1ZGJ A;  1F9N A;  3F21 A;  1J5Y A;  5LGT A;  3VOE A;  3LA7 A;  2O3F A;  2XVC A;  5LRS A;  2NYX A;  4EJO A;  4R79 A;  2FOK A;  1Z6R A;  2KRF A;  2YSR A;  4HYE A;  1XDU A;  4U0Y A;  3VEP A;  4ZZD A;  2BBY A;  1W5T A;  2G7U A;  3FZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...