3E3VA

Crystal structure of recx from lactobacillus salivarius
Total Genus 61
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
61
sequence length
154
structure length
154
Chain Sequence
LADDISKGYNAALNYLSYQLRTRKEVEDKLRSLDIHEDYISEIINKLIDLDLINDKNYAESYVRTMMNTSDKGPKVIKLNLSKKGIDDNIAEDALILYTDKLQVEKGVTLAEKLANRYSHDSYRNKQNKIKQSLLTKGFSYDIIDTIIQELDLI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Recombination
molecule keywords Regulatory protein recX
publication title Crystal structure of RecX
rcsb
source organism Lactobacillus salivarius
total genus 61
structure length 154
sequence length 154
ec nomenclature
pdb deposition date 2008-08-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA03
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA01
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3e3vA02
3GEZA 1BOAA 1SD4A 5K5OA 1QZZA 5DCMA 2K4JA 2R7FA 1TW2A 3O2PE 2M45A 2HTSA 5FB2A 2VOOA 3KEQA 1QPMA 4U88A 2M8EA 1G3TA 2IA2A 1TNTA 2OQGA 1W7PB 4AWXB 2ZBKA 2PLYA 3FXUA 1V3FA 1GXPA 3FM3A 3HRTA 4RS8A 5FO5A 4IRIA 1OKRA 4I01A 1JE8A 3R0AA 3TO7A 4I7HA 4L5IA 2QVOA 2NS0A 2PEXA 3SXYA 2EA2A 1MDMB 1S7AA 4WWCA 1I5ZA 3QAHA 3EETA 1LDKB 2NNNA 3LA7A 3GF2A 3MWMA 1U6GA 3R61A 1IN8A 1P6RA 1MJ9A 3IRQA 2ZNYA 3T0YA 1KGSA 2KJCA 1ONVA 2HS5A 4LG0B 1D5VA 4P9UA 3RIRA 3E6DA 5L3GA 2PG4A 4L0YB 1FY7A 1R1TA 1ZREA 3HTUA 2FOKA 3QP6A 1T6SA 2EA4A 3WU1B 4O5VA 4FX4A 1XSVA 2YX7A 4EJUA 4MGRA 2L01A 3V7SA 4KDPA 1FT9A 3L9FA 4BYYA 4EGYA 2IW5A 2V9VA 2K4BA 2DQRA 4Q47A 1ULYA 3IC7A 3J7AO 4EM0B 1J59A 3E3VA 1IXCA 1ZG3A 5AONA 2JT1A 3FMSA 4A0XA 1Y0UA 5JI6A 1T98A 2E1NA 2H6BA 5CLSA 4KMFA 4Y15A 5ILUA 1UHMA 2K86A 3SZPA 4ZH4F 2VONA 1Z6RA 4ESFA 1D8JA 3GFIA 2X0LA 5D4RA 4M6XA 3KZYA 3QU3A 3KE2A 2IJLA 4XLPF 5E17F 2FSWA 4RGRA 1U2WA 1R58A 5ICCA 1WQ2A 4AIKA 3IL2A 3K69A 2MH9A 2QLZA 4BHBA 2BBYA 2EV6A 5ERIA 1DP7P 3F3XA 3WODF 2LNBA 1P4WA 3FZVA 2CFXA 4DQ2A 3JW4A 1F5TA 3K2ZA 5LRSA 4LGWA 2QZ8A 2DI3A 2YU3A 1WI9A 2PMHA 3RDIA 2KIMA 3RTRA 3C7JA 1KU9A 2M1BA 3I4PA 1PP8F 1SMYF 2Y75A 1BIBA 3ZN0A 1ZLJA 1E17A 2HDCA 2M30A 3TQNA 2OD5A 3LA2A 5FD6A 4E70A 2R3SA 1RNLA 4GYIA 2BGCA 1LVAA 4I0AA 2FMLA 5CYVA 2ELHA 2P4WA 3J80K 1XMAA 3BP8A 4ZZLA 4HW0A 3L09A 4OINF 4QWQA 1W4MA 3M1EA 4N9IA 1Z9CA 4R8HA 4ZYDA 2ZMEA 3J81K 3FXRA 4OIRF 5DCMB 1F1ZA 4HX7A 1I27A 1L0OC 1FOKA 4AIJA 3EYIA 4O3MA 3N4MA 3HUGA 4M72A 1YYVA 3B73A 3I53A 2HQNA 1P4XA 2L02A 1UB9A 2QBYA 2FE3A 2XASA 1K78A 4P9FA 1O57A 2IVMA 3CUQC 5D8KB 2K02A 2FQ3A 2FA5A 3F22A 3TDUC 3IWFA 4K2EA 4YG2F 2O03A 2OQRA 3T1BA 3GO5A 4DNCA 3BZ6A 4UUVA 1XCVA 2YR2A 1FX7A 3JAMK 1W5TA 2EJRA 3U2RA 3GZ6A 4HAMA 2GQQA 4PZJA 4EMSA 3WTTC 1R1VA 3R6SA 3B02A 2ESHA 3DF8A 3F8BA 3KEOA 5DCFA 4A0YA 3N97A 2G7UA 2QENA 2FRHA 1EH6A 1T0FA 1ZARA 2OA4A 3HRSA 4Q4ZF 4GYGA 5BOXA 2RKHA 4KUMA 1HXDA 3ZQ7A 1YO5C 4NB5A 3WGGA 1ON1A 3P9KA 4UVBA 1ZGJA 4LLLA 4BNCA 4HF1A 4L9JA 3KLNA 3KZZA 2DPUA 3WTSC 3GFJA 3BROA 1IN7A 5DUIA 4G7OF 2P6SA 4JQFA 2XKOA 4MQ9F 2L3DA 5K1YA 2EV0A 1BBYA 4I0BA 2XAJA 1S8NA 4XSZF 1DUXC 3LA3A 2ISZA 3I58A 1OYWA 2VBZA 2F2EA 4P5OA 3VEPA 4U0WA 4UHTA 3EUHA 2Z99A 1HKSA 1MZBA 3I64A 3K9TA 1KU2A 3GLXA 3T8RA 3G3ZA 5E8GA 5EEGA 3ERED 4HOBA 5LHIA 1O3QA 4OIPF 1Z05A 3W6KB 2Q8KA 4IF4A 3H3ZA 5A2QK 4HDVA 3I5UA 5ED4A 2HYFA 4EVIA 3CTAA 4HBLA 1I1SA 1HBXG 1SAXA 4ENNA 3LQRA 2VBYA 4HA8A 4A12A 2IA1A 4L9TA 1R5HA 5L3EA 3JSOA 4A0ZA 1R23A 4YFXF 3ML6A 1TQIA 2DTRA 4RGSA 4HX8A 4HZFA 2P7VB 4EQQA 4YIIA 1Z91A 3TGNA 2OZUA 4IJAA 1YS6A 4AIHA 2P5LC 2COMA 4LK1F 3GX4X 1H9TA 5E18F 5CVVA 3DV8A 3V4GA 2NYXA 2ZO4A 4D0PA 1TNSA 3HOTA 4CYDA 3WGHA 2AS5F 1S29A 2HOEA 5E20A 4ON0A 3PFIA 2XKPA 1AWCA 2W84A 2O3FA 1BIAA 5ICFA 1OPCA 2PBIA 3KFWX 1J9IA 1XGOA 5ICEA 2EWNA 2KIFA 2R7DA 2GXBA 5BQTA 2DO7A 4ZYHA 2YPRA 2FNAA 3DQVC 1V4RA 2FNPA 2ZMEB 3LSTA 3FX3A 2D1HA 2QQAA 4B09A 4BAYA 5LGNA 3MEXA 5JVTA 1SFUA 2IA0A 4OOIA 4M71A 2ACJA 2STTA 4HV6A 2XGXA 5E8IA 3GWZA 2GZWA 2DK8A 2ISYA 1L3LA 2M87A 2QBYB 1K78B 2H6CA 4HLXA 5LRRA 3ABUA 5HS9A 1Z6TA 4BH9A 1TTYA 4KNYA 4U7DA 2EFWA 4ESJA 2NRAC 1UHWA 1IN6A 2XAGA 2FBIA 5CVIA 2B0LA 1S6LA 4R1HA 3SFZA 3D0SA 1RZ4A 5DD4A 2HKXA 3TKYA 5J6XA 4PCQA 1J2XA 2UZKA 2HYGD 4Y17A 3OOPA 1P92A 2IP2A 1GVJA 4KA4A 5LGUA 5HLGA 5HOOA 4L9NA 2RGVA 2QWWA 3E5UA 2ADUA 1FLIA 1A04A 3DXJF 1J75A 2HFHA 3JTHA 4KFCA 1U5TC 3F8CA 1XB4A 1OMIA 2P7CB 4LK0F 3CUQA 2VE8A 4ETSA 3T8TA 5HDNA 3LQQA 3BJ6A 4MQVA 3M9AA 4G8XA 5BPDA 4Z2YA 4ASNA 2PMUA 2GIVA 4WX9A 3HOSA 3CUOA 1XSXA 3F8FA 3RI4A 2P8TA 4O6JA 3U9GA 2Q0OA 1G3YA 5H20A 2LF7A 1ZLKA 2J5OA 5E1ZB 2FXAA 3WTVC 4JBAA 1U3EM 1KA8A 1YFHA 1J7KA 1GHCA 3E6CC 4P96A 1YQAA 2KKOA 2FEZA 1SFXA 1YW9A 2XUBA 4XRFA 4IHSA 1XMKA 2FF4A 3BPXA 4HLYA 4H0EA 1B9MA 4ZZDA 4MHGA 3RKXA 2HQRA 2ESNA 1T38A 2VXZA 4G7HF 1ZRFA 4N9HA 5DV5A 2PQ8A 1B6AA 1IN4A 2CG4A 2EFQA 1Z1DA 3M8EA 4HQMA 1DDNA 1G4DA 3IHUA 1U78A 1K79A 2EK5A 2FBHA 2A69F 3VB2A 4AVPA 4UVAA 2QQBA 1JHHA 3KP3A 3IKVA 1EH7A 2LF8A 2MLKA 2EV5A 4EGZA 1LQ1A 1YIOA 2JSCA 5HS7A 5D5XB 5L3BA 4GGGA 3ISPA 3QP5A 4M9SA 5AIPA 3JSPA 1TQMA 1IZ1A 3L2CA 1LB2A 5J8CA 3MZHA 2DK5A 4BXUA 3ZMTA 5BMZA 5BPIA 1OYIA 2L4MA 5L3DA 3KP7A 3GVAA 1B4AA 3WE2A 4KIFA 1FSEA 1STZA 3W6JB 3V7RA 1IW7F 3H92A 2WWYA 3ZP5A 1REPC 2ZCWA 2CO5A 3DKWA 3HIFA 3WE3A 5D6FA 3ULQB 4EJOA 1O3RA 2VBXA 2OZ6A 2MA3A 5LEJA 3QOPA 3FMRA 4LD5A 1YG2A 2QQ9A 4OIOF 1MJBA 5FD5A 3ZMUA 3MFKA 1P2FA 2D1VA 5D8LB 4A2UA 3WG9A 4EM1A 1ZH5A 3H3UA 4MEYF 1Q1HA 1HKTA 1RUOA 1ON2A 4L9VA 3LAJA 1FYMA 3C18A 4LLNA 3T5XA 1YLFA 1FWZA 3HHGA 4G6DA 1USSA 1RUNA 3WTXC 3LAPA 2VC1A 4OMZA 4UXNA 3WTWC 5CVUA 1NHAA 2DBBA 5FLXZ 5TRDA 2JPCA 2XHKA 3DPTA 3L00A 1BJAA 3K0LA 2O8XA 1ZN2A 2A6HF 1ZAOA 1ZGAA 5DDGA 2Z3YA 3KCCA 5AIQA 4WCGA 1F4KA 3RPUA 1FZPB 1G3WA 4G9YA 1MDMA 1HW2A 4MEXF 3VOEA 1HSTA 1YS7A 2F5DA 2QYOA 1P4AA 1BN5A 2W24A 1EV7A 4MNUA 5LHHA 2CWEA 1H0MA 2CYYA 2D45A 3CUQB 4AD9A 2VOPA 1FP1D 5CJ9A 1BC7C 3ZN1A 2VE9A 2XVCA 5EEHA 4IHTA 3FHZA 1FNNA 4KIBA 1TQPA 2RQPA 4BHPA 4UNOA 2L4AA 4CGZA 5DEQA 4WXHA 1U8RA 1CF7A 3F72A 2JZYA 2F5FA 4A5NA 1ZG1A 5F1RA 4NQWA 1QNTA 1FYKA 2M5WA 3GYHX 3TO6A 1FPQA 1XGNA 3HHHA 2PFBA 3KP4A 3I71A 2E1CA 4HQEA 2RN7A 3ECOA 2EB7A 2GA2A 1JXSA 3RYRA 2E7WA 3GFLA 1OR7A 1DPRA 1U5TA 2Z5UA 3QU6A 1CGPA 4KMUX 1XSDA 1S7OA 4WF2A 2LKPA 2CSOA 2CGPA 2HWVA 1FBUA 3MQ0A 1D8KA 1BI0A 2VC0A 4OU0A 2EFPA 3I54A 1RI7A 1DPUA 4FX0A 2H27A 2ZXJA 1R00A 2Z9OA 4ENKA 4CO8A 4I2OA 3DP7A 4A5MA 2EFNA 5IT9K 3D5LA 2DAOA 2XIGA 5HDGA 4RB3C 4KT5C 4LMYA 2VBWA 3PQJA 1ZG5A 2XROA 3TO9A 1ODDA 3EDPA 4IXAA 2GWRA 3EQLF 5D6EA 3O3KA 3WTUC 1I6XA 1XGMA 2QM3A 3HSFA 2UXXA 1KQ0A 1MJAA 2OBPA 1USTA 1FYLA 4XLNF 2V1XA 1YW8A 1B59A 1X3UA 3FXQA 2BEOA 3F8MA 3IWZA 2NAZA 3ABTA 4FT8A 1FP2A 3GZ5A 5ICGA 2GA1A 4U0YA 4PGGA 2MBFA 3TOBA 2STWA 2CQKA 2PN6A 5TJJA 4CDGA 4RAZA 1F9NA 1EH8A 4BQAA 4HYEA 1J0RA 1O7FA 5F6FA 2O6GE 3JTGA 4ENJA 5H6QA 4UVCA 1QZYA 2G9WA 4QLCU 3Q5FA 3BJOA 1OYYA 4ESBA 2D2WA 3E97A 2Q2EA 1MD0A 1Z7UA 2GXGA 3M8FA 2DFIA 3BPVA 3FMQA 3V8JA 3RKYA 4CXFA 4EM2A 3HTSB 4HX4A 3I59A 2WC2A 3BJAA 1XN7A 1UFMA 4EJVA 2DQLA 2H94A 2C6YA 3M7GA 2G7HA 5K5RA 4G7ZF 5D5WB 1FBQA 1TW3A 2UXNA 3ECHA 2KIUA 2RC4A 2XAHA 3C1DA 3MAJA 3KETA 4TV7A 4MTDA 1KQ9A 1WKMA 1R7JA 3IRRA 3HSEA 4RB0A 1YW7A 1KYWA 4N0BA 3REOA 5KK1A 1WSUA 5H6RA 1R1UA 1W7PD 1K6OA 4F7ZA 1VTNC 2V79A 3S2WA 3SQNA 4RAYA 5LEKA 4S05A 1LDJA 3F6VA 1C0WA 3RPQA 4XBFA 3AAFA 4HV5A 1SFEA 3FM5A 1SD6A 3LFKA 5LHGA 2OU2A 2P5KA 4CICA 1CF7B 4L5JA 1IUYA 4KYWA 3NQOA 5DUKA 2X4HA 3P9CA 2F5CA 2JRTA 1IF1A 6PAXA 2P6TA 3K1PA 3HYIA 1I1GA 4IRGA 3QRFF 5JHUA 4JK1X 3KP5A 1E2XA 4XSXF 4G6QA 1LEAA 2YSRA 4LFUA 1B9NA 2PJPA 2ZKZA 5DD8A 1U5TB 2W57A 5D4SA 1HSJA 4RGUA 2K27A 3CJNA 2BV6A 2O0YA 3TOAA 2FBKA 3CO6C 3EYYA 4PGHA 5JR3A 4M73A 2HZTA 1HW5A 3U1DA 3CO7C 5D5VB 1XDUA 4NHJA 1MKMA 4M74A 3J80Z 2LDUA 5E1WA 1ZRDA 5LLQA 2L54A 3LWFA 3VFZA 2A07F 2HKOA 1IRGA 2FU4A 2GAUA 4KN4X 1HQCA 4A6EA 4GO1A 3J81Z 1R36A 4OIQF 2RNJA 4L0ZB 4WK8F 2Y48A 4EJTA 5J8FA 4Y13A 4M9XA 1XGSA 1BM9A 2RV8A 5FFXA 4LJZF 3ELKA 3F8NA 3DPLC 4ZYGA 3MZYA 2LSOA 1QO0D 2WTEA 3F23A 3SZTA 4YFNF 2MC3A 2VN2A 2OAZA 4UV8A 3GFMA 1W5SA 1LDDA 4CZZA 2JPBA 3V8KA 3RYPA 3JAMZ 5KVRA 3COAC 2XAQA 2DW4A 2VT2A 2V1UA 1YTYA 1FBSA 4KIGA 1FSHA 4U7BA 2IPQX 3P9IA 1R22A 3QPHA 5FFZA 3BY6A 2W25A 4RB1A 2XV4S 3O6BB 4U0VA 1XD7A 1PP7U 4I98B 2XAFA 3R0JA 3HRMA 2RVCA 1BI2A 1J5YA 2FMYA 3V7CA 2VODA 5K5QA 2RDPA 2W85A 3ZPLA 4G94A 1ZHFA 2EFOA 3V8LA 2MLGA 3Q9VA 1W7PA 3I59B 2DU9A 2A3SA 1QGPA 3NRVA 1TBXA 3L7WA 2YX4A 1O7LA 1ZYRF 4I09A 2NNYA 2XRNA 3QPTA 2QUFA 3KLOA 4LLGF 2A6EF 3IKTA 2BE5F 5HVQC 1FC3A 3ZMVA 3SHFA 3WGIA 2Z33A 4A6DA 4CHUA 2HGCA 2F5EA 2IRFG 4S04A 3BOQA 3ZMZA 3DFGA 3KP2A 3F6OA 1JHFA 1K7AA 1IAWA 2H09A 1BI3A 4PDKA 3WU0A 4BHCA 4HF2A 4WXCA 4EV0A 3WTYC 1KYZA 4M9ZA 3PQKA 2K7LA 3E5QA 3R4KA 5A2QZ 1KQ8A 1XDSA 5ILSA 1PDNC 1IXRC 4LB6B 4LG0A 2AXLA 2DT5A 4Q5SF 3CDHA 4WXDA 4KN7X 5IT3A 4OMYA 3MCZA 1LJ9A 1WRJA 3GUDA 3I0TA 5FLXK 2MD5A 4EJWA 3BWGA 1SD7A 3C3WA 2E7XA 2CW0F 5HLHA 3ZMDA 1QBJA 3E6BA 5DYMA 2VT3A 5ILVA 1TLHB 4UV9A 1BI1A 3F21A 1O3TA 3ZMSA 3NEUA 2V6CA 4IPAA 5E1XA 5IT9Z 4GXOA 4Q48A 4GCVA 3VODA 1PUEE 4ZYEA 4FHTA 2Y0MA 3K1MA 5FGMA 4ENMA 1WWXA 2HTJA 2UWMA 5F64A 3GW2A 4YFKF 2O61A 2PI0A 3R60A 2A61A 1ZRCA 1O3SA 4L18B 1HW1A 2ZFWA 1GXQA 1D3YA 5D5UB 3FF5A 4IRHA 2DPDA 5HLIA 3TDZC 5JFRA 4IVNA 3CLOA 1S3JA 2JTVA 2A68F 5HDKA 2MH2A 4YIFA 5L3FA 2DLLA 4RB2C 2KJBA 1RIOH 4B8XA 2HEOA 4P55A 3E5XA 2ZNZA 1H9GA 3OV8A 1SMTA 1XCBA 2ZJ2A 1T39A 3DEUA 2P5VA 4R79A 3HRUA 4KICA 5LGTA 1KU7A 1QQIA 3HSRA 3RKWA 1UCRA 3RJPA 3ROUA 1LNWA 3BDDA 3KP6A 3FWEA 4MTEA 4HF0A 1HKQA 5CVRA 1T2KA 3Q9SA 4M6YA 1MGTA 2ETHA 5LBQA 2HR3A 1SD5A 1JGSA 1G6NA 5HS8A 4RGXA 2TDXA 1KU3A 3G73A 1BC8C 5CVJA 3P7NA 2V1DA 2KRFA 1B1BA 5L3CA 4LB5A 3K1NA 1AOYA 1G3SA 3WTZA 1IRFA 5BS6A 1LEBA 3E6MA 1IN5A 2BYVE 2A5YB 2J5PA 4I02A 1R5GA 1IXSB 2WV0A 4HDUA 3GXOA 2IT0A
chains in the Genus database with same CATH superfamily
5KCMA 4X0GA 3GEZA 1BOAA 4RAGA 2M2EA 2VQHA 4ZDLA 1POGA 1SD4A 1QZZA 3W3CA 5K5OA 1A5JA 5DCMA 4PFPA 2K4JA 2R7FA 1TW2A 3O2PE 2M45A 1NK3P 2HTSA 5FB2A 2VOOA 4HSRA 3OS2A 3KEQA 3K6GA 5CPRB 2JK3A 1QPMA 4U88A 2M8EA 3GTQJ 1MMDA 1G3TA 3I4MJ 2CQ7A 4JX6A 2KP6A 2IA2A 2EZLA 1TNTA 1ZTRA 3S1MJ 2OQGA 1W7PB 4AWXB 2ZBKA 4B1RA 2LC2A 4XKWA 3FXUA 4C3JJ 2PLYA 1V3FA 4A3CJ 3DPUA 3PSIA 3W2AA 1GXPA 3FM3A 2KHMA 3HRTA 1TWGJ 4RS8A 5FO5A 4IRIA 1JJ6C 4GDFA 1OKRA 4I01A 2BY3A 4M3FA 2MFZA 5F0FA 1JE8A 5GP9A 3R0AA 3RQ4A 3TO7A 5FLVA 3H5NA 4I7HA 4L5IA 2QVOA 2NS0A 1QZEA 3K10A 5M5YJ 2NVUB 1JKQC 2PEXA 2R7VA 3SXYA 3I9V2 2EA2A 1KZHA 1G59A 4XLAA 1VQ5I 3EUHC 1MDMB 1S7AA 4WWCA 1I5ZA 1OCPA 4CCNA 3OSFA 3G1LA 3QAHA 4JX4A 1FTZA 3TMOA 3EETA 1LDKB 2NNNA 2XPWA 3LA7A 2JUGA 4IX7A 3GF2A 3MWMA 1U6GA 2JSPA 1PUFB 3R61A 5C4XJ 1IN8A 2OJED 3KEYA 1RKWA 2QGUA 1P6RA 1MJ9A 3IRQA 1RKTA 2ZNYA 4XOTA 3T0YA 3VYUB 4BS9A 3M1CA 1KGSA 3LSPA 1Y8RB 2Z2SB 2KJCA 1ONVA 2HS5A 4LG0B 4CH7A 3BCAA 2NVTJ 1D5VA 4P9UA 1ZQ3P 3LSHA 5GTIC 1JT0A 3RIRA 3W6VA 2EZHA 3E6DA 4V2FA 1E3OC 5L3GA 2PG4A 4L0YB 1FY7A 3AG3H 1Z77A 4BDYA 1R1TA 1ZREA 5F1JA 3HTUA 2V1NA 2FOKA 3QP6A 2YUSA 3GBGA 1T6SA 2EA4A 3WU1B 4O5VA 4FX4A 1XSVA 3GTLJ 2IEKA 2NVYJ 2YX7A 2ZJRF 3HGYA 2DA5A 1ENHA 4EJUA 1IO2A 1LVKA 4MGRA 1G2HA 2MSYA 2L01A 3FXOA 1FIPA 1TWCJ 3V7SA 2LD5A 2Y31A 2EPFA 4KDPA 1FT9A 2EINH 3L9FA 4BYYA 4ANJA 4EGYA 2IW5A 2V9VA 4XIDA 2K4BA 2WA0A 2ELKA 2DQRA 3CJRB 4D7MA 1YX3A 4Q47A 1A31A 1ULYA 3IC7A 3J7AO 3CMEI 1WJAA 4EM0B 1J59A 2K9NA 3E3VA 3CDIA 2VKHA 4DBQA 5DM7F 1IXCA 4FE7A 1B72B 4LITA 3TP3A 1T08B 1ZG3A 1U0JA 5AONA 2JT1A 3FMSA 3BG7A 3BT9A 3ZQFA 5JVGF 4A0XA 1Y0UA 1X19A 4CCJA 5JI6A 2IS4A 1IV6A 1T98A 2E1NA 2H6BA 5CLSA 5B66C 2E2HJ 4KMFA 4Y15A 5ILUA 1UHMA 3QQAA 2K86A 3RQIA 3SZPA 2MC4A 4RLFA 4W1UA 2JVHA 1MNDA 4ZH4F 4CYCA 1Z6RA 3CCUI 2VONA 1KONA 1SAUA 4ESFA 1D8JA 3GFIA 2HVRA 4II3A 2BY2A 3G6EI 2X0LA 5E3NA 1N25A 1MMSA 3FXLA 1Z0XA 2H1KA 2IGMA 2ME0A 5D4RA 4M6XA 3KZYA 3QU3A 5K7ZA 5CQEA 1WGXA 3KE2A 4PSWA 2K9LA 2JUCA 2IJLA 2NXNB 4Y4RA 3J7ZI 4XLPF 5E17F 3GTMJ 3HKZA 2X9DA 2X1EA 3HG9A 2FSWA 3S32A 4RGRA 1U2WA 1R58A 2HQAA 5ICCA 1WQ2A 4CSWA 4AIKA 2CUFA 3JREA 1RC9A 3IL2A 3CF5F 4UY8I 3K69A 2MH9A 2QLZA 4J19A 4BHBA 3PNTA 4A3KJ 2BBYA 2EV6A 5ERIA 1DP7P 3F3XA 2VLAA 3BR0A 3WODF 3CJQB 2E35A 2LNBA 4PSXA 4BXXJ 2R7RA 1K61A 5DTDA 4IL6C 5IOZA 1OCOH 1P4WA 3FZVA 3HGGA 3KX2A 2HVQA 2WADA 3A2KA 2R7UA 2CFXA 3OYGA 3FXJA 1T8IA 3BCBA 4DQ2A 3JW4A 5IYCJ 3K2ZA 1F5TA 5LRSA 4LGWA 5M3MJ 1SANA 2QZ8A 2DI3A 4GFBA 2YU3A 4C2MJ 1WI9A 2PMHA 4G6TB 3RDIA 2KIMA 3RTRA 4BACA 3C7JA 2QSGX 1KU9A 2M1BA 3I4PA 1XS9A 3BQYA 1PP8F 1SMYF 3WG7H 2R5ZB 3FBNB 4FCYA 4M3DA 3UKGA 2GOMA 1I3AA 2AHQA 2LVSA 2Y75A 1BIBA 1DU6A 1OJLA 3ZN0A 1ZR4A 2KDOA 1S72I 1ZLJA 2CV1A 1E17A 2LKSA 1VQMI 1MBJA 2HDCA 4B43A 2M30A 4XONA 2OD5A 3LA2A 3TQNA 5FD6A 4E70A 2R3SA 2GIZA 5J1YA 2QA4I 1VQOI 1RNLA 4GYIA 3IH4A 1H89C 5EGOA 1BW6A 2BGCA 1LVAA 4I0AA 2FMLA 4MLOA 5CYVA 2ELHA 1YIJI 2WB1N 4HNTA 2P4WA 2X1CA 3J80K 2HXIA 2DA4A 1XMAA 4XN0A 5EZHA 3BP8A 4ZZLA 4HW0A 3ZGKA 4X6AJ 2L9RA 3L09A 4OINF 2V26A 3LMMA 1MH3A 3H9GA 4KITB 4QWQA 1W4MA 1X4OA 3M1EA 4N9IA 1Z9CA 3QYEA 4R8HA 4ZYDA 2ZMEA 3QYFA 3IAS2 3J81K 3FXRA 2JA7J 4OIRF 1FOWA 1A36A 1R5ID 5DCMB 1T95A 1F1ZA 2H1LA 4HX7A 2BXYA 2HOTA 3DBHB 1I27A 2B9SA 1R9TJ 1L0OC 1FOKA 4AIJA 4M6VA 3FK6A 4AC0A 3EYIA 2NS8A 4O3MA 3N4MA 3HUGA 2LY2A 4M72A 4ZC3A 1YYVA 3B73A 3I53A 2HQNA 3D5SC 4JP0A 1P4XA 1W0UA 1Z67A 2XF7A 3DTEA 2L02A 2YU9J 1UB9A 3A0HC 2FE3A 3ASNH 2XASA 1K78A 4P9FA 2QBYA 1O57A 2IVMA 3CUQC 1X3ZB 5D8KB 2PMZA 1WCMJ 2K02A 3LNQA 3LSRA 2W1OA 1MH4A 2FQ3A 2FA5A 3K7AJ 3F22A 3TDUC 3IWFA 4K2EA 4C2UA 4KISA 2DMNA 1FMVA 3VSKA 4YG2F 4S0HB 2O03A 2OQRA 1OISA 2XSJC 3RZOJ 2B63J 1YJNI 3T1BA 3GO5A 1IG7A 4DNCA 3BZ6A 4UUVA 2R4GA 1XCVA 3GTPJ 2DOEA 5GADJ 2YR2A 1FX7A 3JAMK 1VZ0A 2VUMJ 1W5TA 2EJRA 3HJEA 5EZGA 4BJ6C 2HXOA 3U2RA 3GZ6A 2L9NA 4HAMA 5M3FJ 2GQQA 4PZJA 4EMSA 3OYKA 3W2WA 1MMAA 3WTTC 1R1VA 2Y2ZA 3R6SA 1D0ZA 3B02A 3CESA 3OOUA 3DF8A 2ESHA 3C2HA 1V5EA 3F8BA 5CKTA 3KEOA 5DCFA 3S17J 3M07A 4A0YA 3N97A 1ETWA 2G7UA 2QENA 3L2WA 2FRHA 1EH6A 1YE9A 1ITYA 3AL0C 2A05A 3A0BC 1T0FA 2Y69H 3MKLA 2Z16A 1ZARA 2OA4A 3OYHA 5EDNA 3HRSA 1A6QA 4Q4ZF 4GYGA 4DYCA 5BOXA 2RKHA 3ZRGA 4KUMA 3RKQA 3OSGA 1HXDA 3OL4A 1HF0A 1Y6IA 1F36A 3DTKA 2JRMA 2L7KA 3ZQ7A 1YO5C 4XICA 4NB5A 3WGGA 1XX5A 3FKIJ 5JLXA 4YELA 1ON1A 3P9KA 4UVBA 4ZTJA 1ZGJA 4LLLA 4CA0A 4BNCA 5IPAA 4HF1A 4BJTA 2CRGA 4L9JA 3KLNA 3KZZA 2DPUA 3WTSC 3GFJA 4XL9A 3BROA 1IN7A 3JRFA 3BTCA 3DKYA 5DUIA 4G7OF 2P6SA 4JQFA 2XKOA 3BQZA 4MQ9F 4PUSA 4Y3OA 2L3DA 5K1YA 3D1NI 2EV0A 2K85A 3OYCA 1BBYA 4I0BA 2XAJA 1S8NA 4XSZF 1DUXC 3LA3A 2ISZA 3I58A 1OYWA 3K2AA 3CP2A 4IKFA 1QVTA 2IS6A 2VBZA 2F2EA 4P5OA 4XNFA 3VEPA 4U0WA 1YX5A 1S9HA 4UHTA 1TWAJ 4NDLA 2XGEA 3EUHA 2Z99A 9ANTA 1HKSA 1MZBA 3I64A 1LKXA 3K9TA 1KU2A 3C2BA 3ZQHA 3DTIA 3PO3J 3GLXA 3T8RA 2CJJA 1DGRM 3G3ZA 5E8GA 3L1PA 3FKJA 5EEGA 3ERED 4HOBA 5LHIA 1T33A 1O3QA 4OIPF 3GTOJ 3FISA 1Z05A 3W6KB 2Q8KA 2LY9A 4IF4A 4CYCB 3H3ZA 3HXLA 5A2QK 5J1UA 4HNVA 2DODA 4HDVA 3I5UA 2VQLA 5ED4A 4NBQA 2HYFA 4U87A 4HRIA 3OYFA 1R6RA 3ABLH 4EVIA 5TGTA 2VJ5A 4F52A 1JKOC 1D0YA 1JJ8C 3CTAA 4HBLA 4MIMA 3IAM2 1WPKA 1I1SA 1HBXG 1SAXA 3CCQI 4QTRA 4ENNA 3LQRA 2VBYA 4HA8A 3ONQA 1JTXA 4A12A 1AA7A 2IA1A 3HOXJ 4L9TA 4AU7A 1YJ9I 1R5HA 3G1OA 5L3EA 3JSOA 1VQ9I 4A0ZA 1R23A 4YFXF 2W7NA 3ML6A 1TQIA 2DTRA 5CQGA 4RGSA 1BW5A 3S3MA 2M9HA 2DOAA 2GOXB 4NUBA 5J3LA 4HX8A 4HZFA 3E1SA 2P7VB 1MBKA 5J4VA 1GVDA 3H0GJ 4EQQA 4YIIA 1Z91A 3TGNA 1WFXA 2OZUA 4XLFA 4BE0A 2EIJH 4IJAA 1YS6A 2Z1DA 4AIHA 1XMXA 3JRCA 4AM3A 5FRMA 2P5LC 1YHQI 2DDBA 2COMA 4LK1F 3GX4X 3FIWA 1H9TA 3CDLA 5E18F 1BA5A 4LG3A 5CVVA 4RA2A 1ERDA 3DV8A 1X1CA 3V4GA 2KZGA 2NYXA 2ZO4A 4D0PA 1TNSA 4ZDOA 1FJLA 4CUGA 5GPAA 1UMQA 3HOTA 4CYDA 3WGHA 2AS5F 1S29A 2HOEA 4Y33A 3KYDB 2BVLA 2Y0SN 1MSEC 5E20A 4CCOA 4C9YA 1VQ7I 4ON0A 4AYBA 2XB5A 4Y52J 3PFIA 2XKPA 1AWCA 2W84A 2O3FA 2OCEA 3S1RJ 4CZCA 1BIAA 2OPTA 1TP4A 5ICFA 1QPIA 3H9QA 2LYCA 1OPCA 2PBIA 3FXKA 3DU6A 2L9VA 5KNLA 2IXSA 3H36A 3HPHA 3E0JB 1D1BA 3KFWX 1OCCH 4BE1A 1IRZA 1J9IA 1K83J 2M4KA 1XGOA 3K4NA 1P7JA 5ICEA 2KL4A 2EWNA 1SC7A 3ZR8X 2KIFA 2R7DA 3FHNA 2GXBA 5BQTA 2DO7A 3TL4X 2PJRA 1X1PA 3OYJA 1TWFJ 4ZYHA 2YPRA 2X51A 2FNAA 3DQVC 2O8KA 4II2A 1G8XA 1V4RA 1GV2A 2BHZA 2ID6A 2FNPA 2ZMEB 3LSTA 4A3BJ 3FX3A 2D1HA 2QQAA 4B09A 4JX5A 4BAYA 1T0FC 5LGNA 2QSFX 3MEXA 3CCEI 1UG0A 3AG4H 1S7EA 5JVTA 4YRVA 1SFUA 2IA0A 2X6XA 3SFIA 4AIDA 4OOIA 4E7KA 4M71A 3B6CA 2ACJA 2STTA 4HV6A 2Q1ZB 3ASOH 2E34A 3BZKA 2XGXA 3TP0A 3GWZA 5E8IA 3HUGB 2VQGA 3S15J 2KFDA 1SFOJ 2GZWA 1HLVA 4EEFG 1D1CA 2DK8A 2ISYA 3F0CA 1L3LA 2M87A 5EYRA 2ZSHB 2QBYB 4BUPA 1K78B 2H6CA 4BQOA 5F27A 1UG2A 4HLXA 2WY8Q 2AO9A 5LRRA 1H8AC 3ABUA 4XLCA 5HS9A 1Z6TA 2EZIA 4BH9A 5C44J 2HDDA 1TTYA 1Z7LA 4IOCF 4RM2A 3FK7A 4KNYA 2E36A 3JCUC 4U7DA 3FBIB 5M5WJ 3CC2I 2XF6A 2EFWA 4ESJA 2NRAC 3DEEA 3MKZA 1OLTA 1UHWA 1IN6A 2XAGA 2DYRH 1Z3XA 2FBIA 4IZZA 5CVIA 2B0LA 1S6LA 2LREA 2NS7A 4R1HA 1IRXA 1JTYA 2R7OA 1YOVB 2EH3A 3SFZA 5GAGJ 3D0SA 1RZ4A 5DD4A 2HKXA 1TL8A 3TKYA 5J6XA 1LFBA 4PCQA 1O4XA 3NWTA 1J2XA 2UZKA 1LFUP 2HYGD 3H5RA 4Y17A 3OOPA 3S16J 1P92A 2A6TA 2IP2A 3A03A 1GVJA 3A02A 1E3HA 4KA4A 1UHSA 1UJ8A 5LGUA 4XR6A 5HLTA 1QRYA 4HPQA 4BY7J 5HLGA 5HOOA 4L9NA 2RGVA 2JA5J 2GM4A 4D1QA 2QWWA 3E5UA 2ADUA 3AG2H 1FLIA 2OCCH 2QCOA 1A04A 3DXJF 4DW6A 1OR7C 3K4CA 4J01A 1J75A 2HFHA 3X2QH 3JTHA 4KFCA 1U5TC 3F8CA 1GT0C 1LFPA 4EATA 3DBLB 1XB4A 3V42A 1OMIA 3FXMA 2P7CB 4G12A 3CUQA 4LK0F 1YITI 5EG0A 3H0DA 2VE8A 4ETSA 1WJCA 3T8TA 5HDNA 1VQ8I 3LQQA 3BJ6A 4MQVA 2LR8A 2HNHA 2BY1A 3M9AA 4G8XA 2QKMB 5BPDA 2HQ5A 4XRSA 3AFHA 4Z2YA 4ASNA 1W36D 3VYTB 2F4IA 2PMUA 3S8PA 4F91B 2GIVA 3OMYA 4PJ0C 2KIQA 3OYBA 4C2TA 4WX9A 3HOSA 3CUOA 2HZDA 1XSXA 3F8FA 2P8TA 4O6JA 3RI4A 3U9GA 1BJZA 4XQFA 5IYDJ 2Q0OA 3Q0UA 3RPUD 1G3YA 5H20A 2CV2A 1T56A 2LF7A 1ZLKA 3O8HA 5TISC 1EJ9A 2WAEA 1I50J 2J5OA 4C3HJ 5E1ZB 2FXAA 3WTVC 3E7LA 2K9MA 4JBAA 1U3EM 1KA8A 2EIKH 1YFHA 2CUEA 1R71A 3PJRA 1J7KA 1GHCA 2NVXJ 3E6CC 4P96A 2D5VA 5EJCA 2R7ZJ 1YQAA 5FLMJ 2KKOA 2DFEA 2FEZA 1S5LC 1SFXA 1YW9A 4RLQA 1OCRH 2XUBA 4XRFA 2WAQA 2IS1A 1IV8A 1SVLA 2X6OA 5FROA 4IHSA 2W00A 1XMKA 2FF4A 3BPXA 2IGOA 1WJ5A 3HEFA 4HLYA 4H0EA 5E79C 3BG9A 1WJFA 3CCJI 1B9MA 4ZZDA 1ZKGA 3S1QJ 4MHGA 4A69C 3RKXA 2HQRA 2ESNA 3JR9A 2G0EA 2DDAA 2R92J 1TZLA 1T38A 2VXZA 4G7HF 2XRLA 1ZRFA 4N9HA 2ECBA 4YIRX 5DV5A 2PQ8A 3GZNB 2DT6A 1B6AA 3OR2C 3WHCA 3P5JA 1IN4A 2CG4A 2EFQA 1Z1DA 2P0WA 3DEWA 3M8EA 4IHXA 4HQMA 2XPUA 1DDNA 2WY7Q 1G4DA 3IHUA 3LOCA 4DIQA 1U78A 1K79A 2EK5A 3TBIA 4FTHA 2FBHA 4IEJA 4B48A 3G2BA 4JOMA 2A69F 3VB2A 3ZQQA 4AVPA 4UVAA 2QQBA 1JHHA 1Y0NA 3KP3A 3IKVA 1EH7A 3N05A 2LF8A 2MLKA 2EV5A 2QEXI 3LSKA 4EGZA 4OWRB 1LQ1A 2XF5A 1YIOA 5IP7J 1VFCA 2DFHA 4F55A 3OYLA 1A6IA 2JSCA 5HS7A 2JWTA 5D5XB 1ETVA 2RNGA 5L3BA 4GGGA 3ISPA 3QP5A 2ZFUA 4M9SA 5AIPA 3JSPA 2JA2A 2TRTA 4D5FA 5K7FA 1YRNA 1TQMA 1IZ1A 2VQCA 3L2CA 1P9QC 1LB2A 5J8CA 3MZHA 2DK5A 2VL8A 3PFYA 4BXUA 3HL2A 3OL3A 3ZMTA 3K70C 5BMZA 5BPIA 1OYIA 2LOOA 2L4MA 4OAYA 1V5GA 4IQ4A 5L3DA 5EEAA 4UUSA 3KP7A 3GVAA 1B4AA 3WE2A 4KIFA 4M3EA 1X1BA 4DZJA 1FSEA 4AYBN 1X58A 1STZA 1UZCA 2HDWA 3W6JB 3V7RA 3VSLA 4YEJA 1IW7F 1HDPA 2Y30A 3H92A 3BTLA 2WWYA 3ZP5A 3K4BA 1REPC 3CMAI 2ZCWA 1MIJA 2CO5A 3DKWA 3HIFA 3WE3A 2W48A 2VI6A 2HOAA 5D6FA 4RAFA 3ULQB 4EJOA 1O3RA 2VBXA 2OZ6A 2MA3A 4LOCA 5LEJA 1GUUA 3QOPA 2KMUA 3FMRA 2M7BA 4LD5A 2CUZA 1YG2A 2QQ9A 1AHDP 2TCTA 3KIOA 2PJRB 4OIOF 1MJBA 3HOZJ 5FD5A 4XMYA 3ZMUA 2O7OA 3IH3A 2H8RA 2E19A 4XOPA 3MFKA 2VKVA 1P2FA 2E1MC 1F43A 2D1VA 5D8LB 5HODA 4A2UA 4IO9F 3KZIC 3WG9A 4EM1A 1ZH5A 3H3UA 4MEYF 1Q1HA 4CCKA 1HKTA 4Z6YA 2VASA 1RUOA 3CF2A 1ON2A 3CZ6A 3HOYJ 2DMQA 2LK2A 4L9VA 2L7FP 3LAJA 1FYMA 3C18A 4LLNA 2JA8J 5LFAA 3T5XA 1YLFA 5KAFC 4DBRA 4E7SA 1TC3C 1FWZA 3HHGA 4G6DA 4W97A 1USSA 2R7QA 3JRDA 1RUNA 4XKBA 1QHHD 3WTXC 1X2MA 3HOVJ 3LAPA 4D7NA 2VC1A 4OMZA 4UXNA 1U9OA 1MNEA 5CVUA 1NHAA 4CCLA 1WJBA 2FJ1A 3WTWC 3QYBA 2K5CA 4A3GJ 2DBBA 5FLXZ 5TRDA 2JPCA 1U8BA 1X1DA 2XHKA 5IYBJ 2R7XA 2E5ZA 5M5XJ 3DPTA 4KJZA 3L00A 1BJAA 2VJJA 2WV1A 2VIXA 3K0LA 3SEQA 2O8XA 1LUJB 1D5YA 2ICWG 4RMNA 1OCZH 1I3QJ 1ZN2A 1VQLI 1OCTC 2A6HF 3M4OJ 1ZAOA 3Q0WA 4BEHA 1JUPA 3OY9A 3OYMA 5DS9A 1ZGAA 4BBRJ 5DDGA 3HB9A 1YI2I 2BZTA 2Z3YA 3D5RC 3WU2C 3MKWB 3H3VK 3LSMA 4KT6A 2KQRA 3KCCA 5AIQA 4WCGA 1F4KA 3RPUA 1FZPB 4XN3A 1G3WA 4G9YA 4DJAA 1MDMA 4N4OB 1HW2A 4MEXF 1VQ6I 3VOEA 2FX0A 2WAFA 1HSTA 1YS7A 3K70D 2F5DA 2CU7A 4BBSJ 1DP3A 2EBIA 2QYOA 3OYIA 1P4AA 3ABKH 1J09A 3SJMA 1BN5A 2W24A 1TT5B 4FETA 4E7JA 1XTAA 1EV7A 4MNUA 5LHHA 5DM6F 3OR1C 2DCEA 2MGQA 2BOLA 4DYQA 2RQQA 2XC7A 2CWEA 4BDZA 2K3FA 4H4KC 1H0MA 3WHBA 1X3WB 2CYYA 2DXIA 3DLLF 2D45A 3CUQB 4AD9A 2VOPA 5EG0B 1ETOA 1K6YA 4XKVA 2JA6J 1FP1D 5HNHA 2EIMH 5CJ9A 1BC7C 4M3BA 4IOAF 1WI3A 3ZQGA 3ZN1A 2VE9A 1EF4A 2XVCA 5EEHA 4IHTA 3CJTB 3FHZA 1FNNA 1I39A 4E6KG 4KIBA 1TQPA 3EUKL 3OYNA 4UB6C 2LTPA 4MO7A 2RQPA 4BHPA 4E7IA 4NC8A 2UUZA 4UNOA 3J7AY 2L4AA 4CGZA 5DEQA 4E4HA 4WXHA 1U8RA 2F6CA 1CF7A 3F72A 2V7FA 2JZYA 2I8DA 2F4MB 3BG5A 3MVPA 1HDDC 3M3YJ 1JI8A 3JRIA 2F5FA 4A5NA 1ZG1A 5F1RA 2DMTA 3J7YJ 4LIUA 2KLOA 4NQWA 1QNTA 4M3GA 1FYKA 2M5WA 2DOFA 3QPSA 3GYHX 3ZQCA 2X48A 2DJIA 5FKLA 3MZ8A 3TO6A 4BQQA 1FPQA 3AL0B 1XGNA 3AKZA 3HHHA 5FKNA 2PFBA 3ABMH 1WJEA 3KP4A 3OS0A 3I71A 3DLAA 2E1CA 4L5EA 4HQEA 2RN7A 4C30A 3ECOA 2EB7A 2GA2A 1JXSA 3RYRA 2WAQN 2E7WA 3GFLA 1OR7A 1DPRA 3S3OA 1U5TA 2Z5UA 3QU6A 2HPIA 5LD2C 4KMUX 1CGPA 2OF7A 1XSDA 3VDXA 1S7OA 3JRGA 3CCYA 4WF2A 2LKPA 2CSOA 2CGPA 3RCOA 3AG1H 2HWVA 2DA7A 4OAZA 3HKZN 1FBUA 3OIOA 3MQ0A 1D8KA 1BI0A 2VC0A 4OU0A 1V54H 2EFPA 5FKMA 2OTLI 5H2FC 3I54A 1RI7A 3BR3A 1DPUA 4FX0A 1X1AA 4N4NB 3L2VA 2H27A 2ZXJA 1XC5A 1QVUA 1R00A 2Z9OA 4I99C 4ENKA 5C3EJ 4CO8A 4I2OA 1ETYA 2JVGA 1Z21A 3DP7A 5GPCA 4A5MA 1N77A 2EFNA 2M3AA 1U9NA 5IT9K 1K4TA 3D5LA 4AUXA 3QWLA 2DAOA 2L0KA 2XIGA 5HDGA 4RB3C 2E2IJ 4KT5C 3JRHA 4LMYA 2VBWA 1X4PA 3PQJA 3PNVA 1ZG5A 4NC6A 3CQZJ 4F92B 2R5YA 3A01A 2XROA 1Y1VJ 1YRNB 1VNDA 4UB8C 3TO9A 4X1EA 1ODDA 3EDPA 3TW6A 1BR1A 4IXAA 2GWRA 1TT0A 1R49A 5HNFA 3EQLF 5FJ8J 5D6EA 3O3KA 3WTUC 1I6XA 4BXFA 2M0MA 4UUSB 2GLOA 1XGMA 1ZGWA 3GTGJ 2QM3A 1SVMA 2HI3A 3TEDA 2KT0A 1MBEA 4B4CA 4XK4A 4MFEA 1MMNA 3L2UA 2L7MP 3HSFA 1JKRC 2UXXA 1KQ0A 1MJAA 1P7IA 1MBFA 1USTA 2OBPA 5EGOB 1FYLA 2DFFA 4BKXA 1BOBA 4XLNF 2DMUA 3L2RA 2M4GA 2V1XA 1HOMA 2DTZA 1EA3A 1YW8A 3BZCA 1B59A 1X3UA 1MNMC 1WZ2A 3FXQA 2BEOA 3F8MA 3IWZA 2LRDA 2NAZA 3EPZA 2NVQJ 1W36C 3ABTA 4FT8A 1ZR2A 1FP2A 3GZ5A 3ZQLA 5ICGA 2GA1A 3DCFA 4U0YA 4PGGA 2MBFA 3TOBA 2STWA 2DA6A 2CQKA 2PN6A 2I10A 5TJJA 4CDGA 5KHDA 4RAZA 1F9NA 1EH8A 4BQAA 2ELJA 4HYEA 1J0RA 1O7FA 4B3AA 5F6FA 2FD5A 2O6GE 3VWBA 3JTGA 2XGDA 4ENJA 5H6QA 3HPGA 4UVCA 3PM1A 5B1AH 1QZYA 2ZJPF 4MFDA 2G9WA 4QLCU 3Q5FA 3LL7A 2GBYA 3RSNA 3BJOA 4IHVA 1OYYA 4ESBA 3HDDA 2IS2A 2D2WA 3E97A 4A3LJ 2Q2EA 4QPQA 2O5RA 1MD0A 4RBOA 1Z7UA 2GXGA 1W5CC 3VYRB 2MD0A 3M8FA 4PK4A 2DFIA 3BPVA 2DT7B 1TWHJ 3FMQA 2PMZN 3V8JA 1AKHA 1WJDA 3RKYA 2KPMA 2CUJA 1V5FA 4CXFA 4EM2A 3HTSB 4HX4A 3I59A 3IH2A 2WC2A 2FOWA 3BJAA 4D9JA 3ZCOA 1UFMA 1XN7A 4EJVA 1QHGA 2JJ7A 2DQLA 2HYJA 4HEA2 2DMPA 2LFBA 1NTCA 2AQEA 2H94A 3CCLI 3QODA 3GTJJ 2C6YA 3M7GA 2G7HA 5K5RA 1K4SA 4G7ZF 5D5WB 4BE2A 4BEHB 1FBQA 1TW3A 2VPLA 2UXNA 4XKCA 3ECHA 2L5QA 2KIUA 2RC4A 2XAHA 3C1DA 3DWLE 2DYSH 2JN6A 3GMEA 3BLYA 3H9JA 3LSGA 1Y8QB 3MAJA 5GAEJ 3KETA 4TV7A 4QIWN 4MTDA 1KQ9A 2W82A 1WKMA 4BQNA 1R7JA 3IRRA 3HSEA 1SVOA 5IP9J 3A1YA 3NARA 2KRHA 3CP8A 4FE4A 3MN2A 2OC6A 4RB0A 1YW7A 1IDYA 1ETQA 1JT6A 1KYWA 3K4LA 1ORKA 4N0BA 3REOA 5KK1A 1WSUA 3JRBA 1IJWC 5H6RA 3CMYA 1R1UA 1FMWA 1W7PD 1K6OA 2EILH 3H35A 3S93A 4F7ZA 1VTNC 1JGGA 2V79A 2CV0A 4ABZA 3S2WA 1V55H 3BTIA 3SQNA 2KZVA 2HOSA 4RAYA 5LEKA 1DU0A 4S05A 1LDJA 1JUSA 3F6VA 1RETA 1C0WA 3RPQA 1NG6A 4XBFA 3AAFA 3M8JA 1ZK8A 3BG3A 3MMYB 3LSJA 2IAIA 3VYSB 3QOEA 1Y1WJ 3QPLA 4HV5A 1SFEA 5E3MA 3FM5A 1SD6A 1ETXA 4DGWB 3KYCB 3LFKA 5LHGA 5KAIC 2OU2A 3DKXA 3OYEA 2X6YA 2P5KA 1LE8A 4CICA 5J1RA 2BY0A 1CF7B 3Q0VA 3BR2A 4IQJA 4B47A 2ZB9A 4XM3A 2E71A 4L5JA 4JYKA 1IUYA 4KYWA 3I56I 3PSFA 3HOWJ 1QA6A 4NQWB 3NQOA 5DUKA 1IC8A 2X4HA 2DJNA 3P9CA 4HG2A 2Y9ZA 1W1WE 4HSTA 2N8GA 2F5CA 2JRTA 5FRNA 1IF1A 6PAXA 2NOJB 2Y9YA 2P6TA 2BXZA 3HYIA 3K1PA 4BY1J 1I1GA 4IRGA 3QRFF 5JHUA 3IUOA 1Q1VA 4JK1X 3G71I 3KP5A 4E7ZA 1E2XA 3U21A 4XSXF 3ZXSA 4G6QA 1LEAA 3DU5A 2YSRA 3Q3SA 1WVRA 4LFUA 1B9NA 2R0QC 2PJPA 2ZKZA 3HBLA 5DD8A 5GTHC 3LFUA 2B7EA 1U5TB 3EUAA 3HM5A 2W57A 2KDZA 1PVEA 4BU2A 4F93B 5D4SA 1NK2P 1HSJA 2E2JJ 4RGUA 2K27A 3CJNA 3PL8A 3IP4B 1H88C 5JHFA 4IHWA 2BV6A 2O0YA 1B8IA 3BC8A 3I4NJ 4XRMA 3TOAA 5E3LA 2FBKA 3CO6C 2M7AA 2L9SA 3EYYA 2LY1A 4PGHA 5JR3A 3GCMA 4M73A 4C3IJ 2HZTA 1HW5A 3U1DA 3CO7C 1MMGA 4F3QA 5D5VB 1XDUA 4NHJA 1MKMA 4M74A 3J80Z 2LDUA 5E1WA 1ZRDA 1APLC 3PO2J 5LLQA 3OS1A 2LKXA 3S14J 2L54A 1N75A 3LWFA 3VFZA 2A07F 2HKOA 3HOUJ 4XRSG 1XG1A 1IRGA 1VQKI 2CH0A 3BR1A 3HC7A 4XLEA 2FU4A 5EF6A 2GAUA 4KN4X 1HQCA 3UNGC 4A6EA 4GO1A 1X2NA 3J81Z 1R36A 3CCMI 4OIQF 2RNJA 2LBFA 3A01B 2R5YB 3MKYB 4L0ZB 4V19K 4WK8F 3DBRB 2Y48A 4EJTA 5J8FA 2ID3A 4Y13A 2XSDC 4M9XA 1XGSA 3ZOBA 2GXAA 1BM9A 4IHYA 2PX9A 2RV8A 5FFXA 1M1EB 2Y0SA 2ZXIA 4LJZF 3GLLA 2K9QA 2ZSIB 1UAAA 3ELKA 1JKPC 4ZYAA 3F8NA 3I3LA 5BNGA 4GRIA 3PIOF 4RM3A 3K4MA 1NH3A 3DPLC 4ZYGA 2VB6A 3MZYA 2LSOA 3W2VA 3S2DJ 5B1BH 1QO0D 1Y39A 2WTEA 3F23A 4A93J 4PJLA 3SZTA 4YFNF 2MC3A 2VN2A 2OAZA 4UV8A 3GFMA 1W5SA 2V9PA 1LDDA 4A3DJ 4CZZA 3BG6A 2JPBA 2LLKA 2IBDA 1FTTA 4B3XA 3V8KA 2R7TA 2MW8A 3RYPA 3JAMZ 1DGWY 5KVRA 3COAC 2XAQA 3RZDJ 2DW4A 2VT2A 3ESWB 1CQTA 1VQPI 1YTYA 2V1UA 1FBSA 2IGKA 2BVMA 4KIGA 2UV1A 3U1KA 2E5NA 1FSHA 2X85A 4U7BA 2IPQX 3P9IA 1R22A 3QPHA 5FFZA 2DA3A 3BY6A 2W25A 2BW3A 4RB1A 1MBGA 3G1MA 2M34A 3CCRI 2OTJI 2XV4S 2MG4A 3O6BB 2AQFA 4U0VA 1XD7A 1PP7U 2HVSA 4I98B 2XAFA 1MW7A 3R0JA 3L2QA 1GDTA 4E7HA 2LMDA 2RAEA 3HRMA 2F48A 2V4JC 3TW7A 1ACIA 2Q2EB 4BL0B 2RVCA 1A35A 2CW7A 3SEZA 2QSHX 1VQNI 3PNYA 1BI2A 1J5YA 3UR3C 2FMYA 3V7CA 2VODA 2K9SA 5K5QA 3A4CA 2RDPA 2W85A 1GV5A 3NAUA 4DZPA 3ZPLA 3OIQA 2VJ4A 4G94A 1AKHB 1IGNA 1ZHFA 2EFOA 3V8LA 4BJ5C 5B3SH 2MLGA 3Q9VA 1Z3YA 1BR4A 2VPRA 1FOYA 1W7PA 3I59B 2XAUA 2DU9A 4NC7A 2QQ8A 2A3SA 1IUFA 1JUMA 1QGPA 1TBXA 3NRVA 2CQNA 2OUMA 3CCSI 3L7WA 2YX4A 1O7LA 1ZYRF 2CFOA 2E1OA 2H8WA 2X6WA 4I09A 2NNYA 1NG7A 2XRNA 3QPTA 4FQGA 4QSHA 2ZXWH 2QUFA 3KLOA 4LLGF 3IV5A 2A6EF 2M0CA 4XLHA 1XPXA 4CCMA 3ZQIA 2MABA 2BE5F 2QF7A 5HVQC 1FC3A 3IKTA 3ZMVA 3PIPF 3SHFA 4DYRA 3WGIA 5GAHJ 2Z33A 4A6DA 4LIVA 4CHUA 2VXDA 2F5VA 1VF9A 2HGCA 2NOGA 2F5EA 2IRFG 4S04A 2E1MB 3BOQA 2FUG2 3ZMZA 3DFGA 3KP2A 3F6OA 1JHFA 3BTJA 1K7AA 3CCVI 1IAWA 2H09A 1BI3A 4PDKA 1FIAA 3WU0A 1OFCX 4BHCA 3B6AA 4HF2A 4WXCA 1FEXA 4EV0A 3WTYC 1KYZA 4M9ZA 3PQKA 1RPWA 1PUFA 2K7LA 3E5QA 1UELB 4RDUA 3BR5A 4PJMA 4I6ZA 3R4KA 5A2QZ 5IP6A 2L2OA 4QPOA 1KQ8A 1XDSA 5ILSA 1PDNC 2R93J 2LG4A 5J40A 1AU7A 1IXRC 1RR8C 4LB6B 1YJWI 3CMMA 4I76A 4LG0A 2AXLA 2DT5A 4Q5SF 3CDHA 1Y56A 4WXDA 4KN7X 3SYTA 5IT3A 3CLQA 5IY5H 5C4JJ 2VKEA 2XPVA 3O8GA 2OV7A 4OMYA 1FOXA 2FQ4A 3MCZA 1LJ9A 4ITVA 2XDVA 2YS9A 1WRJA 2F4OB 3CC4I 1OQYA 3GUDA 3I0TA 5FLXK 5JLWA 4ZDPA 2MD5A 2VJIA 4EJWA 2HPMA 2LH9A 3BWGA 1SD7A 4AVZA 3S1NJ 3C3WA 5F0CA 2E7XA 1LE8B 4PJJA 1VI0A 1WHUA 2R7WA 2CW0F 3FDYA 3OIPA 3ZMDA 1BR2A 5HLHA 1WH7A 1QBJA 3E6BA 5DYMA 2L7ZA 3H1CA 3OWTA 1MSFC 3NWSA 3OYDA 1ETKA 2VT3A 5ILVA 1TLHB 2JMWA 4Y7NJ 4A3MJ 2K3PA 4UV9A 1BI1A 3F21A 1O3TA 4A3IJ 3F9KA 2ECCA 1D0XA 3ZMSA 4PFOA 3BR6A 3NEUA 2V6CA 4IPAA 5E1XA 3SDGA 3I55I 1HC8A 5IT9Z 5FKKA 4D5CA 1B72A 1HA8A 3S2HJ 2E60A 4GXOA 4Q48A 4GCVA 2LP0A 4B44A 3VODA 1PUEE 1RRJA 1VQ4I 4ZYEA 3C2GA 1W0TA 4FHTA 2Y0MA 2CW8A 3K1MA 5FGMA 4ENMA 3GTKJ 1WWXA 2HTJA 4DOZA 1RR7A 3OYAA 3JRAA 2UWMA 2V9KA 5J47A 5F64A 5E3OA 3GW2A 5F0HA 3S3NA 3PUBA 4YFKF 2O61A 2CQXA 2MYSA 2PI0A 4J00A 2W4SA 3R60A 2A61A 1E3PA 2KRCA 3HZJA 3SZGA 1O3SA 1ZRCA 1HW1A 4L18B 4A3JJ 4ZJZA 2ZFWA 1SEUA 5B5EC 1GXQA 4P1WA 2BHYA 1D3YA 2CMPA 3K4JA 1B8IB 2XGCA 5D5UB 3FF5A 2DN0A 4IRHA 2DPDA 1PYVA 3MD2A 5FKOA 1BL0A 3SDBA 5HLIA 3TDZC 4PJNA 5JFRA 2O9LA 2EQRA 4IVNA 3G4SI 3CLOA 1S3JA 2JTVA 2EZKA 2A5WA 2CS3A 3KYLA 2A68F 1WH5A 5HDKA 2MH2A 2ZC2A 4YIFA 3CD6I 5L3FA 2RREA 2DLLA 4RB2C 4NNJA 5J4YA 2KJBA 1RIOH 5IOYA 3H5AA 2HU9A 3VPRA 4B8XA 4E7LA 4A3FJ 2HEOA 2ZJQF 4P55A 1I6HJ 3E5XA 5K7HA 1PJRA 1SFKA 2ZNZA 1DQUA 1H9GA 2M8GX 2ZMEC 3OV8A 3LSIA 1SMTA 1XCBA 2X1DA 1R4NB 2LBFB 2ZJ2A 3ERMA 2P81A 2AXTC 3PUFA 1T39A 2IGNA 3DEUA 2P5VA 1LPQA 1EKEA 4R79A 2JQ7A 3HRUA 1HCRA 4KICA 1ZELA 2K40A 5LGTA 1KU7A 1QQIA 1R4MB 3HSRA 3RKWA 1UCRA 3RJPA 2I5UA 3ROUA 1LNWA 3BDDA 3KP6A 3FWEA 2ZXHA 4MTEA 4HF0A 4FASD 1HKQA 5CVRA 1T2KA 2R7SA 2R5ZA 1QU3A 2COBA 3Q9SA 5F08A 4M6YA 1GLNA 1MGTA 2QKLB 4FISA 2DA1A 2ETHA 3CC7I 5LBQA 5F04A 2HR3A 1SD5A 1JGSA 3KPHA 2XB0X 1G6NA 5HS8A 2VKDA 4RGXA 2TDXA 1KU3A 1MBHA 3G73A 1BC8C 5CVJA 4XORA 3P7NA 1IDZA 2WB1A 4BGDA 2V1DA 2KRFA 1B1BA 5L3CA 4LB5A 3K1NA 1AOYA 1G3SA 1D1AA 3WTZA 1IRFA 3K4KA 5BS6A 1LEBA 2WBMA 3E6MA 1IN5A 2CQQA 2BYVE 2A5YB 4ZTFA 2J5PA 2DA2A 2BW3B 4I02A 4A3EJ 1R5GA 1RESA 4V2GA 4UUTA 2ME6A 2KISA 1E0EA 1IXSB 4HNUA 1N78A 2V6EA 2WV0A 4HDUA 3GXOA 2IT0A
chains in the Genus database with same CATH topology
3GEZA 1BOAA 1SD4A 5K5OA 1QZZA 5DCMA 2K4JA 2R7FA 1TW2A 3O2PE 2M45A 2HTSA 5FB2A 2VOOA 3KEQA 1QPMA 4U88A 2M8EA 1G3TA 2IA2A 1TNTA 2OQGA 1W7PB 4AWXB 2ZBKA 2PLYA 3FXUA 1V3FA 1GXPA 3FM3A 3HRTA 4RS8A 5FO5A 4IRIA 1OKRA 4I01A 1JE8A 3R0AA 3TO7A 4I7HA 4L5IA 2QVOA 2NS0A 2PEXA 3SXYA 2EA2A 1MDMB 1S7AA 4WWCA 1I5ZA 3QAHA 3EETA 1LDKB 2NNNA 3LA7A 3GF2A 3MWMA 1U6GA 3R61A 1IN8A 1P6RA 1MJ9A 3IRQA 2ZNYA 3T0YA 1KGSA 2KJCA 1ONVA 2HS5A 4LG0B 1D5VA 4P9UA 3RIRA 3E6DA 5L3GA 2PG4A 4L0YB 1FY7A 1R1TA 1ZREA 3HTUA 2FOKA 3QP6A 1T6SA 2EA4A 3WU1B 4O5VA 4FX4A 1XSVA 2YX7A 4EJUA 4MGRA 2L01A 3V7SA 4KDPA 1FT9A 3L9FA 4BYYA 4EGYA 2IW5A 2V9VA 2K4BA 2DQRA 4Q47A 1ULYA 3IC7A 3J7AO 4EM0B 1J59A 3E3VA 1IXCA 1ZG3A 5AONA 2JT1A 3FMSA 4A0XA 1Y0UA 5JI6A 1T98A 2E1NA 2H6BA 5CLSA 4KMFA 4Y15A 5ILUA 1UHMA 2K86A 3SZPA 4ZH4F 2VONA 1Z6RA 4ESFA 1D8JA 3GFIA 2X0LA 5D4RA 4M6XA 3KZYA 3QU3A 3KE2A 2IJLA 4XLPF 5E17F 2FSWA 4RGRA 1U2WA 1R58A 5ICCA 1WQ2A 4AIKA 3IL2A 3K69A 2MH9A 2QLZA 4BHBA 2BBYA 2EV6A 5ERIA 1DP7P 3F3XA 3WODF 2LNBA 1P4WA 3FZVA 2CFXA 4DQ2A 3JW4A 1F5TA 3K2ZA 5LRSA 4LGWA 2QZ8A 2DI3A 2YU3A 1WI9A 2PMHA 3RDIA 2KIMA 3RTRA 3C7JA 1KU9A 2M1BA 3I4PA 1PP8F 1SMYF 2Y75A 1BIBA 3ZN0A 1ZLJA 1E17A 2HDCA 2M30A 3TQNA 2OD5A 3LA2A 5FD6A 4E70A 2R3SA 1RNLA 4GYIA 2BGCA 1LVAA 4I0AA 2FMLA 5CYVA 2ELHA 2P4WA 3J80K 1XMAA 3BP8A 4ZZLA 4HW0A 3L09A 4OINF 4QWQA 1W4MA 3M1EA 4N9IA 1Z9CA 4R8HA 4ZYDA 2ZMEA 3J81K 3FXRA 4OIRF 5DCMB 1F1ZA 4HX7A 1I27A 1L0OC 1FOKA 4AIJA 3EYIA 4O3MA 3N4MA 3HUGA 4M72A 1YYVA 3B73A 3I53A 2HQNA 1P4XA 2L02A 1UB9A 2QBYA 2FE3A 2XASA 1K78A 4P9FA 1O57A 2IVMA 3CUQC 5D8KB 2K02A 2FQ3A 2FA5A 3F22A 3TDUC 3IWFA 4K2EA 4YG2F 2O03A 2OQRA 3T1BA 3GO5A 4DNCA 3BZ6A 4UUVA 1XCVA 2YR2A 1FX7A 3JAMK 1W5TA 2EJRA 3U2RA 3GZ6A 4HAMA 2GQQA 4PZJA 4EMSA 3WTTC 1R1VA 3R6SA 3B02A 2ESHA 3DF8A 3F8BA 3KEOA 5DCFA 4A0YA 3N97A 2G7UA 2QENA 2FRHA 1EH6A 1T0FA 1ZARA 2OA4A 3HRSA 4Q4ZF 4GYGA 5BOXA 2RKHA 4KUMA 1HXDA 3ZQ7A 1YO5C 4NB5A 3WGGA 1ON1A 3P9KA 4UVBA 1ZGJA 4LLLA 4BNCA 4HF1A 4L9JA 3KLNA 3KZZA 2DPUA 3WTSC 3GFJA 3BROA 1IN7A 5DUIA 4G7OF 2P6SA 4JQFA 2XKOA 4MQ9F 2L3DA 5K1YA 2EV0A 1BBYA 4I0BA 2XAJA 1S8NA 4XSZF 1DUXC 3LA3A 2ISZA 3I58A 1OYWA 2VBZA 2F2EA 4P5OA 3VEPA 4U0WA 4UHTA 3EUHA 2Z99A 1HKSA 1MZBA 3I64A 3K9TA 1KU2A 3GLXA 3T8RA 3G3ZA 5E8GA 5EEGA 3ERED 4HOBA 5LHIA 1O3QA 4OIPF 1Z05A 3W6KB 2Q8KA 4IF4A 3H3ZA 5A2QK 4HDVA 3I5UA 5ED4A 2HYFA 4EVIA 3CTAA 4HBLA 1I1SA 1HBXG 1SAXA 4ENNA 3LQRA 2VBYA 4HA8A 4A12A 2IA1A 4L9TA 1R5HA 5L3EA 3JSOA 4A0ZA 1R23A 4YFXF 3ML6A 1TQIA 2DTRA 4RGSA 4HX8A 4HZFA 2P7VB 4EQQA 4YIIA 1Z91A 3TGNA 2OZUA 4IJAA 1YS6A 4AIHA 2P5LC 2COMA 4LK1F 3GX4X 1H9TA 5E18F 5CVVA 3DV8A 3V4GA 2NYXA 2ZO4A 4D0PA 1TNSA 3HOTA 4CYDA 3WGHA 2AS5F 1S29A 2HOEA 5E20A 4ON0A 3PFIA 2XKPA 1AWCA 2W84A 2O3FA 1BIAA 5ICFA 1OPCA 2PBIA 3KFWX 1J9IA 1XGOA 5ICEA 2EWNA 2KIFA 2R7DA 2GXBA 5BQTA 2DO7A 4ZYHA 2YPRA 2FNAA 3DQVC 1V4RA 2FNPA 2ZMEB 3LSTA 3FX3A 2D1HA 2QQAA 4B09A 4BAYA 5LGNA 3MEXA 5JVTA 1SFUA 2IA0A 4OOIA 4M71A 2ACJA 2STTA 4HV6A 2XGXA 5E8IA 3GWZA 2GZWA 2DK8A 2ISYA 1L3LA 2M87A 2QBYB 1K78B 2H6CA 4HLXA 5LRRA 3ABUA 5HS9A 1Z6TA 4BH9A 1TTYA 4KNYA 4U7DA 2EFWA 4ESJA 2NRAC 1UHWA 1IN6A 2XAGA 2FBIA 5CVIA 2B0LA 1S6LA 4R1HA 3SFZA 3D0SA 1RZ4A 5DD4A 2HKXA 3TKYA 5J6XA 4PCQA 1J2XA 2UZKA 2HYGD 4Y17A 3OOPA 1P92A 2IP2A 1GVJA 4KA4A 5LGUA 5HLGA 5HOOA 4L9NA 2RGVA 2QWWA 3E5UA 2ADUA 1FLIA 1A04A 3DXJF 1J75A 2HFHA 3JTHA 4KFCA 1U5TC 3F8CA 1XB4A 1OMIA 2P7CB 4LK0F 3CUQA 2VE8A 4ETSA 3T8TA 5HDNA 3LQQA 3BJ6A 4MQVA 3M9AA 4G8XA 5BPDA 4Z2YA 4ASNA 2PMUA 2GIVA 4WX9A 3HOSA 3CUOA 1XSXA 3F8FA 3RI4A 2P8TA 4O6JA 3U9GA 2Q0OA 1G3YA 5H20A 2LF7A 1ZLKA 2J5OA 5E1ZB 2FXAA 3WTVC 4JBAA 1U3EM 1KA8A 1YFHA 1J7KA 1GHCA 3E6CC 4P96A 1YQAA 2KKOA 2FEZA 1SFXA 1YW9A 2XUBA 4XRFA 4IHSA 1XMKA 2FF4A 3BPXA 4HLYA 4H0EA 1B9MA 4ZZDA 4MHGA 3RKXA 2HQRA 2ESNA 1T38A 2VXZA 4G7HF 1ZRFA 4N9HA 5DV5A 2PQ8A 1B6AA 1IN4A 2CG4A 2EFQA 1Z1DA 3M8EA 4HQMA 1DDNA 1G4DA 3IHUA 1U78A 1K79A 2EK5A 2FBHA 2A69F 3VB2A 4AVPA 4UVAA 2QQBA 1JHHA 3KP3A 3IKVA 1EH7A 2LF8A 2MLKA 2EV5A 4EGZA 1LQ1A 1YIOA 2JSCA 5HS7A 5D5XB 5L3BA 4GGGA 3ISPA 3QP5A 4M9SA 5AIPA 3JSPA 1TQMA 1IZ1A 3L2CA 1LB2A 5J8CA 3MZHA 2DK5A 4BXUA 3ZMTA 5BMZA 5BPIA 1OYIA 2L4MA 5L3DA 3KP7A 3GVAA 1B4AA 3WE2A 4KIFA 1FSEA 1STZA 3W6JB 3V7RA 1IW7F 3H92A 2WWYA 3ZP5A 1REPC 2ZCWA 2CO5A 3DKWA 3HIFA 3WE3A 5D6FA 3ULQB 4EJOA 1O3RA 2VBXA 2OZ6A 2MA3A 5LEJA 3QOPA 3FMRA 4LD5A 1YG2A 2QQ9A 4OIOF 1MJBA 5FD5A 3ZMUA 3MFKA 1P2FA 2D1VA 5D8LB 4A2UA 3WG9A 4EM1A 1ZH5A 3H3UA 4MEYF 1Q1HA 1HKTA 1RUOA 1ON2A 4L9VA 3LAJA 1FYMA 3C18A 4LLNA 3T5XA 1YLFA 1FWZA 3HHGA 4G6DA 1USSA 1RUNA 3WTXC 3LAPA 2VC1A 4OMZA 4UXNA 3WTWC 5CVUA 1NHAA 2DBBA 5FLXZ 5TRDA 2JPCA 2XHKA 3DPTA 3L00A 1BJAA 3K0LA 2O8XA 1ZN2A 2A6HF 1ZAOA 1ZGAA 5DDGA 2Z3YA 3KCCA 5AIQA 4WCGA 1F4KA 3RPUA 1FZPB 1G3WA 4G9YA 1MDMA 1HW2A 4MEXF 3VOEA 1HSTA 1YS7A 2F5DA 2QYOA 1P4AA 1BN5A 2W24A 1EV7A 4MNUA 5LHHA 2CWEA 1H0MA 2CYYA 2D45A 3CUQB 4AD9A 2VOPA 1FP1D 5CJ9A 1BC7C 3ZN1A 2VE9A 2XVCA 5EEHA 4IHTA 3FHZA 1FNNA 4KIBA 1TQPA 2RQPA 4BHPA 4UNOA 2L4AA 4CGZA 5DEQA 4WXHA 1U8RA 1CF7A 3F72A 2JZYA 2F5FA 4A5NA 1ZG1A 5F1RA 4NQWA 1QNTA 1FYKA 2M5WA 3GYHX 3TO6A 1FPQA 1XGNA 3HHHA 2PFBA 3KP4A 3I71A 2E1CA 4HQEA 2RN7A 3ECOA 2EB7A 2GA2A 1JXSA 3RYRA 2E7WA 3GFLA 1OR7A 1DPRA 1U5TA 2Z5UA 3QU6A 1CGPA 4KMUX 1XSDA 1S7OA 4WF2A 2LKPA 2CSOA 2CGPA 2HWVA 1FBUA 3MQ0A 1D8KA 1BI0A 2VC0A 4OU0A 2EFPA 3I54A 1RI7A 1DPUA 4FX0A 2H27A 2ZXJA 1R00A 2Z9OA 4ENKA 4CO8A 4I2OA 3DP7A 4A5MA 2EFNA 5IT9K 3D5LA 2DAOA 2XIGA 5HDGA 4RB3C 4KT5C 4LMYA 2VBWA 3PQJA 1ZG5A 2XROA 3TO9A 1ODDA 3EDPA 4IXAA 2GWRA 3EQLF 5D6EA 3O3KA 3WTUC 1I6XA 1XGMA 2QM3A 3HSFA 2UXXA 1KQ0A 1MJAA 2OBPA 1USTA 1FYLA 4XLNF 2V1XA 1YW8A 1B59A 1X3UA 3FXQA 2BEOA 3F8MA 3IWZA 2NAZA 3ABTA 4FT8A 1FP2A 3GZ5A 5ICGA 2GA1A 4U0YA 4PGGA 2MBFA 3TOBA 2STWA 2CQKA 2PN6A 5TJJA 4CDGA 4RAZA 1F9NA 1EH8A 4BQAA 4HYEA 1J0RA 1O7FA 5F6FA 2O6GE 3JTGA 4ENJA 5H6QA 4UVCA 1QZYA 2G9WA 4QLCU 3Q5FA 3BJOA 1OYYA 4ESBA 2D2WA 3E97A 2Q2EA 1MD0A 1Z7UA 2GXGA 3M8FA 2DFIA 3BPVA 3FMQA 3V8JA 3RKYA 4CXFA 4EM2A 3HTSB 4HX4A 3I59A 2WC2A 3BJAA 1XN7A 1UFMA 4EJVA 2DQLA 2H94A 2C6YA 3M7GA 2G7HA 5K5RA 4G7ZF 5D5WB 1FBQA 1TW3A 2UXNA 3ECHA 2KIUA 2RC4A 2XAHA 3C1DA 3MAJA 3KETA 4TV7A 4MTDA 1KQ9A 1WKMA 1R7JA 3IRRA 3HSEA 4RB0A 1YW7A 1KYWA 4N0BA 3REOA 5KK1A 1WSUA 5H6RA 1R1UA 1W7PD 1K6OA 4F7ZA 1VTNC 2V79A 3S2WA 3SQNA 4RAYA 5LEKA 4S05A 1LDJA 3F6VA 1C0WA 3RPQA 4XBFA 3AAFA 4HV5A 1SFEA 3FM5A 1SD6A 3LFKA 5LHGA 2OU2A 2P5KA 4CICA 1CF7B 4L5JA 1IUYA 4KYWA 3NQOA 5DUKA 2X4HA 3P9CA 2F5CA 2JRTA 1IF1A 6PAXA 2P6TA 3K1PA 3HYIA 1I1GA 4IRGA 3QRFF 5JHUA 4JK1X 3KP5A 1E2XA 4XSXF 4G6QA 1LEAA 2YSRA 4LFUA 1B9NA 2PJPA 2ZKZA 5DD8A 1U5TB 2W57A 5D4SA 1HSJA 4RGUA 2K27A 3CJNA 2BV6A 2O0YA 3TOAA 2FBKA 3CO6C 3EYYA 4PGHA 5JR3A 4M73A 2HZTA 1HW5A 3U1DA 3CO7C 5D5VB 1XDUA 4NHJA 1MKMA 4M74A 3J80Z 2LDUA 5E1WA 1ZRDA 5LLQA 2L54A 3LWFA 3VFZA 2A07F 2HKOA 1IRGA 2FU4A 2GAUA 4KN4X 1HQCA 4A6EA 4GO1A 3J81Z 1R36A 4OIQF 2RNJA 4L0ZB 4WK8F 2Y48A 4EJTA 5J8FA 4Y13A 4M9XA 1XGSA 1BM9A 2RV8A 5FFXA 4LJZF 3ELKA 3F8NA 3DPLC 4ZYGA 3MZYA 2LSOA 1QO0D 2WTEA 3F23A 3SZTA 4YFNF 2MC3A 2VN2A 2OAZA 4UV8A 3GFMA 1W5SA 1LDDA 4CZZA 2JPBA 3V8KA 3RYPA 3JAMZ 5KVRA 3COAC 2XAQA 2DW4A 2VT2A 2V1UA 1YTYA 1FBSA 4KIGA 1FSHA 4U7BA 2IPQX 3P9IA 1R22A 3QPHA 5FFZA 3BY6A 2W25A 4RB1A 2XV4S 3O6BB 4U0VA 1XD7A 1PP7U 4I98B 2XAFA 3R0JA 3HRMA 2RVCA 1BI2A 1J5YA 2FMYA 3V7CA 2VODA 5K5QA 2RDPA 2W85A 3ZPLA 4G94A 1ZHFA 2EFOA 3V8LA 2MLGA 3Q9VA 1W7PA 3I59B 2DU9A 2A3SA 1QGPA 3NRVA 1TBXA 3L7WA 2YX4A 1O7LA 1ZYRF 4I09A 2NNYA 2XRNA 3QPTA 2QUFA 3KLOA 4LLGF 2A6EF 3IKTA 2BE5F 5HVQC 1FC3A 3ZMVA 3SHFA 3WGIA 2Z33A 4A6DA 4CHUA 2HGCA 2F5EA 2IRFG 4S04A 3BOQA 3ZMZA 3DFGA 3KP2A 3F6OA 1JHFA 1K7AA 1IAWA 2H09A 1BI3A 4PDKA 3WU0A 4BHCA 4HF2A 4WXCA 4EV0A 3WTYC 1KYZA 4M9ZA 3PQKA 2K7LA 3E5QA 3R4KA 5A2QZ 1KQ8A 1XDSA 5ILSA 1PDNC 1IXRC 4LB6B 4LG0A 2AXLA 2DT5A 4Q5SF 3CDHA 4WXDA 4KN7X 5IT3A 4OMYA 3MCZA 1LJ9A 1WRJA 3GUDA 3I0TA 5FLXK 2MD5A 4EJWA 3BWGA 1SD7A 3C3WA 2E7XA 2CW0F 5HLHA 3ZMDA 1QBJA 3E6BA 5DYMA 2VT3A 5ILVA 1TLHB 4UV9A 1BI1A 3F21A 1O3TA 3ZMSA 3NEUA 2V6CA 4IPAA 5E1XA 5IT9Z 4GXOA 4Q48A 4GCVA 3VODA 1PUEE 4ZYEA 4FHTA 2Y0MA 3K1MA 5FGMA 4ENMA 1WWXA 2HTJA 2UWMA 5F64A 3GW2A 4YFKF 2O61A 2PI0A 3R60A 2A61A 1ZRCA 1O3SA 4L18B 1HW1A 2ZFWA 1GXQA 1D3YA 5D5UB 3FF5A 4IRHA 2DPDA 5HLIA 3TDZC 5JFRA 4IVNA 3CLOA 1S3JA 2JTVA 2A68F 5HDKA 2MH2A 4YIFA 5L3FA 2DLLA 4RB2C 2KJBA 1RIOH 4B8XA 2HEOA 4P55A 3E5XA 2ZNZA 1H9GA 3OV8A 1SMTA 1XCBA 2ZJ2A 1T39A 3DEUA 2P5VA 4R79A 3HRUA 4KICA 5LGTA 1KU7A 1QQIA 3HSRA 3RKWA 1UCRA 3RJPA 3ROUA 1LNWA 3BDDA 3KP6A 3FWEA 4MTEA 4HF0A 1HKQA 5CVRA 1T2KA 3Q9SA 4M6YA 1MGTA 2ETHA 5LBQA 2HR3A 1SD5A 1JGSA 1G6NA 5HS8A 4RGXA 2TDXA 1KU3A 3G73A 1BC8C 5CVJA 3P7NA 2V1DA 2KRFA 1B1BA 5L3CA 4LB5A 3K1NA 1AOYA 1G3SA 3WTZA 1IRFA 5BS6A 1LEBA 3E6MA 1IN5A 2BYVE 2A5YB 2J5PA 4I02A 1R5GA 1IXSB 2WV0A 4HDUA 3GXOA 2IT0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GEZ A;  1BOA A;  1SD4 A;  5K5O A;  1QZZ A;  5DCM A;  2K4J A;  2R7F A;  1TW2 A;  3O2P E;  2M45 A;  2HTS A;  5FB2 A;  2VOO A;  3KEQ A;  1QPM A;  4U88 A;  2M8E A;  1G3T A;  2IA2 A;  1TNT A;  2OQG A;  1W7P B;  4AWX B;  2ZBK A;  2PLY A;  3FXU A;  1V3F A;  1GXP A;  3FM3 A;  3HRT A;  4RS8 A;  5FO5 A;  4IRI A;  1OKR A;  4I01 A;  1JE8 A;  3R0A A;  3TO7 A;  4I7H A;  4L5I A;  2QVO A;  2NS0 A;  2PEX A;  3SXY A;  2EA2 A;  1MDM B;  1S7A A;  4WWC A;  1I5Z A;  3QAH A;  3EET A;  1LDK B;  2NNN A;  3LA7 A;  3GF2 A;  3MWM A;  1U6G A;  3R61 A;  1IN8 A;  1P6R A;  1MJ9 A;  3IRQ A;  2ZNY A;  3T0Y A;  1KGS A;  2KJC A;  1ONV A;  2HS5 A;  4LG0 B;  1D5V A;  4P9U A;  3RIR A;  3E6D A;  5L3G A;  2PG4 A;  4L0Y B;  1FY7 A;  1R1T A;  1ZRE A;  3HTU A;  2FOK A;  3QP6 A;  1T6S A;  2EA4 A;  3WU1 B;  4O5V A;  4FX4 A;  1XSV A;  2YX7 A;  4EJU A;  4MGR A;  2L01 A;  3V7S A;  4KDP A;  1FT9 A;  3L9F A;  4BYY A;  4EGY A;  2IW5 A;  2V9V A;  2K4B A;  2DQR A;  4Q47 A;  1ULY A;  3IC7 A;  3J7A O;  4EM0 B;  1J59 A;  3E3V A;  1IXC A;  1ZG3 A;  5AON A;  2JT1 A;  3FMS A;  4A0X A;  1Y0U A;  5JI6 A;  1T98 A;  2E1N A;  2H6B A;  5CLS A;  4KMF A;  4Y15 A;  5ILU A;  1UHM A;  2K86 A;  3SZP A;  4ZH4 F;  2VON A;  1Z6R A;  4ESF A;  1D8J A;  3GFI A;  2X0L A;  5D4R A;  4M6X A;  3KZY A;  3QU3 A;  3KE2 A;  2IJL A;  4XLP F;  5E17 F;  2FSW A;  4RGR A;  1U2W A;  1R58 A;  5ICC A;  1WQ2 A;  4AIK A;  3IL2 A;  3K69 A;  2MH9 A;  2QLZ A;  4BHB A;  2BBY A;  2EV6 A;  5ERI A;  1DP7 P;  3F3X A;  3WOD F;  2LNB A;  1P4W A;  3FZV A;  2CFX A;  4DQ2 A;  3JW4 A;  1F5T A;  3K2Z A;  5LRS A;  4LGW A;  2QZ8 A;  2DI3 A;  2YU3 A;  1WI9 A;  2PMH A;  3RDI A;  2KIM A;  3RTR A;  3C7J A;  1KU9 A;  2M1B A;  3I4P A;  1PP8 F;  1SMY F;  2Y75 A;  1BIB A;  3ZN0 A;  1ZLJ A;  1E17 A;  2HDC A;  2M30 A;  3TQN A;  2OD5 A;  3LA2 A;  5FD6 A;  4E70 A;  2R3S A;  1RNL A;  4GYI A;  2BGC A;  1LVA A;  4I0A A;  2FML A;  5CYV A;  2ELH A;  2P4W A;  3J80 K;  1XMA A;  3BP8 A;  4ZZL A;  4HW0 A;  3L09 A;  4OIN F;  4QWQ A;  1W4M A;  3M1E A;  4N9I A;  1Z9C A;  4R8H A;  4ZYD A;  2ZME A;  3J81 K;  3FXR A;  4OIR F;  5DCM B;  1F1Z A;  4HX7 A;  1I27 A;  1L0O C;  1FOK A;  4AIJ A;  3EYI A;  4O3M A;  3N4M A;  3HUG A;  4M72 A;  1YYV A;  3B73 A;  3I53 A;  2HQN A;  1P4X A;  2L02 A;  1UB9 A;  2QBY A;  2FE3 A;  2XAS A;  1K78 A;  4P9F A;  1O57 A;  2IVM A;  3CUQ C;  5D8K B;  2K02 A;  2FQ3 A;  2FA5 A;  3F22 A;  3TDU C;  3IWF A;  4K2E A;  4YG2 F;  2O03 A;  2OQR A;  3T1B A;  3GO5 A;  4DNC A;  3BZ6 A;  4UUV A;  1XCV A;  2YR2 A;  1FX7 A;  3JAM K;  1W5T A;  2EJR A;  3U2R A;  3GZ6 A;  4HAM A;  2GQQ A;  4PZJ A;  4EMS A;  3WTT C;  1R1V A;  3R6S A;  3B02 A;  2ESH A;  3DF8 A;  3F8B A;  3KEO A;  5DCF A;  4A0Y A;  3N97 A;  2G7U A;  2QEN A;  2FRH A;  1EH6 A;  1T0F A;  1ZAR A;  2OA4 A;  3HRS A;  4Q4Z F;  4GYG A;  5BOX A;  2RKH A;  4KUM A;  1HXD A;  3ZQ7 A;  1YO5 C;  4NB5 A;  3WGG A;  1ON1 A;  3P9K A;  4UVB A;  1ZGJ A;  4LLL A;  4BNC A;  4HF1 A;  4L9J A;  3KLN A;  3KZZ A;  2DPU A;  3WTS C;  3GFJ A;  3BRO A;  1IN7 A;  5DUI A;  4G7O F;  2P6S A;  4JQF A;  2XKO A;  4MQ9 F;  2L3D A;  5K1Y A;  2EV0 A;  1BBY A;  4I0B A;  2XAJ A;  1S8N A;  4XSZ F;  1DUX C;  3LA3 A;  2ISZ A;  3I58 A;  1OYW A;  2VBZ A;  2F2E A;  4P5O A;  3VEP A;  4U0W A;  4UHT A;  3EUH A;  2Z99 A;  1HKS A;  1MZB A;  3I64 A;  3K9T A;  1KU2 A;  3GLX A;  3T8R A;  3G3Z A;  5E8G A;  5EEG A;  3ERE D;  4HOB A;  5LHI A;  1O3Q A;  4OIP F;  1Z05 A;  3W6K B;  2Q8K A;  4IF4 A;  3H3Z A;  5A2Q K;  4HDV A;  3I5U A;  5ED4 A;  2HYF A;  4EVI A;  3CTA A;  4HBL A;  1I1S A;  1HBX G;  1SAX A;  4ENN A;  3LQR A;  2VBY A;  4HA8 A;  4A12 A;  2IA1 A;  4L9T A;  1R5H A;  5L3E A;  3JSO A;  4A0Z A;  1R23 A;  4YFX F;  3ML6 A;  1TQI A;  2DTR A;  4RGS A;  4HX8 A;  4HZF A;  2P7V B;  4EQQ A;  4YII A;  1Z91 A;  3TGN A;  2OZU A;  4IJA A;  1YS6 A;  4AIH A;  2P5L C;  2COM A;  4LK1 F;  3GX4 X;  1H9T A;  5E18 F;  5CVV A;  3DV8 A;  3V4G A;  2NYX A;  2ZO4 A;  4D0P A;  1TNS A;  3HOT A;  4CYD A;  3WGH A;  2AS5 F;  1S29 A;  2HOE A;  5E20 A;  4ON0 A;  3PFI A;  2XKP A;  1AWC A;  2W84 A;  2O3F A;  1BIA A;  5ICF A;  1OPC A;  2PBI A;  3KFW X;  1J9I A;  1XGO A;  5ICE A;  2EWN A;  2KIF A;  2R7D A;  2GXB A;  5BQT A;  2DO7 A;  4ZYH A;  2YPR A;  2FNA A;  3DQV C;  1V4R A;  2FNP A;  2ZME B;  3LST A;  3FX3 A;  2D1H A;  2QQA A;  4B09 A;  4BAY A;  5LGN A;  3MEX A;  5JVT A;  1SFU A;  2IA0 A;  4OOI A;  4M71 A;  2ACJ A;  2STT A;  4HV6 A;  2XGX A;  5E8I A;  3GWZ A;  2GZW A;  2DK8 A;  2ISY A;  1L3L A;  2M87 A;  2QBY B;  1K78 B;  2H6C A;  4HLX A;  5LRR A;  3ABU A;  5HS9 A;  1Z6T A;  4BH9 A;  1TTY A;  4KNY A;  4U7D A;  2EFW A;  4ESJ A;  2NRA C;  1UHW A;  1IN6 A;  2XAG A;  2FBI A;  5CVI A;  2B0L A;  1S6L A;  4R1H A;  3SFZ A;  3D0S A;  1RZ4 A;  5DD4 A;  2HKX A;  3TKY A;  5J6X A;  4PCQ A;  1J2X A;  2UZK A;  2HYG D;  4Y17 A;  3OOP A;  1P92 A;  2IP2 A;  1GVJ A;  4KA4 A;  5LGU A;  5HLG A;  5HOO A;  4L9N A;  2RGV A;  2QWW A;  3E5U A;  2ADU A;  1FLI A;  1A04 A;  3DXJ F;  1J75 A;  2HFH A;  3JTH A;  4KFC A;  1U5T C;  3F8C A;  1XB4 A;  1OMI A;  2P7C B;  4LK0 F;  3CUQ A;  2VE8 A;  4ETS A;  3T8T A;  5HDN A;  3LQQ A;  3BJ6 A;  4MQV A;  3M9A A;  4G8X A;  5BPD A;  4Z2Y A;  4ASN A;  2PMU A;  2GIV A;  4WX9 A;  3HOS A;  3CUO A;  1XSX A;  3F8F A;  3RI4 A;  2P8T A;  4O6J A;  3U9G A;  2Q0O A;  1G3Y A;  5H20 A;  2LF7 A;  1ZLK A;  2J5O A;  5E1Z B;  2FXA A;  3WTV C;  4JBA A;  1U3E M;  1KA8 A;  1YFH A;  1J7K A;  1GHC A;  3E6C C;  4P96 A;  1YQA A;  2KKO A;  2FEZ A;  1SFX A;  1YW9 A;  2XUB A;  4XRF A;  4IHS A;  1XMK A;  2FF4 A;  3BPX A;  4HLY A;  4H0E A;  1B9M A;  4ZZD A;  4MHG A;  3RKX A;  2HQR A;  2ESN A;  1T38 A;  2VXZ A;  4G7H F;  1ZRF A;  4N9H A;  5DV5 A;  2PQ8 A;  1B6A A;  1IN4 A;  2CG4 A;  2EFQ A;  1Z1D A;  3M8E A;  4HQM A;  1DDN A;  1G4D A;  3IHU A;  1U78 A;  1K79 A;  2EK5 A;  2FBH A;  2A69 F;  3VB2 A;  4AVP A;  4UVA A;  2QQB A;  1JHH A;  3KP3 A;  3IKV A;  1EH7 A;  2LF8 A;  2MLK A;  2EV5 A;  4EGZ A;  1LQ1 A;  1YIO A;  2JSC A;  5HS7 A;  5D5X B;  5L3B A;  4GGG A;  3ISP A;  3QP5 A;  4M9S A;  5AIP A;  3JSP A;  1TQM A;  1IZ1 A;  3L2C A;  1LB2 A;  5J8C A;  3MZH A;  2DK5 A;  4BXU A;  3ZMT A;  5BMZ A;  5BPI A;  1OYI A;  2L4M A;  5L3D A;  3KP7 A;  3GVA A;  1B4A A;  3WE2 A;  4KIF A;  1FSE A;  1STZ A;  3W6J B;  3V7R A;  1IW7 F;  3H92 A;  2WWY A;  3ZP5 A;  1REP C;  2ZCW A;  2CO5 A;  3DKW A;  3HIF A;  3WE3 A;  5D6F A;  3ULQ B;  4EJO A;  1O3R A;  2VBX A;  2OZ6 A;  2MA3 A;  5LEJ A;  3QOP A;  3FMR A;  4LD5 A;  1YG2 A;  2QQ9 A;  4OIO F;  1MJB A;  5FD5 A;  3ZMU A;  3MFK A;  1P2F A;  2D1V A;  5D8L B;  4A2U A;  3WG9 A;  4EM1 A;  1ZH5 A;  3H3U A;  4MEY F;  1Q1H A;  1HKT A;  1RUO A;  1ON2 A;  4L9V A;  3LAJ A;  1FYM A;  3C18 A;  4LLN A;  3T5X A;  1YLF A;  1FWZ A;  3HHG A;  4G6D A;  1USS A;  1RUN A;  3WTX C;  3LAP A;  2VC1 A;  4OMZ A;  4UXN A;  3WTW C;  5CVU A;  1NHA A;  2DBB A;  5FLX Z;  5TRD A;  2JPC A;  2XHK A;  3DPT A;  3L00 A;  1BJA A;  3K0L A;  2O8X A;  1ZN2 A;  2A6H F;  1ZAO A;  1ZGA A;  5DDG A;  2Z3Y A;  3KCC A;  5AIQ A;  4WCG A;  1F4K A;  3RPU A;  1FZP B;  1G3W A;  4G9Y A;  1MDM A;  1HW2 A;  4MEX F;  3VOE A;  1HST A;  1YS7 A;  2F5D A;  2QYO A;  1P4A A;  1BN5 A;  2W24 A;  1EV7 A;  4MNU A;  5LHH A;  2CWE A;  1H0M A;  2CYY A;  2D45 A;  3CUQ B;  4AD9 A;  2VOP A;  1FP1 D;  5CJ9 A;  1BC7 C;  3ZN1 A;  2VE9 A;  2XVC A;  5EEH A;  4IHT A;  3FHZ A;  1FNN A;  4KIB A;  1TQP A;  2RQP A;  4BHP A;  4UNO A;  2L4A A;  4CGZ A;  5DEQ A;  4WXH A;  1U8R A;  1CF7 A;  3F72 A;  2JZY A;  2F5F A;  4A5N A;  1ZG1 A;  5F1R A;  4NQW A;  1QNT A;  1FYK A;  2M5W A;  3GYH X;  3TO6 A;  1FPQ A;  1XGN A;  3HHH A;  2PFB A;  3KP4 A;  3I71 A;  2E1C A;  4HQE A;  2RN7 A;  3ECO A;  2EB7 A;  2GA2 A;  1JXS A;  3RYR A;  2E7W A;  3GFL A;  1OR7 A;  1DPR A;  1U5T A;  2Z5U A;  3QU6 A;  1CGP A;  4KMU X;  1XSD A;  1S7O A;  4WF2 A;  2LKP A;  2CSO A;  2CGP A;  2HWV A;  1FBU A;  3MQ0 A;  1D8K A;  1BI0 A;  2VC0 A;  4OU0 A;  2EFP A;  3I54 A;  1RI7 A;  1DPU A;  4FX0 A;  2H27 A;  2ZXJ A;  1R00 A;  2Z9O A;  4ENK A;  4CO8 A;  4I2O A;  3DP7 A;  4A5M A;  2EFN A;  5IT9 K;  3D5L A;  2DAO A;  2XIG A;  5HDG A;  4RB3 C;  4KT5 C;  4LMY A;  2VBW A;  3PQJ A;  1ZG5 A;  2XRO A;  3TO9 A;  1ODD A;  3EDP A;  4IXA A;  2GWR A;  3EQL F;  5D6E A;  3O3K A;  3WTU C;  1I6X A;  1XGM A;  2QM3 A;  3HSF A;  2UXX A;  1KQ0 A;  1MJA A;  2OBP A;  1UST A;  1FYL A;  4XLN F;  2V1X A;  1YW8 A;  1B59 A;  1X3U A;  3FXQ A;  2BEO A;  3F8M A;  3IWZ A;  2NAZ A;  3ABT A;  4FT8 A;  1FP2 A;  3GZ5 A;  5ICG A;  2GA1 A;  4U0Y A;  4PGG A;  2MBF A;  3TOB A;  2STW A;  2CQK A;  2PN6 A;  5TJJ A;  4CDG A;  4RAZ A;  1F9N A;  1EH8 A;  4BQA A;  4HYE A;  1J0R A;  1O7F A;  5F6F A;  2O6G E;  3JTG A;  4ENJ A;  5H6Q A;  4UVC A;  1QZY A;  2G9W A;  4QLC U;  3Q5F A;  3BJO A;  1OYY A;  4ESB A;  2D2W A;  3E97 A;  2Q2E A;  1MD0 A;  1Z7U A;  2GXG A;  3M8F A;  2DFI A;  3BPV A;  3FMQ A;  3V8J A;  3RKY A;  4CXF A;  4EM2 A;  3HTS B;  4HX4 A;  3I59 A;  2WC2 A;  3BJA A;  1XN7 A;  1UFM A;  4EJV A;  2DQL A;  2H94 A;  2C6Y A;  3M7G A;  2G7H A;  5K5R A;  4G7Z F;  5D5W B;  1FBQ A;  1TW3 A;  2UXN A;  3ECH A;  2KIU A;  2RC4 A;  2XAH A;  3C1D A;  3MAJ A;  3KET A;  4TV7 A;  4MTD A;  1KQ9 A;  1WKM A;  1R7J A;  3IRR A;  3HSE A;  4RB0 A;  1YW7 A;  1KYW A;  4N0B A;  3REO A;  5KK1 A;  1WSU A;  5H6R A;  1R1U A;  1W7P D;  1K6O A;  4F7Z A;  1VTN C;  2V79 A;  3S2W A;  3SQN A;  4RAY A;  5LEK A;  4S05 A;  1LDJ A;  3F6V A;  1C0W A;  3RPQ A;  4XBF A;  3AAF A;  4HV5 A;  1SFE A;  3FM5 A;  1SD6 A;  3LFK A;  5LHG A;  2OU2 A;  2P5K A;  4CIC A;  1CF7 B;  4L5J A;  1IUY A;  4KYW A;  3NQO A;  5DUK A;  2X4H A;  3P9C A;  2F5C A;  2JRT A;  1IF1 A;  6PAX A;  2P6T A;  3K1P A;  3HYI A;  1I1G A;  4IRG A;  3QRF F;  5JHU A;  4JK1 X;  3KP5 A;  1E2X A;  4XSX F;  4G6Q A;  1LEA A;  2YSR A;  4LFU A;  1B9N A;  2PJP A;  2ZKZ A;  5DD8 A;  1U5T B;  2W57 A;  5D4S A;  1HSJ A;  4RGU A;  2K27 A;  3CJN A;  2BV6 A;  2O0Y A;  3TOA A;  2FBK A;  3CO6 C;  3EYY A;  4PGH A;  5JR3 A;  4M73 A;  2HZT A;  1HW5 A;  3U1D A;  3CO7 C;  5D5V B;  1XDU A;  4NHJ A;  1MKM A;  4M74 A;  3J80 Z;  2LDU A;  5E1W A;  1ZRD A;  5LLQ A;  2L54 A;  3LWF A;  3VFZ A;  2A07 F;  2HKO A;  1IRG A;  2FU4 A;  2GAU A;  4KN4 X;  1HQC A;  4A6E A;  4GO1 A;  3J81 Z;  1R36 A;  4OIQ F;  2RNJ A;  4L0Z B;  4WK8 F;  2Y48 A;  4EJT A;  5J8F A;  4Y13 A;  4M9X A;  1XGS A;  1BM9 A;  2RV8 A;  5FFX A;  4LJZ F;  3ELK A;  3F8N A;  3DPL C;  4ZYG A;  3MZY A;  2LSO A;  1QO0 D;  2WTE A;  3F23 A;  3SZT A;  4YFN F;  2MC3 A;  2VN2 A;  2OAZ A;  4UV8 A;  3GFM A;  1W5S A;  1LDD A;  4CZZ A;  2JPB A;  3V8K A;  3RYP A;  3JAM Z;  5KVR A;  3COA C;  2XAQ A;  2DW4 A;  2VT2 A;  2V1U A;  1YTY A;  1FBS A;  4KIG A;  1FSH A;  4U7B A;  2IPQ X;  3P9I A;  1R22 A;  3QPH A;  5FFZ A;  3BY6 A;  2W25 A;  4RB1 A;  2XV4 S;  3O6B B;  4U0V A;  1XD7 A;  1PP7 U;  4I98 B;  2XAF A;  3R0J A;  3HRM A;  2RVC A;  1BI2 A;  1J5Y A;  2FMY A;  3V7C A;  2VOD A;  5K5Q A;  2RDP A;  2W85 A;  3ZPL A;  4G94 A;  1ZHF A;  2EFO A;  3V8L A;  2MLG A;  3Q9V A;  1W7P A;  3I59 B;  2DU9 A;  2A3S A;  1QGP A;  3NRV A;  1TBX A;  3L7W A;  2YX4 A;  1O7L A;  1ZYR F;  4I09 A;  2NNY A;  2XRN A;  3QPT A;  2QUF A;  3KLO A;  4LLG F;  2A6E F;  3IKT A;  2BE5 F;  5HVQ C;  1FC3 A;  3ZMV A;  3SHF A;  3WGI A;  2Z33 A;  4A6D A;  4CHU A;  2HGC A;  2F5E A;  2IRF G;  4S04 A;  3BOQ A;  3ZMZ A;  3DFG A;  3KP2 A;  3F6O A;  1JHF A;  1K7A A;  1IAW A;  2H09 A;  1BI3 A;  4PDK A;  3WU0 A;  4BHC A;  4HF2 A;  4WXC A;  4EV0 A;  3WTY C;  1KYZ A;  4M9Z A;  3PQK A;  2K7L A;  3E5Q A;  3R4K A;  5A2Q Z;  1KQ8 A;  1XDS A;  5ILS A;  1PDN C;  1IXR C;  4LB6 B;  4LG0 A;  2AXL A;  2DT5 A;  4Q5S F;  3CDH A;  4WXD A;  4KN7 X;  5IT3 A;  4OMY A;  3MCZ A;  1LJ9 A;  1WRJ A;  3GUD A;  3I0T A;  5FLX K;  2MD5 A;  4EJW A;  3BWG A;  1SD7 A;  3C3W A;  2E7X A;  2CW0 F;  5HLH A;  3ZMD A;  1QBJ A;  3E6B A;  5DYM A;  2VT3 A;  5ILV A;  1TLH B;  4UV9 A;  1BI1 A;  3F21 A;  1O3T A;  3ZMS A;  3NEU A;  2V6C A;  4IPA A;  5E1X A;  5IT9 Z;  4GXO A;  4Q48 A;  4GCV A;  3VOD A;  1PUE E;  4ZYE A;  4FHT A;  2Y0M A;  3K1M A;  5FGM A;  4ENM A;  1WWX A;  2HTJ A;  2UWM A;  5F64 A;  3GW2 A;  4YFK F;  2O61 A;  2PI0 A;  3R60 A;  2A61 A;  1ZRC A;  1O3S A;  4L18 B;  1HW1 A;  2ZFW A;  1GXQ A;  1D3Y A;  5D5U B;  3FF5 A;  4IRH A;  2DPD A;  5HLI A;  3TDZ C;  5JFR A;  4IVN A;  3CLO A;  1S3J A;  2JTV A;  2A68 F;  5HDK A;  2MH2 A;  4YIF A;  5L3F A;  2DLL A;  4RB2 C;  2KJB A;  1RIO H;  4B8X A;  2HEO A;  4P55 A;  3E5X A;  2ZNZ A;  1H9G A;  3OV8 A;  1SMT A;  1XCB A;  2ZJ2 A;  1T39 A;  3DEU A;  2P5V A;  4R79 A;  3HRU A;  4KIC A;  5LGT A;  1KU7 A;  1QQI A;  3HSR A;  3RKW A;  1UCR A;  3RJP A;  3ROU A;  1LNW A;  3BDD A;  3KP6 A;  3FWE A;  4MTE A;  4HF0 A;  1HKQ A;  5CVR A;  1T2K A;  3Q9S A;  4M6Y A;  1MGT A;  2ETH A;  5LBQ A;  2HR3 A;  1SD5 A;  1JGS A;  1G6N A;  5HS8 A;  4RGX A;  2TDX A;  1KU3 A;  3G73 A;  1BC8 C;  5CVJ A;  3P7N A;  2V1D A;  2KRF A;  1B1B A;  5L3C A;  4LB5 A;  3K1N A;  1AOY A;  1G3S A;  3WTZ A;  1IRF A;  5BS6 A;  1LEB A;  3E6M A;  1IN5 A;  2BYV E;  2A5Y B;  2J5P A;  4I02 A;  1R5G A;  1IXS B;  2WV0 A;  4HDU A;  3GXO A;  2IT0 A; 
#chains in the Genus database with same CATH topology
 5KCM A;  4X0G A;  3GEZ A;  1BOA A;  4RAG A;  2M2E A;  2VQH A;  4ZDL A;  1POG A;  1SD4 A;  1QZZ A;  3W3C A;  5K5O A;  1A5J A;  5DCM A;  4PFP A;  2K4J A;  2R7F A;  1TW2 A;  3O2P E;  2M45 A;  1NK3 P;  2HTS A;  5FB2 A;  2VOO A;  4HSR A;  3OS2 A;  3KEQ A;  3K6G A;  5CPR B;  2JK3 A;  1QPM A;  4U88 A;  2M8E A;  3GTQ J;  1MMD A;  1G3T A;  3I4M J;  2CQ7 A;  4JX6 A;  2KP6 A;  2IA2 A;  2EZL A;  1TNT A;  1ZTR A;  3S1M J;  2OQG A;  1W7P B;  4AWX B;  2ZBK A;  4B1R A;  2LC2 A;  4XKW A;  3FXU A;  4C3J J;  2PLY A;  1V3F A;  4A3C J;  3DPU A;  3PSI A;  3W2A A;  1GXP A;  3FM3 A;  2KHM A;  3HRT A;  1TWG J;  4RS8 A;  5FO5 A;  4IRI A;  1JJ6 C;  4GDF A;  1OKR A;  4I01 A;  2BY3 A;  4M3F A;  2MFZ A;  5F0F A;  1JE8 A;  5GP9 A;  3R0A A;  3RQ4 A;  3TO7 A;  5FLV A;  3H5N A;  4I7H A;  4L5I A;  2QVO A;  2NS0 A;  1QZE A;  3K10 A;  5M5Y J;  2NVU B;  1JKQ C;  2PEX A;  2R7V A;  3SXY A;  3I9V 2;  2EA2 A;  1KZH A;  1G59 A;  4XLA A;  1VQ5 I;  3EUH C;  1MDM B;  1S7A A;  4WWC A;  1I5Z A;  1OCP A;  4CCN A;  3OSF A;  3G1L A;  3QAH A;  4JX4 A;  1FTZ A;  3TMO A;  3EET A;  1LDK B;  2NNN A;  2XPW A;  3LA7 A;  2JUG A;  4IX7 A;  3GF2 A;  3MWM A;  1U6G A;  2JSP A;  1PUF B;  3R61 A;  5C4X J;  1IN8 A;  2OJE D;  3KEY A;  1RKW A;  2QGU A;  1P6R A;  1MJ9 A;  3IRQ A;  1RKT A;  2ZNY A;  4XOT A;  3T0Y A;  3VYU B;  4BS9 A;  3M1C A;  1KGS A;  3LSP A;  1Y8R B;  2Z2S B;  2KJC A;  1ONV A;  2HS5 A;  4LG0 B;  4CH7 A;  3BCA A;  2NVT J;  1D5V A;  4P9U A;  1ZQ3 P;  3LSH A;  5GTI C;  1JT0 A;  3RIR A;  3W6V A;  2EZH A;  3E6D A;  4V2F A;  1E3O C;  5L3G A;  2PG4 A;  4L0Y B;  1FY7 A;  3AG3 H;  1Z77 A;  4BDY A;  1R1T A;  1ZRE A;  5F1J A;  3HTU A;  2V1N A;  2FOK A;  3QP6 A;  2YUS A;  3GBG A;  1T6S A;  2EA4 A;  3WU1 B;  4O5V A;  4FX4 A;  1XSV A;  3GTL J;  2IEK A;  2NVY J;  2YX7 A;  2ZJR F;  3HGY A;  2DA5 A;  1ENH A;  4EJU A;  1IO2 A;  1LVK A;  4MGR A;  1G2H A;  2MSY A;  2L01 A;  3FXO A;  1FIP A;  1TWC J;  3V7S A;  2LD5 A;  2Y31 A;  2EPF A;  4KDP A;  1FT9 A;  2EIN H;  3L9F A;  4BYY A;  4ANJ A;  4EGY A;  2IW5 A;  2V9V A;  4XID A;  2K4B A;  2WA0 A;  2ELK A;  2DQR A;  3CJR B;  4D7M A;  1YX3 A;  4Q47 A;  1A31 A;  1ULY A;  3IC7 A;  3J7A O;  3CME I;  1WJA A;  4EM0 B;  1J59 A;  2K9N A;  3E3V A;  3CDI A;  2VKH A;  4DBQ A;  5DM7 F;  1IXC A;  4FE7 A;  1B72 B;  4LIT A;  3TP3 A;  1T08 B;  1ZG3 A;  1U0J A;  5AON A;  2JT1 A;  3FMS A;  3BG7 A;  3BT9 A;  3ZQF A;  5JVG F;  4A0X A;  1Y0U A;  1X19 A;  4CCJ A;  5JI6 A;  2IS4 A;  1IV6 A;  1T98 A;  2E1N A;  2H6B A;  5CLS A;  5B66 C;  2E2H J;  4KMF A;  4Y15 A;  5ILU A;  1UHM A;  3QQA A;  2K86 A;  3RQI A;  3SZP A;  2MC4 A;  4RLF A;  4W1U A;  2JVH A;  1MND A;  4ZH4 F;  4CYC A;  1Z6R A;  3CCU I;  2VON A;  1KON A;  1SAU A;  4ESF A;  1D8J A;  3GFI A;  2HVR A;  4II3 A;  2BY2 A;  3G6E I;  2X0L A;  5E3N A;  1N25 A;  1MMS A;  3FXL A;  1Z0X A;  2H1K A;  2IGM A;  2ME0 A;  5D4R A;  4M6X A;  3KZY A;  3QU3 A;  5K7Z A;  5CQE A;  1WGX A;  3KE2 A;  4PSW A;  2K9L A;  2JUC A;  2IJL A;  2NXN B;  4Y4R A;  3J7Z I;  4XLP F;  5E17 F;  3GTM J;  3HKZ A;  2X9D A;  2X1E A;  3HG9 A;  2FSW A;  3S32 A;  4RGR A;  1U2W A;  1R58 A;  2HQA A;  5ICC A;  1WQ2 A;  4CSW A;  4AIK A;  2CUF A;  3JRE A;  1RC9 A;  3IL2 A;  3CF5 F;  4UY8 I;  3K69 A;  2MH9 A;  2QLZ A;  4J19 A;  4BHB A;  3PNT A;  4A3K J;  2BBY A;  2EV6 A;  5ERI A;  1DP7 P;  3F3X A;  2VLA A;  3BR0 A;  3WOD F;  3CJQ B;  2E35 A;  2LNB A;  4PSX A;  4BXX J;  2R7R A;  1K61 A;  5DTD A;  4IL6 C;  5IOZ A;  1OCO H;  1P4W A;  3FZV A;  3HGG A;  3KX2 A;  2HVQ A;  2WAD A;  3A2K A;  2R7U A;  2CFX A;  3OYG A;  3FXJ A;  1T8I A;  3BCB A;  4DQ2 A;  3JW4 A;  5IYC J;  3K2Z A;  1F5T A;  5LRS A;  4LGW A;  5M3M J;  1SAN A;  2QZ8 A;  2DI3 A;  4GFB A;  2YU3 A;  4C2M J;  1WI9 A;  2PMH A;  4G6T B;  3RDI A;  2KIM A;  3RTR A;  4BAC A;  3C7J A;  2QSG X;  1KU9 A;  2M1B A;  3I4P A;  1XS9 A;  3BQY A;  1PP8 F;  1SMY F;  3WG7 H;  2R5Z B;  3FBN B;  4FCY A;  4M3D A;  3UKG A;  2GOM A;  1I3A A;  2AHQ A;  2LVS A;  2Y75 A;  1BIB A;  1DU6 A;  1OJL A;  3ZN0 A;  1ZR4 A;  2KDO A;  1S72 I;  1ZLJ A;  2CV1 A;  1E17 A;  2LKS A;  1VQM I;  1MBJ A;  2HDC A;  4B43 A;  2M30 A;  4XON A;  2OD5 A;  3LA2 A;  3TQN A;  5FD6 A;  4E70 A;  2R3S A;  2GIZ A;  5J1Y A;  2QA4 I;  1VQO I;  1RNL A;  4GYI A;  3IH4 A;  1H89 C;  5EGO A;  1BW6 A;  2BGC A;  1LVA A;  4I0A A;  2FML A;  4MLO A;  5CYV A;  2ELH A;  1YIJ I;  2WB1 N;  4HNT A;  2P4W A;  2X1C A;  3J80 K;  2HXI A;  2DA4 A;  1XMA A;  4XN0 A;  5EZH A;  3BP8 A;  4ZZL A;  4HW0 A;  3ZGK A;  4X6A J;  2L9R A;  3L09 A;  4OIN F;  2V26 A;  3LMM A;  1MH3 A;  3H9G A;  4KIT B;  4QWQ A;  1W4M A;  1X4O A;  3M1E A;  4N9I A;  1Z9C A;  3QYE A;  4R8H A;  4ZYD A;  2ZME A;  3QYF A;  3IAS 2;  3J81 K;  3FXR A;  2JA7 J;  4OIR F;  1FOW A;  1A36 A;  1R5I D;  5DCM B;  1T95 A;  1F1Z A;  2H1L A;  4HX7 A;  2BXY A;  2HOT A;  3DBH B;  1I27 A;  2B9S A;  1R9T J;  1L0O C;  1FOK A;  4AIJ A;  4M6V A;  3FK6 A;  4AC0 A;  3EYI A;  2NS8 A;  4O3M A;  3N4M A;  3HUG A;  2LY2 A;  4M72 A;  4ZC3 A;  1YYV A;  3B73 A;  3I53 A;  2HQN A;  3D5S C;  4JP0 A;  1P4X A;  1W0U A;  1Z67 A;  2XF7 A;  3DTE A;  2L02 A;  2YU9 J;  1UB9 A;  3A0H C;  2FE3 A;  3ASN H;  2XAS A;  1K78 A;  4P9F A;  2QBY A;  1O57 A;  2IVM A;  3CUQ C;  1X3Z B;  5D8K B;  2PMZ A;  1WCM J;  2K02 A;  3LNQ A;  3LSR A;  2W1O A;  1MH4 A;  2FQ3 A;  2FA5 A;  3K7A J;  3F22 A;  3TDU C;  3IWF A;  4K2E A;  4C2U A;  4KIS A;  2DMN A;  1FMV A;  3VSK A;  4YG2 F;  4S0H B;  2O03 A;  2OQR A;  1OIS A;  2XSJ C;  3RZO J;  2B63 J;  1YJN I;  3T1B A;  3GO5 A;  1IG7 A;  4DNC A;  3BZ6 A;  4UUV A;  2R4G A;  1XCV A;  3GTP J;  2DOE A;  5GAD J;  2YR2 A;  1FX7 A;  3JAM K;  1VZ0 A;  2VUM J;  1W5T A;  2EJR A;  3HJE A;  5EZG A;  4BJ6 C;  2HXO A;  3U2R A;  3GZ6 A;  2L9N A;  4HAM A;  5M3F J;  2GQQ A;  4PZJ A;  4EMS A;  3OYK A;  3W2W A;  1MMA A;  3WTT C;  1R1V A;  2Y2Z A;  3R6S A;  1D0Z A;  3B02 A;  3CES A;  3OOU A;  3DF8 A;  2ESH A;  3C2H A;  1V5E A;  3F8B A;  5CKT A;  3KEO A;  5DCF A;  3S17 J;  3M07 A;  4A0Y A;  3N97 A;  1ETW A;  2G7U A;  2QEN A;  3L2W A;  2FRH A;  1EH6 A;  1YE9 A;  1ITY A;  3AL0 C;  2A05 A;  3A0B C;  1T0F A;  2Y69 H;  3MKL A;  2Z16 A;  1ZAR A;  2OA4 A;  3OYH A;  5EDN A;  3HRS A;  1A6Q A;  4Q4Z F;  4GYG A;  4DYC A;  5BOX A;  2RKH A;  3ZRG A;  4KUM A;  3RKQ A;  3OSG A;  1HXD A;  3OL4 A;  1HF0 A;  1Y6I A;  1F36 A;  3DTK A;  2JRM A;  2L7K A;  3ZQ7 A;  1YO5 C;  4XIC A;  4NB5 A;  3WGG A;  1XX5 A;  3FKI J;  5JLX A;  4YEL A;  1ON1 A;  3P9K A;  4UVB A;  4ZTJ A;  1ZGJ A;  4LLL A;  4CA0 A;  4BNC A;  5IPA A;  4HF1 A;  4BJT A;  2CRG A;  4L9J A;  3KLN A;  3KZZ A;  2DPU A;  3WTS C;  3GFJ A;  4XL9 A;  3BRO A;  1IN7 A;  3JRF A;  3BTC A;  3DKY A;  5DUI A;  4G7O F;  2P6S A;  4JQF A;  2XKO A;  3BQZ A;  4MQ9 F;  4PUS A;  4Y3O A;  2L3D A;  5K1Y A;  3D1N I;  2EV0 A;  2K85 A;  3OYC A;  1BBY A;  4I0B A;  2XAJ A;  1S8N A;  4XSZ F;  1DUX C;  3LA3 A;  2ISZ A;  3I58 A;  1OYW A;  3K2A A;  3CP2 A;  4IKF A;  1QVT A;  2IS6 A;  2VBZ A;  2F2E A;  4P5O A;  4XNF A;  3VEP A;  4U0W A;  1YX5 A;  1S9H A;  4UHT A;  1TWA J;  4NDL A;  2XGE A;  3EUH A;  2Z99 A;  9ANT A;  1HKS A;  1MZB A;  3I64 A;  1LKX A;  3K9T A;  1KU2 A;  3C2B A;  3ZQH A;  3DTI A;  3PO3 J;  3GLX A;  3T8R A;  2CJJ A;  1DGR M;  3G3Z A;  5E8G A;  3L1P A;  3FKJ A;  5EEG A;  3ERE D;  4HOB A;  5LHI A;  1T33 A;  1O3Q A;  4OIP F;  3GTO J;  3FIS A;  1Z05 A;  3W6K B;  2Q8K A;  2LY9 A;  4IF4 A;  4CYC B;  3H3Z A;  3HXL A;  5A2Q K;  5J1U A;  4HNV A;  2DOD A;  4HDV A;  3I5U A;  2VQL A;  5ED4 A;  4NBQ A;  2HYF A;  4U87 A;  4HRI A;  3OYF A;  1R6R A;  3ABL H;  4EVI A;  5TGT A;  2VJ5 A;  4F52 A;  1JKO C;  1D0Y A;  1JJ8 C;  3CTA A;  4HBL A;  4MIM A;  3IAM 2;  1WPK A;  1I1S A;  1HBX G;  1SAX A;  3CCQ I;  4QTR A;  4ENN A;  3LQR A;  2VBY A;  4HA8 A;  3ONQ A;  1JTX A;  4A12 A;  1AA7 A;  2IA1 A;  3HOX J;  4L9T A;  4AU7 A;  1YJ9 I;  1R5H A;  3G1O A;  5L3E A;  3JSO A;  1VQ9 I;  4A0Z A;  1R23 A;  4YFX F;  2W7N A;  3ML6 A;  1TQI A;  2DTR A;  5CQG A;  4RGS A;  1BW5 A;  3S3M A;  2M9H A;  2DOA A;  2GOX B;  4NUB A;  5J3L A;  4HX8 A;  4HZF A;  3E1S A;  2P7V B;  1MBK A;  5J4V A;  1GVD A;  3H0G J;  4EQQ A;  4YII A;  1Z91 A;  3TGN A;  1WFX A;  2OZU A;  4XLF A;  4BE0 A;  2EIJ H;  4IJA A;  1YS6 A;  2Z1D A;  4AIH A;  1XMX A;  3JRC A;  4AM3 A;  5FRM A;  2P5L C;  1YHQ I;  2DDB A;  2COM A;  4LK1 F;  3GX4 X;  3FIW A;  1H9T A;  3CDL A;  5E18 F;  1BA5 A;  4LG3 A;  5CVV A;  4RA2 A;  1ERD A;  3DV8 A;  1X1C A;  3V4G A;  2KZG A;  2NYX A;  2ZO4 A;  4D0P A;  1TNS A;  4ZDO A;  1FJL A;  4CUG A;  5GPA A;  1UMQ A;  3HOT A;  4CYD A;  3WGH A;  2AS5 F;  1S29 A;  2HOE A;  4Y33 A;  3KYD B;  2BVL A;  2Y0S N;  1MSE C;  5E20 A;  4CCO A;  4C9Y A;  1VQ7 I;  4ON0 A;  4AYB A;  2XB5 A;  4Y52 J;  3PFI A;  2XKP A;  1AWC A;  2W84 A;  2O3F A;  2OCE A;  3S1R J;  4CZC A;  1BIA A;  2OPT A;  1TP4 A;  5ICF A;  1QPI A;  3H9Q A;  2LYC A;  1OPC A;  2PBI A;  3FXK A;  3DU6 A;  2L9V A;  5KNL A;  2IXS A;  3H36 A;  3HPH A;  3E0J B;  1D1B A;  3KFW X;  1OCC H;  4BE1 A;  1IRZ A;  1J9I A;  1K83 J;  2M4K A;  1XGO A;  3K4N A;  1P7J A;  5ICE A;  2KL4 A;  2EWN A;  1SC7 A;  3ZR8 X;  2KIF A;  2R7D A;  3FHN A;  2GXB A;  5BQT A;  2DO7 A;  3TL4 X;  2PJR A;  1X1P A;  3OYJ A;  1TWF J;  4ZYH A;  2YPR A;  2X51 A;  2FNA A;  3DQV C;  2O8K A;  4II2 A;  1G8X A;  1V4R A;  1GV2 A;  2BHZ A;  2ID6 A;  2FNP A;  2ZME B;  3LST A;  4A3B J;  3FX3 A;  2D1H A;  2QQA A;  4B09 A;  4JX5 A;  4BAY A;  1T0F C;  5LGN A;  2QSF X;  3MEX A;  3CCE I;  1UG0 A;  3AG4 H;  1S7E A;  5JVT A;  4YRV A;  1SFU A;  2IA0 A;  2X6X A;  3SFI A;  4AID A;  4OOI A;  4E7K A;  4M71 A;  3B6C A;  2ACJ A;  2STT A;  4HV6 A;  2Q1Z B;  3ASO H;  2E34 A;  3BZK A;  2XGX A;  3TP0 A;  3GWZ A;  5E8I A;  3HUG B;  2VQG A;  3S15 J;  2KFD A;  1SFO J;  2GZW A;  1HLV A;  4EEF G;  1D1C A;  2DK8 A;  2ISY A;  3F0C A;  1L3L A;  2M87 A;  5EYR A;  2ZSH B;  2QBY B;  4BUP A;  1K78 B;  2H6C A;  4BQO A;  5F27 A;  1UG2 A;  4HLX A;  2WY8 Q;  2AO9 A;  5LRR A;  1H8A C;  3ABU A;  4XLC A;  5HS9 A;  1Z6T A;  2EZI A;  4BH9 A;  5C44 J;  2HDD A;  1TTY A;  1Z7L A;  4IOC F;  4RM2 A;  3FK7 A;  4KNY A;  2E36 A;  3JCU C;  4U7D A;  3FBI B;  5M5W J;  3CC2 I;  2XF6 A;  2EFW A;  4ESJ A;  2NRA C;  3DEE A;  3MKZ A;  1OLT A;  1UHW A;  1IN6 A;  2XAG A;  2DYR H;  1Z3X A;  2FBI A;  4IZZ A;  5CVI A;  2B0L A;  1S6L A;  2LRE A;  2NS7 A;  4R1H A;  1IRX A;  1JTY A;  2R7O A;  1YOV B;  2EH3 A;  3SFZ A;  5GAG J;  3D0S A;  1RZ4 A;  5DD4 A;  2HKX A;  1TL8 A;  3TKY A;  5J6X A;  1LFB A;  4PCQ A;  1O4X A;  3NWT A;  1J2X A;  2UZK A;  1LFU P;  2HYG D;  3H5R A;  4Y17 A;  3OOP A;  3S16 J;  1P92 A;  2A6T A;  2IP2 A;  3A03 A;  1GVJ A;  3A02 A;  1E3H A;  4KA4 A;  1UHS A;  1UJ8 A;  5LGU A;  4XR6 A;  5HLT A;  1QRY A;  4HPQ A;  4BY7 J;  5HLG A;  5HOO A;  4L9N A;  2RGV A;  2JA5 J;  2GM4 A;  4D1Q A;  2QWW A;  3E5U A;  2ADU A;  3AG2 H;  1FLI A;  2OCC H;  2QCO A;  1A04 A;  3DXJ F;  4DW6 A;  1OR7 C;  3K4C A;  4J01 A;  1J75 A;  2HFH A;  3X2Q H;  3JTH A;  4KFC A;  1U5T C;  3F8C A;  1GT0 C;  1LFP A;  4EAT A;  3DBL B;  1XB4 A;  3V42 A;  1OMI A;  3FXM A;  2P7C B;  4G12 A;  3CUQ A;  4LK0 F;  1YIT I;  5EG0 A;  3H0D A;  2VE8 A;  4ETS A;  1WJC A;  3T8T A;  5HDN A;  1VQ8 I;  3LQQ A;  3BJ6 A;  4MQV A;  2LR8 A;  2HNH A;  2BY1 A;  3M9A A;  4G8X A;  2QKM B;  5BPD A;  2HQ5 A;  4XRS A;  3AFH A;  4Z2Y A;  4ASN A;  1W36 D;  3VYT B;  2F4I A;  2PMU A;  3S8P A;  4F91 B;  2GIV A;  3OMY A;  4PJ0 C;  2KIQ A;  3OYB A;  4C2T A;  4WX9 A;  3HOS A;  3CUO A;  2HZD A;  1XSX A;  3F8F A;  2P8T A;  4O6J A;  3RI4 A;  3U9G A;  1BJZ A;  4XQF A;  5IYD J;  2Q0O A;  3Q0U A;  3RPU D;  1G3Y A;  5H20 A;  2CV2 A;  1T56 A;  2LF7 A;  1ZLK A;  3O8H A;  5TIS C;  1EJ9 A;  2WAE A;  1I50 J;  2J5O A;  4C3H J;  5E1Z B;  2FXA A;  3WTV C;  3E7L A;  2K9M A;  4JBA A;  1U3E M;  1KA8 A;  2EIK H;  1YFH A;  2CUE A;  1R71 A;  3PJR A;  1J7K A;  1GHC A;  2NVX J;  3E6C C;  4P96 A;  2D5V A;  5EJC A;  2R7Z J;  1YQA A;  5FLM J;  2KKO A;  2DFE A;  2FEZ A;  1S5L C;  1SFX A;  1YW9 A;  4RLQ A;  1OCR H;  2XUB A;  4XRF A;  2WAQ A;  2IS1 A;  1IV8 A;  1SVL A;  2X6O A;  5FRO A;  4IHS A;  2W00 A;  1XMK A;  2FF4 A;  3BPX A;  2IGO A;  1WJ5 A;  3HEF A;  4HLY A;  4H0E A;  5E79 C;  3BG9 A;  1WJF A;  3CCJ I;  1B9M A;  4ZZD A;  1ZKG A;  3S1Q J;  4MHG A;  4A69 C;  3RKX A;  2HQR A;  2ESN A;  3JR9 A;  2G0E A;  2DDA A;  2R92 J;  1TZL A;  1T38 A;  2VXZ A;  4G7H F;  2XRL A;  1ZRF A;  4N9H A;  2ECB A;  4YIR X;  5DV5 A;  2PQ8 A;  3GZN B;  2DT6 A;  1B6A A;  3OR2 C;  3WHC A;  3P5J A;  1IN4 A;  2CG4 A;  2EFQ A;  1Z1D A;  2P0W A;  3DEW A;  3M8E A;  4IHX A;  4HQM A;  2XPU A;  1DDN A;  2WY7 Q;  1G4D A;  3IHU A;  3LOC A;  4DIQ A;  1U78 A;  1K79 A;  2EK5 A;  3TBI A;  4FTH A;  2FBH A;  4IEJ A;  4B48 A;  3G2B A;  4JOM A;  2A69 F;  3VB2 A;  3ZQQ A;  4AVP A;  4UVA A;  2QQB A;  1JHH A;  1Y0N A;  3KP3 A;  3IKV A;  1EH7 A;  3N05 A;  2LF8 A;  2MLK A;  2EV5 A;  2QEX I;  3LSK A;  4EGZ A;  4OWR B;  1LQ1 A;  2XF5 A;  1YIO A;  5IP7 J;  1VFC A;  2DFH A;  4F55 A;  3OYL A;  1A6I A;  2JSC A;  5HS7 A;  2JWT A;  5D5X B;  1ETV A;  2RNG A;  5L3B A;  4GGG A;  3ISP A;  3QP5 A;  2ZFU A;  4M9S A;  5AIP A;  3JSP A;  2JA2 A;  2TRT A;  4D5F A;  5K7F A;  1YRN A;  1TQM A;  1IZ1 A;  2VQC A;  3L2C A;  1P9Q C;  1LB2 A;  5J8C A;  3MZH A;  2DK5 A;  2VL8 A;  3PFY A;  4BXU A;  3HL2 A;  3OL3 A;  3ZMT A;  3K70 C;  5BMZ A;  5BPI A;  1OYI A;  2LOO A;  2L4M A;  4OAY A;  1V5G A;  4IQ4 A;  5L3D A;  5EEA A;  4UUS A;  3KP7 A;  3GVA A;  1B4A A;  3WE2 A;  4KIF A;  4M3E A;  1X1B A;  4DZJ A;  1FSE A;  4AYB N;  1X58 A;  1STZ A;  1UZC A;  2HDW A;  3W6J B;  3V7R A;  3VSL A;  4YEJ A;  1IW7 F;  1HDP A;  2Y30 A;  3H92 A;  3BTL A;  2WWY A;  3ZP5 A;  3K4B A;  1REP C;  3CMA I;  2ZCW A;  1MIJ A;  2CO5 A;  3DKW A;  3HIF A;  3WE3 A;  2W48 A;  2VI6 A;  2HOA A;  5D6F A;  4RAF A;  3ULQ B;  4EJO A;  1O3R A;  2VBX A;  2OZ6 A;  2MA3 A;  4LOC A;  5LEJ A;  1GUU A;  3QOP A;  2KMU A;  3FMR A;  2M7B A;  4LD5 A;  2CUZ A;  1YG2 A;  2QQ9 A;  1AHD P;  2TCT A;  3KIO A;  2PJR B;  4OIO F;  1MJB A;  3HOZ J;  5FD5 A;  4XMY A;  3ZMU A;  2O7O A;  3IH3 A;  2H8R A;  2E19 A;  4XOP A;  3MFK A;  2VKV A;  1P2F A;  2E1M C;  1F43 A;  2D1V A;  5D8L B;  5HOD A;  4A2U A;  4IO9 F;  3KZI C;  3WG9 A;  4EM1 A;  1ZH5 A;  3H3U A;  4MEY F;  1Q1H A;  4CCK A;  1HKT A;  4Z6Y A;  2VAS A;  1RUO A;  3CF2 A;  1ON2 A;  3CZ6 A;  3HOY J;  2DMQ A;  2LK2 A;  4L9V A;  2L7F P;  3LAJ A;  1FYM A;  3C18 A;  4LLN A;  2JA8 J;  5LFA A;  3T5X A;  1YLF A;  5KAF C;  4DBR A;  4E7S A;  1TC3 C;  1FWZ A;  3HHG A;  4G6D A;  4W97 A;  1USS A;  2R7Q A;  3JRD A;  1RUN A;  4XKB A;  1QHH D;  3WTX C;  1X2M A;  3HOV J;  3LAP A;  4D7N A;  2VC1 A;  4OMZ A;  4UXN A;  1U9O A;  1MNE A;  5CVU A;  1NHA A;  4CCL A;  1WJB A;  2FJ1 A;  3WTW C;  3QYB A;  2K5C A;  4A3G J;  2DBB A;  5FLX Z;  5TRD A;  2JPC A;  1U8B A;  1X1D A;  2XHK A;  5IYB J;  2R7X A;  2E5Z A;  5M5X J;  3DPT A;  4KJZ A;  3L00 A;  1BJA A;  2VJJ A;  2WV1 A;  2VIX A;  3K0L A;  3SEQ A;  2O8X A;  1LUJ B;  1D5Y A;  2ICW G;  4RMN A;  1OCZ H;  1I3Q J;  1ZN2 A;  1VQL I;  1OCT C;  2A6H F;  3M4O J;  1ZAO A;  3Q0W A;  4BEH A;  1JUP A;  3OY9 A;  3OYM A;  5DS9 A;  1ZGA A;  4BBR J;  5DDG A;  3HB9 A;  1YI2 I;  2BZT A;  2Z3Y A;  3D5R C;  3WU2 C;  3MKW B;  3H3V K;  3LSM A;  4KT6 A;  2KQR A;  3KCC A;  5AIQ A;  4WCG A;  1F4K A;  3RPU A;  1FZP B;  4XN3 A;  1G3W A;  4G9Y A;  4DJA A;  1MDM A;  4N4O B;  1HW2 A;  4MEX F;  1VQ6 I;  3VOE A;  2FX0 A;  2WAF A;  1HST A;  1YS7 A;  3K70 D;  2F5D A;  2CU7 A;  4BBS J;  1DP3 A;  2EBI A;  2QYO A;  3OYI A;  1P4A A;  3ABK H;  1J09 A;  3SJM A;  1BN5 A;  2W24 A;  1TT5 B;  4FET A;  4E7J A;  1XTA A;  1EV7 A;  4MNU A;  5LHH A;  5DM6 F;  3OR1 C;  2DCE A;  2MGQ A;  2BOL A;  4DYQ A;  2RQQ A;  2XC7 A;  2CWE A;  4BDZ A;  2K3F A;  4H4K C;  1H0M A;  3WHB A;  1X3W B;  2CYY A;  2DXI A;  3DLL F;  2D45 A;  3CUQ B;  4AD9 A;  2VOP A;  5EG0 B;  1ETO A;  1K6Y A;  4XKV A;  2JA6 J;  1FP1 D;  5HNH A;  2EIM H;  5CJ9 A;  1BC7 C;  4M3B A;  4IOA F;  1WI3 A;  3ZQG A;  3ZN1 A;  2VE9 A;  1EF4 A;  2XVC A;  5EEH A;  4IHT A;  3CJT B;  3FHZ A;  1FNN A;  1I39 A;  4E6K G;  4KIB A;  1TQP A;  3EUK L;  3OYN A;  4UB6 C;  2LTP A;  4MO7 A;  2RQP A;  4BHP A;  4E7I A;  4NC8 A;  2UUZ A;  4UNO A;  3J7A Y;  2L4A A;  4CGZ A;  5DEQ A;  4E4H A;  4WXH A;  1U8R A;  2F6C A;  1CF7 A;  3F72 A;  2V7F A;  2JZY A;  2I8D A;  2F4M B;  3BG5 A;  3MVP A;  1HDD C;  3M3Y J;  1JI8 A;  3JRI A;  2F5F A;  4A5N A;  1ZG1 A;  5F1R A;  2DMT A;  3J7Y J;  4LIU A;  2KLO A;  4NQW A;  1QNT A;  4M3G A;  1FYK A;  2M5W A;  2DOF A;  3QPS A;  3GYH X;  3ZQC A;  2X48 A;  2DJI A;  5FKL A;  3MZ8 A;  3TO6 A;  4BQQ A;  1FPQ A;  3AL0 B;  1XGN A;  3AKZ A;  3HHH A;  5FKN A;  2PFB A;  3ABM H;  1WJE A;  3KP4 A;  3OS0 A;  3I71 A;  3DLA A;  2E1C A;  4L5E A;  4HQE A;  2RN7 A;  4C30 A;  3ECO A;  2EB7 A;  2GA2 A;  1JXS A;  3RYR A;  2WAQ N;  2E7W A;  3GFL A;  1OR7 A;  1DPR A;  3S3O A;  1U5T A;  2Z5U A;  3QU6 A;  2HPI A;  5LD2 C;  4KMU X;  1CGP A;  2OF7 A;  1XSD A;  3VDX A;  1S7O A;  3JRG A;  3CCY A;  4WF2 A;  2LKP A;  2CSO A;  2CGP A;  3RCO A;  3AG1 H;  2HWV A;  2DA7 A;  4OAZ A;  3HKZ N;  1FBU A;  3OIO A;  3MQ0 A;  1D8K A;  1BI0 A;  2VC0 A;  4OU0 A;  1V54 H;  2EFP A;  5FKM A;  2OTL I;  5H2F C;  3I54 A;  1RI7 A;  3BR3 A;  1DPU A;  4FX0 A;  1X1A A;  4N4N B;  3L2V A;  2H27 A;  2ZXJ A;  1XC5 A;  1QVU A;  1R00 A;  2Z9O A;  4I99 C;  4ENK A;  5C3E J;  4CO8 A;  4I2O A;  1ETY A;  2JVG A;  1Z21 A;  3DP7 A;  5GPC A;  4A5M A;  1N77 A;  2EFN A;  2M3A A;  1U9N A;  5IT9 K;  1K4T A;  3D5L A;  4AUX A;  3QWL A;  2DAO A;  2L0K A;  2XIG A;  5HDG A;  4RB3 C;  2E2I J;  4KT5 C;  3JRH A;  4LMY A;  2VBW A;  1X4P A;  3PQJ A;  3PNV A;  1ZG5 A;  4NC6 A;  3CQZ J;  4F92 B;  2R5Y A;  3A01 A;  2XRO A;  1Y1V J;  1YRN B;  1VND A;  4UB8 C;  3TO9 A;  4X1E A;  1ODD A;  3EDP A;  3TW6 A;  1BR1 A;  4IXA A;  2GWR A;  1TT0 A;  1R49 A;  5HNF A;  3EQL F;  5FJ8 J;  5D6E A;  3O3K A;  3WTU C;  1I6X A;  4BXF A;  2M0M A;  4UUS B;  2GLO A;  1XGM A;  1ZGW A;  3GTG J;  2QM3 A;  1SVM A;  2HI3 A;  3TED A;  2KT0 A;  1MBE A;  4B4C A;  4XK4 A;  4MFE A;  1MMN A;  3L2U A;  2L7M P;  3HSF A;  1JKR C;  2UXX A;  1KQ0 A;  1MJA A;  1P7I A;  1MBF A;  1UST A;  2OBP A;  5EGO B;  1FYL A;  2DFF A;  4BKX A;  1BOB A;  4XLN F;  2DMU A;  3L2R A;  2M4G A;  2V1X A;  1HOM A;  2DTZ A;  1EA3 A;  1YW8 A;  3BZC A;  1B59 A;  1X3U A;  1MNM C;  1WZ2 A;  3FXQ A;  2BEO A;  3F8M A;  3IWZ A;  2LRD A;  2NAZ A;  3EPZ A;  2NVQ J;  1W36 C;  3ABT A;  4FT8 A;  1ZR2 A;  1FP2 A;  3GZ5 A;  3ZQL A;  5ICG A;  2GA1 A;  3DCF A;  4U0Y A;  4PGG A;  2MBF A;  3TOB A;  2STW A;  2DA6 A;  2CQK A;  2PN6 A;  2I10 A;  5TJJ A;  4CDG A;  5KHD A;  4RAZ A;  1F9N A;  1EH8 A;  4BQA A;  2ELJ A;  4HYE A;  1J0R A;  1O7F A;  4B3A A;  5F6F A;  2FD5 A;  2O6G E;  3VWB A;  3JTG A;  2XGD A;  4ENJ A;  5H6Q A;  3HPG A;  4UVC A;  3PM1 A;  5B1A H;  1QZY A;  2ZJP F;  4MFD A;  2G9W A;  4QLC U;  3Q5F A;  3LL7 A;  2GBY A;  3RSN A;  3BJO A;  4IHV A;  1OYY A;  4ESB A;  3HDD A;  2IS2 A;  2D2W A;  3E97 A;  4A3L J;  2Q2E A;  4QPQ A;  2O5R A;  1MD0 A;  4RBO A;  1Z7U A;  2GXG A;  1W5C C;  3VYR B;  2MD0 A;  3M8F A;  4PK4 A;  2DFI A;  3BPV A;  2DT7 B;  1TWH J;  3FMQ A;  2PMZ N;  3V8J A;  1AKH A;  1WJD A;  3RKY A;  2KPM A;  2CUJ A;  1V5F A;  4CXF A;  4EM2 A;  3HTS B;  4HX4 A;  3I59 A;  3IH2 A;  2WC2 A;  2FOW A;  3BJA A;  4D9J A;  3ZCO A;  1UFM A;  1XN7 A;  4EJV A;  1QHG A;  2JJ7 A;  2DQL A;  2HYJ A;  4HEA 2;  2DMP A;  2LFB A;  1NTC A;  2AQE A;  2H94 A;  3CCL I;  3QOD A;  3GTJ J;  2C6Y A;  3M7G A;  2G7H A;  5K5R A;  1K4S A;  4G7Z F;  5D5W B;  4BE2 A;  4BEH B;  1FBQ A;  1TW3 A;  2VPL A;  2UXN A;  4XKC A;  3ECH A;  2L5Q A;  2KIU A;  2RC4 A;  2XAH A;  3C1D A;  3DWL E;  2DYS H;  2JN6 A;  3GME A;  3BLY A;  3H9J A;  3LSG A;  1Y8Q B;  3MAJ A;  5GAE J;  3KET A;  4TV7 A;  4QIW N;  4MTD A;  1KQ9 A;  2W82 A;  1WKM A;  4BQN A;  1R7J A;  3IRR A;  3HSE A;  1SVO A;  5IP9 J;  3A1Y A;  3NAR A;  2KRH A;  3CP8 A;  4FE4 A;  3MN2 A;  2OC6 A;  4RB0 A;  1YW7 A;  1IDY A;  1ETQ A;  1JT6 A;  1KYW A;  3K4L A;  1ORK A;  4N0B A;  3REO A;  5KK1 A;  1WSU A;  3JRB A;  1IJW C;  5H6R A;  3CMY A;  1R1U A;  1FMW A;  1W7P D;  1K6O A;  2EIL H;  3H35 A;  3S93 A;  4F7Z A;  1VTN C;  1JGG A;  2V79 A;  2CV0 A;  4ABZ A;  3S2W A;  1V55 H;  3BTI A;  3SQN A;  2KZV A;  2HOS A;  4RAY A;  5LEK A;  1DU0 A;  4S05 A;  1LDJ A;  1JUS A;  3F6V A;  1RET A;  1C0W A;  3RPQ A;  1NG6 A;  4XBF A;  3AAF A;  3M8J A;  1ZK8 A;  3BG3 A;  3MMY B;  3LSJ A;  2IAI A;  3VYS B;  3QOE A;  1Y1W J;  3QPL A;  4HV5 A;  1SFE A;  5E3M A;  3FM5 A;  1SD6 A;  1ETX A;  4DGW B;  3KYC B;  3LFK A;  5LHG A;  5KAI C;  2OU2 A;  3DKX A;  3OYE A;  2X6Y A;  2P5K A;  1LE8 A;  4CIC A;  5J1R A;  2BY0 A;  1CF7 B;  3Q0V A;  3BR2 A;  4IQJ A;  4B47 A;  2ZB9 A;  4XM3 A;  2E71 A;  4L5J A;  4JYK A;  1IUY A;  4KYW A;  3I56 I;  3PSF A;  3HOW J;  1QA6 A;  4NQW B;  3NQO A;  5DUK A;  1IC8 A;  2X4H A;  2DJN A;  3P9C A;  4HG2 A;  2Y9Z A;  1W1W E;  4HST A;  2N8G A;  2F5C A;  2JRT A;  5FRN A;  1IF1 A;  6PAX A;  2NOJ B;  2Y9Y A;  2P6T A;  2BXZ A;  3HYI A;  3K1P A;  4BY1 J;  1I1G A;  4IRG A;  3QRF F;  5JHU A;  3IUO A;  1Q1V A;  4JK1 X;  3G71 I;  3KP5 A;  4E7Z A;  1E2X A;  3U21 A;  4XSX F;  3ZXS A;  4G6Q A;  1LEA A;  3DU5 A;  2YSR A;  3Q3S A;  1WVR A;  4LFU A;  1B9N A;  2R0Q C;  2PJP A;  2ZKZ A;  3HBL A;  5DD8 A;  5GTH C;  3LFU A;  2B7E A;  1U5T B;  3EUA A;  3HM5 A;  2W57 A;  2KDZ A;  1PVE A;  4BU2 A;  4F93 B;  5D4S A;  1NK2 P;  1HSJ A;  2E2J J;  4RGU A;  2K27 A;  3CJN A;  3PL8 A;  3IP4 B;  1H88 C;  5JHF A;  4IHW A;  2BV6 A;  2O0Y A;  1B8I A;  3BC8 A;  3I4N J;  4XRM A;  3TOA A;  5E3L A;  2FBK A;  3CO6 C;  2M7A A;  2L9S A;  3EYY A;  2LY1 A;  4PGH A;  5JR3 A;  3GCM A;  4M73 A;  4C3I J;  2HZT A;  1HW5 A;  3U1D A;  3CO7 C;  1MMG A;  4F3Q A;  5D5V B;  1XDU A;  4NHJ A;  1MKM A;  4M74 A;  3J80 Z;  2LDU A;  5E1W A;  1ZRD A;  1APL C;  3PO2 J;  5LLQ A;  3OS1 A;  2LKX A;  3S14 J;  2L54 A;  1N75 A;  3LWF A;  3VFZ A;  2A07 F;  2HKO A;  3HOU J;  4XRS G;  1XG1 A;  1IRG A;  1VQK I;  2CH0 A;  3BR1 A;  3HC7 A;  4XLE A;  2FU4 A;  5EF6 A;  2GAU A;  4KN4 X;  1HQC A;  3UNG C;  4A6E A;  4GO1 A;  1X2N A;  3J81 Z;  1R36 A;  3CCM I;  4OIQ F;  2RNJ A;  2LBF A;  3A01 B;  2R5Y B;  3MKY B;  4L0Z B;  4V19 K;  4WK8 F;  3DBR B;  2Y48 A;  4EJT A;  5J8F A;  2ID3 A;  4Y13 A;  2XSD C;  4M9X A;  1XGS A;  3ZOB A;  2GXA A;  1BM9 A;  4IHY A;  2PX9 A;  2RV8 A;  5FFX A;  1M1E B;  2Y0S A;  2ZXI A;  4LJZ F;  3GLL A;  2K9Q A;  2ZSI B;  1UAA A;  3ELK A;  1JKP C;  4ZYA A;  3F8N A;  3I3L A;  5BNG A;  4GRI A;  3PIO F;  4RM3 A;  3K4M A;  1NH3 A;  3DPL C;  4ZYG A;  2VB6 A;  3MZY A;  2LSO A;  3W2V A;  3S2D J;  5B1B H;  1QO0 D;  1Y39 A;  2WTE A;  3F23 A;  4A93 J;  4PJL A;  3SZT A;  4YFN F;  2MC3 A;  2VN2 A;  2OAZ A;  4UV8 A;  3GFM A;  1W5S A;  2V9P A;  1LDD A;  4A3D J;  4CZZ A;  3BG6 A;  2JPB A;  2LLK A;  2IBD A;  1FTT A;  4B3X A;  3V8K A;  2R7T A;  2MW8 A;  3RYP A;  3JAM Z;  1DGW Y;  5KVR A;  3COA C;  2XAQ A;  3RZD J;  2DW4 A;  2VT2 A;  3ESW B;  1CQT A;  1VQP I;  1YTY A;  2V1U A;  1FBS A;  2IGK A;  2BVM A;  4KIG A;  2UV1 A;  3U1K A;  2E5N A;  1FSH A;  2X85 A;  4U7B A;  2IPQ X;  3P9I A;  1R22 A;  3QPH A;  5FFZ A;  2DA3 A;  3BY6 A;  2W25 A;  2BW3 A;  4RB1 A;  1MBG A;  3G1M A;  2M34 A;  3CCR I;  2OTJ I;  2XV4 S;  2MG4 A;  3O6B B;  2AQF A;  4U0V A;  1XD7 A;  1PP7 U;  2HVS A;  4I98 B;  2XAF A;  1MW7 A;  3R0J A;  3L2Q A;  1GDT A;  4E7H A;  2LMD A;  2RAE A;  3HRM A;  2F48 A;  2V4J C;  3TW7 A;  1ACI A;  2Q2E B;  4BL0 B;  2RVC A;  1A35 A;  2CW7 A;  3SEZ A;  2QSH X;  1VQN I;  3PNY A;  1BI2 A;  1J5Y A;  3UR3 C;  2FMY A;  3V7C A;  2VOD A;  2K9S A;  5K5Q A;  3A4C A;  2RDP A;  2W85 A;  1GV5 A;  3NAU A;  4DZP A;  3ZPL A;  3OIQ A;  2VJ4 A;  4G94 A;  1AKH B;  1IGN A;  1ZHF A;  2EFO A;  3V8L A;  4BJ5 C;  5B3S H;  2MLG A;  3Q9V A;  1Z3Y A;  1BR4 A;  2VPR A;  1FOY A;  1W7P A;  3I59 B;  2XAU A;  2DU9 A;  4NC7 A;  2QQ8 A;  2A3S A;  1IUF A;  1JUM A;  1QGP A;  1TBX A;  3NRV A;  2CQN A;  2OUM A;  3CCS I;  3L7W A;  2YX4 A;  1O7L A;  1ZYR F;  2CFO A;  2E1O A;  2H8W A;  2X6W A;  4I09 A;  2NNY A;  1NG7 A;  2XRN A;  3QPT A;  4FQG A;  4QSH A;  2ZXW H;  2QUF A;  3KLO A;  4LLG F;  3IV5 A;  2A6E F;  2M0C A;  4XLH A;  1XPX A;  4CCM A;  3ZQI A;  2MAB A;  2BE5 F;  2QF7 A;  5HVQ C;  1FC3 A;  3IKT A;  3ZMV A;  3PIP F;  3SHF A;  4DYR A;  3WGI A;  5GAH J;  2Z33 A;  4A6D A;  4LIV A;  4CHU A;  2VXD A;  2F5V A;  1VF9 A;  2HGC A;  2NOG A;  2F5E A;  2IRF G;  4S04 A;  2E1M B;  3BOQ A;  2FUG 2;  3ZMZ A;  3DFG A;  3KP2 A;  3F6O A;  1JHF A;  3BTJ A;  1K7A A;  3CCV I;  1IAW A;  2H09 A;  1BI3 A;  4PDK A;  1FIA A;  3WU0 A;  1OFC X;  4BHC A;  3B6A A;  4HF2 A;  4WXC A;  1FEX A;  4EV0 A;  3WTY C;  1KYZ A;  4M9Z A;  3PQK A;  1RPW A;  1PUF A;  2K7L A;  3E5Q A;  1UEL B;  4RDU A;  3BR5 A;  4PJM A;  4I6Z A;  3R4K A;  5A2Q Z;  5IP6 A;  2L2O A;  4QPO A;  1KQ8 A;  1XDS A;  5ILS A;  1PDN C;  2R93 J;  2LG4 A;  5J40 A;  1AU7 A;  1IXR C;  1RR8 C;  4LB6 B;  1YJW I;  3CMM A;  4I76 A;  4LG0 A;  2AXL A;  2DT5 A;  4Q5S F;  3CDH A;  1Y56 A;  4WXD A;  4KN7 X;  3SYT A;  5IT3 A;  3CLQ A;  5IY5 H;  5C4J J;  2VKE A;  2XPV A;  3O8G A;  2OV7 A;  4OMY A;  1FOX A;  2FQ4 A;  3MCZ A;  1LJ9 A;  4ITV A;  2XDV A;  2YS9 A;  1WRJ A;  2F4O B;  3CC4 I;  1OQY A;  3GUD A;  3I0T A;  5FLX K;  5JLW A;  4ZDP A;  2MD5 A;  2VJI A;  4EJW A;  2HPM A;  2LH9 A;  3BWG A;  1SD7 A;  4AVZ A;  3S1N J;  3C3W A;  5F0C A;  2E7X A;  1LE8 B;  4PJJ A;  1VI0 A;  1WHU A;  2R7W A;  2CW0 F;  3FDY A;  3OIP A;  3ZMD A;  1BR2 A;  5HLH A;  1WH7 A;  1QBJ A;  3E6B A;  5DYM A;  2L7Z A;  3H1C A;  3OWT A;  1MSF C;  3NWS A;  3OYD A;  1ETK A;  2VT3 A;  5ILV A;  1TLH B;  2JMW A;  4Y7N J;  4A3M J;  2K3P A;  4UV9 A;  1BI1 A;  3F21 A;  1O3T A;  4A3I J;  3F9K A;  2ECC A;  1D0X A;  3ZMS A;  4PFO A;  3BR6 A;  3NEU A;  2V6C A;  4IPA A;  5E1X A;  3SDG A;  3I55 I;  1HC8 A;  5IT9 Z;  5FKK A;  4D5C A;  1B72 A;  1HA8 A;  3S2H J;  2E60 A;  4GXO A;  4Q48 A;  4GCV A;  2LP0 A;  4B44 A;  3VOD A;  1PUE E;  1RRJ A;  1VQ4 I;  4ZYE A;  3C2G A;  1W0T A;  4FHT A;  2Y0M A;  2CW8 A;  3K1M A;  5FGM A;  4ENM A;  3GTK J;  1WWX A;  2HTJ A;  4DOZ A;  1RR7 A;  3OYA A;  3JRA A;  2UWM A;  2V9K A;  5J47 A;  5F64 A;  5E3O A;  3GW2 A;  5F0H A;  3S3N A;  3PUB A;  4YFK F;  2O61 A;  2CQX A;  2MYS A;  2PI0 A;  4J00 A;  2W4S A;  3R60 A;  2A61 A;  1E3P A;  2KRC A;  3HZJ A;  3SZG A;  1O3S A;  1ZRC A;  1HW1 A;  4L18 B;  4A3J J;  4ZJZ A;  2ZFW A;  1SEU A;  5B5E C;  1GXQ A;  4P1W A;  2BHY A;  1D3Y A;  2CMP A;  3K4J A;  1B8I B;  2XGC A;  5D5U B;  3FF5 A;  2DN0 A;  4IRH A;  2DPD A;  1PYV A;  3MD2 A;  5FKO A;  1BL0 A;  3SDB A;  5HLI A;  3TDZ C;  4PJN A;  5JFR A;  2O9L A;  2EQR A;  4IVN A;  3G4S I;  3CLO A;  1S3J A;  2JTV A;  2EZK A;  2A5W A;  2CS3 A;  3KYL A;  2A68 F;  1WH5 A;  5HDK A;  2MH2 A;  2ZC2 A;  4YIF A;  3CD6 I;  5L3F A;  2RRE A;  2DLL A;  4RB2 C;  4NNJ A;  5J4Y A;  2KJB A;  1RIO H;  5IOY A;  3H5A A;  2HU9 A;  3VPR A;  4B8X A;  4E7L A;  4A3F J;  2HEO A;  2ZJQ F;  4P55 A;  1I6H J;  3E5X A;  5K7H A;  1PJR A;  1SFK A;  2ZNZ A;  1DQU A;  1H9G A;  2M8G X;  2ZME C;  3OV8 A;  3LSI A;  1SMT A;  1XCB A;  2X1D A;  1R4N B;  2LBF B;  2ZJ2 A;  3ERM A;  2P81 A;  2AXT C;  3PUF A;  1T39 A;  2IGN A;  3DEU A;  2P5V A;  1LPQ A;  1EKE A;  4R79 A;  2JQ7 A;  3HRU A;  1HCR A;  4KIC A;  1ZEL A;  2K40 A;  5LGT A;  1KU7 A;  1QQI A;  1R4M B;  3HSR A;  3RKW A;  1UCR A;  3RJP A;  2I5U A;  3ROU A;  1LNW A;  3BDD A;  3KP6 A;  3FWE A;  2ZXH A;  4MTE A;  4HF0 A;  4FAS D;  1HKQ A;  5CVR A;  1T2K A;  2R7S A;  2R5Z A;  1QU3 A;  2COB A;  3Q9S A;  5F08 A;  4M6Y A;  1GLN A;  1MGT A;  2QKL B;  4FIS A;  2DA1 A;  2ETH A;  3CC7 I;  5LBQ A;  5F04 A;  2HR3 A;  1SD5 A;  1JGS A;  3KPH A;  2XB0 X;  1G6N A;  5HS8 A;  2VKD A;  4RGX A;  2TDX A;  1KU3 A;  1MBH A;  3G73 A;  1BC8 C;  5CVJ A;  4XOR A;  3P7N A;  1IDZ A;  2WB1 A;  4BGD A;  2V1D A;  2KRF A;  1B1B A;  5L3C A;  4LB5 A;  3K1N A;  1AOY A;  1G3S A;  1D1A A;  3WTZ A;  1IRF A;  3K4K A;  5BS6 A;  1LEB A;  2WBM A;  3E6M A;  1IN5 A;  2CQQ A;  2BYV E;  2A5Y B;  4ZTF A;  2J5P A;  2DA2 A;  2BW3 B;  4I02 A;  4A3E J;  1R5G A;  1RES A;  4V2G A;  4UUT A;  2ME6 A;  2KIS A;  1E0E A;  1IXS B;  4HNU A;  1N78 A;  2V6E A;  2WV0 A;  4HDU A;  3GXO A;  2IT0 A; 
#chains in the Genus database with same CATH homology
 3GEZ A;  1BOA A;  1SD4 A;  5K5O A;  1QZZ A;  5DCM A;  2K4J A;  2R7F A;  1TW2 A;  3O2P E;  2M45 A;  2HTS A;  5FB2 A;  2VOO A;  3KEQ A;  1QPM A;  4U88 A;  2M8E A;  1G3T A;  2IA2 A;  1TNT A;  2OQG A;  1W7P B;  4AWX B;  2ZBK A;  2PLY A;  3FXU A;  1V3F A;  1GXP A;  3FM3 A;  3HRT A;  4RS8 A;  5FO5 A;  4IRI A;  1OKR A;  4I01 A;  1JE8 A;  3R0A A;  3TO7 A;  4I7H A;  4L5I A;  2QVO A;  2NS0 A;  2PEX A;  3SXY A;  2EA2 A;  1MDM B;  1S7A A;  4WWC A;  1I5Z A;  3QAH A;  3EET A;  1LDK B;  2NNN A;  3LA7 A;  3GF2 A;  3MWM A;  1U6G A;  3R61 A;  1IN8 A;  1P6R A;  1MJ9 A;  3IRQ A;  2ZNY A;  3T0Y A;  1KGS A;  2KJC A;  1ONV A;  2HS5 A;  4LG0 B;  1D5V A;  4P9U A;  3RIR A;  3E6D A;  5L3G A;  2PG4 A;  4L0Y B;  1FY7 A;  1R1T A;  1ZRE A;  3HTU A;  2FOK A;  3QP6 A;  1T6S A;  2EA4 A;  3WU1 B;  4O5V A;  4FX4 A;  1XSV A;  2YX7 A;  4EJU A;  4MGR A;  2L01 A;  3V7S A;  4KDP A;  1FT9 A;  3L9F A;  4BYY A;  4EGY A;  2IW5 A;  2V9V A;  2K4B A;  2DQR A;  4Q47 A;  1ULY A;  3IC7 A;  3J7A O;  4EM0 B;  1J59 A;  3E3V A;  1IXC A;  1ZG3 A;  5AON A;  2JT1 A;  3FMS A;  4A0X A;  1Y0U A;  5JI6 A;  1T98 A;  2E1N A;  2H6B A;  5CLS A;  4KMF A;  4Y15 A;  5ILU A;  1UHM A;  2K86 A;  3SZP A;  4ZH4 F;  2VON A;  1Z6R A;  4ESF A;  1D8J A;  3GFI A;  2X0L A;  5D4R A;  4M6X A;  3KZY A;  3QU3 A;  3KE2 A;  2IJL A;  4XLP F;  5E17 F;  2FSW A;  4RGR A;  1U2W A;  1R58 A;  5ICC A;  1WQ2 A;  4AIK A;  3IL2 A;  3K69 A;  2MH9 A;  2QLZ A;  4BHB A;  2BBY A;  2EV6 A;  5ERI A;  1DP7 P;  3F3X A;  3WOD F;  2LNB A;  1P4W A;  3FZV A;  2CFX A;  4DQ2 A;  3JW4 A;  1F5T A;  3K2Z A;  5LRS A;  4LGW A;  2QZ8 A;  2DI3 A;  2YU3 A;  1WI9 A;  2PMH A;  3RDI A;  2KIM A;  3RTR A;  3C7J A;  1KU9 A;  2M1B A;  3I4P A;  1PP8 F;  1SMY F;  2Y75 A;  1BIB A;  3ZN0 A;  1ZLJ A;  1E17 A;  2HDC A;  2M30 A;  3TQN A;  2OD5 A;  3LA2 A;  5FD6 A;  4E70 A;  2R3S A;  1RNL A;  4GYI A;  2BGC A;  1LVA A;  4I0A A;  2FML A;  5CYV A;  2ELH A;  2P4W A;  3J80 K;  1XMA A;  3BP8 A;  4ZZL A;  4HW0 A;  3L09 A;  4OIN F;  4QWQ A;  1W4M A;  3M1E A;  4N9I A;  1Z9C A;  4R8H A;  4ZYD A;  2ZME A;  3J81 K;  3FXR A;  4OIR F;  5DCM B;  1F1Z A;  4HX7 A;  1I27 A;  1L0O C;  1FOK A;  4AIJ A;  3EYI A;  4O3M A;  3N4M A;  3HUG A;  4M72 A;  1YYV A;  3B73 A;  3I53 A;  2HQN A;  1P4X A;  2L02 A;  1UB9 A;  2QBY A;  2FE3 A;  2XAS A;  1K78 A;  4P9F A;  1O57 A;  2IVM A;  3CUQ C;  5D8K B;  2K02 A;  2FQ3 A;  2FA5 A;  3F22 A;  3TDU C;  3IWF A;  4K2E A;  4YG2 F;  2O03 A;  2OQR A;  3T1B A;  3GO5 A;  4DNC A;  3BZ6 A;  4UUV A;  1XCV A;  2YR2 A;  1FX7 A;  3JAM K;  1W5T A;  2EJR A;  3U2R A;  3GZ6 A;  4HAM A;  2GQQ A;  4PZJ A;  4EMS A;  3WTT C;  1R1V A;  3R6S A;  3B02 A;  2ESH A;  3DF8 A;  3F8B A;  3KEO A;  5DCF A;  4A0Y A;  3N97 A;  2G7U A;  2QEN A;  2FRH A;  1EH6 A;  1T0F A;  1ZAR A;  2OA4 A;  3HRS A;  4Q4Z F;  4GYG A;  5BOX A;  2RKH A;  4KUM A;  1HXD A;  3ZQ7 A;  1YO5 C;  4NB5 A;  3WGG A;  1ON1 A;  3P9K A;  4UVB A;  1ZGJ A;  4LLL A;  4BNC A;  4HF1 A;  4L9J A;  3KLN A;  3KZZ A;  2DPU A;  3WTS C;  3GFJ A;  3BRO A;  1IN7 A;  5DUI A;  4G7O F;  2P6S A;  4JQF A;  2XKO A;  4MQ9 F;  2L3D A;  5K1Y A;  2EV0 A;  1BBY A;  4I0B A;  2XAJ A;  1S8N A;  4XSZ F;  1DUX C;  3LA3 A;  2ISZ A;  3I58 A;  1OYW A;  2VBZ A;  2F2E A;  4P5O A;  3VEP A;  4U0W A;  4UHT A;  3EUH A;  2Z99 A;  1HKS A;  1MZB A;  3I64 A;  3K9T A;  1KU2 A;  3GLX A;  3T8R A;  3G3Z A;  5E8G A;  5EEG A;  3ERE D;  4HOB A;  5LHI A;  1O3Q A;  4OIP F;  1Z05 A;  3W6K B;  2Q8K A;  4IF4 A;  3H3Z A;  5A2Q K;  4HDV A;  3I5U A;  5ED4 A;  2HYF A;  4EVI A;  3CTA A;  4HBL A;  1I1S A;  1HBX G;  1SAX A;  4ENN A;  3LQR A;  2VBY A;  4HA8 A;  4A12 A;  2IA1 A;  4L9T A;  1R5H A;  5L3E A;  3JSO A;  4A0Z A;  1R23 A;  4YFX F;  3ML6 A;  1TQI A;  2DTR A;  4RGS A;  4HX8 A;  4HZF A;  2P7V B;  4EQQ A;  4YII A;  1Z91 A;  3TGN A;  2OZU A;  4IJA A;  1YS6 A;  4AIH A;  2P5L C;  2COM A;  4LK1 F;  3GX4 X;  1H9T A;  5E18 F;  5CVV A;  3DV8 A;  3V4G A;  2NYX A;  2ZO4 A;  4D0P A;  1TNS A;  3HOT A;  4CYD A;  3WGH A;  2AS5 F;  1S29 A;  2HOE A;  5E20 A;  4ON0 A;  3PFI A;  2XKP A;  1AWC A;  2W84 A;  2O3F A;  1BIA A;  5ICF A;  1OPC A;  2PBI A;  3KFW X;  1J9I A;  1XGO A;  5ICE A;  2EWN A;  2KIF A;  2R7D A;  2GXB A;  5BQT A;  2DO7 A;  4ZYH A;  2YPR A;  2FNA A;  3DQV C;  1V4R A;  2FNP A;  2ZME B;  3LST A;  3FX3 A;  2D1H A;  2QQA A;  4B09 A;  4BAY A;  5LGN A;  3MEX A;  5JVT A;  1SFU A;  2IA0 A;  4OOI A;  4M71 A;  2ACJ A;  2STT A;  4HV6 A;  2XGX A;  5E8I A;  3GWZ A;  2GZW A;  2DK8 A;  2ISY A;  1L3L A;  2M87 A;  2QBY B;  1K78 B;  2H6C A;  4HLX A;  5LRR A;  3ABU A;  5HS9 A;  1Z6T A;  4BH9 A;  1TTY A;  4KNY A;  4U7D A;  2EFW A;  4ESJ A;  2NRA C;  1UHW A;  1IN6 A;  2XAG A;  2FBI A;  5CVI A;  2B0L A;  1S6L A;  4R1H A;  3SFZ A;  3D0S A;  1RZ4 A;  5DD4 A;  2HKX A;  3TKY A;  5J6X A;  4PCQ A;  1J2X A;  2UZK A;  2HYG D;  4Y17 A;  3OOP A;  1P92 A;  2IP2 A;  1GVJ A;  4KA4 A;  5LGU A;  5HLG A;  5HOO A;  4L9N A;  2RGV A;  2QWW A;  3E5U A;  2ADU A;  1FLI A;  1A04 A;  3DXJ F;  1J75 A;  2HFH A;  3JTH A;  4KFC A;  1U5T C;  3F8C A;  1XB4 A;  1OMI A;  2P7C B;  4LK0 F;  3CUQ A;  2VE8 A;  4ETS A;  3T8T A;  5HDN A;  3LQQ A;  3BJ6 A;  4MQV A;  3M9A A;  4G8X A;  5BPD A;  4Z2Y A;  4ASN A;  2PMU A;  2GIV A;  4WX9 A;  3HOS A;  3CUO A;  1XSX A;  3F8F A;  3RI4 A;  2P8T A;  4O6J A;  3U9G A;  2Q0O A;  1G3Y A;  5H20 A;  2LF7 A;  1ZLK A;  2J5O A;  5E1Z B;  2FXA A;  3WTV C;  4JBA A;  1U3E M;  1KA8 A;  1YFH A;  1J7K A;  1GHC A;  3E6C C;  4P96 A;  1YQA A;  2KKO A;  2FEZ A;  1SFX A;  1YW9 A;  2XUB A;  4XRF A;  4IHS A;  1XMK A;  2FF4 A;  3BPX A;  4HLY A;  4H0E A;  1B9M A;  4ZZD A;  4MHG A;  3RKX A;  2HQR A;  2ESN A;  1T38 A;  2VXZ A;  4G7H F;  1ZRF A;  4N9H A;  5DV5 A;  2PQ8 A;  1B6A A;  1IN4 A;  2CG4 A;  2EFQ A;  1Z1D A;  3M8E A;  4HQM A;  1DDN A;  1G4D A;  3IHU A;  1U78 A;  1K79 A;  2EK5 A;  2FBH A;  2A69 F;  3VB2 A;  4AVP A;  4UVA A;  2QQB A;  1JHH A;  3KP3 A;  3IKV A;  1EH7 A;  2LF8 A;  2MLK A;  2EV5 A;  4EGZ A;  1LQ1 A;  1YIO A;  2JSC A;  5HS7 A;  5D5X B;  5L3B A;  4GGG A;  3ISP A;  3QP5 A;  4M9S A;  5AIP A;  3JSP A;  1TQM A;  1IZ1 A;  3L2C A;  1LB2 A;  5J8C A;  3MZH A;  2DK5 A;  4BXU A;  3ZMT A;  5BMZ A;  5BPI A;  1OYI A;  2L4M A;  5L3D A;  3KP7 A;  3GVA A;  1B4A A;  3WE2 A;  4KIF A;  1FSE A;  1STZ A;  3W6J B;  3V7R A;  1IW7 F;  3H92 A;  2WWY A;  3ZP5 A;  1REP C;  2ZCW A;  2CO5 A;  3DKW A;  3HIF A;  3WE3 A;  5D6F A;  3ULQ B;  4EJO A;  1O3R A;  2VBX A;  2OZ6 A;  2MA3 A;  5LEJ A;  3QOP A;  3FMR A;  4LD5 A;  1YG2 A;  2QQ9 A;  4OIO F;  1MJB A;  5FD5 A;  3ZMU A;  3MFK A;  1P2F A;  2D1V A;  5D8L B;  4A2U A;  3WG9 A;  4EM1 A;  1ZH5 A;  3H3U A;  4MEY F;  1Q1H A;  1HKT A;  1RUO A;  1ON2 A;  4L9V A;  3LAJ A;  1FYM A;  3C18 A;  4LLN A;  3T5X A;  1YLF A;  1FWZ A;  3HHG A;  4G6D A;  1USS A;  1RUN A;  3WTX C;  3LAP A;  2VC1 A;  4OMZ A;  4UXN A;  3WTW C;  5CVU A;  1NHA A;  2DBB A;  5FLX Z;  5TRD A;  2JPC A;  2XHK A;  3DPT A;  3L00 A;  1BJA A;  3K0L A;  2O8X A;  1ZN2 A;  2A6H F;  1ZAO A;  1ZGA A;  5DDG A;  2Z3Y A;  3KCC A;  5AIQ A;  4WCG A;  1F4K A;  3RPU A;  1FZP B;  1G3W A;  4G9Y A;  1MDM A;  1HW2 A;  4MEX F;  3VOE A;  1HST A;  1YS7 A;  2F5D A;  2QYO A;  1P4A A;  1BN5 A;  2W24 A;  1EV7 A;  4MNU A;  5LHH A;  2CWE A;  1H0M A;  2CYY A;  2D45 A;  3CUQ B;  4AD9 A;  2VOP A;  1FP1 D;  5CJ9 A;  1BC7 C;  3ZN1 A;  2VE9 A;  2XVC A;  5EEH A;  4IHT A;  3FHZ A;  1FNN A;  4KIB A;  1TQP A;  2RQP A;  4BHP A;  4UNO A;  2L4A A;  4CGZ A;  5DEQ A;  4WXH A;  1U8R A;  1CF7 A;  3F72 A;  2JZY A;  2F5F A;  4A5N A;  1ZG1 A;  5F1R A;  4NQW A;  1QNT A;  1FYK A;  2M5W A;  3GYH X;  3TO6 A;  1FPQ A;  1XGN A;  3HHH A;  2PFB A;  3KP4 A;  3I71 A;  2E1C A;  4HQE A;  2RN7 A;  3ECO A;  2EB7 A;  2GA2 A;  1JXS A;  3RYR A;  2E7W A;  3GFL A;  1OR7 A;  1DPR A;  1U5T A;  2Z5U A;  3QU6 A;  1CGP A;  4KMU X;  1XSD A;  1S7O A;  4WF2 A;  2LKP A;  2CSO A;  2CGP A;  2HWV A;  1FBU A;  3MQ0 A;  1D8K A;  1BI0 A;  2VC0 A;  4OU0 A;  2EFP A;  3I54 A;  1RI7 A;  1DPU A;  4FX0 A;  2H27 A;  2ZXJ A;  1R00 A;  2Z9O A;  4ENK A;  4CO8 A;  4I2O A;  3DP7 A;  4A5M A;  2EFN A;  5IT9 K;  3D5L A;  2DAO A;  2XIG A;  5HDG A;  4RB3 C;  4KT5 C;  4LMY A;  2VBW A;  3PQJ A;  1ZG5 A;  2XRO A;  3TO9 A;  1ODD A;  3EDP A;  4IXA A;  2GWR A;  3EQL F;  5D6E A;  3O3K A;  3WTU C;  1I6X A;  1XGM A;  2QM3 A;  3HSF A;  2UXX A;  1KQ0 A;  1MJA A;  2OBP A;  1UST A;  1FYL A;  4XLN F;  2V1X A;  1YW8 A;  1B59 A;  1X3U A;  3FXQ A;  2BEO A;  3F8M A;  3IWZ A;  2NAZ A;  3ABT A;  4FT8 A;  1FP2 A;  3GZ5 A;  5ICG A;  2GA1 A;  4U0Y A;  4PGG A;  2MBF A;  3TOB A;  2STW A;  2CQK A;  2PN6 A;  5TJJ A;  4CDG A;  4RAZ A;  1F9N A;  1EH8 A;  4BQA A;  4HYE A;  1J0R A;  1O7F A;  5F6F A;  2O6G E;  3JTG A;  4ENJ A;  5H6Q A;  4UVC A;  1QZY A;  2G9W A;  4QLC U;  3Q5F A;  3BJO A;  1OYY A;  4ESB A;  2D2W A;  3E97 A;  2Q2E A;  1MD0 A;  1Z7U A;  2GXG A;  3M8F A;  2DFI A;  3BPV A;  3FMQ A;  3V8J A;  3RKY A;  4CXF A;  4EM2 A;  3HTS B;  4HX4 A;  3I59 A;  2WC2 A;  3BJA A;  1XN7 A;  1UFM A;  4EJV A;  2DQL A;  2H94 A;  2C6Y A;  3M7G A;  2G7H A;  5K5R A;  4G7Z F;  5D5W B;  1FBQ A;  1TW3 A;  2UXN A;  3ECH A;  2KIU A;  2RC4 A;  2XAH A;  3C1D A;  3MAJ A;  3KET A;  4TV7 A;  4MTD A;  1KQ9 A;  1WKM A;  1R7J A;  3IRR A;  3HSE A;  4RB0 A;  1YW7 A;  1KYW A;  4N0B A;  3REO A;  5KK1 A;  1WSU A;  5H6R A;  1R1U A;  1W7P D;  1K6O A;  4F7Z A;  1VTN C;  2V79 A;  3S2W A;  3SQN A;  4RAY A;  5LEK A;  4S05 A;  1LDJ A;  3F6V A;  1C0W A;  3RPQ A;  4XBF A;  3AAF A;  4HV5 A;  1SFE A;  3FM5 A;  1SD6 A;  3LFK A;  5LHG A;  2OU2 A;  2P5K A;  4CIC A;  1CF7 B;  4L5J A;  1IUY A;  4KYW A;  3NQO A;  5DUK A;  2X4H A;  3P9C A;  2F5C A;  2JRT A;  1IF1 A;  6PAX A;  2P6T A;  3K1P A;  3HYI A;  1I1G A;  4IRG A;  3QRF F;  5JHU A;  4JK1 X;  3KP5 A;  1E2X A;  4XSX F;  4G6Q A;  1LEA A;  2YSR A;  4LFU A;  1B9N A;  2PJP A;  2ZKZ A;  5DD8 A;  1U5T B;  2W57 A;  5D4S A;  1HSJ A;  4RGU A;  2K27 A;  3CJN A;  2BV6 A;  2O0Y A;  3TOA A;  2FBK A;  3CO6 C;  3EYY A;  4PGH A;  5JR3 A;  4M73 A;  2HZT A;  1HW5 A;  3U1D A;  3CO7 C;  5D5V B;  1XDU A;  4NHJ A;  1MKM A;  4M74 A;  3J80 Z;  2LDU A;  5E1W A;  1ZRD A;  5LLQ A;  2L54 A;  3LWF A;  3VFZ A;  2A07 F;  2HKO A;  1IRG A;  2FU4 A;  2GAU A;  4KN4 X;  1HQC A;  4A6E A;  4GO1 A;  3J81 Z;  1R36 A;  4OIQ F;  2RNJ A;  4L0Z B;  4WK8 F;  2Y48 A;  4EJT A;  5J8F A;  4Y13 A;  4M9X A;  1XGS A;  1BM9 A;  2RV8 A;  5FFX A;  4LJZ F;  3ELK A;  3F8N A;  3DPL C;  4ZYG A;  3MZY A;  2LSO A;  1QO0 D;  2WTE A;  3F23 A;  3SZT A;  4YFN F;  2MC3 A;  2VN2 A;  2OAZ A;  4UV8 A;  3GFM A;  1W5S A;  1LDD A;  4CZZ A;  2JPB A;  3V8K A;  3RYP A;  3JAM Z;  5KVR A;  3COA C;  2XAQ A;  2DW4 A;  2VT2 A;  2V1U A;  1YTY A;  1FBS A;  4KIG A;  1FSH A;  4U7B A;  2IPQ X;  3P9I A;  1R22 A;  3QPH A;  5FFZ A;  3BY6 A;  2W25 A;  4RB1 A;  2XV4 S;  3O6B B;  4U0V A;  1XD7 A;  1PP7 U;  4I98 B;  2XAF A;  3R0J A;  3HRM A;  2RVC A;  1BI2 A;  1J5Y A;  2FMY A;  3V7C A;  2VOD A;  5K5Q A;  2RDP A;  2W85 A;  3ZPL A;  4G94 A;  1ZHF A;  2EFO A;  3V8L A;  2MLG A;  3Q9V A;  1W7P A;  3I59 B;  2DU9 A;  2A3S A;  1QGP A;  3NRV A;  1TBX A;  3L7W A;  2YX4 A;  1O7L A;  1ZYR F;  4I09 A;  2NNY A;  2XRN A;  3QPT A;  2QUF A;  3KLO A;  4LLG F;  2A6E F;  3IKT A;  2BE5 F;  5HVQ C;  1FC3 A;  3ZMV A;  3SHF A;  3WGI A;  2Z33 A;  4A6D A;  4CHU A;  2HGC A;  2F5E A;  2IRF G;  4S04 A;  3BOQ A;  3ZMZ A;  3DFG A;  3KP2 A;  3F6O A;  1JHF A;  1K7A A;  1IAW A;  2H09 A;  1BI3 A;  4PDK A;  3WU0 A;  4BHC A;  4HF2 A;  4WXC A;  4EV0 A;  3WTY C;  1KYZ A;  4M9Z A;  3PQK A;  2K7L A;  3E5Q A;  3R4K A;  5A2Q Z;  1KQ8 A;  1XDS A;  5ILS A;  1PDN C;  1IXR C;  4LB6 B;  4LG0 A;  2AXL A;  2DT5 A;  4Q5S F;  3CDH A;  4WXD A;  4KN7 X;  5IT3 A;  4OMY A;  3MCZ A;  1LJ9 A;  1WRJ A;  3GUD A;  3I0T A;  5FLX K;  2MD5 A;  4EJW A;  3BWG A;  1SD7 A;  3C3W A;  2E7X A;  2CW0 F;  5HLH A;  3ZMD A;  1QBJ A;  3E6B A;  5DYM A;  2VT3 A;  5ILV A;  1TLH B;  4UV9 A;  1BI1 A;  3F21 A;  1O3T A;  3ZMS A;  3NEU A;  2V6C A;  4IPA A;  5E1X A;  5IT9 Z;  4GXO A;  4Q48 A;  4GCV A;  3VOD A;  1PUE E;  4ZYE A;  4FHT A;  2Y0M A;  3K1M A;  5FGM A;  4ENM A;  1WWX A;  2HTJ A;  2UWM A;  5F64 A;  3GW2 A;  4YFK F;  2O61 A;  2PI0 A;  3R60 A;  2A61 A;  1ZRC A;  1O3S A;  4L18 B;  1HW1 A;  2ZFW A;  1GXQ A;  1D3Y A;  5D5U B;  3FF5 A;  4IRH A;  2DPD A;  5HLI A;  3TDZ C;  5JFR A;  4IVN A;  3CLO A;  1S3J A;  2JTV A;  2A68 F;  5HDK A;  2MH2 A;  4YIF A;  5L3F A;  2DLL A;  4RB2 C;  2KJB A;  1RIO H;  4B8X A;  2HEO A;  4P55 A;  3E5X A;  2ZNZ A;  1H9G A;  3OV8 A;  1SMT A;  1XCB A;  2ZJ2 A;  1T39 A;  3DEU A;  2P5V A;  4R79 A;  3HRU A;  4KIC A;  5LGT A;  1KU7 A;  1QQI A;  3HSR A;  3RKW A;  1UCR A;  3RJP A;  3ROU A;  1LNW A;  3BDD A;  3KP6 A;  3FWE A;  4MTE A;  4HF0 A;  1HKQ A;  5CVR A;  1T2K A;  3Q9S A;  4M6Y A;  1MGT A;  2ETH A;  5LBQ A;  2HR3 A;  1SD5 A;  1JGS A;  1G6N A;  5HS8 A;  4RGX A;  2TDX A;  1KU3 A;  3G73 A;  1BC8 C;  5CVJ A;  3P7N A;  2V1D A;  2KRF A;  1B1B A;  5L3C A;  4LB5 A;  3K1N A;  1AOY A;  1G3S A;  3WTZ A;  1IRF A;  5BS6 A;  1LEB A;  3E6M A;  1IN5 A;  2BYV E;  2A5Y B;  2J5P A;  4I02 A;  1R5G A;  1IXS B;  2WV0 A;  4HDU A;  3GXO A;  2IT0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...