1OCZH

Bovine heart cytochrome c oxidase in azide-bound state
Total Genus 24
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
24
sequence length
75
structure length
75
Chain Sequence
YQTAPFDSRFPNQNQTRNCWQNYLDFHRCEKAMTAKGGDVSVCEWYRRVYKSLCPISWVSTWDDRRAEGTFPGKI
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Oxidoreductase
molecule keywords CYTOCHROME C OXIDASE
publication title Redox-coupled crystal structural changes in bovine heart cytochrome c oxidase.
pubmed doi rcsb
total genus 24
structure length 75
sequence length 75
chains with identical sequence U
ec nomenclature
pdb deposition date 1998-07-13

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
H PF02297 COX6B Cytochrome oxidase c subunit VIb
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.140 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Cytochrome c oxidase, subunit VIb 1oczH00
2EINH 2EIJH 1OCCH 2EIMH 3ABKH 3ASNH 1V54H 1OCOH 5B1BH 2ZXWH 5IY5H 3ABMH 2Y69H 3AG2H 3WG7H 2OCCH 5B3SH 1OCRH 2DYSH 3AG4H 3AG1H 5B1AH 1V55H 2DYRH 2EILH 2EIKH 3ASOH 3AG3H 3X2QH 1OCZH 3ABLH
chains in the Genus database with same CATH superfamily
3K4MA 1ZARA 1JI8A 5E1XA 4I2OA 3S14J 1DUXC 5L3EA 4KIBA 1YYVA 2O3FA 3OOUA 5J4YA 3HB9A 1SANA 2RKHA 3BJOA 4KDPA 4B43A 1NTCA 4DYCA 4LK1F 1ZH5A 5HLTA 3KYDB 5D8LB 3RI4A 1VTNC 2QBYB 1AWCA 2DPUA 5FKLA 1IN7A 4C3JJ 4FHTA 1WH5A 2FQ4A 1AA7A 4YFKF 3MZHA 3LFKA 2W00A 4Y13A 1O57A 3I53A 4EM2A 1QO0D 2ZFWA 1NG6A 2OF7A 1HKSA 5IYBJ 5LEJA 1OYWA 2DK8A 2AO9A 2M3AA 1Z9CA 2IEKA 3A2KA 3O2PE 1Z7UA 2WC2A 2NNYA 5D6FA 2XKPA 2H8RA 4KMFA 2FMLA 1KONA 1QHHD 4DBRA 2R7ZJ 2W1OA 3AG1H 2VQLA 3QP6A 4YEJA 3F21A 4V19K 3CJTB 2R7VA 3D5RC 4RMNA 3HOUJ 1IJWC 3T8TA 4OMYA 2G9WA 1TL8A 4A6EA 5IYDJ 2Y2ZA 1FSHA 3F8FA 5EZHA 2LREA 1R23A 1QU3A 2XF7A 4W97A 1LVKA 2K9MA 1GVDA 1BR1A 2DDBA 5JLWA 5BMZA 5L3FA 4Q4ZF 3S8PA 1ZG3A 3I9V2 3IAS2 3JSOA 3J80Z 2QYOA 1IN4A 1ZRDA 2LFBA 2A61A 3I71A 2ZJ2A 2HKOA 1V55H 1B9MA 4M3GA 1HQCA 2JTVA 3H5RA 3L00A 2KJCA 4IJAA 2EFPA 3HUGB 1X1CA 3RTRA 1VQOI 2W57A 2H27A 5DM6F 2MD0A 4D1QA 2LR8A 1RZ4A 3HBLA 4F91B 1OCTC 3Q3SA 4KN7X 3SZPA 3K4CA 2CV0A 4A3DJ 5M3FJ 2F5VA 4LD5A 3P5JA 4CSWA 4UVBA 1IUYA 1XMXA 1K4SA 2X48A 3HPHA 2LC2A 1BW6A 2GQQA 4MHGA 5K7HA 3H9JA 1W0TA 2J5PA 3ZP5A 3S2DJ 4IKFA 4Q5SF 5CJ9A 4XLCA 2EIKH 1XGMA 2R5ZB 5FO5A 2E5NA 1I39A 3DEUA 4EGZA 5CPRB 1RETA 3PFIA 4CICA 4B8XA 1MSFC 2QSHX 4N4OB 4WWCA 4MTEA 2LBFB 1T0FA 2R92J 1D5YA 2GZWA 4KN4X 1FMWA 1D0ZA 2Y48A 2XSDC 2DQRA 2VKHA 1DPRA 3TW6A 3CCSI 3J81Z 2DYSH 4IPAA 3IKTA 4KIFA 3E5XA 5FB2A 1I6HJ 1F1ZA 3WHBA 1HC8A 4MFDA 4P5OA 2R7TA 3I58A 2ZJPF 1BC8C 4PDKA 2A5WA 4B44A 2VKDA 2OUMA 4ZDPA 3FM5A 3FXLA 3ASNH 1YJWI 5ED4A 1SVLA 3KEOA 3RDIA 4XL9A 4KA4A 2BXZA 4RBOA 4ABZA 4D5FA 3BLYA 3BC8A 3HYIA 1ONVA 2AXTC 1W5CC 1LFPA 3C18A 2VN2A 1BI0A 3EDPA 1H88C 3O8HA 4RB0A 2JA8J 3IWFA 3IAM2 2BV6A 1HW5A 4ZZLA 3MKWB 2X6YA 2PMZA 3GMEA 4C2UA 5IY5H 2DAOA 1I50J 4CXFA 3R0JA 3GWZA 1MGTA 1XCBA 5CYVA 4OU0A 1QA6A 1BR2A 3BDDA 1TTYA 2FD5A 3IL2A 2IGOA 3FXMA 1HDDC 4BHBA 3GXOA 4HNVA 1DP3A 4U0YA 1D8KA 1AU7A 2JA6J 3R60A 3PUBA 3RKWA 3CMEI 2Z5UA 1BBYA 1T56A 2CQKA 2L7ZA 3CUQC 2QM3A 3EYYA 3OY9A 3LAJA 2BEOA 4BXXJ 3W6JB 4BU2A 1KZHA 2VJ4A 1SFEA 2O5RA 4KT5C 3WG7H 2GXAA 1G3TA 2M8GX 2MC3A 1U3EM 2VXDA 1ZLJA 4HPQA 1MIJA 3LSTA 3K10A 2I8DA 4M6XA 4LB6B 4D7MA 4BEHB 1A6QA 1BOAA 3MVPA 4LIVA 5CVJA 4EJWA 3C3WA 1WJDA 1XB4A 1ETVA 1YRNA 3M8JA 3K1PA 3C2HA 1JT6A 3G1OA 4AC0A 3SZTA 2DA2A 3OS1A 2W7NA 3CMYA 1UG0A 4HSRA 3OYAA 1YW8A 5J1YA 5KK1A 1ZGJA 4XKVA 2KKOA 1UZCA 3G1MA 1POGA 2DQLA 3PIOF 2FEZA 1VFCA 1XGOA 1AOYA 3CJRB 5AIPA 1R1VA 2PMZN 2AQFA 1S3JA 2DTRA 2B7EA 3RIRA 1Y0NA 2HQAA 3K1NA 2GIVA 2XPUA 3V7SA 3CQZJ 2IT0A 4ESFA 4JQFA 1FY7A 2X1DA 3R4KA 3C7JA 2XC7A 3QP5A 2ZXWH 3WGGA 1B72B 2IVMA 1FOYA 2CW7A 3VODA 1L3LA 1N77A 2MA3A 2CJJA 4I0BA 4HBLA 3I0TA 2NVUB 1U5TB 5EZGA 2AQEA 2CYYA 1APLC 2VI6A 4CO8A 1RR8C 4L0ZB 2IAIA 4ZDLA 1G3SA 5K7ZA 4BHCA 4A3IJ 3CCRI 1QNTA 2VQCA 3WU2C 2LMDA 3A4CA 5FKKA 3OYGA 1L0OC 4BKXA 5DUIA 3ONQA 4BQOA 4XRSA 4PSWA 4MQVA 4I02A 2QQ8A 3TO6A 4XICA 1O3QA 3IHUA 2ZXHA 2V1NA 3NQOA 5J1UA 1BI1A 3D0SA 5J6XA 5EG0A 4GO1A 1HCRA 2QSGX 5JI6A 1PUFB 3R0AA 1S72I 2CG4A 2Y0MA 1R58A 2IXSA 2WTEA 4ZYGA 2K9SA 1FZPB 1FBUA 2W85A 2P7VB 3A01B 3H3VK 2IRFG 2UXNA 4PSXA 5C3EJ 4EQQA 2M0CA 1LJ9A 3QAHA 4ON0A 2R7DA 2V9VA 3KZZA 3PNYA 1YOVB 3B6CA 1FP2A 1BM9A 3K6GA 2R7QA 3EUHC 1X1AA 3S1QJ 2E7XA 4C3IJ 5D5WB 2GIZA 3OYDA 2XAUA 4WXHA 2HKXA 3H9QA 1P4AA 1FX7A 1IDYA 4IXAA 3BCBA 5K5RA 3PUFA 2RNGA 2W82A 3RZDJ 1HBXG 1NH3A 1TWGJ 1ORKA 1MSEC 2F6CA 3HOTA 3I5UA 1I3AA 2DODA 3RKQA 1VI0A 4I6ZA 1W36D 2E2JJ 4XN0A 2E2HJ 3WTXC 5L3CA 1VQLI 1Q1VA 4M6YA 1HXDA 4PJ0C 1BR4A 4JBAA 5J47A 4S05A 3ELKA 3TOAA 4EEFG 3OIQA 1YIJI 3HL2A 1ZGWA 5HS9A 3A01A 3HOYJ 3ZQ7A 4YIIA 4V2FA 1OJLA 4P9UA 3LA3A 1XGNA 2MD5A 3MZYA 1ZREA 2K02A 1S6LA 1C0WA 4UV9A 5LHIA 3DLLF 4A0YA 2HYFA 4FISA 1XD7A 1IRZA 3ULQB 2IA1A 4A5NA 1CF7A 3GLLA 4LJZF 2FUG2 1R6RA 1HW1A 1G3YA 4BE1A 4BJ6C 1R5GA 1VQ9I 2LY1A 4B47A 1YHQI 3GLXA 1A04A 3CLOA 3ZMZA 3D5LA 4UUSB 3WTUC 4NUBA 5BOXA 2IGNA 3CF5F 3HTUA 4QLCU 2VE9A 3CO6C 3BOQA 3BR5A 2Z1DA 4J00A 2DOAA 3G2BA 4RGRA 5L3DA 2PFBA 1TC3C 4A5MA 1LE8B 2ADUA 1FYLA 3CCYA 2ZCWA 3ABKH 2H6CA 2QZ8A 2A5YB 3BPVA 2P6SA 2EV0A 3ABMH 3GBGA 3RKXA 4OMZA 2VUMJ 3LQQA 4S0HB 2VBXA 2UWMA 2CQQA 5C4XJ 5J3LA 4A0ZA 3FXQA 3CC4I 1EH6A 5FLMJ 1A36A 3AG4H 3LA7A 2D2WA 1IZ1A 2LF8A 3A1YA 4MO7A 2RC4A 2V9KA 3KEYA 3DF8A 4C3HJ 2RV8A 2CMPA 2DFIA 1VQ6I 3R6SA 5J1RA 1ULYA 3VYSB 2WWYA 4A3EJ 5F27A 1W7PB 3S1RJ 5E20A 4XK4A 1XSVA 4UXNA 4D5CA 2NVQJ 1S8NA 3HOZJ 2F4IA 3I59A 5TISC 1QBJA 3UNGC 1GT0C 4F55A 1TWAJ 3K0LA 1TT5B 1LEBA 2Y31A 2A68F 1LVAA 2FF4A 4GRIA 4HEA2 4RA2A 2NAZA 4S04A 1X4PA 3AL0C 2BHZA 2ME6A 2PJPA 5HNFA 3GTJJ 3PNTA 1SD5A 3RPQA 1LDDA 2DT7B 3MKZA 5HNHA 1X3WB 4C2MJ 2KJBA 1IG7A 3O3KA 2DMNA 4B1RA 2A6EF 1HF0A 1BC7C 4G6DA 2CRGA 4HDUA 4II3A 1FLIA 3MD2A 3I55I 4HV6A 3FXRA 4N0BA 4XORA 3CJQB 3HDDA 1QZEA 4AUXA 1IUFA 2CUJA 3KP2A 3N05A 5F0HA 2NYXA 2BBYA 4C9YA 3K70D 4WXDA 1J7KA 2Z9OA 3BG7A 2VE8A 3T0YA 2DA3A 3HSRA 3TBIA 4YG2F 4XNFA 2UZKA 5BPIA 3ZMUA 2TDXA 1YX5A 1AKHB 5KVRA 2CFXA 4LOCA 2W84A 4MQ9F 3E5UA 3JSPA 3OYKA 3NWTA 2E5ZA 3HHGA 3I4NJ 5L3BA 1JKRC 2L9RA 4ANJA 5KAIC 2R93J 4M9SA 3RPUA 2OZUA 2PX9A 2HI3A 4PCQA 4OAZA 1AHDP 2ISZA 2CWEA 2ZSIB 1KQ9A 3RZOJ 2EH3A 3E6CC 3M07A 4HLXA 3E0JB 2LG4A 4NBQA 5B5EC 2KL4A 1LEAA 3H3UA 1Y39A 1ZK8A 2QWWA 3CDIA 4CZZA 5D5UB 4AIJA 1GHCA 3K2ZA 1GUUA 4M73A 4EMSA 1YG2A 5ICEA 1J09A 4F52A 1HKQA 4LB5A 1YW9A 5FKNA 5DEQA 3H5NA 1GV5A 1WVRA 1NG7A 4G7OF 2M8EA 3SEZA 3GO5A 2ACJA 1ZHFA 2HVSA 1B59A 3OYCA 3HHHA 3TQNA 2STWA 1SVOA 1LUJB 2K3PA 4R1HA 4AIDA 2HDDA 4A3GJ 4ENKA 3OYJA 4Z2YA 1V4RA 3DU5A 2HZTA 3SEQA 3EYIA 2L7FP 2XIGA 1WFXA 3C2BA 2P0WA 3GCMA 3QODA 3FM3A 1NK3P 5DDGA 3QPSA 4BHPA 2R7FA 5C44J 1MJ9A 4ITVA 3ZMSA 1SVMA 4Q48A 1BI3A 2HTSA 3K4NA 4FE4A 1FTTA 2COMA 2KQRA 3EETA 2A3SA 1D1AA 1OYYA 4KISA 3CCMI 1O3SA 5DYMA 2DA4A 4KUMA 1A31A 5B1BH 1FIAA 5D5XB 1EV7A 3KLNA 4AWXB 2WAEA 4FQGA 1MW7A 1VNDA 4RS8A 5D6EA 1XCVA 3S3OA 3E97A 2E1MC 4BJTA 2QLZA 5LHGA 4H4KC 4ZZDA 3HKZA 4L5JA 1Z67A 3KE2A 1MBJA 2HPMA 1P92A 4RM3A 4RAFA 1SD4A 2ELHA 3DKWA 1FYMA 3CP8A 4TV7A 2RN7A 3IH2A 2MLKA 2DPDA 3W2WA 3J7AO 4LLGF 3CMAI 1FSEA 2PI0A 3VSKA 4HA8A 1DDNA 5EEGA 1WWXA 2DFFA 1W5TA 1D3YA 4A3MJ 4QSHA 2W4SA 3OYFA 2YUSA 1S5LC 1B9NA 1I27A 1KYWA 2JT1A 2XAGA 3COAC 3LOCA 4DNCA 2X1CA 3S1MJ 1I1GA 4BH9A 3TGNA 3K4LA 3KP5A 1QVUA 2XV4S 1HSJA 1VQPI 3L7WA 4HX4A 2R7SA 1IN8A 2E1MB 4QPQA 2CV2A 4RGSA 4DGWB 1D1BA 3WTTC 4G9YA 5JHFA 1RRJA 2VB6A 4M9ZA 1G3WA 2XRLA 1OCPA 1E3HA 2P5VA 3FX3A 1TW2A 3W6VA 2B0LA 2Y30A 3SYTA 1Z05A 4XR6A 3RQIA 3G71I 1IN5A 2VT2A 2GXBA 5EEAA 1WCMJ 2P81A 2VONA 2IS4A 4A3KJ 1BW5A 4NC8A 1BOBA 2DJIA 2GOMA 4NB5A 1S7EA 2CSOA 1RKTA 1B4AA 2DJNA 1XGSA 5JVGF 1FP1D 1VF9A 2FNPA 3FXKA 3M4OJ 2GLOA 4P55A 3HZJA 5LFAA 3HKZN 1YO5C 1OPCA 2OA4A 5HOOA 4GFBA 3HEFA 3PSIA 1Q1HA 4PGGA 5BS6A 3GTLJ 4XRFA 3V7CA 3WHCA 4E7ZA 2O9LA 2K3FA 4RAZA 4ZC3A 2OTJI 2Y0SA 2FBHA 3SFIA 3GFIA 4KYWA 2EPFA 1FPQA 3OOPA 1YITI 3EUKL 2CQXA 1TQIA 1ZTRA 2F2EA 1FYKA 2F5FA 5GP9A 4F93B 4CCOA 1VQ7I 2FNAA 4WX9A 3WE2A 3ZQFA 1TWHJ 3ZMTA 3JR9A 2LOOA 1ZG1A 3FXOA 2W25A 2DK5A 5E3OA 4HSTA 3BWGA 4CZCA 4IO9F 2ZFUA 4A6DA 4GDFA 3QWLA 1WI9A 4Z6YA 2K7LA 4YIRX 2G7HA 1LDJA 4PJNA 3RPUD 3PL8A 1NK2P 2JPCA 3VPRA 4HF2A 1R5ID 2XVCA 1JHHA 3K4BA 1GXQA 3KP4A 5M5XJ 4E70A 5CQEA 3TDZC 3CLQA 2FBKA 5H6QA 3ESWB 5FKMA 3HSEA 5D5VB 3JTHA 2NS7A 5E79C 3GTKJ 1GVJA 2E1NA 1X2MA 4ZYDA 2TCTA 1Z77A 2CW8A 3V8JA 5BNGA 5EYRA 1T8IA 1QPIA 1JXSA 1X1BA 1DQUA 1KU9A 2Y69H 3A0HC 2F48A 3IRQA 3FDYA 5BQTA 2PMHA 2VBZA 4IHXA 2EFNA 3M1CA 2VL8A 3TP0A 1UJ8A 2XF5A 3F0CA 2XKOA 1LQ1A 1MD0A 3S17J 2XHKA 3OYHA 3L09A 3JRHA 3AG3H 3DV8A 2Y0SN 3K9TA 1ZRFA 1J9IA 2KRHA 4IQ4A 2PEXA 1Y1VJ 3BROA 2VOPA 3K1MA 1PUEE 2Q8KA 4ESJA 4M3BA 4WXCA 2X6WA 1OQYA 2LSOA 2NXNB 1TBXA 2IPQX 2V1DA 4I98B 3CTAA 1JJ6C 1SMYF 3FK7A 2EFWA 1ETYA 2L4AA 4FX4A 5H20A 3JRGA 3H5AA 2EFOA 1VZ0A 2HR3A 3ASOH 1ZRCA 2K4JA 1SAUA 2QCOA 3GUDA 5CVVA 3KP3A 3DU6A 2QVOA 1VQ8I 3EUAA 4NNJA 1S29A 2YU9J 3BTLA 4A3LJ 2EIJH 1BIAA 5FLVA 2K86A 1N75A 4M3DA 3U1KA 2F4MB 3HGGA 4IRGA 1R7JA 4RAYA 4CA0A 3BQYA 2E2IJ 1YRNB 4YFXF 5H6RA 1U8RA 1Z0XA 2BY3A 4YIFA 1ETOA 3DXJF 2JK3A 2CQ7A 4U88A 2P7CB 2XGDA 1EKEA 3FK6A 4XOPA 1RNLA 3CUOA 5CVUA 2CFOA 2DDAA 1G8XA 3F8MA 5FGMA 1JUSA 1J5YA 4UNOA 4H0EA 3SDBA 4Y4RA 4XQFA 1R9TJ 4PZJA 2HXIA 3DPLC 4CDGA 1MJBA 2HS5A 3WTVC 5C4JJ 3TMOA 3LL7A 2FU4A 2L0KA 2EB7A 4O6JA 4BBRJ 2L7KA 2ESNA 1WPKA 4GXOA 2EA2A 2ICWG 3PQKA 4EJOA 4UB6C 5DD4A 3FZVA 4BDZA 3Q0UA 2BW3B 2HQ5A 2L9VA 3VYUB 3BZCA 1SAXA 4MEYF 1EF4A 2Z2SB 2H1KA 2RQQA 2Y75A 3HSFA 4FASD 2UUZA 1JTXA 2X9DA 3E3VA 2O6GE 1MNDA 3P9CA 3AG2H 2F5CA 4G7HF 1U5TC 3MAJA 1ETQA 5E17F 4XSXF 3BZKA 2KDZA 2GOXB 4XIDA 4KMUX 5IPAA 3DWLE 5GADJ 5EG0B 1Z3XA 2RNJA 5B1AH 2LTPA 3ZMDA 1WHUA 4XBFA 4YRVA 3HPGA 3M1EA 2KPMA 1T39A 4CCMA 3S3MA 2QQBA 1JE8A 2L02A 4X0GA 6PAXA 5H2FC 3ZN1A 1HA8A 1OR7A 2JVGA 4ENJA 2K9QA 3VEPA 1TNSA 3CCEI 4ZDOA 2DA7A 1RUNA 5HDKA 1FT9A 5FFZA 3LWFA 3LA2A 2ZSHB 3TEDA 2VQHA 3JCUC 1W0UA 3S16J 1PYVA 2DO7A 1UG2A 2OBPA 5DCMA 2FQ3A 4NC7A 3AKZA 2H6BA 2KZVA 4A3BJ 1MJAA 2XAFA 1Z7LA 2BW3A 1ZR4A 3S32A 4F92B 5E1ZB 2R4GA 2KIFA 4FTHA 3MN2A 4IF4A 4RB2C 3BZ6A 1HOMA 3IKVA 3KZIC 1OCCH 2ID6A 2WV0A 2WB1A 4QPOA 2DMPA 1B6AA 2YPRA 2DXIA 4CUGA 3M3YJ 3R61A 5LGNA 1T33A 4BY7J 5EJCA 1ZLKA 1PP7U 3CJNA 5JLXA 4XLPF 2ZB9A 1ON1A 2H1LA 4HLYA 2QKLB 1EH8A 1V3FA 4XSZF 1TQPA 3CUQA 5GPCA 3KETA 1R5HA 2K27A 5ICFA 1U9NA 1YX3A 2ISYA 2X51A 4P96A 1IRFA 4RAGA 4XLNF 3FKIJ 1FMVA 1X1DA 4HW0A 5A2QK 1P7JA 1HKTA 3SHFA 4GYGA 5K1YA 2DFEA 2IGMA 3K7AJ 3KP7A 1CF7B 4WK8F 2KZGA 4E7JA 1XSXA 4M9XA 1WJFA 2MGQA 3G3ZA 3I54A 3EQLF 2FOKA 2A6TA 2DT6A 3I3LA 4DW6A 4B3AA 2F4OB 1ZN2A 2FBIA 5DV5A 4XKBA 1WJCA 1MBHA 2L54A 1ITYA 3GTQJ 2XRNA 2P5LC 2EQRA 1V54H 1G59A 3LNQA 1SFOJ 2H8WA 2HWVA 1VQ5I 2EZLA 4YFNF 3QYBA 3DPUA 1K83J 2JA7J 2JA2A 4XKWA 4DOZA 1OCRH 1RPWA 1O3RA 2LKSA 2VBYA 1X2NA 1IXRC 4B3XA 5IYCJ 4CCLA 3OYIA 2LRDA 3M8FA 3VOEA 4XKCA 2WB1N 3T1BA 2F5EA 2XASA 4EJUA 5FRNA 2G7UA 2YSRA 2IA0A 1WJEA 1TZLA 5IP7J 4F7ZA 4Q47A 3L1PA 2Q0OA 1ERDA 1S7OA 1ZELA 3LSIA 4LMYA 3GTOJ 2HGCA 2D45A 4L18B 4XLHA 2EV5A 2EZHA 1PP8F 5F6FA 4CH7A 2I5UA 4QWQA 4N9HA 3Q9SA 1G2HA 1MNEA 1SD6A 4A69C 1U0JA 2ZMEA 4IHSA 2AXLA 5EDNA 5FKOA 3WGIA 4G7ZF 2HQRA 2HVQA 1ACIA 1WRJA 3RSNA 2FMYA 4LFUA 1U78A 5BPDA 3J7AY 3JRIA 1MBGA 2OU2A 1MBFA 3I59B 4LG3A 3HRTA 2MFZA 2L9NA 1S7AA 3TO7A 1KU3A 4U0VA 2STTA 2GA1A 3FMRA 2K4BA 2XAQA 3HRMA 3FF5A 2CH0A 3WU1B 4E6KG 4FETA 3O8GA 4C30A 1MZBA 2DA6A 1SFKA 2VXZA 2IJLA 2JQ7A 2Q2EA 1YS7A 3F8BA 3ISPA 5K5OA 2CS3A 3K69A 4JX5A 4AYBA 1ZR2A 3RCOA 1R49A 3WE3A 3ZQHA 4F3QA 3FBNB 2EINH 1HW2A 1B8IA 4CYCA 3WGHA 3E6BA 1JUMA 2KLOA 3DCFA 2QEXI 4D0PA 2DI3A 4HQMA 4I99C 1K61A 4PK4A 4KT6A 2DU9A 2IS2A 2Y9ZA 3REOA 3JRBA 1MH3A 1U6GA 1XN7A 2YS9A 3B6AA 3ZN0A 2CW0F 2OJED 3MFKA 1K4TA 2DYRH 1JGGA 1Z21A 2QQAA 3GF2A 1X19A 3MKLA 1UB9A 4FT8A 4BE0A 1BJZA 3UR3C 5F08A 4XLFA 4C2TA 2V4JC 1R1UA 4OOIA 5FJ8J 5A2QZ 3FHZA 3IV5A 2B63J 4N4NB 4RLQA 4UVCA 1IW7F 1BI2A 2E71A 3TKYA 1TP4A 2DN0A 2P8TA 3L9FA 3M7GA 4HF0A 1XS9A 2CUFA 4Y17A 3V8LA 2FX0A 4UUTA 1FOXA 1P4XA 4XOTA 4EV0A 2ESHA 1TW3A 2X1EA 3WG9A 2WY8Q 2KIMA 2K9LA 2YR2A 3CCQI 4L9VA 1IXSB 2FOWA 4NQWA 2IBDA 2EILH 1P4WA 3DBHB 2L01A 4B48A 3D5SC 3M8EA 1P9QC 3IH3A 2IP2A 3IC7A 1RESA 1USSA 2YU3A 2RDPA 3LSGA 5E8IA 4DBQA 1T08B 1RIOH 5HS8A 3HG9A 2ECBA 4EJVA 3TL4X 1IV8A 1DGWY 1XX5A 2OQGA 4AU7A 4CCKA 1YJNI 2V79A 4O5VA 4RM2A 3HTSB 3WTZA 3ZOBA 3BTJA 4ZYHA 3V7RA 2ETHA 2IA2A 5D8KB 4E4HA 1P2FA 3ABUA 3BTCA 4XONA 4UUVA 1QGPA 2XPWA 4E7HA 5LGTA 3V4GA 4IHWA 4M74A 4Y7NJ 2BY1A 2LKPA 2E19A 3W6KB 1IGNA 1JT0A 2GM4A 4XRMA 2TRTA 1IO2A 2OTLI 2LYCA 1X3UA 2VPLA 4BJ5C 3FISA 4ZH4F 4Y33A 1H9TA 3CD6I 1OCOH 2GXGA 3K4KA 4MFEA 1Y6IA 3UKGA 1BJAA 2OC6A 3OIOA 4A3JJ 1WKMA 4BQAA 5E8GA 4IHYA 2L2OA 1QZZA 1UHWA 3OIPA 1FC3A 4L9JA 4BS9A 1IC8A 4ENNA 1FWZA 1BN5A 3F23A 9ANTA 1ODDA 2XDVA 1YE9A 3TO9A 5LHHA 2OD5A 3TP3A 1CQTA 2VOOA 2DT5A 1DU0A 4JK1X 2M87A 5D4RA 4ZTJA 5GAHJ 5TRDA 2VASA 5ICGA 4M3FA 3OSGA 1VQ4I 3PQJA 2KIUA 5CVIA 3VSLA 4B09A 3QU6A 1MDMB 4HV5A 2JPBA 2JRTA 2VPRA 4LITA 3NARA 3SJMA 2LF7A 1SC7A 1H0MA 4ZYAA 4BAYA 1BL0A 3KFWX 4FX0A 1ZQ3P 3CP2A 5E18F 3OYBA 1JKOC 4RGUA 2PG4A 2J5OA 2EK5A 3KPHA 3WU0A 4BUPA 1K78A 5ERIA 2L4MA 1Y56A 1R4NB 1H8AC 3WTWC 4G94A 3HRSA 1FTZA 2BE5F 3SDGA 4NHJA 2R7UA 1XTAA 2EFQA 4X6AJ 2PJRB 2CO5A 3G1LA 4CCNA 2MW8A 3PSFA 5LD2C 1XG1A 3JW4A 3ZGKA 5AONA 1Z3YA 2YX4A 2VLAA 1KGSA 1Z91A 1J2XA 3BR2A 3ZQLA 4LG0A 5IOZA 4UHTA 2HNHA 2PMUA 3OYNA 4L0YB 1WQ2A 1I1SA 2PQ8A 2V1XA 5LBQA 5EGOA 3OR1C 3T8RA 3JAMK 1QZYA 5EF6A 3JTGA 2WADA 2K9NA 1MDMA 1D0YA 3H92A 4XM3A 5IP6A 2NS0A 3H0DA 1GDTA 3LSKA 4KIGA 5LEKA 2OPTA 3BR1A 4HAMA 4EM0B 3SFZA 1E17A 2QA4I 4R8HA 1XMKA 5HLIA 4IEJA 1ETWA 2VJJA 2P5KA 2Z33A 4IZZA 2VODA 3IP4B 3ABTA 4E7SA 4AD9A 5IT3A 1OMIA 2ZKZA 1LB2A 5HLHA 2ZJQF 1BA5A 3Q5FA 4GYIA 2PJRA 3A0BC 2DMUA 3WTSC 1UCRA 1MMGA 5E3MA 2RVCA 4HG2A 5JR3A 4BACA 2M5WA 2CQNA 1T0FC 2JUGA 4I76A 1I3QJ 2OCCH 2KP6A 3M9AA 4OAYA 2PN6A 4HNUA 4CHUA 5GPAA 2L7MP 3LSPA 2M4KA 2O03A 3DP7A 3GEZA 3QQAA 4LLNA 2YX7A 1XSDA 4HQEA 1S9HA 4MEXF 2JVHA 1SD7A 3OL4A 2XUBA 3TW7A 3NRVA 2HPIA 3DTEA 4BE2A 4G6QA 1FEXA 3DQVC 4HF1A 1U9OA 1A6IA 1VQKI 2DCEA 3AFHA 5E3NA 4Y52J 2VKVA 3CDHA 2VC0A 3ZPLA 3W2VA 2XGEA 3PFYA 2X6OA 2XROA 3HC7A 3PM1A 1E3OC 4EJTA 4MIMA 4WF2A 4M3EA 1YW7A 4L5EA 2BY2A 2M30A 3A02A 3DKYA 3KP6A 1RUOA 1FNNA 1W36C 3GFLA 2A69F 3ERMA 3NWSA 2XAJA 5M5WJ 1JUPA 1WSUA 3U9GA 3ABLH 3W2AA 5LRSA 2PBIA 1O7FA 4IL6C 4G8XA 2OAZA 4EGYA 1Z1DA 1REPC 2KMUA 2NOJB 3S2WA 4DZPA 3E7LA 5DCFA 1I6XA 2N8GA 2HFHA 3FBIB 2D5VA 2CV1A 2KISA 1TNTA 4ZTFA 3ROUA 2A07F 2QBYA 4AVZA 2V26A 4BL0B 3JRCA 5E1WA 1U8BA 5J4VA 1W7PD 4OIOF 4IRHA 3Q0WA 2LD5A 3CC7I 1YS6A 4RLFA 3OYMA 3Q9VA 2WV1A 4JOMA 4ETSA 1N25A 2LY9A 3ZMVA 4HZFA 3BTIA 3J7ZI 2HOSA 4HX7A 5LLQA 4EVIA 1V5GA 1R4MB 2RQPA 4MNUA 2CUEA 5ILUA 2UV1A 3WODF 1OKRA 2HZDA 1GXPA 3T5XA 3OMYA 5CLSA 2O8XA 2DA5A 3L2UA 1E0EA 1IF1A 1P7IA 2FXAA 2QQ9A 3DEEA 3PO2J 2WBMA 3FHNA 2E34A 5JVTA 1TLHB 3PJRA 1Y8QB 4PFOA 3E6MA 1JHFA 3GTPJ 2P4WA 4I01A 3F72A 4JX6A 5E3LA 3JAMZ 2MLGA 1MBKA 2BYVE 2OZ6A 1UHSA 5F1RA 4U0WA 4HRIA 5TGTA 3ERED 2OCEA 3C2GA 3L2QA 2E60A 3S3NA 3BPXA 1OLTA 2K5CA 3MMYB 1QRYA 3DTKA 1TT0A 3DTIA 4W1UA 5F64A 4ZYEA 1ZG5A 2MH9A 4P9FA 3LSJA 3F9KA 3B02A 1XPXA 3S1NJ 5DUKA 2DLLA 3GFMA 1MKMA 1UELB 4UY8I 2AHQA 1KU2A 4X1EA 3KZYA 3OSFA 3OS2A 1F5TA 3WTYC 3BG9A 2JSCA 4AIKA 2ELJA 3E5QA 3PNVA 1N78A 2AS5F 2BGCA 2QUFA 5ILVA 2LKXA 3HUGA 3DFGA 2QENA 4OINF 1MMNA 2ZJRF 1YIOA 1UMQA 2D1VA 1K7AA 1D8JA 5FRMA 1T38A 2HYJA 1RR7A 3U21A 5K5QA 4IHTA 2H94A 3BP8A 4OIQF 3U2RA 1Y8RB 4RB3C 3OYEA 1OR7C 3VDXA 3ECHA 2R7RA 4E7LA 2B9SA 4KNYA 4BGDA 2HVRA 3OS0A 3HJEA 1KA8A 4XMYA 3BR3A 4BXUA 5HDNA 2NS8A 1IRXA 4PJMA 3KYLA 2HQNA 2R5ZA 3P9KA 1YI2I 2KDOA 2V6CA 2E1OA 4IX7A 2M34A 3HRUA 2LBFA 1WJAA 3KLOA 1Y1WJ 3H35A 3BQZA 2VKEA 4YELA 3JRFA 3LQRA 3TOBA 5J8FA 3RKYA 1FBSA 5KAFC 2BZTA 2BOLA 2WAQA 2K85A 2MYSA 5FROA 3HOXJ 2CGPA 4UVAA 2KT0A 1EA3A 3DLAA 3FIWA 4GGGA 2W24A 2CU7A 2EJRA 5CVRA 3HOVJ 1F43A 3K70C 2ZO4A 4XLAA 4ASNA 2V7FA 2XGCA 4UV8A 4M71A 5JHUA 4Y15A 1G6NA 2JJ7A 2R3SA 3VYTB 2BY0A 3BG5A 2LNBA 3DBLB 2ECCA 3ECOA 2E7WA 4FCYA 5DCMB 4EM1A 2Q1ZB 5IT9K 1HDPA 2LH9A 3QPHA 1MNMC 2M7BA 5L3GA 3F6OA 2OQRA 4RGXA 1W5SA 3HIFA 1ON2A 3RQ4A 2PLYA 2EZIA 3MZ8A 3ZQQA 2XSJC 4RDUA 2M2EA 2O0YA 1R71A 4HOBA 3BR6A 4IOCF 1A35A 2G0EA 4A0XA 4G6TB 1J59A 4D9JA 2LVSA 2R5YB 4BQNA 1R22A 2VT3A 2KRCA 2HXOA 5GAGJ 1UAAA 2A6HF 1RC9A 3AAFA 4M72A 3OR2C 3CCUI 3GZ6A 1B1BA 5DS9A 2HOTA 1PJRA 5KHDA 3CUQB 3G73A 4MLOA 3FMQA 1T2KA 2ZXJA 2P6TA 5AIQA 3I64A 3KCCA 2MC4A 5LRRA 3ZQIA 1RI7A 1YFHA 1LPQA 3BR0A 1LFUP 2EWNA 2DW4A 4DJAA 3QU3A 4J01A 2DA1A 2M4GA 2WAQN 1T98A 1MMSA 2ZBKA 1ZYRF 3SZGA 1KU7A 1H89C 3GVAA 1K79A 2HDCA 1XDSA 3HM5A 2H09A 3GW2A 4U7DA 1J75A 3S2HJ 3GFJA 2O61A 3DBRB 1IN6A 3MEXA 2HTJA 3H3ZA 3HXLA 4JYKA 2F5DA 3QOEA 1ENHA 3N4MA 1DU6A 2EA4A 3CCLI 3ML6A 4IVNA 3ZQCA 5B3SH 1X58A 1QHGA 1F9NA 1Z6RA 5GTIC 3JRAA 4BEHA 2R5YA 3OL3A 2ZMEC 4A3CJ 1D0XA 1FBQA 2BVLA 2M1BA 1K6OA 3F8CA 3HOSA 4BY1J 1LKXA 1BIBA 4BXFA 2DOEA 3LSRA 1LDKB 2NVTJ 2EZKA 2BXYA 5FD6A 2R7OA 5F1JA 2KRFA 1MBEA 3BJ6A 3VFZA 1VQMI 3DEWA 3B73A 4A2UA 3DPTA 4LGWA 5DTDA 2JRMA 2KFDA 3H1CA 4NDLA 2Y9YA 1TWCJ 2E36A 3F8NA 2CUZA 4A12A 2I10A 1D5VA 3LSHA 2FA5A 2FRHA 2ZMEB 3HGYA 3FXUA 3CMMA 3MCZA 2GA2A 4K2EA 3X2QH 3QYEA 3P7NA 5JFRA 4UB8C 1YLFA 1GV2A 1B72A 1G4DA 4J19A 2Z16A 2HEOA 4ZJZA 3CO7C 5KCMA 1CGPA 1WGXA 3L2WA 2KIQA 3U1DA 1IDZA 2XB5A 1U5TA 3K4JA 5EEHA 2LY2A 3CC2I 2X0LA 1KQ0A 3K2AA 3H0GJ 5ILSA 1GLNA 1HSTA 2JWTA 4G12A 2K40A 3RJPA 2W48A 3VB2A 1O7LA 3F6VA 4OWRB 2IS1A 2COBA 2HOEA 2Q2EB 4JX4A 3EPZA 4II2A 4MTDA 3QRFF 1RKWA 4PJLA 1DP7P 3GX4X 5IT9Z 1ZGAA 3Q0VA 3LSMA 1X3ZB 4PFPA 5M3MJ 3CCVI 4E7KA 3CESA 1T6SA 4OIPF 3BG3A 2JMWA 2NVXJ 1IV6A 4LLLA 3I56I 1JGSA 2X4HA 5K7FA 4U7BA 4HYEA 3L2CA 1PUFA 2OV7A 1B8IB 2NOGA 4CYCB 4AVPA 3G6EI 1WJ5A 1FOKA 2M0MA 1KQ8A 2V9PA 1TWFJ 3L2VA 4IHVA 4DQ2A 2JSPA 1LFBA 2D1HA 2VJIA 1V5FA 4I7HA 2RREA 2XF6A 4GCVA 3O6BB 4FE7A 2R7WA 1W1WE 2NVYJ 4MGRA 2MBFA 3E6DA 4NC6A 2BVMA 3IWZA 1H9GA 3F3XA 1TQMA 2XB0X 2BHYA 2EBIA 1WZ2A 4LK0F 4WCGA 2VC1A 3CDLA 4A93J 2IS6A 2FE3A 1J0RA 3F22A 2ME0A 4P1WA 5HLGA 4O3MA 1IRGA 5FFXA 1O4XA 3GTGJ 2Z99A 3V42A 4KITB 1X4OA 1MMAA 1JTYA 1PVEA 5IP9J 1E2XA 2V6EA 4CGZA 1YTYA 2M45A 2E35A 4E7IA 2L9SA 2DMQA 2M7AA 5HS7A 3GYHX 1DPUA 3GZ5A 4NQWB 2HDWA 2XPVA 5ICCA 2LDUA 2R7XA 3FKJA 2IGKA 5FLXK 1OISA 3NAUA 2HYGD 2VQGA 1ZKGA 1FOWA 3FWEA 3EUHA 2L5QA 3ZQGA 1IAWA 4A3FJ 3ZXSA 1OYIA 3MQ0A 4I0AA 1R36A 4DIQA 5DD8A 2VIXA 1SFXA 1YQAA 1PDNC 3RYPA 1MMDA 4JP0A 1IXCA 2DMTA 2HOAA 5FD5A 5B66C 4KFCA 2VJ5A 3QYFA 2MG4A 2MH2A 4DZJA 5DM7F 4HDVA 3BY6A 1XMAA 3HOWJ 3BT9A 3QPLA 3H36A 2O8KA 2EV6A 3MWMA 4ENMA 1T95A 3SQNA 1P6RA 2MSYA 3KIOA 2Z3YA 3OV8A 4QIWN 2QGUA 4UUSA 3S93A 3QPTA 1QVTA 3LAPA 4BDYA 3VYRB 3JREA 3P9IA 3SXYA 1LE8A 3TDUC 4QTRA 1KYZA 1QQIA 4DYRA 2GAUA 1OCZH 5HVQC 1SEUA 1A5JA 4XN3A 3CCJI 4IQJA 3OYLA 1R1TA 3KX2A 4HNTA 1QPMA 2ZNZA 4BBSJ 3ZRGA 2FSWA 4Y3OA 2DTZA 1WJBA 2ZXIA 3IH4A 4AYBN 3A03A 5GTHC 2FJ1A 2DOFA 2JA5J 3LFUA 2XGXA 4D7NA 3N97A 1U2WA 2M9HA 5IOYA 4EATA 4IOAF 2RAEA 3H9GA 3CZ6A 1LNWA 2UXXA 1OFCX 1UFMA 1HLVA 1ETKA 4DYQA 2DFHA 4L9NA 1K78B 3E1SA 4PJJA 3PO3J 5TJJA 1WI3A 3AL0B 3GTMJ 3IRRA 1W7PA 1O3TA 2VBWA 2QKMB 3OWTA 3L2RA 3BJAA 1WH7A 1SFUA 5KNLA 1X1PA 3G4SI 2KHMA 1D1CA 4AM3A 4BNCA 1I5ZA 2WY7Q 3FMSA 4BYYA 4PGHA 2X6XA 1R00A 2JN6A 4LG0B 1NHAA 3KYCB 2JUCA 4KJZA 1K6YA 1STZA 2WA0A 3KEQA 2R0QC 2ID3A 5EGOB 3DKXA 4V2GA 1FJLA 3BG6A 1F36A 2GWRA 1FIPA 2WAFA 1XDUA 5HDGA 5J8CA 3PIPF 3I4MJ 1DGRM 3ZCOA 1JJ8C 4XLEA 2A05A 2ZC2A 3FXJA 2JZYA 3J80K 2V1UA 1MH4A 2ELKA 1W4MA 4R79A 3S15J 2LLKA 4M6VA 4LIUA 5M5YJ 5CKTA 1SMTA 1XC5A 1ETXA 1JKQC 5HODA 1AKHA 5FLXZ 4BQQA 2EIMH 3QOPA 4RB1A 1M1EB 4HX8A 2NRAC 1YJ9I 5D4SA 1JKPC 4U87A 3ZR8X 2LK2A 4IRIA 3V8KA 3C1DA 1EJ9A 5LGUA 1F4KA 5J40A 2C6YA 4XRSG 3I4PA 3RYRA 3NEUA 4CYDA 3D1NI 3VWBA 3BCAA 4AIHA 2QSFX 4CCJA 3GZNB 3CF2A 4PUSA 1VQNI 5GAEJ 2GBYA 2IW5A 2MABA 2X85A 2E1CA 2ZNYA 2RGVA 4N9IA 2O7OA 1USTA 2L3DA 1EH7A 1UHMA 2HU9A 4KICA 3W3CA 4B4CA 2QF7A 5F04A 2DBBA 1Y0UA 4L9TA 1ZAOA 4ESBA 3JRDA 2NNNA 1V5EA 4OIRF 2XAHA 3IUOA 3J81K 1E3PA 2LP0A 4L5IA 3J7YJ 5CQGA 3LMMA 5F0FA 4I09A 3MKYB 5F0CA 1Z6TA
chains in the Genus database with same CATH topology
2EINH 2EIJH 1OCCH 2EIMH 3ABKH 3ASNH 1V54H 1OCOH 5B1BH 2ZXWH 5IY5H 3ABMH 2Y69H 3AG2H 3WG7H 2OCCH 5B3SH 1OCRH 2DYSH 3AG4H 3AG1H 5B1AH 1V55H 2DYRH 2EILH 2EIKH 3ASOH 3AG3H 3X2QH 1OCZH 3ABLH
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2EIN H;  2EIJ H;  1OCC H;  2EIM H;  3ABK H;  3ASN H;  1V54 H;  1OCO H;  5B1B H;  2ZXW H;  5IY5 H;  3ABM H;  2Y69 H;  3AG2 H;  3WG7 H;  2OCC H;  5B3S H;  1OCR H;  2DYS H;  3AG4 H;  3AG1 H;  5B1A H;  1V55 H;  2DYR H;  2EIL H;  2EIK H;  3ASO H;  3AG3 H;  3X2Q H;  1OCZ H;  3ABL H; 
#chains in the Genus database with same CATH topology
 3K4M A;  1ZAR A;  1JI8 A;  5E1X A;  4I2O A;  3S14 J;  1DUX C;  5L3E A;  4KIB A;  1YYV A;  2O3F A;  3OOU A;  5J4Y A;  3HB9 A;  1SAN A;  2RKH A;  3BJO A;  4KDP A;  4B43 A;  1NTC A;  4DYC A;  4LK1 F;  1ZH5 A;  5HLT A;  3KYD B;  5D8L B;  3RI4 A;  1VTN C;  2QBY B;  1AWC A;  2DPU A;  5FKL A;  1IN7 A;  4C3J J;  4FHT A;  1WH5 A;  2FQ4 A;  1AA7 A;  4YFK F;  3MZH A;  3LFK A;  2W00 A;  4Y13 A;  1O57 A;  3I53 A;  4EM2 A;  1QO0 D;  2ZFW A;  1NG6 A;  2OF7 A;  1HKS A;  5IYB J;  5LEJ A;  1OYW A;  2DK8 A;  2AO9 A;  2M3A A;  1Z9C A;  2IEK A;  3A2K A;  3O2P E;  1Z7U A;  2WC2 A;  2NNY A;  5D6F A;  2XKP A;  2H8R A;  4KMF A;  2FML A;  1KON A;  1QHH D;  4DBR A;  2R7Z J;  2W1O A;  3AG1 H;  2VQL A;  3QP6 A;  4YEJ A;  3F21 A;  4V19 K;  3CJT B;  2R7V A;  3D5R C;  4RMN A;  3HOU J;  1IJW C;  3T8T A;  4OMY A;  2G9W A;  1TL8 A;  4A6E A;  5IYD J;  2Y2Z A;  1FSH A;  3F8F A;  5EZH A;  2LRE A;  1R23 A;  1QU3 A;  2XF7 A;  4W97 A;  1LVK A;  2K9M A;  1GVD A;  1BR1 A;  2DDB A;  5JLW A;  5BMZ A;  5L3F A;  4Q4Z F;  3S8P A;  1ZG3 A;  3I9V 2;  3IAS 2;  3JSO A;  3J80 Z;  2QYO A;  1IN4 A;  1ZRD A;  2LFB A;  2A61 A;  3I71 A;  2ZJ2 A;  2HKO A;  1V55 H;  1B9M A;  4M3G A;  1HQC A;  2JTV A;  3H5R A;  3L00 A;  2KJC A;  4IJA A;  2EFP A;  3HUG B;  1X1C A;  3RTR A;  1VQO I;  2W57 A;  2H27 A;  5DM6 F;  2MD0 A;  4D1Q A;  2LR8 A;  1RZ4 A;  3HBL A;  4F91 B;  1OCT C;  3Q3S A;  4KN7 X;  3SZP A;  3K4C A;  2CV0 A;  4A3D J;  5M3F J;  2F5V A;  4LD5 A;  3P5J A;  4CSW A;  4UVB A;  1IUY A;  1XMX A;  1K4S A;  2X48 A;  3HPH A;  2LC2 A;  1BW6 A;  2GQQ A;  4MHG A;  5K7H A;  3H9J A;  1W0T A;  2J5P A;  3ZP5 A;  3S2D J;  4IKF A;  4Q5S F;  5CJ9 A;  4XLC A;  2EIK H;  1XGM A;  2R5Z B;  5FO5 A;  2E5N A;  1I39 A;  3DEU A;  4EGZ A;  5CPR B;  1RET A;  3PFI A;  4CIC A;  4B8X A;  1MSF C;  2QSH X;  4N4O B;  4WWC A;  4MTE A;  2LBF B;  1T0F A;  2R92 J;  1D5Y A;  2GZW A;  4KN4 X;  1FMW A;  1D0Z A;  2Y48 A;  2XSD C;  2DQR A;  2VKH A;  1DPR A;  3TW6 A;  3CCS I;  3J81 Z;  2DYS H;  4IPA A;  3IKT A;  4KIF A;  3E5X A;  5FB2 A;  1I6H J;  1F1Z A;  3WHB A;  1HC8 A;  4MFD A;  4P5O A;  2R7T A;  3I58 A;  2ZJP F;  1BC8 C;  4PDK A;  2A5W A;  4B44 A;  2VKD A;  2OUM A;  4ZDP A;  3FM5 A;  3FXL A;  3ASN H;  1YJW I;  5ED4 A;  1SVL A;  3KEO A;  3RDI A;  4XL9 A;  4KA4 A;  2BXZ A;  4RBO A;  4ABZ A;  4D5F A;  3BLY A;  3BC8 A;  3HYI A;  1ONV A;  2AXT C;  1W5C C;  1LFP A;  3C18 A;  2VN2 A;  1BI0 A;  3EDP A;  1H88 C;  3O8H A;  4RB0 A;  2JA8 J;  3IWF A;  3IAM 2;  2BV6 A;  1HW5 A;  4ZZL A;  3MKW B;  2X6Y A;  2PMZ A;  3GME A;  4C2U A;  5IY5 H;  2DAO A;  1I50 J;  4CXF A;  3R0J A;  3GWZ A;  1MGT A;  1XCB A;  5CYV A;  4OU0 A;  1QA6 A;  1BR2 A;  3BDD A;  1TTY A;  2FD5 A;  3IL2 A;  2IGO A;  3FXM A;  1HDD C;  4BHB A;  3GXO A;  4HNV A;  1DP3 A;  4U0Y A;  1D8K A;  1AU7 A;  2JA6 J;  3R60 A;  3PUB A;  3RKW A;  3CME I;  2Z5U A;  1BBY A;  1T56 A;  2CQK A;  2L7Z A;  3CUQ C;  2QM3 A;  3EYY A;  3OY9 A;  3LAJ A;  2BEO A;  4BXX J;  3W6J B;  4BU2 A;  1KZH A;  2VJ4 A;  1SFE A;  2O5R A;  4KT5 C;  3WG7 H;  2GXA A;  1G3T A;  2M8G X;  2MC3 A;  1U3E M;  2VXD A;  1ZLJ A;  4HPQ A;  1MIJ A;  3LST A;  3K10 A;  2I8D A;  4M6X A;  4LB6 B;  4D7M A;  4BEH B;  1A6Q A;  1BOA A;  3MVP A;  4LIV A;  5CVJ A;  4EJW A;  3C3W A;  1WJD A;  1XB4 A;  1ETV A;  1YRN A;  3M8J A;  3K1P A;  3C2H A;  1JT6 A;  3G1O A;  4AC0 A;  3SZT A;  2DA2 A;  3OS1 A;  2W7N A;  3CMY A;  1UG0 A;  4HSR A;  3OYA A;  1YW8 A;  5J1Y A;  5KK1 A;  1ZGJ A;  4XKV A;  2KKO A;  1UZC A;  3G1M A;  1POG A;  2DQL A;  3PIO F;  2FEZ A;  1VFC A;  1XGO A;  1AOY A;  3CJR B;  5AIP A;  1R1V A;  2PMZ N;  2AQF A;  1S3J A;  2DTR A;  2B7E A;  3RIR A;  1Y0N A;  2HQA A;  3K1N A;  2GIV A;  2XPU A;  3V7S A;  3CQZ J;  2IT0 A;  4ESF A;  4JQF A;  1FY7 A;  2X1D A;  3R4K A;  3C7J A;  2XC7 A;  3QP5 A;  2ZXW H;  3WGG A;  1B72 B;  2IVM A;  1FOY A;  2CW7 A;  3VOD A;  1L3L A;  1N77 A;  2MA3 A;  2CJJ A;  4I0B A;  4HBL A;  3I0T A;  2NVU B;  1U5T B;  5EZG A;  2AQE A;  2CYY A;  1APL C;  2VI6 A;  4CO8 A;  1RR8 C;  4L0Z B;  2IAI A;  4ZDL A;  1G3S A;  5K7Z A;  4BHC A;  4A3I J;  3CCR I;  1QNT A;  2VQC A;  3WU2 C;  2LMD A;  3A4C A;  5FKK A;  3OYG A;  1L0O C;  4BKX A;  5DUI A;  3ONQ A;  4BQO A;  4XRS A;  4PSW A;  4MQV A;  4I02 A;  2QQ8 A;  3TO6 A;  4XIC A;  1O3Q A;  3IHU A;  2ZXH A;  2V1N A;  3NQO A;  5J1U A;  1BI1 A;  3D0S A;  5J6X A;  5EG0 A;  4GO1 A;  1HCR A;  2QSG X;  5JI6 A;  1PUF B;  3R0A A;  1S72 I;  2CG4 A;  2Y0M A;  1R58 A;  2IXS A;  2WTE A;  4ZYG A;  2K9S A;  1FZP B;  1FBU A;  2W85 A;  2P7V B;  3A01 B;  3H3V K;  2IRF G;  2UXN A;  4PSX A;  5C3E J;  4EQQ A;  2M0C A;  1LJ9 A;  3QAH A;  4ON0 A;  2R7D A;  2V9V A;  3KZZ A;  3PNY A;  1YOV B;  3B6C A;  1FP2 A;  1BM9 A;  3K6G A;  2R7Q A;  3EUH C;  1X1A A;  3S1Q J;  2E7X A;  4C3I J;  5D5W B;  2GIZ A;  3OYD A;  2XAU A;  4WXH A;  2HKX A;  3H9Q A;  1P4A A;  1FX7 A;  1IDY A;  4IXA A;  3BCB A;  5K5R A;  3PUF A;  2RNG A;  2W82 A;  3RZD J;  1HBX G;  1NH3 A;  1TWG J;  1ORK A;  1MSE C;  2F6C A;  3HOT A;  3I5U A;  1I3A A;  2DOD A;  3RKQ A;  1VI0 A;  4I6Z A;  1W36 D;  2E2J J;  4XN0 A;  2E2H J;  3WTX C;  5L3C A;  1VQL I;  1Q1V A;  4M6Y A;  1HXD A;  4PJ0 C;  1BR4 A;  4JBA A;  5J47 A;  4S05 A;  3ELK A;  3TOA A;  4EEF G;  3OIQ A;  1YIJ I;  3HL2 A;  1ZGW A;  5HS9 A;  3A01 A;  3HOY J;  3ZQ7 A;  4YII A;  4V2F A;  1OJL A;  4P9U A;  3LA3 A;  1XGN A;  2MD5 A;  3MZY A;  1ZRE A;  2K02 A;  1S6L A;  1C0W A;  4UV9 A;  5LHI A;  3DLL F;  4A0Y A;  2HYF A;  4FIS A;  1XD7 A;  1IRZ A;  3ULQ B;  2IA1 A;  4A5N A;  1CF7 A;  3GLL A;  4LJZ F;  2FUG 2;  1R6R A;  1HW1 A;  1G3Y A;  4BE1 A;  4BJ6 C;  1R5G A;  1VQ9 I;  2LY1 A;  4B47 A;  1YHQ I;  3GLX A;  1A04 A;  3CLO A;  3ZMZ A;  3D5L A;  4UUS B;  3WTU C;  4NUB A;  5BOX A;  2IGN A;  3CF5 F;  3HTU A;  4QLC U;  2VE9 A;  3CO6 C;  3BOQ A;  3BR5 A;  2Z1D A;  4J00 A;  2DOA A;  3G2B A;  4RGR A;  5L3D A;  2PFB A;  1TC3 C;  4A5M A;  1LE8 B;  2ADU A;  1FYL A;  3CCY A;  2ZCW A;  3ABK H;  2H6C A;  2QZ8 A;  2A5Y B;  3BPV A;  2P6S A;  2EV0 A;  3ABM H;  3GBG A;  3RKX A;  4OMZ A;  2VUM J;  3LQQ A;  4S0H B;  2VBX A;  2UWM A;  2CQQ A;  5C4X J;  5J3L A;  4A0Z A;  3FXQ A;  3CC4 I;  1EH6 A;  5FLM J;  1A36 A;  3AG4 H;  3LA7 A;  2D2W A;  1IZ1 A;  2LF8 A;  3A1Y A;  4MO7 A;  2RC4 A;  2V9K A;  3KEY A;  3DF8 A;  4C3H J;  2RV8 A;  2CMP A;  2DFI A;  1VQ6 I;  3R6S A;  5J1R A;  1ULY A;  3VYS B;  2WWY A;  4A3E J;  5F27 A;  1W7P B;  3S1R J;  5E20 A;  4XK4 A;  1XSV A;  4UXN A;  4D5C A;  2NVQ J;  1S8N A;  3HOZ J;  2F4I A;  3I59 A;  5TIS C;  1QBJ A;  3UNG C;  1GT0 C;  4F55 A;  1TWA J;  3K0L A;  1TT5 B;  1LEB A;  2Y31 A;  2A68 F;  1LVA A;  2FF4 A;  4GRI A;  4HEA 2;  4RA2 A;  2NAZ A;  4S04 A;  1X4P A;  3AL0 C;  2BHZ A;  2ME6 A;  2PJP A;  5HNF A;  3GTJ J;  3PNT A;  1SD5 A;  3RPQ A;  1LDD A;  2DT7 B;  3MKZ A;  5HNH A;  1X3W B;  4C2M J;  2KJB A;  1IG7 A;  3O3K A;  2DMN A;  4B1R A;  2A6E F;  1HF0 A;  1BC7 C;  4G6D A;  2CRG A;  4HDU A;  4II3 A;  1FLI A;  3MD2 A;  3I55 I;  4HV6 A;  3FXR A;  4N0B A;  4XOR A;  3CJQ B;  3HDD A;  1QZE A;  4AUX A;  1IUF A;  2CUJ A;  3KP2 A;  3N05 A;  5F0H A;  2NYX A;  2BBY A;  4C9Y A;  3K70 D;  4WXD A;  1J7K A;  2Z9O A;  3BG7 A;  2VE8 A;  3T0Y A;  2DA3 A;  3HSR A;  3TBI A;  4YG2 F;  4XNF A;  2UZK A;  5BPI A;  3ZMU A;  2TDX A;  1YX5 A;  1AKH B;  5KVR A;  2CFX A;  4LOC A;  2W84 A;  4MQ9 F;  3E5U A;  3JSP A;  3OYK A;  3NWT A;  2E5Z A;  3HHG A;  3I4N J;  5L3B A;  1JKR C;  2L9R A;  4ANJ A;  5KAI C;  2R93 J;  4M9S A;  3RPU A;  2OZU A;  2PX9 A;  2HI3 A;  4PCQ A;  4OAZ A;  1AHD P;  2ISZ A;  2CWE A;  2ZSI B;  1KQ9 A;  3RZO J;  2EH3 A;  3E6C C;  3M07 A;  4HLX A;  3E0J B;  2LG4 A;  4NBQ A;  5B5E C;  2KL4 A;  1LEA A;  3H3U A;  1Y39 A;  1ZK8 A;  2QWW A;  3CDI A;  4CZZ A;  5D5U B;  4AIJ A;  1GHC A;  3K2Z A;  1GUU A;  4M73 A;  4EMS A;  1YG2 A;  5ICE A;  1J09 A;  4F52 A;  1HKQ A;  4LB5 A;  1YW9 A;  5FKN A;  5DEQ A;  3H5N A;  1GV5 A;  1WVR A;  1NG7 A;  4G7O F;  2M8E A;  3SEZ A;  3GO5 A;  2ACJ A;  1ZHF A;  2HVS A;  1B59 A;  3OYC A;  3HHH A;  3TQN A;  2STW A;  1SVO A;  1LUJ B;  2K3P A;  4R1H A;  4AID A;  2HDD A;  4A3G J;  4ENK A;  3OYJ A;  4Z2Y A;  1V4R A;  3DU5 A;  2HZT A;  3SEQ A;  3EYI A;  2L7F P;  2XIG A;  1WFX A;  3C2B A;  2P0W A;  3GCM A;  3QOD A;  3FM3 A;  1NK3 P;  5DDG A;  3QPS A;  4BHP A;  2R7F A;  5C44 J;  1MJ9 A;  4ITV A;  3ZMS A;  1SVM A;  4Q48 A;  1BI3 A;  2HTS A;  3K4N A;  4FE4 A;  1FTT A;  2COM A;  2KQR A;  3EET A;  2A3S A;  1D1A A;  1OYY A;  4KIS A;  3CCM I;  1O3S A;  5DYM A;  2DA4 A;  4KUM A;  1A31 A;  5B1B H;  1FIA A;  5D5X B;  1EV7 A;  3KLN A;  4AWX B;  2WAE A;  4FQG A;  1MW7 A;  1VND A;  4RS8 A;  5D6E A;  1XCV A;  3S3O A;  3E97 A;  2E1M C;  4BJT A;  2QLZ A;  5LHG A;  4H4K C;  4ZZD A;  3HKZ A;  4L5J A;  1Z67 A;  3KE2 A;  1MBJ A;  2HPM A;  1P92 A;  4RM3 A;  4RAF A;  1SD4 A;  2ELH A;  3DKW A;  1FYM A;  3CP8 A;  4TV7 A;  2RN7 A;  3IH2 A;  2MLK A;  2DPD A;  3W2W A;  3J7A O;  4LLG F;  3CMA I;  1FSE A;  2PI0 A;  3VSK A;  4HA8 A;  1DDN A;  5EEG A;  1WWX A;  2DFF A;  1W5T A;  1D3Y A;  4A3M J;  4QSH A;  2W4S A;  3OYF A;  2YUS A;  1S5L C;  1B9N A;  1I27 A;  1KYW A;  2JT1 A;  2XAG A;  3COA C;  3LOC A;  4DNC A;  2X1C A;  3S1M J;  1I1G A;  4BH9 A;  3TGN A;  3K4L A;  3KP5 A;  1QVU A;  2XV4 S;  1HSJ A;  1VQP I;  3L7W A;  4HX4 A;  2R7S A;  1IN8 A;  2E1M B;  4QPQ A;  2CV2 A;  4RGS A;  4DGW B;  1D1B A;  3WTT C;  4G9Y A;  5JHF A;  1RRJ A;  2VB6 A;  4M9Z A;  1G3W A;  2XRL A;  1OCP A;  1E3H A;  2P5V A;  3FX3 A;  1TW2 A;  3W6V A;  2B0L A;  2Y30 A;  3SYT A;  1Z05 A;  4XR6 A;  3RQI A;  3G71 I;  1IN5 A;  2VT2 A;  2GXB A;  5EEA A;  1WCM J;  2P81 A;  2VON A;  2IS4 A;  4A3K J;  1BW5 A;  4NC8 A;  1BOB A;  2DJI A;  2GOM A;  4NB5 A;  1S7E A;  2CSO A;  1RKT A;  1B4A A;  2DJN A;  1XGS A;  5JVG F;  1FP1 D;  1VF9 A;  2FNP A;  3FXK A;  3M4O J;  2GLO A;  4P55 A;  3HZJ A;  5LFA A;  3HKZ N;  1YO5 C;  1OPC A;  2OA4 A;  5HOO A;  4GFB A;  3HEF A;  3PSI A;  1Q1H A;  4PGG A;  5BS6 A;  3GTL J;  4XRF A;  3V7C A;  3WHC A;  4E7Z A;  2O9L A;  2K3F A;  4RAZ A;  4ZC3 A;  2OTJ I;  2Y0S A;  2FBH A;  3SFI A;  3GFI A;  4KYW A;  2EPF A;  1FPQ A;  3OOP A;  1YIT I;  3EUK L;  2CQX A;  1TQI A;  1ZTR A;  2F2E A;  1FYK A;  2F5F A;  5GP9 A;  4F93 B;  4CCO A;  1VQ7 I;  2FNA A;  4WX9 A;  3WE2 A;  3ZQF A;  1TWH J;  3ZMT A;  3JR9 A;  2LOO A;  1ZG1 A;  3FXO A;  2W25 A;  2DK5 A;  5E3O A;  4HST A;  3BWG A;  4CZC A;  4IO9 F;  2ZFU A;  4A6D A;  4GDF A;  3QWL A;  1WI9 A;  4Z6Y A;  2K7L A;  4YIR X;  2G7H A;  1LDJ A;  4PJN A;  3RPU D;  3PL8 A;  1NK2 P;  2JPC A;  3VPR A;  4HF2 A;  1R5I D;  2XVC A;  1JHH A;  3K4B A;  1GXQ A;  3KP4 A;  5M5X J;  4E70 A;  5CQE A;  3TDZ C;  3CLQ A;  2FBK A;  5H6Q A;  3ESW B;  5FKM A;  3HSE A;  5D5V B;  3JTH A;  2NS7 A;  5E79 C;  3GTK J;  1GVJ A;  2E1N A;  1X2M A;  4ZYD A;  2TCT A;  1Z77 A;  2CW8 A;  3V8J A;  5BNG A;  5EYR A;  1T8I A;  1QPI A;  1JXS A;  1X1B A;  1DQU A;  1KU9 A;  2Y69 H;  3A0H C;  2F48 A;  3IRQ A;  3FDY A;  5BQT A;  2PMH A;  2VBZ A;  4IHX A;  2EFN A;  3M1C A;  2VL8 A;  3TP0 A;  1UJ8 A;  2XF5 A;  3F0C A;  2XKO A;  1LQ1 A;  1MD0 A;  3S17 J;  2XHK A;  3OYH A;  3L09 A;  3JRH A;  3AG3 H;  3DV8 A;  2Y0S N;  3K9T A;  1ZRF A;  1J9I A;  2KRH A;  4IQ4 A;  2PEX A;  1Y1V J;  3BRO A;  2VOP A;  3K1M A;  1PUE E;  2Q8K A;  4ESJ A;  4M3B A;  4WXC A;  2X6W A;  1OQY A;  2LSO A;  2NXN B;  1TBX A;  2IPQ X;  2V1D A;  4I98 B;  3CTA A;  1JJ6 C;  1SMY F;  3FK7 A;  2EFW A;  1ETY A;  2L4A A;  4FX4 A;  5H20 A;  3JRG A;  3H5A A;  2EFO A;  1VZ0 A;  2HR3 A;  3ASO H;  1ZRC A;  2K4J A;  1SAU A;  2QCO A;  3GUD A;  5CVV A;  3KP3 A;  3DU6 A;  2QVO A;  1VQ8 I;  3EUA A;  4NNJ A;  1S29 A;  2YU9 J;  3BTL A;  4A3L J;  2EIJ H;  1BIA A;  5FLV A;  2K86 A;  1N75 A;  4M3D A;  3U1K A;  2F4M B;  3HGG A;  4IRG A;  1R7J A;  4RAY A;  4CA0 A;  3BQY A;  2E2I J;  1YRN B;  4YFX F;  5H6R A;  1U8R A;  1Z0X A;  2BY3 A;  4YIF A;  1ETO A;  3DXJ F;  2JK3 A;  2CQ7 A;  4U88 A;  2P7C B;  2XGD A;  1EKE A;  3FK6 A;  4XOP A;  1RNL A;  3CUO A;  5CVU A;  2CFO A;  2DDA A;  1G8X A;  3F8M A;  5FGM A;  1JUS A;  1J5Y A;  4UNO A;  4H0E A;  3SDB A;  4Y4R A;  4XQF A;  1R9T J;  4PZJ A;  2HXI A;  3DPL C;  4CDG A;  1MJB A;  2HS5 A;  3WTV C;  5C4J J;  3TMO A;  3LL7 A;  2FU4 A;  2L0K A;  2EB7 A;  4O6J A;  4BBR J;  2L7K A;  2ESN A;  1WPK A;  4GXO A;  2EA2 A;  2ICW G;  3PQK A;  4EJO A;  4UB6 C;  5DD4 A;  3FZV A;  4BDZ A;  3Q0U A;  2BW3 B;  2HQ5 A;  2L9V A;  3VYU B;  3BZC A;  1SAX A;  4MEY F;  1EF4 A;  2Z2S B;  2H1K A;  2RQQ A;  2Y75 A;  3HSF A;  4FAS D;  2UUZ A;  1JTX A;  2X9D A;  3E3V A;  2O6G E;  1MND A;  3P9C A;  3AG2 H;  2F5C A;  4G7H F;  1U5T C;  3MAJ A;  1ETQ A;  5E17 F;  4XSX F;  3BZK A;  2KDZ A;  2GOX B;  4XID A;  4KMU X;  5IPA A;  3DWL E;  5GAD J;  5EG0 B;  1Z3X A;  2RNJ A;  5B1A H;  2LTP A;  3ZMD A;  1WHU A;  4XBF A;  4YRV A;  3HPG A;  3M1E A;  2KPM A;  1T39 A;  4CCM A;  3S3M A;  2QQB A;  1JE8 A;  2L02 A;  4X0G A;  6PAX A;  5H2F C;  3ZN1 A;  1HA8 A;  1OR7 A;  2JVG A;  4ENJ A;  2K9Q A;  3VEP A;  1TNS A;  3CCE I;  4ZDO A;  2DA7 A;  1RUN A;  5HDK A;  1FT9 A;  5FFZ A;  3LWF A;  3LA2 A;  2ZSH B;  3TED A;  2VQH A;  3JCU C;  1W0U A;  3S16 J;  1PYV A;  2DO7 A;  1UG2 A;  2OBP A;  5DCM A;  2FQ3 A;  4NC7 A;  3AKZ A;  2H6B A;  2KZV A;  4A3B J;  1MJA A;  2XAF A;  1Z7L A;  2BW3 A;  1ZR4 A;  3S32 A;  4F92 B;  5E1Z B;  2R4G A;  2KIF A;  4FTH A;  3MN2 A;  4IF4 A;  4RB2 C;  3BZ6 A;  1HOM A;  3IKV A;  3KZI C;  1OCC H;  2ID6 A;  2WV0 A;  2WB1 A;  4QPO A;  2DMP A;  1B6A A;  2YPR A;  2DXI A;  4CUG A;  3M3Y J;  3R61 A;  5LGN A;  1T33 A;  4BY7 J;  5EJC A;  1ZLK A;  1PP7 U;  3CJN A;  5JLX A;  4XLP F;  2ZB9 A;  1ON1 A;  2H1L A;  4HLY A;  2QKL B;  1EH8 A;  1V3F A;  4XSZ F;  1TQP A;  3CUQ A;  5GPC A;  3KET A;  1R5H A;  2K27 A;  5ICF A;  1U9N A;  1YX3 A;  2ISY A;  2X51 A;  4P96 A;  1IRF A;  4RAG A;  4XLN F;  3FKI J;  1FMV A;  1X1D A;  4HW0 A;  5A2Q K;  1P7J A;  1HKT A;  3SHF A;  4GYG A;  5K1Y A;  2DFE A;  2IGM A;  3K7A J;  3KP7 A;  1CF7 B;  4WK8 F;  2KZG A;  4E7J A;  1XSX A;  4M9X A;  1WJF A;  2MGQ A;  3G3Z A;  3I54 A;  3EQL F;  2FOK A;  2A6T A;  2DT6 A;  3I3L A;  4DW6 A;  4B3A A;  2F4O B;  1ZN2 A;  2FBI A;  5DV5 A;  4XKB A;  1WJC A;  1MBH A;  2L54 A;  1ITY A;  3GTQ J;  2XRN A;  2P5L C;  2EQR A;  1V54 H;  1G59 A;  3LNQ A;  1SFO J;  2H8W A;  2HWV A;  1VQ5 I;  2EZL A;  4YFN F;  3QYB A;  3DPU A;  1K83 J;  2JA7 J;  2JA2 A;  4XKW A;  4DOZ A;  1OCR H;  1RPW A;  1O3R A;  2LKS A;  2VBY A;  1X2N A;  1IXR C;  4B3X A;  5IYC J;  4CCL A;  3OYI A;  2LRD A;  3M8F A;  3VOE A;  4XKC A;  2WB1 N;  3T1B A;  2F5E A;  2XAS A;  4EJU A;  5FRN A;  2G7U A;  2YSR A;  2IA0 A;  1WJE A;  1TZL A;  5IP7 J;  4F7Z A;  4Q47 A;  3L1P A;  2Q0O A;  1ERD A;  1S7O A;  1ZEL A;  3LSI A;  4LMY A;  3GTO J;  2HGC A;  2D45 A;  4L18 B;  4XLH A;  2EV5 A;  2EZH A;  1PP8 F;  5F6F A;  4CH7 A;  2I5U A;  4QWQ A;  4N9H A;  3Q9S A;  1G2H A;  1MNE A;  1SD6 A;  4A69 C;  1U0J A;  2ZME A;  4IHS A;  2AXL A;  5EDN A;  5FKO A;  3WGI A;  4G7Z F;  2HQR A;  2HVQ A;  1ACI A;  1WRJ A;  3RSN A;  2FMY A;  4LFU A;  1U78 A;  5BPD A;  3J7A Y;  3JRI A;  1MBG A;  2OU2 A;  1MBF A;  3I59 B;  4LG3 A;  3HRT A;  2MFZ A;  2L9N A;  1S7A A;  3TO7 A;  1KU3 A;  4U0V A;  2STT A;  2GA1 A;  3FMR A;  2K4B A;  2XAQ A;  3HRM A;  3FF5 A;  2CH0 A;  3WU1 B;  4E6K G;  4FET A;  3O8G A;  4C30 A;  1MZB A;  2DA6 A;  1SFK A;  2VXZ A;  2IJL A;  2JQ7 A;  2Q2E A;  1YS7 A;  3F8B A;  3ISP A;  5K5O A;  2CS3 A;  3K69 A;  4JX5 A;  4AYB A;  1ZR2 A;  3RCO A;  1R49 A;  3WE3 A;  3ZQH A;  4F3Q A;  3FBN B;  2EIN H;  1HW2 A;  1B8I A;  4CYC A;  3WGH A;  3E6B A;  1JUM A;  2KLO A;  3DCF A;  2QEX I;  4D0P A;  2DI3 A;  4HQM A;  4I99 C;  1K61 A;  4PK4 A;  4KT6 A;  2DU9 A;  2IS2 A;  2Y9Z A;  3REO A;  3JRB A;  1MH3 A;  1U6G A;  1XN7 A;  2YS9 A;  3B6A A;  3ZN0 A;  2CW0 F;  2OJE D;  3MFK A;  1K4T A;  2DYR H;  1JGG A;  1Z21 A;  2QQA A;  3GF2 A;  1X19 A;  3MKL A;  1UB9 A;  4FT8 A;  4BE0 A;  1BJZ A;  3UR3 C;  5F08 A;  4XLF A;  4C2T A;  2V4J C;  1R1U A;  4OOI A;  5FJ8 J;  5A2Q Z;  3FHZ A;  3IV5 A;  2B63 J;  4N4N B;  4RLQ A;  4UVC A;  1IW7 F;  1BI2 A;  2E71 A;  3TKY A;  1TP4 A;  2DN0 A;  2P8T A;  3L9F A;  3M7G A;  4HF0 A;  1XS9 A;  2CUF A;  4Y17 A;  3V8L A;  2FX0 A;  4UUT A;  1FOX A;  1P4X A;  4XOT A;  4EV0 A;  2ESH A;  1TW3 A;  2X1E A;  3WG9 A;  2WY8 Q;  2KIM A;  2K9L A;  2YR2 A;  3CCQ I;  4L9V A;  1IXS B;  2FOW A;  4NQW A;  2IBD A;  2EIL H;  1P4W A;  3DBH B;  2L01 A;  4B48 A;  3D5S C;  3M8E A;  1P9Q C;  3IH3 A;  2IP2 A;  3IC7 A;  1RES A;  1USS A;  2YU3 A;  2RDP A;  3LSG A;  5E8I A;  4DBQ A;  1T08 B;  1RIO H;  5HS8 A;  3HG9 A;  2ECB A;  4EJV A;  3TL4 X;  1IV8 A;  1DGW Y;  1XX5 A;  2OQG A;  4AU7 A;  4CCK A;  1YJN I;  2V79 A;  4O5V A;  4RM2 A;  3HTS B;  3WTZ A;  3ZOB A;  3BTJ A;  4ZYH A;  3V7R A;  2ETH A;  2IA2 A;  5D8K B;  4E4H A;  1P2F A;  3ABU A;  3BTC A;  4XON A;  4UUV A;  1QGP A;  2XPW A;  4E7H A;  5LGT A;  3V4G A;  4IHW A;  4M74 A;  4Y7N J;  2BY1 A;  2LKP A;  2E19 A;  3W6K B;  1IGN A;  1JT0 A;  2GM4 A;  4XRM A;  2TRT A;  1IO2 A;  2OTL I;  2LYC A;  1X3U A;  2VPL A;  4BJ5 C;  3FIS A;  4ZH4 F;  4Y33 A;  1H9T A;  3CD6 I;  1OCO H;  2GXG A;  3K4K A;  4MFE A;  1Y6I A;  3UKG A;  1BJA A;  2OC6 A;  3OIO A;  4A3J J;  1WKM A;  4BQA A;  5E8G A;  4IHY A;  2L2O A;  1QZZ A;  1UHW A;  3OIP A;  1FC3 A;  4L9J A;  4BS9 A;  1IC8 A;  4ENN A;  1FWZ A;  1BN5 A;  3F23 A;  9ANT A;  1ODD A;  2XDV A;  1YE9 A;  3TO9 A;  5LHH A;  2OD5 A;  3TP3 A;  1CQT A;  2VOO A;  2DT5 A;  1DU0 A;  4JK1 X;  2M87 A;  5D4R A;  4ZTJ A;  5GAH J;  5TRD A;  2VAS A;  5ICG A;  4M3F A;  3OSG A;  1VQ4 I;  3PQJ A;  2KIU A;  5CVI A;  3VSL A;  4B09 A;  3QU6 A;  1MDM B;  4HV5 A;  2JPB A;  2JRT A;  2VPR A;  4LIT A;  3NAR A;  3SJM A;  2LF7 A;  1SC7 A;  1H0M A;  4ZYA A;  4BAY A;  1BL0 A;  3KFW X;  4FX0 A;  1ZQ3 P;  3CP2 A;  5E18 F;  3OYB A;  1JKO C;  4RGU A;  2PG4 A;  2J5O A;  2EK5 A;  3KPH A;  3WU0 A;  4BUP A;  1K78 A;  5ERI A;  2L4M A;  1Y56 A;  1R4N B;  1H8A C;  3WTW C;  4G94 A;  3HRS A;  1FTZ A;  2BE5 F;  3SDG A;  4NHJ A;  2R7U A;  1XTA A;  2EFQ A;  4X6A J;  2PJR B;  2CO5 A;  3G1L A;  4CCN A;  2MW8 A;  3PSF A;  5LD2 C;  1XG1 A;  3JW4 A;  3ZGK A;  5AON A;  1Z3Y A;  2YX4 A;  2VLA A;  1KGS A;  1Z91 A;  1J2X A;  3BR2 A;  3ZQL A;  4LG0 A;  5IOZ A;  4UHT A;  2HNH A;  2PMU A;  3OYN A;  4L0Y B;  1WQ2 A;  1I1S A;  2PQ8 A;  2V1X A;  5LBQ A;  5EGO A;  3OR1 C;  3T8R A;  3JAM K;  1QZY A;  5EF6 A;  3JTG A;  2WAD A;  2K9N A;  1MDM A;  1D0Y A;  3H92 A;  4XM3 A;  5IP6 A;  2NS0 A;  3H0D A;  1GDT A;  3LSK A;  4KIG A;  5LEK A;  2OPT A;  3BR1 A;  4HAM A;  4EM0 B;  3SFZ A;  1E17 A;  2QA4 I;  4R8H A;  1XMK A;  5HLI A;  4IEJ A;  1ETW A;  2VJJ A;  2P5K A;  2Z33 A;  4IZZ A;  2VOD A;  3IP4 B;  3ABT A;  4E7S A;  4AD9 A;  5IT3 A;  1OMI A;  2ZKZ A;  1LB2 A;  5HLH A;  2ZJQ F;  1BA5 A;  3Q5F A;  4GYI A;  2PJR A;  3A0B C;  2DMU A;  3WTS C;  1UCR A;  1MMG A;  5E3M A;  2RVC A;  4HG2 A;  5JR3 A;  4BAC A;  2M5W A;  2CQN A;  1T0F C;  2JUG A;  4I76 A;  1I3Q J;  2OCC H;  2KP6 A;  3M9A A;  4OAY A;  2PN6 A;  4HNU A;  4CHU A;  5GPA A;  2L7M P;  3LSP A;  2M4K A;  2O03 A;  3DP7 A;  3GEZ A;  3QQA A;  4LLN A;  2YX7 A;  1XSD A;  4HQE A;  1S9H A;  4MEX F;  2JVH A;  1SD7 A;  3OL4 A;  2XUB A;  3TW7 A;  3NRV A;  2HPI A;  3DTE A;  4BE2 A;  4G6Q A;  1FEX A;  3DQV C;  4HF1 A;  1U9O A;  1A6I A;  1VQK I;  2DCE A;  3AFH A;  5E3N A;  4Y52 J;  2VKV A;  3CDH A;  2VC0 A;  3ZPL A;  3W2V A;  2XGE A;  3PFY A;  2X6O A;  2XRO A;  3HC7 A;  3PM1 A;  1E3O C;  4EJT A;  4MIM A;  4WF2 A;  4M3E A;  1YW7 A;  4L5E A;  2BY2 A;  2M30 A;  3A02 A;  3DKY A;  3KP6 A;  1RUO A;  1FNN A;  1W36 C;  3GFL A;  2A69 F;  3ERM A;  3NWS A;  2XAJ A;  5M5W J;  1JUP A;  1WSU A;  3U9G A;  3ABL H;  3W2A A;  5LRS A;  2PBI A;  1O7F A;  4IL6 C;  4G8X A;  2OAZ A;  4EGY A;  1Z1D A;  1REP C;  2KMU A;  2NOJ B;  3S2W A;  4DZP A;  3E7L A;  5DCF A;  1I6X A;  2N8G A;  2HFH A;  3FBI B;  2D5V A;  2CV1 A;  2KIS A;  1TNT A;  4ZTF A;  3ROU A;  2A07 F;  2QBY A;  4AVZ A;  2V26 A;  4BL0 B;  3JRC A;  5E1W A;  1U8B A;  5J4V A;  1W7P D;  4OIO F;  4IRH A;  3Q0W A;  2LD5 A;  3CC7 I;  1YS6 A;  4RLF A;  3OYM A;  3Q9V A;  2WV1 A;  4JOM A;  4ETS A;  1N25 A;  2LY9 A;  3ZMV A;  4HZF A;  3BTI A;  3J7Z I;  2HOS A;  4HX7 A;  5LLQ A;  4EVI A;  1V5G A;  1R4M B;  2RQP A;  4MNU A;  2CUE A;  5ILU A;  2UV1 A;  3WOD F;  1OKR A;  2HZD A;  1GXP A;  3T5X A;  3OMY A;  5CLS A;  2O8X A;  2DA5 A;  3L2U A;  1E0E A;  1IF1 A;  1P7I A;  2FXA A;  2QQ9 A;  3DEE A;  3PO2 J;  2WBM A;  3FHN A;  2E34 A;  5JVT A;  1TLH B;  3PJR A;  1Y8Q B;  4PFO A;  3E6M A;  1JHF A;  3GTP J;  2P4W A;  4I01 A;  3F72 A;  4JX6 A;  5E3L A;  3JAM Z;  2MLG A;  1MBK A;  2BYV E;  2OZ6 A;  1UHS A;  5F1R A;  4U0W A;  4HRI A;  5TGT A;  3ERE D;  2OCE A;  3C2G A;  3L2Q A;  2E60 A;  3S3N A;  3BPX A;  1OLT A;  2K5C A;  3MMY B;  1QRY A;  3DTK A;  1TT0 A;  3DTI A;  4W1U A;  5F64 A;  4ZYE A;  1ZG5 A;  2MH9 A;  4P9F A;  3LSJ A;  3F9K A;  3B02 A;  1XPX A;  3S1N J;  5DUK A;  2DLL A;  3GFM A;  1MKM A;  1UEL B;  4UY8 I;  2AHQ A;  1KU2 A;  4X1E A;  3KZY A;  3OSF A;  3OS2 A;  1F5T A;  3WTY C;  3BG9 A;  2JSC A;  4AIK A;  2ELJ A;  3E5Q A;  3PNV A;  1N78 A;  2AS5 F;  2BGC A;  2QUF A;  5ILV A;  2LKX A;  3HUG A;  3DFG A;  2QEN A;  4OIN F;  1MMN A;  2ZJR F;  1YIO A;  1UMQ A;  2D1V A;  1K7A A;  1D8J A;  5FRM A;  1T38 A;  2HYJ A;  1RR7 A;  3U21 A;  5K5Q A;  4IHT A;  2H94 A;  3BP8 A;  4OIQ F;  3U2R A;  1Y8R B;  4RB3 C;  3OYE A;  1OR7 C;  3VDX A;  3ECH A;  2R7R A;  4E7L A;  2B9S A;  4KNY A;  4BGD A;  2HVR A;  3OS0 A;  3HJE A;  1KA8 A;  4XMY A;  3BR3 A;  4BXU A;  5HDN A;  2NS8 A;  1IRX A;  4PJM A;  3KYL A;  2HQN A;  2R5Z A;  3P9K A;  1YI2 I;  2KDO A;  2V6C A;  2E1O A;  4IX7 A;  2M34 A;  3HRU A;  2LBF A;  1WJA A;  3KLO A;  1Y1W J;  3H35 A;  3BQZ A;  2VKE A;  4YEL A;  3JRF A;  3LQR A;  3TOB A;  5J8F A;  3RKY A;  1FBS A;  5KAF C;  2BZT A;  2BOL A;  2WAQ A;  2K85 A;  2MYS A;  5FRO A;  3HOX J;  2CGP A;  4UVA A;  2KT0 A;  1EA3 A;  3DLA A;  3FIW A;  4GGG A;  2W24 A;  2CU7 A;  2EJR A;  5CVR A;  3HOV J;  1F43 A;  3K70 C;  2ZO4 A;  4XLA A;  4ASN A;  2V7F A;  2XGC A;  4UV8 A;  4M71 A;  5JHU A;  4Y15 A;  1G6N A;  2JJ7 A;  2R3S A;  3VYT B;  2BY0 A;  3BG5 A;  2LNB A;  3DBL B;  2ECC A;  3ECO A;  2E7W A;  4FCY A;  5DCM B;  4EM1 A;  2Q1Z B;  5IT9 K;  1HDP A;  2LH9 A;  3QPH A;  1MNM C;  2M7B A;  5L3G A;  3F6O A;  2OQR A;  4RGX A;  1W5S A;  3HIF A;  1ON2 A;  3RQ4 A;  2PLY A;  2EZI A;  3MZ8 A;  3ZQQ A;  2XSJ C;  4RDU A;  2M2E A;  2O0Y A;  1R71 A;  4HOB A;  3BR6 A;  4IOC F;  1A35 A;  2G0E A;  4A0X A;  4G6T B;  1J59 A;  4D9J A;  2LVS A;  2R5Y B;  4BQN A;  1R22 A;  2VT3 A;  2KRC A;  2HXO A;  5GAG J;  1UAA A;  2A6H F;  1RC9 A;  3AAF A;  4M72 A;  3OR2 C;  3CCU I;  3GZ6 A;  1B1B A;  5DS9 A;  2HOT A;  1PJR A;  5KHD A;  3CUQ B;  3G73 A;  4MLO A;  3FMQ A;  1T2K A;  2ZXJ A;  2P6T A;  5AIQ A;  3I64 A;  3KCC A;  2MC4 A;  5LRR A;  3ZQI A;  1RI7 A;  1YFH A;  1LPQ A;  3BR0 A;  1LFU P;  2EWN A;  2DW4 A;  4DJA A;  3QU3 A;  4J01 A;  2DA1 A;  2M4G A;  2WAQ N;  1T98 A;  1MMS A;  2ZBK A;  1ZYR F;  3SZG A;  1KU7 A;  1H89 C;  3GVA A;  1K79 A;  2HDC A;  1XDS A;  3HM5 A;  2H09 A;  3GW2 A;  4U7D A;  1J75 A;  3S2H J;  3GFJ A;  2O61 A;  3DBR B;  1IN6 A;  3MEX A;  2HTJ A;  3H3Z A;  3HXL A;  4JYK A;  2F5D A;  3QOE A;  1ENH A;  3N4M A;  1DU6 A;  2EA4 A;  3CCL I;  3ML6 A;  4IVN A;  3ZQC A;  5B3S H;  1X58 A;  1QHG A;  1F9N A;  1Z6R A;  5GTI C;  3JRA A;  4BEH A;  2R5Y A;  3OL3 A;  2ZME C;  4A3C J;  1D0X A;  1FBQ A;  2BVL A;  2M1B A;  1K6O A;  3F8C A;  3HOS A;  4BY1 J;  1LKX A;  1BIB A;  4BXF A;  2DOE A;  3LSR A;  1LDK B;  2NVT J;  2EZK A;  2BXY A;  5FD6 A;  2R7O A;  5F1J A;  2KRF A;  1MBE A;  3BJ6 A;  3VFZ A;  1VQM I;  3DEW A;  3B73 A;  4A2U A;  3DPT A;  4LGW A;  5DTD A;  2JRM A;  2KFD A;  3H1C A;  4NDL A;  2Y9Y A;  1TWC J;  2E36 A;  3F8N A;  2CUZ A;  4A12 A;  2I10 A;  1D5V A;  3LSH A;  2FA5 A;  2FRH A;  2ZME B;  3HGY A;  3FXU A;  3CMM A;  3MCZ A;  2GA2 A;  4K2E A;  3X2Q H;  3QYE A;  3P7N A;  5JFR A;  4UB8 C;  1YLF A;  1GV2 A;  1B72 A;  1G4D A;  4J19 A;  2Z16 A;  2HEO A;  4ZJZ A;  3CO7 C;  5KCM A;  1CGP A;  1WGX A;  3L2W A;  2KIQ A;  3U1D A;  1IDZ A;  2XB5 A;  1U5T A;  3K4J A;  5EEH A;  2LY2 A;  3CC2 I;  2X0L A;  1KQ0 A;  3K2A A;  3H0G J;  5ILS A;  1GLN A;  1HST A;  2JWT A;  4G12 A;  2K40 A;  3RJP A;  2W48 A;  3VB2 A;  1O7L A;  3F6V A;  4OWR B;  2IS1 A;  2COB A;  2HOE A;  2Q2E B;  4JX4 A;  3EPZ A;  4II2 A;  4MTD A;  3QRF F;  1RKW A;  4PJL A;  1DP7 P;  3GX4 X;  5IT9 Z;  1ZGA A;  3Q0V A;  3LSM A;  1X3Z B;  4PFP A;  5M3M J;  3CCV I;  4E7K A;  3CES A;  1T6S A;  4OIP F;  3BG3 A;  2JMW A;  2NVX J;  1IV6 A;  4LLL A;  3I56 I;  1JGS A;  2X4H A;  5K7F A;  4U7B A;  4HYE A;  3L2C A;  1PUF A;  2OV7 A;  1B8I B;  2NOG A;  4CYC B;  4AVP A;  3G6E I;  1WJ5 A;  1FOK A;  2M0M A;  1KQ8 A;  2V9P A;  1TWF J;  3L2V A;  4IHV A;  4DQ2 A;  2JSP A;  1LFB A;  2D1H A;  2VJI A;  1V5F A;  4I7H A;  2RRE A;  2XF6 A;  4GCV A;  3O6B B;  4FE7 A;  2R7W A;  1W1W E;  2NVY J;  4MGR A;  2MBF A;  3E6D A;  4NC6 A;  2BVM A;  3IWZ A;  1H9G A;  3F3X A;  1TQM A;  2XB0 X;  2BHY A;  2EBI A;  1WZ2 A;  4LK0 F;  4WCG A;  2VC1 A;  3CDL A;  4A93 J;  2IS6 A;  2FE3 A;  1J0R A;  3F22 A;  2ME0 A;  4P1W A;  5HLG A;  4O3M A;  1IRG A;  5FFX A;  1O4X A;  3GTG J;  2Z99 A;  3V42 A;  4KIT B;  1X4O A;  1MMA A;  1JTY A;  1PVE A;  5IP9 J;  1E2X A;  2V6E A;  4CGZ A;  1YTY A;  2M45 A;  2E35 A;  4E7I A;  2L9S A;  2DMQ A;  2M7A A;  5HS7 A;  3GYH X;  1DPU A;  3GZ5 A;  4NQW B;  2HDW A;  2XPV A;  5ICC A;  2LDU A;  2R7X A;  3FKJ A;  2IGK A;  5FLX K;  1OIS A;  3NAU A;  2HYG D;  2VQG A;  1ZKG A;  1FOW A;  3FWE A;  3EUH A;  2L5Q A;  3ZQG A;  1IAW A;  4A3F J;  3ZXS A;  1OYI A;  3MQ0 A;  4I0A A;  1R36 A;  4DIQ A;  5DD8 A;  2VIX A;  1SFX A;  1YQA A;  1PDN C;  3RYP A;  1MMD A;  4JP0 A;  1IXC A;  2DMT A;  2HOA A;  5FD5 A;  5B66 C;  4KFC A;  2VJ5 A;  3QYF A;  2MG4 A;  2MH2 A;  4DZJ A;  5DM7 F;  4HDV A;  3BY6 A;  1XMA A;  3HOW J;  3BT9 A;  3QPL A;  3H36 A;  2O8K A;  2EV6 A;  3MWM A;  4ENM A;  1T95 A;  3SQN A;  1P6R A;  2MSY A;  3KIO A;  2Z3Y A;  3OV8 A;  4QIW N;  2QGU A;  4UUS A;  3S93 A;  3QPT A;  1QVT A;  3LAP A;  4BDY A;  3VYR B;  3JRE A;  3P9I A;  3SXY A;  1LE8 A;  3TDU C;  4QTR A;  1KYZ A;  1QQI A;  4DYR A;  2GAU A;  1OCZ H;  5HVQ C;  1SEU A;  1A5J A;  4XN3 A;  3CCJ I;  4IQJ A;  3OYL A;  1R1T A;  3KX2 A;  4HNT A;  1QPM A;  2ZNZ A;  4BBS J;  3ZRG A;  2FSW A;  4Y3O A;  2DTZ A;  1WJB A;  2ZXI A;  3IH4 A;  4AYB N;  3A03 A;  5GTH C;  2FJ1 A;  2DOF A;  2JA5 J;  3LFU A;  2XGX A;  4D7N A;  3N97 A;  1U2W A;  2M9H A;  5IOY A;  4EAT A;  4IOA F;  2RAE A;  3H9G A;  3CZ6 A;  1LNW A;  2UXX A;  1OFC X;  1UFM A;  1HLV A;  1ETK A;  4DYQ A;  2DFH A;  4L9N A;  1K78 B;  3E1S A;  4PJJ A;  3PO3 J;  5TJJ A;  1WI3 A;  3AL0 B;  3GTM J;  3IRR A;  1W7P A;  1O3T A;  2VBW A;  2QKM B;  3OWT A;  3L2R A;  3BJA A;  1WH7 A;  1SFU A;  5KNL A;  1X1P A;  3G4S I;  2KHM A;  1D1C A;  4AM3 A;  4BNC A;  1I5Z A;  2WY7 Q;  3FMS A;  4BYY A;  4PGH A;  2X6X A;  1R00 A;  2JN6 A;  4LG0 B;  1NHA A;  3KYC B;  2JUC A;  4KJZ A;  1K6Y A;  1STZ A;  2WA0 A;  3KEQ A;  2R0Q C;  2ID3 A;  5EGO B;  3DKX A;  4V2G A;  1FJL A;  3BG6 A;  1F36 A;  2GWR A;  1FIP A;  2WAF A;  1XDU A;  5HDG A;  5J8C A;  3PIP F;  3I4M J;  1DGR M;  3ZCO A;  1JJ8 C;  4XLE A;  2A05 A;  2ZC2 A;  3FXJ A;  2JZY A;  3J80 K;  2V1U A;  1MH4 A;  2ELK A;  1W4M A;  4R79 A;  3S15 J;  2LLK A;  4M6V A;  4LIU A;  5M5Y J;  5CKT A;  1SMT A;  1XC5 A;  1ETX A;  1JKQ C;  5HOD A;  1AKH A;  5FLX Z;  4BQQ A;  2EIM H;  3QOP A;  4RB1 A;  1M1E B;  4HX8 A;  2NRA C;  1YJ9 I;  5D4S A;  1JKP C;  4U87 A;  3ZR8 X;  2LK2 A;  4IRI A;  3V8K A;  3C1D A;  1EJ9 A;  5LGU A;  1F4K A;  5J40 A;  2C6Y A;  4XRS G;  3I4P A;  3RYR A;  3NEU A;  4CYD A;  3D1N I;  3VWB A;  3BCA A;  4AIH A;  2QSF X;  4CCJ A;  3GZN B;  3CF2 A;  4PUS A;  1VQN I;  5GAE J;  2GBY A;  2IW5 A;  2MAB A;  2X85 A;  2E1C A;  2ZNY A;  2RGV A;  4N9I A;  2O7O A;  1UST A;  2L3D A;  1EH7 A;  1UHM A;  2HU9 A;  4KIC A;  3W3C A;  4B4C A;  2QF7 A;  5F04 A;  2DBB A;  1Y0U A;  4L9T A;  1ZAO A;  4ESB A;  3JRD A;  2NNN A;  1V5E A;  4OIR F;  2XAH A;  3IUO A;  3J81 K;  1E3P A;  2LP0 A;  4L5I A;  3J7Y J;  5CQG A;  3LMM A;  5F0F A;  4I09 A;  3MKY B;  5F0C A;  1Z6T A; 
#chains in the Genus database with same CATH homology
 2EIN H;  2EIJ H;  1OCC H;  2EIM H;  3ABK H;  3ASN H;  1V54 H;  1OCO H;  5B1B H;  2ZXW H;  5IY5 H;  3ABM H;  2Y69 H;  3AG2 H;  3WG7 H;  2OCC H;  5B3S H;  1OCR H;  2DYS H;  3AG4 H;  3AG1 H;  5B1A H;  1V55 H;  2DYR H;  2EIL H;  2EIK H;  3ASO H;  3AG3 H;  3X2Q H;  1OCZ H;  3ABL H; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...