3WTTC

Crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wttC00
2XAGA 2EJRA 3QU3A 3K9TA 3BY6A 3HSRA 1PUEE 5FB2A 1WKMA 2LSOA 2QQAA 4RAZA 3JSOA 3LA7A 1BIBA 3COAC 3C1DA 1Z6TA 1QO0D 5J8CA 5HS9A 5A2QK 2P7VB 1EH6A 5FFXA 2RNJA 3WU1B 1Z05A 4KA4A 4H0EA 4L0ZB 4G6QA 2FOKA 3VEPA 3EYYA 4A5MA 1U3EM 3HHHA 2RV8A 4L9VA 5L3FA 1GXQA 2XHKA 2WTEA 2DK5A 4I0AA 2JSCA 3DPTA 2M45A 1JXSA 3WTXC 2OZUA 2CO5A 5LLQA 1MJBA 1S29A 4UHTA 4M9SA 4KN4X 3JAMK 1LDKB 2A6EF 2YSRA 1SMTA 4OIQF 1Z7UA 3MZHA 4ENJA 1D8KA 3KP4A 4HZFA 2ADUA 2HQNA 2RVCA 1FNNA 3Q9SA 1P92A 2JPBA 4D0PA 5BPIA 2FE3A 1G4DA 1XSVA 3K2ZA 5D5WB 1MD0A 1ON1A 2EK5A 5ICGA 2O61A 3FM3A 2OBPA 2BE5F 3E3VA 3WE2A 3BPXA 1QPMA 5TRDA 2W57A 1D3YA 2X4HA 2RC4A 2XAJA 5D5XB 2ISZA 1IXRC 1P4WA 3F6OA 2H09A 4FHTA 1AOYA 4RAYA 5DEQA 2ZMEB 2YX7A 3J81Z 2PFBA 4M73A 2GXGA 2H6BA 4O3MA 2L4MA 2K4BA 1A04A 2P5VA 2ESHA 4RS8A 1S8NA 1O57A 2ELHA 2GA2A 1HW2A 5E18F 1W7PD 2OQRA 2VBWA 5K5RA 3WE3A 3WTYC 2EFWA 2DAOA 4CZZA 3IWFA 1EV7A 3EUHA 5FGMA 3LSTA 4YFXF 1QBJA 4EMSA 1Z91A 3BPVA 5JHUA 2HYGD 3RDIA 1BI1A 2R3SA 1J0RA 2X0LA 1IN6A 3KE2A 4Z2YA 4L9JA 1E2XA 1HQCA 1UHMA 5HS8A 4CXFA 2F5CA 1YYVA 2XUBA 1OYYA 4MHGA 1JHFA 4ESFA 1SAXA 5E1WA 4RB1A 2P6SA 2HTJA 1ODDA 4ESBA 1U6GA 1WQ2A 3BDDA 2K4JA 2LF8A 2PJPA 2HQRA 4G7ZF 5HDGA 4RGSA 1R22A 4TV7A 4ENNA 2YX4A 2JRTA 3JSPA 2P5KA 2KIFA 2ZCWA 3HSEA 5E1ZB 5IT9Z 1USSA 2P5LC 2BBYA 3QP5A 1IN5A 2UXXA 4P9UA 2F5EA 1BI3A 3ZPLA 5AONA 3O6BB 4HV6A 5ILUA 3J7AO 1VTNC 5D5UB 1QNTA 3F22A 3ULQB 5LHIA 1P4AA 2ZO4A 4XLNF 1R23A 3JTHA 2DK8A 4L5JA 2V1DA 3KZZA 2A68F 2CG4A 4OU0A 1D8JA 3F6VA 2Z33A 3EQLF 1I6XA 1T38A 3GWZA 3IWZA 4A6DA 4HX8A 1BOAA 2XVCA 3C18A 5E8IA 3TO6A 5K5OA 4EM2A 2J5PA 3WGGA 3E6BA 1F9NA 2Y0MA 2EFOA 2H6CA 2GZWA 4I98B 5ILVA 2LNBA 1KU3A 3QPTA 4N9HA 4IRIA 4HX7A 2NNYA 3DPLC 1R1UA 1XGMA 1KYWA 2XIGA 3DEUA 5LBQA 5LGUA 1BBYA 4IF4A 2LDUA 3FXRA 3KFWX 3KP6A 3P9KA 3FMSA 3RKYA 3CUQC 1YW9A 3BZ6A 5ICFA 4KT5C 5LHGA 5KK1A 5DUKA 1H9TA 5FFZA 2VBZA 4I02A 1I5ZA 3B02A 4KIFA 1TNSA 1BIAA 1JGSA 4A2UA 4LG0B 4LMYA 4XRFA 2HKOA 3K1PA 2NNNA 3LA2A 5JI6A 3BJAA 1YQAA 3KLNA 1JE8A 1IF1A 2QQBA 5ICEA 1ON2A 1TLHB 1K6OA 2O6GE 3RYRA 1OYWA 2RGVA 2FSWA 1FC3A 1KU2A 3KLOA 2IA1A 1XN7A 2D1VA 1DDNA 3ABTA 3M7GA 1O7LA 1U8RA 3HRTA 2F2EA 1MGTA 1WSUA 3CUOA 2LF7A 2HDCA 3GF2A 5E17F 1BJAA 4O6JA 4ZZLA 3BP8A 1LNWA 4KYWA 2FA5A 2CSOA 5A2QZ 2KIUA 3B73A 5FLXK 4G9YA 4JK1X 1J2XA 5CLSA 1W7PB 1GVJA 1XCVA 4NQWA 1G3WA 4GYGA 2VT3A 1RI7A 2UWMA 3LQRA 1BN5A 4WK8F 2JT1A 2ZMEA 1MDMA 1HBXG 1R58A 4OMZA 4XSZF 2XKOA 3SFZA 3GVAA 4HBLA 1XD7A 4ASNA 1YTYA 4IJAA 4PCQA 4U0VA 4XSXF 3JAMZ 4LK1F 2GQQA 4HA8A 3WU0A 5CVRA 3EDPA 2IP2A 3REOA 2EA2A 1Z9CA 4IHTA 1SD5A 4DQ2A 1UFMA 5HVQC 3QRFF 4JBAA 2M87A 3CJNA 2QBYA 4ON0A 3P7NA 1OR7A 2DQLA 5BPDA 1ULYA 3IKVA 3HOSA 1STZA 4ZH4F 4AIJA 3M9AA 2RKHA 3IL2A 1R00A 4IHSA 2O03A 4HLXA 2V1XA 2ZFWA 4HQMA 1C0WA 1HW1A 4AVPA 2O8XA 2Q0OA 4GO1A 2P6TA 3ECOA 5CJ9A 2FBKA 3HUGA 3W6JB 3CO7C 1G6NA 3KP7A 2JPCA 1XGOA 2PG4A 3TOAA 2DBBA 3L09A 3VODA 4R1HA 4ZYDA 3ZMSA 3QU6A 1OMIA 4U7BA 1IZ1A 3RKXA 4M9XA 2MC3A 2Z99A 4HV5A 4U0WA 2VODA 3LAJA 5FO5A 3V7RA 4S05A 2FNAA 3GO5A 1QZYA 2KJBA 3C7JA 4GYIA 3T0YA 1CGPA 1PP8F 2Y48A 3WG9A 2V79A 1RIOH 3MFKA 2NAZA 5HLGA 2FNPA 1LEBA 4UV9A 4ETSA 1LQ1A 1FBSA 3O2PE 4EQQA 1U78A 3M8EA 3TO9A 1ZAOA 3V8JA 3TQNA 2EFPA 4MTEA 4CICA 1HSJA 2M5WA 5D5VB 4BHPA 3ZMTA 1J75A 1ZN2A 2STWA 3TOBA 2W24A 1LVAA 1GXPA 5D6FA 1ZLKA 2PMHA 5HDKA 3WTWC 1BI2A 4LB6B 3RI4A 4MGRA 2AXLA 2IRFG 5LHHA 4CGZA 1XMKA 5BOXA 1KQ8A 4M72A 5F6FA 2DLLA 5H20A 2R7FA 3FHZA 4M74A 4DNCA 2FQ3A 2XASA 4HLYA 2E1CA 2DI3A 3HOTA 5JVTA 1SFUA 3JTGA 2A07F 2D45A 4G7OF 1LEAA 1FY7A 1K78A 3ZN0A 4XLPF 4BHCA 3BOQA 2GA1A 2JTVA 3RPQA 2GWRA 2HFHA 1H0MA 1HKQA 3MWMA 2QM3A 4LLNA 2WV0A 2HR3A 3VOEA 4RB0A 1XSDA 1O3TA 1YO5C 2DPDA 3KP3A 3M1EA 4WX9A 3RIRA 3WODF 3RYPA 1HKSA 3T5XA 3Q9VA 3BWGA 3WTTC 4BXUA 2WC2A 1YLFA 2Z5UA 4WXDA 5EEHA 2VN2A 3H3UA 2OD5A 1ZYRF 3D0SA 1CF7A 3QAHA 3OOPA 1TW2A 2RDPA 3ISPA 2A69F 3KETA 4GCVA 2RQPA 2BGCA 1MKMA 3DXJF 1G3SA 2VBXA 4LB5A 4NHJA 5E20A 4A12A 2ZJ2A 2D2WA 3FXQA 4HF2A 3CUQB 4RB3C 4B8XA 2OQGA 2QWWA 1W7PA 1B4AA 5BMZA 5ICCA 3I59A 2KIMA 1IRGA 1HXDA 2MD5A 1R1VA 4RGRA 4KN7X 1XSXA 5ED4A 3CO6C 4KICA 2DFIA 3U9GA 2W85A 4RB2C 3NEUA 4I09A 2EV6A 1EH7A 4LLGF 5L3BA 2FMLA 1DPRA 1F4KA 5D8KB 2FRHA 1U5TA 3ZN1A 2W84A 5CVIA 2M1BA 4EJUA 4OMYA 1Q1HA 1USTA 3FWEA 3T8RA 4HF1A 5DCMA 5FLXZ 4E70A 2IA0A 2ZNYA 1FZPB 3KP5A 1UHWA 1D5VA 3GW2A 2VOPA 1YS7A 3H92A 1X3UA 2HTSA 4KDPA 5JR3A 1O3QA 4HAMA 2DO7A 3WTUC 3WGHA 2FF4A 3CLOA 3TDZC 5D8LB 4XBFA 4PGGA 3F8NA 4HDVA 1HKTA 4ZYEA 3IHUA 1IN8A 2EV5A 5CYVA 4F7ZA 2IT0A 1FOKA 4MEXF 3HRMA 3E5QA 5DCFA 2KRFA 4Y15A 3ROUA 3EYIA 2CGPA 3SZTA 3IRRA 4EVIA 4YFKF 2A5YB 5DDGA 4KIGA 4KMUX 3LA3A 4WF2A 4IPAA 2PMUA 1HSTA 3V7SA 2QENA 3H3ZA 2VXZA 4HYEA 1ZLJA 2YPRA 2BYVE 1S6LA 2KJCA 4QWQA 3D5LA 4A5NA 1FPQA 2A3SA 5TJJA 1SMYF 1REPC 1RZ4A 4LLLA 1XGNA 4IXAA 4A0ZA 4FX0A 3WTZA 2FBIA 4KMFA 3S2WA 1EH8A 3K0LA 1KU7A 1LDDA 4YIIA 3I4PA 1I1GA 1O3SA 3NQOA 2Z3YA 3R0JA 5L3EA 3MCZA 5LRSA 3F8MA 3ZP5A 2V9VA 1TW3A 5IT3A 4BQAA 3BJOA 4PDKA 2EV0A 2MLKA 2V6CA 1RNLA 1J7KA 4L5IA 4YIFA 3GX4X 3F21A 4G7HF 1MJAA 4HX4A 2HS5A 3TDUC 3TO7A 1ZG5A 1XDSA 4P9FA 1IXCA 3SHFA 1ZHFA 2FMYA 3GZ6A 3I71A 4CDGA 1IN7A 4JQFA 4GGGA 3N4MA 2QZ8A 5J8FA 1ZGAA 5FD5A 3EETA 1BC7C 2GIVA 4PGHA 3ABUA 2L3DA 2VONA 3HTSB 3KCCA 4U88A 2D1HA 3BJ6A 2P4WA 5BQTA 2PBIA 3MQ0A 5DUIA 3DKWA 1I27A 4UXNA 2F5DA 4EJOA 3P9IA 4ZYHA 2VC0A 3MEXA 4BH9A 5HOOA 3VFZA 4WCGA 2W25A 1G3YA 3HTUA 1IXSB 4HQEA 3QPHA 4M6XA 5D4RA 1ZARA 3FF5A 1T98A 3OV8A 3LWFA 1SD7A 2VE8A 1B9MA 4I2OA 2ETHA 3I58A 3GZ5A 3E5UA 3PQKA 3HYIA 2QLZA 2K27A 2UXNA 1OKRA 1NHAA 2OZ6A 3JW4A 5DV5A 2NRAC 1SD6A 1FP1D 1IRFA 3FMQA 2VC1A 4GXOA 1FT9A 5K1YA 1IAWA 3HHGA 4M9ZA 5CVJA 4OOIA 2Q2EA 1QGPA 4HOBA 5HLIA 4EM0B 3C3WA 4UVAA 1BC8C 4MTDA 2NYXA 4LD5A 1MJ9A 3HIFA 1KGSA 1J59A 1LDJA 2IW5A 4L9NA 1Z1DA 4KUMA 2IPQX 2ESNA 2Q8KA 1B6AA 4OINF 1XB4A 5JFRA 1YW7A 4U0YA 5CVVA 1IW7F 2PQ8A 2HZTA 2ACJA 5ERIA 4R8HA 4N0BA 1TQPA 4ESJA 1P2FA 2FXAA 1TQIA 3O3KA 1AWCA 4A6EA 1O3RA 3M8FA 5LGTA 3TKYA 3RJPA 2Z9OA 4R79A 2A61A 3WTSC 3F8FA 2BEOA 2QYOA 3U1DA 2FU4A 3DQVC 2QVOA 3GFLA 4YG2F 4ENMA 4RGXA 4NB5A 3ZMUA 3KEOA 3ZMDA 1P4XA 4OIOF 3F3XA 2J5OA 1U5TC 3L00A 3GFMA 1RUOA 4AIHA 5LRRA 4U7DA 2XROA 4FT8A 2ZXJA 3VB2A 1KYZA 5E8GA 4EJTA 2M30A 1KA8A 2TDXA 2PN6A 2FEZA 3K1MA 2XAQA 1ZGJA 4N9IA 4CO8A 1IN4A 2HGCA 2MH9A 1KQ0A 1RUNA 1S3JA 1XGSA 2EWNA 3FX3A 2COMA 2IA2A 1WWXA 3J80K 2OA4A 2EFQA 4P96A 1ZH5A 4K2EA 1LJ9A 1R5GA 3RTRA 1XMAA 4KFCA 4BHBA 1OPCA 2R7DA 1TQMA 1DUXC 1ZRCA 4LG0A 2PLYA 1E17A 3ECHA 4Q5SF 2XRNA 5LEKA 3T8TA 3L2CA 4LJZF 4A0XA 4UV8A 5FD6A 1MDMB 4EGYA 4S04A 4L9TA 1R5HA 1XCBA 2E7XA 3I0TA 4IVNA 1YG2A 4I01A 1FWZA 1L3LA 5ILSA 3V4GA 3DF8A 1J5YA 4BNCA 1FYLA 1ZRDA 2E7WA 2QBYB 4EJVA 1TBXA 4RGUA 4UUVA 4L18B 2MH2A 3R6SA 4O5VA 1DPUA 3HRSA 4WXCA 1T39A 1FBUA 2ZNZA 2L01A 1S7AA 2GXBA 3CTAA 2M8EA 3SQNA 2IVMA 3F23A 3WTVC 5LEJA 2XV4S 5E1XA 4HW0A 3MZYA 2KKOA 2H94A 2MA3A 5L3CA 3LAPA 2BV6A 4WWCA 1V3FA 2IJLA 4HF0A 5DD8A 1FLIA 4MNUA 4UVBA 1QZZA 2O3FA 4EJWA 4EM1A 4MQVA 1FYKA 4EV0A 4CYDA 4FX4A 5K5QA 2XAFA 3MAJA 2VOOA 1JHHA 4PZJA 3P9CA 3R61A 1YS6A 2GAUA 5EEGA 1K79A 2ZKZA 1UCRA 1W5TA 3ML6A 5L3GA 1Y0UA 2HKXA 3U2RA 5LGNA 2L4AA 2ISYA 1PP7U 3GUDA 1Z6RA 2JZYA 1V4RA 3GEZA 2F5FA 5DYMA 3RKWA 2OAZA 3NRVA 4Q47A 3E97A 5F1RA 3K1NA 1R7JA 2L02A 3F8CA 1BM9A 1FBQA 1SFEA 4HDUA 3GFIA 4L0YB 4UVCA 5L3DA 3PQJA 3E6DA 2Y75A 4LK0F 4YFNF 4M6YA 4BYYA 4P55A 4Y13A 1WRJA 1UB9A 1B9NA 1OYIA 2QUFA 3J81K 5HDNA 1P6RA 4P5OA 1YW8A 1TNTA 1KU9A 3KZYA 3DFGA 5D6EA 3GLXA 5BS6A 3KEQA 2L54A 3PFIA 6PAXA 1I1SA 3RPUA 1ZREA 2P7CB 4QLCU 2C6YA 3G3ZA 4ZYGA 3ERED 1T0FA 1L0OC 1MZBA 3FXUA 4I7HA 4KNYA 3FM5A 2EFNA 1W5SA 5AIPA 2B0LA 2HEOA 4UNOA 3R60A 3LQQA 3V8KA 3I53A 2K7LA 3V7CA 2VE9A 3E6CC 2HOEA 3CDHA 3Q5FA 3QOPA 1G3TA 4OIRF 4AIKA 4OIPF 4Y17A 1K78B 1FSHA 2CWEA 3I5UA 2EB7A 3R0AA 2XAHA 4EGZA 2UZKA 2XGXA 3W6KB 4LFUA 3FMRA 5H6QA 4IRHA 3IC7A 2RN7A 4KIBA 2AS5F 3KP2A 3I64A 5D4SA 2LKPA 2V1UA 1FP2A 3T1BA 3QP6A 4ZZDA 3WGIA 5AIQA 1BI0A 1TTYA 3BROA 1SD4A 1S7OA 2A6HF 1T2KA 1ZG1A 3SZPA 1ZRFA 5HS7A 3HSFA 3DV8A 2DTRA 3F8BA 5IT9K 2FBHA 1J9IA 2DU9A 2O0YA 5H6RA 3E6MA 3G73A 4LGWA 3IKTA 1KQ9A 1CF7B 2ZBKA 2CW0F 1XDUA 2H27A 1QQIA 1H9GA 4MQ9F 4AD9A 2G7UA 4WXHA 2CQKA 1ZG3A 3F72A 2PI0A 1R36A 2OU2A 2HWVA 5HLHA 1R1TA 4MEYF 3I59B 3DP7A 4Q4ZF 2EA4A 1FSEA 2MBFA 3LFKA 2G7HA 3FZVA 5KVRA 1YFHA 3V8LA 2DW4A 1LB2A 3E5XA 1T6SA 4G6DA 2VT2A 2P8TA 1W4MA 1PDNC 3HRUA 1U5TB 1WI9A 1B59A 1FYMA 2K02A 2CYYA 3R4KA 3ZMZA 3AAFA 4G94A 4B09A 4ENKA 2DPUA 4IRGA 3GXOA 4BAYA 5J6XA 5DCMB 1F1ZA 3SXYA 3J80Z 1FX7A 1O7FA 2CFXA 3CUQA 5DD4A 2QQ9A 3K69A 1ONVA 1B1BA 2WWYA 2DT5A 2K86A 4CHUA 1SFXA 2YU3A 4G8XA 2E1NA 1GHCA 1IUYA 1U2WA 5F64A 2NS0A 4AWXB 3IRQA 3I54A 2XKPA 2MLGA 2VBYA 4M71A 2STTA 4Q48A 3N97A 4A0YA 1F5TA 3GFJA 2PEXA 2DQRA 5CVUA 3GYHX 1YIOA 1K7AA 3ELKA 2HYFA 3L9FA 1HW5A 2YR2A 4I0BA 3ZMVA 1DP7P 3ZQ7A 3L7WA 3TGNA 2G9WA
chains in the Genus database with same CATH superfamily
1T95A 2EJRA 2XAGA 2ZXHA 3QU3A 3K9TA 3BY6A 3CJRB 4KITB 3HSRA 1PUEE 1Y8RB 2P0WA 5FRMA 5FB2A 2DA5A 1WKMA 2LSOA 2QQAA 4RAZA 3AG3H 3OOUA 4M3DA 3JSOA 3LA7A 1BIBA 1VQ4I 1QHHD 3COAC 1FIAA 1MBHA 3C1DA 3PIOF 2LR8A 3K70C 1JUMA 1QO0D 1Z6TA 1R49A 4E7LA 3G1LA 4X0GA 5J8CA 5HS9A 5A2QK 2BY2A 3HOVJ 2P7VB 1ZELA 1EH6A 5FFXA 1VQLI 2RNJA 3WU1B 1Z05A 4KA4A 2JK3A 4H0EA 3K4LA 4PJLA 4L0ZB 4G6QA 1A6QA 5K7FA 3OY9A 2F6CA 2FOKA 3VEPA 3EYYA 1NG7A 1I39A 4A5MA 1U3EM 3CMMA 1IDYA 3HHHA 2RV8A 3CD6I 4L9VA 5EJCA 1GXQA 5L3FA 2XHKA 5F1JA 2WTEA 2DK5A 3ESWB 4I0AA 2JSCA 3DPTA 2M45A 1JXSA 2FUG2 4AUXA 2QSHX 3VPRA 3WTXC 2OCCH 4NBQA 3HOUJ 2OZUA 2XF5A 3HOYJ 2CO5A 4LIUA 5LLQA 1MJBA 1R9TJ 1S29A 1P9QC 4UHTA 4M9SA 4KN4X 5DTDA 2MC4A 2HPIA 3JAMK 1XX5A 3MMYB 1LDKB 2A6EF 2YSRA 1SMTA 4OIQF 2L7KA 1Z7UA 5HODA 1Y56A 3OIOA 4JX6A 1ETOA 2WY7Q 3MZHA 4ENJA 1D8KA 2JA2A 3KP4A 2NVXJ 4BBSJ 4HZFA 2ADUA 2HQNA 3S14J 2RVCA 1FNNA 3Q9SA 3ZOBA 1MBGA 2LG4A 1P92A 2JPBA 3PSFA 1Z3XA 3GZNB 4D0PA 5BPIA 2FE3A 4NNJA 1G4DA 1XSVA 2W82A 3K2ZA 1P7JA 5D5WB 1MD0A 3MKYB 1ON1A 2EK5A 5ICGA 2O61A 3VSLA 3FM3A 2OBPA 2BE5F 3E3VA 1S9HA 4PK4A 2FD5A 3WE2A 3BPXA 1QPMA 5TRDA 3CC7I 4GFBA 2ECCA 2P81A 3ABLH 2W57A 1D3YA 2OV7A 2X4HA 3BG6A 2RC4A 1SANA 2JA7J 3PUBA 1NG6A 2VKDA 3OYMA 3O8HA 3S3NA 2XAJA 5D5XB 2ISZA 1IXRC 1MBJA 1WI3A 1WJCA 3CF2A 4LOCA 3DPUA 2VKVA 1P4WA 1YOVB 3F6OA 2H09A 2GLOA 4FHTA 1AOYA 3LNQA 4RAYA 3H5RA 5DEQA 2ZMEB 2YX7A 2DCEA 3J81Z 2PFBA 4M73A 2GXGA 2H6BA 4O3MA 2L4MA 3RQ4A 2K4BA 4W1UA 5F27A 3ZQLA 3OYNA 2OPTA 1ERDA 3TW6A 1WPKA 1A04A 2P5VA 2KDZA 3JRCA 1I3AA 2ESHA 4RS8A 1S8NA 1O57A 2ELHA 2GA2A 1HW2A 5E18F 2CW8A 1W7PD 3KZIC 2OQRA 2VBWA 4J19A 5K5RA 4XN3A 3WE3A 3WTYC 2EFWA 2ICWG 2IGOA 2DAOA 4CZZA 2K40A 3IWFA 4OAYA 3S3OA 1MH4A 2TCTA 1VQKI 5M3FJ 1EV7A 3AG1H 3EUHA 3QYBA 3LSPA 2UUZA 5FGMA 1ACIA 3BTJA 3GTKJ 3LSTA 4YFXF 1QBJA 4EMSA 1Z91A 1DQUA 1U9NA 5CQEA 1WJ5A 3BPVA 5JHUA 3FXKA 2X6YA 3OYIA 1AU7A 1W36D 2MYSA 3HPHA 3N05A 3CESA 2HYGD 2WB1N 2AQEA 2K9LA 2ID6A 3RDIA 2D5VA 1BI1A 1IUFA 1ETYA 2R3SA 1J0RA 2X0LA 1IN6A 4BJ5C 3KE2A 4Z2YA 3I4NJ 4L9JA 1E2XA 2R5ZB 2DMNA 1HQCA 1UHMA 3CJQB 1FIPA 1XMXA 5HS8A 4CXFA 2F5CA 3A01B 3A0HC 1YYVA 2Y9ZA 3LOCA 2XUBA 1OYYA 4MHGA 4B44A 3B6CA 2GBYA 2V26A 1JHFA 1QPIA 2DA6A 1E0EA 5CKTA 4ESFA 2I8DA 4ZC3A 1SAXA 1H89C 3FK7A 1VQ6I 2EPFA 5E1WA 4RB1A 3TMOA 2P6SA 4DIQA 2HTJA 1ODDA 4ESBA 1U6GA 1WQ2A 3BDDA 2WAEA 1JT6A 2MW8A 5CQGA 2K4JA 2Q2EB 2LF8A 3MZ8A 4RMNA 4CCKA 2HQRA 2PJPA 2MSYA 4G7ZF 5HDGA 4RGSA 1R22A 2DMUA 4TV7A 1WJAA 4ENNA 3H0GJ 2YX4A 2JRTA 2E2JJ 3K4JA 3JSPA 1W1WE 1GLNA 2P5KA 3MD2A 2KIFA 2LK2A 2ZCWA 2PMZN 1WZ2A 1D0XA 3HSEA 3TEDA 5E1ZB 3H3VK 1USSA 2AQFA 2BBYA 2P5LC 5IT9Z 3DU6A 2CS3A 3QP5A 1IRZA 2N8GA 2BY0A 1IN5A 2UXXA 4XN0A 2TRTA 4P9UA 2F5EA 1BI3A 1WH5A 3ZPLA 2M0MA 4AM3A 2HOSA 3BTCA 5AONA 2Y69H 3O6BB 1VQ8I 2E36A 2JVHA 2MGQA 3K4MA 4HV6A 5ILUA 3J7AO 1VTNC 5D5UB 1RR8C 1S5LC 3OYFA 1QNTA 4B48A 1VFCA 3F22A 3ULQB 4UUSB 3SEQA 1IO2A 4RA2A 2ZFUA 4PJNA 3JRBA 5LHIA 2CV0A 1WVRA 3DEEA 1P4AA 2ZO4A 3KX2A 4XLNF 4AVZA 1R23A 3JTHA 2DK8A 4L5JA 2DDBA 4C3JJ 1AKHA 2V1DA 5EGOB 3KZZA 2O7OA 2A68F 2CG4A 3HDDA 1QU3A 1GDTA 4OU0A 1JKPC 1D8JA 1BR4A 3F6VA 1M1EB 2Z33A 3EQLF 4JX4A 2ECBA 2IGKA 4BBRJ 1I6XA 4IHXA 1T38A 3GWZA 3IWZA 4DGWB 4A6DA 4HX8A 4RDUA 1BOAA 2XF6A 2O5RA 2XVCA 3C18A 3M07A 4CH7A 5E8IA 3TO6A 1X2MA 5K5OA 2EZHA 4EM2A 2H1LA 1JI8A 2J5PA 3WGGA 4CYCA 4A3DJ 3E6BA 1F9NA 4F91B 2Y0MA 2EFOA 3FHNA 4AU7A 2R5YA 2E60A 2H6CA 2GZWA 3LMMA 2K85A 2W4SA 3QYFA 3CCVI 4PSWA 4I98B 5IYCJ 2R7RA 3ZQQA 5ILVA 2LNBA 3MKWB 4XOPA 2NVUB 1KU3A 3QPTA 4N9HA 1HF0A 4IRIA 2H8RA 4HX7A 4XRSG 4RM3A 4BE2A 2NNYA 3DPLC 1R1UA 1XGMA 1KYWA 2XIGA 3DEUA 5LBQA 5LGUA 2F48A 4ZTFA 1BBYA 4IF4A 4E4HA 4A3FJ 1JUSA 3OS1A 2E35A 3OYJA 5TISC 5GTIC 2HOTA 2LDUA 1BJZA 3FXRA 3KFWX 3KP6A 3P9KA 3OS2A 2XPVA 3FMSA 3RKYA 3C2HA 3CUQC 4PSXA 1YW9A 2DYRH 5EG0B 3BZ6A 5ICFA 2QGUA 4DJAA 1SFKA 1HLVA 3Q0WA 4KT5C 3WHCA 2KIQA 5LHGA 3ASOH 5KK1A 5DUKA 2X48A 1H9TA 2GOXB 5FFZA 2VBZA 4I02A 1I5ZA 5FRNA 4X1EA 3OYAA 1XS9A 3B02A 1ZQ3P 4KIFA 4ZYAA 1TNSA 1BIAA 4CCMA 3QOEA 1YJNI 1JGSA 4A2UA 2CUFA 2DA1A 1SVOA 4LG0B 4LMYA 4XRFA 3PUFA 2IS2A 2HKOA 3K1PA 2NNNA 5GADJ 1VQPI 3LA2A 5JI6A 4C30A 1B8IB 3BJAA 1YQAA 3HC7A 4F3QA 3BC8A 1TZLA 3KLNA 3BT9A 4Y33A 4YIRX 2AXTC 1JE8A 1IF1A 5J47A 2QQBA 5ICEA 1ON2A 1TLHB 1K6OA 2O6GE 3RYRA 1OYWA 2RGVA 2FSWA 2Y30A 1FC3A 2BXYA 2K5CA 1KU2A 3KLOA 2IA1A 1XN7A 2D1VA 1DDNA 3ABTA 3B6AA 4HRIA 3PNYA 3CJTB 1O7LA 3M7GA 3VYRB 3GTJJ 1U8RA 1TWFJ 4IOCF 3GTOJ 3HRTA 2F2EA 1MGTA 1WSUA 1NK3P 2IS4A 3CUOA 1OCCH 2LF7A 2HDCA 3GF2A 5E17F 3QYEA 2ID3A 1BJAA 4O6JA 1W5CC 1BL0A 3L2UA 4XICA 4ZZLA 3BP8A 1LNWA 4KYWA 2EZLA 2FA5A 2CSOA 3H1CA 1LPQA 2CH0A 5JHFA 1V54H 4II3A 2KIUA 2R7OA 3B73A 5A2QZ 1A5JA 5FLXK 4PFPA 1D5YA 4G9YA 1A35A 4JK1X 1VZ0A 2VJIA 2LYCA 1J2XA 3BZCA 2IS6A 3IP4B 4BXXJ 5CLSA 1W7PB 1GVJA 1XCVA 4NQWA 2MABA 1G3WA 4GYGA 2VT3A 5J1UA 1RI7A 2UWMA 5M3MJ 1OQYA 3LQRA 1BN5A 2HXIA 4WK8F 2JT1A 2ZMEA 4UY8I 3LSKA 1MDMA 1HA8A 1HBXG 1TWCJ 1R58A 4OMZA 2BOLA 2WBMA 5HNHA 5C4JJ 4XSZF 3ONQA 2XKOA 1LFUP 3SFZA 4AYBN 3GVAA 4HBLA 1MW7A 1XD7A 4ASNA 1YTYA 1GT0C 3FXMA 3IAS2 4IJAA 2LREA 2DT6A 4EATA 4PCQA 4U0VA 4XSXF 2QSFX 3JAMZ 4LK1F 2GQQA 4HA8A 3WU0A 3NWTA 3FKJA 5CVRA 4BEHB 3EDPA 2IP2A 3REOA 1X4PA 2EA2A 1Z9CA 3PFYA 4IHTA 5FKNA 3H9QA 2KZVA 1SD5A 2Z2SB 1UFMA 4DQ2A 5HVQC 3OSFA 3QRFF 4JBAA 2M87A 1UG0A 3CJNA 2QBYA 4ON0A 2CQ7A 1PYVA 3P7NA 2VI6A 1OR7A 1X58A 3HXLA 4XKVA 1R4NB 5GAHJ 3TW7A 1HCRA 4B3XA 2ZXIA 2DQLA 2KL4A 5BPDA 4DW6A 4Z6YA 5IYDJ 1ULYA 3IKVA 3AKZA 1ETWA 3VYSB 2EINH 3HOSA 1STZA 4ZH4F 2GOMA 2E71A 3KYDB 4C3HJ 4AIJA 2VB6A 3K7AJ 3M9AA 2M2EA 3G1MA 5F08A 4X6AJ 2RKHA 2M3AA 3IL2A 1G2HA 3WHBA 3LSRA 3H9GA 2FJ1A 3ZR8X 2G0EA 1R00A 4IHSA 1WJFA 2O03A 4A3IJ 4XOTA 4HLXA 1MIJA 2R7WA 2V1XA 2ZFWA 4HQMA 4ZDLA 5M5XJ 3RKQA 1C0WA 1HW1A 1N25A 2WA0A 4AVPA 2O8XA 2XRLA 3JCUC 5EYRA 2Q0OA 4GO1A 2COBA 4XRMA 3FBIB 1ETKA 2P6TA 2LLKA 3ECOA 5HNFA 5CJ9A 2FBKA 2QSGX 2VUMJ 3HUGA 3LSGA 4XKWA 3W6JB 2OF7A 5FLMJ 1UG2A 3P5JA 4E7ZA 1IV8A 4A3EJ 3CO7C 1G6NA 3KP7A 2M34A 2JPCA 1XGOA 2PG4A 1VQ7I 3TOAA 2DBBA 4YELA 3L09A 3VODA 4R1HA 4ZYDA 1G59A 1FJLA 1TWHJ 3CC4I 4Y7NJ 2HQAA 3ZMSA 1WCMJ 1D1AA 2XPWA 3QU6A 1OMIA 2M0CA 4U7BA 1IZ1A 4JX5A 3RKXA 2MC3A 4M9XA 2Z99A 1YRNA 4HV5A 4U0WA 2JJ7A 2VODA 3LAJA 5FO5A 3V7RA 4S05A 4XLCA 2FNAA 1U8BA 3GO5A 3S3MA 1RETA 2BZTA 2V9KA 3BR5A 1QZYA 5GPAA 2KJBA 2MD0A 3C7JA 2Y0SN 1NTCA 2LD5A 2VJ5A 5DM7F 2BHZA 5FLVA 4GYIA 4N4OB 2L5QA 2X6OA 2IS1A 3T0YA 2JN6A 1CGPA 2L7ZA 2CUEA 3W2WA 1PP8F 2NVQJ 5JLXA 2Y48A 2VIXA 5IP6A 2DMQA 3WG9A 1G8XA 1N75A 2V79A 1RIOH 2LRDA 3MFKA 4MLOA 1OISA 2NAZA 5HLGA 2FNPA 1LEBA 4ZDPA 3CCQI 4UV9A 4ETSA 5J4YA 4FQGA 1LQ1A 4ZDOA 1FBSA 2O9LA 2BVMA 3O2PE 1HOMA 4EQQA 1U78A 2LOOA 3OYKA 3GTGJ 2E1MC 3M8EA 3TO9A 1ZAOA 3V8JA 3TQNA 2OCEA 2EFPA 2BHYA 4MTEA 3S2HJ 4CICA 4XLHA 4C2UA 2LBFB 1HSJA 1R4MB 2M5WA 2R93J 5D5VB 4XORA 4BHPA 3ZMTA 3ASNH 1J75A 1ZN2A 2DT7B 2STWA 3TOBA 2W24A 1LVAA 1GXPA 5D6FA 1ZLKA 2PMHA 3IUOA 3RZOJ 2DA7A 3FDYA 2CUJA 3RCOA 3K6GA 1Y0NA 3OYCA 1JGGA 5HDKA 2PX9A 3K4NA 1T33A 3WTWC 1X1DA 2ZJPF 2JSPA 5HLTA 1BI2A 4LB6B 1V5FA 3RI4A 1FMWA 4DYRA 1Y8QB 1RC9A 2EBIA 4MGRA 2AXLA 1TC3C 2IRFG 3ABMH 3IAM2 5LHHA 3RQIA 4CGZA 3H5AA 1XMKA 5BOXA 1KQ8A 4M72A 3SYTA 5F6FA 5IPAA 2DLLA 5H20A 2R7FA 1I3QJ 3IH4A 2ZB9A 3FHZA 4M74A 4DNCA 2M7BA 1D1CA 2FQ3A 4J01A 1DP3A 2ELJA 2XASA 3OIPA 4HLYA 2E1CA 3JREA 2DI3A 1QVUA 3HOTA 1WJDA 2LP0A 5JVTA 1VQMI 1SFUA 3SDGA 3JTGA 2A07F 2D45A 1BW5A 1ETVA 5F0HA 4G7OF 1LEAA 1FY7A 3AG2H 1K78A 2IEKA 3ZN0A 4XLPF 4BHCA 3BOQA 2GA1A 2JTVA 2CMPA 3CF5F 3RPQA 1TL8A 2GWRA 2HFHA 3JRIA 4BE1A 1H0MA 1HKQA 2MG4A 3MWMA 1HC8A 3HL2A 2QM3A 4MO7A 1I50J 3BR6A 1RESA 3FK6A 4LLNA 2CQXA 3BR1A 5E3NA 1UAAA 2WV0A 5GP9A 4XKCA 2HR3A 4JOMA 5FKLA 3VOEA 4A93J 4RB0A 3HKZN 1B8IA 1XSDA 1O3TA 1YO5C 1IJWC 3L2QA 4B1RA 2DPDA 2DOAA 3KP3A 3M1EA 4WX9A 3K70D 3RIRA 2AHQA 3WODF 1MMGA 3RYPA 1HKSA 1LFBA 3T5XA 1FOWA 3Q9VA 3BWGA 3WTTC 4BXUA 3RSNA 2WC2A 3AL0C 1YLFA 1BR2A 2R4GA 2Z5UA 1JUPA 4WXDA 5EEHA 1P7IA 2VN2A 3H5NA 1R5ID 3H3UA 2OD5A 2VQCA 1ZYRF 1MBEA 1WJBA 3LSIA 3D0SA 4I6ZA 2PJRB 1CF7A 2WB1A 3QAHA 3OOPA 1TW2A 2RDPA 3ISPA 2A69F 2F5VA 2KRHA 3KETA 4GCVA 2HU9A 4DZJA 2M9HA 2RQPA 2BGCA 3KYLA 1MKMA 3DXJF 1G3SA 2VBXA 4LB5A 4NHJA 3PSIA 4XNFA 3BR2A 5E20A 4A12A 3W6VA 1VQ5I 2ZJ2A 3MKLA 3QPLA 4V2GA 2CV2A 2D2WA 3FXQA 3G1OA 2VKHA 4HF2A 1BOBA 2L9VA 1AHDP 1ORKA 1B72A 3CUQB 4RB3C 3ZQCA 3RZDJ 3M8JA 2V7FA 4B8XA 2OQGA 2XDVA 2QWWA 5TGTA 4CCLA 1PUFA 1W7PA 4A3CJ 1ETXA 4GRIA 2LY1A 3ZQHA 1JKOC 1B4AA 3BQYA 5BMZA 5ICCA 3I59A 5FKMA 2KIMA 1W0TA 2Y9YA 1IRGA 1HXDA 2MD5A 1R1VA 3CLQA 4KN7X 4RGRA 4RM2A 1YX3A 1XSXA 5EF6A 2QEXI 3W3CA 1Q1VA 2ZXWH 5B1AH 5ED4A 3DLAA 4N4NB 3CO6C 4KICA 2DFIA 3U9GA 2W85A 2V1NA 5M5YJ 4RB2C 3NEUA 4I09A 2EV6A 1EH7A 4LLGF 3J7YJ 3BTIA 2HVQA 2FOWA 5L3BA 2FMLA 2IGNA 1BA5A 4A3MJ 2L2OA 1DPRA 3A03A 1HDDC 1F4KA 4E7KA 1Y6IA 4HSTA 3GTPJ 5D8KB 2FRHA 1U5TA 3ZN1A 2Y2ZA 2W84A 1FOXA 3A4CA 4G12A 1S72I 5CVIA 1JTXA 3DTIA 2M1BA 4EJUA 4OMYA 1VNDA 3LL7A 1FTZA 4IKFA 3ZRGA 3I3LA 1Q1HA 1USTA 3FWEA 5K7ZA 1DU0A 1YJ9I 4PJMA 2LY9A 4FISA 2XC7A 2VQLA 2ZJQF 3PM1A 3T8RA 4HF1A 5DCMA 1R6RA 5FLXZ 4B4CA 4F93B 4E70A 2IA0A 2ZNYA 1FZPB 3KP5A 4ANJA 3EUAA 1UHWA 2AO9A 1D5VA 2HOAA 3GW2A 3OYLA 5J3LA 2VL8A 1Z77A 2K9QA 3RPUD 1POGA 3X2QH 2VOPA 1YS7A 3H92A 2OJED 1X3UA 2XGDA 2HTSA 3H36A 2KT0A 4KDPA 1V5EA 5JR3A 1LE8A 2LMDA 1O3QA 4M3FA 5E79C 2ZC2A 4HAMA 3CCLI 1U9OA 1YITI 3D5SC 2DO7A 4B3AA 1UZCA 4M3BA 4PJJA 4ITVA 3WTUC 3WGHA 2LKSA 1IRXA 3G2BA 2CFOA 2FF4A 3JR9A 1QZEA 2UV1A 3CLOA 3BZKA 2ZMEC 3TDZC 5D8LB 2VQGA 4XBFA 4PGGA 5IY5H 2DMPA 3F8NA 4B43A 4HDVA 1HKTA 4FE4A 4ZYEA 3IHUA 3BTLA 3IH2A 4RLFA 3CDIA 1JTYA 1IN8A 1FOYA 2KPMA 3OS0A 3S1MJ 4BACA 1QHGA 2EV5A 3G4SI 5CYVA 4F7ZA 1TT5B 2IT0A 1FOKA 2K9MA 3VYUB 4MEXF 3HRMA 3E5QA 5DCFA 4IQ4A 2KRFA 3OYDA 3KEYA 4Y15A 3OYGA 3ROUA 3EYIA 2CGPA 3SZTA 3IRRA 4EVIA 4YFKF 2BW3A 2A5YB 5E3LA 5DDGA 3ZXSA 4IHYA 2VJJA 1XG1A 4KIGA 4AC0A 1YE9A 4KMUX 3LA3A 3Q0VA 1OR7C 1JKQC 1X1CA 5J40A 4WF2A 4IPAA 4QPQA 2PMUA 1HSTA 3V7SA 4CZCA 2DA2A 2QENA 3H3ZA 1K4SA 2VXZA 4HYEA 2WAQN 1F36A 5F0CA 1ZLJA 2RAEA 2YPRA 2KQRA 2BYVE 3H35A 1WGXA 1S6LA 2X1CA 4QTRA 4V2FA 1IG7A 5LD2C 4IO9F 3CCEI 1ZK8A 4D5FA 2KJCA 4QWQA 3D5LA 3ZQIA 4A5NA 3AFHA 1FPQA 2E19A 3IV5A 2A3SA 4P1WA 1SMYF 5TJJA 2EZKA 1F43A 1REPC 4KJZA 1RZ4A 4LLLA 1XGNA 3VWBA 2ELKA 4IXAA 3SEZA 2CUZA 2XSDC 4A0ZA 4FX0A 3WTZA 4Y52J 3OR1C 3MN2A 2FBIA 4KMFA 2CV1A 3S2WA 3FXLA 1EH8A 2Q1ZB 1GV2A 3K0LA 1KU7A 1LDDA 4II2A 4PFOA 3VSKA 4YIIA 2DXIA 3GTMJ 3I4PA 4DBQA 2H1KA 1K61A 4ABZA 1I1GA 1O3SA 3NQOA 2Z3YA 3R0JA 2HQ5A 4BJTA 2YU9J 2VLAA 5L3EA 1DU6A 3MCZA 4C3IJ 3W2VA 3M4OJ 2EZIA 5LRSA 3L2VA 2ZJRF 4E6KG 3F8MA 3ZP5A 3HG9A 2V9VA 1RR7A 1TW3A 2L7MP 5IT3A 4BQAA 3BJOA 1WFXA 4PDKA 3U21A 2EV0A 2L0KA 2MLKA 2EH3A 2V6CA 1Z21A 1T8IA 1RNLA 1J7KA 1IC8A 4L5IA 1EA3A 4YIFA 3GX4X 1V5GA 1VI0A 1VQNI 4XQFA 3F21A 4G7HF 1MJAA 4HX4A 3JRAA 1U0JA 2HS5A 2JRMA 3TDUC 3TO7A 2OC6A 1ZG5A 3S15J 1X3WB 1XDSA 3E1SA 4P9FA 1IXCA 3SHFA 1ZHFA 2VPRA 1LVKA 3PL8A 4QSHA 2FMYA 5BNGA 2R7VA 5FJ8J 3GZ6A 2KLOA 3I71A 4CDGA 5C3EJ 1K83J 1IN7A 2Z1DA 4XLEA 4XR6A 4JQFA 3CCUI 4GGGA 3N4MA 4C2TA 2QZ8A 5J8FA 2GM4A 4M3EA 2KHMA 1ZGAA 5FD5A 3EETA 1BC7C 2GIVA 2IBDA 3PNVA 4PGHA 4RLQA 3ZQFA 3ABUA 2L3DA 1SC7A 5IOZA 2VONA 5C4XJ 1MH3A 2ME0A 1DGRM 2X51A 1X19A 1W0UA 3HTSB 4BS9A 4XK4A 4LIVA 2VKEA 1LUJB 3KCCA 3CZ6A 2E1MB 1VF9A 4U88A 4AYBA 1X3ZB 4A3LJ 2D1HA 4W97A 3BJ6A 3JRGA 2P4WA 5BQTA 2PBIA 3MQ0A 3ZGKA 3JRHA 5KCMA 3WG7H 5DUIA 3DKWA 1I27A 4UXNA 2F4MB 2F5DA 2HNHA 4EJOA 3P9IA 1UMQA 5FKKA 1ZKGA 2A05A 1JKRC 4ZYHA 2VC0A 1MNDA 2CQNA 3OR2C 3MEXA 4BH9A 5HOOA 3VFZA 2DOEA 3BR0A 2B7EA 3BCAA 4WCGA 2W25A 2V9PA 1G3YA 3HTUA 1IXSB 2L9RA 3QPHA 1Z67A 2DDAA 4HQEA 1JJ6C 1IDZA 3HBLA 4RAFA 3NARA 2DMTA 2L9SA 4M6XA 4HSRA 5D4RA 2E5NA 3S16J 2E5ZA 1ZARA 3CP8A 3LSMA 3NWSA 3A02A 3FF5A 2BY1A 1T98A 2PJRA 3OV8A 4NDLA 3LWFA 2JMWA 1E3OC 1SD7A 2VE8A 3L7WA 3QPSA 2KDOA 3H0DA 1Z3YA 4Y3OA 5F0FA 1B9MA 4I2OA 2ETHA 4XM3A 2DA3A 3GZ5A 3I58A 3E5UA 5DM6F 2BVLA 1MBFA 2X6XA 4FE7A 4FASD 2R5ZA 3PQKA 3HYIA 4NC8A 2R0QC 3FBNB 3A01A 3C2GA 2QLZA 1UELB 2K27A 4BDZA 3JRFA 3BG9A 4PJ0C 2VJ4A 2UXNA 1OKRA 3S1RJ 1AKHB 1H88C 1NHAA 2OZ6A 3JW4A 2E1OA 1YI2I 5DV5A 2NRAC 1MNEA 2EIMH 4CCOA 1SD6A 1IRFA 1FP1D 3FMQA 4CCJA 4RBOA 2VC1A 3TP3A 4GXOA 1FT9A 1Y1WJ 5K1YA 1IAWA 2K3PA 3HHGA 3Q3SA 4M9ZA 5CVJA 4BL0B 4OOIA 4BGDA 2Q2EA 1QGPA 4HOBA 5HLIA 1GUUA 4EM0B 4OWRB 2BY3A 2IXSA 3EUKL 4D7MA 4BKXA 1FEXA 3C3WA 4UVAA 1BC8C 3CQZJ 3DEWA 4MTDA 2NYXA 1Z0XA 3O8GA 4LD5A 1MJ9A 4QIWN 4HNTA 3HIFA 5B5EC 1KGSA 4CYCB 1X4OA 3L2WA 2R5YB 3MKZA 1J59A 1LDJA 1T08B 2IW5A 2KRCA 4L9NA 2Y0SA 1Z1DA 4HPQA 2WADA 3FIWA 1YIJI 2NXNB 4KUMA 2GXAA 4UB8C 1WJEA 2IPQX 2HVSA 3HOWJ 2VQHA 1BR1A 1MMNA 2O8KA 4A3BJ 4JP0A 3W2AA 2ESNA 4E7JA 3F9KA 1CQTA 3OIQA 2Q8KA 1B6AA 2LTPA 1XB4A 4OINF 1OCOH 1APLC 3PJRA 4UUSA 5JFRA 2Z16A 1YW7A 3BG3A 2NS7A 3VYTB 4U0YA 2KISA 4D9JA 2XGEA 3TL4X 1DGWY 4PUSA 5CVVA 1IW7F 2E2IJ 5EGOA 2PQ8A 2QKLB 2M8GX 3S1QJ 2HZTA 2ACJA 1X1BA 5ERIA 4BDYA 2X1DA 1LFPA 2OUMA 1XC5A 2IGMA 4R8HA 1VQ9I 4N0BA 1TQPA 3HGGA 4UUTA 1P2FA 2FXAA 3I55I 4ESJA 1TQIA 3O3KA 1AWCA 4HNVA 3OYEA 3HPGA 3FXOA 5CPRB 4A6EA 1O3RA 3M8FA 2CJJA 5LGTA 3TKYA 2EQRA 2W48A 3RJPA 2Z9OA 4R79A 2A61A 1OFCX 3WTSC 1KZHA 3F8FA 1K4TA 1RKWA 2BEOA 2HDDA 1FMVA 3HJEA 2QYOA 3U1DA 2FU4A 3DQVC 1TP4A 3I4MJ 1A6IA 2QF7A 3HGYA 4MFDA 2QVOA 3GFLA 1JJ8C 4YG2F 5H2FC 4ENMA 1ZR4A 2V4JC 4CSWA 2CRGA 1BW6A 4RGXA 2XB5A 4M6VA 4NB5A 3ZMUA 1E3HA 2X85A 3KEOA 3KPHA 3ZMDA 1P4XA 1W36C 1A31A 4OIOF 3F3XA 2ZSHB 2J5OA 3E0JB 3QODA 1U5TC 3L00A 3GFMA 2LFBA 1RUOA 4IHWA 4AIHA 5LRRA 2X6WA 4U7DA 3WU2C 2XROA 3J7AY 5E3MA 4FT8A 2ZXJA 3VB2A 1S7EA 1OCZH 1V55H 4NUBA 4BY1J 3M3YJ 1KYZA 2A6TA 5E8GA 4EJTA 5M5WJ 2M30A 3CDLA 3S17J 1KA8A 1SAUA 5IOYA 3UKGA 2TDXA 4Y4RA 2PN6A 2FEZA 3K1MA 3K4CA 3PIPF 3OSGA 2XAQA 1ZGJA 3BG7A 4N9IA 3DKXA 4CO8A 2LY2A 1IN4A 2HGCA 2MH9A 4UB6C 5EG0A 1KQ0A 1RUNA 2F4IA 1S3JA 3D1NI 1XGSA 2EWNA 3FX3A 3OYHA 4V19K 5EZGA 2COMA 2IA2A 1WWXA 2JUCA 2RNGA 4EEFG 5LFAA 1RPWA 3NAUA 4MFEA 2I5UA 3GLLA 3J80K 2R7UA 2OA4A 2EFQA 4P96A 1ZH5A 4K2EA 1LJ9A 1XTAA 1R5GA 3RTRA 1XMAA 3FISA 4KFCA 2HI3A 4BHBA 3CMYA 1EJ9A 5KNLA 1OPCA 1WH7A 2R7DA 1TQMA 1DUXC 4BU2A 3HKZA 3BCBA 4NQWB 4LG0A 5KAFC 1ZRCA 2PLYA 4XMYA 1E17A 3ECHA 2ME6A 1D1BA 3DBHB 4Q5SF 2XRNA 4B47A 5LEKA 3T8TA 2V6EA 2QA4I 2CW7A 4IEJA 3L2CA 4LJZF 4KT6A 4A0XA 2VPLA 4UV8A 5FD6A 1MDMB 2NOJB 4EGYA 4S04A 1JT0A 4L9TA 1R5HA 1QA6A 1XCBA 2E7XA 3I0TA 4IVNA 3K4KA 1OCRH 3A0BC 1YG2A 4I01A 2LC2A 1FWZA 4YEJA 3A1YA 4BQNA 5B66C 1L3LA 5ILSA 3V4GA 3DF8A 1QRYA 4A3JJ 2NS8A 1N78A 2R7ZJ 4A3KJ 2KP6A 1J5YA 4BNCA 1FYLA 1IV6A 5EZHA 1ZRDA 1SVMA 2XPUA 4KISA 4F52A 1T0FC 2E7WA 3KYCB 3HB9A 3BG5A 3H9JA 4EJVA 2QBYB 1TBXA 4RGUA 3DTEA 4UUVA 2R7SA 5C44J 4L18B 2MH2A 2W00A 3R6SA 2JQ7A 4O5VA 1MMSA 1DPUA 1OCPA 2DOFA 2HXOA 3HRSA 2XB0X 4FCYA 2R7XA 1O4XA 4WXCA 3OMYA 1T39A 4H4KC 1FBUA 2ZNZA 2L01A 4IQJA 1S7AA 5KAIC 2GXBA 2MFZA 3CTAA 1NH3A 3HOXJ 4HG2A 5J1YA 2M8EA 1SEUA 2DJIA 3SQNA 2IVMA 3QWLA 2W1OA 4XONA 3HEFA 4DYQA 3WTVC 4I99C 3F23A 5LEJA 2XV4S 5E1XA 2EIJH 2KZGA 1UHSA 4HW0A 3MZYA 2KKOA 2H94A 4LITA 2MA3A 3HOZJ 2NOGA 5L3CA 3LAPA 2BV6A 4YRVA 3K10A 1V3FA 4WWCA 2IJLA 4HF0A 4RAGA 3D5RC 3S93A 2PMZA 2IAIA 5DD8A 3HUGB 1FLIA 4MNUA 4UVBA 3QQAA 1XPXA 1QZZA 2O3FA 1TT0A 4EJWA 4EM1A 4A3GJ 2DODA 3LFUA 3G71I 4MQVA 2LVSA 4BEHA 1FYKA 4EV0A 4CYDA 2R92J 1H8AC 4FX4A 5K5QA 1K6YA 2XAFA 3AG4H 1ENHA 3MAJA 4BUPA 4CA0A 2VOOA 2DYSH 1JHHA 4PZJA 2CQQA 1YRNB 3OYBA 3I9V2 3P9CA 3R61A 1YS6A 1GVDA 2GAUA 3DBRB 4A69C 2E34A 5EEGA 2BXZA 1K79A 2LKXA 4CCNA 2FX0A 2ZKZA 1UCRA 3SFIA 1W5TA 3ML6A 5L3GA 1Y0UA 4XL9A 2HKXA 3U2RA 3CCJI 5LGNA 2L4AA 2OTLI 2ISYA 5KHDA 2HYJA 4S0HB 1PP7U 2X1EA 2GIZA 3GUDA 1Z6RA 2JZYA 3OWTA 1V4RA 1D0YA 4FETA 2HDWA 3GEZA 3SJMA 4XIDA 2F5FA 5DYMA 1RKTA 2DFHA 3RKWA 2OAZA 3NRVA 2RQQA 3K2AA 1ZTRA 4NC6A 3E97A 4Q47A 2F4OB 2FQ4A 5F1RA 4BQQA 4IX7A 3K1NA 1R7JA 2L02A 3F8CA 3M1CA 1BM9A 1FBQA 5JLWA 3L1PA 1Y39A 4C2MJ 2DN0A 5JVGF 1SFEA 4HDUA 4J00A 4XLFA 4FTHA 2YS9A 3GFIA 1A36A 4L0YB 2NVTJ 4UVCA 5L3DA 3PQJA 3E6DA 3PNTA 2Y75A 4LK0F 4OAZA 4YFNF 3PO3J 3DU5A 4M6YA 1J09A 4BYYA 4G6TB 4P55A 2H8WA 4Y13A 1WRJA 5DS9A 1UB9A 4XRSA 2I10A 1B9NA 1OYIA 2QUFA 3E7LA 1Y1VJ 3UR3C 1P6RA 5HDNA 3J81K 4P5OA 2K3FA 3BLYA 1YW8A 1TNTA 2KFDA 1KU9A 3KZYA 2W7NA 2R7QA 1SVLA 3DFGA 2K9NA 5D6EA 4D5CA 4BE0A 3GLXA 5BS6A 3KEQA 2L54A 3PFIA 6PAXA 3SDBA 1HDPA 1I1SA 3RPUA 1ZREA 4E7HA 2P7CB 4QLCU 1KONA 2C6YA 3G3ZA 4ZYGA 3ERED 1EF4A 2CU7A 1T0FA 2YUSA 2Y31A 1L0OC 1X1AA 1R71A 2WAQA 1MZBA 3DTKA 3CCYA 3FXUA 4I7HA 3JRDA 5F04A 4KNYA 3FM5A 4HNUA 2EFNA 1W5SA 5GTHC 5AIPA 4DZPA 2B0LA 2A5WA 2KMUA 2EILH 2HEOA 4UNOA 3R60A 3LQQA 3V8KA 2DFEA 3ZQGA 3I53A 4BXFA 3SZGA 2K7LA 2WAFA 5FROA 3V7CA 3S1NJ 2VE9A 2ZSIB 4DOZA 3E6CC 2HOEA 3CDHA 3QOPA 3Q5FA 1G3TA 4OIRF 4AIKA 2B63J 3J7ZI 4OIPF 4Y17A 1K78B 1FSHA 1EKEA 1I6HJ 2CWEA 2LBFA 3I5UA 2EB7A 3R0AA 2XAHA 4EGZA 1WHUA 2UZKA 3Q0UA 2XGXA 3LSJA 3W6KB 4LFUA 4I76A 3FMRA 5H6QA 1PJRA 4IRHA 9ANTA 5IP9J 3IC7A 2RN7A 4KIBA 5J4VA 2AS5F 3KP2A 3I64A 3BQZA 2RREA 2QQ8A 5D4SA 2LKPA 2V1UA 4GDFA 1FTTA 2L7FP 1FP2A 2M4GA 3T1BA 2K9SA 3QP6A 2WY8Q 1MSEC 3GCMA 2NVYJ 3MVPA 1NK2P 2VASA 4ZZDA 3CC2I 3WGIA 1GV5A 5AIQA 1BI0A 1TTYA 3BROA 3DWLE 2OTJI 3OL4A 1SD4A 1S7OA 1YHQI 2A6HF 2JWTA 5IYBJ 4C9YA 1T2KA 2JVGA 3LSHA 1ZG1A 3SZPA 4ZTJA 1ZRFA 5HS7A 3HSFA 2XGCA 3DV8A 2DTRA 4MIMA 3F8BA 4CUGA 4DBRA 3UNGC 5IT9K 2FBHA 3CP2A 4F92B 3U1KA 3GTLJ 2VXDA 3CMAI 4D1QA 1J9IA 4IZZA 1Z7LA 2DU9A 2O0YA 5H6RA 3E6MA 3HZJA 1E3PA 5GPCA 4IOAF 1ZR2A 2DFFA 3G73A 4LGWA 3HM5A 3IKTA 1KQ9A 3ABKH 1CF7B 3A2KA 4DYCA 3GTQJ 4LG3A 3GBGA 1RRJA 2ZBKA 3S2DJ 2E2HJ 3CCMI 2M4KA 2CW0F 1XDUA 1D0ZA 2H27A 1ZGWA 1QQIA 3VDXA 1TWGJ 1MMAA 2XSJC 4BY7J 1H9GA 4MQ9F 3EPZA 4AD9A 3DCFA 1SFOJ 2G7UA 5IP7J 1B72B 4WXHA 1AA7A 2CQKA 2X9DA 1ZG3A 3F72A 2EIKH 3TBIA 2PI0A 1PUFB 1R36A 2OU2A 5EDNA 2JA8J 2HWVA 4XLAA 5HLHA 1R1TA 3GMEA 3S8PA 3PO2J 4MEYF 1X2NA 3I59B 3DP7A 4Q4ZF 3C2BA 4AIDA 2HPMA 2EA4A 3CMEI 3DKYA 4F55A 1FSEA 3KIOA 2MBFA 3LFKA 4HEA2 2XAUA 2G7HA 3ERMA 3FZVA 5KVRA 3ZCOA 5GAEJ 1YFHA 3L2RA 4L5EA 1ITYA 3CCRI 3DLLF 3V8LA 2XF7A 2DW4A 2QKMB 1MSFC 1LB2A 3E5XA 1T6SA 4G6DA 2VT2A 2L9NA 2P8TA 2HZDA 3F0CA 2JA6J 1W4MA 1PDNC 3HRUA 1U5TB 1WI9A 3FKIJ 5FKOA 2DA4A 1B59A 1FYMA 4IL6C 2DJNA 2K02A 4IHVA 4U87A 2CYYA 4QPOA 3R4KA 3ZMZA 1MBKA 3AAFA 5B1BH 1QVTA 4D7NA 4G94A 4B09A 4ENKA 2WV1A 2DPUA 3IH3A 4IRGA 3GXOA 4BAYA 5J6XA 2M7AA 4JYKA 4NC7A 2QCOA 1F1ZA 5DCMB 3SXYA 1FX7A 1OLTA 5K7HA 3J80Z 3CCSI 1N77A 1OCTC 1O7FA 3S32A 1YJWI 3V42A 2CFXA 3CUQA 5DD4A 3BR3A 4E7IA 2QQ9A 3K69A 1ONVA 1B1BA 4BQOA 1T56A 4BJ6C 2WWYA 2DT5A 2K86A 4CHUA 1MMDA 4XKBA 1X1PA 1LKXA 1SFXA 3OL3A 2YU3A 4ZJZA 5J1RA 4G8XA 5EEAA 2R7TA 2E1NA 3K4BA 1GHCA 1LE8B 1IUYA 1U2WA 2JA5J 1TWAJ 5B3SH 5F64A 1MNMC 2DTZA 2B9SA 2NS0A 4E7SA 2LH9A 4AWXB 3IRQA 4M3GA 5GAGJ 3I54A 1UJ8A 1YX5A 1IGNA 3DBLB 2XKPA 2MLGA 2VBYA 2JUGA 4M71A 2STTA 4Q48A 3N97A 4A0YA 1F5TA 3GFJA 2PEXA 2DQRA 5E3OA 5CVUA 3GYHX 1YIOA 1K7AA 3ELKA 2HYFA 3FXJA 3L9FA 3G6EI 1HW5A 1OJLA 2YR2A 4I0BA 3AL0B 3ZMVA 2HVRA 3TP0A 1DP7P 1ETQA 3I56I 3ZQ7A 3EUHC 1VQOI 1PVEA 3TGNA 2G9WA 2BW3B
chains in the Genus database with same CATH topology
2XAGA 2EJRA 3QU3A 3K9TA 3BY6A 3HSRA 1PUEE 5FB2A 1WKMA 2LSOA 2QQAA 4RAZA 3JSOA 3LA7A 1BIBA 3COAC 3C1DA 1Z6TA 1QO0D 5J8CA 5HS9A 5A2QK 2P7VB 1EH6A 5FFXA 2RNJA 3WU1B 1Z05A 4KA4A 4H0EA 4L0ZB 4G6QA 2FOKA 3VEPA 3EYYA 4A5MA 1U3EM 3HHHA 2RV8A 4L9VA 5L3FA 1GXQA 2XHKA 2WTEA 2DK5A 4I0AA 2JSCA 3DPTA 2M45A 1JXSA 3WTXC 2OZUA 2CO5A 5LLQA 1MJBA 1S29A 4UHTA 4M9SA 4KN4X 3JAMK 1LDKB 2A6EF 2YSRA 1SMTA 4OIQF 1Z7UA 3MZHA 4ENJA 1D8KA 3KP4A 4HZFA 2ADUA 2HQNA 2RVCA 1FNNA 3Q9SA 1P92A 2JPBA 4D0PA 5BPIA 2FE3A 1G4DA 1XSVA 3K2ZA 5D5WB 1MD0A 1ON1A 2EK5A 5ICGA 2O61A 3FM3A 2OBPA 2BE5F 3E3VA 3WE2A 3BPXA 1QPMA 5TRDA 2W57A 1D3YA 2X4HA 2RC4A 2XAJA 5D5XB 2ISZA 1IXRC 1P4WA 3F6OA 2H09A 4FHTA 1AOYA 4RAYA 5DEQA 2ZMEB 2YX7A 3J81Z 2PFBA 4M73A 2GXGA 2H6BA 4O3MA 2L4MA 2K4BA 1A04A 2P5VA 2ESHA 4RS8A 1S8NA 1O57A 2ELHA 2GA2A 1HW2A 5E18F 1W7PD 2OQRA 2VBWA 5K5RA 3WE3A 3WTYC 2EFWA 2DAOA 4CZZA 3IWFA 1EV7A 3EUHA 5FGMA 3LSTA 4YFXF 1QBJA 4EMSA 1Z91A 3BPVA 5JHUA 2HYGD 3RDIA 1BI1A 2R3SA 1J0RA 2X0LA 1IN6A 3KE2A 4Z2YA 4L9JA 1E2XA 1HQCA 1UHMA 5HS8A 4CXFA 2F5CA 1YYVA 2XUBA 1OYYA 4MHGA 1JHFA 4ESFA 1SAXA 5E1WA 4RB1A 2P6SA 2HTJA 1ODDA 4ESBA 1U6GA 1WQ2A 3BDDA 2K4JA 2LF8A 2PJPA 2HQRA 4G7ZF 5HDGA 4RGSA 1R22A 4TV7A 4ENNA 2YX4A 2JRTA 3JSPA 2P5KA 2KIFA 2ZCWA 3HSEA 5E1ZB 5IT9Z 1USSA 2P5LC 2BBYA 3QP5A 1IN5A 2UXXA 4P9UA 2F5EA 1BI3A 3ZPLA 5AONA 3O6BB 4HV6A 5ILUA 3J7AO 1VTNC 5D5UB 1QNTA 3F22A 3ULQB 5LHIA 1P4AA 2ZO4A 4XLNF 1R23A 3JTHA 2DK8A 4L5JA 2V1DA 3KZZA 2A68F 2CG4A 4OU0A 1D8JA 3F6VA 2Z33A 3EQLF 1I6XA 1T38A 3GWZA 3IWZA 4A6DA 4HX8A 1BOAA 2XVCA 3C18A 5E8IA 3TO6A 5K5OA 4EM2A 2J5PA 3WGGA 3E6BA 1F9NA 2Y0MA 2EFOA 2H6CA 2GZWA 4I98B 5ILVA 2LNBA 1KU3A 3QPTA 4N9HA 4IRIA 4HX7A 2NNYA 3DPLC 1R1UA 1XGMA 1KYWA 2XIGA 3DEUA 5LBQA 5LGUA 1BBYA 4IF4A 2LDUA 3FXRA 3KFWX 3KP6A 3P9KA 3FMSA 3RKYA 3CUQC 1YW9A 3BZ6A 5ICFA 4KT5C 5LHGA 5KK1A 5DUKA 1H9TA 5FFZA 2VBZA 4I02A 1I5ZA 3B02A 4KIFA 1TNSA 1BIAA 1JGSA 4A2UA 4LG0B 4LMYA 4XRFA 2HKOA 3K1PA 2NNNA 3LA2A 5JI6A 3BJAA 1YQAA 3KLNA 1JE8A 1IF1A 2QQBA 5ICEA 1ON2A 1TLHB 1K6OA 2O6GE 3RYRA 1OYWA 2RGVA 2FSWA 1FC3A 1KU2A 3KLOA 2IA1A 1XN7A 2D1VA 1DDNA 3ABTA 3M7GA 1O7LA 1U8RA 3HRTA 2F2EA 1MGTA 1WSUA 3CUOA 2LF7A 2HDCA 3GF2A 5E17F 1BJAA 4O6JA 4ZZLA 3BP8A 1LNWA 4KYWA 2FA5A 2CSOA 5A2QZ 2KIUA 3B73A 5FLXK 4G9YA 4JK1X 1J2XA 5CLSA 1W7PB 1GVJA 1XCVA 4NQWA 1G3WA 4GYGA 2VT3A 1RI7A 2UWMA 3LQRA 1BN5A 4WK8F 2JT1A 2ZMEA 1MDMA 1HBXG 1R58A 4OMZA 4XSZF 2XKOA 3SFZA 3GVAA 4HBLA 1XD7A 4ASNA 1YTYA 4IJAA 4PCQA 4U0VA 4XSXF 3JAMZ 4LK1F 2GQQA 4HA8A 3WU0A 5CVRA 3EDPA 2IP2A 3REOA 2EA2A 1Z9CA 4IHTA 1SD5A 4DQ2A 1UFMA 5HVQC 3QRFF 4JBAA 2M87A 3CJNA 2QBYA 4ON0A 3P7NA 1OR7A 2DQLA 5BPDA 1ULYA 3IKVA 3HOSA 1STZA 4ZH4F 4AIJA 3M9AA 2RKHA 3IL2A 1R00A 4IHSA 2O03A 4HLXA 2V1XA 2ZFWA 4HQMA 1C0WA 1HW1A 4AVPA 2O8XA 2Q0OA 4GO1A 2P6TA 3ECOA 5CJ9A 2FBKA 3HUGA 3W6JB 3CO7C 1G6NA 3KP7A 2JPCA 1XGOA 2PG4A 3TOAA 2DBBA 3L09A 3VODA 4R1HA 4ZYDA 3ZMSA 3QU6A 1OMIA 4U7BA 1IZ1A 3RKXA 4M9XA 2MC3A 2Z99A 4HV5A 4U0WA 2VODA 3LAJA 5FO5A 3V7RA 4S05A 2FNAA 3GO5A 1QZYA 2KJBA 3C7JA 4GYIA 3T0YA 1CGPA 1PP8F 2Y48A 3WG9A 2V79A 1RIOH 3MFKA 2NAZA 5HLGA 2FNPA 1LEBA 4UV9A 4ETSA 1LQ1A 1FBSA 3O2PE 4EQQA 1U78A 3M8EA 3TO9A 1ZAOA 3V8JA 3TQNA 2EFPA 4MTEA 4CICA 1HSJA 2M5WA 5D5VB 4BHPA 3ZMTA 1J75A 1ZN2A 2STWA 3TOBA 2W24A 1LVAA 1GXPA 5D6FA 1ZLKA 2PMHA 5HDKA 3WTWC 1BI2A 4LB6B 3RI4A 4MGRA 2AXLA 2IRFG 5LHHA 4CGZA 1XMKA 5BOXA 1KQ8A 4M72A 5F6FA 2DLLA 5H20A 2R7FA 3FHZA 4M74A 4DNCA 2FQ3A 2XASA 4HLYA 2E1CA 2DI3A 3HOTA 5JVTA 1SFUA 3JTGA 2A07F 2D45A 4G7OF 1LEAA 1FY7A 1K78A 3ZN0A 4XLPF 4BHCA 3BOQA 2GA1A 2JTVA 3RPQA 2GWRA 2HFHA 1H0MA 1HKQA 3MWMA 2QM3A 4LLNA 2WV0A 2HR3A 3VOEA 4RB0A 1XSDA 1O3TA 1YO5C 2DPDA 3KP3A 3M1EA 4WX9A 3RIRA 3WODF 3RYPA 1HKSA 3T5XA 3Q9VA 3BWGA 3WTTC 4BXUA 2WC2A 1YLFA 2Z5UA 4WXDA 5EEHA 2VN2A 3H3UA 2OD5A 1ZYRF 3D0SA 1CF7A 3QAHA 3OOPA 1TW2A 2RDPA 3ISPA 2A69F 3KETA 4GCVA 2RQPA 2BGCA 1MKMA 3DXJF 1G3SA 2VBXA 4LB5A 4NHJA 5E20A 4A12A 2ZJ2A 2D2WA 3FXQA 4HF2A 3CUQB 4RB3C 4B8XA 2OQGA 2QWWA 1W7PA 1B4AA 5BMZA 5ICCA 3I59A 2KIMA 1IRGA 1HXDA 2MD5A 1R1VA 4RGRA 4KN7X 1XSXA 5ED4A 3CO6C 4KICA 2DFIA 3U9GA 2W85A 4RB2C 3NEUA 4I09A 2EV6A 1EH7A 4LLGF 5L3BA 2FMLA 1DPRA 1F4KA 5D8KB 2FRHA 1U5TA 3ZN1A 2W84A 5CVIA 2M1BA 4EJUA 4OMYA 1Q1HA 1USTA 3FWEA 3T8RA 4HF1A 5DCMA 5FLXZ 4E70A 2IA0A 2ZNYA 1FZPB 3KP5A 1UHWA 1D5VA 3GW2A 2VOPA 1YS7A 3H92A 1X3UA 2HTSA 4KDPA 5JR3A 1O3QA 4HAMA 2DO7A 3WTUC 3WGHA 2FF4A 3CLOA 3TDZC 5D8LB 4XBFA 4PGGA 3F8NA 4HDVA 1HKTA 4ZYEA 3IHUA 1IN8A 2EV5A 5CYVA 4F7ZA 2IT0A 1FOKA 4MEXF 3HRMA 3E5QA 5DCFA 2KRFA 4Y15A 3ROUA 3EYIA 2CGPA 3SZTA 3IRRA 4EVIA 4YFKF 2A5YB 5DDGA 4KIGA 4KMUX 3LA3A 4WF2A 4IPAA 2PMUA 1HSTA 3V7SA 2QENA 3H3ZA 2VXZA 4HYEA 1ZLJA 2YPRA 2BYVE 1S6LA 2KJCA 4QWQA 3D5LA 4A5NA 1FPQA 2A3SA 5TJJA 1SMYF 1REPC 1RZ4A 4LLLA 1XGNA 4IXAA 4A0ZA 4FX0A 3WTZA 2FBIA 4KMFA 3S2WA 1EH8A 3K0LA 1KU7A 1LDDA 4YIIA 3I4PA 1I1GA 1O3SA 3NQOA 2Z3YA 3R0JA 5L3EA 3MCZA 5LRSA 3F8MA 3ZP5A 2V9VA 1TW3A 5IT3A 4BQAA 3BJOA 4PDKA 2EV0A 2MLKA 2V6CA 1RNLA 1J7KA 4L5IA 4YIFA 3GX4X 3F21A 4G7HF 1MJAA 4HX4A 2HS5A 3TDUC 3TO7A 1ZG5A 1XDSA 4P9FA 1IXCA 3SHFA 1ZHFA 2FMYA 3GZ6A 3I71A 4CDGA 1IN7A 4JQFA 4GGGA 3N4MA 2QZ8A 5J8FA 1ZGAA 5FD5A 3EETA 1BC7C 2GIVA 4PGHA 3ABUA 2L3DA 2VONA 3HTSB 3KCCA 4U88A 2D1HA 3BJ6A 2P4WA 5BQTA 2PBIA 3MQ0A 5DUIA 3DKWA 1I27A 4UXNA 2F5DA 4EJOA 3P9IA 4ZYHA 2VC0A 3MEXA 4BH9A 5HOOA 3VFZA 4WCGA 2W25A 1G3YA 3HTUA 1IXSB 4HQEA 3QPHA 4M6XA 5D4RA 1ZARA 3FF5A 1T98A 3OV8A 3LWFA 1SD7A 2VE8A 1B9MA 4I2OA 2ETHA 3I58A 3GZ5A 3E5UA 3PQKA 3HYIA 2QLZA 2K27A 2UXNA 1OKRA 1NHAA 2OZ6A 3JW4A 5DV5A 2NRAC 1SD6A 1FP1D 1IRFA 3FMQA 2VC1A 4GXOA 1FT9A 5K1YA 1IAWA 3HHGA 4M9ZA 5CVJA 4OOIA 2Q2EA 1QGPA 4HOBA 5HLIA 4EM0B 3C3WA 4UVAA 1BC8C 4MTDA 2NYXA 4LD5A 1MJ9A 3HIFA 1KGSA 1J59A 1LDJA 2IW5A 4L9NA 1Z1DA 4KUMA 2IPQX 2ESNA 2Q8KA 1B6AA 4OINF 1XB4A 5JFRA 1YW7A 4U0YA 5CVVA 1IW7F 2PQ8A 2HZTA 2ACJA 5ERIA 4R8HA 4N0BA 1TQPA 4ESJA 1P2FA 2FXAA 1TQIA 3O3KA 1AWCA 4A6EA 1O3RA 3M8FA 5LGTA 3TKYA 3RJPA 2Z9OA 4R79A 2A61A 3WTSC 3F8FA 2BEOA 2QYOA 3U1DA 2FU4A 3DQVC 2QVOA 3GFLA 4YG2F 4ENMA 4RGXA 4NB5A 3ZMUA 3KEOA 3ZMDA 1P4XA 4OIOF 3F3XA 2J5OA 1U5TC 3L00A 3GFMA 1RUOA 4AIHA 5LRRA 4U7DA 2XROA 4FT8A 2ZXJA 3VB2A 1KYZA 5E8GA 4EJTA 2M30A 1KA8A 2TDXA 2PN6A 2FEZA 3K1MA 2XAQA 1ZGJA 4N9IA 4CO8A 1IN4A 2HGCA 2MH9A 1KQ0A 1RUNA 1S3JA 1XGSA 2EWNA 3FX3A 2COMA 2IA2A 1WWXA 3J80K 2OA4A 2EFQA 4P96A 1ZH5A 4K2EA 1LJ9A 1R5GA 3RTRA 1XMAA 4KFCA 4BHBA 1OPCA 2R7DA 1TQMA 1DUXC 1ZRCA 4LG0A 2PLYA 1E17A 3ECHA 4Q5SF 2XRNA 5LEKA 3T8TA 3L2CA 4LJZF 4A0XA 4UV8A 5FD6A 1MDMB 4EGYA 4S04A 4L9TA 1R5HA 1XCBA 2E7XA 3I0TA 4IVNA 1YG2A 4I01A 1FWZA 1L3LA 5ILSA 3V4GA 3DF8A 1J5YA 4BNCA 1FYLA 1ZRDA 2E7WA 2QBYB 4EJVA 1TBXA 4RGUA 4UUVA 4L18B 2MH2A 3R6SA 4O5VA 1DPUA 3HRSA 4WXCA 1T39A 1FBUA 2ZNZA 2L01A 1S7AA 2GXBA 3CTAA 2M8EA 3SQNA 2IVMA 3F23A 3WTVC 5LEJA 2XV4S 5E1XA 4HW0A 3MZYA 2KKOA 2H94A 2MA3A 5L3CA 3LAPA 2BV6A 4WWCA 1V3FA 2IJLA 4HF0A 5DD8A 1FLIA 4MNUA 4UVBA 1QZZA 2O3FA 4EJWA 4EM1A 4MQVA 1FYKA 4EV0A 4CYDA 4FX4A 5K5QA 2XAFA 3MAJA 2VOOA 1JHHA 4PZJA 3P9CA 3R61A 1YS6A 2GAUA 5EEGA 1K79A 2ZKZA 1UCRA 1W5TA 3ML6A 5L3GA 1Y0UA 2HKXA 3U2RA 5LGNA 2L4AA 2ISYA 1PP7U 3GUDA 1Z6RA 2JZYA 1V4RA 3GEZA 2F5FA 5DYMA 3RKWA 2OAZA 3NRVA 4Q47A 3E97A 5F1RA 3K1NA 1R7JA 2L02A 3F8CA 1BM9A 1FBQA 1SFEA 4HDUA 3GFIA 4L0YB 4UVCA 5L3DA 3PQJA 3E6DA 2Y75A 4LK0F 4YFNF 4M6YA 4BYYA 4P55A 4Y13A 1WRJA 1UB9A 1B9NA 1OYIA 2QUFA 3J81K 5HDNA 1P6RA 4P5OA 1YW8A 1TNTA 1KU9A 3KZYA 3DFGA 5D6EA 3GLXA 5BS6A 3KEQA 2L54A 3PFIA 6PAXA 1I1SA 3RPUA 1ZREA 2P7CB 4QLCU 2C6YA 3G3ZA 4ZYGA 3ERED 1T0FA 1L0OC 1MZBA 3FXUA 4I7HA 4KNYA 3FM5A 2EFNA 1W5SA 5AIPA 2B0LA 2HEOA 4UNOA 3R60A 3LQQA 3V8KA 3I53A 2K7LA 3V7CA 2VE9A 3E6CC 2HOEA 3CDHA 3Q5FA 3QOPA 1G3TA 4OIRF 4AIKA 4OIPF 4Y17A 1K78B 1FSHA 2CWEA 3I5UA 2EB7A 3R0AA 2XAHA 4EGZA 2UZKA 2XGXA 3W6KB 4LFUA 3FMRA 5H6QA 4IRHA 3IC7A 2RN7A 4KIBA 2AS5F 3KP2A 3I64A 5D4SA 2LKPA 2V1UA 1FP2A 3T1BA 3QP6A 4ZZDA 3WGIA 5AIQA 1BI0A 1TTYA 3BROA 1SD4A 1S7OA 2A6HF 1T2KA 1ZG1A 3SZPA 1ZRFA 5HS7A 3HSFA 3DV8A 2DTRA 3F8BA 5IT9K 2FBHA 1J9IA 2DU9A 2O0YA 5H6RA 3E6MA 3G73A 4LGWA 3IKTA 1KQ9A 1CF7B 2ZBKA 2CW0F 1XDUA 2H27A 1QQIA 1H9GA 4MQ9F 4AD9A 2G7UA 4WXHA 2CQKA 1ZG3A 3F72A 2PI0A 1R36A 2OU2A 2HWVA 5HLHA 1R1TA 4MEYF 3I59B 3DP7A 4Q4ZF 2EA4A 1FSEA 2MBFA 3LFKA 2G7HA 3FZVA 5KVRA 1YFHA 3V8LA 2DW4A 1LB2A 3E5XA 1T6SA 4G6DA 2VT2A 2P8TA 1W4MA 1PDNC 3HRUA 1U5TB 1WI9A 1B59A 1FYMA 2K02A 2CYYA 3R4KA 3ZMZA 3AAFA 4G94A 4B09A 4ENKA 2DPUA 4IRGA 3GXOA 4BAYA 5J6XA 5DCMB 1F1ZA 3SXYA 3J80Z 1FX7A 1O7FA 2CFXA 3CUQA 5DD4A 2QQ9A 3K69A 1ONVA 1B1BA 2WWYA 2DT5A 2K86A 4CHUA 1SFXA 2YU3A 4G8XA 2E1NA 1GHCA 1IUYA 1U2WA 5F64A 2NS0A 4AWXB 3IRQA 3I54A 2XKPA 2MLGA 2VBYA 4M71A 2STTA 4Q48A 3N97A 4A0YA 1F5TA 3GFJA 2PEXA 2DQRA 5CVUA 3GYHX 1YIOA 1K7AA 3ELKA 2HYFA 3L9FA 1HW5A 2YR2A 4I0BA 3ZMVA 1DP7P 3ZQ7A 3L7WA 3TGNA 2G9WA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XAG A;  2EJR A;  3QU3 A;  3K9T A;  3BY6 A;  3HSR A;  1PUE E;  5FB2 A;  1WKM A;  2LSO A;  2QQA A;  4RAZ A;  3JSO A;  3LA7 A;  1BIB A;  3COA C;  3C1D A;  1Z6T A;  1QO0 D;  5J8C A;  5HS9 A;  5A2Q K;  2P7V B;  1EH6 A;  5FFX A;  2RNJ A;  3WU1 B;  1Z05 A;  4KA4 A;  4H0E A;  4L0Z B;  4G6Q A;  2FOK A;  3VEP A;  3EYY A;  4A5M A;  1U3E M;  3HHH A;  2RV8 A;  4L9V A;  5L3F A;  1GXQ A;  2XHK A;  2WTE A;  2DK5 A;  4I0A A;  2JSC A;  3DPT A;  2M45 A;  1JXS A;  3WTX C;  2OZU A;  2CO5 A;  5LLQ A;  1MJB A;  1S29 A;  4UHT A;  4M9S A;  4KN4 X;  3JAM K;  1LDK B;  2A6E F;  2YSR A;  1SMT A;  4OIQ F;  1Z7U A;  3MZH A;  4ENJ A;  1D8K A;  3KP4 A;  4HZF A;  2ADU A;  2HQN A;  2RVC A;  1FNN A;  3Q9S A;  1P92 A;  2JPB A;  4D0P A;  5BPI A;  2FE3 A;  1G4D A;  1XSV A;  3K2Z A;  5D5W B;  1MD0 A;  1ON1 A;  2EK5 A;  5ICG A;  2O61 A;  3FM3 A;  2OBP A;  2BE5 F;  3E3V A;  3WE2 A;  3BPX A;  1QPM A;  5TRD A;  2W57 A;  1D3Y A;  2X4H A;  2RC4 A;  2XAJ A;  5D5X B;  2ISZ A;  1IXR C;  1P4W A;  3F6O A;  2H09 A;  4FHT A;  1AOY A;  4RAY A;  5DEQ A;  2ZME B;  2YX7 A;  3J81 Z;  2PFB A;  4M73 A;  2GXG A;  2H6B A;  4O3M A;  2L4M A;  2K4B A;  1A04 A;  2P5V A;  2ESH A;  4RS8 A;  1S8N A;  1O57 A;  2ELH A;  2GA2 A;  1HW2 A;  5E18 F;  1W7P D;  2OQR A;  2VBW A;  5K5R A;  3WE3 A;  3WTY C;  2EFW A;  2DAO A;  4CZZ A;  3IWF A;  1EV7 A;  3EUH A;  5FGM A;  3LST A;  4YFX F;  1QBJ A;  4EMS A;  1Z91 A;  3BPV A;  5JHU A;  2HYG D;  3RDI A;  1BI1 A;  2R3S A;  1J0R A;  2X0L A;  1IN6 A;  3KE2 A;  4Z2Y A;  4L9J A;  1E2X A;  1HQC A;  1UHM A;  5HS8 A;  4CXF A;  2F5C A;  1YYV A;  2XUB A;  1OYY A;  4MHG A;  1JHF A;  4ESF A;  1SAX A;  5E1W A;  4RB1 A;  2P6S A;  2HTJ A;  1ODD A;  4ESB A;  1U6G A;  1WQ2 A;  3BDD A;  2K4J A;  2LF8 A;  2PJP A;  2HQR A;  4G7Z F;  5HDG A;  4RGS A;  1R22 A;  4TV7 A;  4ENN A;  2YX4 A;  2JRT A;  3JSP A;  2P5K A;  2KIF A;  2ZCW A;  3HSE A;  5E1Z B;  5IT9 Z;  1USS A;  2P5L C;  2BBY A;  3QP5 A;  1IN5 A;  2UXX A;  4P9U A;  2F5E A;  1BI3 A;  3ZPL A;  5AON A;  3O6B B;  4HV6 A;  5ILU A;  3J7A O;  1VTN C;  5D5U B;  1QNT A;  3F22 A;  3ULQ B;  5LHI A;  1P4A A;  2ZO4 A;  4XLN F;  1R23 A;  3JTH A;  2DK8 A;  4L5J A;  2V1D A;  3KZZ A;  2A68 F;  2CG4 A;  4OU0 A;  1D8J A;  3F6V A;  2Z33 A;  3EQL F;  1I6X A;  1T38 A;  3GWZ A;  3IWZ A;  4A6D A;  4HX8 A;  1BOA A;  2XVC A;  3C18 A;  5E8I A;  3TO6 A;  5K5O A;  4EM2 A;  2J5P A;  3WGG A;  3E6B A;  1F9N A;  2Y0M A;  2EFO A;  2H6C A;  2GZW A;  4I98 B;  5ILV A;  2LNB A;  1KU3 A;  3QPT A;  4N9H A;  4IRI A;  4HX7 A;  2NNY A;  3DPL C;  1R1U A;  1XGM A;  1KYW A;  2XIG A;  3DEU A;  5LBQ A;  5LGU A;  1BBY A;  4IF4 A;  2LDU A;  3FXR A;  3KFW X;  3KP6 A;  3P9K A;  3FMS A;  3RKY A;  3CUQ C;  1YW9 A;  3BZ6 A;  5ICF A;  4KT5 C;  5LHG A;  5KK1 A;  5DUK A;  1H9T A;  5FFZ A;  2VBZ A;  4I02 A;  1I5Z A;  3B02 A;  4KIF A;  1TNS A;  1BIA A;  1JGS A;  4A2U A;  4LG0 B;  4LMY A;  4XRF A;  2HKO A;  3K1P A;  2NNN A;  3LA2 A;  5JI6 A;  3BJA A;  1YQA A;  3KLN A;  1JE8 A;  1IF1 A;  2QQB A;  5ICE A;  1ON2 A;  1TLH B;  1K6O A;  2O6G E;  3RYR A;  1OYW A;  2RGV A;  2FSW A;  1FC3 A;  1KU2 A;  3KLO A;  2IA1 A;  1XN7 A;  2D1V A;  1DDN A;  3ABT A;  3M7G A;  1O7L A;  1U8R A;  3HRT A;  2F2E A;  1MGT A;  1WSU A;  3CUO A;  2LF7 A;  2HDC A;  3GF2 A;  5E17 F;  1BJA A;  4O6J A;  4ZZL A;  3BP8 A;  1LNW A;  4KYW A;  2FA5 A;  2CSO A;  5A2Q Z;  2KIU A;  3B73 A;  5FLX K;  4G9Y A;  4JK1 X;  1J2X A;  5CLS A;  1W7P B;  1GVJ A;  1XCV A;  4NQW A;  1G3W A;  4GYG A;  2VT3 A;  1RI7 A;  2UWM A;  3LQR A;  1BN5 A;  4WK8 F;  2JT1 A;  2ZME A;  1MDM A;  1HBX G;  1R58 A;  4OMZ A;  4XSZ F;  2XKO A;  3SFZ A;  3GVA A;  4HBL A;  1XD7 A;  4ASN A;  1YTY A;  4IJA A;  4PCQ A;  4U0V A;  4XSX F;  3JAM Z;  4LK1 F;  2GQQ A;  4HA8 A;  3WU0 A;  5CVR A;  3EDP A;  2IP2 A;  3REO A;  2EA2 A;  1Z9C A;  4IHT A;  1SD5 A;  4DQ2 A;  1UFM A;  5HVQ C;  3QRF F;  4JBA A;  2M87 A;  3CJN A;  2QBY A;  4ON0 A;  3P7N A;  1OR7 A;  2DQL A;  5BPD A;  1ULY A;  3IKV A;  3HOS A;  1STZ A;  4ZH4 F;  4AIJ A;  3M9A A;  2RKH A;  3IL2 A;  1R00 A;  4IHS A;  2O03 A;  4HLX A;  2V1X A;  2ZFW A;  4HQM A;  1C0W A;  1HW1 A;  4AVP A;  2O8X A;  2Q0O A;  4GO1 A;  2P6T A;  3ECO A;  5CJ9 A;  2FBK A;  3HUG A;  3W6J B;  3CO7 C;  1G6N A;  3KP7 A;  2JPC A;  1XGO A;  2PG4 A;  3TOA A;  2DBB A;  3L09 A;  3VOD A;  4R1H A;  4ZYD A;  3ZMS A;  3QU6 A;  1OMI A;  4U7B A;  1IZ1 A;  3RKX A;  4M9X A;  2MC3 A;  2Z99 A;  4HV5 A;  4U0W A;  2VOD A;  3LAJ A;  5FO5 A;  3V7R A;  4S05 A;  2FNA A;  3GO5 A;  1QZY A;  2KJB A;  3C7J A;  4GYI A;  3T0Y A;  1CGP A;  1PP8 F;  2Y48 A;  3WG9 A;  2V79 A;  1RIO H;  3MFK A;  2NAZ A;  5HLG A;  2FNP A;  1LEB A;  4UV9 A;  4ETS A;  1LQ1 A;  1FBS A;  3O2P E;  4EQQ A;  1U78 A;  3M8E A;  3TO9 A;  1ZAO A;  3V8J A;  3TQN A;  2EFP A;  4MTE A;  4CIC A;  1HSJ A;  2M5W A;  5D5V B;  4BHP A;  3ZMT A;  1J75 A;  1ZN2 A;  2STW A;  3TOB A;  2W24 A;  1LVA A;  1GXP A;  5D6F A;  1ZLK A;  2PMH A;  5HDK A;  3WTW C;  1BI2 A;  4LB6 B;  3RI4 A;  4MGR A;  2AXL A;  2IRF G;  5LHH A;  4CGZ A;  1XMK A;  5BOX A;  1KQ8 A;  4M72 A;  5F6F A;  2DLL A;  5H20 A;  2R7F A;  3FHZ A;  4M74 A;  4DNC A;  2FQ3 A;  2XAS A;  4HLY A;  2E1C A;  2DI3 A;  3HOT A;  5JVT A;  1SFU A;  3JTG A;  2A07 F;  2D45 A;  4G7O F;  1LEA A;  1FY7 A;  1K78 A;  3ZN0 A;  4XLP F;  4BHC A;  3BOQ A;  2GA1 A;  2JTV A;  3RPQ A;  2GWR A;  2HFH A;  1H0M A;  1HKQ A;  3MWM A;  2QM3 A;  4LLN A;  2WV0 A;  2HR3 A;  3VOE A;  4RB0 A;  1XSD A;  1O3T A;  1YO5 C;  2DPD A;  3KP3 A;  3M1E A;  4WX9 A;  3RIR A;  3WOD F;  3RYP A;  1HKS A;  3T5X A;  3Q9V A;  3BWG A;  3WTT C;  4BXU A;  2WC2 A;  1YLF A;  2Z5U A;  4WXD A;  5EEH A;  2VN2 A;  3H3U A;  2OD5 A;  1ZYR F;  3D0S A;  1CF7 A;  3QAH A;  3OOP A;  1TW2 A;  2RDP A;  3ISP A;  2A69 F;  3KET A;  4GCV A;  2RQP A;  2BGC A;  1MKM A;  3DXJ F;  1G3S A;  2VBX A;  4LB5 A;  4NHJ A;  5E20 A;  4A12 A;  2ZJ2 A;  2D2W A;  3FXQ A;  4HF2 A;  3CUQ B;  4RB3 C;  4B8X A;  2OQG A;  2QWW A;  1W7P A;  1B4A A;  5BMZ A;  5ICC A;  3I59 A;  2KIM A;  1IRG A;  1HXD A;  2MD5 A;  1R1V A;  4RGR A;  4KN7 X;  1XSX A;  5ED4 A;  3CO6 C;  4KIC A;  2DFI A;  3U9G A;  2W85 A;  4RB2 C;  3NEU A;  4I09 A;  2EV6 A;  1EH7 A;  4LLG F;  5L3B A;  2FML A;  1DPR A;  1F4K A;  5D8K B;  2FRH A;  1U5T A;  3ZN1 A;  2W84 A;  5CVI A;  2M1B A;  4EJU A;  4OMY A;  1Q1H A;  1UST A;  3FWE A;  3T8R A;  4HF1 A;  5DCM A;  5FLX Z;  4E70 A;  2IA0 A;  2ZNY A;  1FZP B;  3KP5 A;  1UHW A;  1D5V A;  3GW2 A;  2VOP A;  1YS7 A;  3H92 A;  1X3U A;  2HTS A;  4KDP A;  5JR3 A;  1O3Q A;  4HAM A;  2DO7 A;  3WTU C;  3WGH A;  2FF4 A;  3CLO A;  3TDZ C;  5D8L B;  4XBF A;  4PGG A;  3F8N A;  4HDV A;  1HKT A;  4ZYE A;  3IHU A;  1IN8 A;  2EV5 A;  5CYV A;  4F7Z A;  2IT0 A;  1FOK A;  4MEX F;  3HRM A;  3E5Q A;  5DCF A;  2KRF A;  4Y15 A;  3ROU A;  3EYI A;  2CGP A;  3SZT A;  3IRR A;  4EVI A;  4YFK F;  2A5Y B;  5DDG A;  4KIG A;  4KMU X;  3LA3 A;  4WF2 A;  4IPA A;  2PMU A;  1HST A;  3V7S A;  2QEN A;  3H3Z A;  2VXZ A;  4HYE A;  1ZLJ A;  2YPR A;  2BYV E;  1S6L A;  2KJC A;  4QWQ A;  3D5L A;  4A5N A;  1FPQ A;  2A3S A;  5TJJ A;  1SMY F;  1REP C;  1RZ4 A;  4LLL A;  1XGN A;  4IXA A;  4A0Z A;  4FX0 A;  3WTZ A;  2FBI A;  4KMF A;  3S2W A;  1EH8 A;  3K0L A;  1KU7 A;  1LDD A;  4YII A;  3I4P A;  1I1G A;  1O3S A;  3NQO A;  2Z3Y A;  3R0J A;  5L3E A;  3MCZ A;  5LRS A;  3F8M A;  3ZP5 A;  2V9V A;  1TW3 A;  5IT3 A;  4BQA A;  3BJO A;  4PDK A;  2EV0 A;  2MLK A;  2V6C A;  1RNL A;  1J7K A;  4L5I A;  4YIF A;  3GX4 X;  3F21 A;  4G7H F;  1MJA A;  4HX4 A;  2HS5 A;  3TDU C;  3TO7 A;  1ZG5 A;  1XDS A;  4P9F A;  1IXC A;  3SHF A;  1ZHF A;  2FMY A;  3GZ6 A;  3I71 A;  4CDG A;  1IN7 A;  4JQF A;  4GGG A;  3N4M A;  2QZ8 A;  5J8F A;  1ZGA A;  5FD5 A;  3EET A;  1BC7 C;  2GIV A;  4PGH A;  3ABU A;  2L3D A;  2VON A;  3HTS B;  3KCC A;  4U88 A;  2D1H A;  3BJ6 A;  2P4W A;  5BQT A;  2PBI A;  3MQ0 A;  5DUI A;  3DKW A;  1I27 A;  4UXN A;  2F5D A;  4EJO A;  3P9I A;  4ZYH A;  2VC0 A;  3MEX A;  4BH9 A;  5HOO A;  3VFZ A;  4WCG A;  2W25 A;  1G3Y A;  3HTU A;  1IXS B;  4HQE A;  3QPH A;  4M6X A;  5D4R A;  1ZAR A;  3FF5 A;  1T98 A;  3OV8 A;  3LWF A;  1SD7 A;  2VE8 A;  1B9M A;  4I2O A;  2ETH A;  3I58 A;  3GZ5 A;  3E5U A;  3PQK A;  3HYI A;  2QLZ A;  2K27 A;  2UXN A;  1OKR A;  1NHA A;  2OZ6 A;  3JW4 A;  5DV5 A;  2NRA C;  1SD6 A;  1FP1 D;  1IRF A;  3FMQ A;  2VC1 A;  4GXO A;  1FT9 A;  5K1Y A;  1IAW A;  3HHG A;  4M9Z A;  5CVJ A;  4OOI A;  2Q2E A;  1QGP A;  4HOB A;  5HLI A;  4EM0 B;  3C3W A;  4UVA A;  1BC8 C;  4MTD A;  2NYX A;  4LD5 A;  1MJ9 A;  3HIF A;  1KGS A;  1J59 A;  1LDJ A;  2IW5 A;  4L9N A;  1Z1D A;  4KUM A;  2IPQ X;  2ESN A;  2Q8K A;  1B6A A;  4OIN F;  1XB4 A;  5JFR A;  1YW7 A;  4U0Y A;  5CVV A;  1IW7 F;  2PQ8 A;  2HZT A;  2ACJ A;  5ERI A;  4R8H A;  4N0B A;  1TQP A;  4ESJ A;  1P2F A;  2FXA A;  1TQI A;  3O3K A;  1AWC A;  4A6E A;  1O3R A;  3M8F A;  5LGT A;  3TKY A;  3RJP A;  2Z9O A;  4R79 A;  2A61 A;  3WTS C;  3F8F A;  2BEO A;  2QYO A;  3U1D A;  2FU4 A;  3DQV C;  2QVO A;  3GFL A;  4YG2 F;  4ENM A;  4RGX A;  4NB5 A;  3ZMU A;  3KEO A;  3ZMD A;  1P4X A;  4OIO F;  3F3X A;  2J5O A;  1U5T C;  3L00 A;  3GFM A;  1RUO A;  4AIH A;  5LRR A;  4U7D A;  2XRO A;  4FT8 A;  2ZXJ A;  3VB2 A;  1KYZ A;  5E8G A;  4EJT A;  2M30 A;  1KA8 A;  2TDX A;  2PN6 A;  2FEZ A;  3K1M A;  2XAQ A;  1ZGJ A;  4N9I A;  4CO8 A;  1IN4 A;  2HGC A;  2MH9 A;  1KQ0 A;  1RUN A;  1S3J A;  1XGS A;  2EWN A;  3FX3 A;  2COM A;  2IA2 A;  1WWX A;  3J80 K;  2OA4 A;  2EFQ A;  4P96 A;  1ZH5 A;  4K2E A;  1LJ9 A;  1R5G A;  3RTR A;  1XMA A;  4KFC A;  4BHB A;  1OPC A;  2R7D A;  1TQM A;  1DUX C;  1ZRC A;  4LG0 A;  2PLY A;  1E17 A;  3ECH A;  4Q5S F;  2XRN A;  5LEK A;  3T8T A;  3L2C A;  4LJZ F;  4A0X A;  4UV8 A;  5FD6 A;  1MDM B;  4EGY A;  4S04 A;  4L9T A;  1R5H A;  1XCB A;  2E7X A;  3I0T A;  4IVN A;  1YG2 A;  4I01 A;  1FWZ A;  1L3L A;  5ILS A;  3V4G A;  3DF8 A;  1J5Y A;  4BNC A;  1FYL A;  1ZRD A;  2E7W A;  2QBY B;  4EJV A;  1TBX A;  4RGU A;  4UUV A;  4L18 B;  2MH2 A;  3R6S A;  4O5V A;  1DPU A;  3HRS A;  4WXC A;  1T39 A;  1FBU A;  2ZNZ A;  2L01 A;  1S7A A;  2GXB A;  3CTA A;  2M8E A;  3SQN A;  2IVM A;  3F23 A;  3WTV C;  5LEJ A;  2XV4 S;  5E1X A;  4HW0 A;  3MZY A;  2KKO A;  2H94 A;  2MA3 A;  5L3C A;  3LAP A;  2BV6 A;  4WWC A;  1V3F A;  2IJL A;  4HF0 A;  5DD8 A;  1FLI A;  4MNU A;  4UVB A;  1QZZ A;  2O3F A;  4EJW A;  4EM1 A;  4MQV A;  1FYK A;  4EV0 A;  4CYD A;  4FX4 A;  5K5Q A;  2XAF A;  3MAJ A;  2VOO A;  1JHH A;  4PZJ A;  3P9C A;  3R61 A;  1YS6 A;  2GAU A;  5EEG A;  1K79 A;  2ZKZ A;  1UCR A;  1W5T A;  3ML6 A;  5L3G A;  1Y0U A;  2HKX A;  3U2R A;  5LGN A;  2L4A A;  2ISY A;  1PP7 U;  3GUD A;  1Z6R A;  2JZY A;  1V4R A;  3GEZ A;  2F5F A;  5DYM A;  3RKW A;  2OAZ A;  3NRV A;  4Q47 A;  3E97 A;  5F1R A;  3K1N A;  1R7J A;  2L02 A;  3F8C A;  1BM9 A;  1FBQ A;  1SFE A;  4HDU A;  3GFI A;  4L0Y B;  4UVC A;  5L3D A;  3PQJ A;  3E6D A;  2Y75 A;  4LK0 F;  4YFN F;  4M6Y A;  4BYY A;  4P55 A;  4Y13 A;  1WRJ A;  1UB9 A;  1B9N A;  1OYI A;  2QUF A;  3J81 K;  5HDN A;  1P6R A;  4P5O A;  1YW8 A;  1TNT A;  1KU9 A;  3KZY A;  3DFG A;  5D6E A;  3GLX A;  5BS6 A;  3KEQ A;  2L54 A;  3PFI A;  6PAX A;  1I1S A;  3RPU A;  1ZRE A;  2P7C B;  4QLC U;  2C6Y A;  3G3Z A;  4ZYG A;  3ERE D;  1T0F A;  1L0O C;  1MZB A;  3FXU A;  4I7H A;  4KNY A;  3FM5 A;  2EFN A;  1W5S A;  5AIP A;  2B0L A;  2HEO A;  4UNO A;  3R60 A;  3LQQ A;  3V8K A;  3I53 A;  2K7L A;  3V7C A;  2VE9 A;  3E6C C;  2HOE A;  3CDH A;  3Q5F A;  3QOP A;  1G3T A;  4OIR F;  4AIK A;  4OIP F;  4Y17 A;  1K78 B;  1FSH A;  2CWE A;  3I5U A;  2EB7 A;  3R0A A;  2XAH A;  4EGZ A;  2UZK A;  2XGX A;  3W6K B;  4LFU A;  3FMR A;  5H6Q A;  4IRH A;  3IC7 A;  2RN7 A;  4KIB A;  2AS5 F;  3KP2 A;  3I64 A;  5D4S A;  2LKP A;  2V1U A;  1FP2 A;  3T1B A;  3QP6 A;  4ZZD A;  3WGI A;  5AIQ A;  1BI0 A;  1TTY A;  3BRO A;  1SD4 A;  1S7O A;  2A6H F;  1T2K A;  1ZG1 A;  3SZP A;  1ZRF A;  5HS7 A;  3HSF A;  3DV8 A;  2DTR A;  3F8B A;  5IT9 K;  2FBH A;  1J9I A;  2DU9 A;  2O0Y A;  5H6R A;  3E6M A;  3G73 A;  4LGW A;  3IKT A;  1KQ9 A;  1CF7 B;  2ZBK A;  2CW0 F;  1XDU A;  2H27 A;  1QQI A;  1H9G A;  4MQ9 F;  4AD9 A;  2G7U A;  4WXH A;  2CQK A;  1ZG3 A;  3F72 A;  2PI0 A;  1R36 A;  2OU2 A;  2HWV A;  5HLH A;  1R1T A;  4MEY F;  3I59 B;  3DP7 A;  4Q4Z F;  2EA4 A;  1FSE A;  2MBF A;  3LFK A;  2G7H A;  3FZV A;  5KVR A;  1YFH A;  3V8L A;  2DW4 A;  1LB2 A;  3E5X A;  1T6S A;  4G6D A;  2VT2 A;  2P8T A;  1W4M A;  1PDN C;  3HRU A;  1U5T B;  1WI9 A;  1B59 A;  1FYM A;  2K02 A;  2CYY A;  3R4K A;  3ZMZ A;  3AAF A;  4G94 A;  4B09 A;  4ENK A;  2DPU A;  4IRG A;  3GXO A;  4BAY A;  5J6X A;  5DCM B;  1F1Z A;  3SXY A;  3J80 Z;  1FX7 A;  1O7F A;  2CFX A;  3CUQ A;  5DD4 A;  2QQ9 A;  3K69 A;  1ONV A;  1B1B A;  2WWY A;  2DT5 A;  2K86 A;  4CHU A;  1SFX A;  2YU3 A;  4G8X A;  2E1N A;  1GHC A;  1IUY A;  1U2W A;  5F64 A;  2NS0 A;  4AWX B;  3IRQ A;  3I54 A;  2XKP A;  2MLG A;  2VBY A;  4M71 A;  2STT A;  4Q48 A;  3N97 A;  4A0Y A;  1F5T A;  3GFJ A;  2PEX A;  2DQR A;  5CVU A;  3GYH X;  1YIO A;  1K7A A;  3ELK A;  2HYF A;  3L9F A;  1HW5 A;  2YR2 A;  4I0B A;  3ZMV A;  1DP7 P;  3ZQ7 A;  3L7W A;  3TGN A;  2G9W A; 
#chains in the Genus database with same CATH topology
 1T95 A;  2EJR A;  2XAG A;  2ZXH A;  3QU3 A;  3K9T A;  3BY6 A;  3CJR B;  4KIT B;  3HSR A;  1PUE E;  1Y8R B;  2P0W A;  5FRM A;  5FB2 A;  2DA5 A;  1WKM A;  2LSO A;  2QQA A;  4RAZ A;  3AG3 H;  3OOU A;  4M3D A;  3JSO A;  3LA7 A;  1BIB A;  1VQ4 I;  1QHH D;  3COA C;  1FIA A;  1MBH A;  3C1D A;  3PIO F;  2LR8 A;  3K70 C;  1JUM A;  1QO0 D;  1Z6T A;  1R49 A;  4E7L A;  3G1L A;  4X0G A;  5J8C A;  5HS9 A;  5A2Q K;  2BY2 A;  3HOV J;  2P7V B;  1ZEL A;  1EH6 A;  5FFX A;  1VQL I;  2RNJ A;  3WU1 B;  1Z05 A;  4KA4 A;  2JK3 A;  4H0E A;  3K4L A;  4PJL A;  4L0Z B;  4G6Q A;  1A6Q A;  5K7F A;  3OY9 A;  2F6C A;  2FOK A;  3VEP A;  3EYY A;  1NG7 A;  1I39 A;  4A5M A;  1U3E M;  3CMM A;  1IDY A;  3HHH A;  2RV8 A;  3CD6 I;  4L9V A;  5EJC A;  1GXQ A;  5L3F A;  2XHK A;  5F1J A;  2WTE A;  2DK5 A;  3ESW B;  4I0A A;  2JSC A;  3DPT A;  2M45 A;  1JXS A;  2FUG 2;  4AUX A;  2QSH X;  3VPR A;  3WTX C;  2OCC H;  4NBQ A;  3HOU J;  2OZU A;  2XF5 A;  3HOY J;  2CO5 A;  4LIU A;  5LLQ A;  1MJB A;  1R9T J;  1S29 A;  1P9Q C;  4UHT A;  4M9S A;  4KN4 X;  5DTD A;  2MC4 A;  2HPI A;  3JAM K;  1XX5 A;  3MMY B;  1LDK B;  2A6E F;  2YSR A;  1SMT A;  4OIQ F;  2L7K A;  1Z7U A;  5HOD A;  1Y56 A;  3OIO A;  4JX6 A;  1ETO A;  2WY7 Q;  3MZH A;  4ENJ A;  1D8K A;  2JA2 A;  3KP4 A;  2NVX J;  4BBS J;  4HZF A;  2ADU A;  2HQN A;  3S14 J;  2RVC A;  1FNN A;  3Q9S A;  3ZOB A;  1MBG A;  2LG4 A;  1P92 A;  2JPB A;  3PSF A;  1Z3X A;  3GZN B;  4D0P A;  5BPI A;  2FE3 A;  4NNJ A;  1G4D A;  1XSV A;  2W82 A;  3K2Z A;  1P7J A;  5D5W B;  1MD0 A;  3MKY B;  1ON1 A;  2EK5 A;  5ICG A;  2O61 A;  3VSL A;  3FM3 A;  2OBP A;  2BE5 F;  3E3V A;  1S9H A;  4PK4 A;  2FD5 A;  3WE2 A;  3BPX A;  1QPM A;  5TRD A;  3CC7 I;  4GFB A;  2ECC A;  2P81 A;  3ABL H;  2W57 A;  1D3Y A;  2OV7 A;  2X4H A;  3BG6 A;  2RC4 A;  1SAN A;  2JA7 J;  3PUB A;  1NG6 A;  2VKD A;  3OYM A;  3O8H A;  3S3N A;  2XAJ A;  5D5X B;  2ISZ A;  1IXR C;  1MBJ A;  1WI3 A;  1WJC A;  3CF2 A;  4LOC A;  3DPU A;  2VKV A;  1P4W A;  1YOV B;  3F6O A;  2H09 A;  2GLO A;  4FHT A;  1AOY A;  3LNQ A;  4RAY A;  3H5R A;  5DEQ A;  2ZME B;  2YX7 A;  2DCE A;  3J81 Z;  2PFB A;  4M73 A;  2GXG A;  2H6B A;  4O3M A;  2L4M A;  3RQ4 A;  2K4B A;  4W1U A;  5F27 A;  3ZQL A;  3OYN A;  2OPT A;  1ERD A;  3TW6 A;  1WPK A;  1A04 A;  2P5V A;  2KDZ A;  3JRC A;  1I3A A;  2ESH A;  4RS8 A;  1S8N A;  1O57 A;  2ELH A;  2GA2 A;  1HW2 A;  5E18 F;  2CW8 A;  1W7P D;  3KZI C;  2OQR A;  2VBW A;  4J19 A;  5K5R A;  4XN3 A;  3WE3 A;  3WTY C;  2EFW A;  2ICW G;  2IGO A;  2DAO A;  4CZZ A;  2K40 A;  3IWF A;  4OAY A;  3S3O A;  1MH4 A;  2TCT A;  1VQK I;  5M3F J;  1EV7 A;  3AG1 H;  3EUH A;  3QYB A;  3LSP A;  2UUZ A;  5FGM A;  1ACI A;  3BTJ A;  3GTK J;  3LST A;  4YFX F;  1QBJ A;  4EMS A;  1Z91 A;  1DQU A;  1U9N A;  5CQE A;  1WJ5 A;  3BPV A;  5JHU A;  3FXK A;  2X6Y A;  3OYI A;  1AU7 A;  1W36 D;  2MYS A;  3HPH A;  3N05 A;  3CES A;  2HYG D;  2WB1 N;  2AQE A;  2K9L A;  2ID6 A;  3RDI A;  2D5V A;  1BI1 A;  1IUF A;  1ETY A;  2R3S A;  1J0R A;  2X0L A;  1IN6 A;  4BJ5 C;  3KE2 A;  4Z2Y A;  3I4N J;  4L9J A;  1E2X A;  2R5Z B;  2DMN A;  1HQC A;  1UHM A;  3CJQ B;  1FIP A;  1XMX A;  5HS8 A;  4CXF A;  2F5C A;  3A01 B;  3A0H C;  1YYV A;  2Y9Z A;  3LOC A;  2XUB A;  1OYY A;  4MHG A;  4B44 A;  3B6C A;  2GBY A;  2V26 A;  1JHF A;  1QPI A;  2DA6 A;  1E0E A;  5CKT A;  4ESF A;  2I8D A;  4ZC3 A;  1SAX A;  1H89 C;  3FK7 A;  1VQ6 I;  2EPF A;  5E1W A;  4RB1 A;  3TMO A;  2P6S A;  4DIQ A;  2HTJ A;  1ODD A;  4ESB A;  1U6G A;  1WQ2 A;  3BDD A;  2WAE A;  1JT6 A;  2MW8 A;  5CQG A;  2K4J A;  2Q2E B;  2LF8 A;  3MZ8 A;  4RMN A;  4CCK A;  2HQR A;  2PJP A;  2MSY A;  4G7Z F;  5HDG A;  4RGS A;  1R22 A;  2DMU A;  4TV7 A;  1WJA A;  4ENN A;  3H0G J;  2YX4 A;  2JRT A;  2E2J J;  3K4J A;  3JSP A;  1W1W E;  1GLN A;  2P5K A;  3MD2 A;  2KIF A;  2LK2 A;  2ZCW A;  2PMZ N;  1WZ2 A;  1D0X A;  3HSE A;  3TED A;  5E1Z B;  3H3V K;  1USS A;  2AQF A;  2BBY A;  2P5L C;  5IT9 Z;  3DU6 A;  2CS3 A;  3QP5 A;  1IRZ A;  2N8G A;  2BY0 A;  1IN5 A;  2UXX A;  4XN0 A;  2TRT A;  4P9U A;  2F5E A;  1BI3 A;  1WH5 A;  3ZPL A;  2M0M A;  4AM3 A;  2HOS A;  3BTC A;  5AON A;  2Y69 H;  3O6B B;  1VQ8 I;  2E36 A;  2JVH A;  2MGQ A;  3K4M A;  4HV6 A;  5ILU A;  3J7A O;  1VTN C;  5D5U B;  1RR8 C;  1S5L C;  3OYF A;  1QNT A;  4B48 A;  1VFC A;  3F22 A;  3ULQ B;  4UUS B;  3SEQ A;  1IO2 A;  4RA2 A;  2ZFU A;  4PJN A;  3JRB A;  5LHI A;  2CV0 A;  1WVR A;  3DEE A;  1P4A A;  2ZO4 A;  3KX2 A;  4XLN F;  4AVZ A;  1R23 A;  3JTH A;  2DK8 A;  4L5J A;  2DDB A;  4C3J J;  1AKH A;  2V1D A;  5EGO B;  3KZZ A;  2O7O A;  2A68 F;  2CG4 A;  3HDD A;  1QU3 A;  1GDT A;  4OU0 A;  1JKP C;  1D8J A;  1BR4 A;  3F6V A;  1M1E B;  2Z33 A;  3EQL F;  4JX4 A;  2ECB A;  2IGK A;  4BBR J;  1I6X A;  4IHX A;  1T38 A;  3GWZ A;  3IWZ A;  4DGW B;  4A6D A;  4HX8 A;  4RDU A;  1BOA A;  2XF6 A;  2O5R A;  2XVC A;  3C18 A;  3M07 A;  4CH7 A;  5E8I A;  3TO6 A;  1X2M A;  5K5O A;  2EZH A;  4EM2 A;  2H1L A;  1JI8 A;  2J5P A;  3WGG A;  4CYC A;  4A3D J;  3E6B A;  1F9N A;  4F91 B;  2Y0M A;  2EFO A;  3FHN A;  4AU7 A;  2R5Y A;  2E60 A;  2H6C A;  2GZW A;  3LMM A;  2K85 A;  2W4S A;  3QYF A;  3CCV I;  4PSW A;  4I98 B;  5IYC J;  2R7R A;  3ZQQ A;  5ILV A;  2LNB A;  3MKW B;  4XOP A;  2NVU B;  1KU3 A;  3QPT A;  4N9H A;  1HF0 A;  4IRI A;  2H8R A;  4HX7 A;  4XRS G;  4RM3 A;  4BE2 A;  2NNY A;  3DPL C;  1R1U A;  1XGM A;  1KYW A;  2XIG A;  3DEU A;  5LBQ A;  5LGU A;  2F48 A;  4ZTF A;  1BBY A;  4IF4 A;  4E4H A;  4A3F J;  1JUS A;  3OS1 A;  2E35 A;  3OYJ A;  5TIS C;  5GTI C;  2HOT A;  2LDU A;  1BJZ A;  3FXR A;  3KFW X;  3KP6 A;  3P9K A;  3OS2 A;  2XPV A;  3FMS A;  3RKY A;  3C2H A;  3CUQ C;  4PSX A;  1YW9 A;  2DYR H;  5EG0 B;  3BZ6 A;  5ICF A;  2QGU A;  4DJA A;  1SFK A;  1HLV A;  3Q0W A;  4KT5 C;  3WHC A;  2KIQ A;  5LHG A;  3ASO H;  5KK1 A;  5DUK A;  2X48 A;  1H9T A;  2GOX B;  5FFZ A;  2VBZ A;  4I02 A;  1I5Z A;  5FRN A;  4X1E A;  3OYA A;  1XS9 A;  3B02 A;  1ZQ3 P;  4KIF A;  4ZYA A;  1TNS A;  1BIA A;  4CCM A;  3QOE A;  1YJN I;  1JGS A;  4A2U A;  2CUF A;  2DA1 A;  1SVO A;  4LG0 B;  4LMY A;  4XRF A;  3PUF A;  2IS2 A;  2HKO A;  3K1P A;  2NNN A;  5GAD J;  1VQP I;  3LA2 A;  5JI6 A;  4C30 A;  1B8I B;  3BJA A;  1YQA A;  3HC7 A;  4F3Q A;  3BC8 A;  1TZL A;  3KLN A;  3BT9 A;  4Y33 A;  4YIR X;  2AXT C;  1JE8 A;  1IF1 A;  5J47 A;  2QQB A;  5ICE A;  1ON2 A;  1TLH B;  1K6O A;  2O6G E;  3RYR A;  1OYW A;  2RGV A;  2FSW A;  2Y30 A;  1FC3 A;  2BXY A;  2K5C A;  1KU2 A;  3KLO A;  2IA1 A;  1XN7 A;  2D1V A;  1DDN A;  3ABT A;  3B6A A;  4HRI A;  3PNY A;  3CJT B;  1O7L A;  3M7G A;  3VYR B;  3GTJ J;  1U8R A;  1TWF J;  4IOC F;  3GTO J;  3HRT A;  2F2E A;  1MGT A;  1WSU A;  1NK3 P;  2IS4 A;  3CUO A;  1OCC H;  2LF7 A;  2HDC A;  3GF2 A;  5E17 F;  3QYE A;  2ID3 A;  1BJA A;  4O6J A;  1W5C C;  1BL0 A;  3L2U A;  4XIC A;  4ZZL A;  3BP8 A;  1LNW A;  4KYW A;  2EZL A;  2FA5 A;  2CSO A;  3H1C A;  1LPQ A;  2CH0 A;  5JHF A;  1V54 H;  4II3 A;  2KIU A;  2R7O A;  3B73 A;  5A2Q Z;  1A5J A;  5FLX K;  4PFP A;  1D5Y A;  4G9Y A;  1A35 A;  4JK1 X;  1VZ0 A;  2VJI A;  2LYC A;  1J2X A;  3BZC A;  2IS6 A;  3IP4 B;  4BXX J;  5CLS A;  1W7P B;  1GVJ A;  1XCV A;  4NQW A;  2MAB A;  1G3W A;  4GYG A;  2VT3 A;  5J1U A;  1RI7 A;  2UWM A;  5M3M J;  1OQY A;  3LQR A;  1BN5 A;  2HXI A;  4WK8 F;  2JT1 A;  2ZME A;  4UY8 I;  3LSK A;  1MDM A;  1HA8 A;  1HBX G;  1TWC J;  1R58 A;  4OMZ A;  2BOL A;  2WBM A;  5HNH A;  5C4J J;  4XSZ F;  3ONQ A;  2XKO A;  1LFU P;  3SFZ A;  4AYB N;  3GVA A;  4HBL A;  1MW7 A;  1XD7 A;  4ASN A;  1YTY A;  1GT0 C;  3FXM A;  3IAS 2;  4IJA A;  2LRE A;  2DT6 A;  4EAT A;  4PCQ A;  4U0V A;  4XSX F;  2QSF X;  3JAM Z;  4LK1 F;  2GQQ A;  4HA8 A;  3WU0 A;  3NWT A;  3FKJ A;  5CVR A;  4BEH B;  3EDP A;  2IP2 A;  3REO A;  1X4P A;  2EA2 A;  1Z9C A;  3PFY A;  4IHT A;  5FKN A;  3H9Q A;  2KZV A;  1SD5 A;  2Z2S B;  1UFM A;  4DQ2 A;  5HVQ C;  3OSF A;  3QRF F;  4JBA A;  2M87 A;  1UG0 A;  3CJN A;  2QBY A;  4ON0 A;  2CQ7 A;  1PYV A;  3P7N A;  2VI6 A;  1OR7 A;  1X58 A;  3HXL A;  4XKV A;  1R4N B;  5GAH J;  3TW7 A;  1HCR A;  4B3X A;  2ZXI A;  2DQL A;  2KL4 A;  5BPD A;  4DW6 A;  4Z6Y A;  5IYD J;  1ULY A;  3IKV A;  3AKZ A;  1ETW A;  3VYS B;  2EIN H;  3HOS A;  1STZ A;  4ZH4 F;  2GOM A;  2E71 A;  3KYD B;  4C3H J;  4AIJ A;  2VB6 A;  3K7A J;  3M9A A;  2M2E A;  3G1M A;  5F08 A;  4X6A J;  2RKH A;  2M3A A;  3IL2 A;  1G2H A;  3WHB A;  3LSR A;  3H9G A;  2FJ1 A;  3ZR8 X;  2G0E A;  1R00 A;  4IHS A;  1WJF A;  2O03 A;  4A3I J;  4XOT A;  4HLX A;  1MIJ A;  2R7W A;  2V1X A;  2ZFW A;  4HQM A;  4ZDL A;  5M5X J;  3RKQ A;  1C0W A;  1HW1 A;  1N25 A;  2WA0 A;  4AVP A;  2O8X A;  2XRL A;  3JCU C;  5EYR A;  2Q0O A;  4GO1 A;  2COB A;  4XRM A;  3FBI B;  1ETK A;  2P6T A;  2LLK A;  3ECO A;  5HNF A;  5CJ9 A;  2FBK A;  2QSG X;  2VUM J;  3HUG A;  3LSG A;  4XKW A;  3W6J B;  2OF7 A;  5FLM J;  1UG2 A;  3P5J A;  4E7Z A;  1IV8 A;  4A3E J;  3CO7 C;  1G6N A;  3KP7 A;  2M34 A;  2JPC A;  1XGO A;  2PG4 A;  1VQ7 I;  3TOA A;  2DBB A;  4YEL A;  3L09 A;  3VOD A;  4R1H A;  4ZYD A;  1G59 A;  1FJL A;  1TWH J;  3CC4 I;  4Y7N J;  2HQA A;  3ZMS A;  1WCM J;  1D1A A;  2XPW A;  3QU6 A;  1OMI A;  2M0C A;  4U7B A;  1IZ1 A;  4JX5 A;  3RKX A;  2MC3 A;  4M9X A;  2Z99 A;  1YRN A;  4HV5 A;  4U0W A;  2JJ7 A;  2VOD A;  3LAJ A;  5FO5 A;  3V7R A;  4S05 A;  4XLC A;  2FNA A;  1U8B A;  3GO5 A;  3S3M A;  1RET A;  2BZT A;  2V9K A;  3BR5 A;  1QZY A;  5GPA A;  2KJB A;  2MD0 A;  3C7J A;  2Y0S N;  1NTC A;  2LD5 A;  2VJ5 A;  5DM7 F;  2BHZ A;  5FLV A;  4GYI A;  4N4O B;  2L5Q A;  2X6O A;  2IS1 A;  3T0Y A;  2JN6 A;  1CGP A;  2L7Z A;  2CUE A;  3W2W A;  1PP8 F;  2NVQ J;  5JLX A;  2Y48 A;  2VIX A;  5IP6 A;  2DMQ A;  3WG9 A;  1G8X A;  1N75 A;  2V79 A;  1RIO H;  2LRD A;  3MFK A;  4MLO A;  1OIS A;  2NAZ A;  5HLG A;  2FNP A;  1LEB A;  4ZDP A;  3CCQ I;  4UV9 A;  4ETS A;  5J4Y A;  4FQG A;  1LQ1 A;  4ZDO A;  1FBS A;  2O9L A;  2BVM A;  3O2P E;  1HOM A;  4EQQ A;  1U78 A;  2LOO A;  3OYK A;  3GTG J;  2E1M C;  3M8E A;  3TO9 A;  1ZAO A;  3V8J A;  3TQN A;  2OCE A;  2EFP A;  2BHY A;  4MTE A;  3S2H J;  4CIC A;  4XLH A;  4C2U A;  2LBF B;  1HSJ A;  1R4M B;  2M5W A;  2R93 J;  5D5V B;  4XOR A;  4BHP A;  3ZMT A;  3ASN H;  1J75 A;  1ZN2 A;  2DT7 B;  2STW A;  3TOB A;  2W24 A;  1LVA A;  1GXP A;  5D6F A;  1ZLK A;  2PMH A;  3IUO A;  3RZO J;  2DA7 A;  3FDY A;  2CUJ A;  3RCO A;  3K6G A;  1Y0N A;  3OYC A;  1JGG A;  5HDK A;  2PX9 A;  3K4N A;  1T33 A;  3WTW C;  1X1D A;  2ZJP F;  2JSP A;  5HLT A;  1BI2 A;  4LB6 B;  1V5F A;  3RI4 A;  1FMW A;  4DYR A;  1Y8Q B;  1RC9 A;  2EBI A;  4MGR A;  2AXL A;  1TC3 C;  2IRF G;  3ABM H;  3IAM 2;  5LHH A;  3RQI A;  4CGZ A;  3H5A A;  1XMK A;  5BOX A;  1KQ8 A;  4M72 A;  3SYT A;  5F6F A;  5IPA A;  2DLL A;  5H20 A;  2R7F A;  1I3Q J;  3IH4 A;  2ZB9 A;  3FHZ A;  4M74 A;  4DNC A;  2M7B A;  1D1C A;  2FQ3 A;  4J01 A;  1DP3 A;  2ELJ A;  2XAS A;  3OIP A;  4HLY A;  2E1C A;  3JRE A;  2DI3 A;  1QVU A;  3HOT A;  1WJD A;  2LP0 A;  5JVT A;  1VQM I;  1SFU A;  3SDG A;  3JTG A;  2A07 F;  2D45 A;  1BW5 A;  1ETV A;  5F0H A;  4G7O F;  1LEA A;  1FY7 A;  3AG2 H;  1K78 A;  2IEK A;  3ZN0 A;  4XLP F;  4BHC A;  3BOQ A;  2GA1 A;  2JTV A;  2CMP A;  3CF5 F;  3RPQ A;  1TL8 A;  2GWR A;  2HFH A;  3JRI A;  4BE1 A;  1H0M A;  1HKQ A;  2MG4 A;  3MWM A;  1HC8 A;  3HL2 A;  2QM3 A;  4MO7 A;  1I50 J;  3BR6 A;  1RES A;  3FK6 A;  4LLN A;  2CQX A;  3BR1 A;  5E3N A;  1UAA A;  2WV0 A;  5GP9 A;  4XKC A;  2HR3 A;  4JOM A;  5FKL A;  3VOE A;  4A93 J;  4RB0 A;  3HKZ N;  1B8I A;  1XSD A;  1O3T A;  1YO5 C;  1IJW C;  3L2Q A;  4B1R A;  2DPD A;  2DOA A;  3KP3 A;  3M1E A;  4WX9 A;  3K70 D;  3RIR A;  2AHQ A;  3WOD F;  1MMG A;  3RYP A;  1HKS A;  1LFB A;  3T5X A;  1FOW A;  3Q9V A;  3BWG A;  3WTT C;  4BXU A;  3RSN A;  2WC2 A;  3AL0 C;  1YLF A;  1BR2 A;  2R4G A;  2Z5U A;  1JUP A;  4WXD A;  5EEH A;  1P7I A;  2VN2 A;  3H5N A;  1R5I D;  3H3U A;  2OD5 A;  2VQC A;  1ZYR F;  1MBE A;  1WJB A;  3LSI A;  3D0S A;  4I6Z A;  2PJR B;  1CF7 A;  2WB1 A;  3QAH A;  3OOP A;  1TW2 A;  2RDP A;  3ISP A;  2A69 F;  2F5V A;  2KRH A;  3KET A;  4GCV A;  2HU9 A;  4DZJ A;  2M9H A;  2RQP A;  2BGC A;  3KYL A;  1MKM A;  3DXJ F;  1G3S A;  2VBX A;  4LB5 A;  4NHJ A;  3PSI A;  4XNF A;  3BR2 A;  5E20 A;  4A12 A;  3W6V A;  1VQ5 I;  2ZJ2 A;  3MKL A;  3QPL A;  4V2G A;  2CV2 A;  2D2W A;  3FXQ A;  3G1O A;  2VKH A;  4HF2 A;  1BOB A;  2L9V A;  1AHD P;  1ORK A;  1B72 A;  3CUQ B;  4RB3 C;  3ZQC A;  3RZD J;  3M8J A;  2V7F A;  4B8X A;  2OQG A;  2XDV A;  2QWW A;  5TGT A;  4CCL A;  1PUF A;  1W7P A;  4A3C J;  1ETX A;  4GRI A;  2LY1 A;  3ZQH A;  1JKO C;  1B4A A;  3BQY A;  5BMZ A;  5ICC A;  3I59 A;  5FKM A;  2KIM A;  1W0T A;  2Y9Y A;  1IRG A;  1HXD A;  2MD5 A;  1R1V A;  3CLQ A;  4KN7 X;  4RGR A;  4RM2 A;  1YX3 A;  1XSX A;  5EF6 A;  2QEX I;  3W3C A;  1Q1V A;  2ZXW H;  5B1A H;  5ED4 A;  3DLA A;  4N4N B;  3CO6 C;  4KIC A;  2DFI A;  3U9G A;  2W85 A;  2V1N A;  5M5Y J;  4RB2 C;  3NEU A;  4I09 A;  2EV6 A;  1EH7 A;  4LLG F;  3J7Y J;  3BTI A;  2HVQ A;  2FOW A;  5L3B A;  2FML A;  2IGN A;  1BA5 A;  4A3M J;  2L2O A;  1DPR A;  3A03 A;  1HDD C;  1F4K A;  4E7K A;  1Y6I A;  4HST A;  3GTP J;  5D8K B;  2FRH A;  1U5T A;  3ZN1 A;  2Y2Z A;  2W84 A;  1FOX A;  3A4C A;  4G12 A;  1S72 I;  5CVI A;  1JTX A;  3DTI A;  2M1B A;  4EJU A;  4OMY A;  1VND A;  3LL7 A;  1FTZ A;  4IKF A;  3ZRG A;  3I3L A;  1Q1H A;  1UST A;  3FWE A;  5K7Z A;  1DU0 A;  1YJ9 I;  4PJM A;  2LY9 A;  4FIS A;  2XC7 A;  2VQL A;  2ZJQ F;  3PM1 A;  3T8R A;  4HF1 A;  5DCM A;  1R6R A;  5FLX Z;  4B4C A;  4F93 B;  4E70 A;  2IA0 A;  2ZNY A;  1FZP B;  3KP5 A;  4ANJ A;  3EUA A;  1UHW A;  2AO9 A;  1D5V A;  2HOA A;  3GW2 A;  3OYL A;  5J3L A;  2VL8 A;  1Z77 A;  2K9Q A;  3RPU D;  1POG A;  3X2Q H;  2VOP A;  1YS7 A;  3H92 A;  2OJE D;  1X3U A;  2XGD A;  2HTS A;  3H36 A;  2KT0 A;  4KDP A;  1V5E A;  5JR3 A;  1LE8 A;  2LMD A;  1O3Q A;  4M3F A;  5E79 C;  2ZC2 A;  4HAM A;  3CCL I;  1U9O A;  1YIT I;  3D5S C;  2DO7 A;  4B3A A;  1UZC A;  4M3B A;  4PJJ A;  4ITV A;  3WTU C;  3WGH A;  2LKS A;  1IRX A;  3G2B A;  2CFO A;  2FF4 A;  3JR9 A;  1QZE A;  2UV1 A;  3CLO A;  3BZK A;  2ZME C;  3TDZ C;  5D8L B;  2VQG A;  4XBF A;  4PGG A;  5IY5 H;  2DMP A;  3F8N A;  4B43 A;  4HDV A;  1HKT A;  4FE4 A;  4ZYE A;  3IHU A;  3BTL A;  3IH2 A;  4RLF A;  3CDI A;  1JTY A;  1IN8 A;  1FOY A;  2KPM A;  3OS0 A;  3S1M J;  4BAC A;  1QHG A;  2EV5 A;  3G4S I;  5CYV A;  4F7Z A;  1TT5 B;  2IT0 A;  1FOK A;  2K9M A;  3VYU B;  4MEX F;  3HRM A;  3E5Q A;  5DCF A;  4IQ4 A;  2KRF A;  3OYD A;  3KEY A;  4Y15 A;  3OYG A;  3ROU A;  3EYI A;  2CGP A;  3SZT A;  3IRR A;  4EVI A;  4YFK F;  2BW3 A;  2A5Y B;  5E3L A;  5DDG A;  3ZXS A;  4IHY A;  2VJJ A;  1XG1 A;  4KIG A;  4AC0 A;  1YE9 A;  4KMU X;  3LA3 A;  3Q0V A;  1OR7 C;  1JKQ C;  1X1C A;  5J40 A;  4WF2 A;  4IPA A;  4QPQ A;  2PMU A;  1HST A;  3V7S A;  4CZC A;  2DA2 A;  2QEN A;  3H3Z A;  1K4S A;  2VXZ A;  4HYE A;  2WAQ N;  1F36 A;  5F0C A;  1ZLJ A;  2RAE A;  2YPR A;  2KQR A;  2BYV E;  3H35 A;  1WGX A;  1S6L A;  2X1C A;  4QTR A;  4V2F A;  1IG7 A;  5LD2 C;  4IO9 F;  3CCE I;  1ZK8 A;  4D5F A;  2KJC A;  4QWQ A;  3D5L A;  3ZQI A;  4A5N A;  3AFH A;  1FPQ A;  2E19 A;  3IV5 A;  2A3S A;  4P1W A;  1SMY F;  5TJJ A;  2EZK A;  1F43 A;  1REP C;  4KJZ A;  1RZ4 A;  4LLL A;  1XGN A;  3VWB A;  2ELK A;  4IXA A;  3SEZ A;  2CUZ A;  2XSD C;  4A0Z A;  4FX0 A;  3WTZ A;  4Y52 J;  3OR1 C;  3MN2 A;  2FBI A;  4KMF A;  2CV1 A;  3S2W A;  3FXL A;  1EH8 A;  2Q1Z B;  1GV2 A;  3K0L A;  1KU7 A;  1LDD A;  4II2 A;  4PFO A;  3VSK A;  4YII A;  2DXI A;  3GTM J;  3I4P A;  4DBQ A;  2H1K A;  1K61 A;  4ABZ A;  1I1G A;  1O3S A;  3NQO A;  2Z3Y A;  3R0J A;  2HQ5 A;  4BJT A;  2YU9 J;  2VLA A;  5L3E A;  1DU6 A;  3MCZ A;  4C3I J;  3W2V A;  3M4O J;  2EZI A;  5LRS A;  3L2V A;  2ZJR F;  4E6K G;  3F8M A;  3ZP5 A;  3HG9 A;  2V9V A;  1RR7 A;  1TW3 A;  2L7M P;  5IT3 A;  4BQA A;  3BJO A;  1WFX A;  4PDK A;  3U21 A;  2EV0 A;  2L0K A;  2MLK A;  2EH3 A;  2V6C A;  1Z21 A;  1T8I A;  1RNL A;  1J7K A;  1IC8 A;  4L5I A;  1EA3 A;  4YIF A;  3GX4 X;  1V5G A;  1VI0 A;  1VQN I;  4XQF A;  3F21 A;  4G7H F;  1MJA A;  4HX4 A;  3JRA A;  1U0J A;  2HS5 A;  2JRM A;  3TDU C;  3TO7 A;  2OC6 A;  1ZG5 A;  3S15 J;  1X3W B;  1XDS A;  3E1S A;  4P9F A;  1IXC A;  3SHF A;  1ZHF A;  2VPR A;  1LVK A;  3PL8 A;  4QSH A;  2FMY A;  5BNG A;  2R7V A;  5FJ8 J;  3GZ6 A;  2KLO A;  3I71 A;  4CDG A;  5C3E J;  1K83 J;  1IN7 A;  2Z1D A;  4XLE A;  4XR6 A;  4JQF A;  3CCU I;  4GGG A;  3N4M A;  4C2T A;  2QZ8 A;  5J8F A;  2GM4 A;  4M3E A;  2KHM A;  1ZGA A;  5FD5 A;  3EET A;  1BC7 C;  2GIV A;  2IBD A;  3PNV A;  4PGH A;  4RLQ A;  3ZQF A;  3ABU A;  2L3D A;  1SC7 A;  5IOZ A;  2VON A;  5C4X J;  1MH3 A;  2ME0 A;  1DGR M;  2X51 A;  1X19 A;  1W0U A;  3HTS B;  4BS9 A;  4XK4 A;  4LIV A;  2VKE A;  1LUJ B;  3KCC A;  3CZ6 A;  2E1M B;  1VF9 A;  4U88 A;  4AYB A;  1X3Z B;  4A3L J;  2D1H A;  4W97 A;  3BJ6 A;  3JRG A;  2P4W A;  5BQT A;  2PBI A;  3MQ0 A;  3ZGK A;  3JRH A;  5KCM A;  3WG7 H;  5DUI A;  3DKW A;  1I27 A;  4UXN A;  2F4M B;  2F5D A;  2HNH A;  4EJO A;  3P9I A;  1UMQ A;  5FKK A;  1ZKG A;  2A05 A;  1JKR C;  4ZYH A;  2VC0 A;  1MND A;  2CQN A;  3OR2 C;  3MEX A;  4BH9 A;  5HOO A;  3VFZ A;  2DOE A;  3BR0 A;  2B7E A;  3BCA A;  4WCG A;  2W25 A;  2V9P A;  1G3Y A;  3HTU A;  1IXS B;  2L9R A;  3QPH A;  1Z67 A;  2DDA A;  4HQE A;  1JJ6 C;  1IDZ A;  3HBL A;  4RAF A;  3NAR A;  2DMT A;  2L9S A;  4M6X A;  4HSR A;  5D4R A;  2E5N A;  3S16 J;  2E5Z A;  1ZAR A;  3CP8 A;  3LSM A;  3NWS A;  3A02 A;  3FF5 A;  2BY1 A;  1T98 A;  2PJR A;  3OV8 A;  4NDL A;  3LWF A;  2JMW A;  1E3O C;  1SD7 A;  2VE8 A;  3L7W A;  3QPS A;  2KDO A;  3H0D A;  1Z3Y A;  4Y3O A;  5F0F A;  1B9M A;  4I2O A;  2ETH A;  4XM3 A;  2DA3 A;  3GZ5 A;  3I58 A;  3E5U A;  5DM6 F;  2BVL A;  1MBF A;  2X6X A;  4FE7 A;  4FAS D;  2R5Z A;  3PQK A;  3HYI A;  4NC8 A;  2R0Q C;  3FBN B;  3A01 A;  3C2G A;  2QLZ A;  1UEL B;  2K27 A;  4BDZ A;  3JRF A;  3BG9 A;  4PJ0 C;  2VJ4 A;  2UXN A;  1OKR A;  3S1R J;  1AKH B;  1H88 C;  1NHA A;  2OZ6 A;  3JW4 A;  2E1O A;  1YI2 I;  5DV5 A;  2NRA C;  1MNE A;  2EIM H;  4CCO A;  1SD6 A;  1IRF A;  1FP1 D;  3FMQ A;  4CCJ A;  4RBO A;  2VC1 A;  3TP3 A;  4GXO A;  1FT9 A;  1Y1W J;  5K1Y A;  1IAW A;  2K3P A;  3HHG A;  3Q3S A;  4M9Z A;  5CVJ A;  4BL0 B;  4OOI A;  4BGD A;  2Q2E A;  1QGP A;  4HOB A;  5HLI A;  1GUU A;  4EM0 B;  4OWR B;  2BY3 A;  2IXS A;  3EUK L;  4D7M A;  4BKX A;  1FEX A;  3C3W A;  4UVA A;  1BC8 C;  3CQZ J;  3DEW A;  4MTD A;  2NYX A;  1Z0X A;  3O8G A;  4LD5 A;  1MJ9 A;  4QIW N;  4HNT A;  3HIF A;  5B5E C;  1KGS A;  4CYC B;  1X4O A;  3L2W A;  2R5Y B;  3MKZ A;  1J59 A;  1LDJ A;  1T08 B;  2IW5 A;  2KRC A;  4L9N A;  2Y0S A;  1Z1D A;  4HPQ A;  2WAD A;  3FIW A;  1YIJ I;  2NXN B;  4KUM A;  2GXA A;  4UB8 C;  1WJE A;  2IPQ X;  2HVS A;  3HOW J;  2VQH A;  1BR1 A;  1MMN A;  2O8K A;  4A3B J;  4JP0 A;  3W2A A;  2ESN A;  4E7J A;  3F9K A;  1CQT A;  3OIQ A;  2Q8K A;  1B6A A;  2LTP A;  1XB4 A;  4OIN F;  1OCO H;  1APL C;  3PJR A;  4UUS A;  5JFR A;  2Z16 A;  1YW7 A;  3BG3 A;  2NS7 A;  3VYT B;  4U0Y A;  2KIS A;  4D9J A;  2XGE A;  3TL4 X;  1DGW Y;  4PUS A;  5CVV A;  1IW7 F;  2E2I J;  5EGO A;  2PQ8 A;  2QKL B;  2M8G X;  3S1Q J;  2HZT A;  2ACJ A;  1X1B A;  5ERI A;  4BDY A;  2X1D A;  1LFP A;  2OUM A;  1XC5 A;  2IGM A;  4R8H A;  1VQ9 I;  4N0B A;  1TQP A;  3HGG A;  4UUT A;  1P2F A;  2FXA A;  3I55 I;  4ESJ A;  1TQI A;  3O3K A;  1AWC A;  4HNV A;  3OYE A;  3HPG A;  3FXO A;  5CPR B;  4A6E A;  1O3R A;  3M8F A;  2CJJ A;  5LGT A;  3TKY A;  2EQR A;  2W48 A;  3RJP A;  2Z9O A;  4R79 A;  2A61 A;  1OFC X;  3WTS C;  1KZH A;  3F8F A;  1K4T A;  1RKW A;  2BEO A;  2HDD A;  1FMV A;  3HJE A;  2QYO A;  3U1D A;  2FU4 A;  3DQV C;  1TP4 A;  3I4M J;  1A6I A;  2QF7 A;  3HGY A;  4MFD A;  2QVO A;  3GFL A;  1JJ8 C;  4YG2 F;  5H2F C;  4ENM A;  1ZR4 A;  2V4J C;  4CSW A;  2CRG A;  1BW6 A;  4RGX A;  2XB5 A;  4M6V A;  4NB5 A;  3ZMU A;  1E3H A;  2X85 A;  3KEO A;  3KPH A;  3ZMD A;  1P4X A;  1W36 C;  1A31 A;  4OIO F;  3F3X A;  2ZSH B;  2J5O A;  3E0J B;  3QOD A;  1U5T C;  3L00 A;  3GFM A;  2LFB A;  1RUO A;  4IHW A;  4AIH A;  5LRR A;  2X6W A;  4U7D A;  3WU2 C;  2XRO A;  3J7A Y;  5E3M A;  4FT8 A;  2ZXJ A;  3VB2 A;  1S7E A;  1OCZ H;  1V55 H;  4NUB A;  4BY1 J;  3M3Y J;  1KYZ A;  2A6T A;  5E8G A;  4EJT A;  5M5W J;  2M30 A;  3CDL A;  3S17 J;  1KA8 A;  1SAU A;  5IOY A;  3UKG A;  2TDX A;  4Y4R A;  2PN6 A;  2FEZ A;  3K1M A;  3K4C A;  3PIP F;  3OSG A;  2XAQ A;  1ZGJ A;  3BG7 A;  4N9I A;  3DKX A;  4CO8 A;  2LY2 A;  1IN4 A;  2HGC A;  2MH9 A;  4UB6 C;  5EG0 A;  1KQ0 A;  1RUN A;  2F4I A;  1S3J A;  3D1N I;  1XGS A;  2EWN A;  3FX3 A;  3OYH A;  4V19 K;  5EZG A;  2COM A;  2IA2 A;  1WWX A;  2JUC A;  2RNG A;  4EEF G;  5LFA A;  1RPW A;  3NAU A;  4MFE A;  2I5U A;  3GLL A;  3J80 K;  2R7U A;  2OA4 A;  2EFQ A;  4P96 A;  1ZH5 A;  4K2E A;  1LJ9 A;  1XTA A;  1R5G A;  3RTR A;  1XMA A;  3FIS A;  4KFC A;  2HI3 A;  4BHB A;  3CMY A;  1EJ9 A;  5KNL A;  1OPC A;  1WH7 A;  2R7D A;  1TQM A;  1DUX C;  4BU2 A;  3HKZ A;  3BCB A;  4NQW B;  4LG0 A;  5KAF C;  1ZRC A;  2PLY A;  4XMY A;  1E17 A;  3ECH A;  2ME6 A;  1D1B A;  3DBH B;  4Q5S F;  2XRN A;  4B47 A;  5LEK A;  3T8T A;  2V6E A;  2QA4 I;  2CW7 A;  4IEJ A;  3L2C A;  4LJZ F;  4KT6 A;  4A0X A;  2VPL A;  4UV8 A;  5FD6 A;  1MDM B;  2NOJ B;  4EGY A;  4S04 A;  1JT0 A;  4L9T A;  1R5H A;  1QA6 A;  1XCB A;  2E7X A;  3I0T A;  4IVN A;  3K4K A;  1OCR H;  3A0B C;  1YG2 A;  4I01 A;  2LC2 A;  1FWZ A;  4YEJ A;  3A1Y A;  4BQN A;  5B66 C;  1L3L A;  5ILS A;  3V4G A;  3DF8 A;  1QRY A;  4A3J J;  2NS8 A;  1N78 A;  2R7Z J;  4A3K J;  2KP6 A;  1J5Y A;  4BNC A;  1FYL A;  1IV6 A;  5EZH A;  1ZRD A;  1SVM A;  2XPU A;  4KIS A;  4F52 A;  1T0F C;  2E7W A;  3KYC B;  3HB9 A;  3BG5 A;  3H9J A;  4EJV A;  2QBY B;  1TBX A;  4RGU A;  3DTE A;  4UUV A;  2R7S A;  5C44 J;  4L18 B;  2MH2 A;  2W00 A;  3R6S A;  2JQ7 A;  4O5V A;  1MMS A;  1DPU A;  1OCP A;  2DOF A;  2HXO A;  3HRS A;  2XB0 X;  4FCY A;  2R7X A;  1O4X A;  4WXC A;  3OMY A;  1T39 A;  4H4K C;  1FBU A;  2ZNZ A;  2L01 A;  4IQJ A;  1S7A A;  5KAI C;  2GXB A;  2MFZ A;  3CTA A;  1NH3 A;  3HOX J;  4HG2 A;  5J1Y A;  2M8E A;  1SEU A;  2DJI A;  3SQN A;  2IVM A;  3QWL A;  2W1O A;  4XON A;  3HEF A;  4DYQ A;  3WTV C;  4I99 C;  3F23 A;  5LEJ A;  2XV4 S;  5E1X A;  2EIJ H;  2KZG A;  1UHS A;  4HW0 A;  3MZY A;  2KKO A;  2H94 A;  4LIT A;  2MA3 A;  3HOZ J;  2NOG A;  5L3C A;  3LAP A;  2BV6 A;  4YRV A;  3K10 A;  1V3F A;  4WWC A;  2IJL A;  4HF0 A;  4RAG A;  3D5R C;  3S93 A;  2PMZ A;  2IAI A;  5DD8 A;  3HUG B;  1FLI A;  4MNU A;  4UVB A;  3QQA A;  1XPX A;  1QZZ A;  2O3F A;  1TT0 A;  4EJW A;  4EM1 A;  4A3G J;  2DOD A;  3LFU A;  3G71 I;  4MQV A;  2LVS A;  4BEH A;  1FYK A;  4EV0 A;  4CYD A;  2R92 J;  1H8A C;  4FX4 A;  5K5Q A;  1K6Y A;  2XAF A;  3AG4 H;  1ENH A;  3MAJ A;  4BUP A;  4CA0 A;  2VOO A;  2DYS H;  1JHH A;  4PZJ A;  2CQQ A;  1YRN B;  3OYB A;  3I9V 2;  3P9C A;  3R61 A;  1YS6 A;  1GVD A;  2GAU A;  3DBR B;  4A69 C;  2E34 A;  5EEG A;  2BXZ A;  1K79 A;  2LKX A;  4CCN A;  2FX0 A;  2ZKZ A;  1UCR A;  3SFI A;  1W5T A;  3ML6 A;  5L3G A;  1Y0U A;  4XL9 A;  2HKX A;  3U2R A;  3CCJ I;  5LGN A;  2L4A A;  2OTL I;  2ISY A;  5KHD A;  2HYJ A;  4S0H B;  1PP7 U;  2X1E A;  2GIZ A;  3GUD A;  1Z6R A;  2JZY A;  3OWT A;  1V4R A;  1D0Y A;  4FET A;  2HDW A;  3GEZ A;  3SJM A;  4XID A;  2F5F A;  5DYM A;  1RKT A;  2DFH A;  3RKW A;  2OAZ A;  3NRV A;  2RQQ A;  3K2A A;  1ZTR A;  4NC6 A;  3E97 A;  4Q47 A;  2F4O B;  2FQ4 A;  5F1R A;  4BQQ A;  4IX7 A;  3K1N A;  1R7J A;  2L02 A;  3F8C A;  3M1C A;  1BM9 A;  1FBQ A;  5JLW A;  3L1P A;  1Y39 A;  4C2M J;  2DN0 A;  5JVG F;  1SFE A;  4HDU A;  4J00 A;  4XLF A;  4FTH A;  2YS9 A;  3GFI A;  1A36 A;  4L0Y B;  2NVT J;  4UVC A;  5L3D A;  3PQJ A;  3E6D A;  3PNT A;  2Y75 A;  4LK0 F;  4OAZ A;  4YFN F;  3PO3 J;  3DU5 A;  4M6Y A;  1J09 A;  4BYY A;  4G6T B;  4P55 A;  2H8W A;  4Y13 A;  1WRJ A;  5DS9 A;  1UB9 A;  4XRS A;  2I10 A;  1B9N A;  1OYI A;  2QUF A;  3E7L A;  1Y1V J;  3UR3 C;  1P6R A;  5HDN A;  3J81 K;  4P5O A;  2K3F A;  3BLY A;  1YW8 A;  1TNT A;  2KFD A;  1KU9 A;  3KZY A;  2W7N A;  2R7Q A;  1SVL A;  3DFG A;  2K9N A;  5D6E A;  4D5C A;  4BE0 A;  3GLX A;  5BS6 A;  3KEQ A;  2L54 A;  3PFI A;  6PAX A;  3SDB A;  1HDP A;  1I1S A;  3RPU A;  1ZRE A;  4E7H A;  2P7C B;  4QLC U;  1KON A;  2C6Y A;  3G3Z A;  4ZYG A;  3ERE D;  1EF4 A;  2CU7 A;  1T0F A;  2YUS A;  2Y31 A;  1L0O C;  1X1A A;  1R71 A;  2WAQ A;  1MZB A;  3DTK A;  3CCY A;  3FXU A;  4I7H A;  3JRD A;  5F04 A;  4KNY A;  3FM5 A;  4HNU A;  2EFN A;  1W5S A;  5GTH C;  5AIP A;  4DZP A;  2B0L A;  2A5W A;  2KMU A;  2EIL H;  2HEO A;  4UNO A;  3R60 A;  3LQQ A;  3V8K A;  2DFE A;  3ZQG A;  3I53 A;  4BXF A;  3SZG A;  2K7L A;  2WAF A;  5FRO A;  3V7C A;  3S1N J;  2VE9 A;  2ZSI B;  4DOZ A;  3E6C C;  2HOE A;  3CDH A;  3QOP A;  3Q5F A;  1G3T A;  4OIR F;  4AIK A;  2B63 J;  3J7Z I;  4OIP F;  4Y17 A;  1K78 B;  1FSH A;  1EKE A;  1I6H J;  2CWE A;  2LBF A;  3I5U A;  2EB7 A;  3R0A A;  2XAH A;  4EGZ A;  1WHU A;  2UZK A;  3Q0U A;  2XGX A;  3LSJ A;  3W6K B;  4LFU A;  4I76 A;  3FMR A;  5H6Q A;  1PJR A;  4IRH A;  9ANT A;  5IP9 J;  3IC7 A;  2RN7 A;  4KIB A;  5J4V A;  2AS5 F;  3KP2 A;  3I64 A;  3BQZ A;  2RRE A;  2QQ8 A;  5D4S A;  2LKP A;  2V1U A;  4GDF A;  1FTT A;  2L7F P;  1FP2 A;  2M4G A;  3T1B A;  2K9S A;  3QP6 A;  2WY8 Q;  1MSE C;  3GCM A;  2NVY J;  3MVP A;  1NK2 P;  2VAS A;  4ZZD A;  3CC2 I;  3WGI A;  1GV5 A;  5AIQ A;  1BI0 A;  1TTY A;  3BRO A;  3DWL E;  2OTJ I;  3OL4 A;  1SD4 A;  1S7O A;  1YHQ I;  2A6H F;  2JWT A;  5IYB J;  4C9Y A;  1T2K A;  2JVG A;  3LSH A;  1ZG1 A;  3SZP A;  4ZTJ A;  1ZRF A;  5HS7 A;  3HSF A;  2XGC A;  3DV8 A;  2DTR A;  4MIM A;  3F8B A;  4CUG A;  4DBR A;  3UNG C;  5IT9 K;  2FBH A;  3CP2 A;  4F92 B;  3U1K A;  3GTL J;  2VXD A;  3CMA I;  4D1Q A;  1J9I A;  4IZZ A;  1Z7L A;  2DU9 A;  2O0Y A;  5H6R A;  3E6M A;  3HZJ A;  1E3P A;  5GPC A;  4IOA F;  1ZR2 A;  2DFF A;  3G73 A;  4LGW A;  3HM5 A;  3IKT A;  1KQ9 A;  3ABK H;  1CF7 B;  3A2K A;  4DYC A;  3GTQ J;  4LG3 A;  3GBG A;  1RRJ A;  2ZBK A;  3S2D J;  2E2H J;  3CCM I;  2M4K A;  2CW0 F;  1XDU A;  1D0Z A;  2H27 A;  1ZGW A;  1QQI A;  3VDX A;  1TWG J;  1MMA A;  2XSJ C;  4BY7 J;  1H9G A;  4MQ9 F;  3EPZ A;  4AD9 A;  3DCF A;  1SFO J;  2G7U A;  5IP7 J;  1B72 B;  4WXH A;  1AA7 A;  2CQK A;  2X9D A;  1ZG3 A;  3F72 A;  2EIK H;  3TBI A;  2PI0 A;  1PUF B;  1R36 A;  2OU2 A;  5EDN A;  2JA8 J;  2HWV A;  4XLA A;  5HLH A;  1R1T A;  3GME A;  3S8P A;  3PO2 J;  4MEY F;  1X2N A;  3I59 B;  3DP7 A;  4Q4Z F;  3C2B A;  4AID A;  2HPM A;  2EA4 A;  3CME I;  3DKY A;  4F55 A;  1FSE A;  3KIO A;  2MBF A;  3LFK A;  4HEA 2;  2XAU A;  2G7H A;  3ERM A;  3FZV A;  5KVR A;  3ZCO A;  5GAE J;  1YFH A;  3L2R A;  4L5E A;  1ITY A;  3CCR I;  3DLL F;  3V8L A;  2XF7 A;  2DW4 A;  2QKM B;  1MSF C;  1LB2 A;  3E5X A;  1T6S A;  4G6D A;  2VT2 A;  2L9N A;  2P8T A;  2HZD A;  3F0C A;  2JA6 J;  1W4M A;  1PDN C;  3HRU A;  1U5T B;  1WI9 A;  3FKI J;  5FKO A;  2DA4 A;  1B59 A;  1FYM A;  4IL6 C;  2DJN A;  2K02 A;  4IHV A;  4U87 A;  2CYY A;  4QPO A;  3R4K A;  3ZMZ A;  1MBK A;  3AAF A;  5B1B H;  1QVT A;  4D7N A;  4G94 A;  4B09 A;  4ENK A;  2WV1 A;  2DPU A;  3IH3 A;  4IRG A;  3GXO A;  4BAY A;  5J6X A;  2M7A A;  4JYK A;  4NC7 A;  2QCO A;  1F1Z A;  5DCM B;  3SXY A;  1FX7 A;  1OLT A;  5K7H A;  3J80 Z;  3CCS I;  1N77 A;  1OCT C;  1O7F A;  3S32 A;  1YJW I;  3V42 A;  2CFX A;  3CUQ A;  5DD4 A;  3BR3 A;  4E7I A;  2QQ9 A;  3K69 A;  1ONV A;  1B1B A;  4BQO A;  1T56 A;  4BJ6 C;  2WWY A;  2DT5 A;  2K86 A;  4CHU A;  1MMD A;  4XKB A;  1X1P A;  1LKX A;  1SFX A;  3OL3 A;  2YU3 A;  4ZJZ A;  5J1R A;  4G8X A;  5EEA A;  2R7T A;  2E1N A;  3K4B A;  1GHC A;  1LE8 B;  1IUY A;  1U2W A;  2JA5 J;  1TWA J;  5B3S H;  5F64 A;  1MNM C;  2DTZ A;  2B9S A;  2NS0 A;  4E7S A;  2LH9 A;  4AWX B;  3IRQ A;  4M3G A;  5GAG J;  3I54 A;  1UJ8 A;  1YX5 A;  1IGN A;  3DBL B;  2XKP A;  2MLG A;  2VBY A;  2JUG A;  4M71 A;  2STT A;  4Q48 A;  3N97 A;  4A0Y A;  1F5T A;  3GFJ A;  2PEX A;  2DQR A;  5E3O A;  5CVU A;  3GYH X;  1YIO A;  1K7A A;  3ELK A;  2HYF A;  3FXJ A;  3L9F A;  3G6E I;  1HW5 A;  1OJL A;  2YR2 A;  4I0B A;  3AL0 B;  3ZMV A;  2HVR A;  3TP0 A;  1DP7 P;  1ETQ A;  3I56 I;  3ZQ7 A;  3EUH C;  1VQO I;  1PVE A;  3TGN A;  2G9W A;  2BW3 B; 
#chains in the Genus database with same CATH homology
 2XAG A;  2EJR A;  3QU3 A;  3K9T A;  3BY6 A;  3HSR A;  1PUE E;  5FB2 A;  1WKM A;  2LSO A;  2QQA A;  4RAZ A;  3JSO A;  3LA7 A;  1BIB A;  3COA C;  3C1D A;  1Z6T A;  1QO0 D;  5J8C A;  5HS9 A;  5A2Q K;  2P7V B;  1EH6 A;  5FFX A;  2RNJ A;  3WU1 B;  1Z05 A;  4KA4 A;  4H0E A;  4L0Z B;  4G6Q A;  2FOK A;  3VEP A;  3EYY A;  4A5M A;  1U3E M;  3HHH A;  2RV8 A;  4L9V A;  5L3F A;  1GXQ A;  2XHK A;  2WTE A;  2DK5 A;  4I0A A;  2JSC A;  3DPT A;  2M45 A;  1JXS A;  3WTX C;  2OZU A;  2CO5 A;  5LLQ A;  1MJB A;  1S29 A;  4UHT A;  4M9S A;  4KN4 X;  3JAM K;  1LDK B;  2A6E F;  2YSR A;  1SMT A;  4OIQ F;  1Z7U A;  3MZH A;  4ENJ A;  1D8K A;  3KP4 A;  4HZF A;  2ADU A;  2HQN A;  2RVC A;  1FNN A;  3Q9S A;  1P92 A;  2JPB A;  4D0P A;  5BPI A;  2FE3 A;  1G4D A;  1XSV A;  3K2Z A;  5D5W B;  1MD0 A;  1ON1 A;  2EK5 A;  5ICG A;  2O61 A;  3FM3 A;  2OBP A;  2BE5 F;  3E3V A;  3WE2 A;  3BPX A;  1QPM A;  5TRD A;  2W57 A;  1D3Y A;  2X4H A;  2RC4 A;  2XAJ A;  5D5X B;  2ISZ A;  1IXR C;  1P4W A;  3F6O A;  2H09 A;  4FHT A;  1AOY A;  4RAY A;  5DEQ A;  2ZME B;  2YX7 A;  3J81 Z;  2PFB A;  4M73 A;  2GXG A;  2H6B A;  4O3M A;  2L4M A;  2K4B A;  1A04 A;  2P5V A;  2ESH A;  4RS8 A;  1S8N A;  1O57 A;  2ELH A;  2GA2 A;  1HW2 A;  5E18 F;  1W7P D;  2OQR A;  2VBW A;  5K5R A;  3WE3 A;  3WTY C;  2EFW A;  2DAO A;  4CZZ A;  3IWF A;  1EV7 A;  3EUH A;  5FGM A;  3LST A;  4YFX F;  1QBJ A;  4EMS A;  1Z91 A;  3BPV A;  5JHU A;  2HYG D;  3RDI A;  1BI1 A;  2R3S A;  1J0R A;  2X0L A;  1IN6 A;  3KE2 A;  4Z2Y A;  4L9J A;  1E2X A;  1HQC A;  1UHM A;  5HS8 A;  4CXF A;  2F5C A;  1YYV A;  2XUB A;  1OYY A;  4MHG A;  1JHF A;  4ESF A;  1SAX A;  5E1W A;  4RB1 A;  2P6S A;  2HTJ A;  1ODD A;  4ESB A;  1U6G A;  1WQ2 A;  3BDD A;  2K4J A;  2LF8 A;  2PJP A;  2HQR A;  4G7Z F;  5HDG A;  4RGS A;  1R22 A;  4TV7 A;  4ENN A;  2YX4 A;  2JRT A;  3JSP A;  2P5K A;  2KIF A;  2ZCW A;  3HSE A;  5E1Z B;  5IT9 Z;  1USS A;  2P5L C;  2BBY A;  3QP5 A;  1IN5 A;  2UXX A;  4P9U A;  2F5E A;  1BI3 A;  3ZPL A;  5AON A;  3O6B B;  4HV6 A;  5ILU A;  3J7A O;  1VTN C;  5D5U B;  1QNT A;  3F22 A;  3ULQ B;  5LHI A;  1P4A A;  2ZO4 A;  4XLN F;  1R23 A;  3JTH A;  2DK8 A;  4L5J A;  2V1D A;  3KZZ A;  2A68 F;  2CG4 A;  4OU0 A;  1D8J A;  3F6V A;  2Z33 A;  3EQL F;  1I6X A;  1T38 A;  3GWZ A;  3IWZ A;  4A6D A;  4HX8 A;  1BOA A;  2XVC A;  3C18 A;  5E8I A;  3TO6 A;  5K5O A;  4EM2 A;  2J5P A;  3WGG A;  3E6B A;  1F9N A;  2Y0M A;  2EFO A;  2H6C A;  2GZW A;  4I98 B;  5ILV A;  2LNB A;  1KU3 A;  3QPT A;  4N9H A;  4IRI A;  4HX7 A;  2NNY A;  3DPL C;  1R1U A;  1XGM A;  1KYW A;  2XIG A;  3DEU A;  5LBQ A;  5LGU A;  1BBY A;  4IF4 A;  2LDU A;  3FXR A;  3KFW X;  3KP6 A;  3P9K A;  3FMS A;  3RKY A;  3CUQ C;  1YW9 A;  3BZ6 A;  5ICF A;  4KT5 C;  5LHG A;  5KK1 A;  5DUK A;  1H9T A;  5FFZ A;  2VBZ A;  4I02 A;  1I5Z A;  3B02 A;  4KIF A;  1TNS A;  1BIA A;  1JGS A;  4A2U A;  4LG0 B;  4LMY A;  4XRF A;  2HKO A;  3K1P A;  2NNN A;  3LA2 A;  5JI6 A;  3BJA A;  1YQA A;  3KLN A;  1JE8 A;  1IF1 A;  2QQB A;  5ICE A;  1ON2 A;  1TLH B;  1K6O A;  2O6G E;  3RYR A;  1OYW A;  2RGV A;  2FSW A;  1FC3 A;  1KU2 A;  3KLO A;  2IA1 A;  1XN7 A;  2D1V A;  1DDN A;  3ABT A;  3M7G A;  1O7L A;  1U8R A;  3HRT A;  2F2E A;  1MGT A;  1WSU A;  3CUO A;  2LF7 A;  2HDC A;  3GF2 A;  5E17 F;  1BJA A;  4O6J A;  4ZZL A;  3BP8 A;  1LNW A;  4KYW A;  2FA5 A;  2CSO A;  5A2Q Z;  2KIU A;  3B73 A;  5FLX K;  4G9Y A;  4JK1 X;  1J2X A;  5CLS A;  1W7P B;  1GVJ A;  1XCV A;  4NQW A;  1G3W A;  4GYG A;  2VT3 A;  1RI7 A;  2UWM A;  3LQR A;  1BN5 A;  4WK8 F;  2JT1 A;  2ZME A;  1MDM A;  1HBX G;  1R58 A;  4OMZ A;  4XSZ F;  2XKO A;  3SFZ A;  3GVA A;  4HBL A;  1XD7 A;  4ASN A;  1YTY A;  4IJA A;  4PCQ A;  4U0V A;  4XSX F;  3JAM Z;  4LK1 F;  2GQQ A;  4HA8 A;  3WU0 A;  5CVR A;  3EDP A;  2IP2 A;  3REO A;  2EA2 A;  1Z9C A;  4IHT A;  1SD5 A;  4DQ2 A;  1UFM A;  5HVQ C;  3QRF F;  4JBA A;  2M87 A;  3CJN A;  2QBY A;  4ON0 A;  3P7N A;  1OR7 A;  2DQL A;  5BPD A;  1ULY A;  3IKV A;  3HOS A;  1STZ A;  4ZH4 F;  4AIJ A;  3M9A A;  2RKH A;  3IL2 A;  1R00 A;  4IHS A;  2O03 A;  4HLX A;  2V1X A;  2ZFW A;  4HQM A;  1C0W A;  1HW1 A;  4AVP A;  2O8X A;  2Q0O A;  4GO1 A;  2P6T A;  3ECO A;  5CJ9 A;  2FBK A;  3HUG A;  3W6J B;  3CO7 C;  1G6N A;  3KP7 A;  2JPC A;  1XGO A;  2PG4 A;  3TOA A;  2DBB A;  3L09 A;  3VOD A;  4R1H A;  4ZYD A;  3ZMS A;  3QU6 A;  1OMI A;  4U7B A;  1IZ1 A;  3RKX A;  4M9X A;  2MC3 A;  2Z99 A;  4HV5 A;  4U0W A;  2VOD A;  3LAJ A;  5FO5 A;  3V7R A;  4S05 A;  2FNA A;  3GO5 A;  1QZY A;  2KJB A;  3C7J A;  4GYI A;  3T0Y A;  1CGP A;  1PP8 F;  2Y48 A;  3WG9 A;  2V79 A;  1RIO H;  3MFK A;  2NAZ A;  5HLG A;  2FNP A;  1LEB A;  4UV9 A;  4ETS A;  1LQ1 A;  1FBS A;  3O2P E;  4EQQ A;  1U78 A;  3M8E A;  3TO9 A;  1ZAO A;  3V8J A;  3TQN A;  2EFP A;  4MTE A;  4CIC A;  1HSJ A;  2M5W A;  5D5V B;  4BHP A;  3ZMT A;  1J75 A;  1ZN2 A;  2STW A;  3TOB A;  2W24 A;  1LVA A;  1GXP A;  5D6F A;  1ZLK A;  2PMH A;  5HDK A;  3WTW C;  1BI2 A;  4LB6 B;  3RI4 A;  4MGR A;  2AXL A;  2IRF G;  5LHH A;  4CGZ A;  1XMK A;  5BOX A;  1KQ8 A;  4M72 A;  5F6F A;  2DLL A;  5H20 A;  2R7F A;  3FHZ A;  4M74 A;  4DNC A;  2FQ3 A;  2XAS A;  4HLY A;  2E1C A;  2DI3 A;  3HOT A;  5JVT A;  1SFU A;  3JTG A;  2A07 F;  2D45 A;  4G7O F;  1LEA A;  1FY7 A;  1K78 A;  3ZN0 A;  4XLP F;  4BHC A;  3BOQ A;  2GA1 A;  2JTV A;  3RPQ A;  2GWR A;  2HFH A;  1H0M A;  1HKQ A;  3MWM A;  2QM3 A;  4LLN A;  2WV0 A;  2HR3 A;  3VOE A;  4RB0 A;  1XSD A;  1O3T A;  1YO5 C;  2DPD A;  3KP3 A;  3M1E A;  4WX9 A;  3RIR A;  3WOD F;  3RYP A;  1HKS A;  3T5X A;  3Q9V A;  3BWG A;  3WTT C;  4BXU A;  2WC2 A;  1YLF A;  2Z5U A;  4WXD A;  5EEH A;  2VN2 A;  3H3U A;  2OD5 A;  1ZYR F;  3D0S A;  1CF7 A;  3QAH A;  3OOP A;  1TW2 A;  2RDP A;  3ISP A;  2A69 F;  3KET A;  4GCV A;  2RQP A;  2BGC A;  1MKM A;  3DXJ F;  1G3S A;  2VBX A;  4LB5 A;  4NHJ A;  5E20 A;  4A12 A;  2ZJ2 A;  2D2W A;  3FXQ A;  4HF2 A;  3CUQ B;  4RB3 C;  4B8X A;  2OQG A;  2QWW A;  1W7P A;  1B4A A;  5BMZ A;  5ICC A;  3I59 A;  2KIM A;  1IRG A;  1HXD A;  2MD5 A;  1R1V A;  4RGR A;  4KN7 X;  1XSX A;  5ED4 A;  3CO6 C;  4KIC A;  2DFI A;  3U9G A;  2W85 A;  4RB2 C;  3NEU A;  4I09 A;  2EV6 A;  1EH7 A;  4LLG F;  5L3B A;  2FML A;  1DPR A;  1F4K A;  5D8K B;  2FRH A;  1U5T A;  3ZN1 A;  2W84 A;  5CVI A;  2M1B A;  4EJU A;  4OMY A;  1Q1H A;  1UST A;  3FWE A;  3T8R A;  4HF1 A;  5DCM A;  5FLX Z;  4E70 A;  2IA0 A;  2ZNY A;  1FZP B;  3KP5 A;  1UHW A;  1D5V A;  3GW2 A;  2VOP A;  1YS7 A;  3H92 A;  1X3U A;  2HTS A;  4KDP A;  5JR3 A;  1O3Q A;  4HAM A;  2DO7 A;  3WTU C;  3WGH A;  2FF4 A;  3CLO A;  3TDZ C;  5D8L B;  4XBF A;  4PGG A;  3F8N A;  4HDV A;  1HKT A;  4ZYE A;  3IHU A;  1IN8 A;  2EV5 A;  5CYV A;  4F7Z A;  2IT0 A;  1FOK A;  4MEX F;  3HRM A;  3E5Q A;  5DCF A;  2KRF A;  4Y15 A;  3ROU A;  3EYI A;  2CGP A;  3SZT A;  3IRR A;  4EVI A;  4YFK F;  2A5Y B;  5DDG A;  4KIG A;  4KMU X;  3LA3 A;  4WF2 A;  4IPA A;  2PMU A;  1HST A;  3V7S A;  2QEN A;  3H3Z A;  2VXZ A;  4HYE A;  1ZLJ A;  2YPR A;  2BYV E;  1S6L A;  2KJC A;  4QWQ A;  3D5L A;  4A5N A;  1FPQ A;  2A3S A;  5TJJ A;  1SMY F;  1REP C;  1RZ4 A;  4LLL A;  1XGN A;  4IXA A;  4A0Z A;  4FX0 A;  3WTZ A;  2FBI A;  4KMF A;  3S2W A;  1EH8 A;  3K0L A;  1KU7 A;  1LDD A;  4YII A;  3I4P A;  1I1G A;  1O3S A;  3NQO A;  2Z3Y A;  3R0J A;  5L3E A;  3MCZ A;  5LRS A;  3F8M A;  3ZP5 A;  2V9V A;  1TW3 A;  5IT3 A;  4BQA A;  3BJO A;  4PDK A;  2EV0 A;  2MLK A;  2V6C A;  1RNL A;  1J7K A;  4L5I A;  4YIF A;  3GX4 X;  3F21 A;  4G7H F;  1MJA A;  4HX4 A;  2HS5 A;  3TDU C;  3TO7 A;  1ZG5 A;  1XDS A;  4P9F A;  1IXC A;  3SHF A;  1ZHF A;  2FMY A;  3GZ6 A;  3I71 A;  4CDG A;  1IN7 A;  4JQF A;  4GGG A;  3N4M A;  2QZ8 A;  5J8F A;  1ZGA A;  5FD5 A;  3EET A;  1BC7 C;  2GIV A;  4PGH A;  3ABU A;  2L3D A;  2VON A;  3HTS B;  3KCC A;  4U88 A;  2D1H A;  3BJ6 A;  2P4W A;  5BQT A;  2PBI A;  3MQ0 A;  5DUI A;  3DKW A;  1I27 A;  4UXN A;  2F5D A;  4EJO A;  3P9I A;  4ZYH A;  2VC0 A;  3MEX A;  4BH9 A;  5HOO A;  3VFZ A;  4WCG A;  2W25 A;  1G3Y A;  3HTU A;  1IXS B;  4HQE A;  3QPH A;  4M6X A;  5D4R A;  1ZAR A;  3FF5 A;  1T98 A;  3OV8 A;  3LWF A;  1SD7 A;  2VE8 A;  1B9M A;  4I2O A;  2ETH A;  3I58 A;  3GZ5 A;  3E5U A;  3PQK A;  3HYI A;  2QLZ A;  2K27 A;  2UXN A;  1OKR A;  1NHA A;  2OZ6 A;  3JW4 A;  5DV5 A;  2NRA C;  1SD6 A;  1FP1 D;  1IRF A;  3FMQ A;  2VC1 A;  4GXO A;  1FT9 A;  5K1Y A;  1IAW A;  3HHG A;  4M9Z A;  5CVJ A;  4OOI A;  2Q2E A;  1QGP A;  4HOB A;  5HLI A;  4EM0 B;  3C3W A;  4UVA A;  1BC8 C;  4MTD A;  2NYX A;  4LD5 A;  1MJ9 A;  3HIF A;  1KGS A;  1J59 A;  1LDJ A;  2IW5 A;  4L9N A;  1Z1D A;  4KUM A;  2IPQ X;  2ESN A;  2Q8K A;  1B6A A;  4OIN F;  1XB4 A;  5JFR A;  1YW7 A;  4U0Y A;  5CVV A;  1IW7 F;  2PQ8 A;  2HZT A;  2ACJ A;  5ERI A;  4R8H A;  4N0B A;  1TQP A;  4ESJ A;  1P2F A;  2FXA A;  1TQI A;  3O3K A;  1AWC A;  4A6E A;  1O3R A;  3M8F A;  5LGT A;  3TKY A;  3RJP A;  2Z9O A;  4R79 A;  2A61 A;  3WTS C;  3F8F A;  2BEO A;  2QYO A;  3U1D A;  2FU4 A;  3DQV C;  2QVO A;  3GFL A;  4YG2 F;  4ENM A;  4RGX A;  4NB5 A;  3ZMU A;  3KEO A;  3ZMD A;  1P4X A;  4OIO F;  3F3X A;  2J5O A;  1U5T C;  3L00 A;  3GFM A;  1RUO A;  4AIH A;  5LRR A;  4U7D A;  2XRO A;  4FT8 A;  2ZXJ A;  3VB2 A;  1KYZ A;  5E8G A;  4EJT A;  2M30 A;  1KA8 A;  2TDX A;  2PN6 A;  2FEZ A;  3K1M A;  2XAQ A;  1ZGJ A;  4N9I A;  4CO8 A;  1IN4 A;  2HGC A;  2MH9 A;  1KQ0 A;  1RUN A;  1S3J A;  1XGS A;  2EWN A;  3FX3 A;  2COM A;  2IA2 A;  1WWX A;  3J80 K;  2OA4 A;  2EFQ A;  4P96 A;  1ZH5 A;  4K2E A;  1LJ9 A;  1R5G A;  3RTR A;  1XMA A;  4KFC A;  4BHB A;  1OPC A;  2R7D A;  1TQM A;  1DUX C;  1ZRC A;  4LG0 A;  2PLY A;  1E17 A;  3ECH A;  4Q5S F;  2XRN A;  5LEK A;  3T8T A;  3L2C A;  4LJZ F;  4A0X A;  4UV8 A;  5FD6 A;  1MDM B;  4EGY A;  4S04 A;  4L9T A;  1R5H A;  1XCB A;  2E7X A;  3I0T A;  4IVN A;  1YG2 A;  4I01 A;  1FWZ A;  1L3L A;  5ILS A;  3V4G A;  3DF8 A;  1J5Y A;  4BNC A;  1FYL A;  1ZRD A;  2E7W A;  2QBY B;  4EJV A;  1TBX A;  4RGU A;  4UUV A;  4L18 B;  2MH2 A;  3R6S A;  4O5V A;  1DPU A;  3HRS A;  4WXC A;  1T39 A;  1FBU A;  2ZNZ A;  2L01 A;  1S7A A;  2GXB A;  3CTA A;  2M8E A;  3SQN A;  2IVM A;  3F23 A;  3WTV C;  5LEJ A;  2XV4 S;  5E1X A;  4HW0 A;  3MZY A;  2KKO A;  2H94 A;  2MA3 A;  5L3C A;  3LAP A;  2BV6 A;  4WWC A;  1V3F A;  2IJL A;  4HF0 A;  5DD8 A;  1FLI A;  4MNU A;  4UVB A;  1QZZ A;  2O3F A;  4EJW A;  4EM1 A;  4MQV A;  1FYK A;  4EV0 A;  4CYD A;  4FX4 A;  5K5Q A;  2XAF A;  3MAJ A;  2VOO A;  1JHH A;  4PZJ A;  3P9C A;  3R61 A;  1YS6 A;  2GAU A;  5EEG A;  1K79 A;  2ZKZ A;  1UCR A;  1W5T A;  3ML6 A;  5L3G A;  1Y0U A;  2HKX A;  3U2R A;  5LGN A;  2L4A A;  2ISY A;  1PP7 U;  3GUD A;  1Z6R A;  2JZY A;  1V4R A;  3GEZ A;  2F5F A;  5DYM A;  3RKW A;  2OAZ A;  3NRV A;  4Q47 A;  3E97 A;  5F1R A;  3K1N A;  1R7J A;  2L02 A;  3F8C A;  1BM9 A;  1FBQ A;  1SFE A;  4HDU A;  3GFI A;  4L0Y B;  4UVC A;  5L3D A;  3PQJ A;  3E6D A;  2Y75 A;  4LK0 F;  4YFN F;  4M6Y A;  4BYY A;  4P55 A;  4Y13 A;  1WRJ A;  1UB9 A;  1B9N A;  1OYI A;  2QUF A;  3J81 K;  5HDN A;  1P6R A;  4P5O A;  1YW8 A;  1TNT A;  1KU9 A;  3KZY A;  3DFG A;  5D6E A;  3GLX A;  5BS6 A;  3KEQ A;  2L54 A;  3PFI A;  6PAX A;  1I1S A;  3RPU A;  1ZRE A;  2P7C B;  4QLC U;  2C6Y A;  3G3Z A;  4ZYG A;  3ERE D;  1T0F A;  1L0O C;  1MZB A;  3FXU A;  4I7H A;  4KNY A;  3FM5 A;  2EFN A;  1W5S A;  5AIP A;  2B0L A;  2HEO A;  4UNO A;  3R60 A;  3LQQ A;  3V8K A;  3I53 A;  2K7L A;  3V7C A;  2VE9 A;  3E6C C;  2HOE A;  3CDH A;  3Q5F A;  3QOP A;  1G3T A;  4OIR F;  4AIK A;  4OIP F;  4Y17 A;  1K78 B;  1FSH A;  2CWE A;  3I5U A;  2EB7 A;  3R0A A;  2XAH A;  4EGZ A;  2UZK A;  2XGX A;  3W6K B;  4LFU A;  3FMR A;  5H6Q A;  4IRH A;  3IC7 A;  2RN7 A;  4KIB A;  2AS5 F;  3KP2 A;  3I64 A;  5D4S A;  2LKP A;  2V1U A;  1FP2 A;  3T1B A;  3QP6 A;  4ZZD A;  3WGI A;  5AIQ A;  1BI0 A;  1TTY A;  3BRO A;  1SD4 A;  1S7O A;  2A6H F;  1T2K A;  1ZG1 A;  3SZP A;  1ZRF A;  5HS7 A;  3HSF A;  3DV8 A;  2DTR A;  3F8B A;  5IT9 K;  2FBH A;  1J9I A;  2DU9 A;  2O0Y A;  5H6R A;  3E6M A;  3G73 A;  4LGW A;  3IKT A;  1KQ9 A;  1CF7 B;  2ZBK A;  2CW0 F;  1XDU A;  2H27 A;  1QQI A;  1H9G A;  4MQ9 F;  4AD9 A;  2G7U A;  4WXH A;  2CQK A;  1ZG3 A;  3F72 A;  2PI0 A;  1R36 A;  2OU2 A;  2HWV A;  5HLH A;  1R1T A;  4MEY F;  3I59 B;  3DP7 A;  4Q4Z F;  2EA4 A;  1FSE A;  2MBF A;  3LFK A;  2G7H A;  3FZV A;  5KVR A;  1YFH A;  3V8L A;  2DW4 A;  1LB2 A;  3E5X A;  1T6S A;  4G6D A;  2VT2 A;  2P8T A;  1W4M A;  1PDN C;  3HRU A;  1U5T B;  1WI9 A;  1B59 A;  1FYM A;  2K02 A;  2CYY A;  3R4K A;  3ZMZ A;  3AAF A;  4G94 A;  4B09 A;  4ENK A;  2DPU A;  4IRG A;  3GXO A;  4BAY A;  5J6X A;  5DCM B;  1F1Z A;  3SXY A;  3J80 Z;  1FX7 A;  1O7F A;  2CFX A;  3CUQ A;  5DD4 A;  2QQ9 A;  3K69 A;  1ONV A;  1B1B A;  2WWY A;  2DT5 A;  2K86 A;  4CHU A;  1SFX A;  2YU3 A;  4G8X A;  2E1N A;  1GHC A;  1IUY A;  1U2W A;  5F64 A;  2NS0 A;  4AWX B;  3IRQ A;  3I54 A;  2XKP A;  2MLG A;  2VBY A;  4M71 A;  2STT A;  4Q48 A;  3N97 A;  4A0Y A;  1F5T A;  3GFJ A;  2PEX A;  2DQR A;  5CVU A;  3GYH X;  1YIO A;  1K7A A;  3ELK A;  2HYF A;  3L9F A;  1HW5 A;  2YR2 A;  4I0B A;  3ZMV A;  1DP7 P;  3ZQ7 A;  3L7W A;  3TGN A;  2G9W A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...