3WTTC

Crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wttC00
5IT3A 4EJTA 1EH7A 3F8FA 5HLHA 1YW9A 2EWNA 2LSOA 3CUQC 1VTNC 2CFXA 2DTRA 1E2XA 1SMYF 3E3VA 1BN5A 3QU6A 3DV8A 1D8JA 2MC3A 4Q5SF 2P5LC 3BWGA 4YFNF 3TOBA 2ADUA 5FGMA 4Y13A 2PMHA 3P9CA 2EA2A 2R7FA 3I5UA 3SZTA 4I01A 5TJJA 4AWXB 3QOPA 5ICGA 1GXPA 2PMUA 4HF0A 3O3KA 4P9UA 1SFUA 3DFGA 1KU3A 2M1BA 2RGVA 4LB5A 3DEUA 1R1UA 2QQ9A 5E18F 2ETHA 4M6YA 3GFIA 4RB0A 3GLXA 1ZLKA 1J7KA 2WWYA 3L9FA 1LEBA 2QUFA 3E5UA 4U7DA 2YSRA 1SFXA 1O3QA 2EFNA 3TO6A 3U9GA 2DQRA 3E6MA 4NQWA 3ISPA 1XCBA 1MD0A 1FYMA 1XB4A 1YTYA 1OYWA 3HOSA 1K79A 3H3UA 3FMQA 2FEZA 3KP3A 4R8HA 5CYVA 1IAWA 4NB5A 1J59A 1LQ1A 2H94A 2GIVA 1GHCA 4OMYA 2WTEA 1RNLA 2KIFA 2ZO4A 2F5EA 1ZRCA 1B59A 2CYYA 3F6VA 2O6GE 3GW2A 5L3FA 2P7CB 1QZZA 1B4AA 3MEXA 2E1CA 1TQPA 3O2PE 3RI4A 2BEOA 5CVUA 3CJNA 3DF8A 2JPBA 3KZYA 4HOBA 2A07F 4MQVA 3RJPA 2UWMA 5FFZA 3U1DA 2A3SA 1G4DA 4PDKA 3TO7A 4RAYA 1RUOA 4DNCA 5H6QA 1ZARA 1D3YA 1Z7UA 4BHPA 1K78B 3MZHA 3WTUC 2BV6A 2XVCA 4EJOA 3KLNA 2VE8A 2OZUA 3ZMVA 2EK5A 1SD6A 3G3ZA 2OQRA 2A6EF 1CF7B 4HLYA 4WF2A 2XAQA 2ZCWA 3ELKA 2VBWA 1P92A 1TNTA 2VBZA 4UV9A 1O3RA 1KGSA 3ZMDA 2CSOA 4O3MA 5LBQA 1XSXA 2XROA 4LB6B 2DO7A 2MH2A 4FX4A 1G6NA 2QVOA 2NS0A 4RB3C 1B1BA 3MFKA 3ZPLA 5K5QA 4MNUA 1FX7A 1QPMA 5D8LB 2FF4A 4O6JA 5CVJA 1R7JA 5DUIA 3F3XA 1FZPB 4LG0A 1ODDA 2GXBA 1LDKB 1DUXC 1IN7A 4HZFA 3JAMZ 4OIOF 1BI1A 4M9SA 1MDMB 4ENKA 1WRJA 3FF5A 2XASA 3KLOA 3P7NA 4ZYGA 3BPVA 5CVVA 4QLCU 1Z9CA 4EJVA 1G3WA 4ENJA 1O3SA 2DW4A 3C3WA 4G7HF 2AS5F 1AWCA 3J7AO 5E17F 3RKWA 4M72A 1R36A 2H09A 3R60A 2V9VA 1YG2A 5D5XB 2FBKA 1K7AA 1V3FA 2XAHA 4NHJA 5DD8A 1P4WA 3I58A 3TKYA 2HKOA 4IVNA 3TO9A 3H92A 3GZ6A 1XGMA 1LNWA 4MGRA 1F1ZA 5J6XA 3ZQ7A 1SD4A 4KIFA 3J81Z 1MJAA 2NNNA 4BYYA 3TDZC 2D45A 2OA4A 1XCVA 3LAPA 2A5YB 5HVQC 4U0VA 2EFWA 3NRVA 1FPQA 3VODA 1PUEE 2GA2A 1QNTA 1HSTA 2DFIA 3RPUA 3SZPA 3IWZA 2R3SA 5LEJA 1Z1DA 1YYVA 5DCFA 4XRFA 4HBLA 4IRGA 3FXQA 1U3EM 1LB2A 2HQRA 3OV8A 1FP1D 1IRGA 3QAHA 1J0RA 4LG0B 3K0LA 1HW5A 2NYXA 4GGGA 4M9XA 4HX7A 1RUNA 3TGNA 3T8TA 3M8FA 5H6RA 1XSDA 3LQQA 2CWEA 4Z2YA 1KYZA 4I0AA 3N97A 2Q2EA 2J5PA 1T39A 3CUQA 5F64A 3S2WA 3O6BB 4FHTA 2RN7A 3HSFA 4HQEA 3VOEA 3EUHA 2O3FA 1R5GA 4HDVA 4N0BA 5ERIA 5LHIA 2GWRA 1FSEA 2DBBA 3M8EA 3LFKA 3LA7A 2PQ8A 3JTGA 1T98A 2VE9A 4LK0F 4OMZA 3FXRA 3ZMSA 4L9VA 4I02A 1LDJA 1PP7U 2IT0A 1S29A 2IPQX 1XN7A 3HTSB 4WXHA 3U2RA 1W5TA 1J5YA 4HA8A 4LLLA 1FY7A 1IN4A 1TW2A 1YFHA 3P9IA 2NRAC 2UXXA 4IF4A 3HTUA 5ICFA 1IN5A 1ZLJA 3ROUA 4JK1X 1O7FA 3E5QA 3MAJA 4Q48A 2F2EA 3JSPA 2IJLA 4AIHA 1FBQA 3ZMZA 4LK1F 5E1XA 4G7OF 5HLGA 5HDNA 4ESJA 2P5KA 3ECOA 5CLSA 4HV6A 2OAZA 3GZ5A 3FHZA 2PI0A 2RC4A 3KCCA 4ZYDA 1U2WA 1Z91A 4L9NA 3LA3A 1OR7A 1GVJA 3LSTA 5ILVA 1HW1A 1W5SA 3F8MA 1HBXG 1BOAA 1WKMA 3MWMA 3WTSC 3WTXC 4CDGA 1ONVA 3DXJF 1G3TA 3E97A 3M7GA 3L7WA 1P4AA 4WCGA 3RKXA 2FNPA 4FX0A 1I1GA 4EGYA 3Q5FA 1FT9A 1W7PB 4UXNA 2P7VB 5HDGA 5HS9A 3HHGA 2K7LA 5F1RA 3W6JB 2CW0F 1EH8A 5ICCA 1XDSA 5LHHA 2O03A 1ZRDA 1IUYA 4MTDA 1TTYA 4P9FA 1HKTA 2XKOA 1USTA 1H0MA 4KT5C 5LRRA 4S04A 2Q0OA 3BPXA 2HKXA 4ENNA 1ZG3A 4Y15A 3BROA 3ULQB 2VONA 3CO7C 5FO5A 2K02A 3RYRA 1FLIA 3LAJA 4LMYA 1K6OA 1MZBA 2MBFA 1K78A 3RYPA 2HYFA 3FMRA 4RS8A 4ASNA 5IT9Z 1HXDA 3CTAA 3BDDA 5E8IA 3WGGA 1CF7A 3T5XA 4OIQF 3IHUA 2HWVA 4L9TA 1U5TC 1YO5C 2QQBA 3WE2A 2FU4A 4IPAA 3QU3A 5ED4A 3CUOA 3H3ZA 4L9JA 5L3GA 4RGRA 2QLZA 1S7AA 1EV7A 2EJRA 4M73A 3SHFA 3JW4A 1F5TA 3DKWA 1WSUA 1IN6A 5BS6A 1KQ0A 4L18B 5LRSA 3BJOA 4HYEA 3GFJA 1PDNC 1P2FA 1A04A 3M1EA 2H27A 1JXSA 2FE3A 5LEKA 3WTZA 1BI3A 4U7BA 1V4RA 5DDGA 5HS8A 1MDMA 1I1SA 5D8KB 3P9KA 5D4SA 2K86A 5D6FA 2HDCA 1S6LA 4AVPA 3WTTC 1ZAOA 4ZH4F 1Z6RA 1R23A 2CQKA 3BOQA 2YX7A 4L0ZB 2GAUA 2VN2A 2KKOA 4WWCA 5AIPA 1ZGJA 2V6CA 1U6GA 1BJAA 3ZN1A 2QBYA 2JZYA 1BI0A 3ERED 3F8CA 2Y75A 1C0WA 3VB2A 2PG4A 1IXSB 1DDNA 3WGIA 1P6RA 3M9AA 2O8XA 2RDPA 3HSRA 4LLNA 1TLHB 1DP7P 3RDIA 2EFQA 1HKQA 1TW3A 3F8NA 3FMSA 4A12A 4O5VA 5E20A 4EM2A 1Z05A 2G7HA 2DI3A 4KNYA 2VOOA 4Q4ZF 3J80K 1IZ1A 2FRHA 4KMFA 2FA5A 2L4MA 3ZN0A 4UVAA 5ICEA 3QRFF 2OBPA 3KFWX 3GX4X 2KIMA 1FWZA 2JT1A 4XSXF 1BBYA 4QWQA 5CVIA 4KICA 5FD5A 2RV8A 1XDUA 2FBIA 1U78A 2E1NA 1IW7F 1ZH5A 4EQQA 1REPC 1HQCA 1FNNA 2DLLA 3LWFA 2FOKA 2ELHA 1SD7A 2ISZA 4KN7X 4HDUA 3PQJA 4I2OA 3HUGA 1OMIA 5KK1A 4UVCA 1R22A 1SD5A 4ESFA 4JBAA 4ESBA 4WX9A 3WE3A 4RB1A 2MD5A 4KUMA 1XGSA 4L5JA 2QBYB 5K5OA 4BXUA 4LLGF 5DUKA 2L01A 3JSOA 4LFUA 3K9TA 3PQKA 2FXAA 1HKSA 2DQLA 2QM3A 3L09A 3NQOA 4M9ZA 2F5DA 4CICA 4UHTA 1FOKA 1H9GA 2C6YA 3WTWC 1R1VA 2BGCA 2OD5A 1Q1HA 2HOEA 2STWA 4LJZF 3WG9A 1GXQA 1AOYA 2LKPA 5BMZA 3D5LA 1KU2A 3KP7A 4ZYHA 4RB2C 3K1PA 5DCMB 2YU3A 3FM3A 2XRNA 4I09A 4XLPF 2ZJ2A 1FP2A 2EB7A 3I4PA 3KP5A 5E8GA 3LA2A 3QPHA 2MH9A 4XLNF 3QP5A 1MKMA 2JRTA 2WC2A 2PJPA 1YW7A 4HF2A 4MTEA 3R61A 2J5OA 3F21A 1KU7A 3QPTA 4A0XA 4A6EA 2XV4S 2G7UA 4I98B 3DQVC 4KA4A 1BIBA 1ZRFA 3SFZA 4DQ2A 2X4HA 2QQAA 3T8RA 2K4BA 2B0LA 1XGOA 1OYIA 5ILUA 3GYHX 3HRTA 1QBJA 2YPRA 4ETSA 2VC0A 3CLOA 1WWXA 1XD7A 5D4RA 5K5RA 2HS5A 1JE8A 4PGHA 4IHSA 2L02A 4BNCA 4MQ9F 4D0PA 1XGNA 5FLXK 2FMYA 4N9HA 2IA2A 4MEYF 3D0SA 1H9TA 3WU1B 4OIPF 1IXCA 3WODF 1WQ2A 1MJBA 2XIGA 2FSWA 2GA1A 1W7PA 5DD4A 4GO1A 1O57A 4GYIA 2A69F 1R58A 3GUDA 3IC7A 3KZZA 2L54A 3CDHA 2EA4A 2YR2A 3HIFA 1UCRA 2NAZA 2IW5A 3F23A 2P8TA 1B9MA 4CZZA 1S3JA 5K1YA 2GZWA 2TDXA 4BAYA 2PFBA 1E17A 2QENA 4HAMA 1ULYA 4M71A 5A2QZ 5HDKA 2DK8A 3WTYC 1KA8A 2IRFG 2FNAA 1YW8A 3EYIA 2R7DA 1ZYRF 3HYIA 2XAGA 1ZHFA 1D5VA 1ON1A 5FB2A 4GXOA 2STTA 2G9WA 2ESNA 2NNYA 3B73A 3RKYA 3V8LA 2VC1A 2OU2A 1WI9A 3VEPA 2D1HA 4EMSA 5JI6A 1MGTA 3MCZA 4G8XA 4ZZDA 4M74A 2M8EA 4A5NA 2GXGA 1F4KA 4EM1A 2KIUA 1JHHA 2Z3YA 3I0TA 4U0YA 1G3YA 3IRRA 1BC7C 3HHHA 5EEHA 4F7ZA 2DK5A 4CGZA 2D2WA 4ON0A 1XSVA 4Y17A 1Y0UA 1HW2A 5E1ZB 2F5FA 3WU0A 1UHMA 2IVMA 3RPQA 1FBSA 1BIAA 1IRFA 1IXRC 2K27A 4BHBA 4YFXF 2EFOA 4BQAA 5D5VB 2PLYA 2FMLA 3BZ6A 5EEGA 2ZNYA 2LDUA 4A2UA 4KYWA 2QYOA 3B02A 5L3DA 3V7CA 1CGPA 1B9NA 4H0EA 2Z5UA 2DU9A 4I0BA 3BP8A 2O61A 2EV6A 4OINF 2Z33A 4YG2F 4G6DA 3EDPA 4CYDA 1DPRA 4HF1A 4IHTA 2RQPA 2EV0A 2W84A 1J2XA 2F5CA 2V1UA 3SXYA 4B8XA 3ZMUA 3BJAA 2MLKA 4E70A 3I64A 4G7ZF 5HS7A 1U5TB 2QZ8A 2W57A 4RGSA 4IRHA 3TQNA 4PCQA 1ZN2A 3F6OA 3ABUA 3I59B 4WXCA 2VODA 1STZA 3DPTA 3EETA 3GVAA 1KQ9A 1PP8F 4WK8F 5IT9K 3L00A 5JHUA 1LVAA 1ZG1A 1U8RA 1FBUA 3LQRA 3HRUA 3HSEA 1OPCA 4KFCA 2CG4A 3V8KA 3BJ6A 3MQ0A 3MZYA 5H20A 2L3DA 2L4AA 4LGWA 4EV0A 2ZMEB 4RGUA 1XMKA 3SQNA 1Z6TA 1L3LA 1W7PD 2VT2A 3IRQA 2ISYA 2Y0MA 4ENMA 1TQMA 4UVBA 3REOA 2M87A 2Z9OA 1UHWA 1L0OC 3ECHA 4S05A 2W24A 2E7XA 5JFRA 2H6BA 2MLGA 5DV5A 3F8BA 1KU9A 4R1HA 2ZBKA 3Q9VA 1G3SA 5L3CA 1YQAA 5BOXA 2IP2A 4KN4X 2V1DA 3BY6A 2M30A 2XAFA 2KRFA 1TQIA 4KIGA 1O7LA 3ZP5A 3KP2A 4OU0A 5D5WB 3R4KA 1KQ8A 4UNOA 2ZFWA 3COAC 1D8KA 4R79A 1TNSA 4IJAA 1BC8C 4AD9A 4YFKF 1TBXA 2XUBA 5LHGA 1ZGAA 4ZYEA 2X0LA 2XHKA 3ZMTA 3K1NA 4FT8A 4MHGA 3E5XA 5D5UB 3F22A 4P5OA 2M45A 2Z99A 3R6SA 2KJCA 4UUVA 2HEOA 3FZVA 3V8JA 3KEQA 3DPLC 1YS6A 1SFEA 5DCMA 5ILSA 5LGUA 4B09A 5DYMA 3IKTA 2QWWA 1I27A 3HRSA 1DPUA 4A0YA 1ON2A 3I71A 1LEAA 3RIRA 4HLXA 1NHAA 3GF2A 3J80Z 2EV5A 4HV5A 5FFXA 1XMAA 4A6DA 1LDDA 3IKVA 2HZTA 1QQIA 5L3EA 3V7RA 4N9IA 4K2EA 2HQNA 2XGXA 3F72A 1I5ZA 4BHCA 3KE2A 2E7WA 4BH9A 2VXZA 1FYKA 2D1VA 2XKPA 3JAMK 2V1XA 3CO6C 3TDUC 2Q8KA 2A6HF 2PBIA 1SAXA 2EFPA 5KVRA 2IA1A 2LF8A 4OOIA 2VOPA 3IL2A 1UB9A 3R0JA 4GYGA 5JR3A 3R0AA 5CVRA 2OQGA 3E6DA 3K1MA 3KEOA 1T6SA 1EH6A 3AAFA 5LGTA 5HLIA 1RZ4A 2YX4A 4HX4A 5E1WA 3J81K 4M6XA 2V79A 3V4GA 1QO0D 4ZZLA 3N4MA 4UV8A 1QGPA 2IA0A 4AIJA 3WGHA 2PEXA 1T2KA 1FYLA 1J75A 5L3BA 3IWFA 1IF1A 2P6SA 3E6CC 1MJ9A 1FSHA 2DAOA 4PZJA 5LGNA 2RKHA 3JTHA 3PFIA 5TRDA 2LF7A 2O0YA 4YIIA 1FC3A 4G6QA 4RAZA 2UZKA 2ACJA 1P4XA 4HQMA 1I6XA 2VT3A 5LLQA 4EJUA 4YIFA 2HYGD 4CXFA 1BI2A 5BPIA 4KMUX 2COMA 2A61A 2Y48A 2UXNA 2ZKZA 1T0FA 4AIKA 4EM0B 2VBYA 4Q47A 2M5WA 4WXDA 1R00A 3K69A 2JPCA 1YIOA 3VFZA 1T38A 1X3UA 1JGSA 3Q9SA 3QP6A 2JTVA 1OYYA 1SMTA 5AONA 1ZG5A 3C1DA 3C7JA 4XSZF 2ZNZA 5FLXZ 2P5VA 2AXLA 2XAJA 1J9IA 2WV0A 3GO5A 3G73A 4EJWA 4TV7A 3KETA 1R1TA 2CO5A 2JSCA 4EGZA 2CGPA 4L0YB 3RTRA 3ML6A 5JVTA 5CJ9A 3GEZA 4HX8A 2HTJA 2K4JA 2ESHA 2DT5A 2DPUA 5J8CA 4LD5A 2RVCA 2RNJA 2MA3A 4GCVA 3I53A 3GWZA 1U5TA 5A2QK 3GFMA 3T0YA 3EYYA 1RI7A 1HSJA 5D6EA 4A0ZA 4PGGA 1UFMA 3I59A 4G94A 2VBXA 3NEUA 4XBFA 2FBHA 2BE5F 4G9YA 2BYVE 3TOAA 3E6BA 3I54A 3K2ZA 3T1BA 1OKRA 2OZ6A 3W6KB 1LJ9A 2HR3A 1BM9A 2W85A 2DPDA 2PN6A 3GFLA 1JHFA 1KYWA 3FXUA 1YS7A 3C18A 4CO8A 4RGXA 2P6TA 3V7SA 3FM5A 1W4MA 4P55A 5J8FA 1F9NA 5BPDA 2A68F 1ZREA 2ZMEA 3FX3A 4HW0A 1R5HA 4KDPA 2H6CA 3ABTA 4OIRF 2LNBA 3EQLF 4I7HA 4IXAA 2W25A 1S7OA 1RIOH 4EVIA 2FQ3A 5HOOA 4MEXF 4U88A 2KJBA 5F6FA 2HGCA 5DEQA 5FD6A 3DP7A 3L2CA 4L5IA 2ZXJA 3WTVC 1YLFA 4KIBA 4CHUA 3FWEA 4P96A 3OOPA 1USSA 2GQQA 3CUQB 4IRIA 2BBYA 3HOTA 1S8NA 6PAXA 3GXOA 4JQFA 2HTSA 1QZYA 3KP6A 4U0WA 3HRMA 1B6AA 3KP4A 5BQTA 2P4WA 4A5MA 1IN8A 5AIQA 1O3TA 2HFHA
chains in the Genus database with same CATH superfamily
4M3FA 5IT3A 4EJTA 3K4MA 1FIAA 3J7AY 1EH7A 3F8FA 3NWTA 5HLHA 1YW9A 2LC2A 1QHGA 2EWNA 2LSOA 1GUUA 3CUQC 1VTNC 1B8IB 2CFXA 2DTRA 1X2MA 4PSWA 1E2XA 1SMYF 3E3VA 1BN5A 3QU6A 4XLFA 3DV8A 1D8JA 2MC3A 4Q5SF 2P5LC 3CC7I 1IUFA 4PFOA 3BWGA 4YFNF 3TOBA 2MGQA 2ADUA 1YHQI 5FGMA 4B1RA 4Y13A 2GOMA 3ZQIA 2PMHA 3P9CA 1ERDA 2K5CA 3CDLA 2UUZA 1RESA 1WJAA 2EA2A 2R7FA 3I5UA 3G1MA 4A3JJ 2L9NA 2LFBA 2DFEA 3SZTA 4I01A 5TJJA 1T08B 3HBLA 2LVSA 4AWXB 3QOPA 5ICGA 2Y2ZA 3JCUC 2XPVA 1GXPA 4B48A 2DOEA 4OWRB 4W97A 2TCTA 2EIJH 2LK2A 2PMUA 3FXKA 4HF0A 4UB8C 1TC3C 3HOZJ 3O3KA 4P9UA 1X1PA 2YS9A 3H9GA 1SFUA 3DFGA 1W5CC 4YRVA 2CQNA 3K70D 4II2A 1KU3A 5TGTA 1X4OA 3OYCA 3BR1A 5F1JA 1RC9A 5FKNA 2M1BA 2RGVA 4LB5A 3G4SI 3DEUA 2NOJB 3BG9A 1K4TA 1R1UA 5C44J 2QQ9A 5E18F 4PSXA 1PUFA 4DIQA 3DU5A 5J4VA 4ZTJA 3OIOA 3H5RA 2ETHA 4M6YA 3GFIA 4RB0A 3GLXA 1ZLKA 2MSYA 1VQ8I 1OCOH 1J7KA 2VPLA 2WWYA 2ECCA 3L9FA 1LEBA 1X1DA 2QUFA 1AKHB 3HDDA 4MFEA 3OY9A 2HYJA 1R6RA 1H8AC 3E5UA 4U7DA 1ITYA 4ITVA 2YSRA 1IC8A 1SFXA 1FMVA 2ZC2A 3G71I 2VKVA 1BA5A 1G8XA 2EFNA 3W3CA 2MD0A 3TO6A 1O3QA 3A4CA 2EBIA 2DQRA 3U9GA 3E6MA 4NQWA 2R92J 1ZR4A 4GDFA 4F52A 2LOOA 3ISPA 1XCBA 4RAFA 1MD0A 2KRCA 1FYMA 1XB4A 3ONQA 3U21A 1WHUA 3S2HJ 1YTYA 1VQNI 3GZNB 1OYWA 2QKMB 4XIDA 3HOSA 1K79A 3H3UA 1OR7C 3FMQA 1WJDA 3LSRA 2FEZA 3CCLI 3KP3A 4R8HA 5CYVA 1IAWA 4C2MJ 4NB5A 4BEHA 2IXSA 1J59A 1LQ1A 2H94A 2GIVA 3DLAA 1GHCA 4OMYA 2M0CA 2WTEA 1RNLA 4XRSG 2KIFA 2ZO4A 2DDAA 2F5EA 2K9NA 4DYCA 1ZRCA 1B59A 4ZJZA 4HNTA 1R4NB 2CYYA 3F6VA 2O6GE 3GW2A 5L3FA 2P7CB 4BU2A 1QZZA 4XN3A 1B4AA 5F0CA 1SVOA 5FROA 5CPRB 3MEXA 2R5YA 2E1CA 1TQPA 2DMTA 3J7ZI 2JUGA 3O2PE 4E7JA 3RI4A 3G2BA 2BEOA 5CVUA 1FMWA 2OC6A 3I9V2 3CJNA 3BQYA 3DF8A 3NAUA 1SEUA 2JPBA 2DA5A 5IYDJ 2CQQA 3KZYA 1MH4A 2CQXA 4HOBA 4Y3OA 3BZCA 2P0WA 3G6EI 5IP6A 2A07F 4MQVA 3D1NI 3RJPA 2UWMA 5FFZA 2RNGA 3U1DA 1W36C 2A3SA 1G4DA 4PDKA 1MMNA 1Y56A 3TO7A 4RAYA 3HL2A 2DMPA 1HC8A 1RUOA 2LG4A 2IGNA 1WJFA 3C2HA 4DNCA 5H6QA 1ZARA 1D3YA 1Z7UA 2ME6A 4BHPA 2R7ZJ 1K78B 3MZHA 3WTUC 2BOLA 1GDTA 2XF6A 2BV6A 3ERMA 2L7ZA 2XVCA 3BG3A 4EJOA 1XC5A 2O9LA 4V2GA 3KLNA 2VE8A 2OZUA 1R5ID 2EK5A 3ZMVA 3MKZA 1SD6A 3G3ZA 3RQ4A 2OQRA 5M5YJ 2VJIA 3GCMA 2A6EF 3KEYA 1CF7B 1GV2A 4WF2A 3WHCA 2KMUA 5J3LA 2XAQA 3L2WA 2ZCWA 1FOYA 4HLYA 3ELKA 5KHDA 3ZQLA 1X4PA 2VBWA 3DU6A 4IHWA 3FDYA 1XTAA 1P92A 3L2RA 1TNTA 2BVMA 2VBZA 4UV9A 1O3RA 1KGSA 3ZMDA 4J00A 1LKXA 3HB9A 2CSOA 4O3MA 5LBQA 2DA6A 1XSXA 3KYCB 1MSFC 2XROA 1BL0A 4LB6B 2DO7A 3KX2A 4I76A 2MH2A 4RLQA 4FX4A 1G6NA 2QVOA 2NS0A 4RB3C 1B1BA 1FOWA 3MFKA 3ZPLA 5K5QA 2AXTC 3C2BA 2QEXI 3FXOA 3QYEA 3KZIC 5EZGA 3CCJI 1WZ2A 4MNUA 1FX7A 1QPMA 4XR6A 4AUXA 5D8LB 4XONA 5DTDA 2FF4A 2MW8A 4O6JA 2K9QA 5CVJA 3S32A 1R7JA 3IP4B 3CCRI 5EGOB 5DUIA 3F3XA 4A93J 1FZPB 5IYCJ 4XNFA 4LG0A 1ODDA 4D7NA 3IH3A 2GXBA 2ID6A 3BC8A 4UUSA 1LDKB 1DUXC 1WH7A 1Z3YA 2RAEA 2E35A 1IN7A 2W7NA 3PNYA 4HZFA 2ICWG 3JAMZ 2OUMA 1BI1A 4OIOF 4M9SA 1MDMB 4ENKA 1WRJA 3FF5A 4X6AJ 2XASA 3WU2C 3KLOA 3P7NA 4ZYGA 3K2AA 3BPVA 3K4KA 4DZPA 1VF9A 3OYKA 4A3MJ 2NVTJ 1X58A 5CVVA 4X1EA 5J1YA 4QLCU 1Z9CA 4EJVA 1G3WA 4ENJA 1O3SA 2DW4A 3C3WA 2EILH 5B1BH 2HVQA 4G7HF 2AS5F 1AWCA 3J7AO 1X1AA 5E17F 3RKWA 4M72A 3S93A 5F0HA 1R36A 3JRBA 3BR5A 2H09A 1YJNI 3OSGA 1V5EA 4LIUA 3R60A 2V9VA 1YG2A 5D5XB 2X6XA 2FBKA 4GRIA 1K7AA 1V3FA 2XAHA 4NHJA 3LFUA 3HC7A 5F0FA 3E1SA 2R7QA 4II3A 4JYKA 5DD8A 4FASD 4Z6YA 1IGNA 2LR8A 3PIOF 5M5XJ 1P4WA 2DYSH 3I58A 4UY8I 3TKYA 3SEZA 3GTQJ 2HKOA 2L7MP 4IVNA 3TO9A 4CSWA 1A6IA 3H92A 3TL4X 3GZ6A 1XGMA 1LNWA 5GAGJ 1WVRA 1PJRA 2M7AA 2AO9A 3H0GJ 4MGRA 1O4XA 1F1ZA 1APLC 2JA6J 1POGA 4BJ6C 5J6XA 3ZQ7A 1SD4A 4KIFA 4UB6C 1P7IA 2I8DA 3DBLB 3J81Z 2E36A 3I4NJ 2QSHX 1MJAA 5HNFA 2NNNA 1K6YA 3VYUB 4BYYA 1IJWC 4C2UA 1MW7A 3TDZC 3KYLA 2EZHA 2D45A 2OA4A 4PUSA 1XCVA 2GBYA 3LAPA 4AC0A 2IEKA 1ORKA 2A5YB 2M34A 5HVQC 2XGEA 4U0VA 2EFWA 3NRVA 2E71A 2XB0X 9ANTA 1FPQA 3VODA 1PUEE 2GA2A 1QNTA 3PL8A 1HSTA 3DTIA 1Y1WJ 2YUSA 2E2JJ 2DFIA 3RPUA 1D5YA 3SZPA 3IWZA 2R3SA 3CP8A 5LEJA 2V6EA 1Z1DA 3HM5A 2X6WA 1S7EA 2LH9A 1YYVA 5DCFA 3MMYB 1TL8A 3DEEA 4XRFA 2WAQA 4HBLA 4IRGA 5TISC 1IG7A 3FXQA 3RZDJ 1U3EM 1LB2A 4CCJA 1BJZA 3S1MJ 1KZHA 2HQRA 3OV8A 4F55A 1FP1D 3HOWJ 1JJ6C 5M3FJ 1IRGA 3QAHA 3O8HA 1J0RA 2ZJPF 4LG0B 2F4OB 3K0LA 4D5FA 1HW5A 3CCYA 2M9HA 2NYXA 4IHXA 4GGGA 4M9XA 4HX7A 1RUNA 1HOMA 3Q0UA 3TGNA 3T8TA 3M8FA 2KHMA 5H6RA 1XSDA 2JJ7A 3JRDA 5HLTA 2LYCA 3LQQA 1S9HA 3BR3A 3BR6A 2CWEA 3GTMJ 1QVTA 4Z2YA 1KYZA 4I0AA 3N97A 2Q2EA 4A3GJ 4JX4A 4ZTFA 2J5PA 1T39A 3CUQA 2BXYA 5F64A 3S2WA 3U1KA 4B4CA 3O6BB 3RSNA 4FHTA 4IL6C 5FRNA 2RN7A 3HSFA 4C30A 3OYNA 2H1KA 3BG5A 2DMUA 4HQEA 3CF2A 3OIPA 3E7LA 3VOEA 4P1WA 3OYLA 3S2DJ 2BW3A 3EUHA 2O3FA 4XOPA 1VNDA 1R5GA 3MKWB 4N0BA 5ERIA 4HDVA 5LHIA 2GWRA 1FSEA 1IDYA 3CC4I 2DBBA 3HPGA 2O7OA 3M8EA 3LFKA 5GPCA 3LA7A 1VQ5I 1MBEA 4N4OB 2PQ8A 4BACA 4BDYA 3JTGA 1ZR2A 1FIPA 2Y69H 3IAS2 3TMOA 3TBIA 2V9PA 1T98A 4ZDOA 2XSDC 2DA7A 2DA2A 1NK3P 1B8IA 5F04A 2JUCA 2FUG2 2VJ4A 3SYTA 2VE9A 4LK0F 4OMZA 3FHNA 2CW8A 3FXRA 3ZMSA 4L9VA 4I02A 1BW5A 1HDDC 1LDJA 2DOFA 3CLQA 1PP7U 4MIMA 2IT0A 1S29A 2IPQX 1XN7A 2K40A 3M4OJ 1OCCH 4WXHA 1AA7A 3HTSB 3DEWA 3U2RA 4LOCA 5M3MJ 2IS4A 1W5TA 1J5YA 2HXIA 4HA8A 4PJNA 4BXFA 4LLLA 2ZJQF 1FY7A 1IN4A 1X1CA 1TW2A 1X3ZB 1YFHA 1ACIA 3P9IA 3WG7H 2NRAC 1SFOJ 1RKWA 2UXXA 4IF4A 5DM6F 5FJ8J 3HTUA 3A02A 2NXNB 5ICFA 1IN5A 1ZLJA 3ROUA 4JK1X 1O7FA 3E5QA 2Z1DA 3MAJA 4Q48A 4IQ4A 2F2EA 3JSPA 2IJLA 4PFPA 4AIHA 1FBQA 3GTKJ 3ZMZA 4Y33A 4LK1F 5E1XA 2CUJA 4G7OF 5HLGA 5HDNA 4ESJA 2CMPA 2P5KA 3ECOA 5CLSA 4HV6A 2OAZA 5GTHC 3GZ5A 3FHZA 2PI0A 2RC4A 1QU3A 3KCCA 2KZGA 1ETXA 4ZYDA 1U2WA 3DKXA 4H4KC 1Z91A 4L9NA 3LA3A 3PJRA 1OR7A 1I6HJ 1GVJA 2HXOA 2L7KA 3LSTA 5CKTA 4LIVA 1AKHA 5ILVA 1HW1A 5GAHJ 1W5SA 3F8MA 1HBXG 2E1MC 2Y31A 2EINH 2KL4A 1ETKA 4Y7NJ 1QA6A 1BOAA 1Y6IA 1WKMA 3MWMA 4J19A 4M3EA 4HPQA 4X0GA 1Z77A 2HPMA 3WTSC 1FTTA 3WTXC 2VPRA 4CDGA 4FE7A 4OAZA 2HZDA 2PJRB 1ONVA 4FQGA 3DXJF 1G3TA 3E97A 5J1RA 3M7GA 3L7WA 4HNUA 1P4AA 1TT5B 4WCGA 3RKXA 2FNPA 4FX0A 2E2HJ 2BVLA 3G1OA 1I1GA 4EGYA 3Q5FA 2DMQA 1FT9A 2CUEA 2BW3B 3DTEA 1W7PB 4UXNA 4Y4RA 2P7VB 5HDGA 5HS9A 2W48A 4RM3A 3BTLA 3OWTA 3GTGJ 1MBFA 2K7LA 3HHGA 5F1RA 2CJJA 3W6JB 3FBIB 2CW0F 1K4SA 1EH8A 1SC7A 5ICCA 2WAEA 4NUBA 1T0FC 1XDSA 5LHHA 2O03A 1ZRDA 2DXIA 1IUYA 3MKYB 1BW6A 1TTYA 2VKEA 4P9FA 4MTDA 1QPIA 1HKTA 2XKOA 1USTA 4BQOA 1H0MA 2DODA 1ENHA 3DBHB 4EATA 4KT5C 5LRRA 3RPUD 2DFHA 1TWCJ 1Z67A 4A3IJ 4S04A 2Q0OA 3BPXA 3ESWB 5K7HA 3OS1A 5KAIC 2HKXA 3CCSI 4ENNA 3GTPJ 1ZG3A 4Y15A 3BROA 3ULQB 2VONA 1SVMA 4XLCA 3CO7C 1T95A 5FO5A 2K02A 2R93J 3RYRA 1NG7A 1J09A 1FLIA 2R5ZA 3LAJA 4LMYA 1YI2I 1D1CA 1PVEA 2HI3A 5E3NA 1K6OA 2FQ4A 2R7VA 1VQ7I 1MZBA 1UELB 3JRFA 4E7IA 2ZSHB 2MBFA 4BXXJ 3K4LA 1K78A 4XL9A 2BY2A 3TP0A 3RYPA 2HYFA 3IV5A 3PFYA 3FMRA 4C9YA 3CCUI 4RS8A 4A3BJ 2JN6A 4ASNA 5IT9Z 3VDXA 1HXDA 3CTAA 3BDDA 2DJNA 5E8IA 3WGGA 1CF7A 3W2WA 3T5XA 3ZQHA 3EUAA 5EYRA 4OIQF 2VB6A 3IHUA 2HWVA 4L9TA 1D1BA 1U5TC 2FD5A 2B9SA 1MBGA 3OYAA 1YO5C 1VQ9I 2QQBA 3WE2A 2FU4A 4IPAA 3QU3A 3VSLA 1S72I 5ED4A 1TP4A 3CUOA 3K10A 3H3ZA 4L9JA 5L3GA 4RGRA 2QLZA 2AQFA 1Z21A 1S7AA 1EV7A 1OJLA 2ELJA 2EJRA 1N78A 5H2FC 1FJLA 4M73A 3SHFA 3JW4A 1F5TA 3HXLA 3DKWA 1WSUA 1IN6A 5BS6A 1KQ0A 2Z2SB 4L18B 3BG6A 5LRSA 5EGOA 3BJOA 3CJRB 4B3AA 5E3MA 4HYEA 3GFJA 3CP2A 1P2FA 1PDNC 3K4JA 1A04A 1A6QA 5K7FA 3M1EA 2H27A 1JXSA 1TT0A 2FE3A 5LEKA 4I99C 3WTZA 1JGGA 1BI3A 4U7BA 1V4RA 2XPUA 5DDGA 2X1DA 1D1AA 2MYSA 2CV1A 2W4SA 3E0JB 2GM4A 4KITB 2VQGA 3MZ8A 3QODA 3CMEI 5HS8A 4C2TA 1MDMA 1JI8A 1I1SA 4QSHA 5HNHA 2F6CA 3HOXJ 5M5WJ 5D8KB 3P9KA 1Y39A 1FTZA 3I3LA 5D4SA 2K86A 1VQMI 5D6FA 1EF4A 2TRTA 2HDCA 1S6LA 2XRLA 4AVPA 3WTTC 1ZAOA 4ZH4F 4YIRX 3FK7A 1Z6RA 1R23A 2CQKA 2XGDA 1SFKA 3BOQA 3B6AA 2P81A 1FOXA 1ZGWA 5E3OA 3CESA 3DKYA 2YX7A 5CQGA 4L0ZB 1N25A 1QHHD 2GAUA 2VN2A 2KKOA 4AU7A 4WWCA 1ETYA 1ZGJA 5AIPA 2V6CA 1LFPA 5K7ZA 1U6GA 1DGWY 2KISA 1WJBA 2XF7A 3GTJJ 1BJAA 2F48A 3ZN1A 2QBYA 2JZYA 1BI0A 3ERED 3CCEI 3F8CA 2Y75A 1C0WA 3VB2A 2PG4A 2IS2A 2CS3A 1IXSB 2R5ZB 4RLFA 1DDNA 3WGIA 1P6RA 4HRIA 3M9AA 4XM3A 3HGGA 2O8XA 3IAM2 5HODA 2A5WA 2RDPA 4D9JA 3HSRA 2DT7B 4LLNA 1WH5A 1TLHB 1DP7P 1MIJA 3RDIA 2EFQA 1HKQA 2QCOA 4FCYA 3DLLF 1TW3A 3F8NA 4NNJA 5FKMA 3FMSA 4A12A 4O5VA 2EZIA 4RM2A 2OJED 1Z05A 2G7HA 5E20A 4EM2A 5IP9J 3TEDA 2DI3A 1P7JA 4UUTA 1EJ9A 3CF5F 4KNYA 2ME0A 2VOOA 4XLEA 4Q4ZF 1P9QC 3QYFA 3J80K 1IZ1A 1M1EB 2FRHA 4KMFA 2FA5A 4PJJA 3OYHA 3ZQFA 2L4MA 3ZN0A 2JSPA 4UVAA 5E3LA 5ICEA 3L2UA 3QRFF 3TW6A 3H0DA 2OBPA 3AG4H 3KFWX 1ETWA 2X9DA 3GX4X 2KIMA 1FWZA 1F36A 2JT1A 4XSXF 1BBYA 3AG3H 2E34A 4QWQA 5CVIA 3LOCA 4D5CA 4KICA 3VYRB 5FD5A 2RV8A 4FISA 2E5NA 1XDUA 2X6YA 3BG7A 4RBOA 2Y0SN 2I5UA 1MMSA 1MSEC 2FBIA 1U78A 3JR9A 4BQNA 3A0HC 2E1NA 3SDBA 3K4CA 5C4JJ 1W36D 1IW7F 1ZH5A 1VI0A 4EQQA 3OYMA 1REPC 2V7FA 1OCZH 1HQCA 1FNNA 4IEJA 2QSGX 2W00A 2DA3A 2DLLA 1EKEA 1T33A 1X3WB 3LWFA 5EZHA 3GTOJ 4E7ZA 5GPAA 2FOKA 1ZK8A 2LKSA 3ZXSA 1E0EA 1I39A 1OCTC 2ELHA 2UV1A 1SD7A 2ISZA 5F27A 4KN7X 2KPMA 2M4KA 4HDUA 2YU9J 3PQJA 4A3EJ 2LD5A 4I2OA 1D0XA 4CYCA 3HUGA 1OMIA 5KK1A 4UVCA 1R22A 1SD5A 4ESFA 2R7WA 4ZDLA 1JUPA 2Y0SA 2IAIA 5B3SH 4JBAA 4M6VA 4F92B 3ZCOA 3S3OA 1U9NA 3DBRB 4ESBA 4WX9A 5FRMA 3FXLA 3WE3A 4RB1A 3PO3J 1E3HA 2MD5A 1XGSA 4KUMA 4L5JA 1TZLA 2QBYB 1YITI 5K5OA 4BXUA 4DYQA 4LLGF 5DUKA 3ZOBA 2L01A 2R7RA 3VYTB 3IUOA 5EG0A 2XC7A 3JSOA 1IV6A 3S1QJ 4LFUA 3K9TA 3PQKA 3MN2A 2FXAA 1U8BA 1HKSA 2DQLA 2QM3A 3L09A 3NQOA 4M9ZA 2F5DA 2KQRA 4RAGA 4CICA 3PIPF 4UHTA 1A31A 1H9GA 1FOKA 2C6YA 3WTWC 1R1VA 2BGCA 4BKXA 4XN0A 2OD5A 1Q1HA 3OYJA 2XPWA 2HOEA 2STWA 2E2IJ 4LJZF 1NTCA 3WG9A 1GXQA 1BR4A 1AOYA 4DJAA 3BTIA 4CCNA 4HSRA 2WY7Q 3OL3A 2LKPA 3HEFA 5BMZA 4XKWA 1JUSA 3D5LA 1YX3A 3RKQA 1D0YA 3H36A 1KU2A 3KP7A 4AYBN 4ZYHA 3PSFA 4RB2C 3K1PA 5DCMB 3JRCA 2YU3A 3CC2I 3FM3A 2XRNA 4I09A 4XLPF 2ZJ2A 2ZFUA 1FP2A 2EB7A 2OCEA 2HVRA 3N05A 2XSJC 3I4PA 4PK4A 2LLKA 3KP5A 5E8GA 1YRNB 3GLLA 3LA2A 1ZELA 5C4XJ 3QPHA 2MH9A 4XLNF 3QP5A 4KT6A 4ZYAA 1MKMA 2JRTA 2WC2A 2PJPA 2ZSIB 1YW7A 4HF2A 3A01B 5GP9A 4MTEA 3R61A 2QGUA 3K4BA 2O5RA 2J5OA 3F21A 3CDIA 1KU7A 2A05A 3QPTA 4A0XA 4A6EA 3UKGA 4IQJA 1RR8C 2XV4S 2G7UA 2D5VA 2HOAA 3DQVC 4I98B 4KA4A 1BIBA 1JUMA 4XICA 2L9VA 1ZRFA 1OCRH 3SFZA 4DQ2A 4BBSJ 2X4HA 2QQAA 3T8RA 2NVQJ 3PUBA 2K4BA 2B0LA 3Q0VA 2EIMH 1XGOA 1OYIA 5ILUA 3GYHX 3HRTA 3OL4A 3JRHA 1QBJA 4AYBA 2DFFA 2YPRA 4A3DJ 4ETSA 2VC0A 3CLOA 2DA4A 1WWXA 1XD7A 4ABZA 3BTJA 3UR3C 2EH3A 2PMZN 5D4RA 2OTJI 5K5RA 3DTKA 1VQLI 2HS5A 1JE8A 4PGHA 4IHSA 2VKDA 2L02A 4BNCA 4MQ9F 4D0PA 4HSTA 2LY1A 4CYCB 3I56I 3HUGB 1XGNA 2XB5A 2PJRA 2JA5J 3S14J 1UAAA 5FLXK 2FMYA 5EF6A 3K6GA 4N9HA 3BQZA 2IA2A 4MEYF 3D0SA 3LSKA 1H9TA 3WU1B 4OIPF 1IXCA 3WODF 1WQ2A 1MJBA 3B6CA 4V2FA 5B5EC 1Q1VA 2XIGA 2FSWA 3UNGC 1H89C 2EIKH 3PNVA 3BZKA 2GA1A 2HNHA 1W7PA 3C2GA 4C3JJ 2NS7A 4RMNA 5DD4A 4GO1A 1I3QJ 1O57A 4GYIA 2A69F 4CCLA 1F43A 1R58A 3GUDA 5EG0B 3IC7A 2CQ7A 3KZZA 1NG6A 5IOZA 2L54A 3CDHA 2EA4A 2YR2A 3HIFA 3S15J 1UCRA 2NAZA 2WB1N 2MABA 1E3OC 4BUPA 2IW5A 3F23A 2R7SA 2PMZA 2P8TA 4DOZA 1WI3A 1YE9A 4QPOA 4BDZA 3JRIA 1B9MA 3W6VA 4RA2A 4CZZA 1S3JA 2VLAA 3CCMI 2QQ8A 5K1YA 2GZWA 2TDXA 4BAYA 5KCMA 1XS9A 4ZC3A 2PFBA 1E17A 2QENA 4HAMA 1ULYA 1TWFJ 4M71A 5F08A 5A2QZ 4DBRA 2JA7J 5HDKA 2DK8A 2X1CA 3S8PA 3WTYC 3GMEA 2BY1A 1KA8A 4V19K 2IRFG 3ZGKA 2FNAA 4B43A 1YW8A 3EYIA 5LD2C 4F93B 2R7DA 2Y9ZA 2I10A 2LREA 1ZYRF 2COBA 3RZOJ 1B72B 3HYIA 3LSJA 3P5JA 2E1MB 5J40A 2XAGA 1ZHFA 3L2VA 1TWAJ 5FKKA 1D5VA 1ON1A 4M3GA 2DMNA 5FB2A 4GXOA 2STTA 2G9WA 2ESNA 2NNYA 3OOUA 3B73A 3RKYA 2X48A 2AHQA 4B3XA 3V8LA 2L5QA 2DCEA 2VC1A 2OTLI 2OU2A 2WB1A 1WI9A 3VEPA 2E19A 1HLVA 2D1HA 3FXJA 1ETQA 4EMSA 5JI6A 1MGTA 3S16J 1WFXA 3MCZA 3ABLH 4G8XA 3ZQGA 1YIJI 1VQ4I 4JP0A 1YX5A 4S0HB 4ZZDA 4M74A 2M8EA 4XRMA 4A5NA 3FBNB 1I3AA 2VL8A 1A36A 3FISA 2KIQA 4CCOA 2GXGA 1F4KA 4EM1A 2KIUA 1JHHA 2Z3YA 3I0TA 3I4MJ 4U0YA 2LRDA 4I6ZA 1G3YA 1MNDA 3IRRA 1BC7C 3IH4A 2OV7A 4XORA 3HHHA 4A69C 5EEHA 4F7ZA 2HQ5A 4QIWN 2GLOA 1RETA 2DK5A 3WHBA 4CGZA 2D2WA 5JLWA 4ON0A 3OYFA 1XSVA 4Y17A 2IBDA 1Y0UA 1Z0XA 1HW2A 3M8JA 4XMYA 3ABKH 4E6KG 5E1ZB 1UJ8A 2F5FA 3WU0A 4BJ5C 1UHMA 2IVMA 1BR2A 1UG0A 3RPQA 3SZGA 4C3IJ 3S3MA 1ZQ3P 2VJJA 1GT0C 2JMWA 1FBSA 1U0JA 4A3KJ 1TWHJ 1DP3A 1BIAA 1IRFA 4AVZA 1IXRC 2K27A 4BHBA 4YFXF 3QYBA 3LSPA 2EFOA 1QZEA 5D5VB 4BQAA 3ZR8X 3A03A 2PLYA 2FMLA 3BZ6A 2KZVA 2JRMA 5EEGA 2ZNYA 1MNMC 2LDUA 4A2UA 4KYWA 1UZCA 2QYOA 3A1YA 3B02A 4U87A 5L3DA 3V7CA 1CGPA 1B9NA 4H0EA 2Z5UA 2DU9A 4I0BA 4L5EA 3BP8A 3OYIA 2NVYJ 2B7EA 2O61A 4XLAA 4YELA 2EV6A 4OINF 2Z33A 4YG2F 3OIQA 3EDPA 4G6DA 2RREA 4CYDA 3W2AA 1DPRA 3BR2A 4HF1A 4IHTA 2RQPA 3HPHA 2EV0A 2KLOA 2VIXA 2H8WA 2W84A 1J2XA 3K70C 2F5CA 4IOAF 2V1UA 1VQ6I 3SXYA 4B8XA 1LFUP 1Y1VJ 2BXZA 1IV8A 2CFOA 3ASOH 5EEAA 3GTLJ 2E5ZA 3ZMUA 3QQAA 3BJAA 2MLKA 4E70A 3I64A 1WJCA 4G7ZF 5HS7A 1U5TB 1WJEA 2M2EA 2QZ8A 2W57A 3K7AJ 3FK6A 1WJ5A 4RGSA 4IRHA 2NOGA 3TQNA 2LTPA 4PCQA 3D5RC 1ZN2A 2VI6A 1VQOI 3F6OA 3ABUA 1N77A 3I59B 1R4MB 2XF5A 4WXCA 2JWTA 4HNVA 3TW7A 2VODA 1STZA 3DPTA 3EETA 5J47A 3EUHC 4NBQA 3GVAA 1KQ9A 2LY2A 1T56A 4NC6A 2ZXIA 1PP8F 4WK8F 1JKQC 4KISA 2LKXA 5IT9K 1WPKA 3L00A 1AHDP 4BY7J 1JJ8C 5JHUA 1XPXA 1LVAA 1ZG1A 3MD2A 3FKJA 1VZ0A 2L9SA 1U8RA 1ETVA 1FBUA 3OMYA 3LQRA 2K3FA 3HRUA 3W2VA 2MG4A 3HSEA 1OPCA 4KFCA 1R9TJ 2B63J 2CG4A 2Y30A 3AL0B 2OCCH 3DCFA 1IRXA 3V8KA 3BJ6A 3MQ0A 2CW7A 3MZYA 5H20A 1VFCA 4E7LA 2L3DA 2BY0A 2V1NA 4XLHA 5J1UA 3H5NA 2L4AA 4PJLA 2LBFB 4LGWA 3L1PA 3HZJA 4B44A 4EV0A 2ZMEB 4RGUA 1XMKA 1SANA 3SQNA 1OLTA 3VWBA 1PYVA 1Z6TA 1L3LA 1W7PD 2HQAA 2VT2A 4ZDPA 1GVDA 3IRQA 2ISYA 2JVHA 2Y0MA 2X85A 4ENMA 1TQMA 4UVBA 3REOA 2M87A 2Z9OA 1CQTA 5J4YA 2NVXJ 1UHWA 3QPLA 1L0OC 2L9RA 2JA8J 3ECHA 3NWSA 4S05A 2W24A 2E7XA 1ETOA 5JFRA 2H6BA 2MLGA 5DV5A 3F8BA 4YEJA 1KU9A 1LUJB 4R1HA 2ZBKA 1LVKA 3Q9VA 1G3SA 5FLVA 1MMAA 5L3CA 3AL0C 1YQAA 1JTYA 4KJZA 1JT0A 4AIDA 3H1CA 1EA3A 1XG1A 2IP2A 5BOXA 4KN4X 2O8KA 3M3YJ 1MMDA 3FIWA 3I55I 1A35A 2V1DA 3S17J 1QVUA 3BY6A 2M30A 4N4NB 2XAFA 5IOYA 1G59A 2KRFA 2ZMEC 4IO9F 1TWGJ 1TQIA 1QRYA 3LSIA 4KIGA 1O7LA 3ZP5A 3KP2A 2R7OA 4OU0A 3JRGA 1I50J 5D5WB 2CUZA 3R4KA 1KQ8A 2M3AA 4PJ0C 2HDWA 4FTHA 2AQEA 3D5SC 1HDPA 3EUKL 3JREA 2JVGA 4UNOA 3K4NA 2ZFWA 3COAC 1D8KA 1W0UA 4R79A 2OPTA 3KPHA 1TNSA 4IJAA 1MNEA 1BC8C 4AD9A 4YFKF 1TBXA 2ECBA 2X1EA 4GFBA 2XUBA 3A0BC 4E7HA 5LHGA 4A3FJ 1IO2A 1V54H 4JX6A 4XKVA 1ZGAA 4AM3A 2IS6A 3OS0A 1X19A 5FLMJ 4ZYEA 2X0LA 2XHKA 3ZMTA 3AFHA 1UHSA 3K1NA 4FT8A 4MHGA 1JKOC 3E5XA 3BTCA 5D5UB 4BE1A 2GIZA 5GADJ 3PNTA 1ZKGA 4XRSA 3KYDB 3F22A 1S5LC 3SEQA 2W1OA 4P5OA 2K9MA 2M45A 2R4GA 2Z99A 2X6OA 3R6SA 2KJCA 4UUVA 2HEOA 4E7KA 2HOSA 1E3PA 2H8RA 1LE8A 3FZVA 3V8JA 3KEQA 3DPLC 1YS6A 4Y52J 1BR1A 3OR2C 2KT0A 1SFEA 4BE0A 2VXDA 2M8GX 2ZB9A 5DCMA 4XQFA 3BCAA 5ILSA 3LNQA 5LGUA 2WAFA 4J01A 5JHFA 4B09A 2DTZA 5DYMA 3IKTA 2QWWA 1I27A 3HRSA 1DPUA 3OR1C 1RR7A 4A0YA 5IY5H 1YRNA 3OYDA 1OQYA 3VYSB 2HDDA 1MBKA 5GTIC 1ON2A 1XMXA 4G12A 4QTRA 3H5AA 4MLOA 3I71A 1LEAA 3RIRA 3V42A 4HLXA 4JOMA 1NHAA 5IYBJ 3A01A 2VQLA 3GF2A 1PUFB 3RQIA 2HOTA 3J80Z 1D0ZA 2DA1A 2EV5A 4HV5A 5FFXA 5EDNA 1XMAA 4A6DA 2MFZA 1LDDA 3IKVA 4M3DA 2HZTA 4CZCA 1QQIA 3O8GA 5L3EA 1VQPI 3V7RA 3BR0A 4N9IA 2PX9A 3HJEA 4K2EA 1RKTA 2HQNA 2X51A 4BQQA 1YJ9I 2XGXA 2E1OA 3F72A 4MO7A 1HCRA 2FJ1A 1I5ZA 2K9LA 4BHCA 3KE2A 2E7WA 1K83J 4BH9A 2VXZA 2V4JC 4EEFG 1FYKA 4BY1J 2D1VA 2XKPA 3H9QA 4NQWB 5FKOA 3JAMK 2V1XA 2MC4A 3CO6C 3OYEA 1DQUA 3TDUC 4DBQA 2BY3A 3S1NJ 1GLNA 2Q8KA 1GV5A 2IS1A 1Y8RB 2A6HF 2PBIA 1SAXA 3GBGA 4BGDA 2EFPA 4IHYA 3Q0WA 5KVRA 4C3HJ 2IA1A 3SDGA 2LF8A 4OOIA 2VOPA 2EQRA 4HEA2 5DM7F 3IL2A 4BEHB 3AG2H 1UB9A 3R0JA 4GYGA 5JR3A 2KRHA 5EJCA 3PUFA 2VKHA 3R0AA 4ANJA 3HGYA 4E7SA 5CVRA 2VQHA 2OQGA 3E6DA 2VUMJ 3K1MA 3KEOA 2GXAA 1T6SA 1EH6A 3MVPA 3CMMA 3AAFA 3PO2J 4F3QA 5IP7J 2JA2A 2GOXB 3FXMA 3L2QA 3VSKA 5LGTA 2R5YB 2RQQA 1DU0A 5HLIA 1RZ4A 3LL7A 2YX4A 1ZTRA 2M7BA 1OCPA 4HX4A 5E1WA 1A5JA 2FOWA 3AKZA 3J81K 2QSFX 3ZQCA 4M6XA 2V79A 4IZZA 3V4GA 1Z3XA 4BJTA 1QO0D 4ZZLA 2H1LA 3OYBA 3N4MA 4UV8A 3CJTB 1KONA 3DWLE 1LE8B 1QGPA 3JRAA 2WAQN 3H9JA 1T8IA 2R7XA 2IA0A 4AIJA 2L7FP 2ZJRF 2K85A 3S1RJ 4DW6A 2F5VA 4FETA 2PEXA 3WGHA 1JKRC 1T2KA 1XX5A 2WBMA 1FYLA 4B47A 5L3BA 1J75A 1MBJA 3IWFA 1RRJA 1IF1A 2P6SA 3IH2A 3E6CC 1B72A 1MJ9A 1Z7LA 1FSHA 2DAOA 3OYGA 4PZJA 3CD6I 5LGNA 3QPSA 2KDOA 2RKHA 4XOTA 2F4IA 2DN0A 3JTHA 3PFIA 5TRDA 2LF7A 2O0YA 4YIIA 1FC3A 1NH3A 2WY8Q 3OSFA 2A6TA 4G6QA 4RAZA 2HU9A 2NS8A 2UZKA 1AU7A 3HOYJ 1YJWI 4M3BA 2DYRH 2L2OA 2Z16A 2ACJA 2K9SA 1P4XA 3AG1H 4HQMA 1I6XA 2VT3A 4PJMA 5LLQA 1X2NA 4W1UA 4EJUA 1MMGA 5KNLA 4YIFA 4LITA 2HYGD 4XKBA 1BI2A 4CXFA 5BPIA 4KMUX 5JLXA 3ASNH 1SAUA 2COMA 1RPWA 2A61A 2Y48A 3HOUJ 2UXNA 2BZTA 2ZKZA 1LFBA 3CZ6A 2HPIA 2ZXWH 4JX5A 3RCOA 1NK2P 1T0FA 4AIKA 2CUFA 4EM0B 1HF0A 2VBYA 4CH7A 3CCVI 4Q47A 1WCMJ 3BT9A 2QF7A 5E79C 2M5WA 4WXDA 4UUSB 1R00A 3K69A 4LG3A 2JPCA 2EZKA 1YIOA 3VFZA 1T38A 1X3UA 1JGSA 3Q9SA 4CUGA 1R49A 1V5FA 1FEXA 4MFDA 3QP6A 2LMDA 4QPQA 2JTVA 5FKLA 4RDUA 1OYYA 1SMTA 3QOEA 3BCBA 3CCQI 3NARA 1X1BA 2DJIA 1U9OA 5JVGF 2IGMA 4DYRA 5B66C 5AONA 5C3EJ 3C1DA 3LSGA 3BLYA 2ELKA 3C7JA 3MKLA 1ZG5A 4XSZF 2ZNZA 4IKFA 5FLXZ 2P5VA 2AXLA 1Y8QB 2R0QC 4HG2A 3Q3SA 2XAJA 1BOBA 2WV1A 1J9IA 4IX7A 4A3LJ 3ABMH 2WV0A 3GO5A 3QWLA 3TP3A 3G1LA 5LFAA 3G73A 4EJWA 3SFIA 2QA4I 2LP0A 4TV7A 3KETA 1R1TA 2CO5A 2JSCA 2KDZA 2BHZA 4EGZA 2CGPA 3RTRA 4L0YB 1IRZA 3X2QH 4DZJA 3ML6A 1VQKI 5JVTA 5CJ9A 1JKPC 3SJMA 4BS9A 3ZRGA 3GEZA 4HX8A 2HTJA 4F91B 3HG9A 2K3PA 1JTXA 4D1QA 4XKCA 2N8GA 2K4JA 2ESHA 2DT5A 2DPUA 2V26A 1H88C 5J8CA 1N75A 4LD5A 4CCKA 2RVCA 2RNJA 2MA3A 4GCVA 2JQ7A 3I53A 1MBHA 3CQZJ 3GWZA 1U5TA 5A2QK 3GFMA 3T0YA 5GAEJ 3EYYA 1W1WE 2WADA 3CJQB 3ZQQA 4DGWB 1RI7A 4IOCF 1HSJA 5D6EA 4A0ZA 1DGRM 4PGGA 2CU7A 4FE4A 2Q1ZB 1UFMA 3I59A 3LMMA 2V9KA 5IPAA 2OF7A 4G94A 1DU6A 2CH0A 2VBXA 3NEUA 5B1AH 4XBFA 2FBHA 2BE5F 4G9YA 1IDZA 1OFCX 2BYVE 2VASA 3TOAA 3E6BA 3I54A 2FX0A 2DT6A 3K2ZA 3T1BA 2XAUA 1OKRA 2CV2A 2OZ6A 3W6KB 2XDVA 4OAYA 1LJ9A 3H3VK 1R71A 2HR3A 1BM9A 2W85A 2DPDA 2ID3A 2PN6A 2WA0A 2ZXHA 3GFLA 1JHFA 1KYWA 2Y9YA 3FXUA 1YS7A 2VQCA 3C18A 4CO8A 2CV0A 2DDBA 4RGXA 2P6TA 3V7SA 4E4HA 3F0CA 2M0MA 2XGCA 4G6TB 3PM1A 3FM5A 2EZLA 1UMQA 2IGKA 1W0TA 3HOVJ 2LBFA 1W4MA 3OS2A 4P55A 5J8FA 1F9NA 3PSIA 5BPDA 2A68F 1ZREA 2ZMEA 3FX3A 3J7YJ 2KFDA 4IHVA 1V5GA 4HW0A 1R5HA 4KDPA 2H6CA 2KP6A 2HVSA 2L0KA 3ABTA 3CMAI 4XK4A 1V55H 4OIRF 1G2HA 2LNBA 3EQLF 3HKZN 3S3NA 1SVLA 4I7HA 4IXAA 2W25A 4NC8A 3DPUA 1S7OA 1RIOH 2W82A 4EVIA 4NC7A 2FQ3A 4CCMA 5HOOA 1LPQA 4NDLA 3EPZA 4MEXF 3CMYA 4U88A 2IGOA 2KJBA 5F6FA 2HGCA 3FKIJ 3H35A 5DEQA 5FD6A 3DP7A 3L2CA 4L5IA 2JK3A 2ZXJA 3WTVC 1YLFA 2Q2EB 4KIBA 3FWEA 4P96A 4CHUA 2R7UA 2VJ5A 2R7TA 3OOPA 1USSA 2GQQA 3M07A 3CUQB 2LY9A 4IRIA 1HA8A 2BHYA 1OISA 4D7MA 2EPFA 1K61A 2F4MB 2BBYA 3HOTA 1S8NA 3A2KA 1YOVB 6PAXA 3GXOA 4JQFA 2HTSA 3LSMA 1QZYA 1Y0NA 3KP6A 4U0WA 4A3CJ 3M1CA 3VPRA 4BBRJ 2M4GA 3HRMA 5CQEA 1JT6A 1B6AA 4BL0B 1MH3A 1WGXA 2G0EA 4CA0A 3KP4A 5KAFC 1UG2A 2CRGA 3LSHA 3F9KA 4BE2A 2E60A 2NVUB 2DOAA 5BQTA 2P4WA 5DS9A 4A5MA 1IN8A 5BNGA 3KIOA 5AIQA 2QKLB 1O3TA 3HKZA 2HFHA
chains in the Genus database with same CATH topology
5IT3A 4EJTA 1EH7A 3F8FA 5HLHA 1YW9A 2EWNA 2LSOA 3CUQC 1VTNC 2CFXA 2DTRA 1E2XA 1SMYF 3E3VA 1BN5A 3QU6A 3DV8A 1D8JA 2MC3A 4Q5SF 2P5LC 3BWGA 4YFNF 3TOBA 2ADUA 5FGMA 4Y13A 2PMHA 3P9CA 2EA2A 2R7FA 3I5UA 3SZTA 4I01A 5TJJA 4AWXB 3QOPA 5ICGA 1GXPA 2PMUA 4HF0A 3O3KA 4P9UA 1SFUA 3DFGA 1KU3A 2M1BA 2RGVA 4LB5A 3DEUA 1R1UA 2QQ9A 5E18F 2ETHA 4M6YA 3GFIA 4RB0A 3GLXA 1ZLKA 1J7KA 2WWYA 3L9FA 1LEBA 2QUFA 3E5UA 4U7DA 2YSRA 1SFXA 1O3QA 2EFNA 3TO6A 3U9GA 2DQRA 3E6MA 4NQWA 3ISPA 1XCBA 1MD0A 1FYMA 1XB4A 1YTYA 1OYWA 3HOSA 1K79A 3H3UA 3FMQA 2FEZA 3KP3A 4R8HA 5CYVA 1IAWA 4NB5A 1J59A 1LQ1A 2H94A 2GIVA 1GHCA 4OMYA 2WTEA 1RNLA 2KIFA 2ZO4A 2F5EA 1ZRCA 1B59A 2CYYA 3F6VA 2O6GE 3GW2A 5L3FA 2P7CB 1QZZA 1B4AA 3MEXA 2E1CA 1TQPA 3O2PE 3RI4A 2BEOA 5CVUA 3CJNA 3DF8A 2JPBA 3KZYA 4HOBA 2A07F 4MQVA 3RJPA 2UWMA 5FFZA 3U1DA 2A3SA 1G4DA 4PDKA 3TO7A 4RAYA 1RUOA 4DNCA 5H6QA 1ZARA 1D3YA 1Z7UA 4BHPA 1K78B 3MZHA 3WTUC 2BV6A 2XVCA 4EJOA 3KLNA 2VE8A 2OZUA 3ZMVA 2EK5A 1SD6A 3G3ZA 2OQRA 2A6EF 1CF7B 4HLYA 4WF2A 2XAQA 2ZCWA 3ELKA 2VBWA 1P92A 1TNTA 2VBZA 4UV9A 1O3RA 1KGSA 3ZMDA 2CSOA 4O3MA 5LBQA 1XSXA 2XROA 4LB6B 2DO7A 2MH2A 4FX4A 1G6NA 2QVOA 2NS0A 4RB3C 1B1BA 3MFKA 3ZPLA 5K5QA 4MNUA 1FX7A 1QPMA 5D8LB 2FF4A 4O6JA 5CVJA 1R7JA 5DUIA 3F3XA 1FZPB 4LG0A 1ODDA 2GXBA 1LDKB 1DUXC 1IN7A 4HZFA 3JAMZ 4OIOF 1BI1A 4M9SA 1MDMB 4ENKA 1WRJA 3FF5A 2XASA 3KLOA 3P7NA 4ZYGA 3BPVA 5CVVA 4QLCU 1Z9CA 4EJVA 1G3WA 4ENJA 1O3SA 2DW4A 3C3WA 4G7HF 2AS5F 1AWCA 3J7AO 5E17F 3RKWA 4M72A 1R36A 2H09A 3R60A 2V9VA 1YG2A 5D5XB 2FBKA 1K7AA 1V3FA 2XAHA 4NHJA 5DD8A 1P4WA 3I58A 3TKYA 2HKOA 4IVNA 3TO9A 3H92A 3GZ6A 1XGMA 1LNWA 4MGRA 1F1ZA 5J6XA 3ZQ7A 1SD4A 4KIFA 3J81Z 1MJAA 2NNNA 4BYYA 3TDZC 2D45A 2OA4A 1XCVA 3LAPA 2A5YB 5HVQC 4U0VA 2EFWA 3NRVA 1FPQA 3VODA 1PUEE 2GA2A 1QNTA 1HSTA 2DFIA 3RPUA 3SZPA 3IWZA 2R3SA 5LEJA 1Z1DA 1YYVA 5DCFA 4XRFA 4HBLA 4IRGA 3FXQA 1U3EM 1LB2A 2HQRA 3OV8A 1FP1D 1IRGA 3QAHA 1J0RA 4LG0B 3K0LA 1HW5A 2NYXA 4GGGA 4M9XA 4HX7A 1RUNA 3TGNA 3T8TA 3M8FA 5H6RA 1XSDA 3LQQA 2CWEA 4Z2YA 1KYZA 4I0AA 3N97A 2Q2EA 2J5PA 1T39A 3CUQA 5F64A 3S2WA 3O6BB 4FHTA 2RN7A 3HSFA 4HQEA 3VOEA 3EUHA 2O3FA 1R5GA 4HDVA 4N0BA 5ERIA 5LHIA 2GWRA 1FSEA 2DBBA 3M8EA 3LFKA 3LA7A 2PQ8A 3JTGA 1T98A 2VE9A 4LK0F 4OMZA 3FXRA 3ZMSA 4L9VA 4I02A 1LDJA 1PP7U 2IT0A 1S29A 2IPQX 1XN7A 3HTSB 4WXHA 3U2RA 1W5TA 1J5YA 4HA8A 4LLLA 1FY7A 1IN4A 1TW2A 1YFHA 3P9IA 2NRAC 2UXXA 4IF4A 3HTUA 5ICFA 1IN5A 1ZLJA 3ROUA 4JK1X 1O7FA 3E5QA 3MAJA 4Q48A 2F2EA 3JSPA 2IJLA 4AIHA 1FBQA 3ZMZA 4LK1F 5E1XA 4G7OF 5HLGA 5HDNA 4ESJA 2P5KA 3ECOA 5CLSA 4HV6A 2OAZA 3GZ5A 3FHZA 2PI0A 2RC4A 3KCCA 4ZYDA 1U2WA 1Z91A 4L9NA 3LA3A 1OR7A 1GVJA 3LSTA 5ILVA 1HW1A 1W5SA 3F8MA 1HBXG 1BOAA 1WKMA 3MWMA 3WTSC 3WTXC 4CDGA 1ONVA 3DXJF 1G3TA 3E97A 3M7GA 3L7WA 1P4AA 4WCGA 3RKXA 2FNPA 4FX0A 1I1GA 4EGYA 3Q5FA 1FT9A 1W7PB 4UXNA 2P7VB 5HDGA 5HS9A 3HHGA 2K7LA 5F1RA 3W6JB 2CW0F 1EH8A 5ICCA 1XDSA 5LHHA 2O03A 1ZRDA 1IUYA 4MTDA 1TTYA 4P9FA 1HKTA 2XKOA 1USTA 1H0MA 4KT5C 5LRRA 4S04A 2Q0OA 3BPXA 2HKXA 4ENNA 1ZG3A 4Y15A 3BROA 3ULQB 2VONA 3CO7C 5FO5A 2K02A 3RYRA 1FLIA 3LAJA 4LMYA 1K6OA 1MZBA 2MBFA 1K78A 3RYPA 2HYFA 3FMRA 4RS8A 4ASNA 5IT9Z 1HXDA 3CTAA 3BDDA 5E8IA 3WGGA 1CF7A 3T5XA 4OIQF 3IHUA 2HWVA 4L9TA 1U5TC 1YO5C 2QQBA 3WE2A 2FU4A 4IPAA 3QU3A 5ED4A 3CUOA 3H3ZA 4L9JA 5L3GA 4RGRA 2QLZA 1S7AA 1EV7A 2EJRA 4M73A 3SHFA 3JW4A 1F5TA 3DKWA 1WSUA 1IN6A 5BS6A 1KQ0A 4L18B 5LRSA 3BJOA 4HYEA 3GFJA 1PDNC 1P2FA 1A04A 3M1EA 2H27A 1JXSA 2FE3A 5LEKA 3WTZA 1BI3A 4U7BA 1V4RA 5DDGA 5HS8A 1MDMA 1I1SA 5D8KB 3P9KA 5D4SA 2K86A 5D6FA 2HDCA 1S6LA 4AVPA 3WTTC 1ZAOA 4ZH4F 1Z6RA 1R23A 2CQKA 3BOQA 2YX7A 4L0ZB 2GAUA 2VN2A 2KKOA 4WWCA 5AIPA 1ZGJA 2V6CA 1U6GA 1BJAA 3ZN1A 2QBYA 2JZYA 1BI0A 3ERED 3F8CA 2Y75A 1C0WA 3VB2A 2PG4A 1IXSB 1DDNA 3WGIA 1P6RA 3M9AA 2O8XA 2RDPA 3HSRA 4LLNA 1TLHB 1DP7P 3RDIA 2EFQA 1HKQA 1TW3A 3F8NA 3FMSA 4A12A 4O5VA 5E20A 4EM2A 1Z05A 2G7HA 2DI3A 4KNYA 2VOOA 4Q4ZF 3J80K 1IZ1A 2FRHA 4KMFA 2FA5A 2L4MA 3ZN0A 4UVAA 5ICEA 3QRFF 2OBPA 3KFWX 3GX4X 2KIMA 1FWZA 2JT1A 4XSXF 1BBYA 4QWQA 5CVIA 4KICA 5FD5A 2RV8A 1XDUA 2FBIA 1U78A 2E1NA 1IW7F 1ZH5A 4EQQA 1REPC 1HQCA 1FNNA 2DLLA 3LWFA 2FOKA 2ELHA 1SD7A 2ISZA 4KN7X 4HDUA 3PQJA 4I2OA 3HUGA 1OMIA 5KK1A 4UVCA 1R22A 1SD5A 4ESFA 4JBAA 4ESBA 4WX9A 3WE3A 4RB1A 2MD5A 4KUMA 1XGSA 4L5JA 2QBYB 5K5OA 4BXUA 4LLGF 5DUKA 2L01A 3JSOA 4LFUA 3K9TA 3PQKA 2FXAA 1HKSA 2DQLA 2QM3A 3L09A 3NQOA 4M9ZA 2F5DA 4CICA 4UHTA 1FOKA 1H9GA 2C6YA 3WTWC 1R1VA 2BGCA 2OD5A 1Q1HA 2HOEA 2STWA 4LJZF 3WG9A 1GXQA 1AOYA 2LKPA 5BMZA 3D5LA 1KU2A 3KP7A 4ZYHA 4RB2C 3K1PA 5DCMB 2YU3A 3FM3A 2XRNA 4I09A 4XLPF 2ZJ2A 1FP2A 2EB7A 3I4PA 3KP5A 5E8GA 3LA2A 3QPHA 2MH9A 4XLNF 3QP5A 1MKMA 2JRTA 2WC2A 2PJPA 1YW7A 4HF2A 4MTEA 3R61A 2J5OA 3F21A 1KU7A 3QPTA 4A0XA 4A6EA 2XV4S 2G7UA 4I98B 3DQVC 4KA4A 1BIBA 1ZRFA 3SFZA 4DQ2A 2X4HA 2QQAA 3T8RA 2K4BA 2B0LA 1XGOA 1OYIA 5ILUA 3GYHX 3HRTA 1QBJA 2YPRA 4ETSA 2VC0A 3CLOA 1WWXA 1XD7A 5D4RA 5K5RA 2HS5A 1JE8A 4PGHA 4IHSA 2L02A 4BNCA 4MQ9F 4D0PA 1XGNA 5FLXK 2FMYA 4N9HA 2IA2A 4MEYF 3D0SA 1H9TA 3WU1B 4OIPF 1IXCA 3WODF 1WQ2A 1MJBA 2XIGA 2FSWA 2GA1A 1W7PA 5DD4A 4GO1A 1O57A 4GYIA 2A69F 1R58A 3GUDA 3IC7A 3KZZA 2L54A 3CDHA 2EA4A 2YR2A 3HIFA 1UCRA 2NAZA 2IW5A 3F23A 2P8TA 1B9MA 4CZZA 1S3JA 5K1YA 2GZWA 2TDXA 4BAYA 2PFBA 1E17A 2QENA 4HAMA 1ULYA 4M71A 5A2QZ 5HDKA 2DK8A 3WTYC 1KA8A 2IRFG 2FNAA 1YW8A 3EYIA 2R7DA 1ZYRF 3HYIA 2XAGA 1ZHFA 1D5VA 1ON1A 5FB2A 4GXOA 2STTA 2G9WA 2ESNA 2NNYA 3B73A 3RKYA 3V8LA 2VC1A 2OU2A 1WI9A 3VEPA 2D1HA 4EMSA 5JI6A 1MGTA 3MCZA 4G8XA 4ZZDA 4M74A 2M8EA 4A5NA 2GXGA 1F4KA 4EM1A 2KIUA 1JHHA 2Z3YA 3I0TA 4U0YA 1G3YA 3IRRA 1BC7C 3HHHA 5EEHA 4F7ZA 2DK5A 4CGZA 2D2WA 4ON0A 1XSVA 4Y17A 1Y0UA 1HW2A 5E1ZB 2F5FA 3WU0A 1UHMA 2IVMA 3RPQA 1FBSA 1BIAA 1IRFA 1IXRC 2K27A 4BHBA 4YFXF 2EFOA 4BQAA 5D5VB 2PLYA 2FMLA 3BZ6A 5EEGA 2ZNYA 2LDUA 4A2UA 4KYWA 2QYOA 3B02A 5L3DA 3V7CA 1CGPA 1B9NA 4H0EA 2Z5UA 2DU9A 4I0BA 3BP8A 2O61A 2EV6A 4OINF 2Z33A 4YG2F 4G6DA 3EDPA 4CYDA 1DPRA 4HF1A 4IHTA 2RQPA 2EV0A 2W84A 1J2XA 2F5CA 2V1UA 3SXYA 4B8XA 3ZMUA 3BJAA 2MLKA 4E70A 3I64A 4G7ZF 5HS7A 1U5TB 2QZ8A 2W57A 4RGSA 4IRHA 3TQNA 4PCQA 1ZN2A 3F6OA 3ABUA 3I59B 4WXCA 2VODA 1STZA 3DPTA 3EETA 3GVAA 1KQ9A 1PP8F 4WK8F 5IT9K 3L00A 5JHUA 1LVAA 1ZG1A 1U8RA 1FBUA 3LQRA 3HRUA 3HSEA 1OPCA 4KFCA 2CG4A 3V8KA 3BJ6A 3MQ0A 3MZYA 5H20A 2L3DA 2L4AA 4LGWA 4EV0A 2ZMEB 4RGUA 1XMKA 3SQNA 1Z6TA 1L3LA 1W7PD 2VT2A 3IRQA 2ISYA 2Y0MA 4ENMA 1TQMA 4UVBA 3REOA 2M87A 2Z9OA 1UHWA 1L0OC 3ECHA 4S05A 2W24A 2E7XA 5JFRA 2H6BA 2MLGA 5DV5A 3F8BA 1KU9A 4R1HA 2ZBKA 3Q9VA 1G3SA 5L3CA 1YQAA 5BOXA 2IP2A 4KN4X 2V1DA 3BY6A 2M30A 2XAFA 2KRFA 1TQIA 4KIGA 1O7LA 3ZP5A 3KP2A 4OU0A 5D5WB 3R4KA 1KQ8A 4UNOA 2ZFWA 3COAC 1D8KA 4R79A 1TNSA 4IJAA 1BC8C 4AD9A 4YFKF 1TBXA 2XUBA 5LHGA 1ZGAA 4ZYEA 2X0LA 2XHKA 3ZMTA 3K1NA 4FT8A 4MHGA 3E5XA 5D5UB 3F22A 4P5OA 2M45A 2Z99A 3R6SA 2KJCA 4UUVA 2HEOA 3FZVA 3V8JA 3KEQA 3DPLC 1YS6A 1SFEA 5DCMA 5ILSA 5LGUA 4B09A 5DYMA 3IKTA 2QWWA 1I27A 3HRSA 1DPUA 4A0YA 1ON2A 3I71A 1LEAA 3RIRA 4HLXA 1NHAA 3GF2A 3J80Z 2EV5A 4HV5A 5FFXA 1XMAA 4A6DA 1LDDA 3IKVA 2HZTA 1QQIA 5L3EA 3V7RA 4N9IA 4K2EA 2HQNA 2XGXA 3F72A 1I5ZA 4BHCA 3KE2A 2E7WA 4BH9A 2VXZA 1FYKA 2D1VA 2XKPA 3JAMK 2V1XA 3CO6C 3TDUC 2Q8KA 2A6HF 2PBIA 1SAXA 2EFPA 5KVRA 2IA1A 2LF8A 4OOIA 2VOPA 3IL2A 1UB9A 3R0JA 4GYGA 5JR3A 3R0AA 5CVRA 2OQGA 3E6DA 3K1MA 3KEOA 1T6SA 1EH6A 3AAFA 5LGTA 5HLIA 1RZ4A 2YX4A 4HX4A 5E1WA 3J81K 4M6XA 2V79A 3V4GA 1QO0D 4ZZLA 3N4MA 4UV8A 1QGPA 2IA0A 4AIJA 3WGHA 2PEXA 1T2KA 1FYLA 1J75A 5L3BA 3IWFA 1IF1A 2P6SA 3E6CC 1MJ9A 1FSHA 2DAOA 4PZJA 5LGNA 2RKHA 3JTHA 3PFIA 5TRDA 2LF7A 2O0YA 4YIIA 1FC3A 4G6QA 4RAZA 2UZKA 2ACJA 1P4XA 4HQMA 1I6XA 2VT3A 5LLQA 4EJUA 4YIFA 2HYGD 4CXFA 1BI2A 5BPIA 4KMUX 2COMA 2A61A 2Y48A 2UXNA 2ZKZA 1T0FA 4AIKA 4EM0B 2VBYA 4Q47A 2M5WA 4WXDA 1R00A 3K69A 2JPCA 1YIOA 3VFZA 1T38A 1X3UA 1JGSA 3Q9SA 3QP6A 2JTVA 1OYYA 1SMTA 5AONA 1ZG5A 3C1DA 3C7JA 4XSZF 2ZNZA 5FLXZ 2P5VA 2AXLA 2XAJA 1J9IA 2WV0A 3GO5A 3G73A 4EJWA 4TV7A 3KETA 1R1TA 2CO5A 2JSCA 4EGZA 2CGPA 4L0YB 3RTRA 3ML6A 5JVTA 5CJ9A 3GEZA 4HX8A 2HTJA 2K4JA 2ESHA 2DT5A 2DPUA 5J8CA 4LD5A 2RVCA 2RNJA 2MA3A 4GCVA 3I53A 3GWZA 1U5TA 5A2QK 3GFMA 3T0YA 3EYYA 1RI7A 1HSJA 5D6EA 4A0ZA 4PGGA 1UFMA 3I59A 4G94A 2VBXA 3NEUA 4XBFA 2FBHA 2BE5F 4G9YA 2BYVE 3TOAA 3E6BA 3I54A 3K2ZA 3T1BA 1OKRA 2OZ6A 3W6KB 1LJ9A 2HR3A 1BM9A 2W85A 2DPDA 2PN6A 3GFLA 1JHFA 1KYWA 3FXUA 1YS7A 3C18A 4CO8A 4RGXA 2P6TA 3V7SA 3FM5A 1W4MA 4P55A 5J8FA 1F9NA 5BPDA 2A68F 1ZREA 2ZMEA 3FX3A 4HW0A 1R5HA 4KDPA 2H6CA 3ABTA 4OIRF 2LNBA 3EQLF 4I7HA 4IXAA 2W25A 1S7OA 1RIOH 4EVIA 2FQ3A 5HOOA 4MEXF 4U88A 2KJBA 5F6FA 2HGCA 5DEQA 5FD6A 3DP7A 3L2CA 4L5IA 2ZXJA 3WTVC 1YLFA 4KIBA 4CHUA 3FWEA 4P96A 3OOPA 1USSA 2GQQA 3CUQB 4IRIA 2BBYA 3HOTA 1S8NA 6PAXA 3GXOA 4JQFA 2HTSA 1QZYA 3KP6A 4U0WA 3HRMA 1B6AA 3KP4A 5BQTA 2P4WA 4A5MA 1IN8A 5AIQA 1O3TA 2HFHA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5IT3 A;  4EJT A;  1EH7 A;  3F8F A;  5HLH A;  1YW9 A;  2EWN A;  2LSO A;  3CUQ C;  1VTN C;  2CFX A;  2DTR A;  1E2X A;  1SMY F;  3E3V A;  1BN5 A;  3QU6 A;  3DV8 A;  1D8J A;  2MC3 A;  4Q5S F;  2P5L C;  3BWG A;  4YFN F;  3TOB A;  2ADU A;  5FGM A;  4Y13 A;  2PMH A;  3P9C A;  2EA2 A;  2R7F A;  3I5U A;  3SZT A;  4I01 A;  5TJJ A;  4AWX B;  3QOP A;  5ICG A;  1GXP A;  2PMU A;  4HF0 A;  3O3K A;  4P9U A;  1SFU A;  3DFG A;  1KU3 A;  2M1B A;  2RGV A;  4LB5 A;  3DEU A;  1R1U A;  2QQ9 A;  5E18 F;  2ETH A;  4M6Y A;  3GFI A;  4RB0 A;  3GLX A;  1ZLK A;  1J7K A;  2WWY A;  3L9F A;  1LEB A;  2QUF A;  3E5U A;  4U7D A;  2YSR A;  1SFX A;  1O3Q A;  2EFN A;  3TO6 A;  3U9G A;  2DQR A;  3E6M A;  4NQW A;  3ISP A;  1XCB A;  1MD0 A;  1FYM A;  1XB4 A;  1YTY A;  1OYW A;  3HOS A;  1K79 A;  3H3U A;  3FMQ A;  2FEZ A;  3KP3 A;  4R8H A;  5CYV A;  1IAW A;  4NB5 A;  1J59 A;  1LQ1 A;  2H94 A;  2GIV A;  1GHC A;  4OMY A;  2WTE A;  1RNL A;  2KIF A;  2ZO4 A;  2F5E A;  1ZRC A;  1B59 A;  2CYY A;  3F6V A;  2O6G E;  3GW2 A;  5L3F A;  2P7C B;  1QZZ A;  1B4A A;  3MEX A;  2E1C A;  1TQP A;  3O2P E;  3RI4 A;  2BEO A;  5CVU A;  3CJN A;  3DF8 A;  2JPB A;  3KZY A;  4HOB A;  2A07 F;  4MQV A;  3RJP A;  2UWM A;  5FFZ A;  3U1D A;  2A3S A;  1G4D A;  4PDK A;  3TO7 A;  4RAY A;  1RUO A;  4DNC A;  5H6Q A;  1ZAR A;  1D3Y A;  1Z7U A;  4BHP A;  1K78 B;  3MZH A;  3WTU C;  2BV6 A;  2XVC A;  4EJO A;  3KLN A;  2VE8 A;  2OZU A;  3ZMV A;  2EK5 A;  1SD6 A;  3G3Z A;  2OQR A;  2A6E F;  1CF7 B;  4HLY A;  4WF2 A;  2XAQ A;  2ZCW A;  3ELK A;  2VBW A;  1P92 A;  1TNT A;  2VBZ A;  4UV9 A;  1O3R A;  1KGS A;  3ZMD A;  2CSO A;  4O3M A;  5LBQ A;  1XSX A;  2XRO A;  4LB6 B;  2DO7 A;  2MH2 A;  4FX4 A;  1G6N A;  2QVO A;  2NS0 A;  4RB3 C;  1B1B A;  3MFK A;  3ZPL A;  5K5Q A;  4MNU A;  1FX7 A;  1QPM A;  5D8L B;  2FF4 A;  4O6J A;  5CVJ A;  1R7J A;  5DUI A;  3F3X A;  1FZP B;  4LG0 A;  1ODD A;  2GXB A;  1LDK B;  1DUX C;  1IN7 A;  4HZF A;  3JAM Z;  4OIO F;  1BI1 A;  4M9S A;  1MDM B;  4ENK A;  1WRJ A;  3FF5 A;  2XAS A;  3KLO A;  3P7N A;  4ZYG A;  3BPV A;  5CVV A;  4QLC U;  1Z9C A;  4EJV A;  1G3W A;  4ENJ A;  1O3S A;  2DW4 A;  3C3W A;  4G7H F;  2AS5 F;  1AWC A;  3J7A O;  5E17 F;  3RKW A;  4M72 A;  1R36 A;  2H09 A;  3R60 A;  2V9V A;  1YG2 A;  5D5X B;  2FBK A;  1K7A A;  1V3F A;  2XAH A;  4NHJ A;  5DD8 A;  1P4W A;  3I58 A;  3TKY A;  2HKO A;  4IVN A;  3TO9 A;  3H92 A;  3GZ6 A;  1XGM A;  1LNW A;  4MGR A;  1F1Z A;  5J6X A;  3ZQ7 A;  1SD4 A;  4KIF A;  3J81 Z;  1MJA A;  2NNN A;  4BYY A;  3TDZ C;  2D45 A;  2OA4 A;  1XCV A;  3LAP A;  2A5Y B;  5HVQ C;  4U0V A;  2EFW A;  3NRV A;  1FPQ A;  3VOD A;  1PUE E;  2GA2 A;  1QNT A;  1HST A;  2DFI A;  3RPU A;  3SZP A;  3IWZ A;  2R3S A;  5LEJ A;  1Z1D A;  1YYV A;  5DCF A;  4XRF A;  4HBL A;  4IRG A;  3FXQ A;  1U3E M;  1LB2 A;  2HQR A;  3OV8 A;  1FP1 D;  1IRG A;  3QAH A;  1J0R A;  4LG0 B;  3K0L A;  1HW5 A;  2NYX A;  4GGG A;  4M9X A;  4HX7 A;  1RUN A;  3TGN A;  3T8T A;  3M8F A;  5H6R A;  1XSD A;  3LQQ A;  2CWE A;  4Z2Y A;  1KYZ A;  4I0A A;  3N97 A;  2Q2E A;  2J5P A;  1T39 A;  3CUQ A;  5F64 A;  3S2W A;  3O6B B;  4FHT A;  2RN7 A;  3HSF A;  4HQE A;  3VOE A;  3EUH A;  2O3F A;  1R5G A;  4HDV A;  4N0B A;  5ERI A;  5LHI A;  2GWR A;  1FSE A;  2DBB A;  3M8E A;  3LFK A;  3LA7 A;  2PQ8 A;  3JTG A;  1T98 A;  2VE9 A;  4LK0 F;  4OMZ A;  3FXR A;  3ZMS A;  4L9V A;  4I02 A;  1LDJ A;  1PP7 U;  2IT0 A;  1S29 A;  2IPQ X;  1XN7 A;  3HTS B;  4WXH A;  3U2R A;  1W5T A;  1J5Y A;  4HA8 A;  4LLL A;  1FY7 A;  1IN4 A;  1TW2 A;  1YFH A;  3P9I A;  2NRA C;  2UXX A;  4IF4 A;  3HTU A;  5ICF A;  1IN5 A;  1ZLJ A;  3ROU A;  4JK1 X;  1O7F A;  3E5Q A;  3MAJ A;  4Q48 A;  2F2E A;  3JSP A;  2IJL A;  4AIH A;  1FBQ A;  3ZMZ A;  4LK1 F;  5E1X A;  4G7O F;  5HLG A;  5HDN A;  4ESJ A;  2P5K A;  3ECO A;  5CLS A;  4HV6 A;  2OAZ A;  3GZ5 A;  3FHZ A;  2PI0 A;  2RC4 A;  3KCC A;  4ZYD A;  1U2W A;  1Z91 A;  4L9N A;  3LA3 A;  1OR7 A;  1GVJ A;  3LST A;  5ILV A;  1HW1 A;  1W5S A;  3F8M A;  1HBX G;  1BOA A;  1WKM A;  3MWM A;  3WTS C;  3WTX C;  4CDG A;  1ONV A;  3DXJ F;  1G3T A;  3E97 A;  3M7G A;  3L7W A;  1P4A A;  4WCG A;  3RKX A;  2FNP A;  4FX0 A;  1I1G A;  4EGY A;  3Q5F A;  1FT9 A;  1W7P B;  4UXN A;  2P7V B;  5HDG A;  5HS9 A;  3HHG A;  2K7L A;  5F1R A;  3W6J B;  2CW0 F;  1EH8 A;  5ICC A;  1XDS A;  5LHH A;  2O03 A;  1ZRD A;  1IUY A;  4MTD A;  1TTY A;  4P9F A;  1HKT A;  2XKO A;  1UST A;  1H0M A;  4KT5 C;  5LRR A;  4S04 A;  2Q0O A;  3BPX A;  2HKX A;  4ENN A;  1ZG3 A;  4Y15 A;  3BRO A;  3ULQ B;  2VON A;  3CO7 C;  5FO5 A;  2K02 A;  3RYR A;  1FLI A;  3LAJ A;  4LMY A;  1K6O A;  1MZB A;  2MBF A;  1K78 A;  3RYP A;  2HYF A;  3FMR A;  4RS8 A;  4ASN A;  5IT9 Z;  1HXD A;  3CTA A;  3BDD A;  5E8I A;  3WGG A;  1CF7 A;  3T5X A;  4OIQ F;  3IHU A;  2HWV A;  4L9T A;  1U5T C;  1YO5 C;  2QQB A;  3WE2 A;  2FU4 A;  4IPA A;  3QU3 A;  5ED4 A;  3CUO A;  3H3Z A;  4L9J A;  5L3G A;  4RGR A;  2QLZ A;  1S7A A;  1EV7 A;  2EJR A;  4M73 A;  3SHF A;  3JW4 A;  1F5T A;  3DKW A;  1WSU A;  1IN6 A;  5BS6 A;  1KQ0 A;  4L18 B;  5LRS A;  3BJO A;  4HYE A;  3GFJ A;  1PDN C;  1P2F A;  1A04 A;  3M1E A;  2H27 A;  1JXS A;  2FE3 A;  5LEK A;  3WTZ A;  1BI3 A;  4U7B A;  1V4R A;  5DDG A;  5HS8 A;  1MDM A;  1I1S A;  5D8K B;  3P9K A;  5D4S A;  2K86 A;  5D6F A;  2HDC A;  1S6L A;  4AVP A;  3WTT C;  1ZAO A;  4ZH4 F;  1Z6R A;  1R23 A;  2CQK A;  3BOQ A;  2YX7 A;  4L0Z B;  2GAU A;  2VN2 A;  2KKO A;  4WWC A;  5AIP A;  1ZGJ A;  2V6C A;  1U6G A;  1BJA A;  3ZN1 A;  2QBY A;  2JZY A;  1BI0 A;  3ERE D;  3F8C A;  2Y75 A;  1C0W A;  3VB2 A;  2PG4 A;  1IXS B;  1DDN A;  3WGI A;  1P6R A;  3M9A A;  2O8X A;  2RDP A;  3HSR A;  4LLN A;  1TLH B;  1DP7 P;  3RDI A;  2EFQ A;  1HKQ A;  1TW3 A;  3F8N A;  3FMS A;  4A12 A;  4O5V A;  5E20 A;  4EM2 A;  1Z05 A;  2G7H A;  2DI3 A;  4KNY A;  2VOO A;  4Q4Z F;  3J80 K;  1IZ1 A;  2FRH A;  4KMF A;  2FA5 A;  2L4M A;  3ZN0 A;  4UVA A;  5ICE A;  3QRF F;  2OBP A;  3KFW X;  3GX4 X;  2KIM A;  1FWZ A;  2JT1 A;  4XSX F;  1BBY A;  4QWQ A;  5CVI A;  4KIC A;  5FD5 A;  2RV8 A;  1XDU A;  2FBI A;  1U78 A;  2E1N A;  1IW7 F;  1ZH5 A;  4EQQ A;  1REP C;  1HQC A;  1FNN A;  2DLL A;  3LWF A;  2FOK A;  2ELH A;  1SD7 A;  2ISZ A;  4KN7 X;  4HDU A;  3PQJ A;  4I2O A;  3HUG A;  1OMI A;  5KK1 A;  4UVC A;  1R22 A;  1SD5 A;  4ESF A;  4JBA A;  4ESB A;  4WX9 A;  3WE3 A;  4RB1 A;  2MD5 A;  4KUM A;  1XGS A;  4L5J A;  2QBY B;  5K5O A;  4BXU A;  4LLG F;  5DUK A;  2L01 A;  3JSO A;  4LFU A;  3K9T A;  3PQK A;  2FXA A;  1HKS A;  2DQL A;  2QM3 A;  3L09 A;  3NQO A;  4M9Z A;  2F5D A;  4CIC A;  4UHT A;  1FOK A;  1H9G A;  2C6Y A;  3WTW C;  1R1V A;  2BGC A;  2OD5 A;  1Q1H A;  2HOE A;  2STW A;  4LJZ F;  3WG9 A;  1GXQ A;  1AOY A;  2LKP A;  5BMZ A;  3D5L A;  1KU2 A;  3KP7 A;  4ZYH A;  4RB2 C;  3K1P A;  5DCM B;  2YU3 A;  3FM3 A;  2XRN A;  4I09 A;  4XLP F;  2ZJ2 A;  1FP2 A;  2EB7 A;  3I4P A;  3KP5 A;  5E8G A;  3LA2 A;  3QPH A;  2MH9 A;  4XLN F;  3QP5 A;  1MKM A;  2JRT A;  2WC2 A;  2PJP A;  1YW7 A;  4HF2 A;  4MTE A;  3R61 A;  2J5O A;  3F21 A;  1KU7 A;  3QPT A;  4A0X A;  4A6E A;  2XV4 S;  2G7U A;  4I98 B;  3DQV C;  4KA4 A;  1BIB A;  1ZRF A;  3SFZ A;  4DQ2 A;  2X4H A;  2QQA A;  3T8R A;  2K4B A;  2B0L A;  1XGO A;  1OYI A;  5ILU A;  3GYH X;  3HRT A;  1QBJ A;  2YPR A;  4ETS A;  2VC0 A;  3CLO A;  1WWX A;  1XD7 A;  5D4R A;  5K5R A;  2HS5 A;  1JE8 A;  4PGH A;  4IHS A;  2L02 A;  4BNC A;  4MQ9 F;  4D0P A;  1XGN A;  5FLX K;  2FMY A;  4N9H A;  2IA2 A;  4MEY F;  3D0S A;  1H9T A;  3WU1 B;  4OIP F;  1IXC A;  3WOD F;  1WQ2 A;  1MJB A;  2XIG A;  2FSW A;  2GA1 A;  1W7P A;  5DD4 A;  4GO1 A;  1O57 A;  4GYI A;  2A69 F;  1R58 A;  3GUD A;  3IC7 A;  3KZZ A;  2L54 A;  3CDH A;  2EA4 A;  2YR2 A;  3HIF A;  1UCR A;  2NAZ A;  2IW5 A;  3F23 A;  2P8T A;  1B9M A;  4CZZ A;  1S3J A;  5K1Y A;  2GZW A;  2TDX A;  4BAY A;  2PFB A;  1E17 A;  2QEN A;  4HAM A;  1ULY A;  4M71 A;  5A2Q Z;  5HDK A;  2DK8 A;  3WTY C;  1KA8 A;  2IRF G;  2FNA A;  1YW8 A;  3EYI A;  2R7D A;  1ZYR F;  3HYI A;  2XAG A;  1ZHF A;  1D5V A;  1ON1 A;  5FB2 A;  4GXO A;  2STT A;  2G9W A;  2ESN A;  2NNY A;  3B73 A;  3RKY A;  3V8L A;  2VC1 A;  2OU2 A;  1WI9 A;  3VEP A;  2D1H A;  4EMS A;  5JI6 A;  1MGT A;  3MCZ A;  4G8X A;  4ZZD A;  4M74 A;  2M8E A;  4A5N A;  2GXG A;  1F4K A;  4EM1 A;  2KIU A;  1JHH A;  2Z3Y A;  3I0T A;  4U0Y A;  1G3Y A;  3IRR A;  1BC7 C;  3HHH A;  5EEH A;  4F7Z A;  2DK5 A;  4CGZ A;  2D2W A;  4ON0 A;  1XSV A;  4Y17 A;  1Y0U A;  1HW2 A;  5E1Z B;  2F5F A;  3WU0 A;  1UHM A;  2IVM A;  3RPQ A;  1FBS A;  1BIA A;  1IRF A;  1IXR C;  2K27 A;  4BHB A;  4YFX F;  2EFO A;  4BQA A;  5D5V B;  2PLY A;  2FML A;  3BZ6 A;  5EEG A;  2ZNY A;  2LDU A;  4A2U A;  4KYW A;  2QYO A;  3B02 A;  5L3D A;  3V7C A;  1CGP A;  1B9N A;  4H0E A;  2Z5U A;  2DU9 A;  4I0B A;  3BP8 A;  2O61 A;  2EV6 A;  4OIN F;  2Z33 A;  4YG2 F;  4G6D A;  3EDP A;  4CYD A;  1DPR A;  4HF1 A;  4IHT A;  2RQP A;  2EV0 A;  2W84 A;  1J2X A;  2F5C A;  2V1U A;  3SXY A;  4B8X A;  3ZMU A;  3BJA A;  2MLK A;  4E70 A;  3I64 A;  4G7Z F;  5HS7 A;  1U5T B;  2QZ8 A;  2W57 A;  4RGS A;  4IRH A;  3TQN A;  4PCQ A;  1ZN2 A;  3F6O A;  3ABU A;  3I59 B;  4WXC A;  2VOD A;  1STZ A;  3DPT A;  3EET A;  3GVA A;  1KQ9 A;  1PP8 F;  4WK8 F;  5IT9 K;  3L00 A;  5JHU A;  1LVA A;  1ZG1 A;  1U8R A;  1FBU A;  3LQR A;  3HRU A;  3HSE A;  1OPC A;  4KFC A;  2CG4 A;  3V8K A;  3BJ6 A;  3MQ0 A;  3MZY A;  5H20 A;  2L3D A;  2L4A A;  4LGW A;  4EV0 A;  2ZME B;  4RGU A;  1XMK A;  3SQN A;  1Z6T A;  1L3L A;  1W7P D;  2VT2 A;  3IRQ A;  2ISY A;  2Y0M A;  4ENM A;  1TQM A;  4UVB A;  3REO A;  2M87 A;  2Z9O A;  1UHW A;  1L0O C;  3ECH A;  4S05 A;  2W24 A;  2E7X A;  5JFR A;  2H6B A;  2MLG A;  5DV5 A;  3F8B A;  1KU9 A;  4R1H A;  2ZBK A;  3Q9V A;  1G3S A;  5L3C A;  1YQA A;  5BOX A;  2IP2 A;  4KN4 X;  2V1D A;  3BY6 A;  2M30 A;  2XAF A;  2KRF A;  1TQI A;  4KIG A;  1O7L A;  3ZP5 A;  3KP2 A;  4OU0 A;  5D5W B;  3R4K A;  1KQ8 A;  4UNO A;  2ZFW A;  3COA C;  1D8K A;  4R79 A;  1TNS A;  4IJA A;  1BC8 C;  4AD9 A;  4YFK F;  1TBX A;  2XUB A;  5LHG A;  1ZGA A;  4ZYE A;  2X0L A;  2XHK A;  3ZMT A;  3K1N A;  4FT8 A;  4MHG A;  3E5X A;  5D5U B;  3F22 A;  4P5O A;  2M45 A;  2Z99 A;  3R6S A;  2KJC A;  4UUV A;  2HEO A;  3FZV A;  3V8J A;  3KEQ A;  3DPL C;  1YS6 A;  1SFE A;  5DCM A;  5ILS A;  5LGU A;  4B09 A;  5DYM A;  3IKT A;  2QWW A;  1I27 A;  3HRS A;  1DPU A;  4A0Y A;  1ON2 A;  3I71 A;  1LEA A;  3RIR A;  4HLX A;  1NHA A;  3GF2 A;  3J80 Z;  2EV5 A;  4HV5 A;  5FFX A;  1XMA A;  4A6D A;  1LDD A;  3IKV A;  2HZT A;  1QQI A;  5L3E A;  3V7R A;  4N9I A;  4K2E A;  2HQN A;  2XGX A;  3F72 A;  1I5Z A;  4BHC A;  3KE2 A;  2E7W A;  4BH9 A;  2VXZ A;  1FYK A;  2D1V A;  2XKP A;  3JAM K;  2V1X A;  3CO6 C;  3TDU C;  2Q8K A;  2A6H F;  2PBI A;  1SAX A;  2EFP A;  5KVR A;  2IA1 A;  2LF8 A;  4OOI A;  2VOP A;  3IL2 A;  1UB9 A;  3R0J A;  4GYG A;  5JR3 A;  3R0A A;  5CVR A;  2OQG A;  3E6D A;  3K1M A;  3KEO A;  1T6S A;  1EH6 A;  3AAF A;  5LGT A;  5HLI A;  1RZ4 A;  2YX4 A;  4HX4 A;  5E1W A;  3J81 K;  4M6X A;  2V79 A;  3V4G A;  1QO0 D;  4ZZL A;  3N4M A;  4UV8 A;  1QGP A;  2IA0 A;  4AIJ A;  3WGH A;  2PEX A;  1T2K A;  1FYL A;  1J75 A;  5L3B A;  3IWF A;  1IF1 A;  2P6S A;  3E6C C;  1MJ9 A;  1FSH A;  2DAO A;  4PZJ A;  5LGN A;  2RKH A;  3JTH A;  3PFI A;  5TRD A;  2LF7 A;  2O0Y A;  4YII A;  1FC3 A;  4G6Q A;  4RAZ A;  2UZK A;  2ACJ A;  1P4X A;  4HQM A;  1I6X A;  2VT3 A;  5LLQ A;  4EJU A;  4YIF A;  2HYG D;  4CXF A;  1BI2 A;  5BPI A;  4KMU X;  2COM A;  2A61 A;  2Y48 A;  2UXN A;  2ZKZ A;  1T0F A;  4AIK A;  4EM0 B;  2VBY A;  4Q47 A;  2M5W A;  4WXD A;  1R00 A;  3K69 A;  2JPC A;  1YIO A;  3VFZ A;  1T38 A;  1X3U A;  1JGS A;  3Q9S A;  3QP6 A;  2JTV A;  1OYY A;  1SMT A;  5AON A;  1ZG5 A;  3C1D A;  3C7J A;  4XSZ F;  2ZNZ A;  5FLX Z;  2P5V A;  2AXL A;  2XAJ A;  1J9I A;  2WV0 A;  3GO5 A;  3G73 A;  4EJW A;  4TV7 A;  3KET A;  1R1T A;  2CO5 A;  2JSC A;  4EGZ A;  2CGP A;  4L0Y B;  3RTR A;  3ML6 A;  5JVT A;  5CJ9 A;  3GEZ A;  4HX8 A;  2HTJ A;  2K4J A;  2ESH A;  2DT5 A;  2DPU A;  5J8C A;  4LD5 A;  2RVC A;  2RNJ A;  2MA3 A;  4GCV A;  3I53 A;  3GWZ A;  1U5T A;  5A2Q K;  3GFM A;  3T0Y A;  3EYY A;  1RI7 A;  1HSJ A;  5D6E A;  4A0Z A;  4PGG A;  1UFM A;  3I59 A;  4G94 A;  2VBX A;  3NEU A;  4XBF A;  2FBH A;  2BE5 F;  4G9Y A;  2BYV E;  3TOA A;  3E6B A;  3I54 A;  3K2Z A;  3T1B A;  1OKR A;  2OZ6 A;  3W6K B;  1LJ9 A;  2HR3 A;  1BM9 A;  2W85 A;  2DPD A;  2PN6 A;  3GFL A;  1JHF A;  1KYW A;  3FXU A;  1YS7 A;  3C18 A;  4CO8 A;  4RGX A;  2P6T A;  3V7S A;  3FM5 A;  1W4M A;  4P55 A;  5J8F A;  1F9N A;  5BPD A;  2A68 F;  1ZRE A;  2ZME A;  3FX3 A;  4HW0 A;  1R5H A;  4KDP A;  2H6C A;  3ABT A;  4OIR F;  2LNB A;  3EQL F;  4I7H A;  4IXA A;  2W25 A;  1S7O A;  1RIO H;  4EVI A;  2FQ3 A;  5HOO A;  4MEX F;  4U88 A;  2KJB A;  5F6F A;  2HGC A;  5DEQ A;  5FD6 A;  3DP7 A;  3L2C A;  4L5I A;  2ZXJ A;  3WTV C;  1YLF A;  4KIB A;  4CHU A;  3FWE A;  4P96 A;  3OOP A;  1USS A;  2GQQ A;  3CUQ B;  4IRI A;  2BBY A;  3HOT A;  1S8N A;  6PAX A;  3GXO A;  4JQF A;  2HTS A;  1QZY A;  3KP6 A;  4U0W A;  3HRM A;  1B6A A;  3KP4 A;  5BQT A;  2P4W A;  4A5M A;  1IN8 A;  5AIQ A;  1O3T A;  2HFH A; 
#chains in the Genus database with same CATH topology
 4M3F A;  5IT3 A;  4EJT A;  3K4M A;  1FIA A;  3J7A Y;  1EH7 A;  3F8F A;  3NWT A;  5HLH A;  1YW9 A;  2LC2 A;  1QHG A;  2EWN A;  2LSO A;  1GUU A;  3CUQ C;  1VTN C;  1B8I B;  2CFX A;  2DTR A;  1X2M A;  4PSW A;  1E2X A;  1SMY F;  3E3V A;  1BN5 A;  3QU6 A;  4XLF A;  3DV8 A;  1D8J A;  2MC3 A;  4Q5S F;  2P5L C;  3CC7 I;  1IUF A;  4PFO A;  3BWG A;  4YFN F;  3TOB A;  2MGQ A;  2ADU A;  1YHQ I;  5FGM A;  4B1R A;  4Y13 A;  2GOM A;  3ZQI A;  2PMH A;  3P9C A;  1ERD A;  2K5C A;  3CDL A;  2UUZ A;  1RES A;  1WJA A;  2EA2 A;  2R7F A;  3I5U A;  3G1M A;  4A3J J;  2L9N A;  2LFB A;  2DFE A;  3SZT A;  4I01 A;  5TJJ A;  1T08 B;  3HBL A;  2LVS A;  4AWX B;  3QOP A;  5ICG A;  2Y2Z A;  3JCU C;  2XPV A;  1GXP A;  4B48 A;  2DOE A;  4OWR B;  4W97 A;  2TCT A;  2EIJ H;  2LK2 A;  2PMU A;  3FXK A;  4HF0 A;  4UB8 C;  1TC3 C;  3HOZ J;  3O3K A;  4P9U A;  1X1P A;  2YS9 A;  3H9G A;  1SFU A;  3DFG A;  1W5C C;  4YRV A;  2CQN A;  3K70 D;  4II2 A;  1KU3 A;  5TGT A;  1X4O A;  3OYC A;  3BR1 A;  5F1J A;  1RC9 A;  5FKN A;  2M1B A;  2RGV A;  4LB5 A;  3G4S I;  3DEU A;  2NOJ B;  3BG9 A;  1K4T A;  1R1U A;  5C44 J;  2QQ9 A;  5E18 F;  4PSX A;  1PUF A;  4DIQ A;  3DU5 A;  5J4V A;  4ZTJ A;  3OIO A;  3H5R A;  2ETH A;  4M6Y A;  3GFI A;  4RB0 A;  3GLX A;  1ZLK A;  2MSY A;  1VQ8 I;  1OCO H;  1J7K A;  2VPL A;  2WWY A;  2ECC A;  3L9F A;  1LEB A;  1X1D A;  2QUF A;  1AKH B;  3HDD A;  4MFE A;  3OY9 A;  2HYJ A;  1R6R A;  1H8A C;  3E5U A;  4U7D A;  1ITY A;  4ITV A;  2YSR A;  1IC8 A;  1SFX A;  1FMV A;  2ZC2 A;  3G71 I;  2VKV A;  1BA5 A;  1G8X A;  2EFN A;  3W3C A;  2MD0 A;  3TO6 A;  1O3Q A;  3A4C A;  2EBI A;  2DQR A;  3U9G A;  3E6M A;  4NQW A;  2R92 J;  1ZR4 A;  4GDF A;  4F52 A;  2LOO A;  3ISP A;  1XCB A;  4RAF A;  1MD0 A;  2KRC A;  1FYM A;  1XB4 A;  3ONQ A;  3U21 A;  1WHU A;  3S2H J;  1YTY A;  1VQN I;  3GZN B;  1OYW A;  2QKM B;  4XID A;  3HOS A;  1K79 A;  3H3U A;  1OR7 C;  3FMQ A;  1WJD A;  3LSR A;  2FEZ A;  3CCL I;  3KP3 A;  4R8H A;  5CYV A;  1IAW A;  4C2M J;  4NB5 A;  4BEH A;  2IXS A;  1J59 A;  1LQ1 A;  2H94 A;  2GIV A;  3DLA A;  1GHC A;  4OMY A;  2M0C A;  2WTE A;  1RNL A;  4XRS G;  2KIF A;  2ZO4 A;  2DDA A;  2F5E A;  2K9N A;  4DYC A;  1ZRC A;  1B59 A;  4ZJZ A;  4HNT A;  1R4N B;  2CYY A;  3F6V A;  2O6G E;  3GW2 A;  5L3F A;  2P7C B;  4BU2 A;  1QZZ A;  4XN3 A;  1B4A A;  5F0C A;  1SVO A;  5FRO A;  5CPR B;  3MEX A;  2R5Y A;  2E1C A;  1TQP A;  2DMT A;  3J7Z I;  2JUG A;  3O2P E;  4E7J A;  3RI4 A;  3G2B A;  2BEO A;  5CVU A;  1FMW A;  2OC6 A;  3I9V 2;  3CJN A;  3BQY A;  3DF8 A;  3NAU A;  1SEU A;  2JPB A;  2DA5 A;  5IYD J;  2CQQ A;  3KZY A;  1MH4 A;  2CQX A;  4HOB A;  4Y3O A;  3BZC A;  2P0W A;  3G6E I;  5IP6 A;  2A07 F;  4MQV A;  3D1N I;  3RJP A;  2UWM A;  5FFZ A;  2RNG A;  3U1D A;  1W36 C;  2A3S A;  1G4D A;  4PDK A;  1MMN A;  1Y56 A;  3TO7 A;  4RAY A;  3HL2 A;  2DMP A;  1HC8 A;  1RUO A;  2LG4 A;  2IGN A;  1WJF A;  3C2H A;  4DNC A;  5H6Q A;  1ZAR A;  1D3Y A;  1Z7U A;  2ME6 A;  4BHP A;  2R7Z J;  1K78 B;  3MZH A;  3WTU C;  2BOL A;  1GDT A;  2XF6 A;  2BV6 A;  3ERM A;  2L7Z A;  2XVC A;  3BG3 A;  4EJO A;  1XC5 A;  2O9L A;  4V2G A;  3KLN A;  2VE8 A;  2OZU A;  1R5I D;  2EK5 A;  3ZMV A;  3MKZ A;  1SD6 A;  3G3Z A;  3RQ4 A;  2OQR A;  5M5Y J;  2VJI A;  3GCM A;  2A6E F;  3KEY A;  1CF7 B;  1GV2 A;  4WF2 A;  3WHC A;  2KMU A;  5J3L A;  2XAQ A;  3L2W A;  2ZCW A;  1FOY A;  4HLY A;  3ELK A;  5KHD A;  3ZQL A;  1X4P A;  2VBW A;  3DU6 A;  4IHW A;  3FDY A;  1XTA A;  1P92 A;  3L2R A;  1TNT A;  2BVM A;  2VBZ A;  4UV9 A;  1O3R A;  1KGS A;  3ZMD A;  4J00 A;  1LKX A;  3HB9 A;  2CSO A;  4O3M A;  5LBQ A;  2DA6 A;  1XSX A;  3KYC B;  1MSF C;  2XRO A;  1BL0 A;  4LB6 B;  2DO7 A;  3KX2 A;  4I76 A;  2MH2 A;  4RLQ A;  4FX4 A;  1G6N A;  2QVO A;  2NS0 A;  4RB3 C;  1B1B A;  1FOW A;  3MFK A;  3ZPL A;  5K5Q A;  2AXT C;  3C2B A;  2QEX I;  3FXO A;  3QYE A;  3KZI C;  5EZG A;  3CCJ I;  1WZ2 A;  4MNU A;  1FX7 A;  1QPM A;  4XR6 A;  4AUX A;  5D8L B;  4XON A;  5DTD A;  2FF4 A;  2MW8 A;  4O6J A;  2K9Q A;  5CVJ A;  3S32 A;  1R7J A;  3IP4 B;  3CCR I;  5EGO B;  5DUI A;  3F3X A;  4A93 J;  1FZP B;  5IYC J;  4XNF A;  4LG0 A;  1ODD A;  4D7N A;  3IH3 A;  2GXB A;  2ID6 A;  3BC8 A;  4UUS A;  1LDK B;  1DUX C;  1WH7 A;  1Z3Y A;  2RAE A;  2E35 A;  1IN7 A;  2W7N A;  3PNY A;  4HZF A;  2ICW G;  3JAM Z;  2OUM A;  1BI1 A;  4OIO F;  4M9S A;  1MDM B;  4ENK A;  1WRJ A;  3FF5 A;  4X6A J;  2XAS A;  3WU2 C;  3KLO A;  3P7N A;  4ZYG A;  3K2A A;  3BPV A;  3K4K A;  4DZP A;  1VF9 A;  3OYK A;  4A3M J;  2NVT J;  1X58 A;  5CVV A;  4X1E A;  5J1Y A;  4QLC U;  1Z9C A;  4EJV A;  1G3W A;  4ENJ A;  1O3S A;  2DW4 A;  3C3W A;  2EIL H;  5B1B H;  2HVQ A;  4G7H F;  2AS5 F;  1AWC A;  3J7A O;  1X1A A;  5E17 F;  3RKW A;  4M72 A;  3S93 A;  5F0H A;  1R36 A;  3JRB A;  3BR5 A;  2H09 A;  1YJN I;  3OSG A;  1V5E A;  4LIU A;  3R60 A;  2V9V A;  1YG2 A;  5D5X B;  2X6X A;  2FBK A;  4GRI A;  1K7A A;  1V3F A;  2XAH A;  4NHJ A;  3LFU A;  3HC7 A;  5F0F A;  3E1S A;  2R7Q A;  4II3 A;  4JYK A;  5DD8 A;  4FAS D;  4Z6Y A;  1IGN A;  2LR8 A;  3PIO F;  5M5X J;  1P4W A;  2DYS H;  3I58 A;  4UY8 I;  3TKY A;  3SEZ A;  3GTQ J;  2HKO A;  2L7M P;  4IVN A;  3TO9 A;  4CSW A;  1A6I A;  3H92 A;  3TL4 X;  3GZ6 A;  1XGM A;  1LNW A;  5GAG J;  1WVR A;  1PJR A;  2M7A A;  2AO9 A;  3H0G J;  4MGR A;  1O4X A;  1F1Z A;  1APL C;  2JA6 J;  1POG A;  4BJ6 C;  5J6X A;  3ZQ7 A;  1SD4 A;  4KIF A;  4UB6 C;  1P7I A;  2I8D A;  3DBL B;  3J81 Z;  2E36 A;  3I4N J;  2QSH X;  1MJA A;  5HNF A;  2NNN A;  1K6Y A;  3VYU B;  4BYY A;  1IJW C;  4C2U A;  1MW7 A;  3TDZ C;  3KYL A;  2EZH A;  2D45 A;  2OA4 A;  4PUS A;  1XCV A;  2GBY A;  3LAP A;  4AC0 A;  2IEK A;  1ORK A;  2A5Y B;  2M34 A;  5HVQ C;  2XGE A;  4U0V A;  2EFW A;  3NRV A;  2E71 A;  2XB0 X;  9ANT A;  1FPQ A;  3VOD A;  1PUE E;  2GA2 A;  1QNT A;  3PL8 A;  1HST A;  3DTI A;  1Y1W J;  2YUS A;  2E2J J;  2DFI A;  3RPU A;  1D5Y A;  3SZP A;  3IWZ A;  2R3S A;  3CP8 A;  5LEJ A;  2V6E A;  1Z1D A;  3HM5 A;  2X6W A;  1S7E A;  2LH9 A;  1YYV A;  5DCF A;  3MMY B;  1TL8 A;  3DEE A;  4XRF A;  2WAQ A;  4HBL A;  4IRG A;  5TIS C;  1IG7 A;  3FXQ A;  3RZD J;  1U3E M;  1LB2 A;  4CCJ A;  1BJZ A;  3S1M J;  1KZH A;  2HQR A;  3OV8 A;  4F55 A;  1FP1 D;  3HOW J;  1JJ6 C;  5M3F J;  1IRG A;  3QAH A;  3O8H A;  1J0R A;  2ZJP F;  4LG0 B;  2F4O B;  3K0L A;  4D5F A;  1HW5 A;  3CCY A;  2M9H A;  2NYX A;  4IHX A;  4GGG A;  4M9X A;  4HX7 A;  1RUN A;  1HOM A;  3Q0U A;  3TGN A;  3T8T A;  3M8F A;  2KHM A;  5H6R A;  1XSD A;  2JJ7 A;  3JRD A;  5HLT A;  2LYC A;  3LQQ A;  1S9H A;  3BR3 A;  3BR6 A;  2CWE A;  3GTM J;  1QVT A;  4Z2Y A;  1KYZ A;  4I0A A;  3N97 A;  2Q2E A;  4A3G J;  4JX4 A;  4ZTF A;  2J5P A;  1T39 A;  3CUQ A;  2BXY A;  5F64 A;  3S2W A;  3U1K A;  4B4C A;  3O6B B;  3RSN A;  4FHT A;  4IL6 C;  5FRN A;  2RN7 A;  3HSF A;  4C30 A;  3OYN A;  2H1K A;  3BG5 A;  2DMU A;  4HQE A;  3CF2 A;  3OIP A;  3E7L A;  3VOE A;  4P1W A;  3OYL A;  3S2D J;  2BW3 A;  3EUH A;  2O3F A;  4XOP A;  1VND A;  1R5G A;  3MKW B;  4N0B A;  5ERI A;  4HDV A;  5LHI A;  2GWR A;  1FSE A;  1IDY A;  3CC4 I;  2DBB A;  3HPG A;  2O7O A;  3M8E A;  3LFK A;  5GPC A;  3LA7 A;  1VQ5 I;  1MBE A;  4N4O B;  2PQ8 A;  4BAC A;  4BDY A;  3JTG A;  1ZR2 A;  1FIP A;  2Y69 H;  3IAS 2;  3TMO A;  3TBI A;  2V9P A;  1T98 A;  4ZDO A;  2XSD C;  2DA7 A;  2DA2 A;  1NK3 P;  1B8I A;  5F04 A;  2JUC A;  2FUG 2;  2VJ4 A;  3SYT A;  2VE9 A;  4LK0 F;  4OMZ A;  3FHN A;  2CW8 A;  3FXR A;  3ZMS A;  4L9V A;  4I02 A;  1BW5 A;  1HDD C;  1LDJ A;  2DOF A;  3CLQ A;  1PP7 U;  4MIM A;  2IT0 A;  1S29 A;  2IPQ X;  1XN7 A;  2K40 A;  3M4O J;  1OCC H;  4WXH A;  1AA7 A;  3HTS B;  3DEW A;  3U2R A;  4LOC A;  5M3M J;  2IS4 A;  1W5T A;  1J5Y A;  2HXI A;  4HA8 A;  4PJN A;  4BXF A;  4LLL A;  2ZJQ F;  1FY7 A;  1IN4 A;  1X1C A;  1TW2 A;  1X3Z B;  1YFH A;  1ACI A;  3P9I A;  3WG7 H;  2NRA C;  1SFO J;  1RKW A;  2UXX A;  4IF4 A;  5DM6 F;  5FJ8 J;  3HTU A;  3A02 A;  2NXN B;  5ICF A;  1IN5 A;  1ZLJ A;  3ROU A;  4JK1 X;  1O7F A;  3E5Q A;  2Z1D A;  3MAJ A;  4Q48 A;  4IQ4 A;  2F2E A;  3JSP A;  2IJL A;  4PFP A;  4AIH A;  1FBQ A;  3GTK J;  3ZMZ A;  4Y33 A;  4LK1 F;  5E1X A;  2CUJ A;  4G7O F;  5HLG A;  5HDN A;  4ESJ A;  2CMP A;  2P5K A;  3ECO A;  5CLS A;  4HV6 A;  2OAZ A;  5GTH C;  3GZ5 A;  3FHZ A;  2PI0 A;  2RC4 A;  1QU3 A;  3KCC A;  2KZG A;  1ETX A;  4ZYD A;  1U2W A;  3DKX A;  4H4K C;  1Z91 A;  4L9N A;  3LA3 A;  3PJR A;  1OR7 A;  1I6H J;  1GVJ A;  2HXO A;  2L7K A;  3LST A;  5CKT A;  4LIV A;  1AKH A;  5ILV A;  1HW1 A;  5GAH J;  1W5S A;  3F8M A;  1HBX G;  2E1M C;  2Y31 A;  2EIN H;  2KL4 A;  1ETK A;  4Y7N J;  1QA6 A;  1BOA A;  1Y6I A;  1WKM A;  3MWM A;  4J19 A;  4M3E A;  4HPQ A;  4X0G A;  1Z77 A;  2HPM A;  3WTS C;  1FTT A;  3WTX C;  2VPR A;  4CDG A;  4FE7 A;  4OAZ A;  2HZD A;  2PJR B;  1ONV A;  4FQG A;  3DXJ F;  1G3T A;  3E97 A;  5J1R A;  3M7G A;  3L7W A;  4HNU A;  1P4A A;  1TT5 B;  4WCG A;  3RKX A;  2FNP A;  4FX0 A;  2E2H J;  2BVL A;  3G1O A;  1I1G A;  4EGY A;  3Q5F A;  2DMQ A;  1FT9 A;  2CUE A;  2BW3 B;  3DTE A;  1W7P B;  4UXN A;  4Y4R A;  2P7V B;  5HDG A;  5HS9 A;  2W48 A;  4RM3 A;  3BTL A;  3OWT A;  3GTG J;  1MBF A;  2K7L A;  3HHG A;  5F1R A;  2CJJ A;  3W6J B;  3FBI B;  2CW0 F;  1K4S A;  1EH8 A;  1SC7 A;  5ICC A;  2WAE A;  4NUB A;  1T0F C;  1XDS A;  5LHH A;  2O03 A;  1ZRD A;  2DXI A;  1IUY A;  3MKY B;  1BW6 A;  1TTY A;  2VKE A;  4P9F A;  4MTD A;  1QPI A;  1HKT A;  2XKO A;  1UST A;  4BQO A;  1H0M A;  2DOD A;  1ENH A;  3DBH B;  4EAT A;  4KT5 C;  5LRR A;  3RPU D;  2DFH A;  1TWC J;  1Z67 A;  4A3I J;  4S04 A;  2Q0O A;  3BPX A;  3ESW B;  5K7H A;  3OS1 A;  5KAI C;  2HKX A;  3CCS I;  4ENN A;  3GTP J;  1ZG3 A;  4Y15 A;  3BRO A;  3ULQ B;  2VON A;  1SVM A;  4XLC A;  3CO7 C;  1T95 A;  5FO5 A;  2K02 A;  2R93 J;  3RYR A;  1NG7 A;  1J09 A;  1FLI A;  2R5Z A;  3LAJ A;  4LMY A;  1YI2 I;  1D1C A;  1PVE A;  2HI3 A;  5E3N A;  1K6O A;  2FQ4 A;  2R7V A;  1VQ7 I;  1MZB A;  1UEL B;  3JRF A;  4E7I A;  2ZSH B;  2MBF A;  4BXX J;  3K4L A;  1K78 A;  4XL9 A;  2BY2 A;  3TP0 A;  3RYP A;  2HYF A;  3IV5 A;  3PFY A;  3FMR A;  4C9Y A;  3CCU I;  4RS8 A;  4A3B J;  2JN6 A;  4ASN A;  5IT9 Z;  3VDX A;  1HXD A;  3CTA A;  3BDD A;  2DJN A;  5E8I A;  3WGG A;  1CF7 A;  3W2W A;  3T5X A;  3ZQH A;  3EUA A;  5EYR A;  4OIQ F;  2VB6 A;  3IHU A;  2HWV A;  4L9T A;  1D1B A;  1U5T C;  2FD5 A;  2B9S A;  1MBG A;  3OYA A;  1YO5 C;  1VQ9 I;  2QQB A;  3WE2 A;  2FU4 A;  4IPA A;  3QU3 A;  3VSL A;  1S72 I;  5ED4 A;  1TP4 A;  3CUO A;  3K10 A;  3H3Z A;  4L9J A;  5L3G A;  4RGR A;  2QLZ A;  2AQF A;  1Z21 A;  1S7A A;  1EV7 A;  1OJL A;  2ELJ A;  2EJR A;  1N78 A;  5H2F C;  1FJL A;  4M73 A;  3SHF A;  3JW4 A;  1F5T A;  3HXL A;  3DKW A;  1WSU A;  1IN6 A;  5BS6 A;  1KQ0 A;  2Z2S B;  4L18 B;  3BG6 A;  5LRS A;  5EGO A;  3BJO A;  3CJR B;  4B3A A;  5E3M A;  4HYE A;  3GFJ A;  3CP2 A;  1P2F A;  1PDN C;  3K4J A;  1A04 A;  1A6Q A;  5K7F A;  3M1E A;  2H27 A;  1JXS A;  1TT0 A;  2FE3 A;  5LEK A;  4I99 C;  3WTZ A;  1JGG A;  1BI3 A;  4U7B A;  1V4R A;  2XPU A;  5DDG A;  2X1D A;  1D1A A;  2MYS A;  2CV1 A;  2W4S A;  3E0J B;  2GM4 A;  4KIT B;  2VQG A;  3MZ8 A;  3QOD A;  3CME I;  5HS8 A;  4C2T A;  1MDM A;  1JI8 A;  1I1S A;  4QSH A;  5HNH A;  2F6C A;  3HOX J;  5M5W J;  5D8K B;  3P9K A;  1Y39 A;  1FTZ A;  3I3L A;  5D4S A;  2K86 A;  1VQM I;  5D6F A;  1EF4 A;  2TRT A;  2HDC A;  1S6L A;  2XRL A;  4AVP A;  3WTT C;  1ZAO A;  4ZH4 F;  4YIR X;  3FK7 A;  1Z6R A;  1R23 A;  2CQK A;  2XGD A;  1SFK A;  3BOQ A;  3B6A A;  2P81 A;  1FOX A;  1ZGW A;  5E3O A;  3CES A;  3DKY A;  2YX7 A;  5CQG A;  4L0Z B;  1N25 A;  1QHH D;  2GAU A;  2VN2 A;  2KKO A;  4AU7 A;  4WWC A;  1ETY A;  1ZGJ A;  5AIP A;  2V6C A;  1LFP A;  5K7Z A;  1U6G A;  1DGW Y;  2KIS A;  1WJB A;  2XF7 A;  3GTJ J;  1BJA A;  2F48 A;  3ZN1 A;  2QBY A;  2JZY A;  1BI0 A;  3ERE D;  3CCE I;  3F8C A;  2Y75 A;  1C0W A;  3VB2 A;  2PG4 A;  2IS2 A;  2CS3 A;  1IXS B;  2R5Z B;  4RLF A;  1DDN A;  3WGI A;  1P6R A;  4HRI A;  3M9A A;  4XM3 A;  3HGG A;  2O8X A;  3IAM 2;  5HOD A;  2A5W A;  2RDP A;  4D9J A;  3HSR A;  2DT7 B;  4LLN A;  1WH5 A;  1TLH B;  1DP7 P;  1MIJ A;  3RDI A;  2EFQ A;  1HKQ A;  2QCO A;  4FCY A;  3DLL F;  1TW3 A;  3F8N A;  4NNJ A;  5FKM A;  3FMS A;  4A12 A;  4O5V A;  2EZI A;  4RM2 A;  2OJE D;  1Z05 A;  2G7H A;  5E20 A;  4EM2 A;  5IP9 J;  3TED A;  2DI3 A;  1P7J A;  4UUT A;  1EJ9 A;  3CF5 F;  4KNY A;  2ME0 A;  2VOO A;  4XLE A;  4Q4Z F;  1P9Q C;  3QYF A;  3J80 K;  1IZ1 A;  1M1E B;  2FRH A;  4KMF A;  2FA5 A;  4PJJ A;  3OYH A;  3ZQF A;  2L4M A;  3ZN0 A;  2JSP A;  4UVA A;  5E3L A;  5ICE A;  3L2U A;  3QRF F;  3TW6 A;  3H0D A;  2OBP A;  3AG4 H;  3KFW X;  1ETW A;  2X9D A;  3GX4 X;  2KIM A;  1FWZ A;  1F36 A;  2JT1 A;  4XSX F;  1BBY A;  3AG3 H;  2E34 A;  4QWQ A;  5CVI A;  3LOC A;  4D5C A;  4KIC A;  3VYR B;  5FD5 A;  2RV8 A;  4FIS A;  2E5N A;  1XDU A;  2X6Y A;  3BG7 A;  4RBO A;  2Y0S N;  2I5U A;  1MMS A;  1MSE C;  2FBI A;  1U78 A;  3JR9 A;  4BQN A;  3A0H C;  2E1N A;  3SDB A;  3K4C A;  5C4J J;  1W36 D;  1IW7 F;  1ZH5 A;  1VI0 A;  4EQQ A;  3OYM A;  1REP C;  2V7F A;  1OCZ H;  1HQC A;  1FNN A;  4IEJ A;  2QSG X;  2W00 A;  2DA3 A;  2DLL A;  1EKE A;  1T33 A;  1X3W B;  3LWF A;  5EZH A;  3GTO J;  4E7Z A;  5GPA A;  2FOK A;  1ZK8 A;  2LKS A;  3ZXS A;  1E0E A;  1I39 A;  1OCT C;  2ELH A;  2UV1 A;  1SD7 A;  2ISZ A;  5F27 A;  4KN7 X;  2KPM A;  2M4K A;  4HDU A;  2YU9 J;  3PQJ A;  4A3E J;  2LD5 A;  4I2O A;  1D0X A;  4CYC A;  3HUG A;  1OMI A;  5KK1 A;  4UVC A;  1R22 A;  1SD5 A;  4ESF A;  2R7W A;  4ZDL A;  1JUP A;  2Y0S A;  2IAI A;  5B3S H;  4JBA A;  4M6V A;  4F92 B;  3ZCO A;  3S3O A;  1U9N A;  3DBR B;  4ESB A;  4WX9 A;  5FRM A;  3FXL A;  3WE3 A;  4RB1 A;  3PO3 J;  1E3H A;  2MD5 A;  1XGS A;  4KUM A;  4L5J A;  1TZL A;  2QBY B;  1YIT I;  5K5O A;  4BXU A;  4DYQ A;  4LLG F;  5DUK A;  3ZOB A;  2L01 A;  2R7R A;  3VYT B;  3IUO A;  5EG0 A;  2XC7 A;  3JSO A;  1IV6 A;  3S1Q J;  4LFU A;  3K9T A;  3PQK A;  3MN2 A;  2FXA A;  1U8B A;  1HKS A;  2DQL A;  2QM3 A;  3L09 A;  3NQO A;  4M9Z A;  2F5D A;  2KQR A;  4RAG A;  4CIC A;  3PIP F;  4UHT A;  1A31 A;  1H9G A;  1FOK A;  2C6Y A;  3WTW C;  1R1V A;  2BGC A;  4BKX A;  4XN0 A;  2OD5 A;  1Q1H A;  3OYJ A;  2XPW A;  2HOE A;  2STW A;  2E2I J;  4LJZ F;  1NTC A;  3WG9 A;  1GXQ A;  1BR4 A;  1AOY A;  4DJA A;  3BTI A;  4CCN A;  4HSR A;  2WY7 Q;  3OL3 A;  2LKP A;  3HEF A;  5BMZ A;  4XKW A;  1JUS A;  3D5L A;  1YX3 A;  3RKQ A;  1D0Y A;  3H36 A;  1KU2 A;  3KP7 A;  4AYB N;  4ZYH A;  3PSF A;  4RB2 C;  3K1P A;  5DCM B;  3JRC A;  2YU3 A;  3CC2 I;  3FM3 A;  2XRN A;  4I09 A;  4XLP F;  2ZJ2 A;  2ZFU A;  1FP2 A;  2EB7 A;  2OCE A;  2HVR A;  3N05 A;  2XSJ C;  3I4P A;  4PK4 A;  2LLK A;  3KP5 A;  5E8G A;  1YRN B;  3GLL A;  3LA2 A;  1ZEL A;  5C4X J;  3QPH A;  2MH9 A;  4XLN F;  3QP5 A;  4KT6 A;  4ZYA A;  1MKM A;  2JRT A;  2WC2 A;  2PJP A;  2ZSI B;  1YW7 A;  4HF2 A;  3A01 B;  5GP9 A;  4MTE A;  3R61 A;  2QGU A;  3K4B A;  2O5R A;  2J5O A;  3F21 A;  3CDI A;  1KU7 A;  2A05 A;  3QPT A;  4A0X A;  4A6E A;  3UKG A;  4IQJ A;  1RR8 C;  2XV4 S;  2G7U A;  2D5V A;  2HOA A;  3DQV C;  4I98 B;  4KA4 A;  1BIB A;  1JUM A;  4XIC A;  2L9V A;  1ZRF A;  1OCR H;  3SFZ A;  4DQ2 A;  4BBS J;  2X4H A;  2QQA A;  3T8R A;  2NVQ J;  3PUB A;  2K4B A;  2B0L A;  3Q0V A;  2EIM H;  1XGO A;  1OYI A;  5ILU A;  3GYH X;  3HRT A;  3OL4 A;  3JRH A;  1QBJ A;  4AYB A;  2DFF A;  2YPR A;  4A3D J;  4ETS A;  2VC0 A;  3CLO A;  2DA4 A;  1WWX A;  1XD7 A;  4ABZ A;  3BTJ A;  3UR3 C;  2EH3 A;  2PMZ N;  5D4R A;  2OTJ I;  5K5R A;  3DTK A;  1VQL I;  2HS5 A;  1JE8 A;  4PGH A;  4IHS A;  2VKD A;  2L02 A;  4BNC A;  4MQ9 F;  4D0P A;  4HST A;  2LY1 A;  4CYC B;  3I56 I;  3HUG B;  1XGN A;  2XB5 A;  2PJR A;  2JA5 J;  3S14 J;  1UAA A;  5FLX K;  2FMY A;  5EF6 A;  3K6G A;  4N9H A;  3BQZ A;  2IA2 A;  4MEY F;  3D0S A;  3LSK A;  1H9T A;  3WU1 B;  4OIP F;  1IXC A;  3WOD F;  1WQ2 A;  1MJB A;  3B6C A;  4V2F A;  5B5E C;  1Q1V A;  2XIG A;  2FSW A;  3UNG C;  1H89 C;  2EIK H;  3PNV A;  3BZK A;  2GA1 A;  2HNH A;  1W7P A;  3C2G A;  4C3J J;  2NS7 A;  4RMN A;  5DD4 A;  4GO1 A;  1I3Q J;  1O57 A;  4GYI A;  2A69 F;  4CCL A;  1F43 A;  1R58 A;  3GUD A;  5EG0 B;  3IC7 A;  2CQ7 A;  3KZZ A;  1NG6 A;  5IOZ A;  2L54 A;  3CDH A;  2EA4 A;  2YR2 A;  3HIF A;  3S15 J;  1UCR A;  2NAZ A;  2WB1 N;  2MAB A;  1E3O C;  4BUP A;  2IW5 A;  3F23 A;  2R7S A;  2PMZ A;  2P8T A;  4DOZ A;  1WI3 A;  1YE9 A;  4QPO A;  4BDZ A;  3JRI A;  1B9M A;  3W6V A;  4RA2 A;  4CZZ A;  1S3J A;  2VLA A;  3CCM I;  2QQ8 A;  5K1Y A;  2GZW A;  2TDX A;  4BAY A;  5KCM A;  1XS9 A;  4ZC3 A;  2PFB A;  1E17 A;  2QEN A;  4HAM A;  1ULY A;  1TWF J;  4M71 A;  5F08 A;  5A2Q Z;  4DBR A;  2JA7 J;  5HDK A;  2DK8 A;  2X1C A;  3S8P A;  3WTY C;  3GME A;  2BY1 A;  1KA8 A;  4V19 K;  2IRF G;  3ZGK A;  2FNA A;  4B43 A;  1YW8 A;  3EYI A;  5LD2 C;  4F93 B;  2R7D A;  2Y9Z A;  2I10 A;  2LRE A;  1ZYR F;  2COB A;  3RZO J;  1B72 B;  3HYI A;  3LSJ A;  3P5J A;  2E1M B;  5J40 A;  2XAG A;  1ZHF A;  3L2V A;  1TWA J;  5FKK A;  1D5V A;  1ON1 A;  4M3G A;  2DMN A;  5FB2 A;  4GXO A;  2STT A;  2G9W A;  2ESN A;  2NNY A;  3OOU A;  3B73 A;  3RKY A;  2X48 A;  2AHQ A;  4B3X A;  3V8L A;  2L5Q A;  2DCE A;  2VC1 A;  2OTL I;  2OU2 A;  2WB1 A;  1WI9 A;  3VEP A;  2E19 A;  1HLV A;  2D1H A;  3FXJ A;  1ETQ A;  4EMS A;  5JI6 A;  1MGT A;  3S16 J;  1WFX A;  3MCZ A;  3ABL H;  4G8X A;  3ZQG A;  1YIJ I;  1VQ4 I;  4JP0 A;  1YX5 A;  4S0H B;  4ZZD A;  4M74 A;  2M8E A;  4XRM A;  4A5N A;  3FBN B;  1I3A A;  2VL8 A;  1A36 A;  3FIS A;  2KIQ A;  4CCO A;  2GXG A;  1F4K A;  4EM1 A;  2KIU A;  1JHH A;  2Z3Y A;  3I0T A;  3I4M J;  4U0Y A;  2LRD A;  4I6Z A;  1G3Y A;  1MND A;  3IRR A;  1BC7 C;  3IH4 A;  2OV7 A;  4XOR A;  3HHH A;  4A69 C;  5EEH A;  4F7Z A;  2HQ5 A;  4QIW N;  2GLO A;  1RET A;  2DK5 A;  3WHB A;  4CGZ A;  2D2W A;  5JLW A;  4ON0 A;  3OYF A;  1XSV A;  4Y17 A;  2IBD A;  1Y0U A;  1Z0X A;  1HW2 A;  3M8J A;  4XMY A;  3ABK H;  4E6K G;  5E1Z B;  1UJ8 A;  2F5F A;  3WU0 A;  4BJ5 C;  1UHM A;  2IVM A;  1BR2 A;  1UG0 A;  3RPQ A;  3SZG A;  4C3I J;  3S3M A;  1ZQ3 P;  2VJJ A;  1GT0 C;  2JMW A;  1FBS A;  1U0J A;  4A3K J;  1TWH J;  1DP3 A;  1BIA A;  1IRF A;  4AVZ A;  1IXR C;  2K27 A;  4BHB A;  4YFX F;  3QYB A;  3LSP A;  2EFO A;  1QZE A;  5D5V B;  4BQA A;  3ZR8 X;  3A03 A;  2PLY A;  2FML A;  3BZ6 A;  2KZV A;  2JRM A;  5EEG A;  2ZNY A;  1MNM C;  2LDU A;  4A2U A;  4KYW A;  1UZC A;  2QYO A;  3A1Y A;  3B02 A;  4U87 A;  5L3D A;  3V7C A;  1CGP A;  1B9N A;  4H0E A;  2Z5U A;  2DU9 A;  4I0B A;  4L5E A;  3BP8 A;  3OYI A;  2NVY J;  2B7E A;  2O61 A;  4XLA A;  4YEL A;  2EV6 A;  4OIN F;  2Z33 A;  4YG2 F;  3OIQ A;  3EDP A;  4G6D A;  2RRE A;  4CYD A;  3W2A A;  1DPR A;  3BR2 A;  4HF1 A;  4IHT A;  2RQP A;  3HPH A;  2EV0 A;  2KLO A;  2VIX A;  2H8W A;  2W84 A;  1J2X A;  3K70 C;  2F5C A;  4IOA F;  2V1U A;  1VQ6 I;  3SXY A;  4B8X A;  1LFU P;  1Y1V J;  2BXZ A;  1IV8 A;  2CFO A;  3ASO H;  5EEA A;  3GTL J;  2E5Z A;  3ZMU A;  3QQA A;  3BJA A;  2MLK A;  4E70 A;  3I64 A;  1WJC A;  4G7Z F;  5HS7 A;  1U5T B;  1WJE A;  2M2E A;  2QZ8 A;  2W57 A;  3K7A J;  3FK6 A;  1WJ5 A;  4RGS A;  4IRH A;  2NOG A;  3TQN A;  2LTP A;  4PCQ A;  3D5R C;  1ZN2 A;  2VI6 A;  1VQO I;  3F6O A;  3ABU A;  1N77 A;  3I59 B;  1R4M B;  2XF5 A;  4WXC A;  2JWT A;  4HNV A;  3TW7 A;  2VOD A;  1STZ A;  3DPT A;  3EET A;  5J47 A;  3EUH C;  4NBQ A;  3GVA A;  1KQ9 A;  2LY2 A;  1T56 A;  4NC6 A;  2ZXI A;  1PP8 F;  4WK8 F;  1JKQ C;  4KIS A;  2LKX A;  5IT9 K;  1WPK A;  3L00 A;  1AHD P;  4BY7 J;  1JJ8 C;  5JHU A;  1XPX A;  1LVA A;  1ZG1 A;  3MD2 A;  3FKJ A;  1VZ0 A;  2L9S A;  1U8R A;  1ETV A;  1FBU A;  3OMY A;  3LQR A;  2K3F A;  3HRU A;  3W2V A;  2MG4 A;  3HSE A;  1OPC A;  4KFC A;  1R9T J;  2B63 J;  2CG4 A;  2Y30 A;  3AL0 B;  2OCC H;  3DCF A;  1IRX A;  3V8K A;  3BJ6 A;  3MQ0 A;  2CW7 A;  3MZY A;  5H20 A;  1VFC A;  4E7L A;  2L3D A;  2BY0 A;  2V1N A;  4XLH A;  5J1U A;  3H5N A;  2L4A A;  4PJL A;  2LBF B;  4LGW A;  3L1P A;  3HZJ A;  4B44 A;  4EV0 A;  2ZME B;  4RGU A;  1XMK A;  1SAN A;  3SQN A;  1OLT A;  3VWB A;  1PYV A;  1Z6T A;  1L3L A;  1W7P D;  2HQA A;  2VT2 A;  4ZDP A;  1GVD A;  3IRQ A;  2ISY A;  2JVH A;  2Y0M A;  2X85 A;  4ENM A;  1TQM A;  4UVB A;  3REO A;  2M87 A;  2Z9O A;  1CQT A;  5J4Y A;  2NVX J;  1UHW A;  3QPL A;  1L0O C;  2L9R A;  2JA8 J;  3ECH A;  3NWS A;  4S05 A;  2W24 A;  2E7X A;  1ETO A;  5JFR A;  2H6B A;  2MLG A;  5DV5 A;  3F8B A;  4YEJ A;  1KU9 A;  1LUJ B;  4R1H A;  2ZBK A;  1LVK A;  3Q9V A;  1G3S A;  5FLV A;  1MMA A;  5L3C A;  3AL0 C;  1YQA A;  1JTY A;  4KJZ A;  1JT0 A;  4AID A;  3H1C A;  1EA3 A;  1XG1 A;  2IP2 A;  5BOX A;  4KN4 X;  2O8K A;  3M3Y J;  1MMD A;  3FIW A;  3I55 I;  1A35 A;  2V1D A;  3S17 J;  1QVU A;  3BY6 A;  2M30 A;  4N4N B;  2XAF A;  5IOY A;  1G59 A;  2KRF A;  2ZME C;  4IO9 F;  1TWG J;  1TQI A;  1QRY A;  3LSI A;  4KIG A;  1O7L A;  3ZP5 A;  3KP2 A;  2R7O A;  4OU0 A;  3JRG A;  1I50 J;  5D5W B;  2CUZ A;  3R4K A;  1KQ8 A;  2M3A A;  4PJ0 C;  2HDW A;  4FTH A;  2AQE A;  3D5S C;  1HDP A;  3EUK L;  3JRE A;  2JVG A;  4UNO A;  3K4N A;  2ZFW A;  3COA C;  1D8K A;  1W0U A;  4R79 A;  2OPT A;  3KPH A;  1TNS A;  4IJA A;  1MNE A;  1BC8 C;  4AD9 A;  4YFK F;  1TBX A;  2ECB A;  2X1E A;  4GFB A;  2XUB A;  3A0B C;  4E7H A;  5LHG A;  4A3F J;  1IO2 A;  1V54 H;  4JX6 A;  4XKV A;  1ZGA A;  4AM3 A;  2IS6 A;  3OS0 A;  1X19 A;  5FLM J;  4ZYE A;  2X0L A;  2XHK A;  3ZMT A;  3AFH A;  1UHS A;  3K1N A;  4FT8 A;  4MHG A;  1JKO C;  3E5X A;  3BTC A;  5D5U B;  4BE1 A;  2GIZ A;  5GAD J;  3PNT A;  1ZKG A;  4XRS A;  3KYD B;  3F22 A;  1S5L C;  3SEQ A;  2W1O A;  4P5O A;  2K9M A;  2M45 A;  2R4G A;  2Z99 A;  2X6O A;  3R6S A;  2KJC A;  4UUV A;  2HEO A;  4E7K A;  2HOS A;  1E3P A;  2H8R A;  1LE8 A;  3FZV A;  3V8J A;  3KEQ A;  3DPL C;  1YS6 A;  4Y52 J;  1BR1 A;  3OR2 C;  2KT0 A;  1SFE A;  4BE0 A;  2VXD A;  2M8G X;  2ZB9 A;  5DCM A;  4XQF A;  3BCA A;  5ILS A;  3LNQ A;  5LGU A;  2WAF A;  4J01 A;  5JHF A;  4B09 A;  2DTZ A;  5DYM A;  3IKT A;  2QWW A;  1I27 A;  3HRS A;  1DPU A;  3OR1 C;  1RR7 A;  4A0Y A;  5IY5 H;  1YRN A;  3OYD A;  1OQY A;  3VYS B;  2HDD A;  1MBK A;  5GTI C;  1ON2 A;  1XMX A;  4G12 A;  4QTR A;  3H5A A;  4MLO A;  3I71 A;  1LEA A;  3RIR A;  3V42 A;  4HLX A;  4JOM A;  1NHA A;  5IYB J;  3A01 A;  2VQL A;  3GF2 A;  1PUF B;  3RQI A;  2HOT A;  3J80 Z;  1D0Z A;  2DA1 A;  2EV5 A;  4HV5 A;  5FFX A;  5EDN A;  1XMA A;  4A6D A;  2MFZ A;  1LDD A;  3IKV A;  4M3D A;  2HZT A;  4CZC A;  1QQI A;  3O8G A;  5L3E A;  1VQP I;  3V7R A;  3BR0 A;  4N9I A;  2PX9 A;  3HJE A;  4K2E A;  1RKT A;  2HQN A;  2X51 A;  4BQQ A;  1YJ9 I;  2XGX A;  2E1O A;  3F72 A;  4MO7 A;  1HCR A;  2FJ1 A;  1I5Z A;  2K9L A;  4BHC A;  3KE2 A;  2E7W A;  1K83 J;  4BH9 A;  2VXZ A;  2V4J C;  4EEF G;  1FYK A;  4BY1 J;  2D1V A;  2XKP A;  3H9Q A;  4NQW B;  5FKO A;  3JAM K;  2V1X A;  2MC4 A;  3CO6 C;  3OYE A;  1DQU A;  3TDU C;  4DBQ A;  2BY3 A;  3S1N J;  1GLN A;  2Q8K A;  1GV5 A;  2IS1 A;  1Y8R B;  2A6H F;  2PBI A;  1SAX A;  3GBG A;  4BGD A;  2EFP A;  4IHY A;  3Q0W A;  5KVR A;  4C3H J;  2IA1 A;  3SDG A;  2LF8 A;  4OOI A;  2VOP A;  2EQR A;  4HEA 2;  5DM7 F;  3IL2 A;  4BEH B;  3AG2 H;  1UB9 A;  3R0J A;  4GYG A;  5JR3 A;  2KRH A;  5EJC A;  3PUF A;  2VKH A;  3R0A A;  4ANJ A;  3HGY A;  4E7S A;  5CVR A;  2VQH A;  2OQG A;  3E6D A;  2VUM J;  3K1M A;  3KEO A;  2GXA A;  1T6S A;  1EH6 A;  3MVP A;  3CMM A;  3AAF A;  3PO2 J;  4F3Q A;  5IP7 J;  2JA2 A;  2GOX B;  3FXM A;  3L2Q A;  3VSK A;  5LGT A;  2R5Y B;  2RQQ A;  1DU0 A;  5HLI A;  1RZ4 A;  3LL7 A;  2YX4 A;  1ZTR A;  2M7B A;  1OCP A;  4HX4 A;  5E1W A;  1A5J A;  2FOW A;  3AKZ A;  3J81 K;  2QSF X;  3ZQC A;  4M6X A;  2V79 A;  4IZZ A;  3V4G A;  1Z3X A;  4BJT A;  1QO0 D;  4ZZL A;  2H1L A;  3OYB A;  3N4M A;  4UV8 A;  3CJT B;  1KON A;  3DWL E;  1LE8 B;  1QGP A;  3JRA A;  2WAQ N;  3H9J A;  1T8I A;  2R7X A;  2IA0 A;  4AIJ A;  2L7F P;  2ZJR F;  2K85 A;  3S1R J;  4DW6 A;  2F5V A;  4FET A;  2PEX A;  3WGH A;  1JKR C;  1T2K A;  1XX5 A;  2WBM A;  1FYL A;  4B47 A;  5L3B A;  1J75 A;  1MBJ A;  3IWF A;  1RRJ A;  1IF1 A;  2P6S A;  3IH2 A;  3E6C C;  1B72 A;  1MJ9 A;  1Z7L A;  1FSH A;  2DAO A;  3OYG A;  4PZJ A;  3CD6 I;  5LGN A;  3QPS A;  2KDO A;  2RKH A;  4XOT A;  2F4I A;  2DN0 A;  3JTH A;  3PFI A;  5TRD A;  2LF7 A;  2O0Y A;  4YII A;  1FC3 A;  1NH3 A;  2WY8 Q;  3OSF A;  2A6T A;  4G6Q A;  4RAZ A;  2HU9 A;  2NS8 A;  2UZK A;  1AU7 A;  3HOY J;  1YJW I;  4M3B A;  2DYR H;  2L2O A;  2Z16 A;  2ACJ A;  2K9S A;  1P4X A;  3AG1 H;  4HQM A;  1I6X A;  2VT3 A;  4PJM A;  5LLQ A;  1X2N A;  4W1U A;  4EJU A;  1MMG A;  5KNL A;  4YIF A;  4LIT A;  2HYG D;  4XKB A;  1BI2 A;  4CXF A;  5BPI A;  4KMU X;  5JLX A;  3ASN H;  1SAU A;  2COM A;  1RPW A;  2A61 A;  2Y48 A;  3HOU J;  2UXN A;  2BZT A;  2ZKZ A;  1LFB A;  3CZ6 A;  2HPI A;  2ZXW H;  4JX5 A;  3RCO A;  1NK2 P;  1T0F A;  4AIK A;  2CUF A;  4EM0 B;  1HF0 A;  2VBY A;  4CH7 A;  3CCV I;  4Q47 A;  1WCM J;  3BT9 A;  2QF7 A;  5E79 C;  2M5W A;  4WXD A;  4UUS B;  1R00 A;  3K69 A;  4LG3 A;  2JPC A;  2EZK A;  1YIO A;  3VFZ A;  1T38 A;  1X3U A;  1JGS A;  3Q9S A;  4CUG A;  1R49 A;  1V5F A;  1FEX A;  4MFD A;  3QP6 A;  2LMD A;  4QPQ A;  2JTV A;  5FKL A;  4RDU A;  1OYY A;  1SMT A;  3QOE A;  3BCB A;  3CCQ I;  3NAR A;  1X1B A;  2DJI A;  1U9O A;  5JVG F;  2IGM A;  4DYR A;  5B66 C;  5AON A;  5C3E J;  3C1D A;  3LSG A;  3BLY A;  2ELK A;  3C7J A;  3MKL A;  1ZG5 A;  4XSZ F;  2ZNZ A;  4IKF A;  5FLX Z;  2P5V A;  2AXL A;  1Y8Q B;  2R0Q C;  4HG2 A;  3Q3S A;  2XAJ A;  1BOB A;  2WV1 A;  1J9I A;  4IX7 A;  4A3L J;  3ABM H;  2WV0 A;  3GO5 A;  3QWL A;  3TP3 A;  3G1L A;  5LFA A;  3G73 A;  4EJW A;  3SFI A;  2QA4 I;  2LP0 A;  4TV7 A;  3KET A;  1R1T A;  2CO5 A;  2JSC A;  2KDZ A;  2BHZ A;  4EGZ A;  2CGP A;  3RTR A;  4L0Y B;  1IRZ A;  3X2Q H;  4DZJ A;  3ML6 A;  1VQK I;  5JVT A;  5CJ9 A;  1JKP C;  3SJM A;  4BS9 A;  3ZRG A;  3GEZ A;  4HX8 A;  2HTJ A;  4F91 B;  3HG9 A;  2K3P A;  1JTX A;  4D1Q A;  4XKC A;  2N8G A;  2K4J A;  2ESH A;  2DT5 A;  2DPU A;  2V26 A;  1H88 C;  5J8C A;  1N75 A;  4LD5 A;  4CCK A;  2RVC A;  2RNJ A;  2MA3 A;  4GCV A;  2JQ7 A;  3I53 A;  1MBH A;  3CQZ J;  3GWZ A;  1U5T A;  5A2Q K;  3GFM A;  3T0Y A;  5GAE J;  3EYY A;  1W1W E;  2WAD A;  3CJQ B;  3ZQQ A;  4DGW B;  1RI7 A;  4IOC F;  1HSJ A;  5D6E A;  4A0Z A;  1DGR M;  4PGG A;  2CU7 A;  4FE4 A;  2Q1Z B;  1UFM A;  3I59 A;  3LMM A;  2V9K A;  5IPA A;  2OF7 A;  4G94 A;  1DU6 A;  2CH0 A;  2VBX A;  3NEU A;  5B1A H;  4XBF A;  2FBH A;  2BE5 F;  4G9Y A;  1IDZ A;  1OFC X;  2BYV E;  2VAS A;  3TOA A;  3E6B A;  3I54 A;  2FX0 A;  2DT6 A;  3K2Z A;  3T1B A;  2XAU A;  1OKR A;  2CV2 A;  2OZ6 A;  3W6K B;  2XDV A;  4OAY A;  1LJ9 A;  3H3V K;  1R71 A;  2HR3 A;  1BM9 A;  2W85 A;  2DPD A;  2ID3 A;  2PN6 A;  2WA0 A;  2ZXH A;  3GFL A;  1JHF A;  1KYW A;  2Y9Y A;  3FXU A;  1YS7 A;  2VQC A;  3C18 A;  4CO8 A;  2CV0 A;  2DDB A;  4RGX A;  2P6T A;  3V7S A;  4E4H A;  3F0C A;  2M0M A;  2XGC A;  4G6T B;  3PM1 A;  3FM5 A;  2EZL A;  1UMQ A;  2IGK A;  1W0T A;  3HOV J;  2LBF A;  1W4M A;  3OS2 A;  4P55 A;  5J8F A;  1F9N A;  3PSI A;  5BPD A;  2A68 F;  1ZRE A;  2ZME A;  3FX3 A;  3J7Y J;  2KFD A;  4IHV A;  1V5G A;  4HW0 A;  1R5H A;  4KDP A;  2H6C A;  2KP6 A;  2HVS A;  2L0K A;  3ABT A;  3CMA I;  4XK4 A;  1V55 H;  4OIR F;  1G2H A;  2LNB A;  3EQL F;  3HKZ N;  3S3N A;  1SVL A;  4I7H A;  4IXA A;  2W25 A;  4NC8 A;  3DPU A;  1S7O A;  1RIO H;  2W82 A;  4EVI A;  4NC7 A;  2FQ3 A;  4CCM A;  5HOO A;  1LPQ A;  4NDL A;  3EPZ A;  4MEX F;  3CMY A;  4U88 A;  2IGO A;  2KJB A;  5F6F A;  2HGC A;  3FKI J;  3H35 A;  5DEQ A;  5FD6 A;  3DP7 A;  3L2C A;  4L5I A;  2JK3 A;  2ZXJ A;  3WTV C;  1YLF A;  2Q2E B;  4KIB A;  3FWE A;  4P96 A;  4CHU A;  2R7U A;  2VJ5 A;  2R7T A;  3OOP A;  1USS A;  2GQQ A;  3M07 A;  3CUQ B;  2LY9 A;  4IRI A;  1HA8 A;  2BHY A;  1OIS A;  4D7M A;  2EPF A;  1K61 A;  2F4M B;  2BBY A;  3HOT A;  1S8N A;  3A2K A;  1YOV B;  6PAX A;  3GXO A;  4JQF A;  2HTS A;  3LSM A;  1QZY A;  1Y0N A;  3KP6 A;  4U0W A;  4A3C J;  3M1C A;  3VPR A;  4BBR J;  2M4G A;  3HRM A;  5CQE A;  1JT6 A;  1B6A A;  4BL0 B;  1MH3 A;  1WGX A;  2G0E A;  4CA0 A;  3KP4 A;  5KAF C;  1UG2 A;  2CRG A;  3LSH A;  3F9K A;  4BE2 A;  2E60 A;  2NVU B;  2DOA A;  5BQT A;  2P4W A;  5DS9 A;  4A5M A;  1IN8 A;  5BNG A;  3KIO A;  5AIQ A;  2QKL B;  1O3T A;  3HKZ A;  2HFH A; 
#chains in the Genus database with same CATH homology
 5IT3 A;  4EJT A;  1EH7 A;  3F8F A;  5HLH A;  1YW9 A;  2EWN A;  2LSO A;  3CUQ C;  1VTN C;  2CFX A;  2DTR A;  1E2X A;  1SMY F;  3E3V A;  1BN5 A;  3QU6 A;  3DV8 A;  1D8J A;  2MC3 A;  4Q5S F;  2P5L C;  3BWG A;  4YFN F;  3TOB A;  2ADU A;  5FGM A;  4Y13 A;  2PMH A;  3P9C A;  2EA2 A;  2R7F A;  3I5U A;  3SZT A;  4I01 A;  5TJJ A;  4AWX B;  3QOP A;  5ICG A;  1GXP A;  2PMU A;  4HF0 A;  3O3K A;  4P9U A;  1SFU A;  3DFG A;  1KU3 A;  2M1B A;  2RGV A;  4LB5 A;  3DEU A;  1R1U A;  2QQ9 A;  5E18 F;  2ETH A;  4M6Y A;  3GFI A;  4RB0 A;  3GLX A;  1ZLK A;  1J7K A;  2WWY A;  3L9F A;  1LEB A;  2QUF A;  3E5U A;  4U7D A;  2YSR A;  1SFX A;  1O3Q A;  2EFN A;  3TO6 A;  3U9G A;  2DQR A;  3E6M A;  4NQW A;  3ISP A;  1XCB A;  1MD0 A;  1FYM A;  1XB4 A;  1YTY A;  1OYW A;  3HOS A;  1K79 A;  3H3U A;  3FMQ A;  2FEZ A;  3KP3 A;  4R8H A;  5CYV A;  1IAW A;  4NB5 A;  1J59 A;  1LQ1 A;  2H94 A;  2GIV A;  1GHC A;  4OMY A;  2WTE A;  1RNL A;  2KIF A;  2ZO4 A;  2F5E A;  1ZRC A;  1B59 A;  2CYY A;  3F6V A;  2O6G E;  3GW2 A;  5L3F A;  2P7C B;  1QZZ A;  1B4A A;  3MEX A;  2E1C A;  1TQP A;  3O2P E;  3RI4 A;  2BEO A;  5CVU A;  3CJN A;  3DF8 A;  2JPB A;  3KZY A;  4HOB A;  2A07 F;  4MQV A;  3RJP A;  2UWM A;  5FFZ A;  3U1D A;  2A3S A;  1G4D A;  4PDK A;  3TO7 A;  4RAY A;  1RUO A;  4DNC A;  5H6Q A;  1ZAR A;  1D3Y A;  1Z7U A;  4BHP A;  1K78 B;  3MZH A;  3WTU C;  2BV6 A;  2XVC A;  4EJO A;  3KLN A;  2VE8 A;  2OZU A;  3ZMV A;  2EK5 A;  1SD6 A;  3G3Z A;  2OQR A;  2A6E F;  1CF7 B;  4HLY A;  4WF2 A;  2XAQ A;  2ZCW A;  3ELK A;  2VBW A;  1P92 A;  1TNT A;  2VBZ A;  4UV9 A;  1O3R A;  1KGS A;  3ZMD A;  2CSO A;  4O3M A;  5LBQ A;  1XSX A;  2XRO A;  4LB6 B;  2DO7 A;  2MH2 A;  4FX4 A;  1G6N A;  2QVO A;  2NS0 A;  4RB3 C;  1B1B A;  3MFK A;  3ZPL A;  5K5Q A;  4MNU A;  1FX7 A;  1QPM A;  5D8L B;  2FF4 A;  4O6J A;  5CVJ A;  1R7J A;  5DUI A;  3F3X A;  1FZP B;  4LG0 A;  1ODD A;  2GXB A;  1LDK B;  1DUX C;  1IN7 A;  4HZF A;  3JAM Z;  4OIO F;  1BI1 A;  4M9S A;  1MDM B;  4ENK A;  1WRJ A;  3FF5 A;  2XAS A;  3KLO A;  3P7N A;  4ZYG A;  3BPV A;  5CVV A;  4QLC U;  1Z9C A;  4EJV A;  1G3W A;  4ENJ A;  1O3S A;  2DW4 A;  3C3W A;  4G7H F;  2AS5 F;  1AWC A;  3J7A O;  5E17 F;  3RKW A;  4M72 A;  1R36 A;  2H09 A;  3R60 A;  2V9V A;  1YG2 A;  5D5X B;  2FBK A;  1K7A A;  1V3F A;  2XAH A;  4NHJ A;  5DD8 A;  1P4W A;  3I58 A;  3TKY A;  2HKO A;  4IVN A;  3TO9 A;  3H92 A;  3GZ6 A;  1XGM A;  1LNW A;  4MGR A;  1F1Z A;  5J6X A;  3ZQ7 A;  1SD4 A;  4KIF A;  3J81 Z;  1MJA A;  2NNN A;  4BYY A;  3TDZ C;  2D45 A;  2OA4 A;  1XCV A;  3LAP A;  2A5Y B;  5HVQ C;  4U0V A;  2EFW A;  3NRV A;  1FPQ A;  3VOD A;  1PUE E;  2GA2 A;  1QNT A;  1HST A;  2DFI A;  3RPU A;  3SZP A;  3IWZ A;  2R3S A;  5LEJ A;  1Z1D A;  1YYV A;  5DCF A;  4XRF A;  4HBL A;  4IRG A;  3FXQ A;  1U3E M;  1LB2 A;  2HQR A;  3OV8 A;  1FP1 D;  1IRG A;  3QAH A;  1J0R A;  4LG0 B;  3K0L A;  1HW5 A;  2NYX A;  4GGG A;  4M9X A;  4HX7 A;  1RUN A;  3TGN A;  3T8T A;  3M8F A;  5H6R A;  1XSD A;  3LQQ A;  2CWE A;  4Z2Y A;  1KYZ A;  4I0A A;  3N97 A;  2Q2E A;  2J5P A;  1T39 A;  3CUQ A;  5F64 A;  3S2W A;  3O6B B;  4FHT A;  2RN7 A;  3HSF A;  4HQE A;  3VOE A;  3EUH A;  2O3F A;  1R5G A;  4HDV A;  4N0B A;  5ERI A;  5LHI A;  2GWR A;  1FSE A;  2DBB A;  3M8E A;  3LFK A;  3LA7 A;  2PQ8 A;  3JTG A;  1T98 A;  2VE9 A;  4LK0 F;  4OMZ A;  3FXR A;  3ZMS A;  4L9V A;  4I02 A;  1LDJ A;  1PP7 U;  2IT0 A;  1S29 A;  2IPQ X;  1XN7 A;  3HTS B;  4WXH A;  3U2R A;  1W5T A;  1J5Y A;  4HA8 A;  4LLL A;  1FY7 A;  1IN4 A;  1TW2 A;  1YFH A;  3P9I A;  2NRA C;  2UXX A;  4IF4 A;  3HTU A;  5ICF A;  1IN5 A;  1ZLJ A;  3ROU A;  4JK1 X;  1O7F A;  3E5Q A;  3MAJ A;  4Q48 A;  2F2E A;  3JSP A;  2IJL A;  4AIH A;  1FBQ A;  3ZMZ A;  4LK1 F;  5E1X A;  4G7O F;  5HLG A;  5HDN A;  4ESJ A;  2P5K A;  3ECO A;  5CLS A;  4HV6 A;  2OAZ A;  3GZ5 A;  3FHZ A;  2PI0 A;  2RC4 A;  3KCC A;  4ZYD A;  1U2W A;  1Z91 A;  4L9N A;  3LA3 A;  1OR7 A;  1GVJ A;  3LST A;  5ILV A;  1HW1 A;  1W5S A;  3F8M A;  1HBX G;  1BOA A;  1WKM A;  3MWM A;  3WTS C;  3WTX C;  4CDG A;  1ONV A;  3DXJ F;  1G3T A;  3E97 A;  3M7G A;  3L7W A;  1P4A A;  4WCG A;  3RKX A;  2FNP A;  4FX0 A;  1I1G A;  4EGY A;  3Q5F A;  1FT9 A;  1W7P B;  4UXN A;  2P7V B;  5HDG A;  5HS9 A;  3HHG A;  2K7L A;  5F1R A;  3W6J B;  2CW0 F;  1EH8 A;  5ICC A;  1XDS A;  5LHH A;  2O03 A;  1ZRD A;  1IUY A;  4MTD A;  1TTY A;  4P9F A;  1HKT A;  2XKO A;  1UST A;  1H0M A;  4KT5 C;  5LRR A;  4S04 A;  2Q0O A;  3BPX A;  2HKX A;  4ENN A;  1ZG3 A;  4Y15 A;  3BRO A;  3ULQ B;  2VON A;  3CO7 C;  5FO5 A;  2K02 A;  3RYR A;  1FLI A;  3LAJ A;  4LMY A;  1K6O A;  1MZB A;  2MBF A;  1K78 A;  3RYP A;  2HYF A;  3FMR A;  4RS8 A;  4ASN A;  5IT9 Z;  1HXD A;  3CTA A;  3BDD A;  5E8I A;  3WGG A;  1CF7 A;  3T5X A;  4OIQ F;  3IHU A;  2HWV A;  4L9T A;  1U5T C;  1YO5 C;  2QQB A;  3WE2 A;  2FU4 A;  4IPA A;  3QU3 A;  5ED4 A;  3CUO A;  3H3Z A;  4L9J A;  5L3G A;  4RGR A;  2QLZ A;  1S7A A;  1EV7 A;  2EJR A;  4M73 A;  3SHF A;  3JW4 A;  1F5T A;  3DKW A;  1WSU A;  1IN6 A;  5BS6 A;  1KQ0 A;  4L18 B;  5LRS A;  3BJO A;  4HYE A;  3GFJ A;  1PDN C;  1P2F A;  1A04 A;  3M1E A;  2H27 A;  1JXS A;  2FE3 A;  5LEK A;  3WTZ A;  1BI3 A;  4U7B A;  1V4R A;  5DDG A;  5HS8 A;  1MDM A;  1I1S A;  5D8K B;  3P9K A;  5D4S A;  2K86 A;  5D6F A;  2HDC A;  1S6L A;  4AVP A;  3WTT C;  1ZAO A;  4ZH4 F;  1Z6R A;  1R23 A;  2CQK A;  3BOQ A;  2YX7 A;  4L0Z B;  2GAU A;  2VN2 A;  2KKO A;  4WWC A;  5AIP A;  1ZGJ A;  2V6C A;  1U6G A;  1BJA A;  3ZN1 A;  2QBY A;  2JZY A;  1BI0 A;  3ERE D;  3F8C A;  2Y75 A;  1C0W A;  3VB2 A;  2PG4 A;  1IXS B;  1DDN A;  3WGI A;  1P6R A;  3M9A A;  2O8X A;  2RDP A;  3HSR A;  4LLN A;  1TLH B;  1DP7 P;  3RDI A;  2EFQ A;  1HKQ A;  1TW3 A;  3F8N A;  3FMS A;  4A12 A;  4O5V A;  5E20 A;  4EM2 A;  1Z05 A;  2G7H A;  2DI3 A;  4KNY A;  2VOO A;  4Q4Z F;  3J80 K;  1IZ1 A;  2FRH A;  4KMF A;  2FA5 A;  2L4M A;  3ZN0 A;  4UVA A;  5ICE A;  3QRF F;  2OBP A;  3KFW X;  3GX4 X;  2KIM A;  1FWZ A;  2JT1 A;  4XSX F;  1BBY A;  4QWQ A;  5CVI A;  4KIC A;  5FD5 A;  2RV8 A;  1XDU A;  2FBI A;  1U78 A;  2E1N A;  1IW7 F;  1ZH5 A;  4EQQ A;  1REP C;  1HQC A;  1FNN A;  2DLL A;  3LWF A;  2FOK A;  2ELH A;  1SD7 A;  2ISZ A;  4KN7 X;  4HDU A;  3PQJ A;  4I2O A;  3HUG A;  1OMI A;  5KK1 A;  4UVC A;  1R22 A;  1SD5 A;  4ESF A;  4JBA A;  4ESB A;  4WX9 A;  3WE3 A;  4RB1 A;  2MD5 A;  4KUM A;  1XGS A;  4L5J A;  2QBY B;  5K5O A;  4BXU A;  4LLG F;  5DUK A;  2L01 A;  3JSO A;  4LFU A;  3K9T A;  3PQK A;  2FXA A;  1HKS A;  2DQL A;  2QM3 A;  3L09 A;  3NQO A;  4M9Z A;  2F5D A;  4CIC A;  4UHT A;  1FOK A;  1H9G A;  2C6Y A;  3WTW C;  1R1V A;  2BGC A;  2OD5 A;  1Q1H A;  2HOE A;  2STW A;  4LJZ F;  3WG9 A;  1GXQ A;  1AOY A;  2LKP A;  5BMZ A;  3D5L A;  1KU2 A;  3KP7 A;  4ZYH A;  4RB2 C;  3K1P A;  5DCM B;  2YU3 A;  3FM3 A;  2XRN A;  4I09 A;  4XLP F;  2ZJ2 A;  1FP2 A;  2EB7 A;  3I4P A;  3KP5 A;  5E8G A;  3LA2 A;  3QPH A;  2MH9 A;  4XLN F;  3QP5 A;  1MKM A;  2JRT A;  2WC2 A;  2PJP A;  1YW7 A;  4HF2 A;  4MTE A;  3R61 A;  2J5O A;  3F21 A;  1KU7 A;  3QPT A;  4A0X A;  4A6E A;  2XV4 S;  2G7U A;  4I98 B;  3DQV C;  4KA4 A;  1BIB A;  1ZRF A;  3SFZ A;  4DQ2 A;  2X4H A;  2QQA A;  3T8R A;  2K4B A;  2B0L A;  1XGO A;  1OYI A;  5ILU A;  3GYH X;  3HRT A;  1QBJ A;  2YPR A;  4ETS A;  2VC0 A;  3CLO A;  1WWX A;  1XD7 A;  5D4R A;  5K5R A;  2HS5 A;  1JE8 A;  4PGH A;  4IHS A;  2L02 A;  4BNC A;  4MQ9 F;  4D0P A;  1XGN A;  5FLX K;  2FMY A;  4N9H A;  2IA2 A;  4MEY F;  3D0S A;  1H9T A;  3WU1 B;  4OIP F;  1IXC A;  3WOD F;  1WQ2 A;  1MJB A;  2XIG A;  2FSW A;  2GA1 A;  1W7P A;  5DD4 A;  4GO1 A;  1O57 A;  4GYI A;  2A69 F;  1R58 A;  3GUD A;  3IC7 A;  3KZZ A;  2L54 A;  3CDH A;  2EA4 A;  2YR2 A;  3HIF A;  1UCR A;  2NAZ A;  2IW5 A;  3F23 A;  2P8T A;  1B9M A;  4CZZ A;  1S3J A;  5K1Y A;  2GZW A;  2TDX A;  4BAY A;  2PFB A;  1E17 A;  2QEN A;  4HAM A;  1ULY A;  4M71 A;  5A2Q Z;  5HDK A;  2DK8 A;  3WTY C;  1KA8 A;  2IRF G;  2FNA A;  1YW8 A;  3EYI A;  2R7D A;  1ZYR F;  3HYI A;  2XAG A;  1ZHF A;  1D5V A;  1ON1 A;  5FB2 A;  4GXO A;  2STT A;  2G9W A;  2ESN A;  2NNY A;  3B73 A;  3RKY A;  3V8L A;  2VC1 A;  2OU2 A;  1WI9 A;  3VEP A;  2D1H A;  4EMS A;  5JI6 A;  1MGT A;  3MCZ A;  4G8X A;  4ZZD A;  4M74 A;  2M8E A;  4A5N A;  2GXG A;  1F4K A;  4EM1 A;  2KIU A;  1JHH A;  2Z3Y A;  3I0T A;  4U0Y A;  1G3Y A;  3IRR A;  1BC7 C;  3HHH A;  5EEH A;  4F7Z A;  2DK5 A;  4CGZ A;  2D2W A;  4ON0 A;  1XSV A;  4Y17 A;  1Y0U A;  1HW2 A;  5E1Z B;  2F5F A;  3WU0 A;  1UHM A;  2IVM A;  3RPQ A;  1FBS A;  1BIA A;  1IRF A;  1IXR C;  2K27 A;  4BHB A;  4YFX F;  2EFO A;  4BQA A;  5D5V B;  2PLY A;  2FML A;  3BZ6 A;  5EEG A;  2ZNY A;  2LDU A;  4A2U A;  4KYW A;  2QYO A;  3B02 A;  5L3D A;  3V7C A;  1CGP A;  1B9N A;  4H0E A;  2Z5U A;  2DU9 A;  4I0B A;  3BP8 A;  2O61 A;  2EV6 A;  4OIN F;  2Z33 A;  4YG2 F;  4G6D A;  3EDP A;  4CYD A;  1DPR A;  4HF1 A;  4IHT A;  2RQP A;  2EV0 A;  2W84 A;  1J2X A;  2F5C A;  2V1U A;  3SXY A;  4B8X A;  3ZMU A;  3BJA A;  2MLK A;  4E70 A;  3I64 A;  4G7Z F;  5HS7 A;  1U5T B;  2QZ8 A;  2W57 A;  4RGS A;  4IRH A;  3TQN A;  4PCQ A;  1ZN2 A;  3F6O A;  3ABU A;  3I59 B;  4WXC A;  2VOD A;  1STZ A;  3DPT A;  3EET A;  3GVA A;  1KQ9 A;  1PP8 F;  4WK8 F;  5IT9 K;  3L00 A;  5JHU A;  1LVA A;  1ZG1 A;  1U8R A;  1FBU A;  3LQR A;  3HRU A;  3HSE A;  1OPC A;  4KFC A;  2CG4 A;  3V8K A;  3BJ6 A;  3MQ0 A;  3MZY A;  5H20 A;  2L3D A;  2L4A A;  4LGW A;  4EV0 A;  2ZME B;  4RGU A;  1XMK A;  3SQN A;  1Z6T A;  1L3L A;  1W7P D;  2VT2 A;  3IRQ A;  2ISY A;  2Y0M A;  4ENM A;  1TQM A;  4UVB A;  3REO A;  2M87 A;  2Z9O A;  1UHW A;  1L0O C;  3ECH A;  4S05 A;  2W24 A;  2E7X A;  5JFR A;  2H6B A;  2MLG A;  5DV5 A;  3F8B A;  1KU9 A;  4R1H A;  2ZBK A;  3Q9V A;  1G3S A;  5L3C A;  1YQA A;  5BOX A;  2IP2 A;  4KN4 X;  2V1D A;  3BY6 A;  2M30 A;  2XAF A;  2KRF A;  1TQI A;  4KIG A;  1O7L A;  3ZP5 A;  3KP2 A;  4OU0 A;  5D5W B;  3R4K A;  1KQ8 A;  4UNO A;  2ZFW A;  3COA C;  1D8K A;  4R79 A;  1TNS A;  4IJA A;  1BC8 C;  4AD9 A;  4YFK F;  1TBX A;  2XUB A;  5LHG A;  1ZGA A;  4ZYE A;  2X0L A;  2XHK A;  3ZMT A;  3K1N A;  4FT8 A;  4MHG A;  3E5X A;  5D5U B;  3F22 A;  4P5O A;  2M45 A;  2Z99 A;  3R6S A;  2KJC A;  4UUV A;  2HEO A;  3FZV A;  3V8J A;  3KEQ A;  3DPL C;  1YS6 A;  1SFE A;  5DCM A;  5ILS A;  5LGU A;  4B09 A;  5DYM A;  3IKT A;  2QWW A;  1I27 A;  3HRS A;  1DPU A;  4A0Y A;  1ON2 A;  3I71 A;  1LEA A;  3RIR A;  4HLX A;  1NHA A;  3GF2 A;  3J80 Z;  2EV5 A;  4HV5 A;  5FFX A;  1XMA A;  4A6D A;  1LDD A;  3IKV A;  2HZT A;  1QQI A;  5L3E A;  3V7R A;  4N9I A;  4K2E A;  2HQN A;  2XGX A;  3F72 A;  1I5Z A;  4BHC A;  3KE2 A;  2E7W A;  4BH9 A;  2VXZ A;  1FYK A;  2D1V A;  2XKP A;  3JAM K;  2V1X A;  3CO6 C;  3TDU C;  2Q8K A;  2A6H F;  2PBI A;  1SAX A;  2EFP A;  5KVR A;  2IA1 A;  2LF8 A;  4OOI A;  2VOP A;  3IL2 A;  1UB9 A;  3R0J A;  4GYG A;  5JR3 A;  3R0A A;  5CVR A;  2OQG A;  3E6D A;  3K1M A;  3KEO A;  1T6S A;  1EH6 A;  3AAF A;  5LGT A;  5HLI A;  1RZ4 A;  2YX4 A;  4HX4 A;  5E1W A;  3J81 K;  4M6X A;  2V79 A;  3V4G A;  1QO0 D;  4ZZL A;  3N4M A;  4UV8 A;  1QGP A;  2IA0 A;  4AIJ A;  3WGH A;  2PEX A;  1T2K A;  1FYL A;  1J75 A;  5L3B A;  3IWF A;  1IF1 A;  2P6S A;  3E6C C;  1MJ9 A;  1FSH A;  2DAO A;  4PZJ A;  5LGN A;  2RKH A;  3JTH A;  3PFI A;  5TRD A;  2LF7 A;  2O0Y A;  4YII A;  1FC3 A;  4G6Q A;  4RAZ A;  2UZK A;  2ACJ A;  1P4X A;  4HQM A;  1I6X A;  2VT3 A;  5LLQ A;  4EJU A;  4YIF A;  2HYG D;  4CXF A;  1BI2 A;  5BPI A;  4KMU X;  2COM A;  2A61 A;  2Y48 A;  2UXN A;  2ZKZ A;  1T0F A;  4AIK A;  4EM0 B;  2VBY A;  4Q47 A;  2M5W A;  4WXD A;  1R00 A;  3K69 A;  2JPC A;  1YIO A;  3VFZ A;  1T38 A;  1X3U A;  1JGS A;  3Q9S A;  3QP6 A;  2JTV A;  1OYY A;  1SMT A;  5AON A;  1ZG5 A;  3C1D A;  3C7J A;  4XSZ F;  2ZNZ A;  5FLX Z;  2P5V A;  2AXL A;  2XAJ A;  1J9I A;  2WV0 A;  3GO5 A;  3G73 A;  4EJW A;  4TV7 A;  3KET A;  1R1T A;  2CO5 A;  2JSC A;  4EGZ A;  2CGP A;  4L0Y B;  3RTR A;  3ML6 A;  5JVT A;  5CJ9 A;  3GEZ A;  4HX8 A;  2HTJ A;  2K4J A;  2ESH A;  2DT5 A;  2DPU A;  5J8C A;  4LD5 A;  2RVC A;  2RNJ A;  2MA3 A;  4GCV A;  3I53 A;  3GWZ A;  1U5T A;  5A2Q K;  3GFM A;  3T0Y A;  3EYY A;  1RI7 A;  1HSJ A;  5D6E A;  4A0Z A;  4PGG A;  1UFM A;  3I59 A;  4G94 A;  2VBX A;  3NEU A;  4XBF A;  2FBH A;  2BE5 F;  4G9Y A;  2BYV E;  3TOA A;  3E6B A;  3I54 A;  3K2Z A;  3T1B A;  1OKR A;  2OZ6 A;  3W6K B;  1LJ9 A;  2HR3 A;  1BM9 A;  2W85 A;  2DPD A;  2PN6 A;  3GFL A;  1JHF A;  1KYW A;  3FXU A;  1YS7 A;  3C18 A;  4CO8 A;  4RGX A;  2P6T A;  3V7S A;  3FM5 A;  1W4M A;  4P55 A;  5J8F A;  1F9N A;  5BPD A;  2A68 F;  1ZRE A;  2ZME A;  3FX3 A;  4HW0 A;  1R5H A;  4KDP A;  2H6C A;  3ABT A;  4OIR F;  2LNB A;  3EQL F;  4I7H A;  4IXA A;  2W25 A;  1S7O A;  1RIO H;  4EVI A;  2FQ3 A;  5HOO A;  4MEX F;  4U88 A;  2KJB A;  5F6F A;  2HGC A;  5DEQ A;  5FD6 A;  3DP7 A;  3L2C A;  4L5I A;  2ZXJ A;  3WTV C;  1YLF A;  4KIB A;  4CHU A;  3FWE A;  4P96 A;  3OOP A;  1USS A;  2GQQ A;  3CUQ B;  4IRI A;  2BBY A;  3HOT A;  1S8N A;  6PAX A;  3GXO A;  4JQF A;  2HTS A;  1QZY A;  3KP6 A;  4U0W A;  3HRM A;  1B6A A;  3KP4 A;  5BQT A;  2P4W A;  4A5M A;  1IN8 A;  5AIQ A;  1O3T A;  2HFH A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...