3WTTC

Crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Runt-related transcription factor 1
publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wttC00
2K7LA 4UV9A 3MCZA 2STTA 4ENMA 2QENA 4M71A 2FNAA 2V6CA 1WWXA 5AIPA 1KU7A 2EFNA 3E97A 4OIOF 1TNSA 2UWMA 1KU9A 1JHFA 3WTXC 3TO7A 1U2WA 4XLNF 1T38A 3HIFA 5FGMA 4O6JA 4RGSA 5L3FA 4GCVA 1U8RA 2G9WA 5DCMA 3WE3A 2DAOA 3E5XA 1D5VA 2LNBA 2P5VA 5DCFA 3WU1B 3ABUA 3LQRA 2PMUA 5LLQA 1R36A 2EJRA 2D1VA 3IKVA 5ICFA 3E5QA 3W6JB 1UFMA 1J59A 2CYYA 3SFZA 2EFQA 1FOKA 2IT0A 3I53A 3VB2A 1OYWA 2IVMA 5AIQA 2DFIA 1DPUA 3Q5FA 2DLLA 2PEXA 1CF7B 3G3ZA 1Z6RA 2FA5A 1FSHA 1EH6A 4NQWA 1TW3A 1ZGAA 1G3TA 4ON0A 1LVAA 2VOPA 3J80Z 1OR7A 2EWNA 2DT5A 1J75A 2Q8KA 1S7OA 5IT9K 3RJPA 1BIBA 4YIFA 1USTA 2LSOA 3BP8A 2BGCA 1FZPB 5DUKA 3QAHA 3L2CA 2W25A 3H3ZA 2ZKZA 4XLPF 4BH9A 3N97A 3BWGA 2X0LA 3HSFA 2XRNA 3WTWC 5FLXK 2KRFA 2KKOA 2VC0A 3CTAA 3DKWA 3E6DA 2GIVA 5A2QZ 1D3YA 3M8EA 3EETA 4M73A 2FMLA 3ZMDA 1IXSB 1GHCA 4ZYDA 1Z7UA 1DDNA 2OQGA 2CSOA 3I5UA 2R3SA 2XAQA 1BI2A 4RB2C 3KP5A 4RS8A 1MJBA 2OU2A 4KFCA 3O6BB 4G6DA 3IWFA 4WXHA 4M72A 2LF7A 2E7WA 3F8BA 5LGTA 5CVIA 1I1SA 5D5XB 2QUFA 3P9KA 4IPAA 5HLIA 4HQEA 3ISPA 1IRGA 2ZMEB 3ELKA 5LEKA 4IRIA 4EJOA 1X3UA 5DEQA 1Y0UA 2MH2A 1MZBA 3C18A 4A6DA 2NNNA 3FM3A 3CO7C 1L3LA 4EM0B 2XGXA 3U1DA 4G7OF 3LAJA 2HEOA 2XAFA 3TOAA 3HUGA 2FBIA 4LLLA 1RZ4A 5HDNA 4P9FA 2O8XA 5FO5A 2Q0OA 3KP3A 3HOTA 4UNOA 1G3YA 2E1NA 4P55A 3J81Z 2TDXA 3FX3A 2UZKA 5ILSA 2EA4A 3FM5A 1P2FA 3L09A 4BYYA 2V79A 2VE9A 4AVPA 2ETHA 1IXCA 4EMSA 5ED4A 3VODA 3ZMVA 1HXDA 3ECOA 4Y13A 2RN7A 4GYIA 5LHIA 2Z5UA 1QQIA 2KJCA 1P6RA 5L3GA 3DQVC 1W7PB 1Z91A 2F5FA 1O3SA 1HKTA 4ZZDA 1JXSA 2XUBA 1D8KA 3ZN0A 1UHWA 4UHTA 5D6EA 3CUQC 4L9JA 1G3WA 4CYDA 1MKMA 2B0LA 3I54A 5JHUA 1GVJA 1TTYA 3NEUA 2D45A 1W4MA 2A6HF 3QRFF 2M8EA 3V8KA 2IP2A 2P8TA 2RGVA 1FWZA 3J80K 1MD0A 1C0WA 5FD5A 2KIFA 4HZFA 5DV5A 4G7HF 5HS7A 1H9GA 1HSJA 5ICCA 1STZA 1W5SA 2JZYA 3NRVA 4ETSA 3KETA 2ZFWA 3KP7A 4IJAA 4N9HA 2F5DA 3DXJF 4M74A 4HW0A 4ESBA 1O7FA 3QP5A 3BJAA 3U9GA 2MLGA 1I1GA 3FMSA 1O3QA 3ABTA 4FHTA 1R5HA 3GYHX 3R6SA 2NRAC 1SMYF 2O0YA 4IXAA 2GA2A 1HSTA 2ESNA 2OZUA 2XKPA 1QO0D 1NHAA 1FP2A 2K02A 5HLGA 4HF2A 3GEZA 4OMZA 1YQAA 4KNYA 1ON2A 3WTUC 3O2PE 3G73A 3RKWA 4AIHA 2LKPA 4G7ZF 1IRFA 3O3KA 1YW9A 4PGGA 4I0AA 5LHHA 1FYKA 1ONVA 2IA1A 4MGRA 2A69F 3WTVC 4ZYHA 3T0YA 2HKOA 2H6BA 4I7HA 2YX4A 1R00A 5L3DA 4RGUA 5H6QA 3L7WA 1IN5A 4U0VA 5TJJA 4UXNA 3KZZA 1WSUA 2AXLA 1A04A 2WTEA 3HSEA 1XCVA 2XHKA 3J81K 4LG0B 2FSWA 1ZH5A 1OMIA 2VOOA 3LA2A 1LEAA 3EUHA 2WV0A 2K4JA 1ZG5A 5D5WB 2RV8A 5ERIA 2JRTA 1DP7P 4RGXA 1OPCA 1MJ9A 5ICGA 3WTYC 4KIFA 2G7HA 2A3SA 1CF7A 4BHCA 4L5IA 3ZMUA 4U0YA 2Q2EA 4LB5A 1XSDA 3ULQB 2F2EA 2DQLA 4I2OA 3DF8A 1HKQA 2Y75A 4AD9A 3CO6C 2XVCA 2XAJA 3WTZA 2JPCA 2ISZA 4EGYA 4S05A 4FX4A 2FRHA 3E6BA 3LFKA 4FT8A 2LF8A 3N4MA 3I59B 2BV6A 1RUOA 2VBYA 3PQKA 4M6YA 3T5XA 2L4AA 5IT3A 3WODF 1I27A 1S29A 2DK8A 2FOKA 4A5MA 2QYOA 3QP6A 5HLHA 4IHTA 2GAUA 1Z9CA 1W7PD 1UHMA 4GO1A 3I58A 5FFZA 3JAMK 3TOBA 1F5TA 3WGHA 2CG4A 4D0PA 4HDUA 2DPDA 1SD6A 3RKXA 4PZJA 5DUIA 4KUMA 3HHHA 1EV7A 3NQOA 4ESJA 1YLFA 3K0LA 4IRGA 5LRSA 5E8GA 1UCRA 4O3MA 2HKXA 2HQNA 2GXBA 4HX7A 3TKYA 1R22A 1TNTA 2VODA 4OIQF 4M9SA 4JBAA 5BOXA 1BC8C 1PUEE 4B8XA 2ZMEA 2VE8A 3RDIA 3IRQA 4CICA 2HZTA 1BM9A 1T2KA 2VBWA 2A5YB 4KN4X 4WXCA 1S7AA 1V4RA 4R8HA 4XSXF 4R1HA 1ZHFA 4I02A 4EJWA 3K1MA 3GFJA 3AAFA 2HWVA 2H09A 1BBYA 3SZPA 3BROA 1SFUA 2HYGD 3R60A 4M9XA 1ZRDA 3KP2A 1T0FA 5CLSA 3RYRA 4PCQA 4JQFA 2W57A 1KU2A 6PAXA 1U5TC 1KQ8A 1OKRA 1G6NA 2P7VB 1G4DA 1T98A 4UV8A 3V7RA 1U3EM 4OIRF 4CDGA 1V3FA 3MEXA 5LRRA 2EA2A 3CUOA 3C7JA 1HBXG 2PG4A 4ZYGA 1XB4A 4N0BA 4EM2A 1RI7A 3V7SA 1B1BA 4ENNA 1YO5C 1RNLA 1W7PA 2XASA 1TBXA 3ZMSA 1IUYA 2X4HA 1F9NA 1XSXA 5K5OA 2YSRA 2CFXA 2A6EF 3JW4A 2DW4A 1R5GA 5LEJA 4MEYF 3SZTA 2BBYA 3ML6A 3FXRA 2FQ3A 4MQ9F 5DYMA 5E20A 2BEOA 3GZ6A 2O61A 2A61A 5F64A 2H6CA 1I6XA 2ACJA 4GXOA 1FYLA 3CJNA 1OYYA 2FNPA 4L9NA 3RYPA 3GFMA 1LEBA 3GO5A 3HYIA 1YS7A 4G94A 2W24A 4MTDA 3KLOA 2CW0F 2JTVA 4GGGA 3TDZC 3GXOA 5KK1A 3IRRA 2UXNA 3QU6A 5HDKA 2RQPA 3L9FA 2HFHA 2ZNZA 1S3JA 3L00A 4EM1A 1WRJA 4OIPF 4M9ZA 1XDSA 3BY6A 3PFIA 3FZVA 1YW8A 2D2WA 1J5YA 4HLXA 2M5WA 2O6GE 5HS8A 4A6EA 4A0XA 1QNTA 2XAHA 3LAPA 2MLKA 4RB1A 3RIRA 3HTSB 3E6CC 1CGPA 2HTSA 3R61A 1SFXA 4K2EA 1KA8A 1FBSA 1E2XA 3J7AO 4HA8A 4Y15A 2QM3A 4HX8A 4HBLA 3M8FA 3PQJA 3GFLA 1IAWA 5LBQA 3R0AA 1G3SA 4LK1F 2EV0A 3M1EA 3IL2A 4HF0A 3E5UA 2VT2A 1HW5A 3K2ZA 1ZRFA 1TQPA 1XD7A 1BC7C 2DK5A 4WCGA 4HAMA 1T39A 2FXAA 2ZXJA 3FWEA 2L4MA 3K1NA 3F8MA 4Y17A 4LG0A 4Q47A 1MJAA 2OD5A 3Q9VA 3CUQA 4OMYA 2EFPA 1SD5A 1P4XA 3F8NA 2XAGA 4AIKA 1XGNA 3ZPLA 1IN7A 4EJUA 2NYXA 3VOEA 2L3DA 4KIGA 4I0BA 1XSVA 5HS9A 2XKOA 2ZJ2A 2P6SA 4EGZA 1O7LA 4BXUA 1XGOA 2VXZA 1QZYA 1J0RA 3BJ6A 1QGPA 2H94A 4CZZA 1E17A 3GWZA 5L3BA 5AONA 2DI3A 3FMQA 4DQ2A 1AOYA 4P96A 1SMTA 3V7CA 3BJOA 3E6MA 1O3TA 4ZZLA 1T6SA 4YIIA 2C6YA 3BPXA 1BI0A 4XRFA 4NHJA 4S04A 5E1XA 5J6XA 3I59A 2J5PA 5J8CA 4JK1X 2JPBA 1UB9A 5KVRA 4YFKF 2P5KA 3DPTA 4YG2F 2RC4A 1HW1A 4LMYA 3ERED 3IHUA 3I4PA 1S8NA 1BIAA 4UVAA 2JSCA 4BNCA 2HYFA 3H92A 2V9VA 3ZN1A 1IXRC 2EV5A 3DEUA 3GUDA 2VONA 5A2QK 3ROUA 1ZARA 1J7KA 1GXQA 4EQQA 5K1YA 4LJZF 1H9TA 1LJ9A 4EJVA 1K7AA 2GWRA 4UVCA 2ADUA 3FXUA 3JSOA 3WGIA 5E17F 4LLGF 3SQNA 4WK8F 4HQMA 2XROA 3VFZA 3DP7A 1ZREA 3R0JA 5CJ9A 3F21A 1LDKB 2CGPA 2FU4A 3EYIA 5J8FA 3WU0A 4O5VA 3P7NA 5D8KB 1IN8A 4P9UA 1USSA 2JT1A 2K27A 1IZ1A 2WC2A 3P9CA 4RGRA 3OOPA 1XMKA 1MDMB 2ELHA 3CUQB 1LNWA 1LQ1A 4TV7A 4Q48A 4E70A 5LHGA 3RPUA 4GYGA 2VBZA 2QBYB 2BE5F 3SXYA 3ZMTA 2RKHA 2VBXA 2HDCA 5D5UB 2L54A 3RI4A 2UXXA 3KE2A 1B9MA 4U0WA 1S6LA 2DPUA 3C3WA 3TGNA 4N9IA 4IRHA 1BI1A 5LGUA 3WTTC 3HRSA 3GF2A 4XSZF 4G6QA 2M87A 2YU3A 2O3FA 5L3EA 5EEHA 5BPDA 5D8LB 5CYVA 1BOAA 3RKYA 2MA3A 2IRFG 3H3UA 3DPLC 3F8FA 1XDUA 4KA4A 2PFBA 2V1DA 2ZNYA 1U78A 3T8RA 2WWYA 3B73A 1ZLKA 3ZMZA 2DQRA 3GFIA 3F22A 2FMYA 5CVJA 1I5ZA 4KDPA 4A0ZA 3LA7A 2FE3A 1FYMA 1Q1HA 3E3VA 4HYEA 4WWCA 5CVRA 2G7UA 2MBFA 3TQNA 1KQ0A 1TLHB 4A12A 4H0EA 5DD8A 2GA1A 1FBQA 1ZYRF 2QLZA 1FLIA 1P4WA 4BAYA 4ENJA 2OZ6A 2CO5A 1ZG3A 5ICEA 5EEGA 1FPQA 4KYWA 3HRUA 4CXFA 5HOOA 5E18F 1VTNC 2BYVE 4NB5A 1O3RA 3GW2A 2F5EA 2HR3A 4LK0F 4B09A 1PP7U 2A07F 2QVOA 1U5TA 1WQ2A 2V1UA 2AS5F 4A2UA 1DPRA 3FXQA 2ISYA 5H6RA 1LDJA 1ZGJA 1PDNC 2GQQA 1P4AA 4QWQA 1W5TA 2PLYA 5HVQC 3JSPA 2IJLA 3GVAA 3DFGA 1FSEA 2KJBA 1QZZA 5F6FA 1KQ9A 2IPQX 2Z9OA 4AIJA 3KP6A 5JFRA 2CQKA 1REPC 2PBIA 2DO7A 1RIOH 5E1WA 1Z1DA 4RB0A 3EQLF 2DTRA 4IVNA 1SAXA 4XBFA 4ASNA 5FD6A 2M1BA 3TDUC 5E8IA 3Q9SA 2IA2A 4HV5A 1HW2A 1FX7A 5JR3A 2W84A 4R79A 1BJAA 2HS5A 2STWA 4HV6A 2PMHA 2PN6A 1B59A 5CVVA 1K79A 4PDKA 5JVTA 2E1CA 4I01A 1YTYA 3EYYA 2P4WA 4ENKA 1J2XA 2RDPA 3IWZA 2K86A 3QU3A 4KT5C 3ZP5A 1AWCA 1FT9A 4KICA 2IW5A 1F4KA 4L18B 4MEXF 5BQTA 4EV0A 1FNNA 5BPIA 3U2RA 3REOA 3QOPA 3WG9A 4KIBA 5CVUA 1H0MA 2FEZA 2W85A 3JTHA 4CO8A 4IF4A 2PQ8A 3KFWX 1FC3A 1B4AA 2YX7A 1B6AA 1SD4A 3B02A 1ZG1A 2OA4A 1KU3A 2HGCA 3K9TA 4I09A 4KMUX 4MTEA 2QQ9A 1ZLJA 3BOQA 1TW2A 2XIGA 4LGWA 3M9AA 3MZHA 4L0YB 3T1BA 2ZBKA 3OV8A 1FY7A 1DUXC 2A68F 5H20A 1XCBA 3FMRA 4L9VA 3EDPA 4LFUA 3KEOA 1U5TB 2OQRA 3MZYA 2MC3A 2PI0A 2NS0A 1B9NA 4CGZA 3BZ6A 1IF1A 4EJTA 4ZYEA 2YR2A 2ZCWA 5DCMB 1O57A 4OU0A 1BN5A 4AWXB 4IHSA 4ESFA 2VC1A 4HX4A 3GLXA 1TQMA 2Z99A 4U7DA 5TRDA 3FHZA 4F7ZA 4MHGA 2Y48A 3T8TA 2FBHA 5K5QA 3BDDA 1MDMA 1HKSA 1JHHA 1JE8A 3F8CA 1RUNA 5D6FA 1XMAA 1FP1D 4G8XA 3MFKA 3F6VA 5BMZA 2QBYA 3MAJA 2GXGA 5ILUA 3W6KB 2VN2A 2EK5A 3M7GA 2HQRA 1XN7A 3IKTA 2M30A 2P6TA 2D1HA 3HRMA 2CWEA 2LDUA 4FX0A 3KCCA 4L0ZB 3I0TA 1P92A 1YYVA 2ESHA 3SHFA 1K78A 2NAZA 2YPRA 3V8LA 1HQCA 3KP4A 2HTJA 5D5VB 1K6OA 5L3CA 3F23A 3MQ0A 2M45A 3D0SA 1YFHA 1QBJA 2QWWA 3V8JA 1F1ZA 3I71A 4HDVA 5JI6A 1R1TA 3VEPA 5LGNA 4U7BA 1Z05A 1PP8F 3JAMZ 2OBPA 3QPHA 2E7XA 2Y0MA 3WE2A 2F5CA 4OINF 4L5JA 3P9IA 2H27A 2ZO4A 1WKMA 1EH8A 3FF5A 3GX4X 4HLYA 4YFNF 4Q4ZF 2QQAA 3WGGA 5FB2A 2EB7A 3LWFA 2PJPA 5D4RA 4KMFA 4BQAA 5HDGA 3KZYA 2L01A 4LB6B 2HOEA 1YG2A 3CDHA 2VT3A 3BPVA 2P5LC 3TO9A 1R58A 5DD4A 4A0YA 1R7JA 2DBBA 1ON1A 1D8JA 1YW7A 1KYWA 3LQQA 2QZ8A 1ZRCA 3HRTA 3C1DA 4OOIA 1SFEA 1TQIA 3KEQA 3F3XA 1BI3A 3COAC 1ODDA 1ZN2A 4RAZA 2R7DA 2FF4A 5F1RA 4M6XA 1U6GA 5DDGA 3RTRA 1GXPA 4PGHA 2XV4S 4HF1A 2K4BA 1R23A 3TO6A 4LLNA 1YIOA 4WX9A 1LDDA 4QLCU 4RAYA 3RPQA 4WF2A 1OYIA 1L0OC 3LSTA 1XGMA 1KYZA 2L02A 5K5RA 4BHPA 4EVIA 2RVCA 4L9TA 3WTSC 4A5NA 5IT9Z 1SD7A 4P5OA 4KN7X 2KIUA 3R4KA 2KIMA 2EFOA 4BHBA 4RB3C 1R1VA 1K78B 2P7CB 4LD5A 3JTGA 2J5OA 2MD5A 2OAZA 1R1UA 4I98B 5FFXA 1XGSA 3K1PA 5FLXZ 5BS6A 3IC7A 2GZWA 2Z33A 4U88A 3F72A 2R7FA 2EFWA 4UUVA 3F6OA 2V1XA 3HSRA 2IA0A 1WI9A 2MH9A 4ZH4F 1IW7F 4WXDA 1FBUA 4CHUA 3ZQ7A 1JGSA 4DNCA 2DU9A 1KGSA 3QPTA 1ULYA 3ECHA 2NNYA 1EH7A 3S2WA 5ILVA 1YS6A 2FBKA 1LB2A 3HOSA 2Z3YA 4Q5SF 1IN4A 3V4GA 1MGTA 3DV8A 5E1ZB 3KLNA 3D5LA 4Z2YA 5D4SA 1IN6A 2RNJA 1Z6TA 4MNUA 2QQBA 1ZAOA 1QPMA 3MWMA 3GZ5A 3CLOA 1J9IA 3HTUA 3K69A 2COMA 4UVBA 4YFXF 2EV6A 4HOBA 4MQVA 3I64A 2O03A 3LA3A 4G9YA 3HHGA
chains in the Genus database with same CATH superfamily
3DU5A 4ZYAA 2K7LA 5GPAA 4BU2A 4UV9A 3MCZA 2UV1A 2STTA 4ENMA 1VQMI 4GDFA 2QENA 2DA7A 4M71A 2FNAA 1DGRM 2V6CA 2O8KA 1WWXA 5AIPA 3W2WA 4E7IA 2Y0SN 1KU7A 3Q3SA 1OCCH 2EFNA 2X6XA 2JA5J 3K10A 4ZC3A 1Y1WJ 3GTQJ 3CMMA 1X3ZB 3SYTA 3E97A 1UAAA 4OIOF 1TNSA 1W0TA 1DGWY 2EIJH 2UWMA 1KU9A 1TWFJ 1JHFA 2KLOA 3WTXC 3TO7A 1U2WA 4F93B 4XLNF 3ABKH 4Y4RA 3Q0WA 1T38A 3HIFA 2JA8J 4IHWA 5FGMA 4MFEA 5KCMA 2LG4A 2GOXB 4O6JA 4RGSA 5L3FA 3FXJA 4GCVA 4D5FA 2ZMEC 2E19A 1U8RA 2G9WA 3B6CA 3HL2A 5DCMA 3WE3A 2M2EA 3LSHA 1ETKA 2MW8A 3DTEA 2DAOA 3E5XA 1LE8A 1D5VA 4I99C 1T95A 2LNBA 2P5VA 5DCFA 3WU1B 3ABUA 2XPVA 5B1BH 3OIPA 4E7SA 3LQRA 4XN0A 2PMUA 4BL0B 4E6KG 5LLQA 1R36A 3AKZA 2EJRA 5EYRA 3GLLA 3JRGA 3QPSA 1MNEA 2D1VA 3IKVA 1T0FC 3LFUA 5ICFA 3E5QA 4PJJA 3W6JB 2AQFA 1UFMA 1J59A 2CYYA 4JOMA 3SFZA 2EFQA 2LBFB 1FOKA 5JLWA 4HNUA 2IT0A 3BG3A 4DYQA 3I53A 1WJAA 3VB2A 1OYWA 1UJ8A 2PMZN 4ZDPA 2IVMA 5AIQA 5B1AH 2DFIA 1DPUA 4LOCA 2L9VA 3HOUJ 3VSLA 3Q5FA 2DLLA 3CP8A 2XGCA 3OYGA 2JA6J 2PEXA 1YHQI 3A4CA 1CF7B 4DZJA 3C2HA 3G3ZA 2GIZA 1Z6RA 2FA5A 3BR0A 1FTZA 2KT0A 2CUEA 1FSHA 5F0FA 1EH6A 2Q2EB 4NQWA 1TW3A 1ZGAA 1G3TA 4V2GA 4ON0A 1LVAA 2VOPA 3J80Z 1OR7A 3FBNB 2EWNA 2DT5A 1J75A 2Q8KA 4XICA 5HLTA 1S7OA 2EZKA 5IT9K 5EEAA 2VJJA 3HPHA 3RJPA 2NVQJ 1BIBA 4YIFA 1VZ0A 5E3LA 1G8XA 1T08B 1X19A 1USTA 2LSOA 3JRFA 1I6HJ 4V19K 3BP8A 3IH3A 2BGCA 1FZPB 5DUKA 3RCOA 1APLC 3AG2H 3QAHA 4C2MJ 2EIKH 3CC2I 2EZIA 1IRZA 4AIDA 3L2CA 2W25A 5GP9A 3H3ZA 2ZKZA 4XLPF 4BH9A 3N97A 1X1DA 3HB9A 4IKFA 3AG4H 3BWGA 1TP4A 3QYBA 4ABZA 2X0LA 3HSFA 3CLQA 2XRNA 3WTWC 5FLXK 2X1CA 2OCEA 2KRFA 2TRTA 2BY0A 2KKOA 2VC0A 3CTAA 3DKWA 4B3AA 3E6DA 2GIVA 1SAUA 1OJLA 5A2QZ 1JKQC 1D3YA 3M8EA 1WCMJ 3EETA 3OYNA 4M73A 2VIXA 3FXMA 2FMLA 2O7OA 3ZMDA 1D0YA 1IXSB 1K4TA 4ZYDA 1GHCA 1Z7UA 1MNDA 2WA0A 1DDNA 2OQGA 2CSOA 2DDBA 4XOPA 3I5UA 2R3SA 2XAQA 3D5RC 1BI2A 4RB2C 2JQ7A 3UNGC 3KP5A 3S2HJ 2KPMA 4RS8A 1MJBA 2OU2A 2BW3B 3NWSA 4KFCA 3FIWA 3O6BB 4CUGA 4G6DA 1TWCJ 3IWFA 4WXHA 4ANJA 4M72A 5IYCJ 3IH4A 2LF7A 2E7WA 3F8BA 5LGTA 5CVIA 1I1SA 4M3EA 5D5XB 5J1YA 5EGOB 4LIVA 3JRBA 3OYJA 2EZHA 2E71A 2QUFA 3P9KA 3OYIA 2VI6A 2XGEA 3PFYA 4IPAA 1D0ZA 5HLIA 2R5YB 4HQEA 1W0UA 1DU0A 3ISPA 1ZR4A 1IRGA 4RAFA 5IYBJ 1OCPA 2DCEA 2ZMEB 3ELKA 3WU2C 5LEKA 3LSPA 4IRIA 2M4KA 2LMDA 4EJOA 1X3UA 5DEQA 1Y0UA 2MH2A 2HQ5A 4BXFA 2KHMA 1MZBA 3C18A 4A6DA 1ZK8A 2NNNA 3FM3A 3CO7C 1L3LA 4EM0B 2XGXA 3U1DA 5GTIC 3LAJA 2HEOA 4BUPA 4G7OF 1TT5B 3CP2A 2XAFA 3TOAA 3X2QH 3HUGA 1JUMA 2FBIA 1PUFB 1HA8A 3CJRB 4LLLA 4BS9A 1RZ4A 5HDNA 4P9FA 2O8XA 4W97A 4AU7A 4A3DJ 5FO5A 2Q0OA 3KP3A 3HOTA 4UNOA 1G3YA 3NAUA 2E1NA 1SANA 4P55A 3J81Z 4F55A 5IP9J 5C4JJ 2BXYA 4OAZA 2TDXA 3FX3A 2UZKA 1HF0A 2L2OA 4XK4A 3CCUI 4NNJA 5ILSA 2EA4A 3FM5A 4BXXJ 1P2FA 3H36A 1ETWA 2XRLA 3W2AA 1QHHD 4FASD 2X6YA 1V55H 2IS2A 2XC7A 1MBJA 2R7WA 3L09A 3CCLI 4BYYA 2V79A 5IP7J 2VE9A 5M5YJ 3BTCA 4FE4A 4AVPA 1B72A 3LSMA 2ETHA 1IXCA 3HJEA 4EMSA 1UG2A 3UR3C 5ED4A 3VODA 4X6AJ 3ZMVA 1HXDA 3ECOA 3HM5A 1WJDA 4Y13A 1F43A 2RN7A 4N4NB 1YX3A 1NG6A 2FUG2 4GYIA 1NTCA 1D1BA 5LHIA 2Z5UA 4XRMA 1QQIA 2KJCA 2DFEA 1P6RA 3S32A 1JT0A 5L3GA 3DQVC 1W7PB 4CCJA 1MSEC 4UY8I 3HOYJ 2JUCA 1NK2P 3ERMA 2X1DA 1Z91A 1U9OA 2F5FA 2RREA 1AA7A 3CCJI 1NH3A 4KT6A 1O3SA 2R7RA 1HKTA 1U8BA 1Y6IA 4XLAA 3PO2J 2I8DA 4ZZDA 1JXSA 2AXTC 2XUBA 1D8KA 3ZN0A 1UHWA 4NC7A 4UHTA 2MYSA 5D6EA 3KEYA 2M7BA 1JT6A 3CUQC 4L9JA 1PJRA 3L2WA 4AUXA 1G3WA 1B8IB 3DKXA 2JJ7A 2LKSA 1MKMA 2B0LA 4CYDA 3I54A 5JHUA 1MH4A 1R6RA 2F4IA 1GVJA 1TTYA 4J00A 2IAIA 1MSFC 3NEUA 2D45A 1W4MA 4EATA 1I39A 1UELB 3JRDA 4XORA 2A6HF 3QRFF 2M8EA 2VQCA 1HCRA 4D7NA 3V8KA 4IOCF 2IP2A 1ETQA 2GOMA 2RGVA 2P8TA 1FWZA 3J80K 1MD0A 2HDDA 1V5GA 3D5SC 1C0WA 4DIQA 1FOYA 5FD5A 2TCTA 2KIFA 4X1EA 1ETYA 4HZFA 1QPIA 5DV5A 4G7HF 4QTRA 4D7MA 3KYLA 3S17J 5HS7A 1H9GA 4BBRJ 1HSJA 2PX9A 5ICCA 3F0CA 3VDXA 4PJMA 1STZA 2BY3A 1W5SA 2JZYA 3NRVA 3QOEA 1JKOC 4ETSA 1HLVA 3KETA 1WVRA 3HDDA 2E36A 4BJ6C 2XGDA 2ZFWA 2R92J 3RSNA 2LLKA 3KP7A 2KIQA 4IJAA 4L5EA 3BCBA 2F5DA 4N9HA 1AKHB 1E0EA 4LG3A 4E7ZA 1IUFA 1W1WE 3DXJF 5B5EC 1R4NB 2HNHA 4M74A 2QQ8A 4HW0A 1IDYA 4ESBA 2G0EA 2X85A 1O7FA 3QP5A 4N4OB 3BJAA 3OYEA 3U9GA 3NARA 4IHYA 2MLGA 2R7SA 1I1GA 3FMSA 2WADA 1O3QA 3ABTA 2LVSA 1R5HA 4FHTA 3GYHX 3BCAA 3K7AJ 2R5ZB 3R6SA 2OC6A 4FE7A 3BTJA 2FJ1A 1SMYF 4CYCB 2NRAC 1Z3XA 3RQIA 3OYKA 2O0YA 4IXAA 4UUSB 1YX5A 2GA2A 1HSTA 4IX7A 2DXIA 1ETVA 2ESNA 2OZUA 2XKPA 2E1MC 1QO0D 1NHAA 2E5ZA 1I50J 3M8JA 1FP2A 2K02A 3K4BA 1O4XA 5HLGA 1IDZA 4HF2A 1JUSA 3GEZA 4DOZA 4OMZA 1YQAA 4PUSA 4LIUA 4KNYA 1ON2A 2DA6A 3WTUC 3O2PE 1ZGWA 5J4VA 2MD0A 1RKTA 2DOAA 3G73A 3RKWA 4AIHA 1JKPC 3S1NJ 2LKPA 4D5CA 4G7ZF 2ZSIB 4PSWA 1RKWA 1D0XA 1IRFA 3O3KA 1YW9A 2M8GX 2HOAA 4PGGA 2DA2A 4I0AA 3H5RA 5LHHA 1FYKA 1ONVA 3IV5A 4E7HA 2IA1A 4MGRA 4BBSJ 3K4LA 2A69F 1OCZH 2X6WA 4BQNA 3WTVC 4ZYHA 3T0YA 1Z77A 2HKOA 2H6BA 4CSWA 4I7HA 1BW5A 2YX4A 3OYHA 1ACIA 1R00A 5L3DA 3G1LA 4RGUA 4ZDLA 5H6QA 3L7WA 1IN5A 4U0VA 5TJJA 4I6ZA 2Y2ZA 4UXNA 3KZZA 1WSUA 2AXLA 1VQ4I 1A04A 2WTEA 3HSEA 1XCVA 2XHKA 3ASOH 4JX5A 3J81K 1Z67A 3SEZA 4LG0B 2FSWA 2KFDA 1ZH5A 3DWLE 1OMIA 2VOOA 2X9DA 3LA2A 1LEAA 3EUHA 2X48A 3ZQIA 2WV0A 2K4JA 1ZG5A 3HKZN 4YEJA 5D5WB 4IQ4A 1GLNA 2RV8A 3DLLF 2LBFA 5ERIA 5FKMA 2JRTA 1DP7P 2FOWA 3K4KA 4RGXA 2KDOA 1MMDA 1OPCA 5KAIC 2LYCA 1MJ9A 4A69C 5ICGA 3WTYC 1FEXA 4KIFA 2YS9A 2G7HA 2A3SA 1XC5A 2R7ZJ 4JP0A 1CF7A 4BHCA 4L5IA 3ZMUA 5J47A 2WAQA 3TEDA 2HOTA 4E7JA 3PJRA 2I10A 4U0YA 2DMTA 2Q2EA 4LB5A 1JTXA 4RM2A 2LKXA 3ULQB 1XSDA 1X1CA 2E2HJ 2F2EA 4KISA 2DQLA 4I2OA 3HZJA 3DF8A 1HKQA 2VL8A 2JA2A 2Y75A 4AD9A 3CO6C 1BR1A 2XVCA 2OUMA 2XAJA 3ESWB 2P0WA 2CH0A 1X2MA 2KZGA 3U21A 3WTZA 2JPCA 3K70C 3OR2C 2ISZA 2LD5A 4EGYA 4S05A 4FX4A 2FRHA 3E6BA 4A3GJ 1Y8QB 3LFKA 3FBIB 4FT8A 2LF8A 3N4MA 3I59B 1MBEA 4U87A 3BT9A 2BV6A 1RUOA 2VBYA 3PQKA 4M6YA 3MVPA 3T5XA 1A36A 3JR9A 1ETOA 4RM3A 2L4AA 1A31A 1YIJI 5IT3A 3WODF 1I27A 1S29A 2DK8A 2OV7A 5K7HA 1D1AA 2NS7A 2FOKA 1FOWA 4A5MA 1FIAA 1HDPA 2QYOA 3LSIA 3QP6A 4XMYA 5HLHA 4IHTA 2GAUA 2HI3A 1YITI 1Z9CA 1AHDP 1W7PD 2CW7A 5IPAA 2L0KA 3BR2A 2F6CA 2H1LA 3SDBA 2X6OA 1QA6A 1UHMA 2E1MB 4GO1A 3I58A 5FFZA 3HBLA 3JAMK 1MNMC 3TOBA 1F5TA 3WGHA 2CG4A 1VQKI 4D0PA 4Y33A 3J7AY 3S16J 3K4CA 3CZ6A 4HDUA 3S1RJ 2DPDA 1SD6A 4XLFA 3RKXA 4F52A 4PZJA 4B4CA 5DUIA 3S2DJ 2YU9J 4KUMA 4XKWA 3HHHA 1VI0A 2V6EA 2BW3A 4FETA 4MIMA 1EV7A 3NQOA 4ESJA 3AL0C 1YLFA 5EF6A 1WHUA 3K0LA 4IRGA 5GADJ 5E8GA 5LRSA 4RBOA 4UB8C 1UCRA 4O3MA 2B7EA 2HKXA 2HQNA 5EGOA 2W1OA 4HX7A 2GXBA 3TKYA 2A6TA 1R22A 1TNTA 3PNTA 3CCVI 2VODA 3OYBA 3MKLA 2OPTA 2R5YA 4OIQF 4M9SA 2CQQA 2L9RA 4JBAA 2ME6A 5BOXA 1BC8C 3ZGKA 3Q0VA 1PUEE 4B8XA 2ZMEA 2M34A 3L2UA 1N25A 2VE8A 3S1QJ 2CV1A 3RDIA 5GPCA 4JX4A 1MMGA 3IRQA 1WJBA 4CICA 2HZTA 1EJ9A 3BR3A 2JRMA 1BM9A 1T2KA 2VBWA 1YJWI 4M6VA 1HDDC 2A5YB 2HXIA 3E1SA 3HGGA 4KN4X 4WXCA 3CCMI 1VQ7I 2NVTJ 1S7AA 1V4RA 4R8HA 4XSXF 5B3SH 4R1HA 4BY1J 1ZHFA 4I02A 4EJWA 3K1MA 3GFJA 3AAFA 3DPUA 5J4YA 2HWVA 2IGNA 2H09A 1BBYA 3SZPA 1MBHA 2JVHA 1PUFA 3BROA 1SFUA 3BG9A 3IAM2 2NVXJ 2HYGD 3R60A 4M9XA 1ZRDA 2ZJRF 3KP2A 5IYDJ 1T0FA 5CLSA 2W4SA 2FD5A 3RYRA 1EF4A 4PCQA 4JQFA 2W57A 3OYMA 1KU2A 6PAXA 5F04A 1U5TC 4C2UA 1R5ID 2QSFX 2QA4I 1KQ8A 1OKRA 1G6NA 2P7VB 4E7KA 1G4DA 1T98A 2CUFA 4UV8A 1BW6A 3V7RA 1U3EM 1OQYA 3A2KA 4GRIA 2ELKA 4OIRF 3PNVA 3ZQCA 2VJ5A 5CPRB 3TP3A 4CDGA 2K9NA 2VASA 1V3FA 3MEXA 5LRRA 3WHBA 2EA2A 2IEKA 2VJ4A 3CUOA 3C7JA 1HBXG 2PG4A 4ZYGA 1XB4A 3G2BA 4N0BA 4EM2A 1RETA 5LFAA 3AFHA 1RI7A 1Y39A 2R7OA 3H9JA 3V7SA 1CQTA 1B1BA 4ENNA 1OFCX 1YO5C 1RNLA 1W7PA 2XASA 2LK2A 1TBXA 2Y9YA 3ZMSA 3H0DA 1IUYA 2X4HA 4DBQA 2EILH 1F9NA 4DW6A 1Z7LA 1XSXA 2K9LA 3P5JA 4HNVA 3A02A 2R4GA 5E3MA 4HSRA 5K5OA 2YSRA 3K6GA 3VYRB 2CFXA 2A6EF 3JW4A 2DW4A 1R5GA 1ITYA 1Z3YA 3DEEA 5LEJA 4MEYF 3SZTA 2QF7A 2CJJA 4RA2A 1B8IA 2BBYA 1JJ8C 3ML6A 3S8PA 2ZXIA 2L7KA 3FXRA 1XX5A 2XSJC 2FQ3A 2V9KA 3QQAA 2KL4A 4MQ9F 3HC7A 5DYMA 5E20A 2BEOA 4CZCA 3GZ6A 2O61A 2A61A 5F64A 1P9QC 3W2VA 3ZQQA 2H6CA 2R0QC 1A6QA 1I6XA 2ACJA 4GXOA 4XKCA 1FYLA 1FTTA 3BQZA 3CJNA 5GAHJ 1OYYA 2FNPA 1E3PA 4L9NA 3A1YA 3VSKA 3RYPA 3VYUB 3GFMA 1LEBA 1DQUA 3GO5A 3FXKA 1XMXA 3AL0B 3HYIA 1YS7A 3SFIA 2K85A 3A0HC 4G94A 2W24A 4MTDA 4HG2A 3HKZA 1FMWA 3KLOA 5IY5H 3CCQI 1IRXA 3PIPF 2HVRA 2CW0F 2JTVA 4GGGA 3TDZC 3GXOA 5KK1A 3PNYA 1U0JA 3FKIJ 5FJ8J 3IRRA 3TW7A 2CFOA 5F08A 4B1RA 1AKHA 3MMYB 2UXNA 2LH9A 3LSJA 3QU6A 4CCOA 5HDKA 2M4GA 2RQPA 3L9FA 2LR8A 5GAEJ 2DMNA 3H9GA 5M3FJ 5C4XJ 5JLXA 2HFHA 2ZNZA 1S3JA 3L00A 4EM1A 1JGGA 1WRJA 3Q0UA 4OIPF 4M9ZA 1XDSA 3BY6A 2PJRB 3OYDA 3HPGA 1WJCA 3PFIA 3FZVA 2KDZA 1YW8A 5CQEA 2D2WA 2E1OA 1QVTA 1J5YA 4HLXA 2M5WA 2O6GE 1S5LC 3JREA 3CCRI 5HS8A 2R5ZA 4A6EA 5FKLA 4CYCA 5KHDA 2CS3A 1BL0A 4BE0A 1RR8C 4A3BJ 2W48A 4A0XA 1SEUA 2CV2A 4UUSA 2KP6A 4XKVA 1QNTA 2XAHA 2WAQN 3LAPA 2MLKA 2OF7A 4RB1A 3RIRA 3HTSB 3E6CC 1CGPA 2ELJA 2HTSA 3R61A 1SFXA 1LPQA 1LUJB 4IOAF 2QSHX 2BZTA 1W36D 3MN2A 1MW7A 4K2EA 2ZFUA 2ZB9A 1KA8A 1FBSA 1E2XA 3J7AO 4XOTA 4HA8A 2WBMA 4Y15A 3CESA 2QM3A 3GTPJ 2CQXA 4HX8A 3V42A 4C30A 4HBLA 3KPHA 3M8FA 3G1MA 3PQJA 4IHXA 4J01A 3GFLA 2GBYA 1IAWA 3DTIA 5LBQA 1UG0A 5FRMA 2XF7A 3R0AA 3TP0A 1IGNA 1G3SA 4C3HJ 4LK1F 2EV0A 2N8GA 3M1EA 3IL2A 4HF0A 3PUBA 3E5UA 2VT2A 1HW5A 3K2ZA 1ZRFA 2ID3A 4BDYA 2W7NA 1SVOA 1TQPA 1XD7A 2ECBA 1A5JA 2KISA 1BC7C 2DK5A 4WCGA 1YJ9I 4HAMA 1T39A 2FXAA 3I4MJ 2ZXJA 3FWEA 3M1CA 4B3XA 2L4MA 3K1NA 1MBGA 4ZDOA 5J1RA 2E35A 4AC0A 3F8MA 4Y17A 4LG0A 4Q47A 1VQPI 2DTZA 3H1CA 3K4JA 1GT0C 1QU3A 1MJAA 2OD5A 1MMAA 3Q9VA 3CUQA 3AG3H 4XLCA 4OMYA 3OMYA 2EPFA 3DU6A 2EFPA 1ZR2A 1SD5A 1JUPA 1P4XA 1S9HA 3F8NA 3ZQHA 2XAGA 2E5NA 4AIKA 1XGNA 2H8RA 2LFBA 3S93A 1IJWC 3ZPLA 1POGA 1IN7A 2VQLA 2DJIA 4MLOA 4EJUA 2NYXA 4NDLA 3VOEA 2L3DA 3OR1C 2BY2A 4I0BA 4KIGA 3CC7I 3M4OJ 3LMMA 1XSVA 2O5RA 5HS9A 2MFZA 1S72I 2QCOA 2XKOA 2ZJ2A 1WJ5A 2XSDC 3QODA 2HZDA 2P6SA 2MGQA 4EGZA 1O7LA 4BXUA 1XGOA 2VXZA 4D9JA 1QZYA 9ANTA 1J0RA 3BJ6A 3CDLA 4FTHA 1QGPA 2H94A 2DOFA 1XG1A 4CZZA 5H2FC 3GWZA 2ECCA 5L3BA 1E3OC 1E17A 5AONA 2OTLI 2HU9A 2DI3A 3FMQA 4DQ2A 1AOYA 2EINH 3HXLA 4P96A 1SMTA 2R7XA 3V7CA 3BJOA 3H9QA 1DP3A 4ITVA 3E6MA 1O3TA 2BVMA 4ZZLA 1T6SA 4YIIA 2C6YA 3BPXA 4XM3A 3JCUC 1BI0A 3ZQFA 2V9PA 3RPUD 4YRVA 1X1PA 2MG4A 4XRFA 1U9NA 4NHJA 4S04A 1DU6A 5E1XA 5J6XA 1NG7A 2L9NA 3I59A 1YI2I 2J5PA 5J8CA 2ICWG 4JK1X 1X3WB 2JPBA 2P81A 4AM3A 1UB9A 4BJ5C 5KVRA 4YFKF 3BG6A 2P5KA 3DPTA 4B44A 1F36A 3FXOA 4YG2F 3DLAA 2RC4A 1HW1A 4LMYA 3ERED 1TWGJ 3IHUA 3I4PA 2XPUA 1S8NA 3OS0A 3VYTB 1IV6A 2WAFA 1BIAA 1XTAA 4UVAA 5F1JA 1N77A 2JSCA 1BOBA 4BNCA 2HYFA 5IOZA 3TBIA 3H92A 2V9VA 3K70D 3ZN1A 1IXRC 3BG5A 4PFPA 2EV5A 3DEUA 3GUDA 2HVQA 2VONA 5A2QK 3AG1H 3S3NA 3ROUA 1ZARA 1J7KA 3FK7A 3LNQA 3J7YJ 1GXQA 4EQQA 4J19A 2WB1A 5K1YA 4LJZF 1H9TA 1LJ9A 4EJVA 1D1CA 2EH3A 4B43A 1K7AA 3E7LA 2GWRA 3GMEA 1TZLA 4UVCA 2ADUA 4P1WA 2R7VA 4V2FA 2V26A 3FXUA 2RQQA 2VKDA 2DA1A 1TWAJ 3JSOA 3WGIA 4D1QA 1FOXA 3OYAA 4QSHA 2QEXI 1EA3A 1I3QJ 5E17F 4LLGF 2CW8A 3SQNA 3CF2A 5HNFA 4WK8F 4QPOA 3G6EI 1WJEA 2DDAA 4QIWN 4HQMA 2GLOA 2HDWA 2XROA 3VFZA 2XAUA 2CMPA 3DP7A 1ZREA 3JRIA 3R0JA 3QYFA 3TW6A 5CJ9A 3BZCA 1T33A 3QYEA 2RAEA 3F21A 1LDKB 3BR1A 2B9SA 2VPLA 2CGPA 2FU4A 3EYIA 5J8FA 2CQ7A 2HPMA 3WU0A 4O5VA 3P7NA 5D8KB 1IN8A 4P9UA 3PIOF 1USSA 3ZXSA 1SFOJ 2WV1A 2DMPA 4FCYA 5F0HA 2ZJQF 2JT1A 2CV0A 2K27A 4W1UA 4IZZA 2QSGX 4JYKA 3OL4A 3QWLA 1VQLI 2KZVA 3HOZJ 4A3FJ 4CCNA 1FIPA 1IZ1A 2WC2A 3P9CA 1X58A 4RGRA 3OOPA 5C3EJ 1XMKA 1X4OA 4IO9F 3PUFA 1P7IA 4BEHA 4M3FA 2HPIA 3E0JB 1MDMB 2L7ZA 4XLHA 2ELHA 1H89C 5HODA 3CUQB 4RLFA 1LNWA 1LQ1A 4TV7A 5GTHC 4Q48A 4E70A 5LHGA 3RPUA 4UB6C 4GYGA 2VBZA 2QBYB 2BE5F 2XB5A 3DBRB 3SXYA 1Y56A 1SVLA 3S3OA 3ZMTA 2RKHA 2VBXA 4A3EJ 2HOSA 2AQEA 3H5NA 2HDCA 2E60A 5D5UB 2L54A 3RI4A 2UXXA 1WPKA 4A3KJ 3KE2A 4BJTA 3ZQLA 1OLTA 3VPRA 1B9MA 1K83J 4U0WA 4ZJZA 1S6LA 5EG0B 2M3AA 1RPWA 3ZRGA 1JTYA 2DPUA 3C3WA 3TGNA 4N9IA 1WGXA 4IRHA 4HRIA 1BI1A 5LGUA 4IHVA 1LFPA 3WG7H 3L2VA 2M0MA 1FJLA 2LY1A 2V1NA 1V5EA 3WTTC 3HRSA 3GF2A 3I55I 2LC2A 3L2QA 2YUSA 3OWTA 2LOOA 4XSZF 4G6QA 2M87A 1WH5A 2YU3A 2O3FA 5L3EA 5EEHA 1YOVB 5BPDA 3PL8A 5D8LB 5CYVA 4B47A 1BOAA 3RKYA 2MA3A 1UZCA 2IRFG 2HQAA 3H3UA 3LSGA 3DPLC 5CKTA 2VUMJ 3F8FA 4IQJA 1XDUA 2D5VA 4KA4A 2PFBA 2V1DA 2ZNYA 2EQRA 2X51A 1KZHA 1UMQA 1U78A 2LRDA 4ZTFA 3FXLA 3T8RA 3OYCA 1BA5A 5HNHA 2K9MA 2DFFA 2WWYA 3B73A 1R49A 1ZLKA 3H35A 2JWTA 3ZMZA 2DQRA 3GFIA 3F22A 2FMYA 5CVJA 3GTKJ 4DGWB 2K3FA 2BHYA 4H4KC 1ZKGA 3ABMH 2JSPA 1I5ZA 4KDPA 4A0ZA 3LA7A 2FE3A 1RR7A 1FYMA 4AVZA 4RMNA 2DMQA 1Q1HA 3E3VA 4HYEA 5DTDA 4WWCA 5CVRA 2BY1A 2G7UA 2MBFA 1VQ8I 3TQNA 2JN6A 2VXDA 1KQ0A 1TLHB 4A12A 2DODA 4H0EA 3ABLH 5DD8A 2GA1A 2WAEA 1FBQA 1ZYRF 2QLZA 3DKYA 1FLIA 2K9SA 3RZDJ 2VPRA 2IXSA 1S7EA 1P4WA 2VQGA 4BAYA 3F9KA 4ENJA 2OZ6A 1RRJA 3FDYA 2CO5A 1Y8RB 1ZG3A 2UUZA 3CMAI 5ICEA 5E3OA 3GTLJ 5FROA 5EEGA 1LVKA 4BE1A 1X1AA 1MBFA 2PJRA 4F92B 1FPQA 4KYWA 3HRUA 4CCLA 4X0GA 3DBLB 4CXFA 5HOOA 2KMUA 5M5WJ 2FQ4A 2DYRH 2OJED 5E18F 3LSRA 1VTNC 2BYVE 4NB5A 5KNLA 2CUJA 3L1PA 3LL7A 1PYVA 3OL3A 1O3RA 3GW2A 5FKNA 2V7FA 2F5EA 5F0CA 2HR3A 4LK0F 2ZC2A 2KRHA 3MZ8A 2Q1ZB 2F5VA 5M5XJ 1JKRC 1BJZA 3S1MJ 4B09A 2DA4A 2F48A 3MKZA 1YRNB 1PP7U 2A07F 2QVOA 1U5TA 1WQ2A 4XRSG 1H8AC 2V1UA 4BACA 1HC8A 2AS5F 4A2UA 1DPRA 3FXQA 1BR2A 2ISYA 4BDZA 2H8WA 2NOGA 5H6RA 1LDJA 1ZGJA 1PDNC 2GQQA 1IV8A 1P4AA 3A03A 4QWQA 1W5TA 1A6IA 1VQNI 2PLYA 5HVQC 3JSPA 4BEHB 2IJLA 1WH7A 3GVAA 5E3NA 3DFGA 1FSEA 2KJBA 1Y1VJ 1QZZA 4OWRB 5F6FA 4BGDA 3VWBA 1KQ9A 2IPQX 2Z9OA 4CCMA 4AIJA 1XS9A 3CQZJ 3KP6A 2JUGA 3I56I 4II2A 4RAGA 1QHGA 2O9LA 5DM7F 5JFRA 2IBDA 4YIRX 2CQKA 3OYFA 3HOXJ 1FMVA 1REPC 2PBIA 2DO7A 1RIOH 2WY8Q 1Z1DA 5E1WA 4RB0A 4XR6A 1ETXA 3EQLF 2K5CA 4A3LJ 2M0CA 2DTRA 4IVNA 1SAXA 4XBFA 4ASNA 2COBA 2LP0A 1QRYA 5FD6A 3G4SI 2M1BA 3TDUC 2R7TA 4MFDA 1YJNI 2HYJA 5E8IA 3IH2A 3LSKA 3Q9SA 1ZELA 1GUUA 2IA2A 4HV5A 1HW2A 2NVUB 3ZOBA 1FX7A 5JR3A 4GFBA 2GM4A 2NXNB 2DT6A 2R7QA 2W84A 1TT0A 1X1BA 5EJCA 4E7LA 3J7ZI 4BQOA 4R79A 1A35A 3M3YJ 4KITB 1BJAA 2HS5A 5JHFA 2STWA 2WB1N 4HV6A 2PMHA 2PN6A 1WI3A 3DTKA 1OCTC 1B59A 2EBIA 2Y30A 3FKJA 3EUKL 3O8GA 2A5WA 2RNGA 5CVVA 1K79A 5IOYA 1XPXA 2CRGA 4PDKA 5JVTA 2E1CA 4I01A 3A0BC 2MC4A 3EYYA 1YTYA 2P4WA 4ENKA 1J2XA 2BVLA 2RDPA 5K7ZA 1N78A 3IWZA 2QKLB 2K86A 2ID6A 3QU3A 4KT5C 2NOJB 3ZP5A 1AWCA 3BZKA 1FT9A 4KICA 1X4PA 2V4JC 2IW5A 1F4KA 3KZIC 2JK3A 3TMOA 1SC7A 1UHSA 5J1UA 2IGOA 4L18B 1OR7C 3CCSI 5F27A 2M7AA 1MIJA 3SJMA 4MEXF 4EV0A 5BQTA 1FNNA 5BPIA 3U2RA 3MKWB 3REOA 2L5QA 1ZQ3P 1E3HA 3QOPA 3WG9A 4KIBA 5FKOA 3BR6A 5CVUA 1QVUA 1H0MA 1GV5A 2FEZA 2W85A 4G6TB 1LFUP 3JTHA 4CO8A 4IF4A 4Y7NJ 2PQ8A 3KFWX 1FC3A 1B4AA 2YX7A 3BQYA 1B6AA 1SD4A 3B02A 4OAYA 1HOMA 3OS1A 3M07A 5EZGA 3I4NJ 2LY2A 3O8HA 4UUTA 1ZG1A 2DT7B 2OA4A 2OTJI 3CJQB 1KU3A 2HGCA 5EZHA 3K9TA 3BR5A 4I09A 1J09A 2K9QA 3I3LA 3A01B 1PVEA 4KMUX 3ZQGA 1MBKA 4MTEA 2QQ9A 2BHZA 1ZLJA 3BOQA 1MH3A 3N05A 1IC8A 4C3IJ 1TW2A 2XIGA 4LGWA 3M9AA 3MZHA 4L0YB 3T1BA 2L7FP 2ZBKA 3SZGA 3OV8A 1FY7A 1DUXC 1MMSA 3HHGA 5H20A 1T8IA 1XCBA 3FMRA 3K4MA 4L9VA 4PK4A 2AHQA 3JRCA 4FQGA 1VQ6I 3BLYA 3EDPA 4LFUA 4XQFA 2LTPA 5KAFC 3KEOA 4FISA 1U5TB 1AU7A 2OQRA 3MZYA 2MC3A 3JRHA 3MKYB 4AYBN 4A3IJ 2PI0A 1Y0NA 4CCKA 2NS0A 5J3LA 1B9NA 3S3MA 2IS6A 4XIDA 2Z1DA 5CQGA 1EKEA 3BZ6A 1IF1A 4CGZA 5IP6A 4EJTA 3W6VA 4ZYEA 4S0HB 4G12A 2YR2A 3D1NI 2ZCWA 5DCMB 5BNGA 4Z6YA 3CMYA 3ZR8X 4BY7J 1LE8B 1O57A 3PSFA 4OU0A 1BN5A 1H88C 4AWXB 1YE9A 3I9V2 1IG7A 3EPZA 5TISC 4ESFA 4IHSA 2E34A 2VC1A 1D5YA 3SEQA 4HX4A 3GLXA 2OCCH 3S14J 2MABA 1TQMA 2Z99A 4U7DA 5TRDA 3FHZA 2IGKA 5FLMJ 4C3JJ 1OISA 4F7ZA 4MHGA 2Y48A 4PSXA 1Q1VA 2DJNA 3T8TA 3FK6A 3FHNA 3CD6I 2FBHA 3RZOJ 1ZTRA 5FLVA 5K5QA 3CMEI 3BDDA 1T56A 3CCYA 1MDMA 3CC4I 4PJNA 3GCMA 4DBRA 1HKSA 1JHHA 1JE8A 2R93J 2VQHA 3HGYA 3OOUA 3F8CA 2QGUA 1WZ2A 2KRCA 2W00A 2CU7A 3K2AA 4BKXA 1RUNA 5D6FA 1RC9A 2JA7J 1XMAA 5E79C 3LOCA 3DEWA 5GAGJ 1FP1D 4G8XA 3MFKA 3F6VA 3KYCB 5BMZA 2QBYA 3MAJA 2GXGA 1RESA 5ILUA 4NQWB 1VQOI 3W6KB 2DMUA 2VN2A 2EK5A 3C2GA 5LD2C 2Y0SA 3M7GA 2F4OB 3BC8A 4C9YA 2DA3A 5B66C 2CQNA 2HQRA 3IP4B 1XN7A 4RDUA 2M30A 3IKTA 2P6TA 1Z21A 2D1HA 2K3PA 3BTLA 3HRMA 2LY9A 3CDIA 2CWEA 1X2NA 2AO9A 3DCFA 2DN0A 4I76A 4XNFA 5EG0A 2LDUA 5M3MJ 4FX0A 4A3MJ 3KCCA 4L0ZB 2Y31A 3I0TA 3OSFA 1P92A 1YYVA 1K6YA 3KIOA 2XF5A 2ESHA 1W5CC 5DS9A 4HSTA 3SHFA 2ZXHA 4F3QA 2BXZA 1K78A 1K4SA 2HXOA 2NAZA 5FKKA 2BOLA 3WHCA 2YPRA 5EDNA 2DFHA 4A3JJ 2VKEA 3V8LA 2JVGA 1HQCA 2ME0A 2HTJA 3KP4A 2LREA 3CF5F 5D5VB 1K6OA 2WY7Q 5L3CA 3F23A 3MQ0A 4XLEA 2M45A 3D0SA 2VLAA 3CJTB 1YFHA 3ZCOA 1Z0XA 1QBJA 2QWWA 1SFKA 3V8JA 1F1ZA 3I71A 2MSYA 1G2HA 4HDVA 3GTJJ 3B6AA 3JRAA 1ORKA 5JI6A 1R1TA 3VEPA 5LGNA 4U7BA 1Z05A 3IAS2 1PP8F 3JAMZ 1LKXA 3ASNH 2OBPA 3QPLA 4YELA 4DYRA 4C2TA 2DA5A 1R4MB 1WFXA 3QPHA 3G71I 2KQRA 3K4NA 4HPQA 2E7XA 4DJAA 4DYCA 1SVMA 2Y0MA 4PJ0C 3WE2A 5FRNA 2PMZA 2F5CA 4MO7A 4OINF 4L5JA 3BG7A 3P9IA 2H27A 2ZO4A 1WKMA 3C2BA 3EUAA 1EH8A 3FF5A 2Y69H 3GX4X 1TC3C 3HOVJ 4HLYA 4YFNF 4Q4ZF 2QQAA 2ZJPF 3WGGA 3MD2A 5FB2A 1VQ9I 2EB7A 3FISA 3LWFA 1GV2A 5D4RA 2H1KA 4KMFA 2B63J 2PJPA 5K7FA 4BQAA 4M3BA 5HDGA 3KZYA 4BE2A 2L01A 1W36C 2VJIA 4LB6B 2HOEA 1YG2A 2ZSHB 3CDHA 2VT3A 2E2IJ 2X1EA 1VQ5I 3BPVA 2P5LC 3TO9A 2NVYJ 3HOWJ 1VFCA 1R58A 2VKVA 1V54H 5DD4A 2M9HA 4A0YA 1I3AA 3HUGB 1R7JA 4DZPA 2DBBA 4XKBA 5C44J 1ON1A 1D8JA 1YW7A 1KYWA 3LQQA 2QZ8A 1ZRCA 3HRTA 4IEJA 4HNTA 3C1DA 4OOIA 4JX6A 1SFEA 1TQIA 2HVSA 3KEQA 2DOEA 3F3XA 1BI3A 1YRNA 1GDTA 3KYDB 2CUZA 3COAC 1ODDA 1ZN2A 3ONQA 2NS8A 4RAZA 3IUOA 4PJLA 1GVDA 2R7DA 2FF4A 5F1RA 4M6XA 1U6GA 3TL4X 3NWTA 5DDGA 3GTOJ 3RTRA 1GXPA 3GTMJ 4PGHA 2XDVA 2XV4S 4HF1A 1B72B 5DM6F 2K4BA 2XB0X 1R23A 3TO6A 3CCEI 4LLNA 3S15J 1N75A 1YIOA 2IS4A 4WX9A 1LDDA 2W82A 4QLCU 4RAYA 4HEA2 3H0GJ 3RPQA 4NC6A 3GBGA 1BR4A 4Y3OA 2ZXWH 4WF2A 1OYIA 3HEFA 2VKHA 1L0OC 3LSTA 1XGMA 1KYZA 2VB6A 2L02A 5K5RA 1VNDA 4LITA 4BHPA 5J40A 4XRSA 4M3DA 4EVIA 2RVCA 4L9TA 3WTSC 1LFBA 4RLQA 4A5NA 5IT9Z 2L9SA 3RQ4A 3PM1A 1SD7A 4XN3A 3GZNB 4P5OA 4AYBA 3BTIA 2IGMA 4KN7X 4XONA 2KIUA 3R4KA 2GXAA 3G1OA 2KIMA 1R9TJ 3VYSB 1ENHA 2EFOA 3L2RA 4M3GA 4NBQA 4BHBA 3EUHC 1V5FA 2K40A 4RB3C 4CA0A 1R1VA 5TGTA 3OYLA 1K78B 1P7JA 2P7CB 1QZEA 4IL6C 4LD5A 3W3CA 3JTGA 2J5OA 4B48A 1OCRH 2MD5A 2OAZA 1R1UA 4I98B 3H3VK 4CH7A 5FFXA 1XGSA 2XF6A 4Y52J 3K1PA 2R7UA 3DBHB 5FLXZ 3SDGA 5BS6A 4ZTJA 3IC7A 2DYSH 2GZWA 4XL9A 2Z33A 4U88A 1TWHJ 3F72A 2R7FA 2EFWA 4UUVA 3F6OA 2V1XA 4NC8A 3HSRA 2IA0A 2QKMB 1WI9A 1WJFA 2MH9A 3U1KA 4ZH4F 1G59A 4A3CJ 2A05A 1IW7F 2FX0A 1FBUA 4WXDA 4CHUA 2I5UA 2JMWA 3ZQ7A 4KJZA 4EEFG 3OIQA 1JGSA 4DNCA 2IS1A 2L7MP 2DU9A 3OS2A 3GTGJ 1KGSA 3QPTA 1ULYA 3ECHA 2NNYA 1EH7A 1IO2A 3S2WA 4NUBA 5ILVA 4E4HA 1YS6A 2FBKA 1NK3P 1LB2A 3HOSA 3RKQA 2XPWA 4BQQA 2Z3YA 4Q5SF 1IN4A 3V4GA 1MGTA 3DV8A 1M1EB 5E1ZB 4II3A 2Y9ZA 3KLNA 3KX2A 1TL8A 4A93J 3D5LA 4Z2YA 5D4SA 1MMNA 3OIOA 3UKGA 1IN6A 1OCOH 4QPQA 2Z2SB 3OY9A 2F4MB 3OSGA 2RNJA 1Z6TA 2Z16A 4MNUA 2QQBA 1ZAOA 1QPMA 3MWMA 2EZLA 3GZ5A 3CLOA 1J9IA 2EIMH 2E2JJ 3HTUA 1JJ6C 3K69A 1VF9A 2COMA 4UVBA 1K61A 1KONA 4YFXF 3PSIA 2EV6A 4F91B 3H5AA 4HOBA 4MQVA 3A01A 1R71A 4PFOA 1ERDA 3HG9A 3I64A 1JI8A 2O03A 5JVGF 3LA3A 4G9YA 3PO3J 2A68F
chains in the Genus database with same CATH topology
2K7LA 4UV9A 3MCZA 2STTA 4ENMA 2QENA 4M71A 2FNAA 2V6CA 1WWXA 5AIPA 1KU7A 2EFNA 3E97A 4OIOF 1TNSA 2UWMA 1KU9A 1JHFA 3WTXC 3TO7A 1U2WA 4XLNF 1T38A 3HIFA 5FGMA 4O6JA 4RGSA 5L3FA 4GCVA 1U8RA 2G9WA 5DCMA 3WE3A 2DAOA 3E5XA 1D5VA 2LNBA 2P5VA 5DCFA 3WU1B 3ABUA 3LQRA 2PMUA 5LLQA 1R36A 2EJRA 2D1VA 3IKVA 5ICFA 3E5QA 3W6JB 1UFMA 1J59A 2CYYA 3SFZA 2EFQA 1FOKA 2IT0A 3I53A 3VB2A 1OYWA 2IVMA 5AIQA 2DFIA 1DPUA 3Q5FA 2DLLA 2PEXA 1CF7B 3G3ZA 1Z6RA 2FA5A 1FSHA 1EH6A 4NQWA 1TW3A 1ZGAA 1G3TA 4ON0A 1LVAA 2VOPA 3J80Z 1OR7A 2EWNA 2DT5A 1J75A 2Q8KA 1S7OA 5IT9K 3RJPA 1BIBA 4YIFA 1USTA 2LSOA 3BP8A 2BGCA 1FZPB 5DUKA 3QAHA 3L2CA 2W25A 3H3ZA 2ZKZA 4XLPF 4BH9A 3N97A 3BWGA 2X0LA 3HSFA 2XRNA 3WTWC 5FLXK 2KRFA 2KKOA 2VC0A 3CTAA 3DKWA 3E6DA 2GIVA 5A2QZ 1D3YA 3M8EA 3EETA 4M73A 2FMLA 3ZMDA 1IXSB 1GHCA 4ZYDA 1Z7UA 1DDNA 2OQGA 2CSOA 3I5UA 2R3SA 2XAQA 1BI2A 4RB2C 3KP5A 4RS8A 1MJBA 2OU2A 4KFCA 3O6BB 4G6DA 3IWFA 4WXHA 4M72A 2LF7A 2E7WA 3F8BA 5LGTA 5CVIA 1I1SA 5D5XB 2QUFA 3P9KA 4IPAA 5HLIA 4HQEA 3ISPA 1IRGA 2ZMEB 3ELKA 5LEKA 4IRIA 4EJOA 1X3UA 5DEQA 1Y0UA 2MH2A 1MZBA 3C18A 4A6DA 2NNNA 3FM3A 3CO7C 1L3LA 4EM0B 2XGXA 3U1DA 4G7OF 3LAJA 2HEOA 2XAFA 3TOAA 3HUGA 2FBIA 4LLLA 1RZ4A 5HDNA 4P9FA 2O8XA 5FO5A 2Q0OA 3KP3A 3HOTA 4UNOA 1G3YA 2E1NA 4P55A 3J81Z 2TDXA 3FX3A 2UZKA 5ILSA 2EA4A 3FM5A 1P2FA 3L09A 4BYYA 2V79A 2VE9A 4AVPA 2ETHA 1IXCA 4EMSA 5ED4A 3VODA 3ZMVA 1HXDA 3ECOA 4Y13A 2RN7A 4GYIA 5LHIA 2Z5UA 1QQIA 2KJCA 1P6RA 5L3GA 3DQVC 1W7PB 1Z91A 2F5FA 1O3SA 1HKTA 4ZZDA 1JXSA 2XUBA 1D8KA 3ZN0A 1UHWA 4UHTA 5D6EA 3CUQC 4L9JA 1G3WA 4CYDA 1MKMA 2B0LA 3I54A 5JHUA 1GVJA 1TTYA 3NEUA 2D45A 1W4MA 2A6HF 3QRFF 2M8EA 3V8KA 2IP2A 2P8TA 2RGVA 1FWZA 3J80K 1MD0A 1C0WA 5FD5A 2KIFA 4HZFA 5DV5A 4G7HF 5HS7A 1H9GA 1HSJA 5ICCA 1STZA 1W5SA 2JZYA 3NRVA 4ETSA 3KETA 2ZFWA 3KP7A 4IJAA 4N9HA 2F5DA 3DXJF 4M74A 4HW0A 4ESBA 1O7FA 3QP5A 3BJAA 3U9GA 2MLGA 1I1GA 3FMSA 1O3QA 3ABTA 4FHTA 1R5HA 3GYHX 3R6SA 2NRAC 1SMYF 2O0YA 4IXAA 2GA2A 1HSTA 2ESNA 2OZUA 2XKPA 1QO0D 1NHAA 1FP2A 2K02A 5HLGA 4HF2A 3GEZA 4OMZA 1YQAA 4KNYA 1ON2A 3WTUC 3O2PE 3G73A 3RKWA 4AIHA 2LKPA 4G7ZF 1IRFA 3O3KA 1YW9A 4PGGA 4I0AA 5LHHA 1FYKA 1ONVA 2IA1A 4MGRA 2A69F 3WTVC 4ZYHA 3T0YA 2HKOA 2H6BA 4I7HA 2YX4A 1R00A 5L3DA 4RGUA 5H6QA 3L7WA 1IN5A 4U0VA 5TJJA 4UXNA 3KZZA 1WSUA 2AXLA 1A04A 2WTEA 3HSEA 1XCVA 2XHKA 3J81K 4LG0B 2FSWA 1ZH5A 1OMIA 2VOOA 3LA2A 1LEAA 3EUHA 2WV0A 2K4JA 1ZG5A 5D5WB 2RV8A 5ERIA 2JRTA 1DP7P 4RGXA 1OPCA 1MJ9A 5ICGA 3WTYC 4KIFA 2G7HA 2A3SA 1CF7A 4BHCA 4L5IA 3ZMUA 4U0YA 2Q2EA 4LB5A 1XSDA 3ULQB 2F2EA 2DQLA 4I2OA 3DF8A 1HKQA 2Y75A 4AD9A 3CO6C 2XVCA 2XAJA 3WTZA 2JPCA 2ISZA 4EGYA 4S05A 4FX4A 2FRHA 3E6BA 3LFKA 4FT8A 2LF8A 3N4MA 3I59B 2BV6A 1RUOA 2VBYA 3PQKA 4M6YA 3T5XA 2L4AA 5IT3A 3WODF 1I27A 1S29A 2DK8A 2FOKA 4A5MA 2QYOA 3QP6A 5HLHA 4IHTA 2GAUA 1Z9CA 1W7PD 1UHMA 4GO1A 3I58A 5FFZA 3JAMK 3TOBA 1F5TA 3WGHA 2CG4A 4D0PA 4HDUA 2DPDA 1SD6A 3RKXA 4PZJA 5DUIA 4KUMA 3HHHA 1EV7A 3NQOA 4ESJA 1YLFA 3K0LA 4IRGA 5LRSA 5E8GA 1UCRA 4O3MA 2HKXA 2HQNA 2GXBA 4HX7A 3TKYA 1R22A 1TNTA 2VODA 4OIQF 4M9SA 4JBAA 5BOXA 1BC8C 1PUEE 4B8XA 2ZMEA 2VE8A 3RDIA 3IRQA 4CICA 2HZTA 1BM9A 1T2KA 2VBWA 2A5YB 4KN4X 4WXCA 1S7AA 1V4RA 4R8HA 4XSXF 4R1HA 1ZHFA 4I02A 4EJWA 3K1MA 3GFJA 3AAFA 2HWVA 2H09A 1BBYA 3SZPA 3BROA 1SFUA 2HYGD 3R60A 4M9XA 1ZRDA 3KP2A 1T0FA 5CLSA 3RYRA 4PCQA 4JQFA 2W57A 1KU2A 6PAXA 1U5TC 1KQ8A 1OKRA 1G6NA 2P7VB 1G4DA 1T98A 4UV8A 3V7RA 1U3EM 4OIRF 4CDGA 1V3FA 3MEXA 5LRRA 2EA2A 3CUOA 3C7JA 1HBXG 2PG4A 4ZYGA 1XB4A 4N0BA 4EM2A 1RI7A 3V7SA 1B1BA 4ENNA 1YO5C 1RNLA 1W7PA 2XASA 1TBXA 3ZMSA 1IUYA 2X4HA 1F9NA 1XSXA 5K5OA 2YSRA 2CFXA 2A6EF 3JW4A 2DW4A 1R5GA 5LEJA 4MEYF 3SZTA 2BBYA 3ML6A 3FXRA 2FQ3A 4MQ9F 5DYMA 5E20A 2BEOA 3GZ6A 2O61A 2A61A 5F64A 2H6CA 1I6XA 2ACJA 4GXOA 1FYLA 3CJNA 1OYYA 2FNPA 4L9NA 3RYPA 3GFMA 1LEBA 3GO5A 3HYIA 1YS7A 4G94A 2W24A 4MTDA 3KLOA 2CW0F 2JTVA 4GGGA 3TDZC 3GXOA 5KK1A 3IRRA 2UXNA 3QU6A 5HDKA 2RQPA 3L9FA 2HFHA 2ZNZA 1S3JA 3L00A 4EM1A 1WRJA 4OIPF 4M9ZA 1XDSA 3BY6A 3PFIA 3FZVA 1YW8A 2D2WA 1J5YA 4HLXA 2M5WA 2O6GE 5HS8A 4A6EA 4A0XA 1QNTA 2XAHA 3LAPA 2MLKA 4RB1A 3RIRA 3HTSB 3E6CC 1CGPA 2HTSA 3R61A 1SFXA 4K2EA 1KA8A 1FBSA 1E2XA 3J7AO 4HA8A 4Y15A 2QM3A 4HX8A 4HBLA 3M8FA 3PQJA 3GFLA 1IAWA 5LBQA 3R0AA 1G3SA 4LK1F 2EV0A 3M1EA 3IL2A 4HF0A 3E5UA 2VT2A 1HW5A 3K2ZA 1ZRFA 1TQPA 1XD7A 1BC7C 2DK5A 4WCGA 4HAMA 1T39A 2FXAA 2ZXJA 3FWEA 2L4MA 3K1NA 3F8MA 4Y17A 4LG0A 4Q47A 1MJAA 2OD5A 3Q9VA 3CUQA 4OMYA 2EFPA 1SD5A 1P4XA 3F8NA 2XAGA 4AIKA 1XGNA 3ZPLA 1IN7A 4EJUA 2NYXA 3VOEA 2L3DA 4KIGA 4I0BA 1XSVA 5HS9A 2XKOA 2ZJ2A 2P6SA 4EGZA 1O7LA 4BXUA 1XGOA 2VXZA 1QZYA 1J0RA 3BJ6A 1QGPA 2H94A 4CZZA 1E17A 3GWZA 5L3BA 5AONA 2DI3A 3FMQA 4DQ2A 1AOYA 4P96A 1SMTA 3V7CA 3BJOA 3E6MA 1O3TA 4ZZLA 1T6SA 4YIIA 2C6YA 3BPXA 1BI0A 4XRFA 4NHJA 4S04A 5E1XA 5J6XA 3I59A 2J5PA 5J8CA 4JK1X 2JPBA 1UB9A 5KVRA 4YFKF 2P5KA 3DPTA 4YG2F 2RC4A 1HW1A 4LMYA 3ERED 3IHUA 3I4PA 1S8NA 1BIAA 4UVAA 2JSCA 4BNCA 2HYFA 3H92A 2V9VA 3ZN1A 1IXRC 2EV5A 3DEUA 3GUDA 2VONA 5A2QK 3ROUA 1ZARA 1J7KA 1GXQA 4EQQA 5K1YA 4LJZF 1H9TA 1LJ9A 4EJVA 1K7AA 2GWRA 4UVCA 2ADUA 3FXUA 3JSOA 3WGIA 5E17F 4LLGF 3SQNA 4WK8F 4HQMA 2XROA 3VFZA 3DP7A 1ZREA 3R0JA 5CJ9A 3F21A 1LDKB 2CGPA 2FU4A 3EYIA 5J8FA 3WU0A 4O5VA 3P7NA 5D8KB 1IN8A 4P9UA 1USSA 2JT1A 2K27A 1IZ1A 2WC2A 3P9CA 4RGRA 3OOPA 1XMKA 1MDMB 2ELHA 3CUQB 1LNWA 1LQ1A 4TV7A 4Q48A 4E70A 5LHGA 3RPUA 4GYGA 2VBZA 2QBYB 2BE5F 3SXYA 3ZMTA 2RKHA 2VBXA 2HDCA 5D5UB 2L54A 3RI4A 2UXXA 3KE2A 1B9MA 4U0WA 1S6LA 2DPUA 3C3WA 3TGNA 4N9IA 4IRHA 1BI1A 5LGUA 3WTTC 3HRSA 3GF2A 4XSZF 4G6QA 2M87A 2YU3A 2O3FA 5L3EA 5EEHA 5BPDA 5D8LB 5CYVA 1BOAA 3RKYA 2MA3A 2IRFG 3H3UA 3DPLC 3F8FA 1XDUA 4KA4A 2PFBA 2V1DA 2ZNYA 1U78A 3T8RA 2WWYA 3B73A 1ZLKA 3ZMZA 2DQRA 3GFIA 3F22A 2FMYA 5CVJA 1I5ZA 4KDPA 4A0ZA 3LA7A 2FE3A 1FYMA 1Q1HA 3E3VA 4HYEA 4WWCA 5CVRA 2G7UA 2MBFA 3TQNA 1KQ0A 1TLHB 4A12A 4H0EA 5DD8A 2GA1A 1FBQA 1ZYRF 2QLZA 1FLIA 1P4WA 4BAYA 4ENJA 2OZ6A 2CO5A 1ZG3A 5ICEA 5EEGA 1FPQA 4KYWA 3HRUA 4CXFA 5HOOA 5E18F 1VTNC 2BYVE 4NB5A 1O3RA 3GW2A 2F5EA 2HR3A 4LK0F 4B09A 1PP7U 2A07F 2QVOA 1U5TA 1WQ2A 2V1UA 2AS5F 4A2UA 1DPRA 3FXQA 2ISYA 5H6RA 1LDJA 1ZGJA 1PDNC 2GQQA 1P4AA 4QWQA 1W5TA 2PLYA 5HVQC 3JSPA 2IJLA 3GVAA 3DFGA 1FSEA 2KJBA 1QZZA 5F6FA 1KQ9A 2IPQX 2Z9OA 4AIJA 3KP6A 5JFRA 2CQKA 1REPC 2PBIA 2DO7A 1RIOH 5E1WA 1Z1DA 4RB0A 3EQLF 2DTRA 4IVNA 1SAXA 4XBFA 4ASNA 5FD6A 2M1BA 3TDUC 5E8IA 3Q9SA 2IA2A 4HV5A 1HW2A 1FX7A 5JR3A 2W84A 4R79A 1BJAA 2HS5A 2STWA 4HV6A 2PMHA 2PN6A 1B59A 5CVVA 1K79A 4PDKA 5JVTA 2E1CA 4I01A 1YTYA 3EYYA 2P4WA 4ENKA 1J2XA 2RDPA 3IWZA 2K86A 3QU3A 4KT5C 3ZP5A 1AWCA 1FT9A 4KICA 2IW5A 1F4KA 4L18B 4MEXF 5BQTA 4EV0A 1FNNA 5BPIA 3U2RA 3REOA 3QOPA 3WG9A 4KIBA 5CVUA 1H0MA 2FEZA 2W85A 3JTHA 4CO8A 4IF4A 2PQ8A 3KFWX 1FC3A 1B4AA 2YX7A 1B6AA 1SD4A 3B02A 1ZG1A 2OA4A 1KU3A 2HGCA 3K9TA 4I09A 4KMUX 4MTEA 2QQ9A 1ZLJA 3BOQA 1TW2A 2XIGA 4LGWA 3M9AA 3MZHA 4L0YB 3T1BA 2ZBKA 3OV8A 1FY7A 1DUXC 2A68F 5H20A 1XCBA 3FMRA 4L9VA 3EDPA 4LFUA 3KEOA 1U5TB 2OQRA 3MZYA 2MC3A 2PI0A 2NS0A 1B9NA 4CGZA 3BZ6A 1IF1A 4EJTA 4ZYEA 2YR2A 2ZCWA 5DCMB 1O57A 4OU0A 1BN5A 4AWXB 4IHSA 4ESFA 2VC1A 4HX4A 3GLXA 1TQMA 2Z99A 4U7DA 5TRDA 3FHZA 4F7ZA 4MHGA 2Y48A 3T8TA 2FBHA 5K5QA 3BDDA 1MDMA 1HKSA 1JHHA 1JE8A 3F8CA 1RUNA 5D6FA 1XMAA 1FP1D 4G8XA 3MFKA 3F6VA 5BMZA 2QBYA 3MAJA 2GXGA 5ILUA 3W6KB 2VN2A 2EK5A 3M7GA 2HQRA 1XN7A 3IKTA 2M30A 2P6TA 2D1HA 3HRMA 2CWEA 2LDUA 4FX0A 3KCCA 4L0ZB 3I0TA 1P92A 1YYVA 2ESHA 3SHFA 1K78A 2NAZA 2YPRA 3V8LA 1HQCA 3KP4A 2HTJA 5D5VB 1K6OA 5L3CA 3F23A 3MQ0A 2M45A 3D0SA 1YFHA 1QBJA 2QWWA 3V8JA 1F1ZA 3I71A 4HDVA 5JI6A 1R1TA 3VEPA 5LGNA 4U7BA 1Z05A 1PP8F 3JAMZ 2OBPA 3QPHA 2E7XA 2Y0MA 3WE2A 2F5CA 4OINF 4L5JA 3P9IA 2H27A 2ZO4A 1WKMA 1EH8A 3FF5A 3GX4X 4HLYA 4YFNF 4Q4ZF 2QQAA 3WGGA 5FB2A 2EB7A 3LWFA 2PJPA 5D4RA 4KMFA 4BQAA 5HDGA 3KZYA 2L01A 4LB6B 2HOEA 1YG2A 3CDHA 2VT3A 3BPVA 2P5LC 3TO9A 1R58A 5DD4A 4A0YA 1R7JA 2DBBA 1ON1A 1D8JA 1YW7A 1KYWA 3LQQA 2QZ8A 1ZRCA 3HRTA 3C1DA 4OOIA 1SFEA 1TQIA 3KEQA 3F3XA 1BI3A 3COAC 1ODDA 1ZN2A 4RAZA 2R7DA 2FF4A 5F1RA 4M6XA 1U6GA 5DDGA 3RTRA 1GXPA 4PGHA 2XV4S 4HF1A 2K4BA 1R23A 3TO6A 4LLNA 1YIOA 4WX9A 1LDDA 4QLCU 4RAYA 3RPQA 4WF2A 1OYIA 1L0OC 3LSTA 1XGMA 1KYZA 2L02A 5K5RA 4BHPA 4EVIA 2RVCA 4L9TA 3WTSC 4A5NA 5IT9Z 1SD7A 4P5OA 4KN7X 2KIUA 3R4KA 2KIMA 2EFOA 4BHBA 4RB3C 1R1VA 1K78B 2P7CB 4LD5A 3JTGA 2J5OA 2MD5A 2OAZA 1R1UA 4I98B 5FFXA 1XGSA 3K1PA 5FLXZ 5BS6A 3IC7A 2GZWA 2Z33A 4U88A 3F72A 2R7FA 2EFWA 4UUVA 3F6OA 2V1XA 3HSRA 2IA0A 1WI9A 2MH9A 4ZH4F 1IW7F 4WXDA 1FBUA 4CHUA 3ZQ7A 1JGSA 4DNCA 2DU9A 1KGSA 3QPTA 1ULYA 3ECHA 2NNYA 1EH7A 3S2WA 5ILVA 1YS6A 2FBKA 1LB2A 3HOSA 2Z3YA 4Q5SF 1IN4A 3V4GA 1MGTA 3DV8A 5E1ZB 3KLNA 3D5LA 4Z2YA 5D4SA 1IN6A 2RNJA 1Z6TA 4MNUA 2QQBA 1ZAOA 1QPMA 3MWMA 3GZ5A 3CLOA 1J9IA 3HTUA 3K69A 2COMA 4UVBA 4YFXF 2EV6A 4HOBA 4MQVA 3I64A 2O03A 3LA3A 4G9YA 3HHGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2K7L A;  4UV9 A;  3MCZ A;  2STT A;  4ENM A;  2QEN A;  4M71 A;  2FNA A;  2V6C A;  1WWX A;  5AIP A;  1KU7 A;  2EFN A;  3E97 A;  4OIO F;  1TNS A;  2UWM A;  1KU9 A;  1JHF A;  3WTX C;  3TO7 A;  1U2W A;  4XLN F;  1T38 A;  3HIF A;  5FGM A;  4O6J A;  4RGS A;  5L3F A;  4GCV A;  1U8R A;  2G9W A;  5DCM A;  3WE3 A;  2DAO A;  3E5X A;  1D5V A;  2LNB A;  2P5V A;  5DCF A;  3WU1 B;  3ABU A;  3LQR A;  2PMU A;  5LLQ A;  1R36 A;  2EJR A;  2D1V A;  3IKV A;  5ICF A;  3E5Q A;  3W6J B;  1UFM A;  1J59 A;  2CYY A;  3SFZ A;  2EFQ A;  1FOK A;  2IT0 A;  3I53 A;  3VB2 A;  1OYW A;  2IVM A;  5AIQ A;  2DFI A;  1DPU A;  3Q5F A;  2DLL A;  2PEX A;  1CF7 B;  3G3Z A;  1Z6R A;  2FA5 A;  1FSH A;  1EH6 A;  4NQW A;  1TW3 A;  1ZGA A;  1G3T A;  4ON0 A;  1LVA A;  2VOP A;  3J80 Z;  1OR7 A;  2EWN A;  2DT5 A;  1J75 A;  2Q8K A;  1S7O A;  5IT9 K;  3RJP A;  1BIB A;  4YIF A;  1UST A;  2LSO A;  3BP8 A;  2BGC A;  1FZP B;  5DUK A;  3QAH A;  3L2C A;  2W25 A;  3H3Z A;  2ZKZ A;  4XLP F;  4BH9 A;  3N97 A;  3BWG A;  2X0L A;  3HSF A;  2XRN A;  3WTW C;  5FLX K;  2KRF A;  2KKO A;  2VC0 A;  3CTA A;  3DKW A;  3E6D A;  2GIV A;  5A2Q Z;  1D3Y A;  3M8E A;  3EET A;  4M73 A;  2FML A;  3ZMD A;  1IXS B;  1GHC A;  4ZYD A;  1Z7U A;  1DDN A;  2OQG A;  2CSO A;  3I5U A;  2R3S A;  2XAQ A;  1BI2 A;  4RB2 C;  3KP5 A;  4RS8 A;  1MJB A;  2OU2 A;  4KFC A;  3O6B B;  4G6D A;  3IWF A;  4WXH A;  4M72 A;  2LF7 A;  2E7W A;  3F8B A;  5LGT A;  5CVI A;  1I1S A;  5D5X B;  2QUF A;  3P9K A;  4IPA A;  5HLI A;  4HQE A;  3ISP A;  1IRG A;  2ZME B;  3ELK A;  5LEK A;  4IRI A;  4EJO A;  1X3U A;  5DEQ A;  1Y0U A;  2MH2 A;  1MZB A;  3C18 A;  4A6D A;  2NNN A;  3FM3 A;  3CO7 C;  1L3L A;  4EM0 B;  2XGX A;  3U1D A;  4G7O F;  3LAJ A;  2HEO A;  2XAF A;  3TOA A;  3HUG A;  2FBI A;  4LLL A;  1RZ4 A;  5HDN A;  4P9F A;  2O8X A;  5FO5 A;  2Q0O A;  3KP3 A;  3HOT A;  4UNO A;  1G3Y A;  2E1N A;  4P55 A;  3J81 Z;  2TDX A;  3FX3 A;  2UZK A;  5ILS A;  2EA4 A;  3FM5 A;  1P2F A;  3L09 A;  4BYY A;  2V79 A;  2VE9 A;  4AVP A;  2ETH A;  1IXC A;  4EMS A;  5ED4 A;  3VOD A;  3ZMV A;  1HXD A;  3ECO A;  4Y13 A;  2RN7 A;  4GYI A;  5LHI A;  2Z5U A;  1QQI A;  2KJC A;  1P6R A;  5L3G A;  3DQV C;  1W7P B;  1Z91 A;  2F5F A;  1O3S A;  1HKT A;  4ZZD A;  1JXS A;  2XUB A;  1D8K A;  3ZN0 A;  1UHW A;  4UHT A;  5D6E A;  3CUQ C;  4L9J A;  1G3W A;  4CYD A;  1MKM A;  2B0L A;  3I54 A;  5JHU A;  1GVJ A;  1TTY A;  3NEU A;  2D45 A;  1W4M A;  2A6H F;  3QRF F;  2M8E A;  3V8K A;  2IP2 A;  2P8T A;  2RGV A;  1FWZ A;  3J80 K;  1MD0 A;  1C0W A;  5FD5 A;  2KIF A;  4HZF A;  5DV5 A;  4G7H F;  5HS7 A;  1H9G A;  1HSJ A;  5ICC A;  1STZ A;  1W5S A;  2JZY A;  3NRV A;  4ETS A;  3KET A;  2ZFW A;  3KP7 A;  4IJA A;  4N9H A;  2F5D A;  3DXJ F;  4M74 A;  4HW0 A;  4ESB A;  1O7F A;  3QP5 A;  3BJA A;  3U9G A;  2MLG A;  1I1G A;  3FMS A;  1O3Q A;  3ABT A;  4FHT A;  1R5H A;  3GYH X;  3R6S A;  2NRA C;  1SMY F;  2O0Y A;  4IXA A;  2GA2 A;  1HST A;  2ESN A;  2OZU A;  2XKP A;  1QO0 D;  1NHA A;  1FP2 A;  2K02 A;  5HLG A;  4HF2 A;  3GEZ A;  4OMZ A;  1YQA A;  4KNY A;  1ON2 A;  3WTU C;  3O2P E;  3G73 A;  3RKW A;  4AIH A;  2LKP A;  4G7Z F;  1IRF A;  3O3K A;  1YW9 A;  4PGG A;  4I0A A;  5LHH A;  1FYK A;  1ONV A;  2IA1 A;  4MGR A;  2A69 F;  3WTV C;  4ZYH A;  3T0Y A;  2HKO A;  2H6B A;  4I7H A;  2YX4 A;  1R00 A;  5L3D A;  4RGU A;  5H6Q A;  3L7W A;  1IN5 A;  4U0V A;  5TJJ A;  4UXN A;  3KZZ A;  1WSU A;  2AXL A;  1A04 A;  2WTE A;  3HSE A;  1XCV A;  2XHK A;  3J81 K;  4LG0 B;  2FSW A;  1ZH5 A;  1OMI A;  2VOO A;  3LA2 A;  1LEA A;  3EUH A;  2WV0 A;  2K4J A;  1ZG5 A;  5D5W B;  2RV8 A;  5ERI A;  2JRT A;  1DP7 P;  4RGX A;  1OPC A;  1MJ9 A;  5ICG A;  3WTY C;  4KIF A;  2G7H A;  2A3S A;  1CF7 A;  4BHC A;  4L5I A;  3ZMU A;  4U0Y A;  2Q2E A;  4LB5 A;  1XSD A;  3ULQ B;  2F2E A;  2DQL A;  4I2O A;  3DF8 A;  1HKQ A;  2Y75 A;  4AD9 A;  3CO6 C;  2XVC A;  2XAJ A;  3WTZ A;  2JPC A;  2ISZ A;  4EGY A;  4S05 A;  4FX4 A;  2FRH A;  3E6B A;  3LFK A;  4FT8 A;  2LF8 A;  3N4M A;  3I59 B;  2BV6 A;  1RUO A;  2VBY A;  3PQK A;  4M6Y A;  3T5X A;  2L4A A;  5IT3 A;  3WOD F;  1I27 A;  1S29 A;  2DK8 A;  2FOK A;  4A5M A;  2QYO A;  3QP6 A;  5HLH A;  4IHT A;  2GAU A;  1Z9C A;  1W7P D;  1UHM A;  4GO1 A;  3I58 A;  5FFZ A;  3JAM K;  3TOB A;  1F5T A;  3WGH A;  2CG4 A;  4D0P A;  4HDU A;  2DPD A;  1SD6 A;  3RKX A;  4PZJ A;  5DUI A;  4KUM A;  3HHH A;  1EV7 A;  3NQO A;  4ESJ A;  1YLF A;  3K0L A;  4IRG A;  5LRS A;  5E8G A;  1UCR A;  4O3M A;  2HKX A;  2HQN A;  2GXB A;  4HX7 A;  3TKY A;  1R22 A;  1TNT A;  2VOD A;  4OIQ F;  4M9S A;  4JBA A;  5BOX A;  1BC8 C;  1PUE E;  4B8X A;  2ZME A;  2VE8 A;  3RDI A;  3IRQ A;  4CIC A;  2HZT A;  1BM9 A;  1T2K A;  2VBW A;  2A5Y B;  4KN4 X;  4WXC A;  1S7A A;  1V4R A;  4R8H A;  4XSX F;  4R1H A;  1ZHF A;  4I02 A;  4EJW A;  3K1M A;  3GFJ A;  3AAF A;  2HWV A;  2H09 A;  1BBY A;  3SZP A;  3BRO A;  1SFU A;  2HYG D;  3R60 A;  4M9X A;  1ZRD A;  3KP2 A;  1T0F A;  5CLS A;  3RYR A;  4PCQ A;  4JQF A;  2W57 A;  1KU2 A;  6PAX A;  1U5T C;  1KQ8 A;  1OKR A;  1G6N A;  2P7V B;  1G4D A;  1T98 A;  4UV8 A;  3V7R A;  1U3E M;  4OIR F;  4CDG A;  1V3F A;  3MEX A;  5LRR A;  2EA2 A;  3CUO A;  3C7J A;  1HBX G;  2PG4 A;  4ZYG A;  1XB4 A;  4N0B A;  4EM2 A;  1RI7 A;  3V7S A;  1B1B A;  4ENN A;  1YO5 C;  1RNL A;  1W7P A;  2XAS A;  1TBX A;  3ZMS A;  1IUY A;  2X4H A;  1F9N A;  1XSX A;  5K5O A;  2YSR A;  2CFX A;  2A6E F;  3JW4 A;  2DW4 A;  1R5G A;  5LEJ A;  4MEY F;  3SZT A;  2BBY A;  3ML6 A;  3FXR A;  2FQ3 A;  4MQ9 F;  5DYM A;  5E20 A;  2BEO A;  3GZ6 A;  2O61 A;  2A61 A;  5F64 A;  2H6C A;  1I6X A;  2ACJ A;  4GXO A;  1FYL A;  3CJN A;  1OYY A;  2FNP A;  4L9N A;  3RYP A;  3GFM A;  1LEB A;  3GO5 A;  3HYI A;  1YS7 A;  4G94 A;  2W24 A;  4MTD A;  3KLO A;  2CW0 F;  2JTV A;  4GGG A;  3TDZ C;  3GXO A;  5KK1 A;  3IRR A;  2UXN A;  3QU6 A;  5HDK A;  2RQP A;  3L9F A;  2HFH A;  2ZNZ A;  1S3J A;  3L00 A;  4EM1 A;  1WRJ A;  4OIP F;  4M9Z A;  1XDS A;  3BY6 A;  3PFI A;  3FZV A;  1YW8 A;  2D2W A;  1J5Y A;  4HLX A;  2M5W A;  2O6G E;  5HS8 A;  4A6E A;  4A0X A;  1QNT A;  2XAH A;  3LAP A;  2MLK A;  4RB1 A;  3RIR A;  3HTS B;  3E6C C;  1CGP A;  2HTS A;  3R61 A;  1SFX A;  4K2E A;  1KA8 A;  1FBS A;  1E2X A;  3J7A O;  4HA8 A;  4Y15 A;  2QM3 A;  4HX8 A;  4HBL A;  3M8F A;  3PQJ A;  3GFL A;  1IAW A;  5LBQ A;  3R0A A;  1G3S A;  4LK1 F;  2EV0 A;  3M1E A;  3IL2 A;  4HF0 A;  3E5U A;  2VT2 A;  1HW5 A;  3K2Z A;  1ZRF A;  1TQP A;  1XD7 A;  1BC7 C;  2DK5 A;  4WCG A;  4HAM A;  1T39 A;  2FXA A;  2ZXJ A;  3FWE A;  2L4M A;  3K1N A;  3F8M A;  4Y17 A;  4LG0 A;  4Q47 A;  1MJA A;  2OD5 A;  3Q9V A;  3CUQ A;  4OMY A;  2EFP A;  1SD5 A;  1P4X A;  3F8N A;  2XAG A;  4AIK A;  1XGN A;  3ZPL A;  1IN7 A;  4EJU A;  2NYX A;  3VOE A;  2L3D A;  4KIG A;  4I0B A;  1XSV A;  5HS9 A;  2XKO A;  2ZJ2 A;  2P6S A;  4EGZ A;  1O7L A;  4BXU A;  1XGO A;  2VXZ A;  1QZY A;  1J0R A;  3BJ6 A;  1QGP A;  2H94 A;  4CZZ A;  1E17 A;  3GWZ A;  5L3B A;  5AON A;  2DI3 A;  3FMQ A;  4DQ2 A;  1AOY A;  4P96 A;  1SMT A;  3V7C A;  3BJO A;  3E6M A;  1O3T A;  4ZZL A;  1T6S A;  4YII A;  2C6Y A;  3BPX A;  1BI0 A;  4XRF A;  4NHJ A;  4S04 A;  5E1X A;  5J6X A;  3I59 A;  2J5P A;  5J8C A;  4JK1 X;  2JPB A;  1UB9 A;  5KVR A;  4YFK F;  2P5K A;  3DPT A;  4YG2 F;  2RC4 A;  1HW1 A;  4LMY A;  3ERE D;  3IHU A;  3I4P A;  1S8N A;  1BIA A;  4UVA A;  2JSC A;  4BNC A;  2HYF A;  3H92 A;  2V9V A;  3ZN1 A;  1IXR C;  2EV5 A;  3DEU A;  3GUD A;  2VON A;  5A2Q K;  3ROU A;  1ZAR A;  1J7K A;  1GXQ A;  4EQQ A;  5K1Y A;  4LJZ F;  1H9T A;  1LJ9 A;  4EJV A;  1K7A A;  2GWR A;  4UVC A;  2ADU A;  3FXU A;  3JSO A;  3WGI A;  5E17 F;  4LLG F;  3SQN A;  4WK8 F;  4HQM A;  2XRO A;  3VFZ A;  3DP7 A;  1ZRE A;  3R0J A;  5CJ9 A;  3F21 A;  1LDK B;  2CGP A;  2FU4 A;  3EYI A;  5J8F A;  3WU0 A;  4O5V A;  3P7N A;  5D8K B;  1IN8 A;  4P9U A;  1USS A;  2JT1 A;  2K27 A;  1IZ1 A;  2WC2 A;  3P9C A;  4RGR A;  3OOP A;  1XMK A;  1MDM B;  2ELH A;  3CUQ B;  1LNW A;  1LQ1 A;  4TV7 A;  4Q48 A;  4E70 A;  5LHG A;  3RPU A;  4GYG A;  2VBZ A;  2QBY B;  2BE5 F;  3SXY A;  3ZMT A;  2RKH A;  2VBX A;  2HDC A;  5D5U B;  2L54 A;  3RI4 A;  2UXX A;  3KE2 A;  1B9M A;  4U0W A;  1S6L A;  2DPU A;  3C3W A;  3TGN A;  4N9I A;  4IRH A;  1BI1 A;  5LGU A;  3WTT C;  3HRS A;  3GF2 A;  4XSZ F;  4G6Q A;  2M87 A;  2YU3 A;  2O3F A;  5L3E A;  5EEH A;  5BPD A;  5D8L B;  5CYV A;  1BOA A;  3RKY A;  2MA3 A;  2IRF G;  3H3U A;  3DPL C;  3F8F A;  1XDU A;  4KA4 A;  2PFB A;  2V1D A;  2ZNY A;  1U78 A;  3T8R A;  2WWY A;  3B73 A;  1ZLK A;  3ZMZ A;  2DQR A;  3GFI A;  3F22 A;  2FMY A;  5CVJ A;  1I5Z A;  4KDP A;  4A0Z A;  3LA7 A;  2FE3 A;  1FYM A;  1Q1H A;  3E3V A;  4HYE A;  4WWC A;  5CVR A;  2G7U A;  2MBF A;  3TQN A;  1KQ0 A;  1TLH B;  4A12 A;  4H0E A;  5DD8 A;  2GA1 A;  1FBQ A;  1ZYR F;  2QLZ A;  1FLI A;  1P4W A;  4BAY A;  4ENJ A;  2OZ6 A;  2CO5 A;  1ZG3 A;  5ICE A;  5EEG A;  1FPQ A;  4KYW A;  3HRU A;  4CXF A;  5HOO A;  5E18 F;  1VTN C;  2BYV E;  4NB5 A;  1O3R A;  3GW2 A;  2F5E A;  2HR3 A;  4LK0 F;  4B09 A;  1PP7 U;  2A07 F;  2QVO A;  1U5T A;  1WQ2 A;  2V1U A;  2AS5 F;  4A2U A;  1DPR A;  3FXQ A;  2ISY A;  5H6R A;  1LDJ A;  1ZGJ A;  1PDN C;  2GQQ A;  1P4A A;  4QWQ A;  1W5T A;  2PLY A;  5HVQ C;  3JSP A;  2IJL A;  3GVA A;  3DFG A;  1FSE A;  2KJB A;  1QZZ A;  5F6F A;  1KQ9 A;  2IPQ X;  2Z9O A;  4AIJ A;  3KP6 A;  5JFR A;  2CQK A;  1REP C;  2PBI A;  2DO7 A;  1RIO H;  5E1W A;  1Z1D A;  4RB0 A;  3EQL F;  2DTR A;  4IVN A;  1SAX A;  4XBF A;  4ASN A;  5FD6 A;  2M1B A;  3TDU C;  5E8I A;  3Q9S A;  2IA2 A;  4HV5 A;  1HW2 A;  1FX7 A;  5JR3 A;  2W84 A;  4R79 A;  1BJA A;  2HS5 A;  2STW A;  4HV6 A;  2PMH A;  2PN6 A;  1B59 A;  5CVV A;  1K79 A;  4PDK A;  5JVT A;  2E1C A;  4I01 A;  1YTY A;  3EYY A;  2P4W A;  4ENK A;  1J2X A;  2RDP A;  3IWZ A;  2K86 A;  3QU3 A;  4KT5 C;  3ZP5 A;  1AWC A;  1FT9 A;  4KIC A;  2IW5 A;  1F4K A;  4L18 B;  4MEX F;  5BQT A;  4EV0 A;  1FNN A;  5BPI A;  3U2R A;  3REO A;  3QOP A;  3WG9 A;  4KIB A;  5CVU A;  1H0M A;  2FEZ A;  2W85 A;  3JTH A;  4CO8 A;  4IF4 A;  2PQ8 A;  3KFW X;  1FC3 A;  1B4A A;  2YX7 A;  1B6A A;  1SD4 A;  3B02 A;  1ZG1 A;  2OA4 A;  1KU3 A;  2HGC A;  3K9T A;  4I09 A;  4KMU X;  4MTE A;  2QQ9 A;  1ZLJ A;  3BOQ A;  1TW2 A;  2XIG A;  4LGW A;  3M9A A;  3MZH A;  4L0Y B;  3T1B A;  2ZBK A;  3OV8 A;  1FY7 A;  1DUX C;  2A68 F;  5H20 A;  1XCB A;  3FMR A;  4L9V A;  3EDP A;  4LFU A;  3KEO A;  1U5T B;  2OQR A;  3MZY A;  2MC3 A;  2PI0 A;  2NS0 A;  1B9N A;  4CGZ A;  3BZ6 A;  1IF1 A;  4EJT A;  4ZYE A;  2YR2 A;  2ZCW A;  5DCM B;  1O57 A;  4OU0 A;  1BN5 A;  4AWX B;  4IHS A;  4ESF A;  2VC1 A;  4HX4 A;  3GLX A;  1TQM A;  2Z99 A;  4U7D A;  5TRD A;  3FHZ A;  4F7Z A;  4MHG A;  2Y48 A;  3T8T A;  2FBH A;  5K5Q A;  3BDD A;  1MDM A;  1HKS A;  1JHH A;  1JE8 A;  3F8C A;  1RUN A;  5D6F A;  1XMA A;  1FP1 D;  4G8X A;  3MFK A;  3F6V A;  5BMZ A;  2QBY A;  3MAJ A;  2GXG A;  5ILU A;  3W6K B;  2VN2 A;  2EK5 A;  3M7G A;  2HQR A;  1XN7 A;  3IKT A;  2M30 A;  2P6T A;  2D1H A;  3HRM A;  2CWE A;  2LDU A;  4FX0 A;  3KCC A;  4L0Z B;  3I0T A;  1P92 A;  1YYV A;  2ESH A;  3SHF A;  1K78 A;  2NAZ A;  2YPR A;  3V8L A;  1HQC A;  3KP4 A;  2HTJ A;  5D5V B;  1K6O A;  5L3C A;  3F23 A;  3MQ0 A;  2M45 A;  3D0S A;  1YFH A;  1QBJ A;  2QWW A;  3V8J A;  1F1Z A;  3I71 A;  4HDV A;  5JI6 A;  1R1T A;  3VEP A;  5LGN A;  4U7B A;  1Z05 A;  1PP8 F;  3JAM Z;  2OBP A;  3QPH A;  2E7X A;  2Y0M A;  3WE2 A;  2F5C A;  4OIN F;  4L5J A;  3P9I A;  2H27 A;  2ZO4 A;  1WKM A;  1EH8 A;  3FF5 A;  3GX4 X;  4HLY A;  4YFN F;  4Q4Z F;  2QQA A;  3WGG A;  5FB2 A;  2EB7 A;  3LWF A;  2PJP A;  5D4R A;  4KMF A;  4BQA A;  5HDG A;  3KZY A;  2L01 A;  4LB6 B;  2HOE A;  1YG2 A;  3CDH A;  2VT3 A;  3BPV A;  2P5L C;  3TO9 A;  1R58 A;  5DD4 A;  4A0Y A;  1R7J A;  2DBB A;  1ON1 A;  1D8J A;  1YW7 A;  1KYW A;  3LQQ A;  2QZ8 A;  1ZRC A;  3HRT A;  3C1D A;  4OOI A;  1SFE A;  1TQI A;  3KEQ A;  3F3X A;  1BI3 A;  3COA C;  1ODD A;  1ZN2 A;  4RAZ A;  2R7D A;  2FF4 A;  5F1R A;  4M6X A;  1U6G A;  5DDG A;  3RTR A;  1GXP A;  4PGH A;  2XV4 S;  4HF1 A;  2K4B A;  1R23 A;  3TO6 A;  4LLN A;  1YIO A;  4WX9 A;  1LDD A;  4QLC U;  4RAY A;  3RPQ A;  4WF2 A;  1OYI A;  1L0O C;  3LST A;  1XGM A;  1KYZ A;  2L02 A;  5K5R A;  4BHP A;  4EVI A;  2RVC A;  4L9T A;  3WTS C;  4A5N A;  5IT9 Z;  1SD7 A;  4P5O A;  4KN7 X;  2KIU A;  3R4K A;  2KIM A;  2EFO A;  4BHB A;  4RB3 C;  1R1V A;  1K78 B;  2P7C B;  4LD5 A;  3JTG A;  2J5O A;  2MD5 A;  2OAZ A;  1R1U A;  4I98 B;  5FFX A;  1XGS A;  3K1P A;  5FLX Z;  5BS6 A;  3IC7 A;  2GZW A;  2Z33 A;  4U88 A;  3F72 A;  2R7F A;  2EFW A;  4UUV A;  3F6O A;  2V1X A;  3HSR A;  2IA0 A;  1WI9 A;  2MH9 A;  4ZH4 F;  1IW7 F;  4WXD A;  1FBU A;  4CHU A;  3ZQ7 A;  1JGS A;  4DNC A;  2DU9 A;  1KGS A;  3QPT A;  1ULY A;  3ECH A;  2NNY A;  1EH7 A;  3S2W A;  5ILV A;  1YS6 A;  2FBK A;  1LB2 A;  3HOS A;  2Z3Y A;  4Q5S F;  1IN4 A;  3V4G A;  1MGT A;  3DV8 A;  5E1Z B;  3KLN A;  3D5L A;  4Z2Y A;  5D4S A;  1IN6 A;  2RNJ A;  1Z6T A;  4MNU A;  2QQB A;  1ZAO A;  1QPM A;  3MWM A;  3GZ5 A;  3CLO A;  1J9I A;  3HTU A;  3K69 A;  2COM A;  4UVB A;  4YFX F;  2EV6 A;  4HOB A;  4MQV A;  3I64 A;  2O03 A;  3LA3 A;  4G9Y A;  3HHG A; 
#chains in the Genus database with same CATH topology
 3DU5 A;  4ZYA A;  2K7L A;  5GPA A;  4BU2 A;  4UV9 A;  3MCZ A;  2UV1 A;  2STT A;  4ENM A;  1VQM I;  4GDF A;  2QEN A;  2DA7 A;  4M71 A;  2FNA A;  1DGR M;  2V6C A;  2O8K A;  1WWX A;  5AIP A;  3W2W A;  4E7I A;  2Y0S N;  1KU7 A;  3Q3S A;  1OCC H;  2EFN A;  2X6X A;  2JA5 J;  3K10 A;  4ZC3 A;  1Y1W J;  3GTQ J;  3CMM A;  1X3Z B;  3SYT A;  3E97 A;  1UAA A;  4OIO F;  1TNS A;  1W0T A;  1DGW Y;  2EIJ H;  2UWM A;  1KU9 A;  1TWF J;  1JHF A;  2KLO A;  3WTX C;  3TO7 A;  1U2W A;  4F93 B;  4XLN F;  3ABK H;  4Y4R A;  3Q0W A;  1T38 A;  3HIF A;  2JA8 J;  4IHW A;  5FGM A;  4MFE A;  5KCM A;  2LG4 A;  2GOX B;  4O6J A;  4RGS A;  5L3F A;  3FXJ A;  4GCV A;  4D5F A;  2ZME C;  2E19 A;  1U8R A;  2G9W A;  3B6C A;  3HL2 A;  5DCM A;  3WE3 A;  2M2E A;  3LSH A;  1ETK A;  2MW8 A;  3DTE A;  2DAO A;  3E5X A;  1LE8 A;  1D5V A;  4I99 C;  1T95 A;  2LNB A;  2P5V A;  5DCF A;  3WU1 B;  3ABU A;  2XPV A;  5B1B H;  3OIP A;  4E7S A;  3LQR A;  4XN0 A;  2PMU A;  4BL0 B;  4E6K G;  5LLQ A;  1R36 A;  3AKZ A;  2EJR A;  5EYR A;  3GLL A;  3JRG A;  3QPS A;  1MNE A;  2D1V A;  3IKV A;  1T0F C;  3LFU A;  5ICF A;  3E5Q A;  4PJJ A;  3W6J B;  2AQF A;  1UFM A;  1J59 A;  2CYY A;  4JOM A;  3SFZ A;  2EFQ A;  2LBF B;  1FOK A;  5JLW A;  4HNU A;  2IT0 A;  3BG3 A;  4DYQ A;  3I53 A;  1WJA A;  3VB2 A;  1OYW A;  1UJ8 A;  2PMZ N;  4ZDP A;  2IVM A;  5AIQ A;  5B1A H;  2DFI A;  1DPU A;  4LOC A;  2L9V A;  3HOU J;  3VSL A;  3Q5F A;  2DLL A;  3CP8 A;  2XGC A;  3OYG A;  2JA6 J;  2PEX A;  1YHQ I;  3A4C A;  1CF7 B;  4DZJ A;  3C2H A;  3G3Z A;  2GIZ A;  1Z6R A;  2FA5 A;  3BR0 A;  1FTZ A;  2KT0 A;  2CUE A;  1FSH A;  5F0F A;  1EH6 A;  2Q2E B;  4NQW A;  1TW3 A;  1ZGA A;  1G3T A;  4V2G A;  4ON0 A;  1LVA A;  2VOP A;  3J80 Z;  1OR7 A;  3FBN B;  2EWN A;  2DT5 A;  1J75 A;  2Q8K A;  4XIC A;  5HLT A;  1S7O A;  2EZK A;  5IT9 K;  5EEA A;  2VJJ A;  3HPH A;  3RJP A;  2NVQ J;  1BIB A;  4YIF A;  1VZ0 A;  5E3L A;  1G8X A;  1T08 B;  1X19 A;  1UST A;  2LSO A;  3JRF A;  1I6H J;  4V19 K;  3BP8 A;  3IH3 A;  2BGC A;  1FZP B;  5DUK A;  3RCO A;  1APL C;  3AG2 H;  3QAH A;  4C2M J;  2EIK H;  3CC2 I;  2EZI A;  1IRZ A;  4AID A;  3L2C A;  2W25 A;  5GP9 A;  3H3Z A;  2ZKZ A;  4XLP F;  4BH9 A;  3N97 A;  1X1D A;  3HB9 A;  4IKF A;  3AG4 H;  3BWG A;  1TP4 A;  3QYB A;  4ABZ A;  2X0L A;  3HSF A;  3CLQ A;  2XRN A;  3WTW C;  5FLX K;  2X1C A;  2OCE A;  2KRF A;  2TRT A;  2BY0 A;  2KKO A;  2VC0 A;  3CTA A;  3DKW A;  4B3A A;  3E6D A;  2GIV A;  1SAU A;  1OJL A;  5A2Q Z;  1JKQ C;  1D3Y A;  3M8E A;  1WCM J;  3EET A;  3OYN A;  4M73 A;  2VIX A;  3FXM A;  2FML A;  2O7O A;  3ZMD A;  1D0Y A;  1IXS B;  1K4T A;  4ZYD A;  1GHC A;  1Z7U A;  1MND A;  2WA0 A;  1DDN A;  2OQG A;  2CSO A;  2DDB A;  4XOP A;  3I5U A;  2R3S A;  2XAQ A;  3D5R C;  1BI2 A;  4RB2 C;  2JQ7 A;  3UNG C;  3KP5 A;  3S2H J;  2KPM A;  4RS8 A;  1MJB A;  2OU2 A;  2BW3 B;  3NWS A;  4KFC A;  3FIW A;  3O6B B;  4CUG A;  4G6D A;  1TWC J;  3IWF A;  4WXH A;  4ANJ A;  4M72 A;  5IYC J;  3IH4 A;  2LF7 A;  2E7W A;  3F8B A;  5LGT A;  5CVI A;  1I1S A;  4M3E A;  5D5X B;  5J1Y A;  5EGO B;  4LIV A;  3JRB A;  3OYJ A;  2EZH A;  2E71 A;  2QUF A;  3P9K A;  3OYI A;  2VI6 A;  2XGE A;  3PFY A;  4IPA A;  1D0Z A;  5HLI A;  2R5Y B;  4HQE A;  1W0U A;  1DU0 A;  3ISP A;  1ZR4 A;  1IRG A;  4RAF A;  5IYB J;  1OCP A;  2DCE A;  2ZME B;  3ELK A;  3WU2 C;  5LEK A;  3LSP A;  4IRI A;  2M4K A;  2LMD A;  4EJO A;  1X3U A;  5DEQ A;  1Y0U A;  2MH2 A;  2HQ5 A;  4BXF A;  2KHM A;  1MZB A;  3C18 A;  4A6D A;  1ZK8 A;  2NNN A;  3FM3 A;  3CO7 C;  1L3L A;  4EM0 B;  2XGX A;  3U1D A;  5GTI C;  3LAJ A;  2HEO A;  4BUP A;  4G7O F;  1TT5 B;  3CP2 A;  2XAF A;  3TOA A;  3X2Q H;  3HUG A;  1JUM A;  2FBI A;  1PUF B;  1HA8 A;  3CJR B;  4LLL A;  4BS9 A;  1RZ4 A;  5HDN A;  4P9F A;  2O8X A;  4W97 A;  4AU7 A;  4A3D J;  5FO5 A;  2Q0O A;  3KP3 A;  3HOT A;  4UNO A;  1G3Y A;  3NAU A;  2E1N A;  1SAN A;  4P55 A;  3J81 Z;  4F55 A;  5IP9 J;  5C4J J;  2BXY A;  4OAZ A;  2TDX A;  3FX3 A;  2UZK A;  1HF0 A;  2L2O A;  4XK4 A;  3CCU I;  4NNJ A;  5ILS A;  2EA4 A;  3FM5 A;  4BXX J;  1P2F A;  3H36 A;  1ETW A;  2XRL A;  3W2A A;  1QHH D;  4FAS D;  2X6Y A;  1V55 H;  2IS2 A;  2XC7 A;  1MBJ A;  2R7W A;  3L09 A;  3CCL I;  4BYY A;  2V79 A;  5IP7 J;  2VE9 A;  5M5Y J;  3BTC A;  4FE4 A;  4AVP A;  1B72 A;  3LSM A;  2ETH A;  1IXC A;  3HJE A;  4EMS A;  1UG2 A;  3UR3 C;  5ED4 A;  3VOD A;  4X6A J;  3ZMV A;  1HXD A;  3ECO A;  3HM5 A;  1WJD A;  4Y13 A;  1F43 A;  2RN7 A;  4N4N B;  1YX3 A;  1NG6 A;  2FUG 2;  4GYI A;  1NTC A;  1D1B A;  5LHI A;  2Z5U A;  4XRM A;  1QQI A;  2KJC A;  2DFE A;  1P6R A;  3S32 A;  1JT0 A;  5L3G A;  3DQV C;  1W7P B;  4CCJ A;  1MSE C;  4UY8 I;  3HOY J;  2JUC A;  1NK2 P;  3ERM A;  2X1D A;  1Z91 A;  1U9O A;  2F5F A;  2RRE A;  1AA7 A;  3CCJ I;  1NH3 A;  4KT6 A;  1O3S A;  2R7R A;  1HKT A;  1U8B A;  1Y6I A;  4XLA A;  3PO2 J;  2I8D A;  4ZZD A;  1JXS A;  2AXT C;  2XUB A;  1D8K A;  3ZN0 A;  1UHW A;  4NC7 A;  4UHT A;  2MYS A;  5D6E A;  3KEY A;  2M7B A;  1JT6 A;  3CUQ C;  4L9J A;  1PJR A;  3L2W A;  4AUX A;  1G3W A;  1B8I B;  3DKX A;  2JJ7 A;  2LKS A;  1MKM A;  2B0L A;  4CYD A;  3I54 A;  5JHU A;  1MH4 A;  1R6R A;  2F4I A;  1GVJ A;  1TTY A;  4J00 A;  2IAI A;  1MSF C;  3NEU A;  2D45 A;  1W4M A;  4EAT A;  1I39 A;  1UEL B;  3JRD A;  4XOR A;  2A6H F;  3QRF F;  2M8E A;  2VQC A;  1HCR A;  4D7N A;  3V8K A;  4IOC F;  2IP2 A;  1ETQ A;  2GOM A;  2RGV A;  2P8T A;  1FWZ A;  3J80 K;  1MD0 A;  2HDD A;  1V5G A;  3D5S C;  1C0W A;  4DIQ A;  1FOY A;  5FD5 A;  2TCT A;  2KIF A;  4X1E A;  1ETY A;  4HZF A;  1QPI A;  5DV5 A;  4G7H F;  4QTR A;  4D7M A;  3KYL A;  3S17 J;  5HS7 A;  1H9G A;  4BBR J;  1HSJ A;  2PX9 A;  5ICC A;  3F0C A;  3VDX A;  4PJM A;  1STZ A;  2BY3 A;  1W5S A;  2JZY A;  3NRV A;  3QOE A;  1JKO C;  4ETS A;  1HLV A;  3KET A;  1WVR A;  3HDD A;  2E36 A;  4BJ6 C;  2XGD A;  2ZFW A;  2R92 J;  3RSN A;  2LLK A;  3KP7 A;  2KIQ A;  4IJA A;  4L5E A;  3BCB A;  2F5D A;  4N9H A;  1AKH B;  1E0E A;  4LG3 A;  4E7Z A;  1IUF A;  1W1W E;  3DXJ F;  5B5E C;  1R4N B;  2HNH A;  4M74 A;  2QQ8 A;  4HW0 A;  1IDY A;  4ESB A;  2G0E A;  2X85 A;  1O7F A;  3QP5 A;  4N4O B;  3BJA A;  3OYE A;  3U9G A;  3NAR A;  4IHY A;  2MLG A;  2R7S A;  1I1G A;  3FMS A;  2WAD A;  1O3Q A;  3ABT A;  2LVS A;  1R5H A;  4FHT A;  3GYH X;  3BCA A;  3K7A J;  2R5Z B;  3R6S A;  2OC6 A;  4FE7 A;  3BTJ A;  2FJ1 A;  1SMY F;  4CYC B;  2NRA C;  1Z3X A;  3RQI A;  3OYK A;  2O0Y A;  4IXA A;  4UUS B;  1YX5 A;  2GA2 A;  1HST A;  4IX7 A;  2DXI A;  1ETV A;  2ESN A;  2OZU A;  2XKP A;  2E1M C;  1QO0 D;  1NHA A;  2E5Z A;  1I50 J;  3M8J A;  1FP2 A;  2K02 A;  3K4B A;  1O4X A;  5HLG A;  1IDZ A;  4HF2 A;  1JUS A;  3GEZ A;  4DOZ A;  4OMZ A;  1YQA A;  4PUS A;  4LIU A;  4KNY A;  1ON2 A;  2DA6 A;  3WTU C;  3O2P E;  1ZGW A;  5J4V A;  2MD0 A;  1RKT A;  2DOA A;  3G73 A;  3RKW A;  4AIH A;  1JKP C;  3S1N J;  2LKP A;  4D5C A;  4G7Z F;  2ZSI B;  4PSW A;  1RKW A;  1D0X A;  1IRF A;  3O3K A;  1YW9 A;  2M8G X;  2HOA A;  4PGG A;  2DA2 A;  4I0A A;  3H5R A;  5LHH A;  1FYK A;  1ONV A;  3IV5 A;  4E7H A;  2IA1 A;  4MGR A;  4BBS J;  3K4L A;  2A69 F;  1OCZ H;  2X6W A;  4BQN A;  3WTV C;  4ZYH A;  3T0Y A;  1Z77 A;  2HKO A;  2H6B A;  4CSW A;  4I7H A;  1BW5 A;  2YX4 A;  3OYH A;  1ACI A;  1R00 A;  5L3D A;  3G1L A;  4RGU A;  4ZDL A;  5H6Q A;  3L7W A;  1IN5 A;  4U0V A;  5TJJ A;  4I6Z A;  2Y2Z A;  4UXN A;  3KZZ A;  1WSU A;  2AXL A;  1VQ4 I;  1A04 A;  2WTE A;  3HSE A;  1XCV A;  2XHK A;  3ASO H;  4JX5 A;  3J81 K;  1Z67 A;  3SEZ A;  4LG0 B;  2FSW A;  2KFD A;  1ZH5 A;  3DWL E;  1OMI A;  2VOO A;  2X9D A;  3LA2 A;  1LEA A;  3EUH A;  2X48 A;  3ZQI A;  2WV0 A;  2K4J A;  1ZG5 A;  3HKZ N;  4YEJ A;  5D5W B;  4IQ4 A;  1GLN A;  2RV8 A;  3DLL F;  2LBF A;  5ERI A;  5FKM A;  2JRT A;  1DP7 P;  2FOW A;  3K4K A;  4RGX A;  2KDO A;  1MMD A;  1OPC A;  5KAI C;  2LYC A;  1MJ9 A;  4A69 C;  5ICG A;  3WTY C;  1FEX A;  4KIF A;  2YS9 A;  2G7H A;  2A3S A;  1XC5 A;  2R7Z J;  4JP0 A;  1CF7 A;  4BHC A;  4L5I A;  3ZMU A;  5J47 A;  2WAQ A;  3TED A;  2HOT A;  4E7J A;  3PJR A;  2I10 A;  4U0Y A;  2DMT A;  2Q2E A;  4LB5 A;  1JTX A;  4RM2 A;  2LKX A;  3ULQ B;  1XSD A;  1X1C A;  2E2H J;  2F2E A;  4KIS A;  2DQL A;  4I2O A;  3HZJ A;  3DF8 A;  1HKQ A;  2VL8 A;  2JA2 A;  2Y75 A;  4AD9 A;  3CO6 C;  1BR1 A;  2XVC A;  2OUM A;  2XAJ A;  3ESW B;  2P0W A;  2CH0 A;  1X2M A;  2KZG A;  3U21 A;  3WTZ A;  2JPC A;  3K70 C;  3OR2 C;  2ISZ A;  2LD5 A;  4EGY A;  4S05 A;  4FX4 A;  2FRH A;  3E6B A;  4A3G J;  1Y8Q B;  3LFK A;  3FBI B;  4FT8 A;  2LF8 A;  3N4M A;  3I59 B;  1MBE A;  4U87 A;  3BT9 A;  2BV6 A;  1RUO A;  2VBY A;  3PQK A;  4M6Y A;  3MVP A;  3T5X A;  1A36 A;  3JR9 A;  1ETO A;  4RM3 A;  2L4A A;  1A31 A;  1YIJ I;  5IT3 A;  3WOD F;  1I27 A;  1S29 A;  2DK8 A;  2OV7 A;  5K7H A;  1D1A A;  2NS7 A;  2FOK A;  1FOW A;  4A5M A;  1FIA A;  1HDP A;  2QYO A;  3LSI A;  3QP6 A;  4XMY A;  5HLH A;  4IHT A;  2GAU A;  2HI3 A;  1YIT I;  1Z9C A;  1AHD P;  1W7P D;  2CW7 A;  5IPA A;  2L0K A;  3BR2 A;  2F6C A;  2H1L A;  3SDB A;  2X6O A;  1QA6 A;  1UHM A;  2E1M B;  4GO1 A;  3I58 A;  5FFZ A;  3HBL A;  3JAM K;  1MNM C;  3TOB A;  1F5T A;  3WGH A;  2CG4 A;  1VQK I;  4D0P A;  4Y33 A;  3J7A Y;  3S16 J;  3K4C A;  3CZ6 A;  4HDU A;  3S1R J;  2DPD A;  1SD6 A;  4XLF A;  3RKX A;  4F52 A;  4PZJ A;  4B4C A;  5DUI A;  3S2D J;  2YU9 J;  4KUM A;  4XKW A;  3HHH A;  1VI0 A;  2V6E A;  2BW3 A;  4FET A;  4MIM A;  1EV7 A;  3NQO A;  4ESJ A;  3AL0 C;  1YLF A;  5EF6 A;  1WHU A;  3K0L A;  4IRG A;  5GAD J;  5E8G A;  5LRS A;  4RBO A;  4UB8 C;  1UCR A;  4O3M A;  2B7E A;  2HKX A;  2HQN A;  5EGO A;  2W1O A;  4HX7 A;  2GXB A;  3TKY A;  2A6T A;  1R22 A;  1TNT A;  3PNT A;  3CCV I;  2VOD A;  3OYB A;  3MKL A;  2OPT A;  2R5Y A;  4OIQ F;  4M9S A;  2CQQ A;  2L9R A;  4JBA A;  2ME6 A;  5BOX A;  1BC8 C;  3ZGK A;  3Q0V A;  1PUE E;  4B8X A;  2ZME A;  2M34 A;  3L2U A;  1N25 A;  2VE8 A;  3S1Q J;  2CV1 A;  3RDI A;  5GPC A;  4JX4 A;  1MMG A;  3IRQ A;  1WJB A;  4CIC A;  2HZT A;  1EJ9 A;  3BR3 A;  2JRM A;  1BM9 A;  1T2K A;  2VBW A;  1YJW I;  4M6V A;  1HDD C;  2A5Y B;  2HXI A;  3E1S A;  3HGG A;  4KN4 X;  4WXC A;  3CCM I;  1VQ7 I;  2NVT J;  1S7A A;  1V4R A;  4R8H A;  4XSX F;  5B3S H;  4R1H A;  4BY1 J;  1ZHF A;  4I02 A;  4EJW A;  3K1M A;  3GFJ A;  3AAF A;  3DPU A;  5J4Y A;  2HWV A;  2IGN A;  2H09 A;  1BBY A;  3SZP A;  1MBH A;  2JVH A;  1PUF A;  3BRO A;  1SFU A;  3BG9 A;  3IAM 2;  2NVX J;  2HYG D;  3R60 A;  4M9X A;  1ZRD A;  2ZJR F;  3KP2 A;  5IYD J;  1T0F A;  5CLS A;  2W4S A;  2FD5 A;  3RYR A;  1EF4 A;  4PCQ A;  4JQF A;  2W57 A;  3OYM A;  1KU2 A;  6PAX A;  5F04 A;  1U5T C;  4C2U A;  1R5I D;  2QSF X;  2QA4 I;  1KQ8 A;  1OKR A;  1G6N A;  2P7V B;  4E7K A;  1G4D A;  1T98 A;  2CUF A;  4UV8 A;  1BW6 A;  3V7R A;  1U3E M;  1OQY A;  3A2K A;  4GRI A;  2ELK A;  4OIR F;  3PNV A;  3ZQC A;  2VJ5 A;  5CPR B;  3TP3 A;  4CDG A;  2K9N A;  2VAS A;  1V3F A;  3MEX A;  5LRR A;  3WHB A;  2EA2 A;  2IEK A;  2VJ4 A;  3CUO A;  3C7J A;  1HBX G;  2PG4 A;  4ZYG A;  1XB4 A;  3G2B A;  4N0B A;  4EM2 A;  1RET A;  5LFA A;  3AFH A;  1RI7 A;  1Y39 A;  2R7O A;  3H9J A;  3V7S A;  1CQT A;  1B1B A;  4ENN A;  1OFC X;  1YO5 C;  1RNL A;  1W7P A;  2XAS A;  2LK2 A;  1TBX A;  2Y9Y A;  3ZMS A;  3H0D A;  1IUY A;  2X4H A;  4DBQ A;  2EIL H;  1F9N A;  4DW6 A;  1Z7L A;  1XSX A;  2K9L A;  3P5J A;  4HNV A;  3A02 A;  2R4G A;  5E3M A;  4HSR A;  5K5O A;  2YSR A;  3K6G A;  3VYR B;  2CFX A;  2A6E F;  3JW4 A;  2DW4 A;  1R5G A;  1ITY A;  1Z3Y A;  3DEE A;  5LEJ A;  4MEY F;  3SZT A;  2QF7 A;  2CJJ A;  4RA2 A;  1B8I A;  2BBY A;  1JJ8 C;  3ML6 A;  3S8P A;  2ZXI A;  2L7K A;  3FXR A;  1XX5 A;  2XSJ C;  2FQ3 A;  2V9K A;  3QQA A;  2KL4 A;  4MQ9 F;  3HC7 A;  5DYM A;  5E20 A;  2BEO A;  4CZC A;  3GZ6 A;  2O61 A;  2A61 A;  5F64 A;  1P9Q C;  3W2V A;  3ZQQ A;  2H6C A;  2R0Q C;  1A6Q A;  1I6X A;  2ACJ A;  4GXO A;  4XKC A;  1FYL A;  1FTT A;  3BQZ A;  3CJN A;  5GAH J;  1OYY A;  2FNP A;  1E3P A;  4L9N A;  3A1Y A;  3VSK A;  3RYP A;  3VYU B;  3GFM A;  1LEB A;  1DQU A;  3GO5 A;  3FXK A;  1XMX A;  3AL0 B;  3HYI A;  1YS7 A;  3SFI A;  2K85 A;  3A0H C;  4G94 A;  2W24 A;  4MTD A;  4HG2 A;  3HKZ A;  1FMW A;  3KLO A;  5IY5 H;  3CCQ I;  1IRX A;  3PIP F;  2HVR A;  2CW0 F;  2JTV A;  4GGG A;  3TDZ C;  3GXO A;  5KK1 A;  3PNY A;  1U0J A;  3FKI J;  5FJ8 J;  3IRR A;  3TW7 A;  2CFO A;  5F08 A;  4B1R A;  1AKH A;  3MMY B;  2UXN A;  2LH9 A;  3LSJ A;  3QU6 A;  4CCO A;  5HDK A;  2M4G A;  2RQP A;  3L9F A;  2LR8 A;  5GAE J;  2DMN A;  3H9G A;  5M3F J;  5C4X J;  5JLX A;  2HFH A;  2ZNZ A;  1S3J A;  3L00 A;  4EM1 A;  1JGG A;  1WRJ A;  3Q0U A;  4OIP F;  4M9Z A;  1XDS A;  3BY6 A;  2PJR B;  3OYD A;  3HPG A;  1WJC A;  3PFI A;  3FZV A;  2KDZ A;  1YW8 A;  5CQE A;  2D2W A;  2E1O A;  1QVT A;  1J5Y A;  4HLX A;  2M5W A;  2O6G E;  1S5L C;  3JRE A;  3CCR I;  5HS8 A;  2R5Z A;  4A6E A;  5FKL A;  4CYC A;  5KHD A;  2CS3 A;  1BL0 A;  4BE0 A;  1RR8 C;  4A3B J;  2W48 A;  4A0X A;  1SEU A;  2CV2 A;  4UUS A;  2KP6 A;  4XKV A;  1QNT A;  2XAH A;  2WAQ N;  3LAP A;  2MLK A;  2OF7 A;  4RB1 A;  3RIR A;  3HTS B;  3E6C C;  1CGP A;  2ELJ A;  2HTS A;  3R61 A;  1SFX A;  1LPQ A;  1LUJ B;  4IOA F;  2QSH X;  2BZT A;  1W36 D;  3MN2 A;  1MW7 A;  4K2E A;  2ZFU A;  2ZB9 A;  1KA8 A;  1FBS A;  1E2X A;  3J7A O;  4XOT A;  4HA8 A;  2WBM A;  4Y15 A;  3CES A;  2QM3 A;  3GTP J;  2CQX A;  4HX8 A;  3V42 A;  4C30 A;  4HBL A;  3KPH A;  3M8F A;  3G1M A;  3PQJ A;  4IHX A;  4J01 A;  3GFL A;  2GBY A;  1IAW A;  3DTI A;  5LBQ A;  1UG0 A;  5FRM A;  2XF7 A;  3R0A A;  3TP0 A;  1IGN A;  1G3S A;  4C3H J;  4LK1 F;  2EV0 A;  2N8G A;  3M1E A;  3IL2 A;  4HF0 A;  3PUB A;  3E5U A;  2VT2 A;  1HW5 A;  3K2Z A;  1ZRF A;  2ID3 A;  4BDY A;  2W7N A;  1SVO A;  1TQP A;  1XD7 A;  2ECB A;  1A5J A;  2KIS A;  1BC7 C;  2DK5 A;  4WCG A;  1YJ9 I;  4HAM A;  1T39 A;  2FXA A;  3I4M J;  2ZXJ A;  3FWE A;  3M1C A;  4B3X A;  2L4M A;  3K1N A;  1MBG A;  4ZDO A;  5J1R A;  2E35 A;  4AC0 A;  3F8M A;  4Y17 A;  4LG0 A;  4Q47 A;  1VQP I;  2DTZ A;  3H1C A;  3K4J A;  1GT0 C;  1QU3 A;  1MJA A;  2OD5 A;  1MMA A;  3Q9V A;  3CUQ A;  3AG3 H;  4XLC A;  4OMY A;  3OMY A;  2EPF A;  3DU6 A;  2EFP A;  1ZR2 A;  1SD5 A;  1JUP A;  1P4X A;  1S9H A;  3F8N A;  3ZQH A;  2XAG A;  2E5N A;  4AIK A;  1XGN A;  2H8R A;  2LFB A;  3S93 A;  1IJW C;  3ZPL A;  1POG A;  1IN7 A;  2VQL A;  2DJI A;  4MLO A;  4EJU A;  2NYX A;  4NDL A;  3VOE A;  2L3D A;  3OR1 C;  2BY2 A;  4I0B A;  4KIG A;  3CC7 I;  3M4O J;  3LMM A;  1XSV A;  2O5R A;  5HS9 A;  2MFZ A;  1S72 I;  2QCO A;  2XKO A;  2ZJ2 A;  1WJ5 A;  2XSD C;  3QOD A;  2HZD A;  2P6S A;  2MGQ A;  4EGZ A;  1O7L A;  4BXU A;  1XGO A;  2VXZ A;  4D9J A;  1QZY A;  9ANT A;  1J0R A;  3BJ6 A;  3CDL A;  4FTH A;  1QGP A;  2H94 A;  2DOF A;  1XG1 A;  4CZZ A;  5H2F C;  3GWZ A;  2ECC A;  5L3B A;  1E3O C;  1E17 A;  5AON A;  2OTL I;  2HU9 A;  2DI3 A;  3FMQ A;  4DQ2 A;  1AOY A;  2EIN H;  3HXL A;  4P96 A;  1SMT A;  2R7X A;  3V7C A;  3BJO A;  3H9Q A;  1DP3 A;  4ITV A;  3E6M A;  1O3T A;  2BVM A;  4ZZL A;  1T6S A;  4YII A;  2C6Y A;  3BPX A;  4XM3 A;  3JCU C;  1BI0 A;  3ZQF A;  2V9P A;  3RPU D;  4YRV A;  1X1P A;  2MG4 A;  4XRF A;  1U9N A;  4NHJ A;  4S04 A;  1DU6 A;  5E1X A;  5J6X A;  1NG7 A;  2L9N A;  3I59 A;  1YI2 I;  2J5P A;  5J8C A;  2ICW G;  4JK1 X;  1X3W B;  2JPB A;  2P81 A;  4AM3 A;  1UB9 A;  4BJ5 C;  5KVR A;  4YFK F;  3BG6 A;  2P5K A;  3DPT A;  4B44 A;  1F36 A;  3FXO A;  4YG2 F;  3DLA A;  2RC4 A;  1HW1 A;  4LMY A;  3ERE D;  1TWG J;  3IHU A;  3I4P A;  2XPU A;  1S8N A;  3OS0 A;  3VYT B;  1IV6 A;  2WAF A;  1BIA A;  1XTA A;  4UVA A;  5F1J A;  1N77 A;  2JSC A;  1BOB A;  4BNC A;  2HYF A;  5IOZ A;  3TBI A;  3H92 A;  2V9V A;  3K70 D;  3ZN1 A;  1IXR C;  3BG5 A;  4PFP A;  2EV5 A;  3DEU A;  3GUD A;  2HVQ A;  2VON A;  5A2Q K;  3AG1 H;  3S3N A;  3ROU A;  1ZAR A;  1J7K A;  3FK7 A;  3LNQ A;  3J7Y J;  1GXQ A;  4EQQ A;  4J19 A;  2WB1 A;  5K1Y A;  4LJZ F;  1H9T A;  1LJ9 A;  4EJV A;  1D1C A;  2EH3 A;  4B43 A;  1K7A A;  3E7L A;  2GWR A;  3GME A;  1TZL A;  4UVC A;  2ADU A;  4P1W A;  2R7V A;  4V2F A;  2V26 A;  3FXU A;  2RQQ A;  2VKD A;  2DA1 A;  1TWA J;  3JSO A;  3WGI A;  4D1Q A;  1FOX A;  3OYA A;  4QSH A;  2QEX I;  1EA3 A;  1I3Q J;  5E17 F;  4LLG F;  2CW8 A;  3SQN A;  3CF2 A;  5HNF A;  4WK8 F;  4QPO A;  3G6E I;  1WJE A;  2DDA A;  4QIW N;  4HQM A;  2GLO A;  2HDW A;  2XRO A;  3VFZ A;  2XAU A;  2CMP A;  3DP7 A;  1ZRE A;  3JRI A;  3R0J A;  3QYF A;  3TW6 A;  5CJ9 A;  3BZC A;  1T33 A;  3QYE A;  2RAE A;  3F21 A;  1LDK B;  3BR1 A;  2B9S A;  2VPL A;  2CGP A;  2FU4 A;  3EYI A;  5J8F A;  2CQ7 A;  2HPM A;  3WU0 A;  4O5V A;  3P7N A;  5D8K B;  1IN8 A;  4P9U A;  3PIO F;  1USS A;  3ZXS A;  1SFO J;  2WV1 A;  2DMP A;  4FCY A;  5F0H A;  2ZJQ F;  2JT1 A;  2CV0 A;  2K27 A;  4W1U A;  4IZZ A;  2QSG X;  4JYK A;  3OL4 A;  3QWL A;  1VQL I;  2KZV A;  3HOZ J;  4A3F J;  4CCN A;  1FIP A;  1IZ1 A;  2WC2 A;  3P9C A;  1X58 A;  4RGR A;  3OOP A;  5C3E J;  1XMK A;  1X4O A;  4IO9 F;  3PUF A;  1P7I A;  4BEH A;  4M3F A;  2HPI A;  3E0J B;  1MDM B;  2L7Z A;  4XLH A;  2ELH A;  1H89 C;  5HOD A;  3CUQ B;  4RLF A;  1LNW A;  1LQ1 A;  4TV7 A;  5GTH C;  4Q48 A;  4E70 A;  5LHG A;  3RPU A;  4UB6 C;  4GYG A;  2VBZ A;  2QBY B;  2BE5 F;  2XB5 A;  3DBR B;  3SXY A;  1Y56 A;  1SVL A;  3S3O A;  3ZMT A;  2RKH A;  2VBX A;  4A3E J;  2HOS A;  2AQE A;  3H5N A;  2HDC A;  2E60 A;  5D5U B;  2L54 A;  3RI4 A;  2UXX A;  1WPK A;  4A3K J;  3KE2 A;  4BJT A;  3ZQL A;  1OLT A;  3VPR A;  1B9M A;  1K83 J;  4U0W A;  4ZJZ A;  1S6L A;  5EG0 B;  2M3A A;  1RPW A;  3ZRG A;  1JTY A;  2DPU A;  3C3W A;  3TGN A;  4N9I A;  1WGX A;  4IRH A;  4HRI A;  1BI1 A;  5LGU A;  4IHV A;  1LFP A;  3WG7 H;  3L2V A;  2M0M A;  1FJL A;  2LY1 A;  2V1N A;  1V5E A;  3WTT C;  3HRS A;  3GF2 A;  3I55 I;  2LC2 A;  3L2Q A;  2YUS A;  3OWT A;  2LOO A;  4XSZ F;  4G6Q A;  2M87 A;  1WH5 A;  2YU3 A;  2O3F A;  5L3E A;  5EEH A;  1YOV B;  5BPD A;  3PL8 A;  5D8L B;  5CYV A;  4B47 A;  1BOA A;  3RKY A;  2MA3 A;  1UZC A;  2IRF G;  2HQA A;  3H3U A;  3LSG A;  3DPL C;  5CKT A;  2VUM J;  3F8F A;  4IQJ A;  1XDU A;  2D5V A;  4KA4 A;  2PFB A;  2V1D A;  2ZNY A;  2EQR A;  2X51 A;  1KZH A;  1UMQ A;  1U78 A;  2LRD A;  4ZTF A;  3FXL A;  3T8R A;  3OYC A;  1BA5 A;  5HNH A;  2K9M A;  2DFF A;  2WWY A;  3B73 A;  1R49 A;  1ZLK A;  3H35 A;  2JWT A;  3ZMZ A;  2DQR A;  3GFI A;  3F22 A;  2FMY A;  5CVJ A;  3GTK J;  4DGW B;  2K3F A;  2BHY A;  4H4K C;  1ZKG A;  3ABM H;  2JSP A;  1I5Z A;  4KDP A;  4A0Z A;  3LA7 A;  2FE3 A;  1RR7 A;  1FYM A;  4AVZ A;  4RMN A;  2DMQ A;  1Q1H A;  3E3V A;  4HYE A;  5DTD A;  4WWC A;  5CVR A;  2BY1 A;  2G7U A;  2MBF A;  1VQ8 I;  3TQN A;  2JN6 A;  2VXD A;  1KQ0 A;  1TLH B;  4A12 A;  2DOD A;  4H0E A;  3ABL H;  5DD8 A;  2GA1 A;  2WAE A;  1FBQ A;  1ZYR F;  2QLZ A;  3DKY A;  1FLI A;  2K9S A;  3RZD J;  2VPR A;  2IXS A;  1S7E A;  1P4W A;  2VQG A;  4BAY A;  3F9K A;  4ENJ A;  2OZ6 A;  1RRJ A;  3FDY A;  2CO5 A;  1Y8R B;  1ZG3 A;  2UUZ A;  3CMA I;  5ICE A;  5E3O A;  3GTL J;  5FRO A;  5EEG A;  1LVK A;  4BE1 A;  1X1A A;  1MBF A;  2PJR A;  4F92 B;  1FPQ A;  4KYW A;  3HRU A;  4CCL A;  4X0G A;  3DBL B;  4CXF A;  5HOO A;  2KMU A;  5M5W J;  2FQ4 A;  2DYR H;  2OJE D;  5E18 F;  3LSR A;  1VTN C;  2BYV E;  4NB5 A;  5KNL A;  2CUJ A;  3L1P A;  3LL7 A;  1PYV A;  3OL3 A;  1O3R A;  3GW2 A;  5FKN A;  2V7F A;  2F5E A;  5F0C A;  2HR3 A;  4LK0 F;  2ZC2 A;  2KRH A;  3MZ8 A;  2Q1Z B;  2F5V A;  5M5X J;  1JKR C;  1BJZ A;  3S1M J;  4B09 A;  2DA4 A;  2F48 A;  3MKZ A;  1YRN B;  1PP7 U;  2A07 F;  2QVO A;  1U5T A;  1WQ2 A;  4XRS G;  1H8A C;  2V1U A;  4BAC A;  1HC8 A;  2AS5 F;  4A2U A;  1DPR A;  3FXQ A;  1BR2 A;  2ISY A;  4BDZ A;  2H8W A;  2NOG A;  5H6R A;  1LDJ A;  1ZGJ A;  1PDN C;  2GQQ A;  1IV8 A;  1P4A A;  3A03 A;  4QWQ A;  1W5T A;  1A6I A;  1VQN I;  2PLY A;  5HVQ C;  3JSP A;  4BEH B;  2IJL A;  1WH7 A;  3GVA A;  5E3N A;  3DFG A;  1FSE A;  2KJB A;  1Y1V J;  1QZZ A;  4OWR B;  5F6F A;  4BGD A;  3VWB A;  1KQ9 A;  2IPQ X;  2Z9O A;  4CCM A;  4AIJ A;  1XS9 A;  3CQZ J;  3KP6 A;  2JUG A;  3I56 I;  4II2 A;  4RAG A;  1QHG A;  2O9L A;  5DM7 F;  5JFR A;  2IBD A;  4YIR X;  2CQK A;  3OYF A;  3HOX J;  1FMV A;  1REP C;  2PBI A;  2DO7 A;  1RIO H;  2WY8 Q;  1Z1D A;  5E1W A;  4RB0 A;  4XR6 A;  1ETX A;  3EQL F;  2K5C A;  4A3L J;  2M0C A;  2DTR A;  4IVN A;  1SAX A;  4XBF A;  4ASN A;  2COB A;  2LP0 A;  1QRY A;  5FD6 A;  3G4S I;  2M1B A;  3TDU C;  2R7T A;  4MFD A;  1YJN I;  2HYJ A;  5E8I A;  3IH2 A;  3LSK A;  3Q9S A;  1ZEL A;  1GUU A;  2IA2 A;  4HV5 A;  1HW2 A;  2NVU B;  3ZOB A;  1FX7 A;  5JR3 A;  4GFB A;  2GM4 A;  2NXN B;  2DT6 A;  2R7Q A;  2W84 A;  1TT0 A;  1X1B A;  5EJC A;  4E7L A;  3J7Z I;  4BQO A;  4R79 A;  1A35 A;  3M3Y J;  4KIT B;  1BJA A;  2HS5 A;  5JHF A;  2STW A;  2WB1 N;  4HV6 A;  2PMH A;  2PN6 A;  1WI3 A;  3DTK A;  1OCT C;  1B59 A;  2EBI A;  2Y30 A;  3FKJ A;  3EUK L;  3O8G A;  2A5W A;  2RNG A;  5CVV A;  1K79 A;  5IOY A;  1XPX A;  2CRG A;  4PDK A;  5JVT A;  2E1C A;  4I01 A;  3A0B C;  2MC4 A;  3EYY A;  1YTY A;  2P4W A;  4ENK A;  1J2X A;  2BVL A;  2RDP A;  5K7Z A;  1N78 A;  3IWZ A;  2QKL B;  2K86 A;  2ID6 A;  3QU3 A;  4KT5 C;  2NOJ B;  3ZP5 A;  1AWC A;  3BZK A;  1FT9 A;  4KIC A;  1X4P A;  2V4J C;  2IW5 A;  1F4K A;  3KZI C;  2JK3 A;  3TMO A;  1SC7 A;  1UHS A;  5J1U A;  2IGO A;  4L18 B;  1OR7 C;  3CCS I;  5F27 A;  2M7A A;  1MIJ A;  3SJM A;  4MEX F;  4EV0 A;  5BQT A;  1FNN A;  5BPI A;  3U2R A;  3MKW B;  3REO A;  2L5Q A;  1ZQ3 P;  1E3H A;  3QOP A;  3WG9 A;  4KIB A;  5FKO A;  3BR6 A;  5CVU A;  1QVU A;  1H0M A;  1GV5 A;  2FEZ A;  2W85 A;  4G6T B;  1LFU P;  3JTH A;  4CO8 A;  4IF4 A;  4Y7N J;  2PQ8 A;  3KFW X;  1FC3 A;  1B4A A;  2YX7 A;  3BQY A;  1B6A A;  1SD4 A;  3B02 A;  4OAY A;  1HOM A;  3OS1 A;  3M07 A;  5EZG A;  3I4N J;  2LY2 A;  3O8H A;  4UUT A;  1ZG1 A;  2DT7 B;  2OA4 A;  2OTJ I;  3CJQ B;  1KU3 A;  2HGC A;  5EZH A;  3K9T A;  3BR5 A;  4I09 A;  1J09 A;  2K9Q A;  3I3L A;  3A01 B;  1PVE A;  4KMU X;  3ZQG A;  1MBK A;  4MTE A;  2QQ9 A;  2BHZ A;  1ZLJ A;  3BOQ A;  1MH3 A;  3N05 A;  1IC8 A;  4C3I J;  1TW2 A;  2XIG A;  4LGW A;  3M9A A;  3MZH A;  4L0Y B;  3T1B A;  2L7F P;  2ZBK A;  3SZG A;  3OV8 A;  1FY7 A;  1DUX C;  1MMS A;  3HHG A;  5H20 A;  1T8I A;  1XCB A;  3FMR A;  3K4M A;  4L9V A;  4PK4 A;  2AHQ A;  3JRC A;  4FQG A;  1VQ6 I;  3BLY A;  3EDP A;  4LFU A;  4XQF A;  2LTP A;  5KAF C;  3KEO A;  4FIS A;  1U5T B;  1AU7 A;  2OQR A;  3MZY A;  2MC3 A;  3JRH A;  3MKY B;  4AYB N;  4A3I J;  2PI0 A;  1Y0N A;  4CCK A;  2NS0 A;  5J3L A;  1B9N A;  3S3M A;  2IS6 A;  4XID A;  2Z1D A;  5CQG A;  1EKE A;  3BZ6 A;  1IF1 A;  4CGZ A;  5IP6 A;  4EJT A;  3W6V A;  4ZYE A;  4S0H B;  4G12 A;  2YR2 A;  3D1N I;  2ZCW A;  5DCM B;  5BNG A;  4Z6Y A;  3CMY A;  3ZR8 X;  4BY7 J;  1LE8 B;  1O57 A;  3PSF A;  4OU0 A;  1BN5 A;  1H88 C;  4AWX B;  1YE9 A;  3I9V 2;  1IG7 A;  3EPZ A;  5TIS C;  4ESF A;  4IHS A;  2E34 A;  2VC1 A;  1D5Y A;  3SEQ A;  4HX4 A;  3GLX A;  2OCC H;  3S14 J;  2MAB A;  1TQM A;  2Z99 A;  4U7D A;  5TRD A;  3FHZ A;  2IGK A;  5FLM J;  4C3J J;  1OIS A;  4F7Z A;  4MHG A;  2Y48 A;  4PSX A;  1Q1V A;  2DJN A;  3T8T A;  3FK6 A;  3FHN A;  3CD6 I;  2FBH A;  3RZO J;  1ZTR A;  5FLV A;  5K5Q A;  3CME I;  3BDD A;  1T56 A;  3CCY A;  1MDM A;  3CC4 I;  4PJN A;  3GCM A;  4DBR A;  1HKS A;  1JHH A;  1JE8 A;  2R93 J;  2VQH A;  3HGY A;  3OOU A;  3F8C A;  2QGU A;  1WZ2 A;  2KRC A;  2W00 A;  2CU7 A;  3K2A A;  4BKX A;  1RUN A;  5D6F A;  1RC9 A;  2JA7 J;  1XMA A;  5E79 C;  3LOC A;  3DEW A;  5GAG J;  1FP1 D;  4G8X A;  3MFK A;  3F6V A;  3KYC B;  5BMZ A;  2QBY A;  3MAJ A;  2GXG A;  1RES A;  5ILU A;  4NQW B;  1VQO I;  3W6K B;  2DMU A;  2VN2 A;  2EK5 A;  3C2G A;  5LD2 C;  2Y0S A;  3M7G A;  2F4O B;  3BC8 A;  4C9Y A;  2DA3 A;  5B66 C;  2CQN A;  2HQR A;  3IP4 B;  1XN7 A;  4RDU A;  2M30 A;  3IKT A;  2P6T A;  1Z21 A;  2D1H A;  2K3P A;  3BTL A;  3HRM A;  2LY9 A;  3CDI A;  2CWE A;  1X2N A;  2AO9 A;  3DCF A;  2DN0 A;  4I76 A;  4XNF A;  5EG0 A;  2LDU A;  5M3M J;  4FX0 A;  4A3M J;  3KCC A;  4L0Z B;  2Y31 A;  3I0T A;  3OSF A;  1P92 A;  1YYV A;  1K6Y A;  3KIO A;  2XF5 A;  2ESH A;  1W5C C;  5DS9 A;  4HST A;  3SHF A;  2ZXH A;  4F3Q A;  2BXZ A;  1K78 A;  1K4S A;  2HXO A;  2NAZ A;  5FKK A;  2BOL A;  3WHC A;  2YPR A;  5EDN A;  2DFH A;  4A3J J;  2VKE A;  3V8L A;  2JVG A;  1HQC A;  2ME0 A;  2HTJ A;  3KP4 A;  2LRE A;  3CF5 F;  5D5V B;  1K6O A;  2WY7 Q;  5L3C A;  3F23 A;  3MQ0 A;  4XLE A;  2M45 A;  3D0S A;  2VLA A;  3CJT B;  1YFH A;  3ZCO A;  1Z0X A;  1QBJ A;  2QWW A;  1SFK A;  3V8J A;  1F1Z A;  3I71 A;  2MSY A;  1G2H A;  4HDV A;  3GTJ J;  3B6A A;  3JRA A;  1ORK A;  5JI6 A;  1R1T A;  3VEP A;  5LGN A;  4U7B A;  1Z05 A;  3IAS 2;  1PP8 F;  3JAM Z;  1LKX A;  3ASN H;  2OBP A;  3QPL A;  4YEL A;  4DYR A;  4C2T A;  2DA5 A;  1R4M B;  1WFX A;  3QPH A;  3G71 I;  2KQR A;  3K4N A;  4HPQ A;  2E7X A;  4DJA A;  4DYC A;  1SVM A;  2Y0M A;  4PJ0 C;  3WE2 A;  5FRN A;  2PMZ A;  2F5C A;  4MO7 A;  4OIN F;  4L5J A;  3BG7 A;  3P9I A;  2H27 A;  2ZO4 A;  1WKM A;  3C2B A;  3EUA A;  1EH8 A;  3FF5 A;  2Y69 H;  3GX4 X;  1TC3 C;  3HOV J;  4HLY A;  4YFN F;  4Q4Z F;  2QQA A;  2ZJP F;  3WGG A;  3MD2 A;  5FB2 A;  1VQ9 I;  2EB7 A;  3FIS A;  3LWF A;  1GV2 A;  5D4R A;  2H1K A;  4KMF A;  2B63 J;  2PJP A;  5K7F A;  4BQA A;  4M3B A;  5HDG A;  3KZY A;  4BE2 A;  2L01 A;  1W36 C;  2VJI A;  4LB6 B;  2HOE A;  1YG2 A;  2ZSH B;  3CDH A;  2VT3 A;  2E2I J;  2X1E A;  1VQ5 I;  3BPV A;  2P5L C;  3TO9 A;  2NVY J;  3HOW J;  1VFC A;  1R58 A;  2VKV A;  1V54 H;  5DD4 A;  2M9H A;  4A0Y A;  1I3A A;  3HUG B;  1R7J A;  4DZP A;  2DBB A;  4XKB A;  5C44 J;  1ON1 A;  1D8J A;  1YW7 A;  1KYW A;  3LQQ A;  2QZ8 A;  1ZRC A;  3HRT A;  4IEJ A;  4HNT A;  3C1D A;  4OOI A;  4JX6 A;  1SFE A;  1TQI A;  2HVS A;  3KEQ A;  2DOE A;  3F3X A;  1BI3 A;  1YRN A;  1GDT A;  3KYD B;  2CUZ A;  3COA C;  1ODD A;  1ZN2 A;  3ONQ A;  2NS8 A;  4RAZ A;  3IUO A;  4PJL A;  1GVD A;  2R7D A;  2FF4 A;  5F1R A;  4M6X A;  1U6G A;  3TL4 X;  3NWT A;  5DDG A;  3GTO J;  3RTR A;  1GXP A;  3GTM J;  4PGH A;  2XDV A;  2XV4 S;  4HF1 A;  1B72 B;  5DM6 F;  2K4B A;  2XB0 X;  1R23 A;  3TO6 A;  3CCE I;  4LLN A;  3S15 J;  1N75 A;  1YIO A;  2IS4 A;  4WX9 A;  1LDD A;  2W82 A;  4QLC U;  4RAY A;  4HEA 2;  3H0G J;  3RPQ A;  4NC6 A;  3GBG A;  1BR4 A;  4Y3O A;  2ZXW H;  4WF2 A;  1OYI A;  3HEF A;  2VKH A;  1L0O C;  3LST A;  1XGM A;  1KYZ A;  2VB6 A;  2L02 A;  5K5R A;  1VND A;  4LIT A;  4BHP A;  5J40 A;  4XRS A;  4M3D A;  4EVI A;  2RVC A;  4L9T A;  3WTS C;  1LFB A;  4RLQ A;  4A5N A;  5IT9 Z;  2L9S A;  3RQ4 A;  3PM1 A;  1SD7 A;  4XN3 A;  3GZN B;  4P5O A;  4AYB A;  3BTI A;  2IGM A;  4KN7 X;  4XON A;  2KIU A;  3R4K A;  2GXA A;  3G1O A;  2KIM A;  1R9T J;  3VYS B;  1ENH A;  2EFO A;  3L2R A;  4M3G A;  4NBQ A;  4BHB A;  3EUH C;  1V5F A;  2K40 A;  4RB3 C;  4CA0 A;  1R1V A;  5TGT A;  3OYL A;  1K78 B;  1P7J A;  2P7C B;  1QZE A;  4IL6 C;  4LD5 A;  3W3C A;  3JTG A;  2J5O A;  4B48 A;  1OCR H;  2MD5 A;  2OAZ A;  1R1U A;  4I98 B;  3H3V K;  4CH7 A;  5FFX A;  1XGS A;  2XF6 A;  4Y52 J;  3K1P A;  2R7U A;  3DBH B;  5FLX Z;  3SDG A;  5BS6 A;  4ZTJ A;  3IC7 A;  2DYS H;  2GZW A;  4XL9 A;  2Z33 A;  4U88 A;  1TWH J;  3F72 A;  2R7F A;  2EFW A;  4UUV A;  3F6O A;  2V1X A;  4NC8 A;  3HSR A;  2IA0 A;  2QKM B;  1WI9 A;  1WJF A;  2MH9 A;  3U1K A;  4ZH4 F;  1G59 A;  4A3C J;  2A05 A;  1IW7 F;  2FX0 A;  1FBU A;  4WXD A;  4CHU A;  2I5U A;  2JMW A;  3ZQ7 A;  4KJZ A;  4EEF G;  3OIQ A;  1JGS A;  4DNC A;  2IS1 A;  2L7M P;  2DU9 A;  3OS2 A;  3GTG J;  1KGS A;  3QPT A;  1ULY A;  3ECH A;  2NNY A;  1EH7 A;  1IO2 A;  3S2W A;  4NUB A;  5ILV A;  4E4H A;  1YS6 A;  2FBK A;  1NK3 P;  1LB2 A;  3HOS A;  3RKQ A;  2XPW A;  4BQQ A;  2Z3Y A;  4Q5S F;  1IN4 A;  3V4G A;  1MGT A;  3DV8 A;  1M1E B;  5E1Z B;  4II3 A;  2Y9Z A;  3KLN A;  3KX2 A;  1TL8 A;  4A93 J;  3D5L A;  4Z2Y A;  5D4S A;  1MMN A;  3OIO A;  3UKG A;  1IN6 A;  1OCO H;  4QPQ A;  2Z2S B;  3OY9 A;  2F4M B;  3OSG A;  2RNJ A;  1Z6T A;  2Z16 A;  4MNU A;  2QQB A;  1ZAO A;  1QPM A;  3MWM A;  2EZL A;  3GZ5 A;  3CLO A;  1J9I A;  2EIM H;  2E2J J;  3HTU A;  1JJ6 C;  3K69 A;  1VF9 A;  2COM A;  4UVB A;  1K61 A;  1KON A;  4YFX F;  3PSI A;  2EV6 A;  4F91 B;  3H5A A;  4HOB A;  4MQV A;  3A01 A;  1R71 A;  4PFO A;  1ERD A;  3HG9 A;  3I64 A;  1JI8 A;  2O03 A;  5JVG F;  3LA3 A;  4G9Y A;  3PO3 J;  2A68 F; 
#chains in the Genus database with same CATH homology
 2K7L A;  4UV9 A;  3MCZ A;  2STT A;  4ENM A;  2QEN A;  4M71 A;  2FNA A;  2V6C A;  1WWX A;  5AIP A;  1KU7 A;  2EFN A;  3E97 A;  4OIO F;  1TNS A;  2UWM A;  1KU9 A;  1JHF A;  3WTX C;  3TO7 A;  1U2W A;  4XLN F;  1T38 A;  3HIF A;  5FGM A;  4O6J A;  4RGS A;  5L3F A;  4GCV A;  1U8R A;  2G9W A;  5DCM A;  3WE3 A;  2DAO A;  3E5X A;  1D5V A;  2LNB A;  2P5V A;  5DCF A;  3WU1 B;  3ABU A;  3LQR A;  2PMU A;  5LLQ A;  1R36 A;  2EJR A;  2D1V A;  3IKV A;  5ICF A;  3E5Q A;  3W6J B;  1UFM A;  1J59 A;  2CYY A;  3SFZ A;  2EFQ A;  1FOK A;  2IT0 A;  3I53 A;  3VB2 A;  1OYW A;  2IVM A;  5AIQ A;  2DFI A;  1DPU A;  3Q5F A;  2DLL A;  2PEX A;  1CF7 B;  3G3Z A;  1Z6R A;  2FA5 A;  1FSH A;  1EH6 A;  4NQW A;  1TW3 A;  1ZGA A;  1G3T A;  4ON0 A;  1LVA A;  2VOP A;  3J80 Z;  1OR7 A;  2EWN A;  2DT5 A;  1J75 A;  2Q8K A;  1S7O A;  5IT9 K;  3RJP A;  1BIB A;  4YIF A;  1UST A;  2LSO A;  3BP8 A;  2BGC A;  1FZP B;  5DUK A;  3QAH A;  3L2C A;  2W25 A;  3H3Z A;  2ZKZ A;  4XLP F;  4BH9 A;  3N97 A;  3BWG A;  2X0L A;  3HSF A;  2XRN A;  3WTW C;  5FLX K;  2KRF A;  2KKO A;  2VC0 A;  3CTA A;  3DKW A;  3E6D A;  2GIV A;  5A2Q Z;  1D3Y A;  3M8E A;  3EET A;  4M73 A;  2FML A;  3ZMD A;  1IXS B;  1GHC A;  4ZYD A;  1Z7U A;  1DDN A;  2OQG A;  2CSO A;  3I5U A;  2R3S A;  2XAQ A;  1BI2 A;  4RB2 C;  3KP5 A;  4RS8 A;  1MJB A;  2OU2 A;  4KFC A;  3O6B B;  4G6D A;  3IWF A;  4WXH A;  4M72 A;  2LF7 A;  2E7W A;  3F8B A;  5LGT A;  5CVI A;  1I1S A;  5D5X B;  2QUF A;  3P9K A;  4IPA A;  5HLI A;  4HQE A;  3ISP A;  1IRG A;  2ZME B;  3ELK A;  5LEK A;  4IRI A;  4EJO A;  1X3U A;  5DEQ A;  1Y0U A;  2MH2 A;  1MZB A;  3C18 A;  4A6D A;  2NNN A;  3FM3 A;  3CO7 C;  1L3L A;  4EM0 B;  2XGX A;  3U1D A;  4G7O F;  3LAJ A;  2HEO A;  2XAF A;  3TOA A;  3HUG A;  2FBI A;  4LLL A;  1RZ4 A;  5HDN A;  4P9F A;  2O8X A;  5FO5 A;  2Q0O A;  3KP3 A;  3HOT A;  4UNO A;  1G3Y A;  2E1N A;  4P55 A;  3J81 Z;  2TDX A;  3FX3 A;  2UZK A;  5ILS A;  2EA4 A;  3FM5 A;  1P2F A;  3L09 A;  4BYY A;  2V79 A;  2VE9 A;  4AVP A;  2ETH A;  1IXC A;  4EMS A;  5ED4 A;  3VOD A;  3ZMV A;  1HXD A;  3ECO A;  4Y13 A;  2RN7 A;  4GYI A;  5LHI A;  2Z5U A;  1QQI A;  2KJC A;  1P6R A;  5L3G A;  3DQV C;  1W7P B;  1Z91 A;  2F5F A;  1O3S A;  1HKT A;  4ZZD A;  1JXS A;  2XUB A;  1D8K A;  3ZN0 A;  1UHW A;  4UHT A;  5D6E A;  3CUQ C;  4L9J A;  1G3W A;  4CYD A;  1MKM A;  2B0L A;  3I54 A;  5JHU A;  1GVJ A;  1TTY A;  3NEU A;  2D45 A;  1W4M A;  2A6H F;  3QRF F;  2M8E A;  3V8K A;  2IP2 A;  2P8T A;  2RGV A;  1FWZ A;  3J80 K;  1MD0 A;  1C0W A;  5FD5 A;  2KIF A;  4HZF A;  5DV5 A;  4G7H F;  5HS7 A;  1H9G A;  1HSJ A;  5ICC A;  1STZ A;  1W5S A;  2JZY A;  3NRV A;  4ETS A;  3KET A;  2ZFW A;  3KP7 A;  4IJA A;  4N9H A;  2F5D A;  3DXJ F;  4M74 A;  4HW0 A;  4ESB A;  1O7F A;  3QP5 A;  3BJA A;  3U9G A;  2MLG A;  1I1G A;  3FMS A;  1O3Q A;  3ABT A;  4FHT A;  1R5H A;  3GYH X;  3R6S A;  2NRA C;  1SMY F;  2O0Y A;  4IXA A;  2GA2 A;  1HST A;  2ESN A;  2OZU A;  2XKP A;  1QO0 D;  1NHA A;  1FP2 A;  2K02 A;  5HLG A;  4HF2 A;  3GEZ A;  4OMZ A;  1YQA A;  4KNY A;  1ON2 A;  3WTU C;  3O2P E;  3G73 A;  3RKW A;  4AIH A;  2LKP A;  4G7Z F;  1IRF A;  3O3K A;  1YW9 A;  4PGG A;  4I0A A;  5LHH A;  1FYK A;  1ONV A;  2IA1 A;  4MGR A;  2A69 F;  3WTV C;  4ZYH A;  3T0Y A;  2HKO A;  2H6B A;  4I7H A;  2YX4 A;  1R00 A;  5L3D A;  4RGU A;  5H6Q A;  3L7W A;  1IN5 A;  4U0V A;  5TJJ A;  4UXN A;  3KZZ A;  1WSU A;  2AXL A;  1A04 A;  2WTE A;  3HSE A;  1XCV A;  2XHK A;  3J81 K;  4LG0 B;  2FSW A;  1ZH5 A;  1OMI A;  2VOO A;  3LA2 A;  1LEA A;  3EUH A;  2WV0 A;  2K4J A;  1ZG5 A;  5D5W B;  2RV8 A;  5ERI A;  2JRT A;  1DP7 P;  4RGX A;  1OPC A;  1MJ9 A;  5ICG A;  3WTY C;  4KIF A;  2G7H A;  2A3S A;  1CF7 A;  4BHC A;  4L5I A;  3ZMU A;  4U0Y A;  2Q2E A;  4LB5 A;  1XSD A;  3ULQ B;  2F2E A;  2DQL A;  4I2O A;  3DF8 A;  1HKQ A;  2Y75 A;  4AD9 A;  3CO6 C;  2XVC A;  2XAJ A;  3WTZ A;  2JPC A;  2ISZ A;  4EGY A;  4S05 A;  4FX4 A;  2FRH A;  3E6B A;  3LFK A;  4FT8 A;  2LF8 A;  3N4M A;  3I59 B;  2BV6 A;  1RUO A;  2VBY A;  3PQK A;  4M6Y A;  3T5X A;  2L4A A;  5IT3 A;  3WOD F;  1I27 A;  1S29 A;  2DK8 A;  2FOK A;  4A5M A;  2QYO A;  3QP6 A;  5HLH A;  4IHT A;  2GAU A;  1Z9C A;  1W7P D;  1UHM A;  4GO1 A;  3I58 A;  5FFZ A;  3JAM K;  3TOB A;  1F5T A;  3WGH A;  2CG4 A;  4D0P A;  4HDU A;  2DPD A;  1SD6 A;  3RKX A;  4PZJ A;  5DUI A;  4KUM A;  3HHH A;  1EV7 A;  3NQO A;  4ESJ A;  1YLF A;  3K0L A;  4IRG A;  5LRS A;  5E8G A;  1UCR A;  4O3M A;  2HKX A;  2HQN A;  2GXB A;  4HX7 A;  3TKY A;  1R22 A;  1TNT A;  2VOD A;  4OIQ F;  4M9S A;  4JBA A;  5BOX A;  1BC8 C;  1PUE E;  4B8X A;  2ZME A;  2VE8 A;  3RDI A;  3IRQ A;  4CIC A;  2HZT A;  1BM9 A;  1T2K A;  2VBW A;  2A5Y B;  4KN4 X;  4WXC A;  1S7A A;  1V4R A;  4R8H A;  4XSX F;  4R1H A;  1ZHF A;  4I02 A;  4EJW A;  3K1M A;  3GFJ A;  3AAF A;  2HWV A;  2H09 A;  1BBY A;  3SZP A;  3BRO A;  1SFU A;  2HYG D;  3R60 A;  4M9X A;  1ZRD A;  3KP2 A;  1T0F A;  5CLS A;  3RYR A;  4PCQ A;  4JQF A;  2W57 A;  1KU2 A;  6PAX A;  1U5T C;  1KQ8 A;  1OKR A;  1G6N A;  2P7V B;  1G4D A;  1T98 A;  4UV8 A;  3V7R A;  1U3E M;  4OIR F;  4CDG A;  1V3F A;  3MEX A;  5LRR A;  2EA2 A;  3CUO A;  3C7J A;  1HBX G;  2PG4 A;  4ZYG A;  1XB4 A;  4N0B A;  4EM2 A;  1RI7 A;  3V7S A;  1B1B A;  4ENN A;  1YO5 C;  1RNL A;  1W7P A;  2XAS A;  1TBX A;  3ZMS A;  1IUY A;  2X4H A;  1F9N A;  1XSX A;  5K5O A;  2YSR A;  2CFX A;  2A6E F;  3JW4 A;  2DW4 A;  1R5G A;  5LEJ A;  4MEY F;  3SZT A;  2BBY A;  3ML6 A;  3FXR A;  2FQ3 A;  4MQ9 F;  5DYM A;  5E20 A;  2BEO A;  3GZ6 A;  2O61 A;  2A61 A;  5F64 A;  2H6C A;  1I6X A;  2ACJ A;  4GXO A;  1FYL A;  3CJN A;  1OYY A;  2FNP A;  4L9N A;  3RYP A;  3GFM A;  1LEB A;  3GO5 A;  3HYI A;  1YS7 A;  4G94 A;  2W24 A;  4MTD A;  3KLO A;  2CW0 F;  2JTV A;  4GGG A;  3TDZ C;  3GXO A;  5KK1 A;  3IRR A;  2UXN A;  3QU6 A;  5HDK A;  2RQP A;  3L9F A;  2HFH A;  2ZNZ A;  1S3J A;  3L00 A;  4EM1 A;  1WRJ A;  4OIP F;  4M9Z A;  1XDS A;  3BY6 A;  3PFI A;  3FZV A;  1YW8 A;  2D2W A;  1J5Y A;  4HLX A;  2M5W A;  2O6G E;  5HS8 A;  4A6E A;  4A0X A;  1QNT A;  2XAH A;  3LAP A;  2MLK A;  4RB1 A;  3RIR A;  3HTS B;  3E6C C;  1CGP A;  2HTS A;  3R61 A;  1SFX A;  4K2E A;  1KA8 A;  1FBS A;  1E2X A;  3J7A O;  4HA8 A;  4Y15 A;  2QM3 A;  4HX8 A;  4HBL A;  3M8F A;  3PQJ A;  3GFL A;  1IAW A;  5LBQ A;  3R0A A;  1G3S A;  4LK1 F;  2EV0 A;  3M1E A;  3IL2 A;  4HF0 A;  3E5U A;  2VT2 A;  1HW5 A;  3K2Z A;  1ZRF A;  1TQP A;  1XD7 A;  1BC7 C;  2DK5 A;  4WCG A;  4HAM A;  1T39 A;  2FXA A;  2ZXJ A;  3FWE A;  2L4M A;  3K1N A;  3F8M A;  4Y17 A;  4LG0 A;  4Q47 A;  1MJA A;  2OD5 A;  3Q9V A;  3CUQ A;  4OMY A;  2EFP A;  1SD5 A;  1P4X A;  3F8N A;  2XAG A;  4AIK A;  1XGN A;  3ZPL A;  1IN7 A;  4EJU A;  2NYX A;  3VOE A;  2L3D A;  4KIG A;  4I0B A;  1XSV A;  5HS9 A;  2XKO A;  2ZJ2 A;  2P6S A;  4EGZ A;  1O7L A;  4BXU A;  1XGO A;  2VXZ A;  1QZY A;  1J0R A;  3BJ6 A;  1QGP A;  2H94 A;  4CZZ A;  1E17 A;  3GWZ A;  5L3B A;  5AON A;  2DI3 A;  3FMQ A;  4DQ2 A;  1AOY A;  4P96 A;  1SMT A;  3V7C A;  3BJO A;  3E6M A;  1O3T A;  4ZZL A;  1T6S A;  4YII A;  2C6Y A;  3BPX A;  1BI0 A;  4XRF A;  4NHJ A;  4S04 A;  5E1X A;  5J6X A;  3I59 A;  2J5P A;  5J8C A;  4JK1 X;  2JPB A;  1UB9 A;  5KVR A;  4YFK F;  2P5K A;  3DPT A;  4YG2 F;  2RC4 A;  1HW1 A;  4LMY A;  3ERE D;  3IHU A;  3I4P A;  1S8N A;  1BIA A;  4UVA A;  2JSC A;  4BNC A;  2HYF A;  3H92 A;  2V9V A;  3ZN1 A;  1IXR C;  2EV5 A;  3DEU A;  3GUD A;  2VON A;  5A2Q K;  3ROU A;  1ZAR A;  1J7K A;  1GXQ A;  4EQQ A;  5K1Y A;  4LJZ F;  1H9T A;  1LJ9 A;  4EJV A;  1K7A A;  2GWR A;  4UVC A;  2ADU A;  3FXU A;  3JSO A;  3WGI A;  5E17 F;  4LLG F;  3SQN A;  4WK8 F;  4HQM A;  2XRO A;  3VFZ A;  3DP7 A;  1ZRE A;  3R0J A;  5CJ9 A;  3F21 A;  1LDK B;  2CGP A;  2FU4 A;  3EYI A;  5J8F A;  3WU0 A;  4O5V A;  3P7N A;  5D8K B;  1IN8 A;  4P9U A;  1USS A;  2JT1 A;  2K27 A;  1IZ1 A;  2WC2 A;  3P9C A;  4RGR A;  3OOP A;  1XMK A;  1MDM B;  2ELH A;  3CUQ B;  1LNW A;  1LQ1 A;  4TV7 A;  4Q48 A;  4E70 A;  5LHG A;  3RPU A;  4GYG A;  2VBZ A;  2QBY B;  2BE5 F;  3SXY A;  3ZMT A;  2RKH A;  2VBX A;  2HDC A;  5D5U B;  2L54 A;  3RI4 A;  2UXX A;  3KE2 A;  1B9M A;  4U0W A;  1S6L A;  2DPU A;  3C3W A;  3TGN A;  4N9I A;  4IRH A;  1BI1 A;  5LGU A;  3WTT C;  3HRS A;  3GF2 A;  4XSZ F;  4G6Q A;  2M87 A;  2YU3 A;  2O3F A;  5L3E A;  5EEH A;  5BPD A;  5D8L B;  5CYV A;  1BOA A;  3RKY A;  2MA3 A;  2IRF G;  3H3U A;  3DPL C;  3F8F A;  1XDU A;  4KA4 A;  2PFB A;  2V1D A;  2ZNY A;  1U78 A;  3T8R A;  2WWY A;  3B73 A;  1ZLK A;  3ZMZ A;  2DQR A;  3GFI A;  3F22 A;  2FMY A;  5CVJ A;  1I5Z A;  4KDP A;  4A0Z A;  3LA7 A;  2FE3 A;  1FYM A;  1Q1H A;  3E3V A;  4HYE A;  4WWC A;  5CVR A;  2G7U A;  2MBF A;  3TQN A;  1KQ0 A;  1TLH B;  4A12 A;  4H0E A;  5DD8 A;  2GA1 A;  1FBQ A;  1ZYR F;  2QLZ A;  1FLI A;  1P4W A;  4BAY A;  4ENJ A;  2OZ6 A;  2CO5 A;  1ZG3 A;  5ICE A;  5EEG A;  1FPQ A;  4KYW A;  3HRU A;  4CXF A;  5HOO A;  5E18 F;  1VTN C;  2BYV E;  4NB5 A;  1O3R A;  3GW2 A;  2F5E A;  2HR3 A;  4LK0 F;  4B09 A;  1PP7 U;  2A07 F;  2QVO A;  1U5T A;  1WQ2 A;  2V1U A;  2AS5 F;  4A2U A;  1DPR A;  3FXQ A;  2ISY A;  5H6R A;  1LDJ A;  1ZGJ A;  1PDN C;  2GQQ A;  1P4A A;  4QWQ A;  1W5T A;  2PLY A;  5HVQ C;  3JSP A;  2IJL A;  3GVA A;  3DFG A;  1FSE A;  2KJB A;  1QZZ A;  5F6F A;  1KQ9 A;  2IPQ X;  2Z9O A;  4AIJ A;  3KP6 A;  5JFR A;  2CQK A;  1REP C;  2PBI A;  2DO7 A;  1RIO H;  5E1W A;  1Z1D A;  4RB0 A;  3EQL F;  2DTR A;  4IVN A;  1SAX A;  4XBF A;  4ASN A;  5FD6 A;  2M1B A;  3TDU C;  5E8I A;  3Q9S A;  2IA2 A;  4HV5 A;  1HW2 A;  1FX7 A;  5JR3 A;  2W84 A;  4R79 A;  1BJA A;  2HS5 A;  2STW A;  4HV6 A;  2PMH A;  2PN6 A;  1B59 A;  5CVV A;  1K79 A;  4PDK A;  5JVT A;  2E1C A;  4I01 A;  1YTY A;  3EYY A;  2P4W A;  4ENK A;  1J2X A;  2RDP A;  3IWZ A;  2K86 A;  3QU3 A;  4KT5 C;  3ZP5 A;  1AWC A;  1FT9 A;  4KIC A;  2IW5 A;  1F4K A;  4L18 B;  4MEX F;  5BQT A;  4EV0 A;  1FNN A;  5BPI A;  3U2R A;  3REO A;  3QOP A;  3WG9 A;  4KIB A;  5CVU A;  1H0M A;  2FEZ A;  2W85 A;  3JTH A;  4CO8 A;  4IF4 A;  2PQ8 A;  3KFW X;  1FC3 A;  1B4A A;  2YX7 A;  1B6A A;  1SD4 A;  3B02 A;  1ZG1 A;  2OA4 A;  1KU3 A;  2HGC A;  3K9T A;  4I09 A;  4KMU X;  4MTE A;  2QQ9 A;  1ZLJ A;  3BOQ A;  1TW2 A;  2XIG A;  4LGW A;  3M9A A;  3MZH A;  4L0Y B;  3T1B A;  2ZBK A;  3OV8 A;  1FY7 A;  1DUX C;  2A68 F;  5H20 A;  1XCB A;  3FMR A;  4L9V A;  3EDP A;  4LFU A;  3KEO A;  1U5T B;  2OQR A;  3MZY A;  2MC3 A;  2PI0 A;  2NS0 A;  1B9N A;  4CGZ A;  3BZ6 A;  1IF1 A;  4EJT A;  4ZYE A;  2YR2 A;  2ZCW A;  5DCM B;  1O57 A;  4OU0 A;  1BN5 A;  4AWX B;  4IHS A;  4ESF A;  2VC1 A;  4HX4 A;  3GLX A;  1TQM A;  2Z99 A;  4U7D A;  5TRD A;  3FHZ A;  4F7Z A;  4MHG A;  2Y48 A;  3T8T A;  2FBH A;  5K5Q A;  3BDD A;  1MDM A;  1HKS A;  1JHH A;  1JE8 A;  3F8C A;  1RUN A;  5D6F A;  1XMA A;  1FP1 D;  4G8X A;  3MFK A;  3F6V A;  5BMZ A;  2QBY A;  3MAJ A;  2GXG A;  5ILU A;  3W6K B;  2VN2 A;  2EK5 A;  3M7G A;  2HQR A;  1XN7 A;  3IKT A;  2M30 A;  2P6T A;  2D1H A;  3HRM A;  2CWE A;  2LDU A;  4FX0 A;  3KCC A;  4L0Z B;  3I0T A;  1P92 A;  1YYV A;  2ESH A;  3SHF A;  1K78 A;  2NAZ A;  2YPR A;  3V8L A;  1HQC A;  3KP4 A;  2HTJ A;  5D5V B;  1K6O A;  5L3C A;  3F23 A;  3MQ0 A;  2M45 A;  3D0S A;  1YFH A;  1QBJ A;  2QWW A;  3V8J A;  1F1Z A;  3I71 A;  4HDV A;  5JI6 A;  1R1T A;  3VEP A;  5LGN A;  4U7B A;  1Z05 A;  1PP8 F;  3JAM Z;  2OBP A;  3QPH A;  2E7X A;  2Y0M A;  3WE2 A;  2F5C A;  4OIN F;  4L5J A;  3P9I A;  2H27 A;  2ZO4 A;  1WKM A;  1EH8 A;  3FF5 A;  3GX4 X;  4HLY A;  4YFN F;  4Q4Z F;  2QQA A;  3WGG A;  5FB2 A;  2EB7 A;  3LWF A;  2PJP A;  5D4R A;  4KMF A;  4BQA A;  5HDG A;  3KZY A;  2L01 A;  4LB6 B;  2HOE A;  1YG2 A;  3CDH A;  2VT3 A;  3BPV A;  2P5L C;  3TO9 A;  1R58 A;  5DD4 A;  4A0Y A;  1R7J A;  2DBB A;  1ON1 A;  1D8J A;  1YW7 A;  1KYW A;  3LQQ A;  2QZ8 A;  1ZRC A;  3HRT A;  3C1D A;  4OOI A;  1SFE A;  1TQI A;  3KEQ A;  3F3X A;  1BI3 A;  3COA C;  1ODD A;  1ZN2 A;  4RAZ A;  2R7D A;  2FF4 A;  5F1R A;  4M6X A;  1U6G A;  5DDG A;  3RTR A;  1GXP A;  4PGH A;  2XV4 S;  4HF1 A;  2K4B A;  1R23 A;  3TO6 A;  4LLN A;  1YIO A;  4WX9 A;  1LDD A;  4QLC U;  4RAY A;  3RPQ A;  4WF2 A;  1OYI A;  1L0O C;  3LST A;  1XGM A;  1KYZ A;  2L02 A;  5K5R A;  4BHP A;  4EVI A;  2RVC A;  4L9T A;  3WTS C;  4A5N A;  5IT9 Z;  1SD7 A;  4P5O A;  4KN7 X;  2KIU A;  3R4K A;  2KIM A;  2EFO A;  4BHB A;  4RB3 C;  1R1V A;  1K78 B;  2P7C B;  4LD5 A;  3JTG A;  2J5O A;  2MD5 A;  2OAZ A;  1R1U A;  4I98 B;  5FFX A;  1XGS A;  3K1P A;  5FLX Z;  5BS6 A;  3IC7 A;  2GZW A;  2Z33 A;  4U88 A;  3F72 A;  2R7F A;  2EFW A;  4UUV A;  3F6O A;  2V1X A;  3HSR A;  2IA0 A;  1WI9 A;  2MH9 A;  4ZH4 F;  1IW7 F;  4WXD A;  1FBU A;  4CHU A;  3ZQ7 A;  1JGS A;  4DNC A;  2DU9 A;  1KGS A;  3QPT A;  1ULY A;  3ECH A;  2NNY A;  1EH7 A;  3S2W A;  5ILV A;  1YS6 A;  2FBK A;  1LB2 A;  3HOS A;  2Z3Y A;  4Q5S F;  1IN4 A;  3V4G A;  1MGT A;  3DV8 A;  5E1Z B;  3KLN A;  3D5L A;  4Z2Y A;  5D4S A;  1IN6 A;  2RNJ A;  1Z6T A;  4MNU A;  2QQB A;  1ZAO A;  1QPM A;  3MWM A;  3GZ5 A;  3CLO A;  1J9I A;  3HTU A;  3K69 A;  2COM A;  4UVB A;  4YFX F;  2EV6 A;  4HOB A;  4MQV A;  3I64 A;  2O03 A;  3LA3 A;  4G9Y A;  3HHG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...