3WTTC

Crystal structure of the complex comprised of phosphorylated ets1, runx1, cbfbeta, and the tcralpha gene enhancer dna
Total Genus 40
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
40
sequence length
118
structure length
118
Chain Sequence
PVIPAAALAGYTGSGPIQLWQFLLELLTDKSCQSFISWTGDGWEFKLSDPDEVARRWGKRKNKPKMNYEKLSRGLRYYYDKNIIHKTAGKRYVYRFVCDLQSLLGYTPEELHAMLDVK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title A novel allosteric mechanism on protein-DNA interactions underlying the phosphorylation-dependent regulation of Ets1 target gene expressions
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription/dna
molecule keywords Runt-related transcription factor 1
total genus 40
structure length 118
sequence length 118
chains with identical sequence H
ec nomenclature
pdb deposition date 2014-04-21

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
C PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3wttC00
1XN7A 1PP7U 3V7RA 5FLXZ 4A12A 4M9ZA 1TLHB 4NB5A 2R3SA 4M6XA 3P9KA 1TW3A 3ISPA 2VOOA 4EMSA 3FHZA 4EV0A 2DT5A 3L9FA 1MZBA 4OIOF 2EB7A 2BYVE 1GXPA 2DFIA 2FNPA 1R00A 4BYYA 3OV8A 3COAC 1FBUA 3CO7C 2Q8KA 3KZYA 2G7UA 2DU9A 4MQVA 2XROA 4IVNA 4RB2C 5BPIA 3BROA 1S29A 5A2QZ 4CICA 1HKTA 1BIBA 3RTRA 4EM2A 1JHHA 2X4HA 1MD0A 4UVBA 1DUXC 1XSVA 2Q0OA 3FXUA 2IJLA 2P5LC 1LEBA 1YW9A 4I0AA 2XVCA 5E18F 2FBHA 4I2OA 3NQOA 2GWRA 1AOYA 2ACJA 2CQKA 3M8EA 3F8MA 4AWXB 2NYXA 2VBXA 1YYVA 1YW7A 2Y0MA 3JSPA 4ENKA 5HS7A 1IRGA 4A6EA 4LB5A 1X3UA 4I01A 4RGUA 3GFLA 3CTAA 2VONA 1O3SA 1WKMA 1ZG3A 4OINF 4BHCA 3KLOA 2XIGA 5HS9A 1DDNA 1EV7A 1OMIA 1J75A 4LMYA 1TTYA 3L09A 4HX4A 3KETA 4XSXF 3CLOA 2STWA 3JTGA 2W84A 3NRVA 4PZJA 1XMAA 4ESFA 5D5VB 2MA3A 3V8JA 3RIRA 4E70A 4JK1X 2HQRA 2OBPA 4M74A 2UXXA 3P9CA 2EFOA 4XSZF 4HF2A 2GQQA 2VT3A 5HS8A 3S2WA 2P7CB 2UWMA 2CGPA 3NEUA 1BM9A 2DW4A 2YU3A 3LWFA 2OD5A 3ERED 2DPDA 2Y48A 4IHSA 2D1HA 1HSTA 3KE2A 4GO1A 1WWXA 1U6GA 1XGSA 2Z5UA 4KYWA 4LG0A 2BGCA 3R4KA 1ZLJA 4GGGA 3LA2A 2VBWA 2O3FA 3KP5A 5LRSA 4RB0A 3QP6A 2DQLA 2BBYA 4AIJA 4L5IA 4HA8A 2RKHA 2FBIA 3CUOA 4LLGF 3RPUA 3FMRA 1Z1DA 2GZWA 1PUEE 3QU6A 4GCVA 2V1UA 2PFBA 1FY7A 2STTA 2CO5A 4R79A 4MHGA 3M1EA 4HF1A 2FE3A 4HZFA 2KIUA 1UHMA 5FD6A 1R5HA 3MEXA 4KT5C 1MDMA 4OOIA 2HOEA 3V4GA 3F3XA 1YS7A 5AONA 1ZH5A 1YIOA 2Q2EA 4M9SA 3REOA 1O57A 4UNOA 5HLHA 1J0RA 4NHJA 1UHWA 1KU3A 2ETHA 1BI2A 1ZYRF 3E5XA 2EFWA 4IF4A 2EV0A 2HWVA 5TRDA 1JE8A 1SMYF 3GZ6A 2O0YA 4HQEA 3DKWA 1P4WA 1MJ9A 3PFIA 2GA2A 3T8RA 2OQGA 1IF1A 2AS5F 1QBJA 4IRIA 2E7WA 4G6DA 1BI3A 3TO6A 4L9JA 2QQAA 3MZYA 3O2PE 2XUBA 2VT2A 5FB2A 5CJ9A 4I02A 3WE2A 3D0SA 3ZMTA 2RQPA 3BPXA 3HRUA 3O3KA 4N9HA 3K2ZA 5D8LB 2J5OA 2W25A 3ML6A 5HDKA 3R60A 5JFRA 2LF7A 4HOBA 4IRHA 3WTSC 4ZH4F 2O61A 5IT3A 2RC4A 4LFUA 4FX4A 1BI1A 4B09A 3PQKA 3KEOA 4QWQA 4M72A 1R36A 4ENNA 4O6JA 5FFZA 3MWMA 3I54A 4B8XA 3JAMZ 3M8FA 1USSA 2IW5A 1REPC 4MNUA 2M45A 1E17A 2YPRA 1UFMA 3WU1B 1L0OC 3FZVA 1V4RA 4L0ZB 2IA0A 5H6QA 3ZMZA 2K7LA 1FP2A 2RN7A 3F8FA 2Z9OA 2F5CA 4NQWA 2M30A 4P96A 2HTSA 1T6SA 2HKOA 2RVCA 5F1RA 1W4MA 1QZYA 3VFZA 1A04A 3ZMUA 6PAXA 1ZARA 3T0YA 4HF0A 5E1XA 1XB4A 2JPBA 3L7WA 3ULQB 1BIAA 1F9NA 3I0TA 2ZKZA 4HAMA 1I6XA 1DPUA 4LB6B 4PGHA 4RB3C 2HYGD 3IL2A 2JZYA 1YO5C 3WTXC 1U2WA 5LEKA 1KYWA 1TBXA 4ENJA 2EJRA 5CVJA 3BWGA 3IHUA 3GFMA 1FP1D 5DD8A 2GA1A 5K5QA 2H27A 2A07F 1YS6A 2LDUA 4BHPA 3JAMK 4A5NA 5LLQA 3D5LA 3KZZA 4UVCA 3L00A 2FXAA 2QVOA 2BV6A 2IA2A 2L4AA 1FWZA 3TDZC 4WXDA 3ZMSA 5D5XB 3ABTA 2MD5A 4WCGA 3IKVA 5ERIA 3HSFA 2JRTA 4G9YA 3HOSA 5JVTA 4IXAA 5ILUA 2O8XA 3IC7A 5ICCA 5TJJA 1XD7A 4S04A 3ABUA 5LBQA 3GUDA 3IWFA 5DCMB 3ZP5A 2L3DA 2NRAC 2ZCWA 3JTHA 1BBYA 2V79A 1HQCA 1W5SA 3I59B 2IT0A 4LLNA 1FYMA 1OKRA 1LJ9A 4EJWA 2ZMEA 3JW4A 3WTZA 2XHKA 2OA4A 3R0JA 4RGRA 3IKTA 2HTJA 3BJOA 1XGMA 1CF7A 5DDGA 2H94A 3GWZA 2XAFA 1SD5A 2P5VA 5KVRA 4S05A 4G7ZF 2F2EA 2ADUA 3RDIA 3EUHA 1FC3A 4PGGA 4P9FA 1ONVA 4RS8A 3LA7A 4BHBA 3J80K 2K4JA 4IPAA 4BH9A 1XGNA 3DPLC 4LK1F 1G3SA 2PJPA 5CVVA 1FYKA 2R7FA 1AWCA 4RAZA 3N97A 1T2KA 3H3ZA 1QNTA 2AXLA 1T98A 2ZO4A 5K5RA 1H9TA 4R8HA 3RKWA 1OYWA 4U7DA 3CJNA 2RDPA 1BOAA 4L9TA 1FNNA 2F5FA 2VC0A 2K4BA 4ZYEA 5AIQA 3WGHA 2QLZA 1KU7A 1VTNC 1K7AA 2HR3A 5H20A 2Z33A 4EQQA 3RI4A 4EGYA 1P4XA 3GLXA 5FGMA 2EWNA 5F64A 2P5KA 2A5YB 1CF7B 1KGSA 1SFEA 4UHTA 4HYEA 5D8KB 1P4AA 2DPUA 1E2XA 5L3DA 1HW2A 4CZZA 2XKOA 1KQ0A 4N9IA 2EFNA 3V7CA 1B4AA 2PMUA 3Q9SA 3HSEA 1B9MA 1PP8F 1UCRA 3BJAA 3FM5A 2HDCA 2V6CA 1IXSB 2L4MA 1HBXG 3KP4A 3I71A 4EJTA 4I09A 2JSCA 2NNNA 2EV6A 3I4PA 2YX7A 4PCQA 3W6JB 3GEZA 5CYVA 3T5XA 2OQRA 1ON2A 4MQ9F 2KJCA 4DNCA 4CHUA 4UXNA 1JGSA 3HRSA 4HX8A 1FSEA 2XAGA 4YFXF 1MGTA 4EVIA 1BC7C 1O3TA 3TOBA 2FNAA 1BI0A 4U0VA 3HOTA 3IRRA 1BN5A 3PQJA 2ISZA 2FA5A 1OYYA 1R1VA 2A6EF 1XSXA 5F6FA 4L5JA 3WTWC 3G3ZA 1U5TC 3HYIA 4XBFA 1ZRFA 2M5WA 1RUOA 2PQ8A 2A61A 2WTEA 4HV6A 2DAOA 3RYPA 4RGSA 2QQBA 3WU0A 3LFKA 3CUQB 1BJAA 4Y13A 4HV5A 4OIPF 2PMHA 1IUYA 4A0YA 2ZXJA 4AIKA 1RI7A 2OZ6A 3F22A 1FPQA 2QENA 2GXGA 3BOQA 4IJAA 3KEQA 3HTSB 1KQ8A 5A2QK 4L9VA 3KP7A 4BXUA 4G94A 2F5DA 4ZYGA 4JQFA 1Z6TA 3KLNA 2MH9A 3ELKA 3HIFA 3WTVC 3E6BA 3SQNA 3EYYA 3TQNA 3M7GA 1LDJA 1TNSA 4XRFA 3MZHA 4IHTA 2HYFA 5DCFA 3ROUA 3LSTA 4ESBA 2VBZA 5BOXA 3QPTA 3G73A 1YG2A 5IT9K 2E7XA 3FWEA 1D8JA 2VE9A 1RNLA 2Z3YA 4KMUX 1Z91A 1FX7A 3RPQA 1FT9A 1QO0D 3E6DA 4KDPA 1HW5A 2LNBA 5K1YA 3MQ0A 3K9TA 3P9IA 5L3CA 1JXSA 4M9XA 4MTEA 5LEJA 1O3QA 2ZJ2A 1WRJA 2YR2A 1J59A 3LQRA 4MTDA 1RUNA 2IA1A 1IZ1A 1GHCA 1T38A 1Z05A 2E1CA 1B9NA 5E1ZB 5D4SA 2LSOA 1HSJA 4KFCA 4KN7X 3E3VA 4BAYA 3DP7A 2B0LA 2UZKA 2ESNA 2PI0A 1MDMB 2FEZA 3OOPA 4JBAA 1MJBA 3F72A 1KU2A 2O6GE 2ZMEB 2BEOA 2W24A 1MKMA 3I59A 4CGZA 2KIFA 2IP2A 1HW1A 1ODDA 3K1NA 4WK8F 4ZZLA 3K1MA 3RKYA 1SD7A 1WQ2A 4WXCA 3Q5FA 4ASNA 1QZZA 3KP6A 5ILVA 4G8XA 2K02A 3SZTA 3FM3A 1FBSA 5HLGA 2K27A 2VC1A 5LHGA 3GZ5A 4EGZA 2FMYA 2XASA 5JHUA 3WTTC 4FX0A 1W5TA 1F5TA 4YFNF 3MFKA 3E6MA 1LNWA 3TDUC 2DLLA 3J81Z 2EFPA 3F8NA 4AD9A 3H92A 1DPRA 3B73A 1T0FA 1L3LA 3MAJA 3U1DA 4A2UA 3GXOA 1ZLKA 3HUGA 5HDGA 5BS6A 4PDKA 1IN7A 4FHTA 5HVQC 3SHFA 2CSOA 4GXOA 5BMZA 3GFIA 1ZRDA 2DK8A 3K0LA 4A0ZA 3V7SA 5DD4A 3V8LA 4OU0A 2D45A 3QRFF 2J5PA 4ENMA 3GX4X 3E5UA 2YX4A 2CG4A 3HTUA 3WE3A 2DBBA 1Z6RA 4M73A 3VODA 1U3EM 5H6RA 2KIMA 1G4DA 3W6KB 2ISYA 2EK5A 4Q47A 3ZPLA 4LG0B 4OIRF 3JSOA 3B02A 3BPVA 1F1ZA 2HS5A 3BZ6A 2V1DA 2A68F 1FBQA 2XRNA 4EJOA 3GFJA 4R1HA 2NAZA 3R61A 4G7OF 3MCZA 5HLIA 1O3RA 4RAYA 4P9UA 5CVRA 4KIBA 5EEHA 4L0YB 1FZPB 3VEPA 4DQ2A 2HQNA 3DF8A 1XDSA 1G3WA 2CWEA 4ZYDA 2WC2A 1I1SA 1YQAA 2GXBA 5D5UB 4EM0B 1FOKA 5DEQA 3KCCA 2XAQA 4UVAA 4UUVA 5CLSA 5CVIA 1IN8A 1TW2A 1J7KA 2RNJA 4Q5SF 3WGGA 2CYYA 3DV8A 1K79A 4QLCU 1IW7F 2G9WA 4EJUA 4OMZA 5ILSA 2L01A 3I58A 2FRHA 5HDNA 2O03A 4UV8A 3GW2A 5LHIA 1YLFA 3KP3A 1KA8A 2UXNA 3R6SA 5ICGA 4P55A 3DPTA 1R5GA 3FX3A 2DK5A 4HDVA 2OU2A 3BP8A 4HLXA 4HX7A 1LEAA 2K86A 4EJVA 1B6AA 1SFXA 1OPCA 5E1WA 2IPQX 4M71A 1J9IA 1USTA 3C1DA 4IRGA 2WWYA 2A6HF 2RGVA 1GXQA 2FBKA 2DQRA 2PN6A 2EV5A 3EETA 1D5VA 3WTUC 1O7LA 2TDXA 5E8IA 1QPMA 3HRTA 1EH6A 1V3FA 3FF5A 2V9VA 4CYDA 1SAXA 3GO5A 2D1VA 4RGXA 1WSUA 4BNCA 5J8FA 5BPDA 3ZMVA 3FXRA 5FFXA 1S3JA 2COMA 5JI6A 2JPCA 4TV7A 2H6BA 1IRFA 1LVAA 1LQ1A 1IN4A 4KMFA 5D6EA 4YFKF 3AAFA 2VXZA 2ESHA 5ICEA 1DP7P 5L3EA 2QUFA 1C0WA 2PLYA 3F6OA 5IT9Z 3U2RA 1O7FA 2QQ9A 2XKPA 4MGRA 1D8KA 4A5MA 3DEUA 4Y17A 2M1BA 4L18B 3ZN0A 3SFZA 5FLXK 1TQMA 4ZYHA 2QBYA 2KKOA 5D6FA 4KA4A 1R22A 4KN4X 3VOEA 4WX9A 1R1UA 1XGOA 3FXQA 1SFUA 5LGTA 1ZG1A 5E8GA 4I98B 4HBLA 3K69A 2MC3A 4Q48A 2RV8A 3RYRA 3Q9VA 5K5OA 1H0MA 3WG9A 1ZN2A 1U8RA 4U88A 5EEGA 1R1TA 1RIOH 2VN2A 3CDHA 2IRFG 3CO6C 5LHHA 3LA3A 1W7PD 1IXRC 3SZPA 3I5UA 4U7BA 2JTVA 1I27A 2GIVA 4K2EA 1IXCA 3T1BA 1KYZA 5E20A 1UB9A 2MLKA 1W7PB 1IAWA 2R7DA 2H09A 1OYIA 3EDPA 3ECOA 4KIFA 3L2CA 3EQLF 4GYIA 1Q1HA 3IWZA 3F8CA 2QYOA 4KICA 4OIQF 3C7JA 1SD6A 1Z7UA 5FO5A 4AIHA 3WGIA 3C18A 2ELHA 2NS0A 2L54A 4Z2YA 3J7AO 1ZGAA 2QWWA 2EFQA 1ZG5A 1STZA 3V8KA 1JHFA 4XLNF 2W85A 4RB1A 1H9GA 2BE5F 3F6VA 3TO9A 3SXYA 1FLIA 5LGNA 3ZMDA 3QU3A 3N4MA 2MLGA 2P8TA 5DYMA 1F4KA 2MBFA 1S8NA 3J81K 3FMQA 2ZBKA 1S7OA 4MEYF 2DI3A 2HGCA 3O6BB 4LD5A 1XSDA 1QQIA 1Y0UA 1NHAA 2VE8A 3HSRA 2JT1A 3E6CC 2VODA 1ULYA 4A6DA 1B59A 4CXFA 3IRQA 5DV5A 3U9GA 3F23A 2FQ3A 4ZZDA 4ON0A 1U5TA 2XAHA 4O5VA 1D3YA 4L9NA 1R58A 3RJPA 3ZN1A 3DFGA 3CUQA 4KNYA 3H3UA 1XCVA 3F8BA 1GVJA 2XGXA 2HKXA 1LB2A 3EYIA 2NNYA 3QOPA 2G7HA 4WF2A 4U0WA 2EA4A 3ECHA 4U0YA 4Y15A 2W57A 1G6NA 4BQAA 3KFWX 3LAPA 1SMTA 1WI9A 2OAZA 3R0AA 2M8EA 4H0EA 1R7JA 4A0XA 1P92A 2P7VB 2X0LA 4F7ZA 5L3GA 2P6TA 2QM3A 2QBYB 4AVPA 3QAHA 1P6RA 2A69F 3TOAA 4MEXF 2YSRA 4LGWA 1YTYA 5L3FA 4YIIA 1QGPA 1KU9A 1B1BA 2MH2A 3LAJA 1J5YA 4UV9A 2FF4A 2LF8A 3TKYA 3BDDA 2V1XA 2VBYA 5J8CA 3WTYC 1LDKB 4ESJA 4ETSA 1U5TB 1K78B 1J2XA 2L02A 3I53A 3FMSA 1K78A 5D4RA 4XLPF 1FYLA 2FU4A 1EH8A 2WV0A 2C6YA 3M9AA 1ZGJA 1LDDA 3ZQ7A 5DUKA 2Z99A 1HXDA 1IN5A 2FSWA 2F5EA 2P4WA 1T39A 1ZRCA 2HZTA 1P2FA 4OMYA 3P7NA 3DQVC 2XAJA 2IVMA 4CDGA 5LGUA 3E97A 3C3WA 1XDUA 2GAUA 2LKPA 5ICFA 5HOOA 5D5WB 2OZUA 5DCMA 4EM1A 3GYHX 1FSHA 1G3YA 3HRMA 5L3BA 1S6LA 2M87A 1CGPA 2QZ8A 1SD4A 3QP5A 1MJAA 3E5QA 2P6SA 3KP2A 2E1NA 2VOPA 3QPHA 5JR3A 3HHGA 3DXJF 4P5OA 3I64A 4CO8A 2CFXA 3BJ6A 1ZAOA 3HHHA 4LK0F 4G7HF 4HW0A 2KJBA 4HQMA 1TQIA 2D2WA 1XCBA 4LLLA 3TGNA 5J6XA 4O3MA 1ON1A 4I0BA 1Z9CA 4KUMA 4N0BA 4GYGA 4HLYA 4HDUA 1IN6A 1OR7A 2FOKA 4LJZF 2Y75A 1R23A 1PDNC 5ED4A 3VB2A 1U78A 4WWCA 1EH7A 3BY6A 1I5ZA 1XMKA 1HKQA 5FD5A 2ZNZA 1RZ4A 2KRFA 1G3TA 4WXHA 2DTRA 4YIFA 4KIGA 1KQ9A 4D0PA 2CW0F 3WODF 4YG2F 3LQQA 1YFHA 1ZREA 5BQTA 5KK1A 1K6OA 4I7HA 2H6CA 4G6QA 5E17F 4FT8A 2PEXA 2HEOA 3GVAA 5AIPA 3TO7A 2ZNYA 1ZHFA 3J80Z 2PBIA 2XV4S 4M6YA 2A3SA 2FMLA 4Q4ZF 2ZFWA 1HKSA 2EA2A 3CUQC 2DO7A 2PG4A 1TQPA 2HFHA 3T8TA 1I1GA 5LRRA 1W7PA 3F21A 5CVUA 3K1PA 3GF2A 5DUIA 1S7AA 1BC8C 1YW8A 3RKXA 1TNTA
chains in the Genus database with same CATH superfamily
2LOOA 1XN7A 1PP7U 1Z3XA 3V7RA 5FLXZ 2L7MP 4XMYA 4A12A 3S14J 1G2HA 5E3OA 2DA3A 1OLTA 3FXLA 5M5YJ 4M9ZA 1TLHB 4NB5A 4BXXJ 1IRXA 2R3SA 5K7HA 4M6XA 1T0FC 3P5JA 3P9KA 4ABZA 1TW3A 2IBDA 1AA7A 3ISPA 3K70C 4J19A 2VOOA 4EMSA 1NG6A 3FHZA 2XDVA 4EV0A 2DT5A 3IUOA 3L9FA 2VQGA 1MZBA 3H3VK 4JYKA 3LOCA 1WZ2A 3E1SA 4XRMA 4OIOF 4OAYA 4DYQA 2DMQA 3RCOA 2EB7A 2BYVE 5H2FC 1GXPA 2VJIA 2KP6A 1V54H 2DFIA 2FNPA 1R00A 4NDLA 1ZGWA 4BYYA 3OV8A 3DTIA 3PUBA 1WHUA 3D1NI 3COAC 1FBUA 5F08A 3CO7C 2O5RA 2Q8KA 3KZYA 3MKYB 2G7UA 5M3MJ 4E7JA 2DU9A 2W48A 4MQVA 1LKXA 2I5UA 4IZZA 2XROA 1VNDA 4IVNA 4RB2C 1MMNA 3BROA 5BPIA 1SVMA 1S29A 5A2QZ 4CICA 3CP2A 2BXYA 2DDBA 1HKTA 1BIBA 3RTRA 4EM2A 1JHHA 2X4HA 1MD0A 4UVBA 1DUXC 3FK7A 1OCRH 1XSVA 3WHBA 3CMEI 3BR5A 2LLKA 2Q0OA 3FXUA 2IJLA 1T8IA 2P5LC 1LEBA 1N75A 2DDAA 1YW9A 4I0AA 2XVCA 5E18F 1IG7A 2FBHA 4IQ4A 4I2OA 3NQOA 2GWRA 1JKOC 1ZR4A 3CCJI 4G6TB 2DN0A 1AOYA 2YUSA 2ACJA 2CQKA 3M8EA 4QPQA 3F8MA 4ZTJA 3G1MA 4AWXB 1FTTA 2NYXA 2VBXA 1YYVA 1YW7A 3OIPA 3LSGA 2Y0MA 3JSPA 1TZLA 4ENKA 5HS7A 1IRGA 4A6EA 4LB5A 2CU7A 1X3UA 2OJED 3KYCB 4I01A 4BBSJ 4CZCA 4RGUA 1E3HA 3GFLA 3OIQA 1UG2A 3TBIA 3DEWA 2EILH 3CTAA 5KAFC 1F36A 2VONA 1O3SA 1JUSA 3QWLA 2F48A 3CMAI 1WKMA 1ZG3A 2M8GX 2R5ZB 1ERDA 4OINF 4BHCA 2BY3A 2VKEA 4JOMA 3L2QA 3KLOA 3HEFA 3OOUA 3L2VA 2XIGA 2DJNA 5HS9A 2CUFA 2QGUA 3ERMA 3OYKA 2HZDA 1DDNA 1EV7A 1OMIA 1J75A 3KIOA 4LMYA 4AYBN 1VQOI 1TTYA 2BVLA 3L09A 3I4MJ 3IH4A 1HDPA 4HX4A 3KETA 2MABA 4PFPA 4XSXF 3CLOA 4UUSA 2STWA 3JTGA 2JVHA 4HNUA 2W84A 3NRVA 4PZJA 4HSRA 1XMAA 3LSIA 3GLLA 4ESFA 4Z6YA 5KCMA 1T95A 2MA3A 4F92B 3V8JA 5D5VB 3RIRA 2X1CA 4PJMA 2VPRA 4M3BA 5EF6A 2IS4A 2EIJH 4E7KA 4E70A 1GT0C 4JK1X 1GVDA 3ZQLA 2HQRA 2OBPA 2X9DA 2W7NA 1MMGA 4BY7J 4M74A 2UXXA 3P9CA 1OQYA 2EFOA 4XSZF 4H4KC 2X51A 1MSEC 5K7ZA 4EATA 4HF2A 2GQQA 2VT3A 5HS8A 3S2WA 2P7CB 2UWMA 3S3OA 2W82A 2CGPA 3NEUA 1BM9A 2XGCA 2L9SA 5GTHC 2DW4A 2R4GA 3DKXA 2YU3A 3LWFA 5FLMJ 2JVGA 2OD5A 3ERED 3OYIA 2DPDA 2Y48A 1VFCA 4IHSA 2D1HA 1HSTA 3KE2A 4FE7A 4GO1A 3FXJA 1U6GA 1WWXA 1XGSA 2Z5UA 3K4NA 4IHWA 4KYWA 3CZ6A 1K61A 4LG0A 3W2VA 2BGCA 3LSKA 3R4KA 1ZLJA 4GGGA 3LA2A 4YELA 2VBWA 4Y33A 2O3FA 3KP5A 4BQQA 5LRSA 2LP0A 3OS0A 4RB0A 3QP6A 2DQLA 2BBYA 3BC8A 4AIJA 3QODA 4YRVA 4L5IA 4FASD 4GDFA 4HA8A 2E2HJ 3OL3A 2RKHA 2FBIA 3CUOA 4LLGF 3RPUA 3FMRA 1Z1DA 2GZWA 1PUEE 1X58A 3QU6A 4GCVA 2V1UA 2XAUA 2PFBA 1FY7A 2STTA 5C4JJ 2CO5A 3CC7I 4R79A 1JTYA 3OYFA 5GAGJ 1X1BA 4MHGA 1HF0A 3M1EA 1YOVB 1NK2P 2FE3A 4HZFA 1NH3A 4A3EJ 2V9PA 2KIUA 4HF1A 1UHMA 3SYTA 5M5XJ 3MKZA 5FD6A 1R5HA 3MEXA 1H88C 4KT5C 2LKSA 1MDMA 4OOIA 2HOEA 2CQQA 3V4GA 5BNGA 3F3XA 1YS7A 5AONA 1EA3A 2LK2A 1ZH5A 3M4OJ 1YIOA 2Q2EA 3Q0UA 4M9SA 2ID6A 4AM3A 3REOA 1O57A 1IC8A 2VPLA 2KRHA 4RLQA 4U87A 4UNOA 4Y3OA 5HLHA 1J0RA 3OYBA 4NHJA 3HOZJ 1UHWA 1KU3A 2FJ1A 5J40A 2ETHA 1BI2A 1ZYRF 4V2FA 2KT0A 3E5XA 2EFWA 5GP9A 4IF4A 4DYCA 2EV0A 2P81A 2VKHA 1DP3A 2HWVA 5TRDA 1JE8A 1SMYF 3GZ6A 2NVUB 1HDDC 2O0YA 2Q1ZB 3UR3C 3SEQA 4B43A 2DYSH 3CCUI 1WJCA 4HQEA 3DKWA 4BE0A 2QSFX 1T08B 3CMYA 1P4WA 1MJ9A 3PFIA 2GA2A 3T8RA 2JA8J 2OQGA 1IF1A 1T33A 2AS5F 2UV1A 1QBJA 4IRIA 2E7WA 4G6DA 1BI3A 1JJ6C 3L2WA 1Y8RB 4OWRB 3TO6A 3S1NJ 4A3LJ 4L9JA 4BE2A 2QQAA 2Y0SA 3MZYA 3O2PE 1JKRC 2LREA 2VT2A 3FKJA 2XUBA 4XKBA 5FB2A 5CJ9A 4I02A 3WE2A 3DBLB 2XC7A 5HNHA 4FCYA 3D0SA 3OYNA 1LVKA 3HDDA 3ZMTA 5IYCJ 4BJ6C 2RQPA 3BPXA 3HRUA 3O3KA 1V5GA 4N9HA 2JJ7A 3HOVJ 4UUSB 3K2ZA 4C3HJ 3ZGKA 5D8LB 2J5OA 2W25A 1LUJB 3ML6A 5HDKA 2DMPA 1QVTA 3PNYA 3R60A 5JFRA 3NARA 3J7YJ 2LF7A 1YI2I 4HOBA 4IRHA 3FBNB 3WTSC 4ZH4F 2O61A 2YS9A 5IT3A 4EEFG 3NWSA 2RC4A 4LFUA 3A2KA 4PFOA 4FX4A 2W4SA 1BI1A 3H9GA 4B09A 3PQKA 3LNQA 3OWTA 2R5ZA 1Y0NA 2NVTJ 1ZKGA 3KEOA 4QWQA 4M72A 1R36A 1R4MB 1Y6IA 1XTAA 3PUFA 4ENNA 2L7KA 1HC8A 4O6JA 2JN6A 2QCOA 5FFZA 3MWMA 1VI0A 2ICWG 3I54A 1RR7A 1UAAA 4NBQA 3JRGA 3DU5A 1WJFA 4B8XA 1OCOH 1Z67A 4CSWA 4PK4A 1TC3C 2Z1DA 1RRJA 3JAMZ 1WJDA 3M8FA 1USSA 2IW5A 1REPC 4MNUA 2VKVA 2I10A 2M45A 3EPZA 3K4JA 1N77A 1E17A 4B3AA 1EKEA 2YPRA 3I9V2 1UFMA 3WU1B 1L0OC 5GPAA 3FZVA 1V4RA 2BOLA 2IA0A 4L0ZB 3TP0A 5FROA 5H6QA 4X1EA 2KZVA 3ZMZA 4F91B 2K7LA 1FP2A 2RN7A 3F8FA 4XR6A 2Z9OA 4N4OB 2F5CA 3JCUC 4NQWA 2PMZA 2M30A 3BTCA 3C2HA 4P96A 2HTSA 1T6SA 2HKOA 2RVCA 3BG3A 5F1RA 1YRNB 1W4MA 1QZYA 3VFZA 3CJQB 1GV2A 1A04A 3ZMUA 5C44J 6PAXA 1ZARA 3T0YA 4HF0A 4B4CA 5E1XA 3DBRB 3HGYA 3ZQFA 1XB4A 1AHDP 2JPBA 3L7WA 1PUFA 4XKWA 3ULQB 3AG1H 5FKMA 3CF2A 1BIAA 1F9NA 3HOXJ 4DOZA 3J7ZI 3GTGJ 1ETOA 3I0TA 2ZKZA 4HAMA 1I6XA 1DPUA 2DA5A 4LB6B 4PGHA 4RB3C 2HYGD 3IL2A 5IOYA 1B8IB 2JZYA 5TGTA 1YO5C 1YJWI 1YJ9I 1I3QJ 3WTXC 1U2WA 3O8HA 5LEKA 2DA7A 1KYWA 2E36A 1OFCX 1TBXA 3G2BA 4II3A 4ENJA 2EJRA 1MMDA 1LFUP 1SVOA 5CVJA 2E1MC 1MMSA 3BWGA 3IHUA 4V19K 3GFMA 1FP1D 3FBIB 5DD8A 2JA6J 2GA1A 5K5QA 4LIVA 3OS1A 2A07F 2H27A 2H1LA 4XORA 2CQNA 3CCRI 1YS6A 2LY2A 2LDUA 4BHPA 1MBJA 3JAMK 4A5NA 3GTOJ 2HOTA 5LLQA 3D5LA 3KZZA 4UVCA 4E7HA 2H1KA 3L00A 1JUMA 2FXAA 2QVOA 2BV6A 2IA2A 2RNGA 2L4AA 1FWZA 3TDZC 1X3WB 3DTEA 3HKZN 4WXDA 3ZMSA 5D5XB 3PM1A 3ABTA 2MD5A 4WCGA 1LE8B 4A3CJ 3IKVA 5ERIA 2HI3A 3SJMA 1OR7C 2JRTA 3HSFA 4PSWA 4B48A 1A31A 4G9YA 1RPWA 3HOSA 5JVTA 3W2WA 4IXAA 5ILUA 2O8XA 3IC7A 4DBRA 5ICCA 3FDYA 5TJJA 1XD7A 9ANTA 3ABUA 4S04A 5LBQA 4QIWN 3GUDA 3IWFA 5DCMB 3ZP5A 4UY8I 2L3DA 1P7JA 2JMWA 3BR2A 2NRAC 1PJRA 2ZCWA 2KL4A 3JTHA 1BBYA 2V79A 2BZTA 5IY5H 1HQCA 1W5SA 3I59B 5EZGA 2IT0A 4LLNA 4PJNA 1FYMA 1OKRA 2XGDA 1LJ9A 1IDZA 4X0GA 3CCQI 3W6VA 4EJWA 3OYMA 5F0FA 2ZMEA 2FUG2 3IH3A 2PJRA 3JW4A 3WTZA 4DYRA 2XHKA 2OA4A 3R0JA 3O8GA 4RGRA 2RREA 4JX4A 1MBHA 3IKTA 2TRTA 2HTJA 3BJOA 4C2MJ 1XGMA 1CF7A 5DDGA 4D9JA 1IJWC 3A1YA 2H94A 2M0MA 2ECBA 3GWZA 2XAFA 3CCYA 1SD5A 2K3FA 1PYVA 3PNTA 5JLWA 2CQXA 2ZXIA 2P5VA 2ME0A 3VYTB 5KVRA 4S05A 4G7ZF 1Z0XA 2F2EA 1Y39A 1MMAA 2ADUA 3RDIA 3SEZA 2BW3B 2A5WA 3I4NJ 2EH3A 3EUHA 1FC3A 5HLTA 4PGGA 4P9FA 1ONVA 2VJ4A 4RS8A 3LA7A 4BHBA 3J80K 2VXDA 2X48A 4NUBA 4IQJA 1G59A 3VYUB 1SVLA 2XF6A 2K4JA 4IPAA 2HYJA 2GM4A 3RZOJ 2F4OB 4XRSA 1I50J 2VIXA 1XGNA 4BH9A 4DJAA 2LFBA 5FLVA 2R93J 3DPLC 3CESA 4LK1F 4E7ZA 5FRNA 1G3SA 3RQIA 2KHMA 5CKTA 2CUZA 2PJPA 5CVVA 1AKHA 1FYKA 1VQ8I 2R7FA 5FKKA 3VSKA 4XICA 3S2DJ 5EGOA 1AWCA 5TISC 4GFBA 4RAZA 3N97A 1Z21A 4B44A 1T2KA 1UJ8A 3H3ZA 2M9HA 2CMPA 1WH7A 5J4VA 3GTMJ 5K7FA 3DCFA 1QNTA 2AXLA 4E7LA 2LY1A 3L2RA 4D1QA 1T98A 2EIMH 1QHGA 2ZO4A 4BXFA 5K5RA 1H9TA 1I3AA 3DKYA 1YIJI 4R8HA 2K5CA 1IDYA 2X6OA 3RKWA 1OYWA 2EBIA 4U7DA 3CJNA 5M5WJ 2RDPA 4UB8C 1JGGA 5IOZA 1BOAA 1Y56A 4HSTA 4L9TA 3CMMA 5J3LA 1FNNA 2F5FA 2VC0A 2K4BA 3CJRB 4ZYEA 5AIQA 3WGHA 2BHYA 2QLZA 3BQZA 3H36A 3MN2A 1KU7A 1VTNC 3K7AJ 2PMZN 1K7AA 2HR3A 3W3CA 5H20A 1SAUA 2F6CA 2VUMJ 2Z33A 4EQQA 4CYCB 1RESA 3DTKA 3UNGC 3RI4A 1TWGJ 3OYAA 2ECCA 3VSLA 4FTHA 2HVSA 3FXOA 3LSJA 4EGYA 1P4XA 4S0HB 4KISA 1VQ6I 3GLXA 3OY9A 4IO9F 5FGMA 2EWNA 5F64A 1D1BA 2R7UA 2P5KA 2A5YB 1CF7B 2Y30A 5KHDA 2MW8A 1KGSA 1NK3P 1SFEA 2CW8A 2Z16A 2CFOA 4UHTA 1MSFC 2L7FP 3CJTB 3ASOH 4HYEA 1VQNI 3S2HJ 2XPUA 5D8KB 1HA8A 1P4AA 4RM2A 1QZEA 5DTDA 1PUFB 1YJNI 4LG3A 2DPUA 1DU6A 4F3QA 3CC4I 3K4CA 1E2XA 5L3DA 1HW2A 4CZZA 2XKOA 1KQ0A 4N9IA 4B1RA 2EFNA 1VQ4I 1F43A 3V7CA 1B4AA 5B1AH 2E34A 2PMUA 3Q9SA 3HSEA 1B9MA 1HCRA 2HOSA 2B63J 1PP8F 1Z77A 1UCRA 3AFHA 3BJAA 3FM5A 2HDCA 2V6CA 1UELB 1IXSB 2L4MA 3BCAA 2BW3A 2DT7B 1HBXG 2CS3A 3KP4A 2Y31A 1X1DA 2AXTC 3I71A 4EJTA 4X6AJ 3ZQGA 4I09A 1GV5A 1K83J 2KISA 4BU2A 2JSCA 2NNNA 3JREA 2EV6A 3I4PA 2ME6A 1ZELA 2YX7A 2M4GA 1X1PA 1IV8A 3VWBA 4PCQA 3W6JB 3JRFA 3GEZA 1VQ9I 3B6CA 5CYVA 1MNEA 2OQRA 3T5XA 2XF7A 1ON2A 4MQ9F 2KJCA 4DNCA 1RC9A 4CHUA 4XLEA 5KAIC 4FE4A 4UXNA 3BTJA 1JGSA 4IL6C 2LR8A 3HRSA 4HX8A 1FSEA 5FRMA 1D0YA 4NC6A 1XMXA 2CV0A 2XAGA 3D5RC 4YFXF 1MGTA 4BKXA 4EVIA 1BC7C 1O3TA 3TOBA 2FNAA 1BI0A 3BR6A 3QOEA 1S72I 3BZKA 4U0VA 3HOTA 1JKPC 2NOJB 4KITB 3LSHA 3IRRA 4M3EA 2DOFA 1BN5A 2VQCA 3RKQA 3M1CA 3PQJA 3A02A 5GAEJ 5F0HA 2ISZA 2XRLA 2FA5A 1SFOJ 1ZQ3P 1OYYA 1R1VA 2A6EF 1ITYA 1XSXA 5F6FA 4PJ0C 4L5JA 4ZDOA 3WTWC 2E2IJ 3G3ZA 3LFUA 1U5TC 1MW7A 4A3MJ 3HYIA 4XBFA 4UB6C 1A6IA 1ZRFA 1JUPA 2X85A 2M5WA 4KT6A 1RUOA 4MO7A 2PQ8A 2A61A 2WTEA 4HV6A 2DAOA 1BR4A 3RYPA 3CLQA 3KX2A 1TWFJ 4ZDLA 1LPQA 2ELKA 1WPKA 1U0JA 1N78A 2IGNA 2QQBA 4RGSA 2K9NA 3SDGA 3WU0A 3LFKA 1NG7A 1MIJA 3ONQA 3OYEA 2CUJA 4FETA 3CUQB 1BJAA 4Y13A 1OCPA 4HV5A 4OIPF 2PMHA 3ABLH 1IUYA 2CV2A 4A0YA 2ZXJA 1OJLA 4AIKA 5IP9J 1Y1WJ 4RA2A 4XN3A 1RI7A 2OZ6A 1OCZH 1FPQA 2QENA 3F22A 2GXGA 2EZKA 1FJLA 2X1EA 3A4CA 3BOQA 4XN0A 3MVPA 2DFHA 1VQMI 1V5FA 4IJAA 3KEQA 3HTSB 1KQ8A 1HOMA 2OPTA 5A2QK 4L9VA 3EUAA 2WAEA 3KP7A 4BXUA 3LSRA 4A3BJ 1EF4A 2AO9A 4G94A 3SDBA 3K6GA 1A35A 2F5DA 3ABKH 4ZYGA 4JQFA 1Z6TA 2BXZA 3KLNA 3PIPF 2HPMA 2EIKH 1W36D 3H35A 2MH9A 3ELKA 4KJZA 3HIFA 3WTVC 3E6BA 4XLFA 3SQNA 3UKGA 4LITA 3EYYA 1O4XA 5C4XJ 5HODA 3TQNA 3M7GA 1LDJA 1TNSA 4XRFA 4P1WA 3MZHA 4IHTA 2HYFA 2ZB9A 5DCFA 3ROUA 4DW6A 3LSTA 4ESBA 2VBZA 4PJLA 3HB9A 5BOXA 2XPWA 2LC2A 3A0BC 3QPTA 3LSPA 2DMUA 2HU9A 1YG2A 3BR1A 3G73A 5IT9K 2UUZA 3S3NA 2F4MB 2ZFUA 4MFEA 4MFDA 2E7XA 3FWEA 3H5RA 1D8JA 2VE9A 2M34A 1RNLA 4CCKA 4Y7NJ 1WJBA 2Z3YA 1D1CA 4KMUX 4IHYA 1Z91A 3HG9A 2QSHX 2DODA 1YX3A 5FKOA 1FX7A 1RETA 3BG9A 1MNMC 3RPQA 2E71A 3M07A 3ZXSA 4D5CA 3AKZA 3PJRA 1FT9A 1QO0D 3E6DA 4KDPA 1HW5A 1MBFA 1QRYA 3A01B 1AKHB 2VKDA 1WI3A 2L9NA 2R0QC 2LNBA 1XPXA 5K1YA 3MQ0A 3K4MA 3VYRB 4B3XA 3U1KA 2DMNA 2MSYA 3K9TA 3P9IA 5L3CA 1JXSA 4M9XA 4MTEA 5LEJA 2JUCA 4BE1A 1O3QA 1VQLI 2ZJ2A 2ZJRF 1WRJA 3ABMH 2YR2A 2IS6A 5FKNA 3G71I 4E6KG 1J59A 3LQRA 1YRNA 4MTDA 1RUNA 2IA1A 1IZ1A 3K10A 1GHCA 1T38A 1Z05A 4DIQA 4AIDA 2QA4I 2E1CA 1B9NA 1BJZA 5E1ZB 3V42A 5D4SA 2LSOA 1HSJA 5J1YA 3OYDA 1W36C 4KFCA 4KN7X 1ETXA 3E3VA 4BAYA 3DP7A 5LFAA 4BDZA 2B0LA 2HDWA 2UZKA 2ESNA 2PI0A 2IGOA 1MDMB 2R7XA 3ASNH 3HBLA 2FEZA 4XQFA 3OOPA 4JBAA 2BY2A 2JA7J 1MJBA 3F72A 2L0KA 2XSJC 1KU2A 2LD5A 2O6GE 5B3SH 2ZMEB 2M7AA 2BEOA 3PO3J 2W24A 1MKMA 2QEXI 3I59A 3QPLA 1K6YA 1SFKA 3TW6A 1E3OC 1TP4A 4XLHA 2LBFB 4CGZA 4G12A 2KIFA 2E2JJ 4HNTA 2R7QA 2IP2A 2K9QA 1HW1A 1ODDA 3K1NA 3IAS2 4WK8F 1BL0A 5EGOB 2ZJPF 4ZZLA 3K1MA 2E1MB 3I3LA 3RKYA 1SD7A 1WQ2A 5B1BH 3H1CA 4WXCA 3PFYA 3Q5FA 2DMTA 4ASNA 1QZZA 2DA6A 3KP6A 5ILVA 4BDYA 2EQRA 1U9NA 4G8XA 1X4OA 2K02A 4L5EA 3SZTA 3FM3A 4Y52J 3FXMA 1FBSA 2ZC2A 5HLGA 2K27A 2VC1A 5LHGA 3I55I 3GZ5A 4EGZA 3ZOBA 3BZCA 4NQWB 2FMYA 1ETVA 2CH0A 2XASA 1BW6A 5JHUA 4CUGA 3WTTC 1DGRM 4FX0A 1VF9A 1W5TA 3VYSB 4YFNF 3OYLA 1F5TA 4XRSG 3MFKA 3E6MA 3K4KA 1LNWA 2LKXA 3DEEA 5B66C 3OR2C 3TDUC 2DLLA 3CCEI 2HXIA 4F52A 3J81Z 2QQ8A 2EFPA 3F8NA 2CRGA 2ELJA 4AD9A 3HC7A 3H92A 4YEJA 2JA2A 3OR1C 1DQUA 1FIPA 3EUHC 1R71A 2R7TA 1IO2A 1DPRA 3B73A 1P7IA 1T0FA 2OCCH 4D7MA 1L3LA 3BTLA 3MAJA 3U1DA 2E5ZA 4A2UA 3GXOA 1X2MA 2DT6A 2X6YA 3F9KA 1ZLKA 3HUGA 5HDGA 3TEDA 5BS6A 4PDKA 3Q0WA 1IN7A 2HOAA 2IAIA 2HQAA 4XM3A 4FHTA 2V4JC 5HVQC 3SHFA 2CSOA 4GXOA 5BMZA 3SZGA 3GFIA 4B47A 1ZRDA 2DK8A 4BJTA 2N8GA 2P0WA 3K0LA 4A0ZA 2O7OA 2M2EA 3V7SA 2KLOA 5DD4A 3CCLI 3V8LA 4OU0A 2D45A 4J00A 3QRFF 2J5PA 2PX9A 1T56A 4ENMA 1FMVA 3GX4X 1FMWA 3IAM2 3E5UA 1VQ7I 2YX4A 4NC7A 2CG4A 3HTUA 4CCLA 4W1UA 4BACA 3WE3A 5EG0B 2DBBA 1A36A 1Z6RA 3LMMA 4M73A 2L2OA 3VODA 1U3EM 5H6RA 2KIMA 1G4DA 1E0EA 1X1AA 5IYDJ 3PIOF 3W6KB 2ISYA 2EK5A 4Q47A 5JHFA 3ZPLA 4LG0B 3BG5A 4OIRF 3JSOA 3B02A 3BPVA 1F1ZA 2HS5A 3BZ6A 3WHCA 3CCSI 2V1DA 1G8XA 3TMOA 3GZNB 2A68F 1FBQA 2XRNA 1K4TA 4EJOA 3Q0VA 1U9OA 2HXOA 2XB0X 2Y69H 3CDIA 1W0TA 3GFJA 4R1HA 1UHSA 2NAZA 3R61A 5EG0A 4G7OF 4DBQA 3MCZA 1ETKA 2GOXB 5HLIA 1B72B 4AYBA 1O3RA 3K2AA 4RAYA 4P9UA 3LL7A 3K4BA 5CVRA 3PL8A 4KIBA 5EEHA 2DFFA 2E5NA 1ORKA 2EZLA 1FZPB 4L0YB 3NAUA 3HKZA 3S3MA 3VEPA 3VPRA 4DQ2A 2DYRH 2DTZA 2HQNA 3DF8A 3OYHA 4UUTA 1BR1A 1XDSA 1HLVA 1G3WA 2JQ7A 5J4YA 2BHZA 2DOAA 3D5SC 2CWEA 4ZYDA 1JJ8C 2WC2A 2BY1A 1I1SA 1YQAA 2GXBA 1BOBA 3BCBA 5D5UB 4I76A 4EM0B 2BY0A 1FOKA 1R4NB 3CQZJ 2TCTA 3HZJA 2XGEA 5DEQA 1R9TJ 3KCCA 2XAQA 3HUGB 1SEUA 1UZCA 4UVAA 4UUVA 3S17J 5CLSA 5CVIA 4ZTFA 3CC2I 4QSHA 2MGQA 4RLFA 2GIZA 3X2QH 1SANA 3HOYJ 2A05A 1IN8A 1XX5A 2JK3A 1TW2A 2MFZA 1J7KA 2VLAA 4CCJA 2RNJA 2OC6A 4Q5SF 2WB1N 3WGGA 2CYYA 3JRIA 3DV8A 2EINH 3F0CA 1K79A 4QLCU 3GTJJ 1IW7F 1POGA 1DU0A 2NOGA 1ETYA 2G9WA 2RQQA 3ESWB 4A69C 5J1UA 1Z3YA 4OMZA 5ILSA 4EJUA 4HG2A 4IOAF 2LTPA 2A6TA 2L01A 3HPHA 1EJ9A 3I58A 2FRHA 4MLOA 4XKCA 1MH4A 5HDNA 2O03A 4ITVA 2DA1A 4UV8A 3BQYA 3GW2A 1Z7LA 4E7SA 5LHIA 1YLFA 3KP3A 1KA8A 2UXNA 2L9RA 3R6SA 5ICGA 1LFBA 4P55A 3DPTA 3H0GJ 3OYGA 1R5GA 3FK6A 3OIOA 1QU3A 3FX3A 1QA6A 2NS7A 2DK5A 4HDVA 2OU2A 2NVXJ 1JT6A 2KDOA 5DM7F 4I99C 3BP8A 2ZXWH 4HLXA 1GLNA 4HX7A 1LEAA 1YE9A 2K85A 2K86A 4EJVA 1B6AA 1SFXA 2V7FA 3AG3H 1PVEA 1OPCA 5E1WA 2IPQX 2GXAA 4M71A 1WJAA 1J9IA 3JR9A 1USTA 3C1DA 1TT5B 4IRGA 2WWYA 4AC0A 4BL0B 2A6HF 2RGVA 4GRIA 2MG4A 4AU7A 4MIMA 1GXQA 1K4SA 2FBKA 1MH3A 2DQRA 1BR2A 2PN6A 2EV5A 3EETA 1D5VA 3WTUC 3AG4H 4FISA 3ZQHA 1O7LA 2TDXA 3CCMI 4II2A 1XS9A 5B5EC 5E8IA 2EZHA 2RAEA 3RPUD 2CJJA 2COBA 2EZIA 4XLAA 1B72A 1QPMA 3HRTA 2XB5A 1JI8A 1APLC 1EH6A 2VB6A 1V3FA 3FF5A 4E7IA 2V9VA 4RMNA 4CYDA 4M6VA 3B6AA 1SAXA 4A3JJ 3GO5A 2QKLB 2IS2A 5GPCA 2K9SA 4HPQA 2D1VA 1A6QA 4C2UA 2HQ5A 4RGXA 1WSUA 4BNCA 1X4PA 3Q3SA 5J8FA 3BR3A 1D0XA 2E35A 5BPDA 3ZMVA 1XG1A 2IGMA 3FXRA 4PJJA 5FFXA 3G6EI 1S3JA 4RAFA 3ZQCA 1X3ZB 2DOEA 1Q1VA 2COMA 5JI6A 2JPCA 4TV7A 1RKTA 2L7ZA 1VZ0A 5F04A 2V9KA 2LY9A 2H6BA 1IRFA 1LVAA 1LQ1A 1IN4A 4XOTA 4KMFA 1IRZA 5D6EA 4YFKF 3AAFA 2VXZA 2LBFA 4BQOA 1WJEA 2ESHA 2ZXHA 2Y9ZA 5ICEA 1DP7P 4CCNA 1X2NA 5L3EA 2DCEA 2QUFA 1C0WA 2PLYA 3F6OA 5IT9Z 1YX5A 3U2RA 1O7FA 2QQ9A 1WGXA 2XKPA 3CDLA 3ZQQA 5IP7J 1TL8A 4MGRA 1D8KA 2CW7A 2ZJQF 4A5MA 2KZGA 3DEUA 3C2GA 1ACIA 5J47A 4Y17A 2M1BA 4IHVA 5FKLA 1FOYA 2E1OA 4L18B 4V2GA 2QSGX 3ZN0A 3SFZA 5FLXK 5DS9A 3S1RJ 4PSXA 1TWAJ 3GBGA 1TQMA 4ZYHA 4FQGA 4BS9A 2QBYA 4RBOA 1I39A 4NC8A 3IP4B 2KKOA 5D6FA 2QKMB 2HDDA 2O8KA 4KA4A 1FEXA 3BT9A 2JA5J 2KDZA 1R22A 4KN4X 4YIRX 3VOEA 2ZSHB 3A01A 4WX9A 1IV6A 3NWTA 1H89C 1R1UA 1XGOA 4XNFA 3GTLJ 3JRHA 3FXQA 3HM5A 5LGTA 1ZG1A 1SFUA 5E8GA 2IXSA 2VJ5A 4I98B 4HBLA 3S8PA 2W1OA 2MC3A 3K69A 4Q48A 1NTCA 2VQHA 1P9QC 2RV8A 5F1JA 3RYRA 3Q9VA 3HPGA 5K5OA 1H0MA 3WG9A 2YU9J 1ZN2A 1U8RA 4U88A 1QPIA 5EEGA 4XOPA 3LSMA 1D0ZA 1R1TA 1RIOH 2VN2A 3CDHA 4F55A 2IRFG 2JUGA 3CO6C 4CYCA 5LHHA 3K70D 4JX5A 3LA3A 1R5ID 1W7PD 4QTRA 3HGGA 1IXRC 3FXKA 4D5FA 1U8BA 2R7VA 1ZR2A 2WAFA 1WVRA 3SZPA 3I5UA 4U7BA 4I6ZA 1ETQA 3A0HC 2JTVA 1I27A 2GIVA 4K2EA 1V5EA 1IXCA 1S5LC 3T1BA 1KYZA 3CF5F 2OF7A 5E20A 1UB9A 2NXNB 2MLKA 2O9LA 1W7PB 1IAWA 1V55H 3H9JA 1S9HA 2R7DA 2AQFA 2H09A 3G1OA 1OYIA 3EDPA 1YITI 1UMQA 2LVSA 3ECOA 2W00A 3VDXA 3ZR8X 4KIFA 1I6HJ 2K40A 3EQLF 3L2CA 4GYIA 1Q1HA 3IWZA 3F8CA 3SFIA 2QYOA 2NS8A 4KICA 1A5JA 3GTPJ 1D1AA 1KZHA 4OIQF 2Y2ZA 3C7JA 1JTXA 5HNFA 1SD6A 1Z7UA 3JRDA 5FO5A 1RR8C 4AIHA 2E19A 5E3NA 4HRIA 3WGIA 2V26A 3C18A 2ELHA 2NS0A 3A03A 2L54A 5E79C 3DLAA 2I8DA 4Z2YA 2NVQJ 3J7AO 1ZGAA 2QWWA 2XSDC 2LRDA 2EFQA 1ZG5A 3IV5A 1STZA 2IGKA 4RDUA 4RM3A 4JP0A 3V8KA 3HJEA 1JHFA 4XLNF 2WAQN 3OYJA 2W85A 2ZSIB 4RB1A 2B9SA 5JVGF 1WJ5A 3KEYA 3KZIC 1H9GA 2BE5F 3F6VA 3TO9A 3SXYA 1FLIA 5LGNA 3ZMDA 2WY7Q 5EDNA 3J7AY 2VL8A 3QU3A 4PUSA 3N4MA 3HXLA 2MLGA 2P8TA 2KRCA 5DYMA 1F4KA 1KONA 2G0EA 2MBFA 1DGWY 1QHHD 1S8NA 3GMEA 3J81K 3FMQA 2ZBKA 3AL0B 1S7OA 3MKLA 2OTLI 4MEYF 2DI3A 1JT0A 2HGCA 5JLXA 3O6BB 3S93A 4LD5A 1M1EB 1XSDA 1QQIA 2ZMEC 1Y0UA 2QF7A 2CQ7A 2WV1A 1FTZA 4BEHB 3N05A 1NHAA 2VE8A 1ZTRA 3HSRA 2DFEA 2JT1A 3E6CC 4IX7A 4M3DA 3S16J 3CP8A 2VODA 1ULYA 4A6DA 2MD0A 1B59A 2X6XA 4CXFA 3G1LA 1N25A 3IRQA 2MC4A 5DV5A 1TWHJ 1S7EA 4IEJA 3JRAA 3U9GA 4ZDPA 3F23A 2FQ3A 4ZZDA 1AU7A 2M4KA 4ON0A 4DZPA 1U5TA 1FOWA 1FOXA 2XAHA 4O5VA 2OUMA 4ANJA 3E0JB 2BVMA 1D3YA 4L9NA 4CCMA 1R58A 3RJPA 3ZN1A 3DFGA 1JKQC 3IH2A 3ZCOA 2WAQA 4BBRJ 1MBEA 2EPFA 3CUQA 4KNYA 3TW7A 4IKFA 3H3UA 2ID3A 2R7ZJ 1XCVA 3F8BA 2L5QA 4D7NA 1GVJA 2XGXA 2HKXA 4CCOA 1VQPI 1LB2A 2K3PA 1VQKI 3EYIA 2NNYA 3M8JA 4IHXA 1LFPA 4E4HA 2GBYA 3MMYB 3QOPA 2G7HA 4BUPA 2AQEA 2KQRA 1OISA 2JSPA 4WF2A 3RQ4A 4U0WA 2EA4A 3ECHA 4U0YA 4A3FJ 5IYBJ 4AUXA 3DBHB 3S1MJ 5DM6F 4C30A 4BEHA 4NNJA 4Y15A 2W57A 2OTJI 1G6NA 1ETWA 3KFWX 3U21A 3LAPA 4BQAA 4C2TA 1SMTA 1WI9A 2OAZA 2PJRB 3R0AA 5J1RA 2M8EA 5E3MA 4XIDA 4H0EA 1R7JA 4A0XA 1P92A 3H5AA 2IEKA 1VQ5I 2P7VB 2X0LA 4F7ZA 1TT0A 4HEA2 5L3GA 2P6TA 2QM3A 2QBYB 3FHNA 3TL4X 1OCTC 4AVPA 2FQ4A 3QAHA 2R7SA 1P6RA 2A69F 3TOAA 5LD2C 3TP3A 1ZK8A 4MEXF 2YSRA 2F4IA 2WADA 4LGWA 2Y9YA 1YTYA 2VI6A 1WCMJ 3RSNA 3BLYA 3DPUA 5L3FA 4YIIA 1QGPA 1KU9A 3OSGA 2WB1A 2HVRA 1BW5A 1B1BA 1CQTA 2MH2A 3LAJA 2AHQA 1J5YA 1MBKA 4UV9A 2FF4A 3DU6A 2LF8A 1D5YA 1WFXA 5EZHA 2R5YA 1W1WE 4ZYAA 3H0DA 3TKYA 3BDDA 3FIWA 3BTIA 3FISA 2K9LA 2V1XA 3E7LA 1SC7A 2VBYA 2LG4A 5J8CA 2M7BA 1IGNA 3ZQIA 3WTYC 1LDKB 4ESJA 4ETSA 1U5TB 4C3IJ 1K78B 1J2XA 2L02A 3I53A 3W2AA 2WBMA 3PNVA 3FMSA 1ENHA 4Y4RA 1K78A 5D4RA 4HNVA 2R7WA 2R7RA 5M3FJ 4XLPF 2OV7A 1FYLA 2FU4A 1UG0A 1EH8A 2WV0A 3AG2H 2VQLA 4XKVA 2C6YA 3QYBA 1R49A 5EYRA 2H8RA 2KMUA 5GADJ 3KYDB 2WY8Q 2VJJA 2V1NA 3M9AA 3DWLE 1WH5A 3L1PA 4A3DJ 1ZGJA 2IS1A 1MBGA 2R92J 1B8IA 2LYCA 1LDDA 4XK4A 3OYCA 1YHQI 3ZQ7A 2B7EA 1GDTA 5DUKA 2L9VA 3JRBA 2XPVA 2Z99A 1HXDA 3WG7H 2DXIA 3K4LA 3DLLF 1IN5A 2FSWA 2VASA 3GTKJ 1QVUA 2F5EA 2P4WA 3GCMA 1T39A 1ZRCA 5GAHJ 4DZJA 3BR0A 2HZTA 1P2FA 3OS2A 4OMYA 3P7NA 4M3GA 2HPIA 4CA0A 2FX0A 1H8AC 5FJ8J 3DQVC 1XC5A 1FIAA 2XAJA 2MYSA 4C9YA 1RKWA 3KPHA 2IVMA 4XLCA 2LMDA 4CDGA 5LGUA 2DA2A 4OAZA 3E97A 3FKIJ 4JX6A 3CD6I 2DA4A 3C3WA 2X6WA 1XDUA 3QYFA 3ZRGA 3G4SI 2LH9A 5F0CA 1GUUA 2GAUA 2M0CA 2LKPA 5ICFA 2GOMA 1IUFA 5HOOA 2CUEA 4ZJZA 2Y0SN 5D5WB 2OZUA 5DCMA 4EM1A 3HOUJ 2F5VA 3I56I 3GYHX 1FSHA 1G3YA 3HRMA 4A3GJ 4F93B 5L3BA 2JWTA 4A93J 3HL2A 3QPSA 5IPAA 1S6LA 2M87A 1CGPA 2QZ8A 1SD4A 3BG6A 3QP5A 1MJAA 3E5QA 2P6SA 3KP2A 4XL9A 1Y1VJ 2E1NA 2VOPA 1TWCJ 4A3KJ 3QPHA 5JR3A 4J01A 2FD5A 2Q2EB 2X1DA 3EUKL 3DXJF 2JRMA 2OCEA 3HHGA 1J09A 4P5OA 1MNDA 2K9MA 2E60A 3AL0C 3S32A 3I64A 4CO8A 3WU2C 3GTQJ 2R5YB 5KNLA 2CFXA 3BJ6A 1ZAOA 5F27A 3JRCA 3HHHA 2HNHA 3C2BA 4LK0F 2H8WA 4G7HF 4HW0A 2KJBA 3L2UA 4HQMA 1TQIA 2D2WA 5CPRB 1XCBA 4CH7A 3CCVI 4DGWB 4LLLA 3TGNA 3QQAA 4LOCA 5J6XA 4O3MA 5CQGA 1ON1A 4I0BA 3S1QJ 1Z9CA 4AVZA 4KUMA 4N0BA 1X1CA 4GYGA 2KPMA 4HLYA 2HVQA 5C3EJ 2GLOA 3KYLA 4ZC3A 2NVYJ 4HDUA 1IN6A 2CV1A 2KIQA 1OR7A 3H9QA 2FOKA 3OL4A 2D5VA 4LJZF 4BQNA 2Y75A 1R23A 4LIUA 1PDNC 5ED4A 1Y8QB 3VB2A 3MKWB 4QPOA 1U78A 4WWCA 1EH7A 3BY6A 1I5ZA 1XMKA 4IOCF 2DJIA 2FOWA 1HKQA 1OCCH 5E3LA 2M3AA 5FD5A 2ZNZA 4BJ5C 3OMYA 4XONA 1RZ4A 2KRFA 1G3TA 4WXHA 2DTRA 2Z2SB 1E3PA 4YIFA 2R7OA 4KIGA 1KQ9A 3QYEA 3PSFA 5IP6A 4W97A 3HOWJ 4D0PA 2CW0F 4RAGA 3WODF 4YG2F 2WA0A 3LQQA 4N4NB 1YFHA 1ZREA 3PSIA 1W5CC 3RZDJ 5BQTA 4A3IJ 1BA5A 5KK1A 1K6OA 4I7HA 2H6CA 4G6QA 5E17F 4FT8A 2PEXA 2HEOA 3GVAA 5AIPA 3TO7A 3MZ8A 2ZNYA 3BG7A 1ZHFA 4M3FA 3M3YJ 3J80Z 2PBIA 2XV4S 3OSFA 4M6YA 2A3SA 2FMLA 4BY1J 4BGDA 4Q4ZF 5CQEA 2ZFWA 1HKSA 2EA2A 4C3JJ 1R6RA 1X19A 3CUQC 2DO7A 3S15J 3MD2A 2V6EA 2PG4A 1TQPA 2HFHA 3H5NA 3T8TA 1I1GA 1W0UA 5EEAA 5EJCA 5LRRA 1W7PA 2XF5A 3F21A 5CVUA 3K1PA 3GF2A 5GTIC 1LE8A 5DUIA 1S7AA 3PO2J 1BC8C 1YW8A 3RKXA 1TNTA 2KFDA
chains in the Genus database with same CATH topology
1XN7A 1PP7U 3V7RA 5FLXZ 4A12A 4M9ZA 1TLHB 4NB5A 2R3SA 4M6XA 3P9KA 1TW3A 3ISPA 2VOOA 4EMSA 3FHZA 4EV0A 2DT5A 3L9FA 1MZBA 4OIOF 2EB7A 2BYVE 1GXPA 2DFIA 2FNPA 1R00A 4BYYA 3OV8A 3COAC 1FBUA 3CO7C 2Q8KA 3KZYA 2G7UA 2DU9A 4MQVA 2XROA 4IVNA 4RB2C 5BPIA 3BROA 1S29A 5A2QZ 4CICA 1HKTA 1BIBA 3RTRA 4EM2A 1JHHA 2X4HA 1MD0A 4UVBA 1DUXC 1XSVA 2Q0OA 3FXUA 2IJLA 2P5LC 1LEBA 1YW9A 4I0AA 2XVCA 5E18F 2FBHA 4I2OA 3NQOA 2GWRA 1AOYA 2ACJA 2CQKA 3M8EA 3F8MA 4AWXB 2NYXA 2VBXA 1YYVA 1YW7A 2Y0MA 3JSPA 4ENKA 5HS7A 1IRGA 4A6EA 4LB5A 1X3UA 4I01A 4RGUA 3GFLA 3CTAA 2VONA 1O3SA 1WKMA 1ZG3A 4OINF 4BHCA 3KLOA 2XIGA 5HS9A 1DDNA 1EV7A 1OMIA 1J75A 4LMYA 1TTYA 3L09A 4HX4A 3KETA 4XSXF 3CLOA 2STWA 3JTGA 2W84A 3NRVA 4PZJA 1XMAA 4ESFA 5D5VB 2MA3A 3V8JA 3RIRA 4E70A 4JK1X 2HQRA 2OBPA 4M74A 2UXXA 3P9CA 2EFOA 4XSZF 4HF2A 2GQQA 2VT3A 5HS8A 3S2WA 2P7CB 2UWMA 2CGPA 3NEUA 1BM9A 2DW4A 2YU3A 3LWFA 2OD5A 3ERED 2DPDA 2Y48A 4IHSA 2D1HA 1HSTA 3KE2A 4GO1A 1WWXA 1U6GA 1XGSA 2Z5UA 4KYWA 4LG0A 2BGCA 3R4KA 1ZLJA 4GGGA 3LA2A 2VBWA 2O3FA 3KP5A 5LRSA 4RB0A 3QP6A 2DQLA 2BBYA 4AIJA 4L5IA 4HA8A 2RKHA 2FBIA 3CUOA 4LLGF 3RPUA 3FMRA 1Z1DA 2GZWA 1PUEE 3QU6A 4GCVA 2V1UA 2PFBA 1FY7A 2STTA 2CO5A 4R79A 4MHGA 3M1EA 4HF1A 2FE3A 4HZFA 2KIUA 1UHMA 5FD6A 1R5HA 3MEXA 4KT5C 1MDMA 4OOIA 2HOEA 3V4GA 3F3XA 1YS7A 5AONA 1ZH5A 1YIOA 2Q2EA 4M9SA 3REOA 1O57A 4UNOA 5HLHA 1J0RA 4NHJA 1UHWA 1KU3A 2ETHA 1BI2A 1ZYRF 3E5XA 2EFWA 4IF4A 2EV0A 2HWVA 5TRDA 1JE8A 1SMYF 3GZ6A 2O0YA 4HQEA 3DKWA 1P4WA 1MJ9A 3PFIA 2GA2A 3T8RA 2OQGA 1IF1A 2AS5F 1QBJA 4IRIA 2E7WA 4G6DA 1BI3A 3TO6A 4L9JA 2QQAA 3MZYA 3O2PE 2XUBA 2VT2A 5FB2A 5CJ9A 4I02A 3WE2A 3D0SA 3ZMTA 2RQPA 3BPXA 3HRUA 3O3KA 4N9HA 3K2ZA 5D8LB 2J5OA 2W25A 3ML6A 5HDKA 3R60A 5JFRA 2LF7A 4HOBA 4IRHA 3WTSC 4ZH4F 2O61A 5IT3A 2RC4A 4LFUA 4FX4A 1BI1A 4B09A 3PQKA 3KEOA 4QWQA 4M72A 1R36A 4ENNA 4O6JA 5FFZA 3MWMA 3I54A 4B8XA 3JAMZ 3M8FA 1USSA 2IW5A 1REPC 4MNUA 2M45A 1E17A 2YPRA 1UFMA 3WU1B 1L0OC 3FZVA 1V4RA 4L0ZB 2IA0A 5H6QA 3ZMZA 2K7LA 1FP2A 2RN7A 3F8FA 2Z9OA 2F5CA 4NQWA 2M30A 4P96A 2HTSA 1T6SA 2HKOA 2RVCA 5F1RA 1W4MA 1QZYA 3VFZA 1A04A 3ZMUA 6PAXA 1ZARA 3T0YA 4HF0A 5E1XA 1XB4A 2JPBA 3L7WA 3ULQB 1BIAA 1F9NA 3I0TA 2ZKZA 4HAMA 1I6XA 1DPUA 4LB6B 4PGHA 4RB3C 2HYGD 3IL2A 2JZYA 1YO5C 3WTXC 1U2WA 5LEKA 1KYWA 1TBXA 4ENJA 2EJRA 5CVJA 3BWGA 3IHUA 3GFMA 1FP1D 5DD8A 2GA1A 5K5QA 2H27A 2A07F 1YS6A 2LDUA 4BHPA 3JAMK 4A5NA 5LLQA 3D5LA 3KZZA 4UVCA 3L00A 2FXAA 2QVOA 2BV6A 2IA2A 2L4AA 1FWZA 3TDZC 4WXDA 3ZMSA 5D5XB 3ABTA 2MD5A 4WCGA 3IKVA 5ERIA 3HSFA 2JRTA 4G9YA 3HOSA 5JVTA 4IXAA 5ILUA 2O8XA 3IC7A 5ICCA 5TJJA 1XD7A 4S04A 3ABUA 5LBQA 3GUDA 3IWFA 5DCMB 3ZP5A 2L3DA 2NRAC 2ZCWA 3JTHA 1BBYA 2V79A 1HQCA 1W5SA 3I59B 2IT0A 4LLNA 1FYMA 1OKRA 1LJ9A 4EJWA 2ZMEA 3JW4A 3WTZA 2XHKA 2OA4A 3R0JA 4RGRA 3IKTA 2HTJA 3BJOA 1XGMA 1CF7A 5DDGA 2H94A 3GWZA 2XAFA 1SD5A 2P5VA 5KVRA 4S05A 4G7ZF 2F2EA 2ADUA 3RDIA 3EUHA 1FC3A 4PGGA 4P9FA 1ONVA 4RS8A 3LA7A 4BHBA 3J80K 2K4JA 4IPAA 4BH9A 1XGNA 3DPLC 4LK1F 1G3SA 2PJPA 5CVVA 1FYKA 2R7FA 1AWCA 4RAZA 3N97A 1T2KA 3H3ZA 1QNTA 2AXLA 1T98A 2ZO4A 5K5RA 1H9TA 4R8HA 3RKWA 1OYWA 4U7DA 3CJNA 2RDPA 1BOAA 4L9TA 1FNNA 2F5FA 2VC0A 2K4BA 4ZYEA 5AIQA 3WGHA 2QLZA 1KU7A 1VTNC 1K7AA 2HR3A 5H20A 2Z33A 4EQQA 3RI4A 4EGYA 1P4XA 3GLXA 5FGMA 2EWNA 5F64A 2P5KA 2A5YB 1CF7B 1KGSA 1SFEA 4UHTA 4HYEA 5D8KB 1P4AA 2DPUA 1E2XA 5L3DA 1HW2A 4CZZA 2XKOA 1KQ0A 4N9IA 2EFNA 3V7CA 1B4AA 2PMUA 3Q9SA 3HSEA 1B9MA 1PP8F 1UCRA 3BJAA 3FM5A 2HDCA 2V6CA 1IXSB 2L4MA 1HBXG 3KP4A 3I71A 4EJTA 4I09A 2JSCA 2NNNA 2EV6A 3I4PA 2YX7A 4PCQA 3W6JB 3GEZA 5CYVA 3T5XA 2OQRA 1ON2A 4MQ9F 2KJCA 4DNCA 4CHUA 4UXNA 1JGSA 3HRSA 4HX8A 1FSEA 2XAGA 4YFXF 1MGTA 4EVIA 1BC7C 1O3TA 3TOBA 2FNAA 1BI0A 4U0VA 3HOTA 3IRRA 1BN5A 3PQJA 2ISZA 2FA5A 1OYYA 1R1VA 2A6EF 1XSXA 5F6FA 4L5JA 3WTWC 3G3ZA 1U5TC 3HYIA 4XBFA 1ZRFA 2M5WA 1RUOA 2PQ8A 2A61A 2WTEA 4HV6A 2DAOA 3RYPA 4RGSA 2QQBA 3WU0A 3LFKA 3CUQB 1BJAA 4Y13A 4HV5A 4OIPF 2PMHA 1IUYA 4A0YA 2ZXJA 4AIKA 1RI7A 2OZ6A 3F22A 1FPQA 2QENA 2GXGA 3BOQA 4IJAA 3KEQA 3HTSB 1KQ8A 5A2QK 4L9VA 3KP7A 4BXUA 4G94A 2F5DA 4ZYGA 4JQFA 1Z6TA 3KLNA 2MH9A 3ELKA 3HIFA 3WTVC 3E6BA 3SQNA 3EYYA 3TQNA 3M7GA 1LDJA 1TNSA 4XRFA 3MZHA 4IHTA 2HYFA 5DCFA 3ROUA 3LSTA 4ESBA 2VBZA 5BOXA 3QPTA 3G73A 1YG2A 5IT9K 2E7XA 3FWEA 1D8JA 2VE9A 1RNLA 2Z3YA 4KMUX 1Z91A 1FX7A 3RPQA 1FT9A 1QO0D 3E6DA 4KDPA 1HW5A 2LNBA 5K1YA 3MQ0A 3K9TA 3P9IA 5L3CA 1JXSA 4M9XA 4MTEA 5LEJA 1O3QA 2ZJ2A 1WRJA 2YR2A 1J59A 3LQRA 4MTDA 1RUNA 2IA1A 1IZ1A 1GHCA 1T38A 1Z05A 2E1CA 1B9NA 5E1ZB 5D4SA 2LSOA 1HSJA 4KFCA 4KN7X 3E3VA 4BAYA 3DP7A 2B0LA 2UZKA 2ESNA 2PI0A 1MDMB 2FEZA 3OOPA 4JBAA 1MJBA 3F72A 1KU2A 2O6GE 2ZMEB 2BEOA 2W24A 1MKMA 3I59A 4CGZA 2KIFA 2IP2A 1HW1A 1ODDA 3K1NA 4WK8F 4ZZLA 3K1MA 3RKYA 1SD7A 1WQ2A 4WXCA 3Q5FA 4ASNA 1QZZA 3KP6A 5ILVA 4G8XA 2K02A 3SZTA 3FM3A 1FBSA 5HLGA 2K27A 2VC1A 5LHGA 3GZ5A 4EGZA 2FMYA 2XASA 5JHUA 3WTTC 4FX0A 1W5TA 1F5TA 4YFNF 3MFKA 3E6MA 1LNWA 3TDUC 2DLLA 3J81Z 2EFPA 3F8NA 4AD9A 3H92A 1DPRA 3B73A 1T0FA 1L3LA 3MAJA 3U1DA 4A2UA 3GXOA 1ZLKA 3HUGA 5HDGA 5BS6A 4PDKA 1IN7A 4FHTA 5HVQC 3SHFA 2CSOA 4GXOA 5BMZA 3GFIA 1ZRDA 2DK8A 3K0LA 4A0ZA 3V7SA 5DD4A 3V8LA 4OU0A 2D45A 3QRFF 2J5PA 4ENMA 3GX4X 3E5UA 2YX4A 2CG4A 3HTUA 3WE3A 2DBBA 1Z6RA 4M73A 3VODA 1U3EM 5H6RA 2KIMA 1G4DA 3W6KB 2ISYA 2EK5A 4Q47A 3ZPLA 4LG0B 4OIRF 3JSOA 3B02A 3BPVA 1F1ZA 2HS5A 3BZ6A 2V1DA 2A68F 1FBQA 2XRNA 4EJOA 3GFJA 4R1HA 2NAZA 3R61A 4G7OF 3MCZA 5HLIA 1O3RA 4RAYA 4P9UA 5CVRA 4KIBA 5EEHA 4L0YB 1FZPB 3VEPA 4DQ2A 2HQNA 3DF8A 1XDSA 1G3WA 2CWEA 4ZYDA 2WC2A 1I1SA 1YQAA 2GXBA 5D5UB 4EM0B 1FOKA 5DEQA 3KCCA 2XAQA 4UVAA 4UUVA 5CLSA 5CVIA 1IN8A 1TW2A 1J7KA 2RNJA 4Q5SF 3WGGA 2CYYA 3DV8A 1K79A 4QLCU 1IW7F 2G9WA 4EJUA 4OMZA 5ILSA 2L01A 3I58A 2FRHA 5HDNA 2O03A 4UV8A 3GW2A 5LHIA 1YLFA 3KP3A 1KA8A 2UXNA 3R6SA 5ICGA 4P55A 3DPTA 1R5GA 3FX3A 2DK5A 4HDVA 2OU2A 3BP8A 4HLXA 4HX7A 1LEAA 2K86A 4EJVA 1B6AA 1SFXA 1OPCA 5E1WA 2IPQX 4M71A 1J9IA 1USTA 3C1DA 4IRGA 2WWYA 2A6HF 2RGVA 1GXQA 2FBKA 2DQRA 2PN6A 2EV5A 3EETA 1D5VA 3WTUC 1O7LA 2TDXA 5E8IA 1QPMA 3HRTA 1EH6A 1V3FA 3FF5A 2V9VA 4CYDA 1SAXA 3GO5A 2D1VA 4RGXA 1WSUA 4BNCA 5J8FA 5BPDA 3ZMVA 3FXRA 5FFXA 1S3JA 2COMA 5JI6A 2JPCA 4TV7A 2H6BA 1IRFA 1LVAA 1LQ1A 1IN4A 4KMFA 5D6EA 4YFKF 3AAFA 2VXZA 2ESHA 5ICEA 1DP7P 5L3EA 2QUFA 1C0WA 2PLYA 3F6OA 5IT9Z 3U2RA 1O7FA 2QQ9A 2XKPA 4MGRA 1D8KA 4A5MA 3DEUA 4Y17A 2M1BA 4L18B 3ZN0A 3SFZA 5FLXK 1TQMA 4ZYHA 2QBYA 2KKOA 5D6FA 4KA4A 1R22A 4KN4X 3VOEA 4WX9A 1R1UA 1XGOA 3FXQA 1SFUA 5LGTA 1ZG1A 5E8GA 4I98B 4HBLA 3K69A 2MC3A 4Q48A 2RV8A 3RYRA 3Q9VA 5K5OA 1H0MA 3WG9A 1ZN2A 1U8RA 4U88A 5EEGA 1R1TA 1RIOH 2VN2A 3CDHA 2IRFG 3CO6C 5LHHA 3LA3A 1W7PD 1IXRC 3SZPA 3I5UA 4U7BA 2JTVA 1I27A 2GIVA 4K2EA 1IXCA 3T1BA 1KYZA 5E20A 1UB9A 2MLKA 1W7PB 1IAWA 2R7DA 2H09A 1OYIA 3EDPA 3ECOA 4KIFA 3L2CA 3EQLF 4GYIA 1Q1HA 3IWZA 3F8CA 2QYOA 4KICA 4OIQF 3C7JA 1SD6A 1Z7UA 5FO5A 4AIHA 3WGIA 3C18A 2ELHA 2NS0A 2L54A 4Z2YA 3J7AO 1ZGAA 2QWWA 2EFQA 1ZG5A 1STZA 3V8KA 1JHFA 4XLNF 2W85A 4RB1A 1H9GA 2BE5F 3F6VA 3TO9A 3SXYA 1FLIA 5LGNA 3ZMDA 3QU3A 3N4MA 2MLGA 2P8TA 5DYMA 1F4KA 2MBFA 1S8NA 3J81K 3FMQA 2ZBKA 1S7OA 4MEYF 2DI3A 2HGCA 3O6BB 4LD5A 1XSDA 1QQIA 1Y0UA 1NHAA 2VE8A 3HSRA 2JT1A 3E6CC 2VODA 1ULYA 4A6DA 1B59A 4CXFA 3IRQA 5DV5A 3U9GA 3F23A 2FQ3A 4ZZDA 4ON0A 1U5TA 2XAHA 4O5VA 1D3YA 4L9NA 1R58A 3RJPA 3ZN1A 3DFGA 3CUQA 4KNYA 3H3UA 1XCVA 3F8BA 1GVJA 2XGXA 2HKXA 1LB2A 3EYIA 2NNYA 3QOPA 2G7HA 4WF2A 4U0WA 2EA4A 3ECHA 4U0YA 4Y15A 2W57A 1G6NA 4BQAA 3KFWX 3LAPA 1SMTA 1WI9A 2OAZA 3R0AA 2M8EA 4H0EA 1R7JA 4A0XA 1P92A 2P7VB 2X0LA 4F7ZA 5L3GA 2P6TA 2QM3A 2QBYB 4AVPA 3QAHA 1P6RA 2A69F 3TOAA 4MEXF 2YSRA 4LGWA 1YTYA 5L3FA 4YIIA 1QGPA 1KU9A 1B1BA 2MH2A 3LAJA 1J5YA 4UV9A 2FF4A 2LF8A 3TKYA 3BDDA 2V1XA 2VBYA 5J8CA 3WTYC 1LDKB 4ESJA 4ETSA 1U5TB 1K78B 1J2XA 2L02A 3I53A 3FMSA 1K78A 5D4RA 4XLPF 1FYLA 2FU4A 1EH8A 2WV0A 2C6YA 3M9AA 1ZGJA 1LDDA 3ZQ7A 5DUKA 2Z99A 1HXDA 1IN5A 2FSWA 2F5EA 2P4WA 1T39A 1ZRCA 2HZTA 1P2FA 4OMYA 3P7NA 3DQVC 2XAJA 2IVMA 4CDGA 5LGUA 3E97A 3C3WA 1XDUA 2GAUA 2LKPA 5ICFA 5HOOA 5D5WB 2OZUA 5DCMA 4EM1A 3GYHX 1FSHA 1G3YA 3HRMA 5L3BA 1S6LA 2M87A 1CGPA 2QZ8A 1SD4A 3QP5A 1MJAA 3E5QA 2P6SA 3KP2A 2E1NA 2VOPA 3QPHA 5JR3A 3HHGA 3DXJF 4P5OA 3I64A 4CO8A 2CFXA 3BJ6A 1ZAOA 3HHHA 4LK0F 4G7HF 4HW0A 2KJBA 4HQMA 1TQIA 2D2WA 1XCBA 4LLLA 3TGNA 5J6XA 4O3MA 1ON1A 4I0BA 1Z9CA 4KUMA 4N0BA 4GYGA 4HLYA 4HDUA 1IN6A 1OR7A 2FOKA 4LJZF 2Y75A 1R23A 1PDNC 5ED4A 3VB2A 1U78A 4WWCA 1EH7A 3BY6A 1I5ZA 1XMKA 1HKQA 5FD5A 2ZNZA 1RZ4A 2KRFA 1G3TA 4WXHA 2DTRA 4YIFA 4KIGA 1KQ9A 4D0PA 2CW0F 3WODF 4YG2F 3LQQA 1YFHA 1ZREA 5BQTA 5KK1A 1K6OA 4I7HA 2H6CA 4G6QA 5E17F 4FT8A 2PEXA 2HEOA 3GVAA 5AIPA 3TO7A 2ZNYA 1ZHFA 3J80Z 2PBIA 2XV4S 4M6YA 2A3SA 2FMLA 4Q4ZF 2ZFWA 1HKSA 2EA2A 3CUQC 2DO7A 2PG4A 1TQPA 2HFHA 3T8TA 1I1GA 5LRRA 1W7PA 3F21A 5CVUA 3K1PA 3GF2A 5DUIA 1S7AA 1BC8C 1YW8A 3RKXA 1TNTA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XN7 A;  1PP7 U;  3V7R A;  5FLX Z;  4A12 A;  4M9Z A;  1TLH B;  4NB5 A;  2R3S A;  4M6X A;  3P9K A;  1TW3 A;  3ISP A;  2VOO A;  4EMS A;  3FHZ A;  4EV0 A;  2DT5 A;  3L9F A;  1MZB A;  4OIO F;  2EB7 A;  2BYV E;  1GXP A;  2DFI A;  2FNP A;  1R00 A;  4BYY A;  3OV8 A;  3COA C;  1FBU A;  3CO7 C;  2Q8K A;  3KZY A;  2G7U A;  2DU9 A;  4MQV A;  2XRO A;  4IVN A;  4RB2 C;  5BPI A;  3BRO A;  1S29 A;  5A2Q Z;  4CIC A;  1HKT A;  1BIB A;  3RTR A;  4EM2 A;  1JHH A;  2X4H A;  1MD0 A;  4UVB A;  1DUX C;  1XSV A;  2Q0O A;  3FXU A;  2IJL A;  2P5L C;  1LEB A;  1YW9 A;  4I0A A;  2XVC A;  5E18 F;  2FBH A;  4I2O A;  3NQO A;  2GWR A;  1AOY A;  2ACJ A;  2CQK A;  3M8E A;  3F8M A;  4AWX B;  2NYX A;  2VBX A;  1YYV A;  1YW7 A;  2Y0M A;  3JSP A;  4ENK A;  5HS7 A;  1IRG A;  4A6E A;  4LB5 A;  1X3U A;  4I01 A;  4RGU A;  3GFL A;  3CTA A;  2VON A;  1O3S A;  1WKM A;  1ZG3 A;  4OIN F;  4BHC A;  3KLO A;  2XIG A;  5HS9 A;  1DDN A;  1EV7 A;  1OMI A;  1J75 A;  4LMY A;  1TTY A;  3L09 A;  4HX4 A;  3KET A;  4XSX F;  3CLO A;  2STW A;  3JTG A;  2W84 A;  3NRV A;  4PZJ A;  1XMA A;  4ESF A;  5D5V B;  2MA3 A;  3V8J A;  3RIR A;  4E70 A;  4JK1 X;  2HQR A;  2OBP A;  4M74 A;  2UXX A;  3P9C A;  2EFO A;  4XSZ F;  4HF2 A;  2GQQ A;  2VT3 A;  5HS8 A;  3S2W A;  2P7C B;  2UWM A;  2CGP A;  3NEU A;  1BM9 A;  2DW4 A;  2YU3 A;  3LWF A;  2OD5 A;  3ERE D;  2DPD A;  2Y48 A;  4IHS A;  2D1H A;  1HST A;  3KE2 A;  4GO1 A;  1WWX A;  1U6G A;  1XGS A;  2Z5U A;  4KYW A;  4LG0 A;  2BGC A;  3R4K A;  1ZLJ A;  4GGG A;  3LA2 A;  2VBW A;  2O3F A;  3KP5 A;  5LRS A;  4RB0 A;  3QP6 A;  2DQL A;  2BBY A;  4AIJ A;  4L5I A;  4HA8 A;  2RKH A;  2FBI A;  3CUO A;  4LLG F;  3RPU A;  3FMR A;  1Z1D A;  2GZW A;  1PUE E;  3QU6 A;  4GCV A;  2V1U A;  2PFB A;  1FY7 A;  2STT A;  2CO5 A;  4R79 A;  4MHG A;  3M1E A;  4HF1 A;  2FE3 A;  4HZF A;  2KIU A;  1UHM A;  5FD6 A;  1R5H A;  3MEX A;  4KT5 C;  1MDM A;  4OOI A;  2HOE A;  3V4G A;  3F3X A;  1YS7 A;  5AON A;  1ZH5 A;  1YIO A;  2Q2E A;  4M9S A;  3REO A;  1O57 A;  4UNO A;  5HLH A;  1J0R A;  4NHJ A;  1UHW A;  1KU3 A;  2ETH A;  1BI2 A;  1ZYR F;  3E5X A;  2EFW A;  4IF4 A;  2EV0 A;  2HWV A;  5TRD A;  1JE8 A;  1SMY F;  3GZ6 A;  2O0Y A;  4HQE A;  3DKW A;  1P4W A;  1MJ9 A;  3PFI A;  2GA2 A;  3T8R A;  2OQG A;  1IF1 A;  2AS5 F;  1QBJ A;  4IRI A;  2E7W A;  4G6D A;  1BI3 A;  3TO6 A;  4L9J A;  2QQA A;  3MZY A;  3O2P E;  2XUB A;  2VT2 A;  5FB2 A;  5CJ9 A;  4I02 A;  3WE2 A;  3D0S A;  3ZMT A;  2RQP A;  3BPX A;  3HRU A;  3O3K A;  4N9H A;  3K2Z A;  5D8L B;  2J5O A;  2W25 A;  3ML6 A;  5HDK A;  3R60 A;  5JFR A;  2LF7 A;  4HOB A;  4IRH A;  3WTS C;  4ZH4 F;  2O61 A;  5IT3 A;  2RC4 A;  4LFU A;  4FX4 A;  1BI1 A;  4B09 A;  3PQK A;  3KEO A;  4QWQ A;  4M72 A;  1R36 A;  4ENN A;  4O6J A;  5FFZ A;  3MWM A;  3I54 A;  4B8X A;  3JAM Z;  3M8F A;  1USS A;  2IW5 A;  1REP C;  4MNU A;  2M45 A;  1E17 A;  2YPR A;  1UFM A;  3WU1 B;  1L0O C;  3FZV A;  1V4R A;  4L0Z B;  2IA0 A;  5H6Q A;  3ZMZ A;  2K7L A;  1FP2 A;  2RN7 A;  3F8F A;  2Z9O A;  2F5C A;  4NQW A;  2M30 A;  4P96 A;  2HTS A;  1T6S A;  2HKO A;  2RVC A;  5F1R A;  1W4M A;  1QZY A;  3VFZ A;  1A04 A;  3ZMU A;  6PAX A;  1ZAR A;  3T0Y A;  4HF0 A;  5E1X A;  1XB4 A;  2JPB A;  3L7W A;  3ULQ B;  1BIA A;  1F9N A;  3I0T A;  2ZKZ A;  4HAM A;  1I6X A;  1DPU A;  4LB6 B;  4PGH A;  4RB3 C;  2HYG D;  3IL2 A;  2JZY A;  1YO5 C;  3WTX C;  1U2W A;  5LEK A;  1KYW A;  1TBX A;  4ENJ A;  2EJR A;  5CVJ A;  3BWG A;  3IHU A;  3GFM A;  1FP1 D;  5DD8 A;  2GA1 A;  5K5Q A;  2H27 A;  2A07 F;  1YS6 A;  2LDU A;  4BHP A;  3JAM K;  4A5N A;  5LLQ A;  3D5L A;  3KZZ A;  4UVC A;  3L00 A;  2FXA A;  2QVO A;  2BV6 A;  2IA2 A;  2L4A A;  1FWZ A;  3TDZ C;  4WXD A;  3ZMS A;  5D5X B;  3ABT A;  2MD5 A;  4WCG A;  3IKV A;  5ERI A;  3HSF A;  2JRT A;  4G9Y A;  3HOS A;  5JVT A;  4IXA A;  5ILU A;  2O8X A;  3IC7 A;  5ICC A;  5TJJ A;  1XD7 A;  4S04 A;  3ABU A;  5LBQ A;  3GUD A;  3IWF A;  5DCM B;  3ZP5 A;  2L3D A;  2NRA C;  2ZCW A;  3JTH A;  1BBY A;  2V79 A;  1HQC A;  1W5S A;  3I59 B;  2IT0 A;  4LLN A;  1FYM A;  1OKR A;  1LJ9 A;  4EJW A;  2ZME A;  3JW4 A;  3WTZ A;  2XHK A;  2OA4 A;  3R0J A;  4RGR A;  3IKT A;  2HTJ A;  3BJO A;  1XGM A;  1CF7 A;  5DDG A;  2H94 A;  3GWZ A;  2XAF A;  1SD5 A;  2P5V A;  5KVR A;  4S05 A;  4G7Z F;  2F2E A;  2ADU A;  3RDI A;  3EUH A;  1FC3 A;  4PGG A;  4P9F A;  1ONV A;  4RS8 A;  3LA7 A;  4BHB A;  3J80 K;  2K4J A;  4IPA A;  4BH9 A;  1XGN A;  3DPL C;  4LK1 F;  1G3S A;  2PJP A;  5CVV A;  1FYK A;  2R7F A;  1AWC A;  4RAZ A;  3N97 A;  1T2K A;  3H3Z A;  1QNT A;  2AXL A;  1T98 A;  2ZO4 A;  5K5R A;  1H9T A;  4R8H A;  3RKW A;  1OYW A;  4U7D A;  3CJN A;  2RDP A;  1BOA A;  4L9T A;  1FNN A;  2F5F A;  2VC0 A;  2K4B A;  4ZYE A;  5AIQ A;  3WGH A;  2QLZ A;  1KU7 A;  1VTN C;  1K7A A;  2HR3 A;  5H20 A;  2Z33 A;  4EQQ A;  3RI4 A;  4EGY A;  1P4X A;  3GLX A;  5FGM A;  2EWN A;  5F64 A;  2P5K A;  2A5Y B;  1CF7 B;  1KGS A;  1SFE A;  4UHT A;  4HYE A;  5D8K B;  1P4A A;  2DPU A;  1E2X A;  5L3D A;  1HW2 A;  4CZZ A;  2XKO A;  1KQ0 A;  4N9I A;  2EFN A;  3V7C A;  1B4A A;  2PMU A;  3Q9S A;  3HSE A;  1B9M A;  1PP8 F;  1UCR A;  3BJA A;  3FM5 A;  2HDC A;  2V6C A;  1IXS B;  2L4M A;  1HBX G;  3KP4 A;  3I71 A;  4EJT A;  4I09 A;  2JSC A;  2NNN A;  2EV6 A;  3I4P A;  2YX7 A;  4PCQ A;  3W6J B;  3GEZ A;  5CYV A;  3T5X A;  2OQR A;  1ON2 A;  4MQ9 F;  2KJC A;  4DNC A;  4CHU A;  4UXN A;  1JGS A;  3HRS A;  4HX8 A;  1FSE A;  2XAG A;  4YFX F;  1MGT A;  4EVI A;  1BC7 C;  1O3T A;  3TOB A;  2FNA A;  1BI0 A;  4U0V A;  3HOT A;  3IRR A;  1BN5 A;  3PQJ A;  2ISZ A;  2FA5 A;  1OYY A;  1R1V A;  2A6E F;  1XSX A;  5F6F A;  4L5J A;  3WTW C;  3G3Z A;  1U5T C;  3HYI A;  4XBF A;  1ZRF A;  2M5W A;  1RUO A;  2PQ8 A;  2A61 A;  2WTE A;  4HV6 A;  2DAO A;  3RYP A;  4RGS A;  2QQB A;  3WU0 A;  3LFK A;  3CUQ B;  1BJA A;  4Y13 A;  4HV5 A;  4OIP F;  2PMH A;  1IUY A;  4A0Y A;  2ZXJ A;  4AIK A;  1RI7 A;  2OZ6 A;  3F22 A;  1FPQ A;  2QEN A;  2GXG A;  3BOQ A;  4IJA A;  3KEQ A;  3HTS B;  1KQ8 A;  5A2Q K;  4L9V A;  3KP7 A;  4BXU A;  4G94 A;  2F5D A;  4ZYG A;  4JQF A;  1Z6T A;  3KLN A;  2MH9 A;  3ELK A;  3HIF A;  3WTV C;  3E6B A;  3SQN A;  3EYY A;  3TQN A;  3M7G A;  1LDJ A;  1TNS A;  4XRF A;  3MZH A;  4IHT A;  2HYF A;  5DCF A;  3ROU A;  3LST A;  4ESB A;  2VBZ A;  5BOX A;  3QPT A;  3G73 A;  1YG2 A;  5IT9 K;  2E7X A;  3FWE A;  1D8J A;  2VE9 A;  1RNL A;  2Z3Y A;  4KMU X;  1Z91 A;  1FX7 A;  3RPQ A;  1FT9 A;  1QO0 D;  3E6D A;  4KDP A;  1HW5 A;  2LNB A;  5K1Y A;  3MQ0 A;  3K9T A;  3P9I A;  5L3C A;  1JXS A;  4M9X A;  4MTE A;  5LEJ A;  1O3Q A;  2ZJ2 A;  1WRJ A;  2YR2 A;  1J59 A;  3LQR A;  4MTD A;  1RUN A;  2IA1 A;  1IZ1 A;  1GHC A;  1T38 A;  1Z05 A;  2E1C A;  1B9N A;  5E1Z B;  5D4S A;  2LSO A;  1HSJ A;  4KFC A;  4KN7 X;  3E3V A;  4BAY A;  3DP7 A;  2B0L A;  2UZK A;  2ESN A;  2PI0 A;  1MDM B;  2FEZ A;  3OOP A;  4JBA A;  1MJB A;  3F72 A;  1KU2 A;  2O6G E;  2ZME B;  2BEO A;  2W24 A;  1MKM A;  3I59 A;  4CGZ A;  2KIF A;  2IP2 A;  1HW1 A;  1ODD A;  3K1N A;  4WK8 F;  4ZZL A;  3K1M A;  3RKY A;  1SD7 A;  1WQ2 A;  4WXC A;  3Q5F A;  4ASN A;  1QZZ A;  3KP6 A;  5ILV A;  4G8X A;  2K02 A;  3SZT A;  3FM3 A;  1FBS A;  5HLG A;  2K27 A;  2VC1 A;  5LHG A;  3GZ5 A;  4EGZ A;  2FMY A;  2XAS A;  5JHU A;  3WTT C;  4FX0 A;  1W5T A;  1F5T A;  4YFN F;  3MFK A;  3E6M A;  1LNW A;  3TDU C;  2DLL A;  3J81 Z;  2EFP A;  3F8N A;  4AD9 A;  3H92 A;  1DPR A;  3B73 A;  1T0F A;  1L3L A;  3MAJ A;  3U1D A;  4A2U A;  3GXO A;  1ZLK A;  3HUG A;  5HDG A;  5BS6 A;  4PDK A;  1IN7 A;  4FHT A;  5HVQ C;  3SHF A;  2CSO A;  4GXO A;  5BMZ A;  3GFI A;  1ZRD A;  2DK8 A;  3K0L A;  4A0Z A;  3V7S A;  5DD4 A;  3V8L A;  4OU0 A;  2D45 A;  3QRF F;  2J5P A;  4ENM A;  3GX4 X;  3E5U A;  2YX4 A;  2CG4 A;  3HTU A;  3WE3 A;  2DBB A;  1Z6R A;  4M73 A;  3VOD A;  1U3E M;  5H6R A;  2KIM A;  1G4D A;  3W6K B;  2ISY A;  2EK5 A;  4Q47 A;  3ZPL A;  4LG0 B;  4OIR F;  3JSO A;  3B02 A;  3BPV A;  1F1Z A;  2HS5 A;  3BZ6 A;  2V1D A;  2A68 F;  1FBQ A;  2XRN A;  4EJO A;  3GFJ A;  4R1H A;  2NAZ A;  3R61 A;  4G7O F;  3MCZ A;  5HLI A;  1O3R A;  4RAY A;  4P9U A;  5CVR A;  4KIB A;  5EEH A;  4L0Y B;  1FZP B;  3VEP A;  4DQ2 A;  2HQN A;  3DF8 A;  1XDS A;  1G3W A;  2CWE A;  4ZYD A;  2WC2 A;  1I1S A;  1YQA A;  2GXB A;  5D5U B;  4EM0 B;  1FOK A;  5DEQ A;  3KCC A;  2XAQ A;  4UVA A;  4UUV A;  5CLS A;  5CVI A;  1IN8 A;  1TW2 A;  1J7K A;  2RNJ A;  4Q5S F;  3WGG A;  2CYY A;  3DV8 A;  1K79 A;  4QLC U;  1IW7 F;  2G9W A;  4EJU A;  4OMZ A;  5ILS A;  2L01 A;  3I58 A;  2FRH A;  5HDN A;  2O03 A;  4UV8 A;  3GW2 A;  5LHI A;  1YLF A;  3KP3 A;  1KA8 A;  2UXN A;  3R6S A;  5ICG A;  4P55 A;  3DPT A;  1R5G A;  3FX3 A;  2DK5 A;  4HDV A;  2OU2 A;  3BP8 A;  4HLX A;  4HX7 A;  1LEA A;  2K86 A;  4EJV A;  1B6A A;  1SFX A;  1OPC A;  5E1W A;  2IPQ X;  4M71 A;  1J9I A;  1UST A;  3C1D A;  4IRG A;  2WWY A;  2A6H F;  2RGV A;  1GXQ A;  2FBK A;  2DQR A;  2PN6 A;  2EV5 A;  3EET A;  1D5V A;  3WTU C;  1O7L A;  2TDX A;  5E8I A;  1QPM A;  3HRT A;  1EH6 A;  1V3F A;  3FF5 A;  2V9V A;  4CYD A;  1SAX A;  3GO5 A;  2D1V A;  4RGX A;  1WSU A;  4BNC A;  5J8F A;  5BPD A;  3ZMV A;  3FXR A;  5FFX A;  1S3J A;  2COM A;  5JI6 A;  2JPC A;  4TV7 A;  2H6B A;  1IRF A;  1LVA A;  1LQ1 A;  1IN4 A;  4KMF A;  5D6E A;  4YFK F;  3AAF A;  2VXZ A;  2ESH A;  5ICE A;  1DP7 P;  5L3E A;  2QUF A;  1C0W A;  2PLY A;  3F6O A;  5IT9 Z;  3U2R A;  1O7F A;  2QQ9 A;  2XKP A;  4MGR A;  1D8K A;  4A5M A;  3DEU A;  4Y17 A;  2M1B A;  4L18 B;  3ZN0 A;  3SFZ A;  5FLX K;  1TQM A;  4ZYH A;  2QBY A;  2KKO A;  5D6F A;  4KA4 A;  1R22 A;  4KN4 X;  3VOE A;  4WX9 A;  1R1U A;  1XGO A;  3FXQ A;  1SFU A;  5LGT A;  1ZG1 A;  5E8G A;  4I98 B;  4HBL A;  3K69 A;  2MC3 A;  4Q48 A;  2RV8 A;  3RYR A;  3Q9V A;  5K5O A;  1H0M A;  3WG9 A;  1ZN2 A;  1U8R A;  4U88 A;  5EEG A;  1R1T A;  1RIO H;  2VN2 A;  3CDH A;  2IRF G;  3CO6 C;  5LHH A;  3LA3 A;  1W7P D;  1IXR C;  3SZP A;  3I5U A;  4U7B A;  2JTV A;  1I27 A;  2GIV A;  4K2E A;  1IXC A;  3T1B A;  1KYZ A;  5E20 A;  1UB9 A;  2MLK A;  1W7P B;  1IAW A;  2R7D A;  2H09 A;  1OYI A;  3EDP A;  3ECO A;  4KIF A;  3L2C A;  3EQL F;  4GYI A;  1Q1H A;  3IWZ A;  3F8C A;  2QYO A;  4KIC A;  4OIQ F;  3C7J A;  1SD6 A;  1Z7U A;  5FO5 A;  4AIH A;  3WGI A;  3C18 A;  2ELH A;  2NS0 A;  2L54 A;  4Z2Y A;  3J7A O;  1ZGA A;  2QWW A;  2EFQ A;  1ZG5 A;  1STZ A;  3V8K A;  1JHF A;  4XLN F;  2W85 A;  4RB1 A;  1H9G A;  2BE5 F;  3F6V A;  3TO9 A;  3SXY A;  1FLI A;  5LGN A;  3ZMD A;  3QU3 A;  3N4M A;  2MLG A;  2P8T A;  5DYM A;  1F4K A;  2MBF A;  1S8N A;  3J81 K;  3FMQ A;  2ZBK A;  1S7O A;  4MEY F;  2DI3 A;  2HGC A;  3O6B B;  4LD5 A;  1XSD A;  1QQI A;  1Y0U A;  1NHA A;  2VE8 A;  3HSR A;  2JT1 A;  3E6C C;  2VOD A;  1ULY A;  4A6D A;  1B59 A;  4CXF A;  3IRQ A;  5DV5 A;  3U9G A;  3F23 A;  2FQ3 A;  4ZZD A;  4ON0 A;  1U5T A;  2XAH A;  4O5V A;  1D3Y A;  4L9N A;  1R58 A;  3RJP A;  3ZN1 A;  3DFG A;  3CUQ A;  4KNY A;  3H3U A;  1XCV A;  3F8B A;  1GVJ A;  2XGX A;  2HKX A;  1LB2 A;  3EYI A;  2NNY A;  3QOP A;  2G7H A;  4WF2 A;  4U0W A;  2EA4 A;  3ECH A;  4U0Y A;  4Y15 A;  2W57 A;  1G6N A;  4BQA A;  3KFW X;  3LAP A;  1SMT A;  1WI9 A;  2OAZ A;  3R0A A;  2M8E A;  4H0E A;  1R7J A;  4A0X A;  1P92 A;  2P7V B;  2X0L A;  4F7Z A;  5L3G A;  2P6T A;  2QM3 A;  2QBY B;  4AVP A;  3QAH A;  1P6R A;  2A69 F;  3TOA A;  4MEX F;  2YSR A;  4LGW A;  1YTY A;  5L3F A;  4YII A;  1QGP A;  1KU9 A;  1B1B A;  2MH2 A;  3LAJ A;  1J5Y A;  4UV9 A;  2FF4 A;  2LF8 A;  3TKY A;  3BDD A;  2V1X A;  2VBY A;  5J8C A;  3WTY C;  1LDK B;  4ESJ A;  4ETS A;  1U5T B;  1K78 B;  1J2X A;  2L02 A;  3I53 A;  3FMS A;  1K78 A;  5D4R A;  4XLP F;  1FYL A;  2FU4 A;  1EH8 A;  2WV0 A;  2C6Y A;  3M9A A;  1ZGJ A;  1LDD A;  3ZQ7 A;  5DUK A;  2Z99 A;  1HXD A;  1IN5 A;  2FSW A;  2F5E A;  2P4W A;  1T39 A;  1ZRC A;  2HZT A;  1P2F A;  4OMY A;  3P7N A;  3DQV C;  2XAJ A;  2IVM A;  4CDG A;  5LGU A;  3E97 A;  3C3W A;  1XDU A;  2GAU A;  2LKP A;  5ICF A;  5HOO A;  5D5W B;  2OZU A;  5DCM A;  4EM1 A;  3GYH X;  1FSH A;  1G3Y A;  3HRM A;  5L3B A;  1S6L A;  2M87 A;  1CGP A;  2QZ8 A;  1SD4 A;  3QP5 A;  1MJA A;  3E5Q A;  2P6S A;  3KP2 A;  2E1N A;  2VOP A;  3QPH A;  5JR3 A;  3HHG A;  3DXJ F;  4P5O A;  3I64 A;  4CO8 A;  2CFX A;  3BJ6 A;  1ZAO A;  3HHH A;  4LK0 F;  4G7H F;  4HW0 A;  2KJB A;  4HQM A;  1TQI A;  2D2W A;  1XCB A;  4LLL A;  3TGN A;  5J6X A;  4O3M A;  1ON1 A;  4I0B A;  1Z9C A;  4KUM A;  4N0B A;  4GYG A;  4HLY A;  4HDU A;  1IN6 A;  1OR7 A;  2FOK A;  4LJZ F;  2Y75 A;  1R23 A;  1PDN C;  5ED4 A;  3VB2 A;  1U78 A;  4WWC A;  1EH7 A;  3BY6 A;  1I5Z A;  1XMK A;  1HKQ A;  5FD5 A;  2ZNZ A;  1RZ4 A;  2KRF A;  1G3T A;  4WXH A;  2DTR A;  4YIF A;  4KIG A;  1KQ9 A;  4D0P A;  2CW0 F;  3WOD F;  4YG2 F;  3LQQ A;  1YFH A;  1ZRE A;  5BQT A;  5KK1 A;  1K6O A;  4I7H A;  2H6C A;  4G6Q A;  5E17 F;  4FT8 A;  2PEX A;  2HEO A;  3GVA A;  5AIP A;  3TO7 A;  2ZNY A;  1ZHF A;  3J80 Z;  2PBI A;  2XV4 S;  4M6Y A;  2A3S A;  2FML A;  4Q4Z F;  2ZFW A;  1HKS A;  2EA2 A;  3CUQ C;  2DO7 A;  2PG4 A;  1TQP A;  2HFH A;  3T8T A;  1I1G A;  5LRR A;  1W7P A;  3F21 A;  5CVU A;  3K1P A;  3GF2 A;  5DUI A;  1S7A A;  1BC8 C;  1YW8 A;  3RKX A;  1TNT A; 
#chains in the Genus database with same CATH topology
 2LOO A;  1XN7 A;  1PP7 U;  1Z3X A;  3V7R A;  5FLX Z;  2L7M P;  4XMY A;  4A12 A;  3S14 J;  1G2H A;  5E3O A;  2DA3 A;  1OLT A;  3FXL A;  5M5Y J;  4M9Z A;  1TLH B;  4NB5 A;  4BXX J;  1IRX A;  2R3S A;  5K7H A;  4M6X A;  1T0F C;  3P5J A;  3P9K A;  4ABZ A;  1TW3 A;  2IBD A;  1AA7 A;  3ISP A;  3K70 C;  4J19 A;  2VOO A;  4EMS A;  1NG6 A;  3FHZ A;  2XDV A;  4EV0 A;  2DT5 A;  3IUO A;  3L9F A;  2VQG A;  1MZB A;  3H3V K;  4JYK A;  3LOC A;  1WZ2 A;  3E1S A;  4XRM A;  4OIO F;  4OAY A;  4DYQ A;  2DMQ A;  3RCO A;  2EB7 A;  2BYV E;  5H2F C;  1GXP A;  2VJI A;  2KP6 A;  1V54 H;  2DFI A;  2FNP A;  1R00 A;  4NDL A;  1ZGW A;  4BYY A;  3OV8 A;  3DTI A;  3PUB A;  1WHU A;  3D1N I;  3COA C;  1FBU A;  5F08 A;  3CO7 C;  2O5R A;  2Q8K A;  3KZY A;  3MKY B;  2G7U A;  5M3M J;  4E7J A;  2DU9 A;  2W48 A;  4MQV A;  1LKX A;  2I5U A;  4IZZ A;  2XRO A;  1VND A;  4IVN A;  4RB2 C;  1MMN A;  3BRO A;  5BPI A;  1SVM A;  1S29 A;  5A2Q Z;  4CIC A;  3CP2 A;  2BXY A;  2DDB A;  1HKT A;  1BIB A;  3RTR A;  4EM2 A;  1JHH A;  2X4H A;  1MD0 A;  4UVB A;  1DUX C;  3FK7 A;  1OCR H;  1XSV A;  3WHB A;  3CME I;  3BR5 A;  2LLK A;  2Q0O A;  3FXU A;  2IJL A;  1T8I A;  2P5L C;  1LEB A;  1N75 A;  2DDA A;  1YW9 A;  4I0A A;  2XVC A;  5E18 F;  1IG7 A;  2FBH A;  4IQ4 A;  4I2O A;  3NQO A;  2GWR A;  1JKO C;  1ZR4 A;  3CCJ I;  4G6T B;  2DN0 A;  1AOY A;  2YUS A;  2ACJ A;  2CQK A;  3M8E A;  4QPQ A;  3F8M A;  4ZTJ A;  3G1M A;  4AWX B;  1FTT A;  2NYX A;  2VBX A;  1YYV A;  1YW7 A;  3OIP A;  3LSG A;  2Y0M A;  3JSP A;  1TZL A;  4ENK A;  5HS7 A;  1IRG A;  4A6E A;  4LB5 A;  2CU7 A;  1X3U A;  2OJE D;  3KYC B;  4I01 A;  4BBS J;  4CZC A;  4RGU A;  1E3H A;  3GFL A;  3OIQ A;  1UG2 A;  3TBI A;  3DEW A;  2EIL H;  3CTA A;  5KAF C;  1F36 A;  2VON A;  1O3S A;  1JUS A;  3QWL A;  2F48 A;  3CMA I;  1WKM A;  1ZG3 A;  2M8G X;  2R5Z B;  1ERD A;  4OIN F;  4BHC A;  2BY3 A;  2VKE A;  4JOM A;  3L2Q A;  3KLO A;  3HEF A;  3OOU A;  3L2V A;  2XIG A;  2DJN A;  5HS9 A;  2CUF A;  2QGU A;  3ERM A;  3OYK A;  2HZD A;  1DDN A;  1EV7 A;  1OMI A;  1J75 A;  3KIO A;  4LMY A;  4AYB N;  1VQO I;  1TTY A;  2BVL A;  3L09 A;  3I4M J;  3IH4 A;  1HDP A;  4HX4 A;  3KET A;  2MAB A;  4PFP A;  4XSX F;  3CLO A;  4UUS A;  2STW A;  3JTG A;  2JVH A;  4HNU A;  2W84 A;  3NRV A;  4PZJ A;  4HSR A;  1XMA A;  3LSI A;  3GLL A;  4ESF A;  4Z6Y A;  5KCM A;  1T95 A;  2MA3 A;  4F92 B;  3V8J A;  5D5V B;  3RIR A;  2X1C A;  4PJM A;  2VPR A;  4M3B A;  5EF6 A;  2IS4 A;  2EIJ H;  4E7K A;  4E70 A;  1GT0 C;  4JK1 X;  1GVD A;  3ZQL A;  2HQR A;  2OBP A;  2X9D A;  2W7N A;  1MMG A;  4BY7 J;  4M74 A;  2UXX A;  3P9C A;  1OQY A;  2EFO A;  4XSZ F;  4H4K C;  2X51 A;  1MSE C;  5K7Z A;  4EAT A;  4HF2 A;  2GQQ A;  2VT3 A;  5HS8 A;  3S2W A;  2P7C B;  2UWM A;  3S3O A;  2W82 A;  2CGP A;  3NEU A;  1BM9 A;  2XGC A;  2L9S A;  5GTH C;  2DW4 A;  2R4G A;  3DKX A;  2YU3 A;  3LWF A;  5FLM J;  2JVG A;  2OD5 A;  3ERE D;  3OYI A;  2DPD A;  2Y48 A;  1VFC A;  4IHS A;  2D1H A;  1HST A;  3KE2 A;  4FE7 A;  4GO1 A;  3FXJ A;  1U6G A;  1WWX A;  1XGS A;  2Z5U A;  3K4N A;  4IHW A;  4KYW A;  3CZ6 A;  1K61 A;  4LG0 A;  3W2V A;  2BGC A;  3LSK A;  3R4K A;  1ZLJ A;  4GGG A;  3LA2 A;  4YEL A;  2VBW A;  4Y33 A;  2O3F A;  3KP5 A;  4BQQ A;  5LRS A;  2LP0 A;  3OS0 A;  4RB0 A;  3QP6 A;  2DQL A;  2BBY A;  3BC8 A;  4AIJ A;  3QOD A;  4YRV A;  4L5I A;  4FAS D;  4GDF A;  4HA8 A;  2E2H J;  3OL3 A;  2RKH A;  2FBI A;  3CUO A;  4LLG F;  3RPU A;  3FMR A;  1Z1D A;  2GZW A;  1PUE E;  1X58 A;  3QU6 A;  4GCV A;  2V1U A;  2XAU A;  2PFB A;  1FY7 A;  2STT A;  5C4J J;  2CO5 A;  3CC7 I;  4R79 A;  1JTY A;  3OYF A;  5GAG J;  1X1B A;  4MHG A;  1HF0 A;  3M1E A;  1YOV B;  1NK2 P;  2FE3 A;  4HZF A;  1NH3 A;  4A3E J;  2V9P A;  2KIU A;  4HF1 A;  1UHM A;  3SYT A;  5M5X J;  3MKZ A;  5FD6 A;  1R5H A;  3MEX A;  1H88 C;  4KT5 C;  2LKS A;  1MDM A;  4OOI A;  2HOE A;  2CQQ A;  3V4G A;  5BNG A;  3F3X A;  1YS7 A;  5AON A;  1EA3 A;  2LK2 A;  1ZH5 A;  3M4O J;  1YIO A;  2Q2E A;  3Q0U A;  4M9S A;  2ID6 A;  4AM3 A;  3REO A;  1O57 A;  1IC8 A;  2VPL A;  2KRH A;  4RLQ A;  4U87 A;  4UNO A;  4Y3O A;  5HLH A;  1J0R A;  3OYB A;  4NHJ A;  3HOZ J;  1UHW A;  1KU3 A;  2FJ1 A;  5J40 A;  2ETH A;  1BI2 A;  1ZYR F;  4V2F A;  2KT0 A;  3E5X A;  2EFW A;  5GP9 A;  4IF4 A;  4DYC A;  2EV0 A;  2P81 A;  2VKH A;  1DP3 A;  2HWV A;  5TRD A;  1JE8 A;  1SMY F;  3GZ6 A;  2NVU B;  1HDD C;  2O0Y A;  2Q1Z B;  3UR3 C;  3SEQ A;  4B43 A;  2DYS H;  3CCU I;  1WJC A;  4HQE A;  3DKW A;  4BE0 A;  2QSF X;  1T08 B;  3CMY A;  1P4W A;  1MJ9 A;  3PFI A;  2GA2 A;  3T8R A;  2JA8 J;  2OQG A;  1IF1 A;  1T33 A;  2AS5 F;  2UV1 A;  1QBJ A;  4IRI A;  2E7W A;  4G6D A;  1BI3 A;  1JJ6 C;  3L2W A;  1Y8R B;  4OWR B;  3TO6 A;  3S1N J;  4A3L J;  4L9J A;  4BE2 A;  2QQA A;  2Y0S A;  3MZY A;  3O2P E;  1JKR C;  2LRE A;  2VT2 A;  3FKJ A;  2XUB A;  4XKB A;  5FB2 A;  5CJ9 A;  4I02 A;  3WE2 A;  3DBL B;  2XC7 A;  5HNH A;  4FCY A;  3D0S A;  3OYN A;  1LVK A;  3HDD A;  3ZMT A;  5IYC J;  4BJ6 C;  2RQP A;  3BPX A;  3HRU A;  3O3K A;  1V5G A;  4N9H A;  2JJ7 A;  3HOV J;  4UUS B;  3K2Z A;  4C3H J;  3ZGK A;  5D8L B;  2J5O A;  2W25 A;  1LUJ B;  3ML6 A;  5HDK A;  2DMP A;  1QVT A;  3PNY A;  3R60 A;  5JFR A;  3NAR A;  3J7Y J;  2LF7 A;  1YI2 I;  4HOB A;  4IRH A;  3FBN B;  3WTS C;  4ZH4 F;  2O61 A;  2YS9 A;  5IT3 A;  4EEF G;  3NWS A;  2RC4 A;  4LFU A;  3A2K A;  4PFO A;  4FX4 A;  2W4S A;  1BI1 A;  3H9G A;  4B09 A;  3PQK A;  3LNQ A;  3OWT A;  2R5Z A;  1Y0N A;  2NVT J;  1ZKG A;  3KEO A;  4QWQ A;  4M72 A;  1R36 A;  1R4M B;  1Y6I A;  1XTA A;  3PUF A;  4ENN A;  2L7K A;  1HC8 A;  4O6J A;  2JN6 A;  2QCO A;  5FFZ A;  3MWM A;  1VI0 A;  2ICW G;  3I54 A;  1RR7 A;  1UAA A;  4NBQ A;  3JRG A;  3DU5 A;  1WJF A;  4B8X A;  1OCO H;  1Z67 A;  4CSW A;  4PK4 A;  1TC3 C;  2Z1D A;  1RRJ A;  3JAM Z;  1WJD A;  3M8F A;  1USS A;  2IW5 A;  1REP C;  4MNU A;  2VKV A;  2I10 A;  2M45 A;  3EPZ A;  3K4J A;  1N77 A;  1E17 A;  4B3A A;  1EKE A;  2YPR A;  3I9V 2;  1UFM A;  3WU1 B;  1L0O C;  5GPA A;  3FZV A;  1V4R A;  2BOL A;  2IA0 A;  4L0Z B;  3TP0 A;  5FRO A;  5H6Q A;  4X1E A;  2KZV A;  3ZMZ A;  4F91 B;  2K7L A;  1FP2 A;  2RN7 A;  3F8F A;  4XR6 A;  2Z9O A;  4N4O B;  2F5C A;  3JCU C;  4NQW A;  2PMZ A;  2M30 A;  3BTC A;  3C2H A;  4P96 A;  2HTS A;  1T6S A;  2HKO A;  2RVC A;  3BG3 A;  5F1R A;  1YRN B;  1W4M A;  1QZY A;  3VFZ A;  3CJQ B;  1GV2 A;  1A04 A;  3ZMU A;  5C44 J;  6PAX A;  1ZAR A;  3T0Y A;  4HF0 A;  4B4C A;  5E1X A;  3DBR B;  3HGY A;  3ZQF A;  1XB4 A;  1AHD P;  2JPB A;  3L7W A;  1PUF A;  4XKW A;  3ULQ B;  3AG1 H;  5FKM A;  3CF2 A;  1BIA A;  1F9N A;  3HOX J;  4DOZ A;  3J7Z I;  3GTG J;  1ETO A;  3I0T A;  2ZKZ A;  4HAM A;  1I6X A;  1DPU A;  2DA5 A;  4LB6 B;  4PGH A;  4RB3 C;  2HYG D;  3IL2 A;  5IOY A;  1B8I B;  2JZY A;  5TGT A;  1YO5 C;  1YJW I;  1YJ9 I;  1I3Q J;  3WTX C;  1U2W A;  3O8H A;  5LEK A;  2DA7 A;  1KYW A;  2E36 A;  1OFC X;  1TBX A;  3G2B A;  4II3 A;  4ENJ A;  2EJR A;  1MMD A;  1LFU P;  1SVO A;  5CVJ A;  2E1M C;  1MMS A;  3BWG A;  3IHU A;  4V19 K;  3GFM A;  1FP1 D;  3FBI B;  5DD8 A;  2JA6 J;  2GA1 A;  5K5Q A;  4LIV A;  3OS1 A;  2A07 F;  2H27 A;  2H1L A;  4XOR A;  2CQN A;  3CCR I;  1YS6 A;  2LY2 A;  2LDU A;  4BHP A;  1MBJ A;  3JAM K;  4A5N A;  3GTO J;  2HOT A;  5LLQ A;  3D5L A;  3KZZ A;  4UVC A;  4E7H A;  2H1K A;  3L00 A;  1JUM A;  2FXA A;  2QVO A;  2BV6 A;  2IA2 A;  2RNG A;  2L4A A;  1FWZ A;  3TDZ C;  1X3W B;  3DTE A;  3HKZ N;  4WXD A;  3ZMS A;  5D5X B;  3PM1 A;  3ABT A;  2MD5 A;  4WCG A;  1LE8 B;  4A3C J;  3IKV A;  5ERI A;  2HI3 A;  3SJM A;  1OR7 C;  2JRT A;  3HSF A;  4PSW A;  4B48 A;  1A31 A;  4G9Y A;  1RPW A;  3HOS A;  5JVT A;  3W2W A;  4IXA A;  5ILU A;  2O8X A;  3IC7 A;  4DBR A;  5ICC A;  3FDY A;  5TJJ A;  1XD7 A;  9ANT A;  3ABU A;  4S04 A;  5LBQ A;  4QIW N;  3GUD A;  3IWF A;  5DCM B;  3ZP5 A;  4UY8 I;  2L3D A;  1P7J A;  2JMW A;  3BR2 A;  2NRA C;  1PJR A;  2ZCW A;  2KL4 A;  3JTH A;  1BBY A;  2V79 A;  2BZT A;  5IY5 H;  1HQC A;  1W5S A;  3I59 B;  5EZG A;  2IT0 A;  4LLN A;  4PJN A;  1FYM A;  1OKR A;  2XGD A;  1LJ9 A;  1IDZ A;  4X0G A;  3CCQ I;  3W6V A;  4EJW A;  3OYM A;  5F0F A;  2ZME A;  2FUG 2;  3IH3 A;  2PJR A;  3JW4 A;  3WTZ A;  4DYR A;  2XHK A;  2OA4 A;  3R0J A;  3O8G A;  4RGR A;  2RRE A;  4JX4 A;  1MBH A;  3IKT A;  2TRT A;  2HTJ A;  3BJO A;  4C2M J;  1XGM A;  1CF7 A;  5DDG A;  4D9J A;  1IJW C;  3A1Y A;  2H94 A;  2M0M A;  2ECB A;  3GWZ A;  2XAF A;  3CCY A;  1SD5 A;  2K3F A;  1PYV A;  3PNT A;  5JLW A;  2CQX A;  2ZXI A;  2P5V A;  2ME0 A;  3VYT B;  5KVR A;  4S05 A;  4G7Z F;  1Z0X A;  2F2E A;  1Y39 A;  1MMA A;  2ADU A;  3RDI A;  3SEZ A;  2BW3 B;  2A5W A;  3I4N J;  2EH3 A;  3EUH A;  1FC3 A;  5HLT A;  4PGG A;  4P9F A;  1ONV A;  2VJ4 A;  4RS8 A;  3LA7 A;  4BHB A;  3J80 K;  2VXD A;  2X48 A;  4NUB A;  4IQJ A;  1G59 A;  3VYU B;  1SVL A;  2XF6 A;  2K4J A;  4IPA A;  2HYJ A;  2GM4 A;  3RZO J;  2F4O B;  4XRS A;  1I50 J;  2VIX A;  1XGN A;  4BH9 A;  4DJA A;  2LFB A;  5FLV A;  2R93 J;  3DPL C;  3CES A;  4LK1 F;  4E7Z A;  5FRN A;  1G3S A;  3RQI A;  2KHM A;  5CKT A;  2CUZ A;  2PJP A;  5CVV A;  1AKH A;  1FYK A;  1VQ8 I;  2R7F A;  5FKK A;  3VSK A;  4XIC A;  3S2D J;  5EGO A;  1AWC A;  5TIS C;  4GFB A;  4RAZ A;  3N97 A;  1Z21 A;  4B44 A;  1T2K A;  1UJ8 A;  3H3Z A;  2M9H A;  2CMP A;  1WH7 A;  5J4V A;  3GTM J;  5K7F A;  3DCF A;  1QNT A;  2AXL A;  4E7L A;  2LY1 A;  3L2R A;  4D1Q A;  1T98 A;  2EIM H;  1QHG A;  2ZO4 A;  4BXF A;  5K5R A;  1H9T A;  1I3A A;  3DKY A;  1YIJ I;  4R8H A;  2K5C A;  1IDY A;  2X6O A;  3RKW A;  1OYW A;  2EBI A;  4U7D A;  3CJN A;  5M5W J;  2RDP A;  4UB8 C;  1JGG A;  5IOZ A;  1BOA A;  1Y56 A;  4HST A;  4L9T A;  3CMM A;  5J3L A;  1FNN A;  2F5F A;  2VC0 A;  2K4B A;  3CJR B;  4ZYE A;  5AIQ A;  3WGH A;  2BHY A;  2QLZ A;  3BQZ A;  3H36 A;  3MN2 A;  1KU7 A;  1VTN C;  3K7A J;  2PMZ N;  1K7A A;  2HR3 A;  3W3C A;  5H20 A;  1SAU A;  2F6C A;  2VUM J;  2Z33 A;  4EQQ A;  4CYC B;  1RES A;  3DTK A;  3UNG C;  3RI4 A;  1TWG J;  3OYA A;  2ECC A;  3VSL A;  4FTH A;  2HVS A;  3FXO A;  3LSJ A;  4EGY A;  1P4X A;  4S0H B;  4KIS A;  1VQ6 I;  3GLX A;  3OY9 A;  4IO9 F;  5FGM A;  2EWN A;  5F64 A;  1D1B A;  2R7U A;  2P5K A;  2A5Y B;  1CF7 B;  2Y30 A;  5KHD A;  2MW8 A;  1KGS A;  1NK3 P;  1SFE A;  2CW8 A;  2Z16 A;  2CFO A;  4UHT A;  1MSF C;  2L7F P;  3CJT B;  3ASO H;  4HYE A;  1VQN I;  3S2H J;  2XPU A;  5D8K B;  1HA8 A;  1P4A A;  4RM2 A;  1QZE A;  5DTD A;  1PUF B;  1YJN I;  4LG3 A;  2DPU A;  1DU6 A;  4F3Q A;  3CC4 I;  3K4C A;  1E2X A;  5L3D A;  1HW2 A;  4CZZ A;  2XKO A;  1KQ0 A;  4N9I A;  4B1R A;  2EFN A;  1VQ4 I;  1F43 A;  3V7C A;  1B4A A;  5B1A H;  2E34 A;  2PMU A;  3Q9S A;  3HSE A;  1B9M A;  1HCR A;  2HOS A;  2B63 J;  1PP8 F;  1Z77 A;  1UCR A;  3AFH A;  3BJA A;  3FM5 A;  2HDC A;  2V6C A;  1UEL B;  1IXS B;  2L4M A;  3BCA A;  2BW3 A;  2DT7 B;  1HBX G;  2CS3 A;  3KP4 A;  2Y31 A;  1X1D A;  2AXT C;  3I71 A;  4EJT A;  4X6A J;  3ZQG A;  4I09 A;  1GV5 A;  1K83 J;  2KIS A;  4BU2 A;  2JSC A;  2NNN A;  3JRE A;  2EV6 A;  3I4P A;  2ME6 A;  1ZEL A;  2YX7 A;  2M4G A;  1X1P A;  1IV8 A;  3VWB A;  4PCQ A;  3W6J B;  3JRF A;  3GEZ A;  1VQ9 I;  3B6C A;  5CYV A;  1MNE A;  2OQR A;  3T5X A;  2XF7 A;  1ON2 A;  4MQ9 F;  2KJC A;  4DNC A;  1RC9 A;  4CHU A;  4XLE A;  5KAI C;  4FE4 A;  4UXN A;  3BTJ A;  1JGS A;  4IL6 C;  2LR8 A;  3HRS A;  4HX8 A;  1FSE A;  5FRM A;  1D0Y A;  4NC6 A;  1XMX A;  2CV0 A;  2XAG A;  3D5R C;  4YFX F;  1MGT A;  4BKX A;  4EVI A;  1BC7 C;  1O3T A;  3TOB A;  2FNA A;  1BI0 A;  3BR6 A;  3QOE A;  1S72 I;  3BZK A;  4U0V A;  3HOT A;  1JKP C;  2NOJ B;  4KIT B;  3LSH A;  3IRR A;  4M3E A;  2DOF A;  1BN5 A;  2VQC A;  3RKQ A;  3M1C A;  3PQJ A;  3A02 A;  5GAE J;  5F0H A;  2ISZ A;  2XRL A;  2FA5 A;  1SFO J;  1ZQ3 P;  1OYY A;  1R1V A;  2A6E F;  1ITY A;  1XSX A;  5F6F A;  4PJ0 C;  4L5J A;  4ZDO A;  3WTW C;  2E2I J;  3G3Z A;  3LFU A;  1U5T C;  1MW7 A;  4A3M J;  3HYI A;  4XBF A;  4UB6 C;  1A6I A;  1ZRF A;  1JUP A;  2X85 A;  2M5W A;  4KT6 A;  1RUO A;  4MO7 A;  2PQ8 A;  2A61 A;  2WTE A;  4HV6 A;  2DAO A;  1BR4 A;  3RYP A;  3CLQ A;  3KX2 A;  1TWF J;  4ZDL A;  1LPQ A;  2ELK A;  1WPK A;  1U0J A;  1N78 A;  2IGN A;  2QQB A;  4RGS A;  2K9N A;  3SDG A;  3WU0 A;  3LFK A;  1NG7 A;  1MIJ A;  3ONQ A;  3OYE A;  2CUJ A;  4FET A;  3CUQ B;  1BJA A;  4Y13 A;  1OCP A;  4HV5 A;  4OIP F;  2PMH A;  3ABL H;  1IUY A;  2CV2 A;  4A0Y A;  2ZXJ A;  1OJL A;  4AIK A;  5IP9 J;  1Y1W J;  4RA2 A;  4XN3 A;  1RI7 A;  2OZ6 A;  1OCZ H;  1FPQ A;  2QEN A;  3F22 A;  2GXG A;  2EZK A;  1FJL A;  2X1E A;  3A4C A;  3BOQ A;  4XN0 A;  3MVP A;  2DFH A;  1VQM I;  1V5F A;  4IJA A;  3KEQ A;  3HTS B;  1KQ8 A;  1HOM A;  2OPT A;  5A2Q K;  4L9V A;  3EUA A;  2WAE A;  3KP7 A;  4BXU A;  3LSR A;  4A3B J;  1EF4 A;  2AO9 A;  4G94 A;  3SDB A;  3K6G A;  1A35 A;  2F5D A;  3ABK H;  4ZYG A;  4JQF A;  1Z6T A;  2BXZ A;  3KLN A;  3PIP F;  2HPM A;  2EIK H;  1W36 D;  3H35 A;  2MH9 A;  3ELK A;  4KJZ A;  3HIF A;  3WTV C;  3E6B A;  4XLF A;  3SQN A;  3UKG A;  4LIT A;  3EYY A;  1O4X A;  5C4X J;  5HOD A;  3TQN A;  3M7G A;  1LDJ A;  1TNS A;  4XRF A;  4P1W A;  3MZH A;  4IHT A;  2HYF A;  2ZB9 A;  5DCF A;  3ROU A;  4DW6 A;  3LST A;  4ESB A;  2VBZ A;  4PJL A;  3HB9 A;  5BOX A;  2XPW A;  2LC2 A;  3A0B C;  3QPT A;  3LSP A;  2DMU A;  2HU9 A;  1YG2 A;  3BR1 A;  3G73 A;  5IT9 K;  2UUZ A;  3S3N A;  2F4M B;  2ZFU A;  4MFE A;  4MFD A;  2E7X A;  3FWE A;  3H5R A;  1D8J A;  2VE9 A;  2M34 A;  1RNL A;  4CCK A;  4Y7N J;  1WJB A;  2Z3Y A;  1D1C A;  4KMU X;  4IHY A;  1Z91 A;  3HG9 A;  2QSH X;  2DOD A;  1YX3 A;  5FKO A;  1FX7 A;  1RET A;  3BG9 A;  1MNM C;  3RPQ A;  2E71 A;  3M07 A;  3ZXS A;  4D5C A;  3AKZ A;  3PJR A;  1FT9 A;  1QO0 D;  3E6D A;  4KDP A;  1HW5 A;  1MBF A;  1QRY A;  3A01 B;  1AKH B;  2VKD A;  1WI3 A;  2L9N A;  2R0Q C;  2LNB A;  1XPX A;  5K1Y A;  3MQ0 A;  3K4M A;  3VYR B;  4B3X A;  3U1K A;  2DMN A;  2MSY A;  3K9T A;  3P9I A;  5L3C A;  1JXS A;  4M9X A;  4MTE A;  5LEJ A;  2JUC A;  4BE1 A;  1O3Q A;  1VQL I;  2ZJ2 A;  2ZJR F;  1WRJ A;  3ABM H;  2YR2 A;  2IS6 A;  5FKN A;  3G71 I;  4E6K G;  1J59 A;  3LQR A;  1YRN A;  4MTD A;  1RUN A;  2IA1 A;  1IZ1 A;  3K10 A;  1GHC A;  1T38 A;  1Z05 A;  4DIQ A;  4AID A;  2QA4 I;  2E1C A;  1B9N A;  1BJZ A;  5E1Z B;  3V42 A;  5D4S A;  2LSO A;  1HSJ A;  5J1Y A;  3OYD A;  1W36 C;  4KFC A;  4KN7 X;  1ETX A;  3E3V A;  4BAY A;  3DP7 A;  5LFA A;  4BDZ A;  2B0L A;  2HDW A;  2UZK A;  2ESN A;  2PI0 A;  2IGO A;  1MDM B;  2R7X A;  3ASN H;  3HBL A;  2FEZ A;  4XQF A;  3OOP A;  4JBA A;  2BY2 A;  2JA7 J;  1MJB A;  3F72 A;  2L0K A;  2XSJ C;  1KU2 A;  2LD5 A;  2O6G E;  5B3S H;  2ZME B;  2M7A A;  2BEO A;  3PO3 J;  2W24 A;  1MKM A;  2QEX I;  3I59 A;  3QPL A;  1K6Y A;  1SFK A;  3TW6 A;  1E3O C;  1TP4 A;  4XLH A;  2LBF B;  4CGZ A;  4G12 A;  2KIF A;  2E2J J;  4HNT A;  2R7Q A;  2IP2 A;  2K9Q A;  1HW1 A;  1ODD A;  3K1N A;  3IAS 2;  4WK8 F;  1BL0 A;  5EGO B;  2ZJP F;  4ZZL A;  3K1M A;  2E1M B;  3I3L A;  3RKY A;  1SD7 A;  1WQ2 A;  5B1B H;  3H1C A;  4WXC A;  3PFY A;  3Q5F A;  2DMT A;  4ASN A;  1QZZ A;  2DA6 A;  3KP6 A;  5ILV A;  4BDY A;  2EQR A;  1U9N A;  4G8X A;  1X4O A;  2K02 A;  4L5E A;  3SZT A;  3FM3 A;  4Y52 J;  3FXM A;  1FBS A;  2ZC2 A;  5HLG A;  2K27 A;  2VC1 A;  5LHG A;  3I55 I;  3GZ5 A;  4EGZ A;  3ZOB A;  3BZC A;  4NQW B;  2FMY A;  1ETV A;  2CH0 A;  2XAS A;  1BW6 A;  5JHU A;  4CUG A;  3WTT C;  1DGR M;  4FX0 A;  1VF9 A;  1W5T A;  3VYS B;  4YFN F;  3OYL A;  1F5T A;  4XRS G;  3MFK A;  3E6M A;  3K4K A;  1LNW A;  2LKX A;  3DEE A;  5B66 C;  3OR2 C;  3TDU C;  2DLL A;  3CCE I;  2HXI A;  4F52 A;  3J81 Z;  2QQ8 A;  2EFP A;  3F8N A;  2CRG A;  2ELJ A;  4AD9 A;  3HC7 A;  3H92 A;  4YEJ A;  2JA2 A;  3OR1 C;  1DQU A;  1FIP A;  3EUH C;  1R71 A;  2R7T A;  1IO2 A;  1DPR A;  3B73 A;  1P7I A;  1T0F A;  2OCC H;  4D7M A;  1L3L A;  3BTL A;  3MAJ A;  3U1D A;  2E5Z A;  4A2U A;  3GXO A;  1X2M A;  2DT6 A;  2X6Y A;  3F9K A;  1ZLK A;  3HUG A;  5HDG A;  3TED A;  5BS6 A;  4PDK A;  3Q0W A;  1IN7 A;  2HOA A;  2IAI A;  2HQA A;  4XM3 A;  4FHT A;  2V4J C;  5HVQ C;  3SHF A;  2CSO A;  4GXO A;  5BMZ A;  3SZG A;  3GFI A;  4B47 A;  1ZRD A;  2DK8 A;  4BJT A;  2N8G A;  2P0W A;  3K0L A;  4A0Z A;  2O7O A;  2M2E A;  3V7S A;  2KLO A;  5DD4 A;  3CCL I;  3V8L A;  4OU0 A;  2D45 A;  4J00 A;  3QRF F;  2J5P A;  2PX9 A;  1T56 A;  4ENM A;  1FMV A;  3GX4 X;  1FMW A;  3IAM 2;  3E5U A;  1VQ7 I;  2YX4 A;  4NC7 A;  2CG4 A;  3HTU A;  4CCL A;  4W1U A;  4BAC A;  3WE3 A;  5EG0 B;  2DBB A;  1A36 A;  1Z6R A;  3LMM A;  4M73 A;  2L2O A;  3VOD A;  1U3E M;  5H6R A;  2KIM A;  1G4D A;  1E0E A;  1X1A A;  5IYD J;  3PIO F;  3W6K B;  2ISY A;  2EK5 A;  4Q47 A;  5JHF A;  3ZPL A;  4LG0 B;  3BG5 A;  4OIR F;  3JSO A;  3B02 A;  3BPV A;  1F1Z A;  2HS5 A;  3BZ6 A;  3WHC A;  3CCS I;  2V1D A;  1G8X A;  3TMO A;  3GZN B;  2A68 F;  1FBQ A;  2XRN A;  1K4T A;  4EJO A;  3Q0V A;  1U9O A;  2HXO A;  2XB0 X;  2Y69 H;  3CDI A;  1W0T A;  3GFJ A;  4R1H A;  1UHS A;  2NAZ A;  3R61 A;  5EG0 A;  4G7O F;  4DBQ A;  3MCZ A;  1ETK A;  2GOX B;  5HLI A;  1B72 B;  4AYB A;  1O3R A;  3K2A A;  4RAY A;  4P9U A;  3LL7 A;  3K4B A;  5CVR A;  3PL8 A;  4KIB A;  5EEH A;  2DFF A;  2E5N A;  1ORK A;  2EZL A;  1FZP B;  4L0Y B;  3NAU A;  3HKZ A;  3S3M A;  3VEP A;  3VPR A;  4DQ2 A;  2DYR H;  2DTZ A;  2HQN A;  3DF8 A;  3OYH A;  4UUT A;  1BR1 A;  1XDS A;  1HLV A;  1G3W A;  2JQ7 A;  5J4Y A;  2BHZ A;  2DOA A;  3D5S C;  2CWE A;  4ZYD A;  1JJ8 C;  2WC2 A;  2BY1 A;  1I1S A;  1YQA A;  2GXB A;  1BOB A;  3BCB A;  5D5U B;  4I76 A;  4EM0 B;  2BY0 A;  1FOK A;  1R4N B;  3CQZ J;  2TCT A;  3HZJ A;  2XGE A;  5DEQ A;  1R9T J;  3KCC A;  2XAQ A;  3HUG B;  1SEU A;  1UZC A;  4UVA A;  4UUV A;  3S17 J;  5CLS A;  5CVI A;  4ZTF A;  3CC2 I;  4QSH A;  2MGQ A;  4RLF A;  2GIZ A;  3X2Q H;  1SAN A;  3HOY J;  2A05 A;  1IN8 A;  1XX5 A;  2JK3 A;  1TW2 A;  2MFZ A;  1J7K A;  2VLA A;  4CCJ A;  2RNJ A;  2OC6 A;  4Q5S F;  2WB1 N;  3WGG A;  2CYY A;  3JRI A;  3DV8 A;  2EIN H;  3F0C A;  1K79 A;  4QLC U;  3GTJ J;  1IW7 F;  1POG A;  1DU0 A;  2NOG A;  1ETY A;  2G9W A;  2RQQ A;  3ESW B;  4A69 C;  5J1U A;  1Z3Y A;  4OMZ A;  5ILS A;  4EJU A;  4HG2 A;  4IOA F;  2LTP A;  2A6T A;  2L01 A;  3HPH A;  1EJ9 A;  3I58 A;  2FRH A;  4MLO A;  4XKC A;  1MH4 A;  5HDN A;  2O03 A;  4ITV A;  2DA1 A;  4UV8 A;  3BQY A;  3GW2 A;  1Z7L A;  4E7S A;  5LHI A;  1YLF A;  3KP3 A;  1KA8 A;  2UXN A;  2L9R A;  3R6S A;  5ICG A;  1LFB A;  4P55 A;  3DPT A;  3H0G J;  3OYG A;  1R5G A;  3FK6 A;  3OIO A;  1QU3 A;  3FX3 A;  1QA6 A;  2NS7 A;  2DK5 A;  4HDV A;  2OU2 A;  2NVX J;  1JT6 A;  2KDO A;  5DM7 F;  4I99 C;  3BP8 A;  2ZXW H;  4HLX A;  1GLN A;  4HX7 A;  1LEA A;  1YE9 A;  2K85 A;  2K86 A;  4EJV A;  1B6A A;  1SFX A;  2V7F A;  3AG3 H;  1PVE A;  1OPC A;  5E1W A;  2IPQ X;  2GXA A;  4M71 A;  1WJA A;  1J9I A;  3JR9 A;  1UST A;  3C1D A;  1TT5 B;  4IRG A;  2WWY A;  4AC0 A;  4BL0 B;  2A6H F;  2RGV A;  4GRI A;  2MG4 A;  4AU7 A;  4MIM A;  1GXQ A;  1K4S A;  2FBK A;  1MH3 A;  2DQR A;  1BR2 A;  2PN6 A;  2EV5 A;  3EET A;  1D5V A;  3WTU C;  3AG4 H;  4FIS A;  3ZQH A;  1O7L A;  2TDX A;  3CCM I;  4II2 A;  1XS9 A;  5B5E C;  5E8I A;  2EZH A;  2RAE A;  3RPU D;  2CJJ A;  2COB A;  2EZI A;  4XLA A;  1B72 A;  1QPM A;  3HRT A;  2XB5 A;  1JI8 A;  1APL C;  1EH6 A;  2VB6 A;  1V3F A;  3FF5 A;  4E7I A;  2V9V A;  4RMN A;  4CYD A;  4M6V A;  3B6A A;  1SAX A;  4A3J J;  3GO5 A;  2QKL B;  2IS2 A;  5GPC A;  2K9S A;  4HPQ A;  2D1V A;  1A6Q A;  4C2U A;  2HQ5 A;  4RGX A;  1WSU A;  4BNC A;  1X4P A;  3Q3S A;  5J8F A;  3BR3 A;  1D0X A;  2E35 A;  5BPD A;  3ZMV A;  1XG1 A;  2IGM A;  3FXR A;  4PJJ A;  5FFX A;  3G6E I;  1S3J A;  4RAF A;  3ZQC A;  1X3Z B;  2DOE A;  1Q1V A;  2COM A;  5JI6 A;  2JPC A;  4TV7 A;  1RKT A;  2L7Z A;  1VZ0 A;  5F04 A;  2V9K A;  2LY9 A;  2H6B A;  1IRF A;  1LVA A;  1LQ1 A;  1IN4 A;  4XOT A;  4KMF A;  1IRZ A;  5D6E A;  4YFK F;  3AAF A;  2VXZ A;  2LBF A;  4BQO A;  1WJE A;  2ESH A;  2ZXH A;  2Y9Z A;  5ICE A;  1DP7 P;  4CCN A;  1X2N A;  5L3E A;  2DCE A;  2QUF A;  1C0W A;  2PLY A;  3F6O A;  5IT9 Z;  1YX5 A;  3U2R A;  1O7F A;  2QQ9 A;  1WGX A;  2XKP A;  3CDL A;  3ZQQ A;  5IP7 J;  1TL8 A;  4MGR A;  1D8K A;  2CW7 A;  2ZJQ F;  4A5M A;  2KZG A;  3DEU A;  3C2G A;  1ACI A;  5J47 A;  4Y17 A;  2M1B A;  4IHV A;  5FKL A;  1FOY A;  2E1O A;  4L18 B;  4V2G A;  2QSG X;  3ZN0 A;  3SFZ A;  5FLX K;  5DS9 A;  3S1R J;  4PSX A;  1TWA J;  3GBG A;  1TQM A;  4ZYH A;  4FQG A;  4BS9 A;  2QBY A;  4RBO A;  1I39 A;  4NC8 A;  3IP4 B;  2KKO A;  5D6F A;  2QKM B;  2HDD A;  2O8K A;  4KA4 A;  1FEX A;  3BT9 A;  2JA5 J;  2KDZ A;  1R22 A;  4KN4 X;  4YIR X;  3VOE A;  2ZSH B;  3A01 A;  4WX9 A;  1IV6 A;  3NWT A;  1H89 C;  1R1U A;  1XGO A;  4XNF A;  3GTL J;  3JRH A;  3FXQ A;  3HM5 A;  5LGT A;  1ZG1 A;  1SFU A;  5E8G A;  2IXS A;  2VJ5 A;  4I98 B;  4HBL A;  3S8P A;  2W1O A;  2MC3 A;  3K69 A;  4Q48 A;  1NTC A;  2VQH A;  1P9Q C;  2RV8 A;  5F1J A;  3RYR A;  3Q9V A;  3HPG A;  5K5O A;  1H0M A;  3WG9 A;  2YU9 J;  1ZN2 A;  1U8R A;  4U88 A;  1QPI A;  5EEG A;  4XOP A;  3LSM A;  1D0Z A;  1R1T A;  1RIO H;  2VN2 A;  3CDH A;  4F55 A;  2IRF G;  2JUG A;  3CO6 C;  4CYC A;  5LHH A;  3K70 D;  4JX5 A;  3LA3 A;  1R5I D;  1W7P D;  4QTR A;  3HGG A;  1IXR C;  3FXK A;  4D5F A;  1U8B A;  2R7V A;  1ZR2 A;  2WAF A;  1WVR A;  3SZP A;  3I5U A;  4U7B A;  4I6Z A;  1ETQ A;  3A0H C;  2JTV A;  1I27 A;  2GIV A;  4K2E A;  1V5E A;  1IXC A;  1S5L C;  3T1B A;  1KYZ A;  3CF5 F;  2OF7 A;  5E20 A;  1UB9 A;  2NXN B;  2MLK A;  2O9L A;  1W7P B;  1IAW A;  1V55 H;  3H9J A;  1S9H A;  2R7D A;  2AQF A;  2H09 A;  3G1O A;  1OYI A;  3EDP A;  1YIT I;  1UMQ A;  2LVS A;  3ECO A;  2W00 A;  3VDX A;  3ZR8 X;  4KIF A;  1I6H J;  2K40 A;  3EQL F;  3L2C A;  4GYI A;  1Q1H A;  3IWZ A;  3F8C A;  3SFI A;  2QYO A;  2NS8 A;  4KIC A;  1A5J A;  3GTP J;  1D1A A;  1KZH A;  4OIQ F;  2Y2Z A;  3C7J A;  1JTX A;  5HNF A;  1SD6 A;  1Z7U A;  3JRD A;  5FO5 A;  1RR8 C;  4AIH A;  2E19 A;  5E3N A;  4HRI A;  3WGI A;  2V26 A;  3C18 A;  2ELH A;  2NS0 A;  3A03 A;  2L54 A;  5E79 C;  3DLA A;  2I8D A;  4Z2Y A;  2NVQ J;  3J7A O;  1ZGA A;  2QWW A;  2XSD C;  2LRD A;  2EFQ A;  1ZG5 A;  3IV5 A;  1STZ A;  2IGK A;  4RDU A;  4RM3 A;  4JP0 A;  3V8K A;  3HJE A;  1JHF A;  4XLN F;  2WAQ N;  3OYJ A;  2W85 A;  2ZSI B;  4RB1 A;  2B9S A;  5JVG F;  1WJ5 A;  3KEY A;  3KZI C;  1H9G A;  2BE5 F;  3F6V A;  3TO9 A;  3SXY A;  1FLI A;  5LGN A;  3ZMD A;  2WY7 Q;  5EDN A;  3J7A Y;  2VL8 A;  3QU3 A;  4PUS A;  3N4M A;  3HXL A;  2MLG A;  2P8T A;  2KRC A;  5DYM A;  1F4K A;  1KON A;  2G0E A;  2MBF A;  1DGW Y;  1QHH D;  1S8N A;  3GME A;  3J81 K;  3FMQ A;  2ZBK A;  3AL0 B;  1S7O A;  3MKL A;  2OTL I;  4MEY F;  2DI3 A;  1JT0 A;  2HGC A;  5JLX A;  3O6B B;  3S93 A;  4LD5 A;  1M1E B;  1XSD A;  1QQI A;  2ZME C;  1Y0U A;  2QF7 A;  2CQ7 A;  2WV1 A;  1FTZ A;  4BEH B;  3N05 A;  1NHA A;  2VE8 A;  1ZTR A;  3HSR A;  2DFE A;  2JT1 A;  3E6C C;  4IX7 A;  4M3D A;  3S16 J;  3CP8 A;  2VOD A;  1ULY A;  4A6D A;  2MD0 A;  1B59 A;  2X6X A;  4CXF A;  3G1L A;  1N25 A;  3IRQ A;  2MC4 A;  5DV5 A;  1TWH J;  1S7E A;  4IEJ A;  3JRA A;  3U9G A;  4ZDP A;  3F23 A;  2FQ3 A;  4ZZD A;  1AU7 A;  2M4K A;  4ON0 A;  4DZP A;  1U5T A;  1FOW A;  1FOX A;  2XAH A;  4O5V A;  2OUM A;  4ANJ A;  3E0J B;  2BVM A;  1D3Y A;  4L9N A;  4CCM A;  1R58 A;  3RJP A;  3ZN1 A;  3DFG A;  1JKQ C;  3IH2 A;  3ZCO A;  2WAQ A;  4BBR J;  1MBE A;  2EPF A;  3CUQ A;  4KNY A;  3TW7 A;  4IKF A;  3H3U A;  2ID3 A;  2R7Z J;  1XCV A;  3F8B A;  2L5Q A;  4D7N A;  1GVJ A;  2XGX A;  2HKX A;  4CCO A;  1VQP I;  1LB2 A;  2K3P A;  1VQK I;  3EYI A;  2NNY A;  3M8J A;  4IHX A;  1LFP A;  4E4H A;  2GBY A;  3MMY B;  3QOP A;  2G7H A;  4BUP A;  2AQE A;  2KQR A;  1OIS A;  2JSP A;  4WF2 A;  3RQ4 A;  4U0W A;  2EA4 A;  3ECH A;  4U0Y A;  4A3F J;  5IYB J;  4AUX A;  3DBH B;  3S1M J;  5DM6 F;  4C30 A;  4BEH A;  4NNJ A;  4Y15 A;  2W57 A;  2OTJ I;  1G6N A;  1ETW A;  3KFW X;  3U21 A;  3LAP A;  4BQA A;  4C2T A;  1SMT A;  1WI9 A;  2OAZ A;  2PJR B;  3R0A A;  5J1R A;  2M8E A;  5E3M A;  4XID A;  4H0E A;  1R7J A;  4A0X A;  1P92 A;  3H5A A;  2IEK A;  1VQ5 I;  2P7V B;  2X0L A;  4F7Z A;  1TT0 A;  4HEA 2;  5L3G A;  2P6T A;  2QM3 A;  2QBY B;  3FHN A;  3TL4 X;  1OCT C;  4AVP A;  2FQ4 A;  3QAH A;  2R7S A;  1P6R A;  2A69 F;  3TOA A;  5LD2 C;  3TP3 A;  1ZK8 A;  4MEX F;  2YSR A;  2F4I A;  2WAD A;  4LGW A;  2Y9Y A;  1YTY A;  2VI6 A;  1WCM J;  3RSN A;  3BLY A;  3DPU A;  5L3F A;  4YII A;  1QGP A;  1KU9 A;  3OSG A;  2WB1 A;  2HVR A;  1BW5 A;  1B1B A;  1CQT A;  2MH2 A;  3LAJ A;  2AHQ A;  1J5Y A;  1MBK A;  4UV9 A;  2FF4 A;  3DU6 A;  2LF8 A;  1D5Y A;  1WFX A;  5EZH A;  2R5Y A;  1W1W E;  4ZYA A;  3H0D A;  3TKY A;  3BDD A;  3FIW A;  3BTI A;  3FIS A;  2K9L A;  2V1X A;  3E7L A;  1SC7 A;  2VBY A;  2LG4 A;  5J8C A;  2M7B A;  1IGN A;  3ZQI A;  3WTY C;  1LDK B;  4ESJ A;  4ETS A;  1U5T B;  4C3I J;  1K78 B;  1J2X A;  2L02 A;  3I53 A;  3W2A A;  2WBM A;  3PNV A;  3FMS A;  1ENH A;  4Y4R A;  1K78 A;  5D4R A;  4HNV A;  2R7W A;  2R7R A;  5M3F J;  4XLP F;  2OV7 A;  1FYL A;  2FU4 A;  1UG0 A;  1EH8 A;  2WV0 A;  3AG2 H;  2VQL A;  4XKV A;  2C6Y A;  3QYB A;  1R49 A;  5EYR A;  2H8R A;  2KMU A;  5GAD J;  3KYD B;  2WY8 Q;  2VJJ A;  2V1N A;  3M9A A;  3DWL E;  1WH5 A;  3L1P A;  4A3D J;  1ZGJ A;  2IS1 A;  1MBG A;  2R92 J;  1B8I A;  2LYC A;  1LDD A;  4XK4 A;  3OYC A;  1YHQ I;  3ZQ7 A;  2B7E A;  1GDT A;  5DUK A;  2L9V A;  3JRB A;  2XPV A;  2Z99 A;  1HXD A;  3WG7 H;  2DXI A;  3K4L A;  3DLL F;  1IN5 A;  2FSW A;  2VAS A;  3GTK J;  1QVU A;  2F5E A;  2P4W A;  3GCM A;  1T39 A;  1ZRC A;  5GAH J;  4DZJ A;  3BR0 A;  2HZT A;  1P2F A;  3OS2 A;  4OMY A;  3P7N A;  4M3G A;  2HPI A;  4CA0 A;  2FX0 A;  1H8A C;  5FJ8 J;  3DQV C;  1XC5 A;  1FIA A;  2XAJ A;  2MYS A;  4C9Y A;  1RKW A;  3KPH A;  2IVM A;  4XLC A;  2LMD A;  4CDG A;  5LGU A;  2DA2 A;  4OAZ A;  3E97 A;  3FKI J;  4JX6 A;  3CD6 I;  2DA4 A;  3C3W A;  2X6W A;  1XDU A;  3QYF A;  3ZRG A;  3G4S I;  2LH9 A;  5F0C A;  1GUU A;  2GAU A;  2M0C A;  2LKP A;  5ICF A;  2GOM A;  1IUF A;  5HOO A;  2CUE A;  4ZJZ A;  2Y0S N;  5D5W B;  2OZU A;  5DCM A;  4EM1 A;  3HOU J;  2F5V A;  3I56 I;  3GYH X;  1FSH A;  1G3Y A;  3HRM A;  4A3G J;  4F93 B;  5L3B A;  2JWT A;  4A93 J;  3HL2 A;  3QPS A;  5IPA A;  1S6L A;  2M87 A;  1CGP A;  2QZ8 A;  1SD4 A;  3BG6 A;  3QP5 A;  1MJA A;  3E5Q A;  2P6S A;  3KP2 A;  4XL9 A;  1Y1V J;  2E1N A;  2VOP A;  1TWC J;  4A3K J;  3QPH A;  5JR3 A;  4J01 A;  2FD5 A;  2Q2E B;  2X1D A;  3EUK L;  3DXJ F;  2JRM A;  2OCE A;  3HHG A;  1J09 A;  4P5O A;  1MND A;  2K9M A;  2E60 A;  3AL0 C;  3S32 A;  3I64 A;  4CO8 A;  3WU2 C;  3GTQ J;  2R5Y B;  5KNL A;  2CFX A;  3BJ6 A;  1ZAO A;  5F27 A;  3JRC A;  3HHH A;  2HNH A;  3C2B A;  4LK0 F;  2H8W A;  4G7H F;  4HW0 A;  2KJB A;  3L2U A;  4HQM A;  1TQI A;  2D2W A;  5CPR B;  1XCB A;  4CH7 A;  3CCV I;  4DGW B;  4LLL A;  3TGN A;  3QQA A;  4LOC A;  5J6X A;  4O3M A;  5CQG A;  1ON1 A;  4I0B A;  3S1Q J;  1Z9C A;  4AVZ A;  4KUM A;  4N0B A;  1X1C A;  4GYG A;  2KPM A;  4HLY A;  2HVQ A;  5C3E J;  2GLO A;  3KYL A;  4ZC3 A;  2NVY J;  4HDU A;  1IN6 A;  2CV1 A;  2KIQ A;  1OR7 A;  3H9Q A;  2FOK A;  3OL4 A;  2D5V A;  4LJZ F;  4BQN A;  2Y75 A;  1R23 A;  4LIU A;  1PDN C;  5ED4 A;  1Y8Q B;  3VB2 A;  3MKW B;  4QPO A;  1U78 A;  4WWC A;  1EH7 A;  3BY6 A;  1I5Z A;  1XMK A;  4IOC F;  2DJI A;  2FOW A;  1HKQ A;  1OCC H;  5E3L A;  2M3A A;  5FD5 A;  2ZNZ A;  4BJ5 C;  3OMY A;  4XON A;  1RZ4 A;  2KRF A;  1G3T A;  4WXH A;  2DTR A;  2Z2S B;  1E3P A;  4YIF A;  2R7O A;  4KIG A;  1KQ9 A;  3QYE A;  3PSF A;  5IP6 A;  4W97 A;  3HOW J;  4D0P A;  2CW0 F;  4RAG A;  3WOD F;  4YG2 F;  2WA0 A;  3LQQ A;  4N4N B;  1YFH A;  1ZRE A;  3PSI A;  1W5C C;  3RZD J;  5BQT A;  4A3I J;  1BA5 A;  5KK1 A;  1K6O A;  4I7H A;  2H6C A;  4G6Q A;  5E17 F;  4FT8 A;  2PEX A;  2HEO A;  3GVA A;  5AIP A;  3TO7 A;  3MZ8 A;  2ZNY A;  3BG7 A;  1ZHF A;  4M3F A;  3M3Y J;  3J80 Z;  2PBI A;  2XV4 S;  3OSF A;  4M6Y A;  2A3S A;  2FML A;  4BY1 J;  4BGD A;  4Q4Z F;  5CQE A;  2ZFW A;  1HKS A;  2EA2 A;  4C3J J;  1R6R A;  1X19 A;  3CUQ C;  2DO7 A;  3S15 J;  3MD2 A;  2V6E A;  2PG4 A;  1TQP A;  2HFH A;  3H5N A;  3T8T A;  1I1G A;  1W0U A;  5EEA A;  5EJC A;  5LRR A;  1W7P A;  2XF5 A;  3F21 A;  5CVU A;  3K1P A;  3GF2 A;  5GTI C;  1LE8 A;  5DUI A;  1S7A A;  3PO2 J;  1BC8 C;  1YW8 A;  3RKX A;  1TNT A;  2KFD A; 
#chains in the Genus database with same CATH homology
 1XN7 A;  1PP7 U;  3V7R A;  5FLX Z;  4A12 A;  4M9Z A;  1TLH B;  4NB5 A;  2R3S A;  4M6X A;  3P9K A;  1TW3 A;  3ISP A;  2VOO A;  4EMS A;  3FHZ A;  4EV0 A;  2DT5 A;  3L9F A;  1MZB A;  4OIO F;  2EB7 A;  2BYV E;  1GXP A;  2DFI A;  2FNP A;  1R00 A;  4BYY A;  3OV8 A;  3COA C;  1FBU A;  3CO7 C;  2Q8K A;  3KZY A;  2G7U A;  2DU9 A;  4MQV A;  2XRO A;  4IVN A;  4RB2 C;  5BPI A;  3BRO A;  1S29 A;  5A2Q Z;  4CIC A;  1HKT A;  1BIB A;  3RTR A;  4EM2 A;  1JHH A;  2X4H A;  1MD0 A;  4UVB A;  1DUX C;  1XSV A;  2Q0O A;  3FXU A;  2IJL A;  2P5L C;  1LEB A;  1YW9 A;  4I0A A;  2XVC A;  5E18 F;  2FBH A;  4I2O A;  3NQO A;  2GWR A;  1AOY A;  2ACJ A;  2CQK A;  3M8E A;  3F8M A;  4AWX B;  2NYX A;  2VBX A;  1YYV A;  1YW7 A;  2Y0M A;  3JSP A;  4ENK A;  5HS7 A;  1IRG A;  4A6E A;  4LB5 A;  1X3U A;  4I01 A;  4RGU A;  3GFL A;  3CTA A;  2VON A;  1O3S A;  1WKM A;  1ZG3 A;  4OIN F;  4BHC A;  3KLO A;  2XIG A;  5HS9 A;  1DDN A;  1EV7 A;  1OMI A;  1J75 A;  4LMY A;  1TTY A;  3L09 A;  4HX4 A;  3KET A;  4XSX F;  3CLO A;  2STW A;  3JTG A;  2W84 A;  3NRV A;  4PZJ A;  1XMA A;  4ESF A;  5D5V B;  2MA3 A;  3V8J A;  3RIR A;  4E70 A;  4JK1 X;  2HQR A;  2OBP A;  4M74 A;  2UXX A;  3P9C A;  2EFO A;  4XSZ F;  4HF2 A;  2GQQ A;  2VT3 A;  5HS8 A;  3S2W A;  2P7C B;  2UWM A;  2CGP A;  3NEU A;  1BM9 A;  2DW4 A;  2YU3 A;  3LWF A;  2OD5 A;  3ERE D;  2DPD A;  2Y48 A;  4IHS A;  2D1H A;  1HST A;  3KE2 A;  4GO1 A;  1WWX A;  1U6G A;  1XGS A;  2Z5U A;  4KYW A;  4LG0 A;  2BGC A;  3R4K A;  1ZLJ A;  4GGG A;  3LA2 A;  2VBW A;  2O3F A;  3KP5 A;  5LRS A;  4RB0 A;  3QP6 A;  2DQL A;  2BBY A;  4AIJ A;  4L5I A;  4HA8 A;  2RKH A;  2FBI A;  3CUO A;  4LLG F;  3RPU A;  3FMR A;  1Z1D A;  2GZW A;  1PUE E;  3QU6 A;  4GCV A;  2V1U A;  2PFB A;  1FY7 A;  2STT A;  2CO5 A;  4R79 A;  4MHG A;  3M1E A;  4HF1 A;  2FE3 A;  4HZF A;  2KIU A;  1UHM A;  5FD6 A;  1R5H A;  3MEX A;  4KT5 C;  1MDM A;  4OOI A;  2HOE A;  3V4G A;  3F3X A;  1YS7 A;  5AON A;  1ZH5 A;  1YIO A;  2Q2E A;  4M9S A;  3REO A;  1O57 A;  4UNO A;  5HLH A;  1J0R A;  4NHJ A;  1UHW A;  1KU3 A;  2ETH A;  1BI2 A;  1ZYR F;  3E5X A;  2EFW A;  4IF4 A;  2EV0 A;  2HWV A;  5TRD A;  1JE8 A;  1SMY F;  3GZ6 A;  2O0Y A;  4HQE A;  3DKW A;  1P4W A;  1MJ9 A;  3PFI A;  2GA2 A;  3T8R A;  2OQG A;  1IF1 A;  2AS5 F;  1QBJ A;  4IRI A;  2E7W A;  4G6D A;  1BI3 A;  3TO6 A;  4L9J A;  2QQA A;  3MZY A;  3O2P E;  2XUB A;  2VT2 A;  5FB2 A;  5CJ9 A;  4I02 A;  3WE2 A;  3D0S A;  3ZMT A;  2RQP A;  3BPX A;  3HRU A;  3O3K A;  4N9H A;  3K2Z A;  5D8L B;  2J5O A;  2W25 A;  3ML6 A;  5HDK A;  3R60 A;  5JFR A;  2LF7 A;  4HOB A;  4IRH A;  3WTS C;  4ZH4 F;  2O61 A;  5IT3 A;  2RC4 A;  4LFU A;  4FX4 A;  1BI1 A;  4B09 A;  3PQK A;  3KEO A;  4QWQ A;  4M72 A;  1R36 A;  4ENN A;  4O6J A;  5FFZ A;  3MWM A;  3I54 A;  4B8X A;  3JAM Z;  3M8F A;  1USS A;  2IW5 A;  1REP C;  4MNU A;  2M45 A;  1E17 A;  2YPR A;  1UFM A;  3WU1 B;  1L0O C;  3FZV A;  1V4R A;  4L0Z B;  2IA0 A;  5H6Q A;  3ZMZ A;  2K7L A;  1FP2 A;  2RN7 A;  3F8F A;  2Z9O A;  2F5C A;  4NQW A;  2M30 A;  4P96 A;  2HTS A;  1T6S A;  2HKO A;  2RVC A;  5F1R A;  1W4M A;  1QZY A;  3VFZ A;  1A04 A;  3ZMU A;  6PAX A;  1ZAR A;  3T0Y A;  4HF0 A;  5E1X A;  1XB4 A;  2JPB A;  3L7W A;  3ULQ B;  1BIA A;  1F9N A;  3I0T A;  2ZKZ A;  4HAM A;  1I6X A;  1DPU A;  4LB6 B;  4PGH A;  4RB3 C;  2HYG D;  3IL2 A;  2JZY A;  1YO5 C;  3WTX C;  1U2W A;  5LEK A;  1KYW A;  1TBX A;  4ENJ A;  2EJR A;  5CVJ A;  3BWG A;  3IHU A;  3GFM A;  1FP1 D;  5DD8 A;  2GA1 A;  5K5Q A;  2H27 A;  2A07 F;  1YS6 A;  2LDU A;  4BHP A;  3JAM K;  4A5N A;  5LLQ A;  3D5L A;  3KZZ A;  4UVC A;  3L00 A;  2FXA A;  2QVO A;  2BV6 A;  2IA2 A;  2L4A A;  1FWZ A;  3TDZ C;  4WXD A;  3ZMS A;  5D5X B;  3ABT A;  2MD5 A;  4WCG A;  3IKV A;  5ERI A;  3HSF A;  2JRT A;  4G9Y A;  3HOS A;  5JVT A;  4IXA A;  5ILU A;  2O8X A;  3IC7 A;  5ICC A;  5TJJ A;  1XD7 A;  4S04 A;  3ABU A;  5LBQ A;  3GUD A;  3IWF A;  5DCM B;  3ZP5 A;  2L3D A;  2NRA C;  2ZCW A;  3JTH A;  1BBY A;  2V79 A;  1HQC A;  1W5S A;  3I59 B;  2IT0 A;  4LLN A;  1FYM A;  1OKR A;  1LJ9 A;  4EJW A;  2ZME A;  3JW4 A;  3WTZ A;  2XHK A;  2OA4 A;  3R0J A;  4RGR A;  3IKT A;  2HTJ A;  3BJO A;  1XGM A;  1CF7 A;  5DDG A;  2H94 A;  3GWZ A;  2XAF A;  1SD5 A;  2P5V A;  5KVR A;  4S05 A;  4G7Z F;  2F2E A;  2ADU A;  3RDI A;  3EUH A;  1FC3 A;  4PGG A;  4P9F A;  1ONV A;  4RS8 A;  3LA7 A;  4BHB A;  3J80 K;  2K4J A;  4IPA A;  4BH9 A;  1XGN A;  3DPL C;  4LK1 F;  1G3S A;  2PJP A;  5CVV A;  1FYK A;  2R7F A;  1AWC A;  4RAZ A;  3N97 A;  1T2K A;  3H3Z A;  1QNT A;  2AXL A;  1T98 A;  2ZO4 A;  5K5R A;  1H9T A;  4R8H A;  3RKW A;  1OYW A;  4U7D A;  3CJN A;  2RDP A;  1BOA A;  4L9T A;  1FNN A;  2F5F A;  2VC0 A;  2K4B A;  4ZYE A;  5AIQ A;  3WGH A;  2QLZ A;  1KU7 A;  1VTN C;  1K7A A;  2HR3 A;  5H20 A;  2Z33 A;  4EQQ A;  3RI4 A;  4EGY A;  1P4X A;  3GLX A;  5FGM A;  2EWN A;  5F64 A;  2P5K A;  2A5Y B;  1CF7 B;  1KGS A;  1SFE A;  4UHT A;  4HYE A;  5D8K B;  1P4A A;  2DPU A;  1E2X A;  5L3D A;  1HW2 A;  4CZZ A;  2XKO A;  1KQ0 A;  4N9I A;  2EFN A;  3V7C A;  1B4A A;  2PMU A;  3Q9S A;  3HSE A;  1B9M A;  1PP8 F;  1UCR A;  3BJA A;  3FM5 A;  2HDC A;  2V6C A;  1IXS B;  2L4M A;  1HBX G;  3KP4 A;  3I71 A;  4EJT A;  4I09 A;  2JSC A;  2NNN A;  2EV6 A;  3I4P A;  2YX7 A;  4PCQ A;  3W6J B;  3GEZ A;  5CYV A;  3T5X A;  2OQR A;  1ON2 A;  4MQ9 F;  2KJC A;  4DNC A;  4CHU A;  4UXN A;  1JGS A;  3HRS A;  4HX8 A;  1FSE A;  2XAG A;  4YFX F;  1MGT A;  4EVI A;  1BC7 C;  1O3T A;  3TOB A;  2FNA A;  1BI0 A;  4U0V A;  3HOT A;  3IRR A;  1BN5 A;  3PQJ A;  2ISZ A;  2FA5 A;  1OYY A;  1R1V A;  2A6E F;  1XSX A;  5F6F A;  4L5J A;  3WTW C;  3G3Z A;  1U5T C;  3HYI A;  4XBF A;  1ZRF A;  2M5W A;  1RUO A;  2PQ8 A;  2A61 A;  2WTE A;  4HV6 A;  2DAO A;  3RYP A;  4RGS A;  2QQB A;  3WU0 A;  3LFK A;  3CUQ B;  1BJA A;  4Y13 A;  4HV5 A;  4OIP F;  2PMH A;  1IUY A;  4A0Y A;  2ZXJ A;  4AIK A;  1RI7 A;  2OZ6 A;  3F22 A;  1FPQ A;  2QEN A;  2GXG A;  3BOQ A;  4IJA A;  3KEQ A;  3HTS B;  1KQ8 A;  5A2Q K;  4L9V A;  3KP7 A;  4BXU A;  4G94 A;  2F5D A;  4ZYG A;  4JQF A;  1Z6T A;  3KLN A;  2MH9 A;  3ELK A;  3HIF A;  3WTV C;  3E6B A;  3SQN A;  3EYY A;  3TQN A;  3M7G A;  1LDJ A;  1TNS A;  4XRF A;  3MZH A;  4IHT A;  2HYF A;  5DCF A;  3ROU A;  3LST A;  4ESB A;  2VBZ A;  5BOX A;  3QPT A;  3G73 A;  1YG2 A;  5IT9 K;  2E7X A;  3FWE A;  1D8J A;  2VE9 A;  1RNL A;  2Z3Y A;  4KMU X;  1Z91 A;  1FX7 A;  3RPQ A;  1FT9 A;  1QO0 D;  3E6D A;  4KDP A;  1HW5 A;  2LNB A;  5K1Y A;  3MQ0 A;  3K9T A;  3P9I A;  5L3C A;  1JXS A;  4M9X A;  4MTE A;  5LEJ A;  1O3Q A;  2ZJ2 A;  1WRJ A;  2YR2 A;  1J59 A;  3LQR A;  4MTD A;  1RUN A;  2IA1 A;  1IZ1 A;  1GHC A;  1T38 A;  1Z05 A;  2E1C A;  1B9N A;  5E1Z B;  5D4S A;  2LSO A;  1HSJ A;  4KFC A;  4KN7 X;  3E3V A;  4BAY A;  3DP7 A;  2B0L A;  2UZK A;  2ESN A;  2PI0 A;  1MDM B;  2FEZ A;  3OOP A;  4JBA A;  1MJB A;  3F72 A;  1KU2 A;  2O6G E;  2ZME B;  2BEO A;  2W24 A;  1MKM A;  3I59 A;  4CGZ A;  2KIF A;  2IP2 A;  1HW1 A;  1ODD A;  3K1N A;  4WK8 F;  4ZZL A;  3K1M A;  3RKY A;  1SD7 A;  1WQ2 A;  4WXC A;  3Q5F A;  4ASN A;  1QZZ A;  3KP6 A;  5ILV A;  4G8X A;  2K02 A;  3SZT A;  3FM3 A;  1FBS A;  5HLG A;  2K27 A;  2VC1 A;  5LHG A;  3GZ5 A;  4EGZ A;  2FMY A;  2XAS A;  5JHU A;  3WTT C;  4FX0 A;  1W5T A;  1F5T A;  4YFN F;  3MFK A;  3E6M A;  1LNW A;  3TDU C;  2DLL A;  3J81 Z;  2EFP A;  3F8N A;  4AD9 A;  3H92 A;  1DPR A;  3B73 A;  1T0F A;  1L3L A;  3MAJ A;  3U1D A;  4A2U A;  3GXO A;  1ZLK A;  3HUG A;  5HDG A;  5BS6 A;  4PDK A;  1IN7 A;  4FHT A;  5HVQ C;  3SHF A;  2CSO A;  4GXO A;  5BMZ A;  3GFI A;  1ZRD A;  2DK8 A;  3K0L A;  4A0Z A;  3V7S A;  5DD4 A;  3V8L A;  4OU0 A;  2D45 A;  3QRF F;  2J5P A;  4ENM A;  3GX4 X;  3E5U A;  2YX4 A;  2CG4 A;  3HTU A;  3WE3 A;  2DBB A;  1Z6R A;  4M73 A;  3VOD A;  1U3E M;  5H6R A;  2KIM A;  1G4D A;  3W6K B;  2ISY A;  2EK5 A;  4Q47 A;  3ZPL A;  4LG0 B;  4OIR F;  3JSO A;  3B02 A;  3BPV A;  1F1Z A;  2HS5 A;  3BZ6 A;  2V1D A;  2A68 F;  1FBQ A;  2XRN A;  4EJO A;  3GFJ A;  4R1H A;  2NAZ A;  3R61 A;  4G7O F;  3MCZ A;  5HLI A;  1O3R A;  4RAY A;  4P9U A;  5CVR A;  4KIB A;  5EEH A;  4L0Y B;  1FZP B;  3VEP A;  4DQ2 A;  2HQN A;  3DF8 A;  1XDS A;  1G3W A;  2CWE A;  4ZYD A;  2WC2 A;  1I1S A;  1YQA A;  2GXB A;  5D5U B;  4EM0 B;  1FOK A;  5DEQ A;  3KCC A;  2XAQ A;  4UVA A;  4UUV A;  5CLS A;  5CVI A;  1IN8 A;  1TW2 A;  1J7K A;  2RNJ A;  4Q5S F;  3WGG A;  2CYY A;  3DV8 A;  1K79 A;  4QLC U;  1IW7 F;  2G9W A;  4EJU A;  4OMZ A;  5ILS A;  2L01 A;  3I58 A;  2FRH A;  5HDN A;  2O03 A;  4UV8 A;  3GW2 A;  5LHI A;  1YLF A;  3KP3 A;  1KA8 A;  2UXN A;  3R6S A;  5ICG A;  4P55 A;  3DPT A;  1R5G A;  3FX3 A;  2DK5 A;  4HDV A;  2OU2 A;  3BP8 A;  4HLX A;  4HX7 A;  1LEA A;  2K86 A;  4EJV A;  1B6A A;  1SFX A;  1OPC A;  5E1W A;  2IPQ X;  4M71 A;  1J9I A;  1UST A;  3C1D A;  4IRG A;  2WWY A;  2A6H F;  2RGV A;  1GXQ A;  2FBK A;  2DQR A;  2PN6 A;  2EV5 A;  3EET A;  1D5V A;  3WTU C;  1O7L A;  2TDX A;  5E8I A;  1QPM A;  3HRT A;  1EH6 A;  1V3F A;  3FF5 A;  2V9V A;  4CYD A;  1SAX A;  3GO5 A;  2D1V A;  4RGX A;  1WSU A;  4BNC A;  5J8F A;  5BPD A;  3ZMV A;  3FXR A;  5FFX A;  1S3J A;  2COM A;  5JI6 A;  2JPC A;  4TV7 A;  2H6B A;  1IRF A;  1LVA A;  1LQ1 A;  1IN4 A;  4KMF A;  5D6E A;  4YFK F;  3AAF A;  2VXZ A;  2ESH A;  5ICE A;  1DP7 P;  5L3E A;  2QUF A;  1C0W A;  2PLY A;  3F6O A;  5IT9 Z;  3U2R A;  1O7F A;  2QQ9 A;  2XKP A;  4MGR A;  1D8K A;  4A5M A;  3DEU A;  4Y17 A;  2M1B A;  4L18 B;  3ZN0 A;  3SFZ A;  5FLX K;  1TQM A;  4ZYH A;  2QBY A;  2KKO A;  5D6F A;  4KA4 A;  1R22 A;  4KN4 X;  3VOE A;  4WX9 A;  1R1U A;  1XGO A;  3FXQ A;  1SFU A;  5LGT A;  1ZG1 A;  5E8G A;  4I98 B;  4HBL A;  3K69 A;  2MC3 A;  4Q48 A;  2RV8 A;  3RYR A;  3Q9V A;  5K5O A;  1H0M A;  3WG9 A;  1ZN2 A;  1U8R A;  4U88 A;  5EEG A;  1R1T A;  1RIO H;  2VN2 A;  3CDH A;  2IRF G;  3CO6 C;  5LHH A;  3LA3 A;  1W7P D;  1IXR C;  3SZP A;  3I5U A;  4U7B A;  2JTV A;  1I27 A;  2GIV A;  4K2E A;  1IXC A;  3T1B A;  1KYZ A;  5E20 A;  1UB9 A;  2MLK A;  1W7P B;  1IAW A;  2R7D A;  2H09 A;  1OYI A;  3EDP A;  3ECO A;  4KIF A;  3L2C A;  3EQL F;  4GYI A;  1Q1H A;  3IWZ A;  3F8C A;  2QYO A;  4KIC A;  4OIQ F;  3C7J A;  1SD6 A;  1Z7U A;  5FO5 A;  4AIH A;  3WGI A;  3C18 A;  2ELH A;  2NS0 A;  2L54 A;  4Z2Y A;  3J7A O;  1ZGA A;  2QWW A;  2EFQ A;  1ZG5 A;  1STZ A;  3V8K A;  1JHF A;  4XLN F;  2W85 A;  4RB1 A;  1H9G A;  2BE5 F;  3F6V A;  3TO9 A;  3SXY A;  1FLI A;  5LGN A;  3ZMD A;  3QU3 A;  3N4M A;  2MLG A;  2P8T A;  5DYM A;  1F4K A;  2MBF A;  1S8N A;  3J81 K;  3FMQ A;  2ZBK A;  1S7O A;  4MEY F;  2DI3 A;  2HGC A;  3O6B B;  4LD5 A;  1XSD A;  1QQI A;  1Y0U A;  1NHA A;  2VE8 A;  3HSR A;  2JT1 A;  3E6C C;  2VOD A;  1ULY A;  4A6D A;  1B59 A;  4CXF A;  3IRQ A;  5DV5 A;  3U9G A;  3F23 A;  2FQ3 A;  4ZZD A;  4ON0 A;  1U5T A;  2XAH A;  4O5V A;  1D3Y A;  4L9N A;  1R58 A;  3RJP A;  3ZN1 A;  3DFG A;  3CUQ A;  4KNY A;  3H3U A;  1XCV A;  3F8B A;  1GVJ A;  2XGX A;  2HKX A;  1LB2 A;  3EYI A;  2NNY A;  3QOP A;  2G7H A;  4WF2 A;  4U0W A;  2EA4 A;  3ECH A;  4U0Y A;  4Y15 A;  2W57 A;  1G6N A;  4BQA A;  3KFW X;  3LAP A;  1SMT A;  1WI9 A;  2OAZ A;  3R0A A;  2M8E A;  4H0E A;  1R7J A;  4A0X A;  1P92 A;  2P7V B;  2X0L A;  4F7Z A;  5L3G A;  2P6T A;  2QM3 A;  2QBY B;  4AVP A;  3QAH A;  1P6R A;  2A69 F;  3TOA A;  4MEX F;  2YSR A;  4LGW A;  1YTY A;  5L3F A;  4YII A;  1QGP A;  1KU9 A;  1B1B A;  2MH2 A;  3LAJ A;  1J5Y A;  4UV9 A;  2FF4 A;  2LF8 A;  3TKY A;  3BDD A;  2V1X A;  2VBY A;  5J8C A;  3WTY C;  1LDK B;  4ESJ A;  4ETS A;  1U5T B;  1K78 B;  1J2X A;  2L02 A;  3I53 A;  3FMS A;  1K78 A;  5D4R A;  4XLP F;  1FYL A;  2FU4 A;  1EH8 A;  2WV0 A;  2C6Y A;  3M9A A;  1ZGJ A;  1LDD A;  3ZQ7 A;  5DUK A;  2Z99 A;  1HXD A;  1IN5 A;  2FSW A;  2F5E A;  2P4W A;  1T39 A;  1ZRC A;  2HZT A;  1P2F A;  4OMY A;  3P7N A;  3DQV C;  2XAJ A;  2IVM A;  4CDG A;  5LGU A;  3E97 A;  3C3W A;  1XDU A;  2GAU A;  2LKP A;  5ICF A;  5HOO A;  5D5W B;  2OZU A;  5DCM A;  4EM1 A;  3GYH X;  1FSH A;  1G3Y A;  3HRM A;  5L3B A;  1S6L A;  2M87 A;  1CGP A;  2QZ8 A;  1SD4 A;  3QP5 A;  1MJA A;  3E5Q A;  2P6S A;  3KP2 A;  2E1N A;  2VOP A;  3QPH A;  5JR3 A;  3HHG A;  3DXJ F;  4P5O A;  3I64 A;  4CO8 A;  2CFX A;  3BJ6 A;  1ZAO A;  3HHH A;  4LK0 F;  4G7H F;  4HW0 A;  2KJB A;  4HQM A;  1TQI A;  2D2W A;  1XCB A;  4LLL A;  3TGN A;  5J6X A;  4O3M A;  1ON1 A;  4I0B A;  1Z9C A;  4KUM A;  4N0B A;  4GYG A;  4HLY A;  4HDU A;  1IN6 A;  1OR7 A;  2FOK A;  4LJZ F;  2Y75 A;  1R23 A;  1PDN C;  5ED4 A;  3VB2 A;  1U78 A;  4WWC A;  1EH7 A;  3BY6 A;  1I5Z A;  1XMK A;  1HKQ A;  5FD5 A;  2ZNZ A;  1RZ4 A;  2KRF A;  1G3T A;  4WXH A;  2DTR A;  4YIF A;  4KIG A;  1KQ9 A;  4D0P A;  2CW0 F;  3WOD F;  4YG2 F;  3LQQ A;  1YFH A;  1ZRE A;  5BQT A;  5KK1 A;  1K6O A;  4I7H A;  2H6C A;  4G6Q A;  5E17 F;  4FT8 A;  2PEX A;  2HEO A;  3GVA A;  5AIP A;  3TO7 A;  2ZNY A;  1ZHF A;  3J80 Z;  2PBI A;  2XV4 S;  4M6Y A;  2A3S A;  2FML A;  4Q4Z F;  2ZFW A;  1HKS A;  2EA2 A;  3CUQ C;  2DO7 A;  2PG4 A;  1TQP A;  2HFH A;  3T8T A;  1I1G A;  5LRR A;  1W7P A;  3F21 A;  5CVU A;  3K1P A;  3GF2 A;  5DUI A;  1S7A A;  1BC8 C;  1YW8 A;  3RKX A;  1TNT A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...