1IUFA

Low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
144
structure length
144
Chain Sequence
GIHMGKIKRRAITEHEKRALRHYFFQLQNRSGQQDLIEWFREKFGKDISQPSVSQILSSKYSYLDNTVEKPWDVKRNRPPKYPLLEAALFEWQVQQGDDATLSGETIKRAAAILWHKIPEYQDQPVPNFSNGWLEGFRKRHILH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords centromere abp1 protein
publication title Solution structure determination of the two DNA-binding domains in the Schizosaccharomyces pombe Abp1 protein by a combination of dipolar coupling and diffusion anisotropy restraints.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
total genus 25
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18107 HTH_ABP1_N Fission yeast centromere protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1iufA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1iufA01
1FTZA 4FE4A 4D7NA 4UUSB 2YU9J 1GV5A 4DZJA 4XRSG 2NVXJ 2AO9A 1WI3A 4A3LJ 2FD5A 3Q0WA 3A03A 4G12A 1JTYA 2NVYJ 2YS9A 3ZQIA 2HOAA 4EEFG 3HOVJ 3WHCA 5FKKA 2X48A 4AC0A 1JJ6C 1GV2A 2ID6A 1WGXA 5M5XJ 2AHQA 2PMZN 3TW7A 3S16J 3JRGA 2LKXA 3WHBA 2KT0A 4Y52J 1IRZA 1JJ8C 3HBLA 4V2GA 2HOTA 1VF9A 3IH3A 1YRNA 3JRCA 5FKLA 1GVDA 4DYQA 2LTPA 4B4CA 2EH3A 4CYCB 3IH4A 2DA3A 3HEFA 2E19A 3H3VK 3TW6A 4FISA 1MSFC 3G1MA 4M6VA 2JA6J 3K2AA 4C3IJ 5EG0B 4BY7J 3PM1A 5F08A 2EBIA 2M9HA 4HNVA 4S0HB 1U9OA 3B6AA 4W1UA 2HQ5A 3BR5A 4A93J 1VFCA 2DMNA 2O8KA 2CU7A 5EF6A 2DA2A 3S17J 3HB9A 2M2EA 2XB5A 5IPAA 2Y31A 1LFUP 4FCYA 2JJ7A 4MLOA 2CJJA 5EZHA 1JUPA 1ZR4A 2K9NA 3A02A 1LE8A 1WH5A 1Z77A 2VKEA 1IJWC 1JT0A 2OPTA 2YUSA 3BG5A 4IEJA 5E3NA 3OIOA 2L7FP 5IP7J 3CMYA 1GUUA 4IHYA 5JLWA 1A5JA 1T33A 4LOCA 4B3AA 3W6VA 3MVPA 2MSYA 5FJ8J 1H8AC 1ITYA 1HDPA 5EZGA 5F1JA 5C44J 4XK4A 1AKHB 1R9TJ 1WCMJ 1UHSA 5GPAA 4RBOA 3RZOJ 1JKPC 4D5FA 1QVTA 1XG1A 1GT0C 2K9QA 3F0CA 4M3BA 2TCTA 2CRGA 1F36A 3K7AJ 4D7MA 1BJZA 3ZQHA 2W48A 4DZPA 3BR1A 5M5YJ 2JN6A 1U8BA 3GTQJ 2CUEA 2WAQN 1IUFA 1BW5A 1FTTA 9ANTA 4I6ZA 1OJLA 1IV6A 1X2NA 1FIPA 1IG7A 5DTDA 2XPWA 1JKOC 1B72A 1HDDC 2G0EA 2E2JJ 2R5ZB 4QIWN 2IBDA 4A3FJ 3LSRA 2ECBA 4A3GJ 2WB1N 2Y9YA 4IHVA 2DMQA 2M34A 3H0GJ 5EGOB 1ETWA 2ECCA 3BTJA 3M3YJ 2LD5A 1B8IB 2HOSA 2MG4A 2MGQA 1JGGA 4JX4A 5C4XJ 2DA6A 2WV1A 3S1MJ 5EYRA 5GP9A 3CQZJ 4DYRA 2LK2A 4M3EA 2EZIA 3VPRA 1OCPA 1ORKA 5HODA 1IC8A 1OCTC 1XS9A 3ZQCA 4AUXA 4A3IJ 1TWGJ 3TP3A 1LFBA 1UG2A 1NTCA 3HOXJ 4FE7A 4XRSA 2R5YB 3DEWA 4V2FA 4MIMA 3O8GA 2NOGA 3A01B 3HOYJ 1Y1VJ 1F43A 1MH4A 5FKMA 3UKGA 4JP0A 1A6IA 2XB0X 2E1OA 2XRLA 5FKOA 1W0TA 5C3EJ 3HOUJ 2DA5A 3ZQGA 2ID3A 1MBHA 2Y0SN 3C2BA 3JREA 1FIAA 1QRYA 1RETA 2EZKA 3BR2A 1VI0A 3FKIJ 5F0HA 2O7OA 4A3EJ 3MKLA 3OSFA 2VUMJ 4BBSJ 3ZOBA 3S1QJ 4RDUA 4W97A 2R92J 2EZLA 5GPCA 4IHWA 1BW6A 1MBGA 1U78A 1ZK8A 3RZDJ 1NK3P 1P7JA 1JTXA 1IDZA 1ZTRA 4UUSA 5FLMJ 3JRDA 1IGNA 3FIWA 2JA7J 4DYCA 2JA5J 4J19A 2R0QC 2L7MP 1RESA 2N8GA 1PUFB 1JT6A 3BTIA 2D5VA 1W0UA 1XC5A 2XPUA 2XGDA 2NS7A 1TWCJ 2LY9A 2HXOA 3IV5A 1K83J 1TWAJ 2LVSA 4QTRA 4B1RA 3G1OA 1ZGWA 1BL0A 4CYCA 1JUMA 3JR9A 2TRTA 3M4OJ 2KDZA 4XRMA 4BY1J 5F0FA 5EG0A 2DA4A 1FJLA 5K7ZA 3S14J 3L1PA 3HOWJ 3PO3J 1DU6A 3JRBA 1I50J 3ZQFA 3LSGA 2Y30A 1AU7A 5FKNA 1MBJA 1MNMC 4L5EA 3TP0A 5IOYA 3QPSA 4A3JJ 5IYBJ 2LR8A 4A3DJ 3RQIA 2O9LA 2COBA 4C3HJ 1NK2P 4JYKA 5DS9A 1I3QJ 2Y2ZA 5F04A 2HDDA 1JKQC 5K7HA 3JRHA 4M3DA 2VKVA 3TEDA 2FJ1A 3BG9A 1EF4A 1POGA 3HDDA 1I6HJ 2JK3A 2K40A 4A3MJ 3S2HJ 3S2DJ 5F27A 1JUSA 4GFBA 2QCOA 3BR0A 5FLVA 5F0CA 3S15J 3Q3SA 2DA7A 3LSPA 2L9RA 4A3KJ 5K7FA 1Z0XA 2QF7A 1ETYA 1D5YA 3JRAA 1YRNB 2DTZA 1ETKA 1P7IA 3G1LA 3CDLA 3FK7A 1SFOJ 2FX0A 1DU0A 1MBFA 3BQZA 3GTOJ 3LOCA 4BXXJ 3FK6A 5E3LA 3S1RJ 3BTCA 1S7EA 4UUTA 1SANA 3PO2J 2JMWA 2OF7A 2CQXA 2XPVA 3DCFA 3NARA 4DW6A 3GTKJ 1RKTA 3FISA 1WH7A 1CQTA 2DJNA 3Q0UA 3GTMJ 1ETQA 2JA8J 1U9NA 1FEXA 2XGCA 1IDYA 4X1EA 4A69C 2R5ZA 2E2HJ 2L7ZA 5J1UA 1ETXA 2M8GX 3QQAA 3SDGA 1QPIA 5JLXA 1TWFJ 5EGOA 2DMTA 2NS8A 1LE8B 1ZR2A 2XSDC 2ME0A 2IAIA 1H88C 4A3BJ 1B8IA 5J3LA 2RAEA 3HM5A 3BTLA 2XGEA 3BT9A 2VI6A 4FTHA 1ETVA 1RR7A 3HGYA 4MFDA 2HYJA 3BR6A 1VNDA 1ETOA 2GBYA 5E3MA 4JX6A 2LLKA 2GLOA 5BNGA 3BR3A 3SJMA 1O4XA 2X9DA 2NVTJ 1WPKA 1T56A 2LP0A 2X6OA 3HKZN 5IYCJ 2R5YA 1Y1WJ 4BKXA 1MBKA 4M3GA 4NDLA 2GM4A 5E3OA 4IHXA 3A01A 3I4NJ 5IP9J 5M3FJ 2CQQA 2E2IJ 3JRIA 3HOZJ 4D5CA 5EEAA 2L0KA 1ZQ3P 1BA5A 3LSJA 3GTGJ 1HLVA 2B63J 2H8RA 5IYDJ 2P81A 3Q0VA 3GTJJ 1B72B 3GBGA 2FQ4A 3E7LA 2M0CA 1K61A 2ELKA 2EQRA 2EZHA 4XIDA 3RKQA 3BQYA 2R7ZJ 4MFEA 3JRFA 5M3MJ 4XICA 4ABZA 3I4MJ 2IEKA 1GDTA 3MN2A 5J1RA 1Q1VA 4X6AJ 1HF0A 1PUFA 3OSGA 4QSHA 2H1KA 1UMQA 4M3FA 4BBRJ 3IH2A 3LNQA 5J1YA 4AYBN 4I76A 2NVQJ 1QVUA 1MH3A 2DA1A 3CCYA 3SFIA 3B6CA 2DN0A 2I10A 2Y9ZA 1OFCX 1RPWA 4Y7NJ 4JX5A 2LFBA 2VPRA 2HI3A 2ME6A 5IOZA 2DMUA 5IP6A 3D1NI 3ZQLA 1E3OC 1TC3C 2JWTA 5EDNA 1MBEA 3GTPJ 1TWHJ 1HOMA 2K9SA 3NAUA 1AKHA 1MSEC 5M5WJ 4C3JJ 3GTLJ 3BG3A 3O8HA 4C2MJ 2MW8A 1H89C 2HXIA 3OOUA 1X58A 1AHDP 1JKRC 4A3CJ 4MO7A 1APLC 2ZB9A 1HCRA 1ENHA 1RKWA 1X2MA 2CUFA 3QPLA 2R93J 3S1NJ 5C4JJ 3HGGA 2DMPA 1G2HA 1ZKGA
chains in the Genus database with same CATH superfamily
1FTZA 3TQNA 2XUBA 4FE4A 3L09A 3GF2A 3VSKA 4ASNA 2IGNA 2YU9J 2A61A 4XRSG 2AO9A 2EFQA 2FMLA 2KDOA 5B1BH 4A3LJ 1ZAOA 2R7OA 1R4MB 3A03A 3Q0WA 1IO2A 1JTYA 2NVYJ 3ZQIA 2HOAA 3G3ZA 1T95A 3WHCA 3PNVA 2KISA 2MH2A 2ID6A 5E1WA 4HRIA 2DTRA 4F55A 1BC8C 1D1AA 3JSPA 2AHQA 2KJBA 1FPQA 3S16J 4YFKF 2Q8KA 4BUPA 3VFZA 2M1BA 3A1YA 3P7NA 4E7SA 2HEOA 2XV4S 3U21A 2DCEA 5CLSA 2IW5A 1YRNA 5FKLA 3EUKL 2V7FA 3SZGA 2P6SA 1GVDA 4EJTA 2ZSIB 1SFEA 2LTPA 3QOPA 3AFHA 2EH3A 2V26A 4WF2A 1SFUA 2H09A 2EV6A 2E71A 2DYSH 2EWNA 4FISA 1MSFC 2LC2A 2HYGD 3G1MA 3L7WA 3HZJA 3BROA 3K2AA 3PSFA 4M6VA 2KMUA 3J7YJ 3PM1A 1UB9A 2XROA 2H27A 4XN3A 2M9HA 3HUGA 2DPUA 1USSA 2XAQA 2QM3A 2H94A 2O8KA 2CU7A 3S17J 2GOMA 3HB9A 2KPMA 3GZ5A 5E79C 2QSFX 3OYHA 4FASD 1V4RA 5CVVA 2CQKA 2KJCA 4NC7A 3FM5A 2Z2SB 4BXUA 4MLOA 2QSHX 1SAUA 2LSOA 1SAXA 2CFOA 1ZR4A 3A02A 4EVIA 4KIGA 4CCLA 2MC3A 4P96A 2VKEA 2A6HF 4ZTFA 1IJWC 4EJOA 1JT0A 2OA4A 2JUGA 2L01A 4IEJA 4BAYA 5AIQA 5D8KB 2L7FP 2LKPA 1V54H 5D4SA 1A5JA 1T98A 1X1CA 3MVPA 1D5VA 2B7EA 4Q47A 4EJUA 3WG7H 2LOOA 1IW7F 2BOLA 2DOFA 5D6EA 1ITYA 1W4MA 5EZGA 3ERMA 3OYLA 1WHUA 4XONA 2KIFA 1UHSA 2R7FA 4YELA 4RBOA 3LSTA 3P9KA 3CJNA 1XG1A 1MJ9A 3CCEI 2F48A 3K4BA 2I5UA 3RCOA 1R5HA 3DQVC 3ZQHA 3WODF 3B02A 2ESNA 1T0FC 4LK1F 2HVQA 1U8BA 1IUFA 2A05A 2E1MB 3KCCA 5A2QZ 2VE9A 4L18B 1HKTA 5IT3A 1FTTA 4N9HA 4I6ZA 1X2NA 1BI1A 2JA2A 4ESBA 1Y39A 1Y8QB 4BXFA 3QYFA 3FXUA 2W1OA 1SVOA 2DT7B 4BH9A 3HOTA 1BR4A 1W5SA 2ECBA 1T6SA 2VASA 1YIJI 2WB1N 3L9FA 3HTUA 2STTA 3PQKA 1JXSA 3F72A 2M34A 1WI9A 3BTJA 3M3YJ 1D8JA 1LNWA 1YW7A 1U3EM 5TISC 3M8EA 4AIJA 1K4TA 4E6KG 2PG4A 2LG4A 4AVZA 3K1NA 3LSMA 4U88A 2D2WA 4M3EA 4CCKA 2IS2A 4HPQA 3E6MA 2F5DA 1XS9A 3ZQCA 4ZDLA 1FP2A 1TWGJ 5TRDA 1UG2A 1WJEA 3OWTA 4XRSA 3DEWA 1MJBA 2P4WA 1V3FA 2F4IA 1LFPA 1X4PA 3A01B 3U2RA 5JVTA 1FX7A 1EH8A 4HDUA 1ZH5A 3UKGA 4P9FA 1FOXA 3K6GA 2K5CA 2XB0X 3RPUA 2E1OA 2O0YA 2XRLA 5FKOA 1K78A 1MBHA 1WJCA 3JREA 1QRYA 2EZKA 4UVAA 4A3EJ 3BY6A 4BE1A 1J0RA 2RV8A 3IKTA 3C1DA 1ERDA 1QZYA 1DQUA 2R92J 1JE8A 2E1NA 2KLOA 2VXZA 1R5GA 2IXSA 1MMDA 2PN6A 4UUSA 2HPIA 3JTHA 5IT9K 2ZBKA 1RESA 2LBFA 2N8GA 1PUFB 2R4GA 2YSRA 4XLPF 1IV8A 3ZR8X 3AG3H 3HSEA 2VBZA 4CZCA 4QPOA 2E1MC 3DFGA 3HRMA 3KEYA 4A0XA 4BJ6C 3FMRA 3EQLF 4D1QA 3MZ8A 3I58A 3W3CA 4MQ9F 4N4NB 3G4SI 4QTRA 1TT5B 3RKXA 3MFKA 3CUQB 4KYWA 2IA1A 5E17F 3PNYA 3FBIB 3V8LA 2JPCA 4DGWB 1DP7P 2A5WA 3VODA 4CYCA 3PSIA 3TOAA 1H9GA 4BQNA 3N97A 4XRMA 4UNOA 1Z6RA 3FBNB 4P1WA 5F0FA 1R58A 3ZCOA 5K7ZA 3FM3A 1E3HA 3ZQFA 2XGXA 1Q1HA 1MNMC 4L5EA 3TP0A 5E8IA 1EKEA 3FDYA 5IOYA 3DEUA 2OV7A 3PFIA 1YX5A 2EFNA 2NNNA 2E35A 5IYBJ 2LR8A 4A3DJ 4H4KC 3RQIA 3SFZA 3SZTA 2ISYA 4LK0F 2Y2ZA 3WTTC 3COAC 3CCRI 3GLLA 2CH0A 1V5GA 4Y3OA 3HXLA 2MC4A 3GUDA 1OYIA 4AYBA 3TO9A 3GW2A 3FXRA 4NQWB 3TEDA 1HBXG 2VOPA 3LAJA 5D5XB 4ETSA 1DUXC 3TDUC 4A3MJ 4IOCF 3S2DJ 5AONA 5ICFA 2DAOA 3GEZA 1OYYA 4BJ5C 3N4MA 2YR2A 1Z3YA 1G3TA 5DCFA 1SC7A 3PIOF 1RUOA 4WXDA 3ZMVA 5F0CA 4HNUA 4XMYA 1XPXA 1YW8A 2CYYA 3OS1A 2VE8A 3CCLI 1BIAA 2XF7A 3F8NA 2DPDA 1XGOA 2WAEA 3ULQB 4PZJA 3KP2A 3P9IA 5HDGA 3D5RC 3E6CC 3EUHC 3GO5A 4CCNA 2X51A 4CYDA 1YX3A 3FK7A 2FX0A 2R7TA 1I6XA 3P5JA 4KN7X 3GVAA 3L2VA 1AOYA 3LOCA 1S7EA 4LG3A 1ZGJA 2BY0A 1SVMA 5KNLA 4Z6YA 1T39A 2IGMA 3GTKJ 2JVGA 1Z91A 1PYVA 1WH7A 4CUGA 3GTMJ 3DTKA 4EQQA 2UUZA 3CC4I 3KX2A 1JHHA 3JAMZ 3KIOA 3NWSA 5HS8A 2X1DA 3AAFA 3WU2C 2ZXWH 2CW8A 3FXQA 2J5PA 3PFYA 2MD5A 5CPRB 1T08B 1G3YA 3K2ZA 5JLXA 3VYSB 5D4RA 1LPQA 2XSDC 2IAIA 2FQ3A 4WXHA 4A3BJ 3CP2A 5J3LA 5DCMA 1FZPB 1Z3XA 5LEJA 2M0MA 2XGEA 3J7AY 4GYGA 1ZRCA 1W1WE 2VI6A 2DQLA 1R7JA 4M9ZA 3HG9A 4M71A 3HGYA 2XAUA 1TLHB 3VSLA 2HDCA 2HYJA 5LFAA 3BR6A 2O6GE 1VNDA 3CP8A 3ZQQA 3T8TA 4JX6A 1GHCA 1HXDA 2GLOA 1YJ9I 3OYDA 2EINH 4RAGA 1XSXA 2MABA 2X9DA 4ZYAA 1DPRA 1WPKA 1F9NA 1YIOA 2OCCH 2QENA 4B47A 5FLXZ 3CCSI 3S3OA 2X6OA 1SVLA 3FKJA 4FX0A 1YJNI 2UV1A 1B1BA 2EA4A 2O5RA 4NDLA 2ZMEB 2DFIA 2FBKA 2BXYA 3GFIA 2R3SA 3HL2A 3G73A 4D5CA 4HG2A 2GWRA 1P4XA 2QQ9A 3IRQA 1FY7A 3QWLA 3V8JA 2ZNYA 2UXNA 1S5LC 1GVJA 2QA4I 2VODA 3GTGJ 2B63J 4XSXF 2GIVA 4OAYA 5IYDJ 4CCMA 3WTSC 4HX8A 2L5QA 2HZDA 2P81A 1Z7UA 3IC7A 4UV9A 2FQ4A 4HV5A 1KONA 1K61A 4L9VA 4XIDA 3I59A 3WTYC 2LMDA 3RKQA 5E1XA 3DBLB 3WE2A 4MFEA 1ULYA 1X19A 1VQ6I 4F92B 4ABZA 4XICA 1TW2A 2V1XA 3PL8A 4PJLA 3J81Z 3I4MJ 4BYYA 4DIQA 2IEKA 2GQQA 2WAFA 2Z99A 3MN2A 2VQGA 1HF0A 1FMVA 3FXLA 3M1CA 2RNJA 1HW1A 2OBPA 4M3FA 4I02A 3FXMA 2E1CA 1WJBA 3DP7A 2DODA 2V1NA 2QUFA 3FX3A 3SXYA 1V55H 2DA1A 3RTRA 5A2QK 2ICWG 1OFCX 1KU2A 4JX5A 4A6EA 2HI3A 4HSTA 4BQQA 4BNCA 2E34A 2HWVA 1P4AA 5IP6A 5DM7F 1TZLA 3TDZC 4AWXB 1TC3C 1H9TA 2Y69H 5HS9A 2FF4A 3GZNB 3ABMH 3OOPA 4DBRA 1TWHJ 3MD2A 2K9SA 3NAUA 1PVEA 1AKHA 1MSEC 4YEJA 2M30A 2CO5A 4N0BA 3DEEA 2YPRA 3U1KA 1BN5A 1SD5A 1YITI 4IVNA 1WQ2A 1WJ5A 2VT2A 4YFXF 3ABKH 4RGSA 2WB1A 4A0ZA 3OYFA 2ZB9A 4PJNA 5HDNA 2CSOA 1YS6A 4UY8I 1X2MA 2CUFA 3QPLA 1VQOI 3S1NJ 5C4JJ 3BCAA 1OCOH 3G6EI 1ZKGA 2Z33A 4CHUA 2BBYA 1SEUA 2E36A 1X3WB 4DZJA 2LH9A 4HW0A 2IP2A 1LQ1A 2ZMEC 2R7WA 2ZJPF 3T5XA 2FEZA 1DPUA 1R1TA 2LRDA 1UFMA 1FBQA 3ZMUA 3CLOA 1FWZA 4ZYEA 3OYNA 4J01A 4BQAA 1J59A 3BZCA 1HSTA 2ADUA 4G6DA 3OS2A 1C0WA 2V1DA 5J40A 4BDYA 3TW7A 4Q5SF 2LKXA 2HOEA 2VLAA 4UB6C 5FO5A 3OYGA 1IRFA 5CYVA 3ZPLA 2Q1ZB 2HOTA 1VF9A 3IH3A 4XM3A 5FD6A 3BC8A 4CCJA 2WY7Q 2CV2A 4DYQA 1XB4A 1S6LA 4RAZA 1LKXA 4OIPF 3HSFA 3IH4A 2DA3A 2CWEA 3I0TA 4MQVA 1O7LA 2E19A 3H3VK 2K85A 2P7VB 3TW6A 2NRAC 4ZTJA 2E7XA 4LD5A 2QEXI 1A36A 5EG0B 2X6XA 2OAZA 1ZHFA 1IN4A 3OL4A 1R1VA 3K4MA 4W1UA 2F5EA 4FX4A 2QKMB 2DK8A 2DMNA 4HNTA 2MH9A 1VQMI 2BZTA 1YJWI 4LG0A 2Y31A 4CH7A 1LFUP 4FCYA 2WADA 3WGGA 3NEUA 4B44A 2CJJA 2XKPA 2HVSA 2K9NA 1WZ2A 1LE8A 3BWGA 1R36A 5EEHA 1LDJA 1NG6A 1UJ8A 3M1EA 2OU2A 5F64A 2L4MA 5KAFC 4NUBA 1QGPA 2L2OA 5IP7J 3CMYA 3PNTA 2V9PA 3HYIA 5JI6A 5JLWA 3W2VA 3CJTB 4B3AA 2E7WA 3DWLE 1MGTA 3D5SC 5FJ8J 2GOXB 4P55A 5GADJ 3GYHX 3BPVA 4KA4A 2ZJRF 2P5LC 1NG7A 4UVBA 2JRMA 1R9TJ 3RZOJ 2M5WA 4UV8A 2E5NA 2ZFUA 3UR3C 5L3GA 2QBYB 3I55I 2FMYA 1BC7C 3WTUC 2K9QA 3F0CA 2GA2A 3GFLA 1OPCA 3BJOA 3K7AJ 4D7MA 1BJZA 1VQKI 2W48A 2VQHA 3CCVI 5M5YJ 2JN6A 3HSRA 3H1CA 2CUEA 1MMSA 1BW5A 4XLNF 9ANTA 3ZQ7A 3NQOA 4KFCA 1OJLA 3BP8A 1IG7A 5DTDA 2QZ8A 2R7DA 1B72A 2E2JJ 3BJAA 2R5ZB 4QIWN 2IBDA 3C3WA 4IHSA 4PCQA 2CQNA 1VQLI 2P7CB 2GXAA 4KMFA 1FSEA 4IHVA 2DMQA 3H0GJ 5EGOB 5H6QA 3RSNA 2ZC2A 1ETWA 4I7HA 2EILH 2M8EA 1L3LA 1KQ8A 4BEHB 3CDIA 4M74A 4E7KA 2MGQA 4R79A 2Y75A 3CMAI 1SD6A 2DYRH 3DU5A 1MNEA 2RKHA 1BR2A 2ZFWA 4DBQA 3M8JA 3ZGKA 1W7PA 2LK2A 1KU7A 1Z7LA 4CSWA 2EZIA 1W5CC 1XCVA 1ORKA 5HODA 4QLCU 1P92A 2BY1A 3SHFA 3L2QA 2PBIA 1TBXA 4ESFA 2VN2A 5FFZA 3F6OA 2W24A 2HZTA 3I3LA 2XRNA 3RPQA 2JSCA 4FE7A 1MDMA 1OCCH 4V2FA 3V7CA 1S72I 3JAMK 3RKWA 3OYBA 3HOYJ 2VJIA 2CQ7A 2BHZA 1WJFA 3DU6A 2HTSA 2X6YA 1MH4A 1CF7B 1A6IA 4HEA2 2XF5A 2P5KA 4RLQA 1RETA 1TQIA 1UHMA 1I1SA 5BQTA 3MKLA 2XKOA 2M87A 3EPZA 4HX4A 5J4YA 1U5TA 2IS1A 4ZH4F 3VWBA 2WV0A 4W97A 5LGUA 2EZLA 2EJRA 5GPCA 1LEBA 1ZG3A 1U2WA 1BW6A 3KE2A 1MBGA 4B43A 4IHWA 2HPMA 2K9LA 1XSDA 3HIFA 1ZTRA 2VKDA 3AKZA 4BJTA 4Y4RA 2K7LA 2PMUA 1O7FA 3FIWA 1T0FA 2JA7J 1RRJA 2HQAA 2Z3YA 3VEPA 4XLAA 4XLHA 4F7ZA 4G7ZF 2XGDA 1SMTA 2NS7A 1TWCJ 4Y15A 4OIRF 3V42A 1B59A 1OCZH 3CC2I 1KGSA 2EV0A 4PGGA 5FD5A 1OMIA 1WVRA 3K4CA 3OYJA 2AQEA 2LVSA 3O6BB 3WU1B 1B6AA 4LMYA 5ICGA 4B1RA 2FOWA 3TOBA 3RJPA 5HLIA 4G8XA 3BOQA 4HBLA 5K5RA 1NH3A 4RGXA 3VYUB 3JR9A 1YHQI 1IRXA 3RDIA 2TRTA 4G9YA 4ON0A 2BE5F 3IHUA 2KDZA 2AQFA 4HOBA 1XGSA 3HOWJ 2DU9A 2XAJA 1BR1A 4A6DA 3J81K 3JRBA 2ISZA 4E7HA 5BPDA 3MMYB 4BQOA 5LHIA 3LSGA 2JQ7A 3OIQA 1FP1D 1AU7A 1MBJA 1UZCA 3OL3A 1MMGA 2BW3A 4XSZF 3H5RA 1ZREA 2CV0A 4R8HA 4JYKA 2H1LA 2H8WA 3LSIA 2NNYA 5J6XA 1BJAA 2PLYA 3JRHA 4ANJA 2FJ1A 3A0HC 2FA5A 2W85A 4HYEA 1EF4A 5ICCA 2DFFA 3HDDA 2VXDA 3CCUI 2JK3A 4EJWA 5GTHC 3S2HJ 1ZRFA 2W82A 5ED4A 5F27A 1JUSA 2W57A 4M9XA 2HKXA 3BR0A 2HFHA 2WAQA 4HF0A 1HA8A 3LSPA 3WGHA 1Y6IA 1Z0XA 5JHFA 3S32A 2COMA 3LAPA 1ETYA 3LA3A 4RM3A 3TBIA 4II2A 2M4GA 1P7IA 3G1LA 2VOOA 2KRCA 2HDWA 4RB2C 3OMYA 5CVIA 3A2KA 5FROA 2R7XA 1RNLA 3L2RA 3ZMZA 2EIKH 2VJ5A 4BXXJ 2V9VA 2EK5A 1J7KA 1SANA 3T8RA 3NARA 2EFOA 1LDDA 3E97A 1RKTA 4IX7A 3R0AA 1CQTA 2G7HA 2DJNA 2OTJI 4C9YA 1XD7A 2JA8J 1U9NA 1QQIA 1Z6TA 5HVQC 2L02A 2CS3A 2E2HJ 2L7ZA 4KMUX 2MLGA 3F21A 1UELB 3KP7A 3JCUC 2KKOA 4F3QA 1YG2A 1W36C 4K2EA 4AIKA 2HVRA 2DMTA 4U0YA 2NS8A 3J7ZI 1O3TA 2Z16A 3ECOA 4HX7A 3HM5A 5HLTA 4F91B 3BT9A 2OJED 5DEQA 1RR7A 2Q2EB 1OQYA 1YS7A 3VYRB 3F22A 1OR7A 1ZN2A 4NHJA 3KP6A 4RLFA 5JHUA 2IS6A 2A6TA 4AD9A 4GGGA 5DV5A 4ESJA 4MEXF 2OD5A 3C2HA 2DK5A 5L3DA 3WU0A 3V7RA 1R5ID 3SJMA 1F4KA 3C2GA 3TKYA 4LB5A 3HKZN 2P8TA 4RS8A 3CJQB 1MBKA 4M3GA 4BKXA 1H0MA 5E3OA 2FOKA 3A01A 3I4NJ 5IP9J 3HOZJ 3DBRB 2GIZA 2KP6A 2L0KA 1ZQ3P 2PJRB 3LSJA 3FXOA 3ELKA 2A69F 4NC8A 2X85A 5E20A 2FRHA 5LBQA 3QRFF 4WX9A 2M4KA 4IRIA 3A0BC 3DV8A 1X4OA 5ICEA 5ILSA 4O5VA 3CO6C 4HLYA 2O61A 1RZ4A 3E1SA 3F8CA 4XLFA 1G4DA 3GX4X 2PQ8A 2W4SA 4CZZA 3JRFA 2IGOA 1K6YA 2DXIA 3HPGA 1S9HA 5TGTA 1MNDA 4OOIA 1RR8C 4X6AJ 1PUFA 2FU4A 3OV8A 3CESA 4F93B 1X3ZB 3LNQA 4BBRJ 3IH2A 3K1PA 5J1YA 4I76A 3M07A 2KZGA 2ZO4A 3CCYA 2QQBA 3GWZA 5JR3A 4ENKA 3MZHA 3KP5A 4L5IA 4N9IA 2Y9ZA 1RPWA 2HR3A 5LRSA 2G7UA 1ZLKA 3E0JB 3CUQA 2DMUA 2ME6A 3D1NI 1D3YA 3ZQLA 1ON2A 4WWCA 3S2WA 5FRMA 2VT3A 2UWMA 5H20A 1MBEA 1GLNA 1ZELA 4UB8C 3X2QH 3QYEA 2RNGA 4FETA 4KDPA 3KYLA 1O3QA 2XF6A 2QVOA 1YI2I 5M5WJ 4C3JJ 3BG3A 3ASNH 3BG7A 5J47A 3O8HA 4GXOA 1H89C 2JT1A 1X58A 2CUJA 3K10A 4FQGA 4OIQF 3S3MA 1HW5A 4XNFA 4IHTA 4HF1A 4GDFA 1HC8A 1S3JA 4KICA 5K5OA 3K69A 3K1MA 1V5FA 1ZYRF 1GV5A 1S29A 2IA2A 3K4LA 4NQWA 2MA3A 2XVCA 1QO0D 4OMZA 4U0WA 3JSOA 3DLAA 2FBHA 4ZDOA 4I98B 4KT5C 3SEZA 5FKKA 2KL4A 3I4PA 4PJJA 1WGXA 2DI3A 3RI4A 3FHZA 2PJPA 4A5NA 2G9WA 4DNCA 3FXJA 3JRGA 5EEGA 4Y52J 2QLZA 2VL8A 2K27A 4DQ2A 1IRZA 3TO7A 1K4SA 4V2GA 1I1GA 2M7AA 2MBFA 4B8XA 3WTVC 3JRCA 2C6YA 1REPC 4IL6C 1QZEA 1P2FA 4B4CA 1RI7A 2X1CA 5IY5H 3HEFA 2R7QA 3SYTA 1MZBA 4UXNA 3KZIC 1TTYA 3R0JA 3OYKA 2EIJH 4N4OB 2JA6J 4C3IJ 1WRJA 2VBYA 3I71A 3O3KA 2BVLA 1FBUA 4XORA 1V5EA 1XTAA 4HNVA 2FNPA 3K0LA 2AXTC 3BR5A 3H3ZA 5EF6A 3MEXA 3WE3A 4XRFA 4IQJA 4AM3A 2E5ZA 5CQGA 5LEKA 2M2EA 3QYBA 4A12A 2J5OA 1FOYA 1FBSA 3BG6A 1Z9CA 1LVKA 4C2TA 3IUOA 1E3PA 5EZHA 4OINF 3ABUA 4E70A 1EV7A 5DM6F 1BI0A 1WH5A 4Z2YA 1EA3A 4UHTA 2OPTA 3WTXC 4S05A 2LYCA 2P5VA 1QNTA 3OIOA 2ZJQF 3I64A 4YFNF 1FC3A 1Z1DA 4IHYA 1T33A 3ERED 3HHGA 4LOCA 3E6BA 1Z67A 2D1HA 1LB2A 2ETHA 1J09A 5C44J 1AKHB 4JQFA 4XKBA 2L9VA 4XLCA 3TGNA 3WTWC 1JKPC 3OS0A 3IRRA 1BIBA 1IAWA 2ZMEA 4YRVA 1FNNA 4IOAF 1G3WA 2TCTA 3QOEA 1F36A 3LFKA 2B9SA 3CLQA 4XBFA 1D0XA 2MD0A 2WAQN 4XKWA 4P5OA 5LGTA 3ROUA 2WTEA 3HRTA 1S7AA 2KZVA 3DLLF 1IV6A 5HS7A 4U7BA 3CF5F 1MMAA 3REOA 5TJJA 3TL4X 2XPWA 2LKSA 2HQNA 3UNGC 1HDDC 1DP3A 2G0EA 3QU6A 2EV5A 2AS5F 3LSRA 4A3GJ 3DPTA 1HKSA 2A3SA 2A5YB 4I2OA 2Y9YA 3GCMA 5E18F 4BACA 2LD5A 2DT6A 1B8IB 3ML6A 2HOSA 2DDAA 4E7LA 2MG4A 1JGGA 3EYIA 3MAJA 3CO7C 3R61A 4JX4A 5C4XJ 2GAUA 2L7KA 4L9TA 1ZGAA 3S1MJ 2L4AA 5GTIC 3CQZJ 4ITVA 1J75A 3PIPF 1WKMA 2BY3A 1OCPA 2TDXA 4M73A 4A2UA 1E2XA 4P9UA 4CA0A 2R7UA 1OCTC 1A35A 3LSHA 4AUXA 1R49A 2BYVE 3MZYA 3QU3A 3TP3A 1LFBA 1NTCA 3MKZA 3EUAA 5B66C 2R5YB 2NOJB 1AA7A 4MIMA 3CZ6A 1D1CA 3O8GA 4PDKA 2NOGA 1P9QC 4LLLA 3BPXA 2YX7A 3MCZA 1Y1VJ 4NB5A 1W7PD 5FKMA 1KU9A 3N05A 4JP0A 3H0DA 3FXKA 3AL0B 3DKWA 5E8GA 3HOUJ 3FF5A 1W0TA 1VQ5I 4GO1A 3WTZA 5KAIC 3ZQGA 2KQRA 2Y0SN 4Y13A 1P6RA 3C2BA 1FIAA 1CGPA 3K70D 3FKIJ 4AIHA 2W00A 1F5TA 2Z5UA 3ZOBA 4LLNA 1XGMA 4RDUA 3HTSB 3S1QJ 3H9JA 1IRGA 1XMXA 2K4JA 2PMZA 2NS0A 1KZHA 1ZK8A 1U78A 1B4AA 3RZDJ 3JTGA 1P7JA 1JTXA 2W25A 4XOPA 1IDZA 1BBYA 3OYMA 1P4WA 2ELHA 5CVRA 3BCBA 3WG9A 2B0LA 4DYCA 1VQ4I 2JA5J 3CMMA 2ESHA 4KJZA 1JT6A 3BTIA 1MW7A 2ZKZA 2D5VA 2X4HA 1N78A 1W0UA 1XC5A 5FRNA 2Q0OA 3HKZA 4AVPA 2VBXA 4II3A 3CDHA 3IAM2 2LY9A 2PMHA 4XQFA 2HXOA 3IV5A 1YOVB 3PJRA 2DLLA 1R22A 1K83J 2LF8A 1TWAJ 1MIJA 4L5JA 4RM2A 4IZZA 1I39A 3I56I 4LITA 1YO5C 1TT0A 5BPIA 1QZZA 1Y56A 2KRHA 3WGIA 1KQ0A 1UHWA 3G1OA 4IXAA 4F52A 3CF2A 2XASA 1ZGWA 1BL0A 3OY9A 1JUMA 5E1ZB 4ENMA 3M4OJ 4QWQA 4BY1J 3AG1H 3F8BA 1XGNA 2VBWA 5EG0A 2DA4A 3L1PA 3PO3J 1J9IA 4A0YA 3OYAA 1DU6A 1USTA 2OZUA 1W5TA 2WBMA 2EFWA 5DD4A 3BZ6A 4C2UA 4MHGA 3QPSA 4IO9F 2O9LA 1FOKA 3RIRA 4YIFA 1HQCA 1PP8F 5F04A 1W7PB 3FWEA 1EH6A 4HA8A 1JKQC 3EYYA 5K7HA 4CICA 1K6OA 2VKHA 3W6JB 4UUVA 2Z1DA 1X3UA 2VKVA 3CTAA 2O3FA 4PGHA 2E60A 2KIUA 1D1BA 3L2UA 2P0WA 3E5UA 1VZ0A 4RGRA 4ENJA 2QKLB 1I6HJ 1JGSA 3E6DA 4EM2A 4GFBA 3AL0C 1MDMB 1Y0UA 1W36D 2DQRA 1DGWY 1IF1A 3S15J 4MEYF 1L0OC 3AG2H 2DA7A 2L9RA 5K7FA 2QF7A 2RVCA 4GYIA 3Q9VA 5HOOA 3R6SA 1D5YA 3S93A 5GAGJ 2PI0A 5LHHA 1YRNB 2XAHA 1D0YA 2DTZA 2LF7A 1UAAA 3KZYA 1XDUA 3ISPA 5K1YA 2QBYA 4HQMA 1Y0NA 2V6CA 3ECHA 2BV6A 1F1ZA 3BQZA 2IA0A 4GCVA 2VONA 1QA6A 3HC7A 3PO2J 2JMWA 1HW2A 2XPVA 4OMYA 5CKTA 4DW6A 4L0ZB 3HUGB 4LIVA 4BS9A 1IXSB 2K3PA 4ZC3A 3K4KA 1N77A 3C7JA 3HRSA 1FEXA 2JRTA 2XGCA 4X1EA 2R5ZA 1XN7A 2IVMA 4MTEA 2DT5A 3F23A 3H35A 1G6NA 2M8GX 3QQAA 3SDGA 1T8IA 1BM9A 1TWFJ 5EGOA 1OLTA 4BEHA 3OR1C 5CJ9A 3I54A 4I99C 1ETVA 4BE2A 1FYKA 4MFDA 3RPUD 2RQQA 1OKRA 3F6VA 1YFHA 2ZCWA 5FLXK 3OYIA 5H2FC 1XCBA 2GBYA 5E3MA 3HRUA 1VQ7I 5F6FA 1I27A 2LLKA 3W2WA 2O8XA 4UVCA 2NVTJ 3BR3A 4RAYA 1O4XA 6PAXA 1T56A 4I0AA 1IXRC 3S3NA 4O3MA 2EB7A 5IYCJ 1VQ9I 1Y1WJ 3T0YA 3IAS2 4RAFA 4M6YA 3M7GA 1KA8A 4Y33A 2CQQA 5M3FJ 5KK1A 2V1UA 4CXFA 1LVAA 2EPFA 5EEAA 5GAHJ 1CF7A 1BA5A 2BW3B 3QPHA 1HLVA 3K70C 2VJJA 3T1BA 2H8RA 2ELJA 5FFXA 2X6WA 3GTJJ 4D0PA 3GBGA 3E7LA 3IKVA 3H3UA 2HQRA 2F5CA 2OC6A 4XKCA 5HLGA 2ELKA 2UZKA 2EZHA 4PSWA 1SFKA 3KYDB 2L54A 3ZMTA 3OYCA 3G71I 1EH7A 4RGUA 3ZN1A 3MKYB 3C18A 2FSWA 1PJRA 1WJAA 4EGYA 4RB1A 2DJIA 4AU7A 1SFXA 2OQRA 1XMKA 4LB6B 2BEOA 1Q1VA 3OSGA 4G6TB 1U5TC 5B1AH 2H1KA 2VQCA 3FMSA 2W7NA 2MFZA 2D45A 1QVUA 2MYSA 2VQLA 3BJ6A 1S7OA 1YLFA 5DYMA 3PQJA 3U1DA 3B6CA 5GAEJ 2DN0A 5D5UB 3GZ6A 2I10A 1FSHA 3FMQA 2LREA 3DPLC 2LFBA 3F9KA 4XKVA 3ZN0A 4V19K 5IOZA 2ZSHB 4KNYA 3P9CA 1WFXA 4ZYDA 2JWTA 3GTPJ 4G7HF 5L3BA 3LQRA 4RB0A 2BXZA 4YG2F 5HNFA 3IP4B 5LLQA 4Q4ZF 1PUEE 3MKWB 1G59A 1K78B 4IPAA 1RUNA 2GA1A 2EA2A 3GTLJ 1TQMA 2W84A 1QU3A 1ZG5A 3MQ0A 1SD4A 4LIUA 2MW8A 4C2MJ 2HXIA 1Y8RB 3OOUA 1AHDP 1JKRC 3KEOA 4MO7A 4A3CJ 1HCRA 1STZA 3ASOH 1ENHA 3V4GA 1RKWA 2XSJC 4PJMA 4NC6A 2R93J 1XDSA 2OZ6A 1ACIA 4HF2A 2HYFA 3HGGA 1JI8A 3J80Z 2DMPA 1X1BA 1ETQA 4PSXA 5L3CA 2BGCA 2VJ4A 5L3EA 1FMWA 1K7AA 1VQ8I 1BOAA 4D7NA 4UUSB 2DW4A 4MGRA 4B3XA 3U9GA 3KLOA 2NVXJ 1WI3A 3L2WA 2FD5A 3KEQA 4G12A 4E7ZA 3CC7I 2LBFB 2YS9A 4EEFG 3HOVJ 1EJ9A 2X48A 4AC0A 4R1HA 5D5WB 1GV2A 1JJ6C 1GXPA 3D0SA 3K9TA 1A31A 1R71A 1A6QA 5M5XJ 2PMZN 1T2KA 3WHBA 2CMPA 1FT9A 1B9NA 2KT0A 5HDKA 3DPUA 3HBLA 4EGZA 1JJ8C 2IS4A 3RYRA 2L9SA 5K5QA 3BDDA 3DBHB 3KP3A 2BY2A 2IJLA 4E7IA 3LFUA 2Y0SA 4CYCB 2QGUA 1U8RA 2GXBA 4BHCA 2QQAA 4PFPA 3L00A 2WA0A 4FT8A 1WSUA 4BY7J 1IN6A 5F08A 5DD8A 3QPTA 5KCMA 2ZXJA 2X1EA 2EBIA 1QPMA 4KIBA 4S0HB 1U9OA 3B6AA 2HQ5A 2ZJ2A 4ZYHA 4A93J 1VFCA 2FE3A 1PDNC 2DA2A 3ESWB 4YIIA 3JW4A 2XDVA 2XB5A 5IPAA 1LUJB 4BU2A 4KIFA 1LDKB 3QP6A 5LHGA 2JJ7A 4M9SA 3KLNA 2M3AA 1O3RA 1JHFA 3SEQA 2A68F 1JUPA 4L9NA 2VPLA 4I0BA 1Z77A 1U6GA 3H92A 4GRIA 3EUHA 2YUSA 3BG5A 1X1AA 1BI3A 5E3NA 4XLEA 3EDPA 4HSRA 1GUUA 4ZJZA 4ZZLA 2Q2EA 5L3FA 2GZWA 2QQ8A 4IF4A 3KPHA 3W6VA 5JVGF 2MSYA 5ILVA 5B3SH 1H8AC 3OYEA 3DKXA 1HDPA 1Z05A 5F1JA 3R60A 4XK4A 4HZFA 5BOXA 1WCMJ 5GPAA 4D5FA 1QVTA 2K02A 1GT0C 2DOAA 3ZXSA 2DDBA 4XL9A 4M3BA 1S8NA 2VC1A 2ZXHA 3LA7A 1WWXA 2CRGA 2QYOA 2A07F 1OR7C 2PFBA 4DZPA 3BR1A 2PJRA 2OTLI 3LL7A 3GTQJ 2OUMA 3J7AO 5KHDA 1MJAA 2UXXA 2K4BA 5JFRA 1FIPA 2V9KA 2IT0A 2LDUA 2LY1A 2ACJA 1JKOC 4IQ4A 4CO8A 3LA2A 4E4HA 5FB2A 2IPQX 3I53A 3W2AA 5D6FA 4A3FJ 4PK4A 3DTEA 2RQPA 1R00A 3FZVA 3DXJF 2ECCA 4QPQA 3AG4H 5DCMB 2JSPA 1FLIA 2H6BA 4BHBA 3PUBA 2DA6A 2WV1A 1OYWA 3M8FA 5EYRA 5GP9A 2Z9OA 3HHHA 4DYRA 2F6CA 3VPRA 1IC8A 4BDZA 4WXCA 5CQEA 2XIGA 3HOSA 1TNTA 2QWWA 3S8PA 3ZMSA 4TV7A 3QP5A 4A3IJ 3HOXJ 3A4CA 4KT6A 1IN5A 2MLKA 3ABTA 3PUFA 1YE9A 1BI2A 2A6EF 2FBIA 4B48A 1X1DA 2F4MB 3IWZA 1U0JA 2EIMH 3H5NA 5J4VA 5ERIA 1F43A 3BLYA 5B5EC 1N25A 2GXGA 5EJCA 1UG0A 1MMNA 4M72A 2NYXA 5C3EJ 3VYTB 2DA5A 1XSVA 2FXAA 2ID3A 2OCEA 4J00A 5AIPA 4D9JA 3HPHA 3KFWX 3BR2A 5F0HA 3E5XA 3CCMI 1VI0A 4G6QA 2O7OA 5D8LB 3F8MA 3CUQC 2EFPA 3OSFA 2VUMJ 4BBSJ 1KQ9A 1R1UA 4B09A 1FYLA 3BZKA 1ON1A 5F1RA 5DUIA 2JUCA 2I8DA 3I59B 1FOWA 1NHAA 3E3VA 1OCRH 1R4NB 4MTDA 1VTNC 1NK3P 1ZRDA 3DF8A 2HNHA 2VC0A 3O2PE 4JK1X 1IN7A 1XX5A 5FLMJ 3JRDA 1IGNA 2Y0MA 3RQ4A 2IGKA 3IWFA 2F2EA 4KITB 3TMOA 2L7MP 2R0QC 4J19A 4CGZA 1RIOH 4FHTA 2YX4A 3NWTA 5CVUA 4EATA 2OQGA 2XPUA 4EJVA 4WK8F 3CMEI 4DJAA 3I9V2 3Q9SA 3TO6A 3QODA 2K3FA 5CVJA 2DBBA 5DUKA 4I01A 4HDVA 4DOZA 3W6KB 4U0VA 1I3AA 5FGMA 3RYPA 3ZRGA 2KIQA 3F3XA 3K4JA 4O6JA 1M1EB 1FJLA 1O3SA 3S14J 1B9MA 2M45A 5KVRA 1I50J 3H9QA 3VOEA 1TNSA 1HSJA 2L9NA 2Y30A 2M7BA 5FKNA 2ZNZA 4NNJA 4G7OF 4ZDPA 4A3JJ 2CW0F 2K86A 1ODDA 3HJEA 4HLXA 1X1PA 2COBA 4C3HJ 1NK2P 1TW3A 1LJ9A 5H6RA 5DS9A 1I3QJ 4RB3C 2HDDA 2WY8Q 2XAFA 1KYWA 5J8CA 2D1VA 4IJAA 2CUZA 1K79A 5HLHA 1VQNI 4M3DA 2F4OB 2HKOA 3FHNA 3BG9A 4LFUA 3KETA 1POGA 2V6EA 2K40A 4LGWA 2HGCA 2QCOA 4AIDA 4BGDA 5FLVA 4Q48A 2F5FA 3F8FA 2NAZA 2LY2A 5LRRA 1RC9A 3Q3SA 2NVUB 4RMNA 2AXLA 4M6XA 4A3KJ 5J8FA 3CCQI 1J5YA 4WCGA 4IRGA 3LSKA 3JRAA 5BS6A 3H9GA 4ZZDA 2DFHA 4S04A 4KN4X 1IZ1A 2KFDA 1ETKA 4BHPA 3CDLA 3B73A 4G94A 4KUMA 3CUOA 2CG4A 2FUG2 3MWMA 1J2XA 2BVMA 1N75A 2NXNB 3J80K 3I5UA 3Q5FA 1SFOJ 4YIRX 1MBFA 2WWYA 1DU0A 3CCJI 1XMAA 3GTOJ 2IRFG 4HQEA 3FK6A 5E3LA 3S1RJ 3BTCA 4UUTA 2H6CA 2OF7A 2CQXA 3DCFA 4IRHA 4OU0A 4BL0B 5DDGA 3VB2A 1AWCA 4ENNA 1A04A 3FISA 1VQPI 1QHGA 1ZARA 2P6TA 3Q0UA 1SMYF 1I5ZA 3E5QA 3H5AA 4LG0B 1KYZA 1IDYA 4A69C 4H0EA 3RKYA 4BE0A 1T38A 2RN7A 5J1UA 1ETXA 2V79A 4MNUA 1QPIA 4PFOA 5LD2C 1G3SA 4JBAA 1DDNA 1LE8B 2XC7A 1ZR2A 1H88C 2ME0A 1GXQA 4XOTA 4JOMA 3ONQA 2XHKA 2RAEA 3V7SA 1B8IA 3BTLA 3NRVA 3H36A 3R4KA 4XN0A 4FTHA 3SQNA 3OR2C 4OAZA 3ZP5A 1IUYA 1E0EA 2RREA 1ONVA 3DKYA 2CV1A 1ETOA 4I09A 2V4JC 4RA2A 3SDBA 2FNAA 2DFEA 3OIPA 5D5VB 2HU9A 1HKQA 3VDXA 5BNGA 2LP0A 4EM0B 1G8XA 2R5YA 1D8KA 5LGNA 3KZZA 5IT9Z 4NBQA 2PEXA 2R7SA 1MD0A 1TL8A 1R23A 2QSGX 1FYMA 2GM4A 3DTIA 4L0YB 4IHXA 3GFJA 3CJRB 3GMEA 4CDGA 1YTYA 2E2IJ 3JRIA 3KP4A 4ZYGA 2KRFA 2KIMA 3EETA 3LMMA 1QBJA 2CGPA 1MKMA 3GFMA 4EM1A 2CW7A 2JTVA 4L9JA 5ILUA 3L2CA 1LEAA 2STWA 1D0ZA 4C30A 3V8KA 2JZYA 1IN8A 2L3DA 4XR6A 1UCRA 3M9AA 3QAHA 2Y48A 3D5LA 3GXOA 4KISA 1KU3A 3Q0VA 4LJZF 1B72B 1R6RA 2HS5A 2M0CA 3ABLH 4U7DA 2KHMA 3KYCB 2EQRA 4OIOF 4HV6A 2HTJA 1YYVA 3BQYA 2R7ZJ 2O03A 2PX9A 1Z21A 1OISA 2BHYA 1E17A 5M3MJ 2DOEA 2RDPA 3LQQA 1DGRM 4LLGF 2CFXA 4U87A 1GDTA 2YU3A 4EMSA 5J1RA 4PUSA 1YW9A 4QSHA 3LWFA 1UMQA 3ZMDA 4X0GA 4AYBN 1SD7A 5HNHA 2F5VA 2NVQJ 1MH3A 2X0LA 4OWRB 2JPBA 3SFIA 2WC2A 4Y7NJ 2VPRA 5BMZA 2R7VA 1TP4A 4IKFA 1WJDA 2VIXA 1E3OC 3K4NA 2XAGA 5EDNA 3SZPA 1ZG1A 1O57A 4E7JA 4EV0A 1HOMA 4PJ0C 1YQAA 1PP7U 1ZLJA 2DO7A 3GLXA 2LNBA 2K9MA 3CD6I 1BOBA 2JVHA 4A5MA 1IXCA 1APLC 1U5TB 2ZXIA 3G2BA 4HAMA 2RGVA 1QHHD 4Y17A 4CCOA 2R7RA 3IL2A 1TQPA 2RC4A 1G2HA 2VB6A
chains in the Genus database with same CATH topology
1FTZA 4FE4A 4D7NA 4UUSB 2YU9J 1GV5A 4DZJA 4XRSG 2NVXJ 2AO9A 1WI3A 4A3LJ 2FD5A 3Q0WA 3A03A 4G12A 1JTYA 2NVYJ 2YS9A 3ZQIA 2HOAA 4EEFG 3HOVJ 3WHCA 5FKKA 2X48A 4AC0A 1JJ6C 1GV2A 2ID6A 1WGXA 5M5XJ 2AHQA 2PMZN 3TW7A 3S16J 3JRGA 2LKXA 3WHBA 2KT0A 4Y52J 1IRZA 1JJ8C 3HBLA 4V2GA 2HOTA 1VF9A 3IH3A 1YRNA 3JRCA 5FKLA 1GVDA 4DYQA 2LTPA 4B4CA 2EH3A 4CYCB 3IH4A 2DA3A 3HEFA 2E19A 3H3VK 3TW6A 4FISA 1MSFC 3G1MA 4M6VA 2JA6J 3K2AA 4C3IJ 5EG0B 4BY7J 3PM1A 5F08A 2EBIA 2M9HA 4HNVA 4S0HB 1U9OA 3B6AA 4W1UA 2HQ5A 3BR5A 4A93J 1VFCA 2DMNA 2O8KA 2CU7A 5EF6A 2DA2A 3S17J 3HB9A 2M2EA 2XB5A 5IPAA 2Y31A 1LFUP 4FCYA 2JJ7A 4MLOA 2CJJA 5EZHA 1JUPA 1ZR4A 2K9NA 3A02A 1LE8A 1WH5A 1Z77A 2VKEA 1IJWC 1JT0A 2OPTA 2YUSA 3BG5A 4IEJA 5E3NA 3OIOA 2L7FP 5IP7J 3CMYA 1GUUA 4IHYA 5JLWA 1A5JA 1T33A 4LOCA 4B3AA 3W6VA 3MVPA 2MSYA 5FJ8J 1H8AC 1ITYA 1HDPA 5EZGA 5F1JA 5C44J 4XK4A 1AKHB 1R9TJ 1WCMJ 1UHSA 5GPAA 4RBOA 3RZOJ 1JKPC 4D5FA 1QVTA 1XG1A 1GT0C 2K9QA 3F0CA 4M3BA 2TCTA 2CRGA 1F36A 3K7AJ 4D7MA 1BJZA 3ZQHA 2W48A 4DZPA 3BR1A 5M5YJ 2JN6A 1U8BA 3GTQJ 2CUEA 2WAQN 1IUFA 1BW5A 1FTTA 9ANTA 4I6ZA 1OJLA 1IV6A 1X2NA 1FIPA 1IG7A 5DTDA 2XPWA 1JKOC 1B72A 1HDDC 2G0EA 2E2JJ 2R5ZB 4QIWN 2IBDA 4A3FJ 3LSRA 2ECBA 4A3GJ 2WB1N 2Y9YA 4IHVA 2DMQA 2M34A 3H0GJ 5EGOB 1ETWA 2ECCA 3BTJA 3M3YJ 2LD5A 1B8IB 2HOSA 2MG4A 2MGQA 1JGGA 4JX4A 5C4XJ 2DA6A 2WV1A 3S1MJ 5EYRA 5GP9A 3CQZJ 4DYRA 2LK2A 4M3EA 2EZIA 3VPRA 1OCPA 1ORKA 5HODA 1IC8A 1OCTC 1XS9A 3ZQCA 4AUXA 4A3IJ 1TWGJ 3TP3A 1LFBA 1UG2A 1NTCA 3HOXJ 4FE7A 4XRSA 2R5YB 3DEWA 4V2FA 4MIMA 3O8GA 2NOGA 3A01B 3HOYJ 1Y1VJ 1F43A 1MH4A 5FKMA 3UKGA 4JP0A 1A6IA 2XB0X 2E1OA 2XRLA 5FKOA 1W0TA 5C3EJ 3HOUJ 2DA5A 3ZQGA 2ID3A 1MBHA 2Y0SN 3C2BA 3JREA 1FIAA 1QRYA 1RETA 2EZKA 3BR2A 1VI0A 3FKIJ 5F0HA 2O7OA 4A3EJ 3MKLA 3OSFA 2VUMJ 4BBSJ 3ZOBA 3S1QJ 4RDUA 4W97A 2R92J 2EZLA 5GPCA 4IHWA 1BW6A 1MBGA 1U78A 1ZK8A 3RZDJ 1NK3P 1P7JA 1JTXA 1IDZA 1ZTRA 4UUSA 5FLMJ 3JRDA 1IGNA 3FIWA 2JA7J 4DYCA 2JA5J 4J19A 2R0QC 2L7MP 1RESA 2N8GA 1PUFB 1JT6A 3BTIA 2D5VA 1W0UA 1XC5A 2XPUA 2XGDA 2NS7A 1TWCJ 2LY9A 2HXOA 3IV5A 1K83J 1TWAJ 2LVSA 4QTRA 4B1RA 3G1OA 1ZGWA 1BL0A 4CYCA 1JUMA 3JR9A 2TRTA 3M4OJ 2KDZA 4XRMA 4BY1J 5F0FA 5EG0A 2DA4A 1FJLA 5K7ZA 3S14J 3L1PA 3HOWJ 3PO3J 1DU6A 3JRBA 1I50J 3ZQFA 3LSGA 2Y30A 1AU7A 5FKNA 1MBJA 1MNMC 4L5EA 3TP0A 5IOYA 3QPSA 4A3JJ 5IYBJ 2LR8A 4A3DJ 3RQIA 2O9LA 2COBA 4C3HJ 1NK2P 4JYKA 5DS9A 1I3QJ 2Y2ZA 5F04A 2HDDA 1JKQC 5K7HA 3JRHA 4M3DA 2VKVA 3TEDA 2FJ1A 3BG9A 1EF4A 1POGA 3HDDA 1I6HJ 2JK3A 2K40A 4A3MJ 3S2HJ 3S2DJ 5F27A 1JUSA 4GFBA 2QCOA 3BR0A 5FLVA 5F0CA 3S15J 3Q3SA 2DA7A 3LSPA 2L9RA 4A3KJ 5K7FA 1Z0XA 2QF7A 1ETYA 1D5YA 3JRAA 1YRNB 2DTZA 1ETKA 1P7IA 3G1LA 3CDLA 3FK7A 1SFOJ 2FX0A 1DU0A 1MBFA 3BQZA 3GTOJ 3LOCA 4BXXJ 3FK6A 5E3LA 3S1RJ 3BTCA 1S7EA 4UUTA 1SANA 3PO2J 2JMWA 2OF7A 2CQXA 2XPVA 3DCFA 3NARA 4DW6A 3GTKJ 1RKTA 3FISA 1WH7A 1CQTA 2DJNA 3Q0UA 3GTMJ 1ETQA 2JA8J 1U9NA 1FEXA 2XGCA 1IDYA 4X1EA 4A69C 2R5ZA 2E2HJ 2L7ZA 5J1UA 1ETXA 2M8GX 3QQAA 3SDGA 1QPIA 5JLXA 1TWFJ 5EGOA 2DMTA 2NS8A 1LE8B 1ZR2A 2XSDC 2ME0A 2IAIA 1H88C 4A3BJ 1B8IA 5J3LA 2RAEA 3HM5A 3BTLA 2XGEA 3BT9A 2VI6A 4FTHA 1ETVA 1RR7A 3HGYA 4MFDA 2HYJA 3BR6A 1VNDA 1ETOA 2GBYA 5E3MA 4JX6A 2LLKA 2GLOA 5BNGA 3BR3A 3SJMA 1O4XA 2X9DA 2NVTJ 1WPKA 1T56A 2LP0A 2X6OA 3HKZN 5IYCJ 2R5YA 1Y1WJ 4BKXA 1MBKA 4M3GA 4NDLA 2GM4A 5E3OA 4IHXA 3A01A 3I4NJ 5IP9J 5M3FJ 2CQQA 2E2IJ 3JRIA 3HOZJ 4D5CA 5EEAA 2L0KA 1ZQ3P 1BA5A 3LSJA 3GTGJ 1HLVA 2B63J 2H8RA 5IYDJ 2P81A 3Q0VA 3GTJJ 1B72B 3GBGA 2FQ4A 3E7LA 2M0CA 1K61A 2ELKA 2EQRA 2EZHA 4XIDA 3RKQA 3BQYA 2R7ZJ 4MFEA 3JRFA 5M3MJ 4XICA 4ABZA 3I4MJ 2IEKA 1GDTA 3MN2A 5J1RA 1Q1VA 4X6AJ 1HF0A 1PUFA 3OSGA 4QSHA 2H1KA 1UMQA 4M3FA 4BBRJ 3IH2A 3LNQA 5J1YA 4AYBN 4I76A 2NVQJ 1QVUA 1MH3A 2DA1A 3CCYA 3SFIA 3B6CA 2DN0A 2I10A 2Y9ZA 1OFCX 1RPWA 4Y7NJ 4JX5A 2LFBA 2VPRA 2HI3A 2ME6A 5IOZA 2DMUA 5IP6A 3D1NI 3ZQLA 1E3OC 1TC3C 2JWTA 5EDNA 1MBEA 3GTPJ 1TWHJ 1HOMA 2K9SA 3NAUA 1AKHA 1MSEC 5M5WJ 4C3JJ 3GTLJ 3BG3A 3O8HA 4C2MJ 2MW8A 1H89C 2HXIA 3OOUA 1X58A 1AHDP 1JKRC 4A3CJ 4MO7A 1APLC 2ZB9A 1HCRA 1ENHA 1RKWA 1X2MA 2CUFA 3QPLA 2R93J 3S1NJ 5C4JJ 3HGGA 2DMPA 1G2HA 1ZKGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FTZ A;  4FE4 A;  4D7N A;  4UUS B;  2YU9 J;  1GV5 A;  4DZJ A;  4XRS G;  2NVX J;  2AO9 A;  1WI3 A;  4A3L J;  2FD5 A;  3Q0W A;  3A03 A;  4G12 A;  1JTY A;  2NVY J;  2YS9 A;  3ZQI A;  2HOA A;  4EEF G;  3HOV J;  3WHC A;  5FKK A;  2X48 A;  4AC0 A;  1JJ6 C;  1GV2 A;  2ID6 A;  1WGX A;  5M5X J;  2AHQ A;  2PMZ N;  3TW7 A;  3S16 J;  3JRG A;  2LKX A;  3WHB A;  2KT0 A;  4Y52 J;  1IRZ A;  1JJ8 C;  3HBL A;  4V2G A;  2HOT A;  1VF9 A;  3IH3 A;  1YRN A;  3JRC A;  5FKL A;  1GVD A;  4DYQ A;  2LTP A;  4B4C A;  2EH3 A;  4CYC B;  3IH4 A;  2DA3 A;  3HEF A;  2E19 A;  3H3V K;  3TW6 A;  4FIS A;  1MSF C;  3G1M A;  4M6V A;  2JA6 J;  3K2A A;  4C3I J;  5EG0 B;  4BY7 J;  3PM1 A;  5F08 A;  2EBI A;  2M9H A;  4HNV A;  4S0H B;  1U9O A;  3B6A A;  4W1U A;  2HQ5 A;  3BR5 A;  4A93 J;  1VFC A;  2DMN A;  2O8K A;  2CU7 A;  5EF6 A;  2DA2 A;  3S17 J;  3HB9 A;  2M2E A;  2XB5 A;  5IPA A;  2Y31 A;  1LFU P;  4FCY A;  2JJ7 A;  4MLO A;  2CJJ A;  5EZH A;  1JUP A;  1ZR4 A;  2K9N A;  3A02 A;  1LE8 A;  1WH5 A;  1Z77 A;  2VKE A;  1IJW C;  1JT0 A;  2OPT A;  2YUS A;  3BG5 A;  4IEJ A;  5E3N A;  3OIO A;  2L7F P;  5IP7 J;  3CMY A;  1GUU A;  4IHY A;  5JLW A;  1A5J A;  1T33 A;  4LOC A;  4B3A A;  3W6V A;  3MVP A;  2MSY A;  5FJ8 J;  1H8A C;  1ITY A;  1HDP A;  5EZG A;  5F1J A;  5C44 J;  4XK4 A;  1AKH B;  1R9T J;  1WCM J;  1UHS A;  5GPA A;  4RBO A;  3RZO J;  1JKP C;  4D5F A;  1QVT A;  1XG1 A;  1GT0 C;  2K9Q A;  3F0C A;  4M3B A;  2TCT A;  2CRG A;  1F36 A;  3K7A J;  4D7M A;  1BJZ A;  3ZQH A;  2W48 A;  4DZP A;  3BR1 A;  5M5Y J;  2JN6 A;  1U8B A;  3GTQ J;  2CUE A;  2WAQ N;  1IUF A;  1BW5 A;  1FTT A;  9ANT A;  4I6Z A;  1OJL A;  1IV6 A;  1X2N A;  1FIP A;  1IG7 A;  5DTD A;  2XPW A;  1JKO C;  1B72 A;  1HDD C;  2G0E A;  2E2J J;  2R5Z B;  4QIW N;  2IBD A;  4A3F J;  3LSR A;  2ECB A;  4A3G J;  2WB1 N;  2Y9Y A;  4IHV A;  2DMQ A;  2M34 A;  3H0G J;  5EGO B;  1ETW A;  2ECC A;  3BTJ A;  3M3Y J;  2LD5 A;  1B8I B;  2HOS A;  2MG4 A;  2MGQ A;  1JGG A;  4JX4 A;  5C4X J;  2DA6 A;  2WV1 A;  3S1M J;  5EYR A;  5GP9 A;  3CQZ J;  4DYR A;  2LK2 A;  4M3E A;  2EZI A;  3VPR A;  1OCP A;  1ORK A;  5HOD A;  1IC8 A;  1OCT C;  1XS9 A;  3ZQC A;  4AUX A;  4A3I J;  1TWG J;  3TP3 A;  1LFB A;  1UG2 A;  1NTC A;  3HOX J;  4FE7 A;  4XRS A;  2R5Y B;  3DEW A;  4V2F A;  4MIM A;  3O8G A;  2NOG A;  3A01 B;  3HOY J;  1Y1V J;  1F43 A;  1MH4 A;  5FKM A;  3UKG A;  4JP0 A;  1A6I A;  2XB0 X;  2E1O A;  2XRL A;  5FKO A;  1W0T A;  5C3E J;  3HOU J;  2DA5 A;  3ZQG A;  2ID3 A;  1MBH A;  2Y0S N;  3C2B A;  3JRE A;  1FIA A;  1QRY A;  1RET A;  2EZK A;  3BR2 A;  1VI0 A;  3FKI J;  5F0H A;  2O7O A;  4A3E J;  3MKL A;  3OSF A;  2VUM J;  4BBS J;  3ZOB A;  3S1Q J;  4RDU A;  4W97 A;  2R92 J;  2EZL A;  5GPC A;  4IHW A;  1BW6 A;  1MBG A;  1U78 A;  1ZK8 A;  3RZD J;  1NK3 P;  1P7J A;  1JTX A;  1IDZ A;  1ZTR A;  4UUS A;  5FLM J;  3JRD A;  1IGN A;  3FIW A;  2JA7 J;  4DYC A;  2JA5 J;  4J19 A;  2R0Q C;  2L7M P;  1RES A;  2N8G A;  1PUF B;  1JT6 A;  3BTI A;  2D5V A;  1W0U A;  1XC5 A;  2XPU A;  2XGD A;  2NS7 A;  1TWC J;  2LY9 A;  2HXO A;  3IV5 A;  1K83 J;  1TWA J;  2LVS A;  4QTR A;  4B1R A;  3G1O A;  1ZGW A;  1BL0 A;  4CYC A;  1JUM A;  3JR9 A;  2TRT A;  3M4O J;  2KDZ A;  4XRM A;  4BY1 J;  5F0F A;  5EG0 A;  2DA4 A;  1FJL A;  5K7Z A;  3S14 J;  3L1P A;  3HOW J;  3PO3 J;  1DU6 A;  3JRB A;  1I50 J;  3ZQF A;  3LSG A;  2Y30 A;  1AU7 A;  5FKN A;  1MBJ A;  1MNM C;  4L5E A;  3TP0 A;  5IOY A;  3QPS A;  4A3J J;  5IYB J;  2LR8 A;  4A3D J;  3RQI A;  2O9L A;  2COB A;  4C3H J;  1NK2 P;  4JYK A;  5DS9 A;  1I3Q J;  2Y2Z A;  5F04 A;  2HDD A;  1JKQ C;  5K7H A;  3JRH A;  4M3D A;  2VKV A;  3TED A;  2FJ1 A;  3BG9 A;  1EF4 A;  1POG A;  3HDD A;  1I6H J;  2JK3 A;  2K40 A;  4A3M J;  3S2H J;  3S2D J;  5F27 A;  1JUS A;  4GFB A;  2QCO A;  3BR0 A;  5FLV A;  5F0C A;  3S15 J;  3Q3S A;  2DA7 A;  3LSP A;  2L9R A;  4A3K J;  5K7F A;  1Z0X A;  2QF7 A;  1ETY A;  1D5Y A;  3JRA A;  1YRN B;  2DTZ A;  1ETK A;  1P7I A;  3G1L A;  3CDL A;  3FK7 A;  1SFO J;  2FX0 A;  1DU0 A;  1MBF A;  3BQZ A;  3GTO J;  3LOC A;  4BXX J;  3FK6 A;  5E3L A;  3S1R J;  3BTC A;  1S7E A;  4UUT A;  1SAN A;  3PO2 J;  2JMW A;  2OF7 A;  2CQX A;  2XPV A;  3DCF A;  3NAR A;  4DW6 A;  3GTK J;  1RKT A;  3FIS A;  1WH7 A;  1CQT A;  2DJN A;  3Q0U A;  3GTM J;  1ETQ A;  2JA8 J;  1U9N A;  1FEX A;  2XGC A;  1IDY A;  4X1E A;  4A69 C;  2R5Z A;  2E2H J;  2L7Z A;  5J1U A;  1ETX A;  2M8G X;  3QQA A;  3SDG A;  1QPI A;  5JLX A;  1TWF J;  5EGO A;  2DMT A;  2NS8 A;  1LE8 B;  1ZR2 A;  2XSD C;  2ME0 A;  2IAI A;  1H88 C;  4A3B J;  1B8I A;  5J3L A;  2RAE A;  3HM5 A;  3BTL A;  2XGE A;  3BT9 A;  2VI6 A;  4FTH A;  1ETV A;  1RR7 A;  3HGY A;  4MFD A;  2HYJ A;  3BR6 A;  1VND A;  1ETO A;  2GBY A;  5E3M A;  4JX6 A;  2LLK A;  2GLO A;  5BNG A;  3BR3 A;  3SJM A;  1O4X A;  2X9D A;  2NVT J;  1WPK A;  1T56 A;  2LP0 A;  2X6O A;  3HKZ N;  5IYC J;  2R5Y A;  1Y1W J;  4BKX A;  1MBK A;  4M3G A;  4NDL A;  2GM4 A;  5E3O A;  4IHX A;  3A01 A;  3I4N J;  5IP9 J;  5M3F J;  2CQQ A;  2E2I J;  3JRI A;  3HOZ J;  4D5C A;  5EEA A;  2L0K A;  1ZQ3 P;  1BA5 A;  3LSJ A;  3GTG J;  1HLV A;  2B63 J;  2H8R A;  5IYD J;  2P81 A;  3Q0V A;  3GTJ J;  1B72 B;  3GBG A;  2FQ4 A;  3E7L A;  2M0C A;  1K61 A;  2ELK A;  2EQR A;  2EZH A;  4XID A;  3RKQ A;  3BQY A;  2R7Z J;  4MFE A;  3JRF A;  5M3M J;  4XIC A;  4ABZ A;  3I4M J;  2IEK A;  1GDT A;  3MN2 A;  5J1R A;  1Q1V A;  4X6A J;  1HF0 A;  1PUF A;  3OSG A;  4QSH A;  2H1K A;  1UMQ A;  4M3F A;  4BBR J;  3IH2 A;  3LNQ A;  5J1Y A;  4AYB N;  4I76 A;  2NVQ J;  1QVU A;  1MH3 A;  2DA1 A;  3CCY A;  3SFI A;  3B6C A;  2DN0 A;  2I10 A;  2Y9Z A;  1OFC X;  1RPW A;  4Y7N J;  4JX5 A;  2LFB A;  2VPR A;  2HI3 A;  2ME6 A;  5IOZ A;  2DMU A;  5IP6 A;  3D1N I;  3ZQL A;  1E3O C;  1TC3 C;  2JWT A;  5EDN A;  1MBE A;  3GTP J;  1TWH J;  1HOM A;  2K9S A;  3NAU A;  1AKH A;  1MSE C;  5M5W J;  4C3J J;  3GTL J;  3BG3 A;  3O8H A;  4C2M J;  2MW8 A;  1H89 C;  2HXI A;  3OOU A;  1X58 A;  1AHD P;  1JKR C;  4A3C J;  4MO7 A;  1APL C;  2ZB9 A;  1HCR A;  1ENH A;  1RKW A;  1X2M A;  2CUF A;  3QPL A;  2R93 J;  3S1N J;  5C4J J;  3HGG A;  2DMP A;  1G2H A;  1ZKG A; 
#chains in the Genus database with same CATH topology
 1FTZ A;  3TQN A;  2XUB A;  4FE4 A;  3L09 A;  3GF2 A;  3VSK A;  4ASN A;  2IGN A;  2YU9 J;  2A61 A;  4XRS G;  2AO9 A;  2EFQ A;  2FML A;  2KDO A;  5B1B H;  4A3L J;  1ZAO A;  2R7O A;  1R4M B;  3A03 A;  3Q0W A;  1IO2 A;  1JTY A;  2NVY J;  3ZQI A;  2HOA A;  3G3Z A;  1T95 A;  3WHC A;  3PNV A;  2KIS A;  2MH2 A;  2ID6 A;  5E1W A;  4HRI A;  2DTR A;  4F55 A;  1BC8 C;  1D1A A;  3JSP A;  2AHQ A;  2KJB A;  1FPQ A;  3S16 J;  4YFK F;  2Q8K A;  4BUP A;  3VFZ A;  2M1B A;  3A1Y A;  3P7N A;  4E7S A;  2HEO A;  2XV4 S;  3U21 A;  2DCE A;  5CLS A;  2IW5 A;  1YRN A;  5FKL A;  3EUK L;  2V7F A;  3SZG A;  2P6S A;  1GVD A;  4EJT A;  2ZSI B;  1SFE A;  2LTP A;  3QOP A;  3AFH A;  2EH3 A;  2V26 A;  4WF2 A;  1SFU A;  2H09 A;  2EV6 A;  2E71 A;  2DYS H;  2EWN A;  4FIS A;  1MSF C;  2LC2 A;  2HYG D;  3G1M A;  3L7W A;  3HZJ A;  3BRO A;  3K2A A;  3PSF A;  4M6V A;  2KMU A;  3J7Y J;  3PM1 A;  1UB9 A;  2XRO A;  2H27 A;  4XN3 A;  2M9H A;  3HUG A;  2DPU A;  1USS A;  2XAQ A;  2QM3 A;  2H94 A;  2O8K A;  2CU7 A;  3S17 J;  2GOM A;  3HB9 A;  2KPM A;  3GZ5 A;  5E79 C;  2QSF X;  3OYH A;  4FAS D;  1V4R A;  5CVV A;  2CQK A;  2KJC A;  4NC7 A;  3FM5 A;  2Z2S B;  4BXU A;  4MLO A;  2QSH X;  1SAU A;  2LSO A;  1SAX A;  2CFO A;  1ZR4 A;  3A02 A;  4EVI A;  4KIG A;  4CCL A;  2MC3 A;  4P96 A;  2VKE A;  2A6H F;  4ZTF A;  1IJW C;  4EJO A;  1JT0 A;  2OA4 A;  2JUG A;  2L01 A;  4IEJ A;  4BAY A;  5AIQ A;  5D8K B;  2L7F P;  2LKP A;  1V54 H;  5D4S A;  1A5J A;  1T98 A;  1X1C A;  3MVP A;  1D5V A;  2B7E A;  4Q47 A;  4EJU A;  3WG7 H;  2LOO A;  1IW7 F;  2BOL A;  2DOF A;  5D6E A;  1ITY A;  1W4M A;  5EZG A;  3ERM A;  3OYL A;  1WHU A;  4XON A;  2KIF A;  1UHS A;  2R7F A;  4YEL A;  4RBO A;  3LST A;  3P9K A;  3CJN A;  1XG1 A;  1MJ9 A;  3CCE I;  2F48 A;  3K4B A;  2I5U A;  3RCO A;  1R5H A;  3DQV C;  3ZQH A;  3WOD F;  3B02 A;  2ESN A;  1T0F C;  4LK1 F;  2HVQ A;  1U8B A;  1IUF A;  2A05 A;  2E1M B;  3KCC A;  5A2Q Z;  2VE9 A;  4L18 B;  1HKT A;  5IT3 A;  1FTT A;  4N9H A;  4I6Z A;  1X2N A;  1BI1 A;  2JA2 A;  4ESB A;  1Y39 A;  1Y8Q B;  4BXF A;  3QYF A;  3FXU A;  2W1O A;  1SVO A;  2DT7 B;  4BH9 A;  3HOT A;  1BR4 A;  1W5S A;  2ECB A;  1T6S A;  2VAS A;  1YIJ I;  2WB1 N;  3L9F A;  3HTU A;  2STT A;  3PQK A;  1JXS A;  3F72 A;  2M34 A;  1WI9 A;  3BTJ A;  3M3Y J;  1D8J A;  1LNW A;  1YW7 A;  1U3E M;  5TIS C;  3M8E A;  4AIJ A;  1K4T A;  4E6K G;  2PG4 A;  2LG4 A;  4AVZ A;  3K1N A;  3LSM A;  4U88 A;  2D2W A;  4M3E A;  4CCK A;  2IS2 A;  4HPQ A;  3E6M A;  2F5D A;  1XS9 A;  3ZQC A;  4ZDL A;  1FP2 A;  1TWG J;  5TRD A;  1UG2 A;  1WJE A;  3OWT A;  4XRS A;  3DEW A;  1MJB A;  2P4W A;  1V3F A;  2F4I A;  1LFP A;  1X4P A;  3A01 B;  3U2R A;  5JVT A;  1FX7 A;  1EH8 A;  4HDU A;  1ZH5 A;  3UKG A;  4P9F A;  1FOX A;  3K6G A;  2K5C A;  2XB0 X;  3RPU A;  2E1O A;  2O0Y A;  2XRL A;  5FKO A;  1K78 A;  1MBH A;  1WJC A;  3JRE A;  1QRY A;  2EZK A;  4UVA A;  4A3E J;  3BY6 A;  4BE1 A;  1J0R A;  2RV8 A;  3IKT A;  3C1D A;  1ERD A;  1QZY A;  1DQU A;  2R92 J;  1JE8 A;  2E1N A;  2KLO A;  2VXZ A;  1R5G A;  2IXS A;  1MMD A;  2PN6 A;  4UUS A;  2HPI A;  3JTH A;  5IT9 K;  2ZBK A;  1RES A;  2LBF A;  2N8G A;  1PUF B;  2R4G A;  2YSR A;  4XLP F;  1IV8 A;  3ZR8 X;  3AG3 H;  3HSE A;  2VBZ A;  4CZC A;  4QPO A;  2E1M C;  3DFG A;  3HRM A;  3KEY A;  4A0X A;  4BJ6 C;  3FMR A;  3EQL F;  4D1Q A;  3MZ8 A;  3I58 A;  3W3C A;  4MQ9 F;  4N4N B;  3G4S I;  4QTR A;  1TT5 B;  3RKX A;  3MFK A;  3CUQ B;  4KYW A;  2IA1 A;  5E17 F;  3PNY A;  3FBI B;  3V8L A;  2JPC A;  4DGW B;  1DP7 P;  2A5W A;  3VOD A;  4CYC A;  3PSI A;  3TOA A;  1H9G A;  4BQN A;  3N97 A;  4XRM A;  4UNO A;  1Z6R A;  3FBN B;  4P1W A;  5F0F A;  1R58 A;  3ZCO A;  5K7Z A;  3FM3 A;  1E3H A;  3ZQF A;  2XGX A;  1Q1H A;  1MNM C;  4L5E A;  3TP0 A;  5E8I A;  1EKE A;  3FDY A;  5IOY A;  3DEU A;  2OV7 A;  3PFI A;  1YX5 A;  2EFN A;  2NNN A;  2E35 A;  5IYB J;  2LR8 A;  4A3D J;  4H4K C;  3RQI A;  3SFZ A;  3SZT A;  2ISY A;  4LK0 F;  2Y2Z A;  3WTT C;  3COA C;  3CCR I;  3GLL A;  2CH0 A;  1V5G A;  4Y3O A;  3HXL A;  2MC4 A;  3GUD A;  1OYI A;  4AYB A;  3TO9 A;  3GW2 A;  3FXR A;  4NQW B;  3TED A;  1HBX G;  2VOP A;  3LAJ A;  5D5X B;  4ETS A;  1DUX C;  3TDU C;  4A3M J;  4IOC F;  3S2D J;  5AON A;  5ICF A;  2DAO A;  3GEZ A;  1OYY A;  4BJ5 C;  3N4M A;  2YR2 A;  1Z3Y A;  1G3T A;  5DCF A;  1SC7 A;  3PIO F;  1RUO A;  4WXD A;  3ZMV A;  5F0C A;  4HNU A;  4XMY A;  1XPX A;  1YW8 A;  2CYY A;  3OS1 A;  2VE8 A;  3CCL I;  1BIA A;  2XF7 A;  3F8N A;  2DPD A;  1XGO A;  2WAE A;  3ULQ B;  4PZJ A;  3KP2 A;  3P9I A;  5HDG A;  3D5R C;  3E6C C;  3EUH C;  3GO5 A;  4CCN A;  2X51 A;  4CYD A;  1YX3 A;  3FK7 A;  2FX0 A;  2R7T A;  1I6X A;  3P5J A;  4KN7 X;  3GVA A;  3L2V A;  1AOY A;  3LOC A;  1S7E A;  4LG3 A;  1ZGJ A;  2BY0 A;  1SVM A;  5KNL A;  4Z6Y A;  1T39 A;  2IGM A;  3GTK J;  2JVG A;  1Z91 A;  1PYV A;  1WH7 A;  4CUG A;  3GTM J;  3DTK A;  4EQQ A;  2UUZ A;  3CC4 I;  3KX2 A;  1JHH A;  3JAM Z;  3KIO A;  3NWS A;  5HS8 A;  2X1D A;  3AAF A;  3WU2 C;  2ZXW H;  2CW8 A;  3FXQ A;  2J5P A;  3PFY A;  2MD5 A;  5CPR B;  1T08 B;  1G3Y A;  3K2Z A;  5JLX A;  3VYS B;  5D4R A;  1LPQ A;  2XSD C;  2IAI A;  2FQ3 A;  4WXH A;  4A3B J;  3CP2 A;  5J3L A;  5DCM A;  1FZP B;  1Z3X A;  5LEJ A;  2M0M A;  2XGE A;  3J7A Y;  4GYG A;  1ZRC A;  1W1W E;  2VI6 A;  2DQL A;  1R7J A;  4M9Z A;  3HG9 A;  4M71 A;  3HGY A;  2XAU A;  1TLH B;  3VSL A;  2HDC A;  2HYJ A;  5LFA A;  3BR6 A;  2O6G E;  1VND A;  3CP8 A;  3ZQQ A;  3T8T A;  4JX6 A;  1GHC A;  1HXD A;  2GLO A;  1YJ9 I;  3OYD A;  2EIN H;  4RAG A;  1XSX A;  2MAB A;  2X9D A;  4ZYA A;  1DPR A;  1WPK A;  1F9N A;  1YIO A;  2OCC H;  2QEN A;  4B47 A;  5FLX Z;  3CCS I;  3S3O A;  2X6O A;  1SVL A;  3FKJ A;  4FX0 A;  1YJN I;  2UV1 A;  1B1B A;  2EA4 A;  2O5R A;  4NDL A;  2ZME B;  2DFI A;  2FBK A;  2BXY A;  3GFI A;  2R3S A;  3HL2 A;  3G73 A;  4D5C A;  4HG2 A;  2GWR A;  1P4X A;  2QQ9 A;  3IRQ A;  1FY7 A;  3QWL A;  3V8J A;  2ZNY A;  2UXN A;  1S5L C;  1GVJ A;  2QA4 I;  2VOD A;  3GTG J;  2B63 J;  4XSX F;  2GIV A;  4OAY A;  5IYD J;  4CCM A;  3WTS C;  4HX8 A;  2L5Q A;  2HZD A;  2P81 A;  1Z7U A;  3IC7 A;  4UV9 A;  2FQ4 A;  4HV5 A;  1KON A;  1K61 A;  4L9V A;  4XID A;  3I59 A;  3WTY C;  2LMD A;  3RKQ A;  5E1X A;  3DBL B;  3WE2 A;  4MFE A;  1ULY A;  1X19 A;  1VQ6 I;  4F92 B;  4ABZ A;  4XIC A;  1TW2 A;  2V1X A;  3PL8 A;  4PJL A;  3J81 Z;  3I4M J;  4BYY A;  4DIQ A;  2IEK A;  2GQQ A;  2WAF A;  2Z99 A;  3MN2 A;  2VQG A;  1HF0 A;  1FMV A;  3FXL A;  3M1C A;  2RNJ A;  1HW1 A;  2OBP A;  4M3F A;  4I02 A;  3FXM A;  2E1C A;  1WJB A;  3DP7 A;  2DOD A;  2V1N A;  2QUF A;  3FX3 A;  3SXY A;  1V55 H;  2DA1 A;  3RTR A;  5A2Q K;  2ICW G;  1OFC X;  1KU2 A;  4JX5 A;  4A6E A;  2HI3 A;  4HST A;  4BQQ A;  4BNC A;  2E34 A;  2HWV A;  1P4A A;  5IP6 A;  5DM7 F;  1TZL A;  3TDZ C;  4AWX B;  1TC3 C;  1H9T A;  2Y69 H;  5HS9 A;  2FF4 A;  3GZN B;  3ABM H;  3OOP A;  4DBR A;  1TWH J;  3MD2 A;  2K9S A;  3NAU A;  1PVE A;  1AKH A;  1MSE C;  4YEJ A;  2M30 A;  2CO5 A;  4N0B A;  3DEE A;  2YPR A;  3U1K A;  1BN5 A;  1SD5 A;  1YIT I;  4IVN A;  1WQ2 A;  1WJ5 A;  2VT2 A;  4YFX F;  3ABK H;  4RGS A;  2WB1 A;  4A0Z A;  3OYF A;  2ZB9 A;  4PJN A;  5HDN A;  2CSO A;  1YS6 A;  4UY8 I;  1X2M A;  2CUF A;  3QPL A;  1VQO I;  3S1N J;  5C4J J;  3BCA A;  1OCO H;  3G6E I;  1ZKG A;  2Z33 A;  4CHU A;  2BBY A;  1SEU A;  2E36 A;  1X3W B;  4DZJ A;  2LH9 A;  4HW0 A;  2IP2 A;  1LQ1 A;  2ZME C;  2R7W A;  2ZJP F;  3T5X A;  2FEZ A;  1DPU A;  1R1T A;  2LRD A;  1UFM A;  1FBQ A;  3ZMU A;  3CLO A;  1FWZ A;  4ZYE A;  3OYN A;  4J01 A;  4BQA A;  1J59 A;  3BZC A;  1HST A;  2ADU A;  4G6D A;  3OS2 A;  1C0W A;  2V1D A;  5J40 A;  4BDY A;  3TW7 A;  4Q5S F;  2LKX A;  2HOE A;  2VLA A;  4UB6 C;  5FO5 A;  3OYG A;  1IRF A;  5CYV A;  3ZPL A;  2Q1Z B;  2HOT A;  1VF9 A;  3IH3 A;  4XM3 A;  5FD6 A;  3BC8 A;  4CCJ A;  2WY7 Q;  2CV2 A;  4DYQ A;  1XB4 A;  1S6L A;  4RAZ A;  1LKX A;  4OIP F;  3HSF A;  3IH4 A;  2DA3 A;  2CWE A;  3I0T A;  4MQV A;  1O7L A;  2E19 A;  3H3V K;  2K85 A;  2P7V B;  3TW6 A;  2NRA C;  4ZTJ A;  2E7X A;  4LD5 A;  2QEX I;  1A36 A;  5EG0 B;  2X6X A;  2OAZ A;  1ZHF A;  1IN4 A;  3OL4 A;  1R1V A;  3K4M A;  4W1U A;  2F5E A;  4FX4 A;  2QKM B;  2DK8 A;  2DMN A;  4HNT A;  2MH9 A;  1VQM I;  2BZT A;  1YJW I;  4LG0 A;  2Y31 A;  4CH7 A;  1LFU P;  4FCY A;  2WAD A;  3WGG A;  3NEU A;  4B44 A;  2CJJ A;  2XKP A;  2HVS A;  2K9N A;  1WZ2 A;  1LE8 A;  3BWG A;  1R36 A;  5EEH A;  1LDJ A;  1NG6 A;  1UJ8 A;  3M1E A;  2OU2 A;  5F64 A;  2L4M A;  5KAF C;  4NUB A;  1QGP A;  2L2O A;  5IP7 J;  3CMY A;  3PNT A;  2V9P A;  3HYI A;  5JI6 A;  5JLW A;  3W2V A;  3CJT B;  4B3A A;  2E7W A;  3DWL E;  1MGT A;  3D5S C;  5FJ8 J;  2GOX B;  4P55 A;  5GAD J;  3GYH X;  3BPV A;  4KA4 A;  2ZJR F;  2P5L C;  1NG7 A;  4UVB A;  2JRM A;  1R9T J;  3RZO J;  2M5W A;  4UV8 A;  2E5N A;  2ZFU A;  3UR3 C;  5L3G A;  2QBY B;  3I55 I;  2FMY A;  1BC7 C;  3WTU C;  2K9Q A;  3F0C A;  2GA2 A;  3GFL A;  1OPC A;  3BJO A;  3K7A J;  4D7M A;  1BJZ A;  1VQK I;  2W48 A;  2VQH A;  3CCV I;  5M5Y J;  2JN6 A;  3HSR A;  3H1C A;  2CUE A;  1MMS A;  1BW5 A;  4XLN F;  9ANT A;  3ZQ7 A;  3NQO A;  4KFC A;  1OJL A;  3BP8 A;  1IG7 A;  5DTD A;  2QZ8 A;  2R7D A;  1B72 A;  2E2J J;  3BJA A;  2R5Z B;  4QIW N;  2IBD A;  3C3W A;  4IHS A;  4PCQ A;  2CQN A;  1VQL I;  2P7C B;  2GXA A;  4KMF A;  1FSE A;  4IHV A;  2DMQ A;  3H0G J;  5EGO B;  5H6Q A;  3RSN A;  2ZC2 A;  1ETW A;  4I7H A;  2EIL H;  2M8E A;  1L3L A;  1KQ8 A;  4BEH B;  3CDI A;  4M74 A;  4E7K A;  2MGQ A;  4R79 A;  2Y75 A;  3CMA I;  1SD6 A;  2DYR H;  3DU5 A;  1MNE A;  2RKH A;  1BR2 A;  2ZFW A;  4DBQ A;  3M8J A;  3ZGK A;  1W7P A;  2LK2 A;  1KU7 A;  1Z7L A;  4CSW A;  2EZI A;  1W5C C;  1XCV A;  1ORK A;  5HOD A;  4QLC U;  1P92 A;  2BY1 A;  3SHF A;  3L2Q A;  2PBI A;  1TBX A;  4ESF A;  2VN2 A;  5FFZ A;  3F6O A;  2W24 A;  2HZT A;  3I3L A;  2XRN A;  3RPQ A;  2JSC A;  4FE7 A;  1MDM A;  1OCC H;  4V2F A;  3V7C A;  1S72 I;  3JAM K;  3RKW A;  3OYB A;  3HOY J;  2VJI A;  2CQ7 A;  2BHZ A;  1WJF A;  3DU6 A;  2HTS A;  2X6Y A;  1MH4 A;  1CF7 B;  1A6I A;  4HEA 2;  2XF5 A;  2P5K A;  4RLQ A;  1RET A;  1TQI A;  1UHM A;  1I1S A;  5BQT A;  3MKL A;  2XKO A;  2M87 A;  3EPZ A;  4HX4 A;  5J4Y A;  1U5T A;  2IS1 A;  4ZH4 F;  3VWB A;  2WV0 A;  4W97 A;  5LGU A;  2EZL A;  2EJR A;  5GPC A;  1LEB A;  1ZG3 A;  1U2W A;  1BW6 A;  3KE2 A;  1MBG A;  4B43 A;  4IHW A;  2HPM A;  2K9L A;  1XSD A;  3HIF A;  1ZTR A;  2VKD A;  3AKZ A;  4BJT A;  4Y4R A;  2K7L A;  2PMU A;  1O7F A;  3FIW A;  1T0F A;  2JA7 J;  1RRJ A;  2HQA A;  2Z3Y A;  3VEP A;  4XLA A;  4XLH A;  4F7Z A;  4G7Z F;  2XGD A;  1SMT A;  2NS7 A;  1TWC J;  4Y15 A;  4OIR F;  3V42 A;  1B59 A;  1OCZ H;  3CC2 I;  1KGS A;  2EV0 A;  4PGG A;  5FD5 A;  1OMI A;  1WVR A;  3K4C A;  3OYJ A;  2AQE A;  2LVS A;  3O6B B;  3WU1 B;  1B6A A;  4LMY A;  5ICG A;  4B1R A;  2FOW A;  3TOB A;  3RJP A;  5HLI A;  4G8X A;  3BOQ A;  4HBL A;  5K5R A;  1NH3 A;  4RGX A;  3VYU B;  3JR9 A;  1YHQ I;  1IRX A;  3RDI A;  2TRT A;  4G9Y A;  4ON0 A;  2BE5 F;  3IHU A;  2KDZ A;  2AQF A;  4HOB A;  1XGS A;  3HOW J;  2DU9 A;  2XAJ A;  1BR1 A;  4A6D A;  3J81 K;  3JRB A;  2ISZ A;  4E7H A;  5BPD A;  3MMY B;  4BQO A;  5LHI A;  3LSG A;  2JQ7 A;  3OIQ A;  1FP1 D;  1AU7 A;  1MBJ A;  1UZC A;  3OL3 A;  1MMG A;  2BW3 A;  4XSZ F;  3H5R A;  1ZRE A;  2CV0 A;  4R8H A;  4JYK A;  2H1L A;  2H8W A;  3LSI A;  2NNY A;  5J6X A;  1BJA A;  2PLY A;  3JRH A;  4ANJ A;  2FJ1 A;  3A0H C;  2FA5 A;  2W85 A;  4HYE A;  1EF4 A;  5ICC A;  2DFF A;  3HDD A;  2VXD A;  3CCU I;  2JK3 A;  4EJW A;  5GTH C;  3S2H J;  1ZRF A;  2W82 A;  5ED4 A;  5F27 A;  1JUS A;  2W57 A;  4M9X A;  2HKX A;  3BR0 A;  2HFH A;  2WAQ A;  4HF0 A;  1HA8 A;  3LSP A;  3WGH A;  1Y6I A;  1Z0X A;  5JHF A;  3S32 A;  2COM A;  3LAP A;  1ETY A;  3LA3 A;  4RM3 A;  3TBI A;  4II2 A;  2M4G A;  1P7I A;  3G1L A;  2VOO A;  2KRC A;  2HDW A;  4RB2 C;  3OMY A;  5CVI A;  3A2K A;  5FRO A;  2R7X A;  1RNL A;  3L2R A;  3ZMZ A;  2EIK H;  2VJ5 A;  4BXX J;  2V9V A;  2EK5 A;  1J7K A;  1SAN A;  3T8R A;  3NAR A;  2EFO A;  1LDD A;  3E97 A;  1RKT A;  4IX7 A;  3R0A A;  1CQT A;  2G7H A;  2DJN A;  2OTJ I;  4C9Y A;  1XD7 A;  2JA8 J;  1U9N A;  1QQI A;  1Z6T A;  5HVQ C;  2L02 A;  2CS3 A;  2E2H J;  2L7Z A;  4KMU X;  2MLG A;  3F21 A;  1UEL B;  3KP7 A;  3JCU C;  2KKO A;  4F3Q A;  1YG2 A;  1W36 C;  4K2E A;  4AIK A;  2HVR A;  2DMT A;  4U0Y A;  2NS8 A;  3J7Z I;  1O3T A;  2Z16 A;  3ECO A;  4HX7 A;  3HM5 A;  5HLT A;  4F91 B;  3BT9 A;  2OJE D;  5DEQ A;  1RR7 A;  2Q2E B;  1OQY A;  1YS7 A;  3VYR B;  3F22 A;  1OR7 A;  1ZN2 A;  4NHJ A;  3KP6 A;  4RLF A;  5JHU A;  2IS6 A;  2A6T A;  4AD9 A;  4GGG A;  5DV5 A;  4ESJ A;  4MEX F;  2OD5 A;  3C2H A;  2DK5 A;  5L3D A;  3WU0 A;  3V7R A;  1R5I D;  3SJM A;  1F4K A;  3C2G A;  3TKY A;  4LB5 A;  3HKZ N;  2P8T A;  4RS8 A;  3CJQ B;  1MBK A;  4M3G A;  4BKX A;  1H0M A;  5E3O A;  2FOK A;  3A01 A;  3I4N J;  5IP9 J;  3HOZ J;  3DBR B;  2GIZ A;  2KP6 A;  2L0K A;  1ZQ3 P;  2PJR B;  3LSJ A;  3FXO A;  3ELK A;  2A69 F;  4NC8 A;  2X85 A;  5E20 A;  2FRH A;  5LBQ A;  3QRF F;  4WX9 A;  2M4K A;  4IRI A;  3A0B C;  3DV8 A;  1X4O A;  5ICE A;  5ILS A;  4O5V A;  3CO6 C;  4HLY A;  2O61 A;  1RZ4 A;  3E1S A;  3F8C A;  4XLF A;  1G4D A;  3GX4 X;  2PQ8 A;  2W4S A;  4CZZ A;  3JRF A;  2IGO A;  1K6Y A;  2DXI A;  3HPG A;  1S9H A;  5TGT A;  1MND A;  4OOI A;  1RR8 C;  4X6A J;  1PUF A;  2FU4 A;  3OV8 A;  3CES A;  4F93 B;  1X3Z B;  3LNQ A;  4BBR J;  3IH2 A;  3K1P A;  5J1Y A;  4I76 A;  3M07 A;  2KZG A;  2ZO4 A;  3CCY A;  2QQB A;  3GWZ A;  5JR3 A;  4ENK A;  3MZH A;  3KP5 A;  4L5I A;  4N9I A;  2Y9Z A;  1RPW A;  2HR3 A;  5LRS A;  2G7U A;  1ZLK A;  3E0J B;  3CUQ A;  2DMU A;  2ME6 A;  3D1N I;  1D3Y A;  3ZQL A;  1ON2 A;  4WWC A;  3S2W A;  5FRM A;  2VT3 A;  2UWM A;  5H20 A;  1MBE A;  1GLN A;  1ZEL A;  4UB8 C;  3X2Q H;  3QYE A;  2RNG A;  4FET A;  4KDP A;  3KYL A;  1O3Q A;  2XF6 A;  2QVO A;  1YI2 I;  5M5W J;  4C3J J;  3BG3 A;  3ASN H;  3BG7 A;  5J47 A;  3O8H A;  4GXO A;  1H89 C;  2JT1 A;  1X58 A;  2CUJ A;  3K10 A;  4FQG A;  4OIQ F;  3S3M A;  1HW5 A;  4XNF A;  4IHT A;  4HF1 A;  4GDF A;  1HC8 A;  1S3J A;  4KIC A;  5K5O A;  3K69 A;  3K1M A;  1V5F A;  1ZYR F;  1GV5 A;  1S29 A;  2IA2 A;  3K4L A;  4NQW A;  2MA3 A;  2XVC A;  1QO0 D;  4OMZ A;  4U0W A;  3JSO A;  3DLA A;  2FBH A;  4ZDO A;  4I98 B;  4KT5 C;  3SEZ A;  5FKK A;  2KL4 A;  3I4P A;  4PJJ A;  1WGX A;  2DI3 A;  3RI4 A;  3FHZ A;  2PJP A;  4A5N A;  2G9W A;  4DNC A;  3FXJ A;  3JRG A;  5EEG A;  4Y52 J;  2QLZ A;  2VL8 A;  2K27 A;  4DQ2 A;  1IRZ A;  3TO7 A;  1K4S A;  4V2G A;  1I1G A;  2M7A A;  2MBF A;  4B8X A;  3WTV C;  3JRC A;  2C6Y A;  1REP C;  4IL6 C;  1QZE A;  1P2F A;  4B4C A;  1RI7 A;  2X1C A;  5IY5 H;  3HEF A;  2R7Q A;  3SYT A;  1MZB A;  4UXN A;  3KZI C;  1TTY A;  3R0J A;  3OYK A;  2EIJ H;  4N4O B;  2JA6 J;  4C3I J;  1WRJ A;  2VBY A;  3I71 A;  3O3K A;  2BVL A;  1FBU A;  4XOR A;  1V5E A;  1XTA A;  4HNV A;  2FNP A;  3K0L A;  2AXT C;  3BR5 A;  3H3Z A;  5EF6 A;  3MEX A;  3WE3 A;  4XRF A;  4IQJ A;  4AM3 A;  2E5Z A;  5CQG A;  5LEK A;  2M2E A;  3QYB A;  4A12 A;  2J5O A;  1FOY A;  1FBS A;  3BG6 A;  1Z9C A;  1LVK A;  4C2T A;  3IUO A;  1E3P A;  5EZH A;  4OIN F;  3ABU A;  4E70 A;  1EV7 A;  5DM6 F;  1BI0 A;  1WH5 A;  4Z2Y A;  1EA3 A;  4UHT A;  2OPT A;  3WTX C;  4S05 A;  2LYC A;  2P5V A;  1QNT A;  3OIO A;  2ZJQ F;  3I64 A;  4YFN F;  1FC3 A;  1Z1D A;  4IHY A;  1T33 A;  3ERE D;  3HHG A;  4LOC A;  3E6B A;  1Z67 A;  2D1H A;  1LB2 A;  2ETH A;  1J09 A;  5C44 J;  1AKH B;  4JQF A;  4XKB A;  2L9V A;  4XLC A;  3TGN A;  3WTW C;  1JKP C;  3OS0 A;  3IRR A;  1BIB A;  1IAW A;  2ZME A;  4YRV A;  1FNN A;  4IOA F;  1G3W A;  2TCT A;  3QOE A;  1F36 A;  3LFK A;  2B9S A;  3CLQ A;  4XBF A;  1D0X A;  2MD0 A;  2WAQ N;  4XKW A;  4P5O A;  5LGT A;  3ROU A;  2WTE A;  3HRT A;  1S7A A;  2KZV A;  3DLL F;  1IV6 A;  5HS7 A;  4U7B A;  3CF5 F;  1MMA A;  3REO A;  5TJJ A;  3TL4 X;  2XPW A;  2LKS A;  2HQN A;  3UNG C;  1HDD C;  1DP3 A;  2G0E A;  3QU6 A;  2EV5 A;  2AS5 F;  3LSR A;  4A3G J;  3DPT A;  1HKS A;  2A3S A;  2A5Y B;  4I2O A;  2Y9Y A;  3GCM A;  5E18 F;  4BAC A;  2LD5 A;  2DT6 A;  1B8I B;  3ML6 A;  2HOS A;  2DDA A;  4E7L A;  2MG4 A;  1JGG A;  3EYI A;  3MAJ A;  3CO7 C;  3R61 A;  4JX4 A;  5C4X J;  2GAU A;  2L7K A;  4L9T A;  1ZGA A;  3S1M J;  2L4A A;  5GTI C;  3CQZ J;  4ITV A;  1J75 A;  3PIP F;  1WKM A;  2BY3 A;  1OCP A;  2TDX A;  4M73 A;  4A2U A;  1E2X A;  4P9U A;  4CA0 A;  2R7U A;  1OCT C;  1A35 A;  3LSH A;  4AUX A;  1R49 A;  2BYV E;  3MZY A;  3QU3 A;  3TP3 A;  1LFB A;  1NTC A;  3MKZ A;  3EUA A;  5B66 C;  2R5Y B;  2NOJ B;  1AA7 A;  4MIM A;  3CZ6 A;  1D1C A;  3O8G A;  4PDK A;  2NOG A;  1P9Q C;  4LLL A;  3BPX A;  2YX7 A;  3MCZ A;  1Y1V J;  4NB5 A;  1W7P D;  5FKM A;  1KU9 A;  3N05 A;  4JP0 A;  3H0D A;  3FXK A;  3AL0 B;  3DKW A;  5E8G A;  3HOU J;  3FF5 A;  1W0T A;  1VQ5 I;  4GO1 A;  3WTZ A;  5KAI C;  3ZQG A;  2KQR A;  2Y0S N;  4Y13 A;  1P6R A;  3C2B A;  1FIA A;  1CGP A;  3K70 D;  3FKI J;  4AIH A;  2W00 A;  1F5T A;  2Z5U A;  3ZOB A;  4LLN A;  1XGM A;  4RDU A;  3HTS B;  3S1Q J;  3H9J A;  1IRG A;  1XMX A;  2K4J A;  2PMZ A;  2NS0 A;  1KZH A;  1ZK8 A;  1U78 A;  1B4A A;  3RZD J;  3JTG A;  1P7J A;  1JTX A;  2W25 A;  4XOP A;  1IDZ A;  1BBY A;  3OYM A;  1P4W A;  2ELH A;  5CVR A;  3BCB A;  3WG9 A;  2B0L A;  4DYC A;  1VQ4 I;  2JA5 J;  3CMM A;  2ESH A;  4KJZ A;  1JT6 A;  3BTI A;  1MW7 A;  2ZKZ A;  2D5V A;  2X4H A;  1N78 A;  1W0U A;  1XC5 A;  5FRN A;  2Q0O A;  3HKZ A;  4AVP A;  2VBX A;  4II3 A;  3CDH A;  3IAM 2;  2LY9 A;  2PMH A;  4XQF A;  2HXO A;  3IV5 A;  1YOV B;  3PJR A;  2DLL A;  1R22 A;  1K83 J;  2LF8 A;  1TWA J;  1MIJ A;  4L5J A;  4RM2 A;  4IZZ A;  1I39 A;  3I56 I;  4LIT A;  1YO5 C;  1TT0 A;  5BPI A;  1QZZ A;  1Y56 A;  2KRH A;  3WGI A;  1KQ0 A;  1UHW A;  3G1O A;  4IXA A;  4F52 A;  3CF2 A;  2XAS A;  1ZGW A;  1BL0 A;  3OY9 A;  1JUM A;  5E1Z B;  4ENM A;  3M4O J;  4QWQ A;  4BY1 J;  3AG1 H;  3F8B A;  1XGN A;  2VBW A;  5EG0 A;  2DA4 A;  3L1P A;  3PO3 J;  1J9I A;  4A0Y A;  3OYA A;  1DU6 A;  1UST A;  2OZU A;  1W5T A;  2WBM A;  2EFW A;  5DD4 A;  3BZ6 A;  4C2U A;  4MHG A;  3QPS A;  4IO9 F;  2O9L A;  1FOK A;  3RIR A;  4YIF A;  1HQC A;  1PP8 F;  5F04 A;  1W7P B;  3FWE A;  1EH6 A;  4HA8 A;  1JKQ C;  3EYY A;  5K7H A;  4CIC A;  1K6O A;  2VKH A;  3W6J B;  4UUV A;  2Z1D A;  1X3U A;  2VKV A;  3CTA A;  2O3F A;  4PGH A;  2E60 A;  2KIU A;  1D1B A;  3L2U A;  2P0W A;  3E5U A;  1VZ0 A;  4RGR A;  4ENJ A;  2QKL B;  1I6H J;  1JGS A;  3E6D A;  4EM2 A;  4GFB A;  3AL0 C;  1MDM B;  1Y0U A;  1W36 D;  2DQR A;  1DGW Y;  1IF1 A;  3S15 J;  4MEY F;  1L0O C;  3AG2 H;  2DA7 A;  2L9R A;  5K7F A;  2QF7 A;  2RVC A;  4GYI A;  3Q9V A;  5HOO A;  3R6S A;  1D5Y A;  3S93 A;  5GAG J;  2PI0 A;  5LHH A;  1YRN B;  2XAH A;  1D0Y A;  2DTZ A;  2LF7 A;  1UAA A;  3KZY A;  1XDU A;  3ISP A;  5K1Y A;  2QBY A;  4HQM A;  1Y0N A;  2V6C A;  3ECH A;  2BV6 A;  1F1Z A;  3BQZ A;  2IA0 A;  4GCV A;  2VON A;  1QA6 A;  3HC7 A;  3PO2 J;  2JMW A;  1HW2 A;  2XPV A;  4OMY A;  5CKT A;  4DW6 A;  4L0Z B;  3HUG B;  4LIV A;  4BS9 A;  1IXS B;  2K3P A;  4ZC3 A;  3K4K A;  1N77 A;  3C7J A;  3HRS A;  1FEX A;  2JRT A;  2XGC A;  4X1E A;  2R5Z A;  1XN7 A;  2IVM A;  4MTE A;  2DT5 A;  3F23 A;  3H35 A;  1G6N A;  2M8G X;  3QQA A;  3SDG A;  1T8I A;  1BM9 A;  1TWF J;  5EGO A;  1OLT A;  4BEH A;  3OR1 C;  5CJ9 A;  3I54 A;  4I99 C;  1ETV A;  4BE2 A;  1FYK A;  4MFD A;  3RPU D;  2RQQ A;  1OKR A;  3F6V A;  1YFH A;  2ZCW A;  5FLX K;  3OYI A;  5H2F C;  1XCB A;  2GBY A;  5E3M A;  3HRU A;  1VQ7 I;  5F6F A;  1I27 A;  2LLK A;  3W2W A;  2O8X A;  4UVC A;  2NVT J;  3BR3 A;  4RAY A;  1O4X A;  6PAX A;  1T56 A;  4I0A A;  1IXR C;  3S3N A;  4O3M A;  2EB7 A;  5IYC J;  1VQ9 I;  1Y1W J;  3T0Y A;  3IAS 2;  4RAF A;  4M6Y A;  3M7G A;  1KA8 A;  4Y33 A;  2CQQ A;  5M3F J;  5KK1 A;  2V1U A;  4CXF A;  1LVA A;  2EPF A;  5EEA A;  5GAH J;  1CF7 A;  1BA5 A;  2BW3 B;  3QPH A;  1HLV A;  3K70 C;  2VJJ A;  3T1B A;  2H8R A;  2ELJ A;  5FFX A;  2X6W A;  3GTJ J;  4D0P A;  3GBG A;  3E7L A;  3IKV A;  3H3U A;  2HQR A;  2F5C A;  2OC6 A;  4XKC A;  5HLG A;  2ELK A;  2UZK A;  2EZH A;  4PSW A;  1SFK A;  3KYD B;  2L54 A;  3ZMT A;  3OYC A;  3G71 I;  1EH7 A;  4RGU A;  3ZN1 A;  3MKY B;  3C18 A;  2FSW A;  1PJR A;  1WJA A;  4EGY A;  4RB1 A;  2DJI A;  4AU7 A;  1SFX A;  2OQR A;  1XMK A;  4LB6 B;  2BEO A;  1Q1V A;  3OSG A;  4G6T B;  1U5T C;  5B1A H;  2H1K A;  2VQC A;  3FMS A;  2W7N A;  2MFZ A;  2D45 A;  1QVU A;  2MYS A;  2VQL A;  3BJ6 A;  1S7O A;  1YLF A;  5DYM A;  3PQJ A;  3U1D A;  3B6C A;  5GAE J;  2DN0 A;  5D5U B;  3GZ6 A;  2I10 A;  1FSH A;  3FMQ A;  2LRE A;  3DPL C;  2LFB A;  3F9K A;  4XKV A;  3ZN0 A;  4V19 K;  5IOZ A;  2ZSH B;  4KNY A;  3P9C A;  1WFX A;  4ZYD A;  2JWT A;  3GTP J;  4G7H F;  5L3B A;  3LQR A;  4RB0 A;  2BXZ A;  4YG2 F;  5HNF A;  3IP4 B;  5LLQ A;  4Q4Z F;  1PUE E;  3MKW B;  1G59 A;  1K78 B;  4IPA A;  1RUN A;  2GA1 A;  2EA2 A;  3GTL J;  1TQM A;  2W84 A;  1QU3 A;  1ZG5 A;  3MQ0 A;  1SD4 A;  4LIU A;  2MW8 A;  4C2M J;  2HXI A;  1Y8R B;  3OOU A;  1AHD P;  1JKR C;  3KEO A;  4MO7 A;  4A3C J;  1HCR A;  1STZ A;  3ASO H;  1ENH A;  3V4G A;  1RKW A;  2XSJ C;  4PJM A;  4NC6 A;  2R93 J;  1XDS A;  2OZ6 A;  1ACI A;  4HF2 A;  2HYF A;  3HGG A;  1JI8 A;  3J80 Z;  2DMP A;  1X1B A;  1ETQ A;  4PSX A;  5L3C A;  2BGC A;  2VJ4 A;  5L3E A;  1FMW A;  1K7A A;  1VQ8 I;  1BOA A;  4D7N A;  4UUS B;  2DW4 A;  4MGR A;  4B3X A;  3U9G A;  3KLO A;  2NVX J;  1WI3 A;  3L2W A;  2FD5 A;  3KEQ A;  4G12 A;  4E7Z A;  3CC7 I;  2LBF B;  2YS9 A;  4EEF G;  3HOV J;  1EJ9 A;  2X48 A;  4AC0 A;  4R1H A;  5D5W B;  1GV2 A;  1JJ6 C;  1GXP A;  3D0S A;  3K9T A;  1A31 A;  1R71 A;  1A6Q A;  5M5X J;  2PMZ N;  1T2K A;  3WHB A;  2CMP A;  1FT9 A;  1B9N A;  2KT0 A;  5HDK A;  3DPU A;  3HBL A;  4EGZ A;  1JJ8 C;  2IS4 A;  3RYR A;  2L9S A;  5K5Q A;  3BDD A;  3DBH B;  3KP3 A;  2BY2 A;  2IJL A;  4E7I A;  3LFU A;  2Y0S A;  4CYC B;  2QGU A;  1U8R A;  2GXB A;  4BHC A;  2QQA A;  4PFP A;  3L00 A;  2WA0 A;  4FT8 A;  1WSU A;  4BY7 J;  1IN6 A;  5F08 A;  5DD8 A;  3QPT A;  5KCM A;  2ZXJ A;  2X1E A;  2EBI A;  1QPM A;  4KIB A;  4S0H B;  1U9O A;  3B6A A;  2HQ5 A;  2ZJ2 A;  4ZYH A;  4A93 J;  1VFC A;  2FE3 A;  1PDN C;  2DA2 A;  3ESW B;  4YII A;  3JW4 A;  2XDV A;  2XB5 A;  5IPA A;  1LUJ B;  4BU2 A;  4KIF A;  1LDK B;  3QP6 A;  5LHG A;  2JJ7 A;  4M9S A;  3KLN A;  2M3A A;  1O3R A;  1JHF A;  3SEQ A;  2A68 F;  1JUP A;  4L9N A;  2VPL A;  4I0B A;  1Z77 A;  1U6G A;  3H92 A;  4GRI A;  3EUH A;  2YUS A;  3BG5 A;  1X1A A;  1BI3 A;  5E3N A;  4XLE A;  3EDP A;  4HSR A;  1GUU A;  4ZJZ A;  4ZZL A;  2Q2E A;  5L3F A;  2GZW A;  2QQ8 A;  4IF4 A;  3KPH A;  3W6V A;  5JVG F;  2MSY A;  5ILV A;  5B3S H;  1H8A C;  3OYE A;  3DKX A;  1HDP A;  1Z05 A;  5F1J A;  3R60 A;  4XK4 A;  4HZF A;  5BOX A;  1WCM J;  5GPA A;  4D5F A;  1QVT A;  2K02 A;  1GT0 C;  2DOA A;  3ZXS A;  2DDB A;  4XL9 A;  4M3B A;  1S8N A;  2VC1 A;  2ZXH A;  3LA7 A;  1WWX A;  2CRG A;  2QYO A;  2A07 F;  1OR7 C;  2PFB A;  4DZP A;  3BR1 A;  2PJR A;  2OTL I;  3LL7 A;  3GTQ J;  2OUM A;  3J7A O;  5KHD A;  1MJA A;  2UXX A;  2K4B A;  5JFR A;  1FIP A;  2V9K A;  2IT0 A;  2LDU A;  2LY1 A;  2ACJ A;  1JKO C;  4IQ4 A;  4CO8 A;  3LA2 A;  4E4H A;  5FB2 A;  2IPQ X;  3I53 A;  3W2A A;  5D6F A;  4A3F J;  4PK4 A;  3DTE A;  2RQP A;  1R00 A;  3FZV A;  3DXJ F;  2ECC A;  4QPQ A;  3AG4 H;  5DCM B;  2JSP A;  1FLI A;  2H6B A;  4BHB A;  3PUB A;  2DA6 A;  2WV1 A;  1OYW A;  3M8F A;  5EYR A;  5GP9 A;  2Z9O A;  3HHH A;  4DYR A;  2F6C A;  3VPR A;  1IC8 A;  4BDZ A;  4WXC A;  5CQE A;  2XIG A;  3HOS A;  1TNT A;  2QWW A;  3S8P A;  3ZMS A;  4TV7 A;  3QP5 A;  4A3I J;  3HOX J;  3A4C A;  4KT6 A;  1IN5 A;  2MLK A;  3ABT A;  3PUF A;  1YE9 A;  1BI2 A;  2A6E F;  2FBI A;  4B48 A;  1X1D A;  2F4M B;  3IWZ A;  1U0J A;  2EIM H;  3H5N A;  5J4V A;  5ERI A;  1F43 A;  3BLY A;  5B5E C;  1N25 A;  2GXG A;  5EJC A;  1UG0 A;  1MMN A;  4M72 A;  2NYX A;  5C3E J;  3VYT B;  2DA5 A;  1XSV A;  2FXA A;  2ID3 A;  2OCE A;  4J00 A;  5AIP A;  4D9J A;  3HPH A;  3KFW X;  3BR2 A;  5F0H A;  3E5X A;  3CCM I;  1VI0 A;  4G6Q A;  2O7O A;  5D8L B;  3F8M A;  3CUQ C;  2EFP A;  3OSF A;  2VUM J;  4BBS J;  1KQ9 A;  1R1U A;  4B09 A;  1FYL A;  3BZK A;  1ON1 A;  5F1R A;  5DUI A;  2JUC A;  2I8D A;  3I59 B;  1FOW A;  1NHA A;  3E3V A;  1OCR H;  1R4N B;  4MTD A;  1VTN C;  1NK3 P;  1ZRD A;  3DF8 A;  2HNH A;  2VC0 A;  3O2P E;  4JK1 X;  1IN7 A;  1XX5 A;  5FLM J;  3JRD A;  1IGN A;  2Y0M A;  3RQ4 A;  2IGK A;  3IWF A;  2F2E A;  4KIT B;  3TMO A;  2L7M P;  2R0Q C;  4J19 A;  4CGZ A;  1RIO H;  4FHT A;  2YX4 A;  3NWT A;  5CVU A;  4EAT A;  2OQG A;  2XPU A;  4EJV A;  4WK8 F;  3CME I;  4DJA A;  3I9V 2;  3Q9S A;  3TO6 A;  3QOD A;  2K3F A;  5CVJ A;  2DBB A;  5DUK A;  4I01 A;  4HDV A;  4DOZ A;  3W6K B;  4U0V A;  1I3A A;  5FGM A;  3RYP A;  3ZRG A;  2KIQ A;  3F3X A;  3K4J A;  4O6J A;  1M1E B;  1FJL A;  1O3S A;  3S14 J;  1B9M A;  2M45 A;  5KVR A;  1I50 J;  3H9Q A;  3VOE A;  1TNS A;  1HSJ A;  2L9N A;  2Y30 A;  2M7B A;  5FKN A;  2ZNZ A;  4NNJ A;  4G7O F;  4ZDP A;  4A3J J;  2CW0 F;  2K86 A;  1ODD A;  3HJE A;  4HLX A;  1X1P A;  2COB A;  4C3H J;  1NK2 P;  1TW3 A;  1LJ9 A;  5H6R A;  5DS9 A;  1I3Q J;  4RB3 C;  2HDD A;  2WY8 Q;  2XAF A;  1KYW A;  5J8C A;  2D1V A;  4IJA A;  2CUZ A;  1K79 A;  5HLH A;  1VQN I;  4M3D A;  2F4O B;  2HKO A;  3FHN A;  3BG9 A;  4LFU A;  3KET A;  1POG A;  2V6E A;  2K40 A;  4LGW A;  2HGC A;  2QCO A;  4AID A;  4BGD A;  5FLV A;  4Q48 A;  2F5F A;  3F8F A;  2NAZ A;  2LY2 A;  5LRR A;  1RC9 A;  3Q3S A;  2NVU B;  4RMN A;  2AXL A;  4M6X A;  4A3K J;  5J8F A;  3CCQ I;  1J5Y A;  4WCG A;  4IRG A;  3LSK A;  3JRA A;  5BS6 A;  3H9G A;  4ZZD A;  2DFH A;  4S04 A;  4KN4 X;  1IZ1 A;  2KFD A;  1ETK A;  4BHP A;  3CDL A;  3B73 A;  4G94 A;  4KUM A;  3CUO A;  2CG4 A;  2FUG 2;  3MWM A;  1J2X A;  2BVM A;  1N75 A;  2NXN B;  3J80 K;  3I5U A;  3Q5F A;  1SFO J;  4YIR X;  1MBF A;  2WWY A;  1DU0 A;  3CCJ I;  1XMA A;  3GTO J;  2IRF G;  4HQE A;  3FK6 A;  5E3L A;  3S1R J;  3BTC A;  4UUT A;  2H6C A;  2OF7 A;  2CQX A;  3DCF A;  4IRH A;  4OU0 A;  4BL0 B;  5DDG A;  3VB2 A;  1AWC A;  4ENN A;  1A04 A;  3FIS A;  1VQP I;  1QHG A;  1ZAR A;  2P6T A;  3Q0U A;  1SMY F;  1I5Z A;  3E5Q A;  3H5A A;  4LG0 B;  1KYZ A;  1IDY A;  4A69 C;  4H0E A;  3RKY A;  4BE0 A;  1T38 A;  2RN7 A;  5J1U A;  1ETX A;  2V79 A;  4MNU A;  1QPI A;  4PFO A;  5LD2 C;  1G3S A;  4JBA A;  1DDN A;  1LE8 B;  2XC7 A;  1ZR2 A;  1H88 C;  2ME0 A;  1GXQ A;  4XOT A;  4JOM A;  3ONQ A;  2XHK A;  2RAE A;  3V7S A;  1B8I A;  3BTL A;  3NRV A;  3H36 A;  3R4K A;  4XN0 A;  4FTH A;  3SQN A;  3OR2 C;  4OAZ A;  3ZP5 A;  1IUY A;  1E0E A;  2RRE A;  1ONV A;  3DKY A;  2CV1 A;  1ETO A;  4I09 A;  2V4J C;  4RA2 A;  3SDB A;  2FNA A;  2DFE A;  3OIP A;  5D5V B;  2HU9 A;  1HKQ A;  3VDX A;  5BNG A;  2LP0 A;  4EM0 B;  1G8X A;  2R5Y A;  1D8K A;  5LGN A;  3KZZ A;  5IT9 Z;  4NBQ A;  2PEX A;  2R7S A;  1MD0 A;  1TL8 A;  1R23 A;  2QSG X;  1FYM A;  2GM4 A;  3DTI A;  4L0Y B;  4IHX A;  3GFJ A;  3CJR B;  3GME A;  4CDG A;  1YTY A;  2E2I J;  3JRI A;  3KP4 A;  4ZYG A;  2KRF A;  2KIM A;  3EET A;  3LMM A;  1QBJ A;  2CGP A;  1MKM A;  3GFM A;  4EM1 A;  2CW7 A;  2JTV A;  4L9J A;  5ILU A;  3L2C A;  1LEA A;  2STW A;  1D0Z A;  4C30 A;  3V8K A;  2JZY A;  1IN8 A;  2L3D A;  4XR6 A;  1UCR A;  3M9A A;  3QAH A;  2Y48 A;  3D5L A;  3GXO A;  4KIS A;  1KU3 A;  3Q0V A;  4LJZ F;  1B72 B;  1R6R A;  2HS5 A;  2M0C A;  3ABL H;  4U7D A;  2KHM A;  3KYC B;  2EQR A;  4OIO F;  4HV6 A;  2HTJ A;  1YYV A;  3BQY A;  2R7Z J;  2O03 A;  2PX9 A;  1Z21 A;  1OIS A;  2BHY A;  1E17 A;  5M3M J;  2DOE A;  2RDP A;  3LQQ A;  1DGR M;  4LLG F;  2CFX A;  4U87 A;  1GDT A;  2YU3 A;  4EMS A;  5J1R A;  4PUS A;  1YW9 A;  4QSH A;  3LWF A;  1UMQ A;  3ZMD A;  4X0G A;  4AYB N;  1SD7 A;  5HNH A;  2F5V A;  2NVQ J;  1MH3 A;  2X0L A;  4OWR B;  2JPB A;  3SFI A;  2WC2 A;  4Y7N J;  2VPR A;  5BMZ A;  2R7V A;  1TP4 A;  4IKF A;  1WJD A;  2VIX A;  1E3O C;  3K4N A;  2XAG A;  5EDN A;  3SZP A;  1ZG1 A;  1O57 A;  4E7J A;  4EV0 A;  1HOM A;  4PJ0 C;  1YQA A;  1PP7 U;  1ZLJ A;  2DO7 A;  3GLX A;  2LNB A;  2K9M A;  3CD6 I;  1BOB A;  2JVH A;  4A5M A;  1IXC A;  1APL C;  1U5T B;  2ZXI A;  3G2B A;  4HAM A;  2RGV A;  1QHH D;  4Y17 A;  4CCO A;  2R7R A;  3IL2 A;  1TQP A;  2RC4 A;  1G2H A;  2VB6 A; 
#chains in the Genus database with same CATH homology
 1FTZ A;  4FE4 A;  4D7N A;  4UUS B;  2YU9 J;  1GV5 A;  4DZJ A;  4XRS G;  2NVX J;  2AO9 A;  1WI3 A;  4A3L J;  2FD5 A;  3Q0W A;  3A03 A;  4G12 A;  1JTY A;  2NVY J;  2YS9 A;  3ZQI A;  2HOA A;  4EEF G;  3HOV J;  3WHC A;  5FKK A;  2X48 A;  4AC0 A;  1JJ6 C;  1GV2 A;  2ID6 A;  1WGX A;  5M5X J;  2AHQ A;  2PMZ N;  3TW7 A;  3S16 J;  3JRG A;  2LKX A;  3WHB A;  2KT0 A;  4Y52 J;  1IRZ A;  1JJ8 C;  3HBL A;  4V2G A;  2HOT A;  1VF9 A;  3IH3 A;  1YRN A;  3JRC A;  5FKL A;  1GVD A;  4DYQ A;  2LTP A;  4B4C A;  2EH3 A;  4CYC B;  3IH4 A;  2DA3 A;  3HEF A;  2E19 A;  3H3V K;  3TW6 A;  4FIS A;  1MSF C;  3G1M A;  4M6V A;  2JA6 J;  3K2A A;  4C3I J;  5EG0 B;  4BY7 J;  3PM1 A;  5F08 A;  2EBI A;  2M9H A;  4HNV A;  4S0H B;  1U9O A;  3B6A A;  4W1U A;  2HQ5 A;  3BR5 A;  4A93 J;  1VFC A;  2DMN A;  2O8K A;  2CU7 A;  5EF6 A;  2DA2 A;  3S17 J;  3HB9 A;  2M2E A;  2XB5 A;  5IPA A;  2Y31 A;  1LFU P;  4FCY A;  2JJ7 A;  4MLO A;  2CJJ A;  5EZH A;  1JUP A;  1ZR4 A;  2K9N A;  3A02 A;  1LE8 A;  1WH5 A;  1Z77 A;  2VKE A;  1IJW C;  1JT0 A;  2OPT A;  2YUS A;  3BG5 A;  4IEJ A;  5E3N A;  3OIO A;  2L7F P;  5IP7 J;  3CMY A;  1GUU A;  4IHY A;  5JLW A;  1A5J A;  1T33 A;  4LOC A;  4B3A A;  3W6V A;  3MVP A;  2MSY A;  5FJ8 J;  1H8A C;  1ITY A;  1HDP A;  5EZG A;  5F1J A;  5C44 J;  4XK4 A;  1AKH B;  1R9T J;  1WCM J;  1UHS A;  5GPA A;  4RBO A;  3RZO J;  1JKP C;  4D5F A;  1QVT A;  1XG1 A;  1GT0 C;  2K9Q A;  3F0C A;  4M3B A;  2TCT A;  2CRG A;  1F36 A;  3K7A J;  4D7M A;  1BJZ A;  3ZQH A;  2W48 A;  4DZP A;  3BR1 A;  5M5Y J;  2JN6 A;  1U8B A;  3GTQ J;  2CUE A;  2WAQ N;  1IUF A;  1BW5 A;  1FTT A;  9ANT A;  4I6Z A;  1OJL A;  1IV6 A;  1X2N A;  1FIP A;  1IG7 A;  5DTD A;  2XPW A;  1JKO C;  1B72 A;  1HDD C;  2G0E A;  2E2J J;  2R5Z B;  4QIW N;  2IBD A;  4A3F J;  3LSR A;  2ECB A;  4A3G J;  2WB1 N;  2Y9Y A;  4IHV A;  2DMQ A;  2M34 A;  3H0G J;  5EGO B;  1ETW A;  2ECC A;  3BTJ A;  3M3Y J;  2LD5 A;  1B8I B;  2HOS A;  2MG4 A;  2MGQ A;  1JGG A;  4JX4 A;  5C4X J;  2DA6 A;  2WV1 A;  3S1M J;  5EYR A;  5GP9 A;  3CQZ J;  4DYR A;  2LK2 A;  4M3E A;  2EZI A;  3VPR A;  1OCP A;  1ORK A;  5HOD A;  1IC8 A;  1OCT C;  1XS9 A;  3ZQC A;  4AUX A;  4A3I J;  1TWG J;  3TP3 A;  1LFB A;  1UG2 A;  1NTC A;  3HOX J;  4FE7 A;  4XRS A;  2R5Y B;  3DEW A;  4V2F A;  4MIM A;  3O8G A;  2NOG A;  3A01 B;  3HOY J;  1Y1V J;  1F43 A;  1MH4 A;  5FKM A;  3UKG A;  4JP0 A;  1A6I A;  2XB0 X;  2E1O A;  2XRL A;  5FKO A;  1W0T A;  5C3E J;  3HOU J;  2DA5 A;  3ZQG A;  2ID3 A;  1MBH A;  2Y0S N;  3C2B A;  3JRE A;  1FIA A;  1QRY A;  1RET A;  2EZK A;  3BR2 A;  1VI0 A;  3FKI J;  5F0H A;  2O7O A;  4A3E J;  3MKL A;  3OSF A;  2VUM J;  4BBS J;  3ZOB A;  3S1Q J;  4RDU A;  4W97 A;  2R92 J;  2EZL A;  5GPC A;  4IHW A;  1BW6 A;  1MBG A;  1U78 A;  1ZK8 A;  3RZD J;  1NK3 P;  1P7J A;  1JTX A;  1IDZ A;  1ZTR A;  4UUS A;  5FLM J;  3JRD A;  1IGN A;  3FIW A;  2JA7 J;  4DYC A;  2JA5 J;  4J19 A;  2R0Q C;  2L7M P;  1RES A;  2N8G A;  1PUF B;  1JT6 A;  3BTI A;  2D5V A;  1W0U A;  1XC5 A;  2XPU A;  2XGD A;  2NS7 A;  1TWC J;  2LY9 A;  2HXO A;  3IV5 A;  1K83 J;  1TWA J;  2LVS A;  4QTR A;  4B1R A;  3G1O A;  1ZGW A;  1BL0 A;  4CYC A;  1JUM A;  3JR9 A;  2TRT A;  3M4O J;  2KDZ A;  4XRM A;  4BY1 J;  5F0F A;  5EG0 A;  2DA4 A;  1FJL A;  5K7Z A;  3S14 J;  3L1P A;  3HOW J;  3PO3 J;  1DU6 A;  3JRB A;  1I50 J;  3ZQF A;  3LSG A;  2Y30 A;  1AU7 A;  5FKN A;  1MBJ A;  1MNM C;  4L5E A;  3TP0 A;  5IOY A;  3QPS A;  4A3J J;  5IYB J;  2LR8 A;  4A3D J;  3RQI A;  2O9L A;  2COB A;  4C3H J;  1NK2 P;  4JYK A;  5DS9 A;  1I3Q J;  2Y2Z A;  5F04 A;  2HDD A;  1JKQ C;  5K7H A;  3JRH A;  4M3D A;  2VKV A;  3TED A;  2FJ1 A;  3BG9 A;  1EF4 A;  1POG A;  3HDD A;  1I6H J;  2JK3 A;  2K40 A;  4A3M J;  3S2H J;  3S2D J;  5F27 A;  1JUS A;  4GFB A;  2QCO A;  3BR0 A;  5FLV A;  5F0C A;  3S15 J;  3Q3S A;  2DA7 A;  3LSP A;  2L9R A;  4A3K J;  5K7F A;  1Z0X A;  2QF7 A;  1ETY A;  1D5Y A;  3JRA A;  1YRN B;  2DTZ A;  1ETK A;  1P7I A;  3G1L A;  3CDL A;  3FK7 A;  1SFO J;  2FX0 A;  1DU0 A;  1MBF A;  3BQZ A;  3GTO J;  3LOC A;  4BXX J;  3FK6 A;  5E3L A;  3S1R J;  3BTC A;  1S7E A;  4UUT A;  1SAN A;  3PO2 J;  2JMW A;  2OF7 A;  2CQX A;  2XPV A;  3DCF A;  3NAR A;  4DW6 A;  3GTK J;  1RKT A;  3FIS A;  1WH7 A;  1CQT A;  2DJN A;  3Q0U A;  3GTM J;  1ETQ A;  2JA8 J;  1U9N A;  1FEX A;  2XGC A;  1IDY A;  4X1E A;  4A69 C;  2R5Z A;  2E2H J;  2L7Z A;  5J1U A;  1ETX A;  2M8G X;  3QQA A;  3SDG A;  1QPI A;  5JLX A;  1TWF J;  5EGO A;  2DMT A;  2NS8 A;  1LE8 B;  1ZR2 A;  2XSD C;  2ME0 A;  2IAI A;  1H88 C;  4A3B J;  1B8I A;  5J3L A;  2RAE A;  3HM5 A;  3BTL A;  2XGE A;  3BT9 A;  2VI6 A;  4FTH A;  1ETV A;  1RR7 A;  3HGY A;  4MFD A;  2HYJ A;  3BR6 A;  1VND A;  1ETO A;  2GBY A;  5E3M A;  4JX6 A;  2LLK A;  2GLO A;  5BNG A;  3BR3 A;  3SJM A;  1O4X A;  2X9D A;  2NVT J;  1WPK A;  1T56 A;  2LP0 A;  2X6O A;  3HKZ N;  5IYC J;  2R5Y A;  1Y1W J;  4BKX A;  1MBK A;  4M3G A;  4NDL A;  2GM4 A;  5E3O A;  4IHX A;  3A01 A;  3I4N J;  5IP9 J;  5M3F J;  2CQQ A;  2E2I J;  3JRI A;  3HOZ J;  4D5C A;  5EEA A;  2L0K A;  1ZQ3 P;  1BA5 A;  3LSJ A;  3GTG J;  1HLV A;  2B63 J;  2H8R A;  5IYD J;  2P81 A;  3Q0V A;  3GTJ J;  1B72 B;  3GBG A;  2FQ4 A;  3E7L A;  2M0C A;  1K61 A;  2ELK A;  2EQR A;  2EZH A;  4XID A;  3RKQ A;  3BQY A;  2R7Z J;  4MFE A;  3JRF A;  5M3M J;  4XIC A;  4ABZ A;  3I4M J;  2IEK A;  1GDT A;  3MN2 A;  5J1R A;  1Q1V A;  4X6A J;  1HF0 A;  1PUF A;  3OSG A;  4QSH A;  2H1K A;  1UMQ A;  4M3F A;  4BBR J;  3IH2 A;  3LNQ A;  5J1Y A;  4AYB N;  4I76 A;  2NVQ J;  1QVU A;  1MH3 A;  2DA1 A;  3CCY A;  3SFI A;  3B6C A;  2DN0 A;  2I10 A;  2Y9Z A;  1OFC X;  1RPW A;  4Y7N J;  4JX5 A;  2LFB A;  2VPR A;  2HI3 A;  2ME6 A;  5IOZ A;  2DMU A;  5IP6 A;  3D1N I;  3ZQL A;  1E3O C;  1TC3 C;  2JWT A;  5EDN A;  1MBE A;  3GTP J;  1TWH J;  1HOM A;  2K9S A;  3NAU A;  1AKH A;  1MSE C;  5M5W J;  4C3J J;  3GTL J;  3BG3 A;  3O8H A;  4C2M J;  2MW8 A;  1H89 C;  2HXI A;  3OOU A;  1X58 A;  1AHD P;  1JKR C;  4A3C J;  4MO7 A;  1APL C;  2ZB9 A;  1HCR A;  1ENH A;  1RKW A;  1X2M A;  2CUF A;  3QPL A;  2R93 J;  3S1N J;  5C4J J;  3HGG A;  2DMP A;  1G2H A;  1ZKG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...