1IUFA

Low resolution solution structure of the two dna-binding domains in schizosaccharomyces pombe abp1 protein
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
144
structure length
144
Chain Sequence
GIHMGKIKRRAITEHEKRALRHYFFQLQNRSGQQDLIEWFREKFGKDISQPSVSQILSSKYSYLDNTVEKPWDVKRNRPPKYPLLEAALFEWQVQQGDDATLSGETIKRAAAILWHKIPEYQDQPVPNFSNGWLEGFRKRHILH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords centromere abp1 protein
publication title Solution structure determination of the two DNA-binding domains in the Schizosaccharomyces pombe Abp1 protein by a combination of dipolar coupling and diffusion anisotropy restraints.
pubmed doi rcsb
source organism Schizosaccharomyces pombe
molecule tags Dna binding protein
total genus 25
structure length 144
sequence length 144
ec nomenclature
pdb deposition date 2002-03-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF18107 HTH_ABP1_N Fission yeast centromere protein N-terminal domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1iufA02
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1iufA01
5M5YJ 3B6AA 3Q3SA 1FTTA 1U9NA 3HOXJ 3UKGA 3MVPA 1Y1WJ 2EZHA 3VPRA 1DU6A 2JN6A 4JX6A 1E3OC 2L0KA 3TW7A 3K2AA 5FKOA 4C3IJ 5IPAA 2R0QC 3RKQA 4BY1J 1X2MA 3IV5A 3ZQGA 3BR6A 3BG5A 1BJZA 1JKPC 1B72B 2COBA 3FISA 3LSGA 2XPWA 1LFUP 2JA5J 3HGYA 1FIAA 2LTPA 5EEAA 2GM4A 2HXIA 1ETOA 1AKHA 3BQYA 1X58A 2JJ7A 2EZLA 5IP9J 1JKRC 2ME6A 1UMQA 4FCYA 5IOZA 4MFEA 3S17J 3WHCA 2R7ZJ 5EG0B 2LK2A 2LP0A 2RAEA 3NAUA 1ZR2A 1IDYA 1MBKA 2XB5A 4M3DA 1IDZA 3S1RJ 4EEFG 2EBIA 4FISA 3HOZJ 4W97A 3HOUJ 4CYCB 1WI3A 1OJLA 2L7MP 2HOSA 3BR3A 3A01A 1EF4A 2VKEA 4XK4A 1GVDA 4G12A 1IRZA 2K9NA 2YS9A 3LNQA 3S14J 4BY7J 3A02A 2CJJA 4I6ZA 1ETKA 2XPVA 3IH4A 3RZDJ 2LVSA 2DA4A 3F0CA 1QVUA 5F0FA 2Y9YA 3H3VK 2TCTA 2O9LA 3SDGA 4A3BJ 2KDZA 4JX5A 1ZKGA 2ID6A 3HGGA 3C2BA 3JRIA 5EDNA 1MSEC 1IC8A 5M5WJ 1NK2P 3S2DJ 2IAIA 3TP0A 1JTYA 2DA3A 2VPRA 4M3GA 1HLVA 2LR8A 4QSHA 2E2IJ 4DYCA 1AKHB 2ECBA 4A93J 3RQIA 3GTKJ 3HB9A 1VNDA 2L7ZA 1TWAJ 2QF7A 4MFDA 2VUMJ 3M4OJ 4HNVA 1BW5A 3HOVJ 3E7LA 1X2NA 2DMUA 3GBGA 2ID3A 2W48A 1ZR4A 3K7AJ 2H8RA 3BTJA 3QPLA 2XB0X 2LKXA 2CUEA 3HDDA 1XC5A 3L1PA 3G1MA 1Z0XA 4NDLA 5F1JA 1TC3C 3BR0A 5GPAA 2Y31A 4Y52J 1RESA 4BBRJ 5M3FJ 1GT0C 4XRSG 3HBLA 3TW6A 4XRMA 1JUPA 5FKKA 5E3MA 1PUFA 3RZOJ 3JRFA 5J1UA 4V2FA 2CUFA 3DCFA 4UUTA 4DYQA 5E3OA 3LOCA 3PO3J 2HQ5A 3GTJJ 1FTZA 2O7OA 5JLWA 4FTHA 1P7IA 3BG3A 9ANTA 4UUSB 1Y1VJ 3Q0VA 1RR7A 2ECCA 2R93J 1BW6A 5EGOA 2JK3A 2MSYA 1G2HA 1U78A 1MH3A 3O8GA 1WH7A 3BTCA 2N8GA 3DEWA 3ZQHA 1QVTA 1YRNA 1ZQ3P 1LE8A 5IOYA 4A3LJ 1D5YA 2XRLA 4D7NA 2HI3A 4D5FA 2K9SA 2JMWA 3JRGA 1JJ6C 5C3EJ 3HKZN 5F27A 1A5JA 3OOUA 3G1OA 1TWGJ 1WH5A 2FJ1A 5C44J 1MBGA 2HDDA 5IYBJ 2XPUA 3JRHA 2MGQA 3G1LA 2KT0A 5BNGA 3M3YJ 2ZB9A 2M2EA 4MIMA 2FD5A 5F04A 2VKVA 3LSPA 3LSJA 3WHBA 1ITYA 2DN0A 3IH3A 1FEXA 2DA6A 4M6VA 1SFOJ 3QPSA 1B8IB 1ENHA 1UG2A 3CMYA 5K7ZA 1IUFA 2DA5A 1IV6A 4FE7A 2GLOA 3OIOA 5FKMA 4M3FA 2TRTA 5K7FA 3CCYA 1ZTRA 4XICA 3QQAA 1MBHA 4IEJA 3OSFA 3Q0WA 2R5ZA 1LFBA 1IGNA 2OF7A 2AO9A 1Z77A 4BKXA 4A69C 5JLXA 2DA7A 3S2HJ 1JGGA 1VFCA 1OCPA 2XGDA 5EZHA 2K9QA 4QIWN 4MO7A 2E2JJ 4RDUA 1LE8B 2CQQA 2E19A 2DMTA 2NVQJ 4FE4A 2M0CA 1POGA 1ZGWA 1T33A 5E3LA 1W0UA 2O8KA 1U8BA 1RKWA 3HM5A 3S15J 2K40A 1F43A 2Y9ZA 1H89C 5EYRA 5J1RA 2JA7J 5M3MJ 5E3NA 3A03A 1AHDP 4X6AJ 1A6IA 2WAQN 2YU9J 4Y7NJ 3GTGJ 3I4MJ 5IP6A 3GTOJ 5GP9A 1U9OA 4A3CJ 3JR9A 2CRGA 2L9RA 1JKOC 2E1OA 3BTIA 1DU0A 1XG1A 1JT6A 3JRAA 3GTQJ 3MN2A 1IG7A 1VF9A 2IBDA 4BXXJ 1I6HJ 4JYKA 3O8HA 1WCMJ 2WV1A 3IH2A 1QRYA 3A01B 1MSFC 5GPCA 4J19A 4B3AA 4A3FJ 2G0EA 2IEKA 4ABZA 1BA5A 2X6OA 2JWTA 4QTRA 2NS7A 4AYBN 2NVYJ 3ZOBA 4B4CA 1TWFJ 3HOYJ 4M3BA 1ETQA 4XIDA 1VI0A 1H88C 5C4XJ 2VI6A 2XGCA 2R5ZB 2AHQA 2DMPA 2Y0SN 5FLVA 1FIPA 4I76A 2XSDC 5F0CA 4CYCA 2DTZA 3LSRA 2ELKA 2WB1N 2M34A 4L5EA 2H1KA 1P7JA 4S0HB 1JUMA 2NOGA 1O4XA 2LLKA 4C3JJ 3JRDA 3MKLA 1K61A 5DTDA 3Q0UA 5J1YA 1TWHJ 3ZQLA 4DYRA 3S1QJ 4A3MJ 1HCRA 1HDPA 3BR2A 5K7HA 2CU7A 3W6VA 4D5CA 1ZK8A 2EQRA 1ETXA 4D7MA 1BL0A 1RPWA 2B63J 3GTMJ 1MH4A 1F36A 1IJWC 1RKTA 2NS8A 2PMZN 5J3LA 3JREA 2D5VA 3GTLJ 3B6CA 1UHSA 1GUUA 4V2GA 1FJLA 5C4JJ 1SANA 4X1EA 5HODA 1MNMC 1JUSA 2LD5A 2DA2A 3SFIA 2R5YA 4W1UA 3HOWJ 2EH3A 4A3IJ 1HOMA 1PUFB 1I50J 1ETYA 2HYJA 3BG9A 3JRCA 2E2HJ 5M5XJ 3NARA 5IYCJ 3ZQCA 1K83J 4IHVA 2QCOA 1Q1VA 3CQZJ 4AUXA 4AC0A 4IHYA 5FKNA 2XGEA 1I3QJ 2EZKA 3FK6A 1APLC 3D1NI 1GDTA 2Y30A 4C3HJ 1MBJA 5FKLA 3FK7A 2NVTJ 2P81A 1GV5A 2FX0A 2JA8J 3S1NJ 5EGOB 4BBSJ 2LFBA 1XS9A 1R9TJ 1CQTA 3OSGA 4GFBA 2CQXA 2R92J 1HF0A 3S1MJ 2DMQA 3PO2J 4M3EA 1YRNB 2LY9A 2I10A 1H8AC 2X48A 1W0TA 1AU7A 1JTXA 1ETWA 5EF6A 1TWCJ 4A3KJ 2NVXJ 2DA1A 3S16J 3I4NJ 2MW8A 2OPTA 3FIWA 4UUSA 4IHXA 4XRSA 3TEDA 1OCTC 4A3JJ 3JRBA 4DZJA 1JT0A 4RBOA 2DJNA 4JP0A 3BT9A 1MBEA 1ORKA 3PM1A 1B72A 3H0GJ 1NTCA 5F0HA 1T56A 2YUSA 2R5YB 4DZPA 2HOAA 5IP7J 4LOCA 3BTLA 3ZQIA 4DW6A 2FQ4A 3BR5A 1JKQC 3TP3A 4B1RA 1JJ8C 1HDDC 3GTPJ 2M9HA 3SJMA 2ME0A 2HXOA 1QPIA 2M8GX 1WGXA 3BR1A 3ZQFA 5IYDJ 2DMNA 2GBYA 5DS9A 5EG0A 5EZGA 1S7EA 1NK3P 4MLOA 5FJ8J 1GV2A 2Y2ZA 1MBFA 4IHWA 4C2MJ 4A3GJ 3FKIJ 3HEFA 2X9DA 4JX4A 4A3EJ 3CDLA 5F08A 1OFCX 1RETA 2JA6J 4A3DJ 1WPKA 2HOTA 2EZIA 1ETVA 2MG4A 5FLMJ 2L7FP 3BQZA 1B8IA
chains in the Genus database with same CATH superfamily
4NQWA 5HLGA 4HSTA 4GRIA 3DEEA 1R7JA 1FTTA 5ED4A 4J01A 1EKEA 3NRVA 5D4SA 2P7VB 3VPRA 1QZZA 2CV2A 2L0KA 2XAFA 3TW7A 4BY1J 1X2MA 3KCCA 2FU4A 4DQ2A 3FMQA 5ILVA 2O61A 2EWNA 4ZYAA 1BJZA 3GO5A 5B3SH 3I58A 3EETA 1R23A 4AU7A 3BOQA 1LFUP 4BS9A 4IRIA 3HGYA 4AIJA 2AS5F 1KZHA 2HXIA 2ZFWA 1J5YA 5DM6F 3QRFF 1S8NA 4XSZF 1AA7A 1X58A 4I0AA 1MMAA 4CUGA 1G3SA 3IKVA 2X1DA 4XLAA 2J5OA 1SFUA 3ZMZA 3M1CA 5CVJA 2ESHA 2VJIA 3M8FA 2LY2A 5IOZA 4MFEA 3TL4X 1UJ8A 3WHCA 2X6YA 4ANJA 4BDZA 4Q48A 1IXCA 2B7EA 2XB5A 4M3DA 2LKPA 3VOEA 3R6SA 3H1CA 2F5CA 3AG4H 5TJJA 4FASD 2FSWA 5JR3A 2HVSA 3HOZJ 4C2UA 3E1SA 1ZRCA 3TO7A 1WI3A 1IRFA 1OJLA 3QPTA 2L7MP 3NWTA 5L3BA 3N97A 3BJOA 4XK4A 2YS9A 4BY7J 4BXUA 2VLAA 5H6RA 2CJJA 2LYCA 2XPVA 5KVRA 4UXNA 1VQLI 2QM3A 1QVUA 3FM5A 3AKZA 3H3VK 3BZCA 1H0MA 4A3BJ 3JCUC 4XMYA 4JX5A 2A6HF 3C2BA 3JRIA 1UFMA 2JSPA 5EDNA 1R49A 3HSFA 3FHNA 1NG6A 5M5WJ 1K4SA 1MSEC 2IAIA 4DOZA 2QSHX 1LDJA 2DA3A 4CYDA 2QZ8A 5HDNA 3CCEI 3VYSB 4RAFA 2XV4S 4BEHA 2OQRA 2VIXA 2CYYA 3CUOA 4M3GA 4RLFA 1HLVA 4XL9A 4QSHA 2MA3A 1O3QA 3VDXA 2HFHA 1X3UA 3LQRA 1KU3A 4HX4A 1RUNA 2D1HA 1XDSA 4KNYA 2HQAA 3HHGA 3PFYA 2BY2A 4HNVA 3DPLC 4RB3C 4HPQA 3HXLA 2RQQA 3L7WA 3CUQC 2VODA 1BOAA 2QQ9A 4E7KA 4XLEA 3L2UA 3LMMA 1W5CC 3W2WA 1KU7A 5AIPA 2CUEA 2MC4A 3QYFA 1F9NA 1USSA 2J5PA 2R3SA 2DLLA 3TQNA 2CFXA 2EA2A 2CV1A 3BR0A 3G3ZA 2BGCA 4Y52J 1DP7P 2E60A 3IHUA 3MEXA 2NYXA 4BJTA 2KRFA 3HBLA 3NWSA 3L00A 2LNBA 1IN5A 3JRFA 3HZJA 1S3JA 2CUFA 1Z9CA 1HQCA 1IAWA 1EV7A 2R7SA 1D0XA 1U8RA 2KL4A 2K86A 1TNTA 4JOMA 3PO3J 1BIBA 1YS6A 3EDPA 1Z6RA 4ZC3A 2Q2EB 1MNDA 3T8TA 3ASNH 5GAHJ 1R4NB 3U1DA 4AYBA 1RR7A 2OQGA 2ECCA 1BW6A 1W5SA 2LREA 2GOXB 2ICWG 5EGOA 1F1ZA 5FB2A 5JVTA 2ISYA 4D1QA 2VBZA 4QWQA 5TGTA 3BTCA 4ASNA 1QVTA 1V4RA 3EYYA 3GZNB 3J7ZI 1LE8A 3AG3H 1HKQA 1XX5A 1T8IA 1D5YA 3F22A 2HTJA 2VKHA 4D7NA 4I99C 1XMAA 2JMWA 3DU6A 2EIJH 4F7ZA 4O3MA 1MD0A 2A5WA 3OIPA 3F8MA 1B9NA 5B1AH 2OZ6A 3H0DA 2KRCA 3I0TA 3OOUA 3PFIA 3OS1A 1Q1HA 2PFBA 2H1LA 4HX7A 5CVUA 1ZYRF 4HF2A 2MGQA 4F52A 2KT0A 2Z16A 1XCBA 3F8CA 4FX0A 5A2QK 2L2OA 2M2EA 2ZKZA 4WXHA 4A0ZA 4MIMA 4B43A 4OIRF 1MGTA 2QBYA 5F04A 3LAJA 4AD9A 1V5EA 2PMZA 3WHBA 3EPZA 1ITYA 2DN0A 3S3MA 1FEXA 3DWLE 4M6VA 4P96A 4BACA 3I64A 1LDKB 4KUMA 1B8IB 4NQWB 5EJCA 3U2RA 1UG2A 1FWZA 3H9GA 2FF4A 4HF1A 4XQFA 3C2HA 1K4TA 4L18B 3FZVA 3FBNB 4HV6A 2STWA 1TQIA 3K4BA 3QQAA 3QU3A 3F21A 3OSFA 3P7NA 1S7AA 3CCJI 3DKYA 2OF7A 4E6KG 2M4GA 2F48A 2AO9A 1Z77A 2KIQA 4J00A 4A69C 1U6GA 4HYEA 5CPRB 1VFCA 1KA8A 1MMSA 2Y75A 5H2FC 3ABKH 1J09A 4XKCA 2E2JJ 2E7WA 2XC7A 3DBRB 2ZFUA 2EFNA 4A0YA 2E19A 4LK1F 2NVQJ 1T33A 1EA3A 3MWMA 4ENJA 1U8BA 3F72A 1BC8C 4G94A 2CV0A 3AG1H 3ZMUA 2L02A 3OYHA 2Y9ZA 3A03A 1I1GA 2QGUA 4P55A 2E7XA 4BE1A 4I09A 2L01A 4HA8A 5BPDA 1VQKI 3I4MJ 1LDDA 2EILH 1ACIA 4OAZA 1TBXA 5LEKA 2O3FA 1X1BA 4B3XA 2E1OA 4QLCU 4RAZA 3GF2A 5KAFC 1VF9A 1K78B 4BXXJ 2FUG2 4GDFA 3ERMA 4B3AA 2OA4A 1SD6A 4V19K 3E5UA 1HC8A 3HSRA 3CCQI 1UELB 1YIOA 1IXSB 3ZOBA 2HDCA 1TWFJ 2EV0A 3R0JA 1Y8QB 1H88C 5C4XJ 4NC8A 2IA2A 4YG2F 2JRTA 3R0AA 1STZA 1ZELA 3HPGA 2DMPA 1H9TA 1FIPA 5F6FA 4I76A 1GVJA 3FBIB 2GWRA 2ZXJA 4AIHA 5K5RA 5D8KB 1YHQI 2W25A 2GXAA 3EYIA 4U7DA 4CA0A 2VBYA 2L9NA 2WB1N 2W00A 2OBPA 4BAYA 1SVMA 3CCRI 4A0XA 3FM3A 4ZJZA 3JRDA 4C30A 2V6EA 1BN5A 2VQCA 3MKLA 1V5FA 1K61A 2WY8Q 4C2TA 3S1QJ 3ZQLA 4DYRA 2R7VA 3BR2A 5K7HA 1ZK8A 1BL0A 4G7OF 1RPWA 3GFLA 1BIAA 1FBUA 3RKYA 3GTMJ 4OAYA 1FYMA 4CCOA 1I5ZA 3OYMA 3WTYC 3JREA 3GTLJ 4XLNF 4LG3A 3N05A 4V2GA 1FJLA 1OLTA 2P6SA 3RYPA 2UXXA 3DPTA 1JUSA 3OR2C 3HOWJ 3CO6C 4B48A 3QAHA 3IWFA 2CMPA 1G3TA 4RB0A 4F91B 1I50J 1Y8RB 3BG9A 3JRCA 1XSDA 2CSOA 1T6SA 2MABA 1K83J 4MNUA 2DXIA 3HUGA 3V7SA 3HRTA 3H9JA 4IHVA 1HXDA 2YU3A 2XGEA 2XAGA 3HTUA 2HR3A 2LBFA 3CMMA 2CQNA 1Z7UA 3KLNA 4C3HJ 3I4PA 4BNCA 2OU2A 5HLIA 5ILSA 1LUJB 3FK7A 2P81A 2K85A 2QLZA 2XASA 4BBSJ 5EGOB 2F5DA 2DAOA 4R1HA 4AWXB 4NC7A 2KIFA 2K3PA 1PP7U 3QP6A 3ZMDA 3S1MJ 1FMVA 1E2XA 1SD4A 2VKDA 2OTLI 2ZMEC 2EA4A 3FDYA 4M3EA 3REOA 4BU2A 1GLNA 2X1CA 2AXTC 4MQ9F 3ZMVA 1O7FA 2YPRA 2X48A 1H8AC 1IN6A 2C6YA 2M87A 1IN7A 1SC7A 4WF2A 1K79A 1Z7LA 2XDVA 5EF6A 3KX2A 1DUXC 4ON0A 5FROA 2DA1A 1ZN2A 2L54A 4IOAF 2WC2A 2ZXIA 3FIWA 3OS2A 4IHXA 4MGRA 1W7PD 3BG7A 3H9QA 4LB6B 1YQAA 1MJ9A 2ACJA 4IPAA 4WCGA 1FBSA 3HPHA 4YELA 2DJNA 4WXCA 4KMFA 1MBEA 1ERDA 3ZQQA 1OCCH 4DJAA 2Z3YA 5F0HA 2R5YB 2YUSA 3DKXA 2HKOA 4BUPA 4A5NA 3WU1B 1O3RA 5IP7J 4LOCA 2WWYA 1MMNA 3KEYA 3ZQIA 4DW6A 3U21A 3OYLA 4ESJA 1OCZH 1JJ8C 1FZPB 1HDDC 1VQNI 3X2QH 1E3HA 2ME0A 3WTZA 5HS8A 2M8GX 3ZQFA 3H3UA 3COAC 5E79C 2D1VA 4IL6C 3H5NA 1XGMA 3MAJA 2KIUA 1UHWA 4ZDLA 4HF0A 3K4KA 5EZGA 1X1DA 4GYIA 2LH9A 4K2EA 3AL0C 1NK3P 4LIUA 4YFNF 3MKYB 3GXOA 3OR1C 4A3GJ 2G7HA 4EVIA 3CC2I 2NRAC 1DGRM 3FKIJ 4I2OA 3RQ4A 2E1MC 2H8WA 1OFCX 2IA1A 2HS5A 2JA6J 4A3DJ 2V1XA 2VC1A 5FLMJ 3S2WA 5LRRA 1L3LA 1K6OA 2HOTA 2NXNB 1XSVA 5M5YJ 3B6AA 4EJUA 3Q3SA 5E1ZB 1S9HA 4F3QA 4PFOA 1KGSA 1O57A 4YFKF 3HOXJ 5JHFA 1A6QA 2EFQA 2EZHA 1DU6A 3TO9A 2A68F 2JN6A 2H6CA 3OIQA 3K2AA 4NC6A 5IT3A 1JE8A 2GIZA 3CESA 3HRSA 3IV5A 4L0ZB 3ZQGA 3HHHA 3BR6A 3EUKL 1E0EA 3KP2A 2P8TA 4HQEA 4UHTA 1B72B 4EATA 2COBA 3FISA 1FLIA 2XPWA 2O03A 2RNJA 4Q4ZF 4IZZA 3L2CA 2JA5J 2E35A 4BHPA 5EEAA 2KZVA 2HKXA 2Z5UA 3FXLA 1ETOA 5BOXA 2VASA 1FOKA 5LRSA 4KDPA 2JJ7A 2PI0A 2ZNYA 3HTSB 5ICFA 4E7SA 4HBLA 4YIRX 1UZCA 2Z2SB 2XAJA 4G6DA 3SEZA 1HBXG 2R7ZJ 3FMSA 2LP0A 1R6RA 2MYSA 2RAEA 5HDGA 3IRRA 2Z9OA 1IDYA 5KHDA 2V1DA 3O2PE 3S1RJ 1Y39A 4HRIA 3HKZA 3K2ZA 3IAM2 3VYRB 2ZSHB 3I59A 4C9YA 1B9MA 2HOSA 3BR3A 4M9XA 2XF6A 1EH7A 2XUBA 2M3AA 3A01A 1EF4A 2OD5A 1IRZA 2MC3A 3S3OA 4KN7X 1YJNI 2Y48A 3OYCA 3GLLA 4FT8A 1G8XA 3BPXA 3HSEA 5H6QA 3IH4A 1D5VA 2DA4A 3P9CA 1OYWA 4L9TA 5F0FA 5DV5A 3IUOA 3RCOA 4RB2C 3GX4X 2IRFG 2RKHA 1I3AA 3KP6A 3BP8A 5D5WB 1LQ1A 2VOPA 2EFPA 1NK2P 2DI3A 4XM3A 2LSOA 5K5OA 4B09A 1G6NA 1QGPA 3VYTB 3BROA 5FLXZ 3TDZC 4U7BA 2E5ZA 4DYCA 1AKHB 4M71A 2IGMA 3ROUA 3RQIA 3GTKJ 3HB9A 2TDXA 3RKWA 4UB8C 4A2UA 2XAQA 2JQ7A 1VNDA 3ML6A 5FFXA 5HVQC 1XGOA 2QF7A 3SDBA 2VUMJ 1SMYF 5E8GA 3WGHA 2VXZA 1J59A 2K02A 5ICEA 3SEQA 2H6BA 1TT5B 4KISA 3HOVJ 2WAFA 1R36A 2DMUA 2LBFB 1F5TA 3GBGA 2ID3A 2OAZA 2DYRH 2W48A 1ZR4A 1RIOH 2P0WA 3IRQA 1LPQA 3KETA 4XN3A 3QPLA 2PJRA 4I98B 2LKXA 2R7WA 3G1MA 2XHKA 1TC3C 5AIQA 3PSIA 2Y31A 1RESA 3VEPA 1MMGA 5M3FJ 2ZJQF 3TW6A 3M8EA 3UR3C 5TISC 2PBIA 2YX4A 5FKKA 4XRMA 1PUFA 1MW7A 3RZOJ 2Y0MA 5J1UA 1YYVA 4AVPA 4UUTA 3F8FA 4XKVA 2W1OA 2GZWA 4Y33A 1FY7A 4HNUA 3LOCA 2V6CA 4YIIA 3RYRA 2HQ5A 1YW9A 4X0GA 2O7OA 1B4AA 5JLWA 5BQTA 4FTHA 1OQYA 1P7IA 3JSOA 5ICGA 3L09A 3A4CA 3IP4B 1WJ5A 3LQQA 3Q0VA 1R22A 5H20A 1YTYA 2QQAA 2ELHA 3S8PA 2Z33A 3HG9A 3RKXA 4Y13A 1PDNC 4XLFA 1D1AA 1MH3A 2RQPA 3F8BA 4M6XA 2N8GA 3WTWC 2HEOA 1YRNA 1I27A 4HZFA 3CF5F 2D2WA 3ZQ7A 5DUKA 2W4SA 4D5FA 1ZH5A 1DDNA 2FOKA 2K9SA 2DFEA 4KITB 4ESFA 5C3EJ 3LL7A 2ESNA 3BJ6A 3IAS2 4DGWB 1N77A 1RUOA 2STTA 5CJ9A 5F27A 2OCEA 4EJWA 1JHHA 1QO0D 1WJBA 2A6TA 3EUHA 4AIDA 3G1OA 2DQLA 1TWGJ 3ZRGA 1WH5A 3IWZA 2VC0A 2VBXA 5IYBJ 2HDDA 4FHTA 2XPUA 4CH7A 3JW4A 1ZARA 5BNGA 3LFUA 4CHUA 2A69F 1RR8C 1HSJA 1X1PA 2FD5A 2VKVA 1K78A 1ZGAA 3LSJA 4E7LA 5JHUA 2DA6A 4II3A 3ONQA 3QPSA 3J81K 2H09A 1XMKA 2WAEA 1XGSA 2ZC2A 4ZTFA 1MJBA 3I53A 3CMYA 3PNTA 1YO5C 1SVLA 4FE7A 4XNFA 2TRTA 4M3FA 3BJAA 1ZTRA 1MBHA 2CFOA 1J75A 2DQRA 3K10A 1XN7A 4U0WA 2VE8A 2L7KA 5GAGJ 3S2HJ 1JGGA 3H92A 2HDWA 1OCPA 3OYJA 4IKFA 2K9QA 2L9SA 4MO7A 1P4AA 2L9VA 3HC7A 2CGPA 2GAUA 1BI0A 2JVHA 2DMTA 2M0CA 1A31A 1IO2A 1N25A 1RKWA 3HM5A 2K40A 3V8KA 4LLLA 1A36A 3S15J 5D5VB 1BI2A 2UV1A 1F43A 1VQOI 2XGXA 3FWEA 5J1RA 1H89C 3K4CA 2X1EA 5DYMA 3DFGA 1AHDP 4X6AJ 2WAQN 4YRVA 3G71I 3E6CC 3R60A 5IP6A 3OMYA 2DW4A 1PJRA 4A3CJ 3BY6A 2CRGA 3CCUI 1JKOC 1LEAA 2YX7A 3RPUD 4M6YA 1DU0A 3F9KA 2F5FA 3I59B 3MN2A 3C2GA 4XOTA 3WGIA 3CZ6A 4JYKA 2MLGA 1WCMJ 4N0BA 2WV1A 3A01B 1QRYA 1MSFC 2F6CA 3F6VA 2DOEA 3OYNA 2F5EA 3KZYA 2A05A 4ABZA 2ZJPF 1BA5A 2JWTA 4ENNA 4XORA 1WI9A 3O6BB 2W7NA 2DK8A 3PQJA 3HOYJ 1D3YA 2LMDA 5LEJA 4HX8A 2IGKA 2E71A 4G8XA 2R5ZB 3ZN0A 1Z3XA 1IW7F 3VSKA 2OZUA 4PJ0C 2KQRA 5J8CA 2Y0SN 1QU3A 1E17A 1YOVB 2IT0A 3V4GA 3LSRA 4ZZLA 1VQ8I 2ELKA 4KN4X 2ZXHA 1QHHD 3BDDA 4KT6A 2F4OB 5LFAA 4S0HB 1A04A 1JUMA 2QQBA 3DTEA 1G59A 2NOGA 1BR4A 1JI8A 5AONA 3QPHA 1KU9A 2HPIA 4XKBA 2LLKA 2Z99A 2LRDA 2HNHA 5L3EA 1BM9A 2Y69H 5J1YA 1TWHJ 1TZLA 3LAPA 1HDPA 3CP8A 4UVBA 1TT0A 2ELJA 3ABMH 3ABTA 3T0YA 2B63J 3RIRA 2PJRB 3OYFA 5LGNA 4MEXF 1DPUA 4JBAA 2EB7A 1KQ8A 3M1EA 5L3DA 1SANA 4X1EA 5HODA 2E5NA 4IF4A 3ZPLA 2HVQA 1TQPA 2EV6A 5HNHA 3PIPF 2DA2A 3SFIA 2R5YA 2EH3A 1U5TC 3QU6A 4RMNA 1PUFB 2HYJA 1ETYA 3WU0A 2E2HJ 2PLYA 3Q9SA 5M5XJ 2K3FA 5IYCJ 3J7AY 2CW0F 3G4SI 4F55A 4AUXA 4IHYA 1I3QJ 2R7TA 3D1NI 3KP5A 1GDTA 5FKLA 2DDAA 3VSLA 1GHCA 1QHGA 1GV5A 2FX0A 3S1NJ 3BCAA 3LSIA 4DIQA 3LSHA 4IRHA 3WU2C 3OSGA 3K70C 4OIPF 1T0FC 2P6TA 2FBIA 3E97A 1TL8A 1O3SA 4LK0F 3PO2J 1OCRH 2BHZA 3FHZA 1YRNB 2HQNA 3SXYA 2AQFA 3H5RA 3MKZA 2KHMA 4RAYA 1IN8A 2RREA 5J6XA 3Q9VA 4N9HA 4RM3A 1ODDA 4EQQA 2R7QA 5K1YA 2NVXJ 3KFWX 1VQ7I 4NHJA 1WJEA 4ENKA 3I4NJ 4KFCA 2DDBA 2MW8A 2CQ7A 3OYKA 4UUSA 2DPUA 4BE2A 1FT9A 2WV0A 3KEOA 4XRSA 3KE2A 3CMEI 5DEQA 1JT0A 4GXOA 1YITI 5IT9Z 2RNGA 2FEZA 3CF2A 1ORKA 1B72A 3PUBA 4HV5A 3H0GJ 1P6RA 3FX3A 1NTCA 4XRFA 3WTSC 4FX4A 1BI1A 1T56A 3TO6A 4ZZDA 3KLOA 3W6KB 5DCMA 2MD0A 4G6TB 4CSWA 4OINF 1FYLA 2DFFA 2K7LA 4AVZA 1JKQC 4S04A 2WBMA 3GTPJ 3PQKA 5FFZA 2LF7A 1QPIA 1Y0UA 3PUFA 5IYDJ 1WGXA 3BR1A 2OCCH 5D5UB 2ETHA 3PNYA 3CMAI 2BY0A 3QOPA 1VQ4I 1U0JA 4MLOA 3ZR8X 3GMEA 5FJ8J 3GLXA 4PGGA 3CDHA 4HDUA 2JPBA 3KYCB 1GV2A 2Y2ZA 3D5RC 2GA1A 4C2MJ 5LHHA 3T1BA 4IX7A 1X4PA 3N4MA 2VQHA 3MKWB 2IS6A 2FA5A 3G6EI 3CDLA 1TW3A 1RETA 2DOFA 2XF7A 2IPQX 3BQZA 2EJRA 4UY8I 2IS2A 3QYEA 5DUIA 1U9NA 3VWBA 3MVPA 2VXDA 1Y1WJ 3C3WA 4JX6A 1E3OC 1MDMB 3CC7I 2V9VA 3WTTC 3K69A 2GA2A 1Z1DA 5DD8A 4C3IJ 5IPAA 3RKQA 4IQJA 1H9GA 3HOTA 4UVAA 1MMDA 1A35A 1J2XA 3BG5A 1W1WE 2K9MA 1P4WA 1RZ4A 1JKPC 3K1PA 3LSGA 4LFUA 1W7PA 2HOEA 2QUFA 5IT9K 2LDUA 2VN2A 3RPQA 3WODF 1U2WA 1AKHA 3BQYA 1R5GA 3DTKA 1WHUA 2PJPA 1WJCA 5CQGA 5L3FA 5IP9J 2R7XA 4KMUX 1UMQA 1XB4A 4MQVA 4EJVA 5E20A 1B59A 3S17J 3HIFA 5GADJ 1SD7A 3QP5A 4IJAA 2MH2A 3I5UA 1ZR2A 1UAAA 1MBKA 3K4JA 1FYKA 4LITA 3CJQB 2EBIA 4FISA 1TLHB 4W97A 2M8EA 1QA6A 2VQLA 3G73A 5FD5A 3D5SC 1DP3A 1PVEA 1IRXA 2VKEA 2E1CA 2KZGA 1HSTA 3GEZA 3FXOA 1GVDA 1M1EB 3EUAA 4G12A 2K9NA 2LOOA 4HDVA 1ZRDA 3A2KA 3OS0A 5J40A 3VYUB 1OR7A 3OL4A 2MFZA 1ETKA 4G9YA 1EJ9A 2LVSA 4A6DA 2PG4A 4WXDA 1ZG1A 1JHFA 4UVCA 3TBIA 2Y9YA 1YLFA 2TCTA 2O9LA 4IQ4A 2KDZA 1ONVA 2DJIA 1ZKGA 3HGGA 4YEJA 2IS1A 3FXQA 1IC8A 2PMUA 3TP0A 1JTYA 2X51A 1CGPA 2VPRA 2PEXA 1Y0NA 2KKOA 5CQEA 2K5CA 2EFOA 4Y17A 2LR8A 2E2IJ 1E3PA 2CQKA 2IGNA 2M0MA 3BPVA 4RGXA 4E70A 3FXJA 3L2WA 4IXAA 3DLLF 1BI3A 5DD4A 2L7ZA 3QODA 4BL0B 2OTJI 3OYAA 1TWAJ 2DOAA 4BDYA 4MFDA 2V1NA 4HNTA 3LWFA 4ZYDA 1BW5A 3CCLI 2LG4A 5ILUA 1X2NA 3CC4I 1D0ZA 2JT1A 4L9NA 4B47A 3K7AJ 1ZGJA 1MKMA 2VL8A 2WADA 4O6JA 4XKWA 3BTJA 3ZMSA 4EGYA 2XB0X 1IXRC 1XC5A 1Z0XA 2FMLA 5FO5A 4BXFA 5F1JA 1Z21A 1JXSA 5GPAA 5HNFA 4I02A 4BBRJ 1RRJA 3MCZA 3U9GA 3GFJA 4E7HA 2BHYA 4OWRB 1YE9A 5KNLA 2E36A 1FOWA 2IA0A 1QPMA 4V2FA 1F4KA 5HS9A 4FQGA 1FP1D 2CO5A 2K9LA 5FRMA 5E3OA 4E7IA 2AXLA 4WWCA 1FTZA 4EMSA 2K4JA 2FXAA 1YFHA 4E4HA 4UUSB 1Y1VJ 1VTNC 4EM1A 1XSXA 2R93J 2JA2A 3I55I 3CUQB 1TW2A 2JK3A 2QKLB 5L3CA 1S7OA 3P9IA 2CS3A 5E1WA 1G2HA 1D1BA 1U78A 3ECOA 1LB2A 3GVAA 1WH7A 3I56I 3CCSI 3DEWA 1IUYA 1W4MA 2DTRA 2I5UA 4IHTA 4CCLA 3TGNA 1ZQ3P 5E1XA 5DCMB 3I9V2 2V9PA 1R5ID 4ZYHA 3WTVC 3SYTA 2XRLA 1HKTA 2WB1A 2GQQA 1IV8A 3R4KA 3WTXC 4GO1A 4BQAA 1X19A 4PJMA 3HRMA 3NEUA 1JJ6C 2VQGA 1T08B 2O5RA 3H35A 3DP7A 4L5JA 1A5JA 1B1BA 4P9UA 3BLYA 3L2VA 2NNNA 3OYBA 2VONA 2KP6A 1MBGA 1ZAOA 4MTDA 3G1LA 5CLSA 4II2A 1X4OA 3E3VA 3H36A 3KYDB 4RLQA 5FD6A 2HYFA 3B02A 1T95A 5FGMA 3GZ6A 3BG6A 1U3EM 1EH8A 2KISA 1XD7A 3DU5A 3QWLA 4L5IA 1WFXA 3ULQB 2X4HA 3GW2A 4HSRA 4EM0B 4XR6A 2A07F 2ZMEA 3FKJA 2DU9A 3V7CA 1ENHA 2IGOA 3EUHC 1PUEE 5K7ZA 3PSFA 3UNGC 5K7FA 2XKOA 3CCYA 2BW3A 4XICA 2VBWA 4IEJA 2DO7A 2FNPA 2R5ZA 1TP4A 1IGNA 1IRGA 2JZYA 1RI7A 2BE5F 1OMIA 4IHSA 3LSTA 2DA7A 3PL8A 2XGDA 4DBRA 4G7ZF 3K4MA 3WE2A 3M9AA 2IXSA 3L9FA 2KRHA 4HEA2 1W7PB 1YJ9I 4RDUA 1XPXA 1D8KA 2CQQA 3G2BA 4FE4A 1POGA 3Q5FA 1ZGWA 4LG0B 2L4MA 2E1NA 1W0UA 2BXYA 1J7KA 2VB6A 2K27A 4TV7A 2XROA 3RSNA 2DBBA 3AAFA 2NS0A 2YU9J 3GTGJ 2A5YB 3ZP5A 3K4LA 3DPUA 1VQ5I 2DYSH 4B8XA 1MZBA 1XG1A 1JT6A 3JRAA 3GTQJ 3ZGKA 2DT6A 4BHCA 1IG7A 4U0VA 4H4KC 2IBDA 2ZBKA 3DXJF 5L3GA 1I6HJ 3IH2A 4Z6YA 4S05A 4J19A 4R8HA 2R4GA 4A3FJ 2G0EA 2H27A 3F8NA 1G4DA 1FOYA 2CW7A 5GAEJ 2X6OA 2BBYA 4QTRA 4PJLA 3TMOA 2NS7A 4AYBN 4B4CA 2DT7B 4M3BA 1ETQA 2K4BA 1VI0A 3E5QA 2GXGA 2VI6A 2WA0A 1K7AA 2YR2A 1BOBA 1TTYA 2DPDA 3ZMTA 5FLVA 5K5QA 2CG4A 2XSDC 4UB6C 4CYCA 3CJRB 2DTZA 1S72I 4UV9A 4NNJA 1TQMA 2XIGA 4RM2A 3TKYA 1ZLKA 2M34A 1D1CA 2RDPA 2H1KA 4M72A 2E34A 1NG7A 3CTAA 5FLXK 1O4XA 2IVMA 1WZ2A 4C3JJ 5LBQA 1D0YA 4Q5SF 3CD6I 2GXBA 2V9KA 3DEUA 5E8IA 4A5MA 5D6EA 1SFEA 3EQLF 3LA7A 3GWZA 4EJOA 1HCRA 2CU7A 4KA4A 1Z6TA 4D5CA 2EQRA 1ETXA 4D7MA 4ETSA 3K4NA 4PJJA 1FSHA 5CYVA 4BQQA 1F36A 4B44A 1RKTA 2Q0OA 2GOMA 2PMZN 4RS8A 1IJWC 3B6CA 3H3ZA 1UHSA 3K6GA 5C4JJ 3BC8A 1MNMC 3GCMA 2LD5A 2V4JC 1J0RA 3GFMA 3RPUA 3T5XA 4Y15A 1PYVA 2XRNA 3ZQCA 5HS7A 1XGNA 4BYYA 4LD5A 1VQPI 2QCOA 1Q1VA 1UCRA 1ZG3A 3CQZJ 4DBQA 1JGSA 4L0YB 4LGWA 2EZKA 4Y4RA 5EEGA 2QYOA 2QQ8A 2QEXI 1MBJA 3MZ8A 1LEBA 1I1SA 3A1YA 1LJ9A 2GIVA 3S93A 4CCNA 2JA8J 2FE3A 2LFBA 2ZJ2A 5CVVA 2DODA 3WGGA 1BJAA 2R92J 4CZZA 3OL3A 1J9IA 5J47A 4UV8A 1ZHFA 1HW5A 2ZCWA 3P9KA 1FC3A 2I10A 4PFPA 3FF5A 3KYLA 2BXZA 2P4WA 1YJWI 3ERED 1REPC 2PX9A 1W0TA 3FXMA 3ABLH 1AU7A 1JTXA 1LVKA 3OYEA 2UUZA 3W2VA 1FMWA 3S16J 4ESBA 3CCVI 3VB2A 1MDMA 4YIFA 4O5VA 3DBHB 3O3KA 4CXFA 4A3JJ 1OCTC 4BJ5C 3JRBA 3C18A 4RBOA 3K0LA 3T8RA 3MQ0A 1W36C 2DT5A 3PM1A 2KJCA 4IOCF 3C7JA 2HZTA 3OYIA 3W6JB 3J7YJ 4LLNA 1QZYA 3BTLA 2ZMEB 1SEUA 1LVAA 1Y6IA 4P5OA 2WTEA 4PZJA 5D6FA 4UNOA 4A12A 2M9HA 3SJMA 3OY9A 1WJFA 2HXOA 4IVNA 4M73A 3RTRA 1S29A 3E5XA 2VJJA 2BW3B 4LMYA 2EPFA 5A2QZ 1S7EA 2BV6A 3TOBA 1KQ0A 4AIKA 4IHWA 3OWTA 3PIOF 4KICA 5ERIA 4ZH4F 3HEFA 3JTGA 4XBFA 2X9DA 3CCMI 4JX4A 2JUCA 4A3EJ 5BPIA 1KQ9A 5LLQA 5J4YA 3DF8A 3BCBA 1WPKA 2EZIA 2VOOA 2A3SA 2L7FP 4PGHA 4QPQA 5DCFA 4GGGA 2IS4A 1C0WA 3SFZA 2ISZA 1B6AA 3ELKA 2Q1ZB 1Y56A 3A0BC 3ISPA 4XN0A 3UKGA 4MTEA 5GTHC 2XKPA 3DTIA 5FKOA 3TOAA 2R0QC 2X6XA 5B5EC 2W84A 5KAIC 2QENA 5LGTA 2VT3A 4QPOA 3AL0B 2XVCA 3LSMA 4I0BA 5E18F 3BZKA 2HPMA 1I39A 1FIAA 2LTPA 2MLKA 2GM4A 3LFKA 4F92B 3ASOH 3FXRA 2R7DA 4XLHA 2PQ8A 2L5QA 3OYDA 1R00A 1OPCA 2EZLA 2KDOA 2E1MB 2KJBA 3WG7H 2FMYA 4GCVA 4BH9A 3M8JA 4N4NB 1JKRC 3AG2H 2ME6A 4FCYA 2ZSIB 1WRJA 3DBLB 3V7RA 2BYVE 1XDUA 3I71A 3D0SA 5LD2C 3R61A 5EG0B 2LK2A 1WJAA 3NAUA 2R7FA 1QZEA 4I7HA 3AFHA 3L2QA 1IDZA 4CGZA 5HDKA 2AQEA 2DFHA 4EEFG 4BHBA 1ULYA 4EV0A 3HOUJ 1UG0A 2F4IA 4RGSA 3OYGA 2XAHA 2IW5A 1BR1A 5CVRA 4CYCB 1XCVA 3MFKA 1YX3A 4JK1X 2XF5A 1WJDA 2M1BA 3M07A 2COMA 2X6WA 3LNQA 3SZGA 3S14J 2Z1DA 5F1RA 2KIMA 3A02A 1SVOA 2KMUA 4XSXF 4I6ZA 1OCOH 3RZDJ 1P92A 2QVOA 3VFZA 3E6MA 4KT5C 2LC2A 1W5TA 3F0CA 4FETA 4HG2A 3SQNA 1HKSA 3A0HC 2M30A 3SDGA 1CF7A 1T38A 2L4AA 2ID6A 4EGZA 3HRUA 1O7LA 3S2DJ 3S3NA 1RNLA 2BY1A 3J80Z 3CUQA 2I8DA 1L0OC 3CDIA 4WK8F 1IF1A 3NQOA 1OR7C 4I01A 1IZ1A 4ZTJA 2ECBA 2FBHA 2R7OA 2KLOA 4HOBA 4A93J 2CW8A 4HLXA 1GXPA 1BR2A 1SMTA 4XLCA 3L2RA 1OYIA 1GXQA 3J7AO 3M4OJ 3E6DA 2D45A 1SFKA 2F4MB 4IO9F 3HL2A 4NUBA 3E7LA 2EIMH 1HW1A 3ZCOA 2KFDA 4KIFA 5JVGF 1ZREA 4EJTA 2LF8A 1SD5A 1VQMI 2F5VA 2M45A 3C1DA 3BWGA 2H8RA 2WAQA 4CCKA 1LFPA 3L1PA 3MMYB 3HDDA 2OUMA 2HYGD 3KP3A 1R4MB 4L9JA 4NDLA 2QA4I 5J8FA 3GZ5A 2NNYA 2VPLA 3LSKA 1GT0C 4XRSG 1JUPA 1T39A 3W3CA 3RJPA 5E3MA 4U88A 3DCFA 1VQ9I 1R1UA 4RGUA 3RDIA 4MEYF 4DYQA 2M5WA 4LLGF 2R7UA 5JFRA 2EK5A 4LIVA 1NH3A 2P5KA 3GTJJ 2FRHA 2OC6A 2XSJC 4OMZA 3U1KA 1V55H 5J4VA 1MIJA 1G3WA 4HW0A 3BG3A 9ANTA 2BY3A 3KEQA 1WQ2A 4CZCA 4OIOF 1UHMA 1W36D 3FXKA 3SZPA 1FNNA 4RB1A 4BEHB 2EFWA 3K1MA 2MSYA 1ZRFA 3J80K 2Y0SA 3O8GA 5KCMA 3ZXSA 1X1CA 3ZQHA 4U0YA 1V3FA 4PSWA 5IOYA 3WTUC 4H0EA 4A3LJ 4M74A 1USTA 4CCMA 4LG0A 2HI3A 1U5TA 3CLOA 4M9SA 1LNWA 3JRGA 1R58A 3V8LA 1QQIA 5BMZA 4A6EA 2VT2A 3HKZN 4BJ6C 1FSEA 3QOEA 2FJ1A 2B0LA 2Q8KA 1SFXA 2MH9A 4YFXF 2QWWA 5C44J 3V8JA 3OV8A 3JRHA 2VJ4A 1SAUA 1WVRA 3ECHA 2B9SA 3M3YJ 3SZTA 3CJNA 1VQ6I 1YS7A 2ZB9A 3TDUC 2DCEA 1MNEA 1OYYA 3IC7A 4RAGA 1KU2A 3LSPA 2FQ3A 2CUJA 4BE0A 1T0FA 1Z67A 4KJZA 3IH3A 5F64A 4LJZF 1SFOJ 2X0LA 2PN6A 1YG2A 4D9JA 4HLYA 4LB5A 2F2EA 4E7ZA 1FP2A 3P5JA 1WSUA 3RI4A 1IUFA 2DA5A 4XOPA 3ZN1A 4OOIA 1IV6A 1HA8A 2JVGA 2GLOA 5CVIA 3OIOA 5FKMA 2HGCA 1FX7A 2A61A 2ZJRF 1V5GA 5HLTA 1KYWA 3Q0WA 1LFBA 4PCQA 5B1BH 3WE3A 2O8XA 2VE9A 1OISA 2LKSA 4U87A 3LA3A 1NHAA 4Z2YA 4BKXA 4NBQA 5JLXA 2JUGA 5EZHA 4XLPF 3D5LA 3F3XA 1ZLJA 3S32A 1S5LC 4QIWN 4IRGA 2CH0A 3VODA 2BVLA 2OV7A 1LE8B 2A6EF 1XTAA 1ZG5A 2V1UA 5E3LA 2O8KA 1AOYA 2NAZA 2X85A 3ABUA 4PSXA 2G9WA 1I6XA 4ZYEA 5EYRA 2JA7J 2M4KA 3E6BA 5M3MJ 5E3NA 2LY1A 4CCJA 1DGWY 2O0YA 1A6IA 1KONA 3DLAA 2G7UA 4Y7NJ 5JI6A 1YIJI 3DV8A 5GP9A 1U9OA 4PJNA 3GTOJ 4XONA 2R7RA 1O3TA 2DFIA 3JR9A 5E17F 3CJTB 3ESWB 2L9RA 2ZO4A 3H5AA 3K70D 1DQUA 4UUVA 2VJ5A 3BTIA 5BS6A 3I3LA 2QBYB 3JSPA 2MD5A 1IN4A 1T2KA 1BC7C 2HVRA 3O8HA 1X3ZB 5D8LB 5GPCA 1WKMA 5LGUA 2IEKA 3MZHA 5ICCA 4F93B 3GYHX 2P5VA 1DPRA 2P5LC 2JRMA 4ENMA 2BEOA 2NVYJ 4WX9A 2DK5A 1FBQA 4XIDA 1CF7B 1D8JA 3CLQA 2XGCA 5TRDA 2AHQA 4OMYA 5D4RA 1R71A 2XAUA 1AWCA 2QSFX 3KZZA 2RN7A 4OIQF 6PAXA 1V54H 5F0CA 4MHGA 3GFIA 1SAXA 2V7FA 2W57A 5D5XB 1Z05A 1P2FA 1K6YA 4KIGA 1T98A 4Q47A 3B73A 2PMHA 3KP4A 4JQFA 4OU0A 4L5EA 1TNSA 3KP7A 1P7JA 2QKMB 4DNCA 3CP2A 2M7AA 1YW8A 5CKTA 4M9ZA 4KYWA 2NVUB 4BQOA 1ON2A 3OOPA 4CO8A 5DTDA 3JTHA 2UXNA 3Q0UA 4EM2A 4A3MJ 2W82A 1N75A 2H94A 3JAMZ 2FNAA 3W6VA 3F6OA 3V42A 4KIBA 1N78A 1MH4A 1VZ0A 1QNTA 1Z91A 2NS8A 5J3LA 2D5VA 4ZDOA 4AM3A 1GUUA 1R5HA 4NB5A 5KK1A 2FBKA 3BZ6A 4RA2A 1UB9A 2UWMA 3DKWA 4W1UA 3QYBA 4PK4A 1RC9A 4A3IJ 1HOMA 3NARA 4BQNA 3FXUA 4AC0A 5LHGA 5FKNA 2HTSA 5HLHA 2QSGX 2OJED 3IKTA 3CO7C 3FK6A 1APLC 2HQRA 2W85A 2Y30A 4CICA 4PDKA 2M7BA 3LA2A 2NVTJ 2JTVA 1QBJA 1XS9A 1R9TJ 4GYGA 1CQTA 2HWVA 4GFBA 2CQXA 5DM7F 1HF0A 4Y3OA 2RGVA 3WG9A 2DMQA 5DDGA 3KZIC 2P7CB 5HOOA 2LY9A 2W24A 1PP8F 2RVCA 1R1VA 1ON1A 3HYIA 4N9IA 3MD2A 4G6QA 3IL2A 1P4XA 2IP2A 1U5TB 1ETWA 3HJEA 2KPMA 3KPHA 4ITVA 2JPCA 3M7GA 1TWCJ 1Z3YA 2NOJB 2WY7Q 2L3DA 4A3KJ 2EINH 2Q2EA 2V26A 2OPTA 5FRNA 3GUDA 3I54A 1FPQA 2CWEA 1WWXA 3TEDA 1X3WB 2BZTA 2YSRA 4DZJA 4E7JA 2ZXWH 3KIOA 3JAMK 4L9VA 4JP0A 2IJLA 3BT9A 4P9FA 1S6LA 2UZKA 4HAMA 5EEHA 3K1NA 3PJRA 2RC4A 1LKXA 1P9QC 3DQVC 4DZPA 2HOAA 1BBYA 5IY5H 5LHIA 1HW2A 1R1TA 2BOLA 1YX5A 2FQ4A 2EIKH 3BR5A 1OKRA 3HUGB 3F23A 3TP3A 2ADUA 4B1RA 4CDGA 3W2AA 2HU9A 4ZDPA 1MJAA 4R79A 2EV5A 2BVMA 4ZYGA 3FMRA 4BGDA 1X1AA 3HOSA 1G3YA 2DMNA 1EH6A 2RV8A 2GBYA 5B66C 2O6GE 2V79A 4N4OB 5DS9A 5EG0A 2CUZA 1XMXA 1YW7A 2FOWA 1YI2I 1FOXA 4G7HF 3E0JB 2MBFA 1MBFA 3SHFA 4PUSA 5GTIC 3J81Z 3K9TA 2ZNZA 4HQMA 2JSCA 1KYZA 2HZDA 5F08A 3MZYA 4D0PA 2MG4A 1ETVA 3PNVA 4P1WA 4RGRA 1B8IA
chains in the Genus database with same CATH topology
5M5YJ 3B6AA 3Q3SA 1FTTA 1U9NA 3HOXJ 3UKGA 3MVPA 1Y1WJ 2EZHA 3VPRA 1DU6A 2JN6A 4JX6A 1E3OC 2L0KA 3TW7A 3K2AA 5FKOA 4C3IJ 5IPAA 2R0QC 3RKQA 4BY1J 1X2MA 3IV5A 3ZQGA 3BR6A 3BG5A 1BJZA 1JKPC 1B72B 2COBA 3FISA 3LSGA 2XPWA 1LFUP 2JA5J 3HGYA 1FIAA 2LTPA 5EEAA 2GM4A 2HXIA 1ETOA 1AKHA 3BQYA 1X58A 2JJ7A 2EZLA 5IP9J 1JKRC 2ME6A 1UMQA 4FCYA 5IOZA 4MFEA 3S17J 3WHCA 2R7ZJ 5EG0B 2LK2A 2LP0A 2RAEA 3NAUA 1ZR2A 1IDYA 1MBKA 2XB5A 4M3DA 1IDZA 3S1RJ 4EEFG 2EBIA 4FISA 3HOZJ 4W97A 3HOUJ 4CYCB 1WI3A 1OJLA 2L7MP 2HOSA 3BR3A 3A01A 1EF4A 2VKEA 4XK4A 1GVDA 4G12A 1IRZA 2K9NA 2YS9A 3LNQA 3S14J 4BY7J 3A02A 2CJJA 4I6ZA 1ETKA 2XPVA 3IH4A 3RZDJ 2LVSA 2DA4A 3F0CA 1QVUA 5F0FA 2Y9YA 3H3VK 2TCTA 2O9LA 3SDGA 4A3BJ 2KDZA 4JX5A 1ZKGA 2ID6A 3HGGA 3C2BA 3JRIA 5EDNA 1MSEC 1IC8A 5M5WJ 1NK2P 3S2DJ 2IAIA 3TP0A 1JTYA 2DA3A 2VPRA 4M3GA 1HLVA 2LR8A 4QSHA 2E2IJ 4DYCA 1AKHB 2ECBA 4A93J 3RQIA 3GTKJ 3HB9A 1VNDA 2L7ZA 1TWAJ 2QF7A 4MFDA 2VUMJ 3M4OJ 4HNVA 1BW5A 3HOVJ 3E7LA 1X2NA 2DMUA 3GBGA 2ID3A 2W48A 1ZR4A 3K7AJ 2H8RA 3BTJA 3QPLA 2XB0X 2LKXA 2CUEA 3HDDA 1XC5A 3L1PA 3G1MA 1Z0XA 4NDLA 5F1JA 1TC3C 3BR0A 5GPAA 2Y31A 4Y52J 1RESA 4BBRJ 5M3FJ 1GT0C 4XRSG 3HBLA 3TW6A 4XRMA 1JUPA 5FKKA 5E3MA 1PUFA 3RZOJ 3JRFA 5J1UA 4V2FA 2CUFA 3DCFA 4UUTA 4DYQA 5E3OA 3LOCA 3PO3J 2HQ5A 3GTJJ 1FTZA 2O7OA 5JLWA 4FTHA 1P7IA 3BG3A 9ANTA 4UUSB 1Y1VJ 3Q0VA 1RR7A 2ECCA 2R93J 1BW6A 5EGOA 2JK3A 2MSYA 1G2HA 1U78A 1MH3A 3O8GA 1WH7A 3BTCA 2N8GA 3DEWA 3ZQHA 1QVTA 1YRNA 1ZQ3P 1LE8A 5IOYA 4A3LJ 1D5YA 2XRLA 4D7NA 2HI3A 4D5FA 2K9SA 2JMWA 3JRGA 1JJ6C 5C3EJ 3HKZN 5F27A 1A5JA 3OOUA 3G1OA 1TWGJ 1WH5A 2FJ1A 5C44J 1MBGA 2HDDA 5IYBJ 2XPUA 3JRHA 2MGQA 3G1LA 2KT0A 5BNGA 3M3YJ 2ZB9A 2M2EA 4MIMA 2FD5A 5F04A 2VKVA 3LSPA 3LSJA 3WHBA 1ITYA 2DN0A 3IH3A 1FEXA 2DA6A 4M6VA 1SFOJ 3QPSA 1B8IB 1ENHA 1UG2A 3CMYA 5K7ZA 1IUFA 2DA5A 1IV6A 4FE7A 2GLOA 3OIOA 5FKMA 4M3FA 2TRTA 5K7FA 3CCYA 1ZTRA 4XICA 3QQAA 1MBHA 4IEJA 3OSFA 3Q0WA 2R5ZA 1LFBA 1IGNA 2OF7A 2AO9A 1Z77A 4BKXA 4A69C 5JLXA 2DA7A 3S2HJ 1JGGA 1VFCA 1OCPA 2XGDA 5EZHA 2K9QA 4QIWN 4MO7A 2E2JJ 4RDUA 1LE8B 2CQQA 2E19A 2DMTA 2NVQJ 4FE4A 2M0CA 1POGA 1ZGWA 1T33A 5E3LA 1W0UA 2O8KA 1U8BA 1RKWA 3HM5A 3S15J 2K40A 1F43A 2Y9ZA 1H89C 5EYRA 5J1RA 2JA7J 5M3MJ 5E3NA 3A03A 1AHDP 4X6AJ 1A6IA 2WAQN 2YU9J 4Y7NJ 3GTGJ 3I4MJ 5IP6A 3GTOJ 5GP9A 1U9OA 4A3CJ 3JR9A 2CRGA 2L9RA 1JKOC 2E1OA 3BTIA 1DU0A 1XG1A 1JT6A 3JRAA 3GTQJ 3MN2A 1IG7A 1VF9A 2IBDA 4BXXJ 1I6HJ 4JYKA 3O8HA 1WCMJ 2WV1A 3IH2A 1QRYA 3A01B 1MSFC 5GPCA 4J19A 4B3AA 4A3FJ 2G0EA 2IEKA 4ABZA 1BA5A 2X6OA 2JWTA 4QTRA 2NS7A 4AYBN 2NVYJ 3ZOBA 4B4CA 1TWFJ 3HOYJ 4M3BA 1ETQA 4XIDA 1VI0A 1H88C 5C4XJ 2VI6A 2XGCA 2R5ZB 2AHQA 2DMPA 2Y0SN 5FLVA 1FIPA 4I76A 2XSDC 5F0CA 4CYCA 2DTZA 3LSRA 2ELKA 2WB1N 2M34A 4L5EA 2H1KA 1P7JA 4S0HB 1JUMA 2NOGA 1O4XA 2LLKA 4C3JJ 3JRDA 3MKLA 1K61A 5DTDA 3Q0UA 5J1YA 1TWHJ 3ZQLA 4DYRA 3S1QJ 4A3MJ 1HCRA 1HDPA 3BR2A 5K7HA 2CU7A 3W6VA 4D5CA 1ZK8A 2EQRA 1ETXA 4D7MA 1BL0A 1RPWA 2B63J 3GTMJ 1MH4A 1F36A 1IJWC 1RKTA 2NS8A 2PMZN 5J3LA 3JREA 2D5VA 3GTLJ 3B6CA 1UHSA 1GUUA 4V2GA 1FJLA 5C4JJ 1SANA 4X1EA 5HODA 1MNMC 1JUSA 2LD5A 2DA2A 3SFIA 2R5YA 4W1UA 3HOWJ 2EH3A 4A3IJ 1HOMA 1PUFB 1I50J 1ETYA 2HYJA 3BG9A 3JRCA 2E2HJ 5M5XJ 3NARA 5IYCJ 3ZQCA 1K83J 4IHVA 2QCOA 1Q1VA 3CQZJ 4AUXA 4AC0A 4IHYA 5FKNA 2XGEA 1I3QJ 2EZKA 3FK6A 1APLC 3D1NI 1GDTA 2Y30A 4C3HJ 1MBJA 5FKLA 3FK7A 2NVTJ 2P81A 1GV5A 2FX0A 2JA8J 3S1NJ 5EGOB 4BBSJ 2LFBA 1XS9A 1R9TJ 1CQTA 3OSGA 4GFBA 2CQXA 2R92J 1HF0A 3S1MJ 2DMQA 3PO2J 4M3EA 1YRNB 2LY9A 2I10A 1H8AC 2X48A 1W0TA 1AU7A 1JTXA 1ETWA 5EF6A 1TWCJ 4A3KJ 2NVXJ 2DA1A 3S16J 3I4NJ 2MW8A 2OPTA 3FIWA 4UUSA 4IHXA 4XRSA 3TEDA 1OCTC 4A3JJ 3JRBA 4DZJA 1JT0A 4RBOA 2DJNA 4JP0A 3BT9A 1MBEA 1ORKA 3PM1A 1B72A 3H0GJ 1NTCA 5F0HA 1T56A 2YUSA 2R5YB 4DZPA 2HOAA 5IP7J 4LOCA 3BTLA 3ZQIA 4DW6A 2FQ4A 3BR5A 1JKQC 3TP3A 4B1RA 1JJ8C 1HDDC 3GTPJ 2M9HA 3SJMA 2ME0A 2HXOA 1QPIA 2M8GX 1WGXA 3BR1A 3ZQFA 5IYDJ 2DMNA 2GBYA 5DS9A 5EG0A 5EZGA 1S7EA 1NK3P 4MLOA 5FJ8J 1GV2A 2Y2ZA 1MBFA 4IHWA 4C2MJ 4A3GJ 3FKIJ 3HEFA 2X9DA 4JX4A 4A3EJ 3CDLA 5F08A 1OFCX 1RETA 2JA6J 4A3DJ 1WPKA 2HOTA 2EZIA 1ETVA 2MG4A 5FLMJ 2L7FP 3BQZA 1B8IA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5M5Y J;  3B6A A;  3Q3S A;  1FTT A;  1U9N A;  3HOX J;  3UKG A;  3MVP A;  1Y1W J;  2EZH A;  3VPR A;  1DU6 A;  2JN6 A;  4JX6 A;  1E3O C;  2L0K A;  3TW7 A;  3K2A A;  5FKO A;  4C3I J;  5IPA A;  2R0Q C;  3RKQ A;  4BY1 J;  1X2M A;  3IV5 A;  3ZQG A;  3BR6 A;  3BG5 A;  1BJZ A;  1JKP C;  1B72 B;  2COB A;  3FIS A;  3LSG A;  2XPW A;  1LFU P;  2JA5 J;  3HGY A;  1FIA A;  2LTP A;  5EEA A;  2GM4 A;  2HXI A;  1ETO A;  1AKH A;  3BQY A;  1X58 A;  2JJ7 A;  2EZL A;  5IP9 J;  1JKR C;  2ME6 A;  1UMQ A;  4FCY A;  5IOZ A;  4MFE A;  3S17 J;  3WHC A;  2R7Z J;  5EG0 B;  2LK2 A;  2LP0 A;  2RAE A;  3NAU A;  1ZR2 A;  1IDY A;  1MBK A;  2XB5 A;  4M3D A;  1IDZ A;  3S1R J;  4EEF G;  2EBI A;  4FIS A;  3HOZ J;  4W97 A;  3HOU J;  4CYC B;  1WI3 A;  1OJL A;  2L7M P;  2HOS A;  3BR3 A;  3A01 A;  1EF4 A;  2VKE A;  4XK4 A;  1GVD A;  4G12 A;  1IRZ A;  2K9N A;  2YS9 A;  3LNQ A;  3S14 J;  4BY7 J;  3A02 A;  2CJJ A;  4I6Z A;  1ETK A;  2XPV A;  3IH4 A;  3RZD J;  2LVS A;  2DA4 A;  3F0C A;  1QVU A;  5F0F A;  2Y9Y A;  3H3V K;  2TCT A;  2O9L A;  3SDG A;  4A3B J;  2KDZ A;  4JX5 A;  1ZKG A;  2ID6 A;  3HGG A;  3C2B A;  3JRI A;  5EDN A;  1MSE C;  1IC8 A;  5M5W J;  1NK2 P;  3S2D J;  2IAI A;  3TP0 A;  1JTY A;  2DA3 A;  2VPR A;  4M3G A;  1HLV A;  2LR8 A;  4QSH A;  2E2I J;  4DYC A;  1AKH B;  2ECB A;  4A93 J;  3RQI A;  3GTK J;  3HB9 A;  1VND A;  2L7Z A;  1TWA J;  2QF7 A;  4MFD A;  2VUM J;  3M4O J;  4HNV A;  1BW5 A;  3HOV J;  3E7L A;  1X2N A;  2DMU A;  3GBG A;  2ID3 A;  2W48 A;  1ZR4 A;  3K7A J;  2H8R A;  3BTJ A;  3QPL A;  2XB0 X;  2LKX A;  2CUE A;  3HDD A;  1XC5 A;  3L1P A;  3G1M A;  1Z0X A;  4NDL A;  5F1J A;  1TC3 C;  3BR0 A;  5GPA A;  2Y31 A;  4Y52 J;  1RES A;  4BBR J;  5M3F J;  1GT0 C;  4XRS G;  3HBL A;  3TW6 A;  4XRM A;  1JUP A;  5FKK A;  5E3M A;  1PUF A;  3RZO J;  3JRF A;  5J1U A;  4V2F A;  2CUF A;  3DCF A;  4UUT A;  4DYQ A;  5E3O A;  3LOC A;  3PO3 J;  2HQ5 A;  3GTJ J;  1FTZ A;  2O7O A;  5JLW A;  4FTH A;  1P7I A;  3BG3 A;  9ANT A;  4UUS B;  1Y1V J;  3Q0V A;  1RR7 A;  2ECC A;  2R93 J;  1BW6 A;  5EGO A;  2JK3 A;  2MSY A;  1G2H A;  1U78 A;  1MH3 A;  3O8G A;  1WH7 A;  3BTC A;  2N8G A;  3DEW A;  3ZQH A;  1QVT A;  1YRN A;  1ZQ3 P;  1LE8 A;  5IOY A;  4A3L J;  1D5Y A;  2XRL A;  4D7N A;  2HI3 A;  4D5F A;  2K9S A;  2JMW A;  3JRG A;  1JJ6 C;  5C3E J;  3HKZ N;  5F27 A;  1A5J A;  3OOU A;  3G1O A;  1TWG J;  1WH5 A;  2FJ1 A;  5C44 J;  1MBG A;  2HDD A;  5IYB J;  2XPU A;  3JRH A;  2MGQ A;  3G1L A;  2KT0 A;  5BNG A;  3M3Y J;  2ZB9 A;  2M2E A;  4MIM A;  2FD5 A;  5F04 A;  2VKV A;  3LSP A;  3LSJ A;  3WHB A;  1ITY A;  2DN0 A;  3IH3 A;  1FEX A;  2DA6 A;  4M6V A;  1SFO J;  3QPS A;  1B8I B;  1ENH A;  1UG2 A;  3CMY A;  5K7Z A;  1IUF A;  2DA5 A;  1IV6 A;  4FE7 A;  2GLO A;  3OIO A;  5FKM A;  4M3F A;  2TRT A;  5K7F A;  3CCY A;  1ZTR A;  4XIC A;  3QQA A;  1MBH A;  4IEJ A;  3OSF A;  3Q0W A;  2R5Z A;  1LFB A;  1IGN A;  2OF7 A;  2AO9 A;  1Z77 A;  4BKX A;  4A69 C;  5JLX A;  2DA7 A;  3S2H J;  1JGG A;  1VFC A;  1OCP A;  2XGD A;  5EZH A;  2K9Q A;  4QIW N;  4MO7 A;  2E2J J;  4RDU A;  1LE8 B;  2CQQ A;  2E19 A;  2DMT A;  2NVQ J;  4FE4 A;  2M0C A;  1POG A;  1ZGW A;  1T33 A;  5E3L A;  1W0U A;  2O8K A;  1U8B A;  1RKW A;  3HM5 A;  3S15 J;  2K40 A;  1F43 A;  2Y9Z A;  1H89 C;  5EYR A;  5J1R A;  2JA7 J;  5M3M J;  5E3N A;  3A03 A;  1AHD P;  4X6A J;  1A6I A;  2WAQ N;  2YU9 J;  4Y7N J;  3GTG J;  3I4M J;  5IP6 A;  3GTO J;  5GP9 A;  1U9O A;  4A3C J;  3JR9 A;  2CRG A;  2L9R A;  1JKO C;  2E1O A;  3BTI A;  1DU0 A;  1XG1 A;  1JT6 A;  3JRA A;  3GTQ J;  3MN2 A;  1IG7 A;  1VF9 A;  2IBD A;  4BXX J;  1I6H J;  4JYK A;  3O8H A;  1WCM J;  2WV1 A;  3IH2 A;  1QRY A;  3A01 B;  1MSF C;  5GPC A;  4J19 A;  4B3A A;  4A3F J;  2G0E A;  2IEK A;  4ABZ A;  1BA5 A;  2X6O A;  2JWT A;  4QTR A;  2NS7 A;  4AYB N;  2NVY J;  3ZOB A;  4B4C A;  1TWF J;  3HOY J;  4M3B A;  1ETQ A;  4XID A;  1VI0 A;  1H88 C;  5C4X J;  2VI6 A;  2XGC A;  2R5Z B;  2AHQ A;  2DMP A;  2Y0S N;  5FLV A;  1FIP A;  4I76 A;  2XSD C;  5F0C A;  4CYC A;  2DTZ A;  3LSR A;  2ELK A;  2WB1 N;  2M34 A;  4L5E A;  2H1K A;  1P7J A;  4S0H B;  1JUM A;  2NOG A;  1O4X A;  2LLK A;  4C3J J;  3JRD A;  3MKL A;  1K61 A;  5DTD A;  3Q0U A;  5J1Y A;  1TWH J;  3ZQL A;  4DYR A;  3S1Q J;  4A3M J;  1HCR A;  1HDP A;  3BR2 A;  5K7H A;  2CU7 A;  3W6V A;  4D5C A;  1ZK8 A;  2EQR A;  1ETX A;  4D7M A;  1BL0 A;  1RPW A;  2B63 J;  3GTM J;  1MH4 A;  1F36 A;  1IJW C;  1RKT A;  2NS8 A;  2PMZ N;  5J3L A;  3JRE A;  2D5V A;  3GTL J;  3B6C A;  1UHS A;  1GUU A;  4V2G A;  1FJL A;  5C4J J;  1SAN A;  4X1E A;  5HOD A;  1MNM C;  1JUS A;  2LD5 A;  2DA2 A;  3SFI A;  2R5Y A;  4W1U A;  3HOW J;  2EH3 A;  4A3I J;  1HOM A;  1PUF B;  1I50 J;  1ETY A;  2HYJ A;  3BG9 A;  3JRC A;  2E2H J;  5M5X J;  3NAR A;  5IYC J;  3ZQC A;  1K83 J;  4IHV A;  2QCO A;  1Q1V A;  3CQZ J;  4AUX A;  4AC0 A;  4IHY A;  5FKN A;  2XGE A;  1I3Q J;  2EZK A;  3FK6 A;  1APL C;  3D1N I;  1GDT A;  2Y30 A;  4C3H J;  1MBJ A;  5FKL A;  3FK7 A;  2NVT J;  2P81 A;  1GV5 A;  2FX0 A;  2JA8 J;  3S1N J;  5EGO B;  4BBS J;  2LFB A;  1XS9 A;  1R9T J;  1CQT A;  3OSG A;  4GFB A;  2CQX A;  2R92 J;  1HF0 A;  3S1M J;  2DMQ A;  3PO2 J;  4M3E A;  1YRN B;  2LY9 A;  2I10 A;  1H8A C;  2X48 A;  1W0T A;  1AU7 A;  1JTX A;  1ETW A;  5EF6 A;  1TWC J;  4A3K J;  2NVX J;  2DA1 A;  3S16 J;  3I4N J;  2MW8 A;  2OPT A;  3FIW A;  4UUS A;  4IHX A;  4XRS A;  3TED A;  1OCT C;  4A3J J;  3JRB A;  4DZJ A;  1JT0 A;  4RBO A;  2DJN A;  4JP0 A;  3BT9 A;  1MBE A;  1ORK A;  3PM1 A;  1B72 A;  3H0G J;  1NTC A;  5F0H A;  1T56 A;  2YUS A;  2R5Y B;  4DZP A;  2HOA A;  5IP7 J;  4LOC A;  3BTL A;  3ZQI A;  4DW6 A;  2FQ4 A;  3BR5 A;  1JKQ C;  3TP3 A;  4B1R A;  1JJ8 C;  1HDD C;  3GTP J;  2M9H A;  3SJM A;  2ME0 A;  2HXO A;  1QPI A;  2M8G X;  1WGX A;  3BR1 A;  3ZQF A;  5IYD J;  2DMN A;  2GBY A;  5DS9 A;  5EG0 A;  5EZG A;  1S7E A;  1NK3 P;  4MLO A;  5FJ8 J;  1GV2 A;  2Y2Z A;  1MBF A;  4IHW A;  4C2M J;  4A3G J;  3FKI J;  3HEF A;  2X9D A;  4JX4 A;  4A3E J;  3CDL A;  5F08 A;  1OFC X;  1RET A;  2JA6 J;  4A3D J;  1WPK A;  2HOT A;  2EZI A;  1ETV A;  2MG4 A;  5FLM J;  2L7F P;  3BQZ A;  1B8I A; 
#chains in the Genus database with same CATH topology
 4NQW A;  5HLG A;  4HST A;  4GRI A;  3DEE A;  1R7J A;  1FTT A;  5ED4 A;  4J01 A;  1EKE A;  3NRV A;  5D4S A;  2P7V B;  3VPR A;  1QZZ A;  2CV2 A;  2L0K A;  2XAF A;  3TW7 A;  4BY1 J;  1X2M A;  3KCC A;  2FU4 A;  4DQ2 A;  3FMQ A;  5ILV A;  2O61 A;  2EWN A;  4ZYA A;  1BJZ A;  3GO5 A;  5B3S H;  3I58 A;  3EET A;  1R23 A;  4AU7 A;  3BOQ A;  1LFU P;  4BS9 A;  4IRI A;  3HGY A;  4AIJ A;  2AS5 F;  1KZH A;  2HXI A;  2ZFW A;  1J5Y A;  5DM6 F;  3QRF F;  1S8N A;  4XSZ F;  1AA7 A;  1X58 A;  4I0A A;  1MMA A;  4CUG A;  1G3S A;  3IKV A;  2X1D A;  4XLA A;  2J5O A;  1SFU A;  3ZMZ A;  3M1C A;  5CVJ A;  2ESH A;  2VJI A;  3M8F A;  2LY2 A;  5IOZ A;  4MFE A;  3TL4 X;  1UJ8 A;  3WHC A;  2X6Y A;  4ANJ A;  4BDZ A;  4Q48 A;  1IXC A;  2B7E A;  2XB5 A;  4M3D A;  2LKP A;  3VOE A;  3R6S A;  3H1C A;  2F5C A;  3AG4 H;  5TJJ A;  4FAS D;  2FSW A;  5JR3 A;  2HVS A;  3HOZ J;  4C2U A;  3E1S A;  1ZRC A;  3TO7 A;  1WI3 A;  1IRF A;  1OJL A;  3QPT A;  2L7M P;  3NWT A;  5L3B A;  3N97 A;  3BJO A;  4XK4 A;  2YS9 A;  4BY7 J;  4BXU A;  2VLA A;  5H6R A;  2CJJ A;  2LYC A;  2XPV A;  5KVR A;  4UXN A;  1VQL I;  2QM3 A;  1QVU A;  3FM5 A;  3AKZ A;  3H3V K;  3BZC A;  1H0M A;  4A3B J;  3JCU C;  4XMY A;  4JX5 A;  2A6H F;  3C2B A;  3JRI A;  1UFM A;  2JSP A;  5EDN A;  1R49 A;  3HSF A;  3FHN A;  1NG6 A;  5M5W J;  1K4S A;  1MSE C;  2IAI A;  4DOZ A;  2QSH X;  1LDJ A;  2DA3 A;  4CYD A;  2QZ8 A;  5HDN A;  3CCE I;  3VYS B;  4RAF A;  2XV4 S;  4BEH A;  2OQR A;  2VIX A;  2CYY A;  3CUO A;  4M3G A;  4RLF A;  1HLV A;  4XL9 A;  4QSH A;  2MA3 A;  1O3Q A;  3VDX A;  2HFH A;  1X3U A;  3LQR A;  1KU3 A;  4HX4 A;  1RUN A;  2D1H A;  1XDS A;  4KNY A;  2HQA A;  3HHG A;  3PFY A;  2BY2 A;  4HNV A;  3DPL C;  4RB3 C;  4HPQ A;  3HXL A;  2RQQ A;  3L7W A;  3CUQ C;  2VOD A;  1BOA A;  2QQ9 A;  4E7K A;  4XLE A;  3L2U A;  3LMM A;  1W5C C;  3W2W A;  1KU7 A;  5AIP A;  2CUE A;  2MC4 A;  3QYF A;  1F9N A;  1USS A;  2J5P A;  2R3S A;  2DLL A;  3TQN A;  2CFX A;  2EA2 A;  2CV1 A;  3BR0 A;  3G3Z A;  2BGC A;  4Y52 J;  1DP7 P;  2E60 A;  3IHU A;  3MEX A;  2NYX A;  4BJT A;  2KRF A;  3HBL A;  3NWS A;  3L00 A;  2LNB A;  1IN5 A;  3JRF A;  3HZJ A;  1S3J A;  2CUF A;  1Z9C A;  1HQC A;  1IAW A;  1EV7 A;  2R7S A;  1D0X A;  1U8R A;  2KL4 A;  2K86 A;  1TNT A;  4JOM A;  3PO3 J;  1BIB A;  1YS6 A;  3EDP A;  1Z6R A;  4ZC3 A;  2Q2E B;  1MND A;  3T8T A;  3ASN H;  5GAH J;  1R4N B;  3U1D A;  4AYB A;  1RR7 A;  2OQG A;  2ECC A;  1BW6 A;  1W5S A;  2LRE A;  2GOX B;  2ICW G;  5EGO A;  1F1Z A;  5FB2 A;  5JVT A;  2ISY A;  4D1Q A;  2VBZ A;  4QWQ A;  5TGT A;  3BTC A;  4ASN A;  1QVT A;  1V4R A;  3EYY A;  3GZN B;  3J7Z I;  1LE8 A;  3AG3 H;  1HKQ A;  1XX5 A;  1T8I A;  1D5Y A;  3F22 A;  2HTJ A;  2VKH A;  4D7N A;  4I99 C;  1XMA A;  2JMW A;  3DU6 A;  2EIJ H;  4F7Z A;  4O3M A;  1MD0 A;  2A5W A;  3OIP A;  3F8M A;  1B9N A;  5B1A H;  2OZ6 A;  3H0D A;  2KRC A;  3I0T A;  3OOU A;  3PFI A;  3OS1 A;  1Q1H A;  2PFB A;  2H1L A;  4HX7 A;  5CVU A;  1ZYR F;  4HF2 A;  2MGQ A;  4F52 A;  2KT0 A;  2Z16 A;  1XCB A;  3F8C A;  4FX0 A;  5A2Q K;  2L2O A;  2M2E A;  2ZKZ A;  4WXH A;  4A0Z A;  4MIM A;  4B43 A;  4OIR F;  1MGT A;  2QBY A;  5F04 A;  3LAJ A;  4AD9 A;  1V5E A;  2PMZ A;  3WHB A;  3EPZ A;  1ITY A;  2DN0 A;  3S3M A;  1FEX A;  3DWL E;  4M6V A;  4P96 A;  4BAC A;  3I64 A;  1LDK B;  4KUM A;  1B8I B;  4NQW B;  5EJC A;  3U2R A;  1UG2 A;  1FWZ A;  3H9G A;  2FF4 A;  4HF1 A;  4XQF A;  3C2H A;  1K4T A;  4L18 B;  3FZV A;  3FBN B;  4HV6 A;  2STW A;  1TQI A;  3K4B A;  3QQA A;  3QU3 A;  3F21 A;  3OSF A;  3P7N A;  1S7A A;  3CCJ I;  3DKY A;  2OF7 A;  4E6K G;  2M4G A;  2F48 A;  2AO9 A;  1Z77 A;  2KIQ A;  4J00 A;  4A69 C;  1U6G A;  4HYE A;  5CPR B;  1VFC A;  1KA8 A;  1MMS A;  2Y75 A;  5H2F C;  3ABK H;  1J09 A;  4XKC A;  2E2J J;  2E7W A;  2XC7 A;  3DBR B;  2ZFU A;  2EFN A;  4A0Y A;  2E19 A;  4LK1 F;  2NVQ J;  1T33 A;  1EA3 A;  3MWM A;  4ENJ A;  1U8B A;  3F72 A;  1BC8 C;  4G94 A;  2CV0 A;  3AG1 H;  3ZMU A;  2L02 A;  3OYH A;  2Y9Z A;  3A03 A;  1I1G A;  2QGU A;  4P55 A;  2E7X A;  4BE1 A;  4I09 A;  2L01 A;  4HA8 A;  5BPD A;  1VQK I;  3I4M J;  1LDD A;  2EIL H;  1ACI A;  4OAZ A;  1TBX A;  5LEK A;  2O3F A;  1X1B A;  4B3X A;  2E1O A;  4QLC U;  4RAZ A;  3GF2 A;  5KAF C;  1VF9 A;  1K78 B;  4BXX J;  2FUG 2;  4GDF A;  3ERM A;  4B3A A;  2OA4 A;  1SD6 A;  4V19 K;  3E5U A;  1HC8 A;  3HSR A;  3CCQ I;  1UEL B;  1YIO A;  1IXS B;  3ZOB A;  2HDC A;  1TWF J;  2EV0 A;  3R0J A;  1Y8Q B;  1H88 C;  5C4X J;  4NC8 A;  2IA2 A;  4YG2 F;  2JRT A;  3R0A A;  1STZ A;  1ZEL A;  3HPG A;  2DMP A;  1H9T A;  1FIP A;  5F6F A;  4I76 A;  1GVJ A;  3FBI B;  2GWR A;  2ZXJ A;  4AIH A;  5K5R A;  5D8K B;  1YHQ I;  2W25 A;  2GXA A;  3EYI A;  4U7D A;  4CA0 A;  2VBY A;  2L9N A;  2WB1 N;  2W00 A;  2OBP A;  4BAY A;  1SVM A;  3CCR I;  4A0X A;  3FM3 A;  4ZJZ A;  3JRD A;  4C30 A;  2V6E A;  1BN5 A;  2VQC A;  3MKL A;  1V5F A;  1K61 A;  2WY8 Q;  4C2T A;  3S1Q J;  3ZQL A;  4DYR A;  2R7V A;  3BR2 A;  5K7H A;  1ZK8 A;  1BL0 A;  4G7O F;  1RPW A;  3GFL A;  1BIA A;  1FBU A;  3RKY A;  3GTM J;  4OAY A;  1FYM A;  4CCO A;  1I5Z A;  3OYM A;  3WTY C;  3JRE A;  3GTL J;  4XLN F;  4LG3 A;  3N05 A;  4V2G A;  1FJL A;  1OLT A;  2P6S A;  3RYP A;  2UXX A;  3DPT A;  1JUS A;  3OR2 C;  3HOW J;  3CO6 C;  4B48 A;  3QAH A;  3IWF A;  2CMP A;  1G3T A;  4RB0 A;  4F91 B;  1I50 J;  1Y8R B;  3BG9 A;  3JRC A;  1XSD A;  2CSO A;  1T6S A;  2MAB A;  1K83 J;  4MNU A;  2DXI A;  3HUG A;  3V7S A;  3HRT A;  3H9J A;  4IHV A;  1HXD A;  2YU3 A;  2XGE A;  2XAG A;  3HTU A;  2HR3 A;  2LBF A;  3CMM A;  2CQN A;  1Z7U A;  3KLN A;  4C3H J;  3I4P A;  4BNC A;  2OU2 A;  5HLI A;  5ILS A;  1LUJ B;  3FK7 A;  2P81 A;  2K85 A;  2QLZ A;  2XAS A;  4BBS J;  5EGO B;  2F5D A;  2DAO A;  4R1H A;  4AWX B;  4NC7 A;  2KIF A;  2K3P A;  1PP7 U;  3QP6 A;  3ZMD A;  3S1M J;  1FMV A;  1E2X A;  1SD4 A;  2VKD A;  2OTL I;  2ZME C;  2EA4 A;  3FDY A;  4M3E A;  3REO A;  4BU2 A;  1GLN A;  2X1C A;  2AXT C;  4MQ9 F;  3ZMV A;  1O7F A;  2YPR A;  2X48 A;  1H8A C;  1IN6 A;  2C6Y A;  2M87 A;  1IN7 A;  1SC7 A;  4WF2 A;  1K79 A;  1Z7L A;  2XDV A;  5EF6 A;  3KX2 A;  1DUX C;  4ON0 A;  5FRO A;  2DA1 A;  1ZN2 A;  2L54 A;  4IOA F;  2WC2 A;  2ZXI A;  3FIW A;  3OS2 A;  4IHX A;  4MGR A;  1W7P D;  3BG7 A;  3H9Q A;  4LB6 B;  1YQA A;  1MJ9 A;  2ACJ A;  4IPA A;  4WCG A;  1FBS A;  3HPH A;  4YEL A;  2DJN A;  4WXC A;  4KMF A;  1MBE A;  1ERD A;  3ZQQ A;  1OCC H;  4DJA A;  2Z3Y A;  5F0H A;  2R5Y B;  2YUS A;  3DKX A;  2HKO A;  4BUP A;  4A5N A;  3WU1 B;  1O3R A;  5IP7 J;  4LOC A;  2WWY A;  1MMN A;  3KEY A;  3ZQI A;  4DW6 A;  3U21 A;  3OYL A;  4ESJ A;  1OCZ H;  1JJ8 C;  1FZP B;  1HDD C;  1VQN I;  3X2Q H;  1E3H A;  2ME0 A;  3WTZ A;  5HS8 A;  2M8G X;  3ZQF A;  3H3U A;  3COA C;  5E79 C;  2D1V A;  4IL6 C;  3H5N A;  1XGM A;  3MAJ A;  2KIU A;  1UHW A;  4ZDL A;  4HF0 A;  3K4K A;  5EZG A;  1X1D A;  4GYI A;  2LH9 A;  4K2E A;  3AL0 C;  1NK3 P;  4LIU A;  4YFN F;  3MKY B;  3GXO A;  3OR1 C;  4A3G J;  2G7H A;  4EVI A;  3CC2 I;  2NRA C;  1DGR M;  3FKI J;  4I2O A;  3RQ4 A;  2E1M C;  2H8W A;  1OFC X;  2IA1 A;  2HS5 A;  2JA6 J;  4A3D J;  2V1X A;  2VC1 A;  5FLM J;  3S2W A;  5LRR A;  1L3L A;  1K6O A;  2HOT A;  2NXN B;  1XSV A;  5M5Y J;  3B6A A;  4EJU A;  3Q3S A;  5E1Z B;  1S9H A;  4F3Q A;  4PFO A;  1KGS A;  1O57 A;  4YFK F;  3HOX J;  5JHF A;  1A6Q A;  2EFQ A;  2EZH A;  1DU6 A;  3TO9 A;  2A68 F;  2JN6 A;  2H6C A;  3OIQ A;  3K2A A;  4NC6 A;  5IT3 A;  1JE8 A;  2GIZ A;  3CES A;  3HRS A;  3IV5 A;  4L0Z B;  3ZQG A;  3HHH A;  3BR6 A;  3EUK L;  1E0E A;  3KP2 A;  2P8T A;  4HQE A;  4UHT A;  1B72 B;  4EAT A;  2COB A;  3FIS A;  1FLI A;  2XPW A;  2O03 A;  2RNJ A;  4Q4Z F;  4IZZ A;  3L2C A;  2JA5 J;  2E35 A;  4BHP A;  5EEA A;  2KZV A;  2HKX A;  2Z5U A;  3FXL A;  1ETO A;  5BOX A;  2VAS A;  1FOK A;  5LRS A;  4KDP A;  2JJ7 A;  2PI0 A;  2ZNY A;  3HTS B;  5ICF A;  4E7S A;  4HBL A;  4YIR X;  1UZC A;  2Z2S B;  2XAJ A;  4G6D A;  3SEZ A;  1HBX G;  2R7Z J;  3FMS A;  2LP0 A;  1R6R A;  2MYS A;  2RAE A;  5HDG A;  3IRR A;  2Z9O A;  1IDY A;  5KHD A;  2V1D A;  3O2P E;  3S1R J;  1Y39 A;  4HRI A;  3HKZ A;  3K2Z A;  3IAM 2;  3VYR B;  2ZSH B;  3I59 A;  4C9Y A;  1B9M A;  2HOS A;  3BR3 A;  4M9X A;  2XF6 A;  1EH7 A;  2XUB A;  2M3A A;  3A01 A;  1EF4 A;  2OD5 A;  1IRZ A;  2MC3 A;  3S3O A;  4KN7 X;  1YJN I;  2Y48 A;  3OYC A;  3GLL A;  4FT8 A;  1G8X A;  3BPX A;  3HSE A;  5H6Q A;  3IH4 A;  1D5V A;  2DA4 A;  3P9C A;  1OYW A;  4L9T A;  5F0F A;  5DV5 A;  3IUO A;  3RCO A;  4RB2 C;  3GX4 X;  2IRF G;  2RKH A;  1I3A A;  3KP6 A;  3BP8 A;  5D5W B;  1LQ1 A;  2VOP A;  2EFP A;  1NK2 P;  2DI3 A;  4XM3 A;  2LSO A;  5K5O A;  4B09 A;  1G6N A;  1QGP A;  3VYT B;  3BRO A;  5FLX Z;  3TDZ C;  4U7B A;  2E5Z A;  4DYC A;  1AKH B;  4M71 A;  2IGM A;  3ROU A;  3RQI A;  3GTK J;  3HB9 A;  2TDX A;  3RKW A;  4UB8 C;  4A2U A;  2XAQ A;  2JQ7 A;  1VND A;  3ML6 A;  5FFX A;  5HVQ C;  1XGO A;  2QF7 A;  3SDB A;  2VUM J;  1SMY F;  5E8G A;  3WGH A;  2VXZ A;  1J59 A;  2K02 A;  5ICE A;  3SEQ A;  2H6B A;  1TT5 B;  4KIS A;  3HOV J;  2WAF A;  1R36 A;  2DMU A;  2LBF B;  1F5T A;  3GBG A;  2ID3 A;  2OAZ A;  2DYR H;  2W48 A;  1ZR4 A;  1RIO H;  2P0W A;  3IRQ A;  1LPQ A;  3KET A;  4XN3 A;  3QPL A;  2PJR A;  4I98 B;  2LKX A;  2R7W A;  3G1M A;  2XHK A;  1TC3 C;  5AIQ A;  3PSI A;  2Y31 A;  1RES A;  3VEP A;  1MMG A;  5M3F J;  2ZJQ F;  3TW6 A;  3M8E A;  3UR3 C;  5TIS C;  2PBI A;  2YX4 A;  5FKK A;  4XRM A;  1PUF A;  1MW7 A;  3RZO J;  2Y0M A;  5J1U A;  1YYV A;  4AVP A;  4UUT A;  3F8F A;  4XKV A;  2W1O A;  2GZW A;  4Y33 A;  1FY7 A;  4HNU A;  3LOC A;  2V6C A;  4YII A;  3RYR A;  2HQ5 A;  1YW9 A;  4X0G A;  2O7O A;  1B4A A;  5JLW A;  5BQT A;  4FTH A;  1OQY A;  1P7I A;  3JSO A;  5ICG A;  3L09 A;  3A4C A;  3IP4 B;  1WJ5 A;  3LQQ A;  3Q0V A;  1R22 A;  5H20 A;  1YTY A;  2QQA A;  2ELH A;  3S8P A;  2Z33 A;  3HG9 A;  3RKX A;  4Y13 A;  1PDN C;  4XLF A;  1D1A A;  1MH3 A;  2RQP A;  3F8B A;  4M6X A;  2N8G A;  3WTW C;  2HEO A;  1YRN A;  1I27 A;  4HZF A;  3CF5 F;  2D2W A;  3ZQ7 A;  5DUK A;  2W4S A;  4D5F A;  1ZH5 A;  1DDN A;  2FOK A;  2K9S A;  2DFE A;  4KIT B;  4ESF A;  5C3E J;  3LL7 A;  2ESN A;  3BJ6 A;  3IAS 2;  4DGW B;  1N77 A;  1RUO A;  2STT A;  5CJ9 A;  5F27 A;  2OCE A;  4EJW A;  1JHH A;  1QO0 D;  1WJB A;  2A6T A;  3EUH A;  4AID A;  3G1O A;  2DQL A;  1TWG J;  3ZRG A;  1WH5 A;  3IWZ A;  2VC0 A;  2VBX A;  5IYB J;  2HDD A;  4FHT A;  2XPU A;  4CH7 A;  3JW4 A;  1ZAR A;  5BNG A;  3LFU A;  4CHU A;  2A69 F;  1RR8 C;  1HSJ A;  1X1P A;  2FD5 A;  2VKV A;  1K78 A;  1ZGA A;  3LSJ A;  4E7L A;  5JHU A;  2DA6 A;  4II3 A;  3ONQ A;  3QPS A;  3J81 K;  2H09 A;  1XMK A;  2WAE A;  1XGS A;  2ZC2 A;  4ZTF A;  1MJB A;  3I53 A;  3CMY A;  3PNT A;  1YO5 C;  1SVL A;  4FE7 A;  4XNF A;  2TRT A;  4M3F A;  3BJA A;  1ZTR A;  1MBH A;  2CFO A;  1J75 A;  2DQR A;  3K10 A;  1XN7 A;  4U0W A;  2VE8 A;  2L7K A;  5GAG J;  3S2H J;  1JGG A;  3H92 A;  2HDW A;  1OCP A;  3OYJ A;  4IKF A;  2K9Q A;  2L9S A;  4MO7 A;  1P4A A;  2L9V A;  3HC7 A;  2CGP A;  2GAU A;  1BI0 A;  2JVH A;  2DMT A;  2M0C A;  1A31 A;  1IO2 A;  1N25 A;  1RKW A;  3HM5 A;  2K40 A;  3V8K A;  4LLL A;  1A36 A;  3S15 J;  5D5V B;  1BI2 A;  2UV1 A;  1F43 A;  1VQO I;  2XGX A;  3FWE A;  5J1R A;  1H89 C;  3K4C A;  2X1E A;  5DYM A;  3DFG A;  1AHD P;  4X6A J;  2WAQ N;  4YRV A;  3G71 I;  3E6C C;  3R60 A;  5IP6 A;  3OMY A;  2DW4 A;  1PJR A;  4A3C J;  3BY6 A;  2CRG A;  3CCU I;  1JKO C;  1LEA A;  2YX7 A;  3RPU D;  4M6Y A;  1DU0 A;  3F9K A;  2F5F A;  3I59 B;  3MN2 A;  3C2G A;  4XOT A;  3WGI A;  3CZ6 A;  4JYK A;  2MLG A;  1WCM J;  4N0B A;  2WV1 A;  3A01 B;  1QRY A;  1MSF C;  2F6C A;  3F6V A;  2DOE A;  3OYN A;  2F5E A;  3KZY A;  2A05 A;  4ABZ A;  2ZJP F;  1BA5 A;  2JWT A;  4ENN A;  4XOR A;  1WI9 A;  3O6B B;  2W7N A;  2DK8 A;  3PQJ A;  3HOY J;  1D3Y A;  2LMD A;  5LEJ A;  4HX8 A;  2IGK A;  2E71 A;  4G8X A;  2R5Z B;  3ZN0 A;  1Z3X A;  1IW7 F;  3VSK A;  2OZU A;  4PJ0 C;  2KQR A;  5J8C A;  2Y0S N;  1QU3 A;  1E17 A;  1YOV B;  2IT0 A;  3V4G A;  3LSR A;  4ZZL A;  1VQ8 I;  2ELK A;  4KN4 X;  2ZXH A;  1QHH D;  3BDD A;  4KT6 A;  2F4O B;  5LFA A;  4S0H B;  1A04 A;  1JUM A;  2QQB A;  3DTE A;  1G59 A;  2NOG A;  1BR4 A;  1JI8 A;  5AON A;  3QPH A;  1KU9 A;  2HPI A;  4XKB A;  2LLK A;  2Z99 A;  2LRD A;  2HNH A;  5L3E A;  1BM9 A;  2Y69 H;  5J1Y A;  1TWH J;  1TZL A;  3LAP A;  1HDP A;  3CP8 A;  4UVB A;  1TT0 A;  2ELJ A;  3ABM H;  3ABT A;  3T0Y A;  2B63 J;  3RIR A;  2PJR B;  3OYF A;  5LGN A;  4MEX F;  1DPU A;  4JBA A;  2EB7 A;  1KQ8 A;  3M1E A;  5L3D A;  1SAN A;  4X1E A;  5HOD A;  2E5N A;  4IF4 A;  3ZPL A;  2HVQ A;  1TQP A;  2EV6 A;  5HNH A;  3PIP F;  2DA2 A;  3SFI A;  2R5Y A;  2EH3 A;  1U5T C;  3QU6 A;  4RMN A;  1PUF B;  2HYJ A;  1ETY A;  3WU0 A;  2E2H J;  2PLY A;  3Q9S A;  5M5X J;  2K3F A;  5IYC J;  3J7A Y;  2CW0 F;  3G4S I;  4F55 A;  4AUX A;  4IHY A;  1I3Q J;  2R7T A;  3D1N I;  3KP5 A;  1GDT A;  5FKL A;  2DDA A;  3VSL A;  1GHC A;  1QHG A;  1GV5 A;  2FX0 A;  3S1N J;  3BCA A;  3LSI A;  4DIQ A;  3LSH A;  4IRH A;  3WU2 C;  3OSG A;  3K70 C;  4OIP F;  1T0F C;  2P6T A;  2FBI A;  3E97 A;  1TL8 A;  1O3S A;  4LK0 F;  3PO2 J;  1OCR H;  2BHZ A;  3FHZ A;  1YRN B;  2HQN A;  3SXY A;  2AQF A;  3H5R A;  3MKZ A;  2KHM A;  4RAY A;  1IN8 A;  2RRE A;  5J6X A;  3Q9V A;  4N9H A;  4RM3 A;  1ODD A;  4EQQ A;  2R7Q A;  5K1Y A;  2NVX J;  3KFW X;  1VQ7 I;  4NHJ A;  1WJE A;  4ENK A;  3I4N J;  4KFC A;  2DDB A;  2MW8 A;  2CQ7 A;  3OYK A;  4UUS A;  2DPU A;  4BE2 A;  1FT9 A;  2WV0 A;  3KEO A;  4XRS A;  3KE2 A;  3CME I;  5DEQ A;  1JT0 A;  4GXO A;  1YIT I;  5IT9 Z;  2RNG A;  2FEZ A;  3CF2 A;  1ORK A;  1B72 A;  3PUB A;  4HV5 A;  3H0G J;  1P6R A;  3FX3 A;  1NTC A;  4XRF A;  3WTS C;  4FX4 A;  1BI1 A;  1T56 A;  3TO6 A;  4ZZD A;  3KLO A;  3W6K B;  5DCM A;  2MD0 A;  4G6T B;  4CSW A;  4OIN F;  1FYL A;  2DFF A;  2K7L A;  4AVZ A;  1JKQ C;  4S04 A;  2WBM A;  3GTP J;  3PQK A;  5FFZ A;  2LF7 A;  1QPI A;  1Y0U A;  3PUF A;  5IYD J;  1WGX A;  3BR1 A;  2OCC H;  5D5U B;  2ETH A;  3PNY A;  3CMA I;  2BY0 A;  3QOP A;  1VQ4 I;  1U0J A;  4MLO A;  3ZR8 X;  3GME A;  5FJ8 J;  3GLX A;  4PGG A;  3CDH A;  4HDU A;  2JPB A;  3KYC B;  1GV2 A;  2Y2Z A;  3D5R C;  2GA1 A;  4C2M J;  5LHH A;  3T1B A;  4IX7 A;  1X4P A;  3N4M A;  2VQH A;  3MKW B;  2IS6 A;  2FA5 A;  3G6E I;  3CDL A;  1TW3 A;  1RET A;  2DOF A;  2XF7 A;  2IPQ X;  3BQZ A;  2EJR A;  4UY8 I;  2IS2 A;  3QYE A;  5DUI A;  1U9N A;  3VWB A;  3MVP A;  2VXD A;  1Y1W J;  3C3W A;  4JX6 A;  1E3O C;  1MDM B;  3CC7 I;  2V9V A;  3WTT C;  3K69 A;  2GA2 A;  1Z1D A;  5DD8 A;  4C3I J;  5IPA A;  3RKQ A;  4IQJ A;  1H9G A;  3HOT A;  4UVA A;  1MMD A;  1A35 A;  1J2X A;  3BG5 A;  1W1W E;  2K9M A;  1P4W A;  1RZ4 A;  1JKP C;  3K1P A;  3LSG A;  4LFU A;  1W7P A;  2HOE A;  2QUF A;  5IT9 K;  2LDU A;  2VN2 A;  3RPQ A;  3WOD F;  1U2W A;  1AKH A;  3BQY A;  1R5G A;  3DTK A;  1WHU A;  2PJP A;  1WJC A;  5CQG A;  5L3F A;  5IP9 J;  2R7X A;  4KMU X;  1UMQ A;  1XB4 A;  4MQV A;  4EJV A;  5E20 A;  1B59 A;  3S17 J;  3HIF A;  5GAD J;  1SD7 A;  3QP5 A;  4IJA A;  2MH2 A;  3I5U A;  1ZR2 A;  1UAA A;  1MBK A;  3K4J A;  1FYK A;  4LIT A;  3CJQ B;  2EBI A;  4FIS A;  1TLH B;  4W97 A;  2M8E A;  1QA6 A;  2VQL A;  3G73 A;  5FD5 A;  3D5S C;  1DP3 A;  1PVE A;  1IRX A;  2VKE A;  2E1C A;  2KZG A;  1HST A;  3GEZ A;  3FXO A;  1GVD A;  1M1E B;  3EUA A;  4G12 A;  2K9N A;  2LOO A;  4HDV A;  1ZRD A;  3A2K A;  3OS0 A;  5J40 A;  3VYU B;  1OR7 A;  3OL4 A;  2MFZ A;  1ETK A;  4G9Y A;  1EJ9 A;  2LVS A;  4A6D A;  2PG4 A;  4WXD A;  1ZG1 A;  1JHF A;  4UVC A;  3TBI A;  2Y9Y A;  1YLF A;  2TCT A;  2O9L A;  4IQ4 A;  2KDZ A;  1ONV A;  2DJI A;  1ZKG A;  3HGG A;  4YEJ A;  2IS1 A;  3FXQ A;  1IC8 A;  2PMU A;  3TP0 A;  1JTY A;  2X51 A;  1CGP A;  2VPR A;  2PEX A;  1Y0N A;  2KKO A;  5CQE A;  2K5C A;  2EFO A;  4Y17 A;  2LR8 A;  2E2I J;  1E3P A;  2CQK A;  2IGN A;  2M0M A;  3BPV A;  4RGX A;  4E70 A;  3FXJ A;  3L2W A;  4IXA A;  3DLL F;  1BI3 A;  5DD4 A;  2L7Z A;  3QOD A;  4BL0 B;  2OTJ I;  3OYA A;  1TWA J;  2DOA A;  4BDY A;  4MFD A;  2V1N A;  4HNT A;  3LWF A;  4ZYD A;  1BW5 A;  3CCL I;  2LG4 A;  5ILU A;  1X2N A;  3CC4 I;  1D0Z A;  2JT1 A;  4L9N A;  4B47 A;  3K7A J;  1ZGJ A;  1MKM A;  2VL8 A;  2WAD A;  4O6J A;  4XKW A;  3BTJ A;  3ZMS A;  4EGY A;  2XB0 X;  1IXR C;  1XC5 A;  1Z0X A;  2FML A;  5FO5 A;  4BXF A;  5F1J A;  1Z21 A;  1JXS A;  5GPA A;  5HNF A;  4I02 A;  4BBR J;  1RRJ A;  3MCZ A;  3U9G A;  3GFJ A;  4E7H A;  2BHY A;  4OWR B;  1YE9 A;  5KNL A;  2E36 A;  1FOW A;  2IA0 A;  1QPM A;  4V2F A;  1F4K A;  5HS9 A;  4FQG A;  1FP1 D;  2CO5 A;  2K9L A;  5FRM A;  5E3O A;  4E7I A;  2AXL A;  4WWC A;  1FTZ A;  4EMS A;  2K4J A;  2FXA A;  1YFH A;  4E4H A;  4UUS B;  1Y1V J;  1VTN C;  4EM1 A;  1XSX A;  2R93 J;  2JA2 A;  3I55 I;  3CUQ B;  1TW2 A;  2JK3 A;  2QKL B;  5L3C A;  1S7O A;  3P9I A;  2CS3 A;  5E1W A;  1G2H A;  1D1B A;  1U78 A;  3ECO A;  1LB2 A;  3GVA A;  1WH7 A;  3I56 I;  3CCS I;  3DEW A;  1IUY A;  1W4M A;  2DTR A;  2I5U A;  4IHT A;  4CCL A;  3TGN A;  1ZQ3 P;  5E1X A;  5DCM B;  3I9V 2;  2V9P A;  1R5I D;  4ZYH A;  3WTV C;  3SYT A;  2XRL A;  1HKT A;  2WB1 A;  2GQQ A;  1IV8 A;  3R4K A;  3WTX C;  4GO1 A;  4BQA A;  1X19 A;  4PJM A;  3HRM A;  3NEU A;  1JJ6 C;  2VQG A;  1T08 B;  2O5R A;  3H35 A;  3DP7 A;  4L5J A;  1A5J A;  1B1B A;  4P9U A;  3BLY A;  3L2V A;  2NNN A;  3OYB A;  2VON A;  2KP6 A;  1MBG A;  1ZAO A;  4MTD A;  3G1L A;  5CLS A;  4II2 A;  1X4O A;  3E3V A;  3H36 A;  3KYD B;  4RLQ A;  5FD6 A;  2HYF A;  3B02 A;  1T95 A;  5FGM A;  3GZ6 A;  3BG6 A;  1U3E M;  1EH8 A;  2KIS A;  1XD7 A;  3DU5 A;  3QWL A;  4L5I A;  1WFX A;  3ULQ B;  2X4H A;  3GW2 A;  4HSR A;  4EM0 B;  4XR6 A;  2A07 F;  2ZME A;  3FKJ A;  2DU9 A;  3V7C A;  1ENH A;  2IGO A;  3EUH C;  1PUE E;  5K7Z A;  3PSF A;  3UNG C;  5K7F A;  2XKO A;  3CCY A;  2BW3 A;  4XIC A;  2VBW A;  4IEJ A;  2DO7 A;  2FNP A;  2R5Z A;  1TP4 A;  1IGN A;  1IRG A;  2JZY A;  1RI7 A;  2BE5 F;  1OMI A;  4IHS A;  3LST A;  2DA7 A;  3PL8 A;  2XGD A;  4DBR A;  4G7Z F;  3K4M A;  3WE2 A;  3M9A A;  2IXS A;  3L9F A;  2KRH A;  4HEA 2;  1W7P B;  1YJ9 I;  4RDU A;  1XPX A;  1D8K A;  2CQQ A;  3G2B A;  4FE4 A;  1POG A;  3Q5F A;  1ZGW A;  4LG0 B;  2L4M A;  2E1N A;  1W0U A;  2BXY A;  1J7K A;  2VB6 A;  2K27 A;  4TV7 A;  2XRO A;  3RSN A;  2DBB A;  3AAF A;  2NS0 A;  2YU9 J;  3GTG J;  2A5Y B;  3ZP5 A;  3K4L A;  3DPU A;  1VQ5 I;  2DYS H;  4B8X A;  1MZB A;  1XG1 A;  1JT6 A;  3JRA A;  3GTQ J;  3ZGK A;  2DT6 A;  4BHC A;  1IG7 A;  4U0V A;  4H4K C;  2IBD A;  2ZBK A;  3DXJ F;  5L3G A;  1I6H J;  3IH2 A;  4Z6Y A;  4S05 A;  4J19 A;  4R8H A;  2R4G A;  4A3F J;  2G0E A;  2H27 A;  3F8N A;  1G4D A;  1FOY A;  2CW7 A;  5GAE J;  2X6O A;  2BBY A;  4QTR A;  4PJL A;  3TMO A;  2NS7 A;  4AYB N;  4B4C A;  2DT7 B;  4M3B A;  1ETQ A;  2K4B A;  1VI0 A;  3E5Q A;  2GXG A;  2VI6 A;  2WA0 A;  1K7A A;  2YR2 A;  1BOB A;  1TTY A;  2DPD A;  3ZMT A;  5FLV A;  5K5Q A;  2CG4 A;  2XSD C;  4UB6 C;  4CYC A;  3CJR B;  2DTZ A;  1S72 I;  4UV9 A;  4NNJ A;  1TQM A;  2XIG A;  4RM2 A;  3TKY A;  1ZLK A;  2M34 A;  1D1C A;  2RDP A;  2H1K A;  4M72 A;  2E34 A;  1NG7 A;  3CTA A;  5FLX K;  1O4X A;  2IVM A;  1WZ2 A;  4C3J J;  5LBQ A;  1D0Y A;  4Q5S F;  3CD6 I;  2GXB A;  2V9K A;  3DEU A;  5E8I A;  4A5M A;  5D6E A;  1SFE A;  3EQL F;  3LA7 A;  3GWZ A;  4EJO A;  1HCR A;  2CU7 A;  4KA4 A;  1Z6T A;  4D5C A;  2EQR A;  1ETX A;  4D7M A;  4ETS A;  3K4N A;  4PJJ A;  1FSH A;  5CYV A;  4BQQ A;  1F36 A;  4B44 A;  1RKT A;  2Q0O A;  2GOM A;  2PMZ N;  4RS8 A;  1IJW C;  3B6C A;  3H3Z A;  1UHS A;  3K6G A;  5C4J J;  3BC8 A;  1MNM C;  3GCM A;  2LD5 A;  2V4J C;  1J0R A;  3GFM A;  3RPU A;  3T5X A;  4Y15 A;  1PYV A;  2XRN A;  3ZQC A;  5HS7 A;  1XGN A;  4BYY A;  4LD5 A;  1VQP I;  2QCO A;  1Q1V A;  1UCR A;  1ZG3 A;  3CQZ J;  4DBQ A;  1JGS A;  4L0Y B;  4LGW A;  2EZK A;  4Y4R A;  5EEG A;  2QYO A;  2QQ8 A;  2QEX I;  1MBJ A;  3MZ8 A;  1LEB A;  1I1S A;  3A1Y A;  1LJ9 A;  2GIV A;  3S93 A;  4CCN A;  2JA8 J;  2FE3 A;  2LFB A;  2ZJ2 A;  5CVV A;  2DOD A;  3WGG A;  1BJA A;  2R92 J;  4CZZ A;  3OL3 A;  1J9I A;  5J47 A;  4UV8 A;  1ZHF A;  1HW5 A;  2ZCW A;  3P9K A;  1FC3 A;  2I10 A;  4PFP A;  3FF5 A;  3KYL A;  2BXZ A;  2P4W A;  1YJW I;  3ERE D;  1REP C;  2PX9 A;  1W0T A;  3FXM A;  3ABL H;  1AU7 A;  1JTX A;  1LVK A;  3OYE A;  2UUZ A;  3W2V A;  1FMW A;  3S16 J;  4ESB A;  3CCV I;  3VB2 A;  1MDM A;  4YIF A;  4O5V A;  3DBH B;  3O3K A;  4CXF A;  4A3J J;  1OCT C;  4BJ5 C;  3JRB A;  3C18 A;  4RBO A;  3K0L A;  3T8R A;  3MQ0 A;  1W36 C;  2DT5 A;  3PM1 A;  2KJC A;  4IOC F;  3C7J A;  2HZT A;  3OYI A;  3W6J B;  3J7Y J;  4LLN A;  1QZY A;  3BTL A;  2ZME B;  1SEU A;  1LVA A;  1Y6I A;  4P5O A;  2WTE A;  4PZJ A;  5D6F A;  4UNO A;  4A12 A;  2M9H A;  3SJM A;  3OY9 A;  1WJF A;  2HXO A;  4IVN A;  4M73 A;  3RTR A;  1S29 A;  3E5X A;  2VJJ A;  2BW3 B;  4LMY A;  2EPF A;  5A2Q Z;  1S7E A;  2BV6 A;  3TOB A;  1KQ0 A;  4AIK A;  4IHW A;  3OWT A;  3PIO F;  4KIC A;  5ERI A;  4ZH4 F;  3HEF A;  3JTG A;  4XBF A;  2X9D A;  3CCM I;  4JX4 A;  2JUC A;  4A3E J;  5BPI A;  1KQ9 A;  5LLQ A;  5J4Y A;  3DF8 A;  3BCB A;  1WPK A;  2EZI A;  2VOO A;  2A3S A;  2L7F P;  4PGH A;  4QPQ A;  5DCF A;  4GGG A;  2IS4 A;  1C0W A;  3SFZ A;  2ISZ A;  1B6A A;  3ELK A;  2Q1Z B;  1Y56 A;  3A0B C;  3ISP A;  4XN0 A;  3UKG A;  4MTE A;  5GTH C;  2XKP A;  3DTI A;  5FKO A;  3TOA A;  2R0Q C;  2X6X A;  5B5E C;  2W84 A;  5KAI C;  2QEN A;  5LGT A;  2VT3 A;  4QPO A;  3AL0 B;  2XVC A;  3LSM A;  4I0B A;  5E18 F;  3BZK A;  2HPM A;  1I39 A;  1FIA A;  2LTP A;  2MLK A;  2GM4 A;  3LFK A;  4F92 B;  3ASO H;  3FXR A;  2R7D A;  4XLH A;  2PQ8 A;  2L5Q A;  3OYD A;  1R00 A;  1OPC A;  2EZL A;  2KDO A;  2E1M B;  2KJB A;  3WG7 H;  2FMY A;  4GCV A;  4BH9 A;  3M8J A;  4N4N B;  1JKR C;  3AG2 H;  2ME6 A;  4FCY A;  2ZSI B;  1WRJ A;  3DBL B;  3V7R A;  2BYV E;  1XDU A;  3I71 A;  3D0S A;  5LD2 C;  3R61 A;  5EG0 B;  2LK2 A;  1WJA A;  3NAU A;  2R7F A;  1QZE A;  4I7H A;  3AFH A;  3L2Q A;  1IDZ A;  4CGZ A;  5HDK A;  2AQE A;  2DFH A;  4EEF G;  4BHB A;  1ULY A;  4EV0 A;  3HOU J;  1UG0 A;  2F4I A;  4RGS A;  3OYG A;  2XAH A;  2IW5 A;  1BR1 A;  5CVR A;  4CYC B;  1XCV A;  3MFK A;  1YX3 A;  4JK1 X;  2XF5 A;  1WJD A;  2M1B A;  3M07 A;  2COM A;  2X6W A;  3LNQ A;  3SZG A;  3S14 J;  2Z1D A;  5F1R A;  2KIM A;  3A02 A;  1SVO A;  2KMU A;  4XSX F;  4I6Z A;  1OCO H;  3RZD J;  1P92 A;  2QVO A;  3VFZ A;  3E6M A;  4KT5 C;  2LC2 A;  1W5T A;  3F0C A;  4FET A;  4HG2 A;  3SQN A;  1HKS A;  3A0H C;  2M30 A;  3SDG A;  1CF7 A;  1T38 A;  2L4A A;  2ID6 A;  4EGZ A;  3HRU A;  1O7L A;  3S2D J;  3S3N A;  1RNL A;  2BY1 A;  3J80 Z;  3CUQ A;  2I8D A;  1L0O C;  3CDI A;  4WK8 F;  1IF1 A;  3NQO A;  1OR7 C;  4I01 A;  1IZ1 A;  4ZTJ A;  2ECB A;  2FBH A;  2R7O A;  2KLO A;  4HOB A;  4A93 J;  2CW8 A;  4HLX A;  1GXP A;  1BR2 A;  1SMT A;  4XLC A;  3L2R A;  1OYI A;  1GXQ A;  3J7A O;  3M4O J;  3E6D A;  2D45 A;  1SFK A;  2F4M B;  4IO9 F;  3HL2 A;  4NUB A;  3E7L A;  2EIM H;  1HW1 A;  3ZCO A;  2KFD A;  4KIF A;  5JVG F;  1ZRE A;  4EJT A;  2LF8 A;  1SD5 A;  1VQM I;  2F5V A;  2M45 A;  3C1D A;  3BWG A;  2H8R A;  2WAQ A;  4CCK A;  1LFP A;  3L1P A;  3MMY B;  3HDD A;  2OUM A;  2HYG D;  3KP3 A;  1R4M B;  4L9J A;  4NDL A;  2QA4 I;  5J8F A;  3GZ5 A;  2NNY A;  2VPL A;  3LSK A;  1GT0 C;  4XRS G;  1JUP A;  1T39 A;  3W3C A;  3RJP A;  5E3M A;  4U88 A;  3DCF A;  1VQ9 I;  1R1U A;  4RGU A;  3RDI A;  4MEY F;  4DYQ A;  2M5W A;  4LLG F;  2R7U A;  5JFR A;  2EK5 A;  4LIV A;  1NH3 A;  2P5K A;  3GTJ J;  2FRH A;  2OC6 A;  2XSJ C;  4OMZ A;  3U1K A;  1V55 H;  5J4V A;  1MIJ A;  1G3W A;  4HW0 A;  3BG3 A;  9ANT A;  2BY3 A;  3KEQ A;  1WQ2 A;  4CZC A;  4OIO F;  1UHM A;  1W36 D;  3FXK A;  3SZP A;  1FNN A;  4RB1 A;  4BEH B;  2EFW A;  3K1M A;  2MSY A;  1ZRF A;  3J80 K;  2Y0S A;  3O8G A;  5KCM A;  3ZXS A;  1X1C A;  3ZQH A;  4U0Y A;  1V3F A;  4PSW A;  5IOY A;  3WTU C;  4H0E A;  4A3L J;  4M74 A;  1UST A;  4CCM A;  4LG0 A;  2HI3 A;  1U5T A;  3CLO A;  4M9S A;  1LNW A;  3JRG A;  1R58 A;  3V8L A;  1QQI A;  5BMZ A;  4A6E A;  2VT2 A;  3HKZ N;  4BJ6 C;  1FSE A;  3QOE A;  2FJ1 A;  2B0L A;  2Q8K A;  1SFX A;  2MH9 A;  4YFX F;  2QWW A;  5C44 J;  3V8J A;  3OV8 A;  3JRH A;  2VJ4 A;  1SAU A;  1WVR A;  3ECH A;  2B9S A;  3M3Y J;  3SZT A;  3CJN A;  1VQ6 I;  1YS7 A;  2ZB9 A;  3TDU C;  2DCE A;  1MNE A;  1OYY A;  3IC7 A;  4RAG A;  1KU2 A;  3LSP A;  2FQ3 A;  2CUJ A;  4BE0 A;  1T0F A;  1Z67 A;  4KJZ A;  3IH3 A;  5F64 A;  4LJZ F;  1SFO J;  2X0L A;  2PN6 A;  1YG2 A;  4D9J A;  4HLY A;  4LB5 A;  2F2E A;  4E7Z A;  1FP2 A;  3P5J A;  1WSU A;  3RI4 A;  1IUF A;  2DA5 A;  4XOP A;  3ZN1 A;  4OOI A;  1IV6 A;  1HA8 A;  2JVG A;  2GLO A;  5CVI A;  3OIO A;  5FKM A;  2HGC A;  1FX7 A;  2A61 A;  2ZJR F;  1V5G A;  5HLT A;  1KYW A;  3Q0W A;  1LFB A;  4PCQ A;  5B1B H;  3WE3 A;  2O8X A;  2VE9 A;  1OIS A;  2LKS A;  4U87 A;  3LA3 A;  1NHA A;  4Z2Y A;  4BKX A;  4NBQ A;  5JLX A;  2JUG A;  5EZH A;  4XLP F;  3D5L A;  3F3X A;  1ZLJ A;  3S32 A;  1S5L C;  4QIW N;  4IRG A;  2CH0 A;  3VOD A;  2BVL A;  2OV7 A;  1LE8 B;  2A6E F;  1XTA A;  1ZG5 A;  2V1U A;  5E3L A;  2O8K A;  1AOY A;  2NAZ A;  2X85 A;  3ABU A;  4PSX A;  2G9W A;  1I6X A;  4ZYE A;  5EYR A;  2JA7 J;  2M4K A;  3E6B A;  5M3M J;  5E3N A;  2LY1 A;  4CCJ A;  1DGW Y;  2O0Y A;  1A6I A;  1KON A;  3DLA A;  2G7U A;  4Y7N J;  5JI6 A;  1YIJ I;  3DV8 A;  5GP9 A;  1U9O A;  4PJN A;  3GTO J;  4XON A;  2R7R A;  1O3T A;  2DFI A;  3JR9 A;  5E17 F;  3CJT B;  3ESW B;  2L9R A;  2ZO4 A;  3H5A A;  3K70 D;  1DQU A;  4UUV A;  2VJ5 A;  3BTI A;  5BS6 A;  3I3L A;  2QBY B;  3JSP A;  2MD5 A;  1IN4 A;  1T2K A;  1BC7 C;  2HVR A;  3O8H A;  1X3Z B;  5D8L B;  5GPC A;  1WKM A;  5LGU A;  2IEK A;  3MZH A;  5ICC A;  4F93 B;  3GYH X;  2P5V A;  1DPR A;  2P5L C;  2JRM A;  4ENM A;  2BEO A;  2NVY J;  4WX9 A;  2DK5 A;  1FBQ A;  4XID A;  1CF7 B;  1D8J A;  3CLQ A;  2XGC A;  5TRD A;  2AHQ A;  4OMY A;  5D4R A;  1R71 A;  2XAU A;  1AWC A;  2QSF X;  3KZZ A;  2RN7 A;  4OIQ F;  6PAX A;  1V54 H;  5F0C A;  4MHG A;  3GFI A;  1SAX A;  2V7F A;  2W57 A;  5D5X B;  1Z05 A;  1P2F A;  1K6Y A;  4KIG A;  1T98 A;  4Q47 A;  3B73 A;  2PMH A;  3KP4 A;  4JQF A;  4OU0 A;  4L5E A;  1TNS A;  3KP7 A;  1P7J A;  2QKM B;  4DNC A;  3CP2 A;  2M7A A;  1YW8 A;  5CKT A;  4M9Z A;  4KYW A;  2NVU B;  4BQO A;  1ON2 A;  3OOP A;  4CO8 A;  5DTD A;  3JTH A;  2UXN A;  3Q0U A;  4EM2 A;  4A3M J;  2W82 A;  1N75 A;  2H94 A;  3JAM Z;  2FNA A;  3W6V A;  3F6O A;  3V42 A;  4KIB A;  1N78 A;  1MH4 A;  1VZ0 A;  1QNT A;  1Z91 A;  2NS8 A;  5J3L A;  2D5V A;  4ZDO A;  4AM3 A;  1GUU A;  1R5H A;  4NB5 A;  5KK1 A;  2FBK A;  3BZ6 A;  4RA2 A;  1UB9 A;  2UWM A;  3DKW A;  4W1U A;  3QYB A;  4PK4 A;  1RC9 A;  4A3I J;  1HOM A;  3NAR A;  4BQN A;  3FXU A;  4AC0 A;  5LHG A;  5FKN A;  2HTS A;  5HLH A;  2QSG X;  2OJE D;  3IKT A;  3CO7 C;  3FK6 A;  1APL C;  2HQR A;  2W85 A;  2Y30 A;  4CIC A;  4PDK A;  2M7B A;  3LA2 A;  2NVT J;  2JTV A;  1QBJ A;  1XS9 A;  1R9T J;  4GYG A;  1CQT A;  2HWV A;  4GFB A;  2CQX A;  5DM7 F;  1HF0 A;  4Y3O A;  2RGV A;  3WG9 A;  2DMQ A;  5DDG A;  3KZI C;  2P7C B;  5HOO A;  2LY9 A;  2W24 A;  1PP8 F;  2RVC A;  1R1V A;  1ON1 A;  3HYI A;  4N9I A;  3MD2 A;  4G6Q A;  3IL2 A;  1P4X A;  2IP2 A;  1U5T B;  1ETW A;  3HJE A;  2KPM A;  3KPH A;  4ITV A;  2JPC A;  3M7G A;  1TWC J;  1Z3Y A;  2NOJ B;  2WY7 Q;  2L3D A;  4A3K J;  2EIN H;  2Q2E A;  2V26 A;  2OPT A;  5FRN A;  3GUD A;  3I54 A;  1FPQ A;  2CWE A;  1WWX A;  3TED A;  1X3W B;  2BZT A;  2YSR A;  4DZJ A;  4E7J A;  2ZXW H;  3KIO A;  3JAM K;  4L9V A;  4JP0 A;  2IJL A;  3BT9 A;  4P9F A;  1S6L A;  2UZK A;  4HAM A;  5EEH A;  3K1N A;  3PJR A;  2RC4 A;  1LKX A;  1P9Q C;  3DQV C;  4DZP A;  2HOA A;  1BBY A;  5IY5 H;  5LHI A;  1HW2 A;  1R1T A;  2BOL A;  1YX5 A;  2FQ4 A;  2EIK H;  3BR5 A;  1OKR A;  3HUG B;  3F23 A;  3TP3 A;  2ADU A;  4B1R A;  4CDG A;  3W2A A;  2HU9 A;  4ZDP A;  1MJA A;  4R79 A;  2EV5 A;  2BVM A;  4ZYG A;  3FMR A;  4BGD A;  1X1A A;  3HOS A;  1G3Y A;  2DMN A;  1EH6 A;  2RV8 A;  2GBY A;  5B66 C;  2O6G E;  2V79 A;  4N4O B;  5DS9 A;  5EG0 A;  2CUZ A;  1XMX A;  1YW7 A;  2FOW A;  1YI2 I;  1FOX A;  4G7H F;  3E0J B;  2MBF A;  1MBF A;  3SHF A;  4PUS A;  5GTI C;  3J81 Z;  3K9T A;  2ZNZ A;  4HQM A;  2JSC A;  1KYZ A;  2HZD A;  5F08 A;  3MZY A;  4D0P A;  2MG4 A;  1ETV A;  3PNV A;  4P1W A;  4RGR A;  1B8I A; 
#chains in the Genus database with same CATH homology
 5M5Y J;  3B6A A;  3Q3S A;  1FTT A;  1U9N A;  3HOX J;  3UKG A;  3MVP A;  1Y1W J;  2EZH A;  3VPR A;  1DU6 A;  2JN6 A;  4JX6 A;  1E3O C;  2L0K A;  3TW7 A;  3K2A A;  5FKO A;  4C3I J;  5IPA A;  2R0Q C;  3RKQ A;  4BY1 J;  1X2M A;  3IV5 A;  3ZQG A;  3BR6 A;  3BG5 A;  1BJZ A;  1JKP C;  1B72 B;  2COB A;  3FIS A;  3LSG A;  2XPW A;  1LFU P;  2JA5 J;  3HGY A;  1FIA A;  2LTP A;  5EEA A;  2GM4 A;  2HXI A;  1ETO A;  1AKH A;  3BQY A;  1X58 A;  2JJ7 A;  2EZL A;  5IP9 J;  1JKR C;  2ME6 A;  1UMQ A;  4FCY A;  5IOZ A;  4MFE A;  3S17 J;  3WHC A;  2R7Z J;  5EG0 B;  2LK2 A;  2LP0 A;  2RAE A;  3NAU A;  1ZR2 A;  1IDY A;  1MBK A;  2XB5 A;  4M3D A;  1IDZ A;  3S1R J;  4EEF G;  2EBI A;  4FIS A;  3HOZ J;  4W97 A;  3HOU J;  4CYC B;  1WI3 A;  1OJL A;  2L7M P;  2HOS A;  3BR3 A;  3A01 A;  1EF4 A;  2VKE A;  4XK4 A;  1GVD A;  4G12 A;  1IRZ A;  2K9N A;  2YS9 A;  3LNQ A;  3S14 J;  4BY7 J;  3A02 A;  2CJJ A;  4I6Z A;  1ETK A;  2XPV A;  3IH4 A;  3RZD J;  2LVS A;  2DA4 A;  3F0C A;  1QVU A;  5F0F A;  2Y9Y A;  3H3V K;  2TCT A;  2O9L A;  3SDG A;  4A3B J;  2KDZ A;  4JX5 A;  1ZKG A;  2ID6 A;  3HGG A;  3C2B A;  3JRI A;  5EDN A;  1MSE C;  1IC8 A;  5M5W J;  1NK2 P;  3S2D J;  2IAI A;  3TP0 A;  1JTY A;  2DA3 A;  2VPR A;  4M3G A;  1HLV A;  2LR8 A;  4QSH A;  2E2I J;  4DYC A;  1AKH B;  2ECB A;  4A93 J;  3RQI A;  3GTK J;  3HB9 A;  1VND A;  2L7Z A;  1TWA J;  2QF7 A;  4MFD A;  2VUM J;  3M4O J;  4HNV A;  1BW5 A;  3HOV J;  3E7L A;  1X2N A;  2DMU A;  3GBG A;  2ID3 A;  2W48 A;  1ZR4 A;  3K7A J;  2H8R A;  3BTJ A;  3QPL A;  2XB0 X;  2LKX A;  2CUE A;  3HDD A;  1XC5 A;  3L1P A;  3G1M A;  1Z0X A;  4NDL A;  5F1J A;  1TC3 C;  3BR0 A;  5GPA A;  2Y31 A;  4Y52 J;  1RES A;  4BBR J;  5M3F J;  1GT0 C;  4XRS G;  3HBL A;  3TW6 A;  4XRM A;  1JUP A;  5FKK A;  5E3M A;  1PUF A;  3RZO J;  3JRF A;  5J1U A;  4V2F A;  2CUF A;  3DCF A;  4UUT A;  4DYQ A;  5E3O A;  3LOC A;  3PO3 J;  2HQ5 A;  3GTJ J;  1FTZ A;  2O7O A;  5JLW A;  4FTH A;  1P7I A;  3BG3 A;  9ANT A;  4UUS B;  1Y1V J;  3Q0V A;  1RR7 A;  2ECC A;  2R93 J;  1BW6 A;  5EGO A;  2JK3 A;  2MSY A;  1G2H A;  1U78 A;  1MH3 A;  3O8G A;  1WH7 A;  3BTC A;  2N8G A;  3DEW A;  3ZQH A;  1QVT A;  1YRN A;  1ZQ3 P;  1LE8 A;  5IOY A;  4A3L J;  1D5Y A;  2XRL A;  4D7N A;  2HI3 A;  4D5F A;  2K9S A;  2JMW A;  3JRG A;  1JJ6 C;  5C3E J;  3HKZ N;  5F27 A;  1A5J A;  3OOU A;  3G1O A;  1TWG J;  1WH5 A;  2FJ1 A;  5C44 J;  1MBG A;  2HDD A;  5IYB J;  2XPU A;  3JRH A;  2MGQ A;  3G1L A;  2KT0 A;  5BNG A;  3M3Y J;  2ZB9 A;  2M2E A;  4MIM A;  2FD5 A;  5F04 A;  2VKV A;  3LSP A;  3LSJ A;  3WHB A;  1ITY A;  2DN0 A;  3IH3 A;  1FEX A;  2DA6 A;  4M6V A;  1SFO J;  3QPS A;  1B8I B;  1ENH A;  1UG2 A;  3CMY A;  5K7Z A;  1IUF A;  2DA5 A;  1IV6 A;  4FE7 A;  2GLO A;  3OIO A;  5FKM A;  4M3F A;  2TRT A;  5K7F A;  3CCY A;  1ZTR A;  4XIC A;  3QQA A;  1MBH A;  4IEJ A;  3OSF A;  3Q0W A;  2R5Z A;  1LFB A;  1IGN A;  2OF7 A;  2AO9 A;  1Z77 A;  4BKX A;  4A69 C;  5JLX A;  2DA7 A;  3S2H J;  1JGG A;  1VFC A;  1OCP A;  2XGD A;  5EZH A;  2K9Q A;  4QIW N;  4MO7 A;  2E2J J;  4RDU A;  1LE8 B;  2CQQ A;  2E19 A;  2DMT A;  2NVQ J;  4FE4 A;  2M0C A;  1POG A;  1ZGW A;  1T33 A;  5E3L A;  1W0U A;  2O8K A;  1U8B A;  1RKW A;  3HM5 A;  3S15 J;  2K40 A;  1F43 A;  2Y9Z A;  1H89 C;  5EYR A;  5J1R A;  2JA7 J;  5M3M J;  5E3N A;  3A03 A;  1AHD P;  4X6A J;  1A6I A;  2WAQ N;  2YU9 J;  4Y7N J;  3GTG J;  3I4M J;  5IP6 A;  3GTO J;  5GP9 A;  1U9O A;  4A3C J;  3JR9 A;  2CRG A;  2L9R A;  1JKO C;  2E1O A;  3BTI A;  1DU0 A;  1XG1 A;  1JT6 A;  3JRA A;  3GTQ J;  3MN2 A;  1IG7 A;  1VF9 A;  2IBD A;  4BXX J;  1I6H J;  4JYK A;  3O8H A;  1WCM J;  2WV1 A;  3IH2 A;  1QRY A;  3A01 B;  1MSF C;  5GPC A;  4J19 A;  4B3A A;  4A3F J;  2G0E A;  2IEK A;  4ABZ A;  1BA5 A;  2X6O A;  2JWT A;  4QTR A;  2NS7 A;  4AYB N;  2NVY J;  3ZOB A;  4B4C A;  1TWF J;  3HOY J;  4M3B A;  1ETQ A;  4XID A;  1VI0 A;  1H88 C;  5C4X J;  2VI6 A;  2XGC A;  2R5Z B;  2AHQ A;  2DMP A;  2Y0S N;  5FLV A;  1FIP A;  4I76 A;  2XSD C;  5F0C A;  4CYC A;  2DTZ A;  3LSR A;  2ELK A;  2WB1 N;  2M34 A;  4L5E A;  2H1K A;  1P7J A;  4S0H B;  1JUM A;  2NOG A;  1O4X A;  2LLK A;  4C3J J;  3JRD A;  3MKL A;  1K61 A;  5DTD A;  3Q0U A;  5J1Y A;  1TWH J;  3ZQL A;  4DYR A;  3S1Q J;  4A3M J;  1HCR A;  1HDP A;  3BR2 A;  5K7H A;  2CU7 A;  3W6V A;  4D5C A;  1ZK8 A;  2EQR A;  1ETX A;  4D7M A;  1BL0 A;  1RPW A;  2B63 J;  3GTM J;  1MH4 A;  1F36 A;  1IJW C;  1RKT A;  2NS8 A;  2PMZ N;  5J3L A;  3JRE A;  2D5V A;  3GTL J;  3B6C A;  1UHS A;  1GUU A;  4V2G A;  1FJL A;  5C4J J;  1SAN A;  4X1E A;  5HOD A;  1MNM C;  1JUS A;  2LD5 A;  2DA2 A;  3SFI A;  2R5Y A;  4W1U A;  3HOW J;  2EH3 A;  4A3I J;  1HOM A;  1PUF B;  1I50 J;  1ETY A;  2HYJ A;  3BG9 A;  3JRC A;  2E2H J;  5M5X J;  3NAR A;  5IYC J;  3ZQC A;  1K83 J;  4IHV A;  2QCO A;  1Q1V A;  3CQZ J;  4AUX A;  4AC0 A;  4IHY A;  5FKN A;  2XGE A;  1I3Q J;  2EZK A;  3FK6 A;  1APL C;  3D1N I;  1GDT A;  2Y30 A;  4C3H J;  1MBJ A;  5FKL A;  3FK7 A;  2NVT J;  2P81 A;  1GV5 A;  2FX0 A;  2JA8 J;  3S1N J;  5EGO B;  4BBS J;  2LFB A;  1XS9 A;  1R9T J;  1CQT A;  3OSG A;  4GFB A;  2CQX A;  2R92 J;  1HF0 A;  3S1M J;  2DMQ A;  3PO2 J;  4M3E A;  1YRN B;  2LY9 A;  2I10 A;  1H8A C;  2X48 A;  1W0T A;  1AU7 A;  1JTX A;  1ETW A;  5EF6 A;  1TWC J;  4A3K J;  2NVX J;  2DA1 A;  3S16 J;  3I4N J;  2MW8 A;  2OPT A;  3FIW A;  4UUS A;  4IHX A;  4XRS A;  3TED A;  1OCT C;  4A3J J;  3JRB A;  4DZJ A;  1JT0 A;  4RBO A;  2DJN A;  4JP0 A;  3BT9 A;  1MBE A;  1ORK A;  3PM1 A;  1B72 A;  3H0G J;  1NTC A;  5F0H A;  1T56 A;  2YUS A;  2R5Y B;  4DZP A;  2HOA A;  5IP7 J;  4LOC A;  3BTL A;  3ZQI A;  4DW6 A;  2FQ4 A;  3BR5 A;  1JKQ C;  3TP3 A;  4B1R A;  1JJ8 C;  1HDD C;  3GTP J;  2M9H A;  3SJM A;  2ME0 A;  2HXO A;  1QPI A;  2M8G X;  1WGX A;  3BR1 A;  3ZQF A;  5IYD J;  2DMN A;  2GBY A;  5DS9 A;  5EG0 A;  5EZG A;  1S7E A;  1NK3 P;  4MLO A;  5FJ8 J;  1GV2 A;  2Y2Z A;  1MBF A;  4IHW A;  4C2M J;  4A3G J;  3FKI J;  3HEF A;  2X9D A;  4JX4 A;  4A3E J;  3CDL A;  5F08 A;  1OFC X;  1RET A;  2JA6 J;  4A3D J;  1WPK A;  2HOT A;  2EZI A;  1ETV A;  2MG4 A;  5FLM J;  2L7F P;  3BQZ A;  1B8I A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...