1G4DA

Nmr structure of the mu bacteriophage repressor dna-binding domain/dna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title The Mu repressor-DNA complex contains an immobilized 'wing' within the minor groove.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Viral protein/dna
molecule keywords 5'-D(P*CP*CP*TP*TP*TP*TP*CP*AP*GP*TP*AP*AP*TP*CP*TP*G)-3'
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g4dA00
1NHAA 3I53A 4L5IA 2JTVA 4YG2F 3AAFA 2FXAA 4YIFA 4IRIA 1ZH5A 2O03A 1O3QA 5FO5A 4A12A 4KICA 3EETA 5A2QZ 2KJCA 3JSPA 2ADUA 1FSEA 3JTGA 4O3MA 2A6HF 2WWYA 4CGZA 4LLGF 1R00A 3WTZA 2Q0OA 1PP7U 1OMIA 1J2XA 2FA5A 5LRSA 2H27A 4RGXA 2EV6A 4HLYA 4I7HA 4HX4A 2M8EA 1E17A 4IPAA 1MDMB 1OKRA 2DPDA 1FC3A 3BROA 5ED4A 1KQ8A 3LA7A 4OIPF 4P9FA 3T1BA 3R0AA 4FHTA 2VBYA 3BPXA 1XMKA 4OMYA 3HUGA 2M5WA 3VB2A 3K9TA 2YU3A 1KU3A 2QQ9A 3FHZA 2RQPA 2ZBKA 3M7GA 2HOEA 1ON2A 4IRHA 3HRMA 4BXUA 1W7PA 3MZYA 3IC7A 1LQ1A 2W24A 4N9IA 4M6YA 2EB7A 1BC7C 4BHBA 3NRVA 5IT9Z 4R8HA 1Z6RA 2L02A 2NNYA 3P9KA 5FD5A 2VC0A 3BY6A 1U2WA 3FM3A 4MTEA 3RDIA 3V8LA 2YX7A 3R4KA 4RGSA 2D1HA 3Q9SA 2CGPA 4G7ZF 3KCCA 4BYYA 1L3LA 4I02A 2DFIA 3WU1B 3R61A 1XDSA 1IXCA 1F4KA 3CO6C 1DPRA 3SZTA 3RPUA 5DCMA 5HS9A 3BDDA 2GA2A 2XIGA 2KJBA 2BV6A 3LQQA 3FXRA 1W7PB 1KU2A 1LDKB 1ZRFA 1J9IA 4UVCA 4G9YA 3LA3A 3ZP5A 4I2OA 2GZWA 4KMUX 3GZ6A 1K78B 3HHGA 1OPCA 4CHUA 3IKVA 3SZPA 1R1UA 3IRRA 3TO9A 2HTSA 4L18B 3K69A 2V1XA 1Y0UA 1EH6A 4HQMA 4KIFA 1B4AA 4ZYDA 3TQNA 1BN5A 2A07F 1A04A 4JK1X 4M9SA 1ODDA 2FSWA 3MFKA 3RIRA 2ISYA 2NYXA 4IJAA 5EEHA 1CF7A 3E97A 1T39A 2C6YA 5D4RA 1LEAA 1Z7UA 4L9VA 2VN2A 3TKYA 3QP5A 2HTJA 3F3XA 2ZXJA 1IXRC 5FFXA 3M8EA 3RKXA 3E5QA 1FYKA 2FOKA 2RVCA 2PFBA 1KYZA 5FB2A 1B59A 2XROA 2M45A 2W25A 3K1PA 2G7HA 5KK1A 5L3BA 2HEOA 2FU4A 2Q8KA 3CTAA 4U0YA 2VE8A 1LJ9A 3ISPA 1TW2A 3D0SA 5DV5A 3CUQA 2TDXA 4LG0A 4UV8A 1IW7F 1XCBA 4HDUA 1UCRA 4Y17A 3QRFF 3KLOA 2GXGA 4UHTA 4O5VA 5D5UB 3TDZC 2OAZA 4LB5A 5D6FA 4WXCA 1ZYRF 3JTHA 4U0WA 2WC2A 1QGPA 1YS6A 5J6XA 2STTA 4BNCA 2OQRA 2QZ8A 4LMYA 4I0BA 3GFJA 5FLXZ 4JQFA 4CZZA 3V7RA 1PP8F 3WTTC 4ZYHA 4ZZDA 3F8BA 2A61A 1BIBA 4WXHA 3L00A 4YFXF 4KA4A 3RPQA 1ZRDA 2PG4A 3EYYA 2PLYA 5FGMA 2VT2A 3OOPA 3E6CC 5A2QK 5L3CA 3CO7C 2W84A 4HLXA 3WGGA 4S05A 3ZMUA 1MZBA 1STZA 2HDCA 1G3SA 3DFGA 2M87A 1Q1HA 4HF1A 1WKMA 5JFRA 1O3RA 2H6BA 3T8TA 3G3ZA 1XSXA 4E70A 3LQRA 1ZARA 3I4PA 1EV7A 3EYIA 1XN7A 1YS7A 4WX9A 1R22A 3QOPA 4O6JA 2YX4A 4KMFA 4OMZA 1B1BA 4RS8A 2CO5A 1LVAA 1G6NA 2IA2A 2OZ6A 1W4MA 2QENA 1ZG1A 1HKQA 5D4SA 4U7BA 3Q5FA 4HV6A 2L54A 4YFNF 4G94A 4L9NA 2HZTA 4MGRA 4KIBA 4L9TA 1FPQA 1IN8A 3LAJA 2WV0A 3I59B 1DPUA 1S6LA 2EV0A 4CO8A 4FX0A 3K1MA 1R58A 3BZ6A 1Z6TA 4UV9A 2E1NA 4P9UA 3J81K 2KKOA 4KNYA 4HQEA 4PGHA 2YSRA 1SMYF 2OA4A 3KZZA 5ICCA 2B0LA 4G7OF 2JPCA 5DD8A 4BQAA 3LFKA 4OIRF 2NRAC 3CLOA 3WGIA 1XGNA 3H3ZA 1TNSA 2IA0A 2XAFA 2XKOA 2V9VA 2VBZA 2XAGA 3DF8A 2NAZA 1V4RA 1IUYA 2ELHA 1H9GA 5ERIA 2VOOA 3QAHA 2Z5UA 1BBYA 1TQMA 5L3GA 1P2FA 1RNLA 4Y13A 2PI0A 3TOBA 5LGUA 1YO5C 1UHMA 3F6OA 1KQ0A 1RUNA 3GUDA 1W5TA 2RC4A 5CYVA 4IRGA 5HLGA 5H6QA 2IA1A 5D5WB 3FXUA 4EGYA 2EFOA 1U5TA 1HBXG 3V7SA 3O2PE 4BAYA 1F1ZA 3RKWA 3MAJA 5CVJA 4BH9A 1FBSA 3WTWC 1BI2A 1FLIA 2IPQX 2VBWA 3HIFA 5CJ9A 2F5DA 3KP6A 1JHFA 3FXQA 2K4BA 1AOYA 2GA1A 2BEOA 3DV8A 1J0RA 5DUIA 3C1DA 4L5JA 2P5KA 4M74A 5K5QA 2FBHA 5ILVA 5L3EA 2UXXA 2A5YB 1U5TC 4MHGA 3F8MA 2UXNA 1LEBA 3G73A 4ZYGA 4HV5A 2DTRA 1X3UA 5CVRA 5IT9K 2Y48A 5DUKA 1QQIA 5JVTA 3C3WA 1I6XA 2YR2A 4AVPA 1IN4A 3KZYA 4UNOA 1SFXA 2L4AA 4P55A 2DAOA 2D45A 3HTUA 5DYMA 1K7AA 3F8FA 3FWEA 4FX4A 1DP7P 2FRHA 2Y75A 3GO5A 4L0YB 3M9AA 2KIMA 4LLLA 1XDUA 2J5PA 4M6XA 4RB2C 4EQQA 5K1YA 4LD5A 1XD7A 2O8XA 2VXZA 2K4JA 4A0ZA 3WTVC 3KP3A 1ZRCA 2VC1A 1XSDA 2P5VA 2JPBA 3ZN1A 2LNBA 4NQWA 4LGWA 3ZPLA 2IP2A 2P6TA 3T8RA 3I5UA 6PAXA 3TGNA 1FZPB 5F6FA 3ZMDA 1IN7A 4R1HA 2XGXA 1FX7A 5CVVA 2AXLA 3O3KA 4LJZF 2WTEA 4RAYA 1SAXA 2XAJA 1RUOA 2EFPA 4M73A 3BP8A 2X0LA 3GZ5A 1S3JA 2DQLA 5CVIA 2FEZA 4I09A 1WWXA 2V1UA 1REPC 3IRQA 2FQ3A 4A5NA 1QBJA 4M9XA 2HKOA 5HS7A 2QVOA 3REOA 1BI1A 4N9HA 2HYGD 5L3FA 1IZ1A 2ISZA 2Z9OA 1OYWA 3WODF 5FLXK 1UB9A 3JAMZ 5HVQC 4GXOA 2MLGA 4HX7A 4L9JA 4M72A 4HA8A 2IW5A 3ZMTA 3F23A 1QZZA 2RN7A 3WGHA 2W57A 4KN4X 1VTNC 5HOOA 1XSVA 4KUMA 3IL2A 3KEOA 1ZHFA 4HZFA 2K7LA 3N97A 2EJRA 3HTSB 1W5SA 2Y0MA 4RB3C 2G9WA 4P96A 1T0FA 2RNJA 3BWGA 4LLNA 4OINF 3E5XA 1P4XA 1R5GA 2EFQA 4WK8F 4HF2A 4PDKA 1ZAOA 1ZG5A 3K2ZA 4MEXF 1AWCA 3ECOA 2KIUA 5K5OA 2PMUA 4EM1A 2IVMA 5LGTA 3HOTA 4RGRA 5D5VB 1SFUA 2DI3A 1QZYA 1K79A 3RI4A 1LDDA 4PGGA 1O3TA 1I27A 1YW8A 2IT0A 1YTYA 2G7UA 3T5XA 2GAUA 3E5UA 5E8GA 2X4HA 4GGGA 4EM2A 1V3FA 3E6MA 4TV7A 5LEKA 1KYWA 4XLPF 2P8TA 1U8RA 2IJLA 3J80Z 3F72A 3IHUA 2AS5F 2RGVA 2F5CA 2E1CA 1LNWA 1H0MA 2R7DA 4HW0A 2LSOA 3H92A 1R5HA 5FD6A 2P7VB 2F5FA 4IHTA 2Z99A 3ABTA 3BJAA 4RGUA 1B9MA 1RZ4A 4FT8A 3NQOA 1YYVA 1KU9A 2MC3A 2DPUA 3I64A 1O3SA 4EMSA 4EJOA 1D8JA 1QPMA 3GYHX 2EFNA 5CLSA 4QLCU 4OOIA 4B8XA 3F8CA 3O6BB 1MJ9A 2D2WA 3GFMA 2XHKA 2M1BA 2VODA 3F8NA 1XCVA 1RIOH 5TJJA 2HWVA 1ZLKA 1YIOA 2FE3A 3HYIA 4CYDA 3ERED 2F5EA 4PCQA 1HSTA 1S7OA 2A3SA 3WTSC 1IN5A 2ZFWA 4XLNF 2FBKA 2GIVA 2HS5A 3LWFA 3ML6A 2A68F 1LDJA 1KGSA 1Z1DA 4WXDA 3RYRA 4I98B 1OYIA 4A2UA 1USTA 5LHIA 1T98A 5D8LB 3M1EA 1K78A 1YW7A 1C0WA 3RJPA 4KIGA 5D8KB 1O57A 1MJAA 4EJUA 4DQ2A 5DDGA 3RKYA 3B73A 5HDKA 1UHWA 4I01A 1TW3A 2O6GE 1FOKA 2DBBA 3ZMSA 5LLQA 1FBUA 2FMYA 1R36A 3DPTA 3KP4A 1J59A 3P7NA 2HKXA 3NEUA 1Z9CA 3L2CA 4EM0B 4AIKA 2XUBA 5TRDA 2QBYA 2ZMEA 4M71A 1GXQA 1K6OA 1Z91A 1ONVA 3HRSA 2DQRA 4HDVA 1HXDA 2UZKA 1FYMA 3IWZA 1F5TA 4ETSA 2V6CA 4AWXB 3DXJF 2H94A 1FYLA 2DK8A 1TNTA 5E1XA 5D5XB 5E18F 4A5MA 3V7CA 4Q5SF 4RAZA 1RI7A 3MQ0A 2ACJA 2OQGA 2FF4A 2L4MA 4IF4A 5ICGA 1IRFA 3J81Z 1G4DA 2E7WA 3SQNA 4B09A 1XMAA 4IVNA 2H6CA 3P9CA 3ZMVA 4G6DA 1TQPA 1QO0D 2HR3A 3U9GA 4HF0A 1J7KA 2QWWA 1JGSA 3LAPA 1ZGJA 3QPTA 5HDNA 4KFCA 2K02A 4G8XA 3VODA 1JE8A 4A6DA 3GX4X 5D6EA 5ILUA 4Q48A 5HDGA 3M8FA 3JW4A 1D8KA 1YW9A 3KP2A 3TDUC 5E20A 3TOAA 1I1GA 2ZNZA 3KP7A 4KDPA 1YFHA 1WSUA 3CUQC 1S7AA 2QBYB 5LRRA 2K86A 1OR7A 1MGTA 3HRTA 2EFWA 3F22A 3ROUA 2DU9A 1TBXA 3WTUC 3L9FA 2BBYA 2HYFA 4IXAA 4WF2A 1MDMA 1IF1A 3N4MA 2XASA 2MLKA 1MJBA 3TO6A 1FY7A 3COAC 4I0AA 3ZMZA 5HLHA 2VT3A 3P9IA 4HX8A 1ZN2A 1G3TA 2L3DA 1P4WA 2ZMEB 5J8CA 3KP5A 2Z33A 3V4GA 1FNNA 2VOPA 1HSJA 4UVAA 3BPVA 4YFKF 4MNUA 3ECHA 1MKMA 1B6AA 3JSOA 1J5YA 4A0XA 3ULQB 4ESFA 4DNCA 1YG2A 4EJVA 2CSOA 1WRJA 5IT3A 3K1NA 4OU0A 3V8JA 1R23A 1EH7A 1FP2A 2QUFA 4HAMA 3GFIA 2DO7A 1PUEE 3WU0A 5K5RA 4D0PA 4GCVA 1BM9A 2PMHA 2ESNA 5F1RA 2PEXA 2ZO4A 2JT1A 1LB2A 2JZYA 4R79A 4XSXF 2OZUA 4UVBA 1FP1D 3BOQA 5LHHA 1HKTA 5H20A 3SXYA 1CGPA 4XSZF 1JHHA 4Z2YA 4G6QA 3RYPA 4AD9A 3WTXC 4AIJA 3I71A 3E6BA 1FSHA 5AIPA 3Q9VA 1PDNC 4EGZA 4BHPA 3FMQA 2O0YA 3QPHA 4WWCA 2EK5A 3HSFA 3BJ6A 4GO1A 5KVRA 2KRFA 3C18A 1HW5A 1SD5A 1TTYA 2FBIA 2P5LC 1TLHB 5BPDA 3W6JB 1O7LA 3WG9A 1UFMA 2OD5A 1B9NA 4U7DA 3F6VA 1I5ZA 2A69F 5AONA 3PFIA 3DPLC 1S29A 2K27A 2FNAA 4N0BA 2V79A 3EQLF 3HSRA 2RV8A 3KE2A 4RB0A 3GFLA 1U78A 2P4WA 2XRNA 4LG0B 3QU6A 4HBLA 5AIQA 1T38A 3MEXA 1YQAA 2MBFA 5ICFA 5J8FA 3K0LA 3WTYC 3IKTA 3L7WA 2DK5A 1H9TA 3MWMA 4RB1A 3KEQA 5E8IA 1GVJA 5DEQA 5HLIA 4KN7X 2NS0A 2P6SA 4QWQA 1G3YA 2RKHA 4LK0F 1G3WA 3HRUA 5ICEA 2FMLA 3GW2A 3I54A 2O3FA 1WQ2A 2GXBA 4EJTA 2CYYA 1IAWA 1R7JA 2VE9A 1CF7B 1FWZA 1ON1A 5E17F 3GXOA 1D3YA 4G7HF 5H6RA 5DCMB 3DQVC 4S04A 2ETHA 5BMZA 2COMA 4EV0A 3I58A 5DCFA 2PJPA 2JRTA 3R60A 2XKPA 3CDHA 2ZCWA 5BQTA 4PZJA 3FF5A 1R1TA 3LSTA 1DDNA 1DUXC 1ULYA 1E2XA 3SHFA 2J5OA 3ZQ7A 2XVCA 1ZLJA 2ZKZA 5BS6A 1KU7A 5EEGA 4JBAA 1TQIA 3I0TA 3E3VA 1BJAA 3B02A 2YPRA 5L3DA 2HQNA 2F2EA 5FFZA 4MQ9F 4Q47A 3U1DA 4F7ZA 5BPIA 1QNTA 3OV8A 5JR3A 1Z05A 3H3UA 4KYWA 4AIHA 3C7JA 4IHSA 4ZYEA 4HOBA 2EA2A 3J80K 1L0OC 4EVIA 1SFEA 3HSEA 4U88A 4M9ZA 2QQBA 4ESBA 4A6EA 3U2RA 4ENJA 2LKPA 4CXFA 3GWZA 1WI9A 5E1ZB 2IRFG 3GLXA 3WE3A 4H0EA 3FX3A 4XBFA 2PN6A 3PQKA 4LK1F 2CQKA 4Q4ZF 3FZVA 1W7PD 1HKSA 1HW2A 2MD5A 3KFWX 1ZREA 2NNNA 1BIAA 2W85A 1SD4A 1SMTA 2HQRA 1GXPA 5LHGA 3S2WA 2PQ8A 1SD7A 2XAQA 1FT9A 2VBXA 1P92A 2LF8A 2QYOA 3GVAA 2LF7A 4MQVA 4HYEA 3BJOA 1R1VA 2KIFA 1IN6A 1U5TB 3FM5A 1T2KA 2ESHA 3KLNA 1U3EM 1ZGAA 2VONA 2QM3A 4MEYF 1ZG3A 2EA4A 3VOEA 3PQJA 2EV5A 2R3SA 4UXNA 2STWA 1O7FA 3JAMK 1EH8A 4OIOF 1D5VA 3FMSA 1HQCA 3DP7A 2D1VA 2L01A 5DD4A 2CWEA 3R0JA 1USSA 4ESJA 2BE5F 3GF2A 3IWFA 2GWRA 3I59A 2ZJ2A 1BI3A 2HFHA 3EUHA 4ENMA 4CDGA 2FNPA 4GYIA 1KQ9A 4U0VA 3DEUA 4EJWA 1P4AA 2LDUA 2M30A 3MCZA 3VFZA 1HW1A 1U6GA 4L0ZB 1F9NA 3SFZA 1SD6A 1XB4A 4ON0A 5JI6A 1XGSA 1S8NA 4KT5C 1FBQA 2MH2A 3ZN0A 2MA3A 2DT5A 1BOAA 1IXSB 3D5LA 2CW0F 5LEJA 4ENNA 2P7CB 2R7FA 4ZZLA 1XGOA 5JHUA 3LA2A 4NHJA 4CICA 3J7AO 4MTDA 2QLZA 4WCGA 3DKWA 2EWNA 1MD0A 3CUOA 4LB6B 3F21A 1XGMA 1JXSA 3TO7A 2Z3YA 3GEZA 4XRFA 4ENKA 2OBPA 3MZHA 4NB5A 1I1SA 1J75A 2XAHA 2XV4S 3CUQB 2A6EF 5E1WA 3EDPA 2GQQA 4A0YA 2CG4A 2E7XA 3FMRA 2PBIA 3RTRA 2O61A 5BOXA 4GYGA 4UUVA 3ABUA 3T0YA 4BHCA 2V1DA 5CVUA 5LBQA 2BYVE 2Q2EA 5ILSA 4P5OA 5HS8A 4ZH4F 2HGCA 4YIIA 4ASNA 2BGCA 4OIQF 3E6DA 1BI0A 5LGNA 4K2EA 1OYYA 2RDPA 3QP6A 1KA8A 3WE2A 2JSCA 2UWMA 1P6RA 1GHCA 2H09A 1BC8C 2QQAA 3L09A 2OU2A 3R6SA 3ELKA 1T6SA 4LFUA 3W6KB 3V8KA 2CFXA 4Y15A 3KETA 1IRGA 2DLLA 3HOSA 3VEPA 3QU3A 2MH9A 3HHHA 3CJNA 5F64A 1YLFA 2ZNYA 2DW4A
chains in the Genus database with same CATH superfamily
1NHAA 1UHSA 3I53A 4L5IA 2VKVA 2JTVA 4YG2F 3AAFA 4XRMA 2FXAA 4YIFA 4IRIA 3K4LA 1ZH5A 4C3HJ 3CC2I 3BG6A 2O03A 1O3QA 1RR7A 1B72A 3GMEA 4CCNA 4BJTA 2D5VA 5FO5A 4A12A 1S5LC 4KICA 1JJ6C 2CQQA 3EETA 5A2QZ 1PUFB 1APLC 4LOCA 1R49A 2XRLA 1ETQA 2KJCA 3JSPA 2ADUA 3FBIB 3LNQA 1FSEA 3JTGA 4O3MA 2A6HF 1OCZH 1U8BA 3SFIA 4M3GA 2E71A 4CCOA 2WWYA 1VI0A 2PJRB 4GFBA 4CGZA 2Y2ZA 4LLGF 1B8IA 4J19A 3MD2A 2CQNA 2KQRA 1VNDA 3IV5A 4HNUA 2LP0A 2BHZA 4C2UA 1R00A 3N05A 3TMOA 3L2UA 2MG4A 3WTZA 3AG3H 2Q0OA 1W1WE 4XKWA 1OMIA 1PP7U 1IV6A 1J2XA 2FA5A 2NS8A 2BW3B 5LRSA 3FDYA 4RGXA 2EV6A 4HLYA 1WHUA 2H27A 2RNGA 1BOBA 4I7HA 2Y69H 4HX4A 2HOSA 2M8EA 4V19K 1E17A 4IPAA 1MDMB 4J00A 1OKRA 2A05A 1ORKA 2VPLA 3HOYJ 3K4CA 2DPDA 4ZC3A 1FC3A 3BROA 2LFBA 5ED4A 2W7NA 3VSLA 3F0CA 3HGGA 3CCYA 4QIWN 4B47A 1KQ8A 3LA7A 4OIPF 3FIWA 4P9FA 3T1BA 3R0AA 4KJZA 4FHTA 2VBYA 4N4OB 3BPXA 1DGWY 3IP4B 4HEA2 1YIJI 5KCMA 1XMKA 2DXIA 4OMYA 3HUGA 1TC3C 3ONQA 1G2HA 1WI3A 2M5WA 3VB2A 3K9TA 3G2BA 5IYCJ 4EEFG 2EINH 2YU3A 1KU3A 2QQ9A 3FHZA 1MW7A 1OCOH 2RQPA 2ZBKA 5C44J 3M7GA 2HOEA 1ON2A 4DYCA 4BQNA 1BR2A 3K4BA 4RDUA 4IRHA 4QPOA 4BJ5C 3HRMA 4BXUA 1W7PA 1E0EA 3UR3C 3MZYA 5F0HA 1FIAA 4LITA 5FRMA 3IC7A 1LQ1A 2W24A 4N9IA 4M6YA 2ZXHA 2EB7A 4S0HB 1BC7C 1WJ5A 4BHBA 1A36A 4KITB 3NRVA 5IT9Z 4R8HA 2R7QA 1Z6RA 3OYNA 2L02A 2LY1A 4NC8A 4E7KA 2NNYA 2OCEA 3P9KA 3K10A 5FD5A 2VC0A 2XDVA 3BY6A 5EF6A 3CF2A 1U2WA 2KLOA 4BBRJ 3D5RC 3FM3A 3TP0A 4MTEA 1T33A 3RDIA 3V8LA 2ZC2A 2YX7A 3R4KA 4HSRA 3OYGA 4RGSA 5FJ8J 3DU5A 2D1HA 3CD6I 3PUFA 3Q9SA 3CC7I 1G8XA 2CGPA 2CU7A 4KT6A 4G7ZF 2XGCA 4LIVA 3KCCA 4BYYA 1L3LA 4I02A 2DFIA 2DA2A 4JX4A 4DYRA 2NS7A 2VL8A 2O8KA 3WU1B 2KISA 1S9HA 5GTIC 1YJ9I 2R7UA 3R61A 1XDSA 2ZXIA 1IXCA 1F4KA 2R7ZJ 3CO6C 3MZ8A 5CPRB 3VSKA 1J09A 2L0KA 2WY7Q 1DPRA 3SZTA 3RPUA 5DCMA 1MSEC 2WAQN 1MMAA 5HLTA 1Z77A 5HS9A 1LKXA 3BDDA 2AQEA 2GA2A 5IOZA 2JA8J 2XIGA 2KJBA 2Y31A 2BV6A 3LQQA 3MKLA 4PJNA 4M3FA 3FXRA 1W7PB 1KU2A 2KP6A 1LDKB 2HDWA 3CCRI 3ZCOA 4F52A 1ZRFA 1J9IA 4UVCA 4G9YA 3LA3A 3SEQA 4BEHB 1NG7A 3ZP5A 3VYUB 3H5RA 5EZGA 5K7HA 4I2OA 2GZWA 4KMUX 3GZ6A 1K78B 3K70C 3HHGA 2QSFX 2AHQA 1OPCA 4F55A 2KDZA 4CHUA 3IKVA 3HUGB 3SZPA 1R1UA 3IRRA 3TO9A 1MIJA 2HTSA 3HC7A 4FE4A 3A01A 4L18B 4CH7A 5F0CA 3RKQA 3S1RJ 2DYRH 2TRTA 3KYCB 3K69A 3QYBA 3J7AY 2V1XA 1FTZA 3CF5F 1Y0UA 3SJMA 3RCOA 3ZQHA 1ETXA 3ZR8X 5LFAA 1EH6A 1NH3A 1BL0A 3I4MJ 4JOMA 4QSHA 3HGYA 4HQMA 4KIFA 2FJ1A 3LSIA 4Y7NJ 1B4AA 1VFCA 4ZYDA 3TQNA 2G0EA 1BN5A 2JA7J 1GUUA 2NOJB 2A07F 1A04A 3DTKA 1F36A 4JK1X 1ZELA 2L9NA 4M9SA 1ODDA 2FSWA 3MFKA 3RIRA 2ISYA 1FOYA 3K4NA 1GT0C 2NYXA 4IJAA 3S32A 5EEHA 4B1RA 3ZQCA 1CF7A 3E97A 3KYLA 1T39A 2C6YA 5D4RA 2ELJA 4UUSA 4XICA 1LEAA 1Z7UA 2XPVA 2VN2A 3H35A 4L9VA 2MFZA 2VJJA 5EG0B 1Y0NA 3TKYA 3QP5A 2HTJA 3F3XA 2ZXJA 1IXRC 5FFXA 1R4NB 1JTXA 1E3OC 3M8EA 3RKXA 3E5QA 2FOKA 1FYKA 2RVCA 2PFBA 4MLOA 1AHDP 1KYZA 2X48A 5FB2A 1B59A 2XROA 3QYEA 4ZTJA 2M45A 2W25A 3K1PA 2G7HA 5KK1A 2VB6A 3ZQLA 5L3BA 3ABMH 2HEOA 2FU4A 2Q8KA 3CTAA 4U0YA 2VE8A 1LJ9A 3ISPA 1TW2A 2WY8Q 4AIDA 3D0SA 5DV5A 3CUQA 2TDXA 3I4NJ 4LG0A 1ZR2A 2R4GA 4UV8A 3G4SI 1IW7F 1GLNA 1WFXA 2DFEA 3KEYA 1XCBA 4HDUA 4B3XA 2IGNA 2DDAA 1EF4A 1UCRA 3S1QJ 4Y17A 4IL6C 3S1MJ 3QRFF 3AL0C 3KLOA 2GXGA 1WJEA 2X6XA 3Q0UA 4MFEA 4O5VA 4UHTA 5D5UB 3TDZC 2HPIA 2LVSA 2OAZA 4D5FA 4IHXA 4LB5A 2KMUA 5IPAA 3DTEA 5D6FA 4WXCA 4DIQA 1ZYRF 3JTHA 4U0WA 2WC2A 1QGPA 1YS6A 5J6XA 4DJAA 3AKZA 2STTA 4BNCA 2OQRA 2QZ8A 4LMYA 4A3JJ 4I0BA 3GFJA 5FLXZ 3FXJA 4JQFA 3HKZA 4CZZA 2LBFB 4BBSJ 3V7RA 1PP8F 3ERMA 3WTTC 4ZYHA 4ZZDA 3F8BA 2A61A 2V7FA 1BIBA 4WXHA 3L00A 3G6EI 4YFXF 4KA4A 3RPQA 1ZRDA 4XN3A 2PG4A 4BXXJ 3EYYA 1VQKI 5IYBJ 2PLYA 4OWRB 1POGA 5FGMA 4FTHA 2VT2A 3OOPA 5FKNA 1XS9A 5DM7F 2IS2A 4D5CA 3E6CC 5A2QK 1IV8A 3BCBA 4F91B 2GM4A 5L3CA 3CO7C 2W84A 4HLXA 1T56A 3WGGA 4S05A 3ZMUA 3CCMI 1MZBA 1STZA 3JRAA 2HDCA 1G3SA 2V9KA 3RQ4A 1JKQC 3DFGA 2M87A 2JUCA 1Q1HA 3KYDB 1TWAJ 3K4MA 2X51A 1CQTA 5GAHJ 4HF1A 2VXDA 3QPLA 2QKLB 4XKCA 2B7EA 1WKMA 5JFRA 3OOUA 1O3RA 3TW7A 4E7LA 2H6BA 3T8TA 3G3ZA 1XSXA 4E70A 4OAZA 3LQRA 1JUMA 3BR6A 1ZARA 3I4PA 5F27A 1EV7A 3EYIA 2EIKH 1XN7A 1D1AA 5E79C 1YS7A 2I5UA 2M3AA 4WX9A 3HL2A 1R22A 3QOPA 4O6JA 3S2DJ 1WJBA 2X1CA 1XC5A 5F1JA 2YX4A 1A35A 4KMFA 4A3BJ 3OS2A 1QU3A 4OMZA 1B1BA 4RS8A 3CP8A 2ECBA 2V4JC 2CO5A 3HOVJ 4II2A 1LVAA 1G6NA 5FRNA 2MSYA 1F43A 1Y6IA 3CCEI 1MSFC 2LC2A 3GTLJ 1YHQI 2R5YA 2IA2A 4C3JJ 3S14J 2OZ6A 2V9PA 1W4MA 2QENA 1ZG1A 1ZQ3P 2K3PA 3G1MA 1NG6A 1HKQA 5D4SA 4U7BA 3Q5FA 1X2NA 4HV6A 2L54A 4YFNF 3K6GA 1HA8A 2M4KA 3CESA 2KZGA 2UV1A 1VQLI 3PO3J 1OISA 1P7JA 2QSGX 1BW6A 4BUPA 4KISA 3LOCA 4G94A 4L9NA 4DZJA 2HZTA 2Q2EB 4KIBA 4MGRA 3PIPF 4L9TA 1FPQA 4XN0A 3GBGA 1DP3A 1IN8A 4BS9A 1R4MB 3LAJA 2WV0A 3I59B 2ICWG 1TT0A 3FK6A 2DA5A 1DPUA 1X1AA 1S6LA 2EV0A 2E35A 3VYRB 4FX0A 3K1MA 4CO8A 1R58A 3OYBA 1X4OA 4A3LJ 3BZ6A 4D7MA 1Z6TA 2WADA 4UB6C 4UV9A 2E1NA 4P9UA 3J81K 2KKOA 3SZGA 4KNYA 4HQEA 1ITYA 4E4HA 4PGHA 2YSRA 1SMYF 4BGDA 3KZIC 2OA4A 3KZZA 5ICCA 3ZXSA 2DMNA 3EUAA 1HOMA 2B0LA 1ZKGA 4G7OF 2JPCA 2NVXJ 5JVGF 1VQ9I 4XORA 2X1EA 1KZHA 4HNTA 5DD8A 3C2HA 4BQAA 3LFKA 1SVOA 4OIRF 1Z3XA 2NRAC 2E1OA 2LLKA 3CLOA 2CW8A 3A1YA 1AKHA 3WGIA 1XGNA 3H3ZA 3TEDA 1TNSA 2IA0A 5EEAA 1HC8A 1V54H 3H1CA 2XAFA 2XKOA 1MH3A 2V9VA 2VBZA 3DLLF 2XAGA 3DF8A 3RZDJ 2NAZA 4ITVA 4Y52J 1WCMJ 1V4RA 2UUZA 1IUYA 4ABZA 2ELHA 2JWTA 2Y30A 4BE0A 1RRJA 1H9GA 1QVTA 5ERIA 3DEWA 2VOOA 2NVUB 3FXOA 3NWTA 3QAHA 2Z1DA 2Z5UA 2JVGA 1BBYA 2CV0A 3OR2C 2IGMA 2R7RA 3M4OJ 4CUGA 1TQMA 5IP7J 5L3GA 1MNMC 1P2FA 2F4OB 1RNLA 4Y13A 2PI0A 3TOBA 1ETKA 5LGUA 3OY9A 1YO5C 3LSJA 2BY3A 1UHMA 3F6OA 4G12A 2OC6A 2XGEA 1KQ0A 3LSHA 1RUNA 3GUDA 3AG4H 1XX5A 1E3HA 1W5TA 2RC4A 4CYCA 3H5NA 3L1PA 5CYVA 4IRGA 2V6EA 4D1QA 5HLGA 4LIUA 5H6QA 2IA1A 3HPHA 3FXUA 5D5WB 3OYCA 4EGYA 3BR0A 1SANA 2K5CA 4XLAA 2EFOA 3PIOF 3PUBA 2LREA 1IRZA 4B48A 1U5TA 2RREA 1HBXG 3V7SA 4UB8C 3O2PE 2OPTA 4BAYA 4E7IA 1F1ZA 3RKWA 3GTGJ 2W1OA 1RC9A 3DKYA 2OTLI 3MAJA 5CVJA 4BH9A 1FBSA 3WTWC 1BI2A 4NDLA 1FLIA 2IPQX 1K61A 3ZQIA 1ERDA 3ZQQA 1YI2I 2HNHA 2VBWA 3HIFA 2EH3A 2LYCA 5CJ9A 2F5DA 4IHWA 3KP6A 1JHFA 3FXQA 4PK4A 2K4BA 1AOYA 2JMWA 2WB1A 2GA1A 1FOXA 2BEOA 4CCMA 3DV8A 1LFUP 2VKHA 1OJLA 1J0RA 3NARA 5DUIA 2ZJRF 4CZCA 3C1DA 4L5JA 2P5KA 4M74A 1FOWA 1MH4A 3VYTB 4B4CA 5K5QA 2FBHA 5ILVA 5L3EA 1G59A 2UXXA 2A5YB 3GTQJ 2CUJA 3E7LA 2CV2A 1U5TC 4IO9F 2KT0A 4MHGA 3F8MA 3CCLI 1W36C 2E1MC 2UXNA 2OV7A 1LEBA 1QZEA 3G73A 4ZYGA 4HV5A 2DTRA 2JJ7A 3C2GA 1PUFA 1X3UA 5CVRA 4BE2A 4E7SA 5IT9K 2JRMA 5B1AH 2Y48A 4DW6A 3OYLA 3DEEA 1X1PA 5DUKA 5TISC 1QVUA 3TW6A 1QQIA 5JVTA 2XPWA 3C3WA 1I6XA 2YR2A 4HPQA 2KZVA 4AVPA 3S2HJ 5EGOB 1IN4A 3KZYA 1X1DA 4UNOA 1SFXA 2L4AA 4P55A 2X9DA 1LFBA 2DAOA 3HTUA 2D45A 5DYMA 1K7AA 3F8FA 3FWEA 4FX4A 1DP7P 4JX6A 4BU2A 1HDPA 2FRHA 1DQUA 2Y75A 2M7BA 3L2WA 3GO5A 4L0YB 3BR5A 2FD5A 4QTRA 3JRFA 2CW7A 1IO2A 2HYJA 3CQZJ 2CUEA 3M9AA 2KIMA 2ID3A 1JKPC 4LLLA 1XDUA 2J5PA 4RLQA 3OYHA 4M6XA 3GLLA 4RB2C 4EQQA 5K1YA 2DOFA 4LD5A 2A6TA 1WVRA 1XD7A 2O8XA 2F6CA 4MO7A 2VXZA 2K4JA 2B63J 1JUPA 2LH9A 2QEXI 2XF5A 3W2AA 4DZPA 4A0ZA 3A02A 5M3MJ 3DKXA 3WTVC 5FLMJ 2N8GA 3HBLA 3KP3A 2R0QC 1ZRCA 3B6CA 3ESWB 2VC1A 1XSDA 2P5VA 2JPBA 2Y0SA 3ZN1A 2LNBA 4NQWA 2L5QA 1X1CA 2XSDC 4LGWA 3ZPLA 2IP2A 2P6TA 2DA6A 3T8RA 1W0UA 3I5UA 2R5ZA 2BVLA 6PAXA 3OYFA 2R93J 3TGNA 1FZPB 5F08A 3CP2A 3IAS2 2DMTA 5F6FA 3ZMDA 3H9JA 1IN7A 1JKRC 4R1HA 2XGXA 1FX7A 5CVVA 2AXLA 3O3KA 5B1BH 5FKKA 4LJZF 2WTEA 1K4SA 2EBIA 1D0XA 4RAYA 1BR4A 1SAXA 2XAJA 1IRXA 1RUOA 2EFPA 3DPUA 4M73A 2X6OA 3JRCA 3B6AA 3AG2H 2X0LA 3BP8A 3GZ5A 1S3JA 5J3LA 2RQQA 4CCKA 4C2MJ 2DQLA 5CVIA 2FEZA 4W97A 2R7VA 4I09A 1WWXA 1REPC 2V1UA 3IRQA 2FQ3A 3DCFA 3DU6A 4A5NA 1Z67A 1JJ8C 4M9XA 1QBJA 2HKOA 5HS7A 4AYBN 2QVOA 2OJED 2R92J 2L7FP 1I50J 2LY2A 3REOA 5IY5H 1BI1A 3WHCA 1AA7A 4N9HA 2L7ZA 3CMMA 1JT0A 2HYGD 5L3FA 1IZ1A 1IJWC 2ISZA 1HDDC 1XMXA 3CZ6A 1NK3P 2Z9OA 4HSTA 4DYQA 3GTKJ 1OYWA 3WODF 5FLXK 3HZJA 1JKOC 3I56I 1UB9A 2IS4A 3JAMZ 5HVQC 1GV2A 1BR1A 4FQGA 2P81A 4GXOA 2MLGA 3A4CA 1RESA 4HX7A 4L9JA 4M72A 4HA8A 2IW5A 3ZMTA 5J47A 1QZZA 3F23A 2KRHA 1R9TJ 2RN7A 3MKYB 2ECCA 3WGHA 2W57A 1IG7A 2KIQA 4KN4X 5E3OA 1VTNC 5HOOA 2EPFA 1XSVA 1V5FA 4CCLA 3K70D 4E7HA 1VQ8I 4KUMA 3IL2A 2WBMA 1ACIA 3KEOA 2DMQA 1ZHFA 1QPIA 4HZFA 2K7LA 3N97A 2EJRA 3HTSB 2KHMA 1W5SA 2Y0MA 5J4VA 2OTJI 2F4IA 3HOZJ 3HOUJ 1OCPA 1Y39A 4RB3C 3RZOJ 2G9WA 2XC7A 1WJDA 1LUJB 2BY1A 2EZIA 2WA0A 4P96A 1T0FA 2RNJA 2ZB9A 2VLAA 2HXOA 3BWGA 5FKLA 4G6TB 1EJ9A 3PNTA 4LLNA 3IUOA 1TP4A 2JSPA 5CKTA 2PJRA 2IS1A 4OINF 3E5XA 1P4XA 1A31A 2M7AA 4IQJA 1R5GA 1ENHA 3BG7A 1RR8C 2EFQA 4WK8F 2O9LA 4HF2A 4PDKA 1OCCH 1ZAOA 1SFKA 1ZG5A 2VJ5A 3K2ZA 3A0BC 4XMYA 4MEXF 1AWCA 3ECOA 2KIUA 4II3A 5K5OA 2PMUA 4IEJA 2DODA 4EM1A 2I8DA 2IVMA 5B3SH 5LGTA 3HOTA 4XRSA 4RGRA 5C3EJ 3MN2A 5D5VB 1SFUA 5K7ZA 2DI3A 4C3IJ 1QZYA 2L7KA 5JLWA 2JA5J 3K4JA 1K79A 1QHHD 1PVEA 3H0GJ 3RI4A 5HNHA 3BZKA 4C30A 4BQQA 3IH2A 5E3NA 1LDDA 1VZ0A 4PGGA 1Y8RB 1I27A 1YW8A 1O3TA 2E2IJ 4E6KG 1YTYA 2G7UA 2IT0A 3T5XA 1RPWA 2GAUA 2L9RA 2K9SA 3E5UA 5E8GA 4B43A 1Y8QB 2X4HA 4GGGA 4Z6YA 4PJLA 1V55H 4XL9A 1E3PA 4ZDPA 4EM2A 3OYEA 1V3FA 2L7MP 3E6MA 4TV7A 5LEKA 2WAFA 1KYWA 4XLPF 1H8AC 2P8TA 1U8RA 3D1NI 1T8IA 2IJLA 4QPQA 3J80Z 3F72A 4XM3A 1VQ5I 1LFPA 2ZSIB 3IHUA 3MVPA 2PMZN 2AS5F 1DGRM 2ZFUA 2RGVA 2F5CA 4RBOA 3HJEA 2E1CA 1LNWA 2CS3A 1H0MA 2R7DA 1MBKA 2LR8A 4HW0A 2BZTA 1ETWA 2V26A 2LSOA 2COBA 3H92A 1R5HA 3O8HA 5FD6A 2P7VB 2F5FA 4IHTA 1Y1VJ 2DN0A 2DCEA 2Z99A 3ABTA 3EUKL 3BJAA 3S3NA 3KPHA 4XONA 4RGUA 1B9MA 3BQYA 1RZ4A 2M4GA 4A3EJ 4FT8A 2I10A 2BHYA 3NQOA 1YYVA 1KU9A 2MC3A 3BTCA 3GTOJ 4GDFA 2DPUA 5IYDJ 4BACA 3I64A 2E60A 1O3SA 4YEJA 1U9OA 4EMSA 3L2RA 4EJOA 5M3FJ 1WPKA 2LTPA 1D8JA 1QPMA 3GYHX 2EFNA 5CLSA 2B9SA 4QLCU 4CA0A 2QKMB 4OOIA 3S17J 4XLFA 1K83J 2ZJQF 1WH5A 2M0MA 4B8XA 3CJRB 4AVZA 3F8CA 3O6BB 1TL8A 2KRCA 2Q1ZB 5B5EC 1MJ9A 2D2WA 2DYSH 2DJNA 3V42A 4A3IJ 3GFMA 2XHKA 3PNYA 1D5YA 4CCJA 3FKIJ 3PM1A 5JLXA 5EYRA 2HVQA 2M1BA 2V1NA 2VODA 3J7ZI 3F8NA 1XCVA 1RIOH 5TJJA 3FXMA 2HWVA 1U0JA 5FKOA 1N77A 1ZLKA 2JVHA 5KAIC 2EILH 2GXAA 2JA2A 2W00A 1H89C 1YIOA 2FE3A 3A0HC 3HYIA 4CYDA 3NWSA 1IDZA 2LG4A 3ERED 3HPGA 1Q1VA 2F5EA 1X19A 2QGUA 4PCQA 1HSTA 3DBRB 1S7OA 4B44A 1HLVA 3GTPJ 2A3SA 3WTSC 1IN5A 2ZFWA 4XLNF 2FBKA 2GIVA 3QODA 2HS5A 3LWFA 3A2KA 3ML6A 2A68F 1LDJA 1KGSA 1Z1DA 4WXDA 3RYRA 4I98B 1OYIA 4A2UA 5GAGJ 1USTA 5LHIA 4M3DA 4BDZA 2VQGA 1HCRA 4RMNA 1T98A 1TWCJ 3JRBA 4D7NA 5D8LB 3M1EA 1K78A 3GTMJ 1YW7A 1C0WA 1MNDA 3S15J 1W5CC 3ASNH 3RJPA 5K7FA 4KIGA 1UJ8A 5D8KB 1A6QA 5IP6A 4X0GA 3UKGA 1WJAA 1YX3A 1AU7A 1O57A 1MJAA 3CCSI 2ZMEC 4EJUA 4DQ2A 5DDGA 3HG9A 3RKYA 3S93A 2F48A 3B73A 4RM3A 3WG7H 4F3QA 5HDKA 4AU7A 1UHWA 1OQYA 4X1EA 2ID6A 4I01A 1TW3A 2VUMJ 1ZTRA 1FMVA 3FBNB 4FISA 2O6GE 1WJCA 4CSWA 1SEUA 3EPZA 4XK4A 3S8PA 3JRHA 1FOKA 2L2OA 2DBBA 3ZMSA 5LLQA 1FBUA 2FMYA 1R36A 2VPRA 3DPTA 3KP4A 4IOCF 3VDXA 2DA3A 3A01B 1J59A 2JQ7A 3P7NA 3FHNA 1I3QJ 4M6VA 2HKXA 3NEUA 1Z9CA 3CLQA 3L2CA 2ME6A 4EM0B 4AIKA 2GOMA 2XUBA 5H2FC 5TRDA 3OYMA 1UAAA 2QBYA 2ZMEA 5C4XJ 4V2FA 4AYBA 4M71A 3OYDA 1GXQA 2DOAA 4ZJZA 5DM6F 1K6OA 3QQAA 1Z91A 1ONVA 3HRSA 2DQRA 2XB0X 4XLHA 2AQFA 4HDVA 1HXDA 3CMAI 2UZKA 2VQCA 1X3ZB 1FYMA 1UZCA 3IWZA 2EZLA 4IX7A 1F5TA 2ELKA 3P5JA 2XAUA 3S16J 4ETSA 2V6CA 4AWXB 2XPUA 2K40A 5DTDA 3L2QA 2HZDA 3BCAA 2K9QA 2M0CA 3DXJF 3ZOBA 2H94A 4F93B 5GPCA 2R7OA 4DBQA 1N25A 2EIMH 1FYLA 2DK8A 1TNTA 1T08B 4N4NB 3S1NJ 5E1XA 4J01A 5D5XB 5E18F 4A5MA 3HEFA 3V7CA 4IOAF 4Q5SF 1QA6A 3MKZA 4RAZA 2K9NA 2W4SA 3RPUD 3U21A 3Q0VA 2NVTJ 1HF0A 1RI7A 3MQ0A 2KDOA 3CCUI 2ACJA 1A5JA 2OQGA 2DMUA 2YUSA 3FXLA 4UUTA 2FF4A 2L4MA 3HKZN 4IF4A 1D0ZA 4AM3A 5ICGA 1IRFA 3J81Z 1G4DA 2E7WA 3SQNA 3AG1H 4B09A 4A3GJ 1XMAA 4IVNA 2R5ZB 3PFYA 1UMQA 2H6CA 1I39A 3F9KA 3P9CA 2HVSA 3ZMVA 4G6DA 1TQPA 2CMPA 1QO0D 2HR3A 3MMYB 2HXIA 2ZJPF 3U9GA 4HF0A 1LE8B 5KHDA 4M3EA 1J7KA 2QWWA 1WZ2A 1JGSA 1N78A 3LAPA 2R7SA 1ZGJA 3G1OA 3PSFA 5IP9J 3QPTA 5HDNA 4XNFA 5B66C 3DWLE 1ETYA 3SYTA 3K4KA 4KFCA 2K02A 4BDYA 4G8XA 3BR3A 3VODA 1JE8A 3NAUA 4A6DA 1VF9A 2VI6A 3GX4X 4IQ4A 5D6EA 5ILUA 3PNVA 2DA1A 4Q48A 5HDGA 3M8FA 3OR1C 4FE7A 3JW4A 1D8KA 1SAUA 4BQOA 4JP0A 5EZHA 1YW9A 3KP2A 2O5RA 3LFUA 4XR6A 2OUMA 3DBHB 3TDUC 2WAEA 2CV1A 5E20A 3TOAA 1I1GA 1OLTA 2ZNZA 3KP7A 5TGTA 3HOWJ 1TWGJ 3BG3A 4KDPA 1YFHA 1WSUA 3CUQC 1S7AA 2QBYB 5LRRA 1S72I 2K86A 1OR7A 1MGTA 3HRTA 5EGOA 2EFWA 3F22A 4ANJA 3ROUA 1YJWI 2DU9A 1TBXA 3WTUC 3L9FA 2BBYA 2HYFA 3JCUC 4IXAA 4M3BA 4WF2A 1MDMA 1IF1A 3DLAA 1GVDA 2DT6A 2XASA 3N4MA 2MLKA 2MD0A 1MJBA 3TO6A 4XIDA 2NVQJ 1X1BA 1FY7A 3BTJA 4C9YA 1VQ6I 1R6RA 4EATA 3COAC 4BXFA 4I0AA 3ZMZA 5HLHA 2VT3A 3P9IA 3K7AJ 2JK3A 4HX8A 2VJIA 3L2VA 1ZN2A 1MMNA 1G3TA 2L3DA 2LKXA 1RKWA 1P4WA 2E5ZA 3FKJA 1K4TA 1RKTA 2BXYA 2KFDA 2ZMEB 2FUG2 4HRIA 1OR7C 1VQPI 5J8CA 2E34A 3KP5A 2Z33A 2VJ4A 3V4GA 3VPRA 1FNNA 5GTHC 3OL4A 2VOPA 2NVYJ 3JR9A 1HSJA 4UVAA 1DU6A 3BPVA 4YFKF 4MNUA 2CUFA 3ECHA 1MKMA 1GDTA 2L9VA 4I76A 5E3LA 4MFDA 3JRGA 1FIPA 1FTTA 1B6AA 3BR2A 2E2HJ 4PSWA 3JSOA 1J5YA 4HG2A 4A0XA 3ULQB 3HDDA 2VIXA 3IAM2 4GRIA 2VKEA 4ESFA 1VQ7I 4U87A 1YRNA 4DNCA 2VQLA 1YG2A 4EJVA 2CSOA 1MMDA 3SEZA 2PMZA 1WRJA 4HNVA 5IT3A 3CCQI 2CQ7A 3K1NA 4OU0A 3ABKH 3V8JA 1I3AA 2K85A 1R23A 1EH7A 1FP2A 2FQ4A 2GBYA 2QUFA 4HAMA 2OCCH 3O8GA 3GFIA 4XOTA 2DO7A 1PUEE 3WU0A 2PX9A 5K5RA 2TCTA 2VASA 4D0PA 1WJFA 2KPMA 2DFHA 2LKSA 3DBLB 4GCVA 1BM9A 2YS9A 2MC4A 2PMHA 2ESNA 3OMYA 4XKVA 5F1RA 2PEXA 2ZO4A 3W6VA 2K9MA 2JT1A 1LB2A 4A69C 2JZYA 4R79A 4XSXF 2OZUA 1ZGWA 4UVBA 3M8JA 1XTAA 1Z3YA 1FP1D 3I9V2 4RM2A 3BOQA 5LHHA 1HKTA 5H20A 5E3MA 3SXYA 2A5WA 1CGPA 4BY1J 4XSZF 1MMGA 1JHHA 2JN6A 1Y56A 4G6QA 4Z2YA 3RYPA 4AD9A 3WTXC 4AIJA 5C4JJ 3I71A 4Y3OA 3E6BA 2HVRA 1FSHA 1EKEA 1UELB 5EDNA 4H4KC 1TWFJ 5AIPA 3H9GA 3Q9VA 1PDNC 4EGZA 4BHPA 3FMQA 2O0YA 3QPHA 4WWCA 4A3CJ 2M2EA 2LY9A 2LK2A 2DA7A 2EK5A 3HSFA 3BJ6A 4LG3A 2W48A 2F4MB 2WV1A 4Y4RA 1K6YA 4GO1A 4NQWB 5KVRA 1JUSA 2KRFA 3C18A 1T95A 1HW5A 4I99C 1SD5A 1TTYA 2FBIA 1TLHB 2P5LC 5BPDA 3W6JB 1O7LA 3WG9A 4XLEA 1MBJA 4L5EA 3AL0B 3ZQFA 3H9QA 4UUSB 1FMWA 1YJNI 3LSMA 1UFMA 2OD5A 3BR1A 1B9NA 2E5NA 4U7DA 3F6VA 2P0WA 1I5ZA 3CDLA 2A69F 3ABLH 3OIOA 5AONA 3PFIA 4PUSA 4PFOA 3DPLC 1S29A 2K27A 3Q3SA 1Z0XA 2FNAA 4N0BA 2DFFA 2VKDA 2V79A 3EQLF 3M1CA 3HSRA 3RQIA 4BJ6C 2RV8A 3KE2A 1YE9A 4RB0A 3GFLA 1U78A 2P4WA 2XRNA 2R7XA 4LG0B 3QU6A 4HBLA 5AIQA 4A93J 2EZHA 1T38A 2LBFA 4NNJA 3S3OA 2DOEA 3MEXA 1IDYA 1YQAA 2MBFA 3SDBA 2IBDA 5ICFA 1GV5A 2DA4A 5J8FA 3S3MA 3K0LA 3WTYC 3IKTA 2H8RA 3L7WA 2X6WA 2R7TA 3FISA 2DK5A 1H9TA 3MWMA 1X2MA 4RB1A 4D9JA 4FASD 3KEQA 1EA3A 2QQ8A 1GVJA 5DEQA 5E8IA 5HLIA 3QYFA 4DGWB 1MBEA 2BVMA 1TZLA 4KN7X 4DBRA 1P9QC 1MBGA 2XB5A 2NS0A 2AXTC 2P6SA 3LMMA 4QWQA 4BEHA 3OS0A 1Z21A 1G3YA 2RKHA 2X1DA 1G3WA 3HRUA 4LK0F 2FMLA 5ICEA 3GW2A 4C2TA 3I54A 2O3FA 1WQ2A 2GXBA 4EJTA 2CYYA 1N75A 1ZK8A 1IAWA 2MGQA 3K2AA 1R7JA 2VE9A 1CF7B 4YRVA 1FWZA 1ON1A 5E17F 3GXOA 1D3YA 4NC7A 4G7HF 5H6RA 2R7WA 5DCMB 3DQVC 4S04A 3I3LA 4ZDOA 1X58A 4BY7J 2BY0A 1SFOJ 2ETHA 3CCVI 2CH0A 5J1RA 2ZXWH 2QCOA 2DT7B 3BT9A 5GAEJ 2CUZA 3HOXJ 5BMZA 4ZYAA 3TP3A 2COMA 4EV0A 1YX5A 3I58A 5DCFA 4A3KJ 2HDDA 2PJPA 5KAFC 2JRTA 1JGGA 1MBHA 3R60A 2XKPA 3OL3A 1LPQA 3CDHA 2XF7A 1ETOA 3OYJA 3QPSA 2ZCWA 5BQTA 4PZJA 4E7JA 3FF5A 1R1TA 3LSTA 2EIJH 3WHBA 1DDNA 1DUXC 1ULYA 4PJMA 4XQFA 3VYSB 1E2XA 3IH3A 3QOEA 3H36A 2DJIA 4JX5A 2AO9A 4PFPA 3SHFA 2J5OA 3AFHA 2XVCA 3ZQ7A 3E1SA 5F0FA 3TBIA 2QA4I 5HNFA 2XSJC 3ZGKA 1PJRA 1ZLJA 2ZKZA 4JYKA 5BS6A 1KU7A 4RA2A 4MIMA 5EEGA 2IEKA 4JBAA 3LSRA 1TQIA 3I0TA 3E3VA 1V5EA 5M5WJ 1BJAA 4B3AA 2BOLA 3VWBA 1LE8A 3B02A 1ZR4A 3OS1A 3CCJI 2Z16A 2YPRA 5L3DA 2HQNA 2F2EA 2IXSA 1JI8A 5FFZA 1OCRH 2BXZA 4MQ9F 2FX0A 2LRDA 2MABA 4Q47A 3U1DA 4F7ZA 5BPIA 4A3FJ 1UG0A 5GP9A 1QNTA 2CRGA 3OV8A 2JA6J 5JR3A 4A3DJ 1Z05A 2QF7A 3E0JB 2CQXA 3BTIA 2VQHA 3H3UA 4KYWA 2IGKA 4AIHA 2JUGA 3GTJJ 2M8GX 3HM5A 2GLOA 1UG2A 3C7JA 4IHSA 4ZYEA 4HOBA 2EA2A 3J80K 3JRDA 1L0OC 4EVIA 2LD5A 1X4PA 1SFEA 3LSPA 4RAGA 3HSEA 4U88A 4M9ZA 2QQBA 5GADJ 4ESBA 1WGXA 4A6EA 2L9SA 3U2RA 3CMEI 4ENJA 2F5VA 3JREA 2LKPA 4CXFA 1U9NA 2XGDA 1VQNI 3GWZA 1WI9A 5E1ZB 1M1EB 2HOAA 5GPAA 1SC7A 3GLXA 2HOTA 2X6YA 3WE3A 2IRFG 2BY2A 4H0EA 3CJTB 1MBFA 3BTLA 2MW8A 4F92B 4IKFA 1P7IA 3FX3A 2XF6A 4XBFA 2PN6A 1IGNA 3CC4I 3PQKA 4LK1F 5EG0A 2CQKA 4Q4ZF 5F04A 2IS6A 2GIZA 2WB1N 3FZVA 4OAYA 1W7PD 1ETVA 1HKSA 1HW2A 2KL4A 2MD5A 3KFWX 1ZREA 2NNNA 2NOGA 4PSXA 1OCTC 1BIAA 4UY8I 1IC8A 3RSNA 2W85A 1SVMA 4P1WA 4ZTFA 1QHGA 2LMDA 5M5XJ 3W2VA 1SD4A 2OF7A 1SMTA 4BKXA 1XPXA 2HQRA 1GXPA 5LHGA 1VQMI 3UNGC 3KIOA 3S2WA 2PQ8A 1SD7A 2XAQA 1FT9A 4XLCA 3OSFA 3LL7A 2VBXA 1P92A 3FK7A 2LF8A 1BW5A 2QYOA 4RAFA 3GVAA 2LF7A 4MQVA 4HYEA 5EJCA 3BJOA 1VQ4I 5CQEA 1R1VA 2KIFA 3GCMA 3HXLA 1VQOI 3JRIA 1IN6A 3BQZA 4NUBA 1U5TB 4BL0B 2IAIA 3FM5A 2M34A 2CJJA 3OYAA 3ZQGA 1OFCX 1T2KA 2ESHA 3KLNA 1U3EM 1ZGAA 2VONA 3J7YJ 1MMSA 2QM3A 4MEYF 1ZG3A 2HPMA 3BLYA 2EA4A 3VOEA 4CYCB 2H1LA 5HODA 1FJLA 3PO2J 3OYIA 1Z7LA 3EUHC 3PQJA 2E1MB 2WAQA 3G71I 2EV5A 2R3SA 1IUFA 1KONA 4UXNA 1W0TA 2STWA 3OYKA 1JTYA 5J4YA 2E2JJ 3KX2A 1MNEA 4FCYA 1O7FA 3JAMK 2YU9J 1I6HJ 1EH8A 1R71A 4OIOF 1D5VA 4PJJA 5M5YJ 3FMSA 1HQCA 3M07A 4AC0A 4BE1A 3DP7A 4ZDLA 2D1VA 2HU9A 2LOOA 2L01A 5DD4A 2CWEA 2K9LA 3R0JA 2NXNB 1USSA 4NBQA 4ESJA 2BE5F 1R5ID 3PJRA 3GF2A 2BW3A 1AKHB 3IWFA 2GWRA 3WU2C 3I59A 2ZJ2A 1BI3A 2HFHA 2HQAA 3EUHA 1LVKA 4ENMA 4CDGA 2FNPA 4GYIA 1D1BA 1KQ9A 4U0VA 4XRSG 4A3MJ 3DEUA 4PJ0C 3Q0WA 4EJWA 3OIQA 9ANTA 1P4AA 2QSHX 2LDUA 2W82A 3BG5A 2M30A 3MCZA 3VFZA 4YIRX 1HW1A 1U6GA 4L0ZB 1F9NA 3SFZA 1SD6A 1XB4A 4ON0A 5JI6A 1XGSA 1S8NA 3PSIA 4KT5C 1T0FC 1FBQA 3M3YJ 2MH2A 3ZN0A 2IGOA 1PYVA 2HQ5A 2MA3A 2DT5A 1BOAA 1IXSB 1V5GA 3D5LA 1B72B 2CW0F 5LEJA 4Y33A 3SDGA 4ENNA 1W36D 1FEXA 4E7ZA 2P7CB 2R7FA 4ZZLA 1XGOA 5JHFA 5JHUA 3DTIA 3TL4X 3LA2A 2Z2SB 4NHJA 2H1KA 3BG9A 4CICA 3J7AO 4MTDA 2MYSA 2QLZA 4YELA 4WCGA 4DOZA 3DKWA 2FOWA 2EWNA 2HI3A 3ASOH 1MD0A 3CDIA 1SVLA 4V2GA 5FKMA 3CUOA 4LB6B 2CFOA 3A03A 1DU0A 5FROA 2Y9YA 2DMPA 3F21A 1XGMA 3ZRGA 1BJZA 1Y1WJ 1JXSA 3TO7A 1TWHJ 2Z3YA 3HB9A 2X85A 3W2WA 3GEZA 4XRFA 1YOVB 2H8WA 3D5SC 1QRYA 3I55I 3IH4A 4ENKA 2OBPA 3MZHA 4NB5A 1YITI 3U1KA 1J75A 1I1SA 4W1UA 2XAHA 2O7OA 2XV4S 2ME0A 3CUQB 3FXKA 2A6EF 1NTCA 5E1WA 2M9HA 3EDPA 3OSGA 2GQQA 4A0YA 2CG4A 2EQRA 4RLFA 3QWLA 2E7XA 1D1CA 3FMRA 2PBIA 3RTRA 2RAEA 3W3CA 2O61A 5DS9A 5BOXA 2ZSHB 4GYGA 1H88C 3X2QH 4UUVA 5J40A 3ABUA 5CQGA 4IHYA 3T0YA 4BHCA 4NC6A 2V1DA 1D0YA 5CVUA 5LBQA 3GZNB 2BYVE 3LSKA 2Q2EA 5ILSA 4P5OA 1TT5B 5HS8A 1O4XA 4ZH4F 1YRNB 2HGCA 4YIIA 4IHVA 1B8IB 4ASNA 2BGCA 4OIQF 2GOXB 3E6DA 4I6ZA 1BI0A 1JT6A 3C2BA 1XG1A 4K2EA 1OYYA 5LGNA 2RDPA 3QP6A 1KA8A 3LSGA 5FLVA 3WE2A 3H5AA 2JSCA 2UWMA 3OIPA 1P6RA 1BA5A 1GHCA 2H09A 1BC8C 5IOYA 1WH7A 2QQAA 2K3FA 2R5YB 3L09A 1NK2P 2OU2A 3R6SA 3ELKA 1T6SA 3BZCA 3H0DA 4LFUA 4IZZA 3CJQB 3V8KA 2DDBA 3W6KB 2E19A 2CFXA 4Y15A 5J1YA 5BNGA 4AUXA 4XKBA 3BC8A 5KNLA 3H3VK 3KETA 1A6IA 1IRGA 3MKWB 2DLLA 2E36A 3OWTA 4FETA 4XOPA 2EZKA 2Y0SN 3PL8A 3HOSA 3CMYA 1RETA 5LD2C 3VEPA 3QU3A 2Y9ZA 2MH9A 3HHHA 5J1UA 1X3WB 3CJNA 4X6AJ 2DTZA 3G1LA 5F64A 1YLFA 2ZNYA 1S7EA 2DW4A
chains in the Genus database with same CATH topology
1NHAA 3I53A 4L5IA 2JTVA 4YG2F 3AAFA 2FXAA 4YIFA 4IRIA 1ZH5A 2O03A 1O3QA 5FO5A 4A12A 4KICA 3EETA 5A2QZ 2KJCA 3JSPA 2ADUA 1FSEA 3JTGA 4O3MA 2A6HF 2WWYA 4CGZA 4LLGF 1R00A 3WTZA 2Q0OA 1PP7U 1OMIA 1J2XA 2FA5A 5LRSA 2H27A 4RGXA 2EV6A 4HLYA 4I7HA 4HX4A 2M8EA 1E17A 4IPAA 1MDMB 1OKRA 2DPDA 1FC3A 3BROA 5ED4A 1KQ8A 3LA7A 4OIPF 4P9FA 3T1BA 3R0AA 4FHTA 2VBYA 3BPXA 1XMKA 4OMYA 3HUGA 2M5WA 3VB2A 3K9TA 2YU3A 1KU3A 2QQ9A 3FHZA 2RQPA 2ZBKA 3M7GA 2HOEA 1ON2A 4IRHA 3HRMA 4BXUA 1W7PA 3MZYA 3IC7A 1LQ1A 2W24A 4N9IA 4M6YA 2EB7A 1BC7C 4BHBA 3NRVA 5IT9Z 4R8HA 1Z6RA 2L02A 2NNYA 3P9KA 5FD5A 2VC0A 3BY6A 1U2WA 3FM3A 4MTEA 3RDIA 3V8LA 2YX7A 3R4KA 4RGSA 2D1HA 3Q9SA 2CGPA 4G7ZF 3KCCA 4BYYA 1L3LA 4I02A 2DFIA 3WU1B 3R61A 1XDSA 1IXCA 1F4KA 3CO6C 1DPRA 3SZTA 3RPUA 5DCMA 5HS9A 3BDDA 2GA2A 2XIGA 2KJBA 2BV6A 3LQQA 3FXRA 1W7PB 1KU2A 1LDKB 1ZRFA 1J9IA 4UVCA 4G9YA 3LA3A 3ZP5A 4I2OA 2GZWA 4KMUX 3GZ6A 1K78B 3HHGA 1OPCA 4CHUA 3IKVA 3SZPA 1R1UA 3IRRA 3TO9A 2HTSA 4L18B 3K69A 2V1XA 1Y0UA 1EH6A 4HQMA 4KIFA 1B4AA 4ZYDA 3TQNA 1BN5A 2A07F 1A04A 4JK1X 4M9SA 1ODDA 2FSWA 3MFKA 3RIRA 2ISYA 2NYXA 4IJAA 5EEHA 1CF7A 3E97A 1T39A 2C6YA 5D4RA 1LEAA 1Z7UA 4L9VA 2VN2A 3TKYA 3QP5A 2HTJA 3F3XA 2ZXJA 1IXRC 5FFXA 3M8EA 3RKXA 3E5QA 1FYKA 2FOKA 2RVCA 2PFBA 1KYZA 5FB2A 1B59A 2XROA 2M45A 2W25A 3K1PA 2G7HA 5KK1A 5L3BA 2HEOA 2FU4A 2Q8KA 3CTAA 4U0YA 2VE8A 1LJ9A 3ISPA 1TW2A 3D0SA 5DV5A 3CUQA 2TDXA 4LG0A 4UV8A 1IW7F 1XCBA 4HDUA 1UCRA 4Y17A 3QRFF 3KLOA 2GXGA 4UHTA 4O5VA 5D5UB 3TDZC 2OAZA 4LB5A 5D6FA 4WXCA 1ZYRF 3JTHA 4U0WA 2WC2A 1QGPA 1YS6A 5J6XA 2STTA 4BNCA 2OQRA 2QZ8A 4LMYA 4I0BA 3GFJA 5FLXZ 4JQFA 4CZZA 3V7RA 1PP8F 3WTTC 4ZYHA 4ZZDA 3F8BA 2A61A 1BIBA 4WXHA 3L00A 4YFXF 4KA4A 3RPQA 1ZRDA 2PG4A 3EYYA 2PLYA 5FGMA 2VT2A 3OOPA 3E6CC 5A2QK 5L3CA 3CO7C 2W84A 4HLXA 3WGGA 4S05A 3ZMUA 1MZBA 1STZA 2HDCA 1G3SA 3DFGA 2M87A 1Q1HA 4HF1A 1WKMA 5JFRA 1O3RA 2H6BA 3T8TA 3G3ZA 1XSXA 4E70A 3LQRA 1ZARA 3I4PA 1EV7A 3EYIA 1XN7A 1YS7A 4WX9A 1R22A 3QOPA 4O6JA 2YX4A 4KMFA 4OMZA 1B1BA 4RS8A 2CO5A 1LVAA 1G6NA 2IA2A 2OZ6A 1W4MA 2QENA 1ZG1A 1HKQA 5D4SA 4U7BA 3Q5FA 4HV6A 2L54A 4YFNF 4G94A 4L9NA 2HZTA 4MGRA 4KIBA 4L9TA 1FPQA 1IN8A 3LAJA 2WV0A 3I59B 1DPUA 1S6LA 2EV0A 4CO8A 4FX0A 3K1MA 1R58A 3BZ6A 1Z6TA 4UV9A 2E1NA 4P9UA 3J81K 2KKOA 4KNYA 4HQEA 4PGHA 2YSRA 1SMYF 2OA4A 3KZZA 5ICCA 2B0LA 4G7OF 2JPCA 5DD8A 4BQAA 3LFKA 4OIRF 2NRAC 3CLOA 3WGIA 1XGNA 3H3ZA 1TNSA 2IA0A 2XAFA 2XKOA 2V9VA 2VBZA 2XAGA 3DF8A 2NAZA 1V4RA 1IUYA 2ELHA 1H9GA 5ERIA 2VOOA 3QAHA 2Z5UA 1BBYA 1TQMA 5L3GA 1P2FA 1RNLA 4Y13A 2PI0A 3TOBA 5LGUA 1YO5C 1UHMA 3F6OA 1KQ0A 1RUNA 3GUDA 1W5TA 2RC4A 5CYVA 4IRGA 5HLGA 5H6QA 2IA1A 5D5WB 3FXUA 4EGYA 2EFOA 1U5TA 1HBXG 3V7SA 3O2PE 4BAYA 1F1ZA 3RKWA 3MAJA 5CVJA 4BH9A 1FBSA 3WTWC 1BI2A 1FLIA 2IPQX 2VBWA 3HIFA 5CJ9A 2F5DA 3KP6A 1JHFA 3FXQA 2K4BA 1AOYA 2GA1A 2BEOA 3DV8A 1J0RA 5DUIA 3C1DA 4L5JA 2P5KA 4M74A 5K5QA 2FBHA 5ILVA 5L3EA 2UXXA 2A5YB 1U5TC 4MHGA 3F8MA 2UXNA 1LEBA 3G73A 4ZYGA 4HV5A 2DTRA 1X3UA 5CVRA 5IT9K 2Y48A 5DUKA 1QQIA 5JVTA 3C3WA 1I6XA 2YR2A 4AVPA 1IN4A 3KZYA 4UNOA 1SFXA 2L4AA 4P55A 2DAOA 2D45A 3HTUA 5DYMA 1K7AA 3F8FA 3FWEA 4FX4A 1DP7P 2FRHA 2Y75A 3GO5A 4L0YB 3M9AA 2KIMA 4LLLA 1XDUA 2J5PA 4M6XA 4RB2C 4EQQA 5K1YA 4LD5A 1XD7A 2O8XA 2VXZA 2K4JA 4A0ZA 3WTVC 3KP3A 1ZRCA 2VC1A 1XSDA 2P5VA 2JPBA 3ZN1A 2LNBA 4NQWA 4LGWA 3ZPLA 2IP2A 2P6TA 3T8RA 3I5UA 6PAXA 3TGNA 1FZPB 5F6FA 3ZMDA 1IN7A 4R1HA 2XGXA 1FX7A 5CVVA 2AXLA 3O3KA 4LJZF 2WTEA 4RAYA 1SAXA 2XAJA 1RUOA 2EFPA 4M73A 3BP8A 2X0LA 3GZ5A 1S3JA 2DQLA 5CVIA 2FEZA 4I09A 1WWXA 2V1UA 1REPC 3IRQA 2FQ3A 4A5NA 1QBJA 4M9XA 2HKOA 5HS7A 2QVOA 3REOA 1BI1A 4N9HA 2HYGD 5L3FA 1IZ1A 2ISZA 2Z9OA 1OYWA 3WODF 5FLXK 1UB9A 3JAMZ 5HVQC 4GXOA 2MLGA 4HX7A 4L9JA 4M72A 4HA8A 2IW5A 3ZMTA 3F23A 1QZZA 2RN7A 3WGHA 2W57A 4KN4X 1VTNC 5HOOA 1XSVA 4KUMA 3IL2A 3KEOA 1ZHFA 4HZFA 2K7LA 3N97A 2EJRA 3HTSB 1W5SA 2Y0MA 4RB3C 2G9WA 4P96A 1T0FA 2RNJA 3BWGA 4LLNA 4OINF 3E5XA 1P4XA 1R5GA 2EFQA 4WK8F 4HF2A 4PDKA 1ZAOA 1ZG5A 3K2ZA 4MEXF 1AWCA 3ECOA 2KIUA 5K5OA 2PMUA 4EM1A 2IVMA 5LGTA 3HOTA 4RGRA 5D5VB 1SFUA 2DI3A 1QZYA 1K79A 3RI4A 1LDDA 4PGGA 1O3TA 1I27A 1YW8A 2IT0A 1YTYA 2G7UA 3T5XA 2GAUA 3E5UA 5E8GA 2X4HA 4GGGA 4EM2A 1V3FA 3E6MA 4TV7A 5LEKA 1KYWA 4XLPF 2P8TA 1U8RA 2IJLA 3J80Z 3F72A 3IHUA 2AS5F 2RGVA 2F5CA 2E1CA 1LNWA 1H0MA 2R7DA 4HW0A 2LSOA 3H92A 1R5HA 5FD6A 2P7VB 2F5FA 4IHTA 2Z99A 3ABTA 3BJAA 4RGUA 1B9MA 1RZ4A 4FT8A 3NQOA 1YYVA 1KU9A 2MC3A 2DPUA 3I64A 1O3SA 4EMSA 4EJOA 1D8JA 1QPMA 3GYHX 2EFNA 5CLSA 4QLCU 4OOIA 4B8XA 3F8CA 3O6BB 1MJ9A 2D2WA 3GFMA 2XHKA 2M1BA 2VODA 3F8NA 1XCVA 1RIOH 5TJJA 2HWVA 1ZLKA 1YIOA 2FE3A 3HYIA 4CYDA 3ERED 2F5EA 4PCQA 1HSTA 1S7OA 2A3SA 3WTSC 1IN5A 2ZFWA 4XLNF 2FBKA 2GIVA 2HS5A 3LWFA 3ML6A 2A68F 1LDJA 1KGSA 1Z1DA 4WXDA 3RYRA 4I98B 1OYIA 4A2UA 1USTA 5LHIA 1T98A 5D8LB 3M1EA 1K78A 1YW7A 1C0WA 3RJPA 4KIGA 5D8KB 1O57A 1MJAA 4EJUA 4DQ2A 5DDGA 3RKYA 3B73A 5HDKA 1UHWA 4I01A 1TW3A 2O6GE 1FOKA 2DBBA 3ZMSA 5LLQA 1FBUA 2FMYA 1R36A 3DPTA 3KP4A 1J59A 3P7NA 2HKXA 3NEUA 1Z9CA 3L2CA 4EM0B 4AIKA 2XUBA 5TRDA 2QBYA 2ZMEA 4M71A 1GXQA 1K6OA 1Z91A 1ONVA 3HRSA 2DQRA 4HDVA 1HXDA 2UZKA 1FYMA 3IWZA 1F5TA 4ETSA 2V6CA 4AWXB 3DXJF 2H94A 1FYLA 2DK8A 1TNTA 5E1XA 5D5XB 5E18F 4A5MA 3V7CA 4Q5SF 4RAZA 1RI7A 3MQ0A 2ACJA 2OQGA 2FF4A 2L4MA 4IF4A 5ICGA 1IRFA 3J81Z 1G4DA 2E7WA 3SQNA 4B09A 1XMAA 4IVNA 2H6CA 3P9CA 3ZMVA 4G6DA 1TQPA 1QO0D 2HR3A 3U9GA 4HF0A 1J7KA 2QWWA 1JGSA 3LAPA 1ZGJA 3QPTA 5HDNA 4KFCA 2K02A 4G8XA 3VODA 1JE8A 4A6DA 3GX4X 5D6EA 5ILUA 4Q48A 5HDGA 3M8FA 3JW4A 1D8KA 1YW9A 3KP2A 3TDUC 5E20A 3TOAA 1I1GA 2ZNZA 3KP7A 4KDPA 1YFHA 1WSUA 3CUQC 1S7AA 2QBYB 5LRRA 2K86A 1OR7A 1MGTA 3HRTA 2EFWA 3F22A 3ROUA 2DU9A 1TBXA 3WTUC 3L9FA 2BBYA 2HYFA 4IXAA 4WF2A 1MDMA 1IF1A 3N4MA 2XASA 2MLKA 1MJBA 3TO6A 1FY7A 3COAC 4I0AA 3ZMZA 5HLHA 2VT3A 3P9IA 4HX8A 1ZN2A 1G3TA 2L3DA 1P4WA 2ZMEB 5J8CA 3KP5A 2Z33A 3V4GA 1FNNA 2VOPA 1HSJA 4UVAA 3BPVA 4YFKF 4MNUA 3ECHA 1MKMA 1B6AA 3JSOA 1J5YA 4A0XA 3ULQB 4ESFA 4DNCA 1YG2A 4EJVA 2CSOA 1WRJA 5IT3A 3K1NA 4OU0A 3V8JA 1R23A 1EH7A 1FP2A 2QUFA 4HAMA 3GFIA 2DO7A 1PUEE 3WU0A 5K5RA 4D0PA 4GCVA 1BM9A 2PMHA 2ESNA 5F1RA 2PEXA 2ZO4A 2JT1A 1LB2A 2JZYA 4R79A 4XSXF 2OZUA 4UVBA 1FP1D 3BOQA 5LHHA 1HKTA 5H20A 3SXYA 1CGPA 4XSZF 1JHHA 4Z2YA 4G6QA 3RYPA 4AD9A 3WTXC 4AIJA 3I71A 3E6BA 1FSHA 5AIPA 3Q9VA 1PDNC 4EGZA 4BHPA 3FMQA 2O0YA 3QPHA 4WWCA 2EK5A 3HSFA 3BJ6A 4GO1A 5KVRA 2KRFA 3C18A 1HW5A 1SD5A 1TTYA 2FBIA 2P5LC 1TLHB 5BPDA 3W6JB 1O7LA 3WG9A 1UFMA 2OD5A 1B9NA 4U7DA 3F6VA 1I5ZA 2A69F 5AONA 3PFIA 3DPLC 1S29A 2K27A 2FNAA 4N0BA 2V79A 3EQLF 3HSRA 2RV8A 3KE2A 4RB0A 3GFLA 1U78A 2P4WA 2XRNA 4LG0B 3QU6A 4HBLA 5AIQA 1T38A 3MEXA 1YQAA 2MBFA 5ICFA 5J8FA 3K0LA 3WTYC 3IKTA 3L7WA 2DK5A 1H9TA 3MWMA 4RB1A 3KEQA 5E8IA 1GVJA 5DEQA 5HLIA 4KN7X 2NS0A 2P6SA 4QWQA 1G3YA 2RKHA 4LK0F 1G3WA 3HRUA 5ICEA 2FMLA 3GW2A 3I54A 2O3FA 1WQ2A 2GXBA 4EJTA 2CYYA 1IAWA 1R7JA 2VE9A 1CF7B 1FWZA 1ON1A 5E17F 3GXOA 1D3YA 4G7HF 5H6RA 5DCMB 3DQVC 4S04A 2ETHA 5BMZA 2COMA 4EV0A 3I58A 5DCFA 2PJPA 2JRTA 3R60A 2XKPA 3CDHA 2ZCWA 5BQTA 4PZJA 3FF5A 1R1TA 3LSTA 1DDNA 1DUXC 1ULYA 1E2XA 3SHFA 2J5OA 3ZQ7A 2XVCA 1ZLJA 2ZKZA 5BS6A 1KU7A 5EEGA 4JBAA 1TQIA 3I0TA 3E3VA 1BJAA 3B02A 2YPRA 5L3DA 2HQNA 2F2EA 5FFZA 4MQ9F 4Q47A 3U1DA 4F7ZA 5BPIA 1QNTA 3OV8A 5JR3A 1Z05A 3H3UA 4KYWA 4AIHA 3C7JA 4IHSA 4ZYEA 4HOBA 2EA2A 3J80K 1L0OC 4EVIA 1SFEA 3HSEA 4U88A 4M9ZA 2QQBA 4ESBA 4A6EA 3U2RA 4ENJA 2LKPA 4CXFA 3GWZA 1WI9A 5E1ZB 2IRFG 3GLXA 3WE3A 4H0EA 3FX3A 4XBFA 2PN6A 3PQKA 4LK1F 2CQKA 4Q4ZF 3FZVA 1W7PD 1HKSA 1HW2A 2MD5A 3KFWX 1ZREA 2NNNA 1BIAA 2W85A 1SD4A 1SMTA 2HQRA 1GXPA 5LHGA 3S2WA 2PQ8A 1SD7A 2XAQA 1FT9A 2VBXA 1P92A 2LF8A 2QYOA 3GVAA 2LF7A 4MQVA 4HYEA 3BJOA 1R1VA 2KIFA 1IN6A 1U5TB 3FM5A 1T2KA 2ESHA 3KLNA 1U3EM 1ZGAA 2VONA 2QM3A 4MEYF 1ZG3A 2EA4A 3VOEA 3PQJA 2EV5A 2R3SA 4UXNA 2STWA 1O7FA 3JAMK 1EH8A 4OIOF 1D5VA 3FMSA 1HQCA 3DP7A 2D1VA 2L01A 5DD4A 2CWEA 3R0JA 1USSA 4ESJA 2BE5F 3GF2A 3IWFA 2GWRA 3I59A 2ZJ2A 1BI3A 2HFHA 3EUHA 4ENMA 4CDGA 2FNPA 4GYIA 1KQ9A 4U0VA 3DEUA 4EJWA 1P4AA 2LDUA 2M30A 3MCZA 3VFZA 1HW1A 1U6GA 4L0ZB 1F9NA 3SFZA 1SD6A 1XB4A 4ON0A 5JI6A 1XGSA 1S8NA 4KT5C 1FBQA 2MH2A 3ZN0A 2MA3A 2DT5A 1BOAA 1IXSB 3D5LA 2CW0F 5LEJA 4ENNA 2P7CB 2R7FA 4ZZLA 1XGOA 5JHUA 3LA2A 4NHJA 4CICA 3J7AO 4MTDA 2QLZA 4WCGA 3DKWA 2EWNA 1MD0A 3CUOA 4LB6B 3F21A 1XGMA 1JXSA 3TO7A 2Z3YA 3GEZA 4XRFA 4ENKA 2OBPA 3MZHA 4NB5A 1I1SA 1J75A 2XAHA 2XV4S 3CUQB 2A6EF 5E1WA 3EDPA 2GQQA 4A0YA 2CG4A 2E7XA 3FMRA 2PBIA 3RTRA 2O61A 5BOXA 4GYGA 4UUVA 3ABUA 3T0YA 4BHCA 2V1DA 5CVUA 5LBQA 2BYVE 2Q2EA 5ILSA 4P5OA 5HS8A 4ZH4F 2HGCA 4YIIA 4ASNA 2BGCA 4OIQF 3E6DA 1BI0A 5LGNA 4K2EA 1OYYA 2RDPA 3QP6A 1KA8A 3WE2A 2JSCA 2UWMA 1P6RA 1GHCA 2H09A 1BC8C 2QQAA 3L09A 2OU2A 3R6SA 3ELKA 1T6SA 4LFUA 3W6KB 3V8KA 2CFXA 4Y15A 3KETA 1IRGA 2DLLA 3HOSA 3VEPA 3QU3A 2MH9A 3HHHA 3CJNA 5F64A 1YLFA 2ZNYA 2DW4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1NHA A;  3I53 A;  4L5I A;  2JTV A;  4YG2 F;  3AAF A;  2FXA A;  4YIF A;  4IRI A;  1ZH5 A;  2O03 A;  1O3Q A;  5FO5 A;  4A12 A;  4KIC A;  3EET A;  5A2Q Z;  2KJC A;  3JSP A;  2ADU A;  1FSE A;  3JTG A;  4O3M A;  2A6H F;  2WWY A;  4CGZ A;  4LLG F;  1R00 A;  3WTZ A;  2Q0O A;  1PP7 U;  1OMI A;  1J2X A;  2FA5 A;  5LRS A;  2H27 A;  4RGX A;  2EV6 A;  4HLY A;  4I7H A;  4HX4 A;  2M8E A;  1E17 A;  4IPA A;  1MDM B;  1OKR A;  2DPD A;  1FC3 A;  3BRO A;  5ED4 A;  1KQ8 A;  3LA7 A;  4OIP F;  4P9F A;  3T1B A;  3R0A A;  4FHT A;  2VBY A;  3BPX A;  1XMK A;  4OMY A;  3HUG A;  2M5W A;  3VB2 A;  3K9T A;  2YU3 A;  1KU3 A;  2QQ9 A;  3FHZ A;  2RQP A;  2ZBK A;  3M7G A;  2HOE A;  1ON2 A;  4IRH A;  3HRM A;  4BXU A;  1W7P A;  3MZY A;  3IC7 A;  1LQ1 A;  2W24 A;  4N9I A;  4M6Y A;  2EB7 A;  1BC7 C;  4BHB A;  3NRV A;  5IT9 Z;  4R8H A;  1Z6R A;  2L02 A;  2NNY A;  3P9K A;  5FD5 A;  2VC0 A;  3BY6 A;  1U2W A;  3FM3 A;  4MTE A;  3RDI A;  3V8L A;  2YX7 A;  3R4K A;  4RGS A;  2D1H A;  3Q9S A;  2CGP A;  4G7Z F;  3KCC A;  4BYY A;  1L3L A;  4I02 A;  2DFI A;  3WU1 B;  3R61 A;  1XDS A;  1IXC A;  1F4K A;  3CO6 C;  1DPR A;  3SZT A;  3RPU A;  5DCM A;  5HS9 A;  3BDD A;  2GA2 A;  2XIG A;  2KJB A;  2BV6 A;  3LQQ A;  3FXR A;  1W7P B;  1KU2 A;  1LDK B;  1ZRF A;  1J9I A;  4UVC A;  4G9Y A;  3LA3 A;  3ZP5 A;  4I2O A;  2GZW A;  4KMU X;  3GZ6 A;  1K78 B;  3HHG A;  1OPC A;  4CHU A;  3IKV A;  3SZP A;  1R1U A;  3IRR A;  3TO9 A;  2HTS A;  4L18 B;  3K69 A;  2V1X A;  1Y0U A;  1EH6 A;  4HQM A;  4KIF A;  1B4A A;  4ZYD A;  3TQN A;  1BN5 A;  2A07 F;  1A04 A;  4JK1 X;  4M9S A;  1ODD A;  2FSW A;  3MFK A;  3RIR A;  2ISY A;  2NYX A;  4IJA A;  5EEH A;  1CF7 A;  3E97 A;  1T39 A;  2C6Y A;  5D4R A;  1LEA A;  1Z7U A;  4L9V A;  2VN2 A;  3TKY A;  3QP5 A;  2HTJ A;  3F3X A;  2ZXJ A;  1IXR C;  5FFX A;  3M8E A;  3RKX A;  3E5Q A;  1FYK A;  2FOK A;  2RVC A;  2PFB A;  1KYZ A;  5FB2 A;  1B59 A;  2XRO A;  2M45 A;  2W25 A;  3K1P A;  2G7H A;  5KK1 A;  5L3B A;  2HEO A;  2FU4 A;  2Q8K A;  3CTA A;  4U0Y A;  2VE8 A;  1LJ9 A;  3ISP A;  1TW2 A;  3D0S A;  5DV5 A;  3CUQ A;  2TDX A;  4LG0 A;  4UV8 A;  1IW7 F;  1XCB A;  4HDU A;  1UCR A;  4Y17 A;  3QRF F;  3KLO A;  2GXG A;  4UHT A;  4O5V A;  5D5U B;  3TDZ C;  2OAZ A;  4LB5 A;  5D6F A;  4WXC A;  1ZYR F;  3JTH A;  4U0W A;  2WC2 A;  1QGP A;  1YS6 A;  5J6X A;  2STT A;  4BNC A;  2OQR A;  2QZ8 A;  4LMY A;  4I0B A;  3GFJ A;  5FLX Z;  4JQF A;  4CZZ A;  3V7R A;  1PP8 F;  3WTT C;  4ZYH A;  4ZZD A;  3F8B A;  2A61 A;  1BIB A;  4WXH A;  3L00 A;  4YFX F;  4KA4 A;  3RPQ A;  1ZRD A;  2PG4 A;  3EYY A;  2PLY A;  5FGM A;  2VT2 A;  3OOP A;  3E6C C;  5A2Q K;  5L3C A;  3CO7 C;  2W84 A;  4HLX A;  3WGG A;  4S05 A;  3ZMU A;  1MZB A;  1STZ A;  2HDC A;  1G3S A;  3DFG A;  2M87 A;  1Q1H A;  4HF1 A;  1WKM A;  5JFR A;  1O3R A;  2H6B A;  3T8T A;  3G3Z A;  1XSX A;  4E70 A;  3LQR A;  1ZAR A;  3I4P A;  1EV7 A;  3EYI A;  1XN7 A;  1YS7 A;  4WX9 A;  1R22 A;  3QOP A;  4O6J A;  2YX4 A;  4KMF A;  4OMZ A;  1B1B A;  4RS8 A;  2CO5 A;  1LVA A;  1G6N A;  2IA2 A;  2OZ6 A;  1W4M A;  2QEN A;  1ZG1 A;  1HKQ A;  5D4S A;  4U7B A;  3Q5F A;  4HV6 A;  2L54 A;  4YFN F;  4G94 A;  4L9N A;  2HZT A;  4MGR A;  4KIB A;  4L9T A;  1FPQ A;  1IN8 A;  3LAJ A;  2WV0 A;  3I59 B;  1DPU A;  1S6L A;  2EV0 A;  4CO8 A;  4FX0 A;  3K1M A;  1R58 A;  3BZ6 A;  1Z6T A;  4UV9 A;  2E1N A;  4P9U A;  3J81 K;  2KKO A;  4KNY A;  4HQE A;  4PGH A;  2YSR A;  1SMY F;  2OA4 A;  3KZZ A;  5ICC A;  2B0L A;  4G7O F;  2JPC A;  5DD8 A;  4BQA A;  3LFK A;  4OIR F;  2NRA C;  3CLO A;  3WGI A;  1XGN A;  3H3Z A;  1TNS A;  2IA0 A;  2XAF A;  2XKO A;  2V9V A;  2VBZ A;  2XAG A;  3DF8 A;  2NAZ A;  1V4R A;  1IUY A;  2ELH A;  1H9G A;  5ERI A;  2VOO A;  3QAH A;  2Z5U A;  1BBY A;  1TQM A;  5L3G A;  1P2F A;  1RNL A;  4Y13 A;  2PI0 A;  3TOB A;  5LGU A;  1YO5 C;  1UHM A;  3F6O A;  1KQ0 A;  1RUN A;  3GUD A;  1W5T A;  2RC4 A;  5CYV A;  4IRG A;  5HLG A;  5H6Q A;  2IA1 A;  5D5W B;  3FXU A;  4EGY A;  2EFO A;  1U5T A;  1HBX G;  3V7S A;  3O2P E;  4BAY A;  1F1Z A;  3RKW A;  3MAJ A;  5CVJ A;  4BH9 A;  1FBS A;  3WTW C;  1BI2 A;  1FLI A;  2IPQ X;  2VBW A;  3HIF A;  5CJ9 A;  2F5D A;  3KP6 A;  1JHF A;  3FXQ A;  2K4B A;  1AOY A;  2GA1 A;  2BEO A;  3DV8 A;  1J0R A;  5DUI A;  3C1D A;  4L5J A;  2P5K A;  4M74 A;  5K5Q A;  2FBH A;  5ILV A;  5L3E A;  2UXX A;  2A5Y B;  1U5T C;  4MHG A;  3F8M A;  2UXN A;  1LEB A;  3G73 A;  4ZYG A;  4HV5 A;  2DTR A;  1X3U A;  5CVR A;  5IT9 K;  2Y48 A;  5DUK A;  1QQI A;  5JVT A;  3C3W A;  1I6X A;  2YR2 A;  4AVP A;  1IN4 A;  3KZY A;  4UNO A;  1SFX A;  2L4A A;  4P55 A;  2DAO A;  2D45 A;  3HTU A;  5DYM A;  1K7A A;  3F8F A;  3FWE A;  4FX4 A;  1DP7 P;  2FRH A;  2Y75 A;  3GO5 A;  4L0Y B;  3M9A A;  2KIM A;  4LLL A;  1XDU A;  2J5P A;  4M6X A;  4RB2 C;  4EQQ A;  5K1Y A;  4LD5 A;  1XD7 A;  2O8X A;  2VXZ A;  2K4J A;  4A0Z A;  3WTV C;  3KP3 A;  1ZRC A;  2VC1 A;  1XSD A;  2P5V A;  2JPB A;  3ZN1 A;  2LNB A;  4NQW A;  4LGW A;  3ZPL A;  2IP2 A;  2P6T A;  3T8R A;  3I5U A;  6PAX A;  3TGN A;  1FZP B;  5F6F A;  3ZMD A;  1IN7 A;  4R1H A;  2XGX A;  1FX7 A;  5CVV A;  2AXL A;  3O3K A;  4LJZ F;  2WTE A;  4RAY A;  1SAX A;  2XAJ A;  1RUO A;  2EFP A;  4M73 A;  3BP8 A;  2X0L A;  3GZ5 A;  1S3J A;  2DQL A;  5CVI A;  2FEZ A;  4I09 A;  1WWX A;  2V1U A;  1REP C;  3IRQ A;  2FQ3 A;  4A5N A;  1QBJ A;  4M9X A;  2HKO A;  5HS7 A;  2QVO A;  3REO A;  1BI1 A;  4N9H A;  2HYG D;  5L3F A;  1IZ1 A;  2ISZ A;  2Z9O A;  1OYW A;  3WOD F;  5FLX K;  1UB9 A;  3JAM Z;  5HVQ C;  4GXO A;  2MLG A;  4HX7 A;  4L9J A;  4M72 A;  4HA8 A;  2IW5 A;  3ZMT A;  3F23 A;  1QZZ A;  2RN7 A;  3WGH A;  2W57 A;  4KN4 X;  1VTN C;  5HOO A;  1XSV A;  4KUM A;  3IL2 A;  3KEO A;  1ZHF A;  4HZF A;  2K7L A;  3N97 A;  2EJR A;  3HTS B;  1W5S A;  2Y0M A;  4RB3 C;  2G9W A;  4P96 A;  1T0F A;  2RNJ A;  3BWG A;  4LLN A;  4OIN F;  3E5X A;  1P4X A;  1R5G A;  2EFQ A;  4WK8 F;  4HF2 A;  4PDK A;  1ZAO A;  1ZG5 A;  3K2Z A;  4MEX F;  1AWC A;  3ECO A;  2KIU A;  5K5O A;  2PMU A;  4EM1 A;  2IVM A;  5LGT A;  3HOT A;  4RGR A;  5D5V B;  1SFU A;  2DI3 A;  1QZY A;  1K79 A;  3RI4 A;  1LDD A;  4PGG A;  1O3T A;  1I27 A;  1YW8 A;  2IT0 A;  1YTY A;  2G7U A;  3T5X A;  2GAU A;  3E5U A;  5E8G A;  2X4H A;  4GGG A;  4EM2 A;  1V3F A;  3E6M A;  4TV7 A;  5LEK A;  1KYW A;  4XLP F;  2P8T A;  1U8R A;  2IJL A;  3J80 Z;  3F72 A;  3IHU A;  2AS5 F;  2RGV A;  2F5C A;  2E1C A;  1LNW A;  1H0M A;  2R7D A;  4HW0 A;  2LSO A;  3H92 A;  1R5H A;  5FD6 A;  2P7V B;  2F5F A;  4IHT A;  2Z99 A;  3ABT A;  3BJA A;  4RGU A;  1B9M A;  1RZ4 A;  4FT8 A;  3NQO A;  1YYV A;  1KU9 A;  2MC3 A;  2DPU A;  3I64 A;  1O3S A;  4EMS A;  4EJO A;  1D8J A;  1QPM A;  3GYH X;  2EFN A;  5CLS A;  4QLC U;  4OOI A;  4B8X A;  3F8C A;  3O6B B;  1MJ9 A;  2D2W A;  3GFM A;  2XHK A;  2M1B A;  2VOD A;  3F8N A;  1XCV A;  1RIO H;  5TJJ A;  2HWV A;  1ZLK A;  1YIO A;  2FE3 A;  3HYI A;  4CYD A;  3ERE D;  2F5E A;  4PCQ A;  1HST A;  1S7O A;  2A3S A;  3WTS C;  1IN5 A;  2ZFW A;  4XLN F;  2FBK A;  2GIV A;  2HS5 A;  3LWF A;  3ML6 A;  2A68 F;  1LDJ A;  1KGS A;  1Z1D A;  4WXD A;  3RYR A;  4I98 B;  1OYI A;  4A2U A;  1UST A;  5LHI A;  1T98 A;  5D8L B;  3M1E A;  1K78 A;  1YW7 A;  1C0W A;  3RJP A;  4KIG A;  5D8K B;  1O57 A;  1MJA A;  4EJU A;  4DQ2 A;  5DDG A;  3RKY A;  3B73 A;  5HDK A;  1UHW A;  4I01 A;  1TW3 A;  2O6G E;  1FOK A;  2DBB A;  3ZMS A;  5LLQ A;  1FBU A;  2FMY A;  1R36 A;  3DPT A;  3KP4 A;  1J59 A;  3P7N A;  2HKX A;  3NEU A;  1Z9C A;  3L2C A;  4EM0 B;  4AIK A;  2XUB A;  5TRD A;  2QBY A;  2ZME A;  4M71 A;  1GXQ A;  1K6O A;  1Z91 A;  1ONV A;  3HRS A;  2DQR A;  4HDV A;  1HXD A;  2UZK A;  1FYM A;  3IWZ A;  1F5T A;  4ETS A;  2V6C A;  4AWX B;  3DXJ F;  2H94 A;  1FYL A;  2DK8 A;  1TNT A;  5E1X A;  5D5X B;  5E18 F;  4A5M A;  3V7C A;  4Q5S F;  4RAZ A;  1RI7 A;  3MQ0 A;  2ACJ A;  2OQG A;  2FF4 A;  2L4M A;  4IF4 A;  5ICG A;  1IRF A;  3J81 Z;  1G4D A;  2E7W A;  3SQN A;  4B09 A;  1XMA A;  4IVN A;  2H6C A;  3P9C A;  3ZMV A;  4G6D A;  1TQP A;  1QO0 D;  2HR3 A;  3U9G A;  4HF0 A;  1J7K A;  2QWW A;  1JGS A;  3LAP A;  1ZGJ A;  3QPT A;  5HDN A;  4KFC A;  2K02 A;  4G8X A;  3VOD A;  1JE8 A;  4A6D A;  3GX4 X;  5D6E A;  5ILU A;  4Q48 A;  5HDG A;  3M8F A;  3JW4 A;  1D8K A;  1YW9 A;  3KP2 A;  3TDU C;  5E20 A;  3TOA A;  1I1G A;  2ZNZ A;  3KP7 A;  4KDP A;  1YFH A;  1WSU A;  3CUQ C;  1S7A A;  2QBY B;  5LRR A;  2K86 A;  1OR7 A;  1MGT A;  3HRT A;  2EFW A;  3F22 A;  3ROU A;  2DU9 A;  1TBX A;  3WTU C;  3L9F A;  2BBY A;  2HYF A;  4IXA A;  4WF2 A;  1MDM A;  1IF1 A;  3N4M A;  2XAS A;  2MLK A;  1MJB A;  3TO6 A;  1FY7 A;  3COA C;  4I0A A;  3ZMZ A;  5HLH A;  2VT3 A;  3P9I A;  4HX8 A;  1ZN2 A;  1G3T A;  2L3D A;  1P4W A;  2ZME B;  5J8C A;  3KP5 A;  2Z33 A;  3V4G A;  1FNN A;  2VOP A;  1HSJ A;  4UVA A;  3BPV A;  4YFK F;  4MNU A;  3ECH A;  1MKM A;  1B6A A;  3JSO A;  1J5Y A;  4A0X A;  3ULQ B;  4ESF A;  4DNC A;  1YG2 A;  4EJV A;  2CSO A;  1WRJ A;  5IT3 A;  3K1N A;  4OU0 A;  3V8J A;  1R23 A;  1EH7 A;  1FP2 A;  2QUF A;  4HAM A;  3GFI A;  2DO7 A;  1PUE E;  3WU0 A;  5K5R A;  4D0P A;  4GCV A;  1BM9 A;  2PMH A;  2ESN A;  5F1R A;  2PEX A;  2ZO4 A;  2JT1 A;  1LB2 A;  2JZY A;  4R79 A;  4XSX F;  2OZU A;  4UVB A;  1FP1 D;  3BOQ A;  5LHH A;  1HKT A;  5H20 A;  3SXY A;  1CGP A;  4XSZ F;  1JHH A;  4Z2Y A;  4G6Q A;  3RYP A;  4AD9 A;  3WTX C;  4AIJ A;  3I71 A;  3E6B A;  1FSH A;  5AIP A;  3Q9V A;  1PDN C;  4EGZ A;  4BHP A;  3FMQ A;  2O0Y A;  3QPH A;  4WWC A;  2EK5 A;  3HSF A;  3BJ6 A;  4GO1 A;  5KVR A;  2KRF A;  3C18 A;  1HW5 A;  1SD5 A;  1TTY A;  2FBI A;  2P5L C;  1TLH B;  5BPD A;  3W6J B;  1O7L A;  3WG9 A;  1UFM A;  2OD5 A;  1B9N A;  4U7D A;  3F6V A;  1I5Z A;  2A69 F;  5AON A;  3PFI A;  3DPL C;  1S29 A;  2K27 A;  2FNA A;  4N0B A;  2V79 A;  3EQL F;  3HSR A;  2RV8 A;  3KE2 A;  4RB0 A;  3GFL A;  1U78 A;  2P4W A;  2XRN A;  4LG0 B;  3QU6 A;  4HBL A;  5AIQ A;  1T38 A;  3MEX A;  1YQA A;  2MBF A;  5ICF A;  5J8F A;  3K0L A;  3WTY C;  3IKT A;  3L7W A;  2DK5 A;  1H9T A;  3MWM A;  4RB1 A;  3KEQ A;  5E8I A;  1GVJ A;  5DEQ A;  5HLI A;  4KN7 X;  2NS0 A;  2P6S A;  4QWQ A;  1G3Y A;  2RKH A;  4LK0 F;  1G3W A;  3HRU A;  5ICE A;  2FML A;  3GW2 A;  3I54 A;  2O3F A;  1WQ2 A;  2GXB A;  4EJT A;  2CYY A;  1IAW A;  1R7J A;  2VE9 A;  1CF7 B;  1FWZ A;  1ON1 A;  5E17 F;  3GXO A;  1D3Y A;  4G7H F;  5H6R A;  5DCM B;  3DQV C;  4S04 A;  2ETH A;  5BMZ A;  2COM A;  4EV0 A;  3I58 A;  5DCF A;  2PJP A;  2JRT A;  3R60 A;  2XKP A;  3CDH A;  2ZCW A;  5BQT A;  4PZJ A;  3FF5 A;  1R1T A;  3LST A;  1DDN A;  1DUX C;  1ULY A;  1E2X A;  3SHF A;  2J5O A;  3ZQ7 A;  2XVC A;  1ZLJ A;  2ZKZ A;  5BS6 A;  1KU7 A;  5EEG A;  4JBA A;  1TQI A;  3I0T A;  3E3V A;  1BJA A;  3B02 A;  2YPR A;  5L3D A;  2HQN A;  2F2E A;  5FFZ A;  4MQ9 F;  4Q47 A;  3U1D A;  4F7Z A;  5BPI A;  1QNT A;  3OV8 A;  5JR3 A;  1Z05 A;  3H3U A;  4KYW A;  4AIH A;  3C7J A;  4IHS A;  4ZYE A;  4HOB A;  2EA2 A;  3J80 K;  1L0O C;  4EVI A;  1SFE A;  3HSE A;  4U88 A;  4M9Z A;  2QQB A;  4ESB A;  4A6E A;  3U2R A;  4ENJ A;  2LKP A;  4CXF A;  3GWZ A;  1WI9 A;  5E1Z B;  2IRF G;  3GLX A;  3WE3 A;  4H0E A;  3FX3 A;  4XBF A;  2PN6 A;  3PQK A;  4LK1 F;  2CQK A;  4Q4Z F;  3FZV A;  1W7P D;  1HKS A;  1HW2 A;  2MD5 A;  3KFW X;  1ZRE A;  2NNN A;  1BIA A;  2W85 A;  1SD4 A;  1SMT A;  2HQR A;  1GXP A;  5LHG A;  3S2W A;  2PQ8 A;  1SD7 A;  2XAQ A;  1FT9 A;  2VBX A;  1P92 A;  2LF8 A;  2QYO A;  3GVA A;  2LF7 A;  4MQV A;  4HYE A;  3BJO A;  1R1V A;  2KIF A;  1IN6 A;  1U5T B;  3FM5 A;  1T2K A;  2ESH A;  3KLN A;  1U3E M;  1ZGA A;  2VON A;  2QM3 A;  4MEY F;  1ZG3 A;  2EA4 A;  3VOE A;  3PQJ A;  2EV5 A;  2R3S A;  4UXN A;  2STW A;  1O7F A;  3JAM K;  1EH8 A;  4OIO F;  1D5V A;  3FMS A;  1HQC A;  3DP7 A;  2D1V A;  2L01 A;  5DD4 A;  2CWE A;  3R0J A;  1USS A;  4ESJ A;  2BE5 F;  3GF2 A;  3IWF A;  2GWR A;  3I59 A;  2ZJ2 A;  1BI3 A;  2HFH A;  3EUH A;  4ENM A;  4CDG A;  2FNP A;  4GYI A;  1KQ9 A;  4U0V A;  3DEU A;  4EJW A;  1P4A A;  2LDU A;  2M30 A;  3MCZ A;  3VFZ A;  1HW1 A;  1U6G A;  4L0Z B;  1F9N A;  3SFZ A;  1SD6 A;  1XB4 A;  4ON0 A;  5JI6 A;  1XGS A;  1S8N A;  4KT5 C;  1FBQ A;  2MH2 A;  3ZN0 A;  2MA3 A;  2DT5 A;  1BOA A;  1IXS B;  3D5L A;  2CW0 F;  5LEJ A;  4ENN A;  2P7C B;  2R7F A;  4ZZL A;  1XGO A;  5JHU A;  3LA2 A;  4NHJ A;  4CIC A;  3J7A O;  4MTD A;  2QLZ A;  4WCG A;  3DKW A;  2EWN A;  1MD0 A;  3CUO A;  4LB6 B;  3F21 A;  1XGM A;  1JXS A;  3TO7 A;  2Z3Y A;  3GEZ A;  4XRF A;  4ENK A;  2OBP A;  3MZH A;  4NB5 A;  1I1S A;  1J75 A;  2XAH A;  2XV4 S;  3CUQ B;  2A6E F;  5E1W A;  3EDP A;  2GQQ A;  4A0Y A;  2CG4 A;  2E7X A;  3FMR A;  2PBI A;  3RTR A;  2O61 A;  5BOX A;  4GYG A;  4UUV A;  3ABU A;  3T0Y A;  4BHC A;  2V1D A;  5CVU A;  5LBQ A;  2BYV E;  2Q2E A;  5ILS A;  4P5O A;  5HS8 A;  4ZH4 F;  2HGC A;  4YII A;  4ASN A;  2BGC A;  4OIQ F;  3E6D A;  1BI0 A;  5LGN A;  4K2E A;  1OYY A;  2RDP A;  3QP6 A;  1KA8 A;  3WE2 A;  2JSC A;  2UWM A;  1P6R A;  1GHC A;  2H09 A;  1BC8 C;  2QQA A;  3L09 A;  2OU2 A;  3R6S A;  3ELK A;  1T6S A;  4LFU A;  3W6K B;  3V8K A;  2CFX A;  4Y15 A;  3KET A;  1IRG A;  2DLL A;  3HOS A;  3VEP A;  3QU3 A;  2MH9 A;  3HHH A;  3CJN A;  5F64 A;  1YLF A;  2ZNY A;  2DW4 A; 
#chains in the Genus database with same CATH topology
 1NHA A;  1UHS A;  3I53 A;  4L5I A;  2VKV A;  2JTV A;  4YG2 F;  3AAF A;  4XRM A;  2FXA A;  4YIF A;  4IRI A;  3K4L A;  1ZH5 A;  4C3H J;  3CC2 I;  3BG6 A;  2O03 A;  1O3Q A;  1RR7 A;  1B72 A;  3GME A;  4CCN A;  4BJT A;  2D5V A;  5FO5 A;  4A12 A;  1S5L C;  4KIC A;  1JJ6 C;  2CQQ A;  3EET A;  5A2Q Z;  1PUF B;  1APL C;  4LOC A;  1R49 A;  2XRL A;  1ETQ A;  2KJC A;  3JSP A;  2ADU A;  3FBI B;  3LNQ A;  1FSE A;  3JTG A;  4O3M A;  2A6H F;  1OCZ H;  1U8B A;  3SFI A;  4M3G A;  2E71 A;  4CCO A;  2WWY A;  1VI0 A;  2PJR B;  4GFB A;  4CGZ A;  2Y2Z A;  4LLG F;  1B8I A;  4J19 A;  3MD2 A;  2CQN A;  2KQR A;  1VND A;  3IV5 A;  4HNU A;  2LP0 A;  2BHZ A;  4C2U A;  1R00 A;  3N05 A;  3TMO A;  3L2U A;  2MG4 A;  3WTZ A;  3AG3 H;  2Q0O A;  1W1W E;  4XKW A;  1OMI A;  1PP7 U;  1IV6 A;  1J2X A;  2FA5 A;  2NS8 A;  2BW3 B;  5LRS A;  3FDY A;  4RGX A;  2EV6 A;  4HLY A;  1WHU A;  2H27 A;  2RNG A;  1BOB A;  4I7H A;  2Y69 H;  4HX4 A;  2HOS A;  2M8E A;  4V19 K;  1E17 A;  4IPA A;  1MDM B;  4J00 A;  1OKR A;  2A05 A;  1ORK A;  2VPL A;  3HOY J;  3K4C A;  2DPD A;  4ZC3 A;  1FC3 A;  3BRO A;  2LFB A;  5ED4 A;  2W7N A;  3VSL A;  3F0C A;  3HGG A;  3CCY A;  4QIW N;  4B47 A;  1KQ8 A;  3LA7 A;  4OIP F;  3FIW A;  4P9F A;  3T1B A;  3R0A A;  4KJZ A;  4FHT A;  2VBY A;  4N4O B;  3BPX A;  1DGW Y;  3IP4 B;  4HEA 2;  1YIJ I;  5KCM A;  1XMK A;  2DXI A;  4OMY A;  3HUG A;  1TC3 C;  3ONQ A;  1G2H A;  1WI3 A;  2M5W A;  3VB2 A;  3K9T A;  3G2B A;  5IYC J;  4EEF G;  2EIN H;  2YU3 A;  1KU3 A;  2QQ9 A;  3FHZ A;  1MW7 A;  1OCO H;  2RQP A;  2ZBK A;  5C44 J;  3M7G A;  2HOE A;  1ON2 A;  4DYC A;  4BQN A;  1BR2 A;  3K4B A;  4RDU A;  4IRH A;  4QPO A;  4BJ5 C;  3HRM A;  4BXU A;  1W7P A;  1E0E A;  3UR3 C;  3MZY A;  5F0H A;  1FIA A;  4LIT A;  5FRM A;  3IC7 A;  1LQ1 A;  2W24 A;  4N9I A;  4M6Y A;  2ZXH A;  2EB7 A;  4S0H B;  1BC7 C;  1WJ5 A;  4BHB A;  1A36 A;  4KIT B;  3NRV A;  5IT9 Z;  4R8H A;  2R7Q A;  1Z6R A;  3OYN A;  2L02 A;  2LY1 A;  4NC8 A;  4E7K A;  2NNY A;  2OCE A;  3P9K A;  3K10 A;  5FD5 A;  2VC0 A;  2XDV A;  3BY6 A;  5EF6 A;  3CF2 A;  1U2W A;  2KLO A;  4BBR J;  3D5R C;  3FM3 A;  3TP0 A;  4MTE A;  1T33 A;  3RDI A;  3V8L A;  2ZC2 A;  2YX7 A;  3R4K A;  4HSR A;  3OYG A;  4RGS A;  5FJ8 J;  3DU5 A;  2D1H A;  3CD6 I;  3PUF A;  3Q9S A;  3CC7 I;  1G8X A;  2CGP A;  2CU7 A;  4KT6 A;  4G7Z F;  2XGC A;  4LIV A;  3KCC A;  4BYY A;  1L3L A;  4I02 A;  2DFI A;  2DA2 A;  4JX4 A;  4DYR A;  2NS7 A;  2VL8 A;  2O8K A;  3WU1 B;  2KIS A;  1S9H A;  5GTI C;  1YJ9 I;  2R7U A;  3R61 A;  1XDS A;  2ZXI A;  1IXC A;  1F4K A;  2R7Z J;  3CO6 C;  3MZ8 A;  5CPR B;  3VSK A;  1J09 A;  2L0K A;  2WY7 Q;  1DPR A;  3SZT A;  3RPU A;  5DCM A;  1MSE C;  2WAQ N;  1MMA A;  5HLT A;  1Z77 A;  5HS9 A;  1LKX A;  3BDD A;  2AQE A;  2GA2 A;  5IOZ A;  2JA8 J;  2XIG A;  2KJB A;  2Y31 A;  2BV6 A;  3LQQ A;  3MKL A;  4PJN A;  4M3F A;  3FXR A;  1W7P B;  1KU2 A;  2KP6 A;  1LDK B;  2HDW A;  3CCR I;  3ZCO A;  4F52 A;  1ZRF A;  1J9I A;  4UVC A;  4G9Y A;  3LA3 A;  3SEQ A;  4BEH B;  1NG7 A;  3ZP5 A;  3VYU B;  3H5R A;  5EZG A;  5K7H A;  4I2O A;  2GZW A;  4KMU X;  3GZ6 A;  1K78 B;  3K70 C;  3HHG A;  2QSF X;  2AHQ A;  1OPC A;  4F55 A;  2KDZ A;  4CHU A;  3IKV A;  3HUG B;  3SZP A;  1R1U A;  3IRR A;  3TO9 A;  1MIJ A;  2HTS A;  3HC7 A;  4FE4 A;  3A01 A;  4L18 B;  4CH7 A;  5F0C A;  3RKQ A;  3S1R J;  2DYR H;  2TRT A;  3KYC B;  3K69 A;  3QYB A;  3J7A Y;  2V1X A;  1FTZ A;  3CF5 F;  1Y0U A;  3SJM A;  3RCO A;  3ZQH A;  1ETX A;  3ZR8 X;  5LFA A;  1EH6 A;  1NH3 A;  1BL0 A;  3I4M J;  4JOM A;  4QSH A;  3HGY A;  4HQM A;  4KIF A;  2FJ1 A;  3LSI A;  4Y7N J;  1B4A A;  1VFC A;  4ZYD A;  3TQN A;  2G0E A;  1BN5 A;  2JA7 J;  1GUU A;  2NOJ B;  2A07 F;  1A04 A;  3DTK A;  1F36 A;  4JK1 X;  1ZEL A;  2L9N A;  4M9S A;  1ODD A;  2FSW A;  3MFK A;  3RIR A;  2ISY A;  1FOY A;  3K4N A;  1GT0 C;  2NYX A;  4IJA A;  3S32 A;  5EEH A;  4B1R A;  3ZQC A;  1CF7 A;  3E97 A;  3KYL A;  1T39 A;  2C6Y A;  5D4R A;  2ELJ A;  4UUS A;  4XIC A;  1LEA A;  1Z7U A;  2XPV A;  2VN2 A;  3H35 A;  4L9V A;  2MFZ A;  2VJJ A;  5EG0 B;  1Y0N A;  3TKY A;  3QP5 A;  2HTJ A;  3F3X A;  2ZXJ A;  1IXR C;  5FFX A;  1R4N B;  1JTX A;  1E3O C;  3M8E A;  3RKX A;  3E5Q A;  2FOK A;  1FYK A;  2RVC A;  2PFB A;  4MLO A;  1AHD P;  1KYZ A;  2X48 A;  5FB2 A;  1B59 A;  2XRO A;  3QYE A;  4ZTJ A;  2M45 A;  2W25 A;  3K1P A;  2G7H A;  5KK1 A;  2VB6 A;  3ZQL A;  5L3B A;  3ABM H;  2HEO A;  2FU4 A;  2Q8K A;  3CTA A;  4U0Y A;  2VE8 A;  1LJ9 A;  3ISP A;  1TW2 A;  2WY8 Q;  4AID A;  3D0S A;  5DV5 A;  3CUQ A;  2TDX A;  3I4N J;  4LG0 A;  1ZR2 A;  2R4G A;  4UV8 A;  3G4S I;  1IW7 F;  1GLN A;  1WFX A;  2DFE A;  3KEY A;  1XCB A;  4HDU A;  4B3X A;  2IGN A;  2DDA A;  1EF4 A;  1UCR A;  3S1Q J;  4Y17 A;  4IL6 C;  3S1M J;  3QRF F;  3AL0 C;  3KLO A;  2GXG A;  1WJE A;  2X6X A;  3Q0U A;  4MFE A;  4O5V A;  4UHT A;  5D5U B;  3TDZ C;  2HPI A;  2LVS A;  2OAZ A;  4D5F A;  4IHX A;  4LB5 A;  2KMU A;  5IPA A;  3DTE A;  5D6F A;  4WXC A;  4DIQ A;  1ZYR F;  3JTH A;  4U0W A;  2WC2 A;  1QGP A;  1YS6 A;  5J6X A;  4DJA A;  3AKZ A;  2STT A;  4BNC A;  2OQR A;  2QZ8 A;  4LMY A;  4A3J J;  4I0B A;  3GFJ A;  5FLX Z;  3FXJ A;  4JQF A;  3HKZ A;  4CZZ A;  2LBF B;  4BBS J;  3V7R A;  1PP8 F;  3ERM A;  3WTT C;  4ZYH A;  4ZZD A;  3F8B A;  2A61 A;  2V7F A;  1BIB A;  4WXH A;  3L00 A;  3G6E I;  4YFX F;  4KA4 A;  3RPQ A;  1ZRD A;  4XN3 A;  2PG4 A;  4BXX J;  3EYY A;  1VQK I;  5IYB J;  2PLY A;  4OWR B;  1POG A;  5FGM A;  4FTH A;  2VT2 A;  3OOP A;  5FKN A;  1XS9 A;  5DM7 F;  2IS2 A;  4D5C A;  3E6C C;  5A2Q K;  1IV8 A;  3BCB A;  4F91 B;  2GM4 A;  5L3C A;  3CO7 C;  2W84 A;  4HLX A;  1T56 A;  3WGG A;  4S05 A;  3ZMU A;  3CCM I;  1MZB A;  1STZ A;  3JRA A;  2HDC A;  1G3S A;  2V9K A;  3RQ4 A;  1JKQ C;  3DFG A;  2M87 A;  2JUC A;  1Q1H A;  3KYD B;  1TWA J;  3K4M A;  2X51 A;  1CQT A;  5GAH J;  4HF1 A;  2VXD A;  3QPL A;  2QKL B;  4XKC A;  2B7E A;  1WKM A;  5JFR A;  3OOU A;  1O3R A;  3TW7 A;  4E7L A;  2H6B A;  3T8T A;  3G3Z A;  1XSX A;  4E70 A;  4OAZ A;  3LQR A;  1JUM A;  3BR6 A;  1ZAR A;  3I4P A;  5F27 A;  1EV7 A;  3EYI A;  2EIK H;  1XN7 A;  1D1A A;  5E79 C;  1YS7 A;  2I5U A;  2M3A A;  4WX9 A;  3HL2 A;  1R22 A;  3QOP A;  4O6J A;  3S2D J;  1WJB A;  2X1C A;  1XC5 A;  5F1J A;  2YX4 A;  1A35 A;  4KMF A;  4A3B J;  3OS2 A;  1QU3 A;  4OMZ A;  1B1B A;  4RS8 A;  3CP8 A;  2ECB A;  2V4J C;  2CO5 A;  3HOV J;  4II2 A;  1LVA A;  1G6N A;  5FRN A;  2MSY A;  1F43 A;  1Y6I A;  3CCE I;  1MSF C;  2LC2 A;  3GTL J;  1YHQ I;  2R5Y A;  2IA2 A;  4C3J J;  3S14 J;  2OZ6 A;  2V9P A;  1W4M A;  2QEN A;  1ZG1 A;  1ZQ3 P;  2K3P A;  3G1M A;  1NG6 A;  1HKQ A;  5D4S A;  4U7B A;  3Q5F A;  1X2N A;  4HV6 A;  2L54 A;  4YFN F;  3K6G A;  1HA8 A;  2M4K A;  3CES A;  2KZG A;  2UV1 A;  1VQL I;  3PO3 J;  1OIS A;  1P7J A;  2QSG X;  1BW6 A;  4BUP A;  4KIS A;  3LOC A;  4G94 A;  4L9N A;  4DZJ A;  2HZT A;  2Q2E B;  4KIB A;  4MGR A;  3PIP F;  4L9T A;  1FPQ A;  4XN0 A;  3GBG A;  1DP3 A;  1IN8 A;  4BS9 A;  1R4M B;  3LAJ A;  2WV0 A;  3I59 B;  2ICW G;  1TT0 A;  3FK6 A;  2DA5 A;  1DPU A;  1X1A A;  1S6L A;  2EV0 A;  2E35 A;  3VYR B;  4FX0 A;  3K1M A;  4CO8 A;  1R58 A;  3OYB A;  1X4O A;  4A3L J;  3BZ6 A;  4D7M A;  1Z6T A;  2WAD A;  4UB6 C;  4UV9 A;  2E1N A;  4P9U A;  3J81 K;  2KKO A;  3SZG A;  4KNY A;  4HQE A;  1ITY A;  4E4H A;  4PGH A;  2YSR A;  1SMY F;  4BGD A;  3KZI C;  2OA4 A;  3KZZ A;  5ICC A;  3ZXS A;  2DMN A;  3EUA A;  1HOM A;  2B0L A;  1ZKG A;  4G7O F;  2JPC A;  2NVX J;  5JVG F;  1VQ9 I;  4XOR A;  2X1E A;  1KZH A;  4HNT A;  5DD8 A;  3C2H A;  4BQA A;  3LFK A;  1SVO A;  4OIR F;  1Z3X A;  2NRA C;  2E1O A;  2LLK A;  3CLO A;  2CW8 A;  3A1Y A;  1AKH A;  3WGI A;  1XGN A;  3H3Z A;  3TED A;  1TNS A;  2IA0 A;  5EEA A;  1HC8 A;  1V54 H;  3H1C A;  2XAF A;  2XKO A;  1MH3 A;  2V9V A;  2VBZ A;  3DLL F;  2XAG A;  3DF8 A;  3RZD J;  2NAZ A;  4ITV A;  4Y52 J;  1WCM J;  1V4R A;  2UUZ A;  1IUY A;  4ABZ A;  2ELH A;  2JWT A;  2Y30 A;  4BE0 A;  1RRJ A;  1H9G A;  1QVT A;  5ERI A;  3DEW A;  2VOO A;  2NVU B;  3FXO A;  3NWT A;  3QAH A;  2Z1D A;  2Z5U A;  2JVG A;  1BBY A;  2CV0 A;  3OR2 C;  2IGM A;  2R7R A;  3M4O J;  4CUG A;  1TQM A;  5IP7 J;  5L3G A;  1MNM C;  1P2F A;  2F4O B;  1RNL A;  4Y13 A;  2PI0 A;  3TOB A;  1ETK A;  5LGU A;  3OY9 A;  1YO5 C;  3LSJ A;  2BY3 A;  1UHM A;  3F6O A;  4G12 A;  2OC6 A;  2XGE A;  1KQ0 A;  3LSH A;  1RUN A;  3GUD A;  3AG4 H;  1XX5 A;  1E3H A;  1W5T A;  2RC4 A;  4CYC A;  3H5N A;  3L1P A;  5CYV A;  4IRG A;  2V6E A;  4D1Q A;  5HLG A;  4LIU A;  5H6Q A;  2IA1 A;  3HPH A;  3FXU A;  5D5W B;  3OYC A;  4EGY A;  3BR0 A;  1SAN A;  2K5C A;  4XLA A;  2EFO A;  3PIO F;  3PUB A;  2LRE A;  1IRZ A;  4B48 A;  1U5T A;  2RRE A;  1HBX G;  3V7S A;  4UB8 C;  3O2P E;  2OPT A;  4BAY A;  4E7I A;  1F1Z A;  3RKW A;  3GTG J;  2W1O A;  1RC9 A;  3DKY A;  2OTL I;  3MAJ A;  5CVJ A;  4BH9 A;  1FBS A;  3WTW C;  1BI2 A;  4NDL A;  1FLI A;  2IPQ X;  1K61 A;  3ZQI A;  1ERD A;  3ZQQ A;  1YI2 I;  2HNH A;  2VBW A;  3HIF A;  2EH3 A;  2LYC A;  5CJ9 A;  2F5D A;  4IHW A;  3KP6 A;  1JHF A;  3FXQ A;  4PK4 A;  2K4B A;  1AOY A;  2JMW A;  2WB1 A;  2GA1 A;  1FOX A;  2BEO A;  4CCM A;  3DV8 A;  1LFU P;  2VKH A;  1OJL A;  1J0R A;  3NAR A;  5DUI A;  2ZJR F;  4CZC A;  3C1D A;  4L5J A;  2P5K A;  4M74 A;  1FOW A;  1MH4 A;  3VYT B;  4B4C A;  5K5Q A;  2FBH A;  5ILV A;  5L3E A;  1G59 A;  2UXX A;  2A5Y B;  3GTQ J;  2CUJ A;  3E7L A;  2CV2 A;  1U5T C;  4IO9 F;  2KT0 A;  4MHG A;  3F8M A;  3CCL I;  1W36 C;  2E1M C;  2UXN A;  2OV7 A;  1LEB A;  1QZE A;  3G73 A;  4ZYG A;  4HV5 A;  2DTR A;  2JJ7 A;  3C2G A;  1PUF A;  1X3U A;  5CVR A;  4BE2 A;  4E7S A;  5IT9 K;  2JRM A;  5B1A H;  2Y48 A;  4DW6 A;  3OYL A;  3DEE A;  1X1P A;  5DUK A;  5TIS C;  1QVU A;  3TW6 A;  1QQI A;  5JVT A;  2XPW A;  3C3W A;  1I6X A;  2YR2 A;  4HPQ A;  2KZV A;  4AVP A;  3S2H J;  5EGO B;  1IN4 A;  3KZY A;  1X1D A;  4UNO A;  1SFX A;  2L4A A;  4P55 A;  2X9D A;  1LFB A;  2DAO A;  3HTU A;  2D45 A;  5DYM A;  1K7A A;  3F8F A;  3FWE A;  4FX4 A;  1DP7 P;  4JX6 A;  4BU2 A;  1HDP A;  2FRH A;  1DQU A;  2Y75 A;  2M7B A;  3L2W A;  3GO5 A;  4L0Y B;  3BR5 A;  2FD5 A;  4QTR A;  3JRF A;  2CW7 A;  1IO2 A;  2HYJ A;  3CQZ J;  2CUE A;  3M9A A;  2KIM A;  2ID3 A;  1JKP C;  4LLL A;  1XDU A;  2J5P A;  4RLQ A;  3OYH A;  4M6X A;  3GLL A;  4RB2 C;  4EQQ A;  5K1Y A;  2DOF A;  4LD5 A;  2A6T A;  1WVR A;  1XD7 A;  2O8X A;  2F6C A;  4MO7 A;  2VXZ A;  2K4J A;  2B63 J;  1JUP A;  2LH9 A;  2QEX I;  2XF5 A;  3W2A A;  4DZP A;  4A0Z A;  3A02 A;  5M3M J;  3DKX A;  3WTV C;  5FLM J;  2N8G A;  3HBL A;  3KP3 A;  2R0Q C;  1ZRC A;  3B6C A;  3ESW B;  2VC1 A;  1XSD A;  2P5V A;  2JPB A;  2Y0S A;  3ZN1 A;  2LNB A;  4NQW A;  2L5Q A;  1X1C A;  2XSD C;  4LGW A;  3ZPL A;  2IP2 A;  2P6T A;  2DA6 A;  3T8R A;  1W0U A;  3I5U A;  2R5Z A;  2BVL A;  6PAX A;  3OYF A;  2R93 J;  3TGN A;  1FZP B;  5F08 A;  3CP2 A;  3IAS 2;  2DMT A;  5F6F A;  3ZMD A;  3H9J A;  1IN7 A;  1JKR C;  4R1H A;  2XGX A;  1FX7 A;  5CVV A;  2AXL A;  3O3K A;  5B1B H;  5FKK A;  4LJZ F;  2WTE A;  1K4S A;  2EBI A;  1D0X A;  4RAY A;  1BR4 A;  1SAX A;  2XAJ A;  1IRX A;  1RUO A;  2EFP A;  3DPU A;  4M73 A;  2X6O A;  3JRC A;  3B6A A;  3AG2 H;  2X0L A;  3BP8 A;  3GZ5 A;  1S3J A;  5J3L A;  2RQQ A;  4CCK A;  4C2M J;  2DQL A;  5CVI A;  2FEZ A;  4W97 A;  2R7V A;  4I09 A;  1WWX A;  1REP C;  2V1U A;  3IRQ A;  2FQ3 A;  3DCF A;  3DU6 A;  4A5N A;  1Z67 A;  1JJ8 C;  4M9X A;  1QBJ A;  2HKO A;  5HS7 A;  4AYB N;  2QVO A;  2OJE D;  2R92 J;  2L7F P;  1I50 J;  2LY2 A;  3REO A;  5IY5 H;  1BI1 A;  3WHC A;  1AA7 A;  4N9H A;  2L7Z A;  3CMM A;  1JT0 A;  2HYG D;  5L3F A;  1IZ1 A;  1IJW C;  2ISZ A;  1HDD C;  1XMX A;  3CZ6 A;  1NK3 P;  2Z9O A;  4HST A;  4DYQ A;  3GTK J;  1OYW A;  3WOD F;  5FLX K;  3HZJ A;  1JKO C;  3I56 I;  1UB9 A;  2IS4 A;  3JAM Z;  5HVQ C;  1GV2 A;  1BR1 A;  4FQG A;  2P81 A;  4GXO A;  2MLG A;  3A4C A;  1RES A;  4HX7 A;  4L9J A;  4M72 A;  4HA8 A;  2IW5 A;  3ZMT A;  5J47 A;  1QZZ A;  3F23 A;  2KRH A;  1R9T J;  2RN7 A;  3MKY B;  2ECC A;  3WGH A;  2W57 A;  1IG7 A;  2KIQ A;  4KN4 X;  5E3O A;  1VTN C;  5HOO A;  2EPF A;  1XSV A;  1V5F A;  4CCL A;  3K70 D;  4E7H A;  1VQ8 I;  4KUM A;  3IL2 A;  2WBM A;  1ACI A;  3KEO A;  2DMQ A;  1ZHF A;  1QPI A;  4HZF A;  2K7L A;  3N97 A;  2EJR A;  3HTS B;  2KHM A;  1W5S A;  2Y0M A;  5J4V A;  2OTJ I;  2F4I A;  3HOZ J;  3HOU J;  1OCP A;  1Y39 A;  4RB3 C;  3RZO J;  2G9W A;  2XC7 A;  1WJD A;  1LUJ B;  2BY1 A;  2EZI A;  2WA0 A;  4P96 A;  1T0F A;  2RNJ A;  2ZB9 A;  2VLA A;  2HXO A;  3BWG A;  5FKL A;  4G6T B;  1EJ9 A;  3PNT A;  4LLN A;  3IUO A;  1TP4 A;  2JSP A;  5CKT A;  2PJR A;  2IS1 A;  4OIN F;  3E5X A;  1P4X A;  1A31 A;  2M7A A;  4IQJ A;  1R5G A;  1ENH A;  3BG7 A;  1RR8 C;  2EFQ A;  4WK8 F;  2O9L A;  4HF2 A;  4PDK A;  1OCC H;  1ZAO A;  1SFK A;  1ZG5 A;  2VJ5 A;  3K2Z A;  3A0B C;  4XMY A;  4MEX F;  1AWC A;  3ECO A;  2KIU A;  4II3 A;  5K5O A;  2PMU A;  4IEJ A;  2DOD A;  4EM1 A;  2I8D A;  2IVM A;  5B3S H;  5LGT A;  3HOT A;  4XRS A;  4RGR A;  5C3E J;  3MN2 A;  5D5V B;  1SFU A;  5K7Z A;  2DI3 A;  4C3I J;  1QZY A;  2L7K A;  5JLW A;  2JA5 J;  3K4J A;  1K79 A;  1QHH D;  1PVE A;  3H0G J;  3RI4 A;  5HNH A;  3BZK A;  4C30 A;  4BQQ A;  3IH2 A;  5E3N A;  1LDD A;  1VZ0 A;  4PGG A;  1Y8R B;  1I27 A;  1YW8 A;  1O3T A;  2E2I J;  4E6K G;  1YTY A;  2G7U A;  2IT0 A;  3T5X A;  1RPW A;  2GAU A;  2L9R A;  2K9S A;  3E5U A;  5E8G A;  4B43 A;  1Y8Q B;  2X4H A;  4GGG A;  4Z6Y A;  4PJL A;  1V55 H;  4XL9 A;  1E3P A;  4ZDP A;  4EM2 A;  3OYE A;  1V3F A;  2L7M P;  3E6M A;  4TV7 A;  5LEK A;  2WAF A;  1KYW A;  4XLP F;  1H8A C;  2P8T A;  1U8R A;  3D1N I;  1T8I A;  2IJL A;  4QPQ A;  3J80 Z;  3F72 A;  4XM3 A;  1VQ5 I;  1LFP A;  2ZSI B;  3IHU A;  3MVP A;  2PMZ N;  2AS5 F;  1DGR M;  2ZFU A;  2RGV A;  2F5C A;  4RBO A;  3HJE A;  2E1C A;  1LNW A;  2CS3 A;  1H0M A;  2R7D A;  1MBK A;  2LR8 A;  4HW0 A;  2BZT A;  1ETW A;  2V26 A;  2LSO A;  2COB A;  3H92 A;  1R5H A;  3O8H A;  5FD6 A;  2P7V B;  2F5F A;  4IHT A;  1Y1V J;  2DN0 A;  2DCE A;  2Z99 A;  3ABT A;  3EUK L;  3BJA A;  3S3N A;  3KPH A;  4XON A;  4RGU A;  1B9M A;  3BQY A;  1RZ4 A;  2M4G A;  4A3E J;  4FT8 A;  2I10 A;  2BHY A;  3NQO A;  1YYV A;  1KU9 A;  2MC3 A;  3BTC A;  3GTO J;  4GDF A;  2DPU A;  5IYD J;  4BAC A;  3I64 A;  2E60 A;  1O3S A;  4YEJ A;  1U9O A;  4EMS A;  3L2R A;  4EJO A;  5M3F J;  1WPK A;  2LTP A;  1D8J A;  1QPM A;  3GYH X;  2EFN A;  5CLS A;  2B9S A;  4QLC U;  4CA0 A;  2QKM B;  4OOI A;  3S17 J;  4XLF A;  1K83 J;  2ZJQ F;  1WH5 A;  2M0M A;  4B8X A;  3CJR B;  4AVZ A;  3F8C A;  3O6B B;  1TL8 A;  2KRC A;  2Q1Z B;  5B5E C;  1MJ9 A;  2D2W A;  2DYS H;  2DJN A;  3V42 A;  4A3I J;  3GFM A;  2XHK A;  3PNY A;  1D5Y A;  4CCJ A;  3FKI J;  3PM1 A;  5JLX A;  5EYR A;  2HVQ A;  2M1B A;  2V1N A;  2VOD A;  3J7Z I;  3F8N A;  1XCV A;  1RIO H;  5TJJ A;  3FXM A;  2HWV A;  1U0J A;  5FKO A;  1N77 A;  1ZLK A;  2JVH A;  5KAI C;  2EIL H;  2GXA A;  2JA2 A;  2W00 A;  1H89 C;  1YIO A;  2FE3 A;  3A0H C;  3HYI A;  4CYD A;  3NWS A;  1IDZ A;  2LG4 A;  3ERE D;  3HPG A;  1Q1V A;  2F5E A;  1X19 A;  2QGU A;  4PCQ A;  1HST A;  3DBR B;  1S7O A;  4B44 A;  1HLV A;  3GTP J;  2A3S A;  3WTS C;  1IN5 A;  2ZFW A;  4XLN F;  2FBK A;  2GIV A;  3QOD A;  2HS5 A;  3LWF A;  3A2K A;  3ML6 A;  2A68 F;  1LDJ A;  1KGS A;  1Z1D A;  4WXD A;  3RYR A;  4I98 B;  1OYI A;  4A2U A;  5GAG J;  1UST A;  5LHI A;  4M3D A;  4BDZ A;  2VQG A;  1HCR A;  4RMN A;  1T98 A;  1TWC J;  3JRB A;  4D7N A;  5D8L B;  3M1E A;  1K78 A;  3GTM J;  1YW7 A;  1C0W A;  1MND A;  3S15 J;  1W5C C;  3ASN H;  3RJP A;  5K7F A;  4KIG A;  1UJ8 A;  5D8K B;  1A6Q A;  5IP6 A;  4X0G A;  3UKG A;  1WJA A;  1YX3 A;  1AU7 A;  1O57 A;  1MJA A;  3CCS I;  2ZME C;  4EJU A;  4DQ2 A;  5DDG A;  3HG9 A;  3RKY A;  3S93 A;  2F48 A;  3B73 A;  4RM3 A;  3WG7 H;  4F3Q A;  5HDK A;  4AU7 A;  1UHW A;  1OQY A;  4X1E A;  2ID6 A;  4I01 A;  1TW3 A;  2VUM J;  1ZTR A;  1FMV A;  3FBN B;  4FIS A;  2O6G E;  1WJC A;  4CSW A;  1SEU A;  3EPZ A;  4XK4 A;  3S8P A;  3JRH A;  1FOK A;  2L2O A;  2DBB A;  3ZMS A;  5LLQ A;  1FBU A;  2FMY A;  1R36 A;  2VPR A;  3DPT A;  3KP4 A;  4IOC F;  3VDX A;  2DA3 A;  3A01 B;  1J59 A;  2JQ7 A;  3P7N A;  3FHN A;  1I3Q J;  4M6V A;  2HKX A;  3NEU A;  1Z9C A;  3CLQ A;  3L2C A;  2ME6 A;  4EM0 B;  4AIK A;  2GOM A;  2XUB A;  5H2F C;  5TRD A;  3OYM A;  1UAA A;  2QBY A;  2ZME A;  5C4X J;  4V2F A;  4AYB A;  4M71 A;  3OYD A;  1GXQ A;  2DOA A;  4ZJZ A;  5DM6 F;  1K6O A;  3QQA A;  1Z91 A;  1ONV A;  3HRS A;  2DQR A;  2XB0 X;  4XLH A;  2AQF A;  4HDV A;  1HXD A;  3CMA I;  2UZK A;  2VQC A;  1X3Z B;  1FYM A;  1UZC A;  3IWZ A;  2EZL A;  4IX7 A;  1F5T A;  2ELK A;  3P5J A;  2XAU A;  3S16 J;  4ETS A;  2V6C A;  4AWX B;  2XPU A;  2K40 A;  5DTD A;  3L2Q A;  2HZD A;  3BCA A;  2K9Q A;  2M0C A;  3DXJ F;  3ZOB A;  2H94 A;  4F93 B;  5GPC A;  2R7O A;  4DBQ A;  1N25 A;  2EIM H;  1FYL A;  2DK8 A;  1TNT A;  1T08 B;  4N4N B;  3S1N J;  5E1X A;  4J01 A;  5D5X B;  5E18 F;  4A5M A;  3HEF A;  3V7C A;  4IOA F;  4Q5S F;  1QA6 A;  3MKZ A;  4RAZ A;  2K9N A;  2W4S A;  3RPU D;  3U21 A;  3Q0V A;  2NVT J;  1HF0 A;  1RI7 A;  3MQ0 A;  2KDO A;  3CCU I;  2ACJ A;  1A5J A;  2OQG A;  2DMU A;  2YUS A;  3FXL A;  4UUT A;  2FF4 A;  2L4M A;  3HKZ N;  4IF4 A;  1D0Z A;  4AM3 A;  5ICG A;  1IRF A;  3J81 Z;  1G4D A;  2E7W A;  3SQN A;  3AG1 H;  4B09 A;  4A3G J;  1XMA A;  4IVN A;  2R5Z B;  3PFY A;  1UMQ A;  2H6C A;  1I39 A;  3F9K A;  3P9C A;  2HVS A;  3ZMV A;  4G6D A;  1TQP A;  2CMP A;  1QO0 D;  2HR3 A;  3MMY B;  2HXI A;  2ZJP F;  3U9G A;  4HF0 A;  1LE8 B;  5KHD A;  4M3E A;  1J7K A;  2QWW A;  1WZ2 A;  1JGS A;  1N78 A;  3LAP A;  2R7S A;  1ZGJ A;  3G1O A;  3PSF A;  5IP9 J;  3QPT A;  5HDN A;  4XNF A;  5B66 C;  3DWL E;  1ETY A;  3SYT A;  3K4K A;  4KFC A;  2K02 A;  4BDY A;  4G8X A;  3BR3 A;  3VOD A;  1JE8 A;  3NAU A;  4A6D A;  1VF9 A;  2VI6 A;  3GX4 X;  4IQ4 A;  5D6E A;  5ILU A;  3PNV A;  2DA1 A;  4Q48 A;  5HDG A;  3M8F A;  3OR1 C;  4FE7 A;  3JW4 A;  1D8K A;  1SAU A;  4BQO A;  4JP0 A;  5EZH A;  1YW9 A;  3KP2 A;  2O5R A;  3LFU A;  4XR6 A;  2OUM A;  3DBH B;  3TDU C;  2WAE A;  2CV1 A;  5E20 A;  3TOA A;  1I1G A;  1OLT A;  2ZNZ A;  3KP7 A;  5TGT A;  3HOW J;  1TWG J;  3BG3 A;  4KDP A;  1YFH A;  1WSU A;  3CUQ C;  1S7A A;  2QBY B;  5LRR A;  1S72 I;  2K86 A;  1OR7 A;  1MGT A;  3HRT A;  5EGO A;  2EFW A;  3F22 A;  4ANJ A;  3ROU A;  1YJW I;  2DU9 A;  1TBX A;  3WTU C;  3L9F A;  2BBY A;  2HYF A;  3JCU C;  4IXA A;  4M3B A;  4WF2 A;  1MDM A;  1IF1 A;  3DLA A;  1GVD A;  2DT6 A;  2XAS A;  3N4M A;  2MLK A;  2MD0 A;  1MJB A;  3TO6 A;  4XID A;  2NVQ J;  1X1B A;  1FY7 A;  3BTJ A;  4C9Y A;  1VQ6 I;  1R6R A;  4EAT A;  3COA C;  4BXF A;  4I0A A;  3ZMZ A;  5HLH A;  2VT3 A;  3P9I A;  3K7A J;  2JK3 A;  4HX8 A;  2VJI A;  3L2V A;  1ZN2 A;  1MMN A;  1G3T A;  2L3D A;  2LKX A;  1RKW A;  1P4W A;  2E5Z A;  3FKJ A;  1K4T A;  1RKT A;  2BXY A;  2KFD A;  2ZME B;  2FUG 2;  4HRI A;  1OR7 C;  1VQP I;  5J8C A;  2E34 A;  3KP5 A;  2Z33 A;  2VJ4 A;  3V4G A;  3VPR A;  1FNN A;  5GTH C;  3OL4 A;  2VOP A;  2NVY J;  3JR9 A;  1HSJ A;  4UVA A;  1DU6 A;  3BPV A;  4YFK F;  4MNU A;  2CUF A;  3ECH A;  1MKM A;  1GDT A;  2L9V A;  4I76 A;  5E3L A;  4MFD A;  3JRG A;  1FIP A;  1FTT A;  1B6A A;  3BR2 A;  2E2H J;  4PSW A;  3JSO A;  1J5Y A;  4HG2 A;  4A0X A;  3ULQ B;  3HDD A;  2VIX A;  3IAM 2;  4GRI A;  2VKE A;  4ESF A;  1VQ7 I;  4U87 A;  1YRN A;  4DNC A;  2VQL A;  1YG2 A;  4EJV A;  2CSO A;  1MMD A;  3SEZ A;  2PMZ A;  1WRJ A;  4HNV A;  5IT3 A;  3CCQ I;  2CQ7 A;  3K1N A;  4OU0 A;  3ABK H;  3V8J A;  1I3A A;  2K85 A;  1R23 A;  1EH7 A;  1FP2 A;  2FQ4 A;  2GBY A;  2QUF A;  4HAM A;  2OCC H;  3O8G A;  3GFI A;  4XOT A;  2DO7 A;  1PUE E;  3WU0 A;  2PX9 A;  5K5R A;  2TCT A;  2VAS A;  4D0P A;  1WJF A;  2KPM A;  2DFH A;  2LKS A;  3DBL B;  4GCV A;  1BM9 A;  2YS9 A;  2MC4 A;  2PMH A;  2ESN A;  3OMY A;  4XKV A;  5F1R A;  2PEX A;  2ZO4 A;  3W6V A;  2K9M A;  2JT1 A;  1LB2 A;  4A69 C;  2JZY A;  4R79 A;  4XSX F;  2OZU A;  1ZGW A;  4UVB A;  3M8J A;  1XTA A;  1Z3Y A;  1FP1 D;  3I9V 2;  4RM2 A;  3BOQ A;  5LHH A;  1HKT A;  5H20 A;  5E3M A;  3SXY A;  2A5W A;  1CGP A;  4BY1 J;  4XSZ F;  1MMG A;  1JHH A;  2JN6 A;  1Y56 A;  4G6Q A;  4Z2Y A;  3RYP A;  4AD9 A;  3WTX C;  4AIJ A;  5C4J J;  3I71 A;  4Y3O A;  3E6B A;  2HVR A;  1FSH A;  1EKE A;  1UEL B;  5EDN A;  4H4K C;  1TWF J;  5AIP A;  3H9G A;  3Q9V A;  1PDN C;  4EGZ A;  4BHP A;  3FMQ A;  2O0Y A;  3QPH A;  4WWC A;  4A3C J;  2M2E A;  2LY9 A;  2LK2 A;  2DA7 A;  2EK5 A;  3HSF A;  3BJ6 A;  4LG3 A;  2W48 A;  2F4M B;  2WV1 A;  4Y4R A;  1K6Y A;  4GO1 A;  4NQW B;  5KVR A;  1JUS A;  2KRF A;  3C18 A;  1T95 A;  1HW5 A;  4I99 C;  1SD5 A;  1TTY A;  2FBI A;  1TLH B;  2P5L C;  5BPD A;  3W6J B;  1O7L A;  3WG9 A;  4XLE A;  1MBJ A;  4L5E A;  3AL0 B;  3ZQF A;  3H9Q A;  4UUS B;  1FMW A;  1YJN I;  3LSM A;  1UFM A;  2OD5 A;  3BR1 A;  1B9N A;  2E5N A;  4U7D A;  3F6V A;  2P0W A;  1I5Z A;  3CDL A;  2A69 F;  3ABL H;  3OIO A;  5AON A;  3PFI A;  4PUS A;  4PFO A;  3DPL C;  1S29 A;  2K27 A;  3Q3S A;  1Z0X A;  2FNA A;  4N0B A;  2DFF A;  2VKD A;  2V79 A;  3EQL F;  3M1C A;  3HSR A;  3RQI A;  4BJ6 C;  2RV8 A;  3KE2 A;  1YE9 A;  4RB0 A;  3GFL A;  1U78 A;  2P4W A;  2XRN A;  2R7X A;  4LG0 B;  3QU6 A;  4HBL A;  5AIQ A;  4A93 J;  2EZH A;  1T38 A;  2LBF A;  4NNJ A;  3S3O A;  2DOE A;  3MEX A;  1IDY A;  1YQA A;  2MBF A;  3SDB A;  2IBD A;  5ICF A;  1GV5 A;  2DA4 A;  5J8F A;  3S3M A;  3K0L A;  3WTY C;  3IKT A;  2H8R A;  3L7W A;  2X6W A;  2R7T A;  3FIS A;  2DK5 A;  1H9T A;  3MWM A;  1X2M A;  4RB1 A;  4D9J A;  4FAS D;  3KEQ A;  1EA3 A;  2QQ8 A;  1GVJ A;  5DEQ A;  5E8I A;  5HLI A;  3QYF A;  4DGW B;  1MBE A;  2BVM A;  1TZL A;  4KN7 X;  4DBR A;  1P9Q C;  1MBG A;  2XB5 A;  2NS0 A;  2AXT C;  2P6S A;  3LMM A;  4QWQ A;  4BEH A;  3OS0 A;  1Z21 A;  1G3Y A;  2RKH A;  2X1D A;  1G3W A;  3HRU A;  4LK0 F;  2FML A;  5ICE A;  3GW2 A;  4C2T A;  3I54 A;  2O3F A;  1WQ2 A;  2GXB A;  4EJT A;  2CYY A;  1N75 A;  1ZK8 A;  1IAW A;  2MGQ A;  3K2A A;  1R7J A;  2VE9 A;  1CF7 B;  4YRV A;  1FWZ A;  1ON1 A;  5E17 F;  3GXO A;  1D3Y A;  4NC7 A;  4G7H F;  5H6R A;  2R7W A;  5DCM B;  3DQV C;  4S04 A;  3I3L A;  4ZDO A;  1X58 A;  4BY7 J;  2BY0 A;  1SFO J;  2ETH A;  3CCV I;  2CH0 A;  5J1R A;  2ZXW H;  2QCO A;  2DT7 B;  3BT9 A;  5GAE J;  2CUZ A;  3HOX J;  5BMZ A;  4ZYA A;  3TP3 A;  2COM A;  4EV0 A;  1YX5 A;  3I58 A;  5DCF A;  4A3K J;  2HDD A;  2PJP A;  5KAF C;  2JRT A;  1JGG A;  1MBH A;  3R60 A;  2XKP A;  3OL3 A;  1LPQ A;  3CDH A;  2XF7 A;  1ETO A;  3OYJ A;  3QPS A;  2ZCW A;  5BQT A;  4PZJ A;  4E7J A;  3FF5 A;  1R1T A;  3LST A;  2EIJ H;  3WHB A;  1DDN A;  1DUX C;  1ULY A;  4PJM A;  4XQF A;  3VYS B;  1E2X A;  3IH3 A;  3QOE A;  3H36 A;  2DJI A;  4JX5 A;  2AO9 A;  4PFP A;  3SHF A;  2J5O A;  3AFH A;  2XVC A;  3ZQ7 A;  3E1S A;  5F0F A;  3TBI A;  2QA4 I;  5HNF A;  2XSJ C;  3ZGK A;  1PJR A;  1ZLJ A;  2ZKZ A;  4JYK A;  5BS6 A;  1KU7 A;  4RA2 A;  4MIM A;  5EEG A;  2IEK A;  4JBA A;  3LSR A;  1TQI A;  3I0T A;  3E3V A;  1V5E A;  5M5W J;  1BJA A;  4B3A A;  2BOL A;  3VWB A;  1LE8 A;  3B02 A;  1ZR4 A;  3OS1 A;  3CCJ I;  2Z16 A;  2YPR A;  5L3D A;  2HQN A;  2F2E A;  2IXS A;  1JI8 A;  5FFZ A;  1OCR H;  2BXZ A;  4MQ9 F;  2FX0 A;  2LRD A;  2MAB A;  4Q47 A;  3U1D A;  4F7Z A;  5BPI A;  4A3F J;  1UG0 A;  5GP9 A;  1QNT A;  2CRG A;  3OV8 A;  2JA6 J;  5JR3 A;  4A3D J;  1Z05 A;  2QF7 A;  3E0J B;  2CQX A;  3BTI A;  2VQH A;  3H3U A;  4KYW A;  2IGK A;  4AIH A;  2JUG A;  3GTJ J;  2M8G X;  3HM5 A;  2GLO A;  1UG2 A;  3C7J A;  4IHS A;  4ZYE A;  4HOB A;  2EA2 A;  3J80 K;  3JRD A;  1L0O C;  4EVI A;  2LD5 A;  1X4P A;  1SFE A;  3LSP A;  4RAG A;  3HSE A;  4U88 A;  4M9Z A;  2QQB A;  5GAD J;  4ESB A;  1WGX A;  4A6E A;  2L9S A;  3U2R A;  3CME I;  4ENJ A;  2F5V A;  3JRE A;  2LKP A;  4CXF A;  1U9N A;  2XGD A;  1VQN I;  3GWZ A;  1WI9 A;  5E1Z B;  1M1E B;  2HOA A;  5GPA A;  1SC7 A;  3GLX A;  2HOT A;  2X6Y A;  3WE3 A;  2IRF G;  2BY2 A;  4H0E A;  3CJT B;  1MBF A;  3BTL A;  2MW8 A;  4F92 B;  4IKF A;  1P7I A;  3FX3 A;  2XF6 A;  4XBF A;  2PN6 A;  1IGN A;  3CC4 I;  3PQK A;  4LK1 F;  5EG0 A;  2CQK A;  4Q4Z F;  5F04 A;  2IS6 A;  2GIZ A;  2WB1 N;  3FZV A;  4OAY A;  1W7P D;  1ETV A;  1HKS A;  1HW2 A;  2KL4 A;  2MD5 A;  3KFW X;  1ZRE A;  2NNN A;  2NOG A;  4PSX A;  1OCT C;  1BIA A;  4UY8 I;  1IC8 A;  3RSN A;  2W85 A;  1SVM A;  4P1W A;  4ZTF A;  1QHG A;  2LMD A;  5M5X J;  3W2V A;  1SD4 A;  2OF7 A;  1SMT A;  4BKX A;  1XPX A;  2HQR A;  1GXP A;  5LHG A;  1VQM I;  3UNG C;  3KIO A;  3S2W A;  2PQ8 A;  1SD7 A;  2XAQ A;  1FT9 A;  4XLC A;  3OSF A;  3LL7 A;  2VBX A;  1P92 A;  3FK7 A;  2LF8 A;  1BW5 A;  2QYO A;  4RAF A;  3GVA A;  2LF7 A;  4MQV A;  4HYE A;  5EJC A;  3BJO A;  1VQ4 I;  5CQE A;  1R1V A;  2KIF A;  3GCM A;  3HXL A;  1VQO I;  3JRI A;  1IN6 A;  3BQZ A;  4NUB A;  1U5T B;  4BL0 B;  2IAI A;  3FM5 A;  2M34 A;  2CJJ A;  3OYA A;  3ZQG A;  1OFC X;  1T2K A;  2ESH A;  3KLN A;  1U3E M;  1ZGA A;  2VON A;  3J7Y J;  1MMS A;  2QM3 A;  4MEY F;  1ZG3 A;  2HPM A;  3BLY A;  2EA4 A;  3VOE A;  4CYC B;  2H1L A;  5HOD A;  1FJL A;  3PO2 J;  3OYI A;  1Z7L A;  3EUH C;  3PQJ A;  2E1M B;  2WAQ A;  3G71 I;  2EV5 A;  2R3S A;  1IUF A;  1KON A;  4UXN A;  1W0T A;  2STW A;  3OYK A;  1JTY A;  5J4Y A;  2E2J J;  3KX2 A;  1MNE A;  4FCY A;  1O7F A;  3JAM K;  2YU9 J;  1I6H J;  1EH8 A;  1R71 A;  4OIO F;  1D5V A;  4PJJ A;  5M5Y J;  3FMS A;  1HQC A;  3M07 A;  4AC0 A;  4BE1 A;  3DP7 A;  4ZDL A;  2D1V A;  2HU9 A;  2LOO A;  2L01 A;  5DD4 A;  2CWE A;  2K9L A;  3R0J A;  2NXN B;  1USS A;  4NBQ A;  4ESJ A;  2BE5 F;  1R5I D;  3PJR A;  3GF2 A;  2BW3 A;  1AKH B;  3IWF A;  2GWR A;  3WU2 C;  3I59 A;  2ZJ2 A;  1BI3 A;  2HFH A;  2HQA A;  3EUH A;  1LVK A;  4ENM A;  4CDG A;  2FNP A;  4GYI A;  1D1B A;  1KQ9 A;  4U0V A;  4XRS G;  4A3M J;  3DEU A;  4PJ0 C;  3Q0W A;  4EJW A;  3OIQ A;  9ANT A;  1P4A A;  2QSH X;  2LDU A;  2W82 A;  3BG5 A;  2M30 A;  3MCZ A;  3VFZ A;  4YIR X;  1HW1 A;  1U6G A;  4L0Z B;  1F9N A;  3SFZ A;  1SD6 A;  1XB4 A;  4ON0 A;  5JI6 A;  1XGS A;  1S8N A;  3PSI A;  4KT5 C;  1T0F C;  1FBQ A;  3M3Y J;  2MH2 A;  3ZN0 A;  2IGO A;  1PYV A;  2HQ5 A;  2MA3 A;  2DT5 A;  1BOA A;  1IXS B;  1V5G A;  3D5L A;  1B72 B;  2CW0 F;  5LEJ A;  4Y33 A;  3SDG A;  4ENN A;  1W36 D;  1FEX A;  4E7Z A;  2P7C B;  2R7F A;  4ZZL A;  1XGO A;  5JHF A;  5JHU A;  3DTI A;  3TL4 X;  3LA2 A;  2Z2S B;  4NHJ A;  2H1K A;  3BG9 A;  4CIC A;  3J7A O;  4MTD A;  2MYS A;  2QLZ A;  4YEL A;  4WCG A;  4DOZ A;  3DKW A;  2FOW A;  2EWN A;  2HI3 A;  3ASO H;  1MD0 A;  3CDI A;  1SVL A;  4V2G A;  5FKM A;  3CUO A;  4LB6 B;  2CFO A;  3A03 A;  1DU0 A;  5FRO A;  2Y9Y A;  2DMP A;  3F21 A;  1XGM A;  3ZRG A;  1BJZ A;  1Y1W J;  1JXS A;  3TO7 A;  1TWH J;  2Z3Y A;  3HB9 A;  2X85 A;  3W2W A;  3GEZ A;  4XRF A;  1YOV B;  2H8W A;  3D5S C;  1QRY A;  3I55 I;  3IH4 A;  4ENK A;  2OBP A;  3MZH A;  4NB5 A;  1YIT I;  3U1K A;  1J75 A;  1I1S A;  4W1U A;  2XAH A;  2O7O A;  2XV4 S;  2ME0 A;  3CUQ B;  3FXK A;  2A6E F;  1NTC A;  5E1W A;  2M9H A;  3EDP A;  3OSG A;  2GQQ A;  4A0Y A;  2CG4 A;  2EQR A;  4RLF A;  3QWL A;  2E7X A;  1D1C A;  3FMR A;  2PBI A;  3RTR A;  2RAE A;  3W3C A;  2O61 A;  5DS9 A;  5BOX A;  2ZSH B;  4GYG A;  1H88 C;  3X2Q H;  4UUV A;  5J40 A;  3ABU A;  5CQG A;  4IHY A;  3T0Y A;  4BHC A;  4NC6 A;  2V1D A;  1D0Y A;  5CVU A;  5LBQ A;  3GZN B;  2BYV E;  3LSK A;  2Q2E A;  5ILS A;  4P5O A;  1TT5 B;  5HS8 A;  1O4X A;  4ZH4 F;  1YRN B;  2HGC A;  4YII A;  4IHV A;  1B8I B;  4ASN A;  2BGC A;  4OIQ F;  2GOX B;  3E6D A;  4I6Z A;  1BI0 A;  1JT6 A;  3C2B A;  1XG1 A;  4K2E A;  1OYY A;  5LGN A;  2RDP A;  3QP6 A;  1KA8 A;  3LSG A;  5FLV A;  3WE2 A;  3H5A A;  2JSC A;  2UWM A;  3OIP A;  1P6R A;  1BA5 A;  1GHC A;  2H09 A;  1BC8 C;  5IOY A;  1WH7 A;  2QQA A;  2K3F A;  2R5Y B;  3L09 A;  1NK2 P;  2OU2 A;  3R6S A;  3ELK A;  1T6S A;  3BZC A;  3H0D A;  4LFU A;  4IZZ A;  3CJQ B;  3V8K A;  2DDB A;  3W6K B;  2E19 A;  2CFX A;  4Y15 A;  5J1Y A;  5BNG A;  4AUX A;  4XKB A;  3BC8 A;  5KNL A;  3H3V K;  3KET A;  1A6I A;  1IRG A;  3MKW B;  2DLL A;  2E36 A;  3OWT A;  4FET A;  4XOP A;  2EZK A;  2Y0S N;  3PL8 A;  3HOS A;  3CMY A;  1RET A;  5LD2 C;  3VEP A;  3QU3 A;  2Y9Z A;  2MH9 A;  3HHH A;  5J1U A;  1X3W B;  3CJN A;  4X6A J;  2DTZ A;  3G1L A;  5F64 A;  1YLF A;  2ZNY A;  1S7E A;  2DW4 A; 
#chains in the Genus database with same CATH homology
 1NHA A;  3I53 A;  4L5I A;  2JTV A;  4YG2 F;  3AAF A;  2FXA A;  4YIF A;  4IRI A;  1ZH5 A;  2O03 A;  1O3Q A;  5FO5 A;  4A12 A;  4KIC A;  3EET A;  5A2Q Z;  2KJC A;  3JSP A;  2ADU A;  1FSE A;  3JTG A;  4O3M A;  2A6H F;  2WWY A;  4CGZ A;  4LLG F;  1R00 A;  3WTZ A;  2Q0O A;  1PP7 U;  1OMI A;  1J2X A;  2FA5 A;  5LRS A;  2H27 A;  4RGX A;  2EV6 A;  4HLY A;  4I7H A;  4HX4 A;  2M8E A;  1E17 A;  4IPA A;  1MDM B;  1OKR A;  2DPD A;  1FC3 A;  3BRO A;  5ED4 A;  1KQ8 A;  3LA7 A;  4OIP F;  4P9F A;  3T1B A;  3R0A A;  4FHT A;  2VBY A;  3BPX A;  1XMK A;  4OMY A;  3HUG A;  2M5W A;  3VB2 A;  3K9T A;  2YU3 A;  1KU3 A;  2QQ9 A;  3FHZ A;  2RQP A;  2ZBK A;  3M7G A;  2HOE A;  1ON2 A;  4IRH A;  3HRM A;  4BXU A;  1W7P A;  3MZY A;  3IC7 A;  1LQ1 A;  2W24 A;  4N9I A;  4M6Y A;  2EB7 A;  1BC7 C;  4BHB A;  3NRV A;  5IT9 Z;  4R8H A;  1Z6R A;  2L02 A;  2NNY A;  3P9K A;  5FD5 A;  2VC0 A;  3BY6 A;  1U2W A;  3FM3 A;  4MTE A;  3RDI A;  3V8L A;  2YX7 A;  3R4K A;  4RGS A;  2D1H A;  3Q9S A;  2CGP A;  4G7Z F;  3KCC A;  4BYY A;  1L3L A;  4I02 A;  2DFI A;  3WU1 B;  3R61 A;  1XDS A;  1IXC A;  1F4K A;  3CO6 C;  1DPR A;  3SZT A;  3RPU A;  5DCM A;  5HS9 A;  3BDD A;  2GA2 A;  2XIG A;  2KJB A;  2BV6 A;  3LQQ A;  3FXR A;  1W7P B;  1KU2 A;  1LDK B;  1ZRF A;  1J9I A;  4UVC A;  4G9Y A;  3LA3 A;  3ZP5 A;  4I2O A;  2GZW A;  4KMU X;  3GZ6 A;  1K78 B;  3HHG A;  1OPC A;  4CHU A;  3IKV A;  3SZP A;  1R1U A;  3IRR A;  3TO9 A;  2HTS A;  4L18 B;  3K69 A;  2V1X A;  1Y0U A;  1EH6 A;  4HQM A;  4KIF A;  1B4A A;  4ZYD A;  3TQN A;  1BN5 A;  2A07 F;  1A04 A;  4JK1 X;  4M9S A;  1ODD A;  2FSW A;  3MFK A;  3RIR A;  2ISY A;  2NYX A;  4IJA A;  5EEH A;  1CF7 A;  3E97 A;  1T39 A;  2C6Y A;  5D4R A;  1LEA A;  1Z7U A;  4L9V A;  2VN2 A;  3TKY A;  3QP5 A;  2HTJ A;  3F3X A;  2ZXJ A;  1IXR C;  5FFX A;  3M8E A;  3RKX A;  3E5Q A;  1FYK A;  2FOK A;  2RVC A;  2PFB A;  1KYZ A;  5FB2 A;  1B59 A;  2XRO A;  2M45 A;  2W25 A;  3K1P A;  2G7H A;  5KK1 A;  5L3B A;  2HEO A;  2FU4 A;  2Q8K A;  3CTA A;  4U0Y A;  2VE8 A;  1LJ9 A;  3ISP A;  1TW2 A;  3D0S A;  5DV5 A;  3CUQ A;  2TDX A;  4LG0 A;  4UV8 A;  1IW7 F;  1XCB A;  4HDU A;  1UCR A;  4Y17 A;  3QRF F;  3KLO A;  2GXG A;  4UHT A;  4O5V A;  5D5U B;  3TDZ C;  2OAZ A;  4LB5 A;  5D6F A;  4WXC A;  1ZYR F;  3JTH A;  4U0W A;  2WC2 A;  1QGP A;  1YS6 A;  5J6X A;  2STT A;  4BNC A;  2OQR A;  2QZ8 A;  4LMY A;  4I0B A;  3GFJ A;  5FLX Z;  4JQF A;  4CZZ A;  3V7R A;  1PP8 F;  3WTT C;  4ZYH A;  4ZZD A;  3F8B A;  2A61 A;  1BIB A;  4WXH A;  3L00 A;  4YFX F;  4KA4 A;  3RPQ A;  1ZRD A;  2PG4 A;  3EYY A;  2PLY A;  5FGM A;  2VT2 A;  3OOP A;  3E6C C;  5A2Q K;  5L3C A;  3CO7 C;  2W84 A;  4HLX A;  3WGG A;  4S05 A;  3ZMU A;  1MZB A;  1STZ A;  2HDC A;  1G3S A;  3DFG A;  2M87 A;  1Q1H A;  4HF1 A;  1WKM A;  5JFR A;  1O3R A;  2H6B A;  3T8T A;  3G3Z A;  1XSX A;  4E70 A;  3LQR A;  1ZAR A;  3I4P A;  1EV7 A;  3EYI A;  1XN7 A;  1YS7 A;  4WX9 A;  1R22 A;  3QOP A;  4O6J A;  2YX4 A;  4KMF A;  4OMZ A;  1B1B A;  4RS8 A;  2CO5 A;  1LVA A;  1G6N A;  2IA2 A;  2OZ6 A;  1W4M A;  2QEN A;  1ZG1 A;  1HKQ A;  5D4S A;  4U7B A;  3Q5F A;  4HV6 A;  2L54 A;  4YFN F;  4G94 A;  4L9N A;  2HZT A;  4MGR A;  4KIB A;  4L9T A;  1FPQ A;  1IN8 A;  3LAJ A;  2WV0 A;  3I59 B;  1DPU A;  1S6L A;  2EV0 A;  4CO8 A;  4FX0 A;  3K1M A;  1R58 A;  3BZ6 A;  1Z6T A;  4UV9 A;  2E1N A;  4P9U A;  3J81 K;  2KKO A;  4KNY A;  4HQE A;  4PGH A;  2YSR A;  1SMY F;  2OA4 A;  3KZZ A;  5ICC A;  2B0L A;  4G7O F;  2JPC A;  5DD8 A;  4BQA A;  3LFK A;  4OIR F;  2NRA C;  3CLO A;  3WGI A;  1XGN A;  3H3Z A;  1TNS A;  2IA0 A;  2XAF A;  2XKO A;  2V9V A;  2VBZ A;  2XAG A;  3DF8 A;  2NAZ A;  1V4R A;  1IUY A;  2ELH A;  1H9G A;  5ERI A;  2VOO A;  3QAH A;  2Z5U A;  1BBY A;  1TQM A;  5L3G A;  1P2F A;  1RNL A;  4Y13 A;  2PI0 A;  3TOB A;  5LGU A;  1YO5 C;  1UHM A;  3F6O A;  1KQ0 A;  1RUN A;  3GUD A;  1W5T A;  2RC4 A;  5CYV A;  4IRG A;  5HLG A;  5H6Q A;  2IA1 A;  5D5W B;  3FXU A;  4EGY A;  2EFO A;  1U5T A;  1HBX G;  3V7S A;  3O2P E;  4BAY A;  1F1Z A;  3RKW A;  3MAJ A;  5CVJ A;  4BH9 A;  1FBS A;  3WTW C;  1BI2 A;  1FLI A;  2IPQ X;  2VBW A;  3HIF A;  5CJ9 A;  2F5D A;  3KP6 A;  1JHF A;  3FXQ A;  2K4B A;  1AOY A;  2GA1 A;  2BEO A;  3DV8 A;  1J0R A;  5DUI A;  3C1D A;  4L5J A;  2P5K A;  4M74 A;  5K5Q A;  2FBH A;  5ILV A;  5L3E A;  2UXX A;  2A5Y B;  1U5T C;  4MHG A;  3F8M A;  2UXN A;  1LEB A;  3G73 A;  4ZYG A;  4HV5 A;  2DTR A;  1X3U A;  5CVR A;  5IT9 K;  2Y48 A;  5DUK A;  1QQI A;  5JVT A;  3C3W A;  1I6X A;  2YR2 A;  4AVP A;  1IN4 A;  3KZY A;  4UNO A;  1SFX A;  2L4A A;  4P55 A;  2DAO A;  2D45 A;  3HTU A;  5DYM A;  1K7A A;  3F8F A;  3FWE A;  4FX4 A;  1DP7 P;  2FRH A;  2Y75 A;  3GO5 A;  4L0Y B;  3M9A A;  2KIM A;  4LLL A;  1XDU A;  2J5P A;  4M6X A;  4RB2 C;  4EQQ A;  5K1Y A;  4LD5 A;  1XD7 A;  2O8X A;  2VXZ A;  2K4J A;  4A0Z A;  3WTV C;  3KP3 A;  1ZRC A;  2VC1 A;  1XSD A;  2P5V A;  2JPB A;  3ZN1 A;  2LNB A;  4NQW A;  4LGW A;  3ZPL A;  2IP2 A;  2P6T A;  3T8R A;  3I5U A;  6PAX A;  3TGN A;  1FZP B;  5F6F A;  3ZMD A;  1IN7 A;  4R1H A;  2XGX A;  1FX7 A;  5CVV A;  2AXL A;  3O3K A;  4LJZ F;  2WTE A;  4RAY A;  1SAX A;  2XAJ A;  1RUO A;  2EFP A;  4M73 A;  3BP8 A;  2X0L A;  3GZ5 A;  1S3J A;  2DQL A;  5CVI A;  2FEZ A;  4I09 A;  1WWX A;  2V1U A;  1REP C;  3IRQ A;  2FQ3 A;  4A5N A;  1QBJ A;  4M9X A;  2HKO A;  5HS7 A;  2QVO A;  3REO A;  1BI1 A;  4N9H A;  2HYG D;  5L3F A;  1IZ1 A;  2ISZ A;  2Z9O A;  1OYW A;  3WOD F;  5FLX K;  1UB9 A;  3JAM Z;  5HVQ C;  4GXO A;  2MLG A;  4HX7 A;  4L9J A;  4M72 A;  4HA8 A;  2IW5 A;  3ZMT A;  3F23 A;  1QZZ A;  2RN7 A;  3WGH A;  2W57 A;  4KN4 X;  1VTN C;  5HOO A;  1XSV A;  4KUM A;  3IL2 A;  3KEO A;  1ZHF A;  4HZF A;  2K7L A;  3N97 A;  2EJR A;  3HTS B;  1W5S A;  2Y0M A;  4RB3 C;  2G9W A;  4P96 A;  1T0F A;  2RNJ A;  3BWG A;  4LLN A;  4OIN F;  3E5X A;  1P4X A;  1R5G A;  2EFQ A;  4WK8 F;  4HF2 A;  4PDK A;  1ZAO A;  1ZG5 A;  3K2Z A;  4MEX F;  1AWC A;  3ECO A;  2KIU A;  5K5O A;  2PMU A;  4EM1 A;  2IVM A;  5LGT A;  3HOT A;  4RGR A;  5D5V B;  1SFU A;  2DI3 A;  1QZY A;  1K79 A;  3RI4 A;  1LDD A;  4PGG A;  1O3T A;  1I27 A;  1YW8 A;  2IT0 A;  1YTY A;  2G7U A;  3T5X A;  2GAU A;  3E5U A;  5E8G A;  2X4H A;  4GGG A;  4EM2 A;  1V3F A;  3E6M A;  4TV7 A;  5LEK A;  1KYW A;  4XLP F;  2P8T A;  1U8R A;  2IJL A;  3J80 Z;  3F72 A;  3IHU A;  2AS5 F;  2RGV A;  2F5C A;  2E1C A;  1LNW A;  1H0M A;  2R7D A;  4HW0 A;  2LSO A;  3H92 A;  1R5H A;  5FD6 A;  2P7V B;  2F5F A;  4IHT A;  2Z99 A;  3ABT A;  3BJA A;  4RGU A;  1B9M A;  1RZ4 A;  4FT8 A;  3NQO A;  1YYV A;  1KU9 A;  2MC3 A;  2DPU A;  3I64 A;  1O3S A;  4EMS A;  4EJO A;  1D8J A;  1QPM A;  3GYH X;  2EFN A;  5CLS A;  4QLC U;  4OOI A;  4B8X A;  3F8C A;  3O6B B;  1MJ9 A;  2D2W A;  3GFM A;  2XHK A;  2M1B A;  2VOD A;  3F8N A;  1XCV A;  1RIO H;  5TJJ A;  2HWV A;  1ZLK A;  1YIO A;  2FE3 A;  3HYI A;  4CYD A;  3ERE D;  2F5E A;  4PCQ A;  1HST A;  1S7O A;  2A3S A;  3WTS C;  1IN5 A;  2ZFW A;  4XLN F;  2FBK A;  2GIV A;  2HS5 A;  3LWF A;  3ML6 A;  2A68 F;  1LDJ A;  1KGS A;  1Z1D A;  4WXD A;  3RYR A;  4I98 B;  1OYI A;  4A2U A;  1UST A;  5LHI A;  1T98 A;  5D8L B;  3M1E A;  1K78 A;  1YW7 A;  1C0W A;  3RJP A;  4KIG A;  5D8K B;  1O57 A;  1MJA A;  4EJU A;  4DQ2 A;  5DDG A;  3RKY A;  3B73 A;  5HDK A;  1UHW A;  4I01 A;  1TW3 A;  2O6G E;  1FOK A;  2DBB A;  3ZMS A;  5LLQ A;  1FBU A;  2FMY A;  1R36 A;  3DPT A;  3KP4 A;  1J59 A;  3P7N A;  2HKX A;  3NEU A;  1Z9C A;  3L2C A;  4EM0 B;  4AIK A;  2XUB A;  5TRD A;  2QBY A;  2ZME A;  4M71 A;  1GXQ A;  1K6O A;  1Z91 A;  1ONV A;  3HRS A;  2DQR A;  4HDV A;  1HXD A;  2UZK A;  1FYM A;  3IWZ A;  1F5T A;  4ETS A;  2V6C A;  4AWX B;  3DXJ F;  2H94 A;  1FYL A;  2DK8 A;  1TNT A;  5E1X A;  5D5X B;  5E18 F;  4A5M A;  3V7C A;  4Q5S F;  4RAZ A;  1RI7 A;  3MQ0 A;  2ACJ A;  2OQG A;  2FF4 A;  2L4M A;  4IF4 A;  5ICG A;  1IRF A;  3J81 Z;  1G4D A;  2E7W A;  3SQN A;  4B09 A;  1XMA A;  4IVN A;  2H6C A;  3P9C A;  3ZMV A;  4G6D A;  1TQP A;  1QO0 D;  2HR3 A;  3U9G A;  4HF0 A;  1J7K A;  2QWW A;  1JGS A;  3LAP A;  1ZGJ A;  3QPT A;  5HDN A;  4KFC A;  2K02 A;  4G8X A;  3VOD A;  1JE8 A;  4A6D A;  3GX4 X;  5D6E A;  5ILU A;  4Q48 A;  5HDG A;  3M8F A;  3JW4 A;  1D8K A;  1YW9 A;  3KP2 A;  3TDU C;  5E20 A;  3TOA A;  1I1G A;  2ZNZ A;  3KP7 A;  4KDP A;  1YFH A;  1WSU A;  3CUQ C;  1S7A A;  2QBY B;  5LRR A;  2K86 A;  1OR7 A;  1MGT A;  3HRT A;  2EFW A;  3F22 A;  3ROU A;  2DU9 A;  1TBX A;  3WTU C;  3L9F A;  2BBY A;  2HYF A;  4IXA A;  4WF2 A;  1MDM A;  1IF1 A;  3N4M A;  2XAS A;  2MLK A;  1MJB A;  3TO6 A;  1FY7 A;  3COA C;  4I0A A;  3ZMZ A;  5HLH A;  2VT3 A;  3P9I A;  4HX8 A;  1ZN2 A;  1G3T A;  2L3D A;  1P4W A;  2ZME B;  5J8C A;  3KP5 A;  2Z33 A;  3V4G A;  1FNN A;  2VOP A;  1HSJ A;  4UVA A;  3BPV A;  4YFK F;  4MNU A;  3ECH A;  1MKM A;  1B6A A;  3JSO A;  1J5Y A;  4A0X A;  3ULQ B;  4ESF A;  4DNC A;  1YG2 A;  4EJV A;  2CSO A;  1WRJ A;  5IT3 A;  3K1N A;  4OU0 A;  3V8J A;  1R23 A;  1EH7 A;  1FP2 A;  2QUF A;  4HAM A;  3GFI A;  2DO7 A;  1PUE E;  3WU0 A;  5K5R A;  4D0P A;  4GCV A;  1BM9 A;  2PMH A;  2ESN A;  5F1R A;  2PEX A;  2ZO4 A;  2JT1 A;  1LB2 A;  2JZY A;  4R79 A;  4XSX F;  2OZU A;  4UVB A;  1FP1 D;  3BOQ A;  5LHH A;  1HKT A;  5H20 A;  3SXY A;  1CGP A;  4XSZ F;  1JHH A;  4Z2Y A;  4G6Q A;  3RYP A;  4AD9 A;  3WTX C;  4AIJ A;  3I71 A;  3E6B A;  1FSH A;  5AIP A;  3Q9V A;  1PDN C;  4EGZ A;  4BHP A;  3FMQ A;  2O0Y A;  3QPH A;  4WWC A;  2EK5 A;  3HSF A;  3BJ6 A;  4GO1 A;  5KVR A;  2KRF A;  3C18 A;  1HW5 A;  1SD5 A;  1TTY A;  2FBI A;  2P5L C;  1TLH B;  5BPD A;  3W6J B;  1O7L A;  3WG9 A;  1UFM A;  2OD5 A;  1B9N A;  4U7D A;  3F6V A;  1I5Z A;  2A69 F;  5AON A;  3PFI A;  3DPL C;  1S29 A;  2K27 A;  2FNA A;  4N0B A;  2V79 A;  3EQL F;  3HSR A;  2RV8 A;  3KE2 A;  4RB0 A;  3GFL A;  1U78 A;  2P4W A;  2XRN A;  4LG0 B;  3QU6 A;  4HBL A;  5AIQ A;  1T38 A;  3MEX A;  1YQA A;  2MBF A;  5ICF A;  5J8F A;  3K0L A;  3WTY C;  3IKT A;  3L7W A;  2DK5 A;  1H9T A;  3MWM A;  4RB1 A;  3KEQ A;  5E8I A;  1GVJ A;  5DEQ A;  5HLI A;  4KN7 X;  2NS0 A;  2P6S A;  4QWQ A;  1G3Y A;  2RKH A;  4LK0 F;  1G3W A;  3HRU A;  5ICE A;  2FML A;  3GW2 A;  3I54 A;  2O3F A;  1WQ2 A;  2GXB A;  4EJT A;  2CYY A;  1IAW A;  1R7J A;  2VE9 A;  1CF7 B;  1FWZ A;  1ON1 A;  5E17 F;  3GXO A;  1D3Y A;  4G7H F;  5H6R A;  5DCM B;  3DQV C;  4S04 A;  2ETH A;  5BMZ A;  2COM A;  4EV0 A;  3I58 A;  5DCF A;  2PJP A;  2JRT A;  3R60 A;  2XKP A;  3CDH A;  2ZCW A;  5BQT A;  4PZJ A;  3FF5 A;  1R1T A;  3LST A;  1DDN A;  1DUX C;  1ULY A;  1E2X A;  3SHF A;  2J5O A;  3ZQ7 A;  2XVC A;  1ZLJ A;  2ZKZ A;  5BS6 A;  1KU7 A;  5EEG A;  4JBA A;  1TQI A;  3I0T A;  3E3V A;  1BJA A;  3B02 A;  2YPR A;  5L3D A;  2HQN A;  2F2E A;  5FFZ A;  4MQ9 F;  4Q47 A;  3U1D A;  4F7Z A;  5BPI A;  1QNT A;  3OV8 A;  5JR3 A;  1Z05 A;  3H3U A;  4KYW A;  4AIH A;  3C7J A;  4IHS A;  4ZYE A;  4HOB A;  2EA2 A;  3J80 K;  1L0O C;  4EVI A;  1SFE A;  3HSE A;  4U88 A;  4M9Z A;  2QQB A;  4ESB A;  4A6E A;  3U2R A;  4ENJ A;  2LKP A;  4CXF A;  3GWZ A;  1WI9 A;  5E1Z B;  2IRF G;  3GLX A;  3WE3 A;  4H0E A;  3FX3 A;  4XBF A;  2PN6 A;  3PQK A;  4LK1 F;  2CQK A;  4Q4Z F;  3FZV A;  1W7P D;  1HKS A;  1HW2 A;  2MD5 A;  3KFW X;  1ZRE A;  2NNN A;  1BIA A;  2W85 A;  1SD4 A;  1SMT A;  2HQR A;  1GXP A;  5LHG A;  3S2W A;  2PQ8 A;  1SD7 A;  2XAQ A;  1FT9 A;  2VBX A;  1P92 A;  2LF8 A;  2QYO A;  3GVA A;  2LF7 A;  4MQV A;  4HYE A;  3BJO A;  1R1V A;  2KIF A;  1IN6 A;  1U5T B;  3FM5 A;  1T2K A;  2ESH A;  3KLN A;  1U3E M;  1ZGA A;  2VON A;  2QM3 A;  4MEY F;  1ZG3 A;  2EA4 A;  3VOE A;  3PQJ A;  2EV5 A;  2R3S A;  4UXN A;  2STW A;  1O7F A;  3JAM K;  1EH8 A;  4OIO F;  1D5V A;  3FMS A;  1HQC A;  3DP7 A;  2D1V A;  2L01 A;  5DD4 A;  2CWE A;  3R0J A;  1USS A;  4ESJ A;  2BE5 F;  3GF2 A;  3IWF A;  2GWR A;  3I59 A;  2ZJ2 A;  1BI3 A;  2HFH A;  3EUH A;  4ENM A;  4CDG A;  2FNP A;  4GYI A;  1KQ9 A;  4U0V A;  3DEU A;  4EJW A;  1P4A A;  2LDU A;  2M30 A;  3MCZ A;  3VFZ A;  1HW1 A;  1U6G A;  4L0Z B;  1F9N A;  3SFZ A;  1SD6 A;  1XB4 A;  4ON0 A;  5JI6 A;  1XGS A;  1S8N A;  4KT5 C;  1FBQ A;  2MH2 A;  3ZN0 A;  2MA3 A;  2DT5 A;  1BOA A;  1IXS B;  3D5L A;  2CW0 F;  5LEJ A;  4ENN A;  2P7C B;  2R7F A;  4ZZL A;  1XGO A;  5JHU A;  3LA2 A;  4NHJ A;  4CIC A;  3J7A O;  4MTD A;  2QLZ A;  4WCG A;  3DKW A;  2EWN A;  1MD0 A;  3CUO A;  4LB6 B;  3F21 A;  1XGM A;  1JXS A;  3TO7 A;  2Z3Y A;  3GEZ A;  4XRF A;  4ENK A;  2OBP A;  3MZH A;  4NB5 A;  1I1S A;  1J75 A;  2XAH A;  2XV4 S;  3CUQ B;  2A6E F;  5E1W A;  3EDP A;  2GQQ A;  4A0Y A;  2CG4 A;  2E7X A;  3FMR A;  2PBI A;  3RTR A;  2O61 A;  5BOX A;  4GYG A;  4UUV A;  3ABU A;  3T0Y A;  4BHC A;  2V1D A;  5CVU A;  5LBQ A;  2BYV E;  2Q2E A;  5ILS A;  4P5O A;  5HS8 A;  4ZH4 F;  2HGC A;  4YII A;  4ASN A;  2BGC A;  4OIQ F;  3E6D A;  1BI0 A;  5LGN A;  4K2E A;  1OYY A;  2RDP A;  3QP6 A;  1KA8 A;  3WE2 A;  2JSC A;  2UWM A;  1P6R A;  1GHC A;  2H09 A;  1BC8 C;  2QQA A;  3L09 A;  2OU2 A;  3R6S A;  3ELK A;  1T6S A;  4LFU A;  3W6K B;  3V8K A;  2CFX A;  4Y15 A;  3KET A;  1IRG A;  2DLL A;  3HOS A;  3VEP A;  3QU3 A;  2MH9 A;  3HHH A;  3CJN A;  5F64 A;  1YLF A;  2ZNY A;  2DW4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...