1G4DA

Nmr structure of the mu bacteriophage repressor dna-binding domain/dna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Viral protein/dna
molecule keywords 5'-D(P*CP*CP*TP*TP*TP*TP*CP*AP*GP*TP*AP*AP*TP*CP*TP*G)-3'
publication title The Mu repressor-DNA complex contains an immobilized 'wing' within the minor groove.
pubmed doi rcsb
source organism Enterobacteria phage mu
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g4dA00
3F8MA 2ZFWA 2ZBKA 3KFWX 1HXDA 4M74A 1B4AA 2LF7A 4L5JA 2Q2EA 1W5SA 2O03A 2K27A 1YS7A 4KT5C 1EV7A 2BV6A 2ISZA 3WTVC 2ZNYA 2FNAA 2LDUA 3ABUA 2BGCA 3GVAA 4GYIA 2Q0OA 3GYHX 2STTA 2KIFA 4Q47A 2JPBA 1ZRCA 4L9VA 2OBPA 2OU2A 4RAYA 2JPCA 1IF1A 2D2WA 4L0ZB 3V7CA 1L3LA 3FMRA 3ROUA 2V9VA 1UCRA 5HVQC 2FBIA 4LD5A 2QWWA 4AIJA 1FC3A 5J6XA 5F1RA 5ICEA 1TQIA 3HSFA 2W24A 1K7AA 3GF2A 5FD5A 2HTSA 2A6EF 2ZMEB 4Z2YA 1MDMB 3FMSA 2QENA 1USSA 2GXBA 4Y15A 4HQEA 5KK1A 4PGHA 3RPUA 5CVJA 3FXQA 4M6XA 1TTYA 5LHGA 1O3RA 2M87A 4IRIA 2XAHA 2DK8A 3WGIA 4EJUA 1U5TA 5DD8A 1YG2A 3CJNA 5LBQA 4ASNA 1HKQA 4MNUA 5DCFA 3N4MA 4LK0F 1KU9A 1BN5A 3KP2A 2A3SA 3RKXA 2WTEA 5DUIA 4U0VA 3HRUA 5JVTA 1O57A 5D8LB 5A2QK 3IWFA 3M8EA 1FWZA 3F72A 5TJJA 3CO6C 2RDPA 2RNJA 2NS0A 1D8JA 2KJCA 1W7PB 2STWA 1Z05A 3MZHA 1UFMA 2MH9A 5D5VB 5ILSA 1ZGAA 1YYVA 2BE5F 3P9KA 3PFIA 4JQFA 4EJVA 1ZARA 3LQQA 4LK1F 3KP3A 2FU4A 2E1CA 1Z91A 4WF2A 3ERED 1ZH5A 2IA2A 1BBYA 2FA5A 5BMZA 1P4XA 1TNTA 3ELKA 3MCZA 2YSRA 5FLXK 2EV5A 1S7OA 3WE3A 3I0TA 4ENJA 1UHWA 2VN2A 2A07F 4BQAA 4B8XA 2H6CA 1S3JA 2Z5UA 1P92A 2G7UA 5LLQA 3WTUC 4FHTA 3I59A 2CFXA 1ODDA 3QPTA 2OA4A 1SD6A 2F5FA 4AWXB 4ESFA 2JZYA 1V4RA 1U8RA 4FX4A 1G3SA 2VC1A 4XSXF 1USTA 3EETA 3I64A 2GXGA 4WCGA 4ESJA 5FGMA 1LJ9A 3KP6A 2ESNA 1G3WA 1ZLJA 4M9XA 1R1UA 4CXFA 3WTSC 5F64A 2EFPA 1T6SA 3MZYA 2GA2A 2VC0A 3MAJA 3DPTA 1P4WA 2E7XA 3ZMSA 5DD4A 1YW9A 2CWEA 4CZZA 2H09A 1DPUA 4IRGA 5IT3A 4A6EA 1SMTA 3QOPA 3L00A 3K1MA 1BM9A 3TGNA 3S2WA 2XROA 3DFGA 2EFQA 2JTVA 2O61A 4XRFA 1XGOA 3ZPLA 4EGYA 3N97A 2A6HF 3GXOA 2Z9OA 4ZZDA 3WE2A 1S8NA 2Q8KA 4I0AA 2IRFG 1OKRA 1IW7F 3SFZA 1A04A 4CGZA 1QBJA 5L3EA 1ZLKA 3BJOA 5JR3A 4HF1A 4WX9A 3IKTA 3O3KA 3GW2A 2XKPA 2ELHA 4HA8A 4EM0B 1U5TB 3FM3A 3WTZA 3KEOA 1XN7A 2GAUA 2QQAA 1S6LA 4OIPF 3JSPA 2VOPA 1B9MA 4HV6A 4G6QA 2KRFA 2P5LC 3C18A 3ABTA 5J8CA 3GFLA 2E1NA 2HOEA 1BIAA 2OZ6A 1SD4A 1RIOH 2AS5F 1C0WA 3K69A 4GXOA 3T8RA 3ECOA 3HHGA 4KA4A 2CSOA 3BJ6A 3F8FA 2DPDA 4N9HA 4YFKF 3PQJA 1XGNA 2IJLA 2QUFA 4HOBA 1R1VA 1Z7UA 4CO8A 4GCVA 1FYKA 3JTHA 4K2EA 2FBHA 4M9ZA 1WRJA 4S04A 1BI3A 2M5WA 4KDPA 1FYLA 3ZMTA 1XDSA 2V1XA 2M30A 3LFKA 3V8KA 3HRTA 1PUEE 5ED4A 4EJTA 1P4AA 4EMSA 4CICA 1FSHA 4HBLA 1J75A 3BPVA 1FOKA 2PJPA 1OPCA 4MEXF 3WTYC 2M8EA 3C7JA 1KYWA 1YIOA 3LAPA 5JHUA 2DQRA 3K0LA 1F1ZA 4I09A 3CUQB 1WWXA 2JT1A 5DYMA 5AONA 5EEGA 2W57A 3FM5A 2LF8A 3EYYA 1PP7U 5L3CA 1BC8C 3H3UA 1LNWA 3RYRA 4HAMA 3KP4A 3TKYA 1ZAOA 3F8BA 3M1EA 1HKTA 3ECHA 4JK1X 2OZUA 2BEOA 1SFUA 3D5LA 3F8CA 4BH9A 1KU3A 1R5HA 4R79A 2Y75A 3HHHA 3V8JA 2HGCA 1ZG3A 2IA1A 2HKOA 5F6FA 1TQPA 3Q9VA 1G3YA 1HSJA 2FF4A 2TDXA 4RGSA 2K7LA 4I2OA 4EM1A 2ESHA 3E6MA 4OMYA 5D4SA 3VODA 5JI6A 1SFEA 5HDKA 5L3DA 4MGRA 4Q5SF 3RI4A 3L9FA 1I27A 2D45A 3I71A 1H9GA 2EV6A 2OQRA 5AIPA 3WGHA 2O8XA 1FNNA 3T0YA 1FT9A 4XBFA 3ZMUA 2EFWA 5K5QA 1OR7A 4GYGA 2FOKA 1U3EM 2ZO4A 3LQRA 4AD9A 3GFIA 2GZWA 1UHMA 3HRMA 2BYVE 4RB1A 1R23A 3E6BA 4L9TA 4A12A 5E18F 1E2XA 5KVRA 1T0FA 4MQVA 2IP2A 3BP8A 4RGRA 1XMKA 4HF0A 2V6CA 4WK8F 1YW8A 1CF7A 3E5QA 3VB2A 1TQMA 1BJAA 1D8KA 2HWVA 4A0ZA 4UUVA 1ZREA 2DI3A 1H0MA 3FF5A 1DUXC 5CJ9A 3F21A 3IWZA 3IHUA 4HLXA 4LB6B 2A68F 1WKMA 3HIFA 1LDDA 3J80Z 3KE2A 1TNSA 5HLHA 1SD5A 5DUKA 4LLGF 2RN7A 4JBAA 3KETA 4Q4ZF 1QZZA 5E8IA 2PEXA 1QGPA 4EJWA 5LHIA 1Q1HA 2YR2A 2VBYA 1CGPA 1ZHFA 3QPHA 3W6JB 3R6SA 3K2ZA 3J81Z 1K79A 2XIGA 1RZ4A 1B1BA 1KYZA 1XCVA 1R36A 2ZKZA 4EM2A 1B9NA 3LA2A 4KUMA 4P96A 4U0YA 2E7WA 1J5YA 2UXXA 3VOEA 4RGXA 4IHSA 1XDUA 1FP1D 5DDGA 3IRQA 4BHBA 2G9WA 1KU7A 2QVOA 2PN6A 2L3DA 3FXUA 3GLXA 2V1UA 1LVAA 1TW2A 1JHFA 3FZVA 4M72A 2A69F 4ZYDA 1B59A 4HDVA 1O3TA 4HW0A 4UVBA 1MZBA 5L3FA 1MJ9A 2Y0MA 1IN5A 3G3ZA 2DO7A 1BOAA 4KN4X 1S7AA 2EWNA 3DXJF 4IRHA 1WSUA 1IRGA 1LEBA 1OMIA 5BOXA 3HSEA 2FEZA 1LEAA 2VE8A 4L18B 1OYYA 2O0YA 3RYPA 2ETHA 2R7FA 3R60A 4HQMA 3TDUC 1BIBA 4G8XA 2MH2A 3CUQA 2A61A 1S29A 3D0SA 1XGSA 3WU1B 4ZH4F 1L0OC 3ZN1A 3Q5FA 4R1HA 2V1DA 4RAZA 1IZ1A 1T39A 4OOIA 4I0BA 4AVPA 3EUHA 3IRRA 4IPAA 4I01A 1I1GA 4NHJA 5HLIA 1XSVA 1J59A 5LHHA 1HBXG 1TW3A 4LMYA 5A2QZ 3MWMA 2JRTA 2FMLA 2LSOA 5D5XB 5E1WA 1ZGJA 1FLIA 1I6XA 2FNPA 2F5CA 4P5OA 2VT3A 3LAJA 1DP7P 1EH8A 3I58A 1B6AA 4ENNA 4WXDA 1FSEA 2PQ8A 5E1ZB 5LRSA 3ZMDA 2VE9A 3R61A 4IHTA 1XSXA 5K5OA 5IT9Z 4EJOA 4ESBA 4YFNF 2ISYA 2LNBA 2P7CB 4EV0A 4H0EA 4IF4A 4KIBA 1G6NA 2R7DA 1SMYF 2P6TA 2QM3A 1G4DA 2RQPA 1ONVA 1LDJA 1XD7A 1RI7A 5ICGA 1Z6TA 2XKOA 5FLXZ 3O6BB 1JE8A 3V4GA 2NNYA 2WC2A 1IXRC 2IA0A 2EFOA 1YLFA 2XAGA 1CF7B 2Z33A 4YFXF 1I1SA 1IN7A 2L02A 2VOOA 5AIQA 1LDKB 1D3YA 3JSOA 1WI9A 1JXSA 4RS8A 4P9UA 4IJAA 2CGPA 1DPRA 4BHPA 4R8HA 1ZRDA 5LEJA 2HR3A 3QAHA 1ON1A 5HS9A 3TOAA 4Y13A 2P8TA 1KU2A 1XMAA 4G7OF 1HQCA 1T38A 1KQ0A 2IW5A 2HFHA 4KIFA 3K9TA 5E17F 4I02A 2UZKA 4A6DA 4ZZLA 4KN7X 2OQGA 1HW5A 5CVRA 3I5UA 1G3TA 5D4RA 2Y48A 5D8KB 5FFXA 3K1NA 2HEOA 2QZ8A 4I98B 2O6GE 4IXAA 3ZMVA 2CYYA 3WTTC 2HQNA 1KA8A 2P6SA 3GZ5A 3C1DA 3M8FA 4N0BA 4UXNA 2XASA 1W7PD 2FE3A 2PI0A 4L0YB 4ON0A 4Y17A 1J7KA 1YW7A 4OIQF 2QBYA 4HLYA 2W85A 3JAMK 1YTYA 3E5UA 2FBKA 3H3ZA 4HDUA 3CDHA 1HW2A 1EH6A 2EA4A 4HV5A 2XAJA 3ISPA 4WXHA 4P55A 2GIVA 3RIRA 2BBYA 2P5VA 5HDGA 3LA3A 1Z6RA 3L7WA 4F7ZA 4Q48A 1Z9CA 1J9IA 3RTRA 1UB9A 3FXRA 2MLGA 3V7SA 3LWFA 2RC4A 3E5XA 3WTWC 1PDNC 3C3WA 1D5VA 2CW0F 3DP7A 2PG4A 2PMUA 3F6OA 2MLKA 5HS7A 5D6FA 5LGNA 1MD0A 2DK5A 5ILVA 4OMZA 4MTEA 3WG9A 4LGWA 4WXCA 2PMHA 1IRFA 3RDIA 4DQ2A 2DAOA 3GEZA 4M73A 2DBBA 3I4PA 2W84A 2FRHA 2F5EA 4L9JA 3GWZA 2QLZA 3VFZA 2H94A 1LB2A 2C6YA 1ON2A 4NQWA 1O3SA 4RGUA 4RB3C 2NRAC 1XB4A 1E17A 1T98A 1FYMA 1QO0D 4QWQA 5LGTA 1BI0A 4I7HA 5CVUA 2XUBA 4D0PA 3SZTA 5J8FA 3IKVA 5K1YA 4PZJA 2YX7A 4M6YA 1AOYA 4UV8A 3F6VA 3FX3A 3J80K 2KKOA 4LLNA 1TBXA 1F5TA 4YIIA 4AIKA 3BPXA 4ENMA 1JGSA 3E6DA 5FB2A 3U1DA 2VODA 1MGTA 4U7DA 2VONA 2XVCA 1IXSB 1YQAA 2IPQX 4FX0A 5EEHA 2GA1A 2Z99A 4EQQA 4ZYGA 3J81K 5D6EA 5HS8A 4OIRF 1ZG1A 2UXNA 3HOTA 3QP6A 3ZQ7A 4NB5A 3E3VA 2GQQA 2ZXJA 2WV0A 1P6RA 4LFUA 4FT8A 2NAZA 5CVIA 3BY6A 4UV9A 5BQTA 3IC7A 2HKXA 5E1XA 4L5IA 3BROA 5L3GA 1IAWA 3K1PA 3RKYA 2OAZA 3O2PE 5JFRA 2CO5A 2EV0A 1SAXA 2ADUA 2V79A 2DU9A 1F9NA 2DTRA 2RKHA 1BI2A 4KYWA 1BC7C 2UWMA 2XV4S 4ETSA 3BDDA 4KICA 1IN4A 1ZN2A 2X0LA 2K4BA 1R58A 3FHZA 1ULYA 2DLLA 2DW4A 3KZYA 4B09A 4MHGA 3Q9SA 1Z1DA 2QBYB 4BNCA 3SQNA 3G73A 3QRFF 4MTDA 3F23A 2DT5A 4U88A 5DEQA 4UHTA 4A0YA 3GO5A 1YFHA 2WWYA 4DNCA 4LLLA 3R0JA 1ZYRF 2KIMA 5HLGA 1YO5C 1HW1A 2ZJ2A 3WU0A 5ICCA 3I53A 2D1VA 3J7AO 4RB0A 2MD5A 4KNYA 3R4KA 1KQ8A 1MJBA 3MQ0A 1JHHA 2DFIA 1QQIA 3L09A 2R3SA 1T2KA 2O3FA 1X3UA 3NRVA 1IN8A 1GVJA 5D5WB 4QLCU 4LB5A 3V7RA 2RV8A 5BPIA 2G7HA 1U6GA 2AXLA 3TOBA 3T5XA 2ACJA 5IT9K 4OINF 3GFJA 4HF2A 3HUGA 3FWEA 4BYYA 3NQOA 4O5VA 2EFNA 3ZP5A 1FY7A 2P4WA 2DQLA 2XGXA 3KZZA 1WQ2A 2L01A 5L3BA 1F4KA 4M9SA 5CYVA 4XSZF 1NHAA 5BS6A 3H92A 3P9CA 3GZ6A 3REOA 3DF8A 1AWCA 5ERIA 2VBXA 2GWRA 3HTUA 4BAYA 3KLNA 5LRRA 2JSCA 2EJRA 1HSTA 2QQBA 3ZN0A 2FMYA 3F8NA 2DPUA 4GO1A 1J2XA 2B0LA 1MJAA 3V8LA 2HDCA 1IUYA 1VTNC 3EYIA 3B73A 5CLSA 2K4JA 1RNLA 2KJBA 3F3XA 2VT2A 1FZPB 3DPLC 4HX8A 3P9IA 5DCMA 4ZYHA 3QU6A 4HYEA 4EGZA 1K78A 4CYDA 2M45A 3TO7A 5ILUA 1SD7A 4G7ZF 5K5RA 1GHCA 3CO7C 3L2CA 3RJPA 4A2UA 4XLNF 1QNTA 1KQ9A 1V3FA 4G9YA 4S05A 2FQ3A 4O6JA 4PGGA 4U0WA 1R5GA 1XCBA 4OU0A 2FXAA 3BJAA 4BXUA 3KCCA 1FX7A 5FD6A 1STZA 3QP5A 3MFKA 5TRDA 3DV8A 2MA3A 3BZ6A 3SZPA 5E20A 2L4AA 2VBZA 1GXPA 3RPQA 4A0XA 3DQVC 1TLHB 1IN6A 1OYIA 4LG0A 1K6OA 5BPDA 4HZFA 3P7NA 4U7BA 3VEPA 2ZNZA 2L4MA 4L9NA 1XSDA 3SXYA 3TO9A 3JTGA 3M9AA 1XGMA 2HS5A 3SHFA 3R0AA 1I5ZA 3TDZC 3U2RA 2XHKA 5ICFA 3F22A 4A5NA 4N9IA 3CTAA 2PFBA 3NEUA 1R7JA 2EA2A 1W4MA 1R1TA 1ZG5A 2EB7A 4HX7A 5H20A 4P9FA 3W6KB 2W25A 3T8TA 4YIFA 5LGUA 4KMUX 1OYWA 3WGGA 2IT0A 1Y0UA 2MC3A 3B02A 4OIOF 3HSRA 3HOSA 4CDGA 3QU3A 2Z3YA 2FSWA 3T1BA 2X4HA 1QPMA 2OD5A 3E97A 2QYOA 2ZMEA 4LJZF 1DDNA 1MDMA 3OV8A 4YG2F 1FBSA 4AIHA 4UVAA 2H6BA 4KIGA 2PLYA 1R00A 4KMFA 3I54A 1O3QA 3AAFA 2QQ9A 2VXZA 5E8GA 3EQLF 2YU3A 5CVVA 4PDKA 2K86A 3ZMZA 4GGGA 2NYXA 3ULQB 4EVIA 3COAC 1H9TA 5H6QA 2A5YB 2F2EA 2HYFA 4WWCA 4TV7A 3CLOA 1O7FA 1SFXA 2COMA 1RUNA 4ENKA 2F5DA 3GUDA 3OOPA 1R22A 2CG4A 4UVCA 4MEYF 2MBFA 4M71A 1W5TA 4IVNA 1MKMA 2M1BA 2VBWA 4HX4A 3M7GA 1U5TC 1W7PA 2PBIA 3HRSA 3CUOA 1U78A 3IL2A 2H27A 1FP2A 4ZYEA 3E6CC 3HTSB 2HQRA 2IVMA 3PQKA 3MEXA 1J0RA 5LEKA 1IXCA 2NNNA 3BWGA 4BHCA 4A5MA 1ZRFA 4RB2C 4KFCA 2ZCWA 1LQ1A 2LKPA 3TO6A 1U2WA 3GFMA 2XAFA 3DEUA 4PCQA 5FFZA 5HDNA 1O7LA 5DV5A 3U9GA 4XLPF 3KEQA 1YS6A 1HKSA 3LSTA 3I59B 3RKWA 2HZTA 2J5OA 3FMQA 1FBUA 4G94A 5H6RA 3GX4X 4MQ9F 2K02A 5DCMB 2YX4A 4G7HF 1BI1A 2P5KA 1P2FA 3JW4A 1K78B 2J5PA 1GXQA 3JAMZ 2D1HA 3DKWA 5FO5A 3LA7A 2CQKA 4G6DA 3WTXC 1QZYA 3WODF 1EH7A 1PP8F 3KLOA 4UNOA 2XAQA 3BOQA 2EK5A 2HYGD 1REPC 2RGVA 3EDPA 2L54A 3HYIA 2XRNA 3KP7A 1RUOA 2P7VB 2YPRA 6PAXA 1KGSA 4E70A 3ML6A 2KIUA 2RVCA 2HTJA 3KP5A 3CUQC 4O3MA 1FPQA 1FBQA 5HOOA 5D5UB 4CHUA 3TQNA 4LG0B
chains in the Genus database with same CATH superfamily
3V42A 3F8MA 2ZFWA 2ZBKA 3KFWX 1HXDA 5GTIC 4D7NA 3K4NA 4M74A 4BXXJ 2AXTC 3EUHC 4HG2A 2EZKA 1B4AA 2LF7A 4L5JA 1X1PA 2Q2EA 4A3LJ 1W5SA 2O03A 2E1OA 2K27A 1YS7A 4KT5C 2LK2A 1EV7A 2BV6A 3HBLA 3WTVC 2ISZA 2EH3A 2QF7A 2Y31A 2ZNYA 2FNAA 2LDUA 3CJRB 3BR3A 4C30A 2ZJRF 3ABUA 1AKHB 1GDTA 5FLMJ 2BGCA 3GVAA 4GYIA 1Y39A 2Q0OA 3GYHX 1Z3YA 2STTA 3PL8A 2KIFA 4Q47A 4AYBN 2JPBA 1U9OA 1PUFA 1ZRCA 4L9VA 4ZC3A 1ETOA 2OBPA 2OU2A 2E35A 1SAUA 4RAYA 3OR1C 2JPCA 4LITA 4A3IJ 1IF1A 3CESA 4D7MA 4BL0B 2D2WA 4L0ZB 3V7CA 1L3LA 4MLOA 3L2UA 3FMRA 5EGOB 3AFHA 3ROUA 2V9VA 2IS4A 1UCRA 5HVQC 1LE8A 3DEWA 1VFCA 2FBIA 4LD5A 2JUCA 1DGRM 2QWWA 4AIJA 2JK3A 2KPMA 1FC3A 5J6XA 5F1RA 5ICEA 4X6AJ 3G2BA 3K4LA 4BE1A 1TQIA 1EJ9A 2R5YB 2CQQA 2W24A 3HSFA 1TWAJ 3CP2A 4XKBA 1MSEC 1FMVA 1K7AA 3FBNB 3GF2A 2VKHA 3SDBA 2JVHA 3GTJJ 1X3WB 1XPXA 3AL0C 4KT6A 5FD5A 2HTSA 2A6EF 3QPSA 2ZMEB 3VSLA 4Z2YA 1MDMB 2HOAA 4BJ5C 3H5AA 1TWCJ 2QENA 1USSA 3FMSA 2GXBA 4Y15A 3K2AA 2ZXIA 4HQEA 5KK1A 3GCMA 1W36D 4PGHA 3RPUA 5CVJA 3BR2A 3DLAA 3FXQA 4M6XA 1SFOJ 2E1MB 1TTYA 5LHGA 3OR2C 1O3RA 2I10A 2M87A 4IRIA 2AQFA 4CA0A 1VQ6I 2XAHA 2DK8A 3DKYA 3WGIA 4EJUA 1U5TA 3L2RA 2WAFA 5GP9A 5DD8A 1YG2A 3CJNA 1Y1VJ 4BBSJ 4HPQA 5LBQA 3S17J 4ASNA 1HKQA 3BG7A 4MNUA 2BW3B 2GLOA 2DMUA 2HYJA 5DCFA 3N4MA 2DA3A 4LK0F 3ZCOA 3PUBA 1KU9A 1BN5A 2VXDA 4CYCB 3KP2A 3ZQLA 2A3SA 3RKXA 2WTEA 5DUIA 3C2HA 4U0VA 3HRUA 2EIKH 4HNUA 2R93J 3QOEA 5JVTA 2GM4A 1O57A 5D8LB 5A2QK 4B4CA 3IWFA 3M8EA 1FWZA 3ZQHA 3F72A 5TJJA 3CO6C 2RDPA 1YX5A 2RNJA 3LSKA 2NS0A 3AG3H 1D8JA 4MIMA 2W48A 2KJCA 1W7PB 2L9SA 3I56I 2STWA 1Z05A 2XSDC 3MZHA 1UFMA 2MH9A 5D5VB 5ILSA 4AVZA 4UB8C 4FTHA 3E0JB 1ZGAA 3JREA 2K9SA 1YYVA 4A93J 2BE5F 2DA1A 3P9KA 1MBEA 3OYIA 3PFIA 3MKLA 4JQFA 4EJVA 4PK4A 4XLCA 1ZARA 3LQQA 2CUZA 1X1DA 2E5ZA 4LK1F 3PUFA 3TP0A 2M9HA 1WJCA 3KP3A 1EF4A 2FU4A 1GUUA 2PX9A 2E1CA 2XSJC 1D0ZA 3IAM2 1Z91A 4UUSA 4WF2A 3ERED 2R5ZB 2IA2A 4D5CA 1ZH5A 1TP4A 3FKJA 1BBYA 2FA5A 3K4BA 3PIOF 5BMZA 1P4XA 1ETKA 3BQZA 3OYHA 3OOUA 1TNTA 3ELKA 3MCZA 2L9NA 2YSRA 5FLXK 2LG4A 1NG6A 2EV5A 1R6RA 4I99C 1S7OA 1K4SA 4BQNA 1JKOC 3DLLF 3A0HC 3OL4A 2B63J 3WE3A 3I0TA 4ENJA 1UHWA 2VN2A 2A07F 1UG2A 1XC5A 1OJLA 4BQAA 3OYAA 4B8XA 2H6CA 1S3JA 1OFCX 1FOWA 1TZLA 2KQRA 2Z5UA 4A3JJ 2B9SA 1P92A 1RKWA 2G7UA 3HOXJ 1GV5A 2QQ8A 3MKYB 5LLQA 3WTUC 4FHTA 1BW5A 4ANJA 4CCJA 2R7RA 3I59A 3CC4I 2CFXA 2X6YA 1BA5A 2EBIA 4CCLA 4CCMA 4NNJA 5IOYA 3CCQI 1ODDA 3QPTA 2OA4A 1SD6A 1HA8A 1VQMI 2F5FA 4AWXB 2XB5A 1ETYA 4E7ZA 3ZQGA 5DM6F 3MZ8A 4ESFA 2JZYA 3ZXSA 5IY5H 3BG3A 3VSKA 2DOFA 3AG2H 1V4RA 4NUBA 1U8RA 2WAEA 4FX4A 1G3SA 2VC1A 2FJ1A 4XSXF 1T8IA 1USTA 3EETA 3I64A 1JJ8C 2GXGA 3OYMA 4WCGA 2R7TA 3CMMA 3S3OA 2LMDA 4ESJA 3CMAI 5FGMA 1LJ9A 3KP6A 1R9TJ 1EKEA 2ESNA 1K4TA 1A6QA 1G3WA 1ZLJA 4M9XA 1R1UA 4CXFA 3WTSC 5F64A 2Q2EB 2EFPA 1T6SA 1E3OC 1HC8A 3MZYA 2GA2A 2DFEA 1EA3A 4PSXA 2VC0A 3HOWJ 4XL9A 1YITI 3MAJA 2JA2A 4RAGA 4GDFA 2LBFA 3S2HJ 3DPTA 1P4WA 5E79C 3HPHA 2E7XA 5EG0A 1BOBA 2JA6J 1PYVA 3TP3A 3ZMSA 5DD4A 4RDUA 1YW9A 2CWEA 1VQ7I 4GRIA 1PUFB 4CZZA 3HZJA 3FXMA 2H09A 1DPUA 4IRGA 5EJCA 5IT3A 4A6EA 1SMTA 3CCJI 1LFPA 3RZDJ 1RR7A 3CC2I 3TEDA 2X6XA 1ENHA 3QOPA 1WGXA 3L00A 3K1MA 2ZSIB 1BM9A 4MO7A 3TGNA 3OSGA 2IEKA 3S2WA 3DFGA 3J7YJ 2XROA 5B66C 2EFQA 2JTVA 1N78A 2O61A 2ELKA 4XRFA 1XGOA 3ZPLA 1AA7A 1F36A 3HGYA 4D1QA 2ZJQF 2K40A 3VWBA 3DU5A 1LE8B 2H8RA 3EUKL 3K70C 3BR0A 1F43A 4DIQA 4EGYA 1AKHA 1TT0A 3N97A 2A6HF 3I4NJ 3MKWB 2WB1N 3GXOA 2Z9OA 4ZZDA 4RM3A 3WE2A 3TW7A 5CQEA 1W0TA 1S8NA 2Q8KA 3LSIA 2HXIA 3M07A 4I0AA 2GOMA 4RA2A 2IRFG 1OKRA 2IBDA 1IW7F 1V5GA 4CZCA 3HKZA 4HEA2 2DODA 3GTPJ 1P7JA 3SFZA 1A04A 1OR7C 4CGZA 1QBJA 4XNFA 5L3EA 2KDZA 3K10A 1ZLKA 3BJOA 2L7ZA 5JR3A 4Y52J 1OCCH 1J09A 4HF1A 4WX9A 3IKTA 5M3FJ 3BTJA 3O3KA 3GW2A 2MFZA 2XKPA 3KZIC 3B6AA 2ELHA 1HF0A 2R7WA 2GXAA 4HA8A 1UMQA 4EM0B 2HQ5A 3LSHA 3VDXA 3JRAA 3DKXA 5KNLA 3IV5A 2L5QA 3JCUC 1U5TB 3FM3A 3WTZA 1T33A 3KEOA 1XN7A 4BXFA 2GAUA 1T0FC 1WHUA 2QQAA 3A02A 3FK7A 1S6LA 2VASA 3NAUA 3I55I 4OIPF 5FKOA 3JSPA 1E3HA 5F0CA 2VOPA 1B9MA 4HV6A 3GTGJ 4G6QA 2KRFA 2P5LC 2LLKA 3C18A 5TISC 4DYRA 4W1UA 3ABTA 3OYEA 5J8CA 3GFLA 3H0DA 2E1NA 2K9NA 2LY2A 3M4OJ 2HOEA 2YU9J 2DYSH 2VKDA 3ONQA 1BIAA 2OZ6A 1SD4A 1RIOH 2AS5F 3LMMA 1C0WA 2EILH 2LH9A 3K69A 3OYKA 4GXOA 3T8RA 4YIRX 3ECOA 4M3BA 3HHGA 4KA4A 2CSOA 3BJ6A 3F8FA 2DPDA 4N9HA 4A69C 4YFKF 1H88C 3PQJA 1XGNA 2IJLA 2QUFA 1HDPA 1MBGA 4HOBA 1R1VA 1Z7UA 3NWSA 4CO8A 2H1LA 4GCVA 5CQGA 4XOPA 3KYDB 3CCUI 1FYKA 2BW3A 3JTHA 2JRMA 4K2EA 3ERMA 2FBHA 1BR4A 4M9ZA 1WRJA 4S04A 1BI3A 2M5WA 3G6EI 4KDPA 2GIZA 1FYLA 2WAQA 2XF7A 3ZMTA 3CMYA 2XF5A 3CDLA 1XDSA 2V1XA 5JVGF 2DMNA 4FE7A 1DQUA 4XKVA 2M30A 3LFKA 3L2QA 3V8KA 2QSFX 4XKWA 3HRTA 1PUEE 5ED4A 4BDYA 4B44A 4EJTA 3C2GA 1MNMC 1P4AA 2NOGA 4C3IJ 2WA0A 3UNGC 4EMSA 4CICA 4UUSB 1FSHA 4MFEA 4HBLA 5F1JA 1MBFA 1J75A 1MH3A 3BPVA 1FOKA 2PJPA 3W2AA 2JQ7A 4XR6A 4BU2A 1OPCA 4MEXF 3WTYC 2COBA 2M8EA 2ZB9A 4FASD 2PMZA 3C7JA 1ERDA 1G8XA 3HJEA 1KYWA 3MVPA 1MBHA 1YIOA 1MBKA 3LAPA 5JHUA 5F0HA 2DQRA 3K0LA 5F27A 1F1ZA 2ZXWH 1W5CC 2BVLA 4I09A 4BQQA 3CUQB 4PJNA 2EINH 1WWXA 2JT1A 5DYMA 5AONA 5EEGA 4XONA 1U9NA 1X1CA 2DA6A 2L2OA 2W57A 3FM5A 3L1PA 1I6HJ 4PJLA 1W0UA 2LF8A 2LYCA 3BCBA 3EYYA 1AU7A 2ECCA 1PP7U 1W36C 5M5XJ 5L3CA 3O8HA 3H5NA 1VQ8I 3PNVA 1YE9A 1FJLA 1VNDA 1BC8C 3C2BA 3H3UA 3TBIA 1G2HA 3PNTA 1LNWA 3RYRA 2IS6A 1SC7A 4HAMA 2CW8A 2X6OA 3JRDA 2NXNB 3KYLA 3KP4A 3TKYA 1ZAOA 2DYRH 3H9GA 3F8BA 3M1EA 3OYGA 2BXYA 3ECHA 1HKTA 4E7KA 3GTQJ 1TL8A 3G1OA 5GPAA 3BTIA 1ZQ3P 4JK1X 2VUMJ 2IGKA 2DOAA 2OZUA 3H5RA 2BEOA 1SFUA 3D5LA 4QTRA 3F8CA 1NG7A 4BH9A 1KU3A 2M34A 1R5HA 4R79A 2E71A 2Y75A 3HHHA 3H9JA 3V8JA 2NS7A 3S14J 2ELJA 2L9VA 1VF9A 2HGCA 1ZG3A 3W2WA 1QPIA 2IA1A 2HKOA 2DFFA 4B1RA 5F6FA 1TQPA 5IOZA 5BNGA 4A3CJ 3Q9VA 1G3YA 1VZ0A 1HSJA 2FF4A 1YRNA 2TDXA 3OYBA 4RGSA 2VQCA 1I3AA 1LKXA 2K7LA 3J7ZI 1VQ9I 4I2OA 1IO2A 5KAIC 4EM1A 2ESHA 2KMUA 3E6MA 5IPAA 5DM7F 1OCPA 5D4SA 2VQHA 4OMYA 3VODA 5JI6A 1SFEA 2HI3A 3RQ4A 3A4CA 5HDKA 2LBFB 5L3DA 2WY7Q 4MGRA 4Q5SF 2X6WA 1WI3A 3RI4A 2EQRA 3L9FA 1X3ZB 1I27A 2D45A 5C4JJ 5EG0B 2V9KA 3I71A 1S9HA 3ZGKA 1H9GA 2EV6A 2CFOA 2A05A 2F6CA 2W7NA 2E60A 3RCOA 2OQRA 5AIPA 3WGHA 2O8XA 1FNNA 1WJ5A 3T0YA 1FT9A 4XBFA 3ZMUA 4AIDA 2EFWA 2MW8A 3MMYB 5K5QA 2XGEA 1OR7A 4GYGA 2FOKA 2QGUA 2R7OA 4XKCA 1U3EM 1JKQC 4HSRA 2ZO4A 1Y8QB 3ZOBA 1I39A 1K61A 3LQRA 4AD9A 3GFIA 1OISA 2R7VA 2GZWA 1UHMA 3HRMA 3CCEI 2BYVE 4RB1A 3IUOA 4CH7A 5F04A 1N25A 3W2VA 1A35A 2JSPA 1MNEA 1R23A 3E6BA 4L9TA 4A12A 1D1BA 5E18F 1E2XA 5KVRA 4M6VA 2Q1ZB 1T0FA 4MQVA 3Q0WA 2IP2A 3BP8A 4RGRA 2DT6A 1XMKA 1JT6A 2KP6A 3IAS2 4HF0A 3PSFA 2V6CA 4WK8F 1M1EB 1VQOI 1YW8A 2VKEA 4PUSA 1KZHA 1CF7A 3E5QA 3VB2A 1TQMA 3CZ6A 1XTAA 1BJAA 5B5EC 1D8KA 2HWVA 2OF7A 4A0ZA 4UUTA 2K9LA 1OCTC 1SVMA 2CH0A 2F48A 4UUVA 1ZREA 2DI3A 5K7FA 3FF5A 1H0MA 4IHWA 2LY1A 5J1YA 5J1RA 3OYCA 1DUXC 5CJ9A 3F21A 3IWZA 4AU7A 3PIPF 3IHUA 4HLXA 4LB6B 1QZEA 3HDDA 2A68F 3PO3J 1OCZH 1WKMA 2K85A 2Y9YA 3HIFA 3GTMJ 1ZTRA 2WBMA 1QVUA 2ME0A 1LDDA 4ZTJA 1PJRA 2H1KA 2LOOA 4JX4A 2UV1A 3J80Z 3KE2A 4F3QA 3JRHA 1TNSA 5HLHA 4PFPA 3CJQB 3I3LA 1SD5A 3ZRGA 5DUKA 2VPLA 1JTYA 4LLGF 1TC3C 2RN7A 4JBAA 3KETA 3CCYA 4Q4ZF 1QZZA 4A3FJ 4F52A 4BDZA 3A01A 5E8IA 2FD5A 2IS1A 2O9LA 2PEXA 1QGPA 4NC6A 4EJWA 1Q1HA 5LHIA 1ETQA 2YR2A 2VBYA 1CGPA 3DBLB 1ZHFA 3QPHA 3W6JB 1FEXA 3R6SA 3K2ZA 2VIXA 4BS9A 3J81Z 1K79A 2MYSA 3KPHA 2XIGA 1V54H 1RZ4A 1B1BA 2XPVA 1KYZA 1XCVA 2XAUA 2MD0A 1R36A 3S93A 3S2DJ 2VJ4A 1KONA 2ZKZA 3TL4X 3K4MA 4EM2A 1B9NA 3GLLA 3LA2A 4BY7J 4KUMA 4P96A 4U0YA 2E7WA 1J5YA 3HM5A 4IZZA 4Z6YA 2UXXA 2NOJB 4RGXA 3VOEA 2B7EA 2FQ4A 4IHSA 1XDUA 1FP1D 2DA2A 2CUJA 5DDGA 3IRQA 4BHBA 2FUG2 1UG0A 3ABLH 2G9WA 2VJIA 2P0WA 2QVOA 2PN6A 1KU7A 4BJ6C 2ECBA 1DGWY 4RAFA 3DU6A 4UB6C 1HLVA 2L3DA 3FXUA 3QYFA 4DYQA 3GLXA 4C9YA 3DEEA 2V1UA 1LVAA 1TW2A 3RQIA 4M3DA 1JHFA 3U21A 3FZVA 4M72A 2A69F 4ZYDA 3LSRA 1B59A 4HDVA 1FIPA 1O3TA 4PSWA 1GT0C 3CD6I 4HW0A 4UVBA 5C3EJ 1MZBA 2BY0A 5L3FA 1MJ9A 2Y0MA 2ZMEC 1IN5A 2EPFA 4BUPA 3G3ZA 1BOAA 2DO7A 4KN4X 1S7AA 2EWNA 3DXJF 4IRHA 4G12A 5B1AH 5J1UA 5IYCJ 2CW7A 2M2EA 2HPMA 1WSUA 1IRGA 1LEBA 1OMIA 3K7AJ 5BOXA 3HSEA 2FEZA 3HOUJ 1WFXA 2JA8J 1BL0A 1LEAA 4ZJZA 2VE8A 3A2KA 4L18B 1OYYA 1T56A 2O0YA 3BZKA 1ETWA 3RYPA 3DTKA 2ETHA 2R7FA 3R60A 4FE4A 4HQMA 3TDUC 4F93B 2DCEA 1BIBA 4G8XA 2MH2A 3GBGA 1ETVA 3CUQA 2A61A 3FDYA 1S29A 3D0SA 1XGSA 3WU1B 4E7LA 4ZH4F 1L0OC 3ZN1A 4IKFA 1RETA 2M3AA 3Q5FA 4R1HA 2Y0SA 4DZPA 3NARA 5F08A 2JN6A 2CUFA 4B43A 2V1DA 1P7IA 4RAZA 1IZ1A 2BZTA 4DW6A 1T39A 4OOIA 2IGOA 4I0BA 3F9KA 4AVPA 1YRNB 4HNVA 3EUHA 3CCSI 3IRRA 3ASOH 4IPAA 3S8PA 4I01A 1I1GA 4NHJA 4IX7A 5HLIA 1XSVA 2R7XA 4ZDPA 1J59A 5LHHA 3S16J 3OS1A 3X2QH 4KITB 1P9QC 1HBXG 3HOYJ 3U1KA 1TW3A 3FXLA 3LOCA 4LMYA 2Y30A 5A2QZ 1DU0A 1FTTA 3LSPA 3MWMA 1ORKA 2BY3A 3L2VA 1YJWI 2V26A 2JRTA 2FMLA 2LSOA 2E34A 5D5XB 1A31A 3CCRI 5E1WA 1ZGJA 1FLIA 4XICA 1I6XA 1B72A 2FNPA 2F5CA 4P5OA 2K9QA 2VT3A 4B3XA 3LSMA 3LAJA 3JRGA 1DP7P 1EH8A 1IJWC 3I58A 1B6AA 4W97A 1H89C 2E2IJ 2O8KA 4ENNA 2LKXA 4WXDA 1FSEA 2N8GA 2PQ8A 5E1ZB 5LRSA 1MW7A 2TRTA 3ZMDA 4NDLA 2LREA 1VQ5I 2HDWA 2VE9A 1VQKI 3R61A 4IHTA 1XSXA 5K5OA 5IT9Z 4EJOA 4ESBA 4YFNF 3MKZA 4IHVA 2ISYA 2LNBA 3O8GA 2OC6A 4EV0A 4H0EA 5FJ8J 1MSFC 2P7CB 1LFBA 2JA5J 4IF4A 4NC8A 2Y69H 4KIBA 1G6NA 2R7DA 2L7FP 1SMYF 2P6TA 3I9V2 2QM3A 1G4DA 2RQPA 3S3NA 1ONVA 2E19A 4M3FA 4JP0A 1LDJA 1XD7A 1RI7A 1IV8A 5ICGA 3HL2A 2I5UA 1Z6TA 2XKOA 5FLXZ 1UAAA 3OYFA 3O6BB 3CCMI 1JE8A 3V4GA 2NVTJ 2OTJI 5M5YJ 2NNYA 2WC2A 2EZIA 1IXRC 4IOCF 2IA0A 2CV1A 1Y6IA 2Z16A 1Z0XA 2EFOA 1YLFA 2XAGA 3FXJA 1CF7B 2Z33A 4V2FA 4YFXF 2YS9A 1I1SA 1JT0A 1IN7A 2L02A 2VOOA 5AIQA 1QVTA 2RNGA 1WH5A 2XB0X 1LDKB 1D3YA 1LFUP 2CV2A 3JSOA 2NVQJ 3SDGA 5FKMA 1GV2A 1VQPI 1IC8A 3JRCA 1QA6A 2IXSA 2K3PA 3OSFA 3K4CA 2CMPA 1E3PA 1WI9A 1MH4A 1JXSA 4RS8A 2R0QC 4P9UA 4IJAA 3H3VK 4XLEA 2CGPA 1XX5A 1DPRA 4BHPA 4R8HA 1ZRDA 3DPUA 4CUGA 3D1NI 5LEJA 2OV7A 2HR3A 5B1BH 1WPKA 3QAHA 1ON1A 5HS9A 3TOAA 2HOTA 1YHQI 4Y13A 2P8TA 3PO2J 3MD2A 2IAIA 2DA5A 2V7FA 1KU2A 2FX0A 4RMNA 1SEUA 1XMAA 1X1AA 4M3GA 1WJBA 3A01B 4G7OF 4AYBA 3WHBA 1APLC 3DCFA 4DOZA 1HQCA 4FETA 3G1MA 1T38A 2HDDA 2I8DA 2DJIA 1KQ0A 5J40A 2IW5A 4E4HA 2HFHA 4KIFA 3K9TA 3DBRB 1R5ID 4B47A 5E17F 4I02A 2UZKA 3HC7A 1SVOA 4A6DA 4ZZLA 3FIWA 1JUSA 4KN7X 2OQGA 1HW5A 4BQOA 2KL4A 2O7OA 5CVRA 3SJMA 2V1NA 3I5UA 1G3TA 5EYRA 1S7EA 5D4RA 2Y48A 2R92J 2XF6A 5IYDJ 5JLXA 5D8KB 5FFXA 5B3SH 3JRFA 3K1NA 5IP7J 2HEOA 2QZ8A 2EIMH 2RQQA 4XLHA 4I98B 4QPQA 4BACA 1ZGWA 2Y9ZA 2O6GE 4IXAA 5IP9J 1XG1A 2DDAA 3ZMVA 2CYYA 2K5CA 3WTTC 5C44J 2CJJA 1NK2P 2HQNA 1KA8A 2P6SA 3S32A 4CSWA 4FQGA 3GZ5A 3PNYA 3C1DA 1Y8RB 3M8FA 1FMWA 3LL7A 4N0BA 4UXNA 2XASA 1LPQA 1W7PD 2FE3A 2PI0A 2Y2ZA 4L0YB 4ON0A 1JI8A 4Y17A 1J7KA 4DZJA 1YW7A 3FKIJ 4OIQF 2QBYA 4HLYA 2QKMB 4A3GJ 4I6ZA 2A5WA 2W85A 2W00A 2EZHA 3HGGA 3JAMK 4ZTFA 2VL8A 2E2HJ 1YTYA 3E5UA 4DJAA 2FBKA 4C2TA 3H3ZA 4HDUA 3CDHA 1HW2A 1EH6A 1LVKA 2EA4A 1U8BA 3J7AY 4HV5A 2BVMA 2XAJA 3ISPA 4E7JA 3CCLI 3EPZA 3IP4B 2LKSA 1WJEA 1VQLI 4WXHA 1FOYA 4P55A 2GIVA 3RIRA 2BBYA 2P5VA 2X1EA 1QU3A 3QYBA 5HDGA 3D5RC 3LA3A 5CKTA 1Z6RA 2GBYA 5KHDA 2ID6A 3BTLA 3L7WA 4Q48A 4F7ZA 1Z9CA 2CQ7A 2CS3A 3SEQA 1ETXA 3QPLA 4S0HB 2MG4A 2OCEA 1J9IA 3KX2A 2LTPA 2YUSA 2HPIA 3RTRA 1UB9A 3FXRA 3HG9A 2KRCA 2MLGA 2M0CA 4A3EJ 3V7SA 3LWFA 4A3KJ 2RC4A 1D1CA 3E5XA 3F0CA 3FBIB 5EF6A 2HVSA 4A3DJ 3S15J 3WTWC 1PDNC 3C3WA 3WU2C 1IRZA 4IEJA 1D5VA 2CW0F 3DP7A 1K6YA 2PG4A 2PMUA 3F6OA 3LSGA 2MLKA 3MN2A 1SANA 2CRGA 5HS7A 5D6FA 4D5FA 2R7SA 5LGNA 1MD0A 2DK5A 5ILVA 3BLYA 4OMZA 5GAEJ 4MTEA 4N4NB 4L5EA 4BE2A 3WG9A 2VQLA 4LGWA 2ZXHA 4WXCA 3BTCA 2PMHA 3FXOA 1IRFA 4EATA 3RDIA 4DQ2A 3G1LA 1R4NB 1Y0NA 4Y4RA 1WZ2A 2R7UA 2DAOA 2QSGX 3HOVJ 1X1BA 1XMXA 3GEZA 4XN0A 4M73A 2DBBA 3I4PA 1FTZA 2W84A 2FRHA 5HNFA 2F5EA 5EEAA 2HQAA 2M7BA 4JYKA 4H4KC 4L9JA 1I3QJ 3GWZA 3S1RJ 2QLZA 1MMDA 4RLFA 2OPTA 3VFZA 4GFBA 3WG7H 2H94A 3DTIA 3DBHB 4QIWN 2DDBA 3K70D 3LNQA 1LB2A 2C6YA 1ON2A 1WVRA 2O5RA 5J4YA 1B72B 4I76A 3OYLA 4NQWA 2F5VA 2WADA 1O3SA 2ZFUA 3G4SI 5K7HA 4RGUA 3HXLA 1GLNA 4RB3C 4OAYA 1XB4A 2NRAC 1E17A 1W1WE 2LC2A 1T98A 2KLOA 3I4MJ 1FYMA 1RESA 1QO0D 4QWQA 1S72I 1A36A 5LGTA 1BR1A 1POGA 4HNTA 1BI0A 2X1CA 2OUMA 4HSTA 4I7HA 4F92B 3E1SA 5CVUA 2XUBA 4BJTA 3PJRA 3PFYA 4D0PA 3SZTA 5J8FA 3IKVA 5K1YA 4PZJA 5M5WJ 2YX7A 3ZR8X 5FRMA 4M6YA 2ZSHB 3JRBA 1AOYA 1JKPC 3CP8A 4UV8A 1OCRH 5FKKA 3OYDA 3F6VA 3H35A 3FX3A 3J80K 1V5FA 2KKOA 1NTCA 3AL0B 2QCOA 4LLNA 1TBXA 5LFAA 4YIIA 1F5TA 4AIKA 3BR5A 3VYSB 4AM3A 2L0KA 2MSYA 2JA7J 3BPXA 4ENMA 1JGSA 3E6DA 4II2A 4AC0A 5FB2A 3ZQQA 4ITVA 3U1DA 4EEFG 2VODA 5LD2C 2X51A 3N05A 3ABMH 3BCAA 1MGTA 1TWHJ 2RREA 2WY8Q 4U7DA 2VONA 2XVCA 1IXSB 1YQAA 2IPQX 2MGQA 4FX0A 5EEHA 2GA1A 4JX5A 2Z99A 5FROA 3H1CA 4EQQA 4ZYGA 3HKZN 3J81K 4IQ4A 2XC7A 5D6EA 2DMQA 5HS8A 4OIRF 1ZG1A 1UJ8A 2UXNA 5E3OA 3HOTA 3QP6A 4NB5A 3ZQ7A 1MMGA 3E3VA 2GQQA 4IQJA 2ZXJA 2WV0A 3BZCA 3IH2A 1P6RA 1TWFJ 4LFUA 2HXOA 4FT8A 2NAZA 5CVIA 3BY6A 4UV9A 1IG7A 1IUFA 1ZR4A 5BQTA 1MNDA 3IC7A 2CQNA 2HKXA 4XM3A 3S3MA 5FRNA 3HB9A 3RPUD 1QHGA 2CQXA 3CDIA 5E1XA 4G6TB 4L5IA 4F91B 3Q3SA 3BROA 5L3GA 1IAWA 3VYRB 3K1PA 3SEZA 3RKYA 2Z1DA 2OAZA 3PSIA 3O2PE 1UHSA 5JFRA 2M8GX 4E7SA 3IH4A 3S1QJ 3OWTA 1SFKA 2CO5A 2PJRA 2WV1A 2EV0A 4PJJA 1SAXA 2KT0A 2ADUA 1TWGJ 2V79A 4DBQA 4DYCA 1DP3A 2DU9A 1F9NA 2DTRA 4F55A 2RKHA 1BI2A 4XRMA 5JHFA 2KZVA 3BG5A 2P81A 4KYWA 1BC7C 2UWMA 2WB1A 4IHYA 2ICWG 4B3AA 2XV4S 4V19K 4ETSA 2MABA 3BDDA 3ZQIA 3GMEA 4X0GA 4KICA 2DJNA 2LFBA 3LSJA 1IN4A 1ZN2A 2W82A 2X0LA 3W6VA 3AKZA 3QODA 3H0GJ 3RZOJ 2K4BA 1R58A 3FHZA 2LRDA 1WCMJ 2XPWA 2NVXJ 1ULYA 2DLLA 4C2UA 2DW4A 3KZYA 2WAQN 4B09A 1BR2A 4MHGA 3OY9A 4A3BJ 3Q9SA 1Z1DA 2QBYB 3M3YJ 5E3MA 4BNCA 5J47A 2QKLB 4ZDOA 3SQNA 3NWTA 3G73A 3QRFF 4MTDA 3G71I 5FKNA 1X19A 3F23A 2VI6A 2DT5A 4U88A 5DEQA 4UHTA 4A0YA 3GO5A 2QEXI 3CLQA 2WWYA 1YFHA 4XN3A 4DNCA 3UKGA 4LLLA 3R0JA 1ZYRF 2G0EA 1UELB 4Y33A 2KIMA 5HLGA 1YO5C 1HW1A 3K4KA 1MMSA 2K3FA 2ZJ2A 3WU0A 5ICCA 4BY1J 2DA7A 5M3MJ 1X4PA 2X85A 2D1VA 3I53A 1YJNI 4YELA 4YEJA 1MIJA 2PMZN 4ZDLA 3J7AO 4RB0A 1UZCA 5F0FA 2MD5A 3JR9A 4CCKA 3R4KA 2KDOA 4KNYA 1KQ8A 1MJBA 1A5JA 2ZJPF 3MQ0A 1JHHA 4C2MJ 2DFIA 2JUGA 5FLVA 1QQIA 1N75A 3L09A 4YRVA 1JUMA 3QQAA 2R3SA 2ZC2A 1T2KA 1B8IB 2DN0A 2O3FA 1D0XA 1X3UA 2R7ZJ 3NRVA 1ITYA 1IN8A 1YIJI 1GVJA 5CPRB 5D5WB 2A6TA 3E7LA 4QLCU 1JGGA 1HOMA 4II3A 3V7RA 3VYTB 4LB5A 1NK3P 1D0YA 4XRSG 4D9JA 2RV8A 5BPIA 3Q0VA 4C3HJ 4XQFA 2QA4I 2G7HA 1U6GA 2AXLA 4XLAA 3TOBA 2DMPA 3T5XA 4OWRB 1Z67A 2E1MC 2ACJA 5IT9K 2V4JC 2HOSA 4OINF 3GFJA 3S1MJ 4HF2A 1LUJB 3HUGA 3FWEA 3H9QA 4Y3OA 2KFDA 4BYYA 3NQOA 3OIQA 3B6CA 4O5VA 2EFNA 4XOTA 3A03A 4X1EA 2BY1A 3ZP5A 5EZHA 1FY7A 2P4WA 2DQLA 2XGXA 1JUPA 1WQ2A 3KZZA 3A1YA 2L01A 5L3BA 1F4KA 4M9SA 2L9RA 2CU7A 5CYVA 4XSZF 1NHAA 3QYEA 5BS6A 2M7AA 5E3LA 3H92A 3P9CA 3GZ6A 3REOA 3DF8A 2AHQA 1AWCA 4NQWB 5ERIA 2L7KA 2VBXA 2GWRA 2JVGA 3HTUA 2NVYJ 3KLNA 4P1WA 5LRRA 4BAYA 4DBRA 5DS9A 2JSCA 2EJRA 2DT7B 1HSTA 2QQBA 3ZN0A 2FMYA 2BHZA 3F8NA 1X2MA 2DPUA 2M4GA 1JTXA 4GO1A 2VKVA 1J2XA 2B0LA 1MJAA 3V8LA 1X2NA 2HDCA 5GAHJ 1FOXA 1IUYA 1VTNC 3EYIA 3B73A 3ZQFA 5CLSA 2EZLA 2K4JA 3OIOA 3BQYA 1YOVB 1RNLA 2KJBA 1BJZA 2IS2A 3F3XA 2VT2A 1VI0A 1FZPB 3DPLC 4HX8A 2VPRA 3P9IA 5GTHC 5DCMA 4ZYHA 2VQGA 3QU6A 5TGTA 4HYEA 2TCTA 5GADJ 4EGZA 1K78A 4CYDA 2M45A 3TO7A 4ABZA 5ILUA 1SD7A 4G7ZF 5K5RA 2W1OA 2M4KA 5HLTA 1GHCA 3CO7C 3L2CA 2BXZA 3RJPA 4BE0A 3DTEA 4FCYA 5FKLA 3OMYA 4A2UA 4XLNF 1QNTA 1KQ9A 1V3FA 4G9YA 4S05A 2FQ3A 3HPGA 4O6JA 4PGGA 4U0WA 1R5GA 1XCBA 2E5NA 4OU0A 2FXAA 3FHNA 4KJZA 4UY8I 3BJAA 2LD5A 4BXUA 3TW6A 4IOAF 4JX6A 3CF2A 4BEHA 3KCCA 1FX7A 2NS8A 5FD6A 1STZA 3QP5A 3MFKA 5TRDA 4OAZA 3DV8A 2MA3A 2AQEA 2ID3A 3BZ6A 2BOLA 5H2FC 2KRHA 2JWTA 3SZPA 5E20A 2DTZA 1IDYA 4NBQA 2L4AA 2Z2SB 3K4JA 5IP6A 4IO9F 2VBZA 2AO9A 3RKQA 1GXPA 3RPQA 3BR6A 4J00A 4A0XA 1HDDC 1A6IA 3DQVC 1TLHB 1IN6A 1OYIA 1Z7LA 3EUAA 4LG0A 4BGDA 1K6OA 2E2JJ 5BPDA 4HZFA 4LIVA 3P7NA 4QPOA 4LOCA 4U7BA 2DFHA 3VEPA 2XGDA 2ZNZA 2VLAA 2L4MA 4L9NA 4U87A 1XSDA 2BHYA 3SXYA 3TO9A 1FIAA 2DMTA 3JTGA 1QHHD 2H8WA 3M9AA 1Q1VA 4FISA 1XGMA 4BKXA 2HS5A 3SHFA 3R0AA 1I5ZA 4M3EA 1X4OA 2PJRB 2OCCH 3TDZC 3U2RA 3BG9A 1YI2I 2XHKA 3IH3A 2IGNA 1AHDP 1H8AC 1G59A 5ICFA 3F22A 4A5NA 4N9IA 2UUZA 1OCOH 2KZGA 2X48A 1D1AA 3CTAA 2PFBA 4B48A 3PM1A 3NEUA 4QSHA 1R7JA 3H36A 2XDVA 2EA2A 1W4MA 3KEYA 5HNHA 1R1TA 2EIJH 2EB7A 4HX7A 5H20A 1X58A 1ZG5A 3CJTB 4A3MJ 3AG4H 4P9FA 3W6KB 2W25A 3GZNB 3T8TA 1ACIA 1N77A 3BT9A 2RAEA 4YIFA 5LGUA 1R49A 2XPUA 4KMUX 4CCOA 2L7MP 1NH3A 1RRJA 1OYWA 4Y7NJ 2VJJA 5EGOA 3CC7I 2V9PA 3WGGA 5C4XJ 9ANTA 1U0JA 1YX3A 3OS0A 2IT0A 1Y0UA 2MC3A 4CCNA 1MMAA 3M1CA 3B02A 1E0EA 1Y1WJ 2F4IA 2R5YA 3BR1A 4OIOF 3HSRA 3JRIA 3GTKJ 3HOSA 4CDGA 3CQZJ 3QU3A 1RKTA 3HEFA 4JOMA 2Z3YA 2FSWA 1IDZA 2BY2A 2FOWA 3T1BA 2X4HA 1R71A 4IHXA 2HNHA 1QPMA 2OD5A 3E97A 2QYOA 2ZMEA 4LJZF 2HZDA 1DDNA 1MDMA 1WH7A 1CQTA 3LFUA 3OV8A 1WJFA 4YG2F 1FBSA 4AIHA 3M8JA 4UVAA 2H6BA 1BW6A 4KIGA 2GOXB 3SZGA 3L2WA 1MBJA 2PLYA 1T08B 3CCVI 4V2GA 1R00A 4KMFA 3I54A 4E7IA 1O3QA 2IGMA 1ZELA 3AAFA 2QQ9A 2DXIA 5GAGJ 1VQ4I 1ZKGA 4XRSA 2VXZA 1IGNA 5E8GA 1WJDA 1Z77A 3EQLF 2R4GA 2YU3A 4N4OB 4XORA 3RSNA 1VQNI 1WJAA 3GTOJ 5CVVA 3D5SC 3W3CA 4PDKA 2K86A 3KYCB 1PVEA 3ZMZA 4GGGA 2NYXA 3FXKA 4LG3A 4BBRJ 3ULQB 3CMEI 4EVIA 3COAC 1H9TA 2KIQA 4XLFA 5H6QA 2A5YB 2LY9A 2ME6A 2F2EA 2HYFA 4WWCA 1Z3XA 4TV7A 4E6KG 3CLOA 1O7FA 3WHCA 1SFXA 2V6EA 2COMA 2M0MA 1RUNA 4ENKA 5HODA 4CYCA 2F5DA 3GUDA 4C3JJ 3HOZJ 2DA4A 3OOPA 1R22A 2CG4A 1Y56A 4UVCA 3FK6A 1ZK8A 1V5EA 1Z21A 3BG6A 5JLWA 4MEYF 3SYTA 2JJ7A 2XRLA 3HUGB 1RR8C 2CUEA 2MBFA 1B8IA 4M71A 1T95A 1W5TA 4IVNA 1MKMA 2M1BA 2VBWA 4HX4A 3M7GA 5J3LA 2X9DA 1U5TC 1W7PA 5GPCA 2PBIA 3HRSA 3SFIA 3CUOA 2VJ5A 2Y0SN 1U78A 1K83J 3DWLE 3IL2A 2QSHX 2H27A 1FP2A 2KISA 4ZYEA 5K7ZA 1D5YA 3E6CC 3HTSB 2HQRA 2IVMA 3PQKA 2E36A 4J01A 3MEXA 1J0RA 5LEKA 1IXCA 2NNNA 3BWGA 2KHMA 4BHCA 4HRIA 2JMWA 5DTDA 3TMOA 4J19A 1IV6A 1RC9A 4A5MA 1DU6A 1R4MB 3CF5F 4RB2C 1ZRFA 1OQYA 4RLQA 1GVDA 2ZCWA 1LQ1A 4KFCA 2LKPA 4PFOA 3TO6A 4XK4A 5E3NA 2NVUB 1U2WA 3ZQCA 3GFMA 5EDNA 4PJMA 4PJ0C 2XAFA 4IL6C 2OJED 3DEUA 4PCQA 5FFZA 5HDNA 1O7LA 5DV5A 2R5ZA 2XGCA 2OTLI 2LVSA 3U9GA 2HVRA 2F4OB 3OYNA 4XLPF 1I50J 2MC4A 1YS6A 1HKSA 3KEQA 1IRXA 1RPWA 3LSTA 2K9MA 3I59B 3RKWA 2HZTA 4DGWB 1QRYA 2J5OA 2DOEA 4RM2A 3FMQA 3ESWB 1FBUA 4G94A 5H6RA 3GX4X 2HU9A 4XMYA 3UR3C 4MQ9F 2CV0A 2K02A 5DCMB 2YX4A 4G7HF 1BI1A 2P5KA 1P2FA 3Q0UA 3OS2A 3JW4A 1K78B 3A0BC 5KAFC 2J5PA 1O4XA 1GXQA 4XIDA 3JAMZ 2D1HA 1OLTA 3DKWA 4ZYAA 5EZGA 1XS9A 1JJ6C 5FO5A 3LA7A 4AUXA 1SVLA 2CQKA 4G6DA 3WTXC 1QZYA 3WODF 1EH7A 2VB6A 1PP8F 1V55H 3ABKH 3KLOA 4UNOA 2XAQA 3BOQA 2EK5A 3K6GA 2LP0A 2HYGD 3FISA 3QWLA 1REPC 2RGVA 2W4SA 3EDPA 3P5JA 4MFDA 3KIOA 2L54A 3OL3A 3VYUB 1YJ9I 2F4MB 3BC8A 3OIPA 3HYIA 1ZR2A 2D5VA 2XRNA 3KP7A 4NC7A 5KCMA 4BEHB 1RUOA 1HCRA 4KISA 2P7VB 2YPRA 6PAXA 1TT5B 1KGSA 3ASNH 3AG1H 4LIUA 5IYBJ 4E70A 3ML6A 2KIUA 5J4VA 2RVCA 1S5LC 2HTJA 4E7HA 1MMNA 3KP5A 3CUQC 4O3MA 3GTLJ 1FPQA 1FBQA 5HOOA 3VPRA 5D5UB 3OYJA 4RBOA 1JKRC 2X1DA 2R7QA 3S1NJ 4CHUA 3TQNA 4LG0B 2HVQA 2LR8A
chains in the Genus database with same CATH topology
3F8MA 2ZFWA 2ZBKA 3KFWX 1HXDA 4M74A 1B4AA 2LF7A 4L5JA 2Q2EA 1W5SA 2O03A 2K27A 1YS7A 4KT5C 1EV7A 2BV6A 2ISZA 3WTVC 2ZNYA 2FNAA 2LDUA 3ABUA 2BGCA 3GVAA 4GYIA 2Q0OA 3GYHX 2STTA 2KIFA 4Q47A 2JPBA 1ZRCA 4L9VA 2OBPA 2OU2A 4RAYA 2JPCA 1IF1A 2D2WA 4L0ZB 3V7CA 1L3LA 3FMRA 3ROUA 2V9VA 1UCRA 5HVQC 2FBIA 4LD5A 2QWWA 4AIJA 1FC3A 5J6XA 5F1RA 5ICEA 1TQIA 3HSFA 2W24A 1K7AA 3GF2A 5FD5A 2HTSA 2A6EF 2ZMEB 4Z2YA 1MDMB 3FMSA 2QENA 1USSA 2GXBA 4Y15A 4HQEA 5KK1A 4PGHA 3RPUA 5CVJA 3FXQA 4M6XA 1TTYA 5LHGA 1O3RA 2M87A 4IRIA 2XAHA 2DK8A 3WGIA 4EJUA 1U5TA 5DD8A 1YG2A 3CJNA 5LBQA 4ASNA 1HKQA 4MNUA 5DCFA 3N4MA 4LK0F 1KU9A 1BN5A 3KP2A 2A3SA 3RKXA 2WTEA 5DUIA 4U0VA 3HRUA 5JVTA 1O57A 5D8LB 5A2QK 3IWFA 3M8EA 1FWZA 3F72A 5TJJA 3CO6C 2RDPA 2RNJA 2NS0A 1D8JA 2KJCA 1W7PB 2STWA 1Z05A 3MZHA 1UFMA 2MH9A 5D5VB 5ILSA 1ZGAA 1YYVA 2BE5F 3P9KA 3PFIA 4JQFA 4EJVA 1ZARA 3LQQA 4LK1F 3KP3A 2FU4A 2E1CA 1Z91A 4WF2A 3ERED 1ZH5A 2IA2A 1BBYA 2FA5A 5BMZA 1P4XA 1TNTA 3ELKA 3MCZA 2YSRA 5FLXK 2EV5A 1S7OA 3WE3A 3I0TA 4ENJA 1UHWA 2VN2A 2A07F 4BQAA 4B8XA 2H6CA 1S3JA 2Z5UA 1P92A 2G7UA 5LLQA 3WTUC 4FHTA 3I59A 2CFXA 1ODDA 3QPTA 2OA4A 1SD6A 2F5FA 4AWXB 4ESFA 2JZYA 1V4RA 1U8RA 4FX4A 1G3SA 2VC1A 4XSXF 1USTA 3EETA 3I64A 2GXGA 4WCGA 4ESJA 5FGMA 1LJ9A 3KP6A 2ESNA 1G3WA 1ZLJA 4M9XA 1R1UA 4CXFA 3WTSC 5F64A 2EFPA 1T6SA 3MZYA 2GA2A 2VC0A 3MAJA 3DPTA 1P4WA 2E7XA 3ZMSA 5DD4A 1YW9A 2CWEA 4CZZA 2H09A 1DPUA 4IRGA 5IT3A 4A6EA 1SMTA 3QOPA 3L00A 3K1MA 1BM9A 3TGNA 3S2WA 2XROA 3DFGA 2EFQA 2JTVA 2O61A 4XRFA 1XGOA 3ZPLA 4EGYA 3N97A 2A6HF 3GXOA 2Z9OA 4ZZDA 3WE2A 1S8NA 2Q8KA 4I0AA 2IRFG 1OKRA 1IW7F 3SFZA 1A04A 4CGZA 1QBJA 5L3EA 1ZLKA 3BJOA 5JR3A 4HF1A 4WX9A 3IKTA 3O3KA 3GW2A 2XKPA 2ELHA 4HA8A 4EM0B 1U5TB 3FM3A 3WTZA 3KEOA 1XN7A 2GAUA 2QQAA 1S6LA 4OIPF 3JSPA 2VOPA 1B9MA 4HV6A 4G6QA 2KRFA 2P5LC 3C18A 3ABTA 5J8CA 3GFLA 2E1NA 2HOEA 1BIAA 2OZ6A 1SD4A 1RIOH 2AS5F 1C0WA 3K69A 4GXOA 3T8RA 3ECOA 3HHGA 4KA4A 2CSOA 3BJ6A 3F8FA 2DPDA 4N9HA 4YFKF 3PQJA 1XGNA 2IJLA 2QUFA 4HOBA 1R1VA 1Z7UA 4CO8A 4GCVA 1FYKA 3JTHA 4K2EA 2FBHA 4M9ZA 1WRJA 4S04A 1BI3A 2M5WA 4KDPA 1FYLA 3ZMTA 1XDSA 2V1XA 2M30A 3LFKA 3V8KA 3HRTA 1PUEE 5ED4A 4EJTA 1P4AA 4EMSA 4CICA 1FSHA 4HBLA 1J75A 3BPVA 1FOKA 2PJPA 1OPCA 4MEXF 3WTYC 2M8EA 3C7JA 1KYWA 1YIOA 3LAPA 5JHUA 2DQRA 3K0LA 1F1ZA 4I09A 3CUQB 1WWXA 2JT1A 5DYMA 5AONA 5EEGA 2W57A 3FM5A 2LF8A 3EYYA 1PP7U 5L3CA 1BC8C 3H3UA 1LNWA 3RYRA 4HAMA 3KP4A 3TKYA 1ZAOA 3F8BA 3M1EA 1HKTA 3ECHA 4JK1X 2OZUA 2BEOA 1SFUA 3D5LA 3F8CA 4BH9A 1KU3A 1R5HA 4R79A 2Y75A 3HHHA 3V8JA 2HGCA 1ZG3A 2IA1A 2HKOA 5F6FA 1TQPA 3Q9VA 1G3YA 1HSJA 2FF4A 2TDXA 4RGSA 2K7LA 4I2OA 4EM1A 2ESHA 3E6MA 4OMYA 5D4SA 3VODA 5JI6A 1SFEA 5HDKA 5L3DA 4MGRA 4Q5SF 3RI4A 3L9FA 1I27A 2D45A 3I71A 1H9GA 2EV6A 2OQRA 5AIPA 3WGHA 2O8XA 1FNNA 3T0YA 1FT9A 4XBFA 3ZMUA 2EFWA 5K5QA 1OR7A 4GYGA 2FOKA 1U3EM 2ZO4A 3LQRA 4AD9A 3GFIA 2GZWA 1UHMA 3HRMA 2BYVE 4RB1A 1R23A 3E6BA 4L9TA 4A12A 5E18F 1E2XA 5KVRA 1T0FA 4MQVA 2IP2A 3BP8A 4RGRA 1XMKA 4HF0A 2V6CA 4WK8F 1YW8A 1CF7A 3E5QA 3VB2A 1TQMA 1BJAA 1D8KA 2HWVA 4A0ZA 4UUVA 1ZREA 2DI3A 1H0MA 3FF5A 1DUXC 5CJ9A 3F21A 3IWZA 3IHUA 4HLXA 4LB6B 2A68F 1WKMA 3HIFA 1LDDA 3J80Z 3KE2A 1TNSA 5HLHA 1SD5A 5DUKA 4LLGF 2RN7A 4JBAA 3KETA 4Q4ZF 1QZZA 5E8IA 2PEXA 1QGPA 4EJWA 5LHIA 1Q1HA 2YR2A 2VBYA 1CGPA 1ZHFA 3QPHA 3W6JB 3R6SA 3K2ZA 3J81Z 1K79A 2XIGA 1RZ4A 1B1BA 1KYZA 1XCVA 1R36A 2ZKZA 4EM2A 1B9NA 3LA2A 4KUMA 4P96A 4U0YA 2E7WA 1J5YA 2UXXA 3VOEA 4RGXA 4IHSA 1XDUA 1FP1D 5DDGA 3IRQA 4BHBA 2G9WA 1KU7A 2QVOA 2PN6A 2L3DA 3FXUA 3GLXA 2V1UA 1LVAA 1TW2A 1JHFA 3FZVA 4M72A 2A69F 4ZYDA 1B59A 4HDVA 1O3TA 4HW0A 4UVBA 1MZBA 5L3FA 1MJ9A 2Y0MA 1IN5A 3G3ZA 2DO7A 1BOAA 4KN4X 1S7AA 2EWNA 3DXJF 4IRHA 1WSUA 1IRGA 1LEBA 1OMIA 5BOXA 3HSEA 2FEZA 1LEAA 2VE8A 4L18B 1OYYA 2O0YA 3RYPA 2ETHA 2R7FA 3R60A 4HQMA 3TDUC 1BIBA 4G8XA 2MH2A 3CUQA 2A61A 1S29A 3D0SA 1XGSA 3WU1B 4ZH4F 1L0OC 3ZN1A 3Q5FA 4R1HA 2V1DA 4RAZA 1IZ1A 1T39A 4OOIA 4I0BA 4AVPA 3EUHA 3IRRA 4IPAA 4I01A 1I1GA 4NHJA 5HLIA 1XSVA 1J59A 5LHHA 1HBXG 1TW3A 4LMYA 5A2QZ 3MWMA 2JRTA 2FMLA 2LSOA 5D5XB 5E1WA 1ZGJA 1FLIA 1I6XA 2FNPA 2F5CA 4P5OA 2VT3A 3LAJA 1DP7P 1EH8A 3I58A 1B6AA 4ENNA 4WXDA 1FSEA 2PQ8A 5E1ZB 5LRSA 3ZMDA 2VE9A 3R61A 4IHTA 1XSXA 5K5OA 5IT9Z 4EJOA 4ESBA 4YFNF 2ISYA 2LNBA 2P7CB 4EV0A 4H0EA 4IF4A 4KIBA 1G6NA 2R7DA 1SMYF 2P6TA 2QM3A 1G4DA 2RQPA 1ONVA 1LDJA 1XD7A 1RI7A 5ICGA 1Z6TA 2XKOA 5FLXZ 3O6BB 1JE8A 3V4GA 2NNYA 2WC2A 1IXRC 2IA0A 2EFOA 1YLFA 2XAGA 1CF7B 2Z33A 4YFXF 1I1SA 1IN7A 2L02A 2VOOA 5AIQA 1LDKB 1D3YA 3JSOA 1WI9A 1JXSA 4RS8A 4P9UA 4IJAA 2CGPA 1DPRA 4BHPA 4R8HA 1ZRDA 5LEJA 2HR3A 3QAHA 1ON1A 5HS9A 3TOAA 4Y13A 2P8TA 1KU2A 1XMAA 4G7OF 1HQCA 1T38A 1KQ0A 2IW5A 2HFHA 4KIFA 3K9TA 5E17F 4I02A 2UZKA 4A6DA 4ZZLA 4KN7X 2OQGA 1HW5A 5CVRA 3I5UA 1G3TA 5D4RA 2Y48A 5D8KB 5FFXA 3K1NA 2HEOA 2QZ8A 4I98B 2O6GE 4IXAA 3ZMVA 2CYYA 3WTTC 2HQNA 1KA8A 2P6SA 3GZ5A 3C1DA 3M8FA 4N0BA 4UXNA 2XASA 1W7PD 2FE3A 2PI0A 4L0YB 4ON0A 4Y17A 1J7KA 1YW7A 4OIQF 2QBYA 4HLYA 2W85A 3JAMK 1YTYA 3E5UA 2FBKA 3H3ZA 4HDUA 3CDHA 1HW2A 1EH6A 2EA4A 4HV5A 2XAJA 3ISPA 4WXHA 4P55A 2GIVA 3RIRA 2BBYA 2P5VA 5HDGA 3LA3A 1Z6RA 3L7WA 4F7ZA 4Q48A 1Z9CA 1J9IA 3RTRA 1UB9A 3FXRA 2MLGA 3V7SA 3LWFA 2RC4A 3E5XA 3WTWC 1PDNC 3C3WA 1D5VA 2CW0F 3DP7A 2PG4A 2PMUA 3F6OA 2MLKA 5HS7A 5D6FA 5LGNA 1MD0A 2DK5A 5ILVA 4OMZA 4MTEA 3WG9A 4LGWA 4WXCA 2PMHA 1IRFA 3RDIA 4DQ2A 2DAOA 3GEZA 4M73A 2DBBA 3I4PA 2W84A 2FRHA 2F5EA 4L9JA 3GWZA 2QLZA 3VFZA 2H94A 1LB2A 2C6YA 1ON2A 4NQWA 1O3SA 4RGUA 4RB3C 2NRAC 1XB4A 1E17A 1T98A 1FYMA 1QO0D 4QWQA 5LGTA 1BI0A 4I7HA 5CVUA 2XUBA 4D0PA 3SZTA 5J8FA 3IKVA 5K1YA 4PZJA 2YX7A 4M6YA 1AOYA 4UV8A 3F6VA 3FX3A 3J80K 2KKOA 4LLNA 1TBXA 1F5TA 4YIIA 4AIKA 3BPXA 4ENMA 1JGSA 3E6DA 5FB2A 3U1DA 2VODA 1MGTA 4U7DA 2VONA 2XVCA 1IXSB 1YQAA 2IPQX 4FX0A 5EEHA 2GA1A 2Z99A 4EQQA 4ZYGA 3J81K 5D6EA 5HS8A 4OIRF 1ZG1A 2UXNA 3HOTA 3QP6A 3ZQ7A 4NB5A 3E3VA 2GQQA 2ZXJA 2WV0A 1P6RA 4LFUA 4FT8A 2NAZA 5CVIA 3BY6A 4UV9A 5BQTA 3IC7A 2HKXA 5E1XA 4L5IA 3BROA 5L3GA 1IAWA 3K1PA 3RKYA 2OAZA 3O2PE 5JFRA 2CO5A 2EV0A 1SAXA 2ADUA 2V79A 2DU9A 1F9NA 2DTRA 2RKHA 1BI2A 4KYWA 1BC7C 2UWMA 2XV4S 4ETSA 3BDDA 4KICA 1IN4A 1ZN2A 2X0LA 2K4BA 1R58A 3FHZA 1ULYA 2DLLA 2DW4A 3KZYA 4B09A 4MHGA 3Q9SA 1Z1DA 2QBYB 4BNCA 3SQNA 3G73A 3QRFF 4MTDA 3F23A 2DT5A 4U88A 5DEQA 4UHTA 4A0YA 3GO5A 1YFHA 2WWYA 4DNCA 4LLLA 3R0JA 1ZYRF 2KIMA 5HLGA 1YO5C 1HW1A 2ZJ2A 3WU0A 5ICCA 3I53A 2D1VA 3J7AO 4RB0A 2MD5A 4KNYA 3R4KA 1KQ8A 1MJBA 3MQ0A 1JHHA 2DFIA 1QQIA 3L09A 2R3SA 1T2KA 2O3FA 1X3UA 3NRVA 1IN8A 1GVJA 5D5WB 4QLCU 4LB5A 3V7RA 2RV8A 5BPIA 2G7HA 1U6GA 2AXLA 3TOBA 3T5XA 2ACJA 5IT9K 4OINF 3GFJA 4HF2A 3HUGA 3FWEA 4BYYA 3NQOA 4O5VA 2EFNA 3ZP5A 1FY7A 2P4WA 2DQLA 2XGXA 3KZZA 1WQ2A 2L01A 5L3BA 1F4KA 4M9SA 5CYVA 4XSZF 1NHAA 5BS6A 3H92A 3P9CA 3GZ6A 3REOA 3DF8A 1AWCA 5ERIA 2VBXA 2GWRA 3HTUA 4BAYA 3KLNA 5LRRA 2JSCA 2EJRA 1HSTA 2QQBA 3ZN0A 2FMYA 3F8NA 2DPUA 4GO1A 1J2XA 2B0LA 1MJAA 3V8LA 2HDCA 1IUYA 1VTNC 3EYIA 3B73A 5CLSA 2K4JA 1RNLA 2KJBA 3F3XA 2VT2A 1FZPB 3DPLC 4HX8A 3P9IA 5DCMA 4ZYHA 3QU6A 4HYEA 4EGZA 1K78A 4CYDA 2M45A 3TO7A 5ILUA 1SD7A 4G7ZF 5K5RA 1GHCA 3CO7C 3L2CA 3RJPA 4A2UA 4XLNF 1QNTA 1KQ9A 1V3FA 4G9YA 4S05A 2FQ3A 4O6JA 4PGGA 4U0WA 1R5GA 1XCBA 4OU0A 2FXAA 3BJAA 4BXUA 3KCCA 1FX7A 5FD6A 1STZA 3QP5A 3MFKA 5TRDA 3DV8A 2MA3A 3BZ6A 3SZPA 5E20A 2L4AA 2VBZA 1GXPA 3RPQA 4A0XA 3DQVC 1TLHB 1IN6A 1OYIA 4LG0A 1K6OA 5BPDA 4HZFA 3P7NA 4U7BA 3VEPA 2ZNZA 2L4MA 4L9NA 1XSDA 3SXYA 3TO9A 3JTGA 3M9AA 1XGMA 2HS5A 3SHFA 3R0AA 1I5ZA 3TDZC 3U2RA 2XHKA 5ICFA 3F22A 4A5NA 4N9IA 3CTAA 2PFBA 3NEUA 1R7JA 2EA2A 1W4MA 1R1TA 1ZG5A 2EB7A 4HX7A 5H20A 4P9FA 3W6KB 2W25A 3T8TA 4YIFA 5LGUA 4KMUX 1OYWA 3WGGA 2IT0A 1Y0UA 2MC3A 3B02A 4OIOF 3HSRA 3HOSA 4CDGA 3QU3A 2Z3YA 2FSWA 3T1BA 2X4HA 1QPMA 2OD5A 3E97A 2QYOA 2ZMEA 4LJZF 1DDNA 1MDMA 3OV8A 4YG2F 1FBSA 4AIHA 4UVAA 2H6BA 4KIGA 2PLYA 1R00A 4KMFA 3I54A 1O3QA 3AAFA 2QQ9A 2VXZA 5E8GA 3EQLF 2YU3A 5CVVA 4PDKA 2K86A 3ZMZA 4GGGA 2NYXA 3ULQB 4EVIA 3COAC 1H9TA 5H6QA 2A5YB 2F2EA 2HYFA 4WWCA 4TV7A 3CLOA 1O7FA 1SFXA 2COMA 1RUNA 4ENKA 2F5DA 3GUDA 3OOPA 1R22A 2CG4A 4UVCA 4MEYF 2MBFA 4M71A 1W5TA 4IVNA 1MKMA 2M1BA 2VBWA 4HX4A 3M7GA 1U5TC 1W7PA 2PBIA 3HRSA 3CUOA 1U78A 3IL2A 2H27A 1FP2A 4ZYEA 3E6CC 3HTSB 2HQRA 2IVMA 3PQKA 3MEXA 1J0RA 5LEKA 1IXCA 2NNNA 3BWGA 4BHCA 4A5MA 1ZRFA 4RB2C 4KFCA 2ZCWA 1LQ1A 2LKPA 3TO6A 1U2WA 3GFMA 2XAFA 3DEUA 4PCQA 5FFZA 5HDNA 1O7LA 5DV5A 3U9GA 4XLPF 3KEQA 1YS6A 1HKSA 3LSTA 3I59B 3RKWA 2HZTA 2J5OA 3FMQA 1FBUA 4G94A 5H6RA 3GX4X 4MQ9F 2K02A 5DCMB 2YX4A 4G7HF 1BI1A 2P5KA 1P2FA 3JW4A 1K78B 2J5PA 1GXQA 3JAMZ 2D1HA 3DKWA 5FO5A 3LA7A 2CQKA 4G6DA 3WTXC 1QZYA 3WODF 1EH7A 1PP8F 3KLOA 4UNOA 2XAQA 3BOQA 2EK5A 2HYGD 1REPC 2RGVA 3EDPA 2L54A 3HYIA 2XRNA 3KP7A 1RUOA 2P7VB 2YPRA 6PAXA 1KGSA 4E70A 3ML6A 2KIUA 2RVCA 2HTJA 3KP5A 3CUQC 4O3MA 1FPQA 1FBQA 5HOOA 5D5UB 4CHUA 3TQNA 4LG0B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3F8M A;  2ZFW A;  2ZBK A;  3KFW X;  1HXD A;  4M74 A;  1B4A A;  2LF7 A;  4L5J A;  2Q2E A;  1W5S A;  2O03 A;  2K27 A;  1YS7 A;  4KT5 C;  1EV7 A;  2BV6 A;  2ISZ A;  3WTV C;  2ZNY A;  2FNA A;  2LDU A;  3ABU A;  2BGC A;  3GVA A;  4GYI A;  2Q0O A;  3GYH X;  2STT A;  2KIF A;  4Q47 A;  2JPB A;  1ZRC A;  4L9V A;  2OBP A;  2OU2 A;  4RAY A;  2JPC A;  1IF1 A;  2D2W A;  4L0Z B;  3V7C A;  1L3L A;  3FMR A;  3ROU A;  2V9V A;  1UCR A;  5HVQ C;  2FBI A;  4LD5 A;  2QWW A;  4AIJ A;  1FC3 A;  5J6X A;  5F1R A;  5ICE A;  1TQI A;  3HSF A;  2W24 A;  1K7A A;  3GF2 A;  5FD5 A;  2HTS A;  2A6E F;  2ZME B;  4Z2Y A;  1MDM B;  3FMS A;  2QEN A;  1USS A;  2GXB A;  4Y15 A;  4HQE A;  5KK1 A;  4PGH A;  3RPU A;  5CVJ A;  3FXQ A;  4M6X A;  1TTY A;  5LHG A;  1O3R A;  2M87 A;  4IRI A;  2XAH A;  2DK8 A;  3WGI A;  4EJU A;  1U5T A;  5DD8 A;  1YG2 A;  3CJN A;  5LBQ A;  4ASN A;  1HKQ A;  4MNU A;  5DCF A;  3N4M A;  4LK0 F;  1KU9 A;  1BN5 A;  3KP2 A;  2A3S A;  3RKX A;  2WTE A;  5DUI A;  4U0V A;  3HRU A;  5JVT A;  1O57 A;  5D8L B;  5A2Q K;  3IWF A;  3M8E A;  1FWZ A;  3F72 A;  5TJJ A;  3CO6 C;  2RDP A;  2RNJ A;  2NS0 A;  1D8J A;  2KJC A;  1W7P B;  2STW A;  1Z05 A;  3MZH A;  1UFM A;  2MH9 A;  5D5V B;  5ILS A;  1ZGA A;  1YYV A;  2BE5 F;  3P9K A;  3PFI A;  4JQF A;  4EJV A;  1ZAR A;  3LQQ A;  4LK1 F;  3KP3 A;  2FU4 A;  2E1C A;  1Z91 A;  4WF2 A;  3ERE D;  1ZH5 A;  2IA2 A;  1BBY A;  2FA5 A;  5BMZ A;  1P4X A;  1TNT A;  3ELK A;  3MCZ A;  2YSR A;  5FLX K;  2EV5 A;  1S7O A;  3WE3 A;  3I0T A;  4ENJ A;  1UHW A;  2VN2 A;  2A07 F;  4BQA A;  4B8X A;  2H6C A;  1S3J A;  2Z5U A;  1P92 A;  2G7U A;  5LLQ A;  3WTU C;  4FHT A;  3I59 A;  2CFX A;  1ODD A;  3QPT A;  2OA4 A;  1SD6 A;  2F5F A;  4AWX B;  4ESF A;  2JZY A;  1V4R A;  1U8R A;  4FX4 A;  1G3S A;  2VC1 A;  4XSX F;  1UST A;  3EET A;  3I64 A;  2GXG A;  4WCG A;  4ESJ A;  5FGM A;  1LJ9 A;  3KP6 A;  2ESN A;  1G3W A;  1ZLJ A;  4M9X A;  1R1U A;  4CXF A;  3WTS C;  5F64 A;  2EFP A;  1T6S A;  3MZY A;  2GA2 A;  2VC0 A;  3MAJ A;  3DPT A;  1P4W A;  2E7X A;  3ZMS A;  5DD4 A;  1YW9 A;  2CWE A;  4CZZ A;  2H09 A;  1DPU A;  4IRG A;  5IT3 A;  4A6E A;  1SMT A;  3QOP A;  3L00 A;  3K1M A;  1BM9 A;  3TGN A;  3S2W A;  2XRO A;  3DFG A;  2EFQ A;  2JTV A;  2O61 A;  4XRF A;  1XGO A;  3ZPL A;  4EGY A;  3N97 A;  2A6H F;  3GXO A;  2Z9O A;  4ZZD A;  3WE2 A;  1S8N A;  2Q8K A;  4I0A A;  2IRF G;  1OKR A;  1IW7 F;  3SFZ A;  1A04 A;  4CGZ A;  1QBJ A;  5L3E A;  1ZLK A;  3BJO A;  5JR3 A;  4HF1 A;  4WX9 A;  3IKT A;  3O3K A;  3GW2 A;  2XKP A;  2ELH A;  4HA8 A;  4EM0 B;  1U5T B;  3FM3 A;  3WTZ A;  3KEO A;  1XN7 A;  2GAU A;  2QQA A;  1S6L A;  4OIP F;  3JSP A;  2VOP A;  1B9M A;  4HV6 A;  4G6Q A;  2KRF A;  2P5L C;  3C18 A;  3ABT A;  5J8C A;  3GFL A;  2E1N A;  2HOE A;  1BIA A;  2OZ6 A;  1SD4 A;  1RIO H;  2AS5 F;  1C0W A;  3K69 A;  4GXO A;  3T8R A;  3ECO A;  3HHG A;  4KA4 A;  2CSO A;  3BJ6 A;  3F8F A;  2DPD A;  4N9H A;  4YFK F;  3PQJ A;  1XGN A;  2IJL A;  2QUF A;  4HOB A;  1R1V A;  1Z7U A;  4CO8 A;  4GCV A;  1FYK A;  3JTH A;  4K2E A;  2FBH A;  4M9Z A;  1WRJ A;  4S04 A;  1BI3 A;  2M5W A;  4KDP A;  1FYL A;  3ZMT A;  1XDS A;  2V1X A;  2M30 A;  3LFK A;  3V8K A;  3HRT A;  1PUE E;  5ED4 A;  4EJT A;  1P4A A;  4EMS A;  4CIC A;  1FSH A;  4HBL A;  1J75 A;  3BPV A;  1FOK A;  2PJP A;  1OPC A;  4MEX F;  3WTY C;  2M8E A;  3C7J A;  1KYW A;  1YIO A;  3LAP A;  5JHU A;  2DQR A;  3K0L A;  1F1Z A;  4I09 A;  3CUQ B;  1WWX A;  2JT1 A;  5DYM A;  5AON A;  5EEG A;  2W57 A;  3FM5 A;  2LF8 A;  3EYY A;  1PP7 U;  5L3C A;  1BC8 C;  3H3U A;  1LNW A;  3RYR A;  4HAM A;  3KP4 A;  3TKY A;  1ZAO A;  3F8B A;  3M1E A;  1HKT A;  3ECH A;  4JK1 X;  2OZU A;  2BEO A;  1SFU A;  3D5L A;  3F8C A;  4BH9 A;  1KU3 A;  1R5H A;  4R79 A;  2Y75 A;  3HHH A;  3V8J A;  2HGC A;  1ZG3 A;  2IA1 A;  2HKO A;  5F6F A;  1TQP A;  3Q9V A;  1G3Y A;  1HSJ A;  2FF4 A;  2TDX A;  4RGS A;  2K7L A;  4I2O A;  4EM1 A;  2ESH A;  3E6M A;  4OMY A;  5D4S A;  3VOD A;  5JI6 A;  1SFE A;  5HDK A;  5L3D A;  4MGR A;  4Q5S F;  3RI4 A;  3L9F A;  1I27 A;  2D45 A;  3I71 A;  1H9G A;  2EV6 A;  2OQR A;  5AIP A;  3WGH A;  2O8X A;  1FNN A;  3T0Y A;  1FT9 A;  4XBF A;  3ZMU A;  2EFW A;  5K5Q A;  1OR7 A;  4GYG A;  2FOK A;  1U3E M;  2ZO4 A;  3LQR A;  4AD9 A;  3GFI A;  2GZW A;  1UHM A;  3HRM A;  2BYV E;  4RB1 A;  1R23 A;  3E6B A;  4L9T A;  4A12 A;  5E18 F;  1E2X A;  5KVR A;  1T0F A;  4MQV A;  2IP2 A;  3BP8 A;  4RGR A;  1XMK A;  4HF0 A;  2V6C A;  4WK8 F;  1YW8 A;  1CF7 A;  3E5Q A;  3VB2 A;  1TQM A;  1BJA A;  1D8K A;  2HWV A;  4A0Z A;  4UUV A;  1ZRE A;  2DI3 A;  1H0M A;  3FF5 A;  1DUX C;  5CJ9 A;  3F21 A;  3IWZ A;  3IHU A;  4HLX A;  4LB6 B;  2A68 F;  1WKM A;  3HIF A;  1LDD A;  3J80 Z;  3KE2 A;  1TNS A;  5HLH A;  1SD5 A;  5DUK A;  4LLG F;  2RN7 A;  4JBA A;  3KET A;  4Q4Z F;  1QZZ A;  5E8I A;  2PEX A;  1QGP A;  4EJW A;  5LHI A;  1Q1H A;  2YR2 A;  2VBY A;  1CGP A;  1ZHF A;  3QPH A;  3W6J B;  3R6S A;  3K2Z A;  3J81 Z;  1K79 A;  2XIG A;  1RZ4 A;  1B1B A;  1KYZ A;  1XCV A;  1R36 A;  2ZKZ A;  4EM2 A;  1B9N A;  3LA2 A;  4KUM A;  4P96 A;  4U0Y A;  2E7W A;  1J5Y A;  2UXX A;  3VOE A;  4RGX A;  4IHS A;  1XDU A;  1FP1 D;  5DDG A;  3IRQ A;  4BHB A;  2G9W A;  1KU7 A;  2QVO A;  2PN6 A;  2L3D A;  3FXU A;  3GLX A;  2V1U A;  1LVA A;  1TW2 A;  1JHF A;  3FZV A;  4M72 A;  2A69 F;  4ZYD A;  1B59 A;  4HDV A;  1O3T A;  4HW0 A;  4UVB A;  1MZB A;  5L3F A;  1MJ9 A;  2Y0M A;  1IN5 A;  3G3Z A;  2DO7 A;  1BOA A;  4KN4 X;  1S7A A;  2EWN A;  3DXJ F;  4IRH A;  1WSU A;  1IRG A;  1LEB A;  1OMI A;  5BOX A;  3HSE A;  2FEZ A;  1LEA A;  2VE8 A;  4L18 B;  1OYY A;  2O0Y A;  3RYP A;  2ETH A;  2R7F A;  3R60 A;  4HQM A;  3TDU C;  1BIB A;  4G8X A;  2MH2 A;  3CUQ A;  2A61 A;  1S29 A;  3D0S A;  1XGS A;  3WU1 B;  4ZH4 F;  1L0O C;  3ZN1 A;  3Q5F A;  4R1H A;  2V1D A;  4RAZ A;  1IZ1 A;  1T39 A;  4OOI A;  4I0B A;  4AVP A;  3EUH A;  3IRR A;  4IPA A;  4I01 A;  1I1G A;  4NHJ A;  5HLI A;  1XSV A;  1J59 A;  5LHH A;  1HBX G;  1TW3 A;  4LMY A;  5A2Q Z;  3MWM A;  2JRT A;  2FML A;  2LSO A;  5D5X B;  5E1W A;  1ZGJ A;  1FLI A;  1I6X A;  2FNP A;  2F5C A;  4P5O A;  2VT3 A;  3LAJ A;  1DP7 P;  1EH8 A;  3I58 A;  1B6A A;  4ENN A;  4WXD A;  1FSE A;  2PQ8 A;  5E1Z B;  5LRS A;  3ZMD A;  2VE9 A;  3R61 A;  4IHT A;  1XSX A;  5K5O A;  5IT9 Z;  4EJO A;  4ESB A;  4YFN F;  2ISY A;  2LNB A;  2P7C B;  4EV0 A;  4H0E A;  4IF4 A;  4KIB A;  1G6N A;  2R7D A;  1SMY F;  2P6T A;  2QM3 A;  1G4D A;  2RQP A;  1ONV A;  1LDJ A;  1XD7 A;  1RI7 A;  5ICG A;  1Z6T A;  2XKO A;  5FLX Z;  3O6B B;  1JE8 A;  3V4G A;  2NNY A;  2WC2 A;  1IXR C;  2IA0 A;  2EFO A;  1YLF A;  2XAG A;  1CF7 B;  2Z33 A;  4YFX F;  1I1S A;  1IN7 A;  2L02 A;  2VOO A;  5AIQ A;  1LDK B;  1D3Y A;  3JSO A;  1WI9 A;  1JXS A;  4RS8 A;  4P9U A;  4IJA A;  2CGP A;  1DPR A;  4BHP A;  4R8H A;  1ZRD A;  5LEJ A;  2HR3 A;  3QAH A;  1ON1 A;  5HS9 A;  3TOA A;  4Y13 A;  2P8T A;  1KU2 A;  1XMA A;  4G7O F;  1HQC A;  1T38 A;  1KQ0 A;  2IW5 A;  2HFH A;  4KIF A;  3K9T A;  5E17 F;  4I02 A;  2UZK A;  4A6D A;  4ZZL A;  4KN7 X;  2OQG A;  1HW5 A;  5CVR A;  3I5U A;  1G3T A;  5D4R A;  2Y48 A;  5D8K B;  5FFX A;  3K1N A;  2HEO A;  2QZ8 A;  4I98 B;  2O6G E;  4IXA A;  3ZMV A;  2CYY A;  3WTT C;  2HQN A;  1KA8 A;  2P6S A;  3GZ5 A;  3C1D A;  3M8F A;  4N0B A;  4UXN A;  2XAS A;  1W7P D;  2FE3 A;  2PI0 A;  4L0Y B;  4ON0 A;  4Y17 A;  1J7K A;  1YW7 A;  4OIQ F;  2QBY A;  4HLY A;  2W85 A;  3JAM K;  1YTY A;  3E5U A;  2FBK A;  3H3Z A;  4HDU A;  3CDH A;  1HW2 A;  1EH6 A;  2EA4 A;  4HV5 A;  2XAJ A;  3ISP A;  4WXH A;  4P55 A;  2GIV A;  3RIR A;  2BBY A;  2P5V A;  5HDG A;  3LA3 A;  1Z6R A;  3L7W A;  4F7Z A;  4Q48 A;  1Z9C A;  1J9I A;  3RTR A;  1UB9 A;  3FXR A;  2MLG A;  3V7S A;  3LWF A;  2RC4 A;  3E5X A;  3WTW C;  1PDN C;  3C3W A;  1D5V A;  2CW0 F;  3DP7 A;  2PG4 A;  2PMU A;  3F6O A;  2MLK A;  5HS7 A;  5D6F A;  5LGN A;  1MD0 A;  2DK5 A;  5ILV A;  4OMZ A;  4MTE A;  3WG9 A;  4LGW A;  4WXC A;  2PMH A;  1IRF A;  3RDI A;  4DQ2 A;  2DAO A;  3GEZ A;  4M73 A;  2DBB A;  3I4P A;  2W84 A;  2FRH A;  2F5E A;  4L9J A;  3GWZ A;  2QLZ A;  3VFZ A;  2H94 A;  1LB2 A;  2C6Y A;  1ON2 A;  4NQW A;  1O3S A;  4RGU A;  4RB3 C;  2NRA C;  1XB4 A;  1E17 A;  1T98 A;  1FYM A;  1QO0 D;  4QWQ A;  5LGT A;  1BI0 A;  4I7H A;  5CVU A;  2XUB A;  4D0P A;  3SZT A;  5J8F A;  3IKV A;  5K1Y A;  4PZJ A;  2YX7 A;  4M6Y A;  1AOY A;  4UV8 A;  3F6V A;  3FX3 A;  3J80 K;  2KKO A;  4LLN A;  1TBX A;  1F5T A;  4YII A;  4AIK A;  3BPX A;  4ENM A;  1JGS A;  3E6D A;  5FB2 A;  3U1D A;  2VOD A;  1MGT A;  4U7D A;  2VON A;  2XVC A;  1IXS B;  1YQA A;  2IPQ X;  4FX0 A;  5EEH A;  2GA1 A;  2Z99 A;  4EQQ A;  4ZYG A;  3J81 K;  5D6E A;  5HS8 A;  4OIR F;  1ZG1 A;  2UXN A;  3HOT A;  3QP6 A;  3ZQ7 A;  4NB5 A;  3E3V A;  2GQQ A;  2ZXJ A;  2WV0 A;  1P6R A;  4LFU A;  4FT8 A;  2NAZ A;  5CVI A;  3BY6 A;  4UV9 A;  5BQT A;  3IC7 A;  2HKX A;  5E1X A;  4L5I A;  3BRO A;  5L3G A;  1IAW A;  3K1P A;  3RKY A;  2OAZ A;  3O2P E;  5JFR A;  2CO5 A;  2EV0 A;  1SAX A;  2ADU A;  2V79 A;  2DU9 A;  1F9N A;  2DTR A;  2RKH A;  1BI2 A;  4KYW A;  1BC7 C;  2UWM A;  2XV4 S;  4ETS A;  3BDD A;  4KIC A;  1IN4 A;  1ZN2 A;  2X0L A;  2K4B A;  1R58 A;  3FHZ A;  1ULY A;  2DLL A;  2DW4 A;  3KZY A;  4B09 A;  4MHG A;  3Q9S A;  1Z1D A;  2QBY B;  4BNC A;  3SQN A;  3G73 A;  3QRF F;  4MTD A;  3F23 A;  2DT5 A;  4U88 A;  5DEQ A;  4UHT A;  4A0Y A;  3GO5 A;  1YFH A;  2WWY A;  4DNC A;  4LLL A;  3R0J A;  1ZYR F;  2KIM A;  5HLG A;  1YO5 C;  1HW1 A;  2ZJ2 A;  3WU0 A;  5ICC A;  3I53 A;  2D1V A;  3J7A O;  4RB0 A;  2MD5 A;  4KNY A;  3R4K A;  1KQ8 A;  1MJB A;  3MQ0 A;  1JHH A;  2DFI A;  1QQI A;  3L09 A;  2R3S A;  1T2K A;  2O3F A;  1X3U A;  3NRV A;  1IN8 A;  1GVJ A;  5D5W B;  4QLC U;  4LB5 A;  3V7R A;  2RV8 A;  5BPI A;  2G7H A;  1U6G A;  2AXL A;  3TOB A;  3T5X A;  2ACJ A;  5IT9 K;  4OIN F;  3GFJ A;  4HF2 A;  3HUG A;  3FWE A;  4BYY A;  3NQO A;  4O5V A;  2EFN A;  3ZP5 A;  1FY7 A;  2P4W A;  2DQL A;  2XGX A;  3KZZ A;  1WQ2 A;  2L01 A;  5L3B A;  1F4K A;  4M9S A;  5CYV A;  4XSZ F;  1NHA A;  5BS6 A;  3H92 A;  3P9C A;  3GZ6 A;  3REO A;  3DF8 A;  1AWC A;  5ERI A;  2VBX A;  2GWR A;  3HTU A;  4BAY A;  3KLN A;  5LRR A;  2JSC A;  2EJR A;  1HST A;  2QQB A;  3ZN0 A;  2FMY A;  3F8N A;  2DPU A;  4GO1 A;  1J2X A;  2B0L A;  1MJA A;  3V8L A;  2HDC A;  1IUY A;  1VTN C;  3EYI A;  3B73 A;  5CLS A;  2K4J A;  1RNL A;  2KJB A;  3F3X A;  2VT2 A;  1FZP B;  3DPL C;  4HX8 A;  3P9I A;  5DCM A;  4ZYH A;  3QU6 A;  4HYE A;  4EGZ A;  1K78 A;  4CYD A;  2M45 A;  3TO7 A;  5ILU A;  1SD7 A;  4G7Z F;  5K5R A;  1GHC A;  3CO7 C;  3L2C A;  3RJP A;  4A2U A;  4XLN F;  1QNT A;  1KQ9 A;  1V3F A;  4G9Y A;  4S05 A;  2FQ3 A;  4O6J A;  4PGG A;  4U0W A;  1R5G A;  1XCB A;  4OU0 A;  2FXA A;  3BJA A;  4BXU A;  3KCC A;  1FX7 A;  5FD6 A;  1STZ A;  3QP5 A;  3MFK A;  5TRD A;  3DV8 A;  2MA3 A;  3BZ6 A;  3SZP A;  5E20 A;  2L4A A;  2VBZ A;  1GXP A;  3RPQ A;  4A0X A;  3DQV C;  1TLH B;  1IN6 A;  1OYI A;  4LG0 A;  1K6O A;  5BPD A;  4HZF A;  3P7N A;  4U7B A;  3VEP A;  2ZNZ A;  2L4M A;  4L9N A;  1XSD A;  3SXY A;  3TO9 A;  3JTG A;  3M9A A;  1XGM A;  2HS5 A;  3SHF A;  3R0A A;  1I5Z A;  3TDZ C;  3U2R A;  2XHK A;  5ICF A;  3F22 A;  4A5N A;  4N9I A;  3CTA A;  2PFB A;  3NEU A;  1R7J A;  2EA2 A;  1W4M A;  1R1T A;  1ZG5 A;  2EB7 A;  4HX7 A;  5H20 A;  4P9F A;  3W6K B;  2W25 A;  3T8T A;  4YIF A;  5LGU A;  4KMU X;  1OYW A;  3WGG A;  2IT0 A;  1Y0U A;  2MC3 A;  3B02 A;  4OIO F;  3HSR A;  3HOS A;  4CDG A;  3QU3 A;  2Z3Y A;  2FSW A;  3T1B A;  2X4H A;  1QPM A;  2OD5 A;  3E97 A;  2QYO A;  2ZME A;  4LJZ F;  1DDN A;  1MDM A;  3OV8 A;  4YG2 F;  1FBS A;  4AIH A;  4UVA A;  2H6B A;  4KIG A;  2PLY A;  1R00 A;  4KMF A;  3I54 A;  1O3Q A;  3AAF A;  2QQ9 A;  2VXZ A;  5E8G A;  3EQL F;  2YU3 A;  5CVV A;  4PDK A;  2K86 A;  3ZMZ A;  4GGG A;  2NYX A;  3ULQ B;  4EVI A;  3COA C;  1H9T A;  5H6Q A;  2A5Y B;  2F2E A;  2HYF A;  4WWC A;  4TV7 A;  3CLO A;  1O7F A;  1SFX A;  2COM A;  1RUN A;  4ENK A;  2F5D A;  3GUD A;  3OOP A;  1R22 A;  2CG4 A;  4UVC A;  4MEY F;  2MBF A;  4M71 A;  1W5T A;  4IVN A;  1MKM A;  2M1B A;  2VBW A;  4HX4 A;  3M7G A;  1U5T C;  1W7P A;  2PBI A;  3HRS A;  3CUO A;  1U78 A;  3IL2 A;  2H27 A;  1FP2 A;  4ZYE A;  3E6C C;  3HTS B;  2HQR A;  2IVM A;  3PQK A;  3MEX A;  1J0R A;  5LEK A;  1IXC A;  2NNN A;  3BWG A;  4BHC A;  4A5M A;  1ZRF A;  4RB2 C;  4KFC A;  2ZCW A;  1LQ1 A;  2LKP A;  3TO6 A;  1U2W A;  3GFM A;  2XAF A;  3DEU A;  4PCQ A;  5FFZ A;  5HDN A;  1O7L A;  5DV5 A;  3U9G A;  4XLP F;  3KEQ A;  1YS6 A;  1HKS A;  3LST A;  3I59 B;  3RKW A;  2HZT A;  2J5O A;  3FMQ A;  1FBU A;  4G94 A;  5H6R A;  3GX4 X;  4MQ9 F;  2K02 A;  5DCM B;  2YX4 A;  4G7H F;  1BI1 A;  2P5K A;  1P2F A;  3JW4 A;  1K78 B;  2J5P A;  1GXQ A;  3JAM Z;  2D1H A;  3DKW A;  5FO5 A;  3LA7 A;  2CQK A;  4G6D A;  3WTX C;  1QZY A;  3WOD F;  1EH7 A;  1PP8 F;  3KLO A;  4UNO A;  2XAQ A;  3BOQ A;  2EK5 A;  2HYG D;  1REP C;  2RGV A;  3EDP A;  2L54 A;  3HYI A;  2XRN A;  3KP7 A;  1RUO A;  2P7V B;  2YPR A;  6PAX A;  1KGS A;  4E70 A;  3ML6 A;  2KIU A;  2RVC A;  2HTJ A;  3KP5 A;  3CUQ C;  4O3M A;  1FPQ A;  1FBQ A;  5HOO A;  5D5U B;  4CHU A;  3TQN A;  4LG0 B; 
#chains in the Genus database with same CATH topology
 3V42 A;  3F8M A;  2ZFW A;  2ZBK A;  3KFW X;  1HXD A;  5GTI C;  4D7N A;  3K4N A;  4M74 A;  4BXX J;  2AXT C;  3EUH C;  4HG2 A;  2EZK A;  1B4A A;  2LF7 A;  4L5J A;  1X1P A;  2Q2E A;  4A3L J;  1W5S A;  2O03 A;  2E1O A;  2K27 A;  1YS7 A;  4KT5 C;  2LK2 A;  1EV7 A;  2BV6 A;  3HBL A;  3WTV C;  2ISZ A;  2EH3 A;  2QF7 A;  2Y31 A;  2ZNY A;  2FNA A;  2LDU A;  3CJR B;  3BR3 A;  4C30 A;  2ZJR F;  3ABU A;  1AKH B;  1GDT A;  5FLM J;  2BGC A;  3GVA A;  4GYI A;  1Y39 A;  2Q0O A;  3GYH X;  1Z3Y A;  2STT A;  3PL8 A;  2KIF A;  4Q47 A;  4AYB N;  2JPB A;  1U9O A;  1PUF A;  1ZRC A;  4L9V A;  4ZC3 A;  1ETO A;  2OBP A;  2OU2 A;  2E35 A;  1SAU A;  4RAY A;  3OR1 C;  2JPC A;  4LIT A;  4A3I J;  1IF1 A;  3CES A;  4D7M A;  4BL0 B;  2D2W A;  4L0Z B;  3V7C A;  1L3L A;  4MLO A;  3L2U A;  3FMR A;  5EGO B;  3AFH A;  3ROU A;  2V9V A;  2IS4 A;  1UCR A;  5HVQ C;  1LE8 A;  3DEW A;  1VFC A;  2FBI A;  4LD5 A;  2JUC A;  1DGR M;  2QWW A;  4AIJ A;  2JK3 A;  2KPM A;  1FC3 A;  5J6X A;  5F1R A;  5ICE A;  4X6A J;  3G2B A;  3K4L A;  4BE1 A;  1TQI A;  1EJ9 A;  2R5Y B;  2CQQ A;  2W24 A;  3HSF A;  1TWA J;  3CP2 A;  4XKB A;  1MSE C;  1FMV A;  1K7A A;  3FBN B;  3GF2 A;  2VKH A;  3SDB A;  2JVH A;  3GTJ J;  1X3W B;  1XPX A;  3AL0 C;  4KT6 A;  5FD5 A;  2HTS A;  2A6E F;  3QPS A;  2ZME B;  3VSL A;  4Z2Y A;  1MDM B;  2HOA A;  4BJ5 C;  3H5A A;  1TWC J;  2QEN A;  1USS A;  3FMS A;  2GXB A;  4Y15 A;  3K2A A;  2ZXI A;  4HQE A;  5KK1 A;  3GCM A;  1W36 D;  4PGH A;  3RPU A;  5CVJ A;  3BR2 A;  3DLA A;  3FXQ A;  4M6X A;  1SFO J;  2E1M B;  1TTY A;  5LHG A;  3OR2 C;  1O3R A;  2I10 A;  2M87 A;  4IRI A;  2AQF A;  4CA0 A;  1VQ6 I;  2XAH A;  2DK8 A;  3DKY A;  3WGI A;  4EJU A;  1U5T A;  3L2R A;  2WAF A;  5GP9 A;  5DD8 A;  1YG2 A;  3CJN A;  1Y1V J;  4BBS J;  4HPQ A;  5LBQ A;  3S17 J;  4ASN A;  1HKQ A;  3BG7 A;  4MNU A;  2BW3 B;  2GLO A;  2DMU A;  2HYJ A;  5DCF A;  3N4M A;  2DA3 A;  4LK0 F;  3ZCO A;  3PUB A;  1KU9 A;  1BN5 A;  2VXD A;  4CYC B;  3KP2 A;  3ZQL A;  2A3S A;  3RKX A;  2WTE A;  5DUI A;  3C2H A;  4U0V A;  3HRU A;  2EIK H;  4HNU A;  2R93 J;  3QOE A;  5JVT A;  2GM4 A;  1O57 A;  5D8L B;  5A2Q K;  4B4C A;  3IWF A;  3M8E A;  1FWZ A;  3ZQH A;  3F72 A;  5TJJ A;  3CO6 C;  2RDP A;  1YX5 A;  2RNJ A;  3LSK A;  2NS0 A;  3AG3 H;  1D8J A;  4MIM A;  2W48 A;  2KJC A;  1W7P B;  2L9S A;  3I56 I;  2STW A;  1Z05 A;  2XSD C;  3MZH A;  1UFM A;  2MH9 A;  5D5V B;  5ILS A;  4AVZ A;  4UB8 C;  4FTH A;  3E0J B;  1ZGA A;  3JRE A;  2K9S A;  1YYV A;  4A93 J;  2BE5 F;  2DA1 A;  3P9K A;  1MBE A;  3OYI A;  3PFI A;  3MKL A;  4JQF A;  4EJV A;  4PK4 A;  4XLC A;  1ZAR A;  3LQQ A;  2CUZ A;  1X1D A;  2E5Z A;  4LK1 F;  3PUF A;  3TP0 A;  2M9H A;  1WJC A;  3KP3 A;  1EF4 A;  2FU4 A;  1GUU A;  2PX9 A;  2E1C A;  2XSJ C;  1D0Z A;  3IAM 2;  1Z91 A;  4UUS A;  4WF2 A;  3ERE D;  2R5Z B;  2IA2 A;  4D5C A;  1ZH5 A;  1TP4 A;  3FKJ A;  1BBY A;  2FA5 A;  3K4B A;  3PIO F;  5BMZ A;  1P4X A;  1ETK A;  3BQZ A;  3OYH A;  3OOU A;  1TNT A;  3ELK A;  3MCZ A;  2L9N A;  2YSR A;  5FLX K;  2LG4 A;  1NG6 A;  2EV5 A;  1R6R A;  4I99 C;  1S7O A;  1K4S A;  4BQN A;  1JKO C;  3DLL F;  3A0H C;  3OL4 A;  2B63 J;  3WE3 A;  3I0T A;  4ENJ A;  1UHW A;  2VN2 A;  2A07 F;  1UG2 A;  1XC5 A;  1OJL A;  4BQA A;  3OYA A;  4B8X A;  2H6C A;  1S3J A;  1OFC X;  1FOW A;  1TZL A;  2KQR A;  2Z5U A;  4A3J J;  2B9S A;  1P92 A;  1RKW A;  2G7U A;  3HOX J;  1GV5 A;  2QQ8 A;  3MKY B;  5LLQ A;  3WTU C;  4FHT A;  1BW5 A;  4ANJ A;  4CCJ A;  2R7R A;  3I59 A;  3CC4 I;  2CFX A;  2X6Y A;  1BA5 A;  2EBI A;  4CCL A;  4CCM A;  4NNJ A;  5IOY A;  3CCQ I;  1ODD A;  3QPT A;  2OA4 A;  1SD6 A;  1HA8 A;  1VQM I;  2F5F A;  4AWX B;  2XB5 A;  1ETY A;  4E7Z A;  3ZQG A;  5DM6 F;  3MZ8 A;  4ESF A;  2JZY A;  3ZXS A;  5IY5 H;  3BG3 A;  3VSK A;  2DOF A;  3AG2 H;  1V4R A;  4NUB A;  1U8R A;  2WAE A;  4FX4 A;  1G3S A;  2VC1 A;  2FJ1 A;  4XSX F;  1T8I A;  1UST A;  3EET A;  3I64 A;  1JJ8 C;  2GXG A;  3OYM A;  4WCG A;  2R7T A;  3CMM A;  3S3O A;  2LMD A;  4ESJ A;  3CMA I;  5FGM A;  1LJ9 A;  3KP6 A;  1R9T J;  1EKE A;  2ESN A;  1K4T A;  1A6Q A;  1G3W A;  1ZLJ A;  4M9X A;  1R1U A;  4CXF A;  3WTS C;  5F64 A;  2Q2E B;  2EFP A;  1T6S A;  1E3O C;  1HC8 A;  3MZY A;  2GA2 A;  2DFE A;  1EA3 A;  4PSX A;  2VC0 A;  3HOW J;  4XL9 A;  1YIT I;  3MAJ A;  2JA2 A;  4RAG A;  4GDF A;  2LBF A;  3S2H J;  3DPT A;  1P4W A;  5E79 C;  3HPH A;  2E7X A;  5EG0 A;  1BOB A;  2JA6 J;  1PYV A;  3TP3 A;  3ZMS A;  5DD4 A;  4RDU A;  1YW9 A;  2CWE A;  1VQ7 I;  4GRI A;  1PUF B;  4CZZ A;  3HZJ A;  3FXM A;  2H09 A;  1DPU A;  4IRG A;  5EJC A;  5IT3 A;  4A6E A;  1SMT A;  3CCJ I;  1LFP A;  3RZD J;  1RR7 A;  3CC2 I;  3TED A;  2X6X A;  1ENH A;  3QOP A;  1WGX A;  3L00 A;  3K1M A;  2ZSI B;  1BM9 A;  4MO7 A;  3TGN A;  3OSG A;  2IEK A;  3S2W A;  3DFG A;  3J7Y J;  2XRO A;  5B66 C;  2EFQ A;  2JTV A;  1N78 A;  2O61 A;  2ELK A;  4XRF A;  1XGO A;  3ZPL A;  1AA7 A;  1F36 A;  3HGY A;  4D1Q A;  2ZJQ F;  2K40 A;  3VWB A;  3DU5 A;  1LE8 B;  2H8R A;  3EUK L;  3K70 C;  3BR0 A;  1F43 A;  4DIQ A;  4EGY A;  1AKH A;  1TT0 A;  3N97 A;  2A6H F;  3I4N J;  3MKW B;  2WB1 N;  3GXO A;  2Z9O A;  4ZZD A;  4RM3 A;  3WE2 A;  3TW7 A;  5CQE A;  1W0T A;  1S8N A;  2Q8K A;  3LSI A;  2HXI A;  3M07 A;  4I0A A;  2GOM A;  4RA2 A;  2IRF G;  1OKR A;  2IBD A;  1IW7 F;  1V5G A;  4CZC A;  3HKZ A;  4HEA 2;  2DOD A;  3GTP J;  1P7J A;  3SFZ A;  1A04 A;  1OR7 C;  4CGZ A;  1QBJ A;  4XNF A;  5L3E A;  2KDZ A;  3K10 A;  1ZLK A;  3BJO A;  2L7Z A;  5JR3 A;  4Y52 J;  1OCC H;  1J09 A;  4HF1 A;  4WX9 A;  3IKT A;  5M3F J;  3BTJ A;  3O3K A;  3GW2 A;  2MFZ A;  2XKP A;  3KZI C;  3B6A A;  2ELH A;  1HF0 A;  2R7W A;  2GXA A;  4HA8 A;  1UMQ A;  4EM0 B;  2HQ5 A;  3LSH A;  3VDX A;  3JRA A;  3DKX A;  5KNL A;  3IV5 A;  2L5Q A;  3JCU C;  1U5T B;  3FM3 A;  3WTZ A;  1T33 A;  3KEO A;  1XN7 A;  4BXF A;  2GAU A;  1T0F C;  1WHU A;  2QQA A;  3A02 A;  3FK7 A;  1S6L A;  2VAS A;  3NAU A;  3I55 I;  4OIP F;  5FKO A;  3JSP A;  1E3H A;  5F0C A;  2VOP A;  1B9M A;  4HV6 A;  3GTG J;  4G6Q A;  2KRF A;  2P5L C;  2LLK A;  3C18 A;  5TIS C;  4DYR A;  4W1U A;  3ABT A;  3OYE A;  5J8C A;  3GFL A;  3H0D A;  2E1N A;  2K9N A;  2LY2 A;  3M4O J;  2HOE A;  2YU9 J;  2DYS H;  2VKD A;  3ONQ A;  1BIA A;  2OZ6 A;  1SD4 A;  1RIO H;  2AS5 F;  3LMM A;  1C0W A;  2EIL H;  2LH9 A;  3K69 A;  3OYK A;  4GXO A;  3T8R A;  4YIR X;  3ECO A;  4M3B A;  3HHG A;  4KA4 A;  2CSO A;  3BJ6 A;  3F8F A;  2DPD A;  4N9H A;  4A69 C;  4YFK F;  1H88 C;  3PQJ A;  1XGN A;  2IJL A;  2QUF A;  1HDP A;  1MBG A;  4HOB A;  1R1V A;  1Z7U A;  3NWS A;  4CO8 A;  2H1L A;  4GCV A;  5CQG A;  4XOP A;  3KYD B;  3CCU I;  1FYK A;  2BW3 A;  3JTH A;  2JRM A;  4K2E A;  3ERM A;  2FBH A;  1BR4 A;  4M9Z A;  1WRJ A;  4S04 A;  1BI3 A;  2M5W A;  3G6E I;  4KDP A;  2GIZ A;  1FYL A;  2WAQ A;  2XF7 A;  3ZMT A;  3CMY A;  2XF5 A;  3CDL A;  1XDS A;  2V1X A;  5JVG F;  2DMN A;  4FE7 A;  1DQU A;  4XKV A;  2M30 A;  3LFK A;  3L2Q A;  3V8K A;  2QSF X;  4XKW A;  3HRT A;  1PUE E;  5ED4 A;  4BDY A;  4B44 A;  4EJT A;  3C2G A;  1MNM C;  1P4A A;  2NOG A;  4C3I J;  2WA0 A;  3UNG C;  4EMS A;  4CIC A;  4UUS B;  1FSH A;  4MFE A;  4HBL A;  5F1J A;  1MBF A;  1J75 A;  1MH3 A;  3BPV A;  1FOK A;  2PJP A;  3W2A A;  2JQ7 A;  4XR6 A;  4BU2 A;  1OPC A;  4MEX F;  3WTY C;  2COB A;  2M8E A;  2ZB9 A;  4FAS D;  2PMZ A;  3C7J A;  1ERD A;  1G8X A;  3HJE A;  1KYW A;  3MVP A;  1MBH A;  1YIO A;  1MBK A;  3LAP A;  5JHU A;  5F0H A;  2DQR A;  3K0L A;  5F27 A;  1F1Z A;  2ZXW H;  1W5C C;  2BVL A;  4I09 A;  4BQQ A;  3CUQ B;  4PJN A;  2EIN H;  1WWX A;  2JT1 A;  5DYM A;  5AON A;  5EEG A;  4XON A;  1U9N A;  1X1C A;  2DA6 A;  2L2O A;  2W57 A;  3FM5 A;  3L1P A;  1I6H J;  4PJL A;  1W0U A;  2LF8 A;  2LYC A;  3BCB A;  3EYY A;  1AU7 A;  2ECC A;  1PP7 U;  1W36 C;  5M5X J;  5L3C A;  3O8H A;  3H5N A;  1VQ8 I;  3PNV A;  1YE9 A;  1FJL A;  1VND A;  1BC8 C;  3C2B A;  3H3U A;  3TBI A;  1G2H A;  3PNT A;  1LNW A;  3RYR A;  2IS6 A;  1SC7 A;  4HAM A;  2CW8 A;  2X6O A;  3JRD A;  2NXN B;  3KYL A;  3KP4 A;  3TKY A;  1ZAO A;  2DYR H;  3H9G A;  3F8B A;  3M1E A;  3OYG A;  2BXY A;  3ECH A;  1HKT A;  4E7K A;  3GTQ J;  1TL8 A;  3G1O A;  5GPA A;  3BTI A;  1ZQ3 P;  4JK1 X;  2VUM J;  2IGK A;  2DOA A;  2OZU A;  3H5R A;  2BEO A;  1SFU A;  3D5L A;  4QTR A;  3F8C A;  1NG7 A;  4BH9 A;  1KU3 A;  2M34 A;  1R5H A;  4R79 A;  2E71 A;  2Y75 A;  3HHH A;  3H9J A;  3V8J A;  2NS7 A;  3S14 J;  2ELJ A;  2L9V A;  1VF9 A;  2HGC A;  1ZG3 A;  3W2W A;  1QPI A;  2IA1 A;  2HKO A;  2DFF A;  4B1R A;  5F6F A;  1TQP A;  5IOZ A;  5BNG A;  4A3C J;  3Q9V A;  1G3Y A;  1VZ0 A;  1HSJ A;  2FF4 A;  1YRN A;  2TDX A;  3OYB A;  4RGS A;  2VQC A;  1I3A A;  1LKX A;  2K7L A;  3J7Z I;  1VQ9 I;  4I2O A;  1IO2 A;  5KAI C;  4EM1 A;  2ESH A;  2KMU A;  3E6M A;  5IPA A;  5DM7 F;  1OCP A;  5D4S A;  2VQH A;  4OMY A;  3VOD A;  5JI6 A;  1SFE A;  2HI3 A;  3RQ4 A;  3A4C A;  5HDK A;  2LBF B;  5L3D A;  2WY7 Q;  4MGR A;  4Q5S F;  2X6W A;  1WI3 A;  3RI4 A;  2EQR A;  3L9F A;  1X3Z B;  1I27 A;  2D45 A;  5C4J J;  5EG0 B;  2V9K A;  3I71 A;  1S9H A;  3ZGK A;  1H9G A;  2EV6 A;  2CFO A;  2A05 A;  2F6C A;  2W7N A;  2E60 A;  3RCO A;  2OQR A;  5AIP A;  3WGH A;  2O8X A;  1FNN A;  1WJ5 A;  3T0Y A;  1FT9 A;  4XBF A;  3ZMU A;  4AID A;  2EFW A;  2MW8 A;  3MMY B;  5K5Q A;  2XGE A;  1OR7 A;  4GYG A;  2FOK A;  2QGU A;  2R7O A;  4XKC A;  1U3E M;  1JKQ C;  4HSR A;  2ZO4 A;  1Y8Q B;  3ZOB A;  1I39 A;  1K61 A;  3LQR A;  4AD9 A;  3GFI A;  1OIS A;  2R7V A;  2GZW A;  1UHM A;  3HRM A;  3CCE I;  2BYV E;  4RB1 A;  3IUO A;  4CH7 A;  5F04 A;  1N25 A;  3W2V A;  1A35 A;  2JSP A;  1MNE A;  1R23 A;  3E6B A;  4L9T A;  4A12 A;  1D1B A;  5E18 F;  1E2X A;  5KVR A;  4M6V A;  2Q1Z B;  1T0F A;  4MQV A;  3Q0W A;  2IP2 A;  3BP8 A;  4RGR A;  2DT6 A;  1XMK A;  1JT6 A;  2KP6 A;  3IAS 2;  4HF0 A;  3PSF A;  2V6C A;  4WK8 F;  1M1E B;  1VQO I;  1YW8 A;  2VKE A;  4PUS A;  1KZH A;  1CF7 A;  3E5Q A;  3VB2 A;  1TQM A;  3CZ6 A;  1XTA A;  1BJA A;  5B5E C;  1D8K A;  2HWV A;  2OF7 A;  4A0Z A;  4UUT A;  2K9L A;  1OCT C;  1SVM A;  2CH0 A;  2F48 A;  4UUV A;  1ZRE A;  2DI3 A;  5K7F A;  3FF5 A;  1H0M A;  4IHW A;  2LY1 A;  5J1Y A;  5J1R A;  3OYC A;  1DUX C;  5CJ9 A;  3F21 A;  3IWZ A;  4AU7 A;  3PIP F;  3IHU A;  4HLX A;  4LB6 B;  1QZE A;  3HDD A;  2A68 F;  3PO3 J;  1OCZ H;  1WKM A;  2K85 A;  2Y9Y A;  3HIF A;  3GTM J;  1ZTR A;  2WBM A;  1QVU A;  2ME0 A;  1LDD A;  4ZTJ A;  1PJR A;  2H1K A;  2LOO A;  4JX4 A;  2UV1 A;  3J80 Z;  3KE2 A;  4F3Q A;  3JRH A;  1TNS A;  5HLH A;  4PFP A;  3CJQ B;  3I3L A;  1SD5 A;  3ZRG A;  5DUK A;  2VPL A;  1JTY A;  4LLG F;  1TC3 C;  2RN7 A;  4JBA A;  3KET A;  3CCY A;  4Q4Z F;  1QZZ A;  4A3F J;  4F52 A;  4BDZ A;  3A01 A;  5E8I A;  2FD5 A;  2IS1 A;  2O9L A;  2PEX A;  1QGP A;  4NC6 A;  4EJW A;  1Q1H A;  5LHI A;  1ETQ A;  2YR2 A;  2VBY A;  1CGP A;  3DBL B;  1ZHF A;  3QPH A;  3W6J B;  1FEX A;  3R6S A;  3K2Z A;  2VIX A;  4BS9 A;  3J81 Z;  1K79 A;  2MYS A;  3KPH A;  2XIG A;  1V54 H;  1RZ4 A;  1B1B A;  2XPV A;  1KYZ A;  1XCV A;  2XAU A;  2MD0 A;  1R36 A;  3S93 A;  3S2D J;  2VJ4 A;  1KON A;  2ZKZ A;  3TL4 X;  3K4M A;  4EM2 A;  1B9N A;  3GLL A;  3LA2 A;  4BY7 J;  4KUM A;  4P96 A;  4U0Y A;  2E7W A;  1J5Y A;  3HM5 A;  4IZZ A;  4Z6Y A;  2UXX A;  2NOJ B;  4RGX A;  3VOE A;  2B7E A;  2FQ4 A;  4IHS A;  1XDU A;  1FP1 D;  2DA2 A;  2CUJ A;  5DDG A;  3IRQ A;  4BHB A;  2FUG 2;  1UG0 A;  3ABL H;  2G9W A;  2VJI A;  2P0W A;  2QVO A;  2PN6 A;  1KU7 A;  4BJ6 C;  2ECB A;  1DGW Y;  4RAF A;  3DU6 A;  4UB6 C;  1HLV A;  2L3D A;  3FXU A;  3QYF A;  4DYQ A;  3GLX A;  4C9Y A;  3DEE A;  2V1U A;  1LVA A;  1TW2 A;  3RQI A;  4M3D A;  1JHF A;  3U21 A;  3FZV A;  4M72 A;  2A69 F;  4ZYD A;  3LSR A;  1B59 A;  4HDV A;  1FIP A;  1O3T A;  4PSW A;  1GT0 C;  3CD6 I;  4HW0 A;  4UVB A;  5C3E J;  1MZB A;  2BY0 A;  5L3F A;  1MJ9 A;  2Y0M A;  2ZME C;  1IN5 A;  2EPF A;  4BUP A;  3G3Z A;  1BOA A;  2DO7 A;  4KN4 X;  1S7A A;  2EWN A;  3DXJ F;  4IRH A;  4G12 A;  5B1A H;  5J1U A;  5IYC J;  2CW7 A;  2M2E A;  2HPM A;  1WSU A;  1IRG A;  1LEB A;  1OMI A;  3K7A J;  5BOX A;  3HSE A;  2FEZ A;  3HOU J;  1WFX A;  2JA8 J;  1BL0 A;  1LEA A;  4ZJZ A;  2VE8 A;  3A2K A;  4L18 B;  1OYY A;  1T56 A;  2O0Y A;  3BZK A;  1ETW A;  3RYP A;  3DTK A;  2ETH A;  2R7F A;  3R60 A;  4FE4 A;  4HQM A;  3TDU C;  4F93 B;  2DCE A;  1BIB A;  4G8X A;  2MH2 A;  3GBG A;  1ETV A;  3CUQ A;  2A61 A;  3FDY A;  1S29 A;  3D0S A;  1XGS A;  3WU1 B;  4E7L A;  4ZH4 F;  1L0O C;  3ZN1 A;  4IKF A;  1RET A;  2M3A A;  3Q5F A;  4R1H A;  2Y0S A;  4DZP A;  3NAR A;  5F08 A;  2JN6 A;  2CUF A;  4B43 A;  2V1D A;  1P7I A;  4RAZ A;  1IZ1 A;  2BZT A;  4DW6 A;  1T39 A;  4OOI A;  2IGO A;  4I0B A;  3F9K A;  4AVP A;  1YRN B;  4HNV A;  3EUH A;  3CCS I;  3IRR A;  3ASO H;  4IPA A;  3S8P A;  4I01 A;  1I1G A;  4NHJ A;  4IX7 A;  5HLI A;  1XSV A;  2R7X A;  4ZDP A;  1J59 A;  5LHH A;  3S16 J;  3OS1 A;  3X2Q H;  4KIT B;  1P9Q C;  1HBX G;  3HOY J;  3U1K A;  1TW3 A;  3FXL A;  3LOC A;  4LMY A;  2Y30 A;  5A2Q Z;  1DU0 A;  1FTT A;  3LSP A;  3MWM A;  1ORK A;  2BY3 A;  3L2V A;  1YJW I;  2V26 A;  2JRT A;  2FML A;  2LSO A;  2E34 A;  5D5X B;  1A31 A;  3CCR I;  5E1W A;  1ZGJ A;  1FLI A;  4XIC A;  1I6X A;  1B72 A;  2FNP A;  2F5C A;  4P5O A;  2K9Q A;  2VT3 A;  4B3X A;  3LSM A;  3LAJ A;  3JRG A;  1DP7 P;  1EH8 A;  1IJW C;  3I58 A;  1B6A A;  4W97 A;  1H89 C;  2E2I J;  2O8K A;  4ENN A;  2LKX A;  4WXD A;  1FSE A;  2N8G A;  2PQ8 A;  5E1Z B;  5LRS A;  1MW7 A;  2TRT A;  3ZMD A;  4NDL A;  2LRE A;  1VQ5 I;  2HDW A;  2VE9 A;  1VQK I;  3R61 A;  4IHT A;  1XSX A;  5K5O A;  5IT9 Z;  4EJO A;  4ESB A;  4YFN F;  3MKZ A;  4IHV A;  2ISY A;  2LNB A;  3O8G A;  2OC6 A;  4EV0 A;  4H0E A;  5FJ8 J;  1MSF C;  2P7C B;  1LFB A;  2JA5 J;  4IF4 A;  4NC8 A;  2Y69 H;  4KIB A;  1G6N A;  2R7D A;  2L7F P;  1SMY F;  2P6T A;  3I9V 2;  2QM3 A;  1G4D A;  2RQP A;  3S3N A;  1ONV A;  2E19 A;  4M3F A;  4JP0 A;  1LDJ A;  1XD7 A;  1RI7 A;  1IV8 A;  5ICG A;  3HL2 A;  2I5U A;  1Z6T A;  2XKO A;  5FLX Z;  1UAA A;  3OYF A;  3O6B B;  3CCM I;  1JE8 A;  3V4G A;  2NVT J;  2OTJ I;  5M5Y J;  2NNY A;  2WC2 A;  2EZI A;  1IXR C;  4IOC F;  2IA0 A;  2CV1 A;  1Y6I A;  2Z16 A;  1Z0X A;  2EFO A;  1YLF A;  2XAG A;  3FXJ A;  1CF7 B;  2Z33 A;  4V2F A;  4YFX F;  2YS9 A;  1I1S A;  1JT0 A;  1IN7 A;  2L02 A;  2VOO A;  5AIQ A;  1QVT A;  2RNG A;  1WH5 A;  2XB0 X;  1LDK B;  1D3Y A;  1LFU P;  2CV2 A;  3JSO A;  2NVQ J;  3SDG A;  5FKM A;  1GV2 A;  1VQP I;  1IC8 A;  3JRC A;  1QA6 A;  2IXS A;  2K3P A;  3OSF A;  3K4C A;  2CMP A;  1E3P A;  1WI9 A;  1MH4 A;  1JXS A;  4RS8 A;  2R0Q C;  4P9U A;  4IJA A;  3H3V K;  4XLE A;  2CGP A;  1XX5 A;  1DPR A;  4BHP A;  4R8H A;  1ZRD A;  3DPU A;  4CUG A;  3D1N I;  5LEJ A;  2OV7 A;  2HR3 A;  5B1B H;  1WPK A;  3QAH A;  1ON1 A;  5HS9 A;  3TOA A;  2HOT A;  1YHQ I;  4Y13 A;  2P8T A;  3PO2 J;  3MD2 A;  2IAI A;  2DA5 A;  2V7F A;  1KU2 A;  2FX0 A;  4RMN A;  1SEU A;  1XMA A;  1X1A A;  4M3G A;  1WJB A;  3A01 B;  4G7O F;  4AYB A;  3WHB A;  1APL C;  3DCF A;  4DOZ A;  1HQC A;  4FET A;  3G1M A;  1T38 A;  2HDD A;  2I8D A;  2DJI A;  1KQ0 A;  5J40 A;  2IW5 A;  4E4H A;  2HFH A;  4KIF A;  3K9T A;  3DBR B;  1R5I D;  4B47 A;  5E17 F;  4I02 A;  2UZK A;  3HC7 A;  1SVO A;  4A6D A;  4ZZL A;  3FIW A;  1JUS A;  4KN7 X;  2OQG A;  1HW5 A;  4BQO A;  2KL4 A;  2O7O A;  5CVR A;  3SJM A;  2V1N A;  3I5U A;  1G3T A;  5EYR A;  1S7E A;  5D4R A;  2Y48 A;  2R92 J;  2XF6 A;  5IYD J;  5JLX A;  5D8K B;  5FFX A;  5B3S H;  3JRF A;  3K1N A;  5IP7 J;  2HEO A;  2QZ8 A;  2EIM H;  2RQQ A;  4XLH A;  4I98 B;  4QPQ A;  4BAC A;  1ZGW A;  2Y9Z A;  2O6G E;  4IXA A;  5IP9 J;  1XG1 A;  2DDA A;  3ZMV A;  2CYY A;  2K5C A;  3WTT C;  5C44 J;  2CJJ A;  1NK2 P;  2HQN A;  1KA8 A;  2P6S A;  3S32 A;  4CSW A;  4FQG A;  3GZ5 A;  3PNY A;  3C1D A;  1Y8R B;  3M8F A;  1FMW A;  3LL7 A;  4N0B A;  4UXN A;  2XAS A;  1LPQ A;  1W7P D;  2FE3 A;  2PI0 A;  2Y2Z A;  4L0Y B;  4ON0 A;  1JI8 A;  4Y17 A;  1J7K A;  4DZJ A;  1YW7 A;  3FKI J;  4OIQ F;  2QBY A;  4HLY A;  2QKM B;  4A3G J;  4I6Z A;  2A5W A;  2W85 A;  2W00 A;  2EZH A;  3HGG A;  3JAM K;  4ZTF A;  2VL8 A;  2E2H J;  1YTY A;  3E5U A;  4DJA A;  2FBK A;  4C2T A;  3H3Z A;  4HDU A;  3CDH A;  1HW2 A;  1EH6 A;  1LVK A;  2EA4 A;  1U8B A;  3J7A Y;  4HV5 A;  2BVM A;  2XAJ A;  3ISP A;  4E7J A;  3CCL I;  3EPZ A;  3IP4 B;  2LKS A;  1WJE A;  1VQL I;  4WXH A;  1FOY A;  4P55 A;  2GIV A;  3RIR A;  2BBY A;  2P5V A;  2X1E A;  1QU3 A;  3QYB A;  5HDG A;  3D5R C;  3LA3 A;  5CKT A;  1Z6R A;  2GBY A;  5KHD A;  2ID6 A;  3BTL A;  3L7W A;  4Q48 A;  4F7Z A;  1Z9C A;  2CQ7 A;  2CS3 A;  3SEQ A;  1ETX A;  3QPL A;  4S0H B;  2MG4 A;  2OCE A;  1J9I A;  3KX2 A;  2LTP A;  2YUS A;  2HPI A;  3RTR A;  1UB9 A;  3FXR A;  3HG9 A;  2KRC A;  2MLG A;  2M0C A;  4A3E J;  3V7S A;  3LWF A;  4A3K J;  2RC4 A;  1D1C A;  3E5X A;  3F0C A;  3FBI B;  5EF6 A;  2HVS A;  4A3D J;  3S15 J;  3WTW C;  1PDN C;  3C3W A;  3WU2 C;  1IRZ A;  4IEJ A;  1D5V A;  2CW0 F;  3DP7 A;  1K6Y A;  2PG4 A;  2PMU A;  3F6O A;  3LSG A;  2MLK A;  3MN2 A;  1SAN A;  2CRG A;  5HS7 A;  5D6F A;  4D5F A;  2R7S A;  5LGN A;  1MD0 A;  2DK5 A;  5ILV A;  3BLY A;  4OMZ A;  5GAE J;  4MTE A;  4N4N B;  4L5E A;  4BE2 A;  3WG9 A;  2VQL A;  4LGW A;  2ZXH A;  4WXC A;  3BTC A;  2PMH A;  3FXO A;  1IRF A;  4EAT A;  3RDI A;  4DQ2 A;  3G1L A;  1R4N B;  1Y0N A;  4Y4R A;  1WZ2 A;  2R7U A;  2DAO A;  2QSG X;  3HOV J;  1X1B A;  1XMX A;  3GEZ A;  4XN0 A;  4M73 A;  2DBB A;  3I4P A;  1FTZ A;  2W84 A;  2FRH A;  5HNF A;  2F5E A;  5EEA A;  2HQA A;  2M7B A;  4JYK A;  4H4K C;  4L9J A;  1I3Q J;  3GWZ A;  3S1R J;  2QLZ A;  1MMD A;  4RLF A;  2OPT A;  3VFZ A;  4GFB A;  3WG7 H;  2H94 A;  3DTI A;  3DBH B;  4QIW N;  2DDB A;  3K70 D;  3LNQ A;  1LB2 A;  2C6Y A;  1ON2 A;  1WVR A;  2O5R A;  5J4Y A;  1B72 B;  4I76 A;  3OYL A;  4NQW A;  2F5V A;  2WAD A;  1O3S A;  2ZFU A;  3G4S I;  5K7H A;  4RGU A;  3HXL A;  1GLN A;  4RB3 C;  4OAY A;  1XB4 A;  2NRA C;  1E17 A;  1W1W E;  2LC2 A;  1T98 A;  2KLO A;  3I4M J;  1FYM A;  1RES A;  1QO0 D;  4QWQ A;  1S72 I;  1A36 A;  5LGT A;  1BR1 A;  1POG A;  4HNT A;  1BI0 A;  2X1C A;  2OUM A;  4HST A;  4I7H A;  4F92 B;  3E1S A;  5CVU A;  2XUB A;  4BJT A;  3PJR A;  3PFY A;  4D0P A;  3SZT A;  5J8F A;  3IKV A;  5K1Y A;  4PZJ A;  5M5W J;  2YX7 A;  3ZR8 X;  5FRM A;  4M6Y A;  2ZSH B;  3JRB A;  1AOY A;  1JKP C;  3CP8 A;  4UV8 A;  1OCR H;  5FKK A;  3OYD A;  3F6V A;  3H35 A;  3FX3 A;  3J80 K;  1V5F A;  2KKO A;  1NTC A;  3AL0 B;  2QCO A;  4LLN A;  1TBX A;  5LFA A;  4YII A;  1F5T A;  4AIK A;  3BR5 A;  3VYS B;  4AM3 A;  2L0K A;  2MSY A;  2JA7 J;  3BPX A;  4ENM A;  1JGS A;  3E6D A;  4II2 A;  4AC0 A;  5FB2 A;  3ZQQ A;  4ITV A;  3U1D A;  4EEF G;  2VOD A;  5LD2 C;  2X51 A;  3N05 A;  3ABM H;  3BCA A;  1MGT A;  1TWH J;  2RRE A;  2WY8 Q;  4U7D A;  2VON A;  2XVC A;  1IXS B;  1YQA A;  2IPQ X;  2MGQ A;  4FX0 A;  5EEH A;  2GA1 A;  4JX5 A;  2Z99 A;  5FRO A;  3H1C A;  4EQQ A;  4ZYG A;  3HKZ N;  3J81 K;  4IQ4 A;  2XC7 A;  5D6E A;  2DMQ A;  5HS8 A;  4OIR F;  1ZG1 A;  1UJ8 A;  2UXN A;  5E3O A;  3HOT A;  3QP6 A;  4NB5 A;  3ZQ7 A;  1MMG A;  3E3V A;  2GQQ A;  4IQJ A;  2ZXJ A;  2WV0 A;  3BZC A;  3IH2 A;  1P6R A;  1TWF J;  4LFU A;  2HXO A;  4FT8 A;  2NAZ A;  5CVI A;  3BY6 A;  4UV9 A;  1IG7 A;  1IUF A;  1ZR4 A;  5BQT A;  1MND A;  3IC7 A;  2CQN A;  2HKX A;  4XM3 A;  3S3M A;  5FRN A;  3HB9 A;  3RPU D;  1QHG A;  2CQX A;  3CDI A;  5E1X A;  4G6T B;  4L5I A;  4F91 B;  3Q3S A;  3BRO A;  5L3G A;  1IAW A;  3VYR B;  3K1P A;  3SEZ A;  3RKY A;  2Z1D A;  2OAZ A;  3PSI A;  3O2P E;  1UHS A;  5JFR A;  2M8G X;  4E7S A;  3IH4 A;  3S1Q J;  3OWT A;  1SFK A;  2CO5 A;  2PJR A;  2WV1 A;  2EV0 A;  4PJJ A;  1SAX A;  2KT0 A;  2ADU A;  1TWG J;  2V79 A;  4DBQ A;  4DYC A;  1DP3 A;  2DU9 A;  1F9N A;  2DTR A;  4F55 A;  2RKH A;  1BI2 A;  4XRM A;  5JHF A;  2KZV A;  3BG5 A;  2P81 A;  4KYW A;  1BC7 C;  2UWM A;  2WB1 A;  4IHY A;  2ICW G;  4B3A A;  2XV4 S;  4V19 K;  4ETS A;  2MAB A;  3BDD A;  3ZQI A;  3GME A;  4X0G A;  4KIC A;  2DJN A;  2LFB A;  3LSJ A;  1IN4 A;  1ZN2 A;  2W82 A;  2X0L A;  3W6V A;  3AKZ A;  3QOD A;  3H0G J;  3RZO J;  2K4B A;  1R58 A;  3FHZ A;  2LRD A;  1WCM J;  2XPW A;  2NVX J;  1ULY A;  2DLL A;  4C2U A;  2DW4 A;  3KZY A;  2WAQ N;  4B09 A;  1BR2 A;  4MHG A;  3OY9 A;  4A3B J;  3Q9S A;  1Z1D A;  2QBY B;  3M3Y J;  5E3M A;  4BNC A;  5J47 A;  2QKL B;  4ZDO A;  3SQN A;  3NWT A;  3G73 A;  3QRF F;  4MTD A;  3G71 I;  5FKN A;  1X19 A;  3F23 A;  2VI6 A;  2DT5 A;  4U88 A;  5DEQ A;  4UHT A;  4A0Y A;  3GO5 A;  2QEX I;  3CLQ A;  2WWY A;  1YFH A;  4XN3 A;  4DNC A;  3UKG A;  4LLL A;  3R0J A;  1ZYR F;  2G0E A;  1UEL B;  4Y33 A;  2KIM A;  5HLG A;  1YO5 C;  1HW1 A;  3K4K A;  1MMS A;  2K3F A;  2ZJ2 A;  3WU0 A;  5ICC A;  4BY1 J;  2DA7 A;  5M3M J;  1X4P A;  2X85 A;  2D1V A;  3I53 A;  1YJN I;  4YEL A;  4YEJ A;  1MIJ A;  2PMZ N;  4ZDL A;  3J7A O;  4RB0 A;  1UZC A;  5F0F A;  2MD5 A;  3JR9 A;  4CCK A;  3R4K A;  2KDO A;  4KNY A;  1KQ8 A;  1MJB A;  1A5J A;  2ZJP F;  3MQ0 A;  1JHH A;  4C2M J;  2DFI A;  2JUG A;  5FLV A;  1QQI A;  1N75 A;  3L09 A;  4YRV A;  1JUM A;  3QQA A;  2R3S A;  2ZC2 A;  1T2K A;  1B8I B;  2DN0 A;  2O3F A;  1D0X A;  1X3U A;  2R7Z J;  3NRV A;  1ITY A;  1IN8 A;  1YIJ I;  1GVJ A;  5CPR B;  5D5W B;  2A6T A;  3E7L A;  4QLC U;  1JGG A;  1HOM A;  4II3 A;  3V7R A;  3VYT B;  4LB5 A;  1NK3 P;  1D0Y A;  4XRS G;  4D9J A;  2RV8 A;  5BPI A;  3Q0V A;  4C3H J;  4XQF A;  2QA4 I;  2G7H A;  1U6G A;  2AXL A;  4XLA A;  3TOB A;  2DMP A;  3T5X A;  4OWR B;  1Z67 A;  2E1M C;  2ACJ A;  5IT9 K;  2V4J C;  2HOS A;  4OIN F;  3GFJ A;  3S1M J;  4HF2 A;  1LUJ B;  3HUG A;  3FWE A;  3H9Q A;  4Y3O A;  2KFD A;  4BYY A;  3NQO A;  3OIQ A;  3B6C A;  4O5V A;  2EFN A;  4XOT A;  3A03 A;  4X1E A;  2BY1 A;  3ZP5 A;  5EZH A;  1FY7 A;  2P4W A;  2DQL A;  2XGX A;  1JUP A;  1WQ2 A;  3KZZ A;  3A1Y A;  2L01 A;  5L3B A;  1F4K A;  4M9S A;  2L9R A;  2CU7 A;  5CYV A;  4XSZ F;  1NHA A;  3QYE A;  5BS6 A;  2M7A A;  5E3L A;  3H92 A;  3P9C A;  3GZ6 A;  3REO A;  3DF8 A;  2AHQ A;  1AWC A;  4NQW B;  5ERI A;  2L7K A;  2VBX A;  2GWR A;  2JVG A;  3HTU A;  2NVY J;  3KLN A;  4P1W A;  5LRR A;  4BAY A;  4DBR A;  5DS9 A;  2JSC A;  2EJR A;  2DT7 B;  1HST A;  2QQB A;  3ZN0 A;  2FMY A;  2BHZ A;  3F8N A;  1X2M A;  2DPU A;  2M4G A;  1JTX A;  4GO1 A;  2VKV A;  1J2X A;  2B0L A;  1MJA A;  3V8L A;  1X2N A;  2HDC A;  5GAH J;  1FOX A;  1IUY A;  1VTN C;  3EYI A;  3B73 A;  3ZQF A;  5CLS A;  2EZL A;  2K4J A;  3OIO A;  3BQY A;  1YOV B;  1RNL A;  2KJB A;  1BJZ A;  2IS2 A;  3F3X A;  2VT2 A;  1VI0 A;  1FZP B;  3DPL C;  4HX8 A;  2VPR A;  3P9I A;  5GTH C;  5DCM A;  4ZYH A;  2VQG A;  3QU6 A;  5TGT A;  4HYE A;  2TCT A;  5GAD J;  4EGZ A;  1K78 A;  4CYD A;  2M45 A;  3TO7 A;  4ABZ A;  5ILU A;  1SD7 A;  4G7Z F;  5K5R A;  2W1O A;  2M4K A;  5HLT A;  1GHC A;  3CO7 C;  3L2C A;  2BXZ A;  3RJP A;  4BE0 A;  3DTE A;  4FCY A;  5FKL A;  3OMY A;  4A2U A;  4XLN F;  1QNT A;  1KQ9 A;  1V3F A;  4G9Y A;  4S05 A;  2FQ3 A;  3HPG A;  4O6J A;  4PGG A;  4U0W A;  1R5G A;  1XCB A;  2E5N A;  4OU0 A;  2FXA A;  3FHN A;  4KJZ A;  4UY8 I;  3BJA A;  2LD5 A;  4BXU A;  3TW6 A;  4IOA F;  4JX6 A;  3CF2 A;  4BEH A;  3KCC A;  1FX7 A;  2NS8 A;  5FD6 A;  1STZ A;  3QP5 A;  3MFK A;  5TRD A;  4OAZ A;  3DV8 A;  2MA3 A;  2AQE A;  2ID3 A;  3BZ6 A;  2BOL A;  5H2F C;  2KRH A;  2JWT A;  3SZP A;  5E20 A;  2DTZ A;  1IDY A;  4NBQ A;  2L4A A;  2Z2S B;  3K4J A;  5IP6 A;  4IO9 F;  2VBZ A;  2AO9 A;  3RKQ A;  1GXP A;  3RPQ A;  3BR6 A;  4J00 A;  4A0X A;  1HDD C;  1A6I A;  3DQV C;  1TLH B;  1IN6 A;  1OYI A;  1Z7L A;  3EUA A;  4LG0 A;  4BGD A;  1K6O A;  2E2J J;  5BPD A;  4HZF A;  4LIV A;  3P7N A;  4QPO A;  4LOC A;  4U7B A;  2DFH A;  3VEP A;  2XGD A;  2ZNZ A;  2VLA A;  2L4M A;  4L9N A;  4U87 A;  1XSD A;  2BHY A;  3SXY A;  3TO9 A;  1FIA A;  2DMT A;  3JTG A;  1QHH D;  2H8W A;  3M9A A;  1Q1V A;  4FIS A;  1XGM A;  4BKX A;  2HS5 A;  3SHF A;  3R0A A;  1I5Z A;  4M3E A;  1X4O A;  2PJR B;  2OCC H;  3TDZ C;  3U2R A;  3BG9 A;  1YI2 I;  2XHK A;  3IH3 A;  2IGN A;  1AHD P;  1H8A C;  1G59 A;  5ICF A;  3F22 A;  4A5N A;  4N9I A;  2UUZ A;  1OCO H;  2KZG A;  2X48 A;  1D1A A;  3CTA A;  2PFB A;  4B48 A;  3PM1 A;  3NEU A;  4QSH A;  1R7J A;  3H36 A;  2XDV A;  2EA2 A;  1W4M A;  3KEY A;  5HNH A;  1R1T A;  2EIJ H;  2EB7 A;  4HX7 A;  5H20 A;  1X58 A;  1ZG5 A;  3CJT B;  4A3M J;  3AG4 H;  4P9F A;  3W6K B;  2W25 A;  3GZN B;  3T8T A;  1ACI A;  1N77 A;  3BT9 A;  2RAE A;  4YIF A;  5LGU A;  1R49 A;  2XPU A;  4KMU X;  4CCO A;  2L7M P;  1NH3 A;  1RRJ A;  1OYW A;  4Y7N J;  2VJJ A;  5EGO A;  3CC7 I;  2V9P A;  3WGG A;  5C4X J;  9ANT A;  1U0J A;  1YX3 A;  3OS0 A;  2IT0 A;  1Y0U A;  2MC3 A;  4CCN A;  1MMA A;  3M1C A;  3B02 A;  1E0E A;  1Y1W J;  2F4I A;  2R5Y A;  3BR1 A;  4OIO F;  3HSR A;  3JRI A;  3GTK J;  3HOS A;  4CDG A;  3CQZ J;  3QU3 A;  1RKT A;  3HEF A;  4JOM A;  2Z3Y A;  2FSW A;  1IDZ A;  2BY2 A;  2FOW A;  3T1B A;  2X4H A;  1R71 A;  4IHX A;  2HNH A;  1QPM A;  2OD5 A;  3E97 A;  2QYO A;  2ZME A;  4LJZ F;  2HZD A;  1DDN A;  1MDM A;  1WH7 A;  1CQT A;  3LFU A;  3OV8 A;  1WJF A;  4YG2 F;  1FBS A;  4AIH A;  3M8J A;  4UVA A;  2H6B A;  1BW6 A;  4KIG A;  2GOX B;  3SZG A;  3L2W A;  1MBJ A;  2PLY A;  1T08 B;  3CCV I;  4V2G A;  1R00 A;  4KMF A;  3I54 A;  4E7I A;  1O3Q A;  2IGM A;  1ZEL A;  3AAF A;  2QQ9 A;  2DXI A;  5GAG J;  1VQ4 I;  1ZKG A;  4XRS A;  2VXZ A;  1IGN A;  5E8G A;  1WJD A;  1Z77 A;  3EQL F;  2R4G A;  2YU3 A;  4N4O B;  4XOR A;  3RSN A;  1VQN I;  1WJA A;  3GTO J;  5CVV A;  3D5S C;  3W3C A;  4PDK A;  2K86 A;  3KYC B;  1PVE A;  3ZMZ A;  4GGG A;  2NYX A;  3FXK A;  4LG3 A;  4BBR J;  3ULQ B;  3CME I;  4EVI A;  3COA C;  1H9T A;  2KIQ A;  4XLF A;  5H6Q A;  2A5Y B;  2LY9 A;  2ME6 A;  2F2E A;  2HYF A;  4WWC A;  1Z3X A;  4TV7 A;  4E6K G;  3CLO A;  1O7F A;  3WHC A;  1SFX A;  2V6E A;  2COM A;  2M0M A;  1RUN A;  4ENK A;  5HOD A;  4CYC A;  2F5D A;  3GUD A;  4C3J J;  3HOZ J;  2DA4 A;  3OOP A;  1R22 A;  2CG4 A;  1Y56 A;  4UVC A;  3FK6 A;  1ZK8 A;  1V5E A;  1Z21 A;  3BG6 A;  5JLW A;  4MEY F;  3SYT A;  2JJ7 A;  2XRL A;  3HUG B;  1RR8 C;  2CUE A;  2MBF A;  1B8I A;  4M71 A;  1T95 A;  1W5T A;  4IVN A;  1MKM A;  2M1B A;  2VBW A;  4HX4 A;  3M7G A;  5J3L A;  2X9D A;  1U5T C;  1W7P A;  5GPC A;  2PBI A;  3HRS A;  3SFI A;  3CUO A;  2VJ5 A;  2Y0S N;  1U78 A;  1K83 J;  3DWL E;  3IL2 A;  2QSH X;  2H27 A;  1FP2 A;  2KIS A;  4ZYE A;  5K7Z A;  1D5Y A;  3E6C C;  3HTS B;  2HQR A;  2IVM A;  3PQK A;  2E36 A;  4J01 A;  3MEX A;  1J0R A;  5LEK A;  1IXC A;  2NNN A;  3BWG A;  2KHM A;  4BHC A;  4HRI A;  2JMW A;  5DTD A;  3TMO A;  4J19 A;  1IV6 A;  1RC9 A;  4A5M A;  1DU6 A;  1R4M B;  3CF5 F;  4RB2 C;  1ZRF A;  1OQY A;  4RLQ A;  1GVD A;  2ZCW A;  1LQ1 A;  4KFC A;  2LKP A;  4PFO A;  3TO6 A;  4XK4 A;  5E3N A;  2NVU B;  1U2W A;  3ZQC A;  3GFM A;  5EDN A;  4PJM A;  4PJ0 C;  2XAF A;  4IL6 C;  2OJE D;  3DEU A;  4PCQ A;  5FFZ A;  5HDN A;  1O7L A;  5DV5 A;  2R5Z A;  2XGC A;  2OTL I;  2LVS A;  3U9G A;  2HVR A;  2F4O B;  3OYN A;  4XLP F;  1I50 J;  2MC4 A;  1YS6 A;  1HKS A;  3KEQ A;  1IRX A;  1RPW A;  3LST A;  2K9M A;  3I59 B;  3RKW A;  2HZT A;  4DGW B;  1QRY A;  2J5O A;  2DOE A;  4RM2 A;  3FMQ A;  3ESW B;  1FBU A;  4G94 A;  5H6R A;  3GX4 X;  2HU9 A;  4XMY A;  3UR3 C;  4MQ9 F;  2CV0 A;  2K02 A;  5DCM B;  2YX4 A;  4G7H F;  1BI1 A;  2P5K A;  1P2F A;  3Q0U A;  3OS2 A;  3JW4 A;  1K78 B;  3A0B C;  5KAF C;  2J5P A;  1O4X A;  1GXQ A;  4XID A;  3JAM Z;  2D1H A;  1OLT A;  3DKW A;  4ZYA A;  5EZG A;  1XS9 A;  1JJ6 C;  5FO5 A;  3LA7 A;  4AUX A;  1SVL A;  2CQK A;  4G6D A;  3WTX C;  1QZY A;  3WOD F;  1EH7 A;  2VB6 A;  1PP8 F;  1V55 H;  3ABK H;  3KLO A;  4UNO A;  2XAQ A;  3BOQ A;  2EK5 A;  3K6G A;  2LP0 A;  2HYG D;  3FIS A;  3QWL A;  1REP C;  2RGV A;  2W4S A;  3EDP A;  3P5J A;  4MFD A;  3KIO A;  2L54 A;  3OL3 A;  3VYU B;  1YJ9 I;  2F4M B;  3BC8 A;  3OIP A;  3HYI A;  1ZR2 A;  2D5V A;  2XRN A;  3KP7 A;  4NC7 A;  5KCM A;  4BEH B;  1RUO A;  1HCR A;  4KIS A;  2P7V B;  2YPR A;  6PAX A;  1TT5 B;  1KGS A;  3ASN H;  3AG1 H;  4LIU A;  5IYB J;  4E70 A;  3ML6 A;  2KIU A;  5J4V A;  2RVC A;  1S5L C;  2HTJ A;  4E7H A;  1MMN A;  3KP5 A;  3CUQ C;  4O3M A;  3GTL J;  1FPQ A;  1FBQ A;  5HOO A;  3VPR A;  5D5U B;  3OYJ A;  4RBO A;  1JKR C;  2X1D A;  2R7Q A;  3S1N J;  4CHU A;  3TQN A;  4LG0 B;  2HVQ A;  2LR8 A; 
#chains in the Genus database with same CATH homology
 3F8M A;  2ZFW A;  2ZBK A;  3KFW X;  1HXD A;  4M74 A;  1B4A A;  2LF7 A;  4L5J A;  2Q2E A;  1W5S A;  2O03 A;  2K27 A;  1YS7 A;  4KT5 C;  1EV7 A;  2BV6 A;  2ISZ A;  3WTV C;  2ZNY A;  2FNA A;  2LDU A;  3ABU A;  2BGC A;  3GVA A;  4GYI A;  2Q0O A;  3GYH X;  2STT A;  2KIF A;  4Q47 A;  2JPB A;  1ZRC A;  4L9V A;  2OBP A;  2OU2 A;  4RAY A;  2JPC A;  1IF1 A;  2D2W A;  4L0Z B;  3V7C A;  1L3L A;  3FMR A;  3ROU A;  2V9V A;  1UCR A;  5HVQ C;  2FBI A;  4LD5 A;  2QWW A;  4AIJ A;  1FC3 A;  5J6X A;  5F1R A;  5ICE A;  1TQI A;  3HSF A;  2W24 A;  1K7A A;  3GF2 A;  5FD5 A;  2HTS A;  2A6E F;  2ZME B;  4Z2Y A;  1MDM B;  3FMS A;  2QEN A;  1USS A;  2GXB A;  4Y15 A;  4HQE A;  5KK1 A;  4PGH A;  3RPU A;  5CVJ A;  3FXQ A;  4M6X A;  1TTY A;  5LHG A;  1O3R A;  2M87 A;  4IRI A;  2XAH A;  2DK8 A;  3WGI A;  4EJU A;  1U5T A;  5DD8 A;  1YG2 A;  3CJN A;  5LBQ A;  4ASN A;  1HKQ A;  4MNU A;  5DCF A;  3N4M A;  4LK0 F;  1KU9 A;  1BN5 A;  3KP2 A;  2A3S A;  3RKX A;  2WTE A;  5DUI A;  4U0V A;  3HRU A;  5JVT A;  1O57 A;  5D8L B;  5A2Q K;  3IWF A;  3M8E A;  1FWZ A;  3F72 A;  5TJJ A;  3CO6 C;  2RDP A;  2RNJ A;  2NS0 A;  1D8J A;  2KJC A;  1W7P B;  2STW A;  1Z05 A;  3MZH A;  1UFM A;  2MH9 A;  5D5V B;  5ILS A;  1ZGA A;  1YYV A;  2BE5 F;  3P9K A;  3PFI A;  4JQF A;  4EJV A;  1ZAR A;  3LQQ A;  4LK1 F;  3KP3 A;  2FU4 A;  2E1C A;  1Z91 A;  4WF2 A;  3ERE D;  1ZH5 A;  2IA2 A;  1BBY A;  2FA5 A;  5BMZ A;  1P4X A;  1TNT A;  3ELK A;  3MCZ A;  2YSR A;  5FLX K;  2EV5 A;  1S7O A;  3WE3 A;  3I0T A;  4ENJ A;  1UHW A;  2VN2 A;  2A07 F;  4BQA A;  4B8X A;  2H6C A;  1S3J A;  2Z5U A;  1P92 A;  2G7U A;  5LLQ A;  3WTU C;  4FHT A;  3I59 A;  2CFX A;  1ODD A;  3QPT A;  2OA4 A;  1SD6 A;  2F5F A;  4AWX B;  4ESF A;  2JZY A;  1V4R A;  1U8R A;  4FX4 A;  1G3S A;  2VC1 A;  4XSX F;  1UST A;  3EET A;  3I64 A;  2GXG A;  4WCG A;  4ESJ A;  5FGM A;  1LJ9 A;  3KP6 A;  2ESN A;  1G3W A;  1ZLJ A;  4M9X A;  1R1U A;  4CXF A;  3WTS C;  5F64 A;  2EFP A;  1T6S A;  3MZY A;  2GA2 A;  2VC0 A;  3MAJ A;  3DPT A;  1P4W A;  2E7X A;  3ZMS A;  5DD4 A;  1YW9 A;  2CWE A;  4CZZ A;  2H09 A;  1DPU A;  4IRG A;  5IT3 A;  4A6E A;  1SMT A;  3QOP A;  3L00 A;  3K1M A;  1BM9 A;  3TGN A;  3S2W A;  2XRO A;  3DFG A;  2EFQ A;  2JTV A;  2O61 A;  4XRF A;  1XGO A;  3ZPL A;  4EGY A;  3N97 A;  2A6H F;  3GXO A;  2Z9O A;  4ZZD A;  3WE2 A;  1S8N A;  2Q8K A;  4I0A A;  2IRF G;  1OKR A;  1IW7 F;  3SFZ A;  1A04 A;  4CGZ A;  1QBJ A;  5L3E A;  1ZLK A;  3BJO A;  5JR3 A;  4HF1 A;  4WX9 A;  3IKT A;  3O3K A;  3GW2 A;  2XKP A;  2ELH A;  4HA8 A;  4EM0 B;  1U5T B;  3FM3 A;  3WTZ A;  3KEO A;  1XN7 A;  2GAU A;  2QQA A;  1S6L A;  4OIP F;  3JSP A;  2VOP A;  1B9M A;  4HV6 A;  4G6Q A;  2KRF A;  2P5L C;  3C18 A;  3ABT A;  5J8C A;  3GFL A;  2E1N A;  2HOE A;  1BIA A;  2OZ6 A;  1SD4 A;  1RIO H;  2AS5 F;  1C0W A;  3K69 A;  4GXO A;  3T8R A;  3ECO A;  3HHG A;  4KA4 A;  2CSO A;  3BJ6 A;  3F8F A;  2DPD A;  4N9H A;  4YFK F;  3PQJ A;  1XGN A;  2IJL A;  2QUF A;  4HOB A;  1R1V A;  1Z7U A;  4CO8 A;  4GCV A;  1FYK A;  3JTH A;  4K2E A;  2FBH A;  4M9Z A;  1WRJ A;  4S04 A;  1BI3 A;  2M5W A;  4KDP A;  1FYL A;  3ZMT A;  1XDS A;  2V1X A;  2M30 A;  3LFK A;  3V8K A;  3HRT A;  1PUE E;  5ED4 A;  4EJT A;  1P4A A;  4EMS A;  4CIC A;  1FSH A;  4HBL A;  1J75 A;  3BPV A;  1FOK A;  2PJP A;  1OPC A;  4MEX F;  3WTY C;  2M8E A;  3C7J A;  1KYW A;  1YIO A;  3LAP A;  5JHU A;  2DQR A;  3K0L A;  1F1Z A;  4I09 A;  3CUQ B;  1WWX A;  2JT1 A;  5DYM A;  5AON A;  5EEG A;  2W57 A;  3FM5 A;  2LF8 A;  3EYY A;  1PP7 U;  5L3C A;  1BC8 C;  3H3U A;  1LNW A;  3RYR A;  4HAM A;  3KP4 A;  3TKY A;  1ZAO A;  3F8B A;  3M1E A;  1HKT A;  3ECH A;  4JK1 X;  2OZU A;  2BEO A;  1SFU A;  3D5L A;  3F8C A;  4BH9 A;  1KU3 A;  1R5H A;  4R79 A;  2Y75 A;  3HHH A;  3V8J A;  2HGC A;  1ZG3 A;  2IA1 A;  2HKO A;  5F6F A;  1TQP A;  3Q9V A;  1G3Y A;  1HSJ A;  2FF4 A;  2TDX A;  4RGS A;  2K7L A;  4I2O A;  4EM1 A;  2ESH A;  3E6M A;  4OMY A;  5D4S A;  3VOD A;  5JI6 A;  1SFE A;  5HDK A;  5L3D A;  4MGR A;  4Q5S F;  3RI4 A;  3L9F A;  1I27 A;  2D45 A;  3I71 A;  1H9G A;  2EV6 A;  2OQR A;  5AIP A;  3WGH A;  2O8X A;  1FNN A;  3T0Y A;  1FT9 A;  4XBF A;  3ZMU A;  2EFW A;  5K5Q A;  1OR7 A;  4GYG A;  2FOK A;  1U3E M;  2ZO4 A;  3LQR A;  4AD9 A;  3GFI A;  2GZW A;  1UHM A;  3HRM A;  2BYV E;  4RB1 A;  1R23 A;  3E6B A;  4L9T A;  4A12 A;  5E18 F;  1E2X A;  5KVR A;  1T0F A;  4MQV A;  2IP2 A;  3BP8 A;  4RGR A;  1XMK A;  4HF0 A;  2V6C A;  4WK8 F;  1YW8 A;  1CF7 A;  3E5Q A;  3VB2 A;  1TQM A;  1BJA A;  1D8K A;  2HWV A;  4A0Z A;  4UUV A;  1ZRE A;  2DI3 A;  1H0M A;  3FF5 A;  1DUX C;  5CJ9 A;  3F21 A;  3IWZ A;  3IHU A;  4HLX A;  4LB6 B;  2A68 F;  1WKM A;  3HIF A;  1LDD A;  3J80 Z;  3KE2 A;  1TNS A;  5HLH A;  1SD5 A;  5DUK A;  4LLG F;  2RN7 A;  4JBA A;  3KET A;  4Q4Z F;  1QZZ A;  5E8I A;  2PEX A;  1QGP A;  4EJW A;  5LHI A;  1Q1H A;  2YR2 A;  2VBY A;  1CGP A;  1ZHF A;  3QPH A;  3W6J B;  3R6S A;  3K2Z A;  3J81 Z;  1K79 A;  2XIG A;  1RZ4 A;  1B1B A;  1KYZ A;  1XCV A;  1R36 A;  2ZKZ A;  4EM2 A;  1B9N A;  3LA2 A;  4KUM A;  4P96 A;  4U0Y A;  2E7W A;  1J5Y A;  2UXX A;  3VOE A;  4RGX A;  4IHS A;  1XDU A;  1FP1 D;  5DDG A;  3IRQ A;  4BHB A;  2G9W A;  1KU7 A;  2QVO A;  2PN6 A;  2L3D A;  3FXU A;  3GLX A;  2V1U A;  1LVA A;  1TW2 A;  1JHF A;  3FZV A;  4M72 A;  2A69 F;  4ZYD A;  1B59 A;  4HDV A;  1O3T A;  4HW0 A;  4UVB A;  1MZB A;  5L3F A;  1MJ9 A;  2Y0M A;  1IN5 A;  3G3Z A;  2DO7 A;  1BOA A;  4KN4 X;  1S7A A;  2EWN A;  3DXJ F;  4IRH A;  1WSU A;  1IRG A;  1LEB A;  1OMI A;  5BOX A;  3HSE A;  2FEZ A;  1LEA A;  2VE8 A;  4L18 B;  1OYY A;  2O0Y A;  3RYP A;  2ETH A;  2R7F A;  3R60 A;  4HQM A;  3TDU C;  1BIB A;  4G8X A;  2MH2 A;  3CUQ A;  2A61 A;  1S29 A;  3D0S A;  1XGS A;  3WU1 B;  4ZH4 F;  1L0O C;  3ZN1 A;  3Q5F A;  4R1H A;  2V1D A;  4RAZ A;  1IZ1 A;  1T39 A;  4OOI A;  4I0B A;  4AVP A;  3EUH A;  3IRR A;  4IPA A;  4I01 A;  1I1G A;  4NHJ A;  5HLI A;  1XSV A;  1J59 A;  5LHH A;  1HBX G;  1TW3 A;  4LMY A;  5A2Q Z;  3MWM A;  2JRT A;  2FML A;  2LSO A;  5D5X B;  5E1W A;  1ZGJ A;  1FLI A;  1I6X A;  2FNP A;  2F5C A;  4P5O A;  2VT3 A;  3LAJ A;  1DP7 P;  1EH8 A;  3I58 A;  1B6A A;  4ENN A;  4WXD A;  1FSE A;  2PQ8 A;  5E1Z B;  5LRS A;  3ZMD A;  2VE9 A;  3R61 A;  4IHT A;  1XSX A;  5K5O A;  5IT9 Z;  4EJO A;  4ESB A;  4YFN F;  2ISY A;  2LNB A;  2P7C B;  4EV0 A;  4H0E A;  4IF4 A;  4KIB A;  1G6N A;  2R7D A;  1SMY F;  2P6T A;  2QM3 A;  1G4D A;  2RQP A;  1ONV A;  1LDJ A;  1XD7 A;  1RI7 A;  5ICG A;  1Z6T A;  2XKO A;  5FLX Z;  3O6B B;  1JE8 A;  3V4G A;  2NNY A;  2WC2 A;  1IXR C;  2IA0 A;  2EFO A;  1YLF A;  2XAG A;  1CF7 B;  2Z33 A;  4YFX F;  1I1S A;  1IN7 A;  2L02 A;  2VOO A;  5AIQ A;  1LDK B;  1D3Y A;  3JSO A;  1WI9 A;  1JXS A;  4RS8 A;  4P9U A;  4IJA A;  2CGP A;  1DPR A;  4BHP A;  4R8H A;  1ZRD A;  5LEJ A;  2HR3 A;  3QAH A;  1ON1 A;  5HS9 A;  3TOA A;  4Y13 A;  2P8T A;  1KU2 A;  1XMA A;  4G7O F;  1HQC A;  1T38 A;  1KQ0 A;  2IW5 A;  2HFH A;  4KIF A;  3K9T A;  5E17 F;  4I02 A;  2UZK A;  4A6D A;  4ZZL A;  4KN7 X;  2OQG A;  1HW5 A;  5CVR A;  3I5U A;  1G3T A;  5D4R A;  2Y48 A;  5D8K B;  5FFX A;  3K1N A;  2HEO A;  2QZ8 A;  4I98 B;  2O6G E;  4IXA A;  3ZMV A;  2CYY A;  3WTT C;  2HQN A;  1KA8 A;  2P6S A;  3GZ5 A;  3C1D A;  3M8F A;  4N0B A;  4UXN A;  2XAS A;  1W7P D;  2FE3 A;  2PI0 A;  4L0Y B;  4ON0 A;  4Y17 A;  1J7K A;  1YW7 A;  4OIQ F;  2QBY A;  4HLY A;  2W85 A;  3JAM K;  1YTY A;  3E5U A;  2FBK A;  3H3Z A;  4HDU A;  3CDH A;  1HW2 A;  1EH6 A;  2EA4 A;  4HV5 A;  2XAJ A;  3ISP A;  4WXH A;  4P55 A;  2GIV A;  3RIR A;  2BBY A;  2P5V A;  5HDG A;  3LA3 A;  1Z6R A;  3L7W A;  4F7Z A;  4Q48 A;  1Z9C A;  1J9I A;  3RTR A;  1UB9 A;  3FXR A;  2MLG A;  3V7S A;  3LWF A;  2RC4 A;  3E5X A;  3WTW C;  1PDN C;  3C3W A;  1D5V A;  2CW0 F;  3DP7 A;  2PG4 A;  2PMU A;  3F6O A;  2MLK A;  5HS7 A;  5D6F A;  5LGN A;  1MD0 A;  2DK5 A;  5ILV A;  4OMZ A;  4MTE A;  3WG9 A;  4LGW A;  4WXC A;  2PMH A;  1IRF A;  3RDI A;  4DQ2 A;  2DAO A;  3GEZ A;  4M73 A;  2DBB A;  3I4P A;  2W84 A;  2FRH A;  2F5E A;  4L9J A;  3GWZ A;  2QLZ A;  3VFZ A;  2H94 A;  1LB2 A;  2C6Y A;  1ON2 A;  4NQW A;  1O3S A;  4RGU A;  4RB3 C;  2NRA C;  1XB4 A;  1E17 A;  1T98 A;  1FYM A;  1QO0 D;  4QWQ A;  5LGT A;  1BI0 A;  4I7H A;  5CVU A;  2XUB A;  4D0P A;  3SZT A;  5J8F A;  3IKV A;  5K1Y A;  4PZJ A;  2YX7 A;  4M6Y A;  1AOY A;  4UV8 A;  3F6V A;  3FX3 A;  3J80 K;  2KKO A;  4LLN A;  1TBX A;  1F5T A;  4YII A;  4AIK A;  3BPX A;  4ENM A;  1JGS A;  3E6D A;  5FB2 A;  3U1D A;  2VOD A;  1MGT A;  4U7D A;  2VON A;  2XVC A;  1IXS B;  1YQA A;  2IPQ X;  4FX0 A;  5EEH A;  2GA1 A;  2Z99 A;  4EQQ A;  4ZYG A;  3J81 K;  5D6E A;  5HS8 A;  4OIR F;  1ZG1 A;  2UXN A;  3HOT A;  3QP6 A;  3ZQ7 A;  4NB5 A;  3E3V A;  2GQQ A;  2ZXJ A;  2WV0 A;  1P6R A;  4LFU A;  4FT8 A;  2NAZ A;  5CVI A;  3BY6 A;  4UV9 A;  5BQT A;  3IC7 A;  2HKX A;  5E1X A;  4L5I A;  3BRO A;  5L3G A;  1IAW A;  3K1P A;  3RKY A;  2OAZ A;  3O2P E;  5JFR A;  2CO5 A;  2EV0 A;  1SAX A;  2ADU A;  2V79 A;  2DU9 A;  1F9N A;  2DTR A;  2RKH A;  1BI2 A;  4KYW A;  1BC7 C;  2UWM A;  2XV4 S;  4ETS A;  3BDD A;  4KIC A;  1IN4 A;  1ZN2 A;  2X0L A;  2K4B A;  1R58 A;  3FHZ A;  1ULY A;  2DLL A;  2DW4 A;  3KZY A;  4B09 A;  4MHG A;  3Q9S A;  1Z1D A;  2QBY B;  4BNC A;  3SQN A;  3G73 A;  3QRF F;  4MTD A;  3F23 A;  2DT5 A;  4U88 A;  5DEQ A;  4UHT A;  4A0Y A;  3GO5 A;  1YFH A;  2WWY A;  4DNC A;  4LLL A;  3R0J A;  1ZYR F;  2KIM A;  5HLG A;  1YO5 C;  1HW1 A;  2ZJ2 A;  3WU0 A;  5ICC A;  3I53 A;  2D1V A;  3J7A O;  4RB0 A;  2MD5 A;  4KNY A;  3R4K A;  1KQ8 A;  1MJB A;  3MQ0 A;  1JHH A;  2DFI A;  1QQI A;  3L09 A;  2R3S A;  1T2K A;  2O3F A;  1X3U A;  3NRV A;  1IN8 A;  1GVJ A;  5D5W B;  4QLC U;  4LB5 A;  3V7R A;  2RV8 A;  5BPI A;  2G7H A;  1U6G A;  2AXL A;  3TOB A;  3T5X A;  2ACJ A;  5IT9 K;  4OIN F;  3GFJ A;  4HF2 A;  3HUG A;  3FWE A;  4BYY A;  3NQO A;  4O5V A;  2EFN A;  3ZP5 A;  1FY7 A;  2P4W A;  2DQL A;  2XGX A;  3KZZ A;  1WQ2 A;  2L01 A;  5L3B A;  1F4K A;  4M9S A;  5CYV A;  4XSZ F;  1NHA A;  5BS6 A;  3H92 A;  3P9C A;  3GZ6 A;  3REO A;  3DF8 A;  1AWC A;  5ERI A;  2VBX A;  2GWR A;  3HTU A;  4BAY A;  3KLN A;  5LRR A;  2JSC A;  2EJR A;  1HST A;  2QQB A;  3ZN0 A;  2FMY A;  3F8N A;  2DPU A;  4GO1 A;  1J2X A;  2B0L A;  1MJA A;  3V8L A;  2HDC A;  1IUY A;  1VTN C;  3EYI A;  3B73 A;  5CLS A;  2K4J A;  1RNL A;  2KJB A;  3F3X A;  2VT2 A;  1FZP B;  3DPL C;  4HX8 A;  3P9I A;  5DCM A;  4ZYH A;  3QU6 A;  4HYE A;  4EGZ A;  1K78 A;  4CYD A;  2M45 A;  3TO7 A;  5ILU A;  1SD7 A;  4G7Z F;  5K5R A;  1GHC A;  3CO7 C;  3L2C A;  3RJP A;  4A2U A;  4XLN F;  1QNT A;  1KQ9 A;  1V3F A;  4G9Y A;  4S05 A;  2FQ3 A;  4O6J A;  4PGG A;  4U0W A;  1R5G A;  1XCB A;  4OU0 A;  2FXA A;  3BJA A;  4BXU A;  3KCC A;  1FX7 A;  5FD6 A;  1STZ A;  3QP5 A;  3MFK A;  5TRD A;  3DV8 A;  2MA3 A;  3BZ6 A;  3SZP A;  5E20 A;  2L4A A;  2VBZ A;  1GXP A;  3RPQ A;  4A0X A;  3DQV C;  1TLH B;  1IN6 A;  1OYI A;  4LG0 A;  1K6O A;  5BPD A;  4HZF A;  3P7N A;  4U7B A;  3VEP A;  2ZNZ A;  2L4M A;  4L9N A;  1XSD A;  3SXY A;  3TO9 A;  3JTG A;  3M9A A;  1XGM A;  2HS5 A;  3SHF A;  3R0A A;  1I5Z A;  3TDZ C;  3U2R A;  2XHK A;  5ICF A;  3F22 A;  4A5N A;  4N9I A;  3CTA A;  2PFB A;  3NEU A;  1R7J A;  2EA2 A;  1W4M A;  1R1T A;  1ZG5 A;  2EB7 A;  4HX7 A;  5H20 A;  4P9F A;  3W6K B;  2W25 A;  3T8T A;  4YIF A;  5LGU A;  4KMU X;  1OYW A;  3WGG A;  2IT0 A;  1Y0U A;  2MC3 A;  3B02 A;  4OIO F;  3HSR A;  3HOS A;  4CDG A;  3QU3 A;  2Z3Y A;  2FSW A;  3T1B A;  2X4H A;  1QPM A;  2OD5 A;  3E97 A;  2QYO A;  2ZME A;  4LJZ F;  1DDN A;  1MDM A;  3OV8 A;  4YG2 F;  1FBS A;  4AIH A;  4UVA A;  2H6B A;  4KIG A;  2PLY A;  1R00 A;  4KMF A;  3I54 A;  1O3Q A;  3AAF A;  2QQ9 A;  2VXZ A;  5E8G A;  3EQL F;  2YU3 A;  5CVV A;  4PDK A;  2K86 A;  3ZMZ A;  4GGG A;  2NYX A;  3ULQ B;  4EVI A;  3COA C;  1H9T A;  5H6Q A;  2A5Y B;  2F2E A;  2HYF A;  4WWC A;  4TV7 A;  3CLO A;  1O7F A;  1SFX A;  2COM A;  1RUN A;  4ENK A;  2F5D A;  3GUD A;  3OOP A;  1R22 A;  2CG4 A;  4UVC A;  4MEY F;  2MBF A;  4M71 A;  1W5T A;  4IVN A;  1MKM A;  2M1B A;  2VBW A;  4HX4 A;  3M7G A;  1U5T C;  1W7P A;  2PBI A;  3HRS A;  3CUO A;  1U78 A;  3IL2 A;  2H27 A;  1FP2 A;  4ZYE A;  3E6C C;  3HTS B;  2HQR A;  2IVM A;  3PQK A;  3MEX A;  1J0R A;  5LEK A;  1IXC A;  2NNN A;  3BWG A;  4BHC A;  4A5M A;  1ZRF A;  4RB2 C;  4KFC A;  2ZCW A;  1LQ1 A;  2LKP A;  3TO6 A;  1U2W A;  3GFM A;  2XAF A;  3DEU A;  4PCQ A;  5FFZ A;  5HDN A;  1O7L A;  5DV5 A;  3U9G A;  4XLP F;  3KEQ A;  1YS6 A;  1HKS A;  3LST A;  3I59 B;  3RKW A;  2HZT A;  2J5O A;  3FMQ A;  1FBU A;  4G94 A;  5H6R A;  3GX4 X;  4MQ9 F;  2K02 A;  5DCM B;  2YX4 A;  4G7H F;  1BI1 A;  2P5K A;  1P2F A;  3JW4 A;  1K78 B;  2J5P A;  1GXQ A;  3JAM Z;  2D1H A;  3DKW A;  5FO5 A;  3LA7 A;  2CQK A;  4G6D A;  3WTX C;  1QZY A;  3WOD F;  1EH7 A;  1PP8 F;  3KLO A;  4UNO A;  2XAQ A;  3BOQ A;  2EK5 A;  2HYG D;  1REP C;  2RGV A;  3EDP A;  2L54 A;  3HYI A;  2XRN A;  3KP7 A;  1RUO A;  2P7V B;  2YPR A;  6PAX A;  1KGS A;  4E70 A;  3ML6 A;  2KIU A;  2RVC A;  2HTJ A;  3KP5 A;  3CUQ C;  4O3M A;  1FPQ A;  1FBQ A;  5HOO A;  5D5U B;  4CHU A;  3TQN A;  4LG0 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...