1G4DA

Nmr structure of the mu bacteriophage repressor dna-binding domain/dna complex
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
69
structure length
69
Chain Sequence
KSIWCSPQEIMAADGMPGSVAGVHYRANVQGWTKRKKEGVKGGKAVEYDVMSMPTKEREQVIAHLGLST
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords 5'-D(P*CP*CP*TP*TP*TP*TP*CP*AP*GP*TP*AP*AP*TP*CP*TP*G)-3'
publication title The Mu repressor-DNA complex contains an immobilized 'wing' within the minor groove.
pubmed doi rcsb
source organism Enterobacteria phage mu
molecule tags Viral protein/dna
total genus 12
structure length 69
sequence length 69
ec nomenclature
pdb deposition date 2000-10-26
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1g4dA00
3E6MA 4UXNA 1O3RA 2NRAC 2LF8A 4A5MA 2HWVA 2WV0A 1QBJA 3K0LA 1P4AA 1D5VA 4XSZF 2FBHA 5K1YA 3LQQA 3QAHA 4JK1X 4CGZA 4YFNF 5BMZA 2XROA 1KGSA 1B9MA 5L3GA 3IRQA 5JVTA 4I0BA 4Q48A 1MJ9A 3MFKA 2QQAA 2PI0A 1IN6A 2EA2A 2PJPA 2IA0A 1FT9A 3DKWA 3IKVA 5CYVA 4G6QA 2DPDA 4OMYA 4HAMA 2HR3A 4HW0A 2OZ6A 3HUGA 3HSRA 3RIRA 4FX0A 3WTXC 3JTHA 3T8RA 4ENKA 1U5TB 3O3KA 4WK8F 3VEPA 3ZN0A 3HHHA 2RVCA 2IW5A 1RNLA 2PG4A 4PZJA 1IW7F 3M1EA 2ESNA 3KETA 1K78A 2HGCA 5LGUA 3GUDA 3QPHA 1XMKA 4I98B 2GA1A 1P2FA 2CYYA 1U3EM 2O61A 2V6CA 1UCRA 3SFZA 3TQNA 2F5FA 1B4AA 5DD4A 3P7NA 1XSXA 3PQKA 1FZPB 3PQJA 3DXJF 1KQ9A 3U1DA 1LDJA 4XLPF 4PCQA 3HIFA 4ETSA 2FU4A 5HS7A 2VBXA 3PFIA 4PDKA 2TDXA 4A2UA 2P6TA 3SXYA 5HVQC 3I53A 3I5UA 3WE2A 1EH6A 2EB7A 2JPCA 2BGCA 2VN2A 3T5XA 3AAFA 1Z6TA 2XAFA 1V3FA 2LKPA 3Q5FA 3IKTA 3JW4A 1TW3A 4N9IA 3DPLC 4Q4ZF 1GHCA 1SD7A 1ZAOA 3T1BA 4LGWA 1I6XA 2HYFA 5LRRA 4FX4A 4KICA 2KIFA 3JSOA 3BOQA 1OYWA 1H0MA 3HOSA 2YX4A 1VTNC 1CF7A 4LD5A 2NNNA 3TKYA 2F2EA 2ZFWA 1YG2A 1WSUA 3MZYA 3EQLF 4H0EA 2VOPA 3D0SA 5ILVA 2ADUA 3L00A 1SFXA 1FSEA 3V4GA 1I1SA 3IRRA 1G6NA 4MNUA 4A5NA 2DO7A 5FFXA 1W7PD 4WF2A 3WU1B 2QUFA 3RPQA 1J75A 2KJBA 3Q9VA 2W57A 2XAJA 3C1DA 1TNSA 3P9CA 4ESJA 2W85A 2PFBA 2A07F 2DQRA 1QPMA 4OIQF 2V1DA 2P6SA 4FT8A 1EH8A 3KP6A 1O3QA 2FNAA 1UHMA 2CO5A 2XAHA 1FX7A 3U2RA 2ACJA 2O03A 3F6OA 1XDSA 3CUQC 4HF2A 4A6EA 1QZYA 2NS0A 4KIGA 5LGTA 5K5OA 2M87A 1V4RA 4KN7X 3LAPA 4L9TA 5EEHA 1KA8A 4XLNF 3NEUA 2QLZA 3RKXA 1ZG3A 1FC3A 4A0XA 5BPDA 2DBBA 5L3FA 3ULQB 1I5ZA 3ERED 4ZYHA 3C7JA 5ILSA 4MEXF 3J7AO 1OYIA 4L0YB 4LB5A 4P55A 5HDNA 4ESFA 2OQRA 2NAZA 3W6KB 1OYYA 3MZHA 4U88A 3HOTA 3CO7C 4ENMA 5AONA 2HFHA 4KIBA 3QPTA 1ODDA 5D5WB 4M72A 3HRTA 4PGHA 2ZO4A 1ZG1A 5IT3A 2A61A 1R1VA 5F1RA 5H20A 2P4WA 4G7ZF 2MLKA 2E7WA 3BP8A 4HV5A 3V7RA 2LDUA 3BY6A 4KA4A 1FWZA 3GEZA 2E1NA 4UV8A 3KEOA 1W7PA 1T2KA 3QU3A 1SD5A 2GWRA 2IA2A 4LG0B 2EFQA 3GO5A 2FBKA 5H6RA 1TQIA 3M7GA 4GYGA 1KQ0A 3BROA 4NHJA 1XGMA 5E20A 2H6CA 5CJ9A 1BBYA 2QZ8A 1YFHA 5JR3A 2EFNA 3WGIA 2M45A 2W25A 1R7JA 1MJAA 1S7AA 3M9AA 1KU2A 2M5WA 3H3ZA 3KP4A 1TNTA 4D0PA 1ZARA 1G3TA 1J5YA 3BPVA 4BAYA 4ASNA 5D5UB 1R22A 2P5VA 2MBFA 1IZ1A 3LA7A 3TGNA 3O6BB 4IRIA 1KU9A 3TDUC 3SZTA 4M9SA 3K1NA 4L9NA 2V1UA 3EYIA 2Q8KA 2STWA 3TO9A 1T0FA 2BEOA 4HBLA 1ON1A 1XSDA 4M9XA 3I59A 1HKTA 2XASA 1IXRC 4LLLA 4MEYF 1G3WA 4QLCU 1XGOA 3KFWX 3ML6A 3TO7A 2CSOA 2VE8A 1JHHA 1QNTA 2VOOA 3WE3A 4U0YA 1YS6A 5DYMA 1XGNA 2VXZA 3DFGA 3G73A 2FEZA 3C18A 2VT3A 2Z3YA 3I64A 3DQVC 2W24A 1REPC 3T0YA 1G4DA 2EFPA 5JHUA 1P92A 4CHUA 1B9NA 4CYDA 2M8EA 1XDUA 2BE5F 4WX9A 2YSRA 2L3DA 3WTYC 1YYVA 3GZ5A 3CJNA 3ZMDA 5K5RA 3E6DA 3I0TA 3VOEA 1BI1A 1Z91A 1ULYA 1K78B 5J8FA 3IWZA 1TLHB 4MQ9F 1ZH5A 3ZMTA 2DK8A 4IHSA 5F6FA 4DNCA 1PDNC 1UFMA 6PAXA 3WGHA 4G8XA 2IJLA 2L01A 3I4PA 1XCBA 5FLXK 1MDMA 2QBYA 4BHCA 5L3DA 5D5XB 3WU0A 2FXAA 1LDDA 4B09A 2RGVA 3L09A 4RGRA 1OKRA 3FWEA 3N4MA 2DTRA 4I02A 4EM2A 4RAYA 4I09A 4HDUA 1HXDA 2DLLA 3W6JB 1KU7A 1NHAA 4HQEA 3LSTA 1J7KA 1IXSB 1T39A 5ED4A 2COMA 3J81K 3CUQA 3FZVA 4LLGF 1SMTA 4YIIA 2IT0A 1W4MA 2HEOA 2D1VA 2JTVA 3MQ0A 5HLHA 5HLIA 1DPRA 1BI2A 1SD4A 3L9FA 1A04A 1CF7B 3LFKA 2GQQA 1K79A 2YPRA 3JTGA 3FXQA 2DW4A 5FLXZ 3DF8A 4YG2F 2YU3A 1LVAA 3KZYA 4LFUA 1W5TA 3F8CA 4KUMA 5H6QA 4JBAA 5FFZA 2DU9A 3FM5A 1HQCA 2R3SA 2PEXA 1C0WA 2DI3A 4LB6B 3RYPA 2NYXA 1IN5A 1T6SA 2XAQA 5KK1A 2GA2A 2MLGA 1FNNA 2MD5A 2G7HA 4RS8A 1RUOA 4F7ZA 4YIFA 3KP3A 1LB2A 3J81Z 2AXLA 5HLGA 4KN4X 4KDPA 1CGPA 1JE8A 5HOOA 3V7CA 2VC1A 4OOIA 2QQ9A 3VFZA 1J2XA 3CO6C 1HSJA 1ZRFA 3FM3A 2EV6A 1ZREA 2ZNYA 3VODA 3GLXA 3RJPA 2ZNZA 4Q47A 3SHFA 2LSOA 2IVMA 4M6YA 1EV7A 1BIBA 2HQNA 4Y15A 3ZP5A 2HZTA 3F8MA 2A69F 3RYRA 5ILUA 3NQOA 5LLQA 3ABUA 1OMIA 5E1XA 1OPCA 1GXPA 1U8RA 1D8KA 1ZRDA 1S3JA 1O3SA 5LHIA 3QOPA 4TV7A 2FA5A 1XD7A 4MQVA 2L4AA 4LK0F 3BWGA 4OINF 4S04A 3FXUA 2QVOA 1HSTA 4RGUA 4WXHA 4I7HA 3B02A 1J0RA 1TW2A 4ZYDA 4EJVA 4L5JA 3CLOA 2X0LA 2P7VB 5LEJA 1IUYA 2Z9OA 3E6BA 4G7HF 3IL2A 1USSA 4GYIA 1QQIA 2HOEA 4HLXA 1H9GA 2PMUA 2EWNA 4YFXF 3RKWA 1BIAA 5F64A 3REOA 3I58A 1FOKA 1W7PB 2BV6A 5D4SA 4G6DA 5L3CA 2A5YB 3GW2A 2KRFA 3GXOA 3WTWC 3HRSA 1T98A 3HRUA 3S2WA 1BC8C 2ETHA 4S05A 1RUNA 4Z2YA 4IF4A 2XKPA 3R0AA 3I71A 3KP5A 4IVNA 4UNOA 3E97A 1T38A 1LQ1A 2CGPA 2RDPA 3GVAA 4AD9A 3F21A 4G7OF 1XB4A 4LMYA 2DFIA 5ICFA 2P8TA 2MC3A 1B1BA 3CTAA 3EETA 4EVIA 5CVJA 2VBYA 5FB2A 1R58A 5LGNA 1L3LA 2P5LC 2XGXA 3M8FA 2ZCWA 1YW8A 5ICCA 4A6DA 2A3SA 4EMSA 3ZMVA 4N9HA 3MAJA 1IN8A 4EGYA 4ON0A 3RKYA 2L4MA 1O7FA 3BDDA 2ZJ2A 4ZZLA 3WG9A 4UUVA 4RGSA 5DUKA 4P9UA 2XHKA 1Z6RA 3BJAA 1F1ZA 4AIHA 5JI6A 1IXCA 3I59B 5HDKA 1HW1A 4NB5A 1D8JA 3HSEA 4L9VA 4OIOF 3RPUA 2H94A 2OAZA 3LQRA 5JFRA 1ZYRF 4R1HA 4PGGA 1KYZA 5CVIA 2Q0OA 1IF1A 1MKMA 3F8NA 2G7UA 1HW2A 2RN7A 2QM3A 2Q2EA 2DQLA 1FY7A 3IWFA 3LAJA 3ISPA 3OOPA 2PBIA 3J80K 3TOBA 1FLIA 1MZBA 1ZHFA 5ERIA 4HYEA 2CW0F 2KIMA 2H6BA 4RGXA 5LHGA 5D8LB 1ON2A 3E5UA 4IRHA 5CVRA 1WQ2A 1ZGJA 2FBIA 3WTSC 4XBFA 1E2XA 1R23A 5TJJA 1QZZA 4AWXB 3QP5A 1E17A 2PN6A 1XMAA 2RQPA 5KVRA 1U2WA 3F8BA 4M71A 2UWMA 1IRFA 1W5SA 1YW7A 2K86A 4EJWA 1U5TC 2FMLA 2AS5F 5HS9A 4O5VA 5E1WA 2PLYA 2Y75A 1TTYA 5E8IA 2FQ3A 3QRFF 2Y48A 4CXFA 2NNYA 1K6OA 4L0ZB 1MDMB 2QBYB 3J80Z 3KZZA 3KLNA 4HX7A 2O0YA 4L18B 3MWMA 2W84A 3GFJA 3WTTC 1PUEE 1EH7A 5LHHA 3JSPA 3F8FA 4N0BA 2V1XA 2P7CB 1ZG5A 1SFEA 2VT2A 3R6SA 4I0AA 2RNJA 3V8LA 4FHTA 2EFWA 1R00A 1R36A 1DUXC 1ZN2A 5EEGA 4MTEA 2ZMEA 1DPUA 4L5IA 1Q1HA 4OIRF 3GFMA 2DK5A 2DT5A 1I27A 3MEXA 1IN7A 1ONVA 5FD5A 3CUQB 4GGGA 3N97A 1LEAA 2FMYA 3ZMSA 3JAMK 2FOKA 2MH9A 3SZPA 3RTRA 2JPBA 1RZ4A 2CG4A 2VBZA 1F4KA 3GF2A 1YW9A 2L54A 4WXCA 4KFCA 5DCMA 3H3UA 3E6CC 3GX4X 2OU2A 5ICEA 4P96A 2ISYA 2HS5A 4K2EA 2XKOA 3R60A 1SMYF 4Q5SF 3IHUA 1F5TA 1STZA 2DAOA 1S7OA 3E5XA 2M1BA 4WXDA 4UHTA 3WTUC 3B73A 2HYGD 2F5EA 4HQMA 2D1HA 1LEBA 1ZRCA 1Z9CA 4HA8A 3JAMZ 4HF0A 2ESHA 4UVAA 5FD6A 4AIKA 4HF1A 3K1PA 1H9TA 4U0WA 4AIJA 2VE9A 5BPIA 3HYIA 2P5KA 3HTUA 4GCVA 5AIQA 1TBXA 2ELHA 1XSVA 1I1GA 3SQNA 2DPUA 4Y17A 1HW5A 2H27A 1IN4A 3WTZA 4ENNA 4HLYA 1YQAA 3K69A 4EM0B 4CO8A 4LLNA 5CVVA 1QO0D 1XCVA 4ZYEA 4ZYGA 1YIOA 3P9KA 3R0JA 3CDHA 3TDZC 4OIPF 1SFUA 3G3ZA 2A6HF 1MD0A 2GZWA 3LWFA 3F72A 4B8XA 3KP7A 4ZH4F 1ZGAA 4HX8A 2GAUA 2FNPA 4U0VA 2GXBA 4KMUX 3ROUA 2G9WA 2XIGA 2PQ8A 1U6GA 4RAZA 3KE2A 4KNYA 2IA1A 5LBQA 1FYLA 3IC7A 2QYOA 3RDIA 4IRGA 3ZQ7A 1LDKB 4IXAA 4MHGA 5FO5A 2MH2A 3LA3A 3K1MA 4U7BA 2K7LA 1J59A 2BBYA 2QWWA 3Q9SA 5J6XA 4OMZA 3LA2A 3ABTA 2ZKZA 4HV6A 1FP1D 1YLFA 1D3YA 1HKSA 4P5OA 1O3TA 1GXQA 3ZN1A 1DP7P 5DDGA 5LEKA 1TQPA 2HKOA 1FYMA 2JZYA 1SAXA 3EUHA 1O7LA 1JHFA 4LK1F 3F23A 4CZZA 3ELKA 3HHGA 4MGRA 2CWEA 2IP2A 5IT9K 2QENA 3TOAA 3BJOA 2ISZA 3GFIA 2WC2A 5BQTA 5L3BA 2OZUA 1OR7A 2RKHA 2HDCA 3F3XA 1YS7A 3GFLA 3K9TA 3MCZA 5DEQA 2R7FA 3F6VA 1PP7U 1P6RA 3WGGA 3GWZA 2V79A 3FMSA 2KKOA 5BS6A 2XAGA 3DV8A 1U78A 1FBSA 3FF5A 2LNBA 3HTSB 1UHWA 2D45A 2VONA 4P9FA 3I54A 4IHTA 2FSWA 5J8CA 3F22A 2L02A 2HKXA 4OU0A 4E70A 4EM1A 3KCCA 4EJTA 2CQKA 1U5TA 2YR2A 1P4XA 1BOAA 3QU6A 4WWCA 5ICGA 1AWCA 4L9JA 1S6LA 5DD8A 2MA3A 1XGSA 2OA4A 2CFXA 4UVBA 5L3EA 2EA4A 4R79A 5IT9Z 4I2OA 3V8KA 2A68F 1HKQA 5LRSA 2D2WA 1FPQA 5D8KB 5E17F 4LJZF 2KIUA 2HTSA 1DDNA 3EDPA 1Z05A 3O2PE 4DQ2A 3ECHA 1LJ9A 2EJRA 2UZKA 1J9IA 3L2CA 2ZBKA 2PMHA 2J5PA 5AIPA 1B59A 2Z33A 5D6EA 2XVCA 1UB9A 1IRGA 3FX3A 2RC4A 3WTVC 2EFOA 3COAC 1K7AA 3CUOA 4ESBA 1RI7A 4EV0A 3FXRA 4RB0A 1FSHA 3ZMZA 1BI0A 1WRJA 1YO5C 4Y13A 2XUBA 1PP8F 3HRMA 4HZFA 1ZLKA 1WWXA 4GXOA 3BJ6A 2JRTA 1R5HA 1G3YA 4UVCA 2UXXA 1IAWA 4IJAA 4BHPA 4NQWA 2X4HA 4WCGA 1LNWA 2F5DA 2WWYA 2O3FA 3BZ6A 3V7SA 1KQ8A 3RI4A 1ZLJA 3TO6A 2B0LA 4O3MA 4G94A 1R1UA 2XV4S 4KIFA 4CDGA 1G3SA 1USTA 4YFKF 3OV8A 2UXNA 1MGTA 5CVUA 4BNCA 2F5CA 1FBUA 4HOBA 2EK5A 1B6AA 1Y0UA 2KJCA 4G9YA 2J5OA 4KYWA 4M73A 2R7DA 3U9GA 2ZMEB 3NRVA 1BI3A 4A0ZA 3R61A 2EV0A 2GIVA 5A2QK 1HBXG 2GXGA 4RB3C 5BOXA 1MJBA 2QQBA 5DV5A 5D4RA 1RIOH 5E1ZB 5K5QA 3D5LA 5D5VB 2Y0MA 2JT1A 4UV9A 3KLOA 4EJOA 1GVJA 4A12A 3QP6A 1FBQA 1O57A 1R5GA 4ZZDA 3GYHX 2HTJA 2Z99A 4RB2C 3C3WA 2VODA 1FYKA 4XRFA 5DCMB 4RB1A 1R1TA 4BH9A 1YTYA 4HDVA 2E7XA 4M9ZA 1BN5A 3WODF 4IPAA 2EV5A 4KT5C 4R8HA 2OQGA 2LF7A 2V9VA 2FE3A 2Z5UA 4JQFA 1Z1DA 2K02A 3K2ZA 3ECOA 3DEUA 5A2QZ 2ZXJA 1QGPA 5FGMA 2IRFG 2YX7A 3ZMUA 1XN7A 4QWQA 1BC7C 2E1CA 4BXUA 2K4JA 4EJUA 2HQRA 2K27A 5TRDA 3E5QA 5E8GA 2A6EF 5HS8A 3R4KA 3T8TA 1KYWA 4A0YA 1AOYA 2JSCA 1FP2A 4XSXF 1JXSA 1WI9A 2M30A 2H09A 3P9IA 1SD6A 4M74A 5HDGA 3KEQA 1Z7UA 4BYYA 4BQAA 1L0OC 1KU3A 1BM9A 2RV8A 4BHBA 4ENJA 4O6JA 2O6GE 2K4BA 4GO1A 3E3VA 3FMRA 1TQMA 2BYVE 5DUIA 1S29A 2STTA 4EQQA 1X3UA 3M8EA 2FF4A 2WTEA 3DPTA 3HSFA 4LG0A 5DCFA 3DP7A 3GZ6A 1P4WA 2VC0A 3ZPLA 4U7DA 2XRNA 3V8JA 2OBPA 3BPXA 3EYYA 4HX4A 4AVPA 1JGSA 3H92A 5E18F 4I01A 1S8NA 2C6YA 5CLSA 4KMFA 4M6XA 3FMQA 4CICA 1WKMA 3L7WA 2O8XA 5D6FA 4MTDA 3FHZA 1BJAA 1F9NA 3KP2A 3VB2A 2OD5A 2IPQX 2VBWA 2FRHA 4EGZA
chains in the Genus database with same CATH superfamily
1CQTA 1MBEA 1RKWA 3E6MA 4UXNA 5B1AH 1O3RA 2HOSA 3M4OJ 2NRAC 2NXNB 2JK3A 3H5AA 3ZQQA 2LF8A 1MMGA 4A5MA 2HWVA 2WV0A 3RKQA 1QBJA 5FRMA 5E79C 1WFXA 1SC7A 2CUEA 3K0LA 4XM3A 1EJ9A 1P4AA 1D5VA 4JX4A 4XSZF 1WJ5A 2FBHA 5FKLA 1R9TJ 2HI3A 1WJCA 5K1YA 3LQQA 3QAHA 4JK1X 3F0CA 3MKWB 4CGZA 4YFNF 3DCFA 2KISA 4PSXA 5BMZA 2XGEA 1WCMJ 2XROA 1KGSA 3JRAA 1B9MA 5L3GA 3IRQA 1PJRA 5JVTA 1IUFA 4I0BA 1WHUA 2E35A 4Q48A 1K4TA 1MJ9A 3MFKA 2QQAA 2F4IA 5GPCA 2ELJA 2KPMA 4M3GA 2PI0A 1IN6A 2EA2A 2PJPA 2M2EA 2IA0A 3BR3A 3TBIA 3HOVJ 2VQLA 5IP7J 3OWTA 4RM2A 3ASNH 1FT9A 2XRLA 3DKWA 5C3EJ 2K9MA 1R5ID 3IKVA 5CYVA 2IS6A 4XLFA 4G6QA 2DPDA 2KMUA 4OMYA 4HAMA 2E2HJ 2HR3A 4IOCF 4HW0A 2DA5A 5BNGA 2VASA 3D1NI 2L9NA 2Y9ZA 2OZ6A 2Y31A 5FJ8J 2HNHA 2R7VA 3HUGA 3LSJA 4A3MJ 1VQNI 3HSRA 2JN6A 4UUSA 3RIRA 4FX0A 3WTXC 1A36A 2FUG2 1UJ8A 1XS9A 2G0EA 2M3AA 3JTHA 3T8RA 1IDZA 1RESA 4ENKA 1U5TB 3O3KA 2EH3A 4WK8F 3VEPA 4GDFA 2UV1A 1PUFA 3ZN0A 3HHHA 2RVCA 1QVUA 1LVKA 3S1QJ 1PYVA 2RQQA 2MC4A 2IW5A 2WY7Q 1RNLA 2PG4A 4PZJA 2E2JJ 1IW7F 2CW7A 3M1EA 4IO9F 1X3ZB 3QYFA 5IY5H 2ESNA 3KETA 1K78A 3S3OA 1FOWA 2B7EA 3IH3A 4XRMA 2HGCA 5LGUA 3GUDA 1YJNI 3QPHA 1XMKA 3CF5F 3RQ4A 4I98B 5CPRB 2GA1A 2VI6A 1P2FA 2CYYA 1U3EM 2O61A 5GAGJ 3AL0C 2V6CA 2DA4A 1UCRA 1QVTA 5M3FJ 3SFZA 5B66C 4F52A 3TQNA 5GP9A 2F5FA 4AUXA 1B4AA 5DD4A 4B44A 3P7NA 5K7HA 1XSXA 3RSNA 3PQKA 1FZPB 4ZDPA 2AQFA 3PQJA 4HG2A 3DXJF 1LFBA 1KQ9A 3QWLA 3U1DA 1LDJA 2Z16A 4XLPF 2AHQA 3HIFA 4PCQA 4HNUA 1I50J 1TP4A 4ETSA 2FU4A 5J4VA 5HS7A 2VBXA 3PFIA 1B72B 4PDKA 2TDXA 4A2UA 3IV5A 4ZJZA 2P6TA 3S93A 3SXYA 5HVQC 3HPGA 3I53A 2JJ7A 2VKVA 3I5UA 1NH3A 1DU0A 1G59A 3WE2A 1EH6A 2HVSA 2CUJA 1MBFA 2EB7A 1ZR4A 2L9RA 2JPCA 2BGCA 2VN2A 1YI2I 3OR1C 1YE9A 3T5XA 3JRBA 3ZRGA 4IQ4A 3AAFA 1Z6TA 2XAFA 5FROA 1V3FA 4XR6A 5FKNA 4PJMA 2LKPA 3Q5FA 3HC7A 3IKTA 3JW4A 1IGNA 2R7TA 1VQ5I 4Y52J 1TW3A 4N9IA 4A69C 1J09A 3DPLC 4Q4ZF 1GHCA 1SD7A 1ZAOA 3T1BA 2XB0X 4NQWB 1IC8A 4LGWA 1I6XA 2HYFA 5LRRA 3GLLA 2E1OA 3IUOA 3ZQCA 4FX4A 4KICA 4C3JJ 2KIFA 3JSOA 3BOQA 1OYWA 1H0MA 3A01A 2NVYJ 3LSKA 3FK6A 3HOSA 2YX4A 1VTNC 1ETYA 3PUFA 1CF7A 4LD5A 2NNNA 4QPOA 3A2KA 3TKYA 2F2EA 2ZFWA 1YG2A 1MBJA 1WSUA 3MZYA 1TWHJ 2M4KA 3EQLF 4H0EA 2VOPA 3D0SA 3SDGA 2ADUA 5ILVA 1YRNB 3L00A 1SFXA 1FSEA 3A0BC 3V4GA 3MKYB 1I1SA 3IRRA 1G6NA 1D0XA 4M3BA 4MNUA 2LVSA 2K9NA 2M7AA 4A5NA 2DO7A 2EZIA 3HZJA 3K6GA 1N77A 5FFXA 4XONA 2M34A 3CMAI 1W7PD 2IGOA 4WF2A 3WU1B 2O8KA 5IYCJ 4RDUA 2QUFA 3RPQA 1J75A 2KJBA 3Q9VA 3OS0A 5J1YA 2W57A 2XAJA 3C1DA 1TNSA 4I99C 4BDYA 3P9CA 2AO9A 4ZDOA 4XICA 4ESJA 3QPSA 4HNTA 3M8JA 2XDVA 2WBMA 3KZIC 1BL0A 2W85A 4ZTFA 2OC6A 2PFBA 1D0ZA 4E7IA 2A07F 3E0JB 2HVRA 2DQRA 1QPMA 4OIQF 4PFPA 1V55H 2W82A 2V1DA 2P6SA 4FT8A 4B3XA 1SVOA 1EH8A 3BR6A 1Y1WJ 3KP6A 1O3QA 1HDDC 4P1WA 2FNAA 5EZGA 1UHMA 3BR1A 2CO5A 2XAHA 1FX7A 3U2RA 4Y33A 3HGYA 2E71A 2O03A 2ACJA 2W00A 3F6OA 1N78A 4II2A 4RA2A 1XDSA 4N4OB 3CCVI 3IAM2 1TWGJ 2DMNA 3CUQC 1OCZH 4HF2A 2HQAA 2QA4I 3IAS2 4A6EA 4RAGA 1QZYA 2NS0A 4X1EA 3HOWJ 3DEWA 2R7SA 4KIGA 3SZGA 2BHZA 3D5RC 2RAEA 5LGTA 2DMPA 5K5OA 2L9VA 2M87A 4IZZA 2HDDA 2AQEA 2OUMA 3GMEA 1V4RA 4KN7X 4E7KA 3SYTA 3LAPA 1JUSA 4L9TA 5EEHA 4E7LA 1IDYA 1KA8A 4XLNF 2P0WA 3NEUA 2DTZA 2QLZA 3RKXA 1ZG3A 1FC3A 2CH0A 2DT7B 2JMWA 1SFKA 4HSRA 4A0XA 3VYTB 3OYLA 2E5ZA 5KAIC 1N75A 5BPDA 2DBBA 5L3FA 3ULQB 1I5ZA 3CDIA 4DJAA 3OIOA 3ERED 3CCUI 4ZYHA 1ERDA 2CQNA 3C7JA 5ILSA 4E4HA 4MEXF 2VXDA 2TCTA 4C2TA 3J7AO 2GOMA 3H36A 3BCBA 1OYIA 3W2WA 4L0YB 4LB5A 4P55A 5HDNA 4ESFA 1YITI 3U1KA 2OQRA 2NAZA 1V54H 2DOFA 3CCJI 3W6KB 1OYYA 1T95A 2VKDA 4UUTA 4U88A 3MZHA 3PJRA 3HOTA 5EJCA 3CO7C 4ENMA 3RZDJ 5AONA 1R6RA 2HFHA 4KIBA 3QPTA 2BZTA 3QYEA 1X1DA 2WAFA 1RR7A 1DGRM 1ODDA 5D5WB 1LE8B 4M72A 4C30A 5E3MA 3HRTA 2GXAA 2PJRA 2CFOA 4PGHA 2ZO4A 1ZG1A 3CC7I 5IT3A 3G1LA 2A61A 1R1VA 4DZPA 5F1RA 2ZJRF 5J3LA 2H8RA 5H20A 4C2UA 2DCEA 2MG4A 4XK4A 1TWCJ 2P4WA 4G7ZF 4IX7A 2MLKA 2E7WA 3BP8A 4FE7A 4HV5A 3V7RA 2V9KA 2NS8A 2LDUA 3BCAA 3BY6A 4AVZA 3C2BA 1UAAA 3MKLA 4RAFA 1JJ8C 1Y8RB 1K83J 4KA4A 3CESA 2KFDA 3OYMA 2R7WA 1HLVA 1FWZA 3GEZA 2E1NA 3LSRA 4UV8A 5M5YJ 2V6EA 4AM3A 3KEOA 2KDOA 1OFCX 2CMPA 2LBFB 1W7PA 1T2KA 3QU3A 1SD5A 2GWRA 4PK4A 2IA2A 4LG0B 2QF7A 2EFQA 2VJ4A 3K4JA 4Y7NJ 3GO5A 1BR4A 1IO2A 2FBKA 5H6RA 1TQIA 3M7GA 4GYGA 1LPQA 1KQ0A 3BROA 4NHJA 3H5RA 4M3EA 4BXFA 1XGMA 5E20A 2CQXA 1T56A 2H6CA 1U9NA 5CJ9A 4H4KC 1BBYA 4V2FA 2QZ8A 4DBQA 3K4CA 5JR3A 3DLLF 1YFHA 2EFNA 1X1PA 3WGIA 2HU9A 1HF0A 2R7UA 2M45A 2XAUA 2NOGA 2W25A 2R92J 1T33A 4ANJA 1R7JA 3H9QA 2E34A 1MJAA 5EEAA 1S7AA 2O7OA 3M9AA 2GM4A 1KU2A 2O9LA 4BEHA 4JX6A 2M5WA 1VQOI 3H3ZA 2ZSIB 1BOBA 3CCRI 2DJNA 3KP4A 1TNTA 3KPHA 4V2GA 4D0PA 2E60A 1ZARA 1G3TA 1J5YA 3BPVA 4BAYA 4ASNA 4LOCA 5D5UB 5C44J 1R22A 2P5VA 2HYJA 1IZ1A 2MBFA 3SEZA 3LA7A 3TGNA 3ZQHA 3O6BB 4MFEA 1VQ9I 1Z21A 1KU9A 5TISC 4IRIA 5FLMJ 2X1EA 5DM6F 5KHDA 2JA6J 3TDUC 2GXBA 3SZTA 2JUGA 2IS4A 4M9SA 3K1NA 4L9NA 3D5SC 3N05A 2V1UA 3EYIA 3HJEA 1JUMA 2CW8A 2Q8KA 1GV2A 2STWA 3CQZJ 2ID3A 3TO9A 1T0FA 1Z67A 2BEOA 4HBLA 2DYSH 1ON1A 4HEA2 2ZFUA 5IYBJ 1I3QJ 2E19A 3OR2C 1XSDA 2DA7A 2DJIA 2A5WA 4M9XA 2I10A 2O5RA 3I59A 1HKTA 3HM5A 2XASA 3ZXSA 3GBGA 1IXRC 3A4CA 4LLLA 4MEYF 1G3WA 4QLCU 1XGOA 3KFWX 2BW3A 2EPFA 3ML6A 3TO7A 2CSOA 2K3PA 2HPIA 2VE8A 4BDZA 2EBIA 4IEJA 1JHHA 4XNFA 1QNTA 2VOOA 3WE3A 4U0YA 2OTJI 1YS6A 3OL3A 5DYMA 3OYBA 1XGNA 3AFHA 2VXZA 4J19A 3DFGA 3S16J 3G73A 4S0HB 1A5JA 2FEZA 3C18A 3HUGB 5HODA 2VT3A 2Z3YA 2L2OA 3V42A 3I64A 2DA3A 3DQVC 3DTEA 2W24A 4UUSB 3BZKA 1REPC 3HXLA 2VQCA 5J47A 3T0YA 1GLNA 1G4DA 1WJFA 2EFPA 5JHUA 4BQNA 1P92A 2K85A 4CHUA 3S3NA 1B9NA 4XORA 4CYDA 4IHXA 2M8EA 1XDUA 2BVLA 1ZGWA 1PUFB 2E1MB 2BE5F 2LH9A 1TZLA 3E7LA 5JLWA 4WX9A 2YSRA 1HCRA 3S17J 4FQGA 3VYUB 2L3DA 3K2AA 2VUMJ 2ZSHB 2R93J 1RRJA 1UZCA 1YYVA 3WTYC 1QHGA 2K40A 1ETWA 3GZ5A 3CJNA 3ZMDA 4BQQA 5K5RA 3E6DA 3BG6A 3I0TA 3VOEA 2LTPA 5J4YA 3HOYJ 1BI1A 5IOZA 4GRIA 4PJ0C 5B3SH 3JR9A 1Z91A 1ULYA 1K78B 5J8FA 3IWZA 1TLHB 4MQ9F 1ZH5A 3ZMTA 2DK8A 4IHSA 5F6FA 4DNCA 1PDNC 1UFMA 1TL8A 2K9LA 1ETOA 6PAXA 3WGHA 4G8XA 2QKMB 3VYSB 1GT0C 2IJLA 2QKLB 2L01A 3I4PA 1XCBA 3BTCA 1FTTA 1MSEC 1SAUA 3LOCA 5FLXK 1MDMA 2QBYA 4BHCA 5L3DA 1OCOH 5D5XB 2HQ5A 3WU0A 3ZQGA 1FMWA 2FXAA 1LDDA 4B09A 2RGVA 3L09A 4RGRA 3FIWA 1OKRA 3Q3SA 3FWEA 4EATA 4NC6A 2M8GX 4BY7J 3N4MA 2DTRA 1AKHA 3ONQA 1V5GA 3WHCA 2XF7A 4I02A 4XOTA 4EM2A 2ECCA 3GTOJ 4RAYA 1MSFC 4CYCA 4I09A 4RBOA 4HDUA 3QPLA 1HXDA 2DLLA 3W6JB 2VPLA 1KU7A 2MW8A 1NHAA 4HQEA 3LSTA 1X4OA 2OJED 3A03A 2HOTA 4MO7A 1IV8A 2EQRA 1J7KA 1JTYA 1IXSB 1LFUP 3RCOA 1FJLA 2WAQA 4QPQA 1T39A 5F0CA 4CCNA 3DPUA 4E7JA 5ED4A 2COMA 3J81K 3K4KA 4D9JA 2Y2ZA 3CUQA 3FDYA 3FZVA 4LLGF 1SMTA 4YIIA 3UNGC 2IT0A 3LSGA 3PNYA 3G1OA 1W4MA 5E3OA 1MBGA 2HEOA 2D1VA 3CDLA 2JTVA 1X19A 3DLAA 3MQ0A 3FBNB 4CUGA 5HLHA 3A01B 5HLIA 3DWLE 1DPRA 1BI2A 2DMTA 3VDXA 5DTDA 1D1BA 1SD4A 3L9FA 1A04A 1CF7B 3LFKA 2GQQA 1GUUA 1K79A 2YPRA 3JTGA 1T8IA 3FXQA 5KAFC 2DW4A 2N8GA 5FLXZ 1ZTRA 3DF8A 4YG2F 2VKHA 2YU3A 1LVAA 3P5JA 4JYKA 2LG4A 1NG7A 3KZYA 4LFUA 1W5TA 4BUPA 2X85A 3F8CA 4KUMA 2IGKA 5H6QA 2I5UA 4JBAA 5FFZA 2DU9A 2IGMA 3QOEA 3FM5A 3OYNA 1HQCA 4KITB 4BBSJ 1DU6A 2R3SA 2PEXA 3CC2I 1C0WA 2DI3A 4LITA 1MNEA 4LB6B 1KZHA 3RYPA 2NYXA 1IN5A 1T6SA 2XAQA 3PNVA 4ITVA 5EG0A 2E2IJ 5KK1A 2JVHA 5C4JJ 2GA2A 2IS1A 2NVUB 2MLGA 3KYCB 1FNNA 2MD5A 2G7HA 3OS2A 2R7QA 3CMMA 4RS8A 3L2WA 4U87A 4F7ZA 4YIFA 1RUOA 2Z2SB 3KP3A 3CMEI 3EPZA 5GTIC 1ENHA 3J81Z 3OYHA 2AXLA 5HLGA 1LB2A 4A3GJ 1F43A 4KN4X 4KDPA 1CGPA 1VZ0A 5F08A 1JE8A 2R5YA 5HOOA 1VQLI 3V7CA 2VC1A 4OOIA 2A05A 2QQ9A 2ME6A 1Q1VA 3VFZA 3I3LA 4BXXJ 2YUSA 5GTHC 2ZMEC 3AG3H 4KISA 4NC7A 1J2XA 3CO6C 1R71A 3OS1A 2K5CA 1HSJA 1ZRFA 2NOJB 1ETQA 3FM3A 2EV6A 4G12A 4II3A 4I6ZA 1ZREA 2ZNYA 2QQ8A 3A02A 3HG9A 1EF4A 3VODA 3GLXA 3RJPA 2ZNZA 4Q47A 2MD0A 3JREA 5FKOA 4YIRX 3SHFA 1QU3A 2LSOA 2IVMA 2NVQJ 4M6YA 4A3EJ 3BTLA 3LMMA 4FISA 1EV7A 3MMYB 1BIBA 3PL8A 2HQNA 1LKXA 3TMOA 1BW6A 4Y15A 2WAQN 4BY1J 1A6QA 3ZP5A 2GOXB 2HZTA 2WA0A 3F8MA 2A69F 3RYRA 5ILUA 3NQOA 3TW7A 5LLQA 1MH3A 2L7MP 3ABUA 1Y39A 3FKJA 5FLVA 2VB6A 1OMIA 1VQPI 1JI8A 4ABZA 5E1XA 1MW7A 1OPCA 4C3IJ 3RPUD 1YX5A 4XRSA 1GXPA 4A3JJ 1U8RA 2CV1A 1D8KA 3LL7A 1S3JA 1O3SA 1ZRDA 1H8AC 4XLEA 4BQOA 2PX9A 5LHIA 3QOPA 4TV7A 2FA5A 1XD7A 4MQVA 1PVEA 2L4AA 1YJ9I 4LK0F 3BWGA 4OINF 2QSGX 3OOUA 1VQMI 1G8XA 4S04A 1ITYA 3DTKA 3FXUA 2QVOA 1HSTA 2R7OA 3NARA 3TL4X 1KONA 4RGUA 4ZTJA 1HA8A 4WXHA 4I7HA 2XGCA 1TC3C 3B02A 3OMYA 2V4JC 2HZDA 3DU6A 1J0RA 3OYFA 1TW2A 3C2GA 4EJVA 4ZYDA 2MGQA 4L5JA 4UB8C 3CLOA 2X0LA 2P7VB 1VQ8I 5JVGF 4OAYA 5LEJA 1IUYA 3ZQIA 2Z9OA 1D0YA 4X6AJ 4A3FJ 1IG7A 2Y0SA 3E6BA 3OYDA 4G7HF 3GTQJ 3IL2A 2PJRB 5EYRA 1USSA 4GYIA 2CQ7A 1QQIA 3OYGA 2DFHA 1TT5B 2B63J 1UHSA 1GVDA 2HOEA 4C3HJ 3FKIJ 4HLXA 1H9GA 3OIPA 3CCEI 1MMNA 3A1YA 2PMUA 1X1CA 2EWNA 4YFXF 1NG6A 3RKWA 3PIPF 2QSFX 4E7HA 1BIAA 3FXLA 5F64A 3REOA 1E3HA 1FIPA 3I58A 1FOKA 5LFAA 1W0UA 2XC7A 1W7PB 2BV6A 4B43A 3JRHA 5D4SA 4G6DA 5L3CA 2A5YB 3GW2A 2KRFA 3GXOA 2NVXJ 3WTWC 3HRSA 2BY0A 5IYDJ 5M5XJ 1T98A 1BR1A 3HRUA 3S2WA 3PO2J 9ANTA 1BC8C 4AIDA 2ETHA 4S05A 3PSIA 5DS9A 3SJMA 4BL0B 1RUNA 1S72I 4Z2YA 2HVQA 4UY8I 2XKPA 3R0AA 4IF4A 3I71A 5EGOA 3KP5A 3GZNB 4IVNA 4UNOA 2BVMA 3E97A 2VIXA 3B6CA 4NDLA 1T38A 1LQ1A 1QA6A 1VNDA 3ASOH 3BR2A 3OYIA 2CGPA 2RDPA 3GVAA 5EDNA 3BTJA 4AD9A 3G6EI 2VJIA 4BEHB 3F21A 3Q0VA 4B3AA 4HSTA 1XB4A 4LMYA 5J1RA 4G7OF 2DFIA 5ICFA 3I9V2 2P8TA 2MC3A 1B1BA 3CTAA 3EETA 4EVIA 5CVJA 2VBYA 5FB2A 1R58A 1V5FA 5FKMA 4XRSG 5LGNA 1R4MB 4B48A 4DYRA 3AG2H 1L3LA 2P5LC 2XGXA 3M8FA 2ZCWA 4E7ZA 1YW8A 5ICCA 4A6DA 3H5NA 2R7ZJ 2A3SA 2QEXI 4EMSA 2DMQA 3ZMVA 4N9HA 3MAJA 1IN8A 4EGYA 5JLXA 4ON0A 1ZK8A 3RKYA 3CCMI 1JKQC 2COBA 4E7SA 3S1NJ 2L4MA 2DDBA 1O7FA 3M3YJ 3BDDA 4GFBA 1DGWY 4JOMA 4DW6A 2JA7J 2ZJ2A 4ZZLA 3ZGKA 3WG9A 4N4NB 3HEFA 2Q1ZB 2Y69H 4UUVA 3GTJJ 2V9PA 4RGSA 3CCYA 5DUKA 4BE0A 4P9UA 2XHKA 1XMXA 1Z6RA 2EIJH 1RKTA 3BJAA 2LKXA 2KHMA 4JP0A 1F1ZA 4AIHA 3AL0B 5JI6A 1IXCA 3I59B 5HDKA 1E0EA 1HW1A 2A6TA 4NB5A 1D8JA 2ECBA 3HSEA 4L9VA 1MBKA 4OIOF 3RPUA 2H94A 2R7RA 2OAZA 1A35A 3LQRA 5JFRA 3GTMJ 1ZYRF 2BW3B 2Y0SN 3HPHA 4R1HA 2IEKA 4PGGA 1KYZA 5CVIA 4A3DJ 2Q0OA 1IF1A 3FXOA 4XLCA 4D7MA 2VQHA 4XLAA 1GV5A 1AHDP 1MKMA 5IPAA 3F8NA 2G7UA 1HW2A 2RN7A 1U8BA 2QM3A 3KIOA 3H35A 3DU5A 2LY1A 2Q2EA 2DQLA 1FY7A 3EUHC 3IWFA 3LAJA 3ISPA 2HXOA 1QRYA 3OOPA 3OL4A 1MIJA 4HPQA 4L5EA 2CS3A 2PBIA 2QSHX 3J80K 1Y6IA 1R4NB 2KP6A 4A3LJ 3TOBA 1FLIA 3H9GA 1MZBA 2BY1A 3G2BA 4J00A 1E3OC 1ZHFA 1S5LC 1N25A 2R4GA 5ERIA 3GTGJ 1G2HA 2BXYA 3RQIA 1OR7C 4HYEA 2CW0F 4NNJA 4XOPA 3MVPA 2KIMA 2H6BA 4RGXA 2E5NA 3OYKA 1POGA 5LHGA 2ZJPF 5D8LB 2R5ZA 1OJLA 1ON2A 2UUZA 4XN3A 3E5UA 2V26A 4IRHA 5CVRA 4X0GA 4YEJA 3S32A 1FTZA 1Z0XA 1WQ2A 1ZGJA 2W1OA 2VL8A 3HKZA 2FBIA 3WTSC 4RMNA 4XBFA 3OYCA 1E2XA 3VPRA 3S3MA 1R23A 5TJJA 1HOMA 1QZZA 4PJLA 3JRIA 3CJQB 1TT0A 3DKXA 1BW5A 2RNGA 1OCRH 4AWXB 3QP5A 2QCOA 1GDTA 5B1BH 1E17A 3ZCOA 2PN6A 5J40A 1XMAA 4IQJA 2RQPA 5KVRA 3IH4A 1U2WA 2OCEA 3F8BA 4QTRA 5B5EC 2XPUA 3BG5A 4M71A 2UWMA 2CUZA 3OYEA 2DOEA 1IRFA 1W5SA 1YW7A 2K86A 4EJWA 4YELA 1U5TC 2FMLA 2AS5F 4FETA 1WJAA 4O5VA 2VQGA 5HS9A 5E1WA 1P7IA 2PLYA 2Y75A 1TTYA 1Z3YA 5E8IA 5GPAA 2FQ3A 1JT0A 3C2HA 2LFBA 3QRFF 3FBIB 2H1KA 2Y48A 4CXFA 2NNYA 2DMUA 3GTKJ 1K6OA 3S15J 2F48A 4F91B 4L0ZB 1MDMB 2QBYB 3J80Z 3KZZA 2LC2A 3KLNA 4HX7A 3MKZA 2O0YA 4L18B 3MWMA 2W84A 1Y56A 3GFJA 3WTTC 1PUEE 3KYLA 1XC5A 1EH7A 4CCMA 2H1LA 5LHHA 2NVTJ 2CV2A 3JSPA 3F8FA 4N0BA 2V1XA 3MD2A 2P7CB 1ZG5A 1WZ2A 1SFEA 2VT2A 3KYDB 3R6SA 1AKHB 4I0AA 4XIDA 3FK7A 2RNJA 3V8LA 4FHTA 2EFWA 1R00A 1SVMA 3TEDA 3NAUA 1R36A 1DUXC 4CYCB 1ZN2A 1OQYA 2X51A 5EEGA 4MTEA 2ZMEA 5TGTA 4CH7A 4BS9A 4L5IA 1DPUA 1Q1HA 1QHHD 4OIRF 4Y3OA 5JHFA 3GFMA 2DK5A 1AU7A 2DT5A 4DYQA 4LG3A 4D5FA 1I27A 3MEXA 1IN7A 1ONVA 2JRMA 1QZEA 3ZQLA 3CJRB 3PNTA 3CCSI 5FD5A 3CUQB 4GGGA 3N97A 1LEAA 1B8IA 2BOLA 2FMYA 4M3DA 3ZMSA 3JAMK 2W4SA 2FOKA 2MH9A 1IRZA 1LUJB 3SEQA 3SFIA 3SZPA 2JVGA 3CD6I 3CMYA 3RTRA 2JPBA 1RZ4A 2VLAA 1YOVB 2CG4A 4XLHA 2VBZA 4DIQA 1F4KA 3CLQA 1YW9A 3GF2A 4BJTA 2L54A 4WXCA 4V19K 2PMZA 2OCCH 4KFCA 2X9DA 2KZGA 5DCMA 3H3UA 4CCOA 3J7YJ 4IOAF 3E6CC 3KX2A 3O8HA 1WJDA 2FX0A 4F92B 3GX4X 4HNVA 4CCLA 2W48A 2OU2A 5KCMA 2V7FA 5ICEA 4P96A 2ISYA 2HS5A 3W6VA 3AKZA 3HKZN 4K2EA 2B9SA 2XKOA 3QODA 3R60A 1SMYF 1YJWI 3BR0A 3OSGA 3TW6A 4Q5SF 2KZVA 3I56I 2EINH 3PO3J 3BR5A 3VSKA 3GTLJ 5C4XJ 1WPKA 1S9HA 3IHUA 5EG0B 2L9SA 2IGNA 2X6YA 1F5TA 1STZA 2FJ1A 2ELKA 2DAOA 2LMDA 3K70C 4CZCA 4JX5A 1OCPA 1S7OA 2E36A 3E5XA 2M1BA 4WXDA 4UHTA 4CSWA 3ABLH 3QYBA 3EUAA 3WTUC 3B73A 1SVLA 2HYGD 5M5WJ 2F5EA 3IH2A 4FASD 2IXSA 2ZC2A 3K10A 4HQMA 2D1HA 2JQ7A 1ZRCA 3CC4I 1Z9CA 2CQQA 1LEBA 2F6CA 2P81A 4HA8A 2DODA 3JAMZ 2R5YB 4HF0A 1ETXA 2ESHA 2LRDA 4UVAA 2WB1A 5FD6A 4AIKA 4IHWA 4HF1A 2DT6A 2LLKA 3K1PA 2R7XA 1X3WB 1H9TA 4XKWA 3W2AA 3A0HC 2EIMH 4U0WA 4AIJA 1IRXA 1X2MA 5FRNA 2JSPA 2VE9A 2CUFA 5DM7F 2DXIA 5F0FA 5BPIA 2CU7A 3HYIA 1FEXA 2P5KA 2DOAA 4MIMA 1X2NA 4BE1A 3HTUA 3VSLA 4GCVA 3CZ6A 3I4MJ 5AIQA 2LP0A 1TBXA 2ELHA 3LSMA 1D1AA 1XSVA 1I1GA 2JUCA 3SQNA 2DPUA 2XB5A 5IP9J 4Y17A 4CCJA 1HW5A 2H27A 2MSYA 1IN4A 3WTZA 4ENNA 3TP0A 4HLYA 1YQAA 3K69A 4EM0B 1WGXA 3S8PA 4CO8A 5E3LA 4XQFA 3PUBA 4XKCA 2CRGA 4LLNA 5CVVA 3B6AA 3PIOF 1QO0D 1XCVA 2X48A 1H88C 3UKGA 2FOWA 4ZYEA 2DFFA 4ZYGA 1YIOA 3P9KA 4PSWA 3R0JA 3CDHA 3TDZC 4OIPF 1SFUA 1MNDA 2KRCA 3G3ZA 2PMZN 4MLOA 2A6HF 1MD0A 5K7ZA 2GZWA 2FQ4A 3LWFA 1VQ7I 3F72A 4FTHA 4B8XA 3KP7A 4ZH4F 2QGUA 1ZGAA 4HX8A 2GAUA 2FNPA 2K3FA 3M07A 4U0VA 4KMUX 3WG7H 3ROUA 2G9WA 3H0DA 3OYJA 1VQ6I 2XIGA 2DFEA 2PQ8A 2BY3A 1U6GA 4RAZA 3KE2A 4KNYA 5K7FA 3DKYA 3HOXJ 2IA1A 5LBQA 2GLOA 1FYLA 3IC7A 2QYOA 3PM1A 3RDIA 1TWFJ 1JT6A 4IRGA 3ZQ7A 3ZOBA 4CCKA 3F9KA 2XSDC 3ABMH 1LDKB 4IXAA 4MHGA 3JRCA 5FO5A 1JKPC 2MH2A 3LA3A 3K1MA 4U7BA 1JKRC 2K7LA 5E3NA 1J59A 1Z7LA 2BBYA 3BC8A 3CJTB 2QWWA 3Q9SA 4BJ6C 1ZR2A 5J6XA 4OMZA 1T0FC 3LA2A 3ABTA 1W1WE 2ZKZA 4HV6A 1FP1D 2L5QA 4A3CJ 1YLFA 1D3YA 1HKSA 2L7FP 4P5OA 1U9OA 1O3TA 2K9SA 1GXQA 3ZN1A 2JWTA 3S1RJ 2WB1N 2MFZA 2M0MA 2HXIA 4AC0A 3TP3A 1DP7P 3AG4H 1MMDA 1ZQ3P 5DDGA 5LEKA 1TQPA 2HKOA 1VI0A 2ME0A 4AYBA 2IAIA 1FYMA 1FMVA 4ZDLA 5M3MJ 2JZYA 1MMAA 1Y0NA 3L2RA 1HC8A 1NK3P 1SAXA 4B47A 2X1CA 3EUHA 1O7LA 4F55A 1JHFA 4LK1F 1D5YA 4DBRA 1MH4A 1UG0A 4C2MJ 2K9QA 3BZCA 3MZ8A 3F23A 2OV7A 4CZZA 2WAEA 3ELKA 3HHGA 4MGRA 1Z3XA 5EGOB 2CWEA 2IP2A 3H0GJ 5IT9K 2QENA 2IBDA 4Y4RA 3TOAA 2EZHA 3BJOA 4A3IJ 5IOYA 3K70D 4IKFA 2ISZA 2YS9A 3GFIA 3KEYA 1A31A 2WC2A 4B4CA 2X6XA 5BQTA 5L3BA 3LFUA 2OZUA 4XMYA 1OR7A 2RKHA 2HDCA 1WVRA 3F3XA 2F4OB 3LNQA 1YS7A 1ZELA 1A6IA 3GFLA 3K9TA 3MCZA 4E6KG 4ZC3A 3L2UA 3FHNA 4PFOA 5DEQA 2R7FA 1D1CA 3F6VA 1PP7U 1O4XA 3VWBA 3H9JA 1P6RA 1VQKI 3NWSA 1MMSA 3WGGA 2W7NA 3GWZA 2V79A 2I8DA 3GTPJ 3FMSA 3ERMA 2LK2A 2KKOA 5BS6A 1IV6A 2XAGA 3DV8A 2DA2A 1U78A 2TRTA 1FBSA 3W3CA 3FF5A 5HNFA 2LNBA 1IJWC 3HTSB 1UHWA 4OAZA 4QIWN 2D45A 2VONA 4FE4A 4P9FA 3I54A 4IHTA 3VYRB 2FSWA 2LYCA 5GADJ 5J8CA 1BA5A 3F22A 2EZKA 3FXMA 2L02A 2HKXA 2L7ZA 4OU0A 4I76A 2F5VA 4E70A 4MFDA 4EM1A 3KCCA 4EJTA 2CQKA 2MABA 1U5TA 2YR2A 1P4XA 1BOAA 1ACIA 3RZOJ 3CCQI 1P9QC 3QU6A 4WWCA 2RREA 5ICGA 1AA7A 1AWCA 4L9JA 1S6LA 5F1JA 1APLC 1TWAJ 5DD8A 2MA3A 3K4NA 1ZKGA 2FD5A 1XGSA 4BBRJ 2OA4A 2CFXA 4UVBA 5L3EA 2EA4A 1K61A 4R79A 5IT9Z 2NS7A 3WHBA 3E1SA 3FXJA 1P7JA 4I2OA 2ID6A 4NC8A 3V8KA 3JRFA 2EZLA 2A68F 1HKQA 2WADA 4QSHA 5LRSA 3J7AY 2LREA 3L1PA 2D2WA 2GIZA 3G4SI 2Q2EB 1FPQA 5D8KB 4XKBA 4LJZF 5E17F 2KIUA 3OSFA 1EA3A 1T08B 2HTSA 3S1MJ 2KIQA 1DDNA 3EDPA 1Z05A 3O2PE 4DQ2A 3ECHA 1XPXA 1VF9A 1LJ9A 1WJEA 4F93B 2EJRA 2UZKA 1J9IA 3L2CA 2ZBKA 2PMHA 3I4NJ 2J5PA 5AIPA 2M9HA 1B59A 2ZXIA 4AYBN 1UG2A 2Z33A 5D6EA 4M3FA 1VQ4I 4B1RA 2XVCA 1UB9A 1IRGA 3FX3A 5HNHA 1X1AA 2RC4A 3WTVC 3CCLI 2AXTC 2EFOA 1OCTC 2DN0A 3COAC 1K7AA 3CUOA 3K4LA 4ESBA 1RI7A 2BY2A 4W1UA 2OTLI 4FCYA 4EV0A 3FXRA 4RB0A 1B72A 1FSHA 2R5ZB 3ZMZA 2YU9J 1BI0A 1WRJA 2GBYA 2DDAA 2VJJA 3BTIA 3L2VA 1YO5C 4Y13A 4RLQA 2XUBA 1PP8F 3HRMA 4IL6C 2WV1A 4HZFA 3CF2A 1M1EB 2OF7A 3K4MA 3BQYA 1FOXA 1ZLKA 5F27A 1WWXA 4GXOA 3BJ6A 1XTAA 2JRTA 2DA1A 4CA0A 1R5HA 2VKEA 3GCMA 4XKVA 1G3YA 1EKEA 1WI3A 3CP2A 1ETVA 2ZJQF 4UVCA 2UXXA 3DEEA 3DTIA 1IAWA 1X1BA 2MYSA 4IJAA 2X6OA 4BHPA 3IP4B 4NQWA 2X4HA 4WCGA 2V1NA 2ZXWH 1LNWA 1OISA 2L7KA 2ICWG 1LFPA 5F0HA 2F5DA 3J7ZI 2WWYA 1SFOJ 3H3VK 2E1MC 4BKXA 2O3FA 2X6WA 1FOYA 3BZ6A 3V7SA 1KQ8A 1OLTA 3RI4A 1ZLJA 3TO6A 2B0LA 4O3MA 3X2QH 4G6TB 4G94A 1R1UA 3MN2A 2XV4S 4KIFA 4LIUA 3HOUJ 4CDGA 4A3BJ 1G3SA 2KDZA 1USTA 4YFKF 4A93J 3OV8A 2UXNA 1MGTA 5EF6A 5CVUA 1RC9A 3ZR8X 1YRNA 4BNCA 2JA5J 2F5CA 1FBUA 4HOBA 2EK5A 2L0KA 1B6AA 3BLYA 3JCUC 1Y0UA 2KJCA 2BXZA 3BG7A 3WU2C 4G9YA 1SEUA 2J5OA 3PFYA 1MNMC 4KYWA 2XF5A 4M73A 2R7DA 5IP6A 4XL9A 5CQGA 1FIAA 1WH5A 3U9GA 2ZMEB 3NRVA 1BI3A 1E3PA 4A0ZA 3R61A 3UR3C 1JUPA 2EV0A 1UELB 2GIVA 1UMQA 1WJBA 2VJ5A 5CQEA 5A2QK 2GXGA 4RB3C 1HBXG 5BOXA 1NK2P 1MJBA 2QQBA 5DV5A 5D4RA 3LSPA 2D5VA 2F4MB 3ESWB 5E1ZB 1RIOH 4PJNA 1JTXA 3BG3A 5K5QA 1B8IB 1DP3A 2X1DA 2DA6A 1U0JA 4J01A 3D5LA 3NWTA 5D5VB 4HRIA 2Y0MA 4OWRB 2JT1A 4UV9A 4BGDA 3KLOA 4EJOA 1GVJA 4A12A 3QP6A 1FBQA 1O57A 1WH7A 1R5GA 1W36C 5KNLA 3BT9A 2CV0A 4ZZDA 3GYHX 2HTJA 2Z99A 4RB2C 2EIKH 3ABKH 3HOZJ 3C3WA 2VODA 4DOZA 1FYKA 1HDPA 2XPVA 3G71I 4XRFA 1RPWA 5DCMB 4RB1A 4M6VA 1R1TA 2IS2A 1XX5A 4BH9A 3HBLA 1V5EA 4PJJA 1YTYA 1H89C 3SDBA 4HDVA 2E7XA 2XGDA 1W0TA 4M9ZA 1BN5A 1S7EA 3WODF 4IPAA 2EV5A 2JA8J 4BJ5C 4KT5C 4R8HA 2OQGA 2LF7A 2V9VA 2KRHA 2FE3A 4EEFG 2M7BA 3HB9A 3LSHA 2Z5UA 4JQFA 1Z1DA 2K02A 2KT0A 3K2ZA 2XF6A 4NBQA 1OCCH 4RM3A 1SANA 3K7AJ 5J1UA 3ECOA 3DBLB 3DEUA 3I55I 5A2QZ 2ZXJA 3OIQA 1QGPA 5FGMA 2IRFG 1I39A 2YX7A 3ZMUA 1QPIA 1YX3A 1XN7A 4YRVA 4QWQA 1BC7C 2E1CA 1X58A 4BXUA 1I6HJ 2K4JA 5GAHJ 4KT6A 3K4BA 4AU7A 1VFCA 3G1MA 4EJUA 2HQRA 2K27A 3FXKA 3OYAA 4RLFA 2ZXHA 1BJZA 3HL2A 3FISA 5TRDA 3E5QA 2Y30A 1ORKA 3PSFA 4W97A 3U21A 5E8GA 1YHQI 4DZJA 2A6EF 5HS8A 1DQUA 4BU2A 3R4KA 3LSIA 3HDDA 4IHVA 2M0CA 3QQAA 3T8TA 1KYWA 2Y9YA 4A0YA 1AOYA 2JSCA 5H2FC 3EUKL 1FP2A 2Z1DA 3BQZA 4XSXF 4KJZA 1JXSA 2XSJC 5FKKA 3ZQFA 1WI9A 2M30A 2H09A 4LIVA 3P9IA 1SD6A 1ETKA 3S14J 2BHYA 2KLOA 1W5CC 2EILH 1RETA 2LR8A 4M74A 5HDGA 4D5CA 3KEQA 1Z7UA 1F36A 4BYYA 4A3KJ 1JKOC 2HPMA 2H8WA 3CP8A 5LD2C 3H1CA 4BQAA 1L0OC 2LY2A 4BACA 2CJJA 1NTCA 1KU3A 1BM9A 2RV8A 4BHBA 1LE8A 3S2HJ 4ENJA 5GAEJ 4O6JA 2O6GE 2DYRH 4D7NA 4IHYA 1R49A 2K4BA 3OY9A 2VPRA 4GO1A 3E3VA 3FMRA 2M4GA 1TQMA 2BYVE 5DUIA 3W2VA 5EZHA 3S2DJ 2LOOA 3AG1H 1BR2A 1S29A 2STTA 4EQQA 1X3UA 1MBHA 4XN0A 3M8EA 4UB6C 1Y8QB 1X4PA 2FF4A 2XPWA 1K6YA 2HOAA 2WTEA 3DPTA 2LBFA 4ZYAA 3HSFA 1JGGA 1Z77A 4LG0A 2OPTA 5DCFA 3DP7A 4D1QA 2KQRA 3L2QA 3GZ6A 1YIJI 1RR8C 1P4WA 2VC0A 3DBHB 2LKSA 3ZPLA 2JA2A 4U7DA 2XRNA 3V8JA 3JRDA 2R0QC 2OBPA 3DBRB 3JRGA 3BPXA 1JJ6C 3EYYA 4HX4A 4AVPA 2LY9A 4Z6YA 5HLTA 3Q0WA 4PUSA 1JGSA 1XG1A 3H92A 4F3QA 5F04A 2ZB9A 5E18F 4BE2A 3M1CA 3Q0UA 3BG9A 4I01A 1S8NA 2C6YA 5CLSA 1Y1VJ 2LD5A 2HDWA 2WY8Q 4NUBA 4KMFA 4M6XA 3FMQA 4CICA 5CKTA 1I3AA 1WKMA 3L7WA 2O8XA 3O8GA 5D6FA 2KL4A 1W36D 4MTDA 4C9YA 3FHZA 1BJAA 1F9NA 3KP2A 3VB2A 2OD5A 3HGGA 4DYCA 1K4SA 2IPQX 4DGWB 2VBWA 2FRHA 4EGZA
chains in the Genus database with same CATH topology
3E6MA 4UXNA 1O3RA 2NRAC 2LF8A 4A5MA 2HWVA 2WV0A 1QBJA 3K0LA 1P4AA 1D5VA 4XSZF 2FBHA 5K1YA 3LQQA 3QAHA 4JK1X 4CGZA 4YFNF 5BMZA 2XROA 1KGSA 1B9MA 5L3GA 3IRQA 5JVTA 4I0BA 4Q48A 1MJ9A 3MFKA 2QQAA 2PI0A 1IN6A 2EA2A 2PJPA 2IA0A 1FT9A 3DKWA 3IKVA 5CYVA 4G6QA 2DPDA 4OMYA 4HAMA 2HR3A 4HW0A 2OZ6A 3HUGA 3HSRA 3RIRA 4FX0A 3WTXC 3JTHA 3T8RA 4ENKA 1U5TB 3O3KA 4WK8F 3VEPA 3ZN0A 3HHHA 2RVCA 2IW5A 1RNLA 2PG4A 4PZJA 1IW7F 3M1EA 2ESNA 3KETA 1K78A 2HGCA 5LGUA 3GUDA 3QPHA 1XMKA 4I98B 2GA1A 1P2FA 2CYYA 1U3EM 2O61A 2V6CA 1UCRA 3SFZA 3TQNA 2F5FA 1B4AA 5DD4A 3P7NA 1XSXA 3PQKA 1FZPB 3PQJA 3DXJF 1KQ9A 3U1DA 1LDJA 4XLPF 4PCQA 3HIFA 4ETSA 2FU4A 5HS7A 2VBXA 3PFIA 4PDKA 2TDXA 4A2UA 2P6TA 3SXYA 5HVQC 3I53A 3I5UA 3WE2A 1EH6A 2EB7A 2JPCA 2BGCA 2VN2A 3T5XA 3AAFA 1Z6TA 2XAFA 1V3FA 2LKPA 3Q5FA 3IKTA 3JW4A 1TW3A 4N9IA 3DPLC 4Q4ZF 1GHCA 1SD7A 1ZAOA 3T1BA 4LGWA 1I6XA 2HYFA 5LRRA 4FX4A 4KICA 2KIFA 3JSOA 3BOQA 1OYWA 1H0MA 3HOSA 2YX4A 1VTNC 1CF7A 4LD5A 2NNNA 3TKYA 2F2EA 2ZFWA 1YG2A 1WSUA 3MZYA 3EQLF 4H0EA 2VOPA 3D0SA 5ILVA 2ADUA 3L00A 1SFXA 1FSEA 3V4GA 1I1SA 3IRRA 1G6NA 4MNUA 4A5NA 2DO7A 5FFXA 1W7PD 4WF2A 3WU1B 2QUFA 3RPQA 1J75A 2KJBA 3Q9VA 2W57A 2XAJA 3C1DA 1TNSA 3P9CA 4ESJA 2W85A 2PFBA 2A07F 2DQRA 1QPMA 4OIQF 2V1DA 2P6SA 4FT8A 1EH8A 3KP6A 1O3QA 2FNAA 1UHMA 2CO5A 2XAHA 1FX7A 3U2RA 2ACJA 2O03A 3F6OA 1XDSA 3CUQC 4HF2A 4A6EA 1QZYA 2NS0A 4KIGA 5LGTA 5K5OA 2M87A 1V4RA 4KN7X 3LAPA 4L9TA 5EEHA 1KA8A 4XLNF 3NEUA 2QLZA 3RKXA 1ZG3A 1FC3A 4A0XA 5BPDA 2DBBA 5L3FA 3ULQB 1I5ZA 3ERED 4ZYHA 3C7JA 5ILSA 4MEXF 3J7AO 1OYIA 4L0YB 4LB5A 4P55A 5HDNA 4ESFA 2OQRA 2NAZA 3W6KB 1OYYA 3MZHA 4U88A 3HOTA 3CO7C 4ENMA 5AONA 2HFHA 4KIBA 3QPTA 1ODDA 5D5WB 4M72A 3HRTA 4PGHA 2ZO4A 1ZG1A 5IT3A 2A61A 1R1VA 5F1RA 5H20A 2P4WA 4G7ZF 2MLKA 2E7WA 3BP8A 4HV5A 3V7RA 2LDUA 3BY6A 4KA4A 1FWZA 3GEZA 2E1NA 4UV8A 3KEOA 1W7PA 1T2KA 3QU3A 1SD5A 2GWRA 2IA2A 4LG0B 2EFQA 3GO5A 2FBKA 5H6RA 1TQIA 3M7GA 4GYGA 1KQ0A 3BROA 4NHJA 1XGMA 5E20A 2H6CA 5CJ9A 1BBYA 2QZ8A 1YFHA 5JR3A 2EFNA 3WGIA 2M45A 2W25A 1R7JA 1MJAA 1S7AA 3M9AA 1KU2A 2M5WA 3H3ZA 3KP4A 1TNTA 4D0PA 1ZARA 1G3TA 1J5YA 3BPVA 4BAYA 4ASNA 5D5UB 1R22A 2P5VA 2MBFA 1IZ1A 3LA7A 3TGNA 3O6BB 4IRIA 1KU9A 3TDUC 3SZTA 4M9SA 3K1NA 4L9NA 2V1UA 3EYIA 2Q8KA 2STWA 3TO9A 1T0FA 2BEOA 4HBLA 1ON1A 1XSDA 4M9XA 3I59A 1HKTA 2XASA 1IXRC 4LLLA 4MEYF 1G3WA 4QLCU 1XGOA 3KFWX 3ML6A 3TO7A 2CSOA 2VE8A 1JHHA 1QNTA 2VOOA 3WE3A 4U0YA 1YS6A 5DYMA 1XGNA 2VXZA 3DFGA 3G73A 2FEZA 3C18A 2VT3A 2Z3YA 3I64A 3DQVC 2W24A 1REPC 3T0YA 1G4DA 2EFPA 5JHUA 1P92A 4CHUA 1B9NA 4CYDA 2M8EA 1XDUA 2BE5F 4WX9A 2YSRA 2L3DA 3WTYC 1YYVA 3GZ5A 3CJNA 3ZMDA 5K5RA 3E6DA 3I0TA 3VOEA 1BI1A 1Z91A 1ULYA 1K78B 5J8FA 3IWZA 1TLHB 4MQ9F 1ZH5A 3ZMTA 2DK8A 4IHSA 5F6FA 4DNCA 1PDNC 1UFMA 6PAXA 3WGHA 4G8XA 2IJLA 2L01A 3I4PA 1XCBA 5FLXK 1MDMA 2QBYA 4BHCA 5L3DA 5D5XB 3WU0A 2FXAA 1LDDA 4B09A 2RGVA 3L09A 4RGRA 1OKRA 3FWEA 3N4MA 2DTRA 4I02A 4EM2A 4RAYA 4I09A 4HDUA 1HXDA 2DLLA 3W6JB 1KU7A 1NHAA 4HQEA 3LSTA 1J7KA 1IXSB 1T39A 5ED4A 2COMA 3J81K 3CUQA 3FZVA 4LLGF 1SMTA 4YIIA 2IT0A 1W4MA 2HEOA 2D1VA 2JTVA 3MQ0A 5HLHA 5HLIA 1DPRA 1BI2A 1SD4A 3L9FA 1A04A 1CF7B 3LFKA 2GQQA 1K79A 2YPRA 3JTGA 3FXQA 2DW4A 5FLXZ 3DF8A 4YG2F 2YU3A 1LVAA 3KZYA 4LFUA 1W5TA 3F8CA 4KUMA 5H6QA 4JBAA 5FFZA 2DU9A 3FM5A 1HQCA 2R3SA 2PEXA 1C0WA 2DI3A 4LB6B 3RYPA 2NYXA 1IN5A 1T6SA 2XAQA 5KK1A 2GA2A 2MLGA 1FNNA 2MD5A 2G7HA 4RS8A 1RUOA 4F7ZA 4YIFA 3KP3A 1LB2A 3J81Z 2AXLA 5HLGA 4KN4X 4KDPA 1CGPA 1JE8A 5HOOA 3V7CA 2VC1A 4OOIA 2QQ9A 3VFZA 1J2XA 3CO6C 1HSJA 1ZRFA 3FM3A 2EV6A 1ZREA 2ZNYA 3VODA 3GLXA 3RJPA 2ZNZA 4Q47A 3SHFA 2LSOA 2IVMA 4M6YA 1EV7A 1BIBA 2HQNA 4Y15A 3ZP5A 2HZTA 3F8MA 2A69F 3RYRA 5ILUA 3NQOA 5LLQA 3ABUA 1OMIA 5E1XA 1OPCA 1GXPA 1U8RA 1D8KA 1ZRDA 1S3JA 1O3SA 5LHIA 3QOPA 4TV7A 2FA5A 1XD7A 4MQVA 2L4AA 4LK0F 3BWGA 4OINF 4S04A 3FXUA 2QVOA 1HSTA 4RGUA 4WXHA 4I7HA 3B02A 1J0RA 1TW2A 4ZYDA 4EJVA 4L5JA 3CLOA 2X0LA 2P7VB 5LEJA 1IUYA 2Z9OA 3E6BA 4G7HF 3IL2A 1USSA 4GYIA 1QQIA 2HOEA 4HLXA 1H9GA 2PMUA 2EWNA 4YFXF 3RKWA 1BIAA 5F64A 3REOA 3I58A 1FOKA 1W7PB 2BV6A 5D4SA 4G6DA 5L3CA 2A5YB 3GW2A 2KRFA 3GXOA 3WTWC 3HRSA 1T98A 3HRUA 3S2WA 1BC8C 2ETHA 4S05A 1RUNA 4Z2YA 4IF4A 2XKPA 3R0AA 3I71A 3KP5A 4IVNA 4UNOA 3E97A 1T38A 1LQ1A 2CGPA 2RDPA 3GVAA 4AD9A 3F21A 4G7OF 1XB4A 4LMYA 2DFIA 5ICFA 2P8TA 2MC3A 1B1BA 3CTAA 3EETA 4EVIA 5CVJA 2VBYA 5FB2A 1R58A 5LGNA 1L3LA 2P5LC 2XGXA 3M8FA 2ZCWA 1YW8A 5ICCA 4A6DA 2A3SA 4EMSA 3ZMVA 4N9HA 3MAJA 1IN8A 4EGYA 4ON0A 3RKYA 2L4MA 1O7FA 3BDDA 2ZJ2A 4ZZLA 3WG9A 4UUVA 4RGSA 5DUKA 4P9UA 2XHKA 1Z6RA 3BJAA 1F1ZA 4AIHA 5JI6A 1IXCA 3I59B 5HDKA 1HW1A 4NB5A 1D8JA 3HSEA 4L9VA 4OIOF 3RPUA 2H94A 2OAZA 3LQRA 5JFRA 1ZYRF 4R1HA 4PGGA 1KYZA 5CVIA 2Q0OA 1IF1A 1MKMA 3F8NA 2G7UA 1HW2A 2RN7A 2QM3A 2Q2EA 2DQLA 1FY7A 3IWFA 3LAJA 3ISPA 3OOPA 2PBIA 3J80K 3TOBA 1FLIA 1MZBA 1ZHFA 5ERIA 4HYEA 2CW0F 2KIMA 2H6BA 4RGXA 5LHGA 5D8LB 1ON2A 3E5UA 4IRHA 5CVRA 1WQ2A 1ZGJA 2FBIA 3WTSC 4XBFA 1E2XA 1R23A 5TJJA 1QZZA 4AWXB 3QP5A 1E17A 2PN6A 1XMAA 2RQPA 5KVRA 1U2WA 3F8BA 4M71A 2UWMA 1IRFA 1W5SA 1YW7A 2K86A 4EJWA 1U5TC 2FMLA 2AS5F 5HS9A 4O5VA 5E1WA 2PLYA 2Y75A 1TTYA 5E8IA 2FQ3A 3QRFF 2Y48A 4CXFA 2NNYA 1K6OA 4L0ZB 1MDMB 2QBYB 3J80Z 3KZZA 3KLNA 4HX7A 2O0YA 4L18B 3MWMA 2W84A 3GFJA 3WTTC 1PUEE 1EH7A 5LHHA 3JSPA 3F8FA 4N0BA 2V1XA 2P7CB 1ZG5A 1SFEA 2VT2A 3R6SA 4I0AA 2RNJA 3V8LA 4FHTA 2EFWA 1R00A 1R36A 1DUXC 1ZN2A 5EEGA 4MTEA 2ZMEA 1DPUA 4L5IA 1Q1HA 4OIRF 3GFMA 2DK5A 2DT5A 1I27A 3MEXA 1IN7A 1ONVA 5FD5A 3CUQB 4GGGA 3N97A 1LEAA 2FMYA 3ZMSA 3JAMK 2FOKA 2MH9A 3SZPA 3RTRA 2JPBA 1RZ4A 2CG4A 2VBZA 1F4KA 3GF2A 1YW9A 2L54A 4WXCA 4KFCA 5DCMA 3H3UA 3E6CC 3GX4X 2OU2A 5ICEA 4P96A 2ISYA 2HS5A 4K2EA 2XKOA 3R60A 1SMYF 4Q5SF 3IHUA 1F5TA 1STZA 2DAOA 1S7OA 3E5XA 2M1BA 4WXDA 4UHTA 3WTUC 3B73A 2HYGD 2F5EA 4HQMA 2D1HA 1LEBA 1ZRCA 1Z9CA 4HA8A 3JAMZ 4HF0A 2ESHA 4UVAA 5FD6A 4AIKA 4HF1A 3K1PA 1H9TA 4U0WA 4AIJA 2VE9A 5BPIA 3HYIA 2P5KA 3HTUA 4GCVA 5AIQA 1TBXA 2ELHA 1XSVA 1I1GA 3SQNA 2DPUA 4Y17A 1HW5A 2H27A 1IN4A 3WTZA 4ENNA 4HLYA 1YQAA 3K69A 4EM0B 4CO8A 4LLNA 5CVVA 1QO0D 1XCVA 4ZYEA 4ZYGA 1YIOA 3P9KA 3R0JA 3CDHA 3TDZC 4OIPF 1SFUA 3G3ZA 2A6HF 1MD0A 2GZWA 3LWFA 3F72A 4B8XA 3KP7A 4ZH4F 1ZGAA 4HX8A 2GAUA 2FNPA 4U0VA 2GXBA 4KMUX 3ROUA 2G9WA 2XIGA 2PQ8A 1U6GA 4RAZA 3KE2A 4KNYA 2IA1A 5LBQA 1FYLA 3IC7A 2QYOA 3RDIA 4IRGA 3ZQ7A 1LDKB 4IXAA 4MHGA 5FO5A 2MH2A 3LA3A 3K1MA 4U7BA 2K7LA 1J59A 2BBYA 2QWWA 3Q9SA 5J6XA 4OMZA 3LA2A 3ABTA 2ZKZA 4HV6A 1FP1D 1YLFA 1D3YA 1HKSA 4P5OA 1O3TA 1GXQA 3ZN1A 1DP7P 5DDGA 5LEKA 1TQPA 2HKOA 1FYMA 2JZYA 1SAXA 3EUHA 1O7LA 1JHFA 4LK1F 3F23A 4CZZA 3ELKA 3HHGA 4MGRA 2CWEA 2IP2A 5IT9K 2QENA 3TOAA 3BJOA 2ISZA 3GFIA 2WC2A 5BQTA 5L3BA 2OZUA 1OR7A 2RKHA 2HDCA 3F3XA 1YS7A 3GFLA 3K9TA 3MCZA 5DEQA 2R7FA 3F6VA 1PP7U 1P6RA 3WGGA 3GWZA 2V79A 3FMSA 2KKOA 5BS6A 2XAGA 3DV8A 1U78A 1FBSA 3FF5A 2LNBA 3HTSB 1UHWA 2D45A 2VONA 4P9FA 3I54A 4IHTA 2FSWA 5J8CA 3F22A 2L02A 2HKXA 4OU0A 4E70A 4EM1A 3KCCA 4EJTA 2CQKA 1U5TA 2YR2A 1P4XA 1BOAA 3QU6A 4WWCA 5ICGA 1AWCA 4L9JA 1S6LA 5DD8A 2MA3A 1XGSA 2OA4A 2CFXA 4UVBA 5L3EA 2EA4A 4R79A 5IT9Z 4I2OA 3V8KA 2A68F 1HKQA 5LRSA 2D2WA 1FPQA 5D8KB 5E17F 4LJZF 2KIUA 2HTSA 1DDNA 3EDPA 1Z05A 3O2PE 4DQ2A 3ECHA 1LJ9A 2EJRA 2UZKA 1J9IA 3L2CA 2ZBKA 2PMHA 2J5PA 5AIPA 1B59A 2Z33A 5D6EA 2XVCA 1UB9A 1IRGA 3FX3A 2RC4A 3WTVC 2EFOA 3COAC 1K7AA 3CUOA 4ESBA 1RI7A 4EV0A 3FXRA 4RB0A 1FSHA 3ZMZA 1BI0A 1WRJA 1YO5C 4Y13A 2XUBA 1PP8F 3HRMA 4HZFA 1ZLKA 1WWXA 4GXOA 3BJ6A 2JRTA 1R5HA 1G3YA 4UVCA 2UXXA 1IAWA 4IJAA 4BHPA 4NQWA 2X4HA 4WCGA 1LNWA 2F5DA 2WWYA 2O3FA 3BZ6A 3V7SA 1KQ8A 3RI4A 1ZLJA 3TO6A 2B0LA 4O3MA 4G94A 1R1UA 2XV4S 4KIFA 4CDGA 1G3SA 1USTA 4YFKF 3OV8A 2UXNA 1MGTA 5CVUA 4BNCA 2F5CA 1FBUA 4HOBA 2EK5A 1B6AA 1Y0UA 2KJCA 4G9YA 2J5OA 4KYWA 4M73A 2R7DA 3U9GA 2ZMEB 3NRVA 1BI3A 4A0ZA 3R61A 2EV0A 2GIVA 5A2QK 1HBXG 2GXGA 4RB3C 5BOXA 1MJBA 2QQBA 5DV5A 5D4RA 1RIOH 5E1ZB 5K5QA 3D5LA 5D5VB 2Y0MA 2JT1A 4UV9A 3KLOA 4EJOA 1GVJA 4A12A 3QP6A 1FBQA 1O57A 1R5GA 4ZZDA 3GYHX 2HTJA 2Z99A 4RB2C 3C3WA 2VODA 1FYKA 4XRFA 5DCMB 4RB1A 1R1TA 4BH9A 1YTYA 4HDVA 2E7XA 4M9ZA 1BN5A 3WODF 4IPAA 2EV5A 4KT5C 4R8HA 2OQGA 2LF7A 2V9VA 2FE3A 2Z5UA 4JQFA 1Z1DA 2K02A 3K2ZA 3ECOA 3DEUA 5A2QZ 2ZXJA 1QGPA 5FGMA 2IRFG 2YX7A 3ZMUA 1XN7A 4QWQA 1BC7C 2E1CA 4BXUA 2K4JA 4EJUA 2HQRA 2K27A 5TRDA 3E5QA 5E8GA 2A6EF 5HS8A 3R4KA 3T8TA 1KYWA 4A0YA 1AOYA 2JSCA 1FP2A 4XSXF 1JXSA 1WI9A 2M30A 2H09A 3P9IA 1SD6A 4M74A 5HDGA 3KEQA 1Z7UA 4BYYA 4BQAA 1L0OC 1KU3A 1BM9A 2RV8A 4BHBA 4ENJA 4O6JA 2O6GE 2K4BA 4GO1A 3E3VA 3FMRA 1TQMA 2BYVE 5DUIA 1S29A 2STTA 4EQQA 1X3UA 3M8EA 2FF4A 2WTEA 3DPTA 3HSFA 4LG0A 5DCFA 3DP7A 3GZ6A 1P4WA 2VC0A 3ZPLA 4U7DA 2XRNA 3V8JA 2OBPA 3BPXA 3EYYA 4HX4A 4AVPA 1JGSA 3H92A 5E18F 4I01A 1S8NA 2C6YA 5CLSA 4KMFA 4M6XA 3FMQA 4CICA 1WKMA 3L7WA 2O8XA 5D6FA 4MTDA 3FHZA 1BJAA 1F9NA 3KP2A 3VB2A 2OD5A 2IPQX 2VBWA 2FRHA 4EGZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3E6M A;  4UXN A;  1O3R A;  2NRA C;  2LF8 A;  4A5M A;  2HWV A;  2WV0 A;  1QBJ A;  3K0L A;  1P4A A;  1D5V A;  4XSZ F;  2FBH A;  5K1Y A;  3LQQ A;  3QAH A;  4JK1 X;  4CGZ A;  4YFN F;  5BMZ A;  2XRO A;  1KGS A;  1B9M A;  5L3G A;  3IRQ A;  5JVT A;  4I0B A;  4Q48 A;  1MJ9 A;  3MFK A;  2QQA A;  2PI0 A;  1IN6 A;  2EA2 A;  2PJP A;  2IA0 A;  1FT9 A;  3DKW A;  3IKV A;  5CYV A;  4G6Q A;  2DPD A;  4OMY A;  4HAM A;  2HR3 A;  4HW0 A;  2OZ6 A;  3HUG A;  3HSR A;  3RIR A;  4FX0 A;  3WTX C;  3JTH A;  3T8R A;  4ENK A;  1U5T B;  3O3K A;  4WK8 F;  3VEP A;  3ZN0 A;  3HHH A;  2RVC A;  2IW5 A;  1RNL A;  2PG4 A;  4PZJ A;  1IW7 F;  3M1E A;  2ESN A;  3KET A;  1K78 A;  2HGC A;  5LGU A;  3GUD A;  3QPH A;  1XMK A;  4I98 B;  2GA1 A;  1P2F A;  2CYY A;  1U3E M;  2O61 A;  2V6C A;  1UCR A;  3SFZ A;  3TQN A;  2F5F A;  1B4A A;  5DD4 A;  3P7N A;  1XSX A;  3PQK A;  1FZP B;  3PQJ A;  3DXJ F;  1KQ9 A;  3U1D A;  1LDJ A;  4XLP F;  4PCQ A;  3HIF A;  4ETS A;  2FU4 A;  5HS7 A;  2VBX A;  3PFI A;  4PDK A;  2TDX A;  4A2U A;  2P6T A;  3SXY A;  5HVQ C;  3I53 A;  3I5U A;  3WE2 A;  1EH6 A;  2EB7 A;  2JPC A;  2BGC A;  2VN2 A;  3T5X A;  3AAF A;  1Z6T A;  2XAF A;  1V3F A;  2LKP A;  3Q5F A;  3IKT A;  3JW4 A;  1TW3 A;  4N9I A;  3DPL C;  4Q4Z F;  1GHC A;  1SD7 A;  1ZAO A;  3T1B A;  4LGW A;  1I6X A;  2HYF A;  5LRR A;  4FX4 A;  4KIC A;  2KIF A;  3JSO A;  3BOQ A;  1OYW A;  1H0M A;  3HOS A;  2YX4 A;  1VTN C;  1CF7 A;  4LD5 A;  2NNN A;  3TKY A;  2F2E A;  2ZFW A;  1YG2 A;  1WSU A;  3MZY A;  3EQL F;  4H0E A;  2VOP A;  3D0S A;  5ILV A;  2ADU A;  3L00 A;  1SFX A;  1FSE A;  3V4G A;  1I1S A;  3IRR A;  1G6N A;  4MNU A;  4A5N A;  2DO7 A;  5FFX A;  1W7P D;  4WF2 A;  3WU1 B;  2QUF A;  3RPQ A;  1J75 A;  2KJB A;  3Q9V A;  2W57 A;  2XAJ A;  3C1D A;  1TNS A;  3P9C A;  4ESJ A;  2W85 A;  2PFB A;  2A07 F;  2DQR A;  1QPM A;  4OIQ F;  2V1D A;  2P6S A;  4FT8 A;  1EH8 A;  3KP6 A;  1O3Q A;  2FNA A;  1UHM A;  2CO5 A;  2XAH A;  1FX7 A;  3U2R A;  2ACJ A;  2O03 A;  3F6O A;  1XDS A;  3CUQ C;  4HF2 A;  4A6E A;  1QZY A;  2NS0 A;  4KIG A;  5LGT A;  5K5O A;  2M87 A;  1V4R A;  4KN7 X;  3LAP A;  4L9T A;  5EEH A;  1KA8 A;  4XLN F;  3NEU A;  2QLZ A;  3RKX A;  1ZG3 A;  1FC3 A;  4A0X A;  5BPD A;  2DBB A;  5L3F A;  3ULQ B;  1I5Z A;  3ERE D;  4ZYH A;  3C7J A;  5ILS A;  4MEX F;  3J7A O;  1OYI A;  4L0Y B;  4LB5 A;  4P55 A;  5HDN A;  4ESF A;  2OQR A;  2NAZ A;  3W6K B;  1OYY A;  3MZH A;  4U88 A;  3HOT A;  3CO7 C;  4ENM A;  5AON A;  2HFH A;  4KIB A;  3QPT A;  1ODD A;  5D5W B;  4M72 A;  3HRT A;  4PGH A;  2ZO4 A;  1ZG1 A;  5IT3 A;  2A61 A;  1R1V A;  5F1R A;  5H20 A;  2P4W A;  4G7Z F;  2MLK A;  2E7W A;  3BP8 A;  4HV5 A;  3V7R A;  2LDU A;  3BY6 A;  4KA4 A;  1FWZ A;  3GEZ A;  2E1N A;  4UV8 A;  3KEO A;  1W7P A;  1T2K A;  3QU3 A;  1SD5 A;  2GWR A;  2IA2 A;  4LG0 B;  2EFQ A;  3GO5 A;  2FBK A;  5H6R A;  1TQI A;  3M7G A;  4GYG A;  1KQ0 A;  3BRO A;  4NHJ A;  1XGM A;  5E20 A;  2H6C A;  5CJ9 A;  1BBY A;  2QZ8 A;  1YFH A;  5JR3 A;  2EFN A;  3WGI A;  2M45 A;  2W25 A;  1R7J A;  1MJA A;  1S7A A;  3M9A A;  1KU2 A;  2M5W A;  3H3Z A;  3KP4 A;  1TNT A;  4D0P A;  1ZAR A;  1G3T A;  1J5Y A;  3BPV A;  4BAY A;  4ASN A;  5D5U B;  1R22 A;  2P5V A;  2MBF A;  1IZ1 A;  3LA7 A;  3TGN A;  3O6B B;  4IRI A;  1KU9 A;  3TDU C;  3SZT A;  4M9S A;  3K1N A;  4L9N A;  2V1U A;  3EYI A;  2Q8K A;  2STW A;  3TO9 A;  1T0F A;  2BEO A;  4HBL A;  1ON1 A;  1XSD A;  4M9X A;  3I59 A;  1HKT A;  2XAS A;  1IXR C;  4LLL A;  4MEY F;  1G3W A;  4QLC U;  1XGO A;  3KFW X;  3ML6 A;  3TO7 A;  2CSO A;  2VE8 A;  1JHH A;  1QNT A;  2VOO A;  3WE3 A;  4U0Y A;  1YS6 A;  5DYM A;  1XGN A;  2VXZ A;  3DFG A;  3G73 A;  2FEZ A;  3C18 A;  2VT3 A;  2Z3Y A;  3I64 A;  3DQV C;  2W24 A;  1REP C;  3T0Y A;  1G4D A;  2EFP A;  5JHU A;  1P92 A;  4CHU A;  1B9N A;  4CYD A;  2M8E A;  1XDU A;  2BE5 F;  4WX9 A;  2YSR A;  2L3D A;  3WTY C;  1YYV A;  3GZ5 A;  3CJN A;  3ZMD A;  5K5R A;  3E6D A;  3I0T A;  3VOE A;  1BI1 A;  1Z91 A;  1ULY A;  1K78 B;  5J8F A;  3IWZ A;  1TLH B;  4MQ9 F;  1ZH5 A;  3ZMT A;  2DK8 A;  4IHS A;  5F6F A;  4DNC A;  1PDN C;  1UFM A;  6PAX A;  3WGH A;  4G8X A;  2IJL A;  2L01 A;  3I4P A;  1XCB A;  5FLX K;  1MDM A;  2QBY A;  4BHC A;  5L3D A;  5D5X B;  3WU0 A;  2FXA A;  1LDD A;  4B09 A;  2RGV A;  3L09 A;  4RGR A;  1OKR A;  3FWE A;  3N4M A;  2DTR A;  4I02 A;  4EM2 A;  4RAY A;  4I09 A;  4HDU A;  1HXD A;  2DLL A;  3W6J B;  1KU7 A;  1NHA A;  4HQE A;  3LST A;  1J7K A;  1IXS B;  1T39 A;  5ED4 A;  2COM A;  3J81 K;  3CUQ A;  3FZV A;  4LLG F;  1SMT A;  4YII A;  2IT0 A;  1W4M A;  2HEO A;  2D1V A;  2JTV A;  3MQ0 A;  5HLH A;  5HLI A;  1DPR A;  1BI2 A;  1SD4 A;  3L9F A;  1A04 A;  1CF7 B;  3LFK A;  2GQQ A;  1K79 A;  2YPR A;  3JTG A;  3FXQ A;  2DW4 A;  5FLX Z;  3DF8 A;  4YG2 F;  2YU3 A;  1LVA A;  3KZY A;  4LFU A;  1W5T A;  3F8C A;  4KUM A;  5H6Q A;  4JBA A;  5FFZ A;  2DU9 A;  3FM5 A;  1HQC A;  2R3S A;  2PEX A;  1C0W A;  2DI3 A;  4LB6 B;  3RYP A;  2NYX A;  1IN5 A;  1T6S A;  2XAQ A;  5KK1 A;  2GA2 A;  2MLG A;  1FNN A;  2MD5 A;  2G7H A;  4RS8 A;  1RUO A;  4F7Z A;  4YIF A;  3KP3 A;  1LB2 A;  3J81 Z;  2AXL A;  5HLG A;  4KN4 X;  4KDP A;  1CGP A;  1JE8 A;  5HOO A;  3V7C A;  2VC1 A;  4OOI A;  2QQ9 A;  3VFZ A;  1J2X A;  3CO6 C;  1HSJ A;  1ZRF A;  3FM3 A;  2EV6 A;  1ZRE A;  2ZNY A;  3VOD A;  3GLX A;  3RJP A;  2ZNZ A;  4Q47 A;  3SHF A;  2LSO A;  2IVM A;  4M6Y A;  1EV7 A;  1BIB A;  2HQN A;  4Y15 A;  3ZP5 A;  2HZT A;  3F8M A;  2A69 F;  3RYR A;  5ILU A;  3NQO A;  5LLQ A;  3ABU A;  1OMI A;  5E1X A;  1OPC A;  1GXP A;  1U8R A;  1D8K A;  1ZRD A;  1S3J A;  1O3S A;  5LHI A;  3QOP A;  4TV7 A;  2FA5 A;  1XD7 A;  4MQV A;  2L4A A;  4LK0 F;  3BWG A;  4OIN F;  4S04 A;  3FXU A;  2QVO A;  1HST A;  4RGU A;  4WXH A;  4I7H A;  3B02 A;  1J0R A;  1TW2 A;  4ZYD A;  4EJV A;  4L5J A;  3CLO A;  2X0L A;  2P7V B;  5LEJ A;  1IUY A;  2Z9O A;  3E6B A;  4G7H F;  3IL2 A;  1USS A;  4GYI A;  1QQI A;  2HOE A;  4HLX A;  1H9G A;  2PMU A;  2EWN A;  4YFX F;  3RKW A;  1BIA A;  5F64 A;  3REO A;  3I58 A;  1FOK A;  1W7P B;  2BV6 A;  5D4S A;  4G6D A;  5L3C A;  2A5Y B;  3GW2 A;  2KRF A;  3GXO A;  3WTW C;  3HRS A;  1T98 A;  3HRU A;  3S2W A;  1BC8 C;  2ETH A;  4S05 A;  1RUN A;  4Z2Y A;  4IF4 A;  2XKP A;  3R0A A;  3I71 A;  3KP5 A;  4IVN A;  4UNO A;  3E97 A;  1T38 A;  1LQ1 A;  2CGP A;  2RDP A;  3GVA A;  4AD9 A;  3F21 A;  4G7O F;  1XB4 A;  4LMY A;  2DFI A;  5ICF A;  2P8T A;  2MC3 A;  1B1B A;  3CTA A;  3EET A;  4EVI A;  5CVJ A;  2VBY A;  5FB2 A;  1R58 A;  5LGN A;  1L3L A;  2P5L C;  2XGX A;  3M8F A;  2ZCW A;  1YW8 A;  5ICC A;  4A6D A;  2A3S A;  4EMS A;  3ZMV A;  4N9H A;  3MAJ A;  1IN8 A;  4EGY A;  4ON0 A;  3RKY A;  2L4M A;  1O7F A;  3BDD A;  2ZJ2 A;  4ZZL A;  3WG9 A;  4UUV A;  4RGS A;  5DUK A;  4P9U A;  2XHK A;  1Z6R A;  3BJA A;  1F1Z A;  4AIH A;  5JI6 A;  1IXC A;  3I59 B;  5HDK A;  1HW1 A;  4NB5 A;  1D8J A;  3HSE A;  4L9V A;  4OIO F;  3RPU A;  2H94 A;  2OAZ A;  3LQR A;  5JFR A;  1ZYR F;  4R1H A;  4PGG A;  1KYZ A;  5CVI A;  2Q0O A;  1IF1 A;  1MKM A;  3F8N A;  2G7U A;  1HW2 A;  2RN7 A;  2QM3 A;  2Q2E A;  2DQL A;  1FY7 A;  3IWF A;  3LAJ A;  3ISP A;  3OOP A;  2PBI A;  3J80 K;  3TOB A;  1FLI A;  1MZB A;  1ZHF A;  5ERI A;  4HYE A;  2CW0 F;  2KIM A;  2H6B A;  4RGX A;  5LHG A;  5D8L B;  1ON2 A;  3E5U A;  4IRH A;  5CVR A;  1WQ2 A;  1ZGJ A;  2FBI A;  3WTS C;  4XBF A;  1E2X A;  1R23 A;  5TJJ A;  1QZZ A;  4AWX B;  3QP5 A;  1E17 A;  2PN6 A;  1XMA A;  2RQP A;  5KVR A;  1U2W A;  3F8B A;  4M71 A;  2UWM A;  1IRF A;  1W5S A;  1YW7 A;  2K86 A;  4EJW A;  1U5T C;  2FML A;  2AS5 F;  5HS9 A;  4O5V A;  5E1W A;  2PLY A;  2Y75 A;  1TTY A;  5E8I A;  2FQ3 A;  3QRF F;  2Y48 A;  4CXF A;  2NNY A;  1K6O A;  4L0Z B;  1MDM B;  2QBY B;  3J80 Z;  3KZZ A;  3KLN A;  4HX7 A;  2O0Y A;  4L18 B;  3MWM A;  2W84 A;  3GFJ A;  3WTT C;  1PUE E;  1EH7 A;  5LHH A;  3JSP A;  3F8F A;  4N0B A;  2V1X A;  2P7C B;  1ZG5 A;  1SFE A;  2VT2 A;  3R6S A;  4I0A A;  2RNJ A;  3V8L A;  4FHT A;  2EFW A;  1R00 A;  1R36 A;  1DUX C;  1ZN2 A;  5EEG A;  4MTE A;  2ZME A;  1DPU A;  4L5I A;  1Q1H A;  4OIR F;  3GFM A;  2DK5 A;  2DT5 A;  1I27 A;  3MEX A;  1IN7 A;  1ONV A;  5FD5 A;  3CUQ B;  4GGG A;  3N97 A;  1LEA A;  2FMY A;  3ZMS A;  3JAM K;  2FOK A;  2MH9 A;  3SZP A;  3RTR A;  2JPB A;  1RZ4 A;  2CG4 A;  2VBZ A;  1F4K A;  3GF2 A;  1YW9 A;  2L54 A;  4WXC A;  4KFC A;  5DCM A;  3H3U A;  3E6C C;  3GX4 X;  2OU2 A;  5ICE A;  4P96 A;  2ISY A;  2HS5 A;  4K2E A;  2XKO A;  3R60 A;  1SMY F;  4Q5S F;  3IHU A;  1F5T A;  1STZ A;  2DAO A;  1S7O A;  3E5X A;  2M1B A;  4WXD A;  4UHT A;  3WTU C;  3B73 A;  2HYG D;  2F5E A;  4HQM A;  2D1H A;  1LEB A;  1ZRC A;  1Z9C A;  4HA8 A;  3JAM Z;  4HF0 A;  2ESH A;  4UVA A;  5FD6 A;  4AIK A;  4HF1 A;  3K1P A;  1H9T A;  4U0W A;  4AIJ A;  2VE9 A;  5BPI A;  3HYI A;  2P5K A;  3HTU A;  4GCV A;  5AIQ A;  1TBX A;  2ELH A;  1XSV A;  1I1G A;  3SQN A;  2DPU A;  4Y17 A;  1HW5 A;  2H27 A;  1IN4 A;  3WTZ A;  4ENN A;  4HLY A;  1YQA A;  3K69 A;  4EM0 B;  4CO8 A;  4LLN A;  5CVV A;  1QO0 D;  1XCV A;  4ZYE A;  4ZYG A;  1YIO A;  3P9K A;  3R0J A;  3CDH A;  3TDZ C;  4OIP F;  1SFU A;  3G3Z A;  2A6H F;  1MD0 A;  2GZW A;  3LWF A;  3F72 A;  4B8X A;  3KP7 A;  4ZH4 F;  1ZGA A;  4HX8 A;  2GAU A;  2FNP A;  4U0V A;  2GXB A;  4KMU X;  3ROU A;  2G9W A;  2XIG A;  2PQ8 A;  1U6G A;  4RAZ A;  3KE2 A;  4KNY A;  2IA1 A;  5LBQ A;  1FYL A;  3IC7 A;  2QYO A;  3RDI A;  4IRG A;  3ZQ7 A;  1LDK B;  4IXA A;  4MHG A;  5FO5 A;  2MH2 A;  3LA3 A;  3K1M A;  4U7B A;  2K7L A;  1J59 A;  2BBY A;  2QWW A;  3Q9S A;  5J6X A;  4OMZ A;  3LA2 A;  3ABT A;  2ZKZ A;  4HV6 A;  1FP1 D;  1YLF A;  1D3Y A;  1HKS A;  4P5O A;  1O3T A;  1GXQ A;  3ZN1 A;  1DP7 P;  5DDG A;  5LEK A;  1TQP A;  2HKO A;  1FYM A;  2JZY A;  1SAX A;  3EUH A;  1O7L A;  1JHF A;  4LK1 F;  3F23 A;  4CZZ A;  3ELK A;  3HHG A;  4MGR A;  2CWE A;  2IP2 A;  5IT9 K;  2QEN A;  3TOA A;  3BJO A;  2ISZ A;  3GFI A;  2WC2 A;  5BQT A;  5L3B A;  2OZU A;  1OR7 A;  2RKH A;  2HDC A;  3F3X A;  1YS7 A;  3GFL A;  3K9T A;  3MCZ A;  5DEQ A;  2R7F A;  3F6V A;  1PP7 U;  1P6R A;  3WGG A;  3GWZ A;  2V79 A;  3FMS A;  2KKO A;  5BS6 A;  2XAG A;  3DV8 A;  1U78 A;  1FBS A;  3FF5 A;  2LNB A;  3HTS B;  1UHW A;  2D45 A;  2VON A;  4P9F A;  3I54 A;  4IHT A;  2FSW A;  5J8C A;  3F22 A;  2L02 A;  2HKX A;  4OU0 A;  4E70 A;  4EM1 A;  3KCC A;  4EJT A;  2CQK A;  1U5T A;  2YR2 A;  1P4X A;  1BOA A;  3QU6 A;  4WWC A;  5ICG A;  1AWC A;  4L9J A;  1S6L A;  5DD8 A;  2MA3 A;  1XGS A;  2OA4 A;  2CFX A;  4UVB A;  5L3E A;  2EA4 A;  4R79 A;  5IT9 Z;  4I2O A;  3V8K A;  2A68 F;  1HKQ A;  5LRS A;  2D2W A;  1FPQ A;  5D8K B;  5E17 F;  4LJZ F;  2KIU A;  2HTS A;  1DDN A;  3EDP A;  1Z05 A;  3O2P E;  4DQ2 A;  3ECH A;  1LJ9 A;  2EJR A;  2UZK A;  1J9I A;  3L2C A;  2ZBK A;  2PMH A;  2J5P A;  5AIP A;  1B59 A;  2Z33 A;  5D6E A;  2XVC A;  1UB9 A;  1IRG A;  3FX3 A;  2RC4 A;  3WTV C;  2EFO A;  3COA C;  1K7A A;  3CUO A;  4ESB A;  1RI7 A;  4EV0 A;  3FXR A;  4RB0 A;  1FSH A;  3ZMZ A;  1BI0 A;  1WRJ A;  1YO5 C;  4Y13 A;  2XUB A;  1PP8 F;  3HRM A;  4HZF A;  1ZLK A;  1WWX A;  4GXO A;  3BJ6 A;  2JRT A;  1R5H A;  1G3Y A;  4UVC A;  2UXX A;  1IAW A;  4IJA A;  4BHP A;  4NQW A;  2X4H A;  4WCG A;  1LNW A;  2F5D A;  2WWY A;  2O3F A;  3BZ6 A;  3V7S A;  1KQ8 A;  3RI4 A;  1ZLJ A;  3TO6 A;  2B0L A;  4O3M A;  4G94 A;  1R1U A;  2XV4 S;  4KIF A;  4CDG A;  1G3S A;  1UST A;  4YFK F;  3OV8 A;  2UXN A;  1MGT A;  5CVU A;  4BNC A;  2F5C A;  1FBU A;  4HOB A;  2EK5 A;  1B6A A;  1Y0U A;  2KJC A;  4G9Y A;  2J5O A;  4KYW A;  4M73 A;  2R7D A;  3U9G A;  2ZME B;  3NRV A;  1BI3 A;  4A0Z A;  3R61 A;  2EV0 A;  2GIV A;  5A2Q K;  1HBX G;  2GXG A;  4RB3 C;  5BOX A;  1MJB A;  2QQB A;  5DV5 A;  5D4R A;  1RIO H;  5E1Z B;  5K5Q A;  3D5L A;  5D5V B;  2Y0M A;  2JT1 A;  4UV9 A;  3KLO A;  4EJO A;  1GVJ A;  4A12 A;  3QP6 A;  1FBQ A;  1O57 A;  1R5G A;  4ZZD A;  3GYH X;  2HTJ A;  2Z99 A;  4RB2 C;  3C3W A;  2VOD A;  1FYK A;  4XRF A;  5DCM B;  4RB1 A;  1R1T A;  4BH9 A;  1YTY A;  4HDV A;  2E7X A;  4M9Z A;  1BN5 A;  3WOD F;  4IPA A;  2EV5 A;  4KT5 C;  4R8H A;  2OQG A;  2LF7 A;  2V9V A;  2FE3 A;  2Z5U A;  4JQF A;  1Z1D A;  2K02 A;  3K2Z A;  3ECO A;  3DEU A;  5A2Q Z;  2ZXJ A;  1QGP A;  5FGM A;  2IRF G;  2YX7 A;  3ZMU A;  1XN7 A;  4QWQ A;  1BC7 C;  2E1C A;  4BXU A;  2K4J A;  4EJU A;  2HQR A;  2K27 A;  5TRD A;  3E5Q A;  5E8G A;  2A6E F;  5HS8 A;  3R4K A;  3T8T A;  1KYW A;  4A0Y A;  1AOY A;  2JSC A;  1FP2 A;  4XSX F;  1JXS A;  1WI9 A;  2M30 A;  2H09 A;  3P9I A;  1SD6 A;  4M74 A;  5HDG A;  3KEQ A;  1Z7U A;  4BYY A;  4BQA A;  1L0O C;  1KU3 A;  1BM9 A;  2RV8 A;  4BHB A;  4ENJ A;  4O6J A;  2O6G E;  2K4B A;  4GO1 A;  3E3V A;  3FMR A;  1TQM A;  2BYV E;  5DUI A;  1S29 A;  2STT A;  4EQQ A;  1X3U A;  3M8E A;  2FF4 A;  2WTE A;  3DPT A;  3HSF A;  4LG0 A;  5DCF A;  3DP7 A;  3GZ6 A;  1P4W A;  2VC0 A;  3ZPL A;  4U7D A;  2XRN A;  3V8J A;  2OBP A;  3BPX A;  3EYY A;  4HX4 A;  4AVP A;  1JGS A;  3H92 A;  5E18 F;  4I01 A;  1S8N A;  2C6Y A;  5CLS A;  4KMF A;  4M6X A;  3FMQ A;  4CIC A;  1WKM A;  3L7W A;  2O8X A;  5D6F A;  4MTD A;  3FHZ A;  1BJA A;  1F9N A;  3KP2 A;  3VB2 A;  2OD5 A;  2IPQ X;  2VBW A;  2FRH A;  4EGZ A; 
#chains in the Genus database with same CATH topology
 1CQT A;  1MBE A;  1RKW A;  3E6M A;  4UXN A;  5B1A H;  1O3R A;  2HOS A;  3M4O J;  2NRA C;  2NXN B;  2JK3 A;  3H5A A;  3ZQQ A;  2LF8 A;  1MMG A;  4A5M A;  2HWV A;  2WV0 A;  3RKQ A;  1QBJ A;  5FRM A;  5E79 C;  1WFX A;  1SC7 A;  2CUE A;  3K0L A;  4XM3 A;  1EJ9 A;  1P4A A;  1D5V A;  4JX4 A;  4XSZ F;  1WJ5 A;  2FBH A;  5FKL A;  1R9T J;  2HI3 A;  1WJC A;  5K1Y A;  3LQQ A;  3QAH A;  4JK1 X;  3F0C A;  3MKW B;  4CGZ A;  4YFN F;  3DCF A;  2KIS A;  4PSX A;  5BMZ A;  2XGE A;  1WCM J;  2XRO A;  1KGS A;  3JRA A;  1B9M A;  5L3G A;  3IRQ A;  1PJR A;  5JVT A;  1IUF A;  4I0B A;  1WHU A;  2E35 A;  4Q48 A;  1K4T A;  1MJ9 A;  3MFK A;  2QQA A;  2F4I A;  5GPC A;  2ELJ A;  2KPM A;  4M3G A;  2PI0 A;  1IN6 A;  2EA2 A;  2PJP A;  2M2E A;  2IA0 A;  3BR3 A;  3TBI A;  3HOV J;  2VQL A;  5IP7 J;  3OWT A;  4RM2 A;  3ASN H;  1FT9 A;  2XRL A;  3DKW A;  5C3E J;  2K9M A;  1R5I D;  3IKV A;  5CYV A;  2IS6 A;  4XLF A;  4G6Q A;  2DPD A;  2KMU A;  4OMY A;  4HAM A;  2E2H J;  2HR3 A;  4IOC F;  4HW0 A;  2DA5 A;  5BNG A;  2VAS A;  3D1N I;  2L9N A;  2Y9Z A;  2OZ6 A;  2Y31 A;  5FJ8 J;  2HNH A;  2R7V A;  3HUG A;  3LSJ A;  4A3M J;  1VQN I;  3HSR A;  2JN6 A;  4UUS A;  3RIR A;  4FX0 A;  3WTX C;  1A36 A;  2FUG 2;  1UJ8 A;  1XS9 A;  2G0E A;  2M3A A;  3JTH A;  3T8R A;  1IDZ A;  1RES A;  4ENK A;  1U5T B;  3O3K A;  2EH3 A;  4WK8 F;  3VEP A;  4GDF A;  2UV1 A;  1PUF A;  3ZN0 A;  3HHH A;  2RVC A;  1QVU A;  1LVK A;  3S1Q J;  1PYV A;  2RQQ A;  2MC4 A;  2IW5 A;  2WY7 Q;  1RNL A;  2PG4 A;  4PZJ A;  2E2J J;  1IW7 F;  2CW7 A;  3M1E A;  4IO9 F;  1X3Z B;  3QYF A;  5IY5 H;  2ESN A;  3KET A;  1K78 A;  3S3O A;  1FOW A;  2B7E A;  3IH3 A;  4XRM A;  2HGC A;  5LGU A;  3GUD A;  1YJN I;  3QPH A;  1XMK A;  3CF5 F;  3RQ4 A;  4I98 B;  5CPR B;  2GA1 A;  2VI6 A;  1P2F A;  2CYY A;  1U3E M;  2O61 A;  5GAG J;  3AL0 C;  2V6C A;  2DA4 A;  1UCR A;  1QVT A;  5M3F J;  3SFZ A;  5B66 C;  4F52 A;  3TQN A;  5GP9 A;  2F5F A;  4AUX A;  1B4A A;  5DD4 A;  4B44 A;  3P7N A;  5K7H A;  1XSX A;  3RSN A;  3PQK A;  1FZP B;  4ZDP A;  2AQF A;  3PQJ A;  4HG2 A;  3DXJ F;  1LFB A;  1KQ9 A;  3QWL A;  3U1D A;  1LDJ A;  2Z16 A;  4XLP F;  2AHQ A;  3HIF A;  4PCQ A;  4HNU A;  1I50 J;  1TP4 A;  4ETS A;  2FU4 A;  5J4V A;  5HS7 A;  2VBX A;  3PFI A;  1B72 B;  4PDK A;  2TDX A;  4A2U A;  3IV5 A;  4ZJZ A;  2P6T A;  3S93 A;  3SXY A;  5HVQ C;  3HPG A;  3I53 A;  2JJ7 A;  2VKV A;  3I5U A;  1NH3 A;  1DU0 A;  1G59 A;  3WE2 A;  1EH6 A;  2HVS A;  2CUJ A;  1MBF A;  2EB7 A;  1ZR4 A;  2L9R A;  2JPC A;  2BGC A;  2VN2 A;  1YI2 I;  3OR1 C;  1YE9 A;  3T5X A;  3JRB A;  3ZRG A;  4IQ4 A;  3AAF A;  1Z6T A;  2XAF A;  5FRO A;  1V3F A;  4XR6 A;  5FKN A;  4PJM A;  2LKP A;  3Q5F A;  3HC7 A;  3IKT A;  3JW4 A;  1IGN A;  2R7T A;  1VQ5 I;  4Y52 J;  1TW3 A;  4N9I A;  4A69 C;  1J09 A;  3DPL C;  4Q4Z F;  1GHC A;  1SD7 A;  1ZAO A;  3T1B A;  2XB0 X;  4NQW B;  1IC8 A;  4LGW A;  1I6X A;  2HYF A;  5LRR A;  3GLL A;  2E1O A;  3IUO A;  3ZQC A;  4FX4 A;  4KIC A;  4C3J J;  2KIF A;  3JSO A;  3BOQ A;  1OYW A;  1H0M A;  3A01 A;  2NVY J;  3LSK A;  3FK6 A;  3HOS A;  2YX4 A;  1VTN C;  1ETY A;  3PUF A;  1CF7 A;  4LD5 A;  2NNN A;  4QPO A;  3A2K A;  3TKY A;  2F2E A;  2ZFW A;  1YG2 A;  1MBJ A;  1WSU A;  3MZY A;  1TWH J;  2M4K A;  3EQL F;  4H0E A;  2VOP A;  3D0S A;  3SDG A;  2ADU A;  5ILV A;  1YRN B;  3L00 A;  1SFX A;  1FSE A;  3A0B C;  3V4G A;  3MKY B;  1I1S A;  3IRR A;  1G6N A;  1D0X A;  4M3B A;  4MNU A;  2LVS A;  2K9N A;  2M7A A;  4A5N A;  2DO7 A;  2EZI A;  3HZJ A;  3K6G A;  1N77 A;  5FFX A;  4XON A;  2M34 A;  3CMA I;  1W7P D;  2IGO A;  4WF2 A;  3WU1 B;  2O8K A;  5IYC J;  4RDU A;  2QUF A;  3RPQ A;  1J75 A;  2KJB A;  3Q9V A;  3OS0 A;  5J1Y A;  2W57 A;  2XAJ A;  3C1D A;  1TNS A;  4I99 C;  4BDY A;  3P9C A;  2AO9 A;  4ZDO A;  4XIC A;  4ESJ A;  3QPS A;  4HNT A;  3M8J A;  2XDV A;  2WBM A;  3KZI C;  1BL0 A;  2W85 A;  4ZTF A;  2OC6 A;  2PFB A;  1D0Z A;  4E7I A;  2A07 F;  3E0J B;  2HVR A;  2DQR A;  1QPM A;  4OIQ F;  4PFP A;  1V55 H;  2W82 A;  2V1D A;  2P6S A;  4FT8 A;  4B3X A;  1SVO A;  1EH8 A;  3BR6 A;  1Y1W J;  3KP6 A;  1O3Q A;  1HDD C;  4P1W A;  2FNA A;  5EZG A;  1UHM A;  3BR1 A;  2CO5 A;  2XAH A;  1FX7 A;  3U2R A;  4Y33 A;  3HGY A;  2E71 A;  2O03 A;  2ACJ A;  2W00 A;  3F6O A;  1N78 A;  4II2 A;  4RA2 A;  1XDS A;  4N4O B;  3CCV I;  3IAM 2;  1TWG J;  2DMN A;  3CUQ C;  1OCZ H;  4HF2 A;  2HQA A;  2QA4 I;  3IAS 2;  4A6E A;  4RAG A;  1QZY A;  2NS0 A;  4X1E A;  3HOW J;  3DEW A;  2R7S A;  4KIG A;  3SZG A;  2BHZ A;  3D5R C;  2RAE A;  5LGT A;  2DMP A;  5K5O A;  2L9V A;  2M87 A;  4IZZ A;  2HDD A;  2AQE A;  2OUM A;  3GME A;  1V4R A;  4KN7 X;  4E7K A;  3SYT A;  3LAP A;  1JUS A;  4L9T A;  5EEH A;  4E7L A;  1IDY A;  1KA8 A;  4XLN F;  2P0W A;  3NEU A;  2DTZ A;  2QLZ A;  3RKX A;  1ZG3 A;  1FC3 A;  2CH0 A;  2DT7 B;  2JMW A;  1SFK A;  4HSR A;  4A0X A;  3VYT B;  3OYL A;  2E5Z A;  5KAI C;  1N75 A;  5BPD A;  2DBB A;  5L3F A;  3ULQ B;  1I5Z A;  3CDI A;  4DJA A;  3OIO A;  3ERE D;  3CCU I;  4ZYH A;  1ERD A;  2CQN A;  3C7J A;  5ILS A;  4E4H A;  4MEX F;  2VXD A;  2TCT A;  4C2T A;  3J7A O;  2GOM A;  3H36 A;  3BCB A;  1OYI A;  3W2W A;  4L0Y B;  4LB5 A;  4P55 A;  5HDN A;  4ESF A;  1YIT I;  3U1K A;  2OQR A;  2NAZ A;  1V54 H;  2DOF A;  3CCJ I;  3W6K B;  1OYY A;  1T95 A;  2VKD A;  4UUT A;  4U88 A;  3MZH A;  3PJR A;  3HOT A;  5EJC A;  3CO7 C;  4ENM A;  3RZD J;  5AON A;  1R6R A;  2HFH A;  4KIB A;  3QPT A;  2BZT A;  3QYE A;  1X1D A;  2WAF A;  1RR7 A;  1DGR M;  1ODD A;  5D5W B;  1LE8 B;  4M72 A;  4C30 A;  5E3M A;  3HRT A;  2GXA A;  2PJR A;  2CFO A;  4PGH A;  2ZO4 A;  1ZG1 A;  3CC7 I;  5IT3 A;  3G1L A;  2A61 A;  1R1V A;  4DZP A;  5F1R A;  2ZJR F;  5J3L A;  2H8R A;  5H20 A;  4C2U A;  2DCE A;  2MG4 A;  4XK4 A;  1TWC J;  2P4W A;  4G7Z F;  4IX7 A;  2MLK A;  2E7W A;  3BP8 A;  4FE7 A;  4HV5 A;  3V7R A;  2V9K A;  2NS8 A;  2LDU A;  3BCA A;  3BY6 A;  4AVZ A;  3C2B A;  1UAA A;  3MKL A;  4RAF A;  1JJ8 C;  1Y8R B;  1K83 J;  4KA4 A;  3CES A;  2KFD A;  3OYM A;  2R7W A;  1HLV A;  1FWZ A;  3GEZ A;  2E1N A;  3LSR A;  4UV8 A;  5M5Y J;  2V6E A;  4AM3 A;  3KEO A;  2KDO A;  1OFC X;  2CMP A;  2LBF B;  1W7P A;  1T2K A;  3QU3 A;  1SD5 A;  2GWR A;  4PK4 A;  2IA2 A;  4LG0 B;  2QF7 A;  2EFQ A;  2VJ4 A;  3K4J A;  4Y7N J;  3GO5 A;  1BR4 A;  1IO2 A;  2FBK A;  5H6R A;  1TQI A;  3M7G A;  4GYG A;  1LPQ A;  1KQ0 A;  3BRO A;  4NHJ A;  3H5R A;  4M3E A;  4BXF A;  1XGM A;  5E20 A;  2CQX A;  1T56 A;  2H6C A;  1U9N A;  5CJ9 A;  4H4K C;  1BBY A;  4V2F A;  2QZ8 A;  4DBQ A;  3K4C A;  5JR3 A;  3DLL F;  1YFH A;  2EFN A;  1X1P A;  3WGI A;  2HU9 A;  1HF0 A;  2R7U A;  2M45 A;  2XAU A;  2NOG A;  2W25 A;  2R92 J;  1T33 A;  4ANJ A;  1R7J A;  3H9Q A;  2E34 A;  1MJA A;  5EEA A;  1S7A A;  2O7O A;  3M9A A;  2GM4 A;  1KU2 A;  2O9L A;  4BEH A;  4JX6 A;  2M5W A;  1VQO I;  3H3Z A;  2ZSI B;  1BOB A;  3CCR I;  2DJN A;  3KP4 A;  1TNT A;  3KPH A;  4V2G A;  4D0P A;  2E60 A;  1ZAR A;  1G3T A;  1J5Y A;  3BPV A;  4BAY A;  4ASN A;  4LOC A;  5D5U B;  5C44 J;  1R22 A;  2P5V A;  2HYJ A;  1IZ1 A;  2MBF A;  3SEZ A;  3LA7 A;  3TGN A;  3ZQH A;  3O6B B;  4MFE A;  1VQ9 I;  1Z21 A;  1KU9 A;  5TIS C;  4IRI A;  5FLM J;  2X1E A;  5DM6 F;  5KHD A;  2JA6 J;  3TDU C;  2GXB A;  3SZT A;  2JUG A;  2IS4 A;  4M9S A;  3K1N A;  4L9N A;  3D5S C;  3N05 A;  2V1U A;  3EYI A;  3HJE A;  1JUM A;  2CW8 A;  2Q8K A;  1GV2 A;  2STW A;  3CQZ J;  2ID3 A;  3TO9 A;  1T0F A;  1Z67 A;  2BEO A;  4HBL A;  2DYS H;  1ON1 A;  4HEA 2;  2ZFU A;  5IYB J;  1I3Q J;  2E19 A;  3OR2 C;  1XSD A;  2DA7 A;  2DJI A;  2A5W A;  4M9X A;  2I10 A;  2O5R A;  3I59 A;  1HKT A;  3HM5 A;  2XAS A;  3ZXS A;  3GBG A;  1IXR C;  3A4C A;  4LLL A;  4MEY F;  1G3W A;  4QLC U;  1XGO A;  3KFW X;  2BW3 A;  2EPF A;  3ML6 A;  3TO7 A;  2CSO A;  2K3P A;  2HPI A;  2VE8 A;  4BDZ A;  2EBI A;  4IEJ A;  1JHH A;  4XNF A;  1QNT A;  2VOO A;  3WE3 A;  4U0Y A;  2OTJ I;  1YS6 A;  3OL3 A;  5DYM A;  3OYB A;  1XGN A;  3AFH A;  2VXZ A;  4J19 A;  3DFG A;  3S16 J;  3G73 A;  4S0H B;  1A5J A;  2FEZ A;  3C18 A;  3HUG B;  5HOD A;  2VT3 A;  2Z3Y A;  2L2O A;  3V42 A;  3I64 A;  2DA3 A;  3DQV C;  3DTE A;  2W24 A;  4UUS B;  3BZK A;  1REP C;  3HXL A;  2VQC A;  5J47 A;  3T0Y A;  1GLN A;  1G4D A;  1WJF A;  2EFP A;  5JHU A;  4BQN A;  1P92 A;  2K85 A;  4CHU A;  3S3N A;  1B9N A;  4XOR A;  4CYD A;  4IHX A;  2M8E A;  1XDU A;  2BVL A;  1ZGW A;  1PUF B;  2E1M B;  2BE5 F;  2LH9 A;  1TZL A;  3E7L A;  5JLW A;  4WX9 A;  2YSR A;  1HCR A;  3S17 J;  4FQG A;  3VYU B;  2L3D A;  3K2A A;  2VUM J;  2ZSH B;  2R93 J;  1RRJ A;  1UZC A;  1YYV A;  3WTY C;  1QHG A;  2K40 A;  1ETW A;  3GZ5 A;  3CJN A;  3ZMD A;  4BQQ A;  5K5R A;  3E6D A;  3BG6 A;  3I0T A;  3VOE A;  2LTP A;  5J4Y A;  3HOY J;  1BI1 A;  5IOZ A;  4GRI A;  4PJ0 C;  5B3S H;  3JR9 A;  1Z91 A;  1ULY A;  1K78 B;  5J8F A;  3IWZ A;  1TLH B;  4MQ9 F;  1ZH5 A;  3ZMT A;  2DK8 A;  4IHS A;  5F6F A;  4DNC A;  1PDN C;  1UFM A;  1TL8 A;  2K9L A;  1ETO A;  6PAX A;  3WGH A;  4G8X A;  2QKM B;  3VYS B;  1GT0 C;  2IJL A;  2QKL B;  2L01 A;  3I4P A;  1XCB A;  3BTC A;  1FTT A;  1MSE C;  1SAU A;  3LOC A;  5FLX K;  1MDM A;  2QBY A;  4BHC A;  5L3D A;  1OCO H;  5D5X B;  2HQ5 A;  3WU0 A;  3ZQG A;  1FMW A;  2FXA A;  1LDD A;  4B09 A;  2RGV A;  3L09 A;  4RGR A;  3FIW A;  1OKR A;  3Q3S A;  3FWE A;  4EAT A;  4NC6 A;  2M8G X;  4BY7 J;  3N4M A;  2DTR A;  1AKH A;  3ONQ A;  1V5G A;  3WHC A;  2XF7 A;  4I02 A;  4XOT A;  4EM2 A;  2ECC A;  3GTO J;  4RAY A;  1MSF C;  4CYC A;  4I09 A;  4RBO A;  4HDU A;  3QPL A;  1HXD A;  2DLL A;  3W6J B;  2VPL A;  1KU7 A;  2MW8 A;  1NHA A;  4HQE A;  3LST A;  1X4O A;  2OJE D;  3A03 A;  2HOT A;  4MO7 A;  1IV8 A;  2EQR A;  1J7K A;  1JTY A;  1IXS B;  1LFU P;  3RCO A;  1FJL A;  2WAQ A;  4QPQ A;  1T39 A;  5F0C A;  4CCN A;  3DPU A;  4E7J A;  5ED4 A;  2COM A;  3J81 K;  3K4K A;  4D9J A;  2Y2Z A;  3CUQ A;  3FDY A;  3FZV A;  4LLG F;  1SMT A;  4YII A;  3UNG C;  2IT0 A;  3LSG A;  3PNY A;  3G1O A;  1W4M A;  5E3O A;  1MBG A;  2HEO A;  2D1V A;  3CDL A;  2JTV A;  1X19 A;  3DLA A;  3MQ0 A;  3FBN B;  4CUG A;  5HLH A;  3A01 B;  5HLI A;  3DWL E;  1DPR A;  1BI2 A;  2DMT A;  3VDX A;  5DTD A;  1D1B A;  1SD4 A;  3L9F A;  1A04 A;  1CF7 B;  3LFK A;  2GQQ A;  1GUU A;  1K79 A;  2YPR A;  3JTG A;  1T8I A;  3FXQ A;  5KAF C;  2DW4 A;  2N8G A;  5FLX Z;  1ZTR A;  3DF8 A;  4YG2 F;  2VKH A;  2YU3 A;  1LVA A;  3P5J A;  4JYK A;  2LG4 A;  1NG7 A;  3KZY A;  4LFU A;  1W5T A;  4BUP A;  2X85 A;  3F8C A;  4KUM A;  2IGK A;  5H6Q A;  2I5U A;  4JBA A;  5FFZ A;  2DU9 A;  2IGM A;  3QOE A;  3FM5 A;  3OYN A;  1HQC A;  4KIT B;  4BBS J;  1DU6 A;  2R3S A;  2PEX A;  3CC2 I;  1C0W A;  2DI3 A;  4LIT A;  1MNE A;  4LB6 B;  1KZH A;  3RYP A;  2NYX A;  1IN5 A;  1T6S A;  2XAQ A;  3PNV A;  4ITV A;  5EG0 A;  2E2I J;  5KK1 A;  2JVH A;  5C4J J;  2GA2 A;  2IS1 A;  2NVU B;  2MLG A;  3KYC B;  1FNN A;  2MD5 A;  2G7H A;  3OS2 A;  2R7Q A;  3CMM A;  4RS8 A;  3L2W A;  4U87 A;  4F7Z A;  4YIF A;  1RUO A;  2Z2S B;  3KP3 A;  3CME I;  3EPZ A;  5GTI C;  1ENH A;  3J81 Z;  3OYH A;  2AXL A;  5HLG A;  1LB2 A;  4A3G J;  1F43 A;  4KN4 X;  4KDP A;  1CGP A;  1VZ0 A;  5F08 A;  1JE8 A;  2R5Y A;  5HOO A;  1VQL I;  3V7C A;  2VC1 A;  4OOI A;  2A05 A;  2QQ9 A;  2ME6 A;  1Q1V A;  3VFZ A;  3I3L A;  4BXX J;  2YUS A;  5GTH C;  2ZME C;  3AG3 H;  4KIS A;  4NC7 A;  1J2X A;  3CO6 C;  1R71 A;  3OS1 A;  2K5C A;  1HSJ A;  1ZRF A;  2NOJ B;  1ETQ A;  3FM3 A;  2EV6 A;  4G12 A;  4II3 A;  4I6Z A;  1ZRE A;  2ZNY A;  2QQ8 A;  3A02 A;  3HG9 A;  1EF4 A;  3VOD A;  3GLX A;  3RJP A;  2ZNZ A;  4Q47 A;  2MD0 A;  3JRE A;  5FKO A;  4YIR X;  3SHF A;  1QU3 A;  2LSO A;  2IVM A;  2NVQ J;  4M6Y A;  4A3E J;  3BTL A;  3LMM A;  4FIS A;  1EV7 A;  3MMY B;  1BIB A;  3PL8 A;  2HQN A;  1LKX A;  3TMO A;  1BW6 A;  4Y15 A;  2WAQ N;  4BY1 J;  1A6Q A;  3ZP5 A;  2GOX B;  2HZT A;  2WA0 A;  3F8M A;  2A69 F;  3RYR A;  5ILU A;  3NQO A;  3TW7 A;  5LLQ A;  1MH3 A;  2L7M P;  3ABU A;  1Y39 A;  3FKJ A;  5FLV A;  2VB6 A;  1OMI A;  1VQP I;  1JI8 A;  4ABZ A;  5E1X A;  1MW7 A;  1OPC A;  4C3I J;  3RPU D;  1YX5 A;  4XRS A;  1GXP A;  4A3J J;  1U8R A;  2CV1 A;  1D8K A;  3LL7 A;  1S3J A;  1O3S A;  1ZRD A;  1H8A C;  4XLE A;  4BQO A;  2PX9 A;  5LHI A;  3QOP A;  4TV7 A;  2FA5 A;  1XD7 A;  4MQV A;  1PVE A;  2L4A A;  1YJ9 I;  4LK0 F;  3BWG A;  4OIN F;  2QSG X;  3OOU A;  1VQM I;  1G8X A;  4S04 A;  1ITY A;  3DTK A;  3FXU A;  2QVO A;  1HST A;  2R7O A;  3NAR A;  3TL4 X;  1KON A;  4RGU A;  4ZTJ A;  1HA8 A;  4WXH A;  4I7H A;  2XGC A;  1TC3 C;  3B02 A;  3OMY A;  2V4J C;  2HZD A;  3DU6 A;  1J0R A;  3OYF A;  1TW2 A;  3C2G A;  4EJV A;  4ZYD A;  2MGQ A;  4L5J A;  4UB8 C;  3CLO A;  2X0L A;  2P7V B;  1VQ8 I;  5JVG F;  4OAY A;  5LEJ A;  1IUY A;  3ZQI A;  2Z9O A;  1D0Y A;  4X6A J;  4A3F J;  1IG7 A;  2Y0S A;  3E6B A;  3OYD A;  4G7H F;  3GTQ J;  3IL2 A;  2PJR B;  5EYR A;  1USS A;  4GYI A;  2CQ7 A;  1QQI A;  3OYG A;  2DFH A;  1TT5 B;  2B63 J;  1UHS A;  1GVD A;  2HOE A;  4C3H J;  3FKI J;  4HLX A;  1H9G A;  3OIP A;  3CCE I;  1MMN A;  3A1Y A;  2PMU A;  1X1C A;  2EWN A;  4YFX F;  1NG6 A;  3RKW A;  3PIP F;  2QSF X;  4E7H A;  1BIA A;  3FXL A;  5F64 A;  3REO A;  1E3H A;  1FIP A;  3I58 A;  1FOK A;  5LFA A;  1W0U A;  2XC7 A;  1W7P B;  2BV6 A;  4B43 A;  3JRH A;  5D4S A;  4G6D A;  5L3C A;  2A5Y B;  3GW2 A;  2KRF A;  3GXO A;  2NVX J;  3WTW C;  3HRS A;  2BY0 A;  5IYD J;  5M5X J;  1T98 A;  1BR1 A;  3HRU A;  3S2W A;  3PO2 J;  9ANT A;  1BC8 C;  4AID A;  2ETH A;  4S05 A;  3PSI A;  5DS9 A;  3SJM A;  4BL0 B;  1RUN A;  1S72 I;  4Z2Y A;  2HVQ A;  4UY8 I;  2XKP A;  3R0A A;  4IF4 A;  3I71 A;  5EGO A;  3KP5 A;  3GZN B;  4IVN A;  4UNO A;  2BVM A;  3E97 A;  2VIX A;  3B6C A;  4NDL A;  1T38 A;  1LQ1 A;  1QA6 A;  1VND A;  3ASO H;  3BR2 A;  3OYI A;  2CGP A;  2RDP A;  3GVA A;  5EDN A;  3BTJ A;  4AD9 A;  3G6E I;  2VJI A;  4BEH B;  3F21 A;  3Q0V A;  4B3A A;  4HST A;  1XB4 A;  4LMY A;  5J1R A;  4G7O F;  2DFI A;  5ICF A;  3I9V 2;  2P8T A;  2MC3 A;  1B1B A;  3CTA A;  3EET A;  4EVI A;  5CVJ A;  2VBY A;  5FB2 A;  1R58 A;  1V5F A;  5FKM A;  4XRS G;  5LGN A;  1R4M B;  4B48 A;  4DYR A;  3AG2 H;  1L3L A;  2P5L C;  2XGX A;  3M8F A;  2ZCW A;  4E7Z A;  1YW8 A;  5ICC A;  4A6D A;  3H5N A;  2R7Z J;  2A3S A;  2QEX I;  4EMS A;  2DMQ A;  3ZMV A;  4N9H A;  3MAJ A;  1IN8 A;  4EGY A;  5JLX A;  4ON0 A;  1ZK8 A;  3RKY A;  3CCM I;  1JKQ C;  2COB A;  4E7S A;  3S1N J;  2L4M A;  2DDB A;  1O7F A;  3M3Y J;  3BDD A;  4GFB A;  1DGW Y;  4JOM A;  4DW6 A;  2JA7 J;  2ZJ2 A;  4ZZL A;  3ZGK A;  3WG9 A;  4N4N B;  3HEF A;  2Q1Z B;  2Y69 H;  4UUV A;  3GTJ J;  2V9P A;  4RGS A;  3CCY A;  5DUK A;  4BE0 A;  4P9U A;  2XHK A;  1XMX A;  1Z6R A;  2EIJ H;  1RKT A;  3BJA A;  2LKX A;  2KHM A;  4JP0 A;  1F1Z A;  4AIH A;  3AL0 B;  5JI6 A;  1IXC A;  3I59 B;  5HDK A;  1E0E A;  1HW1 A;  2A6T A;  4NB5 A;  1D8J A;  2ECB A;  3HSE A;  4L9V A;  1MBK A;  4OIO F;  3RPU A;  2H94 A;  2R7R A;  2OAZ A;  1A35 A;  3LQR A;  5JFR A;  3GTM J;  1ZYR F;  2BW3 B;  2Y0S N;  3HPH A;  4R1H A;  2IEK A;  4PGG A;  1KYZ A;  5CVI A;  4A3D J;  2Q0O A;  1IF1 A;  3FXO A;  4XLC A;  4D7M A;  2VQH A;  4XLA A;  1GV5 A;  1AHD P;  1MKM A;  5IPA A;  3F8N A;  2G7U A;  1HW2 A;  2RN7 A;  1U8B A;  2QM3 A;  3KIO A;  3H35 A;  3DU5 A;  2LY1 A;  2Q2E A;  2DQL A;  1FY7 A;  3EUH C;  3IWF A;  3LAJ A;  3ISP A;  2HXO A;  1QRY A;  3OOP A;  3OL4 A;  1MIJ A;  4HPQ A;  4L5E A;  2CS3 A;  2PBI A;  2QSH X;  3J80 K;  1Y6I A;  1R4N B;  2KP6 A;  4A3L J;  3TOB A;  1FLI A;  3H9G A;  1MZB A;  2BY1 A;  3G2B A;  4J00 A;  1E3O C;  1ZHF A;  1S5L C;  1N25 A;  2R4G A;  5ERI A;  3GTG J;  1G2H A;  2BXY A;  3RQI A;  1OR7 C;  4HYE A;  2CW0 F;  4NNJ A;  4XOP A;  3MVP A;  2KIM A;  2H6B A;  4RGX A;  2E5N A;  3OYK A;  1POG A;  5LHG A;  2ZJP F;  5D8L B;  2R5Z A;  1OJL A;  1ON2 A;  2UUZ A;  4XN3 A;  3E5U A;  2V26 A;  4IRH A;  5CVR A;  4X0G A;  4YEJ A;  3S32 A;  1FTZ A;  1Z0X A;  1WQ2 A;  1ZGJ A;  2W1O A;  2VL8 A;  3HKZ A;  2FBI A;  3WTS C;  4RMN A;  4XBF A;  3OYC A;  1E2X A;  3VPR A;  3S3M A;  1R23 A;  5TJJ A;  1HOM A;  1QZZ A;  4PJL A;  3JRI A;  3CJQ B;  1TT0 A;  3DKX A;  1BW5 A;  2RNG A;  1OCR H;  4AWX B;  3QP5 A;  2QCO A;  1GDT A;  5B1B H;  1E17 A;  3ZCO A;  2PN6 A;  5J40 A;  1XMA A;  4IQJ A;  2RQP A;  5KVR A;  3IH4 A;  1U2W A;  2OCE A;  3F8B A;  4QTR A;  5B5E C;  2XPU A;  3BG5 A;  4M71 A;  2UWM A;  2CUZ A;  3OYE A;  2DOE A;  1IRF A;  1W5S A;  1YW7 A;  2K86 A;  4EJW A;  4YEL A;  1U5T C;  2FML A;  2AS5 F;  4FET A;  1WJA A;  4O5V A;  2VQG A;  5HS9 A;  5E1W A;  1P7I A;  2PLY A;  2Y75 A;  1TTY A;  1Z3Y A;  5E8I A;  5GPA A;  2FQ3 A;  1JT0 A;  3C2H A;  2LFB A;  3QRF F;  3FBI B;  2H1K A;  2Y48 A;  4CXF A;  2NNY A;  2DMU A;  3GTK J;  1K6O A;  3S15 J;  2F48 A;  4F91 B;  4L0Z B;  1MDM B;  2QBY B;  3J80 Z;  3KZZ A;  2LC2 A;  3KLN A;  4HX7 A;  3MKZ A;  2O0Y A;  4L18 B;  3MWM A;  2W84 A;  1Y56 A;  3GFJ A;  3WTT C;  1PUE E;  3KYL A;  1XC5 A;  1EH7 A;  4CCM A;  2H1L A;  5LHH A;  2NVT J;  2CV2 A;  3JSP A;  3F8F A;  4N0B A;  2V1X A;  3MD2 A;  2P7C B;  1ZG5 A;  1WZ2 A;  1SFE A;  2VT2 A;  3KYD B;  3R6S A;  1AKH B;  4I0A A;  4XID A;  3FK7 A;  2RNJ A;  3V8L A;  4FHT A;  2EFW A;  1R00 A;  1SVM A;  3TED A;  3NAU A;  1R36 A;  1DUX C;  4CYC B;  1ZN2 A;  1OQY A;  2X51 A;  5EEG A;  4MTE A;  2ZME A;  5TGT A;  4CH7 A;  4BS9 A;  4L5I A;  1DPU A;  1Q1H A;  1QHH D;  4OIR F;  4Y3O A;  5JHF A;  3GFM A;  2DK5 A;  1AU7 A;  2DT5 A;  4DYQ A;  4LG3 A;  4D5F A;  1I27 A;  3MEX A;  1IN7 A;  1ONV A;  2JRM A;  1QZE A;  3ZQL A;  3CJR B;  3PNT A;  3CCS I;  5FD5 A;  3CUQ B;  4GGG A;  3N97 A;  1LEA A;  1B8I A;  2BOL A;  2FMY A;  4M3D A;  3ZMS A;  3JAM K;  2W4S A;  2FOK A;  2MH9 A;  1IRZ A;  1LUJ B;  3SEQ A;  3SFI A;  3SZP A;  2JVG A;  3CD6 I;  3CMY A;  3RTR A;  2JPB A;  1RZ4 A;  2VLA A;  1YOV B;  2CG4 A;  4XLH A;  2VBZ A;  4DIQ A;  1F4K A;  3CLQ A;  1YW9 A;  3GF2 A;  4BJT A;  2L54 A;  4WXC A;  4V19 K;  2PMZ A;  2OCC H;  4KFC A;  2X9D A;  2KZG A;  5DCM A;  3H3U A;  4CCO A;  3J7Y J;  4IOA F;  3E6C C;  3KX2 A;  3O8H A;  1WJD A;  2FX0 A;  4F92 B;  3GX4 X;  4HNV A;  4CCL A;  2W48 A;  2OU2 A;  5KCM A;  2V7F A;  5ICE A;  4P96 A;  2ISY A;  2HS5 A;  3W6V A;  3AKZ A;  3HKZ N;  4K2E A;  2B9S A;  2XKO A;  3QOD A;  3R60 A;  1SMY F;  1YJW I;  3BR0 A;  3OSG A;  3TW6 A;  4Q5S F;  2KZV A;  3I56 I;  2EIN H;  3PO3 J;  3BR5 A;  3VSK A;  3GTL J;  5C4X J;  1WPK A;  1S9H A;  3IHU A;  5EG0 B;  2L9S A;  2IGN A;  2X6Y A;  1F5T A;  1STZ A;  2FJ1 A;  2ELK A;  2DAO A;  2LMD A;  3K70 C;  4CZC A;  4JX5 A;  1OCP A;  1S7O A;  2E36 A;  3E5X A;  2M1B A;  4WXD A;  4UHT A;  4CSW A;  3ABL H;  3QYB A;  3EUA A;  3WTU C;  3B73 A;  1SVL A;  2HYG D;  5M5W J;  2F5E A;  3IH2 A;  4FAS D;  2IXS A;  2ZC2 A;  3K10 A;  4HQM A;  2D1H A;  2JQ7 A;  1ZRC A;  3CC4 I;  1Z9C A;  2CQQ A;  1LEB A;  2F6C A;  2P81 A;  4HA8 A;  2DOD A;  3JAM Z;  2R5Y B;  4HF0 A;  1ETX A;  2ESH A;  2LRD A;  4UVA A;  2WB1 A;  5FD6 A;  4AIK A;  4IHW A;  4HF1 A;  2DT6 A;  2LLK A;  3K1P A;  2R7X A;  1X3W B;  1H9T A;  4XKW A;  3W2A A;  3A0H C;  2EIM H;  4U0W A;  4AIJ A;  1IRX A;  1X2M A;  5FRN A;  2JSP A;  2VE9 A;  2CUF A;  5DM7 F;  2DXI A;  5F0F A;  5BPI A;  2CU7 A;  3HYI A;  1FEX A;  2P5K A;  2DOA A;  4MIM A;  1X2N A;  4BE1 A;  3HTU A;  3VSL A;  4GCV A;  3CZ6 A;  3I4M J;  5AIQ A;  2LP0 A;  1TBX A;  2ELH A;  3LSM A;  1D1A A;  1XSV A;  1I1G A;  2JUC A;  3SQN A;  2DPU A;  2XB5 A;  5IP9 J;  4Y17 A;  4CCJ A;  1HW5 A;  2H27 A;  2MSY A;  1IN4 A;  3WTZ A;  4ENN A;  3TP0 A;  4HLY A;  1YQA A;  3K69 A;  4EM0 B;  1WGX A;  3S8P A;  4CO8 A;  5E3L A;  4XQF A;  3PUB A;  4XKC A;  2CRG A;  4LLN A;  5CVV A;  3B6A A;  3PIO F;  1QO0 D;  1XCV A;  2X48 A;  1H88 C;  3UKG A;  2FOW A;  4ZYE A;  2DFF A;  4ZYG A;  1YIO A;  3P9K A;  4PSW A;  3R0J A;  3CDH A;  3TDZ C;  4OIP F;  1SFU A;  1MND A;  2KRC A;  3G3Z A;  2PMZ N;  4MLO A;  2A6H F;  1MD0 A;  5K7Z A;  2GZW A;  2FQ4 A;  3LWF A;  1VQ7 I;  3F72 A;  4FTH A;  4B8X A;  3KP7 A;  4ZH4 F;  2QGU A;  1ZGA A;  4HX8 A;  2GAU A;  2FNP A;  2K3F A;  3M07 A;  4U0V A;  4KMU X;  3WG7 H;  3ROU A;  2G9W A;  3H0D A;  3OYJ A;  1VQ6 I;  2XIG A;  2DFE A;  2PQ8 A;  2BY3 A;  1U6G A;  4RAZ A;  3KE2 A;  4KNY A;  5K7F A;  3DKY A;  3HOX J;  2IA1 A;  5LBQ A;  2GLO A;  1FYL A;  3IC7 A;  2QYO A;  3PM1 A;  3RDI A;  1TWF J;  1JT6 A;  4IRG A;  3ZQ7 A;  3ZOB A;  4CCK A;  3F9K A;  2XSD C;  3ABM H;  1LDK B;  4IXA A;  4MHG A;  3JRC A;  5FO5 A;  1JKP C;  2MH2 A;  3LA3 A;  3K1M A;  4U7B A;  1JKR C;  2K7L A;  5E3N A;  1J59 A;  1Z7L A;  2BBY A;  3BC8 A;  3CJT B;  2QWW A;  3Q9S A;  4BJ6 C;  1ZR2 A;  5J6X A;  4OMZ A;  1T0F C;  3LA2 A;  3ABT A;  1W1W E;  2ZKZ A;  4HV6 A;  1FP1 D;  2L5Q A;  4A3C J;  1YLF A;  1D3Y A;  1HKS A;  2L7F P;  4P5O A;  1U9O A;  1O3T A;  2K9S A;  1GXQ A;  3ZN1 A;  2JWT A;  3S1R J;  2WB1 N;  2MFZ A;  2M0M A;  2HXI A;  4AC0 A;  3TP3 A;  1DP7 P;  3AG4 H;  1MMD A;  1ZQ3 P;  5DDG A;  5LEK A;  1TQP A;  2HKO A;  1VI0 A;  2ME0 A;  4AYB A;  2IAI A;  1FYM A;  1FMV A;  4ZDL A;  5M3M J;  2JZY A;  1MMA A;  1Y0N A;  3L2R A;  1HC8 A;  1NK3 P;  1SAX A;  4B47 A;  2X1C A;  3EUH A;  1O7L A;  4F55 A;  1JHF A;  4LK1 F;  1D5Y A;  4DBR A;  1MH4 A;  1UG0 A;  4C2M J;  2K9Q A;  3BZC A;  3MZ8 A;  3F23 A;  2OV7 A;  4CZZ A;  2WAE A;  3ELK A;  3HHG A;  4MGR A;  1Z3X A;  5EGO B;  2CWE A;  2IP2 A;  3H0G J;  5IT9 K;  2QEN A;  2IBD A;  4Y4R A;  3TOA A;  2EZH A;  3BJO A;  4A3I J;  5IOY A;  3K70 D;  4IKF A;  2ISZ A;  2YS9 A;  3GFI A;  3KEY A;  1A31 A;  2WC2 A;  4B4C A;  2X6X A;  5BQT A;  5L3B A;  3LFU A;  2OZU A;  4XMY A;  1OR7 A;  2RKH A;  2HDC A;  1WVR A;  3F3X A;  2F4O B;  3LNQ A;  1YS7 A;  1ZEL A;  1A6I A;  3GFL A;  3K9T A;  3MCZ A;  4E6K G;  4ZC3 A;  3L2U A;  3FHN A;  4PFO A;  5DEQ A;  2R7F A;  1D1C A;  3F6V A;  1PP7 U;  1O4X A;  3VWB A;  3H9J A;  1P6R A;  1VQK I;  3NWS A;  1MMS A;  3WGG A;  2W7N A;  3GWZ A;  2V79 A;  2I8D A;  3GTP J;  3FMS A;  3ERM A;  2LK2 A;  2KKO A;  5BS6 A;  1IV6 A;  2XAG A;  3DV8 A;  2DA2 A;  1U78 A;  2TRT A;  1FBS A;  3W3C A;  3FF5 A;  5HNF A;  2LNB A;  1IJW C;  3HTS B;  1UHW A;  4OAZ A;  4QIW N;  2D45 A;  2VON A;  4FE4 A;  4P9F A;  3I54 A;  4IHT A;  3VYR B;  2FSW A;  2LYC A;  5GAD J;  5J8C A;  1BA5 A;  3F22 A;  2EZK A;  3FXM A;  2L02 A;  2HKX A;  2L7Z A;  4OU0 A;  4I76 A;  2F5V A;  4E70 A;  4MFD A;  4EM1 A;  3KCC A;  4EJT A;  2CQK A;  2MAB A;  1U5T A;  2YR2 A;  1P4X A;  1BOA A;  1ACI A;  3RZO J;  3CCQ I;  1P9Q C;  3QU6 A;  4WWC A;  2RRE A;  5ICG A;  1AA7 A;  1AWC A;  4L9J A;  1S6L A;  5F1J A;  1APL C;  1TWA J;  5DD8 A;  2MA3 A;  3K4N A;  1ZKG A;  2FD5 A;  1XGS A;  4BBR J;  2OA4 A;  2CFX A;  4UVB A;  5L3E A;  2EA4 A;  1K61 A;  4R79 A;  5IT9 Z;  2NS7 A;  3WHB A;  3E1S A;  3FXJ A;  1P7J A;  4I2O A;  2ID6 A;  4NC8 A;  3V8K A;  3JRF A;  2EZL A;  2A68 F;  1HKQ A;  2WAD A;  4QSH A;  5LRS A;  3J7A Y;  2LRE A;  3L1P A;  2D2W A;  2GIZ A;  3G4S I;  2Q2E B;  1FPQ A;  5D8K B;  4XKB A;  4LJZ F;  5E17 F;  2KIU A;  3OSF A;  1EA3 A;  1T08 B;  2HTS A;  3S1M J;  2KIQ A;  1DDN A;  3EDP A;  1Z05 A;  3O2P E;  4DQ2 A;  3ECH A;  1XPX A;  1VF9 A;  1LJ9 A;  1WJE A;  4F93 B;  2EJR A;  2UZK A;  1J9I A;  3L2C A;  2ZBK A;  2PMH A;  3I4N J;  2J5P A;  5AIP A;  2M9H A;  1B59 A;  2ZXI A;  4AYB N;  1UG2 A;  2Z33 A;  5D6E A;  4M3F A;  1VQ4 I;  4B1R A;  2XVC A;  1UB9 A;  1IRG A;  3FX3 A;  5HNH A;  1X1A A;  2RC4 A;  3WTV C;  3CCL I;  2AXT C;  2EFO A;  1OCT C;  2DN0 A;  3COA C;  1K7A A;  3CUO A;  3K4L A;  4ESB A;  1RI7 A;  2BY2 A;  4W1U A;  2OTL I;  4FCY A;  4EV0 A;  3FXR A;  4RB0 A;  1B72 A;  1FSH A;  2R5Z B;  3ZMZ A;  2YU9 J;  1BI0 A;  1WRJ A;  2GBY A;  2DDA A;  2VJJ A;  3BTI A;  3L2V A;  1YO5 C;  4Y13 A;  4RLQ A;  2XUB A;  1PP8 F;  3HRM A;  4IL6 C;  2WV1 A;  4HZF A;  3CF2 A;  1M1E B;  2OF7 A;  3K4M A;  3BQY A;  1FOX A;  1ZLK A;  5F27 A;  1WWX A;  4GXO A;  3BJ6 A;  1XTA A;  2JRT A;  2DA1 A;  4CA0 A;  1R5H A;  2VKE A;  3GCM A;  4XKV A;  1G3Y A;  1EKE A;  1WI3 A;  3CP2 A;  1ETV A;  2ZJQ F;  4UVC A;  2UXX A;  3DEE A;  3DTI A;  1IAW A;  1X1B A;  2MYS A;  4IJA A;  2X6O A;  4BHP A;  3IP4 B;  4NQW A;  2X4H A;  4WCG A;  2V1N A;  2ZXW H;  1LNW A;  1OIS A;  2L7K A;  2ICW G;  1LFP A;  5F0H A;  2F5D A;  3J7Z I;  2WWY A;  1SFO J;  3H3V K;  2E1M C;  4BKX A;  2O3F A;  2X6W A;  1FOY A;  3BZ6 A;  3V7S A;  1KQ8 A;  1OLT A;  3RI4 A;  1ZLJ A;  3TO6 A;  2B0L A;  4O3M A;  3X2Q H;  4G6T B;  4G94 A;  1R1U A;  3MN2 A;  2XV4 S;  4KIF A;  4LIU A;  3HOU J;  4CDG A;  4A3B J;  1G3S A;  2KDZ A;  1UST A;  4YFK F;  4A93 J;  3OV8 A;  2UXN A;  1MGT A;  5EF6 A;  5CVU A;  1RC9 A;  3ZR8 X;  1YRN A;  4BNC A;  2JA5 J;  2F5C A;  1FBU A;  4HOB A;  2EK5 A;  2L0K A;  1B6A A;  3BLY A;  3JCU C;  1Y0U A;  2KJC A;  2BXZ A;  3BG7 A;  3WU2 C;  4G9Y A;  1SEU A;  2J5O A;  3PFY A;  1MNM C;  4KYW A;  2XF5 A;  4M73 A;  2R7D A;  5IP6 A;  4XL9 A;  5CQG A;  1FIA A;  1WH5 A;  3U9G A;  2ZME B;  3NRV A;  1BI3 A;  1E3P A;  4A0Z A;  3R61 A;  3UR3 C;  1JUP A;  2EV0 A;  1UEL B;  2GIV A;  1UMQ A;  1WJB A;  2VJ5 A;  5CQE A;  5A2Q K;  2GXG A;  4RB3 C;  1HBX G;  5BOX A;  1NK2 P;  1MJB A;  2QQB A;  5DV5 A;  5D4R A;  3LSP A;  2D5V A;  2F4M B;  3ESW B;  5E1Z B;  1RIO H;  4PJN A;  1JTX A;  3BG3 A;  5K5Q A;  1B8I B;  1DP3 A;  2X1D A;  2DA6 A;  1U0J A;  4J01 A;  3D5L A;  3NWT A;  5D5V B;  4HRI A;  2Y0M A;  4OWR B;  2JT1 A;  4UV9 A;  4BGD A;  3KLO A;  4EJO A;  1GVJ A;  4A12 A;  3QP6 A;  1FBQ A;  1O57 A;  1WH7 A;  1R5G A;  1W36 C;  5KNL A;  3BT9 A;  2CV0 A;  4ZZD A;  3GYH X;  2HTJ A;  2Z99 A;  4RB2 C;  2EIK H;  3ABK H;  3HOZ J;  3C3W A;  2VOD A;  4DOZ A;  1FYK A;  1HDP A;  2XPV A;  3G71 I;  4XRF A;  1RPW A;  5DCM B;  4RB1 A;  4M6V A;  1R1T A;  2IS2 A;  1XX5 A;  4BH9 A;  3HBL A;  1V5E A;  4PJJ A;  1YTY A;  1H89 C;  3SDB A;  4HDV A;  2E7X A;  2XGD A;  1W0T A;  4M9Z A;  1BN5 A;  1S7E A;  3WOD F;  4IPA A;  2EV5 A;  2JA8 J;  4BJ5 C;  4KT5 C;  4R8H A;  2OQG A;  2LF7 A;  2V9V A;  2KRH A;  2FE3 A;  4EEF G;  2M7B A;  3HB9 A;  3LSH A;  2Z5U A;  4JQF A;  1Z1D A;  2K02 A;  2KT0 A;  3K2Z A;  2XF6 A;  4NBQ A;  1OCC H;  4RM3 A;  1SAN A;  3K7A J;  5J1U A;  3ECO A;  3DBL B;  3DEU A;  3I55 I;  5A2Q Z;  2ZXJ A;  3OIQ A;  1QGP A;  5FGM A;  2IRF G;  1I39 A;  2YX7 A;  3ZMU A;  1QPI A;  1YX3 A;  1XN7 A;  4YRV A;  4QWQ A;  1BC7 C;  2E1C A;  1X58 A;  4BXU A;  1I6H J;  2K4J A;  5GAH J;  4KT6 A;  3K4B A;  4AU7 A;  1VFC A;  3G1M A;  4EJU A;  2HQR A;  2K27 A;  3FXK A;  3OYA A;  4RLF A;  2ZXH A;  1BJZ A;  3HL2 A;  3FIS A;  5TRD A;  3E5Q A;  2Y30 A;  1ORK A;  3PSF A;  4W97 A;  3U21 A;  5E8G A;  1YHQ I;  4DZJ A;  2A6E F;  5HS8 A;  1DQU A;  4BU2 A;  3R4K A;  3LSI A;  3HDD A;  4IHV A;  2M0C A;  3QQA A;  3T8T A;  1KYW A;  2Y9Y A;  4A0Y A;  1AOY A;  2JSC A;  5H2F C;  3EUK L;  1FP2 A;  2Z1D A;  3BQZ A;  4XSX F;  4KJZ A;  1JXS A;  2XSJ C;  5FKK A;  3ZQF A;  1WI9 A;  2M30 A;  2H09 A;  4LIV A;  3P9I A;  1SD6 A;  1ETK A;  3S14 J;  2BHY A;  2KLO A;  1W5C C;  2EIL H;  1RET A;  2LR8 A;  4M74 A;  5HDG A;  4D5C A;  3KEQ A;  1Z7U A;  1F36 A;  4BYY A;  4A3K J;  1JKO C;  2HPM A;  2H8W A;  3CP8 A;  5LD2 C;  3H1C A;  4BQA A;  1L0O C;  2LY2 A;  4BAC A;  2CJJ A;  1NTC A;  1KU3 A;  1BM9 A;  2RV8 A;  4BHB A;  1LE8 A;  3S2H J;  4ENJ A;  5GAE J;  4O6J A;  2O6G E;  2DYR H;  4D7N A;  4IHY A;  1R49 A;  2K4B A;  3OY9 A;  2VPR A;  4GO1 A;  3E3V A;  3FMR A;  2M4G A;  1TQM A;  2BYV E;  5DUI A;  3W2V A;  5EZH A;  3S2D J;  2LOO A;  3AG1 H;  1BR2 A;  1S29 A;  2STT A;  4EQQ A;  1X3U A;  1MBH A;  4XN0 A;  3M8E A;  4UB6 C;  1Y8Q B;  1X4P A;  2FF4 A;  2XPW A;  1K6Y A;  2HOA A;  2WTE A;  3DPT A;  2LBF A;  4ZYA A;  3HSF A;  1JGG A;  1Z77 A;  4LG0 A;  2OPT A;  5DCF A;  3DP7 A;  4D1Q A;  2KQR A;  3L2Q A;  3GZ6 A;  1YIJ I;  1RR8 C;  1P4W A;  2VC0 A;  3DBH B;  2LKS A;  3ZPL A;  2JA2 A;  4U7D A;  2XRN A;  3V8J A;  3JRD A;  2R0Q C;  2OBP A;  3DBR B;  3JRG A;  3BPX A;  1JJ6 C;  3EYY A;  4HX4 A;  4AVP A;  2LY9 A;  4Z6Y A;  5HLT A;  3Q0W A;  4PUS A;  1JGS A;  1XG1 A;  3H92 A;  4F3Q A;  5F04 A;  2ZB9 A;  5E18 F;  4BE2 A;  3M1C A;  3Q0U A;  3BG9 A;  4I01 A;  1S8N A;  2C6Y A;  5CLS A;  1Y1V J;  2LD5 A;  2HDW A;  2WY8 Q;  4NUB A;  4KMF A;  4M6X A;  3FMQ A;  4CIC A;  5CKT A;  1I3A A;  1WKM A;  3L7W A;  2O8X A;  3O8G A;  5D6F A;  2KL4 A;  1W36 D;  4MTD A;  4C9Y A;  3FHZ A;  1BJA A;  1F9N A;  3KP2 A;  3VB2 A;  2OD5 A;  3HGG A;  4DYC A;  1K4S A;  2IPQ X;  4DGW B;  2VBW A;  2FRH A;  4EGZ A; 
#chains in the Genus database with same CATH homology
 3E6M A;  4UXN A;  1O3R A;  2NRA C;  2LF8 A;  4A5M A;  2HWV A;  2WV0 A;  1QBJ A;  3K0L A;  1P4A A;  1D5V A;  4XSZ F;  2FBH A;  5K1Y A;  3LQQ A;  3QAH A;  4JK1 X;  4CGZ A;  4YFN F;  5BMZ A;  2XRO A;  1KGS A;  1B9M A;  5L3G A;  3IRQ A;  5JVT A;  4I0B A;  4Q48 A;  1MJ9 A;  3MFK A;  2QQA A;  2PI0 A;  1IN6 A;  2EA2 A;  2PJP A;  2IA0 A;  1FT9 A;  3DKW A;  3IKV A;  5CYV A;  4G6Q A;  2DPD A;  4OMY A;  4HAM A;  2HR3 A;  4HW0 A;  2OZ6 A;  3HUG A;  3HSR A;  3RIR A;  4FX0 A;  3WTX C;  3JTH A;  3T8R A;  4ENK A;  1U5T B;  3O3K A;  4WK8 F;  3VEP A;  3ZN0 A;  3HHH A;  2RVC A;  2IW5 A;  1RNL A;  2PG4 A;  4PZJ A;  1IW7 F;  3M1E A;  2ESN A;  3KET A;  1K78 A;  2HGC A;  5LGU A;  3GUD A;  3QPH A;  1XMK A;  4I98 B;  2GA1 A;  1P2F A;  2CYY A;  1U3E M;  2O61 A;  2V6C A;  1UCR A;  3SFZ A;  3TQN A;  2F5F A;  1B4A A;  5DD4 A;  3P7N A;  1XSX A;  3PQK A;  1FZP B;  3PQJ A;  3DXJ F;  1KQ9 A;  3U1D A;  1LDJ A;  4XLP F;  4PCQ A;  3HIF A;  4ETS A;  2FU4 A;  5HS7 A;  2VBX A;  3PFI A;  4PDK A;  2TDX A;  4A2U A;  2P6T A;  3SXY A;  5HVQ C;  3I53 A;  3I5U A;  3WE2 A;  1EH6 A;  2EB7 A;  2JPC A;  2BGC A;  2VN2 A;  3T5X A;  3AAF A;  1Z6T A;  2XAF A;  1V3F A;  2LKP A;  3Q5F A;  3IKT A;  3JW4 A;  1TW3 A;  4N9I A;  3DPL C;  4Q4Z F;  1GHC A;  1SD7 A;  1ZAO A;  3T1B A;  4LGW A;  1I6X A;  2HYF A;  5LRR A;  4FX4 A;  4KIC A;  2KIF A;  3JSO A;  3BOQ A;  1OYW A;  1H0M A;  3HOS A;  2YX4 A;  1VTN C;  1CF7 A;  4LD5 A;  2NNN A;  3TKY A;  2F2E A;  2ZFW A;  1YG2 A;  1WSU A;  3MZY A;  3EQL F;  4H0E A;  2VOP A;  3D0S A;  5ILV A;  2ADU A;  3L00 A;  1SFX A;  1FSE A;  3V4G A;  1I1S A;  3IRR A;  1G6N A;  4MNU A;  4A5N A;  2DO7 A;  5FFX A;  1W7P D;  4WF2 A;  3WU1 B;  2QUF A;  3RPQ A;  1J75 A;  2KJB A;  3Q9V A;  2W57 A;  2XAJ A;  3C1D A;  1TNS A;  3P9C A;  4ESJ A;  2W85 A;  2PFB A;  2A07 F;  2DQR A;  1QPM A;  4OIQ F;  2V1D A;  2P6S A;  4FT8 A;  1EH8 A;  3KP6 A;  1O3Q A;  2FNA A;  1UHM A;  2CO5 A;  2XAH A;  1FX7 A;  3U2R A;  2ACJ A;  2O03 A;  3F6O A;  1XDS A;  3CUQ C;  4HF2 A;  4A6E A;  1QZY A;  2NS0 A;  4KIG A;  5LGT A;  5K5O A;  2M87 A;  1V4R A;  4KN7 X;  3LAP A;  4L9T A;  5EEH A;  1KA8 A;  4XLN F;  3NEU A;  2QLZ A;  3RKX A;  1ZG3 A;  1FC3 A;  4A0X A;  5BPD A;  2DBB A;  5L3F A;  3ULQ B;  1I5Z A;  3ERE D;  4ZYH A;  3C7J A;  5ILS A;  4MEX F;  3J7A O;  1OYI A;  4L0Y B;  4LB5 A;  4P55 A;  5HDN A;  4ESF A;  2OQR A;  2NAZ A;  3W6K B;  1OYY A;  3MZH A;  4U88 A;  3HOT A;  3CO7 C;  4ENM A;  5AON A;  2HFH A;  4KIB A;  3QPT A;  1ODD A;  5D5W B;  4M72 A;  3HRT A;  4PGH A;  2ZO4 A;  1ZG1 A;  5IT3 A;  2A61 A;  1R1V A;  5F1R A;  5H20 A;  2P4W A;  4G7Z F;  2MLK A;  2E7W A;  3BP8 A;  4HV5 A;  3V7R A;  2LDU A;  3BY6 A;  4KA4 A;  1FWZ A;  3GEZ A;  2E1N A;  4UV8 A;  3KEO A;  1W7P A;  1T2K A;  3QU3 A;  1SD5 A;  2GWR A;  2IA2 A;  4LG0 B;  2EFQ A;  3GO5 A;  2FBK A;  5H6R A;  1TQI A;  3M7G A;  4GYG A;  1KQ0 A;  3BRO A;  4NHJ A;  1XGM A;  5E20 A;  2H6C A;  5CJ9 A;  1BBY A;  2QZ8 A;  1YFH A;  5JR3 A;  2EFN A;  3WGI A;  2M45 A;  2W25 A;  1R7J A;  1MJA A;  1S7A A;  3M9A A;  1KU2 A;  2M5W A;  3H3Z A;  3KP4 A;  1TNT A;  4D0P A;  1ZAR A;  1G3T A;  1J5Y A;  3BPV A;  4BAY A;  4ASN A;  5D5U B;  1R22 A;  2P5V A;  2MBF A;  1IZ1 A;  3LA7 A;  3TGN A;  3O6B B;  4IRI A;  1KU9 A;  3TDU C;  3SZT A;  4M9S A;  3K1N A;  4L9N A;  2V1U A;  3EYI A;  2Q8K A;  2STW A;  3TO9 A;  1T0F A;  2BEO A;  4HBL A;  1ON1 A;  1XSD A;  4M9X A;  3I59 A;  1HKT A;  2XAS A;  1IXR C;  4LLL A;  4MEY F;  1G3W A;  4QLC U;  1XGO A;  3KFW X;  3ML6 A;  3TO7 A;  2CSO A;  2VE8 A;  1JHH A;  1QNT A;  2VOO A;  3WE3 A;  4U0Y A;  1YS6 A;  5DYM A;  1XGN A;  2VXZ A;  3DFG A;  3G73 A;  2FEZ A;  3C18 A;  2VT3 A;  2Z3Y A;  3I64 A;  3DQV C;  2W24 A;  1REP C;  3T0Y A;  1G4D A;  2EFP A;  5JHU A;  1P92 A;  4CHU A;  1B9N A;  4CYD A;  2M8E A;  1XDU A;  2BE5 F;  4WX9 A;  2YSR A;  2L3D A;  3WTY C;  1YYV A;  3GZ5 A;  3CJN A;  3ZMD A;  5K5R A;  3E6D A;  3I0T A;  3VOE A;  1BI1 A;  1Z91 A;  1ULY A;  1K78 B;  5J8F A;  3IWZ A;  1TLH B;  4MQ9 F;  1ZH5 A;  3ZMT A;  2DK8 A;  4IHS A;  5F6F A;  4DNC A;  1PDN C;  1UFM A;  6PAX A;  3WGH A;  4G8X A;  2IJL A;  2L01 A;  3I4P A;  1XCB A;  5FLX K;  1MDM A;  2QBY A;  4BHC A;  5L3D A;  5D5X B;  3WU0 A;  2FXA A;  1LDD A;  4B09 A;  2RGV A;  3L09 A;  4RGR A;  1OKR A;  3FWE A;  3N4M A;  2DTR A;  4I02 A;  4EM2 A;  4RAY A;  4I09 A;  4HDU A;  1HXD A;  2DLL A;  3W6J B;  1KU7 A;  1NHA A;  4HQE A;  3LST A;  1J7K A;  1IXS B;  1T39 A;  5ED4 A;  2COM A;  3J81 K;  3CUQ A;  3FZV A;  4LLG F;  1SMT A;  4YII A;  2IT0 A;  1W4M A;  2HEO A;  2D1V A;  2JTV A;  3MQ0 A;  5HLH A;  5HLI A;  1DPR A;  1BI2 A;  1SD4 A;  3L9F A;  1A04 A;  1CF7 B;  3LFK A;  2GQQ A;  1K79 A;  2YPR A;  3JTG A;  3FXQ A;  2DW4 A;  5FLX Z;  3DF8 A;  4YG2 F;  2YU3 A;  1LVA A;  3KZY A;  4LFU A;  1W5T A;  3F8C A;  4KUM A;  5H6Q A;  4JBA A;  5FFZ A;  2DU9 A;  3FM5 A;  1HQC A;  2R3S A;  2PEX A;  1C0W A;  2DI3 A;  4LB6 B;  3RYP A;  2NYX A;  1IN5 A;  1T6S A;  2XAQ A;  5KK1 A;  2GA2 A;  2MLG A;  1FNN A;  2MD5 A;  2G7H A;  4RS8 A;  1RUO A;  4F7Z A;  4YIF A;  3KP3 A;  1LB2 A;  3J81 Z;  2AXL A;  5HLG A;  4KN4 X;  4KDP A;  1CGP A;  1JE8 A;  5HOO A;  3V7C A;  2VC1 A;  4OOI A;  2QQ9 A;  3VFZ A;  1J2X A;  3CO6 C;  1HSJ A;  1ZRF A;  3FM3 A;  2EV6 A;  1ZRE A;  2ZNY A;  3VOD A;  3GLX A;  3RJP A;  2ZNZ A;  4Q47 A;  3SHF A;  2LSO A;  2IVM A;  4M6Y A;  1EV7 A;  1BIB A;  2HQN A;  4Y15 A;  3ZP5 A;  2HZT A;  3F8M A;  2A69 F;  3RYR A;  5ILU A;  3NQO A;  5LLQ A;  3ABU A;  1OMI A;  5E1X A;  1OPC A;  1GXP A;  1U8R A;  1D8K A;  1ZRD A;  1S3J A;  1O3S A;  5LHI A;  3QOP A;  4TV7 A;  2FA5 A;  1XD7 A;  4MQV A;  2L4A A;  4LK0 F;  3BWG A;  4OIN F;  4S04 A;  3FXU A;  2QVO A;  1HST A;  4RGU A;  4WXH A;  4I7H A;  3B02 A;  1J0R A;  1TW2 A;  4ZYD A;  4EJV A;  4L5J A;  3CLO A;  2X0L A;  2P7V B;  5LEJ A;  1IUY A;  2Z9O A;  3E6B A;  4G7H F;  3IL2 A;  1USS A;  4GYI A;  1QQI A;  2HOE A;  4HLX A;  1H9G A;  2PMU A;  2EWN A;  4YFX F;  3RKW A;  1BIA A;  5F64 A;  3REO A;  3I58 A;  1FOK A;  1W7P B;  2BV6 A;  5D4S A;  4G6D A;  5L3C A;  2A5Y B;  3GW2 A;  2KRF A;  3GXO A;  3WTW C;  3HRS A;  1T98 A;  3HRU A;  3S2W A;  1BC8 C;  2ETH A;  4S05 A;  1RUN A;  4Z2Y A;  4IF4 A;  2XKP A;  3R0A A;  3I71 A;  3KP5 A;  4IVN A;  4UNO A;  3E97 A;  1T38 A;  1LQ1 A;  2CGP A;  2RDP A;  3GVA A;  4AD9 A;  3F21 A;  4G7O F;  1XB4 A;  4LMY A;  2DFI A;  5ICF A;  2P8T A;  2MC3 A;  1B1B A;  3CTA A;  3EET A;  4EVI A;  5CVJ A;  2VBY A;  5FB2 A;  1R58 A;  5LGN A;  1L3L A;  2P5L C;  2XGX A;  3M8F A;  2ZCW A;  1YW8 A;  5ICC A;  4A6D A;  2A3S A;  4EMS A;  3ZMV A;  4N9H A;  3MAJ A;  1IN8 A;  4EGY A;  4ON0 A;  3RKY A;  2L4M A;  1O7F A;  3BDD A;  2ZJ2 A;  4ZZL A;  3WG9 A;  4UUV A;  4RGS A;  5DUK A;  4P9U A;  2XHK A;  1Z6R A;  3BJA A;  1F1Z A;  4AIH A;  5JI6 A;  1IXC A;  3I59 B;  5HDK A;  1HW1 A;  4NB5 A;  1D8J A;  3HSE A;  4L9V A;  4OIO F;  3RPU A;  2H94 A;  2OAZ A;  3LQR A;  5JFR A;  1ZYR F;  4R1H A;  4PGG A;  1KYZ A;  5CVI A;  2Q0O A;  1IF1 A;  1MKM A;  3F8N A;  2G7U A;  1HW2 A;  2RN7 A;  2QM3 A;  2Q2E A;  2DQL A;  1FY7 A;  3IWF A;  3LAJ A;  3ISP A;  3OOP A;  2PBI A;  3J80 K;  3TOB A;  1FLI A;  1MZB A;  1ZHF A;  5ERI A;  4HYE A;  2CW0 F;  2KIM A;  2H6B A;  4RGX A;  5LHG A;  5D8L B;  1ON2 A;  3E5U A;  4IRH A;  5CVR A;  1WQ2 A;  1ZGJ A;  2FBI A;  3WTS C;  4XBF A;  1E2X A;  1R23 A;  5TJJ A;  1QZZ A;  4AWX B;  3QP5 A;  1E17 A;  2PN6 A;  1XMA A;  2RQP A;  5KVR A;  1U2W A;  3F8B A;  4M71 A;  2UWM A;  1IRF A;  1W5S A;  1YW7 A;  2K86 A;  4EJW A;  1U5T C;  2FML A;  2AS5 F;  5HS9 A;  4O5V A;  5E1W A;  2PLY A;  2Y75 A;  1TTY A;  5E8I A;  2FQ3 A;  3QRF F;  2Y48 A;  4CXF A;  2NNY A;  1K6O A;  4L0Z B;  1MDM B;  2QBY B;  3J80 Z;  3KZZ A;  3KLN A;  4HX7 A;  2O0Y A;  4L18 B;  3MWM A;  2W84 A;  3GFJ A;  3WTT C;  1PUE E;  1EH7 A;  5LHH A;  3JSP A;  3F8F A;  4N0B A;  2V1X A;  2P7C B;  1ZG5 A;  1SFE A;  2VT2 A;  3R6S A;  4I0A A;  2RNJ A;  3V8L A;  4FHT A;  2EFW A;  1R00 A;  1R36 A;  1DUX C;  1ZN2 A;  5EEG A;  4MTE A;  2ZME A;  1DPU A;  4L5I A;  1Q1H A;  4OIR F;  3GFM A;  2DK5 A;  2DT5 A;  1I27 A;  3MEX A;  1IN7 A;  1ONV A;  5FD5 A;  3CUQ B;  4GGG A;  3N97 A;  1LEA A;  2FMY A;  3ZMS A;  3JAM K;  2FOK A;  2MH9 A;  3SZP A;  3RTR A;  2JPB A;  1RZ4 A;  2CG4 A;  2VBZ A;  1F4K A;  3GF2 A;  1YW9 A;  2L54 A;  4WXC A;  4KFC A;  5DCM A;  3H3U A;  3E6C C;  3GX4 X;  2OU2 A;  5ICE A;  4P96 A;  2ISY A;  2HS5 A;  4K2E A;  2XKO A;  3R60 A;  1SMY F;  4Q5S F;  3IHU A;  1F5T A;  1STZ A;  2DAO A;  1S7O A;  3E5X A;  2M1B A;  4WXD A;  4UHT A;  3WTU C;  3B73 A;  2HYG D;  2F5E A;  4HQM A;  2D1H A;  1LEB A;  1ZRC A;  1Z9C A;  4HA8 A;  3JAM Z;  4HF0 A;  2ESH A;  4UVA A;  5FD6 A;  4AIK A;  4HF1 A;  3K1P A;  1H9T A;  4U0W A;  4AIJ A;  2VE9 A;  5BPI A;  3HYI A;  2P5K A;  3HTU A;  4GCV A;  5AIQ A;  1TBX A;  2ELH A;  1XSV A;  1I1G A;  3SQN A;  2DPU A;  4Y17 A;  1HW5 A;  2H27 A;  1IN4 A;  3WTZ A;  4ENN A;  4HLY A;  1YQA A;  3K69 A;  4EM0 B;  4CO8 A;  4LLN A;  5CVV A;  1QO0 D;  1XCV A;  4ZYE A;  4ZYG A;  1YIO A;  3P9K A;  3R0J A;  3CDH A;  3TDZ C;  4OIP F;  1SFU A;  3G3Z A;  2A6H F;  1MD0 A;  2GZW A;  3LWF A;  3F72 A;  4B8X A;  3KP7 A;  4ZH4 F;  1ZGA A;  4HX8 A;  2GAU A;  2FNP A;  4U0V A;  2GXB A;  4KMU X;  3ROU A;  2G9W A;  2XIG A;  2PQ8 A;  1U6G A;  4RAZ A;  3KE2 A;  4KNY A;  2IA1 A;  5LBQ A;  1FYL A;  3IC7 A;  2QYO A;  3RDI A;  4IRG A;  3ZQ7 A;  1LDK B;  4IXA A;  4MHG A;  5FO5 A;  2MH2 A;  3LA3 A;  3K1M A;  4U7B A;  2K7L A;  1J59 A;  2BBY A;  2QWW A;  3Q9S A;  5J6X A;  4OMZ A;  3LA2 A;  3ABT A;  2ZKZ A;  4HV6 A;  1FP1 D;  1YLF A;  1D3Y A;  1HKS A;  4P5O A;  1O3T A;  1GXQ A;  3ZN1 A;  1DP7 P;  5DDG A;  5LEK A;  1TQP A;  2HKO A;  1FYM A;  2JZY A;  1SAX A;  3EUH A;  1O7L A;  1JHF A;  4LK1 F;  3F23 A;  4CZZ A;  3ELK A;  3HHG A;  4MGR A;  2CWE A;  2IP2 A;  5IT9 K;  2QEN A;  3TOA A;  3BJO A;  2ISZ A;  3GFI A;  2WC2 A;  5BQT A;  5L3B A;  2OZU A;  1OR7 A;  2RKH A;  2HDC A;  3F3X A;  1YS7 A;  3GFL A;  3K9T A;  3MCZ A;  5DEQ A;  2R7F A;  3F6V A;  1PP7 U;  1P6R A;  3WGG A;  3GWZ A;  2V79 A;  3FMS A;  2KKO A;  5BS6 A;  2XAG A;  3DV8 A;  1U78 A;  1FBS A;  3FF5 A;  2LNB A;  3HTS B;  1UHW A;  2D45 A;  2VON A;  4P9F A;  3I54 A;  4IHT A;  2FSW A;  5J8C A;  3F22 A;  2L02 A;  2HKX A;  4OU0 A;  4E70 A;  4EM1 A;  3KCC A;  4EJT A;  2CQK A;  1U5T A;  2YR2 A;  1P4X A;  1BOA A;  3QU6 A;  4WWC A;  5ICG A;  1AWC A;  4L9J A;  1S6L A;  5DD8 A;  2MA3 A;  1XGS A;  2OA4 A;  2CFX A;  4UVB A;  5L3E A;  2EA4 A;  4R79 A;  5IT9 Z;  4I2O A;  3V8K A;  2A68 F;  1HKQ A;  5LRS A;  2D2W A;  1FPQ A;  5D8K B;  5E17 F;  4LJZ F;  2KIU A;  2HTS A;  1DDN A;  3EDP A;  1Z05 A;  3O2P E;  4DQ2 A;  3ECH A;  1LJ9 A;  2EJR A;  2UZK A;  1J9I A;  3L2C A;  2ZBK A;  2PMH A;  2J5P A;  5AIP A;  1B59 A;  2Z33 A;  5D6E A;  2XVC A;  1UB9 A;  1IRG A;  3FX3 A;  2RC4 A;  3WTV C;  2EFO A;  3COA C;  1K7A A;  3CUO A;  4ESB A;  1RI7 A;  4EV0 A;  3FXR A;  4RB0 A;  1FSH A;  3ZMZ A;  1BI0 A;  1WRJ A;  1YO5 C;  4Y13 A;  2XUB A;  1PP8 F;  3HRM A;  4HZF A;  1ZLK A;  1WWX A;  4GXO A;  3BJ6 A;  2JRT A;  1R5H A;  1G3Y A;  4UVC A;  2UXX A;  1IAW A;  4IJA A;  4BHP A;  4NQW A;  2X4H A;  4WCG A;  1LNW A;  2F5D A;  2WWY A;  2O3F A;  3BZ6 A;  3V7S A;  1KQ8 A;  3RI4 A;  1ZLJ A;  3TO6 A;  2B0L A;  4O3M A;  4G94 A;  1R1U A;  2XV4 S;  4KIF A;  4CDG A;  1G3S A;  1UST A;  4YFK F;  3OV8 A;  2UXN A;  1MGT A;  5CVU A;  4BNC A;  2F5C A;  1FBU A;  4HOB A;  2EK5 A;  1B6A A;  1Y0U A;  2KJC A;  4G9Y A;  2J5O A;  4KYW A;  4M73 A;  2R7D A;  3U9G A;  2ZME B;  3NRV A;  1BI3 A;  4A0Z A;  3R61 A;  2EV0 A;  2GIV A;  5A2Q K;  1HBX G;  2GXG A;  4RB3 C;  5BOX A;  1MJB A;  2QQB A;  5DV5 A;  5D4R A;  1RIO H;  5E1Z B;  5K5Q A;  3D5L A;  5D5V B;  2Y0M A;  2JT1 A;  4UV9 A;  3KLO A;  4EJO A;  1GVJ A;  4A12 A;  3QP6 A;  1FBQ A;  1O57 A;  1R5G A;  4ZZD A;  3GYH X;  2HTJ A;  2Z99 A;  4RB2 C;  3C3W A;  2VOD A;  1FYK A;  4XRF A;  5DCM B;  4RB1 A;  1R1T A;  4BH9 A;  1YTY A;  4HDV A;  2E7X A;  4M9Z A;  1BN5 A;  3WOD F;  4IPA A;  2EV5 A;  4KT5 C;  4R8H A;  2OQG A;  2LF7 A;  2V9V A;  2FE3 A;  2Z5U A;  4JQF A;  1Z1D A;  2K02 A;  3K2Z A;  3ECO A;  3DEU A;  5A2Q Z;  2ZXJ A;  1QGP A;  5FGM A;  2IRF G;  2YX7 A;  3ZMU A;  1XN7 A;  4QWQ A;  1BC7 C;  2E1C A;  4BXU A;  2K4J A;  4EJU A;  2HQR A;  2K27 A;  5TRD A;  3E5Q A;  5E8G A;  2A6E F;  5HS8 A;  3R4K A;  3T8T A;  1KYW A;  4A0Y A;  1AOY A;  2JSC A;  1FP2 A;  4XSX F;  1JXS A;  1WI9 A;  2M30 A;  2H09 A;  3P9I A;  1SD6 A;  4M74 A;  5HDG A;  3KEQ A;  1Z7U A;  4BYY A;  4BQA A;  1L0O C;  1KU3 A;  1BM9 A;  2RV8 A;  4BHB A;  4ENJ A;  4O6J A;  2O6G E;  2K4B A;  4GO1 A;  3E3V A;  3FMR A;  1TQM A;  2BYV E;  5DUI A;  1S29 A;  2STT A;  4EQQ A;  1X3U A;  3M8E A;  2FF4 A;  2WTE A;  3DPT A;  3HSF A;  4LG0 A;  5DCF A;  3DP7 A;  3GZ6 A;  1P4W A;  2VC0 A;  3ZPL A;  4U7D A;  2XRN A;  3V8J A;  2OBP A;  3BPX A;  3EYY A;  4HX4 A;  4AVP A;  1JGS A;  3H92 A;  5E18 F;  4I01 A;  1S8N A;  2C6Y A;  5CLS A;  4KMF A;  4M6X A;  3FMQ A;  4CIC A;  1WKM A;  3L7W A;  2O8X A;  5D6F A;  4MTD A;  3FHZ A;  1BJA A;  1F9N A;  3KP2 A;  3VB2 A;  2OD5 A;  2IPQ X;  2VBW A;  2FRH A;  4EGZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...