1PP8F

Crystal structure of the t. vaginalis ibp39 initiator binding domain (ibd) bound to the alpha-scs inr element
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
DSNDLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQLEEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKGGWTQWKRSGFTRNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transcription/dna
molecule keywords ALPHA-SCS INR
total genus 33
structure length 113
sequence length 113
chains with identical sequence M, O, P, U, V
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF10416 IBD Transcription-initiator DNA-binding domain IBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pp8F00
1IF1A 2ZXJA 1D8KA 4CGZA 3CDHA 2E1CA 2EJRA 1IN4A 3WTUC 1IW7F 3WGIA 4PZJA 2FE3A 4GYIA 1BC8C 1O57A 1OYWA 3MZHA 4KT5C 4ENKA 3V4GA 3F22A 3E6MA 2DBBA 1CF7A 2CYYA 2QQAA 4G94A 5ILUA 2PFBA 4AD9A 1RNLA 1IN7A 4KN7X 1FT9A 3VFZA 1BC7C 4EM0B 3GUDA 2PBIA 4P9FA 4EM1A 2LNBA 1O3QA 2WC2A 1SD4A 5LEKA 4MTEA 1YTYA 3N97A 5BMZA 4A0YA 4A12A 3D5LA 4LJZF 1LDJA 3LSTA 2Q2EA 1HBXG 2C6YA 1LQ1A 1XGMA 1YG2A 5HLIA 2QBYB 1R1UA 4KMFA 2ESHA 3BY6A 2VOOA 1S6LA 2P4WA 4OIQF 2RKHA 2CO5A 4GGGA 1FLIA 1VTNC 1C0WA 2V79A 2MLGA 2OU2A 1U3EM 1IZ1A 4Z2YA 4JBAA 2GQQA 3KEQA 2O6GE 1ZLJA 1TLHB 3V8LA 3H3UA 5HLHA 2FNPA 1QPMA 4I98B 3GF2A 3TQNA 5AONA 3VODA 4U0VA 4ETSA 3FXUA 4AWXB 1QNTA 2FEZA 3J81K 3T1BA 2ZJ2A 1TQMA 3TOBA 2EA4A 4RB3C 2HR3A 2XAFA 4LK0F 4K2EA 1WWXA 3GFMA 1RZ4A 2P7VB 2MC3A 5L3EA 1XMAA 3E6DA 4IRGA 3KP3A 3KP4A 5HDNA 2P6TA 3K1NA 1BJAA 1KYWA 3F8CA 3RTRA 5LHIA 2Q0OA 5DYMA 1P4XA 3TKYA 1SFXA 4FT8A 4OIRF 1RUOA 4EJOA 2ACJA 4LB6B 2R7FA 2DAOA 3KP7A 4RB1A 1OYYA 2UXNA 5CJ9A 4PGHA 5EEHA 2L4MA 1HKTA 3BROA 5ICFA 1SMYF 2JPCA 2RVCA 1WI9A 2IA1A 3WODF 2M1BA 4ESJA 2UZKA 4LB5A 1B59A 3MCZA 4CZZA 4AIJA 2LF7A 2VBYA 3RKWA 2CGPA 2G7HA 2QBYA 2ZBKA 2NNYA 4BQAA 5DCFA 5D8LB 5L3CA 3ABUA 4YFXF 1Z9CA 3T0YA 3HSRA 4IRIA 1J2XA 1TTYA 2FQ3A 1KQ8A 3I54A 4EJTA 2Y48A 1USTA 3NRVA 1W4MA 2L02A 2ZNYA 4EVIA 4UVAA 2CWEA 5LHGA 2W84A 3EDPA 2QYOA 4GCVA 2YSRA 4UNOA 3J7AO 1U78A 5ICCA 1FYMA 2XVCA 3JSOA 1FP2A 4UV9A 3ZMDA 1B9MA 4L0YB 2J5PA 2W25A 3PQJA 2ZO4A 1USSA 2STWA 4HV5A 4P55A 2H94A 3GO5A 5HS9A 1QBJA 2PG4A 2X4HA 5LGNA 1I1GA 3P9CA 4L5IA 1UFMA 1WQ2A 4IHSA 2O8XA 4KIBA 2QWWA 1KQ0A 2DFIA 3E6BA 1QZYA 2F5DA 1O7LA 5D6EA 1W7PB 2AXLA 4CYDA 3HSFA 4CXFA 4M74A 5AIPA 4NHJA 1X3UA 2BEOA 2A3SA 5D5VB 3L7WA 1HSJA 2HYGD 2ISZA 3L00A 3U1DA 5ERIA 3WTZA 1AWCA 2CSOA 4KMUX 5L3GA 1Z6TA 3JSPA 1J75A 3R4KA 5HVQC 3HRSA 3BJAA 3F21A 1U5TC 5A2QZ 3P9KA 2VT3A 2ADUA 1EH8A 1XCVA 3I58A 1SFUA 1REPC 2D45A 4PCQA 5K5OA 3IKTA 1ZGAA 5FFXA 2EB7A 1FSEA 2HEOA 3BP8A 2DK5A 3E5XA 3JW4A 2FBIA 1I5ZA 5LBQA 3JAMZ 3E5UA 5E18F 3GFLA 2GXGA 3O2PE 1R1TA 2YU3A 1PDNC 2PQ8A 3CO7C 1H9GA 3D0SA 5JFRA 3C18A 4G7HF 2P5VA 2R7DA 4G7ZF 2Z5UA 1DPUA 1FYKA 1DDNA 4KDPA 1XGSA 3CTAA 3KEOA 2MH9A 3B73A 2FBHA 4A0XA 3CUOA 4EGZA 3RDIA 1TW2A 1MJ9A 4L9VA 3GZ6A 1R23A 4OMYA 2TDXA 2HZTA 3T5XA 4BHCA 4OOIA 3ZN1A 1KA8A 4BNCA 2BE5F 4G9YA 3ZMZA 2VE8A 5E20A 4WK8F 1BI2A 2GWRA 1LJ9A 3TO7A 5FB2A 3T8RA 4ZYEA 1YIOA 4ENNA 4A2UA 5CVIA 5D5XB 4EGYA 4I02A 3DFGA 1V3FA 1DPRA 3GWZA 4U7BA 4ASNA 4R79A 3I5UA 3F23A 4BXUA 5IT9K 5EEGA 4M9SA 2PN6A 2EWNA 4ZH4F 2EK5A 2EFOA 1ZRFA 1FX7A 1WRJA 4CO8A 2ZFWA 5ILSA 5LGUA 4MEYF 1TNSA 3ISPA 3WTWC 5L3DA 4E70A 3FXRA 2Y75A 4HQMA 2XASA 4U0WA 4MNUA 4ENJA 1YW8A 3ZMVA 3I71A 4EQQA 1YYVA 4UVBA 3WTXC 4HAMA 1G3WA 4P96A 4D0PA 4FX0A 2Z33A 4S05A 3M8FA 1MD0A 3IC7A 1HW2A 3WU1B 2ELHA 2XRNA 4IPAA 5HS8A 1R58A 3VB2A 2RDPA 1OMIA 3F6OA 5HDKA 3ULQB 4IF4A 2O0YA 3F72A 4RB0A 2V6CA 3QAHA 5F6FA 3V8JA 4I09A 3LAPA 1LNWA 3FM3A 1RI7A 2A61A 1NHAA 1BI1A 1FYLA 1YS6A 2LSOA 2VBXA 2Q8KA 2DO7A 3F8MA 1KU2A 5D8KB 4IHTA 2QUFA 1IN8A 1FZPB 4MTDA 1J0RA 3IWZA 4YFKF 4Q4ZF 2ZMEA 3O3KA 3WTVC 3FX3A 4LLNA 2QENA 4UXNA 1S3JA 4RAYA 1YO5C 4L9TA 2EV5A 4WCGA 2V1UA 1L0OC 5BS6A 4HX8A 5JVTA 1U5TA 2OBPA 1XDSA 1J7KA 4P5OA 3FWEA 3HTUA 4KIFA 3BOQA 1R5GA 3KE2A 4EV0A 3EYYA 3K9TA 2IA2A 2QZ8A 2OAZA 1XGOA 1TQPA 2A5YB 3FM5A 2K02A 1P4AA 4MHGA 1HKQA 1ZG5A 5DEQA 2BV6A 2OA4A 5FO5A 4QLCU 4MGRA 5DDGA 5FFZA 2FXAA 2DQLA 2FBKA 1ZGJA 2P5KA 4AIKA 1ZN2A 3GVAA 2HFHA 3ZQ7A 1ULYA 5D5UB 5ILVA 4HX7A 2EFPA 5E1ZB 4O5VA 4UHTA 2W24A 1H0MA 2KIMA 2W85A 4ESBA 2FA5A 4YIFA 1IXSB 3R6SA 2G9WA 4OU0A 3HRUA 2CFXA 4PDKA 2A68F 2HTSA 1PP7U 2NS0A 1TBXA 1FWZA 3WE2A 1Z6RA 2PJPA 2DW4A 2E7WA 4M6XA 2HTJA 3V7SA 2STTA 2OQRA 4LK1F 1OPCA 1ZAOA 1TW3A 1UB9A 2PI0A 3LWFA 3I53A 4A5MA 2FF4A 3GLXA 3WGGA 1F1ZA 1P2FA 5L3FA 4S04A 4EJWA 2EV6A 2Z3YA 3H3ZA 1T39A 1EV7A 2V1DA 1Y0UA 2F5EA 2DTRA 1FC3A 3R0AA 1KGSA 4AIHA 1BIAA 5DD8A 4DNCA 5E8GA 1T0FA 5K5RA 2O3FA 4BHBA 3IRQA 4XBFA 3BJ6A 3L2CA 2HDCA 3SFZA 5D4SA 2F5FA 1JHFA 1IRGA 2O03A 2BGCA 5DD4A 1U5TB 1ZG1A 5LEJA 3P9IA 1IN5A 1F4KA 1LB2A 2WWYA 3K0LA 3LA3A 1K79A 1SFEA 5CVJA 5J8FA 1J5YA 1RUNA 2QM3A 1U8RA 1YW9A 3I59A 5DCMB 4R8HA 1B4AA 2JZYA 2DT5A 2K4BA 1YW7A 2CQKA 1I1SA 2V1XA 4KICA 3ZMUA 4A5NA 3GEZA 2VE9A 3N4MA 2H27A 5DUKA 4HW0A 1P6RA 3KP2A 3LFKA 2RV8A 4NB5A 3DF8A 4Q47A 1FP1D 3L09A 4L5JA 3FMRA 4LMYA 2JTVA 4HYEA 3E3VA 3M1EA 2RGVA 2M8EA 1Q1HA 1R36A 1HSTA 4NQWA 4EMSA 4BYYA 1G3TA 1BM9A 1FY7A 2MBFA 2RNJA 5FD6A 3U2RA 3ABTA 4HLYA 5L3BA 4L18B 4UUVA 4IVNA 2H6BA 2QQBA 5J8CA 1ZHFA 5A2QK 3RKXA 3M8EA 2HYFA 4M71A 3GXOA 4Y13A 4FHTA 3MZYA 5BQTA 4ZZLA 2ZMEB 3JTHA 3BWGA 2VXZA 3EYIA 1ZH5A 3BPVA 1P4WA 1YQAA 3LAJA 3ERED 1D5VA 3WGHA 4FX4A 2VOPA 1GVJA 1FSHA 1S7OA 2VC0A 5CVUA 1V4RA 3H92A 2IPQX 1T38A 1OKRA 1SD6A 2PMHA 3DV8A 4KUMA 4UV8A 2A69F 4MQVA 2FMLA 2WTEA 2E1NA 2L01A 2OD5A 1F5TA 4TV7A 4HDVA 2HS5A 4XLNF 2P7CB 3FF5A 4HF1A 1HW1A 2IT0A 1XSVA 3EETA 1K6OA 4R1HA 2R3SA 5TRDA 2KIUA 1WSUA 3QU3A 1S8NA 1RIOH 4KA4A 2IA0A 2HKOA 1TNTA 2DK8A 3HRMA 3SHFA 2ETHA 1SD5A 2ZCWA 2AS5F 2XAHA 5FD5A 3IHUA 1R7JA 2V9VA 3V8KA 3IL2A 3DKWA 5BPIA 4WF2A 5JHUA 2VBZA 3J80K 4KN4X 2K86A 2NNNA 1STZA 3JAMK 3CO6C 2XV4S 4F7ZA 1P92A 1W5TA 2PLYA 3NQOA 3VOEA 1IN6A 1OYIA 3F8FA 3HRTA 5F1RA 4ZZDA 5FGMA 1Z1DA 4HDUA 3LA2A 5ED4A 4CICA 3ELKA 1QZZA 2L54A 2K7LA 3CUQB 4HOBA 1BIBA 3HOSA 4B8XA 2EFNA 4EM2A 4L0ZB 4KFCA 1SAXA 3LQRA 4CHUA 4Y17A 3Q5FA 1IXCA 4JQFA 5H6QA 1FOKA 3GYHX 1ZYRF 4LFUA 3HTSB 2QVOA 4HBLA 5LRSA 5CVVA 5IT3A 4WXHA 4N9IA 2KKOA 3GFJA 1J9IA 1ZREA 3MAJA 3ZN0A 1CF7B 2XKOA 3NEUA 1UHMA 4QWQA 2ISYA 1XGNA 2Z99A 4LLGF 4RS8A 1FNNA 4U88A 4RGRA 3I4PA 2J5OA 3KFWX 1XCBA 2O61A 1T98A 4RAZA 1AOYA 3Q9VA 4O6JA 2P6SA 2JSCA 1GHCA 3MQ0A 4A0ZA 1LEAA 1FPQA 4Q5SF 3RKYA 5LGTA 1KYZA 4M9ZA 1G6NA 4ZYHA 1YS7A 3PQKA 2HQNA 3RYPA 3R60A 5KK1A 2MLKA 3DP7A 3QPTA 5BOXA 2EV0A 5IT9Z 5D6FA 4B09A 3EUHA 2F5CA 2GAUA 2RN7A 4RGXA 4RGUA 4KIGA 4M9XA 2DPUA 2COMA 4H0EA 3TDUC 2LDUA 3GW2A 3L9FA 1ZLKA 1D3YA 3QRFF 2NAZA 3DPLC 1U6GA 3CUQC 3K1MA 3QP6A 2HOEA 2VT2A 3TGNA 3FHZA 4OIOF 3M7GA 1QQIA 4EJUA 3ZMTA 1MZBA 2VN2A 5HOOA 1CGPA 3R0JA 3F8NA 1UCRA 1MKMA 2NRAC 2P8TA 2MA3A 3SZPA 4Q48A 5HS7A 2HKXA 2Z9OA 2UXXA 1QGPA 5TJJA 1XB4A 1QO0D 1Z91A 1ODDA 4LLLA 3MFKA 2GZWA 1R5HA 5K5QA 1TQIA 4I01A 4I7HA 4OMZA 1G4DA 2KRFA 3PFIA 3HUGA 3QPHA 3KP5A 1YFHA 2JT1A 2P5LC 4LG0A 4O3MA 1L3LA 3ZP5A 2FNAA 4G6QA 2L3DA 2H09A 3BZ6A 5H6RA 1MGTA 4AVPA 1R00A 3HOTA 3RIRA 1I27A 3Q9SA 5ICEA 1KU3A 3DXJF 3OV8A 3I0TA 2M45A 2MH2A 3HSEA 2IVMA 3M9AA 4YFNF 4WWCA 1A04A 3RPUA 2FU4A 2EA2A 2D2WA 4HQEA 3IWFA 3C7JA 3C1DA 1T2KA 4ZYGA 3TDZC 2F2EA 3DEUA 1WKMA 3ZPLA 2XIGA 2WV0A 4YG2F 3V7RA 1G3SA 3FXQA 3CLOA 2KIFA 3HHGA 1K7AA 1T6SA 1YLFA 2DI3A 2XAGA 3O6BB 2QLZA 1HQCA 3EQLF 3W6KB 1FBUA 4Y15A 1JXSA 2OQGA 1IUYA 4ZYDA 5J6XA 1G3YA 3WTYC 3I64A 1ZARA 4ON0A 1JGSA 2IP2A 4XSXF 1XDUA 1E17A 4OINF 2GA2A 3IRRA 2D1HA 1Z05A 2BYVE 4BH9A 2RC4A 1B6AA 4HLXA 4U7DA 2GXBA 3LQQA 5E1XA 4G6DA 3QP5A 1XSXA 1W7PD 1FBSA 3REOA 1B1BA 3B02A 4I0BA 4IXAA 4EJVA 1BI0A 4WXCA 5DV5A 3P7NA 1OR7A 3GX4X 3HIFA 2NYXA 1BOAA 3ECHA 3QU6A 2VODA 3T8TA 5FLXZ 2YX4A 4A6DA 1F9NA 3WTTC 1LDKB 3CJNA 4P9UA 2ESNA 3FMQA 2YPRA 3WG9A 2FRHA 2CG4A 3JTGA 3R61A 5KVRA 3MWMA 1W5SA 1D8JA 3LA7A 5CVRA 2JPBA 3ROUA 4I2OA 3J80Z 1HKSA 2W57A 2QQ9A 2E7XA 3GFIA 4U0YA 5AIQA 4L9NA 3KLOA 3KLNA 3SZTA 1I6XA 2DU9A 3SQNA 2KJCA 4MEXF 4XLPF 2VONA 5HDGA 2GIVA 3U9GA 1DP7P 4M72A 2XGXA 3E97A 2ZKZA 2MD5A 3RYRA 3KCCA 1O3TA 3FZVA 3WE3A 2LF8A 1ON1A 3TO9A 1B9NA 3TOAA 1DUXC 3TO6A 1J59A 1JE8A 4HA8A 4CDGA 2JRTA 2FOKA 4G8XA 1BI3A 3F3XA 5E17F 1UHWA 2IJLA 4KNYA 1Z7UA 4HF0A 2OZ6A 2XAJA 1LDDA 1H9TA 2LKPA 5K1YA 3GZ5A 2DLLA 3KETA 1ZRCA 2YX7A 4WXDA 1MDMA 1XN7A 4N9HA 2EFQA 2M30A 2RQPA 3RI4A 1R1VA 4RB2C 3BPXA 1S29A 2XKPA 3KP6A 5DUIA 4IRHA 5LLQA 2CW0F 6PAXA 2VBWA 3K2ZA 5CYVA 1K78B 4M73A 1HXDA 1XD7A 1R22A 3ML6A 3J81Z 2IRFG 1IRFA 1K78A 1BN5A 3DPTA 3E5QA 1ON2A 3E6CC 1JHHA 3BJOA 5ICGA 4L9JA 3WTSC 2M5WA 1IXRC 1KU7A 1E2XA 3G3ZA 1S7AA 4UVCA 2HQRA 1HW5A 3RPQA 1O7FA 5HLGA 4I0AA 2DPDA 3ZMSA 4LD5A 2XUBA 3ECOA 4OIPF 3HYIA 4A6EA 3HHHA 2EFWA 2BBYA 3MEXA 5F64A 2YR2A 4HF2A 3DQVC 3KZYA 4N0BA 1PP8F 3KZZA 1KU9A 2K4JA 2IW5A 1LVAA 3RJPA 5LRRA 3K69A 1O3RA 5JI6A 3WU0A 2Y0MA 1ZRDA 1EH6A 1IAWA 1KQ9A 2XROA 1GXQA 1GXPA 4YIIA 3I59B 2A6HF 5DCMA 3W6JB 1ZG3A 2K27A 1MJAA 1W7PA 4M6YA 4HZFA 1PUEE 1LEBA 2A07F 2VC1A 4LG0B 4XSZF 4HV6A 1MDMB 4MQ9F 5D4RA 2UWMA 2PMUA 1ONVA 1SD7A 1XSDA 2X0LA 4BHPA 3AAFA 4ESFA 1BBYA 3BDDA 2FSWA 4PGGA 3IKVA 1XMKA 4DQ2A 4IJAA 4GO1A 1SMTA 4GXOA 3SXYA 2XAQA 1MJBA 4RGSA 4G7OF 4HX4A 3C3WA 4WX9A 2L4AA 1FBQA 4JK1X 3VEPA 5JR3A 3G73A 3F6VA 4KYWA 2OZUA 2KJBA 3V7CA 2M87A 4XRFA 3COAC 5FLXK 2G7UA 2ZNZA 5E1WA 3OOPA 2B0LA 5CLSA 2D1VA 3QOPA 3K1PA 5E8IA 5BPDA 3FMSA 4LGWA 2DQRA 2H6CA 2FMYA 2HGCA 2HWVA 4ENMA 5D5WB 3CUQA 5H20A 2GA1A 5LHHA 1U2WA 3S2WA 1O3SA 4BAYA 3F8BA 2XHKA 2A6EF 4GYGA 1EH7A 2PEXA
chains in the Genus database with same CATH superfamily
1IF1A 2ZXJA 1D8KA 4CGZA 2ZMEC 3CDHA 2E1CA 2EJRA 1IN4A 2BW3B 3PSIA 3WTUC 1IW7F 4A3IJ 3WGIA 3IUOA 2M4GA 2BHZA 4CUGA 4XL9A 4PZJA 2ME6A 1BW5A 2FE3A 2JA7J 2V9PA 2ZFUA 3E1SA 4BU2A 4XRSG 4GYIA 1BC8C 1O57A 1OYWA 4BJTA 3MZHA 3OS0A 4I76A 1FEXA 3HOUJ 4KT5C 3H5RA 4JOMA 4ENKA 3V4GA 4ZDPA 3F22A 2HOSA 3CC4I 2Y69H 3E6MA 5EGOA 4M3FA 3H0DA 2DBBA 1CF7A 3EUHC 2CYYA 2QQAA 4G94A 2BY2A 5ILUA 5IP6A 1AHDP 4AC0A 1JTXA 2PFBA 4AD9A 3OYAA 1RNLA 1IN7A 1VQNI 2O5RA 4KN7X 1FT9A 3VFZA 1BC7C 1X1DA 2MABA 3K4NA 3IP4B 2DOFA 4EM0B 4E6KG 4I6ZA 3GUDA 2PBIA 4P9FA 4EM1A 2LNBA 1O3QA 2PJRB 2WC2A 3DEEA 2JN6A 1SD4A 3FKJA 5LEKA 3S17J 3OYFA 4MTEA 2BZTA 1HA8A 1YTYA 3N97A 1A31A 2M4KA 2DFEA 3NARA 5BMZA 2K3PA 4NUBA 3VYTB 1MMGA 4PSWA 4A0YA 4A12A 3D5LA 1ITYA 1YE9A 4LJZF 4E7SA 1LDJA 3LSTA 4J19A 2Q2EA 1HBXG 4BACA 1DGWY 2JA6J 2C6YA 1MMAA 4LITA 1LQ1A 1XGMA 1YG2A 5HLIA 3LFUA 2QBYB 3PNVA 1Z3XA 2QA4I 1R1UA 3ASNH 4KMFA 1VI0A 2ESHA 3BY6A 2VOOA 2X9DA 3Q0UA 3DTKA 2M8GX 1S6LA 4JX5A 2DMQA 2NVXJ 1A36A 5DM6F 3ZGKA 3SDGA 2P4WA 3BCAA 3CCSI 2RKHA 4OIQF 3H9QA 2CO5A 4GGGA 1FLIA 3S3NA 1VTNC 1C0WA 2V79A 2MLGA 2OU2A 4CCMA 2HXOA 1U3EM 1IZ1A 4Z2YA 1IRZA 1J09A 4JBAA 2E1OA 4W1UA 3BT9A 2GQQA 3KEQA 3CJQB 2O6GE 3HBLA 1ZLJA 5GAEJ 1TLHB 2DOAA 4PJMA 3V8LA 3H3UA 2EZHA 5HLHA 1X2MA 2FNPA 2CV1A 3SJMA 4BDZA 1MIJA 1QPMA 4C2TA 2VJJA 4ITVA 4I98B 3GF2A 3TQNA 2H8RA 3QYBA 1JI8A 4DZJA 5AONA 3VODA 5HODA 3KYLA 2XB0X 4A3DJ 1ZTRA 3BQZA 3M3YJ 2E36A 4U0VA 4B3XA 4ETSA 4DJAA 2K9QA 3FXUA 3IV5A 4AWXB 4FTHA 1QNTA 2FEZA 3J81K 2DMUA 3T1BA 2ZJ2A 1TQMA 2F5VA 3TOBA 2EA4A 4RB3C 4DZPA 2JA2A 3DBRB 5IY5H 3U1KA 2HR3A 2XAFA 3CLQA 2R93J 3EUAA 3LMMA 4LK0F 4K2EA 5BNGA 1WWXA 3GFMA 4QIWN 2JUCA 4Y52J 1RZ4A 4XKCA 2MFZA 4JYKA 2P7VB 2MC3A 5J47A 5L3EA 2FQ4A 3CMEI 1XMAA 3E6DA 2H8WA 4IRGA 1Y56A 3KP3A 1MBFA 3AL0B 5JHFA 3KP4A 3LSIA 5K7FA 5HDNA 3ZQGA 1IG7A 2P6TA 3K1NA 1JKQC 5CKTA 1BJAA 4F55A 4XICA 1KYWA 3HGGA 3U21A 2ZXHA 3F8CA 3RTRA 5LHIA 4IQJA 2L0KA 2Q0OA 2TRTA 3CMYA 2XPWA 3HPGA 3K6GA 4NC6A 5DYMA 1P4XA 1JJ6C 1W36D 3A2KA 1JGGA 3TKYA 1SFXA 4FT8A 4AYBN 4OIRF 1RUOA 5CPRB 4EJOA 2ACJA 4LB6B 2R7FA 3GTKJ 3DPUA 2DAOA 1UG0A 3KP7A 4RB1A 1OYYA 1RR8C 1BW6A 2UXNA 5CJ9A 2XGDA 1VQ9I 4PGHA 5EEHA 2L4MA 3CDIA 2Y30A 1YJ9I 1HKTA 1I6HJ 1TWFJ 3BROA 4XLEA 2WAQA 5ICFA 2CH0A 1SMYF 2JPCA 2LREA 5EZGA 3JRBA 2RVCA 1WI9A 3FK6A 3BZCA 2IA1A 2Z2SB 3EPZA 3JRAA 3WODF 2M1BA 4ESJA 4AIDA 2UZKA 4LB5A 1B59A 1X4OA 2E5NA 3CCQI 2GOMA 2HXIA 3MCZA 4JX4A 4CZZA 4DBRA 4AIJA 1Y6IA 2LF7A 2VBYA 3RKWA 1B72A 2CGPA 2G7HA 2KLOA 3CCVI 2ZBKA 2QBYA 2NNYA 3PIPF 4BQAA 5DCFA 5D8LB 4NDLA 5L3CA 3ABUA 3E0JB 4YFXF 1Z9CA 3T0YA 3HSRA 3G71I 4IRIA 1J2XA 3WHCA 2FJ1A 3TBIA 1P7JA 1TTYA 2FQ3A 1KQ8A 1NK2P 4BQOA 3FXMA 5TISC 3I54A 4NC7A 3G6EI 2AQFA 3OR2C 1GV5A 4XKBA 4EJTA 4CA0A 2Y48A 2HVSA 1USTA 5HNFA 3MD2A 3NRVA 3OYNA 2EILH 1W4MA 2L02A 2ZNYA 4BXXJ 4EVIA 4UVAA 2CWEA 5LHGA 2W84A 3IAS2 3S2HJ 3G2BA 3EDPA 2QYOA 4IL6C 2M0CA 4XM3A 3S3OA 4GCVA 2YSRA 3PNTA 4UNOA 3J7AO 2LMDA 1APLC 1U78A 5ICCA 2E71A 4PJNA 1FYMA 1MNEA 2XVCA 2HVRA 2OCEA 3JSOA 1FP2A 4UV9A 3ZMDA 1B9MA 4L0YB 2J5PA 3VPRA 2W25A 2HQ5A 1LKXA 1WJEA 3GTPJ 3PQJA 2ZO4A 1USSA 2H1LA 2STWA 2VKHA 2NOJB 4ZYAA 3ZQLA 2FOWA 2Z16A 1SVOA 4HV5A 4P55A 1Z7LA 2H94A 1UJ8A 1V5EA 3GO5A 2PG4A 2X4HA 5FKNA 5HS9A 1QBJA 5LGNA 1I1GA 3P9CA 4L5IA 1UFMA 1IUFA 3OR1C 1I3QJ 1XTAA 4II2A 1WQ2A 2R7OA 1FJLA 4IHSA 2O8XA 4KIBA 4RBOA 2QWWA 1KQ0A 5EG0B 2DFIA 2KRHA 4E7JA 1MMDA 2R7ZJ 3E6BA 1QZYA 1OCCH 2F5DA 1O7LA 5D6EA 4XIDA 1W7PB 2AXLA 4CYDA 3HSFA 3OL3A 3A02A 4CXFA 4M74A 5AIPA 4NHJA 1X3UA 2BEOA 2A3SA 2NVQJ 5J4VA 5D5VB 3L7WA 2R92J 1HSJA 2EQRA 2X6YA 2HYGD 5EG0A 2ISZA 3BTJA 1SAUA 3S8PA 3UNGC 4RDUA 3L00A 3U1DA 5ERIA 3WTZA 3O8HA 1AWCA 2CSOA 4KMUX 5B1BH 5L3GA 1Z6TA 2Y9YA 3AG1H 3JSPA 2VQLA 1HCRA 1J75A 2A5WA 2PJRA 4BY7J 4N4NB 2IS6A 2DA2A 2L9RA 3R4KA 3LSGA 5HVQC 1B8IA 3HRSA 4J00A 3BJAA 3F21A 1U5TC 1GVDA 5A2QZ 3P9KA 2VT3A 2OPTA 2ADUA 2CRGA 2KP6A 1EH8A 1DGRM 1E0EA 1XCVA 3I58A 1EJ9A 5M3MJ 1SFUA 4D7MA 2D45A 1REPC 1MBKA 2DFFA 4PCQA 4C3IJ 4XK4A 5K5OA 5M3FJ 1WH5A 3IKTA 1ZGAA 5FFXA 1V5FA 2EB7A 1FSEA 2HEOA 3BP8A 3DEWA 2DK5A 3E5XA 1X1CA 3JW4A 2CV2A 2ZJRF 2FBIA 3CP2A 1I5ZA 3DWLE 5LBQA 2DA4A 2K9LA 3BTLA 1JT6A 3GTJJ 1SVMA 3JAMZ 3E5UA 5E18F 2DA3A 3GFLA 3JR9A 1ETKA 2GXGA 3O2PE 2JK3A 2HDWA 4BUPA 3OSGA 3I4NJ 1R1TA 2YU3A 3A01B 2VJ5A 2IGNA 4Y4RA 2PQ8A 3CO7C 1PDNC 4U87A 1X1PA 2BY0A 3OS2A 1H9GA 3D0SA 5JFRA 1R71A 1LFBA 3C18A 1GLNA 1NG7A 4M6VA 2QSGX 1A5JA 3W2VA 1TP4A 2MGQA 4G7HF 5E3OA 1VQ6I 2P5VA 2R7DA 2P81A 3OOUA 4G7ZF 2Z5UA 1DPUA 2M34A 2WADA 1FYKA 1DDNA 3WG7H 1XGSA 4KDPA 4PSXA 3CTAA 1N25A 3KEOA 2MH9A 4PFPA 2IS4A 3B73A 2FBHA 4B48A 2W7NA 2BW3A 2NVUB 4A0XA 2HPIA 3HPHA 2QCOA 2EBIA 3CUOA 3I9V2 5C4XJ 4EGZA 4XQFA 3PO2J 3RDIA 2F48A 1TW2A 1MJ9A 4RAFA 5J40A 4L9VA 3GZ6A 1R23A 4OMYA 1XX5A 1X3ZB 2TDXA 4NBQA 2HZTA 3T5XA 2VKEA 4CYCB 1HF0A 4CCLA 4BHCA 4OOIA 3RZDJ 3ZN1A 4C2MJ 3ZQIA 1KA8A 4B44A 3OYJA 2BE5F 1K61A 4BNCA 1E3PA 4G9YA 3C2GA 1Z3YA 3ZMZA 2VE8A 5E20A 1MMNA 2R7VA 4WK8F 3OY9A 4PUSA 1BI2A 3JCUC 2GWRA 5IP9J 1LJ9A 5J1RA 3NWSA 3SDBA 3I3LA 1ZKGA 3TO7A 5FB2A 3T8RA 2GM4A 1T0FC 3GTQJ 3G1LA 5M5YJ 1K83J 4OWRB 2RREA 1M1EB 1QA6A 3GTLJ 2NS7A 2DT7B 3DKYA 3A0BC 3DTIA 4ZYEA 4E7IA 1YIOA 4ENNA 2CUJA 4A2UA 3PM1A 2RNGA 5CVIA 5D5XB 4EGYA 3JRIA 1Z67A 4FETA 2ELJA 4I02A 3DFGA 1V3FA 2R7TA 1DPRA 5B3SH 5LFAA 1IDYA 2WB1A 5EJCA 3GWZA 4BJ6C 4U7BA 4ASNA 4R79A 3I5UA 3F23A 4BXUA 2CS3A 5IT9K 5EEGA 4M9SA 2KT0A 2PN6A 2EWNA 1XC5A 2EK5A 3IH3A 2EFOA 2ZB9A 4ZH4F 1ZRFA 1FX7A 1WRJA 4CO8A 2ZFWA 5ILSA 5LGUA 4MEYF 1TNSA 4C30A 3ISPA 3WTWC 2V26A 5L3DA 1RC9A 3BG3A 4E70A 1XG1A 3FXRA 2Y75A 3H36A 4HQMA 2XASA 1K4SA 3S16J 3NAUA 4H4KC 2LY2A 3PO3J 4U0WA 5IYDJ 3HKZA 4MNUA 4ENJA 2X85A 1HC8A 3GTGJ 1CQTA 2GLOA 1YW8A 3ZMVA 3HGYA 1EF4A 4Y7NJ 3I71A 4EQQA 1YYVA 4UVBA 5EZHA 2O8KA 5FKOA 2R0QC 3JRGA 3WTXC 2OUMA 1G3WA 3HB9A 4HAMA 4FX0A 4P96A 4D0PA 4S05A 5J1UA 2Z33A 2HYJA 3M8FA 4ANJA 1MD0A 1MNDA 3IC7A 1HW2A 3WU1B 2IEKA 5FLVA 2ELHA 2XRNA 4IPAA 1D0XA 2GBYA 1R58A 3VB2A 5HS8A 2RDPA 1OMIA 1BR4A 3UKGA 3F6OA 2V4JC 5HDKA 3OYEA 3ULQB 2F4IA 4IF4A 2AO9A 2O0YA 3F72A 4RB0A 1Q1VA 3BCBA 1GT0C 2V6CA 3Q0VA 4C3JJ 2N8GA 3QAHA 5F6FA 3V8JA 4I09A 3LAPA 5DTDA 1MMSA 1LNWA 3FM3A 3V42A 2MW8A 1RI7A 2A61A 1W36C 4QPQA 3TP0A 1NHAA 2MSYA 2QKLB 4CH7A 1BI1A 1W0UA 1FYLA 1YS6A 2LSOA 1WPKA 2CQXA 2VBXA 2TCTA 2Q8KA 2DO7A 3F8MA 1KU2A 5D8KB 4IHTA 1SEUA 2E60A 2O7OA 1JUPA 2ICWG 1LPQA 2QUFA 1ETXA 1IN8A 1FZPB 1N78A 4MTDA 1J0RA 3IWZA 4YFKF 4Q4ZF 2ZMEA 3HZJA 3O3KA 3WTVC 3FX3A 4LLNA 3CD6I 1ZR2A 2QENA 2JA8J 4UXNA 4A3EJ 2LG4A 3GTMJ 1KZHA 4DOZA 1S3JA 1WJDA 5K7ZA 4L5EA 4RAYA 2XDVA 3CP8A 1YO5C 4IHVA 3VYRB 3BG5A 4PJ0C 2DA7A 1VQLI 3N05A 4L9TA 2EV5A 4WCGA 2V1UA 5GADJ 1L0OC 2XPVA 5BS6A 3OIQA 4HX8A 5JVTA 1U5TA 2OBPA 5GTHC 1XDSA 3I55I 1J7KA 2HU9A 1D0ZA 4P5OA 3FWEA 3HTUA 3TL4X 4KIFA 4A3GJ 3BOQA 1TZLA 1R5GA 3KE2A 4EV0A 4XLAA 4F91B 3WHBA 4BKXA 3EYYA 3K9TA 2IA2A 2QZ8A 2OAZA 2XSDC 1VQ4I 4BE0A 1BA5A 1XGOA 1FOXA 3ZQHA 5KCMA 1TQPA 2A5YB 4BS9A 1Z77A 3DLLF 3FM5A 2ELKA 1GDTA 4A69C 2YUSA 2V7FA 1FMWA 3KYDB 2K02A 1P4AA 2DA5A 1PUFB 4ZDOA 3D1NI 4XOTA 4MHGA 1HKQA 2R5YA 1ZG5A 5DEQA 4YRVA 2BV6A 4IX7A 2OA4A 1EKEA 5FO5A 4QLCU 4MGRA 3RCOA 5DDGA 1Y1WJ 5FFZA 2FXAA 2DQLA 2FBKA 1ZGJA 2P5KA 4AIKA 1ZN2A 3GVAA 2HFHA 1OLTA 3LOCA 3ZQ7A 1ULYA 5D5UB 4BGDA 5F1JA 1ETOA 5ILVA 4HX7A 1B72B 4E7ZA 2XF5A 3M1CA 1OFCX 2FD5A 2EFPA 2JMWA 1I3AA 1JT0A 5E1ZB 4O5VA 4UHTA 3GTOJ 2W24A 1H0MA 3MKLA 2KIMA 2QGUA 2AHQA 3QODA 2W85A 4ESBA 2FA5A 4FCYA 2OC6A 1IXSB 4YIFA 2HPMA 3GCMA 2G9WA 3R6SA 3CZ6A 2CQ7A 4OU0A 3HRUA 3TEDA 2CFXA 4PDKA 3H35A 1SVLA 2A68F 2HTSA 1PP7U 3SZGA 1RETA 2NS0A 4DW6A 2CJJA 1TBXA 2ID3A 3A01A 5GTIC 2CW8A 4CZCA 1FWZA 3AG4H 4F3QA 3WE2A 1Z6RA 2PJPA 2DW4A 3H5AA 2E7WA 4DGWB 1TWHJ 4M6XA 4G12A 2HTJA 3QQAA 3V7SA 1ETYA 4HSRA 3SFIA 2STTA 2OQRA 2WAEA 2XF7A 4ZTJA 3IH2A 4LK1F 1S7EA 1OPCA 4LIVA 2VKDA 5HNHA 1ZAOA 1Y8RB 1TW3A 3D5RC 1UB9A 2PI0A 3LWFA 3I53A 4A5MA 2FF4A 4IHYA 3GLXA 4V2FA 3G1OA 4AYBA 3WGGA 1F1ZA 1P2FA 1YJNI 4NC8A 5L3FA 4S04A 4EJWA 2EV6A 2Z3YA 3H3ZA 3OIPA 4I99C 1T39A 2WBMA 1EV7A 2V1DA 3H1CA 5GAHJ 1Y0UA 3BG9A 2R7RA 3GBGA 2F5EA 2L7FP 3BR2A 2DTRA 1FC3A 3R0AA 1KGSA 4AIHA 1BIAA 5DD8A 4DNCA 5E8GA 3AL0C 2BXZA 3S32A 3FBNB 1T0FA 2BOLA 2K9MA 1BJZA 2DN0A 5K5RA 3PFYA 4AVZA 5DM7F 1JUSA 2O3FA 4BEHA 4BHBA 2VKVA 2LLKA 4XBFA 3IRQA 2CU7A 3BJ6A 2NS8A 3L2CA 2HDCA 3SFZA 5D4SA 2F5FA 1JHFA 1QHGA 3OYLA 1IRGA 2O03A 2QEXI 2JVHA 3RQIA 2BGCA 5DD4A 1U5TB 1ZG1A 3K4JA 3L2QA 2Q1ZB 5LEJA 3P9IA 1IN5A 1W1WE 2DMNA 1H8AC 3BC8A 4RAGA 3SYTA 1F4KA 3PSFA 4FISA 1TWAJ 3RSNA 1LB2A 2WWYA 3K0LA 1B8IB 3J7YJ 2ME0A 3LA3A 1K79A 1SFEA 3HUGB 4HRIA 2XGCA 5CVJA 5J8FA 3PIOF 1MSEC 1J5YA 1RUNA 2QM3A 1U8RA 4JX6A 4CCNA 3CCLI 1YW9A 1OCOH 3A1YA 3I59A 5DCMB 4R8HA 1B4AA 5K7HA 1F36A 2JZYA 2DT5A 4IQ4A 2K4BA 1YW7A 5E3MA 3J7ZI 2CQKA 1I1SA 2V1XA 2MC4A 4KICA 3ZMUA 3CF5F 1U0JA 2HDDA 4A5NA 3GEZA 3TW6A 2V6EA 3RPUD 2VE9A 3N4MA 3K70D 2H27A 5DUKA 4F92B 4HW0A 1P6RA 3KP2A 2K40A 3LFKA 2RV8A 2R7SA 1ZQ3P 3CCRI 4NB5A 1BOBA 3DF8A 2DJNA 4Q47A 1AU7A 1FP1D 1JKOC 2RAEA 3VYUB 3L09A 1IV8A 4L5JA 3FMRA 4LMYA 2DFHA 2QF7A 2JTVA 4IZZA 1WZ2A 4HYEA 3IAM2 3E3VA 4J01A 3HOVJ 3M1EA 2RGVA 1F43A 3LSMA 2M8EA 1QHHD 1Q1HA 1OCZH 1R36A 3S2DJ 1HSTA 3M07A 4NQWA 4RM3A 4EMSA 4BYYA 1G3TA 3BR3A 1BM9A 1FY7A 2MBFA 2RNJA 1FOWA 1A35A 2X51A 3ZQQA 5FD6A 4A3JJ 3CMAI 4KJZA 2X1EA 4BBSJ 3U2RA 2JJ7A 5IPAA 3ABTA 3K70C 3P5JA 4HLYA 2XGEA 3KZIC 3PL8A 4QSHA 5L3BA 4L18B 3KX2A 4UUVA 4IVNA 2XB5A 2H6BA 4A3MJ 2QQBA 5J8CA 1ZHFA 4DYRA 5A2QK 3RKXA 2VI6A 3M8EA 2HYFA 2NXNB 4M71A 1T33A 3GXOA 4D9JA 4Y13A 4FHTA 3MZYA 5BQTA 1D5YA 2DA6A 4ZZLA 2ZMEB 3JTHA 3BWGA 2VXZA 3EYIA 4PFOA 3DU6A 1ZH5A 3BPVA 2ID6A 1IDZA 1MBEA 2KRCA 2Y31A 1P4WA 1YQAA 3LAJA 3S15J 3ERED 1WGXA 4KISA 1D5VA 3WGHA 3LSHA 5LD2C 4FX4A 2UUZA 3BZKA 2VOPA 3O8GA 1AKHB 5C3EJ 4FASD 1GVJA 4JP0A 3KIOA 3IH4A 3BQYA 2YU9J 1FSHA 2KQRA 4II3A 4ZDLA 1S7OA 2K3FA 2VB6A 4HSTA 5HLTA 2VC0A 3BR1A 5CVUA 1V4RA 2ZC2A 4B4CA 3H92A 2IPQX 1T38A 1OKRA 2HOAA 3L2RA 1SD6A 1AKHA 3LSRA 2PMHA 3RKQA 1YJWI 3DV8A 1OJLA 4KUMA 4UV8A 2A69F 3HXLA 3F0CA 4PJLA 5TGTA 4MQVA 2FMLA 2WTEA 3LL7A 1XS9A 4UB6C 2E1NA 2L01A 2OD5A 3FXOA 4TV7A 1F5TA 4HDVA 1TT5B 2HS5A 2M3AA 4XLNF 2P7CB 3FF5A 4HF1A 1HW1A 2IT0A 1XSVA 1MBJA 4GDFA 1MBGA 2R5ZA 3EETA 4D5FA 2DTZA 1G59A 1UELB 1K6OA 4R1HA 2KDZA 2KIQA 5H2FC 2E34A 2R3SA 2JRMA 2JUGA 3CC2I 5TRDA 4BXFA 2KIUA 3M4OJ 1WSUA 3QU3A 1S8NA 1RIOH 4S0HB 4KA4A 2IA0A 5KNLA 2HKOA 1LE8A 1D1BA 1V55H 2JVGA 4YIRX 1TNTA 2DK8A 5FKKA 4A3CJ 3HRMA 1YX5A 3SHFA 2KPMA 2ETHA 2DMPA 1SD5A 3CCUI 4B47A 2ZCWA 3S1MJ 3M8JA 2AS5F 2XAHA 2IS2A 5FD5A 1FTZA 3IHUA 1R7JA 2VLAA 2V9VA 3V8KA 3IL2A 2JQ7A 3DKWA 4E7KA 4RLFA 2LR8A 5FROA 5BPIA 2KDOA 4WF2A 5JHUA 1HDDC 2VBZA 3J80K 1YRNA 4KN4X 2K86A 2NNNA 4LIUA 1STZA 3JAMK 4LOCA 3ASOH 2XV4S 3K4BA 3CO6C 4F7ZA 1P92A 2DMTA 3LSJA 3S1QJ 1W5TA 2CQQA 2PLYA 2NVYJ 3NQOA 3VOEA 4A3BJ 1IN6A 3L2VA 5GP9A 1OYIA 1TWGJ 3CDLA 3CCYA 3F8FA 3HRTA 5F1RA 4ZZDA 5FGMA 1X58A 1S72I 3CC7I 1Z1DA 4XOPA 4HDUA 2V1NA 1PYVA 3LA2A 2LC2A 4BY1J 5ED4A 4CICA 3ELKA 1QZZA 2L54A 2K7LA 2PX9A 3CUQB 3CMMA 4HOBA 5KHDA 5JLWA 1BIBA 1X3WB 3HOSA 1WJAA 2DODA 2X6XA 4PK4A 4B8XA 5FRMA 3PUBA 4Y3OA 2EFNA 2IGKA 4EM2A 4L0ZB 1VQ7I 4KFCA 5F27A 1SAXA 3LQRA 1D0YA 4CHUA 4Y17A 3Q5FA 1IXCA 4JQFA 5H6QA 1R49A 1OQYA 4BQQA 1FOKA 1T08B 3GYHX 4IOAF 1ZYRF 4LFUA 3HTSB 1RKTA 5FLMJ 4F52A 1HLVA 5B5EC 1X2NA 2QVOA 3ABKH 4FE7A 4HBLA 5IOYA 2EZIA 5LRSA 2K85A 2RQQA 2L7MP 5CVVA 5IT3A 4WXHA 2CQNA 2CFOA 3QOEA 2KKOA 4N9IA 3HOXJ 1WJBA 3GFJA 1J9IA 3B6CA 1ZREA 3MAJA 3ZN0A 3S1RJ 2E2JJ 1CF7B 1DU6A 1SANA 3RQ4A 2IAIA 3H0GJ 2YS9A 1TL8A 2XKOA 1R4NB 2QSHX 2M0MA 3NEUA 1UHMA 2L9NA 2Z99A 2ISYA 1XGNA 4QWQA 4MIMA 2HQAA 1MNMC 4LLGF 2M7BA 4RS8A 2P0WA 3GZNB 1FNNA 4U88A 4RGRA 3I4PA 2J5OA 1YI2I 3KFWX 1XCBA 1MH4A 5F0FA 1R9TJ 1H88C 2LYCA 2O61A 2I10A 5J1YA 1T98A 1G8XA 2XRLA 2M7AA 3K2AA 5E3LA 1OCTC 2BY3A 4RAZA 1AOYA 4XLCA 3Q9VA 3FKIJ 1JJ8C 4O6JA 2P6SA 4OAZA 2JSCA 1GHCA 3MQ0A 4HEA2 4A0ZA 3OSFA 2Y9ZA 2B7EA 2BVMA 3W2WA 1LEAA 2F4MB 1FPQA 2VUMJ 2ZJQF 3J7AY 2I8DA 4Q5SF 2Y2ZA 4CCOA 1QVTA 3W6VA 3RKYA 3OYBA 5LGTA 4G6TB 1VFCA 1VQOI 1KYZA 3ZRGA 4M9ZA 2G0EA 1G6NA 2DYRH 4ZYHA 3BG7A 1YS7A 3PQKA 1W0TA 5EDNA 2ZJPF 2HQNA 2I5UA 3QWLA 3R60A 3RYPA 5KK1A 1JKPC 2VPLA 2MLKA 3DP7A 3QPTA 5BOXA 2EV0A 3OMYA 1TC3C 2CUFA 3FISA 5IT9Z 5D6FA 3K4LA 4B09A 3OIOA 1QVUA 3EUHA 2F5CA 2GAUA 2RN7A 2E19A 4RGXA 1UHSA 2COBA 2KZGA 4RGUA 1UZCA 2O9LA 4V2GA 4KIGA 4M9XA 2DPUA 2COMA 4H0EA 2OV7A 3TDUC 3JRDA 2KL4A 2WAQN 1P9QC 3DLAA 2LDUA 3GW2A 4XLFA 3L9FA 4B43A 1ZLKA 1D3YA 3QRFF 1ZELA 5E79C 1Z21A 1G2HA 2NAZA 2DYSH 3DPLC 4A3KJ 1U6GA 2JSPA 3CUQC 3K1MA 1WH7A 3MKWB 3QP6A 2HOEA 2VT2A 3TGNA 3FHZA 2L5QA 4OIOF 3M7GA 3OYIA 1FIPA 1QQIA 1DQUA 4PJJA 4EJUA 3ZMTA 1MZBA 2VN2A 2DCEA 3MMYB 1U8BA 5CQGA 5HOOA 2ZSHB 1CGPA 3R0JA 1GUUA 3F8NA 1OCPA 3SEQA 4CCJA 1UCRA 1MKMA 4A93J 4M3EA 2NRAC 2L7KA 2P8TA 2MA3A 4C9YA 3TMOA 3A03A 2IXSA 3SZPA 1DU0A 1YOVB 2K9NA 4MO7A 4IHXA 4Q48A 4IOCF 3OS1A 1UG2A 2OF7A 5CQEA 5HS7A 2HKXA 2Z9OA 1D1CA 1P7IA 2VPRA 4XLHA 2UXXA 1QGPA 3RZOJ 3BR6A 3E7LA 3VSLA 2AQEA 2DOEA 5J4YA 5TJJA 5JVGF 3BR0A 3BLYA 1XB4A 3KPHA 1QO0D 1Z91A 1ODDA 4LLLA 2MG4A 1RR7A 2GZWA 3MFKA 4IO9F 1R5HA 3CJRB 1RPWA 1R4MB 1TWCJ 1UAAA 5K5QA 5DS9A 1TQIA 3HJEA 4OAYA 4I01A 3S14J 4YEJA 4I7HA 4OMZA 3OYKA 3OYGA 2FUG2 1G4DA 3KYCB 4B1RA 2KRFA 3DTEA 3OL4A 4HNUA 3PFIA 3HUGA 3QPHA 3KP5A 4HNTA 1YFHA 1FIAA 2JT1A 2VQGA 2P5LC 2HI3A 2PMZA 2XC7A 4LG0A 4O3MA 2EH3A 4ZC3A 1L3LA 5FKLA 4XRSA 3ZP5A 4MLOA 4RM2A 2FNAA 1ACIA 4G6QA 2EZKA 2L3DA 4EEFG 4ZJZA 2DT6A 2H09A 3BZ6A 5H6RA 2CUEA 1MGTA 2K9SA 4NQWB 4AVPA 1R00A 4B3AA 3HOTA 3RIRA 1YITI 3SEZA 2EIJH 1I27A 2XAUA 3Q9SA 2EPFA 5ICEA 2UV1A 3K4CA 1KU3A 4AM3A 2R7XA 3ABLH 1WHUA 3BR5A 5B66C 3FIWA 1R5ID 3DXJF 3OV8A 1Y39A 1IV6A 3I0TA 2M45A 4BE1A 2MH2A 3HSEA 2IVMA 4DIQA 2B9SA 3LNQA 3M9AA 1XMXA 4YFNF 4WWCA 3NWTA 1A04A 2WAFA 1VNDA 3RPUA 1Y1VJ 2FU4A 3VYSB 3AFHA 2EA2A 2F4OB 2FX0A 2LVSA 2VJ4A 2ZXIA 2D2WA 1WCMJ 1AA7A 1RKWA 2LFBA 3JRCA 4HQEA 3K4MA 3IWFA 3C7JA 3C1DA 1T2KA 3MKZA 4ZYGA 1UMQA 2DDBA 1OISA 3TDZC 2F2EA 1S9HA 1WKMA 3DEUA 3ZPLA 2L7ZA 2VQCA 2X1CA 3G4SI 2XIGA 2WV0A 4YG2F 4E7LA 3V7RA 5C44J 4BQNA 1G3SA 3FXQA 3LSKA 3CLOA 3X2QH 1QZEA 4E4HA 2KIFA 2K5CA 3HHGA 1K7AA 3QYFA 1T6SA 1T8IA 1YLFA 1ZK8A 2DI3A 1Y0NA 3DBLB 4P1WA 2XAGA 3O6BB 5C4JJ 2QLZA 2XSJC 1HQCA 1ETVA 3EQLF 1ORKA 2CUZA 3W6KB 3MVPA 2E1MB 2WY8Q 4QPOA 3H9JA 3FDYA 4A3LJ 1FBUA 4BEHB 1KONA 4Y15A 3OYCA 3H3VK 1JXSA 2OQGA 3DCFA 2F6CA 2VL8A 1IUYA 1VQ5I 4ZYDA 4FQGA 5J6XA 1G3YA 3WTYC 3I64A 1ZARA 4ON0A 4A3FJ 3W2AA 3TP3A 4XONA 1JGSA 1WJ5A 2IP2A 4XSXF 2XPUA 2Z1DA 1XDUA 3WU2C 1N75A 1E17A 2LBFB 2X48A 3I56I 1MBHA 4OINF 2GA2A 3KEYA 2QSFX 3IRRA 2BHYA 1PVEA 2D1HA 1Z05A 2BYVE 4BH9A 2RC4A 1B6AA 4HLXA 4U7DA 2GXBA 1MW7A 3LQQA 5E1XA 4G6DA 3QP5A 1U9OA 1XSXA 1W7PD 1FBSA 3REOA 2R5YB 1B1BA 5EGOB 2OJED 4D5CA 3DU5A 1LE8B 2VXDA 4N4OB 2A05A 5F0HA 4QTRA 4BE2A 2ZSIB 3B02A 4I0BA 1O4XA 4IXAA 4UB8C 4V19K 3BTIA 1WJFA 4CSWA 4EJVA 3Q3SA 1S5LC 1WI3A 1BI0A 2JA5J 2IS1A 2NOGA 3BTCA 5E3NA 4WXCA 2R5ZB 2GXAA 5DV5A 3I4MJ 1Z0XA 2L2OA 3P7NA 1OR7A 3GX4X 4M3BA 3EUKL 3HIFA 3PNYA 3PUFA 2W00A 2NYXA 1V5GA 1NH3A 1BOAA 3ECHA 3QU6A 2VODA 3T8TA 5FLXZ 3HEFA 1VZ0A 2YX4A 4A6DA 4ABZA 1F9NA 3K7AJ 3WTTC 3JREA 1YIJI 1LDKB 1YRNB 5F04A 3CJNA 4P9UA 2ESNA 3FMQA 2YPRA 3WG9A 2FRHA 2Q2EB 5M5WJ 2CG4A 3JTGA 3R61A 2B63J 5KVRA 2OTJI 3L2UA 1NK3P 2V9KA 3MWMA 1W5SA 1D8JA 3LA7A 4AUXA 5CVRA 2JPBA 2BXYA 3ROUA 4I2OA 3J80Z 1HKSA 2W57A 2VJIA 1IJWC 2QQ9A 2E7XA 1JUMA 3GFIA 4U0YA 2W82A 5AIQA 2LRDA 5GPAA 4L9NA 1FTTA 3KLOA 3KLNA 2WV1A 3SZTA 5IYCJ 2W1OA 1I6XA 2DU9A 3S93A 3SQNA 3S3MA 4UY8I 2KJCA 5IP7J 4MEXF 4E7HA 2X1DA 3ZR8X 3DBHB 4XLPF 1FOYA 4AU7A 2VONA 5HDGA 3CCEI 1IO2A 2GIVA 3G1MA 3U9GA 4M72A 3JRHA 2XGXA 1DP7P 1T56A 3E97A 4IEJA 2ZKZA 3HG9A 2EIKH 2MD5A 4UUSA 3ZQCA 2E2HJ 2ECBA 1LFPA 1E3OC 3RYRA 3KCCA 3CCMI 1O3TA 4XORA 4M3GA 3FZVA 2CW7A 3WE3A 2LF8A 1ON1A 1SFKA 3TO9A 1B9NA 1VQ8I 3TOAA 1DUXC 3TO6A 1J59A 1BR2A 1JE8A 4CYCA 1ETWA 4HA8A 3FHNA 4CDGA 3ZQFA 2Y0SA 3VSKA 3VDXA 4XNFA 2JRTA 3H5NA 5FRNA 2FOKA 1MSFC 3L2WA 2X6OA 4G8XA 3LSPA 1BI3A 3F3XA 5E17F 2NVTJ 2EZLA 2DXIA 1UHWA 2IJLA 4XR6A 1Z7UA 4KNYA 4HF0A 1TT0A 2OZ6A 3CESA 2XAJA 1LDDA 2M2EA 1H9TA 2LKPA 5K1YA 3Q0WA 2HVQA 1PUFA 3CQZJ 3AG3H 3GZ5A 2LBFA 5KAIC 2DLLA 3KETA 1JKRC 1ZRCA 1POGA 3DKXA 2YX7A 2XF6A 2LTPA 4WXDA 1ZGWA 1MDMA 4RA2A 1XN7A 3ZCOA 1I50J 1MH3A 2LKSA 4N9HA 1SFOJ 2EFQA 2M30A 2RQPA 2PMZN 1LFUP 5JLXA 4HG2A 3RI4A 1R1VA 4Z6YA 4RB2C 3BPXA 4KT6A 1IC8A 1S29A 2XKPA 5KAFC 1ERDA 3ERMA 2LD5A 3KP6A 5DUIA 2KZVA 4IRHA 1QU3A 5LLQA 2CW0F 4BL0B 5GPCA 2VBWA 3HL2A 3K2ZA 6PAXA 5CYVA 3FBIB 1K78B 4M73A 5EF6A 1BR1A 1HXDA 1XD7A 4BJ5C 1R22A 3ML6A 3J81Z 2IRFG 4MFDA 4C2UA 3MZ8A 1IRFA 5EYRA 3HOWJ 5F08A 2LP0A 4IHWA 1E3HA 5FKMA 1K78A 4BBRJ 1BN5A 3DPTA 3E5QA 1ON2A 4UUTA 1OR7C 3W3CA 2GIZA 3E6CC 4KITB 3A0HC 1JHHA 2E1MC 3OYHA 1LUJB 1WFXA 3BJOA 4HNVA 1PJRA 4XKWA 4F93B 1K6YA 5ICGA 2A6TA 2LY9A 4L9JA 3WTSC 2M5WA 3F9KA 1VQKI 1IXRC 2X6WA 5F0CA 1KU7A 4MFEA 1A6QA 1WJCA 1E2XA 5FJ8J 1N77A 3G3ZA 1S7AA 1RRJA 3FXKA 4UVCA 1VQPI 2HQRA 1HW5A 1K4TA 2IBDA 4X1EA 1O7FA 2LH9A 3RPQA 3ZOBA 4I0AA 4XN0A 5HLGA 2DPDA 3S1NJ 1EA3A 9ANTA 2CMPA 3ZMSA 4LD5A 1WVRA 2DJIA 2XUBA 3HOYJ 3ECOA 4RLQA 4OIPF 3VWBA 3HYIA 4CCKA 2EINH 2IGMA 4A6EA 3HHHA 2EFWA 3D5SC 2BBYA 3B6AA 3MEXA 5F64A 2YR2A 4HF2A 1Y8QB 1D1AA 3DQVC 2CV0A 3KZYA 3HOZJ 4GFBA 3GMEA 4N0BA 1VQMI 1ENHA 4GRIA 1ETQA 2L9VA 2HOTA 3C2BA 1YHQI 2DDAA 3OWTA 1PP8F 3KZZA 1JTYA 1KU9A 2K4JA 2IW5A 4FE4A 1LVAA 3MN2A 2OCCH 2KFDA 3RJPA 4W97A 1T95A 2R7UA 1RESA 5LRRA 2MYSA 2H1KA 3QPLA 4XMYA 3K69A 1O3RA 2E5ZA 4XKVA 1W5CC 5B1AH 5JI6A 4XN3A 3WU0A 4ZTFA 2KMUA 2E2IJ 3ZXSA 2Y0MA 3FXLA 1ZRDA 1YX3A 4D1QA 1A6IA 1EH6A 1OCRH 1IAWA 1IGNA 2W48A 1KQ9A 4EATA 2XROA 2KHMA 2Y0SN 1GXQA 2LOOA 2ZXWH 3FXJA 2QQ8A 3CF2A 1GXPA 4YIIA 1U9NA 2L9SA 3I59B 2A6HF 5DCMA 3W6JB 2R7WA 1R6RA 2VIXA 1ZG3A 3ONQA 4D7NA 4LG3A 2K27A 2WB1N 4HPQA 1MJAA 2VQHA 1W7PA 3FK7A 4M6YA 4HZFA 5IOZA 2EIMH 2KISA 1PUEE 4Y33A 1X1AA 1LEBA 4DYCA 2A07F 2VC1A 3OYMA 2MD0A 4LG0B 4XSZF 2WA0A 4X6AJ 4HV6A 1QPIA 1V54H 2D5VA 4XRMA 1MDMB 4MQ9F 5D4RA 2UWMA 2AXTC 1NG6A 2PMUA 2QKMB 4YELA 3A4CA 1IRXA 1ZR4A 1SC7A 4M3DA 2OTLI 3HC7A 1ONVA 1SD7A 5IYBJ 4RMNA 3K10A 4C3HJ 1BL0A 1XSDA 2WY7Q 5M5XJ 2BVLA 3L1PA 2X0LA 4BHPA 3AAFA 4ESFA 1BBYA 3BG6A 3AKZA 3BDDA 2HZDA 3ESWB 2FSWA 2BY1A 3OYDA 1DP3A 2M9HA 4PGGA 4NNJA 3QYEA 3IKVA 1XMKA 2ECCA 4DQ2A 1VF9A 4IJAA 3H9GA 4GO1A 4DBQA 2LKXA 1SMTA 5EEAA 1HDPA 4GXOA 3SXYA 3ABMH 3HKZN 2DA1A 4BDYA 1H89C 2XAQA 3CJTB 1MJBA 4RGSA 4IKFA 4HX4A 3C3WA 4G7OF 4WX9A 3MKYB 1X1BA 3GLLA 3C2HA 2L4AA 1FBQA 4JK1X 2R7QA 1GV2A 3VEPA 5JR3A 3G73A 3K4KA 2LK2A 3F6VA 3HM5A 4KYWA 3QPSA 3CCJI 2OZUA 2R4GA 2HNHA 2KJBA 3V7CA 2M87A 2JWTA 3PJRA 1I39A 1NTCA 4XRFA 2IGOA 3COAC 3UR3C 5FLXK 2G7UA 2ZNZA 5E1WA 3OOPA 1X19A 2B0LA 5CLSA 1XPXA 2D1VA 3QOPA 2W4SA 3K1PA 5E8IA 5BPDA 3FMSA 4LGWA 2E35A 1QRYA 2DQRA 4DYQA 2H6CA 1LVKA 2LY1A 2FMYA 2GOXB 2HGCA 2HWVA 4UUSB 4ENMA 5D5WB 3CUQA 5GAGJ 5H20A 5J3LA 2GA1A 3HDDA 5LHHA 4X0GA 1U2WA 2VASA 3S2WA 1X4PA 1O3SA 4BAYA 1FMVA 3JRFA 3F8BA 2XHKA 2A6EF 3AG2H 4GYGA 1EH7A 3TW7A 2PEXA 1HOMA
chains in the Genus database with same CATH topology
1IF1A 2ZXJA 1D8KA 4CGZA 3CDHA 2E1CA 2EJRA 1IN4A 3WTUC 1IW7F 3WGIA 4PZJA 2FE3A 4GYIA 1BC8C 1O57A 1OYWA 3MZHA 4KT5C 4ENKA 3V4GA 3F22A 3E6MA 2DBBA 1CF7A 2CYYA 2QQAA 4G94A 5ILUA 2PFBA 4AD9A 1RNLA 1IN7A 4KN7X 1FT9A 3VFZA 1BC7C 4EM0B 3GUDA 2PBIA 4P9FA 4EM1A 2LNBA 1O3QA 2WC2A 1SD4A 5LEKA 4MTEA 1YTYA 3N97A 5BMZA 4A0YA 4A12A 3D5LA 4LJZF 1LDJA 3LSTA 2Q2EA 1HBXG 2C6YA 1LQ1A 1XGMA 1YG2A 5HLIA 2QBYB 1R1UA 4KMFA 2ESHA 3BY6A 2VOOA 1S6LA 2P4WA 4OIQF 2RKHA 2CO5A 4GGGA 1FLIA 1VTNC 1C0WA 2V79A 2MLGA 2OU2A 1U3EM 1IZ1A 4Z2YA 4JBAA 2GQQA 3KEQA 2O6GE 1ZLJA 1TLHB 3V8LA 3H3UA 5HLHA 2FNPA 1QPMA 4I98B 3GF2A 3TQNA 5AONA 3VODA 4U0VA 4ETSA 3FXUA 4AWXB 1QNTA 2FEZA 3J81K 3T1BA 2ZJ2A 1TQMA 3TOBA 2EA4A 4RB3C 2HR3A 2XAFA 4LK0F 4K2EA 1WWXA 3GFMA 1RZ4A 2P7VB 2MC3A 5L3EA 1XMAA 3E6DA 4IRGA 3KP3A 3KP4A 5HDNA 2P6TA 3K1NA 1BJAA 1KYWA 3F8CA 3RTRA 5LHIA 2Q0OA 5DYMA 1P4XA 3TKYA 1SFXA 4FT8A 4OIRF 1RUOA 4EJOA 2ACJA 4LB6B 2R7FA 2DAOA 3KP7A 4RB1A 1OYYA 2UXNA 5CJ9A 4PGHA 5EEHA 2L4MA 1HKTA 3BROA 5ICFA 1SMYF 2JPCA 2RVCA 1WI9A 2IA1A 3WODF 2M1BA 4ESJA 2UZKA 4LB5A 1B59A 3MCZA 4CZZA 4AIJA 2LF7A 2VBYA 3RKWA 2CGPA 2G7HA 2QBYA 2ZBKA 2NNYA 4BQAA 5DCFA 5D8LB 5L3CA 3ABUA 4YFXF 1Z9CA 3T0YA 3HSRA 4IRIA 1J2XA 1TTYA 2FQ3A 1KQ8A 3I54A 4EJTA 2Y48A 1USTA 3NRVA 1W4MA 2L02A 2ZNYA 4EVIA 4UVAA 2CWEA 5LHGA 2W84A 3EDPA 2QYOA 4GCVA 2YSRA 4UNOA 3J7AO 1U78A 5ICCA 1FYMA 2XVCA 3JSOA 1FP2A 4UV9A 3ZMDA 1B9MA 4L0YB 2J5PA 2W25A 3PQJA 2ZO4A 1USSA 2STWA 4HV5A 4P55A 2H94A 3GO5A 5HS9A 1QBJA 2PG4A 2X4HA 5LGNA 1I1GA 3P9CA 4L5IA 1UFMA 1WQ2A 4IHSA 2O8XA 4KIBA 2QWWA 1KQ0A 2DFIA 3E6BA 1QZYA 2F5DA 1O7LA 5D6EA 1W7PB 2AXLA 4CYDA 3HSFA 4CXFA 4M74A 5AIPA 4NHJA 1X3UA 2BEOA 2A3SA 5D5VB 3L7WA 1HSJA 2HYGD 2ISZA 3L00A 3U1DA 5ERIA 3WTZA 1AWCA 2CSOA 4KMUX 5L3GA 1Z6TA 3JSPA 1J75A 3R4KA 5HVQC 3HRSA 3BJAA 3F21A 1U5TC 5A2QZ 3P9KA 2VT3A 2ADUA 1EH8A 1XCVA 3I58A 1SFUA 1REPC 2D45A 4PCQA 5K5OA 3IKTA 1ZGAA 5FFXA 2EB7A 1FSEA 2HEOA 3BP8A 2DK5A 3E5XA 3JW4A 2FBIA 1I5ZA 5LBQA 3JAMZ 3E5UA 5E18F 3GFLA 2GXGA 3O2PE 1R1TA 2YU3A 1PDNC 2PQ8A 3CO7C 1H9GA 3D0SA 5JFRA 3C18A 4G7HF 2P5VA 2R7DA 4G7ZF 2Z5UA 1DPUA 1FYKA 1DDNA 4KDPA 1XGSA 3CTAA 3KEOA 2MH9A 3B73A 2FBHA 4A0XA 3CUOA 4EGZA 3RDIA 1TW2A 1MJ9A 4L9VA 3GZ6A 1R23A 4OMYA 2TDXA 2HZTA 3T5XA 4BHCA 4OOIA 3ZN1A 1KA8A 4BNCA 2BE5F 4G9YA 3ZMZA 2VE8A 5E20A 4WK8F 1BI2A 2GWRA 1LJ9A 3TO7A 5FB2A 3T8RA 4ZYEA 1YIOA 4ENNA 4A2UA 5CVIA 5D5XB 4EGYA 4I02A 3DFGA 1V3FA 1DPRA 3GWZA 4U7BA 4ASNA 4R79A 3I5UA 3F23A 4BXUA 5IT9K 5EEGA 4M9SA 2PN6A 2EWNA 4ZH4F 2EK5A 2EFOA 1ZRFA 1FX7A 1WRJA 4CO8A 2ZFWA 5ILSA 5LGUA 4MEYF 1TNSA 3ISPA 3WTWC 5L3DA 4E70A 3FXRA 2Y75A 4HQMA 2XASA 4U0WA 4MNUA 4ENJA 1YW8A 3ZMVA 3I71A 4EQQA 1YYVA 4UVBA 3WTXC 4HAMA 1G3WA 4P96A 4D0PA 4FX0A 2Z33A 4S05A 3M8FA 1MD0A 3IC7A 1HW2A 3WU1B 2ELHA 2XRNA 4IPAA 5HS8A 1R58A 3VB2A 2RDPA 1OMIA 3F6OA 5HDKA 3ULQB 4IF4A 2O0YA 3F72A 4RB0A 2V6CA 3QAHA 5F6FA 3V8JA 4I09A 3LAPA 1LNWA 3FM3A 1RI7A 2A61A 1NHAA 1BI1A 1FYLA 1YS6A 2LSOA 2VBXA 2Q8KA 2DO7A 3F8MA 1KU2A 5D8KB 4IHTA 2QUFA 1IN8A 1FZPB 4MTDA 1J0RA 3IWZA 4YFKF 4Q4ZF 2ZMEA 3O3KA 3WTVC 3FX3A 4LLNA 2QENA 4UXNA 1S3JA 4RAYA 1YO5C 4L9TA 2EV5A 4WCGA 2V1UA 1L0OC 5BS6A 4HX8A 5JVTA 1U5TA 2OBPA 1XDSA 1J7KA 4P5OA 3FWEA 3HTUA 4KIFA 3BOQA 1R5GA 3KE2A 4EV0A 3EYYA 3K9TA 2IA2A 2QZ8A 2OAZA 1XGOA 1TQPA 2A5YB 3FM5A 2K02A 1P4AA 4MHGA 1HKQA 1ZG5A 5DEQA 2BV6A 2OA4A 5FO5A 4QLCU 4MGRA 5DDGA 5FFZA 2FXAA 2DQLA 2FBKA 1ZGJA 2P5KA 4AIKA 1ZN2A 3GVAA 2HFHA 3ZQ7A 1ULYA 5D5UB 5ILVA 4HX7A 2EFPA 5E1ZB 4O5VA 4UHTA 2W24A 1H0MA 2KIMA 2W85A 4ESBA 2FA5A 4YIFA 1IXSB 3R6SA 2G9WA 4OU0A 3HRUA 2CFXA 4PDKA 2A68F 2HTSA 1PP7U 2NS0A 1TBXA 1FWZA 3WE2A 1Z6RA 2PJPA 2DW4A 2E7WA 4M6XA 2HTJA 3V7SA 2STTA 2OQRA 4LK1F 1OPCA 1ZAOA 1TW3A 1UB9A 2PI0A 3LWFA 3I53A 4A5MA 2FF4A 3GLXA 3WGGA 1F1ZA 1P2FA 5L3FA 4S04A 4EJWA 2EV6A 2Z3YA 3H3ZA 1T39A 1EV7A 2V1DA 1Y0UA 2F5EA 2DTRA 1FC3A 3R0AA 1KGSA 4AIHA 1BIAA 5DD8A 4DNCA 5E8GA 1T0FA 5K5RA 2O3FA 4BHBA 3IRQA 4XBFA 3BJ6A 3L2CA 2HDCA 3SFZA 5D4SA 2F5FA 1JHFA 1IRGA 2O03A 2BGCA 5DD4A 1U5TB 1ZG1A 5LEJA 3P9IA 1IN5A 1F4KA 1LB2A 2WWYA 3K0LA 3LA3A 1K79A 1SFEA 5CVJA 5J8FA 1J5YA 1RUNA 2QM3A 1U8RA 1YW9A 3I59A 5DCMB 4R8HA 1B4AA 2JZYA 2DT5A 2K4BA 1YW7A 2CQKA 1I1SA 2V1XA 4KICA 3ZMUA 4A5NA 3GEZA 2VE9A 3N4MA 2H27A 5DUKA 4HW0A 1P6RA 3KP2A 3LFKA 2RV8A 4NB5A 3DF8A 4Q47A 1FP1D 3L09A 4L5JA 3FMRA 4LMYA 2JTVA 4HYEA 3E3VA 3M1EA 2RGVA 2M8EA 1Q1HA 1R36A 1HSTA 4NQWA 4EMSA 4BYYA 1G3TA 1BM9A 1FY7A 2MBFA 2RNJA 5FD6A 3U2RA 3ABTA 4HLYA 5L3BA 4L18B 4UUVA 4IVNA 2H6BA 2QQBA 5J8CA 1ZHFA 5A2QK 3RKXA 3M8EA 2HYFA 4M71A 3GXOA 4Y13A 4FHTA 3MZYA 5BQTA 4ZZLA 2ZMEB 3JTHA 3BWGA 2VXZA 3EYIA 1ZH5A 3BPVA 1P4WA 1YQAA 3LAJA 3ERED 1D5VA 3WGHA 4FX4A 2VOPA 1GVJA 1FSHA 1S7OA 2VC0A 5CVUA 1V4RA 3H92A 2IPQX 1T38A 1OKRA 1SD6A 2PMHA 3DV8A 4KUMA 4UV8A 2A69F 4MQVA 2FMLA 2WTEA 2E1NA 2L01A 2OD5A 1F5TA 4TV7A 4HDVA 2HS5A 4XLNF 2P7CB 3FF5A 4HF1A 1HW1A 2IT0A 1XSVA 3EETA 1K6OA 4R1HA 2R3SA 5TRDA 2KIUA 1WSUA 3QU3A 1S8NA 1RIOH 4KA4A 2IA0A 2HKOA 1TNTA 2DK8A 3HRMA 3SHFA 2ETHA 1SD5A 2ZCWA 2AS5F 2XAHA 5FD5A 3IHUA 1R7JA 2V9VA 3V8KA 3IL2A 3DKWA 5BPIA 4WF2A 5JHUA 2VBZA 3J80K 4KN4X 2K86A 2NNNA 1STZA 3JAMK 3CO6C 2XV4S 4F7ZA 1P92A 1W5TA 2PLYA 3NQOA 3VOEA 1IN6A 1OYIA 3F8FA 3HRTA 5F1RA 4ZZDA 5FGMA 1Z1DA 4HDUA 3LA2A 5ED4A 4CICA 3ELKA 1QZZA 2L54A 2K7LA 3CUQB 4HOBA 1BIBA 3HOSA 4B8XA 2EFNA 4EM2A 4L0ZB 4KFCA 1SAXA 3LQRA 4CHUA 4Y17A 3Q5FA 1IXCA 4JQFA 5H6QA 1FOKA 3GYHX 1ZYRF 4LFUA 3HTSB 2QVOA 4HBLA 5LRSA 5CVVA 5IT3A 4WXHA 4N9IA 2KKOA 3GFJA 1J9IA 1ZREA 3MAJA 3ZN0A 1CF7B 2XKOA 3NEUA 1UHMA 4QWQA 2ISYA 1XGNA 2Z99A 4LLGF 4RS8A 1FNNA 4U88A 4RGRA 3I4PA 2J5OA 3KFWX 1XCBA 2O61A 1T98A 4RAZA 1AOYA 3Q9VA 4O6JA 2P6SA 2JSCA 1GHCA 3MQ0A 4A0ZA 1LEAA 1FPQA 4Q5SF 3RKYA 5LGTA 1KYZA 4M9ZA 1G6NA 4ZYHA 1YS7A 3PQKA 2HQNA 3RYPA 3R60A 5KK1A 2MLKA 3DP7A 3QPTA 5BOXA 2EV0A 5IT9Z 5D6FA 4B09A 3EUHA 2F5CA 2GAUA 2RN7A 4RGXA 4RGUA 4KIGA 4M9XA 2DPUA 2COMA 4H0EA 3TDUC 2LDUA 3GW2A 3L9FA 1ZLKA 1D3YA 3QRFF 2NAZA 3DPLC 1U6GA 3CUQC 3K1MA 3QP6A 2HOEA 2VT2A 3TGNA 3FHZA 4OIOF 3M7GA 1QQIA 4EJUA 3ZMTA 1MZBA 2VN2A 5HOOA 1CGPA 3R0JA 3F8NA 1UCRA 1MKMA 2NRAC 2P8TA 2MA3A 3SZPA 4Q48A 5HS7A 2HKXA 2Z9OA 2UXXA 1QGPA 5TJJA 1XB4A 1QO0D 1Z91A 1ODDA 4LLLA 3MFKA 2GZWA 1R5HA 5K5QA 1TQIA 4I01A 4I7HA 4OMZA 1G4DA 2KRFA 3PFIA 3HUGA 3QPHA 3KP5A 1YFHA 2JT1A 2P5LC 4LG0A 4O3MA 1L3LA 3ZP5A 2FNAA 4G6QA 2L3DA 2H09A 3BZ6A 5H6RA 1MGTA 4AVPA 1R00A 3HOTA 3RIRA 1I27A 3Q9SA 5ICEA 1KU3A 3DXJF 3OV8A 3I0TA 2M45A 2MH2A 3HSEA 2IVMA 3M9AA 4YFNF 4WWCA 1A04A 3RPUA 2FU4A 2EA2A 2D2WA 4HQEA 3IWFA 3C7JA 3C1DA 1T2KA 4ZYGA 3TDZC 2F2EA 3DEUA 1WKMA 3ZPLA 2XIGA 2WV0A 4YG2F 3V7RA 1G3SA 3FXQA 3CLOA 2KIFA 3HHGA 1K7AA 1T6SA 1YLFA 2DI3A 2XAGA 3O6BB 2QLZA 1HQCA 3EQLF 3W6KB 1FBUA 4Y15A 1JXSA 2OQGA 1IUYA 4ZYDA 5J6XA 1G3YA 3WTYC 3I64A 1ZARA 4ON0A 1JGSA 2IP2A 4XSXF 1XDUA 1E17A 4OINF 2GA2A 3IRRA 2D1HA 1Z05A 2BYVE 4BH9A 2RC4A 1B6AA 4HLXA 4U7DA 2GXBA 3LQQA 5E1XA 4G6DA 3QP5A 1XSXA 1W7PD 1FBSA 3REOA 1B1BA 3B02A 4I0BA 4IXAA 4EJVA 1BI0A 4WXCA 5DV5A 3P7NA 1OR7A 3GX4X 3HIFA 2NYXA 1BOAA 3ECHA 3QU6A 2VODA 3T8TA 5FLXZ 2YX4A 4A6DA 1F9NA 3WTTC 1LDKB 3CJNA 4P9UA 2ESNA 3FMQA 2YPRA 3WG9A 2FRHA 2CG4A 3JTGA 3R61A 5KVRA 3MWMA 1W5SA 1D8JA 3LA7A 5CVRA 2JPBA 3ROUA 4I2OA 3J80Z 1HKSA 2W57A 2QQ9A 2E7XA 3GFIA 4U0YA 5AIQA 4L9NA 3KLOA 3KLNA 3SZTA 1I6XA 2DU9A 3SQNA 2KJCA 4MEXF 4XLPF 2VONA 5HDGA 2GIVA 3U9GA 1DP7P 4M72A 2XGXA 3E97A 2ZKZA 2MD5A 3RYRA 3KCCA 1O3TA 3FZVA 3WE3A 2LF8A 1ON1A 3TO9A 1B9NA 3TOAA 1DUXC 3TO6A 1J59A 1JE8A 4HA8A 4CDGA 2JRTA 2FOKA 4G8XA 1BI3A 3F3XA 5E17F 1UHWA 2IJLA 4KNYA 1Z7UA 4HF0A 2OZ6A 2XAJA 1LDDA 1H9TA 2LKPA 5K1YA 3GZ5A 2DLLA 3KETA 1ZRCA 2YX7A 4WXDA 1MDMA 1XN7A 4N9HA 2EFQA 2M30A 2RQPA 3RI4A 1R1VA 4RB2C 3BPXA 1S29A 2XKPA 3KP6A 5DUIA 4IRHA 5LLQA 2CW0F 6PAXA 2VBWA 3K2ZA 5CYVA 1K78B 4M73A 1HXDA 1XD7A 1R22A 3ML6A 3J81Z 2IRFG 1IRFA 1K78A 1BN5A 3DPTA 3E5QA 1ON2A 3E6CC 1JHHA 3BJOA 5ICGA 4L9JA 3WTSC 2M5WA 1IXRC 1KU7A 1E2XA 3G3ZA 1S7AA 4UVCA 2HQRA 1HW5A 3RPQA 1O7FA 5HLGA 4I0AA 2DPDA 3ZMSA 4LD5A 2XUBA 3ECOA 4OIPF 3HYIA 4A6EA 3HHHA 2EFWA 2BBYA 3MEXA 5F64A 2YR2A 4HF2A 3DQVC 3KZYA 4N0BA 1PP8F 3KZZA 1KU9A 2K4JA 2IW5A 1LVAA 3RJPA 5LRRA 3K69A 1O3RA 5JI6A 3WU0A 2Y0MA 1ZRDA 1EH6A 1IAWA 1KQ9A 2XROA 1GXQA 1GXPA 4YIIA 3I59B 2A6HF 5DCMA 3W6JB 1ZG3A 2K27A 1MJAA 1W7PA 4M6YA 4HZFA 1PUEE 1LEBA 2A07F 2VC1A 4LG0B 4XSZF 4HV6A 1MDMB 4MQ9F 5D4RA 2UWMA 2PMUA 1ONVA 1SD7A 1XSDA 2X0LA 4BHPA 3AAFA 4ESFA 1BBYA 3BDDA 2FSWA 4PGGA 3IKVA 1XMKA 4DQ2A 4IJAA 4GO1A 1SMTA 4GXOA 3SXYA 2XAQA 1MJBA 4RGSA 4G7OF 4HX4A 3C3WA 4WX9A 2L4AA 1FBQA 4JK1X 3VEPA 5JR3A 3G73A 3F6VA 4KYWA 2OZUA 2KJBA 3V7CA 2M87A 4XRFA 3COAC 5FLXK 2G7UA 2ZNZA 5E1WA 3OOPA 2B0LA 5CLSA 2D1VA 3QOPA 3K1PA 5E8IA 5BPDA 3FMSA 4LGWA 2DQRA 2H6CA 2FMYA 2HGCA 2HWVA 4ENMA 5D5WB 3CUQA 5H20A 2GA1A 5LHHA 1U2WA 3S2WA 1O3SA 4BAYA 3F8BA 2XHKA 2A6EF 4GYGA 1EH7A 2PEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IF1 A;  2ZXJ A;  1D8K A;  4CGZ A;  3CDH A;  2E1C A;  2EJR A;  1IN4 A;  3WTU C;  1IW7 F;  3WGI A;  4PZJ A;  2FE3 A;  4GYI A;  1BC8 C;  1O57 A;  1OYW A;  3MZH A;  4KT5 C;  4ENK A;  3V4G A;  3F22 A;  3E6M A;  2DBB A;  1CF7 A;  2CYY A;  2QQA A;  4G94 A;  5ILU A;  2PFB A;  4AD9 A;  1RNL A;  1IN7 A;  4KN7 X;  1FT9 A;  3VFZ A;  1BC7 C;  4EM0 B;  3GUD A;  2PBI A;  4P9F A;  4EM1 A;  2LNB A;  1O3Q A;  2WC2 A;  1SD4 A;  5LEK A;  4MTE A;  1YTY A;  3N97 A;  5BMZ A;  4A0Y A;  4A12 A;  3D5L A;  4LJZ F;  1LDJ A;  3LST A;  2Q2E A;  1HBX G;  2C6Y A;  1LQ1 A;  1XGM A;  1YG2 A;  5HLI A;  2QBY B;  1R1U A;  4KMF A;  2ESH A;  3BY6 A;  2VOO A;  1S6L A;  2P4W A;  4OIQ F;  2RKH A;  2CO5 A;  4GGG A;  1FLI A;  1VTN C;  1C0W A;  2V79 A;  2MLG A;  2OU2 A;  1U3E M;  1IZ1 A;  4Z2Y A;  4JBA A;  2GQQ A;  3KEQ A;  2O6G E;  1ZLJ A;  1TLH B;  3V8L A;  3H3U A;  5HLH A;  2FNP A;  1QPM A;  4I98 B;  3GF2 A;  3TQN A;  5AON A;  3VOD A;  4U0V A;  4ETS A;  3FXU A;  4AWX B;  1QNT A;  2FEZ A;  3J81 K;  3T1B A;  2ZJ2 A;  1TQM A;  3TOB A;  2EA4 A;  4RB3 C;  2HR3 A;  2XAF A;  4LK0 F;  4K2E A;  1WWX A;  3GFM A;  1RZ4 A;  2P7V B;  2MC3 A;  5L3E A;  1XMA A;  3E6D A;  4IRG A;  3KP3 A;  3KP4 A;  5HDN A;  2P6T A;  3K1N A;  1BJA A;  1KYW A;  3F8C A;  3RTR A;  5LHI A;  2Q0O A;  5DYM A;  1P4X A;  3TKY A;  1SFX A;  4FT8 A;  4OIR F;  1RUO A;  4EJO A;  2ACJ A;  4LB6 B;  2R7F A;  2DAO A;  3KP7 A;  4RB1 A;  1OYY A;  2UXN A;  5CJ9 A;  4PGH A;  5EEH A;  2L4M A;  1HKT A;  3BRO A;  5ICF A;  1SMY F;  2JPC A;  2RVC A;  1WI9 A;  2IA1 A;  3WOD F;  2M1B A;  4ESJ A;  2UZK A;  4LB5 A;  1B59 A;  3MCZ A;  4CZZ A;  4AIJ A;  2LF7 A;  2VBY A;  3RKW A;  2CGP A;  2G7H A;  2QBY A;  2ZBK A;  2NNY A;  4BQA A;  5DCF A;  5D8L B;  5L3C A;  3ABU A;  4YFX F;  1Z9C A;  3T0Y A;  3HSR A;  4IRI A;  1J2X A;  1TTY A;  2FQ3 A;  1KQ8 A;  3I54 A;  4EJT A;  2Y48 A;  1UST A;  3NRV A;  1W4M A;  2L02 A;  2ZNY A;  4EVI A;  4UVA A;  2CWE A;  5LHG A;  2W84 A;  3EDP A;  2QYO A;  4GCV A;  2YSR A;  4UNO A;  3J7A O;  1U78 A;  5ICC A;  1FYM A;  2XVC A;  3JSO A;  1FP2 A;  4UV9 A;  3ZMD A;  1B9M A;  4L0Y B;  2J5P A;  2W25 A;  3PQJ A;  2ZO4 A;  1USS A;  2STW A;  4HV5 A;  4P55 A;  2H94 A;  3GO5 A;  5HS9 A;  1QBJ A;  2PG4 A;  2X4H A;  5LGN A;  1I1G A;  3P9C A;  4L5I A;  1UFM A;  1WQ2 A;  4IHS A;  2O8X A;  4KIB A;  2QWW A;  1KQ0 A;  2DFI A;  3E6B A;  1QZY A;  2F5D A;  1O7L A;  5D6E A;  1W7P B;  2AXL A;  4CYD A;  3HSF A;  4CXF A;  4M74 A;  5AIP A;  4NHJ A;  1X3U A;  2BEO A;  2A3S A;  5D5V B;  3L7W A;  1HSJ A;  2HYG D;  2ISZ A;  3L00 A;  3U1D A;  5ERI A;  3WTZ A;  1AWC A;  2CSO A;  4KMU X;  5L3G A;  1Z6T A;  3JSP A;  1J75 A;  3R4K A;  5HVQ C;  3HRS A;  3BJA A;  3F21 A;  1U5T C;  5A2Q Z;  3P9K A;  2VT3 A;  2ADU A;  1EH8 A;  1XCV A;  3I58 A;  1SFU A;  1REP C;  2D45 A;  4PCQ A;  5K5O A;  3IKT A;  1ZGA A;  5FFX A;  2EB7 A;  1FSE A;  2HEO A;  3BP8 A;  2DK5 A;  3E5X A;  3JW4 A;  2FBI A;  1I5Z A;  5LBQ A;  3JAM Z;  3E5U A;  5E18 F;  3GFL A;  2GXG A;  3O2P E;  1R1T A;  2YU3 A;  1PDN C;  2PQ8 A;  3CO7 C;  1H9G A;  3D0S A;  5JFR A;  3C18 A;  4G7H F;  2P5V A;  2R7D A;  4G7Z F;  2Z5U A;  1DPU A;  1FYK A;  1DDN A;  4KDP A;  1XGS A;  3CTA A;  3KEO A;  2MH9 A;  3B73 A;  2FBH A;  4A0X A;  3CUO A;  4EGZ A;  3RDI A;  1TW2 A;  1MJ9 A;  4L9V A;  3GZ6 A;  1R23 A;  4OMY A;  2TDX A;  2HZT A;  3T5X A;  4BHC A;  4OOI A;  3ZN1 A;  1KA8 A;  4BNC A;  2BE5 F;  4G9Y A;  3ZMZ A;  2VE8 A;  5E20 A;  4WK8 F;  1BI2 A;  2GWR A;  1LJ9 A;  3TO7 A;  5FB2 A;  3T8R A;  4ZYE A;  1YIO A;  4ENN A;  4A2U A;  5CVI A;  5D5X B;  4EGY A;  4I02 A;  3DFG A;  1V3F A;  1DPR A;  3GWZ A;  4U7B A;  4ASN A;  4R79 A;  3I5U A;  3F23 A;  4BXU A;  5IT9 K;  5EEG A;  4M9S A;  2PN6 A;  2EWN A;  4ZH4 F;  2EK5 A;  2EFO A;  1ZRF A;  1FX7 A;  1WRJ A;  4CO8 A;  2ZFW A;  5ILS A;  5LGU A;  4MEY F;  1TNS A;  3ISP A;  3WTW C;  5L3D A;  4E70 A;  3FXR A;  2Y75 A;  4HQM A;  2XAS A;  4U0W A;  4MNU A;  4ENJ A;  1YW8 A;  3ZMV A;  3I71 A;  4EQQ A;  1YYV A;  4UVB A;  3WTX C;  4HAM A;  1G3W A;  4P96 A;  4D0P A;  4FX0 A;  2Z33 A;  4S05 A;  3M8F A;  1MD0 A;  3IC7 A;  1HW2 A;  3WU1 B;  2ELH A;  2XRN A;  4IPA A;  5HS8 A;  1R58 A;  3VB2 A;  2RDP A;  1OMI A;  3F6O A;  5HDK A;  3ULQ B;  4IF4 A;  2O0Y A;  3F72 A;  4RB0 A;  2V6C A;  3QAH A;  5F6F A;  3V8J A;  4I09 A;  3LAP A;  1LNW A;  3FM3 A;  1RI7 A;  2A61 A;  1NHA A;  1BI1 A;  1FYL A;  1YS6 A;  2LSO A;  2VBX A;  2Q8K A;  2DO7 A;  3F8M A;  1KU2 A;  5D8K B;  4IHT A;  2QUF A;  1IN8 A;  1FZP B;  4MTD A;  1J0R A;  3IWZ A;  4YFK F;  4Q4Z F;  2ZME A;  3O3K A;  3WTV C;  3FX3 A;  4LLN A;  2QEN A;  4UXN A;  1S3J A;  4RAY A;  1YO5 C;  4L9T A;  2EV5 A;  4WCG A;  2V1U A;  1L0O C;  5BS6 A;  4HX8 A;  5JVT A;  1U5T A;  2OBP A;  1XDS A;  1J7K A;  4P5O A;  3FWE A;  3HTU A;  4KIF A;  3BOQ A;  1R5G A;  3KE2 A;  4EV0 A;  3EYY A;  3K9T A;  2IA2 A;  2QZ8 A;  2OAZ A;  1XGO A;  1TQP A;  2A5Y B;  3FM5 A;  2K02 A;  1P4A A;  4MHG A;  1HKQ A;  1ZG5 A;  5DEQ A;  2BV6 A;  2OA4 A;  5FO5 A;  4QLC U;  4MGR A;  5DDG A;  5FFZ A;  2FXA A;  2DQL A;  2FBK A;  1ZGJ A;  2P5K A;  4AIK A;  1ZN2 A;  3GVA A;  2HFH A;  3ZQ7 A;  1ULY A;  5D5U B;  5ILV A;  4HX7 A;  2EFP A;  5E1Z B;  4O5V A;  4UHT A;  2W24 A;  1H0M A;  2KIM A;  2W85 A;  4ESB A;  2FA5 A;  4YIF A;  1IXS B;  3R6S A;  2G9W A;  4OU0 A;  3HRU A;  2CFX A;  4PDK A;  2A68 F;  2HTS A;  1PP7 U;  2NS0 A;  1TBX A;  1FWZ A;  3WE2 A;  1Z6R A;  2PJP A;  2DW4 A;  2E7W A;  4M6X A;  2HTJ A;  3V7S A;  2STT A;  2OQR A;  4LK1 F;  1OPC A;  1ZAO A;  1TW3 A;  1UB9 A;  2PI0 A;  3LWF A;  3I53 A;  4A5M A;  2FF4 A;  3GLX A;  3WGG A;  1F1Z A;  1P2F A;  5L3F A;  4S04 A;  4EJW A;  2EV6 A;  2Z3Y A;  3H3Z A;  1T39 A;  1EV7 A;  2V1D A;  1Y0U A;  2F5E A;  2DTR A;  1FC3 A;  3R0A A;  1KGS A;  4AIH A;  1BIA A;  5DD8 A;  4DNC A;  5E8G A;  1T0F A;  5K5R A;  2O3F A;  4BHB A;  3IRQ A;  4XBF A;  3BJ6 A;  3L2C A;  2HDC A;  3SFZ A;  5D4S A;  2F5F A;  1JHF A;  1IRG A;  2O03 A;  2BGC A;  5DD4 A;  1U5T B;  1ZG1 A;  5LEJ A;  3P9I A;  1IN5 A;  1F4K A;  1LB2 A;  2WWY A;  3K0L A;  3LA3 A;  1K79 A;  1SFE A;  5CVJ A;  5J8F A;  1J5Y A;  1RUN A;  2QM3 A;  1U8R A;  1YW9 A;  3I59 A;  5DCM B;  4R8H A;  1B4A A;  2JZY A;  2DT5 A;  2K4B A;  1YW7 A;  2CQK A;  1I1S A;  2V1X A;  4KIC A;  3ZMU A;  4A5N A;  3GEZ A;  2VE9 A;  3N4M A;  2H27 A;  5DUK A;  4HW0 A;  1P6R A;  3KP2 A;  3LFK A;  2RV8 A;  4NB5 A;  3DF8 A;  4Q47 A;  1FP1 D;  3L09 A;  4L5J A;  3FMR A;  4LMY A;  2JTV A;  4HYE A;  3E3V A;  3M1E A;  2RGV A;  2M8E A;  1Q1H A;  1R36 A;  1HST A;  4NQW A;  4EMS A;  4BYY A;  1G3T A;  1BM9 A;  1FY7 A;  2MBF A;  2RNJ A;  5FD6 A;  3U2R A;  3ABT A;  4HLY A;  5L3B A;  4L18 B;  4UUV A;  4IVN A;  2H6B A;  2QQB A;  5J8C A;  1ZHF A;  5A2Q K;  3RKX A;  3M8E A;  2HYF A;  4M71 A;  3GXO A;  4Y13 A;  4FHT A;  3MZY A;  5BQT A;  4ZZL A;  2ZME B;  3JTH A;  3BWG A;  2VXZ A;  3EYI A;  1ZH5 A;  3BPV A;  1P4W A;  1YQA A;  3LAJ A;  3ERE D;  1D5V A;  3WGH A;  4FX4 A;  2VOP A;  1GVJ A;  1FSH A;  1S7O A;  2VC0 A;  5CVU A;  1V4R A;  3H92 A;  2IPQ X;  1T38 A;  1OKR A;  1SD6 A;  2PMH A;  3DV8 A;  4KUM A;  4UV8 A;  2A69 F;  4MQV A;  2FML A;  2WTE A;  2E1N A;  2L01 A;  2OD5 A;  1F5T A;  4TV7 A;  4HDV A;  2HS5 A;  4XLN F;  2P7C B;  3FF5 A;  4HF1 A;  1HW1 A;  2IT0 A;  1XSV A;  3EET A;  1K6O A;  4R1H A;  2R3S A;  5TRD A;  2KIU A;  1WSU A;  3QU3 A;  1S8N A;  1RIO H;  4KA4 A;  2IA0 A;  2HKO A;  1TNT A;  2DK8 A;  3HRM A;  3SHF A;  2ETH A;  1SD5 A;  2ZCW A;  2AS5 F;  2XAH A;  5FD5 A;  3IHU A;  1R7J A;  2V9V A;  3V8K A;  3IL2 A;  3DKW A;  5BPI A;  4WF2 A;  5JHU A;  2VBZ A;  3J80 K;  4KN4 X;  2K86 A;  2NNN A;  1STZ A;  3JAM K;  3CO6 C;  2XV4 S;  4F7Z A;  1P92 A;  1W5T A;  2PLY A;  3NQO A;  3VOE A;  1IN6 A;  1OYI A;  3F8F A;  3HRT A;  5F1R A;  4ZZD A;  5FGM A;  1Z1D A;  4HDU A;  3LA2 A;  5ED4 A;  4CIC A;  3ELK A;  1QZZ A;  2L54 A;  2K7L A;  3CUQ B;  4HOB A;  1BIB A;  3HOS A;  4B8X A;  2EFN A;  4EM2 A;  4L0Z B;  4KFC A;  1SAX A;  3LQR A;  4CHU A;  4Y17 A;  3Q5F A;  1IXC A;  4JQF A;  5H6Q A;  1FOK A;  3GYH X;  1ZYR F;  4LFU A;  3HTS B;  2QVO A;  4HBL A;  5LRS A;  5CVV A;  5IT3 A;  4WXH A;  4N9I A;  2KKO A;  3GFJ A;  1J9I A;  1ZRE A;  3MAJ A;  3ZN0 A;  1CF7 B;  2XKO A;  3NEU A;  1UHM A;  4QWQ A;  2ISY A;  1XGN A;  2Z99 A;  4LLG F;  4RS8 A;  1FNN A;  4U88 A;  4RGR A;  3I4P A;  2J5O A;  3KFW X;  1XCB A;  2O61 A;  1T98 A;  4RAZ A;  1AOY A;  3Q9V A;  4O6J A;  2P6S A;  2JSC A;  1GHC A;  3MQ0 A;  4A0Z A;  1LEA A;  1FPQ A;  4Q5S F;  3RKY A;  5LGT A;  1KYZ A;  4M9Z A;  1G6N A;  4ZYH A;  1YS7 A;  3PQK A;  2HQN A;  3RYP A;  3R60 A;  5KK1 A;  2MLK A;  3DP7 A;  3QPT A;  5BOX A;  2EV0 A;  5IT9 Z;  5D6F A;  4B09 A;  3EUH A;  2F5C A;  2GAU A;  2RN7 A;  4RGX A;  4RGU A;  4KIG A;  4M9X A;  2DPU A;  2COM A;  4H0E A;  3TDU C;  2LDU A;  3GW2 A;  3L9F A;  1ZLK A;  1D3Y A;  3QRF F;  2NAZ A;  3DPL C;  1U6G A;  3CUQ C;  3K1M A;  3QP6 A;  2HOE A;  2VT2 A;  3TGN A;  3FHZ A;  4OIO F;  3M7G A;  1QQI A;  4EJU A;  3ZMT A;  1MZB A;  2VN2 A;  5HOO A;  1CGP A;  3R0J A;  3F8N A;  1UCR A;  1MKM A;  2NRA C;  2P8T A;  2MA3 A;  3SZP A;  4Q48 A;  5HS7 A;  2HKX A;  2Z9O A;  2UXX A;  1QGP A;  5TJJ A;  1XB4 A;  1QO0 D;  1Z91 A;  1ODD A;  4LLL A;  3MFK A;  2GZW A;  1R5H A;  5K5Q A;  1TQI A;  4I01 A;  4I7H A;  4OMZ A;  1G4D A;  2KRF A;  3PFI A;  3HUG A;  3QPH A;  3KP5 A;  1YFH A;  2JT1 A;  2P5L C;  4LG0 A;  4O3M A;  1L3L A;  3ZP5 A;  2FNA A;  4G6Q A;  2L3D A;  2H09 A;  3BZ6 A;  5H6R A;  1MGT A;  4AVP A;  1R00 A;  3HOT A;  3RIR A;  1I27 A;  3Q9S A;  5ICE A;  1KU3 A;  3DXJ F;  3OV8 A;  3I0T A;  2M45 A;  2MH2 A;  3HSE A;  2IVM A;  3M9A A;  4YFN F;  4WWC A;  1A04 A;  3RPU A;  2FU4 A;  2EA2 A;  2D2W A;  4HQE A;  3IWF A;  3C7J A;  3C1D A;  1T2K A;  4ZYG A;  3TDZ C;  2F2E A;  3DEU A;  1WKM A;  3ZPL A;  2XIG A;  2WV0 A;  4YG2 F;  3V7R A;  1G3S A;  3FXQ A;  3CLO A;  2KIF A;  3HHG A;  1K7A A;  1T6S A;  1YLF A;  2DI3 A;  2XAG A;  3O6B B;  2QLZ A;  1HQC A;  3EQL F;  3W6K B;  1FBU A;  4Y15 A;  1JXS A;  2OQG A;  1IUY A;  4ZYD A;  5J6X A;  1G3Y A;  3WTY C;  3I64 A;  1ZAR A;  4ON0 A;  1JGS A;  2IP2 A;  4XSX F;  1XDU A;  1E17 A;  4OIN F;  2GA2 A;  3IRR A;  2D1H A;  1Z05 A;  2BYV E;  4BH9 A;  2RC4 A;  1B6A A;  4HLX A;  4U7D A;  2GXB A;  3LQQ A;  5E1X A;  4G6D A;  3QP5 A;  1XSX A;  1W7P D;  1FBS A;  3REO A;  1B1B A;  3B02 A;  4I0B A;  4IXA A;  4EJV A;  1BI0 A;  4WXC A;  5DV5 A;  3P7N A;  1OR7 A;  3GX4 X;  3HIF A;  2NYX A;  1BOA A;  3ECH A;  3QU6 A;  2VOD A;  3T8T A;  5FLX Z;  2YX4 A;  4A6D A;  1F9N A;  3WTT C;  1LDK B;  3CJN A;  4P9U A;  2ESN A;  3FMQ A;  2YPR A;  3WG9 A;  2FRH A;  2CG4 A;  3JTG A;  3R61 A;  5KVR A;  3MWM A;  1W5S A;  1D8J A;  3LA7 A;  5CVR A;  2JPB A;  3ROU A;  4I2O A;  3J80 Z;  1HKS A;  2W57 A;  2QQ9 A;  2E7X A;  3GFI A;  4U0Y A;  5AIQ A;  4L9N A;  3KLO A;  3KLN A;  3SZT A;  1I6X A;  2DU9 A;  3SQN A;  2KJC A;  4MEX F;  4XLP F;  2VON A;  5HDG A;  2GIV A;  3U9G A;  1DP7 P;  4M72 A;  2XGX A;  3E97 A;  2ZKZ A;  2MD5 A;  3RYR A;  3KCC A;  1O3T A;  3FZV A;  3WE3 A;  2LF8 A;  1ON1 A;  3TO9 A;  1B9N A;  3TOA A;  1DUX C;  3TO6 A;  1J59 A;  1JE8 A;  4HA8 A;  4CDG A;  2JRT A;  2FOK A;  4G8X A;  1BI3 A;  3F3X A;  5E17 F;  1UHW A;  2IJL A;  4KNY A;  1Z7U A;  4HF0 A;  2OZ6 A;  2XAJ A;  1LDD A;  1H9T A;  2LKP A;  5K1Y A;  3GZ5 A;  2DLL A;  3KET A;  1ZRC A;  2YX7 A;  4WXD A;  1MDM A;  1XN7 A;  4N9H A;  2EFQ A;  2M30 A;  2RQP A;  3RI4 A;  1R1V A;  4RB2 C;  3BPX A;  1S29 A;  2XKP A;  3KP6 A;  5DUI A;  4IRH A;  5LLQ A;  2CW0 F;  6PAX A;  2VBW A;  3K2Z A;  5CYV A;  1K78 B;  4M73 A;  1HXD A;  1XD7 A;  1R22 A;  3ML6 A;  3J81 Z;  2IRF G;  1IRF A;  1K78 A;  1BN5 A;  3DPT A;  3E5Q A;  1ON2 A;  3E6C C;  1JHH A;  3BJO A;  5ICG A;  4L9J A;  3WTS C;  2M5W A;  1IXR C;  1KU7 A;  1E2X A;  3G3Z A;  1S7A A;  4UVC A;  2HQR A;  1HW5 A;  3RPQ A;  1O7F A;  5HLG A;  4I0A A;  2DPD A;  3ZMS A;  4LD5 A;  2XUB A;  3ECO A;  4OIP F;  3HYI A;  4A6E A;  3HHH A;  2EFW A;  2BBY A;  3MEX A;  5F64 A;  2YR2 A;  4HF2 A;  3DQV C;  3KZY A;  4N0B A;  1PP8 F;  3KZZ A;  1KU9 A;  2K4J A;  2IW5 A;  1LVA A;  3RJP A;  5LRR A;  3K69 A;  1O3R A;  5JI6 A;  3WU0 A;  2Y0M A;  1ZRD A;  1EH6 A;  1IAW A;  1KQ9 A;  2XRO A;  1GXQ A;  1GXP A;  4YII A;  3I59 B;  2A6H F;  5DCM A;  3W6J B;  1ZG3 A;  2K27 A;  1MJA A;  1W7P A;  4M6Y A;  4HZF A;  1PUE E;  1LEB A;  2A07 F;  2VC1 A;  4LG0 B;  4XSZ F;  4HV6 A;  1MDM B;  4MQ9 F;  5D4R A;  2UWM A;  2PMU A;  1ONV A;  1SD7 A;  1XSD A;  2X0L A;  4BHP A;  3AAF A;  4ESF A;  1BBY A;  3BDD A;  2FSW A;  4PGG A;  3IKV A;  1XMK A;  4DQ2 A;  4IJA A;  4GO1 A;  1SMT A;  4GXO A;  3SXY A;  2XAQ A;  1MJB A;  4RGS A;  4G7O F;  4HX4 A;  3C3W A;  4WX9 A;  2L4A A;  1FBQ A;  4JK1 X;  3VEP A;  5JR3 A;  3G73 A;  3F6V A;  4KYW A;  2OZU A;  2KJB A;  3V7C A;  2M87 A;  4XRF A;  3COA C;  5FLX K;  2G7U A;  2ZNZ A;  5E1W A;  3OOP A;  2B0L A;  5CLS A;  2D1V A;  3QOP A;  3K1P A;  5E8I A;  5BPD A;  3FMS A;  4LGW A;  2DQR A;  2H6C A;  2FMY A;  2HGC A;  2HWV A;  4ENM A;  5D5W B;  3CUQ A;  5H20 A;  2GA1 A;  5LHH A;  1U2W A;  3S2W A;  1O3S A;  4BAY A;  3F8B A;  2XHK A;  2A6E F;  4GYG A;  1EH7 A;  2PEX A; 
#chains in the Genus database with same CATH topology
 1IF1 A;  2ZXJ A;  1D8K A;  4CGZ A;  2ZME C;  3CDH A;  2E1C A;  2EJR A;  1IN4 A;  2BW3 B;  3PSI A;  3WTU C;  1IW7 F;  4A3I J;  3WGI A;  3IUO A;  2M4G A;  2BHZ A;  4CUG A;  4XL9 A;  4PZJ A;  2ME6 A;  1BW5 A;  2FE3 A;  2JA7 J;  2V9P A;  2ZFU A;  3E1S A;  4BU2 A;  4XRS G;  4GYI A;  1BC8 C;  1O57 A;  1OYW A;  4BJT A;  3MZH A;  3OS0 A;  4I76 A;  1FEX A;  3HOU J;  4KT5 C;  3H5R A;  4JOM A;  4ENK A;  3V4G A;  4ZDP A;  3F22 A;  2HOS A;  3CC4 I;  2Y69 H;  3E6M A;  5EGO A;  4M3F A;  3H0D A;  2DBB A;  1CF7 A;  3EUH C;  2CYY A;  2QQA A;  4G94 A;  2BY2 A;  5ILU A;  5IP6 A;  1AHD P;  4AC0 A;  1JTX A;  2PFB A;  4AD9 A;  3OYA A;  1RNL A;  1IN7 A;  1VQN I;  2O5R A;  4KN7 X;  1FT9 A;  3VFZ A;  1BC7 C;  1X1D A;  2MAB A;  3K4N A;  3IP4 B;  2DOF A;  4EM0 B;  4E6K G;  4I6Z A;  3GUD A;  2PBI A;  4P9F A;  4EM1 A;  2LNB A;  1O3Q A;  2PJR B;  2WC2 A;  3DEE A;  2JN6 A;  1SD4 A;  3FKJ A;  5LEK A;  3S17 J;  3OYF A;  4MTE A;  2BZT A;  1HA8 A;  1YTY A;  3N97 A;  1A31 A;  2M4K A;  2DFE A;  3NAR A;  5BMZ A;  2K3P A;  4NUB A;  3VYT B;  1MMG A;  4PSW A;  4A0Y A;  4A12 A;  3D5L A;  1ITY A;  1YE9 A;  4LJZ F;  4E7S A;  1LDJ A;  3LST A;  4J19 A;  2Q2E A;  1HBX G;  4BAC A;  1DGW Y;  2JA6 J;  2C6Y A;  1MMA A;  4LIT A;  1LQ1 A;  1XGM A;  1YG2 A;  5HLI A;  3LFU A;  2QBY B;  3PNV A;  1Z3X A;  2QA4 I;  1R1U A;  3ASN H;  4KMF A;  1VI0 A;  2ESH A;  3BY6 A;  2VOO A;  2X9D A;  3Q0U A;  3DTK A;  2M8G X;  1S6L A;  4JX5 A;  2DMQ A;  2NVX J;  1A36 A;  5DM6 F;  3ZGK A;  3SDG A;  2P4W A;  3BCA A;  3CCS I;  2RKH A;  4OIQ F;  3H9Q A;  2CO5 A;  4GGG A;  1FLI A;  3S3N A;  1VTN C;  1C0W A;  2V79 A;  2MLG A;  2OU2 A;  4CCM A;  2HXO A;  1U3E M;  1IZ1 A;  4Z2Y A;  1IRZ A;  1J09 A;  4JBA A;  2E1O A;  4W1U A;  3BT9 A;  2GQQ A;  3KEQ A;  3CJQ B;  2O6G E;  3HBL A;  1ZLJ A;  5GAE J;  1TLH B;  2DOA A;  4PJM A;  3V8L A;  3H3U A;  2EZH A;  5HLH A;  1X2M A;  2FNP A;  2CV1 A;  3SJM A;  4BDZ A;  1MIJ A;  1QPM A;  4C2T A;  2VJJ A;  4ITV A;  4I98 B;  3GF2 A;  3TQN A;  2H8R A;  3QYB A;  1JI8 A;  4DZJ A;  5AON A;  3VOD A;  5HOD A;  3KYL A;  2XB0 X;  4A3D J;  1ZTR A;  3BQZ A;  3M3Y J;  2E36 A;  4U0V A;  4B3X A;  4ETS A;  4DJA A;  2K9Q A;  3FXU A;  3IV5 A;  4AWX B;  4FTH A;  1QNT A;  2FEZ A;  3J81 K;  2DMU A;  3T1B A;  2ZJ2 A;  1TQM A;  2F5V A;  3TOB A;  2EA4 A;  4RB3 C;  4DZP A;  2JA2 A;  3DBR B;  5IY5 H;  3U1K A;  2HR3 A;  2XAF A;  3CLQ A;  2R93 J;  3EUA A;  3LMM A;  4LK0 F;  4K2E A;  5BNG A;  1WWX A;  3GFM A;  4QIW N;  2JUC A;  4Y52 J;  1RZ4 A;  4XKC A;  2MFZ A;  4JYK A;  2P7V B;  2MC3 A;  5J47 A;  5L3E A;  2FQ4 A;  3CME I;  1XMA A;  3E6D A;  2H8W A;  4IRG A;  1Y56 A;  3KP3 A;  1MBF A;  3AL0 B;  5JHF A;  3KP4 A;  3LSI A;  5K7F A;  5HDN A;  3ZQG A;  1IG7 A;  2P6T A;  3K1N A;  1JKQ C;  5CKT A;  1BJA A;  4F55 A;  4XIC A;  1KYW A;  3HGG A;  3U21 A;  2ZXH A;  3F8C A;  3RTR A;  5LHI A;  4IQJ A;  2L0K A;  2Q0O A;  2TRT A;  3CMY A;  2XPW A;  3HPG A;  3K6G A;  4NC6 A;  5DYM A;  1P4X A;  1JJ6 C;  1W36 D;  3A2K A;  1JGG A;  3TKY A;  1SFX A;  4FT8 A;  4AYB N;  4OIR F;  1RUO A;  5CPR B;  4EJO A;  2ACJ A;  4LB6 B;  2R7F A;  3GTK J;  3DPU A;  2DAO A;  1UG0 A;  3KP7 A;  4RB1 A;  1OYY A;  1RR8 C;  1BW6 A;  2UXN A;  5CJ9 A;  2XGD A;  1VQ9 I;  4PGH A;  5EEH A;  2L4M A;  3CDI A;  2Y30 A;  1YJ9 I;  1HKT A;  1I6H J;  1TWF J;  3BRO A;  4XLE A;  2WAQ A;  5ICF A;  2CH0 A;  1SMY F;  2JPC A;  2LRE A;  5EZG A;  3JRB A;  2RVC A;  1WI9 A;  3FK6 A;  3BZC A;  2IA1 A;  2Z2S B;  3EPZ A;  3JRA A;  3WOD F;  2M1B A;  4ESJ A;  4AID A;  2UZK A;  4LB5 A;  1B59 A;  1X4O A;  2E5N A;  3CCQ I;  2GOM A;  2HXI A;  3MCZ A;  4JX4 A;  4CZZ A;  4DBR A;  4AIJ A;  1Y6I A;  2LF7 A;  2VBY A;  3RKW A;  1B72 A;  2CGP A;  2G7H A;  2KLO A;  3CCV I;  2ZBK A;  2QBY A;  2NNY A;  3PIP F;  4BQA A;  5DCF A;  5D8L B;  4NDL A;  5L3C A;  3ABU A;  3E0J B;  4YFX F;  1Z9C A;  3T0Y A;  3HSR A;  3G71 I;  4IRI A;  1J2X A;  3WHC A;  2FJ1 A;  3TBI A;  1P7J A;  1TTY A;  2FQ3 A;  1KQ8 A;  1NK2 P;  4BQO A;  3FXM A;  5TIS C;  3I54 A;  4NC7 A;  3G6E I;  2AQF A;  3OR2 C;  1GV5 A;  4XKB A;  4EJT A;  4CA0 A;  2Y48 A;  2HVS A;  1UST A;  5HNF A;  3MD2 A;  3NRV A;  3OYN A;  2EIL H;  1W4M A;  2L02 A;  2ZNY A;  4BXX J;  4EVI A;  4UVA A;  2CWE A;  5LHG A;  2W84 A;  3IAS 2;  3S2H J;  3G2B A;  3EDP A;  2QYO A;  4IL6 C;  2M0C A;  4XM3 A;  3S3O A;  4GCV A;  2YSR A;  3PNT A;  4UNO A;  3J7A O;  2LMD A;  1APL C;  1U78 A;  5ICC A;  2E71 A;  4PJN A;  1FYM A;  1MNE A;  2XVC A;  2HVR A;  2OCE A;  3JSO A;  1FP2 A;  4UV9 A;  3ZMD A;  1B9M A;  4L0Y B;  2J5P A;  3VPR A;  2W25 A;  2HQ5 A;  1LKX A;  1WJE A;  3GTP J;  3PQJ A;  2ZO4 A;  1USS A;  2H1L A;  2STW A;  2VKH A;  2NOJ B;  4ZYA A;  3ZQL A;  2FOW A;  2Z16 A;  1SVO A;  4HV5 A;  4P55 A;  1Z7L A;  2H94 A;  1UJ8 A;  1V5E A;  3GO5 A;  2PG4 A;  2X4H A;  5FKN A;  5HS9 A;  1QBJ A;  5LGN A;  1I1G A;  3P9C A;  4L5I A;  1UFM A;  1IUF A;  3OR1 C;  1I3Q J;  1XTA A;  4II2 A;  1WQ2 A;  2R7O A;  1FJL A;  4IHS A;  2O8X A;  4KIB A;  4RBO A;  2QWW A;  1KQ0 A;  5EG0 B;  2DFI A;  2KRH A;  4E7J A;  1MMD A;  2R7Z J;  3E6B A;  1QZY A;  1OCC H;  2F5D A;  1O7L A;  5D6E A;  4XID A;  1W7P B;  2AXL A;  4CYD A;  3HSF A;  3OL3 A;  3A02 A;  4CXF A;  4M74 A;  5AIP A;  4NHJ A;  1X3U A;  2BEO A;  2A3S A;  2NVQ J;  5J4V A;  5D5V B;  3L7W A;  2R92 J;  1HSJ A;  2EQR A;  2X6Y A;  2HYG D;  5EG0 A;  2ISZ A;  3BTJ A;  1SAU A;  3S8P A;  3UNG C;  4RDU A;  3L00 A;  3U1D A;  5ERI A;  3WTZ A;  3O8H A;  1AWC A;  2CSO A;  4KMU X;  5B1B H;  5L3G A;  1Z6T A;  2Y9Y A;  3AG1 H;  3JSP A;  2VQL A;  1HCR A;  1J75 A;  2A5W A;  2PJR A;  4BY7 J;  4N4N B;  2IS6 A;  2DA2 A;  2L9R A;  3R4K A;  3LSG A;  5HVQ C;  1B8I A;  3HRS A;  4J00 A;  3BJA A;  3F21 A;  1U5T C;  1GVD A;  5A2Q Z;  3P9K A;  2VT3 A;  2OPT A;  2ADU A;  2CRG A;  2KP6 A;  1EH8 A;  1DGR M;  1E0E A;  1XCV A;  3I58 A;  1EJ9 A;  5M3M J;  1SFU A;  4D7M A;  2D45 A;  1REP C;  1MBK A;  2DFF A;  4PCQ A;  4C3I J;  4XK4 A;  5K5O A;  5M3F J;  1WH5 A;  3IKT A;  1ZGA A;  5FFX A;  1V5F A;  2EB7 A;  1FSE A;  2HEO A;  3BP8 A;  3DEW A;  2DK5 A;  3E5X A;  1X1C A;  3JW4 A;  2CV2 A;  2ZJR F;  2FBI A;  3CP2 A;  1I5Z A;  3DWL E;  5LBQ A;  2DA4 A;  2K9L A;  3BTL A;  1JT6 A;  3GTJ J;  1SVM A;  3JAM Z;  3E5U A;  5E18 F;  2DA3 A;  3GFL A;  3JR9 A;  1ETK A;  2GXG A;  3O2P E;  2JK3 A;  2HDW A;  4BUP A;  3OSG A;  3I4N J;  1R1T A;  2YU3 A;  3A01 B;  2VJ5 A;  2IGN A;  4Y4R A;  2PQ8 A;  3CO7 C;  1PDN C;  4U87 A;  1X1P A;  2BY0 A;  3OS2 A;  1H9G A;  3D0S A;  5JFR A;  1R71 A;  1LFB A;  3C18 A;  1GLN A;  1NG7 A;  4M6V A;  2QSG X;  1A5J A;  3W2V A;  1TP4 A;  2MGQ A;  4G7H F;  5E3O A;  1VQ6 I;  2P5V A;  2R7D A;  2P81 A;  3OOU A;  4G7Z F;  2Z5U A;  1DPU A;  2M34 A;  2WAD A;  1FYK A;  1DDN A;  3WG7 H;  1XGS A;  4KDP A;  4PSX A;  3CTA A;  1N25 A;  3KEO A;  2MH9 A;  4PFP A;  2IS4 A;  3B73 A;  2FBH A;  4B48 A;  2W7N A;  2BW3 A;  2NVU B;  4A0X A;  2HPI A;  3HPH A;  2QCO A;  2EBI A;  3CUO A;  3I9V 2;  5C4X J;  4EGZ A;  4XQF A;  3PO2 J;  3RDI A;  2F48 A;  1TW2 A;  1MJ9 A;  4RAF A;  5J40 A;  4L9V A;  3GZ6 A;  1R23 A;  4OMY A;  1XX5 A;  1X3Z B;  2TDX A;  4NBQ A;  2HZT A;  3T5X A;  2VKE A;  4CYC B;  1HF0 A;  4CCL A;  4BHC A;  4OOI A;  3RZD J;  3ZN1 A;  4C2M J;  3ZQI A;  1KA8 A;  4B44 A;  3OYJ A;  2BE5 F;  1K61 A;  4BNC A;  1E3P A;  4G9Y A;  3C2G A;  1Z3Y A;  3ZMZ A;  2VE8 A;  5E20 A;  1MMN A;  2R7V A;  4WK8 F;  3OY9 A;  4PUS A;  1BI2 A;  3JCU C;  2GWR A;  5IP9 J;  1LJ9 A;  5J1R A;  3NWS A;  3SDB A;  3I3L A;  1ZKG A;  3TO7 A;  5FB2 A;  3T8R A;  2GM4 A;  1T0F C;  3GTQ J;  3G1L A;  5M5Y J;  1K83 J;  4OWR B;  2RRE A;  1M1E B;  1QA6 A;  3GTL J;  2NS7 A;  2DT7 B;  3DKY A;  3A0B C;  3DTI A;  4ZYE A;  4E7I A;  1YIO A;  4ENN A;  2CUJ A;  4A2U A;  3PM1 A;  2RNG A;  5CVI A;  5D5X B;  4EGY A;  3JRI A;  1Z67 A;  4FET A;  2ELJ A;  4I02 A;  3DFG A;  1V3F A;  2R7T A;  1DPR A;  5B3S H;  5LFA A;  1IDY A;  2WB1 A;  5EJC A;  3GWZ A;  4BJ6 C;  4U7B A;  4ASN A;  4R79 A;  3I5U A;  3F23 A;  4BXU A;  2CS3 A;  5IT9 K;  5EEG A;  4M9S A;  2KT0 A;  2PN6 A;  2EWN A;  1XC5 A;  2EK5 A;  3IH3 A;  2EFO A;  2ZB9 A;  4ZH4 F;  1ZRF A;  1FX7 A;  1WRJ A;  4CO8 A;  2ZFW A;  5ILS A;  5LGU A;  4MEY F;  1TNS A;  4C30 A;  3ISP A;  3WTW C;  2V26 A;  5L3D A;  1RC9 A;  3BG3 A;  4E70 A;  1XG1 A;  3FXR A;  2Y75 A;  3H36 A;  4HQM A;  2XAS A;  1K4S A;  3S16 J;  3NAU A;  4H4K C;  2LY2 A;  3PO3 J;  4U0W A;  5IYD J;  3HKZ A;  4MNU A;  4ENJ A;  2X85 A;  1HC8 A;  3GTG J;  1CQT A;  2GLO A;  1YW8 A;  3ZMV A;  3HGY A;  1EF4 A;  4Y7N J;  3I71 A;  4EQQ A;  1YYV A;  4UVB A;  5EZH A;  2O8K A;  5FKO A;  2R0Q C;  3JRG A;  3WTX C;  2OUM A;  1G3W A;  3HB9 A;  4HAM A;  4FX0 A;  4P96 A;  4D0P A;  4S05 A;  5J1U A;  2Z33 A;  2HYJ A;  3M8F A;  4ANJ A;  1MD0 A;  1MND A;  3IC7 A;  1HW2 A;  3WU1 B;  2IEK A;  5FLV A;  2ELH A;  2XRN A;  4IPA A;  1D0X A;  2GBY A;  1R58 A;  3VB2 A;  5HS8 A;  2RDP A;  1OMI A;  1BR4 A;  3UKG A;  3F6O A;  2V4J C;  5HDK A;  3OYE A;  3ULQ B;  2F4I A;  4IF4 A;  2AO9 A;  2O0Y A;  3F72 A;  4RB0 A;  1Q1V A;  3BCB A;  1GT0 C;  2V6C A;  3Q0V A;  4C3J J;  2N8G A;  3QAH A;  5F6F A;  3V8J A;  4I09 A;  3LAP A;  5DTD A;  1MMS A;  1LNW A;  3FM3 A;  3V42 A;  2MW8 A;  1RI7 A;  2A61 A;  1W36 C;  4QPQ A;  3TP0 A;  1NHA A;  2MSY A;  2QKL B;  4CH7 A;  1BI1 A;  1W0U A;  1FYL A;  1YS6 A;  2LSO A;  1WPK A;  2CQX A;  2VBX A;  2TCT A;  2Q8K A;  2DO7 A;  3F8M A;  1KU2 A;  5D8K B;  4IHT A;  1SEU A;  2E60 A;  2O7O A;  1JUP A;  2ICW G;  1LPQ A;  2QUF A;  1ETX A;  1IN8 A;  1FZP B;  1N78 A;  4MTD A;  1J0R A;  3IWZ A;  4YFK F;  4Q4Z F;  2ZME A;  3HZJ A;  3O3K A;  3WTV C;  3FX3 A;  4LLN A;  3CD6 I;  1ZR2 A;  2QEN A;  2JA8 J;  4UXN A;  4A3E J;  2LG4 A;  3GTM J;  1KZH A;  4DOZ A;  1S3J A;  1WJD A;  5K7Z A;  4L5E A;  4RAY A;  2XDV A;  3CP8 A;  1YO5 C;  4IHV A;  3VYR B;  3BG5 A;  4PJ0 C;  2DA7 A;  1VQL I;  3N05 A;  4L9T A;  2EV5 A;  4WCG A;  2V1U A;  5GAD J;  1L0O C;  2XPV A;  5BS6 A;  3OIQ A;  4HX8 A;  5JVT A;  1U5T A;  2OBP A;  5GTH C;  1XDS A;  3I55 I;  1J7K A;  2HU9 A;  1D0Z A;  4P5O A;  3FWE A;  3HTU A;  3TL4 X;  4KIF A;  4A3G J;  3BOQ A;  1TZL A;  1R5G A;  3KE2 A;  4EV0 A;  4XLA A;  4F91 B;  3WHB A;  4BKX A;  3EYY A;  3K9T A;  2IA2 A;  2QZ8 A;  2OAZ A;  2XSD C;  1VQ4 I;  4BE0 A;  1BA5 A;  1XGO A;  1FOX A;  3ZQH A;  5KCM A;  1TQP A;  2A5Y B;  4BS9 A;  1Z77 A;  3DLL F;  3FM5 A;  2ELK A;  1GDT A;  4A69 C;  2YUS A;  2V7F A;  1FMW A;  3KYD B;  2K02 A;  1P4A A;  2DA5 A;  1PUF B;  4ZDO A;  3D1N I;  4XOT A;  4MHG A;  1HKQ A;  2R5Y A;  1ZG5 A;  5DEQ A;  4YRV A;  2BV6 A;  4IX7 A;  2OA4 A;  1EKE A;  5FO5 A;  4QLC U;  4MGR A;  3RCO A;  5DDG A;  1Y1W J;  5FFZ A;  2FXA A;  2DQL A;  2FBK A;  1ZGJ A;  2P5K A;  4AIK A;  1ZN2 A;  3GVA A;  2HFH A;  1OLT A;  3LOC A;  3ZQ7 A;  1ULY A;  5D5U B;  4BGD A;  5F1J A;  1ETO A;  5ILV A;  4HX7 A;  1B72 B;  4E7Z A;  2XF5 A;  3M1C A;  1OFC X;  2FD5 A;  2EFP A;  2JMW A;  1I3A A;  1JT0 A;  5E1Z B;  4O5V A;  4UHT A;  3GTO J;  2W24 A;  1H0M A;  3MKL A;  2KIM A;  2QGU A;  2AHQ A;  3QOD A;  2W85 A;  4ESB A;  2FA5 A;  4FCY A;  2OC6 A;  1IXS B;  4YIF A;  2HPM A;  3GCM A;  2G9W A;  3R6S A;  3CZ6 A;  2CQ7 A;  4OU0 A;  3HRU A;  3TED A;  2CFX A;  4PDK A;  3H35 A;  1SVL A;  2A68 F;  2HTS A;  1PP7 U;  3SZG A;  1RET A;  2NS0 A;  4DW6 A;  2CJJ A;  1TBX A;  2ID3 A;  3A01 A;  5GTI C;  2CW8 A;  4CZC A;  1FWZ A;  3AG4 H;  4F3Q A;  3WE2 A;  1Z6R A;  2PJP A;  2DW4 A;  3H5A A;  2E7W A;  4DGW B;  1TWH J;  4M6X A;  4G12 A;  2HTJ A;  3QQA A;  3V7S A;  1ETY A;  4HSR A;  3SFI A;  2STT A;  2OQR A;  2WAE A;  2XF7 A;  4ZTJ A;  3IH2 A;  4LK1 F;  1S7E A;  1OPC A;  4LIV A;  2VKD A;  5HNH A;  1ZAO A;  1Y8R B;  1TW3 A;  3D5R C;  1UB9 A;  2PI0 A;  3LWF A;  3I53 A;  4A5M A;  2FF4 A;  4IHY A;  3GLX A;  4V2F A;  3G1O A;  4AYB A;  3WGG A;  1F1Z A;  1P2F A;  1YJN I;  4NC8 A;  5L3F A;  4S04 A;  4EJW A;  2EV6 A;  2Z3Y A;  3H3Z A;  3OIP A;  4I99 C;  1T39 A;  2WBM A;  1EV7 A;  2V1D A;  3H1C A;  5GAH J;  1Y0U A;  3BG9 A;  2R7R A;  3GBG A;  2F5E A;  2L7F P;  3BR2 A;  2DTR A;  1FC3 A;  3R0A A;  1KGS A;  4AIH A;  1BIA A;  5DD8 A;  4DNC A;  5E8G A;  3AL0 C;  2BXZ A;  3S32 A;  3FBN B;  1T0F A;  2BOL A;  2K9M A;  1BJZ A;  2DN0 A;  5K5R A;  3PFY A;  4AVZ A;  5DM7 F;  1JUS A;  2O3F A;  4BEH A;  4BHB A;  2VKV A;  2LLK A;  4XBF A;  3IRQ A;  2CU7 A;  3BJ6 A;  2NS8 A;  3L2C A;  2HDC A;  3SFZ A;  5D4S A;  2F5F A;  1JHF A;  1QHG A;  3OYL A;  1IRG A;  2O03 A;  2QEX I;  2JVH A;  3RQI A;  2BGC A;  5DD4 A;  1U5T B;  1ZG1 A;  3K4J A;  3L2Q A;  2Q1Z B;  5LEJ A;  3P9I A;  1IN5 A;  1W1W E;  2DMN A;  1H8A C;  3BC8 A;  4RAG A;  3SYT A;  1F4K A;  3PSF A;  4FIS A;  1TWA J;  3RSN A;  1LB2 A;  2WWY A;  3K0L A;  1B8I B;  3J7Y J;  2ME0 A;  3LA3 A;  1K79 A;  1SFE A;  3HUG B;  4HRI A;  2XGC A;  5CVJ A;  5J8F A;  3PIO F;  1MSE C;  1J5Y A;  1RUN A;  2QM3 A;  1U8R A;  4JX6 A;  4CCN A;  3CCL I;  1YW9 A;  1OCO H;  3A1Y A;  3I59 A;  5DCM B;  4R8H A;  1B4A A;  5K7H A;  1F36 A;  2JZY A;  2DT5 A;  4IQ4 A;  2K4B A;  1YW7 A;  5E3M A;  3J7Z I;  2CQK A;  1I1S A;  2V1X A;  2MC4 A;  4KIC A;  3ZMU A;  3CF5 F;  1U0J A;  2HDD A;  4A5N A;  3GEZ A;  3TW6 A;  2V6E A;  3RPU D;  2VE9 A;  3N4M A;  3K70 D;  2H27 A;  5DUK A;  4F92 B;  4HW0 A;  1P6R A;  3KP2 A;  2K40 A;  3LFK A;  2RV8 A;  2R7S A;  1ZQ3 P;  3CCR I;  4NB5 A;  1BOB A;  3DF8 A;  2DJN A;  4Q47 A;  1AU7 A;  1FP1 D;  1JKO C;  2RAE A;  3VYU B;  3L09 A;  1IV8 A;  4L5J A;  3FMR A;  4LMY A;  2DFH A;  2QF7 A;  2JTV A;  4IZZ A;  1WZ2 A;  4HYE A;  3IAM 2;  3E3V A;  4J01 A;  3HOV J;  3M1E A;  2RGV A;  1F43 A;  3LSM A;  2M8E A;  1QHH D;  1Q1H A;  1OCZ H;  1R36 A;  3S2D J;  1HST A;  3M07 A;  4NQW A;  4RM3 A;  4EMS A;  4BYY A;  1G3T A;  3BR3 A;  1BM9 A;  1FY7 A;  2MBF A;  2RNJ A;  1FOW A;  1A35 A;  2X51 A;  3ZQQ A;  5FD6 A;  4A3J J;  3CMA I;  4KJZ A;  2X1E A;  4BBS J;  3U2R A;  2JJ7 A;  5IPA A;  3ABT A;  3K70 C;  3P5J A;  4HLY A;  2XGE A;  3KZI C;  3PL8 A;  4QSH A;  5L3B A;  4L18 B;  3KX2 A;  4UUV A;  4IVN A;  2XB5 A;  2H6B A;  4A3M J;  2QQB A;  5J8C A;  1ZHF A;  4DYR A;  5A2Q K;  3RKX A;  2VI6 A;  3M8E A;  2HYF A;  2NXN B;  4M71 A;  1T33 A;  3GXO A;  4D9J A;  4Y13 A;  4FHT A;  3MZY A;  5BQT A;  1D5Y A;  2DA6 A;  4ZZL A;  2ZME B;  3JTH A;  3BWG A;  2VXZ A;  3EYI A;  4PFO A;  3DU6 A;  1ZH5 A;  3BPV A;  2ID6 A;  1IDZ A;  1MBE A;  2KRC A;  2Y31 A;  1P4W A;  1YQA A;  3LAJ A;  3S15 J;  3ERE D;  1WGX A;  4KIS A;  1D5V A;  3WGH A;  3LSH A;  5LD2 C;  4FX4 A;  2UUZ A;  3BZK A;  2VOP A;  3O8G A;  1AKH B;  5C3E J;  4FAS D;  1GVJ A;  4JP0 A;  3KIO A;  3IH4 A;  3BQY A;  2YU9 J;  1FSH A;  2KQR A;  4II3 A;  4ZDL A;  1S7O A;  2K3F A;  2VB6 A;  4HST A;  5HLT A;  2VC0 A;  3BR1 A;  5CVU A;  1V4R A;  2ZC2 A;  4B4C A;  3H92 A;  2IPQ X;  1T38 A;  1OKR A;  2HOA A;  3L2R A;  1SD6 A;  1AKH A;  3LSR A;  2PMH A;  3RKQ A;  1YJW I;  3DV8 A;  1OJL A;  4KUM A;  4UV8 A;  2A69 F;  3HXL A;  3F0C A;  4PJL A;  5TGT A;  4MQV A;  2FML A;  2WTE A;  3LL7 A;  1XS9 A;  4UB6 C;  2E1N A;  2L01 A;  2OD5 A;  3FXO A;  4TV7 A;  1F5T A;  4HDV A;  1TT5 B;  2HS5 A;  2M3A A;  4XLN F;  2P7C B;  3FF5 A;  4HF1 A;  1HW1 A;  2IT0 A;  1XSV A;  1MBJ A;  4GDF A;  1MBG A;  2R5Z A;  3EET A;  4D5F A;  2DTZ A;  1G59 A;  1UEL B;  1K6O A;  4R1H A;  2KDZ A;  2KIQ A;  5H2F C;  2E34 A;  2R3S A;  2JRM A;  2JUG A;  3CC2 I;  5TRD A;  4BXF A;  2KIU A;  3M4O J;  1WSU A;  3QU3 A;  1S8N A;  1RIO H;  4S0H B;  4KA4 A;  2IA0 A;  5KNL A;  2HKO A;  1LE8 A;  1D1B A;  1V55 H;  2JVG A;  4YIR X;  1TNT A;  2DK8 A;  5FKK A;  4A3C J;  3HRM A;  1YX5 A;  3SHF A;  2KPM A;  2ETH A;  2DMP A;  1SD5 A;  3CCU I;  4B47 A;  2ZCW A;  3S1M J;  3M8J A;  2AS5 F;  2XAH A;  2IS2 A;  5FD5 A;  1FTZ A;  3IHU A;  1R7J A;  2VLA A;  2V9V A;  3V8K A;  3IL2 A;  2JQ7 A;  3DKW A;  4E7K A;  4RLF A;  2LR8 A;  5FRO A;  5BPI A;  2KDO A;  4WF2 A;  5JHU A;  1HDD C;  2VBZ A;  3J80 K;  1YRN A;  4KN4 X;  2K86 A;  2NNN A;  4LIU A;  1STZ A;  3JAM K;  4LOC A;  3ASO H;  2XV4 S;  3K4B A;  3CO6 C;  4F7Z A;  1P92 A;  2DMT A;  3LSJ A;  3S1Q J;  1W5T A;  2CQQ A;  2PLY A;  2NVY J;  3NQO A;  3VOE A;  4A3B J;  1IN6 A;  3L2V A;  5GP9 A;  1OYI A;  1TWG J;  3CDL A;  3CCY A;  3F8F A;  3HRT A;  5F1R A;  4ZZD A;  5FGM A;  1X58 A;  1S72 I;  3CC7 I;  1Z1D A;  4XOP A;  4HDU A;  2V1N A;  1PYV A;  3LA2 A;  2LC2 A;  4BY1 J;  5ED4 A;  4CIC A;  3ELK A;  1QZZ A;  2L54 A;  2K7L A;  2PX9 A;  3CUQ B;  3CMM A;  4HOB A;  5KHD A;  5JLW A;  1BIB A;  1X3W B;  3HOS A;  1WJA A;  2DOD A;  2X6X A;  4PK4 A;  4B8X A;  5FRM A;  3PUB A;  4Y3O A;  2EFN A;  2IGK A;  4EM2 A;  4L0Z B;  1VQ7 I;  4KFC A;  5F27 A;  1SAX A;  3LQR A;  1D0Y A;  4CHU A;  4Y17 A;  3Q5F A;  1IXC A;  4JQF A;  5H6Q A;  1R49 A;  1OQY A;  4BQQ A;  1FOK A;  1T08 B;  3GYH X;  4IOA F;  1ZYR F;  4LFU A;  3HTS B;  1RKT A;  5FLM J;  4F52 A;  1HLV A;  5B5E C;  1X2N A;  2QVO A;  3ABK H;  4FE7 A;  4HBL A;  5IOY A;  2EZI A;  5LRS A;  2K85 A;  2RQQ A;  2L7M P;  5CVV A;  5IT3 A;  4WXH A;  2CQN A;  2CFO A;  3QOE A;  2KKO A;  4N9I A;  3HOX J;  1WJB A;  3GFJ A;  1J9I A;  3B6C A;  1ZRE A;  3MAJ A;  3ZN0 A;  3S1R J;  2E2J J;  1CF7 B;  1DU6 A;  1SAN A;  3RQ4 A;  2IAI A;  3H0G J;  2YS9 A;  1TL8 A;  2XKO A;  1R4N B;  2QSH X;  2M0M A;  3NEU A;  1UHM A;  2L9N A;  2Z99 A;  2ISY A;  1XGN A;  4QWQ A;  4MIM A;  2HQA A;  1MNM C;  4LLG F;  2M7B A;  4RS8 A;  2P0W A;  3GZN B;  1FNN A;  4U88 A;  4RGR A;  3I4P A;  2J5O A;  1YI2 I;  3KFW X;  1XCB A;  1MH4 A;  5F0F A;  1R9T J;  1H88 C;  2LYC A;  2O61 A;  2I10 A;  5J1Y A;  1T98 A;  1G8X A;  2XRL A;  2M7A A;  3K2A A;  5E3L A;  1OCT C;  2BY3 A;  4RAZ A;  1AOY A;  4XLC A;  3Q9V A;  3FKI J;  1JJ8 C;  4O6J A;  2P6S A;  4OAZ A;  2JSC A;  1GHC A;  3MQ0 A;  4HEA 2;  4A0Z A;  3OSF A;  2Y9Z A;  2B7E A;  2BVM A;  3W2W A;  1LEA A;  2F4M B;  1FPQ A;  2VUM J;  2ZJQ F;  3J7A Y;  2I8D A;  4Q5S F;  2Y2Z A;  4CCO A;  1QVT A;  3W6V A;  3RKY A;  3OYB A;  5LGT A;  4G6T B;  1VFC A;  1VQO I;  1KYZ A;  3ZRG A;  4M9Z A;  2G0E A;  1G6N A;  2DYR H;  4ZYH A;  3BG7 A;  1YS7 A;  3PQK A;  1W0T A;  5EDN A;  2ZJP F;  2HQN A;  2I5U A;  3QWL A;  3R60 A;  3RYP A;  5KK1 A;  1JKP C;  2VPL A;  2MLK A;  3DP7 A;  3QPT A;  5BOX A;  2EV0 A;  3OMY A;  1TC3 C;  2CUF A;  3FIS A;  5IT9 Z;  5D6F A;  3K4L A;  4B09 A;  3OIO A;  1QVU A;  3EUH A;  2F5C A;  2GAU A;  2RN7 A;  2E19 A;  4RGX A;  1UHS A;  2COB A;  2KZG A;  4RGU A;  1UZC A;  2O9L A;  4V2G A;  4KIG A;  4M9X A;  2DPU A;  2COM A;  4H0E A;  2OV7 A;  3TDU C;  3JRD A;  2KL4 A;  2WAQ N;  1P9Q C;  3DLA A;  2LDU A;  3GW2 A;  4XLF A;  3L9F A;  4B43 A;  1ZLK A;  1D3Y A;  3QRF F;  1ZEL A;  5E79 C;  1Z21 A;  1G2H A;  2NAZ A;  2DYS H;  3DPL C;  4A3K J;  1U6G A;  2JSP A;  3CUQ C;  3K1M A;  1WH7 A;  3MKW B;  3QP6 A;  2HOE A;  2VT2 A;  3TGN A;  3FHZ A;  2L5Q A;  4OIO F;  3M7G A;  3OYI A;  1FIP A;  1QQI A;  1DQU A;  4PJJ A;  4EJU A;  3ZMT A;  1MZB A;  2VN2 A;  2DCE A;  3MMY B;  1U8B A;  5CQG A;  5HOO A;  2ZSH B;  1CGP A;  3R0J A;  1GUU A;  3F8N A;  1OCP A;  3SEQ A;  4CCJ A;  1UCR A;  1MKM A;  4A93 J;  4M3E A;  2NRA C;  2L7K A;  2P8T A;  2MA3 A;  4C9Y A;  3TMO A;  3A03 A;  2IXS A;  3SZP A;  1DU0 A;  1YOV B;  2K9N A;  4MO7 A;  4IHX A;  4Q48 A;  4IOC F;  3OS1 A;  1UG2 A;  2OF7 A;  5CQE A;  5HS7 A;  2HKX A;  2Z9O A;  1D1C A;  1P7I A;  2VPR A;  4XLH A;  2UXX A;  1QGP A;  3RZO J;  3BR6 A;  3E7L A;  3VSL A;  2AQE A;  2DOE A;  5J4Y A;  5TJJ A;  5JVG F;  3BR0 A;  3BLY A;  1XB4 A;  3KPH A;  1QO0 D;  1Z91 A;  1ODD A;  4LLL A;  2MG4 A;  1RR7 A;  2GZW A;  3MFK A;  4IO9 F;  1R5H A;  3CJR B;  1RPW A;  1R4M B;  1TWC J;  1UAA A;  5K5Q A;  5DS9 A;  1TQI A;  3HJE A;  4OAY A;  4I01 A;  3S14 J;  4YEJ A;  4I7H A;  4OMZ A;  3OYK A;  3OYG A;  2FUG 2;  1G4D A;  3KYC B;  4B1R A;  2KRF A;  3DTE A;  3OL4 A;  4HNU A;  3PFI A;  3HUG A;  3QPH A;  3KP5 A;  4HNT A;  1YFH A;  1FIA A;  2JT1 A;  2VQG A;  2P5L C;  2HI3 A;  2PMZ A;  2XC7 A;  4LG0 A;  4O3M A;  2EH3 A;  4ZC3 A;  1L3L A;  5FKL A;  4XRS A;  3ZP5 A;  4MLO A;  4RM2 A;  2FNA A;  1ACI A;  4G6Q A;  2EZK A;  2L3D A;  4EEF G;  4ZJZ A;  2DT6 A;  2H09 A;  3BZ6 A;  5H6R A;  2CUE A;  1MGT A;  2K9S A;  4NQW B;  4AVP A;  1R00 A;  4B3A A;  3HOT A;  3RIR A;  1YIT I;  3SEZ A;  2EIJ H;  1I27 A;  2XAU A;  3Q9S A;  2EPF A;  5ICE A;  2UV1 A;  3K4C A;  1KU3 A;  4AM3 A;  2R7X A;  3ABL H;  1WHU A;  3BR5 A;  5B66 C;  3FIW A;  1R5I D;  3DXJ F;  3OV8 A;  1Y39 A;  1IV6 A;  3I0T A;  2M45 A;  4BE1 A;  2MH2 A;  3HSE A;  2IVM A;  4DIQ A;  2B9S A;  3LNQ A;  3M9A A;  1XMX A;  4YFN F;  4WWC A;  3NWT A;  1A04 A;  2WAF A;  1VND A;  3RPU A;  1Y1V J;  2FU4 A;  3VYS B;  3AFH A;  2EA2 A;  2F4O B;  2FX0 A;  2LVS A;  2VJ4 A;  2ZXI A;  2D2W A;  1WCM J;  1AA7 A;  1RKW A;  2LFB A;  3JRC A;  4HQE A;  3K4M A;  3IWF A;  3C7J A;  3C1D A;  1T2K A;  3MKZ A;  4ZYG A;  1UMQ A;  2DDB A;  1OIS A;  3TDZ C;  2F2E A;  1S9H A;  1WKM A;  3DEU A;  3ZPL A;  2L7Z A;  2VQC A;  2X1C A;  3G4S I;  2XIG A;  2WV0 A;  4YG2 F;  4E7L A;  3V7R A;  5C44 J;  4BQN A;  1G3S A;  3FXQ A;  3LSK A;  3CLO A;  3X2Q H;  1QZE A;  4E4H A;  2KIF A;  2K5C A;  3HHG A;  1K7A A;  3QYF A;  1T6S A;  1T8I A;  1YLF A;  1ZK8 A;  2DI3 A;  1Y0N A;  3DBL B;  4P1W A;  2XAG A;  3O6B B;  5C4J J;  2QLZ A;  2XSJ C;  1HQC A;  1ETV A;  3EQL F;  1ORK A;  2CUZ A;  3W6K B;  3MVP A;  2E1M B;  2WY8 Q;  4QPO A;  3H9J A;  3FDY A;  4A3L J;  1FBU A;  4BEH B;  1KON A;  4Y15 A;  3OYC A;  3H3V K;  1JXS A;  2OQG A;  3DCF A;  2F6C A;  2VL8 A;  1IUY A;  1VQ5 I;  4ZYD A;  4FQG A;  5J6X A;  1G3Y A;  3WTY C;  3I64 A;  1ZAR A;  4ON0 A;  4A3F J;  3W2A A;  3TP3 A;  4XON A;  1JGS A;  1WJ5 A;  2IP2 A;  4XSX F;  2XPU A;  2Z1D A;  1XDU A;  3WU2 C;  1N75 A;  1E17 A;  2LBF B;  2X48 A;  3I56 I;  1MBH A;  4OIN F;  2GA2 A;  3KEY A;  2QSF X;  3IRR A;  2BHY A;  1PVE A;  2D1H A;  1Z05 A;  2BYV E;  4BH9 A;  2RC4 A;  1B6A A;  4HLX A;  4U7D A;  2GXB A;  1MW7 A;  3LQQ A;  5E1X A;  4G6D A;  3QP5 A;  1U9O A;  1XSX A;  1W7P D;  1FBS A;  3REO A;  2R5Y B;  1B1B A;  5EGO B;  2OJE D;  4D5C A;  3DU5 A;  1LE8 B;  2VXD A;  4N4O B;  2A05 A;  5F0H A;  4QTR A;  4BE2 A;  2ZSI B;  3B02 A;  4I0B A;  1O4X A;  4IXA A;  4UB8 C;  4V19 K;  3BTI A;  1WJF A;  4CSW A;  4EJV A;  3Q3S A;  1S5L C;  1WI3 A;  1BI0 A;  2JA5 J;  2IS1 A;  2NOG A;  3BTC A;  5E3N A;  4WXC A;  2R5Z B;  2GXA A;  5DV5 A;  3I4M J;  1Z0X A;  2L2O A;  3P7N A;  1OR7 A;  3GX4 X;  4M3B A;  3EUK L;  3HIF A;  3PNY A;  3PUF A;  2W00 A;  2NYX A;  1V5G A;  1NH3 A;  1BOA A;  3ECH A;  3QU6 A;  2VOD A;  3T8T A;  5FLX Z;  3HEF A;  1VZ0 A;  2YX4 A;  4A6D A;  4ABZ A;  1F9N A;  3K7A J;  3WTT C;  3JRE A;  1YIJ I;  1LDK B;  1YRN B;  5F04 A;  3CJN A;  4P9U A;  2ESN A;  3FMQ A;  2YPR A;  3WG9 A;  2FRH A;  2Q2E B;  5M5W J;  2CG4 A;  3JTG A;  3R61 A;  2B63 J;  5KVR A;  2OTJ I;  3L2U A;  1NK3 P;  2V9K A;  3MWM A;  1W5S A;  1D8J A;  3LA7 A;  4AUX A;  5CVR A;  2JPB A;  2BXY A;  3ROU A;  4I2O A;  3J80 Z;  1HKS A;  2W57 A;  2VJI A;  1IJW C;  2QQ9 A;  2E7X A;  1JUM A;  3GFI A;  4U0Y A;  2W82 A;  5AIQ A;  2LRD A;  5GPA A;  4L9N A;  1FTT A;  3KLO A;  3KLN A;  2WV1 A;  3SZT A;  5IYC J;  2W1O A;  1I6X A;  2DU9 A;  3S93 A;  3SQN A;  3S3M A;  4UY8 I;  2KJC A;  5IP7 J;  4MEX F;  4E7H A;  2X1D A;  3ZR8 X;  3DBH B;  4XLP F;  1FOY A;  4AU7 A;  2VON A;  5HDG A;  3CCE I;  1IO2 A;  2GIV A;  3G1M A;  3U9G A;  4M72 A;  3JRH A;  2XGX A;  1DP7 P;  1T56 A;  3E97 A;  4IEJ A;  2ZKZ A;  3HG9 A;  2EIK H;  2MD5 A;  4UUS A;  3ZQC A;  2E2H J;  2ECB A;  1LFP A;  1E3O C;  3RYR A;  3KCC A;  3CCM I;  1O3T A;  4XOR A;  4M3G A;  3FZV A;  2CW7 A;  3WE3 A;  2LF8 A;  1ON1 A;  1SFK A;  3TO9 A;  1B9N A;  1VQ8 I;  3TOA A;  1DUX C;  3TO6 A;  1J59 A;  1BR2 A;  1JE8 A;  4CYC A;  1ETW A;  4HA8 A;  3FHN A;  4CDG A;  3ZQF A;  2Y0S A;  3VSK A;  3VDX A;  4XNF A;  2JRT A;  3H5N A;  5FRN A;  2FOK A;  1MSF C;  3L2W A;  2X6O A;  4G8X A;  3LSP A;  1BI3 A;  3F3X A;  5E17 F;  2NVT J;  2EZL A;  2DXI A;  1UHW A;  2IJL A;  4XR6 A;  1Z7U A;  4KNY A;  4HF0 A;  1TT0 A;  2OZ6 A;  3CES A;  2XAJ A;  1LDD A;  2M2E A;  1H9T A;  2LKP A;  5K1Y A;  3Q0W A;  2HVQ A;  1PUF A;  3CQZ J;  3AG3 H;  3GZ5 A;  2LBF A;  5KAI C;  2DLL A;  3KET A;  1JKR C;  1ZRC A;  1POG A;  3DKX A;  2YX7 A;  2XF6 A;  2LTP A;  4WXD A;  1ZGW A;  1MDM A;  4RA2 A;  1XN7 A;  3ZCO A;  1I50 J;  1MH3 A;  2LKS A;  4N9H A;  1SFO J;  2EFQ A;  2M30 A;  2RQP A;  2PMZ N;  1LFU P;  5JLX A;  4HG2 A;  3RI4 A;  1R1V A;  4Z6Y A;  4RB2 C;  3BPX A;  4KT6 A;  1IC8 A;  1S29 A;  2XKP A;  5KAF C;  1ERD A;  3ERM A;  2LD5 A;  3KP6 A;  5DUI A;  2KZV A;  4IRH A;  1QU3 A;  5LLQ A;  2CW0 F;  4BL0 B;  5GPC A;  2VBW A;  3HL2 A;  3K2Z A;  6PAX A;  5CYV A;  3FBI B;  1K78 B;  4M73 A;  5EF6 A;  1BR1 A;  1HXD A;  1XD7 A;  4BJ5 C;  1R22 A;  3ML6 A;  3J81 Z;  2IRF G;  4MFD A;  4C2U A;  3MZ8 A;  1IRF A;  5EYR A;  3HOW J;  5F08 A;  2LP0 A;  4IHW A;  1E3H A;  5FKM A;  1K78 A;  4BBR J;  1BN5 A;  3DPT A;  3E5Q A;  1ON2 A;  4UUT A;  1OR7 C;  3W3C A;  2GIZ A;  3E6C C;  4KIT B;  3A0H C;  1JHH A;  2E1M C;  3OYH A;  1LUJ B;  1WFX A;  3BJO A;  4HNV A;  1PJR A;  4XKW A;  4F93 B;  1K6Y A;  5ICG A;  2A6T A;  2LY9 A;  4L9J A;  3WTS C;  2M5W A;  3F9K A;  1VQK I;  1IXR C;  2X6W A;  5F0C A;  1KU7 A;  4MFE A;  1A6Q A;  1WJC A;  1E2X A;  5FJ8 J;  1N77 A;  3G3Z A;  1S7A A;  1RRJ A;  3FXK A;  4UVC A;  1VQP I;  2HQR A;  1HW5 A;  1K4T A;  2IBD A;  4X1E A;  1O7F A;  2LH9 A;  3RPQ A;  3ZOB A;  4I0A A;  4XN0 A;  5HLG A;  2DPD A;  3S1N J;  1EA3 A;  9ANT A;  2CMP A;  3ZMS A;  4LD5 A;  1WVR A;  2DJI A;  2XUB A;  3HOY J;  3ECO A;  4RLQ A;  4OIP F;  3VWB A;  3HYI A;  4CCK A;  2EIN H;  2IGM A;  4A6E A;  3HHH A;  2EFW A;  3D5S C;  2BBY A;  3B6A A;  3MEX A;  5F64 A;  2YR2 A;  4HF2 A;  1Y8Q B;  1D1A A;  3DQV C;  2CV0 A;  3KZY A;  3HOZ J;  4GFB A;  3GME A;  4N0B A;  1VQM I;  1ENH A;  4GRI A;  1ETQ A;  2L9V A;  2HOT A;  3C2B A;  1YHQ I;  2DDA A;  3OWT A;  1PP8 F;  3KZZ A;  1JTY A;  1KU9 A;  2K4J A;  2IW5 A;  4FE4 A;  1LVA A;  3MN2 A;  2OCC H;  2KFD A;  3RJP A;  4W97 A;  1T95 A;  2R7U A;  1RES A;  5LRR A;  2MYS A;  2H1K A;  3QPL A;  4XMY A;  3K69 A;  1O3R A;  2E5Z A;  4XKV A;  1W5C C;  5B1A H;  5JI6 A;  4XN3 A;  3WU0 A;  4ZTF A;  2KMU A;  2E2I J;  3ZXS A;  2Y0M A;  3FXL A;  1ZRD A;  1YX3 A;  4D1Q A;  1A6I A;  1EH6 A;  1OCR H;  1IAW A;  1IGN A;  2W48 A;  1KQ9 A;  4EAT A;  2XRO A;  2KHM A;  2Y0S N;  1GXQ A;  2LOO A;  2ZXW H;  3FXJ A;  2QQ8 A;  3CF2 A;  1GXP A;  4YII A;  1U9N A;  2L9S A;  3I59 B;  2A6H F;  5DCM A;  3W6J B;  2R7W A;  1R6R A;  2VIX A;  1ZG3 A;  3ONQ A;  4D7N A;  4LG3 A;  2K27 A;  2WB1 N;  4HPQ A;  1MJA A;  2VQH A;  1W7P A;  3FK7 A;  4M6Y A;  4HZF A;  5IOZ A;  2EIM H;  2KIS A;  1PUE E;  4Y33 A;  1X1A A;  1LEB A;  4DYC A;  2A07 F;  2VC1 A;  3OYM A;  2MD0 A;  4LG0 B;  4XSZ F;  2WA0 A;  4X6A J;  4HV6 A;  1QPI A;  1V54 H;  2D5V A;  4XRM A;  1MDM B;  4MQ9 F;  5D4R A;  2UWM A;  2AXT C;  1NG6 A;  2PMU A;  2QKM B;  4YEL A;  3A4C A;  1IRX A;  1ZR4 A;  1SC7 A;  4M3D A;  2OTL I;  3HC7 A;  1ONV A;  1SD7 A;  5IYB J;  4RMN A;  3K10 A;  4C3H J;  1BL0 A;  1XSD A;  2WY7 Q;  5M5X J;  2BVL A;  3L1P A;  2X0L A;  4BHP A;  3AAF A;  4ESF A;  1BBY A;  3BG6 A;  3AKZ A;  3BDD A;  2HZD A;  3ESW B;  2FSW A;  2BY1 A;  3OYD A;  1DP3 A;  2M9H A;  4PGG A;  4NNJ A;  3QYE A;  3IKV A;  1XMK A;  2ECC A;  4DQ2 A;  1VF9 A;  4IJA A;  3H9G A;  4GO1 A;  4DBQ A;  2LKX A;  1SMT A;  5EEA A;  1HDP A;  4GXO A;  3SXY A;  3ABM H;  3HKZ N;  2DA1 A;  4BDY A;  1H89 C;  2XAQ A;  3CJT B;  1MJB A;  4RGS A;  4IKF A;  4HX4 A;  3C3W A;  4G7O F;  4WX9 A;  3MKY B;  1X1B A;  3GLL A;  3C2H A;  2L4A A;  1FBQ A;  4JK1 X;  2R7Q A;  1GV2 A;  3VEP A;  5JR3 A;  3G73 A;  3K4K A;  2LK2 A;  3F6V A;  3HM5 A;  4KYW A;  3QPS A;  3CCJ I;  2OZU A;  2R4G A;  2HNH A;  2KJB A;  3V7C A;  2M87 A;  2JWT A;  3PJR A;  1I39 A;  1NTC A;  4XRF A;  2IGO A;  3COA C;  3UR3 C;  5FLX K;  2G7U A;  2ZNZ A;  5E1W A;  3OOP A;  1X19 A;  2B0L A;  5CLS A;  1XPX A;  2D1V A;  3QOP A;  2W4S A;  3K1P A;  5E8I A;  5BPD A;  3FMS A;  4LGW A;  2E35 A;  1QRY A;  2DQR A;  4DYQ A;  2H6C A;  1LVK A;  2LY1 A;  2FMY A;  2GOX B;  2HGC A;  2HWV A;  4UUS B;  4ENM A;  5D5W B;  3CUQ A;  5GAG J;  5H20 A;  5J3L A;  2GA1 A;  3HDD A;  5LHH A;  4X0G A;  1U2W A;  2VAS A;  3S2W A;  1X4P A;  1O3S A;  4BAY A;  1FMV A;  3JRF A;  3F8B A;  2XHK A;  2A6E F;  3AG2 H;  4GYG A;  1EH7 A;  3TW7 A;  2PEX A;  1HOM A; 
#chains in the Genus database with same CATH homology
 1IF1 A;  2ZXJ A;  1D8K A;  4CGZ A;  3CDH A;  2E1C A;  2EJR A;  1IN4 A;  3WTU C;  1IW7 F;  3WGI A;  4PZJ A;  2FE3 A;  4GYI A;  1BC8 C;  1O57 A;  1OYW A;  3MZH A;  4KT5 C;  4ENK A;  3V4G A;  3F22 A;  3E6M A;  2DBB A;  1CF7 A;  2CYY A;  2QQA A;  4G94 A;  5ILU A;  2PFB A;  4AD9 A;  1RNL A;  1IN7 A;  4KN7 X;  1FT9 A;  3VFZ A;  1BC7 C;  4EM0 B;  3GUD A;  2PBI A;  4P9F A;  4EM1 A;  2LNB A;  1O3Q A;  2WC2 A;  1SD4 A;  5LEK A;  4MTE A;  1YTY A;  3N97 A;  5BMZ A;  4A0Y A;  4A12 A;  3D5L A;  4LJZ F;  1LDJ A;  3LST A;  2Q2E A;  1HBX G;  2C6Y A;  1LQ1 A;  1XGM A;  1YG2 A;  5HLI A;  2QBY B;  1R1U A;  4KMF A;  2ESH A;  3BY6 A;  2VOO A;  1S6L A;  2P4W A;  4OIQ F;  2RKH A;  2CO5 A;  4GGG A;  1FLI A;  1VTN C;  1C0W A;  2V79 A;  2MLG A;  2OU2 A;  1U3E M;  1IZ1 A;  4Z2Y A;  4JBA A;  2GQQ A;  3KEQ A;  2O6G E;  1ZLJ A;  1TLH B;  3V8L A;  3H3U A;  5HLH A;  2FNP A;  1QPM A;  4I98 B;  3GF2 A;  3TQN A;  5AON A;  3VOD A;  4U0V A;  4ETS A;  3FXU A;  4AWX B;  1QNT A;  2FEZ A;  3J81 K;  3T1B A;  2ZJ2 A;  1TQM A;  3TOB A;  2EA4 A;  4RB3 C;  2HR3 A;  2XAF A;  4LK0 F;  4K2E A;  1WWX A;  3GFM A;  1RZ4 A;  2P7V B;  2MC3 A;  5L3E A;  1XMA A;  3E6D A;  4IRG A;  3KP3 A;  3KP4 A;  5HDN A;  2P6T A;  3K1N A;  1BJA A;  1KYW A;  3F8C A;  3RTR A;  5LHI A;  2Q0O A;  5DYM A;  1P4X A;  3TKY A;  1SFX A;  4FT8 A;  4OIR F;  1RUO A;  4EJO A;  2ACJ A;  4LB6 B;  2R7F A;  2DAO A;  3KP7 A;  4RB1 A;  1OYY A;  2UXN A;  5CJ9 A;  4PGH A;  5EEH A;  2L4M A;  1HKT A;  3BRO A;  5ICF A;  1SMY F;  2JPC A;  2RVC A;  1WI9 A;  2IA1 A;  3WOD F;  2M1B A;  4ESJ A;  2UZK A;  4LB5 A;  1B59 A;  3MCZ A;  4CZZ A;  4AIJ A;  2LF7 A;  2VBY A;  3RKW A;  2CGP A;  2G7H A;  2QBY A;  2ZBK A;  2NNY A;  4BQA A;  5DCF A;  5D8L B;  5L3C A;  3ABU A;  4YFX F;  1Z9C A;  3T0Y A;  3HSR A;  4IRI A;  1J2X A;  1TTY A;  2FQ3 A;  1KQ8 A;  3I54 A;  4EJT A;  2Y48 A;  1UST A;  3NRV A;  1W4M A;  2L02 A;  2ZNY A;  4EVI A;  4UVA A;  2CWE A;  5LHG A;  2W84 A;  3EDP A;  2QYO A;  4GCV A;  2YSR A;  4UNO A;  3J7A O;  1U78 A;  5ICC A;  1FYM A;  2XVC A;  3JSO A;  1FP2 A;  4UV9 A;  3ZMD A;  1B9M A;  4L0Y B;  2J5P A;  2W25 A;  3PQJ A;  2ZO4 A;  1USS A;  2STW A;  4HV5 A;  4P55 A;  2H94 A;  3GO5 A;  5HS9 A;  1QBJ A;  2PG4 A;  2X4H A;  5LGN A;  1I1G A;  3P9C A;  4L5I A;  1UFM A;  1WQ2 A;  4IHS A;  2O8X A;  4KIB A;  2QWW A;  1KQ0 A;  2DFI A;  3E6B A;  1QZY A;  2F5D A;  1O7L A;  5D6E A;  1W7P B;  2AXL A;  4CYD A;  3HSF A;  4CXF A;  4M74 A;  5AIP A;  4NHJ A;  1X3U A;  2BEO A;  2A3S A;  5D5V B;  3L7W A;  1HSJ A;  2HYG D;  2ISZ A;  3L00 A;  3U1D A;  5ERI A;  3WTZ A;  1AWC A;  2CSO A;  4KMU X;  5L3G A;  1Z6T A;  3JSP A;  1J75 A;  3R4K A;  5HVQ C;  3HRS A;  3BJA A;  3F21 A;  1U5T C;  5A2Q Z;  3P9K A;  2VT3 A;  2ADU A;  1EH8 A;  1XCV A;  3I58 A;  1SFU A;  1REP C;  2D45 A;  4PCQ A;  5K5O A;  3IKT A;  1ZGA A;  5FFX A;  2EB7 A;  1FSE A;  2HEO A;  3BP8 A;  2DK5 A;  3E5X A;  3JW4 A;  2FBI A;  1I5Z A;  5LBQ A;  3JAM Z;  3E5U A;  5E18 F;  3GFL A;  2GXG A;  3O2P E;  1R1T A;  2YU3 A;  1PDN C;  2PQ8 A;  3CO7 C;  1H9G A;  3D0S A;  5JFR A;  3C18 A;  4G7H F;  2P5V A;  2R7D A;  4G7Z F;  2Z5U A;  1DPU A;  1FYK A;  1DDN A;  4KDP A;  1XGS A;  3CTA A;  3KEO A;  2MH9 A;  3B73 A;  2FBH A;  4A0X A;  3CUO A;  4EGZ A;  3RDI A;  1TW2 A;  1MJ9 A;  4L9V A;  3GZ6 A;  1R23 A;  4OMY A;  2TDX A;  2HZT A;  3T5X A;  4BHC A;  4OOI A;  3ZN1 A;  1KA8 A;  4BNC A;  2BE5 F;  4G9Y A;  3ZMZ A;  2VE8 A;  5E20 A;  4WK8 F;  1BI2 A;  2GWR A;  1LJ9 A;  3TO7 A;  5FB2 A;  3T8R A;  4ZYE A;  1YIO A;  4ENN A;  4A2U A;  5CVI A;  5D5X B;  4EGY A;  4I02 A;  3DFG A;  1V3F A;  1DPR A;  3GWZ A;  4U7B A;  4ASN A;  4R79 A;  3I5U A;  3F23 A;  4BXU A;  5IT9 K;  5EEG A;  4M9S A;  2PN6 A;  2EWN A;  4ZH4 F;  2EK5 A;  2EFO A;  1ZRF A;  1FX7 A;  1WRJ A;  4CO8 A;  2ZFW A;  5ILS A;  5LGU A;  4MEY F;  1TNS A;  3ISP A;  3WTW C;  5L3D A;  4E70 A;  3FXR A;  2Y75 A;  4HQM A;  2XAS A;  4U0W A;  4MNU A;  4ENJ A;  1YW8 A;  3ZMV A;  3I71 A;  4EQQ A;  1YYV A;  4UVB A;  3WTX C;  4HAM A;  1G3W A;  4P96 A;  4D0P A;  4FX0 A;  2Z33 A;  4S05 A;  3M8F A;  1MD0 A;  3IC7 A;  1HW2 A;  3WU1 B;  2ELH A;  2XRN A;  4IPA A;  5HS8 A;  1R58 A;  3VB2 A;  2RDP A;  1OMI A;  3F6O A;  5HDK A;  3ULQ B;  4IF4 A;  2O0Y A;  3F72 A;  4RB0 A;  2V6C A;  3QAH A;  5F6F A;  3V8J A;  4I09 A;  3LAP A;  1LNW A;  3FM3 A;  1RI7 A;  2A61 A;  1NHA A;  1BI1 A;  1FYL A;  1YS6 A;  2LSO A;  2VBX A;  2Q8K A;  2DO7 A;  3F8M A;  1KU2 A;  5D8K B;  4IHT A;  2QUF A;  1IN8 A;  1FZP B;  4MTD A;  1J0R A;  3IWZ A;  4YFK F;  4Q4Z F;  2ZME A;  3O3K A;  3WTV C;  3FX3 A;  4LLN A;  2QEN A;  4UXN A;  1S3J A;  4RAY A;  1YO5 C;  4L9T A;  2EV5 A;  4WCG A;  2V1U A;  1L0O C;  5BS6 A;  4HX8 A;  5JVT A;  1U5T A;  2OBP A;  1XDS A;  1J7K A;  4P5O A;  3FWE A;  3HTU A;  4KIF A;  3BOQ A;  1R5G A;  3KE2 A;  4EV0 A;  3EYY A;  3K9T A;  2IA2 A;  2QZ8 A;  2OAZ A;  1XGO A;  1TQP A;  2A5Y B;  3FM5 A;  2K02 A;  1P4A A;  4MHG A;  1HKQ A;  1ZG5 A;  5DEQ A;  2BV6 A;  2OA4 A;  5FO5 A;  4QLC U;  4MGR A;  5DDG A;  5FFZ A;  2FXA A;  2DQL A;  2FBK A;  1ZGJ A;  2P5K A;  4AIK A;  1ZN2 A;  3GVA A;  2HFH A;  3ZQ7 A;  1ULY A;  5D5U B;  5ILV A;  4HX7 A;  2EFP A;  5E1Z B;  4O5V A;  4UHT A;  2W24 A;  1H0M A;  2KIM A;  2W85 A;  4ESB A;  2FA5 A;  4YIF A;  1IXS B;  3R6S A;  2G9W A;  4OU0 A;  3HRU A;  2CFX A;  4PDK A;  2A68 F;  2HTS A;  1PP7 U;  2NS0 A;  1TBX A;  1FWZ A;  3WE2 A;  1Z6R A;  2PJP A;  2DW4 A;  2E7W A;  4M6X A;  2HTJ A;  3V7S A;  2STT A;  2OQR A;  4LK1 F;  1OPC A;  1ZAO A;  1TW3 A;  1UB9 A;  2PI0 A;  3LWF A;  3I53 A;  4A5M A;  2FF4 A;  3GLX A;  3WGG A;  1F1Z A;  1P2F A;  5L3F A;  4S04 A;  4EJW A;  2EV6 A;  2Z3Y A;  3H3Z A;  1T39 A;  1EV7 A;  2V1D A;  1Y0U A;  2F5E A;  2DTR A;  1FC3 A;  3R0A A;  1KGS A;  4AIH A;  1BIA A;  5DD8 A;  4DNC A;  5E8G A;  1T0F A;  5K5R A;  2O3F A;  4BHB A;  3IRQ A;  4XBF A;  3BJ6 A;  3L2C A;  2HDC A;  3SFZ A;  5D4S A;  2F5F A;  1JHF A;  1IRG A;  2O03 A;  2BGC A;  5DD4 A;  1U5T B;  1ZG1 A;  5LEJ A;  3P9I A;  1IN5 A;  1F4K A;  1LB2 A;  2WWY A;  3K0L A;  3LA3 A;  1K79 A;  1SFE A;  5CVJ A;  5J8F A;  1J5Y A;  1RUN A;  2QM3 A;  1U8R A;  1YW9 A;  3I59 A;  5DCM B;  4R8H A;  1B4A A;  2JZY A;  2DT5 A;  2K4B A;  1YW7 A;  2CQK A;  1I1S A;  2V1X A;  4KIC A;  3ZMU A;  4A5N A;  3GEZ A;  2VE9 A;  3N4M A;  2H27 A;  5DUK A;  4HW0 A;  1P6R A;  3KP2 A;  3LFK A;  2RV8 A;  4NB5 A;  3DF8 A;  4Q47 A;  1FP1 D;  3L09 A;  4L5J A;  3FMR A;  4LMY A;  2JTV A;  4HYE A;  3E3V A;  3M1E A;  2RGV A;  2M8E A;  1Q1H A;  1R36 A;  1HST A;  4NQW A;  4EMS A;  4BYY A;  1G3T A;  1BM9 A;  1FY7 A;  2MBF A;  2RNJ A;  5FD6 A;  3U2R A;  3ABT A;  4HLY A;  5L3B A;  4L18 B;  4UUV A;  4IVN A;  2H6B A;  2QQB A;  5J8C A;  1ZHF A;  5A2Q K;  3RKX A;  3M8E A;  2HYF A;  4M71 A;  3GXO A;  4Y13 A;  4FHT A;  3MZY A;  5BQT A;  4ZZL A;  2ZME B;  3JTH A;  3BWG A;  2VXZ A;  3EYI A;  1ZH5 A;  3BPV A;  1P4W A;  1YQA A;  3LAJ A;  3ERE D;  1D5V A;  3WGH A;  4FX4 A;  2VOP A;  1GVJ A;  1FSH A;  1S7O A;  2VC0 A;  5CVU A;  1V4R A;  3H92 A;  2IPQ X;  1T38 A;  1OKR A;  1SD6 A;  2PMH A;  3DV8 A;  4KUM A;  4UV8 A;  2A69 F;  4MQV A;  2FML A;  2WTE A;  2E1N A;  2L01 A;  2OD5 A;  1F5T A;  4TV7 A;  4HDV A;  2HS5 A;  4XLN F;  2P7C B;  3FF5 A;  4HF1 A;  1HW1 A;  2IT0 A;  1XSV A;  3EET A;  1K6O A;  4R1H A;  2R3S A;  5TRD A;  2KIU A;  1WSU A;  3QU3 A;  1S8N A;  1RIO H;  4KA4 A;  2IA0 A;  2HKO A;  1TNT A;  2DK8 A;  3HRM A;  3SHF A;  2ETH A;  1SD5 A;  2ZCW A;  2AS5 F;  2XAH A;  5FD5 A;  3IHU A;  1R7J A;  2V9V A;  3V8K A;  3IL2 A;  3DKW A;  5BPI A;  4WF2 A;  5JHU A;  2VBZ A;  3J80 K;  4KN4 X;  2K86 A;  2NNN A;  1STZ A;  3JAM K;  3CO6 C;  2XV4 S;  4F7Z A;  1P92 A;  1W5T A;  2PLY A;  3NQO A;  3VOE A;  1IN6 A;  1OYI A;  3F8F A;  3HRT A;  5F1R A;  4ZZD A;  5FGM A;  1Z1D A;  4HDU A;  3LA2 A;  5ED4 A;  4CIC A;  3ELK A;  1QZZ A;  2L54 A;  2K7L A;  3CUQ B;  4HOB A;  1BIB A;  3HOS A;  4B8X A;  2EFN A;  4EM2 A;  4L0Z B;  4KFC A;  1SAX A;  3LQR A;  4CHU A;  4Y17 A;  3Q5F A;  1IXC A;  4JQF A;  5H6Q A;  1FOK A;  3GYH X;  1ZYR F;  4LFU A;  3HTS B;  2QVO A;  4HBL A;  5LRS A;  5CVV A;  5IT3 A;  4WXH A;  4N9I A;  2KKO A;  3GFJ A;  1J9I A;  1ZRE A;  3MAJ A;  3ZN0 A;  1CF7 B;  2XKO A;  3NEU A;  1UHM A;  4QWQ A;  2ISY A;  1XGN A;  2Z99 A;  4LLG F;  4RS8 A;  1FNN A;  4U88 A;  4RGR A;  3I4P A;  2J5O A;  3KFW X;  1XCB A;  2O61 A;  1T98 A;  4RAZ A;  1AOY A;  3Q9V A;  4O6J A;  2P6S A;  2JSC A;  1GHC A;  3MQ0 A;  4A0Z A;  1LEA A;  1FPQ A;  4Q5S F;  3RKY A;  5LGT A;  1KYZ A;  4M9Z A;  1G6N A;  4ZYH A;  1YS7 A;  3PQK A;  2HQN A;  3RYP A;  3R60 A;  5KK1 A;  2MLK A;  3DP7 A;  3QPT A;  5BOX A;  2EV0 A;  5IT9 Z;  5D6F A;  4B09 A;  3EUH A;  2F5C A;  2GAU A;  2RN7 A;  4RGX A;  4RGU A;  4KIG A;  4M9X A;  2DPU A;  2COM A;  4H0E A;  3TDU C;  2LDU A;  3GW2 A;  3L9F A;  1ZLK A;  1D3Y A;  3QRF F;  2NAZ A;  3DPL C;  1U6G A;  3CUQ C;  3K1M A;  3QP6 A;  2HOE A;  2VT2 A;  3TGN A;  3FHZ A;  4OIO F;  3M7G A;  1QQI A;  4EJU A;  3ZMT A;  1MZB A;  2VN2 A;  5HOO A;  1CGP A;  3R0J A;  3F8N A;  1UCR A;  1MKM A;  2NRA C;  2P8T A;  2MA3 A;  3SZP A;  4Q48 A;  5HS7 A;  2HKX A;  2Z9O A;  2UXX A;  1QGP A;  5TJJ A;  1XB4 A;  1QO0 D;  1Z91 A;  1ODD A;  4LLL A;  3MFK A;  2GZW A;  1R5H A;  5K5Q A;  1TQI A;  4I01 A;  4I7H A;  4OMZ A;  1G4D A;  2KRF A;  3PFI A;  3HUG A;  3QPH A;  3KP5 A;  1YFH A;  2JT1 A;  2P5L C;  4LG0 A;  4O3M A;  1L3L A;  3ZP5 A;  2FNA A;  4G6Q A;  2L3D A;  2H09 A;  3BZ6 A;  5H6R A;  1MGT A;  4AVP A;  1R00 A;  3HOT A;  3RIR A;  1I27 A;  3Q9S A;  5ICE A;  1KU3 A;  3DXJ F;  3OV8 A;  3I0T A;  2M45 A;  2MH2 A;  3HSE A;  2IVM A;  3M9A A;  4YFN F;  4WWC A;  1A04 A;  3RPU A;  2FU4 A;  2EA2 A;  2D2W A;  4HQE A;  3IWF A;  3C7J A;  3C1D A;  1T2K A;  4ZYG A;  3TDZ C;  2F2E A;  3DEU A;  1WKM A;  3ZPL A;  2XIG A;  2WV0 A;  4YG2 F;  3V7R A;  1G3S A;  3FXQ A;  3CLO A;  2KIF A;  3HHG A;  1K7A A;  1T6S A;  1YLF A;  2DI3 A;  2XAG A;  3O6B B;  2QLZ A;  1HQC A;  3EQL F;  3W6K B;  1FBU A;  4Y15 A;  1JXS A;  2OQG A;  1IUY A;  4ZYD A;  5J6X A;  1G3Y A;  3WTY C;  3I64 A;  1ZAR A;  4ON0 A;  1JGS A;  2IP2 A;  4XSX F;  1XDU A;  1E17 A;  4OIN F;  2GA2 A;  3IRR A;  2D1H A;  1Z05 A;  2BYV E;  4BH9 A;  2RC4 A;  1B6A A;  4HLX A;  4U7D A;  2GXB A;  3LQQ A;  5E1X A;  4G6D A;  3QP5 A;  1XSX A;  1W7P D;  1FBS A;  3REO A;  1B1B A;  3B02 A;  4I0B A;  4IXA A;  4EJV A;  1BI0 A;  4WXC A;  5DV5 A;  3P7N A;  1OR7 A;  3GX4 X;  3HIF A;  2NYX A;  1BOA A;  3ECH A;  3QU6 A;  2VOD A;  3T8T A;  5FLX Z;  2YX4 A;  4A6D A;  1F9N A;  3WTT C;  1LDK B;  3CJN A;  4P9U A;  2ESN A;  3FMQ A;  2YPR A;  3WG9 A;  2FRH A;  2CG4 A;  3JTG A;  3R61 A;  5KVR A;  3MWM A;  1W5S A;  1D8J A;  3LA7 A;  5CVR A;  2JPB A;  3ROU A;  4I2O A;  3J80 Z;  1HKS A;  2W57 A;  2QQ9 A;  2E7X A;  3GFI A;  4U0Y A;  5AIQ A;  4L9N A;  3KLO A;  3KLN A;  3SZT A;  1I6X A;  2DU9 A;  3SQN A;  2KJC A;  4MEX F;  4XLP F;  2VON A;  5HDG A;  2GIV A;  3U9G A;  1DP7 P;  4M72 A;  2XGX A;  3E97 A;  2ZKZ A;  2MD5 A;  3RYR A;  3KCC A;  1O3T A;  3FZV A;  3WE3 A;  2LF8 A;  1ON1 A;  3TO9 A;  1B9N A;  3TOA A;  1DUX C;  3TO6 A;  1J59 A;  1JE8 A;  4HA8 A;  4CDG A;  2JRT A;  2FOK A;  4G8X A;  1BI3 A;  3F3X A;  5E17 F;  1UHW A;  2IJL A;  4KNY A;  1Z7U A;  4HF0 A;  2OZ6 A;  2XAJ A;  1LDD A;  1H9T A;  2LKP A;  5K1Y A;  3GZ5 A;  2DLL A;  3KET A;  1ZRC A;  2YX7 A;  4WXD A;  1MDM A;  1XN7 A;  4N9H A;  2EFQ A;  2M30 A;  2RQP A;  3RI4 A;  1R1V A;  4RB2 C;  3BPX A;  1S29 A;  2XKP A;  3KP6 A;  5DUI A;  4IRH A;  5LLQ A;  2CW0 F;  6PAX A;  2VBW A;  3K2Z A;  5CYV A;  1K78 B;  4M73 A;  1HXD A;  1XD7 A;  1R22 A;  3ML6 A;  3J81 Z;  2IRF G;  1IRF A;  1K78 A;  1BN5 A;  3DPT A;  3E5Q A;  1ON2 A;  3E6C C;  1JHH A;  3BJO A;  5ICG A;  4L9J A;  3WTS C;  2M5W A;  1IXR C;  1KU7 A;  1E2X A;  3G3Z A;  1S7A A;  4UVC A;  2HQR A;  1HW5 A;  3RPQ A;  1O7F A;  5HLG A;  4I0A A;  2DPD A;  3ZMS A;  4LD5 A;  2XUB A;  3ECO A;  4OIP F;  3HYI A;  4A6E A;  3HHH A;  2EFW A;  2BBY A;  3MEX A;  5F64 A;  2YR2 A;  4HF2 A;  3DQV C;  3KZY A;  4N0B A;  1PP8 F;  3KZZ A;  1KU9 A;  2K4J A;  2IW5 A;  1LVA A;  3RJP A;  5LRR A;  3K69 A;  1O3R A;  5JI6 A;  3WU0 A;  2Y0M A;  1ZRD A;  1EH6 A;  1IAW A;  1KQ9 A;  2XRO A;  1GXQ A;  1GXP A;  4YII A;  3I59 B;  2A6H F;  5DCM A;  3W6J B;  1ZG3 A;  2K27 A;  1MJA A;  1W7P A;  4M6Y A;  4HZF A;  1PUE E;  1LEB A;  2A07 F;  2VC1 A;  4LG0 B;  4XSZ F;  4HV6 A;  1MDM B;  4MQ9 F;  5D4R A;  2UWM A;  2PMU A;  1ONV A;  1SD7 A;  1XSD A;  2X0L A;  4BHP A;  3AAF A;  4ESF A;  1BBY A;  3BDD A;  2FSW A;  4PGG A;  3IKV A;  1XMK A;  4DQ2 A;  4IJA A;  4GO1 A;  1SMT A;  4GXO A;  3SXY A;  2XAQ A;  1MJB A;  4RGS A;  4G7O F;  4HX4 A;  3C3W A;  4WX9 A;  2L4A A;  1FBQ A;  4JK1 X;  3VEP A;  5JR3 A;  3G73 A;  3F6V A;  4KYW A;  2OZU A;  2KJB A;  3V7C A;  2M87 A;  4XRF A;  3COA C;  5FLX K;  2G7U A;  2ZNZ A;  5E1W A;  3OOP A;  2B0L A;  5CLS A;  2D1V A;  3QOP A;  3K1P A;  5E8I A;  5BPD A;  3FMS A;  4LGW A;  2DQR A;  2H6C A;  2FMY A;  2HGC A;  2HWV A;  4ENM A;  5D5W B;  3CUQ A;  5H20 A;  2GA1 A;  5LHH A;  1U2W A;  3S2W A;  1O3S A;  4BAY A;  3F8B A;  2XHK A;  2A6E F;  4GYG A;  1EH7 A;  2PEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...