1PP8F

Crystal structure of the t. vaginalis ibp39 initiator binding domain (ibd) bound to the alpha-scs inr element
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
DSNDLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQLEEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKGGWTQWKRSGFTRNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords ALPHA-SCS INR
publication title Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
pubmed doi rcsb
source organism Trichomonas vaginalis
total genus 33
structure length 113
sequence length 113
chains with identical sequence M, O, P, U, V
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF10416 IBD Transcription-initiator DNA-binding domain IBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pp8F00
1YW7A 1STZA 5ERIA 3GWZA 1F9NA 4CGZA 4OMZA 3ML6A 2M30A 2W84A 5FLXZ 3FXRA 4BXUA 4WXDA 2CSOA 3TDZC 4P9FA 1PP8F 4EGZA 5AIPA 5CVRA 3MFKA 1UHMA 1MJBA 2ZNYA 4YIIA 4KIFA 3FHZA 1HW1A 5A2QK 3DKWA 2CQKA 4O5VA 4EV0A 2Z33A 2Q0OA 4OU0A 1DP7P 5DD8A 1LQ1A 1TBXA 2OU2A 2ZNZA 3WTVC 2STWA 2FBHA 4RB2C 3MZHA 1ZGJA 2FMLA 3GFIA 6PAXA 5E20A 3E5UA 4WF2A 4UV8A 3WTWC 5KK1A 1Z7UA 1ZHFA 4L5IA 1MKMA 2HS5A 2YSRA 2GXGA 1I5ZA 1R1UA 2J5OA 2ZBKA 2BE5F 3L2CA 4RB3C 1U3EM 1KYWA 4LGWA 5HOOA 1MGTA 3M1EA 2HTJA 1CGPA 1P6RA 1O3TA 2OA4A 1J9IA 1OYWA 2PN6A 1YIOA 2EJRA 1G3SA 2EV0A 3RYRA 4UVAA 5LLQA 1RNLA 5EEGA 4LK1F 2ZXJA 4LJZF 2EA4A 4GO1A 4WK8F 3BOQA 1FOKA 5D5UB 2BV6A 5IT3A 5D5WB 4K2EA 1T39A 1BBYA 4OIPF 3L9FA 2GXBA 4IPAA 5E17F 2B0LA 3MEXA 3HSFA 5ILUA 1YG2A 5LHGA 1S3JA 2XAGA 1TLHB 1ZRDA 5E8IA 5JFRA 2HWVA 2QQAA 1J75A 5BS6A 1KA8A 3EETA 4A5MA 3FF5A 3E6MA 5D6FA 3I58A 1R5HA 2HTSA 4HBLA 1ZRFA 1WRJA 3GZ5A 1Z6TA 4HOBA 2VBWA 4L0ZB 2O6GE 2ADUA 4UVBA 1AWCA 2XASA 4L18B 4ZYGA 2FE3A 1FY7A 3CJNA 1USTA 1SD6A 1RIOH 1U6GA 2K02A 5HLIA 3EYYA 1IN4A 2HKXA 5JVTA 3IKVA 2PBIA 1D5VA 3WTYC 4G7ZF 1BI2A 2GAUA 2EFQA 4UVCA 2JSCA 2QZ8A 3MAJA 2PJPA 1YW9A 5HVQC 3KP6A 2RGVA 2XKOA 4M6XA 1IUYA 5FD6A 2A6EF 3D5LA 3OOPA 3JAMZ 1IXSB 2RNJA 3KFWX 4G7OF 2WC2A 2M8EA 4OIQF 2F5FA 2JRTA 2V1DA 2MA3A 2GQQA 4F7ZA 3SXYA 1BM9A 4MGRA 3FMSA 2HYFA 3E6BA 3ECHA 1O7LA 2IW5A 3U1DA 5HDNA 1W5TA 2VONA 4KN4X 2VBZA 3RKWA 1EH8A 3CO7C 3F8CA 2OQGA 1XGOA 2PFBA 3WU0A 1K78A 4P55A 3F8BA 5D5XB 1BN5A 1BC8C 2DT5A 1XSXA 1FYKA 2XAHA 3HHHA 1LNWA 5BPIA 3MQ0A 4LG0A 3IC7A 2O8XA 4RB0A 4WXHA 1ZN2A 5HDKA 1IW7F 2O61A 4LK0F 1RI7A 2GIVA 3WU1B 1P2FA 3RJPA 5BPDA 4ZH4F 3WODF 1K78B 4RAZA 2XIGA 2HGCA 3TOBA 2NNYA 4B09A 1ON1A 4ESBA 5L3BA 1IN8A 2K7LA 3VODA 2EK5A 4A12A 3HRTA 5DDGA 1ZGAA 3TQNA 4LG0B 1FP2A 1HQCA 3F23A 3T0YA 1RUNA 2V79A 3SHFA 5K5RA 5AIQA 1DUXC 4ESJA 5ICFA 3J81K 1S7OA 1V3FA 2G7UA 1IXCA 2O0YA 4I09A 2DLLA 5CVIA 3RTRA 2HYGD 1HW5A 3GF2A 3VOEA 2NYXA 5CVVA 1ONVA 1Y0UA 2R7DA 4NQWA 2VE8A 2WTEA 2ZKZA 2K27A 5DEQA 4AD9A 4AIJA 5D6EA 3MWMA 5TJJA 3E3VA 5CYVA 1XGMA 1HW2A 2M1BA 2CWEA 2VXZA 4IRIA 2V1XA 4IXAA 4BHBA 3KZZA 1BC7C 2H94A 2A61A 3ROUA 5J8FA 2R3SA 1XB4A 3RPUA 1T0FA 4HA8A 3JTGA 3J80K 1U2WA 3IRRA 4OIRF 3WTZA 4KIBA 2A07F 3KP4A 5KVRA 3LQQA 2DAOA 2GA2A 3GFLA 3LA7A 1TNSA 1RZ4A 2K86A 2VC1A 4HX8A 4A6EA 4OMYA 2IPQX 2OQRA 4IJAA 2DBBA 3DPLC 2KRFA 1XDUA 1WQ2A 2FNPA 1Z91A 5HLHA 4PCQA 2TDXA 3Q5FA 1PDNC 3PFIA 1F4KA 4FX4A 4A5NA 1UFMA 1A04A 4XRFA 2MLGA 2A3SA 3F6OA 1W5SA 1WI9A 4GGGA 5FD5A 2XROA 2FRHA 3BROA 3F72A 3ZN1A 3HTUA 5TRDA 4MTDA 5LGNA 2RDPA 4EGYA 5CLSA 2MLKA 3WGIA 4G6DA 4KT5C 3BJAA 1S6LA 3HSEA 1T6SA 3VFZA 1R00A 2KJCA 5LRSA 4G7HF 1OR7A 4ZYEA 1R36A 4AIHA 2PMUA 1SD4A 1L0OC 4S04A 5FFXA 1I27A 4EJTA 1OPCA 2J5PA 2KJBA 5E8GA 4ETSA 2XV4S 4GCVA 1L3LA 4ESFA 2UXNA 1U8RA 2VN2A 1C0WA 2AS5F 1UCRA 1DDNA 3MZYA 1OYYA 3BZ6A 5DUIA 4QLCU 2JZYA 1HKTA 3I64A 5FO5A 2O03A 2Z3YA 3K2ZA 1T38A 4RGXA 3WTSC 4EQQA 3KP7A 3LA3A 1XMKA 2KIFA 3H3ZA 4O6JA 2DPUA 2A5YB 3S2WA 3IHUA 3K69A 4ASNA 3BWGA 2NAZA 4Z2YA 3ZQ7A 5ICCA 1MJ9A 5LBQA 3V7CA 3NQOA 1FPQA 5K5OA 1E17A 2EWNA 4MQVA 4Y15A 3ZMTA 4ENMA 4IHSA 3JSPA 4B8XA 1XD7A 1X3UA 3DF8A 5JR3A 5BQTA 3IWFA 1BI3A 4EJWA 5ILVA 1LEBA 1ULYA 3K1NA 1B59A 1MDMA 3SZPA 4HF0A 4PDKA 4M72A 4R79A 1HKSA 4XBFA 1TQMA 3M8FA 4L9VA 5LEKA 3LA2A 2MH2A 1QPMA 5D4RA 2A69F 1D8KA 3BY6A 2XGXA 3BPXA 1KQ8A 1LEAA 1YLFA 2FF4A 3J81Z 1HSJA 2ZJ2A 3ECOA 2W57A 2VOOA 1YFHA 5LRRA 1MDMB 3GVAA 2VBXA 4KICA 1SAXA 5LHIA 4M9ZA 4U7BA 3PQJA 4M9SA 1G3YA 3ZN0A 3GZ6A 4Q5SF 3KE2A 1K79A 4CZZA 4Q47A 1LB2A 4EVIA 1OYIA 2STTA 3GFJA 2UXXA 3E6CC 1QNTA 1F1ZA 4WCGA 1XDSA 1XCVA 4M9XA 4R8HA 3AAFA 4AWXB 1ZG1A 5K1YA 3K1PA 5DCMA 1B6AA 4NB5A 3BP8A 1PUEE 3I53A 1QBJA 3J80Z 1YS7A 2FNAA 3L7WA 5BOXA 1O3SA 3P9IA 3QU3A 1Z6RA 4YFNF 3RPQA 3R0JA 4HYEA 2KIUA 2EA2A 4ZYHA 4KA4A 4EM0B 2QUFA 1YQAA 4KUMA 1QQIA 3F8FA 5DCMB 2MH9A 3VEPA 3DEUA 2L01A 3FZVA 3TO7A 3B02A 3OV8A 4HF2A 2JT1A 1Z1DA 1YTYA 2FXAA 4R1HA 3V8LA 2CYYA 2XAJA 3QPHA 4JBAA 3SQNA 1R22A 1ZARA 2ZMEA 1T2KA 1EH6A 1WKMA 3HHGA 2L02A 4BQAA 1FYLA 5E18F 2IVMA 3J7AO 1O57A 3E5QA 3COAC 5HS8A 1LDJA 3HIFA 3GUDA 1B4AA 4A0YA 2P5VA 5J8CA 3H3UA 2QBYB 4UXNA 1KU7A 1KU2A 2H27A 4PGGA 3GXOA 4PZJA 4ENKA 2V9VA 2ZMEB 2D1VA 2L4AA 4HZFA 3ZP5A 2RN7A 3KLNA 3FMQA 4CXFA 3QPTA 2LKPA 4CO8A 2YX7A 1QGPA 4FHTA 2ZFWA 2P4WA 1ZREA 3LQRA 3N97A 2OBPA 5FLXK 3TO6A 1HSTA 2KIMA 1WSUA 1HBXG 1CF7A 3IL2A 3WGHA 2PG4A 3IWZA 1XGSA 2EFPA 4HV6A 4G9YA 1QZYA 3BJOA 4XLNF 1D8JA 3JW4A 4AIKA 1NHAA 2QQBA 4Q48A 5F6FA 3F6VA 3WE3A 3F3XA 4CHUA 2QM3A 2XRNA 4TV7A 3V8KA 4XSXF 3WE2A 4A0ZA 5ED4A 1CF7B 4KN7X 5E1XA 3D0SA 3CUOA 5A2QZ 3FMRA 1SD7A 4P5OA 1S8NA 1H0MA 2CO5A 3FXQA 3ISPA 4RGSA 2X0LA 2F5CA 1J2XA 2LSOA 3KCCA 3HRSA 4ON0A 3U9GA 2O3FA 3M7GA 2VODA 2NS0A 2OZUA 4BH9A 3WTXC 2RVCA 4LLGF 2C6YA 2IRFG 4RS8A 2VOPA 3VB2A 4KIGA 2CG4A 1BI0A 2OAZA 4RGRA 5DCFA 1BIAA 2HDCA 3CDHA 4EJVA 5H20A 1JXSA 4RAYA 2QQ9A 2DFIA 3L00A 2G9WA 1ON2A 2EFNA 3QRFF 4ENNA 1JHHA 3CTAA 4ZZDA 3HUGA 2EV6A 2JPBA 4LB5A 2CGPA 1R1TA 3HTSB 4IRHA 5L3DA 4HV5A 3I59B 1K6OA 2IA1A 5H6RA 3LAJA 4HQEA 3I71A 3R6SA 2HQRA 3KEOA 2PI0A 3TKYA 3WTUC 1EV7A 2IA2A 2DO7A 3B73A 2Z9OA 3QP5A 2YR2A 4GXOA 1P92A 3RKXA 2Y48A 1LJ9A 4MNUA 2NNNA 1TQPA 1FNNA 4DNCA 4O3MA 1SD5A 1IXRC 1IF1A 2Q2EA 2F2EA 3RKYA 4KMUX 4KMFA 2K4JA 2VE9A 3V8JA 4IRGA 1U5TC 3ZMZA 4RB1A 1BOAA 3TOAA 3L09A 3RYPA 4HLYA 4BYYA 3I5UA 3CUQC 4OINF 2VT3A 2ACJA 1JE8A 1FX7A 1YS6A 3F8MA 2P6SA 3P9KA 3IKTA 3WTTC 1ZLJA 1W4MA 1DPUA 2P7CB 4L5JA 4D0PA 1V4RA 4KDPA 5LEJA 1J59A 1G3WA 2MC3A 2E7WA 1FP1D 4CYDA 1XCBA 4WX9A 1B1BA 2JPCA 1ZLKA 2LNBA 5ICGA 2BBYA 3ABTA 4G8XA 2FBKA 4LMYA 3WGGA 4GYGA 4I7HA 3TO9A 2V6CA 2FMYA 4MTEA 4HDVA 2P5KA 4XSZF 2Z5UA 1SFEA 1USSA 1KQ9A 4M74A 2BEOA 2M5WA 3G3ZA 4BAYA 2E1CA 1J0RA 1KGSA 3IRQA 2FOKA 2HOEA 1R23A 2DQRA 5EEHA 5L3GA 3REOA 1SFUA 2YPRA 1ZAOA 3W6KB 2DPDA 2CFXA 3WG9A 3V7SA 1S29A 3CUQA 3U2RA 3C18A 4I98B 5ILSA 5L3FA 4LFUA 3V4GA 2HQNA 3C1DA 1YO5C 4EMSA 3PQKA 1XN7A 2M87A 2D1HA 4N9HA 2UZKA 3O2PE 3RIRA 2FSWA 2RKHA 3DV8A 2MD5A 4UV9A 2HFHA 2Q8KA 1U5TB 1KU9A 2ETHA 2HEOA 4QWQA 3CUQB 3FWEA 5HS7A 3EDPA 1MJAA 2ISYA 3T1BA 5D4SA 4HF1A 3R0AA 4JQFA 1FYMA 2JTVA 2QYOA 4HAMA 2ESNA 2VBYA 2QENA 3T8RA 4P9UA 2DQLA 3H92A 3K9TA 3MCZA 2V1UA 5LHHA 3GX4X 4JK1X 1KQ0A 3F21A 2IT0A 3Q9SA 2EFWA 1P4WA 4YG2F 3ZMUA 4MQ9F 5CJ9A 2W25A 2DI3A 2XAQA 1RUOA 2E1NA 3JSOA 2K4BA 1W7PA 3I54A 4CICA 1B9MA 2EV5A 2H09A 5D8LB 4M6YA 5HDGA 3I0TA 1LDKB 3NRVA 4KNYA 2DW4A 3R61A 2GA1A 1R7JA 5F1RA 2UWMA 1GXPA 2F5EA 3LSTA 3KZYA 4MHGA 4I0AA 5D5VB 1YYVA 5E1WA 5DV5A 5LGUA 3DFGA 2DK8A 1W7PB 3DPTA 4CDGA 3DXJF 3FXUA 3TGNA 3O3KA 2P7VB 2OZ6A 4A0XA 5JI6A 1VTNC 3SFZA 1FBQA 4N9IA 1ZRCA 3LAPA 1XSVA 1SMYF 5HLGA 2FU4A 1TTYA 2NRAC 2LF8A 2DK5A 4KYWA 1U78A 3BJ6A 3TDUC 2G7HA 1OKRA 4P96A 1TNTA 2P8TA 2ISZA 4IHTA 5K5QA 3FM3A 5F64A 4BHCA 3DQVC 4LD5A 1DPRA 2YX4A 3GW2A 4LLLA 1ODDA 3NEUA 4YIFA 2EB7A 2FBIA 3GYHX 4EJOA 4LLNA 4BHPA 5IT9K 2HR3A 4MEXF 1P4XA 2QBYA 5DYMA 2IP2A 2ELHA 1FBUA 1YW8A 1FSHA 3V7RA 4OIOF 3QOPA 3ELKA 3M8EA 1IN5A 4GYIA 3KP2A 4G6QA 1TW3A 2P5LC 4MEYF 4ZYDA 2RV8A 4U0YA 4N0BA 2DTRA 4ZZLA 4LB6B 1O3RA 4UNOA 3F8NA 2OD5A 2XVCA 2W85A 2XAFA 1P4AA 4PGHA 4I0BA 4RGUA 4U0VA 1QZZA 2M45A 3DP7A 3ULQB 1AOYA 2RC4A 2IA0A 3E97A 3CO6C 1FSEA 4OOIA 1UHWA 3I4PA 4DQ2A 1T98A 2FEZA 3FM5A 1Z9CA 2QLZA 4IVNA 1G3TA 1R1VA 2AXLA 3FX3A 3T5XA 2DU9A 1GHCA 1QO0D 3BPVA 3GFMA 4U7DA 4M71A 1H9TA 2PMHA 4HW0A 1ZG5A 1I1SA 5H6QA 5BMZA 3CLOA 4XLPF 4I02A 2ESHA 4ENJA 1IRFA 2PEXA 2L54A 2Z99A 5L3CA 3JTHA 3QAHA 3ZMDA 2PLYA 3GLXA 4YFXF 3KP3A 3P7NA 3KETA 1GVJA 3HOSA 1IZ1A 4UUVA 5D8KB 2QWWA 3EUHA 3HSRA 1XSDA 2HZTA 1FLIA 1I1GA 2W24A 2PQ8A 3KEQA 1Z05A 3RI4A 3EQLF 1WWXA 1W7PD 2L3DA 4U88A 5CVJA 3ZMVA 3EYIA 1ZYRF 5LGTA 3RDIA 1IN6A 1FC3A 3I59A 4U0WA 5L3EA 1IAWA 1BIBA 2COMA 1JGSA 4I2OA 2Y75A 4L9TA 2GZWA 2GWRA 1IN7A 1Q1HA 3G73A 3ERED 2WV0A 1GXQA 4UHTA 3LWFA 3Q9VA 4EJUA 1KU3A 1D3YA 2P6TA 1LDDA 2HKOA 1J5YA 4Y13A 3O6BB 1FT9A 5FGMA 2IJLA 2FA5A 1OMIA 4HDUA 4EM2A 3C3WA 3F22A 1TW2A 1BI1A 2VT2A 1ZG3A 3QU6A 3HRUA 2XHKA 1SMTA 1H9GA 4E70A 3P9CA 1JHFA 4S05A 1MD0A 3HOTA 2YU3A 3HRMA 1R5GA 1O3QA 4EM1A 2RQPA 2F5DA 2VC0A 1MZBA 3T8TA 2MBFA 4L9NA 1EH7A 1ZH5A 1HXDA 3ABUA 1SFXA 2WWYA 1UB9A 1PP7U 4NHJA 1I6XA 3E5XA 1G4DA 1REPC 3M9AA 3K1MA 3ZPLA 3QP6A 4AVPA 1LVAA 4FT8A 2H6CA 1BJAA 5ICEA 2D45A 5FB2A 3SZTA 3W6JB 1J7KA 4BNCA 5AONA 2LF7A 3R4KA 3C7JA 5E1ZB 4HQMA 1FZPB 2FQ3A 4Y17A 5JHUA 4A6DA 2BYVE 1HKQA 2L4MA 4KFCA 4A2UA 3KLOA 5HS9A 4M73A 5FFZA 3BDDA 4I01A 2Y0MA 1TQIA 4L0YB 1IRGA 1E2XA 4H0EA 2CW0F 2QVOA 1FWZA 3JAMK 5DUKA 2A6HF 2R7FA 4HX7A 1G6NA 3ZMSA 2XUBA 2A68F 3LFKA 1XGNA 1FBSA 4G94A 1R58A 5IT9Z 5J6XA 2KKOA 4FX0A 1O7FA 1S7AA 4HLXA 3N4MA 3GEZA 3R60A 2XKPA 3HYIA 2ZO4A 4Q4ZF 1B9NA 2X4HA 2LDUA 1K7AA 1KYZA 5DD4A 4HX4A 1F5TA 4IF4A 1U5TA 3KP5A 3GO5A 4L9JA 4YFKF 4WXCA 2ZCWA 2D2WA 2BGCA 2EFOA 3E6DA 2E7XA 4WWCA 5CVUA 3K0LA 1XMAA 2H6BA
chains in the Genus database with same CATH superfamily
1YW7A 2X48A 4E7IA 2Y2ZA 3BT9A 1K4SA 4CCOA 4C2TA 1FOXA 3HOWJ 1ETKA 1TWCJ 4OAYA 4C2MJ 1STZA 5ERIA 2VLAA 5EEAA 3QYFA 3GWZA 2HI3A 4JOMA 2JMWA 1F9NA 3H0GJ 4LITA 4CGZA 1HLVA 2IS2A 1QVUA 3OOUA 3LMMA 4OMZA 3ML6A 2M30A 2VQGA 2OCCH 3KX2A 3AG2H 2DN0A 2W84A 2EIJH 5FLXZ 3FXRA 4BXUA 1HC8A 4FTHA 3LFUA 4WXDA 2CSOA 3TDZC 4BXFA 4CCMA 2CV1A 1MMDA 2Y9YA 4P9FA 1VQLI 1PP8F 5EF6A 1YI2I 4W97A 4EGZA 3PSFA 5AIPA 1NTCA 5CVRA 3GTKJ 3MFKA 1UHMA 1MJBA 2ZNYA 4YIIA 4XICA 4KIFA 3OYJA 4XLFA 3FHZA 1HW1A 2OTLI 5A2QK 3DKWA 2CQKA 4O5VA 4XRSG 4EV0A 2Z33A 2Q0OA 2AQEA 4OU0A 1DP7P 2ID3A 1E0EA 3OYNA 1E3HA 5DD8A 1LQ1A 1TBXA 2KFDA 1IGNA 2OU2A 2W00A 2QSGX 2ZNZA 3PL8A 3WTVC 4F52A 2STWA 3Q0VA 2FBHA 4XN0A 4RB2C 3MZHA 2Y0SA 1ZGJA 1BOBA 5FLVA 2FMLA 1VQ4I 1TZLA 3GFIA 6PAXA 1V54H 5E20A 3E5UA 4WF2A 3ZGKA 3OMYA 4XKVA 2R7VA 4UV8A 2L9VA 4B48A 3WTWC 1SVMA 5KK1A 3OS0A 3OYIA 4ZTJA 1JTXA 1Z7UA 1ZHFA 4RLFA 4XN3A 2WAQA 2PX9A 2P0WA 2R7TA 2CUJA 4L5IA 1MKMA 2HS5A 2YSRA 1GVDA 5LD2C 2GXGA 1I5ZA 1R1UA 2J5OA 1BJZA 2ZBKA 4PJMA 3OYGA 2MABA 2LKSA 2BE5F 3L2CA 1VF9A 4RB3C 3HB9A 1U3EM 3K4KA 1KYWA 1Y0NA 2XGEA 4LGWA 5HOOA 5M5YJ 1MGTA 3ABLH 3M1EA 4HNTA 5E3NA 1TT0A 2HTJA 1CGPA 1P6RA 4CYCA 1RRJA 1O3TA 2OA4A 1VQMI 1J9IA 1OYWA 2PN6A 1YIOA 2EJRA 4F93B 1G3SA 2DXIA 2EV0A 3GTMJ 3RYRA 2RNGA 2DA3A 1HA8A 2LFBA 3HZJA 3VYUB 1UJ8A 4UVAA 5GADJ 5LLQA 4IQJA 3SEZA 1RNLA 1AHDP 5EEGA 4LK1F 2ZXJA 2BXYA 4A3FJ 2VASA 2DCEA 4LJZF 2EA4A 1ETXA 2OUMA 5FKLA 4GO1A 4WK8F 1X3ZB 3BOQA 3JRGA 1FOKA 5D5UB 2BV6A 4E7SA 3ZQFA 5IT3A 3E7LA 5D5WB 2H1KA 4K2EA 1T39A 4OWRB 1BBYA 2GXAA 4OIPF 3L9FA 2GXBA 4IPAA 2ECCA 5E17F 4PUSA 2B0LA 5GPCA 3MEXA 4XM3A 2HU9A 2CQXA 3HSFA 5ILUA 2R7SA 4E7LA 3CCUI 1YG2A 2LY9A 3FKIJ 5LHGA 2K5CA 4ZDPA 1S3JA 2XAGA 4CYCB 3BTLA 1TLHB 3OSFA 1ZRDA 1UZCA 3C2HA 2W82A 5E8IA 5JFRA 2HWVA 4E6KG 1APLC 1ZKGA 2QQAA 1QVTA 1J75A 5BS6A 1QA6A 2DMPA 3LSGA 1KA8A 3JREA 3BR5A 3QPLA 4CZCA 2Y31A 3EETA 4N4NB 2X6OA 2RREA 3FF5A 3TP0A 4A5MA 2V6EA 1HDPA 1E3PA 1ZR4A 2DA5A 2NVUB 3CCSI 5GPAA 4HPQA 3EPZA 3E6MA 5FLMJ 1S72I 2KL4A 3SDGA 1ACIA 3LSRA 1LFPA 5D6FA 3I58A 1QPIA 3ZOBA 1R5HA 4MFEA 2HTSA 4HBLA 1ZRFA 4BY7J 1WRJA 3CQZJ 3GZ5A 1Z6TA 4HOBA 2DFFA 4E4HA 2VBWA 1VNDA 4DW6A 3AG3H 1X4OA 2F5VA 4XORA 4L0ZB 2O6GE 2ADUA 4UVBA 1PJRA 3HGGA 1AWCA 1LPQA 2BHYA 2XASA 2IAIA 4L18B 2KDOA 1O4XA 4ZYGA 2FE3A 3E0JB 3PUBA 1ZTRA 2KLOA 1FY7A 4FE7A 3CJNA 1USTA 1SD6A 1RIOH 4GDFA 1U6GA 1X19A 4A3DJ 3CCYA 1TP4A 2K02A 2V9PA 4A3EJ 3RZDJ 5HLIA 3EYYA 4A3JJ 1IN4A 2HKXA 4XONA 5JVTA 1Y8QB 2WB1A 1HOMA 1RKTA 3IKVA 2PBIA 5DS9A 1XS9A 1D5VA 2DYSH 2VPRA 3WTYC 4G7ZF 3BG5A 4V2GA 4NC6A 1BI2A 2GAUA 2LH9A 2K3FA 2LC2A 2EFQA 1UG2A 3H5AA 4UVCA 4DBQA 2JSCA 2QZ8A 3MAJA 2PJPA 2CH0A 1I3QJ 1YW9A 2AQFA 5HVQC 3KP6A 2RGVA 2XKOA 2DJNA 2FD5A 4M6XA 4AYBA 1XPXA 4ZDOA 1ENHA 1IUYA 1EF4A 5FD6A 2A6EF 3D5LA 3OOPA 3JAMZ 4RBOA 2X51A 1IXSB 2EIKH 2X85A 2RNJA 4RAFA 3KFWX 4M3EA 1KONA 3CJQB 4G7OF 2WC2A 2M8EA 4OIQF 2F5FA 3PM1A 2ZXWH 4A3KJ 2EINH 2JRTA 2M34A 2R5ZA 2V1DA 2MA3A 2YS9A 2GQQA 1I6HJ 5E3OA 4F7ZA 2LP0A 3SXYA 1BM9A 4MGRA 3LSPA 3FMSA 1P7IA 2HYFA 2QKLB 3E6BA 3ECHA 5GAGJ 1O7LA 2IW5A 3U1DA 5HDNA 1W5TA 2VONA 1BW5A 4KN4X 3ASNH 2VBZA 3RKWA 5JLXA 1FJLA 3RCOA 1EH8A 3PUFA 4FQGA 1TWFJ 1MSFC 5DM6F 3CO7C 4Y7NJ 3F8CA 2OQGA 3DBHB 3OYAA 3AG1H 1XGOA 2PFBA 3WU0A 1K78A 5B1AH 3FXOA 4P55A 1YHQI 4FISA 3F8BA 5D5XB 2VKDA 2JVHA 1BN5A 1BC8C 4PJNA 2KZGA 2MG4A 2LY1A 5GAHJ 4C3JJ 4XLCA 2DT5A 3I55I 1XSXA 1FYKA 2R5ZB 2XAHA 1E3OC 5GTIC 4H4KC 3HHHA 1LNWA 4I76A 5BPIA 3MQ0A 1A35A 1K83J 1ZQ3P 4LG0A 3IC7A 3BQYA 5J47A 2O8XA 2V1NA 4A69C 2YU9J 1W36C 4RB0A 1Z7LA 4WXHA 3S1QJ 1ZN2A 5HDKA 1IW7F 3DLAA 2O61A 4PFOA 1X1CA 4ZJZA 4LK0F 3CC4I 2Y69H 3BR0A 1RI7A 1WJ5A 2IGMA 2GIVA 3WU1B 1MMSA 1P2FA 2ME6A 3RJPA 1T56A 4IOAF 1SFOJ 2DT7B 5BPDA 4ZH4F 3WODF 3RSNA 5CQGA 4RAZA 1K78B 2XIGA 2HGCA 3BR1A 3TOBA 2NNYA 4B09A 1ON1A 4ESBA 4AC0A 3FBIB 3CDIA 1DP3A 1T0FC 2K9MA 5L3BA 1IN8A 2K7LA 3VODA 5E3LA 1JJ8C 3CCMI 2EK5A 4A12A 3HRTA 1R4MB 5DDGA 1ZGAA 2DA6A 1WJDA 4FASD 2HZDA 3TQNA 1GDTA 1YJWI 2VL8A 1MBEA 3NWTA 4Y33A 4LG0B 1FP2A 1HQCA 1WJFA 3IAS2 3F23A 3T0YA 3TP3A 5CPRB 3PIOF 4XIDA 2V79A 1RUNA 3SHFA 1V5EA 1PUFA 1LFUP 1ETOA 1IUFA 2R7QA 5K5RA 5HLTA 3BQZA 3JCUC 5AIQA 1DUXC 4ESJA 2HNHA 5ICFA 3VDXA 3J81K 1S7OA 1V3FA 2G7UA 1K4TA 1H89C 2L5QA 1IXCA 1PVEA 2O0YA 3L2QA 1WI3A 3MKZA 4I09A 2DLLA 5CVIA 3RTRA 2HYGD 1HW5A 3GF2A 3TEDA 2WY7Q 3IP4B 3VOEA 2NYXA 5CVVA 2OPTA 1ONVA 3DWLE 3M8JA 1Y0UA 2R7DA 1RR8C 4NQWA 4CCLA 2VE8A 3QWLA 3DBRB 2DODA 4CUGA 2WTEA 2OJED 2ZKZA 2K27A 2MYSA 5DEQA 2I5UA 4AD9A 1MSEC 2EZHA 4AIJA 2EZIA 3DLLF 5D6EA 3MWMA 5TJJA 3E3VA 2HQAA 4DIQA 2HOAA 1XGMA 5CYVA 3K70C 1PUFB 1HW2A 2VUMJ 2M1BA 2CWEA 2VXZA 2JWTA 3DTEA 4IRIA 2V1XA 1P9QC 4XK4A 3MKWB 1TT5B 2IS4A 2E35A 3M4OJ 4IXAA 4BHBA 3KZZA 3K2AA 2OCEA 1LE8A 1BC7C 1XTAA 2H94A 3J7YJ 2A61A 3ROUA 5J8FA 3KYLA 3G71I 2R3SA 2R93J 2HYJA 1XB4A 2L7MP 3RPUA 2E19A 1T0FA 4HA8A 3LSJA 3W3CA 3TMOA 3J80K 3JTGA 2DA1A 1U2WA 3IRRA 4OIRF 3WTZA 4KIBA 2A07F 1W1WE 3KP4A 5KVRA 3BC8A 4NQWB 4NUBA 3LQQA 1G8XA 2DAOA 5KHDA 2GA2A 1YOVB 3GFLA 1V55H 3QODA 3LA7A 1TNSA 2HDWA 3HM5A 1RZ4A 2K86A 2VC1A 3BG3A 4HX8A 4A6EA 4IX7A 4OMYA 1Z3XA 3LNQA 2IPQX 2IS1A 2OQRA 4IJAA 2KIQA 4FCYA 2XGCA 5IP6A 5F08A 4IZZA 2XSDC 2DBBA 3S3NA 5J4VA 1LE8B 1JUSA 3DPLC 2KRFA 1XDUA 1WQ2A 2FNPA 3UNGC 1Z91A 5HLHA 4PCQA 1WPKA 3HG9A 4G12A 5BNGA 2GBYA 2TDXA 4HEA2 3Q5FA 3CCEI 1PDNC 3FK7A 2LYCA 3PFIA 1F4KA 4M3GA 3D5RC 4A3LJ 4FX4A 3K6GA 3AL0C 3S3OA 1ZK8A 2EIMH 3H9GA 4FETA 4A5NA 1UFMA 1A04A 4XRFA 2MLGA 2A3SA 4DZPA 3F6OA 1W5SA 4NNJA 1WI9A 2K85A 1OCOH 1FMVA 3WU2C 2MD0A 4GGGA 2A05A 5F04A 4AM3A 3HGYA 5FD5A 2NXNB 3WHBA 5JHFA 2XROA 2FRHA 3BROA 3F72A 2WAQN 4E7JA 1RKWA 3ZN1A 2WA0A 2M8GX 3HTUA 1D0YA 5TRDA 4MTDA 4YEJA 5LGNA 2TRTA 1P7JA 2CJJA 2RDPA 1UELB 3FKJA 3K10A 1MBHA 3PNTA 4DZJA 2HXIA 1B72A 4D7NA 5B1BH 4EGYA 1GV5A 5CLSA 2MLKA 1TL8A 5DTDA 1ZR2A 3WGIA 3S2HJ 4G6DA 4C2UA 4KT5C 2Q2EB 4DYQA 1YITI 3S16J 5F27A 2X9DA 3BJAA 4BS9A 1IV8A 3BCAA 2A5WA 3QQAA 1S6LA 5M3FJ 2V26A 3HSEA 1VQNI 1T6SA 5K7HA 3VFZA 1A31A 1R00A 3CP8A 4KISA 5IP7J 2ZXHA 2IEKA 2KJCA 3H36A 4G6TB 4E7ZA 5LRSA 4G7HF 1OR7A 5F0HA 4ZYEA 3OR2C 1R36A 2LMDA 4AIHA 2PMUA 3CESA 1JUMA 1SD4A 1FIAA 1L0OC 4S04A 2XSJC 1KZHA 1B72B 4NDLA 5FFXA 3S93A 2HOSA 4S0HB 1I27A 4EJTA 3BTCA 4BE0A 1OPCA 1BL0A 2J5PA 2XB5A 1R5ID 2KJBA 3QYEA 1POGA 1Y56A 5E8GA 4B47A 2DJIA 4ETSA 2XF6A 2XV4S 4GCVA 4JP0A 4AIDA 2XF5A 1L3LA 1Z0XA 5FROA 2WY8Q 4ESFA 1WGXA 2UXNA 3G6EI 2ME0A 1WCMJ 1Y39A 2W7NA 2BY2A 4ZC3A 1IJWC 2CU7A 5EG0A 4ANJA 2VJ4A 1FIPA 2M4GA 2HOTA 2JA8J 2IXSA 3TW6A 4E7HA 1U8RA 1IG7A 3I4NJ 2VN2A 1C0WA 2AS5F 1UMQA 1UCRA 1DDNA 1DGRM 3MZYA 1OYYA 3BZ6A 3SFIA 5DUIA 2AHQA 4QLCU 2JZYA 4AVZA 1YX3A 1HKTA 4XOTA 4M3FA 3I64A 5FO5A 2XPWA 2O03A 3TL4X 3AL0B 2Z3YA 4NC8A 3K2ZA 3U1KA 1T38A 4RGXA 3W2VA 3WTSC 3FIWA 4EQQA 3KP7A 3LA3A 1XMKA 2KIFA 5FKMA 3H3ZA 4O6JA 2DPUA 2A5YB 3S2WA 3IHUA 3K69A 3MVPA 4MFDA 4ASNA 2Z1DA 2NAZA 3BWGA 1QHGA 4Z2YA 3ZQ7A 3CCJI 5ICCA 1MJ9A 2JRMA 5LBQA 2VI6A 2NS8A 3AG4H 2R4GA 4A3CJ 5IYCJ 3V7CA 3NQOA 5EG0B 1FPQA 2KDZA 1AU7A 4IHYA 1BR2A 5K5OA 5H2FC 2OC6A 3D1NI 1VQ5I 1E17A 2EWNA 2ELJA 4MQVA 4Y15A 3ZMTA 3OYHA 4ENMA 2L9RA 3PJRA 4IHSA 3JSPA 4B8XA 4PFPA 2NOJB 1XD7A 1X3UA 3DF8A 4XKBA 5JR3A 2VKVA 1U9NA 5BQTA 2NVQJ 3IWFA 4I99C 2VJ5A 3HOYJ 1BI3A 5M5WJ 1T33A 4EJWA 2CV0A 5ILVA 1LEBA 4J01A 1ULYA 2DOAA 3K1NA 1B59A 2Y30A 1MDMA 3SZPA 2HXOA 4HF0A 4PDKA 4M72A 4R79A 1HKSA 4XBFA 4C3IJ 1TQMA 1W36D 4M3DA 3M8FA 4X1EA 3W2WA 1MH4A 2O8KA 2BOLA 4L9VA 5F0FA 4DJAA 2UV1A 3LA2A 5LEKA 2MH2A 2E34A 4C9YA 2BZTA 1QPMA 3HOVJ 5J1YA 5D4RA 3G4SI 2A69F 3BG9A 1D8KA 3BY6A 2XGXA 4IL6C 1D1CA 1T08B 3BPXA 5JLWA 1KQ8A 2ID6A 2QF7A 3FXKA 3GTGJ 1LEAA 1RESA 2CW7A 1YLFA 3HC7A 1FOWA 1X1BA 2X6YA 3CC2I 1OCPA 2FF4A 2KRCA 3J7ZI 1ITYA 2CUZA 3RPUD 3ZQQA 1WJCA 3J81Z 1HSJA 2ZJ2A 3ECOA 2W57A 2CFOA 1VFCA 1IC8A 2VOOA 1MW7A 4A3GJ 2GOMA 1YFHA 5LRRA 1MDMB 2VIXA 3GVAA 4X0GA 2VBXA 4KICA 2D5VA 1SAXA 5LHIA 4M9ZA 1X1DA 1B8IB 4U7BA 4KITB 3PQJA 4M9SA 1G3YA 3ZN0A 3GZ6A 4Q5SF 3KE2A 2F4MB 3IUOA 2CRGA 1K79A 4CZZA 4Q47A 3VPRA 3K4JA 3QOEA 3SJMA 2M3AA 4EVIA 1OYIA 1SVOA 1LB2A 2STTA 1H88C 2EPFA 3GFJA 4CCKA 3PNVA 1Y1WJ 2UXXA 1BR1A 4ITVA 2L7FP 3E6CC 1QNTA 4V19K 2XF7A 1F1ZA 1BW6A 4WCGA 2DA4A 1XDSA 1XCVA 2JSPA 2I8DA 4M9XA 1AKHA 4R8HA 2ZMEC 2DTZA 3AAFA 5FKKA 4AWXB 4P1WA 4AU7A 4M3BA 1ZG1A 3S15J 5K1YA 3K1PA 5DCMA 1W0UA 2GM4A 2NVTJ 1YE9A 1B6AA 3EUKL 4NB5A 4E7KA 2VQCA 4A93J 4U87A 4EEFG 2O5RA 3BP8A 1PUEE 3G1MA 3I53A 1QBJA 3O8GA 3J80Z 1ETQA 2JA7J 1YS7A 3FISA 1D1BA 1I3AA 5KAFC 1FTZA 2H1LA 1UHSA 2FNAA 3IAM2 1W0TA 3G1OA 3L7WA 4J00A 5BOXA 2LVSA 1F36A 3A01A 4LOCA 3S8PA 1O3SA 5C44J 3P9IA 3QU3A 1Z6RA 2M7AA 4YFNF 2KP6A 2DDBA 4CCNA 2BHZA 3IH4A 3RPQA 2M9HA 2PMZN 3R0JA 3HOXJ 4IHVA 2M2EA 2ZSIB 2IGNA 4V2FA 4HRIA 2LOOA 4HYEA 2KIUA 3LSKA 3HPGA 5M3MJ 4ABZA 2EA2A 1AKHB 4ZYHA 4KA4A 4EM0B 2QUFA 1YQAA 4KUMA 3OYCA 1QQIA 2LTPA 3F8FA 3H5NA 5DCMB 1FEXA 2MH9A 3ZQIA 1RR7A 5E79C 2ZSHB 2QA4I 3CMAI 3VEPA 1DQUA 4DYRA 3L2UA 3DEUA 3HXLA 2L01A 3FZVA 3B02A 3TO7A 3OV8A 4HF2A 2JT1A 4Y4RA 4LIUA 1Z1DA 1EA3A 3A03A 3S17J 1YTYA 4A3BJ 2FXAA 3H9QA 4R1HA 3V8LA 1IDYA 4GFBA 2CYYA 3A01B 2XAJA 3QPHA 3AFHA 1HDDC 4F55A 2XPUA 4JBAA 2KPMA 3SQNA 1R22A 1ZARA 2ZMEA 1T2KA 4F92B 4F3QA 2MSYA 4RM3A 1EH6A 1WKMA 3DTIA 3I9V2 2DA2A 2A6TA 3HHGA 1Z77A 3GLLA 2L02A 4BQAA 3I56I 1FYLA 1RC9A 5E18F 3A1YA 1RETA 2IVMA 2F6CA 3OL4A 3J7AO 1O57A 3E5QA 1IV6A 5IYBJ 4DOZA 1X4PA 3COAC 5HS8A 3C2BA 5J1UA 3CC7I 1LDJA 2VB6A 3HIFA 3GUDA 1B4AA 4A0YA 3ZCOA 4KJZA 3S1RJ 1W5CC 2P5VA 5J8CA 3H3UA 2E2IJ 2QBYB 4UXNA 1LVKA 1KU7A 2HPIA 2NVXJ 1KU2A 2H27A 2VKEA 4XR6A 3A4CA 2JA2A 4PGGA 2LY2A 3GXOA 4BKXA 3PSIA 4PZJA 4ENKA 2V9VA 2ZMEB 5J3LA 2D1VA 2L4AA 2IGKA 4HZFA 3GZNB 3ZP5A 2JK3A 2QCOA 2RN7A 3S2DJ 3KLNA 3FMQA 4IOCF 4CXFA 3BG7A 3QPTA 1EJ9A 3J7AY 1Y8RB 3Q0WA 2LKPA 4CO8A 1I50J 2YX7A 1TWGJ 1QGPA 2XPVA 2OF7A 5DM7F 5EGOB 3JRBA 3VSKA 4FHTA 2ZFWA 3MZ8A 2P4WA 1ZREA 4BJ5C 3LQRA 3N97A 3L2VA 1D0XA 3L1PA 1HCRA 2UUZA 4PSWA 2OBPA 2CQNA 5FLXK 2FJ1A 3TO6A 1HSTA 1GUUA 2KIMA 1WSUA 3ZRGA 1HBXG 2KISA 1CF7A 2W4SA 2HPMA 4BU2A 3ZQHA 3IL2A 1NK3P 3WGHA 3MKYB 2JQ7A 2PG4A 3IWZA 1XGSA 4D5CA 2HVRA 2EFPA 3VYTB 1MMAA 5EJCA 2VKHA 4HV6A 3ZQGA 4IHXA 4G9YA 1QZYA 3SDBA 4XQFA 2HDDA 2O9LA 2LLKA 4NBQA 3OYFA 2WV1A 3BJOA 4XLNF 1D8JA 3P5JA 4CSWA 3JW4A 4AIKA 1NHAA 2QQBA 2E71A 4Q48A 5F6FA 2R7ZJ 3F6VA 2R92J 3WE3A 3FXJA 3F3XA 3MN2A 4CHUA 2QM3A 2XRNA 4AUXA 1R49A 1JT6A 4TV7A 2ZC2A 4XLEA 3FXMA 3V8KA 4XSXF 3WE2A 3H5RA 4A0ZA 1SVLA 5ED4A 1WZ2A 1CF7B 4KN7X 4Y52J 5E1XA 3D0SA 3CUOA 2DOEA 5A2QZ 3FMRA 4BBSJ 1SD7A 4P5OA 1S8NA 3DTKA 2X6XA 1H0MA 2CO5A 2LK2A 3FXQA 3ISPA 4RGSA 2X0LA 2F5CA 2I10A 1J2XA 2VQHA 2LSOA 3KCCA 2GLOA 3HRSA 4ON0A 3U9GA 2VQLA 2O3FA 3M7GA 4CH7A 1EKEA 2VODA 1IRXA 2NS0A 1V5FA 2OZUA 4BH9A 3H3VK 3WTXC 3HKZA 2RVCA 4LLGF 2C6YA 3D5SC 2IRFG 4RS8A 2VOPA 3VB2A 4BE1A 4KIGA 1QU3A 2F4IA 2VJIA 2CG4A 3S1NJ 2JUGA 1BI0A 2OAZA 4RGRA 5DCFA 1MBJA 3CLQA 1BIAA 1ORKA 2HDCA 3CDHA 4EJVA 5H20A 4RA2A 1JXSA 3CMEI 4RAYA 1ETVA 2QQ9A 2DFIA 3L00A 1X1AA 2G9WA 1Y1VJ 1ON2A 1A6IA 2EFNA 3QRFF 1S7EA 3E1SA 2F4OB 4ENNA 3BG6A 1JHHA 3CTAA 5GAEJ 4ZZDA 3HUGA 5E3MA 2EV6A 2JPBA 3OYLA 4LB5A 1RPWA 2CGPA 5C4JJ 3MD2A 1R1TA 5J40A 2ZJPF 3HTSB 4IRHA 3G2BA 5GTHC 5L3DA 3L2RA 3FHNA 3I59B 4HV5A 3HL2A 1K6OA 2IA1A 2O7OA 2BY1A 5H6RA 3LAJA 4HQEA 3DKYA 3PFYA 2MC4A 2VPLA 3H35A 3ABMH 2R7OA 3I71A 3R6SA 2HQRA 3BLYA 2W48A 3KEOA 2L7KA 2PI0A 3TKYA 3WTUC 1EV7A 2IA2A 1JGGA 4BDZA 1Y6IA 2DO7A 2NVYJ 3B73A 2HVSA 2Z9OA 3TBIA 3IV5A 3QP5A 1D1AA 2YR2A 4GXOA 1P92A 3OSGA 2IS6A 3CMYA 4X6AJ 3RKXA 2CS3A 4QIWN 3CDLA 2Y48A 1LJ9A 4MNUA 3HUGB 2BVMA 1X1PA 2NNNA 1TQPA 3VSLA 1FNNA 2XB0X 4DNCA 4I6ZA 4O3MA 1BA5A 1SD5A 3CCVI 1IXRC 4B43A 1X58A 3CF5F 2HVQA 2Q2EA 3DEWA 1IF1A 4MIMA 3DU5A 2Y0SN 1G2HA 9ANTA 2F2EA 3RKYA 4KMUX 3KYDB 4KMFA 2K4JA 2VE9A 3V8JA 4BXXJ 2DT6A 4A3MJ 3KPHA 1A36A 4IRGA 1U5TC 2LR8A 3ZMZA 4RB1A 2L9SA 1A5JA 3G1LA 1BOAA 3TOAA 4F91B 3JRFA 1U8BA 3ASOH 3L09A 3RYPA 4HLYA 4BYYA 4PJJA 3I5UA 3CUQC 2DYRH 2V4JC 4OINF 2VT3A 2ACJA 4JX4A 2MGQA 1JE8A 3HOUJ 1VI0A 1R6RA 1SAUA 4UUTA 4LIVA 2M0CA 1FX7A 1YS6A 3F8MA 2P6SA 5K7ZA 2R0QC 3P9KA 3IKTA 3WTTC 4PJ0C 3S14J 1ZLJA 3BCBA 3N05A 3K4LA 3OS1A 1W4MA 2R7RA 1DPUA 3K4BA 2E1MC 4L5JA 4MO7A 3EUAA 1V4RA 4D0PA 2P7CB 3DBLB 3U21A 3UR3C 3CCLI 4KDPA 1I39A 5LEJA 4XMYA 4OAZA 1G3WA 1J59A 2MC3A 5M5XJ 2E7WA 1SANA 2EBIA 2WADA 3I3LA 1FP1D 3DU6A 4CYDA 4KT6A 1XCBA 4WX9A 1B1BA 2LD5A 2JPCA 4BDYA 1ZLKA 2LNBA 4W1UA 2BBYA 5ICGA 3ABTA 4G8XA 2FBKA 4LMYA 3IH2A 3WGGA 5HNFA 2DMQA 4GYGA 2DOFA 3GCMA 1NH3A 4I7HA 3TO9A 3F9KA 2V6CA 2K40A 2FMYA 1X2NA 1J09A 2Q1ZB 4MTEA 4HDVA 1MBGA 2P5KA 1OISA 4D9JA 3PO3J 4XSZF 1VQ8I 3OYEA 3W2AA 2Z5UA 5J1RA 1SFEA 1MH3A 1USSA 1KQ9A 4M74A 5B3SH 3LSHA 1V5GA 2BEOA 2M5WA 3G3ZA 4BAYA 3DEEA 3QPSA 2E1CA 3A0BC 1J0RA 1KGSA 2EH3A 3KIOA 3IRQA 2FOKA 3HOZJ 2HOEA 1R23A 2DQRA 5EEHA 5L3GA 3REOA 1SFUA 2E2HJ 2YPRA 1ZAOA 3W6KB 2DPDA 1JT0A 2B7EA 2CFXA 4BUPA 3WG9A 4CA0A 3V7SA 3A2KA 4XLHA 1S29A 4BBRJ 3K7AJ 3CCRI 3CUQA 3U2RA 2E60A 3C18A 1MIJA 4I98B 5ILSA 2ELKA 2X1EA 2TCTA 3JRIA 5L3FA 4LFUA 3V4GA 1VQ7I 2HQNA 3C1DA 3HPHA 1YO5C 2QQ8A 3CF2A 1YX5A 3OYMA 4EMSA 3PQKA 2L9NA 2Y9ZA 1XN7A 2M87A 2D1HA 4N9HA 2UZKA 3O2PE 4RLQA 3RIRA 3FBNB 1NG6A 2FSWA 2OV7A 2RKHA 3DV8A 2MD5A 4GRIA 2HFHA 4UV9A 5EZHA 2XAUA 2WAFA 2Q8KA 1U5TB 1S5LC 5IOZA 2L0KA 1KU9A 2EQRA 2ETHA 2HEOA 5F0CA 2X1CA 5C3EJ 1JJ6C 1SC7A 2Z2SB 4XNFA 4II2A 2M0MA 4BY1J 4QWQA 3CUQB 5K7FA 2KHMA 3FWEA 5HS7A 1ETYA 3K4NA 3EDPA 1MJAA 2ISYA 3ZQLA 1QHHD 3T1BA 5D4SA 4HF1A 3R0AA 5IPAA 3S3MA 1JKOC 4JQFA 4XL9A 1FYMA 1VQKI 2JTVA 2E1MB 2QYOA 1WJBA 4HAMA 3DCFA 1XG1A 1TWAJ 2WB1N 2X1DA 1JI8A 3A02A 2ESNA 1IRZA 2DFHA 3CP2A 2VBYA 2QENA 3M1CA 3X2QH 1VQOI 3T8RA 4P9UA 2E5NA 4BQNA 2DQLA 3H92A 4IKFA 3K9TA 3MCZA 4C30A 2V1UA 1B8IA 3DPUA 5LHHA 1OCCH 3GX4X 4AYBN 1OLTA 2XDVA 1MNDA 1KQ0A 4JK1X 4PSXA 3F21A 3Q9SA 2EFWA 5J4YA 2IT0A 1P4WA 2JVGA 4YG2F 3O8HA 2COBA 3OS2A 3ZMUA 4MQ9F 3RKQA 1JUPA 2JUCA 5CJ9A 2H8WA 3JRAA 2W25A 3KZIC 2DI3A 1N75A 2XAQA 4YIRX 3JRHA 1RUOA 2E1NA 2OTJI 4JYKA 3JSOA 2K4BA 1W7PA 3I54A 4CICA 1B9MA 4BGDA 2EV5A 3SYTA 1A6QA 2H09A 5D8LB 4M6YA 5HDGA 3GTPJ 3I0TA 1LDKB 3NRVA 4KNYA 2DW4A 3R61A 2GA1A 5EZGA 1R7JA 1MBKA 1HF0A 3KYCB 5F1RA 1WVRA 2UWMA 4BACA 3H9JA 4XOPA 1SEUA 1GXPA 2F5EA 3LSTA 3KZYA 2EZLA 3ABKH 4DBRA 4MHGA 4I0AA 5D5VB 2AXTC 3BZCA 1YYVA 3I4MJ 2F48A 5E1WA 5DV5A 5LGUA 2RQQA 2QEXI 3CZ6A 1Z3YA 3H0DA 3PIPF 1VQ6I 3DFGA 2DK8A 1W7PB 3DPTA 4UB6C 3DXJF 3FXUA 3TGNA 4C3HJ 4CDGA 3VWBA 2ZXIA 3O3KA 1VZ0A 2P7VB 2OZ6A 3S32A 4A0XA 5JI6A 1VTNC 3SFZA 1FBQA 2ZB9A 4N9IA 1ZRCA 4IHWA 3LAPA 1XSVA 1SMYF 5HLGA 3CCQI 2FU4A 1TTYA 3K70D 3W6VA 2L7ZA 2LF8A 4II3A 5FKOA 4BQQA 2DK5A 2NRAC 4KYWA 1U78A 3HBLA 4J19A 1OFCX 1LUJB 3BJ6A 3TDUC 2G7HA 1ETWA 2KZVA 4ZTFA 1OKRA 2KT0A 1M1EB 2V9KA 3F0CA 4P96A 1TNTA 3BR3A 2WAEA 2HQ5A 2MFZA 1TWHJ 1XMXA 2P8TA 2R5YA 2ISZA 4IHTA 5K5QA 3FM3A 1TC3C 5F64A 4BHCA 5CKTA 1YJNI 3NAUA 2EZKA 2ZFUA 3DQVC 4LD5A 4QPOA 4XRSA 3BZKA 1WJEA 1DPRA 2CW8A 4B3XA 2XC7A 2YX4A 2FOWA 3GW2A 5HODA 4LLLA 2CQ7A 1ODDA 3NEUA 5JVGF 4YIFA 1IO2A 1PYVA 2EB7A 2XGDA 4HSRA 2MW8A 1OCZH 3LSMA 2FBIA 4HNUA 3GYHX 4EJOA 3GTJJ 3HKZN 4LLNA 4BHPA 5IT9K 1T95A 2HR3A 2RAEA 5TISC 4MEXF 1P4XA 2QBYA 1BR4A 5DYMA 2IP2A 2ELHA 1FBUA 1N78A 1YW8A 1GLNA 2VJJA 1FSHA 3V7RA 3RQ4A 4OIOF 5EYRA 3OL3A 2XRLA 3QOPA 2R5YB 1FMWA 2LRDA 3ELKA 3M8EA 1IN5A 3FXLA 4GYIA 3KP2A 4G6QA 1TW3A 2KRHA 2P5LC 3PO2J 4MEYF 3Q3SA 4DGWB 2N8GA 4ZYDA 2RV8A 3C2GA 4U0YA 4N0BA 2QSHX 2DTRA 4ZZLA 4LB6B 1O3RA 3OIQA 4UNOA 2B63J 3OYKA 5EGOA 3F8NA 2OD5A 2XVCA 4IEJA 1D0ZA 1R9TJ 2BW3A 2LKXA 2W85A 2XAFA 1P4AA 4PGHA 3JRDA 4I0BA 5FRNA 2E36A 1VQPI 4RGUA 4U0VA 1QZZA 2JN6A 5B66C 3CMMA 4HSTA 3FDYA 2M45A 1QRYA 3DP7A 1X2MA 3ULQB 1AOYA 2RC4A 2EILH 1XC5A 2IA0A 2NS7A 3E97A 1T8IA 3CO6C 1FSEA 4OOIA 1K61A 3Q0UA 3EUHC 1QZEA 1UHWA 3OR1C 3I4PA 4A3IJ 4DQ2A 4B1RA 1T98A 2FEZA 3FM5A 2FQ4A 3RQIA 4EATA 1Z9CA 3K4MA 1MMGA 2QLZA 5CQEA 4IVNA 1G3TA 1R1VA 2AXLA 3FX3A 2G0EA 2H8RA 3T5XA 2DU9A 1GHCA 2BW3B 1QO0D 3BPVA 3GFMA 4JX5A 5HNHA 2DFEA 2M4KA 4U7DA 4M71A 3L2WA 1R71A 1Z67A 1LKXA 1H9TA 2PMHA 3GTLJ 4HW0A 1ZG5A 2NOGA 1I1SA 5H6QA 3OIPA 5BMZA 2DMTA 3CLOA 4DYCA 2BY3A 3JR9A 3VYSB 1GT0C 4XLPF 3KEYA 4I02A 1YRNA 2ESHA 4ENJA 5IYDJ 1IRFA 2PEXA 3LSIA 3M3YJ 1S9HA 3MKLA 3ZQCA 2YUSA 2L54A 2Z99A 4D1QA 5L3CA 3B6CA 1FOYA 3JTHA 2K9SA 2FUG2 3NWSA 3QAHA 3ZMDA 1UG0A 2PLYA 2K9LA 5B5EC 3GLXA 4YFXF 1FTTA 3KP3A 3P7NA 3KETA 1GVJA 1UAAA 1VQ9I 4BQOA 1JTYA 4JX6A 5KAIC 3HOSA 1IZ1A 2DA7A 1ZGWA 4UUVA 5C4XJ 1JKQC 2ZJRF 4ZDLA 3GMEA 2CUEA 5D8KB 2QWWA 3EUHA 3HSRA 1XSDA 2HZTA 2R7UA 1FLIA 1I1GA 2W24A 2PQ8A 3KEQA 1Z05A 2IGOA 1YRNB 1WFXA 3RI4A 3EQLF 1WWXA 2DMNA 3ERMA 2PMZA 1W7PD 2L3DA 3H1CA 4U88A 1G59A 3BR2A 3V42A 4B44A 3ZR8X 1NK2P 4PK4A 2JJ7A 4RMNA 5EDNA 2Z16A 5CVJA 3HEFA 4UB8C 4ZYAA 3ZMVA 3EYIA 5IOYA 1YIJI 1ZYRF 5LGTA 1OJLA 3RDIA 1IN6A 1FC3A 3AKZA 1R4NB 3I59A 4U0WA 2L2OA 2R7XA 5L3EA 1IAWA 1BIBA 2COMA 1CQTA 1JGSA 1WH7A 4I2OA 2Y75A 4HNVA 3OWTA 5KCMA 2LREA 4L9TA 2GZWA 2GWRA 3NARA 5IP9J 2KMUA 5KNLA 2CMPA 1IN7A 2ICWG 4RAGA 1Q1HA 3G73A 3ERED 2WV0A 4BEHA 2VXDA 1GXQA 4BJ6C 3OY9A 4UHTA 3LWFA 3Q9VA 1SFKA 4EJUA 1KU3A 1D3YA 2QGUA 1MNMC 2P6TA 1LDDA 4UUSA 3BTJA 4UY8I 2HKOA 3GTQJ 1J5YA 4Y13A 3O6BB 1FT9A 5FGMA 2IJLA 1U9OA 1LFBA 1MNEA 2BXZA 1MMNA 1MBFA 4D5FA 1H8AC 4QTRA 1GV2A 2FA5A 1OMIA 2LG4A 4HDUA 1NG7A 2GIZA 3OYDA 4EM2A 1F43A 2IBDA 3B6AA 3C3WA 3F22A 2WBMA 4YRVA 3UKGA 1TW2A 1BI1A 2VT2A 1ZG3A 3QU6A 3HRUA 2DMUA 3LL7A 2XHKA 1SMTA 1H9GA 1IDZA 4MLOA 3CD6I 4BEHB 4N4OB 4E70A 3P9CA 1JHFA 2GOXB 4BL0B 3WG7H 3SZGA 4D7MA 4S05A 1MD0A 3HOTA 3IH3A 3VYRB 2YU3A 3RZOJ 2E5ZA 3HRMA 4UUSB 3BTIA 3A0HC 2V7FA 1R5GA 1WHUA 2K3PA 2JA6J 3LOCA 2P81A 1O3QA 4QSHA 4EM1A 3TW7A 4XKWA 2RQPA 2F5DA 3DKXA 2VC0A 1MZBA 1WH5A 3T8TA 2K9QA 2PJRA 2MBFA 3GBGA 3JRCA 3QYBA 4L9NA 1EH7A 3PNYA 1ZH5A 2CV2A 4IQ4A 1HXDA 3ABUA 1SFXA 2WWYA 3GTOJ 1DGWY 1UB9A 2KQRA 1PP7U 4NHJA 1OR7C 1I6XA 5LFAA 3E5XA 4IO9F 1G4DA 1REPC 3M9AA 3K1MA 3ZPLA 3QP6A 5TGTA 4AVPA 3CJRB 1LVAA 3BR6A 4RM2A 4FT8A 1ERDA 4XRMA 1OQYA 2H6CA 1BJAA 4B4CA 5ICEA 2D45A 4Z6YA 5FB2A 3SZTA 1ZELA 5FKNA 3W6JB 2E2JJ 1J7KA 2E1OA 4BNCA 5AONA 2LF7A 3R4KA 3C7JA 1OCTC 2CQQA 5E1ZB 4HQMA 3MMYB 2W1OA 1FZPB 4LG3A 2FQ3A 4Y17A 5JHUA 4A6DA 2BYVE 1HKQA 2L4MA 2M7BA 1N77A 2PJRB 2B9SA 4KFCA 1AA7A 2DDAA 4A2UA 3CJTB 3KLOA 4M73A 5HS9A 5FFZA 2QSFX 3BDDA 4I01A 2Y0MA 1TQIA 4L0YB 1IRGA 1DU6A 1OCRH 3OIOA 1E2XA 2CW0F 4H0EA 2QVOA 1FWZA 3JAMK 5DUKA 2A6HF 2R7FA 4HX7A 3OYBA 1G6NA 3ZMSA 2XUBA 2R7WA 1Q1VA 3ZXSA 4HG2A 2A68F 3LFKA 5FRMA 1XGNA 1FBSA 1XX5A 4G94A 1R58A 5IT9Z 5J6XA 2X6WA 2KKOA 4FX0A 3HJEA 5FJ8J 2LBFA 4CCJA 1D5YA 3S1MJ 1O7FA 2FX0A 2BY0A 1S7AA 3WHCA 4HLXA 3N4MA 1DU0A 3M07A 3GEZA 3R60A 4L5EA 1U0JA 2XKPA 3HYIA 4Y3OA 2JA5J 2ZO4A 4B3AA 2AO9A 2QKMB 4Q4ZF 4BE2A 1B9NA 2X4HA 4YELA 2LDUA 1K7AA 1KYZA 5DD4A 4HX4A 2ECBA 4RDUA 2K9NA 1N25A 4IF4A 4M6VA 1F5TA 3HDDA 3K4CA 1JKRC 1U5TA 3KP5A 3GO5A 4L9JA 4NC7A 4WXCA 3ESWB 4YFKF 1WJAA 4FE4A 4XLAA 2ZCWA 3ONQA 2ZJQF 5GP9A 2D2WA 1K6YA 2BGCA 2EFOA 4XKCA 4BJTA 2BVLA 1JKPC 1X3WB 3E6DA 5F1JA 2E7XA 4WWCA 5CVUA 4QPQA 3K0LA 3FK6A 1YJ9I 4PJLA 1XMAA 2CUFA 2LBFB 2H6BA 1Z21A 5IY5H 3SEQA
chains in the Genus database with same CATH topology
1YW7A 1STZA 5ERIA 3GWZA 1F9NA 4CGZA 4OMZA 3ML6A 2M30A 2W84A 5FLXZ 3FXRA 4BXUA 4WXDA 2CSOA 3TDZC 4P9FA 1PP8F 4EGZA 5AIPA 5CVRA 3MFKA 1UHMA 1MJBA 2ZNYA 4YIIA 4KIFA 3FHZA 1HW1A 5A2QK 3DKWA 2CQKA 4O5VA 4EV0A 2Z33A 2Q0OA 4OU0A 1DP7P 5DD8A 1LQ1A 1TBXA 2OU2A 2ZNZA 3WTVC 2STWA 2FBHA 4RB2C 3MZHA 1ZGJA 2FMLA 3GFIA 6PAXA 5E20A 3E5UA 4WF2A 4UV8A 3WTWC 5KK1A 1Z7UA 1ZHFA 4L5IA 1MKMA 2HS5A 2YSRA 2GXGA 1I5ZA 1R1UA 2J5OA 2ZBKA 2BE5F 3L2CA 4RB3C 1U3EM 1KYWA 4LGWA 5HOOA 1MGTA 3M1EA 2HTJA 1CGPA 1P6RA 1O3TA 2OA4A 1J9IA 1OYWA 2PN6A 1YIOA 2EJRA 1G3SA 2EV0A 3RYRA 4UVAA 5LLQA 1RNLA 5EEGA 4LK1F 2ZXJA 4LJZF 2EA4A 4GO1A 4WK8F 3BOQA 1FOKA 5D5UB 2BV6A 5IT3A 5D5WB 4K2EA 1T39A 1BBYA 4OIPF 3L9FA 2GXBA 4IPAA 5E17F 2B0LA 3MEXA 3HSFA 5ILUA 1YG2A 5LHGA 1S3JA 2XAGA 1TLHB 1ZRDA 5E8IA 5JFRA 2HWVA 2QQAA 1J75A 5BS6A 1KA8A 3EETA 4A5MA 3FF5A 3E6MA 5D6FA 3I58A 1R5HA 2HTSA 4HBLA 1ZRFA 1WRJA 3GZ5A 1Z6TA 4HOBA 2VBWA 4L0ZB 2O6GE 2ADUA 4UVBA 1AWCA 2XASA 4L18B 4ZYGA 2FE3A 1FY7A 3CJNA 1USTA 1SD6A 1RIOH 1U6GA 2K02A 5HLIA 3EYYA 1IN4A 2HKXA 5JVTA 3IKVA 2PBIA 1D5VA 3WTYC 4G7ZF 1BI2A 2GAUA 2EFQA 4UVCA 2JSCA 2QZ8A 3MAJA 2PJPA 1YW9A 5HVQC 3KP6A 2RGVA 2XKOA 4M6XA 1IUYA 5FD6A 2A6EF 3D5LA 3OOPA 3JAMZ 1IXSB 2RNJA 3KFWX 4G7OF 2WC2A 2M8EA 4OIQF 2F5FA 2JRTA 2V1DA 2MA3A 2GQQA 4F7ZA 3SXYA 1BM9A 4MGRA 3FMSA 2HYFA 3E6BA 3ECHA 1O7LA 2IW5A 3U1DA 5HDNA 1W5TA 2VONA 4KN4X 2VBZA 3RKWA 1EH8A 3CO7C 3F8CA 2OQGA 1XGOA 2PFBA 3WU0A 1K78A 4P55A 3F8BA 5D5XB 1BN5A 1BC8C 2DT5A 1XSXA 1FYKA 2XAHA 3HHHA 1LNWA 5BPIA 3MQ0A 4LG0A 3IC7A 2O8XA 4RB0A 4WXHA 1ZN2A 5HDKA 1IW7F 2O61A 4LK0F 1RI7A 2GIVA 3WU1B 1P2FA 3RJPA 5BPDA 4ZH4F 3WODF 1K78B 4RAZA 2XIGA 2HGCA 3TOBA 2NNYA 4B09A 1ON1A 4ESBA 5L3BA 1IN8A 2K7LA 3VODA 2EK5A 4A12A 3HRTA 5DDGA 1ZGAA 3TQNA 4LG0B 1FP2A 1HQCA 3F23A 3T0YA 1RUNA 2V79A 3SHFA 5K5RA 5AIQA 1DUXC 4ESJA 5ICFA 3J81K 1S7OA 1V3FA 2G7UA 1IXCA 2O0YA 4I09A 2DLLA 5CVIA 3RTRA 2HYGD 1HW5A 3GF2A 3VOEA 2NYXA 5CVVA 1ONVA 1Y0UA 2R7DA 4NQWA 2VE8A 2WTEA 2ZKZA 2K27A 5DEQA 4AD9A 4AIJA 5D6EA 3MWMA 5TJJA 3E3VA 5CYVA 1XGMA 1HW2A 2M1BA 2CWEA 2VXZA 4IRIA 2V1XA 4IXAA 4BHBA 3KZZA 1BC7C 2H94A 2A61A 3ROUA 5J8FA 2R3SA 1XB4A 3RPUA 1T0FA 4HA8A 3JTGA 3J80K 1U2WA 3IRRA 4OIRF 3WTZA 4KIBA 2A07F 3KP4A 5KVRA 3LQQA 2DAOA 2GA2A 3GFLA 3LA7A 1TNSA 1RZ4A 2K86A 2VC1A 4HX8A 4A6EA 4OMYA 2IPQX 2OQRA 4IJAA 2DBBA 3DPLC 2KRFA 1XDUA 1WQ2A 2FNPA 1Z91A 5HLHA 4PCQA 2TDXA 3Q5FA 1PDNC 3PFIA 1F4KA 4FX4A 4A5NA 1UFMA 1A04A 4XRFA 2MLGA 2A3SA 3F6OA 1W5SA 1WI9A 4GGGA 5FD5A 2XROA 2FRHA 3BROA 3F72A 3ZN1A 3HTUA 5TRDA 4MTDA 5LGNA 2RDPA 4EGYA 5CLSA 2MLKA 3WGIA 4G6DA 4KT5C 3BJAA 1S6LA 3HSEA 1T6SA 3VFZA 1R00A 2KJCA 5LRSA 4G7HF 1OR7A 4ZYEA 1R36A 4AIHA 2PMUA 1SD4A 1L0OC 4S04A 5FFXA 1I27A 4EJTA 1OPCA 2J5PA 2KJBA 5E8GA 4ETSA 2XV4S 4GCVA 1L3LA 4ESFA 2UXNA 1U8RA 2VN2A 1C0WA 2AS5F 1UCRA 1DDNA 3MZYA 1OYYA 3BZ6A 5DUIA 4QLCU 2JZYA 1HKTA 3I64A 5FO5A 2O03A 2Z3YA 3K2ZA 1T38A 4RGXA 3WTSC 4EQQA 3KP7A 3LA3A 1XMKA 2KIFA 3H3ZA 4O6JA 2DPUA 2A5YB 3S2WA 3IHUA 3K69A 4ASNA 3BWGA 2NAZA 4Z2YA 3ZQ7A 5ICCA 1MJ9A 5LBQA 3V7CA 3NQOA 1FPQA 5K5OA 1E17A 2EWNA 4MQVA 4Y15A 3ZMTA 4ENMA 4IHSA 3JSPA 4B8XA 1XD7A 1X3UA 3DF8A 5JR3A 5BQTA 3IWFA 1BI3A 4EJWA 5ILVA 1LEBA 1ULYA 3K1NA 1B59A 1MDMA 3SZPA 4HF0A 4PDKA 4M72A 4R79A 1HKSA 4XBFA 1TQMA 3M8FA 4L9VA 5LEKA 3LA2A 2MH2A 1QPMA 5D4RA 2A69F 1D8KA 3BY6A 2XGXA 3BPXA 1KQ8A 1LEAA 1YLFA 2FF4A 3J81Z 1HSJA 2ZJ2A 3ECOA 2W57A 2VOOA 1YFHA 5LRRA 1MDMB 3GVAA 2VBXA 4KICA 1SAXA 5LHIA 4M9ZA 4U7BA 3PQJA 4M9SA 1G3YA 3ZN0A 3GZ6A 4Q5SF 3KE2A 1K79A 4CZZA 4Q47A 1LB2A 4EVIA 1OYIA 2STTA 3GFJA 2UXXA 3E6CC 1QNTA 1F1ZA 4WCGA 1XDSA 1XCVA 4M9XA 4R8HA 3AAFA 4AWXB 1ZG1A 5K1YA 3K1PA 5DCMA 1B6AA 4NB5A 3BP8A 1PUEE 3I53A 1QBJA 3J80Z 1YS7A 2FNAA 3L7WA 5BOXA 1O3SA 3P9IA 3QU3A 1Z6RA 4YFNF 3RPQA 3R0JA 4HYEA 2KIUA 2EA2A 4ZYHA 4KA4A 4EM0B 2QUFA 1YQAA 4KUMA 1QQIA 3F8FA 5DCMB 2MH9A 3VEPA 3DEUA 2L01A 3FZVA 3TO7A 3B02A 3OV8A 4HF2A 2JT1A 1Z1DA 1YTYA 2FXAA 4R1HA 3V8LA 2CYYA 2XAJA 3QPHA 4JBAA 3SQNA 1R22A 1ZARA 2ZMEA 1T2KA 1EH6A 1WKMA 3HHGA 2L02A 4BQAA 1FYLA 5E18F 2IVMA 3J7AO 1O57A 3E5QA 3COAC 5HS8A 1LDJA 3HIFA 3GUDA 1B4AA 4A0YA 2P5VA 5J8CA 3H3UA 2QBYB 4UXNA 1KU7A 1KU2A 2H27A 4PGGA 3GXOA 4PZJA 4ENKA 2V9VA 2ZMEB 2D1VA 2L4AA 4HZFA 3ZP5A 2RN7A 3KLNA 3FMQA 4CXFA 3QPTA 2LKPA 4CO8A 2YX7A 1QGPA 4FHTA 2ZFWA 2P4WA 1ZREA 3LQRA 3N97A 2OBPA 5FLXK 3TO6A 1HSTA 2KIMA 1WSUA 1HBXG 1CF7A 3IL2A 3WGHA 2PG4A 3IWZA 1XGSA 2EFPA 4HV6A 4G9YA 1QZYA 3BJOA 4XLNF 1D8JA 3JW4A 4AIKA 1NHAA 2QQBA 4Q48A 5F6FA 3F6VA 3WE3A 3F3XA 4CHUA 2QM3A 2XRNA 4TV7A 3V8KA 4XSXF 3WE2A 4A0ZA 5ED4A 1CF7B 4KN7X 5E1XA 3D0SA 3CUOA 5A2QZ 3FMRA 1SD7A 4P5OA 1S8NA 1H0MA 2CO5A 3FXQA 3ISPA 4RGSA 2X0LA 2F5CA 1J2XA 2LSOA 3KCCA 3HRSA 4ON0A 3U9GA 2O3FA 3M7GA 2VODA 2NS0A 2OZUA 4BH9A 3WTXC 2RVCA 4LLGF 2C6YA 2IRFG 4RS8A 2VOPA 3VB2A 4KIGA 2CG4A 1BI0A 2OAZA 4RGRA 5DCFA 1BIAA 2HDCA 3CDHA 4EJVA 5H20A 1JXSA 4RAYA 2QQ9A 2DFIA 3L00A 2G9WA 1ON2A 2EFNA 3QRFF 4ENNA 1JHHA 3CTAA 4ZZDA 3HUGA 2EV6A 2JPBA 4LB5A 2CGPA 1R1TA 3HTSB 4IRHA 5L3DA 4HV5A 3I59B 1K6OA 2IA1A 5H6RA 3LAJA 4HQEA 3I71A 3R6SA 2HQRA 3KEOA 2PI0A 3TKYA 3WTUC 1EV7A 2IA2A 2DO7A 3B73A 2Z9OA 3QP5A 2YR2A 4GXOA 1P92A 3RKXA 2Y48A 1LJ9A 4MNUA 2NNNA 1TQPA 1FNNA 4DNCA 4O3MA 1SD5A 1IXRC 1IF1A 2Q2EA 2F2EA 3RKYA 4KMUX 4KMFA 2K4JA 2VE9A 3V8JA 4IRGA 1U5TC 3ZMZA 4RB1A 1BOAA 3TOAA 3L09A 3RYPA 4HLYA 4BYYA 3I5UA 3CUQC 4OINF 2VT3A 2ACJA 1JE8A 1FX7A 1YS6A 3F8MA 2P6SA 3P9KA 3IKTA 3WTTC 1ZLJA 1W4MA 1DPUA 2P7CB 4L5JA 4D0PA 1V4RA 4KDPA 5LEJA 1J59A 1G3WA 2MC3A 2E7WA 1FP1D 4CYDA 1XCBA 4WX9A 1B1BA 2JPCA 1ZLKA 2LNBA 5ICGA 2BBYA 3ABTA 4G8XA 2FBKA 4LMYA 3WGGA 4GYGA 4I7HA 3TO9A 2V6CA 2FMYA 4MTEA 4HDVA 2P5KA 4XSZF 2Z5UA 1SFEA 1USSA 1KQ9A 4M74A 2BEOA 2M5WA 3G3ZA 4BAYA 2E1CA 1J0RA 1KGSA 3IRQA 2FOKA 2HOEA 1R23A 2DQRA 5EEHA 5L3GA 3REOA 1SFUA 2YPRA 1ZAOA 3W6KB 2DPDA 2CFXA 3WG9A 3V7SA 1S29A 3CUQA 3U2RA 3C18A 4I98B 5ILSA 5L3FA 4LFUA 3V4GA 2HQNA 3C1DA 1YO5C 4EMSA 3PQKA 1XN7A 2M87A 2D1HA 4N9HA 2UZKA 3O2PE 3RIRA 2FSWA 2RKHA 3DV8A 2MD5A 4UV9A 2HFHA 2Q8KA 1U5TB 1KU9A 2ETHA 2HEOA 4QWQA 3CUQB 3FWEA 5HS7A 3EDPA 1MJAA 2ISYA 3T1BA 5D4SA 4HF1A 3R0AA 4JQFA 1FYMA 2JTVA 2QYOA 4HAMA 2ESNA 2VBYA 2QENA 3T8RA 4P9UA 2DQLA 3H92A 3K9TA 3MCZA 2V1UA 5LHHA 3GX4X 4JK1X 1KQ0A 3F21A 2IT0A 3Q9SA 2EFWA 1P4WA 4YG2F 3ZMUA 4MQ9F 5CJ9A 2W25A 2DI3A 2XAQA 1RUOA 2E1NA 3JSOA 2K4BA 1W7PA 3I54A 4CICA 1B9MA 2EV5A 2H09A 5D8LB 4M6YA 5HDGA 3I0TA 1LDKB 3NRVA 4KNYA 2DW4A 3R61A 2GA1A 1R7JA 5F1RA 2UWMA 1GXPA 2F5EA 3LSTA 3KZYA 4MHGA 4I0AA 5D5VB 1YYVA 5E1WA 5DV5A 5LGUA 3DFGA 2DK8A 1W7PB 3DPTA 4CDGA 3DXJF 3FXUA 3TGNA 3O3KA 2P7VB 2OZ6A 4A0XA 5JI6A 1VTNC 3SFZA 1FBQA 4N9IA 1ZRCA 3LAPA 1XSVA 1SMYF 5HLGA 2FU4A 1TTYA 2NRAC 2LF8A 2DK5A 4KYWA 1U78A 3BJ6A 3TDUC 2G7HA 1OKRA 4P96A 1TNTA 2P8TA 2ISZA 4IHTA 5K5QA 3FM3A 5F64A 4BHCA 3DQVC 4LD5A 1DPRA 2YX4A 3GW2A 4LLLA 1ODDA 3NEUA 4YIFA 2EB7A 2FBIA 3GYHX 4EJOA 4LLNA 4BHPA 5IT9K 2HR3A 4MEXF 1P4XA 2QBYA 5DYMA 2IP2A 2ELHA 1FBUA 1YW8A 1FSHA 3V7RA 4OIOF 3QOPA 3ELKA 3M8EA 1IN5A 4GYIA 3KP2A 4G6QA 1TW3A 2P5LC 4MEYF 4ZYDA 2RV8A 4U0YA 4N0BA 2DTRA 4ZZLA 4LB6B 1O3RA 4UNOA 3F8NA 2OD5A 2XVCA 2W85A 2XAFA 1P4AA 4PGHA 4I0BA 4RGUA 4U0VA 1QZZA 2M45A 3DP7A 3ULQB 1AOYA 2RC4A 2IA0A 3E97A 3CO6C 1FSEA 4OOIA 1UHWA 3I4PA 4DQ2A 1T98A 2FEZA 3FM5A 1Z9CA 2QLZA 4IVNA 1G3TA 1R1VA 2AXLA 3FX3A 3T5XA 2DU9A 1GHCA 1QO0D 3BPVA 3GFMA 4U7DA 4M71A 1H9TA 2PMHA 4HW0A 1ZG5A 1I1SA 5H6QA 5BMZA 3CLOA 4XLPF 4I02A 2ESHA 4ENJA 1IRFA 2PEXA 2L54A 2Z99A 5L3CA 3JTHA 3QAHA 3ZMDA 2PLYA 3GLXA 4YFXF 3KP3A 3P7NA 3KETA 1GVJA 3HOSA 1IZ1A 4UUVA 5D8KB 2QWWA 3EUHA 3HSRA 1XSDA 2HZTA 1FLIA 1I1GA 2W24A 2PQ8A 3KEQA 1Z05A 3RI4A 3EQLF 1WWXA 1W7PD 2L3DA 4U88A 5CVJA 3ZMVA 3EYIA 1ZYRF 5LGTA 3RDIA 1IN6A 1FC3A 3I59A 4U0WA 5L3EA 1IAWA 1BIBA 2COMA 1JGSA 4I2OA 2Y75A 4L9TA 2GZWA 2GWRA 1IN7A 1Q1HA 3G73A 3ERED 2WV0A 1GXQA 4UHTA 3LWFA 3Q9VA 4EJUA 1KU3A 1D3YA 2P6TA 1LDDA 2HKOA 1J5YA 4Y13A 3O6BB 1FT9A 5FGMA 2IJLA 2FA5A 1OMIA 4HDUA 4EM2A 3C3WA 3F22A 1TW2A 1BI1A 2VT2A 1ZG3A 3QU6A 3HRUA 2XHKA 1SMTA 1H9GA 4E70A 3P9CA 1JHFA 4S05A 1MD0A 3HOTA 2YU3A 3HRMA 1R5GA 1O3QA 4EM1A 2RQPA 2F5DA 2VC0A 1MZBA 3T8TA 2MBFA 4L9NA 1EH7A 1ZH5A 1HXDA 3ABUA 1SFXA 2WWYA 1UB9A 1PP7U 4NHJA 1I6XA 3E5XA 1G4DA 1REPC 3M9AA 3K1MA 3ZPLA 3QP6A 4AVPA 1LVAA 4FT8A 2H6CA 1BJAA 5ICEA 2D45A 5FB2A 3SZTA 3W6JB 1J7KA 4BNCA 5AONA 2LF7A 3R4KA 3C7JA 5E1ZB 4HQMA 1FZPB 2FQ3A 4Y17A 5JHUA 4A6DA 2BYVE 1HKQA 2L4MA 4KFCA 4A2UA 3KLOA 5HS9A 4M73A 5FFZA 3BDDA 4I01A 2Y0MA 1TQIA 4L0YB 1IRGA 1E2XA 4H0EA 2CW0F 2QVOA 1FWZA 3JAMK 5DUKA 2A6HF 2R7FA 4HX7A 1G6NA 3ZMSA 2XUBA 2A68F 3LFKA 1XGNA 1FBSA 4G94A 1R58A 5IT9Z 5J6XA 2KKOA 4FX0A 1O7FA 1S7AA 4HLXA 3N4MA 3GEZA 3R60A 2XKPA 3HYIA 2ZO4A 4Q4ZF 1B9NA 2X4HA 2LDUA 1K7AA 1KYZA 5DD4A 4HX4A 1F5TA 4IF4A 1U5TA 3KP5A 3GO5A 4L9JA 4YFKF 4WXCA 2ZCWA 2D2WA 2BGCA 2EFOA 3E6DA 2E7XA 4WWCA 5CVUA 3K0LA 1XMAA 2H6BA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1YW7 A;  1STZ A;  5ERI A;  3GWZ A;  1F9N A;  4CGZ A;  4OMZ A;  3ML6 A;  2M30 A;  2W84 A;  5FLX Z;  3FXR A;  4BXU A;  4WXD A;  2CSO A;  3TDZ C;  4P9F A;  1PP8 F;  4EGZ A;  5AIP A;  5CVR A;  3MFK A;  1UHM A;  1MJB A;  2ZNY A;  4YII A;  4KIF A;  3FHZ A;  1HW1 A;  5A2Q K;  3DKW A;  2CQK A;  4O5V A;  4EV0 A;  2Z33 A;  2Q0O A;  4OU0 A;  1DP7 P;  5DD8 A;  1LQ1 A;  1TBX A;  2OU2 A;  2ZNZ A;  3WTV C;  2STW A;  2FBH A;  4RB2 C;  3MZH A;  1ZGJ A;  2FML A;  3GFI A;  6PAX A;  5E20 A;  3E5U A;  4WF2 A;  4UV8 A;  3WTW C;  5KK1 A;  1Z7U A;  1ZHF A;  4L5I A;  1MKM A;  2HS5 A;  2YSR A;  2GXG A;  1I5Z A;  1R1U A;  2J5O A;  2ZBK A;  2BE5 F;  3L2C A;  4RB3 C;  1U3E M;  1KYW A;  4LGW A;  5HOO A;  1MGT A;  3M1E A;  2HTJ A;  1CGP A;  1P6R A;  1O3T A;  2OA4 A;  1J9I A;  1OYW A;  2PN6 A;  1YIO A;  2EJR A;  1G3S A;  2EV0 A;  3RYR A;  4UVA A;  5LLQ A;  1RNL A;  5EEG A;  4LK1 F;  2ZXJ A;  4LJZ F;  2EA4 A;  4GO1 A;  4WK8 F;  3BOQ A;  1FOK A;  5D5U B;  2BV6 A;  5IT3 A;  5D5W B;  4K2E A;  1T39 A;  1BBY A;  4OIP F;  3L9F A;  2GXB A;  4IPA A;  5E17 F;  2B0L A;  3MEX A;  3HSF A;  5ILU A;  1YG2 A;  5LHG A;  1S3J A;  2XAG A;  1TLH B;  1ZRD A;  5E8I A;  5JFR A;  2HWV A;  2QQA A;  1J75 A;  5BS6 A;  1KA8 A;  3EET A;  4A5M A;  3FF5 A;  3E6M A;  5D6F A;  3I58 A;  1R5H A;  2HTS A;  4HBL A;  1ZRF A;  1WRJ A;  3GZ5 A;  1Z6T A;  4HOB A;  2VBW A;  4L0Z B;  2O6G E;  2ADU A;  4UVB A;  1AWC A;  2XAS A;  4L18 B;  4ZYG A;  2FE3 A;  1FY7 A;  3CJN A;  1UST A;  1SD6 A;  1RIO H;  1U6G A;  2K02 A;  5HLI A;  3EYY A;  1IN4 A;  2HKX A;  5JVT A;  3IKV A;  2PBI A;  1D5V A;  3WTY C;  4G7Z F;  1BI2 A;  2GAU A;  2EFQ A;  4UVC A;  2JSC A;  2QZ8 A;  3MAJ A;  2PJP A;  1YW9 A;  5HVQ C;  3KP6 A;  2RGV A;  2XKO A;  4M6X A;  1IUY A;  5FD6 A;  2A6E F;  3D5L A;  3OOP A;  3JAM Z;  1IXS B;  2RNJ A;  3KFW X;  4G7O F;  2WC2 A;  2M8E A;  4OIQ F;  2F5F A;  2JRT A;  2V1D A;  2MA3 A;  2GQQ A;  4F7Z A;  3SXY A;  1BM9 A;  4MGR A;  3FMS A;  2HYF A;  3E6B A;  3ECH A;  1O7L A;  2IW5 A;  3U1D A;  5HDN A;  1W5T A;  2VON A;  4KN4 X;  2VBZ A;  3RKW A;  1EH8 A;  3CO7 C;  3F8C A;  2OQG A;  1XGO A;  2PFB A;  3WU0 A;  1K78 A;  4P55 A;  3F8B A;  5D5X B;  1BN5 A;  1BC8 C;  2DT5 A;  1XSX A;  1FYK A;  2XAH A;  3HHH A;  1LNW A;  5BPI A;  3MQ0 A;  4LG0 A;  3IC7 A;  2O8X A;  4RB0 A;  4WXH A;  1ZN2 A;  5HDK A;  1IW7 F;  2O61 A;  4LK0 F;  1RI7 A;  2GIV A;  3WU1 B;  1P2F A;  3RJP A;  5BPD A;  4ZH4 F;  3WOD F;  1K78 B;  4RAZ A;  2XIG A;  2HGC A;  3TOB A;  2NNY A;  4B09 A;  1ON1 A;  4ESB A;  5L3B A;  1IN8 A;  2K7L A;  3VOD A;  2EK5 A;  4A12 A;  3HRT A;  5DDG A;  1ZGA A;  3TQN A;  4LG0 B;  1FP2 A;  1HQC A;  3F23 A;  3T0Y A;  1RUN A;  2V79 A;  3SHF A;  5K5R A;  5AIQ A;  1DUX C;  4ESJ A;  5ICF A;  3J81 K;  1S7O A;  1V3F A;  2G7U A;  1IXC A;  2O0Y A;  4I09 A;  2DLL A;  5CVI A;  3RTR A;  2HYG D;  1HW5 A;  3GF2 A;  3VOE A;  2NYX A;  5CVV A;  1ONV A;  1Y0U A;  2R7D A;  4NQW A;  2VE8 A;  2WTE A;  2ZKZ A;  2K27 A;  5DEQ A;  4AD9 A;  4AIJ A;  5D6E A;  3MWM A;  5TJJ A;  3E3V A;  5CYV A;  1XGM A;  1HW2 A;  2M1B A;  2CWE A;  2VXZ A;  4IRI A;  2V1X A;  4IXA A;  4BHB A;  3KZZ A;  1BC7 C;  2H94 A;  2A61 A;  3ROU A;  5J8F A;  2R3S A;  1XB4 A;  3RPU A;  1T0F A;  4HA8 A;  3JTG A;  3J80 K;  1U2W A;  3IRR A;  4OIR F;  3WTZ A;  4KIB A;  2A07 F;  3KP4 A;  5KVR A;  3LQQ A;  2DAO A;  2GA2 A;  3GFL A;  3LA7 A;  1TNS A;  1RZ4 A;  2K86 A;  2VC1 A;  4HX8 A;  4A6E A;  4OMY A;  2IPQ X;  2OQR A;  4IJA A;  2DBB A;  3DPL C;  2KRF A;  1XDU A;  1WQ2 A;  2FNP A;  1Z91 A;  5HLH A;  4PCQ A;  2TDX A;  3Q5F A;  1PDN C;  3PFI A;  1F4K A;  4FX4 A;  4A5N A;  1UFM A;  1A04 A;  4XRF A;  2MLG A;  2A3S A;  3F6O A;  1W5S A;  1WI9 A;  4GGG A;  5FD5 A;  2XRO A;  2FRH A;  3BRO A;  3F72 A;  3ZN1 A;  3HTU A;  5TRD A;  4MTD A;  5LGN A;  2RDP A;  4EGY A;  5CLS A;  2MLK A;  3WGI A;  4G6D A;  4KT5 C;  3BJA A;  1S6L A;  3HSE A;  1T6S A;  3VFZ A;  1R00 A;  2KJC A;  5LRS A;  4G7H F;  1OR7 A;  4ZYE A;  1R36 A;  4AIH A;  2PMU A;  1SD4 A;  1L0O C;  4S04 A;  5FFX A;  1I27 A;  4EJT A;  1OPC A;  2J5P A;  2KJB A;  5E8G A;  4ETS A;  2XV4 S;  4GCV A;  1L3L A;  4ESF A;  2UXN A;  1U8R A;  2VN2 A;  1C0W A;  2AS5 F;  1UCR A;  1DDN A;  3MZY A;  1OYY A;  3BZ6 A;  5DUI A;  4QLC U;  2JZY A;  1HKT A;  3I64 A;  5FO5 A;  2O03 A;  2Z3Y A;  3K2Z A;  1T38 A;  4RGX A;  3WTS C;  4EQQ A;  3KP7 A;  3LA3 A;  1XMK A;  2KIF A;  3H3Z A;  4O6J A;  2DPU A;  2A5Y B;  3S2W A;  3IHU A;  3K69 A;  4ASN A;  3BWG A;  2NAZ A;  4Z2Y A;  3ZQ7 A;  5ICC A;  1MJ9 A;  5LBQ A;  3V7C A;  3NQO A;  1FPQ A;  5K5O A;  1E17 A;  2EWN A;  4MQV A;  4Y15 A;  3ZMT A;  4ENM A;  4IHS A;  3JSP A;  4B8X A;  1XD7 A;  1X3U A;  3DF8 A;  5JR3 A;  5BQT A;  3IWF A;  1BI3 A;  4EJW A;  5ILV A;  1LEB A;  1ULY A;  3K1N A;  1B59 A;  1MDM A;  3SZP A;  4HF0 A;  4PDK A;  4M72 A;  4R79 A;  1HKS A;  4XBF A;  1TQM A;  3M8F A;  4L9V A;  5LEK A;  3LA2 A;  2MH2 A;  1QPM A;  5D4R A;  2A69 F;  1D8K A;  3BY6 A;  2XGX A;  3BPX A;  1KQ8 A;  1LEA A;  1YLF A;  2FF4 A;  3J81 Z;  1HSJ A;  2ZJ2 A;  3ECO A;  2W57 A;  2VOO A;  1YFH A;  5LRR A;  1MDM B;  3GVA A;  2VBX A;  4KIC A;  1SAX A;  5LHI A;  4M9Z A;  4U7B A;  3PQJ A;  4M9S A;  1G3Y A;  3ZN0 A;  3GZ6 A;  4Q5S F;  3KE2 A;  1K79 A;  4CZZ A;  4Q47 A;  1LB2 A;  4EVI A;  1OYI A;  2STT A;  3GFJ A;  2UXX A;  3E6C C;  1QNT A;  1F1Z A;  4WCG A;  1XDS A;  1XCV A;  4M9X A;  4R8H A;  3AAF A;  4AWX B;  1ZG1 A;  5K1Y A;  3K1P A;  5DCM A;  1B6A A;  4NB5 A;  3BP8 A;  1PUE E;  3I53 A;  1QBJ A;  3J80 Z;  1YS7 A;  2FNA A;  3L7W A;  5BOX A;  1O3S A;  3P9I A;  3QU3 A;  1Z6R A;  4YFN F;  3RPQ A;  3R0J A;  4HYE A;  2KIU A;  2EA2 A;  4ZYH A;  4KA4 A;  4EM0 B;  2QUF A;  1YQA A;  4KUM A;  1QQI A;  3F8F A;  5DCM B;  2MH9 A;  3VEP A;  3DEU A;  2L01 A;  3FZV A;  3TO7 A;  3B02 A;  3OV8 A;  4HF2 A;  2JT1 A;  1Z1D A;  1YTY A;  2FXA A;  4R1H A;  3V8L A;  2CYY A;  2XAJ A;  3QPH A;  4JBA A;  3SQN A;  1R22 A;  1ZAR A;  2ZME A;  1T2K A;  1EH6 A;  1WKM A;  3HHG A;  2L02 A;  4BQA A;  1FYL A;  5E18 F;  2IVM A;  3J7A O;  1O57 A;  3E5Q A;  3COA C;  5HS8 A;  1LDJ A;  3HIF A;  3GUD A;  1B4A A;  4A0Y A;  2P5V A;  5J8C A;  3H3U A;  2QBY B;  4UXN A;  1KU7 A;  1KU2 A;  2H27 A;  4PGG A;  3GXO A;  4PZJ A;  4ENK A;  2V9V A;  2ZME B;  2D1V A;  2L4A A;  4HZF A;  3ZP5 A;  2RN7 A;  3KLN A;  3FMQ A;  4CXF A;  3QPT A;  2LKP A;  4CO8 A;  2YX7 A;  1QGP A;  4FHT A;  2ZFW A;  2P4W A;  1ZRE A;  3LQR A;  3N97 A;  2OBP A;  5FLX K;  3TO6 A;  1HST A;  2KIM A;  1WSU A;  1HBX G;  1CF7 A;  3IL2 A;  3WGH A;  2PG4 A;  3IWZ A;  1XGS A;  2EFP A;  4HV6 A;  4G9Y A;  1QZY A;  3BJO A;  4XLN F;  1D8J A;  3JW4 A;  4AIK A;  1NHA A;  2QQB A;  4Q48 A;  5F6F A;  3F6V A;  3WE3 A;  3F3X A;  4CHU A;  2QM3 A;  2XRN A;  4TV7 A;  3V8K A;  4XSX F;  3WE2 A;  4A0Z A;  5ED4 A;  1CF7 B;  4KN7 X;  5E1X A;  3D0S A;  3CUO A;  5A2Q Z;  3FMR A;  1SD7 A;  4P5O A;  1S8N A;  1H0M A;  2CO5 A;  3FXQ A;  3ISP A;  4RGS A;  2X0L A;  2F5C A;  1J2X A;  2LSO A;  3KCC A;  3HRS A;  4ON0 A;  3U9G A;  2O3F A;  3M7G A;  2VOD A;  2NS0 A;  2OZU A;  4BH9 A;  3WTX C;  2RVC A;  4LLG F;  2C6Y A;  2IRF G;  4RS8 A;  2VOP A;  3VB2 A;  4KIG A;  2CG4 A;  1BI0 A;  2OAZ A;  4RGR A;  5DCF A;  1BIA A;  2HDC A;  3CDH A;  4EJV A;  5H20 A;  1JXS A;  4RAY A;  2QQ9 A;  2DFI A;  3L00 A;  2G9W A;  1ON2 A;  2EFN A;  3QRF F;  4ENN A;  1JHH A;  3CTA A;  4ZZD A;  3HUG A;  2EV6 A;  2JPB A;  4LB5 A;  2CGP A;  1R1T A;  3HTS B;  4IRH A;  5L3D A;  4HV5 A;  3I59 B;  1K6O A;  2IA1 A;  5H6R A;  3LAJ A;  4HQE A;  3I71 A;  3R6S A;  2HQR A;  3KEO A;  2PI0 A;  3TKY A;  3WTU C;  1EV7 A;  2IA2 A;  2DO7 A;  3B73 A;  2Z9O A;  3QP5 A;  2YR2 A;  4GXO A;  1P92 A;  3RKX A;  2Y48 A;  1LJ9 A;  4MNU A;  2NNN A;  1TQP A;  1FNN A;  4DNC A;  4O3M A;  1SD5 A;  1IXR C;  1IF1 A;  2Q2E A;  2F2E A;  3RKY A;  4KMU X;  4KMF A;  2K4J A;  2VE9 A;  3V8J A;  4IRG A;  1U5T C;  3ZMZ A;  4RB1 A;  1BOA A;  3TOA A;  3L09 A;  3RYP A;  4HLY A;  4BYY A;  3I5U A;  3CUQ C;  4OIN F;  2VT3 A;  2ACJ A;  1JE8 A;  1FX7 A;  1YS6 A;  3F8M A;  2P6S A;  3P9K A;  3IKT A;  3WTT C;  1ZLJ A;  1W4M A;  1DPU A;  2P7C B;  4L5J A;  4D0P A;  1V4R A;  4KDP A;  5LEJ A;  1J59 A;  1G3W A;  2MC3 A;  2E7W A;  1FP1 D;  4CYD A;  1XCB A;  4WX9 A;  1B1B A;  2JPC A;  1ZLK A;  2LNB A;  5ICG A;  2BBY A;  3ABT A;  4G8X A;  2FBK A;  4LMY A;  3WGG A;  4GYG A;  4I7H A;  3TO9 A;  2V6C A;  2FMY A;  4MTE A;  4HDV A;  2P5K A;  4XSZ F;  2Z5U A;  1SFE A;  1USS A;  1KQ9 A;  4M74 A;  2BEO A;  2M5W A;  3G3Z A;  4BAY A;  2E1C A;  1J0R A;  1KGS A;  3IRQ A;  2FOK A;  2HOE A;  1R23 A;  2DQR A;  5EEH A;  5L3G A;  3REO A;  1SFU A;  2YPR A;  1ZAO A;  3W6K B;  2DPD A;  2CFX A;  3WG9 A;  3V7S A;  1S29 A;  3CUQ A;  3U2R A;  3C18 A;  4I98 B;  5ILS A;  5L3F A;  4LFU A;  3V4G A;  2HQN A;  3C1D A;  1YO5 C;  4EMS A;  3PQK A;  1XN7 A;  2M87 A;  2D1H A;  4N9H A;  2UZK A;  3O2P E;  3RIR A;  2FSW A;  2RKH A;  3DV8 A;  2MD5 A;  4UV9 A;  2HFH A;  2Q8K A;  1U5T B;  1KU9 A;  2ETH A;  2HEO A;  4QWQ A;  3CUQ B;  3FWE A;  5HS7 A;  3EDP A;  1MJA A;  2ISY A;  3T1B A;  5D4S A;  4HF1 A;  3R0A A;  4JQF A;  1FYM A;  2JTV A;  2QYO A;  4HAM A;  2ESN A;  2VBY A;  2QEN A;  3T8R A;  4P9U A;  2DQL A;  3H92 A;  3K9T A;  3MCZ A;  2V1U A;  5LHH A;  3GX4 X;  4JK1 X;  1KQ0 A;  3F21 A;  2IT0 A;  3Q9S A;  2EFW A;  1P4W A;  4YG2 F;  3ZMU A;  4MQ9 F;  5CJ9 A;  2W25 A;  2DI3 A;  2XAQ A;  1RUO A;  2E1N A;  3JSO A;  2K4B A;  1W7P A;  3I54 A;  4CIC A;  1B9M A;  2EV5 A;  2H09 A;  5D8L B;  4M6Y A;  5HDG A;  3I0T A;  1LDK B;  3NRV A;  4KNY A;  2DW4 A;  3R61 A;  2GA1 A;  1R7J A;  5F1R A;  2UWM A;  1GXP A;  2F5E A;  3LST A;  3KZY A;  4MHG A;  4I0A A;  5D5V B;  1YYV A;  5E1W A;  5DV5 A;  5LGU A;  3DFG A;  2DK8 A;  1W7P B;  3DPT A;  4CDG A;  3DXJ F;  3FXU A;  3TGN A;  3O3K A;  2P7V B;  2OZ6 A;  4A0X A;  5JI6 A;  1VTN C;  3SFZ A;  1FBQ A;  4N9I A;  1ZRC A;  3LAP A;  1XSV A;  1SMY F;  5HLG A;  2FU4 A;  1TTY A;  2NRA C;  2LF8 A;  2DK5 A;  4KYW A;  1U78 A;  3BJ6 A;  3TDU C;  2G7H A;  1OKR A;  4P96 A;  1TNT A;  2P8T A;  2ISZ A;  4IHT A;  5K5Q A;  3FM3 A;  5F64 A;  4BHC A;  3DQV C;  4LD5 A;  1DPR A;  2YX4 A;  3GW2 A;  4LLL A;  1ODD A;  3NEU A;  4YIF A;  2EB7 A;  2FBI A;  3GYH X;  4EJO A;  4LLN A;  4BHP A;  5IT9 K;  2HR3 A;  4MEX F;  1P4X A;  2QBY A;  5DYM A;  2IP2 A;  2ELH A;  1FBU A;  1YW8 A;  1FSH A;  3V7R A;  4OIO F;  3QOP A;  3ELK A;  3M8E A;  1IN5 A;  4GYI A;  3KP2 A;  4G6Q A;  1TW3 A;  2P5L C;  4MEY F;  4ZYD A;  2RV8 A;  4U0Y A;  4N0B A;  2DTR A;  4ZZL A;  4LB6 B;  1O3R A;  4UNO A;  3F8N A;  2OD5 A;  2XVC A;  2W85 A;  2XAF A;  1P4A A;  4PGH A;  4I0B A;  4RGU A;  4U0V A;  1QZZ A;  2M45 A;  3DP7 A;  3ULQ B;  1AOY A;  2RC4 A;  2IA0 A;  3E97 A;  3CO6 C;  1FSE A;  4OOI A;  1UHW A;  3I4P A;  4DQ2 A;  1T98 A;  2FEZ A;  3FM5 A;  1Z9C A;  2QLZ A;  4IVN A;  1G3T A;  1R1V A;  2AXL A;  3FX3 A;  3T5X A;  2DU9 A;  1GHC A;  1QO0 D;  3BPV A;  3GFM A;  4U7D A;  4M71 A;  1H9T A;  2PMH A;  4HW0 A;  1ZG5 A;  1I1S A;  5H6Q A;  5BMZ A;  3CLO A;  4XLP F;  4I02 A;  2ESH A;  4ENJ A;  1IRF A;  2PEX A;  2L54 A;  2Z99 A;  5L3C A;  3JTH A;  3QAH A;  3ZMD A;  2PLY A;  3GLX A;  4YFX F;  3KP3 A;  3P7N A;  3KET A;  1GVJ A;  3HOS A;  1IZ1 A;  4UUV A;  5D8K B;  2QWW A;  3EUH A;  3HSR A;  1XSD A;  2HZT A;  1FLI A;  1I1G A;  2W24 A;  2PQ8 A;  3KEQ A;  1Z05 A;  3RI4 A;  3EQL F;  1WWX A;  1W7P D;  2L3D A;  4U88 A;  5CVJ A;  3ZMV A;  3EYI A;  1ZYR F;  5LGT A;  3RDI A;  1IN6 A;  1FC3 A;  3I59 A;  4U0W A;  5L3E A;  1IAW A;  1BIB A;  2COM A;  1JGS A;  4I2O A;  2Y75 A;  4L9T A;  2GZW A;  2GWR A;  1IN7 A;  1Q1H A;  3G73 A;  3ERE D;  2WV0 A;  1GXQ A;  4UHT A;  3LWF A;  3Q9V A;  4EJU A;  1KU3 A;  1D3Y A;  2P6T A;  1LDD A;  2HKO A;  1J5Y A;  4Y13 A;  3O6B B;  1FT9 A;  5FGM A;  2IJL A;  2FA5 A;  1OMI A;  4HDU A;  4EM2 A;  3C3W A;  3F22 A;  1TW2 A;  1BI1 A;  2VT2 A;  1ZG3 A;  3QU6 A;  3HRU A;  2XHK A;  1SMT A;  1H9G A;  4E70 A;  3P9C A;  1JHF A;  4S05 A;  1MD0 A;  3HOT A;  2YU3 A;  3HRM A;  1R5G A;  1O3Q A;  4EM1 A;  2RQP A;  2F5D A;  2VC0 A;  1MZB A;  3T8T A;  2MBF A;  4L9N A;  1EH7 A;  1ZH5 A;  1HXD A;  3ABU A;  1SFX A;  2WWY A;  1UB9 A;  1PP7 U;  4NHJ A;  1I6X A;  3E5X A;  1G4D A;  1REP C;  3M9A A;  3K1M A;  3ZPL A;  3QP6 A;  4AVP A;  1LVA A;  4FT8 A;  2H6C A;  1BJA A;  5ICE A;  2D45 A;  5FB2 A;  3SZT A;  3W6J B;  1J7K A;  4BNC A;  5AON A;  2LF7 A;  3R4K A;  3C7J A;  5E1Z B;  4HQM A;  1FZP B;  2FQ3 A;  4Y17 A;  5JHU A;  4A6D A;  2BYV E;  1HKQ A;  2L4M A;  4KFC A;  4A2U A;  3KLO A;  5HS9 A;  4M73 A;  5FFZ A;  3BDD A;  4I01 A;  2Y0M A;  1TQI A;  4L0Y B;  1IRG A;  1E2X A;  4H0E A;  2CW0 F;  2QVO A;  1FWZ A;  3JAM K;  5DUK A;  2A6H F;  2R7F A;  4HX7 A;  1G6N A;  3ZMS A;  2XUB A;  2A68 F;  3LFK A;  1XGN A;  1FBS A;  4G94 A;  1R58 A;  5IT9 Z;  5J6X A;  2KKO A;  4FX0 A;  1O7F A;  1S7A A;  4HLX A;  3N4M A;  3GEZ A;  3R60 A;  2XKP A;  3HYI A;  2ZO4 A;  4Q4Z F;  1B9N A;  2X4H A;  2LDU A;  1K7A A;  1KYZ A;  5DD4 A;  4HX4 A;  1F5T A;  4IF4 A;  1U5T A;  3KP5 A;  3GO5 A;  4L9J A;  4YFK F;  4WXC A;  2ZCW A;  2D2W A;  2BGC A;  2EFO A;  3E6D A;  2E7X A;  4WWC A;  5CVU A;  3K0L A;  1XMA A;  2H6B A; 
#chains in the Genus database with same CATH topology
 1YW7 A;  2X48 A;  4E7I A;  2Y2Z A;  3BT9 A;  1K4S A;  4CCO A;  4C2T A;  1FOX A;  3HOW J;  1ETK A;  1TWC J;  4OAY A;  4C2M J;  1STZ A;  5ERI A;  2VLA A;  5EEA A;  3QYF A;  3GWZ A;  2HI3 A;  4JOM A;  2JMW A;  1F9N A;  3H0G J;  4LIT A;  4CGZ A;  1HLV A;  2IS2 A;  1QVU A;  3OOU A;  3LMM A;  4OMZ A;  3ML6 A;  2M30 A;  2VQG A;  2OCC H;  3KX2 A;  3AG2 H;  2DN0 A;  2W84 A;  2EIJ H;  5FLX Z;  3FXR A;  4BXU A;  1HC8 A;  4FTH A;  3LFU A;  4WXD A;  2CSO A;  3TDZ C;  4BXF A;  4CCM A;  2CV1 A;  1MMD A;  2Y9Y A;  4P9F A;  1VQL I;  1PP8 F;  5EF6 A;  1YI2 I;  4W97 A;  4EGZ A;  3PSF A;  5AIP A;  1NTC A;  5CVR A;  3GTK J;  3MFK A;  1UHM A;  1MJB A;  2ZNY A;  4YII A;  4XIC A;  4KIF A;  3OYJ A;  4XLF A;  3FHZ A;  1HW1 A;  2OTL I;  5A2Q K;  3DKW A;  2CQK A;  4O5V A;  4XRS G;  4EV0 A;  2Z33 A;  2Q0O A;  2AQE A;  4OU0 A;  1DP7 P;  2ID3 A;  1E0E A;  3OYN A;  1E3H A;  5DD8 A;  1LQ1 A;  1TBX A;  2KFD A;  1IGN A;  2OU2 A;  2W00 A;  2QSG X;  2ZNZ A;  3PL8 A;  3WTV C;  4F52 A;  2STW A;  3Q0V A;  2FBH A;  4XN0 A;  4RB2 C;  3MZH A;  2Y0S A;  1ZGJ A;  1BOB A;  5FLV A;  2FML A;  1VQ4 I;  1TZL A;  3GFI A;  6PAX A;  1V54 H;  5E20 A;  3E5U A;  4WF2 A;  3ZGK A;  3OMY A;  4XKV A;  2R7V A;  4UV8 A;  2L9V A;  4B48 A;  3WTW C;  1SVM A;  5KK1 A;  3OS0 A;  3OYI A;  4ZTJ A;  1JTX A;  1Z7U A;  1ZHF A;  4RLF A;  4XN3 A;  2WAQ A;  2PX9 A;  2P0W A;  2R7T A;  2CUJ A;  4L5I A;  1MKM A;  2HS5 A;  2YSR A;  1GVD A;  5LD2 C;  2GXG A;  1I5Z A;  1R1U A;  2J5O A;  1BJZ A;  2ZBK A;  4PJM A;  3OYG A;  2MAB A;  2LKS A;  2BE5 F;  3L2C A;  1VF9 A;  4RB3 C;  3HB9 A;  1U3E M;  3K4K A;  1KYW A;  1Y0N A;  2XGE A;  4LGW A;  5HOO A;  5M5Y J;  1MGT A;  3ABL H;  3M1E A;  4HNT A;  5E3N A;  1TT0 A;  2HTJ A;  1CGP A;  1P6R A;  4CYC A;  1RRJ A;  1O3T A;  2OA4 A;  1VQM I;  1J9I A;  1OYW A;  2PN6 A;  1YIO A;  2EJR A;  4F93 B;  1G3S A;  2DXI A;  2EV0 A;  3GTM J;  3RYR A;  2RNG A;  2DA3 A;  1HA8 A;  2LFB A;  3HZJ A;  3VYU B;  1UJ8 A;  4UVA A;  5GAD J;  5LLQ A;  4IQJ A;  3SEZ A;  1RNL A;  1AHD P;  5EEG A;  4LK1 F;  2ZXJ A;  2BXY A;  4A3F J;  2VAS A;  2DCE A;  4LJZ F;  2EA4 A;  1ETX A;  2OUM A;  5FKL A;  4GO1 A;  4WK8 F;  1X3Z B;  3BOQ A;  3JRG A;  1FOK A;  5D5U B;  2BV6 A;  4E7S A;  3ZQF A;  5IT3 A;  3E7L A;  5D5W B;  2H1K A;  4K2E A;  1T39 A;  4OWR B;  1BBY A;  2GXA A;  4OIP F;  3L9F A;  2GXB A;  4IPA A;  2ECC A;  5E17 F;  4PUS A;  2B0L A;  5GPC A;  3MEX A;  4XM3 A;  2HU9 A;  2CQX A;  3HSF A;  5ILU A;  2R7S A;  4E7L A;  3CCU I;  1YG2 A;  2LY9 A;  3FKI J;  5LHG A;  2K5C A;  4ZDP A;  1S3J A;  2XAG A;  4CYC B;  3BTL A;  1TLH B;  3OSF A;  1ZRD A;  1UZC A;  3C2H A;  2W82 A;  5E8I A;  5JFR A;  2HWV A;  4E6K G;  1APL C;  1ZKG A;  2QQA A;  1QVT A;  1J75 A;  5BS6 A;  1QA6 A;  2DMP A;  3LSG A;  1KA8 A;  3JRE A;  3BR5 A;  3QPL A;  4CZC A;  2Y31 A;  3EET A;  4N4N B;  2X6O A;  2RRE A;  3FF5 A;  3TP0 A;  4A5M A;  2V6E A;  1HDP A;  1E3P A;  1ZR4 A;  2DA5 A;  2NVU B;  3CCS I;  5GPA A;  4HPQ A;  3EPZ A;  3E6M A;  5FLM J;  1S72 I;  2KL4 A;  3SDG A;  1ACI A;  3LSR A;  1LFP A;  5D6F A;  3I58 A;  1QPI A;  3ZOB A;  1R5H A;  4MFE A;  2HTS A;  4HBL A;  1ZRF A;  4BY7 J;  1WRJ A;  3CQZ J;  3GZ5 A;  1Z6T A;  4HOB A;  2DFF A;  4E4H A;  2VBW A;  1VND A;  4DW6 A;  3AG3 H;  1X4O A;  2F5V A;  4XOR A;  4L0Z B;  2O6G E;  2ADU A;  4UVB A;  1PJR A;  3HGG A;  1AWC A;  1LPQ A;  2BHY A;  2XAS A;  2IAI A;  4L18 B;  2KDO A;  1O4X A;  4ZYG A;  2FE3 A;  3E0J B;  3PUB A;  1ZTR A;  2KLO A;  1FY7 A;  4FE7 A;  3CJN A;  1UST A;  1SD6 A;  1RIO H;  4GDF A;  1U6G A;  1X19 A;  4A3D J;  3CCY A;  1TP4 A;  2K02 A;  2V9P A;  4A3E J;  3RZD J;  5HLI A;  3EYY A;  4A3J J;  1IN4 A;  2HKX A;  4XON A;  5JVT A;  1Y8Q B;  2WB1 A;  1HOM A;  1RKT A;  3IKV A;  2PBI A;  5DS9 A;  1XS9 A;  1D5V A;  2DYS H;  2VPR A;  3WTY C;  4G7Z F;  3BG5 A;  4V2G A;  4NC6 A;  1BI2 A;  2GAU A;  2LH9 A;  2K3F A;  2LC2 A;  2EFQ A;  1UG2 A;  3H5A A;  4UVC A;  4DBQ A;  2JSC A;  2QZ8 A;  3MAJ A;  2PJP A;  2CH0 A;  1I3Q J;  1YW9 A;  2AQF A;  5HVQ C;  3KP6 A;  2RGV A;  2XKO A;  2DJN A;  2FD5 A;  4M6X A;  4AYB A;  1XPX A;  4ZDO A;  1ENH A;  1IUY A;  1EF4 A;  5FD6 A;  2A6E F;  3D5L A;  3OOP A;  3JAM Z;  4RBO A;  2X51 A;  1IXS B;  2EIK H;  2X85 A;  2RNJ A;  4RAF A;  3KFW X;  4M3E A;  1KON A;  3CJQ B;  4G7O F;  2WC2 A;  2M8E A;  4OIQ F;  2F5F A;  3PM1 A;  2ZXW H;  4A3K J;  2EIN H;  2JRT A;  2M34 A;  2R5Z A;  2V1D A;  2MA3 A;  2YS9 A;  2GQQ A;  1I6H J;  5E3O A;  4F7Z A;  2LP0 A;  3SXY A;  1BM9 A;  4MGR A;  3LSP A;  3FMS A;  1P7I A;  2HYF A;  2QKL B;  3E6B A;  3ECH A;  5GAG J;  1O7L A;  2IW5 A;  3U1D A;  5HDN A;  1W5T A;  2VON A;  1BW5 A;  4KN4 X;  3ASN H;  2VBZ A;  3RKW A;  5JLX A;  1FJL A;  3RCO A;  1EH8 A;  3PUF A;  4FQG A;  1TWF J;  1MSF C;  5DM6 F;  3CO7 C;  4Y7N J;  3F8C A;  2OQG A;  3DBH B;  3OYA A;  3AG1 H;  1XGO A;  2PFB A;  3WU0 A;  1K78 A;  5B1A H;  3FXO A;  4P55 A;  1YHQ I;  4FIS A;  3F8B A;  5D5X B;  2VKD A;  2JVH A;  1BN5 A;  1BC8 C;  4PJN A;  2KZG A;  2MG4 A;  2LY1 A;  5GAH J;  4C3J J;  4XLC A;  2DT5 A;  3I55 I;  1XSX A;  1FYK A;  2R5Z B;  2XAH A;  1E3O C;  5GTI C;  4H4K C;  3HHH A;  1LNW A;  4I76 A;  5BPI A;  3MQ0 A;  1A35 A;  1K83 J;  1ZQ3 P;  4LG0 A;  3IC7 A;  3BQY A;  5J47 A;  2O8X A;  2V1N A;  4A69 C;  2YU9 J;  1W36 C;  4RB0 A;  1Z7L A;  4WXH A;  3S1Q J;  1ZN2 A;  5HDK A;  1IW7 F;  3DLA A;  2O61 A;  4PFO A;  1X1C A;  4ZJZ A;  4LK0 F;  3CC4 I;  2Y69 H;  3BR0 A;  1RI7 A;  1WJ5 A;  2IGM A;  2GIV A;  3WU1 B;  1MMS A;  1P2F A;  2ME6 A;  3RJP A;  1T56 A;  4IOA F;  1SFO J;  2DT7 B;  5BPD A;  4ZH4 F;  3WOD F;  3RSN A;  5CQG A;  4RAZ A;  1K78 B;  2XIG A;  2HGC A;  3BR1 A;  3TOB A;  2NNY A;  4B09 A;  1ON1 A;  4ESB A;  4AC0 A;  3FBI B;  3CDI A;  1DP3 A;  1T0F C;  2K9M A;  5L3B A;  1IN8 A;  2K7L A;  3VOD A;  5E3L A;  1JJ8 C;  3CCM I;  2EK5 A;  4A12 A;  3HRT A;  1R4M B;  5DDG A;  1ZGA A;  2DA6 A;  1WJD A;  4FAS D;  2HZD A;  3TQN A;  1GDT A;  1YJW I;  2VL8 A;  1MBE A;  3NWT A;  4Y33 A;  4LG0 B;  1FP2 A;  1HQC A;  1WJF A;  3IAS 2;  3F23 A;  3T0Y A;  3TP3 A;  5CPR B;  3PIO F;  4XID A;  2V79 A;  1RUN A;  3SHF A;  1V5E A;  1PUF A;  1LFU P;  1ETO A;  1IUF A;  2R7Q A;  5K5R A;  5HLT A;  3BQZ A;  3JCU C;  5AIQ A;  1DUX C;  4ESJ A;  2HNH A;  5ICF A;  3VDX A;  3J81 K;  1S7O A;  1V3F A;  2G7U A;  1K4T A;  1H89 C;  2L5Q A;  1IXC A;  1PVE A;  2O0Y A;  3L2Q A;  1WI3 A;  3MKZ A;  4I09 A;  2DLL A;  5CVI A;  3RTR A;  2HYG D;  1HW5 A;  3GF2 A;  3TED A;  2WY7 Q;  3IP4 B;  3VOE A;  2NYX A;  5CVV A;  2OPT A;  1ONV A;  3DWL E;  3M8J A;  1Y0U A;  2R7D A;  1RR8 C;  4NQW A;  4CCL A;  2VE8 A;  3QWL A;  3DBR B;  2DOD A;  4CUG A;  2WTE A;  2OJE D;  2ZKZ A;  2K27 A;  2MYS A;  5DEQ A;  2I5U A;  4AD9 A;  1MSE C;  2EZH A;  4AIJ A;  2EZI A;  3DLL F;  5D6E A;  3MWM A;  5TJJ A;  3E3V A;  2HQA A;  4DIQ A;  2HOA A;  1XGM A;  5CYV A;  3K70 C;  1PUF B;  1HW2 A;  2VUM J;  2M1B A;  2CWE A;  2VXZ A;  2JWT A;  3DTE A;  4IRI A;  2V1X A;  1P9Q C;  4XK4 A;  3MKW B;  1TT5 B;  2IS4 A;  2E35 A;  3M4O J;  4IXA A;  4BHB A;  3KZZ A;  3K2A A;  2OCE A;  1LE8 A;  1BC7 C;  1XTA A;  2H94 A;  3J7Y J;  2A61 A;  3ROU A;  5J8F A;  3KYL A;  3G71 I;  2R3S A;  2R93 J;  2HYJ A;  1XB4 A;  2L7M P;  3RPU A;  2E19 A;  1T0F A;  4HA8 A;  3LSJ A;  3W3C A;  3TMO A;  3J80 K;  3JTG A;  2DA1 A;  1U2W A;  3IRR A;  4OIR F;  3WTZ A;  4KIB A;  2A07 F;  1W1W E;  3KP4 A;  5KVR A;  3BC8 A;  4NQW B;  4NUB A;  3LQQ A;  1G8X A;  2DAO A;  5KHD A;  2GA2 A;  1YOV B;  3GFL A;  1V55 H;  3QOD A;  3LA7 A;  1TNS A;  2HDW A;  3HM5 A;  1RZ4 A;  2K86 A;  2VC1 A;  3BG3 A;  4HX8 A;  4A6E A;  4IX7 A;  4OMY A;  1Z3X A;  3LNQ A;  2IPQ X;  2IS1 A;  2OQR A;  4IJA A;  2KIQ A;  4FCY A;  2XGC A;  5IP6 A;  5F08 A;  4IZZ A;  2XSD C;  2DBB A;  3S3N A;  5J4V A;  1LE8 B;  1JUS A;  3DPL C;  2KRF A;  1XDU A;  1WQ2 A;  2FNP A;  3UNG C;  1Z91 A;  5HLH A;  4PCQ A;  1WPK A;  3HG9 A;  4G12 A;  5BNG A;  2GBY A;  2TDX A;  4HEA 2;  3Q5F A;  3CCE I;  1PDN C;  3FK7 A;  2LYC A;  3PFI A;  1F4K A;  4M3G A;  3D5R C;  4A3L J;  4FX4 A;  3K6G A;  3AL0 C;  3S3O A;  1ZK8 A;  2EIM H;  3H9G A;  4FET A;  4A5N A;  1UFM A;  1A04 A;  4XRF A;  2MLG A;  2A3S A;  4DZP A;  3F6O A;  1W5S A;  4NNJ A;  1WI9 A;  2K85 A;  1OCO H;  1FMV A;  3WU2 C;  2MD0 A;  4GGG A;  2A05 A;  5F04 A;  4AM3 A;  3HGY A;  5FD5 A;  2NXN B;  3WHB A;  5JHF A;  2XRO A;  2FRH A;  3BRO A;  3F72 A;  2WAQ N;  4E7J A;  1RKW A;  3ZN1 A;  2WA0 A;  2M8G X;  3HTU A;  1D0Y A;  5TRD A;  4MTD A;  4YEJ A;  5LGN A;  2TRT A;  1P7J A;  2CJJ A;  2RDP A;  1UEL B;  3FKJ A;  3K10 A;  1MBH A;  3PNT A;  4DZJ A;  2HXI A;  1B72 A;  4D7N A;  5B1B H;  4EGY A;  1GV5 A;  5CLS A;  2MLK A;  1TL8 A;  5DTD A;  1ZR2 A;  3WGI A;  3S2H J;  4G6D A;  4C2U A;  4KT5 C;  2Q2E B;  4DYQ A;  1YIT I;  3S16 J;  5F27 A;  2X9D A;  3BJA A;  4BS9 A;  1IV8 A;  3BCA A;  2A5W A;  3QQA A;  1S6L A;  5M3F J;  2V26 A;  3HSE A;  1VQN I;  1T6S A;  5K7H A;  3VFZ A;  1A31 A;  1R00 A;  3CP8 A;  4KIS A;  5IP7 J;  2ZXH A;  2IEK A;  2KJC A;  3H36 A;  4G6T B;  4E7Z A;  5LRS A;  4G7H F;  1OR7 A;  5F0H A;  4ZYE A;  3OR2 C;  1R36 A;  2LMD A;  4AIH A;  2PMU A;  3CES A;  1JUM A;  1SD4 A;  1FIA A;  1L0O C;  4S04 A;  2XSJ C;  1KZH A;  1B72 B;  4NDL A;  5FFX A;  3S93 A;  2HOS A;  4S0H B;  1I27 A;  4EJT A;  3BTC A;  4BE0 A;  1OPC A;  1BL0 A;  2J5P A;  2XB5 A;  1R5I D;  2KJB A;  3QYE A;  1POG A;  1Y56 A;  5E8G A;  4B47 A;  2DJI A;  4ETS A;  2XF6 A;  2XV4 S;  4GCV A;  4JP0 A;  4AID A;  2XF5 A;  1L3L A;  1Z0X A;  5FRO A;  2WY8 Q;  4ESF A;  1WGX A;  2UXN A;  3G6E I;  2ME0 A;  1WCM J;  1Y39 A;  2W7N A;  2BY2 A;  4ZC3 A;  1IJW C;  2CU7 A;  5EG0 A;  4ANJ A;  2VJ4 A;  1FIP A;  2M4G A;  2HOT A;  2JA8 J;  2IXS A;  3TW6 A;  4E7H A;  1U8R A;  1IG7 A;  3I4N J;  2VN2 A;  1C0W A;  2AS5 F;  1UMQ A;  1UCR A;  1DDN A;  1DGR M;  3MZY A;  1OYY A;  3BZ6 A;  3SFI A;  5DUI A;  2AHQ A;  4QLC U;  2JZY A;  4AVZ A;  1YX3 A;  1HKT A;  4XOT A;  4M3F A;  3I64 A;  5FO5 A;  2XPW A;  2O03 A;  3TL4 X;  3AL0 B;  2Z3Y A;  4NC8 A;  3K2Z A;  3U1K A;  1T38 A;  4RGX A;  3W2V A;  3WTS C;  3FIW A;  4EQQ A;  3KP7 A;  3LA3 A;  1XMK A;  2KIF A;  5FKM A;  3H3Z A;  4O6J A;  2DPU A;  2A5Y B;  3S2W A;  3IHU A;  3K69 A;  3MVP A;  4MFD A;  4ASN A;  2Z1D A;  2NAZ A;  3BWG A;  1QHG A;  4Z2Y A;  3ZQ7 A;  3CCJ I;  5ICC A;  1MJ9 A;  2JRM A;  5LBQ A;  2VI6 A;  2NS8 A;  3AG4 H;  2R4G A;  4A3C J;  5IYC J;  3V7C A;  3NQO A;  5EG0 B;  1FPQ A;  2KDZ A;  1AU7 A;  4IHY A;  1BR2 A;  5K5O A;  5H2F C;  2OC6 A;  3D1N I;  1VQ5 I;  1E17 A;  2EWN A;  2ELJ A;  4MQV A;  4Y15 A;  3ZMT A;  3OYH A;  4ENM A;  2L9R A;  3PJR A;  4IHS A;  3JSP A;  4B8X A;  4PFP A;  2NOJ B;  1XD7 A;  1X3U A;  3DF8 A;  4XKB A;  5JR3 A;  2VKV A;  1U9N A;  5BQT A;  2NVQ J;  3IWF A;  4I99 C;  2VJ5 A;  3HOY J;  1BI3 A;  5M5W J;  1T33 A;  4EJW A;  2CV0 A;  5ILV A;  1LEB A;  4J01 A;  1ULY A;  2DOA A;  3K1N A;  1B59 A;  2Y30 A;  1MDM A;  3SZP A;  2HXO A;  4HF0 A;  4PDK A;  4M72 A;  4R79 A;  1HKS A;  4XBF A;  4C3I J;  1TQM A;  1W36 D;  4M3D A;  3M8F A;  4X1E A;  3W2W A;  1MH4 A;  2O8K A;  2BOL A;  4L9V A;  5F0F A;  4DJA A;  2UV1 A;  3LA2 A;  5LEK A;  2MH2 A;  2E34 A;  4C9Y A;  2BZT A;  1QPM A;  3HOV J;  5J1Y A;  5D4R A;  3G4S I;  2A69 F;  3BG9 A;  1D8K A;  3BY6 A;  2XGX A;  4IL6 C;  1D1C A;  1T08 B;  3BPX A;  5JLW A;  1KQ8 A;  2ID6 A;  2QF7 A;  3FXK A;  3GTG J;  1LEA A;  1RES A;  2CW7 A;  1YLF A;  3HC7 A;  1FOW A;  1X1B A;  2X6Y A;  3CC2 I;  1OCP A;  2FF4 A;  2KRC A;  3J7Z I;  1ITY A;  2CUZ A;  3RPU D;  3ZQQ A;  1WJC A;  3J81 Z;  1HSJ A;  2ZJ2 A;  3ECO A;  2W57 A;  2CFO A;  1VFC A;  1IC8 A;  2VOO A;  1MW7 A;  4A3G J;  2GOM A;  1YFH A;  5LRR A;  1MDM B;  2VIX A;  3GVA A;  4X0G A;  2VBX A;  4KIC A;  2D5V A;  1SAX A;  5LHI A;  4M9Z A;  1X1D A;  1B8I B;  4U7B A;  4KIT B;  3PQJ A;  4M9S A;  1G3Y A;  3ZN0 A;  3GZ6 A;  4Q5S F;  3KE2 A;  2F4M B;  3IUO A;  2CRG A;  1K79 A;  4CZZ A;  4Q47 A;  3VPR A;  3K4J A;  3QOE A;  3SJM A;  2M3A A;  4EVI A;  1OYI A;  1SVO A;  1LB2 A;  2STT A;  1H88 C;  2EPF A;  3GFJ A;  4CCK A;  3PNV A;  1Y1W J;  2UXX A;  1BR1 A;  4ITV A;  2L7F P;  3E6C C;  1QNT A;  4V19 K;  2XF7 A;  1F1Z A;  1BW6 A;  4WCG A;  2DA4 A;  1XDS A;  1XCV A;  2JSP A;  2I8D A;  4M9X A;  1AKH A;  4R8H A;  2ZME C;  2DTZ A;  3AAF A;  5FKK A;  4AWX B;  4P1W A;  4AU7 A;  4M3B A;  1ZG1 A;  3S15 J;  5K1Y A;  3K1P A;  5DCM A;  1W0U A;  2GM4 A;  2NVT J;  1YE9 A;  1B6A A;  3EUK L;  4NB5 A;  4E7K A;  2VQC A;  4A93 J;  4U87 A;  4EEF G;  2O5R A;  3BP8 A;  1PUE E;  3G1M A;  3I53 A;  1QBJ A;  3O8G A;  3J80 Z;  1ETQ A;  2JA7 J;  1YS7 A;  3FIS A;  1D1B A;  1I3A A;  5KAF C;  1FTZ A;  2H1L A;  1UHS A;  2FNA A;  3IAM 2;  1W0T A;  3G1O A;  3L7W A;  4J00 A;  5BOX A;  2LVS A;  1F36 A;  3A01 A;  4LOC A;  3S8P A;  1O3S A;  5C44 J;  3P9I A;  3QU3 A;  1Z6R A;  2M7A A;  4YFN F;  2KP6 A;  2DDB A;  4CCN A;  2BHZ A;  3IH4 A;  3RPQ A;  2M9H A;  2PMZ N;  3R0J A;  3HOX J;  4IHV A;  2M2E A;  2ZSI B;  2IGN A;  4V2F A;  4HRI A;  2LOO A;  4HYE A;  2KIU A;  3LSK A;  3HPG A;  5M3M J;  4ABZ A;  2EA2 A;  1AKH B;  4ZYH A;  4KA4 A;  4EM0 B;  2QUF A;  1YQA A;  4KUM A;  3OYC A;  1QQI A;  2LTP A;  3F8F A;  3H5N A;  5DCM B;  1FEX A;  2MH9 A;  3ZQI A;  1RR7 A;  5E79 C;  2ZSH B;  2QA4 I;  3CMA I;  3VEP A;  1DQU A;  4DYR A;  3L2U A;  3DEU A;  3HXL A;  2L01 A;  3FZV A;  3B02 A;  3TO7 A;  3OV8 A;  4HF2 A;  2JT1 A;  4Y4R A;  4LIU A;  1Z1D A;  1EA3 A;  3A03 A;  3S17 J;  1YTY A;  4A3B J;  2FXA A;  3H9Q A;  4R1H A;  3V8L A;  1IDY A;  4GFB A;  2CYY A;  3A01 B;  2XAJ A;  3QPH A;  3AFH A;  1HDD C;  4F55 A;  2XPU A;  4JBA A;  2KPM A;  3SQN A;  1R22 A;  1ZAR A;  2ZME A;  1T2K A;  4F92 B;  4F3Q A;  2MSY A;  4RM3 A;  1EH6 A;  1WKM A;  3DTI A;  3I9V 2;  2DA2 A;  2A6T A;  3HHG A;  1Z77 A;  3GLL A;  2L02 A;  4BQA A;  3I56 I;  1FYL A;  1RC9 A;  5E18 F;  3A1Y A;  1RET A;  2IVM A;  2F6C A;  3OL4 A;  3J7A O;  1O57 A;  3E5Q A;  1IV6 A;  5IYB J;  4DOZ A;  1X4P A;  3COA C;  5HS8 A;  3C2B A;  5J1U A;  3CC7 I;  1LDJ A;  2VB6 A;  3HIF A;  3GUD A;  1B4A A;  4A0Y A;  3ZCO A;  4KJZ A;  3S1R J;  1W5C C;  2P5V A;  5J8C A;  3H3U A;  2E2I J;  2QBY B;  4UXN A;  1LVK A;  1KU7 A;  2HPI A;  2NVX J;  1KU2 A;  2H27 A;  2VKE A;  4XR6 A;  3A4C A;  2JA2 A;  4PGG A;  2LY2 A;  3GXO A;  4BKX A;  3PSI A;  4PZJ A;  4ENK A;  2V9V A;  2ZME B;  5J3L A;  2D1V A;  2L4A A;  2IGK A;  4HZF A;  3GZN B;  3ZP5 A;  2JK3 A;  2QCO A;  2RN7 A;  3S2D J;  3KLN A;  3FMQ A;  4IOC F;  4CXF A;  3BG7 A;  3QPT A;  1EJ9 A;  3J7A Y;  1Y8R B;  3Q0W A;  2LKP A;  4CO8 A;  1I50 J;  2YX7 A;  1TWG J;  1QGP A;  2XPV A;  2OF7 A;  5DM7 F;  5EGO B;  3JRB A;  3VSK A;  4FHT A;  2ZFW A;  3MZ8 A;  2P4W A;  1ZRE A;  4BJ5 C;  3LQR A;  3N97 A;  3L2V A;  1D0X A;  3L1P A;  1HCR A;  2UUZ A;  4PSW A;  2OBP A;  2CQN A;  5FLX K;  2FJ1 A;  3TO6 A;  1HST A;  1GUU A;  2KIM A;  1WSU A;  3ZRG A;  1HBX G;  2KIS A;  1CF7 A;  2W4S A;  2HPM A;  4BU2 A;  3ZQH A;  3IL2 A;  1NK3 P;  3WGH A;  3MKY B;  2JQ7 A;  2PG4 A;  3IWZ A;  1XGS A;  4D5C A;  2HVR A;  2EFP A;  3VYT B;  1MMA A;  5EJC A;  2VKH A;  4HV6 A;  3ZQG A;  4IHX A;  4G9Y A;  1QZY A;  3SDB A;  4XQF A;  2HDD A;  2O9L A;  2LLK A;  4NBQ A;  3OYF A;  2WV1 A;  3BJO A;  4XLN F;  1D8J A;  3P5J A;  4CSW A;  3JW4 A;  4AIK A;  1NHA A;  2QQB A;  2E71 A;  4Q48 A;  5F6F A;  2R7Z J;  3F6V A;  2R92 J;  3WE3 A;  3FXJ A;  3F3X A;  3MN2 A;  4CHU A;  2QM3 A;  2XRN A;  4AUX A;  1R49 A;  1JT6 A;  4TV7 A;  2ZC2 A;  4XLE A;  3FXM A;  3V8K A;  4XSX F;  3WE2 A;  3H5R A;  4A0Z A;  1SVL A;  5ED4 A;  1WZ2 A;  1CF7 B;  4KN7 X;  4Y52 J;  5E1X A;  3D0S A;  3CUO A;  2DOE A;  5A2Q Z;  3FMR A;  4BBS J;  1SD7 A;  4P5O A;  1S8N A;  3DTK A;  2X6X A;  1H0M A;  2CO5 A;  2LK2 A;  3FXQ A;  3ISP A;  4RGS A;  2X0L A;  2F5C A;  2I10 A;  1J2X A;  2VQH A;  2LSO A;  3KCC A;  2GLO A;  3HRS A;  4ON0 A;  3U9G A;  2VQL A;  2O3F A;  3M7G A;  4CH7 A;  1EKE A;  2VOD A;  1IRX A;  2NS0 A;  1V5F A;  2OZU A;  4BH9 A;  3H3V K;  3WTX C;  3HKZ A;  2RVC A;  4LLG F;  2C6Y A;  3D5S C;  2IRF G;  4RS8 A;  2VOP A;  3VB2 A;  4BE1 A;  4KIG A;  1QU3 A;  2F4I A;  2VJI A;  2CG4 A;  3S1N J;  2JUG A;  1BI0 A;  2OAZ A;  4RGR A;  5DCF A;  1MBJ A;  3CLQ A;  1BIA A;  1ORK A;  2HDC A;  3CDH A;  4EJV A;  5H20 A;  4RA2 A;  1JXS A;  3CME I;  4RAY A;  1ETV A;  2QQ9 A;  2DFI A;  3L00 A;  1X1A A;  2G9W A;  1Y1V J;  1ON2 A;  1A6I A;  2EFN A;  3QRF F;  1S7E A;  3E1S A;  2F4O B;  4ENN A;  3BG6 A;  1JHH A;  3CTA A;  5GAE J;  4ZZD A;  3HUG A;  5E3M A;  2EV6 A;  2JPB A;  3OYL A;  4LB5 A;  1RPW A;  2CGP A;  5C4J J;  3MD2 A;  1R1T A;  5J40 A;  2ZJP F;  3HTS B;  4IRH A;  3G2B A;  5GTH C;  5L3D A;  3L2R A;  3FHN A;  3I59 B;  4HV5 A;  3HL2 A;  1K6O A;  2IA1 A;  2O7O A;  2BY1 A;  5H6R A;  3LAJ A;  4HQE A;  3DKY A;  3PFY A;  2MC4 A;  2VPL A;  3H35 A;  3ABM H;  2R7O A;  3I71 A;  3R6S A;  2HQR A;  3BLY A;  2W48 A;  3KEO A;  2L7K A;  2PI0 A;  3TKY A;  3WTU C;  1EV7 A;  2IA2 A;  1JGG A;  4BDZ A;  1Y6I A;  2DO7 A;  2NVY J;  3B73 A;  2HVS A;  2Z9O A;  3TBI A;  3IV5 A;  3QP5 A;  1D1A A;  2YR2 A;  4GXO A;  1P92 A;  3OSG A;  2IS6 A;  3CMY A;  4X6A J;  3RKX A;  2CS3 A;  4QIW N;  3CDL A;  2Y48 A;  1LJ9 A;  4MNU A;  3HUG B;  2BVM A;  1X1P A;  2NNN A;  1TQP A;  3VSL A;  1FNN A;  2XB0 X;  4DNC A;  4I6Z A;  4O3M A;  1BA5 A;  1SD5 A;  3CCV I;  1IXR C;  4B43 A;  1X58 A;  3CF5 F;  2HVQ A;  2Q2E A;  3DEW A;  1IF1 A;  4MIM A;  3DU5 A;  2Y0S N;  1G2H A;  9ANT A;  2F2E A;  3RKY A;  4KMU X;  3KYD B;  4KMF A;  2K4J A;  2VE9 A;  3V8J A;  4BXX J;  2DT6 A;  4A3M J;  3KPH A;  1A36 A;  4IRG A;  1U5T C;  2LR8 A;  3ZMZ A;  4RB1 A;  2L9S A;  1A5J A;  3G1L A;  1BOA A;  3TOA A;  4F91 B;  3JRF A;  1U8B A;  3ASO H;  3L09 A;  3RYP A;  4HLY A;  4BYY A;  4PJJ A;  3I5U A;  3CUQ C;  2DYR H;  2V4J C;  4OIN F;  2VT3 A;  2ACJ A;  4JX4 A;  2MGQ A;  1JE8 A;  3HOU J;  1VI0 A;  1R6R A;  1SAU A;  4UUT A;  4LIV A;  2M0C A;  1FX7 A;  1YS6 A;  3F8M A;  2P6S A;  5K7Z A;  2R0Q C;  3P9K A;  3IKT A;  3WTT C;  4PJ0 C;  3S14 J;  1ZLJ A;  3BCB A;  3N05 A;  3K4L A;  3OS1 A;  1W4M A;  2R7R A;  1DPU A;  3K4B A;  2E1M C;  4L5J A;  4MO7 A;  3EUA A;  1V4R A;  4D0P A;  2P7C B;  3DBL B;  3U21 A;  3UR3 C;  3CCL I;  4KDP A;  1I39 A;  5LEJ A;  4XMY A;  4OAZ A;  1G3W A;  1J59 A;  2MC3 A;  5M5X J;  2E7W A;  1SAN A;  2EBI A;  2WAD A;  3I3L A;  1FP1 D;  3DU6 A;  4CYD A;  4KT6 A;  1XCB A;  4WX9 A;  1B1B A;  2LD5 A;  2JPC A;  4BDY A;  1ZLK A;  2LNB A;  4W1U A;  2BBY A;  5ICG A;  3ABT A;  4G8X A;  2FBK A;  4LMY A;  3IH2 A;  3WGG A;  5HNF A;  2DMQ A;  4GYG A;  2DOF A;  3GCM A;  1NH3 A;  4I7H A;  3TO9 A;  3F9K A;  2V6C A;  2K40 A;  2FMY A;  1X2N A;  1J09 A;  2Q1Z B;  4MTE A;  4HDV A;  1MBG A;  2P5K A;  1OIS A;  4D9J A;  3PO3 J;  4XSZ F;  1VQ8 I;  3OYE A;  3W2A A;  2Z5U A;  5J1R A;  1SFE A;  1MH3 A;  1USS A;  1KQ9 A;  4M74 A;  5B3S H;  3LSH A;  1V5G A;  2BEO A;  2M5W A;  3G3Z A;  4BAY A;  3DEE A;  3QPS A;  2E1C A;  3A0B C;  1J0R A;  1KGS A;  2EH3 A;  3KIO A;  3IRQ A;  2FOK A;  3HOZ J;  2HOE A;  1R23 A;  2DQR A;  5EEH A;  5L3G A;  3REO A;  1SFU A;  2E2H J;  2YPR A;  1ZAO A;  3W6K B;  2DPD A;  1JT0 A;  2B7E A;  2CFX A;  4BUP A;  3WG9 A;  4CA0 A;  3V7S A;  3A2K A;  4XLH A;  1S29 A;  4BBR J;  3K7A J;  3CCR I;  3CUQ A;  3U2R A;  2E60 A;  3C18 A;  1MIJ A;  4I98 B;  5ILS A;  2ELK A;  2X1E A;  2TCT A;  3JRI A;  5L3F A;  4LFU A;  3V4G A;  1VQ7 I;  2HQN A;  3C1D A;  3HPH A;  1YO5 C;  2QQ8 A;  3CF2 A;  1YX5 A;  3OYM A;  4EMS A;  3PQK A;  2L9N A;  2Y9Z A;  1XN7 A;  2M87 A;  2D1H A;  4N9H A;  2UZK A;  3O2P E;  4RLQ A;  3RIR A;  3FBN B;  1NG6 A;  2FSW A;  2OV7 A;  2RKH A;  3DV8 A;  2MD5 A;  4GRI A;  2HFH A;  4UV9 A;  5EZH A;  2XAU A;  2WAF A;  2Q8K A;  1U5T B;  1S5L C;  5IOZ A;  2L0K A;  1KU9 A;  2EQR A;  2ETH A;  2HEO A;  5F0C A;  2X1C A;  5C3E J;  1JJ6 C;  1SC7 A;  2Z2S B;  4XNF A;  4II2 A;  2M0M A;  4BY1 J;  4QWQ A;  3CUQ B;  5K7F A;  2KHM A;  3FWE A;  5HS7 A;  1ETY A;  3K4N A;  3EDP A;  1MJA A;  2ISY A;  3ZQL A;  1QHH D;  3T1B A;  5D4S A;  4HF1 A;  3R0A A;  5IPA A;  3S3M A;  1JKO C;  4JQF A;  4XL9 A;  1FYM A;  1VQK I;  2JTV A;  2E1M B;  2QYO A;  1WJB A;  4HAM A;  3DCF A;  1XG1 A;  1TWA J;  2WB1 N;  2X1D A;  1JI8 A;  3A02 A;  2ESN A;  1IRZ A;  2DFH A;  3CP2 A;  2VBY A;  2QEN A;  3M1C A;  3X2Q H;  1VQO I;  3T8R A;  4P9U A;  2E5N A;  4BQN A;  2DQL A;  3H92 A;  4IKF A;  3K9T A;  3MCZ A;  4C30 A;  2V1U A;  1B8I A;  3DPU A;  5LHH A;  1OCC H;  3GX4 X;  4AYB N;  1OLT A;  2XDV A;  1MND A;  1KQ0 A;  4JK1 X;  4PSX A;  3F21 A;  3Q9S A;  2EFW A;  5J4Y A;  2IT0 A;  1P4W A;  2JVG A;  4YG2 F;  3O8H A;  2COB A;  3OS2 A;  3ZMU A;  4MQ9 F;  3RKQ A;  1JUP A;  2JUC A;  5CJ9 A;  2H8W A;  3JRA A;  2W25 A;  3KZI C;  2DI3 A;  1N75 A;  2XAQ A;  4YIR X;  3JRH A;  1RUO A;  2E1N A;  2OTJ I;  4JYK A;  3JSO A;  2K4B A;  1W7P A;  3I54 A;  4CIC A;  1B9M A;  4BGD A;  2EV5 A;  3SYT A;  1A6Q A;  2H09 A;  5D8L B;  4M6Y A;  5HDG A;  3GTP J;  3I0T A;  1LDK B;  3NRV A;  4KNY A;  2DW4 A;  3R61 A;  2GA1 A;  5EZG A;  1R7J A;  1MBK A;  1HF0 A;  3KYC B;  5F1R A;  1WVR A;  2UWM A;  4BAC A;  3H9J A;  4XOP A;  1SEU A;  1GXP A;  2F5E A;  3LST A;  3KZY A;  2EZL A;  3ABK H;  4DBR A;  4MHG A;  4I0A A;  5D5V B;  2AXT C;  3BZC A;  1YYV A;  3I4M J;  2F48 A;  5E1W A;  5DV5 A;  5LGU A;  2RQQ A;  2QEX I;  3CZ6 A;  1Z3Y A;  3H0D A;  3PIP F;  1VQ6 I;  3DFG A;  2DK8 A;  1W7P B;  3DPT A;  4UB6 C;  3DXJ F;  3FXU A;  3TGN A;  4C3H J;  4CDG A;  3VWB A;  2ZXI A;  3O3K A;  1VZ0 A;  2P7V B;  2OZ6 A;  3S32 A;  4A0X A;  5JI6 A;  1VTN C;  3SFZ A;  1FBQ A;  2ZB9 A;  4N9I A;  1ZRC A;  4IHW A;  3LAP A;  1XSV A;  1SMY F;  5HLG A;  3CCQ I;  2FU4 A;  1TTY A;  3K70 D;  3W6V A;  2L7Z A;  2LF8 A;  4II3 A;  5FKO A;  4BQQ A;  2DK5 A;  2NRA C;  4KYW A;  1U78 A;  3HBL A;  4J19 A;  1OFC X;  1LUJ B;  3BJ6 A;  3TDU C;  2G7H A;  1ETW A;  2KZV A;  4ZTF A;  1OKR A;  2KT0 A;  1M1E B;  2V9K A;  3F0C A;  4P96 A;  1TNT A;  3BR3 A;  2WAE A;  2HQ5 A;  2MFZ A;  1TWH J;  1XMX A;  2P8T A;  2R5Y A;  2ISZ A;  4IHT A;  5K5Q A;  3FM3 A;  1TC3 C;  5F64 A;  4BHC A;  5CKT A;  1YJN I;  3NAU A;  2EZK A;  2ZFU A;  3DQV C;  4LD5 A;  4QPO A;  4XRS A;  3BZK A;  1WJE A;  1DPR A;  2CW8 A;  4B3X A;  2XC7 A;  2YX4 A;  2FOW A;  3GW2 A;  5HOD A;  4LLL A;  2CQ7 A;  1ODD A;  3NEU A;  5JVG F;  4YIF A;  1IO2 A;  1PYV A;  2EB7 A;  2XGD A;  4HSR A;  2MW8 A;  1OCZ H;  3LSM A;  2FBI A;  4HNU A;  3GYH X;  4EJO A;  3GTJ J;  3HKZ N;  4LLN A;  4BHP A;  5IT9 K;  1T95 A;  2HR3 A;  2RAE A;  5TIS C;  4MEX F;  1P4X A;  2QBY A;  1BR4 A;  5DYM A;  2IP2 A;  2ELH A;  1FBU A;  1N78 A;  1YW8 A;  1GLN A;  2VJJ A;  1FSH A;  3V7R A;  3RQ4 A;  4OIO F;  5EYR A;  3OL3 A;  2XRL A;  3QOP A;  2R5Y B;  1FMW A;  2LRD A;  3ELK A;  3M8E A;  1IN5 A;  3FXL A;  4GYI A;  3KP2 A;  4G6Q A;  1TW3 A;  2KRH A;  2P5L C;  3PO2 J;  4MEY F;  3Q3S A;  4DGW B;  2N8G A;  4ZYD A;  2RV8 A;  3C2G A;  4U0Y A;  4N0B A;  2QSH X;  2DTR A;  4ZZL A;  4LB6 B;  1O3R A;  3OIQ A;  4UNO A;  2B63 J;  3OYK A;  5EGO A;  3F8N A;  2OD5 A;  2XVC A;  4IEJ A;  1D0Z A;  1R9T J;  2BW3 A;  2LKX A;  2W85 A;  2XAF A;  1P4A A;  4PGH A;  3JRD A;  4I0B A;  5FRN A;  2E36 A;  1VQP I;  4RGU A;  4U0V A;  1QZZ A;  2JN6 A;  5B66 C;  3CMM A;  4HST A;  3FDY A;  2M45 A;  1QRY A;  3DP7 A;  1X2M A;  3ULQ B;  1AOY A;  2RC4 A;  2EIL H;  1XC5 A;  2IA0 A;  2NS7 A;  3E97 A;  1T8I A;  3CO6 C;  1FSE A;  4OOI A;  1K61 A;  3Q0U A;  3EUH C;  1QZE A;  1UHW A;  3OR1 C;  3I4P A;  4A3I J;  4DQ2 A;  4B1R A;  1T98 A;  2FEZ A;  3FM5 A;  2FQ4 A;  3RQI A;  4EAT A;  1Z9C A;  3K4M A;  1MMG A;  2QLZ A;  5CQE A;  4IVN A;  1G3T A;  1R1V A;  2AXL A;  3FX3 A;  2G0E A;  2H8R A;  3T5X A;  2DU9 A;  1GHC A;  2BW3 B;  1QO0 D;  3BPV A;  3GFM A;  4JX5 A;  5HNH A;  2DFE A;  2M4K A;  4U7D A;  4M71 A;  3L2W A;  1R71 A;  1Z67 A;  1LKX A;  1H9T A;  2PMH A;  3GTL J;  4HW0 A;  1ZG5 A;  2NOG A;  1I1S A;  5H6Q A;  3OIP A;  5BMZ A;  2DMT A;  3CLO A;  4DYC A;  2BY3 A;  3JR9 A;  3VYS B;  1GT0 C;  4XLP F;  3KEY A;  4I02 A;  1YRN A;  2ESH A;  4ENJ A;  5IYD J;  1IRF A;  2PEX A;  3LSI A;  3M3Y J;  1S9H A;  3MKL A;  3ZQC A;  2YUS A;  2L54 A;  2Z99 A;  4D1Q A;  5L3C A;  3B6C A;  1FOY A;  3JTH A;  2K9S A;  2FUG 2;  3NWS A;  3QAH A;  3ZMD A;  1UG0 A;  2PLY A;  2K9L A;  5B5E C;  3GLX A;  4YFX F;  1FTT A;  3KP3 A;  3P7N A;  3KET A;  1GVJ A;  1UAA A;  1VQ9 I;  4BQO A;  1JTY A;  4JX6 A;  5KAI C;  3HOS A;  1IZ1 A;  2DA7 A;  1ZGW A;  4UUV A;  5C4X J;  1JKQ C;  2ZJR F;  4ZDL A;  3GME A;  2CUE A;  5D8K B;  2QWW A;  3EUH A;  3HSR A;  1XSD A;  2HZT A;  2R7U A;  1FLI A;  1I1G A;  2W24 A;  2PQ8 A;  3KEQ A;  1Z05 A;  2IGO A;  1YRN B;  1WFX A;  3RI4 A;  3EQL F;  1WWX A;  2DMN A;  3ERM A;  2PMZ A;  1W7P D;  2L3D A;  3H1C A;  4U88 A;  1G59 A;  3BR2 A;  3V42 A;  4B44 A;  3ZR8 X;  1NK2 P;  4PK4 A;  2JJ7 A;  4RMN A;  5EDN A;  2Z16 A;  5CVJ A;  3HEF A;  4UB8 C;  4ZYA A;  3ZMV A;  3EYI A;  5IOY A;  1YIJ I;  1ZYR F;  5LGT A;  1OJL A;  3RDI A;  1IN6 A;  1FC3 A;  3AKZ A;  1R4N B;  3I59 A;  4U0W A;  2L2O A;  2R7X A;  5L3E A;  1IAW A;  1BIB A;  2COM A;  1CQT A;  1JGS A;  1WH7 A;  4I2O A;  2Y75 A;  4HNV A;  3OWT A;  5KCM A;  2LRE A;  4L9T A;  2GZW A;  2GWR A;  3NAR A;  5IP9 J;  2KMU A;  5KNL A;  2CMP A;  1IN7 A;  2ICW G;  4RAG A;  1Q1H A;  3G73 A;  3ERE D;  2WV0 A;  4BEH A;  2VXD A;  1GXQ A;  4BJ6 C;  3OY9 A;  4UHT A;  3LWF A;  3Q9V A;  1SFK A;  4EJU A;  1KU3 A;  1D3Y A;  2QGU A;  1MNM C;  2P6T A;  1LDD A;  4UUS A;  3BTJ A;  4UY8 I;  2HKO A;  3GTQ J;  1J5Y A;  4Y13 A;  3O6B B;  1FT9 A;  5FGM A;  2IJL A;  1U9O A;  1LFB A;  1MNE A;  2BXZ A;  1MMN A;  1MBF A;  4D5F A;  1H8A C;  4QTR A;  1GV2 A;  2FA5 A;  1OMI A;  2LG4 A;  4HDU A;  1NG7 A;  2GIZ A;  3OYD A;  4EM2 A;  1F43 A;  2IBD A;  3B6A A;  3C3W A;  3F22 A;  2WBM A;  4YRV A;  3UKG A;  1TW2 A;  1BI1 A;  2VT2 A;  1ZG3 A;  3QU6 A;  3HRU A;  2DMU A;  3LL7 A;  2XHK A;  1SMT A;  1H9G A;  1IDZ A;  4MLO A;  3CD6 I;  4BEH B;  4N4O B;  4E70 A;  3P9C A;  1JHF A;  2GOX B;  4BL0 B;  3WG7 H;  3SZG A;  4D7M A;  4S05 A;  1MD0 A;  3HOT A;  3IH3 A;  3VYR B;  2YU3 A;  3RZO J;  2E5Z A;  3HRM A;  4UUS B;  3BTI A;  3A0H C;  2V7F A;  1R5G A;  1WHU A;  2K3P A;  2JA6 J;  3LOC A;  2P81 A;  1O3Q A;  4QSH A;  4EM1 A;  3TW7 A;  4XKW A;  2RQP A;  2F5D A;  3DKX A;  2VC0 A;  1MZB A;  1WH5 A;  3T8T A;  2K9Q A;  2PJR A;  2MBF A;  3GBG A;  3JRC A;  3QYB A;  4L9N A;  1EH7 A;  3PNY A;  1ZH5 A;  2CV2 A;  4IQ4 A;  1HXD A;  3ABU A;  1SFX A;  2WWY A;  3GTO J;  1DGW Y;  1UB9 A;  2KQR A;  1PP7 U;  4NHJ A;  1OR7 C;  1I6X A;  5LFA A;  3E5X A;  4IO9 F;  1G4D A;  1REP C;  3M9A A;  3K1M A;  3ZPL A;  3QP6 A;  5TGT A;  4AVP A;  3CJR B;  1LVA A;  3BR6 A;  4RM2 A;  4FT8 A;  1ERD A;  4XRM A;  1OQY A;  2H6C A;  1BJA A;  4B4C A;  5ICE A;  2D45 A;  4Z6Y A;  5FB2 A;  3SZT A;  1ZEL A;  5FKN A;  3W6J B;  2E2J J;  1J7K A;  2E1O A;  4BNC A;  5AON A;  2LF7 A;  3R4K A;  3C7J A;  1OCT C;  2CQQ A;  5E1Z B;  4HQM A;  3MMY B;  2W1O A;  1FZP B;  4LG3 A;  2FQ3 A;  4Y17 A;  5JHU A;  4A6D A;  2BYV E;  1HKQ A;  2L4M A;  2M7B A;  1N77 A;  2PJR B;  2B9S A;  4KFC A;  1AA7 A;  2DDA A;  4A2U A;  3CJT B;  3KLO A;  4M73 A;  5HS9 A;  5FFZ A;  2QSF X;  3BDD A;  4I01 A;  2Y0M A;  1TQI A;  4L0Y B;  1IRG A;  1DU6 A;  1OCR H;  3OIO A;  1E2X A;  2CW0 F;  4H0E A;  2QVO A;  1FWZ A;  3JAM K;  5DUK A;  2A6H F;  2R7F A;  4HX7 A;  3OYB A;  1G6N A;  3ZMS A;  2XUB A;  2R7W A;  1Q1V A;  3ZXS A;  4HG2 A;  2A68 F;  3LFK A;  5FRM A;  1XGN A;  1FBS A;  1XX5 A;  4G94 A;  1R58 A;  5IT9 Z;  5J6X A;  2X6W A;  2KKO A;  4FX0 A;  3HJE A;  5FJ8 J;  2LBF A;  4CCJ A;  1D5Y A;  3S1M J;  1O7F A;  2FX0 A;  2BY0 A;  1S7A A;  3WHC A;  4HLX A;  3N4M A;  1DU0 A;  3M07 A;  3GEZ A;  3R60 A;  4L5E A;  1U0J A;  2XKP A;  3HYI A;  4Y3O A;  2JA5 J;  2ZO4 A;  4B3A A;  2AO9 A;  2QKM B;  4Q4Z F;  4BE2 A;  1B9N A;  2X4H A;  4YEL A;  2LDU A;  1K7A A;  1KYZ A;  5DD4 A;  4HX4 A;  2ECB A;  4RDU A;  2K9N A;  1N25 A;  4IF4 A;  4M6V A;  1F5T A;  3HDD A;  3K4C A;  1JKR C;  1U5T A;  3KP5 A;  3GO5 A;  4L9J A;  4NC7 A;  4WXC A;  3ESW B;  4YFK F;  1WJA A;  4FE4 A;  4XLA A;  2ZCW A;  3ONQ A;  2ZJQ F;  5GP9 A;  2D2W A;  1K6Y A;  2BGC A;  2EFO A;  4XKC A;  4BJT A;  2BVL A;  1JKP C;  1X3W B;  3E6D A;  5F1J A;  2E7X A;  4WWC A;  5CVU A;  4QPQ A;  3K0L A;  3FK6 A;  1YJ9 I;  4PJL A;  1XMA A;  2CUF A;  2LBF B;  2H6B A;  1Z21 A;  5IY5 H;  3SEQ A; 
#chains in the Genus database with same CATH homology
 1YW7 A;  1STZ A;  5ERI A;  3GWZ A;  1F9N A;  4CGZ A;  4OMZ A;  3ML6 A;  2M30 A;  2W84 A;  5FLX Z;  3FXR A;  4BXU A;  4WXD A;  2CSO A;  3TDZ C;  4P9F A;  1PP8 F;  4EGZ A;  5AIP A;  5CVR A;  3MFK A;  1UHM A;  1MJB A;  2ZNY A;  4YII A;  4KIF A;  3FHZ A;  1HW1 A;  5A2Q K;  3DKW A;  2CQK A;  4O5V A;  4EV0 A;  2Z33 A;  2Q0O A;  4OU0 A;  1DP7 P;  5DD8 A;  1LQ1 A;  1TBX A;  2OU2 A;  2ZNZ A;  3WTV C;  2STW A;  2FBH A;  4RB2 C;  3MZH A;  1ZGJ A;  2FML A;  3GFI A;  6PAX A;  5E20 A;  3E5U A;  4WF2 A;  4UV8 A;  3WTW C;  5KK1 A;  1Z7U A;  1ZHF A;  4L5I A;  1MKM A;  2HS5 A;  2YSR A;  2GXG A;  1I5Z A;  1R1U A;  2J5O A;  2ZBK A;  2BE5 F;  3L2C A;  4RB3 C;  1U3E M;  1KYW A;  4LGW A;  5HOO A;  1MGT A;  3M1E A;  2HTJ A;  1CGP A;  1P6R A;  1O3T A;  2OA4 A;  1J9I A;  1OYW A;  2PN6 A;  1YIO A;  2EJR A;  1G3S A;  2EV0 A;  3RYR A;  4UVA A;  5LLQ A;  1RNL A;  5EEG A;  4LK1 F;  2ZXJ A;  4LJZ F;  2EA4 A;  4GO1 A;  4WK8 F;  3BOQ A;  1FOK A;  5D5U B;  2BV6 A;  5IT3 A;  5D5W B;  4K2E A;  1T39 A;  1BBY A;  4OIP F;  3L9F A;  2GXB A;  4IPA A;  5E17 F;  2B0L A;  3MEX A;  3HSF A;  5ILU A;  1YG2 A;  5LHG A;  1S3J A;  2XAG A;  1TLH B;  1ZRD A;  5E8I A;  5JFR A;  2HWV A;  2QQA A;  1J75 A;  5BS6 A;  1KA8 A;  3EET A;  4A5M A;  3FF5 A;  3E6M A;  5D6F A;  3I58 A;  1R5H A;  2HTS A;  4HBL A;  1ZRF A;  1WRJ A;  3GZ5 A;  1Z6T A;  4HOB A;  2VBW A;  4L0Z B;  2O6G E;  2ADU A;  4UVB A;  1AWC A;  2XAS A;  4L18 B;  4ZYG A;  2FE3 A;  1FY7 A;  3CJN A;  1UST A;  1SD6 A;  1RIO H;  1U6G A;  2K02 A;  5HLI A;  3EYY A;  1IN4 A;  2HKX A;  5JVT A;  3IKV A;  2PBI A;  1D5V A;  3WTY C;  4G7Z F;  1BI2 A;  2GAU A;  2EFQ A;  4UVC A;  2JSC A;  2QZ8 A;  3MAJ A;  2PJP A;  1YW9 A;  5HVQ C;  3KP6 A;  2RGV A;  2XKO A;  4M6X A;  1IUY A;  5FD6 A;  2A6E F;  3D5L A;  3OOP A;  3JAM Z;  1IXS B;  2RNJ A;  3KFW X;  4G7O F;  2WC2 A;  2M8E A;  4OIQ F;  2F5F A;  2JRT A;  2V1D A;  2MA3 A;  2GQQ A;  4F7Z A;  3SXY A;  1BM9 A;  4MGR A;  3FMS A;  2HYF A;  3E6B A;  3ECH A;  1O7L A;  2IW5 A;  3U1D A;  5HDN A;  1W5T A;  2VON A;  4KN4 X;  2VBZ A;  3RKW A;  1EH8 A;  3CO7 C;  3F8C A;  2OQG A;  1XGO A;  2PFB A;  3WU0 A;  1K78 A;  4P55 A;  3F8B A;  5D5X B;  1BN5 A;  1BC8 C;  2DT5 A;  1XSX A;  1FYK A;  2XAH A;  3HHH A;  1LNW A;  5BPI A;  3MQ0 A;  4LG0 A;  3IC7 A;  2O8X A;  4RB0 A;  4WXH A;  1ZN2 A;  5HDK A;  1IW7 F;  2O61 A;  4LK0 F;  1RI7 A;  2GIV A;  3WU1 B;  1P2F A;  3RJP A;  5BPD A;  4ZH4 F;  3WOD F;  1K78 B;  4RAZ A;  2XIG A;  2HGC A;  3TOB A;  2NNY A;  4B09 A;  1ON1 A;  4ESB A;  5L3B A;  1IN8 A;  2K7L A;  3VOD A;  2EK5 A;  4A12 A;  3HRT A;  5DDG A;  1ZGA A;  3TQN A;  4LG0 B;  1FP2 A;  1HQC A;  3F23 A;  3T0Y A;  1RUN A;  2V79 A;  3SHF A;  5K5R A;  5AIQ A;  1DUX C;  4ESJ A;  5ICF A;  3J81 K;  1S7O A;  1V3F A;  2G7U A;  1IXC A;  2O0Y A;  4I09 A;  2DLL A;  5CVI A;  3RTR A;  2HYG D;  1HW5 A;  3GF2 A;  3VOE A;  2NYX A;  5CVV A;  1ONV A;  1Y0U A;  2R7D A;  4NQW A;  2VE8 A;  2WTE A;  2ZKZ A;  2K27 A;  5DEQ A;  4AD9 A;  4AIJ A;  5D6E A;  3MWM A;  5TJJ A;  3E3V A;  5CYV A;  1XGM A;  1HW2 A;  2M1B A;  2CWE A;  2VXZ A;  4IRI A;  2V1X A;  4IXA A;  4BHB A;  3KZZ A;  1BC7 C;  2H94 A;  2A61 A;  3ROU A;  5J8F A;  2R3S A;  1XB4 A;  3RPU A;  1T0F A;  4HA8 A;  3JTG A;  3J80 K;  1U2W A;  3IRR A;  4OIR F;  3WTZ A;  4KIB A;  2A07 F;  3KP4 A;  5KVR A;  3LQQ A;  2DAO A;  2GA2 A;  3GFL A;  3LA7 A;  1TNS A;  1RZ4 A;  2K86 A;  2VC1 A;  4HX8 A;  4A6E A;  4OMY A;  2IPQ X;  2OQR A;  4IJA A;  2DBB A;  3DPL C;  2KRF A;  1XDU A;  1WQ2 A;  2FNP A;  1Z91 A;  5HLH A;  4PCQ A;  2TDX A;  3Q5F A;  1PDN C;  3PFI A;  1F4K A;  4FX4 A;  4A5N A;  1UFM A;  1A04 A;  4XRF A;  2MLG A;  2A3S A;  3F6O A;  1W5S A;  1WI9 A;  4GGG A;  5FD5 A;  2XRO A;  2FRH A;  3BRO A;  3F72 A;  3ZN1 A;  3HTU A;  5TRD A;  4MTD A;  5LGN A;  2RDP A;  4EGY A;  5CLS A;  2MLK A;  3WGI A;  4G6D A;  4KT5 C;  3BJA A;  1S6L A;  3HSE A;  1T6S A;  3VFZ A;  1R00 A;  2KJC A;  5LRS A;  4G7H F;  1OR7 A;  4ZYE A;  1R36 A;  4AIH A;  2PMU A;  1SD4 A;  1L0O C;  4S04 A;  5FFX A;  1I27 A;  4EJT A;  1OPC A;  2J5P A;  2KJB A;  5E8G A;  4ETS A;  2XV4 S;  4GCV A;  1L3L A;  4ESF A;  2UXN A;  1U8R A;  2VN2 A;  1C0W A;  2AS5 F;  1UCR A;  1DDN A;  3MZY A;  1OYY A;  3BZ6 A;  5DUI A;  4QLC U;  2JZY A;  1HKT A;  3I64 A;  5FO5 A;  2O03 A;  2Z3Y A;  3K2Z A;  1T38 A;  4RGX A;  3WTS C;  4EQQ A;  3KP7 A;  3LA3 A;  1XMK A;  2KIF A;  3H3Z A;  4O6J A;  2DPU A;  2A5Y B;  3S2W A;  3IHU A;  3K69 A;  4ASN A;  3BWG A;  2NAZ A;  4Z2Y A;  3ZQ7 A;  5ICC A;  1MJ9 A;  5LBQ A;  3V7C A;  3NQO A;  1FPQ A;  5K5O A;  1E17 A;  2EWN A;  4MQV A;  4Y15 A;  3ZMT A;  4ENM A;  4IHS A;  3JSP A;  4B8X A;  1XD7 A;  1X3U A;  3DF8 A;  5JR3 A;  5BQT A;  3IWF A;  1BI3 A;  4EJW A;  5ILV A;  1LEB A;  1ULY A;  3K1N A;  1B59 A;  1MDM A;  3SZP A;  4HF0 A;  4PDK A;  4M72 A;  4R79 A;  1HKS A;  4XBF A;  1TQM A;  3M8F A;  4L9V A;  5LEK A;  3LA2 A;  2MH2 A;  1QPM A;  5D4R A;  2A69 F;  1D8K A;  3BY6 A;  2XGX A;  3BPX A;  1KQ8 A;  1LEA A;  1YLF A;  2FF4 A;  3J81 Z;  1HSJ A;  2ZJ2 A;  3ECO A;  2W57 A;  2VOO A;  1YFH A;  5LRR A;  1MDM B;  3GVA A;  2VBX A;  4KIC A;  1SAX A;  5LHI A;  4M9Z A;  4U7B A;  3PQJ A;  4M9S A;  1G3Y A;  3ZN0 A;  3GZ6 A;  4Q5S F;  3KE2 A;  1K79 A;  4CZZ A;  4Q47 A;  1LB2 A;  4EVI A;  1OYI A;  2STT A;  3GFJ A;  2UXX A;  3E6C C;  1QNT A;  1F1Z A;  4WCG A;  1XDS A;  1XCV A;  4M9X A;  4R8H A;  3AAF A;  4AWX B;  1ZG1 A;  5K1Y A;  3K1P A;  5DCM A;  1B6A A;  4NB5 A;  3BP8 A;  1PUE E;  3I53 A;  1QBJ A;  3J80 Z;  1YS7 A;  2FNA A;  3L7W A;  5BOX A;  1O3S A;  3P9I A;  3QU3 A;  1Z6R A;  4YFN F;  3RPQ A;  3R0J A;  4HYE A;  2KIU A;  2EA2 A;  4ZYH A;  4KA4 A;  4EM0 B;  2QUF A;  1YQA A;  4KUM A;  1QQI A;  3F8F A;  5DCM B;  2MH9 A;  3VEP A;  3DEU A;  2L01 A;  3FZV A;  3TO7 A;  3B02 A;  3OV8 A;  4HF2 A;  2JT1 A;  1Z1D A;  1YTY A;  2FXA A;  4R1H A;  3V8L A;  2CYY A;  2XAJ A;  3QPH A;  4JBA A;  3SQN A;  1R22 A;  1ZAR A;  2ZME A;  1T2K A;  1EH6 A;  1WKM A;  3HHG A;  2L02 A;  4BQA A;  1FYL A;  5E18 F;  2IVM A;  3J7A O;  1O57 A;  3E5Q A;  3COA C;  5HS8 A;  1LDJ A;  3HIF A;  3GUD A;  1B4A A;  4A0Y A;  2P5V A;  5J8C A;  3H3U A;  2QBY B;  4UXN A;  1KU7 A;  1KU2 A;  2H27 A;  4PGG A;  3GXO A;  4PZJ A;  4ENK A;  2V9V A;  2ZME B;  2D1V A;  2L4A A;  4HZF A;  3ZP5 A;  2RN7 A;  3KLN A;  3FMQ A;  4CXF A;  3QPT A;  2LKP A;  4CO8 A;  2YX7 A;  1QGP A;  4FHT A;  2ZFW A;  2P4W A;  1ZRE A;  3LQR A;  3N97 A;  2OBP A;  5FLX K;  3TO6 A;  1HST A;  2KIM A;  1WSU A;  1HBX G;  1CF7 A;  3IL2 A;  3WGH A;  2PG4 A;  3IWZ A;  1XGS A;  2EFP A;  4HV6 A;  4G9Y A;  1QZY A;  3BJO A;  4XLN F;  1D8J A;  3JW4 A;  4AIK A;  1NHA A;  2QQB A;  4Q48 A;  5F6F A;  3F6V A;  3WE3 A;  3F3X A;  4CHU A;  2QM3 A;  2XRN A;  4TV7 A;  3V8K A;  4XSX F;  3WE2 A;  4A0Z A;  5ED4 A;  1CF7 B;  4KN7 X;  5E1X A;  3D0S A;  3CUO A;  5A2Q Z;  3FMR A;  1SD7 A;  4P5O A;  1S8N A;  1H0M A;  2CO5 A;  3FXQ A;  3ISP A;  4RGS A;  2X0L A;  2F5C A;  1J2X A;  2LSO A;  3KCC A;  3HRS A;  4ON0 A;  3U9G A;  2O3F A;  3M7G A;  2VOD A;  2NS0 A;  2OZU A;  4BH9 A;  3WTX C;  2RVC A;  4LLG F;  2C6Y A;  2IRF G;  4RS8 A;  2VOP A;  3VB2 A;  4KIG A;  2CG4 A;  1BI0 A;  2OAZ A;  4RGR A;  5DCF A;  1BIA A;  2HDC A;  3CDH A;  4EJV A;  5H20 A;  1JXS A;  4RAY A;  2QQ9 A;  2DFI A;  3L00 A;  2G9W A;  1ON2 A;  2EFN A;  3QRF F;  4ENN A;  1JHH A;  3CTA A;  4ZZD A;  3HUG A;  2EV6 A;  2JPB A;  4LB5 A;  2CGP A;  1R1T A;  3HTS B;  4IRH A;  5L3D A;  4HV5 A;  3I59 B;  1K6O A;  2IA1 A;  5H6R A;  3LAJ A;  4HQE A;  3I71 A;  3R6S A;  2HQR A;  3KEO A;  2PI0 A;  3TKY A;  3WTU C;  1EV7 A;  2IA2 A;  2DO7 A;  3B73 A;  2Z9O A;  3QP5 A;  2YR2 A;  4GXO A;  1P92 A;  3RKX A;  2Y48 A;  1LJ9 A;  4MNU A;  2NNN A;  1TQP A;  1FNN A;  4DNC A;  4O3M A;  1SD5 A;  1IXR C;  1IF1 A;  2Q2E A;  2F2E A;  3RKY A;  4KMU X;  4KMF A;  2K4J A;  2VE9 A;  3V8J A;  4IRG A;  1U5T C;  3ZMZ A;  4RB1 A;  1BOA A;  3TOA A;  3L09 A;  3RYP A;  4HLY A;  4BYY A;  3I5U A;  3CUQ C;  4OIN F;  2VT3 A;  2ACJ A;  1JE8 A;  1FX7 A;  1YS6 A;  3F8M A;  2P6S A;  3P9K A;  3IKT A;  3WTT C;  1ZLJ A;  1W4M A;  1DPU A;  2P7C B;  4L5J A;  4D0P A;  1V4R A;  4KDP A;  5LEJ A;  1J59 A;  1G3W A;  2MC3 A;  2E7W A;  1FP1 D;  4CYD A;  1XCB A;  4WX9 A;  1B1B A;  2JPC A;  1ZLK A;  2LNB A;  5ICG A;  2BBY A;  3ABT A;  4G8X A;  2FBK A;  4LMY A;  3WGG A;  4GYG A;  4I7H A;  3TO9 A;  2V6C A;  2FMY A;  4MTE A;  4HDV A;  2P5K A;  4XSZ F;  2Z5U A;  1SFE A;  1USS A;  1KQ9 A;  4M74 A;  2BEO A;  2M5W A;  3G3Z A;  4BAY A;  2E1C A;  1J0R A;  1KGS A;  3IRQ A;  2FOK A;  2HOE A;  1R23 A;  2DQR A;  5EEH A;  5L3G A;  3REO A;  1SFU A;  2YPR A;  1ZAO A;  3W6K B;  2DPD A;  2CFX A;  3WG9 A;  3V7S A;  1S29 A;  3CUQ A;  3U2R A;  3C18 A;  4I98 B;  5ILS A;  5L3F A;  4LFU A;  3V4G A;  2HQN A;  3C1D A;  1YO5 C;  4EMS A;  3PQK A;  1XN7 A;  2M87 A;  2D1H A;  4N9H A;  2UZK A;  3O2P E;  3RIR A;  2FSW A;  2RKH A;  3DV8 A;  2MD5 A;  4UV9 A;  2HFH A;  2Q8K A;  1U5T B;  1KU9 A;  2ETH A;  2HEO A;  4QWQ A;  3CUQ B;  3FWE A;  5HS7 A;  3EDP A;  1MJA A;  2ISY A;  3T1B A;  5D4S A;  4HF1 A;  3R0A A;  4JQF A;  1FYM A;  2JTV A;  2QYO A;  4HAM A;  2ESN A;  2VBY A;  2QEN A;  3T8R A;  4P9U A;  2DQL A;  3H92 A;  3K9T A;  3MCZ A;  2V1U A;  5LHH A;  3GX4 X;  4JK1 X;  1KQ0 A;  3F21 A;  2IT0 A;  3Q9S A;  2EFW A;  1P4W A;  4YG2 F;  3ZMU A;  4MQ9 F;  5CJ9 A;  2W25 A;  2DI3 A;  2XAQ A;  1RUO A;  2E1N A;  3JSO A;  2K4B A;  1W7P A;  3I54 A;  4CIC A;  1B9M A;  2EV5 A;  2H09 A;  5D8L B;  4M6Y A;  5HDG A;  3I0T A;  1LDK B;  3NRV A;  4KNY A;  2DW4 A;  3R61 A;  2GA1 A;  1R7J A;  5F1R A;  2UWM A;  1GXP A;  2F5E A;  3LST A;  3KZY A;  4MHG A;  4I0A A;  5D5V B;  1YYV A;  5E1W A;  5DV5 A;  5LGU A;  3DFG A;  2DK8 A;  1W7P B;  3DPT A;  4CDG A;  3DXJ F;  3FXU A;  3TGN A;  3O3K A;  2P7V B;  2OZ6 A;  4A0X A;  5JI6 A;  1VTN C;  3SFZ A;  1FBQ A;  4N9I A;  1ZRC A;  3LAP A;  1XSV A;  1SMY F;  5HLG A;  2FU4 A;  1TTY A;  2NRA C;  2LF8 A;  2DK5 A;  4KYW A;  1U78 A;  3BJ6 A;  3TDU C;  2G7H A;  1OKR A;  4P96 A;  1TNT A;  2P8T A;  2ISZ A;  4IHT A;  5K5Q A;  3FM3 A;  5F64 A;  4BHC A;  3DQV C;  4LD5 A;  1DPR A;  2YX4 A;  3GW2 A;  4LLL A;  1ODD A;  3NEU A;  4YIF A;  2EB7 A;  2FBI A;  3GYH X;  4EJO A;  4LLN A;  4BHP A;  5IT9 K;  2HR3 A;  4MEX F;  1P4X A;  2QBY A;  5DYM A;  2IP2 A;  2ELH A;  1FBU A;  1YW8 A;  1FSH A;  3V7R A;  4OIO F;  3QOP A;  3ELK A;  3M8E A;  1IN5 A;  4GYI A;  3KP2 A;  4G6Q A;  1TW3 A;  2P5L C;  4MEY F;  4ZYD A;  2RV8 A;  4U0Y A;  4N0B A;  2DTR A;  4ZZL A;  4LB6 B;  1O3R A;  4UNO A;  3F8N A;  2OD5 A;  2XVC A;  2W85 A;  2XAF A;  1P4A A;  4PGH A;  4I0B A;  4RGU A;  4U0V A;  1QZZ A;  2M45 A;  3DP7 A;  3ULQ B;  1AOY A;  2RC4 A;  2IA0 A;  3E97 A;  3CO6 C;  1FSE A;  4OOI A;  1UHW A;  3I4P A;  4DQ2 A;  1T98 A;  2FEZ A;  3FM5 A;  1Z9C A;  2QLZ A;  4IVN A;  1G3T A;  1R1V A;  2AXL A;  3FX3 A;  3T5X A;  2DU9 A;  1GHC A;  1QO0 D;  3BPV A;  3GFM A;  4U7D A;  4M71 A;  1H9T A;  2PMH A;  4HW0 A;  1ZG5 A;  1I1S A;  5H6Q A;  5BMZ A;  3CLO A;  4XLP F;  4I02 A;  2ESH A;  4ENJ A;  1IRF A;  2PEX A;  2L54 A;  2Z99 A;  5L3C A;  3JTH A;  3QAH A;  3ZMD A;  2PLY A;  3GLX A;  4YFX F;  3KP3 A;  3P7N A;  3KET A;  1GVJ A;  3HOS A;  1IZ1 A;  4UUV A;  5D8K B;  2QWW A;  3EUH A;  3HSR A;  1XSD A;  2HZT A;  1FLI A;  1I1G A;  2W24 A;  2PQ8 A;  3KEQ A;  1Z05 A;  3RI4 A;  3EQL F;  1WWX A;  1W7P D;  2L3D A;  4U88 A;  5CVJ A;  3ZMV A;  3EYI A;  1ZYR F;  5LGT A;  3RDI A;  1IN6 A;  1FC3 A;  3I59 A;  4U0W A;  5L3E A;  1IAW A;  1BIB A;  2COM A;  1JGS A;  4I2O A;  2Y75 A;  4L9T A;  2GZW A;  2GWR A;  1IN7 A;  1Q1H A;  3G73 A;  3ERE D;  2WV0 A;  1GXQ A;  4UHT A;  3LWF A;  3Q9V A;  4EJU A;  1KU3 A;  1D3Y A;  2P6T A;  1LDD A;  2HKO A;  1J5Y A;  4Y13 A;  3O6B B;  1FT9 A;  5FGM A;  2IJL A;  2FA5 A;  1OMI A;  4HDU A;  4EM2 A;  3C3W A;  3F22 A;  1TW2 A;  1BI1 A;  2VT2 A;  1ZG3 A;  3QU6 A;  3HRU A;  2XHK A;  1SMT A;  1H9G A;  4E70 A;  3P9C A;  1JHF A;  4S05 A;  1MD0 A;  3HOT A;  2YU3 A;  3HRM A;  1R5G A;  1O3Q A;  4EM1 A;  2RQP A;  2F5D A;  2VC0 A;  1MZB A;  3T8T A;  2MBF A;  4L9N A;  1EH7 A;  1ZH5 A;  1HXD A;  3ABU A;  1SFX A;  2WWY A;  1UB9 A;  1PP7 U;  4NHJ A;  1I6X A;  3E5X A;  1G4D A;  1REP C;  3M9A A;  3K1M A;  3ZPL A;  3QP6 A;  4AVP A;  1LVA A;  4FT8 A;  2H6C A;  1BJA A;  5ICE A;  2D45 A;  5FB2 A;  3SZT A;  3W6J B;  1J7K A;  4BNC A;  5AON A;  2LF7 A;  3R4K A;  3C7J A;  5E1Z B;  4HQM A;  1FZP B;  2FQ3 A;  4Y17 A;  5JHU A;  4A6D A;  2BYV E;  1HKQ A;  2L4M A;  4KFC A;  4A2U A;  3KLO A;  5HS9 A;  4M73 A;  5FFZ A;  3BDD A;  4I01 A;  2Y0M A;  1TQI A;  4L0Y B;  1IRG A;  1E2X A;  4H0E A;  2CW0 F;  2QVO A;  1FWZ A;  3JAM K;  5DUK A;  2A6H F;  2R7F A;  4HX7 A;  1G6N A;  3ZMS A;  2XUB A;  2A68 F;  3LFK A;  1XGN A;  1FBS A;  4G94 A;  1R58 A;  5IT9 Z;  5J6X A;  2KKO A;  4FX0 A;  1O7F A;  1S7A A;  4HLX A;  3N4M A;  3GEZ A;  3R60 A;  2XKP A;  3HYI A;  2ZO4 A;  4Q4Z F;  1B9N A;  2X4H A;  2LDU A;  1K7A A;  1KYZ A;  5DD4 A;  4HX4 A;  1F5T A;  4IF4 A;  1U5T A;  3KP5 A;  3GO5 A;  4L9J A;  4YFK F;  4WXC A;  2ZCW A;  2D2W A;  2BGC A;  2EFO A;  3E6D A;  2E7X A;  4WWC A;  5CVU A;  3K0L A;  1XMA A;  2H6B A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...