1PP8F

Crystal structure of the t. vaginalis ibp39 initiator binding domain (ibd) bound to the alpha-scs inr element
Total Genus 33
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
33
sequence length
113
structure length
113
Chain Sequence
DSNDLEASFTSRLPPEIVAALKRKSSRDPNSRFPRKLHMLLTYLASNPQLEEEIGLSWISDTEFKMKKKNVALVMGIKLNTLNVNLRDLAFEQLQHDKGGWTQWKRSGFTRNS
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ALPHA-SCS INR
publication title Structural Basis of Core Promoter Recognition in a Primitive Eukaryote
pubmed doi rcsb
source organism Trichomonas vaginalis
molecule tags Transcription/dna
total genus 33
structure length 113
sequence length 113
chains with identical sequence M, O, P, U, V
ec nomenclature
pdb deposition date 2003-06-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
F PF10416 IBD Transcription-initiator DNA-binding domain IBD
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1pp8F00
1SD7A 1TLHB 1BOAA 1XSDA 4IJAA 2F5EA 1IXRC 4MTDA 2STWA 1I1GA 4H0EA 3RPQA 4LMYA 5HS7A 2FE3A 3WE2A 4G94A 3ZN1A 2V79A 5DD8A 1R36A 2QLZA 3HOSA 2ZMEB 3OOPA 3VOEA 4P9FA 1J75A 4FX4A 2C6YA 4KYWA 2MH2A 1KYWA 3F22A 5IT3A 3ZPLA 4RAZA 4IF4A 3GZ6A 2MD5A 4LG0B 1B6AA 3SFZA 2DT5A 4BHCA 2P6TA 2UWMA 4OU0A 1SAXA 3HOTA 2OA4A 1A04A 1XB4A 4B8XA 4G6QA 4AIJA 1WQ2A 3OV8A 4EMSA 2HS5A 2KJBA 3FWEA 2FU4A 4OIQF 2L02A 4P9UA 2EB7A 1Z9CA 1MGTA 4U7DA 4JQFA 2V1XA 2OU2A 3CUQA 4N9IA 1S29A 3TO9A 1R5GA 4JBAA 1G3SA 5DCFA 4HDUA 3E3VA 1H0MA 1KU2A 2L01A 3IWZA 1BI1A 1FOKA 4XLNF 1MKMA 3C18A 3K1PA 1JHHA 2K86A 1ZRDA 3R6SA 4Q5SF 1ZARA 4I7HA 3SQNA 2NS0A 5FO5A 3QU3A 4FT8A 1OYYA 2RQPA 2GQQA 1S6LA 4LLGF 1SD4A 4Y17A 1SFXA 3S2WA 1FBQA 4KUMA 3MFKA 4ESJA 4AD9A 1J9IA 2F5DA 3TDUC 1FP1D 2ZCWA 1O3SA 1UHWA 4R1HA 4ENNA 2EWNA 4CXFA 3HRMA 1O7FA 1I6XA 1FNNA 1ZLKA 4L9JA 2TDXA 3F23A 4Q47A 2QVOA 2EK5A 4XSXF 1IN7A 1C0WA 1TBXA 2ZFWA 2OQGA 3EUHA 4ENMA 4L0ZB 2IRFG 5HS9A 3V8KA 1XN7A 5EEGA 4EQQA 5HLHA 1GXPA 2Z3YA 4WX9A 4M71A 1RNLA 1P92A 2DU9A 1BC8C 2DPUA 2X0LA 1YLFA 2FOKA 2P6SA 2RC4A 3WTTC 1J59A 3J7AO 2DO7A 2P5KA 2R3SA 1F9NA 3TO6A 2YX4A 2R7DA 5LEKA 1ON1A 4HBLA 3KCCA 3M7GA 3K1MA 3WTSC 2HTSA 1XGMA 4U0VA 3V7RA 1IW7F 5JI6A 3KP6A 1Z1DA 5K1YA 1R58A 1QZYA 4HOBA 3ECOA 5J6XA 4EJVA 3WTXC 3U1DA 4CZZA 2XAFA 2O3FA 2EFWA 3KP2A 3VODA 1KQ0A 4KN7X 3WU0A 5DD4A 1EH7A 5BPIA 4DQ2A 5LRSA 2BGCA 2VOOA 2Q8KA 5ICFA 3SHFA 1XGNA 4HQMA 2CSOA 2CG4A 2FRHA 2Y75A 3TO7A 4EJOA 2LSOA 5DV5A 4JK1X 2NYXA 2W85A 2HYFA 1BC7C 1FP2A 3BJOA 4MHGA 2ACJA 3HTSB 1J2XA 2GAUA 4EM0B 3LQRA 2P5LC 4KIGA 3DF8A 2Y0MA 2E1NA 2KRFA 3TQNA 2VE8A 3V8JA 2DFIA 2JPCA 1FSEA 5LHIA 1XGOA 2PG4A 3T8RA 4HX8A 4ZYEA 3EQLF 5BS6A 1ONVA 1PP7U 5FD6A 4U7BA 5DUKA 4ENKA 3LAJA 1S8NA 3O3KA 4KIFA 2CW0F 4WF2A 3WU1B 1REPC 4PCQA 2VT2A 2HGCA 2OQRA 2RV8A 3Q9SA 4LJZF 3DKWA 3EETA 3JTGA 2H09A 2WC2A 4DNCA 3BROA 1T0FA 2NNNA 3ZMZA 2CO5A 2VBYA 3I64A 4KIBA 5LHGA 2FEZA 1IXSB 4N9HA 1MDMA 1T39A 3LAPA 1LEAA 3U2RA 3JSOA 1PUEE 4L9VA 2VN2A 3V7CA 2G9WA 4CICA 2RGVA 2OD5A 5H6RA 1Z6TA 4UV9A 2BBYA 3E5QA 2E1CA 1V3FA 4WWCA 5E8IA 4RGXA 3P7NA 2ISZA 1HSTA 5E8GA 1O7LA 2QM3A 2HDCA 1IRGA 3WE3A 3W6KB 2OZUA 1P4AA 4KA4A 5E1ZB 4ZH4F 1TW2A 1ZN2A 2FBIA 1AOYA 1ZG1A 5ICCA 3MQ0A 4CO8A 1QBJA 3H92A 3C3WA 1BI0A 4BH9A 3F72A 4S05A 1HKTA 1IAWA 1EH8A 3T5XA 3QPHA 2FSWA 1XSVA 2WV0A 3KP7A 3PFIA 2LKPA 3W6JB 1WRJA 3J80K 1T6SA 2B0LA 2EA4A 4HW0A 4KFCA 5H20A 3FXRA 2VE9A 5FFZA 1ZH5A 3HRTA 1ON2A 3MAJA 4EVIA 5TJJA 3LSTA 2L54A 1ZG3A 2PN6A 2ELHA 2XIGA 2V1UA 4HYEA 1FYKA 1FY7A 2VBWA 2FBKA 1O3TA 2M87A 2F5CA 1D8JA 3GO5A 3H3ZA 2P5VA 1WSUA 4YFXF 2DW4A 2FMLA 4HV6A 2J5PA 4A6EA 3I59A 4HLXA 3ZMSA 1YO5C 2V6CA 2M8EA 2IA1A 2IW5A 3CO7C 2O8XA 5KVRA 1FBUA 3R0JA 1F4KA 2VT3A 1W7PD 3LFKA 2VC0A 2VC1A 1SMYF 1S7AA 1R1VA 2A61A 3NRVA 4EJTA 2Q2EA 3BP8A 3F8FA 2OAZA 4P96A 2PEXA 3ZMDA 3J81K 1OYWA 1CF7A 1HW2A 3HRSA 2KJCA 1U6GA 4IVNA 1LDDA 2GIVA 2PMUA 2NNYA 4I0AA 4LFUA 5JFRA 2LNBA 4YFNF 4OOIA 1QQIA 4AIHA 1FWZA 1B4AA 1IN4A 1TQIA 3ABUA 5CVVA 1E2XA 1OYIA 1WKMA 4WXDA 1BJAA 3KZYA 1OMIA 2XASA 5EEHA 4G7HF 3DP7A 3B73A 2EV0A 4L9NA 3DV8A 2VXZA 1O57A 2FQ3A 2RDPA 2Y48A 3L2CA 3EDPA 3HSEA 3D5LA 5DDGA 4UNOA 3MZYA 1XMAA 2YSRA 5L3GA 2HEOA 2IPQX 4M74A 4ETSA 5D5WB 1XSXA 5HDNA 3KEQA 2DQLA 3TOBA 4HAMA 3TKYA 1D5VA 1DP7P 3E6BA 2XAQA 1DDNA 2QQBA 3DEUA 4UVBA 4ESBA 1P2FA 4EGYA 1G4DA 2QBYB 2K27A 4A0ZA 4CHUA 2XKOA 4WCGA 1HXDA 3RYPA 1T98A 4RAYA 1TW3A 1BI2A 4RB1A 5CVUA 1L3LA 4KICA 5BMZA 4GYGA 5BQTA 1QZZA 4EM1A 1IXCA 1K7AA 5D5VB 3GEZA 1ZGJA 4EJUA 2QENA 4HX7A 4WXHA 1ZRFA 3CDHA 3L7WA 3P9KA 3CO6C 1U5TC 3B02A 2XAHA 1X3UA 2P7CB 1KQ9A 3SZPA 3IRQA 5HS8A 2Z9OA 3REOA 1YS7A 3O6BB 4PDKA 1B1BA 3FF5A 4A0XA 2DK5A 5E18F 4IHTA 5K5QA 2GXGA 1HSJA 5L3DA 3L09A 4AVPA 3WGIA 1K78A 3R60A 5IT9Z 2RN7A 2FF4A 2MLKA 1CGPA 2MC3A 5DCMB 1FPQA 4GCVA 1D8KA 2FXAA 3LQQA 4I0BA 1IN8A 2EFOA 2RVCA 1JXSA 1V4RA 1ZG5A 3V8LA 2Z33A 2ZO4A 1F5TA 2JT1A 2AS5F 3T1BA 2V1DA 5F64A 3WTVC 4ZYGA 4AWXB 5IT9K 2EA2A 2VODA 1YTYA 2HTJA 2IT0A 3WTYC 3ISPA 3DXJF 4NQWA 4OMZA 5HLIA 2P7VB 4RB2C 1YYVA 3IKVA 4EV0A 4O3MA 5D6FA 2JTVA 1STZA 2DLLA 3CJNA 2LF7A 1LB2A 1GXQA 3CLOA 3TOAA 2IVMA 4QWQA 3FXQA 4MEYF 4M9XA 1XCBA 3IHUA 1FBSA 2E7WA 3BOQA 2UZKA 3GX4X 3TDZC 2XAJA 3ABTA 1QPMA 1OR7A 4MQ9F 4ZZDA 3E97A 3F8BA 4OIOF 2ZMEA 3KP4A 3VEPA 4KT5C 3ECHA 2XRNA 3IWFA 1T2KA 2BYVE 1FC3A 1UCRA 3KETA 2HFHA 4ESFA 1ZYRF 5ILSA 2D1VA 4G6DA 3MZHA 1I5ZA 4LD5A 1IN5A 4LGWA 4RGRA 2WTEA 3DFGA 4F7ZA 4BQAA 1XDUA 4I98B 3WGGA 3SXYA 1KQ8A 3E6MA 1DPRA 2DAOA 3GZ5A 1G3WA 3HSRA 4G7ZF 1Z91A 3QP6A 5HDKA 2XROA 1XCVA 2UXXA 3M8FA 1SFEA 1F1ZA 2PJPA 3AAFA 1RUOA 5LHHA 3BZ6A 2HQNA 2HKOA 2MA3A 4L9TA 1Y0UA 2F5FA 1W7PB 3HRUA 3ZQ7A 3BJ6A 3QU6A 4LLNA 2IA0A 3IC7A 2XVCA 3I59B 4PGHA 4RS8A 4Y15A 3R4KA 1Z05A 3ZMUA 2DBBA 4M72A 4EGZA 4R79A 1D3YA 2K4BA 2DTRA 2Q0OA 2L3DA 2PBIA 1EV7A 2QYOA 3FXUA 2MH9A 1LQ1A 3E6DA 1BBYA 1KGSA 1TQMA 2H94A 2D45A 3ZP5A 2HWVA 3RTRA 2W57A 4UVAA 2GA1A 2STTA 3R0AA 4LK0F 4LLLA 1ZAOA 3GXOA 4HQEA 2W25A 3DPLC 4ZZLA 1LEBA 3M9AA 2A07F 5D6EA 1EH6A 3RKXA 3K69A 3KZZA 5TRDA 1K79A 3BY6A 4N0BA 5D5UB 2XGXA 3KE2A 2A69F 4QLCU 1O3QA 5D8LB 2A3SA 2YU3A 1OPCA 3PQJA 4GYIA 1H9TA 5ICGA 4G7OF 1BIBA 2H6CA 5A2QK 1R7JA 3SZTA 1FX7A 3V7SA 1WI9A 1R22A 1FZPB 3ML6A 5FGMA 3HHGA 4O5VA 1BIAA 3J80Z 4GXOA 1XMKA 2R7FA 5E1WA 5DEQA 5JHUA 4OIRF 2JPBA 1R5HA 2XHKA 3VB2A 4HF2A 5E20A 1T38A 1HBXG 2M1BA 5LLQA 1GVJA 1KU9A 2GA2A 3QRFF 2ZXJA 1R1TA 2YPRA 4A12A 2LF8A 2X4HA 4HA8A 5AONA 3FMRA 1TNTA 1KYZA 3CUQB 4E70A 3LA2A 5L3FA 3P9CA 4D0PA 3L9FA 3LA3A 2IJLA 3GFIA 5HOOA 4YIIA 4UVCA 4L0YB 4P55A 5F6FA 1P6RA 4FX0A 4LK1F 3FM3A 4Y13A 2MLGA 2FBHA 4A6DA 4CYDA 1Z7UA 3GLXA 1W4MA 2E7XA 2ZNYA 1S3JA 1BI3A 3Q9VA 3BPVA 3G3ZA 1DUXC 1W5SA 3ULQB 2FNAA 3I5UA 1R1UA 3JSPA 3WGHA 4OMYA 3KP3A 3GFMA 3J81Z 4A5MA 1USSA 5F1RA 2GXBA 2EV6A 4M6YA 3F6VA 3RKYA 4TV7A 4ASNA 3NEUA 3G73A 2FA5A 2PI0A 5D8KB 3K2ZA 2EFNA 2CGPA 1RZ4A 4RGSA 4MQVA 3GW2A 1G6NA 3JW4A 4CGZA 1ZHFA 1U5TA 1J7KA 2VBXA 2A6EF 4G9YA 3ZN0A 3T8TA 4I2OA 1TNSA 4BYYA 2HYGD 3I4PA 5CVJA 4WK8F 4OINF 3RDIA 1JHFA 1IRFA 3FMSA 4I02A 1K6OA 1P4XA 2P4WA 3KLNA 2IP2A 4HZFA 1MJAA 1R00A 4M73A 2KIFA 3O2PE 5D4SA 4KMUX 2IA2A 2L4AA 2M5WA 1E17A 2Z5UA 5KK1A 2DI3A 1ZLJA 4XLPF 2GZWA 3WTZA 2CWEA 1S7OA 1YQAA 5FLXZ 4IRIA 1KU3A 4R8HA 2V9VA 2FNPA 1XDSA 1LJ9A 1P4WA 5CLSA 2RNJA 4B09A 2OBPA 4BAYA 2A6HF 3F8MA 5HDGA 3LA7A 4KNYA 1B9NA 2BEOA 1XD7A 3ZMTA 4MGRA 3M1EA 4HF1A 1LVAA 4IPAA 2PLYA 2NRAC 4A5NA 5FLXK 4HDVA 3QOPA 4XSZF 3U9GA 1O3RA 3E6CC 4RGUA 5K5OA 3BWGA 3QAHA 1IN6A 2W84A 1I1SA 3HIFA 4UUVA 3DQVC 4M9ZA 1G3TA 5L3BA 1PP8F 3KP5A 5HLGA 2ADUA 2XKPA 4UXNA 3HUGA 4GO1A 2HOEA 2UXNA 5E1XA 1FLIA 4Z2YA 3K0LA 3RI4A 5LEJA 4YIFA 2QUFA 4IHSA 3Q5FA 1KU7A 1R23A 1B9MA 5LBQA 2ZNZA 3EYYA 2LDUA 3NQOA 2ESNA 3CTAA 4BNCA 2EFPA 2PQ8A 3I58A 4CDGA 1BM9A 3COAC 1TTYA 3WG9A 5JR3A 1I27A 5J8FA 1HW5A 4U88A 4S04A 1J5YA 1SD5A 1YIOA 2OZ6A 3M8EA 5LGNA 4IRGA 3QP5A 2NAZA 3VFZA 3JTHA 2KIUA 3ROUA 2J5OA 2DQRA 1PDNC 1YW8A 1MDMB 5H6QA 1SD6A 3ZMVA 4IRHA 2VOPA 1UB9A 3H3UA 1JE8A 3PQKA 4LB6B 1LNWA 1UFMA 1IUYA 1B59A 2QQAA 2FMYA 1ZREA 1Z6RA 3I71A 1ULYA 3QPTA 2JRTA 2G7HA 1BN5A 1DPUA 2BV6A 2ETHA 4ZYDA 4HX4A 1LDJA 3CUQC 2GWRA 3I0TA 1FYMA 4MEXF 4L5IA 4K2EA 1ZGAA 1VTNC 4PGGA 5CYVA 2M30A 3BPXA 3L00A 2F2EA 4U0YA 5DYMA 1AWCA 4LG0A 2PFBA 3FHZA 2COMA 2QQ9A 3FX3A 3IRRA 2EV5A 3JAMZ 4BXUA 2KIMA 1HW1A 2MBFA 2K02A 2QBYA 4XRFA 3P9IA 1J0RA 1ZRCA 4EM2A 1L0OC 3RKWA 2ZKZA 5JVTA 1U8RA 4KDPA 1YG2A 2QWWA 2D1HA 3GVAA 4YFKF 5LRRA 3WTWC 3RIRA 2O03A 2W24A 4MNUA 3JAMK 2HR3A 4A2UA 2ZBKA 3CUOA 4AIKA 1FSHA 3C1DA 1RI7A 4UHTA 3I53A 1SFUA 1YW9A 4I01A 1YS6A 5FFXA 3KLOA 5J8CA 3V4GA 3GUDA 2O61A 3E5UA 5AIQA 4M9SA 2A68F 2DK8A 1MJBA 3D0SA 5BPDA 1H9GA 2BE5F 1TQPA 1HKQA 4UV8A 4RB0A 1CF7B 3GWZA 1MZBA 5HVQC 3F8NA 4WXCA 1U2WA 2ZJ2A 5E17F 4I09A 3RJPA 4IXAA 3RYRA 5DUIA 1FYLA 3RPUA 3K9TA 1YW7A 1U5TB 4GGGA 5K5RA 5LGUA 3DPTA 1RIOH 5CVRA 4BHBA 5DCMA 5A2QZ 5D4RA 1UHMA 5AIPA 2ESHA 1ODDA 2RKHA 2JZYA 4NB5A 3N97A 2HZTA 4U0WA 1WWXA 4KMFA 2M45A 3HTUA 5FD5A 4RB3C 4KN4X 5BOXA 3BDDA 1U3EM 4NHJA 1NHAA 1RUNA 1MJ9A 1YFHA 1LDKB 1KA8A 4PZJA 4Q4ZF 2O0YA 4O6JA 3F6OA 3C7JA 6PAXA 1QO0D 3F3XA 2EFQA 3ELKA 2O6GE 3N4MA 2CQKA 3GFJA 4EJWA 3FM5A 3LWFA 1SMTA 3BJAA 3GFLA 3KFWX 1QGPA 2KKOA 2A5YB 1HQCA 2CFXA 4P5OA 4ENJA 4XBFA 3MWMA 2YR2A 2Z99A 2VBZA 4Q48A 3I54A 2QZ8A 1USTA 4ZYHA 1U78A 2WWYA 1GHCA 4MTEA 4HF0A 1G3YA 3IL2A 3WODF 2XAGA 2CYYA 4BHPA 3E5XA 4OIPF 1OKRA 1IF1A 3TGNA 2JSCA 2YX7A 4YG2F 1QNTA 4FHTA 5ILVA 2HQRA 4M6XA 5ERIA 2XV4S 3EYIA 4HLYA 5LGTA 5D5XB 2ISYA 2P8TA 1FT9A 3IKTA 5ILUA 3ERED 2K7LA 5CVIA 2G7UA 1K78B 4LB5A 1W7PA 3KEOA 3R61A 2PMHA 2H27A 3WTUC 1XGSA 3GF2A 1HKSA 1Q1HA 2DPDA 4ON0A 3HYIA 3HSFA 3HHHA 3MEXA 2EJRA 3GYHX 5L3EA 2HKXA 5ED4A 5CJ9A 4L5JA 5L3CA 1MD0A 4A0YA 3K1NA 2K4JA 1JGSA 2L4MA 1IZ1A 3F8CA 4L18B 3FMQA 2H6BA 3T0YA 2VONA 5FB2A 3F21A 4HV5A 5ICEA 1W5TA 2AXLA 2XUBA 4G8XA 2D2WA 3MCZA 3FZVA
chains in the Genus database with same CATH superfamily
2X1CA 1SD7A 1TLHB 3BR2A 3ONQA 1BOAA 1XSDA 2V4JC 1VQPI 5M5XJ 3ZQHA 3G1MA 2JA8J 3BTCA 4IJAA 2JVGA 3G2BA 2F5EA 1IXRC 1UHSA 4MTDA 2STWA 1I1GA 4H0EA 3RPQA 4B43A 4LMYA 5HS7A 3CCJI 2FE3A 3WE2A 4G94A 4E7ZA 3ZN1A 1RC9A 2OF7A 2V79A 5DD8A 3HOWJ 2HDDA 1R36A 3CCEI 2QLZA 3OOUA 4E7SA 3CP8A 3ZR8X 3FXOA 3HOSA 2VUMJ 2ZMEB 3OOPA 3L2VA 4X1EA 3VOEA 5JVGF 2LD5A 4P9FA 4AYBN 3NARA 3D1NI 1J75A 5H2FC 3DU5A 2K40A 4BEHA 1YITI 4FX4A 1ETXA 3H9JA 2C6YA 4KYWA 2MH2A 1KYWA 4HNUA 3F22A 2HXIA 5IT3A 2NS8A 3ZPLA 2HPIA 4RAZA 4IF4A 5TISC 5FKKA 2K9LA 3GZ6A 1E0EA 2MD5A 4LG0B 4B3XA 1MSFC 1B6AA 3SFZA 3KYLA 4MIMA 4NBQA 2DT5A 4BHCA 2P6TA 2UWMA 3VSLA 4OU0A 3QYEA 1SAXA 4HNVA 3HOTA 2NOGA 2OA4A 1P7IA 1F43A 1ETOA 1A04A 3G1LA 1XB4A 4B8XA 1IC8A 4G6QA 1K6YA 4W97A 4AIJA 4ABZA 1WQ2A 3OYDA 3OV8A 4EMSA 2HS5A 2KJBA 3FWEA 2FU4A 3W2WA 4OIQF 1X3WB 2L02A 4P9UA 1IDYA 3CMYA 2BXZA 3VYRB 3LNQA 2EB7A 2LKXA 5F1JA 5EDNA 1MGTA 2MG4A 1Z9CA 3D5RC 1B72B 1DP3A 3CCRI 2HQAA 2OPTA 1YE9A 3JRBA 3JRDA 2KQRA 4U7DA 1SVOA 3IAS2 1VQ9I 3ZOBA 3H5RA 4JQFA 2LG4A 4C2TA 1WFXA 2V1XA 2OU2A 3H35A 3CUQA 3IV5A 4N9IA 4II3A 1S29A 3TO9A 3RZDJ 4AM3A 3I4NJ 1V5GA 1W1WE 4QPOA 2JA5J 2ID6A 2DJNA 1R5GA 4YEJA 2VLAA 4JBAA 1X1AA 1G3SA 3I9V2 5DCFA 4HDUA 3E3VA 1H0MA 1KU2A 2L01A 3IWZA 1BI1A 2LMDA 1FOKA 3HB9A 4XLNF 1MKMA 3C18A 3K1PA 1JHHA 1VQ7I 2K86A 1ZRDA 3R6SA 2KL4A 4Q5SF 1ZARA 4I7HA 2D5VA 3SQNA 3KZIC 4BS9A 3SYTA 4IOCF 4C2UA 3A03A 1TWAJ 1OCCH 1OLTA 3SFIA 2AXTC 2NS0A 3Q0VA 2EH3A 5FO5A 3QU3A 4FT8A 2ICWG 2DA2A 1OYYA 4BKXA 2RQPA 2E1MB 3GCMA 4L5EA 2GQQA 1S6LA 4LLGF 3DLAA 3S15J 2ZJRF 4RAGA 1SD4A 1RKTA 5IP9J 5FJ8J 1Z21A 3OSGA 2AQEA 1SFXA 4Y17A 3S2WA 1FBQA 3SDBA 4KUMA 3MFKA 2O7OA 5M5YJ 4ESJA 4ZTJA 3VYSB 1TWGJ 1TT0A 3LL7A 4AD9A 3MCZA 2QA4I 1J9IA 1LE8A 2F5DA 2M3AA 3TDUC 1KZHA 4DW6A 1FP1D 3HGYA 2ZCWA 1O3SA 2M34A 1UHWA 2R93J 3K10A 3GTLJ 4R1HA 4ENNA 1W5CC 3EUAA 2L7KA 3EPZA 3RQ4A 2Y9YA 2EWNA 1MNEA 4CXFA 3HRMA 1O7FA 1ZKGA 1I6XA 2HPMA 4UUSA 1FNNA 1ZLKA 4L9JA 4DYQA 3M07A 2TDXA 2OCEA 3KEYA 3HPGA 1PUFA 2KMUA 3F23A 4V19K 1TL8A 4Q47A 3B6CA 1QZEA 2QVOA 1E3HA 3K4KA 3OIQA 1VNDA 2EK5A 2QQ8A 4XSXF 1IN7A 1C0WA 1QA6A 1TBXA 2ZFWA 2OQGA 3GTPJ 3EUHA 1YJNI 4ENMA 4L0ZB 3K4LA 5GAHJ 2IRFG 5HS9A 3V8KA 1XN7A 5EEGA 4EQQA 4Y52J 2R7SA 2XGDA 2GOXB 5HLHA 1GXPA 2Z3YA 3LSKA 4WX9A 4CYCA 3CF2A 1RNLA 4M71A 1P92A 2DU9A 2IGOA 5IP7J 1BC8C 2MGQA 1BL0A 2DPUA 2X0LA 1YLFA 1E3OC 2FOKA 2DFFA 3K4NA 1Z67A 2P6SA 2RC4A 3WTTC 2OV7A 3HOUJ 2RNGA 1MNDA 5EGOA 3GTKJ 3DBLB 1T8IA 3DTEA 1J59A 3J7AO 3ZXSA 4E4HA 1WVRA 2DO7A 4Y4RA 2P5KA 2R3SA 1F9NA 3TO6A 2YX4A 4J01A 2HQ5A 3OYEA 2R7DA 1JUMA 1SAUA 2BW3B 3U1KA 5LEKA 3PNYA 3OS0A 1ON1A 4HBLA 2R7TA 2OJED 1BW5A 3KCCA 3DWLE 3FDYA 3M7GA 2EQRA 3K1MA 3WTSC 1HA8A 2HTSA 1XGMA 4U0VA 3V7RA 2CUZA 1IW7F 3C2HA 2GXAA 5JI6A 3KP6A 1Z1DA 4BUPA 5K1YA 2KDZA 4LITA 4CCNA 1R58A 1QZYA 1A31A 3FISA 4HOBA 1OCRH 3S2DJ 2TRTA 3ECOA 5J6XA 3GTJJ 2IBDA 4LIUA 2VQHA 2E2IJ 2NVUB 4EJVA 3WTXC 3U1DA 1IGNA 3SZGA 4MFEA 2VL8A 4CZZA 2XAFA 2XDVA 1NTCA 2O3FA 3DEWA 2EFWA 3KP2A 3VODA 1KQ0A 1WJEA 4KN7X 3WU0A 3OYHA 2CUFA 1JGGA 5DD4A 3HOZJ 4D5CA 3VWBA 1EH7A 5BPIA 4M3FA 1Q1VA 5C4JJ 2M7AA 4RA2A 4DQ2A 5LRSA 2BGCA 2VOOA 2Q8KA 1XGNA 3BZKA 2BY0A 2CSOA 2CG4A 2FRHA 2Y75A 1GVDA 4HQMA 1LFPA 4MLOA 3TO7A 4EJOA 4FCYA 2LSOA 5DV5A 4C2MJ 4JK1X 2NYXA 2W85A 4BQQA 2HYFA 1BC7C 2V7FA 1FP2A 2RREA 3BJOA 1F36A 4IL6C 4MHGA 2ACJA 3Q0WA 3HTSB 2OCCH 1R9TJ 1MMAA 2R7VA 1J2XA 3JRFA 2GAUA 3O8HA 2CQXA 1YOVB 4EM0B 3LQRA 4Y33A 3FIWA 2P5LC 4KIGA 2CV0A 3DF8A 2MFZA 2Y0MA 4LOCA 2E1NA 2KRFA 5C3EJ 1MW7A 2M8GX 1A6IA 2ID3A 3TQNA 2VE8A 3V8JA 2ZXHA 2DFIA 2JPCA 2QSHX 2UUZA 3K4CA 1FTTA 3LSIA 1X58A 1FSEA 5LHIA 2M0MA 1XGOA 2FQ4A 1YIJI 2PG4A 3T8RA 3CCYA 4HX8A 5E3LA 4ZYEA 3EQLF 5BS6A 4HRIA 1ONVA 1PP7U 1IJWC 5FD6A 4U7BA 1HOMA 5KNLA 5DUKA 4ENKA 3LAJA 3AL0C 1S8NA 3K6GA 3O3KA 1OR7C 3CDLA 4KIFA 3G4SI 2EPFA 3B6AA 2CW0F 4WF2A 3WU1B 2WAFA 2MYSA 2ZMEC 4XMYA 1REPC 4PCQA 2VT2A 2HGCA 2L9SA 3F9KA 2OQRA 5LFAA 3BZCA 2RV8A 2KFDA 4BE0A 1YHQI 2CQ7A 3Q9SA 4LJZF 2MD0A 3DKWA 3EETA 3QOEA 2H09A 2WC2A 4DNCA 3JTGA 2H1KA 3BROA 3RPUD 1T0FA 1BR1A 1I3QJ 2NNNA 3ZMZA 2CO5A 2VBYA 3I64A 4KIBA 5LHGA 5B66C 2GLOA 3WU2C 4DIQA 3IAM2 2DA4A 4NC8A 4PJLA 2FEZA 3BQZA 1IXSB 4N9HA 4MFDA 5J4VA 2MC4A 3ZGKA 1MDMA 3SJMA 1TC3C 3PO2J 1T39A 4B48A 1LFBA 1MBKA 3LAPA 4PFOA 4P1WA 2X51A 1LEAA 3U2RA 1IRZA 3JSOA 1PUEE 4JX6A 3H5AA 4L9VA 2VN2A 2RQQA 1VQLI 5J4YA 2ZFUA 3V7CA 2G9WA 4CICA 2RGVA 3CCMI 2XC7A 4F55A 4CZCA 2OD5A 4RAFA 5H6RA 1Z6TA 4UV9A 5CQEA 2BBYA 3E5QA 2E1CA 4MO7A 1V3FA 1XMXA 4BEHB 5E8IA 4WWCA 4RGXA 2X48A 2ME0A 3P7NA 2ISZA 1HSTA 5E8GA 1O7LA 2LYCA 2QM3A 1U9OA 2HDCA 4C3IJ 3S16J 1IRGA 2BOLA 3ABMH 3WE3A 3W6KB 1WGXA 2OZUA 1P4AA 2EZHA 4KA4A 2XPVA 2QKLB 2HOSA 1GT0C 5E1ZB 2GM4A 1TW2A 1NG7A 3HKZA 1ZN2A 4ZH4F 2FBIA 5E3OA 2PJRA 4ZDPA 1AOYA 1ZG1A 5ICCA 1PYVA 3MQ0A 1MIJA 3ZQLA 4CO8A 1QBJA 5FLMJ 3H92A 3ZQGA 3S3MA 3C3WA 1W0TA 1BI0A 4NC7A 4BH9A 3F72A 1VQMI 5LD2C 4BGDA 3PL8A 1K83J 4S05A 4E7JA 2L0KA 2CRGA 3H0DA 1HKTA 1IAWA 1EH8A 3LSGA 3T5XA 3LSHA 3QPHA 3DU6A 2FSWA 2CV2A 1XSVA 2WV0A 3LFUA 5IYCJ 3KP7A 2X6WA 5GTHC 4OAZA 3PFIA 2LKPA 2A05A 3W6JB 2O5RA 1IRXA 1WRJA 2A6TA 3J80K 2E1MC 1PVEA 4D1QA 1MMSA 1T6SA 3OIOA 4BY7J 2B0LA 4IHYA 3HUGB 3S14J 2EA4A 4HW0A 2VIXA 4KFCA 2L7FP 5H20A 3FXRA 2VE9A 5FFZA 1ZH5A 2QKMB 1I50J 3HRTA 4E7HA 3ASOH 3DEEA 3DLLF 3TL4X 2HOTA 4FE7A 1ON2A 4A3EJ 3HEFA 3MAJA 4EVIA 5TJJA 3LSTA 2JUCA 2L54A 1ZG3A 2PN6A 2ELHA 2XIGA 4QSHA 2V1UA 4HYEA 1FYKA 2LY1A 1LKXA 1FY7A 1BR2A 4HSTA 4CCJA 4D5FA 2VBWA 2FBKA 2JA6J 1MH3A 1O3TA 2M87A 2F5CA 4M3GA 1S72I 1D8JA 1G59A 3GO5A 2X6OA 1VQ5I 3H3ZA 4IHVA 2ZB9A 1SC7A 3I4MJ 2P5VA 1WSUA 3SEQA 2VKHA 3JRHA 4YFXF 2DW4A 1A6QA 2FMLA 1X2NA 2Y69H 4HV6A 2J5PA 4A6EA 3I59A 4HLXA 2JUGA 3ZMSA 1YO5C 5IYDJ 4XNFA 3JRIA 2V6CA 1D5YA 2M8EA 3PM1A 3HG9A 2JRMA 3S2HJ 2IA1A 4KT6A 2IW5A 3CO7C 1JKPC 2O8XA 5KVRA 1FBUA 2IGMA 3R0JA 1F4KA 2VT3A 3OYIA 2R5ZB 2EBIA 1R4NB 3I55I 1W7PD 3LFKA 5HLTA 4CCMA 2VC0A 1JI8A 2VC1A 3HC7A 1SMYF 1S7AA 1R1VA 2V9PA 2A61A 1NG6A 3NRVA 2Q2EA 3BP8A 3F8FA 3K2AA 4EJTA 2OAZA 4P96A 2PEXA 2TCTA 1TWFJ 2KHMA 3ZMDA 4BU2A 3J81K 4I76A 1OYWA 1CF7A 4HPQA 4UUSB 1HW2A 3M4OJ 3HRSA 2KJCA 2CS3A 1U6GA 4AVZA 1HDDC 4IVNA 1LVKA 1PUFB 1LDDA 2GIVA 2PMUA 2NNYA 4I0AA 4ZJZA 3OYCA 2R7RA 4LFUA 5JFRA 1NK3P 3RKQA 3GTOJ 2LNBA 4YFNF 1YJWI 4DBRA 4HG2A 2HVRA 2JVHA 4OOIA 2DOAA 3C2BA 1QQIA 4AIHA 2WY8Q 1FWZA 2Y30A 1B4AA 1IN4A 1MBHA 2NXNB 4A3IJ 1CQTA 1TQIA 3ABUA 4E6KG 1FOYA 5CVVA 5EEAA 1E2XA 1ZELA 1OYIA 1WKMA 4CA0A 4WXDA 1BJAA 1QPIA 4F93B 3KZYA 1OMIA 4CYCB 2XASA 5EEHA 4G7HF 1Y8QB 3DP7A 3B73A 3VYUB 2EV0A 5F27A 1OFCX 4L9NA 3DV8A 2VXZA 1O57A 2FQ3A 3A4CA 4IQ4A 5EJCA 3CC2I 2RDPA 2Y48A 3L2CA 4A3JJ 3EDPA 3HSEA 3D5LA 5DDGA 4UNOA 3MZYA 4C9YA 5EGOB 1XMAA 2JJ7A 2LFBA 2CQNA 2YSRA 2CW7A 2AO9A 5L3GA 2E5NA 3KX2A 2HEOA 2IPQX 4M74A 4ETSA 5K7FA 5D5WB 1XSXA 1D1CA 4EEFG 5HDNA 4FQGA 3AG3H 3KEQA 2DQLA 3TOBA 4HAMA 1ITYA 4X0GA 3TKYA 1D5VA 4DOZA 1DP7P 2DFEA 3E6BA 3CZ6A 1VF9A 2XAQA 1DDNA 1SVMA 3U21A 1WZ2A 2NVQJ 2QQBA 4B4CA 1WH7A 3DEUA 1T08B 4UVBA 4ESBA 1P2FA 3CD6I 3RZOJ 1EKEA 4EGYA 1ZK8A 4XR6A 5IOZA 1G4DA 2QBYB 2K27A 4A0ZA 3OYLA 4CHUA 3TP3A 2FJ1A 2XKOA 4WCGA 1HXDA 3W3CA 3RYPA 1TWHJ 3CDIA 3WHCA 1T98A 3JRGA 4KJZA 1K61A 4RAYA 1TW3A 1FIAA 1BI2A 4RB1A 3SEZA 4BACA 3DCFA 5CVUA 2X1EA 3BTJA 1L3LA 3ABKH 3DTKA 4KICA 2Y9ZA 5BMZA 2DDAA 4GYGA 5BQTA 2P81A 1YX3A 2O8KA 1QZZA 2X9DA 4XIDA 4EM1A 1IXCA 2M4GA 3M8JA 3K7AJ 1K7AA 3KYDB 4BJTA 5D5VB 1UJ8A 3GEZA 2LR8A 1ZGJA 3TBIA 4EJUA 5E79C 4B1RA 4NC6A 2QENA 1H88C 4HX7A 1NK2P 2OUMA 4WXHA 3FKIJ 1ZRFA 2BVMA 3CDHA 3L7WA 1I6HJ 3P9KA 3RCOA 3CO6C 3S17J 1WH5A 1MBGA 2KDOA 1U5TC 2GOMA 3B02A 2XAHA 1X3UA 2P7CB 1KQ9A 3SZPA 4PJJA 1RR8C 2VKVA 2K9NA 1MBFA 2VASA 3IRQA 5HS8A 3CP2A 2Z9OA 3REOA 1YS7A 3O6BB 1ETKA 4PDKA 1B1BA 2K9SA 3FBNB 2WB1N 3FF5A 3I3LA 4BY1J 4DJAA 4ITVA 3AG4H 2R92J 4A0XA 3GMEA 2DK5A 5E18F 1H8AC 4IHTA 5K5QA 1APLC 4IX7A 2GXGA 2IAIA 4DGWB 1HSJA 2E1OA 5F0FA 5L3DA 3FK6A 3L09A 2ZXWH 3OY9A 2QGUA 1XTAA 4AVPA 2JWTA 4XK4A 3WGIA 1K78A 4Z6YA 4IEJA 1GV2A 1Y56A 3AFHA 3R60A 4XL9A 5IT9Z 2RN7A 1QHHD 2FF4A 2MLKA 2XPUA 1CGPA 2MC3A 1RESA 3QWLA 5DCMB 1FPQA 5B1AH 2DN0A 4GCVA 3OYJA 1D8KA 4YRVA 2FXAA 3LQQA 4I0BA 1X1CA 1IN8A 4PK4A 2EFOA 2RVCA 3PUFA 4EATA 5GAEJ 1JXSA 1V4RA 1ZG5A 4IHXA 3V8LA 2Z33A 2E34A 2ZO4A 4G12A 1F5TA 4AU7A 2JN6A 2JT1A 2WAEA 2AS5F 3T1BA 2R7WA 5BNGA 2V1DA 3ESWB 3CC7I 5F64A 4A3MJ 3WTVC 4ZYGA 4AWXB 3OS1A 5IT9K 2EA2A 2NVYJ 2VODA 1P9QC 3S1RJ 2HTJA 1YTYA 4HSRA 4B47A 2IT0A 2IS2A 3WTYC 2DMQA 1X1PA 2KZVA 4RMNA 2F6CA 3ISPA 2EZIA 3DXJF 2KPMA 4NQWA 3OYAA 2ZSIB 4OMZA 5HLIA 2P7VB 4J00A 4RB2C 1YYVA 1OCZH 1JJ6C 3IKVA 1JTXA 5IYBJ 4EV0A 2R5YA 4O3MA 3OL4A 5D6FA 2JTVA 1STZA 1EF4A 2KRHA 1TZLA 2DLLA 3CJNA 1BR4A 1JUPA 2LF7A 4GRIA 1JKQC 1V5EA 1LB2A 1GXQA 3CLOA 3TOAA 1VQ4I 4V2FA 2IVMA 3HKZN 1VI0A 4QWQA 4PJ0C 3FXQA 4RDUA 4MEYF 4XRSG 4A3CJ 4M9XA 5FKOA 2BHYA 1MBEA 1XCBA 2W1OA 4XKCA 3IHUA 1FBSA 4V2GA 3RQIA 2E7WA 3BOQA 2UZKA 3GX4X 1FTZA 4PFPA 2XRLA 3TDZC 2XAJA 3ABTA 2PJRB 1QPMA 3MKYB 1OR7A 4MQ9F 4ZZDA 3E97A 3BTIA 3F8BA 1UZCA 1V5FA 4OIOF 2EIKH 1E3PA 2ZMEA 3KP4A 3VEPA 4KT5C 3ECHA 2XRNA 3IWFA 2YS9A 2Z1DA 3CQZJ 2BYVE 1T2KA 1D0XA 4F91B 1FC3A 1UCRA 2XGCA 4S0HB 1ORKA 3KETA 2HFHA 4ESFA 3KPHA 1ZYRF 4FASD 3H3VK 5ILSA 2D1VA 4G6DA 2ELJA 3MZHA 3A2KA 1I5ZA 3BR1A 2EIMH 5IPAA 2VB6A 4LD5A 1IN5A 4LGWA 4RGRA 5IP6A 2ELKA 2WTEA 4RM3A 3DFGA 4F7ZA 4BQAA 2M9HA 1XDUA 4I98B 3WGGA 3SXYA 1KQ8A 3E6MA 1DPRA 1G8XA 2DAOA 1WI3A 1OJLA 4BL0B 3GZ5A 1G3WA 2Z16A 4XONA 5EZGA 3HSRA 1S5LC 2I8DA 4G7ZF 1Z91A 3QP6A 5HDKA 2LK2A 2XROA 2CFOA 1XCVA 4BBSJ 2UXXA 3M8FA 3VYTB 3PUBA 5GADJ 1SFEA 1F1ZA 5C4XJ 2PJPA 3AAFA 1RUOA 5LHHA 3BZ6A 2HQNA 5DM6F 2HKOA 1B72A 2I5UA 2MA3A 4L9TA 1Y0UA 1A35A 2YU9J 1R49A 3IP4B 2F5FA 3L1PA 1W7PB 3JREA 3HRUA 3ZQ7A 3BJ6A 2EZLA 3X2QH 3QU6A 4LLNA 2IA0A 4UUTA 3IC7A 1Y1WJ 2B63J 3K70C 2LBFA 2XVCA 3I59B 5F08A 4PGHA 1R6RA 4RS8A 3R4KA 4Y15A 4AUXA 1ETQA 1Z05A 2KIQA 3FXJA 2DCEA 4M6VA 1G2HA 3ZMUA 2DA3A 2LKSA 5F0HA 3PJRA 2DBBA 4M72A 4EGZA 4I99C 3VPRA 4R79A 1D3YA 2WB1A 1T95A 3OMYA 1MMDA 3S1MJ 3ZQCA 2K4BA 2DTRA 3BG9A 4LG3A 4Y7NJ 2B7EA 2Q0OA 3IH4A 1SFOJ 2L3DA 2PBIA 1EV7A 2QYOA 3TMOA 3FXUA 2MH9A 3BQYA 1WJ5A 4E7IA 3IH3A 4XORA 1LQ1A 3E6DA 1BBYA 2R7UA 4BBRJ 3Q3SA 4F92B 4CUGA 4XLCA 2X1DA 3A1YA 3G1OA 1KGSA 3LSPA 1TQMA 1Y8RB 2O9LA 5DS9A 2H94A 3FKJA 2D45A 2L9VA 4JOMA 3ZP5A 2HWVA 4OAYA 4NUBA 3I56I 2H8WA 1WJFA 3RTRA 2W57A 4UVAA 1ZR2A 2GA1A 1OCTC 2STTA 2K3PA 4M3BA 3R0AA 1M1EB 4LK0F 4LLLA 1ETVA 2WAQA 1D0ZA 1ZAOA 3HPHA 5J1YA 1EA3A 3GXOA 2HVQA 4M3DA 4HQEA 1HCRA 2W25A 3DPLC 1R5ID 1RETA 4CCLA 4ZZLA 1LEBA 3M9AA 2A07F 5D6EA 1EH6A 2Y31A 4I6ZA 3RKXA 3K69A 4A93J 3KZZA 3TEDA 5TRDA 1K79A 2L2OA 3QPLA 3S3NA 1QHGA 3BY6A 4N0BA 2IS4A 5D5UB 1JKRC 1U0JA 2XGXA 3KE2A 5M5WJ 2A69F 4QLCU 2A5WA 1FOXA 1O3QA 2XAUA 5D8LB 5GPAA 2ZXIA 2A3SA 3GZNB 3MD2A 3H9GA 4QTRA 2YU3A 1OPCA 3HJEA 1ZR4A 3PQJA 4GYIA 1H9TA 3MKLA 3S8PA 5ICGA 4PSXA 5FKLA 4G7OF 1BIBA 2H6CA 5A2QK 2DA7A 3A0HC 1JT6A 1R7JA 3CMEI 2IS6A 3SZTA 3IH2A 1FX7A 3V7SA 1WI9A 3J7YJ 3MVPA 2EIJH 1R22A 1I3AA 4RM2A 1ACIA 2JMWA 1MMGA 3K4MA 1SANA 3CF5F 1FZPB 3ML6A 4XOPA 5FGMA 3HHGA 1Z77A 4O5VA 1BIAA 1ZQ3P 3J80Z 4GXOA 2HNHA 3J7AY 2BHZA 2HZDA 2LRDA 1XMKA 2R7FA 1VQNI 3A01A 5JLXA 5E1WA 1XS9A 5DEQA 5JHUA 4OIRF 1X1DA 3WHBA 2JPBA 1R5HA 5ICFA 2XHKA 3MZ8A 3VB2A 2MABA 1LPQA 4HF2A 5J40A 2CJJA 5E20A 3CCUI 1T38A 1HBXG 2IEKA 1MMNA 2M1BA 4ZDLA 5LLQA 1DU6A 1WPKA 2XF6A 2KZGA 1GVJA 2NS7A 3UR3C 5C44J 1KU9A 2GA2A 2LLKA 5GP9A 3QRFF 4XN3A 2ZXJA 2Y0SA 1TP4A 2BW3A 1P7JA 1R1TA 2YPRA 3A02A 3S93A 4A12A 1OCOH 2LF8A 4X6AJ 4F52A 1GV5A 3H1CA 2E36A 2X4HA 4HA8A 3ZRGA 3NWTA 5AONA 2DMPA 3FMRA 1TNTA 1KYZA 2H1LA 2DMTA 3CUQB 3EUKL 2PMZA 3HZJA 4XN0A 4DYRA 4E70A 4HNTA 3LA2A 1Z0XA 5F0CA 5L3FA 3P9CA 4D0PA 2K5CA 3L9FA 1W0UA 3LA3A 2VJJA 2IJLA 4DYCA 4DBQA 3OS2A 1YRNA 3GFIA 4BJ5C 3H9QA 2CUEA 1QVUA 3KYCB 5HOOA 4YIIA 4UVCA 2E19A 1AA7A 4L0YB 4P55A 5F6FA 1P6RA 4FX0A 1FMWA 3C2GA 4LK1F 3HL2A 3FM3A 4Y13A 2MLGA 2FBHA 4A6DA 3LSRA 4CYDA 1Z7UA 2HVSA 5GAGJ 3GLXA 3E0JB 1W4MA 2E7XA 4JX4A 2ZNYA 1S3JA 1Z3YA 3LMMA 3K4BA 1BI3A 3Q9VA 1S7EA 2VQCA 3BPVA 3G3ZA 1DUXC 1W5SA 3ULQB 2FNAA 2GBYA 3I5UA 1R1UA 4PUSA 3JSPA 3WGHA 4OMYA 1MH4A 1DU0A 3KP3A 3GFMA 3J81Z 4A5MA 1USSA 4E7KA 2LOOA 4FISA 3TW6A 1LFUP 1POGA 5F1RA 4XLAA 1UELB 2GXBA 1Z7LA 2QSGX 2CV1A 2EV6A 4M6YA 3F6VA 3RKYA 1DGWY 2XSDC 1LE8B 4TV7A 4ASNA 3NEUA 2QSFX 4F3QA 5K7ZA 3G73A 3J7ZI 2FA5A 2PI0A 1H89C 5FRNA 2DTZA 5D8KB 4KISA 1WJBA 3K2ZA 2G0EA 2Z2SB 3LSJA 2EFNA 2CGPA 2ECBA 2VPRA 1RZ4A 2DODA 2X85A 2FD5A 4CCKA 4BE2A 2VJ5A 4RGSA 4MQVA 3GW2A 3PSFA 2XF7A 1G6NA 3OYMA 3JW4A 2W48A 1XC5A 4CGZA 1ZHFA 2WBMA 3HOVJ 1U5TA 3OR2C 1MNMC 1J7KA 1UMQA 4D7NA 2IGKA 2VBXA 3IUOA 2FX0A 3OYBA 3W2VA 2A6EF 4G9YA 3ZN0A 2ECCA 3T8TA 3D5SC 4I2OA 3QQAA 2R0QC 1TNSA 4BYYA 2HYGD 3I4PA 5CVJA 4WK8F 4OINF 2R5YB 2VJ4A 3RDIA 2L9NA 4KITB 1JHFA 1IRFA 2CMPA 2DA5A 1N25A 3FMSA 4I02A 1K6OA 1P4XA 2P4WA 3KLNA 4UB6C 1RPWA 2IP2A 4HZFA 1HDPA 1IO2A 1MJAA 1R00A 4M73A 1AU7A 2KIFA 5FKNA 4JX5A 2QEXI 2NVXJ 3O2PE 2V9KA 2VJIA 5D4SA 1O4XA 3BR0A 4KMUX 1OISA 2IA2A 1GUUA 2L7MP 1RKWA 2L4AA 3OL3A 4XLEA 4C30A 1D1BA 2M5WA 4OWRB 2R7XA 1E17A 2Z5UA 2KRCA 4QIWN 5J1RA 3AL0B 3MKWB 2HOAA 4N4NB 1X19A 2DI3A 5KK1A 1PJRA 3PIPF 3H36A 1ZLJA 2M2EA 3MMYB 3BCAA 3CMMA 2BY2A 4A3BJ 2F48A 3BCBA 4NNJA 2XB5A 4U87A 1JKOC 5EG0A 4XLPF 2GZWA 2EZKA 3OYGA 3WTZA 2CWEA 1S7OA 1YQAA 5FLXZ 4IRIA 1KU3A 3PFYA 4R8HA 2V9VA 2FNPA 3NAUA 1XDSA 3DBHB 2MSYA 3L2QA 5E3MA 1FMVA 1TWCJ 4XLFA 1EJ9A 1LJ9A 1P4WA 5CLSA 1A36A 3OWTA 2RNJA 4B09A 2DDBA 4XQFA 2OBPA 2RAEA 4BAYA 3BR5A 2LC2A 2A6HF 3F8MA 5HDGA 3LA7A 4KNYA 1B9NA 3JCUC 1YJ9I 2BEOA 1XD7A 2ZC2A 5CPRB 3ZMTA 4MGRA 3M1EA 4HF1A 1LVAA 2E35A 1W36C 4IPAA 2PLYA 2NRAC 4A5NA 5HNFA 5FLXK 1J09A 4HDVA 3QOPA 4XSZF 3U9GA 1O3RA 3E6CC 1X2MA 4RGUA 5K5OA 3CCQI 1QRYA 3BWGA 1WJCA 3CC4I 3F0CA 1WHUA 3QAHA 2JA2A 1IN6A 2W84A 2QF7A 3BG6A 3O8GA 3HIFA 3OIPA 1AKHA 1I1SA 1Z3XA 1UG0A 1B8IA 4UUVA 3DQVC 4AIDA 3HGGA 2IGNA 4M9ZA 5JHFA 1G3TA 5M3MJ 5L3BA 1X4PA 2JK3A 1PP8F 3KP5A 3GTQJ 1T56A 5J3LA 5HLGA 2ADUA 1JT0A 2XKPA 3HOXJ 4UXNA 2LBFB 5FKMA 3HUGA 1V54H 1GLNA 4GO1A 2HOEA 2UXNA 1VQOI 1ZGWA 2VQGA 3AG2H 2L7ZA 5E1XA 1FLIA 4Z2YA 3K0LA 3K4JA 3RI4A 1RRJA 1JUSA 4ANJA 4CH7A 3GTGJ 3L2WA 5LEJA 2Q1ZB 4YIFA 5KCMA 1KONA 2XB0X 4XKWA 2QUFA 3L2RA 2DT6A 4IHSA 2E71A 2COBA 3Q5FA 1KU7A 1BJZA 1R23A 1B9MA 3N05A 5LBQA 2ZNZA 1SVLA 3JRCA 3EYYA 2LDUA 2CUJA 3NQOA 2CQQA 3G6EI 2ESNA 1OQYA 1YI2I 3CTAA 4BNCA 1UAAA 2EFPA 2PQ8A 4E7LA 3I58A 3FXKA 4CDGA 3SDGA 2FUG2 1X1BA 2H8RA 5J1UA 1BM9A 3COAC 4PJNA 2WAQN 3VDXA 1IG7A 1TTYA 1YX5A 3AG1H 3WG9A 1R4MB 4D9JA 5JR3A 3CLQA 4IOAF 2LY2A 1BOBA 1I27A 1WJDA 3BG5A 5J8FA 1HW5A 4U88A 4B3AA 4S04A 1LUJB 1J5YA 1SD5A 3P5JA 1YIOA 2OZ6A 4A69C 3M8EA 1D0YA 5LGNA 2R5ZA 4IRGA 3QP5A 4RBOA 2NAZA 3VFZA 1XPXA 2XPWA 1MBJA 4BXXJ 4BQNA 3JTHA 3OYKA 2KIUA 3G71I 3ROUA 1VQKI 2L5QA 3QPSA 2J5OA 2DQRA 1ERDA 1I39A 4H4KC 1PDNC 1YW8A 4W1UA 2UV1A 2BVLA 3QYBA 3DTIA 1MDMB 1IV8A 1D1AA 5H6QA 1SD6A 3ZMVA 3OSFA 4IRHA 2VOPA 1UB9A 3S1NJ 3H3UA 1JE8A 3PQKA 4LB6B 1LNWA 1TT5B 1UFMA 1IUYA 4J19A 1B59A 2M0CA 2QQAA 2FMYA 3VSKA 1ZREA 1HC8A 4JP0A 1Z6RA 3I71A 2CH0A 2VXDA 1ULYA 3QPTA 2JRTA 2G7HA 5B1BH 2L9RA 4UB8C 1BN5A 1DPUA 4B44A 2BV6A 2ETHA 4ZYDA 4HX4A 4C3JJ 1LDJA 3K70D 4G6TB 3CUQC 2GWRA 3E7LA 3ZQFA 3LSMA 3I0TA 1FYMA 1AHDP 4MEXF 2VKDA 1JTYA 1V55H 4L5IA 4A3GJ 4K2EA 3A01B 2R7OA 1Y39A 2N8GA 1XX5A 1ZGAA 2Y0SN 1VTNC 1N75A 1FJLA 4PGGA 1ETWA 2XGEA 4Y3OA 5CYVA 5GTIC 4XKBA 2M30A 4AYBA 2F5VA 1DGRM 3BPXA 3L00A 3LOCA 2F2EA 4U0YA 1UG2A 1K4SA 5DYMA 2PMZN 3L2UA 1AWCA 2VQLA 1HF0A 4LG0A 2PFBA 4LIVA 4NDLA 2OTJI 3FHZA 2COMA 2QQ9A 3FX3A 4XM3A 2WV1A 3IRRA 2DOEA 2EV5A 4CCOA 5F04A 2E2JJ 3JAMZ 1R71A 3DKXA 2HYJA 4BXUA 2KIMA 1HW1A 2BZTA 1SFKA 2MBFA 2K02A 3JRAA 2I10A 2QBYA 3BT9A 4XRFA 3P9IA 1J0RA 1YRNB 1ZRCA 2YUSA 4II2A 4EM2A 1L0OC 2R4GA 3CMAI 4BE1A 3RKWA 2ZKZA 4QPQA 4GDFA 5JVTA 1U8RA 4KDPA 1YG2A 2QWWA 4IQJA 2D1HA 2AHQA 3GVAA 4YFKF 5LRRA 2R7QA 2ZJPF 3WTWC 3RIRA 2DOFA 1WJAA 3S32A 2O03A 2W82A 2W24A 1BW6A 4MNUA 4UY8I 3JAMK 2HR3A 3ABLH 1N77A 1JJ8C 4GFBA 3FK7A 4RLFA 3AKZA 4A2UA 2ZBKA 3CUOA 3UKGA 5FRMA 4AIKA 1FSHA 1QU3A 3H0GJ 3C1DA 4ZTFA 5DTDA 4A3KJ 1FEXA 4FE4A 2KLOA 1RI7A 2LREA 4N4OB 4UHTA 2LP0A 2DMUA 3I53A 1U9NA 2E5ZA 1SFUA 1YW9A 4I01A 3ZQQA 1Y6IA 2E2HJ 1YS6A 3GBGA 3KLOA 5FFXA 5J8CA 5M3FJ 3V4GA 3GUDA 3EUHC 2O61A 3BTLA 3E5UA 4AC0A 2VKEA 4BXFA 4YELA 2LTPA 2DT7B 3Q0UA 5AIQA 4M9SA 1VFCA 2A68F 5EZHA 2DK8A 1K4TA 4ZC3A 1MJBA 2Q2EB 3D0SA 5BPDA 2V6EA 1N78A 3BC8A 2ME6A 1H9GA 2BE5F 5KAIC 1TQPA 2WADA 1HKQA 4DZJA 4UV8A 3BR3A 2HI3A 2NOJB 4RB0A 1CF7B 5E3NA 1RR7A 2OC6A 3GWZA 1MZBA 3PNVA 1X4OA 3F8NA 5HVQC 2BY3A 5TGTA 4A3FJ 4WXCA 1VQ8I 1U2WA 2ZJ2A 3A0BC 3SHFA 2HU9A 5E17F 4I09A 3RJPA 4FETA 3HDDA 1S9HA 4M3EA 3FBIB 4C3HJ 3CCVI 4IXAA 3RYRA 2DXIA 2JSPA 1SEUA 2MW8A 4RLQA 1ENHA 5DUIA 2R7ZJ 1FYLA 3FZVA 3RPUA 3K9TA 3V42A 5B3SH 1YW7A 1VZ0A 1U5TB 4GGGA 5K5RA 5LGUA 3PIOF 3DPTA 1GDTA 1RIOH 5CVRA 2K85A 3ASNH 1MSEC 4BHBA 5DCMA 5A2QZ 5D4RA 5GPCA 4BDYA 1UHMA 4XKVA 5AIPA 2ESHA 1ODDA 3W2AA 2RKHA 9ANTA 2JZYA 4NB5A 3N97A 2HZTA 4U0WA 3ZCOA 1IV6A 1WWXA 4KMFA 1VQ6I 2M45A 3HTUA 2BY1A 2P0WA 4PSWA 5FD5A 4RB3C 3PNTA 3HXLA 4KN4X 5BOXA 4IKFA 3BG3A 2ZSHB 3BDDA 1U3EM 2ZJQF 3CJQB 4IZZA 4ZDOA 3TW7A 4NHJA 3OR1C 2F4OB 1ZTRA 2XSJC 2CU7A 1NHAA 1RUNA 1MJ9A 1YFHA 4IHWA 2X6XA 1LDKB 1A5JA 1KA8A 4PZJA 4Q4ZF 2O0YA 4O6JA 3MKZA 4YIRX 3F6OA 3ZQIA 2V1NA 3C7JA 5EG0B 6PAXA 1QO0D 3F3XA 2EFQA 3ELKA 2O6GE 4A3LJ 3CCSI 5HODA 2VI6A 3M3YJ 4FTHA 1DQUA 2B9SA 3N4MA 2CQKA 1BA5A 2F4IA 3GFJA 4BQOA 3OYNA 2W4SA 4EJWA 3KIOA 5EYRA 1FOWA 3FM5A 3LWFA 1SMTA 3BJAA 3GFLA 5HNHA 5K7HA 3WG7H 3KFWX 2DFHA 1QGPA 2KKOA 3QYFA 2K9QA 2A5YB 2KISA 3FXMA 5IY5H 3OYFA 1T33A 2DYSH 1HLVA 3S1QJ 1HQCA 2CFXA 2KT0A 4BDZA 4P5OA 4ENJA 4XBFA 3MWMA 1NH3A 2YR2A 2LH9A 2JA7J 4IO9F 2Z99A 2VBZA 2FOWA 4Q48A 3MN2A 4XLHA 3I54A 5IOYA 2QZ8A 2LVSA 1USTA 4ZYHA 2EILH 3DKYA 2X6YA 1OCPA 2E60A 1U78A 2WWYA 1GHCA 3S3OA 4MTEA 4HF0A 1AKHB 1B8IB 5FLVA 1G3YA 2V26A 3IL2A 3WODF 4XRSA 2XAGA 2JQ7A 3FXLA 2CYYA 4BHPA 3E5XA 4OIPF 2KP6A 2W00A 1WCMJ 1OKRA 1IF1A 3TGNA 2JSCA 2YX7A 2M4KA 4HEA2 4YG2F 1QNTA 4FHTA 2K3FA 5ILVA 2HQRA 2M7BA 4M6XA 5ERIA 4CSWA 2XV4S 3CJRB 5KAFC 3EYIA 4HLYA 5LGTA 5D5XB 2W7NA 2DYRH 1XG1A 2ISYA 3CCLI 2WA0A 5CKTA 1T0FC 4A3DJ 5JLWA 2CW8A 2P8TA 1FT9A 3W6VA 5ILUA 3IKTA 1QVTA 2VPLA 2HXOA 3GLLA 3RSNA 3ERED 4XICA 2K7LA 5CVIA 1IUFA 3QODA 2EINH 2G7UA 1K78B 4LB5A 2PX9A 3DPUA 2DJIA 1W7PA 3KEOA 4XRMA 3BR6A 3NWSA 3R61A 3ERMA 2PMHA 3BLYA 3DBRB 2LY9A 2H27A 3WTUC 2Y2ZA 4XOTA 1XGSA 3GF2A 3M1CA 5B5EC 2IXSA 1HKSA 3CESA 5EF6A 3PO3J 3H5NA 1Q1HA 2DPDA 2HDWA 3HM5A 4ON0A 3HYIA 3HSFA 3HHHA 3HBLA 3MEXA 3UNGC 2EJRA 3GYHX 5L3EA 4D7MA 2HKXA 4JYKA 2WY7Q 5ED4A 5CJ9A 3CJTB 5KHDA 1ETYA 4L5JA 1X3ZB 5L3CA 1MD0A 2F4MB 1IDZA 4PJMA 4A0YA 3BG7A 2GIZA 2K9MA 5FROA 4DZPA 2DA6A 3K1NA 2K4JA 3TP0A 1JGSA 1FIPA 1Y1VJ 5CQGA 2BXYA 2L4MA 1IZ1A 3F8CA 4L18B 3GTMJ 1U8BA 2DMNA 3FMQA 2H6BA 3T0YA 2QCOA 1W36D 2VONA 5FB2A 2AQFA 2XF5A 3F21A 4HV5A 3JR9A 2IS1A 4NQWB 3E1SA 4ZYAA 2NVTJ 5ICEA 1W5TA 2AXLA 3PSIA 5DM7F 2OTLI 2XUBA 4G8XA 1Y0NA 4BJ6C 5J47A 3FHNA 2DA1A 3HOYJ 2D2WA
chains in the Genus database with same CATH topology
1SD7A 1TLHB 1BOAA 1XSDA 4IJAA 2F5EA 1IXRC 4MTDA 2STWA 1I1GA 4H0EA 3RPQA 4LMYA 5HS7A 2FE3A 3WE2A 4G94A 3ZN1A 2V79A 5DD8A 1R36A 2QLZA 3HOSA 2ZMEB 3OOPA 3VOEA 4P9FA 1J75A 4FX4A 2C6YA 4KYWA 2MH2A 1KYWA 3F22A 5IT3A 3ZPLA 4RAZA 4IF4A 3GZ6A 2MD5A 4LG0B 1B6AA 3SFZA 2DT5A 4BHCA 2P6TA 2UWMA 4OU0A 1SAXA 3HOTA 2OA4A 1A04A 1XB4A 4B8XA 4G6QA 4AIJA 1WQ2A 3OV8A 4EMSA 2HS5A 2KJBA 3FWEA 2FU4A 4OIQF 2L02A 4P9UA 2EB7A 1Z9CA 1MGTA 4U7DA 4JQFA 2V1XA 2OU2A 3CUQA 4N9IA 1S29A 3TO9A 1R5GA 4JBAA 1G3SA 5DCFA 4HDUA 3E3VA 1H0MA 1KU2A 2L01A 3IWZA 1BI1A 1FOKA 4XLNF 1MKMA 3C18A 3K1PA 1JHHA 2K86A 1ZRDA 3R6SA 4Q5SF 1ZARA 4I7HA 3SQNA 2NS0A 5FO5A 3QU3A 4FT8A 1OYYA 2RQPA 2GQQA 1S6LA 4LLGF 1SD4A 4Y17A 1SFXA 3S2WA 1FBQA 4KUMA 3MFKA 4ESJA 4AD9A 1J9IA 2F5DA 3TDUC 1FP1D 2ZCWA 1O3SA 1UHWA 4R1HA 4ENNA 2EWNA 4CXFA 3HRMA 1O7FA 1I6XA 1FNNA 1ZLKA 4L9JA 2TDXA 3F23A 4Q47A 2QVOA 2EK5A 4XSXF 1IN7A 1C0WA 1TBXA 2ZFWA 2OQGA 3EUHA 4ENMA 4L0ZB 2IRFG 5HS9A 3V8KA 1XN7A 5EEGA 4EQQA 5HLHA 1GXPA 2Z3YA 4WX9A 4M71A 1RNLA 1P92A 2DU9A 1BC8C 2DPUA 2X0LA 1YLFA 2FOKA 2P6SA 2RC4A 3WTTC 1J59A 3J7AO 2DO7A 2P5KA 2R3SA 1F9NA 3TO6A 2YX4A 2R7DA 5LEKA 1ON1A 4HBLA 3KCCA 3M7GA 3K1MA 3WTSC 2HTSA 1XGMA 4U0VA 3V7RA 1IW7F 5JI6A 3KP6A 1Z1DA 5K1YA 1R58A 1QZYA 4HOBA 3ECOA 5J6XA 4EJVA 3WTXC 3U1DA 4CZZA 2XAFA 2O3FA 2EFWA 3KP2A 3VODA 1KQ0A 4KN7X 3WU0A 5DD4A 1EH7A 5BPIA 4DQ2A 5LRSA 2BGCA 2VOOA 2Q8KA 5ICFA 3SHFA 1XGNA 4HQMA 2CSOA 2CG4A 2FRHA 2Y75A 3TO7A 4EJOA 2LSOA 5DV5A 4JK1X 2NYXA 2W85A 2HYFA 1BC7C 1FP2A 3BJOA 4MHGA 2ACJA 3HTSB 1J2XA 2GAUA 4EM0B 3LQRA 2P5LC 4KIGA 3DF8A 2Y0MA 2E1NA 2KRFA 3TQNA 2VE8A 3V8JA 2DFIA 2JPCA 1FSEA 5LHIA 1XGOA 2PG4A 3T8RA 4HX8A 4ZYEA 3EQLF 5BS6A 1ONVA 1PP7U 5FD6A 4U7BA 5DUKA 4ENKA 3LAJA 1S8NA 3O3KA 4KIFA 2CW0F 4WF2A 3WU1B 1REPC 4PCQA 2VT2A 2HGCA 2OQRA 2RV8A 3Q9SA 4LJZF 3DKWA 3EETA 3JTGA 2H09A 2WC2A 4DNCA 3BROA 1T0FA 2NNNA 3ZMZA 2CO5A 2VBYA 3I64A 4KIBA 5LHGA 2FEZA 1IXSB 4N9HA 1MDMA 1T39A 3LAPA 1LEAA 3U2RA 3JSOA 1PUEE 4L9VA 2VN2A 3V7CA 2G9WA 4CICA 2RGVA 2OD5A 5H6RA 1Z6TA 4UV9A 2BBYA 3E5QA 2E1CA 1V3FA 4WWCA 5E8IA 4RGXA 3P7NA 2ISZA 1HSTA 5E8GA 1O7LA 2QM3A 2HDCA 1IRGA 3WE3A 3W6KB 2OZUA 1P4AA 4KA4A 5E1ZB 4ZH4F 1TW2A 1ZN2A 2FBIA 1AOYA 1ZG1A 5ICCA 3MQ0A 4CO8A 1QBJA 3H92A 3C3WA 1BI0A 4BH9A 3F72A 4S05A 1HKTA 1IAWA 1EH8A 3T5XA 3QPHA 2FSWA 1XSVA 2WV0A 3KP7A 3PFIA 2LKPA 3W6JB 1WRJA 3J80K 1T6SA 2B0LA 2EA4A 4HW0A 4KFCA 5H20A 3FXRA 2VE9A 5FFZA 1ZH5A 3HRTA 1ON2A 3MAJA 4EVIA 5TJJA 3LSTA 2L54A 1ZG3A 2PN6A 2ELHA 2XIGA 2V1UA 4HYEA 1FYKA 1FY7A 2VBWA 2FBKA 1O3TA 2M87A 2F5CA 1D8JA 3GO5A 3H3ZA 2P5VA 1WSUA 4YFXF 2DW4A 2FMLA 4HV6A 2J5PA 4A6EA 3I59A 4HLXA 3ZMSA 1YO5C 2V6CA 2M8EA 2IA1A 2IW5A 3CO7C 2O8XA 5KVRA 1FBUA 3R0JA 1F4KA 2VT3A 1W7PD 3LFKA 2VC0A 2VC1A 1SMYF 1S7AA 1R1VA 2A61A 3NRVA 4EJTA 2Q2EA 3BP8A 3F8FA 2OAZA 4P96A 2PEXA 3ZMDA 3J81K 1OYWA 1CF7A 1HW2A 3HRSA 2KJCA 1U6GA 4IVNA 1LDDA 2GIVA 2PMUA 2NNYA 4I0AA 4LFUA 5JFRA 2LNBA 4YFNF 4OOIA 1QQIA 4AIHA 1FWZA 1B4AA 1IN4A 1TQIA 3ABUA 5CVVA 1E2XA 1OYIA 1WKMA 4WXDA 1BJAA 3KZYA 1OMIA 2XASA 5EEHA 4G7HF 3DP7A 3B73A 2EV0A 4L9NA 3DV8A 2VXZA 1O57A 2FQ3A 2RDPA 2Y48A 3L2CA 3EDPA 3HSEA 3D5LA 5DDGA 4UNOA 3MZYA 1XMAA 2YSRA 5L3GA 2HEOA 2IPQX 4M74A 4ETSA 5D5WB 1XSXA 5HDNA 3KEQA 2DQLA 3TOBA 4HAMA 3TKYA 1D5VA 1DP7P 3E6BA 2XAQA 1DDNA 2QQBA 3DEUA 4UVBA 4ESBA 1P2FA 4EGYA 1G4DA 2QBYB 2K27A 4A0ZA 4CHUA 2XKOA 4WCGA 1HXDA 3RYPA 1T98A 4RAYA 1TW3A 1BI2A 4RB1A 5CVUA 1L3LA 4KICA 5BMZA 4GYGA 5BQTA 1QZZA 4EM1A 1IXCA 1K7AA 5D5VB 3GEZA 1ZGJA 4EJUA 2QENA 4HX7A 4WXHA 1ZRFA 3CDHA 3L7WA 3P9KA 3CO6C 1U5TC 3B02A 2XAHA 1X3UA 2P7CB 1KQ9A 3SZPA 3IRQA 5HS8A 2Z9OA 3REOA 1YS7A 3O6BB 4PDKA 1B1BA 3FF5A 4A0XA 2DK5A 5E18F 4IHTA 5K5QA 2GXGA 1HSJA 5L3DA 3L09A 4AVPA 3WGIA 1K78A 3R60A 5IT9Z 2RN7A 2FF4A 2MLKA 1CGPA 2MC3A 5DCMB 1FPQA 4GCVA 1D8KA 2FXAA 3LQQA 4I0BA 1IN8A 2EFOA 2RVCA 1JXSA 1V4RA 1ZG5A 3V8LA 2Z33A 2ZO4A 1F5TA 2JT1A 2AS5F 3T1BA 2V1DA 5F64A 3WTVC 4ZYGA 4AWXB 5IT9K 2EA2A 2VODA 1YTYA 2HTJA 2IT0A 3WTYC 3ISPA 3DXJF 4NQWA 4OMZA 5HLIA 2P7VB 4RB2C 1YYVA 3IKVA 4EV0A 4O3MA 5D6FA 2JTVA 1STZA 2DLLA 3CJNA 2LF7A 1LB2A 1GXQA 3CLOA 3TOAA 2IVMA 4QWQA 3FXQA 4MEYF 4M9XA 1XCBA 3IHUA 1FBSA 2E7WA 3BOQA 2UZKA 3GX4X 3TDZC 2XAJA 3ABTA 1QPMA 1OR7A 4MQ9F 4ZZDA 3E97A 3F8BA 4OIOF 2ZMEA 3KP4A 3VEPA 4KT5C 3ECHA 2XRNA 3IWFA 1T2KA 2BYVE 1FC3A 1UCRA 3KETA 2HFHA 4ESFA 1ZYRF 5ILSA 2D1VA 4G6DA 3MZHA 1I5ZA 4LD5A 1IN5A 4LGWA 4RGRA 2WTEA 3DFGA 4F7ZA 4BQAA 1XDUA 4I98B 3WGGA 3SXYA 1KQ8A 3E6MA 1DPRA 2DAOA 3GZ5A 1G3WA 3HSRA 4G7ZF 1Z91A 3QP6A 5HDKA 2XROA 1XCVA 2UXXA 3M8FA 1SFEA 1F1ZA 2PJPA 3AAFA 1RUOA 5LHHA 3BZ6A 2HQNA 2HKOA 2MA3A 4L9TA 1Y0UA 2F5FA 1W7PB 3HRUA 3ZQ7A 3BJ6A 3QU6A 4LLNA 2IA0A 3IC7A 2XVCA 3I59B 4PGHA 4RS8A 4Y15A 3R4KA 1Z05A 3ZMUA 2DBBA 4M72A 4EGZA 4R79A 1D3YA 2K4BA 2DTRA 2Q0OA 2L3DA 2PBIA 1EV7A 2QYOA 3FXUA 2MH9A 1LQ1A 3E6DA 1BBYA 1KGSA 1TQMA 2H94A 2D45A 3ZP5A 2HWVA 3RTRA 2W57A 4UVAA 2GA1A 2STTA 3R0AA 4LK0F 4LLLA 1ZAOA 3GXOA 4HQEA 2W25A 3DPLC 4ZZLA 1LEBA 3M9AA 2A07F 5D6EA 1EH6A 3RKXA 3K69A 3KZZA 5TRDA 1K79A 3BY6A 4N0BA 5D5UB 2XGXA 3KE2A 2A69F 4QLCU 1O3QA 5D8LB 2A3SA 2YU3A 1OPCA 3PQJA 4GYIA 1H9TA 5ICGA 4G7OF 1BIBA 2H6CA 5A2QK 1R7JA 3SZTA 1FX7A 3V7SA 1WI9A 1R22A 1FZPB 3ML6A 5FGMA 3HHGA 4O5VA 1BIAA 3J80Z 4GXOA 1XMKA 2R7FA 5E1WA 5DEQA 5JHUA 4OIRF 2JPBA 1R5HA 2XHKA 3VB2A 4HF2A 5E20A 1T38A 1HBXG 2M1BA 5LLQA 1GVJA 1KU9A 2GA2A 3QRFF 2ZXJA 1R1TA 2YPRA 4A12A 2LF8A 2X4HA 4HA8A 5AONA 3FMRA 1TNTA 1KYZA 3CUQB 4E70A 3LA2A 5L3FA 3P9CA 4D0PA 3L9FA 3LA3A 2IJLA 3GFIA 5HOOA 4YIIA 4UVCA 4L0YB 4P55A 5F6FA 1P6RA 4FX0A 4LK1F 3FM3A 4Y13A 2MLGA 2FBHA 4A6DA 4CYDA 1Z7UA 3GLXA 1W4MA 2E7XA 2ZNYA 1S3JA 1BI3A 3Q9VA 3BPVA 3G3ZA 1DUXC 1W5SA 3ULQB 2FNAA 3I5UA 1R1UA 3JSPA 3WGHA 4OMYA 3KP3A 3GFMA 3J81Z 4A5MA 1USSA 5F1RA 2GXBA 2EV6A 4M6YA 3F6VA 3RKYA 4TV7A 4ASNA 3NEUA 3G73A 2FA5A 2PI0A 5D8KB 3K2ZA 2EFNA 2CGPA 1RZ4A 4RGSA 4MQVA 3GW2A 1G6NA 3JW4A 4CGZA 1ZHFA 1U5TA 1J7KA 2VBXA 2A6EF 4G9YA 3ZN0A 3T8TA 4I2OA 1TNSA 4BYYA 2HYGD 3I4PA 5CVJA 4WK8F 4OINF 3RDIA 1JHFA 1IRFA 3FMSA 4I02A 1K6OA 1P4XA 2P4WA 3KLNA 2IP2A 4HZFA 1MJAA 1R00A 4M73A 2KIFA 3O2PE 5D4SA 4KMUX 2IA2A 2L4AA 2M5WA 1E17A 2Z5UA 5KK1A 2DI3A 1ZLJA 4XLPF 2GZWA 3WTZA 2CWEA 1S7OA 1YQAA 5FLXZ 4IRIA 1KU3A 4R8HA 2V9VA 2FNPA 1XDSA 1LJ9A 1P4WA 5CLSA 2RNJA 4B09A 2OBPA 4BAYA 2A6HF 3F8MA 5HDGA 3LA7A 4KNYA 1B9NA 2BEOA 1XD7A 3ZMTA 4MGRA 3M1EA 4HF1A 1LVAA 4IPAA 2PLYA 2NRAC 4A5NA 5FLXK 4HDVA 3QOPA 4XSZF 3U9GA 1O3RA 3E6CC 4RGUA 5K5OA 3BWGA 3QAHA 1IN6A 2W84A 1I1SA 3HIFA 4UUVA 3DQVC 4M9ZA 1G3TA 5L3BA 1PP8F 3KP5A 5HLGA 2ADUA 2XKPA 4UXNA 3HUGA 4GO1A 2HOEA 2UXNA 5E1XA 1FLIA 4Z2YA 3K0LA 3RI4A 5LEJA 4YIFA 2QUFA 4IHSA 3Q5FA 1KU7A 1R23A 1B9MA 5LBQA 2ZNZA 3EYYA 2LDUA 3NQOA 2ESNA 3CTAA 4BNCA 2EFPA 2PQ8A 3I58A 4CDGA 1BM9A 3COAC 1TTYA 3WG9A 5JR3A 1I27A 5J8FA 1HW5A 4U88A 4S04A 1J5YA 1SD5A 1YIOA 2OZ6A 3M8EA 5LGNA 4IRGA 3QP5A 2NAZA 3VFZA 3JTHA 2KIUA 3ROUA 2J5OA 2DQRA 1PDNC 1YW8A 1MDMB 5H6QA 1SD6A 3ZMVA 4IRHA 2VOPA 1UB9A 3H3UA 1JE8A 3PQKA 4LB6B 1LNWA 1UFMA 1IUYA 1B59A 2QQAA 2FMYA 1ZREA 1Z6RA 3I71A 1ULYA 3QPTA 2JRTA 2G7HA 1BN5A 1DPUA 2BV6A 2ETHA 4ZYDA 4HX4A 1LDJA 3CUQC 2GWRA 3I0TA 1FYMA 4MEXF 4L5IA 4K2EA 1ZGAA 1VTNC 4PGGA 5CYVA 2M30A 3BPXA 3L00A 2F2EA 4U0YA 5DYMA 1AWCA 4LG0A 2PFBA 3FHZA 2COMA 2QQ9A 3FX3A 3IRRA 2EV5A 3JAMZ 4BXUA 2KIMA 1HW1A 2MBFA 2K02A 2QBYA 4XRFA 3P9IA 1J0RA 1ZRCA 4EM2A 1L0OC 3RKWA 2ZKZA 5JVTA 1U8RA 4KDPA 1YG2A 2QWWA 2D1HA 3GVAA 4YFKF 5LRRA 3WTWC 3RIRA 2O03A 2W24A 4MNUA 3JAMK 2HR3A 4A2UA 2ZBKA 3CUOA 4AIKA 1FSHA 3C1DA 1RI7A 4UHTA 3I53A 1SFUA 1YW9A 4I01A 1YS6A 5FFXA 3KLOA 5J8CA 3V4GA 3GUDA 2O61A 3E5UA 5AIQA 4M9SA 2A68F 2DK8A 1MJBA 3D0SA 5BPDA 1H9GA 2BE5F 1TQPA 1HKQA 4UV8A 4RB0A 1CF7B 3GWZA 1MZBA 5HVQC 3F8NA 4WXCA 1U2WA 2ZJ2A 5E17F 4I09A 3RJPA 4IXAA 3RYRA 5DUIA 1FYLA 3RPUA 3K9TA 1YW7A 1U5TB 4GGGA 5K5RA 5LGUA 3DPTA 1RIOH 5CVRA 4BHBA 5DCMA 5A2QZ 5D4RA 1UHMA 5AIPA 2ESHA 1ODDA 2RKHA 2JZYA 4NB5A 3N97A 2HZTA 4U0WA 1WWXA 4KMFA 2M45A 3HTUA 5FD5A 4RB3C 4KN4X 5BOXA 3BDDA 1U3EM 4NHJA 1NHAA 1RUNA 1MJ9A 1YFHA 1LDKB 1KA8A 4PZJA 4Q4ZF 2O0YA 4O6JA 3F6OA 3C7JA 6PAXA 1QO0D 3F3XA 2EFQA 3ELKA 2O6GE 3N4MA 2CQKA 3GFJA 4EJWA 3FM5A 3LWFA 1SMTA 3BJAA 3GFLA 3KFWX 1QGPA 2KKOA 2A5YB 1HQCA 2CFXA 4P5OA 4ENJA 4XBFA 3MWMA 2YR2A 2Z99A 2VBZA 4Q48A 3I54A 2QZ8A 1USTA 4ZYHA 1U78A 2WWYA 1GHCA 4MTEA 4HF0A 1G3YA 3IL2A 3WODF 2XAGA 2CYYA 4BHPA 3E5XA 4OIPF 1OKRA 1IF1A 3TGNA 2JSCA 2YX7A 4YG2F 1QNTA 4FHTA 5ILVA 2HQRA 4M6XA 5ERIA 2XV4S 3EYIA 4HLYA 5LGTA 5D5XB 2ISYA 2P8TA 1FT9A 3IKTA 5ILUA 3ERED 2K7LA 5CVIA 2G7UA 1K78B 4LB5A 1W7PA 3KEOA 3R61A 2PMHA 2H27A 3WTUC 1XGSA 3GF2A 1HKSA 1Q1HA 2DPDA 4ON0A 3HYIA 3HSFA 3HHHA 3MEXA 2EJRA 3GYHX 5L3EA 2HKXA 5ED4A 5CJ9A 4L5JA 5L3CA 1MD0A 4A0YA 3K1NA 2K4JA 1JGSA 2L4MA 1IZ1A 3F8CA 4L18B 3FMQA 2H6BA 3T0YA 2VONA 5FB2A 3F21A 4HV5A 5ICEA 1W5TA 2AXLA 2XUBA 4G8XA 2D2WA 3MCZA 3FZVA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1SD7 A;  1TLH B;  1BOA A;  1XSD A;  4IJA A;  2F5E A;  1IXR C;  4MTD A;  2STW A;  1I1G A;  4H0E A;  3RPQ A;  4LMY A;  5HS7 A;  2FE3 A;  3WE2 A;  4G94 A;  3ZN1 A;  2V79 A;  5DD8 A;  1R36 A;  2QLZ A;  3HOS A;  2ZME B;  3OOP A;  3VOE A;  4P9F A;  1J75 A;  4FX4 A;  2C6Y A;  4KYW A;  2MH2 A;  1KYW A;  3F22 A;  5IT3 A;  3ZPL A;  4RAZ A;  4IF4 A;  3GZ6 A;  2MD5 A;  4LG0 B;  1B6A A;  3SFZ A;  2DT5 A;  4BHC A;  2P6T A;  2UWM A;  4OU0 A;  1SAX A;  3HOT A;  2OA4 A;  1A04 A;  1XB4 A;  4B8X A;  4G6Q A;  4AIJ A;  1WQ2 A;  3OV8 A;  4EMS A;  2HS5 A;  2KJB A;  3FWE A;  2FU4 A;  4OIQ F;  2L02 A;  4P9U A;  2EB7 A;  1Z9C A;  1MGT A;  4U7D A;  4JQF A;  2V1X A;  2OU2 A;  3CUQ A;  4N9I A;  1S29 A;  3TO9 A;  1R5G A;  4JBA A;  1G3S A;  5DCF A;  4HDU A;  3E3V A;  1H0M A;  1KU2 A;  2L01 A;  3IWZ A;  1BI1 A;  1FOK A;  4XLN F;  1MKM A;  3C18 A;  3K1P A;  1JHH A;  2K86 A;  1ZRD A;  3R6S A;  4Q5S F;  1ZAR A;  4I7H A;  3SQN A;  2NS0 A;  5FO5 A;  3QU3 A;  4FT8 A;  1OYY A;  2RQP A;  2GQQ A;  1S6L A;  4LLG F;  1SD4 A;  4Y17 A;  1SFX A;  3S2W A;  1FBQ A;  4KUM A;  3MFK A;  4ESJ A;  4AD9 A;  1J9I A;  2F5D A;  3TDU C;  1FP1 D;  2ZCW A;  1O3S A;  1UHW A;  4R1H A;  4ENN A;  2EWN A;  4CXF A;  3HRM A;  1O7F A;  1I6X A;  1FNN A;  1ZLK A;  4L9J A;  2TDX A;  3F23 A;  4Q47 A;  2QVO A;  2EK5 A;  4XSX F;  1IN7 A;  1C0W A;  1TBX A;  2ZFW A;  2OQG A;  3EUH A;  4ENM A;  4L0Z B;  2IRF G;  5HS9 A;  3V8K A;  1XN7 A;  5EEG A;  4EQQ A;  5HLH A;  1GXP A;  2Z3Y A;  4WX9 A;  4M71 A;  1RNL A;  1P92 A;  2DU9 A;  1BC8 C;  2DPU A;  2X0L A;  1YLF A;  2FOK A;  2P6S A;  2RC4 A;  3WTT C;  1J59 A;  3J7A O;  2DO7 A;  2P5K A;  2R3S A;  1F9N A;  3TO6 A;  2YX4 A;  2R7D A;  5LEK A;  1ON1 A;  4HBL A;  3KCC A;  3M7G A;  3K1M A;  3WTS C;  2HTS A;  1XGM A;  4U0V A;  3V7R A;  1IW7 F;  5JI6 A;  3KP6 A;  1Z1D A;  5K1Y A;  1R58 A;  1QZY A;  4HOB A;  3ECO A;  5J6X A;  4EJV A;  3WTX C;  3U1D A;  4CZZ A;  2XAF A;  2O3F A;  2EFW A;  3KP2 A;  3VOD A;  1KQ0 A;  4KN7 X;  3WU0 A;  5DD4 A;  1EH7 A;  5BPI A;  4DQ2 A;  5LRS A;  2BGC A;  2VOO A;  2Q8K A;  5ICF A;  3SHF A;  1XGN A;  4HQM A;  2CSO A;  2CG4 A;  2FRH A;  2Y75 A;  3TO7 A;  4EJO A;  2LSO A;  5DV5 A;  4JK1 X;  2NYX A;  2W85 A;  2HYF A;  1BC7 C;  1FP2 A;  3BJO A;  4MHG A;  2ACJ A;  3HTS B;  1J2X A;  2GAU A;  4EM0 B;  3LQR A;  2P5L C;  4KIG A;  3DF8 A;  2Y0M A;  2E1N A;  2KRF A;  3TQN A;  2VE8 A;  3V8J A;  2DFI A;  2JPC A;  1FSE A;  5LHI A;  1XGO A;  2PG4 A;  3T8R A;  4HX8 A;  4ZYE A;  3EQL F;  5BS6 A;  1ONV A;  1PP7 U;  5FD6 A;  4U7B A;  5DUK A;  4ENK A;  3LAJ A;  1S8N A;  3O3K A;  4KIF A;  2CW0 F;  4WF2 A;  3WU1 B;  1REP C;  4PCQ A;  2VT2 A;  2HGC A;  2OQR A;  2RV8 A;  3Q9S A;  4LJZ F;  3DKW A;  3EET A;  3JTG A;  2H09 A;  2WC2 A;  4DNC A;  3BRO A;  1T0F A;  2NNN A;  3ZMZ A;  2CO5 A;  2VBY A;  3I64 A;  4KIB A;  5LHG A;  2FEZ A;  1IXS B;  4N9H A;  1MDM A;  1T39 A;  3LAP A;  1LEA A;  3U2R A;  3JSO A;  1PUE E;  4L9V A;  2VN2 A;  3V7C A;  2G9W A;  4CIC A;  2RGV A;  2OD5 A;  5H6R A;  1Z6T A;  4UV9 A;  2BBY A;  3E5Q A;  2E1C A;  1V3F A;  4WWC A;  5E8I A;  4RGX A;  3P7N A;  2ISZ A;  1HST A;  5E8G A;  1O7L A;  2QM3 A;  2HDC A;  1IRG A;  3WE3 A;  3W6K B;  2OZU A;  1P4A A;  4KA4 A;  5E1Z B;  4ZH4 F;  1TW2 A;  1ZN2 A;  2FBI A;  1AOY A;  1ZG1 A;  5ICC A;  3MQ0 A;  4CO8 A;  1QBJ A;  3H92 A;  3C3W A;  1BI0 A;  4BH9 A;  3F72 A;  4S05 A;  1HKT A;  1IAW A;  1EH8 A;  3T5X A;  3QPH A;  2FSW A;  1XSV A;  2WV0 A;  3KP7 A;  3PFI A;  2LKP A;  3W6J B;  1WRJ A;  3J80 K;  1T6S A;  2B0L A;  2EA4 A;  4HW0 A;  4KFC A;  5H20 A;  3FXR A;  2VE9 A;  5FFZ A;  1ZH5 A;  3HRT A;  1ON2 A;  3MAJ A;  4EVI A;  5TJJ A;  3LST A;  2L54 A;  1ZG3 A;  2PN6 A;  2ELH A;  2XIG A;  2V1U A;  4HYE A;  1FYK A;  1FY7 A;  2VBW A;  2FBK A;  1O3T A;  2M87 A;  2F5C A;  1D8J A;  3GO5 A;  3H3Z A;  2P5V A;  1WSU A;  4YFX F;  2DW4 A;  2FML A;  4HV6 A;  2J5P A;  4A6E A;  3I59 A;  4HLX A;  3ZMS A;  1YO5 C;  2V6C A;  2M8E A;  2IA1 A;  2IW5 A;  3CO7 C;  2O8X A;  5KVR A;  1FBU A;  3R0J A;  1F4K A;  2VT3 A;  1W7P D;  3LFK A;  2VC0 A;  2VC1 A;  1SMY F;  1S7A A;  1R1V A;  2A61 A;  3NRV A;  4EJT A;  2Q2E A;  3BP8 A;  3F8F A;  2OAZ A;  4P96 A;  2PEX A;  3ZMD A;  3J81 K;  1OYW A;  1CF7 A;  1HW2 A;  3HRS A;  2KJC A;  1U6G A;  4IVN A;  1LDD A;  2GIV A;  2PMU A;  2NNY A;  4I0A A;  4LFU A;  5JFR A;  2LNB A;  4YFN F;  4OOI A;  1QQI A;  4AIH A;  1FWZ A;  1B4A A;  1IN4 A;  1TQI A;  3ABU A;  5CVV A;  1E2X A;  1OYI A;  1WKM A;  4WXD A;  1BJA A;  3KZY A;  1OMI A;  2XAS A;  5EEH A;  4G7H F;  3DP7 A;  3B73 A;  2EV0 A;  4L9N A;  3DV8 A;  2VXZ A;  1O57 A;  2FQ3 A;  2RDP A;  2Y48 A;  3L2C A;  3EDP A;  3HSE A;  3D5L A;  5DDG A;  4UNO A;  3MZY A;  1XMA A;  2YSR A;  5L3G A;  2HEO A;  2IPQ X;  4M74 A;  4ETS A;  5D5W B;  1XSX A;  5HDN A;  3KEQ A;  2DQL A;  3TOB A;  4HAM A;  3TKY A;  1D5V A;  1DP7 P;  3E6B A;  2XAQ A;  1DDN A;  2QQB A;  3DEU A;  4UVB A;  4ESB A;  1P2F A;  4EGY A;  1G4D A;  2QBY B;  2K27 A;  4A0Z A;  4CHU A;  2XKO A;  4WCG A;  1HXD A;  3RYP A;  1T98 A;  4RAY A;  1TW3 A;  1BI2 A;  4RB1 A;  5CVU A;  1L3L A;  4KIC A;  5BMZ A;  4GYG A;  5BQT A;  1QZZ A;  4EM1 A;  1IXC A;  1K7A A;  5D5V B;  3GEZ A;  1ZGJ A;  4EJU A;  2QEN A;  4HX7 A;  4WXH A;  1ZRF A;  3CDH A;  3L7W A;  3P9K A;  3CO6 C;  1U5T C;  3B02 A;  2XAH A;  1X3U A;  2P7C B;  1KQ9 A;  3SZP A;  3IRQ A;  5HS8 A;  2Z9O A;  3REO A;  1YS7 A;  3O6B B;  4PDK A;  1B1B A;  3FF5 A;  4A0X A;  2DK5 A;  5E18 F;  4IHT A;  5K5Q A;  2GXG A;  1HSJ A;  5L3D A;  3L09 A;  4AVP A;  3WGI A;  1K78 A;  3R60 A;  5IT9 Z;  2RN7 A;  2FF4 A;  2MLK A;  1CGP A;  2MC3 A;  5DCM B;  1FPQ A;  4GCV A;  1D8K A;  2FXA A;  3LQQ A;  4I0B A;  1IN8 A;  2EFO A;  2RVC A;  1JXS A;  1V4R A;  1ZG5 A;  3V8L A;  2Z33 A;  2ZO4 A;  1F5T A;  2JT1 A;  2AS5 F;  3T1B A;  2V1D A;  5F64 A;  3WTV C;  4ZYG A;  4AWX B;  5IT9 K;  2EA2 A;  2VOD A;  1YTY A;  2HTJ A;  2IT0 A;  3WTY C;  3ISP A;  3DXJ F;  4NQW A;  4OMZ A;  5HLI A;  2P7V B;  4RB2 C;  1YYV A;  3IKV A;  4EV0 A;  4O3M A;  5D6F A;  2JTV A;  1STZ A;  2DLL A;  3CJN A;  2LF7 A;  1LB2 A;  1GXQ A;  3CLO A;  3TOA A;  2IVM A;  4QWQ A;  3FXQ A;  4MEY F;  4M9X A;  1XCB A;  3IHU A;  1FBS A;  2E7W A;  3BOQ A;  2UZK A;  3GX4 X;  3TDZ C;  2XAJ A;  3ABT A;  1QPM A;  1OR7 A;  4MQ9 F;  4ZZD A;  3E97 A;  3F8B A;  4OIO F;  2ZME A;  3KP4 A;  3VEP A;  4KT5 C;  3ECH A;  2XRN A;  3IWF A;  1T2K A;  2BYV E;  1FC3 A;  1UCR A;  3KET A;  2HFH A;  4ESF A;  1ZYR F;  5ILS A;  2D1V A;  4G6D A;  3MZH A;  1I5Z A;  4LD5 A;  1IN5 A;  4LGW A;  4RGR A;  2WTE A;  3DFG A;  4F7Z A;  4BQA A;  1XDU A;  4I98 B;  3WGG A;  3SXY A;  1KQ8 A;  3E6M A;  1DPR A;  2DAO A;  3GZ5 A;  1G3W A;  3HSR A;  4G7Z F;  1Z91 A;  3QP6 A;  5HDK A;  2XRO A;  1XCV A;  2UXX A;  3M8F A;  1SFE A;  1F1Z A;  2PJP A;  3AAF A;  1RUO A;  5LHH A;  3BZ6 A;  2HQN A;  2HKO A;  2MA3 A;  4L9T A;  1Y0U A;  2F5F A;  1W7P B;  3HRU A;  3ZQ7 A;  3BJ6 A;  3QU6 A;  4LLN A;  2IA0 A;  3IC7 A;  2XVC A;  3I59 B;  4PGH A;  4RS8 A;  4Y15 A;  3R4K A;  1Z05 A;  3ZMU A;  2DBB A;  4M72 A;  4EGZ A;  4R79 A;  1D3Y A;  2K4B A;  2DTR A;  2Q0O A;  2L3D A;  2PBI A;  1EV7 A;  2QYO A;  3FXU A;  2MH9 A;  1LQ1 A;  3E6D A;  1BBY A;  1KGS A;  1TQM A;  2H94 A;  2D45 A;  3ZP5 A;  2HWV A;  3RTR A;  2W57 A;  4UVA A;  2GA1 A;  2STT A;  3R0A A;  4LK0 F;  4LLL A;  1ZAO A;  3GXO A;  4HQE A;  2W25 A;  3DPL C;  4ZZL A;  1LEB A;  3M9A A;  2A07 F;  5D6E A;  1EH6 A;  3RKX A;  3K69 A;  3KZZ A;  5TRD A;  1K79 A;  3BY6 A;  4N0B A;  5D5U B;  2XGX A;  3KE2 A;  2A69 F;  4QLC U;  1O3Q A;  5D8L B;  2A3S A;  2YU3 A;  1OPC A;  3PQJ A;  4GYI A;  1H9T A;  5ICG A;  4G7O F;  1BIB A;  2H6C A;  5A2Q K;  1R7J A;  3SZT A;  1FX7 A;  3V7S A;  1WI9 A;  1R22 A;  1FZP B;  3ML6 A;  5FGM A;  3HHG A;  4O5V A;  1BIA A;  3J80 Z;  4GXO A;  1XMK A;  2R7F A;  5E1W A;  5DEQ A;  5JHU A;  4OIR F;  2JPB A;  1R5H A;  2XHK A;  3VB2 A;  4HF2 A;  5E20 A;  1T38 A;  1HBX G;  2M1B A;  5LLQ A;  1GVJ A;  1KU9 A;  2GA2 A;  3QRF F;  2ZXJ A;  1R1T A;  2YPR A;  4A12 A;  2LF8 A;  2X4H A;  4HA8 A;  5AON A;  3FMR A;  1TNT A;  1KYZ A;  3CUQ B;  4E70 A;  3LA2 A;  5L3F A;  3P9C A;  4D0P A;  3L9F A;  3LA3 A;  2IJL A;  3GFI A;  5HOO A;  4YII A;  4UVC A;  4L0Y B;  4P55 A;  5F6F A;  1P6R A;  4FX0 A;  4LK1 F;  3FM3 A;  4Y13 A;  2MLG A;  2FBH A;  4A6D A;  4CYD A;  1Z7U A;  3GLX A;  1W4M A;  2E7X A;  2ZNY A;  1S3J A;  1BI3 A;  3Q9V A;  3BPV A;  3G3Z A;  1DUX C;  1W5S A;  3ULQ B;  2FNA A;  3I5U A;  1R1U A;  3JSP A;  3WGH A;  4OMY A;  3KP3 A;  3GFM A;  3J81 Z;  4A5M A;  1USS A;  5F1R A;  2GXB A;  2EV6 A;  4M6Y A;  3F6V A;  3RKY A;  4TV7 A;  4ASN A;  3NEU A;  3G73 A;  2FA5 A;  2PI0 A;  5D8K B;  3K2Z A;  2EFN A;  2CGP A;  1RZ4 A;  4RGS A;  4MQV A;  3GW2 A;  1G6N A;  3JW4 A;  4CGZ A;  1ZHF A;  1U5T A;  1J7K A;  2VBX A;  2A6E F;  4G9Y A;  3ZN0 A;  3T8T A;  4I2O A;  1TNS A;  4BYY A;  2HYG D;  3I4P A;  5CVJ A;  4WK8 F;  4OIN F;  3RDI A;  1JHF A;  1IRF A;  3FMS A;  4I02 A;  1K6O A;  1P4X A;  2P4W A;  3KLN A;  2IP2 A;  4HZF A;  1MJA A;  1R00 A;  4M73 A;  2KIF A;  3O2P E;  5D4S A;  4KMU X;  2IA2 A;  2L4A A;  2M5W A;  1E17 A;  2Z5U A;  5KK1 A;  2DI3 A;  1ZLJ A;  4XLP F;  2GZW A;  3WTZ A;  2CWE A;  1S7O A;  1YQA A;  5FLX Z;  4IRI A;  1KU3 A;  4R8H A;  2V9V A;  2FNP A;  1XDS A;  1LJ9 A;  1P4W A;  5CLS A;  2RNJ A;  4B09 A;  2OBP A;  4BAY A;  2A6H F;  3F8M A;  5HDG A;  3LA7 A;  4KNY A;  1B9N A;  2BEO A;  1XD7 A;  3ZMT A;  4MGR A;  3M1E A;  4HF1 A;  1LVA A;  4IPA A;  2PLY A;  2NRA C;  4A5N A;  5FLX K;  4HDV A;  3QOP A;  4XSZ F;  3U9G A;  1O3R A;  3E6C C;  4RGU A;  5K5O A;  3BWG A;  3QAH A;  1IN6 A;  2W84 A;  1I1S A;  3HIF A;  4UUV A;  3DQV C;  4M9Z A;  1G3T A;  5L3B A;  1PP8 F;  3KP5 A;  5HLG A;  2ADU A;  2XKP A;  4UXN A;  3HUG A;  4GO1 A;  2HOE A;  2UXN A;  5E1X A;  1FLI A;  4Z2Y A;  3K0L A;  3RI4 A;  5LEJ A;  4YIF A;  2QUF A;  4IHS A;  3Q5F A;  1KU7 A;  1R23 A;  1B9M A;  5LBQ A;  2ZNZ A;  3EYY A;  2LDU A;  3NQO A;  2ESN A;  3CTA A;  4BNC A;  2EFP A;  2PQ8 A;  3I58 A;  4CDG A;  1BM9 A;  3COA C;  1TTY A;  3WG9 A;  5JR3 A;  1I27 A;  5J8F A;  1HW5 A;  4U88 A;  4S04 A;  1J5Y A;  1SD5 A;  1YIO A;  2OZ6 A;  3M8E A;  5LGN A;  4IRG A;  3QP5 A;  2NAZ A;  3VFZ A;  3JTH A;  2KIU A;  3ROU A;  2J5O A;  2DQR A;  1PDN C;  1YW8 A;  1MDM B;  5H6Q A;  1SD6 A;  3ZMV A;  4IRH A;  2VOP A;  1UB9 A;  3H3U A;  1JE8 A;  3PQK A;  4LB6 B;  1LNW A;  1UFM A;  1IUY A;  1B59 A;  2QQA A;  2FMY A;  1ZRE A;  1Z6R A;  3I71 A;  1ULY A;  3QPT A;  2JRT A;  2G7H A;  1BN5 A;  1DPU A;  2BV6 A;  2ETH A;  4ZYD A;  4HX4 A;  1LDJ A;  3CUQ C;  2GWR A;  3I0T A;  1FYM A;  4MEX F;  4L5I A;  4K2E A;  1ZGA A;  1VTN C;  4PGG A;  5CYV A;  2M30 A;  3BPX A;  3L00 A;  2F2E A;  4U0Y A;  5DYM A;  1AWC A;  4LG0 A;  2PFB A;  3FHZ A;  2COM A;  2QQ9 A;  3FX3 A;  3IRR A;  2EV5 A;  3JAM Z;  4BXU A;  2KIM A;  1HW1 A;  2MBF A;  2K02 A;  2QBY A;  4XRF A;  3P9I A;  1J0R A;  1ZRC A;  4EM2 A;  1L0O C;  3RKW A;  2ZKZ A;  5JVT A;  1U8R A;  4KDP A;  1YG2 A;  2QWW A;  2D1H A;  3GVA A;  4YFK F;  5LRR A;  3WTW C;  3RIR A;  2O03 A;  2W24 A;  4MNU A;  3JAM K;  2HR3 A;  4A2U A;  2ZBK A;  3CUO A;  4AIK A;  1FSH A;  3C1D A;  1RI7 A;  4UHT A;  3I53 A;  1SFU A;  1YW9 A;  4I01 A;  1YS6 A;  5FFX A;  3KLO A;  5J8C A;  3V4G A;  3GUD A;  2O61 A;  3E5U A;  5AIQ A;  4M9S A;  2A68 F;  2DK8 A;  1MJB A;  3D0S A;  5BPD A;  1H9G A;  2BE5 F;  1TQP A;  1HKQ A;  4UV8 A;  4RB0 A;  1CF7 B;  3GWZ A;  1MZB A;  5HVQ C;  3F8N A;  4WXC A;  1U2W A;  2ZJ2 A;  5E17 F;  4I09 A;  3RJP A;  4IXA A;  3RYR A;  5DUI A;  1FYL A;  3RPU A;  3K9T A;  1YW7 A;  1U5T B;  4GGG A;  5K5R A;  5LGU A;  3DPT A;  1RIO H;  5CVR A;  4BHB A;  5DCM A;  5A2Q Z;  5D4R A;  1UHM A;  5AIP A;  2ESH A;  1ODD A;  2RKH A;  2JZY A;  4NB5 A;  3N97 A;  2HZT A;  4U0W A;  1WWX A;  4KMF A;  2M45 A;  3HTU A;  5FD5 A;  4RB3 C;  4KN4 X;  5BOX A;  3BDD A;  1U3E M;  4NHJ A;  1NHA A;  1RUN A;  1MJ9 A;  1YFH A;  1LDK B;  1KA8 A;  4PZJ A;  4Q4Z F;  2O0Y A;  4O6J A;  3F6O A;  3C7J A;  6PAX A;  1QO0 D;  3F3X A;  2EFQ A;  3ELK A;  2O6G E;  3N4M A;  2CQK A;  3GFJ A;  4EJW A;  3FM5 A;  3LWF A;  1SMT A;  3BJA A;  3GFL A;  3KFW X;  1QGP A;  2KKO A;  2A5Y B;  1HQC A;  2CFX A;  4P5O A;  4ENJ A;  4XBF A;  3MWM A;  2YR2 A;  2Z99 A;  2VBZ A;  4Q48 A;  3I54 A;  2QZ8 A;  1UST A;  4ZYH A;  1U78 A;  2WWY A;  1GHC A;  4MTE A;  4HF0 A;  1G3Y A;  3IL2 A;  3WOD F;  2XAG A;  2CYY A;  4BHP A;  3E5X A;  4OIP F;  1OKR A;  1IF1 A;  3TGN A;  2JSC A;  2YX7 A;  4YG2 F;  1QNT A;  4FHT A;  5ILV A;  2HQR A;  4M6X A;  5ERI A;  2XV4 S;  3EYI A;  4HLY A;  5LGT A;  5D5X B;  2ISY A;  2P8T A;  1FT9 A;  3IKT A;  5ILU A;  3ERE D;  2K7L A;  5CVI A;  2G7U A;  1K78 B;  4LB5 A;  1W7P A;  3KEO A;  3R61 A;  2PMH A;  2H27 A;  3WTU C;  1XGS A;  3GF2 A;  1HKS A;  1Q1H A;  2DPD A;  4ON0 A;  3HYI A;  3HSF A;  3HHH A;  3MEX A;  2EJR A;  3GYH X;  5L3E A;  2HKX A;  5ED4 A;  5CJ9 A;  4L5J A;  5L3C A;  1MD0 A;  4A0Y A;  3K1N A;  2K4J A;  1JGS A;  2L4M A;  1IZ1 A;  3F8C A;  4L18 B;  3FMQ A;  2H6B A;  3T0Y A;  2VON A;  5FB2 A;  3F21 A;  4HV5 A;  5ICE A;  1W5T A;  2AXL A;  2XUB A;  4G8X A;  2D2W A;  3MCZ A;  3FZV A; 
#chains in the Genus database with same CATH topology
 2X1C A;  1SD7 A;  1TLH B;  3BR2 A;  3ONQ A;  1BOA A;  1XSD A;  2V4J C;  1VQP I;  5M5X J;  3ZQH A;  3G1M A;  2JA8 J;  3BTC A;  4IJA A;  2JVG A;  3G2B A;  2F5E A;  1IXR C;  1UHS A;  4MTD A;  2STW A;  1I1G A;  4H0E A;  3RPQ A;  4B43 A;  4LMY A;  5HS7 A;  3CCJ I;  2FE3 A;  3WE2 A;  4G94 A;  4E7Z A;  3ZN1 A;  1RC9 A;  2OF7 A;  2V79 A;  5DD8 A;  3HOW J;  2HDD A;  1R36 A;  3CCE I;  2QLZ A;  3OOU A;  4E7S A;  3CP8 A;  3ZR8 X;  3FXO A;  3HOS A;  2VUM J;  2ZME B;  3OOP A;  3L2V A;  4X1E A;  3VOE A;  5JVG F;  2LD5 A;  4P9F A;  4AYB N;  3NAR A;  3D1N I;  1J75 A;  5H2F C;  3DU5 A;  2K40 A;  4BEH A;  1YIT I;  4FX4 A;  1ETX A;  3H9J A;  2C6Y A;  4KYW A;  2MH2 A;  1KYW A;  4HNU A;  3F22 A;  2HXI A;  5IT3 A;  2NS8 A;  3ZPL A;  2HPI A;  4RAZ A;  4IF4 A;  5TIS C;  5FKK A;  2K9L A;  3GZ6 A;  1E0E A;  2MD5 A;  4LG0 B;  4B3X A;  1MSF C;  1B6A A;  3SFZ A;  3KYL A;  4MIM A;  4NBQ A;  2DT5 A;  4BHC A;  2P6T A;  2UWM A;  3VSL A;  4OU0 A;  3QYE A;  1SAX A;  4HNV A;  3HOT A;  2NOG A;  2OA4 A;  1P7I A;  1F43 A;  1ETO A;  1A04 A;  3G1L A;  1XB4 A;  4B8X A;  1IC8 A;  4G6Q A;  1K6Y A;  4W97 A;  4AIJ A;  4ABZ A;  1WQ2 A;  3OYD A;  3OV8 A;  4EMS A;  2HS5 A;  2KJB A;  3FWE A;  2FU4 A;  3W2W A;  4OIQ F;  1X3W B;  2L02 A;  4P9U A;  1IDY A;  3CMY A;  2BXZ A;  3VYR B;  3LNQ A;  2EB7 A;  2LKX A;  5F1J A;  5EDN A;  1MGT A;  2MG4 A;  1Z9C A;  3D5R C;  1B72 B;  1DP3 A;  3CCR I;  2HQA A;  2OPT A;  1YE9 A;  3JRB A;  3JRD A;  2KQR A;  4U7D A;  1SVO A;  3IAS 2;  1VQ9 I;  3ZOB A;  3H5R A;  4JQF A;  2LG4 A;  4C2T A;  1WFX A;  2V1X A;  2OU2 A;  3H35 A;  3CUQ A;  3IV5 A;  4N9I A;  4II3 A;  1S29 A;  3TO9 A;  3RZD J;  4AM3 A;  3I4N J;  1V5G A;  1W1W E;  4QPO A;  2JA5 J;  2ID6 A;  2DJN A;  1R5G A;  4YEJ A;  2VLA A;  4JBA A;  1X1A A;  1G3S A;  3I9V 2;  5DCF A;  4HDU A;  3E3V A;  1H0M A;  1KU2 A;  2L01 A;  3IWZ A;  1BI1 A;  2LMD A;  1FOK A;  3HB9 A;  4XLN F;  1MKM A;  3C18 A;  3K1P A;  1JHH A;  1VQ7 I;  2K86 A;  1ZRD A;  3R6S A;  2KL4 A;  4Q5S F;  1ZAR A;  4I7H A;  2D5V A;  3SQN A;  3KZI C;  4BS9 A;  3SYT A;  4IOC F;  4C2U A;  3A03 A;  1TWA J;  1OCC H;  1OLT A;  3SFI A;  2AXT C;  2NS0 A;  3Q0V A;  2EH3 A;  5FO5 A;  3QU3 A;  4FT8 A;  2ICW G;  2DA2 A;  1OYY A;  4BKX A;  2RQP A;  2E1M B;  3GCM A;  4L5E A;  2GQQ A;  1S6L A;  4LLG F;  3DLA A;  3S15 J;  2ZJR F;  4RAG A;  1SD4 A;  1RKT A;  5IP9 J;  5FJ8 J;  1Z21 A;  3OSG A;  2AQE A;  1SFX A;  4Y17 A;  3S2W A;  1FBQ A;  3SDB A;  4KUM A;  3MFK A;  2O7O A;  5M5Y J;  4ESJ A;  4ZTJ A;  3VYS B;  1TWG J;  1TT0 A;  3LL7 A;  4AD9 A;  3MCZ A;  2QA4 I;  1J9I A;  1LE8 A;  2F5D A;  2M3A A;  3TDU C;  1KZH A;  4DW6 A;  1FP1 D;  3HGY A;  2ZCW A;  1O3S A;  2M34 A;  1UHW A;  2R93 J;  3K10 A;  3GTL J;  4R1H A;  4ENN A;  1W5C C;  3EUA A;  2L7K A;  3EPZ A;  3RQ4 A;  2Y9Y A;  2EWN A;  1MNE A;  4CXF A;  3HRM A;  1O7F A;  1ZKG A;  1I6X A;  2HPM A;  4UUS A;  1FNN A;  1ZLK A;  4L9J A;  4DYQ A;  3M07 A;  2TDX A;  2OCE A;  3KEY A;  3HPG A;  1PUF A;  2KMU A;  3F23 A;  4V19 K;  1TL8 A;  4Q47 A;  3B6C A;  1QZE A;  2QVO A;  1E3H A;  3K4K A;  3OIQ A;  1VND A;  2EK5 A;  2QQ8 A;  4XSX F;  1IN7 A;  1C0W A;  1QA6 A;  1TBX A;  2ZFW A;  2OQG A;  3GTP J;  3EUH A;  1YJN I;  4ENM A;  4L0Z B;  3K4L A;  5GAH J;  2IRF G;  5HS9 A;  3V8K A;  1XN7 A;  5EEG A;  4EQQ A;  4Y52 J;  2R7S A;  2XGD A;  2GOX B;  5HLH A;  1GXP A;  2Z3Y A;  3LSK A;  4WX9 A;  4CYC A;  3CF2 A;  1RNL A;  4M71 A;  1P92 A;  2DU9 A;  2IGO A;  5IP7 J;  1BC8 C;  2MGQ A;  1BL0 A;  2DPU A;  2X0L A;  1YLF A;  1E3O C;  2FOK A;  2DFF A;  3K4N A;  1Z67 A;  2P6S A;  2RC4 A;  3WTT C;  2OV7 A;  3HOU J;  2RNG A;  1MND A;  5EGO A;  3GTK J;  3DBL B;  1T8I A;  3DTE A;  1J59 A;  3J7A O;  3ZXS A;  4E4H A;  1WVR A;  2DO7 A;  4Y4R A;  2P5K A;  2R3S A;  1F9N A;  3TO6 A;  2YX4 A;  4J01 A;  2HQ5 A;  3OYE A;  2R7D A;  1JUM A;  1SAU A;  2BW3 B;  3U1K A;  5LEK A;  3PNY A;  3OS0 A;  1ON1 A;  4HBL A;  2R7T A;  2OJE D;  1BW5 A;  3KCC A;  3DWL E;  3FDY A;  3M7G A;  2EQR A;  3K1M A;  3WTS C;  1HA8 A;  2HTS A;  1XGM A;  4U0V A;  3V7R A;  2CUZ A;  1IW7 F;  3C2H A;  2GXA A;  5JI6 A;  3KP6 A;  1Z1D A;  4BUP A;  5K1Y A;  2KDZ A;  4LIT A;  4CCN A;  1R58 A;  1QZY A;  1A31 A;  3FIS A;  4HOB A;  1OCR H;  3S2D J;  2TRT A;  3ECO A;  5J6X A;  3GTJ J;  2IBD A;  4LIU A;  2VQH A;  2E2I J;  2NVU B;  4EJV A;  3WTX C;  3U1D A;  1IGN A;  3SZG A;  4MFE A;  2VL8 A;  4CZZ A;  2XAF A;  2XDV A;  1NTC A;  2O3F A;  3DEW A;  2EFW A;  3KP2 A;  3VOD A;  1KQ0 A;  1WJE A;  4KN7 X;  3WU0 A;  3OYH A;  2CUF A;  1JGG A;  5DD4 A;  3HOZ J;  4D5C A;  3VWB A;  1EH7 A;  5BPI A;  4M3F A;  1Q1V A;  5C4J J;  2M7A A;  4RA2 A;  4DQ2 A;  5LRS A;  2BGC A;  2VOO A;  2Q8K A;  1XGN A;  3BZK A;  2BY0 A;  2CSO A;  2CG4 A;  2FRH A;  2Y75 A;  1GVD A;  4HQM A;  1LFP A;  4MLO A;  3TO7 A;  4EJO A;  4FCY A;  2LSO A;  5DV5 A;  4C2M J;  4JK1 X;  2NYX A;  2W85 A;  4BQQ A;  2HYF A;  1BC7 C;  2V7F A;  1FP2 A;  2RRE A;  3BJO A;  1F36 A;  4IL6 C;  4MHG A;  2ACJ A;  3Q0W A;  3HTS B;  2OCC H;  1R9T J;  1MMA A;  2R7V A;  1J2X A;  3JRF A;  2GAU A;  3O8H A;  2CQX A;  1YOV B;  4EM0 B;  3LQR A;  4Y33 A;  3FIW A;  2P5L C;  4KIG A;  2CV0 A;  3DF8 A;  2MFZ A;  2Y0M A;  4LOC A;  2E1N A;  2KRF A;  5C3E J;  1MW7 A;  2M8G X;  1A6I A;  2ID3 A;  3TQN A;  2VE8 A;  3V8J A;  2ZXH A;  2DFI A;  2JPC A;  2QSH X;  2UUZ A;  3K4C A;  1FTT A;  3LSI A;  1X58 A;  1FSE A;  5LHI A;  2M0M A;  1XGO A;  2FQ4 A;  1YIJ I;  2PG4 A;  3T8R A;  3CCY A;  4HX8 A;  5E3L A;  4ZYE A;  3EQL F;  5BS6 A;  4HRI A;  1ONV A;  1PP7 U;  1IJW C;  5FD6 A;  4U7B A;  1HOM A;  5KNL A;  5DUK A;  4ENK A;  3LAJ A;  3AL0 C;  1S8N A;  3K6G A;  3O3K A;  1OR7 C;  3CDL A;  4KIF A;  3G4S I;  2EPF A;  3B6A A;  2CW0 F;  4WF2 A;  3WU1 B;  2WAF A;  2MYS A;  2ZME C;  4XMY A;  1REP C;  4PCQ A;  2VT2 A;  2HGC A;  2L9S A;  3F9K A;  2OQR A;  5LFA A;  3BZC A;  2RV8 A;  2KFD A;  4BE0 A;  1YHQ I;  2CQ7 A;  3Q9S A;  4LJZ F;  2MD0 A;  3DKW A;  3EET A;  3QOE A;  2H09 A;  2WC2 A;  4DNC A;  3JTG A;  2H1K A;  3BRO A;  3RPU D;  1T0F A;  1BR1 A;  1I3Q J;  2NNN A;  3ZMZ A;  2CO5 A;  2VBY A;  3I64 A;  4KIB A;  5LHG A;  5B66 C;  2GLO A;  3WU2 C;  4DIQ A;  3IAM 2;  2DA4 A;  4NC8 A;  4PJL A;  2FEZ A;  3BQZ A;  1IXS B;  4N9H A;  4MFD A;  5J4V A;  2MC4 A;  3ZGK A;  1MDM A;  3SJM A;  1TC3 C;  3PO2 J;  1T39 A;  4B48 A;  1LFB A;  1MBK A;  3LAP A;  4PFO A;  4P1W A;  2X51 A;  1LEA A;  3U2R A;  1IRZ A;  3JSO A;  1PUE E;  4JX6 A;  3H5A A;  4L9V A;  2VN2 A;  2RQQ A;  1VQL I;  5J4Y A;  2ZFU A;  3V7C A;  2G9W A;  4CIC A;  2RGV A;  3CCM I;  2XC7 A;  4F55 A;  4CZC A;  2OD5 A;  4RAF A;  5H6R A;  1Z6T A;  4UV9 A;  5CQE A;  2BBY A;  3E5Q A;  2E1C A;  4MO7 A;  1V3F A;  1XMX A;  4BEH B;  5E8I A;  4WWC A;  4RGX A;  2X48 A;  2ME0 A;  3P7N A;  2ISZ A;  1HST A;  5E8G A;  1O7L A;  2LYC A;  2QM3 A;  1U9O A;  2HDC A;  4C3I J;  3S16 J;  1IRG A;  2BOL A;  3ABM H;  3WE3 A;  3W6K B;  1WGX A;  2OZU A;  1P4A A;  2EZH A;  4KA4 A;  2XPV A;  2QKL B;  2HOS A;  1GT0 C;  5E1Z B;  2GM4 A;  1TW2 A;  1NG7 A;  3HKZ A;  1ZN2 A;  4ZH4 F;  2FBI A;  5E3O A;  2PJR A;  4ZDP A;  1AOY A;  1ZG1 A;  5ICC A;  1PYV A;  3MQ0 A;  1MIJ A;  3ZQL A;  4CO8 A;  1QBJ A;  5FLM J;  3H92 A;  3ZQG A;  3S3M A;  3C3W A;  1W0T A;  1BI0 A;  4NC7 A;  4BH9 A;  3F72 A;  1VQM I;  5LD2 C;  4BGD A;  3PL8 A;  1K83 J;  4S05 A;  4E7J A;  2L0K A;  2CRG A;  3H0D A;  1HKT A;  1IAW A;  1EH8 A;  3LSG A;  3T5X A;  3LSH A;  3QPH A;  3DU6 A;  2FSW A;  2CV2 A;  1XSV A;  2WV0 A;  3LFU A;  5IYC J;  3KP7 A;  2X6W A;  5GTH C;  4OAZ A;  3PFI A;  2LKP A;  2A05 A;  3W6J B;  2O5R A;  1IRX A;  1WRJ A;  2A6T A;  3J80 K;  2E1M C;  1PVE A;  4D1Q A;  1MMS A;  1T6S A;  3OIO A;  4BY7 J;  2B0L A;  4IHY A;  3HUG B;  3S14 J;  2EA4 A;  4HW0 A;  2VIX A;  4KFC A;  2L7F P;  5H20 A;  3FXR A;  2VE9 A;  5FFZ A;  1ZH5 A;  2QKM B;  1I50 J;  3HRT A;  4E7H A;  3ASO H;  3DEE A;  3DLL F;  3TL4 X;  2HOT A;  4FE7 A;  1ON2 A;  4A3E J;  3HEF A;  3MAJ A;  4EVI A;  5TJJ A;  3LST A;  2JUC A;  2L54 A;  1ZG3 A;  2PN6 A;  2ELH A;  2XIG A;  4QSH A;  2V1U A;  4HYE A;  1FYK A;  2LY1 A;  1LKX A;  1FY7 A;  1BR2 A;  4HST A;  4CCJ A;  4D5F A;  2VBW A;  2FBK A;  2JA6 J;  1MH3 A;  1O3T A;  2M87 A;  2F5C A;  4M3G A;  1S72 I;  1D8J A;  1G59 A;  3GO5 A;  2X6O A;  1VQ5 I;  3H3Z A;  4IHV A;  2ZB9 A;  1SC7 A;  3I4M J;  2P5V A;  1WSU A;  3SEQ A;  2VKH A;  3JRH A;  4YFX F;  2DW4 A;  1A6Q A;  2FML A;  1X2N A;  2Y69 H;  4HV6 A;  2J5P A;  4A6E A;  3I59 A;  4HLX A;  2JUG A;  3ZMS A;  1YO5 C;  5IYD J;  4XNF A;  3JRI A;  2V6C A;  1D5Y A;  2M8E A;  3PM1 A;  3HG9 A;  2JRM A;  3S2H J;  2IA1 A;  4KT6 A;  2IW5 A;  3CO7 C;  1JKP C;  2O8X A;  5KVR A;  1FBU A;  2IGM A;  3R0J A;  1F4K A;  2VT3 A;  3OYI A;  2R5Z B;  2EBI A;  1R4N B;  3I55 I;  1W7P D;  3LFK A;  5HLT A;  4CCM A;  2VC0 A;  1JI8 A;  2VC1 A;  3HC7 A;  1SMY F;  1S7A A;  1R1V A;  2V9P A;  2A61 A;  1NG6 A;  3NRV A;  2Q2E A;  3BP8 A;  3F8F A;  3K2A A;  4EJT A;  2OAZ A;  4P96 A;  2PEX A;  2TCT A;  1TWF J;  2KHM A;  3ZMD A;  4BU2 A;  3J81 K;  4I76 A;  1OYW A;  1CF7 A;  4HPQ A;  4UUS B;  1HW2 A;  3M4O J;  3HRS A;  2KJC A;  2CS3 A;  1U6G A;  4AVZ A;  1HDD C;  4IVN A;  1LVK A;  1PUF B;  1LDD A;  2GIV A;  2PMU A;  2NNY A;  4I0A A;  4ZJZ A;  3OYC A;  2R7R A;  4LFU A;  5JFR A;  1NK3 P;  3RKQ A;  3GTO J;  2LNB A;  4YFN F;  1YJW I;  4DBR A;  4HG2 A;  2HVR A;  2JVH A;  4OOI A;  2DOA A;  3C2B A;  1QQI A;  4AIH A;  2WY8 Q;  1FWZ A;  2Y30 A;  1B4A A;  1IN4 A;  1MBH A;  2NXN B;  4A3I J;  1CQT A;  1TQI A;  3ABU A;  4E6K G;  1FOY A;  5CVV A;  5EEA A;  1E2X A;  1ZEL A;  1OYI A;  1WKM A;  4CA0 A;  4WXD A;  1BJA A;  1QPI A;  4F93 B;  3KZY A;  1OMI A;  4CYC B;  2XAS A;  5EEH A;  4G7H F;  1Y8Q B;  3DP7 A;  3B73 A;  3VYU B;  2EV0 A;  5F27 A;  1OFC X;  4L9N A;  3DV8 A;  2VXZ A;  1O57 A;  2FQ3 A;  3A4C A;  4IQ4 A;  5EJC A;  3CC2 I;  2RDP A;  2Y48 A;  3L2C A;  4A3J J;  3EDP A;  3HSE A;  3D5L A;  5DDG A;  4UNO A;  3MZY A;  4C9Y A;  5EGO B;  1XMA A;  2JJ7 A;  2LFB A;  2CQN A;  2YSR A;  2CW7 A;  2AO9 A;  5L3G A;  2E5N A;  3KX2 A;  2HEO A;  2IPQ X;  4M74 A;  4ETS A;  5K7F A;  5D5W B;  1XSX A;  1D1C A;  4EEF G;  5HDN A;  4FQG A;  3AG3 H;  3KEQ A;  2DQL A;  3TOB A;  4HAM A;  1ITY A;  4X0G A;  3TKY A;  1D5V A;  4DOZ A;  1DP7 P;  2DFE A;  3E6B A;  3CZ6 A;  1VF9 A;  2XAQ A;  1DDN A;  1SVM A;  3U21 A;  1WZ2 A;  2NVQ J;  2QQB A;  4B4C A;  1WH7 A;  3DEU A;  1T08 B;  4UVB A;  4ESB A;  1P2F A;  3CD6 I;  3RZO J;  1EKE A;  4EGY A;  1ZK8 A;  4XR6 A;  5IOZ A;  1G4D A;  2QBY B;  2K27 A;  4A0Z A;  3OYL A;  4CHU A;  3TP3 A;  2FJ1 A;  2XKO A;  4WCG A;  1HXD A;  3W3C A;  3RYP A;  1TWH J;  3CDI A;  3WHC A;  1T98 A;  3JRG A;  4KJZ A;  1K61 A;  4RAY A;  1TW3 A;  1FIA A;  1BI2 A;  4RB1 A;  3SEZ A;  4BAC A;  3DCF A;  5CVU A;  2X1E A;  3BTJ A;  1L3L A;  3ABK H;  3DTK A;  4KIC A;  2Y9Z A;  5BMZ A;  2DDA A;  4GYG A;  5BQT A;  2P81 A;  1YX3 A;  2O8K A;  1QZZ A;  2X9D A;  4XID A;  4EM1 A;  1IXC A;  2M4G A;  3M8J A;  3K7A J;  1K7A A;  3KYD B;  4BJT A;  5D5V B;  1UJ8 A;  3GEZ A;  2LR8 A;  1ZGJ A;  3TBI A;  4EJU A;  5E79 C;  4B1R A;  4NC6 A;  2QEN A;  1H88 C;  4HX7 A;  1NK2 P;  2OUM A;  4WXH A;  3FKI J;  1ZRF A;  2BVM A;  3CDH A;  3L7W A;  1I6H J;  3P9K A;  3RCO A;  3CO6 C;  3S17 J;  1WH5 A;  1MBG A;  2KDO A;  1U5T C;  2GOM A;  3B02 A;  2XAH A;  1X3U A;  2P7C B;  1KQ9 A;  3SZP A;  4PJJ A;  1RR8 C;  2VKV A;  2K9N A;  1MBF A;  2VAS A;  3IRQ A;  5HS8 A;  3CP2 A;  2Z9O A;  3REO A;  1YS7 A;  3O6B B;  1ETK A;  4PDK A;  1B1B A;  2K9S A;  3FBN B;  2WB1 N;  3FF5 A;  3I3L A;  4BY1 J;  4DJA A;  4ITV A;  3AG4 H;  2R92 J;  4A0X A;  3GME A;  2DK5 A;  5E18 F;  1H8A C;  4IHT A;  5K5Q A;  1APL C;  4IX7 A;  2GXG A;  2IAI A;  4DGW B;  1HSJ A;  2E1O A;  5F0F A;  5L3D A;  3FK6 A;  3L09 A;  2ZXW H;  3OY9 A;  2QGU A;  1XTA A;  4AVP A;  2JWT A;  4XK4 A;  3WGI A;  1K78 A;  4Z6Y A;  4IEJ A;  1GV2 A;  1Y56 A;  3AFH A;  3R60 A;  4XL9 A;  5IT9 Z;  2RN7 A;  1QHH D;  2FF4 A;  2MLK A;  2XPU A;  1CGP A;  2MC3 A;  1RES A;  3QWL A;  5DCM B;  1FPQ A;  5B1A H;  2DN0 A;  4GCV A;  3OYJ A;  1D8K A;  4YRV A;  2FXA A;  3LQQ A;  4I0B A;  1X1C A;  1IN8 A;  4PK4 A;  2EFO A;  2RVC A;  3PUF A;  4EAT A;  5GAE J;  1JXS A;  1V4R A;  1ZG5 A;  4IHX A;  3V8L A;  2Z33 A;  2E34 A;  2ZO4 A;  4G12 A;  1F5T A;  4AU7 A;  2JN6 A;  2JT1 A;  2WAE A;  2AS5 F;  3T1B A;  2R7W A;  5BNG A;  2V1D A;  3ESW B;  3CC7 I;  5F64 A;  4A3M J;  3WTV C;  4ZYG A;  4AWX B;  3OS1 A;  5IT9 K;  2EA2 A;  2NVY J;  2VOD A;  1P9Q C;  3S1R J;  2HTJ A;  1YTY A;  4HSR A;  4B47 A;  2IT0 A;  2IS2 A;  3WTY C;  2DMQ A;  1X1P A;  2KZV A;  4RMN A;  2F6C A;  3ISP A;  2EZI A;  3DXJ F;  2KPM A;  4NQW A;  3OYA A;  2ZSI B;  4OMZ A;  5HLI A;  2P7V B;  4J00 A;  4RB2 C;  1YYV A;  1OCZ H;  1JJ6 C;  3IKV A;  1JTX A;  5IYB J;  4EV0 A;  2R5Y A;  4O3M A;  3OL4 A;  5D6F A;  2JTV A;  1STZ A;  1EF4 A;  2KRH A;  1TZL A;  2DLL A;  3CJN A;  1BR4 A;  1JUP A;  2LF7 A;  4GRI A;  1JKQ C;  1V5E A;  1LB2 A;  1GXQ A;  3CLO A;  3TOA A;  1VQ4 I;  4V2F A;  2IVM A;  3HKZ N;  1VI0 A;  4QWQ A;  4PJ0 C;  3FXQ A;  4RDU A;  4MEY F;  4XRS G;  4A3C J;  4M9X A;  5FKO A;  2BHY A;  1MBE A;  1XCB A;  2W1O A;  4XKC A;  3IHU A;  1FBS A;  4V2G A;  3RQI A;  2E7W A;  3BOQ A;  2UZK A;  3GX4 X;  1FTZ A;  4PFP A;  2XRL A;  3TDZ C;  2XAJ A;  3ABT A;  2PJR B;  1QPM A;  3MKY B;  1OR7 A;  4MQ9 F;  4ZZD A;  3E97 A;  3BTI A;  3F8B A;  1UZC A;  1V5F A;  4OIO F;  2EIK H;  1E3P A;  2ZME A;  3KP4 A;  3VEP A;  4KT5 C;  3ECH A;  2XRN A;  3IWF A;  2YS9 A;  2Z1D A;  3CQZ J;  2BYV E;  1T2K A;  1D0X A;  4F91 B;  1FC3 A;  1UCR A;  2XGC A;  4S0H B;  1ORK A;  3KET A;  2HFH A;  4ESF A;  3KPH A;  1ZYR F;  4FAS D;  3H3V K;  5ILS A;  2D1V A;  4G6D A;  2ELJ A;  3MZH A;  3A2K A;  1I5Z A;  3BR1 A;  2EIM H;  5IPA A;  2VB6 A;  4LD5 A;  1IN5 A;  4LGW A;  4RGR A;  5IP6 A;  2ELK A;  2WTE A;  4RM3 A;  3DFG A;  4F7Z A;  4BQA A;  2M9H A;  1XDU A;  4I98 B;  3WGG A;  3SXY A;  1KQ8 A;  3E6M A;  1DPR A;  1G8X A;  2DAO A;  1WI3 A;  1OJL A;  4BL0 B;  3GZ5 A;  1G3W A;  2Z16 A;  4XON A;  5EZG A;  3HSR A;  1S5L C;  2I8D A;  4G7Z F;  1Z91 A;  3QP6 A;  5HDK A;  2LK2 A;  2XRO A;  2CFO A;  1XCV A;  4BBS J;  2UXX A;  3M8F A;  3VYT B;  3PUB A;  5GAD J;  1SFE A;  1F1Z A;  5C4X J;  2PJP A;  3AAF A;  1RUO A;  5LHH A;  3BZ6 A;  2HQN A;  5DM6 F;  2HKO A;  1B72 A;  2I5U A;  2MA3 A;  4L9T A;  1Y0U A;  1A35 A;  2YU9 J;  1R49 A;  3IP4 B;  2F5F A;  3L1P A;  1W7P B;  3JRE A;  3HRU A;  3ZQ7 A;  3BJ6 A;  2EZL A;  3X2Q H;  3QU6 A;  4LLN A;  2IA0 A;  4UUT A;  3IC7 A;  1Y1W J;  2B63 J;  3K70 C;  2LBF A;  2XVC A;  3I59 B;  5F08 A;  4PGH A;  1R6R A;  4RS8 A;  3R4K A;  4Y15 A;  4AUX A;  1ETQ A;  1Z05 A;  2KIQ A;  3FXJ A;  2DCE A;  4M6V A;  1G2H A;  3ZMU A;  2DA3 A;  2LKS A;  5F0H A;  3PJR A;  2DBB A;  4M72 A;  4EGZ A;  4I99 C;  3VPR A;  4R79 A;  1D3Y A;  2WB1 A;  1T95 A;  3OMY A;  1MMD A;  3S1M J;  3ZQC A;  2K4B A;  2DTR A;  3BG9 A;  4LG3 A;  4Y7N J;  2B7E A;  2Q0O A;  3IH4 A;  1SFO J;  2L3D A;  2PBI A;  1EV7 A;  2QYO A;  3TMO A;  3FXU A;  2MH9 A;  3BQY A;  1WJ5 A;  4E7I A;  3IH3 A;  4XOR A;  1LQ1 A;  3E6D A;  1BBY A;  2R7U A;  4BBR J;  3Q3S A;  4F92 B;  4CUG A;  4XLC A;  2X1D A;  3A1Y A;  3G1O A;  1KGS A;  3LSP A;  1TQM A;  1Y8R B;  2O9L A;  5DS9 A;  2H94 A;  3FKJ A;  2D45 A;  2L9V A;  4JOM A;  3ZP5 A;  2HWV A;  4OAY A;  4NUB A;  3I56 I;  2H8W A;  1WJF A;  3RTR A;  2W57 A;  4UVA A;  1ZR2 A;  2GA1 A;  1OCT C;  2STT A;  2K3P A;  4M3B A;  3R0A A;  1M1E B;  4LK0 F;  4LLL A;  1ETV A;  2WAQ A;  1D0Z A;  1ZAO A;  3HPH A;  5J1Y A;  1EA3 A;  3GXO A;  2HVQ A;  4M3D A;  4HQE A;  1HCR A;  2W25 A;  3DPL C;  1R5I D;  1RET A;  4CCL A;  4ZZL A;  1LEB A;  3M9A A;  2A07 F;  5D6E A;  1EH6 A;  2Y31 A;  4I6Z A;  3RKX A;  3K69 A;  4A93 J;  3KZZ A;  3TED A;  5TRD A;  1K79 A;  2L2O A;  3QPL A;  3S3N A;  1QHG A;  3BY6 A;  4N0B A;  2IS4 A;  5D5U B;  1JKR C;  1U0J A;  2XGX A;  3KE2 A;  5M5W J;  2A69 F;  4QLC U;  2A5W A;  1FOX A;  1O3Q A;  2XAU A;  5D8L B;  5GPA A;  2ZXI A;  2A3S A;  3GZN B;  3MD2 A;  3H9G A;  4QTR A;  2YU3 A;  1OPC A;  3HJE A;  1ZR4 A;  3PQJ A;  4GYI A;  1H9T A;  3MKL A;  3S8P A;  5ICG A;  4PSX A;  5FKL A;  4G7O F;  1BIB A;  2H6C A;  5A2Q K;  2DA7 A;  3A0H C;  1JT6 A;  1R7J A;  3CME I;  2IS6 A;  3SZT A;  3IH2 A;  1FX7 A;  3V7S A;  1WI9 A;  3J7Y J;  3MVP A;  2EIJ H;  1R22 A;  1I3A A;  4RM2 A;  1ACI A;  2JMW A;  1MMG A;  3K4M A;  1SAN A;  3CF5 F;  1FZP B;  3ML6 A;  4XOP A;  5FGM A;  3HHG A;  1Z77 A;  4O5V A;  1BIA A;  1ZQ3 P;  3J80 Z;  4GXO A;  2HNH A;  3J7A Y;  2BHZ A;  2HZD A;  2LRD A;  1XMK A;  2R7F A;  1VQN I;  3A01 A;  5JLX A;  5E1W A;  1XS9 A;  5DEQ A;  5JHU A;  4OIR F;  1X1D A;  3WHB A;  2JPB A;  1R5H A;  5ICF A;  2XHK A;  3MZ8 A;  3VB2 A;  2MAB A;  1LPQ A;  4HF2 A;  5J40 A;  2CJJ A;  5E20 A;  3CCU I;  1T38 A;  1HBX G;  2IEK A;  1MMN A;  2M1B A;  4ZDL A;  5LLQ A;  1DU6 A;  1WPK A;  2XF6 A;  2KZG A;  1GVJ A;  2NS7 A;  3UR3 C;  5C44 J;  1KU9 A;  2GA2 A;  2LLK A;  5GP9 A;  3QRF F;  4XN3 A;  2ZXJ A;  2Y0S A;  1TP4 A;  2BW3 A;  1P7J A;  1R1T A;  2YPR A;  3A02 A;  3S93 A;  4A12 A;  1OCO H;  2LF8 A;  4X6A J;  4F52 A;  1GV5 A;  3H1C A;  2E36 A;  2X4H A;  4HA8 A;  3ZRG A;  3NWT A;  5AON A;  2DMP A;  3FMR A;  1TNT A;  1KYZ A;  2H1L A;  2DMT A;  3CUQ B;  3EUK L;  2PMZ A;  3HZJ A;  4XN0 A;  4DYR A;  4E70 A;  4HNT A;  3LA2 A;  1Z0X A;  5F0C A;  5L3F A;  3P9C A;  4D0P A;  2K5C A;  3L9F A;  1W0U A;  3LA3 A;  2VJJ A;  2IJL A;  4DYC A;  4DBQ A;  3OS2 A;  1YRN A;  3GFI A;  4BJ5 C;  3H9Q A;  2CUE A;  1QVU A;  3KYC B;  5HOO A;  4YII A;  4UVC A;  2E19 A;  1AA7 A;  4L0Y B;  4P55 A;  5F6F A;  1P6R A;  4FX0 A;  1FMW A;  3C2G A;  4LK1 F;  3HL2 A;  3FM3 A;  4Y13 A;  2MLG A;  2FBH A;  4A6D A;  3LSR A;  4CYD A;  1Z7U A;  2HVS A;  5GAG J;  3GLX A;  3E0J B;  1W4M A;  2E7X A;  4JX4 A;  2ZNY A;  1S3J A;  1Z3Y A;  3LMM A;  3K4B A;  1BI3 A;  3Q9V A;  1S7E A;  2VQC A;  3BPV A;  3G3Z A;  1DUX C;  1W5S A;  3ULQ B;  2FNA A;  2GBY A;  3I5U A;  1R1U A;  4PUS A;  3JSP A;  3WGH A;  4OMY A;  1MH4 A;  1DU0 A;  3KP3 A;  3GFM A;  3J81 Z;  4A5M A;  1USS A;  4E7K A;  2LOO A;  4FIS A;  3TW6 A;  1LFU P;  1POG A;  5F1R A;  4XLA A;  1UEL B;  2GXB A;  1Z7L A;  2QSG X;  2CV1 A;  2EV6 A;  4M6Y A;  3F6V A;  3RKY A;  1DGW Y;  2XSD C;  1LE8 B;  4TV7 A;  4ASN A;  3NEU A;  2QSF X;  4F3Q A;  5K7Z A;  3G73 A;  3J7Z I;  2FA5 A;  2PI0 A;  1H89 C;  5FRN A;  2DTZ A;  5D8K B;  4KIS A;  1WJB A;  3K2Z A;  2G0E A;  2Z2S B;  3LSJ A;  2EFN A;  2CGP A;  2ECB A;  2VPR A;  1RZ4 A;  2DOD A;  2X85 A;  2FD5 A;  4CCK A;  4BE2 A;  2VJ5 A;  4RGS A;  4MQV A;  3GW2 A;  3PSF A;  2XF7 A;  1G6N A;  3OYM A;  3JW4 A;  2W48 A;  1XC5 A;  4CGZ A;  1ZHF A;  2WBM A;  3HOV J;  1U5T A;  3OR2 C;  1MNM C;  1J7K A;  1UMQ A;  4D7N A;  2IGK A;  2VBX A;  3IUO A;  2FX0 A;  3OYB A;  3W2V A;  2A6E F;  4G9Y A;  3ZN0 A;  2ECC A;  3T8T A;  3D5S C;  4I2O A;  3QQA A;  2R0Q C;  1TNS A;  4BYY A;  2HYG D;  3I4P A;  5CVJ A;  4WK8 F;  4OIN F;  2R5Y B;  2VJ4 A;  3RDI A;  2L9N A;  4KIT B;  1JHF A;  1IRF A;  2CMP A;  2DA5 A;  1N25 A;  3FMS A;  4I02 A;  1K6O A;  1P4X A;  2P4W A;  3KLN A;  4UB6 C;  1RPW A;  2IP2 A;  4HZF A;  1HDP A;  1IO2 A;  1MJA A;  1R00 A;  4M73 A;  1AU7 A;  2KIF A;  5FKN A;  4JX5 A;  2QEX I;  2NVX J;  3O2P E;  2V9K A;  2VJI A;  5D4S A;  1O4X A;  3BR0 A;  4KMU X;  1OIS A;  2IA2 A;  1GUU A;  2L7M P;  1RKW A;  2L4A A;  3OL3 A;  4XLE A;  4C30 A;  1D1B A;  2M5W A;  4OWR B;  2R7X A;  1E17 A;  2Z5U A;  2KRC A;  4QIW N;  5J1R A;  3AL0 B;  3MKW B;  2HOA A;  4N4N B;  1X19 A;  2DI3 A;  5KK1 A;  1PJR A;  3PIP F;  3H36 A;  1ZLJ A;  2M2E A;  3MMY B;  3BCA A;  3CMM A;  2BY2 A;  4A3B J;  2F48 A;  3BCB A;  4NNJ A;  2XB5 A;  4U87 A;  1JKO C;  5EG0 A;  4XLP F;  2GZW A;  2EZK A;  3OYG A;  3WTZ A;  2CWE A;  1S7O A;  1YQA A;  5FLX Z;  4IRI A;  1KU3 A;  3PFY A;  4R8H A;  2V9V A;  2FNP A;  3NAU A;  1XDS A;  3DBH B;  2MSY A;  3L2Q A;  5E3M A;  1FMV A;  1TWC J;  4XLF A;  1EJ9 A;  1LJ9 A;  1P4W A;  5CLS A;  1A36 A;  3OWT A;  2RNJ A;  4B09 A;  2DDB A;  4XQF A;  2OBP A;  2RAE A;  4BAY A;  3BR5 A;  2LC2 A;  2A6H F;  3F8M A;  5HDG A;  3LA7 A;  4KNY A;  1B9N A;  3JCU C;  1YJ9 I;  2BEO A;  1XD7 A;  2ZC2 A;  5CPR B;  3ZMT A;  4MGR A;  3M1E A;  4HF1 A;  1LVA A;  2E35 A;  1W36 C;  4IPA A;  2PLY A;  2NRA C;  4A5N A;  5HNF A;  5FLX K;  1J09 A;  4HDV A;  3QOP A;  4XSZ F;  3U9G A;  1O3R A;  3E6C C;  1X2M A;  4RGU A;  5K5O A;  3CCQ I;  1QRY A;  3BWG A;  1WJC A;  3CC4 I;  3F0C A;  1WHU A;  3QAH A;  2JA2 A;  1IN6 A;  2W84 A;  2QF7 A;  3BG6 A;  3O8G A;  3HIF A;  3OIP A;  1AKH A;  1I1S A;  1Z3X A;  1UG0 A;  1B8I A;  4UUV A;  3DQV C;  4AID A;  3HGG A;  2IGN A;  4M9Z A;  5JHF A;  1G3T A;  5M3M J;  5L3B A;  1X4P A;  2JK3 A;  1PP8 F;  3KP5 A;  3GTQ J;  1T56 A;  5J3L A;  5HLG A;  2ADU A;  1JT0 A;  2XKP A;  3HOX J;  4UXN A;  2LBF B;  5FKM A;  3HUG A;  1V54 H;  1GLN A;  4GO1 A;  2HOE A;  2UXN A;  1VQO I;  1ZGW A;  2VQG A;  3AG2 H;  2L7Z A;  5E1X A;  1FLI A;  4Z2Y A;  3K0L A;  3K4J A;  3RI4 A;  1RRJ A;  1JUS A;  4ANJ A;  4CH7 A;  3GTG J;  3L2W A;  5LEJ A;  2Q1Z B;  4YIF A;  5KCM A;  1KON A;  2XB0 X;  4XKW A;  2QUF A;  3L2R A;  2DT6 A;  4IHS A;  2E71 A;  2COB A;  3Q5F A;  1KU7 A;  1BJZ A;  1R23 A;  1B9M A;  3N05 A;  5LBQ A;  2ZNZ A;  1SVL A;  3JRC A;  3EYY A;  2LDU A;  2CUJ A;  3NQO A;  2CQQ A;  3G6E I;  2ESN A;  1OQY A;  1YI2 I;  3CTA A;  4BNC A;  1UAA A;  2EFP A;  2PQ8 A;  4E7L A;  3I58 A;  3FXK A;  4CDG A;  3SDG A;  2FUG 2;  1X1B A;  2H8R A;  5J1U A;  1BM9 A;  3COA C;  4PJN A;  2WAQ N;  3VDX A;  1IG7 A;  1TTY A;  1YX5 A;  3AG1 H;  3WG9 A;  1R4M B;  4D9J A;  5JR3 A;  3CLQ A;  4IOA F;  2LY2 A;  1BOB A;  1I27 A;  1WJD A;  3BG5 A;  5J8F A;  1HW5 A;  4U88 A;  4B3A A;  4S04 A;  1LUJ B;  1J5Y A;  1SD5 A;  3P5J A;  1YIO A;  2OZ6 A;  4A69 C;  3M8E A;  1D0Y A;  5LGN A;  2R5Z A;  4IRG A;  3QP5 A;  4RBO A;  2NAZ A;  3VFZ A;  1XPX A;  2XPW A;  1MBJ A;  4BXX J;  4BQN A;  3JTH A;  3OYK A;  2KIU A;  3G71 I;  3ROU A;  1VQK I;  2L5Q A;  3QPS A;  2J5O A;  2DQR A;  1ERD A;  1I39 A;  4H4K C;  1PDN C;  1YW8 A;  4W1U A;  2UV1 A;  2BVL A;  3QYB A;  3DTI A;  1MDM B;  1IV8 A;  1D1A A;  5H6Q A;  1SD6 A;  3ZMV A;  3OSF A;  4IRH A;  2VOP A;  1UB9 A;  3S1N J;  3H3U A;  1JE8 A;  3PQK A;  4LB6 B;  1LNW A;  1TT5 B;  1UFM A;  1IUY A;  4J19 A;  1B59 A;  2M0C A;  2QQA A;  2FMY A;  3VSK A;  1ZRE A;  1HC8 A;  4JP0 A;  1Z6R A;  3I71 A;  2CH0 A;  2VXD A;  1ULY A;  3QPT A;  2JRT A;  2G7H A;  5B1B H;  2L9R A;  4UB8 C;  1BN5 A;  1DPU A;  4B44 A;  2BV6 A;  2ETH A;  4ZYD A;  4HX4 A;  4C3J J;  1LDJ A;  3K70 D;  4G6T B;  3CUQ C;  2GWR A;  3E7L A;  3ZQF A;  3LSM A;  3I0T A;  1FYM A;  1AHD P;  4MEX F;  2VKD A;  1JTY A;  1V55 H;  4L5I A;  4A3G J;  4K2E A;  3A01 B;  2R7O A;  1Y39 A;  2N8G A;  1XX5 A;  1ZGA A;  2Y0S N;  1VTN C;  1N75 A;  1FJL A;  4PGG A;  1ETW A;  2XGE A;  4Y3O A;  5CYV A;  5GTI C;  4XKB A;  2M30 A;  4AYB A;  2F5V A;  1DGR M;  3BPX A;  3L00 A;  3LOC A;  2F2E A;  4U0Y A;  1UG2 A;  1K4S A;  5DYM A;  2PMZ N;  3L2U A;  1AWC A;  2VQL A;  1HF0 A;  4LG0 A;  2PFB A;  4LIV A;  4NDL A;  2OTJ I;  3FHZ A;  2COM A;  2QQ9 A;  3FX3 A;  4XM3 A;  2WV1 A;  3IRR A;  2DOE A;  2EV5 A;  4CCO A;  5F04 A;  2E2J J;  3JAM Z;  1R71 A;  3DKX A;  2HYJ A;  4BXU A;  2KIM A;  1HW1 A;  2BZT A;  1SFK A;  2MBF A;  2K02 A;  3JRA A;  2I10 A;  2QBY A;  3BT9 A;  4XRF A;  3P9I A;  1J0R A;  1YRN B;  1ZRC A;  2YUS A;  4II2 A;  4EM2 A;  1L0O C;  2R4G A;  3CMA I;  4BE1 A;  3RKW A;  2ZKZ A;  4QPQ A;  4GDF A;  5JVT A;  1U8R A;  4KDP A;  1YG2 A;  2QWW A;  4IQJ A;  2D1H A;  2AHQ A;  3GVA A;  4YFK F;  5LRR A;  2R7Q A;  2ZJP F;  3WTW C;  3RIR A;  2DOF A;  1WJA A;  3S32 A;  2O03 A;  2W82 A;  2W24 A;  1BW6 A;  4MNU A;  4UY8 I;  3JAM K;  2HR3 A;  3ABL H;  1N77 A;  1JJ8 C;  4GFB A;  3FK7 A;  4RLF A;  3AKZ A;  4A2U A;  2ZBK A;  3CUO A;  3UKG A;  5FRM A;  4AIK A;  1FSH A;  1QU3 A;  3H0G J;  3C1D A;  4ZTF A;  5DTD A;  4A3K J;  1FEX A;  4FE4 A;  2KLO A;  1RI7 A;  2LRE A;  4N4O B;  4UHT A;  2LP0 A;  2DMU A;  3I53 A;  1U9N A;  2E5Z A;  1SFU A;  1YW9 A;  4I01 A;  3ZQQ A;  1Y6I A;  2E2H J;  1YS6 A;  3GBG A;  3KLO A;  5FFX A;  5J8C A;  5M3F J;  3V4G A;  3GUD A;  3EUH C;  2O61 A;  3BTL A;  3E5U A;  4AC0 A;  2VKE A;  4BXF A;  4YEL A;  2LTP A;  2DT7 B;  3Q0U A;  5AIQ A;  4M9S A;  1VFC A;  2A68 F;  5EZH A;  2DK8 A;  1K4T A;  4ZC3 A;  1MJB A;  2Q2E B;  3D0S A;  5BPD A;  2V6E A;  1N78 A;  3BC8 A;  2ME6 A;  1H9G A;  2BE5 F;  5KAI C;  1TQP A;  2WAD A;  1HKQ A;  4DZJ A;  4UV8 A;  3BR3 A;  2HI3 A;  2NOJ B;  4RB0 A;  1CF7 B;  5E3N A;  1RR7 A;  2OC6 A;  3GWZ A;  1MZB A;  3PNV A;  1X4O A;  3F8N A;  5HVQ C;  2BY3 A;  5TGT A;  4A3F J;  4WXC A;  1VQ8 I;  1U2W A;  2ZJ2 A;  3A0B C;  3SHF A;  2HU9 A;  5E17 F;  4I09 A;  3RJP A;  4FET A;  3HDD A;  1S9H A;  4M3E A;  3FBI B;  4C3H J;  3CCV I;  4IXA A;  3RYR A;  2DXI A;  2JSP A;  1SEU A;  2MW8 A;  4RLQ A;  1ENH A;  5DUI A;  2R7Z J;  1FYL A;  3FZV A;  3RPU A;  3K9T A;  3V42 A;  5B3S H;  1YW7 A;  1VZ0 A;  1U5T B;  4GGG A;  5K5R A;  5LGU A;  3PIO F;  3DPT A;  1GDT A;  1RIO H;  5CVR A;  2K85 A;  3ASN H;  1MSE C;  4BHB A;  5DCM A;  5A2Q Z;  5D4R A;  5GPC A;  4BDY A;  1UHM A;  4XKV A;  5AIP A;  2ESH A;  1ODD A;  3W2A A;  2RKH A;  9ANT A;  2JZY A;  4NB5 A;  3N97 A;  2HZT A;  4U0W A;  3ZCO A;  1IV6 A;  1WWX A;  4KMF A;  1VQ6 I;  2M45 A;  3HTU A;  2BY1 A;  2P0W A;  4PSW A;  5FD5 A;  4RB3 C;  3PNT A;  3HXL A;  4KN4 X;  5BOX A;  4IKF A;  3BG3 A;  2ZSH B;  3BDD A;  1U3E M;  2ZJQ F;  3CJQ B;  4IZZ A;  4ZDO A;  3TW7 A;  4NHJ A;  3OR1 C;  2F4O B;  1ZTR A;  2XSJ C;  2CU7 A;  1NHA A;  1RUN A;  1MJ9 A;  1YFH A;  4IHW A;  2X6X A;  1LDK B;  1A5J A;  1KA8 A;  4PZJ A;  4Q4Z F;  2O0Y A;  4O6J A;  3MKZ A;  4YIR X;  3F6O A;  3ZQI A;  2V1N A;  3C7J A;  5EG0 B;  6PAX A;  1QO0 D;  3F3X A;  2EFQ A;  3ELK A;  2O6G E;  4A3L J;  3CCS I;  5HOD A;  2VI6 A;  3M3Y J;  4FTH A;  1DQU A;  2B9S A;  3N4M A;  2CQK A;  1BA5 A;  2F4I A;  3GFJ A;  4BQO A;  3OYN A;  2W4S A;  4EJW A;  3KIO A;  5EYR A;  1FOW A;  3FM5 A;  3LWF A;  1SMT A;  3BJA A;  3GFL A;  5HNH A;  5K7H A;  3WG7 H;  3KFW X;  2DFH A;  1QGP A;  2KKO A;  3QYF A;  2K9Q A;  2A5Y B;  2KIS A;  3FXM A;  5IY5 H;  3OYF A;  1T33 A;  2DYS H;  1HLV A;  3S1Q J;  1HQC A;  2CFX A;  2KT0 A;  4BDZ A;  4P5O A;  4ENJ A;  4XBF A;  3MWM A;  1NH3 A;  2YR2 A;  2LH9 A;  2JA7 J;  4IO9 F;  2Z99 A;  2VBZ A;  2FOW A;  4Q48 A;  3MN2 A;  4XLH A;  3I54 A;  5IOY A;  2QZ8 A;  2LVS A;  1UST A;  4ZYH A;  2EIL H;  3DKY A;  2X6Y A;  1OCP A;  2E60 A;  1U78 A;  2WWY A;  1GHC A;  3S3O A;  4MTE A;  4HF0 A;  1AKH B;  1B8I B;  5FLV A;  1G3Y A;  2V26 A;  3IL2 A;  3WOD F;  4XRS A;  2XAG A;  2JQ7 A;  3FXL A;  2CYY A;  4BHP A;  3E5X A;  4OIP F;  2KP6 A;  2W00 A;  1WCM J;  1OKR A;  1IF1 A;  3TGN A;  2JSC A;  2YX7 A;  2M4K A;  4HEA 2;  4YG2 F;  1QNT A;  4FHT A;  2K3F A;  5ILV A;  2HQR A;  2M7B A;  4M6X A;  5ERI A;  4CSW A;  2XV4 S;  3CJR B;  5KAF C;  3EYI A;  4HLY A;  5LGT A;  5D5X B;  2W7N A;  2DYR H;  1XG1 A;  2ISY A;  3CCL I;  2WA0 A;  5CKT A;  1T0F C;  4A3D J;  5JLW A;  2CW8 A;  2P8T A;  1FT9 A;  3W6V A;  5ILU A;  3IKT A;  1QVT A;  2VPL A;  2HXO A;  3GLL A;  3RSN A;  3ERE D;  4XIC A;  2K7L A;  5CVI A;  1IUF A;  3QOD A;  2EIN H;  2G7U A;  1K78 B;  4LB5 A;  2PX9 A;  3DPU A;  2DJI A;  1W7P A;  3KEO A;  4XRM A;  3BR6 A;  3NWS A;  3R61 A;  3ERM A;  2PMH A;  3BLY A;  3DBR B;  2LY9 A;  2H27 A;  3WTU C;  2Y2Z A;  4XOT A;  1XGS A;  3GF2 A;  3M1C A;  5B5E C;  2IXS A;  1HKS A;  3CES A;  5EF6 A;  3PO3 J;  3H5N A;  1Q1H A;  2DPD A;  2HDW A;  3HM5 A;  4ON0 A;  3HYI A;  3HSF A;  3HHH A;  3HBL A;  3MEX A;  3UNG C;  2EJR A;  3GYH X;  5L3E A;  4D7M A;  2HKX A;  4JYK A;  2WY7 Q;  5ED4 A;  5CJ9 A;  3CJT B;  5KHD A;  1ETY A;  4L5J A;  1X3Z B;  5L3C A;  1MD0 A;  2F4M B;  1IDZ A;  4PJM A;  4A0Y A;  3BG7 A;  2GIZ A;  2K9M A;  5FRO A;  4DZP A;  2DA6 A;  3K1N A;  2K4J A;  3TP0 A;  1JGS A;  1FIP A;  1Y1V J;  5CQG A;  2BXY A;  2L4M A;  1IZ1 A;  3F8C A;  4L18 B;  3GTM J;  1U8B A;  2DMN A;  3FMQ A;  2H6B A;  3T0Y A;  2QCO A;  1W36 D;  2VON A;  5FB2 A;  2AQF A;  2XF5 A;  3F21 A;  4HV5 A;  3JR9 A;  2IS1 A;  4NQW B;  3E1S A;  4ZYA A;  2NVT J;  5ICE A;  1W5T A;  2AXL A;  3PSI A;  5DM7 F;  2OTL I;  2XUB A;  4G8X A;  1Y0N A;  4BJ6 C;  5J47 A;  3FHN A;  2DA1 A;  3HOY J;  2D2W A; 
#chains in the Genus database with same CATH homology
 1SD7 A;  1TLH B;  1BOA A;  1XSD A;  4IJA A;  2F5E A;  1IXR C;  4MTD A;  2STW A;  1I1G A;  4H0E A;  3RPQ A;  4LMY A;  5HS7 A;  2FE3 A;  3WE2 A;  4G94 A;  3ZN1 A;  2V79 A;  5DD8 A;  1R36 A;  2QLZ A;  3HOS A;  2ZME B;  3OOP A;  3VOE A;  4P9F A;  1J75 A;  4FX4 A;  2C6Y A;  4KYW A;  2MH2 A;  1KYW A;  3F22 A;  5IT3 A;  3ZPL A;  4RAZ A;  4IF4 A;  3GZ6 A;  2MD5 A;  4LG0 B;  1B6A A;  3SFZ A;  2DT5 A;  4BHC A;  2P6T A;  2UWM A;  4OU0 A;  1SAX A;  3HOT A;  2OA4 A;  1A04 A;  1XB4 A;  4B8X A;  4G6Q A;  4AIJ A;  1WQ2 A;  3OV8 A;  4EMS A;  2HS5 A;  2KJB A;  3FWE A;  2FU4 A;  4OIQ F;  2L02 A;  4P9U A;  2EB7 A;  1Z9C A;  1MGT A;  4U7D A;  4JQF A;  2V1X A;  2OU2 A;  3CUQ A;  4N9I A;  1S29 A;  3TO9 A;  1R5G A;  4JBA A;  1G3S A;  5DCF A;  4HDU A;  3E3V A;  1H0M A;  1KU2 A;  2L01 A;  3IWZ A;  1BI1 A;  1FOK A;  4XLN F;  1MKM A;  3C18 A;  3K1P A;  1JHH A;  2K86 A;  1ZRD A;  3R6S A;  4Q5S F;  1ZAR A;  4I7H A;  3SQN A;  2NS0 A;  5FO5 A;  3QU3 A;  4FT8 A;  1OYY A;  2RQP A;  2GQQ A;  1S6L A;  4LLG F;  1SD4 A;  4Y17 A;  1SFX A;  3S2W A;  1FBQ A;  4KUM A;  3MFK A;  4ESJ A;  4AD9 A;  1J9I A;  2F5D A;  3TDU C;  1FP1 D;  2ZCW A;  1O3S A;  1UHW A;  4R1H A;  4ENN A;  2EWN A;  4CXF A;  3HRM A;  1O7F A;  1I6X A;  1FNN A;  1ZLK A;  4L9J A;  2TDX A;  3F23 A;  4Q47 A;  2QVO A;  2EK5 A;  4XSX F;  1IN7 A;  1C0W A;  1TBX A;  2ZFW A;  2OQG A;  3EUH A;  4ENM A;  4L0Z B;  2IRF G;  5HS9 A;  3V8K A;  1XN7 A;  5EEG A;  4EQQ A;  5HLH A;  1GXP A;  2Z3Y A;  4WX9 A;  4M71 A;  1RNL A;  1P92 A;  2DU9 A;  1BC8 C;  2DPU A;  2X0L A;  1YLF A;  2FOK A;  2P6S A;  2RC4 A;  3WTT C;  1J59 A;  3J7A O;  2DO7 A;  2P5K A;  2R3S A;  1F9N A;  3TO6 A;  2YX4 A;  2R7D A;  5LEK A;  1ON1 A;  4HBL A;  3KCC A;  3M7G A;  3K1M A;  3WTS C;  2HTS A;  1XGM A;  4U0V A;  3V7R A;  1IW7 F;  5JI6 A;  3KP6 A;  1Z1D A;  5K1Y A;  1R58 A;  1QZY A;  4HOB A;  3ECO A;  5J6X A;  4EJV A;  3WTX C;  3U1D A;  4CZZ A;  2XAF A;  2O3F A;  2EFW A;  3KP2 A;  3VOD A;  1KQ0 A;  4KN7 X;  3WU0 A;  5DD4 A;  1EH7 A;  5BPI A;  4DQ2 A;  5LRS A;  2BGC A;  2VOO A;  2Q8K A;  5ICF A;  3SHF A;  1XGN A;  4HQM A;  2CSO A;  2CG4 A;  2FRH A;  2Y75 A;  3TO7 A;  4EJO A;  2LSO A;  5DV5 A;  4JK1 X;  2NYX A;  2W85 A;  2HYF A;  1BC7 C;  1FP2 A;  3BJO A;  4MHG A;  2ACJ A;  3HTS B;  1J2X A;  2GAU A;  4EM0 B;  3LQR A;  2P5L C;  4KIG A;  3DF8 A;  2Y0M A;  2E1N A;  2KRF A;  3TQN A;  2VE8 A;  3V8J A;  2DFI A;  2JPC A;  1FSE A;  5LHI A;  1XGO A;  2PG4 A;  3T8R A;  4HX8 A;  4ZYE A;  3EQL F;  5BS6 A;  1ONV A;  1PP7 U;  5FD6 A;  4U7B A;  5DUK A;  4ENK A;  3LAJ A;  1S8N A;  3O3K A;  4KIF A;  2CW0 F;  4WF2 A;  3WU1 B;  1REP C;  4PCQ A;  2VT2 A;  2HGC A;  2OQR A;  2RV8 A;  3Q9S A;  4LJZ F;  3DKW A;  3EET A;  3JTG A;  2H09 A;  2WC2 A;  4DNC A;  3BRO A;  1T0F A;  2NNN A;  3ZMZ A;  2CO5 A;  2VBY A;  3I64 A;  4KIB A;  5LHG A;  2FEZ A;  1IXS B;  4N9H A;  1MDM A;  1T39 A;  3LAP A;  1LEA A;  3U2R A;  3JSO A;  1PUE E;  4L9V A;  2VN2 A;  3V7C A;  2G9W A;  4CIC A;  2RGV A;  2OD5 A;  5H6R A;  1Z6T A;  4UV9 A;  2BBY A;  3E5Q A;  2E1C A;  1V3F A;  4WWC A;  5E8I A;  4RGX A;  3P7N A;  2ISZ A;  1HST A;  5E8G A;  1O7L A;  2QM3 A;  2HDC A;  1IRG A;  3WE3 A;  3W6K B;  2OZU A;  1P4A A;  4KA4 A;  5E1Z B;  4ZH4 F;  1TW2 A;  1ZN2 A;  2FBI A;  1AOY A;  1ZG1 A;  5ICC A;  3MQ0 A;  4CO8 A;  1QBJ A;  3H92 A;  3C3W A;  1BI0 A;  4BH9 A;  3F72 A;  4S05 A;  1HKT A;  1IAW A;  1EH8 A;  3T5X A;  3QPH A;  2FSW A;  1XSV A;  2WV0 A;  3KP7 A;  3PFI A;  2LKP A;  3W6J B;  1WRJ A;  3J80 K;  1T6S A;  2B0L A;  2EA4 A;  4HW0 A;  4KFC A;  5H20 A;  3FXR A;  2VE9 A;  5FFZ A;  1ZH5 A;  3HRT A;  1ON2 A;  3MAJ A;  4EVI A;  5TJJ A;  3LST A;  2L54 A;  1ZG3 A;  2PN6 A;  2ELH A;  2XIG A;  2V1U A;  4HYE A;  1FYK A;  1FY7 A;  2VBW A;  2FBK A;  1O3T A;  2M87 A;  2F5C A;  1D8J A;  3GO5 A;  3H3Z A;  2P5V A;  1WSU A;  4YFX F;  2DW4 A;  2FML A;  4HV6 A;  2J5P A;  4A6E A;  3I59 A;  4HLX A;  3ZMS A;  1YO5 C;  2V6C A;  2M8E A;  2IA1 A;  2IW5 A;  3CO7 C;  2O8X A;  5KVR A;  1FBU A;  3R0J A;  1F4K A;  2VT3 A;  1W7P D;  3LFK A;  2VC0 A;  2VC1 A;  1SMY F;  1S7A A;  1R1V A;  2A61 A;  3NRV A;  4EJT A;  2Q2E A;  3BP8 A;  3F8F A;  2OAZ A;  4P96 A;  2PEX A;  3ZMD A;  3J81 K;  1OYW A;  1CF7 A;  1HW2 A;  3HRS A;  2KJC A;  1U6G A;  4IVN A;  1LDD A;  2GIV A;  2PMU A;  2NNY A;  4I0A A;  4LFU A;  5JFR A;  2LNB A;  4YFN F;  4OOI A;  1QQI A;  4AIH A;  1FWZ A;  1B4A A;  1IN4 A;  1TQI A;  3ABU A;  5CVV A;  1E2X A;  1OYI A;  1WKM A;  4WXD A;  1BJA A;  3KZY A;  1OMI A;  2XAS A;  5EEH A;  4G7H F;  3DP7 A;  3B73 A;  2EV0 A;  4L9N A;  3DV8 A;  2VXZ A;  1O57 A;  2FQ3 A;  2RDP A;  2Y48 A;  3L2C A;  3EDP A;  3HSE A;  3D5L A;  5DDG A;  4UNO A;  3MZY A;  1XMA A;  2YSR A;  5L3G A;  2HEO A;  2IPQ X;  4M74 A;  4ETS A;  5D5W B;  1XSX A;  5HDN A;  3KEQ A;  2DQL A;  3TOB A;  4HAM A;  3TKY A;  1D5V A;  1DP7 P;  3E6B A;  2XAQ A;  1DDN A;  2QQB A;  3DEU A;  4UVB A;  4ESB A;  1P2F A;  4EGY A;  1G4D A;  2QBY B;  2K27 A;  4A0Z A;  4CHU A;  2XKO A;  4WCG A;  1HXD A;  3RYP A;  1T98 A;  4RAY A;  1TW3 A;  1BI2 A;  4RB1 A;  5CVU A;  1L3L A;  4KIC A;  5BMZ A;  4GYG A;  5BQT A;  1QZZ A;  4EM1 A;  1IXC A;  1K7A A;  5D5V B;  3GEZ A;  1ZGJ A;  4EJU A;  2QEN A;  4HX7 A;  4WXH A;  1ZRF A;  3CDH A;  3L7W A;  3P9K A;  3CO6 C;  1U5T C;  3B02 A;  2XAH A;  1X3U A;  2P7C B;  1KQ9 A;  3SZP A;  3IRQ A;  5HS8 A;  2Z9O A;  3REO A;  1YS7 A;  3O6B B;  4PDK A;  1B1B A;  3FF5 A;  4A0X A;  2DK5 A;  5E18 F;  4IHT A;  5K5Q A;  2GXG A;  1HSJ A;  5L3D A;  3L09 A;  4AVP A;  3WGI A;  1K78 A;  3R60 A;  5IT9 Z;  2RN7 A;  2FF4 A;  2MLK A;  1CGP A;  2MC3 A;  5DCM B;  1FPQ A;  4GCV A;  1D8K A;  2FXA A;  3LQQ A;  4I0B A;  1IN8 A;  2EFO A;  2RVC A;  1JXS A;  1V4R A;  1ZG5 A;  3V8L A;  2Z33 A;  2ZO4 A;  1F5T A;  2JT1 A;  2AS5 F;  3T1B A;  2V1D A;  5F64 A;  3WTV C;  4ZYG A;  4AWX B;  5IT9 K;  2EA2 A;  2VOD A;  1YTY A;  2HTJ A;  2IT0 A;  3WTY C;  3ISP A;  3DXJ F;  4NQW A;  4OMZ A;  5HLI A;  2P7V B;  4RB2 C;  1YYV A;  3IKV A;  4EV0 A;  4O3M A;  5D6F A;  2JTV A;  1STZ A;  2DLL A;  3CJN A;  2LF7 A;  1LB2 A;  1GXQ A;  3CLO A;  3TOA A;  2IVM A;  4QWQ A;  3FXQ A;  4MEY F;  4M9X A;  1XCB A;  3IHU A;  1FBS A;  2E7W A;  3BOQ A;  2UZK A;  3GX4 X;  3TDZ C;  2XAJ A;  3ABT A;  1QPM A;  1OR7 A;  4MQ9 F;  4ZZD A;  3E97 A;  3F8B A;  4OIO F;  2ZME A;  3KP4 A;  3VEP A;  4KT5 C;  3ECH A;  2XRN A;  3IWF A;  1T2K A;  2BYV E;  1FC3 A;  1UCR A;  3KET A;  2HFH A;  4ESF A;  1ZYR F;  5ILS A;  2D1V A;  4G6D A;  3MZH A;  1I5Z A;  4LD5 A;  1IN5 A;  4LGW A;  4RGR A;  2WTE A;  3DFG A;  4F7Z A;  4BQA A;  1XDU A;  4I98 B;  3WGG A;  3SXY A;  1KQ8 A;  3E6M A;  1DPR A;  2DAO A;  3GZ5 A;  1G3W A;  3HSR A;  4G7Z F;  1Z91 A;  3QP6 A;  5HDK A;  2XRO A;  1XCV A;  2UXX A;  3M8F A;  1SFE A;  1F1Z A;  2PJP A;  3AAF A;  1RUO A;  5LHH A;  3BZ6 A;  2HQN A;  2HKO A;  2MA3 A;  4L9T A;  1Y0U A;  2F5F A;  1W7P B;  3HRU A;  3ZQ7 A;  3BJ6 A;  3QU6 A;  4LLN A;  2IA0 A;  3IC7 A;  2XVC A;  3I59 B;  4PGH A;  4RS8 A;  4Y15 A;  3R4K A;  1Z05 A;  3ZMU A;  2DBB A;  4M72 A;  4EGZ A;  4R79 A;  1D3Y A;  2K4B A;  2DTR A;  2Q0O A;  2L3D A;  2PBI A;  1EV7 A;  2QYO A;  3FXU A;  2MH9 A;  1LQ1 A;  3E6D A;  1BBY A;  1KGS A;  1TQM A;  2H94 A;  2D45 A;  3ZP5 A;  2HWV A;  3RTR A;  2W57 A;  4UVA A;  2GA1 A;  2STT A;  3R0A A;  4LK0 F;  4LLL A;  1ZAO A;  3GXO A;  4HQE A;  2W25 A;  3DPL C;  4ZZL A;  1LEB A;  3M9A A;  2A07 F;  5D6E A;  1EH6 A;  3RKX A;  3K69 A;  3KZZ A;  5TRD A;  1K79 A;  3BY6 A;  4N0B A;  5D5U B;  2XGX A;  3KE2 A;  2A69 F;  4QLC U;  1O3Q A;  5D8L B;  2A3S A;  2YU3 A;  1OPC A;  3PQJ A;  4GYI A;  1H9T A;  5ICG A;  4G7O F;  1BIB A;  2H6C A;  5A2Q K;  1R7J A;  3SZT A;  1FX7 A;  3V7S A;  1WI9 A;  1R22 A;  1FZP B;  3ML6 A;  5FGM A;  3HHG A;  4O5V A;  1BIA A;  3J80 Z;  4GXO A;  1XMK A;  2R7F A;  5E1W A;  5DEQ A;  5JHU A;  4OIR F;  2JPB A;  1R5H A;  2XHK A;  3VB2 A;  4HF2 A;  5E20 A;  1T38 A;  1HBX G;  2M1B A;  5LLQ A;  1GVJ A;  1KU9 A;  2GA2 A;  3QRF F;  2ZXJ A;  1R1T A;  2YPR A;  4A12 A;  2LF8 A;  2X4H A;  4HA8 A;  5AON A;  3FMR A;  1TNT A;  1KYZ A;  3CUQ B;  4E70 A;  3LA2 A;  5L3F A;  3P9C A;  4D0P A;  3L9F A;  3LA3 A;  2IJL A;  3GFI A;  5HOO A;  4YII A;  4UVC A;  4L0Y B;  4P55 A;  5F6F A;  1P6R A;  4FX0 A;  4LK1 F;  3FM3 A;  4Y13 A;  2MLG A;  2FBH A;  4A6D A;  4CYD A;  1Z7U A;  3GLX A;  1W4M A;  2E7X A;  2ZNY A;  1S3J A;  1BI3 A;  3Q9V A;  3BPV A;  3G3Z A;  1DUX C;  1W5S A;  3ULQ B;  2FNA A;  3I5U A;  1R1U A;  3JSP A;  3WGH A;  4OMY A;  3KP3 A;  3GFM A;  3J81 Z;  4A5M A;  1USS A;  5F1R A;  2GXB A;  2EV6 A;  4M6Y A;  3F6V A;  3RKY A;  4TV7 A;  4ASN A;  3NEU A;  3G73 A;  2FA5 A;  2PI0 A;  5D8K B;  3K2Z A;  2EFN A;  2CGP A;  1RZ4 A;  4RGS A;  4MQV A;  3GW2 A;  1G6N A;  3JW4 A;  4CGZ A;  1ZHF A;  1U5T A;  1J7K A;  2VBX A;  2A6E F;  4G9Y A;  3ZN0 A;  3T8T A;  4I2O A;  1TNS A;  4BYY A;  2HYG D;  3I4P A;  5CVJ A;  4WK8 F;  4OIN F;  3RDI A;  1JHF A;  1IRF A;  3FMS A;  4I02 A;  1K6O A;  1P4X A;  2P4W A;  3KLN A;  2IP2 A;  4HZF A;  1MJA A;  1R00 A;  4M73 A;  2KIF A;  3O2P E;  5D4S A;  4KMU X;  2IA2 A;  2L4A A;  2M5W A;  1E17 A;  2Z5U A;  5KK1 A;  2DI3 A;  1ZLJ A;  4XLP F;  2GZW A;  3WTZ A;  2CWE A;  1S7O A;  1YQA A;  5FLX Z;  4IRI A;  1KU3 A;  4R8H A;  2V9V A;  2FNP A;  1XDS A;  1LJ9 A;  1P4W A;  5CLS A;  2RNJ A;  4B09 A;  2OBP A;  4BAY A;  2A6H F;  3F8M A;  5HDG A;  3LA7 A;  4KNY A;  1B9N A;  2BEO A;  1XD7 A;  3ZMT A;  4MGR A;  3M1E A;  4HF1 A;  1LVA A;  4IPA A;  2PLY A;  2NRA C;  4A5N A;  5FLX K;  4HDV A;  3QOP A;  4XSZ F;  3U9G A;  1O3R A;  3E6C C;  4RGU A;  5K5O A;  3BWG A;  3QAH A;  1IN6 A;  2W84 A;  1I1S A;  3HIF A;  4UUV A;  3DQV C;  4M9Z A;  1G3T A;  5L3B A;  1PP8 F;  3KP5 A;  5HLG A;  2ADU A;  2XKP A;  4UXN A;  3HUG A;  4GO1 A;  2HOE A;  2UXN A;  5E1X A;  1FLI A;  4Z2Y A;  3K0L A;  3RI4 A;  5LEJ A;  4YIF A;  2QUF A;  4IHS A;  3Q5F A;  1KU7 A;  1R23 A;  1B9M A;  5LBQ A;  2ZNZ A;  3EYY A;  2LDU A;  3NQO A;  2ESN A;  3CTA A;  4BNC A;  2EFP A;  2PQ8 A;  3I58 A;  4CDG A;  1BM9 A;  3COA C;  1TTY A;  3WG9 A;  5JR3 A;  1I27 A;  5J8F A;  1HW5 A;  4U88 A;  4S04 A;  1J5Y A;  1SD5 A;  1YIO A;  2OZ6 A;  3M8E A;  5LGN A;  4IRG A;  3QP5 A;  2NAZ A;  3VFZ A;  3JTH A;  2KIU A;  3ROU A;  2J5O A;  2DQR A;  1PDN C;  1YW8 A;  1MDM B;  5H6Q A;  1SD6 A;  3ZMV A;  4IRH A;  2VOP A;  1UB9 A;  3H3U A;  1JE8 A;  3PQK A;  4LB6 B;  1LNW A;  1UFM A;  1IUY A;  1B59 A;  2QQA A;  2FMY A;  1ZRE A;  1Z6R A;  3I71 A;  1ULY A;  3QPT A;  2JRT A;  2G7H A;  1BN5 A;  1DPU A;  2BV6 A;  2ETH A;  4ZYD A;  4HX4 A;  1LDJ A;  3CUQ C;  2GWR A;  3I0T A;  1FYM A;  4MEX F;  4L5I A;  4K2E A;  1ZGA A;  1VTN C;  4PGG A;  5CYV A;  2M30 A;  3BPX A;  3L00 A;  2F2E A;  4U0Y A;  5DYM A;  1AWC A;  4LG0 A;  2PFB A;  3FHZ A;  2COM A;  2QQ9 A;  3FX3 A;  3IRR A;  2EV5 A;  3JAM Z;  4BXU A;  2KIM A;  1HW1 A;  2MBF A;  2K02 A;  2QBY A;  4XRF A;  3P9I A;  1J0R A;  1ZRC A;  4EM2 A;  1L0O C;  3RKW A;  2ZKZ A;  5JVT A;  1U8R A;  4KDP A;  1YG2 A;  2QWW A;  2D1H A;  3GVA A;  4YFK F;  5LRR A;  3WTW C;  3RIR A;  2O03 A;  2W24 A;  4MNU A;  3JAM K;  2HR3 A;  4A2U A;  2ZBK A;  3CUO A;  4AIK A;  1FSH A;  3C1D A;  1RI7 A;  4UHT A;  3I53 A;  1SFU A;  1YW9 A;  4I01 A;  1YS6 A;  5FFX A;  3KLO A;  5J8C A;  3V4G A;  3GUD A;  2O61 A;  3E5U A;  5AIQ A;  4M9S A;  2A68 F;  2DK8 A;  1MJB A;  3D0S A;  5BPD A;  1H9G A;  2BE5 F;  1TQP A;  1HKQ A;  4UV8 A;  4RB0 A;  1CF7 B;  3GWZ A;  1MZB A;  5HVQ C;  3F8N A;  4WXC A;  1U2W A;  2ZJ2 A;  5E17 F;  4I09 A;  3RJP A;  4IXA A;  3RYR A;  5DUI A;  1FYL A;  3RPU A;  3K9T A;  1YW7 A;  1U5T B;  4GGG A;  5K5R A;  5LGU A;  3DPT A;  1RIO H;  5CVR A;  4BHB A;  5DCM A;  5A2Q Z;  5D4R A;  1UHM A;  5AIP A;  2ESH A;  1ODD A;  2RKH A;  2JZY A;  4NB5 A;  3N97 A;  2HZT A;  4U0W A;  1WWX A;  4KMF A;  2M45 A;  3HTU A;  5FD5 A;  4RB3 C;  4KN4 X;  5BOX A;  3BDD A;  1U3E M;  4NHJ A;  1NHA A;  1RUN A;  1MJ9 A;  1YFH A;  1LDK B;  1KA8 A;  4PZJ A;  4Q4Z F;  2O0Y A;  4O6J A;  3F6O A;  3C7J A;  6PAX A;  1QO0 D;  3F3X A;  2EFQ A;  3ELK A;  2O6G E;  3N4M A;  2CQK A;  3GFJ A;  4EJW A;  3FM5 A;  3LWF A;  1SMT A;  3BJA A;  3GFL A;  3KFW X;  1QGP A;  2KKO A;  2A5Y B;  1HQC A;  2CFX A;  4P5O A;  4ENJ A;  4XBF A;  3MWM A;  2YR2 A;  2Z99 A;  2VBZ A;  4Q48 A;  3I54 A;  2QZ8 A;  1UST A;  4ZYH A;  1U78 A;  2WWY A;  1GHC A;  4MTE A;  4HF0 A;  1G3Y A;  3IL2 A;  3WOD F;  2XAG A;  2CYY A;  4BHP A;  3E5X A;  4OIP F;  1OKR A;  1IF1 A;  3TGN A;  2JSC A;  2YX7 A;  4YG2 F;  1QNT A;  4FHT A;  5ILV A;  2HQR A;  4M6X A;  5ERI A;  2XV4 S;  3EYI A;  4HLY A;  5LGT A;  5D5X B;  2ISY A;  2P8T A;  1FT9 A;  3IKT A;  5ILU A;  3ERE D;  2K7L A;  5CVI A;  2G7U A;  1K78 B;  4LB5 A;  1W7P A;  3KEO A;  3R61 A;  2PMH A;  2H27 A;  3WTU C;  1XGS A;  3GF2 A;  1HKS A;  1Q1H A;  2DPD A;  4ON0 A;  3HYI A;  3HSF A;  3HHH A;  3MEX A;  2EJR A;  3GYH X;  5L3E A;  2HKX A;  5ED4 A;  5CJ9 A;  4L5J A;  5L3C A;  1MD0 A;  4A0Y A;  3K1N A;  2K4J A;  1JGS A;  2L4M A;  1IZ1 A;  3F8C A;  4L18 B;  3FMQ A;  2H6B A;  3T0Y A;  2VON A;  5FB2 A;  3F21 A;  4HV5 A;  5ICE A;  1W5T A;  2AXL A;  2XUB A;  4G8X A;  2D2W A;  3MCZ A;  3FZV A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...