2K85A

P190-a rhogap ff1 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
SQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLFLQHIHRLKHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Protein binding
molecule keywords Glucocorticoid receptor DNA-binding factor 1
publication title NMR structural studies on human p190-A RhoGAPFF1 revealed that domain phosphorylation by the PDGF-receptor alpha requires its previous unfolding.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2k85A00
2B7EA 1UZCA 2DODA 2KZGA 2DOEA 2KFDA 4FQGA 2CQNA 2E71A 2JUCA 2KISA 2LKSA 2KIQA 2K85A 2DOFA 2L9VA
chains in the Genus database with same CATH superfamily
3WU1B 2HDWA 1QNTA 3M7GA 3E0JB 1U5TC 2KMUA 2KIQA 3JTHA 4RLQA 3I56I 3DWLE 4I99C 1HLVA 1X4PA 1YW7A 2IGOA 1TL8A 4IOCF 4HDUA 3BJOA 3FMQA 1QRYA 1TC3C 3U1KA 4KNYA 5K7ZA 1ETWA 1P92A 2HFHA 4ESBA 2L9RA 2E1MB 1RUNA 1MIJA 2NVXJ 5J4VA 1NG7A 5J40A 1D8KA 4HA8A 1WRJA 2P5KA 1VQOI 1K78A 2X6OA 1VQPI 2VKDA 5KAFC 3LNQA 2EZLA 3QU6A 2W4SA 4C2UA 1TT0A 4XLPF 3HGYA 1R6RA 4RBOA 2Y31A 1ON1A 1U78A 1UZCA 1H0MA 2E2JJ 2GXBA 1A31A 2D2WA 4KMUX 2EJRA 3FXUA 4FE7A 5JHFA 1O4XA 1S6LA 1WCMJ 1OFCX 1ZTRA 1ETVA 5C3EJ 3OIQA 5ERIA 2GA2A 3HHHA 4E6KG 1ZK8A 3TKYA 3MZHA 4N9HA 4XMYA 3C2BA 4UV8A 1P4WA 4GDFA 1QBJA 1T08B 5FLMJ 2QQAA 1Z3XA 5ICGA 2GIVA 1IG7A 2M87A 1TW3A 3HG9A 4LG0A 1ETOA 2CFXA 2LBFB 4XK4A 3CUQB 4IXAA 3BZCA 5GP9A 3VSKA 2ZO4A 3SQNA 3KEOA 5EGOB 2E19A 2NAZA 3HB9A 3A01B 2O8XA 2KISA 2V9VA 3BG9A 1X19A 1S3JA 2CUJA 2XAJA 1G3TA 5D5WB 2W1OA 4EJWA 4B8XA 1OCTC 3EPZA 4A0ZA 2NXNB 2FX0A 3IKVA 2CFOA 2HTJA 2XRLA 3CQZJ 3E5QA 2YU9J 1LNWA 3PM1A 3E1SA 2GBYA 1XDSA 3NWSA 4I0BA 4EM2A 3KPHA 3QPSA 3FZVA 4DBRA 1IDZA 2VXZA 1IV6A 1QQIA 1R1UA 4B43A 2MH2A 3BZKA 4RA2A 2LLKA 4M9SA 4OOIA 3A2KA 1ZG3A 2FBHA 3ZMSA 4HLXA 3DBHB 1ODDA 1WPKA 5F08A 2RDPA 4ZDPA 3KZZA 3KX2A 3FIWA 2WY7Q 3HOZJ 1GV2A 1RKWA 5LRRA 3DKYA 3SZGA 5DM7F 2L54A 2CQXA 3DEWA 5D5UB 3PUBA 1MBKA 5LLQA 1GXPA 2GXGA 3F0CA 2X9DA 3CZ6A 2EFNA 4LLGF 1FOWA 3I4NJ 2H1LA 2QEXI 1YHQI 3HPHA 1DPRA 1F4KA 3V42A 4KMFA 5IT9K 5F0FA 2WBMA 5FKKA 4I2OA 5JFRA 4GXOA 3TOAA 1WWXA 4MIMA 2K9QA 3OOUA 3VYTB 1G8XA 2LSOA 3BT9A 2YX7A 2Y2ZA 4NC8A 4LB5A 3NEUA 4Q5SF 4KN4X 3FKIJ 4CDGA 1V55H 2Q2EA 3J81Z 2K9LA 3FXQA 5GAGJ 1Y8RB 3WGHA 1XSDA 4G7OF 1OCRH 2NNNA 3FXOA 4A3BJ 3HKZA 3MEXA 2XKOA 1TBXA 1YIOA 1SAUA 1BW5A 1Z05A 4QLCU 1FX7A 3IV5A 2AS5F 4B3XA 2M8GX 2ZB9A 3UKGA 1RC9A 4HYEA 1SFXA 2L2OA 2EZIA 3J80K 2KHMA 2R5YB 5J47A 4ZTJA 1OR7A 4RLFA 3L1PA 4XORA 1Y6IA 4LGWA 4PUSA 1FY7A 5F6FA 3CLQA 4PDKA 2P7VB 5DTDA 2ADUA 4ZYHA 4RM3A 3LSJA 2KKOA 5FKOA 1R36A 5FO5A 1JHHA 1MW7A 1MJBA 2PBIA 4UVCA 1EV7A 2LG4A 3JAMK 3LA3A 3CJNA 2DYSH 4XSZF 2X6WA 2K9NA 3HJEA 4X6AJ 1WVRA 5HS9A 4D7NA 4PJLA 1NG6A 2KIUA 1LFBA 1APLC 1Z7UA 3BR0A 4OIQF 3DTIA 1PYVA 2FNAA 1WGXA 2RC4A 1PVEA 1NHAA 5FROA 1Y1VJ 5HDNA 4XONA 4QIWN 5HDKA 3RCOA 2VUMJ 4DYCA 1NTCA 1R49A 1BJZA 1FMWA 3B6CA 3MD2A 1A04A 3H5AA 5LHHA 2AHQA 4JX4A 4DZPA 4B48A 1U8RA 3LSTA 1BA5A 4TV7A 4CHUA 4XN3A 1OISA 2MYSA 1FTZA 1R4NB 1U8BA 2H94A 3H3ZA 1FT9A 2HZTA 2FE3A 4WXDA 4AYBN 4A3EJ 3T5XA 4B09A 1V5GA 2ID3A 4HX8A 3SYTA 3IWZA 4U0VA 1JHFA 1JE8A 5ILUA 1USSA 3EYYA 1Y56A 4MEYF 3S16J 1SFEA 2IS2A 5HS7A 1W5TA 1PUFB 3HOWJ 4M74A 4XM3A 4F52A 1VF9A 3LOCA 3L2WA 3CCEI 4IHWA 5E18F 3B73A 3OYBA 1R5ID 4IHSA 3GVAA 3HYIA 1N25A 4AD9A 1D0YA 1FBSA 4LFUA 3HTUA 2VN2A 5EEHA 3ASNH 2HKXA 1YJNI 3ABMH 3FMRA 1JJ6C 3ZQQA 1LE8B 4M6YA 1HW1A 1YOVB 3W3CA 5CJ9A 1XSXA 1YI2I 1Y39A 1C0WA 1REPC 1V4RA 4C30A 5FD6A 2NNYA 2EIMH 2XRNA 1Y1WJ 3G6EI 4ZYAA 2Z16A 5CQEA 4K2EA 2W24A 3H0GJ 3V8JA 4ITVA 2LKSA 3R0AA 3MKWB 3V8KA 3S93A 3F72A 3GZNB 2VQGA 2CQ7A 4XOTA 4HW0A 2QSFX 4M3GA 4AU7A 5D6FA 3CESA 2IXSA 2E7WA 3GX4X 3N97A 5TISC 2LR8A 3WU0A 2EV6A 2F4OB 2HOTA 4HSRA 2LVSA 3MMYB 5FGMA 1I6XA 2IBDA 2PJRA 2EBIA 1ZRDA 1IO2A 2EILH 3KLNA 3REOA 3ZQFA 3Q3SA 2X6YA 4JYKA 4E7ZA 1J0RA 2JPBA 4U0WA 4IKFA 3T1BA 1HXDA 2MG4A 3RPQA 5M3MJ 2CG4A 3L2CA 3OSGA 4XRMA 2XGEA 4Y15A 4U7DA 2QWWA 4UNOA 1IF1A 2HKOA 1FPQA 2X1EA 2R7WA 4I6ZA 1K7AA 3OMYA 1J75A 2VJIA 1TWGJ 1Z9CA 2WC2A 4FCYA 4O5VA 1QHHD 4D9JA 1S8NA 4L9TA 4XBFA 2JSCA 2K5CA 4NQWB 1LVKA 2DK5A 5J1RA 2DA4A 1YQAA 5ILSA 1VQ9I 3S1QJ 1ZGAA 2DFEA 3IC7A 4F7ZA 5JHUA 3OS0A 2NS0A 4G7ZF 4XRSG 4HRIA 1Y0UA 1S72I 4BL0B 5BNGA 2ELHA 2Y48A 3E6MA 2CQQA 3FF5A 2V6EA 1D8JA 3I4MJ 1XGSA 2STWA 2B7EA 5IOZA 3DLLF 1HSTA 1Z91A 2GOXB 2ZMEB 2OV7A 4EJTA 5DD4A 5BS6A 1ETQA 4ZTFA 4V19K 2H6CA 4IHTA 4FE4A 5J1UA 1CF7B 3PNYA 3OR1C 2HPIA 4C9YA 2STTA 1MMGA 3RZOJ 2LKXA 4LK1F 1BIAA 5FRNA 2R92J 2VLAA 1XMKA 5M5WJ 5H20A 4PJNA 1K4SA 5AIQA 2CMPA 4KA4A 3TP0A 1PDNC 1ZLKA 3VYRB 2IGNA 5F0HA 2M7AA 4Q47A 3K6GA 3GTPJ 2KDZA 2VXDA 2L01A 1RIOH 1SFOJ 2M45A 3GMEA 3E6DA 1O3RA 2PMUA 4FT8A 2VKVA 2GWRA 2E36A 3HOTA 4PSXA 1NH3A 4C2TA 3LMMA 2VJ4A 4OIPF 2F5FA 1GVJA 3GBGA 3P9IA 2DOFA 1A6QA 3H9GA 3BZ6A 2M8EA 5H2FC 2P7CB 2K4BA 4P96A 1D1AA 4JBAA 4LLLA 2P5VA 4HNTA 5JLWA 5LRSA 1X58A 1LDDA 1HC8A 1B59A 2HDCA 2GIZA 2OTLI 2DTZA 2ZSHB 1QZYA 2QSHX 3CJRB 3J7YJ 3RQIA 1XX5A 2ZXJA 2ZNZA 3HXLA 4YRVA 1ACIA 5TJJA 5D5VB 3HSRA 3ZGKA 3H3UA 3HDDA 4A3CJ 4LMYA 4JX5A 3OYCA 3CCYA 1H88C 4A3DJ 5CYVA 2KP6A 4HX4A 2M7BA 3BWGA 5LD2C 2DA5A 1N75A 1OCCH 1JKQC 3MFKA 3LSHA 4IRHA 3VODA 1ENHA 2JRTA 2Q0OA 2GM4A 4NC6A 1I39A 1RRJA 2P4WA 3D1NI 4FX4A 2VPLA 2FXAA 3HZJA 3F8FA 1KU2A 3S1RJ 1AHDP 4DW6A 1YS6A 2ISYA 2HNHA 2O03A 2P81A 1JGSA 2HZDA 2WADA 2K3PA 3W6KB 3K10A 3ULQB 5GAHJ 3CDHA 3HUGB 4BY7J 3LSKA 4Y17A 1O3QA 5FLVA 3D0SA 3PQKA 3HRSA 3ABTA 4UVAA 2H6BA 1PUEE 1OCOH 3OOPA 2KIMA 2FEZA 2QA4I 2WTEA 3ISPA 3CP8A 2R7TA 4G6QA 2Z99A 4UUTA 3WU2C 1QVUA 1K6YA 4OIOF 2XSJC 2E1OA 4S04A 2KT0A 4XSXF 5LGNA 2XSDC 4EJUA 1F1ZA 1IN4A 3DPTA 2Q2EB 2AQFA 2Y0SA 5E8IA 2M9HA 3GTKJ 4ZH4F 4A69C 1TWFJ 1WJCA 2KDOA 3IHUA 4DNCA 1PJRA 5DCMA 3HOYJ 1VNDA 3BG7A 1TP4A 2DA3A 5EYRA 2MGQA 3AL0C 4RB1A 4E7IA 1IJWC 1IN5A 2DA2A 5CVIA 2FOWA 5FLXZ 3FMSA 1Z3YA 3JCUC 3ABKH 4PJ0C 1KYZA 3L2RA 1BOAA 3GTJJ 1MH3A 2OCEA 1YE9A 1QZZA 2CUFA 1MBJA 3K4CA 3Q9SA 3ZMUA 4JQFA 4NDLA 2PQ8A 2VB6A 2RQQA 1A6IA 4G8XA 1FYLA 4NB5A 1T0FA 3WODF 1Y8QB 1LPQA 1WJDA 2COBA 3ZQ7A 2ACJA 3SFIA 2K4JA 2P6SA 2EV0A 3S3MA 3BG5A 3NRVA 2HYGD 3VFZA 3RPUA 4XLNF 3R6SA 1MH4A 1BI1A 3FBIB 2ZJRF 3L2UA 3PNTA 1J7KA 2ECBA 1UAAA 4BHBA 5A2QK 2IS4A 1P7IA 4H0EA 3BQYA 5DDGA 2QBYA 2IS1A 2L9VA 2WV0A 4KIBA 2V9PA 3OYLA 1HKTA 4J00A 3CC2I 2BW3A 3BPVA 2EQRA 3HHGA 1QU3A 2L7ZA 2F2EA 1WJFA 3E6CC 1MJAA 2R0QC 2BHZA 1T39A 2I8DA 2OU2A 3TP3A 1Z6RA 2VE9A 5IOYA 5JVGF 1H89C 2W48A 1IXCA 5HDGA 1EF4A 1WKMA 2MLKA 1BC8C 3OIOA 3TOBA 2ECCA 3K2AA 1TNSA 4IJAA 3JRHA 2ZFWA 3BCAA 1O7FA 4A5MA 4R1HA 3K2ZA 2GXAA 1U2WA 2R7VA 2IS6A 1SFKA 5FB2A 4UUSA 4EEFG 4BACA 5HOOA 4S05A 1NK2P 4YFNF 2DA1A 3LSRA 3G1OA 4MNUA 5KNLA 3RYPA 3TO9A 4A3IJ 1ETYA 2D1VA 3KP4A 4BEHB 5DD8A 1E0EA 2FJ1A 1MMSA 3H92A 2NYXA 1B8IA 1MMNA 1W5CC 1JT0A 1D0XA 1BN5A 1MBHA 2NVYJ 3ZXSA 2G0EA 1TZLA 2L02A 2CWEA 3G71I 2MW8A 2FD5A 4CCOA 1IN6A 3SFZA 2O7OA 2WAQN 3JRDA 1R23A 4BKXA 2RKHA 3BR6A 2H27A 4BQQA 4HQEA 3DTKA 5FFXA 5D8LB 3D5SC 2K3FA 2K85A 3P5JA 4Y13A 4HG2A 3HOUJ 2PLYA 4W1UA 2ZKZA 2R7UA 2DMQA 1RUOA 3IL2A 3BG6A 3DP7A 2K7LA 3LSGA 3GXOA 1UJ8A 2VKEA 2RNGA 4KT5C 4A5NA 2OUMA 3WTYC 3I71A 3O2PE 4Q4ZF 3ERED 3FDYA 2J5OA 5IY5H 4A3JJ 1B72A 3W6JB 5LHIA 3RPUD 3FXLA 1W7PB 4IF4A 2VBZA 2D45A 2NOGA 1EA3A 4PFPA 4PZJA 2DCEA 5KAIC 1LJ9A 4NC7A 2CV2A 2DFIA 3RZDJ 2QKLB 3DTEA 2IGKA 4M3DA 1R1TA 3I54A 3CMMA 1P2FA 1IRGA 1H9TA 2PEXA 3GFIA 1X1DA 1K4TA 4N9IA 2DQLA 1BI3A 1LDKB 4BBRJ 1YIJI 3V7CA 3K4MA 4HLYA 4ENKA 4DGWB 5HLHA 1U5TB 2RQPA 3KE2A 3N4MA 1E3OC 1JGGA 5GTHC 5DUKA 5CLSA 4II2A 3MCZA 1TT5B 5HNFA 1VTNC 5FKLA 3HM5A 4XKVA 4N0BA 2DU9A 4XLHA 4YFXF 2IPQX 2BXYA 1HSJA 4LITA 2Z3YA 3KEQA 1VQ7I 2DI3A 2XGXA 4ENJA 5E79C 3H1CA 4KYWA 4B44A 1YO5C 3PJRA 2RNJA 2X0LA 2PMZN 1B9NA 3LFUA 3NAUA 3GEZA 1MDMB 3NQOA 1TLHB 3BLYA 4G7HF 4IHXA 3BPXA 3TQNA 5DM6F 3J7ZI 2YSRA 2X1DA 2XUBA 2FMYA 4I0AA 1XMXA 4Y4RA 1U9NA 2HTSA 4N4NB 3JRFA 2L5QA 3GO5A 3QQAA 4C2MJ 2DMNA 4D5CA 4M6XA 2HPMA 2FSWA 1G3SA 1POGA 3MKZA 1FSEA 1AKHB 4MO7A 4I02A 4G94A 4MTEA 1VI0A 1B9MA 4YEJA 5F0CA 2J5PA 2DA6A 4EM1A 1XMAA 2KRCA 3TO7A 1BJAA 1AU7A 1VZ0A 2XKPA 3BTLA 3L00A 2V1XA 3CC4I 2QKMB 4ESJA 5JI6A 4OAZA 5D4RA 4A2UA 3V8LA 3VYSB 3Q5FA 3IH3A 4FISA 3K69A 5IYBJ 3ASOH 5DEQA 1DPUA 2WAEA 4OMZA 5D4SA 1YFHA 1R1VA 1MSFC 1RPWA 3LSPA 1Y0NA 5K1YA 1E3PA 1JUMA 1EH6A 2X85A 4Y52J 1N78A 1DP3A 4HF1A 2DT7B 3ZRGA 1ZR2A 1YS7A 3J7AY 3BOQA 2GA1A 3F9KA 4X1EA 3A4CA 2O9LA 2MC3A 4XL9A 1P4XA 2VL8A 1HCRA 4XKBA 1FSHA 3OYEA 2DQRA 1ZHFA 1WFXA 2OZUA 1YJWI 3L09A 2M0CA 1AA7A 1U9OA 2G9WA 4C3JJ 2R5ZA 1P6RA 2V9KA 3TGNA 4EQQA 2YUSA 5L3GA 1O7LA 2Y0MA 4GCVA 5LBQA 3KEYA 4B47A 4UY8I 1DDNA 1HW5A 1FJLA 1QHGA 1EJ9A 1X1CA 3JR9A 3CC7I 2NVQJ 2E60A 2KIFA 2BVLA 3ZQHA 3IRRA 1DUXC 3T8TA 2B0LA 3WHCA 4E7SA 3DFGA 1YRNA 2IVMA 1YJ9I 1A36A 2W84A 5KCMA 2M30A 3QYBA 3BY6A 3ZMZA 1WJEA 1GV5A 1T0FC 4HQMA 3S2DJ 5M5XJ 2E1CA 2NVTJ 1ITYA 2EINH 2QF7A 2VOOA 5K5QA 3CCJI 1ZYRF 2CU7A 2XHKA 1Z1DA 5BMZA 1B4AA 2A05A 2LD5A 2DT6A 1Z6TA 4IEJA 2I5UA 3ZPLA 1RETA 3DEEA 3F8NA 3ECHA 4Z6YA 3RYRA 1OKRA 4NBQA 3CP2A 3EETA 3IUOA 3BR5A 4Y3OA 2DDBA 3I3LA 1VQ5I 5GPAA 1D3YA 4M6VA 4F91B 1V54H 5E3LA 4DYRA 5GTIC 3ZQCA 1UFMA 2EFOA 3HGGA 4I7HA 1ETXA 1ZLJA 2HI3A 3I53A 2BY3A 3KIOA 3SZPA 3CDLA 1F43A 2Z5UA 3JSPA 1YX3A 3IAM2 3M8FA 2KFDA 3K70D 2A5WA 3K4JA 2QCOA 3I55I 3IAS2 2EFWA 1ZAOA 3IKTA 3I0TA 3VDXA 1OPCA 3ZMVA 2QVOA 4P9FA 2X48A 3S17J 2R7SA 3W2WA 3CMYA 3KP3A 2VT2A 4ZDLA 1A35A 4IHVA 3FXMA 1TW2A 2KPMA 2X1CA 1YW9A 2X51A 4G12A 2WAFA 4UV9A 4ANJA 2E5NA 2XROA 2LOOA 5K7FA 5ILVA 1ZARA 4ESFA 4N4OB 2BY1A 2FBIA 4YIIA 3ZR8X 1MGTA 3IP4B 3QOPA 1DGRM 4HAMA 1LFUP 4A0YA 1L3LA 4J19A 4MTDA 2DODA 4DBQA 4BY1J 3K1PA 1W36D 1XS9A 3WTTC 5AIPA 1OCZH 4FX0A 2A68F 2HYFA 2WB1N 1YITI 2JQ7A 1FP1D 3P9KA 5C44J 3GTOJ 1LUJB 2XF6A 4P55A 2NS8A 4AWXB 4I01A 3OYJA 5IT9Z 3E5UA 4AYBA 3DV8A 3JW4A 1I50J 3H3VK 2BHYA 2QBYB 3MZYA 2R93J 5IP7J 1ETKA 2F48A 3HEFA 4EV0A 1KGSA 1GDTA 4AVZA 1J2XA 2JUCA 2QENA 4U7BA 1ZQ3P 4ABZA 5IYCJ 2CW7A 1XSVA 3ZN0A 2R7OA 3PQJA 2B63J 1QZEA 1SVMA 1T6SA 2ID6A 1XCVA 1O3SA 2XAHA 4RAGA 3S3NA 5M5YJ 4AIDA 3DBRB 1DGWY 3FK6A 4BJ6C 1S7EA 2P8TA 2Z1DA 4R79A 1L0OC 4WCGA 2YPRA 3K4KA 3J80Z 4A3FJ 2BE5F 1V5FA 2QUFA 2DTRA 2A3SA 3P7NA 4CGZA 2CSOA 5EG0B 1SVLA 3SJMA 1ULYA 2PX9A 2XB0X 3ZMDA 1DQUA 2M34A 2QZ8A 2DO7A 3GWZA 4BDZA 4HX7A 3TEDA 4IX7A 1B8IB 4AC0A 2MC4A 4D1QA 2FBKA 1TWHJ 4A12A 2R3SA 3CUQA 2CV1A 4KISA 3BDDA 2KRFA 2Y30A 1BL0A 1R5GA 2HQRA 3S14J 3IH2A 3SDGA 2M3AA 2CRGA 2LMDA 3CO6C 4I09A 1SVOA 1Q1VA 3OWTA 2VQHA 5E1XA 3DU5A 2OF7A 2JT1A 1TQPA 2OPTA 1FYKA 1YLFA 1I1SA 2V1DA 3I5UA 1KU3A 1SMTA 2LFBA 3W2VA 2HGCA 3H9JA 1JXSA 3LSIA 4BDYA 1EH7A 1MBGA 1YG2A 2ELKA 1K78B 1HQCA 4M9XA 4RB2C 3PFIA 1XB4A 3WG7H 2HVRA 1BIBA 4CXFA 3MN2A 3MQ0A 5F1JA 4YG2F 3QYFA 4YIFA 2G7UA 2VBWA 5L3DA 2NOJB 3AG2H 4PJJA 4ENNA 3KETA 3JRIA 2DA7A 3OIPA 5FLXK 2V7FA 2DLLA 4BUPA 3WTXC 1MMAA 3ZQLA 4F55A 1T38A 1Z0XA 4PCQA 3RJPA 1K79A 2A69F 2JPCA 4U88A 5GPCA 2H1KA 5HVQC 3G1MA 1N77A 1Z67A 2IA0A 4PGHA 2ESNA 4MFEA 1MNMC 1MJ9A 2OJED 4IZZA 4MHGA 4AIHA 5GAEJ 4LG0B 2OQRA 3Q0UA 2XC7A 4UB8C 2Z2SB 2IJLA 3QPLA 3QWLA 4A3KJ 3W6VA 2LRDA 1FP2A 2M1BA 1J59A 2FA5A 1BR2A 3WE3A 2TRTA 1JJ8C 1X3WB 2DN0A 5BQTA 1S5LC 3AFHA 4HOBA 4EGYA 4RS8A 2JA6J 4BE2A 1ON2A 2XAFA 2EA4A 2HQNA 3A0BC 4ZZLA 2KQRA 3AKZA 4O6JA 3TDZC 4AIJA 3EUAA 4EJVA 3RTRA 2LF7A 1W7PD 3SEQA 2BZTA 1WJAA 1YX5A 2EWNA 5BPDA 1R4MB 1OQYA 3L9FA 4L0YB 2V79A 1HDPA 3I59A 5DUIA 3CO7C 5DS9A 1Z21A 2EV5A 1OJLA 3QPHA 5FKMA 4PFOA 1OMIA 3E7LA 3WTVC 3F23A 3OYHA 1SD7A 3ELKA 2MD5A 2L7MP 4I76A 1W1WE 3OL3A 2EFQA 4Q48A 2LKPA 2HQ5A 3LL7A 1R22A 1T8IA 2E34A 1XC5A 1MNDA 2MABA 4RMNA 4BJ5C 1IN7A 5E3MA 2RGVA 3OS1A 3DCFA 2CO5A 4B1RA 4M3FA 2HR3A 5KVRA 2NRAC 1RKTA 3RKQA 1S29A 1IUYA 3E3VA 3DKWA 1ZN2A 1JKRC 4KIGA 1XTAA 2VQCA 4ZYDA 4CZZA 2IT0A 3BTCA 2DJIA 3AG1H 4RGXA 4XQFA 3M07A 4MQVA 5HODA 4ZC3A 2KLOA 2CJJA 2XAQA 3OYAA 4XLEA 1CQTA 3TL4X 3JRGA 4YELA 3BQZA 2CS3A 5B3SH 2UUZA 3G73A 4KT6A 4M3EA 2R7FA 2EZKA 2HXIA 4KITB 2WWYA 2ZFUA 4P5OA 1QPIA 4NUBA 4E7LA 2ZSIB 3M4OJ 3L2QA 3FXJA 4QSHA 3QP5A 4BXXJ 5B66C 2M2EA 2MA3A 2DOEA 3H5NA 3RKYA 3PFYA 3GTGJ 1QVTA 2JVGA 4E70A 5BPIA 4A3LJ 2W00A 1F36A 1UHSA 4CCNA 2LK2A 2AO9A 3P9CA 5E17F 4PJMA 2LNBA 1FMVA 2BXZA 2OBPA 3HBLA 3RIRA 4YFKF 3CCQI 2VBYA 3KYDB 2RREA 1SD6A 4MGRA 3CJTB 1SANA 3HC7A 1WHUA 5JLXA 1WSUA 1B6AA 5EZHA 1VQKI 2R5ZB 3BROA 1FWZA 2XAUA 2QM3A 3KP6A 2PJPA 3PSIA 5EDNA 1HKSA 4EATA 2JK3A 5J3LA 4QPQA 1UELB 3MVPA 4BAYA 2LY2A 3HIFA 3QAHA 2Y9ZA 2CQNA 2C6YA 3F6VA 1WH5A 3FXKA 2R7XA 5IT3A 1XGOA 4G9YA 4IL6C 1DU0A 2P6TA 2O61A 3HRMA 1FZPB 2GOMA 2DT5A 3SZTA 5KHDA 4RAFA 2L3DA 3RKWA 4UVBA 2OTJI 1G4DA 4OMYA 4KDPA 4H4KC 1X1BA 2FU4A 2MLGA 3OYGA 2HOAA 5HLGA 1D1BA 1B1BA 3M9AA 2ZXHA 5FJ8J 1ZREA 1PP8F 5LFAA 2HVSA 4GGGA 2OQGA 1FTTA 1LE8A 4UUVA 5D8KB 3CTAA 4XLAA 1XG1A 2K86A 4L9JA 1LEBA 5E3NA 3G4SI 3KP5A 2XASA 3DQVC 1MD0A 3QP6A 2DPUA 3VSLA 4IQJA 2EIJH 1LQ1A 1U3EM 4LIUA 1KA8A 2E1MC 3CDIA 2L4MA 3BR3A 3DU6A 4BU2A 1IAWA 4HBLA 2VIXA 4PGGA 3S1MJ 3AL0B 4HSTA 2BGCA 5H6RA 3WE2A 3SXYA 4IO9F 5FFZA 5C4XJ 5IP9J 2F5VA 4KICA 4ASNA 2XDVA 2VC0A 1LKXA 3F8BA 2OC6A 1J09A 2DAOA 1T2KA 1NK3P 1X3UA 2V1UA 2LP0A 1UCRA 1ZRFA 1BOBA 1IW7F 2FRHA 4HZFA 4MFDA 1KU7A 1WI9A 2NVUB 3IRQA 3JRAA 3KP7A 3VOEA 3IH4A 3FKJA 3CCVI 4NNJA 2XIGA 2PN6A 2TDXA 3BJ6A 5CPRB 3CCMI 2MBFA 3K1NA 5EJCA 4DIQA 1ZRCA 4XR6A 3AG3H 4EM0B 3PSFA 3GZ5A 1YW8A 4F93B 4JX6A 5HNHA 4LLNA 2LY9A 1Q1HA 3BTJA 2G7HA 3ECOA 4XKCA 1SD4A 1FOYA 2V26A 2O8KA 3OV8A 3CUQC 5LEJA 2Z9OA 1QGPA 4FTHA 4PK4A 4NQWA 3S1NJ 3J81K 2R4GA 2UV1A 3K0LA 4GYIA 3EUHC 1ZR4A 2WV1A 3PIOF 2UXNA 1CGPA 4XLCA 1U0JA 4B4CA 1W5SA 4R8HA 4II3A 3I4PA 2FMLA 1V5EA 3GLXA 1TQIA 1K83J 2P0WA 1KYWA 5ICFA 4FETA 2L4AA 3K7AJ 5DYMA 4L5IA 4DOZA 3RSNA 1XD7A 2ZJPF 2PFBA 4RAZA 4QTRA 5JVTA 2ZMEA 5EEGA 3BR2A 1EKEA 2OAZA 3Q0WA 2RVCA 3PNVA 2CYYA 3DLAA 1D5VA 3WHBA 1O57A 2IW5A 1CF7A 2HDDA 1P9QC 2KJBA 2DFHA 4RAYA 1WQ2A 2WAQA 3JREA 3S8PA 1VQ8I 2PJRB 4BXUA 3HSFA 5E1WA 5TRDA 3RI4A 3K9TA 1LVAA 3KFWX 5C4JJ 1HA8A 3GCMA 2HEOA 4A3GJ 4A93J 2W82A 1SD5A 2FQ4A 4ZJZA 2X4HA 1VQMI 3O6BB 2W85A 4L9VA 3FBNB 2HWVA 4FASD 2VKHA 4JOMA 5CVVA 4IPAA 1ONVA 4XOPA 4E7HA 4ON0A 1XDUA 3BJAA 1VFCA 3R4KA 2IA2A 4ETSA 2XVCA 4QPOA 2CV0A 2ISZA 2YX4A 2DK8A 3X2QH 2QQ8A 1T56A 2HYJA 5B1BH 2IRFG 2ZCWA 1XN7A 1QO0D 3O8GA 2XAGA 5IYDJ 5E20A 2XV4S 3M1EA 4EGZA 2E7XA 3CUOA 3G2BA 3ML6A 4HDVA 5IP6A 2DYRH 1TWAJ 1OYYA 5A2QZ 4LD5A 1XGMA 3FHNA 3LA7A 2DMPA 5M3FJ 3DPUA 4UHTA 2HOEA 4U0YA 4B3AA 4YIRX 1IXSB 4WK8F 2KJCA 2O6GE 2VPRA 1IRXA 3EQLF 3HRUA 3A03A 2IAIA 4M9ZA 2MFZA 3EUKL 4U87A 1BW6A 1IV8A 1RNLA 4ENMA 3ZQGA 2O0YA 3Q0VA 2I10A 5J8FA 2JZYA 3UNGC 3HKZN 3FX3A 2VODA 3SHFA 2LC2A 1FOXA 4DJAA 2EPFA 3MKLA 2XF5A 2XPWA 1I3QJ 3EDPA 4CCMA 3W2AA 4KJZA 3I9V2 3CMAI 2UXXA 4X0GA 3BC8A 3F21A 2PMZA 2JSPA 4V2FA 3HUGA 3H35A 4HF0A 2JA7J 3JSOA 4D0PA 1KQ8A 4RDUA 4CA0A 2YR2A 3OYDA 3BR1A 2HOSA 1IN8A 2XGCA 5B1AH 1I27A 1ZGJA 4LK0F 3CLOA 2CUZA 2E35A 4GRIA 5F27A 1HF0A 1GUUA 4F92B 2HU9A 3NWTA 3DPLC 3MKYB 3GLLA 4RGUA 1GT0C 3ABUA 2OD5A 4AM3A 1E2XA 3SEZA 3S32A 2R7QA 2ZXWH 2ME6A 2FOKA 3I58A 3CCLI 4CYDA 1R71A 3R60A 3KYCB 3I59B 4A6DA 1BI0A 1JTXA 1DP7P 1X3ZB 2Q1ZB 2BEOA 2OA4A 2FNPA 1SMYF 2L9SA 1IRZA 3MZ8A 2XPVA 1ZKGA 4BJTA 2ME0A 1K6OA 3ABLH 1Z77A 2X6XA 1J9IA 2F5EA 1RR8C 1VQLI 1UG0A 4BYYA 4RGRA 3H0DA 3G1LA 3KCCA 4A0XA 1IUFA 1JKPC 2GAUA 4I98B 4M3BA 2IGMA 4CYCA 3M8JA 1VQ4I 1M1EB 2WY8Q 3C3WA 3CD6I 4AVPA 4CICA 4Y7NJ 4M72A 4CUGA 1HBXG 2DMTA 1X4OA 3OY9A 3BG3A 3WTWC 2TCTA 4CZCA 1E17A 3HSEA 1D1CA 4BNCA 4A3MJ 4RB3C 3ZN1A 1FC3A 4CH7A 2JA5J 2QSGX 1FEXA 4EVIA 3LAJA 2OZ6A 3F22A 2B9SA 2F6CA 5CQGA 1R58A 3HL2A 2VQLA 1DU6A 5D6EA 3GTQJ 2XB5A 5E1ZB 5LGUA 2K9MA 3BTIA 3H36A 4XKWA 3N05A 1BR1A 1LEAA 2K02A 3LA2A 1JUPA 2A07F 1X1AA 3KYLA 4XRFA 2E1NA 2FQ3A 1FNNA 4M71A 2ELJA 5IPAA 2KZVA 5DCMB 3TW7A 2L7KA 1SC7A 3OYKA 1ZGWA 1E3HA 2O5RA 2FF4A 1UB9A 3C7JA 3IWFA 1OYWA 4WXCA 5JR3A 2A5YB 1R9TJ 3CF2A 1JTYA 3OSFA 1I3AA 5E8GA 5LEKA 3CJQB 5DV5A 2H8WA 2IP2A 2EK5A 4C3IJ 1KZHA 4BQAA 3C2HA 3Q9VA 2MD0A 3VYUB 4BEHA 1MSEC 4UXNA 2YU3A 4LB6B 3K4BA 1IZ1A 1MNEA 2YS9A 1R5HA 1T98A 5EZGA 5H6QA 3DEUA 2E2IJ 2KRHA 3JRCA 4CCJA 2M4KA 3S3OA 4L0ZB 3RDIA 4HNUA 5J8CA 2E2HJ 1HW2A 4L9NA 3FXRA 5L3FA 5TGTA 2VE8A 3ROUA 4MQ9F 4RB0A 3M1CA 3K4NA 1ERDA 1MBFA 9ANTA 5E3OA 2ETHA 4BGDA 1KQ9A 3O3KA 4ZYGA 2IA1A 2XPUA 4J01A 1PP7U 1ZELA 1ORKA 3FK7A 2RAEA 1BI2A 2LYCA 2BW3B 4OAYA 4GO1A 2CGPA 4MLOA 1XCBA 4BQOA 1MZBA 2VOPA 2MH9A 4XNFA 2VBXA 3RKXA 4AUXA 2A6TA 3LSMA 5B5EC 4OINF 3VEPA 5L3CA 4KIFA 2DFFA 2VASA 4CCLA 1WJ5A 2D1HA 2ZMEC 2P5LC 1MBEA 1MMDA 4WF2A 4D7MA 1W7PA 3RQ4A 4PSWA 3OS2A 4AIKA 3ONQA 4UUSB 1FOKA 5FRMA 2QLZA 4RGSA 2WB1A 1USTA 3BCBA 2XF7A 4HF2A 1GXQA 4F3QA 2LDUA 2QYOA 4XRSA 3DBLB 3OL4A 2BY2A 2LTPA 1F5TA 2D5VA 3D5RC 4Y33A 2JUGA 3WTSC 3OYFA 4G6DA 3V7RA 3JRBA 2GLOA 1SFUA 2CQKA 2F5CA 2JVHA 2LBFA 3KP2A 3QYEA 1G59A 4O3MA 3COAC 3VWBA 5EGOA 2DW4A 4WWCA 2VC1A 1RR7A 1RZ4A 3A01A 2F4IA 2VJ5A 3EUHA 2M5WA 1U5TA 5ICCA 3JAMZ 1G3YA 4BE1A 2UWMA 4BH9A 2ZXIA 1HDDC 1LFPA 3D5LA 3ZP5A 2BYVE 5F04A 3S2WA 1I5ZA 2M0MA 3K1MA 1OLTA 3U9GA 5K5RA 4JP0A 1FBUA 3F8CA 3MAJA 1UHMA 3DF8A 3K4LA 4ZYEA 4A6EA 2AXLA 2K27A 4S0HB 3LQQA 3L7WA 5K7HA 1JI8A 4DZJA 1IC8A 3U1DA 2DPDA 3T0YA 2DXIA 2L0KA 4C3HJ 1W4MA 2NS7A 4BE0A 3S2HJ 2XGDA 4DQ2A 3ZCOA 2V4JC 1X2NA 2EZHA 1MDMA 3PIPF 3FM3A 4LJZF 1G3WA 3HOSA 1FYMA 2W57A 3ERMA 2VONA 4P1WA 2R7RA 1B72B 3V4GA 4NHJA 1SAXA 4KUMA 3C1DA 2ESHA 5FKNA 2DJNA 3OYMA 1IGNA 3L2VA 3E5XA 3EYIA 4LG3A 1VQ6I 1F9NA 1KU9A 3BP8A 2K40A 3R0JA 1AKHA 3VB2A 1X2MA 2HXOA 4W97A 3TDUC 2DBBA 2N8GA 2CW0F 2JN6A 3GFMA 1FLIA 3H5RA 3F6OA 2K9SA 5CVJA 4OIRF 5F1RA 2BOLA 2VJJA 4IRIA 1FBQA 2W25A 1IDYA 1TNTA 1G6NA 3NARA 5HS8A 1W0TA 3K70C 5LHGA 1SEUA 3DKXA 1S7AA 1YTYA 1R7JA 2AXTC 3S15J 2R7ZJ 2E5ZA 2LF8A 1QA6A 3GFJA 2A6EF 4GYGA 1H9GA 4E7KA 2PG4A 1S9HA 2DOAA 2EIKH 3GFLA 1FIAA 5J4YA 1KONA 3A1YA 1X1PA 3HOXJ 1XGNA 3KZIC 1YYVA 3CCRI 4KFCA 1WZ2A 1GHCA 3B6AA 1I1GA 3G3ZA 4L5EA 1BBYA 1W36C 1EH8A 3LWFA 4HEA2 4L5JA 5ICEA 4OU0A 2HQAA 2M4GA 1I6HJ 3GZ6A 1BM9A 2BY0A 3A02A 3PO3J 3HPGA 3WGGA 3R61A 2EA2A 2R5YA 2R7DA 2CH0A 3CF5F 3FM5A 2BV6A 4IRGA 4E4HA 3TW6A 4ZDOA 1LDJA 4V2GA 5AONA 3GF2A 4XLFA 3HOVJ 4E7JA 2ICWG 4BQNA 1MKMA 4QWQA 3JTGA 3OYIA 4P9UA 2ZJQF 1T95A 2COMA 1R00A 4HV6A 2ZBKA 4IQ4A 2WA0A 2Y0SN 5DCFA 3QU3A 2W7NA 1H8AC 1D5YA 5LGTA 3KZYA 1WI3A 1QPMA 5FD5A 1OR7C 5EEAA 1AWCA 3J7AO 3WTZA 2JJ7A 1AOYA 4FQGA 2BVMA 2F4MB 1WJBA 1RI7A 2DDAA 1RESA 3QPTA 3T8RA 3AG4H 5F64A 3GW2A 1G2HA 3CCUI 5HLTA 1LB2A 2ZJ2A 1OCPA 3CMEI 4IOAF 6PAXA 2ZNYA 4EMSA 1ZG1A 4EJOA 3O8HA 3LAPA 1JT6A 3KLOA 3F3XA 3GUDA 3GTLJ 1U6GA 2HS5A 3MWMA 4ZZDA 4JK1X 2OCCH 5J6XA 1WH7A 2Z33A 1STZA 4XN0A 2JA2A 4CCKA 2GZWA 2Y69H 3QRFF 3ZOBA 5BOXA 4DYQA 1BC7C 2LH9A 1JUSA 4L18B 4XIDA 2CW8A 4HV5A 2JMWA 3TBIA 3V7SA 4IHYA 3QOEA 3U2RA 4CO8A 1P7JA 5D5XB 4LOCA 3E97A 1J5YA 4OWRB 2EFPA 1O3TA 3HTSB 3ZMTA 3PL8A 3FHZA 5J1YA 1GLNA 2L7FP 2H09A 1TTYA 2Y75A 1PUFA 4G6TB 4BS9A 2EB7A 3E6BA 2F5DA 4HNVA 1T33A 3VPRA 3M3YJ 2RN7A 1ZG5A 5EF6A 3WTUC 3QODA 2V6CA 1YRNB 2DMUA 1HKQA 2KZGA 3C18A 1D0ZA 1OYIA 1TWCJ 3LQRA 1Z7LA 3LFKA 1XPXA 2LY1A 4CYCB 3TMOA 1UG2A 3AAFA 3GYHX 4Z2YA 1V3FA 3H9QA 1P4AA 1FIPA 4BHCA 4KN7X 2JTVA 1HOMA 4BBSJ 3HRTA 2VI6A 3UR3C 3OYNA 2A6HF 3WG9A 5KK1A 2FUG2 2JWTA 3I64A 2QQ9A 5L3BA 4GFBA 4BHPA 2UZKA 1UMQA 1IXRC 1VQNI 1BR4A 2Y9YA 3WGIA 5L3EA 2HVQA 2GQQA 4UB6C 3F8MA 5CVUA 3M8EA 2JA8J 2BBYA 2CUEA 1GVDA 3TO6A 2QGUA 3FISA 4IVNA 1W0UA 2KL4A 1A5JA 2AQEA 2PMHA 5ED4A 2LREA 3PUFA 3FWEA 2PI0A 2IEKA 2VT3A 5CKTA 1K61A 2QQBA 3U21A 5GADJ 3OR2C 3CCSI 2MSYA 2RV8A 3ESWB 2H8RA 5CVRA 5HLIA 1TQMA 4D5FA 3SDBA 1JKOC 3GTMJ 1S7OA 3ZQIA 2A61A 2O3FA 2EH3A 2L9NA 3C2GA 4LIVA 2E71A 4M73A 4BXFA 1UHWA 4FHTA 4WX9A 3B02A 4WXHA 2ZC2A 3A0HC 3DXJF 2Q8KA 4XICA 5EG0A 4MEXF 4HPQA 2V1NA 3PO2J 2JRMA 1IRFA 4RM2A 1KQ0A 4CSWA 5K5OA 1ZH5A
chains in the Genus database with same CATH topology
2B7EA 1UZCA 2DODA 2KZGA 2DOEA 2KFDA 4FQGA 2CQNA 2E71A 2JUCA 2KISA 2LKSA 2KIQA 2K85A 2DOFA 2L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  1UZC A;  2DOD A;  2KZG A;  2DOE A;  2KFD A;  4FQG A;  2CQN A;  2E71 A;  2JUC A;  2KIS A;  2LKS A;  2KIQ A;  2K85 A;  2DOF A;  2L9V A; 
#chains in the Genus database with same CATH topology
 3WU1 B;  2HDW A;  1QNT A;  3M7G A;  3E0J B;  1U5T C;  2KMU A;  2KIQ A;  3JTH A;  4RLQ A;  3I56 I;  3DWL E;  4I99 C;  1HLV A;  1X4P A;  1YW7 A;  2IGO A;  1TL8 A;  4IOC F;  4HDU A;  3BJO A;  3FMQ A;  1QRY A;  1TC3 C;  3U1K A;  4KNY A;  5K7Z A;  1ETW A;  1P92 A;  2HFH A;  4ESB A;  2L9R A;  2E1M B;  1RUN A;  1MIJ A;  2NVX J;  5J4V A;  1NG7 A;  5J40 A;  1D8K A;  4HA8 A;  1WRJ A;  2P5K A;  1VQO I;  1K78 A;  2X6O A;  1VQP I;  2VKD A;  5KAF C;  3LNQ A;  2EZL A;  3QU6 A;  2W4S A;  4C2U A;  1TT0 A;  4XLP F;  3HGY A;  1R6R A;  4RBO A;  2Y31 A;  1ON1 A;  1U78 A;  1UZC A;  1H0M A;  2E2J J;  2GXB A;  1A31 A;  2D2W A;  4KMU X;  2EJR A;  3FXU A;  4FE7 A;  5JHF A;  1O4X A;  1S6L A;  1WCM J;  1OFC X;  1ZTR A;  1ETV A;  5C3E J;  3OIQ A;  5ERI A;  2GA2 A;  3HHH A;  4E6K G;  1ZK8 A;  3TKY A;  3MZH A;  4N9H A;  4XMY A;  3C2B A;  4UV8 A;  1P4W A;  4GDF A;  1QBJ A;  1T08 B;  5FLM J;  2QQA A;  1Z3X A;  5ICG A;  2GIV A;  1IG7 A;  2M87 A;  1TW3 A;  3HG9 A;  4LG0 A;  1ETO A;  2CFX A;  2LBF B;  4XK4 A;  3CUQ B;  4IXA A;  3BZC A;  5GP9 A;  3VSK A;  2ZO4 A;  3SQN A;  3KEO A;  5EGO B;  2E19 A;  2NAZ A;  3HB9 A;  3A01 B;  2O8X A;  2KIS A;  2V9V A;  3BG9 A;  1X19 A;  1S3J A;  2CUJ A;  2XAJ A;  1G3T A;  5D5W B;  2W1O A;  4EJW A;  4B8X A;  1OCT C;  3EPZ A;  4A0Z A;  2NXN B;  2FX0 A;  3IKV A;  2CFO A;  2HTJ A;  2XRL A;  3CQZ J;  3E5Q A;  2YU9 J;  1LNW A;  3PM1 A;  3E1S A;  2GBY A;  1XDS A;  3NWS A;  4I0B A;  4EM2 A;  3KPH A;  3QPS A;  3FZV A;  4DBR A;  1IDZ A;  2VXZ A;  1IV6 A;  1QQI A;  1R1U A;  4B43 A;  2MH2 A;  3BZK A;  4RA2 A;  2LLK A;  4M9S A;  4OOI A;  3A2K A;  1ZG3 A;  2FBH A;  3ZMS A;  4HLX A;  3DBH B;  1ODD A;  1WPK A;  5F08 A;  2RDP A;  4ZDP A;  3KZZ A;  3KX2 A;  3FIW A;  2WY7 Q;  3HOZ J;  1GV2 A;  1RKW A;  5LRR A;  3DKY A;  3SZG A;  5DM7 F;  2L54 A;  2CQX A;  3DEW A;  5D5U B;  3PUB A;  1MBK A;  5LLQ A;  1GXP A;  2GXG A;  3F0C A;  2X9D A;  3CZ6 A;  2EFN A;  4LLG F;  1FOW A;  3I4N J;  2H1L A;  2QEX I;  1YHQ I;  3HPH A;  1DPR A;  1F4K A;  3V42 A;  4KMF A;  5IT9 K;  5F0F A;  2WBM A;  5FKK A;  4I2O A;  5JFR A;  4GXO A;  3TOA A;  1WWX A;  4MIM A;  2K9Q A;  3OOU A;  3VYT B;  1G8X A;  2LSO A;  3BT9 A;  2YX7 A;  2Y2Z A;  4NC8 A;  4LB5 A;  3NEU A;  4Q5S F;  4KN4 X;  3FKI J;  4CDG A;  1V55 H;  2Q2E A;  3J81 Z;  2K9L A;  3FXQ A;  5GAG J;  1Y8R B;  3WGH A;  1XSD A;  4G7O F;  1OCR H;  2NNN A;  3FXO A;  4A3B J;  3HKZ A;  3MEX A;  2XKO A;  1TBX A;  1YIO A;  1SAU A;  1BW5 A;  1Z05 A;  4QLC U;  1FX7 A;  3IV5 A;  2AS5 F;  4B3X A;  2M8G X;  2ZB9 A;  3UKG A;  1RC9 A;  4HYE A;  1SFX A;  2L2O A;  2EZI A;  3J80 K;  2KHM A;  2R5Y B;  5J47 A;  4ZTJ A;  1OR7 A;  4RLF A;  3L1P A;  4XOR A;  1Y6I A;  4LGW A;  4PUS A;  1FY7 A;  5F6F A;  3CLQ A;  4PDK A;  2P7V B;  5DTD A;  2ADU A;  4ZYH A;  4RM3 A;  3LSJ A;  2KKO A;  5FKO A;  1R36 A;  5FO5 A;  1JHH A;  1MW7 A;  1MJB A;  2PBI A;  4UVC A;  1EV7 A;  2LG4 A;  3JAM K;  3LA3 A;  3CJN A;  2DYS H;  4XSZ F;  2X6W A;  2K9N A;  3HJE A;  4X6A J;  1WVR A;  5HS9 A;  4D7N A;  4PJL A;  1NG6 A;  2KIU A;  1LFB A;  1APL C;  1Z7U A;  3BR0 A;  4OIQ F;  3DTI A;  1PYV A;  2FNA A;  1WGX A;  2RC4 A;  1PVE A;  1NHA A;  5FRO A;  1Y1V J;  5HDN A;  4XON A;  4QIW N;  5HDK A;  3RCO A;  2VUM J;  4DYC A;  1NTC A;  1R49 A;  1BJZ A;  1FMW A;  3B6C A;  3MD2 A;  1A04 A;  3H5A A;  5LHH A;  2AHQ A;  4JX4 A;  4DZP A;  4B48 A;  1U8R A;  3LST A;  1BA5 A;  4TV7 A;  4CHU A;  4XN3 A;  1OIS A;  2MYS A;  1FTZ A;  1R4N B;  1U8B A;  2H94 A;  3H3Z A;  1FT9 A;  2HZT A;  2FE3 A;  4WXD A;  4AYB N;  4A3E J;  3T5X A;  4B09 A;  1V5G A;  2ID3 A;  4HX8 A;  3SYT A;  3IWZ A;  4U0V A;  1JHF A;  1JE8 A;  5ILU A;  1USS A;  3EYY A;  1Y56 A;  4MEY F;  3S16 J;  1SFE A;  2IS2 A;  5HS7 A;  1W5T A;  1PUF B;  3HOW J;  4M74 A;  4XM3 A;  4F52 A;  1VF9 A;  3LOC A;  3L2W A;  3CCE I;  4IHW A;  5E18 F;  3B73 A;  3OYB A;  1R5I D;  4IHS A;  3GVA A;  3HYI A;  1N25 A;  4AD9 A;  1D0Y A;  1FBS A;  4LFU A;  3HTU A;  2VN2 A;  5EEH A;  3ASN H;  2HKX A;  1YJN I;  3ABM H;  3FMR A;  1JJ6 C;  3ZQQ A;  1LE8 B;  4M6Y A;  1HW1 A;  1YOV B;  3W3C A;  5CJ9 A;  1XSX A;  1YI2 I;  1Y39 A;  1C0W A;  1REP C;  1V4R A;  4C30 A;  5FD6 A;  2NNY A;  2EIM H;  2XRN A;  1Y1W J;  3G6E I;  4ZYA A;  2Z16 A;  5CQE A;  4K2E A;  2W24 A;  3H0G J;  3V8J A;  4ITV A;  2LKS A;  3R0A A;  3MKW B;  3V8K A;  3S93 A;  3F72 A;  3GZN B;  2VQG A;  2CQ7 A;  4XOT A;  4HW0 A;  2QSF X;  4M3G A;  4AU7 A;  5D6F A;  3CES A;  2IXS A;  2E7W A;  3GX4 X;  3N97 A;  5TIS C;  2LR8 A;  3WU0 A;  2EV6 A;  2F4O B;  2HOT A;  4HSR A;  2LVS A;  3MMY B;  5FGM A;  1I6X A;  2IBD A;  2PJR A;  2EBI A;  1ZRD A;  1IO2 A;  2EIL H;  3KLN A;  3REO A;  3ZQF A;  3Q3S A;  2X6Y A;  4JYK A;  4E7Z A;  1J0R A;  2JPB A;  4U0W A;  4IKF A;  3T1B A;  1HXD A;  2MG4 A;  3RPQ A;  5M3M J;  2CG4 A;  3L2C A;  3OSG A;  4XRM A;  2XGE A;  4Y15 A;  4U7D A;  2QWW A;  4UNO A;  1IF1 A;  2HKO A;  1FPQ A;  2X1E A;  2R7W A;  4I6Z A;  1K7A A;  3OMY A;  1J75 A;  2VJI A;  1TWG J;  1Z9C A;  2WC2 A;  4FCY A;  4O5V A;  1QHH D;  4D9J A;  1S8N A;  4L9T A;  4XBF A;  2JSC A;  2K5C A;  4NQW B;  1LVK A;  2DK5 A;  5J1R A;  2DA4 A;  1YQA A;  5ILS A;  1VQ9 I;  3S1Q J;  1ZGA A;  2DFE A;  3IC7 A;  4F7Z A;  5JHU A;  3OS0 A;  2NS0 A;  4G7Z F;  4XRS G;  4HRI A;  1Y0U A;  1S72 I;  4BL0 B;  5BNG A;  2ELH A;  2Y48 A;  3E6M A;  2CQQ A;  3FF5 A;  2V6E A;  1D8J A;  3I4M J;  1XGS A;  2STW A;  2B7E A;  5IOZ A;  3DLL F;  1HST A;  1Z91 A;  2GOX B;  2ZME B;  2OV7 A;  4EJT A;  5DD4 A;  5BS6 A;  1ETQ A;  4ZTF A;  4V19 K;  2H6C A;  4IHT A;  4FE4 A;  5J1U A;  1CF7 B;  3PNY A;  3OR1 C;  2HPI A;  4C9Y A;  2STT A;  1MMG A;  3RZO J;  2LKX A;  4LK1 F;  1BIA A;  5FRN A;  2R92 J;  2VLA A;  1XMK A;  5M5W J;  5H20 A;  4PJN A;  1K4S A;  5AIQ A;  2CMP A;  4KA4 A;  3TP0 A;  1PDN C;  1ZLK A;  3VYR B;  2IGN A;  5F0H A;  2M7A A;  4Q47 A;  3K6G A;  3GTP J;  2KDZ A;  2VXD A;  2L01 A;  1RIO H;  1SFO J;  2M45 A;  3GME A;  3E6D A;  1O3R A;  2PMU A;  4FT8 A;  2VKV A;  2GWR A;  2E36 A;  3HOT A;  4PSX A;  1NH3 A;  4C2T A;  3LMM A;  2VJ4 A;  4OIP F;  2F5F A;  1GVJ A;  3GBG A;  3P9I A;  2DOF A;  1A6Q A;  3H9G A;  3BZ6 A;  2M8E A;  5H2F C;  2P7C B;  2K4B A;  4P96 A;  1D1A A;  4JBA A;  4LLL A;  2P5V A;  4HNT A;  5JLW A;  5LRS A;  1X58 A;  1LDD A;  1HC8 A;  1B59 A;  2HDC A;  2GIZ A;  2OTL I;  2DTZ A;  2ZSH B;  1QZY A;  2QSH X;  3CJR B;  3J7Y J;  3RQI A;  1XX5 A;  2ZXJ A;  2ZNZ A;  3HXL A;  4YRV A;  1ACI A;  5TJJ A;  5D5V B;  3HSR A;  3ZGK A;  3H3U A;  3HDD A;  4A3C J;  4LMY A;  4JX5 A;  3OYC A;  3CCY A;  1H88 C;  4A3D J;  5CYV A;  2KP6 A;  4HX4 A;  2M7B A;  3BWG A;  5LD2 C;  2DA5 A;  1N75 A;  1OCC H;  1JKQ C;  3MFK A;  3LSH A;  4IRH A;  3VOD A;  1ENH A;  2JRT A;  2Q0O A;  2GM4 A;  4NC6 A;  1I39 A;  1RRJ A;  2P4W A;  3D1N I;  4FX4 A;  2VPL A;  2FXA A;  3HZJ A;  3F8F A;  1KU2 A;  3S1R J;  1AHD P;  4DW6 A;  1YS6 A;  2ISY A;  2HNH A;  2O03 A;  2P81 A;  1JGS A;  2HZD A;  2WAD A;  2K3P A;  3W6K B;  3K10 A;  3ULQ B;  5GAH J;  3CDH A;  3HUG B;  4BY7 J;  3LSK A;  4Y17 A;  1O3Q A;  5FLV A;  3D0S A;  3PQK A;  3HRS A;  3ABT A;  4UVA A;  2H6B A;  1PUE E;  1OCO H;  3OOP A;  2KIM A;  2FEZ A;  2QA4 I;  2WTE A;  3ISP A;  3CP8 A;  2R7T A;  4G6Q A;  2Z99 A;  4UUT A;  3WU2 C;  1QVU A;  1K6Y A;  4OIO F;  2XSJ C;  2E1O A;  4S04 A;  2KT0 A;  4XSX F;  5LGN A;  2XSD C;  4EJU A;  1F1Z A;  1IN4 A;  3DPT A;  2Q2E B;  2AQF A;  2Y0S A;  5E8I A;  2M9H A;  3GTK J;  4ZH4 F;  4A69 C;  1TWF J;  1WJC A;  2KDO A;  3IHU A;  4DNC A;  1PJR A;  5DCM A;  3HOY J;  1VND A;  3BG7 A;  1TP4 A;  2DA3 A;  5EYR A;  2MGQ A;  3AL0 C;  4RB1 A;  4E7I A;  1IJW C;  1IN5 A;  2DA2 A;  5CVI A;  2FOW A;  5FLX Z;  3FMS A;  1Z3Y A;  3JCU C;  3ABK H;  4PJ0 C;  1KYZ A;  3L2R A;  1BOA A;  3GTJ J;  1MH3 A;  2OCE A;  1YE9 A;  1QZZ A;  2CUF A;  1MBJ A;  3K4C A;  3Q9S A;  3ZMU A;  4JQF A;  4NDL A;  2PQ8 A;  2VB6 A;  2RQQ A;  1A6I A;  4G8X A;  1FYL A;  4NB5 A;  1T0F A;  3WOD F;  1Y8Q B;  1LPQ A;  1WJD A;  2COB A;  3ZQ7 A;  2ACJ A;  3SFI A;  2K4J A;  2P6S A;  2EV0 A;  3S3M A;  3BG5 A;  3NRV A;  2HYG D;  3VFZ A;  3RPU A;  4XLN F;  3R6S A;  1MH4 A;  1BI1 A;  3FBI B;  2ZJR F;  3L2U A;  3PNT A;  1J7K A;  2ECB A;  1UAA A;  4BHB A;  5A2Q K;  2IS4 A;  1P7I A;  4H0E A;  3BQY A;  5DDG A;  2QBY A;  2IS1 A;  2L9V A;  2WV0 A;  4KIB A;  2V9P A;  3OYL A;  1HKT A;  4J00 A;  3CC2 I;  2BW3 A;  3BPV A;  2EQR A;  3HHG A;  1QU3 A;  2L7Z A;  2F2E A;  1WJF A;  3E6C C;  1MJA A;  2R0Q C;  2BHZ A;  1T39 A;  2I8D A;  2OU2 A;  3TP3 A;  1Z6R A;  2VE9 A;  5IOY A;  5JVG F;  1H89 C;  2W48 A;  1IXC A;  5HDG A;  1EF4 A;  1WKM A;  2MLK A;  1BC8 C;  3OIO A;  3TOB A;  2ECC A;  3K2A A;  1TNS A;  4IJA A;  3JRH A;  2ZFW A;  3BCA A;  1O7F A;  4A5M A;  4R1H A;  3K2Z A;  2GXA A;  1U2W A;  2R7V A;  2IS6 A;  1SFK A;  5FB2 A;  4UUS A;  4EEF G;  4BAC A;  5HOO A;  4S05 A;  1NK2 P;  4YFN F;  2DA1 A;  3LSR A;  3G1O A;  4MNU A;  5KNL A;  3RYP A;  3TO9 A;  4A3I J;  1ETY A;  2D1V A;  3KP4 A;  4BEH B;  5DD8 A;  1E0E A;  2FJ1 A;  1MMS A;  3H92 A;  2NYX A;  1B8I A;  1MMN A;  1W5C C;  1JT0 A;  1D0X A;  1BN5 A;  1MBH A;  2NVY J;  3ZXS A;  2G0E A;  1TZL A;  2L02 A;  2CWE A;  3G71 I;  2MW8 A;  2FD5 A;  4CCO A;  1IN6 A;  3SFZ A;  2O7O A;  2WAQ N;  3JRD A;  1R23 A;  4BKX A;  2RKH A;  3BR6 A;  2H27 A;  4BQQ A;  4HQE A;  3DTK A;  5FFX A;  5D8L B;  3D5S C;  2K3F A;  2K85 A;  3P5J A;  4Y13 A;  4HG2 A;  3HOU J;  2PLY A;  4W1U A;  2ZKZ A;  2R7U A;  2DMQ A;  1RUO A;  3IL2 A;  3BG6 A;  3DP7 A;  2K7L A;  3LSG A;  3GXO A;  1UJ8 A;  2VKE A;  2RNG A;  4KT5 C;  4A5N A;  2OUM A;  3WTY C;  3I71 A;  3O2P E;  4Q4Z F;  3ERE D;  3FDY A;  2J5O A;  5IY5 H;  4A3J J;  1B72 A;  3W6J B;  5LHI A;  3RPU D;  3FXL A;  1W7P B;  4IF4 A;  2VBZ A;  2D45 A;  2NOG A;  1EA3 A;  4PFP A;  4PZJ A;  2DCE A;  5KAI C;  1LJ9 A;  4NC7 A;  2CV2 A;  2DFI A;  3RZD J;  2QKL B;  3DTE A;  2IGK A;  4M3D A;  1R1T A;  3I54 A;  3CMM A;  1P2F A;  1IRG A;  1H9T A;  2PEX A;  3GFI A;  1X1D A;  1K4T A;  4N9I A;  2DQL A;  1BI3 A;  1LDK B;  4BBR J;  1YIJ I;  3V7C A;  3K4M A;  4HLY A;  4ENK A;  4DGW B;  5HLH A;  1U5T B;  2RQP A;  3KE2 A;  3N4M A;  1E3O C;  1JGG A;  5GTH C;  5DUK A;  5CLS A;  4II2 A;  3MCZ A;  1TT5 B;  5HNF A;  1VTN C;  5FKL A;  3HM5 A;  4XKV A;  4N0B A;  2DU9 A;  4XLH A;  4YFX F;  2IPQ X;  2BXY A;  1HSJ A;  4LIT A;  2Z3Y A;  3KEQ A;  1VQ7 I;  2DI3 A;  2XGX A;  4ENJ A;  5E79 C;  3H1C A;  4KYW A;  4B44 A;  1YO5 C;  3PJR A;  2RNJ A;  2X0L A;  2PMZ N;  1B9N A;  3LFU A;  3NAU A;  3GEZ A;  1MDM B;  3NQO A;  1TLH B;  3BLY A;  4G7H F;  4IHX A;  3BPX A;  3TQN A;  5DM6 F;  3J7Z I;  2YSR A;  2X1D A;  2XUB A;  2FMY A;  4I0A A;  1XMX A;  4Y4R A;  1U9N A;  2HTS A;  4N4N B;  3JRF A;  2L5Q A;  3GO5 A;  3QQA A;  4C2M J;  2DMN A;  4D5C A;  4M6X A;  2HPM A;  2FSW A;  1G3S A;  1POG A;  3MKZ A;  1FSE A;  1AKH B;  4MO7 A;  4I02 A;  4G94 A;  4MTE A;  1VI0 A;  1B9M A;  4YEJ A;  5F0C A;  2J5P A;  2DA6 A;  4EM1 A;  1XMA A;  2KRC A;  3TO7 A;  1BJA A;  1AU7 A;  1VZ0 A;  2XKP A;  3BTL A;  3L00 A;  2V1X A;  3CC4 I;  2QKM B;  4ESJ A;  5JI6 A;  4OAZ A;  5D4R A;  4A2U A;  3V8L A;  3VYS B;  3Q5F A;  3IH3 A;  4FIS A;  3K69 A;  5IYB J;  3ASO H;  5DEQ A;  1DPU A;  2WAE A;  4OMZ A;  5D4S A;  1YFH A;  1R1V A;  1MSF C;  1RPW A;  3LSP A;  1Y0N A;  5K1Y A;  1E3P A;  1JUM A;  1EH6 A;  2X85 A;  4Y52 J;  1N78 A;  1DP3 A;  4HF1 A;  2DT7 B;  3ZRG A;  1ZR2 A;  1YS7 A;  3J7A Y;  3BOQ A;  2GA1 A;  3F9K A;  4X1E A;  3A4C A;  2O9L A;  2MC3 A;  4XL9 A;  1P4X A;  2VL8 A;  1HCR A;  4XKB A;  1FSH A;  3OYE A;  2DQR A;  1ZHF A;  1WFX A;  2OZU A;  1YJW I;  3L09 A;  2M0C A;  1AA7 A;  1U9O A;  2G9W A;  4C3J J;  2R5Z A;  1P6R A;  2V9K A;  3TGN A;  4EQQ A;  2YUS A;  5L3G A;  1O7L A;  2Y0M A;  4GCV A;  5LBQ A;  3KEY A;  4B47 A;  4UY8 I;  1DDN A;  1HW5 A;  1FJL A;  1QHG A;  1EJ9 A;  1X1C A;  3JR9 A;  3CC7 I;  2NVQ J;  2E60 A;  2KIF A;  2BVL A;  3ZQH A;  3IRR A;  1DUX C;  3T8T A;  2B0L A;  3WHC A;  4E7S A;  3DFG A;  1YRN A;  2IVM A;  1YJ9 I;  1A36 A;  2W84 A;  5KCM A;  2M30 A;  3QYB A;  3BY6 A;  3ZMZ A;  1WJE A;  1GV5 A;  1T0F C;  4HQM A;  3S2D J;  5M5X J;  2E1C A;  2NVT J;  1ITY A;  2EIN H;  2QF7 A;  2VOO A;  5K5Q A;  3CCJ I;  1ZYR F;  2CU7 A;  2XHK A;  1Z1D A;  5BMZ A;  1B4A A;  2A05 A;  2LD5 A;  2DT6 A;  1Z6T A;  4IEJ A;  2I5U A;  3ZPL A;  1RET A;  3DEE A;  3F8N A;  3ECH A;  4Z6Y A;  3RYR A;  1OKR A;  4NBQ A;  3CP2 A;  3EET A;  3IUO A;  3BR5 A;  4Y3O A;  2DDB A;  3I3L A;  1VQ5 I;  5GPA A;  1D3Y A;  4M6V A;  4F91 B;  1V54 H;  5E3L A;  4DYR A;  5GTI C;  3ZQC A;  1UFM A;  2EFO A;  3HGG A;  4I7H A;  1ETX A;  1ZLJ A;  2HI3 A;  3I53 A;  2BY3 A;  3KIO A;  3SZP A;  3CDL A;  1F43 A;  2Z5U A;  3JSP A;  1YX3 A;  3IAM 2;  3M8F A;  2KFD A;  3K70 D;  2A5W A;  3K4J A;  2QCO A;  3I55 I;  3IAS 2;  2EFW A;  1ZAO A;  3IKT A;  3I0T A;  3VDX A;  1OPC A;  3ZMV A;  2QVO A;  4P9F A;  2X48 A;  3S17 J;  2R7S A;  3W2W A;  3CMY A;  3KP3 A;  2VT2 A;  4ZDL A;  1A35 A;  4IHV A;  3FXM A;  1TW2 A;  2KPM A;  2X1C A;  1YW9 A;  2X51 A;  4G12 A;  2WAF A;  4UV9 A;  4ANJ A;  2E5N A;  2XRO A;  2LOO A;  5K7F A;  5ILV A;  1ZAR A;  4ESF A;  4N4O B;  2BY1 A;  2FBI A;  4YII A;  3ZR8 X;  1MGT A;  3IP4 B;  3QOP A;  1DGR M;  4HAM A;  1LFU P;  4A0Y A;  1L3L A;  4J19 A;  4MTD A;  2DOD A;  4DBQ A;  4BY1 J;  3K1P A;  1W36 D;  1XS9 A;  3WTT C;  5AIP A;  1OCZ H;  4FX0 A;  2A68 F;  2HYF A;  2WB1 N;  1YIT I;  2JQ7 A;  1FP1 D;  3P9K A;  5C44 J;  3GTO J;  1LUJ B;  2XF6 A;  4P55 A;  2NS8 A;  4AWX B;  4I01 A;  3OYJ A;  5IT9 Z;  3E5U A;  4AYB A;  3DV8 A;  3JW4 A;  1I50 J;  3H3V K;  2BHY A;  2QBY B;  3MZY A;  2R93 J;  5IP7 J;  1ETK A;  2F48 A;  3HEF A;  4EV0 A;  1KGS A;  1GDT A;  4AVZ A;  1J2X A;  2JUC A;  2QEN A;  4U7B A;  1ZQ3 P;  4ABZ A;  5IYC J;  2CW7 A;  1XSV A;  3ZN0 A;  2R7O A;  3PQJ A;  2B63 J;  1QZE A;  1SVM A;  1T6S A;  2ID6 A;  1XCV A;  1O3S A;  2XAH A;  4RAG A;  3S3N A;  5M5Y J;  4AID A;  3DBR B;  1DGW Y;  3FK6 A;  4BJ6 C;  1S7E A;  2P8T A;  2Z1D A;  4R79 A;  1L0O C;  4WCG A;  2YPR A;  3K4K A;  3J80 Z;  4A3F J;  2BE5 F;  1V5F A;  2QUF A;  2DTR A;  2A3S A;  3P7N A;  4CGZ A;  2CSO A;  5EG0 B;  1SVL A;  3SJM A;  1ULY A;  2PX9 A;  2XB0 X;  3ZMD A;  1DQU A;  2M34 A;  2QZ8 A;  2DO7 A;  3GWZ A;  4BDZ A;  4HX7 A;  3TED A;  4IX7 A;  1B8I B;  4AC0 A;  2MC4 A;  4D1Q A;  2FBK A;  1TWH J;  4A12 A;  2R3S A;  3CUQ A;  2CV1 A;  4KIS A;  3BDD A;  2KRF A;  2Y30 A;  1BL0 A;  1R5G A;  2HQR A;  3S14 J;  3IH2 A;  3SDG A;  2M3A A;  2CRG A;  2LMD A;  3CO6 C;  4I09 A;  1SVO A;  1Q1V A;  3OWT A;  2VQH A;  5E1X A;  3DU5 A;  2OF7 A;  2JT1 A;  1TQP A;  2OPT A;  1FYK A;  1YLF A;  1I1S A;  2V1D A;  3I5U A;  1KU3 A;  1SMT A;  2LFB A;  3W2V A;  2HGC A;  3H9J A;  1JXS A;  3LSI A;  4BDY A;  1EH7 A;  1MBG A;  1YG2 A;  2ELK A;  1K78 B;  1HQC A;  4M9X A;  4RB2 C;  3PFI A;  1XB4 A;  3WG7 H;  2HVR A;  1BIB A;  4CXF A;  3MN2 A;  3MQ0 A;  5F1J A;  4YG2 F;  3QYF A;  4YIF A;  2G7U A;  2VBW A;  5L3D A;  2NOJ B;  3AG2 H;  4PJJ A;  4ENN A;  3KET A;  3JRI A;  2DA7 A;  3OIP A;  5FLX K;  2V7F A;  2DLL A;  4BUP A;  3WTX C;  1MMA A;  3ZQL A;  4F55 A;  1T38 A;  1Z0X A;  4PCQ A;  3RJP A;  1K79 A;  2A69 F;  2JPC A;  4U88 A;  5GPC A;  2H1K A;  5HVQ C;  3G1M A;  1N77 A;  1Z67 A;  2IA0 A;  4PGH A;  2ESN A;  4MFE A;  1MNM C;  1MJ9 A;  2OJE D;  4IZZ A;  4MHG A;  4AIH A;  5GAE J;  4LG0 B;  2OQR A;  3Q0U A;  2XC7 A;  4UB8 C;  2Z2S B;  2IJL A;  3QPL A;  3QWL A;  4A3K J;  3W6V A;  2LRD A;  1FP2 A;  2M1B A;  1J59 A;  2FA5 A;  1BR2 A;  3WE3 A;  2TRT A;  1JJ8 C;  1X3W B;  2DN0 A;  5BQT A;  1S5L C;  3AFH A;  4HOB A;  4EGY A;  4RS8 A;  2JA6 J;  4BE2 A;  1ON2 A;  2XAF A;  2EA4 A;  2HQN A;  3A0B C;  4ZZL A;  2KQR A;  3AKZ A;  4O6J A;  3TDZ C;  4AIJ A;  3EUA A;  4EJV A;  3RTR A;  2LF7 A;  1W7P D;  3SEQ A;  2BZT A;  1WJA A;  1YX5 A;  2EWN A;  5BPD A;  1R4M B;  1OQY A;  3L9F A;  4L0Y B;  2V79 A;  1HDP A;  3I59 A;  5DUI A;  3CO7 C;  5DS9 A;  1Z21 A;  2EV5 A;  1OJL A;  3QPH A;  5FKM A;  4PFO A;  1OMI A;  3E7L A;  3WTV C;  3F23 A;  3OYH A;  1SD7 A;  3ELK A;  2MD5 A;  2L7M P;  4I76 A;  1W1W E;  3OL3 A;  2EFQ A;  4Q48 A;  2LKP A;  2HQ5 A;  3LL7 A;  1R22 A;  1T8I A;  2E34 A;  1XC5 A;  1MND A;  2MAB A;  4RMN A;  4BJ5 C;  1IN7 A;  5E3M A;  2RGV A;  3OS1 A;  3DCF A;  2CO5 A;  4B1R A;  4M3F A;  2HR3 A;  5KVR A;  2NRA C;  1RKT A;  3RKQ A;  1S29 A;  1IUY A;  3E3V A;  3DKW A;  1ZN2 A;  1JKR C;  4KIG A;  1XTA A;  2VQC A;  4ZYD A;  4CZZ A;  2IT0 A;  3BTC A;  2DJI A;  3AG1 H;  4RGX A;  4XQF A;  3M07 A;  4MQV A;  5HOD A;  4ZC3 A;  2KLO A;  2CJJ A;  2XAQ A;  3OYA A;  4XLE A;  1CQT A;  3TL4 X;  3JRG A;  4YEL A;  3BQZ A;  2CS3 A;  5B3S H;  2UUZ A;  3G73 A;  4KT6 A;  4M3E A;  2R7F A;  2EZK A;  2HXI A;  4KIT B;  2WWY A;  2ZFU A;  4P5O A;  1QPI A;  4NUB A;  4E7L A;  2ZSI B;  3M4O J;  3L2Q A;  3FXJ A;  4QSH A;  3QP5 A;  4BXX J;  5B66 C;  2M2E A;  2MA3 A;  2DOE A;  3H5N A;  3RKY A;  3PFY A;  3GTG J;  1QVT A;  2JVG A;  4E70 A;  5BPI A;  4A3L J;  2W00 A;  1F36 A;  1UHS A;  4CCN A;  2LK2 A;  2AO9 A;  3P9C A;  5E17 F;  4PJM A;  2LNB A;  1FMV A;  2BXZ A;  2OBP A;  3HBL A;  3RIR A;  4YFK F;  3CCQ I;  2VBY A;  3KYD B;  2RRE A;  1SD6 A;  4MGR A;  3CJT B;  1SAN A;  3HC7 A;  1WHU A;  5JLX A;  1WSU A;  1B6A A;  5EZH A;  1VQK I;  2R5Z B;  3BRO A;  1FWZ A;  2XAU A;  2QM3 A;  3KP6 A;  2PJP A;  3PSI A;  5EDN A;  1HKS A;  4EAT A;  2JK3 A;  5J3L A;  4QPQ A;  1UEL B;  3MVP A;  4BAY A;  2LY2 A;  3HIF A;  3QAH A;  2Y9Z A;  2CQN A;  2C6Y A;  3F6V A;  1WH5 A;  3FXK A;  2R7X A;  5IT3 A;  1XGO A;  4G9Y A;  4IL6 C;  1DU0 A;  2P6T A;  2O61 A;  3HRM A;  1FZP B;  2GOM A;  2DT5 A;  3SZT A;  5KHD A;  4RAF A;  2L3D A;  3RKW A;  4UVB A;  2OTJ I;  1G4D A;  4OMY A;  4KDP A;  4H4K C;  1X1B A;  2FU4 A;  2MLG A;  3OYG A;  2HOA A;  5HLG A;  1D1B A;  1B1B A;  3M9A A;  2ZXH A;  5FJ8 J;  1ZRE A;  1PP8 F;  5LFA A;  2HVS A;  4GGG A;  2OQG A;  1FTT A;  1LE8 A;  4UUV A;  5D8K B;  3CTA A;  4XLA A;  1XG1 A;  2K86 A;  4L9J A;  1LEB A;  5E3N A;  3G4S I;  3KP5 A;  2XAS A;  3DQV C;  1MD0 A;  3QP6 A;  2DPU A;  3VSL A;  4IQJ A;  2EIJ H;  1LQ1 A;  1U3E M;  4LIU A;  1KA8 A;  2E1M C;  3CDI A;  2L4M A;  3BR3 A;  3DU6 A;  4BU2 A;  1IAW A;  4HBL A;  2VIX A;  4PGG A;  3S1M J;  3AL0 B;  4HST A;  2BGC A;  5H6R A;  3WE2 A;  3SXY A;  4IO9 F;  5FFZ A;  5C4X J;  5IP9 J;  2F5V A;  4KIC A;  4ASN A;  2XDV A;  2VC0 A;  1LKX A;  3F8B A;  2OC6 A;  1J09 A;  2DAO A;  1T2K A;  1NK3 P;  1X3U A;  2V1U A;  2LP0 A;  1UCR A;  1ZRF A;  1BOB A;  1IW7 F;  2FRH A;  4HZF A;  4MFD A;  1KU7 A;  1WI9 A;  2NVU B;  3IRQ A;  3JRA A;  3KP7 A;  3VOE A;  3IH4 A;  3FKJ A;  3CCV I;  4NNJ A;  2XIG A;  2PN6 A;  2TDX A;  3BJ6 A;  5CPR B;  3CCM I;  2MBF A;  3K1N A;  5EJC A;  4DIQ A;  1ZRC A;  4XR6 A;  3AG3 H;  4EM0 B;  3PSF A;  3GZ5 A;  1YW8 A;  4F93 B;  4JX6 A;  5HNH A;  4LLN A;  2LY9 A;  1Q1H A;  3BTJ A;  2G7H A;  3ECO A;  4XKC A;  1SD4 A;  1FOY A;  2V26 A;  2O8K A;  3OV8 A;  3CUQ C;  5LEJ A;  2Z9O A;  1QGP A;  4FTH A;  4PK4 A;  4NQW A;  3S1N J;  3J81 K;  2R4G A;  2UV1 A;  3K0L A;  4GYI A;  3EUH C;  1ZR4 A;  2WV1 A;  3PIO F;  2UXN A;  1CGP A;  4XLC A;  1U0J A;  4B4C A;  1W5S A;  4R8H A;  4II3 A;  3I4P A;  2FML A;  1V5E A;  3GLX A;  1TQI A;  1K83 J;  2P0W A;  1KYW A;  5ICF A;  4FET A;  2L4A A;  3K7A J;  5DYM A;  4L5I A;  4DOZ A;  3RSN A;  1XD7 A;  2ZJP F;  2PFB A;  4RAZ A;  4QTR A;  5JVT A;  2ZME A;  5EEG A;  3BR2 A;  1EKE A;  2OAZ A;  3Q0W A;  2RVC A;  3PNV A;  2CYY A;  3DLA A;  1D5V A;  3WHB A;  1O57 A;  2IW5 A;  1CF7 A;  2HDD A;  1P9Q C;  2KJB A;  2DFH A;  4RAY A;  1WQ2 A;  2WAQ A;  3JRE A;  3S8P A;  1VQ8 I;  2PJR B;  4BXU A;  3HSF A;  5E1W A;  5TRD A;  3RI4 A;  3K9T A;  1LVA A;  3KFW X;  5C4J J;  1HA8 A;  3GCM A;  2HEO A;  4A3G J;  4A93 J;  2W82 A;  1SD5 A;  2FQ4 A;  4ZJZ A;  2X4H A;  1VQM I;  3O6B B;  2W85 A;  4L9V A;  3FBN B;  2HWV A;  4FAS D;  2VKH A;  4JOM A;  5CVV A;  4IPA A;  1ONV A;  4XOP A;  4E7H A;  4ON0 A;  1XDU A;  3BJA A;  1VFC A;  3R4K A;  2IA2 A;  4ETS A;  2XVC A;  4QPO A;  2CV0 A;  2ISZ A;  2YX4 A;  2DK8 A;  3X2Q H;  2QQ8 A;  1T56 A;  2HYJ A;  5B1B H;  2IRF G;  2ZCW A;  1XN7 A;  1QO0 D;  3O8G A;  2XAG A;  5IYD J;  5E20 A;  2XV4 S;  3M1E A;  4EGZ A;  2E7X A;  3CUO A;  3G2B A;  3ML6 A;  4HDV A;  5IP6 A;  2DYR H;  1TWA J;  1OYY A;  5A2Q Z;  4LD5 A;  1XGM A;  3FHN A;  3LA7 A;  2DMP A;  5M3F J;  3DPU A;  4UHT A;  2HOE A;  4U0Y A;  4B3A A;  4YIR X;  1IXS B;  4WK8 F;  2KJC A;  2O6G E;  2VPR A;  1IRX A;  3EQL F;  3HRU A;  3A03 A;  2IAI A;  4M9Z A;  2MFZ A;  3EUK L;  4U87 A;  1BW6 A;  1IV8 A;  1RNL A;  4ENM A;  3ZQG A;  2O0Y A;  3Q0V A;  2I10 A;  5J8F A;  2JZY A;  3UNG C;  3HKZ N;  3FX3 A;  2VOD A;  3SHF A;  2LC2 A;  1FOX A;  4DJA A;  2EPF A;  3MKL A;  2XF5 A;  2XPW A;  1I3Q J;  3EDP A;  4CCM A;  3W2A A;  4KJZ A;  3I9V 2;  3CMA I;  2UXX A;  4X0G A;  3BC8 A;  3F21 A;  2PMZ A;  2JSP A;  4V2F A;  3HUG A;  3H35 A;  4HF0 A;  2JA7 J;  3JSO A;  4D0P A;  1KQ8 A;  4RDU A;  4CA0 A;  2YR2 A;  3OYD A;  3BR1 A;  2HOS A;  1IN8 A;  2XGC A;  5B1A H;  1I27 A;  1ZGJ A;  4LK0 F;  3CLO A;  2CUZ A;  2E35 A;  4GRI A;  5F27 A;  1HF0 A;  1GUU A;  4F92 B;  2HU9 A;  3NWT A;  3DPL C;  3MKY B;  3GLL A;  4RGU A;  1GT0 C;  3ABU A;  2OD5 A;  4AM3 A;  1E2X A;  3SEZ A;  3S32 A;  2R7Q A;  2ZXW H;  2ME6 A;  2FOK A;  3I58 A;  3CCL I;  4CYD A;  1R71 A;  3R60 A;  3KYC B;  3I59 B;  4A6D A;  1BI0 A;  1JTX A;  1DP7 P;  1X3Z B;  2Q1Z B;  2BEO A;  2OA4 A;  2FNP A;  1SMY F;  2L9S A;  1IRZ A;  3MZ8 A;  2XPV A;  1ZKG A;  4BJT A;  2ME0 A;  1K6O A;  3ABL H;  1Z77 A;  2X6X A;  1J9I A;  2F5E A;  1RR8 C;  1VQL I;  1UG0 A;  4BYY A;  4RGR A;  3H0D A;  3G1L A;  3KCC A;  4A0X A;  1IUF A;  1JKP C;  2GAU A;  4I98 B;  4M3B A;  2IGM A;  4CYC A;  3M8J A;  1VQ4 I;  1M1E B;  2WY8 Q;  3C3W A;  3CD6 I;  4AVP A;  4CIC A;  4Y7N J;  4M72 A;  4CUG A;  1HBX G;  2DMT A;  1X4O A;  3OY9 A;  3BG3 A;  3WTW C;  2TCT A;  4CZC A;  1E17 A;  3HSE A;  1D1C A;  4BNC A;  4A3M J;  4RB3 C;  3ZN1 A;  1FC3 A;  4CH7 A;  2JA5 J;  2QSG X;  1FEX A;  4EVI A;  3LAJ A;  2OZ6 A;  3F22 A;  2B9S A;  2F6C A;  5CQG A;  1R58 A;  3HL2 A;  2VQL A;  1DU6 A;  5D6E A;  3GTQ J;  2XB5 A;  5E1Z B;  5LGU A;  2K9M A;  3BTI A;  3H36 A;  4XKW A;  3N05 A;  1BR1 A;  1LEA A;  2K02 A;  3LA2 A;  1JUP A;  2A07 F;  1X1A A;  3KYL A;  4XRF A;  2E1N A;  2FQ3 A;  1FNN A;  4M71 A;  2ELJ A;  5IPA A;  2KZV A;  5DCM B;  3TW7 A;  2L7K A;  1SC7 A;  3OYK A;  1ZGW A;  1E3H A;  2O5R A;  2FF4 A;  1UB9 A;  3C7J A;  3IWF A;  1OYW A;  4WXC A;  5JR3 A;  2A5Y B;  1R9T J;  3CF2 A;  1JTY A;  3OSF A;  1I3A A;  5E8G A;  5LEK A;  3CJQ B;  5DV5 A;  2H8W A;  2IP2 A;  2EK5 A;  4C3I J;  1KZH A;  4BQA A;  3C2H A;  3Q9V A;  2MD0 A;  3VYU B;  4BEH A;  1MSE C;  4UXN A;  2YU3 A;  4LB6 B;  3K4B A;  1IZ1 A;  1MNE A;  2YS9 A;  1R5H A;  1T98 A;  5EZG A;  5H6Q A;  3DEU A;  2E2I J;  2KRH A;  3JRC A;  4CCJ A;  2M4K A;  3S3O A;  4L0Z B;  3RDI A;  4HNU A;  5J8C A;  2E2H J;  1HW2 A;  4L9N A;  3FXR A;  5L3F A;  5TGT A;  2VE8 A;  3ROU A;  4MQ9 F;  4RB0 A;  3M1C A;  3K4N A;  1ERD A;  1MBF A;  9ANT A;  5E3O A;  2ETH A;  4BGD A;  1KQ9 A;  3O3K A;  4ZYG A;  2IA1 A;  2XPU A;  4J01 A;  1PP7 U;  1ZEL A;  1ORK A;  3FK7 A;  2RAE A;  1BI2 A;  2LYC A;  2BW3 B;  4OAY A;  4GO1 A;  2CGP A;  4MLO A;  1XCB A;  4BQO A;  1MZB A;  2VOP A;  2MH9 A;  4XNF A;  2VBX A;  3RKX A;  4AUX A;  2A6T A;  3LSM A;  5B5E C;  4OIN F;  3VEP A;  5L3C A;  4KIF A;  2DFF A;  2VAS A;  4CCL A;  1WJ5 A;  2D1H A;  2ZME C;  2P5L C;  1MBE A;  1MMD A;  4WF2 A;  4D7M A;  1W7P A;  3RQ4 A;  4PSW A;  3OS2 A;  4AIK A;  3ONQ A;  4UUS B;  1FOK A;  5FRM A;  2QLZ A;  4RGS A;  2WB1 A;  1UST A;  3BCB A;  2XF7 A;  4HF2 A;  1GXQ A;  4F3Q A;  2LDU A;  2QYO A;  4XRS A;  3DBL B;  3OL4 A;  2BY2 A;  2LTP A;  1F5T A;  2D5V A;  3D5R C;  4Y33 A;  2JUG A;  3WTS C;  3OYF A;  4G6D A;  3V7R A;  3JRB A;  2GLO A;  1SFU A;  2CQK A;  2F5C A;  2JVH A;  2LBF A;  3KP2 A;  3QYE A;  1G59 A;  4O3M A;  3COA C;  3VWB A;  5EGO A;  2DW4 A;  4WWC A;  2VC1 A;  1RR7 A;  1RZ4 A;  3A01 A;  2F4I A;  2VJ5 A;  3EUH A;  2M5W A;  1U5T A;  5ICC A;  3JAM Z;  1G3Y A;  4BE1 A;  2UWM A;  4BH9 A;  2ZXI A;  1HDD C;  1LFP A;  3D5L A;  3ZP5 A;  2BYV E;  5F04 A;  3S2W A;  1I5Z A;  2M0M A;  3K1M A;  1OLT A;  3U9G A;  5K5R A;  4JP0 A;  1FBU A;  3F8C A;  3MAJ A;  1UHM A;  3DF8 A;  3K4L A;  4ZYE A;  4A6E A;  2AXL A;  2K27 A;  4S0H B;  3LQQ A;  3L7W A;  5K7H A;  1JI8 A;  4DZJ A;  1IC8 A;  3U1D A;  2DPD A;  3T0Y A;  2DXI A;  2L0K A;  4C3H J;  1W4M A;  2NS7 A;  4BE0 A;  3S2H J;  2XGD A;  4DQ2 A;  3ZCO A;  2V4J C;  1X2N A;  2EZH A;  1MDM A;  3PIP F;  3FM3 A;  4LJZ F;  1G3W A;  3HOS A;  1FYM A;  2W57 A;  3ERM A;  2VON A;  4P1W A;  2R7R A;  1B72 B;  3V4G A;  4NHJ A;  1SAX A;  4KUM A;  3C1D A;  2ESH A;  5FKN A;  2DJN A;  3OYM A;  1IGN A;  3L2V A;  3E5X A;  3EYI A;  4LG3 A;  1VQ6 I;  1F9N A;  1KU9 A;  3BP8 A;  2K40 A;  3R0J A;  1AKH A;  3VB2 A;  1X2M A;  2HXO A;  4W97 A;  3TDU C;  2DBB A;  2N8G A;  2CW0 F;  2JN6 A;  3GFM A;  1FLI A;  3H5R A;  3F6O A;  2K9S A;  5CVJ A;  4OIR F;  5F1R A;  2BOL A;  2VJJ A;  4IRI A;  1FBQ A;  2W25 A;  1IDY A;  1TNT A;  1G6N A;  3NAR A;  5HS8 A;  1W0T A;  3K70 C;  5LHG A;  1SEU A;  3DKX A;  1S7A A;  1YTY A;  1R7J A;  2AXT C;  3S15 J;  2R7Z J;  2E5Z A;  2LF8 A;  1QA6 A;  3GFJ A;  2A6E F;  4GYG A;  1H9G A;  4E7K A;  2PG4 A;  1S9H A;  2DOA A;  2EIK H;  3GFL A;  1FIA A;  5J4Y A;  1KON A;  3A1Y A;  1X1P A;  3HOX J;  1XGN A;  3KZI C;  1YYV A;  3CCR I;  4KFC A;  1WZ2 A;  1GHC A;  3B6A A;  1I1G A;  3G3Z A;  4L5E A;  1BBY A;  1W36 C;  1EH8 A;  3LWF A;  4HEA 2;  4L5J A;  5ICE A;  4OU0 A;  2HQA A;  2M4G A;  1I6H J;  3GZ6 A;  1BM9 A;  2BY0 A;  3A02 A;  3PO3 J;  3HPG A;  3WGG A;  3R61 A;  2EA2 A;  2R5Y A;  2R7D A;  2CH0 A;  3CF5 F;  3FM5 A;  2BV6 A;  4IRG A;  4E4H A;  3TW6 A;  4ZDO A;  1LDJ A;  4V2G A;  5AON A;  3GF2 A;  4XLF A;  3HOV J;  4E7J A;  2ICW G;  4BQN A;  1MKM A;  4QWQ A;  3JTG A;  3OYI A;  4P9U A;  2ZJQ F;  1T95 A;  2COM A;  1R00 A;  4HV6 A;  2ZBK A;  4IQ4 A;  2WA0 A;  2Y0S N;  5DCF A;  3QU3 A;  2W7N A;  1H8A C;  1D5Y A;  5LGT A;  3KZY A;  1WI3 A;  1QPM A;  5FD5 A;  1OR7 C;  5EEA A;  1AWC A;  3J7A O;  3WTZ A;  2JJ7 A;  1AOY A;  4FQG A;  2BVM A;  2F4M B;  1WJB A;  1RI7 A;  2DDA A;  1RES A;  3QPT A;  3T8R A;  3AG4 H;  5F64 A;  3GW2 A;  1G2H A;  3CCU I;  5HLT A;  1LB2 A;  2ZJ2 A;  1OCP A;  3CME I;  4IOA F;  6PAX A;  2ZNY A;  4EMS A;  1ZG1 A;  4EJO A;  3O8H A;  3LAP A;  1JT6 A;  3KLO A;  3F3X A;  3GUD A;  3GTL J;  1U6G A;  2HS5 A;  3MWM A;  4ZZD A;  4JK1 X;  2OCC H;  5J6X A;  1WH7 A;  2Z33 A;  1STZ A;  4XN0 A;  2JA2 A;  4CCK A;  2GZW A;  2Y69 H;  3QRF F;  3ZOB A;  5BOX A;  4DYQ A;  1BC7 C;  2LH9 A;  1JUS A;  4L18 B;  4XID A;  2CW8 A;  4HV5 A;  2JMW A;  3TBI A;  3V7S A;  4IHY A;  3QOE A;  3U2R A;  4CO8 A;  1P7J A;  5D5X B;  4LOC A;  3E97 A;  1J5Y A;  4OWR B;  2EFP A;  1O3T A;  3HTS B;  3ZMT A;  3PL8 A;  3FHZ A;  5J1Y A;  1GLN A;  2L7F P;  2H09 A;  1TTY A;  2Y75 A;  1PUF A;  4G6T B;  4BS9 A;  2EB7 A;  3E6B A;  2F5D A;  4HNV A;  1T33 A;  3VPR A;  3M3Y J;  2RN7 A;  1ZG5 A;  5EF6 A;  3WTU C;  3QOD A;  2V6C A;  1YRN B;  2DMU A;  1HKQ A;  2KZG A;  3C18 A;  1D0Z A;  1OYI A;  1TWC J;  3LQR A;  1Z7L A;  3LFK A;  1XPX A;  2LY1 A;  4CYC B;  3TMO A;  1UG2 A;  3AAF A;  3GYH X;  4Z2Y A;  1V3F A;  3H9Q A;  1P4A A;  1FIP A;  4BHC A;  4KN7 X;  2JTV A;  1HOM A;  4BBS J;  3HRT A;  2VI6 A;  3UR3 C;  3OYN A;  2A6H F;  3WG9 A;  5KK1 A;  2FUG 2;  2JWT A;  3I64 A;  2QQ9 A;  5L3B A;  4GFB A;  4BHP A;  2UZK A;  1UMQ A;  1IXR C;  1VQN I;  1BR4 A;  2Y9Y A;  3WGI A;  5L3E A;  2HVQ A;  2GQQ A;  4UB6 C;  3F8M A;  5CVU A;  3M8E A;  2JA8 J;  2BBY A;  2CUE A;  1GVD A;  3TO6 A;  2QGU A;  3FIS A;  4IVN A;  1W0U A;  2KL4 A;  1A5J A;  2AQE A;  2PMH A;  5ED4 A;  2LRE A;  3PUF A;  3FWE A;  2PI0 A;  2IEK A;  2VT3 A;  5CKT A;  1K61 A;  2QQB A;  3U21 A;  5GAD J;  3OR2 C;  3CCS I;  2MSY A;  2RV8 A;  3ESW B;  2H8R A;  5CVR A;  5HLI A;  1TQM A;  4D5F A;  3SDB A;  1JKO C;  3GTM J;  1S7O A;  3ZQI A;  2A61 A;  2O3F A;  2EH3 A;  2L9N A;  3C2G A;  4LIV A;  2E71 A;  4M73 A;  4BXF A;  1UHW A;  4FHT A;  4WX9 A;  3B02 A;  4WXH A;  2ZC2 A;  3A0H C;  3DXJ F;  2Q8K A;  4XIC A;  5EG0 A;  4MEX F;  4HPQ A;  2V1N A;  3PO2 J;  2JRM A;  1IRF A;  4RM2 A;  1KQ0 A;  4CSW A;  5K5O A;  1ZH5 A; 
#chains in the Genus database with same CATH homology
 2B7E A;  1UZC A;  2DOD A;  2KZG A;  2DOE A;  2KFD A;  4FQG A;  2CQN A;  2E71 A;  2JUC A;  2KIS A;  2LKS A;  2KIQ A;  2K85 A;  2DOF A;  2L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...