2K85A

P190-a rhogap ff1 domain
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
65
structure length
65
Chain Sequence
SQQIATAKDKYEWLVSRIVKNHNENWLSVSRKMQASPEYQDYVYLEGTQKAKKLFLQHIHRLKHE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Glucocorticoid receptor DNA-binding factor 1
publication title NMR structural studies on human p190-A RhoGAPFF1 revealed that domain phosphorylation by the PDGF-receptor alpha requires its previous unfolding.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein binding
total genus 22
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2008-09-02
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2k85A00
2B7EA 2L9VA 2DOFA 2K85A 2DOEA 2KZGA 2LKSA 2KISA 2E71A 1UZCA 2KFDA 2JUCA 2DODA 2KIQA 2CQNA 4FQGA
chains in the Genus database with same CATH superfamily
3HEFA 5LEJA 3VYUB 1TT0A 4U0WA 3G6EI 1MIJA 2VL8A 4MHGA 2XDVA 3JAMZ 4BYYA 4BUPA 2WV1A 1USSA 3TDUC 5EG0B 3V42A 4HF1A 1WSUA 4BE2A 4RGXA 2DTZA 1HDPA 3ZQFA 3U21A 2KRCA 2JRMA 3Q0WA 3PQJA 3FISA 2BYVE 5FFXA 1I5ZA 3T0YA 1O4XA 2UXXA 4GGGA 2Y0SN 3COAC 5E79C 5M3MJ 1Z6RA 4A2UA 2R7ZJ 3ZQGA 3K4CA 4NNJA 1GVDA 1BR2A 1BR4A 4OMYA 3B02A 3ELKA 3RTRA 2W25A 2R5ZA 2D2WA 3TP3A 2Z99A 3KP4A 3G71I 4NQWB 3HL2A 3LOCA 3JRDA 2IS4A 2JZYA 1YFHA 1JT0A 3CCLI 3GTQJ 3K4NA 1UCRA 1VQPI 1S7EA 5EEGA 2A05A 2DODA 3P9IA 5D4SA 1KU7A 4OIRF 1P4WA 4KIBA 1VQMI 2AXLA 4UHTA 1T39A 2EIKH 4I6ZA 1BI3A 1T2KA 1R58A 2PFBA 1RI7A 2ELHA 1W7PB 5LD2C 2HKXA 3JRGA 2F5CA 3PFIA 1SC7A 1NK3P 1REPC 4HW0A 1KQ0A 1C0WA 1DP7P 3KP3A 3LL7A 3ZXSA 3QOEA 2HOSA 2WWYA 5FRMA 2HQRA 3OYKA 2GXGA 1NH3A 1TWHJ 5KVRA 2K3PA 2TRTA 2PJRB 4I09A 1YLFA 1QHHD 2X6YA 3MKZA 3QAHA 2DPUA 2ACJA 5CJ9A 1FY7A 3CCUI 2QLZA 3EUKL 1QZEA 1D1AA 3RDIA 2LNBA 3CCYA 1ZTRA 4KMFA 5E20A 1KU2A 2MC3A 3EUAA 4XKCA 4ABZA 1K6OA 4BXXJ 1KYWA 2NOGA 3DEEA 4M6XA 4U87A 1NK2P 2EV5A 5GPCA 3E5XA 3S1NJ 2VOPA 3Q0VA 3BDDA 3E6BA 5LEKA 1DPUA 2JT1A 1QQIA 3ZN0A 2LH9A 2FF4A 3OYGA 4IF4A 1LEAA 3OOUA 3GZ6A 1VQ7I 2NS0A 2DOAA 3ESWB 3MZ8A 3M8EA 4KITB 2EV6A 3VSLA 4NBQA 2RNJA 2ZXJA 2VXDA 1GXPA 5BPIA 2EK5A 2CYYA 1VI0A 1LFUP 1G59A 5CLSA 2HR3A 4PDKA 2H27A 1EA3A 3F23A 1XPXA 2DK5A 4OIQF 4MO7A 3I0TA 2KISA 2OJED 1XS9A 3ML6A 4HA8A 2X1EA 4A3GJ 5CVJA 1IGNA 2WADA 1ZQ3P 1ZKGA 2E1OA 2FJ1A 3QPTA 4RM2A 2EZHA 2XKOA 1SMYF 3S2HJ 4B8XA 2QGUA 2GA2A 2VC0A 2RNGA 3Q0UA 3FKIJ 5FKMA 4GRIA 3F3XA 3TO6A 2E36A 4LG3A 3IH3A 4ESFA 1ZGWA 1B72A 1SVMA 2F5FA 5E8GA 2JUGA 1FOWA 3EDPA 3K4JA 2BVMA 2DA2A 2BY3A 2HOTA 2IXSA 3FMRA 4ITVA 3DFGA 4M73A 2IJLA 4L5JA 3BZKA 1LFPA 2R3SA 3WGIA 2NVTJ 4UVBA 4DYQA 4QWQA 3CJQB 5DCFA 1BC7C 1R22A 3PL8A 3VODA 4I02A 1ITYA 2VJ5A 1YX3A 2QCOA 3GFLA 1SD7A 2ESHA 1MBGA 3WU1B 2PMUA 1E0EA 1JUMA 1MD0A 2OU2A 4LK0F 1B59A 1MKMA 4EM0B 3C3WA 3K0LA 4KUMA 5HLIA 4MIMA 1GXQA 2X1DA 4F92B 5HODA 3TW7A 3H0DA 4CGZA 1SFOJ 1Q1HA 1Y1WJ 4GCVA 4E7LA 2Y69H 2A5WA 1USTA 5TGTA 3J81Z 1XMXA 2NAZA 1LQ1A 2F4MB 4D7MA 2X1CA 1WPKA 2ZXHA 3DPUA 4L18B 3FHNA 2VQLA 4LFUA 3LQQA 5J4YA 4U7BA 1A36A 2CFOA 3H1CA 4EJTA 5B1AH 2HFHA 3K69A 1R71A 3JRCA 4I01A 1KQ9A 4KICA 4OIPF 3ZOBA 4LLNA 4HNUA 2EIJH 4KMUX 1BA5A 1TW2A 2JPBA 5IYCJ 5DYMA 3RQIA 1BJAA 2CQNA 3N05A 3S3OA 2KP6A 3M1CA 4Y17A 2NVYJ 2OZ6A 2KL4A 4P9UA 1MJAA 2DJNA 3FBIB 3KYLA 1U78A 1IG7A 5LLQA 2CGPA 2O8KA 2CMPA 9ANTA 2K9SA 1GV5A 2FA5A 3ROUA 2HEOA 1XX5A 2GQQA 1VQ4I 2EFWA 2IVMA 2QENA 3JCUC 1I1GA 3VB2A 2A6HF 4BU2A 1XGMA 4LG0B 2AQEA 3AAFA 1HF0A 2M30A 2HTSA 3ZRGA 1YX5A 3S3NA 2K9LA 4EJVA 2O8XA 3CO6C 2KT0A 3FXMA 1UHSA 3KP2A 2LD5A 2ADUA 4BS9A 4EJWA 3K4BA 3TQNA 2Y48A 5CQEA 2PG4A 4PJNA 3QRFF 1X3UA 5EGOA 4MLOA 4HF2A 2LC2A 4MGRA 3JAMK 1L0OC 2QEXI 3ECHA 3VSKA 1JGSA 1W5CC 5CVUA 3CCMI 2OZUA 5L3DA 1MMSA 3OYCA 1JJ8C 3W2WA 4IHWA 3KZIC 1SEUA 1LVKA 5FLXZ 2JA6J 4IQJA 3WTXC 4V19K 4NC7A 1R6RA 1MDMA 2PMZA 4IHYA 3FXKA 1FBUA 2BY2A 1D8JA 4U0YA 2ELJA 5IP6A 3J80Z 1IN4A 1Z7LA 3BR3A 4WWCA 2F48A 3K1PA 5J6XA 2NNNA 3QU6A 3VEPA 2Y75A 1JTXA 3RJPA 3PSIA 1G3YA 1IN5A 2F5DA 2L9RA 4DGWB 1ZRFA 3HRTA 3DTKA 3TDZC 4XN0A 2QKLB 3MWMA 4FTHA 2FBHA 4WXDA 1D5YA 1HSJA 2LDUA 3KFWX 1D0ZA 5E8IA 4BNCA 3KEYA 3HPHA 3S3MA 3EQLF 5JLWA 2OTJI 4G7ZF 2CUEA 3L9FA 2K85A 3GFIA 2D1HA 4A5NA 1T38A 4XOTA 2DK8A 1LDJA 1PUEE 1J59A 4V2GA 4U7DA 1E3PA 5F08A 4DIQA 2VT2A 1DP3A 1R4NB 3K2AA 2J5PA 3W6JB 2JQ7A 4UY8I 2JA2A 3BR6A 1S7AA 4CYCA 5J1YA 3CJRB 1YG2A 1D8KA 3M7GA 3LSIA 4J01A 4HQEA 5H6RA 2MG4A 3HPGA 4YEJA 4BQOA 4RGSA 3H5RA 2O9LA 3P9KA 2Y0SA 1QO0D 1YJWI 5L3GA 4PJJA 4EJUA 3HM5A 5FKLA 4HSTA 1T98A 5GAHJ 2P5VA 4IQ4A 3I53A 3F8BA 3QPSA 2VQHA 4ENJA 3BR2A 2XIGA 3OYEA 2L01A 5D5XB 1YQAA 3WTVC 2BXYA 2XC7A 1MDMB 5D8LB 2UXNA 4DBQA 3V7CA 4G6DA 2FOKA 3I4NJ 4TV7A 2DDBA 4IRHA 4HG2A 3H35A 5HS7A 2HYFA 3SHFA 1JUSA 3OYBA 3MVPA 2R7VA 5F0HA 3W2AA 1S6LA 5C4XJ 2Q0OA 3S14J 2MH9A 1H89C 3C2GA 2JVHA 2CQ7A 4C3JJ 4BBSJ 4MFEA 2V1NA 2W00A 1YOVB 4XLHA 4CCNA 4M3BA 3G2BA 2Z3YA 2NXNB 1TP4A 1IN6A 2GBYA 2CU7A 5J3LA 3IP4B 3FDYA 4BKXA 4F91B 4F93B 5L3EA 2GLOA 1IUFA 1SFUA 3L09A 1R00A 2LP0A 3HYIA 3OYIA 2B7EA 4IHXA 3QYFA 2DI3A 2M2EA 4M9XA 2HZTA 2BVLA 4EGZA 3WU0A 1QZZA 5D5UB 3BWGA 2Q2EA 3OYMA 4DBRA 5E18F 2V1UA 1TW3A 3I59A 1Q1VA 3SQNA 2CV2A 4ZYGA 2WAQA 2K9QA 2PLYA 1TQMA 1JKQC 3G4SI 1RZ4A 2UV1A 4XLAA 1K78B 3OIOA 2HXOA 2HVSA 3OWTA 1F4KA 4IRIA 3FWEA 4HYEA 2R7SA 3FXRA 2HQAA 4ZYAA 4BGDA 3E7LA 2OTLI 3GEZA 3NQOA 2HOAA 2KIUA 2JRTA 5JVGF 4QPOA 4X0GA 3I4PA 4IHVA 1BI2A 1Z67A 2RKHA 1MBJA 2EIMH 4S0HB 4EATA 4I98B 2R5YA 2EH3A 2M9HA 4UNOA 4O6JA 1SVLA 4P9FA 5GADJ 2QQ9A 3J7AY 4FQGA 4Q5SF 3JRAA 2CUJA 3QP5A 3JTGA 2OCEA 2HS5A 3FX3A 1Z1DA 1OKRA 2CW7A 2L54A 1Y0NA 2XASA 3VDXA 4BJ6C 3J81K 2F5EA 5HVQC 2DO7A 1MH3A 2ZB9A 4AC0A 2LRDA 2Z16A 2FRHA 1PDNC 2BGCA 2DT6A 3FXQA 2V6EA 2IS6A 1JHFA 4UB6C 4A6DA 2DA1A 3S17J 4OINF 2R7UA 3K4LA 2M34A 2BW3A 3P9CA 5J8FA 1JXSA 3FXUA 3HRUA 1K79A 2M4GA 4YIIA 2HYJA 1J9IA 1UG0A 3PNYA 3GZNB 5CYVA 3HGYA 1GVJA 2QA4I 1YW8A 5HNHA 2KJCA 3A2KA 2OA4A 3I59B 4FASD 2L02A 3NWSA 4BY7J 2CH0A 4BXFA 2DTRA 2IGKA 4Y13A 2QBYA 3KLOA 3LMMA 1Z21A 5HNFA 2OAZA 4XONA 4A0YA 3D5RC 4XKBA 2JK3A 5BPDA 3PO3J 3WTTC 4PJLA 1IO2A 4S05A 2KLOA 1Z3YA 3CESA 3V4GA 4CCMA 5F64A 4ETSA 1MJ9A 3BPXA 4DNCA 2W82A 1V55H 3DKYA 1FYLA 3I55I 4HNVA 3K10A 2JA7J 2IEKA 3RI4A 3GTJJ 2DFHA 2OV7A 4NB5A 2HQNA 3FXOA 2CRGA 3CDHA 1AKHA 3TBIA 3DLAA 2DPDA 1SVOA 4M6YA 5LRRA 1LUJB 4JP0A 1YIJI 1AU7A 3VYRB 3PQKA 1J7KA 1TNSA 1IXSB 4IKFA 1E17A 3KEQA 1D0XA 1A6IA 3QYBA 5LRSA 4ESBA 4A3LJ 3J80K 5EG0A 2QSHX 5IT3A 1LVAA 4GO1A 5ILVA 3NWTA 1OCPA 1N75A 2UZKA 2EFOA 2FEZA 2OD5A 2KFDA 1Z7UA 2JA5J 1PJRA 3HTSB 4R1HA 1WJBA 1AWCA 4A93J 3CUOA 1DU6A 4CA0A 2CQKA 1V5EA 2WTEA 1HA8A 3V8LA 3KYDB 3CCQI 1IRFA 1F9NA 2ELKA 2CW8A 4II2A 4RM3A 5EEHA 4BEHB 3OIQA 2K9MA 5K7FA 5LHIA 4NQWA 1SAUA 4CZCA 1ON2A 1APLC 3JRHA 4E7SA 3IC7A 4S04A 2DJIA 5FD6A 4FCYA 2Z5UA 4Y33A 4KA4A 1BI0A 2PI0A 3GVAA 2PEXA 4RAGA 2FMLA 1B9NA 1JUPA 2YX4A 3K9TA 3HB9A 4Z2YA 3F8CA 1ACIA 3TGNA 4KT6A 3VPRA 2EZKA 3ZMVA 3HGGA 2OBPA 3G1LA 3OYJA 4GXOA 4HRIA 2E2JJ 1A5JA 2V26A 4UVAA 1MH4A 2XV4S 1QU3A 4ZZDA 2PJRA 2O03A 3RZDJ 3JSOA 1I1SA 3N4MA 2BE5F 1AKHB 2HGCA 3FBNB 1WZ2A 3OYDA 4LD5A 3LFUA 3CCEI 3CTAA 2LY2A 5D5VB 1VQ6I 2XPVA 3J7ZI 1WFXA 4RDUA 5BQTA 4BDYA 3G73A 1XDUA 3A0HC 3KE2A 1EF4A 4GYGA 2B9SA 2DBBA 2F5VA 2JPCA 2CV1A 2MSYA 3BJ6A 1A6QA 2IAIA 2WAFA 3DLLF 2P7CB 2VBYA 3ABMH 1W4MA 1SFXA 3ABKH 2NVXJ 1W0TA 2E7WA 4L9VA 4FT8A 2M45A 4GYIA 2RN7A 2A5YB 5FFZA 4AYBN 2VONA 2BY1A 5DEQA 4CSWA 2GAUA 5C4JJ 5J4VA 1H9GA 2TCTA 1OCOH 2G9WA 2LFBA 2DA7A 5IPAA 3B73A 4AIDA 5L3BA 1B8IA 5CVIA 1VQOI 2D5VA 4I0BA 3L2VA 2LF7A 1TLHB 4G12A 1BM9A 1BN5A 4B3AA 3F6OA 3GTKJ 2CSOA 3IRQA 1ZREA 3BQZA 3GLXA 4C3HJ 3HKZN 3S1RJ 3IKTA 2Y9ZA 1X1BA 1IAWA 5F0FA 3K2ZA 5E3OA 4DQ2A 4M74A 2BOLA 4BHCA 1OCZH 5AIPA 5FD5A 1KZHA 4XRMA 1P7JA 3QYEA 2JUCA 5GP9A 1D0YA 2JN6A 4EV0A 3HOYJ 1U5TB 4MQVA 5IY5H 1X4PA 1WWXA 3DTEA 5ICCA 3PUBA 1ON1A 3GX4X 4ZTFA 1FOKA 4FHTA 2FNAA 1Y8RB 3G1OA 1R36A 3DKXA 5JI6A 3HHHA 2NS8A 2DOFA 1N78A 3GTMJ 4AIHA 4BQNA 5KNLA 1U9OA 1J75A 3CDLA 1V4RA 2XVCA 2MW8A 3AG1H 3ZGKA 3G3ZA 1VQ9I 3RYRA 3RPUD 3PIOF 2RQPA 4LB6B 2M4KA 1K6YA 2H8WA 1XGOA 1K4TA 5J8CA 3LSHA 4BQAA 2R7QA 2BY0A 3Q9VA 4BQQA 4E7ZA 5EZHA 1MNDA 5LBQA 2XPWA 1SFKA 4PUSA 4ZDOA 3UR3C 2HXIA 3CUQB 1HW5A 4FX0A 1M1EB 3C1DA 4HF0A 2QVOA 2IS1A 2KHMA 3JRIA 4XQFA 4IPAA 4M3GA 3H92A 2L9SA 2DMPA 1UZCA 1P9QC 1R1TA 1WJAA 3OR2C 1R23A 4HX8A 4AVPA 3TO7A 1D5VA 2CQXA 2FSWA 4OU0A 2PMHA 1B8IB 4PJ0C 2Y31A 1JKOC 3W6VA 1JGGA 3W2VA 1BW6A 1LB2A 4KJZA 3A0BC 1R4MB 1XMKA 1Y8QB 1OFCX 2WB1N 3H5AA 3EYIA 3AL0B 1UAAA 3S1QJ 3IWFA 3OMYA 4N4OB 5E17F 1TWAJ 1CF7A 3BJAA 4MEYF 4EM2A 1QGPA 2EB7A 3K1MA 2DN0A 1UFMA 5KK1A 3KZYA 5DDGA 4A69C 4MQ9F 3H36A 2HPMA 3WTUC 1OCCH 4XLFA 5BS6A 3K6GA 3GTPJ 3ZMZA 3I3LA 1XSDA 3S2DJ 1MBHA 2BEOA 3U2RA 2DW4A 3BTLA 1SD6A 3H9QA 1QPMA 2VKVA 3RKXA 2V1DA 3HZJA 1HC8A 2VB6A 2O3FA 5JHUA 2V4JC 4C2TA 2LREA 3BTIA 3MN2A 3BT9A 4IJAA 4LG0A 3IV5A 1S29A 2QQBA 2L4AA 3DEWA 3KIOA 3A01B 2MC4A 1JKPC 1FZPB 1YW9A 3F72A 4XLCA 4A3FJ 3ZQLA 2LVSA 2QSGX 2E5NA 2X6OA 4J19A 2K7LA 1ETYA 2N8GA 2GXAA 2M3AA 3CC4I 3U1KA 2L0KA 5M5YJ 1IJWC 3BTJA 2HQ5A 1D1BA 3Q9SA 2A68F 1W36D 1KYZA 1MMGA 3G1MA 2ZNYA 2J5OA 2KMUA 2OQRA 4HV5A 4M72A 3KCCA 2ID3A 1VZ0A 1OCRH 3O6BB 2RDPA 3ASOH 1IZ1A 1MMAA 4FETA 3DCFA 4C30A 2JMWA 2E1MB 3HTUA 5GPAA 4CXFA 4DZJA 4XK4A 5EJCA 4EEFG 3SDBA 3HRSA 3JRBA 1YO5C 4O3MA 2E1CA 2VIXA 2NVUB 2IA1A 4ZYDA 1YHQI 1JTYA 5DCMB 1HKSA 5K5QA 2Q1ZB 2VE9A 2LKSA 1T8IA 5EEAA 4HAMA 2EFPA 4P5OA 3V7SA 2BBYA 3SEQA 4F7ZA 5A2QZ 3GYHX 5LHGA 2M87A 1TWFJ 4D5FA 4EM1A 4ZYEA 1U3EM 4PFPA 2IW5A 1CF7B 3LSGA 3GFJA 1DDNA 2R7XA 4PSWA 1ZYRF 4HDVA 4I0AA 2DXIA 4IHSA 5HLTA 2E2IJ 2W57A 2CO5A 2HVQA 1UG2A 1E3OC 3CMYA 1HXDA 4XSZF 1O3TA 1P6RA 4OWRB 2DT5A 1T95A 2ISYA 2NNYA 3JW4A 4NHJA 5FO5A 2OCCH 1QVUA 4FE4A 2PJPA 5GAEJ 4AM3A 2QQAA 4P55A 2NVQJ 4B44A 4XLNF 5DD8A 1WH7A 4UV8A 4J00A 3E97A 5HDNA 2UWMA 3WTZA 3OY9A 3HOZJ 2YUSA 5D8KB 1FYMA 5J40A 3AG3H 4WXCA 3H3VK 1LJ9A 3L2RA 3HG9A 3R60A 2FNPA 3NRVA 4KN7X 4N4NB 2VBXA 5M5XJ 2EJRA 4KNYA 5E3LA 1K61A 4ENMA 1Y1VJ 4XN3A 3B6AA 2ZXWH 1RNLA 2MYSA 3RSNA 4BHBA 4BJTA 2M1BA 4RAYA 1O3QA 1VQ8I 2IRFG 3S93A 1YYVA 1R49A 2K4BA 3GLLA 1X4OA 3JRFA 3I64A 1FP1D 2F2EA 2ZNZA 2MGQA 4QPQA 4CCOA 4HNTA 2IPQX 3MEXA 3ABTA 5K7ZA 1Y0UA 2XAHA 5DV5A 2CQQA 1LEBA 5DS9A 2KZVA 3IHUA 1E2XA 1RRJA 3O3KA 1WJEA 2G0EA 3FM5A 4Q4ZF 1J0RA 2XAQA 3WTSC 2P7VB 4F55A 4M3FA 2ZXIA 3RPQA 3K4KA 2V79A 1MSEC 1HOMA 4M6VA 4E7KA 1Y56A 3FMQA 2OPTA 3GW2A 4D0PA 4X1EA 3CCSI 1SD5A 1I3AA 3D5SC 2HDWA 4GFBA 2HNHA 1XCBA 5GTIC 2COBA 2DYSH 4A3KJ 3BG5A 3OV8A 2F4OB 1T6SA 3NAUA 4KT5C 1YI2I 2MLKA 3V7RA 2VKHA 3VWBA 4KFCA 1NG6A 2MABA 1F36A 1ZGAA 2Z9OA 2UUZA 1RKTA 5E3MA 1FNNA 1MBFA 2EILH 5LGNA 5GTHC 2MBFA 4JQFA 5EYRA 3MFKA 2A07F 3AFHA 4YFXF 1NHAA 3PFYA 1BIBA 2LTPA 3HOUJ 1G2HA 5HOOA 1U8RA 1TNTA 1K78A 1BIAA 2FMYA 4IVNA 1TBXA 4NUBA 4NC6A 4M9SA 1EV7A 5ILUA 1ENHA 3M9AA 5CVRA 1WH5A 4ENNA 1RUOA 1LE8A 3CZ6A 3SZGA 1DQUA 4UV9A 4WCGA 3ZQCA 3BPVA 3C18A 4AYBA 1SFEA 4PZJA 3DF8A 1VF9A 5M3FJ 1EH7A 2P81A 1GDTA 3ZPLA 3OS2A 2X0LA 3M8FA 4DYRA 4XKWA 4UB8C 1MBKA 1XG1A 3WTWC 3I56I 2OF7A 1IC8A 1ETVA 3BR1A 4PSXA 3CMEI 1GUUA 4I7HA 3K1NA 4IO9F 2W24A 1FP2A 4BAYA 3R61A 2YR2A 3OS1A 4II3A 2XF7A 3B6CA 4AUXA 3DKWA 3LWFA 5FJ8J 2B63J 4CCJA 2R7RA 5FRNA 3BG9A 5H6QA 2G7UA 3HHGA 2ZSIB 4N9IA 3MKYB 1WI9A 4BDZA 2M7AA 4EGYA 4BY1J 3DBHB 1BBYA 2LMDA 3MAJA 2LBFB 1FYKA 1W36C 3FK6A 3E0JB 4KISA 1IW7F 5J47A 3NEUA 2XF5A 4D5CA 3ULQB 3F9KA 1R5GA 3VOEA 3SXYA 1YS6A 2ID6A 4G94A 3FHZA 5F6FA 2PX9A 5ILSA 1VQKI 3CC2I 3T1BA 3PNTA 3CJNA 5KHDA 2EWNA 1STZA 1HKQA 2DQLA 4HOBA 3ZQHA 2RC4A 4R8HA 5JVTA 1B4AA 3F8FA 1MBEA 2K3FA 1RPWA 2I10A 3QOPA 3JREA 2EINH 4XICA 1LE8B 2K9NA 3IUOA 2FX0A 1ERDA 4E6KG 1XDSA 4C2MJ 3KETA 1U8BA 4QSHA 2DA6A 2FUG2 3FKJA 3WG7H 2GWRA 1OYYA 2I5UA 3RPUA 1F43A 3KYCB 2OUMA 1XCVA 4ESJA 1OR7C 1WVRA 5LFAA 1KONA 1YE9A 4F3QA 3GCMA 3IH4A 4CHUA 4P1WA 4I76A 2ME0A 2H1LA 4B47A 2DA3A 2WB1A 3TKYA 4CO8A 2VUMJ 3BR0A 2O7OA 5FKKA 4A0ZA 1P92A 4A5MA 1O3RA 3C2HA 1OLTA 2L4MA 3EETA 2X9DA 2JWTA 2L7MP 3DBLB 4BACA 2W85A 1U5TC 2GIZA 3O8HA 2V9VA 4CCKA 1HKTA 1TT5B 3RIRA 3F21A 4XMYA 2GOMA 3IL2A 3WG9A 3LAPA 2LYCA 3S16J 3L2QA 4HLXA 1X58A 3HBLA 5D5WB 1YRNB 1P7IA 2KIMA 3M1EA 5FLMJ 1S9HA 4BEHA 2ZC2A 2LG4A 3PNVA 2DMUA 3LSMA 3GF2A 4JK1X 1G3WA 3OYLA 1ETXA 1UB9A 5LHHA 1RESA 1XB4A 3GMEA 3A03A 1K4SA 1MGTA 5H20A 4DW6A 4ENKA 1V5GA 3HUGB 4LK1F 2XKPA 3CUQC 1FWZA 4RMNA 4ZDLA 3REOA 2KRHA 2KJBA 3OL4A 1Z05A 3E6DA 5DD4A 3QPLA 1YJNI 4XRSG 1ZK8A 1U6GA 2YPRA 2Z2SB 2HPIA 2ZJPF 3H0GJ 2WY7Q 4UUVA 1FBSA 1I39A 4LIUA 1ETKA 3CMAI 3QODA 5ERIA 1YW7A 2RREA 4YELA 4AIJA 5L3CA 5B66C 3AL0C 4ZZLA 3O8GA 5FLXK 2O6GE 2A69F 2JSCA 4L9TA 4Y7NJ 3PJRA 3WGGA 3E3VA 4OIOF 1U0JA 2ZJQF 4RAZA 5HLGA 1WI3A 2R93J 2IP2A 1FT9A 3BCBA 5F04A 2VJIA 3BLYA 4RB1A 4RB2C 2L5QA 4I99C 2W1OA 2L7FP 3LNQA 3HOWJ 2H1KA 3DWLE 2VPLA 4LB5A 1G3SA 1UELB 1BL0A 1I3QJ 1VFCA 2E1NA 1X2NA 1Z9CA 2XAUA 2WAEA 3MCZA 3DU5A 3M3YJ 2VXZA 3CLOA 5JR3A 3RKQA 4UXNA 2GXBA 3GXOA 2GZWA 5IP9J 3D1NI 3GWZA 3GZ5A 4IOCF 1TQIA 4ASNA 1K7AA 1R9TJ 2F6CA 2HZDA 3ASNH 3OIPA 5TISC 2YSRA 4L9JA 2DAOA 3UNGC 3F8MA 2AHQA 1I6XA 2QQ8A 1WJCA 3SFZA 2O61A 1BOBA 2LK2A 1OR7A 1XSVA 3DEUA 4UUTA 4G7HF 4XNFA 4N0BA 4ZJZA 2XUBA 5DUKA 1CQTA 1AA7A 2R7TA 4HPQA 2MH2A 4QTRA 2LY1A 1V3FA 5KCMA 1WRJA 4EVIA 2E1MC 3KP6A 4CDGA 3T5XA 3ZCOA 3K70D 1IRXA 1XGSA 3D0SA 3ZMSA 5LGUA 2PMZN 4F52A 2P5LC 4G6QA 4U0VA 3TMOA 1U5TA 3CO7C 1WJ5A 4LITA 5BOXA 2W7NA 1H8AC 3FXLA 4A3IJ 2VQGA 3V8KA 1TZLA 4M3EA 1AOYA 4MNUA 2KZGA 2YU9J 3I4MJ 3HSEA 1TTYA 1I50J 1PUFB 2XAGA 3L1PA 1VNDA 4E7JA 1GT0C 4RA2A 1DGRM 1U2WA 1I27A 3ZP5A 4A6EA 5FGMA 2Z33A 1ULYA 3LA3A 1R1UA 4ZC3A 3JSPA 1TWGJ 4Y3OA 1WJFA 3SZTA 1I6HJ 1OMIA 3M07A 1YIOA 1H9TA 4CZZA 4RLFA 3P7NA 4O5VA 4DJAA 3A02A 4CUGA 1X19A 2XROA 1EH8A 5M5WJ 1T08B 3IH2A 1RUNA 4C2UA 1ETWA 3CQZJ 4OMZA 1ZG3A 3CUQA 2IGMA 1ODDA 4YIRX 4A3JJ 5IYBJ 3GTLJ 3S15J 2FU4A 3LSRA 4PJMA 3L00A 1ZRDA 2L7ZA 3ZR8X 2V6CA 2IA2A 2XB0X 2ESNA 4B3XA 2YS9A 2ZMEB 2RGVA 1O57A 4LLGF 4LLLA 1LDKB 2ECBA 2HVRA 2H8RA 1P4XA 1PP7U 3LQRA 1Z91A 2E60A 4UUSB 1RIOH 2YX7A 1ZR2A 1KU9A 1ZN2A 2PBIA 2WA0A 1X3WB 3UKGA 2NRAC 3QPHA 2XAJA 1IUYA 5EZGA 5JFRA 2L7KA 4EJOA 3OR1C 2VJJA 3OYFA 4BXUA 3ZMUA 2L2OA 4Y4RA 4P96A 1TL8A 3CC7I 1O7LA 2ZCWA 3WE2A 2HDCA 1XGNA 2P4WA 4ANJA 5K5RA 2VI6A 2VQCA 2VN2A 3MZYA 2XB5A 1FIPA 3ZQ7A 5LGTA 4FX4A 1FOYA 2FQ3A 3M8JA 3CCRI 2WY8Q 3A01A 2Y9YA 1XN7A 3KLNA 2EA4A 4ON0A 1T33A 3SZPA 3FF5A 4HZFA 3A4CA 3GFMA 2E71A 4B4CA 1JKRC 4M71A 2DFIA 5KAFC 3GBGA 1J09A 1QBJA 5KAIC 3DV8A 2EZLA 3PSFA 2IGOA 2VE8A 5FROA 3I5UA 1MNMC 1P2FA 1RR7A 2QWWA 5CPRB 3ERMA 1MNEA 2GIVA 1ETOA 1XC5A 4W1UA 2LLKA 2I8DA 3L2WA 3RKYA 2JJ7A 4IOAF 3H3ZA 3KPHA 1IXCA 1N77A 4G8XA 2XSJC 2P6SA 5GAGJ 2WAQN 5D6FA 1UHMA 2W84A 2VOOA 1W1WE 3ERED 5DCMA 1ETQA 3WHBA 4JX6A 4A3EJ 1LFBA 1P4AA 2W4SA 2VT3A 1HQCA 2Y2ZA 3RKWA 3BC8A 1HSTA 1IRGA 1O7FA 2MA3A 4OAZA 3AKZA 3L7WA 3BG3A 3WGHA 2AS5F 1VTNC 2H6BA 4WX9A 2VKEA 3TO9A 2XRNA 1ZG5A 2XRLA 4Y52J 4AVZA 2CV0A 3BZCA 3HIFA 2MLGA 3BROA 5J1UA 1LPQA 1TC3C 2R5ZB 2EA2A 2K4JA 5TJJA 1JI8A 4AIKA 1F5TA 4KN4X 2D1VA 2FXAA 4BHPA 4BE1A 1RR8C 1Z3XA 1IF1A 1BW5A 2BHYA 2XHKA 4HEA2 2XGCA 1ZG1A 3R4KA 1AHDP 3AG4H 1QZYA 1ZRCA 1QRYA 1KA8A 3DQVC 1WJDA 4XR6A 2LKXA 1WQ2A 5IP7J 2M0MA 4E70A 3N97A 2L9VA 2R0QC 4EQQA 3Q5FA 3S8PA 3EYYA 2KRFA 2FQ4A 2K40A 3RCOA 2IGNA 1LNWA 4KIFA 3R0JA 2W48A 4JYKA 4PCQA 4IZZA 4WXHA 3R0AA 2K02A 4V2FA 2ISZA 3J7AO 2KQRA 1X2MA 1XD7A 5E1XA 5F27A 3SEZA 2FOWA 3KX2A 2X6WA 1T0FC 2XGXA 3K70C 3ABLH 1B6AA 3EPZA 6PAXA 1ZARA 1MZBA 5FKNA 1S3JA 4E4HA 1MW7A 4JX4A 2E7XA 5FLVA 2HKOA 1VQNI 2DFFA 2QKMB 4Z6YA 2XSDC 3GO5A 4XIDA 5FKOA 5JLXA 2DLLA 4K2EA 1Y39A 2K5CA 3DP7A 3EUHC 2E35A 4Q47A 3CLQA 3SYTA 4HDUA 1NTCA 3H3UA 2ETHA 3I54A 1X1PA 4L5IA 2Q8KA 2QSFX 5BNGA 1OJLA 5IT9Z 5E1WA 4RGUA 3OSGA 3R6SA 3BG7A 3A1YA 3HXLA 4RAFA 2EFQA 3IWZA 1QPIA 4UVCA 4XLPF 3OSFA 3FIWA 3QU3A 1WGXA 3PIPF 1TQPA 4H4KC 4MFDA 3HOXJ 2E34A 4IEJA 1ZR4A 1L3LA 2A3SA 3CF5F 2TDXA 3IAS2 3TOBA 1MSFC 1FMWA 3FZVA 3E5QA 3E6MA 5EF6A 3IRRA 1N25A 2DMTA 4AU7A 2XPUA 1B1BA 3LSKA 2IBDA 4XL9A 3U1DA 3TP0A 2M7BA 2V7FA 2YU3A 2GA1A 4WF2A 1B72B 3MKWB 4QIWN 1E3HA 1W7PD 2GOXB 3HRMA 2KDZA 3WTYC 3BCAA 4M3DA 1YJ9I 5F1RA 2KDOA 3E1SA 2AQFA 5F0CA 1ZLKA 4Q48A 4IRGA 1ZAOA 3WE3A 5IOZA 4L0ZB 1X1CA 2X4HA 4XRFA 2QUFA 1OCTC 4X6AJ 2HTJA 3QWLA 1UJ8A 1YS7A 4OOIA 4YG2F 1FLIA 3KZZA 4B09A 2VODA 1TWCJ 3GUDA 3M4OJ 3H9JA 2BXZA 3U9GA 2R92J 1G6NA 3ISPA 4IL6C 4YFKF 2H94A 3L2CA 3TL4X 1W0UA 4XORA 4JOMA 2QYOA 1WHUA 2FBKA 1DUXC 3IAM2 2LKPA 1IV8A 1X1DA 3D5LA 3PM1A 4D7NA 1BI1A 1ZLJA 4DYCA 3FK7A 4JBAA 1JE8A 3S2WA 1PP8F 4D9JA 2EV0A 2FE3A 4FE7A 2R7WA 2MD5A 2HYGD 1UMQA 3LSJA 2ICWG 2LBFA 2MFZA 3F22A 3JTHA 2JVGA 2F4IA 4BL0B 3L2UA 2LY9A 1O3SA 5DM7F 5D4RA 1IN7A 1FTZA 3HC7A 1W5SA 2RAEA 1VQLI 4WK8F 3QQAA 4HSRA 4GDFA 2R4GA 3SJMA 2LSOA 1T0FA 2Z1DA 3BZ6A 3TEDA 2GM4A 2ZKZA 1GV2A 2XAFA 2NOJB 4XKVA 2HOEA 3ZMDA 4MEXF 2KIQA 4LOCA 4L0YB 1U9NA 3ONQA 3HSFA 2RV8A 2Y30A 1J5YA 1Z0XA 3BP8A 1HW1A 1FBQA 3EUHA 3T8TA 2NS7A 4KDPA 1GHCA 3I71A 2ZFWA 1BC8C 1ZELA 2LF8A 1RKWA 2QZ8A 2WC2A 3CP2A 1K83J 2H09A 4A0XA 3BTCA 2ZBKA 4YIFA 2M8EA 4HLYA 1WKMA 2DFEA 1MJBA 3WHCA 1G4DA 4M9ZA 1F1ZA 1A04A 4KYWA 2D45A 4HV6A 5K7HA 2M0CA 1H0MA 4IXAA 1QHGA 5AONA 5CKTA 3CP8A 3HKZA 3RYPA 3DTIA 1D1CA 1QVTA 3SFIA 4RLQA 4W97A 5C44J 5EGOB 2X51A 2CG4A 2DT7B 4G6TB 1Z6TA 4B43A 4ZYHA 2P8TA 1DU0A 4A3DJ 3V8JA 1SMTA 2HDDA 3I58A 3DBRB 1G3TA 3MMYB 3VYSB 3DPTA 3OYAA 4G7OF 5E3NA 5CVVA 1SANA 4C9YA 5B5EC 1KU3A 3CCJI 2VJ4A 3IKVA 1ONVA 2DDAA 5HDKA 2P5KA 3LSPA 3H5NA 1D3YA 5K5OA 2DMQA 3BR5A 1KGSA 2BZTA 3KP7A 1BOAA 1S8NA 5D6EA 3FM3A 2EFNA 2ZO4A 4BJ5C 5BMZA 1YRNA 1JT6A 2O0YA 4PGHA 3MD2A 4PFOA 4NDLA 3BOQA 4ZTJA 2IS2A 1MMNA 5HDGA 3E6CC 4KIGA 3PUFA 3HOVJ 3F0CA 4R79A 3F6VA 5FB2A 1NG7A 5CQGA 3ZQQA 2AXTC 1FMVA 2KIFA 1IN8A 2VLAA 2L3DA 3CF2A 4E7HA 2EBIA 4BBRJ 1R7JA 3HUGA 2R7DA 4HQMA 2PN6A 2BV6A 3LA7A 3S1MJ 2JSPA 2VBWA 2X6XA 3ZQIA 1RETA 1LDDA 2E19A 3LAJA 2X85A 5C3EJ 3QP6A 1IRZA 4HBLA 2XGEA 3RZOJ 3KP5A 1IDYA 2ME6A 3RQ4A 1QA6A 2A6EF 2Y0MA 3MKLA 1A31A 2ZMEC 4EMSA 5ICGA 4C3IJ 3DU6A 4PK4A 5L3FA 2CWEA 4ZH4F 4L5EA 3ABUA 4XM3A 4LGWA 3X2QH 1HLVA 3BJOA 3E5UA 5E1ZB 4CYCB 1H88C 3HJEA 1GLNA 2FD5A 3CMMA 1ZGJA 3S32A 2ZFUA 5JHFA 5IOYA 1XSXA 1W5TA 2G7HA 3OYHA 1FIAA 2R7OA 3OL3A 2M5WA 1LKXA 4NC8A 2IT0A 4RBOA 1QNTA 1IDZA 1FEXA 2AO9A 1JJ6C 1OISA 5B3SH 3GTOJ 4HX7A 1BR1A 1MMDA 1PYVA 2HWVA 4CYDA 3SDGA 5A2QK 2QM3A 5K1YA 2ZJ2A 3TOAA 2DQRA 2HI3A 4CH7A 4MTDA 3W3CA 1UHWA 4G9YA 5IT9K 4U88A 2STTA 2RVCA 1X3ZB 2WV0A 3OOPA 2NYXA 1JHHA 4A3BJ 1IXRC 2M8GX 5J1RA 3W6KB 3FXJA 5DTDA 2DA4A 2IA0A 4A3CJ 2KPMA 2RQQA 1HW2A 4XRSA 5ED4A 3H9GA 4DZPA 2EQRA 2H6CA 3K4MA 1T56A 3Q3SA 2HU9A 5B1BH 2EZIA 2COMA 1SD4A 3BY6A 1R1VA 3DPLC 4IHTA 1FOXA 3MQ0A 3I9V2 3T8RA 1HCRA 5DM6F 5DUIA 1VQ5I 3CCVI 3K7AJ 3HOTA 2Q2EB 1FPQA 2ECCA 1ORKA 2OQGA 2VASA 3BQYA 1RC9A 2B0LA 1PUFA 2CJJA 2EPFA 1EJ9A 4RGRA 3ECOA 2L9NA 4BE0A 3GTGJ 2R7FA 2E5ZA 1S5LC 2DU9A 1V5FA 4FISA 1SAXA 3WU2C 4YFNF 1R5HA 1OPCA 3CDIA 3NARA 5HS9A 2R5YB 2K27A 3ZMTA 5ICEA 3WODF 4YRVA 2A6TA 4L9NA 3PO2J 2LOOA 1FX7A 2CUZA 3VFZA 1OYIA 4RS8A 1XTAA 2VBZA 1FTTA 2V1XA 2PQ8A 4B48A 1KQ8A 2JTVA 3DXJF 3FMSA 1FSEA 3CD6I 2CUFA 4CCLA 1POGA 1B9MA 5HLHA 2OC6A 1XMAA 2DMNA 2ZMEA 4AWXB 1OYWA 2P0WA 2XF6A 4A12A 2V9PA 3LSTA 4ZDPA 2O5RA 4XOPA 2ZSHB 2P6TA 4UUSA 1IV6A 5AIQA 2VKDA 1ZHFA 1DGWY 5EDNA 2CFXA 2BHZA 3C2BA 2FBIA 2BW3B 1PVEA 4XBFA 3OS0A 1YITI 3LA2A 3O2PE 4LIVA 1X1AA 3HDDA 1V54H 4E7IA 3KEOA 2CW0F 3P5JA 1G8XA 3LFKA 3TW6A 4RB0A 1FC3A 1A35A 1Z77A 2ZJRF 1HDDC 1R5ID 4JX5A 4IX7A 1ZH5A 2JA8J 4H0EA 5IYDJ 4CICA 1OQYA 2QF7A 2V9KA 3C7JA 3VYTB 2XGDA 4B1RA 5H2FC 2STWA 2KKOA 1FJLA 5TRDA 4BH9A 2QBYB 1EKEA 5F1JA 1J2XA 4LJZF 1S72I 4N9HA 4RB3C 3AG2H 1EH6A 2CS3A 3JR9A 5HS8A 3BG6A 2X48A 4OAYA 4A3MJ 4Y15A 1Y6IA 1YTYA 2K86A 4QLCU 2DCEA 1W7PA 4HX4A 2DYRH 3HOSA 4I2OA 1S7OA 2LR8A 1FSHA 1WCMJ 2VPRA 4XLEA 4DOZA 3ZN1A 4AD9A 3MZHA 2C6YA 3CJTB 4MTEA 2DA5A 2MD0A 4LMYA 3HSRA 1CGPA 2A61A 2VC1A 1BJZA 2WBMA 2E2HJ 3OYNA 1DPRA 4D1QA 4PGGA 2DOEA 3F8NA 3J7YJ 1HBXG 5ICFA 4XSXF
chains in the Genus database with same CATH topology
2B7EA 2L9VA 2DOFA 2K85A 2DOEA 2KZGA 2LKSA 2KISA 2E71A 1UZCA 2KFDA 2JUCA 2DODA 2KIQA 2CQNA 4FQGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  2L9V A;  2DOF A;  2K85 A;  2DOE A;  2KZG A;  2LKS A;  2KIS A;  2E71 A;  1UZC A;  2KFD A;  2JUC A;  2DOD A;  2KIQ A;  2CQN A;  4FQG A; 
#chains in the Genus database with same CATH topology
 3HEF A;  5LEJ A;  3VYU B;  1TT0 A;  4U0W A;  3G6E I;  1MIJ A;  2VL8 A;  4MHG A;  2XDV A;  3JAM Z;  4BYY A;  4BUP A;  2WV1 A;  1USS A;  3TDU C;  5EG0 B;  3V42 A;  4HF1 A;  1WSU A;  4BE2 A;  4RGX A;  2DTZ A;  1HDP A;  3ZQF A;  3U21 A;  2KRC A;  2JRM A;  3Q0W A;  3PQJ A;  3FIS A;  2BYV E;  5FFX A;  1I5Z A;  3T0Y A;  1O4X A;  2UXX A;  4GGG A;  2Y0S N;  3COA C;  5E79 C;  5M3M J;  1Z6R A;  4A2U A;  2R7Z J;  3ZQG A;  3K4C A;  4NNJ A;  1GVD A;  1BR2 A;  1BR4 A;  4OMY A;  3B02 A;  3ELK A;  3RTR A;  2W25 A;  2R5Z A;  2D2W A;  3TP3 A;  2Z99 A;  3KP4 A;  3G71 I;  4NQW B;  3HL2 A;  3LOC A;  3JRD A;  2IS4 A;  2JZY A;  1YFH A;  1JT0 A;  3CCL I;  3GTQ J;  3K4N A;  1UCR A;  1VQP I;  1S7E A;  5EEG A;  2A05 A;  2DOD A;  3P9I A;  5D4S A;  1KU7 A;  4OIR F;  1P4W A;  4KIB A;  1VQM I;  2AXL A;  4UHT A;  1T39 A;  2EIK H;  4I6Z A;  1BI3 A;  1T2K A;  1R58 A;  2PFB A;  1RI7 A;  2ELH A;  1W7P B;  5LD2 C;  2HKX A;  3JRG A;  2F5C A;  3PFI A;  1SC7 A;  1NK3 P;  1REP C;  4HW0 A;  1KQ0 A;  1C0W A;  1DP7 P;  3KP3 A;  3LL7 A;  3ZXS A;  3QOE A;  2HOS A;  2WWY A;  5FRM A;  2HQR A;  3OYK A;  2GXG A;  1NH3 A;  1TWH J;  5KVR A;  2K3P A;  2TRT A;  2PJR B;  4I09 A;  1YLF A;  1QHH D;  2X6Y A;  3MKZ A;  3QAH A;  2DPU A;  2ACJ A;  5CJ9 A;  1FY7 A;  3CCU I;  2QLZ A;  3EUK L;  1QZE A;  1D1A A;  3RDI A;  2LNB A;  3CCY A;  1ZTR A;  4KMF A;  5E20 A;  1KU2 A;  2MC3 A;  3EUA A;  4XKC A;  4ABZ A;  1K6O A;  4BXX J;  1KYW A;  2NOG A;  3DEE A;  4M6X A;  4U87 A;  1NK2 P;  2EV5 A;  5GPC A;  3E5X A;  3S1N J;  2VOP A;  3Q0V A;  3BDD A;  3E6B A;  5LEK A;  1DPU A;  2JT1 A;  1QQI A;  3ZN0 A;  2LH9 A;  2FF4 A;  3OYG A;  4IF4 A;  1LEA A;  3OOU A;  3GZ6 A;  1VQ7 I;  2NS0 A;  2DOA A;  3ESW B;  3MZ8 A;  3M8E A;  4KIT B;  2EV6 A;  3VSL A;  4NBQ A;  2RNJ A;  2ZXJ A;  2VXD A;  1GXP A;  5BPI A;  2EK5 A;  2CYY A;  1VI0 A;  1LFU P;  1G59 A;  5CLS A;  2HR3 A;  4PDK A;  2H27 A;  1EA3 A;  3F23 A;  1XPX A;  2DK5 A;  4OIQ F;  4MO7 A;  3I0T A;  2KIS A;  2OJE D;  1XS9 A;  3ML6 A;  4HA8 A;  2X1E A;  4A3G J;  5CVJ A;  1IGN A;  2WAD A;  1ZQ3 P;  1ZKG A;  2E1O A;  2FJ1 A;  3QPT A;  4RM2 A;  2EZH A;  2XKO A;  1SMY F;  3S2H J;  4B8X A;  2QGU A;  2GA2 A;  2VC0 A;  2RNG A;  3Q0U A;  3FKI J;  5FKM A;  4GRI A;  3F3X A;  3TO6 A;  2E36 A;  4LG3 A;  3IH3 A;  4ESF A;  1ZGW A;  1B72 A;  1SVM A;  2F5F A;  5E8G A;  2JUG A;  1FOW A;  3EDP A;  3K4J A;  2BVM A;  2DA2 A;  2BY3 A;  2HOT A;  2IXS A;  3FMR A;  4ITV A;  3DFG A;  4M73 A;  2IJL A;  4L5J A;  3BZK A;  1LFP A;  2R3S A;  3WGI A;  2NVT J;  4UVB A;  4DYQ A;  4QWQ A;  3CJQ B;  5DCF A;  1BC7 C;  1R22 A;  3PL8 A;  3VOD A;  4I02 A;  1ITY A;  2VJ5 A;  1YX3 A;  2QCO A;  3GFL A;  1SD7 A;  2ESH A;  1MBG A;  3WU1 B;  2PMU A;  1E0E A;  1JUM A;  1MD0 A;  2OU2 A;  4LK0 F;  1B59 A;  1MKM A;  4EM0 B;  3C3W A;  3K0L A;  4KUM A;  5HLI A;  4MIM A;  1GXQ A;  2X1D A;  4F92 B;  5HOD A;  3TW7 A;  3H0D A;  4CGZ A;  1SFO J;  1Q1H A;  1Y1W J;  4GCV A;  4E7L A;  2Y69 H;  2A5W A;  1UST A;  5TGT A;  3J81 Z;  1XMX A;  2NAZ A;  1LQ1 A;  2F4M B;  4D7M A;  2X1C A;  1WPK A;  2ZXH A;  3DPU A;  4L18 B;  3FHN A;  2VQL A;  4LFU A;  3LQQ A;  5J4Y A;  4U7B A;  1A36 A;  2CFO A;  3H1C A;  4EJT A;  5B1A H;  2HFH A;  3K69 A;  1R71 A;  3JRC A;  4I01 A;  1KQ9 A;  4KIC A;  4OIP F;  3ZOB A;  4LLN A;  4HNU A;  2EIJ H;  4KMU X;  1BA5 A;  1TW2 A;  2JPB A;  5IYC J;  5DYM A;  3RQI A;  1BJA A;  2CQN A;  3N05 A;  3S3O A;  2KP6 A;  3M1C A;  4Y17 A;  2NVY J;  2OZ6 A;  2KL4 A;  4P9U A;  1MJA A;  2DJN A;  3FBI B;  3KYL A;  1U78 A;  1IG7 A;  5LLQ A;  2CGP A;  2O8K A;  2CMP A;  9ANT A;  2K9S A;  1GV5 A;  2FA5 A;  3ROU A;  2HEO A;  1XX5 A;  2GQQ A;  1VQ4 I;  2EFW A;  2IVM A;  2QEN A;  3JCU C;  1I1G A;  3VB2 A;  2A6H F;  4BU2 A;  1XGM A;  4LG0 B;  2AQE A;  3AAF A;  1HF0 A;  2M30 A;  2HTS A;  3ZRG A;  1YX5 A;  3S3N A;  2K9L A;  4EJV A;  2O8X A;  3CO6 C;  2KT0 A;  3FXM A;  1UHS A;  3KP2 A;  2LD5 A;  2ADU A;  4BS9 A;  4EJW A;  3K4B A;  3TQN A;  2Y48 A;  5CQE A;  2PG4 A;  4PJN A;  3QRF F;  1X3U A;  5EGO A;  4MLO A;  4HF2 A;  2LC2 A;  4MGR A;  3JAM K;  1L0O C;  2QEX I;  3ECH A;  3VSK A;  1JGS A;  1W5C C;  5CVU A;  3CCM I;  2OZU A;  5L3D A;  1MMS A;  3OYC A;  1JJ8 C;  3W2W A;  4IHW A;  3KZI C;  1SEU A;  1LVK A;  5FLX Z;  2JA6 J;  4IQJ A;  3WTX C;  4V19 K;  4NC7 A;  1R6R A;  1MDM A;  2PMZ A;  4IHY A;  3FXK A;  1FBU A;  2BY2 A;  1D8J A;  4U0Y A;  2ELJ A;  5IP6 A;  3J80 Z;  1IN4 A;  1Z7L A;  3BR3 A;  4WWC A;  2F48 A;  3K1P A;  5J6X A;  2NNN A;  3QU6 A;  3VEP A;  2Y75 A;  1JTX A;  3RJP A;  3PSI A;  1G3Y A;  1IN5 A;  2F5D A;  2L9R A;  4DGW B;  1ZRF A;  3HRT A;  3DTK A;  3TDZ C;  4XN0 A;  2QKL B;  3MWM A;  4FTH A;  2FBH A;  4WXD A;  1D5Y A;  1HSJ A;  2LDU A;  3KFW X;  1D0Z A;  5E8I A;  4BNC A;  3KEY A;  3HPH A;  3S3M A;  3EQL F;  5JLW A;  2OTJ I;  4G7Z F;  2CUE A;  3L9F A;  2K85 A;  3GFI A;  2D1H A;  4A5N A;  1T38 A;  4XOT A;  2DK8 A;  1LDJ A;  1PUE E;  1J59 A;  4V2G A;  4U7D A;  1E3P A;  5F08 A;  4DIQ A;  2VT2 A;  1DP3 A;  1R4N B;  3K2A A;  2J5P A;  3W6J B;  2JQ7 A;  4UY8 I;  2JA2 A;  3BR6 A;  1S7A A;  4CYC A;  5J1Y A;  3CJR B;  1YG2 A;  1D8K A;  3M7G A;  3LSI A;  4J01 A;  4HQE A;  5H6R A;  2MG4 A;  3HPG A;  4YEJ A;  4BQO A;  4RGS A;  3H5R A;  2O9L A;  3P9K A;  2Y0S A;  1QO0 D;  1YJW I;  5L3G A;  4PJJ A;  4EJU A;  3HM5 A;  5FKL A;  4HST A;  1T98 A;  5GAH J;  2P5V A;  4IQ4 A;  3I53 A;  3F8B A;  3QPS A;  2VQH A;  4ENJ A;  3BR2 A;  2XIG A;  3OYE A;  2L01 A;  5D5X B;  1YQA A;  3WTV C;  2BXY A;  2XC7 A;  1MDM B;  5D8L B;  2UXN A;  4DBQ A;  3V7C A;  4G6D A;  2FOK A;  3I4N J;  4TV7 A;  2DDB A;  4IRH A;  4HG2 A;  3H35 A;  5HS7 A;  2HYF A;  3SHF A;  1JUS A;  3OYB A;  3MVP A;  2R7V A;  5F0H A;  3W2A A;  1S6L A;  5C4X J;  2Q0O A;  3S14 J;  2MH9 A;  1H89 C;  3C2G A;  2JVH A;  2CQ7 A;  4C3J J;  4BBS J;  4MFE A;  2V1N A;  2W00 A;  1YOV B;  4XLH A;  4CCN A;  4M3B A;  3G2B A;  2Z3Y A;  2NXN B;  1TP4 A;  1IN6 A;  2GBY A;  2CU7 A;  5J3L A;  3IP4 B;  3FDY A;  4BKX A;  4F91 B;  4F93 B;  5L3E A;  2GLO A;  1IUF A;  1SFU A;  3L09 A;  1R00 A;  2LP0 A;  3HYI A;  3OYI A;  2B7E A;  4IHX A;  3QYF A;  2DI3 A;  2M2E A;  4M9X A;  2HZT A;  2BVL A;  4EGZ A;  3WU0 A;  1QZZ A;  5D5U B;  3BWG A;  2Q2E A;  3OYM A;  4DBR A;  5E18 F;  2V1U A;  1TW3 A;  3I59 A;  1Q1V A;  3SQN A;  2CV2 A;  4ZYG A;  2WAQ A;  2K9Q A;  2PLY A;  1TQM A;  1JKQ C;  3G4S I;  1RZ4 A;  2UV1 A;  4XLA A;  1K78 B;  3OIO A;  2HXO A;  2HVS A;  3OWT A;  1F4K A;  4IRI A;  3FWE A;  4HYE A;  2R7S A;  3FXR A;  2HQA A;  4ZYA A;  4BGD A;  3E7L A;  2OTL I;  3GEZ A;  3NQO A;  2HOA A;  2KIU A;  2JRT A;  5JVG F;  4QPO A;  4X0G A;  3I4P A;  4IHV A;  1BI2 A;  1Z67 A;  2RKH A;  1MBJ A;  2EIM H;  4S0H B;  4EAT A;  4I98 B;  2R5Y A;  2EH3 A;  2M9H A;  4UNO A;  4O6J A;  1SVL A;  4P9F A;  5GAD J;  2QQ9 A;  3J7A Y;  4FQG A;  4Q5S F;  3JRA A;  2CUJ A;  3QP5 A;  3JTG A;  2OCE A;  2HS5 A;  3FX3 A;  1Z1D A;  1OKR A;  2CW7 A;  2L54 A;  1Y0N A;  2XAS A;  3VDX A;  4BJ6 C;  3J81 K;  2F5E A;  5HVQ C;  2DO7 A;  1MH3 A;  2ZB9 A;  4AC0 A;  2LRD A;  2Z16 A;  2FRH A;  1PDN C;  2BGC A;  2DT6 A;  3FXQ A;  2V6E A;  2IS6 A;  1JHF A;  4UB6 C;  4A6D A;  2DA1 A;  3S17 J;  4OIN F;  2R7U A;  3K4L A;  2M34 A;  2BW3 A;  3P9C A;  5J8F A;  1JXS A;  3FXU A;  3HRU A;  1K79 A;  2M4G A;  4YII A;  2HYJ A;  1J9I A;  1UG0 A;  3PNY A;  3GZN B;  5CYV A;  3HGY A;  1GVJ A;  2QA4 I;  1YW8 A;  5HNH A;  2KJC A;  3A2K A;  2OA4 A;  3I59 B;  4FAS D;  2L02 A;  3NWS A;  4BY7 J;  2CH0 A;  4BXF A;  2DTR A;  2IGK A;  4Y13 A;  2QBY A;  3KLO A;  3LMM A;  1Z21 A;  5HNF A;  2OAZ A;  4XON A;  4A0Y A;  3D5R C;  4XKB A;  2JK3 A;  5BPD A;  3PO3 J;  3WTT C;  4PJL A;  1IO2 A;  4S05 A;  2KLO A;  1Z3Y A;  3CES A;  3V4G A;  4CCM A;  5F64 A;  4ETS A;  1MJ9 A;  3BPX A;  4DNC A;  2W82 A;  1V55 H;  3DKY A;  1FYL A;  3I55 I;  4HNV A;  3K10 A;  2JA7 J;  2IEK A;  3RI4 A;  3GTJ J;  2DFH A;  2OV7 A;  4NB5 A;  2HQN A;  3FXO A;  2CRG A;  3CDH A;  1AKH A;  3TBI A;  3DLA A;  2DPD A;  1SVO A;  4M6Y A;  5LRR A;  1LUJ B;  4JP0 A;  1YIJ I;  1AU7 A;  3VYR B;  3PQK A;  1J7K A;  1TNS A;  1IXS B;  4IKF A;  1E17 A;  3KEQ A;  1D0X A;  1A6I A;  3QYB A;  5LRS A;  4ESB A;  4A3L J;  3J80 K;  5EG0 A;  2QSH X;  5IT3 A;  1LVA A;  4GO1 A;  5ILV A;  3NWT A;  1OCP A;  1N75 A;  2UZK A;  2EFO A;  2FEZ A;  2OD5 A;  2KFD A;  1Z7U A;  2JA5 J;  1PJR A;  3HTS B;  4R1H A;  1WJB A;  1AWC A;  4A93 J;  3CUO A;  1DU6 A;  4CA0 A;  2CQK A;  1V5E A;  2WTE A;  1HA8 A;  3V8L A;  3KYD B;  3CCQ I;  1IRF A;  1F9N A;  2ELK A;  2CW8 A;  4II2 A;  4RM3 A;  5EEH A;  4BEH B;  3OIQ A;  2K9M A;  5K7F A;  5LHI A;  4NQW A;  1SAU A;  4CZC A;  1ON2 A;  1APL C;  3JRH A;  4E7S A;  3IC7 A;  4S04 A;  2DJI A;  5FD6 A;  4FCY A;  2Z5U A;  4Y33 A;  4KA4 A;  1BI0 A;  2PI0 A;  3GVA A;  2PEX A;  4RAG A;  2FML A;  1B9N A;  1JUP A;  2YX4 A;  3K9T A;  3HB9 A;  4Z2Y A;  3F8C A;  1ACI A;  3TGN A;  4KT6 A;  3VPR A;  2EZK A;  3ZMV A;  3HGG A;  2OBP A;  3G1L A;  3OYJ A;  4GXO A;  4HRI A;  2E2J J;  1A5J A;  2V26 A;  4UVA A;  1MH4 A;  2XV4 S;  1QU3 A;  4ZZD A;  2PJR A;  2O03 A;  3RZD J;  3JSO A;  1I1S A;  3N4M A;  2BE5 F;  1AKH B;  2HGC A;  3FBN B;  1WZ2 A;  3OYD A;  4LD5 A;  3LFU A;  3CCE I;  3CTA A;  2LY2 A;  5D5V B;  1VQ6 I;  2XPV A;  3J7Z I;  1WFX A;  4RDU A;  5BQT A;  4BDY A;  3G73 A;  1XDU A;  3A0H C;  3KE2 A;  1EF4 A;  4GYG A;  2B9S A;  2DBB A;  2F5V A;  2JPC A;  2CV1 A;  2MSY A;  3BJ6 A;  1A6Q A;  2IAI A;  2WAF A;  3DLL F;  2P7C B;  2VBY A;  3ABM H;  1W4M A;  1SFX A;  3ABK H;  2NVX J;  1W0T A;  2E7W A;  4L9V A;  4FT8 A;  2M45 A;  4GYI A;  2RN7 A;  2A5Y B;  5FFZ A;  4AYB N;  2VON A;  2BY1 A;  5DEQ A;  4CSW A;  2GAU A;  5C4J J;  5J4V A;  1H9G A;  2TCT A;  1OCO H;  2G9W A;  2LFB A;  2DA7 A;  5IPA A;  3B73 A;  4AID A;  5L3B A;  1B8I A;  5CVI A;  1VQO I;  2D5V A;  4I0B A;  3L2V A;  2LF7 A;  1TLH B;  4G12 A;  1BM9 A;  1BN5 A;  4B3A A;  3F6O A;  3GTK J;  2CSO A;  3IRQ A;  1ZRE A;  3BQZ A;  3GLX A;  4C3H J;  3HKZ N;  3S1R J;  3IKT A;  2Y9Z A;  1X1B A;  1IAW A;  5F0F A;  3K2Z A;  5E3O A;  4DQ2 A;  4M74 A;  2BOL A;  4BHC A;  1OCZ H;  5AIP A;  5FD5 A;  1KZH A;  4XRM A;  1P7J A;  3QYE A;  2JUC A;  5GP9 A;  1D0Y A;  2JN6 A;  4EV0 A;  3HOY J;  1U5T B;  4MQV A;  5IY5 H;  1X4P A;  1WWX A;  3DTE A;  5ICC A;  3PUB A;  1ON1 A;  3GX4 X;  4ZTF A;  1FOK A;  4FHT A;  2FNA A;  1Y8R B;  3G1O A;  1R36 A;  3DKX A;  5JI6 A;  3HHH A;  2NS8 A;  2DOF A;  1N78 A;  3GTM J;  4AIH A;  4BQN A;  5KNL A;  1U9O A;  1J75 A;  3CDL A;  1V4R A;  2XVC A;  2MW8 A;  3AG1 H;  3ZGK A;  3G3Z A;  1VQ9 I;  3RYR A;  3RPU D;  3PIO F;  2RQP A;  4LB6 B;  2M4K A;  1K6Y A;  2H8W A;  1XGO A;  1K4T A;  5J8C A;  3LSH A;  4BQA A;  2R7Q A;  2BY0 A;  3Q9V A;  4BQQ A;  4E7Z A;  5EZH A;  1MND A;  5LBQ A;  2XPW A;  1SFK A;  4PUS A;  4ZDO A;  3UR3 C;  2HXI A;  3CUQ B;  1HW5 A;  4FX0 A;  1M1E B;  3C1D A;  4HF0 A;  2QVO A;  2IS1 A;  2KHM A;  3JRI A;  4XQF A;  4IPA A;  4M3G A;  3H92 A;  2L9S A;  2DMP A;  1UZC A;  1P9Q C;  1R1T A;  1WJA A;  3OR2 C;  1R23 A;  4HX8 A;  4AVP A;  3TO7 A;  1D5V A;  2CQX A;  2FSW A;  4OU0 A;  2PMH A;  1B8I B;  4PJ0 C;  2Y31 A;  1JKO C;  3W6V A;  1JGG A;  3W2V A;  1BW6 A;  1LB2 A;  4KJZ A;  3A0B C;  1R4M B;  1XMK A;  1Y8Q B;  1OFC X;  2WB1 N;  3H5A A;  3EYI A;  3AL0 B;  1UAA A;  3S1Q J;  3IWF A;  3OMY A;  4N4O B;  5E17 F;  1TWA J;  1CF7 A;  3BJA A;  4MEY F;  4EM2 A;  1QGP A;  2EB7 A;  3K1M A;  2DN0 A;  1UFM A;  5KK1 A;  3KZY A;  5DDG A;  4A69 C;  4MQ9 F;  3H36 A;  2HPM A;  3WTU C;  1OCC H;  4XLF A;  5BS6 A;  3K6G A;  3GTP J;  3ZMZ A;  3I3L A;  1XSD A;  3S2D J;  1MBH A;  2BEO A;  3U2R A;  2DW4 A;  3BTL A;  1SD6 A;  3H9Q A;  1QPM A;  2VKV A;  3RKX A;  2V1D A;  3HZJ A;  1HC8 A;  2VB6 A;  2O3F A;  5JHU A;  2V4J C;  4C2T A;  2LRE A;  3BTI A;  3MN2 A;  3BT9 A;  4IJA A;  4LG0 A;  3IV5 A;  1S29 A;  2QQB A;  2L4A A;  3DEW A;  3KIO A;  3A01 B;  2MC4 A;  1JKP C;  1FZP B;  1YW9 A;  3F72 A;  4XLC A;  4A3F J;  3ZQL A;  2LVS A;  2QSG X;  2E5N A;  2X6O A;  4J19 A;  2K7L A;  1ETY A;  2N8G A;  2GXA A;  2M3A A;  3CC4 I;  3U1K A;  2L0K A;  5M5Y J;  1IJW C;  3BTJ A;  2HQ5 A;  1D1B A;  3Q9S A;  2A68 F;  1W36 D;  1KYZ A;  1MMG A;  3G1M A;  2ZNY A;  2J5O A;  2KMU A;  2OQR A;  4HV5 A;  4M72 A;  3KCC A;  2ID3 A;  1VZ0 A;  1OCR H;  3O6B B;  2RDP A;  3ASO H;  1IZ1 A;  1MMA A;  4FET A;  3DCF A;  4C30 A;  2JMW A;  2E1M B;  3HTU A;  5GPA A;  4CXF A;  4DZJ A;  4XK4 A;  5EJC A;  4EEF G;  3SDB A;  3HRS A;  3JRB A;  1YO5 C;  4O3M A;  2E1C A;  2VIX A;  2NVU B;  2IA1 A;  4ZYD A;  1YHQ I;  1JTY A;  5DCM B;  1HKS A;  5K5Q A;  2Q1Z B;  2VE9 A;  2LKS A;  1T8I A;  5EEA A;  4HAM A;  2EFP A;  4P5O A;  3V7S A;  2BBY A;  3SEQ A;  4F7Z A;  5A2Q Z;  3GYH X;  5LHG A;  2M87 A;  1TWF J;  4D5F A;  4EM1 A;  4ZYE A;  1U3E M;  4PFP A;  2IW5 A;  1CF7 B;  3LSG A;  3GFJ A;  1DDN A;  2R7X A;  4PSW A;  1ZYR F;  4HDV A;  4I0A A;  2DXI A;  4IHS A;  5HLT A;  2E2I J;  2W57 A;  2CO5 A;  2HVQ A;  1UG2 A;  1E3O C;  3CMY A;  1HXD A;  4XSZ F;  1O3T A;  1P6R A;  4OWR B;  2DT5 A;  1T95 A;  2ISY A;  2NNY A;  3JW4 A;  4NHJ A;  5FO5 A;  2OCC H;  1QVU A;  4FE4 A;  2PJP A;  5GAE J;  4AM3 A;  2QQA A;  4P55 A;  2NVQ J;  4B44 A;  4XLN F;  5DD8 A;  1WH7 A;  4UV8 A;  4J00 A;  3E97 A;  5HDN A;  2UWM A;  3WTZ A;  3OY9 A;  3HOZ J;  2YUS A;  5D8K B;  1FYM A;  5J40 A;  3AG3 H;  4WXC A;  3H3V K;  1LJ9 A;  3L2R A;  3HG9 A;  3R60 A;  2FNP A;  3NRV A;  4KN7 X;  4N4N B;  2VBX A;  5M5X J;  2EJR A;  4KNY A;  5E3L A;  1K61 A;  4ENM A;  1Y1V J;  4XN3 A;  3B6A A;  2ZXW H;  1RNL A;  2MYS A;  3RSN A;  4BHB A;  4BJT A;  2M1B A;  4RAY A;  1O3Q A;  1VQ8 I;  2IRF G;  3S93 A;  1YYV A;  1R49 A;  2K4B A;  3GLL A;  1X4O A;  3JRF A;  3I64 A;  1FP1 D;  2F2E A;  2ZNZ A;  2MGQ A;  4QPQ A;  4CCO A;  4HNT A;  2IPQ X;  3MEX A;  3ABT A;  5K7Z A;  1Y0U A;  2XAH A;  5DV5 A;  2CQQ A;  1LEB A;  5DS9 A;  2KZV A;  3IHU A;  1E2X A;  1RRJ A;  3O3K A;  1WJE A;  2G0E A;  3FM5 A;  4Q4Z F;  1J0R A;  2XAQ A;  3WTS C;  2P7V B;  4F55 A;  4M3F A;  2ZXI A;  3RPQ A;  3K4K A;  2V79 A;  1MSE C;  1HOM A;  4M6V A;  4E7K A;  1Y56 A;  3FMQ A;  2OPT A;  3GW2 A;  4D0P A;  4X1E A;  3CCS I;  1SD5 A;  1I3A A;  3D5S C;  2HDW A;  4GFB A;  2HNH A;  1XCB A;  5GTI C;  2COB A;  2DYS H;  4A3K J;  3BG5 A;  3OV8 A;  2F4O B;  1T6S A;  3NAU A;  4KT5 C;  1YI2 I;  2MLK A;  3V7R A;  2VKH A;  3VWB A;  4KFC A;  1NG6 A;  2MAB A;  1F36 A;  1ZGA A;  2Z9O A;  2UUZ A;  1RKT A;  5E3M A;  1FNN A;  1MBF A;  2EIL H;  5LGN A;  5GTH C;  2MBF A;  4JQF A;  5EYR A;  3MFK A;  2A07 F;  3AFH A;  4YFX F;  1NHA A;  3PFY A;  1BIB A;  2LTP A;  3HOU J;  1G2H A;  5HOO A;  1U8R A;  1TNT A;  1K78 A;  1BIA A;  2FMY A;  4IVN A;  1TBX A;  4NUB A;  4NC6 A;  4M9S A;  1EV7 A;  5ILU A;  1ENH A;  3M9A A;  5CVR A;  1WH5 A;  4ENN A;  1RUO A;  1LE8 A;  3CZ6 A;  3SZG A;  1DQU A;  4UV9 A;  4WCG A;  3ZQC A;  3BPV A;  3C18 A;  4AYB A;  1SFE A;  4PZJ A;  3DF8 A;  1VF9 A;  5M3F J;  1EH7 A;  2P81 A;  1GDT A;  3ZPL A;  3OS2 A;  2X0L A;  3M8F A;  4DYR A;  4XKW A;  4UB8 C;  1MBK A;  1XG1 A;  3WTW C;  3I56 I;  2OF7 A;  1IC8 A;  1ETV A;  3BR1 A;  4PSX A;  3CME I;  1GUU A;  4I7H A;  3K1N A;  4IO9 F;  2W24 A;  1FP2 A;  4BAY A;  3R61 A;  2YR2 A;  3OS1 A;  4II3 A;  2XF7 A;  3B6C A;  4AUX A;  3DKW A;  3LWF A;  5FJ8 J;  2B63 J;  4CCJ A;  2R7R A;  5FRN A;  3BG9 A;  5H6Q A;  2G7U A;  3HHG A;  2ZSI B;  4N9I A;  3MKY B;  1WI9 A;  4BDZ A;  2M7A A;  4EGY A;  4BY1 J;  3DBH B;  1BBY A;  2LMD A;  3MAJ A;  2LBF B;  1FYK A;  1W36 C;  3FK6 A;  3E0J B;  4KIS A;  1IW7 F;  5J47 A;  3NEU A;  2XF5 A;  4D5C A;  3ULQ B;  3F9K A;  1R5G A;  3VOE A;  3SXY A;  1YS6 A;  2ID6 A;  4G94 A;  3FHZ A;  5F6F A;  2PX9 A;  5ILS A;  1VQK I;  3CC2 I;  3T1B A;  3PNT A;  3CJN A;  5KHD A;  2EWN A;  1STZ A;  1HKQ A;  2DQL A;  4HOB A;  3ZQH A;  2RC4 A;  4R8H A;  5JVT A;  1B4A A;  3F8F A;  1MBE A;  2K3F A;  1RPW A;  2I10 A;  3QOP A;  3JRE A;  2EIN H;  4XIC A;  1LE8 B;  2K9N A;  3IUO A;  2FX0 A;  1ERD A;  4E6K G;  1XDS A;  4C2M J;  3KET A;  1U8B A;  4QSH A;  2DA6 A;  2FUG 2;  3FKJ A;  3WG7 H;  2GWR A;  1OYY A;  2I5U A;  3RPU A;  1F43 A;  3KYC B;  2OUM A;  1XCV A;  4ESJ A;  1OR7 C;  1WVR A;  5LFA A;  1KON A;  1YE9 A;  4F3Q A;  3GCM A;  3IH4 A;  4CHU A;  4P1W A;  4I76 A;  2ME0 A;  2H1L A;  4B47 A;  2DA3 A;  2WB1 A;  3TKY A;  4CO8 A;  2VUM J;  3BR0 A;  2O7O A;  5FKK A;  4A0Z A;  1P92 A;  4A5M A;  1O3R A;  3C2H A;  1OLT A;  2L4M A;  3EET A;  2X9D A;  2JWT A;  2L7M P;  3DBL B;  4BAC A;  2W85 A;  1U5T C;  2GIZ A;  3O8H A;  2V9V A;  4CCK A;  1HKT A;  1TT5 B;  3RIR A;  3F21 A;  4XMY A;  2GOM A;  3IL2 A;  3WG9 A;  3LAP A;  2LYC A;  3S16 J;  3L2Q A;  4HLX A;  1X58 A;  3HBL A;  5D5W B;  1YRN B;  1P7I A;  2KIM A;  3M1E A;  5FLM J;  1S9H A;  4BEH A;  2ZC2 A;  2LG4 A;  3PNV A;  2DMU A;  3LSM A;  3GF2 A;  4JK1 X;  1G3W A;  3OYL A;  1ETX A;  1UB9 A;  5LHH A;  1RES A;  1XB4 A;  3GME A;  3A03 A;  1K4S A;  1MGT A;  5H20 A;  4DW6 A;  4ENK A;  1V5G A;  3HUG B;  4LK1 F;  2XKP A;  3CUQ C;  1FWZ A;  4RMN A;  4ZDL A;  3REO A;  2KRH A;  2KJB A;  3OL4 A;  1Z05 A;  3E6D A;  5DD4 A;  3QPL A;  1YJN I;  4XRS G;  1ZK8 A;  1U6G A;  2YPR A;  2Z2S B;  2HPI A;  2ZJP F;  3H0G J;  2WY7 Q;  4UUV A;  1FBS A;  1I39 A;  4LIU A;  1ETK A;  3CMA I;  3QOD A;  5ERI A;  1YW7 A;  2RRE A;  4YEL A;  4AIJ A;  5L3C A;  5B66 C;  3AL0 C;  4ZZL A;  3O8G A;  5FLX K;  2O6G E;  2A69 F;  2JSC A;  4L9T A;  4Y7N J;  3PJR A;  3WGG A;  3E3V A;  4OIO F;  1U0J A;  2ZJQ F;  4RAZ A;  5HLG A;  1WI3 A;  2R93 J;  2IP2 A;  1FT9 A;  3BCB A;  5F04 A;  2VJI A;  3BLY A;  4RB1 A;  4RB2 C;  2L5Q A;  4I99 C;  2W1O A;  2L7F P;  3LNQ A;  3HOW J;  2H1K A;  3DWL E;  2VPL A;  4LB5 A;  1G3S A;  1UEL B;  1BL0 A;  1I3Q J;  1VFC A;  2E1N A;  1X2N A;  1Z9C A;  2XAU A;  2WAE A;  3MCZ A;  3DU5 A;  3M3Y J;  2VXZ A;  3CLO A;  5JR3 A;  3RKQ A;  4UXN A;  2GXB A;  3GXO A;  2GZW A;  5IP9 J;  3D1N I;  3GWZ A;  3GZ5 A;  4IOC F;  1TQI A;  4ASN A;  1K7A A;  1R9T J;  2F6C A;  2HZD A;  3ASN H;  3OIP A;  5TIS C;  2YSR A;  4L9J A;  2DAO A;  3UNG C;  3F8M A;  2AHQ A;  1I6X A;  2QQ8 A;  1WJC A;  3SFZ A;  2O61 A;  1BOB A;  2LK2 A;  1OR7 A;  1XSV A;  3DEU A;  4UUT A;  4G7H F;  4XNF A;  4N0B A;  4ZJZ A;  2XUB A;  5DUK A;  1CQT A;  1AA7 A;  2R7T A;  4HPQ A;  2MH2 A;  4QTR A;  2LY1 A;  1V3F A;  5KCM A;  1WRJ A;  4EVI A;  2E1M C;  3KP6 A;  4CDG A;  3T5X A;  3ZCO A;  3K70 D;  1IRX A;  1XGS A;  3D0S A;  3ZMS A;  5LGU A;  2PMZ N;  4F52 A;  2P5L C;  4G6Q A;  4U0V A;  3TMO A;  1U5T A;  3CO7 C;  1WJ5 A;  4LIT A;  5BOX A;  2W7N A;  1H8A C;  3FXL A;  4A3I J;  2VQG A;  3V8K A;  1TZL A;  4M3E A;  1AOY A;  4MNU A;  2KZG A;  2YU9 J;  3I4M J;  3HSE A;  1TTY A;  1I50 J;  1PUF B;  2XAG A;  3L1P A;  1VND A;  4E7J A;  1GT0 C;  4RA2 A;  1DGR M;  1U2W A;  1I27 A;  3ZP5 A;  4A6E A;  5FGM A;  2Z33 A;  1ULY A;  3LA3 A;  1R1U A;  4ZC3 A;  3JSP A;  1TWG J;  4Y3O A;  1WJF A;  3SZT A;  1I6H J;  1OMI A;  3M07 A;  1YIO A;  1H9T A;  4CZZ A;  4RLF A;  3P7N A;  4O5V A;  4DJA A;  3A02 A;  4CUG A;  1X19 A;  2XRO A;  1EH8 A;  5M5W J;  1T08 B;  3IH2 A;  1RUN A;  4C2U A;  1ETW A;  3CQZ J;  4OMZ A;  1ZG3 A;  3CUQ A;  2IGM A;  1ODD A;  4YIR X;  4A3J J;  5IYB J;  3GTL J;  3S15 J;  2FU4 A;  3LSR A;  4PJM A;  3L00 A;  1ZRD A;  2L7Z A;  3ZR8 X;  2V6C A;  2IA2 A;  2XB0 X;  2ESN A;  4B3X A;  2YS9 A;  2ZME B;  2RGV A;  1O57 A;  4LLG F;  4LLL A;  1LDK B;  2ECB A;  2HVR A;  2H8R A;  1P4X A;  1PP7 U;  3LQR A;  1Z91 A;  2E60 A;  4UUS B;  1RIO H;  2YX7 A;  1ZR2 A;  1KU9 A;  1ZN2 A;  2PBI A;  2WA0 A;  1X3W B;  3UKG A;  2NRA C;  3QPH A;  2XAJ A;  1IUY A;  5EZG A;  5JFR A;  2L7K A;  4EJO A;  3OR1 C;  2VJJ A;  3OYF A;  4BXU A;  3ZMU A;  2L2O A;  4Y4R A;  4P96 A;  1TL8 A;  3CC7 I;  1O7L A;  2ZCW A;  3WE2 A;  2HDC A;  1XGN A;  2P4W A;  4ANJ A;  5K5R A;  2VI6 A;  2VQC A;  2VN2 A;  3MZY A;  2XB5 A;  1FIP A;  3ZQ7 A;  5LGT A;  4FX4 A;  1FOY A;  2FQ3 A;  3M8J A;  3CCR I;  2WY8 Q;  3A01 A;  2Y9Y A;  1XN7 A;  3KLN A;  2EA4 A;  4ON0 A;  1T33 A;  3SZP A;  3FF5 A;  4HZF A;  3A4C A;  3GFM A;  2E71 A;  4B4C A;  1JKR C;  4M71 A;  2DFI A;  5KAF C;  3GBG A;  1J09 A;  1QBJ A;  5KAI C;  3DV8 A;  2EZL A;  3PSF A;  2IGO A;  2VE8 A;  5FRO A;  3I5U A;  1MNM C;  1P2F A;  1RR7 A;  2QWW A;  5CPR B;  3ERM A;  1MNE A;  2GIV A;  1ETO A;  1XC5 A;  4W1U A;  2LLK A;  2I8D A;  3L2W A;  3RKY A;  2JJ7 A;  4IOA F;  3H3Z A;  3KPH A;  1IXC A;  1N77 A;  4G8X A;  2XSJ C;  2P6S A;  5GAG J;  2WAQ N;  5D6F A;  1UHM A;  2W84 A;  2VOO A;  1W1W E;  3ERE D;  5DCM A;  1ETQ A;  3WHB A;  4JX6 A;  4A3E J;  1LFB A;  1P4A A;  2W4S A;  2VT3 A;  1HQC A;  2Y2Z A;  3RKW A;  3BC8 A;  1HST A;  1IRG A;  1O7F A;  2MA3 A;  4OAZ A;  3AKZ A;  3L7W A;  3BG3 A;  3WGH A;  2AS5 F;  1VTN C;  2H6B A;  4WX9 A;  2VKE A;  3TO9 A;  2XRN A;  1ZG5 A;  2XRL A;  4Y52 J;  4AVZ A;  2CV0 A;  3BZC A;  3HIF A;  2MLG A;  3BRO A;  5J1U A;  1LPQ A;  1TC3 C;  2R5Z B;  2EA2 A;  2K4J A;  5TJJ A;  1JI8 A;  4AIK A;  1F5T A;  4KN4 X;  2D1V A;  2FXA A;  4BHP A;  4BE1 A;  1RR8 C;  1Z3X A;  1IF1 A;  1BW5 A;  2BHY A;  2XHK A;  4HEA 2;  2XGC A;  1ZG1 A;  3R4K A;  1AHD P;  3AG4 H;  1QZY A;  1ZRC A;  1QRY A;  1KA8 A;  3DQV C;  1WJD A;  4XR6 A;  2LKX A;  1WQ2 A;  5IP7 J;  2M0M A;  4E70 A;  3N97 A;  2L9V A;  2R0Q C;  4EQQ A;  3Q5F A;  3S8P A;  3EYY A;  2KRF A;  2FQ4 A;  2K40 A;  3RCO A;  2IGN A;  1LNW A;  4KIF A;  3R0J A;  2W48 A;  4JYK A;  4PCQ A;  4IZZ A;  4WXH A;  3R0A A;  2K02 A;  4V2F A;  2ISZ A;  3J7A O;  2KQR A;  1X2M A;  1XD7 A;  5E1X A;  5F27 A;  3SEZ A;  2FOW A;  3KX2 A;  2X6W A;  1T0F C;  2XGX A;  3K70 C;  3ABL H;  1B6A A;  3EPZ A;  6PAX A;  1ZAR A;  1MZB A;  5FKN A;  1S3J A;  4E4H A;  1MW7 A;  4JX4 A;  2E7X A;  5FLV A;  2HKO A;  1VQN I;  2DFF A;  2QKM B;  4Z6Y A;  2XSD C;  3GO5 A;  4XID A;  5FKO A;  5JLX A;  2DLL A;  4K2E A;  1Y39 A;  2K5C A;  3DP7 A;  3EUH C;  2E35 A;  4Q47 A;  3CLQ A;  3SYT A;  4HDU A;  1NTC A;  3H3U A;  2ETH A;  3I54 A;  1X1P A;  4L5I A;  2Q8K A;  2QSF X;  5BNG A;  1OJL A;  5IT9 Z;  5E1W A;  4RGU A;  3OSG A;  3R6S A;  3BG7 A;  3A1Y A;  3HXL A;  4RAF A;  2EFQ A;  3IWZ A;  1QPI A;  4UVC A;  4XLP F;  3OSF A;  3FIW A;  3QU3 A;  1WGX A;  3PIP F;  1TQP A;  4H4K C;  4MFD A;  3HOX J;  2E34 A;  4IEJ A;  1ZR4 A;  1L3L A;  2A3S A;  3CF5 F;  2TDX A;  3IAS 2;  3TOB A;  1MSF C;  1FMW A;  3FZV A;  3E5Q A;  3E6M A;  5EF6 A;  3IRR A;  1N25 A;  2DMT A;  4AU7 A;  2XPU A;  1B1B A;  3LSK A;  2IBD A;  4XL9 A;  3U1D A;  3TP0 A;  2M7B A;  2V7F A;  2YU3 A;  2GA1 A;  4WF2 A;  1B72 B;  3MKW B;  4QIW N;  1E3H A;  1W7P D;  2GOX B;  3HRM A;  2KDZ A;  3WTY C;  3BCA A;  4M3D A;  1YJ9 I;  5F1R A;  2KDO A;  3E1S A;  2AQF A;  5F0C A;  1ZLK A;  4Q48 A;  4IRG A;  1ZAO A;  3WE3 A;  5IOZ A;  4L0Z B;  1X1C A;  2X4H A;  4XRF A;  2QUF A;  1OCT C;  4X6A J;  2HTJ A;  3QWL A;  1UJ8 A;  1YS7 A;  4OOI A;  4YG2 F;  1FLI A;  3KZZ A;  4B09 A;  2VOD A;  1TWC J;  3GUD A;  3M4O J;  3H9J A;  2BXZ A;  3U9G A;  2R92 J;  1G6N A;  3ISP A;  4IL6 C;  4YFK F;  2H94 A;  3L2C A;  3TL4 X;  1W0U A;  4XOR A;  4JOM A;  2QYO A;  1WHU A;  2FBK A;  1DUX C;  3IAM 2;  2LKP A;  1IV8 A;  1X1D A;  3D5L A;  3PM1 A;  4D7N A;  1BI1 A;  1ZLJ A;  4DYC A;  3FK7 A;  4JBA A;  1JE8 A;  3S2W A;  1PP8 F;  4D9J A;  2EV0 A;  2FE3 A;  4FE7 A;  2R7W A;  2MD5 A;  2HYG D;  1UMQ A;  3LSJ A;  2ICW G;  2LBF A;  2MFZ A;  3F22 A;  3JTH A;  2JVG A;  2F4I A;  4BL0 B;  3L2U A;  2LY9 A;  1O3S A;  5DM7 F;  5D4R A;  1IN7 A;  1FTZ A;  3HC7 A;  1W5S A;  2RAE A;  1VQL I;  4WK8 F;  3QQA A;  4HSR A;  4GDF A;  2R4G A;  3SJM A;  2LSO A;  1T0F A;  2Z1D A;  3BZ6 A;  3TED A;  2GM4 A;  2ZKZ A;  1GV2 A;  2XAF A;  2NOJ B;  4XKV A;  2HOE A;  3ZMD A;  4MEX F;  2KIQ A;  4LOC A;  4L0Y B;  1U9N A;  3ONQ A;  3HSF A;  2RV8 A;  2Y30 A;  1J5Y A;  1Z0X A;  3BP8 A;  1HW1 A;  1FBQ A;  3EUH A;  3T8T A;  2NS7 A;  4KDP A;  1GHC A;  3I71 A;  2ZFW A;  1BC8 C;  1ZEL A;  2LF8 A;  1RKW A;  2QZ8 A;  2WC2 A;  3CP2 A;  1K83 J;  2H09 A;  4A0X A;  3BTC A;  2ZBK A;  4YIF A;  2M8E A;  4HLY A;  1WKM A;  2DFE A;  1MJB A;  3WHC A;  1G4D A;  4M9Z A;  1F1Z A;  1A04 A;  4KYW A;  2D45 A;  4HV6 A;  5K7H A;  2M0C A;  1H0M A;  4IXA A;  1QHG A;  5AON A;  5CKT A;  3CP8 A;  3HKZ A;  3RYP A;  3DTI A;  1D1C A;  1QVT A;  3SFI A;  4RLQ A;  4W97 A;  5C44 J;  5EGO B;  2X51 A;  2CG4 A;  2DT7 B;  4G6T B;  1Z6T A;  4B43 A;  4ZYH A;  2P8T A;  1DU0 A;  4A3D J;  3V8J A;  1SMT A;  2HDD A;  3I58 A;  3DBR B;  1G3T A;  3MMY B;  3VYS B;  3DPT A;  3OYA A;  4G7O F;  5E3N A;  5CVV A;  1SAN A;  4C9Y A;  5B5E C;  1KU3 A;  3CCJ I;  2VJ4 A;  3IKV A;  1ONV A;  2DDA A;  5HDK A;  2P5K A;  3LSP A;  3H5N A;  1D3Y A;  5K5O A;  2DMQ A;  3BR5 A;  1KGS A;  2BZT A;  3KP7 A;  1BOA A;  1S8N A;  5D6E A;  3FM3 A;  2EFN A;  2ZO4 A;  4BJ5 C;  5BMZ A;  1YRN A;  1JT6 A;  2O0Y A;  4PGH A;  3MD2 A;  4PFO A;  4NDL A;  3BOQ A;  4ZTJ A;  2IS2 A;  1MMN A;  5HDG A;  3E6C C;  4KIG A;  3PUF A;  3HOV J;  3F0C A;  4R79 A;  3F6V A;  5FB2 A;  1NG7 A;  5CQG A;  3ZQQ A;  2AXT C;  1FMV A;  2KIF A;  1IN8 A;  2VLA A;  2L3D A;  3CF2 A;  4E7H A;  2EBI A;  4BBR J;  1R7J A;  3HUG A;  2R7D A;  4HQM A;  2PN6 A;  2BV6 A;  3LA7 A;  3S1M J;  2JSP A;  2VBW A;  2X6X A;  3ZQI A;  1RET A;  1LDD A;  2E19 A;  3LAJ A;  2X85 A;  5C3E J;  3QP6 A;  1IRZ A;  4HBL A;  2XGE A;  3RZO J;  3KP5 A;  1IDY A;  2ME6 A;  3RQ4 A;  1QA6 A;  2A6E F;  2Y0M A;  3MKL A;  1A31 A;  2ZME C;  4EMS A;  5ICG A;  4C3I J;  3DU6 A;  4PK4 A;  5L3F A;  2CWE A;  4ZH4 F;  4L5E A;  3ABU A;  4XM3 A;  4LGW A;  3X2Q H;  1HLV A;  3BJO A;  3E5U A;  5E1Z B;  4CYC B;  1H88 C;  3HJE A;  1GLN A;  2FD5 A;  3CMM A;  1ZGJ A;  3S32 A;  2ZFU A;  5JHF A;  5IOY A;  1XSX A;  1W5T A;  2G7H A;  3OYH A;  1FIA A;  2R7O A;  3OL3 A;  2M5W A;  1LKX A;  4NC8 A;  2IT0 A;  4RBO A;  1QNT A;  1IDZ A;  1FEX A;  2AO9 A;  1JJ6 C;  1OIS A;  5B3S H;  3GTO J;  4HX7 A;  1BR1 A;  1MMD A;  1PYV A;  2HWV A;  4CYD A;  3SDG A;  5A2Q K;  2QM3 A;  5K1Y A;  2ZJ2 A;  3TOA A;  2DQR A;  2HI3 A;  4CH7 A;  4MTD A;  3W3C A;  1UHW A;  4G9Y A;  5IT9 K;  4U88 A;  2STT A;  2RVC A;  1X3Z B;  2WV0 A;  3OOP A;  2NYX A;  1JHH A;  4A3B J;  1IXR C;  2M8G X;  5J1R A;  3W6K B;  3FXJ A;  5DTD A;  2DA4 A;  2IA0 A;  4A3C J;  2KPM A;  2RQQ A;  1HW2 A;  4XRS A;  5ED4 A;  3H9G A;  4DZP A;  2EQR A;  2H6C A;  3K4M A;  1T56 A;  3Q3S A;  2HU9 A;  5B1B H;  2EZI A;  2COM A;  1SD4 A;  3BY6 A;  1R1V A;  3DPL C;  4IHT A;  1FOX A;  3MQ0 A;  3I9V 2;  3T8R A;  1HCR A;  5DM6 F;  5DUI A;  1VQ5 I;  3CCV I;  3K7A J;  3HOT A;  2Q2E B;  1FPQ A;  2ECC A;  1ORK A;  2OQG A;  2VAS A;  3BQY A;  1RC9 A;  2B0L A;  1PUF A;  2CJJ A;  2EPF A;  1EJ9 A;  4RGR A;  3ECO A;  2L9N A;  4BE0 A;  3GTG J;  2R7F A;  2E5Z A;  1S5L C;  2DU9 A;  1V5F A;  4FIS A;  1SAX A;  3WU2 C;  4YFN F;  1R5H A;  1OPC A;  3CDI A;  3NAR A;  5HS9 A;  2R5Y B;  2K27 A;  3ZMT A;  5ICE A;  3WOD F;  4YRV A;  2A6T A;  4L9N A;  3PO2 J;  2LOO A;  1FX7 A;  2CUZ A;  3VFZ A;  1OYI A;  4RS8 A;  1XTA A;  2VBZ A;  1FTT A;  2V1X A;  2PQ8 A;  4B48 A;  1KQ8 A;  2JTV A;  3DXJ F;  3FMS A;  1FSE A;  3CD6 I;  2CUF A;  4CCL A;  1POG A;  1B9M A;  5HLH A;  2OC6 A;  1XMA A;  2DMN A;  2ZME A;  4AWX B;  1OYW A;  2P0W A;  2XF6 A;  4A12 A;  2V9P A;  3LST A;  4ZDP A;  2O5R A;  4XOP A;  2ZSH B;  2P6T A;  4UUS A;  1IV6 A;  5AIQ A;  2VKD A;  1ZHF A;  1DGW Y;  5EDN A;  2CFX A;  2BHZ A;  3C2B A;  2FBI A;  2BW3 B;  1PVE A;  4XBF A;  3OS0 A;  1YIT I;  3LA2 A;  3O2P E;  4LIV A;  1X1A A;  3HDD A;  1V54 H;  4E7I A;  3KEO A;  2CW0 F;  3P5J A;  1G8X A;  3LFK A;  3TW6 A;  4RB0 A;  1FC3 A;  1A35 A;  1Z77 A;  2ZJR F;  1HDD C;  1R5I D;  4JX5 A;  4IX7 A;  1ZH5 A;  2JA8 J;  4H0E A;  5IYD J;  4CIC A;  1OQY A;  2QF7 A;  2V9K A;  3C7J A;  3VYT B;  2XGD A;  4B1R A;  5H2F C;  2STW A;  2KKO A;  1FJL A;  5TRD A;  4BH9 A;  2QBY B;  1EKE A;  5F1J A;  1J2X A;  4LJZ F;  1S72 I;  4N9H A;  4RB3 C;  3AG2 H;  1EH6 A;  2CS3 A;  3JR9 A;  5HS8 A;  3BG6 A;  2X48 A;  4OAY A;  4A3M J;  4Y15 A;  1Y6I A;  1YTY A;  2K86 A;  4QLC U;  2DCE A;  1W7P A;  4HX4 A;  2DYR H;  3HOS A;  4I2O A;  1S7O A;  2LR8 A;  1FSH A;  1WCM J;  2VPR A;  4XLE A;  4DOZ A;  3ZN1 A;  4AD9 A;  3MZH A;  2C6Y A;  3CJT B;  4MTE A;  2DA5 A;  2MD0 A;  4LMY A;  3HSR A;  1CGP A;  2A61 A;  2VC1 A;  1BJZ A;  2WBM A;  2E2H J;  3OYN A;  1DPR A;  4D1Q A;  4PGG A;  2DOE A;  3F8N A;  3J7Y J;  1HBX G;  5ICF A;  4XSX F; 
#chains in the Genus database with same CATH homology
 2B7E A;  2L9V A;  2DOF A;  2K85 A;  2DOE A;  2KZG A;  2LKS A;  2KIS A;  2E71 A;  1UZC A;  2KFD A;  2JUC A;  2DOD A;  2KIQ A;  2CQN A;  4FQG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...