3KE2A

Crystal structure of a duf2131 family protein (sama_2911) from shewanella amazonensis sb2b at 2.50 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
GDQVSKQHKAFLRKLYLAHLMDDARHNLLSLGKLTGMPRRTLQDAIASFADIGIEVEFVQDGERHNAGYYRIRTWGPISSAWMDTHVDEVKSLLGVDDAVGQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein YP_928783.1
publication title Crystal structure of STRUCTURAL GENOMICS, UNKNOWN FUNCTION (YP_928783.1) from SHEWANELLA AMAZONENSIS SB2B at 2.50 A resolution
rcsb
source organism Shewanella amazonensis sb2b
molecule tags Unknown function
total genus 25
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09904 HTH_43 Winged helix-turn helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ke2A00
5E1WA 2M87A 1ON1A 3E5XA 3PFIA 2KJCA 4IF4A 3SHFA 4JQFA 3B73A 2CG4A 3G3ZA 4EM1A 4P9UA 3QU6A 2VE9A 1B9NA 2YU3A 4RAYA 2O03A 5LRRA 1TW3A 4Y17A 1S29A 2W24A 4HX8A 2XV4S 5ICEA 2L02A 4R1HA 2XAFA 2EB7A 1OPCA 3GFLA 2VT3A 4RS8A 3G73A 3LQQA 4BHBA 3O6BB 2A61A 2YR2A 3ZP5A 5HS7A 2QQBA 1SFUA 2D1VA 2DW4A 4UHTA 4WK8F 5FO5A 2QWWA 4EM2A 2MH9A 1Z05A 1T38A 1WSUA 2A07F 3WTYC 1STZA 5DD4A 4ZYEA 5DUIA 2HKOA 4BNCA 5IT9Z 5E17F 3ZMDA 1R1TA 1I6XA 3FM5A 2P6TA 3BOQA 1AWCA 1LDDA 3KP4A 1LEBA 2EA4A 1KQ0A 4CGZA 4A0XA 2M8EA 3GLXA 1XN7A 2ESNA 3I58A 3MQ0A 2NNYA 1IN5A 4Y13A 2F5FA 1IZ1A 4LB6B 5ILVA 4OOIA 5DEQA 2K27A 1RNLA 6PAXA 2FOKA 1BI0A 2UXNA 4PGHA 1D3YA 1S3JA 1KU2A 1Z91A 3E97A 1I5ZA 5E18F 5LBQA 3SFZA 1FP1D 3CDHA 4A12A 2G7HA 4N0BA 4RAZA 1WRJA 1S7OA 4ON0A 1R22A 3F6VA 2B0LA 3GFIA 1P4AA 3I64A 3KLNA 3DF8A 1T6SA 2Y48A 5D8KB 1D5VA 2YX4A 3LA2A 1I1GA 4GYGA 1XMAA 1BN5A 3N97A 1JXSA 3CLOA 4U88A 2EFNA 2OAZA 5FLXZ 3KP7A 2OD5A 1E17A 2OZ6A 4LK1F 2PQ8A 1OYIA 4R79A 1YW7A 1DP7P 2OBPA 2JTVA 3MFKA 3I53A 5EEHA 4AWXB 5J6XA 5FFXA 1T2KA 5E1XA 1F9NA 3RI4A 4WF2A 1G3TA 2BEOA 2LDUA 3EQLF 3TO7A 1ZRFA 1USSA 3TDZC 3MZYA 1G6NA 3R60A 4CXFA 1G4DA 3BJ6A 3WTTC 1UHMA 3ULQB 4L9JA 4L0YB 4XLPF 5ICFA 5FB2A 2VONA 1BIBA 2F5CA 1TW2A 3QRFF 2QBYB 3E6BA 4L9VA 1PP7U 1R23A 2DI3A 4OMYA 2PEXA 3ELKA 2BE5F 1GXQA 2WTEA 5LHHA 2CFXA 2E7XA 4HOBA 5H20A 3RKXA 1WKMA 3K1MA 4I01A 3SZTA 3FWEA 1DDNA 1QZYA 3RPQA 1LJ9A 1BC7C 5CYVA 1B1BA 5E1ZB 2V9VA 1W7PB 2RNJA 3P7NA 3I59A 2FEZA 1QZZA 5HVQC 3MAJA 2Z99A 4HX4A 3FM3A 2LKPA 2STTA 1DUXC 2QUFA 3WG9A 1ZG5A 3F23A 4HDUA 2IPQX 4XSZF 4A2UA 1K6OA 2ZKZA 4HAMA 3QOPA 5AONA 2ISYA 1J7KA 4MEYF 5HS8A 1P4WA 1BM9A 2XAJA 2YPRA 3O2PE 4ENJA 5ICCA 3LA7A 3GF2A 1ZYRF 4PCQA 5F1RA 4LFUA 5JR3A 4U0YA 2V1DA 2H94A 1XDUA 1S6LA 3RDIA 4G94A 1P4XA 4P9FA 2OA4A 2P7CB 2QLZA 4A6EA 3IL2A 3RYPA 1YFHA 4KIFA 4RGSA 4ZYDA 1F5TA 3F8NA 5F6FA 2PI0A 2DQRA 3WODF 4CHUA 2CYYA 3SQNA 3HYIA 3O3KA 4EJOA 2JZYA 2Z3YA 3CUQB 1E2XA 1OR7A 1LEAA 2O3FA 5L3BA 5IT9K 1VTNC 1HQCA 3GWZA 1BI2A 1ZGAA 3GFJA 3BP8A 3TDUC 2A69F 4Q47A 4L0ZB 2QM3A 5D6FA 1W4MA 1IN7A 2NAZA 2E1CA 3MCZA 2A6EF 2KRFA 2VE8A 2ISZA 1HKQA 1YW8A 2VC0A 3CO7C 4HYEA 2UWMA 2BYVE 1MDMB 4ZYGA 3TKYA 3M7GA 5K5RA 5TJJA 4WXDA 3WE2A 2F5DA 3R0JA 4EMSA 3COAC 3SZPA 4KNYA 5EEGA 2K4JA 1ZLJA 5HDGA 4CZZA 3WTWC 5D6EA 4CO8A 3Q5FA 4N9IA 5HDKA 2VBYA 3CTAA 4HDVA 4Q48A 2K02A 3KP6A 3F22A 4MHGA 3C18A 3JW4A 4AD9A 5K5OA 2DO7A 1KYZA 3H3ZA 3B02A 3I5UA 1Z1DA 1P6RA 2DFIA 4UVBA 5KK1A 3FMSA 3K2ZA 4ZZLA 2ZXJA 1QPMA 2XAHA 3KEQA 4LG0A 2KIUA 3DKWA 1IAWA 3HRUA 4ESBA 2IA2A 2BBYA 2DK8A 1RI7A 3WGHA 1EH6A 1G3YA 4KIBA 4AIJA 4EJUA 1O57A 4HX7A 2BGCA 3F21A 5D5UB 2WC2A 4QLCU 1K7AA 2QBYA 3Q9SA 2JPCA 1FC3A 4S04A 4GXOA 2HEOA 1O3QA 2ZMEB 2MH2A 2TDXA 1OYWA 3P9CA 5JHUA 2ADUA 2BV6A 2XAGA 3ZQ7A 3KFWX 2DAOA 2CO5A 2RN7A 3C1DA 4UVCA 4KA4A 1W7PA 5HLGA 1I1SA 1SFEA 4KN4X 1L0OC 2W57A 5DV5A 4WCGA 3LA3A 1TBXA 1YYVA 5LRSA 3FZVA 1XSVA 5L3EA 2GQQA 3C3WA 2MBFA 3GW2A 2PLYA 2IJLA 1BBYA 5DCFA 2AXLA 1REPC 2CWEA 4FT8A 5A2QZ 3TO6A 4GO1A 3IWZA 1U3EM 2Q8KA 4L18B 4I2OA 2DBBA 5JVTA 3MEXA 1FZPB 4UNOA 4I09A 1SMYF 2DK5A 4HLYA 1BI3A 1B6AA 5D5WB 2CSOA 3Q9VA 3IRRA 2GWRA 1U5TB 1ZN2A 2L4MA 2RQPA 3HOTA 3KP5A 1BI1A 1J75A 1QQIA 2K7LA 4HQEA 5K1YA 1ZRCA 2Q0OA 3K9TA 4UUVA 1Q1HA 1TNSA 1HSTA 4KYWA 1UB9A 4Q5SF 3U2RA 3I0TA 2W85A 1XSDA 2ACJA 2EV0A 2PG4A 4OIOF 3IHUA 4U7BA 5BQTA 4CICA 1TLHB 1W7PD 4RB1A 3K1PA 4EVIA 1GVJA 2CGPA 4R8HA 5DD8A 1GHCA 5CJ9A 4YFNF 3W6JB 4HBLA 2PMHA 2H27A 4M9XA 4PGGA 2OQGA 1JGSA 2HR3A 1TQPA 4P55A 1SFXA 3DV8A 2EV5A 2NRAC 3IC7A 2RV8A 1PDNC 4L5IA 5CVUA 2FBHA 3D0SA 3KZYA 5BPDA 2GXBA 1WI9A 4GCVA 1ON2A 4EQQA 4OINF 3E5UA 2P4WA 1J2XA 1R1VA 2FBIA 1Y0UA 5L3DA 1G3WA 5LGTA 2V1XA 4LLLA 3QP6A 3GZ6A 3EDPA 4HZFA 3KLOA 2AS5F 3F8BA 4XLNF 5E20A 4IJAA 4MTEA 5BS6A 2VXZA 3LSTA 1T0FA 3E6MA 1YO5C 2GZWA 3LFKA 1DPUA 4EGZA 3NEUA 3DFGA 2PFBA 1TNTA 3RKYA 5ERIA 4G8XA 2IA1A 1ONVA 3L00A 1QNTA 4G7OF 4U7DA 1SD5A 1LDJA 5F64A 4ESFA 1D8JA 1OMIA 2RGVA 3GUDA 1XGSA 1B4AA 3KP3A 3CO6C 3R6SA 1IRFA 1R5HA 4JBAA 1HW5A 4YG2F 1ZG3A 2ELHA 3REOA 1YQAA 4MQ9F 4GGGA 4XRFA 1HXDA 5L3FA 1FYKA 5E8GA 1FT9A 4BYYA 3VB2A 1XSXA 2HGCA 4ASNA 3LAJA 2DPDA 2FNAA 4MQVA 2P5LC 1HW1A 1FYMA 5L3GA 3K0LA 1Z7UA 2HYGD 3PQJA 2ZO4A 4KN7X 3GEZA 3ZN0A 1FPQA 1KU3A 4L9TA 3V7SA 5BOXA 4XSXF 3I4PA 5HOOA 2KIFA 1UFMA 1TQIA 2DT5A 1IXSB 5FD5A 2H09A 2FQ3A 4OMZA 2DLLA 2HWVA 4IXAA 1J59A 1FOKA 3QAHA 4B8XA 4LD5A 4G9YA 1IXRC 4LLGF 4H0EA 3TQNA 1S8NA 4M74A 1J0RA 5J8FA 3WTSC 2HQRA 3BY6A 2QENA 2GA2A 5A2QK 2HTJA 1DPRA 1JHFA 3GVAA 3ERED 2OZUA 3I71A 3KP2A 2VOOA 3CJNA 4B09A 4LLNA 4M71A 2WV0A 3RKWA 2WWYA 1USTA 2KJBA 2PN6A 2STWA 5LGUA 4D0PA 4N9HA 2XVCA 1FY7A 1WQ2A 4IRGA 4WXCA 4DNCA 4IRIA 2JT1A 2Y75A 4MEXF 2EFOA 1SAXA 4E70A 3JSOA 3WTUC 1FBSA 4YFXF 1IXCA 1IUYA 3HHHA 4OU0A 2D45A 3IWFA 1OYYA 5FGMA 4G6DA 3RYRA 4M6YA 5D4RA 1HKSA 1LDKB 3NQOA 1IRGA 2IW5A 5CVIA 1R1UA 2K4BA 5DCMB 1F1ZA 1SMTA 3ZPLA 5CVJA 4LGWA 3GYHX 4HQMA 4Q4ZF 3IKTA 1HSJA 3HUGA 3L2CA 2L54A 2XKOA 3F8CA 1ZLKA 4LMYA 1FBUA 2MA3A 1V3FA 2NS0A 3QPHA 2RKHA 4S05A 1G3SA 2EFQA 4MGRA 3R61A 4HW0A 1J5YA 1LB2A 4HF0A 3KEOA 3PQKA 5IT3A 1ZGJA 3KETA 1ZAOA 2M1BA 4LB5A 2EWNA 2VOPA 2FNPA 2IP2A 1XGMA 4ZZDA 1NHAA 1CGPA 1L3LA 2V1UA 3F8MA 4IHSA 3BZ6A 4IHTA 4JK1X 3T0YA 3HIFA 3ECHA 3FXQA 2A68F 4LJZF 2FE3A 3ABTA 1XD7A 3IKVA 3ZMVA 3ZMSA 4KDPA 4O6JA 2A5YB 4IVNA 3C7JA 3EETA 3D5LA 1XGNA 4NQWA 1XDSA 1O3SA 4BHPA 1SD6A 2P7VB 1ZH5A 1Z9CA 3T8RA 2CW0F 2Q2EA 3GZ5A 1U8RA 1RZ4A 3RPUA 2ZJ2A 1TTYA 4EJTA 4RGRA 3VEPA 3BWGA 3V7CA 5ICGA 1YIOA 2L3DA 3FF5A 2ZCWA 2FRHA 5CVVA 4F7ZA 2P5KA 1D8KA 5AIQA 4RB3C 3FHZA 2O61A 4M6XA 2IVMA 3EUHA 1ZREA 5K5QA 4HLXA 3ZN1A 1R7JA 3WTXC 3HSFA 1EV7A 2LF8A 4HV6A 3I59B 1BOAA 2Z33A 3M8EA 3WTVC 2VBXA 3BROA 2G9WA 5ILSA 5LHIA 1XCVA 2Z5UA 1H9TA 3HTUA 4LK0F 4RB0A 1X3UA 3WGGA 1CF7B 1MD0A 3QP5A 1KQ8A 1YG2A 4HA8A 3KZZA 5ED4A 1YW9A 2O6GE 3OOPA 5D5XB 2L4AA 3J80Z 1XCBA 2FMLA 4Z2YA 3T5XA 3JSPA 2HS5A 1B9MA 1KYWA 4IPAA 2FU4A 2OU2A 2FF4A 3M9AA 3HTSB 1LNWA 1LQ1A 2H6CA 2E1NA 1FWZA 1J9IA 2LSOA 2RC4A 5HDNA 3ECOA 1ODDA 4FX0A 3FMQA 2IT0A 4M9SA 1C0WA 1B59A 1YTYA 3DP7A 3VOEA 1FBQA 1YS6A 3ZMZA 4ESJA 2EFWA 3J81Z 5TRDA 2A3SA 1KGSA 3HHGA 1W5SA 2Y0MA 4U0WA 3RIRA 4K2EA 1H9GA 1KU7A 3P9KA 1JE8A 1QBJA 4Y15A 3GFMA 1XGOA 4I7HA 5FFZA 4AIKA 1BIAA 1IW7F 2J5PA 4BXUA 2QQAA 4I0BA 1ULYA 3ISPA 4A5MA 1O3RA 4TV7A 3CUQA 1I27A 5LLQA 3CUQC 4AIHA 2ZBKA 2IRFG 2D1HA 1T39A 1R00A 1JHHA 3GX4X 1XMKA 1PP8F 1KA8A 1XB4A 1V4RA 3DEUA 3WGIA 5DCMA 2EA2A 2XGXA 4BHCA 3WTZA 5CLSA 1R5GA 3H3UA 4RB2C 2ESHA 2F2EA 3ABUA 2EV6A 3L09A 4OIQF 1IN4A 5BPIA 3V8LA 4KT5C 1MDMA 3DPTA 2M5WA 5LEJA 4O3MA 5KVRA 3RTRA 4WWCA 4ZH4F 2HOEA 4A0YA 4AVPA 2P6SA 4KICA 4G7ZF 1QGPA 2GXGA 3J7AO 2JRTA 1U78A 3FXRA 2PMUA 1YLFA 2K86A 1GXPA 4UV8A 1MJAA 1O7FA 4EM0B 3ML6A 1BJAA 4PZJA 3R0AA 5LGNA 2MLGA 4GYIA 2HDCA 3F72A 4A6DA 1SD7A 2CQKA 4P5OA 2UXXA 4DQ2A 1ZRDA 4HF2A 4WXHA 2VBZA 4LG0B 4XBFA 2HKXA 3NRVA 3BJOA 1U6GA 3BDDA 3M1EA 4I98B 4RGUA 4G6QA 4NHJA 1HBXG 3ROUA 2VODA 2XIGA 2HYFA 2C6YA 4FHTA 4M72A 3ZMTA 4WX9A 1PUEE 2FXAA 3JTGA 3V8JA 2ZNYA 3WE3A 2RVCA 1MJ9A 2VC1A 5ILUA 4KFCA 2ETHA 2J5OA 2XUBA 1ZG1A 3P9IA 1YS7A 1P92A 5BMZA 2R3SA 2ZMEA 1RUOA 2XAQA 4KMFA 2LF7A 3F3XA 1P2FA 2HZTA 2R7DA 1R36A 2PBIA 3L7WA 5L3CA 3HRTA 2DPUA 3JAMZ 3IRQA 2F5EA 1K78B 3LQRA 3KE2A 1T98A 2YX7A 1S7AA 2EJRA 2MC3A 4ENNA 4L9NA 4A5NA 1CF7A 1K79A 3CUOA 4BQAA 3DXJF 1IN8A 2X4HA 4EJVA 3J80K 4ZYHA 1RIOH 3LWFA 3BJAA 1Z6TA 2G7UA 4L5JA 3V7RA 4QWQA 2W25A 2UZKA 2XRNA 3TGNA 1H0MA 5H6RA 1UHWA 2EFPA 1RUNA 1IN6A 3T8TA 3DQVC 3E5QA 3SXYA 1BC8C 3VFZA 2JPBA 1MKMA 2COMA 3BPVA 2D2WA 3V8KA 3JTHA 3K1NA 5HLIA 2MD5A 1FNNA 2V79A 2GA1A 2EK5A 1O7LA 4OIPF 4EJWA 1ZHFA 3HSRA 3J81K 1U5TA 2FBKA 4ENMA 1U2WA 2YSRA 2XASA 2A6HF 4I02A 1MJBA 1U5TC 2O8XA 2KIMA 1HKTA 3OV8A 4FX4A 1AOYA 1FP2A 3TOAA 5DUKA 2QVOA 4PDKA 2M30A 3HSEA 5HLHA 4UXNA 3WU0A 5LHGA 4KUMA 1MGTA 5CVRA 4OIRF 5D4SA 3F8FA 1EH7A 1KQ9A 2MLKA 1FSEA 3TO9A 4RGXA 5D8LB 2RDPA 3HRMA 1WWXA 3W6KB 3T1BA 2QYOA 2VN2A 3WU1B 4NB5A 3U9GA 2M45A 1R58A 2P5VA 2P8TA 5D5VB 3MZHA 3KCCA 2DTRA 4O5VA 3ZMUA 4YIFA 3RJPA 4KMUX 2VBWA 1OKRA 4CYDA 4HV5A 1Z6RA 2XKPA 3HRSA 3DPLC 3VODA 2H6BA 3GXOA 4G7HF 3I54A 4IRHA 2HTSA 3EYYA 2IA0A 2O0YA 4U0VA 4M9ZA 2HQNA 5FLXK 1TQMA 1FLIA 2XROA 5E8IA 4HF1A 2E7WA 3R4KA 2DU9A 4EV0A 1FYLA 3V4GA 1IF1A 5FD6A 4P96A 3MWMA 4YIIA 5H6QA 3FMRA 3HOSA 4BAYA 3FX3A 3K69A 4ETSA 3H92A 2W84A 3EYIA 2NNNA 4EGYA 2L01A 2GIVA 3N4MA 1W5TA 3E6DA 5JI6A 1A04A 1ZARA 3S2WA 1QO0D 4UV9A 3AAFA 2GAUA 3L9FA 2FA5A 2HFHA 2FSWA 3LAPA 2LNBA 3GO5A 4I0AA 3U1DA 4BH9A 1UCRA 2DQLA 2FMYA 4CDGA 1FSHA 5J8CA 3QPTA 2JSCA 1HW2A 1EH8A 2XHKA 2OQRA 2ZFWA 2R7FA 2X0LA 2PJPA 2V6CA 1MZBA 3QU3A 5DYMA 5AIPA 1F4KA 3E6CC 4A0ZA 2Z9OA 2QQ9A 1O3TA 2ZNZA 4KIGA 3JAMK 4UVAA 4YFKF 5DDGA 2KKOA 3BPXA 1SD4A 4MNUA 5HS9A 1K78A 4MTDA 3M8FA 2QZ8A 3F6OA 4M73A 1LVAA 4ENKA 3FXUA 2VT2A 1FX7A 5JFRA 2NYXA 3TOBA 3E3VA 1KU9A 5LEKA
chains in the Genus database with same CATH superfamily
2R5YB 1WHUA 5E1WA 2M0MA 1DU6A 2M87A 1JKOC 1ON1A 4CCNA 2V7FA 3BC8A 3E5XA 3ERMA 3K10A 3PFIA 2KJCA 1AKHA 4IF4A 3SHFA 4JQFA 3GTPJ 3B73A 2CG4A 1OFCX 1RETA 1XMXA 3G3ZA 2DFHA 3OS2A 3QWLA 4EM1A 4P9UA 3QU6A 2VE9A 1B9NA 1UJ8A 2YU3A 2W1OA 2V26A 2KDOA 4XM3A 4RAYA 1SANA 2O03A 5LRRA 2GM4A 1TW3A 4Y17A 1S29A 2W24A 1LE8B 1Z67A 3WHBA 3E0JB 1PUFB 4HX8A 2E36A 2XV4S 2MGQA 5ICEA 2L02A 3FIWA 4R1HA 2XAFA 2DFEA 1OPCA 2EB7A 2P81A 2VT3A 3GFLA 4RS8A 1X2MA 3G73A 3LQQA 4BHBA 2X1CA 3JRHA 3O6BB 3OYJA 3RCOA 2A61A 1N77A 2DMTA 2YR2A 5HS7A 2QQBA 3W2VA 2Y0SN 3ZP5A 1SFUA 4A93J 3JRDA 2D1VA 4FE7A 2DW4A 4UHTA 4F91B 3RKQA 1JKRC 4WK8F 2R7QA 5FO5A 3SYTA 2V1NA 2QWWA 4EM2A 2MH9A 1Z05A 4KT6A 1MSFC 1T38A 4I6ZA 2HU9A 1WSUA 2ZJRF 4AM3A 1WCMJ 3NWTA 2A07F 3SDGA 3WTYC 1STZA 5DD4A 4ZYEA 5DUIA 2HKOA 1W36D 4BNCA 5IT9Z 5E17F 3ZMDA 1R1TA 1I6XA 1AHDP 3FM5A 1ETXA 2P6TA 3BOQA 1AWCA 1LDDA 3KP4A 1A31A 3CCUI 1LEBA 2EA4A 3V42A 1KQ0A 5K7ZA 4CGZA 1VI0A 4NC6A 2BY3A 4ZC3A 4I76A 4A0XA 1LFPA 1U9NA 2M8EA 3GLXA 3TEDA 1XN7A 2ESNA 3I58A 3MQ0A 2NNYA 3S1NJ 1K61A 1IN5A 4Y13A 3OYLA 2F5FA 1IZ1A 4X6AJ 4LB6B 2KT0A 5ILVA 2UV1A 4RLQA 4OOIA 4BXFA 5DEQA 4BACA 1X1DA 2K27A 2FD5A 2KDZA 2HPMA 1RNLA 6PAXA 2FOKA 1OCRH 1BI0A 2UXNA 3ZCOA 4PGHA 2NS7A 1D3YA 1S3JA 1KU2A 1Z91A 3E97A 1OLTA 2CUEA 1I5ZA 2DT7B 5EEAA 2OC6A 1K4TA 5E18F 5LBQA 4JX6A 3SFZA 1FP1D 3CDHA 4PSWA 4A12A 2G7HA 4N0BA 4RAZA 1WRJA 3OYHA 1S7OA 4ON0A 1RRJA 4B48A 2R7RA 4RA2A 1R22A 3F6VA 1NK3P 2B0LA 3OYCA 4UB8C 3CDIA 3FBIB 3GFIA 3VDXA 1P4AA 2LFBA 3I64A 3KLNA 2ME0A 5E3OA 1SFKA 3G2BA 3KIOA 3DF8A 1VQNI 1T6SA 2Y48A 5D8KB 1D5VA 2QA4I 2YX4A 3LA2A 1I1GA 4GYGA 2BXZA 3AL0C 1GDTA 2GLOA 1MBJA 1XMAA 3FBNB 3OYKA 2O5RA 1BN5A 3N97A 2VKHA 3HOYJ 3OYMA 1JXSA 3CLOA 4U88A 4Y4RA 2EFNA 3S16J 2OAZA 4IL6C 4E7SA 1NTCA 5DM6F 5FLXZ 3OYGA 3KP7A 2OD5A 4A69C 4BE2A 1E17A 2VUMJ 4IQ4A 2OZ6A 3Q0WA 2PQ8A 4LK1F 1OYIA 2IEKA 2WY7Q 2A05A 1D1BA 2ICWG 2QF7A 4A3CJ 2K85A 4R79A 3OYEA 1YW7A 1DP7P 2OBPA 2JTVA 3MFKA 3I53A 5EEHA 4AWXB 3IAS2 2I8DA 5J6XA 5FFXA 1T2KA 5E1XA 3QODA 2NVXJ 2L7KA 1F9NA 3H36A 3RI4A 1NH3A 2XF5A 4WF2A 1G3TA 2BEOA 2LDUA 3GCMA 3DLLF 1S7EA 3EQLF 3TO7A 1YITI 2JA2A 1ZRFA 1USSA 3TDZC 3MZYA 1Y56A 2PMZA 1G6NA 3Q3SA 3R60A 2DMUA 2MFZA 5C3EJ 1TZLA 2WB1A 2BOLA 2NOGA 2EPFA 3I3LA 4DYCA 2K9LA 4CXFA 1G4DA 1VQLI 3PM1A 3TW6A 3BJ6A 1YX5A 5IOYA 4FASD 3WTTC 4YIRX 1UHMA 2L5QA 3ULQB 3OSGA 4L9JA 4L0YB 1OCTC 4XLPF 3BQYA 3AG4H 5ICFA 4XN3A 5FB2A 2VONA 1EA3A 1MMDA 5FKNA 1BIBA 1WJ5A 3MZ8A 2F5CA 4JYKA 5F0CA 2R93J 3HJEA 1TW2A 3QRFF 2QBYB 3E6BA 4L9VA 1PP7U 1R23A 2DI3A 2L9SA 4OMYA 4BU2A 2CQXA 2PEXA 3ELKA 3PNTA 4BE1A 2BE5F 2NVQJ 3S1RJ 5J3LA 1GXQA 2WTEA 5LHHA 1F43A 4XLCA 2HYJA 2CFXA 2E7XA 4IO9F 5F0HA 2DFFA 2OCEA 4HOBA 4IQJA 5H20A 1MH4A 3RKXA 1WKMA 2VJ5A 3K1MA 3S3OA 3EUKL 3H5NA 4E7IA 4QIWN 3K4CA 4I01A 3SZTA 2KHMA 2ZXHA 3FWEA 3LSPA 1DDNA 1QZYA 4HPQA 3RPQA 1LJ9A 1BC7C 3PFYA 3PUBA 5CYVA 2GXAA 1B1BA 2HOTA 3W6VA 5E1ZB 2V9VA 1W7PB 2RNJA 5M5WJ 2E71A 3P7NA 4CYCB 3I59A 2FEZA 1QZZA 5HVQC 3MAJA 2MYSA 5FKLA 1VQ9I 1HA8A 2Z99A 4HX4A 1FTTA 3FM3A 2LKPA 2STTA 1DUXC 2JRMA 2QUFA 3WG9A 1ZG5A 3F23A 1R5ID 3IUOA 4HDUA 2IPQX 4XSZF 4A2UA 3CCRI 4BXXJ 3QYBA 2QEXI 2VPRA 5J4YA 1PJRA 1IO2A 1D1AA 1K6OA 2ZKZA 3K4MA 2F4MB 4HAMA 2R0QC 5IOZA 3QOPA 2WV1A 1WJDA 4D1QA 5AONA 2ISYA 3CP2A 3J7YJ 2DA4A 1J7KA 2KIQA 4MEYF 3ZQIA 3A03A 4DGWB 4ZTJA 5HS8A 1P4WA 3GTKJ 3X2QH 1BM9A 4XKBA 2XAJA 4UUSB 3S14J 4DZPA 2YPRA 3O2PE 1SC7A 3FHNA 2X48A 4JX4A 4ENJA 5ICCA 2WY8Q 3LA7A 3GF2A 3OYDA 2R5YA 4IOCF 1ZYRF 2M8GX 1ETVA 4PCQA 5F1RA 4LFUA 2L7FP 5FKMA 5JR3A 2PX9A 4U0YA 3AG1H 1D0YA 3K4JA 1V54H 1ZK8A 2V1DA 1D0XA 3M4OJ 2IS2A 2H94A 3OWTA 4CA0A 1XDUA 1S6LA 4FCYA 3HGGA 3RDIA 3ASOH 4G94A 4U87A 1P4XA 4P9FA 2OA4A 3RQ4A 2P7CB 2QLZA 5BNGA 4A6EA 2KQRA 2MC4A 1LE8A 5M3MJ 3IL2A 2CV1A 3RYPA 1V55H 1YFHA 4IHWA 4QSHA 4KIFA 4RGSA 4ZYDA 3RSNA 1F5TA 2EZIA 3VSKA 3AKZA 2ZXWH 3F8NA 5F6FA 2PI0A 3KYLA 2DQRA 3WODF 4CHUA 1MNDA 2CYYA 1W5CC 3SQNA 3HYIA 3O3KA 2JZYA 3A1YA 2DTZA 2Z3YA 3CUQB 4EJOA 1E2XA 3CCJI 1OR7A 1MMAA 1LEAA 2O3FA 4CCLA 5L3BA 5IT9K 2JSPA 4BL0B 2Z2SB 1HQCA 3BT9A 2LMDA 3H9QA 1VTNC 3GWZA 1A6QA 1OR7C 1BI2A 2EZLA 1ZGAA 1GUUA 3K4BA 5EJCA 3GFJA 5DM7F 1VQPI 3Q0UA 3BP8A 3TDUC 1BR4A 2A69F 2EBIA 3DTKA 3IAM2 2R7VA 4Q47A 4L0ZB 2ECCA 2QM3A 2Y30A 1A5JA 5D6FA 3PIOF 1W4MA 1IN7A 2NAZA 4B1RA 3K7AJ 2E1CA 2BY0A 3MCZA 5FJ8J 1ZGWA 2WAQA 4BE0A 5HNHA 2A6EF 2KRFA 3HEFA 4PJ0C 2KRHA 2VE8A 2ISZA 2XF7A 1FJLA 3HGYA 3HKZA 3OR1C 4DW6A 4A3KJ 1VF9A 1HKQA 1JKPC 1YW8A 2VC0A 3CO7C 2K5CA 4HYEA 4BUPA 2UWMA 4PFPA 1OQYA 2JN6A 5LFAA 2BYVE 2HXIA 1HLVA 3PUFA 3S3NA 1MDMB 4ZYGA 1K4SA 2Z16A 3TKYA 3BR2A 3K70D 3M7GA 5K5RA 3HBLA 4AYBA 2ZSHB 5TJJA 2DDBA 1ORKA 4RAGA 4WXDA 3HOWJ 3WE2A 2L9RA 1X4PA 4Y52J 1YOVB 2F5DA 5IY5H 3R0JA 2K40A 4EMSA 3COAC 2LY2A 3SZPA 4KNYA 1IRZA 5EEGA 2K4JA 2E5ZA 1ZLJA 5HDGA 4CZZA 3WTWC 5D6EA 4CO8A 3ZRGA 3Q5FA 4N9IA 5HDKA 3KPHA 2VBYA 3LNQA 5B5EC 3FDYA 3CTAA 2IXSA 5JLXA 4V19K 3A0BC 4HDVA 3JCUC 3GTOJ 3H9JA 4Q48A 2LKXA 2L7ZA 2ELKA 3CJQB 2K02A 3KP6A 3L2QA 1Z7LA 3F22A 4XORA 3CC7I 2E5NA 2R4GA 4MHGA 4GDFA 3C18A 3JW4A 4AD9A 3HC7A 5K5OA 2DO7A 3PSIA 4RAFA 4RDUA 2JVHA 1KYZA 3H3ZA 3B02A 2G0EA 4B3AA 3I5UA 2R7ZJ 1IDZA 1VQMI 5EZHA 1Z1DA 3VYRB 1P6RA 2DFIA 4UVBA 5GTIC 5KK1A 1SVMA 3FMSA 2YU9J 3LFUA 1SVLA 3G71I 5HNFA 3K2ZA 2BY2A 4ZZLA 4HSRA 3O8GA 2ZXJA 4HG2A 4AC0A 2X9DA 1QPMA 5B1AH 2OJED 2XAHA 3KEQA 1TP4A 4LG0A 2KIUA 4H4KC 3A0HC 1SAUA 2W7NA 2DCEA 2LOOA 3DKWA 3OMYA 1IAWA 3HRUA 4ESBA 2IA2A 2XGDA 3IP4B 2BBYA 3G1MA 2DK8A 1RI7A 3WGHA 1EH6A 1G3YA 1GV2A 4KIBA 1HDDC 1HOMA 1QU3A 4AIJA 4EJUA 2X51A 5B3SH 1O57A 4HX7A 3C2HA 2BGCA 3DEWA 5D5UB 3F21A 2WC2A 4QLCU 1K7AA 2QBYA 3Q9SA 2JPCA 3JRGA 1FC3A 4LOCA 4S04A 4GXOA 4V2GA 3S32A 3TL4X 2NVUB 2HEOA 1O3QA 2F6CA 2ZMEB 2MH2A 3S2HJ 2TDXA 2IGNA 1OYWA 3P9CA 1FEXA 5JHUA 1ZQ3P 1B72B 2ADUA 4XMYA 2QCOA 3ZQGA 2IGOA 3K4LA 2BV6A 3CMYA 1W36C 2XAGA 2Y31A 3MVPA 3ZQ7A 3VPRA 5EDNA 3KFWX 2VIXA 3H35A 3C1DA 2DAOA 2CO5A 2RN7A 1WZ2A 4UVCA 4KA4A 4J01A 1W7PA 4BS9A 5HLGA 1I1SA 1SFEA 4KN4X 1L0OC 2W57A 4CYCA 3CF2A 2R7WA 3BTIA 4PJLA 3SEQA 2VJ4A 3OYBA 1WPKA 5DV5A 4WCGA 1QPIA 3LA3A 4FISA 1TBXA 4C3JJ 1YYVA 5F1JA 5LRSA 1BL0A 2VKEA 3FZVA 1XSVA 5L3EA 4EEFG 2GQQA 3C3WA 2MBFA 5FRMA 3D5RC 4Z6YA 3ABMH 1APLC 1MH3A 3GW2A 1WJBA 2PLYA 2IJLA 3CQZJ 4BQOA 1BBYA 4XNFA 5DCFA 2AXLA 4LG3A 4BBSJ 4G6TB 1REPC 2CWEA 2XPVA 3J7AY 1G8XA 4FT8A 3JREA 5A2QZ 3TO6A 3AG2H 3HOXJ 3BR3A 4GO1A 3IWZA 1VNDA 1U3EM 1N25A 4LIVA 2Q8KA 1NG6A 2Y9ZA 4L18B 5K7FA 2DDAA 4I2OA 2MG4A 2CQNA 4UUSA 2FOWA 2CQ7A 2X1DA 4HNTA 2DBBA 5JVTA 4BJ6C 1Z21A 2ZC2A 3MEXA 1FZPB 4UNOA 5C44J 4I09A 1ETQA 1SMYF 3DPUA 2DK5A 4HLYA 1RKWA 1BI3A 2F4OB 4XN0A 1B6AA 5D5WB 3F0CA 2CSOA 1A35A 3Q9VA 3IRRA 2GWRA 1U5TB 1ZN2A 2PJRA 2L4MA 2RQPA 3PIPF 3VWBA 2KFDA 3HOTA 3KP5A 1BR1A 1FMVA 3ZOBA 1R71A 1BI1A 1J75A 1QQIA 2M7AA 2K7LA 2DA3A 3OL4A 2NXNB 3S8PA 2M0CA 4HQEA 5E3MA 5K1YA 1ZRCA 2Q0OA 1T95A 5IYBJ 2W82A 2CFOA 3K9TA 1Q1HA 1TNSA 4UUVA 1HSTA 4KYWA 4JX5A 1UB9A 4Q5SF 3U2RA 3I0TA 2CUJA 2W85A 1XSDA 2KL4A 3I55I 2ACJA 1ZR4A 2EV0A 4IHVA 2PG4A 2JUCA 4OIOF 3IHUA 4U7BA 3OIQA 5BQTA 1MW7A 4B44A 3GLLA 4CICA 1TLHB 1W7PD 1JGGA 3ZQQA 1ERDA 4RB1A 3K1PA 4EVIA 1GVJA 2E34A 3LSKA 1Z0XA 3FXMA 3OIOA 1JT0A 4R8HA 2CGPA 5DD8A 2M7BA 1GHCA 1MBKA 5CJ9A 4C30A 2CS3A 4GFBA 1VQ6I 4YFNF 3W6JB 2LR8A 4HBLA 3VYSB 2PMHA 2H27A 3HUGB 4M9XA 4PGGA 2OQGA 1LPQA 1A6IA 1JGSA 4CZCA 2HR3A 1Q1VA 2R7TA 3DWLE 2LYCA 1TQPA 1J09A 1W1WE 1SFXA 3DV8A 4P55A 2EV5A 2NRAC 3IC7A 2RV8A 3BG7A 1PDNC 3GTQJ 3SZGA 2E2HJ 4L5IA 5J1YA 2JQ7A 3TBIA 2LLKA 4N4NB 1JUSA 5CVUA 5EF6A 2X6YA 3OIPA 2FBHA 1WJAA 5GAGJ 2CW7A 2JA6J 4GRIA 2CRGA 3ZQCA 2B7EA 1FOXA 3D0SA 3KZYA 5BPDA 2GXBA 1WI9A 4MFEA 4GCVA 1ON2A 3JRIA 4EQQA 4OINF 3E5UA 2P4WA 3SEZA 3AG3H 1LUJB 2IS6A 2NVYJ 1J2XA 5HLTA 1R1VA 2DJNA 1Y1WJ 2FBIA 1Y0UA 5L3DA 1G3WA 2LY9A 3TW7A 2V1XA 4LLLA 5LGTA 4UY8I 2CH0A 1UZCA 1RESA 1TWFJ 3QP6A 3VSLA 1U0JA 5GAHJ 3GZ6A 1I6HJ 3EDPA 4HZFA 3KLOA 4C2UA 4IZZA 2AS5F 2OV7A 3F8BA 2QQ8A 4E7HA 2E1MB 1JI8A 5LD2C 4XLNF 5E20A 4IJAA 1YJWI 4MTEA 4BY7J 5BS6A 1VQKI 2VXZA 3LSTA 2HI3A 4AVZA 1T0FA 3E6MA 1YO5C 2EIJH 3CJTB 2GZWA 3LFKA 1DPUA 1T0FC 4XRSA 4EGZA 4NQWB 3D1NI 4BQNA 1ETYA 3NEUA 3DFGA 2PFBA 1TNTA 3JRBA 3RKYA 2K3FA 5EGOB 5ERIA 2HOSA 4G8XA 2CUZA 1XX5A 3WHCA 2M9HA 5DS9A 1FTZA 2EINH 2IA1A 1ONVA 1WJEA 1X1BA 3L00A 1QNTA 2O7OA 2VASA 2Q2EB 2QSHX 4G7OF 1X4OA 5C4XJ 2WAFA 4U7DA 1SD5A 1LDJA 3G1LA 5F64A 4ESFA 1D8JA 2LTPA 1OMIA 2RGVA 3H9GA 3GUDA 1XGSA 1B4AA 3KP3A 3CO6C 1B8IA 3R6SA 1MIJA 2M4GA 1IRFA 1R5HA 1YE9A 5EZGA 4JBAA 1HW5A 4YG2F 1E0EA 2UUZA 1ZG3A 2ELHA 3DLAA 2XAUA 3REOA 1YQAA 4MQ9F 4GGGA 2DXIA 1K83J 3BLYA 3DEEA 3JRFA 4XRFA 1HXDA 3G4SI 5L3FA 1FYKA 5E8GA 1FT9A 4BYYA 4FTHA 3VB2A 3HOVJ 1XSXA 2HGCA 4ASNA 4PJMA 2Z1DA 3LAJA 4XIDA 1YHQI 2HDDA 2HVRA 4BEHB 2DPDA 2FNAA 4MQVA 2BW3B 2KPMA 5EG0B 2P5LC 2CU7A 3NAUA 1HW1A 4A3JJ 1FYMA 5L3GA 1RC9A 3K0LA 1TT0A 1Z7UA 2HYGD 3PQJA 5KAFC 2ZO4A 4KN7X 3GEZA 4II3A 1Y39A 3IH4A 4F3QA 2CUFA 3ZN0A 1FPQA 3H5AA 4ANJA 5KNLA 2HZDA 2AXTC 1JUMA 1KU3A 1IV6A 4XLAA 2DA2A 1X19A 4L9TA 1YJ9I 3HOZJ 3V7SA 4XLHA 3CCQI 4XSXF 5BOXA 1YIJI 2OPTA 3I4PA 2PMZN 4M3BA 1B72A 5HOOA 2KIFA 1UFMA 1TQIA 1ETKA 1MMGA 1IXSB 1X3ZB 2DT5A 5FD5A 2H09A 2WB1N 3LOCA 2JWTA 3DBRB 2FQ3A 1QVTA 2VJJA 2I10A 3W2WA 2COBA 4OMZA 2DLLA 2HWVA 3ZGKA 3CCLI 4IXAA 1J59A 3K4NA 1FOKA 2ZSIB 3QAHA 4B8XA 2BHYA 2XSJC 4LD5A 4RM3A 4G9YA 1IXRC 1QHGA 2QSFX 4JP0A 3BTJA 4LLGF 3O8HA 4H0EA 3TQNA 5KAIC 2B63J 1S8NA 5F08A 4DBQA 4M74A 2XSDC 1J0RA 4CH7A 5B1BH 5J8FA 5TISC 3WTSC 2HQRA 3BY6A 3QQAA 4BDYA 2QENA 4AU7A 1AKHB 3K70C 2GA2A 5A2QK 2DA5A 2CJJA 2R7OA 2W00A 2HTJA 5GP9A 1DPRA 3FISA 2CMPA 1JHFA 3GVAA 1K6YA 3ERED 2OZUA 3ONQA 4IOAF 3I71A 3KP2A 3MKLA 2DYRH 1X2NA 2VOOA 3MMYB 3CJNA 4B09A 2V9PA 1IC8A 4LLNA 4M71A 2N8GA 2WV0A 2K9SA 3RKWA 3LSIA 3OYIA 1YX3A 2WWYA 1USTA 2KJBA 2E2JJ 2KZVA 1GV5A 2Y2ZA 2CQQA 4BGDA 2PN6A 2STWA 5LGUA 1MMSA 4D0PA 4N9HA 2XVCA 1FY7A 5KHDA 1G59A 1PUFA 1IJWC 1WQ2A 4XR6A 4IRGA 4AUXA 2VQGA 4WXCA 4DNCA 4IRIA 2JT1A 2Y75A 4MEXF 2EFOA 1DU0A 1SAXA 4E70A 4XK4A 3JSOA 1ETWA 3WTUC 3S2DJ 1R4MB 2LVSA 2Y69H 1TWHJ 1FBSA 1MNEA 4YFXF 3CP8A 1JTXA 2E60A 2EZKA 3OR2C 1IXCA 1IUYA 3A02A 3HHHA 4OU0A 4XKVA 2LD5A 2CV0A 1XG1A 3B6CA 2EIMH 2M34A 2IGKA 2H8RA 3S1QJ 2GBYA 2D45A 3H0DA 3IWFA 1OYYA 4OAYA 1TL8A 5FGMA 4G6DA 3RYRA 3PL8A 4M6YA 1MBFA 3S17J 3TMOA 2ZXIA 5D4RA 1HKSA 1LDKB 3NARA 3NQOA 1IRGA 2IW5A 5CVIA 1R1UA 4DOZA 1JT6A 2K4BA 5DCMB 2LH9A 1F1ZA 1SMTA 3HB9A 1P9QC 4XKWA 5E79C 5CKTA 3TP3A 3VYTB 3S93A 4UB6C 2DA1A 3ZPLA 5CVJA 5J4VA 4LGWA 4P1WA 2ZFUA 4ZDPA 1HF0A 1XTAA 1JJ8C 3GYHX 4HQMA 4Q4ZF 1QRYA 2H1LA 3IKTA 3ABLH 1HSJA 3HUGA 3UR3C 2M3AA 1UG0A 3N05A 5FROA 4CCJA 3L2CA 2L54A 4NC7A 2XKOA 3F8CA 3U21A 1ZLKA 4LMYA 4W1UA 1FBUA 2MA3A 5IP6A 2XC7A 1BW5A 1V3FA 2BXYA 5FKOA 2IBDA 2NS0A 3QPHA 4N4OB 2RKHA 4S05A 1RKTA 4ZDLA 1WI3A 4KJZA 3AL0B 1G3SA 2EFQA 1T56A 4MGRA 4C3HJ 3R61A 4HW0A 1S72I 1J5YA 4B4CA 1LB2A 4BKXA 4HF0A 3KEOA 3PQKA 5IT3A 3SJMA 1ZGJA 1T33A 3KETA 1ZAOA 1YRNB 2M1BA 4LB5A 2EWNA 2VOPA 2OTJI 2FNPA 2IP2A 1XGMA 3U1KA 4ZZDA 1NHAA 4ZJZA 5IP7J 2LBFB 1MBGA 5M5XJ 4F55A 1CGPA 1VFCA 1L3LA 2V1UA 2V9KA 5DTDA 3F8MA 2X6OA 4E7JA 4IHSA 4D7NA 5JLWA 1CQTA 3BZ6A 4IHTA 1U9OA 4JK1X 3T0YA 2DYSH 4F52A 1JJ6C 2P0WA 3HIFA 3K6GA 3M8JA 3ECHA 4NUBA 3FXQA 2KLOA 5JHFA 1ENHA 2A68F 4LJZF 2FE3A 2HNHA 3ABTA 1XD7A 3IKVA 3ZMVA 1IRXA 4G12A 2NVTJ 3ZMSA 4KDPA 2LY1A 4O6JA 2A5YB 4IVNA 5E3LA 1NK2P 3C7JA 3EETA 3D5LA 1XGNA 4X1EA 4NQWA 1I3AA 1XDSA 1O3SA 1DGRM 1SD6A 4BHPA 4PJJA 1MBEA 3S1MJ 1FOWA 5EGOA 2P7VB 3P5JA 1ZH5A 3RQIA 1Z9CA 4XOTA 1S5LC 1R4NB 3T8RA 2CW0F 3UNGC 2Q2EA 5IPAA 3GZ5A 1V5GA 1U8RA 1RZ4A 3OYAA 3CMAI 2KISA 2HOAA 3FKJA 4C3IJ 1I39A 3RPUA 2ZJ2A 1TTYA 4XONA 4E6KG 4EJTA 2QKLB 3M07A 4E7ZA 3QPSA 3DCFA 4RGRA 3VEPA 3J7ZI 3BWGA 3V7CA 1BJZA 4A3EJ 2OTLI 5ICGA 1YIOA 2L3DA 1SFOJ 2OUMA 1RR8C 2NOJB 1TC3C 3FF5A 4D5CA 2WADA 2ZCWA 3OY9A 3KYDB 2AQEA 2ECBA 2FRHA 5CVVA 4F7ZA 4XRMA 2P5KA 3GTMJ 1D8KA 3ZQLA 5AIQA 4RB3C 3FHZA 2O61A 4M6XA 2RAEA 2IVMA 4IKFA 1HDPA 3EUHA 1ZREA 5K5QA 4HLXA 3HDDA 3ZN1A 1R7JA 3WTXC 2XGEA 3HSFA 1EV7A 3L2RA 3EUHC 4BEHA 2LF8A 2BW3A 3BZKA 4HV6A 3I59B 2XPUA 1BOAA 2Z33A 3M8EA 2R5ZB 3WTVC 2GOMA 2LK2A 2VBXA 3D5SC 3M3YJ 3BROA 2HDWA 4Y33A 4EATA 5GPCA 2JA7J 4B43A 2G9WA 5ILSA 2RQQA 4E4HA 5LHIA 1XCVA 2Z5UA 2ZJPF 1Z3YA 4BJ5C 1IUFA 3HTUA 4LK0F 4RB0A 1H9TA 3A2KA 1X3UA 4OWRB 3H5RA 3WGGA 2Y0SA 4QPQA 1CF7B 4X0GA 1MD0A 4DYQA 3QP5A 1KQ8A 1YG2A 3QPLA 4D5FA 4HA8A 3KZZA 1NG7A 2XB5A 3H3VK 5ED4A 3IV5A 1Y8QB 1YW9A 3L2WA 1DQUA 1QVUA 3OOPA 2O6GE 5D5XB 5HODA 4E7LA 2JMWA 2KMUA 2L4AA 3J80Z 1XCBA 3ZQHA 2FMLA 2I5UA 1QHHD 4Z2YA 3T5XA 4NC8A 3JSPA 2HS5A 3HOUJ 1B9MA 2K9MA 1KYWA 1TWAJ 4IPAA 2FU4A 2OU2A 2VQCA 2FF4A 3M9AA 3HTSB 5IYDJ 2MSYA 1LNWA 1LQ1A 2H6CA 5FLMJ 2E1NA 3BCAA 1FWZA 3CMMA 3Q0VA 1UAAA 3CD6I 3A4CA 1H89C 1WGXA 4HEA2 3HXLA 3CCMI 1J9IA 2LSOA 3W3CA 2RC4A 4E7KA 5HDNA 3PNVA 3ECOA 1IV8A 3RPUD 3KYCB 1ODDA 4FX0A 3FMQA 1T8IA 2VQLA 4M9SA 3SFIA 1C0WA 2IT0A 3I4MJ 5C4JJ 1ZTRA 4CSWA 1AU7A 2K9QA 3DKYA 1B59A 1YTYA 3DP7A 2ID3A 3VOEA 1FBQA 1YS6A 1V5FA 3ZMZA 1OCZH 1X58A 3LSMA 1RPWA 4B47A 4J00A 3BTLA 4ESJA 2EFWA 3CF5F 4DZJA 3J81Z 5TRDA 2A3SA 1KGSA 4A3MJ 3IH3A 3HHGA 2AHQA 1XPXA 1W5SA 2IS1A 2Y0MA 4U0WA 3RIRA 4HRIA 1IDYA 4K2EA 1W0TA 2IAIA 4C9YA 1H9GA 4DIQA 2KZGA 1KU7A 3FK7A 3I9V2 3K4KA 4C2TA 2WA0A 2HVQA 1M1EB 3FKIJ 3P9KA 1E3HA 4XQFA 1JE8A 2JUGA 1QBJA 1T08B 3CLQA 4Y15A 3GFMA 3DU5A 3JRCA 1XGOA 2EILH 4I7HA 5FFZA 4AIKA 3FXKA 1BIAA 1IW7F 1OCOH 2J5PA 2QQAA 2HPIA 4BXUA 5CQEA 4I0BA 1ULYA 5J40A 5KCMA 3ISPA 3DU6A 2DODA 4DJAA 4A5MA 1LVKA 4RMNA 1O3RA 4TV7A 3CUQA 2H1KA 1ETOA 1YJNI 3CC2I 3CC4I 1I27A 3VYUB 5LLQA 3CUQC 5K7HA 4AIHA 3RZOJ 2ZBKA 2IRFG 2BZTA 1PYVA 5M5YJ 4RBOA 4Y7NJ 2D1HA 2KRCA 1T39A 1R00A 1FIPA 4M3FA 1JHHA 4NNJA 4XKCA 1XMKA 3GX4X 5JVGF 3QYFA 4B3XA 1PP8F 5J1UA 3HZJA 2EH3A 1KA8A 5F04A 2DOFA 2TCTA 1XB4A 4A3FJ 2XRLA 1V4RA 1WJFA 2YUSA 3NWSA 3DEUA 3WGIA 1AA7A 5DCMA 1UHSA 5GADJ 2VLAA 2EA2A 2XGXA 3GMEA 3M1CA 4BHCA 2XB0X 3WTZA 4PSXA 2LG4A 3CMEI 5CLSA 3OYFA 1MBHA 1R5GA 4NDLA 3E1SA 5IYCJ 1S9HA 5F27A 3HG9A 3HPGA 1BA5A 3H3UA 2BY1A 4RB2C 3ABUA 2ESHA 2F2EA 2EV6A 3L09A 4OIQF 1IN4A 2JK3A 2DMPA 3ABKH 5BPIA 3V8LA 4KT5C 1MDMA 3DPTA 3JR9A 3BR0A 2A6TA 2M5WA 4JOMA 5LEJA 3CCEI 4O3MA 5KVRA 3RTRA 4WWCA 1MMNA 3E7LA 4ZH4F 4YELA 2HOEA 4A0YA 9ANTA 4AVPA 4C2MJ 2P6SA 4W97A 2CW8A 4KICA 4II2A 3FXJA 1I50J 2RNGA 4XICA 4G7ZF 1QGPA 2GXGA 1YRNA 2H8WA 1VZ0A 1HCRA 3KEYA 3J7AO 3AFHA 3LMMA 2JRTA 1U78A 3FXRA 2LBFA 2PMUA 4BJTA 2VL8A 1D5YA 4IHXA 1YLFA 2K86A 4F93B 3L1PA 1GXPA 1JTYA 4UV8A 1MJAA 1O7FA 1OCCH 2LKSA 4EM0B 2DA6A 3PJRA 2VPLA 1ZKGA 1VQ5I 3ML6A 3CZ6A 1P7JA 3I56I 3FK6A 1BJAA 2R7XA 1MSEC 4PZJA 1DP3A 3R0AA 5LGNA 2MLGA 4M3GA 4GYIA 2HDCA 1JKQC 5H2FC 1R49A 5M3FJ 1LKXA 3F72A 1E3PA 4A6DA 1SD7A 2CQKA 1WFXA 2E19A 4P5OA 2UXXA 4DQ2A 1ZRDA 4HF2A 3HL2A 4WXHA 1WJCA 4DYRA 2VBZA 4LG0B 4XBFA 2HKXA 3NRVA 3BJOA 1U6GA 3BDDA 3M1EA 3BCBA 4I98B 3L2UA 1UG2A 4RGUA 2L9VA 4G6QA 2LRDA 3DTIA 3MKYB 4LITA 4NHJA 1HBXG 3ROUA 2Q1ZB 2VODA 4PUSA 2XIGA 2XPWA 2HYFA 4XRSG 2C6YA 4L5EA 4RM2A 1ACIA 4FHTA 4M72A 3ZMTA 5GTHC 2JA5J 4WX9A 2DOEA 4LIUA 2E35A 1PUEE 2FXAA 3JTGA 2XDVA 3MKZA 3H1CA 3V8JA 2ZNYA 4S0HB 4AIDA 3WE3A 2RVCA 1MJ9A 2FJ1A 3LSJA 1Y6IA 2QKMB 2VC1A 2KP6A 3G1OA 1KONA 5ILUA 2X1EA 2GIZA 4KFCA 5J1RA 2W4SA 2ETHA 2J5OA 2L9NA 2XUBA 1ZG1A 3P9IA 1YS7A 1P92A 3SDBA 4D9JA 5BMZA 2L2OA 2R3SA 4CCOA 2ZMEA 1I3QJ 2OF7A 1TT5B 4MO7A 1A36A 4UUTA 1RUOA 2XAQA 2VKDA 2F48A 4KMFA 3A01B 2DJIA 2LF7A 3F3XA 5CQGA 2ZMEC 1P2FA 2HZTA 3DTEA 3MN2A 3OS1A 2R7DA 1R36A 5FKKA 2DT6A 2PBIA 3L7WA 5L3CA 2K9NA 3S3MA 1Z3XA 2ELJA 3HRTA 2DPUA 1MNMC 2E2IJ 3CESA 1X1AA 3JAMZ 2R5ZA 3IRQA 2F5EA 1K78B 1Y1VJ 4XOPA 1D1CA 3ZXSA 3LQRA 4HNVA 3KE2A 1T98A 4FQGA 2YX7A 1S7AA 2EJRA 2M2EA 3GZNB 4BY1J 2MC3A 4XLFA 2X6XA 4ENNA 3EUAA 3DKXA 4L9NA 4A5NA 4MLOA 1CF7A 1K79A 3BR1A 5GAEJ 3CUOA 4BQAA 1RR7A 2LREA 1TWCJ 1IN8A 2X4HA 3DXJF 4EJVA 3J80K 1FMWA 3FXLA 2TRTA 4ZYHA 1RIOH 3LWFA 2L7MP 1GT0C 5FRNA 2BHZA 5B66C 3BJAA 1Z6TA 2G7UA 2MD0A 4L5JA 4OAZA 3V7RA 2A5WA 2X85A 4QWQA 2W25A 2DMNA 1Y8RB 2VQHA 3L2VA 2UZKA 1ZR2A 2XRNA 3EPZA 3TGNA 2DMQA 1H0MA 5H6RA 3OYNA 2D5VA 1UHWA 2EZHA 2EFPA 1RUNA 2QSGX 1IN6A 1BR2A 3T8TA 3DQVC 3E5QA 3SXYA 4IX7A 1BC8C 3VFZA 3BZCA 4J19A 2JPBA 1MKMA 2COMA 3BPVA 2D2WA 2W48A 2R92J 3V8KA 3JTHA 2X6WA 3K1NA 5HLIA 2MD5A 1FNNA 2VJIA 2V79A 2GA1A 2EK5A 1O7LA 3PSFA 4OIPF 3MKWB 4EJWA 1ZHFA 2PJRB 1FIAA 1P7IA 3CCSI 3BG9A 3HSRA 1IG7A 4A3IJ 2B9SA 1ITYA 4ZTFA 3J81K 1VQ4I 1U5TA 1WH7A 2FBKA 4ENMA 1U2WA 4IHYA 2YSRA 2XASA 2ZB9A 1GVDA 2A6HF 4XL9A 4I02A 4HSTA 4KITB 1HC8A 1MJBA 1U5TC 2O8XA 3ASNH 2KIMA 1HKTA 3OV8A 4FX4A 1AOYA 1FP2A 1N78A 3H0GJ 3DBHB 3TOAA 5DUKA 2QVOA 4PDKA 3LSRA 2MABA 2M30A 3HSEA 4ABZA 3B6AA 4ITVA 3WG7H 5HLHA 4UXNA 3QYEA 3WU0A 2DOAA 5LHGA 2GOXB 3OOUA 3CCVI 4KUMA 1MGTA 5CVRA 4CCMA 3RZDJ 2AO9A 4OIRF 3F8FA 5D4SA 2HQAA 1EH7A 1EKEA 1X3WB 1KQ9A 2MLKA 1FSEA 3TO9A 4RGXA 3UKGA 1PVEA 5D8LB 2BVLA 2RDPA 3HRMA 1H88C 3S15J 1WWXA 2MW8A 1X1CA 3W6KB 3GTLJ 5IP9J 2HXOA 1POGA 3T1BA 2QYOA 2VN2A 3WU1B 2JJ7A 4A3LJ 3LL7A 2V4JC 2EQRA 2V6EA 2HQ5A 4YEJA 4NB5A 3U9GA 3OSFA 2M45A 2ZJQF 2IGMA 1R58A 2BVMA 2JA8J 3ZR8X 2P5VA 2P8TA 3FXOA 4BBRJ 2DN0A 5D5VB 3MZHA 3KCCA 2DTRA 4O5VA 2VXDA 2ID6A 5F0FA 2R7UA 2VI6A 5J47A 1WH5A 2CV2A 2R7SA 3ZMUA 1D0ZA 4YIFA 2WBMA 3RJPA 2F5VA 4KMUX 1WVRA 2VBWA 1OKRA 4CYDA 3ESWB 3KX2A 3GTGJ 4HV5A 1Z6RA 2XKPA 4HNUA 2LC2A 3HRSA 4ZDOA 3HM5A 4XLEA 2O9LA 1ZELA 4BQQA 3DPLC 3VODA 2H6BA 3GXOA 4G7HF 2YS9A 3BTCA 3I54A 1V5EA 3WU2C 4IRHA 2HTSA 1R6RA 3IH2A 3EYYA 1IGNA 2IA0A 4QPOA 1G2HA 1O4XA 2O0YA 4F92B 4U0VA 3F9KA 3BQZA 2LP0A 1XC5A 4M9ZA 3W2AA 3PO3J 1UMQA 1OJLA 2HQNA 5FLXK 1TQMA 4M3EA 3CDLA 1FLIA 2XROA 5E8IA 4HF1A 2E7WA 2E1MC 1QZEA 3K2AA 1Y0NA 3R4KA 3TP0A 2VKVA 1U8BA 3CCYA 4BDZA 2DU9A 4EV0A 1R9TJ 2WAQN 1BOBA 3DBLB 1FYLA 4NBQA 4A3GJ 1OISA 3V4GA 3OS0A 1IF1A 2E1OA 5FD6A 3HKZN 2ME6A 4P96A 4I99C 3MWMA 4YIIA 1VQ7I 2VB6A 3LSHA 5H6QA 3FMRA 3OL3A 3HOSA 4BAYA 3MD2A 3FX3A 1YI2I 1Z77A 2NS8A 1X1PA 2K3PA 2XF6A 3K69A 4AYBN 4ETSA 1JUPA 3H92A 2W84A 1KZHA 2FX0A 3EYIA 2NNNA 4EGYA 3ZQFA 1UELB 1W0UA 1B8IB 2L01A 1E3OC 2RREA 4FETA 2Y9YA 1F36A 2GIVA 5GPAA 3N4MA 4A3BJ 1W5TA 3HPHA 3E6DA 5JI6A 1FOYA 1N75A 1SVOA 2XGCA 1EJ9A 1A04A 1ZARA 5TGTA 2FQ4A 3S2WA 3G6EI 1QO0D 1OCPA 4UV9A 3AAFA 3I4NJ 2GAUA 3L9FA 2FA5A 4M6VA 2HFHA 4V2FA 2FSWA 3CJRB 4PJNA 3LAPA 1VQOI 1QA6A 2LNBA 2IS4A 3GO5A 4I0AA 3BR6A 2M4KA 4RLFA 3GBGA 4MFDA 3U1DA 4FE4A 4BH9A 1UCRA 2DQLA 2FMYA 4CDGA 1EF4A 1FSHA 5J8CA 4IEJA 3QPTA 2JSCA 4CCKA 5EG0A 2F4IA 1HW2A 1EH8A 4PK4A 5EYRA 2XHKA 4PFOA 5FLVA 3BR5A 1DGWY 2OQRA 2ZFWA 4D7MA 2OCCH 4A3DJ 2R7FA 2X0LA 4M3DA 2PJPA 2V6CA 1MZBA 3QU3A 3C2BA 4Y3OA 5DYMA 5AIPA 1F4KA 3PO2J 3GTJJ 3E6CC 4QTRA 2WAEA 4A0ZA 3JRAA 2Z9OA 2QQ9A 3BG5A 1O3TA 3BG3A 1TWGJ 2ZNZA 3A01A 1XS9A 3KZIC 3BG6A 2L0KA 4KIGA 3JAMK 4MIMA 1LFUP 4UVAA 4YFKF 2AQFA 5DDGA 2QGUA 1SEUA 2HVSA 1LFBA 2KKOA 4CUGA 5CPRB 3BPXA 4YRVA 1SD4A 4MNUA 5HS9A 2EIKH 5E3NA 1K78A 3LSGA 2O8KA 4MTDA 3M8FA 3QOEA 2QZ8A 1GLNA 2FUG2 3F6OA 4M73A 1LVAA 4DBRA 4ENKA 3FXUA 2VT2A 3C2GA 1VQ8I 3PNYA 4KISA 1H8AC 1FX7A 5JFRA 1BW6A 2JVGA 2NYXA 2DA7A 3E3VA 4ZYAA 3TOBA 1KU9A 5LEKA
chains in the Genus database with same CATH topology
5E1WA 2M87A 1ON1A 3E5XA 3PFIA 2KJCA 4IF4A 3SHFA 4JQFA 3B73A 2CG4A 3G3ZA 4EM1A 4P9UA 3QU6A 2VE9A 1B9NA 2YU3A 4RAYA 2O03A 5LRRA 1TW3A 4Y17A 1S29A 2W24A 4HX8A 2XV4S 5ICEA 2L02A 4R1HA 2XAFA 2EB7A 1OPCA 3GFLA 2VT3A 4RS8A 3G73A 3LQQA 4BHBA 3O6BB 2A61A 2YR2A 3ZP5A 5HS7A 2QQBA 1SFUA 2D1VA 2DW4A 4UHTA 4WK8F 5FO5A 2QWWA 4EM2A 2MH9A 1Z05A 1T38A 1WSUA 2A07F 3WTYC 1STZA 5DD4A 4ZYEA 5DUIA 2HKOA 4BNCA 5IT9Z 5E17F 3ZMDA 1R1TA 1I6XA 3FM5A 2P6TA 3BOQA 1AWCA 1LDDA 3KP4A 1LEBA 2EA4A 1KQ0A 4CGZA 4A0XA 2M8EA 3GLXA 1XN7A 2ESNA 3I58A 3MQ0A 2NNYA 1IN5A 4Y13A 2F5FA 1IZ1A 4LB6B 5ILVA 4OOIA 5DEQA 2K27A 1RNLA 6PAXA 2FOKA 1BI0A 2UXNA 4PGHA 1D3YA 1S3JA 1KU2A 1Z91A 3E97A 1I5ZA 5E18F 5LBQA 3SFZA 1FP1D 3CDHA 4A12A 2G7HA 4N0BA 4RAZA 1WRJA 1S7OA 4ON0A 1R22A 3F6VA 2B0LA 3GFIA 1P4AA 3I64A 3KLNA 3DF8A 1T6SA 2Y48A 5D8KB 1D5VA 2YX4A 3LA2A 1I1GA 4GYGA 1XMAA 1BN5A 3N97A 1JXSA 3CLOA 4U88A 2EFNA 2OAZA 5FLXZ 3KP7A 2OD5A 1E17A 2OZ6A 4LK1F 2PQ8A 1OYIA 4R79A 1YW7A 1DP7P 2OBPA 2JTVA 3MFKA 3I53A 5EEHA 4AWXB 5J6XA 5FFXA 1T2KA 5E1XA 1F9NA 3RI4A 4WF2A 1G3TA 2BEOA 2LDUA 3EQLF 3TO7A 1ZRFA 1USSA 3TDZC 3MZYA 1G6NA 3R60A 4CXFA 1G4DA 3BJ6A 3WTTC 1UHMA 3ULQB 4L9JA 4L0YB 4XLPF 5ICFA 5FB2A 2VONA 1BIBA 2F5CA 1TW2A 3QRFF 2QBYB 3E6BA 4L9VA 1PP7U 1R23A 2DI3A 4OMYA 2PEXA 3ELKA 2BE5F 1GXQA 2WTEA 5LHHA 2CFXA 2E7XA 4HOBA 5H20A 3RKXA 1WKMA 3K1MA 4I01A 3SZTA 3FWEA 1DDNA 1QZYA 3RPQA 1LJ9A 1BC7C 5CYVA 1B1BA 5E1ZB 2V9VA 1W7PB 2RNJA 3P7NA 3I59A 2FEZA 1QZZA 5HVQC 3MAJA 2Z99A 4HX4A 3FM3A 2LKPA 2STTA 1DUXC 2QUFA 3WG9A 1ZG5A 3F23A 4HDUA 2IPQX 4XSZF 4A2UA 1K6OA 2ZKZA 4HAMA 3QOPA 5AONA 2ISYA 1J7KA 4MEYF 5HS8A 1P4WA 1BM9A 2XAJA 2YPRA 3O2PE 4ENJA 5ICCA 3LA7A 3GF2A 1ZYRF 4PCQA 5F1RA 4LFUA 5JR3A 4U0YA 2V1DA 2H94A 1XDUA 1S6LA 3RDIA 4G94A 1P4XA 4P9FA 2OA4A 2P7CB 2QLZA 4A6EA 3IL2A 3RYPA 1YFHA 4KIFA 4RGSA 4ZYDA 1F5TA 3F8NA 5F6FA 2PI0A 2DQRA 3WODF 4CHUA 2CYYA 3SQNA 3HYIA 3O3KA 4EJOA 2JZYA 2Z3YA 3CUQB 1E2XA 1OR7A 1LEAA 2O3FA 5L3BA 5IT9K 1VTNC 1HQCA 3GWZA 1BI2A 1ZGAA 3GFJA 3BP8A 3TDUC 2A69F 4Q47A 4L0ZB 2QM3A 5D6FA 1W4MA 1IN7A 2NAZA 2E1CA 3MCZA 2A6EF 2KRFA 2VE8A 2ISZA 1HKQA 1YW8A 2VC0A 3CO7C 4HYEA 2UWMA 2BYVE 1MDMB 4ZYGA 3TKYA 3M7GA 5K5RA 5TJJA 4WXDA 3WE2A 2F5DA 3R0JA 4EMSA 3COAC 3SZPA 4KNYA 5EEGA 2K4JA 1ZLJA 5HDGA 4CZZA 3WTWC 5D6EA 4CO8A 3Q5FA 4N9IA 5HDKA 2VBYA 3CTAA 4HDVA 4Q48A 2K02A 3KP6A 3F22A 4MHGA 3C18A 3JW4A 4AD9A 5K5OA 2DO7A 1KYZA 3H3ZA 3B02A 3I5UA 1Z1DA 1P6RA 2DFIA 4UVBA 5KK1A 3FMSA 3K2ZA 4ZZLA 2ZXJA 1QPMA 2XAHA 3KEQA 4LG0A 2KIUA 3DKWA 1IAWA 3HRUA 4ESBA 2IA2A 2BBYA 2DK8A 1RI7A 3WGHA 1EH6A 1G3YA 4KIBA 4AIJA 4EJUA 1O57A 4HX7A 2BGCA 3F21A 5D5UB 2WC2A 4QLCU 1K7AA 2QBYA 3Q9SA 2JPCA 1FC3A 4S04A 4GXOA 2HEOA 1O3QA 2ZMEB 2MH2A 2TDXA 1OYWA 3P9CA 5JHUA 2ADUA 2BV6A 2XAGA 3ZQ7A 3KFWX 2DAOA 2CO5A 2RN7A 3C1DA 4UVCA 4KA4A 1W7PA 5HLGA 1I1SA 1SFEA 4KN4X 1L0OC 2W57A 5DV5A 4WCGA 3LA3A 1TBXA 1YYVA 5LRSA 3FZVA 1XSVA 5L3EA 2GQQA 3C3WA 2MBFA 3GW2A 2PLYA 2IJLA 1BBYA 5DCFA 2AXLA 1REPC 2CWEA 4FT8A 5A2QZ 3TO6A 4GO1A 3IWZA 1U3EM 2Q8KA 4L18B 4I2OA 2DBBA 5JVTA 3MEXA 1FZPB 4UNOA 4I09A 1SMYF 2DK5A 4HLYA 1BI3A 1B6AA 5D5WB 2CSOA 3Q9VA 3IRRA 2GWRA 1U5TB 1ZN2A 2L4MA 2RQPA 3HOTA 3KP5A 1BI1A 1J75A 1QQIA 2K7LA 4HQEA 5K1YA 1ZRCA 2Q0OA 3K9TA 4UUVA 1Q1HA 1TNSA 1HSTA 4KYWA 1UB9A 4Q5SF 3U2RA 3I0TA 2W85A 1XSDA 2ACJA 2EV0A 2PG4A 4OIOF 3IHUA 4U7BA 5BQTA 4CICA 1TLHB 1W7PD 4RB1A 3K1PA 4EVIA 1GVJA 2CGPA 4R8HA 5DD8A 1GHCA 5CJ9A 4YFNF 3W6JB 4HBLA 2PMHA 2H27A 4M9XA 4PGGA 2OQGA 1JGSA 2HR3A 1TQPA 4P55A 1SFXA 3DV8A 2EV5A 2NRAC 3IC7A 2RV8A 1PDNC 4L5IA 5CVUA 2FBHA 3D0SA 3KZYA 5BPDA 2GXBA 1WI9A 4GCVA 1ON2A 4EQQA 4OINF 3E5UA 2P4WA 1J2XA 1R1VA 2FBIA 1Y0UA 5L3DA 1G3WA 5LGTA 2V1XA 4LLLA 3QP6A 3GZ6A 3EDPA 4HZFA 3KLOA 2AS5F 3F8BA 4XLNF 5E20A 4IJAA 4MTEA 5BS6A 2VXZA 3LSTA 1T0FA 3E6MA 1YO5C 2GZWA 3LFKA 1DPUA 4EGZA 3NEUA 3DFGA 2PFBA 1TNTA 3RKYA 5ERIA 4G8XA 2IA1A 1ONVA 3L00A 1QNTA 4G7OF 4U7DA 1SD5A 1LDJA 5F64A 4ESFA 1D8JA 1OMIA 2RGVA 3GUDA 1XGSA 1B4AA 3KP3A 3CO6C 3R6SA 1IRFA 1R5HA 4JBAA 1HW5A 4YG2F 1ZG3A 2ELHA 3REOA 1YQAA 4MQ9F 4GGGA 4XRFA 1HXDA 5L3FA 1FYKA 5E8GA 1FT9A 4BYYA 3VB2A 1XSXA 2HGCA 4ASNA 3LAJA 2DPDA 2FNAA 4MQVA 2P5LC 1HW1A 1FYMA 5L3GA 3K0LA 1Z7UA 2HYGD 3PQJA 2ZO4A 4KN7X 3GEZA 3ZN0A 1FPQA 1KU3A 4L9TA 3V7SA 5BOXA 4XSXF 3I4PA 5HOOA 2KIFA 1UFMA 1TQIA 2DT5A 1IXSB 5FD5A 2H09A 2FQ3A 4OMZA 2DLLA 2HWVA 4IXAA 1J59A 1FOKA 3QAHA 4B8XA 4LD5A 4G9YA 1IXRC 4LLGF 4H0EA 3TQNA 1S8NA 4M74A 1J0RA 5J8FA 3WTSC 2HQRA 3BY6A 2QENA 2GA2A 5A2QK 2HTJA 1DPRA 1JHFA 3GVAA 3ERED 2OZUA 3I71A 3KP2A 2VOOA 3CJNA 4B09A 4LLNA 4M71A 2WV0A 3RKWA 2WWYA 1USTA 2KJBA 2PN6A 2STWA 5LGUA 4D0PA 4N9HA 2XVCA 1FY7A 1WQ2A 4IRGA 4WXCA 4DNCA 4IRIA 2JT1A 2Y75A 4MEXF 2EFOA 1SAXA 4E70A 3JSOA 3WTUC 1FBSA 4YFXF 1IXCA 1IUYA 3HHHA 4OU0A 2D45A 3IWFA 1OYYA 5FGMA 4G6DA 3RYRA 4M6YA 5D4RA 1HKSA 1LDKB 3NQOA 1IRGA 2IW5A 5CVIA 1R1UA 2K4BA 5DCMB 1F1ZA 1SMTA 3ZPLA 5CVJA 4LGWA 3GYHX 4HQMA 4Q4ZF 3IKTA 1HSJA 3HUGA 3L2CA 2L54A 2XKOA 3F8CA 1ZLKA 4LMYA 1FBUA 2MA3A 1V3FA 2NS0A 3QPHA 2RKHA 4S05A 1G3SA 2EFQA 4MGRA 3R61A 4HW0A 1J5YA 1LB2A 4HF0A 3KEOA 3PQKA 5IT3A 1ZGJA 3KETA 1ZAOA 2M1BA 4LB5A 2EWNA 2VOPA 2FNPA 2IP2A 1XGMA 4ZZDA 1NHAA 1CGPA 1L3LA 2V1UA 3F8MA 4IHSA 3BZ6A 4IHTA 4JK1X 3T0YA 3HIFA 3ECHA 3FXQA 2A68F 4LJZF 2FE3A 3ABTA 1XD7A 3IKVA 3ZMVA 3ZMSA 4KDPA 4O6JA 2A5YB 4IVNA 3C7JA 3EETA 3D5LA 1XGNA 4NQWA 1XDSA 1O3SA 4BHPA 1SD6A 2P7VB 1ZH5A 1Z9CA 3T8RA 2CW0F 2Q2EA 3GZ5A 1U8RA 1RZ4A 3RPUA 2ZJ2A 1TTYA 4EJTA 4RGRA 3VEPA 3BWGA 3V7CA 5ICGA 1YIOA 2L3DA 3FF5A 2ZCWA 2FRHA 5CVVA 4F7ZA 2P5KA 1D8KA 5AIQA 4RB3C 3FHZA 2O61A 4M6XA 2IVMA 3EUHA 1ZREA 5K5QA 4HLXA 3ZN1A 1R7JA 3WTXC 3HSFA 1EV7A 2LF8A 4HV6A 3I59B 1BOAA 2Z33A 3M8EA 3WTVC 2VBXA 3BROA 2G9WA 5ILSA 5LHIA 1XCVA 2Z5UA 1H9TA 3HTUA 4LK0F 4RB0A 1X3UA 3WGGA 1CF7B 1MD0A 3QP5A 1KQ8A 1YG2A 4HA8A 3KZZA 5ED4A 1YW9A 2O6GE 3OOPA 5D5XB 2L4AA 3J80Z 1XCBA 2FMLA 4Z2YA 3T5XA 3JSPA 2HS5A 1B9MA 1KYWA 4IPAA 2FU4A 2OU2A 2FF4A 3M9AA 3HTSB 1LNWA 1LQ1A 2H6CA 2E1NA 1FWZA 1J9IA 2LSOA 2RC4A 5HDNA 3ECOA 1ODDA 4FX0A 3FMQA 2IT0A 4M9SA 1C0WA 1B59A 1YTYA 3DP7A 3VOEA 1FBQA 1YS6A 3ZMZA 4ESJA 2EFWA 3J81Z 5TRDA 2A3SA 1KGSA 3HHGA 1W5SA 2Y0MA 4U0WA 3RIRA 4K2EA 1H9GA 1KU7A 3P9KA 1JE8A 1QBJA 4Y15A 3GFMA 1XGOA 4I7HA 5FFZA 4AIKA 1BIAA 1IW7F 2J5PA 4BXUA 2QQAA 4I0BA 1ULYA 3ISPA 4A5MA 1O3RA 4TV7A 3CUQA 1I27A 5LLQA 3CUQC 4AIHA 2ZBKA 2IRFG 2D1HA 1T39A 1R00A 1JHHA 3GX4X 1XMKA 1PP8F 1KA8A 1XB4A 1V4RA 3DEUA 3WGIA 5DCMA 2EA2A 2XGXA 4BHCA 3WTZA 5CLSA 1R5GA 3H3UA 4RB2C 2ESHA 2F2EA 3ABUA 2EV6A 3L09A 4OIQF 1IN4A 5BPIA 3V8LA 4KT5C 1MDMA 3DPTA 2M5WA 5LEJA 4O3MA 5KVRA 3RTRA 4WWCA 4ZH4F 2HOEA 4A0YA 4AVPA 2P6SA 4KICA 4G7ZF 1QGPA 2GXGA 3J7AO 2JRTA 1U78A 3FXRA 2PMUA 1YLFA 2K86A 1GXPA 4UV8A 1MJAA 1O7FA 4EM0B 3ML6A 1BJAA 4PZJA 3R0AA 5LGNA 2MLGA 4GYIA 2HDCA 3F72A 4A6DA 1SD7A 2CQKA 4P5OA 2UXXA 4DQ2A 1ZRDA 4HF2A 4WXHA 2VBZA 4LG0B 4XBFA 2HKXA 3NRVA 3BJOA 1U6GA 3BDDA 3M1EA 4I98B 4RGUA 4G6QA 4NHJA 1HBXG 3ROUA 2VODA 2XIGA 2HYFA 2C6YA 4FHTA 4M72A 3ZMTA 4WX9A 1PUEE 2FXAA 3JTGA 3V8JA 2ZNYA 3WE3A 2RVCA 1MJ9A 2VC1A 5ILUA 4KFCA 2ETHA 2J5OA 2XUBA 1ZG1A 3P9IA 1YS7A 1P92A 5BMZA 2R3SA 2ZMEA 1RUOA 2XAQA 4KMFA 2LF7A 3F3XA 1P2FA 2HZTA 2R7DA 1R36A 2PBIA 3L7WA 5L3CA 3HRTA 2DPUA 3JAMZ 3IRQA 2F5EA 1K78B 3LQRA 3KE2A 1T98A 2YX7A 1S7AA 2EJRA 2MC3A 4ENNA 4L9NA 4A5NA 1CF7A 1K79A 3CUOA 4BQAA 3DXJF 1IN8A 2X4HA 4EJVA 3J80K 4ZYHA 1RIOH 3LWFA 3BJAA 1Z6TA 2G7UA 4L5JA 3V7RA 4QWQA 2W25A 2UZKA 2XRNA 3TGNA 1H0MA 5H6RA 1UHWA 2EFPA 1RUNA 1IN6A 3T8TA 3DQVC 3E5QA 3SXYA 1BC8C 3VFZA 2JPBA 1MKMA 2COMA 3BPVA 2D2WA 3V8KA 3JTHA 3K1NA 5HLIA 2MD5A 1FNNA 2V79A 2GA1A 2EK5A 1O7LA 4OIPF 4EJWA 1ZHFA 3HSRA 3J81K 1U5TA 2FBKA 4ENMA 1U2WA 2YSRA 2XASA 2A6HF 4I02A 1MJBA 1U5TC 2O8XA 2KIMA 1HKTA 3OV8A 4FX4A 1AOYA 1FP2A 3TOAA 5DUKA 2QVOA 4PDKA 2M30A 3HSEA 5HLHA 4UXNA 3WU0A 5LHGA 4KUMA 1MGTA 5CVRA 4OIRF 5D4SA 3F8FA 1EH7A 1KQ9A 2MLKA 1FSEA 3TO9A 4RGXA 5D8LB 2RDPA 3HRMA 1WWXA 3W6KB 3T1BA 2QYOA 2VN2A 3WU1B 4NB5A 3U9GA 2M45A 1R58A 2P5VA 2P8TA 5D5VB 3MZHA 3KCCA 2DTRA 4O5VA 3ZMUA 4YIFA 3RJPA 4KMUX 2VBWA 1OKRA 4CYDA 4HV5A 1Z6RA 2XKPA 3HRSA 3DPLC 3VODA 2H6BA 3GXOA 4G7HF 3I54A 4IRHA 2HTSA 3EYYA 2IA0A 2O0YA 4U0VA 4M9ZA 2HQNA 5FLXK 1TQMA 1FLIA 2XROA 5E8IA 4HF1A 2E7WA 3R4KA 2DU9A 4EV0A 1FYLA 3V4GA 1IF1A 5FD6A 4P96A 3MWMA 4YIIA 5H6QA 3FMRA 3HOSA 4BAYA 3FX3A 3K69A 4ETSA 3H92A 2W84A 3EYIA 2NNNA 4EGYA 2L01A 2GIVA 3N4MA 1W5TA 3E6DA 5JI6A 1A04A 1ZARA 3S2WA 1QO0D 4UV9A 3AAFA 2GAUA 3L9FA 2FA5A 2HFHA 2FSWA 3LAPA 2LNBA 3GO5A 4I0AA 3U1DA 4BH9A 1UCRA 2DQLA 2FMYA 4CDGA 1FSHA 5J8CA 3QPTA 2JSCA 1HW2A 1EH8A 2XHKA 2OQRA 2ZFWA 2R7FA 2X0LA 2PJPA 2V6CA 1MZBA 3QU3A 5DYMA 5AIPA 1F4KA 3E6CC 4A0ZA 2Z9OA 2QQ9A 1O3TA 2ZNZA 4KIGA 3JAMK 4UVAA 4YFKF 5DDGA 2KKOA 3BPXA 1SD4A 4MNUA 5HS9A 1K78A 4MTDA 3M8FA 2QZ8A 3F6OA 4M73A 1LVAA 4ENKA 3FXUA 2VT2A 1FX7A 5JFRA 2NYXA 3TOBA 3E3VA 1KU9A 5LEKA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5E1W A;  2M87 A;  1ON1 A;  3E5X A;  3PFI A;  2KJC A;  4IF4 A;  3SHF A;  4JQF A;  3B73 A;  2CG4 A;  3G3Z A;  4EM1 A;  4P9U A;  3QU6 A;  2VE9 A;  1B9N A;  2YU3 A;  4RAY A;  2O03 A;  5LRR A;  1TW3 A;  4Y17 A;  1S29 A;  2W24 A;  4HX8 A;  2XV4 S;  5ICE A;  2L02 A;  4R1H A;  2XAF A;  2EB7 A;  1OPC A;  3GFL A;  2VT3 A;  4RS8 A;  3G73 A;  3LQQ A;  4BHB A;  3O6B B;  2A61 A;  2YR2 A;  3ZP5 A;  5HS7 A;  2QQB A;  1SFU A;  2D1V A;  2DW4 A;  4UHT A;  4WK8 F;  5FO5 A;  2QWW A;  4EM2 A;  2MH9 A;  1Z05 A;  1T38 A;  1WSU A;  2A07 F;  3WTY C;  1STZ A;  5DD4 A;  4ZYE A;  5DUI A;  2HKO A;  4BNC A;  5IT9 Z;  5E17 F;  3ZMD A;  1R1T A;  1I6X A;  3FM5 A;  2P6T A;  3BOQ A;  1AWC A;  1LDD A;  3KP4 A;  1LEB A;  2EA4 A;  1KQ0 A;  4CGZ A;  4A0X A;  2M8E A;  3GLX A;  1XN7 A;  2ESN A;  3I58 A;  3MQ0 A;  2NNY A;  1IN5 A;  4Y13 A;  2F5F A;  1IZ1 A;  4LB6 B;  5ILV A;  4OOI A;  5DEQ A;  2K27 A;  1RNL A;  6PAX A;  2FOK A;  1BI0 A;  2UXN A;  4PGH A;  1D3Y A;  1S3J A;  1KU2 A;  1Z91 A;  3E97 A;  1I5Z A;  5E18 F;  5LBQ A;  3SFZ A;  1FP1 D;  3CDH A;  4A12 A;  2G7H A;  4N0B A;  4RAZ A;  1WRJ A;  1S7O A;  4ON0 A;  1R22 A;  3F6V A;  2B0L A;  3GFI A;  1P4A A;  3I64 A;  3KLN A;  3DF8 A;  1T6S A;  2Y48 A;  5D8K B;  1D5V A;  2YX4 A;  3LA2 A;  1I1G A;  4GYG A;  1XMA A;  1BN5 A;  3N97 A;  1JXS A;  3CLO A;  4U88 A;  2EFN A;  2OAZ A;  5FLX Z;  3KP7 A;  2OD5 A;  1E17 A;  2OZ6 A;  4LK1 F;  2PQ8 A;  1OYI A;  4R79 A;  1YW7 A;  1DP7 P;  2OBP A;  2JTV A;  3MFK A;  3I53 A;  5EEH A;  4AWX B;  5J6X A;  5FFX A;  1T2K A;  5E1X A;  1F9N A;  3RI4 A;  4WF2 A;  1G3T A;  2BEO A;  2LDU A;  3EQL F;  3TO7 A;  1ZRF A;  1USS A;  3TDZ C;  3MZY A;  1G6N A;  3R60 A;  4CXF A;  1G4D A;  3BJ6 A;  3WTT C;  1UHM A;  3ULQ B;  4L9J A;  4L0Y B;  4XLP F;  5ICF A;  5FB2 A;  2VON A;  1BIB A;  2F5C A;  1TW2 A;  3QRF F;  2QBY B;  3E6B A;  4L9V A;  1PP7 U;  1R23 A;  2DI3 A;  4OMY A;  2PEX A;  3ELK A;  2BE5 F;  1GXQ A;  2WTE A;  5LHH A;  2CFX A;  2E7X A;  4HOB A;  5H20 A;  3RKX A;  1WKM A;  3K1M A;  4I01 A;  3SZT A;  3FWE A;  1DDN A;  1QZY A;  3RPQ A;  1LJ9 A;  1BC7 C;  5CYV A;  1B1B A;  5E1Z B;  2V9V A;  1W7P B;  2RNJ A;  3P7N A;  3I59 A;  2FEZ A;  1QZZ A;  5HVQ C;  3MAJ A;  2Z99 A;  4HX4 A;  3FM3 A;  2LKP A;  2STT A;  1DUX C;  2QUF A;  3WG9 A;  1ZG5 A;  3F23 A;  4HDU A;  2IPQ X;  4XSZ F;  4A2U A;  1K6O A;  2ZKZ A;  4HAM A;  3QOP A;  5AON A;  2ISY A;  1J7K A;  4MEY F;  5HS8 A;  1P4W A;  1BM9 A;  2XAJ A;  2YPR A;  3O2P E;  4ENJ A;  5ICC A;  3LA7 A;  3GF2 A;  1ZYR F;  4PCQ A;  5F1R A;  4LFU A;  5JR3 A;  4U0Y A;  2V1D A;  2H94 A;  1XDU A;  1S6L A;  3RDI A;  4G94 A;  1P4X A;  4P9F A;  2OA4 A;  2P7C B;  2QLZ A;  4A6E A;  3IL2 A;  3RYP A;  1YFH A;  4KIF A;  4RGS A;  4ZYD A;  1F5T A;  3F8N A;  5F6F A;  2PI0 A;  2DQR A;  3WOD F;  4CHU A;  2CYY A;  3SQN A;  3HYI A;  3O3K A;  4EJO A;  2JZY A;  2Z3Y A;  3CUQ B;  1E2X A;  1OR7 A;  1LEA A;  2O3F A;  5L3B A;  5IT9 K;  1VTN C;  1HQC A;  3GWZ A;  1BI2 A;  1ZGA A;  3GFJ A;  3BP8 A;  3TDU C;  2A69 F;  4Q47 A;  4L0Z B;  2QM3 A;  5D6F A;  1W4M A;  1IN7 A;  2NAZ A;  2E1C A;  3MCZ A;  2A6E F;  2KRF A;  2VE8 A;  2ISZ A;  1HKQ A;  1YW8 A;  2VC0 A;  3CO7 C;  4HYE A;  2UWM A;  2BYV E;  1MDM B;  4ZYG A;  3TKY A;  3M7G A;  5K5R A;  5TJJ A;  4WXD A;  3WE2 A;  2F5D A;  3R0J A;  4EMS A;  3COA C;  3SZP A;  4KNY A;  5EEG A;  2K4J A;  1ZLJ A;  5HDG A;  4CZZ A;  3WTW C;  5D6E A;  4CO8 A;  3Q5F A;  4N9I A;  5HDK A;  2VBY A;  3CTA A;  4HDV A;  4Q48 A;  2K02 A;  3KP6 A;  3F22 A;  4MHG A;  3C18 A;  3JW4 A;  4AD9 A;  5K5O A;  2DO7 A;  1KYZ A;  3H3Z A;  3B02 A;  3I5U A;  1Z1D A;  1P6R A;  2DFI A;  4UVB A;  5KK1 A;  3FMS A;  3K2Z A;  4ZZL A;  2ZXJ A;  1QPM A;  2XAH A;  3KEQ A;  4LG0 A;  2KIU A;  3DKW A;  1IAW A;  3HRU A;  4ESB A;  2IA2 A;  2BBY A;  2DK8 A;  1RI7 A;  3WGH A;  1EH6 A;  1G3Y A;  4KIB A;  4AIJ A;  4EJU A;  1O57 A;  4HX7 A;  2BGC A;  3F21 A;  5D5U B;  2WC2 A;  4QLC U;  1K7A A;  2QBY A;  3Q9S A;  2JPC A;  1FC3 A;  4S04 A;  4GXO A;  2HEO A;  1O3Q A;  2ZME B;  2MH2 A;  2TDX A;  1OYW A;  3P9C A;  5JHU A;  2ADU A;  2BV6 A;  2XAG A;  3ZQ7 A;  3KFW X;  2DAO A;  2CO5 A;  2RN7 A;  3C1D A;  4UVC A;  4KA4 A;  1W7P A;  5HLG A;  1I1S A;  1SFE A;  4KN4 X;  1L0O C;  2W57 A;  5DV5 A;  4WCG A;  3LA3 A;  1TBX A;  1YYV A;  5LRS A;  3FZV A;  1XSV A;  5L3E A;  2GQQ A;  3C3W A;  2MBF A;  3GW2 A;  2PLY A;  2IJL A;  1BBY A;  5DCF A;  2AXL A;  1REP C;  2CWE A;  4FT8 A;  5A2Q Z;  3TO6 A;  4GO1 A;  3IWZ A;  1U3E M;  2Q8K A;  4L18 B;  4I2O A;  2DBB A;  5JVT A;  3MEX A;  1FZP B;  4UNO A;  4I09 A;  1SMY F;  2DK5 A;  4HLY A;  1BI3 A;  1B6A A;  5D5W B;  2CSO A;  3Q9V A;  3IRR A;  2GWR A;  1U5T B;  1ZN2 A;  2L4M A;  2RQP A;  3HOT A;  3KP5 A;  1BI1 A;  1J75 A;  1QQI A;  2K7L A;  4HQE A;  5K1Y A;  1ZRC A;  2Q0O A;  3K9T A;  4UUV A;  1Q1H A;  1TNS A;  1HST A;  4KYW A;  1UB9 A;  4Q5S F;  3U2R A;  3I0T A;  2W85 A;  1XSD A;  2ACJ A;  2EV0 A;  2PG4 A;  4OIO F;  3IHU A;  4U7B A;  5BQT A;  4CIC A;  1TLH B;  1W7P D;  4RB1 A;  3K1P A;  4EVI A;  1GVJ A;  2CGP A;  4R8H A;  5DD8 A;  1GHC A;  5CJ9 A;  4YFN F;  3W6J B;  4HBL A;  2PMH A;  2H27 A;  4M9X A;  4PGG A;  2OQG A;  1JGS A;  2HR3 A;  1TQP A;  4P55 A;  1SFX A;  3DV8 A;  2EV5 A;  2NRA C;  3IC7 A;  2RV8 A;  1PDN C;  4L5I A;  5CVU A;  2FBH A;  3D0S A;  3KZY A;  5BPD A;  2GXB A;  1WI9 A;  4GCV A;  1ON2 A;  4EQQ A;  4OIN F;  3E5U A;  2P4W A;  1J2X A;  1R1V A;  2FBI A;  1Y0U A;  5L3D A;  1G3W A;  5LGT A;  2V1X A;  4LLL A;  3QP6 A;  3GZ6 A;  3EDP A;  4HZF A;  3KLO A;  2AS5 F;  3F8B A;  4XLN F;  5E20 A;  4IJA A;  4MTE A;  5BS6 A;  2VXZ A;  3LST A;  1T0F A;  3E6M A;  1YO5 C;  2GZW A;  3LFK A;  1DPU A;  4EGZ A;  3NEU A;  3DFG A;  2PFB A;  1TNT A;  3RKY A;  5ERI A;  4G8X A;  2IA1 A;  1ONV A;  3L00 A;  1QNT A;  4G7O F;  4U7D A;  1SD5 A;  1LDJ A;  5F64 A;  4ESF A;  1D8J A;  1OMI A;  2RGV A;  3GUD A;  1XGS A;  1B4A A;  3KP3 A;  3CO6 C;  3R6S A;  1IRF A;  1R5H A;  4JBA A;  1HW5 A;  4YG2 F;  1ZG3 A;  2ELH A;  3REO A;  1YQA A;  4MQ9 F;  4GGG A;  4XRF A;  1HXD A;  5L3F A;  1FYK A;  5E8G A;  1FT9 A;  4BYY A;  3VB2 A;  1XSX A;  2HGC A;  4ASN A;  3LAJ A;  2DPD A;  2FNA A;  4MQV A;  2P5L C;  1HW1 A;  1FYM A;  5L3G A;  3K0L A;  1Z7U A;  2HYG D;  3PQJ A;  2ZO4 A;  4KN7 X;  3GEZ A;  3ZN0 A;  1FPQ A;  1KU3 A;  4L9T A;  3V7S A;  5BOX A;  4XSX F;  3I4P A;  5HOO A;  2KIF A;  1UFM A;  1TQI A;  2DT5 A;  1IXS B;  5FD5 A;  2H09 A;  2FQ3 A;  4OMZ A;  2DLL A;  2HWV A;  4IXA A;  1J59 A;  1FOK A;  3QAH A;  4B8X A;  4LD5 A;  4G9Y A;  1IXR C;  4LLG F;  4H0E A;  3TQN A;  1S8N A;  4M74 A;  1J0R A;  5J8F A;  3WTS C;  2HQR A;  3BY6 A;  2QEN A;  2GA2 A;  5A2Q K;  2HTJ A;  1DPR A;  1JHF A;  3GVA A;  3ERE D;  2OZU A;  3I71 A;  3KP2 A;  2VOO A;  3CJN A;  4B09 A;  4LLN A;  4M71 A;  2WV0 A;  3RKW A;  2WWY A;  1UST A;  2KJB A;  2PN6 A;  2STW A;  5LGU A;  4D0P A;  4N9H A;  2XVC A;  1FY7 A;  1WQ2 A;  4IRG A;  4WXC A;  4DNC A;  4IRI A;  2JT1 A;  2Y75 A;  4MEX F;  2EFO A;  1SAX A;  4E70 A;  3JSO A;  3WTU C;  1FBS A;  4YFX F;  1IXC A;  1IUY A;  3HHH A;  4OU0 A;  2D45 A;  3IWF A;  1OYY A;  5FGM A;  4G6D A;  3RYR A;  4M6Y A;  5D4R A;  1HKS A;  1LDK B;  3NQO A;  1IRG A;  2IW5 A;  5CVI A;  1R1U A;  2K4B A;  5DCM B;  1F1Z A;  1SMT A;  3ZPL A;  5CVJ A;  4LGW A;  3GYH X;  4HQM A;  4Q4Z F;  3IKT A;  1HSJ A;  3HUG A;  3L2C A;  2L54 A;  2XKO A;  3F8C A;  1ZLK A;  4LMY A;  1FBU A;  2MA3 A;  1V3F A;  2NS0 A;  3QPH A;  2RKH A;  4S05 A;  1G3S A;  2EFQ A;  4MGR A;  3R61 A;  4HW0 A;  1J5Y A;  1LB2 A;  4HF0 A;  3KEO A;  3PQK A;  5IT3 A;  1ZGJ A;  3KET A;  1ZAO A;  2M1B A;  4LB5 A;  2EWN A;  2VOP A;  2FNP A;  2IP2 A;  1XGM A;  4ZZD A;  1NHA A;  1CGP A;  1L3L A;  2V1U A;  3F8M A;  4IHS A;  3BZ6 A;  4IHT A;  4JK1 X;  3T0Y A;  3HIF A;  3ECH A;  3FXQ A;  2A68 F;  4LJZ F;  2FE3 A;  3ABT A;  1XD7 A;  3IKV A;  3ZMV A;  3ZMS A;  4KDP A;  4O6J A;  2A5Y B;  4IVN A;  3C7J A;  3EET A;  3D5L A;  1XGN A;  4NQW A;  1XDS A;  1O3S A;  4BHP A;  1SD6 A;  2P7V B;  1ZH5 A;  1Z9C A;  3T8R A;  2CW0 F;  2Q2E A;  3GZ5 A;  1U8R A;  1RZ4 A;  3RPU A;  2ZJ2 A;  1TTY A;  4EJT A;  4RGR A;  3VEP A;  3BWG A;  3V7C A;  5ICG A;  1YIO A;  2L3D A;  3FF5 A;  2ZCW A;  2FRH A;  5CVV A;  4F7Z A;  2P5K A;  1D8K A;  5AIQ A;  4RB3 C;  3FHZ A;  2O61 A;  4M6X A;  2IVM A;  3EUH A;  1ZRE A;  5K5Q A;  4HLX A;  3ZN1 A;  1R7J A;  3WTX C;  3HSF A;  1EV7 A;  2LF8 A;  4HV6 A;  3I59 B;  1BOA A;  2Z33 A;  3M8E A;  3WTV C;  2VBX A;  3BRO A;  2G9W A;  5ILS A;  5LHI A;  1XCV A;  2Z5U A;  1H9T A;  3HTU A;  4LK0 F;  4RB0 A;  1X3U A;  3WGG A;  1CF7 B;  1MD0 A;  3QP5 A;  1KQ8 A;  1YG2 A;  4HA8 A;  3KZZ A;  5ED4 A;  1YW9 A;  2O6G E;  3OOP A;  5D5X B;  2L4A A;  3J80 Z;  1XCB A;  2FML A;  4Z2Y A;  3T5X A;  3JSP A;  2HS5 A;  1B9M A;  1KYW A;  4IPA A;  2FU4 A;  2OU2 A;  2FF4 A;  3M9A A;  3HTS B;  1LNW A;  1LQ1 A;  2H6C A;  2E1N A;  1FWZ A;  1J9I A;  2LSO A;  2RC4 A;  5HDN A;  3ECO A;  1ODD A;  4FX0 A;  3FMQ A;  2IT0 A;  4M9S A;  1C0W A;  1B59 A;  1YTY A;  3DP7 A;  3VOE A;  1FBQ A;  1YS6 A;  3ZMZ A;  4ESJ A;  2EFW A;  3J81 Z;  5TRD A;  2A3S A;  1KGS A;  3HHG A;  1W5S A;  2Y0M A;  4U0W A;  3RIR A;  4K2E A;  1H9G A;  1KU7 A;  3P9K A;  1JE8 A;  1QBJ A;  4Y15 A;  3GFM A;  1XGO A;  4I7H A;  5FFZ A;  4AIK A;  1BIA A;  1IW7 F;  2J5P A;  4BXU A;  2QQA A;  4I0B A;  1ULY A;  3ISP A;  4A5M A;  1O3R A;  4TV7 A;  3CUQ A;  1I27 A;  5LLQ A;  3CUQ C;  4AIH A;  2ZBK A;  2IRF G;  2D1H A;  1T39 A;  1R00 A;  1JHH A;  3GX4 X;  1XMK A;  1PP8 F;  1KA8 A;  1XB4 A;  1V4R A;  3DEU A;  3WGI A;  5DCM A;  2EA2 A;  2XGX A;  4BHC A;  3WTZ A;  5CLS A;  1R5G A;  3H3U A;  4RB2 C;  2ESH A;  2F2E A;  3ABU A;  2EV6 A;  3L09 A;  4OIQ F;  1IN4 A;  5BPI A;  3V8L A;  4KT5 C;  1MDM A;  3DPT A;  2M5W A;  5LEJ A;  4O3M A;  5KVR A;  3RTR A;  4WWC A;  4ZH4 F;  2HOE A;  4A0Y A;  4AVP A;  2P6S A;  4KIC A;  4G7Z F;  1QGP A;  2GXG A;  3J7A O;  2JRT A;  1U78 A;  3FXR A;  2PMU A;  1YLF A;  2K86 A;  1GXP A;  4UV8 A;  1MJA A;  1O7F A;  4EM0 B;  3ML6 A;  1BJA A;  4PZJ A;  3R0A A;  5LGN A;  2MLG A;  4GYI A;  2HDC A;  3F72 A;  4A6D A;  1SD7 A;  2CQK A;  4P5O A;  2UXX A;  4DQ2 A;  1ZRD A;  4HF2 A;  4WXH A;  2VBZ A;  4LG0 B;  4XBF A;  2HKX A;  3NRV A;  3BJO A;  1U6G A;  3BDD A;  3M1E A;  4I98 B;  4RGU A;  4G6Q A;  4NHJ A;  1HBX G;  3ROU A;  2VOD A;  2XIG A;  2HYF A;  2C6Y A;  4FHT A;  4M72 A;  3ZMT A;  4WX9 A;  1PUE E;  2FXA A;  3JTG A;  3V8J A;  2ZNY A;  3WE3 A;  2RVC A;  1MJ9 A;  2VC1 A;  5ILU A;  4KFC A;  2ETH A;  2J5O A;  2XUB A;  1ZG1 A;  3P9I A;  1YS7 A;  1P92 A;  5BMZ A;  2R3S A;  2ZME A;  1RUO A;  2XAQ A;  4KMF A;  2LF7 A;  3F3X A;  1P2F A;  2HZT A;  2R7D A;  1R36 A;  2PBI A;  3L7W A;  5L3C A;  3HRT A;  2DPU A;  3JAM Z;  3IRQ A;  2F5E A;  1K78 B;  3LQR A;  3KE2 A;  1T98 A;  2YX7 A;  1S7A A;  2EJR A;  2MC3 A;  4ENN A;  4L9N A;  4A5N A;  1CF7 A;  1K79 A;  3CUO A;  4BQA A;  3DXJ F;  1IN8 A;  2X4H A;  4EJV A;  3J80 K;  4ZYH A;  1RIO H;  3LWF A;  3BJA A;  1Z6T A;  2G7U A;  4L5J A;  3V7R A;  4QWQ A;  2W25 A;  2UZK A;  2XRN A;  3TGN A;  1H0M A;  5H6R A;  1UHW A;  2EFP A;  1RUN A;  1IN6 A;  3T8T A;  3DQV C;  3E5Q A;  3SXY A;  1BC8 C;  3VFZ A;  2JPB A;  1MKM A;  2COM A;  3BPV A;  2D2W A;  3V8K A;  3JTH A;  3K1N A;  5HLI A;  2MD5 A;  1FNN A;  2V79 A;  2GA1 A;  2EK5 A;  1O7L A;  4OIP F;  4EJW A;  1ZHF A;  3HSR A;  3J81 K;  1U5T A;  2FBK A;  4ENM A;  1U2W A;  2YSR A;  2XAS A;  2A6H F;  4I02 A;  1MJB A;  1U5T C;  2O8X A;  2KIM A;  1HKT A;  3OV8 A;  4FX4 A;  1AOY A;  1FP2 A;  3TOA A;  5DUK A;  2QVO A;  4PDK A;  2M30 A;  3HSE A;  5HLH A;  4UXN A;  3WU0 A;  5LHG A;  4KUM A;  1MGT A;  5CVR A;  4OIR F;  5D4S A;  3F8F A;  1EH7 A;  1KQ9 A;  2MLK A;  1FSE A;  3TO9 A;  4RGX A;  5D8L B;  2RDP A;  3HRM A;  1WWX A;  3W6K B;  3T1B A;  2QYO A;  2VN2 A;  3WU1 B;  4NB5 A;  3U9G A;  2M45 A;  1R58 A;  2P5V A;  2P8T A;  5D5V B;  3MZH A;  3KCC A;  2DTR A;  4O5V A;  3ZMU A;  4YIF A;  3RJP A;  4KMU X;  2VBW A;  1OKR A;  4CYD A;  4HV5 A;  1Z6R A;  2XKP A;  3HRS A;  3DPL C;  3VOD A;  2H6B A;  3GXO A;  4G7H F;  3I54 A;  4IRH A;  2HTS A;  3EYY A;  2IA0 A;  2O0Y A;  4U0V A;  4M9Z A;  2HQN A;  5FLX K;  1TQM A;  1FLI A;  2XRO A;  5E8I A;  4HF1 A;  2E7W A;  3R4K A;  2DU9 A;  4EV0 A;  1FYL A;  3V4G A;  1IF1 A;  5FD6 A;  4P96 A;  3MWM A;  4YII A;  5H6Q A;  3FMR A;  3HOS A;  4BAY A;  3FX3 A;  3K69 A;  4ETS A;  3H92 A;  2W84 A;  3EYI A;  2NNN A;  4EGY A;  2L01 A;  2GIV A;  3N4M A;  1W5T A;  3E6D A;  5JI6 A;  1A04 A;  1ZAR A;  3S2W A;  1QO0 D;  4UV9 A;  3AAF A;  2GAU A;  3L9F A;  2FA5 A;  2HFH A;  2FSW A;  3LAP A;  2LNB A;  3GO5 A;  4I0A A;  3U1D A;  4BH9 A;  1UCR A;  2DQL A;  2FMY A;  4CDG A;  1FSH A;  5J8C A;  3QPT A;  2JSC A;  1HW2 A;  1EH8 A;  2XHK A;  2OQR A;  2ZFW A;  2R7F A;  2X0L A;  2PJP A;  2V6C A;  1MZB A;  3QU3 A;  5DYM A;  5AIP A;  1F4K A;  3E6C C;  4A0Z A;  2Z9O A;  2QQ9 A;  1O3T A;  2ZNZ A;  4KIG A;  3JAM K;  4UVA A;  4YFK F;  5DDG A;  2KKO A;  3BPX A;  1SD4 A;  4MNU A;  5HS9 A;  1K78 A;  4MTD A;  3M8F A;  2QZ8 A;  3F6O A;  4M73 A;  1LVA A;  4ENK A;  3FXU A;  2VT2 A;  1FX7 A;  5JFR A;  2NYX A;  3TOB A;  3E3V A;  1KU9 A;  5LEK A; 
#chains in the Genus database with same CATH topology
 2R5Y B;  1WHU A;  5E1W A;  2M0M A;  1DU6 A;  2M87 A;  1JKO C;  1ON1 A;  4CCN A;  2V7F A;  3BC8 A;  3E5X A;  3ERM A;  3K10 A;  3PFI A;  2KJC A;  1AKH A;  4IF4 A;  3SHF A;  4JQF A;  3GTP J;  3B73 A;  2CG4 A;  1OFC X;  1RET A;  1XMX A;  3G3Z A;  2DFH A;  3OS2 A;  3QWL A;  4EM1 A;  4P9U A;  3QU6 A;  2VE9 A;  1B9N A;  1UJ8 A;  2YU3 A;  2W1O A;  2V26 A;  2KDO A;  4XM3 A;  4RAY A;  1SAN A;  2O03 A;  5LRR A;  2GM4 A;  1TW3 A;  4Y17 A;  1S29 A;  2W24 A;  1LE8 B;  1Z67 A;  3WHB A;  3E0J B;  1PUF B;  4HX8 A;  2E36 A;  2XV4 S;  2MGQ A;  5ICE A;  2L02 A;  3FIW A;  4R1H A;  2XAF A;  2DFE A;  1OPC A;  2EB7 A;  2P81 A;  2VT3 A;  3GFL A;  4RS8 A;  1X2M A;  3G73 A;  3LQQ A;  4BHB A;  2X1C A;  3JRH A;  3O6B B;  3OYJ A;  3RCO A;  2A61 A;  1N77 A;  2DMT A;  2YR2 A;  5HS7 A;  2QQB A;  3W2V A;  2Y0S N;  3ZP5 A;  1SFU A;  4A93 J;  3JRD A;  2D1V A;  4FE7 A;  2DW4 A;  4UHT A;  4F91 B;  3RKQ A;  1JKR C;  4WK8 F;  2R7Q A;  5FO5 A;  3SYT A;  2V1N A;  2QWW A;  4EM2 A;  2MH9 A;  1Z05 A;  4KT6 A;  1MSF C;  1T38 A;  4I6Z A;  2HU9 A;  1WSU A;  2ZJR F;  4AM3 A;  1WCM J;  3NWT A;  2A07 F;  3SDG A;  3WTY C;  1STZ A;  5DD4 A;  4ZYE A;  5DUI A;  2HKO A;  1W36 D;  4BNC A;  5IT9 Z;  5E17 F;  3ZMD A;  1R1T A;  1I6X A;  1AHD P;  3FM5 A;  1ETX A;  2P6T A;  3BOQ A;  1AWC A;  1LDD A;  3KP4 A;  1A31 A;  3CCU I;  1LEB A;  2EA4 A;  3V42 A;  1KQ0 A;  5K7Z A;  4CGZ A;  1VI0 A;  4NC6 A;  2BY3 A;  4ZC3 A;  4I76 A;  4A0X A;  1LFP A;  1U9N A;  2M8E A;  3GLX A;  3TED A;  1XN7 A;  2ESN A;  3I58 A;  3MQ0 A;  2NNY A;  3S1N J;  1K61 A;  1IN5 A;  4Y13 A;  3OYL A;  2F5F A;  1IZ1 A;  4X6A J;  4LB6 B;  2KT0 A;  5ILV A;  2UV1 A;  4RLQ A;  4OOI A;  4BXF A;  5DEQ A;  4BAC A;  1X1D A;  2K27 A;  2FD5 A;  2KDZ A;  2HPM A;  1RNL A;  6PAX A;  2FOK A;  1OCR H;  1BI0 A;  2UXN A;  3ZCO A;  4PGH A;  2NS7 A;  1D3Y A;  1S3J A;  1KU2 A;  1Z91 A;  3E97 A;  1OLT A;  2CUE A;  1I5Z A;  2DT7 B;  5EEA A;  2OC6 A;  1K4T A;  5E18 F;  5LBQ A;  4JX6 A;  3SFZ A;  1FP1 D;  3CDH A;  4PSW A;  4A12 A;  2G7H A;  4N0B A;  4RAZ A;  1WRJ A;  3OYH A;  1S7O A;  4ON0 A;  1RRJ A;  4B48 A;  2R7R A;  4RA2 A;  1R22 A;  3F6V A;  1NK3 P;  2B0L A;  3OYC A;  4UB8 C;  3CDI A;  3FBI B;  3GFI A;  3VDX A;  1P4A A;  2LFB A;  3I64 A;  3KLN A;  2ME0 A;  5E3O A;  1SFK A;  3G2B A;  3KIO A;  3DF8 A;  1VQN I;  1T6S A;  2Y48 A;  5D8K B;  1D5V A;  2QA4 I;  2YX4 A;  3LA2 A;  1I1G A;  4GYG A;  2BXZ A;  3AL0 C;  1GDT A;  2GLO A;  1MBJ A;  1XMA A;  3FBN B;  3OYK A;  2O5R A;  1BN5 A;  3N97 A;  2VKH A;  3HOY J;  3OYM A;  1JXS A;  3CLO A;  4U88 A;  4Y4R A;  2EFN A;  3S16 J;  2OAZ A;  4IL6 C;  4E7S A;  1NTC A;  5DM6 F;  5FLX Z;  3OYG A;  3KP7 A;  2OD5 A;  4A69 C;  4BE2 A;  1E17 A;  2VUM J;  4IQ4 A;  2OZ6 A;  3Q0W A;  2PQ8 A;  4LK1 F;  1OYI A;  2IEK A;  2WY7 Q;  2A05 A;  1D1B A;  2ICW G;  2QF7 A;  4A3C J;  2K85 A;  4R79 A;  3OYE A;  1YW7 A;  1DP7 P;  2OBP A;  2JTV A;  3MFK A;  3I53 A;  5EEH A;  4AWX B;  3IAS 2;  2I8D A;  5J6X A;  5FFX A;  1T2K A;  5E1X A;  3QOD A;  2NVX J;  2L7K A;  1F9N A;  3H36 A;  3RI4 A;  1NH3 A;  2XF5 A;  4WF2 A;  1G3T A;  2BEO A;  2LDU A;  3GCM A;  3DLL F;  1S7E A;  3EQL F;  3TO7 A;  1YIT I;  2JA2 A;  1ZRF A;  1USS A;  3TDZ C;  3MZY A;  1Y56 A;  2PMZ A;  1G6N A;  3Q3S A;  3R60 A;  2DMU A;  2MFZ A;  5C3E J;  1TZL A;  2WB1 A;  2BOL A;  2NOG A;  2EPF A;  3I3L A;  4DYC A;  2K9L A;  4CXF A;  1G4D A;  1VQL I;  3PM1 A;  3TW6 A;  3BJ6 A;  1YX5 A;  5IOY A;  4FAS D;  3WTT C;  4YIR X;  1UHM A;  2L5Q A;  3ULQ B;  3OSG A;  4L9J A;  4L0Y B;  1OCT C;  4XLP F;  3BQY A;  3AG4 H;  5ICF A;  4XN3 A;  5FB2 A;  2VON A;  1EA3 A;  1MMD A;  5FKN A;  1BIB A;  1WJ5 A;  3MZ8 A;  2F5C A;  4JYK A;  5F0C A;  2R93 J;  3HJE A;  1TW2 A;  3QRF F;  2QBY B;  3E6B A;  4L9V A;  1PP7 U;  1R23 A;  2DI3 A;  2L9S A;  4OMY A;  4BU2 A;  2CQX A;  2PEX A;  3ELK A;  3PNT A;  4BE1 A;  2BE5 F;  2NVQ J;  3S1R J;  5J3L A;  1GXQ A;  2WTE A;  5LHH A;  1F43 A;  4XLC A;  2HYJ A;  2CFX A;  2E7X A;  4IO9 F;  5F0H A;  2DFF A;  2OCE A;  4HOB A;  4IQJ A;  5H20 A;  1MH4 A;  3RKX A;  1WKM A;  2VJ5 A;  3K1M A;  3S3O A;  3EUK L;  3H5N A;  4E7I A;  4QIW N;  3K4C A;  4I01 A;  3SZT A;  2KHM A;  2ZXH A;  3FWE A;  3LSP A;  1DDN A;  1QZY A;  4HPQ A;  3RPQ A;  1LJ9 A;  1BC7 C;  3PFY A;  3PUB A;  5CYV A;  2GXA A;  1B1B A;  2HOT A;  3W6V A;  5E1Z B;  2V9V A;  1W7P B;  2RNJ A;  5M5W J;  2E71 A;  3P7N A;  4CYC B;  3I59 A;  2FEZ A;  1QZZ A;  5HVQ C;  3MAJ A;  2MYS A;  5FKL A;  1VQ9 I;  1HA8 A;  2Z99 A;  4HX4 A;  1FTT A;  3FM3 A;  2LKP A;  2STT A;  1DUX C;  2JRM A;  2QUF A;  3WG9 A;  1ZG5 A;  3F23 A;  1R5I D;  3IUO A;  4HDU A;  2IPQ X;  4XSZ F;  4A2U A;  3CCR I;  4BXX J;  3QYB A;  2QEX I;  2VPR A;  5J4Y A;  1PJR A;  1IO2 A;  1D1A A;  1K6O A;  2ZKZ A;  3K4M A;  2F4M B;  4HAM A;  2R0Q C;  5IOZ A;  3QOP A;  2WV1 A;  1WJD A;  4D1Q A;  5AON A;  2ISY A;  3CP2 A;  3J7Y J;  2DA4 A;  1J7K A;  2KIQ A;  4MEY F;  3ZQI A;  3A03 A;  4DGW B;  4ZTJ A;  5HS8 A;  1P4W A;  3GTK J;  3X2Q H;  1BM9 A;  4XKB A;  2XAJ A;  4UUS B;  3S14 J;  4DZP A;  2YPR A;  3O2P E;  1SC7 A;  3FHN A;  2X48 A;  4JX4 A;  4ENJ A;  5ICC A;  2WY8 Q;  3LA7 A;  3GF2 A;  3OYD A;  2R5Y A;  4IOC F;  1ZYR F;  2M8G X;  1ETV A;  4PCQ A;  5F1R A;  4LFU A;  2L7F P;  5FKM A;  5JR3 A;  2PX9 A;  4U0Y A;  3AG1 H;  1D0Y A;  3K4J A;  1V54 H;  1ZK8 A;  2V1D A;  1D0X A;  3M4O J;  2IS2 A;  2H94 A;  3OWT A;  4CA0 A;  1XDU A;  1S6L A;  4FCY A;  3HGG A;  3RDI A;  3ASO H;  4G94 A;  4U87 A;  1P4X A;  4P9F A;  2OA4 A;  3RQ4 A;  2P7C B;  2QLZ A;  5BNG A;  4A6E A;  2KQR A;  2MC4 A;  1LE8 A;  5M3M J;  3IL2 A;  2CV1 A;  3RYP A;  1V55 H;  1YFH A;  4IHW A;  4QSH A;  4KIF A;  4RGS A;  4ZYD A;  3RSN A;  1F5T A;  2EZI A;  3VSK A;  3AKZ A;  2ZXW H;  3F8N A;  5F6F A;  2PI0 A;  3KYL A;  2DQR A;  3WOD F;  4CHU A;  1MND A;  2CYY A;  1W5C C;  3SQN A;  3HYI A;  3O3K A;  2JZY A;  3A1Y A;  2DTZ A;  2Z3Y A;  3CUQ B;  4EJO A;  1E2X A;  3CCJ I;  1OR7 A;  1MMA A;  1LEA A;  2O3F A;  4CCL A;  5L3B A;  5IT9 K;  2JSP A;  4BL0 B;  2Z2S B;  1HQC A;  3BT9 A;  2LMD A;  3H9Q A;  1VTN C;  3GWZ A;  1A6Q A;  1OR7 C;  1BI2 A;  2EZL A;  1ZGA A;  1GUU A;  3K4B A;  5EJC A;  3GFJ A;  5DM7 F;  1VQP I;  3Q0U A;  3BP8 A;  3TDU C;  1BR4 A;  2A69 F;  2EBI A;  3DTK A;  3IAM 2;  2R7V A;  4Q47 A;  4L0Z B;  2ECC A;  2QM3 A;  2Y30 A;  1A5J A;  5D6F A;  3PIO F;  1W4M A;  1IN7 A;  2NAZ A;  4B1R A;  3K7A J;  2E1C A;  2BY0 A;  3MCZ A;  5FJ8 J;  1ZGW A;  2WAQ A;  4BE0 A;  5HNH A;  2A6E F;  2KRF A;  3HEF A;  4PJ0 C;  2KRH A;  2VE8 A;  2ISZ A;  2XF7 A;  1FJL A;  3HGY A;  3HKZ A;  3OR1 C;  4DW6 A;  4A3K J;  1VF9 A;  1HKQ A;  1JKP C;  1YW8 A;  2VC0 A;  3CO7 C;  2K5C A;  4HYE A;  4BUP A;  2UWM A;  4PFP A;  1OQY A;  2JN6 A;  5LFA A;  2BYV E;  2HXI A;  1HLV A;  3PUF A;  3S3N A;  1MDM B;  4ZYG A;  1K4S A;  2Z16 A;  3TKY A;  3BR2 A;  3K70 D;  3M7G A;  5K5R A;  3HBL A;  4AYB A;  2ZSH B;  5TJJ A;  2DDB A;  1ORK A;  4RAG A;  4WXD A;  3HOW J;  3WE2 A;  2L9R A;  1X4P A;  4Y52 J;  1YOV B;  2F5D A;  5IY5 H;  3R0J A;  2K40 A;  4EMS A;  3COA C;  2LY2 A;  3SZP A;  4KNY A;  1IRZ A;  5EEG A;  2K4J A;  2E5Z A;  1ZLJ A;  5HDG A;  4CZZ A;  3WTW C;  5D6E A;  4CO8 A;  3ZRG A;  3Q5F A;  4N9I A;  5HDK A;  3KPH A;  2VBY A;  3LNQ A;  5B5E C;  3FDY A;  3CTA A;  2IXS A;  5JLX A;  4V19 K;  3A0B C;  4HDV A;  3JCU C;  3GTO J;  3H9J A;  4Q48 A;  2LKX A;  2L7Z A;  2ELK A;  3CJQ B;  2K02 A;  3KP6 A;  3L2Q A;  1Z7L A;  3F22 A;  4XOR A;  3CC7 I;  2E5N A;  2R4G A;  4MHG A;  4GDF A;  3C18 A;  3JW4 A;  4AD9 A;  3HC7 A;  5K5O A;  2DO7 A;  3PSI A;  4RAF A;  4RDU A;  2JVH A;  1KYZ A;  3H3Z A;  3B02 A;  2G0E A;  4B3A A;  3I5U A;  2R7Z J;  1IDZ A;  1VQM I;  5EZH A;  1Z1D A;  3VYR B;  1P6R A;  2DFI A;  4UVB A;  5GTI C;  5KK1 A;  1SVM A;  3FMS A;  2YU9 J;  3LFU A;  1SVL A;  3G71 I;  5HNF A;  3K2Z A;  2BY2 A;  4ZZL A;  4HSR A;  3O8G A;  2ZXJ A;  4HG2 A;  4AC0 A;  2X9D A;  1QPM A;  5B1A H;  2OJE D;  2XAH A;  3KEQ A;  1TP4 A;  4LG0 A;  2KIU A;  4H4K C;  3A0H C;  1SAU A;  2W7N A;  2DCE A;  2LOO A;  3DKW A;  3OMY A;  1IAW A;  3HRU A;  4ESB A;  2IA2 A;  2XGD A;  3IP4 B;  2BBY A;  3G1M A;  2DK8 A;  1RI7 A;  3WGH A;  1EH6 A;  1G3Y A;  1GV2 A;  4KIB A;  1HDD C;  1HOM A;  1QU3 A;  4AIJ A;  4EJU A;  2X51 A;  5B3S H;  1O57 A;  4HX7 A;  3C2H A;  2BGC A;  3DEW A;  5D5U B;  3F21 A;  2WC2 A;  4QLC U;  1K7A A;  2QBY A;  3Q9S A;  2JPC A;  3JRG A;  1FC3 A;  4LOC A;  4S04 A;  4GXO A;  4V2G A;  3S32 A;  3TL4 X;  2NVU B;  2HEO A;  1O3Q A;  2F6C A;  2ZME B;  2MH2 A;  3S2H J;  2TDX A;  2IGN A;  1OYW A;  3P9C A;  1FEX A;  5JHU A;  1ZQ3 P;  1B72 B;  2ADU A;  4XMY A;  2QCO A;  3ZQG A;  2IGO A;  3K4L A;  2BV6 A;  3CMY A;  1W36 C;  2XAG A;  2Y31 A;  3MVP A;  3ZQ7 A;  3VPR A;  5EDN A;  3KFW X;  2VIX A;  3H35 A;  3C1D A;  2DAO A;  2CO5 A;  2RN7 A;  1WZ2 A;  4UVC A;  4KA4 A;  4J01 A;  1W7P A;  4BS9 A;  5HLG A;  1I1S A;  1SFE A;  4KN4 X;  1L0O C;  2W57 A;  4CYC A;  3CF2 A;  2R7W A;  3BTI A;  4PJL A;  3SEQ A;  2VJ4 A;  3OYB A;  1WPK A;  5DV5 A;  4WCG A;  1QPI A;  3LA3 A;  4FIS A;  1TBX A;  4C3J J;  1YYV A;  5F1J A;  5LRS A;  1BL0 A;  2VKE A;  3FZV A;  1XSV A;  5L3E A;  4EEF G;  2GQQ A;  3C3W A;  2MBF A;  5FRM A;  3D5R C;  4Z6Y A;  3ABM H;  1APL C;  1MH3 A;  3GW2 A;  1WJB A;  2PLY A;  2IJL A;  3CQZ J;  4BQO A;  1BBY A;  4XNF A;  5DCF A;  2AXL A;  4LG3 A;  4BBS J;  4G6T B;  1REP C;  2CWE A;  2XPV A;  3J7A Y;  1G8X A;  4FT8 A;  3JRE A;  5A2Q Z;  3TO6 A;  3AG2 H;  3HOX J;  3BR3 A;  4GO1 A;  3IWZ A;  1VND A;  1U3E M;  1N25 A;  4LIV A;  2Q8K A;  1NG6 A;  2Y9Z A;  4L18 B;  5K7F A;  2DDA A;  4I2O A;  2MG4 A;  2CQN A;  4UUS A;  2FOW A;  2CQ7 A;  2X1D A;  4HNT A;  2DBB A;  5JVT A;  4BJ6 C;  1Z21 A;  2ZC2 A;  3MEX A;  1FZP B;  4UNO A;  5C44 J;  4I09 A;  1ETQ A;  1SMY F;  3DPU A;  2DK5 A;  4HLY A;  1RKW A;  1BI3 A;  2F4O B;  4XN0 A;  1B6A A;  5D5W B;  3F0C A;  2CSO A;  1A35 A;  3Q9V A;  3IRR A;  2GWR A;  1U5T B;  1ZN2 A;  2PJR A;  2L4M A;  2RQP A;  3PIP F;  3VWB A;  2KFD A;  3HOT A;  3KP5 A;  1BR1 A;  1FMV A;  3ZOB A;  1R71 A;  1BI1 A;  1J75 A;  1QQI A;  2M7A A;  2K7L A;  2DA3 A;  3OL4 A;  2NXN B;  3S8P A;  2M0C A;  4HQE A;  5E3M A;  5K1Y A;  1ZRC A;  2Q0O A;  1T95 A;  5IYB J;  2W82 A;  2CFO A;  3K9T A;  1Q1H A;  1TNS A;  4UUV A;  1HST A;  4KYW A;  4JX5 A;  1UB9 A;  4Q5S F;  3U2R A;  3I0T A;  2CUJ A;  2W85 A;  1XSD A;  2KL4 A;  3I55 I;  2ACJ A;  1ZR4 A;  2EV0 A;  4IHV A;  2PG4 A;  2JUC A;  4OIO F;  3IHU A;  4U7B A;  3OIQ A;  5BQT A;  1MW7 A;  4B44 A;  3GLL A;  4CIC A;  1TLH B;  1W7P D;  1JGG A;  3ZQQ A;  1ERD A;  4RB1 A;  3K1P A;  4EVI A;  1GVJ A;  2E34 A;  3LSK A;  1Z0X A;  3FXM A;  3OIO A;  1JT0 A;  4R8H A;  2CGP A;  5DD8 A;  2M7B A;  1GHC A;  1MBK A;  5CJ9 A;  4C30 A;  2CS3 A;  4GFB A;  1VQ6 I;  4YFN F;  3W6J B;  2LR8 A;  4HBL A;  3VYS B;  2PMH A;  2H27 A;  3HUG B;  4M9X A;  4PGG A;  2OQG A;  1LPQ A;  1A6I A;  1JGS A;  4CZC A;  2HR3 A;  1Q1V A;  2R7T A;  3DWL E;  2LYC A;  1TQP A;  1J09 A;  1W1W E;  1SFX A;  3DV8 A;  4P55 A;  2EV5 A;  2NRA C;  3IC7 A;  2RV8 A;  3BG7 A;  1PDN C;  3GTQ J;  3SZG A;  2E2H J;  4L5I A;  5J1Y A;  2JQ7 A;  3TBI A;  2LLK A;  4N4N B;  1JUS A;  5CVU A;  5EF6 A;  2X6Y A;  3OIP A;  2FBH A;  1WJA A;  5GAG J;  2CW7 A;  2JA6 J;  4GRI A;  2CRG A;  3ZQC A;  2B7E A;  1FOX A;  3D0S A;  3KZY A;  5BPD A;  2GXB A;  1WI9 A;  4MFE A;  4GCV A;  1ON2 A;  3JRI A;  4EQQ A;  4OIN F;  3E5U A;  2P4W A;  3SEZ A;  3AG3 H;  1LUJ B;  2IS6 A;  2NVY J;  1J2X A;  5HLT A;  1R1V A;  2DJN A;  1Y1W J;  2FBI A;  1Y0U A;  5L3D A;  1G3W A;  2LY9 A;  3TW7 A;  2V1X A;  4LLL A;  5LGT A;  4UY8 I;  2CH0 A;  1UZC A;  1RES A;  1TWF J;  3QP6 A;  3VSL A;  1U0J A;  5GAH J;  3GZ6 A;  1I6H J;  3EDP A;  4HZF A;  3KLO A;  4C2U A;  4IZZ A;  2AS5 F;  2OV7 A;  3F8B A;  2QQ8 A;  4E7H A;  2E1M B;  1JI8 A;  5LD2 C;  4XLN F;  5E20 A;  4IJA A;  1YJW I;  4MTE A;  4BY7 J;  5BS6 A;  1VQK I;  2VXZ A;  3LST A;  2HI3 A;  4AVZ A;  1T0F A;  3E6M A;  1YO5 C;  2EIJ H;  3CJT B;  2GZW A;  3LFK A;  1DPU A;  1T0F C;  4XRS A;  4EGZ A;  4NQW B;  3D1N I;  4BQN A;  1ETY A;  3NEU A;  3DFG A;  2PFB A;  1TNT A;  3JRB A;  3RKY A;  2K3F A;  5EGO B;  5ERI A;  2HOS A;  4G8X A;  2CUZ A;  1XX5 A;  3WHC A;  2M9H A;  5DS9 A;  1FTZ A;  2EIN H;  2IA1 A;  1ONV A;  1WJE A;  1X1B A;  3L00 A;  1QNT A;  2O7O A;  2VAS A;  2Q2E B;  2QSH X;  4G7O F;  1X4O A;  5C4X J;  2WAF A;  4U7D A;  1SD5 A;  1LDJ A;  3G1L A;  5F64 A;  4ESF A;  1D8J A;  2LTP A;  1OMI A;  2RGV A;  3H9G A;  3GUD A;  1XGS A;  1B4A A;  3KP3 A;  3CO6 C;  1B8I A;  3R6S A;  1MIJ A;  2M4G A;  1IRF A;  1R5H A;  1YE9 A;  5EZG A;  4JBA A;  1HW5 A;  4YG2 F;  1E0E A;  2UUZ A;  1ZG3 A;  2ELH A;  3DLA A;  2XAU A;  3REO A;  1YQA A;  4MQ9 F;  4GGG A;  2DXI A;  1K83 J;  3BLY A;  3DEE A;  3JRF A;  4XRF A;  1HXD A;  3G4S I;  5L3F A;  1FYK A;  5E8G A;  1FT9 A;  4BYY A;  4FTH A;  3VB2 A;  3HOV J;  1XSX A;  2HGC A;  4ASN A;  4PJM A;  2Z1D A;  3LAJ A;  4XID A;  1YHQ I;  2HDD A;  2HVR A;  4BEH B;  2DPD A;  2FNA A;  4MQV A;  2BW3 B;  2KPM A;  5EG0 B;  2P5L C;  2CU7 A;  3NAU A;  1HW1 A;  4A3J J;  1FYM A;  5L3G A;  1RC9 A;  3K0L A;  1TT0 A;  1Z7U A;  2HYG D;  3PQJ A;  5KAF C;  2ZO4 A;  4KN7 X;  3GEZ A;  4II3 A;  1Y39 A;  3IH4 A;  4F3Q A;  2CUF A;  3ZN0 A;  1FPQ A;  3H5A A;  4ANJ A;  5KNL A;  2HZD A;  2AXT C;  1JUM A;  1KU3 A;  1IV6 A;  4XLA A;  2DA2 A;  1X19 A;  4L9T A;  1YJ9 I;  3HOZ J;  3V7S A;  4XLH A;  3CCQ I;  4XSX F;  5BOX A;  1YIJ I;  2OPT A;  3I4P A;  2PMZ N;  4M3B A;  1B72 A;  5HOO A;  2KIF A;  1UFM A;  1TQI A;  1ETK A;  1MMG A;  1IXS B;  1X3Z B;  2DT5 A;  5FD5 A;  2H09 A;  2WB1 N;  3LOC A;  2JWT A;  3DBR B;  2FQ3 A;  1QVT A;  2VJJ A;  2I10 A;  3W2W A;  2COB A;  4OMZ A;  2DLL A;  2HWV A;  3ZGK A;  3CCL I;  4IXA A;  1J59 A;  3K4N A;  1FOK A;  2ZSI B;  3QAH A;  4B8X A;  2BHY A;  2XSJ C;  4LD5 A;  4RM3 A;  4G9Y A;  1IXR C;  1QHG A;  2QSF X;  4JP0 A;  3BTJ A;  4LLG F;  3O8H A;  4H0E A;  3TQN A;  5KAI C;  2B63 J;  1S8N A;  5F08 A;  4DBQ A;  4M74 A;  2XSD C;  1J0R A;  4CH7 A;  5B1B H;  5J8F A;  5TIS C;  3WTS C;  2HQR A;  3BY6 A;  3QQA A;  4BDY A;  2QEN A;  4AU7 A;  1AKH B;  3K70 C;  2GA2 A;  5A2Q K;  2DA5 A;  2CJJ A;  2R7O A;  2W00 A;  2HTJ A;  5GP9 A;  1DPR A;  3FIS A;  2CMP A;  1JHF A;  3GVA A;  1K6Y A;  3ERE D;  2OZU A;  3ONQ A;  4IOA F;  3I71 A;  3KP2 A;  3MKL A;  2DYR H;  1X2N A;  2VOO A;  3MMY B;  3CJN A;  4B09 A;  2V9P A;  1IC8 A;  4LLN A;  4M71 A;  2N8G A;  2WV0 A;  2K9S A;  3RKW A;  3LSI A;  3OYI A;  1YX3 A;  2WWY A;  1UST A;  2KJB A;  2E2J J;  2KZV A;  1GV5 A;  2Y2Z A;  2CQQ A;  4BGD A;  2PN6 A;  2STW A;  5LGU A;  1MMS A;  4D0P A;  4N9H A;  2XVC A;  1FY7 A;  5KHD A;  1G59 A;  1PUF A;  1IJW C;  1WQ2 A;  4XR6 A;  4IRG A;  4AUX A;  2VQG A;  4WXC A;  4DNC A;  4IRI A;  2JT1 A;  2Y75 A;  4MEX F;  2EFO A;  1DU0 A;  1SAX A;  4E70 A;  4XK4 A;  3JSO A;  1ETW A;  3WTU C;  3S2D J;  1R4M B;  2LVS A;  2Y69 H;  1TWH J;  1FBS A;  1MNE A;  4YFX F;  3CP8 A;  1JTX A;  2E60 A;  2EZK A;  3OR2 C;  1IXC A;  1IUY A;  3A02 A;  3HHH A;  4OU0 A;  4XKV A;  2LD5 A;  2CV0 A;  1XG1 A;  3B6C A;  2EIM H;  2M34 A;  2IGK A;  2H8R A;  3S1Q J;  2GBY A;  2D45 A;  3H0D A;  3IWF A;  1OYY A;  4OAY A;  1TL8 A;  5FGM A;  4G6D A;  3RYR A;  3PL8 A;  4M6Y A;  1MBF A;  3S17 J;  3TMO A;  2ZXI A;  5D4R A;  1HKS A;  1LDK B;  3NAR A;  3NQO A;  1IRG A;  2IW5 A;  5CVI A;  1R1U A;  4DOZ A;  1JT6 A;  2K4B A;  5DCM B;  2LH9 A;  1F1Z A;  1SMT A;  3HB9 A;  1P9Q C;  4XKW A;  5E79 C;  5CKT A;  3TP3 A;  3VYT B;  3S93 A;  4UB6 C;  2DA1 A;  3ZPL A;  5CVJ A;  5J4V A;  4LGW A;  4P1W A;  2ZFU A;  4ZDP A;  1HF0 A;  1XTA A;  1JJ8 C;  3GYH X;  4HQM A;  4Q4Z F;  1QRY A;  2H1L A;  3IKT A;  3ABL H;  1HSJ A;  3HUG A;  3UR3 C;  2M3A A;  1UG0 A;  3N05 A;  5FRO A;  4CCJ A;  3L2C A;  2L54 A;  4NC7 A;  2XKO A;  3F8C A;  3U21 A;  1ZLK A;  4LMY A;  4W1U A;  1FBU A;  2MA3 A;  5IP6 A;  2XC7 A;  1BW5 A;  1V3F A;  2BXY A;  5FKO A;  2IBD A;  2NS0 A;  3QPH A;  4N4O B;  2RKH A;  4S05 A;  1RKT A;  4ZDL A;  1WI3 A;  4KJZ A;  3AL0 B;  1G3S A;  2EFQ A;  1T56 A;  4MGR A;  4C3H J;  3R61 A;  4HW0 A;  1S72 I;  1J5Y A;  4B4C A;  1LB2 A;  4BKX A;  4HF0 A;  3KEO A;  3PQK A;  5IT3 A;  3SJM A;  1ZGJ A;  1T33 A;  3KET A;  1ZAO A;  1YRN B;  2M1B A;  4LB5 A;  2EWN A;  2VOP A;  2OTJ I;  2FNP A;  2IP2 A;  1XGM A;  3U1K A;  4ZZD A;  1NHA A;  4ZJZ A;  5IP7 J;  2LBF B;  1MBG A;  5M5X J;  4F55 A;  1CGP A;  1VFC A;  1L3L A;  2V1U A;  2V9K A;  5DTD A;  3F8M A;  2X6O A;  4E7J A;  4IHS A;  4D7N A;  5JLW A;  1CQT A;  3BZ6 A;  4IHT A;  1U9O A;  4JK1 X;  3T0Y A;  2DYS H;  4F52 A;  1JJ6 C;  2P0W A;  3HIF A;  3K6G A;  3M8J A;  3ECH A;  4NUB A;  3FXQ A;  2KLO A;  5JHF A;  1ENH A;  2A68 F;  4LJZ F;  2FE3 A;  2HNH A;  3ABT A;  1XD7 A;  3IKV A;  3ZMV A;  1IRX A;  4G12 A;  2NVT J;  3ZMS A;  4KDP A;  2LY1 A;  4O6J A;  2A5Y B;  4IVN A;  5E3L A;  1NK2 P;  3C7J A;  3EET A;  3D5L A;  1XGN A;  4X1E A;  4NQW A;  1I3A A;  1XDS A;  1O3S A;  1DGR M;  1SD6 A;  4BHP A;  4PJJ A;  1MBE A;  3S1M J;  1FOW A;  5EGO A;  2P7V B;  3P5J A;  1ZH5 A;  3RQI A;  1Z9C A;  4XOT A;  1S5L C;  1R4N B;  3T8R A;  2CW0 F;  3UNG C;  2Q2E A;  5IPA A;  3GZ5 A;  1V5G A;  1U8R A;  1RZ4 A;  3OYA A;  3CMA I;  2KIS A;  2HOA A;  3FKJ A;  4C3I J;  1I39 A;  3RPU A;  2ZJ2 A;  1TTY A;  4XON A;  4E6K G;  4EJT A;  2QKL B;  3M07 A;  4E7Z A;  3QPS A;  3DCF A;  4RGR A;  3VEP A;  3J7Z I;  3BWG A;  3V7C A;  1BJZ A;  4A3E J;  2OTL I;  5ICG A;  1YIO A;  2L3D A;  1SFO J;  2OUM A;  1RR8 C;  2NOJ B;  1TC3 C;  3FF5 A;  4D5C A;  2WAD A;  2ZCW A;  3OY9 A;  3KYD B;  2AQE A;  2ECB A;  2FRH A;  5CVV A;  4F7Z A;  4XRM A;  2P5K A;  3GTM J;  1D8K A;  3ZQL A;  5AIQ A;  4RB3 C;  3FHZ A;  2O61 A;  4M6X A;  2RAE A;  2IVM A;  4IKF A;  1HDP A;  3EUH A;  1ZRE A;  5K5Q A;  4HLX A;  3HDD A;  3ZN1 A;  1R7J A;  3WTX C;  2XGE A;  3HSF A;  1EV7 A;  3L2R A;  3EUH C;  4BEH A;  2LF8 A;  2BW3 A;  3BZK A;  4HV6 A;  3I59 B;  2XPU A;  1BOA A;  2Z33 A;  3M8E A;  2R5Z B;  3WTV C;  2GOM A;  2LK2 A;  2VBX A;  3D5S C;  3M3Y J;  3BRO A;  2HDW A;  4Y33 A;  4EAT A;  5GPC A;  2JA7 J;  4B43 A;  2G9W A;  5ILS A;  2RQQ A;  4E4H A;  5LHI A;  1XCV A;  2Z5U A;  2ZJP F;  1Z3Y A;  4BJ5 C;  1IUF A;  3HTU A;  4LK0 F;  4RB0 A;  1H9T A;  3A2K A;  1X3U A;  4OWR B;  3H5R A;  3WGG A;  2Y0S A;  4QPQ A;  1CF7 B;  4X0G A;  1MD0 A;  4DYQ A;  3QP5 A;  1KQ8 A;  1YG2 A;  3QPL A;  4D5F A;  4HA8 A;  3KZZ A;  1NG7 A;  2XB5 A;  3H3V K;  5ED4 A;  3IV5 A;  1Y8Q B;  1YW9 A;  3L2W A;  1DQU A;  1QVU A;  3OOP A;  2O6G E;  5D5X B;  5HOD A;  4E7L A;  2JMW A;  2KMU A;  2L4A A;  3J80 Z;  1XCB A;  3ZQH A;  2FML A;  2I5U A;  1QHH D;  4Z2Y A;  3T5X A;  4NC8 A;  3JSP A;  2HS5 A;  3HOU J;  1B9M A;  2K9M A;  1KYW A;  1TWA J;  4IPA A;  2FU4 A;  2OU2 A;  2VQC A;  2FF4 A;  3M9A A;  3HTS B;  5IYD J;  2MSY A;  1LNW A;  1LQ1 A;  2H6C A;  5FLM J;  2E1N A;  3BCA A;  1FWZ A;  3CMM A;  3Q0V A;  1UAA A;  3CD6 I;  3A4C A;  1H89 C;  1WGX A;  4HEA 2;  3HXL A;  3CCM I;  1J9I A;  2LSO A;  3W3C A;  2RC4 A;  4E7K A;  5HDN A;  3PNV A;  3ECO A;  1IV8 A;  3RPU D;  3KYC B;  1ODD A;  4FX0 A;  3FMQ A;  1T8I A;  2VQL A;  4M9S A;  3SFI A;  1C0W A;  2IT0 A;  3I4M J;  5C4J J;  1ZTR A;  4CSW A;  1AU7 A;  2K9Q A;  3DKY A;  1B59 A;  1YTY A;  3DP7 A;  2ID3 A;  3VOE A;  1FBQ A;  1YS6 A;  1V5F A;  3ZMZ A;  1OCZ H;  1X58 A;  3LSM A;  1RPW A;  4B47 A;  4J00 A;  3BTL A;  4ESJ A;  2EFW A;  3CF5 F;  4DZJ A;  3J81 Z;  5TRD A;  2A3S A;  1KGS A;  4A3M J;  3IH3 A;  3HHG A;  2AHQ A;  1XPX A;  1W5S A;  2IS1 A;  2Y0M A;  4U0W A;  3RIR A;  4HRI A;  1IDY A;  4K2E A;  1W0T A;  2IAI A;  4C9Y A;  1H9G A;  4DIQ A;  2KZG A;  1KU7 A;  3FK7 A;  3I9V 2;  3K4K A;  4C2T A;  2WA0 A;  2HVQ A;  1M1E B;  3FKI J;  3P9K A;  1E3H A;  4XQF A;  1JE8 A;  2JUG A;  1QBJ A;  1T08 B;  3CLQ A;  4Y15 A;  3GFM A;  3DU5 A;  3JRC A;  1XGO A;  2EIL H;  4I7H A;  5FFZ A;  4AIK A;  3FXK A;  1BIA A;  1IW7 F;  1OCO H;  2J5P A;  2QQA A;  2HPI A;  4BXU A;  5CQE A;  4I0B A;  1ULY A;  5J40 A;  5KCM A;  3ISP A;  3DU6 A;  2DOD A;  4DJA A;  4A5M A;  1LVK A;  4RMN A;  1O3R A;  4TV7 A;  3CUQ A;  2H1K A;  1ETO A;  1YJN I;  3CC2 I;  3CC4 I;  1I27 A;  3VYU B;  5LLQ A;  3CUQ C;  5K7H A;  4AIH A;  3RZO J;  2ZBK A;  2IRF G;  2BZT A;  1PYV A;  5M5Y J;  4RBO A;  4Y7N J;  2D1H A;  2KRC A;  1T39 A;  1R00 A;  1FIP A;  4M3F A;  1JHH A;  4NNJ A;  4XKC A;  1XMK A;  3GX4 X;  5JVG F;  3QYF A;  4B3X A;  1PP8 F;  5J1U A;  3HZJ A;  2EH3 A;  1KA8 A;  5F04 A;  2DOF A;  2TCT A;  1XB4 A;  4A3F J;  2XRL A;  1V4R A;  1WJF A;  2YUS A;  3NWS A;  3DEU A;  3WGI A;  1AA7 A;  5DCM A;  1UHS A;  5GAD J;  2VLA A;  2EA2 A;  2XGX A;  3GME A;  3M1C A;  4BHC A;  2XB0 X;  3WTZ A;  4PSX A;  2LG4 A;  3CME I;  5CLS A;  3OYF A;  1MBH A;  1R5G A;  4NDL A;  3E1S A;  5IYC J;  1S9H A;  5F27 A;  3HG9 A;  3HPG A;  1BA5 A;  3H3U A;  2BY1 A;  4RB2 C;  3ABU A;  2ESH A;  2F2E A;  2EV6 A;  3L09 A;  4OIQ F;  1IN4 A;  2JK3 A;  2DMP A;  3ABK H;  5BPI A;  3V8L A;  4KT5 C;  1MDM A;  3DPT A;  3JR9 A;  3BR0 A;  2A6T A;  2M5W A;  4JOM A;  5LEJ A;  3CCE I;  4O3M A;  5KVR A;  3RTR A;  4WWC A;  1MMN A;  3E7L A;  4ZH4 F;  4YEL A;  2HOE A;  4A0Y A;  9ANT A;  4AVP A;  4C2M J;  2P6S A;  4W97 A;  2CW8 A;  4KIC A;  4II2 A;  3FXJ A;  1I50 J;  2RNG A;  4XIC A;  4G7Z F;  1QGP A;  2GXG A;  1YRN A;  2H8W A;  1VZ0 A;  1HCR A;  3KEY A;  3J7A O;  3AFH A;  3LMM A;  2JRT A;  1U78 A;  3FXR A;  2LBF A;  2PMU A;  4BJT A;  2VL8 A;  1D5Y A;  4IHX A;  1YLF A;  2K86 A;  4F93 B;  3L1P A;  1GXP A;  1JTY A;  4UV8 A;  1MJA A;  1O7F A;  1OCC H;  2LKS A;  4EM0 B;  2DA6 A;  3PJR A;  2VPL A;  1ZKG A;  1VQ5 I;  3ML6 A;  3CZ6 A;  1P7J A;  3I56 I;  3FK6 A;  1BJA A;  2R7X A;  1MSE C;  4PZJ A;  1DP3 A;  3R0A A;  5LGN A;  2MLG A;  4M3G A;  4GYI A;  2HDC A;  1JKQ C;  5H2F C;  1R49 A;  5M3F J;  1LKX A;  3F72 A;  1E3P A;  4A6D A;  1SD7 A;  2CQK A;  1WFX A;  2E19 A;  4P5O A;  2UXX A;  4DQ2 A;  1ZRD A;  4HF2 A;  3HL2 A;  4WXH A;  1WJC A;  4DYR A;  2VBZ A;  4LG0 B;  4XBF A;  2HKX A;  3NRV A;  3BJO A;  1U6G A;  3BDD A;  3M1E A;  3BCB A;  4I98 B;  3L2U A;  1UG2 A;  4RGU A;  2L9V A;  4G6Q A;  2LRD A;  3DTI A;  3MKY B;  4LIT A;  4NHJ A;  1HBX G;  3ROU A;  2Q1Z B;  2VOD A;  4PUS A;  2XIG A;  2XPW A;  2HYF A;  4XRS G;  2C6Y A;  4L5E A;  4RM2 A;  1ACI A;  4FHT A;  4M72 A;  3ZMT A;  5GTH C;  2JA5 J;  4WX9 A;  2DOE A;  4LIU A;  2E35 A;  1PUE E;  2FXA A;  3JTG A;  2XDV A;  3MKZ A;  3H1C A;  3V8J A;  2ZNY A;  4S0H B;  4AID A;  3WE3 A;  2RVC A;  1MJ9 A;  2FJ1 A;  3LSJ A;  1Y6I A;  2QKM B;  2VC1 A;  2KP6 A;  3G1O A;  1KON A;  5ILU A;  2X1E A;  2GIZ A;  4KFC A;  5J1R A;  2W4S A;  2ETH A;  2J5O A;  2L9N A;  2XUB A;  1ZG1 A;  3P9I A;  1YS7 A;  1P92 A;  3SDB A;  4D9J A;  5BMZ A;  2L2O A;  2R3S A;  4CCO A;  2ZME A;  1I3Q J;  2OF7 A;  1TT5 B;  4MO7 A;  1A36 A;  4UUT A;  1RUO A;  2XAQ A;  2VKD A;  2F48 A;  4KMF A;  3A01 B;  2DJI A;  2LF7 A;  3F3X A;  5CQG A;  2ZME C;  1P2F A;  2HZT A;  3DTE A;  3MN2 A;  3OS1 A;  2R7D A;  1R36 A;  5FKK A;  2DT6 A;  2PBI A;  3L7W A;  5L3C A;  2K9N A;  3S3M A;  1Z3X A;  2ELJ A;  3HRT A;  2DPU A;  1MNM C;  2E2I J;  3CES A;  1X1A A;  3JAM Z;  2R5Z A;  3IRQ A;  2F5E A;  1K78 B;  1Y1V J;  4XOP A;  1D1C A;  3ZXS A;  3LQR A;  4HNV A;  3KE2 A;  1T98 A;  4FQG A;  2YX7 A;  1S7A A;  2EJR A;  2M2E A;  3GZN B;  4BY1 J;  2MC3 A;  4XLF A;  2X6X A;  4ENN A;  3EUA A;  3DKX A;  4L9N A;  4A5N A;  4MLO A;  1CF7 A;  1K79 A;  3BR1 A;  5GAE J;  3CUO A;  4BQA A;  1RR7 A;  2LRE A;  1TWC J;  1IN8 A;  2X4H A;  3DXJ F;  4EJV A;  3J80 K;  1FMW A;  3FXL A;  2TRT A;  4ZYH A;  1RIO H;  3LWF A;  2L7M P;  1GT0 C;  5FRN A;  2BHZ A;  5B66 C;  3BJA A;  1Z6T A;  2G7U A;  2MD0 A;  4L5J A;  4OAZ A;  3V7R A;  2A5W A;  2X85 A;  4QWQ A;  2W25 A;  2DMN A;  1Y8R B;  2VQH A;  3L2V A;  2UZK A;  1ZR2 A;  2XRN A;  3EPZ A;  3TGN A;  2DMQ A;  1H0M A;  5H6R A;  3OYN A;  2D5V A;  1UHW A;  2EZH A;  2EFP A;  1RUN A;  2QSG X;  1IN6 A;  1BR2 A;  3T8T A;  3DQV C;  3E5Q A;  3SXY A;  4IX7 A;  1BC8 C;  3VFZ A;  3BZC A;  4J19 A;  2JPB A;  1MKM A;  2COM A;  3BPV A;  2D2W A;  2W48 A;  2R92 J;  3V8K A;  3JTH A;  2X6W A;  3K1N A;  5HLI A;  2MD5 A;  1FNN A;  2VJI A;  2V79 A;  2GA1 A;  2EK5 A;  1O7L A;  3PSF A;  4OIP F;  3MKW B;  4EJW A;  1ZHF A;  2PJR B;  1FIA A;  1P7I A;  3CCS I;  3BG9 A;  3HSR A;  1IG7 A;  4A3I J;  2B9S A;  1ITY A;  4ZTF A;  3J81 K;  1VQ4 I;  1U5T A;  1WH7 A;  2FBK A;  4ENM A;  1U2W A;  4IHY A;  2YSR A;  2XAS A;  2ZB9 A;  1GVD A;  2A6H F;  4XL9 A;  4I02 A;  4HST A;  4KIT B;  1HC8 A;  1MJB A;  1U5T C;  2O8X A;  3ASN H;  2KIM A;  1HKT A;  3OV8 A;  4FX4 A;  1AOY A;  1FP2 A;  1N78 A;  3H0G J;  3DBH B;  3TOA A;  5DUK A;  2QVO A;  4PDK A;  3LSR A;  2MAB A;  2M30 A;  3HSE A;  4ABZ A;  3B6A A;  4ITV A;  3WG7 H;  5HLH A;  4UXN A;  3QYE A;  3WU0 A;  2DOA A;  5LHG A;  2GOX B;  3OOU A;  3CCV I;  4KUM A;  1MGT A;  5CVR A;  4CCM A;  3RZD J;  2AO9 A;  4OIR F;  3F8F A;  5D4S A;  2HQA A;  1EH7 A;  1EKE A;  1X3W B;  1KQ9 A;  2MLK A;  1FSE A;  3TO9 A;  4RGX A;  3UKG A;  1PVE A;  5D8L B;  2BVL A;  2RDP A;  3HRM A;  1H88 C;  3S15 J;  1WWX A;  2MW8 A;  1X1C A;  3W6K B;  3GTL J;  5IP9 J;  2HXO A;  1POG A;  3T1B A;  2QYO A;  2VN2 A;  3WU1 B;  2JJ7 A;  4A3L J;  3LL7 A;  2V4J C;  2EQR A;  2V6E A;  2HQ5 A;  4YEJ A;  4NB5 A;  3U9G A;  3OSF A;  2M45 A;  2ZJQ F;  2IGM A;  1R58 A;  2BVM A;  2JA8 J;  3ZR8 X;  2P5V A;  2P8T A;  3FXO A;  4BBR J;  2DN0 A;  5D5V B;  3MZH A;  3KCC A;  2DTR A;  4O5V A;  2VXD A;  2ID6 A;  5F0F A;  2R7U A;  2VI6 A;  5J47 A;  1WH5 A;  2CV2 A;  2R7S A;  3ZMU A;  1D0Z A;  4YIF A;  2WBM A;  3RJP A;  2F5V A;  4KMU X;  1WVR A;  2VBW A;  1OKR A;  4CYD A;  3ESW B;  3KX2 A;  3GTG J;  4HV5 A;  1Z6R A;  2XKP A;  4HNU A;  2LC2 A;  3HRS A;  4ZDO A;  3HM5 A;  4XLE A;  2O9L A;  1ZEL A;  4BQQ A;  3DPL C;  3VOD A;  2H6B A;  3GXO A;  4G7H F;  2YS9 A;  3BTC A;  3I54 A;  1V5E A;  3WU2 C;  4IRH A;  2HTS A;  1R6R A;  3IH2 A;  3EYY A;  1IGN A;  2IA0 A;  4QPO A;  1G2H A;  1O4X A;  2O0Y A;  4F92 B;  4U0V A;  3F9K A;  3BQZ A;  2LP0 A;  1XC5 A;  4M9Z A;  3W2A A;  3PO3 J;  1UMQ A;  1OJL A;  2HQN A;  5FLX K;  1TQM A;  4M3E A;  3CDL A;  1FLI A;  2XRO A;  5E8I A;  4HF1 A;  2E7W A;  2E1M C;  1QZE A;  3K2A A;  1Y0N A;  3R4K A;  3TP0 A;  2VKV A;  1U8B A;  3CCY A;  4BDZ A;  2DU9 A;  4EV0 A;  1R9T J;  2WAQ N;  1BOB A;  3DBL B;  1FYL A;  4NBQ A;  4A3G J;  1OIS A;  3V4G A;  3OS0 A;  1IF1 A;  2E1O A;  5FD6 A;  3HKZ N;  2ME6 A;  4P96 A;  4I99 C;  3MWM A;  4YII A;  1VQ7 I;  2VB6 A;  3LSH A;  5H6Q A;  3FMR A;  3OL3 A;  3HOS A;  4BAY A;  3MD2 A;  3FX3 A;  1YI2 I;  1Z77 A;  2NS8 A;  1X1P A;  2K3P A;  2XF6 A;  3K69 A;  4AYB N;  4ETS A;  1JUP A;  3H92 A;  2W84 A;  1KZH A;  2FX0 A;  3EYI A;  2NNN A;  4EGY A;  3ZQF A;  1UEL B;  1W0U A;  1B8I B;  2L01 A;  1E3O C;  2RRE A;  4FET A;  2Y9Y A;  1F36 A;  2GIV A;  5GPA A;  3N4M A;  4A3B J;  1W5T A;  3HPH A;  3E6D A;  5JI6 A;  1FOY A;  1N75 A;  1SVO A;  2XGC A;  1EJ9 A;  1A04 A;  1ZAR A;  5TGT A;  2FQ4 A;  3S2W A;  3G6E I;  1QO0 D;  1OCP A;  4UV9 A;  3AAF A;  3I4N J;  2GAU A;  3L9F A;  2FA5 A;  4M6V A;  2HFH A;  4V2F A;  2FSW A;  3CJR B;  4PJN A;  3LAP A;  1VQO I;  1QA6 A;  2LNB A;  2IS4 A;  3GO5 A;  4I0A A;  3BR6 A;  2M4K A;  4RLF A;  3GBG A;  4MFD A;  3U1D A;  4FE4 A;  4BH9 A;  1UCR A;  2DQL A;  2FMY A;  4CDG A;  1EF4 A;  1FSH A;  5J8C A;  4IEJ A;  3QPT A;  2JSC A;  4CCK A;  5EG0 A;  2F4I A;  1HW2 A;  1EH8 A;  4PK4 A;  5EYR A;  2XHK A;  4PFO A;  5FLV A;  3BR5 A;  1DGW Y;  2OQR A;  2ZFW A;  4D7M A;  2OCC H;  4A3D J;  2R7F A;  2X0L A;  4M3D A;  2PJP A;  2V6C A;  1MZB A;  3QU3 A;  3C2B A;  4Y3O A;  5DYM A;  5AIP A;  1F4K A;  3PO2 J;  3GTJ J;  3E6C C;  4QTR A;  2WAE A;  4A0Z A;  3JRA A;  2Z9O A;  2QQ9 A;  3BG5 A;  1O3T A;  3BG3 A;  1TWG J;  2ZNZ A;  3A01 A;  1XS9 A;  3KZI C;  3BG6 A;  2L0K A;  4KIG A;  3JAM K;  4MIM A;  1LFU P;  4UVA A;  4YFK F;  2AQF A;  5DDG A;  2QGU A;  1SEU A;  2HVS A;  1LFB A;  2KKO A;  4CUG A;  5CPR B;  3BPX A;  4YRV A;  1SD4 A;  4MNU A;  5HS9 A;  2EIK H;  5E3N A;  1K78 A;  3LSG A;  2O8K A;  4MTD A;  3M8F A;  3QOE A;  2QZ8 A;  1GLN A;  2FUG 2;  3F6O A;  4M73 A;  1LVA A;  4DBR A;  4ENK A;  3FXU A;  2VT2 A;  3C2G A;  1VQ8 I;  3PNY A;  4KIS A;  1H8A C;  1FX7 A;  5JFR A;  1BW6 A;  2JVG A;  2NYX A;  2DA7 A;  3E3V A;  4ZYA A;  3TOB A;  1KU9 A;  5LEK A; 
#chains in the Genus database with same CATH homology
 5E1W A;  2M87 A;  1ON1 A;  3E5X A;  3PFI A;  2KJC A;  4IF4 A;  3SHF A;  4JQF A;  3B73 A;  2CG4 A;  3G3Z A;  4EM1 A;  4P9U A;  3QU6 A;  2VE9 A;  1B9N A;  2YU3 A;  4RAY A;  2O03 A;  5LRR A;  1TW3 A;  4Y17 A;  1S29 A;  2W24 A;  4HX8 A;  2XV4 S;  5ICE A;  2L02 A;  4R1H A;  2XAF A;  2EB7 A;  1OPC A;  3GFL A;  2VT3 A;  4RS8 A;  3G73 A;  3LQQ A;  4BHB A;  3O6B B;  2A61 A;  2YR2 A;  3ZP5 A;  5HS7 A;  2QQB A;  1SFU A;  2D1V A;  2DW4 A;  4UHT A;  4WK8 F;  5FO5 A;  2QWW A;  4EM2 A;  2MH9 A;  1Z05 A;  1T38 A;  1WSU A;  2A07 F;  3WTY C;  1STZ A;  5DD4 A;  4ZYE A;  5DUI A;  2HKO A;  4BNC A;  5IT9 Z;  5E17 F;  3ZMD A;  1R1T A;  1I6X A;  3FM5 A;  2P6T A;  3BOQ A;  1AWC A;  1LDD A;  3KP4 A;  1LEB A;  2EA4 A;  1KQ0 A;  4CGZ A;  4A0X A;  2M8E A;  3GLX A;  1XN7 A;  2ESN A;  3I58 A;  3MQ0 A;  2NNY A;  1IN5 A;  4Y13 A;  2F5F A;  1IZ1 A;  4LB6 B;  5ILV A;  4OOI A;  5DEQ A;  2K27 A;  1RNL A;  6PAX A;  2FOK A;  1BI0 A;  2UXN A;  4PGH A;  1D3Y A;  1S3J A;  1KU2 A;  1Z91 A;  3E97 A;  1I5Z A;  5E18 F;  5LBQ A;  3SFZ A;  1FP1 D;  3CDH A;  4A12 A;  2G7H A;  4N0B A;  4RAZ A;  1WRJ A;  1S7O A;  4ON0 A;  1R22 A;  3F6V A;  2B0L A;  3GFI A;  1P4A A;  3I64 A;  3KLN A;  3DF8 A;  1T6S A;  2Y48 A;  5D8K B;  1D5V A;  2YX4 A;  3LA2 A;  1I1G A;  4GYG A;  1XMA A;  1BN5 A;  3N97 A;  1JXS A;  3CLO A;  4U88 A;  2EFN A;  2OAZ A;  5FLX Z;  3KP7 A;  2OD5 A;  1E17 A;  2OZ6 A;  4LK1 F;  2PQ8 A;  1OYI A;  4R79 A;  1YW7 A;  1DP7 P;  2OBP A;  2JTV A;  3MFK A;  3I53 A;  5EEH A;  4AWX B;  5J6X A;  5FFX A;  1T2K A;  5E1X A;  1F9N A;  3RI4 A;  4WF2 A;  1G3T A;  2BEO A;  2LDU A;  3EQL F;  3TO7 A;  1ZRF A;  1USS A;  3TDZ C;  3MZY A;  1G6N A;  3R60 A;  4CXF A;  1G4D A;  3BJ6 A;  3WTT C;  1UHM A;  3ULQ B;  4L9J A;  4L0Y B;  4XLP F;  5ICF A;  5FB2 A;  2VON A;  1BIB A;  2F5C A;  1TW2 A;  3QRF F;  2QBY B;  3E6B A;  4L9V A;  1PP7 U;  1R23 A;  2DI3 A;  4OMY A;  2PEX A;  3ELK A;  2BE5 F;  1GXQ A;  2WTE A;  5LHH A;  2CFX A;  2E7X A;  4HOB A;  5H20 A;  3RKX A;  1WKM A;  3K1M A;  4I01 A;  3SZT A;  3FWE A;  1DDN A;  1QZY A;  3RPQ A;  1LJ9 A;  1BC7 C;  5CYV A;  1B1B A;  5E1Z B;  2V9V A;  1W7P B;  2RNJ A;  3P7N A;  3I59 A;  2FEZ A;  1QZZ A;  5HVQ C;  3MAJ A;  2Z99 A;  4HX4 A;  3FM3 A;  2LKP A;  2STT A;  1DUX C;  2QUF A;  3WG9 A;  1ZG5 A;  3F23 A;  4HDU A;  2IPQ X;  4XSZ F;  4A2U A;  1K6O A;  2ZKZ A;  4HAM A;  3QOP A;  5AON A;  2ISY A;  1J7K A;  4MEY F;  5HS8 A;  1P4W A;  1BM9 A;  2XAJ A;  2YPR A;  3O2P E;  4ENJ A;  5ICC A;  3LA7 A;  3GF2 A;  1ZYR F;  4PCQ A;  5F1R A;  4LFU A;  5JR3 A;  4U0Y A;  2V1D A;  2H94 A;  1XDU A;  1S6L A;  3RDI A;  4G94 A;  1P4X A;  4P9F A;  2OA4 A;  2P7C B;  2QLZ A;  4A6E A;  3IL2 A;  3RYP A;  1YFH A;  4KIF A;  4RGS A;  4ZYD A;  1F5T A;  3F8N A;  5F6F A;  2PI0 A;  2DQR A;  3WOD F;  4CHU A;  2CYY A;  3SQN A;  3HYI A;  3O3K A;  4EJO A;  2JZY A;  2Z3Y A;  3CUQ B;  1E2X A;  1OR7 A;  1LEA A;  2O3F A;  5L3B A;  5IT9 K;  1VTN C;  1HQC A;  3GWZ A;  1BI2 A;  1ZGA A;  3GFJ A;  3BP8 A;  3TDU C;  2A69 F;  4Q47 A;  4L0Z B;  2QM3 A;  5D6F A;  1W4M A;  1IN7 A;  2NAZ A;  2E1C A;  3MCZ A;  2A6E F;  2KRF A;  2VE8 A;  2ISZ A;  1HKQ A;  1YW8 A;  2VC0 A;  3CO7 C;  4HYE A;  2UWM A;  2BYV E;  1MDM B;  4ZYG A;  3TKY A;  3M7G A;  5K5R A;  5TJJ A;  4WXD A;  3WE2 A;  2F5D A;  3R0J A;  4EMS A;  3COA C;  3SZP A;  4KNY A;  5EEG A;  2K4J A;  1ZLJ A;  5HDG A;  4CZZ A;  3WTW C;  5D6E A;  4CO8 A;  3Q5F A;  4N9I A;  5HDK A;  2VBY A;  3CTA A;  4HDV A;  4Q48 A;  2K02 A;  3KP6 A;  3F22 A;  4MHG A;  3C18 A;  3JW4 A;  4AD9 A;  5K5O A;  2DO7 A;  1KYZ A;  3H3Z A;  3B02 A;  3I5U A;  1Z1D A;  1P6R A;  2DFI A;  4UVB A;  5KK1 A;  3FMS A;  3K2Z A;  4ZZL A;  2ZXJ A;  1QPM A;  2XAH A;  3KEQ A;  4LG0 A;  2KIU A;  3DKW A;  1IAW A;  3HRU A;  4ESB A;  2IA2 A;  2BBY A;  2DK8 A;  1RI7 A;  3WGH A;  1EH6 A;  1G3Y A;  4KIB A;  4AIJ A;  4EJU A;  1O57 A;  4HX7 A;  2BGC A;  3F21 A;  5D5U B;  2WC2 A;  4QLC U;  1K7A A;  2QBY A;  3Q9S A;  2JPC A;  1FC3 A;  4S04 A;  4GXO A;  2HEO A;  1O3Q A;  2ZME B;  2MH2 A;  2TDX A;  1OYW A;  3P9C A;  5JHU A;  2ADU A;  2BV6 A;  2XAG A;  3ZQ7 A;  3KFW X;  2DAO A;  2CO5 A;  2RN7 A;  3C1D A;  4UVC A;  4KA4 A;  1W7P A;  5HLG A;  1I1S A;  1SFE A;  4KN4 X;  1L0O C;  2W57 A;  5DV5 A;  4WCG A;  3LA3 A;  1TBX A;  1YYV A;  5LRS A;  3FZV A;  1XSV A;  5L3E A;  2GQQ A;  3C3W A;  2MBF A;  3GW2 A;  2PLY A;  2IJL A;  1BBY A;  5DCF A;  2AXL A;  1REP C;  2CWE A;  4FT8 A;  5A2Q Z;  3TO6 A;  4GO1 A;  3IWZ A;  1U3E M;  2Q8K A;  4L18 B;  4I2O A;  2DBB A;  5JVT A;  3MEX A;  1FZP B;  4UNO A;  4I09 A;  1SMY F;  2DK5 A;  4HLY A;  1BI3 A;  1B6A A;  5D5W B;  2CSO A;  3Q9V A;  3IRR A;  2GWR A;  1U5T B;  1ZN2 A;  2L4M A;  2RQP A;  3HOT A;  3KP5 A;  1BI1 A;  1J75 A;  1QQI A;  2K7L A;  4HQE A;  5K1Y A;  1ZRC A;  2Q0O A;  3K9T A;  4UUV A;  1Q1H A;  1TNS A;  1HST A;  4KYW A;  1UB9 A;  4Q5S F;  3U2R A;  3I0T A;  2W85 A;  1XSD A;  2ACJ A;  2EV0 A;  2PG4 A;  4OIO F;  3IHU A;  4U7B A;  5BQT A;  4CIC A;  1TLH B;  1W7P D;  4RB1 A;  3K1P A;  4EVI A;  1GVJ A;  2CGP A;  4R8H A;  5DD8 A;  1GHC A;  5CJ9 A;  4YFN F;  3W6J B;  4HBL A;  2PMH A;  2H27 A;  4M9X A;  4PGG A;  2OQG A;  1JGS A;  2HR3 A;  1TQP A;  4P55 A;  1SFX A;  3DV8 A;  2EV5 A;  2NRA C;  3IC7 A;  2RV8 A;  1PDN C;  4L5I A;  5CVU A;  2FBH A;  3D0S A;  3KZY A;  5BPD A;  2GXB A;  1WI9 A;  4GCV A;  1ON2 A;  4EQQ A;  4OIN F;  3E5U A;  2P4W A;  1J2X A;  1R1V A;  2FBI A;  1Y0U A;  5L3D A;  1G3W A;  5LGT A;  2V1X A;  4LLL A;  3QP6 A;  3GZ6 A;  3EDP A;  4HZF A;  3KLO A;  2AS5 F;  3F8B A;  4XLN F;  5E20 A;  4IJA A;  4MTE A;  5BS6 A;  2VXZ A;  3LST A;  1T0F A;  3E6M A;  1YO5 C;  2GZW A;  3LFK A;  1DPU A;  4EGZ A;  3NEU A;  3DFG A;  2PFB A;  1TNT A;  3RKY A;  5ERI A;  4G8X A;  2IA1 A;  1ONV A;  3L00 A;  1QNT A;  4G7O F;  4U7D A;  1SD5 A;  1LDJ A;  5F64 A;  4ESF A;  1D8J A;  1OMI A;  2RGV A;  3GUD A;  1XGS A;  1B4A A;  3KP3 A;  3CO6 C;  3R6S A;  1IRF A;  1R5H A;  4JBA A;  1HW5 A;  4YG2 F;  1ZG3 A;  2ELH A;  3REO A;  1YQA A;  4MQ9 F;  4GGG A;  4XRF A;  1HXD A;  5L3F A;  1FYK A;  5E8G A;  1FT9 A;  4BYY A;  3VB2 A;  1XSX A;  2HGC A;  4ASN A;  3LAJ A;  2DPD A;  2FNA A;  4MQV A;  2P5L C;  1HW1 A;  1FYM A;  5L3G A;  3K0L A;  1Z7U A;  2HYG D;  3PQJ A;  2ZO4 A;  4KN7 X;  3GEZ A;  3ZN0 A;  1FPQ A;  1KU3 A;  4L9T A;  3V7S A;  5BOX A;  4XSX F;  3I4P A;  5HOO A;  2KIF A;  1UFM A;  1TQI A;  2DT5 A;  1IXS B;  5FD5 A;  2H09 A;  2FQ3 A;  4OMZ A;  2DLL A;  2HWV A;  4IXA A;  1J59 A;  1FOK A;  3QAH A;  4B8X A;  4LD5 A;  4G9Y A;  1IXR C;  4LLG F;  4H0E A;  3TQN A;  1S8N A;  4M74 A;  1J0R A;  5J8F A;  3WTS C;  2HQR A;  3BY6 A;  2QEN A;  2GA2 A;  5A2Q K;  2HTJ A;  1DPR A;  1JHF A;  3GVA A;  3ERE D;  2OZU A;  3I71 A;  3KP2 A;  2VOO A;  3CJN A;  4B09 A;  4LLN A;  4M71 A;  2WV0 A;  3RKW A;  2WWY A;  1UST A;  2KJB A;  2PN6 A;  2STW A;  5LGU A;  4D0P A;  4N9H A;  2XVC A;  1FY7 A;  1WQ2 A;  4IRG A;  4WXC A;  4DNC A;  4IRI A;  2JT1 A;  2Y75 A;  4MEX F;  2EFO A;  1SAX A;  4E70 A;  3JSO A;  3WTU C;  1FBS A;  4YFX F;  1IXC A;  1IUY A;  3HHH A;  4OU0 A;  2D45 A;  3IWF A;  1OYY A;  5FGM A;  4G6D A;  3RYR A;  4M6Y A;  5D4R A;  1HKS A;  1LDK B;  3NQO A;  1IRG A;  2IW5 A;  5CVI A;  1R1U A;  2K4B A;  5DCM B;  1F1Z A;  1SMT A;  3ZPL A;  5CVJ A;  4LGW A;  3GYH X;  4HQM A;  4Q4Z F;  3IKT A;  1HSJ A;  3HUG A;  3L2C A;  2L54 A;  2XKO A;  3F8C A;  1ZLK A;  4LMY A;  1FBU A;  2MA3 A;  1V3F A;  2NS0 A;  3QPH A;  2RKH A;  4S05 A;  1G3S A;  2EFQ A;  4MGR A;  3R61 A;  4HW0 A;  1J5Y A;  1LB2 A;  4HF0 A;  3KEO A;  3PQK A;  5IT3 A;  1ZGJ A;  3KET A;  1ZAO A;  2M1B A;  4LB5 A;  2EWN A;  2VOP A;  2FNP A;  2IP2 A;  1XGM A;  4ZZD A;  1NHA A;  1CGP A;  1L3L A;  2V1U A;  3F8M A;  4IHS A;  3BZ6 A;  4IHT A;  4JK1 X;  3T0Y A;  3HIF A;  3ECH A;  3FXQ A;  2A68 F;  4LJZ F;  2FE3 A;  3ABT A;  1XD7 A;  3IKV A;  3ZMV A;  3ZMS A;  4KDP A;  4O6J A;  2A5Y B;  4IVN A;  3C7J A;  3EET A;  3D5L A;  1XGN A;  4NQW A;  1XDS A;  1O3S A;  4BHP A;  1SD6 A;  2P7V B;  1ZH5 A;  1Z9C A;  3T8R A;  2CW0 F;  2Q2E A;  3GZ5 A;  1U8R A;  1RZ4 A;  3RPU A;  2ZJ2 A;  1TTY A;  4EJT A;  4RGR A;  3VEP A;  3BWG A;  3V7C A;  5ICG A;  1YIO A;  2L3D A;  3FF5 A;  2ZCW A;  2FRH A;  5CVV A;  4F7Z A;  2P5K A;  1D8K A;  5AIQ A;  4RB3 C;  3FHZ A;  2O61 A;  4M6X A;  2IVM A;  3EUH A;  1ZRE A;  5K5Q A;  4HLX A;  3ZN1 A;  1R7J A;  3WTX C;  3HSF A;  1EV7 A;  2LF8 A;  4HV6 A;  3I59 B;  1BOA A;  2Z33 A;  3M8E A;  3WTV C;  2VBX A;  3BRO A;  2G9W A;  5ILS A;  5LHI A;  1XCV A;  2Z5U A;  1H9T A;  3HTU A;  4LK0 F;  4RB0 A;  1X3U A;  3WGG A;  1CF7 B;  1MD0 A;  3QP5 A;  1KQ8 A;  1YG2 A;  4HA8 A;  3KZZ A;  5ED4 A;  1YW9 A;  2O6G E;  3OOP A;  5D5X B;  2L4A A;  3J80 Z;  1XCB A;  2FML A;  4Z2Y A;  3T5X A;  3JSP A;  2HS5 A;  1B9M A;  1KYW A;  4IPA A;  2FU4 A;  2OU2 A;  2FF4 A;  3M9A A;  3HTS B;  1LNW A;  1LQ1 A;  2H6C A;  2E1N A;  1FWZ A;  1J9I A;  2LSO A;  2RC4 A;  5HDN A;  3ECO A;  1ODD A;  4FX0 A;  3FMQ A;  2IT0 A;  4M9S A;  1C0W A;  1B59 A;  1YTY A;  3DP7 A;  3VOE A;  1FBQ A;  1YS6 A;  3ZMZ A;  4ESJ A;  2EFW A;  3J81 Z;  5TRD A;  2A3S A;  1KGS A;  3HHG A;  1W5S A;  2Y0M A;  4U0W A;  3RIR A;  4K2E A;  1H9G A;  1KU7 A;  3P9K A;  1JE8 A;  1QBJ A;  4Y15 A;  3GFM A;  1XGO A;  4I7H A;  5FFZ A;  4AIK A;  1BIA A;  1IW7 F;  2J5P A;  4BXU A;  2QQA A;  4I0B A;  1ULY A;  3ISP A;  4A5M A;  1O3R A;  4TV7 A;  3CUQ A;  1I27 A;  5LLQ A;  3CUQ C;  4AIH A;  2ZBK A;  2IRF G;  2D1H A;  1T39 A;  1R00 A;  1JHH A;  3GX4 X;  1XMK A;  1PP8 F;  1KA8 A;  1XB4 A;  1V4R A;  3DEU A;  3WGI A;  5DCM A;  2EA2 A;  2XGX A;  4BHC A;  3WTZ A;  5CLS A;  1R5G A;  3H3U A;  4RB2 C;  2ESH A;  2F2E A;  3ABU A;  2EV6 A;  3L09 A;  4OIQ F;  1IN4 A;  5BPI A;  3V8L A;  4KT5 C;  1MDM A;  3DPT A;  2M5W A;  5LEJ A;  4O3M A;  5KVR A;  3RTR A;  4WWC A;  4ZH4 F;  2HOE A;  4A0Y A;  4AVP A;  2P6S A;  4KIC A;  4G7Z F;  1QGP A;  2GXG A;  3J7A O;  2JRT A;  1U78 A;  3FXR A;  2PMU A;  1YLF A;  2K86 A;  1GXP A;  4UV8 A;  1MJA A;  1O7F A;  4EM0 B;  3ML6 A;  1BJA A;  4PZJ A;  3R0A A;  5LGN A;  2MLG A;  4GYI A;  2HDC A;  3F72 A;  4A6D A;  1SD7 A;  2CQK A;  4P5O A;  2UXX A;  4DQ2 A;  1ZRD A;  4HF2 A;  4WXH A;  2VBZ A;  4LG0 B;  4XBF A;  2HKX A;  3NRV A;  3BJO A;  1U6G A;  3BDD A;  3M1E A;  4I98 B;  4RGU A;  4G6Q A;  4NHJ A;  1HBX G;  3ROU A;  2VOD A;  2XIG A;  2HYF A;  2C6Y A;  4FHT A;  4M72 A;  3ZMT A;  4WX9 A;  1PUE E;  2FXA A;  3JTG A;  3V8J A;  2ZNY A;  3WE3 A;  2RVC A;  1MJ9 A;  2VC1 A;  5ILU A;  4KFC A;  2ETH A;  2J5O A;  2XUB A;  1ZG1 A;  3P9I A;  1YS7 A;  1P92 A;  5BMZ A;  2R3S A;  2ZME A;  1RUO A;  2XAQ A;  4KMF A;  2LF7 A;  3F3X A;  1P2F A;  2HZT A;  2R7D A;  1R36 A;  2PBI A;  3L7W A;  5L3C A;  3HRT A;  2DPU A;  3JAM Z;  3IRQ A;  2F5E A;  1K78 B;  3LQR A;  3KE2 A;  1T98 A;  2YX7 A;  1S7A A;  2EJR A;  2MC3 A;  4ENN A;  4L9N A;  4A5N A;  1CF7 A;  1K79 A;  3CUO A;  4BQA A;  3DXJ F;  1IN8 A;  2X4H A;  4EJV A;  3J80 K;  4ZYH A;  1RIO H;  3LWF A;  3BJA A;  1Z6T A;  2G7U A;  4L5J A;  3V7R A;  4QWQ A;  2W25 A;  2UZK A;  2XRN A;  3TGN A;  1H0M A;  5H6R A;  1UHW A;  2EFP A;  1RUN A;  1IN6 A;  3T8T A;  3DQV C;  3E5Q A;  3SXY A;  1BC8 C;  3VFZ A;  2JPB A;  1MKM A;  2COM A;  3BPV A;  2D2W A;  3V8K A;  3JTH A;  3K1N A;  5HLI A;  2MD5 A;  1FNN A;  2V79 A;  2GA1 A;  2EK5 A;  1O7L A;  4OIP F;  4EJW A;  1ZHF A;  3HSR A;  3J81 K;  1U5T A;  2FBK A;  4ENM A;  1U2W A;  2YSR A;  2XAS A;  2A6H F;  4I02 A;  1MJB A;  1U5T C;  2O8X A;  2KIM A;  1HKT A;  3OV8 A;  4FX4 A;  1AOY A;  1FP2 A;  3TOA A;  5DUK A;  2QVO A;  4PDK A;  2M30 A;  3HSE A;  5HLH A;  4UXN A;  3WU0 A;  5LHG A;  4KUM A;  1MGT A;  5CVR A;  4OIR F;  5D4S A;  3F8F A;  1EH7 A;  1KQ9 A;  2MLK A;  1FSE A;  3TO9 A;  4RGX A;  5D8L B;  2RDP A;  3HRM A;  1WWX A;  3W6K B;  3T1B A;  2QYO A;  2VN2 A;  3WU1 B;  4NB5 A;  3U9G A;  2M45 A;  1R58 A;  2P5V A;  2P8T A;  5D5V B;  3MZH A;  3KCC A;  2DTR A;  4O5V A;  3ZMU A;  4YIF A;  3RJP A;  4KMU X;  2VBW A;  1OKR A;  4CYD A;  4HV5 A;  1Z6R A;  2XKP A;  3HRS A;  3DPL C;  3VOD A;  2H6B A;  3GXO A;  4G7H F;  3I54 A;  4IRH A;  2HTS A;  3EYY A;  2IA0 A;  2O0Y A;  4U0V A;  4M9Z A;  2HQN A;  5FLX K;  1TQM A;  1FLI A;  2XRO A;  5E8I A;  4HF1 A;  2E7W A;  3R4K A;  2DU9 A;  4EV0 A;  1FYL A;  3V4G A;  1IF1 A;  5FD6 A;  4P96 A;  3MWM A;  4YII A;  5H6Q A;  3FMR A;  3HOS A;  4BAY A;  3FX3 A;  3K69 A;  4ETS A;  3H92 A;  2W84 A;  3EYI A;  2NNN A;  4EGY A;  2L01 A;  2GIV A;  3N4M A;  1W5T A;  3E6D A;  5JI6 A;  1A04 A;  1ZAR A;  3S2W A;  1QO0 D;  4UV9 A;  3AAF A;  2GAU A;  3L9F A;  2FA5 A;  2HFH A;  2FSW A;  3LAP A;  2LNB A;  3GO5 A;  4I0A A;  3U1D A;  4BH9 A;  1UCR A;  2DQL A;  2FMY A;  4CDG A;  1FSH A;  5J8C A;  3QPT A;  2JSC A;  1HW2 A;  1EH8 A;  2XHK A;  2OQR A;  2ZFW A;  2R7F A;  2X0L A;  2PJP A;  2V6C A;  1MZB A;  3QU3 A;  5DYM A;  5AIP A;  1F4K A;  3E6C C;  4A0Z A;  2Z9O A;  2QQ9 A;  1O3T A;  2ZNZ A;  4KIG A;  3JAM K;  4UVA A;  4YFK F;  5DDG A;  2KKO A;  3BPX A;  1SD4 A;  4MNU A;  5HS9 A;  1K78 A;  4MTD A;  3M8F A;  2QZ8 A;  3F6O A;  4M73 A;  1LVA A;  4ENK A;  3FXU A;  2VT2 A;  1FX7 A;  5JFR A;  2NYX A;  3TOB A;  3E3V A;  1KU9 A;  5LEK A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...