3KE2A

Crystal structure of a duf2131 family protein (sama_2911) from shewanella amazonensis sb2b at 2.50 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
b'GDQVSKQHKAFLRKLYLAHLMDDARHNLLSLGKLTGMPRRTLQDAIASFADIGIEVEFVQDGERHNAGYYRIRTWGPISSAWMDTHVDEVKSLLGVDDAVGQA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords uncharacterized protein YP_928783.1
publication title Crystal structure of STRUCTURAL GENOMICS, UNKNOWN FUNCTION (YP_928783.1) from SHEWANELLA AMAZONENSIS SB2B at 2.50 A resolution
rcsb
source organism Shewanella amazonensis sb2b
molecule tags Unknown function
total genus 25
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09904 HTH_43 Winged helix-turn helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ke2A00
2L4AA 4U0VA 2EFNA 1GXPA 2HYFA 2H09A 3R0AA 3IRQA 2JZYA 1B6AA 2GIVA 4CGZA 4O3MA 2YX4A 2EA2A 3WODF 1QO0D 1JGSA 3SFZA 5FGMA 3WGHA 2W24A 4P96A 1ZG1A 1QNTA 3V4GA 3BJAA 2IP2A 2XKOA 3F8CA 2C6YA 3MAJA 5CYVA 1WSUA 5E20A 4G6QA 2QVOA 3RYPA 2BYVE 4L9NA 5DCMB 3NQOA 2STWA 3FXRA 4G7HF 2HR3A 2V1DA 3O6BB 2IVMA 2WV0A 1R5GA 2DTRA 4ZYHA 1K78B 4I0BA 1XDUA 5HS7A 4I2OA 3GXOA 2WWYA 2VODA 2EFQA 3TGNA 5DDGA 5D8LB 3E5UA 1R22A 4YG2F 2PMHA 2NNNA 2F5CA 1UHWA 5AONA 3C7JA 2MLGA 4AVPA 5E8GA 2CYYA 4WF2A 4BQAA 3FM3A 1KA8A 4KN7X 2DT5A 5HLGA 1R58A 1Z6TA 4G8XA 5TRDA 1KU7A 3CUOA 1IXRC 1U5TC 2MC3A 3TKYA 3G3ZA 2VOOA 4UHTA 3BOQA 1HW5A 1FBSA 1XN7A 1O3RA 3C3WA 1S6LA 3DF8A 2GZWA 4CDGA 3F23A 2HDCA 2ISYA 2IT0A 1P4AA 4PGHA 3QP6A 3LSTA 3ABUA 3KFWX 3RYRA 2J5PA 2D1VA 3GUDA 4FX0A 5F64A 2EFWA 2H6CA 3WTTC 2HOEA 5D6FA 3N4MA 4IHTA 4ZYGA 1LDJA 3EUHA 4KA4A 1WRJA 4IJAA 3E3VA 3K1NA 2P6TA 4AIHA 1B4AA 2KJCA 2L54A 3HRMA 5LHIA 4R1HA 4L0ZB 3F6OA 5LGTA 4ZZDA 2NNYA 2IA2A 5HS8A 3KETA 2M87A 1XGNA 4KFCA 2ZMEA 2HGCA 1GXQA 2NYXA 5E1XA 1SD4A 5IT9Z 1Z7UA 3EQLF 5CVRA 3FF5A 1XMKA 2UXNA 5ICFA 4EV0A 4CYDA 3F6VA 2HKXA 1O57A 2ADUA 4KYWA 2VBZA 1HKQA 1Z91A 2QUFA 3ZPLA 5JI6A 2VBWA 5HDKA 1QBJA 4A5MA 4QWQA 2XV4S 3ABTA 5DD8A 4L9JA 1O3QA 5JVTA 3HTSB 4D0PA 1ZRCA 5CJ9A 3R60A 1CGPA 2X4HA 3MQ0A 5K1YA 2VC0A 4N9IA 3VODA 2PBIA 3F3XA 4I01A 1D8JA 4M74A 4EMSA 4HZFA 3CUQC 3HOTA 3WTZA 3T8TA 3Q9SA 3LQQA 4LK1F 1IN4A 2K02A 4NB5A 1S29A 3ERED 1F4KA 1HKSA 3CUQA 4I09A 2CG4A 1SMTA 5HOOA 3HRTA 2XUBA 2JPCA 4GXOA 1B9MA 2A6EF 4BAYA 2HTSA 3IC7A 3RDIA 1W5TA 3GW2A 1HW1A 4N0BA 2KJBA 1RI7A 1Z6RA 3E5XA 2VBYA 2X0LA 4BNCA 1MZBA 1KYWA 1TBXA 3HYIA 2V6CA 1PP7U 1R1UA 2DI3A 4LGWA 4P55A 4HQMA 3FMRA 1U78A 4I98B 4O6JA 3F21A 2STTA 3B73A 3GFJA 1S3JA 2A68F 3ZN1A 2AXLA 5ICGA 4R79A 1P4XA 1RUOA 4RB1A 4EM2A 4RGRA 2K86A 2P7VB 3MZYA 2RVCA 2NS0A 3K2ZA 2L01A 2DPUA 1R36A 2LSOA 1PP8F 4HX4A 1ZGAA 5J6XA 3GFIA 3U2RA 4G7OF 4HX7A 1L3LA 2FNAA 3V8KA 2XAQA 4KNYA 2WTEA 5IT9K 3DV8A 4HOBA 3J81K 2GXGA 1KU2A 1ZYRF 4B09A 2PFBA 1U5TB 1QQIA 2DK8A 4OOIA 3RTRA 2FF4A 5F1RA 2E7WA 3H3ZA 2DQRA 4KMUX 2R7FA 3KP6A 3ECOA 5CVVA 1L0OC 3ELKA 2CSOA 3I0TA 1WI9A 4ENKA 1W7PA 4KUMA 2KIMA 2VOPA 4L18B 2HS5A 3C1DA 4Y15A 5BPIA 3U9GA 5ICEA 1TLHB 1ZAOA 3HHGA 3F8FA 5A2QZ 2A07F 5H6RA 3SQNA 2UXXA 2HKOA 3PQKA 3W6KB 4E70A 2OZ6A 2ACJA 5CVUA 2K7LA 1B9NA 2W57A 4LG0B 3D0SA 2KIUA 3SHFA 2O0YA 3S2WA 3N97A 5E17F 4LJZF 2L02A 4LLNA 1BC8C 3GWZA 1FPQA 2EV6A 1KGSA 1HBXG 4HF1A 2PJPA 2OZUA 1YW7A 1JXSA 5E18F 1YS6A 5LEJA 3BPVA 2V1UA 2L4MA 2CO5A 2EK5A 3L00A 2RV8A 1B59A 4BHCA 1MJ9A 1SFXA 2D45A 1MDMB 3I58A 4RAYA 5FO5A 2A6HF 3V7SA 3BPXA 3L09A 1ZG5A 1LQ1A 1T39A 1KU9A 3CUQB 1CF7A 2D2WA 1LB2A 3I5UA 1STZA 3QRFF 3ZMTA 2H94A 3M1EA 1KQ0A 2GA1A 2M1BA 2VN2A 4U7DA 4ZZLA 4XLPF 4XRFA 1LDDA 2XAHA 3QOPA 1XDSA 4WXCA 3RKWA 1WWXA 1GVJA 3V7RA 3GFLA 2V79A 1PUEE 3BWGA 4A12A 2JTVA 5LLQA 4ASNA 2YSRA 3R0JA 3RIRA 2FA5A 1J5YA 2M5WA 3PFIA 3JTGA 3Q5FA 3R61A 1FNNA 4KMFA 1VTNC 4OIOF 1TTYA 1G3WA 4KT5C 3HSFA 4XLNF 3J80Z 3VFZA 2CFXA 1SMYF 2V1XA 3KP3A 2XGXA 2IA1A 2DK5A 1BJAA 3KCCA 1RZ4A 2OQRA 1SD5A 3L7WA 2Q8KA 3QU3A 1IN7A 1UB9A 1J59A 2GA2A 5A2QK 3JAMK 5FD5A 4PCQA 5HDNA 5L3GA 4YFKF 1OYYA 5LEKA 3QP5A 1FP1D 1BI0A 2YU3A 4RS8A 3BJOA 6PAXA 5DD4A 4MQ9F 2VXZA 1QGPA 1TNTA 2P7CB 4EGZA 4FX4A 4EGYA 3MZHA 3SZTA 1I1SA 1HSTA 3FMSA 2ESHA 2XIGA 1R00A 4MNUA 5FFZA 2P6SA 4BYYA 1R1TA 2FBIA 4UXNA 3DQVC 3DP7A 5K5RA 1ZLKA 2FOKA 4HBLA 2O61A 5JHUA 1ZH5A 2JT1A 3WE3A 2VBXA 5EEGA 5F6FA 5ILUA 1OMIA 4F7ZA 3H92A 1FBQA 1RIOH 1WKMA 4WX9A 3LAPA 2HQNA 2QBYA 1I5ZA 2JRTA 1ZGJA 3MWMA 4JQFA 3SXYA 1TNSA 1PDNC 3CLOA 3K1PA 5KVRA 2CGPA 2MBFA 3WU0A 2XHKA 3WE2A 5HS9A 4ETSA 2DQLA 3IL2A 4H0EA 2PLYA 1OKRA 1IZ1A 1EH6A 1Z05A 4DQ2A 1I27A 1IN8A 4RGUA 4MEYF 1XD7A 4EQQA 4IHSA 4K2EA 3CJNA 3I64A 3WTXC 4OIRF 1SFUA 2ZNYA 1UHMA 2OAZA 1XCBA 2OA4A 4BH9A 3J80K 4RGXA 4EJVA 3ZMDA 1EV7A 2FMLA 3EYIA 3HSRA 2MA3A 2YX7A 4ENMA 1QZZA 2EB7A 1YIOA 4EJUA 3EYYA 3CO7C 3I71A 1J9IA 2RC4A 2O03A 1YFHA 3NEUA 3J81Z 1ZN2A 3I4PA 4B8XA 2ETHA 4RB2C 1E2XA 3I59A 1EH8A 1HW2A 3P9CA 3KEOA 3F72A 1FBUA 2HQRA 1BIBA 4Q4ZF 2KKOA 3DXJF 1YTYA 5D6EA 4L0YB 1LVAA 3E97A 2HFHA 2XKPA 2DPDA 1OYWA 4P9FA 4ZH4F 4WCGA 4A6DA 5LRRA 3WGGA 2M30A 4M9XA 2JSCA 1BI2A 1YG2A 3JTHA 2M8EA 2XRNA 2Y75A 3IKVA 2QM3A 1MKMA 2F5EA 2Z5UA 4M6YA 4FHTA 2FQ3A 2Z33A 3K69A 1ZRFA 2HTJA 1A04A 5DUIA 3E6BA 3RJPA 2K27A 4RB0A 3JSPA 3E5QA 4AWXB 2BGCA 3TO7A 4OIPF 1DPUA 1FX7A 1Q1HA 3P9KA 3BJ6A 3KP4A 4KIBA 1K79A 2MH2A 2ZCWA 4XBFA 2H27A 3CO6C 2YR2A 4N9HA 4M6XA 1XSVA 3DKWA 5D5XB 1FSHA 2DAOA 4OMYA 1IUYA 1S8NA 4KIGA 4HA8A 1YS7A 2ZBKA 1ZREA 5E8IA 1JE8A 3LAJA 1WQ2A 4UVBA 1KQ9A 3HRUA 4UVCA 4ZYDA 2QZ8A 3ZMVA 3EETA 2ZFWA 4WWCA 3MEXA 4PZJA 3DPLC 5JFRA 5LHGA 5BOXA 2ZO4A 3VEPA 1BN5A 1USTA 4S05A 4ESFA 2QYOA 5J8CA 2ZXJA 3L9FA 2VT3A 5DV5A 2BEOA 4A6EA 3ISPA 1IF1A 3T5XA 2O8XA 2XAFA 1TQIA 3MCZA 1E17A 4LB5A 4OIQF 5AIPA 3KP7A 4XSXF 3GVAA 3K0LA 3TDZC 4YFXF 2XAJA 3U1DA 3DFGA 3RPQA 5FFXA 1P6RA 1BBYA 4EVIA 3WTYC 4ON0A 5ERIA 3LQRA 1U8RA 2AS5F 4MHGA 1OYIA 1YYVA 4IRHA 2RQPA 5DEQA 3JAMZ 3IWFA 3ULQB 4UNOA 3M7GA 3G73A 2DFIA 2RKHA 2ZMEB 1T2KA 1G6NA 5HLIA 2DBBA 4CXFA 3K1MA 1C0WA 3BDDA 1QZYA 3DEUA 3F22A 2F5FA 5IT3A 5JR3A 1LEAA 5LBQA 3L2CA 1MD0A 4RAZA 4KIFA 1MGTA 4CO8A 2FBHA 2FXAA 4WXDA 1ZARA 3I59B 3F8BA 3GLXA 3R6SA 2A61A 2QLZA 2W85A 3QPHA 3ZP5A 1U2WA 2H6BA 2EWNA 4U0WA 1XSDA 4EJOA 2OU2A 5AIQA 3GF2A 3PQJA 3FXQA 1BC7C 3ZN0A 2A5YB 2OD5A 3W6JB 1ODDA 2FSWA 3IKTA 2Y48A 3TOBA 5E1WA 2PMUA 3E6CC 4KN4X 1FYLA 2ELHA 2VONA 4KICA 1BM9A 4I02A 2FU4A 1SD6A 1OPCA 3AAFA 5ICCA 3CDHA 1GHCA 2LF7A 2O3FA 4ENJA 3EDPA 2P4WA 1IAWA 4PDKA 5CLSA 1YW8A 2NAZA 1BOAA 4CZZA 5L3FA 1P92A 4HW0A 2A69F 2PN6A 3GX4X 1SFEA 3O3KA 2PQ8A 3RPUA 4ESBA 1TW2A 3V8JA 4JBAA 1R5HA 5K5OA 1FY7A 2QENA 4G7ZF 4M71A 2R7DA 5J8FA 3IRRA 1ONVA 4IRIA 2NRAC 2O6GE 3H3UA 3KLOA 1H0MA 3T1BA 5E1ZB 3F8NA 4IVNA 2XVCA 4MTEA 2GXBA 2HYGD 1EH7A 4NQWA 3KP2A 3QPTA 2R3SA 1XGSA 1S7AA 2B0LA 1TQMA 3KZYA 3HHHA 5ILVA 1IRGA 4IPAA 4A0ZA 3LWFA 1DP7P 2CW0F 4BHPA 4O5VA 5D4SA 2VT2A 4QLCU 2EV5A 1F9NA 4Y13A 1KYZA 2XAGA 2DW4A 1O3SA 1HKTA 2RDPA 2E1CA 1FYKA 1BI1A 4L9TA 3BP8A 3FXUA 3LA2A 2QQ9A 3DPTA 2IA0A 2GQQA 5CVJA 4MQVA 2P5LC 1ZHFA 1J75A 4TV7A 2XASA 4HAMA 4AD9A 4HDUA 4HX8A 4AIJA 4ENNA 4XSZF 4L5IA 4R8HA 4PGGA 3K9TA 1W7PB 3LA7A 1YW9A 1UFMA 3TQNA 3P7NA 2PG4A 4I0AA 4L5JA 3COAC 1T98A 4GO1A 1ULYA 5LGUA 2FE3A 1YLFA 1FT9A 4Q5SF 3KE2A 2M45A 3OOPA 4EJTA 2PEXA 1UCRA 4A0YA 1NHAA 1B1BA 2TDXA 3BZ6A 4A0XA 4BXUA 1G3YA 4OU0A 4NHJA 3HIFA 4EM0B 2FNPA 4A2UA 2ESNA 5H20A 4UV9A 1R23A 1LEBA 3ML6A 3WTVC 3HUGA 4A5NA 4U88A 1IN6A 1IRFA 1LDKB 2JPBA 1W7PD 2P5VA 1R1VA 2LF8A 3KLNA 1U5TA 3GZ5A 1ZRDA 3E6MA 4IF4A 4P5OA 3T8RA 2LKPA 3M8FA 3FMQA 1FSEA 4MGRA 3J7AO 1IW7F 4M9SA 5FD6A 4LMYA 4OINF 4HYEA 3SZPA 3FWEA 1Z1DA 4AIKA 5L3EA 1CF7B 4MEXF 1FYMA 2VE9A 1H9TA 1USSA 2IPQX 3O2PE 2VC1A 5ED4A 1V3FA 1ON1A 3IWZA 4LLLA 1R7JA 2A3SA 2MLKA 1TQPA 2P8TA 5CVIA 1G3SA 3ECHA 3RKYA 3R4KA 2UZKA 2BV6A 2QQAA 2HEOA 1S7OA 1HQCA 5D5WB 3KEQA 3ZMZA 1DPRA 3ZQ7A 4G9YA 4LG0A 2KIFA 1O3TA 4LLGF 2V9VA 1D8KA 1DDNA 1X3UA 2G7UA 3P9IA 3WTSC 2P5KA 4HLXA 2EA4A 4HV5A 1T6SA 3VB2A 5D5VB 3ZMUA 5HLHA 2RGVA 3B02A 3FM5A 3REOA 5L3CA 3BROA 1MJAA 2QWWA 3CTAA 1J7KA 1BI3A 4KDPA 3JSOA 4DNCA 4LFUA 3GZ6A 1D5VA 5DCFA 1MJBA 4Y17A 3BY6A 1W4MA 4Q47A 3RI4A 2G9WA 1IXSB 1MDMA 5L3DA 4LB6B 2GWRA 1Y0UA 1FC3A 3I54A 3V8LA 1XMAA 1RUNA 4WXHA 3HOSA 3LA3A 2ZKZA 4M72A 4HF2A 4G94A 1XGMA 1AWCA 2ZNZA 3WTWC 2D1HA 4RGSA 2IW5A 2MD5A 2CWEA 1TW3A 3T0YA 3GO5A 3VOEA 2IRFG 4UUVA 3D5LA 3TO9A 2RN7A 1I6XA 2Z9OA 5EEHA 3FX3A 3WGIA 3HTUA 4YIFA 4EJWA 2W25A 4HQEA 1V4RA 2BBYA 2QBYB 2LDUA 4ESJA 5BMZA 1LJ9A 5LHHA 1SD7A 3FZVA 5BQTA 3QAHA 3KP5A 2VE8A 4HLYA 4HF0A 4LK0F 3TOAA 1IXCA 5LRSA 3F8MA 1T38A 4CICA 2K4BA 2COMA 4EM1A 4WK8F 2QQBA 4G6DA 2F2EA 2Z99A 3WTUC 1HXDA 2PI0A 2OQGA 3WG9A 3I53A 1ZG3A 4JK1X 1REPC 2CQKA 2Q0OA 4FT8A 2FBKA 4U0YA 2RNJA 3HRSA 4GYGA 5BPDA 5DUKA 4M9ZA 4IXAA 1FOKA 5H6QA 1T0FA 5D8KB 1DUXC 1ON2A 1OR7A 3MFKA 4MTDA 3OV8A 5BS6A 2MH9A 2YPRA 2FMYA 2EFOA 5DCMA 2OBPA 1XSXA 2HWVA 1J0RA 1FP2A 3WU1B 5DYMA 4GGGA 1XB4A 1P4WA 1K7AA 5FLXZ 4GCVA 2LNBA 5D4RA 2FEZA 2DLLA 4I7HA 5ILSA 1K78A 1SAXA 2IJLA 1G4DA 2K4JA 2FRHA 2HZTA 2EFPA 2EV0A 2ZJ2A 4YFNF 2Y0MA 2G7HA 1XCVA 2DO7A 1W5SA 4S04A 4L9VA 1QPMA 3GEZA 4Z2YA 1Z9CA 2E1NA 4Q48A 2UWMA 3LFKA 3TDUC 4ZYEA 1JHFA 1FLIA 1AOYA 3E6DA 1HSJA 5KK1A 3ZMSA 2J5OA 1JHHA 2E7XA 1P2FA 4U7BA 3M9AA 3M8EA 5TJJA 1KU3A 3GFMA 1XGOA 1BIAA 4BHBA 4OMZA 1ZLJA 2Z3YA 3KZZA 4CHUA 3TO6A 1O7FA 3NRVA 4GYIA 2L3DA 3IHUA 2XROA 1U6GA 1FZPB 1IN5A 2EJRA 3JW4A 3ROUA 3C18A 5FB2A 4RB3C 2BE5F 5L3BA 4M73A 1RNLA 2WC2A 3Q9VA 5K5QA 1O7LA 1KQ8A 1I1GA 2DU9A 1LNWA 4HV6A 5HDGA 1YQAA 4YIIA 2ISZA 1D3YA 1F5TA 4UVAA 1J2XA 3FHZA 2GAUA 2Q2EA 5D5UB 2KRFA 3QU6A 2F5DA 1U3EM 1H9GA 1FWZA 4P9UA 3V7CA 5LGNA 3GYHX 4UV8A 4HDVA 1YO5C 3RKXA 3HSEA 1K6OA 2W84A 4IRGA 5HVQC 5FLXK 1F1ZA 1G3TA 4LD5A
chains in the Genus database with same CATH superfamily
1IO2A 1WJCA 2L4AA 2DOEA 4J01A 4RBOA 4PFPA 1NH3A 2CW8A 4U0VA 2HQ5A 3N05A 2EFNA 1GXPA 3G71I 1QRYA 3BZKA 4DIQA 2HZDA 2HYFA 2H09A 4BBSJ 3R0AA 3AG4H 3EPZA 2IAIA 3C2HA 3HM5A 3IRQA 1IJWC 4C2TA 1UG0A 2JZYA 1G59A 1B6AA 2GIVA 4ZDLA 1MSFC 1VZ0A 3CCLI 4CGZA 1Z67A 4O3MA 2YX4A 2EA2A 4C3HJ 3WODF 3HPGA 1QO0D 1JGSA 3SFZA 5FGMA 4LITA 3WGHA 2W24A 5FKKA 4P96A 3S32A 1ZG1A 1QNTA 3V4GA 3HPHA 1GT0C 1WZ2A 3BJAA 2QKMB 1N75A 2IP2A 2XAUA 2FQ4A 2XKOA 3OYNA 3F8CA 3A1YA 2K9MA 5EZGA 2C6YA 4X0GA 1K83J 3OIQA 5F27A 2FJ1A 3FKIJ 2XB0X 3LSHA 3MAJA 5HLTA 5CYVA 1WSUA 2JN6A 1QA6A 2YU9J 3A2KA 5E20A 2DYSH 1PUFB 4G6QA 4PK4A 1TL8A 2QVOA 2F5VA 2LP0A 5E3NA 3RYPA 1XMXA 2BYVE 3OYHA 4L9NA 2MFZA 1BW6A 5DCMB 3NQOA 3S3OA 5B1AH 2STWA 2L7KA 2XB5A 4IOCF 3FXRA 4G7HF 3OS1A 2HR3A 2LOOA 2V1DA 4IO9F 2VB6A 4CCKA 3O6BB 2V26A 3ZQHA 2DFHA 2IVMA 2WV0A 4E7JA 1R5GA 2DTRA 4C9YA 2W82A 3TP3A 1RPWA 4ZYHA 1MBFA 2GLOA 1K78B 4I0BA 1XDUA 5HS7A 4I2OA 2HQAA 2GOMA 2ZC2A 3FISA 3GXOA 2WWYA 4KT6A 1JUPA 1HDDC 2VODA 2M7AA 2EFQA 3IP4B 2BY1A 3TGNA 5DDGA 4XL9A 3BTIA 5D8LB 3PIPF 2R7ZJ 1UELB 2UUZA 2EZLA 3E5UA 1R22A 4RA2A 4YG2F 5GAGJ 2PMHA 1E3PA 2NNNA 3B6AA 1F43A 2F5CA 1UHWA 1VI0A 5AONA 2Y9ZA 2GIZA 3C7JA 2MLGA 4AVPA 5HNHA 5E8GA 4FASD 2NVUB 2CYYA 4WF2A 3ZOBA 1T8IA 4BQAA 3FM3A 3HKZN 2DA1A 3DBLB 1KA8A 4KN7X 1NG7A 4MIMA 2DT5A 5HLGA 1R58A 2M2EA 1G8XA 1Z6TA 4G8XA 5TRDA 1KU7A 2AXTC 3CUOA 2R7TA 1IXRC 5F0FA 3H5AA 2XF7A 1U5TC 2MC3A 4Y3OA 3TKYA 4DGWB 4RM3A 2QCOA 3VYUB 3G3ZA 3FXOA 5EDNA 5FKOA 4UHTA 2NS7A 3BOQA 3C2BA 1HW5A 5CQGA 2VOOA 1FBSA 4D9JA 3A02A 1XN7A 1O3RA 3C3WA 1S6LA 3DF8A 4XRSG 4HNUA 2GZWA 4CDGA 3F23A 2HDCA 2ISYA 2OF7A 5IP9J 2IT0A 1P4AA 4PGHA 3QP6A 4NUBA 3LSTA 2DCEA 4D5FA 3ABUA 1AU7A 3KFWX 3BCBA 2J5PA 2D1VA 3RYRA 4HRIA 3GUDA 3AG1H 4FX0A 3TMOA 5F64A 4Y4RA 2EFWA 2H6CA 3WTTC 1JKRC 1OCOH 2V7FA 1FEXA 1ETQA 2HOEA 2R7SA 5D6FA 3N4MA 4IHTA 3ASOH 4ZYGA 1LDJA 1V5EA 3EUHA 4BL0B 2Y31A 1IC8A 4KA4A 1RR8C 3KIOA 3I4NJ 1WRJA 4CCJA 4IJAA 3E3VA 2CU7A 3K1NA 2JWTA 3MKZA 3RKQA 2P6TA 4AIHA 2VXDA 4XKVA 4RDUA 3MZ8A 1B4AA 4D7MA 1FOXA 1M1EB 5FKLA 2KJCA 2L54A 2VJ4A 3HRMA 5LHIA 4R1HA 4L0ZB 3F6OA 3GTPJ 5LGTA 2LKSA 2X9DA 2XSDC 3GZNB 3K2AA 2ECBA 4ZZDA 2NNYA 4H4KC 2IA2A 3CC2I 4E6KG 3H9QA 5HS8A 1XG1A 1HOMA 4AYBN 2M4KA 3KETA 2M87A 2Q2EB 1XGNA 1I3AA 3DKYA 4KFCA 2ZMEA 2HGCA 1GXQA 3HL2A 2NYXA 5E1XA 1SD4A 1K4SA 5IT9Z 1Z7UA 2XDVA 3EQLF 3M07A 1KZHA 5CVRA 2V6EA 3FF5A 1WJFA 3OYCA 1XMKA 2UXNA 5ICFA 4EV0A 2EZIA 4CYDA 3F6VA 2HKXA 3G1OA 4BJ6C 1O57A 3SZGA 1A5JA 2ADUA 3RQ4A 4KYWA 2VBZA 3M1CA 1HKQA 1E3OC 1Z91A 2QUFA 4F93B 1NK3P 4A93J 2NS8A 2IS4A 3HKZA 3ZPLA 2HPMA 4NQWB 5JI6A 1XTAA 2VBWA 2HI3A 5HDKA 1OCCH 3E1SA 3M4OJ 1QBJA 2XPVA 2Q1ZB 4DYQA 3WHCA 2L0KA 4QWQA 4A5MA 4KISA 2XV4S 3ABTA 1W1WE 4L9JA 5DD8A 1O3QA 5JVTA 3HTSB 3K7AJ 3CMMA 4D0PA 1ZRCA 3MMYB 5CJ9A 3R60A 2CW7A 1V54H 1CGPA 2X4HA 3DTEA 3OSFA 3CMEI 3MQ0A 5K1YA 4RMNA 2VC0A 2K3FA 4XK4A 4N9IA 3VODA 2NVYJ 2PBIA 3RPUD 3F3XA 3J7ZI 4I01A 4B48A 4BE2A 3JRHA 1D8JA 4M74A 4EMSA 4HZFA 3CUQC 4CSWA 3HOTA 3PFYA 2EZHA 5GAHJ 3WTZA 1FIAA 3OYFA 3T8TA 4V19K 3Q9SA 3LQQA 4LK1F 1EJ9A 1IN4A 4C2UA 2K02A 2JMWA 4NB5A 2DXIA 2V9PA 1S29A 2FD5A 3ERED 1F4KA 1HKSA 3CJTB 3CUQA 4I09A 2CG4A 1SMTA 2M4GA 5HOOA 3HRTA 5IP6A 1ZGWA 3S2HJ 2VUMJ 1GLNA 2XUBA 4CCLA 2JPCA 2HDWA 4A3MJ 5M3MJ 4GXOA 2R7UA 4FE7A 1R6RA 1B9MA 2A6EF 4BAYA 3BR3A 1D5YA 2HTSA 2Y0SN 2YUSA 5DM7F 1SVLA 2VASA 3KPHA 4LIUA 3IC7A 3RDIA 3S3MA 2OUMA 1W5TA 3LSKA 3BCAA 3PSFA 3GW2A 3PIOF 2OJED 1WI3A 1HW1A 2HOAA 4N0BA 2W00A 2X51A 1DQUA 2KJBA 1RI7A 1Z6RA 3E5XA 5FLVA 2VBYA 2ELJA 2X0LA 4A3FJ 5KHDA 1MZBA 4BNCA 1KYWA 1TBXA 4EATA 2X6OA 4F92B 3DU6A 3HYIA 3AL0C 3PNTA 3OIOA 2XGEA 4AYBA 2V6CA 2BY3A 1RC9A 1PP7U 1R1UA 2KDOA 2DI3A 4LGWA 4P55A 5EF6A 4HQMA 2ZJQF 5E3OA 3FMRA 1U78A 4I98B 2AO9A 3JRCA 3DLLF 4O6JA 3TL4X 3F21A 2STTA 3B73A 5K7ZA 3GFJA 1S3JA 2A68F 3ZN1A 2ZJRF 1F36A 2AXLA 5ICGA 4R79A 3VYTB 1P4XA 1RUOA 4RB1A 2WBMA 4RGRA 4EM2A 2K86A 2P7VB 3MZYA 2FX0A 2RVCA 1MMGA 2NS0A 3ZGKA 4XRMA 3K2ZA 3CCJI 2L01A 4QTRA 3Q0UA 5EG0B 2DPUA 2HDDA 2ECCA 1R36A 1LE8A 2LSOA 1JTYA 5CQEA 1Y8RB 1PP8F 1RETA 2L2OA 4HX4A 1ZGAA 3OL4A 1BOBA 2M0MA 4IL6C 5GAEJ 1TWAJ 2VQLA 1VQ4I 5H2FC 3K6GA 3QOEA 5J6XA 3WG7H 3GFIA 3U2RA 4G7OF 4HX7A 3CDLA 1T0FC 2VPLA 4OWRB 2V1NA 1L3LA 2FNAA 1U0JA 1OR7C 2V9KA 2JA8J 2MGQA 1SANA 3V8KA 2H1KA 2XAQA 2RQQA 1TT5B 2XRLA 2CQNA 4KNYA 2VJ5A 2WTEA 5IT9K 3D5RC 2DJIA 2OC6A 3DV8A 4HOBA 5FJ8J 3J81K 2GXGA 4CH7A 1KU2A 1ZYRF 4B09A 2PFBA 1U5TB 2CQQA 2PJRB 3I56I 1QQIA 2DK8A 4OOIA 1CQTA 3RTRA 3KZIC 2FF4A 5F1RA 5FRNA 3LSMA 2E7WA 3H3ZA 1IV8A 2DQRA 1ITYA 3CC4I 3M3YJ 3L2RA 2EIMH 4KMUX 3BG5A 2YS9A 2W48A 3HOYJ 1TWFJ 2WAFA 2KRHA 2R7FA 4CUGA 5J47A 4C3IJ 2HYJA 3KP6A 3ECOA 3G1LA 2VPRA 5CVVA 1GUUA 1L0OC 3DEWA 3IV5A 3ELKA 2CSOA 3I0TA 1D1BA 4JP0A 1MBKA 5GTIC 2PMZN 1WI9A 2Y2ZA 4ENKA 2Y30A 1W7PA 1VF9A 1JTXA 4BQQA 4KUMA 2KIMA 2VOPA 4L18B 2HS5A 3C1DA 4Y15A 3DEEA 5BPIA 3W2VA 3U9GA 5ICEA 1W36C 1TLHB 1ZAOA 2OCEA 1YX5A 4FE4A 3OYKA 3HHGA 4BQNA 2DA4A 2DYRH 3CESA 4ABZA 1U8BA 1YJNI 3F8FA 5A2QZ 3LNQA 2A07F 5H6RA 4NDLA 2EBIA 3IH4A 4LG3A 3SQNA 2O9LA 2UXXA 2HKOA 3PQKA 3W6KB 4XKWA 4E70A 2OZ6A 3GTMJ 2W4SA 1UAAA 2ACJA 3H36A 4BEHB 5CVUA 3ZQFA 3AG2H 1GDTA 2CFOA 1QHHD 2K7LA 2EINH 1B9NA 3F9KA 1R5ID 2W57A 2KRCA 2W7NA 4LG0B 4CCMA 3D0SA 4DOZA 2KIUA 4I99C 3SHFA 2O0YA 4JOMA 3S2WA 3N97A 5E17F 4LJZF 3ESWB 2L02A 4KITB 2RREA 4E4HA 5JHFA 3CCRI 4LLNA 1WH7A 2L9VA 1BC8C 3GWZA 3CP8A 1FPQA 2CV0A 2EV6A 3D5SC 3RSNA 1KGSA 4UUSB 1HBXG 4HF1A 2PJPA 2LR8A 2OZUA 1YW7A 3HDDA 1GV2A 3OMYA 4YIRX 2KMUA 4PSWA 1JXSA 5E18F 2BW3B 2FOWA 1YS6A 2K9NA 3LSJA 5LEJA 3BPVA 2V1UA 1WCMJ 2E60A 2L4MA 4A3EJ 2CO5A 2EK5A 4I76A 3L00A 3UR3C 3G4SI 2RV8A 3S16J 3TBIA 1B59A 4BHCA 4FTHA 1MJ9A 1SFXA 2HOTA 2D45A 1MDMB 3I58A 4RAYA 4E7ZA 4M3GA 1DP3A 2R5YB 3MN2A 5FO5A 2A6HF 3V7SA 1VQ5I 3BPXA 1PJRA 4E7LA 3L09A 2DMUA 2MABA 1ZG5A 2CUZA 3GTQJ 3IAS2 2E1OA 5EYRA 2IS2A 1LQ1A 1T39A 1KU9A 1V5GA 3CUQB 1CF7A 2D2WA 5FKMA 1LB2A 2KL4A 2L5QA 1ETVA 3I5UA 4BJ5C 1W5CC 3S2DJ 1STZA 2W1OA 1YE9A 3QRFF 2PMZA 3ZMTA 2G0EA 2H94A 3M1EA 2A5WA 2M34A 1KQ0A 2GA1A 2M1BA 2VN2A 4BKXA 4MO7A 1QHGA 5F0HA 4U7DA 5JVGF 3BR6A 5B3SH 4XLEA 1ACIA 4ZZLA 4XLPF 4XRFA 1B72B 1LDDA 2XAHA 3QOPA 1XDSA 4WXCA 4XLHA 3H35A 2Z16A 2ME0A 1TWHJ 3RKWA 1WWXA 1GVJA 1SFKA 2VL8A 3GCMA 3V7RA 1V5FA 1R71A 3GFLA 4B44A 2V79A 1PUEE 1JUSA 3BWGA 1MBHA 2JTVA 5LLQA 4A12A 4ASNA 2X6WA 4AC0A 5GP9A 3FDYA 2YSRA 2WAQN 3R0JA 3RIRA 2FA5A 5B5EC 1J5YA 2PX9A 2QSGX 2M5WA 3PFIA 3JTGA 3Q5FA 3H0GJ 1FNNA 3R61A 4KMFA 1OISA 1VTNC 3PO3J 2E1MC 4OIOF 5J4VA 1TTYA 1G3WA 4KT5C 3HSFA 4XLNF 3J80Z 3BR2A 3VFZA 4AIDA 4ZJZA 2CFXA 1SMYF 2V1XA 3KP3A 2XGXA 3K4KA 3NWTA 4IOAF 2IA1A 1A31A 2DK5A 1BJAA 1WHUA 3DTIA 3KCCA 1RZ4A 1YITI 2LKXA 2OQRA 4RAGA 1QVUA 1SD5A 3L7WA 3QWLA 4MLOA 2Q8KA 3QU3A 2LG4A 1IN7A 1TWCJ 1UB9A 2B7EA 4UB8C 1J59A 4C2MJ 1SFOJ 2GA2A 5A2QK 3JAMK 5FD5A 4DJAA 4J19A 4PCQA 4QPOA 5HDNA 5L3GA 4YFKF 1MNMC 1OYYA 5LEKA 3QP5A 1FP1D 2JA5J 1BI0A 3TW7A 4NBQA 3H0DA 3SEZA 2YU3A 4RS8A 4BGDA 4F3QA 3BJOA 2QEXI 6PAXA 3L2QA 1Z77A 5DD4A 4MQ9F 2VXZA 3M8JA 1ZELA 2DMQA 1QGPA 1SAUA 1TNTA 2P7CB 4EGZA 4FX4A 1MMSA 2JA7J 4EGYA 4XR6A 3DWLE 5FKNA 3MZHA 2ZJPF 3BT9A 3SZTA 5DTDA 2WAEA 1JT0A 1I1SA 4HG2A 1HSTA 3FMSA 2ESHA 2XIGA 1R00A 4MNUA 1W0TA 3S15J 5FFZA 2OTLI 1IUFA 2P6SA 4BYYA 1YJ9I 1IG7A 3OYMA 1R1TA 2BVMA 5E3MA 1T95A 2FBIA 4UXNA 3MKWB 3CLQA 2IGNA 3DQVC 3DP7A 1SEUA 3IAM2 5K5RA 2ME6A 1ZLKA 2XC7A 2FOKA 4HBLA 2O61A 5JHUA 4A3IJ 4RLFA 2XF6A 2B9SA 5J3LA 1ZH5A 1ENHA 3LMMA 2JT1A 3WE3A 2VBXA 3QPLA 4XONA 5EEGA 2BHZA 5F6FA 5ILUA 4NNJA 1OMIA 1Y1VJ 5IYDJ 4F7ZA 3VWBA 3H92A 2E19A 1FBQA 1RIOH 1X1DA 2ID6A 1WKMA 5M5XJ 1JKQC 1RRJA 3PL8A 2CUEA 4RAFA 4WX9A 4PJ0C 3LAPA 2HQNA 1D0ZA 1X1BA 2IBDA 2JJ7A 3HXLA 3PM1A 4JX5A 1VQ9I 2QBYA 1I5ZA 1XX5A 3DLAA 2D5VA 2JRTA 1ZGJA 1UG2A 3MWMA 1A6QA 4JQFA 4C30A 3SXYA 5B66C 1W0UA 2NVQJ 1TNSA 1PDNC 1Z21A 1N77A 3CLOA 3K1PA 5KVRA 2CGPA 4UUTA 3OYBA 2K40A 2MBFA 5F08A 2XHKA 3WU0A 3WE2A 4NC8A 5HS9A 4ETSA 3CCQI 5F1JA 1EA3A 1LVKA 1R4MB 2DQLA 1Z7LA 3IL2A 4H0EA 2PLYA 3LSPA 2IS6A 1OKRA 1IZ1A 3KEYA 1XS9A 1DGRM 3H5NA 1X19A 1EH6A 3EUKL 1G2HA 4BU2A 1Z05A 2NVXJ 4A3DJ 4DQ2A 1I27A 1IN8A 3CZ6A 4RGUA 4MEYF 1BJZA 4XLCA 3HOUJ 3EUHC 2VKDA 2E35A 3JRGA 1XD7A 4EQQA 1ZR2A 2M8GX 4IHSA 4K2EA 3CJNA 2BOLA 1QZEA 3I64A 2ZSHB 3WTXC 4XORA 4OIRF 2ZNYA 1UHMA 1SFUA 5CPRB 2DA2A 4DW6A 4N4NB 2WV1A 2OAZA 5EGOB 4IX7A 1JT6A 1XCBA 2AHQA 2OPTA 3A01B 2Z1DA 2OA4A 4BH9A 3J80K 3BR5A 3CF5F 2LREA 3AFHA 4RGXA 3SEQA 4EJVA 3UNGC 3FK6A 5IYBJ 3ZMDA 2QA4I 3GTLJ 2ZMEC 1EV7A 2FMLA 2N8GA 1FTTA 1K6YA 1D0YA 2A6TA 3EYIA 3HSRA 3MKLA 2MA3A 4B3AA 2YX7A 4ENMA 1QZZA 3JREA 3CMYA 4GRIA 3OR1C 3ZCOA 3FBIB 2EB7A 4X1EA 1YIOA 4EJUA 3EYYA 2K9LA 3CO7C 3I71A 1J9IA 2RC4A 2ZB9A 2O03A 1YFHA 1YHQI 2E2IJ 3NEUA 3J81Z 2E36A 4IZZA 3OYLA 1ZN2A 3I4PA 1E0EA 3ZQGA 5GPCA 4Y33A 2LD5A 4B8XA 3DPUA 2ETHA 2R7OA 4RB2C 1OQYA 5FRMA 1LFBA 1E2XA 3I59A 1EH8A 5C3EJ 2R5ZA 3CCUI 1HW2A 1SVOA 3A0BC 3FXJA 5JLWA 1JJ6C 2JVHA 4MFDA 4W97A 3JRDA 3P9CA 4BUPA 3HOZJ 4XIDA 3KEOA 3ERMA 4HEA2 3F72A 1FBUA 2HQRA 3BQZA 1BIBA 3H1CA 4Q4ZF 1AKHA 2KKOA 2L9SA 3DXJF 1YTYA 3L2WA 5D6EA 3BZCA 4L0YB 1OFCX 1LVAA 2VIXA 2DJNA 1WGXA 3E97A 2HFHA 2M9HA 4BDZA 2XKPA 2IGOA 1OYWA 1X2MA 2DPDA 1PVEA 4P9FA 4ZH4F 2BXYA 4WCGA 4A6DA 4QSHA 5LRRA 3WGGA 1JJ8C 2E1MB 2M30A 3CDIA 2BVLA 3E7LA 4M9XA 2JSCA 1BI2A 3L2VA 3GMEA 1YG2A 1IRXA 3JTHA 2M8EA 2XRNA 2Y75A 3IKVA 2QM3A 1MKMA 4A69C 1D1CA 2F5EA 3I3LA 2Z5UA 4M6YA 4FHTA 3I55I 2FQ3A 2Z33A 1EF4A 3K69A 1ZRFA 2HTJA 3ZQIA 4XICA 1A04A 1D1AA 3BLYA 5DUIA 3E6BA 2HVQA 3J7YJ 2KDZA 1XC5A 1Y6IA 3ZR8X 3RJPA 4Y7NJ 2K27A 4RB0A 4DZJA 3VPRA 1TT0A 1LPQA 3JSPA 3JRIA 1OLTA 1H89C 4Y52J 3E5QA 4AWXB 4ZC3A 2BGCA 3TO7A 2IXSA 4AM3A 4OIPF 3P5JA 1DPUA 1FX7A 1Q1HA 3P9KA 2B63J 1T33A 4FETA 3BJ6A 4Z6YA 3KP4A 2LC2A 4KIBA 3QYEA 1K79A 3H9JA 2MH2A 2KLOA 4FQGA 4W1UA 5M5YJ 4IHWA 2ZCWA 4XBFA 2H27A 1HA8A 1Z3XA 3W3CA 3Q0WA 3CO6C 2GOXB 2YR2A 4CYCA 1Y8QB 4N9HA 2IGMA 4M6XA 5DS9A 1XSVA 2WADA 3DKWA 5D5XB 2X1CA 1FSHA 1MH4A 2DAOA 2F6CA 4OAYA 1UHSA 2F48A 3HOXJ 4OMYA 1IUYA 2P0WA 1ZR4A 1S8NA 4KIGA 4HA8A 1YS7A 2ZBKA 1Y1WJ 3QYFA 3CCSI 1ZREA 5E8IA 2H8RA 1IDZA 3O8HA 1JE8A 3LAJA 2O7OA 1RKTA 3J7AY 1WQ2A 4IHYA 1YX3A 1RR7A 4UVBA 1NG6A 2CUFA 1BR2A 1KQ9A 3HRUA 4UVCA 4ZYDA 2QZ8A 3ZMVA 3EETA 2ZFWA 2RAEA 4WWCA 1LFUP 3MEXA 4XLFA 4PZJA 4ZDPA 3DPLC 5JFRA 2QSFX 3PNYA 5LHGA 5BOXA 3IUOA 4XOTA 2ZO4A 3U21A 4GFBA 3VEPA 3JRAA 1BN5A 1USTA 1H88C 3JRFA 1BR4A 4S05A 4ESFA 3OR2C 2QYOA 5J8CA 2FUG2 2ZXJA 3L9FA 3HC7A 2VT3A 5DV5A 2BEOA 2DT6A 4A6EA 4RM2A 3ABMH 3ABKH 1TP4A 3ISPA 1IF1A 3T5XA 2CQ7A 2O8XA 3GTGJ 1U9NA 4YELA 2XAFA 1X1CA 1FOWA 1TQIA 3Q0VA 3GTOJ 3MCZA 1E17A 5HODA 1MSEC 1VQPI 1WJ5A 5KNLA 2LRDA 4LB5A 4OIQF 2R93J 5AIPA 3BR1A 3KP7A 1JUMA 4XSXF 1PUFA 2Y0SA 1RKWA 3GVAA 3W2WA 3W2AA 3K0LA 4LIVA 3LSIA 3TDZC 4YFXF 2XAJA 1Y39A 2MC4A 3U1DA 4QPQA 3DFGA 3RPQA 5FFXA 3SDGA 1YRNA 1P6RA 1T08B 5JLXA 2Y9YA 2E2JJ 1MMNA 1BBYA 1X3WB 4B1RA 4IKFA 1OJLA 4EVIA 3WTYC 4ON0A 2TCTA 4M3EA 1MH3A 5ERIA 3LQRA 1QPIA 1U8RA 2HXIA 2AS5F 2DMTA 1I3QJ 4MHGA 1OYIA 1YYVA 4IRHA 4ZTJA 2RQPA 5C4XJ 5DEQA 4E7SA 3JAMZ 2BY2A 2E71A 3IWFA 3ULQB 5KAFC 1HF0A 4UNOA 1X1PA 2LYCA 3M7GA 5J40A 3G73A 2DFIA 2RKHA 2ZMEB 1T2KA 2IGKA 1G6NA 1A36A 3HBLA 5HLIA 2DBBA 4CXFA 3HGYA 3K1MA 1C0WA 3BDDA 1QZYA 1ETWA 3DEUA 3K10A 3I9V2 5TISC 4AUXA 3F22A 1IRZA 2F5FA 3V42A 5IT3A 2AQFA 5JR3A 1LEAA 3FXKA 3KYCB 5IPAA 5LBQA 1MD0A 3BTJA 4RAZA 4KIFA 1MGTA 3L2CA 4CO8A 2FBHA 2FXAA 3LOCA 4WXDA 3UKGA 1ZARA 2CH0A 1T56A 3I59B 3F8BA 3GLXA 2R5ZB 4HNTA 3PJRA 1LFPA 2EZKA 4P1WA 3R6SA 2A61A 5IP7J 2QLZA 5EJCA 4II2A 2W85A 3QPHA 3ZP5A 4E7KA 3DKXA 1U2WA 2H6BA 2DMNA 2EWNA 1A35A 4U0WA 3SFIA 1XSDA 4EJOA 2OU2A 5AIQA 2QSHX 4I6ZA 3GF2A 3PQJA 3FXQA 1BC7C 3ZN0A 2A5YB 2OD5A 3ZQCA 2MG4A 3W6JB 1WJEA 5F0CA 3FIWA 1ODDA 2FSWA 3IKTA 2Y48A 2VJIA 3TOBA 3SDBA 2M7BA 1BW5A 2BXZA 3ZQLA 1IGNA 2MD0A 1Y0NA 2OTJI 3S17J 4XNFA 5E1WA 2PMUA 3E6CC 3Q3SA 4KN4X 1FYLA 5IYCJ 4DZPA 2ELHA 2VONA 4KICA 4JX4A 3CC7I 3K70C 1BM9A 3TP0A 4X6AJ 3ABLH 4I02A 4PFOA 2FU4A 3S1QJ 1SD6A 4BACA 1OPCA 4UB6C 3AAFA 1UJ8A 3KYLA 5ICCA 3CDHA 1GHCA 2LF7A 3W6VA 2O3FA 4ENJA 2WB1N 3EDPA 2P4WA 1IAWA 4PDKA 5CLSA 1YW8A 2NAZA 1BOAA 1ZK8A 4CZZA 5L3FA 4A3KJ 2KPMA 1P92A 4RLQA 1Y56A 4HW0A 3D1NI 1VQ8I 2A69F 1V55H 2PN6A 3GX4X 3G2BA 5J4YA 2LLKA 1SFEA 3CD6I 3O3KA 2PQ8A 3RPUA 3QQAA 4ESBA 3BR0A 1TW2A 3V8JA 4J00A 3PNVA 4JBAA 1R5HA 2K5CA 4S0HB 1FMWA 5K5OA 1FY7A 3AKZA 2QENA 3A4CA 4G7ZF 4XM3A 4M71A 1VQKI 2ZXHA 2R7DA 4XOPA 5J8FA 3IRRA 1ONVA 5E79C 4IRIA 4BQOA 2NRAC 3HJEA 3H3UA 2O6GE 3KLOA 4A3GJ 4ANJA 3T1BA 1H0MA 5E1ZB 3F8NA 4IVNA 2XVCA 2JA6J 4MTEA 2GXBA 3DBRB 2HYGD 1I6HJ 1ERDA 4XKCA 3VSKA 4II3A 1EH7A 2WY7Q 4NQWA 1X3ZB 2KT0A 2I8DA 3KP2A 3QPTA 2R3SA 1Q1VA 1LE8B 4PJNA 3AG3H 1XGSA 1S7AA 3I4MJ 2B0LA 1TQMA 3KZYA 3FK7A 3S1NJ 3HHHA 5ILVA 2VQHA 4M3BA 4B4CA 3MKYB 2X1DA 4XLAA 2O8KA 1IRGA 4IPAA 4A0ZA 3OYAA 3LWFA 2DDBA 1DP7P 2CW0F 2LK2A 3H5RA 3ASNH 4BHPA 2HOSA 5EZHA 3KX2A 1VFCA 4O5VA 2OV7A 1IV6A 5D4SA 2X48A 5CKTA 2VT2A 5GADJ 4QLCU 1TZLA 1F9NA 2EV5A 4Y13A 1KYZA 1QU3A 4DBRA 1S5LC 2XAGA 2DODA 2COBA 2DW4A 3BQYA 1O3SA 4BS9A 3CF2A 1HKTA 3FXLA 1WJBA 4PUSA 2RDPA 1YI2I 3ZRGA 2E1CA 1FYKA 1BI1A 4L9TA 3NARA 3EUAA 1DU6A 3BP8A 1U9OA 4F52A 3FXUA 2DDAA 3LA2A 1BL0A 3PSIA 1APLC 4A3JJ 1MNEA 2QQ9A 3NWSA 2JQ7A 3DPTA 2IA0A 2GQQA 5CVJA 4MQVA 2P5LC 1OCTC 4ZYAA 4BE0A 2KQRA 3CCYA 3MVPA 1ZHFA 1J75A 4TV7A 1FOYA 2XASA 3L1PA 4HAMA 2WB1A 3ZQQA 4AD9A 3CJQB 3S8PA 2EQRA 4HDUA 4HX8A 3S93A 4AIJA 4ENNA 1HDPA 1WPKA 3K4CA 2VKEA 1SVMA 4XSZF 4ZTFA 2O5RA 4L5IA 4PGGA 4R8HA 2XSJC 2LFBA 3K9TA 1W7PB 1NK2P 3LA7A 1YRNB 1YW9A 1JKOC 3QYBA 1UFMA 5M3FJ 2L9NA 3TQNA 3P7NA 2PG4A 3IH3A 4I0AA 4L5JA 1T98A 4GO1A 1ULYA 5LGUA 3COAC 2FE3A 3QPSA 1YLFA 3CCVI 5KCMA 1FT9A 3K4BA 4Q5SF 3FHNA 2KHMA 1N78A 3KE2A 1VQLI 2NVTJ 2AQEA 2M45A 1ZTRA 1ETOA 3CP2A 3VDXA 3OOPA 3HOWJ 4XRSA 2DN0A 2WAQA 4YEJA 4EJTA 4F55A 1IDYA 1MIJA 2PEXA 1UCRA 3X2QH 4XN3A 4A0YA 4ITVA 4CCOA 1NHAA 1B1BA 1R9TJ 2LH9A 2L7ZA 2TDXA 2ZFUA 1UZCA 3BZ6A 4A3LJ 4A0XA 1WJDA 3OYGA 4BXUA 5EG0A 1G3YA 1B8IA 4OU0A 4NHJA 3HIFA 4EM0B 2FNPA 2EIKH 4A2UA 3HOVJ 2ESNA 5TGTA 4E7IA 5H20A 3DTKA 4BBRJ 4UV9A 2DMPA 4B47A 1R23A 2IS1A 1LEBA 3ML6A 2L7MP 3WTVC 4BXXJ 3HUGA 4A5NA 3JR9A 5LD2C 4U88A 1IN6A 1H8AC 4ZDOA 1D0XA 3DCFA 3S1RJ 1IRFA 1LDKB 2JPBA 1W7PD 2P5VA 2LBFA 1O4XA 2K3PA 1R1VA 2MW8A 2LF8A 3KLNA 2LY1A 2DOFA 2VQGA 3IH2A 1U5TA 3GZ5A 2PJRA 4IHVA 2GXAA 1ZRDA 1A6IA 3E6MA 5EEAA 1K61A 1WFXA 2QQ8A 4IEJA 1N25A 3SYTA 4E7HA 4IF4A 4P5OA 3T8RA 4NC7A 2TRTA 2LKPA 3M8FA 3FMQA 1FSEA 3C2GA 4MGRA 3J7AO 1IW7F 2I5UA 3BG9A 1W36D 4M9SA 5FD6A 4IQJA 4LMYA 4OINF 5LFAA 1YIJI 4HYEA 1QVTA 3SZPA 3SJMA 3FWEA 3RCOA 2DOAA 1ORKA 1Z1DA 4AIKA 5L3EA 1CF7B 4MEXF 1FYMA 3E0JB 2VE9A 3OYJA 1H9TA 1USSA 2IPQX 2XGDA 2VLAA 3O2PE 2VC1A 5ED4A 1V3FA 4XN0A 1SC7A 2JA2A 4CA0A 1ON1A 4HPQA 3IWZA 2DFFA 4LLLA 3PO2J 5IY5H 2CMPA 5E3LA 3JRBA 1JKPC 1R7JA 4BE1A 4IHXA 3S14J 1MW7A 2A3SA 2MLKA 1TQPA 2P8TA 3A0HC 1DU0A 1R49A 2JK3A 5CVIA 1OCRH 1G3SA 3ECHA 3OOUA 3RKYA 2CV1A 3R4KA 1VQ7I 2UZKA 2BV6A 2I10A 2F4MB 1AA7A 3HG9A 2QQAA 2HEOA 2ICWG 1S7OA 3LSGA 4V2GA 5K7HA 3BG6A 1HQCA 4B3XA 2H1LA 2P81A 2DA7A 3K4MA 4BEHA 5D5WB 3KEQA 5GPAA 5C4JJ 2R4GA 3ZMZA 1DPRA 2JUGA 3ZQ7A 4G9YA 4KJZA 4BY1J 4LG0A 2KIFA 4DYRA 1S7EA 3QODA 2QF7A 1O3TA 4LLGF 2V9VA 1D8KA 1DDNA 2CRGA 1X3UA 2KZVA 1LUJB 2G7UA 3P9IA 1GV5A 3WTSC 2P5KA 4HLXA 4C3JJ 2H8WA 2EA4A 4HV5A 2KP6A 1Z0XA 2NOGA 1T6SA 2DFEA 3VB2A 1OCPA 5D5VB 3ZMUA 5HLHA 2RGVA 3B02A 3FM5A 1WVRA 3REOA 2CJJA 5L3CA 4YRVA 4UUSA 2R7VA 3BROA 1P7JA 3GBGA 1MJAA 2QWWA 3CTAA 1J7KA 1X1AA 1BI3A 3K70D 2VKVA 2BW3A 4KDPA 2OCCH 3JSOA 2Z2SB 4DNCA 4LFUA 1S9HA 4HSRA 2IEKA 2LTPA 3GZ6A 1D5VA 5DCFA 3JCUC 1MJBA 4Y17A 4F91B 4A3CJ 2DA5A 2CUJA 2QGUA 3BY6A 1WH5A 1W4MA 4Q47A 4XMYA 3RI4A 2G9WA 1IXSB 2F4OB 1MDMA 5L3DA 1LKXA 4D7NA 4LB6B 2GWRA 3S3NA 1HC8A 2HXOA 2HPIA 3LFUA 2R5YA 1TWGJ 2WY8Q 1Y0UA 2LMDA 1FC3A 2KFDA 3I54A 3V8LA 2VJJA 2BZTA 4B43A 4N4OB 3CJRB 1XMAA 1RUNA 2JRMA 5J1YA 4WXHA 2LY2A 4XKBA 1I50J 3HOSA 9ANTA 3LA3A 2ZKZA 4M72A 4HF2A 2VKHA 4G94A 1XGMA 2WA0A 1AWCA 4DBQA 2RNGA 2ZNZA 3RQIA 2EILH 3WTWC 2D1HA 3VSLA 4RGSA 3BG7A 2DA6A 2IW5A 4PSXA 2MD5A 1HCRA 4BJTA 3MD2A 1B72A 3CCEI 3OY9A 2CWEA 2X85A 4U87A 1TW3A 3T0YA 2E5ZA 3F0CA 3GO5A 3VOEA 1JI8A 2NOJB 2IRFG 4UUVA 4GDFA 3D5LA 2VI6A 3TO9A 3PUFA 2RN7A 1KONA 4HSTA 1X58A 1I6XA 2Z9OA 5EEHA 3FX3A 3WGIA 3HTUA 2EPFA 4YIFA 2BHYA 4EJWA 2W25A 3CQZJ 4CZCA 4HQEA 3OS2A 2ELKA 1V4RA 1FTZA 2BBYA 3OS0A 2QBYB 5J1UA 2LDUA 4ESJA 1DGWY 1LJ9A 1YOVB 4D5CA 5BMZA 2X6YA 5LHHA 1SD7A 3B6CA 3FZVA 5BQTA 1NTCA 2DTZA 3HZJA 3QAHA 3KP5A 2VE8A 3S1MJ 4HLYA 4HF0A 4G12A 1X4OA 4LK0F 3TOAA 1B8IB 5B1BH 1MBJA 1IXCA 2R7WA 5LRSA 3F8MA 2A05A 1T38A 1AHDP 4CICA 2K4BA 2COMA 4EM1A 4WK8F 4BY7J 2XGCA 2QQBA 4G6DA 1J09A 2F2EA 4XQFA 2M0CA 2Z99A 3WTUC 1HXDA 1PYVA 2PI0A 1MMAA 3U1KA 2OQGA 4PJLA 3WG9A 5FLMJ 1RESA 3HUGB 1ZG3A 3I53A 4JK1X 1REPC 2GBYA 2CQKA 2Q0OA 4FT8A 2FBKA 2E2HJ 1UMQA 3ZXSA 1POGA 2RNJA 4U0YA 2LBFB 3HRSA 4GYGA 2L7FP 5DUKA 5BPDA 4M9ZA 5KAIC 3HB9A 4IXAA 1FOKA 5H6QA 4D1QA 1T0FA 5D8KB 3OIPA 1DUXC 2DT7B 1ON2A 1OR7A 3ONQA 3MFKA 4FISA 3PUBA 4MTDA 2EIJH 4IQ4A 3OV8A 5BS6A 2UV1A 1S72I 4UY8I 2MH9A 2YPRA 2FMYA 2EFOA 5DCMA 1ETKA 2OBPA 3K4JA 3TW6A 1XSXA 2HWVA 1J0RA 2JUCA 2R7QA 1FP2A 2LVSA 5DM6F 1MBEA 3LSRA 3WU1B 2V4JC 5DYMA 4GGGA 2HNHA 2XPUA 3NAUA 3BC8A 1XB4A 3O8GA 1P4WA 1K7AA 1BA5A 5FLXZ 4GCVA 4MFEA 3H9GA 2LNBA 5D4RA 2M3AA 3OWTA 2FEZA 4M6VA 2DLLA 2XF5A 4I7HA 5ILSA 1K78A 1SAXA 1ETYA 3HGGA 2IJLA 2X1EA 2K4JA 1G4DA 2FRHA 2HZTA 1VQMI 5K7FA 2EFPA 2EV0A 4EEFG 2ZJ2A 5IOZA 4FCYA 4YFNF 2Y0MA 2R92J 2G7HA 2EH3A 3FXMA 3RZDJ 1XCVA 2DO7A 3RZOJ 2ZXWH 1MMDA 1W5SA 4S04A 4L9VA 3OSGA 1QPMA 2XPWA 2K9SA 2BY0A 3GEZA 3G1MA 2ZSIB 4Z2YA 1Z9CA 4LOCA 2HU9A 2E1NA 4Q48A 4M3FA 3L2UA 2UWMA 4M3DA 2R7XA 2JVGA 3LFKA 3TDUC 4ZYEA 1JHFA 4HNVA 1AOYA 1FLIA 3E6DA 1HSJA 2CS3A 5KK1A 2ID3A 4AVZA 3ZMSA 3VYSB 1YJWI 3KYDB 2J5OA 2GM4A 1JHHA 3BTCA 2E7XA 2JSPA 5M5WJ 1P2FA 2HVRA 2QKLB 4U7BA 3M9AA 3M8EA 2MYSA 5TJJA 4NC6A 1KU3A 4V2FA 2F4IA 3GFMA 3K4LA 1XGOA 1BIAA 4BHBA 4OMZA 1AKHB 3WU2C 3BTLA 1VQNI 3OL3A 1ZLJA 2Z3YA 3GTKJ 1P9QC 3GLLA 4QIWN 1TC3C 4BDYA 3KZZA 1WJAA 2NXNB 2LY9A 1I39A 4PJMA 4CHUA 2KZGA 3DU5A 4BXFA 3TO6A 1HLVA 2ZXIA 4A3BJ 3TEDA 4DYCA 3CMAI 3OYEA 1X2NA 1O7FA 5FROA 3NRVA 4GYIA 2L3DA 3IHUA 3GTJJ 4OAZA 2XROA 2CV2A 1U6GA 1ZQ3P 1FZPB 1IN5A 4L5EA 2CQXA 2EJRA 3JW4A 4PJJA 3ROUA 2L9RA 2KIQA 3C18A 3FKJA 4JYKA 5FB2A 4RB3C 2MSYA 2R0QC 5EGOA 2BE5F 5L3BA 4M73A 4AU7A 1RNLA 4CCNA 3A01A 1XPXA 2WC2A 3Q9VA 2Y69H 2DA3A 5K5QA 1K4TA 1O7LA 2E5NA 3BG3A 2R7RA 1FIPA 1KQ8A 1I1GA 2DU9A 1LNWA 5IOYA 4HV6A 5HDGA 1YQAA 4YIIA 2ISZA 5HNFA 1ETXA 1D3YA 1X4PA 1F5TA 1VQ6I 1VNDA 1EKEA 3K4NA 1J2XA 4UVAA 3FHZA 4G6TB 2GAUA 2K9QA 2Q2EA 5D5UB 2KRFA 2X6XA 3HEFA 3QU6A 3A03A 3OYDA 1VQOI 2HVSA 2F5DA 3H3VK 3LL7A 2KISA 1U3EM 1Z3YA 1H9GA 1FWZA 4P9UA 1GVDA 4JX6A 1FMVA 3V7CA 4CYCB 1FJLA 5LGNA 3VYRB 1BR1A 5J1RA 3GYHX 4UV8A 4HDVA 1R4NB 3G6EI 1OCZH 3OYIA 1YO5C 3FBNB 1ZKGA 5C44J 1E3HA 3RKXA 5F04A 2VQCA 3HSEA 2K85A 3CCMI 3DBHB 1JGGA 1P7IA 1K6OA 2W84A 4IRGA 5HVQC 2E34A 1MBGA 5BNGA 3WHBA 3AL0B 5FLXK 1F1ZA 1MNDA 5GTHC 1G3TA 4LD5A
chains in the Genus database with same CATH topology
2L4AA 4U0VA 2EFNA 1GXPA 2HYFA 2H09A 3R0AA 3IRQA 2JZYA 1B6AA 2GIVA 4CGZA 4O3MA 2YX4A 2EA2A 3WODF 1QO0D 1JGSA 3SFZA 5FGMA 3WGHA 2W24A 4P96A 1ZG1A 1QNTA 3V4GA 3BJAA 2IP2A 2XKOA 3F8CA 2C6YA 3MAJA 5CYVA 1WSUA 5E20A 4G6QA 2QVOA 3RYPA 2BYVE 4L9NA 5DCMB 3NQOA 2STWA 3FXRA 4G7HF 2HR3A 2V1DA 3O6BB 2IVMA 2WV0A 1R5GA 2DTRA 4ZYHA 1K78B 4I0BA 1XDUA 5HS7A 4I2OA 3GXOA 2WWYA 2VODA 2EFQA 3TGNA 5DDGA 5D8LB 3E5UA 1R22A 4YG2F 2PMHA 2NNNA 2F5CA 1UHWA 5AONA 3C7JA 2MLGA 4AVPA 5E8GA 2CYYA 4WF2A 4BQAA 3FM3A 1KA8A 4KN7X 2DT5A 5HLGA 1R58A 1Z6TA 4G8XA 5TRDA 1KU7A 3CUOA 1IXRC 1U5TC 2MC3A 3TKYA 3G3ZA 2VOOA 4UHTA 3BOQA 1HW5A 1FBSA 1XN7A 1O3RA 3C3WA 1S6LA 3DF8A 2GZWA 4CDGA 3F23A 2HDCA 2ISYA 2IT0A 1P4AA 4PGHA 3QP6A 3LSTA 3ABUA 3KFWX 3RYRA 2J5PA 2D1VA 3GUDA 4FX0A 5F64A 2EFWA 2H6CA 3WTTC 2HOEA 5D6FA 3N4MA 4IHTA 4ZYGA 1LDJA 3EUHA 4KA4A 1WRJA 4IJAA 3E3VA 3K1NA 2P6TA 4AIHA 1B4AA 2KJCA 2L54A 3HRMA 5LHIA 4R1HA 4L0ZB 3F6OA 5LGTA 4ZZDA 2NNYA 2IA2A 5HS8A 3KETA 2M87A 1XGNA 4KFCA 2ZMEA 2HGCA 1GXQA 2NYXA 5E1XA 1SD4A 5IT9Z 1Z7UA 3EQLF 5CVRA 3FF5A 1XMKA 2UXNA 5ICFA 4EV0A 4CYDA 3F6VA 2HKXA 1O57A 2ADUA 4KYWA 2VBZA 1HKQA 1Z91A 2QUFA 3ZPLA 5JI6A 2VBWA 5HDKA 1QBJA 4A5MA 4QWQA 2XV4S 3ABTA 5DD8A 4L9JA 1O3QA 5JVTA 3HTSB 4D0PA 1ZRCA 5CJ9A 3R60A 1CGPA 2X4HA 3MQ0A 5K1YA 2VC0A 4N9IA 3VODA 2PBIA 3F3XA 4I01A 1D8JA 4M74A 4EMSA 4HZFA 3CUQC 3HOTA 3WTZA 3T8TA 3Q9SA 3LQQA 4LK1F 1IN4A 2K02A 4NB5A 1S29A 3ERED 1F4KA 1HKSA 3CUQA 4I09A 2CG4A 1SMTA 5HOOA 3HRTA 2XUBA 2JPCA 4GXOA 1B9MA 2A6EF 4BAYA 2HTSA 3IC7A 3RDIA 1W5TA 3GW2A 1HW1A 4N0BA 2KJBA 1RI7A 1Z6RA 3E5XA 2VBYA 2X0LA 4BNCA 1MZBA 1KYWA 1TBXA 3HYIA 2V6CA 1PP7U 1R1UA 2DI3A 4LGWA 4P55A 4HQMA 3FMRA 1U78A 4I98B 4O6JA 3F21A 2STTA 3B73A 3GFJA 1S3JA 2A68F 3ZN1A 2AXLA 5ICGA 4R79A 1P4XA 1RUOA 4RB1A 4EM2A 4RGRA 2K86A 2P7VB 3MZYA 2RVCA 2NS0A 3K2ZA 2L01A 2DPUA 1R36A 2LSOA 1PP8F 4HX4A 1ZGAA 5J6XA 3GFIA 3U2RA 4G7OF 4HX7A 1L3LA 2FNAA 3V8KA 2XAQA 4KNYA 2WTEA 5IT9K 3DV8A 4HOBA 3J81K 2GXGA 1KU2A 1ZYRF 4B09A 2PFBA 1U5TB 1QQIA 2DK8A 4OOIA 3RTRA 2FF4A 5F1RA 2E7WA 3H3ZA 2DQRA 4KMUX 2R7FA 3KP6A 3ECOA 5CVVA 1L0OC 3ELKA 2CSOA 3I0TA 1WI9A 4ENKA 1W7PA 4KUMA 2KIMA 2VOPA 4L18B 2HS5A 3C1DA 4Y15A 5BPIA 3U9GA 5ICEA 1TLHB 1ZAOA 3HHGA 3F8FA 5A2QZ 2A07F 5H6RA 3SQNA 2UXXA 2HKOA 3PQKA 3W6KB 4E70A 2OZ6A 2ACJA 5CVUA 2K7LA 1B9NA 2W57A 4LG0B 3D0SA 2KIUA 3SHFA 2O0YA 3S2WA 3N97A 5E17F 4LJZF 2L02A 4LLNA 1BC8C 3GWZA 1FPQA 2EV6A 1KGSA 1HBXG 4HF1A 2PJPA 2OZUA 1YW7A 1JXSA 5E18F 1YS6A 5LEJA 3BPVA 2V1UA 2L4MA 2CO5A 2EK5A 3L00A 2RV8A 1B59A 4BHCA 1MJ9A 1SFXA 2D45A 1MDMB 3I58A 4RAYA 5FO5A 2A6HF 3V7SA 3BPXA 3L09A 1ZG5A 1LQ1A 1T39A 1KU9A 3CUQB 1CF7A 2D2WA 1LB2A 3I5UA 1STZA 3QRFF 3ZMTA 2H94A 3M1EA 1KQ0A 2GA1A 2M1BA 2VN2A 4U7DA 4ZZLA 4XLPF 4XRFA 1LDDA 2XAHA 3QOPA 1XDSA 4WXCA 3RKWA 1WWXA 1GVJA 3V7RA 3GFLA 2V79A 1PUEE 3BWGA 4A12A 2JTVA 5LLQA 4ASNA 2YSRA 3R0JA 3RIRA 2FA5A 1J5YA 2M5WA 3PFIA 3JTGA 3Q5FA 3R61A 1FNNA 4KMFA 1VTNC 4OIOF 1TTYA 1G3WA 4KT5C 3HSFA 4XLNF 3J80Z 3VFZA 2CFXA 1SMYF 2V1XA 3KP3A 2XGXA 2IA1A 2DK5A 1BJAA 3KCCA 1RZ4A 2OQRA 1SD5A 3L7WA 2Q8KA 3QU3A 1IN7A 1UB9A 1J59A 2GA2A 5A2QK 3JAMK 5FD5A 4PCQA 5HDNA 5L3GA 4YFKF 1OYYA 5LEKA 3QP5A 1FP1D 1BI0A 2YU3A 4RS8A 3BJOA 6PAXA 5DD4A 4MQ9F 2VXZA 1QGPA 1TNTA 2P7CB 4EGZA 4FX4A 4EGYA 3MZHA 3SZTA 1I1SA 1HSTA 3FMSA 2ESHA 2XIGA 1R00A 4MNUA 5FFZA 2P6SA 4BYYA 1R1TA 2FBIA 4UXNA 3DQVC 3DP7A 5K5RA 1ZLKA 2FOKA 4HBLA 2O61A 5JHUA 1ZH5A 2JT1A 3WE3A 2VBXA 5EEGA 5F6FA 5ILUA 1OMIA 4F7ZA 3H92A 1FBQA 1RIOH 1WKMA 4WX9A 3LAPA 2HQNA 2QBYA 1I5ZA 2JRTA 1ZGJA 3MWMA 4JQFA 3SXYA 1TNSA 1PDNC 3CLOA 3K1PA 5KVRA 2CGPA 2MBFA 3WU0A 2XHKA 3WE2A 5HS9A 4ETSA 2DQLA 3IL2A 4H0EA 2PLYA 1OKRA 1IZ1A 1EH6A 1Z05A 4DQ2A 1I27A 1IN8A 4RGUA 4MEYF 1XD7A 4EQQA 4IHSA 4K2EA 3CJNA 3I64A 3WTXC 4OIRF 1SFUA 2ZNYA 1UHMA 2OAZA 1XCBA 2OA4A 4BH9A 3J80K 4RGXA 4EJVA 3ZMDA 1EV7A 2FMLA 3EYIA 3HSRA 2MA3A 2YX7A 4ENMA 1QZZA 2EB7A 1YIOA 4EJUA 3EYYA 3CO7C 3I71A 1J9IA 2RC4A 2O03A 1YFHA 3NEUA 3J81Z 1ZN2A 3I4PA 4B8XA 2ETHA 4RB2C 1E2XA 3I59A 1EH8A 1HW2A 3P9CA 3KEOA 3F72A 1FBUA 2HQRA 1BIBA 4Q4ZF 2KKOA 3DXJF 1YTYA 5D6EA 4L0YB 1LVAA 3E97A 2HFHA 2XKPA 2DPDA 1OYWA 4P9FA 4ZH4F 4WCGA 4A6DA 5LRRA 3WGGA 2M30A 4M9XA 2JSCA 1BI2A 1YG2A 3JTHA 2M8EA 2XRNA 2Y75A 3IKVA 2QM3A 1MKMA 2F5EA 2Z5UA 4M6YA 4FHTA 2FQ3A 2Z33A 3K69A 1ZRFA 2HTJA 1A04A 5DUIA 3E6BA 3RJPA 2K27A 4RB0A 3JSPA 3E5QA 4AWXB 2BGCA 3TO7A 4OIPF 1DPUA 1FX7A 1Q1HA 3P9KA 3BJ6A 3KP4A 4KIBA 1K79A 2MH2A 2ZCWA 4XBFA 2H27A 3CO6C 2YR2A 4N9HA 4M6XA 1XSVA 3DKWA 5D5XB 1FSHA 2DAOA 4OMYA 1IUYA 1S8NA 4KIGA 4HA8A 1YS7A 2ZBKA 1ZREA 5E8IA 1JE8A 3LAJA 1WQ2A 4UVBA 1KQ9A 3HRUA 4UVCA 4ZYDA 2QZ8A 3ZMVA 3EETA 2ZFWA 4WWCA 3MEXA 4PZJA 3DPLC 5JFRA 5LHGA 5BOXA 2ZO4A 3VEPA 1BN5A 1USTA 4S05A 4ESFA 2QYOA 5J8CA 2ZXJA 3L9FA 2VT3A 5DV5A 2BEOA 4A6EA 3ISPA 1IF1A 3T5XA 2O8XA 2XAFA 1TQIA 3MCZA 1E17A 4LB5A 4OIQF 5AIPA 3KP7A 4XSXF 3GVAA 3K0LA 3TDZC 4YFXF 2XAJA 3U1DA 3DFGA 3RPQA 5FFXA 1P6RA 1BBYA 4EVIA 3WTYC 4ON0A 5ERIA 3LQRA 1U8RA 2AS5F 4MHGA 1OYIA 1YYVA 4IRHA 2RQPA 5DEQA 3JAMZ 3IWFA 3ULQB 4UNOA 3M7GA 3G73A 2DFIA 2RKHA 2ZMEB 1T2KA 1G6NA 5HLIA 2DBBA 4CXFA 3K1MA 1C0WA 3BDDA 1QZYA 3DEUA 3F22A 2F5FA 5IT3A 5JR3A 1LEAA 5LBQA 3L2CA 1MD0A 4RAZA 4KIFA 1MGTA 4CO8A 2FBHA 2FXAA 4WXDA 1ZARA 3I59B 3F8BA 3GLXA 3R6SA 2A61A 2QLZA 2W85A 3QPHA 3ZP5A 1U2WA 2H6BA 2EWNA 4U0WA 1XSDA 4EJOA 2OU2A 5AIQA 3GF2A 3PQJA 3FXQA 1BC7C 3ZN0A 2A5YB 2OD5A 3W6JB 1ODDA 2FSWA 3IKTA 2Y48A 3TOBA 5E1WA 2PMUA 3E6CC 4KN4X 1FYLA 2ELHA 2VONA 4KICA 1BM9A 4I02A 2FU4A 1SD6A 1OPCA 3AAFA 5ICCA 3CDHA 1GHCA 2LF7A 2O3FA 4ENJA 3EDPA 2P4WA 1IAWA 4PDKA 5CLSA 1YW8A 2NAZA 1BOAA 4CZZA 5L3FA 1P92A 4HW0A 2A69F 2PN6A 3GX4X 1SFEA 3O3KA 2PQ8A 3RPUA 4ESBA 1TW2A 3V8JA 4JBAA 1R5HA 5K5OA 1FY7A 2QENA 4G7ZF 4M71A 2R7DA 5J8FA 3IRRA 1ONVA 4IRIA 2NRAC 2O6GE 3H3UA 3KLOA 1H0MA 3T1BA 5E1ZB 3F8NA 4IVNA 2XVCA 4MTEA 2GXBA 2HYGD 1EH7A 4NQWA 3KP2A 3QPTA 2R3SA 1XGSA 1S7AA 2B0LA 1TQMA 3KZYA 3HHHA 5ILVA 1IRGA 4IPAA 4A0ZA 3LWFA 1DP7P 2CW0F 4BHPA 4O5VA 5D4SA 2VT2A 4QLCU 2EV5A 1F9NA 4Y13A 1KYZA 2XAGA 2DW4A 1O3SA 1HKTA 2RDPA 2E1CA 1FYKA 1BI1A 4L9TA 3BP8A 3FXUA 3LA2A 2QQ9A 3DPTA 2IA0A 2GQQA 5CVJA 4MQVA 2P5LC 1ZHFA 1J75A 4TV7A 2XASA 4HAMA 4AD9A 4HDUA 4HX8A 4AIJA 4ENNA 4XSZF 4L5IA 4R8HA 4PGGA 3K9TA 1W7PB 3LA7A 1YW9A 1UFMA 3TQNA 3P7NA 2PG4A 4I0AA 4L5JA 3COAC 1T98A 4GO1A 1ULYA 5LGUA 2FE3A 1YLFA 1FT9A 4Q5SF 3KE2A 2M45A 3OOPA 4EJTA 2PEXA 1UCRA 4A0YA 1NHAA 1B1BA 2TDXA 3BZ6A 4A0XA 4BXUA 1G3YA 4OU0A 4NHJA 3HIFA 4EM0B 2FNPA 4A2UA 2ESNA 5H20A 4UV9A 1R23A 1LEBA 3ML6A 3WTVC 3HUGA 4A5NA 4U88A 1IN6A 1IRFA 1LDKB 2JPBA 1W7PD 2P5VA 1R1VA 2LF8A 3KLNA 1U5TA 3GZ5A 1ZRDA 3E6MA 4IF4A 4P5OA 3T8RA 2LKPA 3M8FA 3FMQA 1FSEA 4MGRA 3J7AO 1IW7F 4M9SA 5FD6A 4LMYA 4OINF 4HYEA 3SZPA 3FWEA 1Z1DA 4AIKA 5L3EA 1CF7B 4MEXF 1FYMA 2VE9A 1H9TA 1USSA 2IPQX 3O2PE 2VC1A 5ED4A 1V3FA 1ON1A 3IWZA 4LLLA 1R7JA 2A3SA 2MLKA 1TQPA 2P8TA 5CVIA 1G3SA 3ECHA 3RKYA 3R4KA 2UZKA 2BV6A 2QQAA 2HEOA 1S7OA 1HQCA 5D5WB 3KEQA 3ZMZA 1DPRA 3ZQ7A 4G9YA 4LG0A 2KIFA 1O3TA 4LLGF 2V9VA 1D8KA 1DDNA 1X3UA 2G7UA 3P9IA 3WTSC 2P5KA 4HLXA 2EA4A 4HV5A 1T6SA 3VB2A 5D5VB 3ZMUA 5HLHA 2RGVA 3B02A 3FM5A 3REOA 5L3CA 3BROA 1MJAA 2QWWA 3CTAA 1J7KA 1BI3A 4KDPA 3JSOA 4DNCA 4LFUA 3GZ6A 1D5VA 5DCFA 1MJBA 4Y17A 3BY6A 1W4MA 4Q47A 3RI4A 2G9WA 1IXSB 1MDMA 5L3DA 4LB6B 2GWRA 1Y0UA 1FC3A 3I54A 3V8LA 1XMAA 1RUNA 4WXHA 3HOSA 3LA3A 2ZKZA 4M72A 4HF2A 4G94A 1XGMA 1AWCA 2ZNZA 3WTWC 2D1HA 4RGSA 2IW5A 2MD5A 2CWEA 1TW3A 3T0YA 3GO5A 3VOEA 2IRFG 4UUVA 3D5LA 3TO9A 2RN7A 1I6XA 2Z9OA 5EEHA 3FX3A 3WGIA 3HTUA 4YIFA 4EJWA 2W25A 4HQEA 1V4RA 2BBYA 2QBYB 2LDUA 4ESJA 5BMZA 1LJ9A 5LHHA 1SD7A 3FZVA 5BQTA 3QAHA 3KP5A 2VE8A 4HLYA 4HF0A 4LK0F 3TOAA 1IXCA 5LRSA 3F8MA 1T38A 4CICA 2K4BA 2COMA 4EM1A 4WK8F 2QQBA 4G6DA 2F2EA 2Z99A 3WTUC 1HXDA 2PI0A 2OQGA 3WG9A 3I53A 1ZG3A 4JK1X 1REPC 2CQKA 2Q0OA 4FT8A 2FBKA 4U0YA 2RNJA 3HRSA 4GYGA 5BPDA 5DUKA 4M9ZA 4IXAA 1FOKA 5H6QA 1T0FA 5D8KB 1DUXC 1ON2A 1OR7A 3MFKA 4MTDA 3OV8A 5BS6A 2MH9A 2YPRA 2FMYA 2EFOA 5DCMA 2OBPA 1XSXA 2HWVA 1J0RA 1FP2A 3WU1B 5DYMA 4GGGA 1XB4A 1P4WA 1K7AA 5FLXZ 4GCVA 2LNBA 5D4RA 2FEZA 2DLLA 4I7HA 5ILSA 1K78A 1SAXA 2IJLA 1G4DA 2K4JA 2FRHA 2HZTA 2EFPA 2EV0A 2ZJ2A 4YFNF 2Y0MA 2G7HA 1XCVA 2DO7A 1W5SA 4S04A 4L9VA 1QPMA 3GEZA 4Z2YA 1Z9CA 2E1NA 4Q48A 2UWMA 3LFKA 3TDUC 4ZYEA 1JHFA 1FLIA 1AOYA 3E6DA 1HSJA 5KK1A 3ZMSA 2J5OA 1JHHA 2E7XA 1P2FA 4U7BA 3M9AA 3M8EA 5TJJA 1KU3A 3GFMA 1XGOA 1BIAA 4BHBA 4OMZA 1ZLJA 2Z3YA 3KZZA 4CHUA 3TO6A 1O7FA 3NRVA 4GYIA 2L3DA 3IHUA 2XROA 1U6GA 1FZPB 1IN5A 2EJRA 3JW4A 3ROUA 3C18A 5FB2A 4RB3C 2BE5F 5L3BA 4M73A 1RNLA 2WC2A 3Q9VA 5K5QA 1O7LA 1KQ8A 1I1GA 2DU9A 1LNWA 4HV6A 5HDGA 1YQAA 4YIIA 2ISZA 1D3YA 1F5TA 4UVAA 1J2XA 3FHZA 2GAUA 2Q2EA 5D5UB 2KRFA 3QU6A 2F5DA 1U3EM 1H9GA 1FWZA 4P9UA 3V7CA 5LGNA 3GYHX 4UV8A 4HDVA 1YO5C 3RKXA 3HSEA 1K6OA 2W84A 4IRGA 5HVQC 5FLXK 1F1ZA 1G3TA 4LD5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L4A A;  4U0V A;  2EFN A;  1GXP A;  2HYF A;  2H09 A;  3R0A A;  3IRQ A;  2JZY A;  1B6A A;  2GIV A;  4CGZ A;  4O3M A;  2YX4 A;  2EA2 A;  3WOD F;  1QO0 D;  1JGS A;  3SFZ A;  5FGM A;  3WGH A;  2W24 A;  4P96 A;  1ZG1 A;  1QNT A;  3V4G A;  3BJA A;  2IP2 A;  2XKO A;  3F8C A;  2C6Y A;  3MAJ A;  5CYV A;  1WSU A;  5E20 A;  4G6Q A;  2QVO A;  3RYP A;  2BYV E;  4L9N A;  5DCM B;  3NQO A;  2STW A;  3FXR A;  4G7H F;  2HR3 A;  2V1D A;  3O6B B;  2IVM A;  2WV0 A;  1R5G A;  2DTR A;  4ZYH A;  1K78 B;  4I0B A;  1XDU A;  5HS7 A;  4I2O A;  3GXO A;  2WWY A;  2VOD A;  2EFQ A;  3TGN A;  5DDG A;  5D8L B;  3E5U A;  1R22 A;  4YG2 F;  2PMH A;  2NNN A;  2F5C A;  1UHW A;  5AON A;  3C7J A;  2MLG A;  4AVP A;  5E8G A;  2CYY A;  4WF2 A;  4BQA A;  3FM3 A;  1KA8 A;  4KN7 X;  2DT5 A;  5HLG A;  1R58 A;  1Z6T A;  4G8X A;  5TRD A;  1KU7 A;  3CUO A;  1IXR C;  1U5T C;  2MC3 A;  3TKY A;  3G3Z A;  2VOO A;  4UHT A;  3BOQ A;  1HW5 A;  1FBS A;  1XN7 A;  1O3R A;  3C3W A;  1S6L A;  3DF8 A;  2GZW A;  4CDG A;  3F23 A;  2HDC A;  2ISY A;  2IT0 A;  1P4A A;  4PGH A;  3QP6 A;  3LST A;  3ABU A;  3KFW X;  3RYR A;  2J5P A;  2D1V A;  3GUD A;  4FX0 A;  5F64 A;  2EFW A;  2H6C A;  3WTT C;  2HOE A;  5D6F A;  3N4M A;  4IHT A;  4ZYG A;  1LDJ A;  3EUH A;  4KA4 A;  1WRJ A;  4IJA A;  3E3V A;  3K1N A;  2P6T A;  4AIH A;  1B4A A;  2KJC A;  2L54 A;  3HRM A;  5LHI A;  4R1H A;  4L0Z B;  3F6O A;  5LGT A;  4ZZD A;  2NNY A;  2IA2 A;  5HS8 A;  3KET A;  2M87 A;  1XGN A;  4KFC A;  2ZME A;  2HGC A;  1GXQ A;  2NYX A;  5E1X A;  1SD4 A;  5IT9 Z;  1Z7U A;  3EQL F;  5CVR A;  3FF5 A;  1XMK A;  2UXN A;  5ICF A;  4EV0 A;  4CYD A;  3F6V A;  2HKX A;  1O57 A;  2ADU A;  4KYW A;  2VBZ A;  1HKQ A;  1Z91 A;  2QUF A;  3ZPL A;  5JI6 A;  2VBW A;  5HDK A;  1QBJ A;  4A5M A;  4QWQ A;  2XV4 S;  3ABT A;  5DD8 A;  4L9J A;  1O3Q A;  5JVT A;  3HTS B;  4D0P A;  1ZRC A;  5CJ9 A;  3R60 A;  1CGP A;  2X4H A;  3MQ0 A;  5K1Y A;  2VC0 A;  4N9I A;  3VOD A;  2PBI A;  3F3X A;  4I01 A;  1D8J A;  4M74 A;  4EMS A;  4HZF A;  3CUQ C;  3HOT A;  3WTZ A;  3T8T A;  3Q9S A;  3LQQ A;  4LK1 F;  1IN4 A;  2K02 A;  4NB5 A;  1S29 A;  3ERE D;  1F4K A;  1HKS A;  3CUQ A;  4I09 A;  2CG4 A;  1SMT A;  5HOO A;  3HRT A;  2XUB A;  2JPC A;  4GXO A;  1B9M A;  2A6E F;  4BAY A;  2HTS A;  3IC7 A;  3RDI A;  1W5T A;  3GW2 A;  1HW1 A;  4N0B A;  2KJB A;  1RI7 A;  1Z6R A;  3E5X A;  2VBY A;  2X0L A;  4BNC A;  1MZB A;  1KYW A;  1TBX A;  3HYI A;  2V6C A;  1PP7 U;  1R1U A;  2DI3 A;  4LGW A;  4P55 A;  4HQM A;  3FMR A;  1U78 A;  4I98 B;  4O6J A;  3F21 A;  2STT A;  3B73 A;  3GFJ A;  1S3J A;  2A68 F;  3ZN1 A;  2AXL A;  5ICG A;  4R79 A;  1P4X A;  1RUO A;  4RB1 A;  4EM2 A;  4RGR A;  2K86 A;  2P7V B;  3MZY A;  2RVC A;  2NS0 A;  3K2Z A;  2L01 A;  2DPU A;  1R36 A;  2LSO A;  1PP8 F;  4HX4 A;  1ZGA A;  5J6X A;  3GFI A;  3U2R A;  4G7O F;  4HX7 A;  1L3L A;  2FNA A;  3V8K A;  2XAQ A;  4KNY A;  2WTE A;  5IT9 K;  3DV8 A;  4HOB A;  3J81 K;  2GXG A;  1KU2 A;  1ZYR F;  4B09 A;  2PFB A;  1U5T B;  1QQI A;  2DK8 A;  4OOI A;  3RTR A;  2FF4 A;  5F1R A;  2E7W A;  3H3Z A;  2DQR A;  4KMU X;  2R7F A;  3KP6 A;  3ECO A;  5CVV A;  1L0O C;  3ELK A;  2CSO A;  3I0T A;  1WI9 A;  4ENK A;  1W7P A;  4KUM A;  2KIM A;  2VOP A;  4L18 B;  2HS5 A;  3C1D A;  4Y15 A;  5BPI A;  3U9G A;  5ICE A;  1TLH B;  1ZAO A;  3HHG A;  3F8F A;  5A2Q Z;  2A07 F;  5H6R A;  3SQN A;  2UXX A;  2HKO A;  3PQK A;  3W6K B;  4E70 A;  2OZ6 A;  2ACJ A;  5CVU A;  2K7L A;  1B9N A;  2W57 A;  4LG0 B;  3D0S A;  2KIU A;  3SHF A;  2O0Y A;  3S2W A;  3N97 A;  5E17 F;  4LJZ F;  2L02 A;  4LLN A;  1BC8 C;  3GWZ A;  1FPQ A;  2EV6 A;  1KGS A;  1HBX G;  4HF1 A;  2PJP A;  2OZU A;  1YW7 A;  1JXS A;  5E18 F;  1YS6 A;  5LEJ A;  3BPV A;  2V1U A;  2L4M A;  2CO5 A;  2EK5 A;  3L00 A;  2RV8 A;  1B59 A;  4BHC A;  1MJ9 A;  1SFX A;  2D45 A;  1MDM B;  3I58 A;  4RAY A;  5FO5 A;  2A6H F;  3V7S A;  3BPX A;  3L09 A;  1ZG5 A;  1LQ1 A;  1T39 A;  1KU9 A;  3CUQ B;  1CF7 A;  2D2W A;  1LB2 A;  3I5U A;  1STZ A;  3QRF F;  3ZMT A;  2H94 A;  3M1E A;  1KQ0 A;  2GA1 A;  2M1B A;  2VN2 A;  4U7D A;  4ZZL A;  4XLP F;  4XRF A;  1LDD A;  2XAH A;  3QOP A;  1XDS A;  4WXC A;  3RKW A;  1WWX A;  1GVJ A;  3V7R A;  3GFL A;  2V79 A;  1PUE E;  3BWG A;  4A12 A;  2JTV A;  5LLQ A;  4ASN A;  2YSR A;  3R0J A;  3RIR A;  2FA5 A;  1J5Y A;  2M5W A;  3PFI A;  3JTG A;  3Q5F A;  3R61 A;  1FNN A;  4KMF A;  1VTN C;  4OIO F;  1TTY A;  1G3W A;  4KT5 C;  3HSF A;  4XLN F;  3J80 Z;  3VFZ A;  2CFX A;  1SMY F;  2V1X A;  3KP3 A;  2XGX A;  2IA1 A;  2DK5 A;  1BJA A;  3KCC A;  1RZ4 A;  2OQR A;  1SD5 A;  3L7W A;  2Q8K A;  3QU3 A;  1IN7 A;  1UB9 A;  1J59 A;  2GA2 A;  5A2Q K;  3JAM K;  5FD5 A;  4PCQ A;  5HDN A;  5L3G A;  4YFK F;  1OYY A;  5LEK A;  3QP5 A;  1FP1 D;  1BI0 A;  2YU3 A;  4RS8 A;  3BJO A;  6PAX A;  5DD4 A;  4MQ9 F;  2VXZ A;  1QGP A;  1TNT A;  2P7C B;  4EGZ A;  4FX4 A;  4EGY A;  3MZH A;  3SZT A;  1I1S A;  1HST A;  3FMS A;  2ESH A;  2XIG A;  1R00 A;  4MNU A;  5FFZ A;  2P6S A;  4BYY A;  1R1T A;  2FBI A;  4UXN A;  3DQV C;  3DP7 A;  5K5R A;  1ZLK A;  2FOK A;  4HBL A;  2O61 A;  5JHU A;  1ZH5 A;  2JT1 A;  3WE3 A;  2VBX A;  5EEG A;  5F6F A;  5ILU A;  1OMI A;  4F7Z A;  3H92 A;  1FBQ A;  1RIO H;  1WKM A;  4WX9 A;  3LAP A;  2HQN A;  2QBY A;  1I5Z A;  2JRT A;  1ZGJ A;  3MWM A;  4JQF A;  3SXY A;  1TNS A;  1PDN C;  3CLO A;  3K1P A;  5KVR A;  2CGP A;  2MBF A;  3WU0 A;  2XHK A;  3WE2 A;  5HS9 A;  4ETS A;  2DQL A;  3IL2 A;  4H0E A;  2PLY A;  1OKR A;  1IZ1 A;  1EH6 A;  1Z05 A;  4DQ2 A;  1I27 A;  1IN8 A;  4RGU A;  4MEY F;  1XD7 A;  4EQQ A;  4IHS A;  4K2E A;  3CJN A;  3I64 A;  3WTX C;  4OIR F;  1SFU A;  2ZNY A;  1UHM A;  2OAZ A;  1XCB A;  2OA4 A;  4BH9 A;  3J80 K;  4RGX A;  4EJV A;  3ZMD A;  1EV7 A;  2FML A;  3EYI A;  3HSR A;  2MA3 A;  2YX7 A;  4ENM A;  1QZZ A;  2EB7 A;  1YIO A;  4EJU A;  3EYY A;  3CO7 C;  3I71 A;  1J9I A;  2RC4 A;  2O03 A;  1YFH A;  3NEU A;  3J81 Z;  1ZN2 A;  3I4P A;  4B8X A;  2ETH A;  4RB2 C;  1E2X A;  3I59 A;  1EH8 A;  1HW2 A;  3P9C A;  3KEO A;  3F72 A;  1FBU A;  2HQR A;  1BIB A;  4Q4Z F;  2KKO A;  3DXJ F;  1YTY A;  5D6E A;  4L0Y B;  1LVA A;  3E97 A;  2HFH A;  2XKP A;  2DPD A;  1OYW A;  4P9F A;  4ZH4 F;  4WCG A;  4A6D A;  5LRR A;  3WGG A;  2M30 A;  4M9X A;  2JSC A;  1BI2 A;  1YG2 A;  3JTH A;  2M8E A;  2XRN A;  2Y75 A;  3IKV A;  2QM3 A;  1MKM A;  2F5E A;  2Z5U A;  4M6Y A;  4FHT A;  2FQ3 A;  2Z33 A;  3K69 A;  1ZRF A;  2HTJ A;  1A04 A;  5DUI A;  3E6B A;  3RJP A;  2K27 A;  4RB0 A;  3JSP A;  3E5Q A;  4AWX B;  2BGC A;  3TO7 A;  4OIP F;  1DPU A;  1FX7 A;  1Q1H A;  3P9K A;  3BJ6 A;  3KP4 A;  4KIB A;  1K79 A;  2MH2 A;  2ZCW A;  4XBF A;  2H27 A;  3CO6 C;  2YR2 A;  4N9H A;  4M6X A;  1XSV A;  3DKW A;  5D5X B;  1FSH A;  2DAO A;  4OMY A;  1IUY A;  1S8N A;  4KIG A;  4HA8 A;  1YS7 A;  2ZBK A;  1ZRE A;  5E8I A;  1JE8 A;  3LAJ A;  1WQ2 A;  4UVB A;  1KQ9 A;  3HRU A;  4UVC A;  4ZYD A;  2QZ8 A;  3ZMV A;  3EET A;  2ZFW A;  4WWC A;  3MEX A;  4PZJ A;  3DPL C;  5JFR A;  5LHG A;  5BOX A;  2ZO4 A;  3VEP A;  1BN5 A;  1UST A;  4S05 A;  4ESF A;  2QYO A;  5J8C A;  2ZXJ A;  3L9F A;  2VT3 A;  5DV5 A;  2BEO A;  4A6E A;  3ISP A;  1IF1 A;  3T5X A;  2O8X A;  2XAF A;  1TQI A;  3MCZ A;  1E17 A;  4LB5 A;  4OIQ F;  5AIP A;  3KP7 A;  4XSX F;  3GVA A;  3K0L A;  3TDZ C;  4YFX F;  2XAJ A;  3U1D A;  3DFG A;  3RPQ A;  5FFX A;  1P6R A;  1BBY A;  4EVI A;  3WTY C;  4ON0 A;  5ERI A;  3LQR A;  1U8R A;  2AS5 F;  4MHG A;  1OYI A;  1YYV A;  4IRH A;  2RQP A;  5DEQ A;  3JAM Z;  3IWF A;  3ULQ B;  4UNO A;  3M7G A;  3G73 A;  2DFI A;  2RKH A;  2ZME B;  1T2K A;  1G6N A;  5HLI A;  2DBB A;  4CXF A;  3K1M A;  1C0W A;  3BDD A;  1QZY A;  3DEU A;  3F22 A;  2F5F A;  5IT3 A;  5JR3 A;  1LEA A;  5LBQ A;  3L2C A;  1MD0 A;  4RAZ A;  4KIF A;  1MGT A;  4CO8 A;  2FBH A;  2FXA A;  4WXD A;  1ZAR A;  3I59 B;  3F8B A;  3GLX A;  3R6S A;  2A61 A;  2QLZ A;  2W85 A;  3QPH A;  3ZP5 A;  1U2W A;  2H6B A;  2EWN A;  4U0W A;  1XSD A;  4EJO A;  2OU2 A;  5AIQ A;  3GF2 A;  3PQJ A;  3FXQ A;  1BC7 C;  3ZN0 A;  2A5Y B;  2OD5 A;  3W6J B;  1ODD A;  2FSW A;  3IKT A;  2Y48 A;  3TOB A;  5E1W A;  2PMU A;  3E6C C;  4KN4 X;  1FYL A;  2ELH A;  2VON A;  4KIC A;  1BM9 A;  4I02 A;  2FU4 A;  1SD6 A;  1OPC A;  3AAF A;  5ICC A;  3CDH A;  1GHC A;  2LF7 A;  2O3F A;  4ENJ A;  3EDP A;  2P4W A;  1IAW A;  4PDK A;  5CLS A;  1YW8 A;  2NAZ A;  1BOA A;  4CZZ A;  5L3F A;  1P92 A;  4HW0 A;  2A69 F;  2PN6 A;  3GX4 X;  1SFE A;  3O3K A;  2PQ8 A;  3RPU A;  4ESB A;  1TW2 A;  3V8J A;  4JBA A;  1R5H A;  5K5O A;  1FY7 A;  2QEN A;  4G7Z F;  4M71 A;  2R7D A;  5J8F A;  3IRR A;  1ONV A;  4IRI A;  2NRA C;  2O6G E;  3H3U A;  3KLO A;  1H0M A;  3T1B A;  5E1Z B;  3F8N A;  4IVN A;  2XVC A;  4MTE A;  2GXB A;  2HYG D;  1EH7 A;  4NQW A;  3KP2 A;  3QPT A;  2R3S A;  1XGS A;  1S7A A;  2B0L A;  1TQM A;  3KZY A;  3HHH A;  5ILV A;  1IRG A;  4IPA A;  4A0Z A;  3LWF A;  1DP7 P;  2CW0 F;  4BHP A;  4O5V A;  5D4S A;  2VT2 A;  4QLC U;  2EV5 A;  1F9N A;  4Y13 A;  1KYZ A;  2XAG A;  2DW4 A;  1O3S A;  1HKT A;  2RDP A;  2E1C A;  1FYK A;  1BI1 A;  4L9T A;  3BP8 A;  3FXU A;  3LA2 A;  2QQ9 A;  3DPT A;  2IA0 A;  2GQQ A;  5CVJ A;  4MQV A;  2P5L C;  1ZHF A;  1J75 A;  4TV7 A;  2XAS A;  4HAM A;  4AD9 A;  4HDU A;  4HX8 A;  4AIJ A;  4ENN A;  4XSZ F;  4L5I A;  4R8H A;  4PGG A;  3K9T A;  1W7P B;  3LA7 A;  1YW9 A;  1UFM A;  3TQN A;  3P7N A;  2PG4 A;  4I0A A;  4L5J A;  3COA C;  1T98 A;  4GO1 A;  1ULY A;  5LGU A;  2FE3 A;  1YLF A;  1FT9 A;  4Q5S F;  3KE2 A;  2M45 A;  3OOP A;  4EJT A;  2PEX A;  1UCR A;  4A0Y A;  1NHA A;  1B1B A;  2TDX A;  3BZ6 A;  4A0X A;  4BXU A;  1G3Y A;  4OU0 A;  4NHJ A;  3HIF A;  4EM0 B;  2FNP A;  4A2U A;  2ESN A;  5H20 A;  4UV9 A;  1R23 A;  1LEB A;  3ML6 A;  3WTV C;  3HUG A;  4A5N A;  4U88 A;  1IN6 A;  1IRF A;  1LDK B;  2JPB A;  1W7P D;  2P5V A;  1R1V A;  2LF8 A;  3KLN A;  1U5T A;  3GZ5 A;  1ZRD A;  3E6M A;  4IF4 A;  4P5O A;  3T8R A;  2LKP A;  3M8F A;  3FMQ A;  1FSE A;  4MGR A;  3J7A O;  1IW7 F;  4M9S A;  5FD6 A;  4LMY A;  4OIN F;  4HYE A;  3SZP A;  3FWE A;  1Z1D A;  4AIK A;  5L3E A;  1CF7 B;  4MEX F;  1FYM A;  2VE9 A;  1H9T A;  1USS A;  2IPQ X;  3O2P E;  2VC1 A;  5ED4 A;  1V3F A;  1ON1 A;  3IWZ A;  4LLL A;  1R7J A;  2A3S A;  2MLK A;  1TQP A;  2P8T A;  5CVI A;  1G3S A;  3ECH A;  3RKY A;  3R4K A;  2UZK A;  2BV6 A;  2QQA A;  2HEO A;  1S7O A;  1HQC A;  5D5W B;  3KEQ A;  3ZMZ A;  1DPR A;  3ZQ7 A;  4G9Y A;  4LG0 A;  2KIF A;  1O3T A;  4LLG F;  2V9V A;  1D8K A;  1DDN A;  1X3U A;  2G7U A;  3P9I A;  3WTS C;  2P5K A;  4HLX A;  2EA4 A;  4HV5 A;  1T6S A;  3VB2 A;  5D5V B;  3ZMU A;  5HLH A;  2RGV A;  3B02 A;  3FM5 A;  3REO A;  5L3C A;  3BRO A;  1MJA A;  2QWW A;  3CTA A;  1J7K A;  1BI3 A;  4KDP A;  3JSO A;  4DNC A;  4LFU A;  3GZ6 A;  1D5V A;  5DCF A;  1MJB A;  4Y17 A;  3BY6 A;  1W4M A;  4Q47 A;  3RI4 A;  2G9W A;  1IXS B;  1MDM A;  5L3D A;  4LB6 B;  2GWR A;  1Y0U A;  1FC3 A;  3I54 A;  3V8L A;  1XMA A;  1RUN A;  4WXH A;  3HOS A;  3LA3 A;  2ZKZ A;  4M72 A;  4HF2 A;  4G94 A;  1XGM A;  1AWC A;  2ZNZ A;  3WTW C;  2D1H A;  4RGS A;  2IW5 A;  2MD5 A;  2CWE A;  1TW3 A;  3T0Y A;  3GO5 A;  3VOE A;  2IRF G;  4UUV A;  3D5L A;  3TO9 A;  2RN7 A;  1I6X A;  2Z9O A;  5EEH A;  3FX3 A;  3WGI A;  3HTU A;  4YIF A;  4EJW A;  2W25 A;  4HQE A;  1V4R A;  2BBY A;  2QBY B;  2LDU A;  4ESJ A;  5BMZ A;  1LJ9 A;  5LHH A;  1SD7 A;  3FZV A;  5BQT A;  3QAH A;  3KP5 A;  2VE8 A;  4HLY A;  4HF0 A;  4LK0 F;  3TOA A;  1IXC A;  5LRS A;  3F8M A;  1T38 A;  4CIC A;  2K4B A;  2COM A;  4EM1 A;  4WK8 F;  2QQB A;  4G6D A;  2F2E A;  2Z99 A;  3WTU C;  1HXD A;  2PI0 A;  2OQG A;  3WG9 A;  3I53 A;  1ZG3 A;  4JK1 X;  1REP C;  2CQK A;  2Q0O A;  4FT8 A;  2FBK A;  4U0Y A;  2RNJ A;  3HRS A;  4GYG A;  5BPD A;  5DUK A;  4M9Z A;  4IXA A;  1FOK A;  5H6Q A;  1T0F A;  5D8K B;  1DUX C;  1ON2 A;  1OR7 A;  3MFK A;  4MTD A;  3OV8 A;  5BS6 A;  2MH9 A;  2YPR A;  2FMY A;  2EFO A;  5DCM A;  2OBP A;  1XSX A;  2HWV A;  1J0R A;  1FP2 A;  3WU1 B;  5DYM A;  4GGG A;  1XB4 A;  1P4W A;  1K7A A;  5FLX Z;  4GCV A;  2LNB A;  5D4R A;  2FEZ A;  2DLL A;  4I7H A;  5ILS A;  1K78 A;  1SAX A;  2IJL A;  1G4D A;  2K4J A;  2FRH A;  2HZT A;  2EFP A;  2EV0 A;  2ZJ2 A;  4YFN F;  2Y0M A;  2G7H A;  1XCV A;  2DO7 A;  1W5S A;  4S04 A;  4L9V A;  1QPM A;  3GEZ A;  4Z2Y A;  1Z9C A;  2E1N A;  4Q48 A;  2UWM A;  3LFK A;  3TDU C;  4ZYE A;  1JHF A;  1FLI A;  1AOY A;  3E6D A;  1HSJ A;  5KK1 A;  3ZMS A;  2J5O A;  1JHH A;  2E7X A;  1P2F A;  4U7B A;  3M9A A;  3M8E A;  5TJJ A;  1KU3 A;  3GFM A;  1XGO A;  1BIA A;  4BHB A;  4OMZ A;  1ZLJ A;  2Z3Y A;  3KZZ A;  4CHU A;  3TO6 A;  1O7F A;  3NRV A;  4GYI A;  2L3D A;  3IHU A;  2XRO A;  1U6G A;  1FZP B;  1IN5 A;  2EJR A;  3JW4 A;  3ROU A;  3C18 A;  5FB2 A;  4RB3 C;  2BE5 F;  5L3B A;  4M73 A;  1RNL A;  2WC2 A;  3Q9V A;  5K5Q A;  1O7L A;  1KQ8 A;  1I1G A;  2DU9 A;  1LNW A;  4HV6 A;  5HDG A;  1YQA A;  4YII A;  2ISZ A;  1D3Y A;  1F5T A;  4UVA A;  1J2X A;  3FHZ A;  2GAU A;  2Q2E A;  5D5U B;  2KRF A;  3QU6 A;  2F5D A;  1U3E M;  1H9G A;  1FWZ A;  4P9U A;  3V7C A;  5LGN A;  3GYH X;  4UV8 A;  4HDV A;  1YO5 C;  3RKX A;  3HSE A;  1K6O A;  2W84 A;  4IRG A;  5HVQ C;  5FLX K;  1F1Z A;  1G3T A;  4LD5 A; 
#chains in the Genus database with same CATH topology
 1IO2 A;  1WJC A;  2L4A A;  2DOE A;  4J01 A;  4RBO A;  4PFP A;  1NH3 A;  2CW8 A;  4U0V A;  2HQ5 A;  3N05 A;  2EFN A;  1GXP A;  3G71 I;  1QRY A;  3BZK A;  4DIQ A;  2HZD A;  2HYF A;  2H09 A;  4BBS J;  3R0A A;  3AG4 H;  3EPZ A;  2IAI A;  3C2H A;  3HM5 A;  3IRQ A;  1IJW C;  4C2T A;  1UG0 A;  2JZY A;  1G59 A;  1B6A A;  2GIV A;  4ZDL A;  1MSF C;  1VZ0 A;  3CCL I;  4CGZ A;  1Z67 A;  4O3M A;  2YX4 A;  2EA2 A;  4C3H J;  3WOD F;  3HPG A;  1QO0 D;  1JGS A;  3SFZ A;  5FGM A;  4LIT A;  3WGH A;  2W24 A;  5FKK A;  4P96 A;  3S32 A;  1ZG1 A;  1QNT A;  3V4G A;  3HPH A;  1GT0 C;  1WZ2 A;  3BJA A;  2QKM B;  1N75 A;  2IP2 A;  2XAU A;  2FQ4 A;  2XKO A;  3OYN A;  3F8C A;  3A1Y A;  2K9M A;  5EZG A;  2C6Y A;  4X0G A;  1K83 J;  3OIQ A;  5F27 A;  2FJ1 A;  3FKI J;  2XB0 X;  3LSH A;  3MAJ A;  5HLT A;  5CYV A;  1WSU A;  2JN6 A;  1QA6 A;  2YU9 J;  3A2K A;  5E20 A;  2DYS H;  1PUF B;  4G6Q A;  4PK4 A;  1TL8 A;  2QVO A;  2F5V A;  2LP0 A;  5E3N A;  3RYP A;  1XMX A;  2BYV E;  3OYH A;  4L9N A;  2MFZ A;  1BW6 A;  5DCM B;  3NQO A;  3S3O A;  5B1A H;  2STW A;  2L7K A;  2XB5 A;  4IOC F;  3FXR A;  4G7H F;  3OS1 A;  2HR3 A;  2LOO A;  2V1D A;  4IO9 F;  2VB6 A;  4CCK A;  3O6B B;  2V26 A;  3ZQH A;  2DFH A;  2IVM A;  2WV0 A;  4E7J A;  1R5G A;  2DTR A;  4C9Y A;  2W82 A;  3TP3 A;  1RPW A;  4ZYH A;  1MBF A;  2GLO A;  1K78 B;  4I0B A;  1XDU A;  5HS7 A;  4I2O A;  2HQA A;  2GOM A;  2ZC2 A;  3FIS A;  3GXO A;  2WWY A;  4KT6 A;  1JUP A;  1HDD C;  2VOD A;  2M7A A;  2EFQ A;  3IP4 B;  2BY1 A;  3TGN A;  5DDG A;  4XL9 A;  3BTI A;  5D8L B;  3PIP F;  2R7Z J;  1UEL B;  2UUZ A;  2EZL A;  3E5U A;  1R22 A;  4RA2 A;  4YG2 F;  5GAG J;  2PMH A;  1E3P A;  2NNN A;  3B6A A;  1F43 A;  2F5C A;  1UHW A;  1VI0 A;  5AON A;  2Y9Z A;  2GIZ A;  3C7J A;  2MLG A;  4AVP A;  5HNH A;  5E8G A;  4FAS D;  2NVU B;  2CYY A;  4WF2 A;  3ZOB A;  1T8I A;  4BQA A;  3FM3 A;  3HKZ N;  2DA1 A;  3DBL B;  1KA8 A;  4KN7 X;  1NG7 A;  4MIM A;  2DT5 A;  5HLG A;  1R58 A;  2M2E A;  1G8X A;  1Z6T A;  4G8X A;  5TRD A;  1KU7 A;  2AXT C;  3CUO A;  2R7T A;  1IXR C;  5F0F A;  3H5A A;  2XF7 A;  1U5T C;  2MC3 A;  4Y3O A;  3TKY A;  4DGW B;  4RM3 A;  2QCO A;  3VYU B;  3G3Z A;  3FXO A;  5EDN A;  5FKO A;  4UHT A;  2NS7 A;  3BOQ A;  3C2B A;  1HW5 A;  5CQG A;  2VOO A;  1FBS A;  4D9J A;  3A02 A;  1XN7 A;  1O3R A;  3C3W A;  1S6L A;  3DF8 A;  4XRS G;  4HNU A;  2GZW A;  4CDG A;  3F23 A;  2HDC A;  2ISY A;  2OF7 A;  5IP9 J;  2IT0 A;  1P4A A;  4PGH A;  3QP6 A;  4NUB A;  3LST A;  2DCE A;  4D5F A;  3ABU A;  1AU7 A;  3KFW X;  3BCB A;  2J5P A;  2D1V A;  3RYR A;  4HRI A;  3GUD A;  3AG1 H;  4FX0 A;  3TMO A;  5F64 A;  4Y4R A;  2EFW A;  2H6C A;  3WTT C;  1JKR C;  1OCO H;  2V7F A;  1FEX A;  1ETQ A;  2HOE A;  2R7S A;  5D6F A;  3N4M A;  4IHT A;  3ASO H;  4ZYG A;  1LDJ A;  1V5E A;  3EUH A;  4BL0 B;  2Y31 A;  1IC8 A;  4KA4 A;  1RR8 C;  3KIO A;  3I4N J;  1WRJ A;  4CCJ A;  4IJA A;  3E3V A;  2CU7 A;  3K1N A;  2JWT A;  3MKZ A;  3RKQ A;  2P6T A;  4AIH A;  2VXD A;  4XKV A;  4RDU A;  3MZ8 A;  1B4A A;  4D7M A;  1FOX A;  1M1E B;  5FKL A;  2KJC A;  2L54 A;  2VJ4 A;  3HRM A;  5LHI A;  4R1H A;  4L0Z B;  3F6O A;  3GTP J;  5LGT A;  2LKS A;  2X9D A;  2XSD C;  3GZN B;  3K2A A;  2ECB A;  4ZZD A;  2NNY A;  4H4K C;  2IA2 A;  3CC2 I;  4E6K G;  3H9Q A;  5HS8 A;  1XG1 A;  1HOM A;  4AYB N;  2M4K A;  3KET A;  2M87 A;  2Q2E B;  1XGN A;  1I3A A;  3DKY A;  4KFC A;  2ZME A;  2HGC A;  1GXQ A;  3HL2 A;  2NYX A;  5E1X A;  1SD4 A;  1K4S A;  5IT9 Z;  1Z7U A;  2XDV A;  3EQL F;  3M07 A;  1KZH A;  5CVR A;  2V6E A;  3FF5 A;  1WJF A;  3OYC A;  1XMK A;  2UXN A;  5ICF A;  4EV0 A;  2EZI A;  4CYD A;  3F6V A;  2HKX A;  3G1O A;  4BJ6 C;  1O57 A;  3SZG A;  1A5J A;  2ADU A;  3RQ4 A;  4KYW A;  2VBZ A;  3M1C A;  1HKQ A;  1E3O C;  1Z91 A;  2QUF A;  4F93 B;  1NK3 P;  4A93 J;  2NS8 A;  2IS4 A;  3HKZ A;  3ZPL A;  2HPM A;  4NQW B;  5JI6 A;  1XTA A;  2VBW A;  2HI3 A;  5HDK A;  1OCC H;  3E1S A;  3M4O J;  1QBJ A;  2XPV A;  2Q1Z B;  4DYQ A;  3WHC A;  2L0K A;  4QWQ A;  4A5M A;  4KIS A;  2XV4 S;  3ABT A;  1W1W E;  4L9J A;  5DD8 A;  1O3Q A;  5JVT A;  3HTS B;  3K7A J;  3CMM A;  4D0P A;  1ZRC A;  3MMY B;  5CJ9 A;  3R60 A;  2CW7 A;  1V54 H;  1CGP A;  2X4H A;  3DTE A;  3OSF A;  3CME I;  3MQ0 A;  5K1Y A;  4RMN A;  2VC0 A;  2K3F A;  4XK4 A;  4N9I A;  3VOD A;  2NVY J;  2PBI A;  3RPU D;  3F3X A;  3J7Z I;  4I01 A;  4B48 A;  4BE2 A;  3JRH A;  1D8J A;  4M74 A;  4EMS A;  4HZF A;  3CUQ C;  4CSW A;  3HOT A;  3PFY A;  2EZH A;  5GAH J;  3WTZ A;  1FIA A;  3OYF A;  3T8T A;  4V19 K;  3Q9S A;  3LQQ A;  4LK1 F;  1EJ9 A;  1IN4 A;  4C2U A;  2K02 A;  2JMW A;  4NB5 A;  2DXI A;  2V9P A;  1S29 A;  2FD5 A;  3ERE D;  1F4K A;  1HKS A;  3CJT B;  3CUQ A;  4I09 A;  2CG4 A;  1SMT A;  2M4G A;  5HOO A;  3HRT A;  5IP6 A;  1ZGW A;  3S2H J;  2VUM J;  1GLN A;  2XUB A;  4CCL A;  2JPC A;  2HDW A;  4A3M J;  5M3M J;  4GXO A;  2R7U A;  4FE7 A;  1R6R A;  1B9M A;  2A6E F;  4BAY A;  3BR3 A;  1D5Y A;  2HTS A;  2Y0S N;  2YUS A;  5DM7 F;  1SVL A;  2VAS A;  3KPH A;  4LIU A;  3IC7 A;  3RDI A;  3S3M A;  2OUM A;  1W5T A;  3LSK A;  3BCA A;  3PSF A;  3GW2 A;  3PIO F;  2OJE D;  1WI3 A;  1HW1 A;  2HOA A;  4N0B A;  2W00 A;  2X51 A;  1DQU A;  2KJB A;  1RI7 A;  1Z6R A;  3E5X A;  5FLV A;  2VBY A;  2ELJ A;  2X0L A;  4A3F J;  5KHD A;  1MZB A;  4BNC A;  1KYW A;  1TBX A;  4EAT A;  2X6O A;  4F92 B;  3DU6 A;  3HYI A;  3AL0 C;  3PNT A;  3OIO A;  2XGE A;  4AYB A;  2V6C A;  2BY3 A;  1RC9 A;  1PP7 U;  1R1U A;  2KDO A;  2DI3 A;  4LGW A;  4P55 A;  5EF6 A;  4HQM A;  2ZJQ F;  5E3O A;  3FMR A;  1U78 A;  4I98 B;  2AO9 A;  3JRC A;  3DLL F;  4O6J A;  3TL4 X;  3F21 A;  2STT A;  3B73 A;  5K7Z A;  3GFJ A;  1S3J A;  2A68 F;  3ZN1 A;  2ZJR F;  1F36 A;  2AXL A;  5ICG A;  4R79 A;  3VYT B;  1P4X A;  1RUO A;  4RB1 A;  2WBM A;  4RGR A;  4EM2 A;  2K86 A;  2P7V B;  3MZY A;  2FX0 A;  2RVC A;  1MMG A;  2NS0 A;  3ZGK A;  4XRM A;  3K2Z A;  3CCJ I;  2L01 A;  4QTR A;  3Q0U A;  5EG0 B;  2DPU A;  2HDD A;  2ECC A;  1R36 A;  1LE8 A;  2LSO A;  1JTY A;  5CQE A;  1Y8R B;  1PP8 F;  1RET A;  2L2O A;  4HX4 A;  1ZGA A;  3OL4 A;  1BOB A;  2M0M A;  4IL6 C;  5GAE J;  1TWA J;  2VQL A;  1VQ4 I;  5H2F C;  3K6G A;  3QOE A;  5J6X A;  3WG7 H;  3GFI A;  3U2R A;  4G7O F;  4HX7 A;  3CDL A;  1T0F C;  2VPL A;  4OWR B;  2V1N A;  1L3L A;  2FNA A;  1U0J A;  1OR7 C;  2V9K A;  2JA8 J;  2MGQ A;  1SAN A;  3V8K A;  2H1K A;  2XAQ A;  2RQQ A;  1TT5 B;  2XRL A;  2CQN A;  4KNY A;  2VJ5 A;  2WTE A;  5IT9 K;  3D5R C;  2DJI A;  2OC6 A;  3DV8 A;  4HOB A;  5FJ8 J;  3J81 K;  2GXG A;  4CH7 A;  1KU2 A;  1ZYR F;  4B09 A;  2PFB A;  1U5T B;  2CQQ A;  2PJR B;  3I56 I;  1QQI A;  2DK8 A;  4OOI A;  1CQT A;  3RTR A;  3KZI C;  2FF4 A;  5F1R A;  5FRN A;  3LSM A;  2E7W A;  3H3Z A;  1IV8 A;  2DQR A;  1ITY A;  3CC4 I;  3M3Y J;  3L2R A;  2EIM H;  4KMU X;  3BG5 A;  2YS9 A;  2W48 A;  3HOY J;  1TWF J;  2WAF A;  2KRH A;  2R7F A;  4CUG A;  5J47 A;  4C3I J;  2HYJ A;  3KP6 A;  3ECO A;  3G1L A;  2VPR A;  5CVV A;  1GUU A;  1L0O C;  3DEW A;  3IV5 A;  3ELK A;  2CSO A;  3I0T A;  1D1B A;  4JP0 A;  1MBK A;  5GTI C;  2PMZ N;  1WI9 A;  2Y2Z A;  4ENK A;  2Y30 A;  1W7P A;  1VF9 A;  1JTX A;  4BQQ A;  4KUM A;  2KIM A;  2VOP A;  4L18 B;  2HS5 A;  3C1D A;  4Y15 A;  3DEE A;  5BPI A;  3W2V A;  3U9G A;  5ICE A;  1W36 C;  1TLH B;  1ZAO A;  2OCE A;  1YX5 A;  4FE4 A;  3OYK A;  3HHG A;  4BQN A;  2DA4 A;  2DYR H;  3CES A;  4ABZ A;  1U8B A;  1YJN I;  3F8F A;  5A2Q Z;  3LNQ A;  2A07 F;  5H6R A;  4NDL A;  2EBI A;  3IH4 A;  4LG3 A;  3SQN A;  2O9L A;  2UXX A;  2HKO A;  3PQK A;  3W6K B;  4XKW A;  4E70 A;  2OZ6 A;  3GTM J;  2W4S A;  1UAA A;  2ACJ A;  3H36 A;  4BEH B;  5CVU A;  3ZQF A;  3AG2 H;  1GDT A;  2CFO A;  1QHH D;  2K7L A;  2EIN H;  1B9N A;  3F9K A;  1R5I D;  2W57 A;  2KRC A;  2W7N A;  4LG0 B;  4CCM A;  3D0S A;  4DOZ A;  2KIU A;  4I99 C;  3SHF A;  2O0Y A;  4JOM A;  3S2W A;  3N97 A;  5E17 F;  4LJZ F;  3ESW B;  2L02 A;  4KIT B;  2RRE A;  4E4H A;  5JHF A;  3CCR I;  4LLN A;  1WH7 A;  2L9V A;  1BC8 C;  3GWZ A;  3CP8 A;  1FPQ A;  2CV0 A;  2EV6 A;  3D5S C;  3RSN A;  1KGS A;  4UUS B;  1HBX G;  4HF1 A;  2PJP A;  2LR8 A;  2OZU A;  1YW7 A;  3HDD A;  1GV2 A;  3OMY A;  4YIR X;  2KMU A;  4PSW A;  1JXS A;  5E18 F;  2BW3 B;  2FOW A;  1YS6 A;  2K9N A;  3LSJ A;  5LEJ A;  3BPV A;  2V1U A;  1WCM J;  2E60 A;  2L4M A;  4A3E J;  2CO5 A;  2EK5 A;  4I76 A;  3L00 A;  3UR3 C;  3G4S I;  2RV8 A;  3S16 J;  3TBI A;  1B59 A;  4BHC A;  4FTH A;  1MJ9 A;  1SFX A;  2HOT A;  2D45 A;  1MDM B;  3I58 A;  4RAY A;  4E7Z A;  4M3G A;  1DP3 A;  2R5Y B;  3MN2 A;  5FO5 A;  2A6H F;  3V7S A;  1VQ5 I;  3BPX A;  1PJR A;  4E7L A;  3L09 A;  2DMU A;  2MAB A;  1ZG5 A;  2CUZ A;  3GTQ J;  3IAS 2;  2E1O A;  5EYR A;  2IS2 A;  1LQ1 A;  1T39 A;  1KU9 A;  1V5G A;  3CUQ B;  1CF7 A;  2D2W A;  5FKM A;  1LB2 A;  2KL4 A;  2L5Q A;  1ETV A;  3I5U A;  4BJ5 C;  1W5C C;  3S2D J;  1STZ A;  2W1O A;  1YE9 A;  3QRF F;  2PMZ A;  3ZMT A;  2G0E A;  2H94 A;  3M1E A;  2A5W A;  2M34 A;  1KQ0 A;  2GA1 A;  2M1B A;  2VN2 A;  4BKX A;  4MO7 A;  1QHG A;  5F0H A;  4U7D A;  5JVG F;  3BR6 A;  5B3S H;  4XLE A;  1ACI A;  4ZZL A;  4XLP F;  4XRF A;  1B72 B;  1LDD A;  2XAH A;  3QOP A;  1XDS A;  4WXC A;  4XLH A;  3H35 A;  2Z16 A;  2ME0 A;  1TWH J;  3RKW A;  1WWX A;  1GVJ A;  1SFK A;  2VL8 A;  3GCM A;  3V7R A;  1V5F A;  1R71 A;  3GFL A;  4B44 A;  2V79 A;  1PUE E;  1JUS A;  3BWG A;  1MBH A;  2JTV A;  5LLQ A;  4A12 A;  4ASN A;  2X6W A;  4AC0 A;  5GP9 A;  3FDY A;  2YSR A;  2WAQ N;  3R0J A;  3RIR A;  2FA5 A;  5B5E C;  1J5Y A;  2PX9 A;  2QSG X;  2M5W A;  3PFI A;  3JTG A;  3Q5F A;  3H0G J;  1FNN A;  3R61 A;  4KMF A;  1OIS A;  1VTN C;  3PO3 J;  2E1M C;  4OIO F;  5J4V A;  1TTY A;  1G3W A;  4KT5 C;  3HSF A;  4XLN F;  3J80 Z;  3BR2 A;  3VFZ A;  4AID A;  4ZJZ A;  2CFX A;  1SMY F;  2V1X A;  3KP3 A;  2XGX A;  3K4K A;  3NWT A;  4IOA F;  2IA1 A;  1A31 A;  2DK5 A;  1BJA A;  1WHU A;  3DTI A;  3KCC A;  1RZ4 A;  1YIT I;  2LKX A;  2OQR A;  4RAG A;  1QVU A;  1SD5 A;  3L7W A;  3QWL A;  4MLO A;  2Q8K A;  3QU3 A;  2LG4 A;  1IN7 A;  1TWC J;  1UB9 A;  2B7E A;  4UB8 C;  1J59 A;  4C2M J;  1SFO J;  2GA2 A;  5A2Q K;  3JAM K;  5FD5 A;  4DJA A;  4J19 A;  4PCQ A;  4QPO A;  5HDN A;  5L3G A;  4YFK F;  1MNM C;  1OYY A;  5LEK A;  3QP5 A;  1FP1 D;  2JA5 J;  1BI0 A;  3TW7 A;  4NBQ A;  3H0D A;  3SEZ A;  2YU3 A;  4RS8 A;  4BGD A;  4F3Q A;  3BJO A;  2QEX I;  6PAX A;  3L2Q A;  1Z77 A;  5DD4 A;  4MQ9 F;  2VXZ A;  3M8J A;  1ZEL A;  2DMQ A;  1QGP A;  1SAU A;  1TNT A;  2P7C B;  4EGZ A;  4FX4 A;  1MMS A;  2JA7 J;  4EGY A;  4XR6 A;  3DWL E;  5FKN A;  3MZH A;  2ZJP F;  3BT9 A;  3SZT A;  5DTD A;  2WAE A;  1JT0 A;  1I1S A;  4HG2 A;  1HST A;  3FMS A;  2ESH A;  2XIG A;  1R00 A;  4MNU A;  1W0T A;  3S15 J;  5FFZ A;  2OTL I;  1IUF A;  2P6S A;  4BYY A;  1YJ9 I;  1IG7 A;  3OYM A;  1R1T A;  2BVM A;  5E3M A;  1T95 A;  2FBI A;  4UXN A;  3MKW B;  3CLQ A;  2IGN A;  3DQV C;  3DP7 A;  1SEU A;  3IAM 2;  5K5R A;  2ME6 A;  1ZLK A;  2XC7 A;  2FOK A;  4HBL A;  2O61 A;  5JHU A;  4A3I J;  4RLF A;  2XF6 A;  2B9S A;  5J3L A;  1ZH5 A;  1ENH A;  3LMM A;  2JT1 A;  3WE3 A;  2VBX A;  3QPL A;  4XON A;  5EEG A;  2BHZ A;  5F6F A;  5ILU A;  4NNJ A;  1OMI A;  1Y1V J;  5IYD J;  4F7Z A;  3VWB A;  3H92 A;  2E19 A;  1FBQ A;  1RIO H;  1X1D A;  2ID6 A;  1WKM A;  5M5X J;  1JKQ C;  1RRJ A;  3PL8 A;  2CUE A;  4RAF A;  4WX9 A;  4PJ0 C;  3LAP A;  2HQN A;  1D0Z A;  1X1B A;  2IBD A;  2JJ7 A;  3HXL A;  3PM1 A;  4JX5 A;  1VQ9 I;  2QBY A;  1I5Z A;  1XX5 A;  3DLA A;  2D5V A;  2JRT A;  1ZGJ A;  1UG2 A;  3MWM A;  1A6Q A;  4JQF A;  4C30 A;  3SXY A;  5B66 C;  1W0U A;  2NVQ J;  1TNS A;  1PDN C;  1Z21 A;  1N77 A;  3CLO A;  3K1P A;  5KVR A;  2CGP A;  4UUT A;  3OYB A;  2K40 A;  2MBF A;  5F08 A;  2XHK A;  3WU0 A;  3WE2 A;  4NC8 A;  5HS9 A;  4ETS A;  3CCQ I;  5F1J A;  1EA3 A;  1LVK A;  1R4M B;  2DQL A;  1Z7L A;  3IL2 A;  4H0E A;  2PLY A;  3LSP A;  2IS6 A;  1OKR A;  1IZ1 A;  3KEY A;  1XS9 A;  1DGR M;  3H5N A;  1X19 A;  1EH6 A;  3EUK L;  1G2H A;  4BU2 A;  1Z05 A;  2NVX J;  4A3D J;  4DQ2 A;  1I27 A;  1IN8 A;  3CZ6 A;  4RGU A;  4MEY F;  1BJZ A;  4XLC A;  3HOU J;  3EUH C;  2VKD A;  2E35 A;  3JRG A;  1XD7 A;  4EQQ A;  1ZR2 A;  2M8G X;  4IHS A;  4K2E A;  3CJN A;  2BOL A;  1QZE A;  3I64 A;  2ZSH B;  3WTX C;  4XOR A;  4OIR F;  2ZNY A;  1UHM A;  1SFU A;  5CPR B;  2DA2 A;  4DW6 A;  4N4N B;  2WV1 A;  2OAZ A;  5EGO B;  4IX7 A;  1JT6 A;  1XCB A;  2AHQ A;  2OPT A;  3A01 B;  2Z1D A;  2OA4 A;  4BH9 A;  3J80 K;  3BR5 A;  3CF5 F;  2LRE A;  3AFH A;  4RGX A;  3SEQ A;  4EJV A;  3UNG C;  3FK6 A;  5IYB J;  3ZMD A;  2QA4 I;  3GTL J;  2ZME C;  1EV7 A;  2FML A;  2N8G A;  1FTT A;  1K6Y A;  1D0Y A;  2A6T A;  3EYI A;  3HSR A;  3MKL A;  2MA3 A;  4B3A A;  2YX7 A;  4ENM A;  1QZZ A;  3JRE A;  3CMY A;  4GRI A;  3OR1 C;  3ZCO A;  3FBI B;  2EB7 A;  4X1E A;  1YIO A;  4EJU A;  3EYY A;  2K9L A;  3CO7 C;  3I71 A;  1J9I A;  2RC4 A;  2ZB9 A;  2O03 A;  1YFH A;  1YHQ I;  2E2I J;  3NEU A;  3J81 Z;  2E36 A;  4IZZ A;  3OYL A;  1ZN2 A;  3I4P A;  1E0E A;  3ZQG A;  5GPC A;  4Y33 A;  2LD5 A;  4B8X A;  3DPU A;  2ETH A;  2R7O A;  4RB2 C;  1OQY A;  5FRM A;  1LFB A;  1E2X A;  3I59 A;  1EH8 A;  5C3E J;  2R5Z A;  3CCU I;  1HW2 A;  1SVO A;  3A0B C;  3FXJ A;  5JLW A;  1JJ6 C;  2JVH A;  4MFD A;  4W97 A;  3JRD A;  3P9C A;  4BUP A;  3HOZ J;  4XID A;  3KEO A;  3ERM A;  4HEA 2;  3F72 A;  1FBU A;  2HQR A;  3BQZ A;  1BIB A;  3H1C A;  4Q4Z F;  1AKH A;  2KKO A;  2L9S A;  3DXJ F;  1YTY A;  3L2W A;  5D6E A;  3BZC A;  4L0Y B;  1OFC X;  1LVA A;  2VIX A;  2DJN A;  1WGX A;  3E97 A;  2HFH A;  2M9H A;  4BDZ A;  2XKP A;  2IGO A;  1OYW A;  1X2M A;  2DPD A;  1PVE A;  4P9F A;  4ZH4 F;  2BXY A;  4WCG A;  4A6D A;  4QSH A;  5LRR A;  3WGG A;  1JJ8 C;  2E1M B;  2M30 A;  3CDI A;  2BVL A;  3E7L A;  4M9X A;  2JSC A;  1BI2 A;  3L2V A;  3GME A;  1YG2 A;  1IRX A;  3JTH A;  2M8E A;  2XRN A;  2Y75 A;  3IKV A;  2QM3 A;  1MKM A;  4A69 C;  1D1C A;  2F5E A;  3I3L A;  2Z5U A;  4M6Y A;  4FHT A;  3I55 I;  2FQ3 A;  2Z33 A;  1EF4 A;  3K69 A;  1ZRF A;  2HTJ A;  3ZQI A;  4XIC A;  1A04 A;  1D1A A;  3BLY A;  5DUI A;  3E6B A;  2HVQ A;  3J7Y J;  2KDZ A;  1XC5 A;  1Y6I A;  3ZR8 X;  3RJP A;  4Y7N J;  2K27 A;  4RB0 A;  4DZJ A;  3VPR A;  1TT0 A;  1LPQ A;  3JSP A;  3JRI A;  1OLT A;  1H89 C;  4Y52 J;  3E5Q A;  4AWX B;  4ZC3 A;  2BGC A;  3TO7 A;  2IXS A;  4AM3 A;  4OIP F;  3P5J A;  1DPU A;  1FX7 A;  1Q1H A;  3P9K A;  2B63 J;  1T33 A;  4FET A;  3BJ6 A;  4Z6Y A;  3KP4 A;  2LC2 A;  4KIB A;  3QYE A;  1K79 A;  3H9J A;  2MH2 A;  2KLO A;  4FQG A;  4W1U A;  5M5Y J;  4IHW A;  2ZCW A;  4XBF A;  2H27 A;  1HA8 A;  1Z3X A;  3W3C A;  3Q0W A;  3CO6 C;  2GOX B;  2YR2 A;  4CYC A;  1Y8Q B;  4N9H A;  2IGM A;  4M6X A;  5DS9 A;  1XSV A;  2WAD A;  3DKW A;  5D5X B;  2X1C A;  1FSH A;  1MH4 A;  2DAO A;  2F6C A;  4OAY A;  1UHS A;  2F48 A;  3HOX J;  4OMY A;  1IUY A;  2P0W A;  1ZR4 A;  1S8N A;  4KIG A;  4HA8 A;  1YS7 A;  2ZBK A;  1Y1W J;  3QYF A;  3CCS I;  1ZRE A;  5E8I A;  2H8R A;  1IDZ A;  3O8H A;  1JE8 A;  3LAJ A;  2O7O A;  1RKT A;  3J7A Y;  1WQ2 A;  4IHY A;  1YX3 A;  1RR7 A;  4UVB A;  1NG6 A;  2CUF A;  1BR2 A;  1KQ9 A;  3HRU A;  4UVC A;  4ZYD A;  2QZ8 A;  3ZMV A;  3EET A;  2ZFW A;  2RAE A;  4WWC A;  1LFU P;  3MEX A;  4XLF A;  4PZJ A;  4ZDP A;  3DPL C;  5JFR A;  2QSF X;  3PNY A;  5LHG A;  5BOX A;  3IUO A;  4XOT A;  2ZO4 A;  3U21 A;  4GFB A;  3VEP A;  3JRA A;  1BN5 A;  1UST A;  1H88 C;  3JRF A;  1BR4 A;  4S05 A;  4ESF A;  3OR2 C;  2QYO A;  5J8C A;  2FUG 2;  2ZXJ A;  3L9F A;  3HC7 A;  2VT3 A;  5DV5 A;  2BEO A;  2DT6 A;  4A6E A;  4RM2 A;  3ABM H;  3ABK H;  1TP4 A;  3ISP A;  1IF1 A;  3T5X A;  2CQ7 A;  2O8X A;  3GTG J;  1U9N A;  4YEL A;  2XAF A;  1X1C A;  1FOW A;  1TQI A;  3Q0V A;  3GTO J;  3MCZ A;  1E17 A;  5HOD A;  1MSE C;  1VQP I;  1WJ5 A;  5KNL A;  2LRD A;  4LB5 A;  4OIQ F;  2R93 J;  5AIP A;  3BR1 A;  3KP7 A;  1JUM A;  4XSX F;  1PUF A;  2Y0S A;  1RKW A;  3GVA A;  3W2W A;  3W2A A;  3K0L A;  4LIV A;  3LSI A;  3TDZ C;  4YFX F;  2XAJ A;  1Y39 A;  2MC4 A;  3U1D A;  4QPQ A;  3DFG A;  3RPQ A;  5FFX A;  3SDG A;  1YRN A;  1P6R A;  1T08 B;  5JLX A;  2Y9Y A;  2E2J J;  1MMN A;  1BBY A;  1X3W B;  4B1R A;  4IKF A;  1OJL A;  4EVI A;  3WTY C;  4ON0 A;  2TCT A;  4M3E A;  1MH3 A;  5ERI A;  3LQR A;  1QPI A;  1U8R A;  2HXI A;  2AS5 F;  2DMT A;  1I3Q J;  4MHG A;  1OYI A;  1YYV A;  4IRH A;  4ZTJ A;  2RQP A;  5C4X J;  5DEQ A;  4E7S A;  3JAM Z;  2BY2 A;  2E71 A;  3IWF A;  3ULQ B;  5KAF C;  1HF0 A;  4UNO A;  1X1P A;  2LYC A;  3M7G A;  5J40 A;  3G73 A;  2DFI A;  2RKH A;  2ZME B;  1T2K A;  2IGK A;  1G6N A;  1A36 A;  3HBL A;  5HLI A;  2DBB A;  4CXF A;  3HGY A;  3K1M A;  1C0W A;  3BDD A;  1QZY A;  1ETW A;  3DEU A;  3K10 A;  3I9V 2;  5TIS C;  4AUX A;  3F22 A;  1IRZ A;  2F5F A;  3V42 A;  5IT3 A;  2AQF A;  5JR3 A;  1LEA A;  3FXK A;  3KYC B;  5IPA A;  5LBQ A;  1MD0 A;  3BTJ A;  4RAZ A;  4KIF A;  1MGT A;  3L2C A;  4CO8 A;  2FBH A;  2FXA A;  3LOC A;  4WXD A;  3UKG A;  1ZAR A;  2CH0 A;  1T56 A;  3I59 B;  3F8B A;  3GLX A;  2R5Z B;  4HNT A;  3PJR A;  1LFP A;  2EZK A;  4P1W A;  3R6S A;  2A61 A;  5IP7 J;  2QLZ A;  5EJC A;  4II2 A;  2W85 A;  3QPH A;  3ZP5 A;  4E7K A;  3DKX A;  1U2W A;  2H6B A;  2DMN A;  2EWN A;  1A35 A;  4U0W A;  3SFI A;  1XSD A;  4EJO A;  2OU2 A;  5AIQ A;  2QSH X;  4I6Z A;  3GF2 A;  3PQJ A;  3FXQ A;  1BC7 C;  3ZN0 A;  2A5Y B;  2OD5 A;  3ZQC A;  2MG4 A;  3W6J B;  1WJE A;  5F0C A;  3FIW A;  1ODD A;  2FSW A;  3IKT A;  2Y48 A;  2VJI A;  3TOB A;  3SDB A;  2M7B A;  1BW5 A;  2BXZ A;  3ZQL A;  1IGN A;  2MD0 A;  1Y0N A;  2OTJ I;  3S17 J;  4XNF A;  5E1W A;  2PMU A;  3E6C C;  3Q3S A;  4KN4 X;  1FYL A;  5IYC J;  4DZP A;  2ELH A;  2VON A;  4KIC A;  4JX4 A;  3CC7 I;  3K70 C;  1BM9 A;  3TP0 A;  4X6A J;  3ABL H;  4I02 A;  4PFO A;  2FU4 A;  3S1Q J;  1SD6 A;  4BAC A;  1OPC A;  4UB6 C;  3AAF A;  1UJ8 A;  3KYL A;  5ICC A;  3CDH A;  1GHC A;  2LF7 A;  3W6V A;  2O3F A;  4ENJ A;  2WB1 N;  3EDP A;  2P4W A;  1IAW A;  4PDK A;  5CLS A;  1YW8 A;  2NAZ A;  1BOA A;  1ZK8 A;  4CZZ A;  5L3F A;  4A3K J;  2KPM A;  1P92 A;  4RLQ A;  1Y56 A;  4HW0 A;  3D1N I;  1VQ8 I;  2A69 F;  1V55 H;  2PN6 A;  3GX4 X;  3G2B A;  5J4Y A;  2LLK A;  1SFE A;  3CD6 I;  3O3K A;  2PQ8 A;  3RPU A;  3QQA A;  4ESB A;  3BR0 A;  1TW2 A;  3V8J A;  4J00 A;  3PNV A;  4JBA A;  1R5H A;  2K5C A;  4S0H B;  1FMW A;  5K5O A;  1FY7 A;  3AKZ A;  2QEN A;  3A4C A;  4G7Z F;  4XM3 A;  4M71 A;  1VQK I;  2ZXH A;  2R7D A;  4XOP A;  5J8F A;  3IRR A;  1ONV A;  5E79 C;  4IRI A;  4BQO A;  2NRA C;  3HJE A;  3H3U A;  2O6G E;  3KLO A;  4A3G J;  4ANJ A;  3T1B A;  1H0M A;  5E1Z B;  3F8N A;  4IVN A;  2XVC A;  2JA6 J;  4MTE A;  2GXB A;  3DBR B;  2HYG D;  1I6H J;  1ERD A;  4XKC A;  3VSK A;  4II3 A;  1EH7 A;  2WY7 Q;  4NQW A;  1X3Z B;  2KT0 A;  2I8D A;  3KP2 A;  3QPT A;  2R3S A;  1Q1V A;  1LE8 B;  4PJN A;  3AG3 H;  1XGS A;  1S7A A;  3I4M J;  2B0L A;  1TQM A;  3KZY A;  3FK7 A;  3S1N J;  3HHH A;  5ILV A;  2VQH A;  4M3B A;  4B4C A;  3MKY B;  2X1D A;  4XLA A;  2O8K A;  1IRG A;  4IPA A;  4A0Z A;  3OYA A;  3LWF A;  2DDB A;  1DP7 P;  2CW0 F;  2LK2 A;  3H5R A;  3ASN H;  4BHP A;  2HOS A;  5EZH A;  3KX2 A;  1VFC A;  4O5V A;  2OV7 A;  1IV6 A;  5D4S A;  2X48 A;  5CKT A;  2VT2 A;  5GAD J;  4QLC U;  1TZL A;  1F9N A;  2EV5 A;  4Y13 A;  1KYZ A;  1QU3 A;  4DBR A;  1S5L C;  2XAG A;  2DOD A;  2COB A;  2DW4 A;  3BQY A;  1O3S A;  4BS9 A;  3CF2 A;  1HKT A;  3FXL A;  1WJB A;  4PUS A;  2RDP A;  1YI2 I;  3ZRG A;  2E1C A;  1FYK A;  1BI1 A;  4L9T A;  3NAR A;  3EUA A;  1DU6 A;  3BP8 A;  1U9O A;  4F52 A;  3FXU A;  2DDA A;  3LA2 A;  1BL0 A;  3PSI A;  1APL C;  4A3J J;  1MNE A;  2QQ9 A;  3NWS A;  2JQ7 A;  3DPT A;  2IA0 A;  2GQQ A;  5CVJ A;  4MQV A;  2P5L C;  1OCT C;  4ZYA A;  4BE0 A;  2KQR A;  3CCY A;  3MVP A;  1ZHF A;  1J75 A;  4TV7 A;  1FOY A;  2XAS A;  3L1P A;  4HAM A;  2WB1 A;  3ZQQ A;  4AD9 A;  3CJQ B;  3S8P A;  2EQR A;  4HDU A;  4HX8 A;  3S93 A;  4AIJ A;  4ENN A;  1HDP A;  1WPK A;  3K4C A;  2VKE A;  1SVM A;  4XSZ F;  4ZTF A;  2O5R A;  4L5I A;  4PGG A;  4R8H A;  2XSJ C;  2LFB A;  3K9T A;  1W7P B;  1NK2 P;  3LA7 A;  1YRN B;  1YW9 A;  1JKO C;  3QYB A;  1UFM A;  5M3F J;  2L9N A;  3TQN A;  3P7N A;  2PG4 A;  3IH3 A;  4I0A A;  4L5J A;  1T98 A;  4GO1 A;  1ULY A;  5LGU A;  3COA C;  2FE3 A;  3QPS A;  1YLF A;  3CCV I;  5KCM A;  1FT9 A;  3K4B A;  4Q5S F;  3FHN A;  2KHM A;  1N78 A;  3KE2 A;  1VQL I;  2NVT J;  2AQE A;  2M45 A;  1ZTR A;  1ETO A;  3CP2 A;  3VDX A;  3OOP A;  3HOW J;  4XRS A;  2DN0 A;  2WAQ A;  4YEJ A;  4EJT A;  4F55 A;  1IDY A;  1MIJ A;  2PEX A;  1UCR A;  3X2Q H;  4XN3 A;  4A0Y A;  4ITV A;  4CCO A;  1NHA A;  1B1B A;  1R9T J;  2LH9 A;  2L7Z A;  2TDX A;  2ZFU A;  1UZC A;  3BZ6 A;  4A3L J;  4A0X A;  1WJD A;  3OYG A;  4BXU A;  5EG0 A;  1G3Y A;  1B8I A;  4OU0 A;  4NHJ A;  3HIF A;  4EM0 B;  2FNP A;  2EIK H;  4A2U A;  3HOV J;  2ESN A;  5TGT A;  4E7I A;  5H20 A;  3DTK A;  4BBR J;  4UV9 A;  2DMP A;  4B47 A;  1R23 A;  2IS1 A;  1LEB A;  3ML6 A;  2L7M P;  3WTV C;  4BXX J;  3HUG A;  4A5N A;  3JR9 A;  5LD2 C;  4U88 A;  1IN6 A;  1H8A C;  4ZDO A;  1D0X A;  3DCF A;  3S1R J;  1IRF A;  1LDK B;  2JPB A;  1W7P D;  2P5V A;  2LBF A;  1O4X A;  2K3P A;  1R1V A;  2MW8 A;  2LF8 A;  3KLN A;  2LY1 A;  2DOF A;  2VQG A;  3IH2 A;  1U5T A;  3GZ5 A;  2PJR A;  4IHV A;  2GXA A;  1ZRD A;  1A6I A;  3E6M A;  5EEA A;  1K61 A;  1WFX A;  2QQ8 A;  4IEJ A;  1N25 A;  3SYT A;  4E7H A;  4IF4 A;  4P5O A;  3T8R A;  4NC7 A;  2TRT A;  2LKP A;  3M8F A;  3FMQ A;  1FSE A;  3C2G A;  4MGR A;  3J7A O;  1IW7 F;  2I5U A;  3BG9 A;  1W36 D;  4M9S A;  5FD6 A;  4IQJ A;  4LMY A;  4OIN F;  5LFA A;  1YIJ I;  4HYE A;  1QVT A;  3SZP A;  3SJM A;  3FWE A;  3RCO A;  2DOA A;  1ORK A;  1Z1D A;  4AIK A;  5L3E A;  1CF7 B;  4MEX F;  1FYM A;  3E0J B;  2VE9 A;  3OYJ A;  1H9T A;  1USS A;  2IPQ X;  2XGD A;  2VLA A;  3O2P E;  2VC1 A;  5ED4 A;  1V3F A;  4XN0 A;  1SC7 A;  2JA2 A;  4CA0 A;  1ON1 A;  4HPQ A;  3IWZ A;  2DFF A;  4LLL A;  3PO2 J;  5IY5 H;  2CMP A;  5E3L A;  3JRB A;  1JKP C;  1R7J A;  4BE1 A;  4IHX A;  3S14 J;  1MW7 A;  2A3S A;  2MLK A;  1TQP A;  2P8T A;  3A0H C;  1DU0 A;  1R49 A;  2JK3 A;  5CVI A;  1OCR H;  1G3S A;  3ECH A;  3OOU A;  3RKY A;  2CV1 A;  3R4K A;  1VQ7 I;  2UZK A;  2BV6 A;  2I10 A;  2F4M B;  1AA7 A;  3HG9 A;  2QQA A;  2HEO A;  2ICW G;  1S7O A;  3LSG A;  4V2G A;  5K7H A;  3BG6 A;  1HQC A;  4B3X A;  2H1L A;  2P81 A;  2DA7 A;  3K4M A;  4BEH A;  5D5W B;  3KEQ A;  5GPA A;  5C4J J;  2R4G A;  3ZMZ A;  1DPR A;  2JUG A;  3ZQ7 A;  4G9Y A;  4KJZ A;  4BY1 J;  4LG0 A;  2KIF A;  4DYR A;  1S7E A;  3QOD A;  2QF7 A;  1O3T A;  4LLG F;  2V9V A;  1D8K A;  1DDN A;  2CRG A;  1X3U A;  2KZV A;  1LUJ B;  2G7U A;  3P9I A;  1GV5 A;  3WTS C;  2P5K A;  4HLX A;  4C3J J;  2H8W A;  2EA4 A;  4HV5 A;  2KP6 A;  1Z0X A;  2NOG A;  1T6S A;  2DFE A;  3VB2 A;  1OCP A;  5D5V B;  3ZMU A;  5HLH A;  2RGV A;  3B02 A;  3FM5 A;  1WVR A;  3REO A;  2CJJ A;  5L3C A;  4YRV A;  4UUS A;  2R7V A;  3BRO A;  1P7J A;  3GBG A;  1MJA A;  2QWW A;  3CTA A;  1J7K A;  1X1A A;  1BI3 A;  3K70 D;  2VKV A;  2BW3 A;  4KDP A;  2OCC H;  3JSO A;  2Z2S B;  4DNC A;  4LFU A;  1S9H A;  4HSR A;  2IEK A;  2LTP A;  3GZ6 A;  1D5V A;  5DCF A;  3JCU C;  1MJB A;  4Y17 A;  4F91 B;  4A3C J;  2DA5 A;  2CUJ A;  2QGU A;  3BY6 A;  1WH5 A;  1W4M A;  4Q47 A;  4XMY A;  3RI4 A;  2G9W A;  1IXS B;  2F4O B;  1MDM A;  5L3D A;  1LKX A;  4D7N A;  4LB6 B;  2GWR A;  3S3N A;  1HC8 A;  2HXO A;  2HPI A;  3LFU A;  2R5Y A;  1TWG J;  2WY8 Q;  1Y0U A;  2LMD A;  1FC3 A;  2KFD A;  3I54 A;  3V8L A;  2VJJ A;  2BZT A;  4B43 A;  4N4O B;  3CJR B;  1XMA A;  1RUN A;  2JRM A;  5J1Y A;  4WXH A;  2LY2 A;  4XKB A;  1I50 J;  3HOS A;  9ANT A;  3LA3 A;  2ZKZ A;  4M72 A;  4HF2 A;  2VKH A;  4G94 A;  1XGM A;  2WA0 A;  1AWC A;  4DBQ A;  2RNG A;  2ZNZ A;  3RQI A;  2EIL H;  3WTW C;  2D1H A;  3VSL A;  4RGS A;  3BG7 A;  2DA6 A;  2IW5 A;  4PSX A;  2MD5 A;  1HCR A;  4BJT A;  3MD2 A;  1B72 A;  3CCE I;  3OY9 A;  2CWE A;  2X85 A;  4U87 A;  1TW3 A;  3T0Y A;  2E5Z A;  3F0C A;  3GO5 A;  3VOE A;  1JI8 A;  2NOJ B;  2IRF G;  4UUV A;  4GDF A;  3D5L A;  2VI6 A;  3TO9 A;  3PUF A;  2RN7 A;  1KON A;  4HST A;  1X58 A;  1I6X A;  2Z9O A;  5EEH A;  3FX3 A;  3WGI A;  3HTU A;  2EPF A;  4YIF A;  2BHY A;  4EJW A;  2W25 A;  3CQZ J;  4CZC A;  4HQE A;  3OS2 A;  2ELK A;  1V4R A;  1FTZ A;  2BBY A;  3OS0 A;  2QBY B;  5J1U A;  2LDU A;  4ESJ A;  1DGW Y;  1LJ9 A;  1YOV B;  4D5C A;  5BMZ A;  2X6Y A;  5LHH A;  1SD7 A;  3B6C A;  3FZV A;  5BQT A;  1NTC A;  2DTZ A;  3HZJ A;  3QAH A;  3KP5 A;  2VE8 A;  3S1M J;  4HLY A;  4HF0 A;  4G12 A;  1X4O A;  4LK0 F;  3TOA A;  1B8I B;  5B1B H;  1MBJ A;  1IXC A;  2R7W A;  5LRS A;  3F8M A;  2A05 A;  1T38 A;  1AHD P;  4CIC A;  2K4B A;  2COM A;  4EM1 A;  4WK8 F;  4BY7 J;  2XGC A;  2QQB A;  4G6D A;  1J09 A;  2F2E A;  4XQF A;  2M0C A;  2Z99 A;  3WTU C;  1HXD A;  1PYV A;  2PI0 A;  1MMA A;  3U1K A;  2OQG A;  4PJL A;  3WG9 A;  5FLM J;  1RES A;  3HUG B;  1ZG3 A;  3I53 A;  4JK1 X;  1REP C;  2GBY A;  2CQK A;  2Q0O A;  4FT8 A;  2FBK A;  2E2H J;  1UMQ A;  3ZXS A;  1POG A;  2RNJ A;  4U0Y A;  2LBF B;  3HRS A;  4GYG A;  2L7F P;  5DUK A;  5BPD A;  4M9Z A;  5KAI C;  3HB9 A;  4IXA A;  1FOK A;  5H6Q A;  4D1Q A;  1T0F A;  5D8K B;  3OIP A;  1DUX C;  2DT7 B;  1ON2 A;  1OR7 A;  3ONQ A;  3MFK A;  4FIS A;  3PUB A;  4MTD A;  2EIJ H;  4IQ4 A;  3OV8 A;  5BS6 A;  2UV1 A;  1S72 I;  4UY8 I;  2MH9 A;  2YPR A;  2FMY A;  2EFO A;  5DCM A;  1ETK A;  2OBP A;  3K4J A;  3TW6 A;  1XSX A;  2HWV A;  1J0R A;  2JUC A;  2R7Q A;  1FP2 A;  2LVS A;  5DM6 F;  1MBE A;  3LSR A;  3WU1 B;  2V4J C;  5DYM A;  4GGG A;  2HNH A;  2XPU A;  3NAU A;  3BC8 A;  1XB4 A;  3O8G A;  1P4W A;  1K7A A;  1BA5 A;  5FLX Z;  4GCV A;  4MFE A;  3H9G A;  2LNB A;  5D4R A;  2M3A A;  3OWT A;  2FEZ A;  4M6V A;  2DLL A;  2XF5 A;  4I7H A;  5ILS A;  1K78 A;  1SAX A;  1ETY A;  3HGG A;  2IJL A;  2X1E A;  2K4J A;  1G4D A;  2FRH A;  2HZT A;  1VQM I;  5K7F A;  2EFP A;  2EV0 A;  4EEF G;  2ZJ2 A;  5IOZ A;  4FCY A;  4YFN F;  2Y0M A;  2R92 J;  2G7H A;  2EH3 A;  3FXM A;  3RZD J;  1XCV A;  2DO7 A;  3RZO J;  2ZXW H;  1MMD A;  1W5S A;  4S04 A;  4L9V A;  3OSG A;  1QPM A;  2XPW A;  2K9S A;  2BY0 A;  3GEZ A;  3G1M A;  2ZSI B;  4Z2Y A;  1Z9C A;  4LOC A;  2HU9 A;  2E1N A;  4Q48 A;  4M3F A;  3L2U A;  2UWM A;  4M3D A;  2R7X A;  2JVG A;  3LFK A;  3TDU C;  4ZYE A;  1JHF A;  4HNV A;  1AOY A;  1FLI A;  3E6D A;  1HSJ A;  2CS3 A;  5KK1 A;  2ID3 A;  4AVZ A;  3ZMS A;  3VYS B;  1YJW I;  3KYD B;  2J5O A;  2GM4 A;  1JHH A;  3BTC A;  2E7X A;  2JSP A;  5M5W J;  1P2F A;  2HVR A;  2QKL B;  4U7B A;  3M9A A;  3M8E A;  2MYS A;  5TJJ A;  4NC6 A;  1KU3 A;  4V2F A;  2F4I A;  3GFM A;  3K4L A;  1XGO A;  1BIA A;  4BHB A;  4OMZ A;  1AKH B;  3WU2 C;  3BTL A;  1VQN I;  3OL3 A;  1ZLJ A;  2Z3Y A;  3GTK J;  1P9Q C;  3GLL A;  4QIW N;  1TC3 C;  4BDY A;  3KZZ A;  1WJA A;  2NXN B;  2LY9 A;  1I39 A;  4PJM A;  4CHU A;  2KZG A;  3DU5 A;  4BXF A;  3TO6 A;  1HLV A;  2ZXI A;  4A3B J;  3TED A;  4DYC A;  3CMA I;  3OYE A;  1X2N A;  1O7F A;  5FRO A;  3NRV A;  4GYI A;  2L3D A;  3IHU A;  3GTJ J;  4OAZ A;  2XRO A;  2CV2 A;  1U6G A;  1ZQ3 P;  1FZP B;  1IN5 A;  4L5E A;  2CQX A;  2EJR A;  3JW4 A;  4PJJ A;  3ROU A;  2L9R A;  2KIQ A;  3C18 A;  3FKJ A;  4JYK A;  5FB2 A;  4RB3 C;  2MSY A;  2R0Q C;  5EGO A;  2BE5 F;  5L3B A;  4M73 A;  4AU7 A;  1RNL A;  4CCN A;  3A01 A;  1XPX A;  2WC2 A;  3Q9V A;  2Y69 H;  2DA3 A;  5K5Q A;  1K4T A;  1O7L A;  2E5N A;  3BG3 A;  2R7R A;  1FIP A;  1KQ8 A;  1I1G A;  2DU9 A;  1LNW A;  5IOY A;  4HV6 A;  5HDG A;  1YQA A;  4YII A;  2ISZ A;  5HNF A;  1ETX A;  1D3Y A;  1X4P A;  1F5T A;  1VQ6 I;  1VND A;  1EKE A;  3K4N A;  1J2X A;  4UVA A;  3FHZ A;  4G6T B;  2GAU A;  2K9Q A;  2Q2E A;  5D5U B;  2KRF A;  2X6X A;  3HEF A;  3QU6 A;  3A03 A;  3OYD A;  1VQO I;  2HVS A;  2F5D A;  3H3V K;  3LL7 A;  2KIS A;  1U3E M;  1Z3Y A;  1H9G A;  1FWZ A;  4P9U A;  1GVD A;  4JX6 A;  1FMV A;  3V7C A;  4CYC B;  1FJL A;  5LGN A;  3VYR B;  1BR1 A;  5J1R A;  3GYH X;  4UV8 A;  4HDV A;  1R4N B;  3G6E I;  1OCZ H;  3OYI A;  1YO5 C;  3FBN B;  1ZKG A;  5C44 J;  1E3H A;  3RKX A;  5F04 A;  2VQC A;  3HSE A;  2K85 A;  3CCM I;  3DBH B;  1JGG A;  1P7I A;  1K6O A;  2W84 A;  4IRG A;  5HVQ C;  2E34 A;  1MBG A;  5BNG A;  3WHB A;  3AL0 B;  5FLX K;  1F1Z A;  1MND A;  5GTH C;  1G3T A;  4LD5 A; 
#chains in the Genus database with same CATH homology
 2L4A A;  4U0V A;  2EFN A;  1GXP A;  2HYF A;  2H09 A;  3R0A A;  3IRQ A;  2JZY A;  1B6A A;  2GIV A;  4CGZ A;  4O3M A;  2YX4 A;  2EA2 A;  3WOD F;  1QO0 D;  1JGS A;  3SFZ A;  5FGM A;  3WGH A;  2W24 A;  4P96 A;  1ZG1 A;  1QNT A;  3V4G A;  3BJA A;  2IP2 A;  2XKO A;  3F8C A;  2C6Y A;  3MAJ A;  5CYV A;  1WSU A;  5E20 A;  4G6Q A;  2QVO A;  3RYP A;  2BYV E;  4L9N A;  5DCM B;  3NQO A;  2STW A;  3FXR A;  4G7H F;  2HR3 A;  2V1D A;  3O6B B;  2IVM A;  2WV0 A;  1R5G A;  2DTR A;  4ZYH A;  1K78 B;  4I0B A;  1XDU A;  5HS7 A;  4I2O A;  3GXO A;  2WWY A;  2VOD A;  2EFQ A;  3TGN A;  5DDG A;  5D8L B;  3E5U A;  1R22 A;  4YG2 F;  2PMH A;  2NNN A;  2F5C A;  1UHW A;  5AON A;  3C7J A;  2MLG A;  4AVP A;  5E8G A;  2CYY A;  4WF2 A;  4BQA A;  3FM3 A;  1KA8 A;  4KN7 X;  2DT5 A;  5HLG A;  1R58 A;  1Z6T A;  4G8X A;  5TRD A;  1KU7 A;  3CUO A;  1IXR C;  1U5T C;  2MC3 A;  3TKY A;  3G3Z A;  2VOO A;  4UHT A;  3BOQ A;  1HW5 A;  1FBS A;  1XN7 A;  1O3R A;  3C3W A;  1S6L A;  3DF8 A;  2GZW A;  4CDG A;  3F23 A;  2HDC A;  2ISY A;  2IT0 A;  1P4A A;  4PGH A;  3QP6 A;  3LST A;  3ABU A;  3KFW X;  3RYR A;  2J5P A;  2D1V A;  3GUD A;  4FX0 A;  5F64 A;  2EFW A;  2H6C A;  3WTT C;  2HOE A;  5D6F A;  3N4M A;  4IHT A;  4ZYG A;  1LDJ A;  3EUH A;  4KA4 A;  1WRJ A;  4IJA A;  3E3V A;  3K1N A;  2P6T A;  4AIH A;  1B4A A;  2KJC A;  2L54 A;  3HRM A;  5LHI A;  4R1H A;  4L0Z B;  3F6O A;  5LGT A;  4ZZD A;  2NNY A;  2IA2 A;  5HS8 A;  3KET A;  2M87 A;  1XGN A;  4KFC A;  2ZME A;  2HGC A;  1GXQ A;  2NYX A;  5E1X A;  1SD4 A;  5IT9 Z;  1Z7U A;  3EQL F;  5CVR A;  3FF5 A;  1XMK A;  2UXN A;  5ICF A;  4EV0 A;  4CYD A;  3F6V A;  2HKX A;  1O57 A;  2ADU A;  4KYW A;  2VBZ A;  1HKQ A;  1Z91 A;  2QUF A;  3ZPL A;  5JI6 A;  2VBW A;  5HDK A;  1QBJ A;  4A5M A;  4QWQ A;  2XV4 S;  3ABT A;  5DD8 A;  4L9J A;  1O3Q A;  5JVT A;  3HTS B;  4D0P A;  1ZRC A;  5CJ9 A;  3R60 A;  1CGP A;  2X4H A;  3MQ0 A;  5K1Y A;  2VC0 A;  4N9I A;  3VOD A;  2PBI A;  3F3X A;  4I01 A;  1D8J A;  4M74 A;  4EMS A;  4HZF A;  3CUQ C;  3HOT A;  3WTZ A;  3T8T A;  3Q9S A;  3LQQ A;  4LK1 F;  1IN4 A;  2K02 A;  4NB5 A;  1S29 A;  3ERE D;  1F4K A;  1HKS A;  3CUQ A;  4I09 A;  2CG4 A;  1SMT A;  5HOO A;  3HRT A;  2XUB A;  2JPC A;  4GXO A;  1B9M A;  2A6E F;  4BAY A;  2HTS A;  3IC7 A;  3RDI A;  1W5T A;  3GW2 A;  1HW1 A;  4N0B A;  2KJB A;  1RI7 A;  1Z6R A;  3E5X A;  2VBY A;  2X0L A;  4BNC A;  1MZB A;  1KYW A;  1TBX A;  3HYI A;  2V6C A;  1PP7 U;  1R1U A;  2DI3 A;  4LGW A;  4P55 A;  4HQM A;  3FMR A;  1U78 A;  4I98 B;  4O6J A;  3F21 A;  2STT A;  3B73 A;  3GFJ A;  1S3J A;  2A68 F;  3ZN1 A;  2AXL A;  5ICG A;  4R79 A;  1P4X A;  1RUO A;  4RB1 A;  4EM2 A;  4RGR A;  2K86 A;  2P7V B;  3MZY A;  2RVC A;  2NS0 A;  3K2Z A;  2L01 A;  2DPU A;  1R36 A;  2LSO A;  1PP8 F;  4HX4 A;  1ZGA A;  5J6X A;  3GFI A;  3U2R A;  4G7O F;  4HX7 A;  1L3L A;  2FNA A;  3V8K A;  2XAQ A;  4KNY A;  2WTE A;  5IT9 K;  3DV8 A;  4HOB A;  3J81 K;  2GXG A;  1KU2 A;  1ZYR F;  4B09 A;  2PFB A;  1U5T B;  1QQI A;  2DK8 A;  4OOI A;  3RTR A;  2FF4 A;  5F1R A;  2E7W A;  3H3Z A;  2DQR A;  4KMU X;  2R7F A;  3KP6 A;  3ECO A;  5CVV A;  1L0O C;  3ELK A;  2CSO A;  3I0T A;  1WI9 A;  4ENK A;  1W7P A;  4KUM A;  2KIM A;  2VOP A;  4L18 B;  2HS5 A;  3C1D A;  4Y15 A;  5BPI A;  3U9G A;  5ICE A;  1TLH B;  1ZAO A;  3HHG A;  3F8F A;  5A2Q Z;  2A07 F;  5H6R A;  3SQN A;  2UXX A;  2HKO A;  3PQK A;  3W6K B;  4E70 A;  2OZ6 A;  2ACJ A;  5CVU A;  2K7L A;  1B9N A;  2W57 A;  4LG0 B;  3D0S A;  2KIU A;  3SHF A;  2O0Y A;  3S2W A;  3N97 A;  5E17 F;  4LJZ F;  2L02 A;  4LLN A;  1BC8 C;  3GWZ A;  1FPQ A;  2EV6 A;  1KGS A;  1HBX G;  4HF1 A;  2PJP A;  2OZU A;  1YW7 A;  1JXS A;  5E18 F;  1YS6 A;  5LEJ A;  3BPV A;  2V1U A;  2L4M A;  2CO5 A;  2EK5 A;  3L00 A;  2RV8 A;  1B59 A;  4BHC A;  1MJ9 A;  1SFX A;  2D45 A;  1MDM B;  3I58 A;  4RAY A;  5FO5 A;  2A6H F;  3V7S A;  3BPX A;  3L09 A;  1ZG5 A;  1LQ1 A;  1T39 A;  1KU9 A;  3CUQ B;  1CF7 A;  2D2W A;  1LB2 A;  3I5U A;  1STZ A;  3QRF F;  3ZMT A;  2H94 A;  3M1E A;  1KQ0 A;  2GA1 A;  2M1B A;  2VN2 A;  4U7D A;  4ZZL A;  4XLP F;  4XRF A;  1LDD A;  2XAH A;  3QOP A;  1XDS A;  4WXC A;  3RKW A;  1WWX A;  1GVJ A;  3V7R A;  3GFL A;  2V79 A;  1PUE E;  3BWG A;  4A12 A;  2JTV A;  5LLQ A;  4ASN A;  2YSR A;  3R0J A;  3RIR A;  2FA5 A;  1J5Y A;  2M5W A;  3PFI A;  3JTG A;  3Q5F A;  3R61 A;  1FNN A;  4KMF A;  1VTN C;  4OIO F;  1TTY A;  1G3W A;  4KT5 C;  3HSF A;  4XLN F;  3J80 Z;  3VFZ A;  2CFX A;  1SMY F;  2V1X A;  3KP3 A;  2XGX A;  2IA1 A;  2DK5 A;  1BJA A;  3KCC A;  1RZ4 A;  2OQR A;  1SD5 A;  3L7W A;  2Q8K A;  3QU3 A;  1IN7 A;  1UB9 A;  1J59 A;  2GA2 A;  5A2Q K;  3JAM K;  5FD5 A;  4PCQ A;  5HDN A;  5L3G A;  4YFK F;  1OYY A;  5LEK A;  3QP5 A;  1FP1 D;  1BI0 A;  2YU3 A;  4RS8 A;  3BJO A;  6PAX A;  5DD4 A;  4MQ9 F;  2VXZ A;  1QGP A;  1TNT A;  2P7C B;  4EGZ A;  4FX4 A;  4EGY A;  3MZH A;  3SZT A;  1I1S A;  1HST A;  3FMS A;  2ESH A;  2XIG A;  1R00 A;  4MNU A;  5FFZ A;  2P6S A;  4BYY A;  1R1T A;  2FBI A;  4UXN A;  3DQV C;  3DP7 A;  5K5R A;  1ZLK A;  2FOK A;  4HBL A;  2O61 A;  5JHU A;  1ZH5 A;  2JT1 A;  3WE3 A;  2VBX A;  5EEG A;  5F6F A;  5ILU A;  1OMI A;  4F7Z A;  3H92 A;  1FBQ A;  1RIO H;  1WKM A;  4WX9 A;  3LAP A;  2HQN A;  2QBY A;  1I5Z A;  2JRT A;  1ZGJ A;  3MWM A;  4JQF A;  3SXY A;  1TNS A;  1PDN C;  3CLO A;  3K1P A;  5KVR A;  2CGP A;  2MBF A;  3WU0 A;  2XHK A;  3WE2 A;  5HS9 A;  4ETS A;  2DQL A;  3IL2 A;  4H0E A;  2PLY A;  1OKR A;  1IZ1 A;  1EH6 A;  1Z05 A;  4DQ2 A;  1I27 A;  1IN8 A;  4RGU A;  4MEY F;  1XD7 A;  4EQQ A;  4IHS A;  4K2E A;  3CJN A;  3I64 A;  3WTX C;  4OIR F;  1SFU A;  2ZNY A;  1UHM A;  2OAZ A;  1XCB A;  2OA4 A;  4BH9 A;  3J80 K;  4RGX A;  4EJV A;  3ZMD A;  1EV7 A;  2FML A;  3EYI A;  3HSR A;  2MA3 A;  2YX7 A;  4ENM A;  1QZZ A;  2EB7 A;  1YIO A;  4EJU A;  3EYY A;  3CO7 C;  3I71 A;  1J9I A;  2RC4 A;  2O03 A;  1YFH A;  3NEU A;  3J81 Z;  1ZN2 A;  3I4P A;  4B8X A;  2ETH A;  4RB2 C;  1E2X A;  3I59 A;  1EH8 A;  1HW2 A;  3P9C A;  3KEO A;  3F72 A;  1FBU A;  2HQR A;  1BIB A;  4Q4Z F;  2KKO A;  3DXJ F;  1YTY A;  5D6E A;  4L0Y B;  1LVA A;  3E97 A;  2HFH A;  2XKP A;  2DPD A;  1OYW A;  4P9F A;  4ZH4 F;  4WCG A;  4A6D A;  5LRR A;  3WGG A;  2M30 A;  4M9X A;  2JSC A;  1BI2 A;  1YG2 A;  3JTH A;  2M8E A;  2XRN A;  2Y75 A;  3IKV A;  2QM3 A;  1MKM A;  2F5E A;  2Z5U A;  4M6Y A;  4FHT A;  2FQ3 A;  2Z33 A;  3K69 A;  1ZRF A;  2HTJ A;  1A04 A;  5DUI A;  3E6B A;  3RJP A;  2K27 A;  4RB0 A;  3JSP A;  3E5Q A;  4AWX B;  2BGC A;  3TO7 A;  4OIP F;  1DPU A;  1FX7 A;  1Q1H A;  3P9K A;  3BJ6 A;  3KP4 A;  4KIB A;  1K79 A;  2MH2 A;  2ZCW A;  4XBF A;  2H27 A;  3CO6 C;  2YR2 A;  4N9H A;  4M6X A;  1XSV A;  3DKW A;  5D5X B;  1FSH A;  2DAO A;  4OMY A;  1IUY A;  1S8N A;  4KIG A;  4HA8 A;  1YS7 A;  2ZBK A;  1ZRE A;  5E8I A;  1JE8 A;  3LAJ A;  1WQ2 A;  4UVB A;  1KQ9 A;  3HRU A;  4UVC A;  4ZYD A;  2QZ8 A;  3ZMV A;  3EET A;  2ZFW A;  4WWC A;  3MEX A;  4PZJ A;  3DPL C;  5JFR A;  5LHG A;  5BOX A;  2ZO4 A;  3VEP A;  1BN5 A;  1UST A;  4S05 A;  4ESF A;  2QYO A;  5J8C A;  2ZXJ A;  3L9F A;  2VT3 A;  5DV5 A;  2BEO A;  4A6E A;  3ISP A;  1IF1 A;  3T5X A;  2O8X A;  2XAF A;  1TQI A;  3MCZ A;  1E17 A;  4LB5 A;  4OIQ F;  5AIP A;  3KP7 A;  4XSX F;  3GVA A;  3K0L A;  3TDZ C;  4YFX F;  2XAJ A;  3U1D A;  3DFG A;  3RPQ A;  5FFX A;  1P6R A;  1BBY A;  4EVI A;  3WTY C;  4ON0 A;  5ERI A;  3LQR A;  1U8R A;  2AS5 F;  4MHG A;  1OYI A;  1YYV A;  4IRH A;  2RQP A;  5DEQ A;  3JAM Z;  3IWF A;  3ULQ B;  4UNO A;  3M7G A;  3G73 A;  2DFI A;  2RKH A;  2ZME B;  1T2K A;  1G6N A;  5HLI A;  2DBB A;  4CXF A;  3K1M A;  1C0W A;  3BDD A;  1QZY A;  3DEU A;  3F22 A;  2F5F A;  5IT3 A;  5JR3 A;  1LEA A;  5LBQ A;  3L2C A;  1MD0 A;  4RAZ A;  4KIF A;  1MGT A;  4CO8 A;  2FBH A;  2FXA A;  4WXD A;  1ZAR A;  3I59 B;  3F8B A;  3GLX A;  3R6S A;  2A61 A;  2QLZ A;  2W85 A;  3QPH A;  3ZP5 A;  1U2W A;  2H6B A;  2EWN A;  4U0W A;  1XSD A;  4EJO A;  2OU2 A;  5AIQ A;  3GF2 A;  3PQJ A;  3FXQ A;  1BC7 C;  3ZN0 A;  2A5Y B;  2OD5 A;  3W6J B;  1ODD A;  2FSW A;  3IKT A;  2Y48 A;  3TOB A;  5E1W A;  2PMU A;  3E6C C;  4KN4 X;  1FYL A;  2ELH A;  2VON A;  4KIC A;  1BM9 A;  4I02 A;  2FU4 A;  1SD6 A;  1OPC A;  3AAF A;  5ICC A;  3CDH A;  1GHC A;  2LF7 A;  2O3F A;  4ENJ A;  3EDP A;  2P4W A;  1IAW A;  4PDK A;  5CLS A;  1YW8 A;  2NAZ A;  1BOA A;  4CZZ A;  5L3F A;  1P92 A;  4HW0 A;  2A69 F;  2PN6 A;  3GX4 X;  1SFE A;  3O3K A;  2PQ8 A;  3RPU A;  4ESB A;  1TW2 A;  3V8J A;  4JBA A;  1R5H A;  5K5O A;  1FY7 A;  2QEN A;  4G7Z F;  4M71 A;  2R7D A;  5J8F A;  3IRR A;  1ONV A;  4IRI A;  2NRA C;  2O6G E;  3H3U A;  3KLO A;  1H0M A;  3T1B A;  5E1Z B;  3F8N A;  4IVN A;  2XVC A;  4MTE A;  2GXB A;  2HYG D;  1EH7 A;  4NQW A;  3KP2 A;  3QPT A;  2R3S A;  1XGS A;  1S7A A;  2B0L A;  1TQM A;  3KZY A;  3HHH A;  5ILV A;  1IRG A;  4IPA A;  4A0Z A;  3LWF A;  1DP7 P;  2CW0 F;  4BHP A;  4O5V A;  5D4S A;  2VT2 A;  4QLC U;  2EV5 A;  1F9N A;  4Y13 A;  1KYZ A;  2XAG A;  2DW4 A;  1O3S A;  1HKT A;  2RDP A;  2E1C A;  1FYK A;  1BI1 A;  4L9T A;  3BP8 A;  3FXU A;  3LA2 A;  2QQ9 A;  3DPT A;  2IA0 A;  2GQQ A;  5CVJ A;  4MQV A;  2P5L C;  1ZHF A;  1J75 A;  4TV7 A;  2XAS A;  4HAM A;  4AD9 A;  4HDU A;  4HX8 A;  4AIJ A;  4ENN A;  4XSZ F;  4L5I A;  4R8H A;  4PGG A;  3K9T A;  1W7P B;  3LA7 A;  1YW9 A;  1UFM A;  3TQN A;  3P7N A;  2PG4 A;  4I0A A;  4L5J A;  3COA C;  1T98 A;  4GO1 A;  1ULY A;  5LGU A;  2FE3 A;  1YLF A;  1FT9 A;  4Q5S F;  3KE2 A;  2M45 A;  3OOP A;  4EJT A;  2PEX A;  1UCR A;  4A0Y A;  1NHA A;  1B1B A;  2TDX A;  3BZ6 A;  4A0X A;  4BXU A;  1G3Y A;  4OU0 A;  4NHJ A;  3HIF A;  4EM0 B;  2FNP A;  4A2U A;  2ESN A;  5H20 A;  4UV9 A;  1R23 A;  1LEB A;  3ML6 A;  3WTV C;  3HUG A;  4A5N A;  4U88 A;  1IN6 A;  1IRF A;  1LDK B;  2JPB A;  1W7P D;  2P5V A;  1R1V A;  2LF8 A;  3KLN A;  1U5T A;  3GZ5 A;  1ZRD A;  3E6M A;  4IF4 A;  4P5O A;  3T8R A;  2LKP A;  3M8F A;  3FMQ A;  1FSE A;  4MGR A;  3J7A O;  1IW7 F;  4M9S A;  5FD6 A;  4LMY A;  4OIN F;  4HYE A;  3SZP A;  3FWE A;  1Z1D A;  4AIK A;  5L3E A;  1CF7 B;  4MEX F;  1FYM A;  2VE9 A;  1H9T A;  1USS A;  2IPQ X;  3O2P E;  2VC1 A;  5ED4 A;  1V3F A;  1ON1 A;  3IWZ A;  4LLL A;  1R7J A;  2A3S A;  2MLK A;  1TQP A;  2P8T A;  5CVI A;  1G3S A;  3ECH A;  3RKY A;  3R4K A;  2UZK A;  2BV6 A;  2QQA A;  2HEO A;  1S7O A;  1HQC A;  5D5W B;  3KEQ A;  3ZMZ A;  1DPR A;  3ZQ7 A;  4G9Y A;  4LG0 A;  2KIF A;  1O3T A;  4LLG F;  2V9V A;  1D8K A;  1DDN A;  1X3U A;  2G7U A;  3P9I A;  3WTS C;  2P5K A;  4HLX A;  2EA4 A;  4HV5 A;  1T6S A;  3VB2 A;  5D5V B;  3ZMU A;  5HLH A;  2RGV A;  3B02 A;  3FM5 A;  3REO A;  5L3C A;  3BRO A;  1MJA A;  2QWW A;  3CTA A;  1J7K A;  1BI3 A;  4KDP A;  3JSO A;  4DNC A;  4LFU A;  3GZ6 A;  1D5V A;  5DCF A;  1MJB A;  4Y17 A;  3BY6 A;  1W4M A;  4Q47 A;  3RI4 A;  2G9W A;  1IXS B;  1MDM A;  5L3D A;  4LB6 B;  2GWR A;  1Y0U A;  1FC3 A;  3I54 A;  3V8L A;  1XMA A;  1RUN A;  4WXH A;  3HOS A;  3LA3 A;  2ZKZ A;  4M72 A;  4HF2 A;  4G94 A;  1XGM A;  1AWC A;  2ZNZ A;  3WTW C;  2D1H A;  4RGS A;  2IW5 A;  2MD5 A;  2CWE A;  1TW3 A;  3T0Y A;  3GO5 A;  3VOE A;  2IRF G;  4UUV A;  3D5L A;  3TO9 A;  2RN7 A;  1I6X A;  2Z9O A;  5EEH A;  3FX3 A;  3WGI A;  3HTU A;  4YIF A;  4EJW A;  2W25 A;  4HQE A;  1V4R A;  2BBY A;  2QBY B;  2LDU A;  4ESJ A;  5BMZ A;  1LJ9 A;  5LHH A;  1SD7 A;  3FZV A;  5BQT A;  3QAH A;  3KP5 A;  2VE8 A;  4HLY A;  4HF0 A;  4LK0 F;  3TOA A;  1IXC A;  5LRS A;  3F8M A;  1T38 A;  4CIC A;  2K4B A;  2COM A;  4EM1 A;  4WK8 F;  2QQB A;  4G6D A;  2F2E A;  2Z99 A;  3WTU C;  1HXD A;  2PI0 A;  2OQG A;  3WG9 A;  3I53 A;  1ZG3 A;  4JK1 X;  1REP C;  2CQK A;  2Q0O A;  4FT8 A;  2FBK A;  4U0Y A;  2RNJ A;  3HRS A;  4GYG A;  5BPD A;  5DUK A;  4M9Z A;  4IXA A;  1FOK A;  5H6Q A;  1T0F A;  5D8K B;  1DUX C;  1ON2 A;  1OR7 A;  3MFK A;  4MTD A;  3OV8 A;  5BS6 A;  2MH9 A;  2YPR A;  2FMY A;  2EFO A;  5DCM A;  2OBP A;  1XSX A;  2HWV A;  1J0R A;  1FP2 A;  3WU1 B;  5DYM A;  4GGG A;  1XB4 A;  1P4W A;  1K7A A;  5FLX Z;  4GCV A;  2LNB A;  5D4R A;  2FEZ A;  2DLL A;  4I7H A;  5ILS A;  1K78 A;  1SAX A;  2IJL A;  1G4D A;  2K4J A;  2FRH A;  2HZT A;  2EFP A;  2EV0 A;  2ZJ2 A;  4YFN F;  2Y0M A;  2G7H A;  1XCV A;  2DO7 A;  1W5S A;  4S04 A;  4L9V A;  1QPM A;  3GEZ A;  4Z2Y A;  1Z9C A;  2E1N A;  4Q48 A;  2UWM A;  3LFK A;  3TDU C;  4ZYE A;  1JHF A;  1FLI A;  1AOY A;  3E6D A;  1HSJ A;  5KK1 A;  3ZMS A;  2J5O A;  1JHH A;  2E7X A;  1P2F A;  4U7B A;  3M9A A;  3M8E A;  5TJJ A;  1KU3 A;  3GFM A;  1XGO A;  1BIA A;  4BHB A;  4OMZ A;  1ZLJ A;  2Z3Y A;  3KZZ A;  4CHU A;  3TO6 A;  1O7F A;  3NRV A;  4GYI A;  2L3D A;  3IHU A;  2XRO A;  1U6G A;  1FZP B;  1IN5 A;  2EJR A;  3JW4 A;  3ROU A;  3C18 A;  5FB2 A;  4RB3 C;  2BE5 F;  5L3B A;  4M73 A;  1RNL A;  2WC2 A;  3Q9V A;  5K5Q A;  1O7L A;  1KQ8 A;  1I1G A;  2DU9 A;  1LNW A;  4HV6 A;  5HDG A;  1YQA A;  4YII A;  2ISZ A;  1D3Y A;  1F5T A;  4UVA A;  1J2X A;  3FHZ A;  2GAU A;  2Q2E A;  5D5U B;  2KRF A;  3QU6 A;  2F5D A;  1U3E M;  1H9G A;  1FWZ A;  4P9U A;  3V7C A;  5LGN A;  3GYH X;  4UV8 A;  4HDV A;  1YO5 C;  3RKX A;  3HSE A;  1K6O A;  2W84 A;  4IRG A;  5HVQ C;  5FLX K;  1F1Z A;  1G3T A;  4LD5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...