3KE2A

Crystal structure of a duf2131 family protein (sama_2911) from shewanella amazonensis sb2b at 2.50 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
GDQVSKQHKAFLRKLYLAHLMDDARHNLLSLGKLTGMPRRTLQDAIASFADIGIEVEFVQDGERHNAGYYRIRTWGPISSAWMDTHVDEVKSLLGVDDAVGQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of STRUCTURAL GENOMICS, UNKNOWN FUNCTION (YP_928783.1) from SHEWANELLA AMAZONENSIS SB2B at 2.50 A resolution
rcsb
source organism Shewanella amazonensis sb2b
molecule tags Unknown function
molecule keywords uncharacterized protein YP_928783.1
total genus 25
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09904 HTH_43 Winged helix-turn helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ke2A00
1FSHA 3JAMZ 4MQVA 1KYZA 2VOPA 5E8GA 5D8KB 1R1TA 4KICA 5A2QZ 1W4MA 2HWVA 2CWEA 5AIQA 1KU9A 1V4RA 1ZLKA 1C0WA 3PQKA 1IN8A 3GFMA 1P4XA 4L5JA 4OU0A 4OMYA 4B8XA 2A6HF 4KT5C 1SFXA 3F6VA 2EFOA 4HF2A 2IA2A 4O3MA 4A6DA 5J8CA 1T38A 1EH6A 4RB0A 4N0BA 4KMUX 4BQAA 4MEYF 2MH9A 4FHTA 1TW3A 2QQ9A 4BHBA 3HRMA 4IHTA 3BWGA 1IZ1A 4AIJA 3HTUA 5AIPA 3J81Z 4AD9A 2KIMA 2DPUA 4G7ZF 4UVAA 2D1HA 5FLXK 1AWCA 4U88A 2VN2A 2ZNZA 4G9YA 2W57A 2HYGD 3CUQA 1I27A 5D4SA 1O3QA 5HDNA 2QUFA 2J5PA 1K6OA 4EVIA 3RKYA 2AS5F 1QQIA 3EYYA 3C18A 1MGTA 2VBXA 4NB5A 1IXSB 2K4BA 4JK1X 1USTA 3WE3A 1B59A 1MDMB 1FYKA 2UZKA 2O8XA 2PMHA 2O3FA 1U3EM 1RI7A 3ZP5A 3GFJA 3VEPA 4WXCA 2IJLA 2EK5A 3ABTA 2NNNA 4KIFA 1UB9A 2F5FA 2DU9A 3GUDA 1YS6A 2OU2A 2YU3A 4HBLA 2DLLA 4CYDA 5K5QA 3I58A 1K78A 3BPXA 3BJAA 5ILVA 2ZFWA 3ABUA 1G3WA 5DDGA 1KQ8A 2ZBKA 2VBWA 4A0XA 1HSJA 3WTXC 4ZYEA 3GVAA 2IT0A 5CVVA 3WG9A 3I54A 4UXNA 3M8EA 2XAFA 4Q5SF 2M1BA 4CGZA 2P5VA 2LSOA 3E97A 4CHUA 1BBYA 3EETA 1GXQA 4ZYDA 1K79A 2O61A 1FZPB 2XIGA 5ERIA 4MTEA 4P9UA 2ZO4A 1YQAA 3C7JA 2M30A 4WXHA 5AONA 1OMIA 2L02A 5DCMB 4KDPA 3RKWA 3RPQA 4EJWA 3E5UA 2H27A 2P6TA 1FBQA 1G3TA 4EM2A 3TOBA 3QPTA 4GO1A 5CYVA 4F7ZA 1HW5A 3COAC 1H9GA 1LNWA 4M71A 2ZMEB 3MCZA 2VE8A 1JXSA 3FF5A 2K86A 3RJPA 1I1SA 1UHWA 1OYIA 2HOEA 3F6OA 3ECOA 2NS0A 5D6FA 3M9AA 5LEJA 1GXPA 4P55A 4UVCA 4G8XA 1NHAA 3BOQA 3QOPA 1ON2A 3OV8A 3ZMTA 3G73A 3QAHA 1UFMA 4A6EA 3J80Z 4WCGA 4ENMA 1KQ9A 4WF2A 2P4WA 2X4HA 1CF7B 1S29A 1XDSA 3J7AO 3ML6A 2PEXA 5LEKA 1F1ZA 4I0AA 2L3DA 3S2WA 4Y15A 4M9SA 5E1ZB 1USSA 3M8FA 4ON0A 2HDCA 2OZUA 4B09A 5K5RA 4OMZA 1ZAOA 1HBXG 5D5XB 1CGPA 4CICA 5DUIA 2ACJA 5H20A 1S7OA 4OIOF 2G9WA 4HDVA 3WODF 2MA3A 1IN7A 5D5UB 4KUMA 4EGZA 1YTYA 3CLOA 1KA8A 4M6YA 3F21A 1R1UA 1YFHA 2L4MA 3I59A 2A6EF 1ZGAA 5D6EA 1T6SA 2AXLA 2VXZA 1PUEE 3HSRA 3C1DA 5H6QA 4GGGA 2FEZA 5LLQA 1WWXA 3JTHA 4GYGA 1XSDA 3K2ZA 3KEQA 1S8NA 4S05A 4HQEA 3CO6C 3EUHA 2L4AA 2OBPA 1EV7A 3CJNA 1IRFA 4HAMA 4ZZDA 4M74A 3BP8A 5E1WA 2A61A 3T8TA 1WQ2A 3FWEA 3SXYA 3HHHA 5E20A 3SHFA 2BYVE 2LDUA 1FOKA 3TQNA 2KJBA 3FMQA 1ON1A 2V9VA 1U5TC 4G6DA 3K1NA 5HS9A 4HW0A 2RGVA 3T1BA 1U6GA 3EDPA 3CDHA 3V8LA 1ZRDA 2WV0A 4UNOA 2BGCA 1H9TA 3WTYC 2W25A 1IN5A 2P7VB 3M7GA 2D1VA 5JFRA 3F8NA 3L09A 2YX7A 3HOTA 2VC0A 5TRDA 3KLOA 1YG2A 4A5NA 5IT9K 3DV8A 3FX3A 3K1MA 1JHFA 3RYRA 2X0LA 4LJZF 1FNNA 1Z1DA 1BC7C 2OZ6A 1BN5A 1W7PD 2XAJA 1R58A 4U7BA 4O6JA 1XB4A 4DNCA 3ROUA 2BE5F 5LBQA 3K0LA 4CDGA 2FNAA 4HV6A 1E17A 3KP5A 5JR3A 3H92A 2O6GE 1ZREA 4AWXB 1ZARA 1U78A 1KQ0A 4RS8A 5DCMA 4ESFA 1SAXA 4ZZLA 3MZHA 3VFZA 4AVPA 3CUQC 2DK8A 1FP1D 4DQ2A 3QP5A 2MLKA 2IVMA 4RB3C 3D5LA 5IT3A 5LGTA 3IWFA 4ESBA 1T2KA 1AOYA 1S3JA 2H94A 1ZGJA 1HKTA 3RYPA 1YW9A 1J7KA 5JI6A 2F2EA 3BZ6A 2Z3YA 3GF2A 1JE8A 2CGPA 5J6XA 5FO5A 4ASNA 3NRVA 4UV8A 2E7XA 4UUVA 4A0ZA 1EH7A 2LF7A 1J5YA 2J5OA 2A69F 2ZNYA 2HYFA 2M5WA 5BQTA 3CUQB 1K7AA 2L01A 1T39A 3REOA 3FHZA 5LGUA 2YR2A 2UXNA 3P9IA 1JHHA 1B6AA 2KIFA 1XSXA 4MHGA 4ZYGA 1J59A 4EV0A 3T0YA 2CQKA 3IL2A 2H6BA 3U2RA 4IXAA 1OPCA 1MDMA 3J81K 2HKXA 3HRTA 2JPBA 3B02A 2VOOA 4ETSA 3RKXA 4KIGA 1GHCA 2HQNA 1FSEA 2VE9A 5E17F 1ZG3A 3I4PA 1YW8A 2NYXA 1G3SA 3P9CA 5BMZA 3GZ6A 1ZYRF 1EH8A 3WTVC 2E7WA 2H09A 3VB2A 3HUGA 3F23A 3WU1B 2E1NA 3LAPA 1TNSA 1Y0UA 2EWNA 1IXRC 1O7LA 5L3EA 1XGNA 1R1VA 1L3LA 5E8IA 2BEOA 3TGNA 2MLGA 2QM3A 3P7NA 3T8RA 5BPDA 2V1DA 1XCVA 4LFUA 4NQWA 2F5EA 3E6BA 2V1XA 1T98A 4RAYA 3V7SA 4Q48A 2FBHA 3PFIA 4HX7A 4RB2C 1KGSA 1R36A 3JAMK 3R0AA 2CO5A 3NQOA 4HZFA 1LB2A 2DQLA 2OA4A 1J0RA 3FM3A 2ZXJA 3KP2A 4KMFA 2MD5A 2P5LC 1Z05A 2RQPA 2W85A 5HOOA 3ERED 3O3KA 1LEAA 4LMYA 1QBJA 2Y0MA 5DD8A 5K1YA 3WTSC 2FNPA 2EJRA 4KNYA 4A12A 4LB5A 6PAXA 1QNTA 3GYHX 2HTSA 1MD0A 3FM5A 1R22A 4U7DA 4D0PA 1W7PB 3MQ0A 3TO6A 1SD4A 5CVJA 1XN7A 1ONVA 1TNTA 2GAUA 3WE2A 1FP2A 4U0YA 1A04A 3GEZA 3H3UA 4M9ZA 4A5MA 1XMKA 4MGRA 2RDPA 1XSVA 4I98B 2FA5A 2FMYA 3QRFF 3GLXA 2EV5A 1F4KA 1KU3A 1SMYF 2V6CA 1YS7A 1BM9A 3L9FA 4QLCU 5L3CA 5CJ9A 3GFIA 2PBIA 3EQLF 2ISZA 4JBAA 1V3FA 4IVNA 3L2CA 2EFWA 3KCCA 4HDUA 4HOBA 1HW2A 5DUKA 5LRRA 1D8KA 1QO0D 3GWZA 2A5YB 3V7CA 1ZHFA 5DEQA 3B73A 3CUOA 2PMUA 1YIOA 1LDJA 1L0OC 1P6RA 2NNYA 2W84A 3G3ZA 2KIUA 3C3WA 2PJPA 1D8JA 2MBFA 3EYIA 2ZMEA 5KK1A 4ESJA 4EJVA 4WX9A 2OQRA 2VONA 1OYWA 1KU2A 1P92A 3IKVA 1BI1A 3DF8A 3WTZA 5ILUA 1MKMA 3K9TA 2IRFG 2ELHA 3QP6A 3GFLA 1G3YA 5EEGA 2NRAC 3WTTC 2STTA 3GO5A 3WTWC 4EGYA 1MZBA 1MJAA 5ICGA 2WTEA 2VODA 1U2WA 2QVOA 1TQPA 1IN6A 4L9TA 1ODDA 3FMRA 4KYWA 3BROA 3FZVA 2XKOA 4BXUA 3I53A 1PP7U 2JTVA 1B1BA 3IRRA 5H6RA 1LDDA 3IRQA 3MWMA 4HX4A 3V7RA 4L0ZB 3LAJA 2P6SA 2ZCWA 1B9NA 3TDZC 3KP7A 3E6CC 1ZRFA 1QPMA 3L7WA 3GZ5A 3OOPA 2O03A 3WGHA 3CO7C 2DK5A 2E1CA 2XRNA 4AIHA 4HYEA 4JQFA 3LA7A 1ZH5A 3E6MA 5D4RA 4OINF 3WGIA 1FWZA 2STWA 5HDGA 1IW7F 4H0EA 3DFGA 2XAHA 2PQ8A 1R7JA 4LB6B 1T0FA 4L9VA 3DP7A 4KA4A 5DD4A 4UVBA 3TO9A 2R7FA 3F3XA 2W24A 4YIFA 2Q2EA 1RUOA 2OQGA 4M73A 1BI3A 2ADUA 2V1UA 2DQRA 1OR7A 2EFQA 1BI0A 5L3FA 3R61A 3ZN1A 3ELKA 2A07F 3T5XA 4KN4X 3BDDA 2UWMA 4N9IA 5E18F 5FFZA 3V4GA 2XV4S 2ESNA 1FBUA 1SD6A 3ZQ7A 3BPVA 5HVQC 2FE3A 4EM1A 2YX4A 4WK8F 1S6LA 1FPQA 1Z6RA 1SD7A 2K4JA 2GXBA 1HXDA 2GXGA 4HQMA 3QU3A 4ZYHA 3V8JA 3PQJA 3KETA 3AAFA 4WXDA 2M87A 4HV5A 1IRGA 4XSXF 3ZMZA 1R5HA 3DPTA 1IUYA 5HDKA 1ULYA 1XD7A 4I0BA 4KIBA 1P4AA 3HTSB 1DPUA 1FLIA 1J2XA 3IWZA 3I59B 1XDUA 4FT8A 4HLXA 3R4KA 1VTNC 3E5XA 2PN6A 1XMAA 2DBBA 5J8FA 2Z9OA 2B0LA 3DQVC 1Z7UA 5A2QK 1HKQA 2FXAA 1FT9A 3TOAA 1XGSA 1G4DA 1SD5A 2H6CA 1O3TA 5HLHA 4XLNF 4BHCA 1Z91A 4RGRA 1LQ1A 2DPDA 1D3YA 1Z6TA 5ICCA 2HKOA 2BV6A 1CF7A 2QQAA 4L5IA 3WGGA 2D45A 5FD5A 5LHHA 4OIPF 2WC2A 4P96A 1I1GA 1Q1HA 4IF4A 1B4AA 2GQQA 1TQMA 2P8TA 3TDUC 4P5OA 3ZMSA 3LSTA 4EMSA 3O6BB 5L3GA 3BJ6A 5FGMA 2ETHA 3HRSA 2FRHA 3F8BA 1HQCA 5LRSA 4L9JA 2CFXA 4IHSA 1W5TA 2K7LA 5E1XA 4Z2YA 1DDNA 1P2FA 4YFKF 1TBXA 2Z5UA 2XROA 1BIBA 3ZN0A 4S04A 4IJAA 5FLXZ 3TO7A 4PDKA 4LK1F 5HLGA 5DYMA 5IT9Z 1R00A 4CXFA 2RNJA 1U5TA 3ZMUA 4OIRF 5D5WB 3P9KA 3MAJA 5CLSA 3WTUC 3KZYA 3JSOA 1FYMA 2WWYA 4MQ9F 3I64A 1O3RA 4RAZA 2LF8A 4A0YA 5F6FA 3H3ZA 4OOIA 3K1PA 3R60A 4BH9A 4ZH4F 2VT3A 2EB7A 1TLHB 5LHIA 1FBSA 1J9IA 2HTJA 3HHGA 4RGSA 1Z9CA 3E5QA 3RDIA 1WKMA 5F1RA 3RPUA 4G6QA 5HS7A 2CG4A 2F5DA 3HSEA 1YLFA 3I71A 1R5GA 2DO7A 3FXRA 1TTYA 1RUNA 1F5TA 4YIIA 5CVUA 3VODA 5FB2A 4MNUA 1O7FA 5D5VB 2LKPA 2RVCA 1H0MA 3F72A 2XVCA 4WWCA 4CO8A 4IPAA 3DXJF 3F8CA 3IHUA 3KZZA 2O0YA 3KEOA 4ENKA 1BI2A 1IXCA 5F64A 4E70A 1WSUA 2MC3A 3FXQA 3GX4X 3QU6A 2QYOA 5JHUA 4NHJA 3W6JB 2R7DA 2QQBA 4LLGF 4LG0B 3HSFA 1TW2A 3Q5FA 3E6DA 2XAQA 4KN7X 3IC7A 1UHMA 1PDNC 3FXUA 1WI9A 4BAYA 5KVRA 2HR3A 3MEXA 1LJ9A 4R8HA 2EA4A 2A68F 5D8LB 1LEBA 2L54A 3Q9VA 4BNCA 3F8MA 2IP2A 4U0VA 1ZLJA 2IW5A 5K5OA 2FBIA 3RIRA 2QBYB 2XAGA 3WU0A 1UCRA 1HSTA 5TJJA 3SZTA 2F5CA 2GWRA 4A2UA 1B9MA 3MZYA 3IKTA 2JT1A 1JGSA 3HOSA 1RNLA 3J80K 1BOAA 4YFNF 2K02A 1LVAA 3O2PE 3I0TA 3R6SA 2P5KA 5BPIA 4EJTA 3MFKA 4ENNA 5HS8A 2R3SA 2A3SA 4FX0A 1XGMA 2HZTA 5CVRA 4PGHA 4IRHA 4P9FA 1WRJA 4PGGA 2UXXA 2D2WA 1DUXC 2KJCA 4EM0B 4AIKA 4LK0F 4UHTA 2TDXA 1SFEA 3D0SA 2DW4A 2G7UA 4RGUA 2HGCA 3L00A 3TKYA 1FC3A 3HIFA 1GVJA 3BY6A 2YSRA 1DPRA 4EJUA 1ZG5A 3HRUA 2EFPA 2NAZA 4UV9A 2XKPA 2Y48A 2FQ3A 3Q9SA 1W7PA 1O57A 3W6KB 3SFZA 3N4MA 3NEUA 5EEHA 2ZJ2A 4RB1A 2HQRA 4PCQA 2IA1A 3ZMDA 3KP4A 2RC4A 3JW4A 4L9NA 5LHGA 3ECHA 2Z33A 4M9XA 2QENA 2V79A 4GCVA 1IAWA 4IRGA 1D5VA 4EQQA 2MH2A 1FYLA 2XUBA 3LWFA 3HYIA 2Z99A 2RN7A 1PP8F 4Q47A 4ENJA 2XHKA 4Q4ZF 2Q8KA 2FBKA 1SFUA 5FFXA 3ZMVA 2ZKZA 2JPCA 1RZ4A 1MJ9A 2GIVA 2KRFA 1F9NA 1K78B 2BBYA 4U0WA 1HW1A 4Y13A 1OYYA 2OD5A 1QGPA 3KFWX 3CTAA 4K2EA 4TV7A 4YG2F 2QBYA 4LD5A 2GZWA 4MTDA 3ULQB 4PZJA 3LA2A 3F8FA 3F22A 1W5SA 2DAOA 1E2XA 1ZG1A 3U1DA 3DEUA 5ED4A 1YYVA 3E3VA 4O5VA 2HS5A 5BOXA 4EJOA 2VBYA 2EV0A 4OIQF 3SZPA 2IA0A 3GXOA 4XLPF 2FMLA 4LG0A 5JVTA 2ISYA 4G7OF 5L3BA 3JTGA 1G6NA 2QZ8A 2PI0A 2FOKA 1U8RA 5DCFA 5DV5A 3SQNA 3R0JA 4LLNA 4Y17A 2EFNA 2FF4A 5BS6A 4L18B 4R79A 2QWWA 2COMA 1DP7P 2C6YA 3RTRA 2DFIA 2VBZA 1O3SA 1HKSA 2DI3A 1U5TB 2Q0OA 2DT5A 3ISPA 3N97A 1MJBA 2RV8A 1R23A 4G7HF 4IRIA 4RGXA 4LGWA 3U9GA 4XSZF 2FSWA 2LNBA 5LGNA 4I2OA 5CVIA 1OKRA 4L0YB 4R1HA 1LDKB 1ZRCA 1XGOA 5ICFA 3V8KA 4KFCA 4BHPA 1BC8C 3LFKA 1J75A 2G7HA 1I5ZA 4I01A 2CW0F 4XRFA 4I7HA 4HF0A 1TQIA 5ILSA 4MEXF 2KKOA 2VC1A 4LLLA 2M45A 2QLZA 2YPRA 3QPHA 2HEOA 2JSCA 1YW7A 2XASA 2PG4A 2DTRA 4BYYA 4GXOA 1STZA 5L3DA 1QZZA 2OAZA 4M72A 4QWQA 4XBFA 1I6XA 1SMTA 4HF1A 2M8EA 4GYIA 4HLYA 4HA8A 3I5UA 1P4WA 3KLNA 4CZZA 3RI4A 2JRTA 2HFHA 2JZYA 2Y75A 3GW2A 2EV6A 4M6XA 1YO5C 3BJOA 2CSOA 4N9HA 1FY7A 1IN4A 3LQQA 3M1EA 5FD6A 2EA2A 5HLIA 1XCBA 1X3UA 1IF1A 3LA3A 4I02A 2FU4A 1RIOH 3KE2A 3LQRA 2PFBA 2GA1A 2K27A 1BJAA 3VOEA 3ZPLA 3K69A 1BIAA 4HX8A 4I09A 4FX4A 2VT2A 1KU7A 1ZN2A 3DPLC 2CYYA 4G94A 1QZYA 2P7CB 3KP3A 1KYWA 4YFXF 2RKHA 2PLYA 1FX7A 3DKWA 1S7AA 3FMSA 3JSPA 3KP6A 1REPC 5ICEA 2GA2A 2XGXA 2ESHA 2IPQX
chains in the Genus database with same CATH superfamily
4FISA 4A3IJ 2E2IJ 1QA6A 1FSHA 3Q3SA 3OYMA 3JAMZ 4XL9A 4MQVA 4XQFA 2K9NA 1KYZA 1D0YA 1D1AA 2VOPA 3QQAA 1TP4A 4IO9F 5E8GA 5D8KB 1R1TA 2ZJRF 2HZDA 2DFFA 4KICA 5IP7J 5A2QZ 3GTKJ 4HG2A 1VQ5I 3OS1A 1PYVA 3C2BA 1W4MA 2RNGA 2HWVA 3GLLA 2LOOA 3A03A 3H5NA 4XLFA 2CWEA 5AIQA 1KU9A 2XPUA 3VYRB 2GOXB 4BE1A 1V4RA 1ZLKA 1C0WA 2DA6A 3PQKA 1KZHA 1IN8A 3GFMA 1P4XA 4L5JA 2ZSIB 4OU0A 4V2GA 1Y39A 4OMYA 4B8XA 2DYRH 2XAUA 4AVZA 2A6HF 1H88C 3OWTA 4DYCA 1JJ8C 2EZKA 4KT5C 3G4SI 3JR9A 1SFXA 4RLFA 3I9V2 4LIUA 2BW3B 3F6VA 2EFOA 2K3PA 2OJED 4HF2A 2IA2A 4O3MA 2AQEA 4FQGA 4A6DA 5J8CA 1UJ8A 1T38A 1MBKA 1BA5A 1Y8QB 1YOVB 1EH6A 1HA8A 2CMPA 2IBDA 4RB0A 4N0BA 1NK2P 4KMUX 4BQAA 4MEYF 1YRNA 1A35A 2MH9A 4FHTA 5IYCJ 5TISC 1R49A 1TW3A 2QQ9A 4BHBA 1AKHA 2CV1A 3HRMA 5LD2C 4IHTA 3BWGA 1IZ1A 3CMAI 4AIJA 3HTUA 1IDYA 5AIPA 3J81Z 4AD9A 2KIMA 2HYJA 1RESA 2DPUA 4G7ZF 2BHYA 2D1HA 4RM2A 4UVAA 5FLXK 1W36C 1AWCA 1T95A 4U88A 1TT5B 2VN2A 2ZNZA 4E7ZA 4G9YA 4A3EJ 2W57A 5E3OA 3HUGB 2HYGD 3CUQA 1I27A 1N25A 5D4SA 1O3QA 5HDNA 2QUFA 2J5PA 2R7UA 1MBEA 3X2QH 2DYSH 4M3BA 2E2JJ 3V42A 1K6OA 4EVIA 3RKYA 1ITYA 2OC6A 2AS5F 1QQIA 3EYYA 3C18A 3HKZA 5JLXA 1VQPI 2FD5A 2L9VA 4BGDA 1MGTA 3DWLE 2VBXA 2NVYJ 4NB5A 3W2VA 1IXSB 2K4BA 1G59A 4JK1X 1USTA 3WE3A 4XR6A 1CQTA 4B47A 1B59A 1U0JA 1MDMB 1FYKA 1GV2A 2UZKA 4NNJA 2KRHA 1RETA 2O8XA 3JCUC 2PMHA 2O3FA 4IQJA 1U3EM 1RI7A 2I5UA 2QQ8A 4XN3A 4DYQA 3JRFA 3ZP5A 3RQIA 3GFJA 3VEPA 3OYDA 2VL8A 2QSHX 4WXCA 2IJLA 4ZDOA 3M3YJ 5GAEJ 3LSRA 3QOEA 3I4MJ 2EK5A 3ABTA 2NNNA 1MH3A 1MW7A 4KIFA 3PFYA 2NVQJ 3NAUA 1UB9A 2LKXA 3GUDA 2DU9A 2F5FA 2FUG2 2DXIA 3HKZN 1YS6A 3JRAA 3L2UA 4II3A 4IQ4A 1P7JA 2OU2A 1JGGA 1IGNA 2YU3A 2UV1A 4HBLA 1RKWA 2DLLA 5EDNA 4CYDA 1TWGJ 5K5QA 3I58A 1K78A 3TL4X 2KLOA 3BPXA 2AO9A 4PK4A 3BJAA 1K4SA 5ILVA 2ZFWA 2AHQA 3ABUA 2KZGA 4J01A 1G3WA 2M4GA 5DDGA 1HCRA 1KQ8A 2ZBKA 4M3GA 2VBWA 4XK4A 2X1EA 3ASOH 1HF0A 4A0XA 1HSJA 2MD0A 3WTXC 2E5ZA 4ZYEA 3GVAA 2IT0A 2DA1A 5CVVA 3WG9A 4B44A 2HOAA 1FEXA 4PFPA 3I54A 4UXNA 3M8EA 3QYBA 2MGQA 2XAFA 2HXOA 2VASA 3W2AA 2L9RA 2V26A 3HGYA 3PIOF 2NVXJ 4RM3A 4Q5SF 2M1BA 1BL0A 4CGZA 2KRCA 2P5VA 2LSOA 2I8DA 2VIXA 1OCTC 3E97A 4QTRA 4JP0A 1WJAA 3B6CA 3ZQIA 4ZJZA 3ONQA 4CHUA 1IV6A 1BBYA 3EETA 1GXQA 4ZYDA 1K79A 3HOUJ 2O61A 3CMMA 1FZPB 2XIGA 2EIJH 5ERIA 1WH5A 4A3MJ 4IHVA 4MTEA 3WHBA 4P9UA 4A3JJ 1SFOJ 3C7JA 2ZO4A 1YQAA 2Q1ZB 2M30A 4WXHA 1X1DA 2VQCA 3H5AA 5AONA 2IEKA 4CSWA 3MN2A 2HQAA 4DZJA 1OMIA 2L2OA 2L02A 5DCMB 4KDPA 3RKWA 2ZXHA 4XOPA 3RPQA 3CP2A 1X2MA 4EJWA 3E5UA 1YX3A 2H27A 2P6TA 2ME6A 3DU5A 1FBQA 2DODA 1G3TA 4EM2A 3BG7A 3TOBA 1H8AC 5EEAA 3QPTA 4GO1A 5CYVA 1FOYA 4F7ZA 1HW5A 3G6EI 3COAC 3QPSA 2E71A 1H9GA 1LNWA 1OFCX 4LIVA 3GMEA 4M71A 2ZMEB 3S2DJ 1JT6A 3G2BA 3UR3C 2DMNA 3MMYB 3MCZA 2VE8A 1FIAA 1JXSA 1MBGA 4BEHA 2JA8J 3FF5A 2WAFA 1LFPA 1SVMA 3KX2A 5GPCA 3E1SA 3K4NA 2K86A 3RJPA 3H35A 3HOXJ 2JQ7A 4AC0A 1UMQA 1WPKA 4QIWN 1I1SA 2AQFA 1UHWA 1OYIA 3QWLA 2V1NA 1TWFJ 2DJIA 4NC7A 1XTAA 2HOEA 3F6OA 1SAUA 3BG9A 3ECOA 2NS0A 3PO3J 5D6FA 3M9AA 3CQZJ 5LEJA 1IV8A 1XMXA 1OCOH 1GXPA 4V19K 4NDLA 1Z77A 2Y31A 4P55A 1QHGA 2E5NA 4G8XA 1NHAA 4UVCA 3CCJI 2OF7A 3BOQA 3TMOA 3QOPA 1ON2A 3OV8A 3ZMTA 3G73A 4E6KG 2PMZA 2JSPA 1MH4A 2KL4A 2Q2EB 3QAHA 2VJ4A 4HNVA 1UFMA 1VQ6I 4A6EA 1W0UA 3J80Z 4WCGA 4ENMA 4E7LA 1ZKGA 2DOAA 4BQNA 1SEUA 5EJCA 5CPRB 4KT6A 1KQ9A 3NWTA 1FMVA 3QYEA 3OYHA 4CCOA 1ZK8A 4J19A 4WF2A 3BG3A 3VPRA 2P4WA 2X4HA 3OS2A 1CF7B 1S29A 1XDSA 3J7AO 4D5CA 3IH2A 3ML6A 5J1RA 5EGOB 1JUSA 2PEXA 5LEKA 3H9QA 1K61A 1F1ZA 4I0AA 2L3DA 2VI6A 3S2WA 4Y15A 4M9SA 2FOWA 3SZGA 4A3KJ 1B72B 5E1ZB 2W82A 4HEA2 3LSPA 1USSA 3DTKA 2ZXIA 3M8FA 4ON0A 2HDCA 2YS9A 3K6GA 2OZUA 2JJ7A 4B09A 5K5RA 4OMZA 5FROA 1ZAOA 1HBXG 5D5XB 2VKEA 4NQWB 1JTYA 3LOCA 1CGPA 4CICA 5DUIA 2KDZA 2CQQA 5H20A 2ACJA 1S7OA 3DBHB 4OIOF 3FK7A 2G9WA 3OY9A 2VJIA 4A3BJ 5FRNA 4HDVA 3WODF 2MA3A 1IN7A 5B1AH 4KUMA 5D5UB 1GV5A 3SEQA 4EGZA 1GUUA 1YTYA 3CLOA 1KA8A 4M6YA 2R7ZJ 2CH0A 2R7OA 3F21A 4X0GA 1VF9A 2R7WA 2HI3A 1R1UA 1YFHA 2L4MA 1YRNB 2K9MA 3I59A 2A6EF 2DMQA 1ZGAA 2MW8A 5D6EA 3HOYJ 2DDBA 1T6SA 5J47A 3K10A 2AXLA 4V2FA 2VXZA 1ZELA 1PUEE 2VPRA 2WV1A 2JUCA 2H8WA 3HSRA 5HNHA 3C1DA 5H6QA 4GGGA 2FEZA 5LLQA 1WWXA 3JTHA 1I3QJ 3CC7I 1R9TJ 1QVUA 4GYGA 1XSDA 2PJRA 5F08A 3K2ZA 3E7LA 3KEQA 1S8NA 4S05A 4HQEA 5C4JJ 3CO6C 2E2HJ 1WJEA 4UUSA 2O9LA 3EUHA 2L4AA 2OBPA 1EV7A 3CJNA 1IRFA 4HAMA 4ZZDA 4M74A 3BP8A 4LG3A 5E1WA 2A61A 3T8TA 1DGRM 1WQ2A 1V5GA 3FWEA 2L7ZA 3K4KA 3SXYA 1I3AA 3K7AJ 4OAYA 5B3SH 3HHHA 1K83J 1XX5A 5E20A 3ZR8X 2R7VA 3SHFA 2BYVE 2LDUA 1FOKA 3CESA 1OCZH 4A3CJ 1UELB 2GOMA 4AUXA 4B48A 3TQNA 2VJJA 2VKVA 2KJBA 3ZXSA 3FMQA 4ZC3A 1ON1A 2V9VA 3TP0A 1U5TC 2Z1DA 4YEJA 2ZMEC 4G6DA 3K1NA 1MNDA 5HS9A 2HVQA 4HW0A 2RGVA 3T1BA 4PJ0C 1U6GA 1X19A 4D7MA 4ZYAA 1HOMA 4BE0A 3EDPA 2OPTA 4XOTA 3FKIJ 4HNTA 3VSKA 1PUFB 3CDHA 1D5YA 3V8LA 1ZRDA 2WV0A 4UNOA 2BGCA 3FXOA 2DA7A 1H9TA 3WTYC 2W25A 3UNGC 2CS3A 3PUFA 1EJ9A 4BY1J 1PJRA 4IOCF 3NARA 1IN5A 2P7VB 4DIQA 3M7GA 2M2EA 4D7NA 2R7RA 2XF6A 1R6RA 1Y6IA 2D1VA 5JFRA 3F8NA 3L09A 2YX7A 3HOTA 2JA6J 2VC0A 1T56A 2ME0A 5TRDA 3KLOA 1YG2A 2OTLI 1WZ2A 4A5NA 2DMPA 3MKYB 5IT9K 2KISA 3DV8A 1WCMJ 3FKJA 2M0MA 3FX3A 3ZGKA 1VQLI 3K1MA 2IS4A 4UB8C 3ZQLA 3DBLB 1JHFA 3FXKA 3RYRA 2X0LA 2B63J 1RRJA 4LJZF 3AL0C 5M5WJ 1FNNA 1Z1DA 4BKXA 1T08B 1BC7C 2OZ6A 1X1CA 1BN5A 2LD5A 2VQLA 3L1PA 4NBQA 1W7PD 3U21A 2XAJA 1R58A 4U7BA 4O6JA 2ZSHB 5KAFC 1XB4A 3OIOA 4MLOA 4DNCA 2ZFUA 2M7AA 3ROUA 1T0FC 2BE5F 4IHWA 4C9YA 2E19A 2ECBA 5LBQA 2VKDA 3K0LA 4CDGA 2FNAA 1IG7A 1IJWC 2DMUA 4HV6A 1E17A 4BL0B 3KP5A 5JR3A 1DGWY 3H92A 2O6GE 2DOEA 1ZREA 4AWXB 1P9QC 1ZARA 1I50J 1U78A 4A3FJ 5C44J 3ZQHA 4Y4RA 3KIOA 1KQ0A 5LFAA 4RS8A 2KZVA 2HU9A 5DCMA 4ESFA 2DA2A 1AHDP 1JKRC 1VQNI 3GTQJ 1HC8A 1SAXA 2V6EA 1OISA 3OR1C 3BTCA 3DTEA 4ZZLA 3MZHA 2LVSA 3VFZA 4AVPA 4XIDA 3CUQC 1IUFA 2DK8A 1FP1D 2LK2A 2LFBA 3CJTB 4DQ2A 3QP5A 4CCJA 3BCAA 4I76A 4JX4A 2WAQN 2MLKA 3OYJA 3H0DA 2IVMA 1OJLA 3M8JA 4OAZA 4RB3C 1ZR2A 3D5LA 5IT3A 3LSGA 1VQ9I 4AIDA 4DW6A 3BTLA 2LKSA 5LGTA 1VNDA 3IWFA 4ESBA 2AXTC 3VDXA 4IZZA 1T2KA 5HLTA 1AOYA 1S3JA 2H94A 1ZGJA 2GLOA 1HKTA 3RYPA 1YW9A 1Z3YA 1EF4A 2ELKA 4A69C 2JN6A 3S93A 3OYAA 1J7KA 1X58A 3VSLA 5JI6A 1V54H 4W97A 3H1CA 2F2EA 3BZ6A 2Z3YA 1FOWA 3GF2A 2X6XA 1JUMA 3FDYA 1JE8A 2CGPA 2WAQA 2X6YA 5J6XA 4IKFA 5FO5A 4ASNA 3NRVA 2Z2SB 4UV8A 2OTJI 2E7XA 3JRHA 3D1NI 4UUVA 4PJMA 4A0ZA 1IDZA 1EH7A 2LF7A 4BJ6C 1Y8RB 5IP6A 1FIPA 1J5YA 2J5OA 2A69F 2ZNYA 1HDDC 2HYFA 2M5WA 5BQTA 2E1OA 4I6ZA 3CUQB 3L2WA 1K7AA 2L01A 3HC7A 1T39A 1D0ZA 3REOA 3FHZA 2IXSA 4KISA 4BUPA 2WBMA 5LGUA 2YR2A 3OYEA 1B72A 2UXNA 3P9IA 1JHHA 3ZOBA 5M5XJ 3ERMA 1S5LC 1B6AA 2KIFA 1XSXA 2KQRA 4C2MJ 2CQXA 4MHGA 3M4OJ 4ZYGA 1XG1A 1J59A 4EV0A 2L7KA 3N05A 3T0YA 1RKTA 2CQKA 4HRIA 4ZDPA 3IL2A 2H6BA 3U2RA 2M0CA 4IXAA 3LSMA 2NS7A 3DEEA 1OPCA 1MDMA 3PNVA 3J81K 2HKXA 3HRTA 1WJCA 2IS2A 2JPBA 3B02A 2KP6A 2VOOA 4ETSA 3RKXA 3VYSB 4KIGA 4B3AA 3PSIA 1GHCA 2HQNA 1FSEA 3BR3A 3OYLA 1ETOA 2ID3A 2LRDA 2VE9A 5M3FJ 5E17F 1T8IA 3HEFA 1ZG3A 5JHFA 2JUGA 2W00A 3I4PA 3MVPA 1YW8A 2NYXA 3IAS2 1G3SA 1NG6A 3OYFA 3P9CA 3K4BA 5BMZA 3GZ6A 1ZYRF 1EH8A 3WTVC 2E7WA 4ANJA 2H09A 3BR5A 3VB2A 3AFHA 3HUGA 3SFIA 3F23A 3PNTA 2Y2ZA 1QHHD 2E1NA 3WU1B 3LAPA 1TNSA 1Y0UA 4L5EA 2EWNA 1IXRC 1O7LA 5L3EA 4CCMA 3A0BC 1XGNA 4RAGA 2XSJC 1R1VA 1L3LA 3BR2A 3MD2A 5E8IA 2BEOA 3TGNA 1E0EA 2MLGA 1G8XA 2QM3A 4D9JA 2LMDA 3P7NA 1AKHB 3T8RA 3CCVI 5BPDA 2V1DA 4MIMA 3FXMA 2BVLA 1XCVA 1MMGA 1BW5A 4LFUA 4E7KA 4NQWA 2F5EA 3DLLF 2WADA 3I55I 3E6BA 2V1XA 2EINH 1MSEC 1T98A 3TW6A 4BU2A 4RAYA 3V7SA 3S8PA 3TEDA 4Q48A 4H4KC 3GTJJ 2FBHA 3PFIA 4HX7A 4RB2C 1KGSA 1R36A 2ZXWH 3JAMK 3I4NJ 1ZTRA 2MABA 3R0AA 2CO5A 1BOBA 3NQOA 4HZFA 1LB2A 2DQLA 1VQOI 5E3MA 2F5VA 2OA4A 1J0RA 2O8KA 3FM3A 3B6AA 3FIWA 2ZXJA 3KP2A 5CQGA 3WHCA 5FLVA 3ZQGA 1U8BA 4Y7NJ 4KMFA 2MD5A 4XKVA 2P5LC 1Z05A 2RQPA 4S0HB 2W85A 1M1EB 1DQUA 5HOOA 3ERED 3BCBA 2LP0A 3W3CA 4XNFA 3O3KA 3S3NA 1LEAA 4LMYA 1QBJA 2Y0MA 1YJNI 4A93J 5DD8A 5K1YA 1ZQ3P 1W5CC 3WTSC 2FNPA 2EJRA 2XGCA 4KNYA 4A12A 2CQNA 4LB5A 2E36A 6PAXA 4BJ5C 3BR6A 1QNTA 2VPLA 2K9QA 1TWHJ 3LMMA 3L2QA 2HTSA 3GYHX 2PX9A 4RBOA 2QF7A 1MD0A 1U9NA 2BXZA 2Y9ZA 3FM5A 3CCUI 1R22A 4U7DA 4D0PA 1W7PB 5GAHJ 2IS6A 4BXFA 3MQ0A 3TO6A 4CYCB 2X48A 1SD4A 5CVJA 5IYBJ 3OS0A 1XN7A 1ONVA 1TNTA 2KMUA 3WG7H 2GAUA 4UUSB 3WE2A 1AA7A 1FP2A 4U0YA 1A04A 3GEZA 3H3UA 3AG2H 3EUKL 4M9ZA 3IV5A 4ZDLA 4UUTA 4A5MA 1XMKA 1MBFA 4MGRA 1LKXA 3H0GJ 2RDPA 1XSVA 4I98B 3HXLA 3A4CA 2FA5A 2FMYA 4RA2A 2M3AA 3QRFF 3GLXA 2EV5A 5M3MJ 2B9SA 1F4KA 1VQ4I 1KU3A 1P7IA 3DKXA 1SMYF 3JRDA 2V6CA 3KYDB 5J3LA 1YS7A 1BM9A 3L9FA 4QLCU 5L3CA 3K2AA 3OL3A 5CJ9A 3GFIA 2PBIA 3DU6A 4DYRA 2R4GA 3EQLF 4JBAA 1YIJI 2ISZA 1V3FA 4IVNA 3L2CA 2GXAA 3BTJA 2QSGX 2EFWA 3CJRB 3KCCA 4HDUA 4DBRA 3CF5F 4HOBA 1HW2A 1UG2A 5DUKA 5LRRA 1TZLA 1D8KA 1QO0D 1Y1VJ 2A5WA 4F55A 4E7HA 3GWZA 2A5YB 3V7CA 1ZHFA 3ESWB 2PMZN 4G6TB 5DEQA 3B73A 3CUOA 2V9KA 2PMUA 1YIOA 3K4MA 2GIZA 2W48A 3JRGA 3CCQI 1NK3P 1LDJA 1L0OC 2HXIA 2QKLB 1P6RA 4XICA 1R5ID 5B5EC 2NNYA 2W84A 3OL4A 3G3ZA 4B43A 2KIUA 3RSNA 1LPQA 3C3WA 5DM7F 2PJPA 1D8JA 2OV7A 2VB6A 2MBFA 4ABZA 3EYIA 4XRSG 1XS9A 1YJWI 2ZMEA 1JT0A 5F04A 1YJ9I 1VQ7I 4XKWA 3ABMH 5KK1A 4ESJA 1YE9A 1R4MB 3S32A 4EJVA 4RMNA 4WX9A 2OQRA 5B66C 4HSRA 2DOFA 1UZCA 3M07A 2VONA 3GTMJ 4BDYA 1OYWA 4P1WA 1KU2A 2NS8A 1P92A 3IKVA 1BI1A 3DF8A 3WTZA 5ILUA 1MKMA 3K9TA 2ELHA 3QP6A 2IRFG 1ETVA 3GFLA 4NC8A 1G3YA 3CCYA 4Z6YA 5EEGA 4M3EA 2Y9YA 3IUOA 2LBFA 2A6TA 2NRAC 1NH3A 2YU9J 3WTTC 1MMAA 2STTA 3GO5A 3SDGA 3WTWC 4EGYA 1MZBA 4E7JA 2IGOA 3DKYA 4A3GJ 1MJAA 5ICGA 2WTEA 2DT7B 3ZRGA 4EATA 1U2WA 2VODA 2QVOA 3OYGA 3KYLA 1TQPA 1VQKI 3OOUA 1WJBA 1IN6A 2V4JC 4L9TA 1ODDA 3FMRA 5KNLA 4KYWA 3RPUD 4CCLA 4DOZA 3BROA 3FZVA 2XKOA 1F36A 4BXUA 3I53A 2R7QA 1PP7U 2JTVA 3RZDJ 1X4OA 2E1MC 3NWSA 4NC6A 1B1BA 3IRRA 5GAGJ 5H6RA 1LDDA 1SC7A 3IRQA 1U9OA 4U87A 3MWMA 1FTTA 4HX4A 3V7RA 5CQEA 4L0ZB 5M5YJ 3ZCOA 3LAJA 2P6SA 2ZCWA 1B9NA 3TDZC 3KP7A 3E6CC 4ITVA 1ZRFA 4HNUA 2K9SA 3K70C 1QPMA 2X6OA 3L7WA 1X1BA 1SVLA 1WJDA 3HZJA 3GZ5A 3OOPA 2O03A 2P81A 3WGHA 3RQ4A 2E34A 4II2A 3CO7C 2DK5A 4FETA 2E60A 2R0QC 2E1CA 2XRNA 4AIHA 4HYEA 4JQFA 2R7SA 3LA7A 1ZH5A 3A1YA 3E6MA 5GADJ 3H9GA 5GTIC 5D4RA 5FKNA 4OINF 3WGIA 1FWZA 5DM6F 2STWA 1A6QA 2DFEA 5HDGA 3WU2C 1IW7F 4H0EA 3DFGA 2XAHA 2PQ8A 3HPHA 3OR2C 4N4OB 3KEYA 4IOAF 1R7JA 4LB6B 1T0FA 1A36A 3PUBA 4MFDA 5DTDA 2BOLA 4L9VA 3DP7A 5GTHC 4KA4A 5DD4A 4UVBA 3TO9A 2R7FA 2CV2A 4X6AJ 3F3XA 2W24A 2IS1A 5FJ8J 5K7FA 2LLKA 4YIFA 3HOZJ 2Q2EA 1QZEA 1MBJA 2IGMA 1RUOA 3G71I 2F6CA 2OQGA 4M73A 5E3LA 5JLWA 5FKOA 3CF2A 1BI3A 2ADUA 2V1UA 2DQRA 5H2FC 1OR7A 3J7YJ 3GCMA 1BI0A 2EFQA 5L3FA 1W1WE 4I99C 5EG0B 4DZPA 3DTIA 1N77A 2M8GX 3R61A 3ZN1A 4CA0A 3ELKA 2A07F 3RCOA 3T5XA 4FTHA 3H36A 4KN4X 3BDDA 2UWMA 3CZ6A 1MNEA 1N75A 4BDZA 4N9IA 5E18F 1J09A 5FFZA 3V4GA 3BG5A 2W7NA 1UG0A 3VYTB 2JRMA 2XV4S 2ESNA 2TCTA 2BY3A 3BT9A 1FBUA 4XLHA 3G1MA 1ZR4A 1SD6A 3ZQ7A 2JVHA 3BPVA 2HQ5A 5HVQC 2FE3A 4EM1A 2YX4A 5F0FA 1V5EA 4WK8F 1S6LA 1E3HA 1FPQA 1Z6RA 1SD7A 2CUZA 2K40A 3I3LA 5J40A 2K4JA 3S15J 2GXBA 1HXDA 2GXGA 4HQMA 1Z67A 3QU3A 1GVDA 4ZYHA 2BXYA 2DFHA 3V8JA 3PQJA 3FXJA 3KETA 1NTCA 3AAFA 2CUFA 3TW7A 1DU6A 1MSFC 4WXDA 2PJRB 3W2WA 1X3WB 2EZLA 4XKCA 2M87A 4HV5A 2CUEA 1IRGA 3HBLA 4AM3A 4KJZA 4XSXF 3ZMZA 3BQZA 1R5HA 3DPTA 3H9JA 2HNHA 3FBIB 1IUYA 5HDKA 1ULYA 1XD7A 2F48A 4I0BA 5BNGA 4KIBA 1P4AA 3LSHA 2JWTA 3HTSB 1DPUA 1FLIA 1GLNA 4D1QA 1J2XA 3IWZA 2EQRA 3S16J 1JKPC 2NVTJ 3QYFA 4LOCA 1B8IA 1I39A 3I59B 3AG3H 3CMYA 5EF6A 4D5FA 1XDUA 1IO2A 4FT8A 3CMEI 4HLXA 3R4KA 3G1LA 2M34A 1VTNC 3MKWB 3CCSI 2XDVA 1JKOC 3FBNB 3E5XA 2PN6A 1XMAA 2V9PA 2DBBA 5J8FA 1R71A 2Z9OA 2VUMJ 1X2NA 4E7SA 1GDTA 4DBQA 2TRTA 1ENHA 2B0LA 1FMWA 2BZTA 3OMYA 3DQVC 2MC4A 1Z7UA 5A2QK 1HKQA 2FXAA 1FT9A 4NUBA 3SYTA 2ZC2A 3TOAA 1XGSA 1G4DA 1SD5A 3OYNA 2KHMA 2H6CA 1O3TA 5HLHA 4XLNF 4BHCA 1Z91A 4RGRA 3C2HA 1Z0XA 5CKTA 1QPIA 2JA2A 1LQ1A 2XF7A 2H8RA 1IC8A 2DPDA 1D3YA 5JVGF 1Z6TA 4M3DA 5ICCA 3K4LA 1ETWA 3HGGA 2BY0A 3GTLJ 3MKZA 2HKOA 2K3FA 2BV6A 4XM3A 1CF7A 3OYCA 2QQAA 1NG7A 4L5IA 2DN0A 3WGGA 2D45A 5FD5A 2DDAA 4RLQA 3SJMA 4F52A 5F1JA 5LHHA 4OIPF 2WC2A 2JA5J 4P96A 1I1GA 1Q1HA 3BR1A 4IF4A 2NVUB 1B4AA 5FLMJ 2GQQA 3CC2I 1TQMA 2MG4A 2OCEA 2P8TA 3TDUC 4P5OA 2IAIA 3ZMSA 3LSTA 4EMSA 3FXLA 3CD6I 1MMNA 3JRBA 1VQMI 3O6BB 2ELJA 3Q0VA 5L3GA 3K4JA 3BJ6A 5FGMA 3S1MJ 2ETHA 2R92J 3KYCB 3HRSA 2FRHA 3F8BA 1HQCA 5LRSA 2X9DA 2XGEA 1ETYA 4L9JA 2CFXA 4XKBA 2FQ4A 2BW3A 1W5TA 5KHDA 5E3NA 1WVRA 2K7LA 4IHSA 5E1XA 4Z2YA 1DDNA 1P2FA 2WA0A 3I56I 4YFKF 1QU3A 1TBXA 2ICWG 2Z5UA 4QPQA 2XROA 1W0TA 1BIBA 4PSXA 3UKGA 1A5JA 3ZN0A 2WY7Q 2HDDA 4S04A 4IJAA 5FLXZ 3TO7A 1K4TA 1BJZA 4PDKA 2F4IA 2WB1N 4LK1F 3TP3A 2Z16A 4W1UA 5HLGA 5DYMA 2E1MB 5IT9Z 2VXDA 1R00A 2W1OA 4CXFA 4A3DJ 2EH3A 2RNJA 2LYCA 1U5TA 3DEWA 2XSDC 3ZMUA 3LSKA 1TL8A 4OIRF 5D5WB 3P9KA 3HB9A 3MAJA 5CLSA 3WTUC 2R7XA 3KZYA 3JSOA 4IHYA 4BBSJ 2JMWA 1FYMA 2WWYA 4MQ9F 4B3XA 3I64A 1JTXA 1O3RA 4RAZA 2LF8A 4A0YA 5F6FA 2H1KA 3H3ZA 4Y3OA 3OYBA 2DA5A 4OOIA 4QPOA 3AL0B 4C3JJ 3K1PA 3S3MA 4Y52J 1OR7C 3HOVJ 2EZHA 2L7MP 3R60A 5KAIC 2QCOA 2B7EA 3ASNH 2NOJB 1JKQC 4BH9A 5C4XJ 4ZH4F 2VT3A 2EB7A 1TLHB 3DLAA 5LHIA 2R7TA 4IEJA 1FBSA 4N4NB 3QODA 4YELA 1RR7A 4YRVA 2HVSA 4HPQA 2HTJA 1J9IA 3HHGA 2RQQA 4RGSA 1Z9CA 1TC3C 1OCPA 3E5QA 3RDIA 1WKMA 5F1RA 3RPUA 4G6QA 2R93J 3A0HC 3BLYA 5HS7A 2CG4A 3A01B 4E7IA 2KT0A 2F5DA 3HSEA 4ZTJA 1YLFA 4M3FA 3I71A 1R5GA 9ANTA 2DO7A 1OQYA 3BG6A 3FXRA 4KITB 3S3OA 1TTYA 4XRSA 1RUNA 1RC9A 1F5TA 4C2UA 3G1OA 4YIIA 5CVUA 3GTGJ 5J1YA 3VODA 1GT0C 2Y0SN 1WJFA 5E79C 4MNUA 1O7FA 5FB2A 5D5VB 4HSTA 2LH9A 2LKPA 1DP3A 2RVCA 1H0MA 3F72A 2XVCA 1TT0A 2L0KA 4WWCA 4CO8A 4IPAA 1POGA 3DXJF 5DS9A 3F8CA 1D1CA 1WHUA 3IHUA 3KZZA 2O0YA 4F91B 3KEOA 3ZQFA 3PL8A 4M6VA 1RR8C 4ENKA 1LE8B 1ERDA 2MFZA 1BI2A 1IXCA 5F64A 4E70A 2K85A 2DA4A 1WSUA 2M4KA 2MC3A 5F27A 4BEHB 5J4YA 1D0XA 3FXQA 3GX4X 3QU6A 2E35A 2JA7J 3S14J 2OCCH 2QYOA 5JHUA 1MNMC 4NHJA 3W6JB 2R7DA 2D5VA 2QQBA 4BBRJ 4LLGF 4LG0B 3HSFA 1TW2A 3D5RC 2LTPA 3Q5FA 3E6DA 3KZIC 2XAQA 4KN7X 2VQGA 2LY1A 3IC7A 1WJ5A 1UHMA 1PDNC 5GP9A 3FXUA 1WI9A 4BAYA 5KVRA 2HR3A 2JVGA 1S7EA 1LVKA 1JJ6C 4PJNA 3OIQA 2OUMA 3D5SC 3MEXA 1LJ9A 4R8HA 2EA4A 1N78A 2A68F 3PNYA 5D8LB 1LEBA 2L54A 4MFEA 4UY8I 2KIQA 2LR8A 2QSFX 3PJRA 3IH3A 5F0HA 5FKMA 5C3EJ 3Q9VA 4BNCA 3F8MA 2IP2A 4AYBN 4JX5A 3CLQA 4OWRB 4U0VA 1ZLJA 4AU7A 2IW5A 5K5OA 2LY2A 2FBIA 1Z7LA 5TGTA 3PSFA 2RREA 3RIRA 4FE4A 2EIMH 1VI0A 4XRMA 1ZGWA 2KDOA 2QBYB 4DJAA 1SVOA 2XAGA 3WU0A 1UCRA 1HSTA 5TJJA 2VLAA 3SZTA 4X1EA 2CFOA 2F5CA 2GWRA 2LC2A 4A2UA 3LFUA 5EGOA 2QEXI 1B9MA 3MZYA 2HPIA 3DBRB 2L7FP 1BR1A 3O8HA 3IKTA 1VFCA 2JT1A 1UHSA 1JGSA 3HOSA 2IGNA 3H3VK 4IHXA 1RNLA 2CRGA 3J80K 1H89C 2HOSA 2HOTA 1BOAA 1JI8A 4YFNF 2K02A 3VYUB 1LVAA 3O2PE 3I0TA 5J1UA 3R6SA 2P5KA 5BPIA 1Z21A 4EJTA 3MFKA 4ENNA 5HS8A 3FK6A 2R5YB 3CCMI 2R3SA 2A3SA 3PO2J 4FX0A 3EPZA 1R4NB 1XGMA 2H1LA 1S9HA 2HZTA 5CVRA 2Y30A 4PGHA 4IRHA 3O8GA 4P9FA 5GPAA 5FRMA 3ABKH 1WRJA 4PGGA 2UXXA 1ACIA 2D2WA 1UAAA 1DUXC 2KJCA 2KFDA 1X1AA 3Q0WA 3BZKA 4EM0B 4AIKA 4LK0F 3DPUA 4UHTA 4JOMA 3DCFA 1BR2A 3HG9A 2TDXA 1SFEA 4J00A 3D0SA 2DW4A 2G7UA 1APLC 1E3PA 4RGUA 2HGCA 3L00A 4B4CA 3CDLA 1FTZA 4XONA 5IY5H 3TKYA 1FC3A 3HIFA 2EZIA 1ETQA 1GVJA 3BY6A 2R5YA 2YSRA 5KCMA 1DPRA 4EJUA 4BY7J 4GRIA 1F43A 3CCLI 3HPGA 2ZJPF 2M9HA 1ZG5A 4CZCA 3HL2A 4ZTFA 3HRUA 5EYRA 4CCNA 3PIPF 3OSFA 2NXNB 2EFPA 4PSWA 5K7ZA 2NAZA 2M7BA 2XKPA 4UV9A 2Y48A 3EUHC 1LUJB 3GBGA 4JYKA 2FQ3A 2Y69H 4C3IJ 4CYCA 2DMTA 3CCRI 3Q9SA 3JRCA 1O57A 1W7PA 3W6KB 3SFZA 3N4MA 2CUJA 3NEUA 1VZ0A 3OIPA 3A2KA 5EEHA 2ZJ2A 3J7AY 3HDDA 4RB1A 3RKQA 2HQRA 4FASD 4PCQA 4QSHA 1MMSA 3HM5A 2IA1A 3ZMDA 4BJTA 3S1RJ 1WI3A 2XGDA 3KP4A 3JREA 2RC4A 2P0WA 3JW4A 2MYSA 4L9NA 5LHGA 3ECHA 2Z33A 4GDFA 4M9XA 1WFXA 3S2HJ 2XC7A 5IOZA 2EIKH 2QENA 2V79A 2IGKA 4GCVA 1IAWA 5EG0A 4IRGA 2DT6A 2GBYA 4F3QA 1I6HJ 1D5VA 2CW7A 1IRXA 4EQQA 2X6WA 2MH2A 1FYLA 4BE2A 3IP4B 1Y1WJ 1VQ8I 2XUBA 3LWFA 1YITI 4A3LJ 1IRZA 2GM4A 3HYIA 2CV0A 2Z99A 2ECCA 4PJJA 2R5ZA 1OCCH 1OCRH 2RN7A 1PP8F 3OSGA 2F4MB 4Q47A 3FISA 4YIRX 4ENJA 2XHKA 4Q4ZF 2Q8KA 2FBKA 1PUFA 3A02A 1SFUA 1DU0A 4C30A 2XPWA 5FFXA 2FJ1A 3ZMVA 3ZQCA 2ZKZA 1G2HA 2JPCA 1RZ4A 1K6YA 1MJ9A 1MBHA 2GIVA 3LNQA 3AG4H 3OYKA 2KRFA 1F9NA 1E3OC 1K78B 1TWCJ 2BBYA 4U0WA 1HW1A 3W6VA 4Y13A 1OYYA 1T33A 2A05A 2OD5A 1QGPA 3KFWX 1Y0NA 3KPHA 3CTAA 3GTOJ 4K2EA 2Y0SA 3TBIA 2LY9A 4TV7A 1B8IB 2CU7A 4YG2F 2QBYA 1RPWA 4LD5A 2N8GA 2CW8A 3VWBA 1TWAJ 2GZWA 4MTDA 3CCEI 2XB5A 4PZJA 3ULQB 3CJQB 5IYDJ 3LA2A 3GZNB 3F8FA 4IL6C 2FX0A 5IOYA 3F22A 4LITA 1W5SA 2VKHA 5FKKA 2DAOA 2JK3A 1E2XA 1ZG1A 2HPMA 3U1DA 3DEUA 3CDIA 1YI2I 3RZOJ 4XLEA 5ED4A 1YYVA 2XB0X 3E3VA 4O5VA 3AKZA 1XPXA 1WGXA 2HS5A 5BOXA 4EJOA 2VBYA 4PJLA 1BR4A 2EV0A 4F93B 4PUSA 4OIQF 3SZPA 2IA0A 3OYIA 3GXOA 1AU7A 4XLPF 3H5RA 3BR0A 2X51A 2FMLA 4LG0A 4EEFG 5JVTA 2VQHA 1JUPA 2ISYA 1BW6A 4BQOA 3JRIA 4G7OF 4XLCA 1KONA 5L3BA 3JTGA 1LFUP 1G6NA 4BQQA 5IP9J 1QVTA 2QZ8A 2PI0A 2LBFB 5J4VA 3L2VA 1EKEA 2X1CA 1S72I 3J7ZI 2QKMB 3ZQQA 2FOKA 3HJEA 1U8RA 1A31A 5DCFA 2X85A 4C3HJ 3EUAA 5FKLA 2ZB9A 5DV5A 3SQNA 3F9KA 4E4HA 3R0JA 1Y56A 4LLNA 4Y17A 1FJLA 2BY2A 2EFNA 2FF4A 5BS6A 4L18B 4RAFA 4R79A 3AG1H 2QWWA 2COMA 2L9SA 1DP7P 2WB1A 4DGWB 2C6YA 2BVMA 2W4SA 3RTRA 2QA4I 2DTZA 2DFIA 2VBZA 1O3SA 1HKSA 2DI3A 1U5TB 2Q0OA 2K9LA 5EZHA 3Q0UA 2HVRA 1A6IA 2EPFA 4CCKA 1V5FA 1HDPA 2CQ7A 2DT5A 3ISPA 1ETKA 3N97A 1Q1VA 1MJBA 2RV8A 1R23A 4G7HF 2COBA 4IRIA 3IAM2 4RGXA 3A01A 2KPMA 2UUZA 4B1RA 4LGWA 3LSIA 3U9GA 3C2GA 5F0CA 4XSZF 3E0JB 2DJNA 4CUGA 2FSWA 1YX5A 2LNBA 3BTIA 5LGNA 3L2RA 1X4PA 4I2OA 5CVIA 1OKRA 3ABLH 1W36D 4L0YB 2G0EA 4R1HA 1D1BA 3LSJA 4XORA 2CJJA 1LDKB 4Y33A 4C2TA 1ZRCA 1XGOA 5ICFA 3LL7A 3V8KA 4UB6C 4KFCA 3BC8A 2X1DA 2VJ5A 3S1NJ 1Z3XA 5EZGA 4BHPA 1BC8C 3LFKA 1J75A 2BY1A 2G7HA 1PVEA 3S17J 1I5ZA 4I01A 1HLVA 1FOXA 2CW0F 4IX7A 2O7OA 4XRFA 4I7HA 4HF0A 4BXXJ 1TQIA 5HNFA 3QPLA 3IH4A 5ILSA 4MEXF 2KKOA 2VC1A 2WAEA 4LLLA 2M45A 2QLZA 2YPRA 5IPAA 1SFKA 3QPHA 2HEOA 5HODA 3HOWJ 2JSCA 1YW7A 3SEZA 2XASA 2PG4A 1XC5A 2L5QA 2DTRA 4BYYA 4GXOA 1STZA 1LFBA 2EBIA 5L3DA 2DCEA 4FE7A 2ZJQF 3U1KA 1QZZA 2OAZA 4F92B 4M72A 1ETXA 1V55H 4QWQA 3M1CA 4XBFA 1I6XA 1SMTA 2EILH 1MIJA 3GTPJ 4HF1A 2M8EA 4GYIA 2DA3A 4HLYA 2LREA 4HA8A 3I5UA 1P4WA 3KLNA 4CZZA 3RI4A 2RAEA 2JRTA 2HFHA 3FHNA 1X1PA 2JZYA 2Y75A 4XLAA 3MZ8A 1O4XA 2R5ZB 3GW2A 2EV6A 1X3ZB 2XRLA 3BQYA 3BJOA 3K4CA 4M6XA 2CSOA 4MO7A 1YO5C 4XN0A 2HDWA 1MMDA 4N9HA 1FY7A 3PM1A 1IN4A 3LQQA 1SANA 3M1EA 5FD6A 2EA2A 2O5RA 5HLIA 3P5JA 1XCBA 1X3UA 3F0CA 3CP8A 3LA3A 2V7FA 2WY8Q 1IF1A 4G12A 2F4OB 4I02A 1QRYA 4RDUA 2FU4A 3MKLA 1RIOH 3KE2A 3LQRA 2PFBA 2LG4A 1ORKA 3S1QJ 2GA1A 4FCYA 4XMYA 2K27A 1BJAA 2NOGA 3VOEA 3ZPLA 4JX6A 2QGUA 3K69A 1BIAA 4HX8A 4I09A 4FX4A 1OLTA 1EA3A 2VT2A 1KU7A 1WH7A 1ZN2A 2CYYA 2K5CA 3DPLC 4G94A 1QZYA 2P7CB 2I10A 3KP3A 1KYWA 4YFXF 2L9NA 2RKHA 4AYBA 5K7HA 1LE8A 2PLYA 1FX7A 3DKWA 1YHQI 3FMSA 1S7AA 2XPVA 2YUSA 3JSPA 3KP6A 2MSYA 3BZCA 4PFOA 3SDBA 2XF5A 3K70D 2BHZA 4CH7A 1REPC 5ICEA 2GA2A 4BACA 2XGXA 2ESHA 3CC4I 4GFBA 2ID6A 2IPQX 5B1BH 4BS9A
chains in the Genus database with same CATH topology
1FSHA 3JAMZ 4MQVA 1KYZA 2VOPA 5E8GA 5D8KB 1R1TA 4KICA 5A2QZ 1W4MA 2HWVA 2CWEA 5AIQA 1KU9A 1V4RA 1ZLKA 1C0WA 3PQKA 1IN8A 3GFMA 1P4XA 4L5JA 4OU0A 4OMYA 4B8XA 2A6HF 4KT5C 1SFXA 3F6VA 2EFOA 4HF2A 2IA2A 4O3MA 4A6DA 5J8CA 1T38A 1EH6A 4RB0A 4N0BA 4KMUX 4BQAA 4MEYF 2MH9A 4FHTA 1TW3A 2QQ9A 4BHBA 3HRMA 4IHTA 3BWGA 1IZ1A 4AIJA 3HTUA 5AIPA 3J81Z 4AD9A 2KIMA 2DPUA 4G7ZF 4UVAA 2D1HA 5FLXK 1AWCA 4U88A 2VN2A 2ZNZA 4G9YA 2W57A 2HYGD 3CUQA 1I27A 5D4SA 1O3QA 5HDNA 2QUFA 2J5PA 1K6OA 4EVIA 3RKYA 2AS5F 1QQIA 3EYYA 3C18A 1MGTA 2VBXA 4NB5A 1IXSB 2K4BA 4JK1X 1USTA 3WE3A 1B59A 1MDMB 1FYKA 2UZKA 2O8XA 2PMHA 2O3FA 1U3EM 1RI7A 3ZP5A 3GFJA 3VEPA 4WXCA 2IJLA 2EK5A 3ABTA 2NNNA 4KIFA 1UB9A 2F5FA 2DU9A 3GUDA 1YS6A 2OU2A 2YU3A 4HBLA 2DLLA 4CYDA 5K5QA 3I58A 1K78A 3BPXA 3BJAA 5ILVA 2ZFWA 3ABUA 1G3WA 5DDGA 1KQ8A 2ZBKA 2VBWA 4A0XA 1HSJA 3WTXC 4ZYEA 3GVAA 2IT0A 5CVVA 3WG9A 3I54A 4UXNA 3M8EA 2XAFA 4Q5SF 2M1BA 4CGZA 2P5VA 2LSOA 3E97A 4CHUA 1BBYA 3EETA 1GXQA 4ZYDA 1K79A 2O61A 1FZPB 2XIGA 5ERIA 4MTEA 4P9UA 2ZO4A 1YQAA 3C7JA 2M30A 4WXHA 5AONA 1OMIA 2L02A 5DCMB 4KDPA 3RKWA 3RPQA 4EJWA 3E5UA 2H27A 2P6TA 1FBQA 1G3TA 4EM2A 3TOBA 3QPTA 4GO1A 5CYVA 4F7ZA 1HW5A 3COAC 1H9GA 1LNWA 4M71A 2ZMEB 3MCZA 2VE8A 1JXSA 3FF5A 2K86A 3RJPA 1I1SA 1UHWA 1OYIA 2HOEA 3F6OA 3ECOA 2NS0A 5D6FA 3M9AA 5LEJA 1GXPA 4P55A 4UVCA 4G8XA 1NHAA 3BOQA 3QOPA 1ON2A 3OV8A 3ZMTA 3G73A 3QAHA 1UFMA 4A6EA 3J80Z 4WCGA 4ENMA 1KQ9A 4WF2A 2P4WA 2X4HA 1CF7B 1S29A 1XDSA 3J7AO 3ML6A 2PEXA 5LEKA 1F1ZA 4I0AA 2L3DA 3S2WA 4Y15A 4M9SA 5E1ZB 1USSA 3M8FA 4ON0A 2HDCA 2OZUA 4B09A 5K5RA 4OMZA 1ZAOA 1HBXG 5D5XB 1CGPA 4CICA 5DUIA 2ACJA 5H20A 1S7OA 4OIOF 2G9WA 4HDVA 3WODF 2MA3A 1IN7A 5D5UB 4KUMA 4EGZA 1YTYA 3CLOA 1KA8A 4M6YA 3F21A 1R1UA 1YFHA 2L4MA 3I59A 2A6EF 1ZGAA 5D6EA 1T6SA 2AXLA 2VXZA 1PUEE 3HSRA 3C1DA 5H6QA 4GGGA 2FEZA 5LLQA 1WWXA 3JTHA 4GYGA 1XSDA 3K2ZA 3KEQA 1S8NA 4S05A 4HQEA 3CO6C 3EUHA 2L4AA 2OBPA 1EV7A 3CJNA 1IRFA 4HAMA 4ZZDA 4M74A 3BP8A 5E1WA 2A61A 3T8TA 1WQ2A 3FWEA 3SXYA 3HHHA 5E20A 3SHFA 2BYVE 2LDUA 1FOKA 3TQNA 2KJBA 3FMQA 1ON1A 2V9VA 1U5TC 4G6DA 3K1NA 5HS9A 4HW0A 2RGVA 3T1BA 1U6GA 3EDPA 3CDHA 3V8LA 1ZRDA 2WV0A 4UNOA 2BGCA 1H9TA 3WTYC 2W25A 1IN5A 2P7VB 3M7GA 2D1VA 5JFRA 3F8NA 3L09A 2YX7A 3HOTA 2VC0A 5TRDA 3KLOA 1YG2A 4A5NA 5IT9K 3DV8A 3FX3A 3K1MA 1JHFA 3RYRA 2X0LA 4LJZF 1FNNA 1Z1DA 1BC7C 2OZ6A 1BN5A 1W7PD 2XAJA 1R58A 4U7BA 4O6JA 1XB4A 4DNCA 3ROUA 2BE5F 5LBQA 3K0LA 4CDGA 2FNAA 4HV6A 1E17A 3KP5A 5JR3A 3H92A 2O6GE 1ZREA 4AWXB 1ZARA 1U78A 1KQ0A 4RS8A 5DCMA 4ESFA 1SAXA 4ZZLA 3MZHA 3VFZA 4AVPA 3CUQC 2DK8A 1FP1D 4DQ2A 3QP5A 2MLKA 2IVMA 4RB3C 3D5LA 5IT3A 5LGTA 3IWFA 4ESBA 1T2KA 1AOYA 1S3JA 2H94A 1ZGJA 1HKTA 3RYPA 1YW9A 1J7KA 5JI6A 2F2EA 3BZ6A 2Z3YA 3GF2A 1JE8A 2CGPA 5J6XA 5FO5A 4ASNA 3NRVA 4UV8A 2E7XA 4UUVA 4A0ZA 1EH7A 2LF7A 1J5YA 2J5OA 2A69F 2ZNYA 2HYFA 2M5WA 5BQTA 3CUQB 1K7AA 2L01A 1T39A 3REOA 3FHZA 5LGUA 2YR2A 2UXNA 3P9IA 1JHHA 1B6AA 2KIFA 1XSXA 4MHGA 4ZYGA 1J59A 4EV0A 3T0YA 2CQKA 3IL2A 2H6BA 3U2RA 4IXAA 1OPCA 1MDMA 3J81K 2HKXA 3HRTA 2JPBA 3B02A 2VOOA 4ETSA 3RKXA 4KIGA 1GHCA 2HQNA 1FSEA 2VE9A 5E17F 1ZG3A 3I4PA 1YW8A 2NYXA 1G3SA 3P9CA 5BMZA 3GZ6A 1ZYRF 1EH8A 3WTVC 2E7WA 2H09A 3VB2A 3HUGA 3F23A 3WU1B 2E1NA 3LAPA 1TNSA 1Y0UA 2EWNA 1IXRC 1O7LA 5L3EA 1XGNA 1R1VA 1L3LA 5E8IA 2BEOA 3TGNA 2MLGA 2QM3A 3P7NA 3T8RA 5BPDA 2V1DA 1XCVA 4LFUA 4NQWA 2F5EA 3E6BA 2V1XA 1T98A 4RAYA 3V7SA 4Q48A 2FBHA 3PFIA 4HX7A 4RB2C 1KGSA 1R36A 3JAMK 3R0AA 2CO5A 3NQOA 4HZFA 1LB2A 2DQLA 2OA4A 1J0RA 3FM3A 2ZXJA 3KP2A 4KMFA 2MD5A 2P5LC 1Z05A 2RQPA 2W85A 5HOOA 3ERED 3O3KA 1LEAA 4LMYA 1QBJA 2Y0MA 5DD8A 5K1YA 3WTSC 2FNPA 2EJRA 4KNYA 4A12A 4LB5A 6PAXA 1QNTA 3GYHX 2HTSA 1MD0A 3FM5A 1R22A 4U7DA 4D0PA 1W7PB 3MQ0A 3TO6A 1SD4A 5CVJA 1XN7A 1ONVA 1TNTA 2GAUA 3WE2A 1FP2A 4U0YA 1A04A 3GEZA 3H3UA 4M9ZA 4A5MA 1XMKA 4MGRA 2RDPA 1XSVA 4I98B 2FA5A 2FMYA 3QRFF 3GLXA 2EV5A 1F4KA 1KU3A 1SMYF 2V6CA 1YS7A 1BM9A 3L9FA 4QLCU 5L3CA 5CJ9A 3GFIA 2PBIA 3EQLF 2ISZA 4JBAA 1V3FA 4IVNA 3L2CA 2EFWA 3KCCA 4HDUA 4HOBA 1HW2A 5DUKA 5LRRA 1D8KA 1QO0D 3GWZA 2A5YB 3V7CA 1ZHFA 5DEQA 3B73A 3CUOA 2PMUA 1YIOA 1LDJA 1L0OC 1P6RA 2NNYA 2W84A 3G3ZA 2KIUA 3C3WA 2PJPA 1D8JA 2MBFA 3EYIA 2ZMEA 5KK1A 4ESJA 4EJVA 4WX9A 2OQRA 2VONA 1OYWA 1KU2A 1P92A 3IKVA 1BI1A 3DF8A 3WTZA 5ILUA 1MKMA 3K9TA 2IRFG 2ELHA 3QP6A 3GFLA 1G3YA 5EEGA 2NRAC 3WTTC 2STTA 3GO5A 3WTWC 4EGYA 1MZBA 1MJAA 5ICGA 2WTEA 2VODA 1U2WA 2QVOA 1TQPA 1IN6A 4L9TA 1ODDA 3FMRA 4KYWA 3BROA 3FZVA 2XKOA 4BXUA 3I53A 1PP7U 2JTVA 1B1BA 3IRRA 5H6RA 1LDDA 3IRQA 3MWMA 4HX4A 3V7RA 4L0ZB 3LAJA 2P6SA 2ZCWA 1B9NA 3TDZC 3KP7A 3E6CC 1ZRFA 1QPMA 3L7WA 3GZ5A 3OOPA 2O03A 3WGHA 3CO7C 2DK5A 2E1CA 2XRNA 4AIHA 4HYEA 4JQFA 3LA7A 1ZH5A 3E6MA 5D4RA 4OINF 3WGIA 1FWZA 2STWA 5HDGA 1IW7F 4H0EA 3DFGA 2XAHA 2PQ8A 1R7JA 4LB6B 1T0FA 4L9VA 3DP7A 4KA4A 5DD4A 4UVBA 3TO9A 2R7FA 3F3XA 2W24A 4YIFA 2Q2EA 1RUOA 2OQGA 4M73A 1BI3A 2ADUA 2V1UA 2DQRA 1OR7A 2EFQA 1BI0A 5L3FA 3R61A 3ZN1A 3ELKA 2A07F 3T5XA 4KN4X 3BDDA 2UWMA 4N9IA 5E18F 5FFZA 3V4GA 2XV4S 2ESNA 1FBUA 1SD6A 3ZQ7A 3BPVA 5HVQC 2FE3A 4EM1A 2YX4A 4WK8F 1S6LA 1FPQA 1Z6RA 1SD7A 2K4JA 2GXBA 1HXDA 2GXGA 4HQMA 3QU3A 4ZYHA 3V8JA 3PQJA 3KETA 3AAFA 4WXDA 2M87A 4HV5A 1IRGA 4XSXF 3ZMZA 1R5HA 3DPTA 1IUYA 5HDKA 1ULYA 1XD7A 4I0BA 4KIBA 1P4AA 3HTSB 1DPUA 1FLIA 1J2XA 3IWZA 3I59B 1XDUA 4FT8A 4HLXA 3R4KA 1VTNC 3E5XA 2PN6A 1XMAA 2DBBA 5J8FA 2Z9OA 2B0LA 3DQVC 1Z7UA 5A2QK 1HKQA 2FXAA 1FT9A 3TOAA 1XGSA 1G4DA 1SD5A 2H6CA 1O3TA 5HLHA 4XLNF 4BHCA 1Z91A 4RGRA 1LQ1A 2DPDA 1D3YA 1Z6TA 5ICCA 2HKOA 2BV6A 1CF7A 2QQAA 4L5IA 3WGGA 2D45A 5FD5A 5LHHA 4OIPF 2WC2A 4P96A 1I1GA 1Q1HA 4IF4A 1B4AA 2GQQA 1TQMA 2P8TA 3TDUC 4P5OA 3ZMSA 3LSTA 4EMSA 3O6BB 5L3GA 3BJ6A 5FGMA 2ETHA 3HRSA 2FRHA 3F8BA 1HQCA 5LRSA 4L9JA 2CFXA 4IHSA 1W5TA 2K7LA 5E1XA 4Z2YA 1DDNA 1P2FA 4YFKF 1TBXA 2Z5UA 2XROA 1BIBA 3ZN0A 4S04A 4IJAA 5FLXZ 3TO7A 4PDKA 4LK1F 5HLGA 5DYMA 5IT9Z 1R00A 4CXFA 2RNJA 1U5TA 3ZMUA 4OIRF 5D5WB 3P9KA 3MAJA 5CLSA 3WTUC 3KZYA 3JSOA 1FYMA 2WWYA 4MQ9F 3I64A 1O3RA 4RAZA 2LF8A 4A0YA 5F6FA 3H3ZA 4OOIA 3K1PA 3R60A 4BH9A 4ZH4F 2VT3A 2EB7A 1TLHB 5LHIA 1FBSA 1J9IA 2HTJA 3HHGA 4RGSA 1Z9CA 3E5QA 3RDIA 1WKMA 5F1RA 3RPUA 4G6QA 5HS7A 2CG4A 2F5DA 3HSEA 1YLFA 3I71A 1R5GA 2DO7A 3FXRA 1TTYA 1RUNA 1F5TA 4YIIA 5CVUA 3VODA 5FB2A 4MNUA 1O7FA 5D5VB 2LKPA 2RVCA 1H0MA 3F72A 2XVCA 4WWCA 4CO8A 4IPAA 3DXJF 3F8CA 3IHUA 3KZZA 2O0YA 3KEOA 4ENKA 1BI2A 1IXCA 5F64A 4E70A 1WSUA 2MC3A 3FXQA 3GX4X 3QU6A 2QYOA 5JHUA 4NHJA 3W6JB 2R7DA 2QQBA 4LLGF 4LG0B 3HSFA 1TW2A 3Q5FA 3E6DA 2XAQA 4KN7X 3IC7A 1UHMA 1PDNC 3FXUA 1WI9A 4BAYA 5KVRA 2HR3A 3MEXA 1LJ9A 4R8HA 2EA4A 2A68F 5D8LB 1LEBA 2L54A 3Q9VA 4BNCA 3F8MA 2IP2A 4U0VA 1ZLJA 2IW5A 5K5OA 2FBIA 3RIRA 2QBYB 2XAGA 3WU0A 1UCRA 1HSTA 5TJJA 3SZTA 2F5CA 2GWRA 4A2UA 1B9MA 3MZYA 3IKTA 2JT1A 1JGSA 3HOSA 1RNLA 3J80K 1BOAA 4YFNF 2K02A 1LVAA 3O2PE 3I0TA 3R6SA 2P5KA 5BPIA 4EJTA 3MFKA 4ENNA 5HS8A 2R3SA 2A3SA 4FX0A 1XGMA 2HZTA 5CVRA 4PGHA 4IRHA 4P9FA 1WRJA 4PGGA 2UXXA 2D2WA 1DUXC 2KJCA 4EM0B 4AIKA 4LK0F 4UHTA 2TDXA 1SFEA 3D0SA 2DW4A 2G7UA 4RGUA 2HGCA 3L00A 3TKYA 1FC3A 3HIFA 1GVJA 3BY6A 2YSRA 1DPRA 4EJUA 1ZG5A 3HRUA 2EFPA 2NAZA 4UV9A 2XKPA 2Y48A 2FQ3A 3Q9SA 1W7PA 1O57A 3W6KB 3SFZA 3N4MA 3NEUA 5EEHA 2ZJ2A 4RB1A 2HQRA 4PCQA 2IA1A 3ZMDA 3KP4A 2RC4A 3JW4A 4L9NA 5LHGA 3ECHA 2Z33A 4M9XA 2QENA 2V79A 4GCVA 1IAWA 4IRGA 1D5VA 4EQQA 2MH2A 1FYLA 2XUBA 3LWFA 3HYIA 2Z99A 2RN7A 1PP8F 4Q47A 4ENJA 2XHKA 4Q4ZF 2Q8KA 2FBKA 1SFUA 5FFXA 3ZMVA 2ZKZA 2JPCA 1RZ4A 1MJ9A 2GIVA 2KRFA 1F9NA 1K78B 2BBYA 4U0WA 1HW1A 4Y13A 1OYYA 2OD5A 1QGPA 3KFWX 3CTAA 4K2EA 4TV7A 4YG2F 2QBYA 4LD5A 2GZWA 4MTDA 3ULQB 4PZJA 3LA2A 3F8FA 3F22A 1W5SA 2DAOA 1E2XA 1ZG1A 3U1DA 3DEUA 5ED4A 1YYVA 3E3VA 4O5VA 2HS5A 5BOXA 4EJOA 2VBYA 2EV0A 4OIQF 3SZPA 2IA0A 3GXOA 4XLPF 2FMLA 4LG0A 5JVTA 2ISYA 4G7OF 5L3BA 3JTGA 1G6NA 2QZ8A 2PI0A 2FOKA 1U8RA 5DCFA 5DV5A 3SQNA 3R0JA 4LLNA 4Y17A 2EFNA 2FF4A 5BS6A 4L18B 4R79A 2QWWA 2COMA 1DP7P 2C6YA 3RTRA 2DFIA 2VBZA 1O3SA 1HKSA 2DI3A 1U5TB 2Q0OA 2DT5A 3ISPA 3N97A 1MJBA 2RV8A 1R23A 4G7HF 4IRIA 4RGXA 4LGWA 3U9GA 4XSZF 2FSWA 2LNBA 5LGNA 4I2OA 5CVIA 1OKRA 4L0YB 4R1HA 1LDKB 1ZRCA 1XGOA 5ICFA 3V8KA 4KFCA 4BHPA 1BC8C 3LFKA 1J75A 2G7HA 1I5ZA 4I01A 2CW0F 4XRFA 4I7HA 4HF0A 1TQIA 5ILSA 4MEXF 2KKOA 2VC1A 4LLLA 2M45A 2QLZA 2YPRA 3QPHA 2HEOA 2JSCA 1YW7A 2XASA 2PG4A 2DTRA 4BYYA 4GXOA 1STZA 5L3DA 1QZZA 2OAZA 4M72A 4QWQA 4XBFA 1I6XA 1SMTA 4HF1A 2M8EA 4GYIA 4HLYA 4HA8A 3I5UA 1P4WA 3KLNA 4CZZA 3RI4A 2JRTA 2HFHA 2JZYA 2Y75A 3GW2A 2EV6A 4M6XA 1YO5C 3BJOA 2CSOA 4N9HA 1FY7A 1IN4A 3LQQA 3M1EA 5FD6A 2EA2A 5HLIA 1XCBA 1X3UA 1IF1A 3LA3A 4I02A 2FU4A 1RIOH 3KE2A 3LQRA 2PFBA 2GA1A 2K27A 1BJAA 3VOEA 3ZPLA 3K69A 1BIAA 4HX8A 4I09A 4FX4A 2VT2A 1KU7A 1ZN2A 3DPLC 2CYYA 4G94A 1QZYA 2P7CB 3KP3A 1KYWA 4YFXF 2RKHA 2PLYA 1FX7A 3DKWA 1S7AA 3FMSA 3JSPA 3KP6A 1REPC 5ICEA 2GA2A 2XGXA 2ESHA 2IPQX
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FSH A;  3JAM Z;  4MQV A;  1KYZ A;  2VOP A;  5E8G A;  5D8K B;  1R1T A;  4KIC A;  5A2Q Z;  1W4M A;  2HWV A;  2CWE A;  5AIQ A;  1KU9 A;  1V4R A;  1ZLK A;  1C0W A;  3PQK A;  1IN8 A;  3GFM A;  1P4X A;  4L5J A;  4OU0 A;  4OMY A;  4B8X A;  2A6H F;  4KT5 C;  1SFX A;  3F6V A;  2EFO A;  4HF2 A;  2IA2 A;  4O3M A;  4A6D A;  5J8C A;  1T38 A;  1EH6 A;  4RB0 A;  4N0B A;  4KMU X;  4BQA A;  4MEY F;  2MH9 A;  4FHT A;  1TW3 A;  2QQ9 A;  4BHB A;  3HRM A;  4IHT A;  3BWG A;  1IZ1 A;  4AIJ A;  3HTU A;  5AIP A;  3J81 Z;  4AD9 A;  2KIM A;  2DPU A;  4G7Z F;  4UVA A;  2D1H A;  5FLX K;  1AWC A;  4U88 A;  2VN2 A;  2ZNZ A;  4G9Y A;  2W57 A;  2HYG D;  3CUQ A;  1I27 A;  5D4S A;  1O3Q A;  5HDN A;  2QUF A;  2J5P A;  1K6O A;  4EVI A;  3RKY A;  2AS5 F;  1QQI A;  3EYY A;  3C18 A;  1MGT A;  2VBX A;  4NB5 A;  1IXS B;  2K4B A;  4JK1 X;  1UST A;  3WE3 A;  1B59 A;  1MDM B;  1FYK A;  2UZK A;  2O8X A;  2PMH A;  2O3F A;  1U3E M;  1RI7 A;  3ZP5 A;  3GFJ A;  3VEP A;  4WXC A;  2IJL A;  2EK5 A;  3ABT A;  2NNN A;  4KIF A;  1UB9 A;  2F5F A;  2DU9 A;  3GUD A;  1YS6 A;  2OU2 A;  2YU3 A;  4HBL A;  2DLL A;  4CYD A;  5K5Q A;  3I58 A;  1K78 A;  3BPX A;  3BJA A;  5ILV A;  2ZFW A;  3ABU A;  1G3W A;  5DDG A;  1KQ8 A;  2ZBK A;  2VBW A;  4A0X A;  1HSJ A;  3WTX C;  4ZYE A;  3GVA A;  2IT0 A;  5CVV A;  3WG9 A;  3I54 A;  4UXN A;  3M8E A;  2XAF A;  4Q5S F;  2M1B A;  4CGZ A;  2P5V A;  2LSO A;  3E97 A;  4CHU A;  1BBY A;  3EET A;  1GXQ A;  4ZYD A;  1K79 A;  2O61 A;  1FZP B;  2XIG A;  5ERI A;  4MTE A;  4P9U A;  2ZO4 A;  1YQA A;  3C7J A;  2M30 A;  4WXH A;  5AON A;  1OMI A;  2L02 A;  5DCM B;  4KDP A;  3RKW A;  3RPQ A;  4EJW A;  3E5U A;  2H27 A;  2P6T A;  1FBQ A;  1G3T A;  4EM2 A;  3TOB A;  3QPT A;  4GO1 A;  5CYV A;  4F7Z A;  1HW5 A;  3COA C;  1H9G A;  1LNW A;  4M71 A;  2ZME B;  3MCZ A;  2VE8 A;  1JXS A;  3FF5 A;  2K86 A;  3RJP A;  1I1S A;  1UHW A;  1OYI A;  2HOE A;  3F6O A;  3ECO A;  2NS0 A;  5D6F A;  3M9A A;  5LEJ A;  1GXP A;  4P55 A;  4UVC A;  4G8X A;  1NHA A;  3BOQ A;  3QOP A;  1ON2 A;  3OV8 A;  3ZMT A;  3G73 A;  3QAH A;  1UFM A;  4A6E A;  3J80 Z;  4WCG A;  4ENM A;  1KQ9 A;  4WF2 A;  2P4W A;  2X4H A;  1CF7 B;  1S29 A;  1XDS A;  3J7A O;  3ML6 A;  2PEX A;  5LEK A;  1F1Z A;  4I0A A;  2L3D A;  3S2W A;  4Y15 A;  4M9S A;  5E1Z B;  1USS A;  3M8F A;  4ON0 A;  2HDC A;  2OZU A;  4B09 A;  5K5R A;  4OMZ A;  1ZAO A;  1HBX G;  5D5X B;  1CGP A;  4CIC A;  5DUI A;  2ACJ A;  5H20 A;  1S7O A;  4OIO F;  2G9W A;  4HDV A;  3WOD F;  2MA3 A;  1IN7 A;  5D5U B;  4KUM A;  4EGZ A;  1YTY A;  3CLO A;  1KA8 A;  4M6Y A;  3F21 A;  1R1U A;  1YFH A;  2L4M A;  3I59 A;  2A6E F;  1ZGA A;  5D6E A;  1T6S A;  2AXL A;  2VXZ A;  1PUE E;  3HSR A;  3C1D A;  5H6Q A;  4GGG A;  2FEZ A;  5LLQ A;  1WWX A;  3JTH A;  4GYG A;  1XSD A;  3K2Z A;  3KEQ A;  1S8N A;  4S05 A;  4HQE A;  3CO6 C;  3EUH A;  2L4A A;  2OBP A;  1EV7 A;  3CJN A;  1IRF A;  4HAM A;  4ZZD A;  4M74 A;  3BP8 A;  5E1W A;  2A61 A;  3T8T A;  1WQ2 A;  3FWE A;  3SXY A;  3HHH A;  5E20 A;  3SHF A;  2BYV E;  2LDU A;  1FOK A;  3TQN A;  2KJB A;  3FMQ A;  1ON1 A;  2V9V A;  1U5T C;  4G6D A;  3K1N A;  5HS9 A;  4HW0 A;  2RGV A;  3T1B A;  1U6G A;  3EDP A;  3CDH A;  3V8L A;  1ZRD A;  2WV0 A;  4UNO A;  2BGC A;  1H9T A;  3WTY C;  2W25 A;  1IN5 A;  2P7V B;  3M7G A;  2D1V A;  5JFR A;  3F8N A;  3L09 A;  2YX7 A;  3HOT A;  2VC0 A;  5TRD A;  3KLO A;  1YG2 A;  4A5N A;  5IT9 K;  3DV8 A;  3FX3 A;  3K1M A;  1JHF A;  3RYR A;  2X0L A;  4LJZ F;  1FNN A;  1Z1D A;  1BC7 C;  2OZ6 A;  1BN5 A;  1W7P D;  2XAJ A;  1R58 A;  4U7B A;  4O6J A;  1XB4 A;  4DNC A;  3ROU A;  2BE5 F;  5LBQ A;  3K0L A;  4CDG A;  2FNA A;  4HV6 A;  1E17 A;  3KP5 A;  5JR3 A;  3H92 A;  2O6G E;  1ZRE A;  4AWX B;  1ZAR A;  1U78 A;  1KQ0 A;  4RS8 A;  5DCM A;  4ESF A;  1SAX A;  4ZZL A;  3MZH A;  3VFZ A;  4AVP A;  3CUQ C;  2DK8 A;  1FP1 D;  4DQ2 A;  3QP5 A;  2MLK A;  2IVM A;  4RB3 C;  3D5L A;  5IT3 A;  5LGT A;  3IWF A;  4ESB A;  1T2K A;  1AOY A;  1S3J A;  2H94 A;  1ZGJ A;  1HKT A;  3RYP A;  1YW9 A;  1J7K A;  5JI6 A;  2F2E A;  3BZ6 A;  2Z3Y A;  3GF2 A;  1JE8 A;  2CGP A;  5J6X A;  5FO5 A;  4ASN A;  3NRV A;  4UV8 A;  2E7X A;  4UUV A;  4A0Z A;  1EH7 A;  2LF7 A;  1J5Y A;  2J5O A;  2A69 F;  2ZNY A;  2HYF A;  2M5W A;  5BQT A;  3CUQ B;  1K7A A;  2L01 A;  1T39 A;  3REO A;  3FHZ A;  5LGU A;  2YR2 A;  2UXN A;  3P9I A;  1JHH A;  1B6A A;  2KIF A;  1XSX A;  4MHG A;  4ZYG A;  1J59 A;  4EV0 A;  3T0Y A;  2CQK A;  3IL2 A;  2H6B A;  3U2R A;  4IXA A;  1OPC A;  1MDM A;  3J81 K;  2HKX A;  3HRT A;  2JPB A;  3B02 A;  2VOO A;  4ETS A;  3RKX A;  4KIG A;  1GHC A;  2HQN A;  1FSE A;  2VE9 A;  5E17 F;  1ZG3 A;  3I4P A;  1YW8 A;  2NYX A;  1G3S A;  3P9C A;  5BMZ A;  3GZ6 A;  1ZYR F;  1EH8 A;  3WTV C;  2E7W A;  2H09 A;  3VB2 A;  3HUG A;  3F23 A;  3WU1 B;  2E1N A;  3LAP A;  1TNS A;  1Y0U A;  2EWN A;  1IXR C;  1O7L A;  5L3E A;  1XGN A;  1R1V A;  1L3L A;  5E8I A;  2BEO A;  3TGN A;  2MLG A;  2QM3 A;  3P7N A;  3T8R A;  5BPD A;  2V1D A;  1XCV A;  4LFU A;  4NQW A;  2F5E A;  3E6B A;  2V1X A;  1T98 A;  4RAY A;  3V7S A;  4Q48 A;  2FBH A;  3PFI A;  4HX7 A;  4RB2 C;  1KGS A;  1R36 A;  3JAM K;  3R0A A;  2CO5 A;  3NQO A;  4HZF A;  1LB2 A;  2DQL A;  2OA4 A;  1J0R A;  3FM3 A;  2ZXJ A;  3KP2 A;  4KMF A;  2MD5 A;  2P5L C;  1Z05 A;  2RQP A;  2W85 A;  5HOO A;  3ERE D;  3O3K A;  1LEA A;  4LMY A;  1QBJ A;  2Y0M A;  5DD8 A;  5K1Y A;  3WTS C;  2FNP A;  2EJR A;  4KNY A;  4A12 A;  4LB5 A;  6PAX A;  1QNT A;  3GYH X;  2HTS A;  1MD0 A;  3FM5 A;  1R22 A;  4U7D A;  4D0P A;  1W7P B;  3MQ0 A;  3TO6 A;  1SD4 A;  5CVJ A;  1XN7 A;  1ONV A;  1TNT A;  2GAU A;  3WE2 A;  1FP2 A;  4U0Y A;  1A04 A;  3GEZ A;  3H3U A;  4M9Z A;  4A5M A;  1XMK A;  4MGR A;  2RDP A;  1XSV A;  4I98 B;  2FA5 A;  2FMY A;  3QRF F;  3GLX A;  2EV5 A;  1F4K A;  1KU3 A;  1SMY F;  2V6C A;  1YS7 A;  1BM9 A;  3L9F A;  4QLC U;  5L3C A;  5CJ9 A;  3GFI A;  2PBI A;  3EQL F;  2ISZ A;  4JBA A;  1V3F A;  4IVN A;  3L2C A;  2EFW A;  3KCC A;  4HDU A;  4HOB A;  1HW2 A;  5DUK A;  5LRR A;  1D8K A;  1QO0 D;  3GWZ A;  2A5Y B;  3V7C A;  1ZHF A;  5DEQ A;  3B73 A;  3CUO A;  2PMU A;  1YIO A;  1LDJ A;  1L0O C;  1P6R A;  2NNY A;  2W84 A;  3G3Z A;  2KIU A;  3C3W A;  2PJP A;  1D8J A;  2MBF A;  3EYI A;  2ZME A;  5KK1 A;  4ESJ A;  4EJV A;  4WX9 A;  2OQR A;  2VON A;  1OYW A;  1KU2 A;  1P92 A;  3IKV A;  1BI1 A;  3DF8 A;  3WTZ A;  5ILU A;  1MKM A;  3K9T A;  2IRF G;  2ELH A;  3QP6 A;  3GFL A;  1G3Y A;  5EEG A;  2NRA C;  3WTT C;  2STT A;  3GO5 A;  3WTW C;  4EGY A;  1MZB A;  1MJA A;  5ICG A;  2WTE A;  2VOD A;  1U2W A;  2QVO A;  1TQP A;  1IN6 A;  4L9T A;  1ODD A;  3FMR A;  4KYW A;  3BRO A;  3FZV A;  2XKO A;  4BXU A;  3I53 A;  1PP7 U;  2JTV A;  1B1B A;  3IRR A;  5H6R A;  1LDD A;  3IRQ A;  3MWM A;  4HX4 A;  3V7R A;  4L0Z B;  3LAJ A;  2P6S A;  2ZCW A;  1B9N A;  3TDZ C;  3KP7 A;  3E6C C;  1ZRF A;  1QPM A;  3L7W A;  3GZ5 A;  3OOP A;  2O03 A;  3WGH A;  3CO7 C;  2DK5 A;  2E1C A;  2XRN A;  4AIH A;  4HYE A;  4JQF A;  3LA7 A;  1ZH5 A;  3E6M A;  5D4R A;  4OIN F;  3WGI A;  1FWZ A;  2STW A;  5HDG A;  1IW7 F;  4H0E A;  3DFG A;  2XAH A;  2PQ8 A;  1R7J A;  4LB6 B;  1T0F A;  4L9V A;  3DP7 A;  4KA4 A;  5DD4 A;  4UVB A;  3TO9 A;  2R7F A;  3F3X A;  2W24 A;  4YIF A;  2Q2E A;  1RUO A;  2OQG A;  4M73 A;  1BI3 A;  2ADU A;  2V1U A;  2DQR A;  1OR7 A;  2EFQ A;  1BI0 A;  5L3F A;  3R61 A;  3ZN1 A;  3ELK A;  2A07 F;  3T5X A;  4KN4 X;  3BDD A;  2UWM A;  4N9I A;  5E18 F;  5FFZ A;  3V4G A;  2XV4 S;  2ESN A;  1FBU A;  1SD6 A;  3ZQ7 A;  3BPV A;  5HVQ C;  2FE3 A;  4EM1 A;  2YX4 A;  4WK8 F;  1S6L A;  1FPQ A;  1Z6R A;  1SD7 A;  2K4J A;  2GXB A;  1HXD A;  2GXG A;  4HQM A;  3QU3 A;  4ZYH A;  3V8J A;  3PQJ A;  3KET A;  3AAF A;  4WXD A;  2M87 A;  4HV5 A;  1IRG A;  4XSX F;  3ZMZ A;  1R5H A;  3DPT A;  1IUY A;  5HDK A;  1ULY A;  1XD7 A;  4I0B A;  4KIB A;  1P4A A;  3HTS B;  1DPU A;  1FLI A;  1J2X A;  3IWZ A;  3I59 B;  1XDU A;  4FT8 A;  4HLX A;  3R4K A;  1VTN C;  3E5X A;  2PN6 A;  1XMA A;  2DBB A;  5J8F A;  2Z9O A;  2B0L A;  3DQV C;  1Z7U A;  5A2Q K;  1HKQ A;  2FXA A;  1FT9 A;  3TOA A;  1XGS A;  1G4D A;  1SD5 A;  2H6C A;  1O3T A;  5HLH A;  4XLN F;  4BHC A;  1Z91 A;  4RGR A;  1LQ1 A;  2DPD A;  1D3Y A;  1Z6T A;  5ICC A;  2HKO A;  2BV6 A;  1CF7 A;  2QQA A;  4L5I A;  3WGG A;  2D45 A;  5FD5 A;  5LHH A;  4OIP F;  2WC2 A;  4P96 A;  1I1G A;  1Q1H A;  4IF4 A;  1B4A A;  2GQQ A;  1TQM A;  2P8T A;  3TDU C;  4P5O A;  3ZMS A;  3LST A;  4EMS A;  3O6B B;  5L3G A;  3BJ6 A;  5FGM A;  2ETH A;  3HRS A;  2FRH A;  3F8B A;  1HQC A;  5LRS A;  4L9J A;  2CFX A;  4IHS A;  1W5T A;  2K7L A;  5E1X A;  4Z2Y A;  1DDN A;  1P2F A;  4YFK F;  1TBX A;  2Z5U A;  2XRO A;  1BIB A;  3ZN0 A;  4S04 A;  4IJA A;  5FLX Z;  3TO7 A;  4PDK A;  4LK1 F;  5HLG A;  5DYM A;  5IT9 Z;  1R00 A;  4CXF A;  2RNJ A;  1U5T A;  3ZMU A;  4OIR F;  5D5W B;  3P9K A;  3MAJ A;  5CLS A;  3WTU C;  3KZY A;  3JSO A;  1FYM A;  2WWY A;  4MQ9 F;  3I64 A;  1O3R A;  4RAZ A;  2LF8 A;  4A0Y A;  5F6F A;  3H3Z A;  4OOI A;  3K1P A;  3R60 A;  4BH9 A;  4ZH4 F;  2VT3 A;  2EB7 A;  1TLH B;  5LHI A;  1FBS A;  1J9I A;  2HTJ A;  3HHG A;  4RGS A;  1Z9C A;  3E5Q A;  3RDI A;  1WKM A;  5F1R A;  3RPU A;  4G6Q A;  5HS7 A;  2CG4 A;  2F5D A;  3HSE A;  1YLF A;  3I71 A;  1R5G A;  2DO7 A;  3FXR A;  1TTY A;  1RUN A;  1F5T A;  4YII A;  5CVU A;  3VOD A;  5FB2 A;  4MNU A;  1O7F A;  5D5V B;  2LKP A;  2RVC A;  1H0M A;  3F72 A;  2XVC A;  4WWC A;  4CO8 A;  4IPA A;  3DXJ F;  3F8C A;  3IHU A;  3KZZ A;  2O0Y A;  3KEO A;  4ENK A;  1BI2 A;  1IXC A;  5F64 A;  4E70 A;  1WSU A;  2MC3 A;  3FXQ A;  3GX4 X;  3QU6 A;  2QYO A;  5JHU A;  4NHJ A;  3W6J B;  2R7D A;  2QQB A;  4LLG F;  4LG0 B;  3HSF A;  1TW2 A;  3Q5F A;  3E6D A;  2XAQ A;  4KN7 X;  3IC7 A;  1UHM A;  1PDN C;  3FXU A;  1WI9 A;  4BAY A;  5KVR A;  2HR3 A;  3MEX A;  1LJ9 A;  4R8H A;  2EA4 A;  2A68 F;  5D8L B;  1LEB A;  2L54 A;  3Q9V A;  4BNC A;  3F8M A;  2IP2 A;  4U0V A;  1ZLJ A;  2IW5 A;  5K5O A;  2FBI A;  3RIR A;  2QBY B;  2XAG A;  3WU0 A;  1UCR A;  1HST A;  5TJJ A;  3SZT A;  2F5C A;  2GWR A;  4A2U A;  1B9M A;  3MZY A;  3IKT A;  2JT1 A;  1JGS A;  3HOS A;  1RNL A;  3J80 K;  1BOA A;  4YFN F;  2K02 A;  1LVA A;  3O2P E;  3I0T A;  3R6S A;  2P5K A;  5BPI A;  4EJT A;  3MFK A;  4ENN A;  5HS8 A;  2R3S A;  2A3S A;  4FX0 A;  1XGM A;  2HZT A;  5CVR A;  4PGH A;  4IRH A;  4P9F A;  1WRJ A;  4PGG A;  2UXX A;  2D2W A;  1DUX C;  2KJC A;  4EM0 B;  4AIK A;  4LK0 F;  4UHT A;  2TDX A;  1SFE A;  3D0S A;  2DW4 A;  2G7U A;  4RGU A;  2HGC A;  3L00 A;  3TKY A;  1FC3 A;  3HIF A;  1GVJ A;  3BY6 A;  2YSR A;  1DPR A;  4EJU A;  1ZG5 A;  3HRU A;  2EFP A;  2NAZ A;  4UV9 A;  2XKP A;  2Y48 A;  2FQ3 A;  3Q9S A;  1W7P A;  1O57 A;  3W6K B;  3SFZ A;  3N4M A;  3NEU A;  5EEH A;  2ZJ2 A;  4RB1 A;  2HQR A;  4PCQ A;  2IA1 A;  3ZMD A;  3KP4 A;  2RC4 A;  3JW4 A;  4L9N A;  5LHG A;  3ECH A;  2Z33 A;  4M9X A;  2QEN A;  2V79 A;  4GCV A;  1IAW A;  4IRG A;  1D5V A;  4EQQ A;  2MH2 A;  1FYL A;  2XUB A;  3LWF A;  3HYI A;  2Z99 A;  2RN7 A;  1PP8 F;  4Q47 A;  4ENJ A;  2XHK A;  4Q4Z F;  2Q8K A;  2FBK A;  1SFU A;  5FFX A;  3ZMV A;  2ZKZ A;  2JPC A;  1RZ4 A;  1MJ9 A;  2GIV A;  2KRF A;  1F9N A;  1K78 B;  2BBY A;  4U0W A;  1HW1 A;  4Y13 A;  1OYY A;  2OD5 A;  1QGP A;  3KFW X;  3CTA A;  4K2E A;  4TV7 A;  4YG2 F;  2QBY A;  4LD5 A;  2GZW A;  4MTD A;  3ULQ B;  4PZJ A;  3LA2 A;  3F8F A;  3F22 A;  1W5S A;  2DAO A;  1E2X A;  1ZG1 A;  3U1D A;  3DEU A;  5ED4 A;  1YYV A;  3E3V A;  4O5V A;  2HS5 A;  5BOX A;  4EJO A;  2VBY A;  2EV0 A;  4OIQ F;  3SZP A;  2IA0 A;  3GXO A;  4XLP F;  2FML A;  4LG0 A;  5JVT A;  2ISY A;  4G7O F;  5L3B A;  3JTG A;  1G6N A;  2QZ8 A;  2PI0 A;  2FOK A;  1U8R A;  5DCF A;  5DV5 A;  3SQN A;  3R0J A;  4LLN A;  4Y17 A;  2EFN A;  2FF4 A;  5BS6 A;  4L18 B;  4R79 A;  2QWW A;  2COM A;  1DP7 P;  2C6Y A;  3RTR A;  2DFI A;  2VBZ A;  1O3S A;  1HKS A;  2DI3 A;  1U5T B;  2Q0O A;  2DT5 A;  3ISP A;  3N97 A;  1MJB A;  2RV8 A;  1R23 A;  4G7H F;  4IRI A;  4RGX A;  4LGW A;  3U9G A;  4XSZ F;  2FSW A;  2LNB A;  5LGN A;  4I2O A;  5CVI A;  1OKR A;  4L0Y B;  4R1H A;  1LDK B;  1ZRC A;  1XGO A;  5ICF A;  3V8K A;  4KFC A;  4BHP A;  1BC8 C;  3LFK A;  1J75 A;  2G7H A;  1I5Z A;  4I01 A;  2CW0 F;  4XRF A;  4I7H A;  4HF0 A;  1TQI A;  5ILS A;  4MEX F;  2KKO A;  2VC1 A;  4LLL A;  2M45 A;  2QLZ A;  2YPR A;  3QPH A;  2HEO A;  2JSC A;  1YW7 A;  2XAS A;  2PG4 A;  2DTR A;  4BYY A;  4GXO A;  1STZ A;  5L3D A;  1QZZ A;  2OAZ A;  4M72 A;  4QWQ A;  4XBF A;  1I6X A;  1SMT A;  4HF1 A;  2M8E A;  4GYI A;  4HLY A;  4HA8 A;  3I5U A;  1P4W A;  3KLN A;  4CZZ A;  3RI4 A;  2JRT A;  2HFH A;  2JZY A;  2Y75 A;  3GW2 A;  2EV6 A;  4M6X A;  1YO5 C;  3BJO A;  2CSO A;  4N9H A;  1FY7 A;  1IN4 A;  3LQQ A;  3M1E A;  5FD6 A;  2EA2 A;  5HLI A;  1XCB A;  1X3U A;  1IF1 A;  3LA3 A;  4I02 A;  2FU4 A;  1RIO H;  3KE2 A;  3LQR A;  2PFB A;  2GA1 A;  2K27 A;  1BJA A;  3VOE A;  3ZPL A;  3K69 A;  1BIA A;  4HX8 A;  4I09 A;  4FX4 A;  2VT2 A;  1KU7 A;  1ZN2 A;  3DPL C;  2CYY A;  4G94 A;  1QZY A;  2P7C B;  3KP3 A;  1KYW A;  4YFX F;  2RKH A;  2PLY A;  1FX7 A;  3DKW A;  1S7A A;  3FMS A;  3JSP A;  3KP6 A;  1REP C;  5ICE A;  2GA2 A;  2XGX A;  2ESH A;  2IPQ X; 
#chains in the Genus database with same CATH topology
 4FIS A;  4A3I J;  2E2I J;  1QA6 A;  1FSH A;  3Q3S A;  3OYM A;  3JAM Z;  4XL9 A;  4MQV A;  4XQF A;  2K9N A;  1KYZ A;  1D0Y A;  1D1A A;  2VOP A;  3QQA A;  1TP4 A;  4IO9 F;  5E8G A;  5D8K B;  1R1T A;  2ZJR F;  2HZD A;  2DFF A;  4KIC A;  5IP7 J;  5A2Q Z;  3GTK J;  4HG2 A;  1VQ5 I;  3OS1 A;  1PYV A;  3C2B A;  1W4M A;  2RNG A;  2HWV A;  3GLL A;  2LOO A;  3A03 A;  3H5N A;  4XLF A;  2CWE A;  5AIQ A;  1KU9 A;  2XPU A;  3VYR B;  2GOX B;  4BE1 A;  1V4R A;  1ZLK A;  1C0W A;  2DA6 A;  3PQK A;  1KZH A;  1IN8 A;  3GFM A;  1P4X A;  4L5J A;  2ZSI B;  4OU0 A;  4V2G A;  1Y39 A;  4OMY A;  4B8X A;  2DYR H;  2XAU A;  4AVZ A;  2A6H F;  1H88 C;  3OWT A;  4DYC A;  1JJ8 C;  2EZK A;  4KT5 C;  3G4S I;  3JR9 A;  1SFX A;  4RLF A;  3I9V 2;  4LIU A;  2BW3 B;  3F6V A;  2EFO A;  2K3P A;  2OJE D;  4HF2 A;  2IA2 A;  4O3M A;  2AQE A;  4FQG A;  4A6D A;  5J8C A;  1UJ8 A;  1T38 A;  1MBK A;  1BA5 A;  1Y8Q B;  1YOV B;  1EH6 A;  1HA8 A;  2CMP A;  2IBD A;  4RB0 A;  4N0B A;  1NK2 P;  4KMU X;  4BQA A;  4MEY F;  1YRN A;  1A35 A;  2MH9 A;  4FHT A;  5IYC J;  5TIS C;  1R49 A;  1TW3 A;  2QQ9 A;  4BHB A;  1AKH A;  2CV1 A;  3HRM A;  5LD2 C;  4IHT A;  3BWG A;  1IZ1 A;  3CMA I;  4AIJ A;  3HTU A;  1IDY A;  5AIP A;  3J81 Z;  4AD9 A;  2KIM A;  2HYJ A;  1RES A;  2DPU A;  4G7Z F;  2BHY A;  2D1H A;  4RM2 A;  4UVA A;  5FLX K;  1W36 C;  1AWC A;  1T95 A;  4U88 A;  1TT5 B;  2VN2 A;  2ZNZ A;  4E7Z A;  4G9Y A;  4A3E J;  2W57 A;  5E3O A;  3HUG B;  2HYG D;  3CUQ A;  1I27 A;  1N25 A;  5D4S A;  1O3Q A;  5HDN A;  2QUF A;  2J5P A;  2R7U A;  1MBE A;  3X2Q H;  2DYS H;  4M3B A;  2E2J J;  3V42 A;  1K6O A;  4EVI A;  3RKY A;  1ITY A;  2OC6 A;  2AS5 F;  1QQI A;  3EYY A;  3C18 A;  3HKZ A;  5JLX A;  1VQP I;  2FD5 A;  2L9V A;  4BGD A;  1MGT A;  3DWL E;  2VBX A;  2NVY J;  4NB5 A;  3W2V A;  1IXS B;  2K4B A;  1G59 A;  4JK1 X;  1UST A;  3WE3 A;  4XR6 A;  1CQT A;  4B47 A;  1B59 A;  1U0J A;  1MDM B;  1FYK A;  1GV2 A;  2UZK A;  4NNJ A;  2KRH A;  1RET A;  2O8X A;  3JCU C;  2PMH A;  2O3F A;  4IQJ A;  1U3E M;  1RI7 A;  2I5U A;  2QQ8 A;  4XN3 A;  4DYQ A;  3JRF A;  3ZP5 A;  3RQI A;  3GFJ A;  3VEP A;  3OYD A;  2VL8 A;  2QSH X;  4WXC A;  2IJL A;  4ZDO A;  3M3Y J;  5GAE J;  3LSR A;  3QOE A;  3I4M J;  2EK5 A;  3ABT A;  2NNN A;  1MH3 A;  1MW7 A;  4KIF A;  3PFY A;  2NVQ J;  3NAU A;  1UB9 A;  2LKX A;  3GUD A;  2DU9 A;  2F5F A;  2FUG 2;  2DXI A;  3HKZ N;  1YS6 A;  3JRA A;  3L2U A;  4II3 A;  4IQ4 A;  1P7J A;  2OU2 A;  1JGG A;  1IGN A;  2YU3 A;  2UV1 A;  4HBL A;  1RKW A;  2DLL A;  5EDN A;  4CYD A;  1TWG J;  5K5Q A;  3I58 A;  1K78 A;  3TL4 X;  2KLO A;  3BPX A;  2AO9 A;  4PK4 A;  3BJA A;  1K4S A;  5ILV A;  2ZFW A;  2AHQ A;  3ABU A;  2KZG A;  4J01 A;  1G3W A;  2M4G A;  5DDG A;  1HCR A;  1KQ8 A;  2ZBK A;  4M3G A;  2VBW A;  4XK4 A;  2X1E A;  3ASO H;  1HF0 A;  4A0X A;  1HSJ A;  2MD0 A;  3WTX C;  2E5Z A;  4ZYE A;  3GVA A;  2IT0 A;  2DA1 A;  5CVV A;  3WG9 A;  4B44 A;  2HOA A;  1FEX A;  4PFP A;  3I54 A;  4UXN A;  3M8E A;  3QYB A;  2MGQ A;  2XAF A;  2HXO A;  2VAS A;  3W2A A;  2L9R A;  2V26 A;  3HGY A;  3PIO F;  2NVX J;  4RM3 A;  4Q5S F;  2M1B A;  1BL0 A;  4CGZ A;  2KRC A;  2P5V A;  2LSO A;  2I8D A;  2VIX A;  1OCT C;  3E97 A;  4QTR A;  4JP0 A;  1WJA A;  3B6C A;  3ZQI A;  4ZJZ A;  3ONQ A;  4CHU A;  1IV6 A;  1BBY A;  3EET A;  1GXQ A;  4ZYD A;  1K79 A;  3HOU J;  2O61 A;  3CMM A;  1FZP B;  2XIG A;  2EIJ H;  5ERI A;  1WH5 A;  4A3M J;  4IHV A;  4MTE A;  3WHB A;  4P9U A;  4A3J J;  1SFO J;  3C7J A;  2ZO4 A;  1YQA A;  2Q1Z B;  2M30 A;  4WXH A;  1X1D A;  2VQC A;  3H5A A;  5AON A;  2IEK A;  4CSW A;  3MN2 A;  2HQA A;  4DZJ A;  1OMI A;  2L2O A;  2L02 A;  5DCM B;  4KDP A;  3RKW A;  2ZXH A;  4XOP A;  3RPQ A;  3CP2 A;  1X2M A;  4EJW A;  3E5U A;  1YX3 A;  2H27 A;  2P6T A;  2ME6 A;  3DU5 A;  1FBQ A;  2DOD A;  1G3T A;  4EM2 A;  3BG7 A;  3TOB A;  1H8A C;  5EEA A;  3QPT A;  4GO1 A;  5CYV A;  1FOY A;  4F7Z A;  1HW5 A;  3G6E I;  3COA C;  3QPS A;  2E71 A;  1H9G A;  1LNW A;  1OFC X;  4LIV A;  3GME A;  4M71 A;  2ZME B;  3S2D J;  1JT6 A;  3G2B A;  3UR3 C;  2DMN A;  3MMY B;  3MCZ A;  2VE8 A;  1FIA A;  1JXS A;  1MBG A;  4BEH A;  2JA8 J;  3FF5 A;  2WAF A;  1LFP A;  1SVM A;  3KX2 A;  5GPC A;  3E1S A;  3K4N A;  2K86 A;  3RJP A;  3H35 A;  3HOX J;  2JQ7 A;  4AC0 A;  1UMQ A;  1WPK A;  4QIW N;  1I1S A;  2AQF A;  1UHW A;  1OYI A;  3QWL A;  2V1N A;  1TWF J;  2DJI A;  4NC7 A;  1XTA A;  2HOE A;  3F6O A;  1SAU A;  3BG9 A;  3ECO A;  2NS0 A;  3PO3 J;  5D6F A;  3M9A A;  3CQZ J;  5LEJ A;  1IV8 A;  1XMX A;  1OCO H;  1GXP A;  4V19 K;  4NDL A;  1Z77 A;  2Y31 A;  4P55 A;  1QHG A;  2E5N A;  4G8X A;  1NHA A;  4UVC A;  3CCJ I;  2OF7 A;  3BOQ A;  3TMO A;  3QOP A;  1ON2 A;  3OV8 A;  3ZMT A;  3G73 A;  4E6K G;  2PMZ A;  2JSP A;  1MH4 A;  2KL4 A;  2Q2E B;  3QAH A;  2VJ4 A;  4HNV A;  1UFM A;  1VQ6 I;  4A6E A;  1W0U A;  3J80 Z;  4WCG A;  4ENM A;  4E7L A;  1ZKG A;  2DOA A;  4BQN A;  1SEU A;  5EJC A;  5CPR B;  4KT6 A;  1KQ9 A;  3NWT A;  1FMV A;  3QYE A;  3OYH A;  4CCO A;  1ZK8 A;  4J19 A;  4WF2 A;  3BG3 A;  3VPR A;  2P4W A;  2X4H A;  3OS2 A;  1CF7 B;  1S29 A;  1XDS A;  3J7A O;  4D5C A;  3IH2 A;  3ML6 A;  5J1R A;  5EGO B;  1JUS A;  2PEX A;  5LEK A;  3H9Q A;  1K61 A;  1F1Z A;  4I0A A;  2L3D A;  2VI6 A;  3S2W A;  4Y15 A;  4M9S A;  2FOW A;  3SZG A;  4A3K J;  1B72 B;  5E1Z B;  2W82 A;  4HEA 2;  3LSP A;  1USS A;  3DTK A;  2ZXI A;  3M8F A;  4ON0 A;  2HDC A;  2YS9 A;  3K6G A;  2OZU A;  2JJ7 A;  4B09 A;  5K5R A;  4OMZ A;  5FRO A;  1ZAO A;  1HBX G;  5D5X B;  2VKE A;  4NQW B;  1JTY A;  3LOC A;  1CGP A;  4CIC A;  5DUI A;  2KDZ A;  2CQQ A;  5H20 A;  2ACJ A;  1S7O A;  3DBH B;  4OIO F;  3FK7 A;  2G9W A;  3OY9 A;  2VJI A;  4A3B J;  5FRN A;  4HDV A;  3WOD F;  2MA3 A;  1IN7 A;  5B1A H;  4KUM A;  5D5U B;  1GV5 A;  3SEQ A;  4EGZ A;  1GUU A;  1YTY A;  3CLO A;  1KA8 A;  4M6Y A;  2R7Z J;  2CH0 A;  2R7O A;  3F21 A;  4X0G A;  1VF9 A;  2R7W A;  2HI3 A;  1R1U A;  1YFH A;  2L4M A;  1YRN B;  2K9M A;  3I59 A;  2A6E F;  2DMQ A;  1ZGA A;  2MW8 A;  5D6E A;  3HOY J;  2DDB A;  1T6S A;  5J47 A;  3K10 A;  2AXL A;  4V2F A;  2VXZ A;  1ZEL A;  1PUE E;  2VPR A;  2WV1 A;  2JUC A;  2H8W A;  3HSR A;  5HNH A;  3C1D A;  5H6Q A;  4GGG A;  2FEZ A;  5LLQ A;  1WWX A;  3JTH A;  1I3Q J;  3CC7 I;  1R9T J;  1QVU A;  4GYG A;  1XSD A;  2PJR A;  5F08 A;  3K2Z A;  3E7L A;  3KEQ A;  1S8N A;  4S05 A;  4HQE A;  5C4J J;  3CO6 C;  2E2H J;  1WJE A;  4UUS A;  2O9L A;  3EUH A;  2L4A A;  2OBP A;  1EV7 A;  3CJN A;  1IRF A;  4HAM A;  4ZZD A;  4M74 A;  3BP8 A;  4LG3 A;  5E1W A;  2A61 A;  3T8T A;  1DGR M;  1WQ2 A;  1V5G A;  3FWE A;  2L7Z A;  3K4K A;  3SXY A;  1I3A A;  3K7A J;  4OAY A;  5B3S H;  3HHH A;  1K83 J;  1XX5 A;  5E20 A;  3ZR8 X;  2R7V A;  3SHF A;  2BYV E;  2LDU A;  1FOK A;  3CES A;  1OCZ H;  4A3C J;  1UEL B;  2GOM A;  4AUX A;  4B48 A;  3TQN A;  2VJJ A;  2VKV A;  2KJB A;  3ZXS A;  3FMQ A;  4ZC3 A;  1ON1 A;  2V9V A;  3TP0 A;  1U5T C;  2Z1D A;  4YEJ A;  2ZME C;  4G6D A;  3K1N A;  1MND A;  5HS9 A;  2HVQ A;  4HW0 A;  2RGV A;  3T1B A;  4PJ0 C;  1U6G A;  1X19 A;  4D7M A;  4ZYA A;  1HOM A;  4BE0 A;  3EDP A;  2OPT A;  4XOT A;  3FKI J;  4HNT A;  3VSK A;  1PUF B;  3CDH A;  1D5Y A;  3V8L A;  1ZRD A;  2WV0 A;  4UNO A;  2BGC A;  3FXO A;  2DA7 A;  1H9T A;  3WTY C;  2W25 A;  3UNG C;  2CS3 A;  3PUF A;  1EJ9 A;  4BY1 J;  1PJR A;  4IOC F;  3NAR A;  1IN5 A;  2P7V B;  4DIQ A;  3M7G A;  2M2E A;  4D7N A;  2R7R A;  2XF6 A;  1R6R A;  1Y6I A;  2D1V A;  5JFR A;  3F8N A;  3L09 A;  2YX7 A;  3HOT A;  2JA6 J;  2VC0 A;  1T56 A;  2ME0 A;  5TRD A;  3KLO A;  1YG2 A;  2OTL I;  1WZ2 A;  4A5N A;  2DMP A;  3MKY B;  5IT9 K;  2KIS A;  3DV8 A;  1WCM J;  3FKJ A;  2M0M A;  3FX3 A;  3ZGK A;  1VQL I;  3K1M A;  2IS4 A;  4UB8 C;  3ZQL A;  3DBL B;  1JHF A;  3FXK A;  3RYR A;  2X0L A;  2B63 J;  1RRJ A;  4LJZ F;  3AL0 C;  5M5W J;  1FNN A;  1Z1D A;  4BKX A;  1T08 B;  1BC7 C;  2OZ6 A;  1X1C A;  1BN5 A;  2LD5 A;  2VQL A;  3L1P A;  4NBQ A;  1W7P D;  3U21 A;  2XAJ A;  1R58 A;  4U7B A;  4O6J A;  2ZSH B;  5KAF C;  1XB4 A;  3OIO A;  4MLO A;  4DNC A;  2ZFU A;  2M7A A;  3ROU A;  1T0F C;  2BE5 F;  4IHW A;  4C9Y A;  2E19 A;  2ECB A;  5LBQ A;  2VKD A;  3K0L A;  4CDG A;  2FNA A;  1IG7 A;  1IJW C;  2DMU A;  4HV6 A;  1E17 A;  4BL0 B;  3KP5 A;  5JR3 A;  1DGW Y;  3H92 A;  2O6G E;  2DOE A;  1ZRE A;  4AWX B;  1P9Q C;  1ZAR A;  1I50 J;  1U78 A;  4A3F J;  5C44 J;  3ZQH A;  4Y4R A;  3KIO A;  1KQ0 A;  5LFA A;  4RS8 A;  2KZV A;  2HU9 A;  5DCM A;  4ESF A;  2DA2 A;  1AHD P;  1JKR C;  1VQN I;  3GTQ J;  1HC8 A;  1SAX A;  2V6E A;  1OIS A;  3OR1 C;  3BTC A;  3DTE A;  4ZZL A;  3MZH A;  2LVS A;  3VFZ A;  4AVP A;  4XID A;  3CUQ C;  1IUF A;  2DK8 A;  1FP1 D;  2LK2 A;  2LFB A;  3CJT B;  4DQ2 A;  3QP5 A;  4CCJ A;  3BCA A;  4I76 A;  4JX4 A;  2WAQ N;  2MLK A;  3OYJ A;  3H0D A;  2IVM A;  1OJL A;  3M8J A;  4OAZ A;  4RB3 C;  1ZR2 A;  3D5L A;  5IT3 A;  3LSG A;  1VQ9 I;  4AID A;  4DW6 A;  3BTL A;  2LKS A;  5LGT A;  1VND A;  3IWF A;  4ESB A;  2AXT C;  3VDX A;  4IZZ A;  1T2K A;  5HLT A;  1AOY A;  1S3J A;  2H94 A;  1ZGJ A;  2GLO A;  1HKT A;  3RYP A;  1YW9 A;  1Z3Y A;  1EF4 A;  2ELK A;  4A69 C;  2JN6 A;  3S93 A;  3OYA A;  1J7K A;  1X58 A;  3VSL A;  5JI6 A;  1V54 H;  4W97 A;  3H1C A;  2F2E A;  3BZ6 A;  2Z3Y A;  1FOW A;  3GF2 A;  2X6X A;  1JUM A;  3FDY A;  1JE8 A;  2CGP A;  2WAQ A;  2X6Y A;  5J6X A;  4IKF A;  5FO5 A;  4ASN A;  3NRV A;  2Z2S B;  4UV8 A;  2OTJ I;  2E7X A;  3JRH A;  3D1N I;  4UUV A;  4PJM A;  4A0Z A;  1IDZ A;  1EH7 A;  2LF7 A;  4BJ6 C;  1Y8R B;  5IP6 A;  1FIP A;  1J5Y A;  2J5O A;  2A69 F;  2ZNY A;  1HDD C;  2HYF A;  2M5W A;  5BQT A;  2E1O A;  4I6Z A;  3CUQ B;  3L2W A;  1K7A A;  2L01 A;  3HC7 A;  1T39 A;  1D0Z A;  3REO A;  3FHZ A;  2IXS A;  4KIS A;  4BUP A;  2WBM A;  5LGU A;  2YR2 A;  3OYE A;  1B72 A;  2UXN A;  3P9I A;  1JHH A;  3ZOB A;  5M5X J;  3ERM A;  1S5L C;  1B6A A;  2KIF A;  1XSX A;  2KQR A;  4C2M J;  2CQX A;  4MHG A;  3M4O J;  4ZYG A;  1XG1 A;  1J59 A;  4EV0 A;  2L7K A;  3N05 A;  3T0Y A;  1RKT A;  2CQK A;  4HRI A;  4ZDP A;  3IL2 A;  2H6B A;  3U2R A;  2M0C A;  4IXA A;  3LSM A;  2NS7 A;  3DEE A;  1OPC A;  1MDM A;  3PNV A;  3J81 K;  2HKX A;  3HRT A;  1WJC A;  2IS2 A;  2JPB A;  3B02 A;  2KP6 A;  2VOO A;  4ETS A;  3RKX A;  3VYS B;  4KIG A;  4B3A A;  3PSI A;  1GHC A;  2HQN A;  1FSE A;  3BR3 A;  3OYL A;  1ETO A;  2ID3 A;  2LRD A;  2VE9 A;  5M3F J;  5E17 F;  1T8I A;  3HEF A;  1ZG3 A;  5JHF A;  2JUG A;  2W00 A;  3I4P A;  3MVP A;  1YW8 A;  2NYX A;  3IAS 2;  1G3S A;  1NG6 A;  3OYF A;  3P9C A;  3K4B A;  5BMZ A;  3GZ6 A;  1ZYR F;  1EH8 A;  3WTV C;  2E7W A;  4ANJ A;  2H09 A;  3BR5 A;  3VB2 A;  3AFH A;  3HUG A;  3SFI A;  3F23 A;  3PNT A;  2Y2Z A;  1QHH D;  2E1N A;  3WU1 B;  3LAP A;  1TNS A;  1Y0U A;  4L5E A;  2EWN A;  1IXR C;  1O7L A;  5L3E A;  4CCM A;  3A0B C;  1XGN A;  4RAG A;  2XSJ C;  1R1V A;  1L3L A;  3BR2 A;  3MD2 A;  5E8I A;  2BEO A;  3TGN A;  1E0E A;  2MLG A;  1G8X A;  2QM3 A;  4D9J A;  2LMD A;  3P7N A;  1AKH B;  3T8R A;  3CCV I;  5BPD A;  2V1D A;  4MIM A;  3FXM A;  2BVL A;  1XCV A;  1MMG A;  1BW5 A;  4LFU A;  4E7K A;  4NQW A;  2F5E A;  3DLL F;  2WAD A;  3I55 I;  3E6B A;  2V1X A;  2EIN H;  1MSE C;  1T98 A;  3TW6 A;  4BU2 A;  4RAY A;  3V7S A;  3S8P A;  3TED A;  4Q48 A;  4H4K C;  3GTJ J;  2FBH A;  3PFI A;  4HX7 A;  4RB2 C;  1KGS A;  1R36 A;  2ZXW H;  3JAM K;  3I4N J;  1ZTR A;  2MAB A;  3R0A A;  2CO5 A;  1BOB A;  3NQO A;  4HZF A;  1LB2 A;  2DQL A;  1VQO I;  5E3M A;  2F5V A;  2OA4 A;  1J0R A;  2O8K A;  3FM3 A;  3B6A A;  3FIW A;  2ZXJ A;  3KP2 A;  5CQG A;  3WHC A;  5FLV A;  3ZQG A;  1U8B A;  4Y7N J;  4KMF A;  2MD5 A;  4XKV A;  2P5L C;  1Z05 A;  2RQP A;  4S0H B;  2W85 A;  1M1E B;  1DQU A;  5HOO A;  3ERE D;  3BCB A;  2LP0 A;  3W3C A;  4XNF A;  3O3K A;  3S3N A;  1LEA A;  4LMY A;  1QBJ A;  2Y0M A;  1YJN I;  4A93 J;  5DD8 A;  5K1Y A;  1ZQ3 P;  1W5C C;  3WTS C;  2FNP A;  2EJR A;  2XGC A;  4KNY A;  4A12 A;  2CQN A;  4LB5 A;  2E36 A;  6PAX A;  4BJ5 C;  3BR6 A;  1QNT A;  2VPL A;  2K9Q A;  1TWH J;  3LMM A;  3L2Q A;  2HTS A;  3GYH X;  2PX9 A;  4RBO A;  2QF7 A;  1MD0 A;  1U9N A;  2BXZ A;  2Y9Z A;  3FM5 A;  3CCU I;  1R22 A;  4U7D A;  4D0P A;  1W7P B;  5GAH J;  2IS6 A;  4BXF A;  3MQ0 A;  3TO6 A;  4CYC B;  2X48 A;  1SD4 A;  5CVJ A;  5IYB J;  3OS0 A;  1XN7 A;  1ONV A;  1TNT A;  2KMU A;  3WG7 H;  2GAU A;  4UUS B;  3WE2 A;  1AA7 A;  1FP2 A;  4U0Y A;  1A04 A;  3GEZ A;  3H3U A;  3AG2 H;  3EUK L;  4M9Z A;  3IV5 A;  4ZDL A;  4UUT A;  4A5M A;  1XMK A;  1MBF A;  4MGR A;  1LKX A;  3H0G J;  2RDP A;  1XSV A;  4I98 B;  3HXL A;  3A4C A;  2FA5 A;  2FMY A;  4RA2 A;  2M3A A;  3QRF F;  3GLX A;  2EV5 A;  5M3M J;  2B9S A;  1F4K A;  1VQ4 I;  1KU3 A;  1P7I A;  3DKX A;  1SMY F;  3JRD A;  2V6C A;  3KYD B;  5J3L A;  1YS7 A;  1BM9 A;  3L9F A;  4QLC U;  5L3C A;  3K2A A;  3OL3 A;  5CJ9 A;  3GFI A;  2PBI A;  3DU6 A;  4DYR A;  2R4G A;  3EQL F;  4JBA A;  1YIJ I;  2ISZ A;  1V3F A;  4IVN A;  3L2C A;  2GXA A;  3BTJ A;  2QSG X;  2EFW A;  3CJR B;  3KCC A;  4HDU A;  4DBR A;  3CF5 F;  4HOB A;  1HW2 A;  1UG2 A;  5DUK A;  5LRR A;  1TZL A;  1D8K A;  1QO0 D;  1Y1V J;  2A5W A;  4F55 A;  4E7H A;  3GWZ A;  2A5Y B;  3V7C A;  1ZHF A;  3ESW B;  2PMZ N;  4G6T B;  5DEQ A;  3B73 A;  3CUO A;  2V9K A;  2PMU A;  1YIO A;  3K4M A;  2GIZ A;  2W48 A;  3JRG A;  3CCQ I;  1NK3 P;  1LDJ A;  1L0O C;  2HXI A;  2QKL B;  1P6R A;  4XIC A;  1R5I D;  5B5E C;  2NNY A;  2W84 A;  3OL4 A;  3G3Z A;  4B43 A;  2KIU A;  3RSN A;  1LPQ A;  3C3W A;  5DM7 F;  2PJP A;  1D8J A;  2OV7 A;  2VB6 A;  2MBF A;  4ABZ A;  3EYI A;  4XRS G;  1XS9 A;  1YJW I;  2ZME A;  1JT0 A;  5F04 A;  1YJ9 I;  1VQ7 I;  4XKW A;  3ABM H;  5KK1 A;  4ESJ A;  1YE9 A;  1R4M B;  3S32 A;  4EJV A;  4RMN A;  4WX9 A;  2OQR A;  5B66 C;  4HSR A;  2DOF A;  1UZC A;  3M07 A;  2VON A;  3GTM J;  4BDY A;  1OYW A;  4P1W A;  1KU2 A;  2NS8 A;  1P92 A;  3IKV A;  1BI1 A;  3DF8 A;  3WTZ A;  5ILU A;  1MKM A;  3K9T A;  2ELH A;  3QP6 A;  2IRF G;  1ETV A;  3GFL A;  4NC8 A;  1G3Y A;  3CCY A;  4Z6Y A;  5EEG A;  4M3E A;  2Y9Y A;  3IUO A;  2LBF A;  2A6T A;  2NRA C;  1NH3 A;  2YU9 J;  3WTT C;  1MMA A;  2STT A;  3GO5 A;  3SDG A;  3WTW C;  4EGY A;  1MZB A;  4E7J A;  2IGO A;  3DKY A;  4A3G J;  1MJA A;  5ICG A;  2WTE A;  2DT7 B;  3ZRG A;  4EAT A;  1U2W A;  2VOD A;  2QVO A;  3OYG A;  3KYL A;  1TQP A;  1VQK I;  3OOU A;  1WJB A;  1IN6 A;  2V4J C;  4L9T A;  1ODD A;  3FMR A;  5KNL A;  4KYW A;  3RPU D;  4CCL A;  4DOZ A;  3BRO A;  3FZV A;  2XKO A;  1F36 A;  4BXU A;  3I53 A;  2R7Q A;  1PP7 U;  2JTV A;  3RZD J;  1X4O A;  2E1M C;  3NWS A;  4NC6 A;  1B1B A;  3IRR A;  5GAG J;  5H6R A;  1LDD A;  1SC7 A;  3IRQ A;  1U9O A;  4U87 A;  3MWM A;  1FTT A;  4HX4 A;  3V7R A;  5CQE A;  4L0Z B;  5M5Y J;  3ZCO A;  3LAJ A;  2P6S A;  2ZCW A;  1B9N A;  3TDZ C;  3KP7 A;  3E6C C;  4ITV A;  1ZRF A;  4HNU A;  2K9S A;  3K70 C;  1QPM A;  2X6O A;  3L7W A;  1X1B A;  1SVL A;  1WJD A;  3HZJ A;  3GZ5 A;  3OOP A;  2O03 A;  2P81 A;  3WGH A;  3RQ4 A;  2E34 A;  4II2 A;  3CO7 C;  2DK5 A;  4FET A;  2E60 A;  2R0Q C;  2E1C A;  2XRN A;  4AIH A;  4HYE A;  4JQF A;  2R7S A;  3LA7 A;  1ZH5 A;  3A1Y A;  3E6M A;  5GAD J;  3H9G A;  5GTI C;  5D4R A;  5FKN A;  4OIN F;  3WGI A;  1FWZ A;  5DM6 F;  2STW A;  1A6Q A;  2DFE A;  5HDG A;  3WU2 C;  1IW7 F;  4H0E A;  3DFG A;  2XAH A;  2PQ8 A;  3HPH A;  3OR2 C;  4N4O B;  3KEY A;  4IOA F;  1R7J A;  4LB6 B;  1T0F A;  1A36 A;  3PUB A;  4MFD A;  5DTD A;  2BOL A;  4L9V A;  3DP7 A;  5GTH C;  4KA4 A;  5DD4 A;  4UVB A;  3TO9 A;  2R7F A;  2CV2 A;  4X6A J;  3F3X A;  2W24 A;  2IS1 A;  5FJ8 J;  5K7F A;  2LLK A;  4YIF A;  3HOZ J;  2Q2E A;  1QZE A;  1MBJ A;  2IGM A;  1RUO A;  3G71 I;  2F6C A;  2OQG A;  4M73 A;  5E3L A;  5JLW A;  5FKO A;  3CF2 A;  1BI3 A;  2ADU A;  2V1U A;  2DQR A;  5H2F C;  1OR7 A;  3J7Y J;  3GCM A;  1BI0 A;  2EFQ A;  5L3F A;  1W1W E;  4I99 C;  5EG0 B;  4DZP A;  3DTI A;  1N77 A;  2M8G X;  3R61 A;  3ZN1 A;  4CA0 A;  3ELK A;  2A07 F;  3RCO A;  3T5X A;  4FTH A;  3H36 A;  4KN4 X;  3BDD A;  2UWM A;  3CZ6 A;  1MNE A;  1N75 A;  4BDZ A;  4N9I A;  5E18 F;  1J09 A;  5FFZ A;  3V4G A;  3BG5 A;  2W7N A;  1UG0 A;  3VYT B;  2JRM A;  2XV4 S;  2ESN A;  2TCT A;  2BY3 A;  3BT9 A;  1FBU A;  4XLH A;  3G1M A;  1ZR4 A;  1SD6 A;  3ZQ7 A;  2JVH A;  3BPV A;  2HQ5 A;  5HVQ C;  2FE3 A;  4EM1 A;  2YX4 A;  5F0F A;  1V5E A;  4WK8 F;  1S6L A;  1E3H A;  1FPQ A;  1Z6R A;  1SD7 A;  2CUZ A;  2K40 A;  3I3L A;  5J40 A;  2K4J A;  3S15 J;  2GXB A;  1HXD A;  2GXG A;  4HQM A;  1Z67 A;  3QU3 A;  1GVD A;  4ZYH A;  2BXY A;  2DFH A;  3V8J A;  3PQJ A;  3FXJ A;  3KET A;  1NTC A;  3AAF A;  2CUF A;  3TW7 A;  1DU6 A;  1MSF C;  4WXD A;  2PJR B;  3W2W A;  1X3W B;  2EZL A;  4XKC A;  2M87 A;  4HV5 A;  2CUE A;  1IRG A;  3HBL A;  4AM3 A;  4KJZ A;  4XSX F;  3ZMZ A;  3BQZ A;  1R5H A;  3DPT A;  3H9J A;  2HNH A;  3FBI B;  1IUY A;  5HDK A;  1ULY A;  1XD7 A;  2F48 A;  4I0B A;  5BNG A;  4KIB A;  1P4A A;  3LSH A;  2JWT A;  3HTS B;  1DPU A;  1FLI A;  1GLN A;  4D1Q A;  1J2X A;  3IWZ A;  2EQR A;  3S16 J;  1JKP C;  2NVT J;  3QYF A;  4LOC A;  1B8I A;  1I39 A;  3I59 B;  3AG3 H;  3CMY A;  5EF6 A;  4D5F A;  1XDU A;  1IO2 A;  4FT8 A;  3CME I;  4HLX A;  3R4K A;  3G1L A;  2M34 A;  1VTN C;  3MKW B;  3CCS I;  2XDV A;  1JKO C;  3FBN B;  3E5X A;  2PN6 A;  1XMA A;  2V9P A;  2DBB A;  5J8F A;  1R71 A;  2Z9O A;  2VUM J;  1X2N A;  4E7S A;  1GDT A;  4DBQ A;  2TRT A;  1ENH A;  2B0L A;  1FMW A;  2BZT A;  3OMY A;  3DQV C;  2MC4 A;  1Z7U A;  5A2Q K;  1HKQ A;  2FXA A;  1FT9 A;  4NUB A;  3SYT A;  2ZC2 A;  3TOA A;  1XGS A;  1G4D A;  1SD5 A;  3OYN A;  2KHM A;  2H6C A;  1O3T A;  5HLH A;  4XLN F;  4BHC A;  1Z91 A;  4RGR A;  3C2H A;  1Z0X A;  5CKT A;  1QPI A;  2JA2 A;  1LQ1 A;  2XF7 A;  2H8R A;  1IC8 A;  2DPD A;  1D3Y A;  5JVG F;  1Z6T A;  4M3D A;  5ICC A;  3K4L A;  1ETW A;  3HGG A;  2BY0 A;  3GTL J;  3MKZ A;  2HKO A;  2K3F A;  2BV6 A;  4XM3 A;  1CF7 A;  3OYC A;  2QQA A;  1NG7 A;  4L5I A;  2DN0 A;  3WGG A;  2D45 A;  5FD5 A;  2DDA A;  4RLQ A;  3SJM A;  4F52 A;  5F1J A;  5LHH A;  4OIP F;  2WC2 A;  2JA5 J;  4P96 A;  1I1G A;  1Q1H A;  3BR1 A;  4IF4 A;  2NVU B;  1B4A A;  5FLM J;  2GQQ A;  3CC2 I;  1TQM A;  2MG4 A;  2OCE A;  2P8T A;  3TDU C;  4P5O A;  2IAI A;  3ZMS A;  3LST A;  4EMS A;  3FXL A;  3CD6 I;  1MMN A;  3JRB A;  1VQM I;  3O6B B;  2ELJ A;  3Q0V A;  5L3G A;  3K4J A;  3BJ6 A;  5FGM A;  3S1M J;  2ETH A;  2R92 J;  3KYC B;  3HRS A;  2FRH A;  3F8B A;  1HQC A;  5LRS A;  2X9D A;  2XGE A;  1ETY A;  4L9J A;  2CFX A;  4XKB A;  2FQ4 A;  2BW3 A;  1W5T A;  5KHD A;  5E3N A;  1WVR A;  2K7L A;  4IHS A;  5E1X A;  4Z2Y A;  1DDN A;  1P2F A;  2WA0 A;  3I56 I;  4YFK F;  1QU3 A;  1TBX A;  2ICW G;  2Z5U A;  4QPQ A;  2XRO A;  1W0T A;  1BIB A;  4PSX A;  3UKG A;  1A5J A;  3ZN0 A;  2WY7 Q;  2HDD A;  4S04 A;  4IJA A;  5FLX Z;  3TO7 A;  1K4T A;  1BJZ A;  4PDK A;  2F4I A;  2WB1 N;  4LK1 F;  3TP3 A;  2Z16 A;  4W1U A;  5HLG A;  5DYM A;  2E1M B;  5IT9 Z;  2VXD A;  1R00 A;  2W1O A;  4CXF A;  4A3D J;  2EH3 A;  2RNJ A;  2LYC A;  1U5T A;  3DEW A;  2XSD C;  3ZMU A;  3LSK A;  1TL8 A;  4OIR F;  5D5W B;  3P9K A;  3HB9 A;  3MAJ A;  5CLS A;  3WTU C;  2R7X A;  3KZY A;  3JSO A;  4IHY A;  4BBS J;  2JMW A;  1FYM A;  2WWY A;  4MQ9 F;  4B3X A;  3I64 A;  1JTX A;  1O3R A;  4RAZ A;  2LF8 A;  4A0Y A;  5F6F A;  2H1K A;  3H3Z A;  4Y3O A;  3OYB A;  2DA5 A;  4OOI A;  4QPO A;  3AL0 B;  4C3J J;  3K1P A;  3S3M A;  4Y52 J;  1OR7 C;  3HOV J;  2EZH A;  2L7M P;  3R60 A;  5KAI C;  2QCO A;  2B7E A;  3ASN H;  2NOJ B;  1JKQ C;  4BH9 A;  5C4X J;  4ZH4 F;  2VT3 A;  2EB7 A;  1TLH B;  3DLA A;  5LHI A;  2R7T A;  4IEJ A;  1FBS A;  4N4N B;  3QOD A;  4YEL A;  1RR7 A;  4YRV A;  2HVS A;  4HPQ A;  2HTJ A;  1J9I A;  3HHG A;  2RQQ A;  4RGS A;  1Z9C A;  1TC3 C;  1OCP A;  3E5Q A;  3RDI A;  1WKM A;  5F1R A;  3RPU A;  4G6Q A;  2R93 J;  3A0H C;  3BLY A;  5HS7 A;  2CG4 A;  3A01 B;  4E7I A;  2KT0 A;  2F5D A;  3HSE A;  4ZTJ A;  1YLF A;  4M3F A;  3I71 A;  1R5G A;  9ANT A;  2DO7 A;  1OQY A;  3BG6 A;  3FXR A;  4KIT B;  3S3O A;  1TTY A;  4XRS A;  1RUN A;  1RC9 A;  1F5T A;  4C2U A;  3G1O A;  4YII A;  5CVU A;  3GTG J;  5J1Y A;  3VOD A;  1GT0 C;  2Y0S N;  1WJF A;  5E79 C;  4MNU A;  1O7F A;  5FB2 A;  5D5V B;  4HST A;  2LH9 A;  2LKP A;  1DP3 A;  2RVC A;  1H0M A;  3F72 A;  2XVC A;  1TT0 A;  2L0K A;  4WWC A;  4CO8 A;  4IPA A;  1POG A;  3DXJ F;  5DS9 A;  3F8C A;  1D1C A;  1WHU A;  3IHU A;  3KZZ A;  2O0Y A;  4F91 B;  3KEO A;  3ZQF A;  3PL8 A;  4M6V A;  1RR8 C;  4ENK A;  1LE8 B;  1ERD A;  2MFZ A;  1BI2 A;  1IXC A;  5F64 A;  4E70 A;  2K85 A;  2DA4 A;  1WSU A;  2M4K A;  2MC3 A;  5F27 A;  4BEH B;  5J4Y A;  1D0X A;  3FXQ A;  3GX4 X;  3QU6 A;  2E35 A;  2JA7 J;  3S14 J;  2OCC H;  2QYO A;  5JHU A;  1MNM C;  4NHJ A;  3W6J B;  2R7D A;  2D5V A;  2QQB A;  4BBR J;  4LLG F;  4LG0 B;  3HSF A;  1TW2 A;  3D5R C;  2LTP A;  3Q5F A;  3E6D A;  3KZI C;  2XAQ A;  4KN7 X;  2VQG A;  2LY1 A;  3IC7 A;  1WJ5 A;  1UHM A;  1PDN C;  5GP9 A;  3FXU A;  1WI9 A;  4BAY A;  5KVR A;  2HR3 A;  2JVG A;  1S7E A;  1LVK A;  1JJ6 C;  4PJN A;  3OIQ A;  2OUM A;  3D5S C;  3MEX A;  1LJ9 A;  4R8H A;  2EA4 A;  1N78 A;  2A68 F;  3PNY A;  5D8L B;  1LEB A;  2L54 A;  4MFE A;  4UY8 I;  2KIQ A;  2LR8 A;  2QSF X;  3PJR A;  3IH3 A;  5F0H A;  5FKM A;  5C3E J;  3Q9V A;  4BNC A;  3F8M A;  2IP2 A;  4AYB N;  4JX5 A;  3CLQ A;  4OWR B;  4U0V A;  1ZLJ A;  4AU7 A;  2IW5 A;  5K5O A;  2LY2 A;  2FBI A;  1Z7L A;  5TGT A;  3PSF A;  2RRE A;  3RIR A;  4FE4 A;  2EIM H;  1VI0 A;  4XRM A;  1ZGW A;  2KDO A;  2QBY B;  4DJA A;  1SVO A;  2XAG A;  3WU0 A;  1UCR A;  1HST A;  5TJJ A;  2VLA A;  3SZT A;  4X1E A;  2CFO A;  2F5C A;  2GWR A;  2LC2 A;  4A2U A;  3LFU A;  5EGO A;  2QEX I;  1B9M A;  3MZY A;  2HPI A;  3DBR B;  2L7F P;  1BR1 A;  3O8H A;  3IKT A;  1VFC A;  2JT1 A;  1UHS A;  1JGS A;  3HOS A;  2IGN A;  3H3V K;  4IHX A;  1RNL A;  2CRG A;  3J80 K;  1H89 C;  2HOS A;  2HOT A;  1BOA A;  1JI8 A;  4YFN F;  2K02 A;  3VYU B;  1LVA A;  3O2P E;  3I0T A;  5J1U A;  3R6S A;  2P5K A;  5BPI A;  1Z21 A;  4EJT A;  3MFK A;  4ENN A;  5HS8 A;  3FK6 A;  2R5Y B;  3CCM I;  2R3S A;  2A3S A;  3PO2 J;  4FX0 A;  3EPZ A;  1R4N B;  1XGM A;  2H1L A;  1S9H A;  2HZT A;  5CVR A;  2Y30 A;  4PGH A;  4IRH A;  3O8G A;  4P9F A;  5GPA A;  5FRM A;  3ABK H;  1WRJ A;  4PGG A;  2UXX A;  1ACI A;  2D2W A;  1UAA A;  1DUX C;  2KJC A;  2KFD A;  1X1A A;  3Q0W A;  3BZK A;  4EM0 B;  4AIK A;  4LK0 F;  3DPU A;  4UHT A;  4JOM A;  3DCF A;  1BR2 A;  3HG9 A;  2TDX A;  1SFE A;  4J00 A;  3D0S A;  2DW4 A;  2G7U A;  1APL C;  1E3P A;  4RGU A;  2HGC A;  3L00 A;  4B4C A;  3CDL A;  1FTZ A;  4XON A;  5IY5 H;  3TKY A;  1FC3 A;  3HIF A;  2EZI A;  1ETQ A;  1GVJ A;  3BY6 A;  2R5Y A;  2YSR A;  5KCM A;  1DPR A;  4EJU A;  4BY7 J;  4GRI A;  1F43 A;  3CCL I;  3HPG A;  2ZJP F;  2M9H A;  1ZG5 A;  4CZC A;  3HL2 A;  4ZTF A;  3HRU A;  5EYR A;  4CCN A;  3PIP F;  3OSF A;  2NXN B;  2EFP A;  4PSW A;  5K7Z A;  2NAZ A;  2M7B A;  2XKP A;  4UV9 A;  2Y48 A;  3EUH C;  1LUJ B;  3GBG A;  4JYK A;  2FQ3 A;  2Y69 H;  4C3I J;  4CYC A;  2DMT A;  3CCR I;  3Q9S A;  3JRC A;  1O57 A;  1W7P A;  3W6K B;  3SFZ A;  3N4M A;  2CUJ A;  3NEU A;  1VZ0 A;  3OIP A;  3A2K A;  5EEH A;  2ZJ2 A;  3J7A Y;  3HDD A;  4RB1 A;  3RKQ A;  2HQR A;  4FAS D;  4PCQ A;  4QSH A;  1MMS A;  3HM5 A;  2IA1 A;  3ZMD A;  4BJT A;  3S1R J;  1WI3 A;  2XGD A;  3KP4 A;  3JRE A;  2RC4 A;  2P0W A;  3JW4 A;  2MYS A;  4L9N A;  5LHG A;  3ECH A;  2Z33 A;  4GDF A;  4M9X A;  1WFX A;  3S2H J;  2XC7 A;  5IOZ A;  2EIK H;  2QEN A;  2V79 A;  2IGK A;  4GCV A;  1IAW A;  5EG0 A;  4IRG A;  2DT6 A;  2GBY A;  4F3Q A;  1I6H J;  1D5V A;  2CW7 A;  1IRX A;  4EQQ A;  2X6W A;  2MH2 A;  1FYL A;  4BE2 A;  3IP4 B;  1Y1W J;  1VQ8 I;  2XUB A;  3LWF A;  1YIT I;  4A3L J;  1IRZ A;  2GM4 A;  3HYI A;  2CV0 A;  2Z99 A;  2ECC A;  4PJJ A;  2R5Z A;  1OCC H;  1OCR H;  2RN7 A;  1PP8 F;  3OSG A;  2F4M B;  4Q47 A;  3FIS A;  4YIR X;  4ENJ A;  2XHK A;  4Q4Z F;  2Q8K A;  2FBK A;  1PUF A;  3A02 A;  1SFU A;  1DU0 A;  4C30 A;  2XPW A;  5FFX A;  2FJ1 A;  3ZMV A;  3ZQC A;  2ZKZ A;  1G2H A;  2JPC A;  1RZ4 A;  1K6Y A;  1MJ9 A;  1MBH A;  2GIV A;  3LNQ A;  3AG4 H;  3OYK A;  2KRF A;  1F9N A;  1E3O C;  1K78 B;  1TWC J;  2BBY A;  4U0W A;  1HW1 A;  3W6V A;  4Y13 A;  1OYY A;  1T33 A;  2A05 A;  2OD5 A;  1QGP A;  3KFW X;  1Y0N A;  3KPH A;  3CTA A;  3GTO J;  4K2E A;  2Y0S A;  3TBI A;  2LY9 A;  4TV7 A;  1B8I B;  2CU7 A;  4YG2 F;  2QBY A;  1RPW A;  4LD5 A;  2N8G A;  2CW8 A;  3VWB A;  1TWA J;  2GZW A;  4MTD A;  3CCE I;  2XB5 A;  4PZJ A;  3ULQ B;  3CJQ B;  5IYD J;  3LA2 A;  3GZN B;  3F8F A;  4IL6 C;  2FX0 A;  5IOY A;  3F22 A;  4LIT A;  1W5S A;  2VKH A;  5FKK A;  2DAO A;  2JK3 A;  1E2X A;  1ZG1 A;  2HPM A;  3U1D A;  3DEU A;  3CDI A;  1YI2 I;  3RZO J;  4XLE A;  5ED4 A;  1YYV A;  2XB0 X;  3E3V A;  4O5V A;  3AKZ A;  1XPX A;  1WGX A;  2HS5 A;  5BOX A;  4EJO A;  2VBY A;  4PJL A;  1BR4 A;  2EV0 A;  4F93 B;  4PUS A;  4OIQ F;  3SZP A;  2IA0 A;  3OYI A;  3GXO A;  1AU7 A;  4XLP F;  3H5R A;  3BR0 A;  2X51 A;  2FML A;  4LG0 A;  4EEF G;  5JVT A;  2VQH A;  1JUP A;  2ISY A;  1BW6 A;  4BQO A;  3JRI A;  4G7O F;  4XLC A;  1KON A;  5L3B A;  3JTG A;  1LFU P;  1G6N A;  4BQQ A;  5IP9 J;  1QVT A;  2QZ8 A;  2PI0 A;  2LBF B;  5J4V A;  3L2V A;  1EKE A;  2X1C A;  1S72 I;  3J7Z I;  2QKM B;  3ZQQ A;  2FOK A;  3HJE A;  1U8R A;  1A31 A;  5DCF A;  2X85 A;  4C3H J;  3EUA A;  5FKL A;  2ZB9 A;  5DV5 A;  3SQN A;  3F9K A;  4E4H A;  3R0J A;  1Y56 A;  4LLN A;  4Y17 A;  1FJL A;  2BY2 A;  2EFN A;  2FF4 A;  5BS6 A;  4L18 B;  4RAF A;  4R79 A;  3AG1 H;  2QWW A;  2COM A;  2L9S A;  1DP7 P;  2WB1 A;  4DGW B;  2C6Y A;  2BVM A;  2W4S A;  3RTR A;  2QA4 I;  2DTZ A;  2DFI A;  2VBZ A;  1O3S A;  1HKS A;  2DI3 A;  1U5T B;  2Q0O A;  2K9L A;  5EZH A;  3Q0U A;  2HVR A;  1A6I A;  2EPF A;  4CCK A;  1V5F A;  1HDP A;  2CQ7 A;  2DT5 A;  3ISP A;  1ETK A;  3N97 A;  1Q1V A;  1MJB A;  2RV8 A;  1R23 A;  4G7H F;  2COB A;  4IRI A;  3IAM 2;  4RGX A;  3A01 A;  2KPM A;  2UUZ A;  4B1R A;  4LGW A;  3LSI A;  3U9G A;  3C2G A;  5F0C A;  4XSZ F;  3E0J B;  2DJN A;  4CUG A;  2FSW A;  1YX5 A;  2LNB A;  3BTI A;  5LGN A;  3L2R A;  1X4P A;  4I2O A;  5CVI A;  1OKR A;  3ABL H;  1W36 D;  4L0Y B;  2G0E A;  4R1H A;  1D1B A;  3LSJ A;  4XOR A;  2CJJ A;  1LDK B;  4Y33 A;  4C2T A;  1ZRC A;  1XGO A;  5ICF A;  3LL7 A;  3V8K A;  4UB6 C;  4KFC A;  3BC8 A;  2X1D A;  2VJ5 A;  3S1N J;  1Z3X A;  5EZG A;  4BHP A;  1BC8 C;  3LFK A;  1J75 A;  2BY1 A;  2G7H A;  1PVE A;  3S17 J;  1I5Z A;  4I01 A;  1HLV A;  1FOX A;  2CW0 F;  4IX7 A;  2O7O A;  4XRF A;  4I7H A;  4HF0 A;  4BXX J;  1TQI A;  5HNF A;  3QPL A;  3IH4 A;  5ILS A;  4MEX F;  2KKO A;  2VC1 A;  2WAE A;  4LLL A;  2M45 A;  2QLZ A;  2YPR A;  5IPA A;  1SFK A;  3QPH A;  2HEO A;  5HOD A;  3HOW J;  2JSC A;  1YW7 A;  3SEZ A;  2XAS A;  2PG4 A;  1XC5 A;  2L5Q A;  2DTR A;  4BYY A;  4GXO A;  1STZ A;  1LFB A;  2EBI A;  5L3D A;  2DCE A;  4FE7 A;  2ZJQ F;  3U1K A;  1QZZ A;  2OAZ A;  4F92 B;  4M72 A;  1ETX A;  1V55 H;  4QWQ A;  3M1C A;  4XBF A;  1I6X A;  1SMT A;  2EIL H;  1MIJ A;  3GTP J;  4HF1 A;  2M8E A;  4GYI A;  2DA3 A;  4HLY A;  2LRE A;  4HA8 A;  3I5U A;  1P4W A;  3KLN A;  4CZZ A;  3RI4 A;  2RAE A;  2JRT A;  2HFH A;  3FHN A;  1X1P A;  2JZY A;  2Y75 A;  4XLA A;  3MZ8 A;  1O4X A;  2R5Z B;  3GW2 A;  2EV6 A;  1X3Z B;  2XRL A;  3BQY A;  3BJO A;  3K4C A;  4M6X A;  2CSO A;  4MO7 A;  1YO5 C;  4XN0 A;  2HDW A;  1MMD A;  4N9H A;  1FY7 A;  3PM1 A;  1IN4 A;  3LQQ A;  1SAN A;  3M1E A;  5FD6 A;  2EA2 A;  2O5R A;  5HLI A;  3P5J A;  1XCB A;  1X3U A;  3F0C A;  3CP8 A;  3LA3 A;  2V7F A;  2WY8 Q;  1IF1 A;  4G12 A;  2F4O B;  4I02 A;  1QRY A;  4RDU A;  2FU4 A;  3MKL A;  1RIO H;  3KE2 A;  3LQR A;  2PFB A;  2LG4 A;  1ORK A;  3S1Q J;  2GA1 A;  4FCY A;  4XMY A;  2K27 A;  1BJA A;  2NOG A;  3VOE A;  3ZPL A;  4JX6 A;  2QGU A;  3K69 A;  1BIA A;  4HX8 A;  4I09 A;  4FX4 A;  1OLT A;  1EA3 A;  2VT2 A;  1KU7 A;  1WH7 A;  1ZN2 A;  2CYY A;  2K5C A;  3DPL C;  4G94 A;  1QZY A;  2P7C B;  2I10 A;  3KP3 A;  1KYW A;  4YFX F;  2L9N A;  2RKH A;  4AYB A;  5K7H A;  1LE8 A;  2PLY A;  1FX7 A;  3DKW A;  1YHQ I;  3FMS A;  1S7A A;  2XPV A;  2YUS A;  3JSP A;  3KP6 A;  2MSY A;  3BZC A;  4PFO A;  3SDB A;  2XF5 A;  3K70 D;  2BHZ A;  4CH7 A;  1REP C;  5ICE A;  2GA2 A;  4BAC A;  2XGX A;  2ESH A;  3CC4 I;  4GFB A;  2ID6 A;  2IPQ X;  5B1B H;  4BS9 A; 
#chains in the Genus database with same CATH homology
 1FSH A;  3JAM Z;  4MQV A;  1KYZ A;  2VOP A;  5E8G A;  5D8K B;  1R1T A;  4KIC A;  5A2Q Z;  1W4M A;  2HWV A;  2CWE A;  5AIQ A;  1KU9 A;  1V4R A;  1ZLK A;  1C0W A;  3PQK A;  1IN8 A;  3GFM A;  1P4X A;  4L5J A;  4OU0 A;  4OMY A;  4B8X A;  2A6H F;  4KT5 C;  1SFX A;  3F6V A;  2EFO A;  4HF2 A;  2IA2 A;  4O3M A;  4A6D A;  5J8C A;  1T38 A;  1EH6 A;  4RB0 A;  4N0B A;  4KMU X;  4BQA A;  4MEY F;  2MH9 A;  4FHT A;  1TW3 A;  2QQ9 A;  4BHB A;  3HRM A;  4IHT A;  3BWG A;  1IZ1 A;  4AIJ A;  3HTU A;  5AIP A;  3J81 Z;  4AD9 A;  2KIM A;  2DPU A;  4G7Z F;  4UVA A;  2D1H A;  5FLX K;  1AWC A;  4U88 A;  2VN2 A;  2ZNZ A;  4G9Y A;  2W57 A;  2HYG D;  3CUQ A;  1I27 A;  5D4S A;  1O3Q A;  5HDN A;  2QUF A;  2J5P A;  1K6O A;  4EVI A;  3RKY A;  2AS5 F;  1QQI A;  3EYY A;  3C18 A;  1MGT A;  2VBX A;  4NB5 A;  1IXS B;  2K4B A;  4JK1 X;  1UST A;  3WE3 A;  1B59 A;  1MDM B;  1FYK A;  2UZK A;  2O8X A;  2PMH A;  2O3F A;  1U3E M;  1RI7 A;  3ZP5 A;  3GFJ A;  3VEP A;  4WXC A;  2IJL A;  2EK5 A;  3ABT A;  2NNN A;  4KIF A;  1UB9 A;  2F5F A;  2DU9 A;  3GUD A;  1YS6 A;  2OU2 A;  2YU3 A;  4HBL A;  2DLL A;  4CYD A;  5K5Q A;  3I58 A;  1K78 A;  3BPX A;  3BJA A;  5ILV A;  2ZFW A;  3ABU A;  1G3W A;  5DDG A;  1KQ8 A;  2ZBK A;  2VBW A;  4A0X A;  1HSJ A;  3WTX C;  4ZYE A;  3GVA A;  2IT0 A;  5CVV A;  3WG9 A;  3I54 A;  4UXN A;  3M8E A;  2XAF A;  4Q5S F;  2M1B A;  4CGZ A;  2P5V A;  2LSO A;  3E97 A;  4CHU A;  1BBY A;  3EET A;  1GXQ A;  4ZYD A;  1K79 A;  2O61 A;  1FZP B;  2XIG A;  5ERI A;  4MTE A;  4P9U A;  2ZO4 A;  1YQA A;  3C7J A;  2M30 A;  4WXH A;  5AON A;  1OMI A;  2L02 A;  5DCM B;  4KDP A;  3RKW A;  3RPQ A;  4EJW A;  3E5U A;  2H27 A;  2P6T A;  1FBQ A;  1G3T A;  4EM2 A;  3TOB A;  3QPT A;  4GO1 A;  5CYV A;  4F7Z A;  1HW5 A;  3COA C;  1H9G A;  1LNW A;  4M71 A;  2ZME B;  3MCZ A;  2VE8 A;  1JXS A;  3FF5 A;  2K86 A;  3RJP A;  1I1S A;  1UHW A;  1OYI A;  2HOE A;  3F6O A;  3ECO A;  2NS0 A;  5D6F A;  3M9A A;  5LEJ A;  1GXP A;  4P55 A;  4UVC A;  4G8X A;  1NHA A;  3BOQ A;  3QOP A;  1ON2 A;  3OV8 A;  3ZMT A;  3G73 A;  3QAH A;  1UFM A;  4A6E A;  3J80 Z;  4WCG A;  4ENM A;  1KQ9 A;  4WF2 A;  2P4W A;  2X4H A;  1CF7 B;  1S29 A;  1XDS A;  3J7A O;  3ML6 A;  2PEX A;  5LEK A;  1F1Z A;  4I0A A;  2L3D A;  3S2W A;  4Y15 A;  4M9S A;  5E1Z B;  1USS A;  3M8F A;  4ON0 A;  2HDC A;  2OZU A;  4B09 A;  5K5R A;  4OMZ A;  1ZAO A;  1HBX G;  5D5X B;  1CGP A;  4CIC A;  5DUI A;  2ACJ A;  5H20 A;  1S7O A;  4OIO F;  2G9W A;  4HDV A;  3WOD F;  2MA3 A;  1IN7 A;  5D5U B;  4KUM A;  4EGZ A;  1YTY A;  3CLO A;  1KA8 A;  4M6Y A;  3F21 A;  1R1U A;  1YFH A;  2L4M A;  3I59 A;  2A6E F;  1ZGA A;  5D6E A;  1T6S A;  2AXL A;  2VXZ A;  1PUE E;  3HSR A;  3C1D A;  5H6Q A;  4GGG A;  2FEZ A;  5LLQ A;  1WWX A;  3JTH A;  4GYG A;  1XSD A;  3K2Z A;  3KEQ A;  1S8N A;  4S05 A;  4HQE A;  3CO6 C;  3EUH A;  2L4A A;  2OBP A;  1EV7 A;  3CJN A;  1IRF A;  4HAM A;  4ZZD A;  4M74 A;  3BP8 A;  5E1W A;  2A61 A;  3T8T A;  1WQ2 A;  3FWE A;  3SXY A;  3HHH A;  5E20 A;  3SHF A;  2BYV E;  2LDU A;  1FOK A;  3TQN A;  2KJB A;  3FMQ A;  1ON1 A;  2V9V A;  1U5T C;  4G6D A;  3K1N A;  5HS9 A;  4HW0 A;  2RGV A;  3T1B A;  1U6G A;  3EDP A;  3CDH A;  3V8L A;  1ZRD A;  2WV0 A;  4UNO A;  2BGC A;  1H9T A;  3WTY C;  2W25 A;  1IN5 A;  2P7V B;  3M7G A;  2D1V A;  5JFR A;  3F8N A;  3L09 A;  2YX7 A;  3HOT A;  2VC0 A;  5TRD A;  3KLO A;  1YG2 A;  4A5N A;  5IT9 K;  3DV8 A;  3FX3 A;  3K1M A;  1JHF A;  3RYR A;  2X0L A;  4LJZ F;  1FNN A;  1Z1D A;  1BC7 C;  2OZ6 A;  1BN5 A;  1W7P D;  2XAJ A;  1R58 A;  4U7B A;  4O6J A;  1XB4 A;  4DNC A;  3ROU A;  2BE5 F;  5LBQ A;  3K0L A;  4CDG A;  2FNA A;  4HV6 A;  1E17 A;  3KP5 A;  5JR3 A;  3H92 A;  2O6G E;  1ZRE A;  4AWX B;  1ZAR A;  1U78 A;  1KQ0 A;  4RS8 A;  5DCM A;  4ESF A;  1SAX A;  4ZZL A;  3MZH A;  3VFZ A;  4AVP A;  3CUQ C;  2DK8 A;  1FP1 D;  4DQ2 A;  3QP5 A;  2MLK A;  2IVM A;  4RB3 C;  3D5L A;  5IT3 A;  5LGT A;  3IWF A;  4ESB A;  1T2K A;  1AOY A;  1S3J A;  2H94 A;  1ZGJ A;  1HKT A;  3RYP A;  1YW9 A;  1J7K A;  5JI6 A;  2F2E A;  3BZ6 A;  2Z3Y A;  3GF2 A;  1JE8 A;  2CGP A;  5J6X A;  5FO5 A;  4ASN A;  3NRV A;  4UV8 A;  2E7X A;  4UUV A;  4A0Z A;  1EH7 A;  2LF7 A;  1J5Y A;  2J5O A;  2A69 F;  2ZNY A;  2HYF A;  2M5W A;  5BQT A;  3CUQ B;  1K7A A;  2L01 A;  1T39 A;  3REO A;  3FHZ A;  5LGU A;  2YR2 A;  2UXN A;  3P9I A;  1JHH A;  1B6A A;  2KIF A;  1XSX A;  4MHG A;  4ZYG A;  1J59 A;  4EV0 A;  3T0Y A;  2CQK A;  3IL2 A;  2H6B A;  3U2R A;  4IXA A;  1OPC A;  1MDM A;  3J81 K;  2HKX A;  3HRT A;  2JPB A;  3B02 A;  2VOO A;  4ETS A;  3RKX A;  4KIG A;  1GHC A;  2HQN A;  1FSE A;  2VE9 A;  5E17 F;  1ZG3 A;  3I4P A;  1YW8 A;  2NYX A;  1G3S A;  3P9C A;  5BMZ A;  3GZ6 A;  1ZYR F;  1EH8 A;  3WTV C;  2E7W A;  2H09 A;  3VB2 A;  3HUG A;  3F23 A;  3WU1 B;  2E1N A;  3LAP A;  1TNS A;  1Y0U A;  2EWN A;  1IXR C;  1O7L A;  5L3E A;  1XGN A;  1R1V A;  1L3L A;  5E8I A;  2BEO A;  3TGN A;  2MLG A;  2QM3 A;  3P7N A;  3T8R A;  5BPD A;  2V1D A;  1XCV A;  4LFU A;  4NQW A;  2F5E A;  3E6B A;  2V1X A;  1T98 A;  4RAY A;  3V7S A;  4Q48 A;  2FBH A;  3PFI A;  4HX7 A;  4RB2 C;  1KGS A;  1R36 A;  3JAM K;  3R0A A;  2CO5 A;  3NQO A;  4HZF A;  1LB2 A;  2DQL A;  2OA4 A;  1J0R A;  3FM3 A;  2ZXJ A;  3KP2 A;  4KMF A;  2MD5 A;  2P5L C;  1Z05 A;  2RQP A;  2W85 A;  5HOO A;  3ERE D;  3O3K A;  1LEA A;  4LMY A;  1QBJ A;  2Y0M A;  5DD8 A;  5K1Y A;  3WTS C;  2FNP A;  2EJR A;  4KNY A;  4A12 A;  4LB5 A;  6PAX A;  1QNT A;  3GYH X;  2HTS A;  1MD0 A;  3FM5 A;  1R22 A;  4U7D A;  4D0P A;  1W7P B;  3MQ0 A;  3TO6 A;  1SD4 A;  5CVJ A;  1XN7 A;  1ONV A;  1TNT A;  2GAU A;  3WE2 A;  1FP2 A;  4U0Y A;  1A04 A;  3GEZ A;  3H3U A;  4M9Z A;  4A5M A;  1XMK A;  4MGR A;  2RDP A;  1XSV A;  4I98 B;  2FA5 A;  2FMY A;  3QRF F;  3GLX A;  2EV5 A;  1F4K A;  1KU3 A;  1SMY F;  2V6C A;  1YS7 A;  1BM9 A;  3L9F A;  4QLC U;  5L3C A;  5CJ9 A;  3GFI A;  2PBI A;  3EQL F;  2ISZ A;  4JBA A;  1V3F A;  4IVN A;  3L2C A;  2EFW A;  3KCC A;  4HDU A;  4HOB A;  1HW2 A;  5DUK A;  5LRR A;  1D8K A;  1QO0 D;  3GWZ A;  2A5Y B;  3V7C A;  1ZHF A;  5DEQ A;  3B73 A;  3CUO A;  2PMU A;  1YIO A;  1LDJ A;  1L0O C;  1P6R A;  2NNY A;  2W84 A;  3G3Z A;  2KIU A;  3C3W A;  2PJP A;  1D8J A;  2MBF A;  3EYI A;  2ZME A;  5KK1 A;  4ESJ A;  4EJV A;  4WX9 A;  2OQR A;  2VON A;  1OYW A;  1KU2 A;  1P92 A;  3IKV A;  1BI1 A;  3DF8 A;  3WTZ A;  5ILU A;  1MKM A;  3K9T A;  2IRF G;  2ELH A;  3QP6 A;  3GFL A;  1G3Y A;  5EEG A;  2NRA C;  3WTT C;  2STT A;  3GO5 A;  3WTW C;  4EGY A;  1MZB A;  1MJA A;  5ICG A;  2WTE A;  2VOD A;  1U2W A;  2QVO A;  1TQP A;  1IN6 A;  4L9T A;  1ODD A;  3FMR A;  4KYW A;  3BRO A;  3FZV A;  2XKO A;  4BXU A;  3I53 A;  1PP7 U;  2JTV A;  1B1B A;  3IRR A;  5H6R A;  1LDD A;  3IRQ A;  3MWM A;  4HX4 A;  3V7R A;  4L0Z B;  3LAJ A;  2P6S A;  2ZCW A;  1B9N A;  3TDZ C;  3KP7 A;  3E6C C;  1ZRF A;  1QPM A;  3L7W A;  3GZ5 A;  3OOP A;  2O03 A;  3WGH A;  3CO7 C;  2DK5 A;  2E1C A;  2XRN A;  4AIH A;  4HYE A;  4JQF A;  3LA7 A;  1ZH5 A;  3E6M A;  5D4R A;  4OIN F;  3WGI A;  1FWZ A;  2STW A;  5HDG A;  1IW7 F;  4H0E A;  3DFG A;  2XAH A;  2PQ8 A;  1R7J A;  4LB6 B;  1T0F A;  4L9V A;  3DP7 A;  4KA4 A;  5DD4 A;  4UVB A;  3TO9 A;  2R7F A;  3F3X A;  2W24 A;  4YIF A;  2Q2E A;  1RUO A;  2OQG A;  4M73 A;  1BI3 A;  2ADU A;  2V1U A;  2DQR A;  1OR7 A;  2EFQ A;  1BI0 A;  5L3F A;  3R61 A;  3ZN1 A;  3ELK A;  2A07 F;  3T5X A;  4KN4 X;  3BDD A;  2UWM A;  4N9I A;  5E18 F;  5FFZ A;  3V4G A;  2XV4 S;  2ESN A;  1FBU A;  1SD6 A;  3ZQ7 A;  3BPV A;  5HVQ C;  2FE3 A;  4EM1 A;  2YX4 A;  4WK8 F;  1S6L A;  1FPQ A;  1Z6R A;  1SD7 A;  2K4J A;  2GXB A;  1HXD A;  2GXG A;  4HQM A;  3QU3 A;  4ZYH A;  3V8J A;  3PQJ A;  3KET A;  3AAF A;  4WXD A;  2M87 A;  4HV5 A;  1IRG A;  4XSX F;  3ZMZ A;  1R5H A;  3DPT A;  1IUY A;  5HDK A;  1ULY A;  1XD7 A;  4I0B A;  4KIB A;  1P4A A;  3HTS B;  1DPU A;  1FLI A;  1J2X A;  3IWZ A;  3I59 B;  1XDU A;  4FT8 A;  4HLX A;  3R4K A;  1VTN C;  3E5X A;  2PN6 A;  1XMA A;  2DBB A;  5J8F A;  2Z9O A;  2B0L A;  3DQV C;  1Z7U A;  5A2Q K;  1HKQ A;  2FXA A;  1FT9 A;  3TOA A;  1XGS A;  1G4D A;  1SD5 A;  2H6C A;  1O3T A;  5HLH A;  4XLN F;  4BHC A;  1Z91 A;  4RGR A;  1LQ1 A;  2DPD A;  1D3Y A;  1Z6T A;  5ICC A;  2HKO A;  2BV6 A;  1CF7 A;  2QQA A;  4L5I A;  3WGG A;  2D45 A;  5FD5 A;  5LHH A;  4OIP F;  2WC2 A;  4P96 A;  1I1G A;  1Q1H A;  4IF4 A;  1B4A A;  2GQQ A;  1TQM A;  2P8T A;  3TDU C;  4P5O A;  3ZMS A;  3LST A;  4EMS A;  3O6B B;  5L3G A;  3BJ6 A;  5FGM A;  2ETH A;  3HRS A;  2FRH A;  3F8B A;  1HQC A;  5LRS A;  4L9J A;  2CFX A;  4IHS A;  1W5T A;  2K7L A;  5E1X A;  4Z2Y A;  1DDN A;  1P2F A;  4YFK F;  1TBX A;  2Z5U A;  2XRO A;  1BIB A;  3ZN0 A;  4S04 A;  4IJA A;  5FLX Z;  3TO7 A;  4PDK A;  4LK1 F;  5HLG A;  5DYM A;  5IT9 Z;  1R00 A;  4CXF A;  2RNJ A;  1U5T A;  3ZMU A;  4OIR F;  5D5W B;  3P9K A;  3MAJ A;  5CLS A;  3WTU C;  3KZY A;  3JSO A;  1FYM A;  2WWY A;  4MQ9 F;  3I64 A;  1O3R A;  4RAZ A;  2LF8 A;  4A0Y A;  5F6F A;  3H3Z A;  4OOI A;  3K1P A;  3R60 A;  4BH9 A;  4ZH4 F;  2VT3 A;  2EB7 A;  1TLH B;  5LHI A;  1FBS A;  1J9I A;  2HTJ A;  3HHG A;  4RGS A;  1Z9C A;  3E5Q A;  3RDI A;  1WKM A;  5F1R A;  3RPU A;  4G6Q A;  5HS7 A;  2CG4 A;  2F5D A;  3HSE A;  1YLF A;  3I71 A;  1R5G A;  2DO7 A;  3FXR A;  1TTY A;  1RUN A;  1F5T A;  4YII A;  5CVU A;  3VOD A;  5FB2 A;  4MNU A;  1O7F A;  5D5V B;  2LKP A;  2RVC A;  1H0M A;  3F72 A;  2XVC A;  4WWC A;  4CO8 A;  4IPA A;  3DXJ F;  3F8C A;  3IHU A;  3KZZ A;  2O0Y A;  3KEO A;  4ENK A;  1BI2 A;  1IXC A;  5F64 A;  4E70 A;  1WSU A;  2MC3 A;  3FXQ A;  3GX4 X;  3QU6 A;  2QYO A;  5JHU A;  4NHJ A;  3W6J B;  2R7D A;  2QQB A;  4LLG F;  4LG0 B;  3HSF A;  1TW2 A;  3Q5F A;  3E6D A;  2XAQ A;  4KN7 X;  3IC7 A;  1UHM A;  1PDN C;  3FXU A;  1WI9 A;  4BAY A;  5KVR A;  2HR3 A;  3MEX A;  1LJ9 A;  4R8H A;  2EA4 A;  2A68 F;  5D8L B;  1LEB A;  2L54 A;  3Q9V A;  4BNC A;  3F8M A;  2IP2 A;  4U0V A;  1ZLJ A;  2IW5 A;  5K5O A;  2FBI A;  3RIR A;  2QBY B;  2XAG A;  3WU0 A;  1UCR A;  1HST A;  5TJJ A;  3SZT A;  2F5C A;  2GWR A;  4A2U A;  1B9M A;  3MZY A;  3IKT A;  2JT1 A;  1JGS A;  3HOS A;  1RNL A;  3J80 K;  1BOA A;  4YFN F;  2K02 A;  1LVA A;  3O2P E;  3I0T A;  3R6S A;  2P5K A;  5BPI A;  4EJT A;  3MFK A;  4ENN A;  5HS8 A;  2R3S A;  2A3S A;  4FX0 A;  1XGM A;  2HZT A;  5CVR A;  4PGH A;  4IRH A;  4P9F A;  1WRJ A;  4PGG A;  2UXX A;  2D2W A;  1DUX C;  2KJC A;  4EM0 B;  4AIK A;  4LK0 F;  4UHT A;  2TDX A;  1SFE A;  3D0S A;  2DW4 A;  2G7U A;  4RGU A;  2HGC A;  3L00 A;  3TKY A;  1FC3 A;  3HIF A;  1GVJ A;  3BY6 A;  2YSR A;  1DPR A;  4EJU A;  1ZG5 A;  3HRU A;  2EFP A;  2NAZ A;  4UV9 A;  2XKP A;  2Y48 A;  2FQ3 A;  3Q9S A;  1W7P A;  1O57 A;  3W6K B;  3SFZ A;  3N4M A;  3NEU A;  5EEH A;  2ZJ2 A;  4RB1 A;  2HQR A;  4PCQ A;  2IA1 A;  3ZMD A;  3KP4 A;  2RC4 A;  3JW4 A;  4L9N A;  5LHG A;  3ECH A;  2Z33 A;  4M9X A;  2QEN A;  2V79 A;  4GCV A;  1IAW A;  4IRG A;  1D5V A;  4EQQ A;  2MH2 A;  1FYL A;  2XUB A;  3LWF A;  3HYI A;  2Z99 A;  2RN7 A;  1PP8 F;  4Q47 A;  4ENJ A;  2XHK A;  4Q4Z F;  2Q8K A;  2FBK A;  1SFU A;  5FFX A;  3ZMV A;  2ZKZ A;  2JPC A;  1RZ4 A;  1MJ9 A;  2GIV A;  2KRF A;  1F9N A;  1K78 B;  2BBY A;  4U0W A;  1HW1 A;  4Y13 A;  1OYY A;  2OD5 A;  1QGP A;  3KFW X;  3CTA A;  4K2E A;  4TV7 A;  4YG2 F;  2QBY A;  4LD5 A;  2GZW A;  4MTD A;  3ULQ B;  4PZJ A;  3LA2 A;  3F8F A;  3F22 A;  1W5S A;  2DAO A;  1E2X A;  1ZG1 A;  3U1D A;  3DEU A;  5ED4 A;  1YYV A;  3E3V A;  4O5V A;  2HS5 A;  5BOX A;  4EJO A;  2VBY A;  2EV0 A;  4OIQ F;  3SZP A;  2IA0 A;  3GXO A;  4XLP F;  2FML A;  4LG0 A;  5JVT A;  2ISY A;  4G7O F;  5L3B A;  3JTG A;  1G6N A;  2QZ8 A;  2PI0 A;  2FOK A;  1U8R A;  5DCF A;  5DV5 A;  3SQN A;  3R0J A;  4LLN A;  4Y17 A;  2EFN A;  2FF4 A;  5BS6 A;  4L18 B;  4R79 A;  2QWW A;  2COM A;  1DP7 P;  2C6Y A;  3RTR A;  2DFI A;  2VBZ A;  1O3S A;  1HKS A;  2DI3 A;  1U5T B;  2Q0O A;  2DT5 A;  3ISP A;  3N97 A;  1MJB A;  2RV8 A;  1R23 A;  4G7H F;  4IRI A;  4RGX A;  4LGW A;  3U9G A;  4XSZ F;  2FSW A;  2LNB A;  5LGN A;  4I2O A;  5CVI A;  1OKR A;  4L0Y B;  4R1H A;  1LDK B;  1ZRC A;  1XGO A;  5ICF A;  3V8K A;  4KFC A;  4BHP A;  1BC8 C;  3LFK A;  1J75 A;  2G7H A;  1I5Z A;  4I01 A;  2CW0 F;  4XRF A;  4I7H A;  4HF0 A;  1TQI A;  5ILS A;  4MEX F;  2KKO A;  2VC1 A;  4LLL A;  2M45 A;  2QLZ A;  2YPR A;  3QPH A;  2HEO A;  2JSC A;  1YW7 A;  2XAS A;  2PG4 A;  2DTR A;  4BYY A;  4GXO A;  1STZ A;  5L3D A;  1QZZ A;  2OAZ A;  4M72 A;  4QWQ A;  4XBF A;  1I6X A;  1SMT A;  4HF1 A;  2M8E A;  4GYI A;  4HLY A;  4HA8 A;  3I5U A;  1P4W A;  3KLN A;  4CZZ A;  3RI4 A;  2JRT A;  2HFH A;  2JZY A;  2Y75 A;  3GW2 A;  2EV6 A;  4M6X A;  1YO5 C;  3BJO A;  2CSO A;  4N9H A;  1FY7 A;  1IN4 A;  3LQQ A;  3M1E A;  5FD6 A;  2EA2 A;  5HLI A;  1XCB A;  1X3U A;  1IF1 A;  3LA3 A;  4I02 A;  2FU4 A;  1RIO H;  3KE2 A;  3LQR A;  2PFB A;  2GA1 A;  2K27 A;  1BJA A;  3VOE A;  3ZPL A;  3K69 A;  1BIA A;  4HX8 A;  4I09 A;  4FX4 A;  2VT2 A;  1KU7 A;  1ZN2 A;  3DPL C;  2CYY A;  4G94 A;  1QZY A;  2P7C B;  3KP3 A;  1KYW A;  4YFX F;  2RKH A;  2PLY A;  1FX7 A;  3DKW A;  1S7A A;  3FMS A;  3JSP A;  3KP6 A;  1REP C;  5ICE A;  2GA2 A;  2XGX A;  2ESH A;  2IPQ X; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...