3KE2A

Crystal structure of a duf2131 family protein (sama_2911) from shewanella amazonensis sb2b at 2.50 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
GDQVSKQHKAFLRKLYLAHLMDDARHNLLSLGKLTGMPRRTLQDAIASFADIGIEVEFVQDGERHNAGYYRIRTWGPISSAWMDTHVDEVKSLLGVDDAVGQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Unknown function
molecule keywords uncharacterized protein YP_928783.1
publication title Crystal structure of STRUCTURAL GENOMICS, UNKNOWN FUNCTION (YP_928783.1) from SHEWANELLA AMAZONENSIS SB2B at 2.50 A resolution
rcsb
source organism Shewanella amazonensis sb2b
total genus 25
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09904 HTH_43 Winged helix-turn helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ke2A00
3K1MA 3H92A 2DBBA 2KIMA 3GZ5A 3M1EA 1BOAA 4LLNA 1W7PD 4NB5A 4UUVA 3GYHX 1ZGAA 2CO5A 3J81K 2VOOA 1D8JA 3IC7A 2Z33A 4UVAA 2IA1A 5J8FA 3F21A 4P5OA 5BMZA 2J5OA 4ZZDA 4HX8A 1OMIA 4RAZA 2XVCA 2VBXA 2XAHA 5K1YA 2OAZA 3EYIA 3VB2A 5CVIA 1KYWA 2FU4A 1YFHA 4BH9A 4FX4A 1R5HA 3VOEA 5D8LB 4BHBA 3Q9SA 3QPTA 4KMFA 3IKTA 5HDKA 3FXQA 1U78A 2CFXA 1K78B 1E2XA 2M45A 3KFWX 1QBJA 1J75A 1DPUA 1TBXA 3BROA 1KQ9A 5IT9Z 2G7HA 3BJ6A 4OIPF 1I1SA 1DPRA 4RB0A 3F6OA 3ROUA 3JW4A 2GQQA 3BOQA 1P2FA 1QO0D 3RYRA 3K1NA 3RYPA 3S2WA 4KA4A 2P5VA 3U2RA 1F4KA 3ZN1A 1I6XA 4KIGA 1T6SA 3SZTA 1Z7UA 2E1NA 1SD7A 4LG0B 4KN7X 4RB1A 4OMZA 4UV9A 1IRFA 2E7WA 2BYVE 3RPUA 4MHGA 1O57A 5D6EA 3D0SA 3IWZA 4BNCA 3GFMA 2HGCA 4A0YA 5BPIA 1FP2A 6PAXA 4ZYEA 3WGGA 4UVBA 2DTRA 3LA2A 2HEOA 3IRQA 1R1UA 2STTA 2KJBA 1J9IA 1RUNA 1FWZA 4IRGA 3D5LA 4A12A 1YO5C 2ESNA 1R58A 3I5UA 4LGWA 1XD7A 4OU0A 4B09A 1B9MA 2HZTA 1LVAA 5HDNA 5JR3A 5DEQA 3M8FA 1SAXA 2JZYA 3FXRA 1VTNC 5CLSA 3K2ZA 1B59A 3LAJA 1O3SA 3WG9A 1ON2A 2Y48A 2UZKA 2VC0A 3F22A 2L4MA 2QENA 2FXAA 4R1HA 3MZHA 2Z5UA 4O6JA 5E1WA 1XDUA 2IW5A 4HOBA 3ZMTA 3RPQA 3KETA 4G7ZF 1DDNA 1SFUA 5K5RA 2XAQA 1ZRDA 2XHKA 3ZPLA 4EGZA 3VFZA 5F64A 1W4MA 4CZZA 1TNSA 4RGSA 2WC2A 3RTRA 3SFZA 4XLNF 3QOPA 1XMKA 2FBKA 3G3ZA 1Z91A 3WTVC 2XAGA 4OINF 1FNNA 2NRAC 2MH9A 3RKWA 4EM0B 4GGGA 2PLYA 2KIUA 5ICFA 4WF2A 1RUOA 2VN2A 2IVMA 4RGUA 3HRMA 4M9SA 3E6MA 4XLPF 1EH7A 4KUMA 3GVAA 4G6DA 5DV5A 1ODDA 1BI2A 1IW7F 5D5WB 2RQPA 3KP7A 5H6QA 1ZAOA 2JTVA 1STZA 3F3XA 2F5DA 4DNCA 5F6FA 3BWGA 1V3FA 4ENMA 3ZMDA 5J8CA 1G4DA 3KE2A 4XRFA 1KQ8A 4G94A 1AOYA 3KP6A 5DDGA 1CF7A 4S05A 1UHMA 3TO6A 2X0LA 4EJVA 3CO6C 2JSCA 2XV4S 5J6XA 3R6SA 1J7KA 1TTYA 2NNNA 2EWNA 1LNWA 2ZFWA 2H09A 4HBLA 4Y13A 1K7AA 3E5XA 5FLXK 4I09A 4OIRF 3CLOA 1LEBA 2DI3A 4EM2A 1FT9A 1REPC 3FZVA 2O61A 3ZN0A 3MEXA 3QRFF 1B4AA 1YS6A 3R0JA 1BIBA 2JT1A 3QPHA 3F8FA 3TO9A 3GX4X 4E70A 4R8HA 3ECHA 1O7FA 5LHIA 3GXOA 3R0AA 1ZREA 3WTSC 3EDPA 3F8NA 2H27A 1BBYA 1WQ2A 1F5TA 2MC3A 3W6KB 3V7CA 3H3ZA 1XSDA 1ZG5A 5D4SA 2O6GE 3Q9VA 3R61A 1WWXA 4JK1X 4AWXB 4GO1A 3L00A 3IL2A 3MQ0A 1MJAA 3V8KA 1XCVA 3FF5A 1SD5A 3I58A 1FBUA 1YW9A 2RDPA 2YPRA 4CO8A 2L01A 3JSPA 2BEOA 2P8TA 3F8BA 2LNBA 4EJWA 1XSXA 1D8KA 3WTYC 3O6BB 3HTSB 3DEUA 5FD6A 2CGPA 2M1BA 3WTXC 1FBSA 2HKXA 4GYGA 3O3KA 5HDGA 2Q8KA 3DKWA 1S7OA 3PFIA 4ETSA 4A2UA 1GXPA 1YG2A 1L3LA 3GEZA 1IXCA 2Y0MA 1U5TB 3Q5FA 4M73A 2DO7A 3DXJF 1TQMA 3I53A 4H0EA 4AIJA 3HRSA 1C0WA 3DF8A 4KICA 2AS5F 2D2WA 1LJ9A 2H6BA 4I02A 1P4XA 4P9UA 3CJNA 5L3CA 4NQWA 1CF7B 3ZP5A 1MZBA 3ZMSA 5BQTA 2MBFA 3G73A 1YIOA 4MTEA 2NAZA 4WK8F 4XSZF 2JPBA 5E1XA 2LDUA 2OZUA 1A04A 1XDSA 1HBXG 2P7CB 2V6CA 3LWFA 3COAC 3I54A 3J81Z 2A07F 2DQRA 2Y75A 3MAJA 1PUEE 2Z9OA 5TJJA 5CVJA 2XASA 3JTHA 3WGIA 1FOKA 5HOOA 3T8RA 4R79A 1SMTA 2IT0A 5ED4A 4UHTA 2VT3A 1B6AA 2LKPA 1SD6A 2D1VA 4A5MA 1BI0A 1F9NA 4KDPA 1HSJA 1UHWA 5FGMA 4UVCA 5ICEA 3I59B 4EMSA 3KP5A 3QP5A 1KQ0A 3P9KA 1ZRCA 3C7JA 1J0RA 2F5EA 3TGNA 1KU9A 3M7GA 4L9VA 4RB3C 4CXFA 1MDMA 4HDUA 4YFNF 3ISPA 2PBIA 4EJTA 2DQLA 4OIQF 2O8XA 1QGPA 2D45A 2RN7A 2A6EF 3LA3A 1DUXC 5CVUA 2V1DA 3W6JB 4HDVA 2B0LA 3FM5A 4KN4X 4IHSA 3FM3A 5AIPA 2CW0F 1Z05A 3OOPA 5L3FA 3FMRA 2W25A 4G7OF 3EUHA 1ZYRF 4CHUA 2BBYA 5D5VB 4PZJA 5BS6A 3L9FA 3FMQA 2L4AA 5D5XB 1UB9A 2EFOA 4N9HA 1OYYA 2ADUA 2WV0A 1SFEA 2ISYA 4ENJA 2MA3A 5LBQA 1V4RA 5DCFA 4WXCA 4MGRA 3GF2A 1IAWA 3IHUA 1B9NA 2CG4A 3N97A 3CUQC 2RV8A 2M30A 3GFLA 1U6GA 2DK5A 4FHTA 2FOKA 4I0BA 4ZH4F 3HRTA 1S8NA 1T2KA 1F1ZA 5A2QK 1QZZA 3WTUC 2ZMEA 4KT5C 2QZ8A 3BZ6A 3SXYA 2GXBA 4O3MA 1D5VA 4MTDA 2ISZA 5ICGA 2V1XA 1E17A 1USSA 4HLYA 4IHTA 3ABUA 1FP1D 3DFGA 3ZQ7A 2UXNA 1S7AA 2QBYA 4EM1A 2R7FA 4UXNA 2A3SA 5DD8A 1BI1A 1HKTA 2IP2A 2PFBA 5AONA 5FO5A 2EV6A 4KNYA 2P6SA 3VEPA 3WU1B 5E1ZB 5LEJA 4U0YA 1BC7C 4A5NA 1XMAA 4UNOA 3TDZC 4LD5A 4HX4A 1IN7A 4P9FA 1U3EM 3FX3A 2FSWA 1FYMA 4I98B 3EETA 3E6DA 1YW7A 1SD4A 3V8JA 4MNUA 1TW3A 2C6YA 1KA8A 1FYKA 4QLCU 1MDMB 3DPLC 2W85A 2O0YA 1Z9CA 1TW2A 3LQRA 2UWMA 4IPAA 3PQKA 3SQNA 4ENNA 2XAFA 3HOSA 1EV7A 2ZNZA 2HQNA 1R1VA 3WTWC 2G7UA 3TKYA 3HRUA 4L5IA 2GWRA 3ML6A 3LFKA 1LEAA 2D1HA 4XSXF 3JAMK 1O3RA 5LRRA 3ZMVA 3WGHA 2FNPA 1ZN2A 4L9NA 1FZPB 1I5ZA 3R4KA 2DAOA 1S29A 3V8LA 2QVOA 4RB2C 3I64A 2QLZA 3L2CA 2IPQX 1LB2A 4AD9A 4WXHA 4GXOA 3MFKA 1LDDA 1R7JA 4AIKA 1TNTA 1T98A 4IVNA 3C18A 3CUQA 4BYYA 5HVQC 3HSEA 1MGTA 4MEXF 2ZNYA 5ILUA 2F2EA 3FWEA 1ZG3A 2EA2A 4MQ9F 5FLXZ 4KIBA 2ZBKA 1BIAA 4S04A 1DP7P 4L0ZB 3KLOA 1WI9A 1W7PA 1BJAA 3T0YA 1JGSA 3EYYA 4ZYDA 2UXXA 1MD0A 4KIFA 3J7AO 1KU3A 2QBYB 4ASNA 1L0OC 3V7SA 4EV0A 2X4HA 3HUGA 2XRNA 2PEXA 3HHHA 3ULQB 1G3TA 4U7DA 4DQ2A 5LGNA 2M87A 2PMHA 2A61A 1OYWA 1R23A 1EH8A 4A6EA 3P9IA 4ESFA 2J5PA 1H0MA 1XCBA 3P9CA 4N9IA 3BPXA 1HW2A 4CGZA 3T8TA 3TOBA 1HW1A 2FBHA 4EJUA 1W5TA 4F7ZA 3QU3A 4HF0A 2RGVA 1R5GA 1IXRC 1HW5A 4ON0A 1YTYA 2F5CA 3MCZA 4L0YB 3KCCA 2MH2A 1GHCA 2PMUA 2A6HF 3JTGA 1K6OA 3F72A 3CO7C 1USTA 3DV8A 2OBPA 2IRFG 3NRVA 1ZRFA 3I0TA 3U1DA 3IRRA 1KU7A 1XN7A 5LEKA 5HS8A 4CYDA 2JPCA 1K79A 3GW2A 1TLHB 4RGRA 1RNLA 2BGCA 1IN6A 3O2PE 4YFKF 3V7RA 2XROA 5E17F 4Z2YA 2KIFA 2GXGA 2NNYA 1ZH5A 5D4RA 3ECOA 2RKHA 1J5YA 2HOEA 4BHCA 5FB2A 4U7BA 2ESHA 2VE8A 4M6YA 5HS9A 1RZ4A 5DCMA 3E97A 2FEZA 4Y17A 5L3GA 1GXQA 1W5SA 3ELKA 5HLIA 1PP7U 3ABTA 2W57A 2R7DA 1Z1DA 1FX7A 2VBZA 3WTTC 1FSHA 2CWEA 2XKOA 1XGOA 4A6DA 2IA2A 5KVRA 3TO7A 4M74A 1LDKB 2OZ6A 4HQEA 4O5VA 5F1RA 4B8XA 2HYGD 4OOIA 3L7WA 3DQVC 2ZJ2A 4IRHA 2MD5A 2K86A 3GZ6A 2EFWA 2YR2A 3B73A 4M71A 1YQAA 2DT5A 1H9TA 2WTEA 2PN6A 3NQOA 3DP7A 1SFXA 1P6RA 2VXZA 2PQ8A 1Z6RA 3BP8A 5LHHA 4HV5A 1I1GA 1X3UA 4RGXA 2NS0A 4LJZF 5EEHA 3AAFA 4U0WA 2P4WA 2CYYA 3E3VA 3RDIA 1BC8C 1FLIA 2K02A 4A0XA 4ZZLA 2O03A 1P4WA 1IUYA 1P4AA 1ULYA 4RS8A 1KGSA 1R36A 2ZCWA 1T39A 4L9TA 1S3JA 4LK1F 1UFMA 5AIQA 2VBYA 1U2WA 1FPQA 2IJLA 1QPMA 4P96A 1Y0UA 1HKSA 1YYVA 3HOTA 2W84A 1T38A 1IN5A 1FYLA 5CVRA 2HDCA 1FBQA 1Q1HA 1NHAA 2LF8A 1UCRA 1SMYF 1O3QA 3LQQA 4I01A 3I4PA 1ZGJA 4I7HA 2QWWA 4G6QA 5HS7A 3KZZA 4D0PA 2HQRA 2KJCA 5ERIA 4BAYA 2KRFA 3ZMUA 1MJ9A 5LGTA 2P5LC 1BM9A 4KYWA 5CYVA 1ZLJA 5JFRA 4NHJA 4YIIA 3ERED 4IF4A 1BI3A 4BHPA 2TDXA 1WKMA 1EH6A 1QZYA 2K4BA 3SZPA 3BY6A 1FC3A 3OV8A 2K4JA 4WX9A 4ESJA 3KP3A 5FFZA 4PGGA 3WE3A 4L9JA 2VONA 2XIGA 2GAUA 2YX4A 5DCMB 3I71A 2RC4A 1AWCA 1PDNC 2FBIA 3P7NA 2FE3A 3RKXA 1O7LA 3MWMA 4HA8A 3GLXA 4HV6A 5A2QZ 3ZMZA 4CDGA 5LRSA 2EA4A 5D6FA 4YIFA 4L18B 3RI4A 2FF4A 4LFUA 4M72A 2XGXA 4GYIA 1WSUA 2COMA 2P6TA 1G3WA 5JVTA 4HF2A 3IWFA 3QP6A 1RIOH 2YX7A 4TV7A 1OPCA 5HLGA 4M6XA 1KU2A 1IZ1A 2VC1A 2HFHA 2V79A 2VE9A 2WWYA 2IA0A 1R00A 4L5JA 2V1UA 5FFXA 4KFCA 4WCGA 2DK8A 2OD5A 3PQJA 3M9AA 4IJAA 3KLNA 4Q48A 2Q2EA 2P5KA 1U5TC 2HTJA 1U8RA 1GVJA 5E20A 2GIVA 4N0BA 3RIRA 1ZLKA 2QM3A 4Q47A 3CTAA 1B1BA 3BJAA 3LA7A 2DFIA 2OU2A 1TQIA 4WXDA 1FSEA 4KMUX 5IT9K 3KZYA 4IXAA 3E5UA 3REOA 1JHHA 2DLLA 1ONVA 3F23A 5K5OA 2H6CA 4G8XA 3F6VA 3BPVA 4MQVA 2GZWA 2P7VB 3U9GA 2QUFA 3JAMZ 4ZYHA 1ZG1A 1HQCA 2L02A 2FMLA 1JE8A 4A0ZA 3K1PA 2L54A 5JHUA 2XAJA 1QQIA 4UV8A 3K0LA 1H9GA 3V4GA 3CDHA 2DU9A 3FHZA 3GFJA 3FXUA 2BE5F 5DD4A 4RAYA 4U0VA 2EB7A 3F8MA 1ON1A 3C1DA 5DUIA 2XKPA 3GO5A 4U88A 2OA4A 5L3DA 3TOAA 1LDJA 5KK1A 3GUDA 1QNTA 5CVVA 4G7HF 5E8IA 2K7LA 5H6RA 4PGHA 5E18F 3M8EA 1I27A 4OIOF 1OR7A 5D8KB 3HIFA 4LB6B 1G6NA 4MEYF 4Q5SF 3LAPA 4XBFA 4PDKA 3E6CC 4M9ZA 4YFXF 5JI6A 2EK5A 3MZYA 4P55A 2R3SA 5BOXA 1TQPA 5FD5A 3LSTA 1S6LA 3K69A 3NEUA 4ESBA 1XGMA 3C3WA 2JRTA 1JXSA 3KEQA 2HR3A 1YLFA 3DPTA 5D5UB 3HSRA 5ICCA 1YS7A 1P92A 4HX7A 2ETHA 3L09A 5LLQA 2NYXA 5ILSA 4BQAA 3QAHA 2PI0A 2EFPA 2ZMEB 5BPDA 2LF7A 4ENKA 4CICA 1MKMA 2BV6A 1OKRA 4BXUA 3SHFA 1J59A 1Z6TA 1U5TA 4FX0A 2FA5A 2PG4A 4LK0F 2EFQA 3WODF 1XGNA 2CQKA 2DW4A 3J80Z 5EEGA 2E1CA 5ILVA 1IXSB 1LQ1A 1O3TA 4HW0A 3RKYA 1ZARA 2QQ9A 2QQAA 2RVCA 1IN4A 1MJBA 4FT8A 1XGSA 3BJOA 5L3EA 2E7XA 2EFNA 1IF1A 4LB5A 2PJPA 3WTZA 2LSOA 4JQFA 4I0AA 1XSVA 3R60A 1IN8A 5K5QA 2VBWA 2MLGA 2GA1A 2Z3YA 5DUKA 3J80K 3WU0A 3CUOA 4LLLA 2A68F 1G3SA 1PP8F 1ZHFA 4HF1A 2K27A 2G9WA 2YU3A 2HS5A 1HKQA 3EQLF 3FMSA 2EJRA 5HLHA 2EV0A 2ELHA 4Q4ZF 3TQNA 1RI7A 2FMYA 4LMYA 5DYMA 1XB4A 3K9TA 3I59A 2ACJA 4PCQA 4EQQA 5CJ9A 3T1BA 2HYFA 3E6BA 5H20A 4K2EA 3T5XA 5L3BA 3B02A 3VODA 1HSTA 2F5FA 3KEOA 2W24A 2A69F 4LLGF 4WWCA 3CUQB 3TDUC 2GA2A 2ZO4A 3KP4A 4YG2F 3N4MA 2HWVA 2FRHA 4HYEA 3IKVA 4HQMA 1D3YA 1JHFA 1R22A 5LGUA 2OQRA 2VOPA 4HZFA 1G3YA 1W7PB 3GWZA 2OQGA 1K78A 4M9XA 2AXLA 3KP2A 1FY7A 1T0FA 3BDDA 4EGYA 3GFIA 2L3DA 3HSFA 2DPDA 3RJPA 2QYOA 1CGPA 1WRJA 2HTSA 3E5QA 4AVPA 4G9YA 2CSOA 2H94A 1BN5A 4AIHA 1R1TA 2FNAA 4JBAA 3HTUA 4OMYA 2ZKZA 2YSRA 1IRGA 3QU6A 2STWA 4LG0A 4I2OA 2XUBA 5IT3A 2VT2A 3JSOA 2Q0OA 2ZXJA 5E8GA 4ZYGA 4IRIA 1HXDA 1YW8A 2DPUA 2VODA 2Z99A 3HYIA 2M8EA 2O3FA 3F8CA 4HLXA 5LHGA 2MLKA 2A5YB 4EJOA 3HHGA 1KYZA 2EV5A 4Y15A 3WE2A 5TRDA 2QQBA 2FQ3A 4QWQA 4EVIA 2HKOA 4GCVA 2M5WA 2RNJA 1J2XA 4HAMA 1OYIA 3H3UA 2V9VA 2KKOA
chains in the Genus database with same CATH superfamily
2IS2A 4ZDOA 3K1MA 3CCRI 3H92A 2DBBA 2KIMA 2KT0A 3GZ5A 1BOAA 3M1EA 4AYBA 4PJMA 4LLNA 1LPQA 1W7PD 2KRHA 2OC6A 4NB5A 4UUVA 1RKTA 3GYHX 1Q1VA 1ZGAA 2CO5A 3J81K 2GLOA 4CCMA 2H8WA 2VOOA 1D8JA 3IC7A 5E3LA 2Z33A 2L2OA 3DEWA 5C4JJ 2JUCA 4UVAA 2E5ZA 2GOMA 2E35A 3K6GA 4IL6C 2E2HJ 2IA1A 3UR3C 5J8FA 3PNTA 1QU3A 1EKEA 1JJ6C 3F21A 4P5OA 4RDUA 5BMZA 5HLTA 4DYCA 2J5OA 4ZZDA 4FTHA 2QKMB 4HX8A 1WJCA 1E3HA 1OMIA 1O4XA 1E3PA 1QVUA 5GPCA 4RAZA 2M4GA 2XVCA 3HEFA 2VBXA 2BW3A 2XAHA 5K1YA 2OAZA 3EYIA 3VB2A 5CVIA 4Y52J 1KYWA 2FU4A 1YFHA 4BH9A 4M3FA 4FX4A 3PFYA 1QHGA 4XRSG 1OISA 2OJED 1R5HA 3K70D 3VOEA 5D8LB 4BHBA 5B3SH 2X6OA 1B72B 1TL8A 3L2UA 3Q9SA 3TW6A 3QPTA 4KMFA 3IKTA 5HDKA 3FXQA 4DBRA 4OAZA 1V5EA 5KHDA 1U78A 3BT9A 4QPQA 1X1PA 2CFXA 4MO7A 5J1YA 2OCCH 1K78B 1N25A 2CUZA 4C30A 1DU0A 5IP6A 1E2XA 2M45A 5CQGA 1X2MA 3KFWX 1QBJA 3QQAA 3IV5A 1J75A 1TT0A 1DPUA 1TBXA 4LIUA 5JLWA 3BROA 1KQ9A 3KX2A 5IT9Z 1Y6IA 2G7HA 3LSPA 1HOMA 2XSDC 4E4HA 2EPFA 3BJ6A 2LP0A 4OIPF 1I1SA 1DPRA 4RB0A 3F6OA 2JSPA 3ROUA 2MW8A 1DP3A 3BR6A 3JW4A 1LFUP 3RKQA 1A31A 1HDDC 5FRMA 2GQQA 3BOQA 5LD2C 2VQLA 1P2FA 3ONQA 3HG9A 4B3XA 3LSIA 1QO0D 2Z16A 2R4GA 3RYRA 3OR2C 3L2RA 3K1NA 3RQ4A 3RYPA 3PM1A 5F0FA 3S2WA 4KA4A 4F92B 1D0XA 4BQOA 1TWGJ 5K7FA 2P5VA 3CQZJ 3U2RA 1F4KA 4FQGA 3ZN1A 3OYFA 2L0KA 1I6XA 2EIJH 3A2KA 1F43A 4KIGA 4BY1J 3G1LA 1T6SA 3SZTA 4W97A 1Z7UA 2E1NA 2X6YA 4JX5A 9ANTA 1SD7A 4LG0B 4J00A 1LKXA 1IGNA 4KN7X 2WA0A 1UMQA 4RB1A 4OMZA 2GM4A 4UV9A 1IRFA 2E7WA 2BYVE 3RPUA 4MHGA 2R5ZA 1NK3P 1O57A 5D6EA 3D0SA 3IWZA 5EEAA 4BNCA 4YELA 3GFMA 2HGCA 4A0YA 5BPIA 4XR6A 1FP2A 3CMYA 3ESWB 1R71A 6PAXA 4ZYEA 2ZFUA 3DEEA 3WGGA 3U21A 4UVBA 2DTRA 3LA2A 2HEOA 5C44J 3M8JA 4XRMA 3K7AJ 2KIQA 3IRQA 1R1UA 3ABKH 2STTA 2ECCA 2KJBA 2JN6A 1J9IA 5C3EJ 1RUNA 4N4OB 3KYLA 1Y1VJ 1FWZA 2EINH 4IRGA 3D5LA 4A12A 1YO5C 3JRIA 2ESNA 1VQ6I 4A93J 4IKFA 3SEZA 1R58A 3I5UA 4LGWA 1XD7A 3LSKA 3RSNA 1ZR2A 4OU0A 2VKDA 2W7NA 4B09A 1MMSA 3TBIA 1B9MA 2HZTA 1LVAA 5HDNA 5JR3A 5DEQA 3PUFA 3M8FA 1SAXA 3BCAA 2JZYA 3FXRA 1VTNC 1XS9A 5CLSA 3K2ZA 3S16J 1B59A 3FBNB 4E7LA 3LAJA 1O3SA 5DTDA 3WG9A 2EBIA 1ON2A 3CCMI 2VB6A 3PO2J 2Y48A 2HXIA 4N4NB 2UZKA 1FIPA 1MH3A 2VC0A 1X4PA 3F22A 3ASOH 4II2A 2L4MA 2O5RA 2QENA 1H89C 2BW3B 2CQNA 3GTOJ 3D5RC 2FXAA 3BTLA 2LRDA 3H0DA 2HYJA 4R1HA 4M3EA 3QYEA 3MZHA 2Z5UA 4O6JA 5E1WA 1LE8B 2BOLA 1XDUA 1NK2P 2IW5A 4HOBA 2DMTA 3ZMTA 4B4CA 2QGUA 1HC8A 2VJ5A 3RCOA 3RPQA 3KETA 1D1AA 4G7ZF 2JMWA 1DDNA 1SFUA 5K5RA 3BR0A 2XAQA 4BDYA 1R6RA 1ZRDA 2ELJA 2XHKA 3ZQCA 3S32A 4BQNA 2ZC2A 3ZPLA 3JRFA 4EGZA 1X1BA 1X3ZB 3VFZA 5FRNA 2KL4A 5F64A 1QPIA 1W4MA 4NC7A 1TNSA 2W00A 4BBRJ 4CZZA 4E7KA 3M3YJ 2R7XA 2HQ5A 4RGSA 4GRIA 4UUSA 1WGXA 1G59A 4BEHA 1W0UA 1D1CA 2WC2A 3RTRA 5BNGA 2X1EA 1AA7A 3SFZA 2F4MB 4BJ5C 4XLNF 3QOPA 3OYKA 4XKWA 1XMKA 2R7UA 1W0TA 2FBKA 3G3ZA 1WVRA 1Z91A 3RZOJ 2ID6A 3WTVC 3FIWA 3GTPJ 2XAGA 4OINF 1FNNA 2NRAC 2MH9A 3RKWA 4EM0B 2AHQA 3AG4H 1EA3A 4GGGA 2PLYA 2KIUA 5ICFA 4WF2A 1H8AC 2VN2A 2IVMA 4RGUA 1RUOA 3HRMA 4M9SA 3VYUB 3E6MA 4XN3A 4XLPF 1EH7A 4KUMA 3GVAA 4G6DA 5J4YA 3A03A 2DA6A 1ETOA 1ODDA 5DV5A 1BI2A 1IW7F 5D5WB 1VQ8I 3X2QH 1SFOJ 2Q1ZB 2QSGX 2D5VA 2RQPA 3KP7A 1XPXA 1V5FA 4Y33A 1E0EA 2PX9A 5H6QA 5F1JA 1QRYA 1ZAOA 2JTVA 1STZA 1DGWY 3F3XA 1A5JA 2F5DA 2VQGA 4DNCA 2VPRA 5EGOA 1RR8C 1XX5A 5F6FA 3BWGA 1V3FA 4ENMA 3ZMDA 1ITYA 3OYHA 5K7ZA 3I55I 2DFHA 2M7BA 5J8CA 1G4DA 3KE2A 4XRFA 3OIOA 1MBFA 1KQ8A 4G94A 1AOYA 3KP6A 5DDGA 1CF7A 2VJIA 4CZCA 4NDLA 4S05A 2UUZA 1UHMA 2X1CA 2B7EA 2GIZA 3CMMA 3TO6A 4UB6C 1I3QJ 4PFPA 2PJRA 2M4KA 2X0LA 4EJVA 4E7SA 3CO6C 3CC7I 2JSCA 2XV4S 3CLQA 2QSFX 5J6XA 3R6SA 2HOSA 2F4IA 3HOZJ 1J7KA 1TTYA 3PIOF 2MGQA 2NNNA 2EWNA 1LNWA 2ZFWA 2H09A 2K3PA 1KZHA 1K4SA 5B1AH 4HBLA 4Y13A 1K7AA 3E5XA 5FLXK 4I09A 3CESA 4OIRF 1ETWA 3CLOA 2HVSA 3IUOA 1LEBA 4DYQA 2DI3A 4EM2A 1FT9A 1REPC 3FZVA 2O61A 3ZN0A 5FLVA 2HDWA 3MEXA 3QPLA 2IS1A 2V1NA 3QRFF 1VQ9I 4BBSJ 1B4AA 1XG1A 1YS6A 3CF2A 3R0JA 3UNGC 1BIBA 2JT1A 3QPHA 3F8FA 3VPRA 3TO9A 4C3HJ 3GX4X 4ZDPA 4E70A 3A4CA 4ITVA 1I50J 3DTEA 4ZJZA 4R8HA 3ECHA 1O7FA 5LHIA 3GXOA 4LITA 3A0BC 2HNHA 3R0AA 5E3MA 1ZREA 3WTSC 1T08B 3EDPA 1JUMA 3B6AA 3F8NA 1FTZA 2H27A 5FKKA 1BBYA 1WQ2A 4HNUA 1GV2A 1NH3A 4NC8A 1F5TA 1W36D 2WY8Q 1HF0A 2MC3A 3W6KB 3V7CA 3H3ZA 1PUFB 1XSDA 3S1QJ 1ZG5A 2K3FA 4XNFA 3CZ6A 2HU9A 3H36A 5D4SA 3HL2A 3DCFA 2O6GE 3Q9VA 2H1KA 3HZJA 4OWRB 3R61A 1WWXA 3AL0B 1FOWA 3K10A 4JK1X 4AWXB 3OYEA 3BG7A 4GO1A 1WJFA 5F0CA 2M0MA 1NG6A 3L00A 3OYJA 4LG3A 1K4TA 4HRIA 1MBGA 4A3LJ 1VNDA 1NTCA 3MQ0A 3IL2A 2RAEA 3Q0UA 1MJAA 2XGCA 2DA1A 2VI6A 3V8KA 1XCVA 3FXLA 2GOXB 3CDIA 3EPZA 3FF5A 1SD5A 3OWTA 3I58A 1QA6A 1FBUA 2ZJRF 1D1BA 1YW9A 2K9MA 3LSRA 2DJIA 2RDPA 4V19K 2YPRA 2DMUA 4CO8A 3RPUD 5GAHJ 2E1MC 2L01A 1DGRM 3JSPA 2BEOA 3WG7H 2P8TA 2BVLA 3F8BA 3HKZA 2LNBA 4IQ4A 1XSXA 1D8KA 5TGTA 4BEHB 4EJWA 3WTYC 3HOWJ 3O6BB 3S1NJ 3HTSB 2CQ7A 2UV1A 3DEUA 4A3BJ 5FD6A 2CGPA 2M1BA 3WTXC 5C4XJ 1FBSA 2VPLA 2HKXA 3Q0VA 3DKYA 1R4MB 4GYGA 3O3KA 5HDGA 2Q8KA 1AHDP 1PJRA 3DKWA 2XPUA 3CCJI 1S7OA 3I4NJ 2AXTC 3PFIA 2MYSA 4ETSA 4A2UA 1OCPA 4RLFA 1GXPA 3LOCA 2CW8A 1YG2A 2BY0A 1S9HA 2LY1A 2HQAA 2PMZN 2W1OA 1GLNA 1I3AA 1L3LA 3GEZA 1IXCA 2F48A 2Y0MA 1YITI 3CC2I 2BHZA 1U5TB 3Q5FA 4M73A 2DO7A 4IHXA 3DXJF 2KMUA 4BGDA 1TQMA 1UG0A 2LR8A 3OIPA 3I53A 4H0EA 4AIJA 1GV5A 1IV6A 4E7IA 3HRSA 1C0WA 1VQ5I 3DF8A 3S15J 4KICA 2AS5F 3H1CA 3CDLA 2D2WA 5TISC 2QA4I 1LJ9A 2H6BA 2LMDA 4I02A 4B43A 1P4XA 4DYRA 4P9UA 1WHUA 3QYBA 1V55H 3CJNA 1K6YA 1QVTA 2MABA 1Z67A 4ZC3A 2WB1A 5L3CA 3RZDJ 4NQWA 2MD0A 1CF7B 3BR1A 3ZP5A 1X1AA 5IP9J 1AKHB 1MZBA 3J7AY 3ZMSA 5BQTA 2MBFA 3G73A 1YIOA 4MTEA 2FOWA 2NAZA 4HEA2 4WK8F 4XSZF 2JPBA 1K61A 2PJRB 5E1XA 3GTQJ 1T33A 2OPTA 2LDUA 1ETQA 2OZUA 2L9NA 1A04A 1XDSA 1HBXG 2ZMEC 2LBFA 2ZJQF 3OYNA 2P7CB 2V6CA 3LWFA 1LUJB 2FX0A 3COAC 3BR5A 2BHYA 5EF6A 4E7JA 2KZGA 2V9KA 3VYTB 3I54A 1T95A 4EEFG 5J1UA 3GZNB 3J81Z 3PO3J 3OR1C 1XC5A 2A07F 2FJ1A 2EZIA 1MMGA 2DQRA 2Y75A 3MAJA 3H0GJ 1Z3YA 1PUEE 2Z9OA 5TJJA 5CVJA 2XASA 3JTHA 3DBHB 3WGIA 1FOKA 5HOOA 3GBGA 2MG4A 3T8RA 4BQQA 4R79A 4L5EA 2JRMA 1Y56A 2Y0SN 4X0GA 1SMTA 1Y1WJ 3ZQHA 2JK3A 1JT6A 3ZGKA 3OYDA 4HNTA 4XICA 2IT0A 3NARA 5ED4A 3ERMA 4UHTA 2VT3A 2R7QA 1B6AA 1YE9A 4M3DA 2H1LA 2LKPA 1SD6A 3BZCA 4IQJA 2D1VA 4A5MA 1BI0A 1F9NA 3HB9A 1HSJA 4BXFA 4KDPA 2DDBA 1UHWA 2K85A 5M3FJ 1MBHA 3PIPF 4YEJA 3W2VA 4PJJA 5GADJ 5DM6F 3HGGA 3MKLA 2HI3A 5FGMA 4B3AA 4UVCA 3DBRB 5ICEA 3BTIA 3I59B 2ZB9A 4PJLA 4EMSA 3KP5A 4E7HA 5IYBJ 2XF7A 3QP5A 1KQ0A 3P9KA 4BKXA 1T8IA 1ZRCA 3C7JA 1J0RA 2L9VA 2F5EA 3F0CA 1FOXA 3TGNA 2QQ8A 1KU9A 3M7GA 4L9VA 4RB3C 4CXFA 1MDMA 4HDUA 2L7FP 3KPHA 4YFNF 3ISPA 2PBIA 1GUUA 2OF7A 4EJTA 2DQLA 4OIQF 2O8XA 1QGPA 4DZPA 2D45A 4PSWA 3OSFA 3L2QA 2RN7A 2R93J 2QEXI 3VWBA 2A6EF 2G0EA 3LA3A 1DUXC 5CVUA 2V1DA 3W6JB 3H9QA 2E2JJ 4BE0A 3SEQA 4IOCF 4HDVA 2OV7A 5EZGA 2DODA 2B0LA 1OCTC 2EIKH 3FM5A 4XIDA 4KN4X 4IHSA 3FM3A 3QODA 5AIPA 2CW0F 1Z05A 3OOPA 5L3FA 2LVSA 3FMRA 2W25A 4G7OF 3L1PA 3BR3A 2JVGA 4PJNA 3EUHA 1ZYRF 1OR7C 4CHUA 2BBYA 5D5VB 4PZJA 1B8IA 5BS6A 1A35A 1JUSA 3MD2A 3L9FA 3FMQA 3S2HJ 2L4AA 3GLLA 5D5XB 1UB9A 2EFOA 3CJRB 4N9HA 1OYYA 2ADUA 4C3IJ 2WV0A 1SFEA 3RQIA 3I4MJ 4FISA 4QTRA 2ISYA 1WH7A 3OMYA 4ENJA 2MA3A 5LBQA 1V4RA 4JP0A 5DCFA 1BJZA 4WXCA 5M5WJ 3E1SA 4MGRA 3GF2A 2KDOA 5GAGJ 1IAWA 3IHUA 3NWSA 2KP6A 1OCCH 2WADA 1B9NA 1WJBA 2CG4A 3N97A 4B1RA 2YU9J 3CUQC 2RV8A 3QOEA 3SDBA 2M30A 2CUFA 3GFLA 2EH3A 3CF5F 1U6GA 2DJNA 2QCOA 2R7OA 2DK5A 4FHTA 3TP3A 5CKTA 2FOKA 4I0BA 4ZH4F 3HRTA 1S8NA 1T2KA 1ZQ3P 1F1ZA 4BU2A 1UG2A 3AG2H 5A2QK 4YRVA 1QZZA 3WTUC 2ZMEA 3FXKA 4KT5C 2QZ8A 3FXOA 2NVUB 3AFHA 3BZ6A 3SXYA 1VQ7I 2GXBA 4O3MA 1D5VA 4BL0B 4MTDA 2HOAA 2WY7Q 2ISZA 3EUKL 1YHQI 3DLAA 2EZLA 2R5YA 3GCMA 4M3GA 5ICGA 2DA4A 2V1XA 1E17A 1USSA 4CUGA 4HLYA 4IHTA 3DBLB 4ZTJA 3ABUA 2CU7A 3PJRA 3KEYA 1X2NA 1FP1D 4XLFA 4ABZA 1F36A 3DFGA 2DYSH 3JR9A 2QSHX 3ZQ7A 2UXNA 1S7AA 2QBYA 2LYCA 4EM1A 2R7FA 4UXNA 3CMEI 2LG4A 1TC3C 1OCOH 2A3SA 5DD8A 1OJLA 1BI1A 1HKTA 2IP2A 4A3MJ 3FK6A 3P5JA 2PFBA 2WV1A 5AONA 1ETXA 2OTLI 3WU2C 5FO5A 3M1CA 1DU6A 4G6TB 1GT0C 2EV6A 4F52A 4KNYA 1UAAA 4NBQA 2P6SA 3H9GA 1X4OA 3VEPA 3WU1B 4EATA 2I8DA 5E1ZB 5LEJA 4U0YA 1BC7C 4A5NA 1XMAA 3ZXSA 4IX7A 4HG2A 2FQ4A 2Z1DA 1S72I 4UNOA 2L9SA 2DOAA 4LD5A 3TDZC 1VFCA 4KT6A 2B9SA 3ZCOA 4HX4A 3K70C 4PFOA 1RKWA 5IYDJ 1IN7A 4P9FA 1U3EM 3OL4A 3FX3A 1Y8RB 4CCNA 1MMDA 3G4SI 3OYAA 2FSWA 1FYMA 2KPMA 4I98B 3GMEA 1WZ2A 5F27A 1HA8A 2IGOA 3EETA 3E6DA 4W1UA 3MKWB 2V26A 5E79C 3W6VA 1YW7A 1SD4A 1YX5A 3V8JA 4MNUA 5EG0A 1TW3A 4V2GA 5EYRA 2C6YA 1KA8A 4NC6A 1FYKA 4QLCU 1RC9A 3DPLC 2W85A 2O0YA 2XPWA 1MDMB 1Z9CA 1JKPC 2NVXJ 2R7TA 4XM3A 4V2FA 1TW2A 5GTHC 4CSWA 3LQRA 1WFXA 2UWMA 2OTJI 1ETYA 1Y0NA 5IOYA 4IPAA 2W82A 2CUJA 2XSJC 3PQKA 3QPSA 2K40A 3SQNA 2ICWG 4ENNA 1VQNI 2XAFA 3HOSA 2B63J 1EV7A 2ZNZA 2HQNA 3J7ZI 4BDZA 1R1VA 1JUPA 3WTWC 2JWTA 1MBJA 2G7UA 2X6XA 3G1MA 1YJNI 3FISA 3NWTA 3HRUA 4L5IA 3TKYA 2GWRA 3ML6A 3LFKA 2VJ4A 1LEAA 2D1HA 2DOFA 2XF6A 4XSXF 4DBQA 3JAMK 1O3RA 5LRRA 3ZMVA 2DMNA 3WGHA 4DW6A 2CV1A 2FNPA 1ZN2A 1B8IB 1MMAA 3PL8A 4L9NA 1FZPB 1I5ZA 2WAEA 3LSGA 3R4KA 2DAOA 1S29A 3V8LA 2W48A 2ME6A 3BTJA 2QVOA 4XMYA 4RB2C 3I64A 2K9LA 2QLZA 5LFAA 3L2CA 1V54H 2IPQX 3ZQFA 1SVMA 2MC4A 1LB2A 1S5LC 4AD9A 4WXHA 2CW7A 4GXOA 2EILH 4PJ0C 5EJCA 1ACIA 3MFKA 1LDDA 2VKEA 3HXLA 2XF5A 4KITB 3ZQLA 5B1BH 1R7JA 3AG3H 4AIKA 2KLOA 4A3CJ 4H4KC 3O8HA 4AC0A 1OCZH 1TNTA 1T98A 4IVNA 3C18A 3CUQA 4GFBA 4BYYA 5HVQC 3I56I 3HSEA 1MGTA 4MEXF 2ZNYA 5ILUA 3NAUA 2VKHA 1X1CA 3CD6I 1FEXA 3D1NI 3OL3A 2F2EA 3FWEA 4RA2A 1ZG3A 2EA2A 1A6IA 4MQ9F 5FLXZ 4KIBA 3S8PA 1BR4A 2ZBKA 1BL0A 1T56A 1BIAA 4S04A 2VL8A 2DT6A 1DP7P 4L0ZB 3KLOA 4D1QA 1WI9A 1W7PA 1BJAA 5J3LA 3T0YA 1JGSA 3SZGA 3EYYA 4ZYDA 1N77A 2UXXA 1UJ8A 1UZCA 5GPAA 4IHWA 1MD0A 4KIFA 3J7AO 2IEKA 1KU3A 2QBYB 2KISA 4ASNA 1L0OC 3V7SA 4EV0A 2R5ZB 5HODA 4IO9F 5CQEA 2X4HA 3HUGA 2BXZA 1YJWI 2ZSIB 1YRNA 4BXXJ 3Q0WA 2XRNA 4B44A 1WH5A 2PEXA 3G71I 3HHHA 3ULQB 4MIMA 1G3TA 4U7DA 4DQ2A 5LGNA 1UHSA 3VDXA 2M3AA 2M87A 2PMHA 1ENHA 4JX6A 2Y2ZA 5EDNA 4F93B 5GTIC 1IC8A 2A61A 2ELKA 1OYWA 1R23A 1EH8A 4A6EA 4BACA 3P9IA 4ESFA 2J5PA 1H0MA 1XCBA 3BLYA 3LNQA 5IP7J 3P9CA 4N9IA 3BPXA 2X48A 4A3JJ 1HW2A 3CCLI 4A3KJ 4A3FJ 4CGZA 3T8TA 1WJ5A 3TOBA 1HW1A 3S3MA 2FBHA 4E7ZA 2BY2A 4EJUA 4QSHA 1W5TA 3E0JB 3OYLA 4F7ZA 2ZSHB 4A3DJ 1PVEA 1JT0A 3A1YA 3QU3A 4HF0A 2RGVA 1R5GA 1IXRC 2VUMJ 1HW5A 4DJAA 4ON0A 4XLAA 1PYVA 1YTYA 1ZKGA 2R0QC 2K9SA 3JRCA 2F5CA 3MCZA 4L0YB 3KCCA 5HNFA 2MH2A 1GHCA 4XLEA 3C2BA 2E19A 2LY2A 3HGYA 3OS2A 3ZR8X 1JKRC 4JYKA 2HVRA 2PMUA 2A6HF 3JTGA 3M4OJ 1K6OA 3F72A 3CO7C 1OCRH 1USTA 3DV8A 2OBPA 2IRFG 3NRVA 1ZRFA 3ABLH 3I0TA 1MNDA 3KZIC 4UUTA 3U1DA 3KYDB 3IRRA 3IAS2 1KU7A 1XN7A 1ZR4A 5LEKA 4AUXA 5HS8A 4CYDA 2JPCA 1K79A 3GW2A 1TLHB 4RGRA 1RNLA 2BGCA 3HOUJ 1IN6A 3U1KA 2V7FA 3K4BA 3FHNA 3O2PE 4BUPA 4YFKF 3V7RA 2N8GA 2XROA 4RLQA 3DTKA 1E3OC 3BQYA 3FXMA 5E17F 3L2WA 4Z2YA 1Z7LA 3OY9A 2KIFA 2GXGA 4IZZA 2LOOA 2NNYA 1ZH5A 4UB8C 5D4RA 2LD5A 3ECOA 2RKHA 1J5YA 4JX4A 2HOEA 4BHCA 5FB2A 4U7BA 2ESHA 2IS6A 2VE8A 4M6YA 5HS9A 3MN2A 4BY7J 2K5CA 4J19A 1RZ4A 1FTTA 5DCMA 3HDDA 3C2GA 4UUSB 3LSHA 2QKLB 4KISA 2NOJB 2Y31A 3E97A 2FEZA 4Y17A 1ETVA 5L3GA 1GXQA 5F0HA 2CUEA 1W5SA 3ELKA 5HLIA 1RR7A 1PP7U 3ABTA 3S3OA 2W57A 2R7DA 1Z1DA 3MKYB 1ETKA 2RREA 5M5YJ 2HOTA 1FX7A 2NVYJ 3K4JA 4Y7NJ 3CCSI 1W5CC 1N75A 2VBZA 4I99C 3WTTC 4S0HB 1FSHA 2PMZA 3JRAA 2CWEA 2XKOA 1XGOA 2LC2A 2IA2A 3DTIA 4A6DA 5FKOA 5KVRA 3TO7A 4M74A 5GAEJ 1LDKB 2NVTJ 2OCEA 4YIRX 2OZ6A 4HQEA 4O5VA 5F1RA 1B72A 1U9NA 4A3EJ 1BR2A 4B8XA 2HYGD 2XRLA 5JLXA 4OOIA 3L7WA 2V9PA 3BG9A 2R92J 3DQVC 2HDDA 5J40A 3JRBA 2ZJ2A 2E1OA 3DU6A 4IRHA 5GP9A 2MD5A 2K86A 2TRTA 3GZ6A 3UKGA 2EFWA 2YR2A 3B73A 4XKBA 5E3NA 4M71A 5EGOB 1YQAA 1SVLA 2DT5A 1H9TA 2WTEA 2PN6A 1U9OA 3NQOA 3DP7A 1SFXA 2XB5A 2F6CA 1P6RA 2VXZA 3GTMJ 2PQ8A 1Z6RA 3HUGB 3K4KA 3BP8A 5LHHA 2XGEA 1YRNB 4HV5A 1I1GA 1X3UA 4RGXA 4XLHA 5KAFC 2DOEA 2NS0A 1D0ZA 4BS9A 1SVOA 4LJZF 5EEHA 3AAFA 3SYTA 4U0WA 2P4WA 2ZXHA 4Y3OA 1TWCJ 2CYYA 2R7ZJ 3E3VA 3RDIA 3K4MA 4D7NA 1BC8C 1FLIA 2K02A 4A0XA 4ZZLA 2O03A 1P4WA 1IUYA 1P4AA 1ULYA 2M7AA 1OQYA 4HSTA 4RS8A 5KNLA 1KGSA 1X58A 1R36A 2EZHA 2ZCWA 4F3QA 1JJ8C 1A36A 1T39A 4L9TA 4BE1A 1MH4A 2Z2SB 1S3JA 1Y39A 4LK1F 1UFMA 2Y30A 4RMNA 5AIQA 2VBYA 1U2WA 1YJ9I 1W1WE 1FPQA 2IJLA 1QPMA 2ID3A 1G2HA 3CC4I 2X6WA 1Z3XA 5DM7F 3VSLA 4P96A 1Y0UA 1HKSA 1YYVA 4PUSA 3HPGA 4QIWN 3HOTA 3S3NA 2W84A 1T38A 2Y0SA 5IY5H 2NXNB 1IN5A 2BY3A 1FYLA 2CH0A 5CVRA 2HDCA 1FBQA 1Q1HA 5K7HA 1NHAA 2LF8A 3CCUI 1UCRA 1SMYF 2LLKA 3OYBA 4MLOA 4BJTA 3H3VK 1O3QA 3LQQA 4I01A 3I4PA 1ZGJA 4I7HA 4C3JJ 2QWWA 4G6QA 5HS7A 3KZZA 4D0PA 3HPHA 2HQRA 2KJCA 5ERIA 4BAYA 2KRFA 3ZMUA 1MJ9A 4FASD 5LGTA 2JA8J 2DFFA 2P5LC 1OFCX 1BM9A 2FUG2 4KYWA 5CYVA 1ZLJA 3QYFA 5JFRA 4NHJA 4YIIA 3ERED 4XRSA 1P7IA 3EUAA 1MMNA 4IF4A 3TMOA 1BI3A 4BHPA 2VXDA 2TDXA 4CA0A 1APLC 1WKMA 3G1OA 1G8XA 1EH6A 1QZYA 1SEUA 3BQZA 2K4BA 2VASA 2VQCA 3SZPA 1LVKA 4BE2A 3BY6A 2Y9ZA 4AYBN 1FC3A 3OV8A 2K4JA 3ZQQA 4WX9A 4ESJA 3CCYA 3ABMH 3S93A 1I39A 5B5EC 3KP3A 5FFZA 4PGGA 1R9TJ 1JGGA 2JUGA 3WE3A 4L9JA 2VONA 2ZJPF 1R49A 1IDZA 2XIGA 2GAUA 2YX4A 3HBLA 5F04A 3OSGA 4IHVA 5DCMB 1NG7A 1JTYA 3I71A 1VQMI 2RC4A 1AWCA 1PDNC 2FBIA 3P7NA 2FE3A 3RKXA 1O7LA 3MWMA 4HA8A 4CCLA 3JRDA 4XORA 3GLXA 1OLTA 4HV6A 5A2QZ 3ZMZA 3N05A 4CDGA 5LRSA 1MBKA 2EA4A 2Y69H 5H2FC 2E34A 5D6FA 3DPUA 4KJZA 1BR1A 4DIQA 3WHCA 4YIFA 3K4CA 3SJMA 4L18B 3RI4A 2DXIA 4RM2A 3KIOA 4F55A 2FF4A 1LE8A 2O9LA 3AL0C 4LFUA 3OYCA 3WHBA 2HPIA 4M72A 1VI0A 2XGXA 4GYIA 1WSUA 4C2TA 2OUMA 2COMA 2CJJA 2Y9YA 4MFDA 1TWHJ 2KRCA 5M5XJ 2P6TA 5JVGF 1G3WA 3TL4X 5JVTA 3FKIJ 2O8KA 2E36A 4CYCA 1X19A 4HF2A 3GTKJ 2LKXA 2IBDA 5J1RA 3IWFA 3LMMA 3QP6A 4C2UA 1I6HJ 1RIOH 2YX7A 1XTAA 3ASNH 5FROA 4TV7A 3I3LA 4P1WA 5FKLA 1OPCA 4IOAF 4NQWB 2E71A 5HLGA 3BCBA 4M6XA 1KU2A 2IS4A 2MFZA 1IZ1A 5J4VA 2VC1A 2HFHA 2V79A 2VE9A 5KAIC 2WWYA 1IRZA 2IA0A 1R00A 4L5JA 5F08A 1P7JA 5FKMA 1SFKA 1LFPA 2V1UA 5FFXA 4KFCA 1MNEA 1U0JA 2LY9A 3DWLE 2DA3A 2LBFB 2GBYA 2K9NA 4WCGA 2NVQJ 2COBA 2M9HA 2DK8A 2JA6J 2OD5A 3CJTB 1N78A 3PQJA 4CCOA 4RBOA 3M9AA 4IJAA 3KLNA 4Q48A 2Q2EA 1QZEA 3L2VA 2P5KA 1U5TC 2HTJA 2TCTA 1U8RA 4AVZA 1GVJA 5E20A 1X3WB 4B48A 2CV2A 1XMXA 2GIVA 2AQFA 4N0BA 5B66C 2CV0A 5E3OA 2CRGA 3RIRA 3W2WA 1ZLKA 2QM3A 2LH9A 4Q47A 2XDVA 3CTAA 1B1BA 3BJAA 1BW6A 2DFIA 3LA7A 2OU2A 2LTPA 1TQIA 4WXDA 2R7SA 1BW5A 3OS0A 1FSEA 2ZXIA 4XOPA 1VQPI 4KMUX 4AU7A 3ZQGA 3A01A 3BR2A 5IT9K 1A6QA 3M07A 4FCYA 3KZYA 4IXAA 3E5UA 3REOA 1JHHA 3H35A 3ZRGA 4X1EA 5FJ8J 1U8BA 3S14J 2DLLA 1ONVA 3F23A 5K5OA 4ZTFA 2H6CA 4A3GJ 4CCKA 4G8XA 3F6VA 3C2HA 3BPVA 2L7KA 4MQVA 2GZWA 1IG7A 1WJEA 2P7VB 4MFEA 1D0YA 3U9GA 2QUFA 3JAMZ 4ZYHA 1ZG1A 1HQCA 2L02A 2QF7A 3OIQA 2FMLA 1BA5A 1JE8A 4A0ZA 4XLCA 3K1PA 2L54A 2M0CA 5JHUA 2XAJA 3FXJA 1QQIA 4UV8A 3K0LA 2L7ZA 3BC8A 4BJ6C 3H5AA 2M8GX 1H9GA 4HSRA 3V4GA 2JA2A 2DA2A 2DU9A 3CDHA 3FHZA 4PSXA 3CMAI 4XOTA 3GFJA 3FXUA 2BE5F 3CJQB 4RAYA 4I76A 4U0VA 5DD4A 3SDGA 2EB7A 3F8MA 2AO9A 3S2DJ 1ON1A 3C1DA 5DUIA 4Y4RA 2XKPA 3GO5A 1MW7A 1RETA 4IEJA 4U88A 1AU7A 2XAUA 2OA4A 5L3DA 1V5GA 3TOAA 2M2EA 1LDJA 2VKVA 1VZ0A 2E1MB 5KK1A 1EF4A 3GUDA 1QNTA 1VQKI 5CVVA 2WAQA 2WAQN 4G7HF 5E8IA 2K7LA 5H6RA 3TEDA 1HCRA 4HPQA 4PGHA 5E18F 3M8EA 3BG5A 5IPAA 5HNHA 3LFUA 4JOMA 5FKNA 4ZYAA 4C2MJ 3A0HC 1X1DA 2HZDA 1I27A 2NS7A 4FE4A 1PUFA 4OIOF 1OR7A 2F5VA 5D8KB 2KZVA 4DZJA 3SFIA 3HIFA 4M6VA 1MSEC 1SANA 3MZ8A 4HNVA 4FETA 4C9YA 4LB6B 1G6NA 4MEYF 4D9JA 4XQFA 4Q5SF 3LAPA 3Q3SA 4XBFA 2LK2A 5FLMJ 4PDKA 3E6CC 4M9ZA 4YFXF 5JI6A 2EK5A 4XK4A 3J7YJ 3MZYA 4P55A 1MBEA 1RESA 3HOYJ 2CQQA 2A05A 2R3SA 5BOXA 3GTLJ 1TQPA 2DT7B 3OYIA 5FD5A 2JVHA 3LSTA 4CYCB 1JKQC 1S6LA 4ZDLA 3K69A 3NEUA 4ESBA 2DA7A 1XGMA 2KQRA 3C3WA 2KDZA 2JRTA 1JXSA 3KEQA 3OS1A 1LFBA 3PSFA 2HR3A 2V4JC 4RM3A 1KONA 1YLFA 3DU5A 4FE7A 2WAFA 3DPTA 5D5UB 3CCEI 3HSRA 1WCMJ 5ICCA 5EZHA 1JKOC 1YS7A 1P92A 2BXYA 1M1EB 1S7EA 4HX7A 1IJWC 2ETHA 3IH4A 4E6KG 3ZOBA 1TWFJ 3L09A 1YOVB 5LLQA 1FMWA 2NYXA 5ILSA 3QAHA 4BQAA 2DMPA 1FIAA 2PI0A 2EFPA 3G2BA 2ZMEB 2VQHA 3S17J 4II3A 5BPDA 2LF7A 3AKZA 4ENKA 3I9V2 2YS9A 3A02A 3LSJA 4XKCA 4CICA 1MKMA 2BV6A 2HXOA 1Z0XA 3BG6A 1OKRA 3VYSB 2NS8A 2R5YB 4BXUA 3SHFA 1J59A 1Z6TA 1JI8A 2HVQA 1U5TA 3CCQI 2Q2EB 2LREA 4FX0A 3LL7A 2E5NA 3S1MJ 4QPOA 5DS9A 2FA5A 1T0FC 3BTCA 3JCUC 2PG4A 1SC7A 2W4SA 4B47A 3G6EI 4LK0F 4X6AJ 2DTZA 4XKVA 2XB0X 2EFQA 3CP2A 3WODF 4LOCA 2A6TA 1XGNA 2CQKA 2DW4A 4DGWB 3J80Z 1DQUA 5EEGA 4A3IJ 3A01B 2E1CA 5ILVA 1IXSB 1RRJA 1VQOI 2CQXA 1VF9A 1AKHA 1LQ1A 1VQLI 1Z21A 1O3TA 2IGMA 2IGKA 4LIVA 2JA5J 1ORKA 4HW0A 3RKYA 1ZARA 2QQ9A 2QQAA 2RVCA 1IN4A 3OYGA 3CP8A 3JRHA 2XGDA 1MJBA 3K2AA 2L7MP 2R7RA 2L5QA 3PUBA 4FT8A 1XGSA 3BJOA 1ZK8A 5L3EA 2RNGA 1YIJI 2HPMA 2X9DA 2VJJA 1ZELA 2E7XA 3OOUA 1FOYA 1IV8A 4A69C 1WI3A 2CFOA 2EFNA 1IF1A 2P0WA 2IXSA 4LB5A 3HOXJ 2PJPA 2JQ7A 5EG0B 2EQRA 3WTZA 2LSOA 2VIXA 4JQFA 4I0AA 1XSVA 1GVDA 2E60A 3R60A 1IN8A 5K5QA 2VBWA 3K4NA 2MLGA 4OAYA 2GA1A 4GDFA 2Z3YA 1CQTA 1TT5B 5DUKA 3J80K 1GDTA 1WJAA 3WU0A 3CUOA 4LLLA 2A68F 1G3SA 4J01A 2R7WA 2EZKA 2XC7A 1PP8F 4IHYA 1ZHFA 3PNVA 3HC7A 4HF1A 4ANJA 2DDAA 2K27A 2G9WA 1IDYA 2YU3A 2HS5A 4D5CA 1IUFA 1HKQA 3EQLF 2JJ7A 3FMSA 1FMVA 4NUBA 2EJRA 2I5UA 5HLHA 4XONA 1MNMC 2EV0A 3JRGA 2K9QA 2ELHA 4Q4ZF 4XL9A 3H5NA 4I6ZA 2YUSA 3TQNA 1RI7A 2FMYA 4LMYA 5DYMA 1XB4A 1WJDA 1Y8QB 3CCVI 3K9TA 3FBIB 3I59A 2ACJA 3VSKA 4PCQA 4EQQA 1MSFC 4CCJA 5CJ9A 3T1BA 2HYFA 3E6BA 3E7LA 5H20A 2R7VA 4K2EA 1TP4A 4U87A 3T5XA 1VQ4I 3H9JA 5L3BA 1P9QC 3B02A 3AG1H 3VODA 1UELB 1HSTA 2F5FA 3KEOA 3GTGJ 1TZLA 2DMQA 5KCMA 1POGA 1K83J 3DLLF 3IP4B 3TP0A 2O7OA 2W24A 2A69F 4D7MA 4LLGF 4WWCA 4PK4A 3IH3A 1ERDA 1YI2I 2VLAA 3CUQB 5IOZA 3TDUC 2DN0A 3IAM2 2GA2A 2ZO4A 3KP4A 1SAUA 4CH7A 3K4LA 3IH2A 3HKZN 4YG2F 1WPKA 3N4MA 2HWVA 2LFBA 2FRHA 4HYEA 3IKVA 4HQMA 1D3YA 1JHFA 1R22A 1R4NB 2OQRA 5J47A 5LGUA 2ME0A 1J09A 2VOPA 1IRXA 2EIMH 3S1RJ 4HZFA 1G3YA 3W3CA 4AIDA 4NNJA 2DFEA 3FK7A 1W7PB 1BOBA 3GWZA 3EUHC 5JHFA 2OQGA 1K78A 2I10A 4M9XA 2P81A 2AXLA 2X85A 3HJEA 5IYCJ 1HDPA 3KP2A 4DOZA 2CMPA 2IAIA 1FJLA 2FD5A 1FY7A 1T0FA 3BDDA 4EGYA 3GFIA 2H8RA 3JREA 1QHHD 2RQQA 1ZTRA 4F91B 2L3DA 3KYCB 3HSFA 4D5FA 4XN0A 3FDYA 2DPDA 1JTXA 2V6EA 2M34A 3RJPA 2QYOA 3ZQIA 1ZGWA 1CGPA 1WRJA 3VYRB 2HTSA 3E5QA 2CS3A 2X51A 2DYRH 3V42A 1W36C 3W2AA 2E2IJ 4AVPA 2WB1N 4G9YA 2CSOA 1R5ID 2H94A 3O8GA 3GTJJ 1BN5A 1D5YA 4AIHA 5M3MJ 1R1TA 2A5WA 2FNAA 2ECBA 4JBAA 1EJ9A 4AM3A 3DKXA 2ZXWH 3HTUA 2BZTA 2NOGA 2LKSA 3HOVJ 4OMYA 2ZKZA 1Z77A 3HM5A 3FKJA 2YSRA 3F9KA 1IRGA 3H5RA 3OYMA 3QU6A 2STWA 4LG0A 1RPWA 2L9RA 2X1DA 1MIJA 3B6CA 5CPRB 2MSYA 2F4OB 4I2OA 2AQEA 2KFDA 2XUBA 5IT3A 2VT2A 3JSOA 2WBMA 2Q0OA 2DCEA 2ZXJA 3PSIA 3BG3A 4Z6YA 3MVPA 3BZKA 5E8GA 4ZYGA 4M3BA 1HXDA 4IRIA 1TWAJ 1YW8A 2DPUA 3QWLA 2DA5A 3LSMA 2GXAA 2VODA 2Z99A 3HYIA 2M8EA 2KHMA 2O3FA 3F8CA 4HLXA 1HLVA 5LHGA 4UY8I 2MLKA 1IO2A 2BVMA 2A5YB 2IGNA 1H88C 4EJOA 3HHGA 1KYZA 2EV5A 4Y15A 3WE2A 1YX3A 2QQBA 5TRDA 2BY1A 2FQ3A 2JA7J 4QWQA 3PNYA 4EVIA 2HKOA 3D5SC 4RAFA 4GCVA 2M5WA 4G12A 2RNJA 1J2XA 4HAMA 4RAGA 1OYIA 3MKZA 3H3UA 3TW7A 2V9VA 2XPVA 3MMYB 2KKOA
chains in the Genus database with same CATH topology
3K1MA 3H92A 2DBBA 2KIMA 3GZ5A 3M1EA 1BOAA 4LLNA 1W7PD 4NB5A 4UUVA 3GYHX 1ZGAA 2CO5A 3J81K 2VOOA 1D8JA 3IC7A 2Z33A 4UVAA 2IA1A 5J8FA 3F21A 4P5OA 5BMZA 2J5OA 4ZZDA 4HX8A 1OMIA 4RAZA 2XVCA 2VBXA 2XAHA 5K1YA 2OAZA 3EYIA 3VB2A 5CVIA 1KYWA 2FU4A 1YFHA 4BH9A 4FX4A 1R5HA 3VOEA 5D8LB 4BHBA 3Q9SA 3QPTA 4KMFA 3IKTA 5HDKA 3FXQA 1U78A 2CFXA 1K78B 1E2XA 2M45A 3KFWX 1QBJA 1J75A 1DPUA 1TBXA 3BROA 1KQ9A 5IT9Z 2G7HA 3BJ6A 4OIPF 1I1SA 1DPRA 4RB0A 3F6OA 3ROUA 3JW4A 2GQQA 3BOQA 1P2FA 1QO0D 3RYRA 3K1NA 3RYPA 3S2WA 4KA4A 2P5VA 3U2RA 1F4KA 3ZN1A 1I6XA 4KIGA 1T6SA 3SZTA 1Z7UA 2E1NA 1SD7A 4LG0B 4KN7X 4RB1A 4OMZA 4UV9A 1IRFA 2E7WA 2BYVE 3RPUA 4MHGA 1O57A 5D6EA 3D0SA 3IWZA 4BNCA 3GFMA 2HGCA 4A0YA 5BPIA 1FP2A 6PAXA 4ZYEA 3WGGA 4UVBA 2DTRA 3LA2A 2HEOA 3IRQA 1R1UA 2STTA 2KJBA 1J9IA 1RUNA 1FWZA 4IRGA 3D5LA 4A12A 1YO5C 2ESNA 1R58A 3I5UA 4LGWA 1XD7A 4OU0A 4B09A 1B9MA 2HZTA 1LVAA 5HDNA 5JR3A 5DEQA 3M8FA 1SAXA 2JZYA 3FXRA 1VTNC 5CLSA 3K2ZA 1B59A 3LAJA 1O3SA 3WG9A 1ON2A 2Y48A 2UZKA 2VC0A 3F22A 2L4MA 2QENA 2FXAA 4R1HA 3MZHA 2Z5UA 4O6JA 5E1WA 1XDUA 2IW5A 4HOBA 3ZMTA 3RPQA 3KETA 4G7ZF 1DDNA 1SFUA 5K5RA 2XAQA 1ZRDA 2XHKA 3ZPLA 4EGZA 3VFZA 5F64A 1W4MA 4CZZA 1TNSA 4RGSA 2WC2A 3RTRA 3SFZA 4XLNF 3QOPA 1XMKA 2FBKA 3G3ZA 1Z91A 3WTVC 2XAGA 4OINF 1FNNA 2NRAC 2MH9A 3RKWA 4EM0B 4GGGA 2PLYA 2KIUA 5ICFA 4WF2A 1RUOA 2VN2A 2IVMA 4RGUA 3HRMA 4M9SA 3E6MA 4XLPF 1EH7A 4KUMA 3GVAA 4G6DA 5DV5A 1ODDA 1BI2A 1IW7F 5D5WB 2RQPA 3KP7A 5H6QA 1ZAOA 2JTVA 1STZA 3F3XA 2F5DA 4DNCA 5F6FA 3BWGA 1V3FA 4ENMA 3ZMDA 5J8CA 1G4DA 3KE2A 4XRFA 1KQ8A 4G94A 1AOYA 3KP6A 5DDGA 1CF7A 4S05A 1UHMA 3TO6A 2X0LA 4EJVA 3CO6C 2JSCA 2XV4S 5J6XA 3R6SA 1J7KA 1TTYA 2NNNA 2EWNA 1LNWA 2ZFWA 2H09A 4HBLA 4Y13A 1K7AA 3E5XA 5FLXK 4I09A 4OIRF 3CLOA 1LEBA 2DI3A 4EM2A 1FT9A 1REPC 3FZVA 2O61A 3ZN0A 3MEXA 3QRFF 1B4AA 1YS6A 3R0JA 1BIBA 2JT1A 3QPHA 3F8FA 3TO9A 3GX4X 4E70A 4R8HA 3ECHA 1O7FA 5LHIA 3GXOA 3R0AA 1ZREA 3WTSC 3EDPA 3F8NA 2H27A 1BBYA 1WQ2A 1F5TA 2MC3A 3W6KB 3V7CA 3H3ZA 1XSDA 1ZG5A 5D4SA 2O6GE 3Q9VA 3R61A 1WWXA 4JK1X 4AWXB 4GO1A 3L00A 3IL2A 3MQ0A 1MJAA 3V8KA 1XCVA 3FF5A 1SD5A 3I58A 1FBUA 1YW9A 2RDPA 2YPRA 4CO8A 2L01A 3JSPA 2BEOA 2P8TA 3F8BA 2LNBA 4EJWA 1XSXA 1D8KA 3WTYC 3O6BB 3HTSB 3DEUA 5FD6A 2CGPA 2M1BA 3WTXC 1FBSA 2HKXA 4GYGA 3O3KA 5HDGA 2Q8KA 3DKWA 1S7OA 3PFIA 4ETSA 4A2UA 1GXPA 1YG2A 1L3LA 3GEZA 1IXCA 2Y0MA 1U5TB 3Q5FA 4M73A 2DO7A 3DXJF 1TQMA 3I53A 4H0EA 4AIJA 3HRSA 1C0WA 3DF8A 4KICA 2AS5F 2D2WA 1LJ9A 2H6BA 4I02A 1P4XA 4P9UA 3CJNA 5L3CA 4NQWA 1CF7B 3ZP5A 1MZBA 3ZMSA 5BQTA 2MBFA 3G73A 1YIOA 4MTEA 2NAZA 4WK8F 4XSZF 2JPBA 5E1XA 2LDUA 2OZUA 1A04A 1XDSA 1HBXG 2P7CB 2V6CA 3LWFA 3COAC 3I54A 3J81Z 2A07F 2DQRA 2Y75A 3MAJA 1PUEE 2Z9OA 5TJJA 5CVJA 2XASA 3JTHA 3WGIA 1FOKA 5HOOA 3T8RA 4R79A 1SMTA 2IT0A 5ED4A 4UHTA 2VT3A 1B6AA 2LKPA 1SD6A 2D1VA 4A5MA 1BI0A 1F9NA 4KDPA 1HSJA 1UHWA 5FGMA 4UVCA 5ICEA 3I59B 4EMSA 3KP5A 3QP5A 1KQ0A 3P9KA 1ZRCA 3C7JA 1J0RA 2F5EA 3TGNA 1KU9A 3M7GA 4L9VA 4RB3C 4CXFA 1MDMA 4HDUA 4YFNF 3ISPA 2PBIA 4EJTA 2DQLA 4OIQF 2O8XA 1QGPA 2D45A 2RN7A 2A6EF 3LA3A 1DUXC 5CVUA 2V1DA 3W6JB 4HDVA 2B0LA 3FM5A 4KN4X 4IHSA 3FM3A 5AIPA 2CW0F 1Z05A 3OOPA 5L3FA 3FMRA 2W25A 4G7OF 3EUHA 1ZYRF 4CHUA 2BBYA 5D5VB 4PZJA 5BS6A 3L9FA 3FMQA 2L4AA 5D5XB 1UB9A 2EFOA 4N9HA 1OYYA 2ADUA 2WV0A 1SFEA 2ISYA 4ENJA 2MA3A 5LBQA 1V4RA 5DCFA 4WXCA 4MGRA 3GF2A 1IAWA 3IHUA 1B9NA 2CG4A 3N97A 3CUQC 2RV8A 2M30A 3GFLA 1U6GA 2DK5A 4FHTA 2FOKA 4I0BA 4ZH4F 3HRTA 1S8NA 1T2KA 1F1ZA 5A2QK 1QZZA 3WTUC 2ZMEA 4KT5C 2QZ8A 3BZ6A 3SXYA 2GXBA 4O3MA 1D5VA 4MTDA 2ISZA 5ICGA 2V1XA 1E17A 1USSA 4HLYA 4IHTA 3ABUA 1FP1D 3DFGA 3ZQ7A 2UXNA 1S7AA 2QBYA 4EM1A 2R7FA 4UXNA 2A3SA 5DD8A 1BI1A 1HKTA 2IP2A 2PFBA 5AONA 5FO5A 2EV6A 4KNYA 2P6SA 3VEPA 3WU1B 5E1ZB 5LEJA 4U0YA 1BC7C 4A5NA 1XMAA 4UNOA 3TDZC 4LD5A 4HX4A 1IN7A 4P9FA 1U3EM 3FX3A 2FSWA 1FYMA 4I98B 3EETA 3E6DA 1YW7A 1SD4A 3V8JA 4MNUA 1TW3A 2C6YA 1KA8A 1FYKA 4QLCU 1MDMB 3DPLC 2W85A 2O0YA 1Z9CA 1TW2A 3LQRA 2UWMA 4IPAA 3PQKA 3SQNA 4ENNA 2XAFA 3HOSA 1EV7A 2ZNZA 2HQNA 1R1VA 3WTWC 2G7UA 3TKYA 3HRUA 4L5IA 2GWRA 3ML6A 3LFKA 1LEAA 2D1HA 4XSXF 3JAMK 1O3RA 5LRRA 3ZMVA 3WGHA 2FNPA 1ZN2A 4L9NA 1FZPB 1I5ZA 3R4KA 2DAOA 1S29A 3V8LA 2QVOA 4RB2C 3I64A 2QLZA 3L2CA 2IPQX 1LB2A 4AD9A 4WXHA 4GXOA 3MFKA 1LDDA 1R7JA 4AIKA 1TNTA 1T98A 4IVNA 3C18A 3CUQA 4BYYA 5HVQC 3HSEA 1MGTA 4MEXF 2ZNYA 5ILUA 2F2EA 3FWEA 1ZG3A 2EA2A 4MQ9F 5FLXZ 4KIBA 2ZBKA 1BIAA 4S04A 1DP7P 4L0ZB 3KLOA 1WI9A 1W7PA 1BJAA 3T0YA 1JGSA 3EYYA 4ZYDA 2UXXA 1MD0A 4KIFA 3J7AO 1KU3A 2QBYB 4ASNA 1L0OC 3V7SA 4EV0A 2X4HA 3HUGA 2XRNA 2PEXA 3HHHA 3ULQB 1G3TA 4U7DA 4DQ2A 5LGNA 2M87A 2PMHA 2A61A 1OYWA 1R23A 1EH8A 4A6EA 3P9IA 4ESFA 2J5PA 1H0MA 1XCBA 3P9CA 4N9IA 3BPXA 1HW2A 4CGZA 3T8TA 3TOBA 1HW1A 2FBHA 4EJUA 1W5TA 4F7ZA 3QU3A 4HF0A 2RGVA 1R5GA 1IXRC 1HW5A 4ON0A 1YTYA 2F5CA 3MCZA 4L0YB 3KCCA 2MH2A 1GHCA 2PMUA 2A6HF 3JTGA 1K6OA 3F72A 3CO7C 1USTA 3DV8A 2OBPA 2IRFG 3NRVA 1ZRFA 3I0TA 3U1DA 3IRRA 1KU7A 1XN7A 5LEKA 5HS8A 4CYDA 2JPCA 1K79A 3GW2A 1TLHB 4RGRA 1RNLA 2BGCA 1IN6A 3O2PE 4YFKF 3V7RA 2XROA 5E17F 4Z2YA 2KIFA 2GXGA 2NNYA 1ZH5A 5D4RA 3ECOA 2RKHA 1J5YA 2HOEA 4BHCA 5FB2A 4U7BA 2ESHA 2VE8A 4M6YA 5HS9A 1RZ4A 5DCMA 3E97A 2FEZA 4Y17A 5L3GA 1GXQA 1W5SA 3ELKA 5HLIA 1PP7U 3ABTA 2W57A 2R7DA 1Z1DA 1FX7A 2VBZA 3WTTC 1FSHA 2CWEA 2XKOA 1XGOA 4A6DA 2IA2A 5KVRA 3TO7A 4M74A 1LDKB 2OZ6A 4HQEA 4O5VA 5F1RA 4B8XA 2HYGD 4OOIA 3L7WA 3DQVC 2ZJ2A 4IRHA 2MD5A 2K86A 3GZ6A 2EFWA 2YR2A 3B73A 4M71A 1YQAA 2DT5A 1H9TA 2WTEA 2PN6A 3NQOA 3DP7A 1SFXA 1P6RA 2VXZA 2PQ8A 1Z6RA 3BP8A 5LHHA 4HV5A 1I1GA 1X3UA 4RGXA 2NS0A 4LJZF 5EEHA 3AAFA 4U0WA 2P4WA 2CYYA 3E3VA 3RDIA 1BC8C 1FLIA 2K02A 4A0XA 4ZZLA 2O03A 1P4WA 1IUYA 1P4AA 1ULYA 4RS8A 1KGSA 1R36A 2ZCWA 1T39A 4L9TA 1S3JA 4LK1F 1UFMA 5AIQA 2VBYA 1U2WA 1FPQA 2IJLA 1QPMA 4P96A 1Y0UA 1HKSA 1YYVA 3HOTA 2W84A 1T38A 1IN5A 1FYLA 5CVRA 2HDCA 1FBQA 1Q1HA 1NHAA 2LF8A 1UCRA 1SMYF 1O3QA 3LQQA 4I01A 3I4PA 1ZGJA 4I7HA 2QWWA 4G6QA 5HS7A 3KZZA 4D0PA 2HQRA 2KJCA 5ERIA 4BAYA 2KRFA 3ZMUA 1MJ9A 5LGTA 2P5LC 1BM9A 4KYWA 5CYVA 1ZLJA 5JFRA 4NHJA 4YIIA 3ERED 4IF4A 1BI3A 4BHPA 2TDXA 1WKMA 1EH6A 1QZYA 2K4BA 3SZPA 3BY6A 1FC3A 3OV8A 2K4JA 4WX9A 4ESJA 3KP3A 5FFZA 4PGGA 3WE3A 4L9JA 2VONA 2XIGA 2GAUA 2YX4A 5DCMB 3I71A 2RC4A 1AWCA 1PDNC 2FBIA 3P7NA 2FE3A 3RKXA 1O7LA 3MWMA 4HA8A 3GLXA 4HV6A 5A2QZ 3ZMZA 4CDGA 5LRSA 2EA4A 5D6FA 4YIFA 4L18B 3RI4A 2FF4A 4LFUA 4M72A 2XGXA 4GYIA 1WSUA 2COMA 2P6TA 1G3WA 5JVTA 4HF2A 3IWFA 3QP6A 1RIOH 2YX7A 4TV7A 1OPCA 5HLGA 4M6XA 1KU2A 1IZ1A 2VC1A 2HFHA 2V79A 2VE9A 2WWYA 2IA0A 1R00A 4L5JA 2V1UA 5FFXA 4KFCA 4WCGA 2DK8A 2OD5A 3PQJA 3M9AA 4IJAA 3KLNA 4Q48A 2Q2EA 2P5KA 1U5TC 2HTJA 1U8RA 1GVJA 5E20A 2GIVA 4N0BA 3RIRA 1ZLKA 2QM3A 4Q47A 3CTAA 1B1BA 3BJAA 3LA7A 2DFIA 2OU2A 1TQIA 4WXDA 1FSEA 4KMUX 5IT9K 3KZYA 4IXAA 3E5UA 3REOA 1JHHA 2DLLA 1ONVA 3F23A 5K5OA 2H6CA 4G8XA 3F6VA 3BPVA 4MQVA 2GZWA 2P7VB 3U9GA 2QUFA 3JAMZ 4ZYHA 1ZG1A 1HQCA 2L02A 2FMLA 1JE8A 4A0ZA 3K1PA 2L54A 5JHUA 2XAJA 1QQIA 4UV8A 3K0LA 1H9GA 3V4GA 3CDHA 2DU9A 3FHZA 3GFJA 3FXUA 2BE5F 5DD4A 4RAYA 4U0VA 2EB7A 3F8MA 1ON1A 3C1DA 5DUIA 2XKPA 3GO5A 4U88A 2OA4A 5L3DA 3TOAA 1LDJA 5KK1A 3GUDA 1QNTA 5CVVA 4G7HF 5E8IA 2K7LA 5H6RA 4PGHA 5E18F 3M8EA 1I27A 4OIOF 1OR7A 5D8KB 3HIFA 4LB6B 1G6NA 4MEYF 4Q5SF 3LAPA 4XBFA 4PDKA 3E6CC 4M9ZA 4YFXF 5JI6A 2EK5A 3MZYA 4P55A 2R3SA 5BOXA 1TQPA 5FD5A 3LSTA 1S6LA 3K69A 3NEUA 4ESBA 1XGMA 3C3WA 2JRTA 1JXSA 3KEQA 2HR3A 1YLFA 3DPTA 5D5UB 3HSRA 5ICCA 1YS7A 1P92A 4HX7A 2ETHA 3L09A 5LLQA 2NYXA 5ILSA 4BQAA 3QAHA 2PI0A 2EFPA 2ZMEB 5BPDA 2LF7A 4ENKA 4CICA 1MKMA 2BV6A 1OKRA 4BXUA 3SHFA 1J59A 1Z6TA 1U5TA 4FX0A 2FA5A 2PG4A 4LK0F 2EFQA 3WODF 1XGNA 2CQKA 2DW4A 3J80Z 5EEGA 2E1CA 5ILVA 1IXSB 1LQ1A 1O3TA 4HW0A 3RKYA 1ZARA 2QQ9A 2QQAA 2RVCA 1IN4A 1MJBA 4FT8A 1XGSA 3BJOA 5L3EA 2E7XA 2EFNA 1IF1A 4LB5A 2PJPA 3WTZA 2LSOA 4JQFA 4I0AA 1XSVA 3R60A 1IN8A 5K5QA 2VBWA 2MLGA 2GA1A 2Z3YA 5DUKA 3J80K 3WU0A 3CUOA 4LLLA 2A68F 1G3SA 1PP8F 1ZHFA 4HF1A 2K27A 2G9WA 2YU3A 2HS5A 1HKQA 3EQLF 3FMSA 2EJRA 5HLHA 2EV0A 2ELHA 4Q4ZF 3TQNA 1RI7A 2FMYA 4LMYA 5DYMA 1XB4A 3K9TA 3I59A 2ACJA 4PCQA 4EQQA 5CJ9A 3T1BA 2HYFA 3E6BA 5H20A 4K2EA 3T5XA 5L3BA 3B02A 3VODA 1HSTA 2F5FA 3KEOA 2W24A 2A69F 4LLGF 4WWCA 3CUQB 3TDUC 2GA2A 2ZO4A 3KP4A 4YG2F 3N4MA 2HWVA 2FRHA 4HYEA 3IKVA 4HQMA 1D3YA 1JHFA 1R22A 5LGUA 2OQRA 2VOPA 4HZFA 1G3YA 1W7PB 3GWZA 2OQGA 1K78A 4M9XA 2AXLA 3KP2A 1FY7A 1T0FA 3BDDA 4EGYA 3GFIA 2L3DA 3HSFA 2DPDA 3RJPA 2QYOA 1CGPA 1WRJA 2HTSA 3E5QA 4AVPA 4G9YA 2CSOA 2H94A 1BN5A 4AIHA 1R1TA 2FNAA 4JBAA 3HTUA 4OMYA 2ZKZA 2YSRA 1IRGA 3QU6A 2STWA 4LG0A 4I2OA 2XUBA 5IT3A 2VT2A 3JSOA 2Q0OA 2ZXJA 5E8GA 4ZYGA 4IRIA 1HXDA 1YW8A 2DPUA 2VODA 2Z99A 3HYIA 2M8EA 2O3FA 3F8CA 4HLXA 5LHGA 2MLKA 2A5YB 4EJOA 3HHGA 1KYZA 2EV5A 4Y15A 3WE2A 5TRDA 2QQBA 2FQ3A 4QWQA 4EVIA 2HKOA 4GCVA 2M5WA 2RNJA 1J2XA 4HAMA 1OYIA 3H3UA 2V9VA 2KKOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3K1M A;  3H92 A;  2DBB A;  2KIM A;  3GZ5 A;  3M1E A;  1BOA A;  4LLN A;  1W7P D;  4NB5 A;  4UUV A;  3GYH X;  1ZGA A;  2CO5 A;  3J81 K;  2VOO A;  1D8J A;  3IC7 A;  2Z33 A;  4UVA A;  2IA1 A;  5J8F A;  3F21 A;  4P5O A;  5BMZ A;  2J5O A;  4ZZD A;  4HX8 A;  1OMI A;  4RAZ A;  2XVC A;  2VBX A;  2XAH A;  5K1Y A;  2OAZ A;  3EYI A;  3VB2 A;  5CVI A;  1KYW A;  2FU4 A;  1YFH A;  4BH9 A;  4FX4 A;  1R5H A;  3VOE A;  5D8L B;  4BHB A;  3Q9S A;  3QPT A;  4KMF A;  3IKT A;  5HDK A;  3FXQ A;  1U78 A;  2CFX A;  1K78 B;  1E2X A;  2M45 A;  3KFW X;  1QBJ A;  1J75 A;  1DPU A;  1TBX A;  3BRO A;  1KQ9 A;  5IT9 Z;  2G7H A;  3BJ6 A;  4OIP F;  1I1S A;  1DPR A;  4RB0 A;  3F6O A;  3ROU A;  3JW4 A;  2GQQ A;  3BOQ A;  1P2F A;  1QO0 D;  3RYR A;  3K1N A;  3RYP A;  3S2W A;  4KA4 A;  2P5V A;  3U2R A;  1F4K A;  3ZN1 A;  1I6X A;  4KIG A;  1T6S A;  3SZT A;  1Z7U A;  2E1N A;  1SD7 A;  4LG0 B;  4KN7 X;  4RB1 A;  4OMZ A;  4UV9 A;  1IRF A;  2E7W A;  2BYV E;  3RPU A;  4MHG A;  1O57 A;  5D6E A;  3D0S A;  3IWZ A;  4BNC A;  3GFM A;  2HGC A;  4A0Y A;  5BPI A;  1FP2 A;  6PAX A;  4ZYE A;  3WGG A;  4UVB A;  2DTR A;  3LA2 A;  2HEO A;  3IRQ A;  1R1U A;  2STT A;  2KJB A;  1J9I A;  1RUN A;  1FWZ A;  4IRG A;  3D5L A;  4A12 A;  1YO5 C;  2ESN A;  1R58 A;  3I5U A;  4LGW A;  1XD7 A;  4OU0 A;  4B09 A;  1B9M A;  2HZT A;  1LVA A;  5HDN A;  5JR3 A;  5DEQ A;  3M8F A;  1SAX A;  2JZY A;  3FXR A;  1VTN C;  5CLS A;  3K2Z A;  1B59 A;  3LAJ A;  1O3S A;  3WG9 A;  1ON2 A;  2Y48 A;  2UZK A;  2VC0 A;  3F22 A;  2L4M A;  2QEN A;  2FXA A;  4R1H A;  3MZH A;  2Z5U A;  4O6J A;  5E1W A;  1XDU A;  2IW5 A;  4HOB A;  3ZMT A;  3RPQ A;  3KET A;  4G7Z F;  1DDN A;  1SFU A;  5K5R A;  2XAQ A;  1ZRD A;  2XHK A;  3ZPL A;  4EGZ A;  3VFZ A;  5F64 A;  1W4M A;  4CZZ A;  1TNS A;  4RGS A;  2WC2 A;  3RTR A;  3SFZ A;  4XLN F;  3QOP A;  1XMK A;  2FBK A;  3G3Z A;  1Z91 A;  3WTV C;  2XAG A;  4OIN F;  1FNN A;  2NRA C;  2MH9 A;  3RKW A;  4EM0 B;  4GGG A;  2PLY A;  2KIU A;  5ICF A;  4WF2 A;  1RUO A;  2VN2 A;  2IVM A;  4RGU A;  3HRM A;  4M9S A;  3E6M A;  4XLP F;  1EH7 A;  4KUM A;  3GVA A;  4G6D A;  5DV5 A;  1ODD A;  1BI2 A;  1IW7 F;  5D5W B;  2RQP A;  3KP7 A;  5H6Q A;  1ZAO A;  2JTV A;  1STZ A;  3F3X A;  2F5D A;  4DNC A;  5F6F A;  3BWG A;  1V3F A;  4ENM A;  3ZMD A;  5J8C A;  1G4D A;  3KE2 A;  4XRF A;  1KQ8 A;  4G94 A;  1AOY A;  3KP6 A;  5DDG A;  1CF7 A;  4S05 A;  1UHM A;  3TO6 A;  2X0L A;  4EJV A;  3CO6 C;  2JSC A;  2XV4 S;  5J6X A;  3R6S A;  1J7K A;  1TTY A;  2NNN A;  2EWN A;  1LNW A;  2ZFW A;  2H09 A;  4HBL A;  4Y13 A;  1K7A A;  3E5X A;  5FLX K;  4I09 A;  4OIR F;  3CLO A;  1LEB A;  2DI3 A;  4EM2 A;  1FT9 A;  1REP C;  3FZV A;  2O61 A;  3ZN0 A;  3MEX A;  3QRF F;  1B4A A;  1YS6 A;  3R0J A;  1BIB A;  2JT1 A;  3QPH A;  3F8F A;  3TO9 A;  3GX4 X;  4E70 A;  4R8H A;  3ECH A;  1O7F A;  5LHI A;  3GXO A;  3R0A A;  1ZRE A;  3WTS C;  3EDP A;  3F8N A;  2H27 A;  1BBY A;  1WQ2 A;  1F5T A;  2MC3 A;  3W6K B;  3V7C A;  3H3Z A;  1XSD A;  1ZG5 A;  5D4S A;  2O6G E;  3Q9V A;  3R61 A;  1WWX A;  4JK1 X;  4AWX B;  4GO1 A;  3L00 A;  3IL2 A;  3MQ0 A;  1MJA A;  3V8K A;  1XCV A;  3FF5 A;  1SD5 A;  3I58 A;  1FBU A;  1YW9 A;  2RDP A;  2YPR A;  4CO8 A;  2L01 A;  3JSP A;  2BEO A;  2P8T A;  3F8B A;  2LNB A;  4EJW A;  1XSX A;  1D8K A;  3WTY C;  3O6B B;  3HTS B;  3DEU A;  5FD6 A;  2CGP A;  2M1B A;  3WTX C;  1FBS A;  2HKX A;  4GYG A;  3O3K A;  5HDG A;  2Q8K A;  3DKW A;  1S7O A;  3PFI A;  4ETS A;  4A2U A;  1GXP A;  1YG2 A;  1L3L A;  3GEZ A;  1IXC A;  2Y0M A;  1U5T B;  3Q5F A;  4M73 A;  2DO7 A;  3DXJ F;  1TQM A;  3I53 A;  4H0E A;  4AIJ A;  3HRS A;  1C0W A;  3DF8 A;  4KIC A;  2AS5 F;  2D2W A;  1LJ9 A;  2H6B A;  4I02 A;  1P4X A;  4P9U A;  3CJN A;  5L3C A;  4NQW A;  1CF7 B;  3ZP5 A;  1MZB A;  3ZMS A;  5BQT A;  2MBF A;  3G73 A;  1YIO A;  4MTE A;  2NAZ A;  4WK8 F;  4XSZ F;  2JPB A;  5E1X A;  2LDU A;  2OZU A;  1A04 A;  1XDS A;  1HBX G;  2P7C B;  2V6C A;  3LWF A;  3COA C;  3I54 A;  3J81 Z;  2A07 F;  2DQR A;  2Y75 A;  3MAJ A;  1PUE E;  2Z9O A;  5TJJ A;  5CVJ A;  2XAS A;  3JTH A;  3WGI A;  1FOK A;  5HOO A;  3T8R A;  4R79 A;  1SMT A;  2IT0 A;  5ED4 A;  4UHT A;  2VT3 A;  1B6A A;  2LKP A;  1SD6 A;  2D1V A;  4A5M A;  1BI0 A;  1F9N A;  4KDP A;  1HSJ A;  1UHW A;  5FGM A;  4UVC A;  5ICE A;  3I59 B;  4EMS A;  3KP5 A;  3QP5 A;  1KQ0 A;  3P9K A;  1ZRC A;  3C7J A;  1J0R A;  2F5E A;  3TGN A;  1KU9 A;  3M7G A;  4L9V A;  4RB3 C;  4CXF A;  1MDM A;  4HDU A;  4YFN F;  3ISP A;  2PBI A;  4EJT A;  2DQL A;  4OIQ F;  2O8X A;  1QGP A;  2D45 A;  2RN7 A;  2A6E F;  3LA3 A;  1DUX C;  5CVU A;  2V1D A;  3W6J B;  4HDV A;  2B0L A;  3FM5 A;  4KN4 X;  4IHS A;  3FM3 A;  5AIP A;  2CW0 F;  1Z05 A;  3OOP A;  5L3F A;  3FMR A;  2W25 A;  4G7O F;  3EUH A;  1ZYR F;  4CHU A;  2BBY A;  5D5V B;  4PZJ A;  5BS6 A;  3L9F A;  3FMQ A;  2L4A A;  5D5X B;  1UB9 A;  2EFO A;  4N9H A;  1OYY A;  2ADU A;  2WV0 A;  1SFE A;  2ISY A;  4ENJ A;  2MA3 A;  5LBQ A;  1V4R A;  5DCF A;  4WXC A;  4MGR A;  3GF2 A;  1IAW A;  3IHU A;  1B9N A;  2CG4 A;  3N97 A;  3CUQ C;  2RV8 A;  2M30 A;  3GFL A;  1U6G A;  2DK5 A;  4FHT A;  2FOK A;  4I0B A;  4ZH4 F;  3HRT A;  1S8N A;  1T2K A;  1F1Z A;  5A2Q K;  1QZZ A;  3WTU C;  2ZME A;  4KT5 C;  2QZ8 A;  3BZ6 A;  3SXY A;  2GXB A;  4O3M A;  1D5V A;  4MTD A;  2ISZ A;  5ICG A;  2V1X A;  1E17 A;  1USS A;  4HLY A;  4IHT A;  3ABU A;  1FP1 D;  3DFG A;  3ZQ7 A;  2UXN A;  1S7A A;  2QBY A;  4EM1 A;  2R7F A;  4UXN A;  2A3S A;  5DD8 A;  1BI1 A;  1HKT A;  2IP2 A;  2PFB A;  5AON A;  5FO5 A;  2EV6 A;  4KNY A;  2P6S A;  3VEP A;  3WU1 B;  5E1Z B;  5LEJ A;  4U0Y A;  1BC7 C;  4A5N A;  1XMA A;  4UNO A;  3TDZ C;  4LD5 A;  4HX4 A;  1IN7 A;  4P9F A;  1U3E M;  3FX3 A;  2FSW A;  1FYM A;  4I98 B;  3EET A;  3E6D A;  1YW7 A;  1SD4 A;  3V8J A;  4MNU A;  1TW3 A;  2C6Y A;  1KA8 A;  1FYK A;  4QLC U;  1MDM B;  3DPL C;  2W85 A;  2O0Y A;  1Z9C A;  1TW2 A;  3LQR A;  2UWM A;  4IPA A;  3PQK A;  3SQN A;  4ENN A;  2XAF A;  3HOS A;  1EV7 A;  2ZNZ A;  2HQN A;  1R1V A;  3WTW C;  2G7U A;  3TKY A;  3HRU A;  4L5I A;  2GWR A;  3ML6 A;  3LFK A;  1LEA A;  2D1H A;  4XSX F;  3JAM K;  1O3R A;  5LRR A;  3ZMV A;  3WGH A;  2FNP A;  1ZN2 A;  4L9N A;  1FZP B;  1I5Z A;  3R4K A;  2DAO A;  1S29 A;  3V8L A;  2QVO A;  4RB2 C;  3I64 A;  2QLZ A;  3L2C A;  2IPQ X;  1LB2 A;  4AD9 A;  4WXH A;  4GXO A;  3MFK A;  1LDD A;  1R7J A;  4AIK A;  1TNT A;  1T98 A;  4IVN A;  3C18 A;  3CUQ A;  4BYY A;  5HVQ C;  3HSE A;  1MGT A;  4MEX F;  2ZNY A;  5ILU A;  2F2E A;  3FWE A;  1ZG3 A;  2EA2 A;  4MQ9 F;  5FLX Z;  4KIB A;  2ZBK A;  1BIA A;  4S04 A;  1DP7 P;  4L0Z B;  3KLO A;  1WI9 A;  1W7P A;  1BJA A;  3T0Y A;  1JGS A;  3EYY A;  4ZYD A;  2UXX A;  1MD0 A;  4KIF A;  3J7A O;  1KU3 A;  2QBY B;  4ASN A;  1L0O C;  3V7S A;  4EV0 A;  2X4H A;  3HUG A;  2XRN A;  2PEX A;  3HHH A;  3ULQ B;  1G3T A;  4U7D A;  4DQ2 A;  5LGN A;  2M87 A;  2PMH A;  2A61 A;  1OYW A;  1R23 A;  1EH8 A;  4A6E A;  3P9I A;  4ESF A;  2J5P A;  1H0M A;  1XCB A;  3P9C A;  4N9I A;  3BPX A;  1HW2 A;  4CGZ A;  3T8T A;  3TOB A;  1HW1 A;  2FBH A;  4EJU A;  1W5T A;  4F7Z A;  3QU3 A;  4HF0 A;  2RGV A;  1R5G A;  1IXR C;  1HW5 A;  4ON0 A;  1YTY A;  2F5C A;  3MCZ A;  4L0Y B;  3KCC A;  2MH2 A;  1GHC A;  2PMU A;  2A6H F;  3JTG A;  1K6O A;  3F72 A;  3CO7 C;  1UST A;  3DV8 A;  2OBP A;  2IRF G;  3NRV A;  1ZRF A;  3I0T A;  3U1D A;  3IRR A;  1KU7 A;  1XN7 A;  5LEK A;  5HS8 A;  4CYD A;  2JPC A;  1K79 A;  3GW2 A;  1TLH B;  4RGR A;  1RNL A;  2BGC A;  1IN6 A;  3O2P E;  4YFK F;  3V7R A;  2XRO A;  5E17 F;  4Z2Y A;  2KIF A;  2GXG A;  2NNY A;  1ZH5 A;  5D4R A;  3ECO A;  2RKH A;  1J5Y A;  2HOE A;  4BHC A;  5FB2 A;  4U7B A;  2ESH A;  2VE8 A;  4M6Y A;  5HS9 A;  1RZ4 A;  5DCM A;  3E97 A;  2FEZ A;  4Y17 A;  5L3G A;  1GXQ A;  1W5S A;  3ELK A;  5HLI A;  1PP7 U;  3ABT A;  2W57 A;  2R7D A;  1Z1D A;  1FX7 A;  2VBZ A;  3WTT C;  1FSH A;  2CWE A;  2XKO A;  1XGO A;  4A6D A;  2IA2 A;  5KVR A;  3TO7 A;  4M74 A;  1LDK B;  2OZ6 A;  4HQE A;  4O5V A;  5F1R A;  4B8X A;  2HYG D;  4OOI A;  3L7W A;  3DQV C;  2ZJ2 A;  4IRH A;  2MD5 A;  2K86 A;  3GZ6 A;  2EFW A;  2YR2 A;  3B73 A;  4M71 A;  1YQA A;  2DT5 A;  1H9T A;  2WTE A;  2PN6 A;  3NQO A;  3DP7 A;  1SFX A;  1P6R A;  2VXZ A;  2PQ8 A;  1Z6R A;  3BP8 A;  5LHH A;  4HV5 A;  1I1G A;  1X3U A;  4RGX A;  2NS0 A;  4LJZ F;  5EEH A;  3AAF A;  4U0W A;  2P4W A;  2CYY A;  3E3V A;  3RDI A;  1BC8 C;  1FLI A;  2K02 A;  4A0X A;  4ZZL A;  2O03 A;  1P4W A;  1IUY A;  1P4A A;  1ULY A;  4RS8 A;  1KGS A;  1R36 A;  2ZCW A;  1T39 A;  4L9T A;  1S3J A;  4LK1 F;  1UFM A;  5AIQ A;  2VBY A;  1U2W A;  1FPQ A;  2IJL A;  1QPM A;  4P96 A;  1Y0U A;  1HKS A;  1YYV A;  3HOT A;  2W84 A;  1T38 A;  1IN5 A;  1FYL A;  5CVR A;  2HDC A;  1FBQ A;  1Q1H A;  1NHA A;  2LF8 A;  1UCR A;  1SMY F;  1O3Q A;  3LQQ A;  4I01 A;  3I4P A;  1ZGJ A;  4I7H A;  2QWW A;  4G6Q A;  5HS7 A;  3KZZ A;  4D0P A;  2HQR A;  2KJC A;  5ERI A;  4BAY A;  2KRF A;  3ZMU A;  1MJ9 A;  5LGT A;  2P5L C;  1BM9 A;  4KYW A;  5CYV A;  1ZLJ A;  5JFR A;  4NHJ A;  4YII A;  3ERE D;  4IF4 A;  1BI3 A;  4BHP A;  2TDX A;  1WKM A;  1EH6 A;  1QZY A;  2K4B A;  3SZP A;  3BY6 A;  1FC3 A;  3OV8 A;  2K4J A;  4WX9 A;  4ESJ A;  3KP3 A;  5FFZ A;  4PGG A;  3WE3 A;  4L9J A;  2VON A;  2XIG A;  2GAU A;  2YX4 A;  5DCM B;  3I71 A;  2RC4 A;  1AWC A;  1PDN C;  2FBI A;  3P7N A;  2FE3 A;  3RKX A;  1O7L A;  3MWM A;  4HA8 A;  3GLX A;  4HV6 A;  5A2Q Z;  3ZMZ A;  4CDG A;  5LRS A;  2EA4 A;  5D6F A;  4YIF A;  4L18 B;  3RI4 A;  2FF4 A;  4LFU A;  4M72 A;  2XGX A;  4GYI A;  1WSU A;  2COM A;  2P6T A;  1G3W A;  5JVT A;  4HF2 A;  3IWF A;  3QP6 A;  1RIO H;  2YX7 A;  4TV7 A;  1OPC A;  5HLG A;  4M6X A;  1KU2 A;  1IZ1 A;  2VC1 A;  2HFH A;  2V79 A;  2VE9 A;  2WWY A;  2IA0 A;  1R00 A;  4L5J A;  2V1U A;  5FFX A;  4KFC A;  4WCG A;  2DK8 A;  2OD5 A;  3PQJ A;  3M9A A;  4IJA A;  3KLN A;  4Q48 A;  2Q2E A;  2P5K A;  1U5T C;  2HTJ A;  1U8R A;  1GVJ A;  5E20 A;  2GIV A;  4N0B A;  3RIR A;  1ZLK A;  2QM3 A;  4Q47 A;  3CTA A;  1B1B A;  3BJA A;  3LA7 A;  2DFI A;  2OU2 A;  1TQI A;  4WXD A;  1FSE A;  4KMU X;  5IT9 K;  3KZY A;  4IXA A;  3E5U A;  3REO A;  1JHH A;  2DLL A;  1ONV A;  3F23 A;  5K5O A;  2H6C A;  4G8X A;  3F6V A;  3BPV A;  4MQV A;  2GZW A;  2P7V B;  3U9G A;  2QUF A;  3JAM Z;  4ZYH A;  1ZG1 A;  1HQC A;  2L02 A;  2FML A;  1JE8 A;  4A0Z A;  3K1P A;  2L54 A;  5JHU A;  2XAJ A;  1QQI A;  4UV8 A;  3K0L A;  1H9G A;  3V4G A;  3CDH A;  2DU9 A;  3FHZ A;  3GFJ A;  3FXU A;  2BE5 F;  5DD4 A;  4RAY A;  4U0V A;  2EB7 A;  3F8M A;  1ON1 A;  3C1D A;  5DUI A;  2XKP A;  3GO5 A;  4U88 A;  2OA4 A;  5L3D A;  3TOA A;  1LDJ A;  5KK1 A;  3GUD A;  1QNT A;  5CVV A;  4G7H F;  5E8I A;  2K7L A;  5H6R A;  4PGH A;  5E18 F;  3M8E A;  1I27 A;  4OIO F;  1OR7 A;  5D8K B;  3HIF A;  4LB6 B;  1G6N A;  4MEY F;  4Q5S F;  3LAP A;  4XBF A;  4PDK A;  3E6C C;  4M9Z A;  4YFX F;  5JI6 A;  2EK5 A;  3MZY A;  4P55 A;  2R3S A;  5BOX A;  1TQP A;  5FD5 A;  3LST A;  1S6L A;  3K69 A;  3NEU A;  4ESB A;  1XGM A;  3C3W A;  2JRT A;  1JXS A;  3KEQ A;  2HR3 A;  1YLF A;  3DPT A;  5D5U B;  3HSR A;  5ICC A;  1YS7 A;  1P92 A;  4HX7 A;  2ETH A;  3L09 A;  5LLQ A;  2NYX A;  5ILS A;  4BQA A;  3QAH A;  2PI0 A;  2EFP A;  2ZME B;  5BPD A;  2LF7 A;  4ENK A;  4CIC A;  1MKM A;  2BV6 A;  1OKR A;  4BXU A;  3SHF A;  1J59 A;  1Z6T A;  1U5T A;  4FX0 A;  2FA5 A;  2PG4 A;  4LK0 F;  2EFQ A;  3WOD F;  1XGN A;  2CQK A;  2DW4 A;  3J80 Z;  5EEG A;  2E1C A;  5ILV A;  1IXS B;  1LQ1 A;  1O3T A;  4HW0 A;  3RKY A;  1ZAR A;  2QQ9 A;  2QQA A;  2RVC A;  1IN4 A;  1MJB A;  4FT8 A;  1XGS A;  3BJO A;  5L3E A;  2E7X A;  2EFN A;  1IF1 A;  4LB5 A;  2PJP A;  3WTZ A;  2LSO A;  4JQF A;  4I0A A;  1XSV A;  3R60 A;  1IN8 A;  5K5Q A;  2VBW A;  2MLG A;  2GA1 A;  2Z3Y A;  5DUK A;  3J80 K;  3WU0 A;  3CUO A;  4LLL A;  2A68 F;  1G3S A;  1PP8 F;  1ZHF A;  4HF1 A;  2K27 A;  2G9W A;  2YU3 A;  2HS5 A;  1HKQ A;  3EQL F;  3FMS A;  2EJR A;  5HLH A;  2EV0 A;  2ELH A;  4Q4Z F;  3TQN A;  1RI7 A;  2FMY A;  4LMY A;  5DYM A;  1XB4 A;  3K9T A;  3I59 A;  2ACJ A;  4PCQ A;  4EQQ A;  5CJ9 A;  3T1B A;  2HYF A;  3E6B A;  5H20 A;  4K2E A;  3T5X A;  5L3B A;  3B02 A;  3VOD A;  1HST A;  2F5F A;  3KEO A;  2W24 A;  2A69 F;  4LLG F;  4WWC A;  3CUQ B;  3TDU C;  2GA2 A;  2ZO4 A;  3KP4 A;  4YG2 F;  3N4M A;  2HWV A;  2FRH A;  4HYE A;  3IKV A;  4HQM A;  1D3Y A;  1JHF A;  1R22 A;  5LGU A;  2OQR A;  2VOP A;  4HZF A;  1G3Y A;  1W7P B;  3GWZ A;  2OQG A;  1K78 A;  4M9X A;  2AXL A;  3KP2 A;  1FY7 A;  1T0F A;  3BDD A;  4EGY A;  3GFI A;  2L3D A;  3HSF A;  2DPD A;  3RJP A;  2QYO A;  1CGP A;  1WRJ A;  2HTS A;  3E5Q A;  4AVP A;  4G9Y A;  2CSO A;  2H94 A;  1BN5 A;  4AIH A;  1R1T A;  2FNA A;  4JBA A;  3HTU A;  4OMY A;  2ZKZ A;  2YSR A;  1IRG A;  3QU6 A;  2STW A;  4LG0 A;  4I2O A;  2XUB A;  5IT3 A;  2VT2 A;  3JSO A;  2Q0O A;  2ZXJ A;  5E8G A;  4ZYG A;  4IRI A;  1HXD A;  1YW8 A;  2DPU A;  2VOD A;  2Z99 A;  3HYI A;  2M8E A;  2O3F A;  3F8C A;  4HLX A;  5LHG A;  2MLK A;  2A5Y B;  4EJO A;  3HHG A;  1KYZ A;  2EV5 A;  4Y15 A;  3WE2 A;  5TRD A;  2QQB A;  2FQ3 A;  4QWQ A;  4EVI A;  2HKO A;  4GCV A;  2M5W A;  2RNJ A;  1J2X A;  4HAM A;  1OYI A;  3H3U A;  2V9V A;  2KKO A; 
#chains in the Genus database with same CATH topology
 2IS2 A;  4ZDO A;  3K1M A;  3CCR I;  3H92 A;  2DBB A;  2KIM A;  2KT0 A;  3GZ5 A;  1BOA A;  3M1E A;  4AYB A;  4PJM A;  4LLN A;  1LPQ A;  1W7P D;  2KRH A;  2OC6 A;  4NB5 A;  4UUV A;  1RKT A;  3GYH X;  1Q1V A;  1ZGA A;  2CO5 A;  3J81 K;  2GLO A;  4CCM A;  2H8W A;  2VOO A;  1D8J A;  3IC7 A;  5E3L A;  2Z33 A;  2L2O A;  3DEW A;  5C4J J;  2JUC A;  4UVA A;  2E5Z A;  2GOM A;  2E35 A;  3K6G A;  4IL6 C;  2E2H J;  2IA1 A;  3UR3 C;  5J8F A;  3PNT A;  1QU3 A;  1EKE A;  1JJ6 C;  3F21 A;  4P5O A;  4RDU A;  5BMZ A;  5HLT A;  4DYC A;  2J5O A;  4ZZD A;  4FTH A;  2QKM B;  4HX8 A;  1WJC A;  1E3H A;  1OMI A;  1O4X A;  1E3P A;  1QVU A;  5GPC A;  4RAZ A;  2M4G A;  2XVC A;  3HEF A;  2VBX A;  2BW3 A;  2XAH A;  5K1Y A;  2OAZ A;  3EYI A;  3VB2 A;  5CVI A;  4Y52 J;  1KYW A;  2FU4 A;  1YFH A;  4BH9 A;  4M3F A;  4FX4 A;  3PFY A;  1QHG A;  4XRS G;  1OIS A;  2OJE D;  1R5H A;  3K70 D;  3VOE A;  5D8L B;  4BHB A;  5B3S H;  2X6O A;  1B72 B;  1TL8 A;  3L2U A;  3Q9S A;  3TW6 A;  3QPT A;  4KMF A;  3IKT A;  5HDK A;  3FXQ A;  4DBR A;  4OAZ A;  1V5E A;  5KHD A;  1U78 A;  3BT9 A;  4QPQ A;  1X1P A;  2CFX A;  4MO7 A;  5J1Y A;  2OCC H;  1K78 B;  1N25 A;  2CUZ A;  4C30 A;  1DU0 A;  5IP6 A;  1E2X A;  2M45 A;  5CQG A;  1X2M A;  3KFW X;  1QBJ A;  3QQA A;  3IV5 A;  1J75 A;  1TT0 A;  1DPU A;  1TBX A;  4LIU A;  5JLW A;  3BRO A;  1KQ9 A;  3KX2 A;  5IT9 Z;  1Y6I A;  2G7H A;  3LSP A;  1HOM A;  2XSD C;  4E4H A;  2EPF A;  3BJ6 A;  2LP0 A;  4OIP F;  1I1S A;  1DPR A;  4RB0 A;  3F6O A;  2JSP A;  3ROU A;  2MW8 A;  1DP3 A;  3BR6 A;  3JW4 A;  1LFU P;  3RKQ A;  1A31 A;  1HDD C;  5FRM A;  2GQQ A;  3BOQ A;  5LD2 C;  2VQL A;  1P2F A;  3ONQ A;  3HG9 A;  4B3X A;  3LSI A;  1QO0 D;  2Z16 A;  2R4G A;  3RYR A;  3OR2 C;  3L2R A;  3K1N A;  3RQ4 A;  3RYP A;  3PM1 A;  5F0F A;  3S2W A;  4KA4 A;  4F92 B;  1D0X A;  4BQO A;  1TWG J;  5K7F A;  2P5V A;  3CQZ J;  3U2R A;  1F4K A;  4FQG A;  3ZN1 A;  3OYF A;  2L0K A;  1I6X A;  2EIJ H;  3A2K A;  1F43 A;  4KIG A;  4BY1 J;  3G1L A;  1T6S A;  3SZT A;  4W97 A;  1Z7U A;  2E1N A;  2X6Y A;  4JX5 A;  9ANT A;  1SD7 A;  4LG0 B;  4J00 A;  1LKX A;  1IGN A;  4KN7 X;  2WA0 A;  1UMQ A;  4RB1 A;  4OMZ A;  2GM4 A;  4UV9 A;  1IRF A;  2E7W A;  2BYV E;  3RPU A;  4MHG A;  2R5Z A;  1NK3 P;  1O57 A;  5D6E A;  3D0S A;  3IWZ A;  5EEA A;  4BNC A;  4YEL A;  3GFM A;  2HGC A;  4A0Y A;  5BPI A;  4XR6 A;  1FP2 A;  3CMY A;  3ESW B;  1R71 A;  6PAX A;  4ZYE A;  2ZFU A;  3DEE A;  3WGG A;  3U21 A;  4UVB A;  2DTR A;  3LA2 A;  2HEO A;  5C44 J;  3M8J A;  4XRM A;  3K7A J;  2KIQ A;  3IRQ A;  1R1U A;  3ABK H;  2STT A;  2ECC A;  2KJB A;  2JN6 A;  1J9I A;  5C3E J;  1RUN A;  4N4O B;  3KYL A;  1Y1V J;  1FWZ A;  2EIN H;  4IRG A;  3D5L A;  4A12 A;  1YO5 C;  3JRI A;  2ESN A;  1VQ6 I;  4A93 J;  4IKF A;  3SEZ A;  1R58 A;  3I5U A;  4LGW A;  1XD7 A;  3LSK A;  3RSN A;  1ZR2 A;  4OU0 A;  2VKD A;  2W7N A;  4B09 A;  1MMS A;  3TBI A;  1B9M A;  2HZT A;  1LVA A;  5HDN A;  5JR3 A;  5DEQ A;  3PUF A;  3M8F A;  1SAX A;  3BCA A;  2JZY A;  3FXR A;  1VTN C;  1XS9 A;  5CLS A;  3K2Z A;  3S16 J;  1B59 A;  3FBN B;  4E7L A;  3LAJ A;  1O3S A;  5DTD A;  3WG9 A;  2EBI A;  1ON2 A;  3CCM I;  2VB6 A;  3PO2 J;  2Y48 A;  2HXI A;  4N4N B;  2UZK A;  1FIP A;  1MH3 A;  2VC0 A;  1X4P A;  3F22 A;  3ASO H;  4II2 A;  2L4M A;  2O5R A;  2QEN A;  1H89 C;  2BW3 B;  2CQN A;  3GTO J;  3D5R C;  2FXA A;  3BTL A;  2LRD A;  3H0D A;  2HYJ A;  4R1H A;  4M3E A;  3QYE A;  3MZH A;  2Z5U A;  4O6J A;  5E1W A;  1LE8 B;  2BOL A;  1XDU A;  1NK2 P;  2IW5 A;  4HOB A;  2DMT A;  3ZMT A;  4B4C A;  2QGU A;  1HC8 A;  2VJ5 A;  3RCO A;  3RPQ A;  3KET A;  1D1A A;  4G7Z F;  2JMW A;  1DDN A;  1SFU A;  5K5R A;  3BR0 A;  2XAQ A;  4BDY A;  1R6R A;  1ZRD A;  2ELJ A;  2XHK A;  3ZQC A;  3S32 A;  4BQN A;  2ZC2 A;  3ZPL A;  3JRF A;  4EGZ A;  1X1B A;  1X3Z B;  3VFZ A;  5FRN A;  2KL4 A;  5F64 A;  1QPI A;  1W4M A;  4NC7 A;  1TNS A;  2W00 A;  4BBR J;  4CZZ A;  4E7K A;  3M3Y J;  2R7X A;  2HQ5 A;  4RGS A;  4GRI A;  4UUS A;  1WGX A;  1G59 A;  4BEH A;  1W0U A;  1D1C A;  2WC2 A;  3RTR A;  5BNG A;  2X1E A;  1AA7 A;  3SFZ A;  2F4M B;  4BJ5 C;  4XLN F;  3QOP A;  3OYK A;  4XKW A;  1XMK A;  2R7U A;  1W0T A;  2FBK A;  3G3Z A;  1WVR A;  1Z91 A;  3RZO J;  2ID6 A;  3WTV C;  3FIW A;  3GTP J;  2XAG A;  4OIN F;  1FNN A;  2NRA C;  2MH9 A;  3RKW A;  4EM0 B;  2AHQ A;  3AG4 H;  1EA3 A;  4GGG A;  2PLY A;  2KIU A;  5ICF A;  4WF2 A;  1H8A C;  2VN2 A;  2IVM A;  4RGU A;  1RUO A;  3HRM A;  4M9S A;  3VYU B;  3E6M A;  4XN3 A;  4XLP F;  1EH7 A;  4KUM A;  3GVA A;  4G6D A;  5J4Y A;  3A03 A;  2DA6 A;  1ETO A;  1ODD A;  5DV5 A;  1BI2 A;  1IW7 F;  5D5W B;  1VQ8 I;  3X2Q H;  1SFO J;  2Q1Z B;  2QSG X;  2D5V A;  2RQP A;  3KP7 A;  1XPX A;  1V5F A;  4Y33 A;  1E0E A;  2PX9 A;  5H6Q A;  5F1J A;  1QRY A;  1ZAO A;  2JTV A;  1STZ A;  1DGW Y;  3F3X A;  1A5J A;  2F5D A;  2VQG A;  4DNC A;  2VPR A;  5EGO A;  1RR8 C;  1XX5 A;  5F6F A;  3BWG A;  1V3F A;  4ENM A;  3ZMD A;  1ITY A;  3OYH A;  5K7Z A;  3I55 I;  2DFH A;  2M7B A;  5J8C A;  1G4D A;  3KE2 A;  4XRF A;  3OIO A;  1MBF A;  1KQ8 A;  4G94 A;  1AOY A;  3KP6 A;  5DDG A;  1CF7 A;  2VJI A;  4CZC A;  4NDL A;  4S05 A;  2UUZ A;  1UHM A;  2X1C A;  2B7E A;  2GIZ A;  3CMM A;  3TO6 A;  4UB6 C;  1I3Q J;  4PFP A;  2PJR A;  2M4K A;  2X0L A;  4EJV A;  4E7S A;  3CO6 C;  3CC7 I;  2JSC A;  2XV4 S;  3CLQ A;  2QSF X;  5J6X A;  3R6S A;  2HOS A;  2F4I A;  3HOZ J;  1J7K A;  1TTY A;  3PIO F;  2MGQ A;  2NNN A;  2EWN A;  1LNW A;  2ZFW A;  2H09 A;  2K3P A;  1KZH A;  1K4S A;  5B1A H;  4HBL A;  4Y13 A;  1K7A A;  3E5X A;  5FLX K;  4I09 A;  3CES A;  4OIR F;  1ETW A;  3CLO A;  2HVS A;  3IUO A;  1LEB A;  4DYQ A;  2DI3 A;  4EM2 A;  1FT9 A;  1REP C;  3FZV A;  2O61 A;  3ZN0 A;  5FLV A;  2HDW A;  3MEX A;  3QPL A;  2IS1 A;  2V1N A;  3QRF F;  1VQ9 I;  4BBS J;  1B4A A;  1XG1 A;  1YS6 A;  3CF2 A;  3R0J A;  3UNG C;  1BIB A;  2JT1 A;  3QPH A;  3F8F A;  3VPR A;  3TO9 A;  4C3H J;  3GX4 X;  4ZDP A;  4E70 A;  3A4C A;  4ITV A;  1I50 J;  3DTE A;  4ZJZ A;  4R8H A;  3ECH A;  1O7F A;  5LHI A;  3GXO A;  4LIT A;  3A0B C;  2HNH A;  3R0A A;  5E3M A;  1ZRE A;  3WTS C;  1T08 B;  3EDP A;  1JUM A;  3B6A A;  3F8N A;  1FTZ A;  2H27 A;  5FKK A;  1BBY A;  1WQ2 A;  4HNU A;  1GV2 A;  1NH3 A;  4NC8 A;  1F5T A;  1W36 D;  2WY8 Q;  1HF0 A;  2MC3 A;  3W6K B;  3V7C A;  3H3Z A;  1PUF B;  1XSD A;  3S1Q J;  1ZG5 A;  2K3F A;  4XNF A;  3CZ6 A;  2HU9 A;  3H36 A;  5D4S A;  3HL2 A;  3DCF A;  2O6G E;  3Q9V A;  2H1K A;  3HZJ A;  4OWR B;  3R61 A;  1WWX A;  3AL0 B;  1FOW A;  3K10 A;  4JK1 X;  4AWX B;  3OYE A;  3BG7 A;  4GO1 A;  1WJF A;  5F0C A;  2M0M A;  1NG6 A;  3L00 A;  3OYJ A;  4LG3 A;  1K4T A;  4HRI A;  1MBG A;  4A3L J;  1VND A;  1NTC A;  3MQ0 A;  3IL2 A;  2RAE A;  3Q0U A;  1MJA A;  2XGC A;  2DA1 A;  2VI6 A;  3V8K A;  1XCV A;  3FXL A;  2GOX B;  3CDI A;  3EPZ A;  3FF5 A;  1SD5 A;  3OWT A;  3I58 A;  1QA6 A;  1FBU A;  2ZJR F;  1D1B A;  1YW9 A;  2K9M A;  3LSR A;  2DJI A;  2RDP A;  4V19 K;  2YPR A;  2DMU A;  4CO8 A;  3RPU D;  5GAH J;  2E1M C;  2L01 A;  1DGR M;  3JSP A;  2BEO A;  3WG7 H;  2P8T A;  2BVL A;  3F8B A;  3HKZ A;  2LNB A;  4IQ4 A;  1XSX A;  1D8K A;  5TGT A;  4BEH B;  4EJW A;  3WTY C;  3HOW J;  3O6B B;  3S1N J;  3HTS B;  2CQ7 A;  2UV1 A;  3DEU A;  4A3B J;  5FD6 A;  2CGP A;  2M1B A;  3WTX C;  5C4X J;  1FBS A;  2VPL A;  2HKX A;  3Q0V A;  3DKY A;  1R4M B;  4GYG A;  3O3K A;  5HDG A;  2Q8K A;  1AHD P;  1PJR A;  3DKW A;  2XPU A;  3CCJ I;  1S7O A;  3I4N J;  2AXT C;  3PFI A;  2MYS A;  4ETS A;  4A2U A;  1OCP A;  4RLF A;  1GXP A;  3LOC A;  2CW8 A;  1YG2 A;  2BY0 A;  1S9H A;  2LY1 A;  2HQA A;  2PMZ N;  2W1O A;  1GLN A;  1I3A A;  1L3L A;  3GEZ A;  1IXC A;  2F48 A;  2Y0M A;  1YIT I;  3CC2 I;  2BHZ A;  1U5T B;  3Q5F A;  4M73 A;  2DO7 A;  4IHX A;  3DXJ F;  2KMU A;  4BGD A;  1TQM A;  1UG0 A;  2LR8 A;  3OIP A;  3I53 A;  4H0E A;  4AIJ A;  1GV5 A;  1IV6 A;  4E7I A;  3HRS A;  1C0W A;  1VQ5 I;  3DF8 A;  3S15 J;  4KIC A;  2AS5 F;  3H1C A;  3CDL A;  2D2W A;  5TIS C;  2QA4 I;  1LJ9 A;  2H6B A;  2LMD A;  4I02 A;  4B43 A;  1P4X A;  4DYR A;  4P9U A;  1WHU A;  3QYB A;  1V55 H;  3CJN A;  1K6Y A;  1QVT A;  2MAB A;  1Z67 A;  4ZC3 A;  2WB1 A;  5L3C A;  3RZD J;  4NQW A;  2MD0 A;  1CF7 B;  3BR1 A;  3ZP5 A;  1X1A A;  5IP9 J;  1AKH B;  1MZB A;  3J7A Y;  3ZMS A;  5BQT A;  2MBF A;  3G73 A;  1YIO A;  4MTE A;  2FOW A;  2NAZ A;  4HEA 2;  4WK8 F;  4XSZ F;  2JPB A;  1K61 A;  2PJR B;  5E1X A;  3GTQ J;  1T33 A;  2OPT A;  2LDU A;  1ETQ A;  2OZU A;  2L9N A;  1A04 A;  1XDS A;  1HBX G;  2ZME C;  2LBF A;  2ZJQ F;  3OYN A;  2P7C B;  2V6C A;  3LWF A;  1LUJ B;  2FX0 A;  3COA C;  3BR5 A;  2BHY A;  5EF6 A;  4E7J A;  2KZG A;  2V9K A;  3VYT B;  3I54 A;  1T95 A;  4EEF G;  5J1U A;  3GZN B;  3J81 Z;  3PO3 J;  3OR1 C;  1XC5 A;  2A07 F;  2FJ1 A;  2EZI A;  1MMG A;  2DQR A;  2Y75 A;  3MAJ A;  3H0G J;  1Z3Y A;  1PUE E;  2Z9O A;  5TJJ A;  5CVJ A;  2XAS A;  3JTH A;  3DBH B;  3WGI A;  1FOK A;  5HOO A;  3GBG A;  2MG4 A;  3T8R A;  4BQQ A;  4R79 A;  4L5E A;  2JRM A;  1Y56 A;  2Y0S N;  4X0G A;  1SMT A;  1Y1W J;  3ZQH A;  2JK3 A;  1JT6 A;  3ZGK A;  3OYD A;  4HNT A;  4XIC A;  2IT0 A;  3NAR A;  5ED4 A;  3ERM A;  4UHT A;  2VT3 A;  2R7Q A;  1B6A A;  1YE9 A;  4M3D A;  2H1L A;  2LKP A;  1SD6 A;  3BZC A;  4IQJ A;  2D1V A;  4A5M A;  1BI0 A;  1F9N A;  3HB9 A;  1HSJ A;  4BXF A;  4KDP A;  2DDB A;  1UHW A;  2K85 A;  5M3F J;  1MBH A;  3PIP F;  4YEJ A;  3W2V A;  4PJJ A;  5GAD J;  5DM6 F;  3HGG A;  3MKL A;  2HI3 A;  5FGM A;  4B3A A;  4UVC A;  3DBR B;  5ICE A;  3BTI A;  3I59 B;  2ZB9 A;  4PJL A;  4EMS A;  3KP5 A;  4E7H A;  5IYB J;  2XF7 A;  3QP5 A;  1KQ0 A;  3P9K A;  4BKX A;  1T8I A;  1ZRC A;  3C7J A;  1J0R A;  2L9V A;  2F5E A;  3F0C A;  1FOX A;  3TGN A;  2QQ8 A;  1KU9 A;  3M7G A;  4L9V A;  4RB3 C;  4CXF A;  1MDM A;  4HDU A;  2L7F P;  3KPH A;  4YFN F;  3ISP A;  2PBI A;  1GUU A;  2OF7 A;  4EJT A;  2DQL A;  4OIQ F;  2O8X A;  1QGP A;  4DZP A;  2D45 A;  4PSW A;  3OSF A;  3L2Q A;  2RN7 A;  2R93 J;  2QEX I;  3VWB A;  2A6E F;  2G0E A;  3LA3 A;  1DUX C;  5CVU A;  2V1D A;  3W6J B;  3H9Q A;  2E2J J;  4BE0 A;  3SEQ A;  4IOC F;  4HDV A;  2OV7 A;  5EZG A;  2DOD A;  2B0L A;  1OCT C;  2EIK H;  3FM5 A;  4XID A;  4KN4 X;  4IHS A;  3FM3 A;  3QOD A;  5AIP A;  2CW0 F;  1Z05 A;  3OOP A;  5L3F A;  2LVS A;  3FMR A;  2W25 A;  4G7O F;  3L1P A;  3BR3 A;  2JVG A;  4PJN A;  3EUH A;  1ZYR F;  1OR7 C;  4CHU A;  2BBY A;  5D5V B;  4PZJ A;  1B8I A;  5BS6 A;  1A35 A;  1JUS A;  3MD2 A;  3L9F A;  3FMQ A;  3S2H J;  2L4A A;  3GLL A;  5D5X B;  1UB9 A;  2EFO A;  3CJR B;  4N9H A;  1OYY A;  2ADU A;  4C3I J;  2WV0 A;  1SFE A;  3RQI A;  3I4M J;  4FIS A;  4QTR A;  2ISY A;  1WH7 A;  3OMY A;  4ENJ A;  2MA3 A;  5LBQ A;  1V4R A;  4JP0 A;  5DCF A;  1BJZ A;  4WXC A;  5M5W J;  3E1S A;  4MGR A;  3GF2 A;  2KDO A;  5GAG J;  1IAW A;  3IHU A;  3NWS A;  2KP6 A;  1OCC H;  2WAD A;  1B9N A;  1WJB A;  2CG4 A;  3N97 A;  4B1R A;  2YU9 J;  3CUQ C;  2RV8 A;  3QOE A;  3SDB A;  2M30 A;  2CUF A;  3GFL A;  2EH3 A;  3CF5 F;  1U6G A;  2DJN A;  2QCO A;  2R7O A;  2DK5 A;  4FHT A;  3TP3 A;  5CKT A;  2FOK A;  4I0B A;  4ZH4 F;  3HRT A;  1S8N A;  1T2K A;  1ZQ3 P;  1F1Z A;  4BU2 A;  1UG2 A;  3AG2 H;  5A2Q K;  4YRV A;  1QZZ A;  3WTU C;  2ZME A;  3FXK A;  4KT5 C;  2QZ8 A;  3FXO A;  2NVU B;  3AFH A;  3BZ6 A;  3SXY A;  1VQ7 I;  2GXB A;  4O3M A;  1D5V A;  4BL0 B;  4MTD A;  2HOA A;  2WY7 Q;  2ISZ A;  3EUK L;  1YHQ I;  3DLA A;  2EZL A;  2R5Y A;  3GCM A;  4M3G A;  5ICG A;  2DA4 A;  2V1X A;  1E17 A;  1USS A;  4CUG A;  4HLY A;  4IHT A;  3DBL B;  4ZTJ A;  3ABU A;  2CU7 A;  3PJR A;  3KEY A;  1X2N A;  1FP1 D;  4XLF A;  4ABZ A;  1F36 A;  3DFG A;  2DYS H;  3JR9 A;  2QSH X;  3ZQ7 A;  2UXN A;  1S7A A;  2QBY A;  2LYC A;  4EM1 A;  2R7F A;  4UXN A;  3CME I;  2LG4 A;  1TC3 C;  1OCO H;  2A3S A;  5DD8 A;  1OJL A;  1BI1 A;  1HKT A;  2IP2 A;  4A3M J;  3FK6 A;  3P5J A;  2PFB A;  2WV1 A;  5AON A;  1ETX A;  2OTL I;  3WU2 C;  5FO5 A;  3M1C A;  1DU6 A;  4G6T B;  1GT0 C;  2EV6 A;  4F52 A;  4KNY A;  1UAA A;  4NBQ A;  2P6S A;  3H9G A;  1X4O A;  3VEP A;  3WU1 B;  4EAT A;  2I8D A;  5E1Z B;  5LEJ A;  4U0Y A;  1BC7 C;  4A5N A;  1XMA A;  3ZXS A;  4IX7 A;  4HG2 A;  2FQ4 A;  2Z1D A;  1S72 I;  4UNO A;  2L9S A;  2DOA A;  4LD5 A;  3TDZ C;  1VFC A;  4KT6 A;  2B9S A;  3ZCO A;  4HX4 A;  3K70 C;  4PFO A;  1RKW A;  5IYD J;  1IN7 A;  4P9F A;  1U3E M;  3OL4 A;  3FX3 A;  1Y8R B;  4CCN A;  1MMD A;  3G4S I;  3OYA A;  2FSW A;  1FYM A;  2KPM A;  4I98 B;  3GME A;  1WZ2 A;  5F27 A;  1HA8 A;  2IGO A;  3EET A;  3E6D A;  4W1U A;  3MKW B;  2V26 A;  5E79 C;  3W6V A;  1YW7 A;  1SD4 A;  1YX5 A;  3V8J A;  4MNU A;  5EG0 A;  1TW3 A;  4V2G A;  5EYR A;  2C6Y A;  1KA8 A;  4NC6 A;  1FYK A;  4QLC U;  1RC9 A;  3DPL C;  2W85 A;  2O0Y A;  2XPW A;  1MDM B;  1Z9C A;  1JKP C;  2NVX J;  2R7T A;  4XM3 A;  4V2F A;  1TW2 A;  5GTH C;  4CSW A;  3LQR A;  1WFX A;  2UWM A;  2OTJ I;  1ETY A;  1Y0N A;  5IOY A;  4IPA A;  2W82 A;  2CUJ A;  2XSJ C;  3PQK A;  3QPS A;  2K40 A;  3SQN A;  2ICW G;  4ENN A;  1VQN I;  2XAF A;  3HOS A;  2B63 J;  1EV7 A;  2ZNZ A;  2HQN A;  3J7Z I;  4BDZ A;  1R1V A;  1JUP A;  3WTW C;  2JWT A;  1MBJ A;  2G7U A;  2X6X A;  3G1M A;  1YJN I;  3FIS A;  3NWT A;  3HRU A;  4L5I A;  3TKY A;  2GWR A;  3ML6 A;  3LFK A;  2VJ4 A;  1LEA A;  2D1H A;  2DOF A;  2XF6 A;  4XSX F;  4DBQ A;  3JAM K;  1O3R A;  5LRR A;  3ZMV A;  2DMN A;  3WGH A;  4DW6 A;  2CV1 A;  2FNP A;  1ZN2 A;  1B8I B;  1MMA A;  3PL8 A;  4L9N A;  1FZP B;  1I5Z A;  2WAE A;  3LSG A;  3R4K A;  2DAO A;  1S29 A;  3V8L A;  2W48 A;  2ME6 A;  3BTJ A;  2QVO A;  4XMY A;  4RB2 C;  3I64 A;  2K9L A;  2QLZ A;  5LFA A;  3L2C A;  1V54 H;  2IPQ X;  3ZQF A;  1SVM A;  2MC4 A;  1LB2 A;  1S5L C;  4AD9 A;  4WXH A;  2CW7 A;  4GXO A;  2EIL H;  4PJ0 C;  5EJC A;  1ACI A;  3MFK A;  1LDD A;  2VKE A;  3HXL A;  2XF5 A;  4KIT B;  3ZQL A;  5B1B H;  1R7J A;  3AG3 H;  4AIK A;  2KLO A;  4A3C J;  4H4K C;  3O8H A;  4AC0 A;  1OCZ H;  1TNT A;  1T98 A;  4IVN A;  3C18 A;  3CUQ A;  4GFB A;  4BYY A;  5HVQ C;  3I56 I;  3HSE A;  1MGT A;  4MEX F;  2ZNY A;  5ILU A;  3NAU A;  2VKH A;  1X1C A;  3CD6 I;  1FEX A;  3D1N I;  3OL3 A;  2F2E A;  3FWE A;  4RA2 A;  1ZG3 A;  2EA2 A;  1A6I A;  4MQ9 F;  5FLX Z;  4KIB A;  3S8P A;  1BR4 A;  2ZBK A;  1BL0 A;  1T56 A;  1BIA A;  4S04 A;  2VL8 A;  2DT6 A;  1DP7 P;  4L0Z B;  3KLO A;  4D1Q A;  1WI9 A;  1W7P A;  1BJA A;  5J3L A;  3T0Y A;  1JGS A;  3SZG A;  3EYY A;  4ZYD A;  1N77 A;  2UXX A;  1UJ8 A;  1UZC A;  5GPA A;  4IHW A;  1MD0 A;  4KIF A;  3J7A O;  2IEK A;  1KU3 A;  2QBY B;  2KIS A;  4ASN A;  1L0O C;  3V7S A;  4EV0 A;  2R5Z B;  5HOD A;  4IO9 F;  5CQE A;  2X4H A;  3HUG A;  2BXZ A;  1YJW I;  2ZSI B;  1YRN A;  4BXX J;  3Q0W A;  2XRN A;  4B44 A;  1WH5 A;  2PEX A;  3G71 I;  3HHH A;  3ULQ B;  4MIM A;  1G3T A;  4U7D A;  4DQ2 A;  5LGN A;  1UHS A;  3VDX A;  2M3A A;  2M87 A;  2PMH A;  1ENH A;  4JX6 A;  2Y2Z A;  5EDN A;  4F93 B;  5GTI C;  1IC8 A;  2A61 A;  2ELK A;  1OYW A;  1R23 A;  1EH8 A;  4A6E A;  4BAC A;  3P9I A;  4ESF A;  2J5P A;  1H0M A;  1XCB A;  3BLY A;  3LNQ A;  5IP7 J;  3P9C A;  4N9I A;  3BPX A;  2X48 A;  4A3J J;  1HW2 A;  3CCL I;  4A3K J;  4A3F J;  4CGZ A;  3T8T A;  1WJ5 A;  3TOB A;  1HW1 A;  3S3M A;  2FBH A;  4E7Z A;  2BY2 A;  4EJU A;  4QSH A;  1W5T A;  3E0J B;  3OYL A;  4F7Z A;  2ZSH B;  4A3D J;  1PVE A;  1JT0 A;  3A1Y A;  3QU3 A;  4HF0 A;  2RGV A;  1R5G A;  1IXR C;  2VUM J;  1HW5 A;  4DJA A;  4ON0 A;  4XLA A;  1PYV A;  1YTY A;  1ZKG A;  2R0Q C;  2K9S A;  3JRC A;  2F5C A;  3MCZ A;  4L0Y B;  3KCC A;  5HNF A;  2MH2 A;  1GHC A;  4XLE A;  3C2B A;  2E19 A;  2LY2 A;  3HGY A;  3OS2 A;  3ZR8 X;  1JKR C;  4JYK A;  2HVR A;  2PMU A;  2A6H F;  3JTG A;  3M4O J;  1K6O A;  3F72 A;  3CO7 C;  1OCR H;  1UST A;  3DV8 A;  2OBP A;  2IRF G;  3NRV A;  1ZRF A;  3ABL H;  3I0T A;  1MND A;  3KZI C;  4UUT A;  3U1D A;  3KYD B;  3IRR A;  3IAS 2;  1KU7 A;  1XN7 A;  1ZR4 A;  5LEK A;  4AUX A;  5HS8 A;  4CYD A;  2JPC A;  1K79 A;  3GW2 A;  1TLH B;  4RGR A;  1RNL A;  2BGC A;  3HOU J;  1IN6 A;  3U1K A;  2V7F A;  3K4B A;  3FHN A;  3O2P E;  4BUP A;  4YFK F;  3V7R A;  2N8G A;  2XRO A;  4RLQ A;  3DTK A;  1E3O C;  3BQY A;  3FXM A;  5E17 F;  3L2W A;  4Z2Y A;  1Z7L A;  3OY9 A;  2KIF A;  2GXG A;  4IZZ A;  2LOO A;  2NNY A;  1ZH5 A;  4UB8 C;  5D4R A;  2LD5 A;  3ECO A;  2RKH A;  1J5Y A;  4JX4 A;  2HOE A;  4BHC A;  5FB2 A;  4U7B A;  2ESH A;  2IS6 A;  2VE8 A;  4M6Y A;  5HS9 A;  3MN2 A;  4BY7 J;  2K5C A;  4J19 A;  1RZ4 A;  1FTT A;  5DCM A;  3HDD A;  3C2G A;  4UUS B;  3LSH A;  2QKL B;  4KIS A;  2NOJ B;  2Y31 A;  3E97 A;  2FEZ A;  4Y17 A;  1ETV A;  5L3G A;  1GXQ A;  5F0H A;  2CUE A;  1W5S A;  3ELK A;  5HLI A;  1RR7 A;  1PP7 U;  3ABT A;  3S3O A;  2W57 A;  2R7D A;  1Z1D A;  3MKY B;  1ETK A;  2RRE A;  5M5Y J;  2HOT A;  1FX7 A;  2NVY J;  3K4J A;  4Y7N J;  3CCS I;  1W5C C;  1N75 A;  2VBZ A;  4I99 C;  3WTT C;  4S0H B;  1FSH A;  2PMZ A;  3JRA A;  2CWE A;  2XKO A;  1XGO A;  2LC2 A;  2IA2 A;  3DTI A;  4A6D A;  5FKO A;  5KVR A;  3TO7 A;  4M74 A;  5GAE J;  1LDK B;  2NVT J;  2OCE A;  4YIR X;  2OZ6 A;  4HQE A;  4O5V A;  5F1R A;  1B72 A;  1U9N A;  4A3E J;  1BR2 A;  4B8X A;  2HYG D;  2XRL A;  5JLX A;  4OOI A;  3L7W A;  2V9P A;  3BG9 A;  2R92 J;  3DQV C;  2HDD A;  5J40 A;  3JRB A;  2ZJ2 A;  2E1O A;  3DU6 A;  4IRH A;  5GP9 A;  2MD5 A;  2K86 A;  2TRT A;  3GZ6 A;  3UKG A;  2EFW A;  2YR2 A;  3B73 A;  4XKB A;  5E3N A;  4M71 A;  5EGO B;  1YQA A;  1SVL A;  2DT5 A;  1H9T A;  2WTE A;  2PN6 A;  1U9O A;  3NQO A;  3DP7 A;  1SFX A;  2XB5 A;  2F6C A;  1P6R A;  2VXZ A;  3GTM J;  2PQ8 A;  1Z6R A;  3HUG B;  3K4K A;  3BP8 A;  5LHH A;  2XGE A;  1YRN B;  4HV5 A;  1I1G A;  1X3U A;  4RGX A;  4XLH A;  5KAF C;  2DOE A;  2NS0 A;  1D0Z A;  4BS9 A;  1SVO A;  4LJZ F;  5EEH A;  3AAF A;  3SYT A;  4U0W A;  2P4W A;  2ZXH A;  4Y3O A;  1TWC J;  2CYY A;  2R7Z J;  3E3V A;  3RDI A;  3K4M A;  4D7N A;  1BC8 C;  1FLI A;  2K02 A;  4A0X A;  4ZZL A;  2O03 A;  1P4W A;  1IUY A;  1P4A A;  1ULY A;  2M7A A;  1OQY A;  4HST A;  4RS8 A;  5KNL A;  1KGS A;  1X58 A;  1R36 A;  2EZH A;  2ZCW A;  4F3Q A;  1JJ8 C;  1A36 A;  1T39 A;  4L9T A;  4BE1 A;  1MH4 A;  2Z2S B;  1S3J A;  1Y39 A;  4LK1 F;  1UFM A;  2Y30 A;  4RMN A;  5AIQ A;  2VBY A;  1U2W A;  1YJ9 I;  1W1W E;  1FPQ A;  2IJL A;  1QPM A;  2ID3 A;  1G2H A;  3CC4 I;  2X6W A;  1Z3X A;  5DM7 F;  3VSL A;  4P96 A;  1Y0U A;  1HKS A;  1YYV A;  4PUS A;  3HPG A;  4QIW N;  3HOT A;  3S3N A;  2W84 A;  1T38 A;  2Y0S A;  5IY5 H;  2NXN B;  1IN5 A;  2BY3 A;  1FYL A;  2CH0 A;  5CVR A;  2HDC A;  1FBQ A;  1Q1H A;  5K7H A;  1NHA A;  2LF8 A;  3CCU I;  1UCR A;  1SMY F;  2LLK A;  3OYB A;  4MLO A;  4BJT A;  3H3V K;  1O3Q A;  3LQQ A;  4I01 A;  3I4P A;  1ZGJ A;  4I7H A;  4C3J J;  2QWW A;  4G6Q A;  5HS7 A;  3KZZ A;  4D0P A;  3HPH A;  2HQR A;  2KJC A;  5ERI A;  4BAY A;  2KRF A;  3ZMU A;  1MJ9 A;  4FAS D;  5LGT A;  2JA8 J;  2DFF A;  2P5L C;  1OFC X;  1BM9 A;  2FUG 2;  4KYW A;  5CYV A;  1ZLJ A;  3QYF A;  5JFR A;  4NHJ A;  4YII A;  3ERE D;  4XRS A;  1P7I A;  3EUA A;  1MMN A;  4IF4 A;  3TMO A;  1BI3 A;  4BHP A;  2VXD A;  2TDX A;  4CA0 A;  1APL C;  1WKM A;  3G1O A;  1G8X A;  1EH6 A;  1QZY A;  1SEU A;  3BQZ A;  2K4B A;  2VAS A;  2VQC A;  3SZP A;  1LVK A;  4BE2 A;  3BY6 A;  2Y9Z A;  4AYB N;  1FC3 A;  3OV8 A;  2K4J A;  3ZQQ A;  4WX9 A;  4ESJ A;  3CCY A;  3ABM H;  3S93 A;  1I39 A;  5B5E C;  3KP3 A;  5FFZ A;  4PGG A;  1R9T J;  1JGG A;  2JUG A;  3WE3 A;  4L9J A;  2VON A;  2ZJP F;  1R49 A;  1IDZ A;  2XIG A;  2GAU A;  2YX4 A;  3HBL A;  5F04 A;  3OSG A;  4IHV A;  5DCM B;  1NG7 A;  1JTY A;  3I71 A;  1VQM I;  2RC4 A;  1AWC A;  1PDN C;  2FBI A;  3P7N A;  2FE3 A;  3RKX A;  1O7L A;  3MWM A;  4HA8 A;  4CCL A;  3JRD A;  4XOR A;  3GLX A;  1OLT A;  4HV6 A;  5A2Q Z;  3ZMZ A;  3N05 A;  4CDG A;  5LRS A;  1MBK A;  2EA4 A;  2Y69 H;  5H2F C;  2E34 A;  5D6F A;  3DPU A;  4KJZ A;  1BR1 A;  4DIQ A;  3WHC A;  4YIF A;  3K4C A;  3SJM A;  4L18 B;  3RI4 A;  2DXI A;  4RM2 A;  3KIO A;  4F55 A;  2FF4 A;  1LE8 A;  2O9L A;  3AL0 C;  4LFU A;  3OYC A;  3WHB A;  2HPI A;  4M72 A;  1VI0 A;  2XGX A;  4GYI A;  1WSU A;  4C2T A;  2OUM A;  2COM A;  2CJJ A;  2Y9Y A;  4MFD A;  1TWH J;  2KRC A;  5M5X J;  2P6T A;  5JVG F;  1G3W A;  3TL4 X;  5JVT A;  3FKI J;  2O8K A;  2E36 A;  4CYC A;  1X19 A;  4HF2 A;  3GTK J;  2LKX A;  2IBD A;  5J1R A;  3IWF A;  3LMM A;  3QP6 A;  4C2U A;  1I6H J;  1RIO H;  2YX7 A;  1XTA A;  3ASN H;  5FRO A;  4TV7 A;  3I3L A;  4P1W A;  5FKL A;  1OPC A;  4IOA F;  4NQW B;  2E71 A;  5HLG A;  3BCB A;  4M6X A;  1KU2 A;  2IS4 A;  2MFZ A;  1IZ1 A;  5J4V A;  2VC1 A;  2HFH A;  2V79 A;  2VE9 A;  5KAI C;  2WWY A;  1IRZ A;  2IA0 A;  1R00 A;  4L5J A;  5F08 A;  1P7J A;  5FKM A;  1SFK A;  1LFP A;  2V1U A;  5FFX A;  4KFC A;  1MNE A;  1U0J A;  2LY9 A;  3DWL E;  2DA3 A;  2LBF B;  2GBY A;  2K9N A;  4WCG A;  2NVQ J;  2COB A;  2M9H A;  2DK8 A;  2JA6 J;  2OD5 A;  3CJT B;  1N78 A;  3PQJ A;  4CCO A;  4RBO A;  3M9A A;  4IJA A;  3KLN A;  4Q48 A;  2Q2E A;  1QZE A;  3L2V A;  2P5K A;  1U5T C;  2HTJ A;  2TCT A;  1U8R A;  4AVZ A;  1GVJ A;  5E20 A;  1X3W B;  4B48 A;  2CV2 A;  1XMX A;  2GIV A;  2AQF A;  4N0B A;  5B66 C;  2CV0 A;  5E3O A;  2CRG A;  3RIR A;  3W2W A;  1ZLK A;  2QM3 A;  2LH9 A;  4Q47 A;  2XDV A;  3CTA A;  1B1B A;  3BJA A;  1BW6 A;  2DFI A;  3LA7 A;  2OU2 A;  2LTP A;  1TQI A;  4WXD A;  2R7S A;  1BW5 A;  3OS0 A;  1FSE A;  2ZXI A;  4XOP A;  1VQP I;  4KMU X;  4AU7 A;  3ZQG A;  3A01 A;  3BR2 A;  5IT9 K;  1A6Q A;  3M07 A;  4FCY A;  3KZY A;  4IXA A;  3E5U A;  3REO A;  1JHH A;  3H35 A;  3ZRG A;  4X1E A;  5FJ8 J;  1U8B A;  3S14 J;  2DLL A;  1ONV A;  3F23 A;  5K5O A;  4ZTF A;  2H6C A;  4A3G J;  4CCK A;  4G8X A;  3F6V A;  3C2H A;  3BPV A;  2L7K A;  4MQV A;  2GZW A;  1IG7 A;  1WJE A;  2P7V B;  4MFE A;  1D0Y A;  3U9G A;  2QUF A;  3JAM Z;  4ZYH A;  1ZG1 A;  1HQC A;  2L02 A;  2QF7 A;  3OIQ A;  2FML A;  1BA5 A;  1JE8 A;  4A0Z A;  4XLC A;  3K1P A;  2L54 A;  2M0C A;  5JHU A;  2XAJ A;  3FXJ A;  1QQI A;  4UV8 A;  3K0L A;  2L7Z A;  3BC8 A;  4BJ6 C;  3H5A A;  2M8G X;  1H9G A;  4HSR A;  3V4G A;  2JA2 A;  2DA2 A;  2DU9 A;  3CDH A;  3FHZ A;  4PSX A;  3CMA I;  4XOT A;  3GFJ A;  3FXU A;  2BE5 F;  3CJQ B;  4RAY A;  4I76 A;  4U0V A;  5DD4 A;  3SDG A;  2EB7 A;  3F8M A;  2AO9 A;  3S2D J;  1ON1 A;  3C1D A;  5DUI A;  4Y4R A;  2XKP A;  3GO5 A;  1MW7 A;  1RET A;  4IEJ A;  4U88 A;  1AU7 A;  2XAU A;  2OA4 A;  5L3D A;  1V5G A;  3TOA A;  2M2E A;  1LDJ A;  2VKV A;  1VZ0 A;  2E1M B;  5KK1 A;  1EF4 A;  3GUD A;  1QNT A;  1VQK I;  5CVV A;  2WAQ A;  2WAQ N;  4G7H F;  5E8I A;  2K7L A;  5H6R A;  3TED A;  1HCR A;  4HPQ A;  4PGH A;  5E18 F;  3M8E A;  3BG5 A;  5IPA A;  5HNH A;  3LFU A;  4JOM A;  5FKN A;  4ZYA A;  4C2M J;  3A0H C;  1X1D A;  2HZD A;  1I27 A;  2NS7 A;  4FE4 A;  1PUF A;  4OIO F;  1OR7 A;  2F5V A;  5D8K B;  2KZV A;  4DZJ A;  3SFI A;  3HIF A;  4M6V A;  1MSE C;  1SAN A;  3MZ8 A;  4HNV A;  4FET A;  4C9Y A;  4LB6 B;  1G6N A;  4MEY F;  4D9J A;  4XQF A;  4Q5S F;  3LAP A;  3Q3S A;  4XBF A;  2LK2 A;  5FLM J;  4PDK A;  3E6C C;  4M9Z A;  4YFX F;  5JI6 A;  2EK5 A;  4XK4 A;  3J7Y J;  3MZY A;  4P55 A;  1MBE A;  1RES A;  3HOY J;  2CQQ A;  2A05 A;  2R3S A;  5BOX A;  3GTL J;  1TQP A;  2DT7 B;  3OYI A;  5FD5 A;  2JVH A;  3LST A;  4CYC B;  1JKQ C;  1S6L A;  4ZDL A;  3K69 A;  3NEU A;  4ESB A;  2DA7 A;  1XGM A;  2KQR A;  3C3W A;  2KDZ A;  2JRT A;  1JXS A;  3KEQ A;  3OS1 A;  1LFB A;  3PSF A;  2HR3 A;  2V4J C;  4RM3 A;  1KON A;  1YLF A;  3DU5 A;  4FE7 A;  2WAF A;  3DPT A;  5D5U B;  3CCE I;  3HSR A;  1WCM J;  5ICC A;  5EZH A;  1JKO C;  1YS7 A;  1P92 A;  2BXY A;  1M1E B;  1S7E A;  4HX7 A;  1IJW C;  2ETH A;  3IH4 A;  4E6K G;  3ZOB A;  1TWF J;  3L09 A;  1YOV B;  5LLQ A;  1FMW A;  2NYX A;  5ILS A;  3QAH A;  4BQA A;  2DMP A;  1FIA A;  2PI0 A;  2EFP A;  3G2B A;  2ZME B;  2VQH A;  3S17 J;  4II3 A;  5BPD A;  2LF7 A;  3AKZ A;  4ENK A;  3I9V 2;  2YS9 A;  3A02 A;  3LSJ A;  4XKC A;  4CIC A;  1MKM A;  2BV6 A;  2HXO A;  1Z0X A;  3BG6 A;  1OKR A;  3VYS B;  2NS8 A;  2R5Y B;  4BXU A;  3SHF A;  1J59 A;  1Z6T A;  1JI8 A;  2HVQ A;  1U5T A;  3CCQ I;  2Q2E B;  2LRE A;  4FX0 A;  3LL7 A;  2E5N A;  3S1M J;  4QPO A;  5DS9 A;  2FA5 A;  1T0F C;  3BTC A;  3JCU C;  2PG4 A;  1SC7 A;  2W4S A;  4B47 A;  3G6E I;  4LK0 F;  4X6A J;  2DTZ A;  4XKV A;  2XB0 X;  2EFQ A;  3CP2 A;  3WOD F;  4LOC A;  2A6T A;  1XGN A;  2CQK A;  2DW4 A;  4DGW B;  3J80 Z;  1DQU A;  5EEG A;  4A3I J;  3A01 B;  2E1C A;  5ILV A;  1IXS B;  1RRJ A;  1VQO I;  2CQX A;  1VF9 A;  1AKH A;  1LQ1 A;  1VQL I;  1Z21 A;  1O3T A;  2IGM A;  2IGK A;  4LIV A;  2JA5 J;  1ORK A;  4HW0 A;  3RKY A;  1ZAR A;  2QQ9 A;  2QQA A;  2RVC A;  1IN4 A;  3OYG A;  3CP8 A;  3JRH A;  2XGD A;  1MJB A;  3K2A A;  2L7M P;  2R7R A;  2L5Q A;  3PUB A;  4FT8 A;  1XGS A;  3BJO A;  1ZK8 A;  5L3E A;  2RNG A;  1YIJ I;  2HPM A;  2X9D A;  2VJJ A;  1ZEL A;  2E7X A;  3OOU A;  1FOY A;  1IV8 A;  4A69 C;  1WI3 A;  2CFO A;  2EFN A;  1IF1 A;  2P0W A;  2IXS A;  4LB5 A;  3HOX J;  2PJP A;  2JQ7 A;  5EG0 B;  2EQR A;  3WTZ A;  2LSO A;  2VIX A;  4JQF A;  4I0A A;  1XSV A;  1GVD A;  2E60 A;  3R60 A;  1IN8 A;  5K5Q A;  2VBW A;  3K4N A;  2MLG A;  4OAY A;  2GA1 A;  4GDF A;  2Z3Y A;  1CQT A;  1TT5 B;  5DUK A;  3J80 K;  1GDT A;  1WJA A;  3WU0 A;  3CUO A;  4LLL A;  2A68 F;  1G3S A;  4J01 A;  2R7W A;  2EZK A;  2XC7 A;  1PP8 F;  4IHY A;  1ZHF A;  3PNV A;  3HC7 A;  4HF1 A;  4ANJ A;  2DDA A;  2K27 A;  2G9W A;  1IDY A;  2YU3 A;  2HS5 A;  4D5C A;  1IUF A;  1HKQ A;  3EQL F;  2JJ7 A;  3FMS A;  1FMV A;  4NUB A;  2EJR A;  2I5U A;  5HLH A;  4XON A;  1MNM C;  2EV0 A;  3JRG A;  2K9Q A;  2ELH A;  4Q4Z F;  4XL9 A;  3H5N A;  4I6Z A;  2YUS A;  3TQN A;  1RI7 A;  2FMY A;  4LMY A;  5DYM A;  1XB4 A;  1WJD A;  1Y8Q B;  3CCV I;  3K9T A;  3FBI B;  3I59 A;  2ACJ A;  3VSK A;  4PCQ A;  4EQQ A;  1MSF C;  4CCJ A;  5CJ9 A;  3T1B A;  2HYF A;  3E6B A;  3E7L A;  5H20 A;  2R7V A;  4K2E A;  1TP4 A;  4U87 A;  3T5X A;  1VQ4 I;  3H9J A;  5L3B A;  1P9Q C;  3B02 A;  3AG1 H;  3VOD A;  1UEL B;  1HST A;  2F5F A;  3KEO A;  3GTG J;  1TZL A;  2DMQ A;  5KCM A;  1POG A;  1K83 J;  3DLL F;  3IP4 B;  3TP0 A;  2O7O A;  2W24 A;  2A69 F;  4D7M A;  4LLG F;  4WWC A;  4PK4 A;  3IH3 A;  1ERD A;  1YI2 I;  2VLA A;  3CUQ B;  5IOZ A;  3TDU C;  2DN0 A;  3IAM 2;  2GA2 A;  2ZO4 A;  3KP4 A;  1SAU A;  4CH7 A;  3K4L A;  3IH2 A;  3HKZ N;  4YG2 F;  1WPK A;  3N4M A;  2HWV A;  2LFB A;  2FRH A;  4HYE A;  3IKV A;  4HQM A;  1D3Y A;  1JHF A;  1R22 A;  1R4N B;  2OQR A;  5J47 A;  5LGU A;  2ME0 A;  1J09 A;  2VOP A;  1IRX A;  2EIM H;  3S1R J;  4HZF A;  1G3Y A;  3W3C A;  4AID A;  4NNJ A;  2DFE A;  3FK7 A;  1W7P B;  1BOB A;  3GWZ A;  3EUH C;  5JHF A;  2OQG A;  1K78 A;  2I10 A;  4M9X A;  2P81 A;  2AXL A;  2X85 A;  3HJE A;  5IYC J;  1HDP A;  3KP2 A;  4DOZ A;  2CMP A;  2IAI A;  1FJL A;  2FD5 A;  1FY7 A;  1T0F A;  3BDD A;  4EGY A;  3GFI A;  2H8R A;  3JRE A;  1QHH D;  2RQQ A;  1ZTR A;  4F91 B;  2L3D A;  3KYC B;  3HSF A;  4D5F A;  4XN0 A;  3FDY A;  2DPD A;  1JTX A;  2V6E A;  2M34 A;  3RJP A;  2QYO A;  3ZQI A;  1ZGW A;  1CGP A;  1WRJ A;  3VYR B;  2HTS A;  3E5Q A;  2CS3 A;  2X51 A;  2DYR H;  3V42 A;  1W36 C;  3W2A A;  2E2I J;  4AVP A;  2WB1 N;  4G9Y A;  2CSO A;  1R5I D;  2H94 A;  3O8G A;  3GTJ J;  1BN5 A;  1D5Y A;  4AIH A;  5M3M J;  1R1T A;  2A5W A;  2FNA A;  2ECB A;  4JBA A;  1EJ9 A;  4AM3 A;  3DKX A;  2ZXW H;  3HTU A;  2BZT A;  2NOG A;  2LKS A;  3HOV J;  4OMY A;  2ZKZ A;  1Z77 A;  3HM5 A;  3FKJ A;  2YSR A;  3F9K A;  1IRG A;  3H5R A;  3OYM A;  3QU6 A;  2STW A;  4LG0 A;  1RPW A;  2L9R A;  2X1D A;  1MIJ A;  3B6C A;  5CPR B;  2MSY A;  2F4O B;  4I2O A;  2AQE A;  2KFD A;  2XUB A;  5IT3 A;  2VT2 A;  3JSO A;  2WBM A;  2Q0O A;  2DCE A;  2ZXJ A;  3PSI A;  3BG3 A;  4Z6Y A;  3MVP A;  3BZK A;  5E8G A;  4ZYG A;  4M3B A;  1HXD A;  4IRI A;  1TWA J;  1YW8 A;  2DPU A;  3QWL A;  2DA5 A;  3LSM A;  2GXA A;  2VOD A;  2Z99 A;  3HYI A;  2M8E A;  2KHM A;  2O3F A;  3F8C A;  4HLX A;  1HLV A;  5LHG A;  4UY8 I;  2MLK A;  1IO2 A;  2BVM A;  2A5Y B;  2IGN A;  1H88 C;  4EJO A;  3HHG A;  1KYZ A;  2EV5 A;  4Y15 A;  3WE2 A;  1YX3 A;  2QQB A;  5TRD A;  2BY1 A;  2FQ3 A;  2JA7 J;  4QWQ A;  3PNY A;  4EVI A;  2HKO A;  3D5S C;  4RAF A;  4GCV A;  2M5W A;  4G12 A;  2RNJ A;  1J2X A;  4HAM A;  4RAG A;  1OYI A;  3MKZ A;  3H3U A;  3TW7 A;  2V9V A;  2XPV A;  3MMY B;  2KKO A; 
#chains in the Genus database with same CATH homology
 3K1M A;  3H92 A;  2DBB A;  2KIM A;  3GZ5 A;  3M1E A;  1BOA A;  4LLN A;  1W7P D;  4NB5 A;  4UUV A;  3GYH X;  1ZGA A;  2CO5 A;  3J81 K;  2VOO A;  1D8J A;  3IC7 A;  2Z33 A;  4UVA A;  2IA1 A;  5J8F A;  3F21 A;  4P5O A;  5BMZ A;  2J5O A;  4ZZD A;  4HX8 A;  1OMI A;  4RAZ A;  2XVC A;  2VBX A;  2XAH A;  5K1Y A;  2OAZ A;  3EYI A;  3VB2 A;  5CVI A;  1KYW A;  2FU4 A;  1YFH A;  4BH9 A;  4FX4 A;  1R5H A;  3VOE A;  5D8L B;  4BHB A;  3Q9S A;  3QPT A;  4KMF A;  3IKT A;  5HDK A;  3FXQ A;  1U78 A;  2CFX A;  1K78 B;  1E2X A;  2M45 A;  3KFW X;  1QBJ A;  1J75 A;  1DPU A;  1TBX A;  3BRO A;  1KQ9 A;  5IT9 Z;  2G7H A;  3BJ6 A;  4OIP F;  1I1S A;  1DPR A;  4RB0 A;  3F6O A;  3ROU A;  3JW4 A;  2GQQ A;  3BOQ A;  1P2F A;  1QO0 D;  3RYR A;  3K1N A;  3RYP A;  3S2W A;  4KA4 A;  2P5V A;  3U2R A;  1F4K A;  3ZN1 A;  1I6X A;  4KIG A;  1T6S A;  3SZT A;  1Z7U A;  2E1N A;  1SD7 A;  4LG0 B;  4KN7 X;  4RB1 A;  4OMZ A;  4UV9 A;  1IRF A;  2E7W A;  2BYV E;  3RPU A;  4MHG A;  1O57 A;  5D6E A;  3D0S A;  3IWZ A;  4BNC A;  3GFM A;  2HGC A;  4A0Y A;  5BPI A;  1FP2 A;  6PAX A;  4ZYE A;  3WGG A;  4UVB A;  2DTR A;  3LA2 A;  2HEO A;  3IRQ A;  1R1U A;  2STT A;  2KJB A;  1J9I A;  1RUN A;  1FWZ A;  4IRG A;  3D5L A;  4A12 A;  1YO5 C;  2ESN A;  1R58 A;  3I5U A;  4LGW A;  1XD7 A;  4OU0 A;  4B09 A;  1B9M A;  2HZT A;  1LVA A;  5HDN A;  5JR3 A;  5DEQ A;  3M8F A;  1SAX A;  2JZY A;  3FXR A;  1VTN C;  5CLS A;  3K2Z A;  1B59 A;  3LAJ A;  1O3S A;  3WG9 A;  1ON2 A;  2Y48 A;  2UZK A;  2VC0 A;  3F22 A;  2L4M A;  2QEN A;  2FXA A;  4R1H A;  3MZH A;  2Z5U A;  4O6J A;  5E1W A;  1XDU A;  2IW5 A;  4HOB A;  3ZMT A;  3RPQ A;  3KET A;  4G7Z F;  1DDN A;  1SFU A;  5K5R A;  2XAQ A;  1ZRD A;  2XHK A;  3ZPL A;  4EGZ A;  3VFZ A;  5F64 A;  1W4M A;  4CZZ A;  1TNS A;  4RGS A;  2WC2 A;  3RTR A;  3SFZ A;  4XLN F;  3QOP A;  1XMK A;  2FBK A;  3G3Z A;  1Z91 A;  3WTV C;  2XAG A;  4OIN F;  1FNN A;  2NRA C;  2MH9 A;  3RKW A;  4EM0 B;  4GGG A;  2PLY A;  2KIU A;  5ICF A;  4WF2 A;  1RUO A;  2VN2 A;  2IVM A;  4RGU A;  3HRM A;  4M9S A;  3E6M A;  4XLP F;  1EH7 A;  4KUM A;  3GVA A;  4G6D A;  5DV5 A;  1ODD A;  1BI2 A;  1IW7 F;  5D5W B;  2RQP A;  3KP7 A;  5H6Q A;  1ZAO A;  2JTV A;  1STZ A;  3F3X A;  2F5D A;  4DNC A;  5F6F A;  3BWG A;  1V3F A;  4ENM A;  3ZMD A;  5J8C A;  1G4D A;  3KE2 A;  4XRF A;  1KQ8 A;  4G94 A;  1AOY A;  3KP6 A;  5DDG A;  1CF7 A;  4S05 A;  1UHM A;  3TO6 A;  2X0L A;  4EJV A;  3CO6 C;  2JSC A;  2XV4 S;  5J6X A;  3R6S A;  1J7K A;  1TTY A;  2NNN A;  2EWN A;  1LNW A;  2ZFW A;  2H09 A;  4HBL A;  4Y13 A;  1K7A A;  3E5X A;  5FLX K;  4I09 A;  4OIR F;  3CLO A;  1LEB A;  2DI3 A;  4EM2 A;  1FT9 A;  1REP C;  3FZV A;  2O61 A;  3ZN0 A;  3MEX A;  3QRF F;  1B4A A;  1YS6 A;  3R0J A;  1BIB A;  2JT1 A;  3QPH A;  3F8F A;  3TO9 A;  3GX4 X;  4E70 A;  4R8H A;  3ECH A;  1O7F A;  5LHI A;  3GXO A;  3R0A A;  1ZRE A;  3WTS C;  3EDP A;  3F8N A;  2H27 A;  1BBY A;  1WQ2 A;  1F5T A;  2MC3 A;  3W6K B;  3V7C A;  3H3Z A;  1XSD A;  1ZG5 A;  5D4S A;  2O6G E;  3Q9V A;  3R61 A;  1WWX A;  4JK1 X;  4AWX B;  4GO1 A;  3L00 A;  3IL2 A;  3MQ0 A;  1MJA A;  3V8K A;  1XCV A;  3FF5 A;  1SD5 A;  3I58 A;  1FBU A;  1YW9 A;  2RDP A;  2YPR A;  4CO8 A;  2L01 A;  3JSP A;  2BEO A;  2P8T A;  3F8B A;  2LNB A;  4EJW A;  1XSX A;  1D8K A;  3WTY C;  3O6B B;  3HTS B;  3DEU A;  5FD6 A;  2CGP A;  2M1B A;  3WTX C;  1FBS A;  2HKX A;  4GYG A;  3O3K A;  5HDG A;  2Q8K A;  3DKW A;  1S7O A;  3PFI A;  4ETS A;  4A2U A;  1GXP A;  1YG2 A;  1L3L A;  3GEZ A;  1IXC A;  2Y0M A;  1U5T B;  3Q5F A;  4M73 A;  2DO7 A;  3DXJ F;  1TQM A;  3I53 A;  4H0E A;  4AIJ A;  3HRS A;  1C0W A;  3DF8 A;  4KIC A;  2AS5 F;  2D2W A;  1LJ9 A;  2H6B A;  4I02 A;  1P4X A;  4P9U A;  3CJN A;  5L3C A;  4NQW A;  1CF7 B;  3ZP5 A;  1MZB A;  3ZMS A;  5BQT A;  2MBF A;  3G73 A;  1YIO A;  4MTE A;  2NAZ A;  4WK8 F;  4XSZ F;  2JPB A;  5E1X A;  2LDU A;  2OZU A;  1A04 A;  1XDS A;  1HBX G;  2P7C B;  2V6C A;  3LWF A;  3COA C;  3I54 A;  3J81 Z;  2A07 F;  2DQR A;  2Y75 A;  3MAJ A;  1PUE E;  2Z9O A;  5TJJ A;  5CVJ A;  2XAS A;  3JTH A;  3WGI A;  1FOK A;  5HOO A;  3T8R A;  4R79 A;  1SMT A;  2IT0 A;  5ED4 A;  4UHT A;  2VT3 A;  1B6A A;  2LKP A;  1SD6 A;  2D1V A;  4A5M A;  1BI0 A;  1F9N A;  4KDP A;  1HSJ A;  1UHW A;  5FGM A;  4UVC A;  5ICE A;  3I59 B;  4EMS A;  3KP5 A;  3QP5 A;  1KQ0 A;  3P9K A;  1ZRC A;  3C7J A;  1J0R A;  2F5E A;  3TGN A;  1KU9 A;  3M7G A;  4L9V A;  4RB3 C;  4CXF A;  1MDM A;  4HDU A;  4YFN F;  3ISP A;  2PBI A;  4EJT A;  2DQL A;  4OIQ F;  2O8X A;  1QGP A;  2D45 A;  2RN7 A;  2A6E F;  3LA3 A;  1DUX C;  5CVU A;  2V1D A;  3W6J B;  4HDV A;  2B0L A;  3FM5 A;  4KN4 X;  4IHS A;  3FM3 A;  5AIP A;  2CW0 F;  1Z05 A;  3OOP A;  5L3F A;  3FMR A;  2W25 A;  4G7O F;  3EUH A;  1ZYR F;  4CHU A;  2BBY A;  5D5V B;  4PZJ A;  5BS6 A;  3L9F A;  3FMQ A;  2L4A A;  5D5X B;  1UB9 A;  2EFO A;  4N9H A;  1OYY A;  2ADU A;  2WV0 A;  1SFE A;  2ISY A;  4ENJ A;  2MA3 A;  5LBQ A;  1V4R A;  5DCF A;  4WXC A;  4MGR A;  3GF2 A;  1IAW A;  3IHU A;  1B9N A;  2CG4 A;  3N97 A;  3CUQ C;  2RV8 A;  2M30 A;  3GFL A;  1U6G A;  2DK5 A;  4FHT A;  2FOK A;  4I0B A;  4ZH4 F;  3HRT A;  1S8N A;  1T2K A;  1F1Z A;  5A2Q K;  1QZZ A;  3WTU C;  2ZME A;  4KT5 C;  2QZ8 A;  3BZ6 A;  3SXY A;  2GXB A;  4O3M A;  1D5V A;  4MTD A;  2ISZ A;  5ICG A;  2V1X A;  1E17 A;  1USS A;  4HLY A;  4IHT A;  3ABU A;  1FP1 D;  3DFG A;  3ZQ7 A;  2UXN A;  1S7A A;  2QBY A;  4EM1 A;  2R7F A;  4UXN A;  2A3S A;  5DD8 A;  1BI1 A;  1HKT A;  2IP2 A;  2PFB A;  5AON A;  5FO5 A;  2EV6 A;  4KNY A;  2P6S A;  3VEP A;  3WU1 B;  5E1Z B;  5LEJ A;  4U0Y A;  1BC7 C;  4A5N A;  1XMA A;  4UNO A;  3TDZ C;  4LD5 A;  4HX4 A;  1IN7 A;  4P9F A;  1U3E M;  3FX3 A;  2FSW A;  1FYM A;  4I98 B;  3EET A;  3E6D A;  1YW7 A;  1SD4 A;  3V8J A;  4MNU A;  1TW3 A;  2C6Y A;  1KA8 A;  1FYK A;  4QLC U;  1MDM B;  3DPL C;  2W85 A;  2O0Y A;  1Z9C A;  1TW2 A;  3LQR A;  2UWM A;  4IPA A;  3PQK A;  3SQN A;  4ENN A;  2XAF A;  3HOS A;  1EV7 A;  2ZNZ A;  2HQN A;  1R1V A;  3WTW C;  2G7U A;  3TKY A;  3HRU A;  4L5I A;  2GWR A;  3ML6 A;  3LFK A;  1LEA A;  2D1H A;  4XSX F;  3JAM K;  1O3R A;  5LRR A;  3ZMV A;  3WGH A;  2FNP A;  1ZN2 A;  4L9N A;  1FZP B;  1I5Z A;  3R4K A;  2DAO A;  1S29 A;  3V8L A;  2QVO A;  4RB2 C;  3I64 A;  2QLZ A;  3L2C A;  2IPQ X;  1LB2 A;  4AD9 A;  4WXH A;  4GXO A;  3MFK A;  1LDD A;  1R7J A;  4AIK A;  1TNT A;  1T98 A;  4IVN A;  3C18 A;  3CUQ A;  4BYY A;  5HVQ C;  3HSE A;  1MGT A;  4MEX F;  2ZNY A;  5ILU A;  2F2E A;  3FWE A;  1ZG3 A;  2EA2 A;  4MQ9 F;  5FLX Z;  4KIB A;  2ZBK A;  1BIA A;  4S04 A;  1DP7 P;  4L0Z B;  3KLO A;  1WI9 A;  1W7P A;  1BJA A;  3T0Y A;  1JGS A;  3EYY A;  4ZYD A;  2UXX A;  1MD0 A;  4KIF A;  3J7A O;  1KU3 A;  2QBY B;  4ASN A;  1L0O C;  3V7S A;  4EV0 A;  2X4H A;  3HUG A;  2XRN A;  2PEX A;  3HHH A;  3ULQ B;  1G3T A;  4U7D A;  4DQ2 A;  5LGN A;  2M87 A;  2PMH A;  2A61 A;  1OYW A;  1R23 A;  1EH8 A;  4A6E A;  3P9I A;  4ESF A;  2J5P A;  1H0M A;  1XCB A;  3P9C A;  4N9I A;  3BPX A;  1HW2 A;  4CGZ A;  3T8T A;  3TOB A;  1HW1 A;  2FBH A;  4EJU A;  1W5T A;  4F7Z A;  3QU3 A;  4HF0 A;  2RGV A;  1R5G A;  1IXR C;  1HW5 A;  4ON0 A;  1YTY A;  2F5C A;  3MCZ A;  4L0Y B;  3KCC A;  2MH2 A;  1GHC A;  2PMU A;  2A6H F;  3JTG A;  1K6O A;  3F72 A;  3CO7 C;  1UST A;  3DV8 A;  2OBP A;  2IRF G;  3NRV A;  1ZRF A;  3I0T A;  3U1D A;  3IRR A;  1KU7 A;  1XN7 A;  5LEK A;  5HS8 A;  4CYD A;  2JPC A;  1K79 A;  3GW2 A;  1TLH B;  4RGR A;  1RNL A;  2BGC A;  1IN6 A;  3O2P E;  4YFK F;  3V7R A;  2XRO A;  5E17 F;  4Z2Y A;  2KIF A;  2GXG A;  2NNY A;  1ZH5 A;  5D4R A;  3ECO A;  2RKH A;  1J5Y A;  2HOE A;  4BHC A;  5FB2 A;  4U7B A;  2ESH A;  2VE8 A;  4M6Y A;  5HS9 A;  1RZ4 A;  5DCM A;  3E97 A;  2FEZ A;  4Y17 A;  5L3G A;  1GXQ A;  1W5S A;  3ELK A;  5HLI A;  1PP7 U;  3ABT A;  2W57 A;  2R7D A;  1Z1D A;  1FX7 A;  2VBZ A;  3WTT C;  1FSH A;  2CWE A;  2XKO A;  1XGO A;  4A6D A;  2IA2 A;  5KVR A;  3TO7 A;  4M74 A;  1LDK B;  2OZ6 A;  4HQE A;  4O5V A;  5F1R A;  4B8X A;  2HYG D;  4OOI A;  3L7W A;  3DQV C;  2ZJ2 A;  4IRH A;  2MD5 A;  2K86 A;  3GZ6 A;  2EFW A;  2YR2 A;  3B73 A;  4M71 A;  1YQA A;  2DT5 A;  1H9T A;  2WTE A;  2PN6 A;  3NQO A;  3DP7 A;  1SFX A;  1P6R A;  2VXZ A;  2PQ8 A;  1Z6R A;  3BP8 A;  5LHH A;  4HV5 A;  1I1G A;  1X3U A;  4RGX A;  2NS0 A;  4LJZ F;  5EEH A;  3AAF A;  4U0W A;  2P4W A;  2CYY A;  3E3V A;  3RDI A;  1BC8 C;  1FLI A;  2K02 A;  4A0X A;  4ZZL A;  2O03 A;  1P4W A;  1IUY A;  1P4A A;  1ULY A;  4RS8 A;  1KGS A;  1R36 A;  2ZCW A;  1T39 A;  4L9T A;  1S3J A;  4LK1 F;  1UFM A;  5AIQ A;  2VBY A;  1U2W A;  1FPQ A;  2IJL A;  1QPM A;  4P96 A;  1Y0U A;  1HKS A;  1YYV A;  3HOT A;  2W84 A;  1T38 A;  1IN5 A;  1FYL A;  5CVR A;  2HDC A;  1FBQ A;  1Q1H A;  1NHA A;  2LF8 A;  1UCR A;  1SMY F;  1O3Q A;  3LQQ A;  4I01 A;  3I4P A;  1ZGJ A;  4I7H A;  2QWW A;  4G6Q A;  5HS7 A;  3KZZ A;  4D0P A;  2HQR A;  2KJC A;  5ERI A;  4BAY A;  2KRF A;  3ZMU A;  1MJ9 A;  5LGT A;  2P5L C;  1BM9 A;  4KYW A;  5CYV A;  1ZLJ A;  5JFR A;  4NHJ A;  4YII A;  3ERE D;  4IF4 A;  1BI3 A;  4BHP A;  2TDX A;  1WKM A;  1EH6 A;  1QZY A;  2K4B A;  3SZP A;  3BY6 A;  1FC3 A;  3OV8 A;  2K4J A;  4WX9 A;  4ESJ A;  3KP3 A;  5FFZ A;  4PGG A;  3WE3 A;  4L9J A;  2VON A;  2XIG A;  2GAU A;  2YX4 A;  5DCM B;  3I71 A;  2RC4 A;  1AWC A;  1PDN C;  2FBI A;  3P7N A;  2FE3 A;  3RKX A;  1O7L A;  3MWM A;  4HA8 A;  3GLX A;  4HV6 A;  5A2Q Z;  3ZMZ A;  4CDG A;  5LRS A;  2EA4 A;  5D6F A;  4YIF A;  4L18 B;  3RI4 A;  2FF4 A;  4LFU A;  4M72 A;  2XGX A;  4GYI A;  1WSU A;  2COM A;  2P6T A;  1G3W A;  5JVT A;  4HF2 A;  3IWF A;  3QP6 A;  1RIO H;  2YX7 A;  4TV7 A;  1OPC A;  5HLG A;  4M6X A;  1KU2 A;  1IZ1 A;  2VC1 A;  2HFH A;  2V79 A;  2VE9 A;  2WWY A;  2IA0 A;  1R00 A;  4L5J A;  2V1U A;  5FFX A;  4KFC A;  4WCG A;  2DK8 A;  2OD5 A;  3PQJ A;  3M9A A;  4IJA A;  3KLN A;  4Q48 A;  2Q2E A;  2P5K A;  1U5T C;  2HTJ A;  1U8R A;  1GVJ A;  5E20 A;  2GIV A;  4N0B A;  3RIR A;  1ZLK A;  2QM3 A;  4Q47 A;  3CTA A;  1B1B A;  3BJA A;  3LA7 A;  2DFI A;  2OU2 A;  1TQI A;  4WXD A;  1FSE A;  4KMU X;  5IT9 K;  3KZY A;  4IXA A;  3E5U A;  3REO A;  1JHH A;  2DLL A;  1ONV A;  3F23 A;  5K5O A;  2H6C A;  4G8X A;  3F6V A;  3BPV A;  4MQV A;  2GZW A;  2P7V B;  3U9G A;  2QUF A;  3JAM Z;  4ZYH A;  1ZG1 A;  1HQC A;  2L02 A;  2FML A;  1JE8 A;  4A0Z A;  3K1P A;  2L54 A;  5JHU A;  2XAJ A;  1QQI A;  4UV8 A;  3K0L A;  1H9G A;  3V4G A;  3CDH A;  2DU9 A;  3FHZ A;  3GFJ A;  3FXU A;  2BE5 F;  5DD4 A;  4RAY A;  4U0V A;  2EB7 A;  3F8M A;  1ON1 A;  3C1D A;  5DUI A;  2XKP A;  3GO5 A;  4U88 A;  2OA4 A;  5L3D A;  3TOA A;  1LDJ A;  5KK1 A;  3GUD A;  1QNT A;  5CVV A;  4G7H F;  5E8I A;  2K7L A;  5H6R A;  4PGH A;  5E18 F;  3M8E A;  1I27 A;  4OIO F;  1OR7 A;  5D8K B;  3HIF A;  4LB6 B;  1G6N A;  4MEY F;  4Q5S F;  3LAP A;  4XBF A;  4PDK A;  3E6C C;  4M9Z A;  4YFX F;  5JI6 A;  2EK5 A;  3MZY A;  4P55 A;  2R3S A;  5BOX A;  1TQP A;  5FD5 A;  3LST A;  1S6L A;  3K69 A;  3NEU A;  4ESB A;  1XGM A;  3C3W A;  2JRT A;  1JXS A;  3KEQ A;  2HR3 A;  1YLF A;  3DPT A;  5D5U B;  3HSR A;  5ICC A;  1YS7 A;  1P92 A;  4HX7 A;  2ETH A;  3L09 A;  5LLQ A;  2NYX A;  5ILS A;  4BQA A;  3QAH A;  2PI0 A;  2EFP A;  2ZME B;  5BPD A;  2LF7 A;  4ENK A;  4CIC A;  1MKM A;  2BV6 A;  1OKR A;  4BXU A;  3SHF A;  1J59 A;  1Z6T A;  1U5T A;  4FX0 A;  2FA5 A;  2PG4 A;  4LK0 F;  2EFQ A;  3WOD F;  1XGN A;  2CQK A;  2DW4 A;  3J80 Z;  5EEG A;  2E1C A;  5ILV A;  1IXS B;  1LQ1 A;  1O3T A;  4HW0 A;  3RKY A;  1ZAR A;  2QQ9 A;  2QQA A;  2RVC A;  1IN4 A;  1MJB A;  4FT8 A;  1XGS A;  3BJO A;  5L3E A;  2E7X A;  2EFN A;  1IF1 A;  4LB5 A;  2PJP A;  3WTZ A;  2LSO A;  4JQF A;  4I0A A;  1XSV A;  3R60 A;  1IN8 A;  5K5Q A;  2VBW A;  2MLG A;  2GA1 A;  2Z3Y A;  5DUK A;  3J80 K;  3WU0 A;  3CUO A;  4LLL A;  2A68 F;  1G3S A;  1PP8 F;  1ZHF A;  4HF1 A;  2K27 A;  2G9W A;  2YU3 A;  2HS5 A;  1HKQ A;  3EQL F;  3FMS A;  2EJR A;  5HLH A;  2EV0 A;  2ELH A;  4Q4Z F;  3TQN A;  1RI7 A;  2FMY A;  4LMY A;  5DYM A;  1XB4 A;  3K9T A;  3I59 A;  2ACJ A;  4PCQ A;  4EQQ A;  5CJ9 A;  3T1B A;  2HYF A;  3E6B A;  5H20 A;  4K2E A;  3T5X A;  5L3B A;  3B02 A;  3VOD A;  1HST A;  2F5F A;  3KEO A;  2W24 A;  2A69 F;  4LLG F;  4WWC A;  3CUQ B;  3TDU C;  2GA2 A;  2ZO4 A;  3KP4 A;  4YG2 F;  3N4M A;  2HWV A;  2FRH A;  4HYE A;  3IKV A;  4HQM A;  1D3Y A;  1JHF A;  1R22 A;  5LGU A;  2OQR A;  2VOP A;  4HZF A;  1G3Y A;  1W7P B;  3GWZ A;  2OQG A;  1K78 A;  4M9X A;  2AXL A;  3KP2 A;  1FY7 A;  1T0F A;  3BDD A;  4EGY A;  3GFI A;  2L3D A;  3HSF A;  2DPD A;  3RJP A;  2QYO A;  1CGP A;  1WRJ A;  2HTS A;  3E5Q A;  4AVP A;  4G9Y A;  2CSO A;  2H94 A;  1BN5 A;  4AIH A;  1R1T A;  2FNA A;  4JBA A;  3HTU A;  4OMY A;  2ZKZ A;  2YSR A;  1IRG A;  3QU6 A;  2STW A;  4LG0 A;  4I2O A;  2XUB A;  5IT3 A;  2VT2 A;  3JSO A;  2Q0O A;  2ZXJ A;  5E8G A;  4ZYG A;  4IRI A;  1HXD A;  1YW8 A;  2DPU A;  2VOD A;  2Z99 A;  3HYI A;  2M8E A;  2O3F A;  3F8C A;  4HLX A;  5LHG A;  2MLK A;  2A5Y B;  4EJO A;  3HHG A;  1KYZ A;  2EV5 A;  4Y15 A;  3WE2 A;  5TRD A;  2QQB A;  2FQ3 A;  4QWQ A;  4EVI A;  2HKO A;  4GCV A;  2M5W A;  2RNJ A;  1J2X A;  4HAM A;  1OYI A;  3H3U A;  2V9V A;  2KKO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...