3KE2A

Crystal structure of a duf2131 family protein (sama_2911) from shewanella amazonensis sb2b at 2.50 a resolution
Total Genus 25
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
25
sequence length
103
structure length
103
Chain Sequence
GDQVSKQHKAFLRKLYLAHLMDDARHNLLSLGKLTGMPRRTLQDAIASFADIGIEVEFVQDGERHNAGYYRIRTWGPISSAWMDTHVDEVKSLLGVDDAVGQA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of STRUCTURAL GENOMICS, UNKNOWN FUNCTION (YP_928783.1) from SHEWANELLA AMAZONENSIS SB2B at 2.50 A resolution
rcsb
source organism Shewanella amazonensis sb2b
molecule tags Unknown function
molecule keywords uncharacterized protein YP_928783.1
total genus 25
structure length 103
sequence length 103
chains with identical sequence B, C
ec nomenclature
pdb deposition date 2009-10-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09904 HTH_43 Winged helix-turn helix
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3ke2A00
2XGXA 1G6NA 3FF5A 5E17F 2NNNA 1IAWA 3RI4A 4NQWA 3HTUA 3WTYC 4M71A 3IL2A 2ELHA 2BBYA 4G6QA 1FBUA 3QPTA 1T2KA 3V7SA 3OOPA 4G8XA 3IRQA 4RB1A 4S05A 4BYYA 5DEQA 1FSHA 2G9WA 2FQ3A 2KJCA 4A0ZA 5DV5A 5HOOA 2HWVA 1A04A 1L0OC 1CF7A 5HS8A 1HXDA 5IT9K 2DQRA 3BROA 3K9TA 1S3JA 3LSTA 1D8JA 4UNOA 3I5UA 1BIBA 2F5DA 1XDSA 3GUDA 3GO5A 2GZWA 4AIHA 4LK1F 1XSXA 4O5VA 4ESBA 2DK8A 2LDUA 2FE3A 5AONA 1U5TC 3HSRA 1SD4A 2K27A 3FMRA 3MZHA 3HRUA 4MQ9F 1J7KA 3AAFA 3TDUC 4OOIA 1HW2A 4BQAA 1EH6A 5AIPA 5TJJA 5K5QA 1LEAA 3HSEA 1JXSA 3HOTA 5CVVA 5DDGA 3FMSA 3RJPA 4CGZA 1HSJA 2STWA 1Y0UA 5LEKA 4UVAA 4KYWA 5DUKA 2PLYA 2QUFA 1KU9A 1S7AA 2EJRA 3FMQA 2L02A 3DQVC 3RYRA 4N0BA 3G73A 4DQ2A 3TKYA 4M9XA 1WSUA 1U78A 2A6HF 4KA4A 1OYYA 3CUQC 4KIFA 5L3EA 2DFIA 3EQLF 2JTVA 3TDZC 2XROA 3FXUA 5E8IA 2CYYA 3ELKA 2LKPA 1B4AA 5DCMA 5TRDA 1IN8A 5A2QK 2FMLA 1YS6A 5HDKA 5FD5A 4EGZA 2FXAA 2RGVA 3I59B 4WXCA 4YFKF 2XHKA 3IWZA 2Z9OA 2V1XA 1PP8F 4HX7A 3K1MA 3F8NA 3GZ5A 5FGMA 5JI6A 1TTYA 2ZMEA 5HDNA 4EM1A 2GWRA 1UFMA 5LEJA 1QZYA 1F1ZA 3E5UA 2CG4A 1W5SA 2IJLA 2MBFA 2EWNA 4JBAA 5HDGA 4YG2F 4NB5A 3TO9A 4L9NA 3O3KA 1LQ1A 1H9TA 3T8RA 1TW3A 3JTHA 5L3CA 3Q5FA 3IC7A 5LGTA 4Q5SF 3E5QA 3Q9VA 5L3FA 3ZPLA 1ON1A 3ABUA 1WKMA 5F1RA 2M87A 4XLPF 1XGMA 3C3WA 3GF2A 1AOYA 1IRFA 2MA3A 3LFKA 2VC0A 1TQMA 1RZ4A 4M73A 4UV8A 1JHFA 5E8GA 2P5KA 3HOSA 2EB7A 1XGSA 4KIBA 2OA4A 5CYVA 4YIFA 3WGIA 2QVOA 2LF8A 5E18F 4MTEA 2HGCA 2ZBKA 4I09A 3WE3A 1FYMA 5CVRA 1FYLA 3QOPA 4UUVA 5BPIA 3D5LA 5LGUA 2HTSA 4TV7A 4IVNA 4YFXF 3E3VA 5K5RA 4L9VA 5E20A 3WE2A 2ISYA 2XAQA 3DPTA 1MJAA 3ECHA 1IXSB 4Y17A 3IKVA 1XDUA 2D1HA 2IVMA 1XSDA 3C1DA 1ZLJA 2Q8KA 3CO7C 3KE2A 4ENMA 4U7BA 1BN5A 2RN7A 1C0WA 2V1UA 4FT8A 1YYVA 2FMYA 4GYIA 4RB2C 2XASA 1HW5A 4MEXF 1U6GA 1STZA 1DP7P 4BXUA 1W7PD 4HQMA 2OAZA 2O03A 3GXOA 3DV8A 3TOBA 5BQTA 3I59A 4OINF 3SQNA 2DPUA 4GGGA 2QQ9A 3QRFF 5HS7A 4HAMA 1DPUA 5D5VB 2JSCA 1ODDA 4R79A 4PGGA 3WODF 2VBZA 1S6LA 2PG4A 2EV5A 1P6RA 1LDJA 2KKOA 3JAMK 3V4GA 1WQ2A 2E1CA 3G3ZA 1IXCA 2NS0A 2YSRA 4EQQA 2KIUA 3KFWX 2JZYA 1R1TA 3I4PA 3KCCA 1QGPA 1B1BA 2ZNYA 3P7NA 4ON0A 4KN4X 1ONVA 4XSXF 1U5TA 3ZN0A 5D5XB 1IRGA 1KGSA 2ESNA 2LSOA 3J80K 1R1VA 1B9MA 1XCVA 2MD5A 3EDPA 2UWMA 3TGNA 3FHZA 4A6DA 2BEOA 1QO0D 2HTJA 1MJ9A 3BJ6A 1R1UA 1ZREA 3P9IA 4HF0A 3IRRA 2EK5A 3M1EA 1PUEE 2F2EA 3ZMSA 3KP4A 4XLNF 3WGHA 3REOA 4ASNA 2QWWA 2P7VB 3ABTA 1ZRDA 4OIPF 4KN7X 4Z2YA 3GYHX 1RI7A 3LAJA 2GIVA 3O2PE 2Z5UA 2R7DA 5ILSA 3J80Z 1FC3A 2M8EA 3KZYA 4ESJA 4A5NA 4RAZA 4IRGA 3NRVA 3WGGA 4MNUA 4IF4A 2DK5A 2DLLA 2VT2A 3KP6A 2GA2A 4L5JA 1FP2A 2B0LA 2WWYA 2GQQA 2R7FA 4E70A 3F6OA 3BZ6A 3T1BA 3BPXA 2WTEA 4HLXA 2A5YB 2ETHA 2W84A 4A12A 1X3UA 4O3MA 4JK1X 5CVUA 1HSTA 1YS7A 3E97A 3E6DA 2EFQA 4Y13A 3PQKA 2QYOA 4IHSA 4UVCA 1ZARA 2A68F 5D4SA 2RDPA 3T8TA 2CWEA 1KU2A 4XSZF 5LHHA 2W25A 3WTXC 4KICA 2M45A 3P9CA 4N9HA 4GYGA 3HYIA 2FU4A 2O8XA 2W24A 3VODA 1EH7A 4U0VA 2PJPA 4EM0B 2QBYB 2IP2A 4DNCA 5F64A 3TOAA 1XMAA 4EJOA 2K4JA 4I98B 1OR7A 4CDGA 2VBXA 3FXQA 1HKQA 2HYFA 3F6VA 4JQFA 1FNNA 2VE8A 2ZNZA 1J5YA 1YFHA 3LQQA 4HDVA 3R61A 1Z6RA 5CVJA 4CO8A 3DP7A 1KU7A 1LJ9A 2NRAC 1BI3A 4CZZA 1SFUA 1MJBA 3ZMZA 4KUMA 1U3EM 2E7WA 1K78B 4P55A 1PP7U 2L01A 4PDKA 3L7WA 2UXNA 5E1ZB 4ENKA 3VB2A 5JHUA 5DCFA 1FY7A 5KK1A 4H0EA 4LJZF 5BMZA 3N4MA 2P4WA 4RGSA 4A6EA 3CLOA 2ZKZA 3RYPA 2RNJA 2JPCA 4OMYA 3OV8A 2ZCWA 3DEUA 3WTWC 2V79A 1TNSA 1PDNC 2IA0A 4IHTA 4HYEA 1EV7A 1WRJA 4FHTA 1F5TA 2V6CA 3FWEA 4OIOF 2Q0OA 1NHAA 3MFKA 4KNYA 3MEXA 3T0YA 3TO6A 4UV9A 2COMA 3BJOA 4A0XA 3HRSA 1BJAA 4Q48A 2DW4A 1FYKA 1Z1DA 5IT9Z 3FM5A 3KETA 2ZXJA 2M5WA 3ZP5A 1ZLKA 1S29A 3F8MA 5BPDA 1W7PB 2A61A 4ENJA 2QBYA 5LBQA 4HA8A 2GA1A 2YR2A 2EFPA 4EV0A 5F6FA 4KMUX 2CFXA 1REPC 4YFNF 4AD9A 1Q1HA 2P5VA 2V9VA 1R7JA 1GXQA 4BH9A 4KIGA 3WU0A 2ZJ2A 3DXJF 3S2WA 2Z99A 1L3LA 1YW7A 1G4DA 1J0RA 4KT5C 1KQ0A 1XN7A 2H94A 4BNCA 1OKRA 4WWCA 3I54A 4HDUA 1HBXG 1J9IA 5HLGA 1FX7A 2XRNA 4ZYEA 1FZPB 1T38A 3RKWA 2ZO4A 5H20A 2F5CA 1GHCA 4U0YA 3W6JB 2FNPA 4ZYDA 2HQNA 1S8NA 2P7CB 2KIMA 1YG2A 4YIIA 2MC3A 1BOAA 3IHUA 5KVRA 3CTAA 1IXRC 4PZJA 1Z6TA 5HS9A 1YO5C 2L4AA 2XIGA 2HKOA 4HX4A 3ULQB 3M8FA 2D45A 2P6TA 1O7FA 3RKXA 2PN6A 1T98A 1IN6A 3KLOA 5DYMA 4WX9A 1O3TA 4LMYA 1I1SA 3HTSB 1D5VA 1IN5A 3CUQB 2IW5A 4M9SA 4LLLA 3R0AA 1OYIA 3GW2A 4CICA 4XBFA 4HF1A 3WTZA 4ZH4F 2OQGA 2YPRA 4K2EA 4EGYA 4D0PA 4RAYA 1E2XA 3VEPA 2HDCA 3KEOA 2L54A 4P5OA 4L0YB 2ZMEB 1P4AA 4N9IA 2L4MA 4MHGA 2WV0A 1MGTA 1R58A 2D1VA 2CQKA 2LNBA 2Y0MA 4EJUA 1DUXC 1MDMB 3KLNA 2K02A 1LDDA 2XV4S 3M7GA 3ZMVA 3HRTA 1K79A 4MQVA 3V7RA 5DUIA 2ADUA 2XVCA 1LB2A 2O3FA 3QU6A 3MCZA 1YTYA 4UVBA 2UXXA 4EJWA 2OD5A 3RDIA 1HKTA 1AWCA 1R5GA 4KMFA 2MLGA 2FF4A 1G3TA 2XUBA 3QP5A 4P9FA 4Q4ZF 3F21A 4RB0A 3JSOA 3I71A 3GLXA 2KJBA 3R0JA 5IT3A 2H27A 2MLKA 3IKTA 2VOPA 1ZHFA 4G7ZF 5LRSA 5ILVA 3GVAA 2FRHA 1UB9A 1E17A 4IPAA 4L5IA 2VXZA 2OQRA 3GWZA 5BOXA 3GFIA 4MEYF 5DD4A 3DF8A 2FA5A 5JR3A 4M9ZA 5LRRA 4I0AA 3KP7A 3MWMA 2IA1A 2FEZA 2RKHA 2Y75A 2J5OA 3EETA 1OYWA 1FWZA 2BV6A 3GEZA 4AWXB 4ETSA 2OZUA 3SXYA 3FXRA 1B9NA 2K86A 3RPUA 4ZZLA 2ISZA 1G3YA 3J81Z 1F4KA 1K78A 1Z05A 3I58A 1W7PA 3T5XA 1QQIA 3L2CA 3H3ZA 2Z33A 2CSOA 4A2UA 4BHPA 4KDPA 3BJAA 4M6YA 4AVPA 1IUYA 5FLXZ 2D2WA 5LHIA 4BAYA 1Z91A 1SMTA 1S7OA 4FX0A 1FP1D 4LB6B 1SFEA 1T39A 5D4RA 1I1GA 5D6EA 5LGNA 3ECOA 2C6YA 5J8CA 2DU9A 2HKXA 2GXBA 1FOKA 2JRTA 3NQOA 4HX8A 1V4RA 3CUOA 1HW1A 3K2ZA 3KP3A 1IW7F 3R6SA 2FNAA 1SFXA 1KQ8A 3GFMA 1H9GA 4Y15A 3B02A 1O3RA 1MKMA 3I0TA 4L0ZB 4WXHA 3L09A 3C18A 4LG0B 1W4MA 1OMIA 1B59A 2EFOA 2DI3A 3KP2A 4RB3C 3RKYA 1FLIA 4WCGA 1QBJA 2NAZA 3GZ6A 1WWXA 3QAHA 1GXPA 2EV6A 2STTA 4EJVA 2H6CA 1ULYA 2DQLA 5D8KB 2HR3A 3KZZA 5E1XA 3DKWA 5DD8A 1R22A 2R3SA 2PFBA 2CW0F 3VFZA 2DO7A 4I0BA 3F72A 2JPBA 3ERED 3PFIA 4G7OF 3HHGA 4HV6A 5LLQA 2DAOA 1R23A 1SMYF 3WTVC 1JHHA 2FBIA 1BI0A 1R00A 4HZFA 3BDDA 2HOEA 2A07F 1BIAA 1IZ1A 4EM2A 3M8EA 2H09A 3E6CC 3WTSC 3Q9SA 4OIRF 3M9AA 4HF2A 4OU0A 3U2RA 1ZGAA 1P92A 2HYGD 5ED4A 2AXLA 4I02A 4G9YA 2YX4A 3MZYA 5A2QZ 1ON2A 5FLXK 1SAXA 4LLGF 2JT1A 1P2FA 3ZN1A 2PMHA 3CJNA 3E6MA 4HW0A 2NNYA 2KIFA 4OMZA 2XAJA 1ZRFA 1I6XA 1XCBA 3SHFA 2DPDA 2UZKA 3BPVA 2QZ8A 4LFUA 4LK0F 2OZ6A 3HIFA 5HLHA 2VT3A 4ENNA 2ESHA 1RIOH 2J5PA 1FSEA 3F8FA 5DCMB 3WTTC 3LAPA 3E5XA 1OPCA 2G7HA 2XKPA 5ERIA 4LG0A 1TQPA 1LEBA 4P96A 2EA2A 4NHJA 3L9FA 3D0SA 2Z3YA 3U9GA 1USTA 3ROUA 1ZG3A 3HSFA 1H0MA 1U8RA 4RGRA 2Q2EA 2O61A 5J6XA 1YW9A 3QU3A 2W57A 1O3QA 1UHWA 1Z7UA 2XAGA 1RUNA 2L3DA 1USSA 2K4BA 3WTUC 1KYZA 1MZBA 3JAMZ 2HQRA 2M30A 2IT0A 1IN4A 3C7JA 3FX3A 1YIOA 2XAFA 4RGUA 1DPRA 2K7LA 1J2XA 2M1BA 1DDNA 3SZTA 4B8XA 2MH2A 3DPLC 4QLCU 4UHTA 2DBBA 1ZG5A 1G3SA 1KYWA 1TW2A 2VONA 2GAUA 1G3WA 2O0YA 2A6EF 5D8LB 4OIQF 1ZRCA 4FX4A 2WC2A 3ISPA 4BHBA 1J59A 4PCQA 4CHUA 3L00A 4M72A 1YLFA 5ICFA 3H92A 1QNTA 4AIKA 1TNTA 3LA7A 4IRIA 4CXFA 2VE9A 2VOOA 1JE8A 1P4XA 1TLHB 2XKOA 1BBYA 4GCVA 3FZVA 2FOKA 4EMSA 1FBQA 1XGOA 3TO7A 3HHHA 1ZAOA 4IXAA 1EH8A 5CVIA 3GFJA 1BI2A 4ESFA 2BE5F 2CGPA 2F5EA 1R5HA 2H6BA 3R4KA 4L9JA 4O6JA 5BS6A 4AIJA 5J8FA 5L3DA 3F3XA 5ICGA 4BHCA 1D8KA 1K6OA 2PI0A 4LGWA 3U1DA 1BM9A 1RUOA 4A5MA 5AIQA 1ZN2A 3NEUA 1F9NA 2PEXA 4HLYA 5ICCA 3RTRA 3V8KA 1V3FA 4KFCA 3ML6A 3ZMDA 5K5OA 4HQEA 4UXNA 1J75A 2EFNA 3EYIA 1YW8A 1JGSA 1ZYRF 1FT9A 4A0YA 2X4HA 3LA2A 2IA2A 3QP6A 1BI1A 1SD5A 2HEOA 1RNLA 2NYXA 1U5TB 3RPQA 4Q47A 2GXGA 5HLIA 4U88A 3JSPA 2FBKA 2OU2A 4MGRA 2TDXA 3ZMTA 5JVTA 2LF7A 1XGNA 2VODA 3I53A 4G94A 1MD0A 3K69A 2VC1A 4MTDA 1ZG1A 1IN7A 5EEHA 4IRHA 4ZYHA 1UHMA 4F7ZA 4R8HA 3MAJA 1P4WA 1KU3A 3KP5A 1VTNC 3W6KB 2E1NA 4IJAA 3VOEA 5ICEA 1O57A 4LLNA 4L9TA 3LWFA 3HRMA 2VBWA 4I2OA 4EVIA 2RV8A 1LDKB 2MH9A 2BYVE 4QWQA 2A3SA 3F8BA 1O7LA 1SD7A 1IF1A 5FB2A 1TBXA 1I5ZA 2QLZA 1XD7A 3DFGA 5CLSA 3F23A 4LB5A 3QPHA 2A69F 3COAC 3O6BB 2PQ8A 2XAHA 2OBPA 5L3GA 4CYDA 4L18B 4P9UA 3J81K 2IPQX 3K0LA 3CUQA 5D6FA 1Z9CA 3H3UA 2Y48A 2P5LC 2YX7A 5FD6A 2KRFA 4M6XA 4GXOA 3N97A 3K1PA 5LHGA 2P8TA 4EJTA 5E1WA 4RGXA 2VN2A 2FSWA 3FM3A 1FBSA 1KA8A 4B09A 4U0WA 5FO5A 2EV0A 5L3BA 4M74A 3J7AO 5H6QA 1QPMA 2CO5A 3BP8A 2HZTA 4I7HA 4RS8A 1WI9A 3E6BA 2QQBA 3BWGA 2ZFWA 1BC7C 4WF2A 3V8LA 4ZZDA 1I27A 1O3SA 5H6RA 2QENA 3GX4X 3WG9A 1R36A 3JW4A 5D5UB 3CO6C 3KEQA 2EA4A 2E7XA 4WXDA 2DTRA 4PGHA 3WU1B 2O6GE 3CDHA 5CJ9A 1XSVA 2DT5A 4HBLA 4G6DA 1ZGJA 1HKSA 1T0FA 5FFZA 3LA3A 3ZMUA 3EYYA 3V8JA 5FFXA 2PBIA 3TQNA 4I01A 2HFHA 3JTGA 2ACJA 3ZQ7A 2YU3A 2F5FA 3I64A 1CF7B 1XMKA 1D3YA 3BOQA 3EUHA 1W5TA 3P9KA 3PQJA 3V7CA 3F8CA 1XB4A 4ZYGA 2V1DA 3HUGA 3K1NA 2AS5F 1MDMA 4HOBA 4R1HA 5ILUA 4G7HF 1GVJA 2BGCA 1B6AA 2QQAA 4LD5A 2P6SA 3F22A 3GFLA 3IWFA 1HQCA 3RIRA 4WK8F 2QM3A 3SZPA 1K7AA 1ZH5A 1LNWA 1YQAA 2RVCA 2VBYA 1BC8C 2RQPA 1LVAA 2HS5A 5EEGA 5K1YA 3LQRA 2EFWA 3SFZA 1U2WA 4U7DA 1UCRA 2RC4A 1SD6A 2X0LA 1CGPA 1KQ9A 2IRFG 6PAXA 2FBHA 1FPQA 4GO1A 3R60A 5JFRA 4S04A 3MQ0A 3BY6A 2PMUA 1TQIA 5D5WB 5HVQC 4XRFA 2G7UA 3B73A 4HV5A 2W85A 1T6SA 1QZZA
chains in the Genus database with same CATH superfamily
2XGXA 1G6NA 1WGXA 2DJNA 3CDLA 3D1NI 3VDXA 3FF5A 1D0YA 2JK3A 5E17F 2Z1DA 2PJRB 4V19K 2NNNA 2LFBA 2ME6A 2E5ZA 1IAWA 3RI4A 4NQWA 4EATA 2WA0A 1FIAA 3HTUA 3WTYC 1MBEA 4M71A 3IL2A 2ELHA 2LY2A 4M3FA 2BBYA 1WHUA 3CJQB 4G6QA 1FBUA 1MNMC 3PO3J 1HA8A 3QPTA 2XGEA 2X9DA 4D7NA 1T2KA 2M2EA 3V7SA 3HPHA 1SAUA 3OOPA 4G8XA 3X2QH 1G2HA 3IRQA 2NVUB 5JLWA 4RB1A 4S05A 4BYYA 3QYFA 4DBRA 5DEQA 1QZEA 1UMQA 2QA4I 4YEJA 1FSHA 3BR5A 2G9WA 2FQ3A 2KJCA 4A0ZA 4E7KA 2X6WA 2Y2ZA 4AIDA 4ZDLA 2XAUA 5FRMA 3H5RA 3HEFA 3FXKA 5DV5A 2YUSA 3CQZJ 5HOOA 4C3HJ 2HWVA 1A04A 3CCJI 1L0OC 1IV6A 3A2KA 1CF7A 5HS8A 1JT6A 2JN6A 5M3MJ 1N25A 4XKCA 1HXDA 3P5JA 5IT9K 4PJJA 2DQRA 3BROA 2VQHA 1S3JA 3K9TA 3LSTA 3K7AJ 2MFZA 3I5UA 1BIBA 4UNOA 2F5DA 1XDSA 4F55A 1IDYA 3GUDA 3GO5A 4W97A 1K4SA 1JI8A 2GZWA 4AIHA 4YELA 4LK1F 4X1EA 5M5YJ 1XSXA 4O5VA 4ESBA 2I5UA 2O5RA 2DK8A 2LDUA 3CP8A 2E1OA 2FE3A 4A3CJ 1OISA 5AONA 2BXZA 2LMDA 1U5TC 5IP9J 3WHBA 3HSRA 2K9QA 1SD4A 3ASNH 2K27A 3FMRA 3MZHA 3HRUA 4MQ9F 3S3OA 1X4OA 1J7KA 4XRSG 3AAFA 2YS9A 1RR8C 2COBA 3TDUC 5C44J 4OOIA 1HW2A 1ETWA 4BQAA 4HEA2 1YI2I 3J7ZI 1EH6A 5AIPA 1A5JA 5TJJA 5K5QA 1LEAA 3HSEA 5F27A 1JXSA 3HOTA 5CVVA 5DDGA 1UAAA 3CD6I 2EH3A 3FMSA 1YJWI 3RJPA 3PFYA 3RSNA 1TWAJ 4CGZA 4AVZA 3QOEA 1HSJA 2STWA 1Y0UA 5LEKA 1Y56A 4UVAA 2Y9YA 4KYWA 1OLTA 5DUKA 2PLYA 2QUFA 4BEHB 1KU9A 1MBGA 1S7AA 1TWGJ 3S1RJ 2VKHA 2EJRA 3FMQA 2L02A 3DQVC 1AU7A 4UUSB 3RYRA 2OJED 4N0BA 3G73A 4DQ2A 3GTQJ 3TKYA 1VQOI 2X6OA 1S9HA 4IL6C 4M9XA 1WSUA 1U78A 2A6HF 3PNTA 4KA4A 3CZ6A 1OYYA 3CUQC 4Y4RA 4KIFA 3S3NA 5L3EA 1H8AC 1POGA 2DFIA 2JJ7A 3EQLF 2KRCA 2CQXA 2IS4A 2JTVA 3TDZC 4ZDPA 4LITA 3FXUA 2XROA 3HPGA 3KIOA 5E8IA 3OYLA 3FDYA 2CYYA 3CJRB 1SFOJ 3ELKA 2GBYA 1FEXA 2EQRA 3PL8A 3QQAA 3HOZJ 4BJ5C 2KFDA 2LKPA 4QTRA 1B4AA 5DCMA 3KYLA 5TRDA 1IN8A 3LOCA 5A2QK 2E60A 1X2MA 2FMLA 2VUMJ 1YS6A 3ABLH 3LMMA 5HDKA 5FD5A 4EGZA 2FXAA 2RGVA 4HSRA 2TRTA 3L2RA 3I59B 4WXCA 4PSXA 2R7TA 2IAIA 4YFKF 2EPFA 5EYRA 3GTLJ 2XHKA 3IWZA 4F91B 3GTJJ 2Z9OA 3OYAA 2V1XA 2HI3A 1PP8F 4HX7A 3GZNB 3K1MA 5K7FA 3F8NA 2VJIA 5HLTA 1DU6A 1LKXA 1YE9A 2BVLA 3HJEA 2KL4A 3GZ5A 4CA0A 4DZPA 2VASA 5GPCA 5FGMA 1TL8A 2XSDC 5H2FC 5JI6A 1IGNA 1RRJA 1TTYA 2ZMEA 3CCMI 5HDNA 3HOYJ 4EM1A 4ZJZA 2GWRA 2HPMA 1ACIA 1MH3A 1UFMA 5LEJA 3K4NA 1QZYA 2L9VA 1F1ZA 3DBLB 3E5UA 3I9V2 2CG4A 1W5SA 3F9KA 3CC7I 2V6EA 4XR6A 3CC4I 3BC8A 2H8WA 1U0JA 2IJLA 2W00A 2MBFA 2EWNA 2MYSA 4JBAA 5HDGA 2K5CA 4YG2F 4NB5A 1K61A 3ZQQA 1FTTA 4AYBA 3TO9A 3I55I 2ZJRF 4L9NA 3O3KA 4XK4A 1LQ1A 1YHQI 1H9TA 3T8RA 1TW3A 2V1NA 3JTHA 5L3CA 5J1RA 3Q5FA 2VPLA 3IC7A 5LGTA 2EZIA 4BJ6C 4Q5SF 1U9NA 3HB9A 1Y1WJ 3QPLA 3E5QA 3Q9VA 3Q0VA 5L3FA 5JVGF 3ZPLA 1ON1A 3ABUA 3ZQLA 1WKMA 4ZYAA 5F1RA 2M87A 4XLPF 1XGMA 2CUEA 3C3WA 3GF2A 1AOYA 5C3EJ 5K7ZA 2L7KA 1IRFA 2MA3A 3DLLF 2E36A 2GM4A 3LFKA 2VC0A 1TQMA 1RZ4A 2KISA 4M73A 1NH3A 3S2HJ 4UV8A 3W2AA 5DTDA 2KPMA 1ETKA 1JHFA 4HNVA 5E8GA 2P5KA 3HOSA 2EB7A 4U87A 2BHZA 1XGSA 4KIBA 2OA4A 5CYVA 2L2OA 4YIFA 2XRLA 1YJ9I 3WGIA 2QVOA 2LF8A 5E18F 4MTEA 2HGCA 3JRDA 2ZBKA 4I09A 2EIJH 2E1MC 3WE3A 1FYMA 3AKZA 2KQRA 2Z16A 5CVRA 1FYLA 3BTJA 1M1EB 3LFUA 3ASOH 3QOPA 4UUVA 2VIXA 5BPIA 3D5LA 5LGUA 2HTSA 3PO2J 4TV7A 3K4LA 4IVNA 4YFXF 1JJ6C 3E3VA 5K5RA 4L9VA 5E20A 1TWHJ 3J7AY 1V55H 3OYJA 3QPSA 4J00A 3WE2A 2ISYA 2XAQA 3DPTA 1X1AA 1MJAA 3ECHA 1IXSB 1Y6IA 4Y17A 2E71A 3IKVA 1XDUA 2D1HA 1MBHA 1OCTC 2IVMA 1WVRA 2DMPA 2ELKA 3C1DA 1IV8A 3QODA 1XSDA 2KLOA 1AHDP 1ZLJA 2B9SA 2Q8KA 3HDDA 3CO7C 4CCMA 3KE2A 3AG1H 2WAQA 2AO9A 4ENMA 4XNFA 1PJRA 4U7BA 4I76A 1BN5A 2RN7A 1C0WA 4L5EA 2V1UA 3BG6A 5M5WJ 4FT8A 4CCLA 1YYVA 3HOWJ 2FMYA 4GYIA 1W5CC 4XKBA 2LP0A 4RB2C 2XASA 1HW5A 3K70C 1VQ9I 2N8GA 4MEXF 2LD5A 1U6GA 1STZA 1DP7P 2BZTA 1W7PD 4BXUA 2OCCH 4HQMA 1R4MB 3FK7A 2OAZA 3OYMA 3GXOA 2O03A 2H8RA 1SC7A 3RZOJ 1BR2A 1Z77A 2DDBA 3DV8A 1W1WE 4CZCA 1JKOC 3TOBA 1JGGA 1UHSA 1YRNA 5BQTA 1P7JA 3HKZA 2JQ7A 3I59A 4OINF 3SQNA 3PUBA 2NVTJ 2DPUA 2LK2A 1LFBA 3AG3H 4GGGA 4LG3A 1Q1VA 3O8GA 1MH4A 2QQ9A 3QRFF 2XPUA 5HS7A 3U1KA 4BDZA 4Z6YA 3RCOA 4HAMA 1Z3XA 1DPUA 3MKYB 2Q1ZB 3ZR8X 3N05A 5FKOA 5D5VB 2A6TA 2JSCA 1ODDA 4R79A 2ZMEC 3JRCA 4PGGA 1XX5A 5F04A 3K4CA 3WODF 2VBZA 1S6LA 2PG4A 2FJ1A 2EV5A 1P6RA 1LDJA 1RC9A 1ZK8A 2GOXB 2KKOA 1ZGWA 1IC8A 1VQKI 3SEZA 3JAMK 3DBHB 4B44A 4A3EJ 3V4GA 4F52A 1WQ2A 1Z21A 4M3EA 2NVYJ 2E1CA 3G3ZA 1J09A 1DQUA 1IXCA 5B66C 1ETYA 2NS0A 2YSRA 2NVXJ 2R7OA 4EQQA 1JKRC 2KIUA 2PMZN 3KFWX 2JZYA 1EF4A 2BY0A 1RKTA 1R1TA 3FXLA 3I4PA 1IG7A 3KCCA 1QGPA 3DCFA 1B1BA 2JA7J 2ZJQF 2ZNYA 4DOZA 2ZSIB 2F4IA 3S93A 3P7NA 2E19A 4ON0A 2CV0A 4IHYA 2DA7A 1B8IA 4KN4X 1ONVA 3VSKA 4XSXF 1U5TA 3ZRGA 4FISA 3ZN0A 4NC8A 4AC0A 5D5XB 3CCYA 5KNLA 1IRGA 1KGSA 2ESNA 2LSOA 2VJ4A 3J80K 3S16J 2DTZA 1PUFA 1R1VA 4JYKA 1QHHD 4HPQA 1B9MA 1XCVA 3FKIJ 2MD5A 2DJIA 2E2JJ 3CDIA 1SANA 3F0CA 3EDPA 2UWMA 2ZFUA 3TGNA 3FHZA 4A6DA 5FROA 2BEOA 4MIMA 1TT0A 2LLKA 1QO0D 2HTJA 2QF7A 3OIQA 1MJ9A 3BJ6A 1R1UA 1V54H 1SEUA 5GPAA 1ZREA 3K2AA 3P9IA 4HF0A 3NAUA 3EUAA 3IRRA 2EK5A 3M1EA 2R7WA 4NC6A 2QKMB 4J19A 3BG7A 2PJRA 2X48A 1LPQA 1PUEE 2BXYA 2H1LA 4LOCA 2F2EA 3ZMSA 4B1RA 3KP4A 4XLNF 3WGHA 3REOA 3SFIA 4ASNA 4OAZA 3IAS2 2QWWA 2P7VB 3S1NJ 4AUXA 3ABTA 1ZRDA 4OIPF 4J01A 4IOCF 3DTKA 4KN7X 4Z2YA 3GYHX 1NK3P 1RI7A 3CP2A 1FTZA 2ELJA 3LAJA 1RR7A 2GIVA 3O2PE 1VI0A 4E7HA 2Z5UA 2R7DA 5ILSA 3J80Z 1MNEA 4G12A 2JRMA 1MIJA 1FC3A 2M8EA 3KZYA 1D8JA 1IDZA 4ESJA 3GCMA 4A5NA 1Y1VJ 4RAZA 2RQQA 4IRGA 5B1BH 4H4KC 3NRVA 4IQ4A 3WGGA 3BT9A 4BDYA 4MNUA 4IF4A 2DK5A 2DLLA 2X6YA 2VT2A 3KP6A 4XKVA 2GA2A 3JRBA 3WU2C 2DN0A 2EILH 2BY3A 3KX2A 4L5JA 1FP2A 2B0LA 2CQQA 3LSHA 5K7HA 4C30A 5FKKA 2MG4A 2WWYA 2GQQA 2R7FA 3PSIA 1BL0A 3RPUD 4E70A 3F6OA 2IS1A 3OOUA 1Z0XA 3OSFA 3BZ6A 4XL9A 2CH0A 3T1BA 3BPXA 3CESA 2WTEA 4HLXA 3BCAA 1XC5A 2A5YB 3CJTB 2ETHA 1VQ5I 1X58A 2IXSA 4BBSJ 3OR1C 4XKWA 2W84A 1Z7LA 4RMNA 2XF5A 4XRMA 2BY2A 4A12A 1X3UA 4O3MA 5BNGA 2X6XA 4JK1X 5CVUA 1HSTA 3TP3A 2M9HA 1YS7A 1ZELA 1H89C 5FLVA 1TWCJ 3E97A 5J40A 3E6DA 2EFQA 2H1KA 4Y13A 1YRNB 4NUBA 4XICA 1A6IA 3PQKA 2R7VA 2QYOA 4IHSA 4UVCA 4RBOA 1ZARA 5GAEJ 4C2TA 2JA8J 2A68F 5D4SA 2RDPA 3T8TA 2CWEA 1KU2A 3JREA 1K6YA 2Q2EB 4DYCA 4BY7J 2FUG2 4XSZF 5LHHA 4D1QA 2W25A 2IGKA 3WTXC 3GTOJ 2CV1A 5JHFA 4KICA 2M45A 4M3GA 4BQQA 2EIMH 3S15J 3E0JB 3P9CA 2VI6A 4IO9F 4N9HA 2K85A 4GYGA 3HYIA 2OCEA 4BEHA 4DW6A 4X0GA 2FU4A 1T0FC 2O8XA 2W24A 3HUGB 3RKQA 4CCKA 3VODA 2W82A 4D9JA 2LKXA 1EH7A 4U0VA 4B3AA 1KONA 3K4MA 2PJPA 3VSLA 1SVMA 1ETOA 4PJLA 4EM0B 3E7LA 2QBYB 2IP2A 2AQEA 4BS9A 4DNCA 1X3WB 2F5VA 5F64A 1A31A 3TOAA 5GP9A 1X3ZB 1XMAA 4EJOA 1JKPC 2K4JA 4UY8I 2B7EA 3ERMA 1WJAA 2BVMA 4I98B 1E3HA 1OR7A 4A3MJ 1X1CA 4CDGA 5GAGJ 2VBXA 3FXQA 4S0HB 1BR1A 2O9LA 1HKQA 2HYFA 3F6VA 3GTKJ 3H9QA 4JQFA 5IY5H 4G6TB 1SVOA 1FNNA 2VE8A 1LE8B 2ZNZA 1J5YA 3AG4H 3OL3A 3LQQA 3UKGA 1YFHA 4ITVA 4HDVA 3R61A 4HNTA 1FOXA 1Z6RA 5CVJA 2XC7A 4CO8A 3DP7A 1KU7A 1LJ9A 2NRAC 4RLQA 3WHCA 1BI3A 4CZZA 2LREA 1SFUA 1MJBA 2M4GA 4QPOA 4E7SA 3ZMZA 1MBKA 4KUMA 2Y31A 2M7AA 4A3FJ 1U3EM 3CLQA 3CMMA 2E7WA 5F0FA 1K78B 1QA6A 1OCRH 4FTHA 4A3KJ 2K9LA 1UJ8A 2M4KA 3OYCA 3SEQA 4P55A 1PP7U 4NDLA 1TWFJ 4JOMA 4DBQA 3FISA 2L01A 4PDKA 3L7WA 1UG2A 2UXNA 5E1ZB 4ENKA 3VB2A 2ZB9A 5JHUA 5DCFA 1FY7A 5KK1A 2ECCA 4H0EA 4LJZF 5BMZA 2WV1A 3N4MA 2P4WA 1R4NB 4II3A 4RGSA 4A6EA 5J4YA 2K9MA 4N4NB 3G4SI 1ZTRA 3CLOA 2ZKZA 2CUZA 2HYJA 3RYPA 2RNJA 3GTMJ 2JPCA 1JKQC 1VQ4I 1RPWA 4OMYA 2L7FP 2R5YA 2F4OB 3G1OA 2E2IJ 4MO7A 3OV8A 2ZCWA 3DEUA 3WTWC 2HOSA 1OCPA 2V79A 1OQYA 1TNSA 1NTCA 3ZQGA 3OS0A 1PDNC 5F0HA 5EDNA 2VL8A 2IA0A 1IJWC 4IHTA 4HYEA 1EV7A 1WRJA 2MW8A 4FHTA 1MBJA 4KJZA 3S8PA 3GMEA 1F5TA 3FWEA 2V6CA 4OIOF 2Q0OA 2DYRH 1P7IA 1BOBA 2FD5A 5EGOA 3C2HA 2OF7A 1NHAA 3B6CA 3MFKA 4KNYA 3MEXA 1ORKA 2DOFA 1WPKA 3T0YA 3TO6A 4UV9A 1OCOH 2COMA 4FASD 3BJOA 4A0XA 2PMZA 1KZHA 3A1YA 3HRSA 5F0CA 1BJAA 2X1EA 3HG9A 1IRXA 1ETQA 2DW4A 4Q48A 2BY1A 3KEYA 2W4SA 1FYKA 1Z1DA 5IT9Z 3FM5A 1S5LC 1NG7A 2CS3A 2ZXJA 3KZIC 3KETA 2L7MP 3BG9A 2NOJB 5FRNA 3HOUJ 2M5WA 3ZP5A 4FQGA 1TZLA 4IHXA 4HG2A 1ERDA 2KHMA 4CH7A 3A0HC 5FKNA 1ZLKA 1S29A 4XLAA 3F8MA 1R71A 5BPDA 1BR4A 1W7PB 2A61A 4ENJA 2QBYA 5LBQA 4GRIA 3TEDA 4HA8A 2CJJA 2XGCA 1VNDA 2GA1A 2YR2A 2EFPA 1I50J 4EV0A 5F6FA 4KMUX 2CFXA 5TGTA 1REPC 4YFNF 4AD9A 3G1LA 3TMOA 3CMYA 5DM7F 2CMPA 3W3CA 1GV2A 1Q1HA 2P5VA 2V9VA 4XORA 2JVHA 1R7JA 1VQ6I 1GXQA 4BH9A 4KIGA 3WU0A 1B8IB 2ZJ2A 3DXJF 3S2WA 2Z99A 1L3LA 1YW7A 1G4DA 2MSYA 1J0RA 4KT5C 1KQ0A 2LTPA 1AKHB 1ZR4A 1XN7A 2H94A 4BNCA 5B1AH 1OKRA 4CUGA 1I3AA 5HODA 4WWCA 3I54A 4BQNA 4UUSA 4HDUA 2X1CA 3CCLI 1HBXG 2VJ5A 3OYBA 1J9IA 5HLGA 3TP0A 1FX7A 2XRNA 4CCNA 4ZYEA 1FZPB 2HXOA 1ETVA 1YX3A 3L2QA 1T38A 3RKWA 2ZO4A 5H20A 3BQZA 1QHGA 2F5CA 5B3SH 1GHCA 4CCJA 4U0YA 3W6JB 2WAQN 2QSGX 4E7LA 3GBGA 3Q3SA 2FNPA 1BW6A 4BGDA 4ZYDA 1WI3A 2R7QA 2R5ZB 1D0XA 2HQNA 1S8NA 2P7CB 2KIMA 1YG2A 4YIIA 1LUJB 2WADA 2WY7Q 2MC3A 1MMDA 3NWSA 1BOAA 1FMVA 3IHUA 4ANJA 5KVRA 3CTAA 1W36C 3DBRB 1XG1A 1IXRC 2OTJI 4E7ZA 4PZJA 1Z6TA 1XTAA 5HS9A 1YO5C 2L4AA 2XIGA 1QPIA 2HKOA 4HX4A 3ULQB 3JRAA 3W2WA 1S72I 1Y8RB 3M8FA 3OWTA 5GADJ 2D45A 2P6TA 1VF9A 4FETA 4JX5A 3SDGA 1O7FA 1FJLA 3RKXA 5IPAA 2PN6A 1T98A 1IN6A 3KLOA 5DYMA 3ZGKA 4WX9A 1O3TA 3FHNA 2K40A 4LMYA 4RAGA 3HTSB 1I1SA 3H3VK 1D5VA 2X1DA 1X1PA 4HNUA 1IN5A 2DA2A 3CUQB 2IW5A 4M9SA 4LLLA 3R0AA 5J47A 1HC8A 1EKEA 1OYIA 3GW2A 4E7JA 4CICA 3BCBA 4XBFA 1UELB 4HF1A 3W6VA 3WTZA 2DA3A 4ZH4F 2OQGA 2KP6A 3IH4A 2YPRA 4K2EA 4EGYA 4D0PA 4RAYA 4KT6A 1E2XA 3VEPA 2XF7A 2HDCA 3KEOA 3G2BA 2L54A 3IUOA 4P5OA 4L0YB 5JLXA 1PYVA 2ZMEB 1P4AA 4CYCA 4N9IA 2L4MA 4B48A 5EZGA 2UUZA 4F93B 4MHGA 2WV0A 2W7NA 2FX0A 2WB1N 1MGTA 1R58A 2MC4A 2D1VA 4JX4A 2CQKA 2LNBA 2Y0MA 4DZJA 4EJUA 1DUXC 2R7UA 4OWRB 1MDMB 3KLNA 1D1AA 3O8HA 2K02A 1LDDA 4A93J 2XV4S 3M7GA 5DS9A 3ZMVA 3HRTA 5EG0B 2HVRA 1K79A 4MQVA 3V7RA 5DUIA 3I4MJ 1PVEA 2ADUA 2XVCA 3ONQA 5KCMA 5DM6F 1LB2A 2Y0SN 2CQ7A 2O3FA 3BR0A 3S14J 3QU6A 3MCZA 1YTYA 3FBNB 4FE7A 4UVBA 2HNHA 4RLFA 2UXXA 4EJWA 1X1DA 2OD5A 2MD0A 3RDIA 1HKTA 1AWCA 1R5GA 4KMFA 2NXNB 2MLGA 5EGOB 3A0BC 4II2A 2ICWG 2FF4A 1G3TA 2XUBA 3QP5A 4P9FA 4Q4ZF 1NG6A 2RNGA 1A36A 4PUSA 3F21A 3PM1A 4RB0A 3JSOA 3CCRI 4KISA 4A3DJ 1GV5A 3I71A 3GLXA 4IEJA 4XLEA 2KJBA 1IO2A 3R0JA 5IT3A 2M0MA 2H27A 2MLKA 2Y0SA 3IKTA 2VOPA 4M6VA 2CU7A 4CSWA 4Y7NJ 1ZHFA 3S32A 4G7ZF 5LRSA 5ILVA 3GVAA 1W0TA 2DCEA 2FRHA 3S1QJ 1XMXA 3IH2A 1UB9A 1E17A 1K4TA 4IPAA 5HNFA 4A3LJ 4RA2A 4L5IA 2VXZA 2LOOA 3ABMH 2OQRA 2R92J 4GDFA 3GWZA 4BXFA 5IOZA 5BOXA 2V26A 2VQLA 4A69C 3GFIA 3HZJA 1GLNA 2W1OA 3HBLA 2NVQJ 2KRHA 3BTCA 4MEYF 5DD4A 4BJTA 2IBDA 3DF8A 1QVTA 2DA5A 2FA5A 5JR3A 4M9ZA 5LRRA 1RETA 2CRGA 4I0AA 4DIQA 3KP7A 2DMUA 3MWMA 4QIWN 2NS7A 1MSEC 2IA1A 2FEZA 3OYDA 2RKHA 2VLAA 3CCUI 2Y75A 2J5OA 3EETA 1JTYA 1OYWA 2HXIA 3L1PA 1FWZA 3TBIA 2BV6A 3GEZA 4AWXB 3PJRA 2GLOA 4B47A 3H36A 4ETSA 2OZUA 3SXYA 5IP6A 3FXRA 1B9NA 2R5ZA 2K86A 3RPUA 4ZZLA 2ISZA 1G3YA 1X2NA 3J81Z 1YJNI 1F4KA 1K78A 3OYGA 3I56I 1Z05A 2DOAA 3I58A 1W7PA 4C3IJ 3ABKH 1Z3YA 5CQGA 3G71I 4XOPA 3T5XA 5IYBJ 5KAIC 1QQIA 3PNVA 3RZDJ 4Y52J 5M5XJ 3L2CA 3H3ZA 2Z33A 2ZXHA 1DU0A 1HDPA 2CSOA 4A2UA 3BTIA 4BHPA 4KDPA 2DMQA 3BJAA 4M6YA 3FBIB 4AVPA 1F36A 1IUYA 4PJ0C 5FLXZ 2D2WA 2G0EA 5EF6A 5LHIA 2Y9ZA 2ID6A 4BAYA 1Z91A 2EINH 1RESA 4XN0A 1WH7A 1SMTA 1ZKGA 1S7OA 2Y30A 1N77A 4FX0A 1FP1D 4LB6B 1SFEA 1T39A 5D4RA 1I1GA 5D6EA 5LGNA 3ECOA 3OYEA 2C6YA 2R7SA 5J8CA 2DU9A 2HKXA 2GXBA 1P9QC 4D5FA 3EPZA 4E4HA 5EJCA 1VQNI 1E0EA 1FOKA 3PNYA 2JRTA 2VKEA 3NQOA 4IKFA 4HX8A 1V4RA 2QKLB 3CUOA 1HW1A 4Y33A 3K2ZA 2M34A 3KP3A 3VYUB 4E6KG 3DWLE 1IW7F 2BW3B 3R6SA 3H35A 4MFDA 5GTHC 2FNAA 1ETXA 4RAFA 1SFXA 3Q0WA 1KQ8A 2WY8Q 3GFMA 2RREA 4P1WA 1H9GA 3MD2A 4Y15A 1FOYA 4QPQA 3B02A 4DYQA 1O3RA 2WAFA 1MKMA 3I0TA 2JSPA 4L0ZB 4WXHA 3ZQFA 3L09A 1V5GA 1X4PA 1D0ZA 3C18A 4LG0B 4XLCA 1W4MA 1LFUP 1OMIA 1B59A 2EFOA 2DI3A 2HDDA 3KP2A 1HF0A 4RB3C 3QYEA 3RKYA 4WCGA 1FLIA 1QBJA 2NAZA 2F48A 3GZ6A 2JVGA 1WZ2A 1SVLA 1WWXA 3QAHA 3K70D 2XSJC 1GXPA 2DMNA 2EV6A 2HZDA 2EIKH 2STTA 4EJVA 2H6CA 1XS9A 3DU5A 2P0WA 1ULYA 2DQLA 5D8KB 2HR3A 3RQ4A 3KZZA 2QEXI 3A02A 5E1XA 3DKWA 4B43A 4XN3A 3HOXJ 1GVDA 3MVPA 5DD8A 4HSTA 1R22A 4EEFG 4V2FA 2R3SA 2PFBA 2Y69H 2CW0F 3VFZA 2DO7A 2GIZA 4I0BA 4LIUA 3F72A 2TCTA 2O7OA 5IP7J 2JPBA 5LFAA 3ERED 3AFHA 1BW5A 3PFIA 2LC2A 4G7OF 3HHGA 4HV6A 5LLQA 2YU9J 2DAOA 2XB5A 1R23A 4AU7A 1SMYF 3FXMA 4KITB 3WTVC 1JHHA 2FBIA 1BI0A 1R00A 2AHQA 2L9NA 4HZFA 3BDDA 3LSMA 2HOEA 2A07F 1BIAA 2VXDA 2CQNA 5E3OA 3G6EI 1IZ1A 2OTLI 4EM2A 5E3MA 3M8EA 2H09A 2NS8A 5TISC 3E6CC 2D5VA 3WTSC 5FKLA 1ENHA 3Q9SA 2ECBA 4OIRF 3MKWB 3HC7A 2OUMA 3IH3A 1V5EA 3M9AA 4HF2A 9ANTA 4OU0A 3U2RA 1ZGAA 2F4MB 1P92A 4XIDA 2HYGD 2DA6A 2PX9A 3M4OJ 5ED4A 2AXLA 4I02A 4G9YA 2ZXWH 1LE8A 2YX4A 3MZYA 5A2QZ 1ON2A 2K3PA 3CF5F 5FLXK 1WJCA 1UZCA 3RQIA 2IGMA 2LBFA 2QGUA 2DFHA 4BE2A 1SAXA 4LLGF 1TT5B 2JT1A 1P2FA 3ZN1A 2WBMA 4ZTFA 2P81A 1D5YA 4XRSA 2LG4A 2PMHA 3E6MA 3CJNA 4HW0A 3A03A 3OMYA 2NNYA 1PUFB 2KIFA 4OMZA 2HDWA 2XAJA 5IYCJ 2FOWA 1ZRFA 1I6XA 1XCBA 3SHFA 2DT7B 2DPDA 2XF6A 4RM3A 5M3FJ 2UZKA 3BPVA 2QZ8A 3VYSB 3QYBA 4LFUA 2E1MB 2R7XA 4LK0F 2OZ6A 1X1BA 3HIFA 3OYHA 5HLHA 5E79C 1OR7C 2VT3A 4ENNA 1VFCA 2VB6A 2ESHA 1RIOH 2J5PA 1FSEA 3F8FA 5DCMB 3WTTC 3PSFA 2CUJA 3LAPA 1VQLI 2CW7A 2W48A 3E5XA 4UB6C 1OPCA 2G7HA 4YIRX 3ZCOA 2XKPA 2KT0A 5ERIA 4LG0A 2LY9A 1JJ8C 2R5YB 1TQPA 3J7YJ 2R7ZJ 5J4VA 1I6HJ 3WG7H 5E3NA 2L9RA 1LEBA 4P96A 4ZC3A 2EA2A 2BOLA 4NHJA 3L9FA 3D0SA 2Z3YA 3U9GA 3H0DA 4NNJA 1USTA 3M8JA 1U9OA 3G1MA 5IOYA 2EZHA 1ZG3A 3ROUA 3HSFA 1OCCH 1H0MA 1V5FA 1U8RA 2A5WA 4RGRA 2Q2EA 2O61A 3BR2A 2L5QA 4BUPA 2OPTA 2MGQA 3FKJA 1YW9A 5J6XA 3QU3A 2W57A 2F6CA 3JRGA 1O3QA 2GXAA 1UHWA 1Z7UA 5HNHA 1HLVA 3KPHA 4DYRA 2XAGA 1RUNA 2VKVA 1WJEA 2L3DA 1MMNA 1USSA 2K4BA 3WTUC 1KYZA 1MZBA 2VJJA 3JAMZ 5KHDA 2DFFA 2HQRA 2IEKA 4JX6A 1Y8QB 4XONA 4F3QA 2M30A 2IT0A 1IN4A 3C7JA 1APLC 3H5AA 5EEAA 2VQCA 3FX3A 3LSRA 1YIOA 2LYCA 2JA5J 3FXOA 3H1CA 5FLMJ 4IOAF 2XAFA 2HOTA 4RGUA 2JUGA 2KDZA 2CW8A 1U8BA 1DPRA 1MNDA 2K7LA 1J2XA 4DJAA 4HRIA 3HXLA 3BG3A 1R49A 4LIVA 4JP0A 2M1BA 1DDNA 1WCMJ 2I10A 3SZTA 1FIPA 3FXJA 3L2VA 3HOVJ 3FIWA 4B8XA 2MH2A 5J1UA 3ZXSA 1S7EA 3DPLC 4B4CA 4QLCU 2NOGA 2AQFA 4UHTA 1GT0C 2DBBA 1ZG5A 2KDOA 1G3SA 1KYWA 1TW2A 2VONA 3AG2H 3H5NA 2GAUA 3D5SC 3QWLA 4RDUA 3PIPF 1G3WA 4N4OB 4IX7A 2XPVA 2O0YA 5J3LA 2A6EF 5D8LB 4BKXA 4OIQF 1TC3C 1ZRCA 4FX4A 2WC2A 3ISPA 4BY1J 4BHBA 2X51A 3S17J 4PK4A 1J59A 4PCQA 1VQMI 4CCOA 4CHUA 3L00A 4M72A 1YLFA 5ICFA 4IQJA 3H92A 1QNTA 2R93J 4D7MA 1G59A 3ZQIA 2ZJPF 4D5CA 1WJDA 2V9KA 2LY1A 4AIKA 1TNTA 3LA7A 2EZLA 3HL2A 2LH9A 3OL4A 2E2HJ 4FE4A 4IRIA 2KMUA 3V42A 1I3QJ 4CXFA 4ABZA 2VE9A 2VOOA 3OYIA 1JE8A 2AXTC 3PUFA 1P4XA 3HM5A 2XB0X 3LSIA 3K4JA 2JA6J 1TLHB 2LVSA 2DXIA 3Q0UA 2XKOA 3OIOA 4PJMA 3IAM2 1BBYA 4B3XA 3LNQA 4GCVA 1HCRA 3FZVA 2FOKA 4EMSA 1FBQA 3UNGC 1XGOA 3TO7A 3HHHA 1ZAOA 2IGNA 4IXAA 2DA1A 1EH8A 4W1UA 1OJLA 4Y3OA 5CVIA 2R0QC 3DLAA 3GFJA 1BI2A 4ESFA 3GTGJ 3BLYA 2BE5F 2CGPA 2WB1A 2F5EA 5F08A 1R5HA 2H6BA 3R4KA 4L9JA 4M3BA 4O6JA 4XMYA 5BS6A 1F43A 1HOMA 4AIJA 2I8DA 2ZSHB 5E3LA 1BA5A 1DP3A 5J8FA 3JRHA 1B72A 5L3DA 2DMTA 4C3JJ 2LBFB 2HVQA 1YOVB 3F3XA 3S2DJ 5C4JJ 5ICGA 3K4KA 5CQEA 4BHCA 3CF2A 1D8KA 1K6OA 2PI0A 4X6AJ 5IYDJ 1XPXA 1LFPA 3DU6A 3JRFA 4E7IA 3OY9A 1AKHA 3CCVI 4LGWA 3SYTA 3VPRA 1W0UA 4BACA 3JRIA 3S1MJ 3U1DA 4CYCB 1EJ9A 1IUFA 2HVSA 3OYKA 2V7FA 1BM9A 2JWTA 1RUOA 1FOWA 1X19A 2DA4A 1YX5A 4A5MA 5AIQA 3CCEI 2EBIA 1ZN2A 3NEUA 1F9NA 3OIPA 2PEXA 3M07A 4HLYA 1JUMA 5ICCA 4NQWB 3RTRA 4IHWA 3V8KA 1V3FA 4KFCA 3ML6A 1IRZA 3E1SA 4NC7A 3ZMDA 5K5OA 4HQEA 3TW6A 3BZCA 3HGGA 4UXNA 5LD2C 3ESWB 5EG0A 1J75A 2EFNA 3VYTB 3EYIA 1Y39A 1YW8A 1JGSA 3K4BA 4XQFA 2A05A 3AL0C 1ZYRF 4XM3A 2QCOA 1VQ8I 3OS2A 1NK2P 1MMGA 3H0GJ 1FT9A 2M7BA 4A0YA 1T08B 2X4HA 3LA2A 1Y0NA 3L2UA 4C2UA 1JTXA 3H9JA 2IA2A 3QP6A 1BI1A 1SD5A 2DT6A 4A3GJ 2M3AA 2HEOA 1RNLA 1QU3A 3KYDB 2NYXA 1U5TB 3MKLA 3RPQA 2JUCA 2GXGA 4Q47A 5HLIA 4U88A 3JSPA 2KZVA 2FBKA 2OU2A 4MGRA 2TDXA 1FMWA 3ZMTA 5JVTA 2FQ4A 2LF7A 1XGNA 2VODA 2CUFA 5CKTA 3CMEI 4A3BJ 3I53A 4G94A 2KIQA 1MD0A 3DEEA 3C2GA 3K69A 5GAHJ 3PIOF 2VC1A 2V4JC 2DDAA 4IZZA 4MTDA 1ZG1A 1YIJI 1IN7A 5EEHA 3LSKA 3B6AA 4IRHA 4ZYHA 1UHMA 1WFXA 4F7ZA 2IS2A 1TP4A 3FK6A 4R8HA 3MAJA 3UR3C 3BR3A 1P4WA 4AYBN 1KU3A 3KP5A 4A3JJ 1VTNC 4XOTA 1ZR2A 3W6KB 1JUPA 2LR8A 1R5ID 1N78A 2E1NA 3DKYA 3I3LA 4IJAA 3VOEA 5ICEA 2ME0A 1O57A 2LRDA 2IGOA 3M3YJ 4LLNA 4L9TA 4BE0A 3LWFA 1CQTA 1RKWA 3HRMA 3GTPJ 2E34A 2VBWA 4I2OA 1T56A 4PFOA 4EVIA 2RV8A 3BG5A 1LDKB 4UB8C 1B72B 2JMWA 2DOEA 3DTIA 3LSPA 2MH9A 2V9PA 2BYVE 2OC6A 4QWQA 5CPRB 2A3SA 3NWTA 3JR9A 1MW7A 3F8BA 1O7LA 3DTEA 2HOAA 1QVUA 1MMSA 2JA2A 1SD7A 3IP4B 1IF1A 2O8KA 1VZ0A 3VYRB 5FB2A 1TBXA 1I5ZA 3TL4X 3A4CA 2QLZA 1XD7A 3OSGA 3DFGA 5CLSA 3F23A 4LB5A 3QPHA 3ZQCA 3BTLA 1YITI 2A69F 4QSHA 1WJBA 3COAC 3O6BB 1G8XA 2PQ8A 2XAHA 3LL7A 2L9SA 2OBPA 5L3GA 4CYDA 3A01B 5GTIC 4C9YA 3SZGA 2CFOA 3NARA 4BE1A 4P9UA 3J81K 4L18B 2IPQX 3K0LA 2VQGA 3CUQA 2M8GX 5D6FA 5C4XJ 2DODA 1Z9CA 1QRYA 1E3PA 3BQYA 1MBFA 3H3UA 2Y48A 1H88C 3BR1A 3GLLA 2IS6A 2P5LC 2YX7A 5FD6A 2KRFA 4IHVA 2L7ZA 3M1CA 4M6XA 4GXOA 3N97A 2E35A 2HQ5A 3K1PA 3SJMA 5LHGA 2P8TA 2B63J 3OYNA 1A35A 1ZQ3P 4EJTA 5E1WA 3K10A 2VN2A 4RGXA 2FSWA 3FM3A 1VQPI 1FBSA 3K6GA 2BHYA 1KA8A 4OAYA 4B09A 2RAEA 2XPWA 3OR2C 3BR6A 4BBRJ 4U0WA 5FO5A 4M3DA 1DGRM 2EV0A 5L3BA 4M74A 4PSWA 3J7AO 3CMAI 5H6QA 1QPMA 2QSFX 2CO5A 2QQ8A 3BP8A 2HZTA 4I7HA 3HGYA 4RS8A 1WI9A 2L0KA 5KAFC 5B5EC 4F92B 1ITYA 3E6BA 3D5RC 2QQBA 3BWGA 3LSJA 1HDDC 2ZFWA 4MFEA 1BC7C 2E5NA 1W36D 2HU9A 2MABA 2BW3A 4C2MJ 4WF2A 3V8LA 1Z67A 2GOMA 2WAEA 4ZZDA 4YRVA 1I27A 1N75A 1O3SA 5H6RA 4RM2A 1WH5A 2QENA 1GDTA 3GX4X 3WG9A 1R36A 3JW4A 2DYSH 5D5UB 3CO6C 3KEQA 1SFKA 2EA4A 2E7XA 3EUKL 4WXDA 2M0CA 2DTRA 2ID3A 4PGHA 3WU1B 1LVKA 3W2VA 2O6GE 3U21A 3CDHA 5CJ9A 3S3MA 1XSVA 2DT5A 4MLOA 3DKXA 4HBLA 1DGWY 4G6DA 4V2GA 1ZGJA 1HKSA 1T95A 1WJFA 1T0FA 3JCUC 5FFZA 3CC2I 1EA3A 4A3IJ 1T8IA 3LA3A 3ZMUA 2EZKA 4PFPA 4BL0B 2KZGA 3EYYA 3V8JA 4ZTJA 5FFXA 2PBIA 3TQNA 3C2BA 4I01A 3ZOBA 3HKZN 4DGWB 5FJ8J 2HFHA 1JUSA 3A01A 3OS1A 3JTGA 3SDBA 2ACJA 1R9TJ 1A6QA 3ZQ7A 2YU3A 2UV1A 2ZC2A 2F5FA 3I64A 1CF7B 1XMKA 4GFBA 4ZDOA 1D3YA 3BOQA 1JT0A 2XGDA 2Z2SB 3EUHA 1W5TA 3P9KA 3PQJA 4XLFA 2K3FA 3V7CA 3F8CA 1XB4A 4ZYGA 1MSFC 3MKZA 2V1DA 3HUGA 3K1NA 4PJNA 2R7RA 1I39A 2AS5F 4I99C 1BJZA 4AM3A 3OYFA 1MDMA 4HOBA 3I4NJ 4R1HA 5ILUA 1T33A 4G7HF 1GVJA 2K9NA 3KYCB 2VKDA 4FCYA 2XDVA 2BGCA 1B6AA 2QSHX 3ZQHA 2QQAA 4LD5A 4BQOA 2P6SA 4BU2A 3MMYB 3L2WA 3VWBA 3AL0B 1WJ5A 2X85A 3TW7A 1AA7A 1OCZH 2HPIA 3GFLA 2ZXIA 3IWFA 1D1CA 1HQCA 5EZHA 3F22A 3LSGA 3RIRA 4WK8F 2HQAA 2QM3A 2R4GA 1E3OC 5FKMA 4UUTA 5J1YA 3SZPA 1D1BA 1K7AA 1ZH5A 1LNWA 1UG0A 1YQAA 2RVCA 2VBYA 3MZ8A 2RQPA 1BC8C 1LVAA 2HS5A 5EEGA 1K83J 4BXXJ 5F1JA 5K1YA 1O4XA 3LQRA 2EFWA 1GUUA 3SFZA 4I6ZA 1U2WA 2OV7A 1UCRA 4U7DA 2CV2A 2VPRA 3MN2A 2RC4A 1SD6A 2X0LA 1CGPA 3DPUA 4NBQA 1KQ9A 4XLHA 3CCSI 2IRFG 6PAXA 2FBHA 3IV5A 1FPQA 2DFEA 3DEWA 4GO1A 3R60A 5JFRA 1VQ7I 4S04A 3MQ0A 3BY6A 1MMAA 3H9GA 2PMUA 1TQIA 5D5WB 5HVQC 4XRFA 3BZKA 1OFCX 2G7UA 3CCQI 3B73A 4HV5A 2W85A 1T6SA 1QZZA 1R6RA 3EUHC 2K9SA 2LKSA
chains in the Genus database with same CATH topology
2XGXA 1G6NA 3FF5A 5E17F 2NNNA 1IAWA 3RI4A 4NQWA 3HTUA 3WTYC 4M71A 3IL2A 2ELHA 2BBYA 4G6QA 1FBUA 3QPTA 1T2KA 3V7SA 3OOPA 4G8XA 3IRQA 4RB1A 4S05A 4BYYA 5DEQA 1FSHA 2G9WA 2FQ3A 2KJCA 4A0ZA 5DV5A 5HOOA 2HWVA 1A04A 1L0OC 1CF7A 5HS8A 1HXDA 5IT9K 2DQRA 3BROA 3K9TA 1S3JA 3LSTA 1D8JA 4UNOA 3I5UA 1BIBA 2F5DA 1XDSA 3GUDA 3GO5A 2GZWA 4AIHA 4LK1F 1XSXA 4O5VA 4ESBA 2DK8A 2LDUA 2FE3A 5AONA 1U5TC 3HSRA 1SD4A 2K27A 3FMRA 3MZHA 3HRUA 4MQ9F 1J7KA 3AAFA 3TDUC 4OOIA 1HW2A 4BQAA 1EH6A 5AIPA 5TJJA 5K5QA 1LEAA 3HSEA 1JXSA 3HOTA 5CVVA 5DDGA 3FMSA 3RJPA 4CGZA 1HSJA 2STWA 1Y0UA 5LEKA 4UVAA 4KYWA 5DUKA 2PLYA 2QUFA 1KU9A 1S7AA 2EJRA 3FMQA 2L02A 3DQVC 3RYRA 4N0BA 3G73A 4DQ2A 3TKYA 4M9XA 1WSUA 1U78A 2A6HF 4KA4A 1OYYA 3CUQC 4KIFA 5L3EA 2DFIA 3EQLF 2JTVA 3TDZC 2XROA 3FXUA 5E8IA 2CYYA 3ELKA 2LKPA 1B4AA 5DCMA 5TRDA 1IN8A 5A2QK 2FMLA 1YS6A 5HDKA 5FD5A 4EGZA 2FXAA 2RGVA 3I59B 4WXCA 4YFKF 2XHKA 3IWZA 2Z9OA 2V1XA 1PP8F 4HX7A 3K1MA 3F8NA 3GZ5A 5FGMA 5JI6A 1TTYA 2ZMEA 5HDNA 4EM1A 2GWRA 1UFMA 5LEJA 1QZYA 1F1ZA 3E5UA 2CG4A 1W5SA 2IJLA 2MBFA 2EWNA 4JBAA 5HDGA 4YG2F 4NB5A 3TO9A 4L9NA 3O3KA 1LQ1A 1H9TA 3T8RA 1TW3A 3JTHA 5L3CA 3Q5FA 3IC7A 5LGTA 4Q5SF 3E5QA 3Q9VA 5L3FA 3ZPLA 1ON1A 3ABUA 1WKMA 5F1RA 2M87A 4XLPF 1XGMA 3C3WA 3GF2A 1AOYA 1IRFA 2MA3A 3LFKA 2VC0A 1TQMA 1RZ4A 4M73A 4UV8A 1JHFA 5E8GA 2P5KA 3HOSA 2EB7A 1XGSA 4KIBA 2OA4A 5CYVA 4YIFA 3WGIA 2QVOA 2LF8A 5E18F 4MTEA 2HGCA 2ZBKA 4I09A 3WE3A 1FYMA 5CVRA 1FYLA 3QOPA 4UUVA 5BPIA 3D5LA 5LGUA 2HTSA 4TV7A 4IVNA 4YFXF 3E3VA 5K5RA 4L9VA 5E20A 3WE2A 2ISYA 2XAQA 3DPTA 1MJAA 3ECHA 1IXSB 4Y17A 3IKVA 1XDUA 2D1HA 2IVMA 1XSDA 3C1DA 1ZLJA 2Q8KA 3CO7C 3KE2A 4ENMA 4U7BA 1BN5A 2RN7A 1C0WA 2V1UA 4FT8A 1YYVA 2FMYA 4GYIA 4RB2C 2XASA 1HW5A 4MEXF 1U6GA 1STZA 1DP7P 4BXUA 1W7PD 4HQMA 2OAZA 2O03A 3GXOA 3DV8A 3TOBA 5BQTA 3I59A 4OINF 3SQNA 2DPUA 4GGGA 2QQ9A 3QRFF 5HS7A 4HAMA 1DPUA 5D5VB 2JSCA 1ODDA 4R79A 4PGGA 3WODF 2VBZA 1S6LA 2PG4A 2EV5A 1P6RA 1LDJA 2KKOA 3JAMK 3V4GA 1WQ2A 2E1CA 3G3ZA 1IXCA 2NS0A 2YSRA 4EQQA 2KIUA 3KFWX 2JZYA 1R1TA 3I4PA 3KCCA 1QGPA 1B1BA 2ZNYA 3P7NA 4ON0A 4KN4X 1ONVA 4XSXF 1U5TA 3ZN0A 5D5XB 1IRGA 1KGSA 2ESNA 2LSOA 3J80K 1R1VA 1B9MA 1XCVA 2MD5A 3EDPA 2UWMA 3TGNA 3FHZA 4A6DA 2BEOA 1QO0D 2HTJA 1MJ9A 3BJ6A 1R1UA 1ZREA 3P9IA 4HF0A 3IRRA 2EK5A 3M1EA 1PUEE 2F2EA 3ZMSA 3KP4A 4XLNF 3WGHA 3REOA 4ASNA 2QWWA 2P7VB 3ABTA 1ZRDA 4OIPF 4KN7X 4Z2YA 3GYHX 1RI7A 3LAJA 2GIVA 3O2PE 2Z5UA 2R7DA 5ILSA 3J80Z 1FC3A 2M8EA 3KZYA 4ESJA 4A5NA 4RAZA 4IRGA 3NRVA 3WGGA 4MNUA 4IF4A 2DK5A 2DLLA 2VT2A 3KP6A 2GA2A 4L5JA 1FP2A 2B0LA 2WWYA 2GQQA 2R7FA 4E70A 3F6OA 3BZ6A 3T1BA 3BPXA 2WTEA 4HLXA 2A5YB 2ETHA 2W84A 4A12A 1X3UA 4O3MA 4JK1X 5CVUA 1HSTA 1YS7A 3E97A 3E6DA 2EFQA 4Y13A 3PQKA 2QYOA 4IHSA 4UVCA 1ZARA 2A68F 5D4SA 2RDPA 3T8TA 2CWEA 1KU2A 4XSZF 5LHHA 2W25A 3WTXC 4KICA 2M45A 3P9CA 4N9HA 4GYGA 3HYIA 2FU4A 2O8XA 2W24A 3VODA 1EH7A 4U0VA 2PJPA 4EM0B 2QBYB 2IP2A 4DNCA 5F64A 3TOAA 1XMAA 4EJOA 2K4JA 4I98B 1OR7A 4CDGA 2VBXA 3FXQA 1HKQA 2HYFA 3F6VA 4JQFA 1FNNA 2VE8A 2ZNZA 1J5YA 1YFHA 3LQQA 4HDVA 3R61A 1Z6RA 5CVJA 4CO8A 3DP7A 1KU7A 1LJ9A 2NRAC 1BI3A 4CZZA 1SFUA 1MJBA 3ZMZA 4KUMA 1U3EM 2E7WA 1K78B 4P55A 1PP7U 2L01A 4PDKA 3L7WA 2UXNA 5E1ZB 4ENKA 3VB2A 5JHUA 5DCFA 1FY7A 5KK1A 4H0EA 4LJZF 5BMZA 3N4MA 2P4WA 4RGSA 4A6EA 3CLOA 2ZKZA 3RYPA 2RNJA 2JPCA 4OMYA 3OV8A 2ZCWA 3DEUA 3WTWC 2V79A 1TNSA 1PDNC 2IA0A 4IHTA 4HYEA 1EV7A 1WRJA 4FHTA 1F5TA 2V6CA 3FWEA 4OIOF 2Q0OA 1NHAA 3MFKA 4KNYA 3MEXA 3T0YA 3TO6A 4UV9A 2COMA 3BJOA 4A0XA 3HRSA 1BJAA 4Q48A 2DW4A 1FYKA 1Z1DA 5IT9Z 3FM5A 3KETA 2ZXJA 2M5WA 3ZP5A 1ZLKA 1S29A 3F8MA 5BPDA 1W7PB 2A61A 4ENJA 2QBYA 5LBQA 4HA8A 2GA1A 2YR2A 2EFPA 4EV0A 5F6FA 4KMUX 2CFXA 1REPC 4YFNF 4AD9A 1Q1HA 2P5VA 2V9VA 1R7JA 1GXQA 4BH9A 4KIGA 3WU0A 2ZJ2A 3DXJF 3S2WA 2Z99A 1L3LA 1YW7A 1G4DA 1J0RA 4KT5C 1KQ0A 1XN7A 2H94A 4BNCA 1OKRA 4WWCA 3I54A 4HDUA 1HBXG 1J9IA 5HLGA 1FX7A 2XRNA 4ZYEA 1FZPB 1T38A 3RKWA 2ZO4A 5H20A 2F5CA 1GHCA 4U0YA 3W6JB 2FNPA 4ZYDA 2HQNA 1S8NA 2P7CB 2KIMA 1YG2A 4YIIA 2MC3A 1BOAA 3IHUA 5KVRA 3CTAA 1IXRC 4PZJA 1Z6TA 5HS9A 1YO5C 2L4AA 2XIGA 2HKOA 4HX4A 3ULQB 3M8FA 2D45A 2P6TA 1O7FA 3RKXA 2PN6A 1T98A 1IN6A 3KLOA 5DYMA 4WX9A 1O3TA 4LMYA 1I1SA 3HTSB 1D5VA 1IN5A 3CUQB 2IW5A 4M9SA 4LLLA 3R0AA 1OYIA 3GW2A 4CICA 4XBFA 4HF1A 3WTZA 4ZH4F 2OQGA 2YPRA 4K2EA 4EGYA 4D0PA 4RAYA 1E2XA 3VEPA 2HDCA 3KEOA 2L54A 4P5OA 4L0YB 2ZMEB 1P4AA 4N9IA 2L4MA 4MHGA 2WV0A 1MGTA 1R58A 2D1VA 2CQKA 2LNBA 2Y0MA 4EJUA 1DUXC 1MDMB 3KLNA 2K02A 1LDDA 2XV4S 3M7GA 3ZMVA 3HRTA 1K79A 4MQVA 3V7RA 5DUIA 2ADUA 2XVCA 1LB2A 2O3FA 3QU6A 3MCZA 1YTYA 4UVBA 2UXXA 4EJWA 2OD5A 3RDIA 1HKTA 1AWCA 1R5GA 4KMFA 2MLGA 2FF4A 1G3TA 2XUBA 3QP5A 4P9FA 4Q4ZF 3F21A 4RB0A 3JSOA 3I71A 3GLXA 2KJBA 3R0JA 5IT3A 2H27A 2MLKA 3IKTA 2VOPA 1ZHFA 4G7ZF 5LRSA 5ILVA 3GVAA 2FRHA 1UB9A 1E17A 4IPAA 4L5IA 2VXZA 2OQRA 3GWZA 5BOXA 3GFIA 4MEYF 5DD4A 3DF8A 2FA5A 5JR3A 4M9ZA 5LRRA 4I0AA 3KP7A 3MWMA 2IA1A 2FEZA 2RKHA 2Y75A 2J5OA 3EETA 1OYWA 1FWZA 2BV6A 3GEZA 4AWXB 4ETSA 2OZUA 3SXYA 3FXRA 1B9NA 2K86A 3RPUA 4ZZLA 2ISZA 1G3YA 3J81Z 1F4KA 1K78A 1Z05A 3I58A 1W7PA 3T5XA 1QQIA 3L2CA 3H3ZA 2Z33A 2CSOA 4A2UA 4BHPA 4KDPA 3BJAA 4M6YA 4AVPA 1IUYA 5FLXZ 2D2WA 5LHIA 4BAYA 1Z91A 1SMTA 1S7OA 4FX0A 1FP1D 4LB6B 1SFEA 1T39A 5D4RA 1I1GA 5D6EA 5LGNA 3ECOA 2C6YA 5J8CA 2DU9A 2HKXA 2GXBA 1FOKA 2JRTA 3NQOA 4HX8A 1V4RA 3CUOA 1HW1A 3K2ZA 3KP3A 1IW7F 3R6SA 2FNAA 1SFXA 1KQ8A 3GFMA 1H9GA 4Y15A 3B02A 1O3RA 1MKMA 3I0TA 4L0ZB 4WXHA 3L09A 3C18A 4LG0B 1W4MA 1OMIA 1B59A 2EFOA 2DI3A 3KP2A 4RB3C 3RKYA 1FLIA 4WCGA 1QBJA 2NAZA 3GZ6A 1WWXA 3QAHA 1GXPA 2EV6A 2STTA 4EJVA 2H6CA 1ULYA 2DQLA 5D8KB 2HR3A 3KZZA 5E1XA 3DKWA 5DD8A 1R22A 2R3SA 2PFBA 2CW0F 3VFZA 2DO7A 4I0BA 3F72A 2JPBA 3ERED 3PFIA 4G7OF 3HHGA 4HV6A 5LLQA 2DAOA 1R23A 1SMYF 3WTVC 1JHHA 2FBIA 1BI0A 1R00A 4HZFA 3BDDA 2HOEA 2A07F 1BIAA 1IZ1A 4EM2A 3M8EA 2H09A 3E6CC 3WTSC 3Q9SA 4OIRF 3M9AA 4HF2A 4OU0A 3U2RA 1ZGAA 1P92A 2HYGD 5ED4A 2AXLA 4I02A 4G9YA 2YX4A 3MZYA 5A2QZ 1ON2A 5FLXK 1SAXA 4LLGF 2JT1A 1P2FA 3ZN1A 2PMHA 3CJNA 3E6MA 4HW0A 2NNYA 2KIFA 4OMZA 2XAJA 1ZRFA 1I6XA 1XCBA 3SHFA 2DPDA 2UZKA 3BPVA 2QZ8A 4LFUA 4LK0F 2OZ6A 3HIFA 5HLHA 2VT3A 4ENNA 2ESHA 1RIOH 2J5PA 1FSEA 3F8FA 5DCMB 3WTTC 3LAPA 3E5XA 1OPCA 2G7HA 2XKPA 5ERIA 4LG0A 1TQPA 1LEBA 4P96A 2EA2A 4NHJA 3L9FA 3D0SA 2Z3YA 3U9GA 1USTA 3ROUA 1ZG3A 3HSFA 1H0MA 1U8RA 4RGRA 2Q2EA 2O61A 5J6XA 1YW9A 3QU3A 2W57A 1O3QA 1UHWA 1Z7UA 2XAGA 1RUNA 2L3DA 1USSA 2K4BA 3WTUC 1KYZA 1MZBA 3JAMZ 2HQRA 2M30A 2IT0A 1IN4A 3C7JA 3FX3A 1YIOA 2XAFA 4RGUA 1DPRA 2K7LA 1J2XA 2M1BA 1DDNA 3SZTA 4B8XA 2MH2A 3DPLC 4QLCU 4UHTA 2DBBA 1ZG5A 1G3SA 1KYWA 1TW2A 2VONA 2GAUA 1G3WA 2O0YA 2A6EF 5D8LB 4OIQF 1ZRCA 4FX4A 2WC2A 3ISPA 4BHBA 1J59A 4PCQA 4CHUA 3L00A 4M72A 1YLFA 5ICFA 3H92A 1QNTA 4AIKA 1TNTA 3LA7A 4IRIA 4CXFA 2VE9A 2VOOA 1JE8A 1P4XA 1TLHB 2XKOA 1BBYA 4GCVA 3FZVA 2FOKA 4EMSA 1FBQA 1XGOA 3TO7A 3HHHA 1ZAOA 4IXAA 1EH8A 5CVIA 3GFJA 1BI2A 4ESFA 2BE5F 2CGPA 2F5EA 1R5HA 2H6BA 3R4KA 4L9JA 4O6JA 5BS6A 4AIJA 5J8FA 5L3DA 3F3XA 5ICGA 4BHCA 1D8KA 1K6OA 2PI0A 4LGWA 3U1DA 1BM9A 1RUOA 4A5MA 5AIQA 1ZN2A 3NEUA 1F9NA 2PEXA 4HLYA 5ICCA 3RTRA 3V8KA 1V3FA 4KFCA 3ML6A 3ZMDA 5K5OA 4HQEA 4UXNA 1J75A 2EFNA 3EYIA 1YW8A 1JGSA 1ZYRF 1FT9A 4A0YA 2X4HA 3LA2A 2IA2A 3QP6A 1BI1A 1SD5A 2HEOA 1RNLA 2NYXA 1U5TB 3RPQA 4Q47A 2GXGA 5HLIA 4U88A 3JSPA 2FBKA 2OU2A 4MGRA 2TDXA 3ZMTA 5JVTA 2LF7A 1XGNA 2VODA 3I53A 4G94A 1MD0A 3K69A 2VC1A 4MTDA 1ZG1A 1IN7A 5EEHA 4IRHA 4ZYHA 1UHMA 4F7ZA 4R8HA 3MAJA 1P4WA 1KU3A 3KP5A 1VTNC 3W6KB 2E1NA 4IJAA 3VOEA 5ICEA 1O57A 4LLNA 4L9TA 3LWFA 3HRMA 2VBWA 4I2OA 4EVIA 2RV8A 1LDKB 2MH9A 2BYVE 4QWQA 2A3SA 3F8BA 1O7LA 1SD7A 1IF1A 5FB2A 1TBXA 1I5ZA 2QLZA 1XD7A 3DFGA 5CLSA 3F23A 4LB5A 3QPHA 2A69F 3COAC 3O6BB 2PQ8A 2XAHA 2OBPA 5L3GA 4CYDA 4L18B 4P9UA 3J81K 2IPQX 3K0LA 3CUQA 5D6FA 1Z9CA 3H3UA 2Y48A 2P5LC 2YX7A 5FD6A 2KRFA 4M6XA 4GXOA 3N97A 3K1PA 5LHGA 2P8TA 4EJTA 5E1WA 4RGXA 2VN2A 2FSWA 3FM3A 1FBSA 1KA8A 4B09A 4U0WA 5FO5A 2EV0A 5L3BA 4M74A 3J7AO 5H6QA 1QPMA 2CO5A 3BP8A 2HZTA 4I7HA 4RS8A 1WI9A 3E6BA 2QQBA 3BWGA 2ZFWA 1BC7C 4WF2A 3V8LA 4ZZDA 1I27A 1O3SA 5H6RA 2QENA 3GX4X 3WG9A 1R36A 3JW4A 5D5UB 3CO6C 3KEQA 2EA4A 2E7XA 4WXDA 2DTRA 4PGHA 3WU1B 2O6GE 3CDHA 5CJ9A 1XSVA 2DT5A 4HBLA 4G6DA 1ZGJA 1HKSA 1T0FA 5FFZA 3LA3A 3ZMUA 3EYYA 3V8JA 5FFXA 2PBIA 3TQNA 4I01A 2HFHA 3JTGA 2ACJA 3ZQ7A 2YU3A 2F5FA 3I64A 1CF7B 1XMKA 1D3YA 3BOQA 3EUHA 1W5TA 3P9KA 3PQJA 3V7CA 3F8CA 1XB4A 4ZYGA 2V1DA 3HUGA 3K1NA 2AS5F 1MDMA 4HOBA 4R1HA 5ILUA 4G7HF 1GVJA 2BGCA 1B6AA 2QQAA 4LD5A 2P6SA 3F22A 3GFLA 3IWFA 1HQCA 3RIRA 4WK8F 2QM3A 3SZPA 1K7AA 1ZH5A 1LNWA 1YQAA 2RVCA 2VBYA 1BC8C 2RQPA 1LVAA 2HS5A 5EEGA 5K1YA 3LQRA 2EFWA 3SFZA 1U2WA 4U7DA 1UCRA 2RC4A 1SD6A 2X0LA 1CGPA 1KQ9A 2IRFG 6PAXA 2FBHA 1FPQA 4GO1A 3R60A 5JFRA 4S04A 3MQ0A 3BY6A 2PMUA 1TQIA 5D5WB 5HVQC 4XRFA 2G7UA 3B73A 4HV5A 2W85A 1T6SA 1QZZA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XGX A;  1G6N A;  3FF5 A;  5E17 F;  2NNN A;  1IAW A;  3RI4 A;  4NQW A;  3HTU A;  3WTY C;  4M71 A;  3IL2 A;  2ELH A;  2BBY A;  4G6Q A;  1FBU A;  3QPT A;  1T2K A;  3V7S A;  3OOP A;  4G8X A;  3IRQ A;  4RB1 A;  4S05 A;  4BYY A;  5DEQ A;  1FSH A;  2G9W A;  2FQ3 A;  2KJC A;  4A0Z A;  5DV5 A;  5HOO A;  2HWV A;  1A04 A;  1L0O C;  1CF7 A;  5HS8 A;  1HXD A;  5IT9 K;  2DQR A;  3BRO A;  3K9T A;  1S3J A;  3LST A;  1D8J A;  4UNO A;  3I5U A;  1BIB A;  2F5D A;  1XDS A;  3GUD A;  3GO5 A;  2GZW A;  4AIH A;  4LK1 F;  1XSX A;  4O5V A;  4ESB A;  2DK8 A;  2LDU A;  2FE3 A;  5AON A;  1U5T C;  3HSR A;  1SD4 A;  2K27 A;  3FMR A;  3MZH A;  3HRU A;  4MQ9 F;  1J7K A;  3AAF A;  3TDU C;  4OOI A;  1HW2 A;  4BQA A;  1EH6 A;  5AIP A;  5TJJ A;  5K5Q A;  1LEA A;  3HSE A;  1JXS A;  3HOT A;  5CVV A;  5DDG A;  3FMS A;  3RJP A;  4CGZ A;  1HSJ A;  2STW A;  1Y0U A;  5LEK A;  4UVA A;  4KYW A;  5DUK A;  2PLY A;  2QUF A;  1KU9 A;  1S7A A;  2EJR A;  3FMQ A;  2L02 A;  3DQV C;  3RYR A;  4N0B A;  3G73 A;  4DQ2 A;  3TKY A;  4M9X A;  1WSU A;  1U78 A;  2A6H F;  4KA4 A;  1OYY A;  3CUQ C;  4KIF A;  5L3E A;  2DFI A;  3EQL F;  2JTV A;  3TDZ C;  2XRO A;  3FXU A;  5E8I A;  2CYY A;  3ELK A;  2LKP A;  1B4A A;  5DCM A;  5TRD A;  1IN8 A;  5A2Q K;  2FML A;  1YS6 A;  5HDK A;  5FD5 A;  4EGZ A;  2FXA A;  2RGV A;  3I59 B;  4WXC A;  4YFK F;  2XHK A;  3IWZ A;  2Z9O A;  2V1X A;  1PP8 F;  4HX7 A;  3K1M A;  3F8N A;  3GZ5 A;  5FGM A;  5JI6 A;  1TTY A;  2ZME A;  5HDN A;  4EM1 A;  2GWR A;  1UFM A;  5LEJ A;  1QZY A;  1F1Z A;  3E5U A;  2CG4 A;  1W5S A;  2IJL A;  2MBF A;  2EWN A;  4JBA A;  5HDG A;  4YG2 F;  4NB5 A;  3TO9 A;  4L9N A;  3O3K A;  1LQ1 A;  1H9T A;  3T8R A;  1TW3 A;  3JTH A;  5L3C A;  3Q5F A;  3IC7 A;  5LGT A;  4Q5S F;  3E5Q A;  3Q9V A;  5L3F A;  3ZPL A;  1ON1 A;  3ABU A;  1WKM A;  5F1R A;  2M87 A;  4XLP F;  1XGM A;  3C3W A;  3GF2 A;  1AOY A;  1IRF A;  2MA3 A;  3LFK A;  2VC0 A;  1TQM A;  1RZ4 A;  4M73 A;  4UV8 A;  1JHF A;  5E8G A;  2P5K A;  3HOS A;  2EB7 A;  1XGS A;  4KIB A;  2OA4 A;  5CYV A;  4YIF A;  3WGI A;  2QVO A;  2LF8 A;  5E18 F;  4MTE A;  2HGC A;  2ZBK A;  4I09 A;  3WE3 A;  1FYM A;  5CVR A;  1FYL A;  3QOP A;  4UUV A;  5BPI A;  3D5L A;  5LGU A;  2HTS A;  4TV7 A;  4IVN A;  4YFX F;  3E3V A;  5K5R A;  4L9V A;  5E20 A;  3WE2 A;  2ISY A;  2XAQ A;  3DPT A;  1MJA A;  3ECH A;  1IXS B;  4Y17 A;  3IKV A;  1XDU A;  2D1H A;  2IVM A;  1XSD A;  3C1D A;  1ZLJ A;  2Q8K A;  3CO7 C;  3KE2 A;  4ENM A;  4U7B A;  1BN5 A;  2RN7 A;  1C0W A;  2V1U A;  4FT8 A;  1YYV A;  2FMY A;  4GYI A;  4RB2 C;  2XAS A;  1HW5 A;  4MEX F;  1U6G A;  1STZ A;  1DP7 P;  4BXU A;  1W7P D;  4HQM A;  2OAZ A;  2O03 A;  3GXO A;  3DV8 A;  3TOB A;  5BQT A;  3I59 A;  4OIN F;  3SQN A;  2DPU A;  4GGG A;  2QQ9 A;  3QRF F;  5HS7 A;  4HAM A;  1DPU A;  5D5V B;  2JSC A;  1ODD A;  4R79 A;  4PGG A;  3WOD F;  2VBZ A;  1S6L A;  2PG4 A;  2EV5 A;  1P6R A;  1LDJ A;  2KKO A;  3JAM K;  3V4G A;  1WQ2 A;  2E1C A;  3G3Z A;  1IXC A;  2NS0 A;  2YSR A;  4EQQ A;  2KIU A;  3KFW X;  2JZY A;  1R1T A;  3I4P A;  3KCC A;  1QGP A;  1B1B A;  2ZNY A;  3P7N A;  4ON0 A;  4KN4 X;  1ONV A;  4XSX F;  1U5T A;  3ZN0 A;  5D5X B;  1IRG A;  1KGS A;  2ESN A;  2LSO A;  3J80 K;  1R1V A;  1B9M A;  1XCV A;  2MD5 A;  3EDP A;  2UWM A;  3TGN A;  3FHZ A;  4A6D A;  2BEO A;  1QO0 D;  2HTJ A;  1MJ9 A;  3BJ6 A;  1R1U A;  1ZRE A;  3P9I A;  4HF0 A;  3IRR A;  2EK5 A;  3M1E A;  1PUE E;  2F2E A;  3ZMS A;  3KP4 A;  4XLN F;  3WGH A;  3REO A;  4ASN A;  2QWW A;  2P7V B;  3ABT A;  1ZRD A;  4OIP F;  4KN7 X;  4Z2Y A;  3GYH X;  1RI7 A;  3LAJ A;  2GIV A;  3O2P E;  2Z5U A;  2R7D A;  5ILS A;  3J80 Z;  1FC3 A;  2M8E A;  3KZY A;  4ESJ A;  4A5N A;  4RAZ A;  4IRG A;  3NRV A;  3WGG A;  4MNU A;  4IF4 A;  2DK5 A;  2DLL A;  2VT2 A;  3KP6 A;  2GA2 A;  4L5J A;  1FP2 A;  2B0L A;  2WWY A;  2GQQ A;  2R7F A;  4E70 A;  3F6O A;  3BZ6 A;  3T1B A;  3BPX A;  2WTE A;  4HLX A;  2A5Y B;  2ETH A;  2W84 A;  4A12 A;  1X3U A;  4O3M A;  4JK1 X;  5CVU A;  1HST A;  1YS7 A;  3E97 A;  3E6D A;  2EFQ A;  4Y13 A;  3PQK A;  2QYO A;  4IHS A;  4UVC A;  1ZAR A;  2A68 F;  5D4S A;  2RDP A;  3T8T A;  2CWE A;  1KU2 A;  4XSZ F;  5LHH A;  2W25 A;  3WTX C;  4KIC A;  2M45 A;  3P9C A;  4N9H A;  4GYG A;  3HYI A;  2FU4 A;  2O8X A;  2W24 A;  3VOD A;  1EH7 A;  4U0V A;  2PJP A;  4EM0 B;  2QBY B;  2IP2 A;  4DNC A;  5F64 A;  3TOA A;  1XMA A;  4EJO A;  2K4J A;  4I98 B;  1OR7 A;  4CDG A;  2VBX A;  3FXQ A;  1HKQ A;  2HYF A;  3F6V A;  4JQF A;  1FNN A;  2VE8 A;  2ZNZ A;  1J5Y A;  1YFH A;  3LQQ A;  4HDV A;  3R61 A;  1Z6R A;  5CVJ A;  4CO8 A;  3DP7 A;  1KU7 A;  1LJ9 A;  2NRA C;  1BI3 A;  4CZZ A;  1SFU A;  1MJB A;  3ZMZ A;  4KUM A;  1U3E M;  2E7W A;  1K78 B;  4P55 A;  1PP7 U;  2L01 A;  4PDK A;  3L7W A;  2UXN A;  5E1Z B;  4ENK A;  3VB2 A;  5JHU A;  5DCF A;  1FY7 A;  5KK1 A;  4H0E A;  4LJZ F;  5BMZ A;  3N4M A;  2P4W A;  4RGS A;  4A6E A;  3CLO A;  2ZKZ A;  3RYP A;  2RNJ A;  2JPC A;  4OMY A;  3OV8 A;  2ZCW A;  3DEU A;  3WTW C;  2V79 A;  1TNS A;  1PDN C;  2IA0 A;  4IHT A;  4HYE A;  1EV7 A;  1WRJ A;  4FHT A;  1F5T A;  2V6C A;  3FWE A;  4OIO F;  2Q0O A;  1NHA A;  3MFK A;  4KNY A;  3MEX A;  3T0Y A;  3TO6 A;  4UV9 A;  2COM A;  3BJO A;  4A0X A;  3HRS A;  1BJA A;  4Q48 A;  2DW4 A;  1FYK A;  1Z1D A;  5IT9 Z;  3FM5 A;  3KET A;  2ZXJ A;  2M5W A;  3ZP5 A;  1ZLK A;  1S29 A;  3F8M A;  5BPD A;  1W7P B;  2A61 A;  4ENJ A;  2QBY A;  5LBQ A;  4HA8 A;  2GA1 A;  2YR2 A;  2EFP A;  4EV0 A;  5F6F A;  4KMU X;  2CFX A;  1REP C;  4YFN F;  4AD9 A;  1Q1H A;  2P5V A;  2V9V A;  1R7J A;  1GXQ A;  4BH9 A;  4KIG A;  3WU0 A;  2ZJ2 A;  3DXJ F;  3S2W A;  2Z99 A;  1L3L A;  1YW7 A;  1G4D A;  1J0R A;  4KT5 C;  1KQ0 A;  1XN7 A;  2H94 A;  4BNC A;  1OKR A;  4WWC A;  3I54 A;  4HDU A;  1HBX G;  1J9I A;  5HLG A;  1FX7 A;  2XRN A;  4ZYE A;  1FZP B;  1T38 A;  3RKW A;  2ZO4 A;  5H20 A;  2F5C A;  1GHC A;  4U0Y A;  3W6J B;  2FNP A;  4ZYD A;  2HQN A;  1S8N A;  2P7C B;  2KIM A;  1YG2 A;  4YII A;  2MC3 A;  1BOA A;  3IHU A;  5KVR A;  3CTA A;  1IXR C;  4PZJ A;  1Z6T A;  5HS9 A;  1YO5 C;  2L4A A;  2XIG A;  2HKO A;  4HX4 A;  3ULQ B;  3M8F A;  2D45 A;  2P6T A;  1O7F A;  3RKX A;  2PN6 A;  1T98 A;  1IN6 A;  3KLO A;  5DYM A;  4WX9 A;  1O3T A;  4LMY A;  1I1S A;  3HTS B;  1D5V A;  1IN5 A;  3CUQ B;  2IW5 A;  4M9S A;  4LLL A;  3R0A A;  1OYI A;  3GW2 A;  4CIC A;  4XBF A;  4HF1 A;  3WTZ A;  4ZH4 F;  2OQG A;  2YPR A;  4K2E A;  4EGY A;  4D0P A;  4RAY A;  1E2X A;  3VEP A;  2HDC A;  3KEO A;  2L54 A;  4P5O A;  4L0Y B;  2ZME B;  1P4A A;  4N9I A;  2L4M A;  4MHG A;  2WV0 A;  1MGT A;  1R58 A;  2D1V A;  2CQK A;  2LNB A;  2Y0M A;  4EJU A;  1DUX C;  1MDM B;  3KLN A;  2K02 A;  1LDD A;  2XV4 S;  3M7G A;  3ZMV A;  3HRT A;  1K79 A;  4MQV A;  3V7R A;  5DUI A;  2ADU A;  2XVC A;  1LB2 A;  2O3F A;  3QU6 A;  3MCZ A;  1YTY A;  4UVB A;  2UXX A;  4EJW A;  2OD5 A;  3RDI A;  1HKT A;  1AWC A;  1R5G A;  4KMF A;  2MLG A;  2FF4 A;  1G3T A;  2XUB A;  3QP5 A;  4P9F A;  4Q4Z F;  3F21 A;  4RB0 A;  3JSO A;  3I71 A;  3GLX A;  2KJB A;  3R0J A;  5IT3 A;  2H27 A;  2MLK A;  3IKT A;  2VOP A;  1ZHF A;  4G7Z F;  5LRS A;  5ILV A;  3GVA A;  2FRH A;  1UB9 A;  1E17 A;  4IPA A;  4L5I A;  2VXZ A;  2OQR A;  3GWZ A;  5BOX A;  3GFI A;  4MEY F;  5DD4 A;  3DF8 A;  2FA5 A;  5JR3 A;  4M9Z A;  5LRR A;  4I0A A;  3KP7 A;  3MWM A;  2IA1 A;  2FEZ A;  2RKH A;  2Y75 A;  2J5O A;  3EET A;  1OYW A;  1FWZ A;  2BV6 A;  3GEZ A;  4AWX B;  4ETS A;  2OZU A;  3SXY A;  3FXR A;  1B9N A;  2K86 A;  3RPU A;  4ZZL A;  2ISZ A;  1G3Y A;  3J81 Z;  1F4K A;  1K78 A;  1Z05 A;  3I58 A;  1W7P A;  3T5X A;  1QQI A;  3L2C A;  3H3Z A;  2Z33 A;  2CSO A;  4A2U A;  4BHP A;  4KDP A;  3BJA A;  4M6Y A;  4AVP A;  1IUY A;  5FLX Z;  2D2W A;  5LHI A;  4BAY A;  1Z91 A;  1SMT A;  1S7O A;  4FX0 A;  1FP1 D;  4LB6 B;  1SFE A;  1T39 A;  5D4R A;  1I1G A;  5D6E A;  5LGN A;  3ECO A;  2C6Y A;  5J8C A;  2DU9 A;  2HKX A;  2GXB A;  1FOK A;  2JRT A;  3NQO A;  4HX8 A;  1V4R A;  3CUO A;  1HW1 A;  3K2Z A;  3KP3 A;  1IW7 F;  3R6S A;  2FNA A;  1SFX A;  1KQ8 A;  3GFM A;  1H9G A;  4Y15 A;  3B02 A;  1O3R A;  1MKM A;  3I0T A;  4L0Z B;  4WXH A;  3L09 A;  3C18 A;  4LG0 B;  1W4M A;  1OMI A;  1B59 A;  2EFO A;  2DI3 A;  3KP2 A;  4RB3 C;  3RKY A;  1FLI A;  4WCG A;  1QBJ A;  2NAZ A;  3GZ6 A;  1WWX A;  3QAH A;  1GXP A;  2EV6 A;  2STT A;  4EJV A;  2H6C A;  1ULY A;  2DQL A;  5D8K B;  2HR3 A;  3KZZ A;  5E1X A;  3DKW A;  5DD8 A;  1R22 A;  2R3S A;  2PFB A;  2CW0 F;  3VFZ A;  2DO7 A;  4I0B A;  3F72 A;  2JPB A;  3ERE D;  3PFI A;  4G7O F;  3HHG A;  4HV6 A;  5LLQ A;  2DAO A;  1R23 A;  1SMY F;  3WTV C;  1JHH A;  2FBI A;  1BI0 A;  1R00 A;  4HZF A;  3BDD A;  2HOE A;  2A07 F;  1BIA A;  1IZ1 A;  4EM2 A;  3M8E A;  2H09 A;  3E6C C;  3WTS C;  3Q9S A;  4OIR F;  3M9A A;  4HF2 A;  4OU0 A;  3U2R A;  1ZGA A;  1P92 A;  2HYG D;  5ED4 A;  2AXL A;  4I02 A;  4G9Y A;  2YX4 A;  3MZY A;  5A2Q Z;  1ON2 A;  5FLX K;  1SAX A;  4LLG F;  2JT1 A;  1P2F A;  3ZN1 A;  2PMH A;  3CJN A;  3E6M A;  4HW0 A;  2NNY A;  2KIF A;  4OMZ A;  2XAJ A;  1ZRF A;  1I6X A;  1XCB A;  3SHF A;  2DPD A;  2UZK A;  3BPV A;  2QZ8 A;  4LFU A;  4LK0 F;  2OZ6 A;  3HIF A;  5HLH A;  2VT3 A;  4ENN A;  2ESH A;  1RIO H;  2J5P A;  1FSE A;  3F8F A;  5DCM B;  3WTT C;  3LAP A;  3E5X A;  1OPC A;  2G7H A;  2XKP A;  5ERI A;  4LG0 A;  1TQP A;  1LEB A;  4P96 A;  2EA2 A;  4NHJ A;  3L9F A;  3D0S A;  2Z3Y A;  3U9G A;  1UST A;  3ROU A;  1ZG3 A;  3HSF A;  1H0M A;  1U8R A;  4RGR A;  2Q2E A;  2O61 A;  5J6X A;  1YW9 A;  3QU3 A;  2W57 A;  1O3Q A;  1UHW A;  1Z7U A;  2XAG A;  1RUN A;  2L3D A;  1USS A;  2K4B A;  3WTU C;  1KYZ A;  1MZB A;  3JAM Z;  2HQR A;  2M30 A;  2IT0 A;  1IN4 A;  3C7J A;  3FX3 A;  1YIO A;  2XAF A;  4RGU A;  1DPR A;  2K7L A;  1J2X A;  2M1B A;  1DDN A;  3SZT A;  4B8X A;  2MH2 A;  3DPL C;  4QLC U;  4UHT A;  2DBB A;  1ZG5 A;  1G3S A;  1KYW A;  1TW2 A;  2VON A;  2GAU A;  1G3W A;  2O0Y A;  2A6E F;  5D8L B;  4OIQ F;  1ZRC A;  4FX4 A;  2WC2 A;  3ISP A;  4BHB A;  1J59 A;  4PCQ A;  4CHU A;  3L00 A;  4M72 A;  1YLF A;  5ICF A;  3H92 A;  1QNT A;  4AIK A;  1TNT A;  3LA7 A;  4IRI A;  4CXF A;  2VE9 A;  2VOO A;  1JE8 A;  1P4X A;  1TLH B;  2XKO A;  1BBY A;  4GCV A;  3FZV A;  2FOK A;  4EMS A;  1FBQ A;  1XGO A;  3TO7 A;  3HHH A;  1ZAO A;  4IXA A;  1EH8 A;  5CVI A;  3GFJ A;  1BI2 A;  4ESF A;  2BE5 F;  2CGP A;  2F5E A;  1R5H A;  2H6B A;  3R4K A;  4L9J A;  4O6J A;  5BS6 A;  4AIJ A;  5J8F A;  5L3D A;  3F3X A;  5ICG A;  4BHC A;  1D8K A;  1K6O A;  2PI0 A;  4LGW A;  3U1D A;  1BM9 A;  1RUO A;  4A5M A;  5AIQ A;  1ZN2 A;  3NEU A;  1F9N A;  2PEX A;  4HLY A;  5ICC A;  3RTR A;  3V8K A;  1V3F A;  4KFC A;  3ML6 A;  3ZMD A;  5K5O A;  4HQE A;  4UXN A;  1J75 A;  2EFN A;  3EYI A;  1YW8 A;  1JGS A;  1ZYR F;  1FT9 A;  4A0Y A;  2X4H A;  3LA2 A;  2IA2 A;  3QP6 A;  1BI1 A;  1SD5 A;  2HEO A;  1RNL A;  2NYX A;  1U5T B;  3RPQ A;  4Q47 A;  2GXG A;  5HLI A;  4U88 A;  3JSP A;  2FBK A;  2OU2 A;  4MGR A;  2TDX A;  3ZMT A;  5JVT A;  2LF7 A;  1XGN A;  2VOD A;  3I53 A;  4G94 A;  1MD0 A;  3K69 A;  2VC1 A;  4MTD A;  1ZG1 A;  1IN7 A;  5EEH A;  4IRH A;  4ZYH A;  1UHM A;  4F7Z A;  4R8H A;  3MAJ A;  1P4W A;  1KU3 A;  3KP5 A;  1VTN C;  3W6K B;  2E1N A;  4IJA A;  3VOE A;  5ICE A;  1O57 A;  4LLN A;  4L9T A;  3LWF A;  3HRM A;  2VBW A;  4I2O A;  4EVI A;  2RV8 A;  1LDK B;  2MH9 A;  2BYV E;  4QWQ A;  2A3S A;  3F8B A;  1O7L A;  1SD7 A;  1IF1 A;  5FB2 A;  1TBX A;  1I5Z A;  2QLZ A;  1XD7 A;  3DFG A;  5CLS A;  3F23 A;  4LB5 A;  3QPH A;  2A69 F;  3COA C;  3O6B B;  2PQ8 A;  2XAH A;  2OBP A;  5L3G A;  4CYD A;  4L18 B;  4P9U A;  3J81 K;  2IPQ X;  3K0L A;  3CUQ A;  5D6F A;  1Z9C A;  3H3U A;  2Y48 A;  2P5L C;  2YX7 A;  5FD6 A;  2KRF A;  4M6X A;  4GXO A;  3N97 A;  3K1P A;  5LHG A;  2P8T A;  4EJT A;  5E1W A;  4RGX A;  2VN2 A;  2FSW A;  3FM3 A;  1FBS A;  1KA8 A;  4B09 A;  4U0W A;  5FO5 A;  2EV0 A;  5L3B A;  4M74 A;  3J7A O;  5H6Q A;  1QPM A;  2CO5 A;  3BP8 A;  2HZT A;  4I7H A;  4RS8 A;  1WI9 A;  3E6B A;  2QQB A;  3BWG A;  2ZFW A;  1BC7 C;  4WF2 A;  3V8L A;  4ZZD A;  1I27 A;  1O3S A;  5H6R A;  2QEN A;  3GX4 X;  3WG9 A;  1R36 A;  3JW4 A;  5D5U B;  3CO6 C;  3KEQ A;  2EA4 A;  2E7X A;  4WXD A;  2DTR A;  4PGH A;  3WU1 B;  2O6G E;  3CDH A;  5CJ9 A;  1XSV A;  2DT5 A;  4HBL A;  4G6D A;  1ZGJ A;  1HKS A;  1T0F A;  5FFZ A;  3LA3 A;  3ZMU A;  3EYY A;  3V8J A;  5FFX A;  2PBI A;  3TQN A;  4I01 A;  2HFH A;  3JTG A;  2ACJ A;  3ZQ7 A;  2YU3 A;  2F5F A;  3I64 A;  1CF7 B;  1XMK A;  1D3Y A;  3BOQ A;  3EUH A;  1W5T A;  3P9K A;  3PQJ A;  3V7C A;  3F8C A;  1XB4 A;  4ZYG A;  2V1D A;  3HUG A;  3K1N A;  2AS5 F;  1MDM A;  4HOB A;  4R1H A;  5ILU A;  4G7H F;  1GVJ A;  2BGC A;  1B6A A;  2QQA A;  4LD5 A;  2P6S A;  3F22 A;  3GFL A;  3IWF A;  1HQC A;  3RIR A;  4WK8 F;  2QM3 A;  3SZP A;  1K7A A;  1ZH5 A;  1LNW A;  1YQA A;  2RVC A;  2VBY A;  1BC8 C;  2RQP A;  1LVA A;  2HS5 A;  5EEG A;  5K1Y A;  3LQR A;  2EFW A;  3SFZ A;  1U2W A;  4U7D A;  1UCR A;  2RC4 A;  1SD6 A;  2X0L A;  1CGP A;  1KQ9 A;  2IRF G;  6PAX A;  2FBH A;  1FPQ A;  4GO1 A;  3R60 A;  5JFR A;  4S04 A;  3MQ0 A;  3BY6 A;  2PMU A;  1TQI A;  5D5W B;  5HVQ C;  4XRF A;  2G7U A;  3B73 A;  4HV5 A;  2W85 A;  1T6S A;  1QZZ A; 
#chains in the Genus database with same CATH topology
 2XGX A;  1G6N A;  1WGX A;  2DJN A;  3CDL A;  3D1N I;  3VDX A;  3FF5 A;  1D0Y A;  2JK3 A;  5E17 F;  2Z1D A;  2PJR B;  4V19 K;  2NNN A;  2LFB A;  2ME6 A;  2E5Z A;  1IAW A;  3RI4 A;  4NQW A;  4EAT A;  2WA0 A;  1FIA A;  3HTU A;  3WTY C;  1MBE A;  4M71 A;  3IL2 A;  2ELH A;  2LY2 A;  4M3F A;  2BBY A;  1WHU A;  3CJQ B;  4G6Q A;  1FBU A;  1MNM C;  3PO3 J;  1HA8 A;  3QPT A;  2XGE A;  2X9D A;  4D7N A;  1T2K A;  2M2E A;  3V7S A;  3HPH A;  1SAU A;  3OOP A;  4G8X A;  3X2Q H;  1G2H A;  3IRQ A;  2NVU B;  5JLW A;  4RB1 A;  4S05 A;  4BYY A;  3QYF A;  4DBR A;  5DEQ A;  1QZE A;  1UMQ A;  2QA4 I;  4YEJ A;  1FSH A;  3BR5 A;  2G9W A;  2FQ3 A;  2KJC A;  4A0Z A;  4E7K A;  2X6W A;  2Y2Z A;  4AID A;  4ZDL A;  2XAU A;  5FRM A;  3H5R A;  3HEF A;  3FXK A;  5DV5 A;  2YUS A;  3CQZ J;  5HOO A;  4C3H J;  2HWV A;  1A04 A;  3CCJ I;  1L0O C;  1IV6 A;  3A2K A;  1CF7 A;  5HS8 A;  1JT6 A;  2JN6 A;  5M3M J;  1N25 A;  4XKC A;  1HXD A;  3P5J A;  5IT9 K;  4PJJ A;  2DQR A;  3BRO A;  2VQH A;  1S3J A;  3K9T A;  3LST A;  3K7A J;  2MFZ A;  3I5U A;  1BIB A;  4UNO A;  2F5D A;  1XDS A;  4F55 A;  1IDY A;  3GUD A;  3GO5 A;  4W97 A;  1K4S A;  1JI8 A;  2GZW A;  4AIH A;  4YEL A;  4LK1 F;  4X1E A;  5M5Y J;  1XSX A;  4O5V A;  4ESB A;  2I5U A;  2O5R A;  2DK8 A;  2LDU A;  3CP8 A;  2E1O A;  2FE3 A;  4A3C J;  1OIS A;  5AON A;  2BXZ A;  2LMD A;  1U5T C;  5IP9 J;  3WHB A;  3HSR A;  2K9Q A;  1SD4 A;  3ASN H;  2K27 A;  3FMR A;  3MZH A;  3HRU A;  4MQ9 F;  3S3O A;  1X4O A;  1J7K A;  4XRS G;  3AAF A;  2YS9 A;  1RR8 C;  2COB A;  3TDU C;  5C44 J;  4OOI A;  1HW2 A;  1ETW A;  4BQA A;  4HEA 2;  1YI2 I;  3J7Z I;  1EH6 A;  5AIP A;  1A5J A;  5TJJ A;  5K5Q A;  1LEA A;  3HSE A;  5F27 A;  1JXS A;  3HOT A;  5CVV A;  5DDG A;  1UAA A;  3CD6 I;  2EH3 A;  3FMS A;  1YJW I;  3RJP A;  3PFY A;  3RSN A;  1TWA J;  4CGZ A;  4AVZ A;  3QOE A;  1HSJ A;  2STW A;  1Y0U A;  5LEK A;  1Y56 A;  4UVA A;  2Y9Y A;  4KYW A;  1OLT A;  5DUK A;  2PLY A;  2QUF A;  4BEH B;  1KU9 A;  1MBG A;  1S7A A;  1TWG J;  3S1R J;  2VKH A;  2EJR A;  3FMQ A;  2L02 A;  3DQV C;  1AU7 A;  4UUS B;  3RYR A;  2OJE D;  4N0B A;  3G73 A;  4DQ2 A;  3GTQ J;  3TKY A;  1VQO I;  2X6O A;  1S9H A;  4IL6 C;  4M9X A;  1WSU A;  1U78 A;  2A6H F;  3PNT A;  4KA4 A;  3CZ6 A;  1OYY A;  3CUQ C;  4Y4R A;  4KIF A;  3S3N A;  5L3E A;  1H8A C;  1POG A;  2DFI A;  2JJ7 A;  3EQL F;  2KRC A;  2CQX A;  2IS4 A;  2JTV A;  3TDZ C;  4ZDP A;  4LIT A;  3FXU A;  2XRO A;  3HPG A;  3KIO A;  5E8I A;  3OYL A;  3FDY A;  2CYY A;  3CJR B;  1SFO J;  3ELK A;  2GBY A;  1FEX A;  2EQR A;  3PL8 A;  3QQA A;  3HOZ J;  4BJ5 C;  2KFD A;  2LKP A;  4QTR A;  1B4A A;  5DCM A;  3KYL A;  5TRD A;  1IN8 A;  3LOC A;  5A2Q K;  2E60 A;  1X2M A;  2FML A;  2VUM J;  1YS6 A;  3ABL H;  3LMM A;  5HDK A;  5FD5 A;  4EGZ A;  2FXA A;  2RGV A;  4HSR A;  2TRT A;  3L2R A;  3I59 B;  4WXC A;  4PSX A;  2R7T A;  2IAI A;  4YFK F;  2EPF A;  5EYR A;  3GTL J;  2XHK A;  3IWZ A;  4F91 B;  3GTJ J;  2Z9O A;  3OYA A;  2V1X A;  2HI3 A;  1PP8 F;  4HX7 A;  3GZN B;  3K1M A;  5K7F A;  3F8N A;  2VJI A;  5HLT A;  1DU6 A;  1LKX A;  1YE9 A;  2BVL A;  3HJE A;  2KL4 A;  3GZ5 A;  4CA0 A;  4DZP A;  2VAS A;  5GPC A;  5FGM A;  1TL8 A;  2XSD C;  5H2F C;  5JI6 A;  1IGN A;  1RRJ A;  1TTY A;  2ZME A;  3CCM I;  5HDN A;  3HOY J;  4EM1 A;  4ZJZ A;  2GWR A;  2HPM A;  1ACI A;  1MH3 A;  1UFM A;  5LEJ A;  3K4N A;  1QZY A;  2L9V A;  1F1Z A;  3DBL B;  3E5U A;  3I9V 2;  2CG4 A;  1W5S A;  3F9K A;  3CC7 I;  2V6E A;  4XR6 A;  3CC4 I;  3BC8 A;  2H8W A;  1U0J A;  2IJL A;  2W00 A;  2MBF A;  2EWN A;  2MYS A;  4JBA A;  5HDG A;  2K5C A;  4YG2 F;  4NB5 A;  1K61 A;  3ZQQ A;  1FTT A;  4AYB A;  3TO9 A;  3I55 I;  2ZJR F;  4L9N A;  3O3K A;  4XK4 A;  1LQ1 A;  1YHQ I;  1H9T A;  3T8R A;  1TW3 A;  2V1N A;  3JTH A;  5L3C A;  5J1R A;  3Q5F A;  2VPL A;  3IC7 A;  5LGT A;  2EZI A;  4BJ6 C;  4Q5S F;  1U9N A;  3HB9 A;  1Y1W J;  3QPL A;  3E5Q A;  3Q9V A;  3Q0V A;  5L3F A;  5JVG F;  3ZPL A;  1ON1 A;  3ABU A;  3ZQL A;  1WKM A;  4ZYA A;  5F1R A;  2M87 A;  4XLP F;  1XGM A;  2CUE A;  3C3W A;  3GF2 A;  1AOY A;  5C3E J;  5K7Z A;  2L7K A;  1IRF A;  2MA3 A;  3DLL F;  2E36 A;  2GM4 A;  3LFK A;  2VC0 A;  1TQM A;  1RZ4 A;  2KIS A;  4M73 A;  1NH3 A;  3S2H J;  4UV8 A;  3W2A A;  5DTD A;  2KPM A;  1ETK A;  1JHF A;  4HNV A;  5E8G A;  2P5K A;  3HOS A;  2EB7 A;  4U87 A;  2BHZ A;  1XGS A;  4KIB A;  2OA4 A;  5CYV A;  2L2O A;  4YIF A;  2XRL A;  1YJ9 I;  3WGI A;  2QVO A;  2LF8 A;  5E18 F;  4MTE A;  2HGC A;  3JRD A;  2ZBK A;  4I09 A;  2EIJ H;  2E1M C;  3WE3 A;  1FYM A;  3AKZ A;  2KQR A;  2Z16 A;  5CVR A;  1FYL A;  3BTJ A;  1M1E B;  3LFU A;  3ASO H;  3QOP A;  4UUV A;  2VIX A;  5BPI A;  3D5L A;  5LGU A;  2HTS A;  3PO2 J;  4TV7 A;  3K4L A;  4IVN A;  4YFX F;  1JJ6 C;  3E3V A;  5K5R A;  4L9V A;  5E20 A;  1TWH J;  3J7A Y;  1V55 H;  3OYJ A;  3QPS A;  4J00 A;  3WE2 A;  2ISY A;  2XAQ A;  3DPT A;  1X1A A;  1MJA A;  3ECH A;  1IXS B;  1Y6I A;  4Y17 A;  2E71 A;  3IKV A;  1XDU A;  2D1H A;  1MBH A;  1OCT C;  2IVM A;  1WVR A;  2DMP A;  2ELK A;  3C1D A;  1IV8 A;  3QOD A;  1XSD A;  2KLO A;  1AHD P;  1ZLJ A;  2B9S A;  2Q8K A;  3HDD A;  3CO7 C;  4CCM A;  3KE2 A;  3AG1 H;  2WAQ A;  2AO9 A;  4ENM A;  4XNF A;  1PJR A;  4U7B A;  4I76 A;  1BN5 A;  2RN7 A;  1C0W A;  4L5E A;  2V1U A;  3BG6 A;  5M5W J;  4FT8 A;  4CCL A;  1YYV A;  3HOW J;  2FMY A;  4GYI A;  1W5C C;  4XKB A;  2LP0 A;  4RB2 C;  2XAS A;  1HW5 A;  3K70 C;  1VQ9 I;  2N8G A;  4MEX F;  2LD5 A;  1U6G A;  1STZ A;  1DP7 P;  2BZT A;  1W7P D;  4BXU A;  2OCC H;  4HQM A;  1R4M B;  3FK7 A;  2OAZ A;  3OYM A;  3GXO A;  2O03 A;  2H8R A;  1SC7 A;  3RZO J;  1BR2 A;  1Z77 A;  2DDB A;  3DV8 A;  1W1W E;  4CZC A;  1JKO C;  3TOB A;  1JGG A;  1UHS A;  1YRN A;  5BQT A;  1P7J A;  3HKZ A;  2JQ7 A;  3I59 A;  4OIN F;  3SQN A;  3PUB A;  2NVT J;  2DPU A;  2LK2 A;  1LFB A;  3AG3 H;  4GGG A;  4LG3 A;  1Q1V A;  3O8G A;  1MH4 A;  2QQ9 A;  3QRF F;  2XPU A;  5HS7 A;  3U1K A;  4BDZ A;  4Z6Y A;  3RCO A;  4HAM A;  1Z3X A;  1DPU A;  3MKY B;  2Q1Z B;  3ZR8 X;  3N05 A;  5FKO A;  5D5V B;  2A6T A;  2JSC A;  1ODD A;  4R79 A;  2ZME C;  3JRC A;  4PGG A;  1XX5 A;  5F04 A;  3K4C A;  3WOD F;  2VBZ A;  1S6L A;  2PG4 A;  2FJ1 A;  2EV5 A;  1P6R A;  1LDJ A;  1RC9 A;  1ZK8 A;  2GOX B;  2KKO A;  1ZGW A;  1IC8 A;  1VQK I;  3SEZ A;  3JAM K;  3DBH B;  4B44 A;  4A3E J;  3V4G A;  4F52 A;  1WQ2 A;  1Z21 A;  4M3E A;  2NVY J;  2E1C A;  3G3Z A;  1J09 A;  1DQU A;  1IXC A;  5B66 C;  1ETY A;  2NS0 A;  2YSR A;  2NVX J;  2R7O A;  4EQQ A;  1JKR C;  2KIU A;  2PMZ N;  3KFW X;  2JZY A;  1EF4 A;  2BY0 A;  1RKT A;  1R1T A;  3FXL A;  3I4P A;  1IG7 A;  3KCC A;  1QGP A;  3DCF A;  1B1B A;  2JA7 J;  2ZJQ F;  2ZNY A;  4DOZ A;  2ZSI B;  2F4I A;  3S93 A;  3P7N A;  2E19 A;  4ON0 A;  2CV0 A;  4IHY A;  2DA7 A;  1B8I A;  4KN4 X;  1ONV A;  3VSK A;  4XSX F;  1U5T A;  3ZRG A;  4FIS A;  3ZN0 A;  4NC8 A;  4AC0 A;  5D5X B;  3CCY A;  5KNL A;  1IRG A;  1KGS A;  2ESN A;  2LSO A;  2VJ4 A;  3J80 K;  3S16 J;  2DTZ A;  1PUF A;  1R1V A;  4JYK A;  1QHH D;  4HPQ A;  1B9M A;  1XCV A;  3FKI J;  2MD5 A;  2DJI A;  2E2J J;  3CDI A;  1SAN A;  3F0C A;  3EDP A;  2UWM A;  2ZFU A;  3TGN A;  3FHZ A;  4A6D A;  5FRO A;  2BEO A;  4MIM A;  1TT0 A;  2LLK A;  1QO0 D;  2HTJ A;  2QF7 A;  3OIQ A;  1MJ9 A;  3BJ6 A;  1R1U A;  1V54 H;  1SEU A;  5GPA A;  1ZRE A;  3K2A A;  3P9I A;  4HF0 A;  3NAU A;  3EUA A;  3IRR A;  2EK5 A;  3M1E A;  2R7W A;  4NC6 A;  2QKM B;  4J19 A;  3BG7 A;  2PJR A;  2X48 A;  1LPQ A;  1PUE E;  2BXY A;  2H1L A;  4LOC A;  2F2E A;  3ZMS A;  4B1R A;  3KP4 A;  4XLN F;  3WGH A;  3REO A;  3SFI A;  4ASN A;  4OAZ A;  3IAS 2;  2QWW A;  2P7V B;  3S1N J;  4AUX A;  3ABT A;  1ZRD A;  4OIP F;  4J01 A;  4IOC F;  3DTK A;  4KN7 X;  4Z2Y A;  3GYH X;  1NK3 P;  1RI7 A;  3CP2 A;  1FTZ A;  2ELJ A;  3LAJ A;  1RR7 A;  2GIV A;  3O2P E;  1VI0 A;  4E7H A;  2Z5U A;  2R7D A;  5ILS A;  3J80 Z;  1MNE A;  4G12 A;  2JRM A;  1MIJ A;  1FC3 A;  2M8E A;  3KZY A;  1D8J A;  1IDZ A;  4ESJ A;  3GCM A;  4A5N A;  1Y1V J;  4RAZ A;  2RQQ A;  4IRG A;  5B1B H;  4H4K C;  3NRV A;  4IQ4 A;  3WGG A;  3BT9 A;  4BDY A;  4MNU A;  4IF4 A;  2DK5 A;  2DLL A;  2X6Y A;  2VT2 A;  3KP6 A;  4XKV A;  2GA2 A;  3JRB A;  3WU2 C;  2DN0 A;  2EIL H;  2BY3 A;  3KX2 A;  4L5J A;  1FP2 A;  2B0L A;  2CQQ A;  3LSH A;  5K7H A;  4C30 A;  5FKK A;  2MG4 A;  2WWY A;  2GQQ A;  2R7F A;  3PSI A;  1BL0 A;  3RPU D;  4E70 A;  3F6O A;  2IS1 A;  3OOU A;  1Z0X A;  3OSF A;  3BZ6 A;  4XL9 A;  2CH0 A;  3T1B A;  3BPX A;  3CES A;  2WTE A;  4HLX A;  3BCA A;  1XC5 A;  2A5Y B;  3CJT B;  2ETH A;  1VQ5 I;  1X58 A;  2IXS A;  4BBS J;  3OR1 C;  4XKW A;  2W84 A;  1Z7L A;  4RMN A;  2XF5 A;  4XRM A;  2BY2 A;  4A12 A;  1X3U A;  4O3M A;  5BNG A;  2X6X A;  4JK1 X;  5CVU A;  1HST A;  3TP3 A;  2M9H A;  1YS7 A;  1ZEL A;  1H89 C;  5FLV A;  1TWC J;  3E97 A;  5J40 A;  3E6D A;  2EFQ A;  2H1K A;  4Y13 A;  1YRN B;  4NUB A;  4XIC A;  1A6I A;  3PQK A;  2R7V A;  2QYO A;  4IHS A;  4UVC A;  4RBO A;  1ZAR A;  5GAE J;  4C2T A;  2JA8 J;  2A68 F;  5D4S A;  2RDP A;  3T8T A;  2CWE A;  1KU2 A;  3JRE A;  1K6Y A;  2Q2E B;  4DYC A;  4BY7 J;  2FUG 2;  4XSZ F;  5LHH A;  4D1Q A;  2W25 A;  2IGK A;  3WTX C;  3GTO J;  2CV1 A;  5JHF A;  4KIC A;  2M45 A;  4M3G A;  4BQQ A;  2EIM H;  3S15 J;  3E0J B;  3P9C A;  2VI6 A;  4IO9 F;  4N9H A;  2K85 A;  4GYG A;  3HYI A;  2OCE A;  4BEH A;  4DW6 A;  4X0G A;  2FU4 A;  1T0F C;  2O8X A;  2W24 A;  3HUG B;  3RKQ A;  4CCK A;  3VOD A;  2W82 A;  4D9J A;  2LKX A;  1EH7 A;  4U0V A;  4B3A A;  1KON A;  3K4M A;  2PJP A;  3VSL A;  1SVM A;  1ETO A;  4PJL A;  4EM0 B;  3E7L A;  2QBY B;  2IP2 A;  2AQE A;  4BS9 A;  4DNC A;  1X3W B;  2F5V A;  5F64 A;  1A31 A;  3TOA A;  5GP9 A;  1X3Z B;  1XMA A;  4EJO A;  1JKP C;  2K4J A;  4UY8 I;  2B7E A;  3ERM A;  1WJA A;  2BVM A;  4I98 B;  1E3H A;  1OR7 A;  4A3M J;  1X1C A;  4CDG A;  5GAG J;  2VBX A;  3FXQ A;  4S0H B;  1BR1 A;  2O9L A;  1HKQ A;  2HYF A;  3F6V A;  3GTK J;  3H9Q A;  4JQF A;  5IY5 H;  4G6T B;  1SVO A;  1FNN A;  2VE8 A;  1LE8 B;  2ZNZ A;  1J5Y A;  3AG4 H;  3OL3 A;  3LQQ A;  3UKG A;  1YFH A;  4ITV A;  4HDV A;  3R61 A;  4HNT A;  1FOX A;  1Z6R A;  5CVJ A;  2XC7 A;  4CO8 A;  3DP7 A;  1KU7 A;  1LJ9 A;  2NRA C;  4RLQ A;  3WHC A;  1BI3 A;  4CZZ A;  2LRE A;  1SFU A;  1MJB A;  2M4G A;  4QPO A;  4E7S A;  3ZMZ A;  1MBK A;  4KUM A;  2Y31 A;  2M7A A;  4A3F J;  1U3E M;  3CLQ A;  3CMM A;  2E7W A;  5F0F A;  1K78 B;  1QA6 A;  1OCR H;  4FTH A;  4A3K J;  2K9L A;  1UJ8 A;  2M4K A;  3OYC A;  3SEQ A;  4P55 A;  1PP7 U;  4NDL A;  1TWF J;  4JOM A;  4DBQ A;  3FIS A;  2L01 A;  4PDK A;  3L7W A;  1UG2 A;  2UXN A;  5E1Z B;  4ENK A;  3VB2 A;  2ZB9 A;  5JHU A;  5DCF A;  1FY7 A;  5KK1 A;  2ECC A;  4H0E A;  4LJZ F;  5BMZ A;  2WV1 A;  3N4M A;  2P4W A;  1R4N B;  4II3 A;  4RGS A;  4A6E A;  5J4Y A;  2K9M A;  4N4N B;  3G4S I;  1ZTR A;  3CLO A;  2ZKZ A;  2CUZ A;  2HYJ A;  3RYP A;  2RNJ A;  3GTM J;  2JPC A;  1JKQ C;  1VQ4 I;  1RPW A;  4OMY A;  2L7F P;  2R5Y A;  2F4O B;  3G1O A;  2E2I J;  4MO7 A;  3OV8 A;  2ZCW A;  3DEU A;  3WTW C;  2HOS A;  1OCP A;  2V79 A;  1OQY A;  1TNS A;  1NTC A;  3ZQG A;  3OS0 A;  1PDN C;  5F0H A;  5EDN A;  2VL8 A;  2IA0 A;  1IJW C;  4IHT A;  4HYE A;  1EV7 A;  1WRJ A;  2MW8 A;  4FHT A;  1MBJ A;  4KJZ A;  3S8P A;  3GME A;  1F5T A;  3FWE A;  2V6C A;  4OIO F;  2Q0O A;  2DYR H;  1P7I A;  1BOB A;  2FD5 A;  5EGO A;  3C2H A;  2OF7 A;  1NHA A;  3B6C A;  3MFK A;  4KNY A;  3MEX A;  1ORK A;  2DOF A;  1WPK A;  3T0Y A;  3TO6 A;  4UV9 A;  1OCO H;  2COM A;  4FAS D;  3BJO A;  4A0X A;  2PMZ A;  1KZH A;  3A1Y A;  3HRS A;  5F0C A;  1BJA A;  2X1E A;  3HG9 A;  1IRX A;  1ETQ A;  2DW4 A;  4Q48 A;  2BY1 A;  3KEY A;  2W4S A;  1FYK A;  1Z1D A;  5IT9 Z;  3FM5 A;  1S5L C;  1NG7 A;  2CS3 A;  2ZXJ A;  3KZI C;  3KET A;  2L7M P;  3BG9 A;  2NOJ B;  5FRN A;  3HOU J;  2M5W A;  3ZP5 A;  4FQG A;  1TZL A;  4IHX A;  4HG2 A;  1ERD A;  2KHM A;  4CH7 A;  3A0H C;  5FKN A;  1ZLK A;  1S29 A;  4XLA A;  3F8M A;  1R71 A;  5BPD A;  1BR4 A;  1W7P B;  2A61 A;  4ENJ A;  2QBY A;  5LBQ A;  4GRI A;  3TED A;  4HA8 A;  2CJJ A;  2XGC A;  1VND A;  2GA1 A;  2YR2 A;  2EFP A;  1I50 J;  4EV0 A;  5F6F A;  4KMU X;  2CFX A;  5TGT A;  1REP C;  4YFN F;  4AD9 A;  3G1L A;  3TMO A;  3CMY A;  5DM7 F;  2CMP A;  3W3C A;  1GV2 A;  1Q1H A;  2P5V A;  2V9V A;  4XOR A;  2JVH A;  1R7J A;  1VQ6 I;  1GXQ A;  4BH9 A;  4KIG A;  3WU0 A;  1B8I B;  2ZJ2 A;  3DXJ F;  3S2W A;  2Z99 A;  1L3L A;  1YW7 A;  1G4D A;  2MSY A;  1J0R A;  4KT5 C;  1KQ0 A;  2LTP A;  1AKH B;  1ZR4 A;  1XN7 A;  2H94 A;  4BNC A;  5B1A H;  1OKR A;  4CUG A;  1I3A A;  5HOD A;  4WWC A;  3I54 A;  4BQN A;  4UUS A;  4HDU A;  2X1C A;  3CCL I;  1HBX G;  2VJ5 A;  3OYB A;  1J9I A;  5HLG A;  3TP0 A;  1FX7 A;  2XRN A;  4CCN A;  4ZYE A;  1FZP B;  2HXO A;  1ETV A;  1YX3 A;  3L2Q A;  1T38 A;  3RKW A;  2ZO4 A;  5H20 A;  3BQZ A;  1QHG A;  2F5C A;  5B3S H;  1GHC A;  4CCJ A;  4U0Y A;  3W6J B;  2WAQ N;  2QSG X;  4E7L A;  3GBG A;  3Q3S A;  2FNP A;  1BW6 A;  4BGD A;  4ZYD A;  1WI3 A;  2R7Q A;  2R5Z B;  1D0X A;  2HQN A;  1S8N A;  2P7C B;  2KIM A;  1YG2 A;  4YII A;  1LUJ B;  2WAD A;  2WY7 Q;  2MC3 A;  1MMD A;  3NWS A;  1BOA A;  1FMV A;  3IHU A;  4ANJ A;  5KVR A;  3CTA A;  1W36 C;  3DBR B;  1XG1 A;  1IXR C;  2OTJ I;  4E7Z A;  4PZJ A;  1Z6T A;  1XTA A;  5HS9 A;  1YO5 C;  2L4A A;  2XIG A;  1QPI A;  2HKO A;  4HX4 A;  3ULQ B;  3JRA A;  3W2W A;  1S72 I;  1Y8R B;  3M8F A;  3OWT A;  5GAD J;  2D45 A;  2P6T A;  1VF9 A;  4FET A;  4JX5 A;  3SDG A;  1O7F A;  1FJL A;  3RKX A;  5IPA A;  2PN6 A;  1T98 A;  1IN6 A;  3KLO A;  5DYM A;  3ZGK A;  4WX9 A;  1O3T A;  3FHN A;  2K40 A;  4LMY A;  4RAG A;  3HTS B;  1I1S A;  3H3V K;  1D5V A;  2X1D A;  1X1P A;  4HNU A;  1IN5 A;  2DA2 A;  3CUQ B;  2IW5 A;  4M9S A;  4LLL A;  3R0A A;  5J47 A;  1HC8 A;  1EKE A;  1OYI A;  3GW2 A;  4E7J A;  4CIC A;  3BCB A;  4XBF A;  1UEL B;  4HF1 A;  3W6V A;  3WTZ A;  2DA3 A;  4ZH4 F;  2OQG A;  2KP6 A;  3IH4 A;  2YPR A;  4K2E A;  4EGY A;  4D0P A;  4RAY A;  4KT6 A;  1E2X A;  3VEP A;  2XF7 A;  2HDC A;  3KEO A;  3G2B A;  2L54 A;  3IUO A;  4P5O A;  4L0Y B;  5JLX A;  1PYV A;  2ZME B;  1P4A A;  4CYC A;  4N9I A;  2L4M A;  4B48 A;  5EZG A;  2UUZ A;  4F93 B;  4MHG A;  2WV0 A;  2W7N A;  2FX0 A;  2WB1 N;  1MGT A;  1R58 A;  2MC4 A;  2D1V A;  4JX4 A;  2CQK A;  2LNB A;  2Y0M A;  4DZJ A;  4EJU A;  1DUX C;  2R7U A;  4OWR B;  1MDM B;  3KLN A;  1D1A A;  3O8H A;  2K02 A;  1LDD A;  4A93 J;  2XV4 S;  3M7G A;  5DS9 A;  3ZMV A;  3HRT A;  5EG0 B;  2HVR A;  1K79 A;  4MQV A;  3V7R A;  5DUI A;  3I4M J;  1PVE A;  2ADU A;  2XVC A;  3ONQ A;  5KCM A;  5DM6 F;  1LB2 A;  2Y0S N;  2CQ7 A;  2O3F A;  3BR0 A;  3S14 J;  3QU6 A;  3MCZ A;  1YTY A;  3FBN B;  4FE7 A;  4UVB A;  2HNH A;  4RLF A;  2UXX A;  4EJW A;  1X1D A;  2OD5 A;  2MD0 A;  3RDI A;  1HKT A;  1AWC A;  1R5G A;  4KMF A;  2NXN B;  2MLG A;  5EGO B;  3A0B C;  4II2 A;  2ICW G;  2FF4 A;  1G3T A;  2XUB A;  3QP5 A;  4P9F A;  4Q4Z F;  1NG6 A;  2RNG A;  1A36 A;  4PUS A;  3F21 A;  3PM1 A;  4RB0 A;  3JSO A;  3CCR I;  4KIS A;  4A3D J;  1GV5 A;  3I71 A;  3GLX A;  4IEJ A;  4XLE A;  2KJB A;  1IO2 A;  3R0J A;  5IT3 A;  2M0M A;  2H27 A;  2MLK A;  2Y0S A;  3IKT A;  2VOP A;  4M6V A;  2CU7 A;  4CSW A;  4Y7N J;  1ZHF A;  3S32 A;  4G7Z F;  5LRS A;  5ILV A;  3GVA A;  1W0T A;  2DCE A;  2FRH A;  3S1Q J;  1XMX A;  3IH2 A;  1UB9 A;  1E17 A;  1K4T A;  4IPA A;  5HNF A;  4A3L J;  4RA2 A;  4L5I A;  2VXZ A;  2LOO A;  3ABM H;  2OQR A;  2R92 J;  4GDF A;  3GWZ A;  4BXF A;  5IOZ A;  5BOX A;  2V26 A;  2VQL A;  4A69 C;  3GFI A;  3HZJ A;  1GLN A;  2W1O A;  3HBL A;  2NVQ J;  2KRH A;  3BTC A;  4MEY F;  5DD4 A;  4BJT A;  2IBD A;  3DF8 A;  1QVT A;  2DA5 A;  2FA5 A;  5JR3 A;  4M9Z A;  5LRR A;  1RET A;  2CRG A;  4I0A A;  4DIQ A;  3KP7 A;  2DMU A;  3MWM A;  4QIW N;  2NS7 A;  1MSE C;  2IA1 A;  2FEZ A;  3OYD A;  2RKH A;  2VLA A;  3CCU I;  2Y75 A;  2J5O A;  3EET A;  1JTY A;  1OYW A;  2HXI A;  3L1P A;  1FWZ A;  3TBI A;  2BV6 A;  3GEZ A;  4AWX B;  3PJR A;  2GLO A;  4B47 A;  3H36 A;  4ETS A;  2OZU A;  3SXY A;  5IP6 A;  3FXR A;  1B9N A;  2R5Z A;  2K86 A;  3RPU A;  4ZZL A;  2ISZ A;  1G3Y A;  1X2N A;  3J81 Z;  1YJN I;  1F4K A;  1K78 A;  3OYG A;  3I56 I;  1Z05 A;  2DOA A;  3I58 A;  1W7P A;  4C3I J;  3ABK H;  1Z3Y A;  5CQG A;  3G71 I;  4XOP A;  3T5X A;  5IYB J;  5KAI C;  1QQI A;  3PNV A;  3RZD J;  4Y52 J;  5M5X J;  3L2C A;  3H3Z A;  2Z33 A;  2ZXH A;  1DU0 A;  1HDP A;  2CSO A;  4A2U A;  3BTI A;  4BHP A;  4KDP A;  2DMQ A;  3BJA A;  4M6Y A;  3FBI B;  4AVP A;  1F36 A;  1IUY A;  4PJ0 C;  5FLX Z;  2D2W A;  2G0E A;  5EF6 A;  5LHI A;  2Y9Z A;  2ID6 A;  4BAY A;  1Z91 A;  2EIN H;  1RES A;  4XN0 A;  1WH7 A;  1SMT A;  1ZKG A;  1S7O A;  2Y30 A;  1N77 A;  4FX0 A;  1FP1 D;  4LB6 B;  1SFE A;  1T39 A;  5D4R A;  1I1G A;  5D6E A;  5LGN A;  3ECO A;  3OYE A;  2C6Y A;  2R7S A;  5J8C A;  2DU9 A;  2HKX A;  2GXB A;  1P9Q C;  4D5F A;  3EPZ A;  4E4H A;  5EJC A;  1VQN I;  1E0E A;  1FOK A;  3PNY A;  2JRT A;  2VKE A;  3NQO A;  4IKF A;  4HX8 A;  1V4R A;  2QKL B;  3CUO A;  1HW1 A;  4Y33 A;  3K2Z A;  2M34 A;  3KP3 A;  3VYU B;  4E6K G;  3DWL E;  1IW7 F;  2BW3 B;  3R6S A;  3H35 A;  4MFD A;  5GTH C;  2FNA A;  1ETX A;  4RAF A;  1SFX A;  3Q0W A;  1KQ8 A;  2WY8 Q;  3GFM A;  2RRE A;  4P1W A;  1H9G A;  3MD2 A;  4Y15 A;  1FOY A;  4QPQ A;  3B02 A;  4DYQ A;  1O3R A;  2WAF A;  1MKM A;  3I0T A;  2JSP A;  4L0Z B;  4WXH A;  3ZQF A;  3L09 A;  1V5G A;  1X4P A;  1D0Z A;  3C18 A;  4LG0 B;  4XLC A;  1W4M A;  1LFU P;  1OMI A;  1B59 A;  2EFO A;  2DI3 A;  2HDD A;  3KP2 A;  1HF0 A;  4RB3 C;  3QYE A;  3RKY A;  4WCG A;  1FLI A;  1QBJ A;  2NAZ A;  2F48 A;  3GZ6 A;  2JVG A;  1WZ2 A;  1SVL A;  1WWX A;  3QAH A;  3K70 D;  2XSJ C;  1GXP A;  2DMN A;  2EV6 A;  2HZD A;  2EIK H;  2STT A;  4EJV A;  2H6C A;  1XS9 A;  3DU5 A;  2P0W A;  1ULY A;  2DQL A;  5D8K B;  2HR3 A;  3RQ4 A;  3KZZ A;  2QEX I;  3A02 A;  5E1X A;  3DKW A;  4B43 A;  4XN3 A;  3HOX J;  1GVD A;  3MVP A;  5DD8 A;  4HST A;  1R22 A;  4EEF G;  4V2F A;  2R3S A;  2PFB A;  2Y69 H;  2CW0 F;  3VFZ A;  2DO7 A;  2GIZ A;  4I0B A;  4LIU A;  3F72 A;  2TCT A;  2O7O A;  5IP7 J;  2JPB A;  5LFA A;  3ERE D;  3AFH A;  1BW5 A;  3PFI A;  2LC2 A;  4G7O F;  3HHG A;  4HV6 A;  5LLQ A;  2YU9 J;  2DAO A;  2XB5 A;  1R23 A;  4AU7 A;  1SMY F;  3FXM A;  4KIT B;  3WTV C;  1JHH A;  2FBI A;  1BI0 A;  1R00 A;  2AHQ A;  2L9N A;  4HZF A;  3BDD A;  3LSM A;  2HOE A;  2A07 F;  1BIA A;  2VXD A;  2CQN A;  5E3O A;  3G6E I;  1IZ1 A;  2OTL I;  4EM2 A;  5E3M A;  3M8E A;  2H09 A;  2NS8 A;  5TIS C;  3E6C C;  2D5V A;  3WTS C;  5FKL A;  1ENH A;  3Q9S A;  2ECB A;  4OIR F;  3MKW B;  3HC7 A;  2OUM A;  3IH3 A;  1V5E A;  3M9A A;  4HF2 A;  9ANT A;  4OU0 A;  3U2R A;  1ZGA A;  2F4M B;  1P92 A;  4XID A;  2HYG D;  2DA6 A;  2PX9 A;  3M4O J;  5ED4 A;  2AXL A;  4I02 A;  4G9Y A;  2ZXW H;  1LE8 A;  2YX4 A;  3MZY A;  5A2Q Z;  1ON2 A;  2K3P A;  3CF5 F;  5FLX K;  1WJC A;  1UZC A;  3RQI A;  2IGM A;  2LBF A;  2QGU A;  2DFH A;  4BE2 A;  1SAX A;  4LLG F;  1TT5 B;  2JT1 A;  1P2F A;  3ZN1 A;  2WBM A;  4ZTF A;  2P81 A;  1D5Y A;  4XRS A;  2LG4 A;  2PMH A;  3E6M A;  3CJN A;  4HW0 A;  3A03 A;  3OMY A;  2NNY A;  1PUF B;  2KIF A;  4OMZ A;  2HDW A;  2XAJ A;  5IYC J;  2FOW A;  1ZRF A;  1I6X A;  1XCB A;  3SHF A;  2DT7 B;  2DPD A;  2XF6 A;  4RM3 A;  5M3F J;  2UZK A;  3BPV A;  2QZ8 A;  3VYS B;  3QYB A;  4LFU A;  2E1M B;  2R7X A;  4LK0 F;  2OZ6 A;  1X1B A;  3HIF A;  3OYH A;  5HLH A;  5E79 C;  1OR7 C;  2VT3 A;  4ENN A;  1VFC A;  2VB6 A;  2ESH A;  1RIO H;  2J5P A;  1FSE A;  3F8F A;  5DCM B;  3WTT C;  3PSF A;  2CUJ A;  3LAP A;  1VQL I;  2CW7 A;  2W48 A;  3E5X A;  4UB6 C;  1OPC A;  2G7H A;  4YIR X;  3ZCO A;  2XKP A;  2KT0 A;  5ERI A;  4LG0 A;  2LY9 A;  1JJ8 C;  2R5Y B;  1TQP A;  3J7Y J;  2R7Z J;  5J4V A;  1I6H J;  3WG7 H;  5E3N A;  2L9R A;  1LEB A;  4P96 A;  4ZC3 A;  2EA2 A;  2BOL A;  4NHJ A;  3L9F A;  3D0S A;  2Z3Y A;  3U9G A;  3H0D A;  4NNJ A;  1UST A;  3M8J A;  1U9O A;  3G1M A;  5IOY A;  2EZH A;  1ZG3 A;  3ROU A;  3HSF A;  1OCC H;  1H0M A;  1V5F A;  1U8R A;  2A5W A;  4RGR A;  2Q2E A;  2O61 A;  3BR2 A;  2L5Q A;  4BUP A;  2OPT A;  2MGQ A;  3FKJ A;  1YW9 A;  5J6X A;  3QU3 A;  2W57 A;  2F6C A;  3JRG A;  1O3Q A;  2GXA A;  1UHW A;  1Z7U A;  5HNH A;  1HLV A;  3KPH A;  4DYR A;  2XAG A;  1RUN A;  2VKV A;  1WJE A;  2L3D A;  1MMN A;  1USS A;  2K4B A;  3WTU C;  1KYZ A;  1MZB A;  2VJJ A;  3JAM Z;  5KHD A;  2DFF A;  2HQR A;  2IEK A;  4JX6 A;  1Y8Q B;  4XON A;  4F3Q A;  2M30 A;  2IT0 A;  1IN4 A;  3C7J A;  1APL C;  3H5A A;  5EEA A;  2VQC A;  3FX3 A;  3LSR A;  1YIO A;  2LYC A;  2JA5 J;  3FXO A;  3H1C A;  5FLM J;  4IOA F;  2XAF A;  2HOT A;  4RGU A;  2JUG A;  2KDZ A;  2CW8 A;  1U8B A;  1DPR A;  1MND A;  2K7L A;  1J2X A;  4DJA A;  4HRI A;  3HXL A;  3BG3 A;  1R49 A;  4LIV A;  4JP0 A;  2M1B A;  1DDN A;  1WCM J;  2I10 A;  3SZT A;  1FIP A;  3FXJ A;  3L2V A;  3HOV J;  3FIW A;  4B8X A;  2MH2 A;  5J1U A;  3ZXS A;  1S7E A;  3DPL C;  4B4C A;  4QLC U;  2NOG A;  2AQF A;  4UHT A;  1GT0 C;  2DBB A;  1ZG5 A;  2KDO A;  1G3S A;  1KYW A;  1TW2 A;  2VON A;  3AG2 H;  3H5N A;  2GAU A;  3D5S C;  3QWL A;  4RDU A;  3PIP F;  1G3W A;  4N4O B;  4IX7 A;  2XPV A;  2O0Y A;  5J3L A;  2A6E F;  5D8L B;  4BKX A;  4OIQ F;  1TC3 C;  1ZRC A;  4FX4 A;  2WC2 A;  3ISP A;  4BY1 J;  4BHB A;  2X51 A;  3S17 J;  4PK4 A;  1J59 A;  4PCQ A;  1VQM I;  4CCO A;  4CHU A;  3L00 A;  4M72 A;  1YLF A;  5ICF A;  4IQJ A;  3H92 A;  1QNT A;  2R93 J;  4D7M A;  1G59 A;  3ZQI A;  2ZJP F;  4D5C A;  1WJD A;  2V9K A;  2LY1 A;  4AIK A;  1TNT A;  3LA7 A;  2EZL A;  3HL2 A;  2LH9 A;  3OL4 A;  2E2H J;  4FE4 A;  4IRI A;  2KMU A;  3V42 A;  1I3Q J;  4CXF A;  4ABZ A;  2VE9 A;  2VOO A;  3OYI A;  1JE8 A;  2AXT C;  3PUF A;  1P4X A;  3HM5 A;  2XB0 X;  3LSI A;  3K4J A;  2JA6 J;  1TLH B;  2LVS A;  2DXI A;  3Q0U A;  2XKO A;  3OIO A;  4PJM A;  3IAM 2;  1BBY A;  4B3X A;  3LNQ A;  4GCV A;  1HCR A;  3FZV A;  2FOK A;  4EMS A;  1FBQ A;  3UNG C;  1XGO A;  3TO7 A;  3HHH A;  1ZAO A;  2IGN A;  4IXA A;  2DA1 A;  1EH8 A;  4W1U A;  1OJL A;  4Y3O A;  5CVI A;  2R0Q C;  3DLA A;  3GFJ A;  1BI2 A;  4ESF A;  3GTG J;  3BLY A;  2BE5 F;  2CGP A;  2WB1 A;  2F5E A;  5F08 A;  1R5H A;  2H6B A;  3R4K A;  4L9J A;  4M3B A;  4O6J A;  4XMY A;  5BS6 A;  1F43 A;  1HOM A;  4AIJ A;  2I8D A;  2ZSH B;  5E3L A;  1BA5 A;  1DP3 A;  5J8F A;  3JRH A;  1B72 A;  5L3D A;  2DMT A;  4C3J J;  2LBF B;  2HVQ A;  1YOV B;  3F3X A;  3S2D J;  5C4J J;  5ICG A;  3K4K A;  5CQE A;  4BHC A;  3CF2 A;  1D8K A;  1K6O A;  2PI0 A;  4X6A J;  5IYD J;  1XPX A;  1LFP A;  3DU6 A;  3JRF A;  4E7I A;  3OY9 A;  1AKH A;  3CCV I;  4LGW A;  3SYT A;  3VPR A;  1W0U A;  4BAC A;  3JRI A;  3S1M J;  3U1D A;  4CYC B;  1EJ9 A;  1IUF A;  2HVS A;  3OYK A;  2V7F A;  1BM9 A;  2JWT A;  1RUO A;  1FOW A;  1X19 A;  2DA4 A;  1YX5 A;  4A5M A;  5AIQ A;  3CCE I;  2EBI A;  1ZN2 A;  3NEU A;  1F9N A;  3OIP A;  2PEX A;  3M07 A;  4HLY A;  1JUM A;  5ICC A;  4NQW B;  3RTR A;  4IHW A;  3V8K A;  1V3F A;  4KFC A;  3ML6 A;  1IRZ A;  3E1S A;  4NC7 A;  3ZMD A;  5K5O A;  4HQE A;  3TW6 A;  3BZC A;  3HGG A;  4UXN A;  5LD2 C;  3ESW B;  5EG0 A;  1J75 A;  2EFN A;  3VYT B;  3EYI A;  1Y39 A;  1YW8 A;  1JGS A;  3K4B A;  4XQF A;  2A05 A;  3AL0 C;  1ZYR F;  4XM3 A;  2QCO A;  1VQ8 I;  3OS2 A;  1NK2 P;  1MMG A;  3H0G J;  1FT9 A;  2M7B A;  4A0Y A;  1T08 B;  2X4H A;  3LA2 A;  1Y0N A;  3L2U A;  4C2U A;  1JTX A;  3H9J A;  2IA2 A;  3QP6 A;  1BI1 A;  1SD5 A;  2DT6 A;  4A3G J;  2M3A A;  2HEO A;  1RNL A;  1QU3 A;  3KYD B;  2NYX A;  1U5T B;  3MKL A;  3RPQ A;  2JUC A;  2GXG A;  4Q47 A;  5HLI A;  4U88 A;  3JSP A;  2KZV A;  2FBK A;  2OU2 A;  4MGR A;  2TDX A;  1FMW A;  3ZMT A;  5JVT A;  2FQ4 A;  2LF7 A;  1XGN A;  2VOD A;  2CUF A;  5CKT A;  3CME I;  4A3B J;  3I53 A;  4G94 A;  2KIQ A;  1MD0 A;  3DEE A;  3C2G A;  3K69 A;  5GAH J;  3PIO F;  2VC1 A;  2V4J C;  2DDA A;  4IZZ A;  4MTD A;  1ZG1 A;  1YIJ I;  1IN7 A;  5EEH A;  3LSK A;  3B6A A;  4IRH A;  4ZYH A;  1UHM A;  1WFX A;  4F7Z A;  2IS2 A;  1TP4 A;  3FK6 A;  4R8H A;  3MAJ A;  3UR3 C;  3BR3 A;  1P4W A;  4AYB N;  1KU3 A;  3KP5 A;  4A3J J;  1VTN C;  4XOT A;  1ZR2 A;  3W6K B;  1JUP A;  2LR8 A;  1R5I D;  1N78 A;  2E1N A;  3DKY A;  3I3L A;  4IJA A;  3VOE A;  5ICE A;  2ME0 A;  1O57 A;  2LRD A;  2IGO A;  3M3Y J;  4LLN A;  4L9T A;  4BE0 A;  3LWF A;  1CQT A;  1RKW A;  3HRM A;  3GTP J;  2E34 A;  2VBW A;  4I2O A;  1T56 A;  4PFO A;  4EVI A;  2RV8 A;  3BG5 A;  1LDK B;  4UB8 C;  1B72 B;  2JMW A;  2DOE A;  3DTI A;  3LSP A;  2MH9 A;  2V9P A;  2BYV E;  2OC6 A;  4QWQ A;  5CPR B;  2A3S A;  3NWT A;  3JR9 A;  1MW7 A;  3F8B A;  1O7L A;  3DTE A;  2HOA A;  1QVU A;  1MMS A;  2JA2 A;  1SD7 A;  3IP4 B;  1IF1 A;  2O8K A;  1VZ0 A;  3VYR B;  5FB2 A;  1TBX A;  1I5Z A;  3TL4 X;  3A4C A;  2QLZ A;  1XD7 A;  3OSG A;  3DFG A;  5CLS A;  3F23 A;  4LB5 A;  3QPH A;  3ZQC A;  3BTL A;  1YIT I;  2A69 F;  4QSH A;  1WJB A;  3COA C;  3O6B B;  1G8X A;  2PQ8 A;  2XAH A;  3LL7 A;  2L9S A;  2OBP A;  5L3G A;  4CYD A;  3A01 B;  5GTI C;  4C9Y A;  3SZG A;  2CFO A;  3NAR A;  4BE1 A;  4P9U A;  3J81 K;  4L18 B;  2IPQ X;  3K0L A;  2VQG A;  3CUQ A;  2M8G X;  5D6F A;  5C4X J;  2DOD A;  1Z9C A;  1QRY A;  1E3P A;  3BQY A;  1MBF A;  3H3U A;  2Y48 A;  1H88 C;  3BR1 A;  3GLL A;  2IS6 A;  2P5L C;  2YX7 A;  5FD6 A;  2KRF A;  4IHV A;  2L7Z A;  3M1C A;  4M6X A;  4GXO A;  3N97 A;  2E35 A;  2HQ5 A;  3K1P A;  3SJM A;  5LHG A;  2P8T A;  2B63 J;  3OYN A;  1A35 A;  1ZQ3 P;  4EJT A;  5E1W A;  3K10 A;  2VN2 A;  4RGX A;  2FSW A;  3FM3 A;  1VQP I;  1FBS A;  3K6G A;  2BHY A;  1KA8 A;  4OAY A;  4B09 A;  2RAE A;  2XPW A;  3OR2 C;  3BR6 A;  4BBR J;  4U0W A;  5FO5 A;  4M3D A;  1DGR M;  2EV0 A;  5L3B A;  4M74 A;  4PSW A;  3J7A O;  3CMA I;  5H6Q A;  1QPM A;  2QSF X;  2CO5 A;  2QQ8 A;  3BP8 A;  2HZT A;  4I7H A;  3HGY A;  4RS8 A;  1WI9 A;  2L0K A;  5KAF C;  5B5E C;  4F92 B;  1ITY A;  3E6B A;  3D5R C;  2QQB A;  3BWG A;  3LSJ A;  1HDD C;  2ZFW A;  4MFE A;  1BC7 C;  2E5N A;  1W36 D;  2HU9 A;  2MAB A;  2BW3 A;  4C2M J;  4WF2 A;  3V8L A;  1Z67 A;  2GOM A;  2WAE A;  4ZZD A;  4YRV A;  1I27 A;  1N75 A;  1O3S A;  5H6R A;  4RM2 A;  1WH5 A;  2QEN A;  1GDT A;  3GX4 X;  3WG9 A;  1R36 A;  3JW4 A;  2DYS H;  5D5U B;  3CO6 C;  3KEQ A;  1SFK A;  2EA4 A;  2E7X A;  3EUK L;  4WXD A;  2M0C A;  2DTR A;  2ID3 A;  4PGH A;  3WU1 B;  1LVK A;  3W2V A;  2O6G E;  3U21 A;  3CDH A;  5CJ9 A;  3S3M A;  1XSV A;  2DT5 A;  4MLO A;  3DKX A;  4HBL A;  1DGW Y;  4G6D A;  4V2G A;  1ZGJ A;  1HKS A;  1T95 A;  1WJF A;  1T0F A;  3JCU C;  5FFZ A;  3CC2 I;  1EA3 A;  4A3I J;  1T8I A;  3LA3 A;  3ZMU A;  2EZK A;  4PFP A;  4BL0 B;  2KZG A;  3EYY A;  3V8J A;  4ZTJ A;  5FFX A;  2PBI A;  3TQN A;  3C2B A;  4I01 A;  3ZOB A;  3HKZ N;  4DGW B;  5FJ8 J;  2HFH A;  1JUS A;  3A01 A;  3OS1 A;  3JTG A;  3SDB A;  2ACJ A;  1R9T J;  1A6Q A;  3ZQ7 A;  2YU3 A;  2UV1 A;  2ZC2 A;  2F5F A;  3I64 A;  1CF7 B;  1XMK A;  4GFB A;  4ZDO A;  1D3Y A;  3BOQ A;  1JT0 A;  2XGD A;  2Z2S B;  3EUH A;  1W5T A;  3P9K A;  3PQJ A;  4XLF A;  2K3F A;  3V7C A;  3F8C A;  1XB4 A;  4ZYG A;  1MSF C;  3MKZ A;  2V1D A;  3HUG A;  3K1N A;  4PJN A;  2R7R A;  1I39 A;  2AS5 F;  4I99 C;  1BJZ A;  4AM3 A;  3OYF A;  1MDM A;  4HOB A;  3I4N J;  4R1H A;  5ILU A;  1T33 A;  4G7H F;  1GVJ A;  2K9N A;  3KYC B;  2VKD A;  4FCY A;  2XDV A;  2BGC A;  1B6A A;  2QSH X;  3ZQH A;  2QQA A;  4LD5 A;  4BQO A;  2P6S A;  4BU2 A;  3MMY B;  3L2W A;  3VWB A;  3AL0 B;  1WJ5 A;  2X85 A;  3TW7 A;  1AA7 A;  1OCZ H;  2HPI A;  3GFL A;  2ZXI A;  3IWF A;  1D1C A;  1HQC A;  5EZH A;  3F22 A;  3LSG A;  3RIR A;  4WK8 F;  2HQA A;  2QM3 A;  2R4G A;  1E3O C;  5FKM A;  4UUT A;  5J1Y A;  3SZP A;  1D1B A;  1K7A A;  1ZH5 A;  1LNW A;  1UG0 A;  1YQA A;  2RVC A;  2VBY A;  3MZ8 A;  2RQP A;  1BC8 C;  1LVA A;  2HS5 A;  5EEG A;  1K83 J;  4BXX J;  5F1J A;  5K1Y A;  1O4X A;  3LQR A;  2EFW A;  1GUU A;  3SFZ A;  4I6Z A;  1U2W A;  2OV7 A;  1UCR A;  4U7D A;  2CV2 A;  2VPR A;  3MN2 A;  2RC4 A;  1SD6 A;  2X0L A;  1CGP A;  3DPU A;  4NBQ A;  1KQ9 A;  4XLH A;  3CCS I;  2IRF G;  6PAX A;  2FBH A;  3IV5 A;  1FPQ A;  2DFE A;  3DEW A;  4GO1 A;  3R60 A;  5JFR A;  1VQ7 I;  4S04 A;  3MQ0 A;  3BY6 A;  1MMA A;  3H9G A;  2PMU A;  1TQI A;  5D5W B;  5HVQ C;  4XRF A;  3BZK A;  1OFC X;  2G7U A;  3CCQ I;  3B73 A;  4HV5 A;  2W85 A;  1T6S A;  1QZZ A;  1R6R A;  3EUH C;  2K9S A;  2LKS A; 
#chains in the Genus database with same CATH homology
 2XGX A;  1G6N A;  3FF5 A;  5E17 F;  2NNN A;  1IAW A;  3RI4 A;  4NQW A;  3HTU A;  3WTY C;  4M71 A;  3IL2 A;  2ELH A;  2BBY A;  4G6Q A;  1FBU A;  3QPT A;  1T2K A;  3V7S A;  3OOP A;  4G8X A;  3IRQ A;  4RB1 A;  4S05 A;  4BYY A;  5DEQ A;  1FSH A;  2G9W A;  2FQ3 A;  2KJC A;  4A0Z A;  5DV5 A;  5HOO A;  2HWV A;  1A04 A;  1L0O C;  1CF7 A;  5HS8 A;  1HXD A;  5IT9 K;  2DQR A;  3BRO A;  3K9T A;  1S3J A;  3LST A;  1D8J A;  4UNO A;  3I5U A;  1BIB A;  2F5D A;  1XDS A;  3GUD A;  3GO5 A;  2GZW A;  4AIH A;  4LK1 F;  1XSX A;  4O5V A;  4ESB A;  2DK8 A;  2LDU A;  2FE3 A;  5AON A;  1U5T C;  3HSR A;  1SD4 A;  2K27 A;  3FMR A;  3MZH A;  3HRU A;  4MQ9 F;  1J7K A;  3AAF A;  3TDU C;  4OOI A;  1HW2 A;  4BQA A;  1EH6 A;  5AIP A;  5TJJ A;  5K5Q A;  1LEA A;  3HSE A;  1JXS A;  3HOT A;  5CVV A;  5DDG A;  3FMS A;  3RJP A;  4CGZ A;  1HSJ A;  2STW A;  1Y0U A;  5LEK A;  4UVA A;  4KYW A;  5DUK A;  2PLY A;  2QUF A;  1KU9 A;  1S7A A;  2EJR A;  3FMQ A;  2L02 A;  3DQV C;  3RYR A;  4N0B A;  3G73 A;  4DQ2 A;  3TKY A;  4M9X A;  1WSU A;  1U78 A;  2A6H F;  4KA4 A;  1OYY A;  3CUQ C;  4KIF A;  5L3E A;  2DFI A;  3EQL F;  2JTV A;  3TDZ C;  2XRO A;  3FXU A;  5E8I A;  2CYY A;  3ELK A;  2LKP A;  1B4A A;  5DCM A;  5TRD A;  1IN8 A;  5A2Q K;  2FML A;  1YS6 A;  5HDK A;  5FD5 A;  4EGZ A;  2FXA A;  2RGV A;  3I59 B;  4WXC A;  4YFK F;  2XHK A;  3IWZ A;  2Z9O A;  2V1X A;  1PP8 F;  4HX7 A;  3K1M A;  3F8N A;  3GZ5 A;  5FGM A;  5JI6 A;  1TTY A;  2ZME A;  5HDN A;  4EM1 A;  2GWR A;  1UFM A;  5LEJ A;  1QZY A;  1F1Z A;  3E5U A;  2CG4 A;  1W5S A;  2IJL A;  2MBF A;  2EWN A;  4JBA A;  5HDG A;  4YG2 F;  4NB5 A;  3TO9 A;  4L9N A;  3O3K A;  1LQ1 A;  1H9T A;  3T8R A;  1TW3 A;  3JTH A;  5L3C A;  3Q5F A;  3IC7 A;  5LGT A;  4Q5S F;  3E5Q A;  3Q9V A;  5L3F A;  3ZPL A;  1ON1 A;  3ABU A;  1WKM A;  5F1R A;  2M87 A;  4XLP F;  1XGM A;  3C3W A;  3GF2 A;  1AOY A;  1IRF A;  2MA3 A;  3LFK A;  2VC0 A;  1TQM A;  1RZ4 A;  4M73 A;  4UV8 A;  1JHF A;  5E8G A;  2P5K A;  3HOS A;  2EB7 A;  1XGS A;  4KIB A;  2OA4 A;  5CYV A;  4YIF A;  3WGI A;  2QVO A;  2LF8 A;  5E18 F;  4MTE A;  2HGC A;  2ZBK A;  4I09 A;  3WE3 A;  1FYM A;  5CVR A;  1FYL A;  3QOP A;  4UUV A;  5BPI A;  3D5L A;  5LGU A;  2HTS A;  4TV7 A;  4IVN A;  4YFX F;  3E3V A;  5K5R A;  4L9V A;  5E20 A;  3WE2 A;  2ISY A;  2XAQ A;  3DPT A;  1MJA A;  3ECH A;  1IXS B;  4Y17 A;  3IKV A;  1XDU A;  2D1H A;  2IVM A;  1XSD A;  3C1D A;  1ZLJ A;  2Q8K A;  3CO7 C;  3KE2 A;  4ENM A;  4U7B A;  1BN5 A;  2RN7 A;  1C0W A;  2V1U A;  4FT8 A;  1YYV A;  2FMY A;  4GYI A;  4RB2 C;  2XAS A;  1HW5 A;  4MEX F;  1U6G A;  1STZ A;  1DP7 P;  4BXU A;  1W7P D;  4HQM A;  2OAZ A;  2O03 A;  3GXO A;  3DV8 A;  3TOB A;  5BQT A;  3I59 A;  4OIN F;  3SQN A;  2DPU A;  4GGG A;  2QQ9 A;  3QRF F;  5HS7 A;  4HAM A;  1DPU A;  5D5V B;  2JSC A;  1ODD A;  4R79 A;  4PGG A;  3WOD F;  2VBZ A;  1S6L A;  2PG4 A;  2EV5 A;  1P6R A;  1LDJ A;  2KKO A;  3JAM K;  3V4G A;  1WQ2 A;  2E1C A;  3G3Z A;  1IXC A;  2NS0 A;  2YSR A;  4EQQ A;  2KIU A;  3KFW X;  2JZY A;  1R1T A;  3I4P A;  3KCC A;  1QGP A;  1B1B A;  2ZNY A;  3P7N A;  4ON0 A;  4KN4 X;  1ONV A;  4XSX F;  1U5T A;  3ZN0 A;  5D5X B;  1IRG A;  1KGS A;  2ESN A;  2LSO A;  3J80 K;  1R1V A;  1B9M A;  1XCV A;  2MD5 A;  3EDP A;  2UWM A;  3TGN A;  3FHZ A;  4A6D A;  2BEO A;  1QO0 D;  2HTJ A;  1MJ9 A;  3BJ6 A;  1R1U A;  1ZRE A;  3P9I A;  4HF0 A;  3IRR A;  2EK5 A;  3M1E A;  1PUE E;  2F2E A;  3ZMS A;  3KP4 A;  4XLN F;  3WGH A;  3REO A;  4ASN A;  2QWW A;  2P7V B;  3ABT A;  1ZRD A;  4OIP F;  4KN7 X;  4Z2Y A;  3GYH X;  1RI7 A;  3LAJ A;  2GIV A;  3O2P E;  2Z5U A;  2R7D A;  5ILS A;  3J80 Z;  1FC3 A;  2M8E A;  3KZY A;  4ESJ A;  4A5N A;  4RAZ A;  4IRG A;  3NRV A;  3WGG A;  4MNU A;  4IF4 A;  2DK5 A;  2DLL A;  2VT2 A;  3KP6 A;  2GA2 A;  4L5J A;  1FP2 A;  2B0L A;  2WWY A;  2GQQ A;  2R7F A;  4E70 A;  3F6O A;  3BZ6 A;  3T1B A;  3BPX A;  2WTE A;  4HLX A;  2A5Y B;  2ETH A;  2W84 A;  4A12 A;  1X3U A;  4O3M A;  4JK1 X;  5CVU A;  1HST A;  1YS7 A;  3E97 A;  3E6D A;  2EFQ A;  4Y13 A;  3PQK A;  2QYO A;  4IHS A;  4UVC A;  1ZAR A;  2A68 F;  5D4S A;  2RDP A;  3T8T A;  2CWE A;  1KU2 A;  4XSZ F;  5LHH A;  2W25 A;  3WTX C;  4KIC A;  2M45 A;  3P9C A;  4N9H A;  4GYG A;  3HYI A;  2FU4 A;  2O8X A;  2W24 A;  3VOD A;  1EH7 A;  4U0V A;  2PJP A;  4EM0 B;  2QBY B;  2IP2 A;  4DNC A;  5F64 A;  3TOA A;  1XMA A;  4EJO A;  2K4J A;  4I98 B;  1OR7 A;  4CDG A;  2VBX A;  3FXQ A;  1HKQ A;  2HYF A;  3F6V A;  4JQF A;  1FNN A;  2VE8 A;  2ZNZ A;  1J5Y A;  1YFH A;  3LQQ A;  4HDV A;  3R61 A;  1Z6R A;  5CVJ A;  4CO8 A;  3DP7 A;  1KU7 A;  1LJ9 A;  2NRA C;  1BI3 A;  4CZZ A;  1SFU A;  1MJB A;  3ZMZ A;  4KUM A;  1U3E M;  2E7W A;  1K78 B;  4P55 A;  1PP7 U;  2L01 A;  4PDK A;  3L7W A;  2UXN A;  5E1Z B;  4ENK A;  3VB2 A;  5JHU A;  5DCF A;  1FY7 A;  5KK1 A;  4H0E A;  4LJZ F;  5BMZ A;  3N4M A;  2P4W A;  4RGS A;  4A6E A;  3CLO A;  2ZKZ A;  3RYP A;  2RNJ A;  2JPC A;  4OMY A;  3OV8 A;  2ZCW A;  3DEU A;  3WTW C;  2V79 A;  1TNS A;  1PDN C;  2IA0 A;  4IHT A;  4HYE A;  1EV7 A;  1WRJ A;  4FHT A;  1F5T A;  2V6C A;  3FWE A;  4OIO F;  2Q0O A;  1NHA A;  3MFK A;  4KNY A;  3MEX A;  3T0Y A;  3TO6 A;  4UV9 A;  2COM A;  3BJO A;  4A0X A;  3HRS A;  1BJA A;  4Q48 A;  2DW4 A;  1FYK A;  1Z1D A;  5IT9 Z;  3FM5 A;  3KET A;  2ZXJ A;  2M5W A;  3ZP5 A;  1ZLK A;  1S29 A;  3F8M A;  5BPD A;  1W7P B;  2A61 A;  4ENJ A;  2QBY A;  5LBQ A;  4HA8 A;  2GA1 A;  2YR2 A;  2EFP A;  4EV0 A;  5F6F A;  4KMU X;  2CFX A;  1REP C;  4YFN F;  4AD9 A;  1Q1H A;  2P5V A;  2V9V A;  1R7J A;  1GXQ A;  4BH9 A;  4KIG A;  3WU0 A;  2ZJ2 A;  3DXJ F;  3S2W A;  2Z99 A;  1L3L A;  1YW7 A;  1G4D A;  1J0R A;  4KT5 C;  1KQ0 A;  1XN7 A;  2H94 A;  4BNC A;  1OKR A;  4WWC A;  3I54 A;  4HDU A;  1HBX G;  1J9I A;  5HLG A;  1FX7 A;  2XRN A;  4ZYE A;  1FZP B;  1T38 A;  3RKW A;  2ZO4 A;  5H20 A;  2F5C A;  1GHC A;  4U0Y A;  3W6J B;  2FNP A;  4ZYD A;  2HQN A;  1S8N A;  2P7C B;  2KIM A;  1YG2 A;  4YII A;  2MC3 A;  1BOA A;  3IHU A;  5KVR A;  3CTA A;  1IXR C;  4PZJ A;  1Z6T A;  5HS9 A;  1YO5 C;  2L4A A;  2XIG A;  2HKO A;  4HX4 A;  3ULQ B;  3M8F A;  2D45 A;  2P6T A;  1O7F A;  3RKX A;  2PN6 A;  1T98 A;  1IN6 A;  3KLO A;  5DYM A;  4WX9 A;  1O3T A;  4LMY A;  1I1S A;  3HTS B;  1D5V A;  1IN5 A;  3CUQ B;  2IW5 A;  4M9S A;  4LLL A;  3R0A A;  1OYI A;  3GW2 A;  4CIC A;  4XBF A;  4HF1 A;  3WTZ A;  4ZH4 F;  2OQG A;  2YPR A;  4K2E A;  4EGY A;  4D0P A;  4RAY A;  1E2X A;  3VEP A;  2HDC A;  3KEO A;  2L54 A;  4P5O A;  4L0Y B;  2ZME B;  1P4A A;  4N9I A;  2L4M A;  4MHG A;  2WV0 A;  1MGT A;  1R58 A;  2D1V A;  2CQK A;  2LNB A;  2Y0M A;  4EJU A;  1DUX C;  1MDM B;  3KLN A;  2K02 A;  1LDD A;  2XV4 S;  3M7G A;  3ZMV A;  3HRT A;  1K79 A;  4MQV A;  3V7R A;  5DUI A;  2ADU A;  2XVC A;  1LB2 A;  2O3F A;  3QU6 A;  3MCZ A;  1YTY A;  4UVB A;  2UXX A;  4EJW A;  2OD5 A;  3RDI A;  1HKT A;  1AWC A;  1R5G A;  4KMF A;  2MLG A;  2FF4 A;  1G3T A;  2XUB A;  3QP5 A;  4P9F A;  4Q4Z F;  3F21 A;  4RB0 A;  3JSO A;  3I71 A;  3GLX A;  2KJB A;  3R0J A;  5IT3 A;  2H27 A;  2MLK A;  3IKT A;  2VOP A;  1ZHF A;  4G7Z F;  5LRS A;  5ILV A;  3GVA A;  2FRH A;  1UB9 A;  1E17 A;  4IPA A;  4L5I A;  2VXZ A;  2OQR A;  3GWZ A;  5BOX A;  3GFI A;  4MEY F;  5DD4 A;  3DF8 A;  2FA5 A;  5JR3 A;  4M9Z A;  5LRR A;  4I0A A;  3KP7 A;  3MWM A;  2IA1 A;  2FEZ A;  2RKH A;  2Y75 A;  2J5O A;  3EET A;  1OYW A;  1FWZ A;  2BV6 A;  3GEZ A;  4AWX B;  4ETS A;  2OZU A;  3SXY A;  3FXR A;  1B9N A;  2K86 A;  3RPU A;  4ZZL A;  2ISZ A;  1G3Y A;  3J81 Z;  1F4K A;  1K78 A;  1Z05 A;  3I58 A;  1W7P A;  3T5X A;  1QQI A;  3L2C A;  3H3Z A;  2Z33 A;  2CSO A;  4A2U A;  4BHP A;  4KDP A;  3BJA A;  4M6Y A;  4AVP A;  1IUY A;  5FLX Z;  2D2W A;  5LHI A;  4BAY A;  1Z91 A;  1SMT A;  1S7O A;  4FX0 A;  1FP1 D;  4LB6 B;  1SFE A;  1T39 A;  5D4R A;  1I1G A;  5D6E A;  5LGN A;  3ECO A;  2C6Y A;  5J8C A;  2DU9 A;  2HKX A;  2GXB A;  1FOK A;  2JRT A;  3NQO A;  4HX8 A;  1V4R A;  3CUO A;  1HW1 A;  3K2Z A;  3KP3 A;  1IW7 F;  3R6S A;  2FNA A;  1SFX A;  1KQ8 A;  3GFM A;  1H9G A;  4Y15 A;  3B02 A;  1O3R A;  1MKM A;  3I0T A;  4L0Z B;  4WXH A;  3L09 A;  3C18 A;  4LG0 B;  1W4M A;  1OMI A;  1B59 A;  2EFO A;  2DI3 A;  3KP2 A;  4RB3 C;  3RKY A;  1FLI A;  4WCG A;  1QBJ A;  2NAZ A;  3GZ6 A;  1WWX A;  3QAH A;  1GXP A;  2EV6 A;  2STT A;  4EJV A;  2H6C A;  1ULY A;  2DQL A;  5D8K B;  2HR3 A;  3KZZ A;  5E1X A;  3DKW A;  5DD8 A;  1R22 A;  2R3S A;  2PFB A;  2CW0 F;  3VFZ A;  2DO7 A;  4I0B A;  3F72 A;  2JPB A;  3ERE D;  3PFI A;  4G7O F;  3HHG A;  4HV6 A;  5LLQ A;  2DAO A;  1R23 A;  1SMY F;  3WTV C;  1JHH A;  2FBI A;  1BI0 A;  1R00 A;  4HZF A;  3BDD A;  2HOE A;  2A07 F;  1BIA A;  1IZ1 A;  4EM2 A;  3M8E A;  2H09 A;  3E6C C;  3WTS C;  3Q9S A;  4OIR F;  3M9A A;  4HF2 A;  4OU0 A;  3U2R A;  1ZGA A;  1P92 A;  2HYG D;  5ED4 A;  2AXL A;  4I02 A;  4G9Y A;  2YX4 A;  3MZY A;  5A2Q Z;  1ON2 A;  5FLX K;  1SAX A;  4LLG F;  2JT1 A;  1P2F A;  3ZN1 A;  2PMH A;  3CJN A;  3E6M A;  4HW0 A;  2NNY A;  2KIF A;  4OMZ A;  2XAJ A;  1ZRF A;  1I6X A;  1XCB A;  3SHF A;  2DPD A;  2UZK A;  3BPV A;  2QZ8 A;  4LFU A;  4LK0 F;  2OZ6 A;  3HIF A;  5HLH A;  2VT3 A;  4ENN A;  2ESH A;  1RIO H;  2J5P A;  1FSE A;  3F8F A;  5DCM B;  3WTT C;  3LAP A;  3E5X A;  1OPC A;  2G7H A;  2XKP A;  5ERI A;  4LG0 A;  1TQP A;  1LEB A;  4P96 A;  2EA2 A;  4NHJ A;  3L9F A;  3D0S A;  2Z3Y A;  3U9G A;  1UST A;  3ROU A;  1ZG3 A;  3HSF A;  1H0M A;  1U8R A;  4RGR A;  2Q2E A;  2O61 A;  5J6X A;  1YW9 A;  3QU3 A;  2W57 A;  1O3Q A;  1UHW A;  1Z7U A;  2XAG A;  1RUN A;  2L3D A;  1USS A;  2K4B A;  3WTU C;  1KYZ A;  1MZB A;  3JAM Z;  2HQR A;  2M30 A;  2IT0 A;  1IN4 A;  3C7J A;  3FX3 A;  1YIO A;  2XAF A;  4RGU A;  1DPR A;  2K7L A;  1J2X A;  2M1B A;  1DDN A;  3SZT A;  4B8X A;  2MH2 A;  3DPL C;  4QLC U;  4UHT A;  2DBB A;  1ZG5 A;  1G3S A;  1KYW A;  1TW2 A;  2VON A;  2GAU A;  1G3W A;  2O0Y A;  2A6E F;  5D8L B;  4OIQ F;  1ZRC A;  4FX4 A;  2WC2 A;  3ISP A;  4BHB A;  1J59 A;  4PCQ A;  4CHU A;  3L00 A;  4M72 A;  1YLF A;  5ICF A;  3H92 A;  1QNT A;  4AIK A;  1TNT A;  3LA7 A;  4IRI A;  4CXF A;  2VE9 A;  2VOO A;  1JE8 A;  1P4X A;  1TLH B;  2XKO A;  1BBY A;  4GCV A;  3FZV A;  2FOK A;  4EMS A;  1FBQ A;  1XGO A;  3TO7 A;  3HHH A;  1ZAO A;  4IXA A;  1EH8 A;  5CVI A;  3GFJ A;  1BI2 A;  4ESF A;  2BE5 F;  2CGP A;  2F5E A;  1R5H A;  2H6B A;  3R4K A;  4L9J A;  4O6J A;  5BS6 A;  4AIJ A;  5J8F A;  5L3D A;  3F3X A;  5ICG A;  4BHC A;  1D8K A;  1K6O A;  2PI0 A;  4LGW A;  3U1D A;  1BM9 A;  1RUO A;  4A5M A;  5AIQ A;  1ZN2 A;  3NEU A;  1F9N A;  2PEX A;  4HLY A;  5ICC A;  3RTR A;  3V8K A;  1V3F A;  4KFC A;  3ML6 A;  3ZMD A;  5K5O A;  4HQE A;  4UXN A;  1J75 A;  2EFN A;  3EYI A;  1YW8 A;  1JGS A;  1ZYR F;  1FT9 A;  4A0Y A;  2X4H A;  3LA2 A;  2IA2 A;  3QP6 A;  1BI1 A;  1SD5 A;  2HEO A;  1RNL A;  2NYX A;  1U5T B;  3RPQ A;  4Q47 A;  2GXG A;  5HLI A;  4U88 A;  3JSP A;  2FBK A;  2OU2 A;  4MGR A;  2TDX A;  3ZMT A;  5JVT A;  2LF7 A;  1XGN A;  2VOD A;  3I53 A;  4G94 A;  1MD0 A;  3K69 A;  2VC1 A;  4MTD A;  1ZG1 A;  1IN7 A;  5EEH A;  4IRH A;  4ZYH A;  1UHM A;  4F7Z A;  4R8H A;  3MAJ A;  1P4W A;  1KU3 A;  3KP5 A;  1VTN C;  3W6K B;  2E1N A;  4IJA A;  3VOE A;  5ICE A;  1O57 A;  4LLN A;  4L9T A;  3LWF A;  3HRM A;  2VBW A;  4I2O A;  4EVI A;  2RV8 A;  1LDK B;  2MH9 A;  2BYV E;  4QWQ A;  2A3S A;  3F8B A;  1O7L A;  1SD7 A;  1IF1 A;  5FB2 A;  1TBX A;  1I5Z A;  2QLZ A;  1XD7 A;  3DFG A;  5CLS A;  3F23 A;  4LB5 A;  3QPH A;  2A69 F;  3COA C;  3O6B B;  2PQ8 A;  2XAH A;  2OBP A;  5L3G A;  4CYD A;  4L18 B;  4P9U A;  3J81 K;  2IPQ X;  3K0L A;  3CUQ A;  5D6F A;  1Z9C A;  3H3U A;  2Y48 A;  2P5L C;  2YX7 A;  5FD6 A;  2KRF A;  4M6X A;  4GXO A;  3N97 A;  3K1P A;  5LHG A;  2P8T A;  4EJT A;  5E1W A;  4RGX A;  2VN2 A;  2FSW A;  3FM3 A;  1FBS A;  1KA8 A;  4B09 A;  4U0W A;  5FO5 A;  2EV0 A;  5L3B A;  4M74 A;  3J7A O;  5H6Q A;  1QPM A;  2CO5 A;  3BP8 A;  2HZT A;  4I7H A;  4RS8 A;  1WI9 A;  3E6B A;  2QQB A;  3BWG A;  2ZFW A;  1BC7 C;  4WF2 A;  3V8L A;  4ZZD A;  1I27 A;  1O3S A;  5H6R A;  2QEN A;  3GX4 X;  3WG9 A;  1R36 A;  3JW4 A;  5D5U B;  3CO6 C;  3KEQ A;  2EA4 A;  2E7X A;  4WXD A;  2DTR A;  4PGH A;  3WU1 B;  2O6G E;  3CDH A;  5CJ9 A;  1XSV A;  2DT5 A;  4HBL A;  4G6D A;  1ZGJ A;  1HKS A;  1T0F A;  5FFZ A;  3LA3 A;  3ZMU A;  3EYY A;  3V8J A;  5FFX A;  2PBI A;  3TQN A;  4I01 A;  2HFH A;  3JTG A;  2ACJ A;  3ZQ7 A;  2YU3 A;  2F5F A;  3I64 A;  1CF7 B;  1XMK A;  1D3Y A;  3BOQ A;  3EUH A;  1W5T A;  3P9K A;  3PQJ A;  3V7C A;  3F8C A;  1XB4 A;  4ZYG A;  2V1D A;  3HUG A;  3K1N A;  2AS5 F;  1MDM A;  4HOB A;  4R1H A;  5ILU A;  4G7H F;  1GVJ A;  2BGC A;  1B6A A;  2QQA A;  4LD5 A;  2P6S A;  3F22 A;  3GFL A;  3IWF A;  1HQC A;  3RIR A;  4WK8 F;  2QM3 A;  3SZP A;  1K7A A;  1ZH5 A;  1LNW A;  1YQA A;  2RVC A;  2VBY A;  1BC8 C;  2RQP A;  1LVA A;  2HS5 A;  5EEG A;  5K1Y A;  3LQR A;  2EFW A;  3SFZ A;  1U2W A;  4U7D A;  1UCR A;  2RC4 A;  1SD6 A;  2X0L A;  1CGP A;  1KQ9 A;  2IRF G;  6PAX A;  2FBH A;  1FPQ A;  4GO1 A;  3R60 A;  5JFR A;  4S04 A;  3MQ0 A;  3BY6 A;  2PMU A;  1TQI A;  5D5W B;  5HVQ C;  4XRF A;  2G7U A;  3B73 A;  4HV5 A;  2W85 A;  1T6S A;  1QZZ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...