2JA8J

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja8J00
3GTJJ 1JKPC 1AKHA 3CDLA 1ZR2A 3BR1A 3HM5A 3JRCA 1AU7A 3TEDA 2M9HA 1DU0A 4X6AJ 2E2JJ 2DMUA 3JRIA 3JRDA 1FTTA 3HEFA 4QTRA 3A01B 2M8GX 3F0CA 2HOAA 4A3DJ 4B4CA 3LOCA 1ITYA 3HOUJ 2YUSA 3ZQLA 3BQZA 1K83J 2DA7A 3IH3A 2WV1A 2LKXA 3CCYA 4BXXJ 3Q0UA 3PO3J 3QPLA 2YU9J 2EZHA 2D5VA 2X6OA 2XB0X 4B1RA 2LD5A 3LNQA 1ENHA 2COBA 4D5CA 3HOWJ 5DS9A 2K9SA 1PUFB 4MFEA 5K7ZA 5E3MA 3BTCA 1ETOA 4JX5A 4XIDA 3B6AA 2E2HJ 5EG0A 3UKGA 2QCOA 4XK4A 4XRMA 1H88C 3LSJA 2O9LA 4CYCA 2L9RA 2MW8A 4M3GA 2CRGA 4BKXA 3HOXJ 1ZGWA 2LTPA 2JA5J 1HDDC 3TP3A 3GTKJ 2ECCA 1JT0A 3BG5A 4HNVA 5C4JJ 2DN0A 3K2AA 1JUMA 5EF6A 5FLMJ 2JA6J 5K7HA 2CQQA 1TWHJ 2NS8A 1RKTA 5M3MJ 3JRGA 1GT0C 2LY9A 1MSEC 1YRNB 2DA2A 2FX0A 1X2NA 3S1NJ 4DYQA 2R7ZJ 2XSDC 1H89C 4C2MJ 1ORKA 4JYKA 5F27A 3S1RJ 5JLXA 1VNDA 1UG2A 2L7ZA 3L1PA 1ETYA 4BY7J 1ETWA 3A01A 4A3FJ 1IRZA 1RPWA 3JRBA 4DYCA 2CUFA 4UUTA 3BT9A 4FE7A 4C3IJ 2IAIA 3B6CA 2DMPA 2I10A 3TW7A 1X58A 3BTLA 1VF9A 1BW6A 1Q1VA 4M3FA 1ETKA 1WI3A 1PUFA 1APLC 5M5WJ 5IOYA 3Q0VA 3VPRA 4DW6A 5EGOB 1IC8A 4IHVA 3ZQFA 1S7EA 5F0FA 3GTGJ 4W1UA 5GPAA 1SFOJ 1HF0A 2H8RA 1MBJA 1XC5A 1JJ8C 3BTJA 4M6VA 4AC0A 3S2DJ 2DMTA 5JLWA 1W0UA 4IHWA 2E19A 3BR6A 4EEFG 5IP7J 1DU6A 4DYRA 5E3NA 2YS9A 3OOUA 2XPVA 3BG9A 4JX6A 1MNMC 1RETA 2M34A 1JKOC 2ME0A 3Q0WA 3OSFA 2ID3A 2E1OA 2JA8J 4BBSJ 2LLKA 1VFCA 2XRLA 3D1NI 1D5YA 4X1EA 4BBRJ 3G1LA 5F1JA 1IG7A 3FK7A 2DA4A 2P81A 1BL0A 3Q3SA 2HQ5A 1GVDA 1JTYA 3QQAA 1LE8A 2JN6A 3M4OJ 1OJLA 4FISA 3ZQHA 2L7FP 2XB5A 2VKVA 5IP6A 1MH4A 3GTPJ 3BR0A 2MGQA 2CU7A 5FKOA 1Y1WJ 5C3EJ 2N8GA 2LR8A 4M3BA 3S14J 4S0HB 2KT0A 5FKKA 2O8KA 1WGXA 5EGOA 3HDDA 3E7LA 5F0CA 3G1OA 5F0HA 1U8BA 3IH4A 1IDZA 2QF7A 4NDLA 5IPAA 2CQXA 1IGNA 4A3MJ 3GTQJ 1TWGJ 2E2IJ 1TWAJ 1B72B 2XGCA 1MBHA 1Y1VJ 2JJ7A 2K9NA 1NK2P 2HOSA 1ZTRA 1CQTA 3QPSA 9ANTA 1HDPA 2M0CA 3HGGA 3DEWA 1MBFA 3OIOA 4C3HJ 4QIWN 1ZQ3P 1GV2A 4A3GJ 1FTZA 3HBLA 5HODA 4MLOA 2K9QA 3GBGA 3MN2A 4RDUA 3LSRA 3HOYJ 3LSPA 3MVPA 2ZB9A 1IUFA 5FJ8J 2DA5A 1GV5A 2AHQA 1BJZA 2OF7A 5M5XJ 1ETQA 4MIMA 5F04A 2R5YA 2DMNA 2DTZA 1I3QJ 3S16J 2XGDA 2DMQA 2LP0A 1T33A 1JUPA 5E3OA 3K7AJ 4Y52J 2VKEA 2WAQN 5C44J 5FLVA 2GLOA 1RKWA 1X2MA 1LE8B 1JGGA 2HOTA 3RKQA 2MG4A 1ETVA 5EZGA 1UMQA 2Y31A 1B8IB 1JKRC 5BNGA 5IP9J 2NVTJ 3PO2J 3S1QJ 2HDDA 3ZOBA 3S1MJ 5IYDJ 1MBEA 2PMZN 2TCTA 4BY1J 1ZK8A 2NS7A 1W0TA 3W6VA 3S2HJ 1QVTA 2Y2ZA 2X9DA 2X48A 5EEAA 5J1UA 4A3IJ 1B72A 1TWCJ 1H8AC 2O7OA 3OSGA 1IV6A 3SJMA 2LK2A 4FE4A 5C4XJ 2FQ4A 1A6IA 2R0QC 2VI6A 2EBIA 1A5JA 3FKIJ 2NVXJ 3JRAA 2IBDA 1R9TJ 1P7JA 1IJWC 3DCFA 4A3CJ 3BR2A 2ID6A 2GBYA 4G12A 1NK3P 1WCMJ 1XG1A 2HYJA 1JJ6C 1HOMA 2CJJA 4IEJA 3GTMJ 3FK6A 2EZKA 5IOZA 1RESA 2M2EA 4A3JJ 4L5EA 5J3LA 1UHSA 3TW6A 2XPWA 1JKQC 1LFUP 2H1KA 4A69C 2AO9A 2CUEA 3JREA 1OFCX 4UUSB 1MH3A 3C2BA 4JP0A 2XPUA 1WPKA 2R5YB 1ETXA 2NVQJ 4A93J 1GUUA 2MSYA 1U9NA 3HB9A 5GP9A 1OCTC 3HGYA 3TP0A 1B8IA 3IV5A 5J1RA 1OCPA 4XICA 3FISA 4A3EJ 1I6HJ 3S15J 3JRFA 1I50J 1FIAA 1RR7A 2FJ1A 1JT6A 2B63J 2RAEA 1T56A 4JX4A 2R5ZB 1Z77A 5FKLA 5EZHA 3NAUA 3ZQIA 4Y7NJ 5IYCJ 1G2HA 3LSGA 2K40A 2JMWA 4IHXA 2XGEA 4D7NA 3PM1A 4B3AA 5M5YJ 1ZR4A 5FKMA 3BQYA 1NTCA 5FKNA 3JR9A 4C3JJ 2JK3A 3S17J 1HLVA 2LVSA 5F08A 1AHDP 4IHYA 4I6ZA 2NOGA 3H3VK 1F43A 1FEXA 3BG3A 1POGA 1JUSA 2EZLA 4UUSA 2DA1A 3HOZJ 2L0KA 1QPIA 1JTXA 1F36A 4DZJA 2Y9YA 2DA3A 4AYBN 2WB1N 1FIPA 4A3LJ 1QVUA 1WH5A 3SDGA 5EDNA 2VPRA 2KDZA 3ZQGA 2FD5A 3NARA 2GM4A 2IEKA 1K61A 1FJLA 3HOVJ 1MBGA 2JA7J 3I4MJ 1ZKGA 3CQZJ 5IYBJ 1TWFJ 1E3OC 1TC3C 5EYRA 4FCYA 3MKLA 2OPTA 4J19A 3FIWA 2HXIA 2L7MP 1MSFC 5GPCA 2Y30A 1VI0A 4A3BJ 2TRTA 1WH7A 2R5ZA 2HI3A 2JWTA 1XS9A 1AKHB 4ABZA 4M3DA 4AUXA 2R93J 5DTDA 2Y9ZA 3RQIA 4XRSA 5K7FA 2NVYJ 4D5FA 4DZPA 2EH3A 1LFBA 2ELKA 1P7IA 3JRHA 1IDYA 2W48A 3M3YJ 1MBKA 3WHCA 1BW5A 3CMYA 2DA6A 4GFBA 3HKZN 2Y0SN 4A3KJ 1GDTA 4MFDA 3ZQCA 3A03A 4RBOA 3WHBA 4V2FA 3IH2A 4I76A 3I4NJ 2VUMJ 2DJNA 5E3LA 2ME6A 4QSHA 4M3EA 2EQRA 1SANA 1QRYA 3RZOJ 1BA5A 5M3FJ 4W97A 2ECBA 3H0GJ 5EG0B 1U78A 1O4XA 1HCRA 4FTHA 4CYCB 3BR5A 1EF4A 4V2GA 4D7MA 3A02A 3RZDJ 1U9OA 4LOCA 1YRNA 3GTOJ 3O8GA 4MO7A 4XRSG 3O8HA 2R92J 3GTLJ 2EZIA 5J1YA 3BTIA 3G1MA 3SFIA 1Z0XA 2G0EA 2LFBA 3BR3A 2HXOA
chains in the Genus database with same CATH superfamily
4OIPF 3V42A 4MHGA 1KZHA 3HL2A 1T98A 3CCUI 3CDLA 1ZR2A 1VQOI 3O6BB 3TEDA 2M9HA 3HUGB 2DMUA 1ZN2A 2R7QA 3JRIA 3JSPA 4BJTA 2XC7A 3K69A 1G3YA 3A01B 5FRMA 4KICA 1VZ0A 1X19A 2FF4A 4A3DJ 3WTYC 5E1WA 3J7AY 1ITYA 1X1DA 1WSUA 1LJ9A 2HR3A 3BQZA 2DA7A 3IH3A 3CJTB 4GXOA 2WV1A 1BI2A 1ZELA 3BCBA 1U6GA 3CCYA 3F8CA 4A0XA 4A0ZA 2KIQA 1HBXG 2STWA 4HG2A 5J4YA 1FMVA 2YU9J 1Z1DA 1QQIA 5TRDA 4D5CA 2EILH 2RREA 4CCOA 3ASOH 3JTHA 4MFEA 2PLYA 2KLOA 4BE1A 2AXTC 3BTCA 1BR1A 4XIDA 1LVKA 2P6TA 2CUZA 3F8FA 5BOXA 3UKGA 2O03A 4BH9A 2QCOA 1LPQA 1H88C 2O9LA 4AIKA 1FOXA 1WJDA 4XLEA 4S05A 2CRGA 3HOXJ 1ZGWA 2LTPA 1HDDC 3TP3A 2KIMA 3GTKJ 2ECCA 2F5DA 3ABUA 4DGWB 2DN0A 2MLGA 2R7DA 3KPHA 2EV6A 2JA6J 2JUCA 3HG9A 1TWHJ 4BQQA 3OYAA 3WG9A 2AS5F 4MQVA 2V26A 3A0HC 4HW0A 5BMZA 1MSEC 1X2NA 3VFZA 2P5VA 3DPUA 4DYQA 1TLHB 5JI6A 1ZRDA 1H89C 4E7SA 2H1LA 4XKCA 1ORKA 1VQKI 2FQ3A 2DYRH 5JLXA 2OQGA 4U0YA 5H6QA 3W3CA 3HUGA 1BOBA 1CF7B 1R71A 4M74A 5HDKA 3CC2I 2CG4A 3ELKA 3K1MA 4BY7J 3A01A 1IRZA 2QQBA 3JRBA 2KPMA 4DYCA 2CUFA 4UUTA 4A5NA 4C3IJ 2IGNA 2R7XA 3B6CA 3JTGA 4HPQA 4NC7A 2Z1DA 3FXMA 3E6BA 4U87A 5B1AH 3BTLA 2YPRA 4ESJA 4MQ9F 3DTKA 1VF9A 1BW6A 1Q1VA 2H6CA 1QZYA 2XAFA 3HTUA 1APLC 5M5WJ 2VBWA 1XTAA 3VPRA 1KU2A 5KCMA 1SVLA 2A3SA 5EGOB 4IHVA 3ZQFA 2VL8A 4RB1A 3GXOA 5D5WB 3F22A 1XGOA 1MBJA 1R49A 4NUBA 5F64A 1JJ8C 3ZQQA 3SYTA 3WODF 3AG1H 4C2UA 3BR6A 2EIKH 4I7HA 2QA4I 2HOEA 1EV7A 1ZREA 2YS9A 2KRCA 3DV8A 3I58A 4GYGA 1JKOC 2XIGA 3REOA 5KHDA 2AQFA 2K02A 3HSRA 3CUQA 3I55I 3KYCB 1VQ6I 4HQEA 2FUG2 5DYMA 1IF1A 2JQ7A 1CF7A 1ZARA 2CQ7A 3DKXA 4BBSJ 1SMTA 2VT2A 3OY9A 2MLKA 4X1EA 4ENJA 4CCMA 5JVTA 1OYYA 2KMUA 2OAZA 1IG7A 1XSXA 4KIFA 1I6XA 3FK7A 1MJBA 1BL0A 5GADJ 1A31A 3H5NA 3K9TA 3ZR8X 3M4OJ 3WTUC 3BLYA 3ZQHA 4JBAA 1S7AA 2QLZA 2X1EA 1M1EB 1Z7LA 2LMDA 1GLNA 2XB5A 5K5QA 1R5ID 4KMFA 1Q1HA 2CU7A 3QODA 2MBFA 5FFXA 2NXNB 5C3EJ 3WGIA 2N8GA 1A04A 3K4NA 3CC4I 2DK5A 2L3DA 3BJ6A 4BHBA 1QNTA 3IC7A 1PDNC 4NC6A 5EGOA 1BN5A 1XGSA 3E7LA 2HPMA 1U8BA 3IH4A 1MMSA 2F4MB 2NYXA 1T95A 2PEXA 4CCLA 3RYRA 3LSTA 4XLAA 5IPAA 5GTIC 4A3MJ 4B48A 1TWGJ 1V54H 2K86A 2XASA 4NC8A 1FOYA 2L4MA 4U0WA 2MFZA 2JJ7A 3MKYB 1MMGA 1QU3A 2LKPA 1Z6RA 1CQTA 3CDIA 5IT9Z 1A6QA 2FOWA 4IXAA 2RQPA 2M0CA 4H4KC 1FOWA 1ZQ3P 4QIWN 1OYWA 2BXZA 4BEHB 4A2UA 2L4AA 4ON0A 2OZUA 4OINF 4ETSA 3MN2A 3T8TA 2HTSA 2WWYA 4XKBA 3IL2A 3LSPA 2DOEA 1FBUA 4CA0A 2P5LC 2EV5A 2PFBA 1ZRFA 1BJZA 3KETA 1BM9A 5FGMA 2UV1A 1X3UA 3H3UA 3J80K 3IAM2 5ED4A 5ICEA 1ETQA 4PJJA 5H6RA 2DMNA 1I3QJ 5FLXK 3S16J 1WKMA 3BWGA 3T5XA 1T33A 1JUPA 4XQFA 3P5JA 4N4NB 3F8NA 2VKEA 5C44J 3GX4X 1B9NA 3F6VA 2GLOA 4BNCA 2BEOA 4PJLA 1LE8B 3S3OA 1JGGA 4KDPA 1ZAOA 3RKQA 4HNUA 4FQGA 5AIPA 1YLFA 2H8WA 3VWBA 4NB5A 3HRMA 1UMQA 1G8XA 5K5OA 1B8IB 2E1MB 3PO2J 3S1QJ 1W1WE 3EPZA 3ZOBA 3S1MJ 4ZYAA 4LK1F 4BXFA 2V9PA 1W0TA 4HV5A 2ICWG 2X1DA 1QVTA 3H1CA 4A3IJ 5E8IA 3K4BA 1H8AC 1IV6A 2JT1A 4IPAA 2R3SA 1T2KA 3DEUA 1ZG1A 4U88A 1A6IA 1R1VA 3KEOA 4HF0A 3SHFA 1IUYA 3PSIA 2B0LA 4BEHA 4IRIA 2ADUA 5HLTA 3A4CA 3K4KA 3DCFA 3QOPA 4M9SA 3KYDB 2ID6A 2VQLA 2QKLB 3SZPA 3PNYA 1WCMJ 1Z3XA 3BY6A 1KU3A 2EINH 3FHNA 1ONVA 3MFKA 4EGZA 2LC2A 2AXLA 1L0OC 2KFDA 2E1MC 3ONQA 2X4HA 3D5SC 3TW6A 3QAHA 4IF4A 3AL0B 2CSOA 2OCEA 5CQGA 2H1KA 2G7HA 2CUEA 3JREA 1OFCX 4UUSB 2E36A 5CVUA 2R7UA 1VQ5I 4M71A 4LLLA 2JTVA 1SFEA 4UVAA 3MZHA 2M8EA 3Q9VA 1OQYA 3HIFA 2HZTA 3R61A 1U9NA 5TGTA 5HVQC 5GP9A 2QSFX 3HGYA 3K1NA 1R6RA 3TP0A 4BQNA 1B8IA 2BVMA 1OCPA 2IS1A 2QKMB 2K4BA 3FKJA 4CH7A 1K7AA 1MKMA 3NQOA 3S93A 2YR2A 3CD6I 4RMNA 2FJ1A 4UVBA 1JT6A 2EB7A 1S5LC 2B63J 4XKVA 1XMXA 4RB3C 5F6FA 3VDXA 2R7VA 4EJUA 2A61A 4UB8C 2GXAA 1S3JA 1Z77A 1T0FC 5EZHA 4UXNA 2CW0F 2EIMH 2L5QA 2UXXA 3RJPA 4EV0A 1B59A 2DCEA 5FO5A 4F91B 5IYCJ 1G2HA 5E1ZB 2JMWA 4IHXA 4L0ZB 1KQ8A 1MMAA 2YU3A 5M5YJ 3TKYA 4BS9A 1ZRCA 4RM3A 4F92B 2LNBA 2RNGA 2VT3A 2QZ8A 1MZBA 1AHDP 4IHYA 2XF7A 3SZTA 3N4MA 3M07A 2HVSA 3L2RA 1Z05A 3OS0A 1XGNA 1T0FA 2BVLA 3I4PA 3P9IA 4BYYA 4AVPA 1J09A 3NWSA 1ON2A 4IO9F 1E17A 4XSXF 2OBPA 1R4MB 2MABA 3FBNB 1O3TA 2EZLA 2HYGD 4UUSA 2VJ5A 4KITB 3I53A 4MNUA 2L0KA 1QPIA 1JTXA 1F36A 3S2WA 2Y9YA 4AYBN 5DDGA 2ZKZA 2W25A 4A3LJ 3OYLA 3V7SA 3GFJA 4P55A 5TISC 3FWEA 1ACIA 4OAYA 2LF7A 2FD5A 1MBGA 5ILVA 3I4MJ 3CQZJ 3CCVI 5HLGA 1E3OC 1TC3C 3JW4A 2IXSA 4E70A 4FCYA 2OPTA 1MSFC 3FMRA 3FDYA 1NH3A 2WTEA 2HI3A 1UHMA 2DFFA 5DTDA 1BIBA 1FP2A 2NVYJ 2DYSH 3I64A 2A6EF 3L7WA 5DEQA 4Z2YA 5E18F 1MW7A 1QZZA 3JRHA 1JE8A 2W48A 4YFNF 1MBKA 3MCZA 3CMYA 2CMPA 5L3FA 4LFUA 4KT5C 2V1UA 5DD8A 4MFDA 3L2WA 2ETHA 3A03A 1XDUA 1PUEE 3CCMI 4FT8A 2X1CA 4I76A 3I4NJ 1YO5C 2HPIA 3CUOA 5E3LA 4ZTJA 3OOPA 1MNDA 2F4IA 2LRDA 3QYEA 4M3EA 2QQ9A 3VYUB 3E5UA 1PP7U 1SANA 2CQNA 3VODA 4Y13A 3RZOJ 1BA5A 2BY2A 4EJVA 2ECBA 3H0GJ 3VSKA 5EG0B 1XN7A 2DTRA 3NEUA 1HCRA 2JUGA 1YQAA 3CTAA 4HNTA 1GXPA 1LKXA 3BR5A 1EF4A 2A6TA 2HZDA 1WVRA 2IRFG 3J7AO 1ZGAA 3H92A 3DEEA 2XV4S 3L2QA 1DQUA 2HQRA 2K9MA 4MO7A 1WI9A 3RDIA 1R22A 2R92J 1Z21A 2K85A 2EZIA 4HEA2 4HV6A 4HYEA 2A5YB 3LMMA 4O5VA 2BY0A 3G1MA 1RIOH 2PMUA 1TNTA 2LFBA 2QSGX 3SQNA 3IHUA 2FMYA 2DOAA 5CLSA 2KIFA 3HM5A 3JRCA 3H5AA 1DP7P 2WC2A 1ZG5A 3GZNB 3C18A 1IN6A 2GQQA 3PUFA 5DV5A 4B09A 5LHGA 4L9NA 4QTRA 1D0ZA 2M8GX 1S9HA 4CHUA 3GLLA 4B4CA 2XAJA 2ZJ2A 4I98B 3QOEA 4Y15A 2YUSA 2EPFA 2MYSA 2VKHA 2IGKA 2NAZA 4ZZLA 1DGWY 2FBHA 2LKXA 2FNPA 4BXXJ 3V8KA 3QPLA 5KVRA 1SVMA 2X6OA 2E34A 5LHHA 4B1RA 4J01A 1WJ5A 2XSJC 4HSRA 2ZNZA 3HOWJ 4I0BA 2Y69H 1LNWA 1A36A 2R7RA 2WY7Q 3CLOA 3BPVA 1XSVA 1B4AA 4JX5A 3F23A 5A2QZ 3B6AA 1X1CA 2ZNYA 5EG0A 1SFUA 3KFWX 4XK4A 2L9SA 4F7ZA 3CJNA 3LSJA 2ZMEB 4M6XA 2L9RA 2BW3A 4UB6C 1ZHFA 2JSPA 1J2XA 4HQMA 3MZYA 4M3GA 2NVUB 1WJFA 3VB2A 4BKXA 2BY3A 2XAGA 3BG5A 1WRJA 4KUMA 4HNVA 4WCGA 5C4JJ 5EF6A 4WK8F 2UXNA 5B66C 1RKTA 1S8NA 3Q5FA 5M3MJ 2GWRA 2RV8A 1BBYA 3S1NJ 1MJAA 3OIPA 1LQ1A 2R7ZJ 4YELA 2XHKA 1IXCA 2JPCA 3KP3A 4JYKA 2A68F 3DBLB 5F27A 2CGPA 2HQNA 2FXAA 2PJPA 2V4JC 4QPOA 2DODA 1CGPA 1VNDA 3TMOA 2MA3A 1S6LA 3M8FA 2G9WA 4YG2F 4A3FJ 1MMNA 3ABKH 2VJ4A 1R1TA 3BOQA 2P0WA 2P4WA 2K9LA 4WXDA 2DMPA 1T38A 3C2HA 2ZMEC 4LGWA 3FMSA 4IRGA 4FX0A 1N75A 4BDYA 4M3FA 4WX9A 1WI3A 1UAAA 2STTA 5IOYA 3ULQB 2M4GA 2RN7A 2IW5A 4KIGA 1FOKA 3KZZA 1IC8A 3ECOA 4DNCA 1KYWA 4M9XA 5F0FA 1AWCA 4PJ0C 3UNGC 2PI0A 4G7OF 3IP4B 2ZMEA 1X1BA 1R23A 1IRFA 4PCQA 3BTJA 1I1SA 3HJEA 2CQKA 4LB5A 1IN4A 4KIBA 1UG0A 2HKXA 5E3NA 2QEXI 2KQRA 2IJLA 3ABTA 5LHIA 1QBJA 4L5IA 2P6SA 2OTLI 2E60A 3MWMA 4JX6A 1Y8RB 3AG2H 2DFEA 2QQAA 2ME0A 3Q0WA 5EJCA 4E7ZA 1Z7UA 3EUHC 5D5XB 3WU1B 2OC6A 1F5TA 4DOZA 2V6CA 3ZMZA 1FWZA 4OU0A 1R00A 2JA8J 3RCOA 2LLKA 5E79C 2VE8A 5F1JA 1TTYA 3WTWC 2DA4A 2J5OA 3ISPA 1YIOA 3Q3SA 4PGGA 1RZ4A 2OU2A 1OJLA 4FISA 4YIFA 1WZ2A 4E6KG 2F5EA 4EMSA 2Y48A 3EUHA 1FSHA 2M7AA 3E0JB 1K4SA 1YI2I 3KEYA 4KFCA 2HU9A 1OCCH 2NNNA 2KZVA 4TV7A 4S0HB 2O8KA 3R6SA 4Y4RA 3J7YJ 2RQQA 4ITVA 1WHUA 2M3AA 2IA1A 3ZN1A 1WQ2A 4CSWA 5F0CA 5F0HA 4HF1A 1KA8A 4P1WA 1H9TA 2CW7A 2DDAA 4YIRX 2QF7A 4NDLA 4XMYA 5HLIA 2O61A 5KAIC 2ISZA 3SFZA 1IGNA 4OIOF 3GTQJ 2OV7A 3BP8A 1TW2A 1W7PD 2F2EA 1EH7A 4U7BA 1LDJA 2XGCA 1MBHA 4BAYA 4A6DA 2K9NA 3QPSA 1XMKA 3DEWA 4C3HJ 4E4HA 2JRMA 1FTZA 1ZGJA 1Z6TA 5FRNA 1ON1A 2KP6A 3QPTA 3U1KA 2VLAA 4IHSA 3MVPA 4AIDA 2DA5A 2AHQA 2E35A 1UCRA 4IHTA 2VOPA 4EGYA 2V1NA 1YTYA 3CUQB 1V5FA 2LY2A 2QYOA 3HOTA 4D1QA 2DMQA 1P9QC 3PQKA 1WJEA 1X4OA 4M72A 4Y52J 3FXJA 3A1YA 1B6AA 1FX7A 5AONA 4HA8A 2WY8Q 3CLQA 5DCFA 3EETA 1PYVA 2VASA 2MG4A 4HLXA 5L3EA 1ETVA 5EZGA 2WAQA 1XDSA 3CMEI 2Y31A 1XCVA 1B9MA 4HDUA 2HDDA 2E7WA 1F4KA 2HVQA 5IYDJ 4BE2A 1MBEA 2PMZN 4BY1J 4LG3A 2NS7A 3W6VA 3HTSB 5E1XA 3ZXSA 2GOMA 2X9DA 2X48A 3UR3C 3L2UA 1RNLA 2M87A 2IT0A 1KQ9A 4KMUX 3LAPA 1FLIA 3IWZA 3SJMA 2LK2A 2V7FA 3CUQC 2M45A 3F8BA 5LGTA 2NVXJ 3JRAA 3T1BA 3HHGA 2ZO4A 2GA2A 1P7JA 2CUJA 1U0JA 1DUXC 1J59A 4P9FA 2HQAA 1LEAA 4A3CJ 3JCUC 5HLHA 2GBYA 3HRUA 1NK3P 1XG1A 1G6NA 2L7KA 2CWEA 2XDVA 3QYBA 5IT9K 3CZ6A 5LBQA 4EJTA 1TW3A 5J47A 2M2EA 2OJED 4L5EA 1OLTA 1REPC 3B73A 3BJOA 3LWFA 3R4KA 4HDVA 1JKQC 2BYVE 3SZGA 2AO9A 4EQQA 2Z9OA 1YITI 2K3PA 5B5EC 4WXHA 1QHGA 4JP0A 3PNVA 2IPQX 1LEBA 4IQ4A 1ETXA 3S3MA 2NVQJ 4A93J 4I09A 3ZMUA 3L00A 4R79A 2IP2A 3LAJA 1O3SA 2ZSIB 4R8HA 4XICA 4E7HA 3ABMH 3DP7A 2DU9A 1LDDA 3CP2A 1I6HJ 3KE2A 2X6WA 1RR7A 1FIAA 1WJAA 2DAOA 4XONA 4ZYGA 1USTA 1W7PB 2MH2A 3LA7A 2Z33A 1KONA 4XN0A 3GEZA 3I9V2 4ZYDA 2R5ZB 5LEJA 5FKLA 1A35A 3H0DA 4Y7NJ 1WJBA 2FEZA 3GYHX 1T8IA 5E17F 3LSGA 4BJ5C 3PQJA 1QHHD 4D7NA 5ILSA 2BZTA 5BPIA 4B3AA 3BQYA 5E20A 3OR2C 1NTCA 3LA3A 2A6HF 4GRIA 5FKNA 3LL7A 2JK3A 3S17J 1HLVA 2LVSA 1TP4A 3KEQA 2I8DA 5F08A 3WTZA 2VJIA 4I6ZA 1D1AA 2HNHA 5L3DA 2NOGA 4Q48A 4XLHA 4RAGA 3L09A 4XL9A 5L3CA 4I02A 4IZZA 2E71A 2NNYA 3AG3H 1JUSA 2CFOA 3WG7H 3TO7A 1LFPA 3CCLI 1YW8A 3O2PE 3HOZJ 3V8JA 4ZH4F 4RAYA 2W4SA 1FY7A 2JVGA 2WB1N 4JK1X 1S72I 3OWTA 1WH5A 3RPQA 4LLGF 3S8PA 3FXUA 3SDGA 2HTJA 4BACA 4XLNF 2QVOA 2VPRA 2VQHA 4BGDA 3TDZC 1ULYA 3IRRA 1K61A 1FJLA 3A2KA 2GIVA 1T39A 3OL4A 1G3WA 2JA7J 3PSFA 3ZMVA 5EYRA 4Y3OA 1FBQA 1Y6IA 5LEKA 2DDBA 1W7PA 2ESNA 2HXIA 2L7MP 3FIWA 2Y30A 3ZGKA 1VI0A 1R7JA 4EJWA 4F55A 4C2TA 1IXRC 2K7LA 2R5ZA 1AKHB 2Y9ZA 4D0PA 3RQIA 2OTJI 5K7FA 2V1XA 4RGUA 2D1VA 1YW9A 2UUZA 4XNFA 4BL0B 1NG7A 2BGCA 2ELKA 4IVNA 1IDYA 2LYCA 1IZ1A 1P2FA 2WADA 1FYLA 1BW5A 2DO7A 5TJJA 3EYIA 3S3NA 2DA6A 3T0YA 1DPRA 3HKZN 2Y0SN 4YRVA 4A3KJ 1GDTA 4RBOA 2W1OA 2DFIA 2DI3A 5J8FA 2DJNA 2NRAC 2AQEA 3I3LA 4QSHA 3OL3A 2EQRA 2K27A 2K3FA 4HOBA 3KIOA 3ZN0A 4EJOA 1HQCA 3TOAA 3J81Z 1I1GA 5BQTA 1MGTA 4KNYA 2PBIA 4OIQF 2BV6A 2A05A 1F1ZA 2DT7B 2VXDA 4D7MA 2KHMA 4A6EA 1YRNA 3GTOJ 1OMIA 2E1NA 1FYMA 2L01A 2EFOA 3F72A 2VJJA 2LREA 2DK8A 2Z3YA 2Q8KA 1KGSA 3BTIA 1J9IA 2Z5UA 2VBXA 2XKPA 1Z0XA 2G0EA 3SDBA 3SFIA 2IA0A 1UZCA 2HWVA 4DQ2A 1FNNA 4L9JA 2M1BA 1YOVB 1VQ9I 4AM3A 1JKPC 4E7LA 2XROA 3IKTA 1AKHA 1OISA 1JXSA 3BR1A 4UY8I 2E2JJ 1HW5A 3HHHA 4CCKA 4WF2A 3F0CA 1SD7A 2EA4A 3AL0C 1IXSB 1XGMA 3LOCA 4PSWA 6PAXA 4M6YA 3HOUJ 3ZQLA 1K83J 2XAQA 3KLNA 1FT9A 3RIRA 2COMA 3M1EA 3Q0UA 3PO3J 3BZCA 2EZHA 2D5VA 2XB0X 5J40A 2CS3A 1EH6A 4RB2C 2DBBA 1ENHA 3LNQA 4WWCA 2K9SA 1LVAA 5D6FA 5K7ZA 2P8TA 5E3MA 1ETOA 3MD2A 1AOYA 1ZLJA 4IOCF 5ICCA 3LFUA 2E2HJ 4XRMA 4LLNA 4DBQA 2P5KA 4QWQA 1R58A 2MW8A 3F9KA 4B3XA 4EM2A 1RR8C 1VQ7I 1SD5A 2CO5A 2XAUA 1JT0A 3TQNA 5CVRA 1R1UA 1YW7A 1V55H 3K2AA 2W00A 3TBIA 2CQQA 3HRSA 2D1HA 2NS8A 3I5UA 5B1BH 3H9GA 3SEZA 4PFPA 2B7EA 3JRGA 2GXGA 2LY9A 2VB6A 2DA2A 3DPLC 3CCJI 1MDMB 3ECHA 3F8MA 2FU4A 5IY5H 1KU9A 1DDNA 2NOJB 1AA7A 4M9ZA 1HKTA 3OV8A 1SAXA 3U1DA 4OMZA 1B1BA 1HKQA 3QU3A 1TQPA 5CPRB 3WU0A 1ZH5A 1ETWA 4G94A 2GXBA 3BT9A 4FE7A 5HNHA 3V7CA 2IAIA 4CGZA 1MIJA 1YX3A 2KJBA 2W57A 1Y56A 1KU7A 4IQJA 3CMMA 2ZJQF 3FMQA 1ZLKA 4UVCA 3EYYA 2FA5A 2MC3A 3FBIB 1FZPB 4L9VA 2Y0MA 4PDKA 3G71I 4DW6A 3K70D 1YJNI 1S7EA 4W1UA 3D0SA 1BJAA 3EUKL 5GPAA 1SFOJ 3VOEA 1HF0A 2H8RA 2NS0A 2PMZA 3HSFA 2ELJA 3HYIA 3OYKA 4QLCU 4LG0B 2R7TA 3S2DJ 2E7XA 2MH9A 5JLWA 1W0UA 1D3YA 1QO0D 4IHWA 2HGCA 4EEFG 3QP6A 2WBMA 5A2QK 2BW3B 4DYRA 2UZKA 2EA2A 5D4SA 3DPTA 5B3SH 2D45A 1WJCA 2XPVA 3BG9A 5GTHC 4YFXF 1MNMC 1MDMA 3CP8A 3P9CA 1TBXA 2HEOA 2X6YA 3I56I 3QYFA 2VOOA 3MKWB 4G6TB 5FFZA 5BS6A 2A07F 1SVOA 2WA0A 4UUVA 4L9TA 4E7KA 3M7GA 2MD5A 2E1OA 3HZJA 2XRLA 3K0LA 2YSRA 1D5YA 1HSTA 1I3AA 3VYTB 2FBKA 1GVDA 3QQAA 3OYGA 3GW2A 1N78A 1BR2A 3CMAI 5IP6A 1MH4A 1V4RA 1WWXA 5D8LB 4U7DA 3GTPJ 3BR0A 5HDGA 4C30A 1Y1WJ 2KIUA 4AD9A 3TDUC 1FPQA 1TT5B 3FXQA 3OYBA 2LR8A 2CYYA 2WAFA 3S14J 2KT0A 2EK5A 4RLFA 1WGXA 1YS6A 2A69F 3S32A 4ASNA 4OMYA 4ZYEA 5EEHA 2E5NA 2YX7A 1IDZA 4GYIA 3AKZA 2ESHA 2FBIA 4LG0A 5LRRA 4A12A 1WFXA 4G8XA 4BXUA 4L18B 1K79A 5CVIA 1Y1VJ 2XF5A 3BCAA 3CF5F 3PNTA 2HOSA 3MMYB 1P92A 3QU6A 1HDPA 4HX7A 2Z2SB 5CVVA 1RI7A 1X3WB 3KP4A 4A3GJ 1MBFA 3GZ5A 3OIOA 4ZDOA 1GV2A 2OUMA 3CJQB 2QGUA 2ZBKA 4A5MA 3HBLA 2K9QA 4LMYA 3LSRA 1OYIA 2O6GE 1PJRA 5HOOA 2KJCA 2ZB9A 1LB2A 1GV5A 1KYZA 2W24A 3ZMSA 1IRGA 3NWTA 2QBYA 3V4GA 3CO6C 1YE9A 2LBFB 1NHAA 3PIPF 4MIMA 4G6DA 3OS2A 2R5YA 1OKRA 3T8RA 4N4OB 1LDKB 2XGDA 2LP0A 2CV2A 3H9JA 3LQQA 5H2FC 5E3OA 3TO6A 3K7AJ 1I27A 4OAZA 5DCMB 3C7JA 1GXQA 3K4CA 1RKWA 1W36D 2HOTA 1IW7F 2WB1A 3KZIC 4IRHA 4EATA 3BPXA 5HDNA 4AIJA 1VQPI 4CDGA 1O3QA 2CV0A 3BDDA 1SFXA 3G3ZA 2GOXB 3FX3A 1XCBA 5BNGA 2V9KA 3GZ6A 2PMHA 4ZJZA 1DGRM 1XPXA 2R4GA 3CO7C 2TCTA 2FRHA 2Y2ZA 5EEAA 2H94A 2WV0A 1TWCJ 3OSGA 4HRIA 2LKSA 2ZXJA 2XVCA 2FSWA 4FE4A 4B8XA 5C4XJ 2M0MA 2I5UA 2DFHA 4XOPA 1T6SA 2VBZA 5FROA 3KP7A 2F6CA 3FKIJ 3ML6A 3FXKA 4RA2A 5L3GA 1O7LA 4ESFA 1ERDA 4GGGA 3RTRA 2HDWA 2CH0A 3HKZA 2Y0SA 3ZCOA 5ICGA 3FHZA 1R5GA 1J7KA 3ZP5A 1KQ0A 3HPGA 3H35A 2CJJA 1X1PA 2W85A 4IEJA 3FK6A 2EZKA 2LBFA 5IOZA 3K70C 4CCNA 5J3LA 2Z16A 3W2WA 2HYFA 1Z3YA 1OR7C 1LFUP 1UHWA 1DP3A 4LITA 1Z67A 1MH3A 2M4KA 5AIQA 4GCVA 3ERED 5DCMA 3E3VA 1YX5A 2BE5F 4BU2A 2EFNA 1Z91A 5HS7A 3FM3A 1LUJB 3GF2A 1HA8A 4UNOA 4B43A 1GUUA 3I54A 3DLAA 1TZLA 2MSYA 1BIAA 1C0WA 2B9SA 1BI0A 2ELHA 4IL6C 3IUOA 5IT3A 2ZJRF 3HC7A 1HW2A 1W5TA 3IV5A 5J1RA 1K78B 3U2RA 1TT0A 4ZYHA 1O7FA 3GFIA 4A3EJ 2X85A 4Q47A 1G3TA 1OR7A 1GHCA 4S04A 3DTEA 2R7WA 4E7JA 2F4OB 1OCZH 2XRNA 4I99C 1XD7A 1BR4A 3JAMZ 1MD0A 2RAEA 4OIRF 4JQFA 1T56A 1EKEA 2RKHA 2HS5A 5LLQA 3NAUA 3NRVA 1O3RA 3W2VA 2K40A 3ZQ7A 2XUBA 1D0YA 4F3QA 3AG4H 3PM1A 1D5VA 3V8LA 3GWZA 4M73A 5FKMA 3AFHA 3OMYA 1DPUA 3GVAA 2JZYA 2FE3A 2Z99A 3M8JA 1UFMA 2O0YA 3KP2A 4A0YA 1V5GA 2DLLA 4BE0A 4KYWA 1JHFA 3H3VK 1V3FA 1YJ9I 1F43A 1BI3A 2DPUA 4YFKF 3M9AA 3CDHA 1SD6A 3KX2A 3HRTA 4Y17A 3E5QA 3K4LA 2XAHA 3CCRI 1MJ9A 4C9YA 3RI4A 3Q9SA 2DOFA 4ZC3A 2KISA 1USSA 4I2OA 3TL4X 2KZGA 1PP8F 1D0XA 1MMDA 5DD4A 2ZJPF 3DLLF 1VQLI 4HBLA 2LOOA 3ZRGA 1G59A 2KDZA 1K78A 3M1CA 4CXFA 4L0YB 1FSEA 3NARA 2DXIA 3E5XA 4AYBA 2IEKA 1EJ9A 4O3MA 3HOVJ 2M30A 4RLQA 5DM6F 2BHYA 2CFXA 2K5CA 3GLXA 1U2WA 4KN7X 3WGHA 2VPLA 1ZKGA 3JSOA 3DQVC 3COAC 3I0TA 4PZJA 1STZA 2ZXIA 4A3BJ 5CKTA 1Y0UA 1YS7A 1WH7A 2JWTA 2IVMA 2ZXHA 4XLFA 4M3DA 4AUXA 3QPHA 4YEJA 4P96A 3RQ4A 3OYMA 4D5FA 1F9NA 4DZPA 2EH3A 1LFBA 2E1CA 3C2GA 2R7SA 3K4MA 2MC4A 3IRQA 3E6MA 4XR6A 4GFBA 5JHFA 3OYCA 4D9JA 2ZFWA 4IKFA 3MZ8A 2BY1A 1W36C 4G9YA 4MTEA 4AWXB 4V2FA 1BC7C 3ERMA 3MAJA 3L2CA 1I5ZA 2VUMJ 3U21A 1IN5A 3D5RC 3ASNH 2PJRB 5ERIA 3H36A 4II2A 1MNEA 2DW4A 4V19K 5M3FJ 3MKZA 2D2WA 4W97A 1U78A 3OYEA 4FTHA 1D8KA 1SC7A 3VYSB 1E3PA 2FOKA 4BJ6C 2JA2A 3KLOA 1RRJA 4CYCB 3EQLF 3J7ZI 1FBSA 1K4TA 3A02A 1U9OA 1N25A 3O8GA 3X2QH 3OS1A 1Y39A 3BZKA 4XRSG 3OYFA 2EIJH 5JR3A 2LY1A 3OYHA 4XBFA 1IO2A 3RYPA 4NHJA 3K10A 3OYNA 4R1HA 2IA2A 4PJMA 1PVEA 1IRXA 3GO5A 1E3HA 2XGXA 2FNAA 4ZDPA 1U8RA 2HXOA 4KN4X 4JOMA 4BDZA 3GTJJ 4LIVA 1UJ8A 2QENA 2VIXA 4XRFA 5FD5A 5GAEJ 1AU7A 2IS4A 2VQCA 4LJZF 5K5RA 1DU0A 4G6QA 2IS6A 4X6AJ 4N9IA 2JSCA 3JRDA 2EWNA 2HKOA 1FTTA 3HEFA 1X3ZB 1QZEA 2XF6A 1NG6A 1FMWA 4EM1A 2HOAA 5CYVA 4HSTA 5BPDA 1Z9CA 1K6OA 4G7HF 1VQ8I 4CCJA 1R36A 2X0LA 3K4JA 4UV8A 2VC0A 2F5VA 1SFKA 4Z6YA 4RGXA 2IGOA 2PJRA 4RAFA 4DBRA 2COBA 3C3WA 2LD5A 5DS9A 1YYVA 4ENKA 1PUFB 4FASD 3EDPA 2KDOA 3F6OA 3DBHB 3FZVA 4WXCA 4RM2A 3ZPLA 3N97A 4HAMA 1TL8A 1ZYRF 4BHPA 1V5EA 2EFQA 5JVGF 4CYCA 5FD6A 5E8GA 5F1RA 2JA5J 4LIUA 2CW8A 4RAZA 1TQMA 1L3LA 2Q0OA 1JUMA 5FLMJ 2VONA 5K7HA 2DT6A 3J81K 1JI8A 4CUGA 5HS8A 3V7RA 3WTXC 5CJ9A 1GT0C 1YRNB 2FX0A 5D6EA 2XSDC 4ANJA 1JGSA 3E1SA 4C2MJ 4ZZDA 2RVCA 3S1RJ 1VTNC 4CO8A 4NQWB 4BQOA 3IWFA 2DQLA 1UG2A 2EFWA 2L7ZA 2M5WA 3L1PA 4P5OA 1QPMA 1ETYA 1P6RA 2OD5A 1RPWA 1ZG3A 1P4AA 3LA2A 5GAHJ 2X51A 3FXLA 2GA1A 2I10A 3TW7A 2BBYA 2KRHA 1X58A 2Q2EB 2VODA 1E0EA 1XB4A 5JHUA 3AAFA 4MEXF 3I59B 1XX5A 2KL4A 2IS2A 2VC1A 1ETKA 4RGSA 2EV0A 2F5FA 3IKVA 4EVIA 1PUFA 2LF8A 3Q0VA 3QP5A 5J4VA 3GMEA 4HX4A 3KYLA 1SAUA 1O57A 3GTGJ 4IOAF 2V9VA 4HLYA 1VQNI 1XC5A 3L9FA 3FF5A 2R7FA 2BHZA 2O5RA 4M6VA 4AC0A 2F5CA 3RPUD 2DMTA 3HOSA 2E19A 4F52A 4F93B 5IP7J 1DU6A 3GFLA 3DBRB 3OOUA 2RGVA 5HNFA 1VQMI 4KA4A 1RETA 3J80Z 2M34A 4RS8A 5J6XA 2F48A 2H6BA 3OSFA 2HFHA 5FLXZ 4G7ZF 4ENMA 2LH9A 1G4DA 3OR1C 3L2VA 3SXYA 4NQWA 2ID3A 2L9NA 3QWLA 3W6JB 4H0EA 2TDXA 1YG2A 1XMAA 1HW1A 3HPHA 1VFCA 1IAWA 3D1NI 4BBRJ 1HSJA 3G1LA 3DXJF 3LFKA 4K2EA 4XSZF 3LSHA 2P81A 3ESWB 4XOTA 2DJIA 2HQ5A 3BG6A 4BQAA 1JTYA 1LE8A 2JN6A 1YFHA 4ENNA 2Q2EA 4AVZA 2L7FP 2VKVA 3G73A 1ODDA 3I59A 4B47A 2VBYA 2MGQA 4B44A 1D8JA 5FKOA 5KNLA 5ILUA 4XKWA 4ZDLA 1OCRH 3GFMA 4II3A 3RKWA 1S7OA 4M3BA 2L2OA 5FKKA 3PJRA 4IJAA 3ROUA 3KZYA 3HDDA 1Y0NA 4GDFA 3G1OA 3KP6A 3DWLE 2QUFA 2CQXA 2E2IJ 1TWAJ 5JFRA 1B72B 1P4XA 1EH8A 1FC3A 1X1AA 2DQRA 2QM3A 2ZXWH 4KJZA 2VKDA 4CZCA 3VEPA 1NK2P 1J0RA 1JHHA 1ZTRA 3I71A 9ANTA 3W2AA 4OWRB 5ICFA 2ZCWA 3HGGA 3MEXA 4PGHA 2ACJA 2X6XA 4QPQA 4AIHA 5HODA 4RDUA 4MLOA 3GBGA 1HXDA 4CZZA 3HOYJ 2DT5A 3FXRA 3K1PA 5K1YA 3P9KA 1UELB 1IUFA 1J5YA 1TQIA 2L9VA 5FJ8J 1H9GA 2LDUA 2OF7A 5M5XJ 1T08B 2Y75A 3OYDA 3FXOA 3CCQI 3OIQA 2ISYA 2P7VB 5F04A 2PQ8A 2DTZA 5D8KB 4BHCA 3RKYA 2VXZA 1Y8QB 4N0BA 2W84A 5GAGJ 2FMLA 2IGMA 2OZ6A 2WAQN 4LK0F 5FLVA 1H0MA 1X2MA 5DM7F 1W4MA 1SD4A 2H27A 3G6EI 2H09A 3CCSI 3BC8A 3BG7A 1JKRC 2KKOA 5IP9J 5D5UB 5H20A 2NVTJ 3A0BC 3BJAA 1W5SA 2Q1ZB 3E6DA 2KRFA 1OCOH 1ZK8A 3S2HJ 3VSLA 5J1UA 5LRSA 2K4JA 3DKWA 1B72A 2ZSHB 3RSNA 2O7OA 1BI1A 3WU2C 1K6YA 1IV8A 1BC8C 2FQ4A 1YIJI 2R0QC 2VI6A 3TGNA 2EBIA 1A5JA 3G2BA 1YHQI 2GZWA 3H3ZA 4NNJA 2IBDA 2O8XA 2VN2A 4CYDA 3MQ0A 1R9TJ 1IJWC 3OYIA 2RDPA 4Y33A 3DTIA 4PUSA 1G3SA 3BR2A 3R60A 4G12A 3DFGA 3LSKA 2HYJA 2ZC2A 1OPCA 4XLPF 1JJ6C 2EFPA 5HS9A 1HOMA 3GTMJ 2P7CB 2A5WA 1UB9A 2VQGA 1HC8A 1I39A 1RESA 2E5ZA 4A3JJ 1D1BA 1UHSA 2W82A 3ABLH 1FP1D 4XM3A 2XPWA 5D5VB 2V79A 1SMYF 4A69C 3K6GA 1FYKA 3C2BA 4P9UA 2QBYB 3LSMA 2HDCA 3FM5A 5EEGA 2XPUA 1WPKA 4MTDA 2BOLA 4Q4ZF 2GAUA 3IAS2 3O3KA 2R5YB 1QA6A 2L02A 4PK4A 4DJAA 3W6KB 1IN8A 3HB9A 1OCTC 4AU7A 3LQRA 2L54A 3PUBA 4LB6B 2PG4A 3FISA 1R4NB 2YX4A 4FETA 2J5PA 3WTSC 2PX9A 1S29A 3M8EA 1RUNA 3R0AA 4EM0B 4FX4A 3S15J 3JRFA 1I50J 1RC9A 4KT6A 1R5HA 2JVHA 4U0VA 3VYRB 3RPUA 3WGGA 3DU6A 5FB2A 4J00A 1EA3A 1QGPA 3H5RA 3H9QA 2OQRA 4JX4A 1TNSA 2OCCH 4ESBA 3KP5A 3KCCA 3BROA 3K2ZA 2O3FA 3C1DA 3ZMDA 3ZQIA 4RGRA 4LD5A 2G7UA 2XGEA 5DUIA 4Q5SF 1ZR4A 3G4SI 3E97A 4I0AA 4C3JJ 3JR9A 2V6EA 4HF2A 4UHTA 5DUKA 1J75A 3CCEI 4KISA 3EUAA 1FEXA 2QQ8A 3BG3A 3LSIA 3U9GA 1POGA 3ZMTA 4GO1A 1BOAA 5LGNA 2MD0A 3GUDA 2R7OA 2RNJA 2EJRA 2DA1A 5CQEA 4MEYF 4IX7A 3OYJA 2GIZA 2LG4A 4DZJA 1W5CC 4E7IA 2V1DA 3QRFF 2BXYA 4PJNA 2DA3A 1U3EM 3B02A 1FIPA 4N9HA 1QVUA 2W7NA 3CESA 1VQ4I 5EDNA 3ZQGA 4NBQA 2GM4A 4RB0A 3BZ6A 1U5TB 5J8CA 1E2XA 1XSDA 3CF2A 3DF8A 3TO9A 4CICA 5D4RA 5IYBJ 1TWFJ 3HSEA 3TOBA 3PFIA 4OOIA 2M7BA 3F21A 2CV1A 3MKLA 4J19A 1X4PA 4HX8A 5GPCA 2C6YA 2TRTA 2QWWA 1XS9A 3E6CC 4ABZA 4X0GA 2R93J 4XRSA 3WTTC 5LGUA 4PSXA 3D5LA 2DPDA 2WAEA 4L5JA 4BUPA 4PFOA 5L3BA 1P7IA 4DIQA 3DU5A 2HVRA 3PFYA 3M3YJ 3JAMK 3WHCA 3F3XA 4XN3A 4UV9A 3P7NA 3WE2A 3ZQCA 4MGRA 4YIIA 3WHBA 3IH2A 2UWMA 3HXLA 1P4WA 3N05A 1RUOA 4FHTA 5LD2C 2RC4A 3GCMA 2QSHX 3PL8A 2ME6A 3CJRB 1U5TC 5KAFC 3DKYA 1QRYA 1YJWI 5LFAA 1N77A 2PN6A 3RKXA 4I01A 1GVJA 1O4XA 2JRTA 1SEUA 4O6JA 2LSOA 4HZFA 1D1CA 2VE9A 1HKSA 4XORA 3PIOF 2OA4A 4V2GA 3SEQA 3RZDJ 4LOCA 4XLCA 2XKOA 3CC7I 1IN7A 5KK1A 3O8HA 5CVJA 3GTLJ 2ZFUA 1U5TA 5J1YA 3R0JA 2JPBA 4ZTFA 3WE3A 3BR3A 3WTVC
chains in the Genus database with same CATH topology
3GTJJ 1JKPC 1AKHA 3CDLA 1ZR2A 3BR1A 3HM5A 3JRCA 1AU7A 3TEDA 2M9HA 1DU0A 4X6AJ 2E2JJ 2DMUA 3JRIA 3JRDA 1FTTA 3HEFA 4QTRA 3A01B 2M8GX 3F0CA 2HOAA 4A3DJ 4B4CA 3LOCA 1ITYA 3HOUJ 2YUSA 3ZQLA 3BQZA 1K83J 2DA7A 3IH3A 2WV1A 2LKXA 3CCYA 4BXXJ 3Q0UA 3PO3J 3QPLA 2YU9J 2EZHA 2D5VA 2X6OA 2XB0X 4B1RA 2LD5A 3LNQA 1ENHA 2COBA 4D5CA 3HOWJ 5DS9A 2K9SA 1PUFB 4MFEA 5K7ZA 5E3MA 3BTCA 1ETOA 4JX5A 4XIDA 3B6AA 2E2HJ 5EG0A 3UKGA 2QCOA 4XK4A 4XRMA 1H88C 3LSJA 2O9LA 4CYCA 2L9RA 2MW8A 4M3GA 2CRGA 4BKXA 3HOXJ 1ZGWA 2LTPA 2JA5J 1HDDC 3TP3A 3GTKJ 2ECCA 1JT0A 3BG5A 4HNVA 5C4JJ 2DN0A 3K2AA 1JUMA 5EF6A 5FLMJ 2JA6J 5K7HA 2CQQA 1TWHJ 2NS8A 1RKTA 5M3MJ 3JRGA 1GT0C 2LY9A 1MSEC 1YRNB 2DA2A 2FX0A 1X2NA 3S1NJ 4DYQA 2R7ZJ 2XSDC 1H89C 4C2MJ 1ORKA 4JYKA 5F27A 3S1RJ 5JLXA 1VNDA 1UG2A 2L7ZA 3L1PA 1ETYA 4BY7J 1ETWA 3A01A 4A3FJ 1IRZA 1RPWA 3JRBA 4DYCA 2CUFA 4UUTA 3BT9A 4FE7A 4C3IJ 2IAIA 3B6CA 2DMPA 2I10A 3TW7A 1X58A 3BTLA 1VF9A 1BW6A 1Q1VA 4M3FA 1ETKA 1WI3A 1PUFA 1APLC 5M5WJ 5IOYA 3Q0VA 3VPRA 4DW6A 5EGOB 1IC8A 4IHVA 3ZQFA 1S7EA 5F0FA 3GTGJ 4W1UA 5GPAA 1SFOJ 1HF0A 2H8RA 1MBJA 1XC5A 1JJ8C 3BTJA 4M6VA 4AC0A 3S2DJ 2DMTA 5JLWA 1W0UA 4IHWA 2E19A 3BR6A 4EEFG 5IP7J 1DU6A 4DYRA 5E3NA 2YS9A 3OOUA 2XPVA 3BG9A 4JX6A 1MNMC 1RETA 2M34A 1JKOC 2ME0A 3Q0WA 3OSFA 2ID3A 2E1OA 2JA8J 4BBSJ 2LLKA 1VFCA 2XRLA 3D1NI 1D5YA 4X1EA 4BBRJ 3G1LA 5F1JA 1IG7A 3FK7A 2DA4A 2P81A 1BL0A 3Q3SA 2HQ5A 1GVDA 1JTYA 3QQAA 1LE8A 2JN6A 3M4OJ 1OJLA 4FISA 3ZQHA 2L7FP 2XB5A 2VKVA 5IP6A 1MH4A 3GTPJ 3BR0A 2MGQA 2CU7A 5FKOA 1Y1WJ 5C3EJ 2N8GA 2LR8A 4M3BA 3S14J 4S0HB 2KT0A 5FKKA 2O8KA 1WGXA 5EGOA 3HDDA 3E7LA 5F0CA 3G1OA 5F0HA 1U8BA 3IH4A 1IDZA 2QF7A 4NDLA 5IPAA 2CQXA 1IGNA 4A3MJ 3GTQJ 1TWGJ 2E2IJ 1TWAJ 1B72B 2XGCA 1MBHA 1Y1VJ 2JJ7A 2K9NA 1NK2P 2HOSA 1ZTRA 1CQTA 3QPSA 9ANTA 1HDPA 2M0CA 3HGGA 3DEWA 1MBFA 3OIOA 4C3HJ 4QIWN 1ZQ3P 1GV2A 4A3GJ 1FTZA 3HBLA 5HODA 4MLOA 2K9QA 3GBGA 3MN2A 4RDUA 3LSRA 3HOYJ 3LSPA 3MVPA 2ZB9A 1IUFA 5FJ8J 2DA5A 1GV5A 2AHQA 1BJZA 2OF7A 5M5XJ 1ETQA 4MIMA 5F04A 2R5YA 2DMNA 2DTZA 1I3QJ 3S16J 2XGDA 2DMQA 2LP0A 1T33A 1JUPA 5E3OA 3K7AJ 4Y52J 2VKEA 2WAQN 5C44J 5FLVA 2GLOA 1RKWA 1X2MA 1LE8B 1JGGA 2HOTA 3RKQA 2MG4A 1ETVA 5EZGA 1UMQA 2Y31A 1B8IB 1JKRC 5BNGA 5IP9J 2NVTJ 3PO2J 3S1QJ 2HDDA 3ZOBA 3S1MJ 5IYDJ 1MBEA 2PMZN 2TCTA 4BY1J 1ZK8A 2NS7A 1W0TA 3W6VA 3S2HJ 1QVTA 2Y2ZA 2X9DA 2X48A 5EEAA 5J1UA 4A3IJ 1B72A 1TWCJ 1H8AC 2O7OA 3OSGA 1IV6A 3SJMA 2LK2A 4FE4A 5C4XJ 2FQ4A 1A6IA 2R0QC 2VI6A 2EBIA 1A5JA 3FKIJ 2NVXJ 3JRAA 2IBDA 1R9TJ 1P7JA 1IJWC 3DCFA 4A3CJ 3BR2A 2ID6A 2GBYA 4G12A 1NK3P 1WCMJ 1XG1A 2HYJA 1JJ6C 1HOMA 2CJJA 4IEJA 3GTMJ 3FK6A 2EZKA 5IOZA 1RESA 2M2EA 4A3JJ 4L5EA 5J3LA 1UHSA 3TW6A 2XPWA 1JKQC 1LFUP 2H1KA 4A69C 2AO9A 2CUEA 3JREA 1OFCX 4UUSB 1MH3A 3C2BA 4JP0A 2XPUA 1WPKA 2R5YB 1ETXA 2NVQJ 4A93J 1GUUA 2MSYA 1U9NA 3HB9A 5GP9A 1OCTC 3HGYA 3TP0A 1B8IA 3IV5A 5J1RA 1OCPA 4XICA 3FISA 4A3EJ 1I6HJ 3S15J 3JRFA 1I50J 1FIAA 1RR7A 2FJ1A 1JT6A 2B63J 2RAEA 1T56A 4JX4A 2R5ZB 1Z77A 5FKLA 5EZHA 3NAUA 3ZQIA 4Y7NJ 5IYCJ 1G2HA 3LSGA 2K40A 2JMWA 4IHXA 2XGEA 4D7NA 3PM1A 4B3AA 5M5YJ 1ZR4A 5FKMA 3BQYA 1NTCA 5FKNA 3JR9A 4C3JJ 2JK3A 3S17J 1HLVA 2LVSA 5F08A 1AHDP 4IHYA 4I6ZA 2NOGA 3H3VK 1F43A 1FEXA 3BG3A 1POGA 1JUSA 2EZLA 4UUSA 2DA1A 3HOZJ 2L0KA 1QPIA 1JTXA 1F36A 4DZJA 2Y9YA 2DA3A 4AYBN 2WB1N 1FIPA 4A3LJ 1QVUA 1WH5A 3SDGA 5EDNA 2VPRA 2KDZA 3ZQGA 2FD5A 3NARA 2GM4A 2IEKA 1K61A 1FJLA 3HOVJ 1MBGA 2JA7J 3I4MJ 1ZKGA 3CQZJ 5IYBJ 1TWFJ 1E3OC 1TC3C 5EYRA 4FCYA 3MKLA 2OPTA 4J19A 3FIWA 2HXIA 2L7MP 1MSFC 5GPCA 2Y30A 1VI0A 4A3BJ 2TRTA 1WH7A 2R5ZA 2HI3A 2JWTA 1XS9A 1AKHB 4ABZA 4M3DA 4AUXA 2R93J 5DTDA 2Y9ZA 3RQIA 4XRSA 5K7FA 2NVYJ 4D5FA 4DZPA 2EH3A 1LFBA 2ELKA 1P7IA 3JRHA 1IDYA 2W48A 3M3YJ 1MBKA 3WHCA 1BW5A 3CMYA 2DA6A 4GFBA 3HKZN 2Y0SN 4A3KJ 1GDTA 4MFDA 3ZQCA 3A03A 4RBOA 3WHBA 4V2FA 3IH2A 4I76A 3I4NJ 2VUMJ 2DJNA 5E3LA 2ME6A 4QSHA 4M3EA 2EQRA 1SANA 1QRYA 3RZOJ 1BA5A 5M3FJ 4W97A 2ECBA 3H0GJ 5EG0B 1U78A 1O4XA 1HCRA 4FTHA 4CYCB 3BR5A 1EF4A 4V2GA 4D7MA 3A02A 3RZDJ 1U9OA 4LOCA 1YRNA 3GTOJ 3O8GA 4MO7A 4XRSG 3O8HA 2R92J 3GTLJ 2EZIA 5J1YA 3BTIA 3G1MA 3SFIA 1Z0XA 2G0EA 2LFBA 3BR3A 2HXOA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ J;  1JKP C;  1AKH A;  3CDL A;  1ZR2 A;  3BR1 A;  3HM5 A;  3JRC A;  1AU7 A;  3TED A;  2M9H A;  1DU0 A;  4X6A J;  2E2J J;  2DMU A;  3JRI A;  3JRD A;  1FTT A;  3HEF A;  4QTR A;  3A01 B;  2M8G X;  3F0C A;  2HOA A;  4A3D J;  4B4C A;  3LOC A;  1ITY A;  3HOU J;  2YUS A;  3ZQL A;  3BQZ A;  1K83 J;  2DA7 A;  3IH3 A;  2WV1 A;  2LKX A;  3CCY A;  4BXX J;  3Q0U A;  3PO3 J;  3QPL A;  2YU9 J;  2EZH A;  2D5V A;  2X6O A;  2XB0 X;  4B1R A;  2LD5 A;  3LNQ A;  1ENH A;  2COB A;  4D5C A;  3HOW J;  5DS9 A;  2K9S A;  1PUF B;  4MFE A;  5K7Z A;  5E3M A;  3BTC A;  1ETO A;  4JX5 A;  4XID A;  3B6A A;  2E2H J;  5EG0 A;  3UKG A;  2QCO A;  4XK4 A;  4XRM A;  1H88 C;  3LSJ A;  2O9L A;  4CYC A;  2L9R A;  2MW8 A;  4M3G A;  2CRG A;  4BKX A;  3HOX J;  1ZGW A;  2LTP A;  2JA5 J;  1HDD C;  3TP3 A;  3GTK J;  2ECC A;  1JT0 A;  3BG5 A;  4HNV A;  5C4J J;  2DN0 A;  3K2A A;  1JUM A;  5EF6 A;  5FLM J;  2JA6 J;  5K7H A;  2CQQ A;  1TWH J;  2NS8 A;  1RKT A;  5M3M J;  3JRG A;  1GT0 C;  2LY9 A;  1MSE C;  1YRN B;  2DA2 A;  2FX0 A;  1X2N A;  3S1N J;  4DYQ A;  2R7Z J;  2XSD C;  1H89 C;  4C2M J;  1ORK A;  4JYK A;  5F27 A;  3S1R J;  5JLX A;  1VND A;  1UG2 A;  2L7Z A;  3L1P A;  1ETY A;  4BY7 J;  1ETW A;  3A01 A;  4A3F J;  1IRZ A;  1RPW A;  3JRB A;  4DYC A;  2CUF A;  4UUT A;  3BT9 A;  4FE7 A;  4C3I J;  2IAI A;  3B6C A;  2DMP A;  2I10 A;  3TW7 A;  1X58 A;  3BTL A;  1VF9 A;  1BW6 A;  1Q1V A;  4M3F A;  1ETK A;  1WI3 A;  1PUF A;  1APL C;  5M5W J;  5IOY A;  3Q0V A;  3VPR A;  4DW6 A;  5EGO B;  1IC8 A;  4IHV A;  3ZQF A;  1S7E A;  5F0F A;  3GTG J;  4W1U A;  5GPA A;  1SFO J;  1HF0 A;  2H8R A;  1MBJ A;  1XC5 A;  1JJ8 C;  3BTJ A;  4M6V A;  4AC0 A;  3S2D J;  2DMT A;  5JLW A;  1W0U A;  4IHW A;  2E19 A;  3BR6 A;  4EEF G;  5IP7 J;  1DU6 A;  4DYR A;  5E3N A;  2YS9 A;  3OOU A;  2XPV A;  3BG9 A;  4JX6 A;  1MNM C;  1RET A;  2M34 A;  1JKO C;  2ME0 A;  3Q0W A;  3OSF A;  2ID3 A;  2E1O A;  2JA8 J;  4BBS J;  2LLK A;  1VFC A;  2XRL A;  3D1N I;  1D5Y A;  4X1E A;  4BBR J;  3G1L A;  5F1J A;  1IG7 A;  3FK7 A;  2DA4 A;  2P81 A;  1BL0 A;  3Q3S A;  2HQ5 A;  1GVD A;  1JTY A;  3QQA A;  1LE8 A;  2JN6 A;  3M4O J;  1OJL A;  4FIS A;  3ZQH A;  2L7F P;  2XB5 A;  2VKV A;  5IP6 A;  1MH4 A;  3GTP J;  3BR0 A;  2MGQ A;  2CU7 A;  5FKO A;  1Y1W J;  5C3E J;  2N8G A;  2LR8 A;  4M3B A;  3S14 J;  4S0H B;  2KT0 A;  5FKK A;  2O8K A;  1WGX A;  5EGO A;  3HDD A;  3E7L A;  5F0C A;  3G1O A;  5F0H A;  1U8B A;  3IH4 A;  1IDZ A;  2QF7 A;  4NDL A;  5IPA A;  2CQX A;  1IGN A;  4A3M J;  3GTQ J;  1TWG J;  2E2I J;  1TWA J;  1B72 B;  2XGC A;  1MBH A;  1Y1V J;  2JJ7 A;  2K9N A;  1NK2 P;  2HOS A;  1ZTR A;  1CQT A;  3QPS A;  9ANT A;  1HDP A;  2M0C A;  3HGG A;  3DEW A;  1MBF A;  3OIO A;  4C3H J;  4QIW N;  1ZQ3 P;  1GV2 A;  4A3G J;  1FTZ A;  3HBL A;  5HOD A;  4MLO A;  2K9Q A;  3GBG A;  3MN2 A;  4RDU A;  3LSR A;  3HOY J;  3LSP A;  3MVP A;  2ZB9 A;  1IUF A;  5FJ8 J;  2DA5 A;  1GV5 A;  2AHQ A;  1BJZ A;  2OF7 A;  5M5X J;  1ETQ A;  4MIM A;  5F04 A;  2R5Y A;  2DMN A;  2DTZ A;  1I3Q J;  3S16 J;  2XGD A;  2DMQ A;  2LP0 A;  1T33 A;  1JUP A;  5E3O A;  3K7A J;  4Y52 J;  2VKE A;  2WAQ N;  5C44 J;  5FLV A;  2GLO A;  1RKW A;  1X2M A;  1LE8 B;  1JGG A;  2HOT A;  3RKQ A;  2MG4 A;  1ETV A;  5EZG A;  1UMQ A;  2Y31 A;  1B8I B;  1JKR C;  5BNG A;  5IP9 J;  2NVT J;  3PO2 J;  3S1Q J;  2HDD A;  3ZOB A;  3S1M J;  5IYD J;  1MBE A;  2PMZ N;  2TCT A;  4BY1 J;  1ZK8 A;  2NS7 A;  1W0T A;  3W6V A;  3S2H J;  1QVT A;  2Y2Z A;  2X9D A;  2X48 A;  5EEA A;  5J1U A;  4A3I J;  1B72 A;  1TWC J;  1H8A C;  2O7O A;  3OSG A;  1IV6 A;  3SJM A;  2LK2 A;  4FE4 A;  5C4X J;  2FQ4 A;  1A6I A;  2R0Q C;  2VI6 A;  2EBI A;  1A5J A;  3FKI J;  2NVX J;  3JRA A;  2IBD A;  1R9T J;  1P7J A;  1IJW C;  3DCF A;  4A3C J;  3BR2 A;  2ID6 A;  2GBY A;  4G12 A;  1NK3 P;  1WCM J;  1XG1 A;  2HYJ A;  1JJ6 C;  1HOM A;  2CJJ A;  4IEJ A;  3GTM J;  3FK6 A;  2EZK A;  5IOZ A;  1RES A;  2M2E A;  4A3J J;  4L5E A;  5J3L A;  1UHS A;  3TW6 A;  2XPW A;  1JKQ C;  1LFU P;  2H1K A;  4A69 C;  2AO9 A;  2CUE A;  3JRE A;  1OFC X;  4UUS B;  1MH3 A;  3C2B A;  4JP0 A;  2XPU A;  1WPK A;  2R5Y B;  1ETX A;  2NVQ J;  4A93 J;  1GUU A;  2MSY A;  1U9N A;  3HB9 A;  5GP9 A;  1OCT C;  3HGY A;  3TP0 A;  1B8I A;  3IV5 A;  5J1R A;  1OCP A;  4XIC A;  3FIS A;  4A3E J;  1I6H J;  3S15 J;  3JRF A;  1I50 J;  1FIA A;  1RR7 A;  2FJ1 A;  1JT6 A;  2B63 J;  2RAE A;  1T56 A;  4JX4 A;  2R5Z B;  1Z77 A;  5FKL A;  5EZH A;  3NAU A;  3ZQI A;  4Y7N J;  5IYC J;  1G2H A;  3LSG A;  2K40 A;  2JMW A;  4IHX A;  2XGE A;  4D7N A;  3PM1 A;  4B3A A;  5M5Y J;  1ZR4 A;  5FKM A;  3BQY A;  1NTC A;  5FKN A;  3JR9 A;  4C3J J;  2JK3 A;  3S17 J;  1HLV A;  2LVS A;  5F08 A;  1AHD P;  4IHY A;  4I6Z A;  2NOG A;  3H3V K;  1F43 A;  1FEX A;  3BG3 A;  1POG A;  1JUS A;  2EZL A;  4UUS A;  2DA1 A;  3HOZ J;  2L0K A;  1QPI A;  1JTX A;  1F36 A;  4DZJ A;  2Y9Y A;  2DA3 A;  4AYB N;  2WB1 N;  1FIP A;  4A3L J;  1QVU A;  1WH5 A;  3SDG A;  5EDN A;  2VPR A;  2KDZ A;  3ZQG A;  2FD5 A;  3NAR A;  2GM4 A;  2IEK A;  1K61 A;  1FJL A;  3HOV J;  1MBG A;  2JA7 J;  3I4M J;  1ZKG A;  3CQZ J;  5IYB J;  1TWF J;  1E3O C;  1TC3 C;  5EYR A;  4FCY A;  3MKL A;  2OPT A;  4J19 A;  3FIW A;  2HXI A;  2L7M P;  1MSF C;  5GPC A;  2Y30 A;  1VI0 A;  4A3B J;  2TRT A;  1WH7 A;  2R5Z A;  2HI3 A;  2JWT A;  1XS9 A;  1AKH B;  4ABZ A;  4M3D A;  4AUX A;  2R93 J;  5DTD A;  2Y9Z A;  3RQI A;  4XRS A;  5K7F A;  2NVY J;  4D5F A;  4DZP A;  2EH3 A;  1LFB A;  2ELK A;  1P7I A;  3JRH A;  1IDY A;  2W48 A;  3M3Y J;  1MBK A;  3WHC A;  1BW5 A;  3CMY A;  2DA6 A;  4GFB A;  3HKZ N;  2Y0S N;  4A3K J;  1GDT A;  4MFD A;  3ZQC A;  3A03 A;  4RBO A;  3WHB A;  4V2F A;  3IH2 A;  4I76 A;  3I4N J;  2VUM J;  2DJN A;  5E3L A;  2ME6 A;  4QSH A;  4M3E A;  2EQR A;  1SAN A;  1QRY A;  3RZO J;  1BA5 A;  5M3F J;  4W97 A;  2ECB A;  3H0G J;  5EG0 B;  1U78 A;  1O4X A;  1HCR A;  4FTH A;  4CYC B;  3BR5 A;  1EF4 A;  4V2G A;  4D7M A;  3A02 A;  3RZD J;  1U9O A;  4LOC A;  1YRN A;  3GTO J;  3O8G A;  4MO7 A;  4XRS G;  3O8H A;  2R92 J;  3GTL J;  2EZI A;  5J1Y A;  3BTI A;  3G1M A;  3SFI A;  1Z0X A;  2G0E A;  2LFB A;  3BR3 A;  2HXO A; 
#chains in the Genus database with same CATH topology
 4OIP F;  3V42 A;  4MHG A;  1KZH A;  3HL2 A;  1T98 A;  3CCU I;  3CDL A;  1ZR2 A;  1VQO I;  3O6B B;  3TED A;  2M9H A;  3HUG B;  2DMU A;  1ZN2 A;  2R7Q A;  3JRI A;  3JSP A;  4BJT A;  2XC7 A;  3K69 A;  1G3Y A;  3A01 B;  5FRM A;  4KIC A;  1VZ0 A;  1X19 A;  2FF4 A;  4A3D J;  3WTY C;  5E1W A;  3J7A Y;  1ITY A;  1X1D A;  1WSU A;  1LJ9 A;  2HR3 A;  3BQZ A;  2DA7 A;  3IH3 A;  3CJT B;  4GXO A;  2WV1 A;  1BI2 A;  1ZEL A;  3BCB A;  1U6G A;  3CCY A;  3F8C A;  4A0X A;  4A0Z A;  2KIQ A;  1HBX G;  2STW A;  4HG2 A;  5J4Y A;  1FMV A;  2YU9 J;  1Z1D A;  1QQI A;  5TRD A;  4D5C A;  2EIL H;  2RRE A;  4CCO A;  3ASO H;  3JTH A;  4MFE A;  2PLY A;  2KLO A;  4BE1 A;  2AXT C;  3BTC A;  1BR1 A;  4XID A;  1LVK A;  2P6T A;  2CUZ A;  3F8F A;  5BOX A;  3UKG A;  2O03 A;  4BH9 A;  2QCO A;  1LPQ A;  1H88 C;  2O9L A;  4AIK A;  1FOX A;  1WJD A;  4XLE A;  4S05 A;  2CRG A;  3HOX J;  1ZGW A;  2LTP A;  1HDD C;  3TP3 A;  2KIM A;  3GTK J;  2ECC A;  2F5D A;  3ABU A;  4DGW B;  2DN0 A;  2MLG A;  2R7D A;  3KPH A;  2EV6 A;  2JA6 J;  2JUC A;  3HG9 A;  1TWH J;  4BQQ A;  3OYA A;  3WG9 A;  2AS5 F;  4MQV A;  2V26 A;  3A0H C;  4HW0 A;  5BMZ A;  1MSE C;  1X2N A;  3VFZ A;  2P5V A;  3DPU A;  4DYQ A;  1TLH B;  5JI6 A;  1ZRD A;  1H89 C;  4E7S A;  2H1L A;  4XKC A;  1ORK A;  1VQK I;  2FQ3 A;  2DYR H;  5JLX A;  2OQG A;  4U0Y A;  5H6Q A;  3W3C A;  3HUG A;  1BOB A;  1CF7 B;  1R71 A;  4M74 A;  5HDK A;  3CC2 I;  2CG4 A;  3ELK A;  3K1M A;  4BY7 J;  3A01 A;  1IRZ A;  2QQB A;  3JRB A;  2KPM A;  4DYC A;  2CUF A;  4UUT A;  4A5N A;  4C3I J;  2IGN A;  2R7X A;  3B6C A;  3JTG A;  4HPQ A;  4NC7 A;  2Z1D A;  3FXM A;  3E6B A;  4U87 A;  5B1A H;  3BTL A;  2YPR A;  4ESJ A;  4MQ9 F;  3DTK A;  1VF9 A;  1BW6 A;  1Q1V A;  2H6C A;  1QZY A;  2XAF A;  3HTU A;  1APL C;  5M5W J;  2VBW A;  1XTA A;  3VPR A;  1KU2 A;  5KCM A;  1SVL A;  2A3S A;  5EGO B;  4IHV A;  3ZQF A;  2VL8 A;  4RB1 A;  3GXO A;  5D5W B;  3F22 A;  1XGO A;  1MBJ A;  1R49 A;  4NUB A;  5F64 A;  1JJ8 C;  3ZQQ A;  3SYT A;  3WOD F;  3AG1 H;  4C2U A;  3BR6 A;  2EIK H;  4I7H A;  2QA4 I;  2HOE A;  1EV7 A;  1ZRE A;  2YS9 A;  2KRC A;  3DV8 A;  3I58 A;  4GYG A;  1JKO C;  2XIG A;  3REO A;  5KHD A;  2AQF A;  2K02 A;  3HSR A;  3CUQ A;  3I55 I;  3KYC B;  1VQ6 I;  4HQE A;  2FUG 2;  5DYM A;  1IF1 A;  2JQ7 A;  1CF7 A;  1ZAR A;  2CQ7 A;  3DKX A;  4BBS J;  1SMT A;  2VT2 A;  3OY9 A;  2MLK A;  4X1E A;  4ENJ A;  4CCM A;  5JVT A;  1OYY A;  2KMU A;  2OAZ A;  1IG7 A;  1XSX A;  4KIF A;  1I6X A;  3FK7 A;  1MJB A;  1BL0 A;  5GAD J;  1A31 A;  3H5N A;  3K9T A;  3ZR8 X;  3M4O J;  3WTU C;  3BLY A;  3ZQH A;  4JBA A;  1S7A A;  2QLZ A;  2X1E A;  1M1E B;  1Z7L A;  2LMD A;  1GLN A;  2XB5 A;  5K5Q A;  1R5I D;  4KMF A;  1Q1H A;  2CU7 A;  3QOD A;  2MBF A;  5FFX A;  2NXN B;  5C3E J;  3WGI A;  2N8G A;  1A04 A;  3K4N A;  3CC4 I;  2DK5 A;  2L3D A;  3BJ6 A;  4BHB A;  1QNT A;  3IC7 A;  1PDN C;  4NC6 A;  5EGO A;  1BN5 A;  1XGS A;  3E7L A;  2HPM A;  1U8B A;  3IH4 A;  1MMS A;  2F4M B;  2NYX A;  1T95 A;  2PEX A;  4CCL A;  3RYR A;  3LST A;  4XLA A;  5IPA A;  5GTI C;  4A3M J;  4B48 A;  1TWG J;  1V54 H;  2K86 A;  2XAS A;  4NC8 A;  1FOY A;  2L4M A;  4U0W A;  2MFZ A;  2JJ7 A;  3MKY B;  1MMG A;  1QU3 A;  2LKP A;  1Z6R A;  1CQT A;  3CDI A;  5IT9 Z;  1A6Q A;  2FOW A;  4IXA A;  2RQP A;  2M0C A;  4H4K C;  1FOW A;  1ZQ3 P;  4QIW N;  1OYW A;  2BXZ A;  4BEH B;  4A2U A;  2L4A A;  4ON0 A;  2OZU A;  4OIN F;  4ETS A;  3MN2 A;  3T8T A;  2HTS A;  2WWY A;  4XKB A;  3IL2 A;  3LSP A;  2DOE A;  1FBU A;  4CA0 A;  2P5L C;  2EV5 A;  2PFB A;  1ZRF A;  1BJZ A;  3KET A;  1BM9 A;  5FGM A;  2UV1 A;  1X3U A;  3H3U A;  3J80 K;  3IAM 2;  5ED4 A;  5ICE A;  1ETQ A;  4PJJ A;  5H6R A;  2DMN A;  1I3Q J;  5FLX K;  3S16 J;  1WKM A;  3BWG A;  3T5X A;  1T33 A;  1JUP A;  4XQF A;  3P5J A;  4N4N B;  3F8N A;  2VKE A;  5C44 J;  3GX4 X;  1B9N A;  3F6V A;  2GLO A;  4BNC A;  2BEO A;  4PJL A;  1LE8 B;  3S3O A;  1JGG A;  4KDP A;  1ZAO A;  3RKQ A;  4HNU A;  4FQG A;  5AIP A;  1YLF A;  2H8W A;  3VWB A;  4NB5 A;  3HRM A;  1UMQ A;  1G8X A;  5K5O A;  1B8I B;  2E1M B;  3PO2 J;  3S1Q J;  1W1W E;  3EPZ A;  3ZOB A;  3S1M J;  4ZYA A;  4LK1 F;  4BXF A;  2V9P A;  1W0T A;  4HV5 A;  2ICW G;  2X1D A;  1QVT A;  3H1C A;  4A3I J;  5E8I A;  3K4B A;  1H8A C;  1IV6 A;  2JT1 A;  4IPA A;  2R3S A;  1T2K A;  3DEU A;  1ZG1 A;  4U88 A;  1A6I A;  1R1V A;  3KEO A;  4HF0 A;  3SHF A;  1IUY A;  3PSI A;  2B0L A;  4BEH A;  4IRI A;  2ADU A;  5HLT A;  3A4C A;  3K4K A;  3DCF A;  3QOP A;  4M9S A;  3KYD B;  2ID6 A;  2VQL A;  2QKL B;  3SZP A;  3PNY A;  1WCM J;  1Z3X A;  3BY6 A;  1KU3 A;  2EIN H;  3FHN A;  1ONV A;  3MFK A;  4EGZ A;  2LC2 A;  2AXL A;  1L0O C;  2KFD A;  2E1M C;  3ONQ A;  2X4H A;  3D5S C;  3TW6 A;  3QAH A;  4IF4 A;  3AL0 B;  2CSO A;  2OCE A;  5CQG A;  2H1K A;  2G7H A;  2CUE A;  3JRE A;  1OFC X;  4UUS B;  2E36 A;  5CVU A;  2R7U A;  1VQ5 I;  4M71 A;  4LLL A;  2JTV A;  1SFE A;  4UVA A;  3MZH A;  2M8E A;  3Q9V A;  1OQY A;  3HIF A;  2HZT A;  3R61 A;  1U9N A;  5TGT A;  5HVQ C;  5GP9 A;  2QSF X;  3HGY A;  3K1N A;  1R6R A;  3TP0 A;  4BQN A;  1B8I A;  2BVM A;  1OCP A;  2IS1 A;  2QKM B;  2K4B A;  3FKJ A;  4CH7 A;  1K7A A;  1MKM A;  3NQO A;  3S93 A;  2YR2 A;  3CD6 I;  4RMN A;  2FJ1 A;  4UVB A;  1JT6 A;  2EB7 A;  1S5L C;  2B63 J;  4XKV A;  1XMX A;  4RB3 C;  5F6F A;  3VDX A;  2R7V A;  4EJU A;  2A61 A;  4UB8 C;  2GXA A;  1S3J A;  1Z77 A;  1T0F C;  5EZH A;  4UXN A;  2CW0 F;  2EIM H;  2L5Q A;  2UXX A;  3RJP A;  4EV0 A;  1B59 A;  2DCE A;  5FO5 A;  4F91 B;  5IYC J;  1G2H A;  5E1Z B;  2JMW A;  4IHX A;  4L0Z B;  1KQ8 A;  1MMA A;  2YU3 A;  5M5Y J;  3TKY A;  4BS9 A;  1ZRC A;  4RM3 A;  4F92 B;  2LNB A;  2RNG A;  2VT3 A;  2QZ8 A;  1MZB A;  1AHD P;  4IHY A;  2XF7 A;  3SZT A;  3N4M A;  3M07 A;  2HVS A;  3L2R A;  1Z05 A;  3OS0 A;  1XGN A;  1T0F A;  2BVL A;  3I4P A;  3P9I A;  4BYY A;  4AVP A;  1J09 A;  3NWS A;  1ON2 A;  4IO9 F;  1E17 A;  4XSX F;  2OBP A;  1R4M B;  2MAB A;  3FBN B;  1O3T A;  2EZL A;  2HYG D;  4UUS A;  2VJ5 A;  4KIT B;  3I53 A;  4MNU A;  2L0K A;  1QPI A;  1JTX A;  1F36 A;  3S2W A;  2Y9Y A;  4AYB N;  5DDG A;  2ZKZ A;  2W25 A;  4A3L J;  3OYL A;  3V7S A;  3GFJ A;  4P55 A;  5TIS C;  3FWE A;  1ACI A;  4OAY A;  2LF7 A;  2FD5 A;  1MBG A;  5ILV A;  3I4M J;  3CQZ J;  3CCV I;  5HLG A;  1E3O C;  1TC3 C;  3JW4 A;  2IXS A;  4E70 A;  4FCY A;  2OPT A;  1MSF C;  3FMR A;  3FDY A;  1NH3 A;  2WTE A;  2HI3 A;  1UHM A;  2DFF A;  5DTD A;  1BIB A;  1FP2 A;  2NVY J;  2DYS H;  3I64 A;  2A6E F;  3L7W A;  5DEQ A;  4Z2Y A;  5E18 F;  1MW7 A;  1QZZ A;  3JRH A;  1JE8 A;  2W48 A;  4YFN F;  1MBK A;  3MCZ A;  3CMY A;  2CMP A;  5L3F A;  4LFU A;  4KT5 C;  2V1U A;  5DD8 A;  4MFD A;  3L2W A;  2ETH A;  3A03 A;  1XDU A;  1PUE E;  3CCM I;  4FT8 A;  2X1C A;  4I76 A;  3I4N J;  1YO5 C;  2HPI A;  3CUO A;  5E3L A;  4ZTJ A;  3OOP A;  1MND A;  2F4I A;  2LRD A;  3QYE A;  4M3E A;  2QQ9 A;  3VYU B;  3E5U A;  1PP7 U;  1SAN A;  2CQN A;  3VOD A;  4Y13 A;  3RZO J;  1BA5 A;  2BY2 A;  4EJV A;  2ECB A;  3H0G J;  3VSK A;  5EG0 B;  1XN7 A;  2DTR A;  3NEU A;  1HCR A;  2JUG A;  1YQA A;  3CTA A;  4HNT A;  1GXP A;  1LKX A;  3BR5 A;  1EF4 A;  2A6T A;  2HZD A;  1WVR A;  2IRF G;  3J7A O;  1ZGA A;  3H92 A;  3DEE A;  2XV4 S;  3L2Q A;  1DQU A;  2HQR A;  2K9M A;  4MO7 A;  1WI9 A;  3RDI A;  1R22 A;  2R92 J;  1Z21 A;  2K85 A;  2EZI A;  4HEA 2;  4HV6 A;  4HYE A;  2A5Y B;  3LMM A;  4O5V A;  2BY0 A;  3G1M A;  1RIO H;  2PMU A;  1TNT A;  2LFB A;  2QSG X;  3SQN A;  3IHU A;  2FMY A;  2DOA A;  5CLS A;  2KIF A;  3HM5 A;  3JRC A;  3H5A A;  1DP7 P;  2WC2 A;  1ZG5 A;  3GZN B;  3C18 A;  1IN6 A;  2GQQ A;  3PUF A;  5DV5 A;  4B09 A;  5LHG A;  4L9N A;  4QTR A;  1D0Z A;  2M8G X;  1S9H A;  4CHU A;  3GLL A;  4B4C A;  2XAJ A;  2ZJ2 A;  4I98 B;  3QOE A;  4Y15 A;  2YUS A;  2EPF A;  2MYS A;  2VKH A;  2IGK A;  2NAZ A;  4ZZL A;  1DGW Y;  2FBH A;  2LKX A;  2FNP A;  4BXX J;  3V8K A;  3QPL A;  5KVR A;  1SVM A;  2X6O A;  2E34 A;  5LHH A;  4B1R A;  4J01 A;  1WJ5 A;  2XSJ C;  4HSR A;  2ZNZ A;  3HOW J;  4I0B A;  2Y69 H;  1LNW A;  1A36 A;  2R7R A;  2WY7 Q;  3CLO A;  3BPV A;  1XSV A;  1B4A A;  4JX5 A;  3F23 A;  5A2Q Z;  3B6A A;  1X1C A;  2ZNY A;  5EG0 A;  1SFU A;  3KFW X;  4XK4 A;  2L9S A;  4F7Z A;  3CJN A;  3LSJ A;  2ZME B;  4M6X A;  2L9R A;  2BW3 A;  4UB6 C;  1ZHF A;  2JSP A;  1J2X A;  4HQM A;  3MZY A;  4M3G A;  2NVU B;  1WJF A;  3VB2 A;  4BKX A;  2BY3 A;  2XAG A;  3BG5 A;  1WRJ A;  4KUM A;  4HNV A;  4WCG A;  5C4J J;  5EF6 A;  4WK8 F;  2UXN A;  5B66 C;  1RKT A;  1S8N A;  3Q5F A;  5M3M J;  2GWR A;  2RV8 A;  1BBY A;  3S1N J;  1MJA A;  3OIP A;  1LQ1 A;  2R7Z J;  4YEL A;  2XHK A;  1IXC A;  2JPC A;  3KP3 A;  4JYK A;  2A68 F;  3DBL B;  5F27 A;  2CGP A;  2HQN A;  2FXA A;  2PJP A;  2V4J C;  4QPO A;  2DOD A;  1CGP A;  1VND A;  3TMO A;  2MA3 A;  1S6L A;  3M8F A;  2G9W A;  4YG2 F;  4A3F J;  1MMN A;  3ABK H;  2VJ4 A;  1R1T A;  3BOQ A;  2P0W A;  2P4W A;  2K9L A;  4WXD A;  2DMP A;  1T38 A;  3C2H A;  2ZME C;  4LGW A;  3FMS A;  4IRG A;  4FX0 A;  1N75 A;  4BDY A;  4M3F A;  4WX9 A;  1WI3 A;  1UAA A;  2STT A;  5IOY A;  3ULQ B;  2M4G A;  2RN7 A;  2IW5 A;  4KIG A;  1FOK A;  3KZZ A;  1IC8 A;  3ECO A;  4DNC A;  1KYW A;  4M9X A;  5F0F A;  1AWC A;  4PJ0 C;  3UNG C;  2PI0 A;  4G7O F;  3IP4 B;  2ZME A;  1X1B A;  1R23 A;  1IRF A;  4PCQ A;  3BTJ A;  1I1S A;  3HJE A;  2CQK A;  4LB5 A;  1IN4 A;  4KIB A;  1UG0 A;  2HKX A;  5E3N A;  2QEX I;  2KQR A;  2IJL A;  3ABT A;  5LHI A;  1QBJ A;  4L5I A;  2P6S A;  2OTL I;  2E60 A;  3MWM A;  4JX6 A;  1Y8R B;  3AG2 H;  2DFE A;  2QQA A;  2ME0 A;  3Q0W A;  5EJC A;  4E7Z A;  1Z7U A;  3EUH C;  5D5X B;  3WU1 B;  2OC6 A;  1F5T A;  4DOZ A;  2V6C A;  3ZMZ A;  1FWZ A;  4OU0 A;  1R00 A;  2JA8 J;  3RCO A;  2LLK A;  5E79 C;  2VE8 A;  5F1J A;  1TTY A;  3WTW C;  2DA4 A;  2J5O A;  3ISP A;  1YIO A;  3Q3S A;  4PGG A;  1RZ4 A;  2OU2 A;  1OJL A;  4FIS A;  4YIF A;  1WZ2 A;  4E6K G;  2F5E A;  4EMS A;  2Y48 A;  3EUH A;  1FSH A;  2M7A A;  3E0J B;  1K4S A;  1YI2 I;  3KEY A;  4KFC A;  2HU9 A;  1OCC H;  2NNN A;  2KZV A;  4TV7 A;  4S0H B;  2O8K A;  3R6S A;  4Y4R A;  3J7Y J;  2RQQ A;  4ITV A;  1WHU A;  2M3A A;  2IA1 A;  3ZN1 A;  1WQ2 A;  4CSW A;  5F0C A;  5F0H A;  4HF1 A;  1KA8 A;  4P1W A;  1H9T A;  2CW7 A;  2DDA A;  4YIR X;  2QF7 A;  4NDL A;  4XMY A;  5HLI A;  2O61 A;  5KAI C;  2ISZ A;  3SFZ A;  1IGN A;  4OIO F;  3GTQ J;  2OV7 A;  3BP8 A;  1TW2 A;  1W7P D;  2F2E A;  1EH7 A;  4U7B A;  1LDJ A;  2XGC A;  1MBH A;  4BAY A;  4A6D A;  2K9N A;  3QPS A;  1XMK A;  3DEW A;  4C3H J;  4E4H A;  2JRM A;  1FTZ A;  1ZGJ A;  1Z6T A;  5FRN A;  1ON1 A;  2KP6 A;  3QPT A;  3U1K A;  2VLA A;  4IHS A;  3MVP A;  4AID A;  2DA5 A;  2AHQ A;  2E35 A;  1UCR A;  4IHT A;  2VOP A;  4EGY A;  2V1N A;  1YTY A;  3CUQ B;  1V5F A;  2LY2 A;  2QYO A;  3HOT A;  4D1Q A;  2DMQ A;  1P9Q C;  3PQK A;  1WJE A;  1X4O A;  4M72 A;  4Y52 J;  3FXJ A;  3A1Y A;  1B6A A;  1FX7 A;  5AON A;  4HA8 A;  2WY8 Q;  3CLQ A;  5DCF A;  3EET A;  1PYV A;  2VAS A;  2MG4 A;  4HLX A;  5L3E A;  1ETV A;  5EZG A;  2WAQ A;  1XDS A;  3CME I;  2Y31 A;  1XCV A;  1B9M A;  4HDU A;  2HDD A;  2E7W A;  1F4K A;  2HVQ A;  5IYD J;  4BE2 A;  1MBE A;  2PMZ N;  4BY1 J;  4LG3 A;  2NS7 A;  3W6V A;  3HTS B;  5E1X A;  3ZXS A;  2GOM A;  2X9D A;  2X48 A;  3UR3 C;  3L2U A;  1RNL A;  2M87 A;  2IT0 A;  1KQ9 A;  4KMU X;  3LAP A;  1FLI A;  3IWZ A;  3SJM A;  2LK2 A;  2V7F A;  3CUQ C;  2M45 A;  3F8B A;  5LGT A;  2NVX J;  3JRA A;  3T1B A;  3HHG A;  2ZO4 A;  2GA2 A;  1P7J A;  2CUJ A;  1U0J A;  1DUX C;  1J59 A;  4P9F A;  2HQA A;  1LEA A;  4A3C J;  3JCU C;  5HLH A;  2GBY A;  3HRU A;  1NK3 P;  1XG1 A;  1G6N A;  2L7K A;  2CWE A;  2XDV A;  3QYB A;  5IT9 K;  3CZ6 A;  5LBQ A;  4EJT A;  1TW3 A;  5J47 A;  2M2E A;  2OJE D;  4L5E A;  1OLT A;  1REP C;  3B73 A;  3BJO A;  3LWF A;  3R4K A;  4HDV A;  1JKQ C;  2BYV E;  3SZG A;  2AO9 A;  4EQQ A;  2Z9O A;  1YIT I;  2K3P A;  5B5E C;  4WXH A;  1QHG A;  4JP0 A;  3PNV A;  2IPQ X;  1LEB A;  4IQ4 A;  1ETX A;  3S3M A;  2NVQ J;  4A93 J;  4I09 A;  3ZMU A;  3L00 A;  4R79 A;  2IP2 A;  3LAJ A;  1O3S A;  2ZSI B;  4R8H A;  4XIC A;  4E7H A;  3ABM H;  3DP7 A;  2DU9 A;  1LDD A;  3CP2 A;  1I6H J;  3KE2 A;  2X6W A;  1RR7 A;  1FIA A;  1WJA A;  2DAO A;  4XON A;  4ZYG A;  1UST A;  1W7P B;  2MH2 A;  3LA7 A;  2Z33 A;  1KON A;  4XN0 A;  3GEZ A;  3I9V 2;  4ZYD A;  2R5Z B;  5LEJ A;  5FKL A;  1A35 A;  3H0D A;  4Y7N J;  1WJB A;  2FEZ A;  3GYH X;  1T8I A;  5E17 F;  3LSG A;  4BJ5 C;  3PQJ A;  1QHH D;  4D7N A;  5ILS A;  2BZT A;  5BPI A;  4B3A A;  3BQY A;  5E20 A;  3OR2 C;  1NTC A;  3LA3 A;  2A6H F;  4GRI A;  5FKN A;  3LL7 A;  2JK3 A;  3S17 J;  1HLV A;  2LVS A;  1TP4 A;  3KEQ A;  2I8D A;  5F08 A;  3WTZ A;  2VJI A;  4I6Z A;  1D1A A;  2HNH A;  5L3D A;  2NOG A;  4Q48 A;  4XLH A;  4RAG A;  3L09 A;  4XL9 A;  5L3C A;  4I02 A;  4IZZ A;  2E71 A;  2NNY A;  3AG3 H;  1JUS A;  2CFO A;  3WG7 H;  3TO7 A;  1LFP A;  3CCL I;  1YW8 A;  3O2P E;  3HOZ J;  3V8J A;  4ZH4 F;  4RAY A;  2W4S A;  1FY7 A;  2JVG A;  2WB1 N;  4JK1 X;  1S72 I;  3OWT A;  1WH5 A;  3RPQ A;  4LLG F;  3S8P A;  3FXU A;  3SDG A;  2HTJ A;  4BAC A;  4XLN F;  2QVO A;  2VPR A;  2VQH A;  4BGD A;  3TDZ C;  1ULY A;  3IRR A;  1K61 A;  1FJL A;  3A2K A;  2GIV A;  1T39 A;  3OL4 A;  1G3W A;  2JA7 J;  3PSF A;  3ZMV A;  5EYR A;  4Y3O A;  1FBQ A;  1Y6I A;  5LEK A;  2DDB A;  1W7P A;  2ESN A;  2HXI A;  2L7M P;  3FIW A;  2Y30 A;  3ZGK A;  1VI0 A;  1R7J A;  4EJW A;  4F55 A;  4C2T A;  1IXR C;  2K7L A;  2R5Z A;  1AKH B;  2Y9Z A;  4D0P A;  3RQI A;  2OTJ I;  5K7F A;  2V1X A;  4RGU A;  2D1V A;  1YW9 A;  2UUZ A;  4XNF A;  4BL0 B;  1NG7 A;  2BGC A;  2ELK A;  4IVN A;  1IDY A;  2LYC A;  1IZ1 A;  1P2F A;  2WAD A;  1FYL A;  1BW5 A;  2DO7 A;  5TJJ A;  3EYI A;  3S3N A;  2DA6 A;  3T0Y A;  1DPR A;  3HKZ N;  2Y0S N;  4YRV A;  4A3K J;  1GDT A;  4RBO A;  2W1O A;  2DFI A;  2DI3 A;  5J8F A;  2DJN A;  2NRA C;  2AQE A;  3I3L A;  4QSH A;  3OL3 A;  2EQR A;  2K27 A;  2K3F A;  4HOB A;  3KIO A;  3ZN0 A;  4EJO A;  1HQC A;  3TOA A;  3J81 Z;  1I1G A;  5BQT A;  1MGT A;  4KNY A;  2PBI A;  4OIQ F;  2BV6 A;  2A05 A;  1F1Z A;  2DT7 B;  2VXD A;  4D7M A;  2KHM A;  4A6E A;  1YRN A;  3GTO J;  1OMI A;  2E1N A;  1FYM A;  2L01 A;  2EFO A;  3F72 A;  2VJJ A;  2LRE A;  2DK8 A;  2Z3Y A;  2Q8K A;  1KGS A;  3BTI A;  1J9I A;  2Z5U A;  2VBX A;  2XKP A;  1Z0X A;  2G0E A;  3SDB A;  3SFI A;  2IA0 A;  1UZC A;  2HWV A;  4DQ2 A;  1FNN A;  4L9J A;  2M1B A;  1YOV B;  1VQ9 I;  4AM3 A;  1JKP C;  4E7L A;  2XRO A;  3IKT A;  1AKH A;  1OIS A;  1JXS A;  3BR1 A;  4UY8 I;  2E2J J;  1HW5 A;  3HHH A;  4CCK A;  4WF2 A;  3F0C A;  1SD7 A;  2EA4 A;  3AL0 C;  1IXS B;  1XGM A;  3LOC A;  4PSW A;  6PAX A;  4M6Y A;  3HOU J;  3ZQL A;  1K83 J;  2XAQ A;  3KLN A;  1FT9 A;  3RIR A;  2COM A;  3M1E A;  3Q0U A;  3PO3 J;  3BZC A;  2EZH A;  2D5V A;  2XB0 X;  5J40 A;  2CS3 A;  1EH6 A;  4RB2 C;  2DBB A;  1ENH A;  3LNQ A;  4WWC A;  2K9S A;  1LVA A;  5D6F A;  5K7Z A;  2P8T A;  5E3M A;  1ETO A;  3MD2 A;  1AOY A;  1ZLJ A;  4IOC F;  5ICC A;  3LFU A;  2E2H J;  4XRM A;  4LLN A;  4DBQ A;  2P5K A;  4QWQ A;  1R58 A;  2MW8 A;  3F9K A;  4B3X A;  4EM2 A;  1RR8 C;  1VQ7 I;  1SD5 A;  2CO5 A;  2XAU A;  1JT0 A;  3TQN A;  5CVR A;  1R1U A;  1YW7 A;  1V55 H;  3K2A A;  2W00 A;  3TBI A;  2CQQ A;  3HRS A;  2D1H A;  2NS8 A;  3I5U A;  5B1B H;  3H9G A;  3SEZ A;  4PFP A;  2B7E A;  3JRG A;  2GXG A;  2LY9 A;  2VB6 A;  2DA2 A;  3DPL C;  3CCJ I;  1MDM B;  3ECH A;  3F8M A;  2FU4 A;  5IY5 H;  1KU9 A;  1DDN A;  2NOJ B;  1AA7 A;  4M9Z A;  1HKT A;  3OV8 A;  1SAX A;  3U1D A;  4OMZ A;  1B1B A;  1HKQ A;  3QU3 A;  1TQP A;  5CPR B;  3WU0 A;  1ZH5 A;  1ETW A;  4G94 A;  2GXB A;  3BT9 A;  4FE7 A;  5HNH A;  3V7C A;  2IAI A;  4CGZ A;  1MIJ A;  1YX3 A;  2KJB A;  2W57 A;  1Y56 A;  1KU7 A;  4IQJ A;  3CMM A;  2ZJQ F;  3FMQ A;  1ZLK A;  4UVC A;  3EYY A;  2FA5 A;  2MC3 A;  3FBI B;  1FZP B;  4L9V A;  2Y0M A;  4PDK A;  3G71 I;  4DW6 A;  3K70 D;  1YJN I;  1S7E A;  4W1U A;  3D0S A;  1BJA A;  3EUK L;  5GPA A;  1SFO J;  3VOE A;  1HF0 A;  2H8R A;  2NS0 A;  2PMZ A;  3HSF A;  2ELJ A;  3HYI A;  3OYK A;  4QLC U;  4LG0 B;  2R7T A;  3S2D J;  2E7X A;  2MH9 A;  5JLW A;  1W0U A;  1D3Y A;  1QO0 D;  4IHW A;  2HGC A;  4EEF G;  3QP6 A;  2WBM A;  5A2Q K;  2BW3 B;  4DYR A;  2UZK A;  2EA2 A;  5D4S A;  3DPT A;  5B3S H;  2D45 A;  1WJC A;  2XPV A;  3BG9 A;  5GTH C;  4YFX F;  1MNM C;  1MDM A;  3CP8 A;  3P9C A;  1TBX A;  2HEO A;  2X6Y A;  3I56 I;  3QYF A;  2VOO A;  3MKW B;  4G6T B;  5FFZ A;  5BS6 A;  2A07 F;  1SVO A;  2WA0 A;  4UUV A;  4L9T A;  4E7K A;  3M7G A;  2MD5 A;  2E1O A;  3HZJ A;  2XRL A;  3K0L A;  2YSR A;  1D5Y A;  1HST A;  1I3A A;  3VYT B;  2FBK A;  1GVD A;  3QQA A;  3OYG A;  3GW2 A;  1N78 A;  1BR2 A;  3CMA I;  5IP6 A;  1MH4 A;  1V4R A;  1WWX A;  5D8L B;  4U7D A;  3GTP J;  3BR0 A;  5HDG A;  4C30 A;  1Y1W J;  2KIU A;  4AD9 A;  3TDU C;  1FPQ A;  1TT5 B;  3FXQ A;  3OYB A;  2LR8 A;  2CYY A;  2WAF A;  3S14 J;  2KT0 A;  2EK5 A;  4RLF A;  1WGX A;  1YS6 A;  2A69 F;  3S32 A;  4ASN A;  4OMY A;  4ZYE A;  5EEH A;  2E5N A;  2YX7 A;  1IDZ A;  4GYI A;  3AKZ A;  2ESH A;  2FBI A;  4LG0 A;  5LRR A;  4A12 A;  1WFX A;  4G8X A;  4BXU A;  4L18 B;  1K79 A;  5CVI A;  1Y1V J;  2XF5 A;  3BCA A;  3CF5 F;  3PNT A;  2HOS A;  3MMY B;  1P92 A;  3QU6 A;  1HDP A;  4HX7 A;  2Z2S B;  5CVV A;  1RI7 A;  1X3W B;  3KP4 A;  4A3G J;  1MBF A;  3GZ5 A;  3OIO A;  4ZDO A;  1GV2 A;  2OUM A;  3CJQ B;  2QGU A;  2ZBK A;  4A5M A;  3HBL A;  2K9Q A;  4LMY A;  3LSR A;  1OYI A;  2O6G E;  1PJR A;  5HOO A;  2KJC A;  2ZB9 A;  1LB2 A;  1GV5 A;  1KYZ A;  2W24 A;  3ZMS A;  1IRG A;  3NWT A;  2QBY A;  3V4G A;  3CO6 C;  1YE9 A;  2LBF B;  1NHA A;  3PIP F;  4MIM A;  4G6D A;  3OS2 A;  2R5Y A;  1OKR A;  3T8R A;  4N4O B;  1LDK B;  2XGD A;  2LP0 A;  2CV2 A;  3H9J A;  3LQQ A;  5H2F C;  5E3O A;  3TO6 A;  3K7A J;  1I27 A;  4OAZ A;  5DCM B;  3C7J A;  1GXQ A;  3K4C A;  1RKW A;  1W36 D;  2HOT A;  1IW7 F;  2WB1 A;  3KZI C;  4IRH A;  4EAT A;  3BPX A;  5HDN A;  4AIJ A;  1VQP I;  4CDG A;  1O3Q A;  2CV0 A;  3BDD A;  1SFX A;  3G3Z A;  2GOX B;  3FX3 A;  1XCB A;  5BNG A;  2V9K A;  3GZ6 A;  2PMH A;  4ZJZ A;  1DGR M;  1XPX A;  2R4G A;  3CO7 C;  2TCT A;  2FRH A;  2Y2Z A;  5EEA A;  2H94 A;  2WV0 A;  1TWC J;  3OSG A;  4HRI A;  2LKS A;  2ZXJ A;  2XVC A;  2FSW A;  4FE4 A;  4B8X A;  5C4X J;  2M0M A;  2I5U A;  2DFH A;  4XOP A;  1T6S A;  2VBZ A;  5FRO A;  3KP7 A;  2F6C A;  3FKI J;  3ML6 A;  3FXK A;  4RA2 A;  5L3G A;  1O7L A;  4ESF A;  1ERD A;  4GGG A;  3RTR A;  2HDW A;  2CH0 A;  3HKZ A;  2Y0S A;  3ZCO A;  5ICG A;  3FHZ A;  1R5G A;  1J7K A;  3ZP5 A;  1KQ0 A;  3HPG A;  3H35 A;  2CJJ A;  1X1P A;  2W85 A;  4IEJ A;  3FK6 A;  2EZK A;  2LBF A;  5IOZ A;  3K70 C;  4CCN A;  5J3L A;  2Z16 A;  3W2W A;  2HYF A;  1Z3Y A;  1OR7 C;  1LFU P;  1UHW A;  1DP3 A;  4LIT A;  1Z67 A;  1MH3 A;  2M4K A;  5AIQ A;  4GCV A;  3ERE D;  5DCM A;  3E3V A;  1YX5 A;  2BE5 F;  4BU2 A;  2EFN A;  1Z91 A;  5HS7 A;  3FM3 A;  1LUJ B;  3GF2 A;  1HA8 A;  4UNO A;  4B43 A;  1GUU A;  3I54 A;  3DLA A;  1TZL A;  2MSY A;  1BIA A;  1C0W A;  2B9S A;  1BI0 A;  2ELH A;  4IL6 C;  3IUO A;  5IT3 A;  2ZJR F;  3HC7 A;  1HW2 A;  1W5T A;  3IV5 A;  5J1R A;  1K78 B;  3U2R A;  1TT0 A;  4ZYH A;  1O7F A;  3GFI A;  4A3E J;  2X85 A;  4Q47 A;  1G3T A;  1OR7 A;  1GHC A;  4S04 A;  3DTE A;  2R7W A;  4E7J A;  2F4O B;  1OCZ H;  2XRN A;  4I99 C;  1XD7 A;  1BR4 A;  3JAM Z;  1MD0 A;  2RAE A;  4OIR F;  4JQF A;  1T56 A;  1EKE A;  2RKH A;  2HS5 A;  5LLQ A;  3NAU A;  3NRV A;  1O3R A;  3W2V A;  2K40 A;  3ZQ7 A;  2XUB A;  1D0Y A;  4F3Q A;  3AG4 H;  3PM1 A;  1D5V A;  3V8L A;  3GWZ A;  4M73 A;  5FKM A;  3AFH A;  3OMY A;  1DPU A;  3GVA A;  2JZY A;  2FE3 A;  2Z99 A;  3M8J A;  1UFM A;  2O0Y A;  3KP2 A;  4A0Y A;  1V5G A;  2DLL A;  4BE0 A;  4KYW A;  1JHF A;  3H3V K;  1V3F A;  1YJ9 I;  1F43 A;  1BI3 A;  2DPU A;  4YFK F;  3M9A A;  3CDH A;  1SD6 A;  3KX2 A;  3HRT A;  4Y17 A;  3E5Q A;  3K4L A;  2XAH A;  3CCR I;  1MJ9 A;  4C9Y A;  3RI4 A;  3Q9S A;  2DOF A;  4ZC3 A;  2KIS A;  1USS A;  4I2O A;  3TL4 X;  2KZG A;  1PP8 F;  1D0X A;  1MMD A;  5DD4 A;  2ZJP F;  3DLL F;  1VQL I;  4HBL A;  2LOO A;  3ZRG A;  1G59 A;  2KDZ A;  1K78 A;  3M1C A;  4CXF A;  4L0Y B;  1FSE A;  3NAR A;  2DXI A;  3E5X A;  4AYB A;  2IEK A;  1EJ9 A;  4O3M A;  3HOV J;  2M30 A;  4RLQ A;  5DM6 F;  2BHY A;  2CFX A;  2K5C A;  3GLX A;  1U2W A;  4KN7 X;  3WGH A;  2VPL A;  1ZKG A;  3JSO A;  3DQV C;  3COA C;  3I0T A;  4PZJ A;  1STZ A;  2ZXI A;  4A3B J;  5CKT A;  1Y0U A;  1YS7 A;  1WH7 A;  2JWT A;  2IVM A;  2ZXH A;  4XLF A;  4M3D A;  4AUX A;  3QPH A;  4YEJ A;  4P96 A;  3RQ4 A;  3OYM A;  4D5F A;  1F9N A;  4DZP A;  2EH3 A;  1LFB A;  2E1C A;  3C2G A;  2R7S A;  3K4M A;  2MC4 A;  3IRQ A;  3E6M A;  4XR6 A;  4GFB A;  5JHF A;  3OYC A;  4D9J A;  2ZFW A;  4IKF A;  3MZ8 A;  2BY1 A;  1W36 C;  4G9Y A;  4MTE A;  4AWX B;  4V2F A;  1BC7 C;  3ERM A;  3MAJ A;  3L2C A;  1I5Z A;  2VUM J;  3U21 A;  1IN5 A;  3D5R C;  3ASN H;  2PJR B;  5ERI A;  3H36 A;  4II2 A;  1MNE A;  2DW4 A;  4V19 K;  5M3F J;  3MKZ A;  2D2W A;  4W97 A;  1U78 A;  3OYE A;  4FTH A;  1D8K A;  1SC7 A;  3VYS B;  1E3P A;  2FOK A;  4BJ6 C;  2JA2 A;  3KLO A;  1RRJ A;  4CYC B;  3EQL F;  3J7Z I;  1FBS A;  1K4T A;  3A02 A;  1U9O A;  1N25 A;  3O8G A;  3X2Q H;  3OS1 A;  1Y39 A;  3BZK A;  4XRS G;  3OYF A;  2EIJ H;  5JR3 A;  2LY1 A;  3OYH A;  4XBF A;  1IO2 A;  3RYP A;  4NHJ A;  3K10 A;  3OYN A;  4R1H A;  2IA2 A;  4PJM A;  1PVE A;  1IRX A;  3GO5 A;  1E3H A;  2XGX A;  2FNA A;  4ZDP A;  1U8R A;  2HXO A;  4KN4 X;  4JOM A;  4BDZ A;  3GTJ J;  4LIV A;  1UJ8 A;  2QEN A;  2VIX A;  4XRF A;  5FD5 A;  5GAE J;  1AU7 A;  2IS4 A;  2VQC A;  4LJZ F;  5K5R A;  1DU0 A;  4G6Q A;  2IS6 A;  4X6A J;  4N9I A;  2JSC A;  3JRD A;  2EWN A;  2HKO A;  1FTT A;  3HEF A;  1X3Z B;  1QZE A;  2XF6 A;  1NG6 A;  1FMW A;  4EM1 A;  2HOA A;  5CYV A;  4HST A;  5BPD A;  1Z9C A;  1K6O A;  4G7H F;  1VQ8 I;  4CCJ A;  1R36 A;  2X0L A;  3K4J A;  4UV8 A;  2VC0 A;  2F5V A;  1SFK A;  4Z6Y A;  4RGX A;  2IGO A;  2PJR A;  4RAF A;  4DBR A;  2COB A;  3C3W A;  2LD5 A;  5DS9 A;  1YYV A;  4ENK A;  1PUF B;  4FAS D;  3EDP A;  2KDO A;  3F6O A;  3DBH B;  3FZV A;  4WXC A;  4RM2 A;  3ZPL A;  3N97 A;  4HAM A;  1TL8 A;  1ZYR F;  4BHP A;  1V5E A;  2EFQ A;  5JVG F;  4CYC A;  5FD6 A;  5E8G A;  5F1R A;  2JA5 J;  4LIU A;  2CW8 A;  4RAZ A;  1TQM A;  1L3L A;  2Q0O A;  1JUM A;  5FLM J;  2VON A;  5K7H A;  2DT6 A;  3J81 K;  1JI8 A;  4CUG A;  5HS8 A;  3V7R A;  3WTX C;  5CJ9 A;  1GT0 C;  1YRN B;  2FX0 A;  5D6E A;  2XSD C;  4ANJ A;  1JGS A;  3E1S A;  4C2M J;  4ZZD A;  2RVC A;  3S1R J;  1VTN C;  4CO8 A;  4NQW B;  4BQO A;  3IWF A;  2DQL A;  1UG2 A;  2EFW A;  2L7Z A;  2M5W A;  3L1P A;  4P5O A;  1QPM A;  1ETY A;  1P6R A;  2OD5 A;  1RPW A;  1ZG3 A;  1P4A A;  3LA2 A;  5GAH J;  2X51 A;  3FXL A;  2GA1 A;  2I10 A;  3TW7 A;  2BBY A;  2KRH A;  1X58 A;  2Q2E B;  2VOD A;  1E0E A;  1XB4 A;  5JHU A;  3AAF A;  4MEX F;  3I59 B;  1XX5 A;  2KL4 A;  2IS2 A;  2VC1 A;  1ETK A;  4RGS A;  2EV0 A;  2F5F A;  3IKV A;  4EVI A;  1PUF A;  2LF8 A;  3Q0V A;  3QP5 A;  5J4V A;  3GME A;  4HX4 A;  3KYL A;  1SAU A;  1O57 A;  3GTG J;  4IOA F;  2V9V A;  4HLY A;  1VQN I;  1XC5 A;  3L9F A;  3FF5 A;  2R7F A;  2BHZ A;  2O5R A;  4M6V A;  4AC0 A;  2F5C A;  3RPU D;  2DMT A;  3HOS A;  2E19 A;  4F52 A;  4F93 B;  5IP7 J;  1DU6 A;  3GFL A;  3DBR B;  3OOU A;  2RGV A;  5HNF A;  1VQM I;  4KA4 A;  1RET A;  3J80 Z;  2M34 A;  4RS8 A;  5J6X A;  2F48 A;  2H6B A;  3OSF A;  2HFH A;  5FLX Z;  4G7Z F;  4ENM A;  2LH9 A;  1G4D A;  3OR1 C;  3L2V A;  3SXY A;  4NQW A;  2ID3 A;  2L9N A;  3QWL A;  3W6J B;  4H0E A;  2TDX A;  1YG2 A;  1XMA A;  1HW1 A;  3HPH A;  1VFC A;  1IAW A;  3D1N I;  4BBR J;  1HSJ A;  3G1L A;  3DXJ F;  3LFK A;  4K2E A;  4XSZ F;  3LSH A;  2P81 A;  3ESW B;  4XOT A;  2DJI A;  2HQ5 A;  3BG6 A;  4BQA A;  1JTY A;  1LE8 A;  2JN6 A;  1YFH A;  4ENN A;  2Q2E A;  4AVZ A;  2L7F P;  2VKV A;  3G73 A;  1ODD A;  3I59 A;  4B47 A;  2VBY A;  2MGQ A;  4B44 A;  1D8J A;  5FKO A;  5KNL A;  5ILU A;  4XKW A;  4ZDL A;  1OCR H;  3GFM A;  4II3 A;  3RKW A;  1S7O A;  4M3B A;  2L2O A;  5FKK A;  3PJR A;  4IJA A;  3ROU A;  3KZY A;  3HDD A;  1Y0N A;  4GDF A;  3G1O A;  3KP6 A;  3DWL E;  2QUF A;  2CQX A;  2E2I J;  1TWA J;  5JFR A;  1B72 B;  1P4X A;  1EH8 A;  1FC3 A;  1X1A A;  2DQR A;  2QM3 A;  2ZXW H;  4KJZ A;  2VKD A;  4CZC A;  3VEP A;  1NK2 P;  1J0R A;  1JHH A;  1ZTR A;  3I71 A;  9ANT A;  3W2A A;  4OWR B;  5ICF A;  2ZCW A;  3HGG A;  3MEX A;  4PGH A;  2ACJ A;  2X6X A;  4QPQ A;  4AIH A;  5HOD A;  4RDU A;  4MLO A;  3GBG A;  1HXD A;  4CZZ A;  3HOY J;  2DT5 A;  3FXR A;  3K1P A;  5K1Y A;  3P9K A;  1UEL B;  1IUF A;  1J5Y A;  1TQI A;  2L9V A;  5FJ8 J;  1H9G A;  2LDU A;  2OF7 A;  5M5X J;  1T08 B;  2Y75 A;  3OYD A;  3FXO A;  3CCQ I;  3OIQ A;  2ISY A;  2P7V B;  5F04 A;  2PQ8 A;  2DTZ A;  5D8K B;  4BHC A;  3RKY A;  2VXZ A;  1Y8Q B;  4N0B A;  2W84 A;  5GAG J;  2FML A;  2IGM A;  2OZ6 A;  2WAQ N;  4LK0 F;  5FLV A;  1H0M A;  1X2M A;  5DM7 F;  1W4M A;  1SD4 A;  2H27 A;  3G6E I;  2H09 A;  3CCS I;  3BC8 A;  3BG7 A;  1JKR C;  2KKO A;  5IP9 J;  5D5U B;  5H20 A;  2NVT J;  3A0B C;  3BJA A;  1W5S A;  2Q1Z B;  3E6D A;  2KRF A;  1OCO H;  1ZK8 A;  3S2H J;  3VSL A;  5J1U A;  5LRS A;  2K4J A;  3DKW A;  1B72 A;  2ZSH B;  3RSN A;  2O7O A;  1BI1 A;  3WU2 C;  1K6Y A;  1IV8 A;  1BC8 C;  2FQ4 A;  1YIJ I;  2R0Q C;  2VI6 A;  3TGN A;  2EBI A;  1A5J A;  3G2B A;  1YHQ I;  2GZW A;  3H3Z A;  4NNJ A;  2IBD A;  2O8X A;  2VN2 A;  4CYD A;  3MQ0 A;  1R9T J;  1IJW C;  3OYI A;  2RDP A;  4Y33 A;  3DTI A;  4PUS A;  1G3S A;  3BR2 A;  3R60 A;  4G12 A;  3DFG A;  3LSK A;  2HYJ A;  2ZC2 A;  1OPC A;  4XLP F;  1JJ6 C;  2EFP A;  5HS9 A;  1HOM A;  3GTM J;  2P7C B;  2A5W A;  1UB9 A;  2VQG A;  1HC8 A;  1I39 A;  1RES A;  2E5Z A;  4A3J J;  1D1B A;  1UHS A;  2W82 A;  3ABL H;  1FP1 D;  4XM3 A;  2XPW A;  5D5V B;  2V79 A;  1SMY F;  4A69 C;  3K6G A;  1FYK A;  3C2B A;  4P9U A;  2QBY B;  3LSM A;  2HDC A;  3FM5 A;  5EEG A;  2XPU A;  1WPK A;  4MTD A;  2BOL A;  4Q4Z F;  2GAU A;  3IAS 2;  3O3K A;  2R5Y B;  1QA6 A;  2L02 A;  4PK4 A;  4DJA A;  3W6K B;  1IN8 A;  3HB9 A;  1OCT C;  4AU7 A;  3LQR A;  2L54 A;  3PUB A;  4LB6 B;  2PG4 A;  3FIS A;  1R4N B;  2YX4 A;  4FET A;  2J5P A;  3WTS C;  2PX9 A;  1S29 A;  3M8E A;  1RUN A;  3R0A A;  4EM0 B;  4FX4 A;  3S15 J;  3JRF A;  1I50 J;  1RC9 A;  4KT6 A;  1R5H A;  2JVH A;  4U0V A;  3VYR B;  3RPU A;  3WGG A;  3DU6 A;  5FB2 A;  4J00 A;  1EA3 A;  1QGP A;  3H5R A;  3H9Q A;  2OQR A;  4JX4 A;  1TNS A;  2OCC H;  4ESB A;  3KP5 A;  3KCC A;  3BRO A;  3K2Z A;  2O3F A;  3C1D A;  3ZMD A;  3ZQI A;  4RGR A;  4LD5 A;  2G7U A;  2XGE A;  5DUI A;  4Q5S F;  1ZR4 A;  3G4S I;  3E97 A;  4I0A A;  4C3J J;  3JR9 A;  2V6E A;  4HF2 A;  4UHT A;  5DUK A;  1J75 A;  3CCE I;  4KIS A;  3EUA A;  1FEX A;  2QQ8 A;  3BG3 A;  3LSI A;  3U9G A;  1POG A;  3ZMT A;  4GO1 A;  1BOA A;  5LGN A;  2MD0 A;  3GUD A;  2R7O A;  2RNJ A;  2EJR A;  2DA1 A;  5CQE A;  4MEY F;  4IX7 A;  3OYJ A;  2GIZ A;  2LG4 A;  4DZJ A;  1W5C C;  4E7I A;  2V1D A;  3QRF F;  2BXY A;  4PJN A;  2DA3 A;  1U3E M;  3B02 A;  1FIP A;  4N9H A;  1QVU A;  2W7N A;  3CES A;  1VQ4 I;  5EDN A;  3ZQG A;  4NBQ A;  2GM4 A;  4RB0 A;  3BZ6 A;  1U5T B;  5J8C A;  1E2X A;  1XSD A;  3CF2 A;  3DF8 A;  3TO9 A;  4CIC A;  5D4R A;  5IYB J;  1TWF J;  3HSE A;  3TOB A;  3PFI A;  4OOI A;  2M7B A;  3F21 A;  2CV1 A;  3MKL A;  4J19 A;  1X4P A;  4HX8 A;  5GPC A;  2C6Y A;  2TRT A;  2QWW A;  1XS9 A;  3E6C C;  4ABZ A;  4X0G A;  2R93 J;  4XRS A;  3WTT C;  5LGU A;  4PSX A;  3D5L A;  2DPD A;  2WAE A;  4L5J A;  4BUP A;  4PFO A;  5L3B A;  1P7I A;  4DIQ A;  3DU5 A;  2HVR A;  3PFY A;  3M3Y J;  3JAM K;  3WHC A;  3F3X A;  4XN3 A;  4UV9 A;  3P7N A;  3WE2 A;  3ZQC A;  4MGR A;  4YII A;  3WHB A;  3IH2 A;  2UWM A;  3HXL A;  1P4W A;  3N05 A;  1RUO A;  4FHT A;  5LD2 C;  2RC4 A;  3GCM A;  2QSH X;  3PL8 A;  2ME6 A;  3CJR B;  1U5T C;  5KAF C;  3DKY A;  1QRY A;  1YJW I;  5LFA A;  1N77 A;  2PN6 A;  3RKX A;  4I01 A;  1GVJ A;  1O4X A;  2JRT A;  1SEU A;  4O6J A;  2LSO A;  4HZF A;  1D1C A;  2VE9 A;  1HKS A;  4XOR A;  3PIO F;  2OA4 A;  4V2G A;  3SEQ A;  3RZD J;  4LOC A;  4XLC A;  2XKO A;  3CC7 I;  1IN7 A;  5KK1 A;  3O8H A;  5CVJ A;  3GTL J;  2ZFU A;  1U5T A;  5J1Y A;  3R0J A;  2JPB A;  4ZTF A;  3WE3 A;  3BR3 A;  3WTV C; 
#chains in the Genus database with same CATH homology
 3GTJ J;  1JKP C;  1AKH A;  3CDL A;  1ZR2 A;  3BR1 A;  3HM5 A;  3JRC A;  1AU7 A;  3TED A;  2M9H A;  1DU0 A;  4X6A J;  2E2J J;  2DMU A;  3JRI A;  3JRD A;  1FTT A;  3HEF A;  4QTR A;  3A01 B;  2M8G X;  3F0C A;  2HOA A;  4A3D J;  4B4C A;  3LOC A;  1ITY A;  3HOU J;  2YUS A;  3ZQL A;  3BQZ A;  1K83 J;  2DA7 A;  3IH3 A;  2WV1 A;  2LKX A;  3CCY A;  4BXX J;  3Q0U A;  3PO3 J;  3QPL A;  2YU9 J;  2EZH A;  2D5V A;  2X6O A;  2XB0 X;  4B1R A;  2LD5 A;  3LNQ A;  1ENH A;  2COB A;  4D5C A;  3HOW J;  5DS9 A;  2K9S A;  1PUF B;  4MFE A;  5K7Z A;  5E3M A;  3BTC A;  1ETO A;  4JX5 A;  4XID A;  3B6A A;  2E2H J;  5EG0 A;  3UKG A;  2QCO A;  4XK4 A;  4XRM A;  1H88 C;  3LSJ A;  2O9L A;  4CYC A;  2L9R A;  2MW8 A;  4M3G A;  2CRG A;  4BKX A;  3HOX J;  1ZGW A;  2LTP A;  2JA5 J;  1HDD C;  3TP3 A;  3GTK J;  2ECC A;  1JT0 A;  3BG5 A;  4HNV A;  5C4J J;  2DN0 A;  3K2A A;  1JUM A;  5EF6 A;  5FLM J;  2JA6 J;  5K7H A;  2CQQ A;  1TWH J;  2NS8 A;  1RKT A;  5M3M J;  3JRG A;  1GT0 C;  2LY9 A;  1MSE C;  1YRN B;  2DA2 A;  2FX0 A;  1X2N A;  3S1N J;  4DYQ A;  2R7Z J;  2XSD C;  1H89 C;  4C2M J;  1ORK A;  4JYK A;  5F27 A;  3S1R J;  5JLX A;  1VND A;  1UG2 A;  2L7Z A;  3L1P A;  1ETY A;  4BY7 J;  1ETW A;  3A01 A;  4A3F J;  1IRZ A;  1RPW A;  3JRB A;  4DYC A;  2CUF A;  4UUT A;  3BT9 A;  4FE7 A;  4C3I J;  2IAI A;  3B6C A;  2DMP A;  2I10 A;  3TW7 A;  1X58 A;  3BTL A;  1VF9 A;  1BW6 A;  1Q1V A;  4M3F A;  1ETK A;  1WI3 A;  1PUF A;  1APL C;  5M5W J;  5IOY A;  3Q0V A;  3VPR A;  4DW6 A;  5EGO B;  1IC8 A;  4IHV A;  3ZQF A;  1S7E A;  5F0F A;  3GTG J;  4W1U A;  5GPA A;  1SFO J;  1HF0 A;  2H8R A;  1MBJ A;  1XC5 A;  1JJ8 C;  3BTJ A;  4M6V A;  4AC0 A;  3S2D J;  2DMT A;  5JLW A;  1W0U A;  4IHW A;  2E19 A;  3BR6 A;  4EEF G;  5IP7 J;  1DU6 A;  4DYR A;  5E3N A;  2YS9 A;  3OOU A;  2XPV A;  3BG9 A;  4JX6 A;  1MNM C;  1RET A;  2M34 A;  1JKO C;  2ME0 A;  3Q0W A;  3OSF A;  2ID3 A;  2E1O A;  2JA8 J;  4BBS J;  2LLK A;  1VFC A;  2XRL A;  3D1N I;  1D5Y A;  4X1E A;  4BBR J;  3G1L A;  5F1J A;  1IG7 A;  3FK7 A;  2DA4 A;  2P81 A;  1BL0 A;  3Q3S A;  2HQ5 A;  1GVD A;  1JTY A;  3QQA A;  1LE8 A;  2JN6 A;  3M4O J;  1OJL A;  4FIS A;  3ZQH A;  2L7F P;  2XB5 A;  2VKV A;  5IP6 A;  1MH4 A;  3GTP J;  3BR0 A;  2MGQ A;  2CU7 A;  5FKO A;  1Y1W J;  5C3E J;  2N8G A;  2LR8 A;  4M3B A;  3S14 J;  4S0H B;  2KT0 A;  5FKK A;  2O8K A;  1WGX A;  5EGO A;  3HDD A;  3E7L A;  5F0C A;  3G1O A;  5F0H A;  1U8B A;  3IH4 A;  1IDZ A;  2QF7 A;  4NDL A;  5IPA A;  2CQX A;  1IGN A;  4A3M J;  3GTQ J;  1TWG J;  2E2I J;  1TWA J;  1B72 B;  2XGC A;  1MBH A;  1Y1V J;  2JJ7 A;  2K9N A;  1NK2 P;  2HOS A;  1ZTR A;  1CQT A;  3QPS A;  9ANT A;  1HDP A;  2M0C A;  3HGG A;  3DEW A;  1MBF A;  3OIO A;  4C3H J;  4QIW N;  1ZQ3 P;  1GV2 A;  4A3G J;  1FTZ A;  3HBL A;  5HOD A;  4MLO A;  2K9Q A;  3GBG A;  3MN2 A;  4RDU A;  3LSR A;  3HOY J;  3LSP A;  3MVP A;  2ZB9 A;  1IUF A;  5FJ8 J;  2DA5 A;  1GV5 A;  2AHQ A;  1BJZ A;  2OF7 A;  5M5X J;  1ETQ A;  4MIM A;  5F04 A;  2R5Y A;  2DMN A;  2DTZ A;  1I3Q J;  3S16 J;  2XGD A;  2DMQ A;  2LP0 A;  1T33 A;  1JUP A;  5E3O A;  3K7A J;  4Y52 J;  2VKE A;  2WAQ N;  5C44 J;  5FLV A;  2GLO A;  1RKW A;  1X2M A;  1LE8 B;  1JGG A;  2HOT A;  3RKQ A;  2MG4 A;  1ETV A;  5EZG A;  1UMQ A;  2Y31 A;  1B8I B;  1JKR C;  5BNG A;  5IP9 J;  2NVT J;  3PO2 J;  3S1Q J;  2HDD A;  3ZOB A;  3S1M J;  5IYD J;  1MBE A;  2PMZ N;  2TCT A;  4BY1 J;  1ZK8 A;  2NS7 A;  1W0T A;  3W6V A;  3S2H J;  1QVT A;  2Y2Z A;  2X9D A;  2X48 A;  5EEA A;  5J1U A;  4A3I J;  1B72 A;  1TWC J;  1H8A C;  2O7O A;  3OSG A;  1IV6 A;  3SJM A;  2LK2 A;  4FE4 A;  5C4X J;  2FQ4 A;  1A6I A;  2R0Q C;  2VI6 A;  2EBI A;  1A5J A;  3FKI J;  2NVX J;  3JRA A;  2IBD A;  1R9T J;  1P7J A;  1IJW C;  3DCF A;  4A3C J;  3BR2 A;  2ID6 A;  2GBY A;  4G12 A;  1NK3 P;  1WCM J;  1XG1 A;  2HYJ A;  1JJ6 C;  1HOM A;  2CJJ A;  4IEJ A;  3GTM J;  3FK6 A;  2EZK A;  5IOZ A;  1RES A;  2M2E A;  4A3J J;  4L5E A;  5J3L A;  1UHS A;  3TW6 A;  2XPW A;  1JKQ C;  1LFU P;  2H1K A;  4A69 C;  2AO9 A;  2CUE A;  3JRE A;  1OFC X;  4UUS B;  1MH3 A;  3C2B A;  4JP0 A;  2XPU A;  1WPK A;  2R5Y B;  1ETX A;  2NVQ J;  4A93 J;  1GUU A;  2MSY A;  1U9N A;  3HB9 A;  5GP9 A;  1OCT C;  3HGY A;  3TP0 A;  1B8I A;  3IV5 A;  5J1R A;  1OCP A;  4XIC A;  3FIS A;  4A3E J;  1I6H J;  3S15 J;  3JRF A;  1I50 J;  1FIA A;  1RR7 A;  2FJ1 A;  1JT6 A;  2B63 J;  2RAE A;  1T56 A;  4JX4 A;  2R5Z B;  1Z77 A;  5FKL A;  5EZH A;  3NAU A;  3ZQI A;  4Y7N J;  5IYC J;  1G2H A;  3LSG A;  2K40 A;  2JMW A;  4IHX A;  2XGE A;  4D7N A;  3PM1 A;  4B3A A;  5M5Y J;  1ZR4 A;  5FKM A;  3BQY A;  1NTC A;  5FKN A;  3JR9 A;  4C3J J;  2JK3 A;  3S17 J;  1HLV A;  2LVS A;  5F08 A;  1AHD P;  4IHY A;  4I6Z A;  2NOG A;  3H3V K;  1F43 A;  1FEX A;  3BG3 A;  1POG A;  1JUS A;  2EZL A;  4UUS A;  2DA1 A;  3HOZ J;  2L0K A;  1QPI A;  1JTX A;  1F36 A;  4DZJ A;  2Y9Y A;  2DA3 A;  4AYB N;  2WB1 N;  1FIP A;  4A3L J;  1QVU A;  1WH5 A;  3SDG A;  5EDN A;  2VPR A;  2KDZ A;  3ZQG A;  2FD5 A;  3NAR A;  2GM4 A;  2IEK A;  1K61 A;  1FJL A;  3HOV J;  1MBG A;  2JA7 J;  3I4M J;  1ZKG A;  3CQZ J;  5IYB J;  1TWF J;  1E3O C;  1TC3 C;  5EYR A;  4FCY A;  3MKL A;  2OPT A;  4J19 A;  3FIW A;  2HXI A;  2L7M P;  1MSF C;  5GPC A;  2Y30 A;  1VI0 A;  4A3B J;  2TRT A;  1WH7 A;  2R5Z A;  2HI3 A;  2JWT A;  1XS9 A;  1AKH B;  4ABZ A;  4M3D A;  4AUX A;  2R93 J;  5DTD A;  2Y9Z A;  3RQI A;  4XRS A;  5K7F A;  2NVY J;  4D5F A;  4DZP A;  2EH3 A;  1LFB A;  2ELK A;  1P7I A;  3JRH A;  1IDY A;  2W48 A;  3M3Y J;  1MBK A;  3WHC A;  1BW5 A;  3CMY A;  2DA6 A;  4GFB A;  3HKZ N;  2Y0S N;  4A3K J;  1GDT A;  4MFD A;  3ZQC A;  3A03 A;  4RBO A;  3WHB A;  4V2F A;  3IH2 A;  4I76 A;  3I4N J;  2VUM J;  2DJN A;  5E3L A;  2ME6 A;  4QSH A;  4M3E A;  2EQR A;  1SAN A;  1QRY A;  3RZO J;  1BA5 A;  5M3F J;  4W97 A;  2ECB A;  3H0G J;  5EG0 B;  1U78 A;  1O4X A;  1HCR A;  4FTH A;  4CYC B;  3BR5 A;  1EF4 A;  4V2G A;  4D7M A;  3A02 A;  3RZD J;  1U9O A;  4LOC A;  1YRN A;  3GTO J;  3O8G A;  4MO7 A;  4XRS G;  3O8H A;  2R92 J;  3GTL J;  2EZI A;  5J1Y A;  3BTI A;  3G1M A;  3SFI A;  1Z0X A;  2G0E A;  2LFB A;  3BR3 A;  2HXO A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...