2JA8J

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja8J00
3ZQCA 2JA6J 2HOTA 2LLKA 1ZK8A 4FISA 1H89C 1QVTA 4JYKA 1TWGJ 2XB0X 3LSGA 1IJWC 2E2IJ 1LFBA 4I76A 1MBFA 4L5EA 2Y2ZA 5F04A 4EEFG 1F43A 3ZQFA 1IDZA 1PUFB 1UG2A 3BR5A 2CU7A 1LE8B 4RBOA 2ID6A 1FTTA 2O8KA 4BBSJ 1MBGA 3CMYA 4X1EA 1AKHB 1WCMJ 5FKLA 1QRYA 1T33A 2Y30A 2K9QA 5C4XJ 2DN0A 4Y7NJ 1P7JA 4MO7A 5M3FJ 2YS9A 1YRNA 2H8RA 2FJ1A 1ETKA 1O4XA 1JUSA 3JRGA 5J1RA 2MGQA 1MBEA 1OFCX 3HGGA 3LOCA 1G2HA 2EQRA 5C3EJ 1B72A 3GTPJ 4W1UA 5F0FA 2AHQA 4UUSA 1QPIA 3HEFA 4IHYA 2R92J 2EZIA 2JA5J 3HOVJ 5IYBJ 1GT0C 4ABZA 4DYRA 1JJ8C 1Z77A 3FIWA 3CCYA 4A3JJ 3HOWJ 1GDTA 3BG9A 1FIPA 4D7NA 3RZDJ 4JX4A 4XK4A 2MG4A 3JRIA 1GUUA 1K61A 2FD5A 4A3GJ 5J1UA 1DU6A 3DEWA 4XRSA 2JK3A 4GFBA 3GTOJ 3FISA 3GBGA 4MFDA 1XG1A 1I6HJ 3JRAA 5J1YA 3HOXJ 3ZQLA 1Y1WJ 4D5FA 3S14J 4QIWN 2EH3A 5M5YJ 1ZGWA 4A93J 4CYCB 3OIOA 1P7IA 3LSPA 4IHXA 3HB9A 1PUFA 2E2HJ 4MFEA 5FKOA 1BW5A 2YU9J 3Q0WA 3OOUA 2DMUA 3IH2A 1NK3P 1HF0A 2DA5A 3LNQA 5E3NA 3BT9A 1AKHA 1HCRA 2ZB9A 4JP0A 2JA8J 2R5YB 1B72B 1RESA 4BKXA 1OJLA 3SDGA 4UUSB 3JRHA 2VKEA 1MBJA 4M3DA 2K40A 1JKOC 2I10A 4C3HJ 3D1NI 3QPLA 3TP3A 2FX0A 4QSHA 1VF9A 2WB1N 2M0CA 2Y9YA 5K7FA 3TEDA 1QVUA 3C2BA 4A3CJ 2R7ZJ 4IHWA 1JT0A 3JREA 4JX6A 5K7HA 3BQZA 5IP6A 1I50J 5DS9A 3ZQHA 4B4CA 3RZOJ 4XRMA 4HNVA 3GTQJ 2NVXJ 3E7LA 2IEKA 2Y9ZA 1ETOA 1JUPA 2RAEA 1FJLA 3HGYA 2OPTA 4V2FA 2GLOA 4A3IJ 3SJMA 2LY9A 5GPCA 4NDLA 3JRFA 2EZLA 5IOYA 3IH3A 4B1RA 4D7MA 1IV6A 4A3LJ 2R93J 3K2AA 3JR9A 2LK2A 2QCOA 2HYJA 4CYCA 1JGGA 1W0TA 2ELKA 1IDYA 1ZR2A 1WGXA 2MSYA 2ECCA 5DTDA 3TW6A 1TWFJ 1IUFA 1H88C 1RKTA 2WV1A 2VUMJ 1XC5A 3S1QJ 2ECBA 3S1NJ 2HOSA 1ZTRA 3A03A 3GTKJ 1IC8A 3Q0VA 2R5YA 1AU7A 3F0CA 5EF6A 4BXXJ 1RKWA 2WAQN 1MBKA 1VFCA 5EG0A 1JTYA 2CRGA 4BBRJ 3Q0UA 2NVTJ 5E3MA 3K7AJ 3LSJA 4M6VA 3S1MJ 1TWAJ 3NARA 2EZKA 2LTPA 1U78A 3I4MJ 2XSDC 3WHCA 4UUTA 2M8GX 4A3EJ 4BY7J 1AHDP 1HDPA 2HXIA 3PM1A 3BTJA 1WH7A 1ZKGA 2JJ7A 2NVYJ 2E1OA 2JMWA 1SANA 3BTCA 3O8HA 5F1JA 2PMZN 1ENHA 4DZPA 4C3IJ 5HODA 4A3DJ 2KT0A 1OCPA 1HOMA 1ETYA 3G1OA 3IH4A 1X2NA 3S2DJ 4FCYA 2X48A 3MN2A 4C2MJ 2HDDA 1T56A 3MVPA 3HKZN 2K9NA 2X9DA 2R0QC 3BR2A 2CQXA 5JLXA 4A3MJ 2M2EA 4IHVA 2COBA 3MKLA 3FK6A 2B63J 3G1MA 2NS8A 1W0UA 4RDUA 1B8IB 5IYDJ 3GTJJ 1BW6A 3L1PA 2DA3A 4XICA 2DJNA 1MBHA 2DTZA 2LD5A 1FTZA 1ETVA 1Q1VA 5EGOA 4FTHA 1A5JA 5F27A 1UHSA 3BR0A 4Y52J 2LVSA 3I4NJ 5IP9J 2JA7J 4XRSG 1A6IA 3S15J 2L7MP 1FIAA 5IP7J 5M5WJ 4MLOA 9ANTA 2LKXA 5EG0B 1OCTC 1SFOJ 1S7EA 1JJ6C 5M3MJ 3LSRA 2VI6A 1JTXA 1MSFC 4BY1J 3VPRA 4AYBN 1ZR4A 1Y1VJ 2HQ5A 1JKQC 2DA7A 5IOZA 1XS9A 2HI3A 1I3QJ 2Y31A 1MH3A 3ZOBA 1GV5A 4LOCA 3SFIA 5EDNA 5C4JJ 2N8GA 1DU0A 4DW6A 1RPWA 3OSFA 3JRDA 2TCTA 3S16J 1X58A 3IV5A 2EBIA 3CQZJ 1WPKA 1F36A 3M3YJ 1NK2P 1WH5A 1R9TJ 1POGA 3A02A 3HOUJ 3BTIA 1MH4A 2KDZA 3FKIJ 1VI0A 2LFBA 2VPRA 2O9LA 3PO3J 4IEJA 2L9RA 4DZJA 1U9NA 3QPSA 2FQ4A 5EGOB 3PO2J 1EF4A 2XRLA 1UMQA 4FE4A 5EZGA 2DMTA 4B3AA 2XB5A 5FJ8J 2O7OA 2XGDA 1B8IA 3FK7A 2P81A 3BR6A 2VKVA 2DA1A 2NS7A 2XGEA 2AO9A 4MIMA 2M9HA 2HXOA 4M3EA 3TW7A 1RR7A 3A01A 3RKQA 1HDDC 1APLC 4AC0A 2TRTA 4V2GA 1MSEC 2L7FP 2K9SA 1GVDA 1K83J 5J3LA 4M3FA 1FEXA 1ETWA 1WI3A 3NAUA 1U9OA 5E3LA 5FLMJ 3H0GJ 3BG3A 1Z0XA 1TC3C 3M4OJ 3G1LA 5C44J 5EEAA 4C3JJ 1ITYA 4A3BJ 2XPWA 2YUSA 3GTMJ 1TWCJ 5JLWA 2NVQJ 3TP0A 4DYQA 2DMQA 5F08A 1BL0A 5IYCJ 3WHBA 3OSGA 1RETA 2R5ZB 5EYRA 5FKNA 4S0HB 3HBLA 1NTCA 1BJZA 2MW8A 2XPVA 4M3GA 1HLVA 3GTLJ 4I6ZA 5F0CA 5FLVA 3BG5A 2E2JJ 1JKPC 2L7ZA 1JUMA 1IRZA 3BQYA 2W48A 3BTLA 3QQAA 3HM5A 3HDDA 2XGCA 3Q3SA 1ZQ3P 3B6AA 5BNGA 3JRBA 1VNDA 4M3BA 4A3FJ 3BR1A 3HOYJ 2DA6A 4D5CA 4QTRA 1LFUP 2IAIA 2H1KA 2OF7A 1JT6A 2CUEA 3GTGJ 2JN6A 2DMNA 4A3KJ 3A01B 5E3OA 3DCFA 2D5VA 5FKMA 1H8AC 1D5YA 1IG7A 3RQIA 1BA5A 2X6OA 4J19A 4DYCA 1U8BA 5F0HA 2DMPA 4A69C 1YRNB 3W6VA 2GM4A 1LE8A 2IBDA 4JX5A 1GV2A 3H3VK 5M5XJ 5K7ZA 4AUXA 3O8GA 4G12A 1JKRC 5GP9A 5GPAA 3S1RJ 3HOZJ 5FKKA 1ORKA 4FE7A 1ETXA 2DA4A 3UKGA 2JWTA 2LR8A 2NOGA 4W97A 2M34A 2E19A 1IGNA 4X6AJ 2EZHA 3BR3A 2CQQA 3B6CA 2DA2A 3JRCA 3S2HJ 2L0KA 5IPAA 1X2MA 2CJJA 2GBYA 5EZHA 3CDLA 2R5ZA 2LP0A 2CUFA 1TWHJ 2ID3A 2ME6A 2Y0SN 3ZQGA 1CQTA 4XIDA 2G0EA 2HOAA 1E3OC 1MNMC 2QF7A 1ETQA 2XPUA 3S17J 3ZQIA 2ME0A
chains in the Genus database with same CATH superfamily
3H9GA 2JA6J 1N78A 1W7PD 1R6RA 3DPLC 2ICWG 2DU9A 1SFEA 1ZK8A 3TGNA 1FSEA 1VQ9I 2LKSA 3O3KA 4BGDA 1FYKA 4EJUA 3K4BA 1IJWC 1P6RA 1IDZA 2LRDA 2VQHA 4IX7A 3ZQFA 2W1OA 3IC7A 5E79C 1K6YA 1A36A 1BBYA 4PDKA 3TDZC 3RCOA 4B09A 3BR5A 5FLXK 4X0GA 2CU7A 2ID6A 1TLHB 2E60A 2CGPA 3ZCOA 2R7TA 1J5YA 3OYCA 4TV7A 3E0JB 3L00A 4OU0A 1T33A 3KLOA 3RSNA 1YRNA 3BCAA 2H8RA 5DV5A 3C3WA 1O4XA 2O5RA 1FMWA 1E17A 5D5XB 4HQMA 4UHTA 2XVCA 4PSWA 2I8DA 3CUQC 1QZEA 1G2HA 4RLQA 5AONA 1HQCA 3QPTA 3A0BC 2FA5A 2LY2A 2ZXJA 5F0FA 1BR2A 4YIRX 2LDUA 1QPIA 1TQPA 1KU7A 1FMVA 4CCJA 2VLAA 2JA5J 1QO0D 3GZNB 2DLLA 1BN5A 4ABZA 4DYRA 1ON1A 2O8XA 3FIWA 3F8MA 2LBFB 1GDTA 1XGNA 5D5VB 1FIPA 3VDXA 3MQ0A 2K7LA 1J0RA 4JX4A 4ZZDA 3RZDJ 4GRIA 4XRFA 2MG4A 3DV8A 1GUUA 1K61A 5DM6F 2FD5A 3GFJA 1DU6A 3ULQB 3DEWA 3BC8A 5LHIA 2PJRA 3GTOJ 3FISA 2OZUA 4HA8A 2NRAC 1I6HJ 1DP7P 5FO5A 4NNJA 4UV9A 1Y1WJ 3A4CA 4PJ0C 3OS1A 4CYCB 2KFDA 5FRMA 1OISA 4G6TB 2K9LA 3V8KA 2E71A 3TO9A 2EILH 4HQEA 1PUFA 1AWCA 2DQRA 5FKOA 2IA0A 2BV6A 2OJED 2L5QA 2RC4A 4M6YA 4UVBA 2YU9J 3JSOA 2HPMA 2X6WA 5H6QA 1T08B 3BPXA 3FXRA 1NK3P 4L18B 1HF0A 4UVCA 3LNQA 1AKHA 1S29A 2H6BA 3HRSA 3ABTA 3I71A 2QENA 1W36C 2BE5F 3QYEA 4XSXF 2R5YB 1FY7A 1O3SA 4CHUA 1OJLA 3SDGA 2QSFX 3JRHA 2VKEA 4M3DA 1RZ4A 3WTXC 4IOCF 2I10A 1R1TA 1P92A 2X85A 3TP3A 4NC6A 3NEUA 2FXAA 2F4OB 2IRFG 2XSJC 3TEDA 3C2BA 4JBAA 2KL4A 1O3RA 4OMYA 4XN3A 4BHPA 1RRJA 2V1NA 1VQLI 4G94A 3H3ZA 3KEYA 2X0LA 3SDBA 2RNGA 3QAHA 4RM2A 5KHDA 2B9SA 5DS9A 3WTZA 4B4CA 3ZMUA 2VBZA 4XONA 3MKYB 4HNVA 3GTQJ 3RZOJ 1MD0A 4PSXA 2V26A 3EUAA 2DOEA 2UV1A 3K9TA 3E7LA 2IEKA 3B73A 5LRRA 4HDVA 5LHGA 1R5ID 2XAHA 4Y13A 2Y9ZA 1W5TA 2HDWA 3PJRA 1JUPA 2RAEA 1FJLA 3HGYA 3DTIA 2OPTA 5LGNA 5GPCA 3JRFA 3M1EA 5IOYA 2LF7A 1XB4A 1WKMA 2ADUA 2QCOA 4I0AA 3HOTA 3AKZA 1JGGA 3VB2A 3EUHA 2O61A 2XRNA 2PX9A 4LITA 4C2TA 3KP6A 1O3TA 2RN7A 3LMMA 4ANJA 4H0EA 4CCOA 3TW6A 3RKYA 1S7OA 4BJ6C 2L2OA 1IUFA 2A6EF 2VUMJ 5L3EA 2VC0A 1YHQI 2HOSA 4G6DA 3K4CA 2AXLA 1AU7A 5EF6A 1ZG1A 1RKWA 1W36D 3F8CA 3OMYA 5EG0A 3L2UA 2PN6A 3JAMK 2J5PA 3Q0UA 2NVTJ 4GCVA 3IRRA 4E7KA 5EJCA 4A5NA 1JXSA 3RJPA 2HU9A 4N9HA 2WY8Q 2KIUA 4UUTA 2M8GX 2ZFWA 2XROA 2HDCA 5HNHA 2YX4A 4Y4RA 4BY7J 1AHDP 2V1UA 4YG2F 3I3LA 1ZKGA 2JMWA 3BJ6A 1VTNC 2X6XA 4C3IJ 3QRFF 1XMXA 2XKPA 2AS5F 1BM9A 5E17F 2K4BA 3K4LA 3U21A 4YFXF 4G7HF 2R7UA 2CG4A 1ETYA 2HS5A 3G1OA 4Q4ZF 3R61A 5K5RA 3MN2A 1QHGA 1VQ5I 3DEUA 1V5FA 1XSXA 2X9DA 5JLXA 2BXZA 2B63J 1IRXA 1I39A 3LSMA 2ZNZA 4RAGA 5IYDJ 1V55H 3V8JA 1BW6A 2MABA 2DA3A 3EPZA 4XICA 2ZO4A 2DJNA 2DTZA 3IWZA 4AD9A 2C6YA 2OC6A 4BAYA 1ZH5A 1UHSA 3BR0A 4IZZA 3O2PE 1S7AA 1W5CC 3BY6A 3I4NJ 1OYIA 4XRSG 2D45A 4IHTA 3WGGA 2DT6A 2GA2A 4XKBA 3CCEI 3OYKA 4MLOA 1FT9A 5E1ZB 5EG0B 2R7WA 4EJWA 3W2AA 2A69F 1SFOJ 2V1DA 1FBQA 3EYYA 1ULYA 3LSRA 4RS8A 1JTXA 3RPUA 2V6CA 2JT1A 2LYCA 1GXQA 1XTAA 3GCMA 1Y1VJ 1N77A 1GVJA 3DPTA 4XM3A 1JKQC 5IOZA 4E7HA 2CFOA 4LG0A 2BW3A 2KQRA 3F72A 2RGVA 5EDNA 3WODF 5C4JJ 2N8GA 1D1AA 1RPWA 3KP5A 3OOPA 2TCTA 3S16J 3N4MA 3WGHA 2GIVA 4BQNA 2QA4I 1C0WA 1VQPI 3PNTA 1NK2P 4U87A 1JHHA 1WH5A 2BBYA 3A02A 3QYFA 3IL2A 4B43A 2VPRA 4HX8A 1H9GA 5HLGA 3ABLH 3QODA 5ILSA 3OYIA 1X1DA 4IHSA 1EF4A 2IT0A 1UMQA 2GIZA 1OCCH 5EZGA 1P4XA 1K78A 2EFOA 2ACJA 3V7CA 2XGDA 4ESFA 3C7JA 2F4MB 1B8IA 3VOEA 2P81A 3HOSA 2DA1A 2P5VA 4PK4A 2NS7A 2JSCA 2PQ8A 2AO9A 2M0MA 3ASNH 2O3FA 1XSDA 2LY1A 1HDDC 4AC0A 2VQCA 4E70A 4BJ5C 2M30A 1YITI 2L7FP 1TT0A 1JGSA 5JFRA 1GVDA 3HUGA 1W5SA 1HW1A 2GXAA 1FEXA 4LG0B 1Z7LA 4EM0B 1T6SA 3DXJF 1ZRFA 4A0XA 3QWLA 1UFMA 3S8PA 2NNYA 1O7FA 3VSKA 3LA3A 5C44J 2H8WA 3BG6A 2L3DA 1H0MA 1ZG5A 4PGGA 2M3AA 2XPWA 4HF2A 4A3BJ 2WY7Q 2NVQJ 1ZRDA 3U2RA 3RYRA 1OLTA 4NC8A 3ESWB 4LFUA 3HBLA 1NTCA 2MW8A 1HLVA 3OYFA 3OS2A 5F0CA 2L02A 2E1MC 2Q2EA 4L5IA 5FROA 2P6TA 3KZIC 1JUMA 1S6LA 2DT7B 3ZMZA 3OYHA 3BWGA 3HPGA 3CCMI 1GLNA 3QQAA 3HDDA 3HYIA 1K78B 2VKDA 3CC4I 4HBLA 1VNDA 2JA2A 1FWZA 2X1CA 2XF6A 5DD4A 2H1KA 2OF7A 3T8TA 4ENNA 3CC7I 3LFKA 3QOPA 4RGRA 2DMNA 2VE9A 3DU6A 5E20A 4PFOA 2CH0A 4NC7A 2J5OA 1YX3A 5E3OA 3ZPLA 2M87A 3I56I 1KQ8A 1LJ9A 1O57A 5FKMA 4BDZA 3FBIB 1IG7A 3RQIA 1P9QC 4XQFA 1OMIA 1Z1DA 3SEZA 1SMYF 3IRQA 5BPDA 4OIQF 4DYCA 3LSHA 4YIIA 1U8BA 3KP4A 5F0HA 5LD2C 1TW2A 5ICEA 5J8CA 2MBFA 4II2A 1FZPB 3W6VA 1F1ZA 2FQ3A 1LFPA 4HNUA 1GV2A 5H6RA 2IS2A 2FSWA 3H3VK 1NG6A 3AG4H 2EV6A 1MNEA 3JTGA 1AA7A 3HOZJ 2DYRH 3E6BA 2R7SA 2NOGA 3EUHC 1NG7A 4W97A 4U0YA 3S3MA 2M34A 4P55A 5DYMA 3FM5A 1QZYA 5CQGA 2W4SA 1K4TA 2QKMB 3MKWB 5JHFA 2TDXA 3U1KA 2QZ8A 1E3PA 4L0ZB 2DA2A 1GXPA 3CJNA 1YO5C 3S2HJ 3CO6C 3T1BA 1UELB 4BEHA 4BACA 2CJJA 3DLLF 4LJZF 1D0XA 2JUGA 4B44A 3ECHA 4F93B 1PDNC 4BQAA 1FYMA 1DGWY 3DU5A 3FX3A 3K10A 1L3LA 2QUFA 1STZA 4N4OB 4XR6A 2RV8A 2XPUA 3S17J 3R60A 1LDKB 4FX0A 4O5VA 4HRIA 1R5GA 2HOTA 2LLKA 4Q5SF 1IRFA 1YW8A 3J81Z 1TNSA 2LKPA 4JYKA 1KGSA 1MBFA 2Y2ZA 2VN2A 5D8KB 4AM3A 5E8GA 1YLFA 4GYGA 1ZREA 4AIDA 1K6OA 1LDJA 5GAHJ 1ZELA 4HF1A 4P9FA 1RI7A 2O03A 2EV5A 5HS7A 1YI2I 4E7SA 3H92A 2Y30A 5C4XJ 2JVGA 1P7JA 4PJNA 3S3OA 5M3FJ 4NBQA 2OV7A 1VQMI 3FXLA 2L4MA 4FT8A 5L3GA 4IRIA 3GZ5A 3L2WA 1WQ2A 2HZDA 1JUSA 4AIJA 2MGQA 4HZFA 1OFCX 4M9XA 1F5TA 3LOCA 1BOBA 3LAPA 1J7KA 4BEHB 1HKQA 1VQ4I 5C3EJ 2IGOA 4P1WA 4P9UA 3GTPJ 5FB2A 3CDIA 3AFHA 5J6XA 3WTTC 4IHYA 2R92J 2UUZA 2EZIA 3HOVJ 3IHUA 3I54A 1GT0C 3OYMA 2VONA 2M8EA 2BGCA 4U0VA 4WK8F 2ZXHA 3C2HA 5FFZA 4D7NA 3WG7H 1G59A 3JRIA 4A3GJ 1D8JA 4ZYAA 4XRSA 4KJZA 4LK1F 1YG2A 4MFDA 1XG1A 2CQ7A 3L2VA 5J1YA 5FGMA 1YTYA 1YJNI 3HJEA 3HZJA 1BJAA 4ON0A 1DUXC 1OYYA 4XNFA 4ZZLA 1KA8A 1IN6A 3LSPA 1GHCA 2BY0A 3HB9A 3ML6A 4MFEA 4G9YA 2YSRA 2QKLB 2DO7A 3RYPA 2CUZA 3IAS2 2EIMH 5L3BA 4HLXA 2BZTA 2JTVA 1QU3A 3KP2A 5E3NA 3BT9A 4AIKA 2LMDA 4OAYA 5IT9Z 3FKJA 4JP0A 5ICGA 1WHUA 3ZMDA 1T0FC 3LA2A 2DPUA 1B1BA 1JKOC 4EM2A 2WBMA 2JUCA 4A5MA 3D1NI 2V7FA 4Y17A 5HNFA 1QGPA 3GFMA 4IRHA 5K7FA 2Y9YA 1ZGJA 4EM1A 3R0AA 4PJJA 1I3AA 2F5FA 1BI2A 4RAYA 4CZCA 3BZKA 4L9VA 3RIRA 3JREA 4JX6A 1A6QA 4XLFA 2JPCA 4FASD 2MC4A 4KN7X 1B9MA 1RNLA 3O6BB 2IPQX 1DPRA 2EK5A 4N4NB 4OAZA 1KU3A 3S2WA 3ZQHA 4A0YA 1SAXA 1IN8A 2ELJA 4JQFA 2Z33A 2KJBA 4C9YA 4EJVA 3DBLB 3RPUD 1FC3A 3CCVI 3PUBA 4M73A 3JTHA 1ETOA 1WFXA 3ZR8X 2R7OA 3C1DA 3MZ8A 1VQ8I 2W84A 4ZDOA 3K1MA 1ONVA 2ZMEC 2QSGX 2HQAA 2GLOA 3BJOA 1P4AA 3SXYA 1KZHA 4BHBA 2EZLA 4B1RA 4D7MA 1QPMA 2KZVA 2NXNB 3ZP5A 3OYJA 4A3LJ 1MDMB 2LK2A 4RB0A 4CYCA 5IT3A 1W0TA 2ELKA 1RUNA 1IDYA 3BCBA 3RQ4A 1WGXA 2CMPA 4YELA 4F3QA 2ECCA 5DTDA 1TWFJ 2P7CB 1H88C 3M1CA 2ISYA 3K4NA 2GXGA 1XC5A 4EGZA 2WAEA 4BXUA 3IAM2 4UV8A 1YYVA 2E35A 1ZTRA 2VE8A 3CZ6A 1DDNA 1I5ZA 2R5YA 5CVIA 3W6KB 4BXXJ 2DDAA 3CLOA 4HEA2 3G2BA 3G3ZA 1DQUA 4HAMA 3J7ZI 2ZSHB 2IS6A 2CRGA 4BBRJ 1D0YA 2K3PA 1J09A 4M6VA 4B48A 3S1MJ 4ZJZA 1TWAJ 3S3NA 1FP2A 1U78A 1I1GA 5E1WA 1YS6A 4GO1A 1EH7A 5JR3A 1VQKI 4XSZF 3CMAI 1Z7UA 2HNHA 3LL7A 4A3EJ 2L01A 2HXIA 2MH9A 3BTJA 2DOFA 2B7EA 1RR8C 2HVRA 3MD2A 1WH7A 2JJ7A 3L9FA 1FOKA 3O8HA 1SANA 5F1JA 2GXBA 3B02A 3GVAA 4DZPA 5K1YA 4ZH4F 4XLEA 4A3DJ 1BR1A 1Y0NA 2KT0A 2MH2A 1E2XA 2DFEA 2WAQA 5A2QZ 3K4KA 1U5TC 1BI1A 3IH4A 4HG2A 3TDUC 4ZC3A 1X2NA 4YRVA 3KZYA 4FCYA 1BC8C 2X48A 3S2DJ 2HPIA 3GYHX 2K5CA 3KEQA 2HDDA 3MVPA 2R0QC 2K9NA 2COBA 3FK6A 4HX4A 4Z2YA 4RDUA 3GTJJ 3KIOA 3ZMTA 2IVMA 2LD5A 3I5UA 2VOPA 3VYRB 3HSRA 1ETVA 1Q1VA 3LA7A 4RB2C 3P9KA 3R4KA 4PJMA 4Y52J 2R7QA 3HG9A 1ZGAA 2HTSA 3MWMA 4A6DA 2JA7J 4PCQA 3S15J 2L7MP 2R7XA 2FUG2 5KAFC 1FIAA 1ZLJA 3MZHA 5M5WJ 9ANTA 1IV8A 1LEAA 3J81K 2XAFA 3M9AA 3KX2A 1Y8RB 3BP8A 4WCGA 3KCCA 2VQGA 2ESNA 2GOXB 2EV0A 3E6DA 4PUSA 2F5CA 4R8HA 5LBQA 2NS0A 2HQ5A 4B8XA 3TOAA 2DA7A 1YE9A 3WE2A 1I3QJ 3ZQQA 1PUEE 2Y31A 3TMOA 1PJRA 3L09A 3E3VA 3EQLF 4XKWA 3M7GA 4NQWA 3SFIA 1ON2A 4KDPA 1DU0A 4N0BA 2VIXA 3WG9A 3W2WA 3JRDA 2FRHA 2A68F 1X58A 3F6OA 3IV5A 2EBIA 1KU9A 3CC2I 2IGMA 4S05A 2V9PA 3M3YJ 2DTRA 1V5EA 1A31A 2XKOA 2O0YA 3H5RA 3KEOA 4S04A 3BTIA 1XD7A 2XV4S 2KDZA 3FKIJ 3E5QA 3OYAA 1MJAA 2V9KA 2CYYA 4IF4A 2O9LA 3HRUA 1XCVA 1YW9A 4J00A 3QPSA 1PP8F 4UUVA 3PO2J 1TT5B 4JOMA 2PJPA 2XRLA 3CF2A 2HKOA 4G8XA 4FE4A 2DMTA 2VKHA 1BIAA 2A5YB 3F9KA 3OR1C 2XB5A 1WJCA 5FJ8J 1OR7C 1YIJI 4CCMA 3OY9A 2VJJA 3AG1H 2CQNA 3VODA 3WTUC 3LSKA 3FK7A 4PZJA 4AIHA 3H35A 5DCFA 2V6EA 3BOQA 4V19K 3V42A 1TL8A 2XGEA 4MIMA 3I59B 2EFWA 4AWXB 4KMFA 1XPXA 2M9HA 2DK5A 4M3EA 1ERDA 1RR7A 3A01A 4LB5A 1MSEC 1D1BA 3LQRA 4UXNA 3GWZA 4WWCA 4D1QA 1QHHD 5L3FA 2M45A 1S8NA 5HS8A 2L4AA 3A0HC 5HS9A 3ABMH 5E3LA 4NQWB 3T8RA 3BG3A 1Z0XA 1ZARA 2KDOA 3M4OJ 3G1LA 2CSOA 2E1MB 5EEAA 1ITYA 2W00A 3AL0B 2OCEA 2YUSA 3GTMJ 1TWCJ 3LSIA 4XOTA 2XDVA 3DF8A 2W24A 2VT2A 5GTHC 1ZRCA 3KYLA 5F08A 2P5LC 2G7HA 5IT9K 5GADJ 4HLYA 2LC2A 4ZDLA 4LMYA 3ZXSA 5CVVA 3KFWX 4M3GA 2O6GE 3PUFA 3REOA 4I6ZA 5BPIA 2DDBA 2DJIA 1ODDA 3BG5A 2P0WA 1JKPC 2L7ZA 3BTLA 1XGOA 1X4OA 2CW8A 4ITVA 2JZYA 3MEXA 3K4JA 4DJAA 1L0OC 5AIPA 2VASA 2WAFA 3W2VA 3M07A 2D2WA 1U2WA 3H36A 4QTRA 1LFUP 1A35A 2IAIA 3PNYA 3CCLI 2BY3A 2LNBA 4Y3OA 2CW7A 5LGUA 1ZYRF 4HDUA 1LNWA 1UAAA 4LLLA 2JQ7A 3OYLA 5B1AH 2OTJI 3P9CA 2AQEA 4D9JA 3A01B 3HSFA 2KRFA 3TO7A 1TQMA 2D5VA 2EFNA 3WGIA 3ABKH 4I01A 1BA5A 2VT3A 2W85A 2W82A 3WE3A 4L9JA 2K27A 2KKOA 2D1HA 2DMPA 4M9ZA 4WXHA 3W3CA 4BQOA 5B3SH 4ENMA 4NHJA 4YEJA 3AG2H 1YIOA 2FNPA 3G73A 4JX5A 1LE8A 3I55I 4KYWA 4MQ9F 4HV5A 2VODA 2E1NA 3O8GA 1N25A 2KZGA 5GPAA 1TZLA 1ORKA 4EJOA 2DA4A 2XASA 2QVOA 2LR8A 1XMKA 3V4GA 3BR3A 1RUOA 3OL3A 2CQQA 1SFKA 2FU4A 1J75A 3JRCA 1W7PA 1Z05A 2OCCH 3KYCB 1I6XA 5HDGA 2A07F 1T95A 4LLNA 2H1LA 5IPAA 2GBYA 3CDLA 2LP0A 2CUFA 1TWHJ 3FM3A 5ILVA 3OYGA 5TGTA 3ZQGA 3R0JA 5ED4A 4F92B 4KT5C 2G7UA 3DKXA 4IQ4A 1F4KA 4MQVA 3Q5FA 2NOJB 3TBIA 2PMHA 3WTSC 3Q9VA 1E3OC 1HSTA 3AAFA 2QF7A 2BXYA 1UCRA 4UB6C 2I5UA 4EVIA 5LLQA 4A6EA 2ZBKA 2E2IJ 1LFBA 3ASOH 4I76A 1F43A 3CLQA 1FPQA 1Y39A 4GXOA 2QBYA 2QQBA 1UG2A 2MFZA 2XGXA 2GWRA 2Z3YA 3SZPA 1LE8B 1FTTA 1LKXA 1R36A 3CMYA 4RGSA 4X1EA 5A2QK 1WCMJ 1X3WB 5FKLA 1Y0UA 2K9QA 4HF0A 4XLPF 4Y7NJ 1USTA 1P2FA 3OYBA 1LEBA 4EJTA 1B6AA 4DQ2A 3VYTB 3LAJA 3SHFA 2FJ1A 2L7KA 4GDFA 2RVCA 2EWNA 3JRGA 2A5WA 5J1RA 3PFYA 1MBEA 4EATA 1W7PB 2RREA 3HGGA 2DAOA 3RKXA 4HV6A 1KYZA 5CVUA 4DBRA 3K0LA 1B72A 4ESBA 4W1UA 3LSTA 4O3MA 2W57A 3ISPA 3COAC 3CCUI 1IZ1A 1CF7B 3DFGA 5IYBJ 3FHNA 1MNDA 1PVEA 1TNTA 3K69A 3CJQB 1JJ8C 1Z77A 4BS9A 4DIQA 2CFXA 3SZGA 3HOWJ 3CMEI 4G7ZF 3BG9A 3CCQI 3N97A 3I9V2 4YIFA 4XOPA 3ROUA 5HLHA 1XGMA 4M9SA 4OIOF 2GQQA 2IS1A 4KT6A 3K1PA 3ABUA 2Z9OA 3VYSB 2BHYA 2JK3A 2DI3A 2QBYB 2EJRA 2KHMA 1SEUA 2BVLA 3JRAA 2WV0A 1R1VA 3V7SA 3HOXJ 3S14J 4D5FA 4QIWN 2A3SA 4J01A 5M5YJ 4A93J 3OR2C 1P7IA 1D0ZA 4IHXA 5EEHA 5BQTA 5DUIA 4EQQA 3OYNA 4UNOA 5F64A 1BW5A 1FSHA 3SZTA 1IN5A 5H2FC 3OOUA 4I7HA 2WWYA 2DMUA 3IH2A 3HTSB 2VXZA 3BJAA 1FOXA 3I0TA 3HC7A 4KIFA 3CUQA 1SD6A 3PSFA 2FMLA 5J4VA 1HKTA 3WU1B 2ISZA 5DCMB 5E18F 2DCEA 4Y33A 5F6FA 4RB3C 1B72B 1RESA 3RPQA 4EMSA 2BOLA 1LB2A 1MBJA 1UG0A 2K40A 2E5NA 2HVQA 3NWTA 5D8LB 1IW7F 2VJIA 3QPLA 4RGUA 2FX0A 4XKVA 5DDGA 4QSHA 4CZZA 3VWBA 3GUDA 4I02A 2M0CA 3IKTA 1K7AA 4HSRA 3K2ZA 1MZBA 3E5XA 4BUPA 1QVUA 3MMYB 5E1XA 2QQ9A 1LUJB 3I58A 4RAZA 4IHWA 1JT0A 1WJEA 2CQKA 5K7HA 3CP2A 3BG7A 1UB9A 3TQNA 4IXAA 3KPHA 1I50J 3F23A 1HXDA 2R4GA 1JE8A 2NVXJ 4EGYA 4CICA 3N05A 2K9MA 2ZC2A 1MJBA 2EB7A 2PBIA 5CLSA 2DT5A 5HDNA 4Y15A 3D5SC 4Q47A 4M74A 2CV0A 1YFHA 2A6TA 3NRVA 4BXFA 2Z16A 4L0YB 1DPUA 4YFNF 1EH6A 4OOIA 1HBXG 4A3IJ 1E0EA 5JI6A 4OINF 4KN4X 3IH3A 1BOAA 1S3JA 2R93J 3CUQB 4I2OA 2HYJA 2F2EA 1U6GA 1ZR2A 3FWEA 1EA3A 3F8FA 4M6XA 1YS7A 5KVRA 3J80Z 2MSYA 5L3DA 3V7RA 5BS6A 1USSA 2JRMA 4HW0A 1OCRH 3DEEA 1RKTA 5CYVA 4OIPF 2FNAA 1OKRA 2QWWA 4PGHA 2E36A 2MYSA 2CW0F 4GYIA 3OIQA 4KISA 2HR3A 3A03A 2EPFA 2HYFA 1IC8A 1HW5A 2L9SA 2WAQN 3CESA 1ZHFA 1VFCA 2HYGD 3A2KA 2COMA 4KITB 3HIFA 1R1UA 4KICA 3TL4X 5E3MA 2IA2A 1FBUA 4ETSA 4CXFA 5B66C 1R58A 3NARA 4LIUA 3KP7A 2IP2A 1YX5A 3I4MJ 3FZVA 2XSDC 4CDGA 1S72I 1QZZA 5HLIA 2X51A 4I09A 1VZ0A 1V3FA 4UY8I 1HDPA 3K70D 2NVYJ 2AXTC 1BIBA 1V4RA 3OL4A 2DOAA 2QGUA 2PG4A 4RMNA 4IO9F 1BI0A 1ENHA 2VC1A 5HODA 1MW7A 4XLNF 1EKEA 4BL0B 1LPQA 2M5WA 1OCPA 3EUKL 3FMSA 2P4WA 3E97A 1HOMA 3QPHA 4LB6B 3WU0A 5ICFA 2X1EA 2LREA 4C2MJ 1SVOA 1T56A 2XAGA 3BR2A 3MAJA 2CQXA 2A6HF 3KP3A 3G1MA 2QQ8A 3FDYA 2QYOA 3E5UA 1MDMA 1FTZA 4PJLA 3VYUB 3I4PA 4R79A 1FNNA 5EGOA 3T0YA 4U7BA 1A5JA 5F27A 3EDPA 2PMZA 1R7JA 3GX4X 3M8EA 2EFPA 5KNLA 1IXSB 2LKXA 5LEKA 4HYEA 1OCTC 1R22A 1JJ6C 4E6KG 2VBWA 4MEYF 2VI6A 4E7JA 3VPRA 4BY1J 3HKZA 3CTAA 5LEJA 1TQIA 3WTVC 2HTJA 3DPUA 1ZR4A 5HVQC 2RKHA 3CUOA 3EETA 1YJWI 4LG3A 2A05A 2Z99A 2OQRA 2VJ4A 4PFPA 4CSWA 1HKSA 3ZOBA 1GV5A 2P5KA 4QPQA 2FOWA 3WU2C 5KK1A 2X6YA 2PLYA 3MCZA 1TW3A 5D5UB 1R00A 4DW6A 1RIOH 3OYDA 3OSFA 3CCJI 4ZTJA 5CQEA 1LQ1A 2DYSH 4FETA 1FYLA 1FBSA 3CQZJ 4Q48A 1K4SA 1F36A 1SD7A 1NH3A 3DTEA 1WZ2A 4JK1X 4BE2A 2DODA 1MH4A 4IKFA 1XGSA 4AYBA 3G71I 2H94A 2MD5A 1VI0A 1IF1A 4LD5A 2CO5A 4O6JA 3PO3J 5KAIC 4IEJA 2QLZA 5J40A 2L9RA 4DZJA 3E6CC 2FQ4A 5BMZA 2MLGA 5EGOB 4BNCA 2E34A 3JSPA 1LVKA 5D4SA 3RKWA 2D1VA 2DQLA 1WJAA 3F3XA 1G3YA 5DD8A 4CYDA 1QBJA 1R23A 2F5VA 2RQQA 2Y0MA 3VFZA 1X1PA 2YPRA 3RI4A 2LF8A 2HQRA 2AQFA 2DK8A 3HRMA 2ZJPF 1UZCA 1APLC 1SFUA 3CD6I 2OA4A 2TRTA 4V2GA 1T98A 5GTIC 1BR4A 5JVGF 4MNUA 4G6QA 4BDYA 1K83J 5J3LA 4M3FA 3D5RC 4U7DA 2YU3A 1SVMA 2NVUB 3J7AO 2M1BA 3NAUA 4WXDA 2GOMA 4RB1A 3GO5A 2NNNA 4R1HA 3PSIA 1VQNI 3P5JA 4C3JJ 3F6VA 1WJDA 5DM7F 1R71A 2P7VB 1UJ8A 5JLWA 5K5OA 1V5GA 1U0JA 1X3ZB 3HHGA 3TP0A 1BL0A 2R5ZB 1PP7U 5EYRA 2M7AA 1X4PA 2PI0A 4S0HB 2STTA 1BJZA 2XPVA 1SMTA 2FE3A 4MTEA 3ZQ7A 5FLVA 5K5QA 4I98B 1IRZA 1HSJA 2DFHA 3ZMVA 3GFLA 1EV7A 4A0ZA 3B6AA 5D4RA 1OYWA 5BNGA 3E6MA 1KQ9A 3LFUA 3LQQA 4A3FJ 3HOYJ 3FXKA 4D5CA 4EV0A 4DGWB 2Z1DA 4G7OF 4OIRF 1BI3A 4QLCU 3CCRI 3PFIA 5D6FA 3UR3C 5HDKA 4WX9A 1H8AC 2OTLI 3GF2A 2IA1A 1U8RA 2Y75A 3BPVA 2DW4A 1PYVA 4J19A 2E5ZA 1VQ6I 1MIJA 4A69C 1YRNB 2XC7A 2GM4A 3IP4B 3I59A 2V1XA 4RA2A 1OPCA 5FFXA 2XAUA 5K7ZA 4XLAA 2JVHA 1MGTA 2F4IA 4IOAF 5FKKA 2R7FA 3UKGA 1ETXA 4ESJA 1ZN2A 3RTRA 4IL6C 1MMGA 2E19A 3F8BA 1IGNA 4X6AJ 2UWMA 5ICCA 1YW7A 2CWEA 3G6EI 4B47A 4XORA 3HL2A 4P96A 3J80K 4I99C 4BYYA 1X1CA 2HWVA 2HFHA 1XSVA 3TOBA 1WRJA 2KIFA 2EA4A 4ZDPA 1Z9CA 1X2MA 2XF7A 2ZXIA 2WADA 2HKXA 1T2KA 3QOEA 2GA1A 2ME6A 1D8KA 1CQTA 3PIPF 2L54A 4XIDA 4OMZA 2G0EA 2STWA 3H5AA 1MNMC 1D1CA 2PJRB 3R6SA 1ETQA 1RC9A 4KMUX 1Q1HA 1SD4A 5LHHA 2K86A 3JW4A 2KRCA 2ME0A 3ZQCA 3ELKA 1SVLA 2GZWA 2JRTA 3HTUA 4FISA 1H89C 4CH7A 1QVTA 1TWGJ 2XB0X 3LSGA 4CGZA 4EEFG 4L5EA 4RAFA 5F04A 1PUFB 4F91B 2W25A 3SQNA 4II3A 2XAJA 2ZJQF 2IXSA 1WI9A 4MTDA 4RBOA 5J8FA 4E7LA 2Y0SA 2O8KA 4BBSJ 1MBGA 3GEZA 2FBHA 3BROA 1DP3A 1SC7A 1Z67A 1AKHB 1I1SA 3H9JA 1QRYA 1CGPA 2MC3A 1IN7A 1YOVB 2DN0A 2CS3A 4MO7A 2EIJH 2EIKH 4QWQA 2H6CA 2YS9A 2ESHA 5DUKA 1KU2A 4IJAA 4CO8A 3DWLE 1ETKA 2MA3A 3IKVA 3KYDB 3QYBA 3LWFA 2NYXA 4NB5A 1P4WA 5D6EA 3QP6A 4KFCA 3K1NA 2EQRA 2WTEA 5ILUA 3J7AY 4IPAA 3JCUC 1M1EB 1V54H 1HC8A 2AHQA 3D0SA 4UUSA 3L2RA 4MGRA 2F5DA 3PQKA 3DP7A 4D0PA 3HEFA 4A2UA 4XLCA 4ENJA 1ZLKA 4DBQA 3M8FA 4E4HA 5B5EC 1BC7C 5J47A 3FF5A 5LGTA 1EH8A 4XN0A 3CF5F 2GAUA 3CCYA 4A3JJ 3QU3A 2YR2A 4UB8C 3HXLA 4KA4A 4XK4A 3CMMA 1X19A 2BVMA 2E7WA 3WTWC 5J1UA 1IXCA 3FXUA 3KE2A 4GFBA 2XUBA 3K6GA 4N9IA 2ZSIB 2R3SA 2XHKA 4XL9A 3CO7C 3GBGA 5TRDA 1HA8A 1Z6RA 3CJRB 3ZQLA 3MFKA 5IY5H 3QU6A 5FD5A 4E7IA 2EH3A 1B9NA 1ZGWA 4UVAA 2VXDA 4IRGA 3OIOA 3P7NA 1Z21A 1Z3XA 5TJJA 2E2HJ 1VQ7I 2HQNA 3MKZA 5L3CA 3Q0WA 1D3YA 5CPRB 1Z6TA 1TTYA 2HOEA 2G9WA 4BH9A 2LSOA 1WJFA 2DA5A 3E1SA 2FOKA 3GZ6A 1HCRA 2YX7A 1R49A 2ZB9A 5D5WB 1KQ0A 3L2QA 1EJ9A 3FMQA 2JA8J 1TBXA 1MKMA 1MMSA 4GGGA 3FXMA 4BKXA 3HSEA 5CVRA 4UUSB 1I27A 2K4JA 2M7BA 4ASNA 3H0DA 5FRNA 1OCOH 4H4KC 4C3HJ 2OAZA 1T8IA 3SFZA 1G6NA 2KISA 1VF9A 4HX7A 2K85A 2WB1N 3ZGKA 4NUBA 2KIQA 4BE1A 2KPMA 4L9TA 1YQAA 2VL8A 4A3CJ 2WC2A 2R7ZJ 4LK0F 6PAXA 3VEPA 1XCBA 3IUOA 1G3TA 4LIVA 4U88A 3BLYA 2KIMA 3BQZA 3NQOA 3T5XA 2ELHA 1CF7A 5IP6A 4ZYHA 1XDSA 4XRMA 2UZKA 2H09A 1Z91A 3Q9SA 1IUYA 2X1DA 2DXIA 2DBBA 3SYTA 3GXOA 3DKWA 3SEQA 5CJ9A 3X2QH 2HVSA 3F22A 3G4SI 4XLHA 3W6JB 2BEOA 1X3UA 1J2XA 1Y6IA 2F6CA 5ERIA 4V2FA 3OWTA 1W4MA 3SJMA 2LY9A 4I0BA 3GMEA 4NDLA 1KYWA 1MMNA 1Y56A 2V4JC 3V8LA 4FHTA 1IV6A 3K2AA 3JR9A 1D5VA 1O7LA 2Q8KA 3S93A 3D5LA 3F21A 3TO6A 1T0FA 4A12A 3GW2A 3C2GA 1FLIA 2R7DA 1QNTA 2WV1A 1K79A 5TISC 3S1QJ 2ECBA 2M4GA 1VQOI 2HEOA 4IQJA 3S1NJ 2OBPA 2X4HA 3L2CA 2V79A 2KLOA 4ZTFA 1LDDA 5DCMA 3GTKJ 3KLNA 3Q0VA 3GFIA 3F0CA 4CCLA 1MBKA 1JTYA 4M71A 3H5NA 2BW3B 3ZN1A 2MD0A 5B1BH 3K7AJ 3LSJA 2QQAA 4RGXA 3M8JA 2EZKA 2LTPA 2FBIA 4WXCA 4WF2A 3UNGC 2VQLA 2LG4A 2HZTA 3WHCA 1R4NB 4P5OA 4AVPA 2QSHX 1X1AA 2JPBA 3ERMA 1B59A 2OUMA 3PM1A 2OD5A 1Y8QB 3BTCA 5FLXZ 2ZMEA 4C2UA 2E1OA 1S9HA 5LRSA 2PMZN 4Z6YA 3HHHA 2VOOA 3TKYA 4E7ZA 2L9NA 5GAEJ 2OU2A 3CCSI 3AL0C 3CJTB 1G3SA 2L9VA 5AIQA 1T39A 3IWFA 2V9VA 3HKZN 3L7WA 4A3MJ 5CKTA 3ECOA 2M2EA 4IHVA 3MKLA 2RNJA 1W0UA 2M4KA 2NS8A 4XKCA 2JSPA 1B8IB 2Y69H 3P9IA 3L1PA 1B4AA 1ACIA 2ZNYA 3RDIA 2Z2SB 1MBHA 3PQJA 4FTHA 2ZJ2A 2ZJRF 4FQGA 2LVSA 5IP9J 1T38A 2OQGA 1A6IA 4YFKF 2W7NA 5IP7J 1MJ9A 3F8NA 3S32A 3HUGB 5HOOA 3H3UA 2ETHA 3FBNB 3OYEA 2A61A 1S7EA 1E3HA 5M3MJ 5EEGA 1MSFC 3ZN0A 2DPDA 2CV1A 1QA6A 4AYBN 1NHAA 1R5HA 3DBRB 2FMYA 2Y48A 2ZKZA 1ZAOA 4CUGA 1XS9A 2HI3A 3K70C 3DTKA 4ENKA 4RM3A 1J9IA 1TP4A 3QP5A 1QQIA 1MH3A 2H27A 3EYIA 1S5LC 2ZMEB 4LOCA 5J4YA 2XIGA 4L9NA 1G3WA 1G8XA 1U5TA 2Q2EB 3H1CA 1WPKA 4BE0A 4L5JA 1POGA 1R9TJ 1AOYA 2WB1A 3HOUJ 3PL8A 2WA0A 2BYVE 3ERED 2EA2A 2MLKA 4HSTA 5CVJA 1A04A 4F52A 4DNCA 4XMYA 2LFBA 5GAGJ 2BY1A 3VSLA 4MEXF 1MMDA 1JI8A 1U9NA 1UHMA 4M72A 4OWRB 2ZCWA 3J7YJ 2UXNA 2HGCA 4B3AA 3U9GA 2O7OA 2LOOA 1N75A 2Q1ZB 1XDUA 2IGKA 1DGRM 3BR6A 2UXXA 2VKVA 4ZYDA 2IW5A 3U1DA 1U3EM 1IXRC 1XX5A 2K3FA 3GLLA 1REPC 2HXOA 3TW7A 5JVTA 3RKQA 3CDHA 2BY2A 1OCZH 1WVRA 2PMUA 2PFBA 4U0WA 3A1YA 5H20A 2K9SA 2BHZA 3PNVA 2PEXA 1ETWA 3ONQA 3DQVC 1WI3A 2RQPA 2KRHA 2CUJA 1U9OA 5FLMJ 1WJ5A 2EFQA 3H0GJ 5LFAA 3CP8A 1TC3C 3WTYC 1UHWA 1U5TB 2CV2A 5KCMA 1R4MB 4XBFA 4HOBA 2KJCA 1Z3YA 4DYQA 2DMQA 5IYCJ 2FF4A 3WHBA 1RETA 3KETA 3OSGA 3BZ6A 1XMAA 5FKNA 1MMAA 3NWSA 3DLAA 2F48A 4KIGA 3GTLJ 3DBHB 3AG3H 3FXOA 2K02A 4F55A 4ZYGA 2VB6A 3HRTA 2Q0OA 3C18A 4IVNA 3K4MA 2E2JJ 1FOWA 1JHFA 2OZ6A 3BQYA 2W48A 3FXQA 3HM5A 4MHGA 2XGCA 3Q3SA 1OR7A 1ZQ3P 2E1CA 3ZMSA 2B0LA 1WSUA 2VBYA 1XN7A 4C30A 3JRBA 4M3BA 3I64A 1W1WE 1KONA 1FP1D 2ZXWH 3BR1A 4CA0A 2DA6A 2NAZA 2R7VA 1HW2A 3H9QA 2LH9A 1IO2A 1YJ9I 1JT6A 2F5EA 3OIPA 4BJTA 2CUEA 3GTGJ 2JN6A 4CCKA 4F7ZA 2VJ5A 4A3KJ 2FEZA 3DCFA 5DEQA 1D5YA 4K2EA 1F9NA 2XAQA 3JAMZ 1ZG3A 5JHUA 2X6OA 2IJLA 2E7XA 4RLFA 2P6SA 4B3XA 4LGWA 1LVAA 1WWXA 2DFFA 4KIBA 4KUMA 2IBDA 4ZYEA 5E8IA 1IAWA 2QM3A 5M5XJ 1J59A 5F1RA 4QPOA 3OV8A 4AUXA 4G12A 2KMUA 4FX4A 5GP9A 2R7RA 3S1RJ 1JKRC 2QEXI 4FE7A 2IGNA 2JWTA 1SFXA 2EINH 4HPQA 2KP6A 3FXJA 1X1BA 3DKYA 2VBXA 2EZHA 4DOZA 2XF5A 2ZFUA 3B6CA 3HPHA 2VPLA 1IRGA 3ZRGA 2DFIA 1FX7A 3BZCA 1G4DA 4AU7A 4HNTA 2L0KA 4LLGF 4BU2A 2P8TA 1IN4A 2FBKA 3BDDA 3I53A 5EZHA 2R5ZA 4KNYA 2ID3A 1SD5A 1WJBA 5BOXA 4AVZA 1OQYA 2Y0SN 1H9TA 3KZZA 1FOYA 3MZYA 2RDPA 5FD6A 2HOAA 3FHZA 4BQQA 5HLTA 3GLXA 3OS0A 3PIOF 2Z5UA 4CCNA 2IS4A 1SAUA 4BHCA 1O3QA 2LBFA 3ZQIA 3FMRA
chains in the Genus database with same CATH topology
3ZQCA 2JA6J 2HOTA 2LLKA 1ZK8A 4FISA 1H89C 1QVTA 4JYKA 1TWGJ 2XB0X 3LSGA 1IJWC 2E2IJ 1LFBA 4I76A 1MBFA 4L5EA 2Y2ZA 5F04A 4EEFG 1F43A 3ZQFA 1IDZA 1PUFB 1UG2A 3BR5A 2CU7A 1LE8B 4RBOA 2ID6A 1FTTA 2O8KA 4BBSJ 1MBGA 3CMYA 4X1EA 1AKHB 1WCMJ 5FKLA 1QRYA 1T33A 2Y30A 2K9QA 5C4XJ 2DN0A 4Y7NJ 1P7JA 4MO7A 5M3FJ 2YS9A 1YRNA 2H8RA 2FJ1A 1ETKA 1O4XA 1JUSA 3JRGA 5J1RA 2MGQA 1MBEA 1OFCX 3HGGA 3LOCA 1G2HA 2EQRA 5C3EJ 1B72A 3GTPJ 4W1UA 5F0FA 2AHQA 4UUSA 1QPIA 3HEFA 4IHYA 2R92J 2EZIA 2JA5J 3HOVJ 5IYBJ 1GT0C 4ABZA 4DYRA 1JJ8C 1Z77A 3FIWA 3CCYA 4A3JJ 3HOWJ 1GDTA 3BG9A 1FIPA 4D7NA 3RZDJ 4JX4A 4XK4A 2MG4A 3JRIA 1GUUA 1K61A 2FD5A 4A3GJ 5J1UA 1DU6A 3DEWA 4XRSA 2JK3A 4GFBA 3GTOJ 3FISA 3GBGA 4MFDA 1XG1A 1I6HJ 3JRAA 5J1YA 3HOXJ 3ZQLA 1Y1WJ 4D5FA 3S14J 4QIWN 2EH3A 5M5YJ 1ZGWA 4A93J 4CYCB 3OIOA 1P7IA 3LSPA 4IHXA 3HB9A 1PUFA 2E2HJ 4MFEA 5FKOA 1BW5A 2YU9J 3Q0WA 3OOUA 2DMUA 3IH2A 1NK3P 1HF0A 2DA5A 3LNQA 5E3NA 3BT9A 1AKHA 1HCRA 2ZB9A 4JP0A 2JA8J 2R5YB 1B72B 1RESA 4BKXA 1OJLA 3SDGA 4UUSB 3JRHA 2VKEA 1MBJA 4M3DA 2K40A 1JKOC 2I10A 4C3HJ 3D1NI 3QPLA 3TP3A 2FX0A 4QSHA 1VF9A 2WB1N 2M0CA 2Y9YA 5K7FA 3TEDA 1QVUA 3C2BA 4A3CJ 2R7ZJ 4IHWA 1JT0A 3JREA 4JX6A 5K7HA 3BQZA 5IP6A 1I50J 5DS9A 3ZQHA 4B4CA 3RZOJ 4XRMA 4HNVA 3GTQJ 2NVXJ 3E7LA 2IEKA 2Y9ZA 1ETOA 1JUPA 2RAEA 1FJLA 3HGYA 2OPTA 4V2FA 2GLOA 4A3IJ 3SJMA 2LY9A 5GPCA 4NDLA 3JRFA 2EZLA 5IOYA 3IH3A 4B1RA 4D7MA 1IV6A 4A3LJ 2R93J 3K2AA 3JR9A 2LK2A 2QCOA 2HYJA 4CYCA 1JGGA 1W0TA 2ELKA 1IDYA 1ZR2A 1WGXA 2MSYA 2ECCA 5DTDA 3TW6A 1TWFJ 1IUFA 1H88C 1RKTA 2WV1A 2VUMJ 1XC5A 3S1QJ 2ECBA 3S1NJ 2HOSA 1ZTRA 3A03A 3GTKJ 1IC8A 3Q0VA 2R5YA 1AU7A 3F0CA 5EF6A 4BXXJ 1RKWA 2WAQN 1MBKA 1VFCA 5EG0A 1JTYA 2CRGA 4BBRJ 3Q0UA 2NVTJ 5E3MA 3K7AJ 3LSJA 4M6VA 3S1MJ 1TWAJ 3NARA 2EZKA 2LTPA 1U78A 3I4MJ 2XSDC 3WHCA 4UUTA 2M8GX 4A3EJ 4BY7J 1AHDP 1HDPA 2HXIA 3PM1A 3BTJA 1WH7A 1ZKGA 2JJ7A 2NVYJ 2E1OA 2JMWA 1SANA 3BTCA 3O8HA 5F1JA 2PMZN 1ENHA 4DZPA 4C3IJ 5HODA 4A3DJ 2KT0A 1OCPA 1HOMA 1ETYA 3G1OA 3IH4A 1X2NA 3S2DJ 4FCYA 2X48A 3MN2A 4C2MJ 2HDDA 1T56A 3MVPA 3HKZN 2K9NA 2X9DA 2R0QC 3BR2A 2CQXA 5JLXA 4A3MJ 2M2EA 4IHVA 2COBA 3MKLA 3FK6A 2B63J 3G1MA 2NS8A 1W0UA 4RDUA 1B8IB 5IYDJ 3GTJJ 1BW6A 3L1PA 2DA3A 4XICA 2DJNA 1MBHA 2DTZA 2LD5A 1FTZA 1ETVA 1Q1VA 5EGOA 4FTHA 1A5JA 5F27A 1UHSA 3BR0A 4Y52J 2LVSA 3I4NJ 5IP9J 2JA7J 4XRSG 1A6IA 3S15J 2L7MP 1FIAA 5IP7J 5M5WJ 4MLOA 9ANTA 2LKXA 5EG0B 1OCTC 1SFOJ 1S7EA 1JJ6C 5M3MJ 3LSRA 2VI6A 1JTXA 1MSFC 4BY1J 3VPRA 4AYBN 1ZR4A 1Y1VJ 2HQ5A 1JKQC 2DA7A 5IOZA 1XS9A 2HI3A 1I3QJ 2Y31A 1MH3A 3ZOBA 1GV5A 4LOCA 3SFIA 5EDNA 5C4JJ 2N8GA 1DU0A 4DW6A 1RPWA 3OSFA 3JRDA 2TCTA 3S16J 1X58A 3IV5A 2EBIA 3CQZJ 1WPKA 1F36A 3M3YJ 1NK2P 1WH5A 1R9TJ 1POGA 3A02A 3HOUJ 3BTIA 1MH4A 2KDZA 3FKIJ 1VI0A 2LFBA 2VPRA 2O9LA 3PO3J 4IEJA 2L9RA 4DZJA 1U9NA 3QPSA 2FQ4A 5EGOB 3PO2J 1EF4A 2XRLA 1UMQA 4FE4A 5EZGA 2DMTA 4B3AA 2XB5A 5FJ8J 2O7OA 2XGDA 1B8IA 3FK7A 2P81A 3BR6A 2VKVA 2DA1A 2NS7A 2XGEA 2AO9A 4MIMA 2M9HA 2HXOA 4M3EA 3TW7A 1RR7A 3A01A 3RKQA 1HDDC 1APLC 4AC0A 2TRTA 4V2GA 1MSEC 2L7FP 2K9SA 1GVDA 1K83J 5J3LA 4M3FA 1FEXA 1ETWA 1WI3A 3NAUA 1U9OA 5E3LA 5FLMJ 3H0GJ 3BG3A 1Z0XA 1TC3C 3M4OJ 3G1LA 5C44J 5EEAA 4C3JJ 1ITYA 4A3BJ 2XPWA 2YUSA 3GTMJ 1TWCJ 5JLWA 2NVQJ 3TP0A 4DYQA 2DMQA 5F08A 1BL0A 5IYCJ 3WHBA 3OSGA 1RETA 2R5ZB 5EYRA 5FKNA 4S0HB 3HBLA 1NTCA 1BJZA 2MW8A 2XPVA 4M3GA 1HLVA 3GTLJ 4I6ZA 5F0CA 5FLVA 3BG5A 2E2JJ 1JKPC 2L7ZA 1JUMA 1IRZA 3BQYA 2W48A 3BTLA 3QQAA 3HM5A 3HDDA 2XGCA 3Q3SA 1ZQ3P 3B6AA 5BNGA 3JRBA 1VNDA 4M3BA 4A3FJ 3BR1A 3HOYJ 2DA6A 4D5CA 4QTRA 1LFUP 2IAIA 2H1KA 2OF7A 1JT6A 2CUEA 3GTGJ 2JN6A 2DMNA 4A3KJ 3A01B 5E3OA 3DCFA 2D5VA 5FKMA 1H8AC 1D5YA 1IG7A 3RQIA 1BA5A 2X6OA 4J19A 4DYCA 1U8BA 5F0HA 2DMPA 4A69C 1YRNB 3W6VA 2GM4A 1LE8A 2IBDA 4JX5A 1GV2A 3H3VK 5M5XJ 5K7ZA 4AUXA 3O8GA 4G12A 1JKRC 5GP9A 5GPAA 3S1RJ 3HOZJ 5FKKA 1ORKA 4FE7A 1ETXA 2DA4A 3UKGA 2JWTA 2LR8A 2NOGA 4W97A 2M34A 2E19A 1IGNA 4X6AJ 2EZHA 3BR3A 2CQQA 3B6CA 2DA2A 3JRCA 3S2HJ 2L0KA 5IPAA 1X2MA 2CJJA 2GBYA 5EZHA 3CDLA 2R5ZA 2LP0A 2CUFA 1TWHJ 2ID3A 2ME6A 2Y0SN 3ZQGA 1CQTA 4XIDA 2G0EA 2HOAA 1E3OC 1MNMC 2QF7A 1ETQA 2XPUA 3S17J 3ZQIA 2ME0A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQC A;  2JA6 J;  2HOT A;  2LLK A;  1ZK8 A;  4FIS A;  1H89 C;  1QVT A;  4JYK A;  1TWG J;  2XB0 X;  3LSG A;  1IJW C;  2E2I J;  1LFB A;  4I76 A;  1MBF A;  4L5E A;  2Y2Z A;  5F04 A;  4EEF G;  1F43 A;  3ZQF A;  1IDZ A;  1PUF B;  1UG2 A;  3BR5 A;  2CU7 A;  1LE8 B;  4RBO A;  2ID6 A;  1FTT A;  2O8K A;  4BBS J;  1MBG A;  3CMY A;  4X1E A;  1AKH B;  1WCM J;  5FKL A;  1QRY A;  1T33 A;  2Y30 A;  2K9Q A;  5C4X J;  2DN0 A;  4Y7N J;  1P7J A;  4MO7 A;  5M3F J;  2YS9 A;  1YRN A;  2H8R A;  2FJ1 A;  1ETK A;  1O4X A;  1JUS A;  3JRG A;  5J1R A;  2MGQ A;  1MBE A;  1OFC X;  3HGG A;  3LOC A;  1G2H A;  2EQR A;  5C3E J;  1B72 A;  3GTP J;  4W1U A;  5F0F A;  2AHQ A;  4UUS A;  1QPI A;  3HEF A;  4IHY A;  2R92 J;  2EZI A;  2JA5 J;  3HOV J;  5IYB J;  1GT0 C;  4ABZ A;  4DYR A;  1JJ8 C;  1Z77 A;  3FIW A;  3CCY A;  4A3J J;  3HOW J;  1GDT A;  3BG9 A;  1FIP A;  4D7N A;  3RZD J;  4JX4 A;  4XK4 A;  2MG4 A;  3JRI A;  1GUU A;  1K61 A;  2FD5 A;  4A3G J;  5J1U A;  1DU6 A;  3DEW A;  4XRS A;  2JK3 A;  4GFB A;  3GTO J;  3FIS A;  3GBG A;  4MFD A;  1XG1 A;  1I6H J;  3JRA A;  5J1Y A;  3HOX J;  3ZQL A;  1Y1W J;  4D5F A;  3S14 J;  4QIW N;  2EH3 A;  5M5Y J;  1ZGW A;  4A93 J;  4CYC B;  3OIO A;  1P7I A;  3LSP A;  4IHX A;  3HB9 A;  1PUF A;  2E2H J;  4MFE A;  5FKO A;  1BW5 A;  2YU9 J;  3Q0W A;  3OOU A;  2DMU A;  3IH2 A;  1NK3 P;  1HF0 A;  2DA5 A;  3LNQ A;  5E3N A;  3BT9 A;  1AKH A;  1HCR A;  2ZB9 A;  4JP0 A;  2JA8 J;  2R5Y B;  1B72 B;  1RES A;  4BKX A;  1OJL A;  3SDG A;  4UUS B;  3JRH A;  2VKE A;  1MBJ A;  4M3D A;  2K40 A;  1JKO C;  2I10 A;  4C3H J;  3D1N I;  3QPL A;  3TP3 A;  2FX0 A;  4QSH A;  1VF9 A;  2WB1 N;  2M0C A;  2Y9Y A;  5K7F A;  3TED A;  1QVU A;  3C2B A;  4A3C J;  2R7Z J;  4IHW A;  1JT0 A;  3JRE A;  4JX6 A;  5K7H A;  3BQZ A;  5IP6 A;  1I50 J;  5DS9 A;  3ZQH A;  4B4C A;  3RZO J;  4XRM A;  4HNV A;  3GTQ J;  2NVX J;  3E7L A;  2IEK A;  2Y9Z A;  1ETO A;  1JUP A;  2RAE A;  1FJL A;  3HGY A;  2OPT A;  4V2F A;  2GLO A;  4A3I J;  3SJM A;  2LY9 A;  5GPC A;  4NDL A;  3JRF A;  2EZL A;  5IOY A;  3IH3 A;  4B1R A;  4D7M A;  1IV6 A;  4A3L J;  2R93 J;  3K2A A;  3JR9 A;  2LK2 A;  2QCO A;  2HYJ A;  4CYC A;  1JGG A;  1W0T A;  2ELK A;  1IDY A;  1ZR2 A;  1WGX A;  2MSY A;  2ECC A;  5DTD A;  3TW6 A;  1TWF J;  1IUF A;  1H88 C;  1RKT A;  2WV1 A;  2VUM J;  1XC5 A;  3S1Q J;  2ECB A;  3S1N J;  2HOS A;  1ZTR A;  3A03 A;  3GTK J;  1IC8 A;  3Q0V A;  2R5Y A;  1AU7 A;  3F0C A;  5EF6 A;  4BXX J;  1RKW A;  2WAQ N;  1MBK A;  1VFC A;  5EG0 A;  1JTY A;  2CRG A;  4BBR J;  3Q0U A;  2NVT J;  5E3M A;  3K7A J;  3LSJ A;  4M6V A;  3S1M J;  1TWA J;  3NAR A;  2EZK A;  2LTP A;  1U78 A;  3I4M J;  2XSD C;  3WHC A;  4UUT A;  2M8G X;  4A3E J;  4BY7 J;  1AHD P;  1HDP A;  2HXI A;  3PM1 A;  3BTJ A;  1WH7 A;  1ZKG A;  2JJ7 A;  2NVY J;  2E1O A;  2JMW A;  1SAN A;  3BTC A;  3O8H A;  5F1J A;  2PMZ N;  1ENH A;  4DZP A;  4C3I J;  5HOD A;  4A3D J;  2KT0 A;  1OCP A;  1HOM A;  1ETY A;  3G1O A;  3IH4 A;  1X2N A;  3S2D J;  4FCY A;  2X48 A;  3MN2 A;  4C2M J;  2HDD A;  1T56 A;  3MVP A;  3HKZ N;  2K9N A;  2X9D A;  2R0Q C;  3BR2 A;  2CQX A;  5JLX A;  4A3M J;  2M2E A;  4IHV A;  2COB A;  3MKL A;  3FK6 A;  2B63 J;  3G1M A;  2NS8 A;  1W0U A;  4RDU A;  1B8I B;  5IYD J;  3GTJ J;  1BW6 A;  3L1P A;  2DA3 A;  4XIC A;  2DJN A;  1MBH A;  2DTZ A;  2LD5 A;  1FTZ A;  1ETV A;  1Q1V A;  5EGO A;  4FTH A;  1A5J A;  5F27 A;  1UHS A;  3BR0 A;  4Y52 J;  2LVS A;  3I4N J;  5IP9 J;  2JA7 J;  4XRS G;  1A6I A;  3S15 J;  2L7M P;  1FIA A;  5IP7 J;  5M5W J;  4MLO A;  9ANT A;  2LKX A;  5EG0 B;  1OCT C;  1SFO J;  1S7E A;  1JJ6 C;  5M3M J;  3LSR A;  2VI6 A;  1JTX A;  1MSF C;  4BY1 J;  3VPR A;  4AYB N;  1ZR4 A;  1Y1V J;  2HQ5 A;  1JKQ C;  2DA7 A;  5IOZ A;  1XS9 A;  2HI3 A;  1I3Q J;  2Y31 A;  1MH3 A;  3ZOB A;  1GV5 A;  4LOC A;  3SFI A;  5EDN A;  5C4J J;  2N8G A;  1DU0 A;  4DW6 A;  1RPW A;  3OSF A;  3JRD A;  2TCT A;  3S16 J;  1X58 A;  3IV5 A;  2EBI A;  3CQZ J;  1WPK A;  1F36 A;  3M3Y J;  1NK2 P;  1WH5 A;  1R9T J;  1POG A;  3A02 A;  3HOU J;  3BTI A;  1MH4 A;  2KDZ A;  3FKI J;  1VI0 A;  2LFB A;  2VPR A;  2O9L A;  3PO3 J;  4IEJ A;  2L9R A;  4DZJ A;  1U9N A;  3QPS A;  2FQ4 A;  5EGO B;  3PO2 J;  1EF4 A;  2XRL A;  1UMQ A;  4FE4 A;  5EZG A;  2DMT A;  4B3A A;  2XB5 A;  5FJ8 J;  2O7O A;  2XGD A;  1B8I A;  3FK7 A;  2P81 A;  3BR6 A;  2VKV A;  2DA1 A;  2NS7 A;  2XGE A;  2AO9 A;  4MIM A;  2M9H A;  2HXO A;  4M3E A;  3TW7 A;  1RR7 A;  3A01 A;  3RKQ A;  1HDD C;  1APL C;  4AC0 A;  2TRT A;  4V2G A;  1MSE C;  2L7F P;  2K9S A;  1GVD A;  1K83 J;  5J3L A;  4M3F A;  1FEX A;  1ETW A;  1WI3 A;  3NAU A;  1U9O A;  5E3L A;  5FLM J;  3H0G J;  3BG3 A;  1Z0X A;  1TC3 C;  3M4O J;  3G1L A;  5C44 J;  5EEA A;  4C3J J;  1ITY A;  4A3B J;  2XPW A;  2YUS A;  3GTM J;  1TWC J;  5JLW A;  2NVQ J;  3TP0 A;  4DYQ A;  2DMQ A;  5F08 A;  1BL0 A;  5IYC J;  3WHB A;  3OSG A;  1RET A;  2R5Z B;  5EYR A;  5FKN A;  4S0H B;  3HBL A;  1NTC A;  1BJZ A;  2MW8 A;  2XPV A;  4M3G A;  1HLV A;  3GTL J;  4I6Z A;  5F0C A;  5FLV A;  3BG5 A;  2E2J J;  1JKP C;  2L7Z A;  1JUM A;  1IRZ A;  3BQY A;  2W48 A;  3BTL A;  3QQA A;  3HM5 A;  3HDD A;  2XGC A;  3Q3S A;  1ZQ3 P;  3B6A A;  5BNG A;  3JRB A;  1VND A;  4M3B A;  4A3F J;  3BR1 A;  3HOY J;  2DA6 A;  4D5C A;  4QTR A;  1LFU P;  2IAI A;  2H1K A;  2OF7 A;  1JT6 A;  2CUE A;  3GTG J;  2JN6 A;  2DMN A;  4A3K J;  3A01 B;  5E3O A;  3DCF A;  2D5V A;  5FKM A;  1H8A C;  1D5Y A;  1IG7 A;  3RQI A;  1BA5 A;  2X6O A;  4J19 A;  4DYC A;  1U8B A;  5F0H A;  2DMP A;  4A69 C;  1YRN B;  3W6V A;  2GM4 A;  1LE8 A;  2IBD A;  4JX5 A;  1GV2 A;  3H3V K;  5M5X J;  5K7Z A;  4AUX A;  3O8G A;  4G12 A;  1JKR C;  5GP9 A;  5GPA A;  3S1R J;  3HOZ J;  5FKK A;  1ORK A;  4FE7 A;  1ETX A;  2DA4 A;  3UKG A;  2JWT A;  2LR8 A;  2NOG A;  4W97 A;  2M34 A;  2E19 A;  1IGN A;  4X6A J;  2EZH A;  3BR3 A;  2CQQ A;  3B6C A;  2DA2 A;  3JRC A;  3S2H J;  2L0K A;  5IPA A;  1X2M A;  2CJJ A;  2GBY A;  5EZH A;  3CDL A;  2R5Z A;  2LP0 A;  2CUF A;  1TWH J;  2ID3 A;  2ME6 A;  2Y0S N;  3ZQG A;  1CQT A;  4XID A;  2G0E A;  2HOA A;  1E3O C;  1MNM C;  2QF7 A;  1ETQ A;  2XPU A;  3S17 J;  3ZQI A;  2ME0 A; 
#chains in the Genus database with same CATH topology
 3H9G A;  2JA6 J;  1N78 A;  1W7P D;  1R6R A;  3DPL C;  2ICW G;  2DU9 A;  1SFE A;  1ZK8 A;  3TGN A;  1FSE A;  1VQ9 I;  2LKS A;  3O3K A;  4BGD A;  1FYK A;  4EJU A;  3K4B A;  1IJW C;  1P6R A;  1IDZ A;  2LRD A;  2VQH A;  4IX7 A;  3ZQF A;  2W1O A;  3IC7 A;  5E79 C;  1K6Y A;  1A36 A;  1BBY A;  4PDK A;  3TDZ C;  3RCO A;  4B09 A;  3BR5 A;  5FLX K;  4X0G A;  2CU7 A;  2ID6 A;  1TLH B;  2E60 A;  2CGP A;  3ZCO A;  2R7T A;  1J5Y A;  3OYC A;  4TV7 A;  3E0J B;  3L00 A;  4OU0 A;  1T33 A;  3KLO A;  3RSN A;  1YRN A;  3BCA A;  2H8R A;  5DV5 A;  3C3W A;  1O4X A;  2O5R A;  1FMW A;  1E17 A;  5D5X B;  4HQM A;  4UHT A;  2XVC A;  4PSW A;  2I8D A;  3CUQ C;  1QZE A;  1G2H A;  4RLQ A;  5AON A;  1HQC A;  3QPT A;  3A0B C;  2FA5 A;  2LY2 A;  2ZXJ A;  5F0F A;  1BR2 A;  4YIR X;  2LDU A;  1QPI A;  1TQP A;  1KU7 A;  1FMV A;  4CCJ A;  2VLA A;  2JA5 J;  1QO0 D;  3GZN B;  2DLL A;  1BN5 A;  4ABZ A;  4DYR A;  1ON1 A;  2O8X A;  3FIW A;  3F8M A;  2LBF B;  1GDT A;  1XGN A;  5D5V B;  1FIP A;  3VDX A;  3MQ0 A;  2K7L A;  1J0R A;  4JX4 A;  4ZZD A;  3RZD J;  4GRI A;  4XRF A;  2MG4 A;  3DV8 A;  1GUU A;  1K61 A;  5DM6 F;  2FD5 A;  3GFJ A;  1DU6 A;  3ULQ B;  3DEW A;  3BC8 A;  5LHI A;  2PJR A;  3GTO J;  3FIS A;  2OZU A;  4HA8 A;  2NRA C;  1I6H J;  1DP7 P;  5FO5 A;  4NNJ A;  4UV9 A;  1Y1W J;  3A4C A;  4PJ0 C;  3OS1 A;  4CYC B;  2KFD A;  5FRM A;  1OIS A;  4G6T B;  2K9L A;  3V8K A;  2E71 A;  3TO9 A;  2EIL H;  4HQE A;  1PUF A;  1AWC A;  2DQR A;  5FKO A;  2IA0 A;  2BV6 A;  2OJE D;  2L5Q A;  2RC4 A;  4M6Y A;  4UVB A;  2YU9 J;  3JSO A;  2HPM A;  2X6W A;  5H6Q A;  1T08 B;  3BPX A;  3FXR A;  1NK3 P;  4L18 B;  1HF0 A;  4UVC A;  3LNQ A;  1AKH A;  1S29 A;  2H6B A;  3HRS A;  3ABT A;  3I71 A;  2QEN A;  1W36 C;  2BE5 F;  3QYE A;  4XSX F;  2R5Y B;  1FY7 A;  1O3S A;  4CHU A;  1OJL A;  3SDG A;  2QSF X;  3JRH A;  2VKE A;  4M3D A;  1RZ4 A;  3WTX C;  4IOC F;  2I10 A;  1R1T A;  1P92 A;  2X85 A;  3TP3 A;  4NC6 A;  3NEU A;  2FXA A;  2F4O B;  2IRF G;  2XSJ C;  3TED A;  3C2B A;  4JBA A;  2KL4 A;  1O3R A;  4OMY A;  4XN3 A;  4BHP A;  1RRJ A;  2V1N A;  1VQL I;  4G94 A;  3H3Z A;  3KEY A;  2X0L A;  3SDB A;  2RNG A;  3QAH A;  4RM2 A;  5KHD A;  2B9S A;  5DS9 A;  3WTZ A;  4B4C A;  3ZMU A;  2VBZ A;  4XON A;  3MKY B;  4HNV A;  3GTQ J;  3RZO J;  1MD0 A;  4PSX A;  2V26 A;  3EUA A;  2DOE A;  2UV1 A;  3K9T A;  3E7L A;  2IEK A;  3B73 A;  5LRR A;  4HDV A;  5LHG A;  1R5I D;  2XAH A;  4Y13 A;  2Y9Z A;  1W5T A;  2HDW A;  3PJR A;  1JUP A;  2RAE A;  1FJL A;  3HGY A;  3DTI A;  2OPT A;  5LGN A;  5GPC A;  3JRF A;  3M1E A;  5IOY A;  2LF7 A;  1XB4 A;  1WKM A;  2ADU A;  2QCO A;  4I0A A;  3HOT A;  3AKZ A;  1JGG A;  3VB2 A;  3EUH A;  2O61 A;  2XRN A;  2PX9 A;  4LIT A;  4C2T A;  3KP6 A;  1O3T A;  2RN7 A;  3LMM A;  4ANJ A;  4H0E A;  4CCO A;  3TW6 A;  3RKY A;  1S7O A;  4BJ6 C;  2L2O A;  1IUF A;  2A6E F;  2VUM J;  5L3E A;  2VC0 A;  1YHQ I;  2HOS A;  4G6D A;  3K4C A;  2AXL A;  1AU7 A;  5EF6 A;  1ZG1 A;  1RKW A;  1W36 D;  3F8C A;  3OMY A;  5EG0 A;  3L2U A;  2PN6 A;  3JAM K;  2J5P A;  3Q0U A;  2NVT J;  4GCV A;  3IRR A;  4E7K A;  5EJC A;  4A5N A;  1JXS A;  3RJP A;  2HU9 A;  4N9H A;  2WY8 Q;  2KIU A;  4UUT A;  2M8G X;  2ZFW A;  2XRO A;  2HDC A;  5HNH A;  2YX4 A;  4Y4R A;  4BY7 J;  1AHD P;  2V1U A;  4YG2 F;  3I3L A;  1ZKG A;  2JMW A;  3BJ6 A;  1VTN C;  2X6X A;  4C3I J;  3QRF F;  1XMX A;  2XKP A;  2AS5 F;  1BM9 A;  5E17 F;  2K4B A;  3K4L A;  3U21 A;  4YFX F;  4G7H F;  2R7U A;  2CG4 A;  1ETY A;  2HS5 A;  3G1O A;  4Q4Z F;  3R61 A;  5K5R A;  3MN2 A;  1QHG A;  1VQ5 I;  3DEU A;  1V5F A;  1XSX A;  2X9D A;  5JLX A;  2BXZ A;  2B63 J;  1IRX A;  1I39 A;  3LSM A;  2ZNZ A;  4RAG A;  5IYD J;  1V55 H;  3V8J A;  1BW6 A;  2MAB A;  2DA3 A;  3EPZ A;  4XIC A;  2ZO4 A;  2DJN A;  2DTZ A;  3IWZ A;  4AD9 A;  2C6Y A;  2OC6 A;  4BAY A;  1ZH5 A;  1UHS A;  3BR0 A;  4IZZ A;  3O2P E;  1S7A A;  1W5C C;  3BY6 A;  3I4N J;  1OYI A;  4XRS G;  2D45 A;  4IHT A;  3WGG A;  2DT6 A;  2GA2 A;  4XKB A;  3CCE I;  3OYK A;  4MLO A;  1FT9 A;  5E1Z B;  5EG0 B;  2R7W A;  4EJW A;  3W2A A;  2A69 F;  1SFO J;  2V1D A;  1FBQ A;  3EYY A;  1ULY A;  3LSR A;  4RS8 A;  1JTX A;  3RPU A;  2V6C A;  2JT1 A;  2LYC A;  1GXQ A;  1XTA A;  3GCM A;  1Y1V J;  1N77 A;  1GVJ A;  3DPT A;  4XM3 A;  1JKQ C;  5IOZ A;  4E7H A;  2CFO A;  4LG0 A;  2BW3 A;  2KQR A;  3F72 A;  2RGV A;  5EDN A;  3WOD F;  5C4J J;  2N8G A;  1D1A A;  1RPW A;  3KP5 A;  3OOP A;  2TCT A;  3S16 J;  3N4M A;  3WGH A;  2GIV A;  4BQN A;  2QA4 I;  1C0W A;  1VQP I;  3PNT A;  1NK2 P;  4U87 A;  1JHH A;  1WH5 A;  2BBY A;  3A02 A;  3QYF A;  3IL2 A;  4B43 A;  2VPR A;  4HX8 A;  1H9G A;  5HLG A;  3ABL H;  3QOD A;  5ILS A;  3OYI A;  1X1D A;  4IHS A;  1EF4 A;  2IT0 A;  1UMQ A;  2GIZ A;  1OCC H;  5EZG A;  1P4X A;  1K78 A;  2EFO A;  2ACJ A;  3V7C A;  2XGD A;  4ESF A;  3C7J A;  2F4M B;  1B8I A;  3VOE A;  2P81 A;  3HOS A;  2DA1 A;  2P5V A;  4PK4 A;  2NS7 A;  2JSC A;  2PQ8 A;  2AO9 A;  2M0M A;  3ASN H;  2O3F A;  1XSD A;  2LY1 A;  1HDD C;  4AC0 A;  2VQC A;  4E70 A;  4BJ5 C;  2M30 A;  1YIT I;  2L7F P;  1TT0 A;  1JGS A;  5JFR A;  1GVD A;  3HUG A;  1W5S A;  1HW1 A;  2GXA A;  1FEX A;  4LG0 B;  1Z7L A;  4EM0 B;  1T6S A;  3DXJ F;  1ZRF A;  4A0X A;  3QWL A;  1UFM A;  3S8P A;  2NNY A;  1O7F A;  3VSK A;  3LA3 A;  5C44 J;  2H8W A;  3BG6 A;  2L3D A;  1H0M A;  1ZG5 A;  4PGG A;  2M3A A;  2XPW A;  4HF2 A;  4A3B J;  2WY7 Q;  2NVQ J;  1ZRD A;  3U2R A;  3RYR A;  1OLT A;  4NC8 A;  3ESW B;  4LFU A;  3HBL A;  1NTC A;  2MW8 A;  1HLV A;  3OYF A;  3OS2 A;  5F0C A;  2L02 A;  2E1M C;  2Q2E A;  4L5I A;  5FRO A;  2P6T A;  3KZI C;  1JUM A;  1S6L A;  2DT7 B;  3ZMZ A;  3OYH A;  3BWG A;  3HPG A;  3CCM I;  1GLN A;  3QQA A;  3HDD A;  3HYI A;  1K78 B;  2VKD A;  3CC4 I;  4HBL A;  1VND A;  2JA2 A;  1FWZ A;  2X1C A;  2XF6 A;  5DD4 A;  2H1K A;  2OF7 A;  3T8T A;  4ENN A;  3CC7 I;  3LFK A;  3QOP A;  4RGR A;  2DMN A;  2VE9 A;  3DU6 A;  5E20 A;  4PFO A;  2CH0 A;  4NC7 A;  2J5O A;  1YX3 A;  5E3O A;  3ZPL A;  2M87 A;  3I56 I;  1KQ8 A;  1LJ9 A;  1O57 A;  5FKM A;  4BDZ A;  3FBI B;  1IG7 A;  3RQI A;  1P9Q C;  4XQF A;  1OMI A;  1Z1D A;  3SEZ A;  1SMY F;  3IRQ A;  5BPD A;  4OIQ F;  4DYC A;  3LSH A;  4YII A;  1U8B A;  3KP4 A;  5F0H A;  5LD2 C;  1TW2 A;  5ICE A;  5J8C A;  2MBF A;  4II2 A;  1FZP B;  3W6V A;  1F1Z A;  2FQ3 A;  1LFP A;  4HNU A;  1GV2 A;  5H6R A;  2IS2 A;  2FSW A;  3H3V K;  1NG6 A;  3AG4 H;  2EV6 A;  1MNE A;  3JTG A;  1AA7 A;  3HOZ J;  2DYR H;  3E6B A;  2R7S A;  2NOG A;  3EUH C;  1NG7 A;  4W97 A;  4U0Y A;  3S3M A;  2M34 A;  4P55 A;  5DYM A;  3FM5 A;  1QZY A;  5CQG A;  2W4S A;  1K4T A;  2QKM B;  3MKW B;  5JHF A;  2TDX A;  3U1K A;  2QZ8 A;  1E3P A;  4L0Z B;  2DA2 A;  1GXP A;  3CJN A;  1YO5 C;  3S2H J;  3CO6 C;  3T1B A;  1UEL B;  4BEH A;  4BAC A;  2CJJ A;  3DLL F;  4LJZ F;  1D0X A;  2JUG A;  4B44 A;  3ECH A;  4F93 B;  1PDN C;  4BQA A;  1FYM A;  1DGW Y;  3DU5 A;  3FX3 A;  3K10 A;  1L3L A;  2QUF A;  1STZ A;  4N4O B;  4XR6 A;  2RV8 A;  2XPU A;  3S17 J;  3R60 A;  1LDK B;  4FX0 A;  4O5V A;  4HRI A;  1R5G A;  2HOT A;  2LLK A;  4Q5S F;  1IRF A;  1YW8 A;  3J81 Z;  1TNS A;  2LKP A;  4JYK A;  1KGS A;  1MBF A;  2Y2Z A;  2VN2 A;  5D8K B;  4AM3 A;  5E8G A;  1YLF A;  4GYG A;  1ZRE A;  4AID A;  1K6O A;  1LDJ A;  5GAH J;  1ZEL A;  4HF1 A;  4P9F A;  1RI7 A;  2O03 A;  2EV5 A;  5HS7 A;  1YI2 I;  4E7S A;  3H92 A;  2Y30 A;  5C4X J;  2JVG A;  1P7J A;  4PJN A;  3S3O A;  5M3F J;  4NBQ A;  2OV7 A;  1VQM I;  3FXL A;  2L4M A;  4FT8 A;  5L3G A;  4IRI A;  3GZ5 A;  3L2W A;  1WQ2 A;  2HZD A;  1JUS A;  4AIJ A;  2MGQ A;  4HZF A;  1OFC X;  4M9X A;  1F5T A;  3LOC A;  1BOB A;  3LAP A;  1J7K A;  4BEH B;  1HKQ A;  1VQ4 I;  5C3E J;  2IGO A;  4P1W A;  4P9U A;  3GTP J;  5FB2 A;  3CDI A;  3AFH A;  5J6X A;  3WTT C;  4IHY A;  2R92 J;  2UUZ A;  2EZI A;  3HOV J;  3IHU A;  3I54 A;  1GT0 C;  3OYM A;  2VON A;  2M8E A;  2BGC A;  4U0V A;  4WK8 F;  2ZXH A;  3C2H A;  5FFZ A;  4D7N A;  3WG7 H;  1G59 A;  3JRI A;  4A3G J;  1D8J A;  4ZYA A;  4XRS A;  4KJZ A;  4LK1 F;  1YG2 A;  4MFD A;  1XG1 A;  2CQ7 A;  3L2V A;  5J1Y A;  5FGM A;  1YTY A;  1YJN I;  3HJE A;  3HZJ A;  1BJA A;  4ON0 A;  1DUX C;  1OYY A;  4XNF A;  4ZZL A;  1KA8 A;  1IN6 A;  3LSP A;  1GHC A;  2BY0 A;  3HB9 A;  3ML6 A;  4MFE A;  4G9Y A;  2YSR A;  2QKL B;  2DO7 A;  3RYP A;  2CUZ A;  3IAS 2;  2EIM H;  5L3B A;  4HLX A;  2BZT A;  2JTV A;  1QU3 A;  3KP2 A;  5E3N A;  3BT9 A;  4AIK A;  2LMD A;  4OAY A;  5IT9 Z;  3FKJ A;  4JP0 A;  5ICG A;  1WHU A;  3ZMD A;  1T0F C;  3LA2 A;  2DPU A;  1B1B A;  1JKO C;  4EM2 A;  2WBM A;  2JUC A;  4A5M A;  3D1N I;  2V7F A;  4Y17 A;  5HNF A;  1QGP A;  3GFM A;  4IRH A;  5K7F A;  2Y9Y A;  1ZGJ A;  4EM1 A;  3R0A A;  4PJJ A;  1I3A A;  2F5F A;  1BI2 A;  4RAY A;  4CZC A;  3BZK A;  4L9V A;  3RIR A;  3JRE A;  4JX6 A;  1A6Q A;  4XLF A;  2JPC A;  4FAS D;  2MC4 A;  4KN7 X;  1B9M A;  1RNL A;  3O6B B;  2IPQ X;  1DPR A;  2EK5 A;  4N4N B;  4OAZ A;  1KU3 A;  3S2W A;  3ZQH A;  4A0Y A;  1SAX A;  1IN8 A;  2ELJ A;  4JQF A;  2Z33 A;  2KJB A;  4C9Y A;  4EJV A;  3DBL B;  3RPU D;  1FC3 A;  3CCV I;  3PUB A;  4M73 A;  3JTH A;  1ETO A;  1WFX A;  3ZR8 X;  2R7O A;  3C1D A;  3MZ8 A;  1VQ8 I;  2W84 A;  4ZDO A;  3K1M A;  1ONV A;  2ZME C;  2QSG X;  2HQA A;  2GLO A;  3BJO A;  1P4A A;  3SXY A;  1KZH A;  4BHB A;  2EZL A;  4B1R A;  4D7M A;  1QPM A;  2KZV A;  2NXN B;  3ZP5 A;  3OYJ A;  4A3L J;  1MDM B;  2LK2 A;  4RB0 A;  4CYC A;  5IT3 A;  1W0T A;  2ELK A;  1RUN A;  1IDY A;  3BCB A;  3RQ4 A;  1WGX A;  2CMP A;  4YEL A;  4F3Q A;  2ECC A;  5DTD A;  1TWF J;  2P7C B;  1H88 C;  3M1C A;  2ISY A;  3K4N A;  2GXG A;  1XC5 A;  4EGZ A;  2WAE A;  4BXU A;  3IAM 2;  4UV8 A;  1YYV A;  2E35 A;  1ZTR A;  2VE8 A;  3CZ6 A;  1DDN A;  1I5Z A;  2R5Y A;  5CVI A;  3W6K B;  4BXX J;  2DDA A;  3CLO A;  4HEA 2;  3G2B A;  3G3Z A;  1DQU A;  4HAM A;  3J7Z I;  2ZSH B;  2IS6 A;  2CRG A;  4BBR J;  1D0Y A;  2K3P A;  1J09 A;  4M6V A;  4B48 A;  3S1M J;  4ZJZ A;  1TWA J;  3S3N A;  1FP2 A;  1U78 A;  1I1G A;  5E1W A;  1YS6 A;  4GO1 A;  1EH7 A;  5JR3 A;  1VQK I;  4XSZ F;  3CMA I;  1Z7U A;  2HNH A;  3LL7 A;  4A3E J;  2L01 A;  2HXI A;  2MH9 A;  3BTJ A;  2DOF A;  2B7E A;  1RR8 C;  2HVR A;  3MD2 A;  1WH7 A;  2JJ7 A;  3L9F A;  1FOK A;  3O8H A;  1SAN A;  5F1J A;  2GXB A;  3B02 A;  3GVA A;  4DZP A;  5K1Y A;  4ZH4 F;  4XLE A;  4A3D J;  1BR1 A;  1Y0N A;  2KT0 A;  2MH2 A;  1E2X A;  2DFE A;  2WAQ A;  5A2Q Z;  3K4K A;  1U5T C;  1BI1 A;  3IH4 A;  4HG2 A;  3TDU C;  4ZC3 A;  1X2N A;  4YRV A;  3KZY A;  4FCY A;  1BC8 C;  2X48 A;  3S2D J;  2HPI A;  3GYH X;  2K5C A;  3KEQ A;  2HDD A;  3MVP A;  2R0Q C;  2K9N A;  2COB A;  3FK6 A;  4HX4 A;  4Z2Y A;  4RDU A;  3GTJ J;  3KIO A;  3ZMT A;  2IVM A;  2LD5 A;  3I5U A;  2VOP A;  3VYR B;  3HSR A;  1ETV A;  1Q1V A;  3LA7 A;  4RB2 C;  3P9K A;  3R4K A;  4PJM A;  4Y52 J;  2R7Q A;  3HG9 A;  1ZGA A;  2HTS A;  3MWM A;  4A6D A;  2JA7 J;  4PCQ A;  3S15 J;  2L7M P;  2R7X A;  2FUG 2;  5KAF C;  1FIA A;  1ZLJ A;  3MZH A;  5M5W J;  9ANT A;  1IV8 A;  1LEA A;  3J81 K;  2XAF A;  3M9A A;  3KX2 A;  1Y8R B;  3BP8 A;  4WCG A;  3KCC A;  2VQG A;  2ESN A;  2GOX B;  2EV0 A;  3E6D A;  4PUS A;  2F5C A;  4R8H A;  5LBQ A;  2NS0 A;  2HQ5 A;  4B8X A;  3TOA A;  2DA7 A;  1YE9 A;  3WE2 A;  1I3Q J;  3ZQQ A;  1PUE E;  2Y31 A;  3TMO A;  1PJR A;  3L09 A;  3E3V A;  3EQL F;  4XKW A;  3M7G A;  4NQW A;  3SFI A;  1ON2 A;  4KDP A;  1DU0 A;  4N0B A;  2VIX A;  3WG9 A;  3W2W A;  3JRD A;  2FRH A;  2A68 F;  1X58 A;  3F6O A;  3IV5 A;  2EBI A;  1KU9 A;  3CC2 I;  2IGM A;  4S05 A;  2V9P A;  3M3Y J;  2DTR A;  1V5E A;  1A31 A;  2XKO A;  2O0Y A;  3H5R A;  3KEO A;  4S04 A;  3BTI A;  1XD7 A;  2XV4 S;  2KDZ A;  3FKI J;  3E5Q A;  3OYA A;  1MJA A;  2V9K A;  2CYY A;  4IF4 A;  2O9L A;  3HRU A;  1XCV A;  1YW9 A;  4J00 A;  3QPS A;  1PP8 F;  4UUV A;  3PO2 J;  1TT5 B;  4JOM A;  2PJP A;  2XRL A;  3CF2 A;  2HKO A;  4G8X A;  4FE4 A;  2DMT A;  2VKH A;  1BIA A;  2A5Y B;  3F9K A;  3OR1 C;  2XB5 A;  1WJC A;  5FJ8 J;  1OR7 C;  1YIJ I;  4CCM A;  3OY9 A;  2VJJ A;  3AG1 H;  2CQN A;  3VOD A;  3WTU C;  3LSK A;  3FK7 A;  4PZJ A;  4AIH A;  3H35 A;  5DCF A;  2V6E A;  3BOQ A;  4V19 K;  3V42 A;  1TL8 A;  2XGE A;  4MIM A;  3I59 B;  2EFW A;  4AWX B;  4KMF A;  1XPX A;  2M9H A;  2DK5 A;  4M3E A;  1ERD A;  1RR7 A;  3A01 A;  4LB5 A;  1MSE C;  1D1B A;  3LQR A;  4UXN A;  3GWZ A;  4WWC A;  4D1Q A;  1QHH D;  5L3F A;  2M45 A;  1S8N A;  5HS8 A;  2L4A A;  3A0H C;  5HS9 A;  3ABM H;  5E3L A;  4NQW B;  3T8R A;  3BG3 A;  1Z0X A;  1ZAR A;  2KDO A;  3M4O J;  3G1L A;  2CSO A;  2E1M B;  5EEA A;  1ITY A;  2W00 A;  3AL0 B;  2OCE A;  2YUS A;  3GTM J;  1TWC J;  3LSI A;  4XOT A;  2XDV A;  3DF8 A;  2W24 A;  2VT2 A;  5GTH C;  1ZRC A;  3KYL A;  5F08 A;  2P5L C;  2G7H A;  5IT9 K;  5GAD J;  4HLY A;  2LC2 A;  4ZDL A;  4LMY A;  3ZXS A;  5CVV A;  3KFW X;  4M3G A;  2O6G E;  3PUF A;  3REO A;  4I6Z A;  5BPI A;  2DDB A;  2DJI A;  1ODD A;  3BG5 A;  2P0W A;  1JKP C;  2L7Z A;  3BTL A;  1XGO A;  1X4O A;  2CW8 A;  4ITV A;  2JZY A;  3MEX A;  3K4J A;  4DJA A;  1L0O C;  5AIP A;  2VAS A;  2WAF A;  3W2V A;  3M07 A;  2D2W A;  1U2W A;  3H36 A;  4QTR A;  1LFU P;  1A35 A;  2IAI A;  3PNY A;  3CCL I;  2BY3 A;  2LNB A;  4Y3O A;  2CW7 A;  5LGU A;  1ZYR F;  4HDU A;  1LNW A;  1UAA A;  4LLL A;  2JQ7 A;  3OYL A;  5B1A H;  2OTJ I;  3P9C A;  2AQE A;  4D9J A;  3A01 B;  3HSF A;  2KRF A;  3TO7 A;  1TQM A;  2D5V A;  2EFN A;  3WGI A;  3ABK H;  4I01 A;  1BA5 A;  2VT3 A;  2W85 A;  2W82 A;  3WE3 A;  4L9J A;  2K27 A;  2KKO A;  2D1H A;  2DMP A;  4M9Z A;  4WXH A;  3W3C A;  4BQO A;  5B3S H;  4ENM A;  4NHJ A;  4YEJ A;  3AG2 H;  1YIO A;  2FNP A;  3G73 A;  4JX5 A;  1LE8 A;  3I55 I;  4KYW A;  4MQ9 F;  4HV5 A;  2VOD A;  2E1N A;  3O8G A;  1N25 A;  2KZG A;  5GPA A;  1TZL A;  1ORK A;  4EJO A;  2DA4 A;  2XAS A;  2QVO A;  2LR8 A;  1XMK A;  3V4G A;  3BR3 A;  1RUO A;  3OL3 A;  2CQQ A;  1SFK A;  2FU4 A;  1J75 A;  3JRC A;  1W7P A;  1Z05 A;  2OCC H;  3KYC B;  1I6X A;  5HDG A;  2A07 F;  1T95 A;  4LLN A;  2H1L A;  5IPA A;  2GBY A;  3CDL A;  2LP0 A;  2CUF A;  1TWH J;  3FM3 A;  5ILV A;  3OYG A;  5TGT A;  3ZQG A;  3R0J A;  5ED4 A;  4F92 B;  4KT5 C;  2G7U A;  3DKX A;  4IQ4 A;  1F4K A;  4MQV A;  3Q5F A;  2NOJ B;  3TBI A;  2PMH A;  3WTS C;  3Q9V A;  1E3O C;  1HST A;  3AAF A;  2QF7 A;  2BXY A;  1UCR A;  4UB6 C;  2I5U A;  4EVI A;  5LLQ A;  4A6E A;  2ZBK A;  2E2I J;  1LFB A;  3ASO H;  4I76 A;  1F43 A;  3CLQ A;  1FPQ A;  1Y39 A;  4GXO A;  2QBY A;  2QQB A;  1UG2 A;  2MFZ A;  2XGX A;  2GWR A;  2Z3Y A;  3SZP A;  1LE8 B;  1FTT A;  1LKX A;  1R36 A;  3CMY A;  4RGS A;  4X1E A;  5A2Q K;  1WCM J;  1X3W B;  5FKL A;  1Y0U A;  2K9Q A;  4HF0 A;  4XLP F;  4Y7N J;  1UST A;  1P2F A;  3OYB A;  1LEB A;  4EJT A;  1B6A A;  4DQ2 A;  3VYT B;  3LAJ A;  3SHF A;  2FJ1 A;  2L7K A;  4GDF A;  2RVC A;  2EWN A;  3JRG A;  2A5W A;  5J1R A;  3PFY A;  1MBE A;  4EAT A;  1W7P B;  2RRE A;  3HGG A;  2DAO A;  3RKX A;  4HV6 A;  1KYZ A;  5CVU A;  4DBR A;  3K0L A;  1B72 A;  4ESB A;  4W1U A;  3LST A;  4O3M A;  2W57 A;  3ISP A;  3COA C;  3CCU I;  1IZ1 A;  1CF7 B;  3DFG A;  5IYB J;  3FHN A;  1MND A;  1PVE A;  1TNT A;  3K69 A;  3CJQ B;  1JJ8 C;  1Z77 A;  4BS9 A;  4DIQ A;  2CFX A;  3SZG A;  3HOW J;  3CME I;  4G7Z F;  3BG9 A;  3CCQ I;  3N97 A;  3I9V 2;  4YIF A;  4XOP A;  3ROU A;  5HLH A;  1XGM A;  4M9S A;  4OIO F;  2GQQ A;  2IS1 A;  4KT6 A;  3K1P A;  3ABU A;  2Z9O A;  3VYS B;  2BHY A;  2JK3 A;  2DI3 A;  2QBY B;  2EJR A;  2KHM A;  1SEU A;  2BVL A;  3JRA A;  2WV0 A;  1R1V A;  3V7S A;  3HOX J;  3S14 J;  4D5F A;  4QIW N;  2A3S A;  4J01 A;  5M5Y J;  4A93 J;  3OR2 C;  1P7I A;  1D0Z A;  4IHX A;  5EEH A;  5BQT A;  5DUI A;  4EQQ A;  3OYN A;  4UNO A;  5F64 A;  1BW5 A;  1FSH A;  3SZT A;  1IN5 A;  5H2F C;  3OOU A;  4I7H A;  2WWY A;  2DMU A;  3IH2 A;  3HTS B;  2VXZ A;  3BJA A;  1FOX A;  3I0T A;  3HC7 A;  4KIF A;  3CUQ A;  1SD6 A;  3PSF A;  2FML A;  5J4V A;  1HKT A;  3WU1 B;  2ISZ A;  5DCM B;  5E18 F;  2DCE A;  4Y33 A;  5F6F A;  4RB3 C;  1B72 B;  1RES A;  3RPQ A;  4EMS A;  2BOL A;  1LB2 A;  1MBJ A;  1UG0 A;  2K40 A;  2E5N A;  2HVQ A;  3NWT A;  5D8L B;  1IW7 F;  2VJI A;  3QPL A;  4RGU A;  2FX0 A;  4XKV A;  5DDG A;  4QSH A;  4CZZ A;  3VWB A;  3GUD A;  4I02 A;  2M0C A;  3IKT A;  1K7A A;  4HSR A;  3K2Z A;  1MZB A;  3E5X A;  4BUP A;  1QVU A;  3MMY B;  5E1X A;  2QQ9 A;  1LUJ B;  3I58 A;  4RAZ A;  4IHW A;  1JT0 A;  1WJE A;  2CQK A;  5K7H A;  3CP2 A;  3BG7 A;  1UB9 A;  3TQN A;  4IXA A;  3KPH A;  1I50 J;  3F23 A;  1HXD A;  2R4G A;  1JE8 A;  2NVX J;  4EGY A;  4CIC A;  3N05 A;  2K9M A;  2ZC2 A;  1MJB A;  2EB7 A;  2PBI A;  5CLS A;  2DT5 A;  5HDN A;  4Y15 A;  3D5S C;  4Q47 A;  4M74 A;  2CV0 A;  1YFH A;  2A6T A;  3NRV A;  4BXF A;  2Z16 A;  4L0Y B;  1DPU A;  4YFN F;  1EH6 A;  4OOI A;  1HBX G;  4A3I J;  1E0E A;  5JI6 A;  4OIN F;  4KN4 X;  3IH3 A;  1BOA A;  1S3J A;  2R93 J;  3CUQ B;  4I2O A;  2HYJ A;  2F2E A;  1U6G A;  1ZR2 A;  3FWE A;  1EA3 A;  3F8F A;  4M6X A;  1YS7 A;  5KVR A;  3J80 Z;  2MSY A;  5L3D A;  3V7R A;  5BS6 A;  1USS A;  2JRM A;  4HW0 A;  1OCR H;  3DEE A;  1RKT A;  5CYV A;  4OIP F;  2FNA A;  1OKR A;  2QWW A;  4PGH A;  2E36 A;  2MYS A;  2CW0 F;  4GYI A;  3OIQ A;  4KIS A;  2HR3 A;  3A03 A;  2EPF A;  2HYF A;  1IC8 A;  1HW5 A;  2L9S A;  2WAQ N;  3CES A;  1ZHF A;  1VFC A;  2HYG D;  3A2K A;  2COM A;  4KIT B;  3HIF A;  1R1U A;  4KIC A;  3TL4 X;  5E3M A;  2IA2 A;  1FBU A;  4ETS A;  4CXF A;  5B66 C;  1R58 A;  3NAR A;  4LIU A;  3KP7 A;  2IP2 A;  1YX5 A;  3I4M J;  3FZV A;  2XSD C;  4CDG A;  1S72 I;  1QZZ A;  5HLI A;  2X51 A;  4I09 A;  1VZ0 A;  1V3F A;  4UY8 I;  1HDP A;  3K70 D;  2NVY J;  2AXT C;  1BIB A;  1V4R A;  3OL4 A;  2DOA A;  2QGU A;  2PG4 A;  4RMN A;  4IO9 F;  1BI0 A;  1ENH A;  2VC1 A;  5HOD A;  1MW7 A;  4XLN F;  1EKE A;  4BL0 B;  1LPQ A;  2M5W A;  1OCP A;  3EUK L;  3FMS A;  2P4W A;  3E97 A;  1HOM A;  3QPH A;  4LB6 B;  3WU0 A;  5ICF A;  2X1E A;  2LRE A;  4C2M J;  1SVO A;  1T56 A;  2XAG A;  3BR2 A;  3MAJ A;  2CQX A;  2A6H F;  3KP3 A;  3G1M A;  2QQ8 A;  3FDY A;  2QYO A;  3E5U A;  1MDM A;  1FTZ A;  4PJL A;  3VYU B;  3I4P A;  4R79 A;  1FNN A;  5EGO A;  3T0Y A;  4U7B A;  1A5J A;  5F27 A;  3EDP A;  2PMZ A;  1R7J A;  3GX4 X;  3M8E A;  2EFP A;  5KNL A;  1IXS B;  2LKX A;  5LEK A;  4HYE A;  1OCT C;  1R22 A;  1JJ6 C;  4E6K G;  2VBW A;  4MEY F;  2VI6 A;  4E7J A;  3VPR A;  4BY1 J;  3HKZ A;  3CTA A;  5LEJ A;  1TQI A;  3WTV C;  2HTJ A;  3DPU A;  1ZR4 A;  5HVQ C;  2RKH A;  3CUO A;  3EET A;  1YJW I;  4LG3 A;  2A05 A;  2Z99 A;  2OQR A;  2VJ4 A;  4PFP A;  4CSW A;  1HKS A;  3ZOB A;  1GV5 A;  2P5K A;  4QPQ A;  2FOW A;  3WU2 C;  5KK1 A;  2X6Y A;  2PLY A;  3MCZ A;  1TW3 A;  5D5U B;  1R00 A;  4DW6 A;  1RIO H;  3OYD A;  3OSF A;  3CCJ I;  4ZTJ A;  5CQE A;  1LQ1 A;  2DYS H;  4FET A;  1FYL A;  1FBS A;  3CQZ J;  4Q48 A;  1K4S A;  1F36 A;  1SD7 A;  1NH3 A;  3DTE A;  1WZ2 A;  4JK1 X;  4BE2 A;  2DOD A;  1MH4 A;  4IKF A;  1XGS A;  4AYB A;  3G71 I;  2H94 A;  2MD5 A;  1VI0 A;  1IF1 A;  4LD5 A;  2CO5 A;  4O6J A;  3PO3 J;  5KAI C;  4IEJ A;  2QLZ A;  5J40 A;  2L9R A;  4DZJ A;  3E6C C;  2FQ4 A;  5BMZ A;  2MLG A;  5EGO B;  4BNC A;  2E34 A;  3JSP A;  1LVK A;  5D4S A;  3RKW A;  2D1V A;  2DQL A;  1WJA A;  3F3X A;  1G3Y A;  5DD8 A;  4CYD A;  1QBJ A;  1R23 A;  2F5V A;  2RQQ A;  2Y0M A;  3VFZ A;  1X1P A;  2YPR A;  3RI4 A;  2LF8 A;  2HQR A;  2AQF A;  2DK8 A;  3HRM A;  2ZJP F;  1UZC A;  1APL C;  1SFU A;  3CD6 I;  2OA4 A;  2TRT A;  4V2G A;  1T98 A;  5GTI C;  1BR4 A;  5JVG F;  4MNU A;  4G6Q A;  4BDY A;  1K83 J;  5J3L A;  4M3F A;  3D5R C;  4U7D A;  2YU3 A;  1SVM A;  2NVU B;  3J7A O;  2M1B A;  3NAU A;  4WXD A;  2GOM A;  4RB1 A;  3GO5 A;  2NNN A;  4R1H A;  3PSI A;  1VQN I;  3P5J A;  4C3J J;  3F6V A;  1WJD A;  5DM7 F;  1R71 A;  2P7V B;  1UJ8 A;  5JLW A;  5K5O A;  1V5G A;  1U0J A;  1X3Z B;  3HHG A;  3TP0 A;  1BL0 A;  2R5Z B;  1PP7 U;  5EYR A;  2M7A A;  1X4P A;  2PI0 A;  4S0H B;  2STT A;  1BJZ A;  2XPV A;  1SMT A;  2FE3 A;  4MTE A;  3ZQ7 A;  5FLV A;  5K5Q A;  4I98 B;  1IRZ A;  1HSJ A;  2DFH A;  3ZMV A;  3GFL A;  1EV7 A;  4A0Z A;  3B6A A;  5D4R A;  1OYW A;  5BNG A;  3E6M A;  1KQ9 A;  3LFU A;  3LQQ A;  4A3F J;  3HOY J;  3FXK A;  4D5C A;  4EV0 A;  4DGW B;  2Z1D A;  4G7O F;  4OIR F;  1BI3 A;  4QLC U;  3CCR I;  3PFI A;  5D6F A;  3UR3 C;  5HDK A;  4WX9 A;  1H8A C;  2OTL I;  3GF2 A;  2IA1 A;  1U8R A;  2Y75 A;  3BPV A;  2DW4 A;  1PYV A;  4J19 A;  2E5Z A;  1VQ6 I;  1MIJ A;  4A69 C;  1YRN B;  2XC7 A;  2GM4 A;  3IP4 B;  3I59 A;  2V1X A;  4RA2 A;  1OPC A;  5FFX A;  2XAU A;  5K7Z A;  4XLA A;  2JVH A;  1MGT A;  2F4I A;  4IOA F;  5FKK A;  2R7F A;  3UKG A;  1ETX A;  4ESJ A;  1ZN2 A;  3RTR A;  4IL6 C;  1MMG A;  2E19 A;  3F8B A;  1IGN A;  4X6A J;  2UWM A;  5ICC A;  1YW7 A;  2CWE A;  3G6E I;  4B47 A;  4XOR A;  3HL2 A;  4P96 A;  3J80 K;  4I99 C;  4BYY A;  1X1C A;  2HWV A;  2HFH A;  1XSV A;  3TOB A;  1WRJ A;  2KIF A;  2EA4 A;  4ZDP A;  1Z9C A;  1X2M A;  2XF7 A;  2ZXI A;  2WAD A;  2HKX A;  1T2K A;  3QOE A;  2GA1 A;  2ME6 A;  1D8K A;  1CQT A;  3PIP F;  2L54 A;  4XID A;  4OMZ A;  2G0E A;  2STW A;  3H5A A;  1MNM C;  1D1C A;  2PJR B;  3R6S A;  1ETQ A;  1RC9 A;  4KMU X;  1Q1H A;  1SD4 A;  5LHH A;  2K86 A;  3JW4 A;  2KRC A;  2ME0 A;  3ZQC A;  3ELK A;  1SVL A;  2GZW A;  2JRT A;  3HTU A;  4FIS A;  1H89 C;  4CH7 A;  1QVT A;  1TWG J;  2XB0 X;  3LSG A;  4CGZ A;  4EEF G;  4L5E A;  4RAF A;  5F04 A;  1PUF B;  4F91 B;  2W25 A;  3SQN A;  4II3 A;  2XAJ A;  2ZJQ F;  2IXS A;  1WI9 A;  4MTD A;  4RBO A;  5J8F A;  4E7L A;  2Y0S A;  2O8K A;  4BBS J;  1MBG A;  3GEZ A;  2FBH A;  3BRO A;  1DP3 A;  1SC7 A;  1Z67 A;  1AKH B;  1I1S A;  3H9J A;  1QRY A;  1CGP A;  2MC3 A;  1IN7 A;  1YOV B;  2DN0 A;  2CS3 A;  4MO7 A;  2EIJ H;  2EIK H;  4QWQ A;  2H6C A;  2YS9 A;  2ESH A;  5DUK A;  1KU2 A;  4IJA A;  4CO8 A;  3DWL E;  1ETK A;  2MA3 A;  3IKV A;  3KYD B;  3QYB A;  3LWF A;  2NYX A;  4NB5 A;  1P4W A;  5D6E A;  3QP6 A;  4KFC A;  3K1N A;  2EQR A;  2WTE A;  5ILU A;  3J7A Y;  4IPA A;  3JCU C;  1M1E B;  1V54 H;  1HC8 A;  2AHQ A;  3D0S A;  4UUS A;  3L2R A;  4MGR A;  2F5D A;  3PQK A;  3DP7 A;  4D0P A;  3HEF A;  4A2U A;  4XLC A;  4ENJ A;  1ZLK A;  4DBQ A;  3M8F A;  4E4H A;  5B5E C;  1BC7 C;  5J47 A;  3FF5 A;  5LGT A;  1EH8 A;  4XN0 A;  3CF5 F;  2GAU A;  3CCY A;  4A3J J;  3QU3 A;  2YR2 A;  4UB8 C;  3HXL A;  4KA4 A;  4XK4 A;  3CMM A;  1X19 A;  2BVM A;  2E7W A;  3WTW C;  5J1U A;  1IXC A;  3FXU A;  3KE2 A;  4GFB A;  2XUB A;  3K6G A;  4N9I A;  2ZSI B;  2R3S A;  2XHK A;  4XL9 A;  3CO7 C;  3GBG A;  5TRD A;  1HA8 A;  1Z6R A;  3CJR B;  3ZQL A;  3MFK A;  5IY5 H;  3QU6 A;  5FD5 A;  4E7I A;  2EH3 A;  1B9N A;  1ZGW A;  4UVA A;  2VXD A;  4IRG A;  3OIO A;  3P7N A;  1Z21 A;  1Z3X A;  5TJJ A;  2E2H J;  1VQ7 I;  2HQN A;  3MKZ A;  5L3C A;  3Q0W A;  1D3Y A;  5CPR B;  1Z6T A;  1TTY A;  2HOE A;  2G9W A;  4BH9 A;  2LSO A;  1WJF A;  2DA5 A;  3E1S A;  2FOK A;  3GZ6 A;  1HCR A;  2YX7 A;  1R49 A;  2ZB9 A;  5D5W B;  1KQ0 A;  3L2Q A;  1EJ9 A;  3FMQ A;  2JA8 J;  1TBX A;  1MKM A;  1MMS A;  4GGG A;  3FXM A;  4BKX A;  3HSE A;  5CVR A;  4UUS B;  1I27 A;  2K4J A;  2M7B A;  4ASN A;  3H0D A;  5FRN A;  1OCO H;  4H4K C;  4C3H J;  2OAZ A;  1T8I A;  3SFZ A;  1G6N A;  2KIS A;  1VF9 A;  4HX7 A;  2K85 A;  2WB1 N;  3ZGK A;  4NUB A;  2KIQ A;  4BE1 A;  2KPM A;  4L9T A;  1YQA A;  2VL8 A;  4A3C J;  2WC2 A;  2R7Z J;  4LK0 F;  6PAX A;  3VEP A;  1XCB A;  3IUO A;  1G3T A;  4LIV A;  4U88 A;  3BLY A;  2KIM A;  3BQZ A;  3NQO A;  3T5X A;  2ELH A;  1CF7 A;  5IP6 A;  4ZYH A;  1XDS A;  4XRM A;  2UZK A;  2H09 A;  1Z91 A;  3Q9S A;  1IUY A;  2X1D A;  2DXI A;  2DBB A;  3SYT A;  3GXO A;  3DKW A;  3SEQ A;  5CJ9 A;  3X2Q H;  2HVS A;  3F22 A;  3G4S I;  4XLH A;  3W6J B;  2BEO A;  1X3U A;  1J2X A;  1Y6I A;  2F6C A;  5ERI A;  4V2F A;  3OWT A;  1W4M A;  3SJM A;  2LY9 A;  4I0B A;  3GME A;  4NDL A;  1KYW A;  1MMN A;  1Y56 A;  2V4J C;  3V8L A;  4FHT A;  1IV6 A;  3K2A A;  3JR9 A;  1D5V A;  1O7L A;  2Q8K A;  3S93 A;  3D5L A;  3F21 A;  3TO6 A;  1T0F A;  4A12 A;  3GW2 A;  3C2G A;  1FLI A;  2R7D A;  1QNT A;  2WV1 A;  1K79 A;  5TIS C;  3S1Q J;  2ECB A;  2M4G A;  1VQO I;  2HEO A;  4IQJ A;  3S1N J;  2OBP A;  2X4H A;  3L2C A;  2V79 A;  2KLO A;  4ZTF A;  1LDD A;  5DCM A;  3GTK J;  3KLN A;  3Q0V A;  3GFI A;  3F0C A;  4CCL A;  1MBK A;  1JTY A;  4M71 A;  3H5N A;  2BW3 B;  3ZN1 A;  2MD0 A;  5B1B H;  3K7A J;  3LSJ A;  2QQA A;  4RGX A;  3M8J A;  2EZK A;  2LTP A;  2FBI A;  4WXC A;  4WF2 A;  3UNG C;  2VQL A;  2LG4 A;  2HZT A;  3WHC A;  1R4N B;  4P5O A;  4AVP A;  2QSH X;  1X1A A;  2JPB A;  3ERM A;  1B59 A;  2OUM A;  3PM1 A;  2OD5 A;  1Y8Q B;  3BTC A;  5FLX Z;  2ZME A;  4C2U A;  2E1O A;  1S9H A;  5LRS A;  2PMZ N;  4Z6Y A;  3HHH A;  2VOO A;  3TKY A;  4E7Z A;  2L9N A;  5GAE J;  2OU2 A;  3CCS I;  3AL0 C;  3CJT B;  1G3S A;  2L9V A;  5AIQ A;  1T39 A;  3IWF A;  2V9V A;  3HKZ N;  3L7W A;  4A3M J;  5CKT A;  3ECO A;  2M2E A;  4IHV A;  3MKL A;  2RNJ A;  1W0U A;  2M4K A;  2NS8 A;  4XKC A;  2JSP A;  1B8I B;  2Y69 H;  3P9I A;  3L1P A;  1B4A A;  1ACI A;  2ZNY A;  3RDI A;  2Z2S B;  1MBH A;  3PQJ A;  4FTH A;  2ZJ2 A;  2ZJR F;  4FQG A;  2LVS A;  5IP9 J;  1T38 A;  2OQG A;  1A6I A;  4YFK F;  2W7N A;  5IP7 J;  1MJ9 A;  3F8N A;  3S32 A;  3HUG B;  5HOO A;  3H3U A;  2ETH A;  3FBN B;  3OYE A;  2A61 A;  1S7E A;  1E3H A;  5M3M J;  5EEG A;  1MSF C;  3ZN0 A;  2DPD A;  2CV1 A;  1QA6 A;  4AYB N;  1NHA A;  1R5H A;  3DBR B;  2FMY A;  2Y48 A;  2ZKZ A;  1ZAO A;  4CUG A;  1XS9 A;  2HI3 A;  3K70 C;  3DTK A;  4ENK A;  4RM3 A;  1J9I A;  1TP4 A;  3QP5 A;  1QQI A;  1MH3 A;  2H27 A;  3EYI A;  1S5L C;  2ZME B;  4LOC A;  5J4Y A;  2XIG A;  4L9N A;  1G3W A;  1G8X A;  1U5T A;  2Q2E B;  3H1C A;  1WPK A;  4BE0 A;  4L5J A;  1POG A;  1R9T J;  1AOY A;  2WB1 A;  3HOU J;  3PL8 A;  2WA0 A;  2BYV E;  3ERE D;  2EA2 A;  2MLK A;  4HST A;  5CVJ A;  1A04 A;  4F52 A;  4DNC A;  4XMY A;  2LFB A;  5GAG J;  2BY1 A;  3VSL A;  4MEX F;  1MMD A;  1JI8 A;  1U9N A;  1UHM A;  4M72 A;  4OWR B;  2ZCW A;  3J7Y J;  2UXN A;  2HGC A;  4B3A A;  3U9G A;  2O7O A;  2LOO A;  1N75 A;  2Q1Z B;  1XDU A;  2IGK A;  1DGR M;  3BR6 A;  2UXX A;  2VKV A;  4ZYD A;  2IW5 A;  3U1D A;  1U3E M;  1IXR C;  1XX5 A;  2K3F A;  3GLL A;  1REP C;  2HXO A;  3TW7 A;  5JVT A;  3RKQ A;  3CDH A;  2BY2 A;  1OCZ H;  1WVR A;  2PMU A;  2PFB A;  4U0W A;  3A1Y A;  5H20 A;  2K9S A;  2BHZ A;  3PNV A;  2PEX A;  1ETW A;  3ONQ A;  3DQV C;  1WI3 A;  2RQP A;  2KRH A;  2CUJ A;  1U9O A;  5FLM J;  1WJ5 A;  2EFQ A;  3H0G J;  5LFA A;  3CP8 A;  1TC3 C;  3WTY C;  1UHW A;  1U5T B;  2CV2 A;  5KCM A;  1R4M B;  4XBF A;  4HOB A;  2KJC A;  1Z3Y A;  4DYQ A;  2DMQ A;  5IYC J;  2FF4 A;  3WHB A;  1RET A;  3KET A;  3OSG A;  3BZ6 A;  1XMA A;  5FKN A;  1MMA A;  3NWS A;  3DLA A;  2F48 A;  4KIG A;  3GTL J;  3DBH B;  3AG3 H;  3FXO A;  2K02 A;  4F55 A;  4ZYG A;  2VB6 A;  3HRT A;  2Q0O A;  3C18 A;  4IVN A;  3K4M A;  2E2J J;  1FOW A;  1JHF A;  2OZ6 A;  3BQY A;  2W48 A;  3FXQ A;  3HM5 A;  4MHG A;  2XGC A;  3Q3S A;  1OR7 A;  1ZQ3 P;  2E1C A;  3ZMS A;  2B0L A;  1WSU A;  2VBY A;  1XN7 A;  4C30 A;  3JRB A;  4M3B A;  3I64 A;  1W1W E;  1KON A;  1FP1 D;  2ZXW H;  3BR1 A;  4CA0 A;  2DA6 A;  2NAZ A;  2R7V A;  1HW2 A;  3H9Q A;  2LH9 A;  1IO2 A;  1YJ9 I;  1JT6 A;  2F5E A;  3OIP A;  4BJT A;  2CUE A;  3GTG J;  2JN6 A;  4CCK A;  4F7Z A;  2VJ5 A;  4A3K J;  2FEZ A;  3DCF A;  5DEQ A;  1D5Y A;  4K2E A;  1F9N A;  2XAQ A;  3JAM Z;  1ZG3 A;  5JHU A;  2X6O A;  2IJL A;  2E7X A;  4RLF A;  2P6S A;  4B3X A;  4LGW A;  1LVA A;  1WWX A;  2DFF A;  4KIB A;  4KUM A;  2IBD A;  4ZYE A;  5E8I A;  1IAW A;  2QM3 A;  5M5X J;  1J59 A;  5F1R A;  4QPO A;  3OV8 A;  4AUX A;  4G12 A;  2KMU A;  4FX4 A;  5GP9 A;  2R7R A;  3S1R J;  1JKR C;  2QEX I;  4FE7 A;  2IGN A;  2JWT A;  1SFX A;  2EIN H;  4HPQ A;  2KP6 A;  3FXJ A;  1X1B A;  3DKY A;  2VBX A;  2EZH A;  4DOZ A;  2XF5 A;  2ZFU A;  3B6C A;  3HPH A;  2VPL A;  1IRG A;  3ZRG A;  2DFI A;  1FX7 A;  3BZC A;  1G4D A;  4AU7 A;  4HNT A;  2L0K A;  4LLG F;  4BU2 A;  2P8T A;  1IN4 A;  2FBK A;  3BDD A;  3I53 A;  5EZH A;  2R5Z A;  4KNY A;  2ID3 A;  1SD5 A;  1WJB A;  5BOX A;  4AVZ A;  1OQY A;  2Y0S N;  1H9T A;  3KZZ A;  1FOY A;  3MZY A;  2RDP A;  5FD6 A;  2HOA A;  3FHZ A;  4BQQ A;  5HLT A;  3GLX A;  3OS0 A;  3PIO F;  2Z5U A;  4CCN A;  2IS4 A;  1SAU A;  4BHC A;  1O3Q A;  2LBF A;  3ZQI A;  3FMR A; 
#chains in the Genus database with same CATH homology
 3ZQC A;  2JA6 J;  2HOT A;  2LLK A;  1ZK8 A;  4FIS A;  1H89 C;  1QVT A;  4JYK A;  1TWG J;  2XB0 X;  3LSG A;  1IJW C;  2E2I J;  1LFB A;  4I76 A;  1MBF A;  4L5E A;  2Y2Z A;  5F04 A;  4EEF G;  1F43 A;  3ZQF A;  1IDZ A;  1PUF B;  1UG2 A;  3BR5 A;  2CU7 A;  1LE8 B;  4RBO A;  2ID6 A;  1FTT A;  2O8K A;  4BBS J;  1MBG A;  3CMY A;  4X1E A;  1AKH B;  1WCM J;  5FKL A;  1QRY A;  1T33 A;  2Y30 A;  2K9Q A;  5C4X J;  2DN0 A;  4Y7N J;  1P7J A;  4MO7 A;  5M3F J;  2YS9 A;  1YRN A;  2H8R A;  2FJ1 A;  1ETK A;  1O4X A;  1JUS A;  3JRG A;  5J1R A;  2MGQ A;  1MBE A;  1OFC X;  3HGG A;  3LOC A;  1G2H A;  2EQR A;  5C3E J;  1B72 A;  3GTP J;  4W1U A;  5F0F A;  2AHQ A;  4UUS A;  1QPI A;  3HEF A;  4IHY A;  2R92 J;  2EZI A;  2JA5 J;  3HOV J;  5IYB J;  1GT0 C;  4ABZ A;  4DYR A;  1JJ8 C;  1Z77 A;  3FIW A;  3CCY A;  4A3J J;  3HOW J;  1GDT A;  3BG9 A;  1FIP A;  4D7N A;  3RZD J;  4JX4 A;  4XK4 A;  2MG4 A;  3JRI A;  1GUU A;  1K61 A;  2FD5 A;  4A3G J;  5J1U A;  1DU6 A;  3DEW A;  4XRS A;  2JK3 A;  4GFB A;  3GTO J;  3FIS A;  3GBG A;  4MFD A;  1XG1 A;  1I6H J;  3JRA A;  5J1Y A;  3HOX J;  3ZQL A;  1Y1W J;  4D5F A;  3S14 J;  4QIW N;  2EH3 A;  5M5Y J;  1ZGW A;  4A93 J;  4CYC B;  3OIO A;  1P7I A;  3LSP A;  4IHX A;  3HB9 A;  1PUF A;  2E2H J;  4MFE A;  5FKO A;  1BW5 A;  2YU9 J;  3Q0W A;  3OOU A;  2DMU A;  3IH2 A;  1NK3 P;  1HF0 A;  2DA5 A;  3LNQ A;  5E3N A;  3BT9 A;  1AKH A;  1HCR A;  2ZB9 A;  4JP0 A;  2JA8 J;  2R5Y B;  1B72 B;  1RES A;  4BKX A;  1OJL A;  3SDG A;  4UUS B;  3JRH A;  2VKE A;  1MBJ A;  4M3D A;  2K40 A;  1JKO C;  2I10 A;  4C3H J;  3D1N I;  3QPL A;  3TP3 A;  2FX0 A;  4QSH A;  1VF9 A;  2WB1 N;  2M0C A;  2Y9Y A;  5K7F A;  3TED A;  1QVU A;  3C2B A;  4A3C J;  2R7Z J;  4IHW A;  1JT0 A;  3JRE A;  4JX6 A;  5K7H A;  3BQZ A;  5IP6 A;  1I50 J;  5DS9 A;  3ZQH A;  4B4C A;  3RZO J;  4XRM A;  4HNV A;  3GTQ J;  2NVX J;  3E7L A;  2IEK A;  2Y9Z A;  1ETO A;  1JUP A;  2RAE A;  1FJL A;  3HGY A;  2OPT A;  4V2F A;  2GLO A;  4A3I J;  3SJM A;  2LY9 A;  5GPC A;  4NDL A;  3JRF A;  2EZL A;  5IOY A;  3IH3 A;  4B1R A;  4D7M A;  1IV6 A;  4A3L J;  2R93 J;  3K2A A;  3JR9 A;  2LK2 A;  2QCO A;  2HYJ A;  4CYC A;  1JGG A;  1W0T A;  2ELK A;  1IDY A;  1ZR2 A;  1WGX A;  2MSY A;  2ECC A;  5DTD A;  3TW6 A;  1TWF J;  1IUF A;  1H88 C;  1RKT A;  2WV1 A;  2VUM J;  1XC5 A;  3S1Q J;  2ECB A;  3S1N J;  2HOS A;  1ZTR A;  3A03 A;  3GTK J;  1IC8 A;  3Q0V A;  2R5Y A;  1AU7 A;  3F0C A;  5EF6 A;  4BXX J;  1RKW A;  2WAQ N;  1MBK A;  1VFC A;  5EG0 A;  1JTY A;  2CRG A;  4BBR J;  3Q0U A;  2NVT J;  5E3M A;  3K7A J;  3LSJ A;  4M6V A;  3S1M J;  1TWA J;  3NAR A;  2EZK A;  2LTP A;  1U78 A;  3I4M J;  2XSD C;  3WHC A;  4UUT A;  2M8G X;  4A3E J;  4BY7 J;  1AHD P;  1HDP A;  2HXI A;  3PM1 A;  3BTJ A;  1WH7 A;  1ZKG A;  2JJ7 A;  2NVY J;  2E1O A;  2JMW A;  1SAN A;  3BTC A;  3O8H A;  5F1J A;  2PMZ N;  1ENH A;  4DZP A;  4C3I J;  5HOD A;  4A3D J;  2KT0 A;  1OCP A;  1HOM A;  1ETY A;  3G1O A;  3IH4 A;  1X2N A;  3S2D J;  4FCY A;  2X48 A;  3MN2 A;  4C2M J;  2HDD A;  1T56 A;  3MVP A;  3HKZ N;  2K9N A;  2X9D A;  2R0Q C;  3BR2 A;  2CQX A;  5JLX A;  4A3M J;  2M2E A;  4IHV A;  2COB A;  3MKL A;  3FK6 A;  2B63 J;  3G1M A;  2NS8 A;  1W0U A;  4RDU A;  1B8I B;  5IYD J;  3GTJ J;  1BW6 A;  3L1P A;  2DA3 A;  4XIC A;  2DJN A;  1MBH A;  2DTZ A;  2LD5 A;  1FTZ A;  1ETV A;  1Q1V A;  5EGO A;  4FTH A;  1A5J A;  5F27 A;  1UHS A;  3BR0 A;  4Y52 J;  2LVS A;  3I4N J;  5IP9 J;  2JA7 J;  4XRS G;  1A6I A;  3S15 J;  2L7M P;  1FIA A;  5IP7 J;  5M5W J;  4MLO A;  9ANT A;  2LKX A;  5EG0 B;  1OCT C;  1SFO J;  1S7E A;  1JJ6 C;  5M3M J;  3LSR A;  2VI6 A;  1JTX A;  1MSF C;  4BY1 J;  3VPR A;  4AYB N;  1ZR4 A;  1Y1V J;  2HQ5 A;  1JKQ C;  2DA7 A;  5IOZ A;  1XS9 A;  2HI3 A;  1I3Q J;  2Y31 A;  1MH3 A;  3ZOB A;  1GV5 A;  4LOC A;  3SFI A;  5EDN A;  5C4J J;  2N8G A;  1DU0 A;  4DW6 A;  1RPW A;  3OSF A;  3JRD A;  2TCT A;  3S16 J;  1X58 A;  3IV5 A;  2EBI A;  3CQZ J;  1WPK A;  1F36 A;  3M3Y J;  1NK2 P;  1WH5 A;  1R9T J;  1POG A;  3A02 A;  3HOU J;  3BTI A;  1MH4 A;  2KDZ A;  3FKI J;  1VI0 A;  2LFB A;  2VPR A;  2O9L A;  3PO3 J;  4IEJ A;  2L9R A;  4DZJ A;  1U9N A;  3QPS A;  2FQ4 A;  5EGO B;  3PO2 J;  1EF4 A;  2XRL A;  1UMQ A;  4FE4 A;  5EZG A;  2DMT A;  4B3A A;  2XB5 A;  5FJ8 J;  2O7O A;  2XGD A;  1B8I A;  3FK7 A;  2P81 A;  3BR6 A;  2VKV A;  2DA1 A;  2NS7 A;  2XGE A;  2AO9 A;  4MIM A;  2M9H A;  2HXO A;  4M3E A;  3TW7 A;  1RR7 A;  3A01 A;  3RKQ A;  1HDD C;  1APL C;  4AC0 A;  2TRT A;  4V2G A;  1MSE C;  2L7F P;  2K9S A;  1GVD A;  1K83 J;  5J3L A;  4M3F A;  1FEX A;  1ETW A;  1WI3 A;  3NAU A;  1U9O A;  5E3L A;  5FLM J;  3H0G J;  3BG3 A;  1Z0X A;  1TC3 C;  3M4O J;  3G1L A;  5C44 J;  5EEA A;  4C3J J;  1ITY A;  4A3B J;  2XPW A;  2YUS A;  3GTM J;  1TWC J;  5JLW A;  2NVQ J;  3TP0 A;  4DYQ A;  2DMQ A;  5F08 A;  1BL0 A;  5IYC J;  3WHB A;  3OSG A;  1RET A;  2R5Z B;  5EYR A;  5FKN A;  4S0H B;  3HBL A;  1NTC A;  1BJZ A;  2MW8 A;  2XPV A;  4M3G A;  1HLV A;  3GTL J;  4I6Z A;  5F0C A;  5FLV A;  3BG5 A;  2E2J J;  1JKP C;  2L7Z A;  1JUM A;  1IRZ A;  3BQY A;  2W48 A;  3BTL A;  3QQA A;  3HM5 A;  3HDD A;  2XGC A;  3Q3S A;  1ZQ3 P;  3B6A A;  5BNG A;  3JRB A;  1VND A;  4M3B A;  4A3F J;  3BR1 A;  3HOY J;  2DA6 A;  4D5C A;  4QTR A;  1LFU P;  2IAI A;  2H1K A;  2OF7 A;  1JT6 A;  2CUE A;  3GTG J;  2JN6 A;  2DMN A;  4A3K J;  3A01 B;  5E3O A;  3DCF A;  2D5V A;  5FKM A;  1H8A C;  1D5Y A;  1IG7 A;  3RQI A;  1BA5 A;  2X6O A;  4J19 A;  4DYC A;  1U8B A;  5F0H A;  2DMP A;  4A69 C;  1YRN B;  3W6V A;  2GM4 A;  1LE8 A;  2IBD A;  4JX5 A;  1GV2 A;  3H3V K;  5M5X J;  5K7Z A;  4AUX A;  3O8G A;  4G12 A;  1JKR C;  5GP9 A;  5GPA A;  3S1R J;  3HOZ J;  5FKK A;  1ORK A;  4FE7 A;  1ETX A;  2DA4 A;  3UKG A;  2JWT A;  2LR8 A;  2NOG A;  4W97 A;  2M34 A;  2E19 A;  1IGN A;  4X6A J;  2EZH A;  3BR3 A;  2CQQ A;  3B6C A;  2DA2 A;  3JRC A;  3S2H J;  2L0K A;  5IPA A;  1X2M A;  2CJJ A;  2GBY A;  5EZH A;  3CDL A;  2R5Z A;  2LP0 A;  2CUF A;  1TWH J;  2ID3 A;  2ME6 A;  2Y0S N;  3ZQG A;  1CQT A;  4XID A;  2G0E A;  2HOA A;  1E3O C;  1MNM C;  2QF7 A;  1ETQ A;  2XPU A;  3S17 J;  3ZQI A;  2ME0 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...