2JA8J

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja8J00
1HLVA 5K7FA 5BNGA 3F0CA 3JREA 1RKTA 1B72B 1AKHA 4J19A 5C4XJ 1ZR4A 3OOUA 3S2DJ 2XGEA 1WPKA 4IEJA 2TCTA 2HI3A 2EQRA 4ABZA 1P7JA 4Y52J 5J1RA 4M3BA 5IP9J 4A3MJ 1DU0A 3GTGJ 1WH5A 3NAUA 5FLVA 5C4JJ 2X6OA 2R0QC 5IP6A 2DA6A 3B6CA 1IGNA 4A3EJ 2NS8A 2EZHA 3Q0VA 3GTKJ 4B1RA 1H89C 2K9QA 2M0CA 2W48A 2E1OA 2DMUA 4C3HJ 3A01B 2HXOA 5J1YA 3GTOJ 1R9TJ 5F27A 2GLOA 1TWGJ 1JT6A 2ELKA 1JUSA 3JRCA 1JGGA 2JA5J 4DYQA 1I6HJ 1H8AC 4AC0A 3PM1A 1ZKGA 2ME0A 4FISA 3JRHA 1F43A 2Y9YA 3RKQA 2NOGA 3MVPA 1PUFB 1BL0A 2LR8A 3M4OJ 3FK6A 2XB5A 1SFOJ 1LE8A 1GT0C 4Y7NJ 1ETYA 2CU7A 1RETA 3JR9A 4DZJA 2FJ1A 3LSJA 2B63J 3BT9A 1JKRC 3CMYA 4EEFG 3BTCA 2G0EA 4HNVA 2DMQA 2MW8A 3IH4A 3GTMJ 2E19A 4A93J 3H0GJ 2DA4A 3VPRA 2R93J 2R7ZJ 2H1KA 4LOCA 1TWFJ 2N8GA 1ENHA 2CQQA 5M5YJ 1RPWA 1A6IA 1H88C 3S14J 1OFCX 4CYCA 1ZK8A 5HODA 1ORKA 3MN2A 4AYBN 5IOZA 2DA3A 4JX4A 1TWCJ 2LY9A 3CDLA 5FKKA 3BTJA 1MH3A 1TWAJ 1HF0A 1WI3A 1WGXA 4NDLA 2ME6A 2R5YA 2FD5A 1T33A 3G1LA 5J1UA 1ETQA 1ETWA 3HB9A 4JX6A 3ZQCA 3ZQGA 2HDDA 1JUMA 2TRTA 5IYCJ 3A01A 2VPRA 3HOYJ 4A3JJ 3DCFA 1W0UA 4JYKA 4XK4A 2XSDC 2GBYA 3HKZN 5F08A 2Y31A 2EH3A 2YUSA 1MBEA 1BJZA 1JKPC 2ECBA 2EZIA 3BG9A 3WHCA 4RBOA 4DYCA 1JJ8C 1OCPA 2M34A 2L9RA 2LTPA 2X9DA 1LE8B 1U9OA 1MBGA 1Z0XA 5IYBJ 2NVQJ 2HOSA 5IP7J 3HDDA 2IEKA 4A3LJ 3BR0A 4C2MJ 3TP0A 2MG4A 4A3GJ 4IHWA 2QF7A 1FTZA 4BBSJ 3BR6A 3BQYA 5C44J 2EZKA 3HBLA 2XGCA 3LOCA 2LVSA 5FKLA 3SDGA 4QSHA 2NVYJ 1MSEC 5IPAA 3B6AA 1W0TA 1DU6A 4UUSB 3GBGA 1NTCA 4XIDA 1MH4A 5EGOA 2K9NA 4D7NA 2DA2A 5GP9A 2HOTA 1ETKA 2WV1A 3GTJJ 1IC8A 2XPWA 2L0KA 5EDNA 2JWTA 3BR1A 2XPUA 1I50J 5JLXA 2HYJA 4CYCB 1X58A 3M3YJ 5E3MA 4BY1J 1OJLA 1IDZA 3A02A 4X6AJ 2OPTA 2JK3A 1BW5A 3RQIA 5IYDJ 1FTTA 1JT0A 9ANTA 2M9HA 1MNMC 3H3VK 2XPVA 3ZQLA 1T56A 1X2MA 5K7HA 2O8KA 2ID3A 3RZOJ 1NK3P 3OSGA 4V2FA 4QIWN 4XRSA 1IV6A 3I4MJ 4XRSG 2NS7A 1SANA 2DA1A 2LKXA 4A3FJ 1JTXA 5F04A 3HOWJ 1APLC 3BR2A 3WHBA 1VNDA 5K7ZA 2CUFA 2JN6A 4S0HB 3I4NJ 3G1MA 3NARA 5JLWA 2X48A 1UMQA 1B8IA 5EYRA 5FKMA 4QTRA 2LLKA 1MBKA 2JMWA 4XRMA 3FIWA 1RESA 2JA6J 2FQ4A 3LSGA 4A3KJ 1QPIA 3IH3A 3ZQIA 1Y1WJ 1JJ6C 4B3AA 3JRAA 1Y1VJ 4FCYA 2JA7J 4XICA 4M3DA 1HCRA 5IOYA 4FE4A 2P81A 4UUTA 4UUSA 2CUEA 1NK2P 1IJWC 3FK7A 1FEXA 2M8GX 1U9NA 5GPCA 3HOUJ 2DMTA 5FKNA 1IDYA 2O7OA 1BW6A 1UG2A 3W6VA 3JRIA 4MFEA 1JTYA 4BY7J 3CCYA 2KT0A 4V2GA 2IAIA 2DTZA 2XGDA 2R5YB 5M3FJ 2NVTJ 2KDZA 1AKHB 3GTPJ 1JUPA 2DMPA 2DN0A 3L1PA 3S16J 1RR7A 5EZGA 5M3MJ 2DJNA 1IUFA 3JRBA 1GUUA 1WCMJ 1ETXA 5EZHA 2LD5A 3LNQA 2JA8J 1O4XA 3HOXJ 1ETVA 2EBIA 3FKIJ 1XC5A 3OIOA 3C2BA 4IHVA 4MIMA 2O9LA 4AUXA 1GVDA 1HOMA 5E3OA 2HXIA 4DYRA 2AHQA 4C3IJ 2K9SA 4D5FA 4A3DJ 5FLMJ 3Q3SA 4A69C 3BTLA 1BA5A 3S1QJ 2DMNA 2I10A 4C3JJ 3RZDJ 2E2JJ 1UHSA 3HGYA 5F0HA 1B72A 1EF4A 3BTIA 2EZLA 1ETOA 2DA5A 2NVXJ 3JRDA 3HEFA 2IBDA 3DEWA 5C3EJ 2WB1N 5J3LA 1X2NA 2MGQA 1IRZA 1OCTC 5FJ8J 2ECCA 4MO7A 1K61A 1G2HA 1PUFA 1CQTA 4M3GA 4BKXA 3O8HA 1HDDC 4I76A 2L7MP 2M2EA 3IH2A 4FE7A 2R92J 1LFUP 4I6ZA 2WAQN 3JRFA 2JJ7A 1QRYA 4RDUA 2RAEA 3FISA 5DS9A 1FIAA 2D5VA 1MBHA 1U8BA 3S1MJ 4A3BJ 2FX0A 3E7LA 3S1NJ 1D5YA 3BR5A 1U78A 1QVUA 4W1UA 4D7MA 4JX5A 2DA7A 3ZQHA 2CQXA 1MSFC 1QVTA 1ZQ3P 1MBFA 2R5ZB 3A03A 3ZQFA 5DTDA 1POGA 1FJLA 2Y30A 5EG0B 1VFCA 3GTLJ 2R5ZA 2LFBA 2AO9A 4M3EA 3LSPA 3TW6A 5EF6A 1GDTA 1A5JA 2YS9A 3QPSA 1P7IA 5M5XJ 4D5CA 2XB0X 5FKOA 3HGGA 5GPAA 1I3QJ 4GFBA 3HOVJ 3JRGA 2YU9J 4FTHA 3TEDA 4DW6A 2ID6A 2K40A 1IG7A 2H8RA 2VKEA 1F36A 3IV5A 1Z77A 5M5WJ 3BG3A 4L5EA 4M3FA 2L7ZA 1TC3C 1WH7A 5E3LA 2ZB9A 1JKQC 3S17J 3TP3A 2CRGA 3BR3A 1LFBA 4DZPA 3LSRA 2L7FP 4IHYA 3Q0WA 3O8GA 2E2HJ 5E3NA 2GM4A 3PO2J 3QQAA 1YRNB 4JP0A 3HOZJ 1S7EA 1XG1A 1ZGWA 4BBRJ 3S15J 1YRNA 1ZTRA 2VI6A 1VF9A 2Y0SN 3BQZA 2VUMJ 1AU7A 5F0CA 1Q1VA 3PO3J 3G1OA 1FIPA 4IHXA 3K7AJ 4M6VA 3K2AA 2VKVA 3BG5A 4MLOA 5EGOB 1E3OC 3D1NI 4B4CA 3S1RJ 1VI0A 2HOAA 3HM5A 3GTQJ 1XS9A 2E2IJ 3ZOBA 5EG0A 3TW7A 1GV5A 4G12A 2CJJA 2COBA 3S2HJ 1TWHJ 1ITYA 3OSFA 3MKLA 1MBJA 4W97A 4A3CJ 3Q0UA 2LP0A 4MFDA 3QPLA 5EEAA 2Y9ZA 1GV2A 2QCOA 2HQ5A 5F1JA 1ZR2A 4BXXJ 3SJMA 1RKWA 3SFIA 2LK2A 2XRLA 2Y2ZA 1AHDP 1B8IB 1K83J 4X1EA 1JKOC 3UKGA 2OF7A 3CQZJ 5F0FA 1HDPA 2MSYA 4A3IJ 2PMZN
chains in the Genus database with same CATH superfamily
1HLVA 5K7FA 2XV4S 3JREA 1RKTA 5C4XJ 3H92A 3CP8A 1VQ9I 3K70C 2JRMA 2TCTA 2Y48A 3RYPA 4AD9A 2HI3A 1BM9A 4Y52J 2BY2A 5CPRB 1WWXA 3ABMH 3H9QA 5J1RA 4A3MJ 2K9LA 2H94A 1WH5A 3TDZC 4D9JA 3K0LA 1MW7A 5C4JJ 4NBQA 3HXLA 1TQMA 1Z91A 2DA6A 4I01A 3M8FA 3GTKJ 2AQEA 4B1RA 3CO6C 4LK0F 3FWEA 3TOBA 3DBRB 3CCLI 2JQ7A 4M9XA 1WJDA 1SVMA 2KIMA 2NAZA 3MCZA 2IW5A 2QA4I 1R9TJ 2JSCA 2GLOA 1TWGJ 2FEZA 4D1QA 1JUSA 2ZNZA 3HSRA 4G94A 2Q0OA 1JGGA 4HAMA 4MQVA 1IF1A 4LG3A 4DYQA 2KFDA 1KU3A 2V6CA 1IXSB 2FQ3A 4AC0A 3HRTA 1YJNI 1F43A 1YX3A 5BOXA 3I53A 1OISA 3SFZA 3ZMDA 1PUFB 3OY9A 3QODA 4ZTJA 5D5UB 4OMZA 2MLGA 4M6YA 2CU7A 4Y7NJ 5CVUA 1DPUA 1RETA 3JR9A 4EMSA 4DZJA 2CV2A 2ISYA 4KNYA 2XC7A 1V3FA 3CJQB 3PL8A 2G0EA 4NQWA 2VT3A 3GTMJ 3I5UA 1Y0UA 1FY7A 1IV8A 1BI2A 3ZMSA 3VPRA 2A6HF 2HVRA 1D1BA 2DK8A 3H5AA 3QPHA 4G6TB 2K4JA 3RTRA 1IXCA 1R1UA 3VFZA 4IKFA 4BXFA 2PQ8A 4CYCA 2L2OA 1VZ0A 2GA1A 3P9CA 4MGRA 3V8JA 3CDLA 3GCMA 1TL8A 4LIVA 3DEEA 1MMSA 4D0PA 2MD0A 2QGUA 1S8NA 2GOXB 2R5YA 4J00A 1NHAA 2IP2A 2RDPA 3ZPLA 1WJBA 1FT9A 1HW2A 2L4MA 1JUMA 5IYCJ 2DLLA 2VXDA 1K79A 2STTA 4A3JJ 2W4SA 1GLNA 1QNTA 3F3XA 3HKZN 4S04A 2LMDA 2YUSA 2VQLA 5H2FC 4WWCA 3KP4A 2ECBA 3HZJA 3WHCA 3FXOA 4J01A 3ML6A 3D5SC 3HHGA 1O3RA 1WJFA 2K3FA 3D5RC 2BYVE 2LTPA 2OTLI 3NWSA 4JBAA 2MC3A 4N9HA 3FMRA 1MBGA 5IP7J 4YIIA 2E7XA 2V1DA 2AQFA 1CF7A 2IEKA 2DFEA 1PJRA 3TP0A 3K70D 2EIKH 4BBSJ 1G3WA 2H09A 2OV7A 2XGCA 5F1RA 1ZG5A 5J8FA 2WAEA 5L3GA 1Y8QB 4QSHA 2RN7A 1V55H 4OOIA 4LLLA 3B6AA 2IGOA 1X1CA 1V4RA 4JQFA 3I54A 1MH4A 3WTUC 2EFWA 1R6RA 2DA2A 3BPXA 2R7XA 2WV1A 5EDNA 3BWGA 2JWTA 3BR1A 1VQ6I 4BQNA 2XPUA 5AIQA 2HYJA 3PJRA 1X58A 3M3YJ 1FMWA 3CCEI 1OJLA 4X6AJ 2BGCA 2IGNA 3RQIA 2BZTA 3CJRB 5JI6A 2XASA 1P9QC 1U6GA 2R7OA 4IZZA 9ANTA 1M1EB 3ZQLA 2ID3A 2W82A 3RKYA 3SEZA 1XB4A 3OSGA 2UWMA 1SANA 3OV8A 2YR2A 2V1NA 4ZZLA 2F48A 4A3FJ 2HU9A 2BBYA 2EIMH 5HS9A 5K7ZA 1X4PA 2JVHA 3J80K 4S0HB 4IQJA 5E1WA 2QQ9A 1ZH5A 1XSDA 2Z99A 5JLWA 2X48A 1L0OC 1EV7A 3ZN0A 2ADUA 3DEUA 2VQHA 1W1WE 4PJMA 5FKMA 1TW3A 1MBKA 3VYSB 3MKYB 3MKZA 2XDVA 2FBIA 4X0GA 4EV0A 1K4TA 2ZSHB 1I5ZA 3BROA 5K5OA 3FIWA 1RESA 3LSTA 3ZQIA 1Y1WJ 1GXQA 3E1SA 4KYWA 2KDOA 4UV9A 3JRAA 4HA8A 4FCYA 4BGDA 1HCRA 1Y0NA 4Q47A 2BY0A 5HNFA 5DUIA 3X2QH 5HOOA 3COAC 2DT7B 1R5GA 2EFOA 4Y3OA 4DJAA 1TNTA 4A0XA 3DLAA 2X4HA 2A68F 3CJTB 1ERDA 3GFJA 5LRSA 1ZYRF 3CCVI 2O7OA 3FZVA 2K02A 1T08B 3EDPA 4N0BA 4A2UA 4WCGA 1TLHB 3GFLA 4V2GA 2Q2EB 2IAIA 2DTZA 5KK1A 3GXOA 2QSHX 1REPC 1J5YA 4XKBA 4IRIA 2DMPA 3L1PA 1XMAA 2FXAA 1RR7A 2GXGA 2DJNA 1GUUA 2LD5A 2CSOA 3LNQA 4ZDOA 3DBLB 1D0XA 3I58A 4YELA 3CCRI 4OIOF 2W84A 2EBIA 2CS3A 4U7DA 3IRQA 1YITI 3V7CA 3OYCA 3GF2A 3C2BA 3KYLA 1SEUA 2O0YA 1KYZA 3FHNA 3RPUA 4OIPF 2CWEA 1GVDA 1HOMA 5E3OA 4DYRA 4OIRF 2AHQA 4C3IJ 5BPDA 1HXDA 1LVKA 2Y0SA 5HDNA 1LJ9A 3Q3SA 1DGWY 2A6TA 1QU3A 2PMHA 2A05A 2ZJQF 4C3JJ 2QBYA 3L2WA 1MNDA 3CCJI 1B72A 1OMIA 3GX4X 1P92A 3EQLF 1ETOA 2VJ4A 4L9VA 4EJWA 2EINH 2KJCA 2HKOA 2J5PA 3K2ZA 2AS5F 1YTYA 5FRMA 1X2NA 4B47A 2ECCA 2VQGA 4XM3A 1JGSA 1O3TA 1D0YA 1ZLKA 3GVAA 1I3AA 1R1VA 5JR3A 2CV0A 3J7YJ 3BG7A 2V26A 4HNTA 5HS7A 3O8HA 4UB8C 5JVGF 5ICGA 2LBFB 1ZGJA 4L0YB 4I6ZA 3PFIA 5D6EA 3CMAI 3EYYA 4ZYHA 5B66C 2WWYA 3RI4A 1QRYA 1W4MA 3LSHA 2RAEA 3OS1A 2WAFA 1MDMB 3E0JB 4YIFA 3PIPF 1U8BA 2FX0A 4MQ9F 1YE9A 3AL0B 4KMUX 3S1NJ 4E7JA 4E7ZA 3T8RA 1SMTA 4WF2A 3M9AA 3DBHB 4JX5A 3TOAA 3BG6A 1UHMA 1QQIA 1QVTA 2R5ZB 2ZJRF 1DUXC 4YFXF 4U87A 4KMFA 1FBUA 2F4OB 3BCBA 3HYIA 3LWFA 2Y30A 5EG0B 3VYTB 2LFBA 3L2CA 2VC1A 4M71A 2O5RA 3ISPA 5M5XJ 3F8MA 2XB0X 1E3PA 5FKOA 1I3QJ 2YPRA 3BDDA 4CGZA 3HOVJ 4RAYA 2Z2SB 2QQAA 5FD5A 4FTHA 3TEDA 3LSMA 4XLEA 3LAPA 1S9HA 2X1EA 4BYYA 3S8PA 2NS0A 1MNEA 1IO2A 3I55I 3RYRA 1XDSA 2HTJA 4JK1X 1G4DA 4UNOA 3LQRA 5J4YA 3BG3A 2CH0A 2MH2A 3WGIA 1WH7A 2DFHA 2ZB9A 1FX7A 2Z33A 3ECOA 3S17J 2CRGA 2KMUA 4DZPA 3LSRA 2RKHA 3CLQA 4B09A 3SZPA 3QAHA 3H5NA 2GM4A 4CSWA 2RNGA 4JP0A 4G7OF 3W6JB 2P7VB 1ZGWA 3E6BA 2R7RA 3BP8A 1YRNA 1LDJA 1ZTRA 3L09A 1R00A 1K78B 4IHTA 3H3ZA 3P9KA 4M73A 1EJ9A 3FM3A 2CUJA 3P5JA 1O7LA 4XONA 4IHXA 1N25A 2BVLA 2NNNA 2ELHA 2VKVA 3BG5A 3GLXA 2VBWA 5EGOB 1FYMA 3QPTA 4L9TA 3T0YA 1YHQI 3S1RJ 2HOAA 3GTQJ 4PFOA 1GV5A 2ZFWA 2CJJA 5TRDA 2ZMEB 4L5IA 2DBBA 2COBA 3HSFA 4UXNA 4XLFA 5L3DA 3HJEA 1I27A 4IOAF 4A3CJ 1BI1A 2LP0A 1FPQA 2M4KA 3QPLA 3L2QA 1GV2A 2QCOA 3OR2C 2ZXWH 5F1JA 4U0YA 1ZR2A 1FOXA 5CQEA 1PVEA 4BXXJ 1D1CA 3WG9A 1CGPA 2PEXA 1N77A 4AIKA 1HW5A 4ENKA 2BHYA 3K4BA 3ESWB 5LFAA 1HDPA 3S32A 4BDZA 1G6NA 5FLXK 5DM6F 2GOMA 1FOKA 2EA4A 1B72B 3K10A 1HKSA 4J19A 4BE1A 1ZR4A 1U2WA 1P4WA 3S2DJ 1WPKA 1Y8RB 2ZNYA 4IEJA 2W1OA 3BY6A 4HV6A 3CJNA 4ABZA 1P7JA 3PNYA 2VIXA 3SXYA 2X0LA 1G59A 4P5OA 4G9YA 4LB6B 3CDIA 4FETA 3I3LA 1DU0A 2R0QC 2PMZA 3B6CA 4A3EJ 3G4SI 3HOSA 2EZHA 3Q0VA 4A12A 3M8EA 1SVOA 5HDGA 4PGGA 3PUFA 2E1OA 4Q48A 1F4KA 2HPMA 2NRAC 2WTEA 4C3HJ 4E6KG 5J1YA 2X6WA 4PDKA 3GTOJ 5GADJ 3QYEA 1J2XA 1WHUA 4RM2A 2XKOA 1JT6A 4EJTA 2FBHA 2MBFA 4ESBA 3WTWC 3M07A 1AA7A 3DKYA 5B1AH 3VSLA 2K85A 2K5CA 1KU2A 2ME0A 4Y13A 1KQ0A 3A0HC 5AIPA 4XLNF 1HQCA 2KHMA 1XGNA 1BL0A 3L00A 4HOBA 1SFOJ 3D0SA 3E6CC 3DV8A 4OWRB 3DPUA 2O3FA 2LKSA 2VOPA 2OZUA 3ZMVA 5CVVA 2F6CA 5J47A 4KIGA 2LG4A 4BAYA 1JKRC 4AIHA 1FSHA 2K9MA 2I5UA 4E4HA 5L3EA 3BTCA 4ESJA 4HNVA 2DOEA 5A2QZ 3O3KA 2ZBKA 2ZO4A 3H0GJ 1ZRDA 4E7KA 4LK1F 3NWTA 5KHDA 3LMMA 5M5YJ 2RQQA 5E1ZB 4ZC3A 3WTYC 4BHBA 1H88C 3S14J 4U7BA 2YU3A 3OYAA 2K7LA 1D0ZA 1EA3A 5IOZA 4JX4A 3DF8A 3BTJA 1MH3A 1TWAJ 1TT0A 3EUAA 4C2UA 1TT5B 1XX5A 1WGXA 5ICEA 3WU2C 2FD5A 3G1LA 1ETQA 1UFMA 1YS7A 1KU9A 3IKVA 4JX6A 3E97A 4ZH4F 1HKTA 3W2WA 3ZQGA 4RGRA 5EJCA 1R36A 1LQ1A 2IA1A 3A01A 2VPRA 3HOYJ 1I39A 2IA2A 1S6LA 3IKTA 2FOWA 2GBYA 2VB6A 2PG4A 4EQQA 4PGHA 2QVOA 4PSXA 3OYBA 3VOEA 2L02A 2VL8A 3DWLE 2EZIA 3BG9A 3F8BA 3GFIA 4ENJA 2YX7A 4RBOA 4MEYF 4DYCA 4YRVA 1R22A 5KAIC 1RUNA 1XGSA 1CF7B 4CXFA 2NVQJ 5CYVA 1U9OA 5E20A 1BBYA 4BUPA 3TO7A 1JXSA 4I98B 4A3LJ 2LNBA 4HEA2 2C6YA 1S7AA 2ESHA 2MG4A 4A3GJ 2DPDA 3TQNA 5L3BA 3V8LA 3HBLA 1MIJA 2J5OA 4F92B 2LVSA 4PZJA 2M30A 2NVYJ 5IPAA 4UVBA 5DCMA 2UZKA 2LKPA 1NTCA 3GBGA 4Y17A 1TBXA 4XIDA 3L2UA 4D7NA 4EM2A 2ZXHA 2VOOA 5GP9A 3ABTA 3KZYA 1ETKA 2DXIA 4RGXA 3F6OA 4FT8A 4N4NB 3ZN1A 1I50J 2LRDA 4KUMA 4Y33A 4M9ZA 5FFXA 2EA2A 2DT6A 4BY1J 1J75A 1HSTA 2FE3A 1BW5A 3LFUA 4M74A 4IQ4A 5DD8A 3JSOA 3HIFA 2BY3A 2XPVA 2HVSA 3FXMA 1T56A 2XHKA 5K7HA 2H6BA 2FSWA 1SFKA 5LHGA 2DDAA 1V54H 3BOQA 4QIWN 4XRSG 2DA1A 2LKXA 4DBRA 2KLOA 1G8XA 2X1CA 3ECHA 3OYNA 1APLC 1DDNA 1MMAA 2E35A 2A5YB 4HV5A 1YYVA 2EPFA 2JN6A 5DD4A 2RV8A 3VDXA 2R7FA 3NARA 4I09A 1BC8C 1UMQA 2YSRA 4FQGA 1B8IA 2QBYB 5EYRA 3ZP5A 1O3SA 1ACIA 1G3SA 1QZEA 2HDWA 5GAEJ 2L5QA 5HLGA 1YO5C 3K1MA 2BVMA 4XRMA 2ZJPF 1WRJA 2VODA 3LSGA 1UG0A 3TDUC 2UV1A 5FB2A 3FXKA 2F5VA 2R7TA 4B3AA 1PP8F 1XGMA 1U5TA 1T98A 2O61A 1W7PD 2NVUB 2VQCA 1X1AA 2FNPA 3OWTA 3WGGA 3FK7A 1I1GA 4CCMA 4EVIA 1FEXA 4C2TA 1OR7C 5A2QK 2M8GX 5GPCA 3HOUJ 1FSEA 4RAFA 3V7RA 1IDYA 1USSA 3V4GA 2LY2A 1VQLI 4MFEA 4BY7J 2AXTC 3CCYA 4NC6A 3PNVA 1B9MA 2XGDA 2R5YB 4A5MA 1AKHB 3S16J 1JUPA 3ONQA 2FMYA 2EV6A 1QO0D 1WCMJ 5EZHA 4ASNA 2PJPA 1WQ2A 4G8XA 1S3JA 2X6YA 4UVCA 1XC5A 3N97A 2E5ZA 3RPUD 1ODDA 4MIMA 2FUG2 4AUXA 3FXLA 2DI3A 1BA5A 4A69C 1J7KA 3L9FA 2DMNA 2I10A 2KZGA 3KP7A 3KP5A 2DODA 5D8LB 2WB1A 3H9GA 3JTHA 2JSPA 2CW7A 3RZDJ 1UHSA 4BL0B 2BW3A 4RB3C 3OYJA 2OD5A 5F0HA 4HQMA 3U1KA 3GW2A 2GAUA 3H35A 1IW7F 2HDCA 4CH7A 4KITB 2DA5A 1PYVA 4H0EA 4F91B 3PQJA 2IBDA 3DEWA 1N75A 3HPGA 1LKXA 1FBSA 4RB1A 4A5NA 2IGKA 1K6OA 1S7OA 3U9GA 2QYOA 1OCTC 3P7NA 2QWWA 2QENA 1FLIA 4MO7A 2DQRA 3EUKL 1G2HA 3AG3H 3G2BA 4KIBA 4BQOA 3CMEI 1B59A 3JW4A 2L3DA 5ILUA 2IS4A 1YQAA 4RAZA 3IH2A 3JAMK 5ILVA 4EM0B 1WSUA 4MHGA 3RSNA 2OQRA 4DIQA 1JHHA 2OQGA 4IXAA 5BQTA 1XDUA 2LY1A 4HBLA 4PUSA 3JRFA 4E7IA 4GYIA 2COMA 1LNWA 3FISA 4LLGF 3W3CA 1SFUA 1FIAA 1RRJA 2D5VA 4NHJA 1MBHA 3CUOA 4PSWA 4BQQA 2FNAA 3KYDB 1F5TA 1KYWA 4Q5SF 1VQOI 4UB6C 1SD6A 2X51A 4W1UA 4D7MA 1P4AA 3ZQHA 2MC4A 2OCCH 2CQXA 3DLLF 3MFKA 3K4LA 4ZJZA 1ZQ3P 2OTJI 3GFMA 2O6GE 2GA2A 2PLYA 3QRFF 1IRFA 3KP6A 4I2OA 1POGA 1YS6A 1FJLA 3FKJA 3GTLJ 2P0WA 5J6XA 4KFCA 4AM3A 3TW6A 5EF6A 2YS9A 4EGYA 2HFHA 3WTTC 4D5CA 2K86A 5FRNA 4XQFA 4P9FA 2DOFA 5L3FA 2CW0F 1Z7LA 2Z3YA 4EGZA 4G7HF 2LF8A 3ZMTA 2NNYA 1ZG3A 1R4NB 2CFXA 3FHZA 2OC6A 1BR2A 1F36A 3DPTA 1OR7A 2WA0A 3IV5A 2VXZA 5M5WJ 2A3SA 4L5EA 3NRVA 1UCRA 1FOWA 1TC3C 2L9SA 3L2VA 4XSXF 4V19K 2HYFA 1X3UA 2L7FP 3Q0WA 3OYEA 2PI0A 3DKXA 1VQKI 2DU9A 5E3NA 4P1WA 1X19A 2LH9A 4WXHA 5B3SH 1BR4A 2CQ7A 1Y56A 3HOZJ 1S7EA 4HF0A 1LPQA 3FXJA 3S15J 1IRXA 1GHCA 3H3UA 2VI6A 2Y0SN 3BQZA 2Z16A 1A04A 4CCJA 2R4GA 3PO3J 2BEOA 3G1OA 2XAGA 3KLOA 4HPQA 3RPQA 4MLOA 1MMNA 4XORA 5F6FA 1VI0A 4EJUA 2E2IJ 1D8KA 5IT9Z 1XSVA 3LQQA 4HSTA 4G12A 1SAUA 1OYWA 1J59A 3B73A 2QKMB 1MZBA 5AONA 2EJRA 1TW2A 3GLLA 4H4KC 1ZREA 4W97A 3KP3A 5CLSA 4MFDA 2W7NA 3IWFA 2Y9ZA 3QU6A 3IAS2 2D45A 2DPUA 2HQ5A 2IS2A 1ON2A 4BXUA 2F5EA 2H1LA 2WADA 4YG2F 1RKWA 2CMPA 2NOJB 2QQBA 4ENMA 2LK2A 1Y6IA 2BXYA 3FMSA 2D1VA 1Z3YA 2XRLA 3OYMA 1HBXG 1AHDP 5CVJA 1K83J 2GIZA 2R7WA 3UKGA 2XAUA 3BZ6A 3HG9A 1G3TA 1RC9A 5FROA 2VT2A 4RLQA 3GZ5A 5BNGA 1SFEA 3F0CA 4ANJA 2EB7A 3IWZA 2A61A 2LOOA 1W5CC 1FC3A 3A1YA 3BJAA 4B43A 4FHTA 4DQ2A 4DNCA 4QLCU 3W2AA 2XGEA 3F8FA 3MWMA 3W6KB 2B0LA 4ZYEA 3WODF 4HLXA 1TTYA 1QBJA 1TQIA 2WBMA 4HX7A 3RQ4A 2B9SA 1QZYA 2EWNA 1FWZA 4ENNA 4M3BA 2W57A 1MKMA 5IP9J 3C3WA 2DCEA 2DAOA 2IA0A 2WY8Q 3OYFA 3GTGJ 2W24A 4I0BA 5FLVA 2CQNA 3NQOA 3EETA 1SAXA 1IGNA 4AYBA 2CV1A 2NS8A 3LAJA 3REOA 1Z7UA 5ICCA 1X4OA 1H89C 3AL0C 2K9QA 3MZYA 4BHCA 2LBFA 2W48A 2JPBA 5LLQA 2XVCA 3A01B 2HXOA 4LLNA 2ESNA 2HYGD 1IRGA 1T8IA 4EJVA 5H6QA 2V4JC 3ZRGA 4U0WA 4XKVA 1X3WB 2OA4A 3FMQA 3F21A 3GUDA 2EK5A 1H8AC 1FP2A 3RKQA 2NOGA 2KZVA 5JVTA 2Y75A 3CCUI 2XB5A 3IC7A 1LE8A 5LGTA 1ETYA 3AG4H 1Y39A 4OAYA 2FJ1A 4RAGA 2B63J 1K4SA 1LB2A 4WXDA 2UXXA 2VKDA 4EEFG 4NC8A 2PBIA 5DCFA 2F2EA 3UNGC 3OOPA 2DMQA 2E7WA 2MW8A 3C18A 2E19A 3IHUA 1WKMA 4A93J 2HPIA 1Z9CA 4B48A 3F72A 3MAJA 1H9GA 3QU3A 1MDMA 1MD0A 2R7ZJ 3SHFA 2XF6A 4QPOA 1TWFJ 4BACA 2N8GA 5CKTA 1RPWA 4DGWB 1BI3A 1A6IA 3U1DA 3SQNA 4XKCA 1ZK8A 5HODA 2ZXJA 1ORKA 5DM7F 4BE2A 2LY9A 4IRGA 3HRMA 5FKKA 2JA2A 1WJEA 4CCNA 1WI3A 2JTVA 4NDLA 1USTA 2ME6A 2PJRA 1T0FA 2L9VA 2ZXIA 1T33A 5J1UA 1XPXA 5BPIA 3CDHA 2KP6A 3GWZA 2HDDA 2CQKA 4EM1A 4HW0A 3J7AY 3CMMA 3QP6A 1VQPI 1Z6RA 1LDDA 1W0UA 3IRRA 1R1TA 4JYKA 4R1HA 4OU0A 4XK4A 5FD6A 2F4MB 4A6EA 4P9UA 1KU7A 5F08A 3WU0A 2EH3A 3J80Z 4XLHA 1NG6A 2H27A 3OIPA 1YW8A 4LGWA 5IT9K 5K1YA 1QHGA 3CTAA 3DU5A 4G7ZF 1MJBA 1JJ8C 4S05A 5GTIC 3VODA 1S72I 3QYFA 2A6EF 4GCVA 3WGHA 1LE8B 5ILSA 3LA3A 4EATA 4NC7A 3HDDA 4C2MJ 2M7AA 2QF7A 4IHWA 4FASD 1FTZA 2EZKA 1F9NA 4XKWA 3LOCA 1ZN2A 5FKLA 3WTSC 2M45A 4RMNA 3BC8A 1MSEC 1W0TA 4XOTA 2QZ8A 2MABA 2X6XA 4ESFA 5E1XA 2NYXA 1HKQA 2I8DA 4PJNA 2HS5A 2KIFA 5LD2C 5EGOA 1XTAA 4AWXB 3HSEA 3CZ6A 1YG2A 1BN5A 3KLNA 1T39A 4MEXF 1AWCA 1FZPB 1X3ZB 4KDPA 3FBIB 2FBKA 2JVGA 3ERMA 1FBQA 5JLXA 1QA6A 1IN7A 4LITA 2DJIA 1TP4A 1RZ4A 1SD7A 3ZCOA 1YIOA 3ZMUA 3BJ6A 2IVMA 2OPTA 3EUHC 5KNLA 1SFXA 2HQRA 3MZHA 5IYDJ 1FTTA 3HPHA 1OCCH 4F7ZA 2DTRA 2VJ5A 4K2EA 4A6DA 4HLYA 1WFXA 1X2MA 4CCOA 3CCSI 1VQ5I 1XD7A 2O8KA 4LG0A 1P6RA 2DYSH 3SYTA 1NK3P 2E71A 1ONVA 3F23A 3OL4A 2XIGA 1SVLA 1UB9A 3J81Z 3GZNB 3RIRA 2ZCWA 4RGSA 1JTXA 1W5TA 5F04A 4YIRX 3HOWJ 3WHBA 2L7KA 1VNDA 4HG2A 4ZYDA 5BMZA 2CUFA 3TO9A 3ULQB 1OLTA 3ASOH 2JUCA 3ROUA 4IPAA 3G1MA 3I4NJ 3L7WA 2M8EA 3B02A 2GXBA 2OBPA 1Z67A 2BW3B 2E36A 3S3MA 3UR3C 1BC7C 4CYDA 1T2KA 1WVRA 3J7ZI 5FLXZ 3K1NA 1IZ1A 1LDKB 2LLKA 4LJZF 4XNFA 3VWBA 2JMWA 1ULYA 2Q8KA 3CP2A 4KIFA 3I71A 4WXCA 3KP2A 1DP7P 2FQ4A 4A3KJ 4HX4A 3N05A 3IH3A 1ZG1A 1Z1DA 5LHIA 4Z6YA 2XF7A 2P6SA 2IT0A 1Y1VJ 4BEHB 4Z2YA 3A0BC 2KL4A 3DTIA 1WJAA 4M3DA 3KYCB 2P5KA 1OPCA 2YX4A 3K1PA 3OYDA 1Z3XA 4F52A 4FE4A 1N78A 4UUTA 3T1BA 4PCQA 2QLZA 3C1DA 4TV7A 3AAFA 2CW8A 5DV5A 2CFOA 1MGTA 1W36D 2DW4A 2DMTA 5FKNA 5JHFA 1BIBA 1BW6A 4AIJA 1OKRA 3W6VA 2LF7A 1F1ZA 2CYYA 1JTYA 2Z9OA 1O7FA 2PJRB 4KT5C 2KT0A 3ZR8X 3HKZA 5M3FJ 2NVTJ 3GTPJ 1FOYA 1HW1A 1V5EA 2L01A 5K5QA 5EZGA 5BS6A 3CLOA 5KAFC 5D4RA 5M3MJ 1B1BA 1E3HA 3TBIA 3MKWB 5J4VA 1ETXA 1Q1HA 2NXNB 1ETVA 1DGRM 3ELKA 4CUGA 3V7SA 3OIOA 2JZYA 1FMVA 1I6XA 2OJED 2IS6A 4YEJA 3JTGA 1YFHA 2F5FA 3WTXC 2M4GA 5HLTA 4WK8F 4OIQF 5EEHA 4O3MA 4RB0A 2K9SA 2E1NA 4D5FA 4XN3A 2M1BA 3S2WA 2MD5A 4WX9A 5FLMJ 3S1QJ 3DPLC 2L4AA 1A6QA 4XL9A 2H8WA 2E2JJ 2IGMA 3L2RA 3RJPA 2M3AA 3HGYA 4BS9A 1PDNC 2Z5UA 1LVAA 3I59A 3ABLH 4L0ZB 3KPHA 5L3CA 1QPMA 3OMYA 4C9YA 5JFRA 2NVXJ 5CQGA 3HEFA 3H9JA 2RQPA 4B8XA 5C3EJ 3K4KA 1TQPA 1OQYA 1IRZA 5FJ8J 1T6SA 3HOTA 5FO5A 4G6DA 4GYGA 4HZFA 3HUGA 1XN7A 1K61A 4UUVA 3N4MA 1PUFA 4PK4A 1HDDC 1DPRA 2L7MP 4O6JA 5ICFA 1BIAA 2CO5A 4FE7A 1IN4A 3AG1H 3J81K 2E34A 1B6AA 4UVAA 2Y69H 3FX3A 4PJLA 5HLHA 3OYKA 2OAZA 2IXSA 3O6BB 5DS9A 3MZ8A 3R4KA 2TDXA 3ASNH 3RCOA 2FOKA 2OZ6A 2QSFX 2V1XA 2FMLA 1HC8A 2DQLA 3E7LA 3KEQA 2STWA 5D5VB 1QGPA 4LFUA 1YW9A 1FNNA 3BR5A 1EH7A 4BJ5C 4CA0A 2R7VA 1A36A 1QVUA 1MJAA 1J0RA 2KRFA 1XGOA 3F8CA 4BU2A 4PJ0C 4N9IA 2ICWG 3A03A 1FP1D 1KA8A 4U88A 3JCUC 3ZQFA 5KVRA 5DTDA 2A5WA 2B7EA 5LEKA 1UZCA 3C7JA 4M3EA 5J40A 1GDTA 2ETHA 4HF2A 1P7IA 2VONA 3A2KA 1LUJB 1WI9A 3HGGA 4GFBA 2P6TA 2Y0MA 1IN6A 5E17F 3K4JA 3E6DA 2YU9J 1J9IA 4XMYA 4DW6A 4F55A 1W36C 2K40A 1KQ8A 1VQ4I 3CUQB 2VKEA 2V7FA 4BJTA 2MA3A 3DP7A 2AXLA 2ZFUA 1Z77A 3ABUA 2XKPA 1E0EA 2L7ZA 1LFPA 2L9NA 2D2WA 4I0AA 4F3QA 2BE5F 3LSKA 1ZRCA 1BOBA 2DO7A 3TP3A 2WY7Q 1LFBA 2Q1ZB 1VQNI 1U5TC 3O8GA 3HTSB 4ZTFA 4UY8I 2IRFG 3DTEA 2KIUA 1YI2I 3F8NA 3FDYA 3ZXSA 3TMOA 3LL7A 3PO2J 5B1BH 1YRNB 4Q4ZF 1XG1A 3OYIA 4A0ZA 4HDVA 1TNSA 1RNLA 4BBRJ 3D5LA 2ZKZA 2HWVA 4QWQA 5GAHJ 2HZTA 1WZ2A 1VF9A 4GRIA 3DQVC 1AU7A 1YX5A 2V9KA 1FYKA 1FIPA 3K7AJ 3KEOA 3K2AA 5IY5H 4KISA 3JAMZ 1ZHFA 4ZZDA 1UAAA 2L54A 4B4CA 4A0YA 3HM5A 2M0MA 4Y4RA 3P9IA 1XS9A 1R5ID 3ZOBA 5EG0A 5H20A 1H9TA 1Z05A 3TW7A 2R7QA 2W00A 4OAZA 4ZYAA 2K27A 3S2HJ 2UUZA 5ED4A 1TWHJ 2XAFA 3VYUB 3VB2A 2ACJA 3OSFA 2M5WA 3HHHA 3K4NA 3MKLA 3SDBA 3TGNA 1MBJA 4HDUA 5DDGA 4O5VA 3I0TA 3FBNB 4KICA 5E8GA 3CCMI 1SD5A 1W5SA 3OYGA 2KRHA 4KT6A 3CC7I 3K4CA 3MD2A 4GDFA 1D1AA 3DU6A 1B8IB 4XBFA 4X1EA 1KQ9A 5E18F 2OF7A 3CQZJ 5F0FA 3PSIA 2MSYA 3CC2I 2R7UA 5E8IA 2ZJ2A 2PMZN 2IPQX 1IN8A 3PSFA 1BR1A 4PJJA 1R4MB 1AKHA 1LEAA 3PUBA 3OOUA 4IRHA 5KCMA 3E5XA 3J7AO 4RB2C 1SC7A 3T8TA 2EQRA 3WTZA 1AOYA 3KE2A 4II3A 4E70A 5LGNA 3CO7C 5E79C 2Q2EA 1K78A 2E1MB 2KRCA 3OYLA 5EEGA 3NAUA 3QYBA 2ZC2A 5B5EC 2BOLA 2X6OA 1R7JA 1ZELA 5IP6A 3BZCA 4G6QA 2PMUA 1VTNC 2M0CA 2DK5A 2QUFA 4BJ6C 2DMUA 3VEPA 1SD4A 4Y15A 2HVQA 3LSIA 3EPZA 3SZGA 2GQQA 3G3ZA 4R79A 1HSJA 2DOAA 4GXOA 3WE3A 5F27A 2HGCA 3I56I 5LRRA 2ELKA 4KN4X 2WAQA 3F6VA 3JRCA 3CF2A 3U21A 1BOAA 4B44A 3E3VA 2JA5J 2FA5A 3IL2A 3KETA 1I6HJ 3PM1A 3RKXA 4N4OB 1ZKGA 2PX9A 4FISA 2HOEA 3JRHA 2Y9YA 2P7CB 1T38A 4L9JA 3MVPA 4BQAA 4YFNF 2LR8A 1J09A 3FK6A 1JHFA 3M4OJ 2BY1A 3VYRB 4IO9F 1GT0C 1A31A 1X1DA 3G71I 3LSJA 3WU1B 1A35A 1GXPA 3BT9A 4M72A 1QZZA 2VBZA 3CMYA 3E6MA 3IAM2 4M9SA 1S29A 1XMKA 2WC2A 3CD6I 3IH4A 3GO5A 3K4MA 2DA4A 2RC4A 4FX0A 2R93J 1B4AA 2H1KA 4LOCA 1W7PB 2X1DA 1OCOH 5TJJA 2V79A 1ENHA 2CQQA 2E5NA 1UJ8A 1WJ5A 2ELJA 3CUQA 1OFCX 3KX2A 4DOZA 3VSKA 1RIOH 2VLAA 1OCRH 3MN2A 4AYBN 2DA3A 2K3PA 1TWCJ 2VASA 3QOEA 3IP4B 1HF0A 1RI7A 2VE9A 1RR8C 4AU7A 4F93B 3R61A 4UHTA 4M6XA 1O3QA 4KN7X 2GWRA 3HC7A 1ETWA 3HB9A 4ZDLA 1YJWI 3DKWA 3ZQCA 4LG0B 1U3EM 3R0AA 3ERED 1STZA 1VQ8I 3H0DA 3R6SA 2TRTA 5CVIA 4R8HA 2QEXI 2FU4A 3DCFA 3O2PE 4IHSA 3AKZA 2W25A 3Q9SA 2XSDC 5HDKA 2Y31A 1MBEA 1BJZA 2A69F 1JKPC 3ABKH 1OCPA 4CZZA 2M34A 2L9RA 2KKOA 5LGUA 2XAHA 2RVCA 2X9DA 5IYBJ 1Z0XA 3BJOA 2HOSA 1K7AA 3BR0A 1OCZH 2P5LC 3TO6A 3BR6A 2EIJH 3BQYA 5C44J 3K69A 3U2RA 4HNUA 3Q5FA 2CGPA 1JI8A 2XRNA 3E5QA 3SDGA 3F9KA 4CO8A 4YFKF 3TKYA 1H0MA 4L9NA 3AFHA 1C0WA 2BXZA 2XGXA 2HKXA 3FXRA 2X85A 3IUOA 1DU6A 4UUSB 4CCKA 3I59B 3ZQ7A 3I4PA 5HLIA 1K6YA 1W7PA 3GMEA 4LIUA 2K9NA 4NB5A 3G6EI 1ZARA 3GEZA 2MLKA 3M1EA 1T95A 4BHPA 2HOTA 1QHHD 3SZTA 3GTJJ 1IC8A 2XPWA 2L0KA 1X1BA 3E5UA 4HQEA 1VQMI 4CYCB 2DFIA 3I64A 3LA2A 5E3MA 5K5RA 3HUGB 3KCCA 1L3LA 3A02A 3F22A 1IDZA 2JK3A 3M7GA 4U0VA 2XROA 3HRSA 5JHUA 2OUMA 1JT0A 3BLYA 4CDGA 2KPMA 4HRIA 2M9HA 1MNMC 3H3VK 4XLAA 5FFZA 1V5GA 3OYHA 1KZHA 2OCEA 2F5CA 2VN2A 5IT3A 5D8KB 2WV0A 3RZOJ 4V2FA 4XRSA 3I4MJ 1IV6A 2NS7A 3H36A 3BZKA 4RGUA 3KEYA 4I02A 3V42A 4MTDA 1BI0A 3OS2A 3BR2A 3W2VA 2ZSIB 4ON0A 5J8CA 4B3XA 4E7LA 4UV8A 1MMDA 2XUBA 4DBQA 4L18B 3LA7A 5FGMA 4BNCA 1ZRFA 4LD5A 1JE8A 5D6FA 1GVJA 1ZLJA 4QTRA 3WG7H 4AVPA 4IOCF 3K9TA 1U0JA 2JT1A 3KIOA 4NNJA 2P8TA 2JA6J 1QPIA 5D4SA 4NUBA 2HR3A 4KJZA 4ZYGA 4CICA 1X1PA 1JJ6C 2FF4A 1R5HA 2JA7J 1LEBA 5DEQA 4XICA 5DUKA 2D1HA 1OYIA 2XF5A 5IOYA 4HYEA 2HEOA 2P81A 4UUSA 2DFFA 3T5XA 3CESA 1RUOA 2HZDA 2CUEA 4P96A 1NK2P 3HL2A 1DQUA 2OU2A 1IJWC 1IN5A 3MMYB 5LEJA 1U9NA 4I7HA 2RGVA 2O8XA 2VJIA 4RS8A 5D5XB 1R23A 1UG2A 3QP5A 2CG4A 2V9VA 3JRIA 4MTEA 3FF5A 3ZGKA 2MH9A 3C2GA 2KDZA 2JRTA 4CCLA 2M7BA 2MYSA 2DN0A 2IS1A 4BDYA 2EV5A 1IAWA 2EV0A 4XOPA 1XSXA 2HQAA 1IUFA 4ZDPA 3JRBA 4OMYA 2CUZA 2JA8J 2ZMEC 1O4XA 3HOXJ 1YIJI 3FKIJ 1KONA 4IHVA 3OIQA 3KZZA 2O9LA 1D3YA 4FX4A 2HXIA 1IXRC 3WE2A 2FRHA 1YLFA 3AG2H 2GZWA 2ZMEA 4HX8A 5D5WB 3CF5F 4L5JA 2A07F 4A3DJ 3BTLA 5LHHA 1V5FA 1D5VA 3SEQA 3Q9VA 1P2FA 4GO1A 2GIVA 4IF4A 1EH8A 2VC0A 4OINF 3ZQQA 4XLCA 1EF4A 4IVNA 1UHWA 3BTIA 2EZLA 3QWLA 1E17A 2F5DA 1MJ9A 1ON1A 4E7HA 2XAJA 4IJAA 1U5TB 2JUGA 3JRDA 2DDBA 1WJCA 3KFWX 2R7DA 2WB1N 5J3LA 3MQ0A 2KIQA 3GYHX 4BH9A 2RNJA 4QPQA 2MGQA 2KQRA 2QM3A 1XMXA 5CVRA 1FYLA 3C2HA 3RKWA 2V6EA 1E2XA 1CQTA 2K4BA 4M3GA 4BKXA 4I76A 2VE8A 3H5RA 2M2EA 1PUEE 1R49A 4E7SA 1NH3A 2V9PA 2VKHA 2R92J 4RA2A 2EFPA 1LFUP 5TGTA 3BCAA 3BPVA 1XCBA 2VBXA 3DXJF 1PP7U 2QSGX 3WTVC 4LB5A 1Z6TA 2HTSA 1YOVB 2WAQN 2E1CA 3S93A 3LFKA 2JJ7A 1R71A 4RDUA 4JOMA 3PFYA 4MNUA 3R60A 1TZLA 4XLPF 1DP3A 3KZIC 1Z21A 3S1MJ 1D8JA 1VQ7I 4A3BJ 1ZGAA 2F4IA 2HNHA 2R3SA 3EUHA 1D5YA 2LYCA 4EJOA 4ITVA 2Z1DA 4LMYA 2DT5A 1U78A 2PN6A 2DA7A 1YW7A 1MSFC 1NG7A 1MBFA 3OL3A 2E1MC 2QKLB 5DYMA 4AVZA 4XR6A 2PFBA 2XAQA 1VFCA 2R5ZA 2AO9A 3DFGA 3LSPA 3CC4I 2M87A 2P4WA 1A5JA 3FM5A 5ERIA 4AIDA 3CCQI 3QPSA 4HF1A 2H6CA 2BV6A 1U8RA 4C30A 4XRFA 5GPAA 1P4XA 5HS8A 2KISA 3JRGA 3R0JA 4P55A 2W85A 3M8JA 2V1UA 1EKEA 2ID6A 3FXUA 1IG7A 2H8RA 4HSRA 2GXAA 2IJLA 1G3YA 1MMGA 2G9WA 1EH6A 3HTUA 1R58A 3I9V2 4M3FA 5LBQA 1OYYA 1JKQC 2LSOA 5E3LA 4CHUA 3A4CA 6PAXA 2XSJC 3GZ6A 3BR3A 4RM3A 3TL4X 2G7UA 5HNHA 4IHYA 2E2HJ 3PNTA 1UELB 1O57A 4IL6C 1I1SA 3QQAA 3RDIA 4XSZF 4NQWB 1HA8A 2DYRH 2RREA 1BJAA 3JSPA 3V8KA 5HVQC 4IX7A 2BHZA 4I99C 2VJJA 2VUMJ 2JPCA 4CZCA 5F0CA 3QOPA 1Q1VA 3G73A 1T0FC 1XCVA 2O03A 4M6VA 4RLFA 3PQKA 2LC2A 1E3OC 2KJBA 2LDUA 3D1NI 3EYIA 2EFQA 2QQ8A 3DTKA 2ISZA 4GGGA 2HQNA 1B9NA 5GAGJ 4KA4A 2VBYA 1ITYA 3S3OA 2LREA 3HRUA 3Q0UA 2UXNA 5EEAA 3MEXA 4PFPA 3OR1C 5H6RA 3K6GA 1S5LC 3ZMZA 2R7SA 2VPLA 3FXQA 2G7HA 4BE0A 3SJMA 3NEUA 3SFIA 5DCMB 2MFZA 4ETSA 2EILH 5TISC 1SMYF 1ZAOA 2P5VA 2Y2ZA 4XN0A 3H1CA 4BEHA 2E60A 1YJ9I 3CUQC 4II2A 2EFNA 5CJ9A 5F64A 3PIOF 5GTHC 3OS0A 3S3NA 1JKOC 1IUYA 4A3IJ 3M1CA 1KGSA
chains in the Genus database with same CATH topology
1HLVA 5K7FA 5BNGA 3F0CA 3JREA 1RKTA 1B72B 1AKHA 4J19A 5C4XJ 1ZR4A 3OOUA 3S2DJ 2XGEA 1WPKA 4IEJA 2TCTA 2HI3A 2EQRA 4ABZA 1P7JA 4Y52J 5J1RA 4M3BA 5IP9J 4A3MJ 1DU0A 3GTGJ 1WH5A 3NAUA 5FLVA 5C4JJ 2X6OA 2R0QC 5IP6A 2DA6A 3B6CA 1IGNA 4A3EJ 2NS8A 2EZHA 3Q0VA 3GTKJ 4B1RA 1H89C 2K9QA 2M0CA 2W48A 2E1OA 2DMUA 4C3HJ 3A01B 2HXOA 5J1YA 3GTOJ 1R9TJ 5F27A 2GLOA 1TWGJ 1JT6A 2ELKA 1JUSA 3JRCA 1JGGA 2JA5J 4DYQA 1I6HJ 1H8AC 4AC0A 3PM1A 1ZKGA 2ME0A 4FISA 3JRHA 1F43A 2Y9YA 3RKQA 2NOGA 3MVPA 1PUFB 1BL0A 2LR8A 3M4OJ 3FK6A 2XB5A 1SFOJ 1LE8A 1GT0C 4Y7NJ 1ETYA 2CU7A 1RETA 3JR9A 4DZJA 2FJ1A 3LSJA 2B63J 3BT9A 1JKRC 3CMYA 4EEFG 3BTCA 2G0EA 4HNVA 2DMQA 2MW8A 3IH4A 3GTMJ 2E19A 4A93J 3H0GJ 2DA4A 3VPRA 2R93J 2R7ZJ 2H1KA 4LOCA 1TWFJ 2N8GA 1ENHA 2CQQA 5M5YJ 1RPWA 1A6IA 1H88C 3S14J 1OFCX 4CYCA 1ZK8A 5HODA 1ORKA 3MN2A 4AYBN 5IOZA 2DA3A 4JX4A 1TWCJ 2LY9A 3CDLA 5FKKA 3BTJA 1MH3A 1TWAJ 1HF0A 1WI3A 1WGXA 4NDLA 2ME6A 2R5YA 2FD5A 1T33A 3G1LA 5J1UA 1ETQA 1ETWA 3HB9A 4JX6A 3ZQCA 3ZQGA 2HDDA 1JUMA 2TRTA 5IYCJ 3A01A 2VPRA 3HOYJ 4A3JJ 3DCFA 1W0UA 4JYKA 4XK4A 2XSDC 2GBYA 3HKZN 5F08A 2Y31A 2EH3A 2YUSA 1MBEA 1BJZA 1JKPC 2ECBA 2EZIA 3BG9A 3WHCA 4RBOA 4DYCA 1JJ8C 1OCPA 2M34A 2L9RA 2LTPA 2X9DA 1LE8B 1U9OA 1MBGA 1Z0XA 5IYBJ 2NVQJ 2HOSA 5IP7J 3HDDA 2IEKA 4A3LJ 3BR0A 4C2MJ 3TP0A 2MG4A 4A3GJ 4IHWA 2QF7A 1FTZA 4BBSJ 3BR6A 3BQYA 5C44J 2EZKA 3HBLA 2XGCA 3LOCA 2LVSA 5FKLA 3SDGA 4QSHA 2NVYJ 1MSEC 5IPAA 3B6AA 1W0TA 1DU6A 4UUSB 3GBGA 1NTCA 4XIDA 1MH4A 5EGOA 2K9NA 4D7NA 2DA2A 5GP9A 2HOTA 1ETKA 2WV1A 3GTJJ 1IC8A 2XPWA 2L0KA 5EDNA 2JWTA 3BR1A 2XPUA 1I50J 5JLXA 2HYJA 4CYCB 1X58A 3M3YJ 5E3MA 4BY1J 1OJLA 1IDZA 3A02A 4X6AJ 2OPTA 2JK3A 1BW5A 3RQIA 5IYDJ 1FTTA 1JT0A 9ANTA 2M9HA 1MNMC 3H3VK 2XPVA 3ZQLA 1T56A 1X2MA 5K7HA 2O8KA 2ID3A 3RZOJ 1NK3P 3OSGA 4V2FA 4QIWN 4XRSA 1IV6A 3I4MJ 4XRSG 2NS7A 1SANA 2DA1A 2LKXA 4A3FJ 1JTXA 5F04A 3HOWJ 1APLC 3BR2A 3WHBA 1VNDA 5K7ZA 2CUFA 2JN6A 4S0HB 3I4NJ 3G1MA 3NARA 5JLWA 2X48A 1UMQA 1B8IA 5EYRA 5FKMA 4QTRA 2LLKA 1MBKA 2JMWA 4XRMA 3FIWA 1RESA 2JA6J 2FQ4A 3LSGA 4A3KJ 1QPIA 3IH3A 3ZQIA 1Y1WJ 1JJ6C 4B3AA 3JRAA 1Y1VJ 4FCYA 2JA7J 4XICA 4M3DA 1HCRA 5IOYA 4FE4A 2P81A 4UUTA 4UUSA 2CUEA 1NK2P 1IJWC 3FK7A 1FEXA 2M8GX 1U9NA 5GPCA 3HOUJ 2DMTA 5FKNA 1IDYA 2O7OA 1BW6A 1UG2A 3W6VA 3JRIA 4MFEA 1JTYA 4BY7J 3CCYA 2KT0A 4V2GA 2IAIA 2DTZA 2XGDA 2R5YB 5M3FJ 2NVTJ 2KDZA 1AKHB 3GTPJ 1JUPA 2DMPA 2DN0A 3L1PA 3S16J 1RR7A 5EZGA 5M3MJ 2DJNA 1IUFA 3JRBA 1GUUA 1WCMJ 1ETXA 5EZHA 2LD5A 3LNQA 2JA8J 1O4XA 3HOXJ 1ETVA 2EBIA 3FKIJ 1XC5A 3OIOA 3C2BA 4IHVA 4MIMA 2O9LA 4AUXA 1GVDA 1HOMA 5E3OA 2HXIA 4DYRA 2AHQA 4C3IJ 2K9SA 4D5FA 4A3DJ 5FLMJ 3Q3SA 4A69C 3BTLA 1BA5A 3S1QJ 2DMNA 2I10A 4C3JJ 3RZDJ 2E2JJ 1UHSA 3HGYA 5F0HA 1B72A 1EF4A 3BTIA 2EZLA 1ETOA 2DA5A 2NVXJ 3JRDA 3HEFA 2IBDA 3DEWA 5C3EJ 2WB1N 5J3LA 1X2NA 2MGQA 1IRZA 1OCTC 5FJ8J 2ECCA 4MO7A 1K61A 1G2HA 1PUFA 1CQTA 4M3GA 4BKXA 3O8HA 1HDDC 4I76A 2L7MP 2M2EA 3IH2A 4FE7A 2R92J 1LFUP 4I6ZA 2WAQN 3JRFA 2JJ7A 1QRYA 4RDUA 2RAEA 3FISA 5DS9A 1FIAA 2D5VA 1MBHA 1U8BA 3S1MJ 4A3BJ 2FX0A 3E7LA 3S1NJ 1D5YA 3BR5A 1U78A 1QVUA 4W1UA 4D7MA 4JX5A 2DA7A 3ZQHA 2CQXA 1MSFC 1QVTA 1ZQ3P 1MBFA 2R5ZB 3A03A 3ZQFA 5DTDA 1POGA 1FJLA 2Y30A 5EG0B 1VFCA 3GTLJ 2R5ZA 2LFBA 2AO9A 4M3EA 3LSPA 3TW6A 5EF6A 1GDTA 1A5JA 2YS9A 3QPSA 1P7IA 5M5XJ 4D5CA 2XB0X 5FKOA 3HGGA 5GPAA 1I3QJ 4GFBA 3HOVJ 3JRGA 2YU9J 4FTHA 3TEDA 4DW6A 2ID6A 2K40A 1IG7A 2H8RA 2VKEA 1F36A 3IV5A 1Z77A 5M5WJ 3BG3A 4L5EA 4M3FA 2L7ZA 1TC3C 1WH7A 5E3LA 2ZB9A 1JKQC 3S17J 3TP3A 2CRGA 3BR3A 1LFBA 4DZPA 3LSRA 2L7FP 4IHYA 3Q0WA 3O8GA 2E2HJ 5E3NA 2GM4A 3PO2J 3QQAA 1YRNB 4JP0A 3HOZJ 1S7EA 1XG1A 1ZGWA 4BBRJ 3S15J 1YRNA 1ZTRA 2VI6A 1VF9A 2Y0SN 3BQZA 2VUMJ 1AU7A 5F0CA 1Q1VA 3PO3J 3G1OA 1FIPA 4IHXA 3K7AJ 4M6VA 3K2AA 2VKVA 3BG5A 4MLOA 5EGOB 1E3OC 3D1NI 4B4CA 3S1RJ 1VI0A 2HOAA 3HM5A 3GTQJ 1XS9A 2E2IJ 3ZOBA 5EG0A 3TW7A 1GV5A 4G12A 2CJJA 2COBA 3S2HJ 1TWHJ 1ITYA 3OSFA 3MKLA 1MBJA 4W97A 4A3CJ 3Q0UA 2LP0A 4MFDA 3QPLA 5EEAA 2Y9ZA 1GV2A 2QCOA 2HQ5A 5F1JA 1ZR2A 4BXXJ 3SJMA 1RKWA 3SFIA 2LK2A 2XRLA 2Y2ZA 1AHDP 1B8IB 1K83J 4X1EA 1JKOC 3UKGA 2OF7A 3CQZJ 5F0FA 1HDPA 2MSYA 4A3IJ 2PMZN
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HLV A;  5K7F A;  5BNG A;  3F0C A;  3JRE A;  1RKT A;  1B72 B;  1AKH A;  4J19 A;  5C4X J;  1ZR4 A;  3OOU A;  3S2D J;  2XGE A;  1WPK A;  4IEJ A;  2TCT A;  2HI3 A;  2EQR A;  4ABZ A;  1P7J A;  4Y52 J;  5J1R A;  4M3B A;  5IP9 J;  4A3M J;  1DU0 A;  3GTG J;  1WH5 A;  3NAU A;  5FLV A;  5C4J J;  2X6O A;  2R0Q C;  5IP6 A;  2DA6 A;  3B6C A;  1IGN A;  4A3E J;  2NS8 A;  2EZH A;  3Q0V A;  3GTK J;  4B1R A;  1H89 C;  2K9Q A;  2M0C A;  2W48 A;  2E1O A;  2DMU A;  4C3H J;  3A01 B;  2HXO A;  5J1Y A;  3GTO J;  1R9T J;  5F27 A;  2GLO A;  1TWG J;  1JT6 A;  2ELK A;  1JUS A;  3JRC A;  1JGG A;  2JA5 J;  4DYQ A;  1I6H J;  1H8A C;  4AC0 A;  3PM1 A;  1ZKG A;  2ME0 A;  4FIS A;  3JRH A;  1F43 A;  2Y9Y A;  3RKQ A;  2NOG A;  3MVP A;  1PUF B;  1BL0 A;  2LR8 A;  3M4O J;  3FK6 A;  2XB5 A;  1SFO J;  1LE8 A;  1GT0 C;  4Y7N J;  1ETY A;  2CU7 A;  1RET A;  3JR9 A;  4DZJ A;  2FJ1 A;  3LSJ A;  2B63 J;  3BT9 A;  1JKR C;  3CMY A;  4EEF G;  3BTC A;  2G0E A;  4HNV A;  2DMQ A;  2MW8 A;  3IH4 A;  3GTM J;  2E19 A;  4A93 J;  3H0G J;  2DA4 A;  3VPR A;  2R93 J;  2R7Z J;  2H1K A;  4LOC A;  1TWF J;  2N8G A;  1ENH A;  2CQQ A;  5M5Y J;  1RPW A;  1A6I A;  1H88 C;  3S14 J;  1OFC X;  4CYC A;  1ZK8 A;  5HOD A;  1ORK A;  3MN2 A;  4AYB N;  5IOZ A;  2DA3 A;  4JX4 A;  1TWC J;  2LY9 A;  3CDL A;  5FKK A;  3BTJ A;  1MH3 A;  1TWA J;  1HF0 A;  1WI3 A;  1WGX A;  4NDL A;  2ME6 A;  2R5Y A;  2FD5 A;  1T33 A;  3G1L A;  5J1U A;  1ETQ A;  1ETW A;  3HB9 A;  4JX6 A;  3ZQC A;  3ZQG A;  2HDD A;  1JUM A;  2TRT A;  5IYC J;  3A01 A;  2VPR A;  3HOY J;  4A3J J;  3DCF A;  1W0U A;  4JYK A;  4XK4 A;  2XSD C;  2GBY A;  3HKZ N;  5F08 A;  2Y31 A;  2EH3 A;  2YUS A;  1MBE A;  1BJZ A;  1JKP C;  2ECB A;  2EZI A;  3BG9 A;  3WHC A;  4RBO A;  4DYC A;  1JJ8 C;  1OCP A;  2M34 A;  2L9R A;  2LTP A;  2X9D A;  1LE8 B;  1U9O A;  1MBG A;  1Z0X A;  5IYB J;  2NVQ J;  2HOS A;  5IP7 J;  3HDD A;  2IEK A;  4A3L J;  3BR0 A;  4C2M J;  3TP0 A;  2MG4 A;  4A3G J;  4IHW A;  2QF7 A;  1FTZ A;  4BBS J;  3BR6 A;  3BQY A;  5C44 J;  2EZK A;  3HBL A;  2XGC A;  3LOC A;  2LVS A;  5FKL A;  3SDG A;  4QSH A;  2NVY J;  1MSE C;  5IPA A;  3B6A A;  1W0T A;  1DU6 A;  4UUS B;  3GBG A;  1NTC A;  4XID A;  1MH4 A;  5EGO A;  2K9N A;  4D7N A;  2DA2 A;  5GP9 A;  2HOT A;  1ETK A;  2WV1 A;  3GTJ J;  1IC8 A;  2XPW A;  2L0K A;  5EDN A;  2JWT A;  3BR1 A;  2XPU A;  1I50 J;  5JLX A;  2HYJ A;  4CYC B;  1X58 A;  3M3Y J;  5E3M A;  4BY1 J;  1OJL A;  1IDZ A;  3A02 A;  4X6A J;  2OPT A;  2JK3 A;  1BW5 A;  3RQI A;  5IYD J;  1FTT A;  1JT0 A;  9ANT A;  2M9H A;  1MNM C;  3H3V K;  2XPV A;  3ZQL A;  1T56 A;  1X2M A;  5K7H A;  2O8K A;  2ID3 A;  3RZO J;  1NK3 P;  3OSG A;  4V2F A;  4QIW N;  4XRS A;  1IV6 A;  3I4M J;  4XRS G;  2NS7 A;  1SAN A;  2DA1 A;  2LKX A;  4A3F J;  1JTX A;  5F04 A;  3HOW J;  1APL C;  3BR2 A;  3WHB A;  1VND A;  5K7Z A;  2CUF A;  2JN6 A;  4S0H B;  3I4N J;  3G1M A;  3NAR A;  5JLW A;  2X48 A;  1UMQ A;  1B8I A;  5EYR A;  5FKM A;  4QTR A;  2LLK A;  1MBK A;  2JMW A;  4XRM A;  3FIW A;  1RES A;  2JA6 J;  2FQ4 A;  3LSG A;  4A3K J;  1QPI A;  3IH3 A;  3ZQI A;  1Y1W J;  1JJ6 C;  4B3A A;  3JRA A;  1Y1V J;  4FCY A;  2JA7 J;  4XIC A;  4M3D A;  1HCR A;  5IOY A;  4FE4 A;  2P81 A;  4UUT A;  4UUS A;  2CUE A;  1NK2 P;  1IJW C;  3FK7 A;  1FEX A;  2M8G X;  1U9N A;  5GPC A;  3HOU J;  2DMT A;  5FKN A;  1IDY A;  2O7O A;  1BW6 A;  1UG2 A;  3W6V A;  3JRI A;  4MFE A;  1JTY A;  4BY7 J;  3CCY A;  2KT0 A;  4V2G A;  2IAI A;  2DTZ A;  2XGD A;  2R5Y B;  5M3F J;  2NVT J;  2KDZ A;  1AKH B;  3GTP J;  1JUP A;  2DMP A;  2DN0 A;  3L1P A;  3S16 J;  1RR7 A;  5EZG A;  5M3M J;  2DJN A;  1IUF A;  3JRB A;  1GUU A;  1WCM J;  1ETX A;  5EZH A;  2LD5 A;  3LNQ A;  2JA8 J;  1O4X A;  3HOX J;  1ETV A;  2EBI A;  3FKI J;  1XC5 A;  3OIO A;  3C2B A;  4IHV A;  4MIM A;  2O9L A;  4AUX A;  1GVD A;  1HOM A;  5E3O A;  2HXI A;  4DYR A;  2AHQ A;  4C3I J;  2K9S A;  4D5F A;  4A3D J;  5FLM J;  3Q3S A;  4A69 C;  3BTL A;  1BA5 A;  3S1Q J;  2DMN A;  2I10 A;  4C3J J;  3RZD J;  2E2J J;  1UHS A;  3HGY A;  5F0H A;  1B72 A;  1EF4 A;  3BTI A;  2EZL A;  1ETO A;  2DA5 A;  2NVX J;  3JRD A;  3HEF A;  2IBD A;  3DEW A;  5C3E J;  2WB1 N;  5J3L A;  1X2N A;  2MGQ A;  1IRZ A;  1OCT C;  5FJ8 J;  2ECC A;  4MO7 A;  1K61 A;  1G2H A;  1PUF A;  1CQT A;  4M3G A;  4BKX A;  3O8H A;  1HDD C;  4I76 A;  2L7M P;  2M2E A;  3IH2 A;  4FE7 A;  2R92 J;  1LFU P;  4I6Z A;  2WAQ N;  3JRF A;  2JJ7 A;  1QRY A;  4RDU A;  2RAE A;  3FIS A;  5DS9 A;  1FIA A;  2D5V A;  1MBH A;  1U8B A;  3S1M J;  4A3B J;  2FX0 A;  3E7L A;  3S1N J;  1D5Y A;  3BR5 A;  1U78 A;  1QVU A;  4W1U A;  4D7M A;  4JX5 A;  2DA7 A;  3ZQH A;  2CQX A;  1MSF C;  1QVT A;  1ZQ3 P;  1MBF A;  2R5Z B;  3A03 A;  3ZQF A;  5DTD A;  1POG A;  1FJL A;  2Y30 A;  5EG0 B;  1VFC A;  3GTL J;  2R5Z A;  2LFB A;  2AO9 A;  4M3E A;  3LSP A;  3TW6 A;  5EF6 A;  1GDT A;  1A5J A;  2YS9 A;  3QPS A;  1P7I A;  5M5X J;  4D5C A;  2XB0 X;  5FKO A;  3HGG A;  5GPA A;  1I3Q J;  4GFB A;  3HOV J;  3JRG A;  2YU9 J;  4FTH A;  3TED A;  4DW6 A;  2ID6 A;  2K40 A;  1IG7 A;  2H8R A;  2VKE A;  1F36 A;  3IV5 A;  1Z77 A;  5M5W J;  3BG3 A;  4L5E A;  4M3F A;  2L7Z A;  1TC3 C;  1WH7 A;  5E3L A;  2ZB9 A;  1JKQ C;  3S17 J;  3TP3 A;  2CRG A;  3BR3 A;  1LFB A;  4DZP A;  3LSR A;  2L7F P;  4IHY A;  3Q0W A;  3O8G A;  2E2H J;  5E3N A;  2GM4 A;  3PO2 J;  3QQA A;  1YRN B;  4JP0 A;  3HOZ J;  1S7E A;  1XG1 A;  1ZGW A;  4BBR J;  3S15 J;  1YRN A;  1ZTR A;  2VI6 A;  1VF9 A;  2Y0S N;  3BQZ A;  2VUM J;  1AU7 A;  5F0C A;  1Q1V A;  3PO3 J;  3G1O A;  1FIP A;  4IHX A;  3K7A J;  4M6V A;  3K2A A;  2VKV A;  3BG5 A;  4MLO A;  5EGO B;  1E3O C;  3D1N I;  4B4C A;  3S1R J;  1VI0 A;  2HOA A;  3HM5 A;  3GTQ J;  1XS9 A;  2E2I J;  3ZOB A;  5EG0 A;  3TW7 A;  1GV5 A;  4G12 A;  2CJJ A;  2COB A;  3S2H J;  1TWH J;  1ITY A;  3OSF A;  3MKL A;  1MBJ A;  4W97 A;  4A3C J;  3Q0U A;  2LP0 A;  4MFD A;  3QPL A;  5EEA A;  2Y9Z A;  1GV2 A;  2QCO A;  2HQ5 A;  5F1J A;  1ZR2 A;  4BXX J;  3SJM A;  1RKW A;  3SFI A;  2LK2 A;  2XRL A;  2Y2Z A;  1AHD P;  1B8I B;  1K83 J;  4X1E A;  1JKO C;  3UKG A;  2OF7 A;  3CQZ J;  5F0F A;  1HDP A;  2MSY A;  4A3I J;  2PMZ N; 
#chains in the Genus database with same CATH topology
 1HLV A;  5K7F A;  2XV4 S;  3JRE A;  1RKT A;  5C4X J;  3H92 A;  3CP8 A;  1VQ9 I;  3K70 C;  2JRM A;  2TCT A;  2Y48 A;  3RYP A;  4AD9 A;  2HI3 A;  1BM9 A;  4Y52 J;  2BY2 A;  5CPR B;  1WWX A;  3ABM H;  3H9Q A;  5J1R A;  4A3M J;  2K9L A;  2H94 A;  1WH5 A;  3TDZ C;  4D9J A;  3K0L A;  1MW7 A;  5C4J J;  4NBQ A;  3HXL A;  1TQM A;  1Z91 A;  2DA6 A;  4I01 A;  3M8F A;  3GTK J;  2AQE A;  4B1R A;  3CO6 C;  4LK0 F;  3FWE A;  3TOB A;  3DBR B;  3CCL I;  2JQ7 A;  4M9X A;  1WJD A;  1SVM A;  2KIM A;  2NAZ A;  3MCZ A;  2IW5 A;  2QA4 I;  1R9T J;  2JSC A;  2GLO A;  1TWG J;  2FEZ A;  4D1Q A;  1JUS A;  2ZNZ A;  3HSR A;  4G94 A;  2Q0O A;  1JGG A;  4HAM A;  4MQV A;  1IF1 A;  4LG3 A;  4DYQ A;  2KFD A;  1KU3 A;  2V6C A;  1IXS B;  2FQ3 A;  4AC0 A;  3HRT A;  1YJN I;  1F43 A;  1YX3 A;  5BOX A;  3I53 A;  1OIS A;  3SFZ A;  3ZMD A;  1PUF B;  3OY9 A;  3QOD A;  4ZTJ A;  5D5U B;  4OMZ A;  2MLG A;  4M6Y A;  2CU7 A;  4Y7N J;  5CVU A;  1DPU A;  1RET A;  3JR9 A;  4EMS A;  4DZJ A;  2CV2 A;  2ISY A;  4KNY A;  2XC7 A;  1V3F A;  3CJQ B;  3PL8 A;  2G0E A;  4NQW A;  2VT3 A;  3GTM J;  3I5U A;  1Y0U A;  1FY7 A;  1IV8 A;  1BI2 A;  3ZMS A;  3VPR A;  2A6H F;  2HVR A;  1D1B A;  2DK8 A;  3H5A A;  3QPH A;  4G6T B;  2K4J A;  3RTR A;  1IXC A;  1R1U A;  3VFZ A;  4IKF A;  4BXF A;  2PQ8 A;  4CYC A;  2L2O A;  1VZ0 A;  2GA1 A;  3P9C A;  4MGR A;  3V8J A;  3CDL A;  3GCM A;  1TL8 A;  4LIV A;  3DEE A;  1MMS A;  4D0P A;  2MD0 A;  2QGU A;  1S8N A;  2GOX B;  2R5Y A;  4J00 A;  1NHA A;  2IP2 A;  2RDP A;  3ZPL A;  1WJB A;  1FT9 A;  1HW2 A;  2L4M A;  1JUM A;  5IYC J;  2DLL A;  2VXD A;  1K79 A;  2STT A;  4A3J J;  2W4S A;  1GLN A;  1QNT A;  3F3X A;  3HKZ N;  4S04 A;  2LMD A;  2YUS A;  2VQL A;  5H2F C;  4WWC A;  3KP4 A;  2ECB A;  3HZJ A;  3WHC A;  3FXO A;  4J01 A;  3ML6 A;  3D5S C;  3HHG A;  1O3R A;  1WJF A;  2K3F A;  3D5R C;  2BYV E;  2LTP A;  2OTL I;  3NWS A;  4JBA A;  2MC3 A;  4N9H A;  3FMR A;  1MBG A;  5IP7 J;  4YII A;  2E7X A;  2V1D A;  2AQF A;  1CF7 A;  2IEK A;  2DFE A;  1PJR A;  3TP0 A;  3K70 D;  2EIK H;  4BBS J;  1G3W A;  2H09 A;  2OV7 A;  2XGC A;  5F1R A;  1ZG5 A;  5J8F A;  2WAE A;  5L3G A;  1Y8Q B;  4QSH A;  2RN7 A;  1V55 H;  4OOI A;  4LLL A;  3B6A A;  2IGO A;  1X1C A;  1V4R A;  4JQF A;  3I54 A;  1MH4 A;  3WTU C;  2EFW A;  1R6R A;  2DA2 A;  3BPX A;  2R7X A;  2WV1 A;  5EDN A;  3BWG A;  2JWT A;  3BR1 A;  1VQ6 I;  4BQN A;  2XPU A;  5AIQ A;  2HYJ A;  3PJR A;  1X58 A;  3M3Y J;  1FMW A;  3CCE I;  1OJL A;  4X6A J;  2BGC A;  2IGN A;  3RQI A;  2BZT A;  3CJR B;  5JI6 A;  2XAS A;  1P9Q C;  1U6G A;  2R7O A;  4IZZ A;  9ANT A;  1M1E B;  3ZQL A;  2ID3 A;  2W82 A;  3RKY A;  3SEZ A;  1XB4 A;  3OSG A;  2UWM A;  1SAN A;  3OV8 A;  2YR2 A;  2V1N A;  4ZZL A;  2F48 A;  4A3F J;  2HU9 A;  2BBY A;  2EIM H;  5HS9 A;  5K7Z A;  1X4P A;  2JVH A;  3J80 K;  4S0H B;  4IQJ A;  5E1W A;  2QQ9 A;  1ZH5 A;  1XSD A;  2Z99 A;  5JLW A;  2X48 A;  1L0O C;  1EV7 A;  3ZN0 A;  2ADU A;  3DEU A;  2VQH A;  1W1W E;  4PJM A;  5FKM A;  1TW3 A;  1MBK A;  3VYS B;  3MKY B;  3MKZ A;  2XDV A;  2FBI A;  4X0G A;  4EV0 A;  1K4T A;  2ZSH B;  1I5Z A;  3BRO A;  5K5O A;  3FIW A;  1RES A;  3LST A;  3ZQI A;  1Y1W J;  1GXQ A;  3E1S A;  4KYW A;  2KDO A;  4UV9 A;  3JRA A;  4HA8 A;  4FCY A;  4BGD A;  1HCR A;  1Y0N A;  4Q47 A;  2BY0 A;  5HNF A;  5DUI A;  3X2Q H;  5HOO A;  3COA C;  2DT7 B;  1R5G A;  2EFO A;  4Y3O A;  4DJA A;  1TNT A;  4A0X A;  3DLA A;  2X4H A;  2A68 F;  3CJT B;  1ERD A;  3GFJ A;  5LRS A;  1ZYR F;  3CCV I;  2O7O A;  3FZV A;  2K02 A;  1T08 B;  3EDP A;  4N0B A;  4A2U A;  4WCG A;  1TLH B;  3GFL A;  4V2G A;  2Q2E B;  2IAI A;  2DTZ A;  5KK1 A;  3GXO A;  2QSH X;  1REP C;  1J5Y A;  4XKB A;  4IRI A;  2DMP A;  3L1P A;  1XMA A;  2FXA A;  1RR7 A;  2GXG A;  2DJN A;  1GUU A;  2LD5 A;  2CSO A;  3LNQ A;  4ZDO A;  3DBL B;  1D0X A;  3I58 A;  4YEL A;  3CCR I;  4OIO F;  2W84 A;  2EBI A;  2CS3 A;  4U7D A;  3IRQ A;  1YIT I;  3V7C A;  3OYC A;  3GF2 A;  3C2B A;  3KYL A;  1SEU A;  2O0Y A;  1KYZ A;  3FHN A;  3RPU A;  4OIP F;  2CWE A;  1GVD A;  1HOM A;  5E3O A;  4DYR A;  4OIR F;  2AHQ A;  4C3I J;  5BPD A;  1HXD A;  1LVK A;  2Y0S A;  5HDN A;  1LJ9 A;  3Q3S A;  1DGW Y;  2A6T A;  1QU3 A;  2PMH A;  2A05 A;  2ZJQ F;  4C3J J;  2QBY A;  3L2W A;  1MND A;  3CCJ I;  1B72 A;  1OMI A;  3GX4 X;  1P92 A;  3EQL F;  1ETO A;  2VJ4 A;  4L9V A;  4EJW A;  2EIN H;  2KJC A;  2HKO A;  2J5P A;  3K2Z A;  2AS5 F;  1YTY A;  5FRM A;  1X2N A;  4B47 A;  2ECC A;  2VQG A;  4XM3 A;  1JGS A;  1O3T A;  1D0Y A;  1ZLK A;  3GVA A;  1I3A A;  1R1V A;  5JR3 A;  2CV0 A;  3J7Y J;  3BG7 A;  2V26 A;  4HNT A;  5HS7 A;  3O8H A;  4UB8 C;  5JVG F;  5ICG A;  2LBF B;  1ZGJ A;  4L0Y B;  4I6Z A;  3PFI A;  5D6E A;  3CMA I;  3EYY A;  4ZYH A;  5B66 C;  2WWY A;  3RI4 A;  1QRY A;  1W4M A;  3LSH A;  2RAE A;  3OS1 A;  2WAF A;  1MDM B;  3E0J B;  4YIF A;  3PIP F;  1U8B A;  2FX0 A;  4MQ9 F;  1YE9 A;  3AL0 B;  4KMU X;  3S1N J;  4E7J A;  4E7Z A;  3T8R A;  1SMT A;  4WF2 A;  3M9A A;  3DBH B;  4JX5 A;  3TOA A;  3BG6 A;  1UHM A;  1QQI A;  1QVT A;  2R5Z B;  2ZJR F;  1DUX C;  4YFX F;  4U87 A;  4KMF A;  1FBU A;  2F4O B;  3BCB A;  3HYI A;  3LWF A;  2Y30 A;  5EG0 B;  3VYT B;  2LFB A;  3L2C A;  2VC1 A;  4M71 A;  2O5R A;  3ISP A;  5M5X J;  3F8M A;  2XB0 X;  1E3P A;  5FKO A;  1I3Q J;  2YPR A;  3BDD A;  4CGZ A;  3HOV J;  4RAY A;  2Z2S B;  2QQA A;  5FD5 A;  4FTH A;  3TED A;  3LSM A;  4XLE A;  3LAP A;  1S9H A;  2X1E A;  4BYY A;  3S8P A;  2NS0 A;  1MNE A;  1IO2 A;  3I55 I;  3RYR A;  1XDS A;  2HTJ A;  4JK1 X;  1G4D A;  4UNO A;  3LQR A;  5J4Y A;  3BG3 A;  2CH0 A;  2MH2 A;  3WGI A;  1WH7 A;  2DFH A;  2ZB9 A;  1FX7 A;  2Z33 A;  3ECO A;  3S17 J;  2CRG A;  2KMU A;  4DZP A;  3LSR A;  2RKH A;  3CLQ A;  4B09 A;  3SZP A;  3QAH A;  3H5N A;  2GM4 A;  4CSW A;  2RNG A;  4JP0 A;  4G7O F;  3W6J B;  2P7V B;  1ZGW A;  3E6B A;  2R7R A;  3BP8 A;  1YRN A;  1LDJ A;  1ZTR A;  3L09 A;  1R00 A;  1K78 B;  4IHT A;  3H3Z A;  3P9K A;  4M73 A;  1EJ9 A;  3FM3 A;  2CUJ A;  3P5J A;  1O7L A;  4XON A;  4IHX A;  1N25 A;  2BVL A;  2NNN A;  2ELH A;  2VKV A;  3BG5 A;  3GLX A;  2VBW A;  5EGO B;  1FYM A;  3QPT A;  4L9T A;  3T0Y A;  1YHQ I;  3S1R J;  2HOA A;  3GTQ J;  4PFO A;  1GV5 A;  2ZFW A;  2CJJ A;  5TRD A;  2ZME B;  4L5I A;  2DBB A;  2COB A;  3HSF A;  4UXN A;  4XLF A;  5L3D A;  3HJE A;  1I27 A;  4IOA F;  4A3C J;  1BI1 A;  2LP0 A;  1FPQ A;  2M4K A;  3QPL A;  3L2Q A;  1GV2 A;  2QCO A;  3OR2 C;  2ZXW H;  5F1J A;  4U0Y A;  1ZR2 A;  1FOX A;  5CQE A;  1PVE A;  4BXX J;  1D1C A;  3WG9 A;  1CGP A;  2PEX A;  1N77 A;  4AIK A;  1HW5 A;  4ENK A;  2BHY A;  3K4B A;  3ESW B;  5LFA A;  1HDP A;  3S32 A;  4BDZ A;  1G6N A;  5FLX K;  5DM6 F;  2GOM A;  1FOK A;  2EA4 A;  1B72 B;  3K10 A;  1HKS A;  4J19 A;  4BE1 A;  1ZR4 A;  1U2W A;  1P4W A;  3S2D J;  1WPK A;  1Y8R B;  2ZNY A;  4IEJ A;  2W1O A;  3BY6 A;  4HV6 A;  3CJN A;  4ABZ A;  1P7J A;  3PNY A;  2VIX A;  3SXY A;  2X0L A;  1G59 A;  4P5O A;  4G9Y A;  4LB6 B;  3CDI A;  4FET A;  3I3L A;  1DU0 A;  2R0Q C;  2PMZ A;  3B6C A;  4A3E J;  3G4S I;  3HOS A;  2EZH A;  3Q0V A;  4A12 A;  3M8E A;  1SVO A;  5HDG A;  4PGG A;  3PUF A;  2E1O A;  4Q48 A;  1F4K A;  2HPM A;  2NRA C;  2WTE A;  4C3H J;  4E6K G;  5J1Y A;  2X6W A;  4PDK A;  3GTO J;  5GAD J;  3QYE A;  1J2X A;  1WHU A;  4RM2 A;  2XKO A;  1JT6 A;  4EJT A;  2FBH A;  2MBF A;  4ESB A;  3WTW C;  3M07 A;  1AA7 A;  3DKY A;  5B1A H;  3VSL A;  2K85 A;  2K5C A;  1KU2 A;  2ME0 A;  4Y13 A;  1KQ0 A;  3A0H C;  5AIP A;  4XLN F;  1HQC A;  2KHM A;  1XGN A;  1BL0 A;  3L00 A;  4HOB A;  1SFO J;  3D0S A;  3E6C C;  3DV8 A;  4OWR B;  3DPU A;  2O3F A;  2LKS A;  2VOP A;  2OZU A;  3ZMV A;  5CVV A;  2F6C A;  5J47 A;  4KIG A;  2LG4 A;  4BAY A;  1JKR C;  4AIH A;  1FSH A;  2K9M A;  2I5U A;  4E4H A;  5L3E A;  3BTC A;  4ESJ A;  4HNV A;  2DOE A;  5A2Q Z;  3O3K A;  2ZBK A;  2ZO4 A;  3H0G J;  1ZRD A;  4E7K A;  4LK1 F;  3NWT A;  5KHD A;  3LMM A;  5M5Y J;  2RQQ A;  5E1Z B;  4ZC3 A;  3WTY C;  4BHB A;  1H88 C;  3S14 J;  4U7B A;  2YU3 A;  3OYA A;  2K7L A;  1D0Z A;  1EA3 A;  5IOZ A;  4JX4 A;  3DF8 A;  3BTJ A;  1MH3 A;  1TWA J;  1TT0 A;  3EUA A;  4C2U A;  1TT5 B;  1XX5 A;  1WGX A;  5ICE A;  3WU2 C;  2FD5 A;  3G1L A;  1ETQ A;  1UFM A;  1YS7 A;  1KU9 A;  3IKV A;  4JX6 A;  3E97 A;  4ZH4 F;  1HKT A;  3W2W A;  3ZQG A;  4RGR A;  5EJC A;  1R36 A;  1LQ1 A;  2IA1 A;  3A01 A;  2VPR A;  3HOY J;  1I39 A;  2IA2 A;  1S6L A;  3IKT A;  2FOW A;  2GBY A;  2VB6 A;  2PG4 A;  4EQQ A;  4PGH A;  2QVO A;  4PSX A;  3OYB A;  3VOE A;  2L02 A;  2VL8 A;  3DWL E;  2EZI A;  3BG9 A;  3F8B A;  3GFI A;  4ENJ A;  2YX7 A;  4RBO A;  4MEY F;  4DYC A;  4YRV A;  1R22 A;  5KAI C;  1RUN A;  1XGS A;  1CF7 B;  4CXF A;  2NVQ J;  5CYV A;  1U9O A;  5E20 A;  1BBY A;  4BUP A;  3TO7 A;  1JXS A;  4I98 B;  4A3L J;  2LNB A;  4HEA 2;  2C6Y A;  1S7A A;  2ESH A;  2MG4 A;  4A3G J;  2DPD A;  3TQN A;  5L3B A;  3V8L A;  3HBL A;  1MIJ A;  2J5O A;  4F92 B;  2LVS A;  4PZJ A;  2M30 A;  2NVY J;  5IPA A;  4UVB A;  5DCM A;  2UZK A;  2LKP A;  1NTC A;  3GBG A;  4Y17 A;  1TBX A;  4XID A;  3L2U A;  4D7N A;  4EM2 A;  2ZXH A;  2VOO A;  5GP9 A;  3ABT A;  3KZY A;  1ETK A;  2DXI A;  4RGX A;  3F6O A;  4FT8 A;  4N4N B;  3ZN1 A;  1I50 J;  2LRD A;  4KUM A;  4Y33 A;  4M9Z A;  5FFX A;  2EA2 A;  2DT6 A;  4BY1 J;  1J75 A;  1HST A;  2FE3 A;  1BW5 A;  3LFU A;  4M74 A;  4IQ4 A;  5DD8 A;  3JSO A;  3HIF A;  2BY3 A;  2XPV A;  2HVS A;  3FXM A;  1T56 A;  2XHK A;  5K7H A;  2H6B A;  2FSW A;  1SFK A;  5LHG A;  2DDA A;  1V54 H;  3BOQ A;  4QIW N;  4XRS G;  2DA1 A;  2LKX A;  4DBR A;  2KLO A;  1G8X A;  2X1C A;  3ECH A;  3OYN A;  1APL C;  1DDN A;  1MMA A;  2E35 A;  2A5Y B;  4HV5 A;  1YYV A;  2EPF A;  2JN6 A;  5DD4 A;  2RV8 A;  3VDX A;  2R7F A;  3NAR A;  4I09 A;  1BC8 C;  1UMQ A;  2YSR A;  4FQG A;  1B8I A;  2QBY B;  5EYR A;  3ZP5 A;  1O3S A;  1ACI A;  1G3S A;  1QZE A;  2HDW A;  5GAE J;  2L5Q A;  5HLG A;  1YO5 C;  3K1M A;  2BVM A;  4XRM A;  2ZJP F;  1WRJ A;  2VOD A;  3LSG A;  1UG0 A;  3TDU C;  2UV1 A;  5FB2 A;  3FXK A;  2F5V A;  2R7T A;  4B3A A;  1PP8 F;  1XGM A;  1U5T A;  1T98 A;  2O61 A;  1W7P D;  2NVU B;  2VQC A;  1X1A A;  2FNP A;  3OWT A;  3WGG A;  3FK7 A;  1I1G A;  4CCM A;  4EVI A;  1FEX A;  4C2T A;  1OR7 C;  5A2Q K;  2M8G X;  5GPC A;  3HOU J;  1FSE A;  4RAF A;  3V7R A;  1IDY A;  1USS A;  3V4G A;  2LY2 A;  1VQL I;  4MFE A;  4BY7 J;  2AXT C;  3CCY A;  4NC6 A;  3PNV A;  1B9M A;  2XGD A;  2R5Y B;  4A5M A;  1AKH B;  3S16 J;  1JUP A;  3ONQ A;  2FMY A;  2EV6 A;  1QO0 D;  1WCM J;  5EZH A;  4ASN A;  2PJP A;  1WQ2 A;  4G8X A;  1S3J A;  2X6Y A;  4UVC A;  1XC5 A;  3N97 A;  2E5Z A;  3RPU D;  1ODD A;  4MIM A;  2FUG 2;  4AUX A;  3FXL A;  2DI3 A;  1BA5 A;  4A69 C;  1J7K A;  3L9F A;  2DMN A;  2I10 A;  2KZG A;  3KP7 A;  3KP5 A;  2DOD A;  5D8L B;  2WB1 A;  3H9G A;  3JTH A;  2JSP A;  2CW7 A;  3RZD J;  1UHS A;  4BL0 B;  2BW3 A;  4RB3 C;  3OYJ A;  2OD5 A;  5F0H A;  4HQM A;  3U1K A;  3GW2 A;  2GAU A;  3H35 A;  1IW7 F;  2HDC A;  4CH7 A;  4KIT B;  2DA5 A;  1PYV A;  4H0E A;  4F91 B;  3PQJ A;  2IBD A;  3DEW A;  1N75 A;  3HPG A;  1LKX A;  1FBS A;  4RB1 A;  4A5N A;  2IGK A;  1K6O A;  1S7O A;  3U9G A;  2QYO A;  1OCT C;  3P7N A;  2QWW A;  2QEN A;  1FLI A;  4MO7 A;  2DQR A;  3EUK L;  1G2H A;  3AG3 H;  3G2B A;  4KIB A;  4BQO A;  3CME I;  1B59 A;  3JW4 A;  2L3D A;  5ILU A;  2IS4 A;  1YQA A;  4RAZ A;  3IH2 A;  3JAM K;  5ILV A;  4EM0 B;  1WSU A;  4MHG A;  3RSN A;  2OQR A;  4DIQ A;  1JHH A;  2OQG A;  4IXA A;  5BQT A;  1XDU A;  2LY1 A;  4HBL A;  4PUS A;  3JRF A;  4E7I A;  4GYI A;  2COM A;  1LNW A;  3FIS A;  4LLG F;  3W3C A;  1SFU A;  1FIA A;  1RRJ A;  2D5V A;  4NHJ A;  1MBH A;  3CUO A;  4PSW A;  4BQQ A;  2FNA A;  3KYD B;  1F5T A;  1KYW A;  4Q5S F;  1VQO I;  4UB6 C;  1SD6 A;  2X51 A;  4W1U A;  4D7M A;  1P4A A;  3ZQH A;  2MC4 A;  2OCC H;  2CQX A;  3DLL F;  3MFK A;  3K4L A;  4ZJZ A;  1ZQ3 P;  2OTJ I;  3GFM A;  2O6G E;  2GA2 A;  2PLY A;  3QRF F;  1IRF A;  3KP6 A;  4I2O A;  1POG A;  1YS6 A;  1FJL A;  3FKJ A;  3GTL J;  2P0W A;  5J6X A;  4KFC A;  4AM3 A;  3TW6 A;  5EF6 A;  2YS9 A;  4EGY A;  2HFH A;  3WTT C;  4D5C A;  2K86 A;  5FRN A;  4XQF A;  4P9F A;  2DOF A;  5L3F A;  2CW0 F;  1Z7L A;  2Z3Y A;  4EGZ A;  4G7H F;  2LF8 A;  3ZMT A;  2NNY A;  1ZG3 A;  1R4N B;  2CFX A;  3FHZ A;  2OC6 A;  1BR2 A;  1F36 A;  3DPT A;  1OR7 A;  2WA0 A;  3IV5 A;  2VXZ A;  5M5W J;  2A3S A;  4L5E A;  3NRV A;  1UCR A;  1FOW A;  1TC3 C;  2L9S A;  3L2V A;  4XSX F;  4V19 K;  2HYF A;  1X3U A;  2L7F P;  3Q0W A;  3OYE A;  2PI0 A;  3DKX A;  1VQK I;  2DU9 A;  5E3N A;  4P1W A;  1X19 A;  2LH9 A;  4WXH A;  5B3S H;  1BR4 A;  2CQ7 A;  1Y56 A;  3HOZ J;  1S7E A;  4HF0 A;  1LPQ A;  3FXJ A;  3S15 J;  1IRX A;  1GHC A;  3H3U A;  2VI6 A;  2Y0S N;  3BQZ A;  2Z16 A;  1A04 A;  4CCJ A;  2R4G A;  3PO3 J;  2BEO A;  3G1O A;  2XAG A;  3KLO A;  4HPQ A;  3RPQ A;  4MLO A;  1MMN A;  4XOR A;  5F6F A;  1VI0 A;  4EJU A;  2E2I J;  1D8K A;  5IT9 Z;  1XSV A;  3LQQ A;  4HST A;  4G12 A;  1SAU A;  1OYW A;  1J59 A;  3B73 A;  2QKM B;  1MZB A;  5AON A;  2EJR A;  1TW2 A;  3GLL A;  4H4K C;  1ZRE A;  4W97 A;  3KP3 A;  5CLS A;  4MFD A;  2W7N A;  3IWF A;  2Y9Z A;  3QU6 A;  3IAS 2;  2D45 A;  2DPU A;  2HQ5 A;  2IS2 A;  1ON2 A;  4BXU A;  2F5E A;  2H1L A;  2WAD A;  4YG2 F;  1RKW A;  2CMP A;  2NOJ B;  2QQB A;  4ENM A;  2LK2 A;  1Y6I A;  2BXY A;  3FMS A;  2D1V A;  1Z3Y A;  2XRL A;  3OYM A;  1HBX G;  1AHD P;  5CVJ A;  1K83 J;  2GIZ A;  2R7W A;  3UKG A;  2XAU A;  3BZ6 A;  3HG9 A;  1G3T A;  1RC9 A;  5FRO A;  2VT2 A;  4RLQ A;  3GZ5 A;  5BNG A;  1SFE A;  3F0C A;  4ANJ A;  2EB7 A;  3IWZ A;  2A61 A;  2LOO A;  1W5C C;  1FC3 A;  3A1Y A;  3BJA A;  4B43 A;  4FHT A;  4DQ2 A;  4DNC A;  4QLC U;  3W2A A;  2XGE A;  3F8F A;  3MWM A;  3W6K B;  2B0L A;  4ZYE A;  3WOD F;  4HLX A;  1TTY A;  1QBJ A;  1TQI A;  2WBM A;  4HX7 A;  3RQ4 A;  2B9S A;  1QZY A;  2EWN A;  1FWZ A;  4ENN A;  4M3B A;  2W57 A;  1MKM A;  5IP9 J;  3C3W A;  2DCE A;  2DAO A;  2IA0 A;  2WY8 Q;  3OYF A;  3GTG J;  2W24 A;  4I0B A;  5FLV A;  2CQN A;  3NQO A;  3EET A;  1SAX A;  1IGN A;  4AYB A;  2CV1 A;  2NS8 A;  3LAJ A;  3REO A;  1Z7U A;  5ICC A;  1X4O A;  1H89 C;  3AL0 C;  2K9Q A;  3MZY A;  4BHC A;  2LBF A;  2W48 A;  2JPB A;  5LLQ A;  2XVC A;  3A01 B;  2HXO A;  4LLN A;  2ESN A;  2HYG D;  1IRG A;  1T8I A;  4EJV A;  5H6Q A;  2V4J C;  3ZRG A;  4U0W A;  4XKV A;  1X3W B;  2OA4 A;  3FMQ A;  3F21 A;  3GUD A;  2EK5 A;  1H8A C;  1FP2 A;  3RKQ A;  2NOG A;  2KZV A;  5JVT A;  2Y75 A;  3CCU I;  2XB5 A;  3IC7 A;  1LE8 A;  5LGT A;  1ETY A;  3AG4 H;  1Y39 A;  4OAY A;  2FJ1 A;  4RAG A;  2B63 J;  1K4S A;  1LB2 A;  4WXD A;  2UXX A;  2VKD A;  4EEF G;  4NC8 A;  2PBI A;  5DCF A;  2F2E A;  3UNG C;  3OOP A;  2DMQ A;  2E7W A;  2MW8 A;  3C18 A;  2E19 A;  3IHU A;  1WKM A;  4A93 J;  2HPI A;  1Z9C A;  4B48 A;  3F72 A;  3MAJ A;  1H9G A;  3QU3 A;  1MDM A;  1MD0 A;  2R7Z J;  3SHF A;  2XF6 A;  4QPO A;  1TWF J;  4BAC A;  2N8G A;  5CKT A;  1RPW A;  4DGW B;  1BI3 A;  1A6I A;  3U1D A;  3SQN A;  4XKC A;  1ZK8 A;  5HOD A;  2ZXJ A;  1ORK A;  5DM7 F;  4BE2 A;  2LY9 A;  4IRG A;  3HRM A;  5FKK A;  2JA2 A;  1WJE A;  4CCN A;  1WI3 A;  2JTV A;  4NDL A;  1UST A;  2ME6 A;  2PJR A;  1T0F A;  2L9V A;  2ZXI A;  1T33 A;  5J1U A;  1XPX A;  5BPI A;  3CDH A;  2KP6 A;  3GWZ A;  2HDD A;  2CQK A;  4EM1 A;  4HW0 A;  3J7A Y;  3CMM A;  3QP6 A;  1VQP I;  1Z6R A;  1LDD A;  1W0U A;  3IRR A;  1R1T A;  4JYK A;  4R1H A;  4OU0 A;  4XK4 A;  5FD6 A;  2F4M B;  4A6E A;  4P9U A;  1KU7 A;  5F08 A;  3WU0 A;  2EH3 A;  3J80 Z;  4XLH A;  1NG6 A;  2H27 A;  3OIP A;  1YW8 A;  4LGW A;  5IT9 K;  5K1Y A;  1QHG A;  3CTA A;  3DU5 A;  4G7Z F;  1MJB A;  1JJ8 C;  4S05 A;  5GTI C;  3VOD A;  1S72 I;  3QYF A;  2A6E F;  4GCV A;  3WGH A;  1LE8 B;  5ILS A;  3LA3 A;  4EAT A;  4NC7 A;  3HDD A;  4C2M J;  2M7A A;  2QF7 A;  4IHW A;  4FAS D;  1FTZ A;  2EZK A;  1F9N A;  4XKW A;  3LOC A;  1ZN2 A;  5FKL A;  3WTS C;  2M45 A;  4RMN A;  3BC8 A;  1MSE C;  1W0T A;  4XOT A;  2QZ8 A;  2MAB A;  2X6X A;  4ESF A;  5E1X A;  2NYX A;  1HKQ A;  2I8D A;  4PJN A;  2HS5 A;  2KIF A;  5LD2 C;  5EGO A;  1XTA A;  4AWX B;  3HSE A;  3CZ6 A;  1YG2 A;  1BN5 A;  3KLN A;  1T39 A;  4MEX F;  1AWC A;  1FZP B;  1X3Z B;  4KDP A;  3FBI B;  2FBK A;  2JVG A;  3ERM A;  1FBQ A;  5JLX A;  1QA6 A;  1IN7 A;  4LIT A;  2DJI A;  1TP4 A;  1RZ4 A;  1SD7 A;  3ZCO A;  1YIO A;  3ZMU A;  3BJ6 A;  2IVM A;  2OPT A;  3EUH C;  5KNL A;  1SFX A;  2HQR A;  3MZH A;  5IYD J;  1FTT A;  3HPH A;  1OCC H;  4F7Z A;  2DTR A;  2VJ5 A;  4K2E A;  4A6D A;  4HLY A;  1WFX A;  1X2M A;  4CCO A;  3CCS I;  1VQ5 I;  1XD7 A;  2O8K A;  4LG0 A;  1P6R A;  2DYS H;  3SYT A;  1NK3 P;  2E71 A;  1ONV A;  3F23 A;  3OL4 A;  2XIG A;  1SVL A;  1UB9 A;  3J81 Z;  3GZN B;  3RIR A;  2ZCW A;  4RGS A;  1JTX A;  1W5T A;  5F04 A;  4YIR X;  3HOW J;  3WHB A;  2L7K A;  1VND A;  4HG2 A;  4ZYD A;  5BMZ A;  2CUF A;  3TO9 A;  3ULQ B;  1OLT A;  3ASO H;  2JUC A;  3ROU A;  4IPA A;  3G1M A;  3I4N J;  3L7W A;  2M8E A;  3B02 A;  2GXB A;  2OBP A;  1Z67 A;  2BW3 B;  2E36 A;  3S3M A;  3UR3 C;  1BC7 C;  4CYD A;  1T2K A;  1WVR A;  3J7Z I;  5FLX Z;  3K1N A;  1IZ1 A;  1LDK B;  2LLK A;  4LJZ F;  4XNF A;  3VWB A;  2JMW A;  1ULY A;  2Q8K A;  3CP2 A;  4KIF A;  3I71 A;  4WXC A;  3KP2 A;  1DP7 P;  2FQ4 A;  4A3K J;  4HX4 A;  3N05 A;  3IH3 A;  1ZG1 A;  1Z1D A;  5LHI A;  4Z6Y A;  2XF7 A;  2P6S A;  2IT0 A;  1Y1V J;  4BEH B;  4Z2Y A;  3A0B C;  2KL4 A;  3DTI A;  1WJA A;  4M3D A;  3KYC B;  2P5K A;  1OPC A;  2YX4 A;  3K1P A;  3OYD A;  1Z3X A;  4F52 A;  4FE4 A;  1N78 A;  4UUT A;  3T1B A;  4PCQ A;  2QLZ A;  3C1D A;  4TV7 A;  3AAF A;  2CW8 A;  5DV5 A;  2CFO A;  1MGT A;  1W36 D;  2DW4 A;  2DMT A;  5FKN A;  5JHF A;  1BIB A;  1BW6 A;  4AIJ A;  1OKR A;  3W6V A;  2LF7 A;  1F1Z A;  2CYY A;  1JTY A;  2Z9O A;  1O7F A;  2PJR B;  4KT5 C;  2KT0 A;  3ZR8 X;  3HKZ A;  5M3F J;  2NVT J;  3GTP J;  1FOY A;  1HW1 A;  1V5E A;  2L01 A;  5K5Q A;  5EZG A;  5BS6 A;  3CLO A;  5KAF C;  5D4R A;  5M3M J;  1B1B A;  1E3H A;  3TBI A;  3MKW B;  5J4V A;  1ETX A;  1Q1H A;  2NXN B;  1ETV A;  1DGR M;  3ELK A;  4CUG A;  3V7S A;  3OIO A;  2JZY A;  1FMV A;  1I6X A;  2OJE D;  2IS6 A;  4YEJ A;  3JTG A;  1YFH A;  2F5F A;  3WTX C;  2M4G A;  5HLT A;  4WK8 F;  4OIQ F;  5EEH A;  4O3M A;  4RB0 A;  2K9S A;  2E1N A;  4D5F A;  4XN3 A;  2M1B A;  3S2W A;  2MD5 A;  4WX9 A;  5FLM J;  3S1Q J;  3DPL C;  2L4A A;  1A6Q A;  4XL9 A;  2H8W A;  2E2J J;  2IGM A;  3L2R A;  3RJP A;  2M3A A;  3HGY A;  4BS9 A;  1PDN C;  2Z5U A;  1LVA A;  3I59 A;  3ABL H;  4L0Z B;  3KPH A;  5L3C A;  1QPM A;  3OMY A;  4C9Y A;  5JFR A;  2NVX J;  5CQG A;  3HEF A;  3H9J A;  2RQP A;  4B8X A;  5C3E J;  3K4K A;  1TQP A;  1OQY A;  1IRZ A;  5FJ8 J;  1T6S A;  3HOT A;  5FO5 A;  4G6D A;  4GYG A;  4HZF A;  3HUG A;  1XN7 A;  1K61 A;  4UUV A;  3N4M A;  1PUF A;  4PK4 A;  1HDD C;  1DPR A;  2L7M P;  4O6J A;  5ICF A;  1BIA A;  2CO5 A;  4FE7 A;  1IN4 A;  3AG1 H;  3J81 K;  2E34 A;  1B6A A;  4UVA A;  2Y69 H;  3FX3 A;  4PJL A;  5HLH A;  3OYK A;  2OAZ A;  2IXS A;  3O6B B;  5DS9 A;  3MZ8 A;  3R4K A;  2TDX A;  3ASN H;  3RCO A;  2FOK A;  2OZ6 A;  2QSF X;  2V1X A;  2FML A;  1HC8 A;  2DQL A;  3E7L A;  3KEQ A;  2STW A;  5D5V B;  1QGP A;  4LFU A;  1YW9 A;  1FNN A;  3BR5 A;  1EH7 A;  4BJ5 C;  4CA0 A;  2R7V A;  1A36 A;  1QVU A;  1MJA A;  1J0R A;  2KRF A;  1XGO A;  3F8C A;  4BU2 A;  4PJ0 C;  4N9I A;  2ICW G;  3A03 A;  1FP1 D;  1KA8 A;  4U88 A;  3JCU C;  3ZQF A;  5KVR A;  5DTD A;  2A5W A;  2B7E A;  5LEK A;  1UZC A;  3C7J A;  4M3E A;  5J40 A;  1GDT A;  2ETH A;  4HF2 A;  1P7I A;  2VON A;  3A2K A;  1LUJ B;  1WI9 A;  3HGG A;  4GFB A;  2P6T A;  2Y0M A;  1IN6 A;  5E17 F;  3K4J A;  3E6D A;  2YU9 J;  1J9I A;  4XMY A;  4DW6 A;  4F55 A;  1W36 C;  2K40 A;  1KQ8 A;  1VQ4 I;  3CUQ B;  2VKE A;  2V7F A;  4BJT A;  2MA3 A;  3DP7 A;  2AXL A;  2ZFU A;  1Z77 A;  3ABU A;  2XKP A;  1E0E A;  2L7Z A;  1LFP A;  2L9N A;  2D2W A;  4I0A A;  4F3Q A;  2BE5 F;  3LSK A;  1ZRC A;  1BOB A;  2DO7 A;  3TP3 A;  2WY7 Q;  1LFB A;  2Q1Z B;  1VQN I;  1U5T C;  3O8G A;  3HTS B;  4ZTF A;  4UY8 I;  2IRF G;  3DTE A;  2KIU A;  1YI2 I;  3F8N A;  3FDY A;  3ZXS A;  3TMO A;  3LL7 A;  3PO2 J;  5B1B H;  1YRN B;  4Q4Z F;  1XG1 A;  3OYI A;  4A0Z A;  4HDV A;  1TNS A;  1RNL A;  4BBR J;  3D5L A;  2ZKZ A;  2HWV A;  4QWQ A;  5GAH J;  2HZT A;  1WZ2 A;  1VF9 A;  4GRI A;  3DQV C;  1AU7 A;  1YX5 A;  2V9K A;  1FYK A;  1FIP A;  3K7A J;  3KEO A;  3K2A A;  5IY5 H;  4KIS A;  3JAM Z;  1ZHF A;  4ZZD A;  1UAA A;  2L54 A;  4B4C A;  4A0Y A;  3HM5 A;  2M0M A;  4Y4R A;  3P9I A;  1XS9 A;  1R5I D;  3ZOB A;  5EG0 A;  5H20 A;  1H9T A;  1Z05 A;  3TW7 A;  2R7Q A;  2W00 A;  4OAZ A;  4ZYA A;  2K27 A;  3S2H J;  2UUZ A;  5ED4 A;  1TWH J;  2XAF A;  3VYU B;  3VB2 A;  2ACJ A;  3OSF A;  2M5W A;  3HHH A;  3K4N A;  3MKL A;  3SDB A;  3TGN A;  1MBJ A;  4HDU A;  5DDG A;  4O5V A;  3I0T A;  3FBN B;  4KIC A;  5E8G A;  3CCM I;  1SD5 A;  1W5S A;  3OYG A;  2KRH A;  4KT6 A;  3CC7 I;  3K4C A;  3MD2 A;  4GDF A;  1D1A A;  3DU6 A;  1B8I B;  4XBF A;  4X1E A;  1KQ9 A;  5E18 F;  2OF7 A;  3CQZ J;  5F0F A;  3PSI A;  2MSY A;  3CC2 I;  2R7U A;  5E8I A;  2ZJ2 A;  2PMZ N;  2IPQ X;  1IN8 A;  3PSF A;  1BR1 A;  4PJJ A;  1R4M B;  1AKH A;  1LEA A;  3PUB A;  3OOU A;  4IRH A;  5KCM A;  3E5X A;  3J7A O;  4RB2 C;  1SC7 A;  3T8T A;  2EQR A;  3WTZ A;  1AOY A;  3KE2 A;  4II3 A;  4E70 A;  5LGN A;  3CO7 C;  5E79 C;  2Q2E A;  1K78 A;  2E1M B;  2KRC A;  3OYL A;  5EEG A;  3NAU A;  3QYB A;  2ZC2 A;  5B5E C;  2BOL A;  2X6O A;  1R7J A;  1ZEL A;  5IP6 A;  3BZC A;  4G6Q A;  2PMU A;  1VTN C;  2M0C A;  2DK5 A;  2QUF A;  4BJ6 C;  2DMU A;  3VEP A;  1SD4 A;  4Y15 A;  2HVQ A;  3LSI A;  3EPZ A;  3SZG A;  2GQQ A;  3G3Z A;  4R79 A;  1HSJ A;  2DOA A;  4GXO A;  3WE3 A;  5F27 A;  2HGC A;  3I56 I;  5LRR A;  2ELK A;  4KN4 X;  2WAQ A;  3F6V A;  3JRC A;  3CF2 A;  3U21 A;  1BOA A;  4B44 A;  3E3V A;  2JA5 J;  2FA5 A;  3IL2 A;  3KET A;  1I6H J;  3PM1 A;  3RKX A;  4N4O B;  1ZKG A;  2PX9 A;  4FIS A;  2HOE A;  3JRH A;  2Y9Y A;  2P7C B;  1T38 A;  4L9J A;  3MVP A;  4BQA A;  4YFN F;  2LR8 A;  1J09 A;  3FK6 A;  1JHF A;  3M4O J;  2BY1 A;  3VYR B;  4IO9 F;  1GT0 C;  1A31 A;  1X1D A;  3G71 I;  3LSJ A;  3WU1 B;  1A35 A;  1GXP A;  3BT9 A;  4M72 A;  1QZZ A;  2VBZ A;  3CMY A;  3E6M A;  3IAM 2;  4M9S A;  1S29 A;  1XMK A;  2WC2 A;  3CD6 I;  3IH4 A;  3GO5 A;  3K4M A;  2DA4 A;  2RC4 A;  4FX0 A;  2R93 J;  1B4A A;  2H1K A;  4LOC A;  1W7P B;  2X1D A;  1OCO H;  5TJJ A;  2V79 A;  1ENH A;  2CQQ A;  2E5N A;  1UJ8 A;  1WJ5 A;  2ELJ A;  3CUQ A;  1OFC X;  3KX2 A;  4DOZ A;  3VSK A;  1RIO H;  2VLA A;  1OCR H;  3MN2 A;  4AYB N;  2DA3 A;  2K3P A;  1TWC J;  2VAS A;  3QOE A;  3IP4 B;  1HF0 A;  1RI7 A;  2VE9 A;  1RR8 C;  4AU7 A;  4F93 B;  3R61 A;  4UHT A;  4M6X A;  1O3Q A;  4KN7 X;  2GWR A;  3HC7 A;  1ETW A;  3HB9 A;  4ZDL A;  1YJW I;  3DKW A;  3ZQC A;  4LG0 B;  1U3E M;  3R0A A;  3ERE D;  1STZ A;  1VQ8 I;  3H0D A;  3R6S A;  2TRT A;  5CVI A;  4R8H A;  2QEX I;  2FU4 A;  3DCF A;  3O2P E;  4IHS A;  3AKZ A;  2W25 A;  3Q9S A;  2XSD C;  5HDK A;  2Y31 A;  1MBE A;  1BJZ A;  2A69 F;  1JKP C;  3ABK H;  1OCP A;  4CZZ A;  2M34 A;  2L9R A;  2KKO A;  5LGU A;  2XAH A;  2RVC A;  2X9D A;  5IYB J;  1Z0X A;  3BJO A;  2HOS A;  1K7A A;  3BR0 A;  1OCZ H;  2P5L C;  3TO6 A;  3BR6 A;  2EIJ H;  3BQY A;  5C44 J;  3K69 A;  3U2R A;  4HNU A;  3Q5F A;  2CGP A;  1JI8 A;  2XRN A;  3E5Q A;  3SDG A;  3F9K A;  4CO8 A;  4YFK F;  3TKY A;  1H0M A;  4L9N A;  3AFH A;  1C0W A;  2BXZ A;  2XGX A;  2HKX A;  3FXR A;  2X85 A;  3IUO A;  1DU6 A;  4UUS B;  4CCK A;  3I59 B;  3ZQ7 A;  3I4P A;  5HLI A;  1K6Y A;  1W7P A;  3GME A;  4LIU A;  2K9N A;  4NB5 A;  3G6E I;  1ZAR A;  3GEZ A;  2MLK A;  3M1E A;  1T95 A;  4BHP A;  2HOT A;  1QHH D;  3SZT A;  3GTJ J;  1IC8 A;  2XPW A;  2L0K A;  1X1B A;  3E5U A;  4HQE A;  1VQM I;  4CYC B;  2DFI A;  3I64 A;  3LA2 A;  5E3M A;  5K5R A;  3HUG B;  3KCC A;  1L3L A;  3A02 A;  3F22 A;  1IDZ A;  2JK3 A;  3M7G A;  4U0V A;  2XRO A;  3HRS A;  5JHU A;  2OUM A;  1JT0 A;  3BLY A;  4CDG A;  2KPM A;  4HRI A;  2M9H A;  1MNM C;  3H3V K;  4XLA A;  5FFZ A;  1V5G A;  3OYH A;  1KZH A;  2OCE A;  2F5C A;  2VN2 A;  5IT3 A;  5D8K B;  2WV0 A;  3RZO J;  4V2F A;  4XRS A;  3I4M J;  1IV6 A;  2NS7 A;  3H36 A;  3BZK A;  4RGU A;  3KEY A;  4I02 A;  3V42 A;  4MTD A;  1BI0 A;  3OS2 A;  3BR2 A;  3W2V A;  2ZSI B;  4ON0 A;  5J8C A;  4B3X A;  4E7L A;  4UV8 A;  1MMD A;  2XUB A;  4DBQ A;  4L18 B;  3LA7 A;  5FGM A;  4BNC A;  1ZRF A;  4LD5 A;  1JE8 A;  5D6F A;  1GVJ A;  1ZLJ A;  4QTR A;  3WG7 H;  4AVP A;  4IOC F;  3K9T A;  1U0J A;  2JT1 A;  3KIO A;  4NNJ A;  2P8T A;  2JA6 J;  1QPI A;  5D4S A;  4NUB A;  2HR3 A;  4KJZ A;  4ZYG A;  4CIC A;  1X1P A;  1JJ6 C;  2FF4 A;  1R5H A;  2JA7 J;  1LEB A;  5DEQ A;  4XIC A;  5DUK A;  2D1H A;  1OYI A;  2XF5 A;  5IOY A;  4HYE A;  2HEO A;  2P81 A;  4UUS A;  2DFF A;  3T5X A;  3CES A;  1RUO A;  2HZD A;  2CUE A;  4P96 A;  1NK2 P;  3HL2 A;  1DQU A;  2OU2 A;  1IJW C;  1IN5 A;  3MMY B;  5LEJ A;  1U9N A;  4I7H A;  2RGV A;  2O8X A;  2VJI A;  4RS8 A;  5D5X B;  1R23 A;  1UG2 A;  3QP5 A;  2CG4 A;  2V9V A;  3JRI A;  4MTE A;  3FF5 A;  3ZGK A;  2MH9 A;  3C2G A;  2KDZ A;  2JRT A;  4CCL A;  2M7B A;  2MYS A;  2DN0 A;  2IS1 A;  4BDY A;  2EV5 A;  1IAW A;  2EV0 A;  4XOP A;  1XSX A;  2HQA A;  1IUF A;  4ZDP A;  3JRB A;  4OMY A;  2CUZ A;  2JA8 J;  2ZME C;  1O4X A;  3HOX J;  1YIJ I;  3FKI J;  1KON A;  4IHV A;  3OIQ A;  3KZZ A;  2O9L A;  1D3Y A;  4FX4 A;  2HXI A;  1IXR C;  3WE2 A;  2FRH A;  1YLF A;  3AG2 H;  2GZW A;  2ZME A;  4HX8 A;  5D5W B;  3CF5 F;  4L5J A;  2A07 F;  4A3D J;  3BTL A;  5LHH A;  1V5F A;  1D5V A;  3SEQ A;  3Q9V A;  1P2F A;  4GO1 A;  2GIV A;  4IF4 A;  1EH8 A;  2VC0 A;  4OIN F;  3ZQQ A;  4XLC A;  1EF4 A;  4IVN A;  1UHW A;  3BTI A;  2EZL A;  3QWL A;  1E17 A;  2F5D A;  1MJ9 A;  1ON1 A;  4E7H A;  2XAJ A;  4IJA A;  1U5T B;  2JUG A;  3JRD A;  2DDB A;  1WJC A;  3KFW X;  2R7D A;  2WB1 N;  5J3L A;  3MQ0 A;  2KIQ A;  3GYH X;  4BH9 A;  2RNJ A;  4QPQ A;  2MGQ A;  2KQR A;  2QM3 A;  1XMX A;  5CVR A;  1FYL A;  3C2H A;  3RKW A;  2V6E A;  1E2X A;  1CQT A;  2K4B A;  4M3G A;  4BKX A;  4I76 A;  2VE8 A;  3H5R A;  2M2E A;  1PUE E;  1R49 A;  4E7S A;  1NH3 A;  2V9P A;  2VKH A;  2R92 J;  4RA2 A;  2EFP A;  1LFU P;  5TGT A;  3BCA A;  3BPV A;  1XCB A;  2VBX A;  3DXJ F;  1PP7 U;  2QSG X;  3WTV C;  4LB5 A;  1Z6T A;  2HTS A;  1YOV B;  2WAQ N;  2E1C A;  3S93 A;  3LFK A;  2JJ7 A;  1R71 A;  4RDU A;  4JOM A;  3PFY A;  4MNU A;  3R60 A;  1TZL A;  4XLP F;  1DP3 A;  3KZI C;  1Z21 A;  3S1M J;  1D8J A;  1VQ7 I;  4A3B J;  1ZGA A;  2F4I A;  2HNH A;  2R3S A;  3EUH A;  1D5Y A;  2LYC A;  4EJO A;  4ITV A;  2Z1D A;  4LMY A;  2DT5 A;  1U78 A;  2PN6 A;  2DA7 A;  1YW7 A;  1MSF C;  1NG7 A;  1MBF A;  3OL3 A;  2E1M C;  2QKL B;  5DYM A;  4AVZ A;  4XR6 A;  2PFB A;  2XAQ A;  1VFC A;  2R5Z A;  2AO9 A;  3DFG A;  3LSP A;  3CC4 I;  2M87 A;  2P4W A;  1A5J A;  3FM5 A;  5ERI A;  4AID A;  3CCQ I;  3QPS A;  4HF1 A;  2H6C A;  2BV6 A;  1U8R A;  4C30 A;  4XRF A;  5GPA A;  1P4X A;  5HS8 A;  2KIS A;  3JRG A;  3R0J A;  4P55 A;  2W85 A;  3M8J A;  2V1U A;  1EKE A;  2ID6 A;  3FXU A;  1IG7 A;  2H8R A;  4HSR A;  2GXA A;  2IJL A;  1G3Y A;  1MMG A;  2G9W A;  1EH6 A;  3HTU A;  1R58 A;  3I9V 2;  4M3F A;  5LBQ A;  1OYY A;  1JKQ C;  2LSO A;  5E3L A;  4CHU A;  3A4C A;  6PAX A;  2XSJ C;  3GZ6 A;  3BR3 A;  4RM3 A;  3TL4 X;  2G7U A;  5HNH A;  4IHY A;  2E2H J;  3PNT A;  1UEL B;  1O57 A;  4IL6 C;  1I1S A;  3QQA A;  3RDI A;  4XSZ F;  4NQW B;  1HA8 A;  2DYR H;  2RRE A;  1BJA A;  3JSP A;  3V8K A;  5HVQ C;  4IX7 A;  2BHZ A;  4I99 C;  2VJJ A;  2VUM J;  2JPC A;  4CZC A;  5F0C A;  3QOP A;  1Q1V A;  3G73 A;  1T0F C;  1XCV A;  2O03 A;  4M6V A;  4RLF A;  3PQK A;  2LC2 A;  1E3O C;  2KJB A;  2LDU A;  3D1N I;  3EYI A;  2EFQ A;  2QQ8 A;  3DTK A;  2ISZ A;  4GGG A;  2HQN A;  1B9N A;  5GAG J;  4KA4 A;  2VBY A;  1ITY A;  3S3O A;  2LRE A;  3HRU A;  3Q0U A;  2UXN A;  5EEA A;  3MEX A;  4PFP A;  3OR1 C;  5H6R A;  3K6G A;  1S5L C;  3ZMZ A;  2R7S A;  2VPL A;  3FXQ A;  2G7H A;  4BE0 A;  3SJM A;  3NEU A;  3SFI A;  5DCM B;  2MFZ A;  4ETS A;  2EIL H;  5TIS C;  1SMY F;  1ZAO A;  2P5V A;  2Y2Z A;  4XN0 A;  3H1C A;  4BEH A;  2E60 A;  1YJ9 I;  3CUQ C;  4II2 A;  2EFN A;  5CJ9 A;  5F64 A;  3PIO F;  5GTH C;  3OS0 A;  3S3N A;  1JKO C;  1IUY A;  4A3I J;  3M1C A;  1KGS A; 
#chains in the Genus database with same CATH homology
 1HLV A;  5K7F A;  5BNG A;  3F0C A;  3JRE A;  1RKT A;  1B72 B;  1AKH A;  4J19 A;  5C4X J;  1ZR4 A;  3OOU A;  3S2D J;  2XGE A;  1WPK A;  4IEJ A;  2TCT A;  2HI3 A;  2EQR A;  4ABZ A;  1P7J A;  4Y52 J;  5J1R A;  4M3B A;  5IP9 J;  4A3M J;  1DU0 A;  3GTG J;  1WH5 A;  3NAU A;  5FLV A;  5C4J J;  2X6O A;  2R0Q C;  5IP6 A;  2DA6 A;  3B6C A;  1IGN A;  4A3E J;  2NS8 A;  2EZH A;  3Q0V A;  3GTK J;  4B1R A;  1H89 C;  2K9Q A;  2M0C A;  2W48 A;  2E1O A;  2DMU A;  4C3H J;  3A01 B;  2HXO A;  5J1Y A;  3GTO J;  1R9T J;  5F27 A;  2GLO A;  1TWG J;  1JT6 A;  2ELK A;  1JUS A;  3JRC A;  1JGG A;  2JA5 J;  4DYQ A;  1I6H J;  1H8A C;  4AC0 A;  3PM1 A;  1ZKG A;  2ME0 A;  4FIS A;  3JRH A;  1F43 A;  2Y9Y A;  3RKQ A;  2NOG A;  3MVP A;  1PUF B;  1BL0 A;  2LR8 A;  3M4O J;  3FK6 A;  2XB5 A;  1SFO J;  1LE8 A;  1GT0 C;  4Y7N J;  1ETY A;  2CU7 A;  1RET A;  3JR9 A;  4DZJ A;  2FJ1 A;  3LSJ A;  2B63 J;  3BT9 A;  1JKR C;  3CMY A;  4EEF G;  3BTC A;  2G0E A;  4HNV A;  2DMQ A;  2MW8 A;  3IH4 A;  3GTM J;  2E19 A;  4A93 J;  3H0G J;  2DA4 A;  3VPR A;  2R93 J;  2R7Z J;  2H1K A;  4LOC A;  1TWF J;  2N8G A;  1ENH A;  2CQQ A;  5M5Y J;  1RPW A;  1A6I A;  1H88 C;  3S14 J;  1OFC X;  4CYC A;  1ZK8 A;  5HOD A;  1ORK A;  3MN2 A;  4AYB N;  5IOZ A;  2DA3 A;  4JX4 A;  1TWC J;  2LY9 A;  3CDL A;  5FKK A;  3BTJ A;  1MH3 A;  1TWA J;  1HF0 A;  1WI3 A;  1WGX A;  4NDL A;  2ME6 A;  2R5Y A;  2FD5 A;  1T33 A;  3G1L A;  5J1U A;  1ETQ A;  1ETW A;  3HB9 A;  4JX6 A;  3ZQC A;  3ZQG A;  2HDD A;  1JUM A;  2TRT A;  5IYC J;  3A01 A;  2VPR A;  3HOY J;  4A3J J;  3DCF A;  1W0U A;  4JYK A;  4XK4 A;  2XSD C;  2GBY A;  3HKZ N;  5F08 A;  2Y31 A;  2EH3 A;  2YUS A;  1MBE A;  1BJZ A;  1JKP C;  2ECB A;  2EZI A;  3BG9 A;  3WHC A;  4RBO A;  4DYC A;  1JJ8 C;  1OCP A;  2M34 A;  2L9R A;  2LTP A;  2X9D A;  1LE8 B;  1U9O A;  1MBG A;  1Z0X A;  5IYB J;  2NVQ J;  2HOS A;  5IP7 J;  3HDD A;  2IEK A;  4A3L J;  3BR0 A;  4C2M J;  3TP0 A;  2MG4 A;  4A3G J;  4IHW A;  2QF7 A;  1FTZ A;  4BBS J;  3BR6 A;  3BQY A;  5C44 J;  2EZK A;  3HBL A;  2XGC A;  3LOC A;  2LVS A;  5FKL A;  3SDG A;  4QSH A;  2NVY J;  1MSE C;  5IPA A;  3B6A A;  1W0T A;  1DU6 A;  4UUS B;  3GBG A;  1NTC A;  4XID A;  1MH4 A;  5EGO A;  2K9N A;  4D7N A;  2DA2 A;  5GP9 A;  2HOT A;  1ETK A;  2WV1 A;  3GTJ J;  1IC8 A;  2XPW A;  2L0K A;  5EDN A;  2JWT A;  3BR1 A;  2XPU A;  1I50 J;  5JLX A;  2HYJ A;  4CYC B;  1X58 A;  3M3Y J;  5E3M A;  4BY1 J;  1OJL A;  1IDZ A;  3A02 A;  4X6A J;  2OPT A;  2JK3 A;  1BW5 A;  3RQI A;  5IYD J;  1FTT A;  1JT0 A;  9ANT A;  2M9H A;  1MNM C;  3H3V K;  2XPV A;  3ZQL A;  1T56 A;  1X2M A;  5K7H A;  2O8K A;  2ID3 A;  3RZO J;  1NK3 P;  3OSG A;  4V2F A;  4QIW N;  4XRS A;  1IV6 A;  3I4M J;  4XRS G;  2NS7 A;  1SAN A;  2DA1 A;  2LKX A;  4A3F J;  1JTX A;  5F04 A;  3HOW J;  1APL C;  3BR2 A;  3WHB A;  1VND A;  5K7Z A;  2CUF A;  2JN6 A;  4S0H B;  3I4N J;  3G1M A;  3NAR A;  5JLW A;  2X48 A;  1UMQ A;  1B8I A;  5EYR A;  5FKM A;  4QTR A;  2LLK A;  1MBK A;  2JMW A;  4XRM A;  3FIW A;  1RES A;  2JA6 J;  2FQ4 A;  3LSG A;  4A3K J;  1QPI A;  3IH3 A;  3ZQI A;  1Y1W J;  1JJ6 C;  4B3A A;  3JRA A;  1Y1V J;  4FCY A;  2JA7 J;  4XIC A;  4M3D A;  1HCR A;  5IOY A;  4FE4 A;  2P81 A;  4UUT A;  4UUS A;  2CUE A;  1NK2 P;  1IJW C;  3FK7 A;  1FEX A;  2M8G X;  1U9N A;  5GPC A;  3HOU J;  2DMT A;  5FKN A;  1IDY A;  2O7O A;  1BW6 A;  1UG2 A;  3W6V A;  3JRI A;  4MFE A;  1JTY A;  4BY7 J;  3CCY A;  2KT0 A;  4V2G A;  2IAI A;  2DTZ A;  2XGD A;  2R5Y B;  5M3F J;  2NVT J;  2KDZ A;  1AKH B;  3GTP J;  1JUP A;  2DMP A;  2DN0 A;  3L1P A;  3S16 J;  1RR7 A;  5EZG A;  5M3M J;  2DJN A;  1IUF A;  3JRB A;  1GUU A;  1WCM J;  1ETX A;  5EZH A;  2LD5 A;  3LNQ A;  2JA8 J;  1O4X A;  3HOX J;  1ETV A;  2EBI A;  3FKI J;  1XC5 A;  3OIO A;  3C2B A;  4IHV A;  4MIM A;  2O9L A;  4AUX A;  1GVD A;  1HOM A;  5E3O A;  2HXI A;  4DYR A;  2AHQ A;  4C3I J;  2K9S A;  4D5F A;  4A3D J;  5FLM J;  3Q3S A;  4A69 C;  3BTL A;  1BA5 A;  3S1Q J;  2DMN A;  2I10 A;  4C3J J;  3RZD J;  2E2J J;  1UHS A;  3HGY A;  5F0H A;  1B72 A;  1EF4 A;  3BTI A;  2EZL A;  1ETO A;  2DA5 A;  2NVX J;  3JRD A;  3HEF A;  2IBD A;  3DEW A;  5C3E J;  2WB1 N;  5J3L A;  1X2N A;  2MGQ A;  1IRZ A;  1OCT C;  5FJ8 J;  2ECC A;  4MO7 A;  1K61 A;  1G2H A;  1PUF A;  1CQT A;  4M3G A;  4BKX A;  3O8H A;  1HDD C;  4I76 A;  2L7M P;  2M2E A;  3IH2 A;  4FE7 A;  2R92 J;  1LFU P;  4I6Z A;  2WAQ N;  3JRF A;  2JJ7 A;  1QRY A;  4RDU A;  2RAE A;  3FIS A;  5DS9 A;  1FIA A;  2D5V A;  1MBH A;  1U8B A;  3S1M J;  4A3B J;  2FX0 A;  3E7L A;  3S1N J;  1D5Y A;  3BR5 A;  1U78 A;  1QVU A;  4W1U A;  4D7M A;  4JX5 A;  2DA7 A;  3ZQH A;  2CQX A;  1MSF C;  1QVT A;  1ZQ3 P;  1MBF A;  2R5Z B;  3A03 A;  3ZQF A;  5DTD A;  1POG A;  1FJL A;  2Y30 A;  5EG0 B;  1VFC A;  3GTL J;  2R5Z A;  2LFB A;  2AO9 A;  4M3E A;  3LSP A;  3TW6 A;  5EF6 A;  1GDT A;  1A5J A;  2YS9 A;  3QPS A;  1P7I A;  5M5X J;  4D5C A;  2XB0 X;  5FKO A;  3HGG A;  5GPA A;  1I3Q J;  4GFB A;  3HOV J;  3JRG A;  2YU9 J;  4FTH A;  3TED A;  4DW6 A;  2ID6 A;  2K40 A;  1IG7 A;  2H8R A;  2VKE A;  1F36 A;  3IV5 A;  1Z77 A;  5M5W J;  3BG3 A;  4L5E A;  4M3F A;  2L7Z A;  1TC3 C;  1WH7 A;  5E3L A;  2ZB9 A;  1JKQ C;  3S17 J;  3TP3 A;  2CRG A;  3BR3 A;  1LFB A;  4DZP A;  3LSR A;  2L7F P;  4IHY A;  3Q0W A;  3O8G A;  2E2H J;  5E3N A;  2GM4 A;  3PO2 J;  3QQA A;  1YRN B;  4JP0 A;  3HOZ J;  1S7E A;  1XG1 A;  1ZGW A;  4BBR J;  3S15 J;  1YRN A;  1ZTR A;  2VI6 A;  1VF9 A;  2Y0S N;  3BQZ A;  2VUM J;  1AU7 A;  5F0C A;  1Q1V A;  3PO3 J;  3G1O A;  1FIP A;  4IHX A;  3K7A J;  4M6V A;  3K2A A;  2VKV A;  3BG5 A;  4MLO A;  5EGO B;  1E3O C;  3D1N I;  4B4C A;  3S1R J;  1VI0 A;  2HOA A;  3HM5 A;  3GTQ J;  1XS9 A;  2E2I J;  3ZOB A;  5EG0 A;  3TW7 A;  1GV5 A;  4G12 A;  2CJJ A;  2COB A;  3S2H J;  1TWH J;  1ITY A;  3OSF A;  3MKL A;  1MBJ A;  4W97 A;  4A3C J;  3Q0U A;  2LP0 A;  4MFD A;  3QPL A;  5EEA A;  2Y9Z A;  1GV2 A;  2QCO A;  2HQ5 A;  5F1J A;  1ZR2 A;  4BXX J;  3SJM A;  1RKW A;  3SFI A;  2LK2 A;  2XRL A;  2Y2Z A;  1AHD P;  1B8I B;  1K83 J;  4X1E A;  1JKO C;  3UKG A;  2OF7 A;  3CQZ J;  5F0F A;  1HDP A;  2MSY A;  4A3I J;  2PMZ N; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...