2JA8J

Cpd lesion containing rna polymerase ii elongation complex d
Total Genus 12
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
12
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Cpd Damage Recognition by Transcribing RNA Polymerase II.
pubmed doi rcsb
total genus 12
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2006-11-23

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2ja8J00
2DA7A 5EZGA 2H1KA 4D5FA 2HOTA 1ETVA 1PUFA 1ZK8A 3ZQGA 3ZQIA 3NAUA 4DYCA 1POGA 5IYBJ 1B72B 1GUUA 3FIWA 3RKQA 4EEFG 2X9DA 2O7OA 3FK7A 2NVYJ 1ZKGA 2LFBA 3BR1A 5DTDA 2M2EA 1HDDC 1HLVA 3LSJA 2VKVA 2IEKA 3O8HA 1IGNA 1F43A 1TWCJ 1OJLA 4B4CA 1T33A 1WI3A 1LFUP 2R5YA 3JR9A 2ME6A 2O9LA 4X6AJ 3FISA 3QPSA 3HOXJ 5EYRA 2JA8J 2HOAA 3BR5A 1K61A 4A3CJ 1QVUA 4B1RA 5E3LA 2M8GX 1VI0A 1P7IA 4M3EA 2K9NA 2DA2A 3TP3A 3H3VK 2D5VA 1W0TA 3SFIA 3S1QJ 3M3YJ 1I6HJ 3O8GA 3IV5A 1T56A 5F27A 2JWTA 4NDLA 1IV6A 3TP0A 1UG2A 2QCOA 1H89C 2DA1A 3HDDA 5IP6A 1NK2P 3PM1A 1SANA 3S17J 1JTXA 4UUTA 4QSHA 2M0CA 2XGCA 4MO7A 4A3JJ 2L7FP 2E2IJ 4M3GA 3LNQA 5EEAA 3LSPA 2LLKA 1S7EA 3BTJA 2O8KA 3S1RJ 1P7JA 4X1EA 3GTKJ 2LTPA 2L9RA 1JKRC 1WGXA 3OIOA 2GLOA 5BNGA 5E3MA 2DMTA 4I76A 3SJMA 4V2FA 4FE4A 2ECCA 5IP7J 4I6ZA 1ZQ3P 1HCRA 2EBIA 4BBRJ 2Y31A 3BTLA 5IYCJ 1JGGA 1AU7A 2NVXJ 2M34A 3BR0A 1B8IA 2ID3A 4G12A 1MH3A 2NS7A 3Q0VA 2XB5A 1APLC 1ZGWA 5GPCA 3B6CA 5J1UA 2K9SA 2R93J 1GV5A 2NOGA 1XC5A 2N8GA 1JKPC 2WB1N 2ECBA 4DZJA 4FCYA 5J1YA 1IRZA 3BQZA 4CYCA 5IYDJ 3A01A 3IH4A 1ETXA 5J3LA 1VF9A 2CU7A 4M3DA 3BTIA 3LSRA 1VFCA 2NVTJ 1XS9A 2HOSA 3M4OJ 2Y2ZA 3TW7A 1H88C 4W1UA 3JRAA 5DS9A 2R5ZA 1DU6A 1ETQA 3S14J 1BA5A 4MIMA 5IOZA 5F0HA 3JRFA 2GM4A 4QIWN 5C44J 1D5YA 2X48A 5J1RA 2EZKA 4BY7J 3A03A 2DMPA 1WH7A 1CQTA 5M5WJ 4S0HB 4CYCB 3BTCA 5E3NA 3SDGA 1EF4A 3GBGA 1Y1WJ 2JA6J 4IHXA 1ETOA 3C2BA 1F36A 4M3BA 3OOUA 4Y52J 3NARA 4IHYA 2ELKA 2CRGA 2IAIA 1MBEA 5C3EJ 3UKGA 2B63J 4C3HJ 2R5ZB 2EZHA 3ZQFA 1WPKA 3IH2A 2VUMJ 3BT9A 2DA5A 3WHCA 5IPAA 4JX5A 2MGQA 1X2MA 4FE7A 5JLXA 2VI6A 1MSFC 4IEJA 4A3FJ 5FKLA 5FJ8J 2E2JJ 1TC3C 1PUFB 3ZQHA 5F08A 3JRIA 2HI3A 1E3OC 4D7MA 4A3LJ 3MVPA 1RKWA 3JREA 3PO2J 1MBJA 3S1NJ 1GVDA 2DA6A 3RZDJ 3CQZJ 3HOYJ 3BR6A 3GTLJ 2XB0X 3JRCA 4C3IJ 5FKNA 4A3MJ 2XPVA 1GT0C 2I10A 3MKLA 1IDZA 2R5YB 1Y1VJ 1ORKA 1HOMA 2EQRA 5GPAA 5E3OA 2P81A 4B3AA 3JRGA 3I4MJ 2E19A 3OSFA 3TEDA 2NS8A 3ZOBA 4UUSA 3K7AJ 4AUXA 3JRDA 1JUSA 3CMYA 3PO3J 4FISA 2JA7J 2OF7A 3DCFA 2JK3A 5FKMA 4J19A 2NVQJ 2CUEA 5EG0A 3S2HJ 2TRTA 4C2MJ 3IH3A 1RETA 2E1OA 3ZQCA 1RKTA 2DMNA 1U8BA 1A5JA 1FTZA 2DJNA 2HQ5A 1QVTA 2XSDC 4A93J 2KT0A 2FJ1A 3OSGA 2E2HJ 1OCPA 1AKHA 1OCTC 2FD5A 4A69C 3ZQLA 1MBHA 1X2NA 2R92J 3GTGJ 2YS9A 1HDPA 3HOVJ 3Q0WA 3TW6A 5EGOA 1JJ6C 1YRNA 1A6IA 3S16J 3CDLA 1Z0XA 1JKOC 2HDDA 4ABZA 2IBDA 1IUFA 9ANTA 4BBSJ 5C4JJ 4XRMA 4C3JJ 3H0GJ 2R0QC 2DMUA 3DEWA 5K7HA 1Q1VA 2XPWA 1U9OA 4AYBN 4W97A 1ZR4A 1B8IB 1Z77A 2CQQA 2HYJA 1LE8A 2EZIA 2JMWA 5F04A 1FEXA 2K40A 4LOCA 2QF7A 5FLVA 1K83J 2JN6A 3BG3A 4A3KJ 5M3FJ 1YRNB 2Y9ZA 1UMQA 5F1JA 2XGEA 4XRSG 2MG4A 1WH5A 1H8AC 1FIAA 3G1LA 1TWGJ 2RAEA 3BG5A 5EF6A 1IG7A 4JX6A 3A01B 3QQAA 2JJ7A 1TWFJ 2CUFA 2Y0SN 4AC0A 2FX0A 2DN0A 1R9TJ 2AO9A 3G1MA 4XICA 1AHDP 3BG9A 4A3GJ 4BKXA 1GV2A 3BR2A 3Q3SA 1BW5A 3HOZJ 4MFDA 1IC8A 2HXOA 4XIDA 3L1PA 3LSGA 3E7LA 4L5EA 1UHSA 2COBA 4M3FA 2H8RA 3S15J 4BXXJ 3S2DJ 3GTOJ 1MBGA 1JT0A 2X6OA 2XGDA 3B6AA 2DTZA 2PMZN 2LD5A 2ZB9A 2XPUA 1ZR2A 2YU9J 5GP9A 1GDTA 2LP0A 1RESA 1MSEC 1ZTRA 1XG1A 4JX4A 1ENHA 1U9NA 2EZLA 1HF0A 1ITYA 2M9HA 2DMQA 5F0FA 1MNMC 1OFCX 2FQ4A 2Y30A 3CCYA 1FTTA 1TWAJ 2G0EA 3HB9A 4HNVA 1LFBA 3GTPJ 2L7ZA 5FKKA 2K9QA 4A3IJ 2MW8A 3W6VA 3GTQJ 1G2HA 4DW6A 4IHVA 2GBYA 2LVSA 1U78A 3K2AA 1TWHJ 1RR7A 1X58A 2Y9YA 2L0KA 3I4NJ 4QTRA 2KDZA 5K7ZA 4RBOA 2TCTA 2MSYA 1BL0A 1I3QJ 2HXIA 1I50J 3HBLA 2WAQN 4MFEA 4DYQA 4V2GA 2CQXA 1VNDA 1MBKA 1NK3P 4XRSA 4JP0A 3HEFA 4BY1J 4DZPA 4UUSB 1NTCA 4XK4A 3A02A 5K7FA 2JA5J 2VKEA 3FKIJ 3HGYA 3LOCA 4M6VA 3JRHA 3MN2A 4A3BJ 5C4XJ 2ME0A 5HODA 1RPWA 3GTMJ 3VPRA 3G1OA 4MLOA 2XRLA 5EG0B 2VPRA 2R7ZJ 1JJ8C 1ETYA 3BR3A 2DA4A 2WV1A 1IJWC 1O4XA 1FIPA 1MBFA 2L7MP 4JYKA 1SFOJ 3RQIA 1WCMJ 1BW6A 5FLMJ 4FTHA 2LR8A 3S1MJ 1JKQC 1ETKA 1JTYA 1JUMA 1MH4A 2AHQA 3HGGA 4Y7NJ 4D5CA 3Q0UA 4D7NA 1BJZA 3WHBA 5M3MJ 1QPIA 1JT6A 1W0UA 5F0CA 1AKHB 3GTJJ 2OPTA 1QRYA 2LK2A 1JUPA 5IOYA 1DU0A 3BQYA 5M5YJ 2YUSA 5EGOB 5JLWA 3HOUJ 3D1NI 1B72A 5IP9J 2LKXA 2CJJA 5M5XJ 1IDYA 4IHWA 3FK6A 1FJLA 4A3DJ 3HKZN 4RDUA 4A3EJ 2DA3A 2LY9A 3HM5A 4DYRA 3HOWJ 2EH3A 3F0CA 3QPLA 2ID6A 5EZHA 3JRBA 1ETWA 3RZOJ 4GFBA 5FKOA 5EDNA 2W48A 1LE8B
chains in the Genus database with same CATH superfamily
1YQAA 1RRJA 2OZUA 1PUFA 3PUBA 4EMSA 4BE1A 4IHTA 5TGTA 4F7ZA 2IGOA 3EQLF 5IYBJ 3FIWA 4CHUA 3QU3A 2O7OA 2NVYJ 3JTGA 3BR1A 4QLCU 5H6RA 2DT5A 3BCBA 2NAZA 5J8CA 2LNBA 2ELJA 2IEKA 4KT6A 2Y0MA 1OJLA 2XVCA 3KLNA 4B4CA 3MQ0A 4A12A 3CUQA 2LG4A 4PJ0C 2BZTA 3DTEA 3JR9A 4OMZA 1P4AA 2EA4A 1VQPI 1LNWA 2GZWA 3QPSA 5HVQC 3CUOA 3LA3A 1ONVA 4B09A 3H9JA 1ZG5A 3ERMA 4U0VA 5EEHA 4B1RA 4DGWB 4ZYGA 4AU7A 3AG2H 1VI0A 2X51A 1MNEA 1VQ8I 2DA2A 2IS6A 1IW7F 3CESA 4G6TB 4P9FA 1E17A 3CP2A 2HVSA 2HR3A 1IN5A 1T39A 3S1QJ 4BQOA 4A0XA 2PMHA 4YIRX 2ZXJA 1BOBA 3KZIC 3O8GA 2VBXA 2XDVA 1T56A 5FB2A 1IV6A 4A0YA 2QCOA 1OMIA 2Z3YA 4HF1A 3HDDA 5IP6A 4I02A 2D45A 3S17J 2XROA 4LB5A 1R4NB 3ZQ7A 1WWXA 3K4JA 3L2VA 2L7FP 2E2IJ 3LNQA 5EEAA 3BTJA 5CVRA 2HPMA 3RKYA 4E70A 2OTJI 4BU2A 4LITA 5HNFA 4I76A 3C18A 4V2FA 3R4KA 4FE4A 2L4MA 1UHWA 3HOSA 1DP7P 1JXSA 3R60A 2WAEA 3S8PA 4OIPF 3LA7A 4G94A 2Y31A 3BTLA 3EUKL 2ZSIB 2NVXJ 2ZBKA 2M7BA 3BR0A 4KDPA 4BQQA 3PIPF 3I56I 2DQRA 1B8IA 2IS2A 1WHUA 2E5NA 4RLFA 3A2KA 3WTZA 1M1EB 2NS7A 3IAM2 3G2BA 4L5IA 4F91B 1HW2A 1GV5A 5JI6A 2W57A 4L5JA 1XC5A 4HX4A 1IAWA 1U5TA 4P1WA 2ECBA 3KCCA 2CH0A 4FCYA 5J1YA 3C3WA 1IRZA 1FY7A 5IYDJ 3CJRB 2NYXA 2ZJPF 3ABKH 2ZNZA 2LKSA 3ECHA 5H2FC 1LQ1A 2MD5A 4G6DA 3OV8A 3C2HA 2XRNA 1VQNI 3WU1B 2CU7A 1SD5A 2YSRA 3IHUA 4M3DA 3LSRA 1VFCA 2AXTC 2FEZA 5HOOA 3K10A 3TW7A 3OIPA 3BY6A 3ZMUA 4DBRA 2QQ9A 4CYDA 3F6VA 2OV7A 1X1CA 4ZZLA 1RI7A 3JW4A 3BJAA 5J6XA 3JRFA 2LF8A 4MGRA 3CCSI 2GM4A 2UWMA 3ZRGA 5J1RA 3GZ6A 3HG9A 4XONA 4E7IA 3RPQA 1EKEA 3I0TA 3TL4X 5J4VA 3WTUC 1MIJA 4XL9A 4PDKA 2M4KA 1Z3XA 2DK8A 3C2BA 2A68F 3R0AA 1DGRM 4M3BA 1WJAA 3OOUA 1WJ5A 3U2RA 3HXLA 3X2QH 1YLFA 2OAZA 2CRGA 2IAIA 3UKGA 2B63J 2WA0A 3W2VA 3OS1A 3AL0C 4CO8A 3SZPA 2CSOA 1WPKA 1OLTA 3KP5A 3ZMZA 1MKMA 4JX5A 2MGQA 1MSFC 4EJVA 5FRNA 4A3FJ 3OYAA 1PUEE 2E2JJ 1TC3C 3ZQHA 5J47A 5F08A 1OR7C 4D7MA 1ZRDA 5B5EC 1BN5A 1EH6A 2OA4A 1B4AA 5K5OA 1MBJA 3H5NA 1MGTA 5GTIC 5E18F 4I7HA 5CKTA 1GVDA 3R6SA 3CQZJ 3VYUB 3V42A 3MEXA 2JPBA 2GIZA 2KISA 1R4MB 2K9LA 2VXZA 5FKNA 3M9AA 4XLNF 1ZG1A 4BH9A 1GT0C 4C2TA 2HQNA 4CICA 1FPQA 4BHPA 3PNVA 2Q8KA 3LQQA 4NQWA 2E1MB 3ZPLA 4BGDA 4B3AA 3KP4A 5E3OA 3QODA 3JRGA 2XAFA 4ZZDA 1HKTA 2NS8A 2EWNA 1YHQI 3ZOBA 3J80K 2FXAA 3K7AJ 1HQCA 1A31A 1SVLA 4LG3A 4CCKA 2Q0OA 1UZCA 3DKWA 3PO3J 1A6QA 2JA7J 4ESJA 4PSXA 5EG0A 3S2HJ 4C2MJ 2ZO4A 3M8FA 2KFDA 4XBFA 4ON0A 3ULQB 5CJ9A 3HIFA 1RKTA 1G3YA 2KIQA 5CLSA 4LIUA 1W7PA 1C0WA 1U8BA 2ZMEB 5ILVA 3HHGA 2VB6A 3GLXA 2CQNA 5LRRA 3J80Z 3WTYC 4D9JA 1LDDA 2FJ1A 2OZ6A 1OCPA 2DXIA 1R5GA 2M3AA 4M6YA 1T98A 3QOEA 3PJRA 4A69C 1MBHA 3GTGJ 3GEZA 3Q0WA 4OINF 2MH9A 5H20A 3SEZA 5EGOA 2DJIA 2YR2A 4CZCA 4XM3A 1B1BA 2M30A 2VC1A 3CDLA 3S16J 2GAUA 1ULYA 2LH9A 2IBDA 1ZHFA 5C4JJ 3HTSB 4C3JJ 3OYCA 3H0GJ 2DMUA 4XLPF 1RUNA 3CD6I 4RAFA 4ENNA 4HBLA 1LPQA 2Y0SA 3A1YA 3H0DA 1X3ZB 2ZJRF 2CQQA 5HNHA 2HYJA 3TGNA 3OS0A 3P9CA 5F04A 4BYYA 1CF7A 3E0JB 1HKQA 2FOWA 2QLZA 2BVLA 1R23A 4RS8A 3W3CA 3KZZA 5F1JA 3GLLA 3I3LA 1OQYA 4HNUA 1X1PA 3K4KA 3B73A 2RAEA 4L0YB 2F5VA 3RSNA 1TWFJ 3B02A 4XSXF 4U88A 3ABMH 2Y0SN 3KP6A 1TNSA 2JUGA 3OOPA 3Q5FA 2DN0A 1HSTA 1NG7A 2VBYA 1FMVA 4WF2A 4XICA 3EETA 3OR1C 3KPHA 4XKCA 3CC7I 4LIVA 3WU0A 3F6OA 5HLHA 1FNNA 2C6YA 3FM5A 1HA8A 4QWQA 5JVGF 2QKMB 2VIXA 3E7LA 2KZVA 3J81K 1UHSA 4RGRA 2K9MA 4ZYAA 3W6JB 4RGSA 3S2DJ 4EGZA 3GTOJ 1MBGA 3I5UA 1USTA 3UR3C 4ESBA 2X6OA 1D1BA 4NHJA 3DPUA 2PJRB 1WI9A 3F3XA 1VQOI 5GP9A 4HDUA 1GDTA 2LP0A 1L3LA 1SD6A 1RESA 3BP8A 4HX7A 1ZGJA 3W6KB 5ICCA 1XG1A 4JX4A 1U9NA 5HLIA 4CGZA 2DMQA 2OC6A 5HLGA 3E5UA 2FQ4A 2VPLA 3CCYA 1FTTA 3J81Z 2DK5A 1TW2A 3ABTA 3EDPA 2ZXHA 1QA6A 3ZGKA 5L3BA 5K5QA 3RDIA 4Q47A 3U21A 3BC8A 3GTQJ 3HSRA 5LEJA 1E3HA 2XKPA 2DW4A 4CSWA 5H6QA 2JT1A 2RN7A 3WTSC 2L0KA 1KYZA 2CQKA 4QTRA 2X4HA 1VTNC 1KQ8A 3GYHX 1I3QJ 4BDYA 4MFEA 1FYMA 1WQ2A 3J7YJ 4N0BA 5DD8A 1KU7A 1FSHA 5ICEA 4XKVA 2XSJC 3QYEA 4PSWA 3HEFA 4UUSB 3KFWX 2VLAA 2DPDA 2PI0A 4GYGA 5HDGA 2M87A 1T08B 3LOCA 3JRHA 3MN2A 4A3BJ 2CS3A 2ME0A 2BY0A 4U7BA 1RPWA 1PDNC 2P6TA 3HPGA 1K6YA 2GOMA 5D5UB 1OCCH 3EYYA 2DA4A 1IJWC 2OTLI 2W00A 5J4YA 4BUPA 4N4NB 2V9VA 2W4SA 1G3WA 2GA1A 3E6BA 3BROA 3CDIA 2LR8A 3P5JA 3MMYB 3H5RA 3V4GA 1JKQC 1ETKA 5D4RA 2L4AA 1JUMA 1MH4A 4N9IA 4Y7NJ 4D5CA 5M3MJ 3JTHA 1T0FC 1QPIA 4OOIA 5F0CA 1AKHB 2PMUA 2ZJQF 3NEUA 3K4MA 2VOOA 1R6RA 2P6SA 3H9GA 3OYHA 2O61A 4YIIA 3RKXA 2RKHA 5FLXK 1FMWA 1QU3A 5IP9J 1T95A 2X1CA 3LAJA 2Z1DA 3IC7A 4RM3A 5KNLA 3HJEA 4RDUA 2HDWA 3D0SA 3UNGC 3PFYA 1BI1A 3BDDA 4O5VA 4DYRA 3HOWJ 5L3CA 1J2XA 3L2CA 4L18B 3DKXA 5E17F 2ID6A 1W7PD 5LGTA 2LYCA 2H27A 2VC0A 5FKOA 1I39A 2W48A 4UB6C 2HDCA 2DA7A 1E0EA 3SZTA 2PG4A 5FLXZ 2V9PA 1U0JA 2WY7Q 4ITVA 1ZK8A 1MDMB 4PGHA 3NAUA 1POGA 1PYVA 2XHKA 1SD7A 3MCZA 4YFNF 1SVOA 3OYLA 4EEFG 4FETA 4ZYDA 4H4KC 3FK7A 1ZKGA 3EUHA 1HLVA 1P2FA 3LSJA 3O8HA 1ON1A 1TWCJ 2MC3A 2HTJA 3WG9A 2LDUA 1T33A 1WI3A 1LFUP 2W1OA 4RB1A 3H3UA 1MMAA 2WV0A 1D1CA 1FOYA 2XF5A 1VQ5I 3CCQI 5LHIA 1W36D 2EV6A 1K61A 2VT2A 4ZJZA 2WC2A 2HQRA 5FO5A 3TP3A 2FNPA 2V1UA 2E60A 1W0TA 1ZAOA 1OCOH 2DYSH 3VSLA 3O6BB 4ANJA 4HV5A 3L2RA 5F27A 2JWTA 5LD2C 1S72I 3CC4I 3TP0A 2QUFA 3F8BA 1P9QC 1LVAA 1J7KA 3E5XA 1SANA 3HUGA 4CH7A 4IHSA 2Z9OA 1MNDA 2QQAA 1BI0A 3DF8A 4MO7A 4A3JJ 4HG2A 2V9KA 3PUFA 4CCOA 4M3GA 4PZJA 2QWWA 1S7EA 2L01A 1G4DA 5DV5A 2O8KA 3GUDA 6PAXA 4U0YA 1IRGA 4IVNA 4X1EA 3GTKJ 2VBZA 4L9TA 3E3VA 1JKRC 2X85A 2FMYA 2DTRA 1WGXA 5E3MA 3K4NA 2DMTA 3FHNA 1Z9CA 2IA2A 1B59A 5IP7J 1H0MA 4I6ZA 2P5LC 3HOTA 5E8IA 1YYVA 4BBRJ 4EVIA 5IYCJ 1MJBA 1JGGA 2VODA 2OQRA 1YITI 1DPRA 5DCMB 5HS8A 4ASNA 5D8KB 3QOPA 3L2UA 2LC2A 3ZMTA 1P4XA 1LUJB 2WY8Q 1IN8A 2O3FA 4G12A 4JBAA 3BLYA 3Q0VA 2XB5A 3QPTA 3E6MA 3H1CA 1ZGWA 1RIOH 3VYSB 3W2AA 1R7JA 3PFIA 1JKPC 1O57A 3J7AO 3F8NA 3G3ZA 2WB1N 3J7ZI 3T5XA 4LD5A 2P0WA 1OCRH 3BQZA 2JSCA 2KL4A 2OCEA 3ABLH 2HTSA 3U9GA 2QBYB 4CCLA 2DPUA 3IH4A 3KEQA 1ETXA 1RR8C 3RTRA 2WTEA 5AIQA 3CCRI 4XR6A 1J75A 3BTIA 2JPCA 4HRIA 2HOSA 3M4OJ 1H88C 4W1UA 3HRUA 2OBPA 5IOZA 3I55I 3FXRA 5KAFC 4QIWN 2PFBA 2E1MC 4ZTFA 2EZKA 4BY7J 3A03A 2JA2A 3BZKA 1HW1A 5M5WJ 3OYMA 5E3NA 1CGPA 3IWZA 4JQFA 4NC8A 2R7SA 1D3YA 4YIFA 3RPUD 2DYRH 5JVTA 1BM9A 3FHZA 4XKBA 4M74A 1XN7A 1GLNA 3CF5F 3NARA 4IHYA 5ED4A 2W84A 5CQEA 4Q4ZF 3OY9A 4G9YA 2VUMJ 3D5LA 3BT9A 1VQ7I 2VJ5A 4II2A 4NNJA 1WVRA 3BZ6A 2ZMEC 1HKSA 2RV8A 2VI6A 2DFEA 4IEJA 5FJ8J 2FBIA 1PUFB 4PJLA 1Z7UA 5JHFA 2HI3A 1E3OC 1Z21A 2QQBA 1RKWA 5HLTA 4JOMA 1S6LA 3FXKA 2OUMA 1XSVA 5LHGA 3K1MA 3R0JA 2DFIA 5E1WA 3GWZA 5D6EA 3BR6A 2EFOA 2OQGA 3BPXA 4U87A 4UHTA 3JRCA 3LSTA 3GCMA 3V8LA 1REPC 4LLNA 2UXXA 1P92A 2XPVA 2I10A 3CUQB 1Y1VJ 3W2WA 2P81A 2W25A 4FX0A 3A4CA 2E19A 1D1AA 2ISZA 2XC7A 4XLCA 4NB5A 1Y8QB 1TLHB 4BACA 2HZDA 3JRDA 1MMSA 4E4HA 3VYTB 3CMYA 1ZLKA 3K69A 2RGVA 1JHFA 1QGPA 3DCFA 1Y39A 2E1NA 1N25A 3P9KA 1JI8A 1SFUA 1BOAA 1RETA 3C1DA 4ZYHA 2V1DA 1KU2A 2XAQA 1RUOA 2V79A 4EM0B 1U3EM 1S29A 3AAFA 4CCJA 4LG0A 2EPFA 2DT6A 3DEUA 3RJPA 4NC7A 5GADJ 2V26A 2BXYA 2HQ5A 1QVTA 3TKYA 2XSDC 2DI3A 3K70C 4A93J 4ZTJA 4AYBA 2M1BA 3FXUA 4LLLA 2FD5A 2R7TA 3SXYA 3ZQLA 3CF2A 2R92J 4UXNA 1JGSA 3MWMA 1MMNA 1YRNA 2LBFA 1JKOC 1QHHD 1L0OC 4ABZA 4BBSJ 4LMYA 2R0QC 4MEYF 1R1UA 3JSOA 2B0LA 2IXSA 1J59A 1Q1VA 2XPWA 4AYBN 3PIOF 1ZR4A 1B8IB 1ZRCA 3T1BA 2QGUA 2XAGA 2EZIA 2UXNA 2FE3A 2JMWA 3CO6C 3T8RA 3OYKA 3ZR8X 2QF7A 4YFKF 2QYOA 2I5UA 5LLQA 1S3JA 2PLYA 2OU2A 5K1YA 2Z99A 4Y3OA 3J7AY 1YRNB 2VASA 2DODA 1QZEA 1Z1DA 1U5TB 3TO6A 1UMQA 2MBFA 4RGUA 3PL8A 3GXOA 1YX5A 1ZYRF 3QU6A 4XRSG 2L3DA 2TDXA 1WH5A 1H8AC 2RNGA 1OKRA 3N97A 1TWGJ 4GYIA 2QQ8A 2JJ7A 2X1EA 2CUFA 2IRFG 5D6FA 4F52A 1ZN2A 2EB7A 3L9FA 4IL6C 4AC0A 1IUYA 5BPIA 2MLGA 4B47A 1KONA 3GX4X 3CCMI 1AHDP 3TO7A 2NVUB 4RLQA 1GV2A 2KKOA 3BR2A 4BNCA 2L02A 2M4GA 3HOZJ 3OL3A 4M6XA 1R1TA 1YFHA 1BR2A 2PX9A 2VOPA 4PGGA 4L5EA 1FBSA 3ML6A 2H8RA 4MEXF 3A0BC 5CVJA 4XLAA 3G6EI 5AONA 1RNLA 2MC4A 3B6AA 3OYFA 2ICWG 1WFXA 1ZR2A 2IGKA 1HC8A 3ECOA 1DUXC 2FF4A 1ZTRA 3HHHA 3K1NA 1ENHA 4HSRA 3P9IA 4P55A 3ROUA 1E2XA 2EZLA 2K86A 1ITYA 2Y48A 1MNMC 3QPHA 2QSFX 5DM7F 1Q1HA 2WAQA 4WCGA 1D0YA 2BVMA 3ZP5A 3QP5A 4MNUA 4XN3A 3G73A 3VWBA 4IZZA 4HNVA 4BHBA 1ZRFA 2GXBA 2BHZA 2DFFA 1EH8A 2JRTA 2L7ZA 2QENA 5FKKA 2CUJA 4M71A 3ABUA 3W6VA 3MAJA 2EIMH 2E5ZA 4N4OB 4ZDOA 3E1SA 3LFKA 3FF5A 1IF1A 2RDPA 5DYMA 4RB2C 1VZ0A 4IHVA 4Q5SF 2YPRA 1RR7A 2VKHA 3ZXSA 3O2PE 1W5SA 4RBOA 2CGPA 4FHTA 3IKVA 2V7FA 1I50J 4HX8A 2WAQN 4KYWA 3KP3A 2BBYA 3I58A 4NQWB 4HLXA 3I53A 4XRSA 3G4SI 1XPXA 1YW9A 2ZCWA 1FOWA 2HGCA 1Z05A 3DBHB 4RAYA 2VN2A 4RGXA 4XK4A 2Y75A 3A02A 1XB4A 1FP1D 4UV9A 2BXZA 2R7UA 2QKLB 3VPRA 3G1OA 2BY2A 2LMDA 1FYLA 3F8CA 4OIQF 2P5KA 2V4JC 5EG0B 2CV1A 3VODA 1QO0D 2M8EA 2WV1A 4PJMA 1Z7LA 1O4XA 1FIPA 2H09A 3M8EA 4XN0A 3K4CA 1FWZA 1W7PB 2G9WA 1MJAA 4IO9F 1SFOJ 3RQIA 3WGGA 4KISA 1KU9A 3OL4A 1BW6A 5FLMJ 1YJ9I 1LEAA 2K4BA 2KIFA 3S1MJ 4BXFA 4G7HF 4D7NA 2BV6A 3T0YA 4IQJA 2X6WA 1JT6A 3KYCB 3TOBA 1R1VA 3GTJJ 2OPTA 1UELB 2MYSA 5IOYA 1DU0A 5ILSA 3BQYA 4B48A 4AWXB 1IXCA 2M7AA 5M5YJ 2O6GE 5EGOB 1MD0A 3HOUJ 4FX4A 1TL8A 2GOXB 2LKXA 1I5ZA 1R00A 2CJJA 1IDYA 3K4LA 2WWYA 4C2UA 2E36A 2FMLA 4A3DJ 2BY3A 4AIJA 3CO7C 4WWCA 2JVGA 1T2KA 1IO2A 1NHAA 2DA3A 2LY9A 3F9KA 3HM5A 4M72A 5D4SA 2EH3A 4JK1X 2GIVA 3KIOA 2JQ7A 4O3MA 2EK5A 3ZMSA 4PK4A 5FD5A 3EYIA 3JRBA 2F4MB 2R7QA 4KN4X 2VQGA 4BQAA 3RZOJ 5CVVA 1HDDC 2A6TA 2FBHA 5EZGA 2H1KA 2H8WA 1CF7B 1KYWA 4YELA 2KJBA 3ZQGA 2IGNA 2M45A 4DYCA 1OCZH 3DPLC 3HC7A 3TQNA 2X9DA 3CJNA 1VQKI 4GGGA 3TO9A 2DU9A 4PFPA 2R7OA 1BI2A 2AXLA 4O6JA 3R61A 4DIQA 1WZ2A 4ZC3A 2WAFA 5J8FA 1F43A 3GW2A 1IGNA 3SDBA 5KAIC 3PNYA 1Z6RA 3GO5A 2R5YA 3OYIA 1Y8RB 3VFZA 4I0BA 5EEGA 2ME6A 2O9LA 3FISA 4B44A 3HOXJ 2JA8J 2EJRA 1U6GA 4L9VA 1QNTA 3BR5A 1Z67A 3DU5A 4XOTA 1QVUA 4EJOA 4A3CJ 5E3LA 1FX7A 5FD6A 1P7IA 4IJAA 3ZN1A 2K9NA 1R22A 3LAPA 4RAGA 4G8XA 1FBUA 2D5VA 2FRHA 5GAEJ 3SFIA 1JE8A 3M3YJ 2DOFA 5LFAA 1IRXA 1SFEA 2EFWA 2F5DA 4BJ6C 3N05A 1TQIA 2DCEA 3IV5A 1SAUA 2GA2A 2V6CA 3T8TA 3IKTA 5IT9K 2PJPA 1S5LC 3OR2C 2DA1A 2QA4I 4TV7A 4U7DA 3I59A 2R7WA 3PM1A 3LQRA 2LSOA 1JTXA 1KQ0A 5DUKA 4Z2YA 2ADUA 3V7SA 2M0CA 1OR7A 2YX4A 2KP6A 2XGCA 4HOBA 3FXOA 3NWSA 3L7WA 1YE9A 4F93B 3LSPA 3CCLI 1YS7A 3WGIA 3MKWB 4A5NA 3VB2A 1P7JA 1ZLJA 1FC3A 2H94A 2LRDA 3RQ4A 5DEQA 2KLOA 2R7DA 4RA2A 4YG2F 2L9NA 1Z91A 3OIOA 4HEA2 2GLOA 5IT9Z 2KHMA 1RC9A 3RPUA 1PJRA 4F3QA 3F8FA 1ZQ3P 1HCRA 2A5YB 1XSXA 2EBIA 3N4MA 2D2WA 1XDUA 5FFZA 4F92B 4I2OA 5CPRB 4HNTA 2M34A 3MZ8A 2ID3A 3PQKA 3EUAA 2KMUA 3FXJA 4M9XA 1FYKA 2ESNA 4RMNA 5GPCA 5DD4A 3B6CA 2OJED 3IP4B 3MD2A 5J1UA 2PBIA 2R93J 2NOGA 3L2QA 1NG6A 1X3WB 2OCCH 1UAAA 3CLOA 2HS5A 3BPVA 1W1WE 2F5FA 3I9V2 2GWRA 4P5OA 2BOLA 3AG3H 1QBJA 4L0ZB 2JUCA 4XLHA 3A01A 3K0LA 3QP6A 5J3LA 3DLLF 2H6BA 2A6HF 3HPHA 2R3SA 4IQ4A 2CW7A 4Y4RA 1IXSB 3H9QA 2B9SA 2K7LA 4HW0A 1RZ4A 2NVTJ 2FNAA 1QPMA 2Y2ZA 3JRAA 2EFNA 4BEHA 2F5CA 4UV8A 5DS9A 4BAYA 4EV0A 2MABA 1DU6A 1ETQA 4PUSA 1I3AA 5FGMA 1F4KA 3CUQC 2P7CB 4H0EA 4ENKA 4BJTA 2GQQA 1BC8C 3NQOA 1J5YA 1B9NA 3ZCOA 3DBLB 1BI3A 4Y17A 1WRJA 2DMPA 1WH7A 2DOEA 2JRMA 4C9YA 1CQTA 3U1DA 3BTCA 2KIMA 3DLAA 2KPMA 1EF4A 1Y1WJ 3LSMA 2CV2A 4IHXA 5JR3A 4B8XA 4J00A 3DPTA 2IW5A 2HFHA 2ELKA 4RAZA 3DU6A 2BYVE 1MBEA 3OIQA 4BEHB 1S9HA 2DO7A 3SHFA 5IY5H 4C3HJ 4DBQA 1WJCA 3ZQFA 2R7XA 3IH2A 2UV1A 2DA5A 3M07A 4DNCA 4YFXF 3HRTA 2V1XA 3WHCA 4CCMA 1XTAA 5FKLA 5TISC 3WE2A 2A69F 3MZHA 4IX7A 4A3LJ 4IRIA 3S1NJ 2CUZA 4PCQA 1SVMA 1TT5B 3IL2A 5KVRA 4OMYA 2DA6A 2XF7A 3OYBA 5F6FA 1O3TA 3HOYJ 3GTLJ 2XB0X 3GFLA 4C3IJ 1XMKA 2CYYA 1X1BA 3K1PA 4XRFA 1F1ZA 2LOOA 3IUOA 1W5TA 1ORKA 4GO1A 4WK8F 1U8RA 5GPAA 3I4MJ 1K78A 3OSFA 3TEDA 4BL0B 1GHCA 2IA1A 1OYIA 2G7HA 1QQIA 2X1DA 3FM3A 1P6RA 2RNJA 1JUSA 3ASOH 4IRHA 1T8IA 1BBYA 2OF7A 2Q1ZB 2JK3A 2X6YA 2CUEA 2TRTA 4HAMA 4AVPA 1U5TC 2CV0A 1O7LA 4KFCA 2Q2EA 3M8JA 2WB1A 2CO5A 2XKOA 3C2GA 1QHGA 2IPQX 3TBIA 3IRRA 2CFXA 4A5MA 2F5EA 3CMEI 1FTZA 2DJNA 3HUGB 2QSHX 5FFXA 1MJ9A 1P4WA 2ESHA 1X4OA 2BW3A 2NNNA 2KT0A 1HBXG 2R4GA 2E2HJ 2X6XA 3FX3A 1UHMA 1SD4A 3V7CA 5ICFA 1K4SA 3HOVJ 4A0ZA 3HRSA 4ESFA 2IT0A 3TW6A 1MZBA 5BS6A 1JJ6C 5AIPA 3M7GA 4OIRF 3HSFA 2DFHA 1SMYF 2GXAA 1N78A 1IUFA 3F23A 2Q2EB 2W82A 3CZ6A 4BQNA 2VQCA 2HZTA 5KCMA 3AKZA 4AM3A 1FSEA 4HLYA 3DEWA 4LJZF 4R8HA 3WODF 2L7KA 4W97A 3D5RC 3F21A 1EH7A 4AIKA 3OYDA 1XSDA 4R79A 3DEEA 1LE8A 5B3SH 1FEXA 1XMXA 2K40A 2W7NA 5FLVA 4IPAA 1V55H 2JN6A 4OAYA 3CTAA 3QWLA 4MHGA 4E7HA 4A3KJ 5M3FJ 2Y9ZA 3I4PA 4AIDA 3GVAA 5LGNA 2D1VA 4B3XA 3K4BA 2QEXI 2JTVA 1XX5A 1X1DA 1X1AA 2XGEA 1XCBA 4BDZA 2P8TA 4KITB 2XF6A 2KRCA 3TOAA 1IRFA 1TZLA 3G1LA 2HWVA 3BG5A 2XUBA 4KICA 4HDVA 1IG7A 1KZHA 5KK1A 1T0FA 1TTYA 1VQMI 2HU9A 1UJ8A 2FX0A 2PMZA 3D5SC 2DLLA 3F72A 4MTEA 2L54A 1XCVA 2AO9A 3WTTC 2CFOA 1I27A 5J40A 4BKXA 4L9JA 4CA0A 3KP7A 1FLIA 1BW5A 1TNTA 4LFUA 3FXQA 4MFDA 1IC8A 1XDSA 2HXOA 4XIDA 1X19A 1HW5A 4UVBA 2COBA 4M3FA 5ILUA 3GZNB 1D0XA 2VONA 3OYEA 5GTHC 5E20A 1JT0A 2XGDA 4BS9A 3G71I 5BMZA 4LGWA 4HV6A 2DTZA 2PMZN 3F8MA 1OYYA 3WTVC 2YX7A 1MSEC 2EV5A 5L3EA 4EJTA 1S7OA 5F0FA 3ELKA 2A5WA 2VKDA 4GDFA 1OFCX 2R7RA 1XGSA 1HXDA 2HKXA 2A61A 2E71A 4L9NA 3IRQA 3IWFA 3HB9A 4DOZA 1N77A 5HDNA 4OU0A 5CVIA 4S04A 2FUG2 2K9QA 4A3IJ 3DWLE 3FMQA 4NBQA 2VJJA 1WJDA 2RREA 4V19K 1SEUA 2DQLA 1E3PA 1G2HA 2R7VA 4DW6A 2ACJA 2J5OA 2GBYA 2LVSA 1R5HA 3K2AA 1R58A 4HQMA 4KIFA 4KJZA 1U78A 3I4NJ 5ERIA 2KDZA 5K7ZA 1ACIA 3DP7A 3IAS2 5K5RA 2R7FA 2HXIA 3FMRA 3HBLA 1SFXA 2Y69H 4DYQA 1DPUA 4EGYA 4A6EA 2MLKA 1YW7A 4I0AA 1VNDA 1MBKA 2FQ3A 1VQLI 4JP0A 2K3PA 2HEOA 2ZSHB 1W36C 3S3NA 4MTDA 2BHYA 1NTCA 4KIBA 2FA5A 5K7FA 3K9TA 3FKIJ 3HGYA 1J0RA 2A3SA 4Z6YA 3I71A 3K6GA 2L2OA 3GTMJ 4MLOA 1BC7C 3FWEA 4PFOA 2VPRA 3FDYA 3BR3A 1WJFA 3CMMA 3L2WA 2A07F 2VL8A 2K02A 3H3ZA 1ZELA 1B9MA 4LG0B 1EJ9A 1S7AA 1WCMJ 4BE2A 4FTHA 4XSZF 1FOXA 3LFUA 3ISPA 3KYDB 2AHQA 3HGGA 2COMA 3Q0UA 4WXCA 4G6QA 3RKWA 1W0UA 1K6OA 4PJJA 4KMUX 3OS2A 4M9SA 1QZZA 3HL2A 1WSUA 1R49A 1S8NA 1JUPA 2HKOA 2O5RA 5B66C 1DP3A 4AIHA 1TBXA 5CYVA 2YUSA 1R36A 5JLWA 3D1NI 3KLOA 1B72A 2Z33A 4XNFA 2LBFB 2LREA 2ZC2A 2RVCA 4UVCA 1K79A 3FK6A 2K5CA 1FJLA 1ZGAA 2E7WA 4A3EJ 3WGHA 3SZGA 2HYGD 1Y0UA 4XLFA 3DTKA 5IT3A 5BOXA 4P96A 3LMMA 1ZH5A 2ZFUA 3P7NA 5EZHA 4CCNA 4BE0A 2HQAA 4GFBA 2EA2A 5EDNA 3GF2A 4LLGF 1LDJA 4D5FA 4KUMA 3PSIA 1ETVA 4LB6B 4DJAA 2HOTA 3AG1H 4E7SA 1TT0A 4BHCA 3ZQIA 3COAC 1FBQA 1B72B 1GUUA 2VT3A 4I09A 4XLEA 3RKQA 2EFQA 1V5EA 3S93A 1F5TA 2LFBA 3LWFA 5DTDA 2M2EA 1GXPA 2XAJA 3DXJF 1I6XA 2K3FA 2VKVA 4M73A 3CMAI 1IZ1A 3BZCA 1X4PA 3VDXA 4NC6A 1V5FA 4X6AJ 2MH2A 5EJCA 5EYRA 1Z3YA 1UFMA 2HOAA 3ESWB 4F55A 4E7JA 1PP8F 1D8JA 2VE8A 3GMEA 4OIOF 2M8GX 4IOCF 4E7LA 4M3EA 2WADA 2OD5A 1V5GA 2NOJB 1D8KA 1TW3A 4E7KA 3H3VK 2LY1A 3BWGA 3AFHA 2BEOA 4QPQA 1DQUA 1I6HJ 1ZG3A 2F2EA 2XGXA 2Z16A 4KMFA 1MMGA 1SFKA 3H92A 1ZREA 4IKFA 4NDLA 1XMAA 4CDGA 3JSPA 1UG2A 5D5VB 2IJLA 1H89C 1VQ9I 2ZMEA 3HYIA 1R71A 3DV8A 1IN4A 1PP7U 2O0YA 1BIAA 1BR1A 1NK2P 1IN7A 2QM3A 3H5AA 4UUTA 4QSHA 3DQVC 1XD7A 1KU3A 4YEJA 4XORA 4EJWA 5D5WB 3TDZC 2LLKA 3QYBA 3S1RJ 1YIJI 3FKJA 2F6CA 1YG2A 2LTPA 3FZVA 2L9RA 1V54H 3SFZA 2XAHA 3ASNH 5BNGA 4QPOA 1TQMA 2LY2A 2ZNYA 3SJMA 1J9IA 3LL7A 5CQGA 2H1LA 4LK1F 2ECCA 4C30A 4E6KG 2NRAC 2DBBA 2IS4A 1ZARA 5JFRA 2AQEA 4YRVA 4XOPA 3MZYA 2HVQA 2JZYA 1OPCA 3KETA 1AU7A 1UB9A 1HSJA 1UG0A 2HYFA 3L09A 1XGNA 2P5VA 1W5CC 2BY1A 4Y15A 3LSHA 4BXUA 1MH3A 4GCVA 5F64A 2G7UA 1STZA 4IOAF 1IV8A 1V3FA 3BJ6A 1APLC 3FXLA 3OYNA 4IXAA 1LEBA 2K9SA 3HTUA 4D1QA 2K4JA 4KN7X 2N8GA 2QSGX 2NXNB 3I54A 4M9ZA 4XMYA 1YJNI 4NUBA 3PSFA 1AA7A 1BJAA 4DZJA 5D5XB 3TDUC 4CYCA 2CW0F 2EV0A 2CQ7A 2ZFWA 3S2WA 2XASA 2KRHA 1X3UA 2I8DA 5LGUA 2F4OB 1UCRA 1VF9A 4ENMA 2ZXWH 3LSIA 1MW7A 3ONQA 1LFPA 1XS9A 3S3MA 3OMYA 1A36A 4ZH4F 2DOAA 1G6NA 4Q48A 5B1AH 2ZXIA 2K27A 1G3TA 5JHUA 1TP4A 3DTIA 3EUHC 3HSEA 2R5ZA 2CW8A 3KE2A 3KEYA 3SEQA 4G7ZF 3S14J 1J09A 4KT5C 1BA5A 4MIMA 5F0HA 3RI4A 4EQQA 2B7EA 2PEXA 1D5YA 5C44J 4GXOA 2X48A 3V7RA 4Y13A 4CZZA 5LEKA 1K4TA 4BJ5C 3CC2I 1H9GA 3ZMVA 1G59A 1K7AA 4S0HB 4CYCB 2L5QA 1KA8A 2LKPA 2VJ4A 3SDGA 3ERED 2VXDA 3GBGA 5HS9A 3GFMA 1ETOA 4EM2A 2JA6J 1F36A 2PJRA 1QZYA 2DDAA 2E35A 1FT9A 1YS6A 4Y52J 3JAMK 1MMDA 5C3EJ 2R5ZB 3CCVI 2EZHA 1WKMA 1YJWI 3V8JA 1D5VA 1A04A 1OISA 3VEPA 4S05A 5IPAA 1X2MA 4FE7A 5JLXA 3KX2A 4HPQA 4HYEA 4A2UA 4WXDA 3OYJA 3JRIA 2K85A 5DUIA 1XGMA 2VJIA 3MVPA 4U0WA 4HF0A 2H6CA 3JREA 3M1CA 3PO2J 1Y0NA 3A0HC 3BCAA 3L00A 4XKWA 2KQRA 3CCEI 2MA3A 1G8XA 3JAMZ 2XV4S 3RZDJ 1USSA 3OWTA 2YU3A 4FT8A 2CG4A 5DM6F 5ICGA 3KEOA 4A3MJ 3LA2A 3MKLA 3FMSA 2R5YB 1IDZA 3NRVA 1O3SA 4RB3C 2VQHA 2EQRA 3F22A 1HOMA 3WTXC 3E97A 2KRFA 4HSTA 4AVZA 3PQJA 4ZYEA 1YX3A 4UUSA 2DDBA 4PJNA 3Q9VA 3U1KA 4AUXA 1FOKA 4HA8A 2AS5F 3REOA 5F1RA 2KIUA 1AWCA 4FISA 2M5WA 2JSPA 5FKMA 2NVQJ 4J19A 1N75A 1NH3A 4WX9A 4EATA 1I1SA 3IH3A 2BE5F 3BG6A 1YO5C 1Y56A 4Y33A 2E1OA 3AL0B 4GRIA 3V8KA 2LF7A 2NNYA 4J01A 3TMOA 2DMNA 3VYRB 3ZQCA 2ZJ2A 1ERDA 3RCOA 3MKYB 3CDHA 5LBQA 2JVHA 3GFJA 1A5JA 3I59B 4UY8I 3WTWC 3CJTB 2DT7B 4B43A 4HZFA 3OSGA 4KA4A 1AKHA 1G3SA 1OCTC 3FBIB 1AOYA 1X2NA 1Z6TA 2YS9A 1HDPA 4I01A 2AQFA 2FSWA 4XQFA 1A6IA 3FXMA 1Z0XA 2HDDA 5L3FA 4D0PA 5L3GA 9ANTA 1U2WA 4UUVA 4XRMA 5B1BH 2VE9A 4II3A 1OYWA 2L9SA 3SQNA 5HDKA 4OWRB 2FOKA 2ISYA 5K7HA 4FQGA 1U9OA 3CCJI 3HRMA 4MQ9F 1Z77A 3HZJA 2IS1A 1LKXA 2RQQA 3AG4H 3VSKA 1WJEA 2D1HA 4LOCA 4UB8C 1K83J 3H36A 5E79C 1R5ID 4OAZA 3BG3A 1MDMA 4UNOA 5E8GA 2EIKH 1F9NA 1VQ6I 2UZKA 1SMTA 4EJUA 5LRSA 2GXGA 2KJCA 2MG4A 1FIAA 2CWEA 5EF6A 1D0ZA 4AD9A 4JX6A 2VQLA 3A01B 3QQAA 1LVKA 3WG7H 1W4MA 2IA0A 2HPIA 4CXFA 5HS7A 2M0MA 1YW8A 4X0GA 1BIBA 2KZGA 2UUZA 2QZ8A 4I98B 5DDGA 1R9TJ 3BOQA 2FBKA 4I99C 3WE3A 3G1MA 2Z2SB 3BG9A 2BGCA 4A3GJ 1DGWY 3Q3SA 4P9UA 5D8LB 3NWTA 3DBRB 1WJBA 1I1GA 3LSGA 3L1PA 2E34A 1DDNA 5GAGJ 3RYRA 3QRFF 2E7XA 5KHDA 3S15J 4BXXJ 1IN6A 1VQ4I 4IRGA 1LJ9A 2PN6A 3ZQQA 4A6DA 2W85A 2LD5A 2ZB9A 4G7OF 2XPUA 4FASD 2YU9J 1FP2A 1V4RA 3BJOA 1LDKB 4ETSA 3ZMDA 3E5QA 2ELHA 3K70D 1GXQA 1KQ9A 2EFPA 2EINH 2P4WA 3E6CC 3DKYA 2VBWA 4WXHA 1HF0A 2M9HA 2DAOA 2EIJH 4K2EA 2Y30A 1YTYA 1TWAJ 3JCUC 2STTA 4ZDPA 2G0EA 1TQPA 2RC4A 2XAUA 3OYGA 2WBMA 1LFBA 1T6SA 3SYTA 3CCUI 3GTPJ 5BPDA 3GZ5A 3S3OA 1YOVB 4UVAA 3RYPA 2MW8A 2Z5UA 4E7ZA 1SAXA 3EPZA 1EA3A 2CMPA 2O8XA 3QYFA 5L3DA 1TWHJ 2Y9YA 1X58A 2J5PA 2MD0A 4N9HA 4DQ2A 5FROA 2MFZA 5DCMA 2TCTA 4RB0A 2MSYA 1BL0A 1O3RA 2X0LA 3H35A 5GAHJ 3MFKA 2PQ8A 2E1CA 3S32A 1JHHA 4KIGA 2HVRA 1PVEA 4V2GA 2CQXA 2A6EF 2IGMA 3VOEA 2HNHA 4CUGA 1NK3P 1K78B 4KNYA 3WU2C 2IP2A 3I64A 3Q9SA 4ENJA 4BY1J 3PNTA 4DZPA 3KZYA 5A2QK 2QVOA 1A35A 5E1ZB 2VKEA 2ZKZA 5BQTA 2JA5J 1BR4A 4M6VA 5C4XJ 2EILH 2HOEA 3ZN0A 5HODA 1GVJA 5TRDA 3E6DA 2QBYA 2XRLA 2P7VB 2V6EA 2R7ZJ 1O7FA 1JJ8C 1ETYA 5E1XA 3KYLA 4R1HA 4LK0F 1EV7A 1KGSA 1MBFA 1ODDA 2L7MP 4JYKA 3HKZA 1SC7A 3CLQA 1LB2A 2F4IA 1IXRC 2NS0A 1XGOA 1JTYA 2L9VA 5FRMA 2BW3B 5A2QZ 1BJZA 3WHBA 3BG7A 3LSKA 4IF4A 4MQVA 2STWA 3KP2A 5TJJA 1Y6IA 1QRYA 2LK2A 3C7JA 4EM1A 2W24A 1YIOA 1B6AA 2ETHA 3CJQB 2KDOA 2A05A 5LHHA 3O3KA 2V1NA 2O03A 4HF2A 1YI2I 5M5XJ 4RM2A 2F48A 2IVMA 2FU4A 4IHWA 3M1EA 4ZDLA 2RQPA 3QAHA 3FBNB 1FZPB 3HKZN 3MKZA 3K2ZA 4HQEA 3RIRA 1O3QA 3GFIA 3F0CA 1ON2A 1T38A 3QPLA 3DFGA 5DCFA 1ETWA 2XIGA 1H9TA 3CP8A 5CVUA 1LE8B
chains in the Genus database with same CATH topology
2DA7A 5EZGA 2H1KA 4D5FA 2HOTA 1ETVA 1PUFA 1ZK8A 3ZQGA 3ZQIA 3NAUA 4DYCA 1POGA 5IYBJ 1B72B 1GUUA 3FIWA 3RKQA 4EEFG 2X9DA 2O7OA 3FK7A 2NVYJ 1ZKGA 2LFBA 3BR1A 5DTDA 2M2EA 1HDDC 1HLVA 3LSJA 2VKVA 2IEKA 3O8HA 1IGNA 1F43A 1TWCJ 1OJLA 4B4CA 1T33A 1WI3A 1LFUP 2R5YA 3JR9A 2ME6A 2O9LA 4X6AJ 3FISA 3QPSA 3HOXJ 5EYRA 2JA8J 2HOAA 3BR5A 1K61A 4A3CJ 1QVUA 4B1RA 5E3LA 2M8GX 1VI0A 1P7IA 4M3EA 2K9NA 2DA2A 3TP3A 3H3VK 2D5VA 1W0TA 3SFIA 3S1QJ 3M3YJ 1I6HJ 3O8GA 3IV5A 1T56A 5F27A 2JWTA 4NDLA 1IV6A 3TP0A 1UG2A 2QCOA 1H89C 2DA1A 3HDDA 5IP6A 1NK2P 3PM1A 1SANA 3S17J 1JTXA 4UUTA 4QSHA 2M0CA 2XGCA 4MO7A 4A3JJ 2L7FP 2E2IJ 4M3GA 3LNQA 5EEAA 3LSPA 2LLKA 1S7EA 3BTJA 2O8KA 3S1RJ 1P7JA 4X1EA 3GTKJ 2LTPA 2L9RA 1JKRC 1WGXA 3OIOA 2GLOA 5BNGA 5E3MA 2DMTA 4I76A 3SJMA 4V2FA 4FE4A 2ECCA 5IP7J 4I6ZA 1ZQ3P 1HCRA 2EBIA 4BBRJ 2Y31A 3BTLA 5IYCJ 1JGGA 1AU7A 2NVXJ 2M34A 3BR0A 1B8IA 2ID3A 4G12A 1MH3A 2NS7A 3Q0VA 2XB5A 1APLC 1ZGWA 5GPCA 3B6CA 5J1UA 2K9SA 2R93J 1GV5A 2NOGA 1XC5A 2N8GA 1JKPC 2WB1N 2ECBA 4DZJA 4FCYA 5J1YA 1IRZA 3BQZA 4CYCA 5IYDJ 3A01A 3IH4A 1ETXA 5J3LA 1VF9A 2CU7A 4M3DA 3BTIA 3LSRA 1VFCA 2NVTJ 1XS9A 2HOSA 3M4OJ 2Y2ZA 3TW7A 1H88C 4W1UA 3JRAA 5DS9A 2R5ZA 1DU6A 1ETQA 3S14J 1BA5A 4MIMA 5IOZA 5F0HA 3JRFA 2GM4A 4QIWN 5C44J 1D5YA 2X48A 5J1RA 2EZKA 4BY7J 3A03A 2DMPA 1WH7A 1CQTA 5M5WJ 4S0HB 4CYCB 3BTCA 5E3NA 3SDGA 1EF4A 3GBGA 1Y1WJ 2JA6J 4IHXA 1ETOA 3C2BA 1F36A 4M3BA 3OOUA 4Y52J 3NARA 4IHYA 2ELKA 2CRGA 2IAIA 1MBEA 5C3EJ 3UKGA 2B63J 4C3HJ 2R5ZB 2EZHA 3ZQFA 1WPKA 3IH2A 2VUMJ 3BT9A 2DA5A 3WHCA 5IPAA 4JX5A 2MGQA 1X2MA 4FE7A 5JLXA 2VI6A 1MSFC 4IEJA 4A3FJ 5FKLA 5FJ8J 2E2JJ 1TC3C 1PUFB 3ZQHA 5F08A 3JRIA 2HI3A 1E3OC 4D7MA 4A3LJ 3MVPA 1RKWA 3JREA 3PO2J 1MBJA 3S1NJ 1GVDA 2DA6A 3RZDJ 3CQZJ 3HOYJ 3BR6A 3GTLJ 2XB0X 3JRCA 4C3IJ 5FKNA 4A3MJ 2XPVA 1GT0C 2I10A 3MKLA 1IDZA 2R5YB 1Y1VJ 1ORKA 1HOMA 2EQRA 5GPAA 5E3OA 2P81A 4B3AA 3JRGA 3I4MJ 2E19A 3OSFA 3TEDA 2NS8A 3ZOBA 4UUSA 3K7AJ 4AUXA 3JRDA 1JUSA 3CMYA 3PO3J 4FISA 2JA7J 2OF7A 3DCFA 2JK3A 5FKMA 4J19A 2NVQJ 2CUEA 5EG0A 3S2HJ 2TRTA 4C2MJ 3IH3A 1RETA 2E1OA 3ZQCA 1RKTA 2DMNA 1U8BA 1A5JA 1FTZA 2DJNA 2HQ5A 1QVTA 2XSDC 4A93J 2KT0A 2FJ1A 3OSGA 2E2HJ 1OCPA 1AKHA 1OCTC 2FD5A 4A69C 3ZQLA 1MBHA 1X2NA 2R92J 3GTGJ 2YS9A 1HDPA 3HOVJ 3Q0WA 3TW6A 5EGOA 1JJ6C 1YRNA 1A6IA 3S16J 3CDLA 1Z0XA 1JKOC 2HDDA 4ABZA 2IBDA 1IUFA 9ANTA 4BBSJ 5C4JJ 4XRMA 4C3JJ 3H0GJ 2R0QC 2DMUA 3DEWA 5K7HA 1Q1VA 2XPWA 1U9OA 4AYBN 4W97A 1ZR4A 1B8IB 1Z77A 2CQQA 2HYJA 1LE8A 2EZIA 2JMWA 5F04A 1FEXA 2K40A 4LOCA 2QF7A 5FLVA 1K83J 2JN6A 3BG3A 4A3KJ 5M3FJ 1YRNB 2Y9ZA 1UMQA 5F1JA 2XGEA 4XRSG 2MG4A 1WH5A 1H8AC 1FIAA 3G1LA 1TWGJ 2RAEA 3BG5A 5EF6A 1IG7A 4JX6A 3A01B 3QQAA 2JJ7A 1TWFJ 2CUFA 2Y0SN 4AC0A 2FX0A 2DN0A 1R9TJ 2AO9A 3G1MA 4XICA 1AHDP 3BG9A 4A3GJ 4BKXA 1GV2A 3BR2A 3Q3SA 1BW5A 3HOZJ 4MFDA 1IC8A 2HXOA 4XIDA 3L1PA 3LSGA 3E7LA 4L5EA 1UHSA 2COBA 4M3FA 2H8RA 3S15J 4BXXJ 3S2DJ 3GTOJ 1MBGA 1JT0A 2X6OA 2XGDA 3B6AA 2DTZA 2PMZN 2LD5A 2ZB9A 2XPUA 1ZR2A 2YU9J 5GP9A 1GDTA 2LP0A 1RESA 1MSEC 1ZTRA 1XG1A 4JX4A 1ENHA 1U9NA 2EZLA 1HF0A 1ITYA 2M9HA 2DMQA 5F0FA 1MNMC 1OFCX 2FQ4A 2Y30A 3CCYA 1FTTA 1TWAJ 2G0EA 3HB9A 4HNVA 1LFBA 3GTPJ 2L7ZA 5FKKA 2K9QA 4A3IJ 2MW8A 3W6VA 3GTQJ 1G2HA 4DW6A 4IHVA 2GBYA 2LVSA 1U78A 3K2AA 1TWHJ 1RR7A 1X58A 2Y9YA 2L0KA 3I4NJ 4QTRA 2KDZA 5K7ZA 4RBOA 2TCTA 2MSYA 1BL0A 1I3QJ 2HXIA 1I50J 3HBLA 2WAQN 4MFEA 4DYQA 4V2GA 2CQXA 1VNDA 1MBKA 1NK3P 4XRSA 4JP0A 3HEFA 4BY1J 4DZPA 4UUSB 1NTCA 4XK4A 3A02A 5K7FA 2JA5J 2VKEA 3FKIJ 3HGYA 3LOCA 4M6VA 3JRHA 3MN2A 4A3BJ 5C4XJ 2ME0A 5HODA 1RPWA 3GTMJ 3VPRA 3G1OA 4MLOA 2XRLA 5EG0B 2VPRA 2R7ZJ 1JJ8C 1ETYA 3BR3A 2DA4A 2WV1A 1IJWC 1O4XA 1FIPA 1MBFA 2L7MP 4JYKA 1SFOJ 3RQIA 1WCMJ 1BW6A 5FLMJ 4FTHA 2LR8A 3S1MJ 1JKQC 1ETKA 1JTYA 1JUMA 1MH4A 2AHQA 3HGGA 4Y7NJ 4D5CA 3Q0UA 4D7NA 1BJZA 3WHBA 5M3MJ 1QPIA 1JT6A 1W0UA 5F0CA 1AKHB 3GTJJ 2OPTA 1QRYA 2LK2A 1JUPA 5IOYA 1DU0A 3BQYA 5M5YJ 2YUSA 5EGOB 5JLWA 3HOUJ 3D1NI 1B72A 5IP9J 2LKXA 2CJJA 5M5XJ 1IDYA 4IHWA 3FK6A 1FJLA 4A3DJ 3HKZN 4RDUA 4A3EJ 2DA3A 2LY9A 3HM5A 4DYRA 3HOWJ 2EH3A 3F0CA 3QPLA 2ID6A 5EZHA 3JRBA 1ETWA 3RZOJ 4GFBA 5FKOA 5EDNA 2W48A 1LE8B
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2DA7 A;  5EZG A;  2H1K A;  4D5F A;  2HOT A;  1ETV A;  1PUF A;  1ZK8 A;  3ZQG A;  3ZQI A;  3NAU A;  4DYC A;  1POG A;  5IYB J;  1B72 B;  1GUU A;  3FIW A;  3RKQ A;  4EEF G;  2X9D A;  2O7O A;  3FK7 A;  2NVY J;  1ZKG A;  2LFB A;  3BR1 A;  5DTD A;  2M2E A;  1HDD C;  1HLV A;  3LSJ A;  2VKV A;  2IEK A;  3O8H A;  1IGN A;  1F43 A;  1TWC J;  1OJL A;  4B4C A;  1T33 A;  1WI3 A;  1LFU P;  2R5Y A;  3JR9 A;  2ME6 A;  2O9L A;  4X6A J;  3FIS A;  3QPS A;  3HOX J;  5EYR A;  2JA8 J;  2HOA A;  3BR5 A;  1K61 A;  4A3C J;  1QVU A;  4B1R A;  5E3L A;  2M8G X;  1VI0 A;  1P7I A;  4M3E A;  2K9N A;  2DA2 A;  3TP3 A;  3H3V K;  2D5V A;  1W0T A;  3SFI A;  3S1Q J;  3M3Y J;  1I6H J;  3O8G A;  3IV5 A;  1T56 A;  5F27 A;  2JWT A;  4NDL A;  1IV6 A;  3TP0 A;  1UG2 A;  2QCO A;  1H89 C;  2DA1 A;  3HDD A;  5IP6 A;  1NK2 P;  3PM1 A;  1SAN A;  3S17 J;  1JTX A;  4UUT A;  4QSH A;  2M0C A;  2XGC A;  4MO7 A;  4A3J J;  2L7F P;  2E2I J;  4M3G A;  3LNQ A;  5EEA A;  3LSP A;  2LLK A;  1S7E A;  3BTJ A;  2O8K A;  3S1R J;  1P7J A;  4X1E A;  3GTK J;  2LTP A;  2L9R A;  1JKR C;  1WGX A;  3OIO A;  2GLO A;  5BNG A;  5E3M A;  2DMT A;  4I76 A;  3SJM A;  4V2F A;  4FE4 A;  2ECC A;  5IP7 J;  4I6Z A;  1ZQ3 P;  1HCR A;  2EBI A;  4BBR J;  2Y31 A;  3BTL A;  5IYC J;  1JGG A;  1AU7 A;  2NVX J;  2M34 A;  3BR0 A;  1B8I A;  2ID3 A;  4G12 A;  1MH3 A;  2NS7 A;  3Q0V A;  2XB5 A;  1APL C;  1ZGW A;  5GPC A;  3B6C A;  5J1U A;  2K9S A;  2R93 J;  1GV5 A;  2NOG A;  1XC5 A;  2N8G A;  1JKP C;  2WB1 N;  2ECB A;  4DZJ A;  4FCY A;  5J1Y A;  1IRZ A;  3BQZ A;  4CYC A;  5IYD J;  3A01 A;  3IH4 A;  1ETX A;  5J3L A;  1VF9 A;  2CU7 A;  4M3D A;  3BTI A;  3LSR A;  1VFC A;  2NVT J;  1XS9 A;  2HOS A;  3M4O J;  2Y2Z A;  3TW7 A;  1H88 C;  4W1U A;  3JRA A;  5DS9 A;  2R5Z A;  1DU6 A;  1ETQ A;  3S14 J;  1BA5 A;  4MIM A;  5IOZ A;  5F0H A;  3JRF A;  2GM4 A;  4QIW N;  5C44 J;  1D5Y A;  2X48 A;  5J1R A;  2EZK A;  4BY7 J;  3A03 A;  2DMP A;  1WH7 A;  1CQT A;  5M5W J;  4S0H B;  4CYC B;  3BTC A;  5E3N A;  3SDG A;  1EF4 A;  3GBG A;  1Y1W J;  2JA6 J;  4IHX A;  1ETO A;  3C2B A;  1F36 A;  4M3B A;  3OOU A;  4Y52 J;  3NAR A;  4IHY A;  2ELK A;  2CRG A;  2IAI A;  1MBE A;  5C3E J;  3UKG A;  2B63 J;  4C3H J;  2R5Z B;  2EZH A;  3ZQF A;  1WPK A;  3IH2 A;  2VUM J;  3BT9 A;  2DA5 A;  3WHC A;  5IPA A;  4JX5 A;  2MGQ A;  1X2M A;  4FE7 A;  5JLX A;  2VI6 A;  1MSF C;  4IEJ A;  4A3F J;  5FKL A;  5FJ8 J;  2E2J J;  1TC3 C;  1PUF B;  3ZQH A;  5F08 A;  3JRI A;  2HI3 A;  1E3O C;  4D7M A;  4A3L J;  3MVP A;  1RKW A;  3JRE A;  3PO2 J;  1MBJ A;  3S1N J;  1GVD A;  2DA6 A;  3RZD J;  3CQZ J;  3HOY J;  3BR6 A;  3GTL J;  2XB0 X;  3JRC A;  4C3I J;  5FKN A;  4A3M J;  2XPV A;  1GT0 C;  2I10 A;  3MKL A;  1IDZ A;  2R5Y B;  1Y1V J;  1ORK A;  1HOM A;  2EQR A;  5GPA A;  5E3O A;  2P81 A;  4B3A A;  3JRG A;  3I4M J;  2E19 A;  3OSF A;  3TED A;  2NS8 A;  3ZOB A;  4UUS A;  3K7A J;  4AUX A;  3JRD A;  1JUS A;  3CMY A;  3PO3 J;  4FIS A;  2JA7 J;  2OF7 A;  3DCF A;  2JK3 A;  5FKM A;  4J19 A;  2NVQ J;  2CUE A;  5EG0 A;  3S2H J;  2TRT A;  4C2M J;  3IH3 A;  1RET A;  2E1O A;  3ZQC A;  1RKT A;  2DMN A;  1U8B A;  1A5J A;  1FTZ A;  2DJN A;  2HQ5 A;  1QVT A;  2XSD C;  4A93 J;  2KT0 A;  2FJ1 A;  3OSG A;  2E2H J;  1OCP A;  1AKH A;  1OCT C;  2FD5 A;  4A69 C;  3ZQL A;  1MBH A;  1X2N A;  2R92 J;  3GTG J;  2YS9 A;  1HDP A;  3HOV J;  3Q0W A;  3TW6 A;  5EGO A;  1JJ6 C;  1YRN A;  1A6I A;  3S16 J;  3CDL A;  1Z0X A;  1JKO C;  2HDD A;  4ABZ A;  2IBD A;  1IUF A;  9ANT A;  4BBS J;  5C4J J;  4XRM A;  4C3J J;  3H0G J;  2R0Q C;  2DMU A;  3DEW A;  5K7H A;  1Q1V A;  2XPW A;  1U9O A;  4AYB N;  4W97 A;  1ZR4 A;  1B8I B;  1Z77 A;  2CQQ A;  2HYJ A;  1LE8 A;  2EZI A;  2JMW A;  5F04 A;  1FEX A;  2K40 A;  4LOC A;  2QF7 A;  5FLV A;  1K83 J;  2JN6 A;  3BG3 A;  4A3K J;  5M3F J;  1YRN B;  2Y9Z A;  1UMQ A;  5F1J A;  2XGE A;  4XRS G;  2MG4 A;  1WH5 A;  1H8A C;  1FIA A;  3G1L A;  1TWG J;  2RAE A;  3BG5 A;  5EF6 A;  1IG7 A;  4JX6 A;  3A01 B;  3QQA A;  2JJ7 A;  1TWF J;  2CUF A;  2Y0S N;  4AC0 A;  2FX0 A;  2DN0 A;  1R9T J;  2AO9 A;  3G1M A;  4XIC A;  1AHD P;  3BG9 A;  4A3G J;  4BKX A;  1GV2 A;  3BR2 A;  3Q3S A;  1BW5 A;  3HOZ J;  4MFD A;  1IC8 A;  2HXO A;  4XID A;  3L1P A;  3LSG A;  3E7L A;  4L5E A;  1UHS A;  2COB A;  4M3F A;  2H8R A;  3S15 J;  4BXX J;  3S2D J;  3GTO J;  1MBG A;  1JT0 A;  2X6O A;  2XGD A;  3B6A A;  2DTZ A;  2PMZ N;  2LD5 A;  2ZB9 A;  2XPU A;  1ZR2 A;  2YU9 J;  5GP9 A;  1GDT A;  2LP0 A;  1RES A;  1MSE C;  1ZTR A;  1XG1 A;  4JX4 A;  1ENH A;  1U9N A;  2EZL A;  1HF0 A;  1ITY A;  2M9H A;  2DMQ A;  5F0F A;  1MNM C;  1OFC X;  2FQ4 A;  2Y30 A;  3CCY A;  1FTT A;  1TWA J;  2G0E A;  3HB9 A;  4HNV A;  1LFB A;  3GTP J;  2L7Z A;  5FKK A;  2K9Q A;  4A3I J;  2MW8 A;  3W6V A;  3GTQ J;  1G2H A;  4DW6 A;  4IHV A;  2GBY A;  2LVS A;  1U78 A;  3K2A A;  1TWH J;  1RR7 A;  1X58 A;  2Y9Y A;  2L0K A;  3I4N J;  4QTR A;  2KDZ A;  5K7Z A;  4RBO A;  2TCT A;  2MSY A;  1BL0 A;  1I3Q J;  2HXI A;  1I50 J;  3HBL A;  2WAQ N;  4MFE A;  4DYQ A;  4V2G A;  2CQX A;  1VND A;  1MBK A;  1NK3 P;  4XRS A;  4JP0 A;  3HEF A;  4BY1 J;  4DZP A;  4UUS B;  1NTC A;  4XK4 A;  3A02 A;  5K7F A;  2JA5 J;  2VKE A;  3FKI J;  3HGY A;  3LOC A;  4M6V A;  3JRH A;  3MN2 A;  4A3B J;  5C4X J;  2ME0 A;  5HOD A;  1RPW A;  3GTM J;  3VPR A;  3G1O A;  4MLO A;  2XRL A;  5EG0 B;  2VPR A;  2R7Z J;  1JJ8 C;  1ETY A;  3BR3 A;  2DA4 A;  2WV1 A;  1IJW C;  1O4X A;  1FIP A;  1MBF A;  2L7M P;  4JYK A;  1SFO J;  3RQI A;  1WCM J;  1BW6 A;  5FLM J;  4FTH A;  2LR8 A;  3S1M J;  1JKQ C;  1ETK A;  1JTY A;  1JUM A;  1MH4 A;  2AHQ A;  3HGG A;  4Y7N J;  4D5C A;  3Q0U A;  4D7N A;  1BJZ A;  3WHB A;  5M3M J;  1QPI A;  1JT6 A;  1W0U A;  5F0C A;  1AKH B;  3GTJ J;  2OPT A;  1QRY A;  2LK2 A;  1JUP A;  5IOY A;  1DU0 A;  3BQY A;  5M5Y J;  2YUS A;  5EGO B;  5JLW A;  3HOU J;  3D1N I;  1B72 A;  5IP9 J;  2LKX A;  2CJJ A;  5M5X J;  1IDY A;  4IHW A;  3FK6 A;  1FJL A;  4A3D J;  3HKZ N;  4RDU A;  4A3E J;  2DA3 A;  2LY9 A;  3HM5 A;  4DYR A;  3HOW J;  2EH3 A;  3F0C A;  3QPL A;  2ID6 A;  5EZH A;  3JRB A;  1ETW A;  3RZO J;  4GFB A;  5FKO A;  5EDN A;  2W48 A;  1LE8 B; 
#chains in the Genus database with same CATH topology
 1YQA A;  1RRJ A;  2OZU A;  1PUF A;  3PUB A;  4EMS A;  4BE1 A;  4IHT A;  5TGT A;  4F7Z A;  2IGO A;  3EQL F;  5IYB J;  3FIW A;  4CHU A;  3QU3 A;  2O7O A;  2NVY J;  3JTG A;  3BR1 A;  4QLC U;  5H6R A;  2DT5 A;  3BCB A;  2NAZ A;  5J8C A;  2LNB A;  2ELJ A;  2IEK A;  4KT6 A;  2Y0M A;  1OJL A;  2XVC A;  3KLN A;  4B4C A;  3MQ0 A;  4A12 A;  3CUQ A;  2LG4 A;  4PJ0 C;  2BZT A;  3DTE A;  3JR9 A;  4OMZ A;  1P4A A;  2EA4 A;  1VQP I;  1LNW A;  2GZW A;  3QPS A;  5HVQ C;  3CUO A;  3LA3 A;  1ONV A;  4B09 A;  3H9J A;  1ZG5 A;  3ERM A;  4U0V A;  5EEH A;  4B1R A;  4DGW B;  4ZYG A;  4AU7 A;  3AG2 H;  1VI0 A;  2X51 A;  1MNE A;  1VQ8 I;  2DA2 A;  2IS6 A;  1IW7 F;  3CES A;  4G6T B;  4P9F A;  1E17 A;  3CP2 A;  2HVS A;  2HR3 A;  1IN5 A;  1T39 A;  3S1Q J;  4BQO A;  4A0X A;  2PMH A;  4YIR X;  2ZXJ A;  1BOB A;  3KZI C;  3O8G A;  2VBX A;  2XDV A;  1T56 A;  5FB2 A;  1IV6 A;  4A0Y A;  2QCO A;  1OMI A;  2Z3Y A;  4HF1 A;  3HDD A;  5IP6 A;  4I02 A;  2D45 A;  3S17 J;  2XRO A;  4LB5 A;  1R4N B;  3ZQ7 A;  1WWX A;  3K4J A;  3L2V A;  2L7F P;  2E2I J;  3LNQ A;  5EEA A;  3BTJ A;  5CVR A;  2HPM A;  3RKY A;  4E70 A;  2OTJ I;  4BU2 A;  4LIT A;  5HNF A;  4I76 A;  3C18 A;  4V2F A;  3R4K A;  4FE4 A;  2L4M A;  1UHW A;  3HOS A;  1DP7 P;  1JXS A;  3R60 A;  2WAE A;  3S8P A;  4OIP F;  3LA7 A;  4G94 A;  2Y31 A;  3BTL A;  3EUK L;  2ZSI B;  2NVX J;  2ZBK A;  2M7B A;  3BR0 A;  4KDP A;  4BQQ A;  3PIP F;  3I56 I;  2DQR A;  1B8I A;  2IS2 A;  1WHU A;  2E5N A;  4RLF A;  3A2K A;  3WTZ A;  1M1E B;  2NS7 A;  3IAM 2;  3G2B A;  4L5I A;  4F91 B;  1HW2 A;  1GV5 A;  5JI6 A;  2W57 A;  4L5J A;  1XC5 A;  4HX4 A;  1IAW A;  1U5T A;  4P1W A;  2ECB A;  3KCC A;  2CH0 A;  4FCY A;  5J1Y A;  3C3W A;  1IRZ A;  1FY7 A;  5IYD J;  3CJR B;  2NYX A;  2ZJP F;  3ABK H;  2ZNZ A;  2LKS A;  3ECH A;  5H2F C;  1LQ1 A;  2MD5 A;  4G6D A;  3OV8 A;  3C2H A;  2XRN A;  1VQN I;  3WU1 B;  2CU7 A;  1SD5 A;  2YSR A;  3IHU A;  4M3D A;  3LSR A;  1VFC A;  2AXT C;  2FEZ A;  5HOO A;  3K10 A;  3TW7 A;  3OIP A;  3BY6 A;  3ZMU A;  4DBR A;  2QQ9 A;  4CYD A;  3F6V A;  2OV7 A;  1X1C A;  4ZZL A;  1RI7 A;  3JW4 A;  3BJA A;  5J6X A;  3JRF A;  2LF8 A;  4MGR A;  3CCS I;  2GM4 A;  2UWM A;  3ZRG A;  5J1R A;  3GZ6 A;  3HG9 A;  4XON A;  4E7I A;  3RPQ A;  1EKE A;  3I0T A;  3TL4 X;  5J4V A;  3WTU C;  1MIJ A;  4XL9 A;  4PDK A;  2M4K A;  1Z3X A;  2DK8 A;  3C2B A;  2A68 F;  3R0A A;  1DGR M;  4M3B A;  1WJA A;  3OOU A;  1WJ5 A;  3U2R A;  3HXL A;  3X2Q H;  1YLF A;  2OAZ A;  2CRG A;  2IAI A;  3UKG A;  2B63 J;  2WA0 A;  3W2V A;  3OS1 A;  3AL0 C;  4CO8 A;  3SZP A;  2CSO A;  1WPK A;  1OLT A;  3KP5 A;  3ZMZ A;  1MKM A;  4JX5 A;  2MGQ A;  1MSF C;  4EJV A;  5FRN A;  4A3F J;  3OYA A;  1PUE E;  2E2J J;  1TC3 C;  3ZQH A;  5J47 A;  5F08 A;  1OR7 C;  4D7M A;  1ZRD A;  5B5E C;  1BN5 A;  1EH6 A;  2OA4 A;  1B4A A;  5K5O A;  1MBJ A;  3H5N A;  1MGT A;  5GTI C;  5E18 F;  4I7H A;  5CKT A;  1GVD A;  3R6S A;  3CQZ J;  3VYU B;  3V42 A;  3MEX A;  2JPB A;  2GIZ A;  2KIS A;  1R4M B;  2K9L A;  2VXZ A;  5FKN A;  3M9A A;  4XLN F;  1ZG1 A;  4BH9 A;  1GT0 C;  4C2T A;  2HQN A;  4CIC A;  1FPQ A;  4BHP A;  3PNV A;  2Q8K A;  3LQQ A;  4NQW A;  2E1M B;  3ZPL A;  4BGD A;  4B3A A;  3KP4 A;  5E3O A;  3QOD A;  3JRG A;  2XAF A;  4ZZD A;  1HKT A;  2NS8 A;  2EWN A;  1YHQ I;  3ZOB A;  3J80 K;  2FXA A;  3K7A J;  1HQC A;  1A31 A;  1SVL A;  4LG3 A;  4CCK A;  2Q0O A;  1UZC A;  3DKW A;  3PO3 J;  1A6Q A;  2JA7 J;  4ESJ A;  4PSX A;  5EG0 A;  3S2H J;  4C2M J;  2ZO4 A;  3M8F A;  2KFD A;  4XBF A;  4ON0 A;  3ULQ B;  5CJ9 A;  3HIF A;  1RKT A;  1G3Y A;  2KIQ A;  5CLS A;  4LIU A;  1W7P A;  1C0W A;  1U8B A;  2ZME B;  5ILV A;  3HHG A;  2VB6 A;  3GLX A;  2CQN A;  5LRR A;  3J80 Z;  3WTY C;  4D9J A;  1LDD A;  2FJ1 A;  2OZ6 A;  1OCP A;  2DXI A;  1R5G A;  2M3A A;  4M6Y A;  1T98 A;  3QOE A;  3PJR A;  4A69 C;  1MBH A;  3GTG J;  3GEZ A;  3Q0W A;  4OIN F;  2MH9 A;  5H20 A;  3SEZ A;  5EGO A;  2DJI A;  2YR2 A;  4CZC A;  4XM3 A;  1B1B A;  2M30 A;  2VC1 A;  3CDL A;  3S16 J;  2GAU A;  1ULY A;  2LH9 A;  2IBD A;  1ZHF A;  5C4J J;  3HTS B;  4C3J J;  3OYC A;  3H0G J;  2DMU A;  4XLP F;  1RUN A;  3CD6 I;  4RAF A;  4ENN A;  4HBL A;  1LPQ A;  2Y0S A;  3A1Y A;  3H0D A;  1X3Z B;  2ZJR F;  2CQQ A;  5HNH A;  2HYJ A;  3TGN A;  3OS0 A;  3P9C A;  5F04 A;  4BYY A;  1CF7 A;  3E0J B;  1HKQ A;  2FOW A;  2QLZ A;  2BVL A;  1R23 A;  4RS8 A;  3W3C A;  3KZZ A;  5F1J A;  3GLL A;  3I3L A;  1OQY A;  4HNU A;  1X1P A;  3K4K A;  3B73 A;  2RAE A;  4L0Y B;  2F5V A;  3RSN A;  1TWF J;  3B02 A;  4XSX F;  4U88 A;  3ABM H;  2Y0S N;  3KP6 A;  1TNS A;  2JUG A;  3OOP A;  3Q5F A;  2DN0 A;  1HST A;  1NG7 A;  2VBY A;  1FMV A;  4WF2 A;  4XIC A;  3EET A;  3OR1 C;  3KPH A;  4XKC A;  3CC7 I;  4LIV A;  3WU0 A;  3F6O A;  5HLH A;  1FNN A;  2C6Y A;  3FM5 A;  1HA8 A;  4QWQ A;  5JVG F;  2QKM B;  2VIX A;  3E7L A;  2KZV A;  3J81 K;  1UHS A;  4RGR A;  2K9M A;  4ZYA A;  3W6J B;  4RGS A;  3S2D J;  4EGZ A;  3GTO J;  1MBG A;  3I5U A;  1UST A;  3UR3 C;  4ESB A;  2X6O A;  1D1B A;  4NHJ A;  3DPU A;  2PJR B;  1WI9 A;  3F3X A;  1VQO I;  5GP9 A;  4HDU A;  1GDT A;  2LP0 A;  1L3L A;  1SD6 A;  1RES A;  3BP8 A;  4HX7 A;  1ZGJ A;  3W6K B;  5ICC A;  1XG1 A;  4JX4 A;  1U9N A;  5HLI A;  4CGZ A;  2DMQ A;  2OC6 A;  5HLG A;  3E5U A;  2FQ4 A;  2VPL A;  3CCY A;  1FTT A;  3J81 Z;  2DK5 A;  1TW2 A;  3ABT A;  3EDP A;  2ZXH A;  1QA6 A;  3ZGK A;  5L3B A;  5K5Q A;  3RDI A;  4Q47 A;  3U21 A;  3BC8 A;  3GTQ J;  3HSR A;  5LEJ A;  1E3H A;  2XKP A;  2DW4 A;  4CSW A;  5H6Q A;  2JT1 A;  2RN7 A;  3WTS C;  2L0K A;  1KYZ A;  2CQK A;  4QTR A;  2X4H A;  1VTN C;  1KQ8 A;  3GYH X;  1I3Q J;  4BDY A;  4MFE A;  1FYM A;  1WQ2 A;  3J7Y J;  4N0B A;  5DD8 A;  1KU7 A;  1FSH A;  5ICE A;  4XKV A;  2XSJ C;  3QYE A;  4PSW A;  3HEF A;  4UUS B;  3KFW X;  2VLA A;  2DPD A;  2PI0 A;  4GYG A;  5HDG A;  2M87 A;  1T08 B;  3LOC A;  3JRH A;  3MN2 A;  4A3B J;  2CS3 A;  2ME0 A;  2BY0 A;  4U7B A;  1RPW A;  1PDN C;  2P6T A;  3HPG A;  1K6Y A;  2GOM A;  5D5U B;  1OCC H;  3EYY A;  2DA4 A;  1IJW C;  2OTL I;  2W00 A;  5J4Y A;  4BUP A;  4N4N B;  2V9V A;  2W4S A;  1G3W A;  2GA1 A;  3E6B A;  3BRO A;  3CDI A;  2LR8 A;  3P5J A;  3MMY B;  3H5R A;  3V4G A;  1JKQ C;  1ETK A;  5D4R A;  2L4A A;  1JUM A;  1MH4 A;  4N9I A;  4Y7N J;  4D5C A;  5M3M J;  3JTH A;  1T0F C;  1QPI A;  4OOI A;  5F0C A;  1AKH B;  2PMU A;  2ZJQ F;  3NEU A;  3K4M A;  2VOO A;  1R6R A;  2P6S A;  3H9G A;  3OYH A;  2O61 A;  4YII A;  3RKX A;  2RKH A;  5FLX K;  1FMW A;  1QU3 A;  5IP9 J;  1T95 A;  2X1C A;  3LAJ A;  2Z1D A;  3IC7 A;  4RM3 A;  5KNL A;  3HJE A;  4RDU A;  2HDW A;  3D0S A;  3UNG C;  3PFY A;  1BI1 A;  3BDD A;  4O5V A;  4DYR A;  3HOW J;  5L3C A;  1J2X A;  3L2C A;  4L18 B;  3DKX A;  5E17 F;  2ID6 A;  1W7P D;  5LGT A;  2LYC A;  2H27 A;  2VC0 A;  5FKO A;  1I39 A;  2W48 A;  4UB6 C;  2HDC A;  2DA7 A;  1E0E A;  3SZT A;  2PG4 A;  5FLX Z;  2V9P A;  1U0J A;  2WY7 Q;  4ITV A;  1ZK8 A;  1MDM B;  4PGH A;  3NAU A;  1POG A;  1PYV A;  2XHK A;  1SD7 A;  3MCZ A;  4YFN F;  1SVO A;  3OYL A;  4EEF G;  4FET A;  4ZYD A;  4H4K C;  3FK7 A;  1ZKG A;  3EUH A;  1HLV A;  1P2F A;  3LSJ A;  3O8H A;  1ON1 A;  1TWC J;  2MC3 A;  2HTJ A;  3WG9 A;  2LDU A;  1T33 A;  1WI3 A;  1LFU P;  2W1O A;  4RB1 A;  3H3U A;  1MMA A;  2WV0 A;  1D1C A;  1FOY A;  2XF5 A;  1VQ5 I;  3CCQ I;  5LHI A;  1W36 D;  2EV6 A;  1K61 A;  2VT2 A;  4ZJZ A;  2WC2 A;  2HQR A;  5FO5 A;  3TP3 A;  2FNP A;  2V1U A;  2E60 A;  1W0T A;  1ZAO A;  1OCO H;  2DYS H;  3VSL A;  3O6B B;  4ANJ A;  4HV5 A;  3L2R A;  5F27 A;  2JWT A;  5LD2 C;  1S72 I;  3CC4 I;  3TP0 A;  2QUF A;  3F8B A;  1P9Q C;  1LVA A;  1J7K A;  3E5X A;  1SAN A;  3HUG A;  4CH7 A;  4IHS A;  2Z9O A;  1MND A;  2QQA A;  1BI0 A;  3DF8 A;  4MO7 A;  4A3J J;  4HG2 A;  2V9K A;  3PUF A;  4CCO A;  4M3G A;  4PZJ A;  2QWW A;  1S7E A;  2L01 A;  1G4D A;  5DV5 A;  2O8K A;  3GUD A;  6PAX A;  4U0Y A;  1IRG A;  4IVN A;  4X1E A;  3GTK J;  2VBZ A;  4L9T A;  3E3V A;  1JKR C;  2X85 A;  2FMY A;  2DTR A;  1WGX A;  5E3M A;  3K4N A;  2DMT A;  3FHN A;  1Z9C A;  2IA2 A;  1B59 A;  5IP7 J;  1H0M A;  4I6Z A;  2P5L C;  3HOT A;  5E8I A;  1YYV A;  4BBR J;  4EVI A;  5IYC J;  1MJB A;  1JGG A;  2VOD A;  2OQR A;  1YIT I;  1DPR A;  5DCM B;  5HS8 A;  4ASN A;  5D8K B;  3QOP A;  3L2U A;  2LC2 A;  3ZMT A;  1P4X A;  1LUJ B;  2WY8 Q;  1IN8 A;  2O3F A;  4G12 A;  4JBA A;  3BLY A;  3Q0V A;  2XB5 A;  3QPT A;  3E6M A;  3H1C A;  1ZGW A;  1RIO H;  3VYS B;  3W2A A;  1R7J A;  3PFI A;  1JKP C;  1O57 A;  3J7A O;  3F8N A;  3G3Z A;  2WB1 N;  3J7Z I;  3T5X A;  4LD5 A;  2P0W A;  1OCR H;  3BQZ A;  2JSC A;  2KL4 A;  2OCE A;  3ABL H;  2HTS A;  3U9G A;  2QBY B;  4CCL A;  2DPU A;  3IH4 A;  3KEQ A;  1ETX A;  1RR8 C;  3RTR A;  2WTE A;  5AIQ A;  3CCR I;  4XR6 A;  1J75 A;  3BTI A;  2JPC A;  4HRI A;  2HOS A;  3M4O J;  1H88 C;  4W1U A;  3HRU A;  2OBP A;  5IOZ A;  3I55 I;  3FXR A;  5KAF C;  4QIW N;  2PFB A;  2E1M C;  4ZTF A;  2EZK A;  4BY7 J;  3A03 A;  2JA2 A;  3BZK A;  1HW1 A;  5M5W J;  3OYM A;  5E3N A;  1CGP A;  3IWZ A;  4JQF A;  4NC8 A;  2R7S A;  1D3Y A;  4YIF A;  3RPU D;  2DYR H;  5JVT A;  1BM9 A;  3FHZ A;  4XKB A;  4M74 A;  1XN7 A;  1GLN A;  3CF5 F;  3NAR A;  4IHY A;  5ED4 A;  2W84 A;  5CQE A;  4Q4Z F;  3OY9 A;  4G9Y A;  2VUM J;  3D5L A;  3BT9 A;  1VQ7 I;  2VJ5 A;  4II2 A;  4NNJ A;  1WVR A;  3BZ6 A;  2ZME C;  1HKS A;  2RV8 A;  2VI6 A;  2DFE A;  4IEJ A;  5FJ8 J;  2FBI A;  1PUF B;  4PJL A;  1Z7U A;  5JHF A;  2HI3 A;  1E3O C;  1Z21 A;  2QQB A;  1RKW A;  5HLT A;  4JOM A;  1S6L A;  3FXK A;  2OUM A;  1XSV A;  5LHG A;  3K1M A;  3R0J A;  2DFI A;  5E1W A;  3GWZ A;  5D6E A;  3BR6 A;  2EFO A;  2OQG A;  3BPX A;  4U87 A;  4UHT A;  3JRC A;  3LST A;  3GCM A;  3V8L A;  1REP C;  4LLN A;  2UXX A;  1P92 A;  2XPV A;  2I10 A;  3CUQ B;  1Y1V J;  3W2W A;  2P81 A;  2W25 A;  4FX0 A;  3A4C A;  2E19 A;  1D1A A;  2ISZ A;  2XC7 A;  4XLC A;  4NB5 A;  1Y8Q B;  1TLH B;  4BAC A;  2HZD A;  3JRD A;  1MMS A;  4E4H A;  3VYT B;  3CMY A;  1ZLK A;  3K69 A;  2RGV A;  1JHF A;  1QGP A;  3DCF A;  1Y39 A;  2E1N A;  1N25 A;  3P9K A;  1JI8 A;  1SFU A;  1BOA A;  1RET A;  3C1D A;  4ZYH A;  2V1D A;  1KU2 A;  2XAQ A;  1RUO A;  2V79 A;  4EM0 B;  1U3E M;  1S29 A;  3AAF A;  4CCJ A;  4LG0 A;  2EPF A;  2DT6 A;  3DEU A;  3RJP A;  4NC7 A;  5GAD J;  2V26 A;  2BXY A;  2HQ5 A;  1QVT A;  3TKY A;  2XSD C;  2DI3 A;  3K70 C;  4A93 J;  4ZTJ A;  4AYB A;  2M1B A;  3FXU A;  4LLL A;  2FD5 A;  2R7T A;  3SXY A;  3ZQL A;  3CF2 A;  2R92 J;  4UXN A;  1JGS A;  3MWM A;  1MMN A;  1YRN A;  2LBF A;  1JKO C;  1QHH D;  1L0O C;  4ABZ A;  4BBS J;  4LMY A;  2R0Q C;  4MEY F;  1R1U A;  3JSO A;  2B0L A;  2IXS A;  1J59 A;  1Q1V A;  2XPW A;  4AYB N;  3PIO F;  1ZR4 A;  1B8I B;  1ZRC A;  3T1B A;  2QGU A;  2XAG A;  2EZI A;  2UXN A;  2FE3 A;  2JMW A;  3CO6 C;  3T8R A;  3OYK A;  3ZR8 X;  2QF7 A;  4YFK F;  2QYO A;  2I5U A;  5LLQ A;  1S3J A;  2PLY A;  2OU2 A;  5K1Y A;  2Z99 A;  4Y3O A;  3J7A Y;  1YRN B;  2VAS A;  2DOD A;  1QZE A;  1Z1D A;  1U5T B;  3TO6 A;  1UMQ A;  2MBF A;  4RGU A;  3PL8 A;  3GXO A;  1YX5 A;  1ZYR F;  3QU6 A;  4XRS G;  2L3D A;  2TDX A;  1WH5 A;  1H8A C;  2RNG A;  1OKR A;  3N97 A;  1TWG J;  4GYI A;  2QQ8 A;  2JJ7 A;  2X1E A;  2CUF A;  2IRF G;  5D6F A;  4F52 A;  1ZN2 A;  2EB7 A;  3L9F A;  4IL6 C;  4AC0 A;  1IUY A;  5BPI A;  2MLG A;  4B47 A;  1KON A;  3GX4 X;  3CCM I;  1AHD P;  3TO7 A;  2NVU B;  4RLQ A;  1GV2 A;  2KKO A;  3BR2 A;  4BNC A;  2L02 A;  2M4G A;  3HOZ J;  3OL3 A;  4M6X A;  1R1T A;  1YFH A;  1BR2 A;  2PX9 A;  2VOP A;  4PGG A;  4L5E A;  1FBS A;  3ML6 A;  2H8R A;  4MEX F;  3A0B C;  5CVJ A;  4XLA A;  3G6E I;  5AON A;  1RNL A;  2MC4 A;  3B6A A;  3OYF A;  2ICW G;  1WFX A;  1ZR2 A;  2IGK A;  1HC8 A;  3ECO A;  1DUX C;  2FF4 A;  1ZTR A;  3HHH A;  3K1N A;  1ENH A;  4HSR A;  3P9I A;  4P55 A;  3ROU A;  1E2X A;  2EZL A;  2K86 A;  1ITY A;  2Y48 A;  1MNM C;  3QPH A;  2QSF X;  5DM7 F;  1Q1H A;  2WAQ A;  4WCG A;  1D0Y A;  2BVM A;  3ZP5 A;  3QP5 A;  4MNU A;  4XN3 A;  3G73 A;  3VWB A;  4IZZ A;  4HNV A;  4BHB A;  1ZRF A;  2GXB A;  2BHZ A;  2DFF A;  1EH8 A;  2JRT A;  2L7Z A;  2QEN A;  5FKK A;  2CUJ A;  4M71 A;  3ABU A;  3W6V A;  3MAJ A;  2EIM H;  2E5Z A;  4N4O B;  4ZDO A;  3E1S A;  3LFK A;  3FF5 A;  1IF1 A;  2RDP A;  5DYM A;  4RB2 C;  1VZ0 A;  4IHV A;  4Q5S F;  2YPR A;  1RR7 A;  2VKH A;  3ZXS A;  3O2P E;  1W5S A;  4RBO A;  2CGP A;  4FHT A;  3IKV A;  2V7F A;  1I50 J;  4HX8 A;  2WAQ N;  4KYW A;  3KP3 A;  2BBY A;  3I58 A;  4NQW B;  4HLX A;  3I53 A;  4XRS A;  3G4S I;  1XPX A;  1YW9 A;  2ZCW A;  1FOW A;  2HGC A;  1Z05 A;  3DBH B;  4RAY A;  2VN2 A;  4RGX A;  4XK4 A;  2Y75 A;  3A02 A;  1XB4 A;  1FP1 D;  4UV9 A;  2BXZ A;  2R7U A;  2QKL B;  3VPR A;  3G1O A;  2BY2 A;  2LMD A;  1FYL A;  3F8C A;  4OIQ F;  2P5K A;  2V4J C;  5EG0 B;  2CV1 A;  3VOD A;  1QO0 D;  2M8E A;  2WV1 A;  4PJM A;  1Z7L A;  1O4X A;  1FIP A;  2H09 A;  3M8E A;  4XN0 A;  3K4C A;  1FWZ A;  1W7P B;  2G9W A;  1MJA A;  4IO9 F;  1SFO J;  3RQI A;  3WGG A;  4KIS A;  1KU9 A;  3OL4 A;  1BW6 A;  5FLM J;  1YJ9 I;  1LEA A;  2K4B A;  2KIF A;  3S1M J;  4BXF A;  4G7H F;  4D7N A;  2BV6 A;  3T0Y A;  4IQJ A;  2X6W A;  1JT6 A;  3KYC B;  3TOB A;  1R1V A;  3GTJ J;  2OPT A;  1UEL B;  2MYS A;  5IOY A;  1DU0 A;  5ILS A;  3BQY A;  4B48 A;  4AWX B;  1IXC A;  2M7A A;  5M5Y J;  2O6G E;  5EGO B;  1MD0 A;  3HOU J;  4FX4 A;  1TL8 A;  2GOX B;  2LKX A;  1I5Z A;  1R00 A;  2CJJ A;  1IDY A;  3K4L A;  2WWY A;  4C2U A;  2E36 A;  2FML A;  4A3D J;  2BY3 A;  4AIJ A;  3CO7 C;  4WWC A;  2JVG A;  1T2K A;  1IO2 A;  1NHA A;  2DA3 A;  2LY9 A;  3F9K A;  3HM5 A;  4M72 A;  5D4S A;  2EH3 A;  4JK1 X;  2GIV A;  3KIO A;  2JQ7 A;  4O3M A;  2EK5 A;  3ZMS A;  4PK4 A;  5FD5 A;  3EYI A;  3JRB A;  2F4M B;  2R7Q A;  4KN4 X;  2VQG A;  4BQA A;  3RZO J;  5CVV A;  1HDD C;  2A6T A;  2FBH A;  5EZG A;  2H1K A;  2H8W A;  1CF7 B;  1KYW A;  4YEL A;  2KJB A;  3ZQG A;  2IGN A;  2M45 A;  4DYC A;  1OCZ H;  3DPL C;  3HC7 A;  3TQN A;  2X9D A;  3CJN A;  1VQK I;  4GGG A;  3TO9 A;  2DU9 A;  4PFP A;  2R7O A;  1BI2 A;  2AXL A;  4O6J A;  3R61 A;  4DIQ A;  1WZ2 A;  4ZC3 A;  2WAF A;  5J8F A;  1F43 A;  3GW2 A;  1IGN A;  3SDB A;  5KAI C;  3PNY A;  1Z6R A;  3GO5 A;  2R5Y A;  3OYI A;  1Y8R B;  3VFZ A;  4I0B A;  5EEG A;  2ME6 A;  2O9L A;  3FIS A;  4B44 A;  3HOX J;  2JA8 J;  2EJR A;  1U6G A;  4L9V A;  1QNT A;  3BR5 A;  1Z67 A;  3DU5 A;  4XOT A;  1QVU A;  4EJO A;  4A3C J;  5E3L A;  1FX7 A;  5FD6 A;  1P7I A;  4IJA A;  3ZN1 A;  2K9N A;  1R22 A;  3LAP A;  4RAG A;  4G8X A;  1FBU A;  2D5V A;  2FRH A;  5GAE J;  3SFI A;  1JE8 A;  3M3Y J;  2DOF A;  5LFA A;  1IRX A;  1SFE A;  2EFW A;  2F5D A;  4BJ6 C;  3N05 A;  1TQI A;  2DCE A;  3IV5 A;  1SAU A;  2GA2 A;  2V6C A;  3T8T A;  3IKT A;  5IT9 K;  2PJP A;  1S5L C;  3OR2 C;  2DA1 A;  2QA4 I;  4TV7 A;  4U7D A;  3I59 A;  2R7W A;  3PM1 A;  3LQR A;  2LSO A;  1JTX A;  1KQ0 A;  5DUK A;  4Z2Y A;  2ADU A;  3V7S A;  2M0C A;  1OR7 A;  2YX4 A;  2KP6 A;  2XGC A;  4HOB A;  3FXO A;  3NWS A;  3L7W A;  1YE9 A;  4F93 B;  3LSP A;  3CCL I;  1YS7 A;  3WGI A;  3MKW B;  4A5N A;  3VB2 A;  1P7J A;  1ZLJ A;  1FC3 A;  2H94 A;  2LRD A;  3RQ4 A;  5DEQ A;  2KLO A;  2R7D A;  4RA2 A;  4YG2 F;  2L9N A;  1Z91 A;  3OIO A;  4HEA 2;  2GLO A;  5IT9 Z;  2KHM A;  1RC9 A;  3RPU A;  1PJR A;  4F3Q A;  3F8F A;  1ZQ3 P;  1HCR A;  2A5Y B;  1XSX A;  2EBI A;  3N4M A;  2D2W A;  1XDU A;  5FFZ A;  4F92 B;  4I2O A;  5CPR B;  4HNT A;  2M34 A;  3MZ8 A;  2ID3 A;  3PQK A;  3EUA A;  2KMU A;  3FXJ A;  4M9X A;  1FYK A;  2ESN A;  4RMN A;  5GPC A;  5DD4 A;  3B6C A;  2OJE D;  3IP4 B;  3MD2 A;  5J1U A;  2PBI A;  2R93 J;  2NOG A;  3L2Q A;  1NG6 A;  1X3W B;  2OCC H;  1UAA A;  3CLO A;  2HS5 A;  3BPV A;  1W1W E;  2F5F A;  3I9V 2;  2GWR A;  4P5O A;  2BOL A;  3AG3 H;  1QBJ A;  4L0Z B;  2JUC A;  4XLH A;  3A01 A;  3K0L A;  3QP6 A;  5J3L A;  3DLL F;  2H6B A;  2A6H F;  3HPH A;  2R3S A;  4IQ4 A;  2CW7 A;  4Y4R A;  1IXS B;  3H9Q A;  2B9S A;  2K7L A;  4HW0 A;  1RZ4 A;  2NVT J;  2FNA A;  1QPM A;  2Y2Z A;  3JRA A;  2EFN A;  4BEH A;  2F5C A;  4UV8 A;  5DS9 A;  4BAY A;  4EV0 A;  2MAB A;  1DU6 A;  1ETQ A;  4PUS A;  1I3A A;  5FGM A;  1F4K A;  3CUQ C;  2P7C B;  4H0E A;  4ENK A;  4BJT A;  2GQQ A;  1BC8 C;  3NQO A;  1J5Y A;  1B9N A;  3ZCO A;  3DBL B;  1BI3 A;  4Y17 A;  1WRJ A;  2DMP A;  1WH7 A;  2DOE A;  2JRM A;  4C9Y A;  1CQT A;  3U1D A;  3BTC A;  2KIM A;  3DLA A;  2KPM A;  1EF4 A;  1Y1W J;  3LSM A;  2CV2 A;  4IHX A;  5JR3 A;  4B8X A;  4J00 A;  3DPT A;  2IW5 A;  2HFH A;  2ELK A;  4RAZ A;  3DU6 A;  2BYV E;  1MBE A;  3OIQ A;  4BEH B;  1S9H A;  2DO7 A;  3SHF A;  5IY5 H;  4C3H J;  4DBQ A;  1WJC A;  3ZQF A;  2R7X A;  3IH2 A;  2UV1 A;  2DA5 A;  3M07 A;  4DNC A;  4YFX F;  3HRT A;  2V1X A;  3WHC A;  4CCM A;  1XTA A;  5FKL A;  5TIS C;  3WE2 A;  2A69 F;  3MZH A;  4IX7 A;  4A3L J;  4IRI A;  3S1N J;  2CUZ A;  4PCQ A;  1SVM A;  1TT5 B;  3IL2 A;  5KVR A;  4OMY A;  2DA6 A;  2XF7 A;  3OYB A;  5F6F A;  1O3T A;  3HOY J;  3GTL J;  2XB0 X;  3GFL A;  4C3I J;  1XMK A;  2CYY A;  1X1B A;  3K1P A;  4XRF A;  1F1Z A;  2LOO A;  3IUO A;  1W5T A;  1ORK A;  4GO1 A;  4WK8 F;  1U8R A;  5GPA A;  3I4M J;  1K78 A;  3OSF A;  3TED A;  4BL0 B;  1GHC A;  2IA1 A;  1OYI A;  2G7H A;  1QQI A;  2X1D A;  3FM3 A;  1P6R A;  2RNJ A;  1JUS A;  3ASO H;  4IRH A;  1T8I A;  1BBY A;  2OF7 A;  2Q1Z B;  2JK3 A;  2X6Y A;  2CUE A;  2TRT A;  4HAM A;  4AVP A;  1U5T C;  2CV0 A;  1O7L A;  4KFC A;  2Q2E A;  3M8J A;  2WB1 A;  2CO5 A;  2XKO A;  3C2G A;  1QHG A;  2IPQ X;  3TBI A;  3IRR A;  2CFX A;  4A5M A;  2F5E A;  3CME I;  1FTZ A;  2DJN A;  3HUG B;  2QSH X;  5FFX A;  1MJ9 A;  1P4W A;  2ESH A;  1X4O A;  2BW3 A;  2NNN A;  2KT0 A;  1HBX G;  2R4G A;  2E2H J;  2X6X A;  3FX3 A;  1UHM A;  1SD4 A;  3V7C A;  5ICF A;  1K4S A;  3HOV J;  4A0Z A;  3HRS A;  4ESF A;  2IT0 A;  3TW6 A;  1MZB A;  5BS6 A;  1JJ6 C;  5AIP A;  3M7G A;  4OIR F;  3HSF A;  2DFH A;  1SMY F;  2GXA A;  1N78 A;  1IUF A;  3F23 A;  2Q2E B;  2W82 A;  3CZ6 A;  4BQN A;  2VQC A;  2HZT A;  5KCM A;  3AKZ A;  4AM3 A;  1FSE A;  4HLY A;  3DEW A;  4LJZ F;  4R8H A;  3WOD F;  2L7K A;  4W97 A;  3D5R C;  3F21 A;  1EH7 A;  4AIK A;  3OYD A;  1XSD A;  4R79 A;  3DEE A;  1LE8 A;  5B3S H;  1FEX A;  1XMX A;  2K40 A;  2W7N A;  5FLV A;  4IPA A;  1V55 H;  2JN6 A;  4OAY A;  3CTA A;  3QWL A;  4MHG A;  4E7H A;  4A3K J;  5M3F J;  2Y9Z A;  3I4P A;  4AID A;  3GVA A;  5LGN A;  2D1V A;  4B3X A;  3K4B A;  2QEX I;  2JTV A;  1XX5 A;  1X1D A;  1X1A A;  2XGE A;  1XCB A;  4BDZ A;  2P8T A;  4KIT B;  2XF6 A;  2KRC A;  3TOA A;  1IRF A;  1TZL A;  3G1L A;  2HWV A;  3BG5 A;  2XUB A;  4KIC A;  4HDV A;  1IG7 A;  1KZH A;  5KK1 A;  1T0F A;  1TTY A;  1VQM I;  2HU9 A;  1UJ8 A;  2FX0 A;  2PMZ A;  3D5S C;  2DLL A;  3F72 A;  4MTE A;  2L54 A;  1XCV A;  2AO9 A;  3WTT C;  2CFO A;  1I27 A;  5J40 A;  4BKX A;  4L9J A;  4CA0 A;  3KP7 A;  1FLI A;  1BW5 A;  1TNT A;  4LFU A;  3FXQ A;  4MFD A;  1IC8 A;  1XDS A;  2HXO A;  4XID A;  1X19 A;  1HW5 A;  4UVB A;  2COB A;  4M3F A;  5ILU A;  3GZN B;  1D0X A;  2VON A;  3OYE A;  5GTH C;  5E20 A;  1JT0 A;  2XGD A;  4BS9 A;  3G71 I;  5BMZ A;  4LGW A;  4HV6 A;  2DTZ A;  2PMZ N;  3F8M A;  1OYY A;  3WTV C;  2YX7 A;  1MSE C;  2EV5 A;  5L3E A;  4EJT A;  1S7O A;  5F0F A;  3ELK A;  2A5W A;  2VKD A;  4GDF A;  1OFC X;  2R7R A;  1XGS A;  1HXD A;  2HKX A;  2A61 A;  2E71 A;  4L9N A;  3IRQ A;  3IWF A;  3HB9 A;  4DOZ A;  1N77 A;  5HDN A;  4OU0 A;  5CVI A;  4S04 A;  2FUG 2;  2K9Q A;  4A3I J;  3DWL E;  3FMQ A;  4NBQ A;  2VJJ A;  1WJD A;  2RRE A;  4V19 K;  1SEU A;  2DQL A;  1E3P A;  1G2H A;  2R7V A;  4DW6 A;  2ACJ A;  2J5O A;  2GBY A;  2LVS A;  1R5H A;  3K2A A;  1R58 A;  4HQM A;  4KIF A;  4KJZ A;  1U78 A;  3I4N J;  5ERI A;  2KDZ A;  5K7Z A;  1ACI A;  3DP7 A;  3IAS 2;  5K5R A;  2R7F A;  2HXI A;  3FMR A;  3HBL A;  1SFX A;  2Y69 H;  4DYQ A;  1DPU A;  4EGY A;  4A6E A;  2MLK A;  1YW7 A;  4I0A A;  1VND A;  1MBK A;  2FQ3 A;  1VQL I;  4JP0 A;  2K3P A;  2HEO A;  2ZSH B;  1W36 C;  3S3N A;  4MTD A;  2BHY A;  1NTC A;  4KIB A;  2FA5 A;  5K7F A;  3K9T A;  3FKI J;  3HGY A;  1J0R A;  2A3S A;  4Z6Y A;  3I71 A;  3K6G A;  2L2O A;  3GTM J;  4MLO A;  1BC7 C;  3FWE A;  4PFO A;  2VPR A;  3FDY A;  3BR3 A;  1WJF A;  3CMM A;  3L2W A;  2A07 F;  2VL8 A;  2K02 A;  3H3Z A;  1ZEL A;  1B9M A;  4LG0 B;  1EJ9 A;  1S7A A;  1WCM J;  4BE2 A;  4FTH A;  4XSZ F;  1FOX A;  3LFU A;  3ISP A;  3KYD B;  2AHQ A;  3HGG A;  2COM A;  3Q0U A;  4WXC A;  4G6Q A;  3RKW A;  1W0U A;  1K6O A;  4PJJ A;  4KMU X;  3OS2 A;  4M9S A;  1QZZ A;  3HL2 A;  1WSU A;  1R49 A;  1S8N A;  1JUP A;  2HKO A;  2O5R A;  5B66 C;  1DP3 A;  4AIH A;  1TBX A;  5CYV A;  2YUS A;  1R36 A;  5JLW A;  3D1N I;  3KLO A;  1B72 A;  2Z33 A;  4XNF A;  2LBF B;  2LRE A;  2ZC2 A;  2RVC A;  4UVC A;  1K79 A;  3FK6 A;  2K5C A;  1FJL A;  1ZGA A;  2E7W A;  4A3E J;  3WGH A;  3SZG A;  2HYG D;  1Y0U A;  4XLF A;  3DTK A;  5IT3 A;  5BOX A;  4P96 A;  3LMM A;  1ZH5 A;  2ZFU A;  3P7N A;  5EZH A;  4CCN A;  4BE0 A;  2HQA A;  4GFB A;  2EA2 A;  5EDN A;  3GF2 A;  4LLG F;  1LDJ A;  4D5F A;  4KUM A;  3PSI A;  1ETV A;  4LB6 B;  4DJA A;  2HOT A;  3AG1 H;  4E7S A;  1TT0 A;  4BHC A;  3ZQI A;  3COA C;  1FBQ A;  1B72 B;  1GUU A;  2VT3 A;  4I09 A;  4XLE A;  3RKQ A;  2EFQ A;  1V5E A;  3S93 A;  1F5T A;  2LFB A;  3LWF A;  5DTD A;  2M2E A;  1GXP A;  2XAJ A;  3DXJ F;  1I6X A;  2K3F A;  2VKV A;  4M73 A;  3CMA I;  1IZ1 A;  3BZC A;  1X4P A;  3VDX A;  4NC6 A;  1V5F A;  4X6A J;  2MH2 A;  5EJC A;  5EYR A;  1Z3Y A;  1UFM A;  2HOA A;  3ESW B;  4F55 A;  4E7J A;  1PP8 F;  1D8J A;  2VE8 A;  3GME A;  4OIO F;  2M8G X;  4IOC F;  4E7L A;  4M3E A;  2WAD A;  2OD5 A;  1V5G A;  2NOJ B;  1D8K A;  1TW3 A;  4E7K A;  3H3V K;  2LY1 A;  3BWG A;  3AFH A;  2BEO A;  4QPQ A;  1DQU A;  1I6H J;  1ZG3 A;  2F2E A;  2XGX A;  2Z16 A;  4KMF A;  1MMG A;  1SFK A;  3H92 A;  1ZRE A;  4IKF A;  4NDL A;  1XMA A;  4CDG A;  3JSP A;  1UG2 A;  5D5V B;  2IJL A;  1H89 C;  1VQ9 I;  2ZME A;  3HYI A;  1R71 A;  3DV8 A;  1IN4 A;  1PP7 U;  2O0Y A;  1BIA A;  1BR1 A;  1NK2 P;  1IN7 A;  2QM3 A;  3H5A A;  4UUT A;  4QSH A;  3DQV C;  1XD7 A;  1KU3 A;  4YEJ A;  4XOR A;  4EJW A;  5D5W B;  3TDZ C;  2LLK A;  3QYB A;  3S1R J;  1YIJ I;  3FKJ A;  2F6C A;  1YG2 A;  2LTP A;  3FZV A;  2L9R A;  1V54 H;  3SFZ A;  2XAH A;  3ASN H;  5BNG A;  4QPO A;  1TQM A;  2LY2 A;  2ZNY A;  3SJM A;  1J9I A;  3LL7 A;  5CQG A;  2H1L A;  4LK1 F;  2ECC A;  4C30 A;  4E6K G;  2NRA C;  2DBB A;  2IS4 A;  1ZAR A;  5JFR A;  2AQE A;  4YRV A;  4XOP A;  3MZY A;  2HVQ A;  2JZY A;  1OPC A;  3KET A;  1AU7 A;  1UB9 A;  1HSJ A;  1UG0 A;  2HYF A;  3L09 A;  1XGN A;  2P5V A;  1W5C C;  2BY1 A;  4Y15 A;  3LSH A;  4BXU A;  1MH3 A;  4GCV A;  5F64 A;  2G7U A;  1STZ A;  4IOA F;  1IV8 A;  1V3F A;  3BJ6 A;  1APL C;  3FXL A;  3OYN A;  4IXA A;  1LEB A;  2K9S A;  3HTU A;  4D1Q A;  2K4J A;  4KN7 X;  2N8G A;  2QSG X;  2NXN B;  3I54 A;  4M9Z A;  4XMY A;  1YJN I;  4NUB A;  3PSF A;  1AA7 A;  1BJA A;  4DZJ A;  5D5X B;  3TDU C;  4CYC A;  2CW0 F;  2EV0 A;  2CQ7 A;  2ZFW A;  3S2W A;  2XAS A;  2KRH A;  1X3U A;  2I8D A;  5LGU A;  2F4O B;  1UCR A;  1VF9 A;  4ENM A;  2ZXW H;  3LSI A;  1MW7 A;  3ONQ A;  1LFP A;  1XS9 A;  3S3M A;  3OMY A;  1A36 A;  4ZH4 F;  2DOA A;  1G6N A;  4Q48 A;  5B1A H;  2ZXI A;  2K27 A;  1G3T A;  5JHU A;  1TP4 A;  3DTI A;  3EUH C;  3HSE A;  2R5Z A;  2CW8 A;  3KE2 A;  3KEY A;  3SEQ A;  4G7Z F;  3S14 J;  1J09 A;  4KT5 C;  1BA5 A;  4MIM A;  5F0H A;  3RI4 A;  4EQQ A;  2B7E A;  2PEX A;  1D5Y A;  5C44 J;  4GXO A;  2X48 A;  3V7R A;  4Y13 A;  4CZZ A;  5LEK A;  1K4T A;  4BJ5 C;  3CC2 I;  1H9G A;  3ZMV A;  1G59 A;  1K7A A;  4S0H B;  4CYC B;  2L5Q A;  1KA8 A;  2LKP A;  2VJ4 A;  3SDG A;  3ERE D;  2VXD A;  3GBG A;  5HS9 A;  3GFM A;  1ETO A;  4EM2 A;  2JA6 J;  1F36 A;  2PJR A;  1QZY A;  2DDA A;  2E35 A;  1FT9 A;  1YS6 A;  4Y52 J;  3JAM K;  1MMD A;  5C3E J;  2R5Z B;  3CCV I;  2EZH A;  1WKM A;  1YJW I;  3V8J A;  1D5V A;  1A04 A;  1OIS A;  3VEP A;  4S05 A;  5IPA A;  1X2M A;  4FE7 A;  5JLX A;  3KX2 A;  4HPQ A;  4HYE A;  4A2U A;  4WXD A;  3OYJ A;  3JRI A;  2K85 A;  5DUI A;  1XGM A;  2VJI A;  3MVP A;  4U0W A;  4HF0 A;  2H6C A;  3JRE A;  3M1C A;  3PO2 J;  1Y0N A;  3A0H C;  3BCA A;  3L00 A;  4XKW A;  2KQR A;  3CCE I;  2MA3 A;  1G8X A;  3JAM Z;  2XV4 S;  3RZD J;  1USS A;  3OWT A;  2YU3 A;  4FT8 A;  2CG4 A;  5DM6 F;  5ICG A;  3KEO A;  4A3M J;  3LA2 A;  3MKL A;  3FMS A;  2R5Y B;  1IDZ A;  3NRV A;  1O3S A;  4RB3 C;  2VQH A;  2EQR A;  3F22 A;  1HOM A;  3WTX C;  3E97 A;  2KRF A;  4HST A;  4AVZ A;  3PQJ A;  4ZYE A;  1YX3 A;  4UUS A;  2DDB A;  4PJN A;  3Q9V A;  3U1K A;  4AUX A;  1FOK A;  4HA8 A;  2AS5 F;  3REO A;  5F1R A;  2KIU A;  1AWC A;  4FIS A;  2M5W A;  2JSP A;  5FKM A;  2NVQ J;  4J19 A;  1N75 A;  1NH3 A;  4WX9 A;  4EAT A;  1I1S A;  3IH3 A;  2BE5 F;  3BG6 A;  1YO5 C;  1Y56 A;  4Y33 A;  2E1O A;  3AL0 B;  4GRI A;  3V8K A;  2LF7 A;  2NNY A;  4J01 A;  3TMO A;  2DMN A;  3VYR B;  3ZQC A;  2ZJ2 A;  1ERD A;  3RCO A;  3MKY B;  3CDH A;  5LBQ A;  2JVH A;  3GFJ A;  1A5J A;  3I59 B;  4UY8 I;  3WTW C;  3CJT B;  2DT7 B;  4B43 A;  4HZF A;  3OSG A;  4KA4 A;  1AKH A;  1G3S A;  1OCT C;  3FBI B;  1AOY A;  1X2N A;  1Z6T A;  2YS9 A;  1HDP A;  4I01 A;  2AQF A;  2FSW A;  4XQF A;  1A6I A;  3FXM A;  1Z0X A;  2HDD A;  5L3F A;  4D0P A;  5L3G A;  9ANT A;  1U2W A;  4UUV A;  4XRM A;  5B1B H;  2VE9 A;  4II3 A;  1OYW A;  2L9S A;  3SQN A;  5HDK A;  4OWR B;  2FOK A;  2ISY A;  5K7H A;  4FQG A;  1U9O A;  3CCJ I;  3HRM A;  4MQ9 F;  1Z77 A;  3HZJ A;  2IS1 A;  1LKX A;  2RQQ A;  3AG4 H;  3VSK A;  1WJE A;  2D1H A;  4LOC A;  4UB8 C;  1K83 J;  3H36 A;  5E79 C;  1R5I D;  4OAZ A;  3BG3 A;  1MDM A;  4UNO A;  5E8G A;  2EIK H;  1F9N A;  1VQ6 I;  2UZK A;  1SMT A;  4EJU A;  5LRS A;  2GXG A;  2KJC A;  2MG4 A;  1FIA A;  2CWE A;  5EF6 A;  1D0Z A;  4AD9 A;  4JX6 A;  2VQL A;  3A01 B;  3QQA A;  1LVK A;  3WG7 H;  1W4M A;  2IA0 A;  2HPI A;  4CXF A;  5HS7 A;  2M0M A;  1YW8 A;  4X0G A;  1BIB A;  2KZG A;  2UUZ A;  2QZ8 A;  4I98 B;  5DDG A;  1R9T J;  3BOQ A;  2FBK A;  4I99 C;  3WE3 A;  3G1M A;  2Z2S B;  3BG9 A;  2BGC A;  4A3G J;  1DGW Y;  3Q3S A;  4P9U A;  5D8L B;  3NWT A;  3DBR B;  1WJB A;  1I1G A;  3LSG A;  3L1P A;  2E34 A;  1DDN A;  5GAG J;  3RYR A;  3QRF F;  2E7X A;  5KHD A;  3S15 J;  4BXX J;  1IN6 A;  1VQ4 I;  4IRG A;  1LJ9 A;  2PN6 A;  3ZQQ A;  4A6D A;  2W85 A;  2LD5 A;  2ZB9 A;  4G7O F;  2XPU A;  4FAS D;  2YU9 J;  1FP2 A;  1V4R A;  3BJO A;  1LDK B;  4ETS A;  3ZMD A;  3E5Q A;  2ELH A;  3K70 D;  1GXQ A;  1KQ9 A;  2EFP A;  2EIN H;  2P4W A;  3E6C C;  3DKY A;  2VBW A;  4WXH A;  1HF0 A;  2M9H A;  2DAO A;  2EIJ H;  4K2E A;  2Y30 A;  1YTY A;  1TWA J;  3JCU C;  2STT A;  4ZDP A;  2G0E A;  1TQP A;  2RC4 A;  2XAU A;  3OYG A;  2WBM A;  1LFB A;  1T6S A;  3SYT A;  3CCU I;  3GTP J;  5BPD A;  3GZ5 A;  3S3O A;  1YOV B;  4UVA A;  3RYP A;  2MW8 A;  2Z5U A;  4E7Z A;  1SAX A;  3EPZ A;  1EA3 A;  2CMP A;  2O8X A;  3QYF A;  5L3D A;  1TWH J;  2Y9Y A;  1X58 A;  2J5P A;  2MD0 A;  4N9H A;  4DQ2 A;  5FRO A;  2MFZ A;  5DCM A;  2TCT A;  4RB0 A;  2MSY A;  1BL0 A;  1O3R A;  2X0L A;  3H35 A;  5GAH J;  3MFK A;  2PQ8 A;  2E1C A;  3S32 A;  1JHH A;  4KIG A;  2HVR A;  1PVE A;  4V2G A;  2CQX A;  2A6E F;  2IGM A;  3VOE A;  2HNH A;  4CUG A;  1NK3 P;  1K78 B;  4KNY A;  3WU2 C;  2IP2 A;  3I64 A;  3Q9S A;  4ENJ A;  4BY1 J;  3PNT A;  4DZP A;  3KZY A;  5A2Q K;  2QVO A;  1A35 A;  5E1Z B;  2VKE A;  2ZKZ A;  5BQT A;  2JA5 J;  1BR4 A;  4M6V A;  5C4X J;  2EIL H;  2HOE A;  3ZN0 A;  5HOD A;  1GVJ A;  5TRD A;  3E6D A;  2QBY A;  2XRL A;  2P7V B;  2V6E A;  2R7Z J;  1O7F A;  1JJ8 C;  1ETY A;  5E1X A;  3KYL A;  4R1H A;  4LK0 F;  1EV7 A;  1KGS A;  1MBF A;  1ODD A;  2L7M P;  4JYK A;  3HKZ A;  1SC7 A;  3CLQ A;  1LB2 A;  2F4I A;  1IXR C;  2NS0 A;  1XGO A;  1JTY A;  2L9V A;  5FRM A;  2BW3 B;  5A2Q Z;  1BJZ A;  3WHB A;  3BG7 A;  3LSK A;  4IF4 A;  4MQV A;  2STW A;  3KP2 A;  5TJJ A;  1Y6I A;  1QRY A;  2LK2 A;  3C7J A;  4EM1 A;  2W24 A;  1YIO A;  1B6A A;  2ETH A;  3CJQ B;  2KDO A;  2A05 A;  5LHH A;  3O3K A;  2V1N A;  2O03 A;  4HF2 A;  1YI2 I;  5M5X J;  4RM2 A;  2F48 A;  2IVM A;  2FU4 A;  4IHW A;  3M1E A;  4ZDL A;  2RQP A;  3QAH A;  3FBN B;  1FZP B;  3HKZ N;  3MKZ A;  3K2Z A;  4HQE A;  3RIR A;  1O3Q A;  3GFI A;  3F0C A;  1ON2 A;  1T38 A;  3QPL A;  3DFG A;  5DCF A;  1ETW A;  2XIG A;  1H9T A;  3CP8 A;  5CVU A;  1LE8 B; 
#chains in the Genus database with same CATH homology
 2DA7 A;  5EZG A;  2H1K A;  4D5F A;  2HOT A;  1ETV A;  1PUF A;  1ZK8 A;  3ZQG A;  3ZQI A;  3NAU A;  4DYC A;  1POG A;  5IYB J;  1B72 B;  1GUU A;  3FIW A;  3RKQ A;  4EEF G;  2X9D A;  2O7O A;  3FK7 A;  2NVY J;  1ZKG A;  2LFB A;  3BR1 A;  5DTD A;  2M2E A;  1HDD C;  1HLV A;  3LSJ A;  2VKV A;  2IEK A;  3O8H A;  1IGN A;  1F43 A;  1TWC J;  1OJL A;  4B4C A;  1T33 A;  1WI3 A;  1LFU P;  2R5Y A;  3JR9 A;  2ME6 A;  2O9L A;  4X6A J;  3FIS A;  3QPS A;  3HOX J;  5EYR A;  2JA8 J;  2HOA A;  3BR5 A;  1K61 A;  4A3C J;  1QVU A;  4B1R A;  5E3L A;  2M8G X;  1VI0 A;  1P7I A;  4M3E A;  2K9N A;  2DA2 A;  3TP3 A;  3H3V K;  2D5V A;  1W0T A;  3SFI A;  3S1Q J;  3M3Y J;  1I6H J;  3O8G A;  3IV5 A;  1T56 A;  5F27 A;  2JWT A;  4NDL A;  1IV6 A;  3TP0 A;  1UG2 A;  2QCO A;  1H89 C;  2DA1 A;  3HDD A;  5IP6 A;  1NK2 P;  3PM1 A;  1SAN A;  3S17 J;  1JTX A;  4UUT A;  4QSH A;  2M0C A;  2XGC A;  4MO7 A;  4A3J J;  2L7F P;  2E2I J;  4M3G A;  3LNQ A;  5EEA A;  3LSP A;  2LLK A;  1S7E A;  3BTJ A;  2O8K A;  3S1R J;  1P7J A;  4X1E A;  3GTK J;  2LTP A;  2L9R A;  1JKR C;  1WGX A;  3OIO A;  2GLO A;  5BNG A;  5E3M A;  2DMT A;  4I76 A;  3SJM A;  4V2F A;  4FE4 A;  2ECC A;  5IP7 J;  4I6Z A;  1ZQ3 P;  1HCR A;  2EBI A;  4BBR J;  2Y31 A;  3BTL A;  5IYC J;  1JGG A;  1AU7 A;  2NVX J;  2M34 A;  3BR0 A;  1B8I A;  2ID3 A;  4G12 A;  1MH3 A;  2NS7 A;  3Q0V A;  2XB5 A;  1APL C;  1ZGW A;  5GPC A;  3B6C A;  5J1U A;  2K9S A;  2R93 J;  1GV5 A;  2NOG A;  1XC5 A;  2N8G A;  1JKP C;  2WB1 N;  2ECB A;  4DZJ A;  4FCY A;  5J1Y A;  1IRZ A;  3BQZ A;  4CYC A;  5IYD J;  3A01 A;  3IH4 A;  1ETX A;  5J3L A;  1VF9 A;  2CU7 A;  4M3D A;  3BTI A;  3LSR A;  1VFC A;  2NVT J;  1XS9 A;  2HOS A;  3M4O J;  2Y2Z A;  3TW7 A;  1H88 C;  4W1U A;  3JRA A;  5DS9 A;  2R5Z A;  1DU6 A;  1ETQ A;  3S14 J;  1BA5 A;  4MIM A;  5IOZ A;  5F0H A;  3JRF A;  2GM4 A;  4QIW N;  5C44 J;  1D5Y A;  2X48 A;  5J1R A;  2EZK A;  4BY7 J;  3A03 A;  2DMP A;  1WH7 A;  1CQT A;  5M5W J;  4S0H B;  4CYC B;  3BTC A;  5E3N A;  3SDG A;  1EF4 A;  3GBG A;  1Y1W J;  2JA6 J;  4IHX A;  1ETO A;  3C2B A;  1F36 A;  4M3B A;  3OOU A;  4Y52 J;  3NAR A;  4IHY A;  2ELK A;  2CRG A;  2IAI A;  1MBE A;  5C3E J;  3UKG A;  2B63 J;  4C3H J;  2R5Z B;  2EZH A;  3ZQF A;  1WPK A;  3IH2 A;  2VUM J;  3BT9 A;  2DA5 A;  3WHC A;  5IPA A;  4JX5 A;  2MGQ A;  1X2M A;  4FE7 A;  5JLX A;  2VI6 A;  1MSF C;  4IEJ A;  4A3F J;  5FKL A;  5FJ8 J;  2E2J J;  1TC3 C;  1PUF B;  3ZQH A;  5F08 A;  3JRI A;  2HI3 A;  1E3O C;  4D7M A;  4A3L J;  3MVP A;  1RKW A;  3JRE A;  3PO2 J;  1MBJ A;  3S1N J;  1GVD A;  2DA6 A;  3RZD J;  3CQZ J;  3HOY J;  3BR6 A;  3GTL J;  2XB0 X;  3JRC A;  4C3I J;  5FKN A;  4A3M J;  2XPV A;  1GT0 C;  2I10 A;  3MKL A;  1IDZ A;  2R5Y B;  1Y1V J;  1ORK A;  1HOM A;  2EQR A;  5GPA A;  5E3O A;  2P81 A;  4B3A A;  3JRG A;  3I4M J;  2E19 A;  3OSF A;  3TED A;  2NS8 A;  3ZOB A;  4UUS A;  3K7A J;  4AUX A;  3JRD A;  1JUS A;  3CMY A;  3PO3 J;  4FIS A;  2JA7 J;  2OF7 A;  3DCF A;  2JK3 A;  5FKM A;  4J19 A;  2NVQ J;  2CUE A;  5EG0 A;  3S2H J;  2TRT A;  4C2M J;  3IH3 A;  1RET A;  2E1O A;  3ZQC A;  1RKT A;  2DMN A;  1U8B A;  1A5J A;  1FTZ A;  2DJN A;  2HQ5 A;  1QVT A;  2XSD C;  4A93 J;  2KT0 A;  2FJ1 A;  3OSG A;  2E2H J;  1OCP A;  1AKH A;  1OCT C;  2FD5 A;  4A69 C;  3ZQL A;  1MBH A;  1X2N A;  2R92 J;  3GTG J;  2YS9 A;  1HDP A;  3HOV J;  3Q0W A;  3TW6 A;  5EGO A;  1JJ6 C;  1YRN A;  1A6I A;  3S16 J;  3CDL A;  1Z0X A;  1JKO C;  2HDD A;  4ABZ A;  2IBD A;  1IUF A;  9ANT A;  4BBS J;  5C4J J;  4XRM A;  4C3J J;  3H0G J;  2R0Q C;  2DMU A;  3DEW A;  5K7H A;  1Q1V A;  2XPW A;  1U9O A;  4AYB N;  4W97 A;  1ZR4 A;  1B8I B;  1Z77 A;  2CQQ A;  2HYJ A;  1LE8 A;  2EZI A;  2JMW A;  5F04 A;  1FEX A;  2K40 A;  4LOC A;  2QF7 A;  5FLV A;  1K83 J;  2JN6 A;  3BG3 A;  4A3K J;  5M3F J;  1YRN B;  2Y9Z A;  1UMQ A;  5F1J A;  2XGE A;  4XRS G;  2MG4 A;  1WH5 A;  1H8A C;  1FIA A;  3G1L A;  1TWG J;  2RAE A;  3BG5 A;  5EF6 A;  1IG7 A;  4JX6 A;  3A01 B;  3QQA A;  2JJ7 A;  1TWF J;  2CUF A;  2Y0S N;  4AC0 A;  2FX0 A;  2DN0 A;  1R9T J;  2AO9 A;  3G1M A;  4XIC A;  1AHD P;  3BG9 A;  4A3G J;  4BKX A;  1GV2 A;  3BR2 A;  3Q3S A;  1BW5 A;  3HOZ J;  4MFD A;  1IC8 A;  2HXO A;  4XID A;  3L1P A;  3LSG A;  3E7L A;  4L5E A;  1UHS A;  2COB A;  4M3F A;  2H8R A;  3S15 J;  4BXX J;  3S2D J;  3GTO J;  1MBG A;  1JT0 A;  2X6O A;  2XGD A;  3B6A A;  2DTZ A;  2PMZ N;  2LD5 A;  2ZB9 A;  2XPU A;  1ZR2 A;  2YU9 J;  5GP9 A;  1GDT A;  2LP0 A;  1RES A;  1MSE C;  1ZTR A;  1XG1 A;  4JX4 A;  1ENH A;  1U9N A;  2EZL A;  1HF0 A;  1ITY A;  2M9H A;  2DMQ A;  5F0F A;  1MNM C;  1OFC X;  2FQ4 A;  2Y30 A;  3CCY A;  1FTT A;  1TWA J;  2G0E A;  3HB9 A;  4HNV A;  1LFB A;  3GTP J;  2L7Z A;  5FKK A;  2K9Q A;  4A3I J;  2MW8 A;  3W6V A;  3GTQ J;  1G2H A;  4DW6 A;  4IHV A;  2GBY A;  2LVS A;  1U78 A;  3K2A A;  1TWH J;  1RR7 A;  1X58 A;  2Y9Y A;  2L0K A;  3I4N J;  4QTR A;  2KDZ A;  5K7Z A;  4RBO A;  2TCT A;  2MSY A;  1BL0 A;  1I3Q J;  2HXI A;  1I50 J;  3HBL A;  2WAQ N;  4MFE A;  4DYQ A;  4V2G A;  2CQX A;  1VND A;  1MBK A;  1NK3 P;  4XRS A;  4JP0 A;  3HEF A;  4BY1 J;  4DZP A;  4UUS B;  1NTC A;  4XK4 A;  3A02 A;  5K7F A;  2JA5 J;  2VKE A;  3FKI J;  3HGY A;  3LOC A;  4M6V A;  3JRH A;  3MN2 A;  4A3B J;  5C4X J;  2ME0 A;  5HOD A;  1RPW A;  3GTM J;  3VPR A;  3G1O A;  4MLO A;  2XRL A;  5EG0 B;  2VPR A;  2R7Z J;  1JJ8 C;  1ETY A;  3BR3 A;  2DA4 A;  2WV1 A;  1IJW C;  1O4X A;  1FIP A;  1MBF A;  2L7M P;  4JYK A;  1SFO J;  3RQI A;  1WCM J;  1BW6 A;  5FLM J;  4FTH A;  2LR8 A;  3S1M J;  1JKQ C;  1ETK A;  1JTY A;  1JUM A;  1MH4 A;  2AHQ A;  3HGG A;  4Y7N J;  4D5C A;  3Q0U A;  4D7N A;  1BJZ A;  3WHB A;  5M3M J;  1QPI A;  1JT6 A;  1W0U A;  5F0C A;  1AKH B;  3GTJ J;  2OPT A;  1QRY A;  2LK2 A;  1JUP A;  5IOY A;  1DU0 A;  3BQY A;  5M5Y J;  2YUS A;  5EGO B;  5JLW A;  3HOU J;  3D1N I;  1B72 A;  5IP9 J;  2LKX A;  2CJJ A;  5M5X J;  1IDY A;  4IHW A;  3FK6 A;  1FJL A;  4A3D J;  3HKZ N;  4RDU A;  4A3E J;  2DA3 A;  2LY9 A;  3HM5 A;  4DYR A;  3HOW J;  2EH3 A;  3F0C A;  3QPL A;  2ID6 A;  5EZH A;  3JRB A;  1ETW A;  3RZO J;  4GFB A;  5FKO A;  5EDN A;  2W48 A;  1LE8 B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...