3H5NA

Crystal structure of e. coli mccb + atp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
338
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MccB protein
total genus 109
structure length 338
sequence length 347
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5nA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5nA02
4KTTE 4ZD6A 1ZMTA 4GX1A 3PJEA 4IMPA 1ZH8A 3HFSA 3OQBA 3LT0A 4OGWA 3AY6A 3DZGA 2J3IA 1KVUA 2OO5A 2YQ5A 4K28A 3VKUA 1YH3A 1AXEA 2Y0DA 4LCEA 3MCVA 1G1AA 3FF4A 3KYCB 1WZIA 4GX2A 2FPGA 1UXGA 4PLHA 2V65A 1X1TA 3ROMA 1K6IA 4CUJA 1YJQA 1GYRA 2WEKA 3PRJA 4CMKA 3SXPA 1FDWA 2VYVD 3AWDA 1UAGA 2P4HX 2VOEA 3KTDA 4XKJA 1QYCA 2X4GA 2GZ1A 3S2FA 2NADA 1X7HA 2JCXA 3C3XA 4W9NA 5JO9A 1LLCA 1DFIA 3DTYA 3ZU5A 4IQGA 3GRKA 3BTOA 3OQ1A 3KSZO 4DRYA 5LCXA 5HS6A 1V8BA 3D5QA 2J5QA 3VVBA 1M66A 4BNWA 5BNTA 1SZJG 5A06A 1LEHA 3O8QA 4E21A 2OUIA 3FNFA 4DMLA 4XEHA 3ZHYA 5JO0A 1XHLA 1DDOA 2GZ2A 4YAJA 3HDHA 5IXYA 3K9QO 4ESOA 5L7TA 2RHRA 2GYYA 1ZSVA 2YHUA 4XIYA 1GY8A 1YL7A 4HFMA 3UFXA 4WJZA 4J1TA 3WBBA 3JQ7B 3R1IA 4YT4A 5C7IO 1O6ZA 2I66A 1JN0A 3HDJA 3DBHA 4Z6KA 1FJHA 2TMDA 1R0KA 3CMMA 1IB6A 5T57A 4BQPA 4YRAA 2JHGA 1DIAA 3OICA 3PPIA 4FIZA 1I24A 1PGQA 1PZEA 3RJ5A 3HUDA 1PGOA 4XX0A 1YKFA 3LF2A 4I5FA 5AXAA 3ZHXA 1EVIA 4FFNA 4YJFB 3I3OA 5HRUA 1ISMA 4BB6A 2ZCUA 2BMAA 4M49A 3C1TA 4CM9D 4J7XA 2ZATA 5JNLA 4RORA 1DAOA 1LDMA 1I3NA 2UDPA 1YQDA 4R69A 4UUOA 3K92A 2NNLD 3DZHA 3PQEA 1DSSG 5A9SB 4O5OA 4FFOA 1H6BA 4CQMB 1LX6A 1NM5A 4L9RA 4GLOA 1NHGA 3KSDO 3SX2A 3JQ8B 2E4AA 4IJWA 1E3IA 2WJPA 3GUYA 1R16A 3SJUA 2HDHA 2NU9A 3ZWMA 1PL7A 1P1RA 4O1MA 4R9RA 3CINA 4CR8A 5T67A 1R4MA 4P8RA 1N9GB 3PJGA 1CRWG 2EV9A 1CWUA 3DB2A 5CP8A 1PZFA 1GTMA 4JX8A 5B4UA 4E2WA 2EW2A 5K6AA 4H16A 2PZMA 3AW9A 4R51A 4HP8A 1JKJA 4W7HA 3ENNA 1L7DA 1K6JA 3W1VA 3EAGA 2FSVA 3RU7A 1DC4A 1U28A 4OXYA 2C5EA 5KKCA 2HUNA 4J91A 4A0SA 1KC1A 1MG0A 4E0BA 5IZCA 4WK6A 1V6AA 1H2BA 3P2YA 3GFBA 1HKUA 1R0LA 4M54A 1XQ1A 1R15A 3GC6A 4L75A 2VNSA 3LQFA 3DEYX 2BLLA 4CLRB 1A27A 3G0OA 3B20A 4R54A 4CR6A 3PZRA 3UUWA 4IDDA 1P77A 3JD0A 4DGSA 3B70A 5KJ1A 1EK6A 4MVJG 1WP4A 1XKQA 3SLKA 4M55A 1QRRA 1T1SA 2I76A 4E13A 2POQX 3K2EA 1ISJA 2DBQA 4R16A 3S8MA 3E9MA 4BL5A 3FSRA 4JJFA 3OM9A 4YYZA 1DLJA 2V6GA 3OMLA 4L4SA 2P5YA 4RLSA 4RVFA 4TVBA 5A3VA 2HO5A 2ZB4A 1H9AA 3D5TA 5G0VA 1R6DA 1YDWA 3AU8A 1CETA 4TKMA 1NPDA 3PDUA 1U3VA 2R6JA 3OJEA 3QVSA 3UKOA 1YL6A 1RM5A 3EK2A 2D59A 3C1OA 1NWHA 4CM1A 2BD0A 1O9BA 3GR6A 3PI7A 4RZHA 2BF7A 3P7MA 3LC7O 1NWCA 2PTGA 4QT0A 4CPDA 3NKLA 4OYRA 3NDJA 4LMPA 1MLDA 4PLPA 2VYNA 3UN1A 2HAEA 4E2ZA 3GF4A 4CMEC 1T4BA 2QX7A 4AJPA 3HG7A 2XXBA 1I01A 3QLJA 5EQDA 4GX0A 4YTEA 4MKRA 1ISGA 3K6JA 2EW8A 4CM4A 2DLDA 1SBYA 1ADCA 3JQBA 2FR0A 5CDTA 2Y66A 1OOEA 3L77A 2GN9A 3NT5A 3K2BA 3GN1A 4GQAA 2Q45A 4CMJA 4CLEA 4LGVA 2DBRA 4Q3DA 4DQVA 1N1EA 1RYDA 2YFHA 5KJEA 4A03A 2Y67A 3JQEA 3UF0A 5EL0A 3ZWWA 4A26A 5C3MA 1JKIA 1H6CA 4KTVE 4MVJI 3TQHA 2W90A 5JDIC 2RH4A 4HNGA 2D2IA 1NNUA 4RDIA 1BDMA 3HNPA 1Y8RB 4FJ0A 1LRLA 3IIEA 4ZJUA 4GLLA 2FPIA 5I8ZA 1RKXA 1PJCA 1FK8A 1ZKMA 3JV7A 3DMTA 4ID9A 1YQGA 5TJ9A 5IZCC 3WYCA 3WMXA 1ISIA 3NDIA 1ENYA 1BWSA 1GUYA 1EVYA 1UP6A 1A72A 4Q3BA 3PHHA 4CMGA 3QW2A 5CG1A 3WTBA 4XYLA 4AG3A 1CQIA 5ES3A 4HADA 3NRCA 4H15A 2IEDA 3DFUA 3HZZA 4TRJA 1LRKA 2BFOA 1ZFNA 1VSVA 1YB5A 1DRUA 1UUFA 4WOJA 1B16A 1Y7TA 1IHYA 2I9PA 2TMGA 1ULUA 3BZUA 5THQA 1K89A 3EYWA 1Y8RA 1HDOA 3A14A 3VZSA 4D44A 3AOEA 4DC0A 2WSBA 4WCDA 1N1GA 4TMFA 4DLBA 1EVZA 4J1QA 1EFLA 1D3AA 4PLZA 2V6BA 4DQUA 2G5CA 3GK3A 1C0LA 1K2WA 4ZHSA 4HY3A 1K0UA 4HXYA 4D46A 4NR0A 4PG4A 4DYVA 3GEMA 4CM9A 3CH6A 4ZICA 2X9NA 4IXTA 2ZTLA 3SJ7A 3OECA 3CIFA 1H93A 1Y1PA 2AQKA 4Z0TA 4J3FA 2XOXA 1GCOA 3Q2KA 1DAPA 1XYGA 2P5UA 3GVPA 3MJCA 4W82A 3RWBA 5K6AC 2VYVA 1PS9A 1NX6A 3MWEB 4S3MA 3RD5A 4RVUA 2Y99A 1Q7GA 3JYLA 3PYXA 4QFCA 2OGUA 1Y81A 4S1VA 3D3WA 5CEJA 2PKQP 1X13A 3WICA 3INTA 3VZRA 5JFOA 2RAFA 4QECA 2GERA 4CV1A 2RBEA 3JQDA 4XYMA 3RASA 3G3EA 1OZAA 1U5CA 3KBOA 4DTIA 3QWBA 3NAQA 3CMCO 1X0XA 3U4IA 3D3WB 1T2CA 3GVHA 3RROA 3W4KA 3U09A 2O2SA 4TVOA 1Z7BA 2EKLA 1FF9A 3IUPA 2Y1FA 3R3SA 3GNQA 4RVDA 2D4AA 4IGEA 3FD8A 1TI7A 3INRA 3DBLA 3GHHA 2QG4A 5DNAA 1P0FA 1JAYA 4JLWA 3KRTA 2Q1UA 1JW9B 1YE3A 5A9TA 2VNAA 4RCVA 1GQQA 3VDQA 4FOSA 2GF2A 1E6WA 1HE5A 1HLPA 2G76A 3FRJA 5ADHA 3X2EA 1R12A 2NSDA 3P2OA 4GMGA 5IDXA 2HMVA 3WGGA 4TRRA 4BIIA 2I5PO 5K9ZA 4XQCA 3TL2A 4A10A 3FBTA 5U4QA 1GDHA 1X7GA 2NTNA 1V3TA 4J90A 4E6PA 4RO0A 1S7CA 1C0KA 1GZ4A 1LI4A 2DUWA 3H2SA 3BYZA 4NJMB 4BKQA 1O95A 4Y9DA 5DCWA 1KY5A 3KOUA 1NFQA 4U0JA 1VKOA 1TXGA 4IDGA 4B79A 1MP0A 3C7DB 3WQQA 1VJTA 5ICMA 3KV3O 3ANLA 5KJ6A 2JKVA 4QQRA 3WB9A 9LDBA 1VLLA 4QO8A 3E18A 1KEPA 2C20A 4MP8A 1F12A 1B15A 2VZ8A 1PR3A 3ANMA 1XR3A 3QSGA 1N9GA 4W9NC 3KEOA 3ZV5A 3QVOA 2O7QA 1GPJA 1GQ2A 3W8FA 2VHZA 1G0OA 1U2GA 5JMPA 5IF3A 5JMWA 1SOWA 1SB9A 2ZB7A 3GG9A 2WMDA 3HN7A 3BTVA 3QRWA 1AHIA 2AEJA 1T2AA 1NFFA 4NQZA 4BNIA 1U8FO 2VUTA 5IDQA 3KZVA 3MOGA 1IULA 2QRJA 4HFRA 1M6WA 4OH1A 1I8TA 4P4GA 5KVCA 4IXWA 4XA8A 4YJGA 1J5PA 3RCBA 3DONA 1FDUA 1IUKA 3MWDB 4O6VA 5LC1A 4CM4B 2VUSA 1T25A 5ER6A 2QRKA 3GAZA 1ZZEA 2J5KA 3BMQA 3FR7A 1GPDG 4MP3A 3WGTA 1A4IA 4WUVA 3ZWNA 1PQUA 4F6CA 1ZK1A 2LDBA 3ROPA 4M86A 1I3MA 3ZN2A 1HWYA 3QVWA 4BO8A 2IZ0A 2V6MA 4XDZA 5TSDA 3CSDA 4BVAA 3JQAA 4UVIA 3H8VA 4F3YA 1DXYA 8LDHA 2JHFA 4J4TA 4OMUA 3D4PA 1M67A 4DMMA 1V9LA 1WZEA 3HE3A 4PZCA 3RUEA 3UVEA 5KVSA 2XPCA 4PIVA 1KEWA 2OMEA 5JDCA 2UAGA 1B8VA 5L7YA 1KEVA 4MO2A 4CR7A 1I2CA 5KVVA 1DB3A 3K73O 1ADFA 4FCCA 2YJZA 4CMBA 5CDGA 1U4OA 3RKRA 4BMVA 3PJFA 4G5HA 3RUFA 3DFZA 1Y5RA 3H5NA 3BMOB 3ZWPA 2UVDA 2Q49A 2PH5A 1LJ8A 5TIIA 1R37A 3JQ9C 3LSYA 5AQ1A 4PFJA 1XQ6A 2Q99A 2ET6A 4Z0PA 1PL6A 5EQFA 2IZ1A 4OOEA 1Y8QB 3WWYA 3PWKA 4OJNA 4PCVA 4BGEA 2AG5A 3L0DA 5TQVA 1DIBA 4WNIA 2Y0CA 4BV9A 5U1PA 5G2OA 1I5RA 3HB5X 2DVMA 1YBMA 4JNKA 3JQ6A 1DIHA 1E1MA 1CDOA 3GRPA 5ILOA 1DEHA 2O3QA 4OM8A 3VH3A 3RBXA 4E5KA 5KIAA 1GUFA 4O59O 4FFMA 4U6SA 3JSAA 3UH1A 1XEAA 3Q1LA 4NK4A 3VDRA 4BMNA 2WD7A 1FDTA 1WWKA 2OOSA 4FC7A 3E9QA 1XDWA 4ND4A 4URFA 1C0IA 3GGOA 4K6CA 4YAGA 1R4MB 3DQPA 1PX0A 2B5VA 5L9AA 5JDIA 2NQTA 2NWQA 5AVOA 3F4LA 3GAFA 5KKAA 1ENOA 4RV9A 3WYBA 1M76A 1Y5MA 5AXDA 5CDYA 2QIOA 3O26A 1GZ3A 4D3SA 1E7WA 3K30A 3ST7A 5ITWA 4XD2A 2BH9A 3B1FA 3ZWCA 2H9IA 5GZ1A 2NLOA 4YJDA 1ENZA 2NUAA 4HBGA 1VJ0A 2GNAA 3TDKA 4N5MA 5KOIA 4IBOA 1UP7A 4WE3A 4GGPA 1TB4A 3NGLA 3NGXA 1IPEA 4RQUA 2O3SA 3GUCA 5T8KC 3I1JA 4BNKA 3UGKA 1CEQA 1KETA 1PSDA 2Q4BA 4IZIA 3M6IA 1Z75A 4GI2A 3EVNA 4R1SA 1P1HA 2P9CA 4CV3A 4LK3A 5L3ZA 3PYMA 1I2BA 3N58A 1U4SA 7MDHA 1XG5A 5L53A 4CMIA 5DOVA 4IQ0A 3TOZA 1Z82A 3MJ4A 3LU1A 4W4TA 1EUDA 5F1OA 5IXSA 3VPGA 1HRDA 2ZTVA 4EJMA 2ZKLA 5A9SA 5L4NA 2ZQZA 2EXXA 4JIGA 2AXQA 3JQ7A 4HUJA 5IFLA 2Q1SA 3H7AA 1LDBA 1HYEA 4H3VA 4Z9XA 4JXKA 4CQLB 1DFGA 3UAGA 3IS3A 3IDSA 1E5QA 3DZIA 1BVRA 3FN4A 1JAXA 4YACA 5C7LO 1E0DA 4PG6A 2HSDA 1A4UA 2P9EA 4BO6A 1P31A 1DC6A 1I32A 1YBVA 4YR9A 3CKYA 4BO4A 1ARZA 3UICA 4IIVA 4TZKA 3ZGYA 4RJTA 5L45A 2IRWA 2ZTMA 2VOJA 4ONEA 7ADHA 4XB1A 4D42A 1D4FA 3PQFA 4J6FA 4C7KA 4IDEA 2LDXA 3WSWA 2DAPA 3DBVO 1PTJA 1NVGA 2EEZA 2OFPA 3H65A 3UCEA 4FQ8A 4A7PA 2YHIB 4DPKA 3R3JA 4JK3A 4UEOA 4MINA 5BR7A 3C85A 2V6FA 1EMDA 2NACA 2B4QA 1EEHA 1H5QA 4FW8A 4Q3AA 4Q39A 3GPIA 3AOEC 3HFGA 3WS7A 1T24A 4E32A 5L51A 1XU7A 1JU9A 4EJ6A 5I9LA 2UUOA 4PVCA 4J4HA 3B1KA 3MJSA 3A4VA 1PWZA 1I36A 1N5DA 2OHXA 4IIUA 5A5FA 1PJ3A 4DBZA 1VRWA 4E5YA 4D41A 2IXAA 3ADOA 3DZBA 3VPFA 5L4LA 2YHIA 1VI2A 3T7EA 3LVFO 4LRSB 2B35A 1YOVB 1J49A 3O03A 4II3A 3RC2A 4Y6RA 3ZHZA 5JSFA 4GVLA 1SCUA 3AY7A 4UVDA 4E5MA 2HU2A 2Y68A 4XRRA 5DT9A 5ER9A 3KYCA 5TLSA 1UXHA 4IDAA 1LSUA 4OO3A 5H82A 2FWMX 3Q11A 3UOGA 4BOYA 4B4VA 4RPHA 3ORFA 1UR5A 3PWSA 4GL4A 4R68A 4YAIA 3Q9UA 4B4WA 3UHAA 5JAQA 3WR5A 4NNJA 4NHEA 2GUGA 1LXCA 3LT1A 2PY6A 2C59A 1LQTA 1P1KA 4A27A 2PD4A 3GEGA 4MIYA 2BGMA 2X9GA 2JD1A 1PIWA 5A05A 4BNYA 1PZGA 4BNZA 4RF3A 4IMRA 3VAZA 2EP7A 1H9BA 4CQLA 1ONOA 3ZW8A 1RM3A 4PRLA 4P4NA 2A92A 3U5TA 4UUPA 4NPCA 1ZK3A 5BQFA 3DBRB 5IZ4A 1HDRA 1GR0A 3GZ4A 3AUSA 1N2SA 4GAEA 4UUMA 3AI1A 3NTQA 4NH4A 4OHUA 3OFSA 1QG6A 2Q4EA 3BMCA 3TNLA 3W4JA 1AE1A 3F9IA 1MX3A 4NBWA 1R0SA 5FWNA 3O38A 4KUHA 3PEFA 1MC4A 3ZWVA 1Z7EA 4CLOA 1A7KA 5A04A 1NBOA 4DQXA 2HK7A 1LNQA 2CFCA 1K3TA 3TF5A 4HV4A 1QYDA 4PLGA 4CJXA 2AA3A 1PEDA 5ILGA 4AICA 2PGDA 4AJJA 1B14A 3LF1A 4QX6A 3LC1O 5HM8A 3ENKA 4AJ1A 1GUZA 3PP8A 3MJVA 3U4HA 5CPFA 3ONEA 1H2HA 4BKOA 4M8SA 4IPTA 4UULA 1X15A 4P4LA 4YWJA 1XLTA 5A3JA 4F46A 1MGOA 3VZQA 4YT5A 2IEBA 4BKRA 3FNHA 4LVCA 2DU8A 4G81A 4AJHA 3KLPX 1E7QA 1QLHA 3NYWA 5G0TA 1HDYA 4IINA 4NMHA 3E03A 1LUAA 3AUAA 3G79A 4WEOA 3UW3A 5J23A 1JLLA 2BI8A 3U9LA 3CEAA 1K5HA 3E6AA 3KXDA 5EIOA 4G2NA 4XQ9A 4N5NA 1PGPA 2BRUA 3OIDA 3N74A 3E82A 1WMBA 4PZEA 3RFVA 2HK8A 4J16A 4E30A 2NVUA 2IE0A 3QQPA 3GDGA 4R3WA 5F3RA 1J4AA 5A02A 3WBFA 4UVGA 3FI9A 2NVWA 4EDFA 3D4OA 3ANNA 1KERA 3DZJA 5FF9A 2Q2QA 1Q7BA 2UUPA 2W2KB 4DIOA 9LDTA 5B4TA 1IPFA 1Q2XA 4AJ2A 4AJEA 3RUHA 4J49A 1CF2O 1JWAB 3PHGA 1U3WA 2EKPA 4I9HA 3MZ0A 3RI3A 3AFMA 4Z3KA 3BAZA 4PLCA 1ZK2A 3GVXA 5DULA 3RBVA 1HE3A 4RPJA 4L0QA 3L9WA 4BMSA 2NU7A 3HN2A 4JJIA 5I7FA 3DWFA 1QMGA 1KBZA 4F6LA 2CD9A 4D43A 3H4VA 4NFHA 2CDBA 4H7PA 3TWOA 1NTOA 5C7OO 3JQAB 2DTXA 1NQTA 4BV8A 2Z5LA 2GN6A 2VTEA 3WX0A 3OJOA 1GD1O 3ZU4A 2B37A 4WECA 2FN7A 4KMSA 3KYDB 2WTBA 3U4DA 3BMQB 1BDBA 3IP3A 1K6XA 4QUKA 5GMOA 1IZ0A 1P33A 2B69A 4YJGB 1YBAA 5ENVA 4XYEA 4E4YA 3F5QA 5MGBA 3I9LA 2CVOA 3IC5A 2AHRA 4FFPA 2BGLA 4RF4A 2CDAA 2WYWA 1EDZA 1H0KA 4AJNA 1UDAA 4KZPA 3MTJA 5MDHA 3GVIA 4XDYA 3COSA 2EWMA 1GZ6A 1ID1A 4CM8A 5JCJD 2E48A 5BSHA 1YXMA 3E5RA 4BO9A 3FHLA 4I9UA 5T64A 3RFXA 3GPDG 1XCBA 3SC4A 3ZV6A 1T4DA 2PA3A 2YZ7A 1YJ8A 4NJOA 4Z9YA 1F17A 3IP1A 1ML3A 3BHMA 2VRCD 3ASVA 4EW6A 4RZIA 4D0SA 5JDCC 4WPGA 4Y67A 1EBUA 3E1KA 2JCVA 1MA0A 3WGZA 4M89A 4IS2A 2YV1A 2I6TA 3IKVA 4FS3A 3WSVA 4DPMA 1EQUA 2OZPA 3U4CA 1WXDA 1YL5A 4HWKA 2JFGA 1BW9B 4NBVA 3ONDA 3EZYA 1ZSYA 3OIGA 3U0BA 4D45A 2RCYA 4PLFA 3GVCA 4F45A 4I5DA 2AQHA 5BT9A 3QWIA 1LDYA 2I99A 3VC7A 1U7HA 5I9MA 3ZV3A 3JQ9A 1DLIA 3Q6IA 2Z1NA 3EY4A 1P1FA 3LDHA 3L4BA 1C0PA 4EEZA 2FHSA 2D5AA 4C7JA 5A9RA 1V3VA 4CMEA 3LK7A 3QY9A 4GBJA 1VE9A 1E1KA 2CVQA 4XZ3A 4ZQBA 2AEFA 3U62A 4NFYA 1XA0A 5IJZA 2O4UX 4HX5A 4TRMA 1QP8A 4CMHA 4CM6A 1IE3A 1SEVA 3T4XA 4YJHB 3OP4A 2GCGA 4NG5A 5L40A 3VTZA 3GN2A 1EDOA 4MVJD 2O48X 4BNFA 3GT0A 3RIHA 4EJ0A 1G6KA 2C54A 3SC6A 5B4VA 1XSEA 1BW9A 4LW8A 1FDSA 5CDUA 1NASA 1TVEA 1SOVA 1GEGA 1OAAA 4R1NA 1CQJA 2F1KA 2PKRA 5JC1A 3KSUA 2PZLA 1UXIA 1C1XB 1QXSA 4OKNA 3HADA 2ZJ0A 3PK0A 4BUCA 4EBFA 1PGJA 4MVJP 3I4FA 2XF8A 3MOIA 4DIFA 2VCYA 3GMSA 4PG5A 2HCTA 1R4NB 3BA1A 3G1UA 3NJ8A 2VT2A 5CG2A 1PJTA 2AQ8A 4YQZA 1A9YA 4I9NA 3SVTA 1H94A 1LC3A 1EVJA 2GPTA 2R00C 4DLLA 2FPPA 4XB2A 2J3HA 3MJEA 1MB4A 1QV6A 2PD3A 2J6IA 3A28A 3RKUA 4B7CA 4PLVA 2B5WA 5JPIA 1E6EA 2E37A 5JW6A 3LC2O 1BG6A 2YV3A 3DAPA 4Q3CA 5DZSA 4I1IA 2GASA 4UEKA 3ZH2A 2NQ8A 5GZ3A 5F21A 2O4CA 4CUKA 3DZKA 3R6DA 4LMRA 3L6DA 1ZJYA 3FWNA 2HMTA 4ITUA 1F0YA 1LLDA 2OP1A 3AK4A 3P5SA 3TL3A 5T6BA 3G49A 2CF6A 3E9NA 1DFHA 1C1DB 1P44A 1C1DA 3RUAA 2Y1EA 2C7GA 1X14A 1E1LA 2ZK7A 5BSEA 2FOIA 4OXNA 1E7SA 3PYLA 1EE9A 3NUGA 1V3UA 1O8CA 4MPDA 2WYUA 3G1TA 3ROQA 1E3WA 4CUZA 3ITDA 1ZIDA 4AFNA 3WIEA 1HE2A 3RVDA 5JS6A 1ONPA 4XR4A 4FPXA 4GMFA 4IJKA 4BO5A 1ZK0A 3D1LA 4J9UE 5DCUA 4B8ZA 3LZ6A 1U8XX 3ZZNA 3L4BC 2B36A 5L7WA 4BGVA 3H9UA 3DTTA 4WKGA 4P22A 4JBIA 4WGGA 4HKTA 3KYDA 2QZZA 4BGUA 1PGNA 1I0ZA 3NT2A 5B12A 5IN5A 3WYEA 2AEMA 5TGDA 5KWEA 2B4RO 4BO3A 2CDCA 1VL6A 3SBOA 1U7TA 2X9VA 4JBHA 1NR1A 4JJGA 3I52A 3WGIA 1O94A 3BTSA 3FTPA 3GGGA 4YEDA 2DFDA 2ZYAA 3PDJA 3H9QA 1BRMA 4LSWA 3RC7A 3T4EA 3DR3A 1RWBA 4D3DA 2EP5A 5F1PA 4UEJA 4AJ4A 1GU7A 2NVUB 3WLFA 4GX5A 2WDZA 3QA9A 4FJ2A 3BXXA 5CHEA 4E12A 4FDAA 1T2EA 4TRNA 4JBGA 2Q1TA 2E6UX 3KO8A 1PS0A 5TRTA 4BNXA 2NU8A 2YUTA 4UVHA 5I7EA 1DRVA 4I08A 4O0LA 4PG8A 1E5LA 3FR8A 3QE3A 2FZWA 4Y8VA 2VUUA 1GEEA 4B8WA 5U9CA 5TX7A 1ZEJA 1B0AA 1ZW1A 3L07A 3WQSB 4P38A 4YJHA 1PJLA 2HLPA 2C5AA 3EHEA 3ITKA 1WMAA 4INAA 5IDYA 1E3EA 3C7AA 3UCXA 1LC0A 5ENDA 4WCFC 5JXWA 3JQFC 2A94A 3RC9A 1HSOA 1ZCJA 3GG2A 3GQVA 2PGLA 3QHAA 4GPD1 4NU6A 3V5NA 3VOSA 2DPGA 5G0WA 4AJLA 5CFZA 3DHEA 5JYDA 2WYVA 1E7RA 1HDZA 1YONA 1DRWA 3TZ6A 2CUKA 3QWAA 4KDFA 3JQGA 2PFGA 1IY8A 1M6HA 4OQZA 3W8EA 4BHTA 5EPOA 1ZK4A 1HDXA 1O89A 2W4QA 4TZTA 2P9GA 3S2EA 4FGWA 3CZRA 3VPXA 1PZHA 3TJRA 4C4OA 1EBFA 1QYWA 2C2XA 2PV7A 1X1EA 4GKVA 5FYDA 5ITVA 3V1TC 4A5OA 1E3LA 3CXRA 4XQGA 4IJVA 2GR9A 1L1FA 3WJ7A 4GVXA 2EG9A 2J5RA 1JVSA 3IQDB 4YAEA 4DXHA 2OL4A 4BO0A 1J6UA 2VQ3A 4WNCA 1SEPA 2Q2VA 4D7AA 4J7CA 2JJYA 4HFJA 1E3SA 1QR6A 1RYEA 3ZW9A 2GSDA 4ALNA 1HYHA 2ZB3A 1HEUA 2I67A 2BHLA 2ZYGA 2YY7A 3F4BA 3JD1A 3HSKA 2X8LA 4RF2A 1MXFA 4ZQHA 5EJ2A 4WEQA 5I8WA 3PVZA 5KVQA 1JWBB 4CLRA 5DBGA 1C14A 4R41A 5IAAA 1Q0LA 1WPQA 2QZ9A 5CEEA 5KTKA 4MVJA 4W99A 2YDYA 4XJTA 1P3DA 4Z0HO 5DF1A 3JYPA 1U5AA 3T7CA 1N8KA 1A5ZA 1HZJA 2QRLA 4NK5A 4WLVA 4LRTB 2EF1A 3ZNNA 3CTMA 4MJLA 4B4OA 4ZQGA 1UXJA 2HQ1A 4Q3NA 1AN9A 5T8KA 1XGKA 3DO5A 1MV8A 1PWXA 2D1YA 3WWZA 1D8AA 5TT0A 2X5KO 3AY3A 3GGPA 4E33A 3DBHB 1N7GA 2P2SA 3NTOA 3DBRA 5DP1A 2C0CA 3C8MA 4PLTA 5KNLA 1QYVA 4QEDA 4RDHA 4WASA 1WLYA 4ALIA 1B3RA 4FJ1A 4TROA 2J8ZA 5G4KB 2JFHA 5AXBA 1TT5A 2H5LA 1IOLA 1VJ1A 4XGKA 4BNGA 1EUCA 1Y9AA 2FZEA 3TZCA 2RH8A 4MOWA 5JCXA 1PS8A 2I3GA 4EUFA 4FOOA 4OXKA 2I3AA 4WLOA 1M2WA 2FP4A 4OOFA 5GZ6A 2HRBA 5HA5A 3ULKA 2C07A 4CM3A 1HLDA 1MFPA 2BFPA 2YW9A 1G0NA 2VHYA 1DHRA 2DBVO 3VKVA 3WFIA 3GY0A 2A35A 1LRJA 3V1UA 1OMOA 1EE2A 4QO7A 3DXFA 3RUIA 1X7DA 3ASUA 3OJLA 3WXBA 4DYDA 5CPBA 3ZHBA 3NT4A 2JAPA 4NI5A 1CYDA 2OBNA 1ORRA 3HB4X 3PXXA 5EINA 3JQCA 3ZDFA 1T26A 4IS3A 4WCFB 4WCFA 3F47A 3W6ZA 4A73A 2OP0A 5IG2A 1VL8A 1D1SA 3EUWA 4ZRNA 1WDMA 2AW5A 2X58A 3D3EA 3FTNA 3PGJA 4ZQFA 5JBIA 4KWIA 1HE4A 4OSOA 3OA0A 4Q3EA 5FI3A 3RU9A 4BNNA 1IHXA 3ZWOA 1MC5A 3L6OO 1XWFA 4UAGA 2O3RA 5F5NA 4XJSA 3DAFA 2X6TA 4D0RA 3DHYA 4IY1A 1FXSA 3WG9A 3PQDA 1Z6ZA 3HDQA 3TZHA 4BGIA 4DWVA 1W4ZA 3ZV4A 3FNGA 4L8VA 4LN1A 4U0KA 5DN9A 4DPLA 1NAIA 3NTRA 4XQEA 4ALJA 1YS4A 1IL0A 1Q0QA 3I9KA 3S2IA 2OORA 3JCZA 2O50A 4ZRMA 3H3JA 1FDVA 4MVJF 4CMAA 3GLQA 3V2HA 3EZLA 4EUEA 3TOXA 1NHWA 3JYOA 3U3XA 1NFRA 3QWHA 4RVGA 4DREA 1EUZA 1J0XO 1Z73A 1ZMOA 3DOJA 1PQPA 2ZJ1A 2VHVA 2EGGA 2GDZA 4XGIA 5IDWA 2X0NA 1QV7A 2ZYDA 4GH5A 4YPOA 3OBBA 3K31A 1ADBA 2NVBA 3K96A 1O0SA 2I65A 2CY0A 3NEPX 4FFRA 4X54A 3TFOA 4ALLA 4R1UA 2A9FA 1A71A 3VPHA 4L74A 2OBYA 3V2UA 4PN3A 4CLXA 5JY6A 5TJHA 1P1IA 2DUUA 1NQ5A 4EITA 5DBIA 4BNMA 1NXQA 1ZXLA 3CPSA 4YRDA 2W2LD 3GNSA 3TN7A 4WLEA 3HWRA 3OEYA 3I9JA 5TF4A 2J3JA 3JD4A 4E3ZA 2B0JA 5BSGA 4R5MA 4I5GA 2BFMA 2EHDA 3ZNQA 5DP2A 4GWKA 1NQOA 4KQWA 1U1IA 3RC1A 3AFNA 2JL1A 2VWPA 1IZ9A 1LSSA 4KWHA 3QJ5A 4R1TA 4BKPA 1E7YA 3WIDA 1YGYA 2EGHA 4U8GA 1U9JA 2CNBA 1DIGA 3IL2A 2WE7A 3OJFA 1WAMA 3ONFA 5AXCA 3H6KA 3QVXA 3ZI0A 1DBVO 5KJFA 4ALKA 3INGA 4ND3A 4NBTA 4BNTA 1KC3A 1GV1A 2EJWA 1E6UA 1T2DA 2CF5A 1Q7CA 2PR2A 2WD7B 4NFSA 4OSPA 1DOHA 2DTEA 1SC6A 3HJAA 3EMKA 1ZJZA 4XYGA 3SEFA 2Y93A 4RF5A 5G0SA 1NR7A 3PZBA 1LSJA 4FGSA 2ILTA 4IQ8A 1SB8A 3GOHA 3KM0A 3AI3A 4RQTA 1CIVA 1YWGO 4A2CA 2X0IA 2WE8A 1LU9A 3DDNA 4YBZA 2G82A 3AUTA 1GL3A 2UYYA 3ZWYA 1ISFA 3FPCA 4ROSA 1WVGA 5KCZA 3GHYA 3AUUA 5FI5A 4BNLA 3GZNB 4RPKA 4AVYA 2JAHA 2HRZA 1E7MA 4J7UA 3G17A 1DC3A 3D0OA 2IXBA 3BMOA 3F6YA 3WOHA 2AQIA 3GNTA 3WNVA 3I9NA 3IMFA 2BGKA 4B3IA 1KY4A 1UZMA 2CMDA 4JROA 4YVFA 3STHA 1YO6A 4BKUA 3C24A 4R5HA 1ZUD1 5DCYA 1MFZA 2PNFA 4GKBA 3VPSA 1DJNA 4YAKA 3JYNA 1KYQA 5JC8A 3LLVA 4WLFA 2FR8A 3WGQA 4QFDA 1P1JA 4ND2A 2R2GA 3VVCA 2B83A 3QIVA 1NPTO 3KYBA 3OHSX 5THKA 3ZWBA 5G4KA 3H2ZA 1KEUA 2FRDA 4OL9A 1KS9A 1OI7A 4YA6A 1B26A 1LQUA 4JN6B 4RVHA 4W7IA 3K5PA 3V2GA 5CEFA 1Y6JA 1ONNA 1YB1A 3PWZA 2ZTUA 1A9ZA 1X0VA 4OAQA 3NX4A 2VHWA 3D64A 2O2YA 3PFWO 1NPYA 5EESA 1R66A 1DIRA 5FEUA 4ZN6A 1ENPA 3BMNB 1U2DA 2VTDA 3F5SA 1F8GA 1M75A 2PGJA 3ROKA 3UXYA 3VZPA 4MVJE 4LISA 2JCYA 4KQXA 1E3WB 4J1SA 3VH1A 5G0UA 1ISHA 1VSUA 1TT5B 5BNIA 2Q50A 2UV8A 2AMFA 3I6IA 2CSUA 4R01A 4CV0A 2C29D 2NV6A 3I4CA 4Q9NA 3S1LA 4XYBA 4Y6PA 1W6UA 3KVOA 2Z95A 4PG7A 2GGSA 4HNHA 1S6YA 1JA9A 4N18A 1HT0A 2VWQA 3WFJA 4IUYA 4GGOA 5H81A 3GFGA 2IYOA 3H9EO 4OIMA 1ADGA 3IOYA 4DBVO 4PRKA 2IYPA 1SO8A 3PTZA 3BHIA 5AYVA 3WGOA 1BGVA 4MVJM 4BO2A 1PU2A 1JDJA 1Y9EA 1QSGA 1I33A 2PZKA 4I5EA 1JQBA 3LT2A 4K1LA 2FMUA 1VPDA 2R00A 5TT1A 3H3FA 3OH8A 8ADHA 1LDEA 4L4RA 5EERA 2P91A 2QYSA 3RSHA 1YB4A 4KOAA 4XWYA 3FWZA 1LLQA 4E5NA 2VZ9A 2D3TA 3FBGA 1W0CA 2GN4A 4DA9A 4J4BA 1KVQA 3ZNOA 3VTFA 4E2YA 1C3VA 3JQGB 1YDEA 1SPXA 2P4QA 2A4KA 3B6ZA 4NJMA 3U49A 2Y0EA 3DC2A 1B3BA 3PIIA 1BXGA 3Q3CA 3QVTA 5CDSA 1O5IA 5DBFA 3IJPA 2X1HA 1KIFA 6LDHA 1A7AA 1NYTA 3TRIA 5TS3A 2VHXA 4BNHA 3OSUA 1HTBA 4QXMA 1QKIA 2DQ4A 5COBA 6ADHA 2YFQA 2X0JA 4MDHA 5C37A 4FN4A 3KETA 3KB6A 2G1UA 4R4JA 3EDMA 1LTHR 5HS4A 2GLXA 1NAHA 2O3UA 3VH2A 3OETA 4WLNA 1KVTA 4EUHA 2VN8A 1LSOA 1V35A 3BIOA 3O9ZA 2IZZA 4AJOA 2OXIA 2Q1WA 4JCOA 2W8ZA 2E49A 1UDBA 4PZDA 3AOGA 3ETGA 3VHRA 1E3JA 1Y8QA 3BTUA 1U3TA 2E82A 1RPNA 4IDFA 4EYEA 3RQSA 1RM4A 3RUCA 1H6AA 4XCVA 3NV9A 2Y1DA 2VZ0A 5A5EA 5L95A 2AG8A 2D5CA 1I3KA 5ICSA 2XXJA 3A9WA 1N7HA 4YT2A 5A03A 5IN4A 3QWFA 4GSKA 3H9GA 2D8AA 2FY8A 3F46A 3I9OA 3DBLB 2X23A 3KUXA 4AJIA 3S2GA 3IUSA 4K9DA 1SAYA 4CLDA 2VWHA 4B7XA 5F5LA 3TZQA 3GH3A 4IJUA 2G17A 4KUGA 4UUNA 4CL8A 4G65A 1I10A 3C1AA 1OC4A 1P9LA 3DMYA 3JQAD 1Z74A 1B2LA 3TFQA 2GN8A 4ZA2A 2DPHA 4JGBA 4E31A 3CUKA 5BSFA 2Y05A 1UXKA 4J0EA 2P68A 3TPCA 3R0IA 2O3TA 1EZ4A 4YT8A 4KP7A 4XIJA 4J43A 4B3JA 2W2LA 3EVTA 1BXZA 1GYPA 1CERA 4DC1A 1AXGA 1UDCA 4JP3A 5EMHA 2RIRA 5CAEA 4EGFA 1MG5A 1LDNA 2W98A 4YRBA 3A06A 4J0FA 4D3FA 1XU9A 2BI7A 2YQ4A 3DL2A 1FMCA 3PIDA 4J2OA 4NBRA 4J1NA 4NBUA 2QQ5A 3A1NA 3QP9A 3IKTA 3WQRA 4L76A 4LSMA 1VM6A 2IODA 3JQFA 4OKIA 1R4NA 1RJWA 4MKXA 4Z9FA 5G4LA 3WJAA 5JAIA 2Z1MA 2PD6A 3WTCA 2Y1OA 5F1KA 3I83A 2YYYA 1C1XA 2WM3A 3N7UA 2Y1CA 3WMWA 3L6EA 4B4UA 1E1NA 3RJ9A 4XRGA 3C7CB 3H5RA 4YB8A 4ILKA 4L73A 1KOLA 2C7VA 1WDLA 4PVDA 4RLHA 3ETDA 5AOVA 2X22A 2DFVA 1DPGA 1GFSA 1AGNA 3AU9A 4Y6SA 4K26A 1PJBA 3RBZA 1H6DA 3PHIA 1GQYA 2FR1A 3JD3A 5JAMA 2ZB8A 3F3SA 1E92A 4JP2A 3EC7A 1BTOA 3PHLA 1B8PA 4II2A 1MUUA 1D1TA 1JKFA 3H9JA 1ZVMA 3L4SO 1ZXBA 3UCFA 2Q46A 3L9XA 3JYQA 3PGXA 3KLMX 3KHUA 4WLUA 1LLUA 2DT5A 4TSKA 4Y98A 3LT4A 1DHTA 4NZ9A 3MTGA 1CJCA 4R3NA 3F1LA 3ADPA 3ZWXA 4ND1A 5HTOA 3IAHA 2WWRA 3JQBC 5COAA 4FC6A 4MVJH 4RVSA 3CE6A 3WNQA 4YXFA 2J3KA 4DUPA 2JD0A 4PGFA 1BMDA 5C5IA 3W8DA 1NVMB 1OBFO 1F06A 4DL9A 4KDEA 4NDNE 2EIHA 4PLWA 1PQWA 1PJ2A 4CL3A 1LDGA 5A1TA 4B3HA 4GSLA 2IDZA 3EW7A 3AI2A 1BXGB 1N92A 4E5PA 5B1YA 4ZU3A 4QSMA 1ZBQA 1WDKA 2WD8A 3H5AA 2BFAA 2H63A 1ZO8A 4CMCA 4FR5A 2NU6A 3D7LA 2VYND 3HDYA 1ULSA 3K8ZA 2HMSA 5HWSA 3AM3A 1Q0HA 1KVSA 2X7HA 4CODB 1RM0A 2QYTA 2Y1GA 1P74A 2YV2A 4L4XA 5JCJA 1GV0A 3DOOA 5LDHA 1DJQA 3I23A 1UAYA 2GZ3A 1F14A 4DIBA 1PJQA 3PLRA 2C82A 1QORA 4CM5A 1U3UA 3JD2A 1UZLA 4CLOB 4M1QA 1YQXA 2Q2WA 5DDIP 4QTZA 2ZCVA 4J2HA 5COQA 1EFKA 4ZVVA 3WGYA 1HSZA 4BQRA 1I30A 1F8FA 4MIOA 4UVEA 4XR9A 1DC5A 3AM4A 3ZU2A 4LVUA 4FB5A 4NU5A 3I6QA 1OFGA 2FSSA 5EN4A 1GAEO 3ZNPA 1LA2A 1TT7A 3V8BA 4W6ZA 5I7VA 3MJTA 2PWZA 3GDOA 3RUDA 2NM0A 1Q1NA 3NJ4A 4CM8B 1XIVA 1B8UA 3D4NA 1BXKA 4TQGA 4XGNA 2VRBA 4MKZA 1HZZA 2ZQYA 5LDGA 3JQ8A 3NDRA 2O23A 1B7GO 4IDBA 2QW8A 3MEQA 2D0IA 4EZBA 4ALMA 5TC4A 3HQ4O 1I3LA 3LLSA 5B37A 4PLYA 1WNTA 4RGBA 4K6FA 1EK5A 3M2TA 3KEQA 1P0CA 1XELA 4BO1A 3AM5A 1HDGO 2RHCA 1TA4A 1VC2A 1GCUA 3QV1A 2VRCA 3ZCXA 4DLAA 3TSCA 1SNYA 2BKAA 2X5OA 3PHJA 4U5QA 4RPLA 4AL4A 4FFLA 1YRLA 4BO7A 1NP3A 3E5MA 1PR9A 3Q0EA 5JYEA 4M87A 1AUPA 3E48A 2EJVA 1TEHA 1HETA 2X5JO 1GYQA 3OIFA 2HMUA 1AHHA 2EERA 2EKQA 4RPGA 4FBGA 4ZGWA 5JY1A 2AE2A 4IZHA 4B7UA 3DMTC 5DOZA 5HBRA 1BHSA 2X86A 4E2XA 4CQMA 3M1AA 2BELA 5JLAA 3DHNA 3FPLA 2X0RA 2HKIA 2Q3EA 1T1RA 3Q2IA 4KUEA 4BNUA 3DOCA 3F1KA 1EQ2A 4R9SA 2SCUA 1QLJA 1JVBA 3Q9NA 4RL6A 4BNVA 1HDCA 4YJFA 4CM7A 2W2KA 1V0JA 3LYLA 2JFFA 3O8QB 4BS9A 3BMNA 3GZNA 2DKNA 1I2ZA 3O4RA 4ZQEA 1NVTA 3P19A 3GEDA 3W4IA 1OC2A 4IDCA 3W6UA 2QHXA 4IGFA 4LCJA 3X2FA 3OF2A 4BNJA 3PJDA 4JQCA 3FCOA 4U7WA 2B4TO 2AE1A 2GO1A 1SMKA 1ZNQO 1ZSNA 5H83A 1BVUA 2XAAA 2PZJA 3FNEA 4TWRA 2DC1A 4AJKA 4O63O 4YDRA 3GMDA 5KJCA 1PL8A 3DZFA 2DM6A 5L4SA 2YDXA 2PLAA 3OJ0A 2GD1O 1BSVA 2CZCA 5I7SA 2PKQO 4BB5A 2HJRA 1HL3A 4DVJA 5A4DA 1UH5A 2O3JA 3ICCA 3OEWA 3GDFA 4EI2A 5I9NA 3WLEA 4EEXA 3BHJA 1VL0A 4Z3DA 3BMCB 4D79A 3OA2A 3M2PA 3AJRA 4N7RA 1IYZA 2F00A 1VKNA 1P45A 2C2YA 3DAGA 3ICPA 4HFNA 3ZWAA 2DBZA 2O7SA 2HJSA 2VT3A 4IM7A 3RFTA 2JD2A 4CQMD 2H6EA 4FSHA 1QYXA 3WGHA 1Z45A 3CZMA 4ND5A 3HHPA 1HXHA 1UZNA 5TNXA 3WDSA 1D7OA 1W73A 3JTMA 4CMIB 1LBEA 4CLHA 1NQAO 1ZEMA 1T2FA 2GRAA 1DO8A 4MIEA 1GADO 5GY7A 3PLNA 1PJSA 4U6QA 3V1YA 2HMWA 3IJRA 4OQYA 4TKLA 4YQYA 2NTVA 1TLTA 3ABIA 3I5MA 4CV2A 1YVEI 5JE8A 4YCAA 2DTDA 4WOKA 3PFFA 3SLGA 2CVZA 2PK3A 4J9VA 5JAZA 3S55A 2VWGA 3EGOA 2NTJA 2PH3A 1UP4A 5K0ZA 3I9MA 5T5QA 2ZIZA 2H1SA 1HYGA 5BNFA 3OQ6A 1KVRA 1W8DA 4N54A 5FFFA 3ETEA 4UREA 1JTVA 1MXHA 3B1JA 4MP6A 2V7PA 3RAJA 3TZKA 3VH4A 2HK9A 3M1LA 2G0TA 1UJMA 1PJ4A 4NIMA 4GWGA 1HF3A 1L7EA 1YOVA 3ON5A 1WW8A 4I8XA 3E8XA 3GA0A 4N5LA 3ZU3A 4FD3A 1E77A
chains in the Genus database with same CATH superfamily
1A8UA 1NYQA 4MQ5A 3PJEA 4IMPA 5IT4A 3WJ2A 2YZKA 3HFSA 5HGJA 4WY5A 1QO0D 3A01A 1EFCA 3LT0A 1P5RA 3NAZA 4OGWA 3OPQA 3DZGA 2G06A 3GRAA 3AINA 4Z6YA 1ZI9A 5A1TA 2OO5A 2YQ5A 1U0GA 3ZMSA 4ZHQB 5HS9A 2FZKA 1W7PD 1Q15A 5EG0A 2C0QA 1YZLA 2JA1A 4E09A 3IIIA 4H59A 4RNDB 1JYFA 5JYDA 1E69A 3MCVA 1NW7A 3FF4A 1CR2A 5CFQA 1Q0ZA 1ZPDA 3OYFA 1IAVA 1UXGA 2FPGA 2BGUA 3CLOA 2HA5A 1XO1A 2V65A 4PLHA 4RBOA 2QL9A 2GAUA 3RLIA 1OWOA 2PIDA 2X4DA 3LZDA 3DXXA 5L3DA 3DDCA 1YJQA 1GYRA 4TQUS 4CMKA 3ZZ0A 1YDGA 1X80B 5CDFE 1EFTA 2VYVD 1TQ6A 4XARA 3ZE2B 2VOEA 5B1DA 1W5SA 2X4GA 2NYUA 2NADA 3DC7A 3F6CA 3KUUA 1GPUA 3C3XA 4P5PA 5E2AA 3TINA 3S3OA 1XTKA 2QL5A 4IQGA 2NNYA 5FWDA 1JXQA 1KGSA 3DP9A 3AG3H 3HPRA 4C7OA 4X93A 3DZCA 2JPCA 2XKKA 2IVZA 3DAHA 1P6XA 2XF5A 5LCXA 5HS6A 3T34A 2DHCA 2P5KA 4I99C 1LK0A 2C2BA 2ZQ5A 4R8KA 4LHYA 1GNRA 1NU8A 1PR6A 1SD2A 4RIHA 4CKYA 1LEHA 2ONKA 1X58A 2RREA 1VIVA 2RGAA 2WHRA 3FNFA 5LU9A 3TOSA 3F8WA 3GLVA 4AIJA 1U2RA 1XHLA 1FJLA 2EWWA 1DDOA 2PBZA 4M1WA 3QBDA 5LJIA 1KOGA 3NCTA 2C9BA 1NK3P 4YAJA 2IS2A 5IXYA 4XKVA 3IQXA 3IT2A 2J07A 2RHRA 3LWDA 3RT9A 4WXCA 1G6Q1 3KTAB 4WJZA 3R1IA 4MRSA 4ZEOA 5FB2A 4YV1A 2DP4E 1GM5A 4KFTA 2XASA 1PX2A 3QEAZ 1RUNA 3M8EA 1O6ZA 1U2PA 2VP9A 4G0MA 1T5BA 1W49A 1DZ3A 1MIOB 4NESA 1FJHA 3AHIA 4XOTA 5CFOA 2HGZA 3FXRA 5T57A 4BQPA 1XPRA 3G2BA 3RTBA 1PNTA 1TGVA 4PANA 2JHGA 4HX7A 1U0NA 2JK1A 2O20A 2Q0XA 1Z17A 3ICOA 4HVAA 5ALTA 4C6RA 2HHAA 5E95A 4PPNA 4ZCRA 2IJLA 2MABA 1PZEA 1Y4AE 2DTZA 2FLVA 2R1UA 3HUDA 3MMNA 3PB3A 2ZAIA 2FVYA 4G56A 4XDHA 5JAUA 4LYDA 3BK2A 5AXAA 4FZJA 3QEBZ 1JI8A 4FFNA 2HIGA 3PBKA 3QPVA 4GL2A 3A0BC 2DE0X 2FZLA 3I3OA 4BB6A 1JKMA 1FX7A 3C1TA 1SCDA 1NXSA 4P98A 1UT8A 4RORA 3PJRA 3BTLA 3OQOA 1LDMA 1UJ4A 1MOZA 2F1IA 4BQAA 3T8YA 4WNAB 3ZI7A 4EHAA 1E3MA 2L0XA 1Q20A 1YQDA 1JIVA 3COPA 4R69A 3D6VA 3IE1A 4I1IA 4H1UA 3C2BA 2NNLD 4K8RB 5EGOA 2ZG6A 4K1XA 2NUAB 1NKSA 3OUTA 1DSSG 5A9SB 2ZBGA 5AK5A 3V7NA 4MVXA 3LNQA 2AR0A 4L9RA 2Q1XA 3KSDO 4NHJA 1LDDA 1K98A 3SX2A 2SBTA 3JQ8B 4IJWA 4EQZA 3ISPA 4F4FA 1JHHA 3KKKA 4HV6A 1H8AC 3CX8A 2IXEA 3B2NA 3GUYA 1KIAA 1H0MA 1ODTC 2D62A 1PL7A 2HDHA 1Z7YA 2NU9A 2Q5CA 4R98A 3CZ4A 2OZUA 5KHDA 2Q62A 3GJZA 5H3LA 2P4UA 1R4MA 2IOYA 4E4TA 1O1YA 3K1PA 2VQEB 3DGFC 2RG7A 2CCGA 2EV9A 5EXTA 5DD8A 5GAHJ 1CWUA 3Q87B 3TTUA 4UASA 4DTCA 4JX8A 4E2WA 3DEWA 1LI5A 3D8SA 2X4LA 5LZ7A 3LFUA 4AXBA 5AHKA 3HTUA 1X3LA 2ORIA 3GLFB 3ENNA 1L7DA 4IHJF 4UFOA 1RRCA 3HDGA 1EX9A 1JT0A 4I66A 2FSVA 4HN9A 5AK0A 2AN9A 1OYVA 1OB5A 1U28A 1UQUA 4EG8A 3KQHA 5KKCA 4ZAZA 1GCIA 1XEFA 4NYMQ 2HOEA 1PUFA 2HJ9A 3CKKA 3HB1A 4DLNA 3EVAA 1DKRA 4GE0A 4E0BA 1DT5A 5D51S 1MW8X 1FTZA 3T5DA 5ALZA 1TKBA 1U81A 1V6AA 3GBSA 4L85A 5IVPA 1AKTA 1M72A 3DB1A 3MCAA 4KA4A 4M54A 1HKUA 3FPJA 4EPTA 3EXHB 1R15A 1WJGA 3BBLA 3GC6A 3DMHA 4HI0E 1XDSA 2XPWA 3HUGB 1W30A 3IWZA 1DPRA 3EGXA 2JW5A 1GPH1 4OLHA 5J9FA 4XWKA 4CLRB 1R9GA 1ETOA 3B20A 1WDWB 1XMVA 2CJPA 3I2FA 3LXUX 5KREA 2DY1A 4TN1A 4DW6A 3GLGA 3KXPA 1H3FA 3N8IA 3O74A 3JD0A 4CEJA 5DCFA 1FRZA 2OFFA 3FXJA 2R84A 3P2KA 1T0FC 3SLKA 4LNHA 2CXHA 2GN1A 4M1EA 4M55A 1ON2A 4N0EA 5KWSA 3UTDA 1J21A 4LGYA 1XD7A 2G0EA 4Q01A 3D5EA 2ZCJA 1ISJA 1KJZA 1QAQA 2DBQA 4R16A 2O6HA 3S14J 2J3QA 2ZJBA 1QGOA 3S8MA 4UFPA 5L3SA 3FPFA 1NLYA 4BL5A 1A8IA 3T06B 2MW8A 3G23A 2F8LA 3MQ2A 3OM9A 2V6GA 3AR5A 4PX5A 4CCMA 4CFSA 1PNVA 1WPRA 1K7CA 3HI6A 4L4SA 2ZIXB 4LV5B 1O6GA 1TM3E 4BHCA 4IXDA 2FFAA 4Q7JB 5DM60 6GPBA 3WGJA 2AI1A 1NBMD 3GPCA 3FZNA 1H9AA 5DNYB 2ZI3A 1FMWA 2VPLA 2DWQA 4M1OA 5D8DA 5BR1A 2EFWA 3G8DA 2D2VA 2Y2ZA 5AKHA 3G0CA 2R6JA 2YRXA 3HCWA 3QVSA 4L6CA 1SD6A 3ZTTA 2BDEA 1HA8A 1W25A 1NWHA 3C1OA 2BD0A 1SVKA 1T0BA 3GR6A 3PI7A 3CCSI 4Q1AA 4AU1A 3FXLA 4EO7A 4GKAA 2WLSA 4BVEA 3RC2A 5BUZA 5FBVB 4DWJA 5LUAA 4MARA 4CCOA 1B93A 2AZ4A 3L09A 4ER6A 1MLDA 4PLPA 2VYNA 4UBNA 3CURA 1CZKA 1W35A 2R7MA 1CQXA 3RS8A 5GAGJ 3WYFA 3LO5A 3HDTA 5EG5A 2PO5A 1T4BA 1V48A 4JB3A 3VR6A 3HG7A 1H2YA 2XXBA 4MI9A 2VDQB 3ZHVA 3Q5FA 2I8AA 3WA7A 4HDOB 4IIGA 2ZRJA 2P9TA 1KR2A 2EH3A 2GQ0A 4OIRF 2C58A 4G9EA 4J76A 1UJCA 2Q3JA 5HF9A 3JQBA 1OR8A 2FR0A 3MJRA 2PS3A 4K9MA 1ETQA 1X42A 2LG4A 1GN9A 2HLDA 3K6RA 4XSVA 5CFLA 3GN1A 1JQAA 5B30A 1QTQA 4CMJA 3M9LA 1YRNA 2XV1A 1N2IA 1OWPA 4C0WA 1WM1A 3AQIA 4DQVA 3U3RA 2PL9A 4F91B 1E2BA 2KZVA 5EUQB 3E5HA 1UWKA 5KJEA 4MROA 3EAQA 1OLXA 1VKZA 2LC2A 1OLSA 2LNDA 2VIXA 3UF0A 3BILA 2G5GX 1ZOIA 4KTVE 3BR0A 5CA1F 3JRFA 1V1RB 1F1ZA 1Q83A 5LGUA 2O2EA 2RB5A 2W90A 4ZQIA 3O95A 4FMDB 4YRKA 1XSVA 4ZCMA 5DPMA 4QM6A 1XTPA 3LHKA 1KAEA 1BDMA 4BFCA 3IQIX 2QYHA 4HRAA 3WBJA 4U2BA 2CL6X 4EM2A 3IIEA 3TOBA 4ZJUA 5I8ZA 4XLPF 1FYLA 1W0KA 1BMFA 2COUA 2FPIA 2DRIA 1PJCA 4H4EA 5CNJA 1FK8A 4DZZA 3EVGA 1E6LA 1JSZA 3CP2A 3GTJJ 1XFDA 4J2TA 5TJ9A 3U3ZA 3QX7A 5DHAA 3WYCA 4WWCA 3WMXA 1UDRA 3NDIA 1ENYA 3ZK7A 1TF7A 1UP6A 4RYLA 1M2JA 4P3YA 1UJ8A 3FBNB 4L8GA 3G02A 4CMGA 4UCWA 3QITA 2BGTA 2LF8A 5DYNA 5TPZD 1QVVA 4DDUA 4PNHA 2ODPA 4AG3A 2Q8NA 2REQB 1CQIA 4FTHA 4BIMA 1NTCA 2C9OA 1N2HA 3F3KA 4H15A 3DFUA 2UXNA 1YAJA 3HZZA 4P2GA 4KSYA 4MFEA 1OCCH 3PC7A 2BFEA 5AW5A 4LZJA 4MUHA 1DRUA 2FWNA 2NOAA 4WOJA 1L7QA 1V11A 1IHYA 3UYKA 1C0WA 4RIIA 5CVTA 1X3UA 5CD1A 1X1DA 2YWFA 4C22A 1CS0B 2B92A 1L5WA 3LVRE 3VU9A 3RU3A 5IAJA 3L79A 4MEJA 5THQA 4DIMA 4DSAA 4EZEA 3OV8A 2QXYA 3OOEA 5FL7D 4LRUA 1VCMA 5LOVF 2J0SA 4WCDA 3DLHA 5FHQA 2J4CA 3PGLA 4TMFA 2XMCA 1EVZA 4DLBA 4J1QA 3BL8A 1M1XB 5JZ9A 4V2GA 1P6QA 4KR9A 3DAOA 1WOYA 2BONA 3M1CA 4ZTFA 1YDFA 2XUJA 2ZIEA 4JLMA 3RIMA 1Z25A 4HS9A 3U48A 2G5CA 3KHTA 4CTKA 1C0LA 2AFHB 4U2EA 2NYRA 4OHFA 3AJDA 2QAJA 3THWA 4HY3A 3HSSA 2OF7A 1AQ6A 1FDRA 3PR1A 1FYEA 1ZUIA 3RS4A 5I4IA 5UKDA 1XNGA 1MVNA 4OUKX 4PG4A 4DYVA 1R0ZA 1JIQA 3SJ7A 1KBOA 3EEOA 3IP4B 1TE2A 5DYTA 3CIFA 3TM4A 3AX6A 3V4VB 1H93A 1L7VC 1Y1PA 2RJ3A 4OJYA 4Z0TA 5ULLA 1RPZA 4F38A 2O9JA 1ORVA 1E20A 1DAPA 3DEJA 5KTRA 4ZC3A 2PWYA 5IW8A 3RI4A 5DHQA 2V0GA 1QDLB 2W6OA 3GARA 1IJBA 1YOBA 3Q88A 5KAMA 3VDNB 4DUYB 4C87A 3AF2A 3OSZA 4GZMA 4MS1A 5CLHA 2Y9PB 2PKQP 3IAFA 5DASA 3INTA 2O8VA 4KG7A 3VZRA 2RAFA 3NJRA 2VKTA 4CIWA 1IWBB 3KE8A 4CV1A 3NOXA 4H1VA 2CQNA 4TTQA 4XYMA 3RASA 3O7MA 4NUBA 3BICA 3UENA 3ABQB 1OZAA 1X7WB 1I7LA 1LPBB 1O3QA 2GRJA 1XFAA 3KEMA 5BT8A 2ELKA 5B6PA 2NU6B 2AF4C 4A82A 3D3WB 3IUMA 4TM7A 3UMFA 1NIJA 3PC4A 2X1EA 4LSGA 5CX1A 3HO8A 5HXAA 1NGSA 3OQVA 2O2CA 4LRXA 3PSFA 1FF9A 5SY4A 2DFHA 4LQLA 1KGDA 1NJ1A 2LV8A 2AX4A 5LR6A 2FRHA 4ZCPA 3L1IA 3INRA 3EUHA 1Z4JA 3PPWA 4WHMA 3VXKA 4ZOBA 1AZWA 1P0FA 5JSYA 3KOMA 1SQ0A 5L3SB 1VECA 4JLWA 1YF3A 2Z8XA 1JW9B 4PZZA 2TCTA 5FBQB 5FD8A 1GQQA 5FPQA 1OCOH 1G4DA 2B63J 2N75A 3NEAA 4H7FA 4MXDA 5SY9A 4R1OA 4C0HA 4DNXA 2GF2A 1KR5A 4RM3A 1E6WA 1XPXA 3N53A 4S35A 4C07A 5HHTA 1NQWA 5A3QA 3X2EA 3C3AA 5F2KA 2NSDA 4GMGA 5I8PA 1X7WA 4GE3A 2FDRA 2EQRA 4UAVA 3WGGA 4I7EA 4TRRA 4B3RB 3FNQA 3MAJA 2W0SA 2I5PO 1MD9A 2YWBA 5FKNA 2CFTA 4QOJA 4WVFA 3K4QA 3T3IA 5K9ZA 2F55A 2R92J 4RLFA 1IC6A 2ZJ4A 5HRAA 3FBTA 4M9QA 1GDHA 1V2HE 4LDAA 3L18A 1VIAA 2EYUA 3AONB 2I6GA 1KWKA 1YK1A 3N2NA 1DV1A 5CM8B 5LP6C 5KNCH 1Z5OA 1G16A 1WKCA 2XIJA 4RO0A 1S7CA 1AB6A 4ON9A 1QOZA 3KDAA 4G0XA 3ZQIA 1CUXA 3G5MA 4BKQA 3ZTYA 1KY5A 3QM1A 4F2HA 2RDPA 4U0JA 1Z88A 1VKOA 2R8RA 2YCBA 1RESA 4TKVA 5JNUA 4LIUA 1YIJI 1NNLA 1SQFA 3AF3A 5DV9A 3M6UA 2GD2A 1XF1A 4DQ0A 2RN7A 2DTRA 1FB5A 3NNSA 4KO2S 4EM0B 4AMZA 3UXHA 2IHVA 2AT1A 1JKJB 3CX7A 4Q02A 4MW6A 1U3EM 2Y0SN 4U4AA 1CY0A 2C20A 1KJJA 1WQ3A 3OT1A 3EEIA 4XJVA 5H68A 2VZ8A 1PR3A 3W6NA 5BR8B 4DA4A 4CYCA 2XE7A 1N9GA 3QTLA 2WV0A 4MFDA 3GGCA 2PRZA 3ASNH 3ZV5A 2HOAA 5HNFA 1N2JA 3I92A 3I9V2 1KI3A 2K86A 4ANJA 1XMKA 1O5OA 1RLTA 2V1NA 1YCHA 2H1RA 3H84A 4R7TA 5EE9A 1CS0A 5JMPA 4NV1A 1A4RA 4BHPA 2ZB7A 4FLMA 4WERA 3PSIA 4ZDPA 3DLIA 4AWXB 2XUPA 3EA4A 4CEHB 3CWZA 2FRXA 3FF5A 4WXRA 2C3YA 4UUAA 3B89A 1B6AA 3IB3A 2ZMEA 2Y9YA 3S1NJ 3H9CA 4HWSA 1RT9A 2ZYVX 3PD0A 1BA2A 1P0MA 2QB5A 1IBMB 1WCYA 5K5EA 1V71A 1X2NA 1LV8A 3RFFA 1V5IA 2VUTA 4UTOA 4DMUB 1L1QA 5HF6A 1LPNA 4OH1A 2X0LA 1M6WA 2AJLI 2H1WA 1BDJA 1WR8A 3NP9A 4LJ7A 4TKUB 5JZBA 4WACA 1LQ1A 1L6IA 4G6TB 1J5PA 3RCBA 1CJVC 2Q1ZB 3BY6A 3OTGA 4CM4B 2JI6A 1T25A 4MK4A 5ER6A 4JL5A 2QRKA 1E2UA 1YKGA 1Z2OX 4O2BB 5CM2Z 1ZZEA 3PR3A 2A6HF 3BMQA 2FPIB 3KZYA 2NXNB 1BFDA 2CXOA 3WV4A 1DGQA 2KKOA 4WUVA 4F6CA 1PQUA 3SZMA 1RC0A 1RW4A 1YFKA 1ZK1A 3DDOA 2PMZA 3ZE1B 2GEKA 1Z4QA 2JZYA 5CNKA 4OOIA 3STUA 1FSGA 3SQLA 4RACA 2F4VB 3A25A 2I87A 1EAMA 1WX1A 2V6MA 1GHCA 3MERA 3PXCX 4QZVA 4ZDIA 2YQZA 2IUUA 3SHTA 4OA8A 4RDXA 5KNBD 3CWQA 4A12A 3JQAA 4OI0A 2CW0F 1KMIY 1NC1A 2GPWA 2ALJA 2VJMB 1TO6A 4HF0A 3H8VA 3K0AB 4KIUA 2JHFA 4XQ0A 4CCWA 4F5YA 1D5YA 4OMUA 1U9ZA 1X7XB 1T1IA 1M67A 2F64A 2PSEA 2VHTA 4PZCA 3HE3A 3QELB 2HHCA 1AGRA 3VTAA 1TD1A 2Q4OA 1U7OA 2AHOA 2X42A 2IIQA 1TECE 3O2JA 4MQFA 2VT7A 2ZJ8A 4YRFA 5AICA 4RV5A 4ZDJA 3HRMA 4PYQA 4XM0A 1SY7A 5L7YA 3DJFA 4MO2A 3JREA 4BN4A 4IPAA 4CCJA 4FEYA 4CR7A 1I2CA 4RKRA 4JOMA 5E7QA 1DB3A 4U7JA 4BYGA 1W4RA 3FCXA 5C4MA 4YRZA 3C7JA 2VBZA 1R5ID 4BP9A 2DPYA 3LSRA 4BMVA 2XT9A 3RUFA 5EIWA 1R5HA 4ZIRB 2GETA 3INNA 4IGIA 3ZWPA 4DFDA 1F5NA 1ISPA 1GT6A 2PH5A 3M6XA 1R37A 1ZS9A 4MJ7A 2KQRA 5AQ1A 1VYHA 4GICA 2Q99A 1YHZA 3UGTA 4K9PA 5EZQA 5EQFA 2C95A 4ENKA 3P9PA 3K16A 4HDSB 2DH6A 1GQSA 5CVDA 4E14A 4GWLA 1R2QA 3F72A 2WTAA 1SFRA 1TUGA 1K8YB 4BGEA 3NR2A 1SHUX 2M8GX 4LXYA 3NQOA 1IV6A 1FP1D 3JZAA 1DIBA 1RKBA 2O0KA 3AIKA 1G6OA 1ZOLA 3JS5A 4RK7A 2EATA 3O1JC 5D5HA 1R5BA 3RHSA 3ZWDA 1Z77A 4MQEB 2VPPA 5FTKA 1I7DA 4I4NA 3BD8A 2DOAA 1DJPA 2DVMA 4NEHB 2GA1A 1A69A 3ABRB 5LLSA 4ZWNA 2P11A 5KTOA 4O2AB 4MPTA 4ZO8A 2IX9A 4JUFA 3RBXA 4QLBA 2LVSA 1B1CA 5FX2A 1YCFA 3VFDA 4EHLA 2GPJA 1XEAA 1SC7A 3AY0A 1F9EA 1JG6A 4MZXA 4PBRA 3TLXA 2Q9AA 2HXSA 2ZYSA 3H8JA 2CUZA 3FFAA 4G1EB 1OVMA 3WQHA 2YPRA 3KP4A 1Y3CE 3SNHA 5J4LA 3OPNA 2H2AA 4ND4A 1GAWA 3CJTA 3K9NA 1VQOI 3PCXA 3EY9A 1VLVA 2CL5A 3LA8A 5JDIA 4CL3A 4OJTA 5J2UF 3GFLA 4IHSA 1WH5A 5LRRA 2R5ZA 1AKVA 2ZRNA 3EXHA 4ZXFA 1ENOA 5C1BA 4QJ4A 4YS6A 1TUBB 3ZY3A 5BMVB 4JJ6A 4QGBA 5FTMA 4B3SB 4Z2YA 1E7WA 3WHKA 2L9RA 2D54A 3RFCA 1ZREA 621PA 3MTQA 4J0GA 2OZLB 3ZWCA 4NNOA 1KDYA 4Y0AA 1DBRA 1W19A 4XK4A 1XTVA 2Q3HA 3FBWA 4D9BA 3FUWA 5C32A 2LLKA 3TDKA 4Q24A 2P9FA 4IBOA 3PRKE 4WE3A 2A69F 2AN1A 1Z18A 2JGNA 4PJ0C 4ISCA 3CJQB 3H5LA 4EJ2A 4RQUA 2QRVA 4IUCS 1NBMA 1G5TA 1U28C 5LWHA 4G94A 4J01A 1HFEL 1TMYA 4G07A 3UGKA 3PFIA 1KETA 2V5VA 1JLRA 1PSDA 3QOFA 1SC4A 2FJ0A 3RWOA 1CC1S 3KLNA 1K92A 3WB2A 4UCXA 4LK3A 4NARA 1ORKA 3PYMA 1GFZA 2JJ2A 1IRIA 3OZTA 1DAIA 4GMHA 3UA3A 7MDHA 5T4BA 4E7ZA 4Z99A 1QHHD 2W00A 1N77A 4IQ0A 1MMNA 3TOZA 1Z82A 2NYAA 2VDOB 2QPTA 1EUDA 2V7GA 3LU1A 5BV7A 1S7OA 2PZFA 2ZTVA 1V54H 1U0SY 1EH5A 5JNRA 5A9SA 4MAMA 5B6JA 3BSYA 1QIMA 1TYEB 1PW5A 4JIGA 3FCEA 2MINB 5D85A 4KLCA 2RDMA 2XOKD 5HIJA 2WPNA 4XIDA 1THGA 3NUZA 4UEWA 1RP1A 1SAUA 1G3IA 4Z9XA 1R1VA 4Y52J 4PZAA 3FSJX 1AUQA 3C5VA 4EH1A 4HTAA 1KH2A 1Z08A 1CJKC 4BEBA 4YACA 5C7LO 4PG6A 5JSQA 3BWBA 2H54A 5LHHA 4L7VA 1FJGB 2JH9A 2F1OA 4BE4A 1ZGWA 3THYB 1KQPA 1VPLA 3H2YA 4ZXPA 3R9XB 4ZJPA 1I32A 2J7KA 2GA8A 1G8KA 2INGX 2O0JA 2PANA 4B9AA 3R0QA 1LFAA 1RBMA 2GCOB 2BW3A 3LYHA 2JCSA 1IK4A 4FEGA 3TRHA 3RC8A 2R1VB 1OGJA 3N87A 3SVZA 4DAOA 4RJTA 3GRUA 2PFSA 1LX7A 2IRWA 2WF6A 1UG0A 1GNQA 4IIXA 4LZLA 4RQAA 5DHPA 3K9BA 4TS1A 5H5JA 2FMFA 4HAUA 1CS4C 3OIYA 4M76B 5HZKA 3KPHA 1WJAA 4DZPA 1J8DA 3NM4A 3WLKX 2H7XA 4BC0A 5IJ0A 1IOVA 2WU1A 4J6FA 4NENA 1RQRA 1SQSA 2ZWOA 1KJWA 2AKAB 1TRHA 3BRSA 3WSWA 1YTYA 1H65A 3MWYW 4AKTA 4AROA 3R8FA 2GVDC 3FKSD 5D8KB 4C3OB 4LRWA 4V0ME 3TSWA 1J1IA 3UCEA 5K7HA 4HMQA 1RWWA 3HJFA 4DPKA 1G20E 4JK3A 4KMOA 1YZFA 3KOZA 2YS6A 1AURA 1ZKGA 3F78A 5BR7A 3QV2A 1FQKA 2L7ZA 2H27A 1EEHA 1H5QA 1XZHA 4JOSA 5FJJA 5KTNA 2B3DA 3Q6NA 4TV9F 1TZLA 4OB7A 3AOEC 3ZY2A 1XVAA 1GTG1 4KFUA 3O8OA 4CIDA 3A0HC 2FPOA 4KYUA 5AT1A 4EJ6A 4RSHA 4ECEA 2ZTSA 1F3OA 1X1AA 4GPAA 4J4HA 4C1NA 1I0LA 5F7OA 1GZ7A 2B34A 5IYCJ 3D8UA 2DJIA 2WIAA 4Q4LA 1N5DA 4BLSA 3Q0UA 4E5YA 4P31A 5EUCA 3HU5A 4IOLA 4NJEB 4E07A 5CLQA 2YHIA 5L4LA 4ZKEA 4Q1DA 3AJ9A 4LRSB 2VK8A 3E22A 3AESB 1J49A 3U44B 2H48A 3ZHZA 4QTYA 2WZQA 3MIZA 2QRMA 4YP7A 1Z1DA 4BEHB 3HEBA 2GN0A 4I98B 2Y68A 4Q3OA 5I7HA 2BL4A 3KYCA 3B78A 3NIWA 4B31A 5TLSA 1UXHA 4DKJA 1LSUA 2FSFA 2W71A 4H7JA 1CUSA 1DQSA 2ZBQA 3H2IA 3IALA 5EIAA 2C84A 3TI7A 2DLCX 3QU3A 2LFBA 1E0KA 1WLSA 3WRVA 2GYUA 5H20A 3OBIA 3UOGA 4B4VA 4BOYA 3HABA 3CJQA 4C4ZA 1UR5A 3PWSA 2XVMA 4RDCA 4B32A 3FOEC 1R9MA 3NOOA 3SAJA 2WIJA 2O14A 3TCXB 1QP7A 3X0DA 2WHEA 3STVA 4LG0A 3K0EA 4NHEA 1XA4A 3DPUA 5A7HA 3CP8A 2QYOA 2A88A 2PHZA 1KE1A 3BDVA 1E9SA 2PY6A 4JVMA 3UV3A 4YIHA 3FHJA 2OXEA 2PD4A 4HDKB 1CEEA 2BGMA 2XQKA 3D2LA 3LQ4A 5K6RA 5A05A 1RYNA 3R0XA 3RYPA 3WK6A 5AMXA 3IJ5A 3X44A 4ES6A 1ACMA 5BPFA 4I50A 4IMRA 4YCJA 3SBDA 1JNYA 2EP7A 3VAZA 2H1VA 4OHYA 3KWLA 1IRZA 1DE0A 1SVOA 2GNPA 1XMSA 3ZW8A 4ENSA 4ZYZA 4P4NA 3T5TA 2C2OA 2G8LA 1XLVA 2XB8A 5DM2A 4EJFA 3L7OA 4N0PA 3UKDA 3U5TA 3K2QA 4QSHA 1FOWA 4BHBA 2E5FA 4NPCA 5BQFA 2ZDHA 2BFWA 2P2YA 1JDZA 1X9GA 4Q9JA 1NMEA 1WCV1 1TQ4A 5G1PA 1M34A 4BVJA 1HNZB 2XUHA 4UUMA 2D2FA 4HXGA 4LK2A 4O4JB 5DLDA 2V58A 2UVPB 4KB5A 4B6QA 1QG6A 1FVXA 3W4JA 3TNLA 2G6BA 5LP6F 2QTCA 4DMGA 1MX3A 1J90A 2XGDA 3D1VA 2P7VB 4X6XA 5ERGB 3Q3GE 1R0SA 1R5OA 3VO8A 3ZE6A 4DA0A 2QI9C 2FRVA 3CH4B 1C9MA 2CNNA 1JEJA 1GRRA 3HBNA 4TTSA 1VE7A 4LY0A 3SSNA 1XMIA 4BAZA 2QVOA 5A04A 3K4MA 1NBOA 1UOPA 3DTKA 1XZLA 2ZIGA 3IQWA 1LNQA 3N2LA 3PS9A 4W8GA 3ZLBA 2MYPA 1XB2A 3RYIA 3GLXA 2CFCA 3N5KA 1KYIA 2HNAA 1K3TA 4G6ZA 2DT7B 1PK9A 2YS7A 3GJSA 2I2BA 1QYDA 1XTTA 4PLGA 4HV4A 8MHTA 4IFBA 1Y0BA 5FTJA 3QLVC 5AW7A 1D2CA 2AA3A 5ILGA 1F2TA 2QGZA 2Q3CA 1MJFA 1V1JA 4QX6A 1YZNA 2V6CA 3LC1O 5LQAA 1GGKA 2VKEA 1KF0A 3ENKA 2R4QA 3AKZA 3PP8A 4P54A 5CPFA 1Y6IA 1H2HA 3D59A 3DT6A 4U7HA 1RBYA 3OTHA 3OVMA 4UULA 4WINA 2QROA 4O3MA 2YN2A 4M74A 1PW7A 3QU6A 3SIXA 2HTFA 3IO5A 5F2OA 3NHRA 2IBSA 2ERCA 4F46A 1WB9A 3SFZA 2VF5X 1Y4DE 1IXZA 1RWPA 1JRLA 2N47A 3BGVA 4TLLB 2FEZA 4BKRA 2D0PB 3GCGA 1ZD9A 2VPWA 3GELA 4TX1A 1TU4A 5ECWA 3ABOB 2KBFA 2G9VA 1L7NA 3F6OA 1QLHA 3QE2A 4HSGA 2ZIVB 5G0TA 4AKSA 5DNWA 2GTPA 3R6LA 2GIZA 3AUAA 5D3QA 3SDZA 3UW3A 1GLNA 5J23A 1E17A 2QVLA 1UFQA 3E6AA 5LBIA 4OGFA 1Z6YA 1ZHFA 2AN3A 3UAVA 2QT9A 2K9LA 3KP3A 1QJ4A 2LK2A 3DE7X 3N74A 2BBOA 4BL0B 2W6JD 1Z16A 3AKYA 3FUVA 3OLCX 4KQCA 4NEGA 3C6XA 2HK8A 3PQ3A 5GPBA 3ZGOA 3DM9B 4F0JA 4QU0A 4WDQA 4LF7B 4E30A 4QU5A 2NVUA 2NUTB 2IE0A 1TNSA 4KPUB 1Z38A 1MO4A 4M3GA 2VQFB 4Z4GA 4HRXA 4OJKA 1L4GA 5A02A 1PWYE 3M6WA 4QXPA 1U8YA 3FI9A 5BW8A 2RGXA 5FEMA 2G28A 3D4OA 3B51X 4BRWA 3H2BA 4OAYA 3F8NA 5GAEJ 2Q0OA 3FUCA 5FF9A 4HDVA 2O0MA 4GPZA 3HUFA 3BT7A 4C21A 1QRTA 2VP6A 3UJPA 1C3OB 3DL0A 4A69C 3TUZC 4I8IA 4AJ2A 2QL6A 1RLUA 2SCUB 2V4MA 1UC5B 3O31A 2BM9A 3ZDXB 1B9NA 3P4XA 3E0QA 4X62B 3NHAA 4JUCA 1N6KA 2PX9A 4G1BA 3UWOA 5BPIA 1NBEA 1Z22A 1WL8A 4I9HA 4BX2A 3NH9A 2ZUBA 3AFMA 3GFPA 3RIGA 4BWFB 1DEXA 1W93A 4FP9A 3BWDD 1NY5A 1ZK2A 2C83A 3GVXA 5DULA 3TLEA 4U7PB 3RE1A 4L0QA 1H8EA 2IEAA 2IYAA 3DWFA 2WK1A 3Q8MA 5CBKA 1IUNA 1HURA 1TBXA 2WHYA 2QGUA 4REOA 4MVCA 5EXSA 5KI6A 1XV5A 3H1PA 2ID3A 3IHTA 3WLJA 2F1RA 2XODA 1NTOA 4IF6A 5DX1A 4TXLA 5IAEA 3CMYA 5NLLA 3NEYA 4AUKA 2Z5LA 3RKSA 2E2HJ 2CLLB 3G5LA 3L5OA 2Z8YA 3GOQA 1D1AA 2IEZA 7AT1A 3RIRA 1NJ8A 1IFXA 4CIXA 5BMOA 2CUEA 1CUAA 3VNBA 5BVHA 1WFXA 3D6MA 4QARA 1T91A 3OT5A 3B60A 3DTNA 4DE5A 3FA2A 4BMNA 3K0CC 3KQSA 3FE2A 4TZ0A 2EJTA 1BDBA 1M2VA 4QPPA 3IP3A 1K6XA 4AECA 5AI0A 2DOFA 3FUTA 2ACJA 2H2HA 4YJGB 3GRVA 2DQRA 2Q21A 3R9XA 4RB0A 2AHRA 3EXIA 1G1MA 1I6KA 3NP7A 2VF2A 1EDZA 3NHMA 4RF4A 4F3NA 4X97A 1UDAA 2DA6A 3MTJA 1TQ8A 4XDYA 4A8PA 5ILSA 1G21E 1GTL1 2HA4A 1EE1A 5JCJD 1P3JA 2RK6A 5BSHA 4TYWA 4I9UA 4MI1A 1RTKA 3FPBA 4FSXA 2KIFA 1W44A 4OQMA 1CF7B 3IOMA 3M1YA 3RVBA 3SIRA 1XJWA 4OXRA 1T34A 3MTIA 2IGTA 1Q3HA 3PIRA 1XCBA 2ZNZA 3GLRA 4PJLA 2Z3ZA 4NNPA 2BPOA 3SC4A 3UG7A 2PA3A 2YZ7A 3FHTA 4CHTA 1QH0A 4Z9YA 1F17A 4KMUX 3IP1A 1ZWKA 3SM3A 3C2QA 1ZVJA 2HYFA 1T9GR 3T9BA 1IUYA 1MO2A 2VRCD 5BYBA 4UNRA 3SFVA 4WPGA 5AUOB 5DH9A 5GTIC 4Y67A 4YDHB 5EJFA 4DJAA 2E34A 3BULA 2IWRA 4BEVA 4CMCA 5KYXB 1DO0A 1RIIA 2JCVA 2KSQA 3QE4A 3WGZA 4L8FA 3AFOA 3EXEB 2BKXA 2HLNA 5JLJA 2OZPA 4B3GA 1WXDA 1WP9A 1YL5A 4ZO9A 4HPQA 1W2WB 2ISCA 1IHPA 2QRUA 4NBVA 5E9QA 4AIIA 1E9FA 5JROA 1HPLA 2EIKH 3I56I 1SANA 1MRNA 1GT0C 1NI4A 1ZSYA 2RCYA 4D45A 4PLFA 4HDQB 4NB5A 1CUHA 3A1EA 4KH0A 1UMCB 3TLCA 5CFRA 2EFDB 2I99A 4FHTA 1CTQA 1A76A 3OZVA 3B38A 2VB6A 1XZ8A 1XHEA 1J2TA 1BYUA 2QRGA 1V39A 5EZHA 2WILA 3JVUA 1XG1A 3WLOA 5G02A 3WLLA 3A4MA 1DLIA 1RLMA 2JKYA 1Q50A 1D2MA 1ECLA 3EY4A 1P1FA 3LDHA 4KE6A 2NV0A 3RPUA 1Y9ZA 3L4BA 1C9YA 2FHSA 4LXQA 2D5AA 1OWNA 5CLGA 5FB3A 2CXRA 5FPPA 4C7JA 3BH0A 3WAJA 1KOJA 3QY9A 2D1HA 3O4HA 1E1KA 4KH1A 4YJ3A 5CK5A 5BN4B 5BSKA 2XMDA 4LTMA 4Q4AA 4GM4A 5FL3A 1VA5A 2JSCA 5HILA 3U62A 2QSUA 4NFYA 5AW9A 3LUKA 2O4UX 3TD2A 2XCRB 3O8RA 4CM6A 1Y7HA 1SZDA 2D0OB 3T4XA 4NG5A 4KIGA 5DHSA 4GXOA 3SJMA 4XM2A 3A6FA 2FG7C 1ZM4A 3LWZA 2GXAA 4DOZA 1K4YA 1OI4A 4WBSA 3GLFE 3T0FA 3CUQB 4X1YB 3NLLA 2XUGA 4W9RA 4OHMA 4OSPA 3BR1A 4HCJA 2R7WA 1RYZA 1Z8DA 1BW9A 1NSFA 2VPYA 1FDSA 2FZGA 4BE1A 1RRFA 2WWTA 1KIMA 3FWKA 5H3HA 1YQAA 1HY3A 1TVEA 3PUYA 1TJ4A 1FOKA 2AYYA 4M9UA 4MSUA 4R1NA 3IXMA 1Y7PA 1WZNA 4YPFA 2FPXA 3ENVA 1ADJA 1JR3D 3KSUA 2HOTA 1YSCA 3A1DA 2IYZA 3L8ZA 2DQZA 1FFEA 3JASA 3NVMB 5TDHA 5HKOA 3HADA 1AMUA 2UKDA 4EBFA 1PGJA 4MVJP 1RBQA 4KX5A 3U2QA 1JNXX 4ZTJA 2EJBA 1IBCA 3MOIA 2QP4A 3GDWA 3TIFA 3ZHQA 3MWJA 3PKZA 4PG5A 2FA5A 3T54A 1R4NB 4N9HA 1V11B 5JNWA 4OYHA 2VT2A 4DR2B 2AQ8A 4Q7EA 4YQZA 2ZR7A 3KB2A 3AVXA 2P7HA 1A9YA 1BOFA 1QAOA 3SY8A 3SVTA 3SBEA 4J16C 2GPTA 1GU0A 2R00C 5CTJA 3TLAA 1A2KC 4RGVA 2STTA 3V3KA 4AIRA 5A6SA 2EZIA 1FL9A 4TV8A 1RUOA 1MB4A 4H0EA 3AB3A 4Y3UA 3F90A 4UXNA 1O97D 5IM5A 3N4MA 4B7CA 4PLVA 2B5WA 3C3PA 2ZIFA 2QE7D 3M3PA 3BMXA 3LC2O 2WWGA 3C98A 3K0CA 3QYAA 4JEUA 1BG6A 5A5GA 1KWGA 4JA0A 2PLFA 3EXEA 5ITZA 4RS4A 1J8YF 4REQA 5JVDA 1QX4A 3DAPA 4BRZA 5KOHA 1S8AA 1D5WA 1V16B 4J7AA 3PFNA 4E70A 2GASA 5E1DA 5DZSA 4Y9SA 5I7AA 3N8GA 4PXYA 4EQ6A 1GLGA 5F21A 3TVTA 1W85B 2O4CA 2QTAA 2LY9A 3DZKA 2IUYA 5E1WA 3L6DA 2ZYTX 3R6DA 4LMRA 4O4IF 5T3YA 3SDGA 1LBTA 4CKZA 2RI0A 3PEWA 3OCUA 4OQQA 4JB2A 1EKEA 2I33A 3AK4A 3TL3A 1A95A 4MIKA 4PZLA 5CH3A 3LQ1A 4GS5A 5F64A 3E9NA 3OYAA 2ZJAA 3F8SA 3UHFA 1C1DA 3EPZA 2DFTA 2QP9X 2C7GA 1X14A 2KLBA 1E1LA 2CVPA 3DO8A 1G98A 5BSEA 2W58A 4CN9A 4MA4A 4FFSA 2E1OA 1KMMA 3HBAA 1E7SA 4IX1A 2IYWA 1EE9A 5TEWA 1V3UA 1U02A 3TK1A 4MPDA 1KEEB 1N9KA 3BGOS 3NTXA 2QLNA 1SK9A 1KJ8A 1XHFA 2NSLA 3PSAA 3ITDA 4KXXA 4BE7B 3O0TA 3IMCA 1JHVA 3RVDA 1Y98A 4EHFA 4EJVA 4CIVA 5LIPA 3GEEA 5CA0B 3MUFA 4IYRA 1VJDA 4LX0A 2H65A 1DP4A 1DL5A 1P2VA 1LKXA 2QQAA 4M71A 3LZ6A 4FZVA 5L3QA 3SWWA 2JLUA 1C0EA 2O8NA 3ZBQA 4A6PA 1MQ9A 2XCIA 2BSAA 2IYXA 2P7CB 3QUCA 5E20A 3LL7A 1N4DA 3QTTA 2AOTB 2QZZA 1A35A 3BGSA 4X3OA 2CMFA 1RIFA 4ER5A 1NUHA 2RFLA 2AVNA 2QKMB 2IYLD 5LA6F 1CRPA 3CBQA 2GPSA 3NWTA 2J9FA 5EKTA 5A6VA 4BFXA 2M6LA 3H1GA 3JARB 4ZCLA 2P6RA 2QW0X 1ZD4A 3VU0A 5B53A 1NR1A 3ZBPA 5J1TB 1CR0A 3WGIA 1JMYA 3VPDA 2BBWA 1R64A 2J9RA 3K1AA 3BTSA 3RQ4A 3GGGA 2ZWVA 4KYVA 2DFDA 1PTKA 3BE4A 2EBIA 3KALA 4ZHQF 4FM9A 4LBWA 1BCRB 4RB2C 2DA3A 1FPMA 1FZQA 2NVOA 2ZYIA 2WUGA 2R7QA 3FSEA 3TQOA 3WLFA 2WDZA 1W0UA 4R2JA 4E12A 4F3RA 1T2EA 1EV7A 4JKYA 3UFBA 3VKHA 2CLSA 1CXZA 2Q1TA 4N12A 1IDN1 3KO8A 4GUAA 1RWOA 4BNDB 1EESA 3S3MA 1MC8A