3H5NA

Crystal structure of e. coli mccb + atp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
338
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MccB protein
total genus 109
structure length 338
sequence length 347
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5nA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5nA02
4FOOA 3FI9A 3U09A 2YHUA 2V6GA 4WKGA 4EI2A 5AXAA 3A9WA 4RPKA 1PIWA 3MJVA 5JAZA 2SCUA 2Q1SA 3K8ZA 5CAEA 3H65A 4QEDA 3PXXA 4DQUA 5JNLA 2PK3A 2OORA 4ROSA 3UHAA 3ON5A 3DHEA 2YFQA 1AE1A 4ALLA 1LLUA 3INRA 4Y6PA 3OMLA 4WLOA 1XQ6A 4F3YA 3V1TC 3BMCB 3VOSA 3BZUA 3K31A 5K6AA 1T2AA 3ST7A 1CETA 4D43A 3VTFA 4FFNA 3S1LA 2JD2A 3UN1A 2IE0A 5I8WA 1J49A 4XWYA 5CDTA 1FDUA 5A4DA 1PS0A 3PLNA 4M8SA 3ZHXA 1ULSA 3PTZA 1PWXA 1TLTA 3ZNNA 2AMFA 3NGXA 3ICPA 3GVHA 5T8KA 1C1XA 1IB6A 3PYLA 1NR1A 4B3JA 2VYVA 3PHIA 3W1VA 3JQCA 1UDBA 4DLBA 3FNEA 2HKIA 3GG9A 1WZEA 1YL6A 3DR3A 3ZNOA 3QW2A 4CMCA 3V1UA 1YQDA 4TRMA 1H6DA 2VTDA 3QWIA 4YRAA 3R3SA 4CMGA 5T57A 2DQ4A 4CMEC 4E2XA 2A4KA 4IDAA 3LDHA 2WJPA 2C20A 1I30A 3BMCA 3KVOA 4HUJA 1HDGO 2DTDA 5CPFA 4OOFA 3UCEA 7MDHA 1AUPA 3NTOA 2OBYA 1C0LA 3NUGA 4E13A 1NPYA 4R1SA 1GR0A 1H0KA 1J0XO 1I5RA 3BMOB 2GD1O 4RLHA 3WIDA 4E0BA 4EDFA 1JA9A 3H2SA 5ADHA 2CVOA 4XJSA 1G6KA 1NPDA 4AVYA 2DTEA 1T4DA 1PJ2A 4FQ8A 1BXZA 1E3EA 3JQDA 3LC7O 3GHYA 3C7AA 2GDZA 5EPOA 2DBQA 3ZHBA 4UEJA 3SX2A 3G0OA 3JYNA 3WGIA 3G17A 2Y67A 5G4LA 5HS4A 3W6ZA 1D8AA 3ZWNA 1PGOA 1PZEA 1F12A 3DAPA 4WLFA 4GKBA 4R9SA 3VPSA 1ZO8A 3WFIA 5C7OO 3R0IA 4RF5A 1Y8RB 4AJHA 3GMDA 3VTZA 4GWKA 4FFRA 1KYQA 3CIFA 1TEHA 5TS3A 3FNFA 1MG5A 2A94A 2C5EA 3NRCA 1PJSA 3ONEA 5DT9A 2X5KO 1DRUA 2NLOA 4O63O 1EBUA 1O94A 1P1RA 4HWKA 3NKLA 5A04A 5I9LA 3GF4A 3H5AA 3IP3A 5K9ZA 1SNYA 3BMOA 1L7EA 4JJIA 4HX5A 4GGOA 4YJGA 4CLOB 1T2FA 2BKAA 3TZQA 3AW9A 1HSOA 2FOIA 1ZIDA 1ONNA 5I7SA 2FZEA 1ID1A 1T2CA 3OQ6A 1KEVA 4I5FA 3DBLB 2QW8A 1EFLA 4JGBA 2C59A 4BGIA 1E3SA 4GQAA 1N7GA 4AL4A 1F8FA 3EAGA 3ZNPA 4ALMA 3W8DA 3BTSA 4MKXA 4E3ZA 3ADOA 4GLLA 2FZWA 3NDJA 2D8AA 1HZJA 2GZ1A 2HRBA 4IDDA 4UEOA 1YB1A 2NACA 4B4UA 4NFYA 3JQFA 1T25A 4YRDA 2NVUA 2Y1DA 4D46A 1X7HA 1F8GA 1HDZA 1PJLA 3KLPX 2FR8A 3VDRA 2OO5A 4M54A 4D44A 2E37A 4IINA 4BO5A 5L45A 3HUDA 1UDAA 3M1LA 4ZGWA 3W4IA 4MVJM 4KTTE 4GKVA 1UP7A 2WSBA 4NDNE 4U6SA 3DZKA 3P2OA 4YAJA 1GAEO 2FPPA 3GGOA 3LLSA 3ZZNA 4R51A 4QXMA 3GA0A 4TRRA 3I4FA 3IAHA 1VSUA 1ISHA 3D0OA 5J23A 2E4AA 1WNTA 4E32A 4WCDA 1E6EA 1TA4A 2WM3A 3VH4A 3GH3A 2ZQYA 3ZN2A 3PGXA 3PYMA 3H4VA 2V7PA 1GUFA 3I1JA 3O8QA 4BS9A 5ENVA 1UUFA 3GVPA 4IBOA 5DBIA 2ZKLA 2I6TA 3AOEC 4QSMA 1EQ2A 3KSDO 2AQIA 4CL3A 1BXGA 4C7KA 1OC4A 1NQAO 4OXYA 1T1SA 4MVJP 1DJQA 1LC0A 1PU2A 1YB5A 4HKTA 2C54A 2CDBA 4A26A 2RCYA 4MKRA 5DF1A 4CUJA 1X1EA 4KWHA 1U3VA 1Q0HA 4BNNA 1U8FO 4AJ4A 1HDXA 2VRCD 3OETA 2EIHA 3ZWCA 1UZNA 3HB4X 4CJXA 3DOCA 3QY9A 2I65A 5JCJD 3P2YA 3WMWA 2GN9A 4LK3A 2NV6A 4BNJA 1BMDA 3A14A 5AXCA 4Q3NA 3S2FA 3ZGYA 3GLQA 4ND4A 4MO2A 4K1LA 1XDWA 5HM8A 1XKQA 2I3GA 1ADGA 2NVWA 3S2IA 3QVSA 4DLLA 4ZQBA 3DFUA 4R41A 1DEHA 2GNAA 4U5QA 5FYDA 1I32A 3IDSA 3HE3A 2BH9A 3MJ4A 5L9AA 1LDYA 1LC3A 3KBOA 2X8LA 2GLXA 5LCXA 5A5FA 2Y1CA 3KV3O 5KJCA 4D3SA 3I9LA 3VH3A 2CF6A 1I3NA 3GGGA 2OGUA 4QX6A 1ISIA 1QYWA 2X0JA 4L74A 5B4VA 3IIEA 4JNKA 3UAGA 4DC1A 1BSVA 2TMDA 1UZLA 4PLPA 2OP1A 4NBTA 4X54A 3H9JA 1M2WA 2ET6A 4XYEA 3AY6A 2AE2A 3LK7A 1SEVA 3TZCA 4NFSA 1YDEA 2UDPA 3PWKA 2YYYA 3M2PA 1ULUA 2EKLA 5BNFA 4DIBA 2AA3A 3R3JA 2VYND 3MJSA 1ZH8A 5F1KA 2G0TA 1GPJA 3WJAA 3AOGA 1O9BA 2B83A 5L3ZA 1SB9A 4RO0A 4IDBA 3F9IA 4UVDA 4L4SA 2YQ5A 4BOYA 4L4RA 3AM5A 1GTMA 2X5OA 1OZAA 2AHRA 3JD4A 3JQAD 4UUMA 2R2GA 4NFHA 1D4FA 2PH3A 1CJCA 2EEZA 2FSVA 1E7WA 4IGFA 4O5OA 4D7AA 4CV1A 1DJNA 2B69A 4ND2A 1NFQA 1E92A 1FXSA 4MP8A 4YYZA 5FWNA 1QMGA 1ORRA 3MJCA 1Z45A 5HWSA 5EN4A 2X0NA 3D3EA 2I99A 4ND5A 3SC4A 4D45A 2GGSA 3GPIA 6LDHA 4AICA 1N7HA 2JFHA 5C7IO 4J0EA 3ASUA 1QV6A 3GFBA 4FB5A 5IJZA 3GZNA 4E5KA 3HNPA 3JD2A 1EZ4A 3W8EA 1ZKMA 3WWYA 1UR5A 1UXIA 1GCUA 2J3KA 4IM7A 1N8KA 1NVTA 3ICCA 1B2LA 1BTOA 4NU6A 2V6FA 3FPCA 4IIVA 4W7IA 3MWEB 1ONOA 3KYCA 5F1OA 1VPDA 5EESA 4YAIA 5JAIA 3JD1A 1I33A 1R4MA 1ZK4A 3JD3A 2FRDA 4FR5A 2YW9A 4LSMA 3ZWXA 2W2LA 4I8XA 3OF2A 3WLEA 3Q9UA 4GI2A 4JQCA 4KOAA 1I01A 4TKMA 2POQX 2ZATA 3BYZA 3WLFA 4J1QA 4E31A 2X1HA 1FK8A 3PHJA 2RH8A 4WOJA 3X2FA 3UF0A 5C5IA 3H9QA 2AQ8A 5AQ1A 4BNLA 2DC1A 1WVGA 3TJRA 1HTBA 4BKQA 5BNIA 1HXHA 4G81A 1QXSA 1O89A 4YDRA 1PX0A 1ISMA 5DCUA 3UXYA 5DCYA 4F6LA 3L07A 4RZIA 3D4PA 5ES3A 2UUOA 2JHGA 5HRUA 2HMWA 4P4NA 2AEJA 4OAQA 3L6DA 4BHTA 3LT4A 1D1SA 4H16A 2R00A 2PD4A 1RYEA 2BLLA 3NT5A 1EK6A 2AQHA 2JCXA 3D5TA 4TQGA 3VVBA 2IDZA 5KJ1A 3DOJA 2DPGA 1X1TA 5JFOA 4I1IA 3WBFA 4BNIA 3GAZA 3JQ7B 4RQTA 2PD6A 1ISGA 1LLCA 2O3TA 4UUNA 5G0VA 1B7GO 1AXEA 2WD7A 2RAFA 3SJ7A 3H6KA 3JQ8A 5MGBA 2NVBA 3ZI0A 1DIBA 1E3IA 2D2IA 3EC7A 4BVAA 4CMIB 3P19A 1XGKA 2V6BA 3JYQA 1GQYA 3T4EA 4XYGA 4JJFA 2BGLA 4NK5A 3ONFA 3KEQA 3BMQA 5ITWA 1XG5A 4Z0TA 3E1KA 4JN6B 1JTVA 2F1KA 2GO1A 2J5KA 2OUIA 1TT5B 4J7CA 2YV2A 1PTJA 1WMBA 4QT0A 2I67A 4WCFA 2GRAA 4H3VA 3PZBA 2J6IA 3OA0A 3KYCB 4BL5A 5I7EA 3NGLA 4WJZA 3B70A 3H5RA 3ZW9A 2EJWA 3QJ5A 3WYCA 1JKJA 5JAMA 5TGDA 5F3RA 3WSWA 4GWGA 4UVHA 3QVWA 2GF2A 4G5HA 2HMTA 4CQLA 3QSGA 4UULA 3WR5A 3P7MA 3UVEA 3NV9A 1RKXA 4PG4A 1R66A 2C5AA 2D5CA 1P74A 4CMHA 4E5NA 1CDOA 1NXQA 1YE3A 2E6UX 4R5MA 3ZHYA 1I3LA 4FFPA 4HFNA 1ZUD1 2VHZA 5TRTA 4OMUA 2HMSA 2CUKA 2P91A 4RPHA 3GZ4A 4ZHSA 5DULA 4DVJA 1YQXA 3N7UA 4J9VA 3GHHA 4FC6A 1KVTA 1Q2XA 4UVIA 5FF9A 4ND3A 4RPJA 4CUKA 2DFDA 3WQRA 3GK3A 1WMAA 4PZEA 4ZQGA 1VKOA 1SC6A 1NASA 5G4KA 2C07A 1TT5A 3DMYA 3L6EA 3K73O 5CFZA 3WYEA 1VC2A 2B4RO 1B0AA 3FNGA 1ZSYA 1P45A 3H8VA 4M1QA 1DSSG 1V9LA 3PHLA 4IQ8A 1KVUA 5JMWA 4BNYA 2ZIZA 5KVQA 1W73A 4RDIA 2ZJ1A 1Z73A 2J3IA 3G1UA 5IXSA 5DBFA 1HZZA 3AM4A 1ADBA 2PZMA 4LVUA 3KZVA 1DPGA 3WGTA 1LSOA 3B1FA 3RUEA 2VZ8A 1DC6A 1HSZA 1NQ5A 4IDFA 1SB8A 1XELA 4M49A 4YEDA 3AI2A 3RASA 4IDEA 3JQEA 4ID9A 4R5HA 4DQXA 2VHXA 4B79A 3WTCA 2VUSA 2CFCA 3PLRA 3FTPA 1DFHA 1R12A 4RGBA 1HRDA 1HLPA 1EVJA 2W2LD 4FGSA 5CDYA 1PGJA 5BNTA 4LCEA 1YH3A 5ENDA 5LDGA 4IDGA 4RVFA 3DZIA 1HE3A 2DAPA 2OFPA 4IY1A 5F5NA 4YTEA 3KTDA 1VKNA 2C7VA 1YJ8A 3E82A 4RORA 5JDIC 2UVDA 4MVJF 2Y66A 2B5WA 3BA1A 3KOUA 1V6AA 3OICA 5DNAA 5KVVA 1AN9A 1I2CA 1Y9AA 4PLYA 1NVMB 2J5RA 3T7EA 4NQZA 1C0KA 1U3WA 3AK4A 5CHEA 3MJTA 4GSKA 4OKIA 2RIRA 4AJ1A 1R0KA 3F46A 2PH5A 1MC5A 3SXPA 1U5CA 3I83A 1CWUA 3PRJA 3ZWAA 3IP1A 3EVTA 2B36A 2UV8A 3GEGA 3SLKA 2PKQP 5EERA 2NVUB 3B6ZA 2EGGA 2PKRA 4UVEA 1I8TA 1LRJA 1CF2O 1U7TA 3I9KA 1K5HA 5G0TA 2Y1FA 2Q1TA 4PG6A 1DAPA 1EFKA 1N2SA 4ZN6A 3GFGA 4II2A 1UP4A 3RAJA 1MA0A 1PJ3A 2BELA 2P9GA 1JAXA 3LT1A 3AI3A 5C7LO 2GPTA 2AW5A 4Z0HO 1PJCA 1Z82A 1I0ZA 1EVZA 3WFJA 3KYBA 3C1TA 3FR8A 2H5LA 4LRTB 1D3AA 3RC2A 1VJTA 4IJKA 5IG2A 4S3MA 1U1IA 3WG9A 3S8MA 2OHXA 4XEHA 4YA6A 2C2YA 1G0NA 2RBEA 3RWBA 3PYXA 3HJAA 3U49A 5JO0A 2IZ0A 3C1OA 3E5MA 1SZJG 3ASVA 1ZSVA 5TC4A 3JQ6A 5JPIA 4J1SA 4N5NA 5IZ4A 3I6IA 4OSOA 5KCZA 3C8MA 1QV7A 5C37A 4NBRA 2ZK7A 3NYWA 1GV0A 1ZEJA 5ITVA 4FJ2A 5BQFA 1V3TA 2CVZA 2XOXA 4MVJH 4O6VA 1HF3A 1IHXA 3SLGA 3DXFA 1FDTA 2O48X 5DP2A 4GL4A 2VWPA 1GQQA 1T24A 2IXBA 1HKUA 1X7DA 2E49A 2RHCA 2V6MA 3CEAA 3I23A 3E5RA 1V0JA 2DLDA 4B8ZA 1QYVA 5K0ZA 3COSA 4KZPA 4WPGA 3ZCXA 2GN8A 1C0PA 4N5LA 2I76A 3RUDA 4CM9A 3DONA 1HDOA 3LQFA 3OJFA 3WGGA 2X9GA 1SAYA 5DOVA 4XQEA 4J16A 4Q3BA 2PR2A 3UFXA 1Z7BA 1C14A 4WLUA 4J3FA 2Y1EA 3TRIA 5EMHA 4EEZA 4J0FA 4W82A 3PZRA 3WGOA 1W8DA 3DZBA 4YPOA 1FDWA 3R1IA 2ZTLA 1R4NB 5KJEA 4MPDA 4DA9A 2DUUA 5CDSA 3GDOA 3AU9A 2P5YA 3WX0A 3PEFA 1GADO 3I9NA 1JKIA 1GY8A 2UUPA 4BO8A 5A9SB 4AFNA 4YJFA 3UICA 4JX8A 1Y7TA 1BG6A 5L40A 4DREA 3VH1A 1LTHR 1A9ZA 4PZDA 3WGZA 1I24A 4NR0A 1VSVA 3NEPX 1C1XB 1FF9A 1LDNA 3HHPA 4RJTA 2NU6A 2W2KB 3TF5A 4JXKA 2AQKA 2JCYA 4XGKA 3T7CA 1PQUA 3UH1A 3DEYX 2Q2QA 4RPGA 5U1PA 4M86A 3JCZA 3EDMA 3H9GA 4H15A 2HK7A 3O38A 1J6UA 1UZMA 2G5CA 1JWBB 1ZJZA 1OMOA 2ZYAA 2AE1A 1PGNA 5BSEA 1U5AA 5FEUA 3MCVA 4K28A 5CPBA 2CDAA 5JAQA 3H9EO 2R00C 3PGJA 3E9QA 3P5SA 5A05A 4PG7A 3U4CA 3TL2A 1MGOA 1A71A 3I3OA 4J49A 2JL1A 3RI3A 3KXDA 3JYLA 1ZMTA 4P4LA 4YB8A 3RJ9A 4BO1A 4CQMB 1WDLA 4FJ0A 4TRNA 5B4TA 3ORFA 5I8ZA 1K89A 5JC8A 4IJUA 4J1TA 3ADPA 2AG5A 3S55A 2ZB8A 2A92A 3RFTA 4B3HA 5L7WA 4NBVA 3FHLA 3DAFA 3TSCA 5KVSA 4NNJA 1DFGA 5A9RA 2RHRA 3CTMA 3HZZA 1KEWA 3INTA 4XYMA 4CMJA 4DWVA 1QYXA 4PLCA 3I9JA 3O4RA 5JE8A 4IS3A 3CSDA 3GN1A 3U4HA 3OEWA 4XQ9A 4H7PA 2X9NA 1T4BA 4IGEA 1UAGA 4S1VA 4BNXA 4WE3A 1LSSA 4WNCA 4BNGA 5B37A 1QRRA 2VN8A 4B7CA 5G0UA 3EUWA 2O23A 2QRKA 2PA3A 2Y0DA 1GU7A 3QP9A 1LLQA 2HAEA 2JAHA 3GT0A 1D1TA 4YVFA 1PEDA 5DOZA 5L4NA 3GNTA 3AJRA 3K30A 4U0KA 4RQUA 4TKLA 1HLDA 4CMAA 3FSRA 4R9RA 1YL7A 2HQ1A 2HLPA 2Z95A 1BDBA 5BSHA 2VOEA 1PR3A 4D0RA 2AXQA 1ZEMA 4O59O 5ILOA 4NK4A 3B1KA 4PGFA 4GMGA 4D3FA 1ADFA 4PRKA 2O3QA 4K26A 5IFLA 4RF4A 3SJUA 1IL0A 4NJOA 5EINA 3RFVA 3SC6A 2ZTMA 1ZXBA 1F17A 1PJBA 2BI7A 4AJJA 3CXRA 1JKFA 1NQTA 4NMHA 4PLTA 3DBVO 4PZCA 1E7MA 1HT0A 2NADA 4GGPA 4XA8A 2ZCVA 4YWJA 1T1RA 3QVXA 4GX2A 1IHYA 1CQIA 2HU2A 3JD0A 2EG9A 2VZ0A 5FFFA 1M6WA 2X0RA 5TSDA 4PLWA 3DHYA 4AJLA 1UXGA 1FJHA 3OECA 3HFSA 3RUHA 3E18A 1OBFO 3V2GA 3ZWOA 2YY7A 4RV9A 1E6WA 1MV8A 4YQZA 5AXDA 4CM8B 1A9YA 1DIRA 3LT0A 3TQHA 4JP3A 3SBOA 4FPXA 1WW8A 1DC3A 2Z1NA 9LDBA 2GZ2A 1LSUA 4I9UA 5DBGA 4L0QA 2C2XA 1PZGA 1DAOA 1I3KA 1DRWA 3PP8A 1ARZA 2FPGA 5I7FA 4ALNA 3MOGA 4XB2A 4CQMD 2Q4EA 4BNVA 2VZ9A 1PQWA 2AG8A 3IJPA 4EW6A 3TNLA 3V1YA 2WYWA 5F21A 3ZU4A 4N18A 4BNWA 2ZB4A 1L7DA 3LC2O 1NAHA 4XYLA 2OMEA 1ENPA 3Q2IA 1Q7GA 1CEQA 3OJ0A 1M67A 4JCOA 3B20A 1DDOA 1B3RA 1ZK0A 4GSLA 1R4NA 1Y5RA 2R6JA 3BHIA 3WTBA 4PG5A 4WLNA 3JQAA 4HV4A 2O7SA 1BW9A 4ZVVA 3AI1A 4PVDA 3VHRA 4A5OA 1I3MA 1P31A 4ITUA 3NX4A 3HDYA 4GBJA 4BB6A 1V3VA 4INAA 4ZU3A 3EMKA 2FHSA 1Y81A 2GUGA 2WD8A 4XIJA 4DTIA 3Q0EA 1EVIA 1C0IA 3IQDB 3K96A 4UVGA 4PVCA 2Y0CA 5JS6A 3KSUA 3N58A 3W8FA 4BV9A 2CVQA 1B8PA 2F00A 4YAEA 4BO9A 1YBVA 1K6IA 3KSZO 5TQVA 1LQUA 4EZBA 3V8BA 4TVOA 2EHDA 1Y5MA 3OSUA 4P38A 3FWZA 4J4TA 4MIOA 3VPGA 1GV1A 1T2DA 2I5PO 3GN2A 1KC3A 5EL0A 3F1KA 4C7JA 3WJ7A 1U3UA 1GZ3A 1O8CA 1WDMA 1NFRA 3PHGA 1QYCA 1ZK3A 3DDNA 1SEPA 4FN4A 5L4LA 4HXYA 4IZIA 4WLEA 2JFFA 4JBHA 1YB4A 4YT2A 5JYDA 3U9LA 4I5DA 4FFLA 4XDZA 4YCAA 3L77A 4CQMA 3V2HA 4RDHA 2VWHA 4ALJA 2UYYA 3JQGB 3HN2A 5KNLA 1KY4A 2FPIA 4CPDA 2I9PA 3HN7A 1XCBA 4XX0A 2IODA 3L4SO 4R54A 3WDSA 4J1NA 1DLIA 1TVEA 4ZICA 3NT2A 3GVCA 4OIMA 3BHMA 3GR6A 3F6YA 4I9HA 2CD9A 3MTJA 3EK2A 4MP3A 1JAYA 2W8ZA 4BNHA 1N5DA 2Q1WA 5JW6A 4BQRA 1LSJA 3TZ6A 1XA0A 2PZLA 3RKUA 4W99A 5CEFA 3I5MA 4LISA 5T5QA 2WDZA 2Q2VA 1EMDA 3ENNA 5DDIP 3D3WB 3WICA 3DOOA 2X58A 2QYSA 3T4XA 1GEGA 4TSKA 4E4YA 2VWGA 2ZQZA 2JFGA 4FD3A 3DBLA 2VWQA 4IXTA 3GRKA 2HRZA 2DVMA 1ISJA 3LU1A 3GC6A 1GCOA 4R3WA 3RUAA 4YRBA 3QWAA 4B7UA 5LDHA 1NWHA 2W90A 4RL6A 4NG5A 2HCTA 4OQYA 2A35A 3JTMA 4CQLB 3HDJA 1HE4A 1QG6A 2EW8A 4IQ0A 2DBZA 3QRWA 4NH4A 2EV9A 1QR6A 2WE8A 2Q99A 4DQVA 2NTNA 2OOSA 1VRWA 4GVLA 4TZKA 3CPSA 5G0SA 4I08A 3OJOA 1EUDA 2X7HA 4NJMB 2WE7A 1H6CA 4QO8A 4YR9A 2JHFA 4DPKA 5KIAA 1U7HA 3VAZA 1P1IA 5F1PA 2X6TA 1EE2A 4JIGA 2LDXA 3DFZA 1G0OA 4CMKA 4CLRA 3QIVA 2NU7A 1JVBA 2HK8A 4R3NA 3U3XA 4CR6A 1U4SA 2YDXA 3K2EA 2ZTUA 3O8QB 1PL8A 3QE3A 3TFQA 1Y1PA 4HY3A 1P33A 1X0VA 4XZ3A 1PGPA 1DC5A 1LU9A 1NTOA 4MOWA 3WQSB 4EJ6A 1LQTA 1O95A 2FWMX 1LDMA 2XAAA 3RFXA 4B8WA 5JSFA 4WK6A 3OA2A 1E7QA 3JQ9A 2P9EA 2QYTA 4CLEA 3SVTA 3LZ6A 4XKJA 5L53A 3EZLA 3E9MA 5JDCA 1H2BA 3ZV4A 4IUYA 1R16A 2GZ3A 3PPIA 3E8XA 3FPLA 1TB4A 4I5EA 1VE9A 5CEEA 1WLYA 1PGQA 1E6UA 1MP0A 4FJ1A 4NBWA 4WGGA 4XIYA 4HBGA 1Q0QA 1MUUA 1HE5A 1JW9B 5GY7A 5HTOA 4IJWA 1IY8A 2VNAA 3CZMA 4DGSA 1P3DA 3OJLA 4A03A 3WOHA 3VKUA 2PGDA 1R0LA 2IZ1A 4J90A 3U62A 4C4OA 1NR7A 4YAKA 4E30A 4E21A 2Q49A 4WLVA 2PNFA 3AY3A 3KRTA 4HFMA 1I2BA 3ITKA 3C3XA 4YJGB 3H2ZA 2BGMA 2G1UA 3C85A 4XR9A 3IC5A 3GG2A 3WGYA 3BTOA 1B26A 2D3TA 4BO4A 3KYDA 1YDWA 4F46A 1UJMA 2NQ8A 4IIUA 5HA5A 2W2KA 1DRVA 1U9JA 3BHJA 4WCFB 3CINA 3TFOA 1IOLA 4LCJA 4AJEA 1VL0A 4ILKA 4LMRA 4Q39A 1A7AA 4Z3DA 4IMRA 2P4QA 1P0FA 1UXHA 4J4BA 3DB2A 2FMUA 1WP4A 1DXYA 3JV7A 2YUTA 1T2EA 5GZ3A 1NFFA 4QFCA 5DCWA 4ZQEA 4D3DA 4BO7A 4XJTA 4ALKA 1LDBA 4DRYA 4Y98A 4CMIA 4FS3A 2VYNA 1GPDG 1IPFA 4PRLA 1PL7A 4BNKA 4UUOA 1PS8A 3FF4A 3M2TA 4P8RA 4YJHA 5KKCA 5IDQA 1PS9A 2JD0A 3LVFO 5IDYA 1DB3A 4M55A 3EY4A 3GQVA 2IYOA 4J4HA 1AHHA 2JCVA 4CV3A 1WAMA 4R4JA 4PLGA 3VPXA 4CL8A 3OFSA 4ZJUA 3C7CB 4MVJA 1XYGA 3I9MA 2IXAA 1P0CA 4TZTA 1F0YA 4B3IA 2J8ZA 1I10A 3GVIA 3NDIA 1EK5A 3UW3A 1NWCA 5EIOA 3ETEA 4N7RA 1MG0A 1EUCA 1M75A 4DYDA 3G1TA 2PWZA 4R1NA 4YXFA 3QVTA 4DUPA 1LLDA 4U8GA 3DBRB 3FRJA 4MIEA 5AVOA 4KMSA 5T67A 1TXGA 1R37A 3AM3A 4KQXA 1M76A 1EDOA 5KJ6A 4IZHA 1ENYA 3M1AA 4YAGA 1YOVA 4NIMA 4RLSA 1YRLA 3H3FA 5I9NA 3HDHA 1CYDA 1JU9A 2TMGA 3CE6A 4BIIA 4NI5A 5JCJA 2DFVA 3HFGA 1KS9A 1LRKA 1XEAA 3LF2A 1E3WB 4RF2A 5BSFA 5JC1A 4YJFB 1YONA 3C1AA 4L4XA 3IJRA 4NBUA 4E2YA 3NJ8A 1N92A 3EVNA 3PHHA 4JLWA 2YHIA 1T26A 4OGWA 3NT4A 1LRLA 2GYYA 4ND1A 5G2OA 2J5QA 5T64A 3LC1O 4RVSA 3MZ0A 2HJRA 3VZQA 3D4OA 4EEXA 3QWFA 4BO0A 3OH8A 3JYPA 5JY1A 1YL5A 3AUTA 3G79A 2VOJA 5A3JA 1BHSA 3DTTA 2EKQA 1P77A 3NDRA 1G1AA 1A4IA 1C1DB 3HSKA 4DIOA 3HADA 4MJLA 2EF1A 2EW2A 1XSEA 1BWSA 2O4CA 5TX7A 3W6UA 5CEJA 1QKIA 1RJWA 1ZSNA 4CLXA 4CM1A 2BHLA 1UXJA 1H93A 1YBAA 1VI2A 2X5JO 4A0SA 4BMVA 4MP6A 9LDTA 3ETGA 2E82A 4II3A 3ETDA 1JLLA 4HNHA 5JYEA 2ZYDA 5JBIA 1NQOA 3CKYA 3Q6IA 3F1LA 4CM8A 3ZU2A 5CP8A 1XU9A 1U8XX 5AYVA 4TRJA 2X4GA 1OI7A 4HFRA 4L75A 5THKA 1ZFNA 2UAGA 3K92A 3TOXA 1YQGA 5ILGA 3ZH2A 1QORA 2C0CA 4AG3A 3VH2A 3WQQA 5A5EA 3G3EA 2G17A 2P2SA 3PFFA 4HNGA 3E48A 3VZRA 3VDQA 4IDCA 3JQ7A 2BRUA 4I9NA 1KIFA 3PDJA 3EYWA 3IKTA 3V2UA 2VCYA 4W6ZA 2P5UA 2OBNA 3I52A 2B37A 4FFMA 1GUYA 1P1JA 3LT2A 4CODB 3O9ZA 3VC7A 1R15A 4KQWA 1OC2A 3ZWMA 1H9AA 1KVRA 4GVXA 2H6EA 3H5NA 3WBBA 3E6AA 3TDKA 4DIFA 4UUPA 2W98A 2X86A 3W4KA 2WYUA 3H9UA 1SCUA 3RU9A 2Z1MA 4K6FA 4QUKA 4ALIA 2Y05A 1XWFA 5DP1A 5JMPA 3L4BC 4E6PA 2ZJ0A 1UP6A 3F4BA 2CF5A 5FI3A 3PQDA 4J7XA 3TZKA 4XCVA 1B8VA 2BFPA 3FR7A 1H94A 2WYVA 4QO7A 1QLJA 2P68A 3DZHA 4PLHA 2HUNA 4ZQFA 4GLOA 2VTEA 3K6JA 4MIYA 4JP2A 3DO5A 3N74A 1ZK2A 1M66A 2FY8A 4E2WA 1R6DA 4MINA 2NWQA 4QQRA 4RVGA 3WGHA 4Z9FA 4BGEA 4ESOA 4OQZA 5IZCC 4YJDA 4NPCA 3D7LA 1AXGA 3FWNA 4Y67A 4BB5A 1ZNQO 2DUWA 2OL4A 5IF3A 1E77A 3IKVA 4TROA 2PZJA 1MC4A 2NM0A 5TLSA 1EBFA 2Y93A 4FSHA 3ZWPA 5GZ1A 2C82A 2AEFA 2CSUA 1KC1A 1W0CA 3BMNA 5B1YA 3FTNA 2B0JA 4DL9A 3MJEA 3S2GA 4QECA 3ROPA 4LN1A 1HWYA 4WASA 3JSAA 5A3VA 5A9TA 1YJQA 1DOHA 1E5LA 3EGOA 3JQGA 3RU7A 1DIGA 4R01A 1MFZA 2HO5A 3U5TA 3GAFA 3JQFC 1S6YA 2QQ5A 1BDMA 1GUZA 3K2BA 2W4QA 3AY7A 4PFJA 3FNHA 3STHA 3I9OA 1NHGA 3D3WA 1A72A 4MDHA 4ZQHA 3KB6A 1WDKA 3PVZA 4LMPA 4IXWA 4CM5A 3ABIA 4OHUA 4E33A 2BF7A 3DAGA 3Q1LA 1E7SA 1X13A 1IUKA 1LX6A 2GCGA 2FR1A 2NNLD 3GEMA 4BQPA 1ZCJA 2O3RA 1I36A 2P9CA 1KEUA 1Y8QB 2JAPA 3RQSA 1P1KA 1SOWA 1E1MA 2ZB7A 2Q4BA 3EHEA 3HQ4O 4R1UA 3ZU3A 1V35A 3PJEA 8LDHA 3F5SA 4Q3CA 5T6BA 2YZ7A 2BI8A 3W4JA 2GSDA 1E3WA 5DN9A 4EJMA 2D0IA 3GRPA 3WNQA 4EUHA 3RVDA 4AJNA 3PQEA 5CDGA 1YO6A 4W4TA 3Q9NA 4EUFA 1E3LA 3DZGA 3KUXA 2DBVO 3IUPA 4UEKA 1CIVA 2Q46A 3TN7A 1J4AA 4NJMA 5BSGA 5IN5A 3ZW8A 1NP3A 1HL3A 3E03A 1JN0A 4DPMA 3VPFA 3VVCA 1W4ZA 2O2SA 4UREA 3QQPA 4K6CA 3BXXA 2IRWA 1TT7A 1Y8QA 4TWRA 1O0SA 2GERA 3BMNB 4Y9DA 2WTBA 4Y6SA 3HG7A 2QZ9A 4RZHA 2EP7A 1Y8RA 1HDCA 3PWZA 3WXBA 2VRBA 5JDIA 4N5MA 4RVDA 4LRSB 1EQUA 2EERA 1NHWA 4B7XA 3JQBC 1EVYA 3KO8A 3PI7A 4GX5A 5BR7A 2A9FA 2X9VA 3S2EA 1QSGA 1N9GB 3OHSX 1CRWG 3F47A 1K3TA 4J6FA 4R1TA 5COBA 3WS7A 4R69A 4BO6A 3OQBA 4IJVA 4CM9D 1HE2A 3PDUA 1HYEA 4HP8A 5EJ2A 2XPCA 1MX3A 3BMQB 3GPDG 1Z7EA 2Y1OA 4OYRA 1E1KA 1DIHA 3RUFA 3GUYA 3TOZA 4AJIA 1UXKA 4E5MA 3PIIA 1KVSA 3DBHB 4DYVA 1PR9A 3OJEA 1VJ1A 1Z6ZA 2IEBA 1MXHA 3U0BA 4W9NA 2QHXA 3QLJA 1MB4A 3WMXA 4D42A 4YT8A 1DHRA 4M89A 1B14A 3UUWA 1U3TA 1PZHA 1LNQA 2O2YA 3OIDA 4F6CA 4PLFA 3HB5X 1LJ8A 1Z74A 3UOGA 4DXHA 1LDGA 2NSDA 1XU7A 4KUEA 3I6QA 4YJHB 4ZRNA 2OXIA 4LW8A 1Q7BA 2ZCUA 4G65A 4AJKA 2LDBA 2Y0EA 2NU9A 1E5QA 1RYDA 2XF8A 4BNFA 3DMTA 4CMEA 2X0IA 1H9BA 1ENZA 1GL3A 2AEMA 2EJVA 2VRCA 2D59A 4ZA2A 3GEDA 1P44A 1X14A 3DC2A 1K0UA 5HBRA 1ISFA 1WWKA 4GPD1 1XR3A 1KERA 2FR0A 1IYZA 1R4MB 5JLAA 1MXFA 1HYGA 4KUGA 4WOKA 2X23A 3ZWBA 2QG4A 1EE9A 4ZRMA 4EJ0A 1W6UA 5AOVA 4WECA 1L1FA 4CV2A 4EUEA 4BNUA 3RUIA 3ITDA 4BKRA 1Q0LA 4RF3A 2PY6A 4DMLA 2NTJA 4DBZA 5IAAA 2BFOA 3AU8A 5F5LA 5JCXA 4EITA 2DM6A 1A7KA 3PWSA 4FC7A 1ZW1A 5ER6A 2FN7A 4J9UE 1NVGA 3AFNA 4CLRB 1E0DA 4J7UA 1RM4A 1PSDA 2YDYA 2DKNA 2IYPA 3Q2KA 5EQDA 2J3HA 5JDCC 1A27A 4XYBA 1XHLA 3QWBA 4EYEA 3FCOA 5TT1A 1LDEA 1TI7A 4BKPA 4I5GA 3WGQA 2QRJA 2HDHA 1Q1NA 4XR4A 1H6BA 1LEHA 4P22A 3UCFA 4OM8A 2Q1UA 4Z9XA 3WWZA 3ZV3A 4QTZA 3RIHA 2FSSA 3ANLA 1ONPA 3DBRA 3LSYA 1SOVA 4QFDA 3WSVA 1C1DA 4NZ9A 4A2CA 1Y6JA 2EWMA 2C7GA 4AJPA 2PGJA 5KTKA 4MKZA 5I9MA 4DMMA 3RC1A 2GN6A 4OSPA 2PLAA 4FGWA 3G49A 3ZU5A 3U4IA 1RPNA 3WB9A 5DZSA 1NYTA 3R6DA 1RM5A 3ANMA 3VZSA 3CMMA 2HMVA 4OL9A 2HSDA 4YBZA 4L8VA 4XGIA 4IMPA 3ZWWA 1BRMA 5C3MA 4YT5A 5LC1A 1UAYA 2CY0A 4CM6A 3AUSA 4Q3AA 2Q45A 3AWDA 3QVOA 3IS3A 2DTXA 4LVCA 2P4HX 4UAGA 2WEKA 2GN4A 4WCFC 4XRRA 3TL3A 1YKFA 1SO8A 3GOHA 5BT9A 4PG8A 1B15A 2DPHA 5FI5A 4PLZA 3KM0A 4Q3EA 4R68A 1JWAB 1E7RA 4XDYA 1ML3A 2QZZA 4Y8VA 1ZXLA 3L0DA 1YXMA 4EBFA 2NTVA 4FDAA 4Z3KA 1YS4A 1F14A 2G76A 2Y99A 1HDYA 3V5NA 3NTQA 5G4KB 4PN3A 3H3JA 4AJOA 3INGA 3GGPA 1GYRA 1PL6A 3BTVA 2B5VA 4L9RA 3KLMX 3TZHA 5A9SA 4FW8A 5JY6A 3B1JA 3GY0A 3PJGA 1MLDA 1RM3A 2CDCA 1PJQA 2HK9A 4WNIA 2G82A 5U4QA 1PQPA 5IDWA 2PD3A 4G2NA 3U4DA 5I7VA 3PJDA 1IZ9A 1SBYA 2B4QA 1V8BA 3IMFA 1OOEA 3OQ1A 4OH1A 4U7WA 2VHWA 3C24A 4BO2A 2JD1A 3NAQA 1WXDA 4BNZA 1KVQA 1X0XA 2RH4A 3HDQA 4J91A 4FCCA 1BXGB 3ROQA 3AUAA 5KJFA 1ENOA 2H1SA 5TF4A 3D64A 8ADHA 5IN4A 5K6AC 1NNUA 4B4VA 1FMCA 1GFSA 4MVJI 1IPEA 1F06A 1VL6A 4ONEA 4TMFA 5KOIA 2NUAA 3PK0A 1QYDA 3F5QA 3GVXA 2EXXA 3GZNB 5IXYA 3DBHA 2NU8A 4BV8A 1ZBQA 4E2ZA 3A28A 1WPQA 2CNBA 3MEQA 4D41A 4JK3A 4DC0A 5CDUA 1C3VA 5KVCA 1GEEA 3UGKA 1U2GA 2XXBA 4KDFA 1H6AA 2EP5A 3VPHA 1KETA 4KWIA 2VYVD 1YOVB 4FIZA 4CR8A 5KWEA 5L7YA 4A73A 3CMCO 2O3JA 6ADHA 4Z0PA 3ZV5A 4PCVA 3L6OO 1O6ZA 4M87A 2HJSA 1GZ6A 2VT2A 1YVEI 4J2HA 2EKPA 1JVSA 3UCXA 3E9NA 3GNSA 1SPXA 3A4VA 3RBZA 4E12A 1R0SA 3CUKA 2X22A 1DIAA 3GUCA 4TVBA 4AJ2A 7ADHA 4JBGA 4CUZA 2VHVA 2O50A 2NQTA 4DPLA 1UDCA 4HFJA 2YJZA 3C7DB 4CR7A 5AXBA 5IDXA 4RVHA 1HYHA 2BD0A 1DC4A 3ZWVA 3JQAB 1XQ1A 5H81A 2OP0A 1IULA 4XD2A 3ROMA 1PZFA 4BGVA 4MVJD 4EGFA 1LXCA 2YHIB 3EW7A 3IUSA 3O26A 5H82A 5IZCA 2YV3A 2VUUA 3DTYA 3ZWYA 1GZ4A 4KTVE 2ILTA 2VNSA 1GD1O 4WEQA 1B8UA 3OIGA 1E1NA 3PJFA 4CM7A 1GYPA 2O3SA 3TWOA 3UKOA 2YV1A 3FD8A 2WD7B 1LI4A 1BGVA 4BGUA 4FBGA 4W7HA 4Z9YA 1AGNA 3EZYA 1YGYA 3DZFA 3K5PA 4P4GA 3Q3CA 4CM4B 1QLHA 5THQA 1JQBA 3ZV6A 5CG2A 3RROA 3AUUA 1VL8A 1OAAA 3MWDB 1ZMOA 2GR9A 4BUCA 4BKOA 4CLDA 1KBZA 3L4BA 2CMDA 4OXKA 1DBVO 4ZD6A 1FDVA 3OM9A 3HWRA 3AOEA 1KY5A 3OEYA 3D1LA 3DL2A 4XB1A 5ICMA 1VLLA 4PLVA 2DU8A 2JKVA 3PFWO 5L4SA 3ROKA 4WUVA 1ADCA 4XRGA 5A02A 5TT0A 1K6XA 1N1EA 1WZIA 4JBIA 1E1LA 1A5ZA 2CZCA 2H9IA 4Q3DA 2BFMA 4Y6RA 3BIOA 4GX0A 3ONDA 2DBRA 4GAEA 3D5QA 4L73A 1NM5A 4U0JA 3A06A 2PKQO 1H2HA 1H5QA 3VKVA 3RUCA 1EUZA 1MFPA 4BMNA 5A1TA 3OBBA 3K9QO 3DWFA 3RCBA 1NBOA 4CM4A 4F45A 2O7QA 1CQJA 3F3SA 2QRLA 2IZZA 4IS2A 2Q2WA 4YQYA 3RJ5A 4DBVO 4R16A 2D5AA 1PWZA 5B12A 4B4OA 4E5PA 5A06A 5B4UA 2VQ3A 4NU5A 2IEDA 3CZRA 1CERA 4W9NC 2D4AA 4KDEA 5COQA 1GQ2A 4OO3A 3BTUA 2BGKA 4URFA 1ZVMA 3RSHA 3ULKA 4CLHA 3VZPA 4OJNA 2Q3EA 2YQ4A 1X7GA 3OP4A 3Q11A 1VM6A 4Q9NA 1Q7CA 1B16A 3BAZA 5G0WA 3RD5A 4GH5A 4O0LA 3ZDFA 4A27A 1J5PA 1N9GA 1SMKA 3CH6A 4J43A 3RC7A 1BXKA 1U28A 4Z6KA 4JROA 4KUHA 2I3AA 1HDRA 1BW9B 5TNXA 3RBVA 3ZNQA 3O03A 3JYOA 4GMFA 4CV0A 3WYBA 1N1GA 2GASA 2B35A 1O5IA 1D7OA 2H63A 3FBTA 1OFGA 3MOIA 4MVJG 4OOEA 1V3UA 1I2ZA 3DQPA 1XIVA 1E3JA 1NX6A 3SEFA 3QA9A 4IPTA 4PIVA 4XQCA 2XXJA 1M6HA 2BFAA 2JJYA 1A4UA 1IE3A 3JQBA 2PZKA 3AFMA 3IOYA 2Y1GA 1P1FA 1KOLA 1ZK1A 4GX1A 3WNVA 1LA2A 4A7PA 4IQGA 2YFHA 1BVUA 2Y68A 1RWBA 2V65A 2VT3A 1DLJA 4OXNA 5L7TA 3GMSA 5L51A 4LSWA 5GMOA 4BO3A 1IZ0A 2ZYGA 1UH5A 3F4LA 2O3UA 4XGNA 4U6QA 3NTRA 2E48A 4YACA 5MDHA 3QWHA 2D1YA 3M6IA 2Z5LA 3ENKA 1XLTA 2Q50A 4BNTA 2J3JA 2QX7A 4BNMA 3JQ8B 4BMSA 2DT5A 3RBXA 2PTGA 1ZJYA 3A1NA 4KP7A 4JJGA 4K9DA 1P1HA 5KKAA 1U2DA 1S7CA 4O1MA 3H7AA 3DZJA 5A03A 1GDHA 1GYQA 4HADA 3GDGA 3L9WA 1P9LA 1QP8A 4FOSA 4J2OA 3TPCA 4A10A 3KETA 4CM3A 4DLAA 4WEOA 2O4UX 2PFGA 4CLOA 3DMTC 3LF1A 3DHNA 4RVUA 1YBMA 1JDJA 1ZZEA 3KHUA 2OZPA 2C29D 5TJ9A 2ZB3A 2VHYA 5TJHA 1K6JA 1BVRA 1E7YA 4YT4A 5ICSA 1PJ4A 1HEUA 1NAIA 1VJ0A 2B4TO 5EQFA 1Z75A 1DHTA 3PIDA 2FP4A 4N54A 2BMAA 1K2WA 4E5YA 3LLVA 4MVJE 1LBEA 3GNQA 3KYDB 4B4WA 5L95A 1HETA 4NHEA 5ER9A 3X2EA 3ZHZA 3ANNA 1DFIA 1FDSA 1NPTO 2PGLA 1EDZA 2I66A 1EEHA 4BKUA 2WWRA 3PQFA 5TIIA 3MTGA 1U4OA 2QIOA 3RC9A 1RM0A 1YWGO 3OIFA 4RCVA 3RKRA 3JQ9C 4LGVA 1AHIA 3D4NA 3FN4A 5HS6A 3QV1A 4CMBA 5COAA 4OKNA 2EGHA 4D0SA 3L9XA 1X15A 2HMUA 1LUAA 5CG1A 3IL2A 3I4CA 3WIEA 5U9CA 2ZTVA 2PV7A 3NJ4A 1DO8A 2VUTA 1B3BA 4XQGA 5JO9A 3GDFA 3FBGA 1Y9EA 5T8KC 5JXWA 4L76A 2WMDA 5GZ6A 3KEOA 3QHAA 1PJTA 5H83A 4RPLA 4D79A 1KEPA 4FFOA 3LYLA
chains in the Genus database with same CATH superfamily
2KZVA 5ICGA 1U0GA 3FI9A 2YHUA 3CB2A 1J00A 1C0WA 1PEYA 2RK6A 4RV5A 4YWHA 4C0XA 1L4YA 1MRZA 2DUMA 4EI2A 3KZYA 5AUOB 1W1WA 3EQLF 1PW7A 1QO9A 2BHYA 3RM3A 1NONA 3MJVA 1NF8A 4I3FA 2OGWA 3MWEA 4KXYA 2XAQA 2SCUA 2Q1SA 4QZVA 4ABYA 4MW5A 1J20A 1JE1A 1G3RA 5I9SA 1DI0A 3S93A 4AO8A 1H23A 3WK4A 4KX5A 1AS3A 1KWKA 4DJEC 4RU1A 3FYUB 4ACBA 2LY2A 1PL0A 4P2BA 5C46F 4ALLA 1CE8B 3I5UA 3QMWA 4G9EA 2BY4A 1X2EA 4YLEA 4G01B 3EZXA 4WLOA 2AXLA 2CJWA 4H2DA 4J94A 3V1TC 5KOHB 4HRVA 4IIYA 3VTAA 1DDNA 4YI5A 4RTPA 4MLPA 4YC7A 1T2AA 1CETA 4B3GA 2BBOA 1HC8A 1U2RA 1R49A 2QAGC 3H2IA 3HY4A 2LFBA 1T8WA 2YUIA 3HTUA 1JJBA 1FDUA 4YRLA 3B9QA 3O1LA 2EDAA 4CCYA 2LIPA 4DSNA 4ECAA 3UMYA 2XB0X 3MZYA 1AGXA 1PS0A 1C8BA 4A3BJ 3MXOA 2VLIA 3PLNA 4M8SA 5FO0A 3X2SA 4PE5B 3TBFA 4YECA 4JLAA 4Y1RB 1Z06A 3RARA 3FNIA 1T0FA 4M73A 1C1XA 2PFSA 3PYLA 1A3CA 3V4SA 2L82A 2XW6A 5FBKA 2MSEB 1J5EB 4Q19A 4I9FA 3CLOA 2HKIA 1WLSA 2WIJA 5DJ5A 3M83A 4R8KA 4X66B 1I80A 3AF6A 1OILA 1WZEA 4OMCA 1NI4A 3OIQA 3DPTA 3KPVA 3IVCA 4U0VA 3QW2A 5CAEB 5A4AA 4UB8C 2QU8A 3OLVA 1R22A 4DJAA 4V0LA 3QWIA 4AROA 2HNHA 2Z30A 3GGJA 3PJRA 3K6SB 4NE7A 3K9TA 1M1YA 2Y9MB 3CZ5A 3DE5X 3S5JA 5IH7A 5IBCA 4MQEA 5CD1A 3T5DA 3ZLJA 2VQCA 2X8WA 1OFCX 3L1PA 2W8BB 3EZNA 4PPFA 3ZHSA 3KVOA 2L9NA 2F2TA 3PE3A 4R3UC 1XZDA 5CXXA 2I91A 3UCEA 3A01A 1R4ZA 4OOFA 1SVWA 1FBNA 1MOPA 1BX1A 1E5XA 3NUGA 4MYUA 5CHYA 1P62B 1PFUA 3WLTA 3OBIA 3E1SA 2G28A 3ABUA 2AGVA 4Q5SF 4LG1A 4C76A 1JA9A 3H2SA 4XQ0A 5KC9A 1W2GA 4XJSA 3U3DA 3GXOA 4OBEA 4EG8A 2DTEA 3L2VA 1PJ2A 1BXZA 1E3EA 2QT1A 3JQDA 2WUEA 1Z16A 2W85A 4IV0A 3A32A 3GHYA 4N39A 4TMTA 5EPOA 5FOXA 3R4VA 3SX2A 1GLNA 3AFIA 3WGIA 3JYNA 3NQOA 4I4CA 5KINB 4UQPA 1IUYA 1J70A 2AOVA 2IHUA 2VJAA 3ABZA 4NQWB 3Q3VA 2WG1A 2WVJA 2HZTA 3WWDA 4IHQA 3W6ZA 3ZWNA 4ZXFA 2J0QA 1X87A 1OCRH 4R9SA 1ZO8A 2EX0A 5B1AH 2DECA 1HBXG 5FFXA 1Z13A 2YWJA 3GMDA 5LDDC 1NRJB 4P08A 4BJHB 1IB0A 3G5TA 1J8YF 3VTZA 3EXHC 4NDLA 4G67A 1YR6A 1TEHA 1J2UA 1KP2A 2ERXA 1WCYA 1ZMRA 2N47A 4LJ9A 2GXAA 4U2DA 5LIRA 2GHQA 3V8QA 2C5EA 4IR7A 1PJSA 5CFOA 5EMNA 1U8UA 3HWSA 2X5KO 1JEJA 3QZUA 3AC0A 3L4JA 4ARBA 2NLOA 4JL6A 3PFHA 1GILA 4BBPA 3C18A 1QX4A 1VLJA 2Y1LA 4MAFA 3RJTA 5I9LA 3PUBA 4KT5C 1F48A 4UHCA 3CWQA 2ZUWA 5KOHA 1DUIA 4GR9A 1KU0A 4MV0A 3HSFA 1JR2A 2LRDA 4MI9A 4EX7A 1XZPA 4JJIA 3W3AH 5K51A 4CLOB 4YJGA 1MPTA 3PHCA 1FUYB 2PMUA 2G6TA 2WTXA 3QKTA 4MGHA 1F9NA 4C4PA 3QKSA 1L7NA 1EFHA 1EIWA 1JQKA 4ZVUA 4EHFA 3DMHA 5CM2Z 1UANA 1EXDA 1JIKA 1T2CA 2HQOA 3NHKA 2EBIA 1KEVA 1TK2A 3ET4A 2QW8A 3O4GA 2Y0MA 4LLLA 4JGBA 1E3SA 3VZDA 4BGIA 4W5JA 3Q7RA 3R5JA 1K7XB 1RQXA 3W8DA 5BRJA 2M1XA 4LEIA 4MKXA 3RPUD 2IPMA 3QHQA 3LDAA 1PR6A 1ST3A 2C5SA 1BE0A 4M72A 2MDTA 2HNKA 3ES9A 3L7OA 4GLLA 4NZNA 3UV3A 1R8JA 5LHHA 2R1VB 4BAZA 4ON0A 1YZKA 2AF3C 2FZWA 1RLMA 3L0CA 3NDJA 3PC7A 4TKUB 5D3QA 2ZXIA 3IDZA 4D80A 3JAMZ 2M98A 1MMNA 4IDDA 2B4KA 1Y6QA 1LVAA 3FMRA 1YB1A 3ACCA 4NFYA 4Z53A 2AF4C 4CLHA 1X7HA 2JFXA 3A3OA 2QMHA 3GXBA 2BMJA 1HDZA 1OREA 3LVQE 3KLPX 3MWKA 2K40A 3QPTA 2FR8A 3NHFA 2JBAB 4D44A 3D02A 1Z7GA 3B1XA 1ZH5A 3AKEA 4WNYA 1FE8A 2JPCA 5L45A 1PN3A 1VE1A 1Z67A 4GUAA 2H8KA 3H1PA 4XVUA 4IG4A 5TLSA 2I6UA 4HDQB 1Z4LA 2DOAA 4KTTE 4GKVA 3RVLA 1QONA 1SOAA 1UP7A 1RQPA 3DZKA 4FCWA 4YAJA 3TSWA 1Q3TA 4YJKA 4F93B 1B42A 1L5WA 3B6EA 3LLSA 4R51A 3SXYA 1NNSA 3P0EA 3QLUC 4QXMA 2ZJBA 4Z1OA 3SJBA 3IAHA 4YIHA 2IZ7A 3W79A 3D0OA 2OBBA 4D8UA 1AV6A 3R4KA 1WNTA 1KY3A 3FTDA 4WCDA 1TA4A 2WM3A 1M7HA 2AMYA 2CMHA 3GH3A 3VR0A 3UK0A 4ZALA 4RDUA 4JMPA 3H4VA 4LIPD 3O8QA 4FB4A 3QFCA 3GUUA 3K9WA 3NFYA 2XGJA 3A6ZA 4TTPA 3GVPA 2O8EB 4DHEA 4QXAA 5EP2A 2DR2A 2QE6A 2R7VA 3DAHA 2DJIA 3KSDO 1M2FA 2RHOA 2AQIA 3LV8A 3CZ6A 3BIWA 3ABTA 4OXYA 4RK0A 3D3JA 2BWJA 2Z58A 1LC0A 5BMVF 1UWVA 1FNCA 1JG2A 3ITEA 4HKTA 2C54A 1IN7A 2AFIB 2RCYA 3G2QA 4RACA 2HKOA 4GDFA 1Y4ZA 3FMPB 3TB4A 3BDDA 4U4AA 4LLGF 1KI6A 1DEKA 1VKZA 3DHWC 1X1EA 1E2EA 1WPRA 4G1BA 1VG8A 4KWHA 5EIBD 4EY6A 2D4HA 2A3NA 1CS4C 2ZROA 2VA8A 1CB0A 2OZEA 2QTVB 5JXJA 2F17A 3ZWCA 3H36A 5BMOA 5H6RA 3PFBA 1P4XA 1UZNA 2VDLB 4LTMA 5AW0A 1M2OB 3HA2A 3LZCA 1E9FA 1EFDN 4CNBA 4PHHA 5BWMA 5LYJF 4LOIA 4HVTA 4RB0A 1ZVQA 1QQ7A 1HYQA 3K0BA 3WBJA 1EP3B 4DKXA 4CKCB 2NV6A 4PHCA 4XI9A 1IY1A 2PQMA 1UKCA 2HRRA 3ECAA 2HYGD 2QN7A 3EFHA 1WCMJ 1KNXA 3GLQA 4HAWA 4R2IA 4Y2GA 3EGEA 3TNJA 1AB6A 2CG4A 2HQ5A 2A0XA 1YAJA 4HPWA 4K1LA 2LG4A 2ZFWA 1UEIA 5FL7D 3RKSA 2PX9A 1XKQA 2I3GA 2ZIFA 3HR4A 1Z0KA 5I51A 4ZQBA 5SY9A 2MMCA 4KLNA 4B32A 5CA1F 1GT0C 1LV7A 4R41A 4LWQA 4R0VA 1I32A 5GPCA 1YC5A 4OIOF 2IU4A 2A1TR 5FYDA 3UAZA 2BH9A 1D1PA 1G18A 1L4NA 4OAOA 3C6ZA 3OVMA 2WJGA 2YV5A 2X8LA 5LCXA 4K6HA 2IXDA 2ZWMA 4M9ZA 1I6LA 3IESA 4JT2A 3GFVA 4P6VF 1W4RA 5KSZA 1KFCB 2BHRA 1SG6A 1QZXA 2CF6A 4NFLA 4IEIA 3GJ6A 3GGGA 1VJCA 3LFUA 3RFFA 5F9HA 3I54A 3IIEA 4ROTA 4WA7A 1I2DA 4DXAA 5JNVA 3OM1A 2LD4A 2BY0A 4HX9A 1NUAA 3R75A 3SIXA 1Y0NA 4RIFA 2OP1A 4X54A 1IFXA 1M2WA 2ET6A 2JGFA 1X1DA 3AY6A 3RSOA 1NN1A 1OA0A 4NE9A 2YZMA 4GZ3A 3WL8A 3TZCA 2WBLC 3VC3A 2UDPA 2Y69H 3K94A 5LZ7A 3PWKA 1J0BA 4PYMA 4ZTUB 4Z4HA 4L4ZA 2GPSA 5HF6A 1N4AA 3ROGA 4G1FA 4DIBA 4CQNA 3OPXA 2ONCA 3R3JA 5K0GA 5CJ9A 4QWMA 1X38A 4A5MA 2JK1A 2QXYA 3MJSA 4JYPA 3MVEA 1GPJA 1B8IA 5F1KA 1WE2A 3NCTA 1BYUA 3TOAA 3U1TA 2B83A 5L3ZA 5M5BA 3A6DA 3FX3A 4UUAA 1NF9A 5JVGF 4IDBA 4B74A 1RPJA 3ZQIA 4HX8A 1C29B 2RC6A 3A1DA 2JDID 3B85A 3QLVC 4K8RB 4UVDA 4Q9IA 4Y6QA 3LUBA 3UMGA 1AQJA 4PCUA 2FF4A 3MXTA 2XMQA 1E4EB 1M7BA 1EM8A 4N3NA 4Q4HA 2R2GA 3EWIA 4NFHA 4YRGA 5F23A 1ZU5A 4Z7JA 5JSHA 4J1TC 2FSVA 4O5OA 1KI3A 5M3BA 5K5EA 1ECCA 3ZQKA 4LF9B 5LIPA 1PV1A 4OHKA 2B69A 5DRYA 4ND2A 4EHJA 1XL0A 3BFVA 1E92A 1Z18A 3EGXB 5FPYA 3UAOA 4DGQA 1E2HA 4D56A 1QMGA 4CE6A 2R7TA 2QTFA 4RY0A 4NICA 1AN0A 2X0NA 3F9RA 1X7YB 2GOYA 3CEPB 3ORQA 2WAQA 2BLNA 4RE6A 5AVSA 1C7RA 1CP3A 4X3OA 1KJZA 2CYCA 3ASUA 4FB5A 4CTKA 3GZNA 1MORA 3TG8A 2O5VA 5EEHA 2OHFA 3CX8A 1UXOA 3C6YA 4HUQB 1PWHA 1R6UA 4OX9Y 2A0WA 1UXIA 2FUG1 2BI4A 2J3KA 2ZVJA 1NVTA 2HJWA 3ICCA 1BTOA 2BV3A 4NU6A 3WV4A 4EAAA 3PDWA 4JI0B 3QXSA 5FPQA 5BWCA 1ONOA 3WIVA 3VYUB 4B3SB 1TZJA 3BD7A 3OWHA 5GP9A 5K45A 4FUQA 5CXUA 1Q6ZA 1NG9A 5JAIA 5KOJB 4P9UA 1I6MA 3EVCA 2OFXA 4LZOA 4FR5A 1ZK4A 1A95A 2XVYA 3JD3A 3H97A 4D0LB 1L1QA 4LSMA 3AB3A 2A5YB 4Y2QA 1PE0A 4I8XA 2DUNA 5IJ9B 3STYA 5HF5A 4W97A 3WNCA 3NYIA 4BLSA 4R2MA 1B1CA 3KYLA 5EG5A 5CH5A 1I01A 1K8QA 2Q0OA 2BFDA 1PVVA 1E2FA 2ZATA 4QC2A 1S5LC 3TGNA 3FMGA 3HYLA 4Q1VA 2B3DA 3RRZA 2RH8A 3V55A 3O0DA 3LBFA 4FDVA 4WOJA 4IP0A 2NP7A 3H9QA 1O94C 4LNUB 1KIAA 1HLGA 1PYVA 5HTKA 3GMEA 3C3AA 3SOPA 1NOKA 4IMIB 3TJRA 3C8UA 1G6OA 1OXBB 3DCIA 4L4YA 1WZNA 2HWWA 4RH0A 3R77A 3QKRA 4BKQA 1JPVA 1QXSA 2QD3A 1ISMA 3I8SA 2XD4A 1VKJA 3K4BA 5G53C 4XRMA 1UC8A 4UTZA 3UT5B 1EG2A 2ZP1A 3CNLA 4AXBA 4JXZA 1KQ8A 2YFYA 3HG9A 1MPXA 5HRUA 4P4NA 3EEYA 2BMDA 1A31A 3H05A 3DU6A 3T7TA 3LT4A 2B63J 4E6KG 4TUYA 1P4SA 2R00A 2BLLA 5FXMA 2DH6A 2JCXA 4FOTA 1T2VA 4E11A 2JC3A 3DOJA 4XOIA 3D5EA 2GBPA 1X1TA 2YQZA 4QAQA 4INJA 4RVCA 3WKBA 5JFOA 3QU2A 4WESA 3A36A 1GTSA 1LPNA 4XUDA 5CDFA 3GAZA 4ED9A 4M3EA 3RWMB 2O3TA 1B7GO 4EJFA 5JQGB 2E1CA 1CF9A 2TCTA 3OYCA 1W36D 1RWWA 2GBLC 1DIBA 3BDVA 3BRCA 1VA5A 3JAKA 4LK2A 3NHSA 2GDJA 4QTXA 3SR3A 3J7ZI 4BVAA 2XGMA 1Y1QA 1W48A 4XGQA 1O96A 2KPOA 1HXDA 2WHPA 4YUVA 5KDDA 4AKHA 2OORC 2PYIA 1XZQA 3JYQA 1XSXA 4NP6A 4UHTA 3OMXA 3WBKA 2FDCA 4NK5A 5KUTA 2AOUB 4UDXX 5ITWA 1PFQA 1QS0A 4LVOA 1SC9A 1XG5A 3D43A 2P6MA 4JN6B 1JTVA 1F6DA 2C98A 3IEXA 4UTXA 4GFBA 2YV2A 5J8FA 3GA5A 3MT0A 3O3OB 3G59A 4XWTA 4MR7B 4WX9A 1U9OA 2RONA 3L3BA 2VH1A 2VHJA 2XNHA 4WCFA 3ZKAA 1XNJA 4AZWA 4PN7A 5I7EA 4K9PA 3U7JA 1EVQA 4TUYB 2GJ9A 1HE8B 1E9BA 1RRKA 2EJWA 3C5EA 5JRDS 3WYCA 5FR2A 1JKJA 1UC4B 1I6KA 1TM4E 5B1BH 3BXOA 3WDMA 2XPVA 5TGDA 3G6KA 2FW9A 1X2NA 2CW0F 4OAYA 4XOPA 2HMTA 1NKTA 2OBLA 2W8BA 1Y3IA 3LSIA 1F38A 1RKXA 3THSA 1YULA 1R66A 2D5CA 3CW2A 2I7DA 4V03A 5ALLA 4DDMA 1NXQA 4CZZA 2OLJA 2X13A 4R5MA 1ELOA 4WBSA 4C7VA 5E1OA 2PM8A 5HRAA 1I94B 2NZYA 2Z3WA 4TMKA 5C32A 5AM1A 2YY6A 2H09A 3AG3H 1P7WA 4MEJA 5DLPA 5KNCD 4OMUA 2P91A 4C3OB 3K9FC 3PXCX 4BX2A 3GZ4A 5BSWA 2YMPA 5EXPA 1FW6A 3N7UA 5AUNB 4J9VA 3LAJA 1UINA 4UJ5A 2PQ0A 3PF8A 1I3CA 1BJTA 1F4KA 2HCFA 4CUKA 1IU9A 4BFYA 2JSPA 4Q7MB 4PZEA 3FF5A 4B3XA 1VKOA 3ETCA 1L5VA 1EGAA 3KSMA 5G4KA 1II8B 3FXLA 3K73O 2DA7A 5CFZA 2HCRA 3UC5A 2Q4RA 5E4FA 4U88A 1HNXB 1E2XA 1HI9A 1X86B 3H4MA 5A7HA 3S1MJ 2B4RO 1VQ7I 4XUCA 1H9CA 2YH2A 4RGQA 1D1AA 3K09A 3PPWA 2QZSA 3H8VA 1C0EA 4M1QA 4BHPA 2O5EA 1SCNE 2VPLA 3GAMA 3PVCA 5BN3A 1JKJB 4P4UA 2A78A 1SXHA 4WVLA 1ZD2P 1K7SN 1XEWY 4P32A 10MHA 5FTWA 2P81A 4M99A 1PFWA 1T8IA 3G1UA 3L2OB 5DBFA 1M2KA 1HF0A 3FXUA 1HZZA 2XLCA 2PZMA 5E7IA 4LVUA 5DEQA 2V7FA 1KTVA 4F8YA 3SBDA 3TLKA 4HDNA 4JJ8A 4D3YA 1C5KA 2G1KA 3L8CA 2UXCB 4YJ3B 1HSZA 3W5UA 1EZ1A 1YT5A 2BMWA 3JQEA 4ID9A 2YHBA 3GLHE 4R5HA 5JFTA 4R8RA 5HK9A 3IQXA 3PNMA 3WTCA 2CFCA 3PLRA 1DFHA 4W5HA 5CLHA 1K83J 1R12A 4RGBA 2VQFB 1M72A 5I48A 2FFHA 3EIHA 2W2LD 3C1UA 3HGTA 4FGSA 7YASA 4HQKA 4XJVA 4QPOA 3WL5A 3HO1A 2F1OA 5JMPA 3H86A 3U80A 5JJIA 4LCEA 3UJ3X 1YH3A 1CZLA 5LDGA 1G98A 3IPRA 1KO8A 2YWCA 2QXTA 4Q7LA 2OFPA 2QTAA 3HU5A 1C4WA 3DKRA 2UZ1B 2LK2A 1HT1E 5J59A 1CR1A 2B8NA 2EHJA 3N2ZB 4F5ZA 5HNFA 1UM9A 4ZODA 3PIPF 4OCZA 1M2HA 4RORA 4MVJF 3Q5GA 3KOUA 2HF9A 4YUXA 4ZI7B 1Y9AA 1SMYF 2DFKB 3CONA 4XUEA 1NVMB 4L0QA 1WMFA 1MNMC 2LCIA 2VDPB 4GGGA 1U2WA 2GAAA 1U3WA 1US8B 3AK4A 4V3BA 4BL0B 2VAPA 5CHEA 4MKIA 4WKBA 3TBKA 1CIJA 1KNQA 4GSKA 3GEIA 4OKIA 3PVSA 1SELA 3LSGA 1V7ZA 4ZK2A 1AOXA 3NPAA 5BRAA 4DW6A 1TAQA 4JOMA 5IKXA 1GJRA 2B92A 1MT0A 1ULYA 1U5CA 3I83A 1CWUA 1B43A 1QQTA 2Q5FA 5FQNA 1OISA 3UBTA 3HEAA 3EVTA 4I3HA 2ZXJA 2F5VA 1WH5A 2B36A 4IFIA 2IOYA 4JBNA 4O4JB 3R41A 2NVUB 3SLKA 2EGGA 4RGUA 2PKRA 5HIKA 2DPDA 3SQMA 1TNSA 4FKBA 1I7LA 5EIFA 1Q0UA 2CMKA 2XH8A 4OXQA 5H3LA 4B71A 4BNDB 1H3EA 1U7TA 5C8VA 5FWYA 3D6NB 3ELUA 3L06A 3Q15C 5IX8A 4DOZA 2NV2B 2XGDA 5CTJA 3PTAA 4O29A 1ZJ5A 4KI0A 3K20A 4BBJA 4K6OA 4Z4EA 4BE7B 2GOXB 1UP4A 4IIDA 1MA0A 2ZVQX 5YASA 1D8JA 2BELA 2MHCA 1JAXA 2P9GA 1MBHA 4DF3A 3WU1B 2QVYX 2RH5A 3GU3A 1T0UA 2GPTA 3O9MA 1T38A 1E89A 3W7VA 3HYSA 4C2AA 2CQXA 1XNRB 1FSGA 3O1JC 4NARA 821PA 3OTOB 3Q8KA 1TYAE 4RJ2A 2H5LA 1QHYA 2I6SA 2P77A 2MBFA 2EPFA 3R7WB 3W8NA 4FWBA 3RC2A 5B1DA 1VJTA 4MMYB 4BX3A 5KTRA 2P11A 4DGWB 2HU5A 3HXKA 3ZLUA 5JAPA 3MOSA 4XEHA 4HF0A 2V98A 1X3SA 1XP5A 3G02A 1XZKA 1ZICA 1KA8A 2RBEA 4C3JJ 4QL3A 3RWBA 1HKQA 3SZPA 1N75A 1SBTA 3BH0A 3TVYA 3P7NA 2NIPA 3E5MA 4TN1A 3EG9A 4EKYA 1JALA 2GS9A 1S9DA 4GEKA 5CB4F 3PL8A 2J09A 5JPIA 2IOQA 5IT9K 2QW0X 4RXUA 5AK0A 5IZ4A 2GN2A 2XYQA 3I6IA 3TGLA 3DLTA 1I0IA 3C8MA 3B2QA 1E9VA 1QV7A 3FDYA 2IK8A 2NO4A 1V26A 3Q3IA 5K3CA 5C37A 1RAEA 2EU8A 2ZJ3A 1ZH0A 3NYWA 5H0IA 3CEJA 4FJ2A 2NQ2C 1QHNA 1XVLA 5BQFA 3IBYA 2HU8A 4F1KA 4KA4A 4HDAA 1FQJA 4O6VA 2ZRQA 1SKYE 4FDUA 1Q0PA 1C9KA 1P5ZB 2WFMA 4LHSA 4E7LA 2WAFA 2EWWA 2VWPA 1T24A 1SCAA 1HKUA 1X7DA 2V6MA 3FF1A 3I23A 4NEGA 1MVLA 1GGVA 1FC0A 2ZTHA 1V0JA 2DLDA 1OI4A 2C58A 3FCYA 4U7BA 3O1IC 4FYIA 5FNVA 1KEZA 1OI3A 1QYVA 3EF1A 2Q3FA 3SKXA 4NQWA 3CTPA 1WB6A 2C2MA 2QXUA 3IEKA 4YONB 1U7DA 3CA8A 5E0KB 3IOBA 2GF9A 2GN8A 1C0PA 1KAEA 2QPOA 4IIJF 5D84A 1B0ZA 2CK3D 1WB4A 1YDGA 1JGTA 3T1NA 2R5YB 4N5LA 4OB6A 2XF6A 2VP0A 4WN3A 3RUDA 1HDOA 4MQ9F 3LQFA 3TEDA 2MOKA 3ICEA 1DIOB 2HT1A 1FRNA 3L7DA 1VE5A 4D2IA 5DOVA 1XMKA 3HDDA 4DZRA 5B7NA 5J4KA 4CEHB 4Q3BA 3I3SR 2Z4RA 4KFUA 5CLIA 4PR0A 5E9WA 3UFXA 2D2FA 5DI3B 5LQKA 3NOOA 4JC0A 1K66A 3UJ7A 4J3FA 5EMHA 4BUPA 2BR5A 4IVRA 2DDAA 4EMSA 1PHPA 2HMYB 4JR2A 4YCMA 4IWNA 1FDWA 4YGXB 4QGHA 4CF3A 2PKCA 2BKLA 4QPZA 5KJEA 4XAQA 1E4YA 2DUUA 2OC9A 4DA9A 1A2QA 4GI3A 1PDWA 1XEWX 1VQ6I 1ZAKA 1J7JA 1Z47A 3EIFA 1QBJA 3VPBA 4DMHA 1PT7A 2Y9PB 3BD8A 3C7TA 2HEOA 1T8YA 3CR7A 1GADO 3PEFA 3MWJA 3P9PA 2QV7A 4G1VA 4OHFA 3S5UA 2WQ7A 1JKIA 1ZJJA 3CPJB 1J8DA 1NKVA 3L2RA 2BFWA 2FLKA 4MI1A 1E3PA 3WXBA 3O8RA 3TQOA 2OK7A 2O03A 3OPQA 4N7JA 4YJFA 1Y7TA 1BG6A 1YV9A 2F4OB 1JG6A 2VASA 2R0QC 2IPAB 4QDXA 1LTHR 3RYIA 5EKSA 4UM7A 3Q0UA 2QVLA 2ZIWB 3GJ8A 1YR3A 2F3QA 1EFVA 3C5CA 4PZDA 4KIUA 4LI0A 1DARA 4M7OA 3MMPA 2FQWA 4A3FJ 1I24A 4RMGA 1Q2UA 3N2GA 4NR0A 5B1HA 5LU9A 1VSVA 5JECA 3NHBA 3A2MA 3KYJB 3CJRB 1EGHA 1FF9A 1LDNA 2CXUA 2ODTX 2R1VA 3NEPX 4FX2A 2C7RA 1MQSA 1P73A 3KQTA 5JSUA 1OCEA 4JXKA 2YS9A 2R6HA 1L3BA 5HCIA 2JI4A 2JCYA 1DQYA 3FPSA 3RVRA 3WDKA 4AIRA 1RHKA 4XGKA 2M87A 3LY9A 1JEOA 2DK8A 2DG2A 4HLUA 4LC9A 4MGIR 2XE6A 2PTHA 3F6BX 1L7OA 3Q7PA 5REQB 4CF6A 5KTSA 5BNGA 2ILVA 3OZXA 1QHEA 2VF7A 3RNOA 4MS4A 2OAP1 2RJNA 3H9GA 5HXAA 2VTBA 1LF0A 1VYHA 1P5FA 1QGYA 4RADA 3CH4B 4WXMA 1M1UA 1W0TA 1R0RE 3AEUA 4M3NA 4MHTA 2E7XA 2FJ0A 2IYWA 1KKMA 1U5AA 3G88A 3MCVA 2UYGA 4K28A 4F4DA 3ZQCA 2CDAA 4LXXA 2WY8Q 2O9JA 4Z0NA 5JAQA 3D5LA 3J7AY 2R00C 4BC1A 1OCPA 1DG9A 4YRCA 5A05A 5NLLA 2J67A 3V7YA 4BFCA 5CITA 5IVKA 1XRSB 1IXYA 2P6UA 3I3OA 1QJ4A 4WZBB 1W52X 4J49A 3AGQA 3KXDA 4MW6A 4E5UA 4A3MJ 2Y0PA 1RWPA 3FYSA 3HNRA 3I9V6 4FJ0A 3P96A 4QBFA 2DI3A 2BSAA 1U5TB 1Z12A 2QAIA 2GPBA 2V3VA 4RV4A 2CMGA 1L5MA 3K1AA 5FHQA 2WAYA 3ADPA 5G3ZA 4JI5B 3MHTA 3URKA 3WRVA 2H7YA 4B3HA 1E2QA 2FSVC 1M5RA 2ORVA 2J9FA 3EUHA 3JTGA 4NBVA 1TW3A 2QW1A 4LFBB 4PYIA 3W6KB 1B2RA 5LLDA 2OO5C 3NIDB 3K2IA 4CKCA 3UKGA 5A6SA 2RHRA 1E0KA 2J4CA 4GMKA 3SYKA 3C2QA 4Q03A 2GAUA 1CTQA 1MQAA 1P19A 1Z2AA 2F1IA 4CMJA 1W7AA 1YDFA 5JWOA 4G1UC 1XTAA 2IVFA 4EO4A 3TLAA 1DP4A 2AMJA 3LVBA 3O8CA 2CLLB 3WL4A 4AM8A 3UPDA 3KP6A 4HGOA 4LI3X 2K9QA 2AX3A 4H7PA 3FLAA 4ETIA 4FONA 1KEEB 4S1VA 4FMPA 5EKUA 5BN1A 3PXGA 1SG9A 3HZOA 3W9UA 2E2WA 3N6RA 4WE3A 4G0YA 4WNCA 4MA4A 3R9WA 3HSRA 5I9TA 4NZOA 1LPQA 3EEFA 5J2UF 4RNDB 4OTZA 4XPIB 4WXEA 4B7CA 5G0UA 1ORTA 1XCPA 2O23A 3ETJA 3EUWA 4UTPA 1C3OB 1W88A 5I7HA 5SZIA 1L1RA 1WZCA 4MEBA 2AC7A 2C61A 1GU7A 2PA3A 2BFBB 5P8WA 5BR4A 2Q7DA 1NE2A 1YIOA 2JAHA 3GBSA 1D1TA 3NB0A 1HURA 3OQOA 4JBYA 5K7HA 2PVSA 4PYJA 4EARA 1IW7F 2R48A 1QH1A 2CQKA 3K30A 4RQUA 2RHDA 4U0KA 3HMQA 4CVNA 4DAEA 1CKEA 3UPUA 4AMBA 1F2UB 2JASA 3FSRA 2IWHA 5L3DA 3ZS8A 3VHLB 3WRXA 4R2LA 3U6KA 5CCXA 4PS1A 5BSHA 1B8OA 1G2IA 2BE7A 1X1CA 5IP7J 2ZSAA 1W29A 2AXQA 3KC2A 3SSNA 3W3AA 2IW3A 3B1KA 4FETA 3B36A 3JW4A 3MRSA 5K4HA 3BXZA 3R7WA 4PJNA 3IAM1 4DMUB 2V4JC 1DGWY 3OIPA 4RMNA 1PR1A 1T0IA 3EOZA 3M34A 3JX9A 5C1DA 3TDZC 3CGGA 1L6IA 4MS4B 4RF4A 3SJUA 1YJCA 1TA0A 3EZ9A 1C7FA 3BSSA 4PX2A 5JNWA 4CEIA 5MFZA 4TV7A 1W9MA 2HA0A 2ZTMA 1E8DA 1R1UA 2WA0A 5JLXA 1F17A 1PJBA 4KQ6A 3EYYA 4QU5A 1NQTA 4UNQA 5FUVA 3UIEA 3UFBA 2Q5CA 4HJXA 1HT0A 1YRAA 3AB8A 3LNCA 3C6KA 5H4GA 5M5XJ 1NW3A 2H29A 4UOQA 1IHYA 4G0NA 1TJYA 3N07A 2ZRAA 2XDWA 1H0MA 1E2MA 2C3MA 3NWOA 2QMQA 3LIPA 3T3NA 4YI3A 2L7KA 5D5VB 4AJLA 3HFSA 1OAKA 1IGNA 1ODSA 4QXPA 3LQ1A 1OBFO 1WRJA 5HMMA 5C5DA 3ZWOA 3RF6A 1UBGA 1L4EA 4YQZA 5AXDA 1A9YA 4BE0A 1V3QE 5TVKA 4IXAA 1H89C 2JIBA 3RYHB 1U9CA 1YGPA 1MAWA 5FNVB 5L3FA 2OUKA 1G3MA 2EFOA 1DU0A 4K2AA 4N8SA 4YMVA 5JNUA 5EE0A 1RACA 1CUWA 3ZE6A 4J16C 3V8LA 4OK5A 1AWCA 2TMKA 1YNSA 2X40A 3IAEA 1Z8DA 5BOXA 1EXMA 5E3NA 3K32A 1DAOA 2JLCA 5KK1A 4G1CA 1NSYA 3TW6A 3IRUA 4LPKA 4WKCA 1FFWA 2OLEA 1IY9A 2QTZA 4CW7A 4F12A 3HB9A 3ET5A 1Z08A 3TXAA 1BW6A 4XB2A 5I7FA 4D6YA 4N7BA 5EZSA 3BWXA 1U1DA 2FK8A 1ZUHA 2Q4EA 3P4YA 3STVA 2BW3A 2YRXA 3EXG1 2AG8A 2NZWA 5EUCA 2Y75A 3T5BA 3TNLA 3KJNA 1EE1A 4BX9A 1E1CA 2LWIA 2CJWB 5I3CA 1TUBA 4MROA 3T12A 2IUTA 4ISCA 2IHYA 3BE5A 1N0UA 2XMRA 1E3MA 5TPWB 1J2TA 5ESDA 1Y82A 1KZGB 5THXA 3KOWA 3TL6A 4XYLA 1TLHB 4H1TA 1RPTA 4P5OA 2WWWA 1DBSA 1N4DA 3JREA 1CEQA 1HO3A 1Z15A 2EC5A 2JFYA 1S1CA 3O83A 4Z1MA 3B20A 4KUMA 2PCLA 4FFWA 5DHQA 3C41J 1AQYA 5JLJA 1XNHA 2DMNA 1SUBA 4RSMA 4C3IJ 1E79A 1ZK0A 2WSSA 4I5GA 1UPTA 3E7FA 1J1UA 2VL7A 5C9ZA 1FY2A 3NR2A 2AIRA 3JQAA 4EGJA 4HV4A 3IQWA 4QLOA 2FPPB 1BW9A 4ZVVA 1UF9A 2IPOA 5JTUA 3NASA 2ZAIA 1UWLA 1CV2A 1I3MA 5LEJA 1P31A 2PANA 2WPNA 4ITUA 4Q34A 1SFRA 5IW8A 4RTOA 3RHZA 2JLQA 3OIVA 2FHSA 4UUTA 3CR3C 3IH5A 4FM9A 3Q0EA 1FUUA 1I14A 2I33A 1JHZA 4UVGA 4PVCA 4BMYA 5C51B 3MKLA 3E9RA 4JT8A 3DUFB 5KAIC 2HVSA 2JLAA 3MD9A 3BGWA 3NKFA 3PNBA 4WRRA 4BAUA 2EFWA 4QEKA 3IRRA 1F5TA 1I3OA 3T7KA 1P6XA 3ZY2A 4PC3A 3HM2A 5FP0A 4LHVA 1RR7A 4S2EA 3KSZO 1YJAA 2C5FA 1E17A 2HTFA 2XQVA 2MSWA 3FWHA 3S1NJ 5AKIA 5TQVA 1JSRA 3T9FA 2WSSD 1USGA 1XRPA 1Z4OA 3O4VA 2LD5A 3ZPLA 3CW9A 2EHDA 1P9QC 2RHHA 4P38A 2QRVB 3B52X 2OG2A 2ZJYA 2DFIA 2BEOA 1EB8A 2JH9A 4HH4A 5EC8A 3ZVKA 1XWIA 1GV1A 2FAXA 3EJWA 4QPDA 1T2DA 3OMYA 3TO7A 2JCBA 2YVQA 3LCRA 3PUKA 1KC3A 5E3IA 5EL0A 4ZT3A 3FRIA 1U3UA 1GZ3A 1FMJA 1O8CA 4MHOA 2Y3IA 2XCLA 2H27A 4EATA 3FPGA 1EFCA 1G41A 1NXPA 1L3IA 1QYCA 2NVTJ 2OCIA 3PHGA 1ZM7A 5B3JA 4GICA 2JFFA 4IILA 1KH3A 3SMVA 3GLUA 3ZQFA 3OQHA 1KDVA 5JYDA 3LLMA 4XDZA 2CWEA 1R00A 1N8NA 1EWKA 3A7EA 1LZLA 2POCA 3ELBA 2J7PD 1PP4A 1CY8A 2FI1A 1UJ2A 2MYSA 3L77A 2CKDA 2XT9A 4YQFA 1NF2A 1C9MA 1OH8A 1ORKA 1LBTA 2OM6A 3EETA 3FFXA 4BATA 4CPDA 4TYMA 5JVDB 2D3WA 3JASB 3SX4A 5K6AA 3VOBA 1U4NA 2XX3A 4IOMA 1KI1A 1IAQA 5EKXA 3BORA 5AVJA 1B9NA 2IODA 4FE3A 2XECA 2J0VA 5KTOA 1TVEA 1WBDA 3DLHA 3EFOA 4GYIA 4XWGA 2HA2A 3FTEA 2PL5A 2QMYA 2M1BA 2JBHA 3F6YA 3GJRA 4IVNA 1T33A 2CD9A 3P4UA 1O97D 4MRVA 5AJHA 2PEZA 5EJFA 3D3QA 1Z83A 621PA 2W8ZA 3SN6A 5FFNA 3NANA 4NY1A 2O14A 3SLRA 2OYRA 1XA0A 3RKUA 4GYGA 4I7HA 1Z17A 1P29A 2Y2VA 3DEAA 1WSDA 3O8LA 4OI1A 4IF6A 4WWHA 1O58A 5CEFA 3SHOA 6CHYA 4MQVA 1L3CA 1M1YE 5K4GA 3EA0A 3N2LA 1XZCA 5T5QA 4R2WA 1NKSA 2WDZA 1T4MA 5IC5A 2E5LB 3D3WB 3BG6A 2CFXA 1GUBA 1GVJA 2VPZA 3D6FA 1DCFA 2VWGA 1ND6A 1PD0A 3F3XA 4HDUA 1E2DA 4FD3A 5I3ZA 4QBIA 4P5DA 3N0WA 5HIIA 4BDYA 2QTHA 4ARUA 4L6CA 3KZCA 4ID3A 1XRLA 3IXMA 4YMHA 4XLLA 1VSBA 1Y3AA 2ZVPX 5I9BA 4X65B 2XBUA 2KRCA 4AWBA 4PFQA 2PQ2A 3PX2A 2QX9A 4QYXA 4B7UA 2Q0XA 4Z4FA 2MC3A 3SJCA 3QM1A 3ZKWA 1LPBB 4GU5A 5FHRA 1NATA 1F20A 3N2IA 1G1MA 4V38A 4HDVA 2VYQA 3HDJA 1E2JA 4N0DA 5FI1B 4CQLB 5I7WA 3D6AA 3FMFA 4NH4A 3HZJA 1FOXA 2GTIA 3EVZA 3TW8B 3MN1A 5A1JA 1PVDA 4L5YA 2NS0A 1D2EA 2WE8A 4CHGA 2ATEA 2DHQA 3DFMA 3J81k 4N9IA 3A04A 4UTNA 3HUGB 1X77A 1VRWA 5M04A 2D1VA 1MDFA 4TZKA 1JXSA 4QXOA 4LHZA 2CB0A 3K1NA 5SYNA 1EGQA 5M5YJ 1Q15A 4EHDA 4CQJA 5BYKA 2QLLA 2VT6A 3CBGA 2P9FA 4UHDA 2JLRA 4QO8A 1U99A 2JHFA 1XMQB 3JZMA 1FCJA 1PBNA 1T8UA 2VQ6A 3M1IA 3Q3GE 3I4NJ 2C3YA 3COZA 2IKQA 3E23A 3K15A 5ICEA 1JKXA 1ETYA 4E07A 3JW8A 2PJPA 1ZKDA 1VLVA 4KFRA 2ESNA 3CUQC 4I01A 1JVBA 3I0NA 1UJ6A 3OM0A 3NHLA 1G9SA 1Z9CA 3GRUA 2R5YA 2G9WA 4Q9LA 3L7LA 3DEEA 5DYGA 4BYMA 1N6IA 1JDUA 1RPAA 4KQCA 3TI7A 4NZZA 1KBQA 2ZTUA 3E4CA 3PE6A 2R8XA 1QRYA 3EARA 4FMCF 2H9YA 4FGUA 4MZDA 4OJKA 4UXJA 3ZIAD 3FMQA 2CJXA 4AW9A 5LP6F 2VTVA 5FTKA 2BZ0A 1K08A 1CQZA 1X0VA 3FCCA 1DC5A 1AHNA 3RPUA 1NTOA 3B9BA 3KKEA 2CYBA 1RI7A 3BR1A 2QSHX 2PX2A 2QM7A 1LDMA 2XAAA 3OSFA 3AUFA 2LMDA 3A7DA 4GXTA 4CCYB 3H17A 2NS7A 1E7QA 1A96A 4JYKA 1ZJ6A 2AV6A 4JYAB 1GKLA 5D8LB 3OL3A 1T5DX 3LZ6A 2K5UA 4DW8A 4RZ2A 4L0MA 1FL9A 3E9MA 3A26A 4IEJA 2XE8A 4N0PA 2FHPA 1A04A 3HL4A 2GZ3A 3PPIA 2WR8A 2VBIA 3E8XA 1XYYA 1G3WA 1E18A 2NT3A 3QGMA 4I5EA 4CCLA 2OHOA 4PICA 4CL0A 1B23P 1O6FA 4HDKA 3OU6A 1ZAYA 2VDUE 3LCJA 2XCUA 5CB4B 1EYZA 4PBRA 1QH9A 4JB2A 4DGSA 5B2FA 5JC8A 5HW0A 4GZ5A 3LL4A 3A25A 3G9QA 1DEAA 3RKYA 4FT8A 2VF2A 4JYCA 5E7QA 3BGDA 3MC1A 5G1PA 3UENA 3WOHA 1XDDA 3ZX5A 4B9EA 1JFTA 4MQFA 4EQ6B 1Q1VA 3VR5D 3I2HA 5CX4A 4L08A 4C4OA 1FSSA 1AKQA 2YOGA 3Q0VA 4ZOQI 4OQXA 3AY3A 4OAPA 4EKNB 1OZGA 1MH1A 3VPAA 1GAQA