3H5NA

Crystal structure of e. coli mccb + atp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
338
Chain Sequence
b'MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 109
structure length 338
sequence length 347
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5nA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5nA02
1SPXA 1NPTO 1ZSYA 1R0KA 2IXBA 5AVOA 2GDZA 3VZRA 2JL1A 1EK5A 1O6ZA 4FFOA 2VRBA 1ULSA 3WICA 2NADA 4D3FA 1K6XA 3OIDA 4FBGA 3KLPX 5EQFA 5JYEA 2OGUA 4ID9A 1E7RA 3HADA 3RU9A 3LLVA 2XPCA 1OZAA 3DFZA 3WBFA 2EV9A 1YJQA 2D4AA 1E0DA 2R00A 1Q0HA 2I67A 1PZGA 1WDLA 2UUOA 3RSHA 3D7LA 4IINA 1KVTA 5JAQA 3FTPA 3UCEA 4JJGA 4Y6PA 3VTFA 1KVUA 4RZIA 4YCAA 3TDKA 3CEAA 5IDXA 4IBOA 2Y05A 4J1NA 2G82A 1XU7A 4BS9A 4U7WA 1R12A 1B8PA 4J2OA 2CF5A 2EHDA 3H5RA 3E9NA 1ZEJA 3E82A 2WYUA 1ZO8A 5FF9A 1SOWA 4YDRA 3QA9A 4CQLA 1X7DA 3QWAA 4GBJA 4NI5A 4XGIA 4E0BA 3UN1A 2CY0A 3I1JA 4BNIA 2GF2A 1P1JA 5GMOA 5B4UA 5B12A 4CV0A 1IHXA 3ENKA 2B83A 5F3RA 4K6FA 4BVAA 4R5MA 3C1OA 5I8WA 1FK8A 5A06A 1EVYA 5B37A 4YB8A 5AQ1A 1I8TA 3ASUA 1JAYA 3DBVO 1DB3A 2D8AA 4M54A 3WMWA 4L8VA 2B5WA 4W6ZA 1N8KA 1QV6A 3ICPA 3N7UA 4O63O 1V3VA 4DLBA 4TKMA 1ZK1A 1B8UA 1E1MA 1J5PA 1QV7A 4RDHA 5LC1A 3K9QO 4GX5A 1O94A 3ROKA 3WYBA 1PIWA 4M1QA 4WLUA 4JN6B 4YJGB 4WPGA 3F4LA 3DOJA 4YAKA 5KNLA 3HDJA 4CM4B 4GSKA 2Y1CA 4E5NA 1NAIA 1FDWA 3SX2A 2DPHA 2BGKA 3D3WA 2NQ8A 3HDHA 4R1NA 5I7EA 4ALNA 1RJWA 2C82A 1N92A 2I3AA 2Y66A 5A9SB 4XJSA 2J3KA 3FNFA 1UZNA 4Y9DA 4DVJA 3OJEA 4PLCA 3TNLA 4HWKA 1RM0A 2PK3A 2CMDA 3EVTA 1DFIA 4PLPA 2WD7A 4TRMA 4D45A 1IYZA 4Q3BA 5ER6A 4GVXA 4K6CA 3EAGA 1W0CA 1DFGA 3JCZA 1GZ3A 2EJVA 4XQCA 1DAPA 2CVQA 4DBVO 3H5AA 3LF1A 1XLTA 3L6EA 5G0VA 1UZMA 5ADHA 1EMDA 1ZK3A 3HHPA 4KOAA 1KOLA 1UUFA 1HEUA 5T6BA 2BRUA 2P5YA 1T4BA 3OA0A 1QMGA 4MVJA 4UULA 2PA3A 4Q3CA 1ZW1A 1ARZA 3OMLA 3KSZO 4F6LA 2JAHA 3AM4A 4D3DA 4ZN6A 1GPDG 2P5UA 5HTOA 3D0OA 3BMNA 3GAFA 2HDHA 3C8MA 3QWBA 3ZWPA 5U1PA 1Y9EA 3UGKA 3RUIA 3IP3A 2QZ9A 2NU8A 4XCVA 1UAGA 5DOVA 3V2UA 2YYYA 3LT4A 5TT1A 4WUVA 2XF8A 3AI3A 1I5RA 1IB6A 4TRNA 4P8RA 5L51A 1MXHA 1E7QA 4BQRA 4CLRA 1GYRA 2PV7A 1YE3A 1E1LA 3KYCB 1LUAA 1NVMB 3ZWWA 3KYDA 4XQGA 1R4NB 2H63A 3JQ9C 1ISJA 4BKUA 4YAIA 4BO0A 1OFGA 1XEAA 3PQDA 5HS6A 3E5MA 3STHA 2DAPA 3LQFA 4CV2A 2VQ3A 1X1TA 1C1XB 4IJUA 4MVJD 1IOLA 1KEPA 1ZKMA 4IQ8A 4B3JA 2FZWA 4CMBA 4MVJF 2QW8A 1W8DA 4QEDA 2FY8A 3GC6A 2YHIB 1DRWA 3GR6A 1GYPA 5L4LA 1GEEA 2YUTA 1E5QA 3U4CA 2EKPA 4JROA 2ZQYA 3HUDA 4OYRA 4AJPA 2O48X 4ZQGA 1NFQA 1ZJZA 2X7HA 4GAEA 3OIGA 4E5MA 1FF9A 4G81A 5JDIC 3AU9A 4JCOA 1TT5B 3P2OA 4WJZA 5HBRA 4WNIA 1C0PA 2G76A 4ZRNA 1FDTA 3RASA 3RC9A 1VL6A 3DHEA 1VKNA 2ZTMA 5EL0A 3U49A 4TKLA 1WMBA 3K6JA 4CM3A 3DQPA 4CM7A 2FZEA 3G1UA 4CMCA 5J23A 3TJRA 1VJ0A 4FCCA 2FSSA 1JAXA 3CPSA 3VPFA 3KUXA 4I5EA 5T8KC 5L9AA 3DBHB 3G49A 4J2HA 1I10A 2DFVA 2QYSA 5LDGA 4NIMA 1BVUA 4BO5A 5IZCC 5U4QA 4WCFC 4AJKA 3ZW9A 4CMAA 4HV4A 1YQXA 5EERA 5JYDA 4NQZA 1KYQA 1P9LA 2CVOA 2HUNA 4DMMA 4QSMA 1QLHA 2A9FA 1RPNA 3WGZA 3AM3A 1E7WA 5HWSA 4DGSA 3GUYA 3DZFA 2EP5A 3VAZA 1UAYA 2DBRA 3VC7A 1LSJA 4BNKA 5AOVA 2GN6A 4CR6A 2AXQA 3H9EO 4D41A 3KEQA 4PVCA 3DAGA 4U0KA 5F21A 4EUHA 2B69A 2VZ9A 4K28A 3O4RA 4QECA 5A04A 4BO6A 1SBYA 3GVXA 3CUKA 2VWGA 4R68A 4YWJA 4J43A 4YAGA 3JYNA 3FWZA 1NAHA 3M1AA 5FYDA 4TSKA 1EEHA 4U5QA 4JXKA 2IEDA 4IY1A 2JAPA 3N58A 1R37A 5A03A 2PD4A 4BO4A 1UXJA 3T7CA 1OC4A 5JXWA 1RYEA 3DR3A 3RBVA 1EVJA 4OGWA 1S7CA 3PQEA 4U6QA 1TXGA 4FDAA 3IP1A 1ISGA 1TA4A 1R16A 2JFFA 3G0OA 3JQAB 1BG6A 2Y1OA 1VI2A 3JYOA 4OQYA 2GLXA 4WASA 3A1NA 3KBOA 2FR8A 3JQCA 1V3TA 1HDRA 1Y8QA 3DWFA 4Q3DA 1SC6A 5H83A 5JDIA 5G2OA 3GHYA 2BI8A 3RBZA 3G17A 3O26A 3LU1A 3GQVA 3GUCA 1C14A 4DQXA 2Q2VA 4J7CA 4A0SA 1PJBA 4J9UE 3ZI0A 9LDBA 4NBVA 3NTQA 4BGVA 4B4VA 1TLTA 2EKLA 1U3VA 1EUCA 4AJOA 2V7PA 1BXGB 1OMOA 3QWHA 4S1VA 1UDAA 5T8KA 1EZ4A 2WMDA 1AXEA 3OEWA 4OAQA 1DO8A 3TZHA 3ZN2A 4LVUA 1F0YA 4OSOA 4HX5A 4BO7A 4ALIA 1GCUA 1F8FA 1TEHA 4MIYA 3UUWA 4BMNA 5DBGA 2PZMA 1EQ2A 4Z0TA 5A05A 2HK8A 3I9JA 2UV8A 3I4FA 4J4TA 5TGDA 4B8WA 1Q7GA 1H9AA 4NFHA 4XYLA 3BMCB 3CINA 1GFSA 3CMMA 1G6KA 3DHNA 1QYVA 1D1TA 4I08A 5KJCA 1KVQA 4BMSA 1U2GA 4DIBA 3ZNQA 4BNGA 2B4TO 1LTHR 1EBFA 2RIRA 5TJHA 1LLUA 4EJ0A 1GDHA 3D64A 3UFXA 3WGGA 4J91A 5F1OA 2DM6A 3JD3A 3MJCA 4TROA 5ENDA 3WX0A 1CIVA 4QT0A 2HRBA 4U8GA 4BMVA 1G0NA 1Y7TA 3AOEA 3GFBA 2JCXA 3TFOA 1EK6A 3HB4X 1F14A 4J7XA 4E2YA 3PZBA 1ZMTA 2V65A 1QYDA 1CWUA 3FNGA 1E1KA 1CERA 2OO5A 4CR7A 2Q2WA 3JV7A 4D43A 1IY8A 3WGOA 1E1NA 3OA2A 3BIOA 1PQWA 1PQUA 3P19A 4XQ9A 4RPLA 3AU8A 3DBLA 1VPDA 4CQLB 1SEVA 3GNTA 3PDJA 2QG4A 3GFGA 3RCBA 4BGIA 4W9NC 5F1KA 3O9ZA 4M49A 1KVRA 3F1LA 3W4KA 3GGGA 5CPBA 4XDYA 1ZSNA 5JCXA 1P1HA 2W4QA 1Q7CA 3H4VA 4XIJA 2G5CA 2IXAA 4L74A 4AJNA 8LDHA 1VSUA 4BV9A 5JO0A 2Y1EA 3NYWA 2GN4A 4DQUA 3UVEA 2I76A 3I9NA 1XSEA 4EYEA 4BB5A 2AG8A 3L77A 1RYDA 1E7SA 2JHFA 4O1MA 5DP2A 3KV3O 5IN4A 2Y99A 1NVGA 1E3JA 3D3WB 4Y6SA 3VZSA 5JFOA 2C7VA 1ZUD1 5TSDA 2X22A 5BSFA 1DEHA 1R0SA 3LLSA 4KDFA 4WLOA 3QSGA 4UVEA 5CP8A 2NU9A 4DC0A 2OMEA 2W2LD 1QP8A 1VJTA 3GEMA 2TMDA 4LCJA 2VHVA 1WNTA 4UUPA 5JSFA 3ZWOA 4IQ0A 3FBGA 3QVWA 2CDCA 3OSUA 1YL6A 5F5NA 4BO3A 3W6UA 3O38A 3W8EA 2OOSA 3QQPA 1LSUA 4NH4A 2X9GA 3VPGA 2V6GA 1P44A 1MXFA 2D1YA 2YQ4A 3ZU4A 4QX6A 1LDGA 3NGXA 4FJ2A 3LVFO 4FR5A 4XYMA 4XZ3A 1A9YA 4FS3A 1HDXA 4GX1A 3RC2A 3U5TA 1I0ZA 3I52A 1Z45A 2GNAA 3RJ5A 1WDKA 1U5AA 2AQHA 5L3ZA 2AE1A 4M87A 1QYWA 4CV1A 5JMPA 4II2A 4RDIA 3B1JA 5K9ZA 3RROA 2PZLA 2AEFA 1PGOA 3NDIA 5BQFA 3RUEA 3PI7A 3BMNB 3AW9A 3E6AA 3WYCA 3VZQA 3UAGA 4ZD6A 3RKUA 2HAEA 5IZ4A 3WGHA 4AJ2A 1H6AA 2VUUA 1B0AA 2XXBA 4Z6KA 3F4BA 1BTOA 5TT0A 1YWGO 4E5PA 2ET6A 1PQPA 3PHJA 1NM5A 4W9NA 5TQVA 4CLRB 4RVFA 1M66A 3FTNA 3IKVA 1T1RA 3NTOA 3M2PA 4CMEA 4QO7A 3K92A 3MEQA 4R41A 1B3RA 3Q3CA 3C7CB 3UHAA 2ZCVA 1I3LA 1GPJA 4J7UA 4WLNA 3VTZA 1MGOA 1GQYA 4OHUA 4P4LA 1V3UA 1ADBA 1HYEA 5CPFA 2A94A 4RV9A 3ZWCA 4PG8A 4OH1A 1JA9A 1DXYA 4E13A 4DYDA 2E82A 1HXHA 1KEWA 2I6TA 4YT5A 1CQJA 4HFRA 1XKQA 2PKQO 3TQHA 5BSGA 4R1SA 3JQ8A 3LC1O 1LQTA 2BFPA 1T2CA 3DOOA 1H93A 4I8XA 4KDEA 4OKNA 1U3UA 5CDSA 2D5CA 3IJRA 1NXQA 2FSVA 4B3IA 3L6OO 3OF2A 3SJ7A 1E6WA 2D2IA 2RH4A 2GCGA 5IN5A 4CLOA 1SMKA 1QYXA 1YO6A 2DUUA 5FI3A 2JD0A 4GMFA 4EUEA 3C1TA 1PR9A 3TZQA 4FJ1A 4CL3A 4CMGA 4LMRA 5ES3A 1LI4A 3JQ7B 4H16A 4PN3A 3L6DA 1DBVO 2OZPA 1PJ2A 1GR0A 3ETEA 2VT3A 4AVYA 5U9CA 3WWYA 2ZB7A 3B20A 1CF2O 4G65A 4PVDA 1GL3A 4LSMA 2RHRA 3ITKA 2Q4EA 1QG6A 2I99A 4DUPA 3VKUA 4HADA 1K3TA 1PJQA 1E3WA 3DBRA 4FC7A 5AXAA 1WZIA 1D8AA 2VWHA 4MVJM 1V6AA 2WSBA 3QHAA 4PLGA 2FR1A 4ZQBA 2VNSA 4BOYA 4KTTE 3SBOA 1M67A 4FOOA 4IS2A 1HE5A 2IRWA 2AQ8A 3BMQB 3KRTA 4X54A 4AJ4A 1BW9A 3NJ8A 5I8ZA 2AE2A 1H0KA 4A7PA 2IEBA 2C29D 2GYYA 3RQSA 4J49A 3JD0A 1W6UA 1A7AA 1BHSA 3D3EA 3L0DA 4RORA 4A5OA 3I4CA 4BNZA 2J3JA 1BWSA 1P0CA 3DHYA 3PJGA 4RZHA 1T26A 5B4TA 4LK3A 2VHZA 3RBXA 1C0LA 1WMAA 4BL5A 1LSOA 1NQAO 2Z5LA 3NKLA 4MKRA 2RAFA 4ZRMA 1I3KA 2X1HA 4FFNA 4AICA 5EESA 4KWHA 2LDBA 3I5MA 5F5LA 4KUGA 3P2YA 3PXXA 2GERA 5G0TA 3ZWAA 1XCBA 2IYPA 3PFFA 3NAQA 4L4RA 3VHRA 2IZ0A 3GPIA 1R4MA 1NWHA 4XB1A 1NBOA 4I9HA 2CSUA 1PGJA 2DTEA 3RWBA 3GZ4A 3Q11A 3T4EA 2YFHA 3KTDA 1Y8QB 4F45A 4B7UA 3WDSA 4WOKA 6ADHA 1O8CA 1HRDA 1Z7BA 2VWQA 2GRAA 3ONEA 3F5SA 4E4YA 3ST7A 1ISFA 4FB5A 2VHYA 4E2XA 3PYLA 5JCJA 5I9MA 2X0JA 1J49A 2NLOA 2EERA 2EGGA 2YY7A 3AY3A 2YV1A 5KJEA 4GLOA 1NP3A 1SEPA 4J4BA 4E3ZA 3JSAA 4BNFA 3WWZA 5L4NA 1B2LA 2Z95A 3H9UA 4ZA2A 5JLAA 3ASVA 3HQ4O 2C20A 1RWBA 4NU5A 3RVDA 4WCFB 1E77A 2QIOA 4I9NA 3PDUA 4XA8A 1FMCA 1H6CA 3AWDA 2FMUA 4D0RA 1PS9A 2B35A 2UDPA 1PJLA 3ZU3A 4AG3A 1HSOA 1XQ1A 2HO5A 2BKAA 2E4AA 3V1YA 5I7FA 4TVBA 2V6BA 2YJZA 3ZW8A 3DC2A 3KEOA 1GCOA 3L4BA 2BF7A 4Z0HO 4JP2A 3LF2A 1VE9A 1U8XX 3HB5X 2ZATA 1KEVA 4FQ8A 1BMDA 3VPHA 4W99A 3D4PA 2NWQA 3NTRA 3MJTA 3S1LA 1WVGA 4ILKA 2E48A 1HLPA 4WE3A 1SNYA 2IDZA 4R16A 1QYCA 2QQ5A 1PWXA 3HN7A 2Q1TA 3H8VA 4YVFA 4AFNA 1PR3A 4LW8A 3F5QA 1A72A 1DHRA 2IZZA 3INRA 4N7RA 4J3FA 4BKRA 3MTJA 4RPJA 3FCOA 3BZUA 3DAPA 3R3SA 1CEQA 5C5IA 3B6ZA 4YT2A 4DYVA 4KQXA 1O95A 4F3YA 3GRPA 4CLEA 2PY6A 3WQQA 5T5QA 3CE6A 3BA1A 1WZEA 4B4OA 4HBGA 5IDYA 4DLAA 2E49A 1M76A 4PLTA 4DTIA 3ULKA 5FI5A 5L95A 1W4ZA 1P1KA 2I66A 3FWNA 4J1SA 1GUYA 4YRAA 1KC1A 4P22A 1LA2A 2CDBA 1X14A 4ZU3A 1U3TA 3ORFA 4Z9XA 4IQGA 1MP0A 4Z3KA 1NYTA 4GSLA 3ZWXA 3INGA 5BNIA 4BO9A 4ZICA 2IYOA 3C24A 2X0NA 1GUFA 3IL2A 5ICMA 2H5LA 4JP3A 4BO1A 3H5NA 5KVSA 5EMHA 1HLDA 1UH5A 3O8QB 3DZJA 2EF1A 4DRYA 4MP3A 4RF3A 4CV3A 1PS8A 1WWKA 3BMOA 5GZ6A 4UVGA 4CLHA 5KVCA 1O9BA 4YBZA 4HFNA 4CPDA 1A27A 1HKUA 4R01A 3BYZA 3D5TA 2C2YA 1SCUA 4WK6A 3Q9UA 4ZJUA 1ENYA 3EZLA 1HZJA 4FJ0A 2JKVA 4IM7A 4A26A 1IL0A 1HE4A 3NUGA 4XYBA 5JE8A 3HSKA 3W4IA 4HKTA 1F17A 2WWRA 3F9IA 1P1FA 3JQ6A 4YT4A 3EGOA 2JD1A 1C3VA 4WEOA 2AG5A 3TOZA 3V5NA 1OI7A 1X0XA 3I6QA 1X0VA 2XOXA 5K6AA 2O3SA 3ETGA 3SC6A 3ZZNA 1GYQA 1M6WA 5L7TA 4C7KA 2PGJA 1Y81A 1H2HA 2Q45A 4L73A 3RUFA 4AL4A 1HYGA 4BNLA 3U4IA 4AJLA 1YB1A 3C3XA 4EBFA 3HG7A 2C7GA 1BRMA 1WDMA 1IZ9A 1BSVA 4E6PA 3RAJA 2ZB4A 3QLJA 1PU2A 1K2WA 3IAHA 2C54A 4ALLA 2AQKA 1LDNA 2X6TA 1U28A 1YGYA 2JFHA 4WOJA 1PL8A 4XGNA 1QR6A 2GGSA 3JYPA 4NFYA 4DXHA 3PHGA 5TS3A 1DPGA 2Y0CA 2GZ1A 4IIVA 4QO8A 3S2FA 2Q1SA 4O59O 4BNWA 5G0WA 5I9LA 2AW5A 3GGOA 3LT2A 1E6UA 4CM5A 5L40A 2E6UX 4R1UA 4FN4A 2RH8A 3OHSX 5ICSA 3ZHZA 1YDEA 1TVEA 2QZZA 3NJ4A 3QVXA 4CMKA 2WE8A 3F47A 3OJLA 4JBIA 4LN1A 1ZJYA 1YBAA 1GUZA 5GZ3A 4ZGWA 3B1KA 1FXSA 2Q1WA 3VPXA 4A27A 1IZ0A 3I3OA 4CR8A 4EDFA 4I5FA 1CDOA 1YB5A 1N1EA 3VZPA 1E3EA 1RM4A 2GN9A 4NK5A 1ID1A 2NACA 1VJ1A 3R6DA 4C4OA 3JQGA 3JQ8B 1LRLA 3AFNA 4FFPA 2FP4A 4FOSA 4JNKA 2NUAA 3VKVA 1BGVA 2QYTA 1ZBQA 5JDCA 2P91A 2ZB3A 4HY3A 4IXTA 1PWZA 1NNUA 1M75A 1MX3A 3NT4A 3L9XA 1PGNA 2X86A 3ROPA 4CLOB 4E2WA 4XYEA 4JJIA 2Q49A 1GQQA 4QQRA 3EUWA 3TZKA 4CM9A 4URFA 3H9GA 3O03A 4N5NA 5G0UA 3TF5A 1PGPA 5CDGA 5TC4A 5DBFA 4XB2A 1YQGA 2DFDA 3PJDA 4RLSA 4BKOA 4FW8A 2ZTLA 5ILGA 2Q46A 1KS9A 2GO1A 1EFKA 4K1LA 5DCWA 3ZNPA 2GASA 5BT9A 4EJMA 3OQ6A 1DSSG 1PTJA 1T25A 1N1GA 3CKYA 4OXNA 4XQEA 2HLPA 3AOEC 3JD4A 1E3WB 4NZ9A 1EDZA 5EINA 2FPPA 2ILTA 4E21A 5TNXA 3GZNA 1YVEI 2W2KB 4R3WA 4OXYA 1NTOA 3ZHYA 5CEFA 1A7KA 1T24A 3JYQA 1PJ4A 2UAGA 4F6CA 1A9ZA 1UJMA 1DIBA 2C0CA 4CUZA 3EC7A 4J1TA 1MUUA 4CMIA 1KVSA 1BW9B 4CM9D 3V8BA 4YRDA 2A4KA 2DLDA 3WTBA 3WG9A 5TRTA 5JO9A 4CMJA 4D7AA 4GH5A 1A4IA 2NNLD 4MVJE 1P45A 1O0SA 3AI1A 3GHHA 3OQ1A 2X5OA 4EW6A 4Q3EA 3MJVA 2DPGA 1XU9A 3WTCA 3X2EA 4YRBA 3FRJA 1ZK2A 1ZXBA 1ISHA 2I5PO 1AN9A 5FFFA 1JN0A 3NV9A 4IDFA 3JYLA 1N5DA 3C7AA 3DXFA 1C0KA 3ONDA 3R0IA 1C1DA 1Y8RA 2D3TA 4AJIA 3IOYA 1DC6A 4GWGA 4B4UA 2D0IA 2VUTA 3OH8A 3RC1A 2A35A 3ICCA 4GL4A 3WSWA 1YXMA 4IMRA 3PZRA 2Y0DA 1Y5MA 4UEJA 4W4TA 4YT8A 3COSA 3GLQA 5JBIA 4M8SA 3QRWA 4DIFA 1U8FO 3SJUA 4J16A 1YBMA 1NQTA 4ZQEA 2WTBA 3IIEA 5TIIA 2O3JA 3PEFA 3ZWYA 3JD1A 1QORA 2O4CA 3DDNA 4CODB 2HU2A 1GD1O 4I5GA 2EEZA 4OMUA 4D0SA 4H7PA 4XD2A 2EXXA 3JQBA 4UREA 4R54A 2I3GA 3OJ0A 1E6EA 1AGNA 5EIOA 5G0SA 2J5RA 1E5LA 1U2DA 4TZTA 4A03A 1IE3A 1NFRA 1ONNA 1RM3A 3QVTA 4RGBA 1I3NA 1EBUA 3CZRA 1CJCA 1PEDA 1ADFA 2BGMA 3PQFA 2OL4A 5JAZA 2I9PA 3ZNOA 1L7DA 2P9EA 3WFIA 3Q2IA 1Z7EA 4MINA 3WGYA 4CLDA 1HE3A 2HMSA 5JAIA 2WYWA 3JQEA 1PJSA 3DL2A 4D46A 2BELA 2QHXA 4BNNA 1E92A 4ESOA 2CFCA 4M55A 4BQPA 3WXBA 1FDUA 1YS4A 4WGGA 5CG1A 4Z3DA 4CMEC 3WFJA 3F6YA 2A92A 2AQIA 1P1RA 4IGFA 2G0TA 3BTSA 4E5YA 1GV0A 4XEHA 1ZMOA 4PLYA 4ALMA 4MVJH 1D1SA 1HWYA 1LC0A 2OBYA 4L76A 4FC6A 2X23A 1H9BA 3D4OA 4XJTA 4GGPA 1MC5A 2Z1MA 3UXYA 1PZFA 3U4HA 4RL6A 3C7DB 5TJ9A 1NPDA 2X9VA 4LISA 1CQIA 4MJLA 4BNVA 2VWPA 5JC1A 5KJFA 1P0FA 2EJWA 1ML3A 2VOEA 1X7HA 4QFCA 5DN9A 4R4JA 3MOGA 4YJHA 3WBBA 3OETA 4A10A 4Z0PA 3M2TA 3LK7A 4DMLA 4G2NA 3PJFA 3GN2A 3TPCA 4F46A 1NWCA 4GWKA 4DREA 1F12A 2BH9A 3W6ZA 1ADGA 1JKFA 4CM8A 2WD7B 2NM0A 2VZ0A 1LLDA 3I9OA 3ITDA 4INAA 3VDRA 4MVJI 4EI2A 3H2SA 2VCYA 3PK0A 4RVHA 4NNJA 2TMGA 2OFPA 4KP7A 1DLIA 3IUPA 2Q2QA 3BTOA 1IULA 2NSDA 3K2EA 1BDBA 4PZEA 4I9UA 1DIRA 3ZU2A 2HMVA 1NFFA 1ZFNA 2NVWA 3AM5A 1HETA 3U9LA 3FI9A 3WJ7A 5CEJA 2YV3A 3NT2A 4Q39A 1VSVA 3HJAA 1QXSA 2X5JO 4ND4A 4UAGA 3WSVA 5A9TA 3TN7A 3ETDA 1UP7A 3WS7A 2OHXA 5T57A 1G1AA 2DU8A 2H1SA 1NR1A 4J4HA 4E33A 4YXFA 6LDHA 4LMPA 5IXSA 5JW6A 4NPCA 5JY1A 3L9WA 3Q0EA 4FGWA 2GN8A 4R69A 4MVJP 3I9LA 3HZZA 4IDGA 4NR0A 4UUOA 3VH3A 1Z74A 4KZPA 1UXHA 4K9DA 2BFOA 3FR7A 4Q3AA 4WCDA 2ZKLA 3GRKA 3MZ0A 1WLYA 3LZ6A 5IG2A 3A28A 7MDHA 3H3FA 1NQOA 1BVRA 2OBNA 2ZYAA 3KYCA 4HFMA 5BNFA 4A73A 5MGBA 1I2ZA 3K96A 5COBA 3KYDB 3ZWVA 3AK4A 5G4LA 2GZ3A 1PL6A 2YDXA 3MWEB 3GDGA 5KOIA 2ZB8A 2RBEA 2Y1DA 3WLFA 4IJKA 3WQRA 4IJVA 1KY4A 3PRJA 2RHCA 3FD8A 1R6DA 5EN4A 1L7EA 2PGLA 3M1LA 3IUSA 2VHXA 1E3LA 2NU7A 3F3SA 5L53A 5EQDA 1R66A 1N9GA 5CHEA 4P38A 2H9IA 1DDOA 3K2BA 4P4NA 4BNMA 5THKA 1HZZA 4MKZA 4DA9A 4KWIA 3E18A 3N74A 4CQMA 4YACA 4B3HA 3RIHA 1TT5A 4Z9YA 2HK9A 3OQBA 4E31A 4GI2A 5KIAA 2QRKA 1GU7A 5LDHA 5C37A 2J3IA 1LLQA 5KCZA 3BHJA 4TMFA 3VOSA 3H3JA 1DRVA 3LDHA 4WKGA 3GDOA 2B5VA 5A4DA 3FNHA 4PRKA 4UVHA 3EDMA 1OC2A 3VH2A 3HDQA 1P74A 2PH3A 3EVNA 5T67A 1DIHA 4B7XA 4DIOA 1DC3A 1GTMA 3JQGB 2P9CA 4W7IA 1T2EA 3TFQA 1GEGA 2CDAA 2C07A 1R15A 5L7WA 4Y8VA 3ZWNA 1EUZA 3NGLA 3PIIA 4IDCA 4R5HA 4ND5A 4JBHA 3ZHXA 3FBTA 2YFQA 1JWBB 4C7JA 5HRUA 1I30A 3I6IA 3AUSA 3IQDB 2ZTVA 4CLXA 3OFSA 2JFGA 1N2SA 3T4XA 4DLLA 3W8FA 3GNQA 3E9MA 1Z6ZA 2POQX 4CQMD 3L4BC 3QY9A 4YYZA 2J3HA 3BHMA 1A4UA 2B0JA 1D7OA 2NQTA 3ENNA 1HYHA 3PWKA 3R1IA 4XR4A 2XXJA 3RUHA 3QW2A 5LCXA 3K30A 4FFMA 3H9JA 5DZSA 3PYXA 1GAEO 2NVBA 4R51A 4EITA 3AUAA 1ZH8A 2CNBA 3NT5A 4OO3A 3RI3A 4M89A 2G17A 1MFPA 2EKQA 5AYVA 4LSWA 4E30A 1BXZA 5DP1A 4II3A 3GG2A 2HJRA 4YQZA 3GZNB 2J5QA 5H82A 4RQTA 1WP4A 3ZHBA 4NG5A 4GX2A 1BDMA 1S6YA 3T7EA 3PHHA 3ADPA 3WR5A 1QRRA 1BXKA 2EP7A 1Y6JA 4JLWA 4D44A 3FPLA 3TZCA 1HF3A 3IMFA 3GEDA 3GG9A 1UXKA 3HFSA 5F1PA 3RUAA 4CMIB 3WQSB 2W8ZA 5KJ1A 2O2YA 3QWFA 4W82A 3OP4A 1P33A 3UCXA 1B26A 5TLSA 2GR9A 1JWAB 1MFZA 2JHGA 4O0LA 1YBVA 3ZH2A 3C1AA 1J6UA 1ENOA 4RQUA 3NDJA 4NBUA 5JMWA 4XGKA 3GMSA 1LSSA 2ZJ1A 1ENPA 5G4KA 1LEHA 1YDWA 3HE3A 3GA0A 5A1TA 2FPIA 3W8DA 1DLJA 4IDBA 4BNUA 3FNEA 4WNCA 4JQCA 1B7GO 2X5KO 4UVDA 3G3EA 4WLVA 2X58A 2ZYGA 5HS4A 3CH6A 3KETA 5DBIA 1BXGA 4XYGA 4ZHSA 1M6HA 3AUTA 2HQ1A 3D4NA 4QUKA 4Z9FA 3BAZA 1J4AA 2HCTA 1UXGA 1C1DB 3KZVA 1FDVA 1HL3A 3U62A 1I3MA 3CSDA 1P1IA 2Y67A 4RF4A 1HDYA 2C59A 4PG6A 1SO8A 4HXYA 3OEYA 3E1KA 3LC7O 3RFTA 2C5EA 1A71A 2PR2A 5ER9A 1LQUA 3EY4A 3VH1A 2HK7A 3B1FA 1TI7A 2VYNA 3KLMX 3WOHA 1KC3A 3ZU5A 3OBBA 2DC1A 2BGLA 3A14A 4GQAA 4J9VA 3RJ9A 1B16A 2O2SA 5K6AC 3I83A 1LX6A 3IC5A 3VDQA 5JCJD 5I9NA 3IKTA 4YTEA 1UZLA 3NDRA 4DPMA 3ZWMA 3U0BA 4MO2A 1VC2A 1WW8A 5IDWA 2PZJA 2O50A 3M6IA 3EYWA 4DBZA 1LDYA 1X1EA 4L0QA 4YQYA 1WXDA 3S2IA 4CUKA 3KYBA 4UEKA 4I1IA 3WIDA 5CDYA 1K0UA 1U4OA 4BGEA 1U7TA 1PZHA 5CDTA 1LDEA 1YKFA 3ONFA 1SOVA 3S2GA 1JW9B 4JIGA 5GZ1A 2PWZA 2NTVA 4CM1A 4GMGA 4R1TA 2R6JA 3ZCXA 4QXMA 4AJ1A 3MJ4A 3DBLB 5JS6A 1VLLA 2VYND 3V1UA 5CG2A 2P2SA 4J0FA 4YJFA 4PLZA 2B4QA 1UP6A 2D5AA 3SLGA 2NTJA 3MTGA 4NJOA 3PWSA 3PHIA 4B79A 1Y9AA 3AI2A 4G5HA 1QKIA 1P3DA 3E48A 3TOXA 1E3IA 1H6BA 2WYVA 4KQWA 4RVUA 1PJ3A 5C7LO 1K6IA 1SB9A 4N18A 5AXDA 2AHRA 2NTNA 3FN4A 5ITVA 4GLLA 1OBFO 1H6DA 2ZTUA 2O23A 1PL7A 2PGDA 1SAYA 3L07A 5C3MA 5ENVA 1E7YA 1U9JA 1YOVA 1T2AA 4H15A 1ZIDA 2Y1GA 3KVOA 3GVIA 1UP4A 4AJHA 4UVIA 4YJHB 3K5PA 5COQA 4E12A 4LCEA 2VYVA 2BHLA 2WE7A 1GY8A 2YV2A 3BXXA 4RVDA 3ANLA 5JC8A 3WGIA 5JDCC 4BNJA 1AHHA 5L45A 2Y0EA 2P68A 4GX0A 3CMCO 2PKQP 3I23A 1ADCA 4IMPA 1LDMA 4R9SA 4CM8B 2P9GA 2FRDA 3P7MA 3H9QA 3DMYA 3ZDFA 2HKIA 3GVPA 3KSUA 4YEDA 3DTYA 1KEUA 3P5SA 1KY5A 3DZIA 1P31A 4NU6A 1I2BA 1V9LA 5MDHA 1H94A 3S8MA 1QLJA 1ISIA 1V8BA 2I65A 4J90A 4NBTA 5IJZA 1YL7A 5A02A 1T2FA 2O3TA 2E37A 2PKRA 3ROQA 2F1KA 1TT7A 4Q9NA 3UOGA 4KTVE 4IZHA 5L7YA 2C5AA 1XA0A 3DMTC 1AE1A 2FOIA 3U09A 3E5RA 4NJMA 1DC4A 2VYVD 1E7MA 1LU9A 1NHGA 1N7GA 4EGFA 3CIFA 4ONEA 1AUPA 1C0IA 1YJ8A 4UUMA 1V35A 4PG4A 2JJYA 5A9RA 4FPXA 3GVHA 1H2BA 1YONA 1YH3A 4JJFA 1T1SA 2HSDA 2QX7A 4RJTA 4PLFA 3ON5A 1U4SA 2CD9A 4MP8A 4BKQA 3GEGA 4TZKA 2HMWA 2VHWA 2VN8A 1WPQA 3HFGA 4ND3A 3Q6IA 1DIGA 1Z75A 1I01A 1ZEMA 3CXRA 3WGQA 4IJWA 2BD0A 2H6EA 2UVDA 3K73O 3KB6A 4E32A 3RFVA 4TVOA 4YPOA 2Q1UA 5DF1A 4HP8A 2DBVO 2EIHA 4KUEA 5JY6A 1XELA 1LXCA 3PPIA 5THQA 4BO8A 3LC2O 3PYMA 4BUCA 1B15A 2V6MA 4RO0A 2X0IA 3OM9A 1W73A 3SXPA 4WLFA 1PGQA 4D79A 5HA5A 1N9GB 4E5KA 4BGUA 4M86A 2X4GA 4P4GA 3TL2A 2DTDA 4ALKA 5JAMA 2EG9A 5IXYA 3ROMA 4CQMB 4E2ZA 1O5IA 1HTBA 3TL3A 1PZEA 2JD2A 2G1UA 2Q4BA 4D3SA 5BR7A 5DT9A 4DQVA 5IAAA 2DTXA 1LNQA 3HDYA 1VKOA 4N5MA 1FJHA 3WJAA 1B14A 3PFWO 5A3JA 1RM5A 4H3VA 3A4VA 1B8VA 4FSHA 3PGXA 4EUFA 2VUSA 3GK3A 3GNSA 3JQ7A 3NX4A 4XX0A 3JQFC 4MVJG 1JTVA 1NR7A 1ZVMA 3LYLA 3GGPA 5DDIP 2DQ4A 1JU9A 3CZMA 2Z1NA 1LDBA 4FGSA 3JQBC 4D42A 3UCFA 1F8GA 1YL5A 4ITUA 1JDJA 1ZZEA 2BFAA 2J5KA 5I7VA 1PJCA 3GVCA 3IS3A 3RUCA 1DHTA 2UYYA 3B70A 1VL0A 2CUKA 1U5CA 2ZIZA 3QWIA 2HMTA 4B8ZA 4BNYA 5C7IO 3DB2A 1XHLA 4RF2A 3V1TC 5K0ZA 3DBRB 2W98A 1XQ6A 3DMTA 1EE2A 3OECA 4LRSB 4N5LA 1P77A 1UXIA 3U4DA 1IPFA 4RPKA 4RVSA 3E9QA 2FHSA 3C85A 3BMQA 1DC5A 2EW2A 2Y93A 2O3QA 3SVTA 2YQ5A 3GOHA 1MLDA 4BHTA 1PJTA 3HNPA 4CL8A 1U7HA 2O3RA 4WEQA 2DUWA 3KHUA 3MOIA 1KIFA 3S55A 4XDZA 4YAJA 1ISMA 3RUDA 1NHWA 3LSYA 5DCUA 4HNGA 3S2EA 2EW8A 1Q2XA 2PTGA 3H7AA 3JQ9A 2NVUA 3QVOA 3GMDA 4MIEA 5DULA 4TQGA 2Y1FA 2VZ8A 2R2GA 1ZNQO 5B4VA 3FSRA 3SEFA 4IIUA 1N7HA 2W90A 4IGEA 5FEUA 3W4JA 3DZHA 3VPSA 4TWRA 1ZSVA 8ADHA 4BNTA 1U3WA 3EK2A 1DAOA 3DEYX 3W1VA 1DOHA 2J6IA 1R4MB 3MCVA 1GZ4A 4RCVA 5DCYA 2JCYA 4L75A 5FWNA 1DJNA 3DAFA 4OKIA 3E8XA 3GPDG 3G1TA 3MWDB 1WAMA 4IPTA 1ENZA 4NHEA 2NU6A 4Y6RA 5G4KB 3PWZA 2OP0A 4BO2A 1JKIA 4DPLA 5BSEA 5C7OO 2FR0A 2C2XA 3EHEA 1PSDA 3QV1A 1JLLA 3ANNA 4WECA 4B4WA 3QVSA 1E3SA 3ZV5A 3V2HA 3GAZA 3LT0A 1MG5A 4IXWA 1UDCA 4FFLA 3BHIA 4FIZA 4FFRA 2HJSA 3JQFA 1X7GA 4W7HA 2CVZA 3PLNA 2PZKA 3EMKA 4MKXA 4PLHA 4RVGA 4GKVA 4DL9A 4HFJA 2UUPA 4ZQHA 1AXGA 4LGVA 5IZCA 1IUKA 1YQDA 2IZ1A 1TB4A 4R9RA 4WCFA 2OXIA 2DVMA 3RD5A 1OAAA 3WMXA 5JNLA 4IUYA 3K8ZA 4NDNE 3PHLA 1Q7BA 2IE0A 3H2ZA 1LC3A 1Z82A 4PGFA 1VRWA 2X8LA 5BNTA 4LRTB 2BI7A 1ZK0A 4WLEA 5IFLA 2Q3EA 3KSDO 1JQBA 4J1QA 2ZK7A 4I5DA 1EFLA 5KJ6A 1T2DA 5CDUA 3A9WA 4XRRA 3ZV6A 3D1LA 2ZCUA 2PD6A 1F06A 5B1YA 3PVZA 4UEOA 3BTVA 5A5EA 3V2GA 1HDGO 1PS0A 1U1IA 1I32A 2YZ7A 3FPCA 3QP9A 1G0OA 4CJXA 1YB4A 4OXKA 5AXCA 1EDOA 4BB6A 3GT0A 2VTDA 1Q0LA 1VM6A 2V6FA 4ALJA 1FDSA 1EVIA 1LJ8A 2Q50A 1GZ6A 3AY6A 1B3BA 2O7SA 1ORRA 2OORA 3MJSA 3I9KA 2DBZA 3WIEA 3EW7A 3H65A 3Q2KA 4L4XA 4ZVVA 5COAA 1I33A 3RU7A 4YR9A 2DT5A 4YJDA 3PGJA 2PLAA 3BTUA 5EJ2A 2X9NA 4CUJA 4EZBA 2O3UA 4YJGA 4CM4A 3QIVA 3CTMA 3OJFA 2W2LA 4JX8A 4YJFB 3DOCA 1OOEA 2EGHA 4IZIA 5ILOA 2CF6A 1UDBA 3R3JA 5EPOA 1ZCJA 4RPHA 1NPYA 2AMFA 4GGOA 2HRZA 4IDDA 4OM8A 3GY0A 4OQZA 4Y98A 5KVQA 3VVBA 2FPGA 5A9SA 4PG7A 1M2WA 1NQ5A 2YDYA 1YRLA 3JQDA 5CEEA 1KERA 2AEMA 4OL9A 2CZCA 4MP6A 1IHYA 5TF4A 1MC4A 1LRKA 1PX0A 9LDTA 2F00A 2OP1A 1V0JA 2GSDA 2YHUA 3O8QA 1VL8A 3I9MA 4MIOA 3SLKA 3F46A 5H81A 1YOVB 4FD3A 1HDOA 4YAEA 2PD3A 3BMOB 2VOJA 3WLEA 4OOEA 1MB4A 4QFDA 4R3NA 2B36A 1RKXA 4MDHA 3WNVA 3KXDA 1NVTA 3DZKA 4PFJA 5HM8A 4NFSA 2YW9A 4JK3A 5BSHA 1LRJA 2B4RO 4GPD1 4PG5A 4EEXA 1K6JA 1MA0A 4XR9A 4TRRA 3FHLA 1GADO 2P4QA 5T64A 3UW3A 3TZ6A 4MOWA 2VTEA 4L4SA 3UICA 1R0LA 2P4HX 4J6FA 1HT0A 4J0EA 1ONPA 4PZDA 5CFZA 3UH1A 1XGKA 3PP8A 3MJEA 3DZBA 1X15A 1EE9A 1MG0A 4OOFA 3ZGYA 3D5QA 3Q9NA 4ND1A 3AY7A 1XWFA 3IJPA 3DONA 2NV6A 4N54A 4BNHA 3DFUA 4NJMB 1LBEA 1R4NA 2BFMA 3OICA 2WJPA 1Y1PA 1DJQA 1Q1NA 3INTA 2LDXA 3WGTA 4JGBA 4IDAA 1KBZA 4OIMA 2WM3A 3Q1LA 4EJ6A 7ADHA 1C1XA 4UUNA 1IPEA 3QE3A 1HE2A 1JVBA 1ZXLA 3A06A 1D4FA 3NRCA 3WNQA 4OJNA 5KKCA 2PH5A 4ROSA 4IS3A 2YHIA 1GQ2A 1UR5A 3QJ5A 2EWMA 2GPTA 1O89A 2PFGA 3DTTA 3FR8A 5CAEA 4L9RA 4ZQFA 2FWMX 1A5ZA 2X0RA 2IODA 2O7QA 3ZV4A 5IDQA 4Y67A 4MPDA 3WB9A 1I36A 5A5FA 1I2CA 1EQUA 3VH4A 1T4DA 4HUJA 2VRCA 3JD2A 4KMSA 2QRLA 3TRIA 1HDCA 3WYEA 4PLWA 4GVLA 4RF5A 1KETA 5KVVA 3E03A 3ANMA 2JCVA 3AFMA 1EUDA 3GDFA 3RKRA 3DBHA 2GUGA 1HSZA 4XKJA 1Z73A 3DZGA 4PLVA 4Q3NA 3UKOA 5IF3A 5I7SA 4DPKA 2OUIA 2VNAA 1LLCA 3SC4A 3G79A 3DO5A 4OSPA 1CETA 3JTMA 2BMAA 4RLHA 1JKJA 4DWVA 1SZJG 5ITWA 2SCUA 1DRUA 4YA6A 4BKPA 1EVZA 1ULUA 2HMUA 2Y68A 3ZV3A 2D59A 5JPIA 2WD8A 3PLRA 1GV1A 2XAAA 2ZQZA 3RFXA 3FF4A 3KO8A 5KWEA 4AJEA 4TRJA 3VVCA 2VRCD 4PIVA 4XIYA 4ND2A 2J8ZA 3PTZA 5KKAA 4IDEA 1NASA 1Q0QA 3NEPX 3PJEA 5AXBA 1XDWA 2B37A 1I24A 2GZ2A 2R00C 4DC1A 3GN1A 4KUHA 4PCVA 4NMHA 3H6KA 1XR3A 4U6SA 2W2KA 3LT1A 3GH3A 2ZYDA 4BIIA 3EZYA 3F1KA 3U3XA 3ZWBA 3ADOA 1X13A 4U0JA 4BV8A 2O4UX 2WDZA 4BNXA 4QTZA 5GY7A 3K31A 4GKBA 4EEZA 3IDSA 4AJJA 5KTKA 4PZCA 4XWYA 1K5HA 1Y5RA 2WEKA 5A3VA 1QSGA 3JQAA 4LVCA 1DIAA 4O5OA 2PNFA 2DBQA 3L4SO 3ABIA 3RC7A 3GF4A 1SB8A 1NX6A 1ZK4A 2BLLA 2VT2A 5TX7A 2NVUB 1CYDA 2AEJA 3AJRA 2QRJA 3PIDA 3AOGA 4A2CA 3OJOA 2FN7A 2RCYA 5L4SA 1L1FA 3KM0A 1XG5A 3UF0A 1AHIA 4NBRA 3ZNNA 1J0XO 1JVSA 2GD1O 1XYGA 1DFHA 4JBGA 1K89A 1HDZA 1D3AA 1CRWG 4CMHA 3OIFA 4PRLA 3KOUA 4S3MA 3HN2A 3X2FA 4NK4A 3TWOA 4K26A 2AA3A 4HNHA 1H5QA 4RPGA 4CM6A 4XRGA 1Y8RB 2ZJ0A 1MV8A 3HWRA 3TSCA 4B7CA 1XIVA 2DKNA 5DOZA 3JQAD 4O6VA 4NBWA 1ONOA 3AUUA 5DNAA 3BMCA 2Q99A
chains in the Genus database with same CATH superfamily
1IHDA 3K70B 3K6KA 4TTIA 4MB0A 4MUJA 4GMHA 2GH1A 2JL1A 3O84A 1X1BA 5F0CA 3QF7A 1X80A 5K0SA 3QYJA 3NBXX 3CH5A 5CHYA 1E0AA 5JAQA 2JLAA 3FYUC 4HVAA 2BYTA 1T9AA 3E9NA 3EZFA 3AF6A 1V37A 4F7WA 4M38A 4CQLA 5L3CA 1M1EB 4ESEA 3H17A 4XRFA 2WWGA 3RM3A 3HNRA 1BDJA 1EVYA 1JP7A 1JAYA 3CN7A 3NWJA 2XSDC 3NPAA 4XORA 4GCVA 1ZXXA 2B5WA 3WSTA 2QVXX 1QV6A 1V3VA 4DLBA 3A9SA 1M5RA 2XTAA 4F38A 3UJ8A 3WYBA 1KEEA 5JSHA 3ZHCA 2C97A 3RRJA 1FFAA 4PO1A 2MW8A 4C0WA 2WBMA 2YMQA 1IRGA 2WU8A 1OTXA 3IO3A 2PK3A 1YS2X 3RJMA 1JU4A 2GILA 3SK0A 1LVHA 4RLFA 4P58A 5DNUA 1OT3A 1XC5A 3I32A 4EKGA 2CW8A 3KL4A 3I73A 1HW2A 1ZJJA 1SQFA 2P5YA 2RGWA 2DU9A 1OAOC 4MVJA 4FCVA 5EPEA 4ACBA 3JWJA 2PIDA 3RSSA 4D9NA 3D0OA 1R18A 4O4LF 3P32A 4ZZLA 3LT4A 5I4CA 4DNQA 3WNCA 1KA8A 4O4JB 1G4AE 4ZALA 1IDN1 1E1LA 1ESCA 3WK9A 1OD6A 2PMZN 2IUFA 1NXPA 4QYTA 4BH9A 3L5KA 2PR7A 1IOLA 2Z04A 4F04A 2VJQA 1DRWA 4O29A 4YWHA 2OGTA 1RBYA 2PJRA 3E7LA 2EKPA 2NXNA 1Y39A 4WXDA 3HHHA 4MITA 2QL9A 1C0PA 3BTLA 5FKOA 4C5BA 2FLWA 3FFTA 1EI9A 4JC5A 1BS2A 4PR3A 1V8PA 2FSSA 2PTHA 1P60A 2ZJ8A 2OZ6A 3ET4A 3DHWC 4I1SA 3M9AA 4WNAB 4CMAA 5DB4A 1AVTA 1H2ZA 1FNNA 4TL6A 1OFUX 2WIBA 1RPNA 2XHEA 3E0JB 2DBRA 4I4CA 2YX4A 2R48A 3ZRGA 5H2FC 4PVCA 3L8EA 4XLAA 1JI8A 4IG9A 4MFEA 4L5AA 3R0VA 1NAHA 3DUWA 4A3FJ 2UYHA 3ELUA 2CQXA 2GZRA 5TS2A 1QDEA 4D4JA 1ISGA 1Z63A 4EB8A 4HQEA 5E4JA 2VDVE 1Y8QA 4YUXA 1KQ0A 1MZBA 1Q0ZA 1Z6XA 3RBZA 1JDPA 4Z4GA 3MT7A 1APLC 3HMKA 2JLQA 5CGZA 2BEUA 4HGZA 1L4HA 3I9V2 2A07F 2I91A 3AB3A 5KEIA 2QRHA 2PNJA 3RYHA 4YMLA 1GFSA 3PQJA 2FW6A 2WIFA 2ZI9A 3GCWA 4TT3D 4YIFA 4N0DA 4V03A 4L18B 4QICA 2VDRB 1WXHA 3QLVC 5TJHA 1BOFA 2J45A 1GDHA 3MJCA 2HRBA 5IYDJ 4HDSB 1F14A 4G4GA 1XXLA 1SWWA 2F4NA 2I22A 2Q2WA 2EC5A 2QUZA 4AC0A 3ERCA 4MGKR 4OI1A 3NIBA 2WWIA 3QLTA 5F1KA 3BD6A 3O9ZA 1NF2A 3Q7TA 4U2EA 3BOQA 5EGSA 2X1EA 2NZWA 2IXAA 1IVNA 3PXBA 3NYWA 4DQUA 2XODA 3P52A 4YO8A 3DD1A 5LQJA 1Z05A 4HLQB 1L4MA 2VJLA 4LYJA 5IH7A 1O6GA 5B7QA 3D3WB 4EHLA 3I9FA 1K3FA 3LLSA 1R5JA 1F60A 1E1CB 1WW2A 3ZWOA 4ASUA 3RI4A 4IWXA 4RMHA 2IH2A 2PV0A 2EP8A 2PQ8A 4WN9B 1Z12A 4XZ3A 1HDXA 3LYHA 2NZUG 5KWJA 2Q9CA 5GM1A 4YMTA 3HRSA 2QE6A 4FNAA 2QZPA 6ABPA 4LYGA 3NVMB 3Q8MA 2C8VA 1BKYA 2IVFA 4B6GA 2J6BA 3O75A 2H1RA 4ZARA 1ZELA 5DM60 2EZ9A 2OBFA 1IVSA 1SZDA 2AW3A 1QIEA 1TZBA 5KOJB 3HXKA 2OD2A 2OV2A 2CE2X 4RV9A 3UXMA 1KU3A 1WEHA 1IH8A 4EL5A 1K27A 2C4HA 1KEWA 4R1SA 2OKGA 3VZDA 3WB1A 1J0BA 2ECCA 5CX1A 1G5PA 1BX3A 3EFOA 1OJLA 2IXGA 1PW5A 3O8NA 5T4EA 4JLBA 2GPAA 2NZ8A 3I2FA 2AFHE 1CUEA 1TPZA 2ACJA 3WK6A 3W7BA 3QHAA 1LWNA 2AOUB 2WK1A 3AR8A 3ZCUA 4IS2A 1W52X 4X54A 2ZDHA 5JTTA 3KT3A 3KZKA 1FIUA 2QT0A 1JG4A 1DRKA 1GAJA 1SD7A 4EGQA 3KALA 2C6YA 4FFNA 2LDBA 3OOHA 3MUFA 3MKWB 1VMAA 2DWPA 4CT5A 4F45A 2BW3A 3EIEA 2ODBA 1CZUA 1HRDA 4GNRA 4NBQA 4PJNA 2HCJB 2FMTA 4Z86A 1MQ9A 1PT8A 2PG3A 1ZLYA 3DC7A 1B2LA 2Z95A 5JLAA 4EKIA 3S32A 1TYCA 5HCIA 1H6CA 4EO9A 2CEKA 5BRAA 1L0BA 1TVKA 1XQ1A 4G0QA 4HK4A 2Q29A 2YJZA 3HC7A 1W5FA 3ILVA 1U8XX 3ZVKA 5J47A 2WJ3A 1G7CA 3OZTA 3PFIA 1O4VA 4RD2A 2XF7A 3GOQA 5ALZA 2VEDA 2B21A 1XCGB 3PU6A 2HOEA 3IDQA 4LW8A 2YHBA 1YYVA 5DHRA 3V8QA 2R6ZA 3C6YA 5K7SA 2JJ1A 3PO2J 5IANA 4EY5A 2QTFA 5FPYA 4DTIA 2LR8A 2GZHA 1ID8A 4P22A 3HI6A 1DI0A 1WXFA 4Z3KA 4CG3A 5BN4A 2Y9YA 1OAKA 3H5NA 3OF5A 3UWKA 4G4SO 2I6QA 2WZCA 4B44A 1WKBA 3TEFA 4MI3A 3D7KA 4ZJUA 1YQ9A 4R8HA 3VO8A 4A26A 4DABA 4YRSA 5HR5A 2CW7A 5KB3A 3BWDD 1QDUA 4PYJA 4FFSA 1OR7A 2M45A 1X0VA 3HY3A 5TEVA 3HLKA 1GYQA 2H52A 1N0IA 1DL5A 2BGUA 1REQA 1VQ8I 1PVEA 1KO8A 2RC4A 3VR2D 3VQTA 3VU9B 4NP6A 2C3PA 3UPDA 1Q44A 1B4AA 4QO8A 4IIVA 1GUUA 2Q1SA 5G0WA 2CXUA 1DKUA 1JX6A 4TYPA 2IWHA 3O0DA 3RYPA 2EV0A 4CFSA 2Z0MA 2WE8A 5FLXA 5AVVA 2V1XA 4ZC1A 3DNMA 1GUZA 1JSRA 4KICA 3K9TA 3JQ8B 3H04A 3K05A 1A7UA 3QODA 1SVOA 2W2QA 3L9XA 4ENNA 5ANRB 2GHQA 1W5TA 4URFA 3H9GA 2UYOA 3WO0A 2HT1A 1MEOA 3N2KA 2EARA 1B9MA 4RLSA 2P8TA 3L92A 4DA8A 2QJTA 2F1RA 1ZUNA 4RSHA 3PFHA 3RKWA 3REOA 4OXNA 4Y2SA 3AOEC 4FFWA 2XMDA 2ILTA 5SY6A 2GBLA 2L82A 2I6UA 3BZKA 1DIBA 1ZD1A 3B6IA 4CMIA 4RABA 4X84A 3BDDA 2V7FA 1MAWA 4CIBA 3A36A 5SY4A 1L5YA 2JFQA 5FLKA 3TLZA 2H8RA 2MMGA 4M6WA 1PN3A 3WL6A 1B23P 3GRZA 1C0KA 1LTKA 2LF7A 1RHRA 1I1HA 3PZRA 2UU9B 3T9AA 3CUQC 4AYBA 4BNDA 1VJRA 2WA1A 3PNSA 1QU3A 2H1HA 3T3MB 1E6EA 3RABA 5CA1A 3D8BA 2Z5GA 4TZTA 1SVLA 3ORQA 3PQFA 4E6KG 2XYHA 2I9PA 1I6HJ 3KQYA 1PJSA 2QVYX 2HHAA 1ZGHA 5DN6A 2WSLA 5C8YA 1UWLA 4ESOA 3WXBA 2OQRA 4Z3DA 4Q93A 1XTAA 5BWLA 1BR1A 2KB0A 4IGFA 4MDYA 3ZZ1A 1E32A 1RHJA 2OBYA 3PXDA 2XAQA 3GLUA 1UMCB 3SF8A 1TUGA 5DV5A 1QRDA 4X90A 1XKTA 1STZA 2G7UA 4URHA 3WBBA 4JASB 3OETA 1J1UA 4UAUA 3N2ZB 1Y3HA 4EY3A 4QVIA 1EFPA 1JG1A 3A04A 4EM1A 4QZVA 3ADDA 3QPHA 2ZYSA 3MS4A 4UBLA 2MYTA 4CU2A 2IH4A 4JBXA 1DLIA 5ALDA 1YK0A 2QVCA 1J5EB 1O7FA 2CCJA 4ZYXA 4TTAA 3QX7A 2XCUA 2RAEA 3LSIA 1IMOA 5GONB 3WS7A 3I12A 6LDHA 5HIIA 2F4IA 1C4XA 3L9WA 3ELDA 4ASUD 2LY9A 4X60A 3F8CA 3L7AA 3UHFA 1FX0A 3BGWA 1N4DA 3Q8XB 4B45A 1C1YA 4YMSA 3MWEB 2VNIA 3MGBA 3MGAA 2F5FA 3R7WB 5EQDA 2JI8A 3EPPA 1UJ2A 2G06A 4B3HA 3ODPA 2HBYA 2QTTA 5ALMA 2XCTB 2B5VA 3UGQA 2PH3A 1PP8F 2WUEA 2PCJA 4D5EA 5D6EA 2JGIA 4BLRA 4E1BA 3FVQA 3IQDB 1BWRA 2ZTVA 2YX1A 3SEZA 1TNDA 3BHMA 2R68A 3R1IA 2BZ0A 4ZV4A 3R7FA 2I33A 1USTA 4R51A 2G1JA 4B33A 1DBPA 3T9FA 3M3HA 2CNBA 3NT5A 2WSIA 3JX9A 4M89A 4KXMA 2EKQA 5JNRA 2YPRA 3R0ZA 1QWSA 3P9ZA 5LOVA 1Y6JA 3KUDA 4OYYA 3KBBA 3ZX4A 3GG9A 1ZD9A 1X8XA 3U80A 1CFZA 3UB2A 4MCJA 1DINA 1J0CA 4NENA 1KK0A 4EF6A 4YCLA 1OQYA 4IYRA 3KZIC 5FJIA 4EEKA 4JQCA 1JLRA 4J01A 2X58A 5B6PA 2MSDB 4XYGA 1X1SA 3SFTA 4YK7A 2V03A 4UE3S 1AHNA 3KZVA 4G25A 1I3MA 1SHKA 4HXYA 2CLFB 4NDAA 2PR2A 1AURA 2HK7A 4JI7B 2XNCA 3K0FA 1UKEA 3TQCA 2QVBA 1VIAA 3GP3A 4DPMA 4PZ0A 4WXCA 3U0BA 2HNKA 3RVPA 2X3FA 2VPPA 4M1EA 3S2IA 2IBMA 3I5AA 1QR2A 3U1VA 1U4OA 1E9EA 2XZPA 2CCGA 2C2GA 3S2GA 5GV7A 4GMGA 1C7IA 1Z7GA 5LM3A 1WX1A 5JXJA 2B4QA 1W1WA 4OK6A 4HX7A 4UMEA 4WBNF 1Z0UA 3PUKA 1K6IA 4N18A 3KR1A 1JIQA 1K7FB 1N78A 1OBFO 4RAQA 1M7GA 3L07A 3E53A 1YFHA 4JGGA 2BE5F 1V2HE 2VJYA 1NN3A 4J03A 2YIMA 4YJHB 5SYAA 1THGA 3B78A 4V0QA 1NDHA 2WA2A 1LPMA 1J70A 4LJKA 3VXKA 1Y6IA 2XCOA 4BE7B 1P31A 4KO8A 2OXFA 2F3RA 4QOJA 3SFIA 2JGFA 2O3TA 4NV1A 1KEZA 3INYA 3UOGA 4Q34A 5B53A 5FKMA 1N34B 2JZOA 2YOFA 2O0LA 3L2OB 3E5RA 2VYQA 3B53X 1IU9A 1H2BA 4F9FA 4RH3A 4M9QA 3MIIA 2CD9A 4LXXA 4PM4A 4UOQA 2XMQA 1VKZA 4NCXA 3CLUD 1N1MA 3Q6IA 3O2SB 2E89A 1SXJA 2ACKA 5AW1A 2OD9A 4TUYB 4BE4A 3IE2A 3F7NA 5THQA 1IQPA 4BO8A 3PICA 1B15A 2XKKA 4OBBA 4RO0A 4KQKA 5EYPA 2OBBA 4HI0E 1Y1LA 2K9QA 4RUKA 1DAEA 1R9TJ 5E1MA 2J85A 4XGQA 5AW9A 5BORA 3MA0A 1O5IA 3KOOA 3S3OA 4PHGA 3GTKJ 3VR6H 2LH9A 1FJHA 1RRKA 4PTYA 3PXGA 3HG9A 1L7PA 4MICA 2WHRA 1KMQA 2H7VA 2MHCA 1GCAA 3JQ7A 1WBJB 1F0KA 3OTQA 1NR7A 4LC1A 2HA6A 3GGPA 4M0UA 4GE3A 1ZG1A 3LSGA 1JDJA 2YWDA 1T5TA 1KIAA 1H89C 4OIOF 2CUKA 2YX7A 1U5CA 3R6LA 1D2CA 1DU6A 1YI8A 3DBRB 1E9SA 1D8TA 3RQ4A 3E9QA 4PXSA 3C85A 3IQHX 3DEFA 4G0XA 5B7PA 3QVVA 4HQFA 4ZO9A 2Z6QA 2EFQA 3V00A 2DUWA 4DSAA 1OWNA 2D13A 3K9NA 2EV5A 1Q2XA 3JQ9A 4L5EA 2ASVA 5B4VA 4S0ZA 2X42A 3UWMA 1X2BA 3N0XA 4ETSA 1DAOA 1DOHA 2ZOSA 1MO3A 2XMBA 3GPDG 3AL0C 3IHKA 1Y37A 4DPLA 5HOEA 2AYYA 4AIIA 1RPAA 3QVSA 3JQFA 2A86A 4YALA 1TK3A 4HOYA 1ULZA 3C5WP 3E05A 2DVMA 3WMXA 2MGQA 2ZXJA 5CLHA 1LC3A 4LRTB 3N2IA 1XSVA 4LZWA 4O1IA 1RLTA 5EMJA 3CNBA 2KPMA 1EFLA 4KRXA 3P0IA 2Z6VA 3RNOA 4FYVA 1IRXA 1GPUA 1ITYA 3QMWA 5A5EA 2H11A 3FPCA 3M3PA 3FXQA 4OHCA 3T7SA 1MJBA 1KRHA 4JSYA 5MFZA 1LJ8A 5DBEX 4L4XA 3ESBA 2OCPA 5DE3A 4ZK2A 5EJ2A 2X9NA 4QYIB 3THXB 2VAMA 1EX1A 3U56A 1ZCJA 2ZIFA 3D6TB 3ETLA 4RPHA 4Y2QA 4OQZA 5KVQA 5A9SA 4PG7A 2Z3WA 5CEEA 1CY1A 3D43A 1T08B 2GSDA 3F9RA 3KLNA 1WM1A 1FFEA 3BPVA 3WGNA 2REBA 3DLHA 2PD3A 3DMFA 5HJ2A 2Z4RA 2ZRCA 4D0PA 5C5EA 1KDOA 2B78A 1CSEE 4G12A 2X6XA 1R6RA 3K9FC 5JQGB 3S44A 5KX5A 2FZ5A 4ZIRA 1BVHA 4HAMA 4WF2A 1WB5A 2ZRLA 3DJFA 4XWOA 1P7CA 2NYAA 2PUGA 1X15A 3NH6A 1MG0A 2ID3A 1YRHA 2OLJA 3IJPA 3I76A 4DZZA 5LMNB 1T4CA 1Q1NA 5E1OA 3MTDA 4IV8A 3HSFA 1C1XA 4A36A 4X9XA 2COMA 4GE0A 1O89A 4OI2A 5CAEA 4N0PA 1WP9A 1GRCA 2PX0A 2HHCA 2JG3A 2M32A 3I1IA 4I1RA 1LW6E 3DXZA 4DUGA 2DY1A 2VRCA 1DCKA 4G5RA 1PZXA 2X0KA 3X1ZA 3UKOA 2Q9UA 5IF3A 2OUIA 4BLSA 1MR3F 1G1MA 4F4DA 1Z0IA 2JRTA 1VE6A 4YA6A 4IRHA 4AN4A 1U1EA 1GV1A 4FXPA 4GMXA 1QYRA 4QTTB 1N0WA 3DVQX 3C3DA 3HBLA 3MT8A 1I14A 1JKOC 2HADA 2P5TB 3JQRA 2OWDA 1XAJA 1YS1X 1N5KA 3G82C 5EFOA 3AXSA 4ZVNA 2ZR7A 3OO1A 2ZPUA 3A6EA 2WEKA 3KQKA 2WPDA 1J2UA 4LLGF 3AESB 2WF9A 4AG5A 5JMTA 4RQAA 4ZJZA 1U9IA 3OZVA 1EFVA 3EZ6A 4WOPA 5KNDD 2QLLA 2YICA 1SH7A 2AKAB 1X8LA 4S3MA 4K26A 4XWAA 4LGCA 4XM3A 3NTUA 4DKJA 1XIVA 2HFHA 4JVMA 1X2NA 4UUQA 4XUEA 1TL8A 3I2IA 3TB6A 1ZSYA 3CZ9A 3KP3A 1M1ZA 5B1AH 2QG9A 5FL7D 1KMHA 1ABBA 1K6XA 4FBGA 5JYEA 2G07A 3HADA 1X70A 4RNDB 1OZAA 3EPLA 4TLDA 2P2DA 1P4RA 4X44A 5K5EA 4HMPA 3L6BA 3IX7A 1YZQA 2H7CA 4UXHA 4TKUA 5FNVF 4HLDA 2A9JA 3E82A 3IHUA 1KXZA 1RJGA 3I5YA 2W1OA 1CJTC 5B12A 3C7TA 3CU5A 3OTOB 3A8TA 4BRUA 4G1CA 1FYVA 3BD9A 5FOUA 4QDXA 3M81A 4YHBA 2E1CA 5LC1A 1SU7A 4UBMA 4GG1A 3II6X 3CEPB 3W5SA 5J59A 3SX2A 4YUZA 2PKEA 4B3TB 1NYLA 3BCUA 3ICWA 4O4LA 5IAOA 1CG6A 1ESMA 3OM1A 3EAFA 1ESZA 3VAAA 2WD7A 4JLUA 1X7WB 1Z29A 1IYZA 4P2BA 3C4VA 4RELA 5CFOA 4Z2AA 3NP9A 3HKBA 3FMGA 2UZ3A 5HCUA 5EWJB 5FOWA 1R8YA 1UCFA 2DA4A 1X7XA 1E64A 4F6LA 4C4PA 4XWGA 4ZN6A 2P5UA 3I6YA 1XNRB 4X00A 3HXTA 3RUIA 1SQSA 2KM1A 3IP3A 2V4ZA 4LOHA 2NPIA 1I3OA 5EQJB 1DV2A 4CLRA 2P4EA 3TE7A 2L02A 1UJNA 3KXKA 1R4NB 1ISJA 2V9VA 1OFGA 4KLRA 2WF6A 1LK5A 2MJLA 4EG6A 2L42A 4B3JA 3PBKA 4YIKA 1MAHA 2NU7B 2O2IA 4BMPB 2WT8A 2HD4A 3HCCA 3M6LA 3L7DA 4JCOA 4UHJA 1EGQA 4W5TA 1A9QA 3S1AA 3U49A 1SXJD 3RHSA 3RCOA 3HKZA 3AGQA 1GA1A 2QSUA 4I5EA 5T8KC 5LDGA 4NIMA 4JAVC 3E70C 4ER3A 3DVAA 1E2GA 5JYDA 4OFXA 3V8JA 1VPWA 5AHOA 2YVKA 2ZJAA 5EG0B 3VZCA 4OL0A 5IYZB 2O2HA 3GLGE 5L3QA 4FETA 4U0KA 2NRAC 2GZDA 3E15A 3MPOA 4QECA 2HO4A 2XWBF 3JYNA 4U5QA 4JXKA 4NAVA 4IY1A 5EDNA 3C18A 5EIEA 4O4IB 1QP0A 3QLUA 2X14A 3OU2A 5B1EA 4M9RA 1BKDR 1BI2A 1ZGJA 3IAAA 3JQCA 1U02A 4PCAA 1U8CB 2FPMA 1FCJA 3C3YA 4I0AA 2R6CA 1DBQA 4AS2A 5ERIA 3VO9A 1IXSB 3S2SA 1Y5IA 4HAZA 4GICA 4G4SP 2DERA 1YMVA 2UV8A 3S7TA 3D7NA 5ICCA 1QYVA 3ZX5A 2JLSA 3R9XB 3H99A 3QEBZ 1OBVA 3HL0A 1LI7A 3CONA 5ENDA 1X39A 1CIVA 3IV5A 2VC1A 2W22A 3JRBA 3V3TA 1PUFB 3IAM1 3HR7A 3RHTA 4N9QA 1VXOA 3VSEA 3CHYA 4D8UA 3LPCA 1N5RA 2F17A 1TZCA 2VUIB 3FVWA 2G5CA 3D6JA 1ETUA 5KVAA 3RPQA 4MGIR 1ONVA 1SFXA 4LZJA 1CNEA 3DDOA 2HJVA 3CR8A 3GCZA 3EOBI 5EWLB 1T1EA 3VZSA 5JFOA 2GXQA 4LGMA 3WL8A 1UFQA 2ZIWB 1LJUA 3D0RA 4Q15A 4DC0A 2OMEA 4JQYA 3EPRA 2XADA 2FOKA 1SPBS 4MFDA 3QVWA 3ZQJA 4QLAA 3FGPA 2W37A 3MXTA 4YNBA 4ZC3A 2XMPA 1SKYE 3NGXA 1QH0A 2AQHA 4HEA6 4CV1A 1EDBA 4X0EA 4XKBA 3A10A 1V1MB 4QE3A 1S7OA 4OB6A 4HEJA 4EABA 3TO5A 3IOCA 5F2OA 4DLUA 3HKDB 1BTOA 5I4KA 2NSHA 3PIOF 1NM5A 1O5OA 3SIRA 4CMEA 4GKAA 3W3AH 2JFPA 1A9PA 2O5EA 1I3LA 3IDZA 4CF4A 4X8HA 4KN8A 3GTLJ 2QR5A 3HB9A 5T4BA 4FLFA 2QMUA 4KO1S 3LQ2A 1FSEA 5JTUA 3DOOA 1NBME 2YXEA 4M98A 2DTZA 7ABPA 3D5EA 3SJ7A 1P4HA 3UK6A 1Q20A 5FI3A 4OQ4A 1X38A 1QO0A 2Q3DA 3ESRA 1QWOA 4DUGD 1FFGA 4MUYA 4IFTA 3W2GA 1KYZA 1FMWA 2Q4EA 1QG6A 2J46A 3H97A 4FC7A 1RRGA 2WSBA 1AK1A 4ZO6A 4OBEA 3T5XA 2YASA 4KTTE 3KPHA 4A2PA 2FWPA 3KRTA 2VASA 2W11A 2KWIA 2IEBA 1A35A 4ZHQB 1USSA 3ZDAA 5CD9A 5TGTA 3TAHA 1LSOA 1OFVA 1Y8AA 2XMSA 3B9BA 3P2YA 3RO7A 4RFSB 2LREA 2YN2A 4K9PA 1RRVA 4DA6A 4C7BA 4MJ7A 1PFUA 1U1CA 5K0NA 4QGBA 2HQRA 3GPIA 2ZUSA 4C4YA 1TUIA 1YS9A 1FIPA 4I9HA 2DTEA 3D7MA 4P33A 1KQFA 2VQFB 3HUEA 2XIGA 1YB2A 5EZYA 3G3ZA 3HYRA 3ONEA 3F5SA 2DA3A 2WPDD 3BXZA 3JZDA 1RYZA 2P69A 2FAXA 2VB6A 1UFKA 4KAXA 3UV6A 4S0XA 1EUQA 1KOFA 3F5FA 4I9NA 1Q1VA 3B3AA 4J75A 5FRNA 4PX2A 5BV0A 5DUKA 4GKJB 2E4AA 3KPJA 5T41A 2LK2A 2ZO4A 3KAJA 4Z0HO 3LF2A 3ZLBA 2MC4A 5LUAA 3AKZA 4BVBA 2EWNA 2XE4A 1MO5A 1M34E 2Y4OA 1PT9A 3MJTA 3KQHA 4G5OA 5HE8A 3WL7A 2WTMA 2VQSA 1J23A 4YVFA 3H8VA 5B2ZA 2FQWA 3F5QA 1YHQI 3INRA 4J3FA 1D9ZA 3MTJA 4M7PA 3K2AA 1HRKA 1IXZA 2LP4Y 3WQQA 2X13A 2E49A 3FBNB 1GUYA 2ZE6A 2O2EA 1LA2A 1X14A 3IKLA 2F3QA 1NYTA 4GSLA 2D0DA 4W8HA 3NO4A 2QCOA 4FCWA 5ELXA 2LBFA 1W30A 4WZBB 3DZJA 3L1KA 4ZEVA 2A1IA 3K1MA 4IIXA 4RFVA 1US8A 4R01A 2GQQA 5K5OA 4WK6A 3VKGA 3DP9A 1PBNA 5FQNA 4A8JA 3AG4H 3GCMA 2W58A 2A69F 3T3GA 5FTKA 2JH3A 4G1MB 1LZLA 2B98A 4C3UA 1M6WA 4A9AA 3G2JA 1QIHA 2IOQA 3KFLA 2ZWVA 2Q45A 3MTEA 4WV3A 1JBKA 4HTAA 3WLQA 2IJLA 3UIEA 1IZ9A 3I3SR 2CU7A 1MBEA 3RAJA 1R23A 2QQ9A 1LDNA 2E7WA 1ZU4A 3AERA 4B3GA 2PRKA 3ORYA 3PHGA 5DTEA 2H2HA 2QS9A 4RX1A 1L4KA 4CM5A 1ZRHA 5K51A 3DZCA 5ICSA 2E2HJ 3QVXA 4ZKEA 3K4NA 2ZSDA 5FOVA 1N33B 3W5DA 3VZPA 4NULA 2XSZA 4MUKA 3RU2A 3BCRA 2W2OA 4X1YA 1U0BB 3U4QA 1N5JA 3QVKA 2YJ4A 3ROPA 4O25A 3WDMA 4N5NA 3HLYA 4QWQA 1SFRA 4W5HA 1IWOA 3RQIA 2FEWB 1ZTRA 5E7MA 4X91A 2G0AA 2ZTLA 2TMKA 1XG1A 3RYRA 3IGFA 3DWLE 4KYUA 1BOBA 1DSSG 4NCAA 2ECQA 1FFBA 1UKVY 5CIYA 2W7NA 3AX6A 1JH9A 3EC7A 3ZY5A 2SECE 2GPJA 3NATA 3HSSA 1ACMA 3KE8A 3WTBA 3CEHA 2CLOB 2DQLA 2P6MA 7MHTA 1R8QA 1EFDN 1GKUB 3K35A 3G2BA 4DCNA 2HWUA 4I5IA 3VYTB 4RKFA 4CSWA 4HB0A 2FNPA 1ZICA 1ZD5A 5L3VA 2FFAA 3WYAA 4OJYA 3KAKA 3C7AA 2DO7A 1P7PA 2RQQA 1SIUA 5A5VA 5JAOA 2EB7A 2CXNA 3L8YA 1G59A 1D5WA 2H17A 4TLAA 5I47A 5IUKC 5AKJA 5KC9A 5TJJA 4P4UA 1XNJA 3K4PA 1IBLB 1DQNA 2A2ZA 3JQBA 2AMJA 2HHHB 2E4ZA 5GIOE 4GOOD 4BIMA 2CC2A 4EB6B 4BFCA 2AYZA 3RTRA 1EJ0A 5CDFE 1G20B 3WFIA 1Z7EA 3MNFA 4IX9A 4KXNA 2XVMA 3JQEA 3CBQA 5H8WA 2ME0A 1W47A 4X7MA 2ODWA 3AF5A 4DA0A 1DKMA 1ORVA 3RIMA 2J3EA 4F96A 3F8MA 4X63A 1GV0A 3FWYA 5LHIA 1TFUA 4XJTA 5D7NA 4OUDB 2ZC2A 5AFSA 1L9KA 1QH8A 4G89A 3MOGA 2JPCA 3NHZA 3C3JA 2WHPA 2EZLA 2NS0A 1M3SA 4INAA 3VDRA 3AHHA 3PK0A 4YUVA 3ZPXA 3TMYA 4AKTA 4B9AA 2NVOA 1NFFA 3I01M 4AJ9A 4FQ7A 3GLXA 3NT2A 2NUBA 5K0GA 4GBED 3L00A 1HXDA 4WVLA 4YXFA 4J4HA 2BEJA 4E33A 5EJ5A 4MR7B 4UUOA 4LNUB 5ESXA 1LDJA 2AS0A 3LHIA 3STWA 4HH0A 1POGA 2GBIA 1Z0SA 3ZKAA 4PFSA 4CNQA 4IEFB 2F3SA 2JJ8A 4Q05A 4FZJA 2Z6AA 3OWOA 1RXCA 5IW8A 3NNSA 1RQ2A 1VHTA 2OPHA 2PHZA 2R65A 3F3SA 1R66A 2E1RA 1IY0A 3WXMA 1SC1A 1K8RA 1K4KA 3RIHA 1TT5A 2IF2A 3FETA 2LRDA 3IEKA 1LLQA 1Y6ZA 2EQAA 3GDOA 4D7MA 1Q57A 1WO8A 2ZG6A 2WPNA 5K2MA 5MF6A 1GTMA 2C07A 3ECOA 4Q03A 1JDNA 3LM8A 1JHDA 1NVXQ 3QX3A 4DR3B 1N2SA 1ZNYA 5FI1B 5FBHA 1WLSA 3ABUA 4XR4A 3OEHD 4QHSA 1C0WA 4JP5A 3VV3A 5BQ5A 3FLEA 5B7GA 3WTWC 1D2GA 2FWNA 4AUXA 1TQ6A 2HSJA 1BXZA 5DP1A 4EX6A 2Q2EB 3HHGA 5DEIA 1KMMA 1XMSA 3R7BA 3GZNB 3KK0A 4U1RA 1ANKA 1QRRA 3M9LA 3OOSA 4KSYA 3DCJA 1K06A 4GDFA 3RUAA 1UXKA 3FTCA 2FZLA 1EXDA 3R3WA 4EG3A 5AKGA 2COEA 2X48A 2HXYA 1LSSA 3EFHA 3HE3A 1DP3A 5KI6A 1XMIA 1XLVA 4I9GA 2ZYGA 3DEZA 2XQVA 3L4EA 3L7WA 3D4NA 2ZUEA 1WDWB 4Z53A 3IAS1 2WB1N 1MVLA 1HDYA 5DTIA 5ECDA 3HPHA 3EGDB 4LDJA 3KQMA 2F67A 2P30A 3FCCA 4MV6A 2BGLA 3N2NA 4BX2A 1H1DA 1Q91A 3BH0A 3QU9A 3IKTA 4MV7A 1M2KA 3NDRA 5J5CA 4EI8A 2ZITA 3WYFA 4NCNA 2E4UA 5KOHA 2WKRA 3KQQA 3DU6A 1G21E 4MS3B 4Z4CA 4CKEB 1XNHA 4BGEA 4Y2VA 5B64A 1PRYA 1HOMA 3V1UA 1GT6A 1D1QA 2D5AA 2B8WA 4WOBA 2GM3A 1H6BA 1JHVA 3ZCTA 1FVOA 1QZXA 3GGSA 2LCQA 4B43A 3W1WA 4FT4A 3A6DA 2DPMA 4BVFA 5ENVA 1U9JA 1IDOA 3V97A 4HYYA 4AU7A 2ZWMA 4UVIA 3LP8A 5COQA 2Q5CA 1W88B 1JZTA 5JDCC 2EIKH 3SKYA 2RH9B 4CCAA 1TUBA 3SZUA 2GAIA 2PUVA 2J3MA 4X1KB 4FX0A 3GVPA 4MHSA 1QPGA 2GJSA 1D2HA 1VL2A 1ISIA 3IA2A 1M2OA 3RKQA 4RTSA 4TXJA 1RTKA 3CUVA 1MRNA 4OK3A 1T2UA 4KNYA 3EVZA 3NNDA 4UPDA 2EFPA 2JJYA 4OP3A 3GVHA 4A3KJ 2HWWA 4PLFA 1ACJA 3GEGA 2WJVA 4DUYB 1AGRA 3ZDXB 3RFVA 3WI7A 1P4AA 2CH0A 5JY6A 1ZJ5A 3LC2O 1FP7A 1Z0DA 4F86A 3M6XA 1XL0A 3CUWA 4H7FA 3G0BA 1VGQA 4ALKA 3WDLA 3TTXA 3PGMA 3RSFA 5EKUA 3WJAA 3PFWO 3EE6A 4ARIA 1OREA 3PGXA 2Y31A 2ZU6A 3HDVA 3A6FA 4GQIA 2DQ4A 1Z8FA 2IXDA 2HF7A 4A16A 1GNTA 4JB3A 2XSZD 3B70A 4MNTA 2XASA 4MGRA 3LC0A 4EKNB 1VSQA 3DKVA 1OKKA 2XMRA 1QIIA 1HEIA 2FW7A 3B36A 5J2UA 4NU8X 1KIFA 3K0HA 4Y1EA 1SM4A 5LBIA 3CTPA 1PUJA 4TQGA 2OILA 3W34A 2Q8NA 5JBNA 2ZDGA 1GRNA 1N7HA 4IGEA 4LBVA 3MHPA 4HXFB 2IS6A 5IVPA 3JAKB 1T36A 5HUJA 2BDUA 5IF9A 1N2BA 4G6DA 4BY1J 5EUMA 2R7UA 1UDCA 3LW7A 1VF9A 1M8JA 3FPGA 2Y30A 2VDUE 3OOPA 3KWFA 1BW6A 2R6FA 5IT5A 1BFKA 2OXIA 3RYCB 1AKTA 5HG0A 4Y0AA 3B85A 4ETIA 4Q4LA 1IC6A 5SV2A 2EJRA 1HQDA 2DHCA 2PZEA 1S8FA 3BTVA 1NNSA 1TLLA 2WFLA 4YEJA 3C3AA 4OATA 5LKRA 2QQ8A 2F43B 1XRPA 5J1SB 3FX2A 3MJSA 4IVQA 2RB5A 4ZWNA 1NJFA 1WHTB 4KXXA 5EZSA 1I33A 1MHTA 1GU0A 2D5VA 3PXEA 2K2WA 3OYAA 2AZDA 2QZJA 4TTTS 4D81A 3VOEA 5KWVA 1Y48E 2RREA 3FPKA 5HIKA 4BX0A 3GLIE 1JEAA 4LSZA 5L6MB 4KLNA 3SFZA 4BP1A 1GZUA 1R9JA 4UD2A 1YOVB 1PHPA 2UVPB 3DZKA 1BH6A 1L5ZA 1DKPA 4PZZA 2QLJA 3ICEA 1RZ3A 5KSYA 2W93A 5JFRA 4IP0A 1TM2A 1UPAA 1T3ZA 4J6FA 1UPXA 4TMWA 3BXHA 1ONPA 2R44A 3ETCA 5FHQA 1NOKA 1QGUB 4G0YA 3JRCA 3ZY6A 4CYCA 5EHGA 4WGFA 1WQ3A 4AUNA 3O3NB 4HF0A 2O2DA 3WGTA 3CLTD 3OFNA 4UUNA 2P2CA 3ZBTA 1ZHHA 4BX8A 1P4SA 3WLHA 2PQ0A 4W8OA 1I36A 4HZIA 4HDCA 5AJYA 2DF8A 2I4OA 3OV8A 4JT2A 4FSXA 3GELA 3JY6A 2AZTA 5GGXA 1PYGA 4YREA 3EJWA 2GPBA 1UXOA 4QODA 3T3HA 1RLMA 3RG8A 1TU0A 3I58A 3JTMA 1A5BB 2ID9A 1XU4A 2HNHA 1VIVA 1J2XA 3GCXA 3A4CA 3FF4A 4ND2A 1W94A 1IQUA 3NEPX 4M1OA 2R85A 2VONA 1QCYA 4IUCS 5JOQA 3HRHA 1WVIA 3LT1A 4U7TB 3PPWA 1Z8HA 5B3JA 2OXEA 2O4UX 5C4IA 3RIRA 3TR5A 4TS4A 3EPKA 3LSKA 4LPSA 1XZGA 5C3UA 4HPJB 4PC1A 2R7KA 2IF0A 1EWYA 1ZS9A 4OQEA 1E18A 3JVVA 3TLXA 1OBOA 3KM0A 4KIGA 2GD1O 3NFYA 1MIOA 2GDJA 2EZTA 5LP6B 4HDRB 2W6NA 3HWRA 1G3QA 4JVNA 3GJZA 3PNOA 4K3UA 3ZZTA 3WA6A 1E2HA 1CZOA 5TQ2B 3BMCA 1R0KA 3W2TA 4UDNA 3KPUA 3KYIB 3U81A 2XVYA 1EK5A 2HIGA 3C8HA 3V4PB 2ZREA 3RSNA 3F0TA 3T5MA 1AZLA 3ROEA 2H08A 1YJQA 3GVAA 1REPC 1G60A 1XEXA 2R00A 5AI5A 4IINA 3UCEA 2XROA 4DM4A 1JHMA 2K27A 4HWPA 3ZCSA 1B8PA 1YCFA 5BSMA 1XTBA 3TAUA 4NI5A 2JCGA 3BXOA 4D92A 2HA2A 4CV0A 5B37A 3MFQA 3I28A 4ARBA 3F5MA 2C04A 1P9WA 1NBEA 4KIJA 1QPBA 4RDHA 1QV7A 1KDZA 3HXQA 2FG5A 2OAGA 1JPJA 4WPGA 3ZDYB 3HV2A 4GSKA 5E4YA 1A2QA 2BGKA 2EZUA 2I8DA 4QPZA 2FGJA 1J8YF 1N92A 3VV2A 4XJSA 1C7FA 3WB0A 3LLMA 1KJNA 3E7XA 3VPDA 2O0YA 1LQ1A 1SKUA 4Q3BA 4CZZA 4XQCA 5L3RA 1RQXA 1AS2A 1CXZA 2C84A 3FISA 3KYJB 3DLAA 1OH6A 1JDTA 2C4NA 4G0ZA 1JBQA 3CUTA 1RMYA 1ARZA 5LQCA 3OX3A 2JAHA 3P9KA 3DL0A 3VHXA 4F4UA 2XKAA 5U1PA 5H3HA 1KZYC 2NO0A 3RWOA 5JZ9A 5KTNA 5D1NA 3TPZA 1NNI1 2HIHA 2RAUA 2O54A 4D9CA 1GYRA 5JZVA 2F6RA 5FTJA 4YIRX 3WLJA 3LRXA 2FQ3A 3PQDA 1YJBA 3T0IA 2DAPA 1TZMA 1FEZA 4MVJD 4CMBA 2PYZA 2I2FA 5DGCA 3ESDA 4FYYA 2WSSA 3ASOH 4U0YA 3T95A 5HBRA 4RGXA 4ZRNA 1ISSA 4N0QA 5HOOA 2IT0A 5AIQA 2CCKA 4BLUA 3SJZA 1C80A 1WE2A 2PGAA 3R74A 3OLXA 2XWPA 1EUDB 4BXUA 1QANA 3ABOB 4IJMA 1MF7A 5F1RA 3U7HB 5E3NA 2DA1A 4CCMA 3PUVA 4NQZA 1Z0JA 4UTVA 4BYMA 3FIWA 4Z3OA 2B20A 4RD1A 3HBMA 3IXMA 3DAGA 2QAGC 2FJ0A 2VWGA 2HUPA 1WB9A 5F23A 4TSKA 1EU1A 1R37A 4G26A 5JXWA 1NXWA 4JB0A 4OGWA 1S7CA 3L05A 1G4HA 2ZDQA 1BIBA 4TSRA 4GYWA 3G0OA 4UE2A 3SSMA 3JYOA 1D04A 4F3RA 3LRPA 3O1LA 3CC7I 2COBA 2X6YA 2VQDA 2R9VA 1WUHS 1K6MA 3NIWA 4M8KA 3GUCA 2YXNA 2BUAA 5DXFA 1BXGB 2B9VA 1U3EM 1P39A 1OWPA 2AXTC 4WY2A 4ALIA 2WG0A 3UUWA 1ZI9A 4M9UA 5A05A 3NH9A 4UTRA 4B8WA 3NHYA 4B6RA 3DHNA 1U2GA 4BNGA 3GJYA 3LDGA 3P2KA 4RK0A 5BMVB 2DM6A 4DRZA 2CXPA 1YJCA 4OKSA 3NIDB 4BMVA 1G0NA 3QKRA 2JCXA 1Z18A 3HB4X 5BNGA 4J7XA 4PYOA 2W2MA 2PDAA 3OOUA 3PDHA 2E2JJ 5ED4A 4MTCA 4J19A 3AIOA 2HPZA 5FTWA 3DLBA 3GNTA 4F1KA 5BSWA 4AB1A 1AF7A 1ZG3A 1RLIA 1KVRA 2QTZA 2O8EB 1N3BA