3H5NA

Crystal structure of e. coli mccb + atp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
338
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
total genus 109
structure length 338
sequence length 347
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5nA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5nA02
1DRUA 1KC1A 4XQEA 1IYZA 1PX0A 4A27A 2W98A 3OETA 1UR5A 1DAOA 2HKIA 4OXYA 1VC2A 3INRA 4FFMA 4YAIA 2BLLA 1DC3A 4RF2A 2A92A 1NVMB 4DIOA 4AVYA 3FBGA 1GQQA 1Y9EA 1JKIA 4FN4A 2O4CA 4L0QA 1KVTA 2TMDA 4WGGA 4BS9A 4CLEA 4QSMA 3D3EA 1Z45A 4WEQA 4B4WA 3K92A 4RVUA 2GN9A 1YO6A 2HK8A 5A5FA 3GPDG 2HMWA 3FPCA 5KCZA 3S55A 4AJOA 1FDWA 3BMQB 3LLVA 3ONDA 4BGIA 4E31A 1RM5A 4A03A 2FZWA 4JBHA 2Z5LA 1BW9A 4UREA 3V2GA 1HE2A 4XR4A 3JYLA 2W2LA 4XGNA 4Q3CA 4BNUA 3H9EO 4DQXA 4XYLA 2G0TA 3FHLA 2GN4A 4OO3A 4XKJA 3ZW9A 4RZHA 1B7GO 1YOVB 1H6BA 5EJ2A 4BNZA 4R4JA 4FFOA 1T24A 1DEHA 3ON5A 4GKBA 1YDEA 2C2XA 1VL8A 3OHSX 3L9XA 4J1TA 3T7CA 1I8TA 1XA0A 2RCYA 2XXJA 3PEFA 2ZYDA 2ZB4A 2VWQA 3BZUA 1EDZA 2FZEA 5B1YA 4WLVA 1PIWA 2TMGA 3RSHA 2B5VA 4INAA 1BXZA 4EUHA 1JQBA 4PG4A 2VWHA 1V8BA 1E3JA 1HE5A 3JQ7A 4QUKA 1DAPA 5A9SA 5I7EA 1W73A 3QW2A 2I6TA 1PGJA 3QWAA 1H6DA 3FR7A 2ILTA 3B70A 1QKIA 1ARZA 3A06A 4OXKA 4U0KA 2UAGA 2J5QA 4AJPA 3GNTA 1GAEO 3W1VA 5I9NA 4BO0A 2B37A 1F06A 2PZJA 3BIOA 1ZNQO 2IRWA 3QE3A 4RVHA 4NJOA 1V3VA 5G0TA 1BXGA 5HS6A 1E3WB 1VJTA 3GZ4A 1JAYA 1LLCA 1QLJA 2WWRA 2YZ7A 3HUDA 4MKZA 2IE0A 5F3RA 4LVUA 3HFSA 4C4OA 4J3FA 4TVOA 4DPMA 1C1XB 4DIBA 4ND3A 4TWRA 4XQGA 3RJ5A 4B4UA 1VRWA 2NV6A 2ZTMA 4LRTB 4BV8A 1VKNA 5GZ1A 4RVFA 4OKIA 1E7YA 3SJ7A 2HK9A 4P4LA 3V2UA 3C3XA 4XGKA 4Z3KA 3GRKA 2RH8A 2X0IA 2ZQYA 5HBRA 4BIIA 2CDCA 3F1LA 3VDQA 2D1YA 2IYOA 1T26A 2V6GA 1LDEA 5FYDA 4IJWA 3TL2A 4IZHA 2Q2VA 4XYMA 1JA9A 1J6UA 4G2NA 4R5HA 2GN8A 3ADPA 3G17A 3HFGA 4IJVA 1NXQA 4M86A 4B4VA 4DYVA 3ASUA 4TSKA 2I65A 2PV7A 3OEYA 1U5CA 2FR0A 3IL2A 4DPLA 1ZFNA 3ULKA 4BO5A 4GAEA 4OQZA 5G0VA 2IZ0A 1WNTA 1SEVA 3IP1A 3B1KA 1UZMA 4XZ3A 3RFTA 4XX0A 4IJKA 3DL2A 3GRPA 3BTOA 1GUZA 1UP6A 2QQ5A 1Z73A 4PLWA 1DFIA 3S2IA 3FNFA 4TRRA 4AJ2A 1I5RA 1ZCJA 3I3OA 3TQHA 1TB4A 4BUCA 2DFDA 2AXQA 2OP0A 4JQCA 3E6AA 1XEAA 1R12A 4HWKA 1NQAO 1SBYA 3VVBA 4KQXA 3VPHA 4BO2A 1DIRA 3DWFA 4J16A 3MEQA 3TL3A 1G6KA 4WKGA 2CF6A 4A10A 4FS3A 4BNTA 4BGVA 1HZJA 1XYGA 2Q45A 1A4IA 3BMQA 1I3LA 1ZBQA 3G1TA 3GAZA 2WE8A 4ZVVA 3ENNA 2FPPA 4U6SA 4OSOA 2P5UA 1WMBA 2QZ9A 4LCJA 1YQDA 4FFPA 1VSVA 2YJZA 1EQ2A 3I9MA 1D1SA 4J0FA 2Z95A 3TZCA 5I8WA 2JD1A 3RKRA 2EW2A 1PS9A 1BSVA 3OH8A 4D79A 4HFJA 1FK8A 5BQFA 2O50A 3IC5A 4NBWA 4NQZA 4N18A 1O0SA 3L6DA 3PHLA 3BTSA 4LK3A 5JDCA 1X7GA 5ILOA 3JD4A 3GGGA 1EDOA 3LT4A 1QYWA 1GYPA 2VCYA 1U3TA 1HETA 2CNBA 1QP8A 3BHIA 2PNFA 1GR0A 3LT0A 4UUOA 1R15A 2AQHA 3FD8A 1BDBA 3GFGA 3U49A 2C82A 1DIAA 1DHTA 2JL1A 3OJ0A 5DBFA 3TJRA 2H6EA 3SXPA 4I5DA 5FI3A 1T4BA 3RASA 4MOWA 5H83A 3WLEA 4Q3EA 2IXBA 2G76A 2EP7A 4PN3A 4TZTA 4MVJG 2C5AA 2AMFA 3VTFA 4Q39A 2ZKLA 1GDHA 1E1LA 1NM5A 3GZNA 4IQGA 2GCGA 4YWJA 1CEQA 4MVJH 4IMRA 1H5QA 1EBFA 2O2YA 4BKPA 2FPIA 2ZCUA 3ZU2A 1UH5A 1AGNA 4BNGA 4BO4A 4MKXA 1C1XA 2O7SA 1UZLA 1XU9A 2JJYA 3NTOA 1ONPA 4K6FA 4PZCA 1GPDG 5JY6A 1YQXA 3K9QO 4BB5A 5L53A 1M2WA 2VHZA 3BTUA 1PGNA 5DBGA 1WW8A 4P4NA 2I5PO 4HADA 5CEEA 3VVCA 5TIIA 4BNFA 5JXWA 3W8FA 2ZTVA 3C7DB 1J5PA 3C1OA 1YE3A 5BNTA 2O48X 1G1AA 4PLGA 5K6AC 2HLPA 3CMCO 2WDZA 5KJEA 4R41A 1MB4A 1QG6A 4A26A 3VDRA 4HP8A 4R9SA 1M75A 2I99A 3NDRA 3ZWYA 4WECA 3K8ZA 1E5LA 1U8XX 3FPLA 1D8AA 4IPTA 3Q9UA 3JV7A 2FOIA 3NDIA 3DFUA 3FSRA 4Q3AA 2C2YA 3U0BA 3VH3A 2D3TA 2X4GA 1MV8A 1I2CA 4ALNA 2CD9A 1HDCA 3RKUA 5HTOA 4BMVA 5FWNA 3RC2A 3FF4A 3LC2O 3ZHBA 4BV9A 3T7EA 3WWYA 3PLNA 1U4OA 3GMDA 4RQUA 2XF8A 5AXDA 1LBEA 4CL8A 3ZZNA 4QECA 3WFIA 5F1KA 3G3EA 2Y1EA 2ZTUA 4RLHA 4BO9A 4W4TA 5C7IO 2VZ8A 4YBZA 4BOYA 3I5MA 1N7HA 2PD4A 3WTBA 1ADBA 1JTVA 3ZHXA 1BGVA 3VPFA 2VUTA 3GHYA 3GK3A 4FJ1A 1R37A 1NFRA 3D3WB 4CMJA 4JP2A 3KV3O 1G0OA 1R4MB 3L07A 2W90A 3OA2A 4ZGWA 4Q3BA 3OJOA 4Z9XA 3KETA 1UXIA 1MLDA 1TT7A 4OKNA 3H3FA 3QWFA 4EEZA 4ND5A 3TZKA 3HB4X 2Q2QA 3CUKA 4OHUA 1JKFA 1Y81A 1U3VA 1WZEA 4IS3A 4PRKA 3CEAA 5ITWA 2YW9A 3ZU3A 4DREA 5CEFA 4WOKA 5CG2A 1Q2XA 2DT5A 3F47A 4CLDA 2ZYGA 1JKJA 3RFVA 5GZ3A 1PL6A 1YWGO 3ONEA 4OGWA 3W4IA 3ROKA 1DJNA 1VJ1A 2XPCA 3JQBC 1NFFA 1P1HA 3GFBA 2C07A 2X23A 1A7KA 3SJUA 1O8CA 1T2CA 1Z82A 2OHXA 3DHEA 5C37A 1MA0A 2NTNA 1WZIA 1IOLA 1LRKA 1ZKMA 3GN2A 1GY8A 2DFVA 5I8ZA 1XCBA 4CV1A 2GASA 4FGWA 4KUHA 1WPQA 3JQ9A 2BFPA 4YT2A 5EESA 1E3EA 3DZKA 1I36A 2QG4A 3H5AA 5DCUA 3PHJA 2VUSA 1DLIA 4CMCA 3OIDA 1EUZA 2FP4A 1VL6A 3KYBA 3O03A 1IHXA 5ER6A 2D4AA 4W99A 4UVGA 4CM7A 3DZFA 2PY6A 1I32A 4R01A 4TQGA 1BTOA 3AW9A 4JGBA 3VZRA 4BNVA 1V3UA 1X14A 4PLTA 4EI2A 2B4RO 5A04A 5L51A 4DMLA 3FBTA 5DT9A 1M66A 5JBIA 1WDMA 4YR9A 3FTPA 5ICMA 1GTMA 3QY9A 1RJWA 2IEDA 3JQBA 2PGDA 2NTJA 2NU7A 3B20A 1E7RA 4FOOA 4O1MA 1Q0LA 1NWCA 5CDTA 1X1TA 4UEJA 4MVJE 3JTMA 3H9GA 3UW3A 4I9UA 3KEQA 2Y0DA 3SEFA 3OBBA 3ZWNA 2BFOA 2ZB7A 1R0KA 3Q0EA 5JPIA 4GGPA 4GGOA 3F9IA 4KP7A 1H9BA 3ITDA 3QWBA 2VRCD 5A9TA 1PSDA 3UCXA 2D8AA 1BRMA 1A9ZA 1H2BA 4CV2A 2RHRA 1C1DB 5TLSA 1U1IA 5GY7A 1ZK4A 1NQTA 4BMSA 3ANLA 3DXFA 3R1IA 4BO3A 1I10A 3V1TC 5IXSA 2Y93A 3DFZA 3KSZO 1V3TA 3UUWA 3GHHA 2HO5A 3KLPX 2GYYA 1R66A 1XQ6A 2DUUA 3E18A 4GWKA 3NYWA 4IDFA 4KOAA 1KC3A 1UP4A 2G1UA 4PIVA 3Q1LA 4Y9DA 5CG1A 2X9NA 3H65A 1W6UA 4QO8A 5IF3A 3SC4A 1YONA 2IDZA 5KIAA 1N1EA 2P9GA 3DMYA 1N2SA 4JCOA 1I3MA 2W2KB 3TF5A 3RUIA 4XYGA 2AE1A 3MWEB 3MZ0A 3D5TA 4OIMA 3WX0A 4E2WA 2ZB8A 4CUJA 5L4SA 4Z9YA 3JQFC 4DLBA 2UV8A 3DOOA 2VOJA 1E6WA 2YHIA 1U7HA 1K5HA 4U6QA 3IIEA 2GUGA 4R3WA 1NQOA 2VRBA 4YA6A 5J23A 2EW8A 1DPGA 5IXYA 3TOZA 3MJSA 2E48A 3Q3CA 3DOJA 4CUKA 4YPOA 1LQUA 3KXDA 3WQSB 2RH4A 2H5LA 3PGXA 4NR0A 1CIVA 3N74A 4I9HA 5IZCC 1YGYA 4DVJA 3S8MA 4PGFA 1MP0A 1YVEI 4HY3A 1KVUA 3WG9A 3R3SA 3D3WA 3SLKA 3GEGA 4NJMB 1BWSA 1R4MA 2V6MA 1J49A 3Q2KA 5TRTA 3V1YA 5MDHA 2CUKA 1XHLA 1H0KA 2CY0A 4UAGA 2PKQP 3OFSA 1NFQA 2CDBA 1B26A 2C7GA 3NTQA 2OO5A 2YDYA 4AJ1A 3OQ1A 3AY6A 4R16A 4D7AA 4MP6A 4JJGA 4MO2A 2CFCA 1YL6A 4RO0A 1H93A 4CLRB 3H9UA 1S7CA 3WMXA 5EIOA 4D42A 4RF4A 4XB2A 1KYQA 4I08A 4J1QA 5DZSA 3CXRA 5CDUA 1Q0HA 2NU8A 4MVJD 1AE1A 2G5CA 1UUFA 2Y05A 2B69A 4IXTA 1MC4A 4XJTA 4Y6PA 5IZCA 2FMUA 1TXGA 2P4HX 2PTGA 3D1LA 3JQCA 4S1VA 3ICCA 5CPFA 1ZK0A 2Y1GA 3JQ6A 5L3ZA 1U3UA 5TGDA 1FJHA 3M2PA 4NK4A 3VHRA 1HDYA 1ISIA 3R6DA 3FNGA 3TFOA 1HLDA 1SOVA 3WGGA 4RPLA 4RORA 3DOCA 1UXGA 4Q9NA 3G79A 1KEUA 3ANMA 2JAPA 3DO5A 5AVOA 1I30A 1GEGA 2A35A 2BFMA 4E30A 5IN4A 2OFPA 3WXBA 1I2BA 2C54A 4R1UA 1YKFA 3GH3A 3AY3A 3IKTA 3CINA 3ZH2A 3OSUA 1W0CA 2WMDA 3BMOB 3M6IA 4UEKA 2QYSA 2V6FA 3UFXA 4CV0A 4IQ8A 4Y6RA 3PWZA 4XYEA 1GADO 4BQRA 2FY8A 1U7TA 4F6CA 5LDGA 5IG2A 1EK6A 2I76A 3C85A 2VTEA 1T2AA 3BTVA 5A4DA 4Y8VA 1TVEA 1QLHA 2VZ0A 4FC6A 1CWUA 2D5AA 1YB5A 2DPGA 2O3JA 2VHYA 3A28A 1DSSG 3C24A 3PQEA 2PZMA 1K0UA 3CZRA 4NMHA 4NZ9A 4UUMA 3CE6A 3O38A 5JC8A 1TEHA 2I3AA 2ZQZA 3S1LA 1D1TA 1C1DA 5KNLA 3Q6IA 3WIDA 3N58A 1ISJA 4KDEA 3ZNQA 4E4YA 3OJEA 5JAQA 3GUCA 1UXJA 1DIHA 1T2DA 2X7HA 1ZJYA 4XRRA 1ZMOA 1SB9A 4GKVA 1ZXLA 3JQAD 2GERA 4DYDA 4XDZA 3JD3A 4NBVA 3GLQA 2PD3A 1AXEA 2W4QA 1IL0A 5T64A 1Q7GA 2W2KA 4BL5A 2NVUA 3I83A 4TZKA 6LDHA 3GR6A 2D2IA 1VL0A 3GY0A 5F21A 1ZO8A 5T6BA 3ZWVA 2AG8A 3HDJA 1U2DA 1X0XA 5BNFA 2CVZA 4Y98A 1WMAA 5COBA 1CQJA 1ENPA 1KY4A 3HN2A 5HA5A 1ADFA 2H63A 4IIVA 4WCFB 5L4NA 3PHHA 3UHAA 3PI7A 4L4SA 4NK5A 5CDSA 2UUPA 4AJNA 5ENVA 1E92A 5TJHA 3L6EA 4XCVA 1NPDA 1ONOA 1RWBA 4QX6A 1UDCA 3WSVA 5ER9A 4OMUA 2DBVO 3MJEA 1PR3A 3H2SA 5I9MA 1LSOA 5KVSA 1NTOA 4NJMA 1HEUA 1HLPA 5TSDA 5BSHA 3RI3A 4HFRA 3AI2A 2FRDA 4GVXA 4EJMA 4BNKA 5ICSA 2BELA 3ST7A 3QLJA 1IPEA 3ETDA 2OZPA 2F00A 3IJPA 1VE9A 4JN6B 2OBYA 1GV1A 1PQWA 1Y9AA 3HHPA 3V8BA 1NX6A 1NAHA 1GUFA 4NHEA 3HG7A 1R4NB 3HADA 4CLRA 2G17A 1AN9A 4RF3A 1Q7BA 2EG9A 4KTTE 4RGBA 3ROQA 2J5KA 1QSGA 2POQX 5BSGA 3OJLA 1DIGA 3WLFA 2D59A 4J2HA 4U8GA 5CAEA 4LMPA 4K28A 1F14A 4LW8A 3PGJA 1E1MA 2HMSA 2R00A 3JYNA 3G49A 4YT4A 3FNEA 2WEKA 2VRCA 1ZIDA 4X54A 2ZCVA 4WK6A 3DAGA 3H9QA 3I9KA 4H7PA 3D0OA 4R69A 1GZ3A 4IZIA 4UVIA 1LX6A 2AQIA 1Y8QB 3RUHA 5A05A 2BFAA 2PD6A 3OP4A 4CMGA 1HSZA 3OIFA 3AY7A 4B8WA 3AOEA 2VYVA 1EVYA 1NPTO 2Z1MA 2EKQA 5ADHA 3ZWMA 3JQAB 2X5OA 1LDMA 3PJDA 4PLZA 2HMVA 5U4QA 3K96A 1YBVA 4NBRA 5JCXA 5JW6A 1AHHA 3IKVA 1R16A 1T2EA 3HDYA 1C0PA 5ES3A 3IUPA 4AICA 2PH5A 4J6FA 1YL5A 2NNLD 2AEFA 3NRCA 5TT1A 1XWFA 3DAFA 4FCCA 3BMOA 1AXGA 2Q1SA 1ULSA 2PR2A 3I6IA 4JIGA 2WM3A 3RUFA 1P1KA 4CM1A 2E4AA 4J0EA 3QJ5A 3GAFA 2JHGA 2O23A 2B36A 4Q3DA 4J1NA 3LT2A 3K30A 3DZIA 4Q3NA 2GD1O 1K3TA 4BMNA 4WLFA 4BNIA 1PGPA 1XDWA 3PFWO 4HXYA 1N9GA 2AG5A 3WWZA 4D3FA 3U5TA 4F45A 1X13A 1IZ0A 1H94A 5TQVA 1Q1NA 4TRMA 2GR9A 5JYEA 5H82A 3LSYA 1I2ZA 3NT2A 1I01A 2GN6A 4BO7A 1WWKA 3BAZA 2X5JO 4BB6A 4QEDA 4YRAA 3GDGA 4L75A 4NH4A 3PDUA 1PQPA 5HS4A 1ZW1A 1HSOA 3WGHA 3F3SA 4J4HA 3DONA 4WNCA 2P9EA 4MIEA 5F1OA 1PU2A 1TT5B 3C7AA 3I6QA 3IOYA 4FQ8A 2DKNA 1OMOA 4RJTA 3NV9A 2QRKA 4ND1A 5DOZA 3S2GA 1LDBA 3LZ6A 4J43A 4CM6A 3O8QB 1PS8A 4PLFA 2R2GA 1CYDA 2Q1UA 3OIGA 3C1TA 1H6AA 4DL9A 2A94A 3T4XA 4MVJA 3MJVA 3KM0A 3KBOA 3LF2A 2JAHA 1MUUA 4OQYA 4BO1A 2P4QA 5G0SA 2VN8A 1QV6A 2BKAA 4HV4A 1VKOA 2D5CA 4D3DA 4IMPA 1DIBA 3E03A 3O9ZA 1FF9A 1QRRA 4CMEA 3PQDA 3HWRA 5C7LO 5HWSA 4CPDA 3E8XA 3WYCA 4E2ZA 5IDWA 3D4NA 3H6KA 1LJ8A 5JDCC 2BHLA 4GWGA 2EJWA 1EVJA 4H16A 3MJ4A 3K73O 3FWNA 2RHCA 3AM3A 1GZ6A 3RBXA 1VM6A 3E9NA 3HN7A 4JX8A 2GSDA 1LRLA 3ZHYA 2X0RA 4MIOA 3A4VA 3JQ8B 3GEDA 5AXBA 3DEYX 5ILGA 1KVSA 4ZU3A 4DWVA 1KERA 1R4NA 3S2FA 2EEZA 4CJXA 4ESOA 3GMSA 3HSKA 4TKMA 2VWGA 1A27A 4Z0TA 5EINA 1HYGA 1LLDA 1ORRA 3ZW8A 3QVOA 2AW5A 3KZVA 1U28A 2J5RA 4JP3A 4PG5A 4PZDA 5I7VA 3UCEA 1YOVA 1B8PA 2VTDA 4XIJA 3VH4A 4YT8A 3F46A 4KWHA 4E5MA 2X0JA 1MFZA 4P22A 4L8VA 3G1UA 1NVTA 4M1QA 3ZN2A 4WOJA 3GVXA 2Y99A 4HX5A 5B12A 1P1JA 3E1KA 4WASA 2DVMA 4FGSA 1R0SA 1V35A 4C7KA 1Y8QA 3ROPA 1X7DA 3SBOA 1ISHA 1NPYA 2PKRA 3WNVA 1DOHA 3PP8A 4M89A 1B8VA 1N1GA 3JQAA 4I5FA 2EXXA 3PWSA 2EGHA 5KJ6A 4YYZA 1L7EA 4FDAA 1DB3A 1ONNA 4NFYA 1HDGO 1KEVA 4DIFA 4S3MA 1E6EA 2BD0A 4DC0A 3WYBA 3VAZA 1U2GA 2EGGA 4LGVA 1KEWA 4IDEA 1W8DA 3PK0A 3F1KA 3K6JA 4FFRA 1GQYA 4XQCA 2VUUA 3H8VA 4KZPA 3JYOA 4N5LA 3NTRA 1IY8A 3B1JA 3INGA 5A3VA 5A5EA 5JMWA 1NHWA 1E3WA 5MGBA 2EWMA 2DTXA 3GG9A 4YAKA 2UDPA 4AJEA 2FR8A 4PG6A 3EZYA 4BO8A 3ZWBA 2O2SA 3ABIA 8LDHA 1GFSA 3QP9A 3FTNA 4UVHA 3AFNA 4UUNA 1O95A 5JNLA 5CEJA 1GCUA 2LDBA 4B79A 1DXYA 3KHUA 2H9IA 8ADHA 2GLXA 1SEPA 2RBEA 1BHSA 2X6TA 3WIEA 3EAGA 1QV7A 3ZWPA 5EQFA 3A1NA 2YV3A 3IUSA 4R9RA 4BQPA 3ZI0A 3DAPA 3ETGA 3U62A 4CUZA 3QV1A 1TT5A 3RJ9A 1LXCA 3CZMA 4WEOA 5DBIA 1FDSA 1K6XA 1E3LA 4NU6A 1EUCA 3VZPA 2EJVA 3O8QA 1JLLA 5TNXA 4E5YA 2EIHA 2HMTA 1ZSNA 1JW9B 2Q3EA 4NBUA 4Z9FA 2XXBA 3RUCA 4IY1A 2I9PA 3MTGA 4Y6SA 2NSDA 1T1RA 1YBAA 4YQZA 3WBBA 1Y5RA 4B3IA 2VNAA 3LDHA 4LCEA 2C20A 3AM4A 1PGOA 3QQPA 4N7RA 2JFFA 1X0VA 5COAA 3TZHA 4XGIA 2IEBA 3A14A 2YHUA 1DC5A 1E7MA 2YDXA 2HK7A 4AG3A 3QVWA 1GU7A 1YRLA 3QVXA 2O7QA 4IDCA 2NVBA 3I4FA 1YH3A 2NADA 3JQ9C 1PR9A 4YRBA 2EHDA 3VKUA 3ONFA 3IAHA 1ENZA 3F4BA 5DDIP 3FNHA 4OL9A 1DFGA 3I23A 5C7OO 4RPKA 5F5LA 4BGEA 2E49A 2GO1A 2HDHA 1ID1A 1KVQA 1O9BA 3MOIA 4JJIA 4AJKA 1F8GA 3ROMA 2BGLA 4U5QA 1ZSYA 3I9JA 4OXNA 1J0XO 1YS4A 1E7WA 2NUAA 1VI2A 2AHRA 4ITUA 4C7JA 4D43A 2HJSA 4J1SA 4RDIA 3UF0A 1X15A 1XG5A 1A5ZA 1KBZA 4M55A 4W7HA 3ZGYA 5L95A 1N7GA 3KOUA 1HL3A 3PJFA 3VPGA 5KWEA 1G0NA 1K6JA 1OAAA 5TT0A 3CMMA 5BT9A 3AUTA 1ADCA 2J3KA 3PYXA 1JAXA 1T1SA 1XKQA 4WJZA 1EE9A 2OUIA 4YVFA 3CPSA 3KTDA 4R3NA 3SX2A 2FSSA 3E5MA 4BKQA 2YUTA 2O3TA 3BMCB 2UVDA 3DR3A 5L7WA 2BRUA 3E48A 1A9YA 1P0FA 4URFA 3DBLB 1GCOA 2WYUA 5JE8A 1OFGA 3RAJA 1FDUA 2V7PA 2BH9A 1GL3A 3UICA 2BGMA 3H5NA 1LRJA 1YJ8A 4BO6A 5THKA 3ZWXA 2RAFA 1DDOA 1WLYA 2R6JA 1ISMA 3W8EA 2I67A 4DMMA 4FB5A 3OQ6A 1TA4A 3DZJA 1ENOA 5ITVA 2P5YA 2ZB3A 2X22A 3SC6A 4GX0A 3NT4A 4MDHA 4TKLA 2O3SA 4IDBA 1PQUA 5G4KB 1IULA 4EGFA 1F12A 1EVIA 3PQFA 2VHXA 3GGPA 1RKXA 2FR1A 1LC3A 4R1NA 5IAAA 5JS6A 4HKTA 4PLYA 4CMBA 3LYLA 3HB5X 3X2FA 4DQVA 1PWXA 4FSHA 5IZ4A 1B0AA 2AQ8A 4W9NC 1E6UA 3ENKA 3KSDO 1HXHA 4MKRA 2Y66A 1GV0A 3DMTA 3F4LA 3U4HA 3LF1A 5AQ1A 5U1PA 2F1KA 3NT5A 1CQIA 1TI7A 5JO9A 2QRJA 3O26A 4CR6A 5KJ1A 3E9QA 1DFHA 4CLXA 3D4OA 1A4UA 3WGIA 1D7OA 3GVHA 4CM5A 2V6BA 2JD0A 1WXDA 3GT0A 2OOSA 5LC1A 5G0UA 3TNLA 3PTZA 1QXSA 4WE3A 4L9RA 3R0IA 4PLCA 4R1SA 4I9NA 2NQTA 3ZNPA 2YY7A 3KVOA 3SVTA 3QRWA 4N54A 2EV9A 4YEDA 3E82A 1O5IA 2GNAA 5IDYA 1ZZEA 4NG5A 1HE3A 2LDXA 2C59A 2VQ3A 3D5QA 4ROSA 3W6UA 2OGUA 2PZLA 3AJRA 4Z0PA 4BHTA 3HDQA 4XQ9A 2PFGA 5AXAA 3VZSA 4ND2A 1MG0A 1JWAB 4W9NA 4QXMA 3ZU5A 3L77A 4D3SA 4P38A 4IS2A 5G0WA 5JSFA 3PYLA 1RM0A 2BMAA 3E5RA 4MPDA 1LDGA 3DTTA 1R6DA 1JVSA 3RIHA 1D4FA 1B3RA 3HQ4O 1DRVA 1VSUA 5I9LA 4J91A 3WYEA 4DBZA 3PDJA 1SNYA 3H2ZA 4DUPA 3ZDFA 4GSLA 4FBGA 1OZAA 1YBMA 1YQGA 3U4IA 4I1IA 1QR6A 3WR5A 9LDBA 2YFQA 4GX2A 3H4VA 3GPIA 3KRTA 4KUEA 3KYCB 1H6CA 3EYWA 4J90A 1SCUA 1P0CA 1Y5MA 3JYPA 1BXKA 2Q50A 2ZJ1A 4RCVA 1HE4A 3LVFO 4R1TA 4BNJA 3K2EA 3DZGA 3M1LA 4YAGA 1GD1O 1C0LA 3ETEA 3TZQA 4E33A 1I3NA 1EK5A 2EP5A 3IP3A 3C8MA 3AU9A 3WQQA 4IIUA 1CDOA 1F8FA 2ZJ0A 2PGLA 2X0NA 3NJ8A 4CMHA 3GVPA 1A71A 4B7UA 4GVLA 4N5NA 2I66A 3AOGA 3DBHB 2W8ZA 4MP3A 4WCDA 5CDYA 4G5HA 4YQYA 4XEHA 1P1IA 3B6ZA 4ALMA 3NGXA 1ZVMA 4GMGA 3DBLA 4CV3A 2B35A 4QO7A 3ZCXA 1P1FA 3FCOA 3PWKA 3PJEA 1ZUD1 3JCZA 4J4BA 4B4OA 1BVUA 4E21A 3KLMX 4OH1A 2AEMA 4L76A 4TMFA 4ZQHA 5KKCA 1I0ZA 1EMDA 4A5OA 3AM5A 5B4UA 4PLVA 4J49A 3WDSA 1Y1PA 1PGQA 3M1AA 1SO8A 1S6YA 3FI9A 4EJ6A 4ALKA 5JDIA 1IPFA 3ZWWA 2PWZA 2IZ1A 4FIZA 1NHGA 2EKLA 4I5GA 4ZA2A 1FXSA 3GN1A 2Q4EA 3DZBA 4JROA 1PZGA 3QVTA 7MDHA 3VC7A 3I9NA 5DNAA 4M87A 2DU8A 1HRDA 4R5MA 2DLDA 2P91A 4FPXA 3M2TA 2C29D 2ET6A 2AEJA 2A4KA 4LVCA 1MFPA 3WGTA 4XIYA 3N7UA 4L74A 4GLLA 3TSCA 1XIVA 1JU9A 3HZZA 4AJHA 4BNNA 4E13A 1YB4A 4RVDA 4IQ0A 3TDKA 3EHEA 1O6ZA 4D0SA 1OOEA 1P31A 3RUEA 4NDNE 4E5NA 2B4TO 3AUAA 2GDZA 4ZICA 2DUWA 3QHAA 1QYCA 3GA0A 4U7WA 2HU2A 3RVDA 1OBFO 3RWBA 1TLTA 2P2SA 3ZHZA 1D3AA 4F3YA 5A9RA 3Q2IA 4PCVA 1B2LA 3GVIA 1DJQA 1VLLA 1ZMTA 4W6ZA 2C7VA 2OP1A 3TZ6A 3W4JA 2HQ1A 2YV1A 1HKUA 5GZ6A 3MWDB 1UAGA 4FW8A 3U4DA 1IB6A 5B4VA 1YJQA 1QYDA 5DP1A 2Q1TA 4N5MA 2NACA 3OA0A 4YJFB 2XOXA 4ZRMA 1U8FO 2J3JA 1PEDA 1P44A 4NU5A 4P8RA 2UYYA 3AFMA 3H5RA 4YDRA 2R00C 4E2YA 3EC7A 4K1LA 4NFHA 3AUUA 2OL4A 2OXIA 5L7TA 4P4GA 3SLGA 4RZIA 3V5NA 4IDGA 2QW8A 2X1HA 3BHMA 1SC6A 4FOSA 2YV2A 3EW7A 4HFMA 1NVGA 3VPSA 1E0DA 1DC6A 2VYND 2DBQA 2YYYA 4EJ0A 5IDQA 3AOEC 4YAJA 1LA2A 1ZK2A 1V0JA 3KYCA 3P2YA 4K26A 4RVGA 3RQSA 2Q2WA 3G0OA 1LDNA 1GPJA 2QZZA 5T57A 1SPXA 5TX7A 1EFLA 3PYMA 1LSJA 1HDXA 3CKYA 3EY4A 1T2FA 3OEWA 1YB1A 2CVOA 3NGLA 2H1SA 4BNYA 2EF1A 5AYVA 4WLOA 1XGKA 1MXHA 4R51A 4PZEA 4CL3A 1IUKA 1BDMA 4MIYA 5HM8A 1ADGA 4IGEA 3WOHA 4CLHA 1DRWA 4PVCA 3BA1A 2DC1A 4FJ2A 4XRGA 2Y0CA 1CJCA 3ANNA 5TC4A 1I33A 2FSVA 1MG5A 4D0RA 3DBHA 2Z1NA 4R68A 1SZJG 2FN7A 5EERA 4RQTA 3WSWA 4RV9A 2Y0EA 4WPGA 5T67A 2DAPA 3AI3A 4LMRA 4MINA 1B14A 1W4ZA 4YTEA 1MGOA 1LDYA 4CM4B 2B83A 1E1KA 4QFDA 1NR7A 4IDAA 3JQGB 5A1TA 3JQDA 4GL4A 3EMKA 2C5EA 4YAEA 2NTVA 2PGJA 4J7XA 1AHIA 3L9WA 3PRJA 4CQMD 1XSEA 3ZNOA 2AA3A 2JKVA 2FWMX 2GZ1A 3I1JA 5BSEA 4DRYA 5JCJD 3WMWA 5FF9A 3PPIA 4H3VA 1SMKA 1LSSA 3VTZA 4ZN6A 3P2OA 2AQKA 5JAZA 2CDAA 4WLUA 4YACA 4W82A 4DTIA 2HSDA 4NPCA 1ZJZA 3U3XA 5L45A 3HJAA 4L73A 1EQUA 1M67A 3KB6A 4OSPA 1E1NA 5TS3A 1X1EA 4BKOA 3VPXA 4Z6KA 4A73A 3AWDA 1XU7A 3H3JA 2BI7A 4WCFC 4TRJA 1Z6ZA 5A02A 4LRSB 5T8KC 1RYEA 1EFKA 4QQRA 4EDFA 4D46A 3JD0A 3RC9A 1Q7CA 2NU6A 5L7YA 2D0IA 1LC0A 2QRLA 3DC2A 1ZXBA 3GZNB 3ZV6A 4CMEC 3OMLA 4XYBA 2YFHA 2DPHA 1LQTA 1XELA 4LISA 4XWYA 4AJJA 4CM9D 1T4DA 4B7XA 4GH5A 1QYVA 4JJFA 3W6ZA 1SAYA 4HNHA 4YJHB 3U4CA 5KVVA 5DP2A 4ZQFA 1N5DA 3UKOA 3DZHA 4YJGB 1KEPA 4ZQBA 1L1FA 2NLOA 4O5OA 4PVDA 1HWYA 1ML3A 3LU1A 4A0SA 1XR3A 2Y1DA 1I3KA 2JCYA 3AI1A 4RVSA 1NYTA 5IFLA 4NNJA 4WCFA 5T8KA 3S2EA 4YJFA 4B8ZA 1JWBB 3AK4A 2DBZA 4FD3A 3WJAA 3W4KA 5CPBA 1CERA 4L4XA 1P45A 2DTEA 3DBVO 4GI2A 4II2A 3ZV3A 3LK7A 2E82A 4BNHA 1E7SA 4XB1A 3LLSA 3MTJA 3QWIA 4UULA 1VJ0A 3KSUA 3BMNB 3PZRA 2O3QA 3OF2A 1HDOA 1KVRA 1NAIA 5DCWA 5CP8A 1P77A 2HRZA 4D44A 3WQRA 4CLOB 4E3ZA 1X7HA 1T25A 2NQ8A 3LQFA 3UOGA 3VZQA 2WJPA 2I3GA 4CQMB 2NWQA 3Q9NA 5KVCA 1C14A 3BXXA 2X8LA 3FN4A 4IUYA 4KMSA 1QYXA 1RYDA 3A9WA 1IHYA 4DBVO 3JSAA 2B0JA 5FFFA 1J4AA 4BKRA 4PRLA 1PWZA 3KO8A 5A06A 2DBRA 1SOWA 2JHFA 4W7IA 4XR9A 2Y67A 3GOHA 4II3A 3NEPX 2WYVA 3PLRA 1HYEA 5KKAA 3RROA 4ZJUA 1UJMA 3EGOA 4G65A 4KWIA 3L6OO 4HFNA 5L4LA 3GVCA 4RF5A 1B3BA 5EQDA 4E32A 3HNPA 1PL7A 4AJ4A 1PJ4A 1NBOA 3K31A 3WGQA 2BF7A 3ZWAA 1BMDA 4DC1A 3DHYA 2A9FA 5G2OA 4J4TA 4CM4A 5JY1A 3DHNA 1PS0A 3DTYA 2CVQA 1RM4A 3JQGA 3PXXA 4GLOA 5DOVA 1E3IA 4IGFA 5JAIA 5IJZA 1FMCA 1Y6JA 1Y7TA 3OM9A 4EBFA 4MVJP 4E5KA 3WICA 4WNIA 1PJSA 3KEOA 3JYQA 3VH1A 2JCXA 1UAYA 2PA3A 1UDBA 4Y67A 1MX3A 2ZTLA 4CQLB 4QT0A 5CDGA 2X5KO 4MVJM 3W8DA 3I52A 4J9VA 4XA8A 5BNIA 3UAGA 1M76A 3TFQA 3IQDB 5F1PA 4BGUA 4OM8A 4NI5A 3PZBA 5LDHA 1DLJA 4MJLA 4RL6A 2QHXA 3MJTA 3K5PA 4FFNA 3JD2A 3TN7A 3U9LA 4QFCA 1EBUA 1OI7A 4K6CA 2DTDA 4E5PA 4O59O 5KTKA 3IDSA 1NASA 4RPHA 2WTBA 2JFGA 4ZHSA 4F46A 3WFJA 5A03A 4FJ0A 4BNWA 4J7CA 3EDMA 1IE3A 4FC7A 4G81A 4LSMA 4IINA 4ONEA 3WNQA 2ZYAA 4GPD1 3KYDB 2IZZA 4H15A 1EZ4A 2Q46A 2VYNA 1KOLA 3CSDA 1GUYA 2O4UX 1PJ2A 1LLUA 3ASVA 3EVNA 4AJLA 1PZEA 3ICPA 1GZ4A 5FEUA 1YXMA 2GRAA 1MXFA 2OBNA 4M54A 4YJHA 3PVZA 3WJ7A 2Q49A 4RLSA 4YJGA 1U5AA 3FR8A 1JN0A 3F5SA 1HT0A 4EUFA 4K9DA 1PJLA 2NVWA 3IMFA 3NJ4A 5EMHA 3L4BC 1RM3A 4NFSA 4EW6A 4JLWA 3ZV4A 5KOIA 4JK3A 3ZV5A 1B16A 4AFNA 3QWHA 4J7UA 5BSFA 1UXKA 4XJSA 5DCYA 4UVDA 1V6AA 1Z74A 2HRBA 1B8UA 3KUXA 1PJTA 3EZLA 5EL0A 3C1AA 2BI8A 1ZH8A 1C3VA 1K89A 3BMNA 5COQA 1LEHA 1RPNA 4UEOA 4F6LA 4NIMA 4A7PA 2YHIB 1DO8A 3PIIA 4E12A 4DXHA 2QX7A 3INTA 5AXCA 5K0ZA 1E7QA 1LNQA 4CLOA 4CODB 4CQMA 2CSUA 4PG7A 3RBZA 4ALLA 2EKPA 4R54A 1EEHA 4CM8B 4TROA 5JCJA 1LU9A 3JQ8A 3MJCA 1M6HA 2WD8A 3I9LA 3L4BA 3F6YA 4PFJA 4BKUA 1PJ3A 2PZKA 2X86A 3GF4A 4YXFA 9LDTA 2GZ3A 5K6AA 1LTHR 3STHA 2JFHA 3PHGA 3UVEA 4JNKA 1O89A 3COSA 3Q11A 3RFXA 2WSBA 4RDHA 1P3DA 7ADHA 4CMAA 1I24A 3LC7O 4B3HA 5B4TA 2PKQO 4DQUA 5H81A 1NWHA 3DDNA 3H7AA 5BR7A 1HTBA 2B5WA 5LCXA 4DPKA 5KJCA 3EVTA 3WGYA 2VT3A 4J9UE 5JO0A 3DMTC 4MP8A 2XAAA 3OJFA 4IDDA 3NX4A 5KJFA 1WVGA 4BVAA 1E3SA 1HDRA 1LI4A 2O3UA 3I4CA 3EUWA 1P74A 4FR5A 4PLPA 5EPOA 4KTVE 3FWZA 1MC5A 4UVEA 1ISGA 1Y8RB 2V65A 4JBIA 3PJGA 4FFLA 4WLNA 5JLAA 4CM9A 3ITKA 4OYRA 4A2CA 3MOGA 1CETA 3MCVA 1U3WA 3CTMA 3DB2A 3NKLA 2ZIZA 1PL8A 1F17A 4ALIA 1HZZA 1LSUA 1UXHA 1ENYA 4KDFA 3WBFA 2HJRA 1E77A 3RBVA 3QSGA 4CMIB 3GDOA 4CQLA 1PZFA 2PH3A 4HUJA 5CHEA 1JDJA 4PLHA 3O4RA 3DBRB 3RCBA 5C5IA 2GGSA 1ZEMA 2X58A 3QVSA 3V1UA 4OOFA 3D7LA 4E6PA 2Y1FA 3GGOA 4TRNA 2GF2A 2JCVA 4I5EA 4LN1A 1L7DA 1WAMA 4MVJI 4M49A 4GBJA 3L0DA 3RU9A 5DF1A 4TVBA 4CR7A 4DA9A 1XQ1A 4CMKA 1BG6A 1C0KA 3ADOA 5JYDA 2W2LD 3GQVA 1Z7BA 4IM7A 1P1RA 4E0BA 2GZ2A 3OICA 2GPTA 3KYDA 2P68A 1C0IA 4ALJA 3BHJA 5JAMA 4ND4A 2PK3A 2YQ5A 5I7FA 5B37A 4KQWA 3P7MA 1DC4A 3JQEA 3WGOA 1HDZA 5U9CA 2DQ4A 2FHSA 2IODA 2AE2A 1HYHA 5AOVA 1NQ5A 3VH2A 3X2EA 4BNLA 1XLTA 2IXAA 1UDAA 3UN1A 5JMPA 1P33A 3AUSA 4L4RA 3UH1A 5HRUA 3GG2A 4GSKA 3P5SA 2VOEA 2NM0A 1PJCA 1CRWG 4OAQA 4OJNA 2ZATA 4ZQEA 2VYVD 4DLLA 2WD7B 2WYWA 4HBGA 4LSWA 2WE7A 1F0YA 1ZK3A 3CIFA 3WTCA 3L4SO 3H9JA 2VWPA 4WUVA 4ZD6A 4YT5A 3HDHA 3R3JA 3I9OA 2VNSA 5CFZA 4EUEA 4YCAA 2DM6A 2NVUB 3NDJA 4QTZA 1ZK1A 4GX5A 4BNMA 1OC4A 1O94A 1H9AA 4D41A 3OECA 3NAQA 1PJBA 2J6IA 1N8KA 4XDYA 4ZRNA 4IBOA 3JD1A 5IDXA 1E5QA 5T5QA 1A7AA 1VPDA 2OORA 2SCUA 2OMEA 3D4PA 4CM8A 1FDVA 4ID9A 3RUDA 5I7SA 3PIDA 4O0LA 3D64A 5G4LA 2VHVA 3RU7A 1R0LA 1BVRA 5C3MA 1U9JA 5DULA 4M8SA 3WB9A 4RPGA 4DGSA 3LT1A 1Z75A 4U0JA 5JDIC 5THQA 1EE2A 4DLAA 2Q99A 1KY5A 3HE3A 6ADHA 3TWOA 3E9MA 5ENDA 3P19A 1B15A 3RUAA 4ZQGA 4Z3DA 1AUPA 1HF3A 4IXWA 5L9AA 1NP3A 3GDFA 2HMUA 2UUOA 1SB8A 2J3HA 4JBGA 1H2HA 2J3IA 3BMCA 3WS7A 4O63O 1BW9B 1YL7A 3JQFA 2HAEA 4E2XA 4XD2A 2X9GA 3QIVA 2QIOA 3CH6A 2O3RA 4GQAA 2NU9A 2Y1OA 3PHIA 2ZK7A 3V2HA 1K6IA 2PLAA 5IN5A 4EEXA 1UP7A 3U09A 1Y8RA 4NBTA 1A72A 3AU8A 1PZHA 1U4SA 1WDKA 4MVJF 2X9VA 4O6VA 4Z0HO 2RIRA 3GNQA 4CR8A 2VHWA 3RC1A 4EYEA 5K9ZA 2BGKA 1DHRA 3RD5A 1ULUA 5JC1A 1UZNA 1ZSVA 2CZCA 1NNUA 2HUNA 5G4KA 4CMIA 3EK2A 4UUPA 3TRIA 2Y68A 3LC1O 3DBRA 2CF5A 2E6UX 1CF2O 4YJDA 1IZ9A 1DBVO 1K2WA 4CM3A 3C7CB 4AJIA 3GNSA 3JQ7B 3PFFA 4BNXA 3TOXA 3RC7A 2Q4BA 3F5QA 1FDTA 5A9SB 1JVBA 4OOEA 5DN9A 5EN4A 2C0CA 4B3JA 1KS9A 1KIFA 3WGZA 1QMGA 3FRJA 3VOSA 2B4QA 1PTJA 4RPJA 5GMOA 4D45A 1EUDA 5TJ9A 4JXKA 1PJQA 4EZBA 2P9CA 3ORFA 3ZU4A 2VT2A 3ZNNA 4YB8A 1BXGB 2Y1CA 1V9LA 5L40A 4ILKA 4WLEA 3NUGA 5FI5A 5JFOA 1QORA 4I8XA 2E37A 5TF4A 3ZWOA 3GUYA 3K2BA 3UGKA 3T4EA 2IYPA 5KVQA 3GC6A 3UXYA 1GYRA 3IJRA 4AL4A 1N9GB 1ISFA 1YDWA 3IS3A 1Z7EA 4IJUA 1NR1A 3UCFA 3QA9A 1ZEJA 5A3JA 2VZ9A 1N92A 2JD2A 2QYTA 3OQBA 3VKVA 3DQPA 3TPCA 1WDLA 1GQ2A 2WD7A 4KUGA 2CMDA 2Q1WA 4GX1A 3BYZA 4GMFA 4YRDA 4EITA 2J8ZA 2EERA 1WP4A 1LUAA 2HCTA 2G82A 1GYQA 1OC2A 2YQ4A 3ZWCA 1LLQA 4PG8A 4B7CA 3GEMA 1GEEA 1M6WA 3B1FA 4J2OA 1P9LA 4HNGA 5F5NA 2FPGA 1EVZA 1Q0QA 1KETA
chains in the Genus database with same CATH superfamily
4XQEA 3U7FB 1ETWA 5DK6A 1IYZA 4A27A 2RD2A 1DAOA 2A92A 1NVMB 3PIOF 4EY4A 4C76A 1Y9EA 4FN4A 3C8DA 3D3EA 3K1PA 2JIPA 4CYMA 1A3CA 4CVNA 4G9GA 3CVXA 4IRUB 1SRRA 1XVVA 2ZVPX 1OCOH 3TZBA 5D6OA 2E2JJ 1Q57A 4NRDA 4Q4HB 3T1YB 4BNZA 1C3OA 4TMYA 2FW8A 4GKBA 3P27A 5AJYA 3OHSX 3T7CA 5E8JA 5F51A 3Q40A 4OI4A 2ZYDA 5IP5A 1EDZA 2RAEA 3VOTA 2R6ZA 2WOOA 1Q1EA 3GLHA 2OGZA 3L0SA 4RAZA 3HH8A 1PVEA 3A06A 3P9YA 4U0KA 1PN3A 3GNTA 5JMOA 3N8GA 4PBSA 4CN9A 1W1UA 2BTQB 2JDIA 4ZARA 4IJQA 2X3FA 1PLLA 3IMGA 1G8KA 4MDYA 1Z0XA 5A2QZ 3PJRA 2YIVX 4I2OA 2NT4A 3ND5A 3IRQA 2VQCA 3V2UA 2WV1A 1ECPA 2X0IA 3EFEA 4BIIA 3KVYA 4YALA 2HVRA 1U80A 3V8QA 3KK0A 2FDRA 2FW1A 4BYGA 2V7VA 2R7XA 1JTEA 1ZFNA 4BO5A 2HOAA 1OLSB 4RFLA 4Y13A 4S05A 2COBA 3WJ2A 4TTTS 1HDPA 3SHQA 2P2GA 3B82A 4OHXA 1UEXC 1G38A 2WFLA 3FM3A 2ID4A 1QU2A 4DADA 3S2IA 4O08A 4M8KA 2NZUG 2BKLA 2VDMB 1T4GA 4FBLA 2VJAA 1CY0A 1U2PA 4LWOA 1TF7A 4FS3A 4LG0B 2QZ9A 4ISCA 5I4KA 4KXUA 3EGWA 3IP8A 3ECSA 1QUEA 4ID3A 3I9MA 3ASNH 2BV3A 3O75A 1EX6A 2XCIA 3W5CA 3T1HB 4NG4A 4RK1A 1VXOA 5DGXA 2ONYA 2ODAA 1EDOA 1AUVA 3RTRA 4L85A 1FFYA 1DGRM 1KONA 1K7YA 3O8CA 3N75A 4MLCA 4C4RA 1T4BA 2IXBA 1WXWA 3WGJA 4MDFA 1BJZA 4IQGA 3P0HA 2IOQA 3CMAI 5JPCA 3TLZA 3DCYA 2JLYA 2ZCUA 1D07A 1LPAB 1UH5A 5LP6C 2BEWA 2AOVA 5CA0A 2ZCJA 1DT5A 2VHZA 4F4DA 5ELXA 5FD5A 1BFKA 3A4MA 5JXWA 1J5PA 5K6AC 3FIJA 5JZVA 1M75A 2K02A 4Q1EA 2ISZA 3D31A 1D8AA 3ZCUA 3DGEC 3U0BA 3U81A 3AFGA 4H2DA 5IVIA 2FUEA 1ULTA 4MJXA 5HZHA 1HYBA 4HSGA 2YXNA 4ADSG 3WFIA 2Y1EA 1CF7B 2H1VA 2G9WA 4DIKA 2WFAA 4M38A 5LQSA 1M5UA 2TS1A 3B3JA 1G0OA 4FMDB 2BY0A 4DYQA 3H3FA 2FBIA 3NHUA 1KZYC 4PRKA 4IS3A 4ZVQA 2WVJA 2MLGA 3MUEA 3OM1A 4BKXA 4KK3A 1NLFA 1QIGA 5JI6A 2XMCA 3HXQA 1WZIA 3S99A 1YQQA 2MD5A 3QFTA 3GDWA 2I3DA 1J42A 2EQBA 4Q9LA 2FSHA 5AESA 1YDGA 2A6TA 1EM8B 2WMNB 3B1YA 4CM7A 2GHRA 4R01A 5DX1A 4UTOA 3QYPA 4LYHA 4PLTA 2IBMA 1Q7EA 3D0SA 3B36A 2ZCWA 5DT9A 1ETYA 2IA0A 2QVBA 3CCEI 1WDMA 5ICMA 2FNAA 1SKBA 2IEDA 3JR3A 2PGDA 1ORDA 3LQKA 4ZYTA 2CLFB 3JTMA 3I42A 2QN9A 2ZB7A 2KL4A 2VC1A 3CJRB 5FOVA 1N4AA 3GHHA 3K0AB 2E1CA 5LA6A 1T10A 5DTJA 1NXVA 3AZOA 2AUTA 2E5WA 4IIEA 2HC9A 4C3OB 1Q1VA 1H5UA 4QFBA 4IEEA 4FI3C 3FLBA 2BBYA 1E6WA 4WKPA 1FYEA 4D7MA 4WWCA 2W22A 2XKOA 4DMHA 4LPSA 2JF0A 1YRBA 4I9HA 1OAOC 3S8MA 4FCTA 1MP0A 1ZUHA 1WKMA 2C2GA 2R7DA 1BWSA 4CI9A 1XHLA 2ZIXA 4UCFA 1RRJA 3K9LA 3NTQA 4OXQA 4G5RA 5HDKA 4KN6A 4HV6A 4RF4A 1K4KA 3HU2A 4TYPA 4KKVA 2XGXA 2XIJA 3ICCA 1FY2A 1U3UA 1M34B 5BQXA 3DDZX 4XIIA 5T4EA 3FNGA 3H18A 5DMXA 4DHWA 4F8JA 3GJ6A 5HJ7A 3EFOB 2WB4A 1OXKB 3PWZA 5DNCA 4NKRA 3IKMB 3KQLA 5DKFA 3UA4A 3HPHA 4Y0VA 3E2PA 2JVJA 1NSYA 1FP1D 1PFQA 1MJAA 1QQAA 2XUQA 4L4ZA 4E4YA 2V9PA 1OFIA 2H57A 2FAXA 2QA4I 2ASEA 3IOCA 4RIGA 5IYBJ 2W4QA 3ERMA 4FFVA 1Q7GA 4GEGA 1JHUA 1N6OA 5JSYA 3HRMA 1P7ZA 5B7QA 1RI7A 4KA4A 1PL0A 4DSOA 4ZXPA 1JTYA 3DMHA 1B93A 4XCVA 4Y0AA 4PRZA 1USKA 3SZUA 4OMUA 2QLFA 3O2QB 4FHGA 1ZKGA 4HFRA 3EZXA 1U3EM 5JROA 1GGVA 4WNYA 4EY5A 3G5UA 5FH9A 3A1FA 1IPEA 2QL7A 3KSAC 4A3DJ 1GUFA 1APBA 3OO0A 2F5FA 3SY8A 1VTNC 3COWA 3WLFA 5IVKA 1WW3A 4YT4A 1ZI8A 4DA6A 4UUTA 3WI7A 1M6EX 1S01A 1KOJA 1JXSA 1ZNYA 1UBCA 4W5JA 5AKGA 1XZBA 4LY6A 4WUTA 3AOEA 2VYVA 3L7CA 2Z1MA 3RF6A 1RDFA 3C1DA 5U4QA 3VXKA 1WBJB 2A1TS 3IKVA 1AHHA 3ORQA 3OZUA 2CNNA 1AXGA 5CX1B 1AUXA 3I6IA 3QSYA 5ALDA 1Q14A 4YV2A 3PFIA 1RQPA 2B36A 2O23A 4PINA 1YI8A 2UYQA 3EXIB 2ZRPA 3KQOA 1JDTA 3PE3A 4EV0A 3V7NA 3LSYA 5CCEA 4NMWA 1JLMA 1OFHA 4TV8A 5CLLA 3V9PA 1WWKA 2EG5A 2ZSKA 1X7XB 5EYPB 2QR2A 4WNCA 4J00A 1Y4DE 4EW1A 3FYSA 3R7WB 7AT1A 2VF7A 4DT1B 2XZTA 3GH1A 4LJ9A 3A9RA 4X8OA 3MB8A 3KBOA 4UDOA 2NO7A 2BKAA 5MHTA 2BYVE 3EWAA 2BMVA 4FNAA 2CW0F 3UXHA 2LR8A 3VJLA 4XH9B 3AR4A 5TGTA 1DBSA 4O25A 5JI2E 1ZGGA 3SM9A 5JS2A 2X0RA 1TQ2A 3BJIC 3I61A 1WJGA 3CC7I 2F9FA 2JT1A 3I9V1 3LBAA 3QKSB 4ENKA 4M3BA 5AT1A 2HHJA 2DPDA 5LEKA 4JEIA 2HBQA 2WUVA 5SYMA 2LXNA 2QLLA 1K08A 5CNKA 4I5FA 1MJGA 2VPTA 3RHZA 2AN1A 1Z33A 2CHGA 2VKDA 5HCIA 4YUAA 1C8BA 5LKAA 3FYCA 4C6TB 4U6NA 4KZPA 3GJ3A 4K2EA 3LPMA 3L1VA 4NQRA 5G41A 2W0SA 2QG6A 2GXAA 5HOEA 2XR1A 4FMDF 5SZJA 4QELA 1J2TA 1NSTA 1CQIB 4PZZA 4X6YA 1O95A 5M5WJ 3TE7A 4R9RA 3O1JC 1DP4A 4X60A 5GPCA 1P0IA 1I2MA 2DJ5A 3CWCA 1OROA 3QE2A 3EC1A 1Y9DA 1XALA 5EE3A 3MT0A 2J33A 2QQFA 2X0KA 3DWIA 4W9MC 1NQUA 4PR0A 4QRIA 2ZBVA 4L72A 2GAIA 1EFRD 2EHJA 2R8ZA 1DC5A 2RREA 4F3KA 1SU8A 1UMQA 3RQIA 5C35A 2NVBA 3UG6A 2W2OA 2VNHA 1USTA 2IZ5A 2OR3A 1ID1A 1TKAA 2WHQA 2WU1A 2BSXA 3QVKA 3W2WA 3BBLA 5CD1A 1BEUB 3ETJA 3V1MA 1N7IA 3AFHA 1ZOPA 5JFRA 1YZFA 4C08A 5KQGA 1XQXA 5JE8A 4KO3S 3HBMA 2ZVJA 4ZKEA 3G2JA 3R8XA 5CA1F 1I4DD 2WTXA 2FN4A 5L3SA 2QVOA 1K79A 3B7GA 4N49A 3CO7C 2Q3LA 4L0DA 3HB5X 3E6DA 4W9NC 1FRFS 3KSDO 5E95A 1DPFA 4MKRA 1KOGA 4Y3OA 5U1PA 3FGOA 5EJCA 1N6LA 1D7OA 3KP4A 3GVHA 1YUNA 3AF6A 5LDDC 3UZUA 3BGVA 1KHTA 3ET5A 3DEJA 4PN7A 2A1UB 4BXXJ 4CF3A 5KAFC 3UPTA 3IMCA 5DX8A 1RI1A 5LRRA 1T56A 1JZQA 3PXCX 1J9GA 3WAKA 3O4JA 3M0EA 3EF3A 3PDJA 4JYAB 1F8YA 4I1IA 4WK0B 2MIIA 4P93A 1X38A 4P9UA 3LXXA 5G02A 4H0EA 4DGWB 2ADFA 3BF7A 1GSHA 2WVGA 2LOOA 3T3NA 1PTKA 5LIPA 3I73A 5BRJA 4N5NA 1FEZA 3K8YA 4XSGA 2FXAA 1G42A 5CXUA 4EJOA 2W93A 1NC1A 5M7EA 1BVUA 1G3YA 3CCQI 2WB1A 1NU6A 3P9KA 3N6RA 5A5GA 4PHHA 5H70A 2CLLB 1CJBA 1W7PB 2NIPA 4CRWB 1BIBA 4IDHA 3DZBA 4JROA 3QUBA 1XTUA 3L06A 2C29D 3R9WA 1VLZA 1Y6ZA 2I34A 2HZ7A 2WRZA 4U7PB 5J8CA 4Y1RB 3TO7A 4QYXA 1BOFA 1UMBB 3K4QA 3PUWA 2OF7A 4HAIA 1EZZA 2OP1A 1J2RA 3K9NA 1TWAJ 4KKXB 1LNWA 1YJQA 5I4IA 2VS1A 1MQ9A 3ZDXB 4JB2A 2QVXX 2CJYA 4LHYA 4Y0NA 1LS6A 2Z4TA 3ZWDA 4JOQA 3AF3A 2EX1A 4C6RA 3SXUA 3RVOA 4MLOA 2R8RA 3GP5A 3AOEC 4X91A 3VVLA 2BBTA 3I59A 1V0JA 4V38A 4FCYA 5I6DA 1SUIA 4LRWA 4M9UA 2KE5A 3TRHA 2I3ZA 4AXXA 4MIYA 4LIPD 4FJ2A 5JWOA 3X3HA 3WKAA 4RQTA 5JWHA 4WPGA 4ZYUA 4MINA 1YFJA 1OJLA 1E1KA 2M5WA 2HUPA 2JVKA 1WS6A 3VV2A 1L7QA 5CVIA 3T9FA 4Z6YA 3D3QA 4O2RA 5C5EA 1J0DA 4ZN6A 1SBIA 5JAZA 2Q4DA 3HJAA 1GQOA 2FFHA 4KLAA 2CJWB 2ZVDA 2J5OA 3JRFA 3L82B 1UHSA 2Y0SA 4ZI3A 3GZNB 3JVVA 3WGVA 4XYBA 1G6NA 2BCGY 2OHGA 3D3JA 3A6HA 1QYVA 1XWIA 4ZQFA 3UKOA 2VPPA 2BKXA 5D3MB 4Z4CA 3HRTA 3RZDJ 3QOPA 2O0YA 3RC3A 5ITZA 3VPAA 3LVRE 5IFLA 3UEOA 3FVQA 1YZHA 4II2A 4C0QC 3OZEA 2B21A 2ONKA 4UULA 4K86A 1OAKA 3KSUA 3PQ6A 1QP7A 3QPWA 2PUWA 2ACEA 2ERCA 3COZA 2JSCA 1YFLA 4FOTA 1X7HA 4AYBA 3DEAA 4YIFA 2I3GA 2X8LA 3QIAA 4HDMA 1V5GA 1U0HC 4B76A 1GKLA 2OE2A 4OHRA 1QIKA 5IUNC 1Y6QA 3EGOA 4PGMA 5H59A 1MORA 4TYWA 3GVCA 3RU3A 1KJIA 4AJ4A 3MFKA 4BLTA 2CSOA 1O95C 1P80A 1QBKC 3CCFA 3JQGA 3PXXA 4Z4IA 1YG2A 3SYTA 1PWEA 4LFAB 2AN3A 4D5GA 2BE9A 1HQYE 2HIGA 2C4WA 3VH1A 2JCXA 3FBNB 5CDGA 3W8DA 3FKIJ 1ZM3A 5ERXA 5A0FA 3UJCA 4D9HA 1CRPA 4HR7A 2HY7A 4CTMA 4G8JA 1U8YA 2XVMA 5I7OA 1N2IA 4QBKA 3PITA 4N48A 2BGWA 3G9UA 3WNQA 2DTZA 4UNNA 1NI4B 3EGXB 1G18A 1PJ2A 3BD9A 2GRAA 4YJHA 1L8LA 3LLMA 5TPWB 1HT0A 2HBYA 2PMUA 2HRRA 3S68A 4UHFA 4IRIA 3A4IA 4R2KA 4MB6A 3GFVA 3V8LA 4CKBA 4JK3A 1GLGA 4XJSA 1BN6A 1MB9A 3KJEA 4PAGA 4ENRA 3EZLA 4B3AA 3JRHA 1W9MA 3PIIA 1HFWA 4PG7A 4TROA 5JCJA 4O0MA 2XGCA 3TXYA 3O2JA 1TU0A 4BKUA 2X86A 1LTHR 5E6SA 3Q11A 3NATA 1WETA 2JA2A 3SZTA 2O2XA 3AESB 3NX4A 4KTVE 2PWPA 4UVEA 2CMGA 5IAJA 1PW7A 3MOGA 5FAKA 1B74A 4QDUA 3W9UA 1GNSA 2ZJRF 1S3IA 4JX9A 3ABMH 2IHKA 4V39A 3O4RA 4F9EA 4LJ8A 4RFSA 1MW8X 2R44A 3KPJA 2PUAA 1OLUB 3W2FA 1FSFA 2DQRA 4LGWA 2DAOA 5K3SA 4TVBA 2VR1A 2WJYA 3UPDA 1FIUA 4CMKA 3GQVA 2X5NA 2PAFA 1EHCA 2PFKA 3LS2A 2V9ZA 2GPTA 3KYDA 4HNAA 3B9QA 5F1YA 4Q4ZF 1LE8B 3CGWA 1LZKA 4KYVA 1GCAA 4BNLA 1K4TA 4EK9A 4UHDA 2HBRA 3HCRA 4XIGS 1CRWG 5HKAA 3CIFA 4WUVA 2PGAA 2FI1A 5CNIA 4YCAA 1T4CB 1PK7A 1ZK1A 1YKGA 3KXIA 3VX4A 3ROUA 2ZUEA 5BVHA 4MMZB 2FQXA 1DC8A 3KDAA 4LHZA 3F7OA 1MV5A 1I1HA 2YN4A 5K0CA 2CUEA 1YMQA 5I7SA 1FZQA 4HEA1 3QU4A 2XECA 2FWNA 1RJDA 1T9DA 4M8SA 2ZWOA 1Z75A 4U0JA 4E7IA 4CCYB 3E9MA 1J21A 1Z67A 2NS8A 3X1KA 1AUPA 1HF3A 4TV7A 1N78A 1GL9B 1FFBA 3O8GA 3NYQA 4R1HA 4UVBA 3QIVA 2R6FA 2WJ4A 1QRDA 4AUMA 4EEXA 2JIMA 1M2FA 5CHYA 1A35A 4UCXA 2X9VA 4CQJA 2I54A 4UUPA 3KKNA 2HDWA 2CF5A 1IZ9A 4Q7MB 4D4HA 3JQ7B 5EJ6A 1SXIA 2Z57A 3C70A 2AFIB 3KP7A 4N39A 4XUEA 4XPIA 2GVDC 2WM9B 1VCHA 1SHJA 1TLLA 4DV6B 5TF4A 4CCOA 3X1ZA 3WL6A 4F96A 1N9GB 3QBTA 5HF6A 4N65A 3OE7D 2WD7A 1QB7A 2WWIA 4R31A 4EITA 1VI0A 3OSZA 5EJ4A 3C3CA 4EOGA 4KV7A 3QPCA 1S6LA 4F2GA 1A9QA 2CQQA 2X13A 3SSMA 3B2NA 2XNSA 1U3CA 1PNVA 4OU0A 1D2GA 1CY6A 4LXYA 1VC2A 4FFMA 4AS1A 5IP6A 2CJPA 3FBGA 2QRHA 2WYOA 1S4QA 4I1SA 1GQQA 4IDNA 1A04A 1S3JA 1X1QA 1YO6A 2HMWA 1KDRA 3GLLA 4ZEVA 5ECGC 1UWVA 4E31A 1OI4A 4RTNA 3L0PA 1MEJA 3ZY6A 4DJFC 1M2GA 2O6HA 3BCUA 4WESB 2HNHA 1RJEA 3QXGA 4QAQA 5DI3B 3C6QA 4LTNA 4Q1FA 2FW9A 4J1TA 2F1HA 2XRNA 1XA0A 4MV7A 3RTEA 1SXJD 2UZIR 3MRSA 3FXMA 1I14A 2V7EA 1PIWA 2WWGA 2Y48A 1RYMA 1ZINA 4KQHA 2DODA 4BQEA 3CVUA 4EA9A 3G2LA 5C80A 4BFUA 5G0TA 1FW6A 3KJIA 2HD4A 4KQFA 5HS6A 3U4MA 4K7JA 2WWRA 4C4OA 1FOEB 2ZSDA 1ZS9A 5BWOA 2VAXA 5GZ1A 5CYOA 4RVFA 3AV3A 3FX2A 2EV6A 3ZHVA 5F2NA 2X40A 4PX2A 3KB1A 4NV3A 1G17A 1NN1A 1IM2A 1ATIA 5E18F 2Q2VA 1JDNA 4B32A 2ORVA 4M86A 3TIFA 2NUTB 2HKOA 1FT9A 4LA4A 1DKNA 3TTSA 4XZ3A 2M9HA 2HQBA 2JLRA 2Q62A 2CYAA 2C95A 2FSWA 3FX3A 1SC9A 1VMDA 1DTSA 1ZCJA 2PE5A 4TTJA 2IHVA 4NVRA 3QFHA 1YA8A 3IAM1 2CF6A 1HZJA 2Q45A 1NBWB 5JFTA 2IHZA 2GIZA 4UD2A 1LBSA 4U6SA 5L3QB 3VSBA 3G9TA 2J6CA 1JKJB 4S2EA 1HC7A 1GNQA 1VJGA 3EQZA 1LZLA 5I8WA 4X65B 2EW2A 3CCCA 2P2NA 4JQYA 2IYXA 5AJZA 1FB5A 5LQMA 3ICEA 2NSLA 2BW3A 2J3EA 3O2NA 2D1TA 4AYWA 1VGRA 3AUYA 3GFGA 1DKUA 3OJ0A 2JL1A 5D8KB 1ZRFA 3SXPA 4I5DA 3U4QA 2JARA 1JHAA 2KZVA 4ZT5A 1GXSA 5LBIA 1VE6A 3CR3C 2IOFA 3BE4A 3UG7A 1YQ9A 4N5IX 4YMIA 1UBSB 3KB2A 1BVYF 1F4KA 2O2YA 1STOA 1TA0A 3TVDA 4ARIA 4FFSA 2AK3A 1XU9A 4IH1A 1N3IA 2G4VA 3CVVA 2MYSA 2AI1A 1G2QA 1AGYA 3ROEA 2VBWA 1EK0A 3UC5A 1E2MA 3NNSA 2OO7A 1Q0ZA 4BYMA 1MB4A 3G1LA 4JR1A 4MUEA 2HOTA 4WKNA 3UV3A 4OG2A 1B73A 1SK9A 2FOIA 1EUQA 3USES 2D3TA 3QTTA 3LWFA 3FF4A 2HCJB 3U1DA 4HDRA 1LBEA 4RYDA 2ZR8A 4DDTA 3LUKA 4UV9A 1YZQA 4KFUA 1LX7A 2VUTA 3D3WB 3TOCA 3B1WA 2OAP1 4IMIB 3KV3O 1PNOA 2W90A 3OJOA 1MLDA 5CVJA 3O3CA 5FPYA 3GRYA 3H36A 4DREA 1PBNA 3MN1A 3FM9A 1O4WA 1YJXA 2I62A 1VJ1A 2ODBA 2DFVA 3E5NA 3LWDA 4HAXA 1FDRA 1QX3A 2GASA 2YC4C 1LJ9A 1FFAA 2G9QA 1LK0A 3DZKA 3O6VA 3EAFA 1JG6A 2ZWMA 1FQJA 1EUZA 4F38A 3LSMA 4W99A 4D5EA 4GNRA 4TPKA 2GM5A 3FBTA 4XTCS 2KJCA 3PT5A 3Q3VA 5H8WA 2QX8A 1CFJA 5CDTA 4UEJA 4N3GA 3H9GA 2DG2A 3WDMA 3LCJA 1ESDA 2P8JA 4GGOA 3V7WA 2VJLA 3IHTA 1V96A 4M76B 4B6QA 2EPFA 3C4VA 2VO1A 3MGCA 3KP5A 4B81A 3HB7A 2R47A 4DFDA 3RUIA 4OIMA 3KXPA 4YA6A 5J23A 4TKVA 3Q3CA 1QNTA 4JL8A 4YPOA 5HSGA 4IUDS 2YWBA 4KN5A 2H5LA 2I6GA 5EHIA 2DFNA 4F71A 5DT2A 4O29A 2R6CA 5D6FA 2CEKA 1DKLA 4D3ZA 5FV7A 5TRTA 3V1YA 2WTEA 2FD5A 4RMHA 2C7GA 3AJ9A 1HY3A 4FNOA 3D3KA 4C9YA 3GT3A 3AGPA 3L1UA 3NU1A 1GOTA 3UM9A 2VBZA 3V4FA 3ENZA 1YR7A 1C30B 3D1LA 3Q3HA 5CPFA 4OB8A 1IXRC 4NK4A 1ISIA 1JLHA 5B66C 2ZJ4A 3KJHA 3K09A 2CLSA 4IXNA 1SK8A 2H1FA 3ABZA 3W3ZB 2V6FA 2XQGA 2M8GX 5KNBA 2F3UA 1OBHA 1U2DC 1LPOA 1CWUA 2WJAA 4UUMA 2I3AA 5I4CA 1ISJA 1TEXA 3MYYA 3WTXC 3V9AA 4RWEA 3JPYA 2A84A 2GERA 4WBXC 1XKXA 2WWVD 4K40A 5DHSA 3KEFA 1NN0A 1KY3A 1KK2A 1SD7A 5IJ9A 2CHFA 1CQJA 4OAOA 2YV5A 4NK5A 4EA8A 2HJGA 3BCSA 1MOQA 1YZGA 2AJLI 1UBJS 2D13A 1SQGA 1M2JA 4J1TC 1IN8A 4BAYA 1KO1A 2HSGA 3SXYA 2FK7A 3DPUA 3H3ZA 3ZJ4A 3QPAA 2W11A 3GTQJ 1NKTA 4GLBA 4LC9A 3IJPA 1NURA 3HG7A 3HADA 2BBSA 3VU0A 1JBEA 4MQUA 3H0CA 3K0CA 1F14A 4WY8A 5K8JB 2BJWA 1ND6A 5KU7A 4PONA 1VMEA 1FEXA 5FULA 1HSZA 1EVYA 1LDMA 4PLZA 3A6EA 3GFIA 2HI0A 4EY7A 3OYJA 1ZUNB 2QBYB 2D74A 4GXQA 1A97A 3W2GA 1JQKA 1P1KA 2J6BA 3TVTA 3ND8A 3AMVA 2I4LA 2PNJA 3DZIA 4FMPA 3FXUA 2OCPA 4BNIA 4UOZA 2AI2A 4NSNA 1AS2A 4H77A 4KQJA 4CKCA 1NBMA 5GJCA 4R8MA 1Q1NA 4AY3A 3CGGA 2ZSUA 3NT2A 3QKWA 3M6WA 1O8BA 1OYYA 4ON9A 4JA2A 5F1OA 5EWLA 1V5WA 1G20E 4LLNA 5BOVA 3CV3A 3P52A 4G0ZA 4PLFA 1G6Q1 3LVBA 1HEYA 1HV8A 4OX9Y 1Z06A 2VN8A 2N9UA 3DU6A 4BRZA 4XK4A 3TLXA 4TM7A 2DWQA 1W5AA 4KJZA 3EGEA 1E89A 4OIFA 4CCKA 4D3XA 3ZQJA 5E7JA 1N2CE 1Z0ZA 1HFEL 3MTIA 4EYGA 4NYMR 4AD8A 2N3ZA 3CF5F 4KVZA 2AW5A 3UXMA 3TZEA 4Y33A 5E1ZB 3A3PA 3DTVB 4V19K 1HYQA 2ZI5A 5GAEJ 3L8FA 3F4KA 1Q3TA 3E1KA 3EXEA 1WH7A 4U7HA 6REQB 3IC7A 4C22A 3JQAA 4YCMA 3E3LA 4JJ7A 1SA0B 4FASD 2GCNA 2QMYA 5HIKA 3F1KA 4FFRA 1VKZA 4CDNA 1ODIA 3HUGA 1K3FA 1KYYA 4QEZA 3UKGA 4ZCMA 1QB8A 1LTKA 3FNIA 4H7KA 5F33A 3ZWBA 1BD4A 4UUNA 3PKZA 3WV4A 3MTAA 4IP0A 2HM7A 1U9CA 5CCBA 4QHSA 3ZVMA 2M3AA 2C0PA 3PCXA 5F04A 5BNGA 3FOAA 4BQPA 2V6JA 2ZIUB 3L0BA 3QVLA 4CUZA 4WEOA 4YLYA 2WAMA 1CZUA 1BRTA 2QVYX 4XIDA 2I9PA 4M9SA 2LPMA 2QAGC 4RWZA 2EARA 1T1RA 4YQZA 4AKEA 2BZTA 3ZEAA 3CQ9A 1RJ9B 4KXVA 2YDXA 4YR7A 1F20A 3TDUC 4JELA 1QCYA 5FTJA 1J8MF 2FN8A 4L27A 4BFCA 1YS4A 1E7WA 4EHAA 1B1CA 3MFQA 3MWJA 3FI0A 3PNPA 2R4GA 1A5ZA 2V7UA 5L95A 2C1XA 3HLTA 1Y82A 2V4MA 3V7UA 2O0MA 3H11B 1K6JA 1OAAA 1JHQA 1XMVA 4RAYA 1Q1GA 4LQDA 1Z0KA 5L7WA 3PXAA 1I4OA 5DPMA 1EP2B 2A9VA 2WG0A 2IHTA 3Q0UA 4W7SA 3NBKA 2I67A 4FB5A 3OQ6A 3DZJA 1KDVA 4UPEA 5IT4A 1K27A 1XX5A 4OFWA 4UHCA 1PLJA 3QRFF 1EVIA 1E99A 3VISA 3U3DA 3X2FA 4P55A 1KIMA 5LQAA 3KNZA 2P7VB 4OYLA 1Y8CA 4NE7A 1QGPA 1WHSA 2QRJA 3O26A 4F3CA 1S7OA 2K85A 3EULA 3I9V6 2QN1A 3TNLA 4U02A 3HCAA 4HVLA 1DMRA 5DE3A 4Z9AA 2JA1A 1X1DA 2F1JA 1DPRA 5DTDA 1R9NA 1UK6A 1PFVA 1HE3A 4UPDA 1GRCA 2Q4OA 3E9DA 2P3SA 1TT0A 2GBGA 5E1WA 1U6JA 5H20A 5TR9A 5EYRA 4PIPA 4C0SA 2BMAA 4NECA 1CJUC 1R6DA 2IYZA 1J59A 4JYBA 4J91A 2CLCX 3EJ6A 1SNYA 1L0BA 2QLJA 3ELUA 4F85A 1R6AA 2IOFK 4P84A 4G8DA 2HEGA 3QVGB 1LFUP 3KYCB 1D8TA 1RHKA 3WLHA 3K09C 2BY2A 1P2VA 1RUOA 3PDIA 1I3NA 1EK5A 3OT4A 2OSVA 4P1WA 2QD5A 4Q1BA 3TDMA 1A71A 1QGZA 1KDPA 1T3TA 4L5EA 1DE0A 3R7BA 1NF3A 3ZCXA 3L7NA 2ECBA 4YRFA 1ETUA 4FK8A 5FQNA 1OZ0A 4EVSA 1FIPA 1TMYA 4RHCA 2O59A 4E70A 2WAAA 3PA6A 1IPFA 3PX3A 1O3YA 2FDXA 1RZUA 1G60A 3OZRA 1DWUA 3N4MA 4C5CA 1P9QC 1R9TJ 3FMVA 3FHNA 3BRSA 1JFVA 3V80A 1Y7PA 1JJFA 2EQAA 2ETVA 5A2QA 2AMLA 4MICA 1GG2A 3ZH9B 3GCDA 1RMTA 2VVTA 3ELYA 2QRGA 1N25A 2HGSA 1JI8A 1ZHFA 3KR9A 1AS3A 1LV7A 5FKKA 4O4LB 2F4OB 3KYLA 4G23A 2ZAOA 4QUJA 3ILXA 4RNCA 3TW8A 1TOAA 1BA3A 4FZRA 4C1BA 3W6PA 4YDRA 3EGDB 4U5XA 4HDAA 2JEOA 1XTAA 5J3JA 3F67A 2GWHA 2WWTA 1E0DA 4PWYA 4TLAA 3HKDA 3UTCA 2DETA 1SPXA 3PYMA 3EY4A 2Q7DA 1XC7A 5AYVA 2GPBA 2B0LA 4ZAZA 5DGCA 4IGEA 1T9ZA 3CZ4A 4D0RA 5GTDA 3OJCA 3IT0A 2Y0EA 2DAPA 1H3NA 2WINI 2JTVA 3DAHA 1LDYA 4GYKA 4A4DA 1GO2A 4D96A 4MAMA 2AA3A 2FWMX 2R6DA 1WF6A 3HP7A 1WFXA 2QTFA 1ZYUA 3E9RA 1CY7A 4V0LA 4WLUA 1EGMB 2A9QA 4OGKA 4A73A 3TG8A 1WUYA 4WCFC 1AQJA 2EINH 1RYEA 2BYTA 5LOVA 1VKJA 2IBDA 5JLWA 3RC9A 4HT3B 3CMEI 3O31A 1M7HA 1STZA 3AC0A 3K0FA 2YFHA 4UUSA 4I8DA 3KTFA 4RELA 4CCSA 4GH5A 4CIBA 1MJNA 2BHRA 1JFFB 1ELOA 3ZP5A 1HWYA 1X7YB 3FPHA 1QAOA 4A0SA 1UFKA 3T99A 3SX0A 3K0HA 2GZMA 3GGJA 4P5PA 1NYTA 3OYDA 4NNJA 4OHFA 2NXNA 4HRVA 3R6WA 3LSJA 3WJAA 5CPBA 3I04M 2UXNA 4OPMA 2Q28A 5EXSA 2XRFA 5K3FB 1QU3A 3I6MA 4DRXB 1W36D 1RBQA 1V11A 4MUAA 4CLOB 3Q9NA 4XX1A 1C14A 1E9CA 2DT6A 1QJCA 1G5QA 4V0NA 3WO1A 1Q17A 2QTVA 1J4AA 3LY8A 3OOEA 4DR6B 1IN6A 2QWXA 3AR2A 4E46A 2Q3MA 3N2EA 1P4WA 2PRIA 4BATA 3E8MA 1RIFA 4NZOA 5JY1A 2DR0A 2W7TA 4RJIA 5JAIA 2GZWA 2AFVA 2DQYA 1H2FA 4REQA 4Y2QA 3G9XA 4EBFA 4E5KA 3UY4A 1IZ1A 2PX0A 2XQIA 1UAYA 1FYLA 4E14A 1FSHA 2F9LA 1XGMA 4U0YA 4TXNA 3QMWA 2V5AA 3G2NA 4G0YA 4QFCA 1EBUA 1CJTC 3HXTA 5A03A 4PSAA 1E6CA 2MCFA 1IE3A 4EHIA 5DEOA 2QA5A 2HA0A 2QMOA 3OUUA 2V1NA 5FEUA 2V59A 2G72A 3BREA 3T1VA 4TYNA 4QA9A 4K9DA 3TSAA 5EMHA 3KT3A 1W1WA 3ZPLA 3GBGA 2PZAA 1SCQA 1W2WB 5ALWA 4YFNF 3V34A 5GINE 1Q5PA 2PX5A 2B8NA 1Q1HA 4X62B 3ORHA 4C03A 1HM5A 1JFSA 1PJ3A 2PZKA 1B00A 4NLLA 2QOEA 1AKMA 4IEIA 4K9OA 4LJ4A 2RGYA 3FG9A 1KP3A 5EJ9A 3LSGA 4DPKA 1XAIA 3N2ZB 5JZ9A 3EVTA 1ZWKA 8OHMA 2XAAA 1CHNA 3F72A 1GGJA 4RKEA 2OD5A 2AW3A 2G4CA 1LKXA 2GA9A 2WMYA 4D6XA 3HXLA 1H8HA 2ZXHA 3K3PA 2Q1ZB 1XX6A 4K87A 3GPLA 2A0UA 1D2CA 3MZYA 5DNYB 1EA3A 4PRYA 2P7IA 3VR4H 7GPBA 3D54D 1Y89A 1XQ1A 2AR9A 5ILUA 4HQKA 2P68A 4MVYA 4C7VA 3DXZA 1J97A 2M2EA 2YWEA 3WGOA 3F3MA 3PPYA 2HOSA 1CIJA 2FHSA 4G5QA 2IXAA 2Q8NA 2GD2A 4WJKB 3AUSA 4M6WA 4Y52J 3GG2A 2JGDA 4DLLA 1US8B 4RZSA 4UEQA 4YT5A 4KQIA 3AIOA 4QTZA 4Y9SA 2OV1A 1R2QA 2J6IA 5J1TB 1NZDA 3EIQA 1NDHA 5CA1B 4AF6A 3GW8A 3AP3A 1NF9A 3HO8A 5IUJC 2PMZN 3CF4G 5AHWA 3TMYA 4BXOA 4C6SA 3GZJA 3WB9A 2GZDA 1BE6A 1DQRA 4L15A 4RAGA 4DSNA 2AOWA 4AIHA 4KPGA 4OU4A 2D5IA 1NP3A 4FYPA 3UQYS 5IBCA 3SWWA 4E7KA 1V3FA 2RNGA 3ZHTA 4P1ZA 2O3RA 4UB6C 1WJEA 1JECA 1P81A 1I3AA 3TE6A 4YWHA 1XMOB 5DWDA 1WR8A 4O4LF 2VHWA 1DHRA 4UNQA 3F7TA 1EM6A 2P9HA 4OI2A 2IJGX 1CG6A 1GLVA 2E6UX 2KYRA 4HX8A 4MO7A 4OFBA 5JHHB 4Z1MA 4YRTA 1VFNA 5A9SB 1HQCA 3SNKA 4LNAA 1J00A 2QP3A 3I1IA 2Y1CA 2CWEA 1V9LA 3TTUA 4ILKA 4TQUS 3BXPA 3BWMA 3PG5A 5CIYA 3HR4A 3UXYA 4H60A 1TD9A 1Z7EA 3C43A 2GYWA 3BZWA 3AAFA 3VKVA 3KBBA 4CICA 1UBTS 4YRDA 3CNNA 1WP4A 4H59A 1PNQA 4ZO9A 3WWDA 5FTNA 1P2TA 4QUAA 1XMSA 4CN8A 1UEIA 1ZESA 2RAVA 5ALSA 1T9CA 4MGYR 2OYCA 5BUQA 2W98A 4OXYA 2OCGA 1VOTA 3LPDA 3OYGA 4IOCF 1JH9A 5F3WB 5FBHA 4MV3A 2X8BA 4CLEA 4KVFA 1T1EA 2R1VB 2Z5GA 1WCYA 3Q0WA 2IAIA 2W4IA 3SBDA 1SVNA 5EKDA 1ZN2A 2YZGA 4QD3A 1CZRA 1L4MA 3EN0A 4BNUA 4XYLA 3FHLA 3C45A 4JUCA 3K4CA 3A26A 1QC5B 2MYTA 4QHTA 1DEHA 1YDEA 2AC2A 4PCLA 1G5FA 1HORA 4Q15A 2K87A 3ETLA 3BZUA 2A30A 3OU2A 3KL2A 3HACA 3JVEA 5BORA 2CEAA 3QKTA 4QUKA 3F3XA 1PGJA 3QWAA 2H0AA 4HEA6 1B8OA 2UAGA 5I9IA 1BDHA 4Q0MA 4A3BJ 4ZCQA 3GZ4A 2ZJ3A 1QLJA 3IEKA 2JI4A 5KPJA 1SFXA 1SD5A 3F9RA 3KAPA 1C1XB 2HNBA 1U1EA 4OJQA 2I4IA 1EP3B 1U0OC 1MX9A 2OV7A 1F2TA 1B0PA 5D85A 5D8DA 4P81A 3KR2A 3JQRA 1WUTA 4DPLA 2ZSHA 3FK6A 5HOOA 3U1BA 1XCPA 4HX4A 1BH6A 1KZ1A 1MCZA 4X3CA 2KJBA 1QYIA 2GAAA 3VU9A 3SHFA 2W37A 1XZIA 2QTGA 4G09A 5A2QK 5DCMA 1J20A 3RODA 3TL3A 5KYYB 1G6KA 3NHBA 4L3WA 3MTEA 4F2PA 4KQ6A 1L1EA 4AVPA 3V46A 3F23A 3JYHA 1QKKA 3H04A 3QHQA 3P26A 5LFAA 1ZD3A 1TAUA 3TQOA 2VJKA 4G1FA 3BTSA 1B72B 2CNLA 2KPOA 4LC1A 4N76A 3USZA 3EQ8A 2YWDA 2CNBA 3WLTA 3Q8LA 2PJPA 2CWDA 1SKUA 5H3CA 5KQMA 2R4UA 1XMJA 1RI5A 4KXYA 1E1LA 2GCGA 1A5SB 3NNDA 1GILA 4MW4A 3HSFA 2XAQA 2D5LA 5F0CA 2RK4A 2VP5A 3S44A 3D5RC 1SUPA 3RHTA 2A07F 4I9GA 4PHGA 3CFYA 1QG6A 3CZQA 4TV9F 4DV7B 2CXSA 2W6JD 3CM0A 4BEJA 4Q5SF 2NRAC 4G5SA 3EPJA 3NDIA 2VHQA 1AURA 3I2IA 2X4GA 3QXJA 4ALNA 2BDTA 1GLNA 4EL5A 2ENUA 1J2EA 1KXZA 2XF8A 1ESZA 5AXDA 4Q02A 4MS3B 2BGCA 3UENA 2NW6A 1SIWA 3GHYA 2KZGA 4RETA 3QLUA 3QWFA 1UHMA 5H2FC 3MJDA 3MMXA 4JAVC 3AW8A 4F06A 3KP6A 2HSJA 3F9CA 2ONCA 1ONVA 1VYHA 5IKXA 1QHHD 4RK5A 4LNHA 3GFBA 3IB3A 4DCVA 3F2IA 2EJCA 1SM4A 2FFQA 3RYIB 4KUHA 2VSXA 5GTIC 2CGPA 3D4BA 2JI6A 1K66A 2PKCA 3GXBA 4EHHA 1SPBS 3DMPA 4MWBA 1OFUA 1RWPA 5CQEA 3MAJA 2W5UA 5K5OA 4R1LA 2BJVA 5PGMA 4ZI7B 2P90A 1NWCA 3MHTA 3B2QA 4LE0A 1TFRA 2HB6A 3ZWNA 3D7RA 4NE9A 1H1LA 1RWNA 2D54A 5DM0A 2CUNA 4ARCA 3DD1A 3UHFA 3DE1X 4BAGA 4GD3Q 4IHKA 1U1IA 5IW8A 4BMSA 2I6UA 4PX3A 2F5VA 4PNPA 5IPAA 3B78A 2O0JA 2XBUA 1EH5A 2JMWA 1RRCA 5KIAA 1D0IA 5DN6A 1EJ0A 1BL0A 3MWEB 4FZ5A 4U63A 5FL7A 4MV4A 5IULC 1EWVA 1JQEA 2HYIC 1SCBA 3QKRA 4GRIA 5IXYA 2O7RA 2LBFB 2BEOA 3L2QA 2Q2NA 5EE5B 4XVHA 3N74A 1B0ZA 2VJQA 5JTTA 4DVJA 3ZGOA 2EP8A 1TMGE 1I5EA 3KXKA 2WPDA 4FHFA 3A37A 4TYYA 1H0KA 4UXJA 3HTSB 5ARCA 5BOSB 2CDBA 2OO5A 2ZMEB 5F2KA 1O87A 4PBTA 4XGRA 5DBOA 3EUAA 2Y05A 2O07A 2CCKA 2J3QA 2FYTA 2VL8A 1MN6A 2PTGA 3JQCA 1MAHA 4PNEA 1GP2A 2O06A