3H5NA

Crystal structure of e. coli mccb + atp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
338
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
molecule tags Transferase
molecule keywords MccB protein
total genus 109
structure length 338
sequence length 347
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5nA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5nA02
4IMRA 4YVFA 2EP7A 3OH8A 1OFGA 3KSUA 2HDHA 4EYEA 2ET6A 3GFGA 5IDYA 1RM3A 4M87A 4EEXA 3PJDA 1EFLA 5T5QA 3U09A 3M6IA 3IQDB 3DFUA 3O26A 3PHJA 4FJ1A 4KOAA 4HADA 1LDGA 4Y6PA 2IYOA 3PRJA 1WW8A 3I6IA 2SCUA 2GZ2A 5LCXA 1ZUD1 3ROMA 3W6ZA 3RC9A 5ILOA 1FF9A 3DTYA 4CLDA 1J5PA 3JCZA 4MVJG 3JQ8A 4FCCA 5BSHA 4CMHA 3H4VA 2DUWA 1BXGA 3ICCA 3PJEA 1ZBQA 4CLHA 5F1KA 3H5NA 4OM8A 5H82A 5HBRA 3GVIA 2WD8A 5EN4A 2D0IA 2GZ1A 2VUTA 4DQXA 3C24A 2IEDA 3C7DB 5I8ZA 4RJTA 3ZGYA 4FD3A 4CMEA 1DPGA 2IZ1A 4FFNA 3IP3A 3EK2A 5I7FA 1Q0HA 1UXIA 4M54A 4YJDA 1T4BA 3DZGA 1ID1A 2HRZA 1NQ5A 2DFDA 3JQ9A 5EINA 2VTEA 4LCJA 5JSFA 1C0IA 4E0BA 1Y9AA 4DWVA 2GN4A 1PS9A 1OZAA 3WNVA 2CFCA 4XQGA 4DQUA 5EQDA 3ZW8A 1UJMA 3BTOA 5EERA 2XXJA 4URFA 2JCXA 2EIHA 2BH9A 1BHSA 2JD0A 4IS2A 3KTDA 1DFGA 1H5QA 4BO8A 3TL2A 3OIGA 3ZU5A 5IXYA 1E7YA 4IIVA 4JP2A 3CEAA 2BFOA 4CQMD 4EUEA 1XGKA 4DGSA 4QO8A 4I5FA 4YT4A 5FYDA 4PGFA 3OHSX 4N7RA 2GF2A 4MVJA 4B7UA 2C59A 4RZHA 3IP1A 3VDRA 4YT8A 3PFWO 1A4IA 2X23A 3PXXA 4BO1A 1XKQA 4OXNA 3G49A 1WLYA 2DU8A 3U4CA 1X7GA 3PVZA 4B3JA 5A02A 2E82A 4J7UA 4AFNA 1I33A 2Y93A 3PJGA 1R4MB 1M76A 2GRAA 4B7CA 3I9MA 4A10A 3WGGA 4UVEA 3ZWOA 3QVTA 3VZPA 3JSAA 4GSKA 3U9LA 1NWHA 4ALKA 1IULA 1BG6A 4BO0A 2VWGA 3RSHA 1Z6ZA 3DO5A 1VKNA 4RLSA 4CV0A 3VPSA 4BNKA 3U3XA 1Y81A 4DTIA 2X5OA 1ZH8A 3VPXA 4HP8A 2WD7A 4DPLA 1YL7A 5CG1A 1QXSA 4C7KA 2VWHA 3PZBA 1HT0A 3PPIA 2OOSA 3MOIA 1U5AA 3K8ZA 4H3VA 4I9HA 4M89A 2VYVD 5F1OA 3RUHA 4CODB 4JNKA 1L7DA 5IG2A 3ZWWA 4BNZA 5MGBA 1PJQA 1Y6JA 3P2YA 1QYXA 2I9PA 4NBTA 2FPIA 4KTVE 3Q11A 3BMNB 4RPKA 1GR0A 3P19A 3DHNA 3GLQA 2C2XA 3BHIA 4Z3DA 3EDMA 4LK3A 2NVBA 1CF2O 3PHHA 2HMSA 4FN4A 4RPHA 4WJZA 5K0ZA 3LDHA 2Q46A 3RASA 3B20A 5L7TA 3COSA 2AG8A 3BHJA 3V5NA 4BGEA 1LEHA 3E03A 1EEHA 5GMOA 4J9VA 1NXQA 3KHUA 2DPHA 2DAPA 2HJRA 5EMHA 3UH1A 1XQ1A 3F3SA 3KVOA 5JPIA 5CEEA 3AUUA 4XQ9A 5JAZA 1NR7A 2WMDA 1O89A 1WMBA 4PCVA 1J49A 5FF9A 2HJSA 1YOVB 2QZZA 3UKOA 1K6IA 1YS4A 2XAAA 1ZK2A 1HYHA 4CLEA 1O0SA 3E9MA 1E0DA 1VJTA 2CY0A 2YY7A 5JMWA 1ISFA 3NV9A 2X5KO 3GEGA 1EVIA 5BSFA 4FFRA 1F0YA 3PLRA 4IQ8A 3T4XA 4MOWA 3NAQA 3OM9A 4UEOA 4JBGA 1ZZEA 4LCEA 3UFXA 1FDVA 3OETA 3ORFA 1VL0A 3L9XA 3UVEA 2X9GA 1NQTA 4YJGB 2V6BA 4Y67A 2QHXA 4BNNA 2C7GA 4ZQGA 3JD1A 5TT1A 3EGOA 4YT2A 2I3GA 5CDSA 1R4NB 4K26A 2P9CA 4QTZA 3WYBA 1TT7A 2PZJA 2HMVA 4Q9NA 3AU8A 2RCYA 5JCXA 2X0IA 2CD9A 3HE3A 3ROKA 1VM6A 4FFPA 3IKVA 1IOLA 4Y6RA 3DMTC 4RQTA 3ZH2A 3RI3A 1ZXBA 2NACA 3U0BA 1F06A 1B8PA 1QYVA 4YJFA 2PZKA 4CM1A 3Q6IA 5AOVA 4RF2A 5TIIA 4LMRA 2RIRA 1NX6A 4RGBA 2E49A 2GCGA 4INAA 4CMCA 3FWZA 4WLOA 5THKA 3RKUA 4BKUA 1O9BA 2PKQP 3BTVA 4ZA2A 4OOFA 1O95A 1N92A 5IF3A 4FC7A 1O5IA 4HNGA 4HNHA 4GSLA 3BTUA 4O5OA 3VZSA 1EBFA 4D42A 4ROSA 5KNLA 4CV3A 5KWEA 4U0JA 3D4PA 5TGDA 1ZK0A 3V1TC 2A92A 1C0KA 1LC0A 1OMOA 4P4GA 1LJ8A 3C85A 4JROA 2XF8A 5A05A 2VYVA 7ADHA 1XQ6A 1ADFA 3DHEA 4S1VA 5I9NA 1NPDA 1DIRA 1PR3A 4PLGA 1LBEA 4F45A 1AXEA 3D0OA 2YDYA 3ZWBA 4U6QA 1DIGA 2J6IA 3VZRA 5KJ1A 1GQQA 4E5NA 1PSDA 4KQWA 1Q7BA 1C0LA 1I01A 2B0JA 4D7AA 3PLNA 3GY0A 3FI9A 3ZCXA 4R51A 2EGGA 1VKOA 2DBRA 3ZDFA 4BO3A 3AI2A 3DBRB 4ALNA 2W90A 4LGVA 4BNGA 2WM3A 2DQ4A 1PGOA 3NJ8A 5LDGA 4AJ4A 3F5SA 1LA2A 1WP4A 1ZJYA 1EQUA 4H16A 4DLAA 3AFNA 4XJTA 5LC1A 4CMIB 1I8TA 1LSOA 1SC6A 4OKIA 3WICA 4D0RA 1U8XX 2JCYA 2DUUA 3JQ9C 4OJNA 2VWPA 4XJSA 1UDBA 1M2WA 2WYWA 1YE3A 4ITUA 1NHWA 4BGIA 3ONDA 2I6TA 3O8QB 1B0AA 2NLOA 2I76A 4NBUA 3WIEA 1A9ZA 1UP6A 1B8VA 4RPLA 2C0CA 3ZHZA 1HSOA 1TT5B 5B37A 1A27A 3BTSA 3WR5A 4Q39A 3VZQA 3OF2A 4LSWA 3INTA 2VCYA 3F4LA 1UXGA 2O3TA 5DT9A 4RQUA 3LQFA 5DZSA 3DQPA 1KYQA 4P4NA 4RF5A 1IPFA 3NUGA 1UZLA 4II3A 3LT1A 1EK6A 3RFXA 2VRBA 4CMKA 2OBNA 3E82A 3GMSA 1R0SA 4CR6A 2Y1OA 3L77A 3R3JA 5COAA 3S2EA 1GTMA 1ISGA 4MVJP 3N58A 5FWNA 2QRLA 3VOSA 3ANNA 4BIIA 5C5IA 4WLEA 1ZEMA 3OJEA 1PS0A 2NUAA 4PVDA 4PZDA 3W8EA 5L3ZA 3VH4A 2EJWA 4S3MA 4ZQBA 1FJHA 3RUCA 1AE1A 3D64A 4PG6A 1I30A 4C4OA 3DL2A 2CDBA 1D8AA 1JTVA 4FR5A 4DIBA 4WEOA 1IE3A 5JXWA 3H3JA 1P1KA 3INRA 3VKUA 2PZLA 4Q3BA 3UUWA 4NNJA 4W7HA 3KXDA 4IJKA 3GRPA 1C1XB 3V8BA 3SLKA 1ADCA 4YCAA 3FD8A 5AXCA 2UUPA 2EV9A 1UH5A 1BVRA 2G0TA 1YVEI 4CL3A 1PU2A 3OJLA 3AM4A 4RL6A 3TJRA 4JBHA 2EKPA 4PLWA 3I4CA 3PQDA 3ULKA 4L76A 3B6ZA 2R6JA 4R3WA 3MOGA 4MP8A 1XSEA 3M1AA 5L7YA 2B83A 5A9SA 3L07A 4R01A 5BNFA 2RBEA 3R0IA 4PFJA 2BRUA 1Y8RA 3CUKA 2X9VA 3JQ7B 5DCUA 2VUUA 4LRSB 3PHLA 1DC4A 5THQA 3MTGA 1A9YA 3A9WA 4KMSA 4N54A 4GPD1 4ND3A 1AXGA 5FI5A 1X0VA 2I3AA 2X58A 3QVOA 4YAEA 1DIAA 2CVQA 1KERA 2CF5A 1FMCA 1NWCA 1BMDA 1OI7A 2IZZA 3I83A 1HDGO 4CQLB 5KJFA 3E8XA 4W82A 4AG3A 2EJVA 3VVBA 1A7AA 5TF4A 2NU9A 1K0UA 2DC1A 4UUNA 1WMAA 2HMWA 4WCFA 1A4UA 3VTFA 3ZN2A 1T2FA 3GFBA 4U8GA 5EPOA 3E5MA 3PYXA 3KV3O 3BMCA 4F46A 4J2OA 1T2DA 4D3SA 2VZ9A 4GX0A 1BWSA 1W4ZA 1U3UA 2HUNA 2CVOA 4NU5A 1N7GA 3W6UA 4E2ZA 4J9UE 3FTNA 4PLHA 4HUJA 3NX4A 3UOGA 4BNMA 2WTBA 3FPLA 5CEFA 3A4VA 1HDYA 4WK6A 1PL7A 2O7SA 1VI2A 2RH4A 4GMGA 4Z9XA 1GL3A 1QV7A 4J6FA 4W7IA 3I23A 3DZBA 5JDCA 3PJFA 1X0XA 3DZHA 5CDGA 1PJ4A 2B35A 2O23A 1KOLA 2Y1GA 2ZB7A 4R3NA 1R15A 4RF4A 4ND2A 4Y6SA 2O3QA 5HA5A 2PH5A 3CH6A 3N7UA 4E12A 5JYEA 3IDSA 2I66A 1T2AA 1IYZA 4U7WA 4BNVA 1I2ZA 4HKTA 5DP2A 5KJ6A 2FMUA 4CR7A 3H9QA 1ZK3A 1LX6A 1FXSA 4L74A 3R3SA 4FC6A 3S8MA 1R66A 2QRJA 4B79A 3ZHBA 1HDRA 2H63A 4BNWA 4AICA 4R54A 1LC3A 1P1HA 3STHA 1E7WA 1GYQA 3KYCB 4J7XA 5JAMA 3MEQA 1MFPA 3RKRA 1HRDA 3HJAA 3MJEA 4L75A 3HB4X 2OP1A 1C0PA 1ZMOA 3NKLA 2PGJA 1VPDA 5CAEA 5I7EA 5A06A 1O8CA 3SJ7A 2EW2A 3D3EA 5JLAA 3ADOA 3JYNA 3G79A 4KUGA 5T67A 3TWOA 3E9NA 1PIWA 2W2LA 4Q3NA 4NK4A 2IE0A 4ND5A 1PQWA 4ZRMA 1PZGA 1R0LA 2GR9A 2ILTA 1DIBA 4YACA 3TRIA 3L4BA 5FFFA 5TNXA 2ZQYA 4J43A 4B4OA 4J7CA 4CV2A 4YBZA 3LT0A 3A14A 1T25A 1B7GO 1PZEA 2CDCA 3ENKA 2BMAA 3IOYA 3K73O 1LU9A 3GNQA 2ZB8A 3F4BA 3BZUA 2YV1A 4O59O 4WECA 3I9LA 1QLJA 3IUSA 5L95A 1KIFA 1WNTA 1UP7A 4I1IA 5H83A 2TMDA 1LUAA 1D1SA 2PNFA 3H9JA 1LLUA 4BGUA 3ON5A 1CIVA 1DAPA 2YHIB 4YB8A 4CUZA 1GD1O 3OA0A 3HG7A 1SMKA 4D41A 5DOZA 1YH3A 2CZCA 3EAGA 1JLLA 1SB9A 3RUDA 1N9GA 1X7HA 3KSZO 2PK3A 4QEDA 1LTHR 1Q0LA 4XRRA 1X14A 1ONOA 1WDMA 2FSSA 2VZ0A 2X0RA 3B1JA 4E33A 5J23A 4RVHA 4A5OA 1GZ6A 4YDRA 3NEPX 4KWHA 3OJFA 4YT5A 3GT0A 3GGPA 1B3BA 1IY8A 1R37A 1XIVA 1XCBA 3LC7O 4Y9DA 1EDZA 3OSUA 2P5YA 4YPOA 3H2ZA 2X7HA 1ZEJA 5GY7A 3ZWMA 1V0JA 4XD2A 2C20A 4GLLA 5L9AA 3QVSA 1I3MA 1OC2A 3KEQA 3KYDB 4L8VA 3WTCA 2UUOA 1SAYA 3H8VA 2D2IA 2GPTA 5JCJD 1J6UA 3I1JA 4NK5A 5A9RA 4AJPA 5I8WA 1YB5A 3VTZA 2CMDA 4GX5A 4BKRA 1ADGA 5TX7A 3FN4A 5G0UA 4NFSA 4B7XA 3VHRA 1JQBA 2P9EA 3UN1A 3E1KA 3LT2A 3QWHA 1HDXA 1A71A 1EK5A 2EXXA 4R68A 2YQ4A 1S6YA 4UULA 3M1LA 2LDXA 1GY8A 4U0KA 1TA4A 1AHHA 4GGPA 3Q0EA 3WGYA 4XYMA 4N5NA 2PV7A 1Y5RA 1E7RA 3CZMA 1DBVO 1EFKA 2NNLD 1WPQA 2G1UA 1WWKA 2AE2A 5HS6A 5ES3A 4TRNA 4XCVA 5JY6A 4BNTA 1R6DA 4IDDA 4LISA 4PG8A 3NYWA 5AYVA 4E5MA 1YOVA 1GV1A 4RLHA 2J3HA 4JGBA 4LW8A 1N8KA 2JAHA 1GCUA 2B4TO 3E48A 5A04A 1E3IA 1W6UA 3K9QO 3JQAB 1ONNA 1E7SA 2B5VA 5DP1A 4EEZA 1NQOA 1IZ0A 2FR0A 4GWGA 3H5AA 3GA0A 1MXHA 1PS8A 4FIZA 3VVCA 1U4OA 4BO2A 3DBLA 3I9KA 4J1SA 4OIMA 2Y0EA 1GU7A 3F5QA 1B16A 3VPFA 1U28A 1H2HA 3JYPA 4IXWA 4BNLA 2AEFA 3GAFA 1G6KA 3H9UA 1X15A 2X0JA 3HNPA 3HSKA 1YONA 1EE2A 3HDYA 4JQCA 1BXGB 1ZXLA 5IFLA 2UVDA 4K6FA 2FZWA 2B69A 4CJXA 5G0WA 2JKVA 2OGUA 2ZTLA 2O2SA 4OQYA 2Y0DA 1LDBA 1Y8RB 1R4NA 3JQ7A 3DOOA 1T26A 3L6OO 4OQZA 3F47A 3C1TA 5ADHA 1Z82A 3FBGA 1E3LA 4PIVA 4TRMA 5IXSA 1CWUA 2BFPA 4ZVVA 1N1GA 2A9FA 4XYEA 2O50A 4DYDA 2O7QA 4OGWA 4XWYA 4MVJE 4FOOA 5BSGA 5KOIA 2DBZA 1BW9A 3OQ1A 1T2CA 1Q7CA 4YJFB 4GWKA 2VOEA 1E1LA 1MGOA 3SXPA 3H5RA 5C7IO 3QWAA 1K6JA 3WGHA 2WYUA 5TQVA 1ZIDA 4PG4A 2GO1A 3QIVA 2GUGA 4I9NA 3NT4A 2VRCD 3JQFC 5DCYA 1A72A 4IY1A 3FBTA 4XRGA 3DWFA 3ZV4A 3F1KA 3BHMA 3CXRA 5JCJA 4AJHA 3ZV6A 1VJ1A 2ZYGA 1CEQA 4XDYA 1CQJA 2NTNA 5KJCA 1W73A 4II2A 4N5LA 1ULUA 5U4QA 1C3VA 1JAXA 2QZ9A 2Y05A 4YR9A 3LT4A 3L4SO 2J3KA 3BMOA 4E5YA 5GZ3A 3ZW9A 4CLRA 4XYGA 3ADPA 1V35A 1KC3A 3QVWA 3WG9A 4XYLA 1X1TA 4BNHA 3ZV5A 1W8DA 4EI2A 1R4MA 5TS3A 2H5LA 2BGKA 1K3TA 2FPPA 1C1DA 1DJQA 4AJJA 2CF6A 4CMIA 3OBBA 2EF1A 1LRJA 1MG5A 2BFMA 4XR4A 2H6EA 3TNLA 3JD3A 4JP3A 4GH5A 1DO8A 3AI1A 3PWZA 2HMUA 1SZJG 4DIOA 1YWGO 1Y9EA 2Q4EA 3VH1A 4E2WA 3V2UA 2CUKA 3DZJA 3DFZA 5DCWA 1PTJA 2NTJA 1MLDA 2Q1UA 2UV8A 1ZFNA 4IDAA 1GAEO 4CQMA 5KIAA 3Q9UA 5CFZA 4FPXA 1JKIA 1DIHA 1YQXA 1CETA 5COBA 5L7WA 4ALMA 3GEDA 2Q2QA 1NVTA 4OXKA 3AW9A 3E6AA 2NQTA 1D4FA 1Y8QB 1GZ3A 3G1UA 3RU9A 5TJ9A 1R16A 4ESOA 4UVGA 1DOHA 3LC2O 3RUAA 1WXDA 3KRTA 3R6DA 4JIGA 4L0QA 4FB5A 3WFIA 3IAHA 4RV9A 4HX5A 1JW9B 1B8UA 3D1LA 1PQUA 3AWDA 1VL6A 1RWBA 1H9AA 1ZCJA 2GASA 3E18A 4W6ZA 3EY4A 4BO4A 1TVEA 3I5MA 3ETDA 2NSDA 3DDNA 5KCZA 5FI3A 3FF4A 1P74A 3WQQA 4H15A 3A28A 5JDCC 4A73A 1CYDA 4B3HA 2JD2A 4IINA 4R1UA 4ALIA 3ICPA 3JYQA 5ILGA 3SLGA 5JDIA 1G0NA 1VE9A 4O0LA 4M1QA 2OHXA 3BIOA 1U8FO 1GYPA 1W0CA 2X4GA 3P5SA 5AXDA 2YQ5A 4NBVA 2HK8A 2WE7A 3SJUA 3OJOA 1H6AA 5TJHA 5DBGA 1JKFA 1SO8A 4W99A 1KETA 1MC5A 4FSHA 4OHUA 2DLDA 2PKRA 1NNUA 4YQYA 5JW6A 1P1IA 4DBZA 4YJGA 4UUMA 3INGA 3BMQB 4DLLA 2A94A 1XYGA 4KQXA 1U2DA 1NYTA 4NHEA 4PLYA 5DN9A 5JS6A 2HKIA 3KLPX 4D43A 4H7PA 2JL1A 3ASVA 1E7MA 3CIFA 3W4JA 1OBFO 3NTOA 3OJ0A 1DC6A 3GGOA 4XB1A 3PWSA 4WPGA 4LVUA 5CHEA 2G5CA 2JHFA 2XOXA 4IDFA 4RDHA 1EVJA 3WGQA 4J1TA 4OSPA 5TC4A 5K6AA 1P0CA 1P0FA 4DC1A 4TKLA 1I3KA 4ILKA 1IZ9A 2Y0CA 1YDWA 3NDRA 2X8LA 3PDUA 5BNTA 3TDKA 3NT5A 1PJSA 1VJ0A 3AY6A 3CTMA 3RCBA 4NJMA 2F1KA 3GC6A 1K2WA 2ZK7A 3GVCA 3RIHA 1N5DA 4F6LA 2A4KA 3RC2A 2GZ3A 3ZHYA 2PZMA 3RBXA 2ZJ0A 3UAGA 2Y99A 2DVMA 1AUPA 5G4KB 2Q50A 5A5EA 2JJYA 3WS7A 2J3JA 3RU7A 3PK0A 4BO5A 4PN3A 5A03A 4BB6A 2JAPA 3G17A 2D5AA 1H94A 5B12A 2ZTUA 4RO0A 5T57A 5GZ1A 3QWIA 2DTEA 5ENVA 2G17A 1XHLA 3DR3A 1U7TA 4UREA 4E13A 1AN9A 4D79A 1B3RA 1J0XO 2AQIA 3I9NA 4PVCA 3IKTA 2UAGA 4PLVA 1CDOA 3ZWXA 5F21A 1ZK4A 3L9WA 3RFVA 3WLEA 4BOYA 2FR1A 4Z3KA 1Q2XA 1P9LA 5C3MA 5ITWA 3ZNNA 3VH3A 1YL5A 1PL8A 4BNIA 4XX0A 2ZB4A 2PD6A 3GN1A 3KOUA 1N1EA 1I3NA 4F3YA 4A0SA 4R1SA 4CM8B 4Q3AA 4XYBA 5ENDA 1BRMA 3GOHA 1JAYA 2DPGA 3DTTA 1OOEA 2AQKA 1PGQA 1DSSG 2BKAA 1HE5A 2W98A 2CVZA 3TOZA 3RUEA 1GUFA 4PZCA 4U6SA 3PQFA 2YFQA 4OXYA 1TT5A 2ZCUA 2NVUA 2RHCA 2W4QA 4E32A 1KEUA 2C54A 2G82A 3GEMA 1NQAO 4IBOA 4OMUA 4DIFA 3H9GA 1OC4A 3O9ZA 4BNJA 5LDHA 1DXYA 3KBOA 4HFMA 3QWBA 3RC1A 3UXYA 1Q1NA 4RPJA 1M66A 3NTRA 4D46A 4PG5A 2JD1A 4RVDA 3GG9A 3GDFA 1E3JA 3K6JA 1LLDA 4K9DA 4AJOA 3EW7A 4BO9A 1BXKA 5B4UA 1LRKA 3DAPA 3AUSA 5EJ2A 2VUSA 4JLWA 4XGKA 1PJ2A 1IHYA 3WQRA 3WQSB 4CM3A 4J3FA 5A4DA 1V3TA 4ZQEA 3D3WA 1EZ4A 3BMOB 4XIYA 5DBFA 1SEPA 5JAQA 4MIOA 4Z6KA 5CDYA 1X13A 4Y98A 2QX7A 1PJLA 4GQAA 1Q0QA 1KVQA 1OAAA 2OXIA 2F00A 4D44A 3GAZA 2VNSA 2ZYDA 2WSBA 3BYZA 2VT3A 1HL3A 4M55A 1PGJA 3H9EO 4WLVA 4LSMA 2AQHA 1ORRA 2Q1SA 1KVUA 1HDZA 1UZNA 4BHTA 5G0TA 3AOEA 3LLVA 2VN8A 3JQEA 1SCUA 2X5JO 1E7QA 4BMSA 1PGPA 2ZTMA 3JQAD 3NGXA 4E4YA 1NVMB 3K92A 4TRRA 3F6YA 3H6KA 4MPDA 5A9SB 6ADHA 4CR8A 3U4IA 3WGTA 2V7PA 4MO2A 2B37A 2X6TA 2BI7A 4CQMB 5L53A 2W2LD 3KYDA 4GKBA 1UAYA 5IZCC 1YBAA 1ISIA 4MVJM 1GQYA 3HFGA 4UEJA 4MIYA 1TB4A 3QA9A 2ZKLA 4M8SA 2E48A 3ZWYA 2WWRA 3KZVA 4MVJD 3KM0A 1MC4A 1J4AA 1XWFA 2OL4A 1VRWA 4XGIA 3AI3A 4UVIA 2NV6A 1K6XA 1TEHA 3FNHA 3PIDA 4PLFA 1YB1A 3DC2A 3JQFA 3OIDA 1DLIA 5A3VA 1XU9A 4ID9A 4JBIA 3IIEA 1QMGA 3AOGA 3S1LA 4WCFB 2G76A 1JVSA 1ZO8A 1A5ZA 4B4WA 5IAAA 4EUFA 4CM6A 1JWAB 4BS9A 4R4JA 4XB2A 3WOHA 3JD4A 3RVDA 4WCFC 2BHLA 1QV6A 1X7DA 2PR2A 4RF3A 2OP0A 3W8FA 2VYND 1S7CA 3JD2A 3AUTA 1GADO 1TLTA 4MIEA 4WCDA 4YJHA 1HWYA 3DAFA 2Z95A 2EG9A 2C82A 1LDEA 3FPCA 4NJOA 1LLQA 5EIOA 4CMJA 3H3FA 4YA6A 4RPGA 4IJWA 4AJ2A 1FK8A 4TVOA 1DLJA 1JWBB 4J1QA 3ZWPA 3JQGB 1RPNA 3FRJA 5JO9A 3H2SA 1QKIA 3V1YA 3DOJA 1KS9A 3C7CB 4DVJA 4WNIA 5T6BA 2NU7A 4HY3A 2YV3A 4W9NA 2YJZA 4TZKA 1QSGA 3EVTA 5BR7A 2ZATA 2AHRA 4ZRNA 1IHXA 2YW9A 1M75A 4QFCA 5IDXA 3GDOA 1TI7A 1QRRA 3PDJA 3GZNA 3GDGA 1E6WA 1WVGA 3HN2A 3KB6A 4B4VA 5KVSA 3X2FA 3DZFA 4LN1A 4RVFA 2PD3A 4YAKA 3U62A 4OOEA 3WGZA 1HE4A 4WLUA 3KYCA 4CV1A 3EC7A 9LDTA 4BV8A 3RJ5A 4BVAA 1ZSVA 4D3FA 4OL9A 5EESA 4O6VA 4B8ZA 4BNFA 1E3WA 2BGLA 4MVJF 4UUOA 1VL8A 2Y66A 4IDBA 2Q1WA 1JA9A 1I32A 3LVFO 4KUEA 3PI7A 1FDWA 1PGNA 3GPIA 1ADBA 4PRKA 1L7EA 4GBJA 2EHDA 3X2EA 1LNQA 2J8ZA 3Q3CA 4PLCA 1Y1PA 2O4CA 3SVTA 4BKOA 1PJTA 1I3LA 4FJ0A 3TN7A 3HADA 4UEKA 5H81A 1E1MA 1U9JA 3HFSA 1LRLA 4WOJA 3TFOA 4YAJA 4Z9FA 2I67A 1LDYA 3S2IA 3RD5A 5KKCA 2YUTA 2JFFA 4MKZA 1NP3A 3C1AA 4XEHA 1H2BA 1QYCA 4NH4A 4YRAA 4ZHSA 2ZIZA 3QQPA 4BKPA 5JNLA 2WJPA 4JXKA 4RVSA 1G1AA 3C8MA 3KUXA 1H93A 4IZHA 3TFQA 1NHGA 2JFGA 3JYLA 4DYVA 1LDNA 1B26A 2QIOA 2B4QA 2VQ3A 3DXFA 4I9UA 5T64A 1UR5A 4IXTA 4E30A 1HXHA 1P1RA 1WDLA 2BLLA 3C7AA 4DUPA 4FFMA 3W4KA 1V9LA 4EJMA 5JY1A 1I2BA 3GR6A 3KEOA 3FHLA 3WIDA 3ZU3A 4EBFA 3V2GA 3IUPA 3GUYA 4I5DA 5KVCA 1YDEA 3AM3A 4G2NA 4CLXA 3F9IA 5BQFA 1LI4A 4XZ3A 1PWZA 2Y68A 3AFMA 3NTQA 4EJ6A 1BTOA 2VYNA 1YQDA 2IDZA 1KY5A 4OAQA 4E31A 3A06A 4HBGA 4WOKA 2O2YA 4HFJA 3CSDA 2ZCVA 3T7CA 1ZSNA 3ZU4A 2GN9A 1IPEA 3VAZA 2VTDA 4JN6B 4J91A 3BA1A 1ZJZA 3KLMX 2AA3A 4IMPA 2GSDA 2Q45A 1PWXA 3AM5A 4J4HA 4M49A 5G4LA 5CDTA 1T2EA 4FQ8A 1VSUA 1DRUA 1EVZA 1ISMA 1O94A 5IN5A 5JO0A 1HZZA 3WXBA 3HUDA 2D8AA 3TZQA 1YJ8A 4CL8A 3TZKA 3RQSA 1HDCA 1GPJA 1A7KA 3DZIA 4CM9A 2V6MA 1AGNA 2Y1CA 3GHHA 2YV2A 1BGVA 3ZZNA 6LDHA 4EW6A 3ZNQA 3GNSA 1Z74A 3LYLA 1QR6A 4FFOA 2BD0A 2O3JA 2EWMA 3DBVO 3ST7A 4BGVA 1I5RA 1M6WA 1DRWA 1H9BA 3GN2A 2Z1MA 1EQ2A 4DREA 1QLHA 4F6CA 4I08A 5JFOA 3ROPA 5JDIC 4GL4A 2POQX 3C3XA 1E3EA 3JQAA 4NMHA 5AXBA 3NGLA 1E6UA 3MJCA 5TT0A 3OA2A 4AJKA 2OO5A 4MVJH 4XQCA 1L1FA 2FWMX 4TROA 1TXGA 3MWEB 2HQ1A 1X1EA 3B70A 5FEUA 3AY7A 3ZU2A 3RUFA 1PQPA 2C2YA 2YZ7A 4NDNE 4NU6A 5JMPA 5B4VA 3DMYA 2E4AA 1CQIA 2VHZA 2WD7B 2GN8A 3BMQA 2GDZA 2V6GA 4GX2A 3RC7A 4NQZA 3WB9A 3G3EA 1U4SA 2NVWA 5KVVA 4Y8VA 2B4RO 2FZEA 1SOVA 3QV1A 4ZD6A 3B1FA 2HK9A 4ONEA 4P38A 4XIJA 1NFRA 4DLBA 2HAEA 3LSYA 4W4TA 3OICA 4R5HA 2YYYA 1ONPA 3H7AA 4MP6A 4IDEA 3BMNA 4CLOA 1PZFA 2IYPA 3WMWA 2GD1O 1JN0A 3WMXA 3HB5X 1NASA 1B2LA 3QJ5A 4IGEA 1BVUA 3WYEA 3GPDG 5BT9A 1ARZA 5A5FA 5KTKA 4FOSA 1LQTA 3PQEA 3F46A 3ASUA 1ENPA 1FDSA 1GUZA 1P3DA 1U7HA 4Q3DA 5A9TA 1PZHA 1ZMTA 1YXMA 4I5EA 3K5PA 2X1HA 3KO8A 2QRKA 4YEDA 4TSKA 1BDBA 3HDJA 3M2PA 1NAHA 4CM4A 5ICSA 2CDAA 2NWQA 4FJ2A 2GLXA 5B1YA 3WDSA 4CMBA 3OFSA 1E92A 2EKLA 2NTVA 1Y7TA 3S2GA 1MV8A 4QSMA 3HDHA 1DAOA 5A1TA 2VOJA 2EKQA 4IJVA 1JVBA 3AU9A 5G0VA 4BL5A 4NPCA 1RYEA 3F1LA 2PD4A 4L73A 2FPGA 1RM0A 1YO6A 4IPTA 4NIMA 1V3VA 4YTEA 3PWKA 3JQ8B 4I8XA 1UXHA 2BFAA 1GYRA 4RCVA 3Q9NA 5F1PA 3MJTA 3G1TA 3KYBA 4RORA 4ND1A 5DOVA 2OMEA 2RHRA 3GNTA 2E6UX 2AE1A 5F5NA 5U1PA 3JYOA 4CLRB 5DNAA 1KVTA 2Y67A 2I99A 4CM9D 5ITVA 2J5RA 2NADA 3PFFA 3Q2IA 2ZYAA 4E5KA 3GQVA 4IM7A 1U5CA 3QP9A 3P7MA 5CPFA 2NU6A 4BQRA 5JC8A 5JYDA 2D5CA 3JQDA 2ZTVA 3RAJA 1LSJA 3PHGA 4HXYA 4TRJA 3MJSA 2EGHA 3RBVA 1HE3A 3ENNA 3ITDA 3L0DA 1IUKA 3ANMA 2QYSA 3OP4A 4WEQA 1MX3A 2W2KA 3EZYA 3VPHA 4BMNA 3O38A 4MDHA 2Y1FA 5TLSA 4XKJA 4BNYA 1E1NA 3VKVA 1KVRA 3WBBA 2WEKA 5JC1A 1PEDA 1YKFA 2HO5A 4ZQHA 3WSWA 3LLSA 4O1MA 1HF3A 1HYGA 1P77A 2D59A 2O3RA 1PX0A 3ETEA 1DFIA 4YQZA 5CEJA 3S55A 5JBIA 1HKUA 4LRTB 5K6AC 5I9MA 5T8KC 3UF0A 3W8DA 1P45A 2C7VA 3PGXA 4K1LA 1MXFA 4TWRA 3VDQA 2Q2VA 2PA3A 2X22A 5TRTA 3JQBC 1V8BA 4PLZA 1MB4A 3QW2A 4TVBA 1UDAA 3K30A 1IB6A 2BI8A 1P31A 4CPDA 3PYMA 4JX8A 1DC3A 3VH2A 4XR9A 3SC4A 2P4QA 4A7PA 3CMCO 2DFVA 4YAGA 4FFLA 4RVUA 4IDGA 4A03A 4AJNA 3GZ4A 4OO3A 1XU7A 1IL0A 2JFHA 3E9QA 4ZQFA 4DL9A 4HFRA 3FNGA 3U4DA 3V2HA 4NZ9A 2A35A 3TZ6A 4FW8A 1ZSYA 1U3WA 3M2TA 2XPCA 3CE6A 5ER9A 4R9SA 5U9CA 3SC6A 3DBLB 2WE8A 4BQPA 2X86A 2GGSA 1R12A 1PJ3A 2ZJ1A 2OORA 1ENYA 2J3IA 5JAIA 4JJFA 5I9LA 1H6BA 3I9JA 2Q99A 1LSSA 4FGWA 3O8QA 3IJRA 4KP7A 4TZTA 5JE8A 4ZJUA 3HWRA 4TQGA 2LDBA 3AK4A 1GEEA 4CMGA 4WNCA 2EW8A 1H6DA 2FHSA 3FSRA 4IS3A 4JK3A 4TKMA 3MJVA 4YYZA 1T1RA 2RAFA 1ZW1A 3ONEA 2VT2A 4KDEA 5CP8A 2PKQO 4FBGA 3H65A 4WUVA 3ZWVA 2HSDA 4E2YA 4D3DA 1LQUA 1SB8A 5DBIA 3DHYA 4PG7A 3L6EA 4NI5A 3NDIA 1EDOA 3MWDB 4BNXA 4C7JA 1KEPA 3JV7A 3EUWA 5C7LO 1YBMA 1JDJA 4DA9A 1H6CA 5KKAA 1U1IA 4FS3A 3ZWCA 3O03A 3DBHB 3ZV3A 2YDXA 2QW8A 3PTZA 2IZ0A 3GVXA 2HMTA 4GLOA 3K96A 3D4OA 4UAGA 3QY9A 2AG5A 3LZ6A 4L4RA 4XDZA 1CJCA 3SX2A 4YXFA 3U49A 4A27A 3TPCA 3NJ4A 1BDMA 2VWQA 1XG5A 4YJHB 3WNQA 4GI2A 1GCOA 1XDWA 4Z9YA 4BV9A 1FDTA 3K2BA 1RKXA 3O4RA 1VSVA 2YFHA 3PHIA 4FGSA 3SEFA 3WYCA 4EGFA 1EBUA 3WFJA 3TZCA 3UCFA 4MINA 4PRLA 1E3SA 1HE2A 1WAMA 4I5GA 3BXXA 1I36A 3GF4A 3VPGA 1MA0A 2Y1DA 3LU1A 4DMMA 4AJIA 1EMDA 5TSDA 3GGGA 1EUZA 1E5QA 3MJ4A 4UUPA 3LF1A 3OMLA 4AJLA 1ISHA 1HLPA 2PLAA 3AUAA 4IQGA 4G81A 3AOEC 1LXCA 3UGKA 2PH3A 3JQCA 1F14A 3UCEA 2JCVA 3TQHA 1GQ2A 2DTDA 5L4NA 4NR0A 1LLCA 2NVUB 2IXBA 1EE9A 4CM8A 4IDCA 1P1JA 1DJNA 2B5WA 1FDUA 4Q3CA 4IGFA 3TSCA 4XGNA 5A3JA 3I52A 5T8KA 2DM6A 3EYWA 3UCXA 1F8GA 3AY3A 5HTOA 4DQVA 3FR7A 2NM0A 5HWSA 3RFTA 2H9IA 3DAGA 3S2FA 3GMDA 3BMCB 1U3VA 2EP5A 2PWZA 4E5PA 4CMAA 3HDQA 5I7VA 1XLTA 4X54A 1P33A 4E2XA 1HEUA 3JTMA 2GERA 2PFGA 3FTPA 3ZWNA 1WZIA 3D5QA 2BELA 3N74A 4DMLA 5MDHA 2V6FA 1NBOA 4GAEA 3WLFA 1CERA 2DKNA 3Q1LA 1ISJA 4KWIA 4K28A 2AXQA 1WZEA 2OFPA 1HYEA 1M67A 1VC2A 2VNAA 3D3WB 4JJGA 5AQ1A 5L4LA 3PIIA 3FR8A 1QYWA 2JHGA 1GV0A 3RJ9A 4R1NA 4HFNA 2J5KA 5IDWA 2X0NA 1G0OA 4EZBA 2HCTA 4KUHA 3T7EA 1MFZA 4OYRA 4M86A 3I4FA 4G65A 4R16A 4Z0TA 3ZI0A 4L4SA 4NFHA 1UAGA 2R00A 4BNUA 1XELA 2B36A 3Q2KA 3QSGA 2IEBA 4TMFA 1E5LA 1Y5MA 2C29D 3CMMA 3OECA 1D7OA 1O6ZA 2OUIA 1HSZA 3B1KA 1KEVA 1N7HA 3ETGA 1E1KA 4LMPA 2QG4A 5IDQA 4DRYA 2IXAA 3FWNA 1DB3A 3HZZA 4J90A 5DF1A 2VHWA 2O48X 3OEWA 3LK7A 4OH1A 5BNIA 1C14A 2P91A 1ULSA 2UDPA 3QWFA 1RM5A 3CZRA 4GX1A 3DB2A 4IJUA 5ER6A 4WLFA 2FP4A 5ICMA 3OQBA 3GHYA 5CG2A 5K9ZA 4BUCA 4CM7A 1UZMA 1PJCA 3K31A 3PEFA 4B4UA 5G0SA 1PL6A 3FCOA 3P2OA 3PGJA 8ADHA 1NTOA 2D1YA 3IC5A 4IQ0A 5AXAA 4GMFA 2I5PO 2Q3EA 3D5TA 3OIFA 4QQRA 2FN7A 1Z73A 3GUCA 3EHEA 4WE3A 5COQA 5F5LA 1E6EA 2HRBA 4E3ZA 4U5QA 1YL6A 3W4IA 2Z5LA 4YRBA 1K89A 2AEMA 4J49A 4EITA 1YRLA 1RJWA 1EUCA 4ND4A 4RZIA 2AMFA 3ROQA 4WKGA 1T24A 4WASA 1M6HA 3NDJA 2Q4BA 4NBRA 3IL2A 3ABIA 1V3UA 4AL4A 2HU2A 1I24A 2P5UA 2IODA 4J4TA 4NJMB 5IJZA 4BKQA 1SOWA 1D3AA 4WGGA 4ALJA 4AVYA 4R41A 2DTXA 4KZPA 1UXJA 4XQEA 1MUUA 1AHIA 1DEHA 4ZGWA 3QE3A 3QLJA 1ZNQO 1Z7BA 2VHXA 4J1NA 1N9GB 3PYLA 4D0SA 2VRCA 1C1XA 1F12A 2C07A 5G4KA 3QHAA 3GK3A 1PR9A 2NQ8A 2VHYA 1GPDG 3EMKA 1DHRA 4RDIA 1KC1A 4R5MA 2Q2WA 4ZU3A 3JQGA 4G5HA 4D45A 4XA8A 1T1SA 2PY6A 3K2EA 1HZJA 4A2CA 4J0FA 2H1SA 3EZLA 1EVYA 4GGOA 4MP3A 2VHVA 3KSDO 4MJLA 4P8RA 1DC5A 5F3RA 2GNAA 4KTTE 4RVGA 2I65A 4N5MA 1XA0A 1SBYA 3WBFA 2AEJA 1RYDA 2HLPA 4JJIA 5KJEA 2HK7A 3GZNB 4R69A 3D7LA 4UVHA 2ZQZA 2RH8A 4CMEC 4DPMA 2R2GA 5I7SA 1KEWA 4Z0PA 1DFHA 3NT2A 3ZNPA 1HETA 4DC0A 1QORA 5HRUA 4CQLA 3TL3A 3DMTA 4IIUA 4BO7A 4GVLA 3L4BC 3MCVA 3E5RA 5IZCA 2UYYA 1Z7EA 3OEYA 2GN6A 4A26A 3MTJA 3WWZA 1E3WB 1E77A 3L6DA 4EJ0A 4BB5A 3I3OA 4CUJA 1MP0A 1QP8A 4QFDA 3KETA 4MKXA 4P4LA 4PLTA 4FDAA 2FSVA 1I2CA 3FNEA 3HN7A 4KDFA 3WTBA 3PP8A 4CM4B 2DBQA 3DOCA 4P22A 3CINA 5AVOA 3MZ0A 4EDFA 3ONFA 1Q7GA 4ALLA 4YRDA 4DBVO 3WJAA 3CKYA 3UICA 5KVQA 4Q3EA 3TOXA 1SNYA 4Z0HO 2P4HX 4QT0A 4QO7A 4YWJA 4IUYA 2Q1TA 2P2SA 2IRWA 5EQFA 1P44A 5HM8A 4WLNA 4NBWA 4DPKA 1GEGA 1NFFA 2OBYA 1WDKA 1T4DA 3SBOA 2P68A 3RROA 1GFSA 3OQ6A 3WX0A 5DULA 1ZKMA 1JKJA 4QECA 1ML3A 3TF5A 5C37A 9LDBA 3I9OA 4L4XA 1LSUA 2EEZA 3IS3A 5DDIP 3FNFA 1KY4A 4MKRA 3DBRA 4B3IA 5CPBA 2BGMA 5L40A 1XR3A 1SPXA 4BO6A 3ZNOA 1YQGA 3GH3A 2PGDA 5L45A 3IMFA 3JQ6A 3LC1O 1N2SA 3JD0A 5G2OA 4L9RA 2CSUA 2X9NA 1H0KA 1PJBA 2W2KB 2C5AA 1GZ4A 4IZIA 1BW9B 4QX6A 4R1TA 4CUKA 1LDMA 3PZRA 4LVCA 1QYDA 1DDOA 1JU9A 4JCOA 1NAIA 3W1VA 3I6QA 4ZN6A 1GUYA 1HLDA 1K5HA 2NU8A 2EERA 3GVHA 1HDOA 1D1TA 1I10A 1Z75A 1R0KA 3LF2A 3WJ7A 4B8WA 3U4HA 3V1UA 1UUFA 1NPTO 3G0OA 4BMVA 4J16A 2AQ8A 4R9RA 1YBVA 2YHUA 2C5EA 1MG0A 3BAZA 2FR8A 3JQBA 1F8FA 4E6PA 1I0ZA 1YB4A 3QRWA 3A1NA 1YGYA 3WSVA 2DT5A 1BSVA 2OZPA 2Z1NA 4CM5A 1ENOA 4YAIA 1BXZA 1SEVA 5EL0A 3NRCA 4NG5A 3WGIA 2FRDA 2TMGA 1NM5A 2Y1EA 2AW5A 2O3UA 3IJPA 4AJEA 1ZK1A 1ENZA 2CNBA 4J2HA 3VC7A 2V65A 1KBZA 2O3SA 2QQ5A 2WDZA 4HWKA 1NVGA 3GG2A 3T4EA 2GYYA 4QXMA 2FOIA 2YHIA 3HQ4O 2PGLA 3GVPA 1NFQA 2ZB3A 3WGOA 1NPYA 2Q49A 1B15A 1DHTA 2R00C 2E37A 4E21A 1C1DB 4NFYA 4UVDA 3UHAA 1U3TA 4HV4A 1F17A 2W8ZA 3DZKA 1QG6A 3DONA 2QYTA 4QUKA 5GZ6A 5IZ4A 5L4SA 5B4TA 1DRVA 1VLLA 4MVJI 4O63O 4K6CA 3ZWAA 3UW3A 4ZICA 1GDHA 4GVXA 3TZHA 1KVSA 3ZHXA 3ITKA 1UXKA 2D3TA 1NR1A 3AJRA 1EUDA 5BSEA 3U5TA 1RM4A 2O4UX 1HTBA 3RBZA 4PZEA 2XXBA 4OKNA 3EVNA 5C7OO 1B14A 2DBVO 2WYVA 3DEYX 4W9NC 2VZ8A 3R1IA 1XEAA 3RUIA 5CDUA 2FY8A 1U2GA 1ZVMA 3CPSA 2BF7A 3HHPA 4J4BA 1Z45A 4OSOA 3RWBA 1UDCA 3QVXA 4DXHA 5L51A 4GKVA 1Y8QA 7MDHA 4CLOB 1P1FA 3WWYA 4AJ1A 2J5QA 3GRKA 5HS4A 2PTGA 8LDHA 4EUHA 3ANLA 5IN4A 4J0EA 2D4AA 3C1OA 4PLPA 1UP4A 2P9GA 4N18A 3D4NA 3DBHA 1V6AA 1YJQA 1CRWG
chains in the Genus database with same CATH superfamily
3FKIJ 3G0CA 3EIFA 1JEQB 4KLZA 5FUVA 3ZDXB 1ZWLA 1OFGA 3O5AA 5JFGA 4EYEA 1EXVA 2ET6A 4FR0A 5ALPA 5IDYA 3RLFA 1Z34A 4HLDA 3QLUC 3H97A 2DE0X 1HZZC 5JNTA 5K2MA 1JJ8C 1GTG1 2IPXA 5F2OA 4NNPA 1A82A 2K40A 1PSZA 3U09A 1V8PA 3CO6C 3PHJA 4G56A 3QEOA 4PZAA 4XIGS 3BRSA 3U61B 4FJ1A 4DRZA 4HADA 5K0TA 5IM4A 1BA2A 1LDGA 2IY9A 3KUKA 4Y6PA 4EJWA 2FGJA 2P41A 3PRJA 4YO8A 3IH2A 1WR8A 2HEOA 1MQAA 1ZYUA 4R31A 4RK0A 5DFAA 2CXHA 2FPOA 2SCUA 3WP0A 5K0EA 4GDFA 5EP4A 4I81A 3DTYA 1DARA 5L3RA 5JAUA 1MH9A 5EMMA 2E2HJ 1GGVA 4WGGA 4EHJA 1MNEA 4FCCA 5C52B 1QBKC 2JA7J 3Q7RA 4JH0A 2COEA 5TQ0A 4AZ3B 3PE6A 5M34A 1ONBA 2HJ9A 4ACBA 5I48A 4CMHA 3D1NI 2ZUEA 1W4MA 3DLLF 1X80B 3BFVA 4LPSA 1JDTA 4KE6A 2DUWA 1T0PA 3E0QA 3ICCA 3TD2A 1MAHA 2IS1A 5L3DA 1DG3A 4W5RA 4TLLB 2BMEA 3FB1A 3H5NA 4ZH4F 3CDLA 1J1ZA 2PZBA 2H2GA 2ZUTA 1Y8ZA 3ZDCA 2O5EA 1PX2A 4BJ3A 1C2YA 5EDNA 4QVKA 4LG1A 3NZEA 4X24A 3VU1A 3T7RA 1OLOA 1COZA 1XRLA 3C24A 2IEDA 3GLUA 2A84A 3GUZA 4DQXA 1CY8A 2XBUA 4TOIA 4RJTA 4FD3A 3ANTA 2ZBVA 721PA 3UJNA 2IZ1A 4FFNA 4Q15A 2KZGA 4BLOA 2IH2A 4MEBA 3IP3A 4XKWA 2H5JA 4F7WA 3LWFA 4EA9A 1KSJA 3KKLA 4UOQA 5IJXA 3PBKA 1MRNA 1A31A 1QP4A 2VTVA 4QGAA 1T4BA 1IY2A 4M6VA 1MTZA 3B89A 4PAMA 5DO9A 1W4AA 4PQGA 3BF7A 1XWWA 3JQ9A 3I6ZA 4A8HA 3QAHA 1ISPA 3ESAA 1C0IA 3MMZA 2BEVA 2VONA 4LCJA 1Y9AA 5CVDA 3RRNA 2GN4A 4YDQA 2C5LA 1OZAA 1UFMA 4IJ6A 1RBQA 3CVYA 1ETKA 3MMSA 1SULA 1R49A 2WU4A 2GXGA 1JUDA 1UJMA 2HDWA 1MIHA 1SBIA 2WU1A 3EFBA 4DIMA 4URHA 1E0KA 2D7JA 3UWKA 2EIHA 3OIOA 5FD5A 4OQFA 2V03A 4V1CA 1C8KA 4JKOA 4INOA 3TL2A 1M73E 2M1ZA 3OIGA 3BSYA 2ID7A 2ZANA 4ZAGA 3ZU5A 3QBTA 5IXYA 4PPYA 3CRW1 3PPWA 3E22B 1B1AA 3CEAA 3KKOA 4JP2A 4PIPA 4Y9SA 4R0MA 1F2DA 3CGWA 3HNRA 1JE8A 1KBQA 3QUBA 3QVLA 1V5FA 1BX3A 4QLAA 5HKLA 3TMKA 4DGSA 4EF6A 5IT9K 4I5FA 4UCFA 2J5PA 3VR3A 5A5GA 1RP1A 3RVOA 1QYIA 2C59A 2OWDA 4FEAA 4RZHA 4X44A 5LA6B 1PFVA 2D2EA 1SXPA 1VQ4I 2A30A 3TVTA 1Q1HA 3AL3A 2OCCH 1S2IA 4BE1A 4YJKA 2Q3HA 2DMTA 2BGCA 3PFWO 4QUDA 4ZOCA 2DT6A 1OASA 3HJTA 4MB0A 2XKBA 3WLEA 1VKHA 2ZDHA 1SBCA 3VPAA 4E11A 2TSYB 2OQIA 1UKAA 1WLYA 5FBHA 1Z6PA 1XZ8A 2GM4A 2DU8A 2OD9A 3KYJB 4B3JA 2BDUA 4Q00A 3P9RA 2KM1A 2ZM6B 2C7QA 2WICA 4MPTA 3CUSA 2YOFA 3BFJA 2GVDC 5ED4A 1NURA 2FPPB 4MLDA 1B41A 2FVYA 2BFEA 2YMMA 4M9QA 2XWJI 5KEIA 1TJPB 1L4MA 4ANFA 4A10A 4ARUA 3OOEA 4ZYYA 4UVEA 1IW7F 3ZWOA 1KU9A 2O2IA 5CW1A 3VZPA 1PVDA 1ZD3A 3G89A 1TU3A 2QKMB 1IULA 2P9FA 4Y6GB 5DN6A 2F48A 3ESDA 5GGXA 3AHIA 4I6GA 1NULA 3F6EX 4L9AA 2FQXA 1SC1A 2QZ4A 4RLSA 1VKNA 2PKCA 1RI4A 2BKXA 1GOTA 2JLSA 4BNKA 1B9MA 3K72B 2H52A 1JAIA 1I7LA 1Y3AA 3EEOA 2BDTA 4V3BA 2CQKA 2DPYA 3FOAA 3AYZB 2WD7A 1NG9A 2I2XB 1U0HC 1E9FA 1KYVA 1QXSA 1UBHS 2QB5A 1FJ2A 2YYAA 3CUWA 3GRRA 1EGHA 1EFRA 3ZXSA 2Q5LA 2C42A 3F8WA 3P2MA 1WCMJ 3BMXA 1Z4LA 3MQFA 2OOSA 1RXEA 1TUBA 3MOIA 4H3VA 4PC6A 1L3IA 4DZZA 1GNLA 1L7DA 1Q11A 4RA6B 3X1JA 2CMGA 4Z8YA 1RQNA 3E6DA 2IIVA 5DLEA 3VDMA 3VKFA 4I76A 4EQ6B 5MGBA 4HLYA 1QHHD 3GTKJ 3DVRX 3QGMA 1CDDA 4PPQA 2DR0A 1A88A 3DUFB 4X00A 1YZGA 1YF3A 1ESZA 3LUCA 4ZTBA 4HMQA 4MCJA 4N9QA 1BW6A 3ZCXA 1N4DA 3P19A 4YROA 5BW8A 2NO5A 1SCQA 3AWIA 3GEHA 1E96A 4ZHQF 1DCKA 3BHIA 3L0PA 1IRGA 3EDMA 2DOKA 2E5NA 2L4AA 1N2JA 5EI5A 5K0ZA 4MQ9F 1CF2O 5BS6A 1BD4A 1JT9A 2HMSA 2R8YA 3K1AA 4FN4A 4L22A 1JH9A 3B20A 2EB7A 3COSA 4UARA 3JRIA 4B4KA 2JJMA 5KWVA 3KQWA 4I14A 1ACJA 2BHNA 2XPWA 2CV1A 3HYLA 5GMOA 3KHUA 3SY8A 2DPHA 1RTKA 2HJRA 3JRFA 5CNIA 4GOND 3KZMA 4TM7A 4AMUA 5DM70 3UBTA 4EHFA 3CVXA 3IOEA 4UTVA 4OIRF 3CF0A 4ER0A 4PCVA 2E0IA 3CDIA 2L54A 3ZVRA 4BVGA 4HDUA 2HEGA 4OI1A 3D6HA 4NY1A 2R6AA 4C29A 5FV4A 2M45A 4NVRA 1R4AA 1Y7PA 2VZEA 3EPPA 5EXDA 1OFIA 2YZNA 1G42A 5LNK1 1HYHA 3B3GA 1LNWA 3QODA 4YIRX 4E7JA 2DHRA 5ALWA 2V5VA 4D9NA 3IT1A 1A77A 2H06A 4PSWA 2UVPA 3KZCA 4X3CA 1ES9A 2YWCA 5A3QA 2HMYB 4LJ4A 3N2ZB 1XUOA 2H92A 1RWVA 4P83A 4A8TA 5JS1A 4PGGA 1F0YA 2HA2A 2VUIB 2WG1A 3GBSA 1SD6A 3INYA 2PXAA 4IQ8A 4OF4A 2RDMA 2C8JA 2ORED 4F55A 3L1KA 1ZZEA 2XUQA 3TUJC 1VMKA 2BFWA 1KEKA 5BRNA 2HDNB 4A82A 3JASA 1P5FA 3UMCA 1VL0A 1H85A 2ZSBA 3DA8A 2FU4A 5A5VA 3RLIA 3NC4A 3L9XA 3IE2A 5AM0A 2FFHA 1FC0A 3L2OB 1P9OA 4MJXA 2NO1A 4C6SA 1E79A 1T6XA 1OW3B 1RYHA 4UV9A 1T34A 2LW7A 3L1IA 2QM7A 3FSGA 5TT1A 4DT1A 4XUCA 2UYOA 1R4NB 1LJLA 3ZHUA 4Q9NA 1I0IA 3FHNA 2RCYA 5JCXA 2X0IA 4M8KA 1B6GA 4K46A 1EJ2A 4B1RA 3P9IA 4ASUA 4BMCA 4LZJA 3FDYA 2RK3A 3M8KA 1B42A 1SHKA 1YFJA 1AT1A 3DMTC 4ED9A 3HRIA 1KDTA 3LYUA 1EV7A 1EFVB 3WKAA 4EFMA 1XZKA 5EEHA 4M6WA 4GHWA 2WZQA 4FMCF 4ZO9A 3ZH2A 3TO6A 2W2TA 4NG4A 5F27A 4X8OA 3USES 3ZLVA 1D0ZA 3W2VA 1GZSA 2LP0A 3D2LA 3L0BA 4YJFA 3M7GA 2PZKA 4CM1A 1X7XA 4P96A 1FLIA 1OBHA 4LGCA 4AUXA 4AYXA 1KQ3A 2R6ZA 3NATA 2GCGA 4XSGA 4MWDA 4YCMA 3OYMA 3FOFC 1FLVA 3BTVA 2PKQP 4ER6A 3R74A 1KI6A 2JVKA 3IEIA 3CEPB 1IOZA 4OQMA 3ZC3A 2G7UA 3BK1A 4HNUA 3OCZA 4HNGA 4HNHA 4M0MA 3OZUA 3T9AA 3B78A 4O5OA 3RYRA 4D42A 5A4IS 5BR4A 4JI4B 2ERCA 1HNXB 2R6FA 3W3CA 4Y2UA 1YZQA 4U0JA 1DVRA 3COPA 2A92A 3ZD9A 1C0KA 1LC0A 1T9HA 1AB6A 5M3FJ 3ADKA 3O4FA 4QDJA 4X41A 3N5CA 2MMCA 2FSHA 4A69C 3ZHQA 3TOBA 1QFMA 2XF8A 5A05A 2VYVA 3LT5A 1D7AA 3OCUA 3ETLA 1T6BY 5TPZA 3TZEA 4AECA 3LSTA 3PXEA 4EA8A 2HOSA 1DX6A 1U9IC 2G28A 2NXJA 4OLJA 1YCDA 1G2PA 4F45A 2QM0A 3ZCOA 3QUQA 4L72A 2YIJA 4MQEA 3ZWBA 3E61A 4B6QA 4CIVA 2PQMA 1SVNA 3EFOA 1RP7A 1KFCB 4HOYA 1FZPB 4RY8A 4L51A 3HR4A 4HEA1 4MGKR 1XCLA 2CH0A 5FWXA 4G9YA 3DNMA 4MR9A 4D7AA 1Q0TA 3NVMB 4AD9A 2C88A 5H4HA 2NS0A 3D4IA 2E19A 1WXGA 1AS0A 2PGAA 3AI2A 1I7NA 3BJEA 5HMMA 5KTMA 1T8RA 1F0PA 1NUSA 4B2LA 3WGUA 4HL6A 2UZAA 2LY9A 4LGVA 3MKYB 2DQ4A 5LDGA 1WP4A 4WXPA 1ZOLA 2EX4A 4A0ZA 1GQSA 2SICE 3KJNA 4DLAA 9MHTA 4YMSA 4XJTA 5LC1A 1I8TA 1SC6A 3FGOA 1T5OA 4OKIA 4HO1X 2MR5A 2PX4A 4PHFA 1U7ZA 3IDOA 3I4PA 5J47A 1U8XX 1V6SA 2A6PA 2G9VA 2JCYA 2NT3A 5CM2Z 4KNYA 5DI9A 3ECCA 1TM7E 2Y76A 4U7BA 1P5HA 4OAYA 1KK2A 1UDBA 1RVDA 3I2KA 3LWZA 4LXGA 3X3HA 2HS5A 1YE3A 2AJDA 3UK0A 3G85A 1YR1A 2I6TA 4YJ3A 2I76A 4CUZA 3KKZA 3LWDA 5JHHB 2NXCA 1TJ5A 1CFZA 1ZCZA 1NOKA 3GCDA 2HEIA 4O5AA 4V0QA 3SLRA 4K9KA 1W7AA 1B8VA 1WW3A 3ZHZA 2R5ZA 4JC0A 2Q6TA 2FCRA 2PKXA 3B1VA 1J0DA 2HBRA 3G68A 3I8OA 4WBNF 4EKDA 2L7FP 5TXGA 1AXRA 4Q39A 1JSCA 1S02A 3F4LA 1U8AA 3K4PA 2IOFA 4MUJA 2BBSA 4FMPA 2O3TA 1NYLA 3LFHA 4G26A 2YICA 1UMCB 4N5HX 2K5UA 3LBAA 4UU7A 2FJ0A 2FPSA 5DZSA 3CJTB 1SCBA 5JYCA 2W6JD 5CVUA 3K1JA 1WJDA 3LHIA 4C0QC 1H4SA 2XZDA 1EK6A 3OOSA 3RFXA 3THOA 4CMKA 3LRXA 1G21E 5FBKA 1XROA 2A3NA 4WZ6A 1K8QA 1E0SA 4AAYA 3DEKA 3R3JA 3IODA 2R4GA 5AJZA 4C76A 4A1FA 4MB2A 3HOSA 1P5ZB 3FDIA 4MVJP 1U0FA 2OFXA 3IEMA 5CQGA 3VYRB 3I1FA 5ALYA 1KQ0A 4ZCQA 3VOSA 3LE8A 1C8VB 4PX3A 2O5CA 1ZEMA 1Z9BA 3OJEA 3SOZA 1Q3KA 4D7NA 2EX1A 3D6FA 4RTMA 4U0VA 4HLQB 4FDMA 2ELJA 4M9RA 4HNAA 1IBLB 4LOHA 3I42A 3U2RA 3VH4A 3W2GA 2W8BB 4ZVSA 1AE1A 2CJWB 1JFVA 4B1FA 3OTOB 2OF7A 3R0JA 3DL2A 4L5CA 4RCZA 1IGNA 3WKCA 3ZCVA 4CN9A 1RZRD 4C9BA 1DKOA 3K6SA 3K69A 2CN1A 1A96A 2X14A 5LHHA 1FA9A 1GKIA 3WIOA 1A0OA 3H3JA 2XGCA 5FLYA 1EAMA 2FD5A 2K02A 1P1KA 3VKUA 1KJNA 4TLMB 4FQ5A 1EFUA 1NVBA 5M3BA 4Q9JA 3HUGA 4IJKA 1A5JA 4JBLA 1C1XB 3U7EB 2OEPA 3WWPA 4X85A 1U0JA 1XSXA 4F8EA 1DV1A 1U3CA 2QRHA 1P4JA 3UH0A 1HT3A 2EV9A 1S8NA 3K4KA 3LSIA 2ODBA 5FBWB 3GLSA 4BE0A 2J6HA 4O3FA 3C3JA 4JEUA 3PRHA 4PLWA 3R9XA 2QQFA 2ZVDA 3THWB 3HPQA 4B75A 1I6KA 2XQGA 3N8GA 4R3WA 1R88A 3AEQA 2B83A 4RD3A 3PO2J 2GAIA 4ZZ2A 4TLCA 5DXFA 3REGA 4R1PA 1ULZA 2DY0A 1TNDA 2RBEA 3AVOA 4IJ5A 4RJJA 1JAZA 2JFOA 1Z4MA 4Q0MA 5BSTA 2Q3FA 4DOZA 4D8XA 2VUUA 4LRSB 1EVEA 1U6JA 3F9RA 1ICIA 1DC4A 5THQA 3T3EA 3V4GA 4ZYGA 4KRFA 2X0KA 1VG0B 1AK1A 1N5MA 1U0NA 3ZE9A 2H3EA 2I3AA 2B92A 2WVAA 3KVVA 2E85A 1WVIA 1J5XA 3WLKX 5DYMA 2JVHA 1IY1A 2P6UA 1TCBA 5B55A 4WK0B 3FNIA 5HIKA 1FMCA 1NWCA 3JS5A 4IF6A 5I4BA 2IZZA 3CCUI 1HDGO 1WY7A 4XOTA 3QBVA 4IKFA 1U0RA 2J4FA 3PFBA 4W82A 3SAJA 2REQB 4AG3A 5LL6P 3BDVA 4G8CA 2VRNA 1A7AA 3IOCA 2QTVA 1X19A 3TW6A 3QVKA 2NU9A 3C6BA 5DHUA 5A4JA 4E7SA 4RZ3A 3RARA 3Q3VA 3OTIA 5I45A 1R5HA 4MWCA 3E9DA 4U4AA 3VTFA 2C7RA 4ZVRA 1T9ZA 4B3AA 2EDAA 2V9VA 3DE6X 1OLUB 4N76A 2ZBPA 3Q8LA 5LKAA 4D3SA 2WYHA 1A8QA 3IDQA 5D1HA 4ENVA 3J7YJ 1AF4A 1BWSA 2WG0A 1QYRA 3DKRA 1T13A 4FCWA 4OHCA 2ZBFA 2VJLA 4D97A 4ENKA 3W5DA 3WE3A 3ZH9B 4YHHB 1ZN9A 4NBLA 2XMCA 1Z7UA 3CLOA 5C35A 4TKVB 2TYSB 1YE9A 4J9UE 5WRFA 5DTMA 5KQMA 1E2MA 3KL2A 3W2WA 4RKQA 2BT4A 3FTNA 4PLHA 4YRJA 4M60A 3NX4A 3UOGA 2MFZA 2SCUB 2LBPA 2ID9A 3A4VA 3S15J 4IVNA 1PL7A 2O7SA 1VI2A 3SJMA 3JAKA 3ILSA 3W3AA 5JALA 4YDSA 1QV7A 4J6FA 4EHAA 3I23A 3PB3A 1NJ2A 5TQ0B 1H9CA 5PGMA 5KX5A 4GZMA 1QFYA 1FQOA 2GWHA 5DYIA 4Q1AA 1CF7A 1RC1A 2OAQ1 3K5WA 4HTAA 4P81A 3GLFB 3WZ2A 5HA5A 5AKZA 2PH5A 1ADJA 3N7UA 5JYEA 4P7KA 1ZNXA 1FBUA 1U9OA 1RI7A 4B3TB 1J1UA 1WLSA 4PAWA 5A71A 1G19A 2CHEA 1F9EA 2F4NA 4K81B 4F7ZA 5DP2A 3ZKAA 3GRZA 1LJUA 5EZHA 4CR7A 1H0SA 5CIYA 1JBEA 5EXEA 3BSWA 4C4TA 3KEFA 4FUTA 1G8XA 2IX9A 4L74A 4RUKA 2DEUA 2KQUA 2QRJA 5C31A 2IEKA 2G9WA 2ZSFA 2REBA 4OREX 3UB2A 3FOBA 3GJ7A 4DV1B 4BNWA 3OQIB 4C06A 3DT8A 1DRKA 1GP2A 3LXUX 3KP7A 1WE2A 2PUGA 4DIUA 4EQQA 3L1VA 3DTVA 4XM2A 3RT9A 3FIUA 1U5TC 3ZDAA 3KYCB 1GYQA 4ZVKA 4J7XA 3SC3A 3TTWA 3V8RA 7MHTA 3NM6B 1MFPA 1II8B 2J0EA 2QG9A 4K9PA 1E63A 4IZOA 3SIWA 3MCUA 2G4VA 3HB4X 1BL0A 1RKTA 3HBNA 3AR6A 3PFNA 1V1RB 4ZAVA 2DFHA 2WM8A 2OQVA 3G2IA 3WYNA 4KGXA 5EE3A 4AWXA 4RTNA 1HKSA 3KSBC 4BJ5C 2EW2A 2GVNA 4LFCB 2OCEA 2VXCA 4AYBN 1DU0A 1UBEA 2ZI3A 3RYCA 3S2WA 4MUEA 1BOOA 1GCAA 2QUFA 1KYIA 1XZNA 2YMQA 3PI6A 3KJHA 1HEIA 2W2LA 1S9HA 1QE3A 3QH4A 4FMBB 4Q3NA 4AK9A 2IE0A 1YGPA 3O4GA 3CWQA 4ND5A 4Y52J 1WPRA 4HB4A 2ZITA 1N0HA 2PEYA 4RE5A 5TVGA 3U3KA 1PZGA 1R0LA 3KL4A 1MC1A 4YRCA 3ZHVA 4RTKA 1DIBA 2GX6A 2WSLA 4YACA 4E5UA 3NHUA 4Q19A 5FFFA 2VBCA 3NXSA 3NYRA 4IV0A 3RB8A 3DEUA 3CWZA 4LZPA 4J43A 4UMEA 1JKRC 2JGIA 4J7CA 4YBZA 4LIUA 1T25A 2GPYA 3VU8A 7ABPA 3EXIB 4G1MB 4POOA 1YUMA 1QRSA 4LJSA 3ZE7A 2BMAA 4JOMA 4F7DA 5LQRA 4IR7A 4B73A 4N49A 1KO8A 3GNQA 1FFSA 3F4BA 5D8KB 1W1UA 2YV1A 4LV8B 4MNTA 1BJKA 1YZUA 2IYZA 1BI3A 4IJMA 2YXDA 2BBTA 3HU2A 1M6YA 2Q5QA 5CT9A 4OJYA 5L95A 2OXEA 2FDXA 1VYUA 3CMAI 1WNTA 3LKDA 3Q72A 4TSRA 5EKUA 2TMDA 4B7ZA 2FPMA 4AU7A 1ZM9A 3VR4D 1X77A 5DSXA 5B1SA 1JXAA 3GLHA 4Q7MB 3ON5A 2MA3A 1PUEE 2BGUA 1CIVA 3H1BA 3QHQA 1O8BA 4GGMX 2ERXA 2IS4A 1GD1O 3AERA 1YKGA 3HG7A 3WAGA 1N36B 2IPMA 5AD1A 3UMFA 4H6VA 4NC8A 2XGEA 1B74A 3A6HA 5LA6F 1YH3A 1MSEC 5HKKA 1SB9A 3KP4A 1X7HA 2JGRA 3ZGNA 2WB2A 2HSWA 3H1GA 4QEDA 4ERXA 4OJMX 2YHBA 3ZJYA 1Q0LA 1SK9A 2RJ3A 4XRRA 1ONOA 4M7OA 3W5AA 1YBFA 2VZ0A 4U8HA 1MOSA 3SZRA 2IAIA 3PV0A 4C2BA 1JBQA 4YDRA 5E4FA 4Y1FA 4I3FA 2DYKA 1JIJA 2H8KA 2OESA 3GT0A 1K2VN 3PNOA 4G6ZA 3IRRA 2WADA 2FG7C 3G5LA 3PE4A 1Z0ZA 3OR1C 1J0EA 3OQMA 4TMKA 4YPOA 1HX7A 4P2BA 1ZEJA 1VL2A 3OL3A 5GY7A 1EUDB 5I4KA 1V0JA 2HO4A 2ZB2A 1RQ2A 4QPDA 4GLLA 5L9AA 1I3MA 1Y7LA 3KEQA 3BR2A 1KMNA 2R1ZA 3Q5DA 1ODIA 1DQNA 1ZA1A 2FZVA 4TKUA 2XNDD 4DJDC 3TMOA 1J6UA 1D07A 3I1JA 4FNMA 5DBOA 4AJPA 1PWYE 1SIOA 4L5BA 5I8WA 4UM9D 1SAXA 3E1GA 4YV7A 4BKRA 4NV3A 5FP0A 3IV5A 3LQ1A 1S2LA 3I6BA 4Y2TA 4NJEA 2AN1A 5G0UA 4NFSA 2D54A 3PFIA 2XTAA 4HQLA 2O8FB 3VHRA 1A5TA 1J22A 1TTPB 3II6X 3WQHA 2PFKA 3NAZA 3E1KA 3TX2A 3LT2A 3LJKA 1A71A 4R68A 4AD8A 2O2CA 1YMVA 1J00A 2E87A 3C2QA 1S6YA 1XDBA 3M6XA 3K9NA 4ENPA 2LDXA 1JIVA 4U0KA 1AS3A 3OZWA 3Q3EA 3R09A 3BDDA 1H3FA 1JRLA 2YPRA 2IZOA 4FKMA 4MCHA 4PBRA 2EJBA 2AMVA 4PPNA 4FGJA 1DBVO 1U5BB 3F6RA 1HLGA 2NUAB 2AE2A 2OD7A 1OCCH 4TRNA 4XCVA 2ZJ5A 3U1DA 3C1UA 2PMEA 4BNTA 1QK5A 2ONCA 1A9RA 2Z43A 4WFJA 5AYVA 3GLGB 3KZYA 4E5MA 2JG3A 4MEJA 4BXUA 2J3HA 1O96B 1MO2A 4A0QA 4PQFA 1TK9A 2EFHB 3E3AA 4DDMA 5C44J 1NNEA 3H8JA 1P1CA 2JAHA 1T8PA 2PG4A 2B4TO 2HBYA 2MSYA 4HF1A 1YR9A 2QN3A 3E48A 3FFBA 1J2JA 4IKEA 1CUXA 4OM7A 3GJ0A 4PNPA 1XA3A 2V9ZA 2CQNA 2GFHA 1QONA 2IXDA 1W48A 1X8XA 2Y77A 5HMLA 4BL0B 1QH8B 1IZ0A 3S8YA 1SKYB 1Z8HA 4C1BA 4GWGA 1F2TB 2OWEA 2A05A 3GA0A 2A3RA 1U4OA 3UHPA 3WB1A 2Z58A 3GEIA 3I9KA 4GNRA 4YR7A 1Q50A 2B1RA 5E4YA 4OIMA 1R8XA 5GJCA 1GU7A 2BGNA 2K2WA 3F5QA 3JYPA 1LF0A 2IYQA 4G5FA 4R7TA 1G6KA 1X15A 2J3MA 1Q20A 3NAGA 4XDGA 5AOAA 1XVVA 4B5LA 1JQAA 1N2IA 1D09A 3OU7A 1CZOA 4BQQA 1YRBA 3GP8A 3TD6A 1XMJA 4JBAA 1ECCA 5F1JA 1JB9A 1XTIA 2BKLA 2D0OB 2UVDA 4P1WA 1DX4A 3DSRA 2OGUA 3EWNA 3G5TA 1A98A 3T0GA 4D2IA 3GLGE 2AJBA 3W3ZB 6NULA 4F85A 3JQ7A 2ZDQA 3ZQ6A 2Q0OA 4FZVA 4CT4B 1PUFB 1U1GA 3IXMA 3EC1A 2UZ1B 1FBTA 3OFKA 1RADA 2IA1A 3KQNA 3RS0A 3A4NA 1XVUA 2E5WA 5CNJA 1T98A 3HCPA 2B8NA 5EHIA 4ZVVA 1N1GA 2A9FA 2WVGA 1H1LB 2Z3VA 3H1TA 4LMYA 1WTCA 2IIBA 2VDWA 2PIAA 4XWYA 2MC4A 5EZQA 5SZHB 2VOPA 1A9TA 1CUFA 4ITRC 3ZX4A 5DLQC 4NZMA 1ZOPA 4GI1A 3EPJA 4YCBA 1CUIA 1VNDA 2BPOA 3G1OA 4P5PA 2MD5A 3OCJA 4GWKA 5CT6A 5K4AA 3UKJA 1CRZA 1MGOA 1E2NA 5ITZA 1KDYA 1G4UR 4JUDX 2PSEA 2WP0A 3SXPA 4C4XA 2BXZA 2A88A 4B3RB 3WU0A 4BY1J 5HZGA 2PMCA 3WBJA 3T7TA 3GJTA 2XHZA 3R5TA 5ERXA 4UBLA 2WYUA 1YYVA 1ZIDA 5TQVA 4KREA 1SBHA 1G8AA 4YRPA 4U0WA 1WEHA 3ZWQA 2XODA 1VQ1A 1ZG3A 4KYWA 3MVEA 4FMCB 5J2TF 2Z9OA 4ZIRB 1YJXA 3N0RA 4LWQA 2KE5A 4P58A 2VRCD 2RG1A 4UM8B 2V1UA 2UUZA 5IP7J 2EFCB 4IY1A 4EVQA 4CYDA 1RYFA 3K1NA 3VZBA 3W77A 2BVMA 1LEBA 3H4MA 5DGXA 5CX4A 4IW3B 2F43A 2F17A 3HVJA 2FE4A 1FSGA 3BHMA 3F1KA 4G24A 5FNZA 4AJHA 4NHJA 4ZJZA 2L5QA 2P6OA 1MRSA 2J9XB 3WLSA 4BFCA 3EVEA 5EZ6B 2ZBDA 3ESCA 3AFHA 1CEQA 1Z16A 3ENWA 4XDYA 2ZBQA 3R77A 5SICE 3RAGA 1W73A 4II2A 1FVFA 4N5LA 2HVRA 2LTPA 5CH8A 5FBRB 1C3VA 1JAXA 3OS2A 3PUHA 5DGTA 3S3TA 2YIVX 1QIDA 4YR9A 2VNIA 2ZT5A 4C3HJ 3LT4A 5IT9Z 4XASA 3SVLA 1VL5A 1G20A 4DXAA 1JGTA 4E5YA 5AUNB 3SHWA 1DKMA 3IWFA 4CQNA 3VSLA 3S17J 2DHDA 1Y1VJ 2WFLA 3B1YA 3KQKA 1KC3A 3WG9A 3BVPA 3U6BA 1XXHB 2WF8A 4EI2A 1R4MA 2BGKA 2OV8A 3ISPA 3OIUA 2B1IA 3OMYA 2MJLA 3W5SA 4Y2SA 4AJJA 2PRIA 2C9DA 4LOJA 4MYCA 4TQ9A 1R3UA 3OBBA 4PJMA 3SHFA 1CUVA 2Y8EA 1VRCA 3PD7A 1N0IA 5F0HA 4IMIB 4URWR 2IU0A 2A14A 2NAZA 1TMOA 5J3LA 1CY2A 1OVGA 1WJGA 2BSQA 3E6BA 5B2EA 3AI1A 1OAOC 4KFSA 4A3JJ 2Q4EA 3IQGX 5BYAA 1S3GA 2ALJA 3MINA 2QSFX 2HRRA 3V2UA 2C7BA 2CUKA 1SU4A 1TRKA 1BE6A 4L9VA 1RZUA 2CE7A 4ZMSA 3EGIA 3O2PE 2GBLC 1T3HA 2NG1A 4LX8A 5HLHA 3UA3A 2UV8A 1ZFNA 2P90A 3B12A 1VYVA 1PO7A 5KIAA 4Q4HA 1HT2E 4G6DA 4FPXA 1EWVA 5DH9A 1U0LA 1GZ7A 3KT3A 1P1BA 2ZRKA 3KFVA 4ZXPA 4C14A 2A6TA 1CY0A 3GRYA 4KNWA 1IN4A 3HY6A 5HFNA 3TS1A 1PYDA 5LOVB 2Q2QA 1DOZA 1NVTA 1J39A 1PR1A 1TWAJ 3E6AA 4TXJA 1BC5A 3ENQA 4F06A 4YIHA 2JIZD 5KNBD 1MJ9A 4MDYA 3U26A 5JI2E 4Q7LA 1D6JA 4BXFA 2AFVA 5AUOB 4UVGA 3H19A 3SYNA 4B87A 2ISZA 3FJYA 3X44A 2IBTA 4ILEA 5IPFA 1XD9A 3IP8A 1TC3C 3PXCX 1H89C 3FSEA 3PUWA 4IRUB 3FLMA 3C1DA 4FB5A 2VQHA 2J30A 3TO7A 1ZM4A 2GFIA 4RV9A 4ZT2A 5FKMA 2FSPA 2ZRIA 5KNCH 1RRGA 3DTKA 1N9KA 1RWBA 4DM3A 2HF8A 3E18A 3OHMA 4GPTA 1L8XA 3EY4A 5ALRA 1MO5A 1JEQA 4YXWA 5CFPA 1F3OA 1GL9B 1G17A 1QR2A 1EIWA 5KCZA 2ZRLA 4QU0A 3BF8A 2R11A 1P74A 3WQQA 1CULC 1FPMA 2GEJA 3CCCA 1A7UA 3A28A 2G9UA 4R2IA 4W63A 5JDCC 4EHDA 5LP6B 4AZ0A 3UK1A 5AVYA 4OLFA 1M1YA 3D1JA 1BS2A 4H08A 4IINA 3WIVA 4L8LA 2G04A 4LBYA 3JYQA 4MGIR 1D6MA 4O0LA 1PI3A 5JSFA 2Y48A 1F5NA 1LW7A 1U8TA 4X6UA 1USVA 2P6PA 2X4GA 4DM7A 4LF8B 2OCGA 2PCLA 2QT0A 2C78A 1SU8A 5HIJA 2B7CA 4EAQA 3H0CA 5JEDA 3BWMA 3O4VA 1X1AA 4GSYA 4JR1A 4IXAA 5KYXB 5D5VB 1KL7A 3B8EA 3IP9A 4XOPA 1JKFA 1ZH2A 3OE7A 2FQ4A 3IAS2 1PFWA 3GZ5A 4FSHA 5C1BA 3ABTA 2DLDA 2PKRA 4MUHA 3IT2A 2QM3A 1YC2A 3ROTA 1F1ZA 5A2QZ 4IV8A 1IXSB 2L7MP 4E2FA 2JI4A 4WACA 4ZOQI 2BGRA 4UUMA 3INGA 4OHOA 1JT0A 2WMYA 3BMQB 1XZAA 2AHQA 1P29A 1DKRA 1NF3A 5AK5A 4NARA 4X65B 5CQEA 3SSOA 3STVA 4NATA 2HA4A 4KQXA 3E5UA 1TZLA 1ATIA 2HKIA 4CNQA 1NBWB 4B47A 4D43A 2CL0X 4H7IA 2A9QA 2JL1A 2QSUA 1PV4A 4UZEA 3QM1A 4K8OA 2OMKA 1YQ9A 2K85A 3U16A 2ZGVA 5FUQA 5LU9A 3RT7A 5FFZA 1ETWA 4RM2A 4ZYHA 1JXSA 2RGNC 3G7NA 3ZGKA 2JHFA 4G0MA 4RDHA 4RM3A 3QUTA 4QPZA 2D5IA 4Y30A 1H8HA 5DT2A 4EGCB 1QG2A 4ZGGA 5B6JA 4G5GA 4UAJA 3R9IA 3SSAA 1BQ3A 3QLVC 1P0FA 4LJZF 3FOZA 3KZOA 4DC1A 1A2QA 2PHZA 1GNTA 2C8VA 1W94A 3EISA 4BLWA 3GMIA 1QQBA 1V3QE 4LZWA 1GKYA 1Z28A 3UT6A 2BBWA 4E08A 1DKUA 4B09A 1S8OA 1RPJA 3WTXC 2PZAA 3NDRA 4QTUB 2QENA 1FW8A 4O29A 4RX1A 5K0JA 4B43A 3ZCRA 2I1VB 1X38A 2CLLB 1OLUA 4CCMA 1RWWA 3NT5A 3GL9A 4MKHA 1OFUX 1VJ0A 2G5PA 5IFKA 2WWTA 1Y39A 4WI1A 3P2IA 2E60A 1ZGHA 4KL8S 4FGLA 4OQLA 5LVAA 4O4JA 2BZTA 3CX7A 2ZRJA 4WY5A 5HS7A 9ANTA 1UWVA 1MNQA 1W25A 2ZK7A 3E22A 3MAGA 1PV2A 5H7XA 3OT4A 2M4KA 4JYKA 2H2HA 3B6JA 5HFJA 3RVBA 1I7SB 2GJKA 3IE0A 1JDNA 4LJ8A 2JAXA 4MVWA 1KO7A 2GZ3A 4W5NA 3WL5A 2PZMA 4YO7A 1HKQA 2H2DA 2QRVA 2OGWA 1J06A 2Y99A 3KJQA 4XJVA 5D00A 3UAGA 3TQFA 4ZDWA 4BYGA 3TZLA 1L1EA 2J3JA 2XQKA 3RU7A 4BO5A 4MO7A 2J4DA 3G17A 1AA7A 4MUXA 4IOKA 4EG7A 2ZTUA 4PR0A 2C58A 1L5RA 4RO0A 5T57A 4C7VA 3BK2A 2B0LA 1JHXA 1VP3A 4QYXA 2KIMA 2EIKH 3OYEA 1BMQA 5FLVA 1JDBB 3OY2A 4EKNB 4G0OA 4UDNA 3WDLA 1LPNA 1Z2DA 4UREA 4EG5A 1C1HA 3W06A 4QM7A 3SK0A 4LF5B 4OHBA 5EIEA 1MMAA 1QX4A 2UAGA 2QF7A 1CSEE 1NF9A 2XF7A 1VB5A 2GAFA 4KQHA 4QRIA 1D1BA 1ZD9A 5ERIA 1H0RA 3CVVA 1Z4OA 3L9WA 5CH3A 4BOYA 4E4TA 4H0EA 1UAAA 1KJZA 1B9NA 2FR1A 2Q62A 4M0EA 1YW8A 3VH3A 5A2QK 1WF3A 5CCEA 2V58A 3HGTA 1V11A 2BONA 2VAMA 3FUXA 4NENA 3V8VA 3W2IA 3RYHA 4KN5A 1IFXA 2I78A 3L0SA 5JFTA 2X85A 3NC1C 1R8QA 1I6LA 2AZTA 3FG9A 5INTA 4Q3AA 1V45E 2IITA 1BRMA 1VFNA 3L8HA 3GOHA 3OCVA 1IJEA 5HOQA 5K03A 3H7IA 2ABWA 1IONA 3ZWXA 3CKLA 2AQKA 3LRPA 4POAA 4HSTA 3I5AA 3CEMA 1V4VA 3RUEA 1P4SA 1GUFA 1SFKA 3PQFA 1I7QB 1H69A 2L7KA 2AC7A 3DL7A 5LNK6 2FW7A 2ZCUA 1ZHFA 3LFKA 3B3JA 4WKCA 2VNHA 4E32A 1FUIA 2DCEA 3M81A 4J00A 3BJRA 2JZYA 4NL4H 2C54A 2G82A 2P8SA 4ZRDA 1L5KA 3MYYA 3GV0A 4YONB 1R18A 1R64A 5BV7A 3ZWDA 3ECHA 3OL4A 1DXYA 3RC1A 1P2GA 4AY5A 1USGA 4Q1EA 3CCFA 4Q4CA 1BYIA 5G1NA 2JD1A 3MTEA 3BBPA 1NRIA 3LNCA 3HIFA 1USWA 3GDFA 1Q1ZA 4G1UC 4ZODA 3FX3A 4LHXA 2M2IA 2COMA 3QUAA 5AW8A 1QU2A 2P8TA 4BO9A 1BXKA 2D2VA 1DDGA 1E5XA 5B53A 5K4GA 2OYSA 4JYPA 3D0RA 3JZDA 5C3UA 1FFDA 3JTEA 3QE2A 4JLWA 1SG0A 4JZKA 5I9IA 4P9UA 1EG2A 1QG0A 1PG2A 2VL8A 4RB0A 2XW6A 4NPAA 4RXTA 3ZQLA 3QFRA 3IAM1 1V3TA 3KU4A 1OI4A 3V55A 1EZ4A 5BV2P 3WKBA 1XJWA 3GLXA 3EMVA 2YV5A 5JAQA 4ACAA 4EMBA 4Z6KA 3ZE2B 2CL6X 5DNCA 2K86A 3J80A 3X1ZA 5HS8A 4BVLA 1TDJA 2O8DB 4DW6A 2FN3A 1DCFA 4B0PA 1P17A 3VHLB 5HILA 4J76A 4MUAA 2O54A 3UJ8A 3FIJA 3OQPA 4PSKA 4XGQA 4JR2A 2L01A 3VU9A 5C4IA 1VE7A 1HL3A 1QQAA 1MJAA 1OX4A 3CPJB 4EENA 3HA7A 4N0MA 3DMRA 2Q1SA 2J3LA 4EYGA 1NLMA 3EH1A 4MLPA 2OO5C 4A6EA 2NYRA 2JSCA 3ESZA 5IBRA 3R9KA 4AQDA 4KQ9A 1R74A 3BGSA 3IBCA 4WBSA 1P61B 2QLJA 4BMSA 4D8WA 4GOMD 3AF1A 4QYIB 1VYTA 4KX5A 4KHZA 3PX7A 1Z2CA 4AF6A 2NP7A 4IDPA 5A9SB 3F6YA 2HW8A 1NVWQ 4MPDA 2E34A 1TBXA 1VQLI 1JEAA 3KUDA 1QHHB 3U4IA 4MO2A 2B37A 2VT6A 2V6JA 4CR8A 1W2WB 3OKFA 3UWPA 5L53A 3WTSC 5LQJA 3ASZA 3OYKA 3I1YA 4GKBA 2NU8B 2DK5A 4D81A 4M3DA 1IUNA 5DNDA 5IT0A 3UMGA 1DP7P 3HA5A 2ZUUA 2W58A 3NH6A 4H4DA 5ETJA 4M8SA 5HODA 3FF5A 2E48A 5CFOA 1IVYA 2WWRA 1NMXA 1P39A 2FSGA 2J9GA 1MC4A 1AQIA 1C9NA 1TO2E 2I71A 1UEXC 3JALA 4GRDA 2Q7DA 1XWFA 2X3YA 2LVSA 2R7NA 3P2KA 4GW3A 3TBFA 5LGUA 2OV1A 3U44A 4FX2A 2Z30A 1EGAA 3GJSA 2A3SA 3FNHA 4YV2A 3DC2A 3OIDA 1DLIA 2X6YA 1EDEA 1QLWA 1WHTA 2GXUA 3OYDA 1MMNA 2ZRMA 1XK7A 3NNDA 2A07F 4JBIA 2ORYA 1KNXA 1QMGA 1UKBA 5HLTA 1FTGA 4UDXX 1QDLB 4A3IJ 2AMJA 1N7IA 1E2KA 3IHUA 3PFYA 2VKVA 3T0YA 5H2FC 1ZO8A 2QN6A 2HCRA 3A3OA 2RGYA 4GOXA 3GRFA 5LYJA 3E23A 4XB2A 4PO9A 1LS6A 4QDXA 4WCFC 1ID8A 4OSEA 3DE2X 3W8FA 5D84A 1SUCA