3H5NA

Crystal structure of e. coli mccb + atp
Total Genus 109
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
109
sequence length
347
structure length
338
Chain Sequence
MDYILGRYVKIARYGSGGLVGGGGKEQYVENLVLWENIIKTAYCFITPSSYTAALETANIPEKDFSNCFRFLKENFFIIPGEYNNSTENNRYSRNFLHYQSYGANPVLVQDKLKNAKVVILGCGGIGNHVSVILATSGIGEIILIDNDQIENTNLTRQVLFSEDDVGKNKTEVIKRELLKRNSEISVSEIALNINDYTDLHKVPEADIWVVSADHPFNLINWVNKYCVRANQPYINAGYVNDIAVFGPLYVPGKTGCYECQKKENIDHKIKLINSRFKPATFAPVNNVAAALCAADVIKFIGKYSEPLSLNKRIGIWSDEIKIHSQNMGRSPVCSVCG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transferase
molecule keywords MccB protein
publication title How the MccB bacterial ancestor of ubiquitin E1 initiates biosynthesis of the microcin C7 antibiotic.
pubmed doi rcsb
source organism Escherichia coli
total genus 109
structure length 338
sequence length 347
chains with identical sequence B, C, D
ec nomenclature
pdb deposition date 2009-04-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00899 ThiF ThiF family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1160 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3h5nA01
3.40.50.720 Alpha Beta 3-Layer(aba) Sandwich Rossmann fold NAD(P)-binding Rossmann-like Domain 3h5nA02
4W6ZA 3F4LA 3WTCA 1WVGA 4OYRA 4WGGA 1QG6A 2HMWA 2AQKA 2JD1A 3JQAB 1YOVB 3CMCO 4XA8A 3BMQB 3UVEA 4ITUA 3GHYA 1LQTA 1ZIDA 1U5AA 2B0JA 3PFFA 3TN7A 3A4VA 3EYWA 3GZNA 1JKJA 2HKIA 3EVTA 3FI9A 4R1TA 3G3EA 1SOWA 5BNFA 3VC7A 5ILOA 2E4AA 3MJVA 1TLTA 4NJMA 4PLGA 1UP4A 3KOUA 3L6OO 4DBZA 1U4SA 1WDMA 4J16A 5DOZA 1FDTA 3PGXA 3DMTA 5JAZA 1GAEO 9LDTA 3D5TA 1KVTA 3ZN2A 1HTBA 1E3JA 5C37A 3H65A 4KUHA 1E6UA 3TZCA 3U3XA 4JP3A 1H0KA 3SVTA 3MOGA 3HUDA 4LISA 3FR8A 2VZ0A 3F47A 3CUKA 3VKVA 3D64A 3KYBA 1HETA 4WJZA 2HK7A 1SB8A 3DO5A 1YB4A 4J1NA 4A2CA 4IBOA 5DCYA 4IJUA 3ZV4A 4A73A 4BB5A 4LCEA 3U62A 1I0ZA 5L7YA 4D3DA 4Y67A 2RH8A 1P45A 1FK8A 3ANLA 1FMCA 1ZBQA 3PEFA 4BB6A 2CMDA 1A27A 1DO8A 4BIIA 3SC6A 1PL8A 3BHIA 1Y1PA 3D5QA 3TPCA 3PK0A 3RI3A 3EY4A 1R4NB 2VWPA 4KOAA 5IFLA 2C59A 3TQHA 1E7WA 1C0KA 4OXYA 1F8FA 1ZKMA 2DM6A 5C7IO 2GN9A 3UCFA 1S7CA 3S2IA 3AOGA 4KDFA 3SJUA 5EJ2A 4CMBA 2B5VA 2NVWA 4JJGA 2DQ4A 4CMEC 2B69A 2CDBA 3A1NA 2X9NA 3PIDA 4ID9A 5F1OA 1ULSA 3ETGA 1NFRA 3WIEA 2Q2VA 4KTVE 3RQSA 2BFOA 3ZHXA 1ZZEA 4J4HA 3ZGYA 1U2GA 4PFJA 4CMHA 1WZEA 4Y6SA 2NM0A 4BGUA 2V6MA 3AM4A 3BMNB 1VSUA 5CG2A 1AXGA 1I30A 2DPGA 3DZJA 4CLDA 4P8RA 1N8KA 3KVOA 4MJLA 2Q99A 5A3JA 2J5KA 3HN7A 1ADCA 3AI3A 4PLFA 2BGKA 1ENZA 1ZMTA 3EAGA 2NNLD 3IJPA 4UVEA 4XQEA 3OECA 1PS0A 2G82A 4ZVVA 4ZICA 1N7HA 1TXGA 2YHIA 4QQRA 5JE8A 1BSVA 4HFRA 1NQOA 3E1KA 4E3ZA 2PTGA 2P4QA 3RJ9A 4LW8A 4PG4A 2GDZA 2Y1FA 4IDDA 3NDIA 4FPXA 1O0SA 3RUEA 4BMNA 3PQFA 3I5MA 4C4OA 3ZU4A 2IZZA 2Q3EA 4J9VA 3GAZA 2C2XA 4RQUA 4UVDA 1N1EA 3RWBA 4LMPA 4CJXA 3E9NA 1I2ZA 1XWFA 4J2HA 1ADGA 3ULKA 3W4JA 1JVBA 5L51A 3O8QA 4LK3A 5TC4A 4A03A 2GCGA 5IF3A 2Q1WA 2DTEA 4XB1A 3GQVA 4Y6RA 2DBRA 5JCJA 4R4JA 5ER6A 1LLUA 2YV3A 3FNFA 4GMFA 2V6FA 3GHHA 3GT0A 1XU7A 2GZ3A 2IYPA 2VZ9A 1T4BA 5GMOA 5IXYA 5JAIA 1H6AA 4TKLA 1HE4A 1PGPA 4K28A 1B8UA 1WXDA 2Q4BA 3UCEA 2AA3A 2AEMA 5JXWA 1Z74A 1JKFA 2FSSA 3BHMA 5JS6A 3VKUA 1ZW1A 2CD9A 1JVSA 4O0LA 4IZIA 1CDOA 2Z1MA 1RM4A 3DONA 4YT8A 1ONPA 3WYEA 3BMOA 3HB5X 2PGJA 4WNCA 1PJ3A 4MVJH 3JD4A 3TNLA 1HE5A 1VE9A 1JWBB 4RPKA 3H5AA 2D1YA 1N7GA 4EUFA 2HRZA 1YBAA 1VL6A 1HF3A 4FDAA 3FD8A 1LI4A 5JW6A 1U4OA 2YV1A 5F5LA 3ITKA 4L75A 5F3RA 3ZNPA 3LC2O 1C1XA 4OSOA 3QWBA 3RUAA 5HS4A 5I7VA 1N9GB 3GFGA 5LDGA 1PGJA 5MDHA 1IOLA 2ZCUA 4OMUA 3E9MA 4KUEA 4CM3A 3L6DA 4N5MA 4RVGA 1HXHA 7ADHA 2QYSA 3CE6A 3SBOA 4Z3KA 3OSUA 3TOZA 5CDTA 4J7UA 1O95A 3GOHA 1GCUA 5EPOA 2I76A 4J2OA 3PHGA 1GZ4A 3EZLA 4R01A 3V2UA 3UHAA 3FPLA 4HNHA 4IXTA 3P2YA 1DRUA 2W2LD 1KEPA 1UDAA 3WBFA 3OBBA 1XEAA 2GRAA 1HE2A 5GZ3A 4XKJA 1MP0A 5DZSA 3G0OA 2YZ7A 1LSJA 4NFYA 1BGVA 5CDGA 2EKPA 2VYNA 3INRA 2I65A 3GMDA 3D4OA 2A9FA 4P4LA 4PN3A 2FR1A 3LT1A 4CODB 5KJ1A 1MG0A 4WEOA 4BNLA 3O03A 3VDQA 4MVJP 3OJLA 3U0BA 2FY8A 3I4FA 1MXHA 3JYPA 3LT4A 4HFJA 4JQCA 3AUSA 1OC2A 4B4WA 4W99A 3D4PA 4ZQBA 3GK3A 3T7CA 4E2ZA 5KKCA 2X0NA 3KV3O 2Y0DA 1IYZA 1H6CA 1WPQA 1XSEA 3DZIA 4BO8A 4BNMA 4B79A 3VTFA 2GERA 1ZH8A 4D3FA 4GBJA 4DA9A 2FRDA 3OP4A 2Y05A 4CV2A 5AXAA 5L4LA 1QLHA 3AM5A 1G0NA 2XPCA 4YCAA 3WR5A 4B4VA 4BVAA 3G1TA 3EW7A 1ZK1A 4L4XA 2J5RA 4YJHB 4BV8A 1KVRA 2QZZA 4W7IA 5EESA 3WGGA 2AQ8A 3PWSA 2HJRA 2PD4A 1NVMB 3DR3A 3MJEA 3TWOA 4CR7A 3MJTA 1DC4A 4I5FA 1UR5A 4B8ZA 5A06A 3D3WB 2NV6A 4D0SA 4BKQA 3PVZA 4UUMA 2ZATA 1KOLA 1PJ4A 3GNQA 4IY1A 1K2WA 2HAEA 4CUZA 3KUXA 5TT0A 2NWQA 3JD1A 1A4IA 5JDCC 2WDZA 1S6YA 4DUPA 5TRTA 3UAGA 4ZQGA 4PIVA 4BNKA 1DRVA 3AUAA 3M6IA 3UOGA 3KYDA 3NGXA 1OAAA 4CQLA 3U09A 5CEJA 1BW9B 4J4BA 3K96A 2HUNA 5A1TA 3F5QA 4L0QA 4MKXA 2ZKLA 4NFHA 2H63A 3WGZA 1YO6A 1HLDA 3PZRA 4E5KA 1EUDA 1LDNA 4MVJM 1ZFNA 4PLTA 1OBFO 2VWHA 4A10A 1DEHA 1R4MA 1LDYA 1Y8RA 4FFOA 4NBVA 2JL1A 1ZXLA 4J90A 4AJOA 2CZCA 4LVUA 4CQMA 2Y93A 3IUSA 3ASUA 4MVJG 1D7OA 1ZXBA 3AI2A 3JQGA 4CUKA 3BA1A 1BXGB 5I7EA 2NU7A 4PG6A 1X1EA 1PZFA 1EVIA 2GR9A 5IN5A 1PTJA 3WGIA 5HRUA 3ZWVA 3QVOA 3L77A 3NT4A 4OAQA 4RPGA 4DBVO 2FWMX 4UEKA 3F1KA 4JX8A 3KSDO 3O4RA 4FSHA 5DCUA 4UUPA 3ROPA 3JQ7A 4OGWA 4OOEA 1MLDA 4D7AA 2VUTA 1D3AA 1V3UA 1Q2XA 4XGKA 1P1KA 1PS9A 1DRWA 1M76A 4ZA2A 4XQCA 3PDJA 4CLRA 1E3WA 1EMDA 3FF4A 3KO8A 4KP7A 4OH1A 4KQWA 3Q3CA 2D0IA 2ZJ1A 3VH1A 5JO0A 4YA6A 3W6ZA 1U2DA 3P5SA 3AW9A 1MV8A 1YBMA 1G6KA 1Z7EA 1NVTA 1YOVA 3JQAA 4S1VA 4EITA 1DOHA 4BO1A 3X2FA 4RGBA 1A5ZA 1ZSVA 4DC1A 2ZB4A 1DFGA 2HSDA 2ZYAA 2PLAA 3MTGA 2VCYA 3P19A 1ZSNA 3B1JA 1B14A 4AFNA 4A7PA 4MVJI 3RD5A 2HMUA 4DPKA 1VJTA 1T24A 1P1FA 4YAJA 1PZGA 3I3OA 3DBRA 4BQRA 1Y6JA 2DTDA 2EWMA 3V1UA 3N74A 3IL2A 4D41A 2Z1NA 4QTZA 4WCFB 2W98A 2R6JA 4DIFA 1DJQA 4D42A 4RJTA 1UXGA 4A0SA 4EJ6A 4BO7A 3CINA 2BRUA 3GAFA 2HK9A 3FHLA 3GGPA 5I9MA 1GUYA 3KEOA 3D1LA 3Q1LA 3ZNOA 3GEMA 3I9NA 5BR7A 5G0UA 4OM8A 1V8BA 2XXBA 4XIJA 2PH5A 4DREA 3PWKA 2G0TA 1X14A 3LSYA 1PJBA 4ND4A 1KC1A 4L8VA 4K1LA 2B35A 3I6QA 2Q49A 4A5OA 1JAXA 2DUUA 5T8KA 1PGQA 1GPDG 2ZK7A 3D0OA 4IPTA 1EDZA 3AWDA 4QEDA 1E3IA 1ZO8A 2R2GA 4FC7A 2FPPA 4BO4A 5IDQA 4BL5A 5L3ZA 4PRLA 3LVFO 3H2ZA 3C7CB 3TF5A 5JMWA 4JJIA 4YAIA 2EKQA 4R68A 5IDWA 2C5AA 4JBIA 1QYDA 3E8XA 5CAEA 5JY1A 1B26A 1WNTA 1ENPA 3I9JA 3VZPA 5HM8A 3M1LA 4PLVA 3IP3A 1E7MA 3INGA 2WD7B 1UXHA 5BSFA 4B7UA 1ZCJA 4R41A 4GMGA 3R0IA 2Q50A 1P1IA 2CVQA 4ZN6A 3DOCA 2O2SA 2VHWA 3C85A 1XIVA 4RV9A 5JO9A 1LX6A 2GSDA 2E49A 1SPXA 3G1UA 3JD0A 4LVCA 1P1JA 4E5NA 4M8SA 1G1AA 4R9RA 2E48A 1SEPA 3ZZNA 3GPIA 1U8XX 1DFIA 3BTUA 2ZTMA 2HMSA 3FR7A 4CMGA 5I8WA 2AMFA 1SAYA 3C24A 4YWJA 5KVCA 3K30A 1P1RA 3BTVA 1CRWG 3VZRA 1VKNA 4IZHA 1ISFA 1J49A 1GUZA 4BNVA 1I2CA 4ZU3A 4FQ8A 4M54A 3LT0A 1IULA 2GPTA 3NJ8A 2C29D 1RM3A 3LT2A 2XAAA 1BTOA 1NFFA 3DQPA 5KJEA 1U3TA 3OF2A 1Z75A 4AJJA 5I8ZA 4B3IA 3H8VA 2J8ZA 3VPFA 3QRWA 3JQBA 2IXAA 4ZQEA 1WMBA 2SCUA 1GQYA 5K9ZA 3QVXA 4GH5A 1U1IA 2NADA 2O3RA 2VNAA 1LSUA 2V6GA 4EJ0A 1DIRA 2C54A 3JQEA 5F21A 3JYNA 4AJHA 3PYXA 4E6PA 4XYEA 2ZB8A 4D0RA 1GQQA 5A03A 3BTOA 4K6CA 2GYYA 5BNTA 2PNFA 1HYGA 3HN2A 3LC1O 1UUFA 4BGEA 4I5DA 1RPNA 2PKQP 2BI8A 1WZIA 1YXMA 3ZNQA 3UH1A 4F6LA 2OMEA 2FPIA 1PWZA 3M2PA 1MFPA 5DN9A 1WMAA 1XELA 3GA0A 2X7HA 5AYVA 2Q1SA 5DNAA 4UVHA 1P33A 2JAPA 4NMHA 1A9YA 1YL7A 3GDFA 2C20A 2W8ZA 3TZHA 1ISHA 1Y7TA 1ZUD1 3O9ZA 1KC3A 3TSCA 3ITDA 3WTBA 1WDLA 4ALJA 2AQHA 2PD6A 1PWXA 2DFDA 3AM3A 3GG2A 3HQ4O 2BMAA 5TJ9A 5C5IA 4DIBA 1BDBA 3MJCA 3GLQA 5BQFA 1B2LA 1U3VA 1N92A 5EMHA 2E6UX 3ZWPA 4WOJA 2GN4A 3EC7A 3D4NA 3DTYA 4HKTA 5DBGA 1N9GA 4EI2A 2XF8A 2Y66A 3VOSA 1BMDA 1HDRA 1PL7A 2OUIA 3BMCB 1J5PA 4BNXA 3WYBA 3I6IA 3Q6IA 1HRDA 4EDFA 2QZ9A 2YHUA 5JMPA 1XU9A 1PJTA 3M2TA 5CHEA 2RIRA 3SLGA 4E32A 1GYQA 2QRKA 4HNGA 1UZMA 1JA9A 1EE2A 4ZQFA 3HDYA 5JBIA 1E3EA 5EL0A 4YT2A 1AUPA 1RKXA 3T7EA 1NPYA 2B4QA 4D3SA 1MA0A 3KZVA 1GZ3A 4NH4A 4D44A 4IQ8A 1E5LA 3E03A 4OHUA 4W82A 5CDUA 4YEDA 5I7FA 1O5IA 4IS2A 4AJLA 4XD2A 1GV0A 4WLNA 1LC0A 5LC1A 4ZRNA 3NTQA 2AG8A 5G4LA 1ML3A 4BMSA 1WLYA 2G5CA 3MEQA 4Q3BA 1HDGO 3HG7A 3DBHB 5AVOA 4CR8A 3TFOA 3JYLA 4BKPA 3TZKA 2VNSA 1ISIA 3A06A 5A3VA 3ORFA 2YUTA 2EKLA 4O63O 4MIEA 4GGPA 2Z95A 5CDYA 2R00C 5MGBA 4J49A 1JWAB 2X58A 1NASA 2OFPA 4J1SA 2QX7A 3DAPA 3E6AA 1BWSA 5AOVA 1DAOA 3WXBA 3GZ4A 3M1AA 4TVBA 2DBQA 4FD3A 1I33A 2G17A 3ANNA 3CH6A 1IB6A 3NJ4A 1GTMA 3AK4A 2B4RO 3K9QO 3PQEA 4GKBA 4J3FA 3DWFA 3PYLA 1PL6A 3B1KA 3KYCA 1YKFA 3OJFA 5BNIA 3R3JA 5JAQA 4IDFA 3P7MA 1GU7A 5EQFA 3TZQA 3VH2A 5C7LO 4MOWA 1RWBA 1DC6A 1UDBA 2I5PO 5IG2A 5JDCA 1Z73A 4TZTA 1C3VA 4GWKA 1NR7A 3F3SA 2VTEA 4UVGA 3QE3A 1SBYA 1M6HA 2LDBA 1VJ0A 3DBLB 5EN4A 3QWIA 4DIOA 1PR9A 1ZEMA 1Y9AA 4BKRA 4CM8B 1HKUA 1TVEA 1LUAA 3D3WA 4E2XA 5IZ4A 4AG3A 1UP6A 4BO2A 2OL4A 4CLOB 1LSSA 2NUAA 5JC8A 3NDRA 3L07A 4E12A 3QHAA 2HLPA 1YBVA 1E6EA 2IXBA 1QKIA 2J5QA 1ZK4A 4GGOA 4QFCA 1GD1O 1XG5A 4YTEA 1T4DA 3WSWA 4JCOA 3ETDA 3KLPX 4BO9A 5TX7A 1FDUA 2FZWA 4NBUA 4BMVA 1BW9A 4PG8A 1I24A 3KETA 4FN4A 1JN0A 3RBZA 2YYYA 5G0WA 2WWRA 2C2YA 3QV1A 1K0UA 4YT5A 3DZKA 4N7RA 2JFGA 2DLDA 3AY3A 4P38A 4HWKA 2IEBA 1MXFA 5TNXA 1B16A 3NTRA 3RSHA 5KCZA 2H5LA 1PJCA 4F46A 3PQDA 1ISGA 2X5OA 5T8KC 4BNNA 4TVOA 2HO5A 1PJ2A 3U4HA 3PI7A 1YB1A 1D1TA 2X22A 3C7AA 5JYDA 1LRKA 1HDCA 3H7AA 4IIUA 1YL6A 1NTOA 4MPDA 4OXKA 4XQGA 2E82A 2D59A 3FTPA 1K89A 4G81A 3E82A 4Y9DA 1T2DA 3RUFA 3CEAA 4IDCA 4PVCA 3V8BA 1X0XA 2OO5A 4X54A 3RFVA 1LLCA 2WEKA 1TI7A 3FNEA 4E2WA 5I9NA 1QLJA 4HY3A 3GUCA 4FFPA 3F1LA 4QT0A 1P44A 1JAYA 3KBOA 1HDOA 3A14A 4Z0HO 3BIOA 3KHUA 5BSGA 2X1HA 5L4SA 2NQTA 1E3SA 4MIYA 2QRLA 4H16A 1K6IA 5KVQA 8LDHA 4I5GA 2V7PA 4PLPA 1YWGO 3SC4A 2J3IA 1B8VA 3WNQA 4E4YA 3L4SO 4TKMA 5ENVA 4M55A 2FN7A 4FR5A 3WFIA 3RROA 4BO5A 2V65A 3K6JA 2CY0A 1GPJA 5JLAA 1NR1A 1P31A 3BAZA 1I10A 3ZH2A 1PGNA 2C0CA 2DTXA 3DOJA 1DDOA 4M87A 1H9AA 4IJVA 5DP2A 5KTKA 3GEDA 4JBHA 5L9AA 1QV7A 4GQAA 3KSZO 1OMOA 2C7VA 3E5RA 4NBRA 4PZEA 1EQUA 1ZVMA 5BSEA 1K5HA 1LJ8A 2EJVA 1B0AA 4DTIA 2CVOA 2NU9A 2HU2A 1UJMA 3HADA 5DBFA 4BNFA 3LQFA 3RJ5A 3I52A 4ALKA 2UDPA 2W90A 3RC7A 4JBGA 1JLLA 2X6TA 1EEHA 2CF6A 3E18A 5CDSA 3H9EO 3JQBC 3V5NA 1EVJA 3G17A 4WLEA 4AJ2A 1UH5A 3A9WA 4AL4A 4BGIA 1VKOA 1BVUA 3C1OA 3OIFA 2I66A 1X1TA 4E0BA 4M86A 3ZU5A 3DOOA 2A92A 3QWFA 3ZV3A 5TF4A 1EBFA 2JFHA 4DXHA 4RLSA 1TT5B 3H3JA 5TIIA 1XQ1A 1PS8A 5A9SB 1GUFA 4L9RA 4P22A 1BHSA 4R1SA 5A5FA 4Y6PA 1UXIA 2HMTA 1E7QA 2ET6A 5I9LA 2W2LA 4XEHA 3ZU2A 2VUSA 4B7XA 1ONOA 4HBGA 2O3SA 4J7XA 3IP1A 4YVFA 4IUYA 1UP7A 3HFSA 2P9GA 1E7SA 2CFCA 4J1TA 1LXCA 3RUHA 3VPXA 4HV4A 3Q11A 4XJTA 5L95A 2O7QA 4XZ3A 2NACA 3RU9A 1EBUA 4ILKA 2PA3A 1DLIA 3MOIA 5HTOA 4JLWA 1VM6A 4YJGA 3SEFA 3CMMA 4TROA 1H6DA 3NYWA 4ZGWA 5IJZA 2BFPA 4QXMA 4I5EA 4RVFA 4H7PA 1HDXA 1W4ZA 3WOHA 4BNZA 3I83A 1GEEA 2J3KA 2PWZA 2GASA 4BNTA 5KIAA 2EJWA 5A05A 2WD7A 1TB4A 4DPMA 3GPDG 4RZIA 3EVNA 4DVJA 2DKNA 3VPSA 2AG5A 1J0XO 4BOYA 4K9DA 1VI2A 4MKZA 2DUWA 2C5EA 3JQ8B 4QX6A 5J23A 1MX3A 4OKNA 1DB3A 4RCVA 4LMRA 3X2EA 4EYEA 4IDAA 2YJZA 3WGOA 3SLKA 2Y68A 3IIEA 4Z0PA 1XR3A 3EUWA 1MG5A 2VQ3A 1WP4A 3AFMA 3AFNA 1F14A 3NT5A 2Y67A 4OL9A 4CMCA 5ICMA 2YV2A 3LLSA 4YRDA 5ITVA 1NHWA 2AE2A 1DC3A 2RCYA 3ONFA 3W4IA 4DQXA 1VL0A 4GVLA 1CJCA 3K92A 1H2HA 1ENOA 3GZNB 3K2BA 4GVXA 6ADHA 2PY6A 4R1UA 5DP1A 4CPDA 4J0FA 1CYDA 1XLTA 4UVIA 1V3VA 1QRRA 3PYMA 4L73A 4OQYA 3VZSA 2PZJA 3RC9A 4FFMA 1R0LA 3JSAA 3BZUA 4KWHA 5DULA 4RPLA 2VRCD 4Q3AA 5B4VA 3WBBA 3P2OA 3HDJA 4DL9A 2VHZA 4YAKA 4HFNA 1LQUA 4CM1A 3F5SA 3V2HA 2P5UA 4WK6A 4ROSA 1SZJG 1NYTA 4ZRMA 1I36A 2PZLA 3DHEA 4JROA 5B12A 3R3SA 3RUDA 3HDQA 1T1RA 4P4NA 1PQUA 4NBTA 1Y8QA 2I9PA 3RKRA 3PRJA 2VOEA 4II2A 3QVWA 3OHSX 5ILGA 1K6JA 4IDGA 2WMDA 3CTMA 1P77A 3ZU3A 3L4BC 4U5QA 7MDHA 4OOFA 4YQYA 1LDGA 1C14A 4I08A 2VHXA 4OO3A 4WLUA 2H6EA 3DTTA 2EHDA 1GEGA 1U5CA 5EIOA 4YB8A 4AICA 3W1VA 5T5QA 3WWYA 3ZWCA 3EMKA 1JDJA 4MDHA 3WFJA 4YPOA 3IKVA 5JSFA 3FN4A 3MTJA 1KEWA 1PZHA 4ALLA 2BKAA 4XR4A 3TJRA 1C1DB 1O9BA 2BF7A 2X5JO 1A7AA 1FDWA 2HJSA 2ZQZA 3QVSA 3FNGA 3PJDA 4CLEA 2JJYA 1DXYA 2NU8A 3KEQA 5IZCA 1QORA 1E6WA 4W4TA 4IJWA 3COSA 1WWKA 3RC1A 3NX4A 2O4CA 3HZZA 2R00A 3UUWA 5ES3A 1LNQA 1Z6ZA 1YVEI 4RDIA 3JQCA 3OA0A 4IQ0A 2PZMA 5DDIP 2B36A 1UDCA 1NHGA 4J0EA 4XQ9A 5L45A 3CXRA 2Z5LA 5T64A 4HADA 5U9CA 1ZMOA 1HYHA 2AHRA 5IDYA 4R3WA 2X0JA 4Z9FA 2EGHA 3IAHA 5TLSA 3I4CA 1IPEA 2RAFA 4C7JA 3F9IA 4DMLA 2X0IA 1BXKA 2YDYA 4N5NA 3WGTA 2D5AA 3DZGA 4CM5A 3WQRA 1YQGA 4L4SA 1I32A 3GVXA 1CWUA 4BNYA 1TA4A 2HQ1A 3BMQA 4RPJA 4B3JA 3KTDA 1E92A 3WMXA 2JD0A 2OZPA 1K3TA 1NWHA 4CLXA 2EP7A 4PCVA 2X86A 4NPCA 3JTMA 1MB4A 1O6ZA 1HYEA 2DT5A 3K8ZA 2CSUA 3NDJA 1BVRA 1NBOA 1IHXA 4PLYA 4BV9A 3QQPA 2W2KB 1AHHA 3ZV6A 1E1MA 4RORA 3PGJA 3F46A 3GF4A 5FI5A 1Y81A 1W0CA 2O7SA 1HSZA 1N1GA 3Q2IA 4XR9A 2GZ1A 2VOJA 4CMAA 1DC5A 4YBZA 3WQQA 3PJFA 2CDAA 1CQIA 1YJQA 4FC6A 1XGKA 4CV3A 1GQ2A 1NP3A 2CF5A 4CM8A 4YT4A 3FNHA 4RDHA 3VPGA 3BMOB 4IGEA 1IUKA 1VSVA 2X0RA 2AE1A 2GGSA 4FJ0A 2RBEA 4ZHSA 5F1KA 1V9LA 1AN9A 3FWZA 1R4NA 3PFWO 1EK5A 1A4UA 3ROMA 5ER9A 3UW3A 1UZNA 2X8LA 3RCBA 1DFHA 1P0FA 4IINA 4UEJA 3ZNNA 1LDBA 1C1XB 2CNBA 3QIVA 9LDBA 4GX1A 4O1MA 1UZLA 1SOVA 1KERA 4Q39A 1Q0HA 2FMUA 1H93A 1Q1NA 5ENDA 1MUUA 2DU8A 2D4AA 5K6AA 1PSDA 2DFVA 2PD3A 2I99A 1BXZA 4OQZA 4KZPA 3JYQA 2UUPA 4FW8A 3JQ9C 4FCCA 3BMNA 1JU9A 3PZBA 2ZCVA 5F5NA 2J3HA 3DFUA 4FGWA 1XCBA 3FCOA 4NK4A 3WIDA 4AJ1A 4URFA 2QQ5A 4NU5A 2BGLA 3QSGA 3B70A 2GN6A 4ND3A 4FOSA 5LCXA 1QYXA 4CM4B 2B37A 4DYDA 2VYVD 4NIMA 1SB9A 2Q4EA 2QRJA 3JQ6A 4ALMA 4GX0A 1A7KA 4E30A 1MFZA 3W6UA 5JAMA 1E5QA 3IC5A 5FWNA 3ZHBA 4OJNA 4XWYA 3F6YA 3QWAA 5HS6A 4YR9A 5L7TA 1M66A 1QV6A 3PLRA 4LSMA 4QECA 2TMGA 1XYGA 2WD8A 1I2BA 1Z7BA 2X9GA 1NFQA 2YFHA 1RYDA 4JXKA 3ANMA 3W8DA 1EUCA 4NZ9A 3DFZA 1P3DA 4NG5A 4LRSB 4LN1A 4PRKA 3KSUA 4FJ2A 5K0ZA 5FFFA 4Y8VA 4K26A 4UAGA 3ICCA 2EV9A 1ZSYA 2F1KA 3HFGA 4XDYA 2O3UA 5KNLA 4B4UA 2I3AA 3DZHA 2HCTA 3W4KA 2OP1A 5KJFA 1LBEA 3QJ5A 2HRBA 4K6FA 3N7UA 2WTBA 1HZZA 4QO8A 4YJDA 4A26A 1X7GA 3UFXA 2VRBA 2Y99A 3QP9A 1A9ZA 3GR6A 3LDHA 4HFMA 1BRMA 1ORRA 5IDXA 2CDCA 1V3TA 1GZ6A 3FBTA 1H5QA 2EGGA 4MVJD 1YGYA 4D45A 3WB9A 1Z82A 1HDYA 4G5HA 5KJ6A 3GUYA 1J4AA 3H4VA 3I1JA 1OOEA 3NUGA 3SJ7A 3WGYA 1A72A 4BQPA 4CLHA 4RVHA 3MWDB 4RL6A 1NVGA 1NQTA 1FF9A 1CQJA 2EW2A 4R16A 2ZQYA 1KVSA 2Q46A 5TSDA 3WX0A 2HMVA 3KYDB 4IMRA 3ZWXA 3UGKA 1F0YA 4CQLB 3DMYA 1MGOA 1QR6A 4E5PA 1B3RA 2FPGA 5CEEA 4Q3CA 2A4KA 3W8FA 5COQA 1YE3A 1VPDA 3FBGA 1UAGA 1WDKA 3JCZA 3IKTA 1R4MB 3ZCXA 4RVSA 3K5PA 4U7WA 4H15A 3W8EA 1L1FA 1Y8RB 3GRKA 4KWIA 3ZWOA 1YJ8A 4WECA 2P9EA 4DGSA 1KEVA 1GYPA 4Q9NA 2PH3A 2YDXA 4XYBA 3RFXA 1AGNA 3JV7A 2VUUA 5JPIA 4IQGA 4H3VA 4R5MA 3CIFA 1T26A 3HB4X 2EG9A 4DRYA 5IZCC 4Y98A 2IRWA 2FR8A 4LCJA 4FS3A 4BNUA 2XXJA 3GVIA 3K73O 5KWEA 4GLOA 4ZJUA 1VLLA 2RHRA 1HDZA 2Q2WA 4WLOA 3GDGA 3RVDA 3WGHA 3K2EA 4XJSA 2Y1GA 2YFQA 1UXKA 3AOEA 4R54A 4UUNA 2O4UX 2B83A 1R66A 3NGLA 1XA0A 5U1PA 2PFGA 4OKIA 4PZCA 1LLQA 1KS9A 1R16A 4RF4A 3CSDA 4ESOA 3WMWA 2NTJA 3V1TC 1V0JA 2WE8A 4XYGA 2F00A 4UULA 3SXPA 2H1SA 4YYZA 4JK3A 4B8WA 4CM7A 1UXJA 1KBZA 3OFSA 4WKGA 4BO6A 4DQVA 1RM5A 4ALNA 2FR0A 3EGOA 4EUEA 5KKAA 1XDWA 1R0SA 2AEJA 1T2AA 3UCXA 5JNLA 3BTSA 1OC4A 4UEOA 4YJHA 2YW9A 3H3FA 1EZ4A 5G0TA 3AJRA 1VC2A 4RVDA 2JKVA 5TQVA 3I9KA 2O2YA 1YONA 2YY7A 3KXDA 4EEXA 1ZK0A 5AXDA 4IM7A 3GVCA 3JQFC 3EZYA 1I01A 3WLFA 3VVBA 3L9XA 5HWSA 4MO2A 4R9SA 5LDHA 3ICPA 1YB5A 3DBRB 2OBNA 2D2IA 2ZYDA 3RFTA 2Y0EA 2HK8A 1D1SA 3DDNA 3L4BA 4OSPA 3VPHA 3ZWBA 1KEUA 1A71A 1OI7A 5JCXA 4PZDA 4KMSA 4GPD1 5EQDA 2G1UA 3WSVA 1NPTO 3AI1A 4F45A 1L7DA 3GH3A 4Z3DA 2AXQA 3WICA 3IOYA 4Q3DA 4R3NA 2G76A 3S55A 3ZV5A 3EDMA 3RASA 3OMLA 1C0LA 2WSBA 3WYCA 1H2BA 1ZEJA 1B3BA 1I5RA 1Q0LA 2ILTA 3AY7A 4EW6A 3DL2A 4BGVA 1E3LA 2NSDA 4QO7A 1SCUA 5JFOA 2ZB7A 3LF1A 3E48A 1Q0QA 1I3LA 3VZQA 3GNSA 4JN6B 5IAAA 1Z45A 3IS3A 3DAGA 1N2SA 3C3XA 5A04A 2DBVO 2NTVA 2QG4A 2GNAA 3NV9A 4J1QA 2B4TO 2QYTA 4WASA 4O5OA 2BI7A 4L74A 4DC0A 1X15A 3CPSA 3QVTA 2P9CA 4Z6KA 4HXYA 1C1DA 1R15A 2FHSA 4MP8A 2IE0A 4F3YA 2IDZA 1E1LA 1BXGA 3PPIA 3GGOA 1U9JA 3LZ6A 1QYCA 4FGSA 5F1PA 3PP8A 3RBVA 5GZ6A 3RIHA 3S2GA 1SEVA 5KOIA 4W7HA 5TT1A 5ITWA 3I9LA 5B37A 5K6AC 4PG5A 1YDWA 3UF0A 2OOSA 3LYLA 4IS3A 4BNWA 1YQXA 4BS9A 3ADOA 4FFNA 1RYEA 2VT2A 4PG7A 3ADPA 3ONDA 3G79A 3ONEA 4MVJF 4IIVA 4AVYA 2O3QA 4J6FA 4TMFA 1DPGA 2OORA 4GI2A 2Y1EA 1LRJA 3NKLA 3RUCA 2EERA 4HP8A 2P68A 4CV0A 2GN8A 3HDHA 2C82A 1LRLA 1D4FA 4RZHA 4R5HA 1ZK3A 2EF1A 3GN2A 4CR6A 1LC3A 3EHEA 3IDSA 3JD2A 4GLLA 1F8GA 1FJHA 2JCVA 1HWYA 4BO3A 2Y1CA 1PIWA 4TWRA 4DYVA 3GEGA 2AW5A 4QSMA 1VJ1A 3D7LA 4YJFB 3KM0A 3WLEA 4MVJE 2O3TA 3MJSA 3HJAA 3NRCA 1KVUA 2H9IA 1V6AA 1AXEA 4CL8A 3V2GA 5G4KB 5JY6A 3DXFA 4GL4A 4U6SA 4BKOA 2I6TA 4FIZA 4BUCA 1Q7CA 2I3GA 1VL8A 4NI5A 2LDXA 1XHLA 2JHFA 3I23A 3OQ1A 3R1IA 3I9OA 3DC2A 4GX2A 1KETA 2WYUA 2PV7A 1M6WA 3PDUA 2ZJ0A 4XGNA 3OM9A 3B1FA 3OEWA 4RF5A 1AE1A 4WCFA 4TRMA 2NVUB 4B4OA 2W2KA 3C1AA 2WM3A 2EXXA 1R37A 5DOVA 4II3A 4MP3A 4GSKA 3IMFA 4I9NA 2RH4A 3D3EA 3VH4A 5CPBA 1K6XA 5GY7A 4L4RA 4L76A 4Z9XA 4NR0A 3Q9NA 4R51A 1W8DA 4XIYA 3ZW8A 5IN4A 1ZJYA 1E1KA 2O3JA 1H9BA 2P4HX 5JDIC 4BKUA 4C7KA 4CUJA 1QYWA 2UV8A 1R0KA 1GADO 4IDBA 1U28A 1X0VA 1PQWA 2GLXA 5CPFA 2P91A 4AJIA 5JCJD 2PGLA 1PX0A 2EIHA 3ZDFA 2O48X 2IZ1A 4KDEA 3DBVO 3GDOA 3JQ9A 4JIGA 3V1YA 1IL0A 1DIGA 1HEUA 5EINA 1PQPA 1ADFA 4BNIA 2J6IA 1BDMA 4MIOA 4D43A 2HDHA 4CMIB 5L53A 3JQDA 2WE7A 2BGMA 2PGDA 4J43A 3INTA 1FDSA 1G0OA 1CF2O 1ZK2A 1HL3A 2X5KO 3NEPX 2VZ8A 4I8XA 1P1HA 5ADHA 4WLVA 2BLLA 5THKA 5C7OO 1HE3A 1VRWA 2O23A 3OETA 3WJAA 4BO0A 3H9GA 4BNGA 3IQDB 4OXNA 1L7EA 5B4UA 2WYWA 3WQSB 3HE3A 1U7HA 2C7GA 3TDKA 1PJSA 3JYOA 5ICSA 3QY9A 1GCOA 1B7GO 1O89A 2A94A 2TMDA 4QFDA 5FYDA 1PZEA 3QWHA 2BHLA 4NBWA 4Q3NA 4JP2A 1I3NA 2D5CA 2BH9A 3N58A 4CM4A 1RJWA 4IXWA 4PLZA 1YQDA 3GVHA 4ZD6A 4GSLA 2BFMA 3LLVA 4I9UA 1DIBA 3ZWWA 4BNJA 3VDRA 2OGUA 1XKQA 4XYLA 4E13A 2Y1DA 2VHVA 2VRCA 1F17A 1IPFA 1QYVA 1ENYA 2JD2A 4J7CA 2X9VA 3OJOA 4KTTE 3AOEC 4RF2A 4CM6A 4D79A 1LLDA 2I67A 4KUGA 3JD3A 1U8FO 1KY5A 1NNUA 3MZ0A 3U4IA 3VTZA 4DPLA 5KJCA 2VYND 3MJ4A 2ZB3A 1EK6A 4NJMB 2NQ8A 4N18A 3HWRA 4W9NC 4WE3A 1QP8A 4XRRA 4AJNA 3H9QA 2GD1O 1RM0A 1EQ2A 3KYCB 1E7RA 1M2WA 2YQ4A 5CEFA 1ZNQO 2VT3A 1F06A 5HBRA 5BT9A 1T2EA 2DPHA 2E37A 4EJMA 4AJPA 1W73A 2VN8A 1E77A 1W6UA 3PXXA 5JYEA 3I9MA 3BYZA 2P5YA 5G0VA 1KIFA 1B8PA 1GR0A 3PTZA 3UKOA 5H81A 3PIIA 5FEUA 4U0JA 4BHTA 2Y1OA 5KVSA 1CEQA 3WNVA 1NX6A 1P0CA 3GY0A 4A27A 4E21A 1ISJA 2CVZA 4AJ4A 3LU1A 3DMTC 1EVYA 3PLNA 1OZAA 1AHIA 1IZ9A 3OQ6A 4WOKA 3WWZA 3AU9A 4B3HA 1PJLA 3O26A 4GX5A 2V6BA 5TJHA 1DIAA 2EW8A 4G65A 3T4XA 3TFQA 2IEDA 1FDVA 4D46A 4XX0A 1N5DA 1PGOA 5C3MA 1C0PA 2DC1A 1MC4A 1GYRA 1GDHA 3H5NA 3EK2A 3R6DA 4G2NA 3VVCA 4F6CA 3BMCA 4HUJA 3U5TA 3IUPA 4TSKA 1KYQA 2D8AA 3WDSA 1H94A 2A35A 3UN1A 1Y5MA 4EUHA 4MP6A 1SC6A 4XGIA 1JW9B 3Q9UA 1DJNA 3L0DA 1E1NA 1PJQA 5CG1A 1KVQA 2GO1A 4NHEA 4EEZA 2NLOA 3PHIA 4XB2A 3OICA 3H9UA 5EERA 3OIGA 3GVPA 3PWZA 3VHRA 4TQGA 5CP8A 3CKYA 2QIOA 1JKIA 1DBVO 5B4TA 3L9WA 4GWGA 4PLHA 4N54A 4IGFA 2B5WA 5FI3A 1JTVA 1T1SA 1DAPA 2YQ5A 2X4GA 4YAEA 4CMJA 1ARZA 2O50A 3RKUA 2ZIZA 4JNKA 1DSSG 3ENNA 5THQA 2YHIB 1Q7BA 2DVMA 3DBHA 1CETA 1IHYA 3ZWYA 4CMKA 4J91A 1UAYA 3DZFA 4DLBA 5A9TA 1LSOA 2NTNA 1I3MA 4CQMD 4IJKA 1FXSA 4R1NA 3CZRA 3WG9A 4DLAA 4RVUA 3QA9A 3U4CA 3AY6A 1MC5A 2UVDA 1IZ0A 3LF2A 1E0DA 4NQZA 3RUIA 3ROQA 3STHA 3H9JA 3S2EA 4LRTB 4FJ1A 3F4BA 3ZI0A 4XDZA 3JQFA 4FB5A 1GY8A 3RU7A 4E2YA 2IYOA 3DHYA 3LK7A 2QW8A 1DHTA 3GRPA 2OXIA 3O8QB 2BFAA 3PJEA 5H83A 2Q45A 2FOIA 4Z9YA 4XCVA 3K31A 4ONEA 1HT0A 3OH8A 3L6EA 4PGFA 1Y9EA 4NK5A 5DF1A 4NFSA 1LDMA 3ENKA 4B7CA 3HSKA 4UUOA 1C0IA 3DBLA 2ZYGA 3GNTA 2J3JA 3TL2A 4WCDA 1ADBA 2EEZA 6LDHA 3ETEA 3E5MA 2PK3A 3PHHA 4MKRA 1SMKA 4RPHA 2Q1TA 3DAFA 3JQAD 4NJOA 5KVVA 3LC7O 3ON5A 4WCFC 4Q3EA 1DLJA 4NDNE 4CLOA 4IMPA 1Q7GA 4LSWA 4ND2A 4TRJA 3MCVA 1LU9A 5FF9A 1NM5A 3TRIA 3OQBA 5AQ1A 2PZKA 3A28A 5IXSA 3S1LA 3ZHZA 5A9RA 3ZHYA 2BELA 1LDEA 4CMEA 1PEDA 3PJGA 4P4GA 1U3UA 1U3WA 2NVBA 1TT7A 1Y5RA 4E5MA 4JGBA 3KLMX 2W4QA 5U4QA 3HNPA 5TGDA 2VYVA 2OBYA 3NTOA 4FBGA 4CM9A 2AEFA 1HZJA 4M49A 4WPGA 4E33A 1P9LA 4CV1A 5JC1A 1GL3A 1NQAO 2ZTVA 1EVZA 4U8GA 8ADHA 1EE9A 4YJGB 1SNYA 3WJ7A 1J6UA 3OA2A 5COBA 3AU8A 1EUZA 3ZWMA 3GFBA 3H5RA 1PU2A 3OJ0A 5COAA 3MWEB 4UREA 2C07A 4GAEA 2FSVA 3FSRA 1LTHR 4YRBA 4CM9D 2WJPA 2Y0CA 3RAJA 4YQZA 1H6BA 5AXBA 3KRTA 3C7DB 1T2FA 3GN1A 1GFSA 5A4DA 1ISMA 1SO8A 1QMGA 2UYYA 5AXCA 5CFZA 5L7WA 5I7SA 4INAA 4M1QA 1V35A 2P2SA 2RHCA 4DWVA 1EDOA 2CUKA 4YDRA 3WGQA 1M67A 3BHJA 4FFLA 5DT9A 3U4DA 4WEQA 4DLLA 4ND5A 3IJRA 4AJEA 3AUTA 3U9LA 5DCWA 2GZ2A 2VTDA 4GKVA 4YJFA 3C8MA 3ZW9A 3S2FA 3HHPA 4RO0A 1NAHA 2PR2A 4N5LA 4NNJA 2PKQO 3B6ZA 4E31A 2OP0A 3AUUA 2Q1UA 1ONNA 2JCYA 3GC6A 4YXFA 5G0SA 4MVJA 1BG6A 5G4KA 5T57A 3SX2A 1P74A 4NU6A 3B20A 3U49A 1DIHA 2VWQA 3Q0EA 4BNHA 2IODA 2OHXA 2JHGA 1YS4A 2FZEA 1YH3A 4RF3A 4TZKA 1O8CA 1IY8A 3QW2A 4J4TA 3FTNA 1I3KA 4HX5A 3DB2A 1LEHA 5JDIA 1R12A 1XQ6A 3DZBA 3DEYX 3GMSA 2NVUA 4DQUA 1O94A 3UXYA 4CL3A 1QSGA 3TOXA 4WLFA 5H82A 4WUVA 5TS3A 5HA5A 1YL5A 1D8AA 3S8MA 1T25A 2AQIA 3UICA 3ROKA 4I9HA 3H6KA 4PLCA 2JCXA 1HSOA 2Q2QA 1TT5A 1ZJZA 4YACA 3WS7A 5A9SA 3ASVA 4DMMA 1E7YA 3C1TA 4S3MA 3TL3A 1HLPA 1Y8QB 5B1YA 1ULUA 4MINA 3ABIA 4FOOA 1TEHA 2IZ0A 2POQX 1LA2A 4IDEA 2DAPA 1NPDA 3FRJA 4TRRA 3FPCA 4JJFA 3RC2A 4AJKA 4XRGA 3T4EA 2BD0A 3Q2KA 1U7TA 2ZTLA 1GV1A 5T67A 4E5YA 1I8TA 4QUKA 4U6QA 5A02A 1R6DA 1M75A 2D3TA 1WW8A 4I1IA 3VAZA 2WYVA 3NT2A 4CMIA 1B15A 4O6VA 4R69A 5L4NA 3DHNA 3VH3A 4EBFA 1NAIA 1CERA 3BXXA 4CQMB 2PKRA 4U0KA 3ZWAA 4Z0TA 3RBXA 3H2SA 2XOXA 2NU6A 2UUOA 1IE3A 2DBZA 4OIMA 3JQGB 4EGFA 2JFFA 4ZQHA 5A5EA 1EFLA 3O38A 1EFKA 1X7DA 1X7HA 2ZTUA 1X13A 3OJEA 1JQBA 4O59O 1NQ5A 1NXQA 1PR3A 2VHYA 4ALIA 1QXSA 4ND1A 4FFRA 3FWNA 3PHLA 1T2CA 3ZWNA 1ID1A 2EP5A 3CZMA 3ST7A 4YAGA 2VWGA 4YRAA 1OFGA 3OEYA 4PLWA 3QLJA 3KB6A 5L40A 3G49A 4RQTA 4TRNA 2QHXA 2UAGA 3NAQA 3JQ7B 4RLHA 2FP4A 2GUGA 5BSHA 3JQ8A 3TZ6A 4PVDA 3OIDA 1KY4A 1NWCA 4LGVA 3GGGA 4XYMA 3GG9A 4M89A 5GZ1A 2X23A 2GF2A 1CIVA 3E9QA 5DBIA 5T6BA 5G2OA 3PHJA 2JAHA 4CLRB 4KQXA 1DHRA 1E3WB 1WAMA 4W9NA 4WNIA 4EZBA 1YDEA 4J9UE 1YRLA 1F12A
chains in the Genus database with same CATH superfamily
3MXTA 3D2BA 4YMVA 1JR6A 1IHDA 4Y6LA 4WGGA 4DHWA 4G6TB 4U2FA 1IMOA 4KDRA 2OVFA 1R0BA 3KVYA 3LSPA 5IP6A 1OQYA 1A9XA 2GH1A 4R1TA 3PR2B 5I4CA 4WMLA 1UP4A 2AN3A 2VEOA 3HJEA 1JHDA 4YH1A 4R31A 1PJ8A 2AWNA 3GFMA 1QIIA 3ABMH 3U3XA 4B73A 1YB4A 1A2OA 5KHOC 3R24A 1TTPB 3GEIA 3ANLA 2QD4A 5D84A 1Z7LA 3Q4GA 4YMLA 5KEIA 4UU1A 3P27A 1L4NA 1F8FA 2PVPA 2GN9A 3LPMA 4KXMA 4JKOA 1R00A 4I99A 4R8RA 2I1WA 3WIEA 3E3LA 3OIUA 1U2GA 2RGUA 1VQ4I 3C2QA 3L2WA 3K4LA 3BH6A 5J47A 1LJLA 1TUGA 1QP4A 4URZR 3IJPA 1J39A 4BDSA 3OECA 2G82A 1PDOA 2E4XA 2XDQB 2P4QA 2MTBA 3ETCA 4XNFA 4LW8A 2Y1FA 3NVKI 3UV3A 4F6RA 3IRUA 1FVFA 4BN4A 2GRUA 4JOCA 2MHCA 5EJFA 1YR7A 1P6UA 3A0RB 3PLAE 4C30A 2CUNA 5IXYA 1KJ9A 3K6RA 1G3YA 2QD2A 3OS2A 2O8EA 3W2TA 1EDBA 2FSSA 3GFFA 3BWEA 4X7MA 2JIQA 2EGUA 3EF3A 4C2BA 4BX2A 4FDAA 3B1ZA 1J06A 5HLIA 2YV1A 3ANXA 2FZLA 1KF0A 3D3JA 5I7VA 4UNOA 5IVKA 3DEWA 3HP1A 5LFAA 1RHUA 4B7AA 4X7BA 3KSBC 1YFHA 4N6NA 1K8RA 3SBOA 4Z3KA 2IYUA 5K45A 1KQGA 5EPOA 1IQUA 1WH5A 4RJLA 3EZLA 3KE8A 1KA8A 2PG4A 4XSVA 1Z3YA 1DRUA 4LMAA 2VP0A 3A25A 2OXFA 2QGUA 1G9XA 1BN6A 2YZ7A 4JBLA 4EZEA 2A9FA 5BMVF 4AZ3A 4CEHA 1UKCA 2LE0A 4LBYA 4KC0A 2GZMA 3ZPXA 3JYPA 4F7DA 1U04A 4LECA 1SWVA 3FMGA 4EAAA 3GELA 1HOXA 3T6KA 4MQFB 1Q2UA 4DA9A 2V7GA 1P9QC 3LCVB 5AKZA 3JVDA 2AQ8A 1IRFA 1BE1A 5CNMA 4I36A 5HGXA 2CLEB 2MIIA 1G3QA 3LHIA 2R11A 1KOLA 2IW3A 3JVEA 1W36C 2PGAA 6PAXA 3JD1A 2PUEA 2WDZA 2M30A 2ERYA 1S6YA 3WK5A 4PIVA 3K16A 3M6IA 5GP9A 4DIEA 4JY7A 5MFPA 4TMWA 3U09A 2ZDGA 4G8DA 1HLDA 2G9UA 1ODCA 1ZFNA 4Y2XA 1OBFO 1R4MA 4H7FA 2RHJA 4RZUA 4KQFA 2P4SA 4Z53A 1U1EA 3OSFA 3JAWB 3QU2A 1W1WE 1L5GB 2ACJA 2Z6VA 4OATA 2A14A 3F8BA 1I39A 2ZFUA 3TVTA 1D3AA 2PKXA 5KYVA 5DWQA 5BPHA 2XGGA 1D0VA 4JFAA 1G6KA 4GS5A 4B32A 2XUJA 3IR7A 3KTAA 1M74A 4A7PA 3H36A 2JFPA 4LG1A 1P1FA 2DYKA 3V1UA 3FOZA 4LV6A 4OBEA 4DMGA 2QDKA 1JILA 1Y4ZA 4QPPA 4M99A 4WX2B 4EHFA 2ZIVB 2DE0X 3HKDB 4HPQA 3EWIA 1KC1A 1BCRA 3OU7A 2Z5GA 1SKBA 3INYA 2HQOA 4DR5B 3LVFO 3BG6A 4JJIA 1AHPA 2A1UB 5CAEA 2CQXA 1CNFA 4X9XA 8OHMA 3H1EA 3A2MA 4G8CA 4NCJA 1LBHA 3MJHA 3ETJA 5GGXA 1RWNA 4AMYA 5DNEA 3GPIA 2O0HA 2ZOSA 4JK1X 1P1RA 5IT4A 1JG4A 4K6OA 5JVGF 4M54A 1QC5B 1BTOA 1NFFA 1Q6YA 1K61A 1Q16A 2J8ZA 2IPXA 4ZVNA 4XGRA 3PNBA 2ZBRA 4LYDA 2A9JA 2C54A 2QE7A 4XIGS 1Q1BA 4UQOA 5BNTA 2HF7A 4I5DA 4WY5A 3KELA 5AI4A 1UOOA 3M2PA 3CZCA 1A0OA 3RRFA 4HXGA 2DR0A 1U3DA 1X3UA 1YL7A 1ISHA 1AU7A 1WDLA 2LD5A 4QPZA 3ESQA 3C14C 3SNKA 3GLQA 2DJIA 5DXAA 5HNKA 4N40A 4XX0B 3EC7A 1P4RA 5G1NA 4FISA 3G9TA 4IOAF 3N70A 4OV6B 1DCTA 2QRHA 2QZ9A 3FLAA 5AKXA 5F2OA 4M3GA 1JA9A 1EE2A 1RWPA 1XZDA 1YDGA 1GZ3A 4L28A 4IQ8A 3ZJTA 4OHUA 1WXWA 5C2JB 3EOAI 1NGSA 4ZRNA 5BRJA 4FI3F 2ADFA 2LKSA 1E66A 1USTA 3OYMA 1UPAA 2O7VA 4FGZA 1U11A 4MIEA 1X92A 4J49A 1JJ6C 1RESA 2QVOA 1BWSA 2R8RA 3WXBA 2WB2A 4U8HA 3TZLA 3QYBA 3GJQA 4LUCA 2PRZA 3AEYA 1G9TA 3PC4A 4UNSA 5M34A 3O5AA 1Z91A 4MOWA 2HCBA 4QNNA 2H6CA 3ZCVA 2HEOA 1B9MA 2P6OA 1X7XA 4FP9A 5F51A 3QWIA 1HKUA 1D0IA 3R3XA 3TG2A 3QFTA 2X2EA 4NCNA 4NYMQ 4URYR 4LLNA 3PSHA 3LX6A 1GM5A 1I6HJ 1FYLA 2C3UA 1M6EX 4Z54A 3K8YA 3T7AA 2E5LB 5DHRA 4UMDA 4YTEA 4JCOA 1EJBA 5IT9K 1SBIA 1X8LA 2STWA 2VONA 2YYYA 3CF4A 1KYIA 3AQ4A 4HGZA 1TF2A 2O8BB 1UBJS 1U78A 1ZRCA 4P5DA 1YB1A 2H51A 4IHKA 4XRSA 3X2SA 4UARA 4IX1A 5CT4A 1LTKA 3FTPA 4Y9DA 3V8BA 3GRFA 4MKIA 2WMNB 1CU1A 1I3OA 3HKZA 3BFKA 3K4QA 2RDMA 1MZVA 4H16A 4ZV7A 4XUDA 4HZFA 2W82A 1F1JA 4I5GA 5K4HA 1ZRSA 2CUTA 2YWCA 1GGJA 5D8KB 2KSQA 4UOZA 3U56A 4MI1A 5F73A 5J5CA 1GQOA 3OCXA 5DP2A 3F8NA 1N32B 3OF3A 3OJWA 1IY2A 2RHOA 3AUKA 2FFRA 1FMLA 3LQFA 4BDTA 2UDPA 3L2VA 1AQIA 1YR1A 2O9LA 5FBLB 1P4WA 4AL4A 5FD5A 1M0WA 5IM5A 3X43A 3IAM2 4CHUA 2BOVA 2RJOA 2PRYA 4R1SA 1UXIA 4IDNA 3UZUA 5SZJA 4EY5A 2KI5A 3QMVA 4RKQA 2C4NA 3HWSA 5D5HA 3QZUA 2CGPA 1N5JA 3L00A 4QTTB 4V02A 1R5JA 3GRVA 3OFND 1DLIA 3R5SA 6NULA 5LNK6 4TV9B 3G5AA 3UMFA 2HGSA 1A31A 2R1TB 4BNZA 2ZROA 4JLSA 4FHTA 1U2PA 2JEZA 3KPWA 4G6QA 2DKNA 3BMXA 1SC1A 3UJHA 3ODGA 4L7VA 1GXSA 3U2RA 1ZK8A 4HWGA 5JMOA 2AC4A 3IKMB 2Y68A 2Q1XA 2WYOA 3IOCA 3WTUC 4DR2B 2WI8A 4OL9A 1JRLA 4ICIA 2D74A 3NHJA 1FQJA 6GPBA 4Z9BA 2LR8A 3FNRA 1KY2A 3IYLW 5DP1A 1AGXA 1CYDA 3SKVA 1UQUA 3AVYA 2IHJA 1E2EA 1OTYA 2HDDA 4Q3AA 3VR2D 1VOTA 5IT9A 2NAFA 3DHEA 3HDQA 1Y8QA 1OYIA 4GXTA 1AC5A 5D2CA 2VXBA 4NOMA 2RVCA 2VHXA 3T41A 3P9CA 2WJ3A 2ESNA 1SH7A 2JIPA 3GLIE 1LEBA 4RS8A 2FUG2 2J67A 2BE7A 3BR6A 2GHIA 1HLVA 1U94A 4YUZA 5GTIC 1ZU4A 3VGJA 1DEKA 2P9YA 3U61B 2AS5F 3N2LA 4MICA 1Z4JA 2O2EA 5HIKA 1PTKA 1J8MF 1ENHA 5ALOA 2C2WA 4QOFA 2ZJFA 2J7KA 1BXKA 3L4EA 3AR8A 1CWUA 2HQ1A 3BMQA 2JGJA 4CKYA 1O3TA 4REMA 4IHSA 3WV5A 5M2QA 1HYEA 4P92A 3CLSC 1K4KA 3NOQA 4PYRA 1ZZGA 3GRAA 1TWAJ 3LPNA 1MMGA 2GPWA 2AK3A 3IESA 3JRBA 3NHZA 5DM6F 2QZ4A 5MF6A 5AIPA 2QE6A 4EHNA 3OVMA 4DCPA 1VSVA 1JGSA 2RBEA 2IZOA 4TVSA 2WPDA 3G82C 2XLBA 3PGLA 3IAEA 1P0FA 3ZNNA 3TSWA 1G18A 2IH2A 4GX1A 4C14A 3Q9VA 3ZWKA 1DZ3A 5HEKA 3VNSA 1MUUA 3ICQB 5JS1A 2A33A 3KAKA 2ODWA 3JQ9C 4GG1A 4JYMA 4FB4A 4B75A 1WDWB 1WZUA 1KSGA 2OFOA 1UT6A 4FOSA 1SK9A 4M0EA 5FLYA 2AI3A 1GTG1 1B42A 1P7ZA 5BN4B 4CNBA 4FZRA 3SZGA 5FWNA 4AUNA 5B1IA 1XP8A 2JPBA 2WV0A 2B8TA 3LO8A 1KFKB 2PS3A 3RO7A 4JXKA 2X9GA 5LLDA 1Y0BA 1VHTA 2FFHA 3CCFA 3HU2A 2O8KA 1VYTA 1EIWA 4D25A 3E7DA 5LQCA 2OBXA 3ICCA 3L79A 4XDYA 4CKBA 1CNEA 1MJAA 3KJXA 3TOVA 4BEWA 1QO0A 4QREA 1E4EB 1JEJA 2BH2A 1YQ9A 3RREA 5I3CA 1WDTA 3SJ7A 2YXDA 2WTUA 2GFIA 1FYEA 2QKYA 4MQVA 4XWWA 2TRSB 3EVEA 3QPTA 3DV0A 3RFFA 2CMHA 3H18A 1XB4A 1JSLA 3TXXA 2P3OA 4IMJB 3MGKA 3SZLA 3KSMA 1QO7A 1Z0ZA 1RFGE 3RIGA 2OV3A 1O77A 3VHXA 1XHEA 1XXHA 2BN4A 2XXJA 2IA2A 4ACAA 1HDZA 1ATZA 1XE3A 3I5AA 3NFRA 1ZRDA 2O4UX 1HI9A 1LLQA 5GQSA 1M8JA 1TF7A 3P9RA 4KRXA 1UXJA 4CTNA 5CFRA 5ARCA 3BTSA 4JC8A 4PN7A 1J90A 3E84A 3F9KA 3ZJ4A 5JSQA 5AXDA 3GVCA 4UV8A 4JLOA 1JX6A 3TNYA 3DBRB 3RFTA 1D1SA 4ZC1A 1KEUA 3HJUA 1PWHA 4GPD1 3GTMJ 1SURA 3RASA 3D31A 2BT4A 2C83A 1UFQA 1O7FA 1JT0A 1WTCA 1C7EA 3LSMA 1OFTA 2HR1A 1NF3A 2H48A 3AKEA 5F52A 4DG5A 5A04A 4JELA 1ST2A 1XNJA 2RGGA 2W6JA 1X15A 1D1BA 4CXFA 1YC2A 4MP8A 4HOBA 4MV0A 1CJVC 5ITWA 4EUKA 4PG5A 1QRDA 3WK9A 4FFNA 4GW3A 1DTSA 2QUFA 1F51E 4CV0A 3JRGA 2ZRPA 3MTIA 3WU1B 1AKQA 4P6VF 3KT8A 3V80A 4FOTA 2CZQA 1FC3A 2PFSA 4MVJE 3FZYA 3MJSA 1XA4A 4DV5B 3K09A 1AXEA 4O0MA 2L42A 5KTOA 1BR1A 1VL8A 5B7PA 2JHFA 3GZ5A 2ZJ6A 1GOTA 4LJ6A 3PDUA 4G41A 3QBVA 4LWQA 4HEHA 5JH7B 3J7AC 3ZLVA 4A8HA 4Y9SA 2NTYC 2DA2A 1HYQA 3IT0A 3JREA 4BKUA 1XX6A 2HQNA 4U00A 2C31A 3JASA 4BNIA 4PRZA 3VJKA 3GTLJ 4QQKA 2XTAA 4HVCA 1ODIA 4XFJA 2P2YA 3RS7A 2L69A 2LCQA 1S2DA 3P9KA 5AONA 2XAHA 3HY3A 4ZAFA 2JFXA 3IQDB 1K78B 2QAGB 3LHSA 4LK1F 2VB6A 4WV3A 4EFDA 4NBWA 4Q4AA 1ZM4A 2WSSD 3LPLA 1RJWA 2XTZA 1DOZA 4KXWA 4GSLA 1XDSA 1O95D 2YS6A 2R84A 4MVXA 3VDRA 2O0KA 5AM4A 5BXQC 3T9DA 1JJFA 2C3YA 2WA0A 3ROGA 3LBNA 4PR3A 4U2GA 4K2HA 3HL4A 1SCAA 5CT8A 2ZKIA 5K8CA 3PXXA 5EIEA 1EH5A 4YMTA 5DW0A 1KIFA 4WF2A 2J87A 4W6QA 5AW4A 3CP2A 4A27A 3BD6A 1KP9A 4AJ4A 4EHLA 3U9TA 2FDRA 1NP6A 2NUAB 4OK5A 2HF2A 3AH8A 4TQ9A 4IIJF 3P4YA 1IY1A 3A01B 4F6CA 3U5TA 4TSKA 2HXYA 1H94A 5E7JA 1PEKE 4EPTA 4RE5A 3SS8A 1M2KA 2F5CA 1PP7U 3PC2A 1S8NA 2UVQA 2RD2A 4CG1A 1RQRA 3C3DA 3FXLA 3KQVA 5B1EA 1DEAA 3IB6A 4DV0B 5GADJ 3EF1A 2Z3VA 4WWCA 4R2MA 2GN1A 2R2AA 3PIRA 2X4GA 2C2GA 2R79A 4E6KG 4M9CA 4IOLA 3RYCA 4JNKA 3B6EA 3CRW1 2Y9MB 5AVZA 2O57A 2GWRA 3CCBA 1QU3A 3OJXA 2BZ1A 3QG5A 2PUHA 3U4CA 5DCMB 1AHNA 1B1AA 3OJCA 3RUIA 5KQGA 4MUYA 3H1BA 3PGVA 2QRGA 2JA7J 4DIKA 221PA 2WVAA 4I01A 1C8KA 1ZGHA 3B51X 5HMMA 3HFRA 5EWMA 4I0BA 1D8TA 4HATA 1NH3A 3I8SA 1UJ6A 1RBMA 1NZJA 3FBWA 5E6UA 2SKEA 4MKRA 4KLRA 3HC7A 2QOEA 1UKZA 1HLFA 3AAFA 4LSWA 3P20A 1EK1A 4M1MA 3L0SA 1LU9A 4Y6GB 1I6XA 4CBVA 4ME6A 3N86A 1XYVA 3W2FA 1SJ9A 1CP2A 1KZ1A 1RRGA 1U3UA 2A78A 1CFJA 1XXLA 4ROTA 1HZJA 4F60A 2IYSA 5CYVA 5KQMA 3TVYA 1UC5B 4PUSA 3LGAA 4N0MA 4FLFA 3BD9A 1J0BA 3VU0A 1LVUA 1PNRA 1LTHR 3G59A 5JQGF 4CM9D 2Y0CA 2LK2A 4JP0A 2V59A 2MW8A 1ISMA 2GYVA 1QAOA 2PMZN 4M1QA 1EIZA 3CPHA 1L9XA 4TKVB 3EPZA 4RB3C 4ND5A 3KQYA 5AJHA 2RQPA 3I04A 4FZJA 3LFHA 3NHUA 1H1LA 5LZ9A 1XEXA 3F6BX 5T57A 5K09A 1SBZA 2BE9A 1NKTA 5AVQA 3KDPA 3K7AJ 4TZKA 1IY8A 2XZOA 2P6NA 1X8KA 3OWTA 2HRDA 1TA9A 5J59A 5TS3A 1PKXA 3VQTA 2ZIXB 4PLCA 2FQQA 2VH2A 3AV0B 2ASEA 5B1YA 3FHJA 1FLVA 5IJ9B 1SKUA 2W71A 5TEVA 2DAPA 1JVNA 3URKA 3N1UA 3E9EA 2ZTLA 2R7XA 2RG1A 3VAZA 4UE3S 1RRFA 1FL9A 2YCLA 1Z0FA 3FB1A 1QK5A 1EVQA 2ZJ8A 3QEKA 2HH9A 4FU0A 5CLJA 1JUDA 2VWGA 1RDFA 1OFGA 4FEEA 3QLJA 5CVVA 3NC4A 3TTTA 3JQ7B 1MNDA 2LIPA 3A04A 4BACA 3OYDA 3UEOA 4OG2A 4QG7A 2VJDA 1F12A 3AW8A 3F4LA 2Q0HA 2CXOA 3QX8A 1UZCA 2AG6A 1YOVB 3CMCO 3QU3A 2KX7A 2B0JA 3PFFA 4RK7A 4RZXA 1P0MA 1SOWA 4UM9D 2E4AA 2XQVA 2JSCA 3LWBA 4ZT6A 2V1DA 5DOZA 3OIYA 1G9SA 3CGWA 3A26A 1D6MA 5EGOA 3P52A 1U8EA 1UJCA 4RHUA 4CN9A 4XL9A 3X1WA 3SVTA 1T8SA 3F47A 1DG9A 4J1NA 2IYNA 5HGJA 2R5YA 1P45A 1HQYE 2JA1A 1Y1PA 2FVYA 5JSZA 4MV4A 3EY4A 1X70A 2YOHA 1ACMA 2EFDB 3BXZA 5EMNA 1K5GA 3HYRA 3NWJA 4TYNA 3PIDA 4ID9A 4IDPA 1Z29A 1ZZEA 5CH5A 1KDVA 5C31A 4RQBA 2ZUVA 3RYHA 1TWHJ 2VTBA 2XB2A 4H6VA 2A6PA 4HVLA 4W8GA 1VSUA 2ZM5A 3S70A 1EHIA 3D8RA 3L5OA 4P8RA 4RCZA 2IYZA 3H2JA 3UT5A 1QPZA 1N7HA 2NXJA 1TO1E 2Z43A 4CI9A 1NQOA 2CJWB 2PTGA 4CICA 3V9AA 2OCXA 4RMIA 4GYGA 4M38A 3FRHA 4C4OA 4M6YA 1BWRA 1WNFA 1NU8A 3UJCA 5HX7A 4NBKA 2NSYA 2QPOA 1X74A 3LHKA 1XWFA 3BL5A 3JPWA 4OGLA 2XT9A 1Q0RA 2DBRA 4MWZA 2V6FA 5EYRA 2OGSA 2DT8A 5AVTA 5JAIA 2CLKB 3FUTA 1DPUA 3P2EA 3FSGD 1MB0A 3ZRGA 3ES9A 1JKFA 1EGHA 3WYEA 4AIJA 1PJ3A 1ST3A 1JWBB 1N7GA 1M9NA 4IVQA 3L05A 1LI4A 1G6Q1 4MS4B 2NVQJ 2IEGA 1SVNA 2NXEA 5LDGA 3WSTA 4JX6A 3MGCA 2IVFA 5HIAA 3SXYA 2ZRCA 1UBNA 3CE6A 4M6XA 5CDTA 1WQ3A 1GCUA 1UPXA 4ENNA 3IHUA 5K0BA 3VKHA 5FCDA 3MMNA 2AYXA 4FX4A 2EFHB 5CGQB 5JS2A 4YCNA 3TTWA 3Q3SA 3L7IA 4EL0A 2Q8NA 3D81A 1Z8DA 1Y0UA 3R40A 5KJ1A 2HU8A 2HPHA 2AMVA 2EDAA 4JQCA 1LW7A 4QPJC 2CLLB 4JT2A 5KKCA 5I47A 3VO9A 4BO8A 3M4XA 2CZGA 1ZH8A 3AM5A 3ZI4A 4JENA 1ZK1A 2REQB 2FPRA 1AKNA 5EESA 4C3HJ 1TZLA 2CUEA 3MJEA 3QEOA 4OMFG 2HGCA 2XQJA 2CW5A 2F4IA 1ECGA 4J16C 2M2EA 2ZATA 2H1RA 3E7WA 5AK3A 1U8CB 3GLRA 3G9UA 3PKZA 4LOHA 2NWQA 3L8HA 3MWDA 5E1WA 4G4SP 5A4IS 1NDHA 1T13A 3ADKA 2P65A 4JYKA 1DG1G 3BKXA 2FG6C 3QVKA 4HGOA 5EJ9A 2R93J 2K02A 3PZRA 2DJNA 1QV9A 2P9JA 1F43A 2IY7A 2TYSB 3ROFA 1W49A 4BZWA 4LQCA 2OBLA 2W2QA 1VLMA 1Y8RA 4NYIR 3ODPA 2CFXA 4PCUA 5ALMA 4EGZA 1O7JA 5DGTA 4MKHA 3M6MD 1NMSA 3BA1A 1JMYA 1QX4A 5HRUA 4NV3A 2VAPA 3ADBA 4OOEA 5BSKA 4BCDA 1N3BA 2QJRA 4V03A 1E79A 4IEIA 3R8CA 3D3QA 4KQWA 4M76B 4EJVA 2PMCA 3EXHA 3S2UA 4S1VA 4G9EA 3X2FA 2V4UA 4A0FA 1DFGA 3LY8A 5E6RB 2AXTC 2VDWB 3MYRA 4J0HA 1H69A 3GJ4A 3HGGA 5ALGA 1VJTA 1SIBE 1T24A 3N74A 4TN5A 4DAEA 4AQDA 3T9FA 4R79A 1LW6E 1ECLA 4BO7A 4MPPA 4KNWA 5CXSA 2PKYX 3RHFA 3OOYA 5G0UA 3W9UA 5INTA 4WADA 2KZVA 5DEIA 3IUQA 3ZR4B 3I4NJ 2B8NA 4ZZ1A 4JP5A 3D0OA 5EZQA 1E3IA 4FC7A 3ZS8A 2M32A 5IDQA 2J4DA 3MMZA 1IN6A 4U7JA 1CY7A 4A6DA 1OIWA 3I37X 2JHPA 3INGA 1JIUA 1VDMA 3NR2A 1RHMA 5EUMA 2LYCA 2R48A 3KOXA 3R0IA 4D0PA 3DOCA 4YP6A 3GO4A 3ZUPA 4IF4A 3UUFA 2XKPA 3TSYA 1DFIA 4CMGA 5KVCA 1Q95A 1N2CE 3BTVA 1CRWG 4KUMA 5AOBA 5L3QB 1SRRA 3N5KA 1Y63A 2FU5C 2RNGA 4XM0A 4MLZA 1ICEA 2YWXA 3MIIA 1G7SA 3QVXA 3SHQA 2O3RA 2VA8A 5FWXB 3JYNA 4XYEA 2XZPA 2IF0A 4NNOA 2XAQA 1UUFA 2UUBB 2PKQP 2BZTA 3NONA 2QN1A 1PWZA 3AFHA 3PB3A 4NXMB 4LG0A 2Z4RA 2F8LA 3OZUA 3HO6A 3GG2A 4I4TB 3W8RA 4RA6A 4E7KA 2HJHA 3D4NA 3DTYA 4ZIRB 2ZXEA 1M0TA 4UUAA 3O2QB 3GLGB 3Q6IA 2QRKA 3JARA 4RIHA 2VPYA 4ZQFA 4DBLE 4L5CA 2H3HA 3OE7D 1KMMA 4HRXA 1AA6A 4Q05A 3ZZTA 2OSBA 3PSFA 3CC8A 3TCXB 2OLKA 2EJUA 4MUGA 3R77A 2CW0F 5ILVA 3K9NA 4BWGA 3MWJA 2HDCA 4EGJA 3BJMA 3CZ6A 4J1SA 3SR4A 1PQYA 2IUFA 1JFTA 5LKRA 2OQIA 3SNHA 3IT2A 4U7TB 4FYVA 3LQ2A 3O1IC 4CVNA 2XITA 5B6IA 1NX9A 2MR5A 1M10A 4PYKA 1K98A 4HDKB 4CKWA 4EX7A 4MULA 4R81A 1SBTA 3F3SA 2VTEA 1O97D 1RP7A 2B99A 1RAEA 2B7LA 1UP6A 2Z6AA 2DPXA 4RAYA 2DFKB 1TD1A 1OT3A 4A3GJ 4GOJA 1RC8A 3MT0A 3UY4A 1A36A 5A71A 9MHTA 2WWRA 4BLTA 4G0YA 4CH7A 1FVHA 4AWBA 4ZI2A 5JAUA 2NPOA 3NTRA 3S5UA 3THYB 3PQ8A 4KRYA 2H5LA 4YNBA 3BSYA 4IV0A 3O4HA 4BNNA 2HWXA 2ZBFA 3N8HA 3U4HA 5BQXA 1W7PD 4KIGA 1HURA 1P62B 3DLCA 1GIAA 4IIUA 4MPDA 2V74B 2Z58A 3V97A 2DO7A 5JNRA 4IDCA 2IGBA 3RFVA 1N8SA 1QLJA 4BLVA 4L4ZA 1YZQA 2ZAGA 3F1LA 3IWFA 3WHCA 1YGPA 2WJWA 3F0CA 1YWGO 1B8VA 3WNQA 3MELA 4N65A 3SYTA 2V65A 5BYJA 2CY0A 1LVHA 1A2BA 3FPAA 1XK6A 1EQUA 4D6XA 2KIUA 1Z7YA 1BXRB 3AF3A 4JEIA 2X6TA 1SBCA 1WCWA 3H9EO 4G23A 3HOWJ 2QBYB 3RYIA 2I66A 3T06B 3KJGA 3H3JA 3VV2A 4XXHA 2O3SA 4Q0MA 1GZ7A 3HRIA 1C8LA 2Q6KA 4XJTA 1DDIA 5ALXA 3UATA 1EBUA 2Q0XA 4MR8B 3B1VA 1X7WA 1ELOA 1BJKA 3RVPA 2H9YA 2BGCA 3O3NB 2IS6A 2GASA 2V7QD 1CTQA 2UZ3A 1E8MA 2M4GA 5ESDA 2C5EA 3B3FA 3AKYA 2O0JA 3S14J 3X2EA 1C4OA 4G85A 3IIEA 2PBFA 1K4YA 4DLZA 3NU1A 5B58T 1BVYF 1FFSA 1Y37A 4DEXA 2GNPA 1GCAA 4B6FA 5KYXB 3ANYB 1RWXA 1ZLXA 3HYSA 4JI7B 4CHTA 4DL9A 3TLCA 2X9DA 1E5VA 4CM1A 3IV7A 4WK6A 1Y33E 1NYTA 4DNOA 5FUQA 4MRAA 2B9EA 3AF1A 3GUZA 4LMBA 2VOEA 3QVWA 2VJAA 1ETUA 4QWQA 3CTMA 2MYUA 3SZUA 1OLXA 3VZDA 5CIYA 3FNIA 3K3PA 2P11A 2YY6A 5A62A 3HLTA 3QVSA 5E3HA 4CLEA 1P3Y1 4JJEA 3HOZJ 1V1MB 5TVKA 3HLKA 1Z5UA 5EE3A 5DDIP 2P62A 4UNIA 4HQLA 4HADA 2X0JA 2JJ8A 3MTDA 3HUGB 3BRSA 1XPUA 2HCFA 4TX1A 2HEIA 5LGTA 1WPRA 2X0IA 3EGIA 4RPJA 3MCTA 2HU9A 1R1UA 2VYQA 1R6BX 1B00A 3RPUD 3ZW7A 2HOTA 3MD2A 1VMEA 1K7AA 4MHTA 4MI3A 2RC6A 4YPVA 4Z3OA 4A8JA 5FTWA 1RCTE 1OYWA 4PLYA 3QQPA 1NSFA 4LHZA 2EFQA 1DC5A 4YBZA 4ARVA 5MFZA 3DNPA 1YKGA 1JR3D 1GQ2A 3GJSA 3FNHA 4OD0A 4W9MC 4I4LA 3CLHA 2AE1A 2L18A 2JJ1D 3TX2A 1HOMA 4YRQA 3MKZA 1C1XB 4O1MA 1KERA 2FMUA 3OEEA 1FQOA 1Q1NA 3OZXA 5IVPA 4NX2A 1NV8A 2BGUA 3U40A 1IEVA 3HK2A 2ONJA 4FW8A 4LDNA 5J4VA 3GLXA 4RYLA 1V4BA 3WRXA 3PDHA 1NC1A 2J3HA 3WRVA 1YR3A 1COWA 2BGGA 3IH2A 1CZRA 1I9CA 1XLUA 2QUKA 4IOMA 1RQ7A 3CVOA 4N6OA 1YS1X 3SF0A 3QLVA 5A5GA 2J3LA 3JQ6A 1HL7A 4GX0A 3TTYA 1BVHA 1H9GA 3ZHBA 1O08A 1GGHA 4BAYA 1SHTX 2GTHA 3NANA 4Y4RA 4DNCA 4QECA 1Z7BA 3UC5A 1YW8A 2OHFA 2PDAA 1YVDA 5LMNB 5B3JA 3HPQA 1OGJA 1IQRA 1Q92A 1WH7A 3MZHA 1QCDA 2L7FP 3ASYA 4Y2PA 4CCNA 3Q15C 1HMPA 4YO8A 4YI3A 4F4UA 2OP1A 1R5GA 2QG6A 1WCYA 5EHXA 4QO8A 2B2XA 3W34A 2C78A 3FIJA 3LDHA 3R3ZA 5IT9Z 2C5SA 2W93A 3K15A 4NE7A 1HDYA 1P2TA 4ZTFA 2AFHA 3A6ZA 3HCPA 2OWEA 5DGCA 1F0KA 3DMRA 3BG9A 5C80A 4X0GA 5LGNA 5E3LA 2R25B 1UJ8A 4CTOA 4EA9A 4U7WA 3DM9B 3GJ5A 2IXTA 3E61A 4LZWA 3HXQA 1U7PA 4P3PA 3RFXA 2GAJA 3JV7A 1I7NA 1W0JD 3MTBA 4WZBE 1GRCA 4O5AA 1ITZA 2VP9A 2G0NA 4OHVA 4DEYA 5DYWA 4HB2A 2QI9C 4UTNA 2C9MA 4OGKA 1QQ6A 3AOEA 5G1PA 2D4HA 5C8DA 1OFHA 4AX8A 1KBOA 1P1CA 1GFIA 3TO5A 3OFSA 5TMEA 5BV2P 4QASA 4IP0A 1JIJA 3E9ZA 4LF8B 2WB1A 4MS1B 2VDQB 2FRVA 5G0TA 1VC2A 2JKVA 3I9KA 4DJTA 1F4LA 1H2XA 3E8MA 1R8JA 3HFJA 3EZYA 2JJ7A 1R3UA 5LDHA 1Z6RA 4RGVA 4CCWA 3UMYA 2AOXA 3FA2A 4E4RA 5JCXA 4PZDA 1NPTO 1E8DA 2AJCA 2J5XA 3ZV5A 2X3YA 1XVAA 1Q0LA 4REOA 1QOQB 3AY7A 1EH7A 4C05A 2BCJQ 5BNWA 3FXRA 5JVDB 4DXAA 3WTWC 3NATA 2DBVO 3LG2A 4RACA 4F7WA 4DC0A 1YSCA 4P53A 2H2GA 1E1LA 2R6HA 3OT1A 2EL9A 4BRWA 4K40A 1XZPA 5JCOC 4TUYB 5K6AC 4BVLA 1A1VA 1DADA 2VT2A 1Z22A 1N4AA 4BLUA 4MB2A 3UWOA 1LRJA 4ETMA 2NVXJ 1XRMA 2ZJOA 4YAWA 4M9QA 3QE4A 2GN8A 1CEXA 4R5HA 4MW5A 3V4FA 3ORSA 4KFUA 5EIFA 4ABZA 2JCVA 2Y1CA 5DCFA 4M1EA 2IOQA 4C4SA 2O3TA 2XV4S 2VJJA 3L49A 4D8TA 5FWYA 2QTVB 1E5XA 3NPAA 2H1VA 5CLGA 3W5VA 2ATCA 1D1PA 2LDXA 4IHAA 4EB0A 2WG1A 4D4HA 2LPMA 3DTVA 5DB4A 2QTFA 2V54A 1U9NA 3U7IA 3WAKA 3OIOA 3REOA 3AR5A 1A6QA 2EXXA 3MWYW 2D6FA 3DU5A 1K6XA 3FETA 1NN3A 3VXKA 4I1RA 1H42A 2O3JA 2RKHA 4AJIA 1OB5A 2ZBUA 2GLXA 4H3SA 2KW5A 1SQSA 2IZ1A 4KDEA 3DBVO 1E5TA 4CYCA 4MZXA 3L1JA 2DKFA 4X8OA 2HDHA 6CHYA 4UHHA 5H7XA 1WHSB 1TTHA 1JPUA 3H97A 4BDYA 1VMAA 4PQEA 4LQ4A 4P4UA 1VRWA 1TECE 4KQJA 3HTSB 1FBSA 4QYIA 1XFAA 5M3MJ 5AICA 1UOQA 1P9WA 5ICSA 2VYCA 2A07F 2CG4A 1EP2B 4KB5A 3LLVA 2ZJZA 3GV0A 5KDOA 5FNVA 4P54A 1WCXA 2ANBA 4Q3OA 2UXBB 3QMMA 4O4HF 1DZIA 2ID7A 2YINC 2I67A 4KUGA 1A9XB 3M4JA 2OA0A 4TTTS 2ZB3A 5GV7A 3HUEA 1H9TA 1UC4B 4ARIA 2CLCX 4MW0A 3H0CA 4WY8A 3QKWA 1T9CA 1B8PA 4E7IA 1VCMA 1FBUA 1BHJA 2CVZA 3KB1A 5BN5A 3TQFA 3OQ6A 1XRSB 2DBYA 4BE2A 1KJIA 2C61A 3R2JA 3T4XA 3BK2A 4D46A 1PGOA 1XMOB 2G0AA 4TTJA 3H5NA 2OZKA 4RV4A 3Q9UA 3WJ2A 1Z7UA 1XCMA 2HVSA 4GWGA 3M82A 2YQ5A 5KPDA 2XQIA 1OW3B 4F4JA 3ENNA 1NJ6A 4CMKA 4DLBA 3FUVA 3R7AA 4ZC8A 1H2YA 4IJKA 4YEJA 4JCCA 5KYTA 3IB3A 1YBFA 3G2LA 4UU8A 1CE8A 3IIJA 1UKBA 1RZVA 4DT1A 4UMEA 4MROA 1OPCA 2IUSA 5DJ5A 3P5BA 2Q45A 3W9SA 2L2OA 4MIKA 3SIPA 4BEJA 1FU8A 4PGFA 1NN0A 3ZZUA 2C4HA 3ENKA 3OX2A 4H7EA 4OUKX 2O8EB 1C0IA 3FCSB 1GU0A 2OESA 3TP0A 3PHHA 3K9LA 1VIYA 2Z98A 1Z5OA 3M5WA 2ATEA 3PQKA 2BY0A 4U4AA 4NAVA 2B0CA 4HT3B 2B21A 4R1OA 3SYMA 1NVUQ 1IIRA 4DLYA 2OHJA 2QM8A 4HW0A 3HNPA 4NYJR 4QEKA 1WKVA 2VDKB 3LUPA 4UNQA 4QDUA 1U63A 2GHQA 2CE2X 3AZOA 1EE9A 5COBA 2GD2A 2Q9UA 1Y4AE 2UYCA 1I4WA 2XGXA 5D5QA 4R84A 1TZKA 2P6UA 4BMOB 3HRMA 2WJPA 1QGAA 3S16J 3M07A 4HYEA 2Z2XA 4UKDA 2I3DA 4BZZA 5HIMA 4E88A 4UD6A 4DLLA 5M5WJ 3HHEA 4NZMA 2CRGA 1OY1A 3D5EA 2YBDA 3EFOA 5SV2A 4BNHA 3I32A 1YS4A 1P73A 1ZNWA 3E8SA 4B8XA 1ONVA 4B9AA 1GN9A 1K2VN 4NOKA 2ICWG 3PC8A 4V0LA 4UTRA 2NVUA 3OLYA 1T91A 5FLKA 2EV0A 4WUVA 5GP1A 1IRIA 3B36A 2ZSHA 1TT5A 2OCGA 2J4FA 4DUGD 5MN6A 1MA3A 2YVQA 4FOOA 3KQWA 1DKQA 3PT5A 4XICA 1QG2A 1U7TA 2L4AA 3MOSA 3UW1A 3NT2A 2X48A 1PDWA 3LL4A 3R4VA 2NU6A 5F6FA 5A5EA 3MNFA 1VG0B 1X13A 1QQ7A 1BW5A 1VG8A 1YUMA 4QOHA 2G08A 1JXOA 1QXSA 1VJGA 1CX9B 1F1ZA 4PLWA 4H3KB 1VQ5I 4EB6A 4FEAA 2QT1A 4EY4A 1DO0A 3KJNA 1R49A 1CIPA 4HH4A 3PHJA 4S1OA 4KQXA 5T3YA 4W6ZA 3T99A 3P2JA 3LC0A 3FKQA 4H4DA 3EPKA 3DG9A 5DFAA 4JJ6A 1F0PA 4MEAA 3KTAB 5LLTA 3GZNA 1O5OA 2WG0A 4HLUA 4M0UA 4HB3A 4YRRA 1L9KA 2VBXA 3SDZA 2GK7A 1FYMA 4YECA 1WDMA 4KVZA 3H65A 3G9QA 3AKDA 3LCRA 3VM6A 2QVCA 3CUKA 4LITA 3SPXA 2HK7A 4A2CA 1YX5A 2YW2A 2NIPA 3FPFA 4FIDA 2G8LA 2Y9PB 1ZNXA 1A27A 4DLNA 4X6UA 3TPCA 2F6RA 1QP7A 3RRBA 2HX1A 2J7PD 2GCOB 3MVPA 1E2PA 2XCUA 3I0MA 4F9TA 2X9NA 4NICA 1FTNA 3PD1A 4Y6SA 4RA9B 4QYSA 2Z2JA 4PONA 2F55A 2DPGA 1A69A 1QH8A 1N77A 1ADCA 5AKKA 1BE8A 1SULA 2YHIA 2W42A 2VJCA 4YFXF 4FCWA 4Q4HB 2QTRA 1RKWA 3H5VA 4BMNA 3S2HJ 4NF2A 3MB8A 3KT3A 3P0JA 2HTEA 5KREA 1UOPA 1WI9A 1Y39A 3NHKA 3T7RA 2MA3A 2QVLA 3F3YA 4AZTA 1XF1A 5ER6A 1YA6A 2GTPA 3GHHA 3GT0A 5GMOA 1IUFA 2W2XA 1PGPA 2IYFA 3SGLA 3BHMA 1VPWA 1JUMA 5CITA 2JLWA 4B2LA 4YT8A 3HA3A 4RSHA 3WG7H 2IPAB 3ITKA 4JLDA 4BPRA 5DUIA 3K0EA 1QF9A 3ABKH 4N5MA 2DECA 2JBWA 4C9BA 2C2BA 4F38A 2FPGB 3DH0A 1SCJA 1ZOSA 2ZR8A 4C0JA 2I76A 3R9KA 2C1XA 2PXCA 1KEPA 1UDAA 2OENG 1KJWA 2L02A 1LSJA 5BVHA 2F1JA 1YZUA 3BDVA 2YN0A 3PUKA 5F1RA 4GPIB 2PA0A 1LJUA 5C35A 1CZOA 4B3BA 1Q1ZA 1WJ5A 4MVJP 2ORYA 4RMGA 3D4PA 4EYOA 5FKNA 1VQOI 4YRLA 4AUXA 1X86B 4BATA 4L6CA 4RB0A 4DCNA 4WBNA 1W5TA 2PUCA 1AMUA 1A4RA 2QUIA 3OUUA 4L4XA 3QJYA 3JW8A 1KMHA 4DMKA 1W4BA 3MJTA 5BUQA 5C8YA 1UBKS 3FYUB 3PVZA 3O2SB 4B09A 1QB8A 2MWMA 5TT0A 4G8XA 3DTEA 1XFDA 3HCAA 1YIJI 5LQUA 4R40A 3O0DA 2RI1A 2WYIA 4F12A 2OQVA 2A61A 1TMOA 3L84A 1DEHA 5IVDA 5C1PA 1DAHA 3MUOA 1YZKA 1LI5A 4E51A 4AZSA 4CUKA 2OKGA 4XWGA 3NVAA 1LBIA 3JYHA 4L02A 2JJ2A 5ALIA 3QU7A 2GXGA 2H59A 4HH3C 4I5IA 5E9QA 5HZKA 2G04A 1DU6A 3D6HA 1M6NA 4UPVA 3DE3X 1SZDA 2DYRH 2IYTA 1JG1A 3FX3A 2ZWPA 1IMJA 3O8LA 3AW9A 4EF5A 1NVTA 3BGDA 1YZLA 3EQ8A 4JI1B 3SQXA 4Q9IA 3ND8A 4JVNA 2QZJA