1K83J

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k83J00
3MN2A 2Y0SN 2Y9YA 4M3FA 5DS9A 3Q0WA 3A03A 1FIPA 4HNVA 5M5XJ 1GUUA 1ZK8A 3FK6A 2HOTA 4JYKA 1X58A 5GPCA 1XS9A 3S14J 3BR1A 5FKNA 5M5YJ 4A3GJ 1ZR4A 1WPKA 3FK7A 3IH4A 3C2BA 1B8IB 1GV2A 4S0HB 2HI3A 1MH4A 2XGCA 2WB1N 3HEFA 2QF7A 4UUSA 2LK2A 3CDLA 2DMPA 4FTHA 5F0FA 4BKXA 5JLXA 2LD5A 5FLMJ 2E1OA 2VUMJ 2EZHA 4A69C 4IHXA 4Y52J 2ID6A 2LY9A 4A93J 3CCYA 2CJJA 2E19A 1Y1VJ 2M8GX 5EEAA 1H88C 2XRLA 3QPLA 5EZHA 1B72B 2IAIA 1XG1A 3HKZN 3A01A 3PO3J 2DJNA 1P7JA 3MVPA 1ENHA 1ETKA 4IHYA 2K9SA 2LR8A 4JP0A 1LE8B 1HCRA 3TP3A 3JRFA 5IP6A 4QIWN 2TCTA 2O8KA 2JA5J 3BG5A 2HDDA 2LLKA 1BL0A 1JTXA 4MIMA 3ZOBA 3S2DJ 1HLVA 3E7LA 2XB5A 4G12A 1FJLA 2DMTA 2LP0A 4M3DA 4D5CA 5FLVA 5M3FJ 3BG3A 3MKLA 2HXIA 5IYDJ 3ZQHA 2R5ZA 1QRYA 2DA2A 3RKQA 2XGEA 2K9NA 1MBFA 2K40A 5GPAA 1Z0XA 3QQAA 5EG0B 3HOYJ 2JK3A 3A01B 4A3MJ 4C3HJ 2YS9A 5FKLA 2ELKA 4IEJA 5FKKA 3HOVJ 4DZJA 1JTYA 5IPAA 1SFOJ 4Y7NJ 1D5YA 1LFBA 3ZQCA 2Y30A 2L0KA 1HDDC 2DA3A 3TP0A 3Q0VA 4M3EA 2HOAA 4A3KJ 2EH3A 2FD5A 1Y1WJ 4XICA 1YRNB 2XGDA 2NS7A 2QCOA 3A02A 1OFCX 1BJZA 4DYRA 1AHDP 2DMNA 4UUTA 1ZQ3P 3JRDA 2NS8A 1OCTC 2MSYA 1AKHB 1HOMA 1ETWA 1XC5A 1RPWA 3M4OJ 3SFIA 3GTQJ 2PMZN 2HOSA 1JKRC 3S2HJ 1RKWA 1WI3A 2DA4A 1W0TA 5EGOB 3UKGA 5FKOA 4D7MA 1AU7A 2H1KA 3H0GJ 3BR0A 3S15J 1MBJA 3I4NJ 4RBOA 4GFBA 2JN6A 4C3JJ 4B1RA 2X48A 1GVDA 1A5JA 1TWCJ 3HOZJ 2JJ7A 1ZTRA 4V2GA 1F43A 2DA5A 1ETXA 1RKTA 1NK2P 4DZPA 1IDZA 3Q0UA 3LOCA 4D7NA 4FCYA 2NVXJ 3GTGJ 3I4MJ 4A3LJ 2GM4A 1I6HJ 1QVTA 2R5YA 1IRZA 3LSGA 1EF4A 3NARA 5C44J 2O7OA 4D5FA 3BT9A 2FQ4A 2JWTA 3GTOJ 2HYJA 1WH5A 2XPUA 1WGXA 5F0CA 4B4CA 3GTPJ 5J1RA 2CQQA 3L1PA 2DTZA 1TWAJ 4FE4A 5M3MJ 2ME6A 5C4XJ 1MBEA 3LSPA 4AC0A 3JRIA 2LKXA 1B72A 2CU7A 3TW7A 1TWHJ 1GDTA 5K7ZA 3HOWJ 2CQXA 2JA7J 4XIDA 2YU9J 4W97A 4CYCA 3NAUA 3JRHA 4XRSG 5M5WJ 3JR9A 2RAEA 1S7EA 1K61A 2KDZA 3K2AA 2ME0A 5F27A 1ETQA 1TWFJ 4IHWA 1HF0A 3H3VK 1I50J 3PO2J 3S1NJ 1PUFA 2WV1A 4I76A 5F04A 1VNDA 2EZLA 2VKEA 5EDNA 3LNQA 2E2HJ 1POGA 5E3LA 3D1NI 1ORKA 3BQYA 1JJ6C 1HDPA 5E3OA 2IEKA 2XB0X 5C3EJ 1LFUP 3GTMJ 1BW6A 2FX0A 4XRMA 2NVYJ 3RQIA 2G0EA 4AUXA 3IH2A 2R5ZB 1X2MA 1TC3C 4JX5A 2X9DA 4B3AA 1JKPC 3F0CA 1FIAA 3TW6A 5EG0A 2ECBA 3TEDA 2KT0A 2ECCA 4DYQA 1U78A 4A3FJ 3WHBA 5DTDA 1I3QJ 5EYRA 4BY7J 2XSDC 4ABZA 1GT0C 3JREA 2JA8J 4JX4A 1MSEC 3HOUJ 2Y2ZA 3K7AJ 4X6AJ 2L7ZA 4A3IJ 3GTLJ 1MSFC 4NDLA 1IDYA 3BR6A 2DMUA 2EQRA 2ZB9A 4W1UA 1NTCA 2COBA 2E2IJ 1IG7A 4FE7A 3FIWA 3BR3A 1JUSA 5C4JJ 3JRAA 1IGNA 1DU6A 2EZKA 4I6ZA 5EF6A 2M0CA 2MG4A 2DA1A 1OCPA 1U9NA 2OPTA 1H8AC 1UMQA 2XPVA 4A3JJ 2HXOA 2Y9ZA 1R9TJ 4DYCA 5IOYA 2GBYA 3G1OA 5J1UA 2R7ZJ 3DEWA 5E3MA 1JKQC 3S1MJ 1LE8A 1MBHA 2CUEA 5F1JA 3OSFA 1BW5A 2GLOA 2CRGA 3LSJA 4A3EJ 4MFDA 3DCFA 3GBGA 2M2EA 2N8GA 4EEFG 1IJWC 2DA7A 3O8GA 2CUFA 3OSGA 2X6OA 2I10A 4M3GA 3S17J 1RETA 2R92J 2K9QA 5E3NA 1IC8A 1NK3P 3RZOJ 2MGQA 3S16J 2TRTA 2L9RA 3W6VA 3HBLA 1VFCA 3OOUA 4LOCA 5J1YA 5F0HA 3JRBA 3BG9A 3OIOA 3S1QJ 2DA6A 3QPSA 1YRNA 3ZQLA 3JRCA 1JT6A 3LSRA 4MLOA 2EBIA 3CQZJ 1H89C 1OJLA 3PM1A 4AYBN 1QPIA 4CYCB 2D5VA 4DW6A 3O8HA 3GTJJ 1JKOC 4BBSJ 4BXXJ 2W48A 4JX6A 3VPRA 2R93J 1GV5A 3BTIA 3FKIJ 3HOXJ 1APLC 1JJ8C 2O9LA 1UG2A 5HODA 1E3OC 1T33A 4FISA 2NOGA 1B8IA 3BTCA 3M3YJ 3BTLA 2WAQN 1IV6A 4UUSB 2Y31A 4MO7A 5IYBJ 1JT0A 1WCMJ 4MFEA 3ZQFA 1MNMC 1G2HA 4QTRA 2IBDA 1P7IA 3G1LA 3HGYA 2JA6J 5F08A 4A3CJ 4XK4A 2HQ5A 2M9HA 4V2FA 3HB9A 2DMQA 1QVUA 2DN0A 5IOZA 2AHQA 1FEXA 3BTJA 2YUSA 1Z77A 1MBGA 2ID3A 2LFBA 1PUFB 5JLWA 5IYCJ 1ZKGA 5EGOA 2EZIA 3BQZA 4QSHA 1RR7A 1ITYA 3SDGA 1JGGA 4J19A 1VI0A 2LVSA 2VKVA 1ETVA 4XRSA 3IV5A 1WH7A 1SANA 2XPWA 4C3IJ 5GP9A 1ETOA 1JUMA 4X1EA 9ANTA 1FTZA 5J3LA 1MH3A 5K7HA 5K7FA 2NVTJ 4BY1J 3WHCA 5EZGA 3BR2A 5IP7J 4A3BJ 3ZQGA 1IUFA 5IP9J 3RZDJ 5FKMA 2LTPA 2E2JJ 4A3DJ 4C2MJ 2VPRA 2L7MP 4M6VA 3SJMA 3BR5A 1X2NA 2OF7A 2R5YB 2NVQJ 3IH3A 2H8RA 2R0QC 4M3BA 3GTKJ 2MW8A 1MBKA 2FJ1A 2P81A 4BBRJ 3B6CA 3FISA 1A6IA 3HM5A 1ETYA 1BA5A 4L5EA 2VI6A 3B6AA 1O4XA 1F36A 5FJ8J 3CMYA 2JMWA 3HDDA 1DU0A 1JUPA 3S1RJ 1W0UA 1T56A 2L7FP 1TWGJ 1VF9A 1U8BA 1CQTA 1UHSA 1ZGWA 5BNGA 2M34A 3ZQIA 2B63J 3JRGA 3Q3SA 1RESA 4IHVA 3G1MA 3HGGA 2AO9A 4RDUA 1K83J 1Q1VA 1ZR2A 1FTTA 1AKHA 1U9OA
chains in the Genus database with same CATH superfamily
3MN2A 4HQEA 2D45A 4FX4A 2Y9YA 1B9NA 2VKHA 1O3RA 4RGSA 3ASOH 1ZG3A 1GUUA 1S9HA 1HXDA 5H6RA 1XTAA 2R7SA 4JYKA 2YPRA 3QU3A 1KGSA 5HVQC 3S14J 4A3GJ 4KA4A 3DWLE 1ZR4A 1WPKA 5HDGA 2Y0SA 3C2BA 3EQLF 1GV2A 2Z3YA 4UVBA 2DQLA 2K7LA 1B59A 4DIQA 3DV8A 2JUGA 4EJVA 1KU7A 3OWTA 2LK2A 2X6XA 2LOOA 2DMPA 1YITI 2IS1A 4LIUA 3KZZA 1LEAA 2WAFA 5F0FA 3DPUA 4BE1A 5FLMJ 4X0GA 1AWCA 1MKMA 3FMQA 3V8JA 5B1AH 1ERDA 3F21A 3C2GA 4I98B 3I59A 5ILVA 4WWCA 3KZYA 2XRLA 3QPLA 1IF1A 2ELHA 2K9LA 3HKZN 3K2ZA 5DDGA 3PO3J 3MVPA 2LBFB 1XGSA 1IN7A 2HQRA 3TP3A 1FY7A 1S3JA 5J40A 1UB9A 5FGMA 1ZARA 1T08B 2TCTA 2CGPA 1ZRCA 4C2UA 1YIOA 2RNJA 1J0RA 3COAC 4NQWA 1QU3A 3E7LA 1FJLA 4G12A 1K78B 1J59A 3I56I 2CUJA 4M3DA 2LP0A 3HXLA 2QQ9A 4OAYA 1QO0D 2HXIA 3M1CA 1X1CA 4I01A 5FROA 2R5ZA 3E3VA 3WGHA 2K9NA 2QUFA 1Z0XA 1IRGA 1XCVA 2H27A 2JK3A 5IT9K 1LUJB 3GYHX 4A3MJ 2RDPA 4DNCA 3HOVJ 3QYBA 5HLIA 1DPUA 1AA7A 3OYMA 2W85A 3SZGA 2ZSHB 1SFOJ 4ZYHA 2EFWA 3ZQCA 1YO5C 1BC7C 2L0KA 1DP7P 4PFOA 3K70C 2DOEA 3CDHA 3Q0VA 5FFXA 4DBQA 4ZTFA 4I0BA 2HOAA 4A3KJ 2EH3A 2IGOA 4H0EA 3BCAA 5CLSA 1Y1WJ 2CS3A 2OTLI 4NHJA 1MZBA 1BN5A 4IJAA 4XICA 1IN4A 3K4MA 1FP1D 3OYGA 1ZRDA 4CXFA 1PP8F 1BJZA 1AHDP 5J4VA 4BE0A 2DDAA 3L2VA 5DD8A 2NS8A 1OCTC 4V19K 4PJMA 4AM3A 3ECHA 4ZJZA 2WADA 1ETWA 5CVUA 2R7DA 3MKYB 4Y17A 2QKLB 2JUCA 3R61A 4AIHA 2JVGA 2PMZN 4O5VA 4FHTA 2WWYA 3H9QA 4WF2A 1O7FA 1OR7C 1ZGJA 2EJRA 2M1BA 2DA4A 3H92A 3WE2A 1YJWI 4HSTA 2DOFA 1KU3A 3K4NA 3BR0A 1R58A 3I4NJ 1TP4A 1BR2A 4L9JA 4CCMA 2HVSA 5LHIA 3HTSB 2DOAA 3ABUA 1W36D 2YSRA 5E8GA 3GMEA 4ZDPA 3VDXA 4A6DA 3CP8A 3HOZJ 4RAYA 2HQNA 3U1DA 3NWTA 5IT3A 2KP6A 2E1CA 2IS2A 3DTEA 4BQOA 1JI8A 4DZPA 5LD2C 4L9VA 2YR2A 3PJRA 3OS0A 2F5EA 2H1LA 4LK1F 3OR2C 5LEJA 2DDBA 2A6TA 2EA2A 3E97A 4ZYEA 1G3TA 3EUHA 2KIUA 1K4SA 2KKOA 1JHHA 2R5YA 2L9SA 2CSOA 3RYPA 3DP7A 4LD5A 2W4SA 3DBHB 1Y8QB 3P9KA 5L3CA 3GTOJ 2EFPA 2X1CA 3TOBA 3DFGA 3TO9A 4EGZA 3GTPJ 2BHYA 5J1RA 1SFEA 3WU0A 1XDSA 5DM6F 4I99C 3L2WA 1TWAJ 5IY5H 4LG3A 2ME6A 3G6EI 4DBRA 2P6TA 3I59B 1USTA 5LFAA 3PUFA 1DP3A 3F9KA 1BM9A 5ICEA 4CCKA 3TW7A 1GDTA 2L7KA 2HVRA 2YU9J 4CYCA 3I71A 1VQ7I 4IRIA 3NAUA 2YU3A 4XRSG 5KAIC 5J47A 3HOTA 4IRHA 5F27A 4CHUA 1ETQA 3J7YJ 1TWFJ 3Q5FA 4MHGA 5E1WA 1HF0A 1CF7A 2FBHA 4GGGA 2EZLA 1U8RA 2LF7A 5E3LA 3A2KA 3BLYA 1HDPA 2KDOA 5E3OA 1H9GA 3KX2A 1XSVA 3DEUA 2DFHA 2CH0A 5B3SH 3GZNB 4XRMA 2DT7B 3AL0C 3LL7A 3PIPF 3TMOA 2R5ZB 3DEEA 2OV7A 2KHMA 2M7AA 2QWWA 3GFJA 5E1XA 4I0AA 4JX5A 5CKTA 3TKYA 2CMPA 1MGTA 1SVMA 2NYXA 1WKMA 2ECBA 2X6WA 1HW5A 4G6DA 2ECCA 5J8CA 4XL9A 3FM5A 2PJRB 3DTIA 3WHBA 1I3QJ 2VQHA 3FXQA 3K69A 3S93A 3TDUC 3WU2C 3H35A 2HS5A 3M8FA 1I39A 4R79A 1SD4A 4JX4A 4KYWA 1R5GA 1R00A 1W1WE 3L2UA 4HAMA 3RPUA 1LDJA 4EM0B 3K7AJ 4X6AJ 3M8EA 4A3IJ 5K5RA 1EKEA 2D1VA 2DMUA 2EQRA 2COBA 1N25A 1JUSA 5E17F 1R6RA 3BPXA 2H8WA 2DCEA 4ETSA 3FXRA 1WZ2A 1Z21A 4B09A 2A61A 3AG4H 3N4MA 2VONA 3WG9A 2V6EA 3BDDA 3OYIA 3ROUA 3GF2A 3GW2A 1R9TJ 5E18F 3GFMA 3GLXA 2Z9OA 2ZMEB 3HPHA 4Y33A 3IL2A 3JSOA 4PJLA 1Z7LA 4EMSA 2UZKA 1BW5A 2HZDA 2CRGA 2IGMA 4ANJA 3SHFA 4HQMA 4MFDA 4B44A 1FMVA 4CH7A 3FXUA 4EEFG 3RDIA 4BEHA 2OA4A 2RNGA 2XHKA 2X6OA 2Q8KA 1O3SA 3S17J 1EH6A 4KN7X 2E1MB 4ITVA 2RVCA 1ZG1A 4IHTA 1W5SA 2MGQA 5KHDA 5GAHJ 3GFLA 3L2CA 2ZXIA 3JRBA 1YS7A 1HBXG 3BG9A 4KMFA 4UUVA 2Y69H 4FETA 4N4NB 4BJ6C 3OMYA 3QPSA 4AU7A 1YRNA 2JTVA 1TNTA 4PJ0C 3S3MA 1IN5A 3FBIB 3GUDA 4RB1A 2DK8A 1VQMI 2D5VA 2B9SA 4BYYA 1JHFA 4CCJA 2Z99A 4S05A 1JKOC 2W48A 5CJ9A 4FASD 5LBQA 3C1DA 2L5QA 5D5WB 3S2WA 3BTIA 3LFKA 4HNTA 2HDWA 5KAFC 2FOKA 3IKVA 2ZBKA 2M3AA 4G6TB 3BJOA 3MZYA 1T0FA 1OYYA 1D1CA 1G3SA 3MZ8A 2G9WA 2WAQN 1LVAA 4MO7A 4PDKA 1KZHA 1JT0A 1X1PA 1WCMJ 5ICGA 1I3AA 4D1QA 1OCCH 1FBSA 2VLAA 2ZCWA 2M4KA 3DBRB 1QZZA 3H9GA 5D8LB 3P5JA 1G2HA 2XAFA 3G73A 2FU4A 4A3CJ 2X1EA 4V2FA 3CUQC 3LSMA 2BV6A 2AS5F 2W00A 3CC4I 2V26A 4XN3A 1TT5B 3RYRA 2YUSA 1MBGA 1G4DA 1T0FC 1PDNC 2LFBA 4C2TA 2VXDA 1CF7B 4G7HF 4JQFA 3WTUC 3CCLI 3EDPA 2O6GE 5EGOA 2EZIA 4QSHA 1RR7A 4A0ZA 1BIAA 4GRIA 3FXJA 1JGGA 4HG2A 3VYRB 3HC7A 3ZMDA 3KETA 4GDFA 1ETVA 4OWRB 2MC4A 1SANA 3LQQA 4KITB 2M5WA 3FMRA 2IJLA 1KONA 3QPTA 1IRFA 2DPDA 1RIOH 5J3LA 1M1EB 2OJED 3BPVA 2FBKA 3WHCA 3MAJA 1PVEA 1UELB 2CFOA 5FKMA 3WTSC 2CV1A 2LTPA 2J5OA 3QWLA 5CVJA 2L7MP 4M6VA 2NNNA 2IS6A 2Y75A 4IVNA 3U2RA 2L9NA 1CGPA 4KISA 2A69F 1MBKA 2O03A 3IAM2 4PSXA 1QA6A 2D1HA 1A6IA 3K1MA 3HM5A 2R7XA 4L5EA 2LC2A 3B6AA 5B66C 3LAPA 2ZJRF 4J00A 3CMYA 1WVRA 1DU0A 1XSXA 1H0MA 1A31A 2JQ7A 1VF9A 4ENKA 1LDKB 4M9XA 3ZN1A 3ZMSA 1E0EA 5BNGA 2M34A 3ZQIA 4P9FA 3ABMH 4BXFA 3D5LA 2H94A 1RESA 4IHVA 4YIRX 1IN8A 3HKZA 4C9YA 2XAGA 3OYJA 1Q1VA 1ZR2A 4UB6C 1FTTA 2P0WA 2M4GA 3CCUI 2GWRA 3FDYA 1H9TA 2V6CA 1OPCA 1OQYA 3Q0WA 4XLCA 3VSLA 4HNVA 5F64A 2P5LC 3KIOA 5DV5A 2VT2A 3IP4B 2R7QA 1WRJA 3ASNH 2V1NA 4XOTA 1ZLKA 4IQJA 5TISC 2GA1A 2HI3A 2O5RA 1MH4A 2XUBA 3MWMA 2XGCA 4A12A 3F8FA 2QF7A 2VOOA 3CLOA 1WI9A 3KE2A 1J75A 2KZVA 4FTHA 2RQPA 2RKHA 2LMDA 3KEQA 2LD5A 3BOQA 3CCJI 2E1OA 2ETHA 2J5PA 3IRQA 2R7TA 3WU1B 2EZHA 2VUMJ 1MJBA 3DPTA 4IHXA 4NC7A 2ID6A 2LY9A 5E79C 2V1XA 2CJJA 5ICCA 1LNWA 1Y39A 1H88C 4RAGA 3JTGA 3L2RA 4BACA 4ZC3A 3A01A 2KJBA 5TRDA 4OIQF 1FOYA 3N97A 3ZMUA 3KPHA 1NG7A 3AG2H 1ETKA 4AYBA 1SD6A 4I7HA 4EM2A 3H36A 3H5AA 4JP0A 2PMHA 1E17A 2O61A 3GO5A 2GOMA 3OL4A 2I8DA 5K1YA 1S6LA 4OINF 3HHGA 3BG5A 2BY2A 1V3FA 2HDDA 3J80Z 1BL0A 1JTXA 2GA2A 3QOEA 2FE3A 3FMSA 5KCMA 3BWGA 1STZA 2BXYA 4ENNA 2CQKA 3RKYA 2PMZA 4ESFA 3N05A 4HOBA 3ZRGA 3GXOA 5IYDJ 1WWXA 2BW3A 2V9VA 3DKXA 1WFXA 3LMMA 5GPAA 1YS6A 2E5NA 2XKOA 3CO7C 3EUHC 2OZ6A 3CLQA 5BQTA 1X1BA 3G4SI 1L0OC 2KZGA 3CJTB 3CF2A 2ISZA 1YX3A 5FKKA 3V8LA 1JTYA 4U7DA 3CCQI 4ZH4F 2MH9A 2X6YA 4B3XA 4BHCA 2Y30A 4PGGA 4BDZA 1A04A 1UFMA 2CV2A 3RCOA 2VC0A 4PZJA 4YEJA 4M3EA 3MCZA 2GQQA 3DTKA 3CUOA 4TV7A 3AFHA 3P7NA 5B5EC 1N77A 2V1UA 2R7FA 3RSNA 1P4AA 4E7LA 3PL8A 5E20A 2GOXB 4NUBA 1D1BA 3K9TA 2QCOA 2W25A 1OCZH 1R1TA 4HNUA 5HS8A 4DYRA 1BI3A 1ZQ3P 1K6YA 1WJAA 1VQKI 2QQAA 3JRDA 1Z9CA 1HOMA 1WJFA 2OUMA 1RPWA 5HOOA 4EJUA 2G7HA 4HX8A 2PBIA 5JHFA 1RKWA 4M6YA 4BJ5C 1SEUA 3W2VA 1TNSA 2HKOA 3RKWA 1DPRA 1RZ4A 2LF8A 2VJJA 5L3EA 5FKOA 4D7MA 2DW4A 1IV8A 3S15J 3H1CA 3ZMZA 1XMXA 1MBJA 2FSWA 4RBOA 3OS2A 3FM3A 3K4KA 2BBYA 4Y3OA 5AIPA 3DQVC 1GVDA 3F6VA 3SXYA 3IUOA 2LYCA 3VOEA 1N78A 2UV1A 5L3BA 1F43A 2FNPA 2RGVA 4B8XA 2DA5A 1ETXA 1TQMA 1NK2P 1RRJA 1MDMB 4LMYA 1IDZA 2E60A 4AVZA 2ZMEA 3LOCA 4XONA 3OL3A 2NVXJ 3GTGJ 3I4MJ 3F8MA 2MLKA 4B47A 1OMIA 1Y0UA 2GM4A 5DEQA 3OOPA 1QVTA 4HX4A 3CD6I 2XF7A 2QQBA 2V79A 3LSGA 3M07A 2OD5A 3PFIA 1XPXA 1FOWA 2EIMH 4E7IA 1UG0A 3QP6A 4FX0A 2JWTA 2MLGA 4UB8C 4PJNA 4EVIA 1WGXA 4OIOF 2CQQA 4KNYA 2CO5A 1YLFA 3KCCA 2K86A 3PFYA 3ZQQA 3P9IA 3H5RA 5C4XJ 3OYNA 1FSHA 1U2WA 4XLNF 3RI4A 4HA8A 2WC2A 1MMGA 1U6GA 3W2AA 4IKFA 2CU7A 5FD6A 1TWHJ 3EUAA 2XF6A 4KJZA 5EEHA 2ZJ2A 3HOWJ 1W7PB 2DT6A 4W97A 1Z91A 5L3DA 3HHHA 5BS6A 4Z2YA 2ISYA 3F8BA 1ACIA 3ELKA 3E1SA 1S7EA 2HTJA 3MEXA 3PUBA 2IA2A 1XCBA 4Y4RA 4IHWA 5CVRA 3F8NA 1J2XA 3H3VK 4PFPA 2DI3A 2JPBA 1PUFA 4I76A 5F04A 3LNQA 1VNDA 1FC3A 1GXPA 4ASNA 1L3LA 4MTEA 2IP2A 3CESA 3HJEA 1ZRFA 4G8XA 1UHMA 3D1NI 4IOAF 1ORKA 4PUSA 1JJ6C 1WJCA 4G6QA 1BIBA 1VQLI 4CCOA 4Q4ZF 2RQQA 2TDXA 1BW6A 1W4MA 3J7AY 1LKXA 2P5KA 3S8PA 2PLYA 3RQIA 2LRDA 2G0EA 2Y0MA 4AUXA 2BW3B 4HSRA 4P55A 3ZPLA 3LQRA 2VQLA 2X9DA 3QYFA 1R7JA 4B3AA 1JKPC 3F0CA 4S04A 1FIAA 1KYZA 3I9V2 4UXNA 2GAUA 2O8XA 3RIRA 2IA1A 2FEZA 4BUPA 4A3FJ 2KIMA 4BY7J 1GT0C 3RPQA 2UXXA 2H09A 5HLHA 1T95A 5CQEA 2VASA 4A5NA 1ULYA 1X4PA 2L7ZA 3PNYA 2NVUB 2MH2A 2WAQA 2WTEA 3BR6A 2FRHA 3ZGKA 5J8FA 4W1UA 2VE8A 1IG7A 3EYIA 2HKXA 3BG7A 4U0VA 1WJDA 4MEYF 4IX7A 5C4JJ 4OMYA 3JRAA 3I58A 1TZLA 1IGNA 2EFOA 4ENJA 3CJQB 5LGNA 3I55I 1QHHD 2Q2EB 4I6ZA 4YIIA 5EF6A 2M0CA 2MG4A 2QLZA 1K78A 1OCPA 3L09A 4A2UA 2HXOA 5ILUA 3T0YA 2Y9ZA 1HSTA 3S32A 3SDBA 1N75A 5IOYA 2GBYA 2PEXA 3G1OA 5J1UA 3H3ZA 1G8XA 4AWXB 1O3QA 2R7ZJ 3S1MJ 1FLIA 1LE8A 3WTYC 4BS9A 1IN6A 2VL8A 4OMZA 2GLOA 1KQ0A 3KYDB 2ESHA 2QQ8A 3S3OA 3KP3A 1BI2A 2F5DA 3GBGA 4FT8A 5KNLA 2DODA 4BGDA 1IJWC 4QLCU 2DA7A 3O8GA 4UY8I 2R3SA 3CJRB 4WXHA 2HR3A 1RETA 1FYMA 3RQ4A 5JFRA 3R0AA 4CYDA 3J81Z 1NK3P 3RZOJ 4II2A 4I2OA 3LSIA 3WTZA 1MDMA 4RM2A 1BOBA 4B43A 4RGUA 5F6FA 4LGWA 2G7UA 2WBMA 3S1QJ 3BZ6A 2DA6A 2LKSA 3HOSA 1MD0A 3CUQA 1H89C 1EJ9A 2CYYA 2HWVA 3PM1A 4AYBN 2L2OA 3O8HA 4XLAA 4E7HA 1IXCA 1GV5A 2QEXI 2O9LA 1JJ8C 3K1NA 5HODA 4XLPF 2DFIA 3VSKA 3J81K 5A2QK 4BQAA 3BTCA 1WHUA 3SZPA 2Y31A 2Y48A 2DLLA 4R8HA 2BY3A 2ZJPF 4RM3A 1MNMC 2XIGA 4NNJA 2DPUA 3KP7A 2IBDA 2JA6J 3HGYA 2WV0A 1YIJI 2CV0A 2MFZA 4NB5A 3SEZA 1QVUA 5GTHC 3SYTA 4RGXA 2JSPA 2V9PA 2CG4A 2IA0A 3GX4X 1Z7UA 4KT5C 1Z77A 3M9AA 4BU2A 4KICA 1PUFB 2JSCA 3U9GA 1W7PD 5IYCJ 3CMAI 2CW0F 2ZNYA 1FOKA 3BQZA 1XGMA 2OQRA 1FBUA 3K4LA 1LEBA 1VI0A 2M45A 2VKVA 3KYLA 3IV5A 1WH7A 2VKDA 4C3IJ 1MMNA 3CTAA 3FBNB 2DYSH 3PSFA 1YQAA 1D8JA 4X1EA 1FTZA 2JA2A 4XKVA 4AIDA 1HKSA 2I5UA 4BH9A 3VYSB 5K7FA 4HV6A 5HDNA 1YJNI 1VQ6I 2JRTA 2E1NA 5IP7J 4XSXF 2BYVE 4RA2A 2BXZA 2JT1A 3O2PE 3SFZA 4BAYA 5IP9J 3RZDJ 3TGNA 1R36A 2FA5A 4LG0B 2E2JJ 4A3DJ 4C2MJ 1NH3A 2DK5A 2R7VA 2OF7A 4LLNA 1ZN2A 4L5IA 1XX5A 4CCLA 3IH3A 2XF5A 3FXMA 2H8RA 4M3BA 1K4TA 3GTKJ 2MW8A 3B6CA 3FISA 4OU0A 5LEKA 1QBJA 1ETYA 2F5CA 1V54H 5E1ZB 1HKQA 5DD4A 2XC7A 1Y56A 2QM3A 1O4XA 4EJWA 2A6HF 3A0HC 5H6QA 3HDDA 5JVTA 4F91B 4F52A 2L7FP 1TTYA 1TWGJ 1Z1DA 2BE5F 3F8CA 1A6QA 1MW7A 1CQTA 2HFHA 4YFNF 1HA8A 3CCMI 3CCEI 2DXIA 2JPCA 1UHSA 2CW7A 4XNFA 1RC9A 1S5LC 3Q3SA 4IF4A 3JRGA 2L02A 4UV8A 3VODA 1VQ4I 3OYKA 2EV5A 1XN7A 2YX4A 2OQGA 2Z5UA 2EFQA 2XV4S 4JK1X 3AAFA 2NNYA 3V7CA 2Y0SN 4G94A 4LB5A 3PNTA 4CICA 1EV7A 2DFEA 4CSWA 3A03A 4HF1A 1YX5A 1ZK8A 1SVLA 3FK6A 1U0JA 4EM1A 3MQ0A 3TL4X 2HOTA 2ZXHA 5GPCA 4HDVA 4HW0A 3BR1A 3E5QA 5FKNA 5M5YJ 2HPMA 1R22A 2H6BA 3FK7A 3IH4A 4PSWA 1OKRA 3RTRA 2F4OB 3I4PA 3T1BA 1B8IB 4S0HB 1K79A 3RPUD 4ENMA 3ZMVA 2A3SA 2AXTC 2ZFWA 4CUGA 3HG9A 1J7KA 3ABKH 4UUSA 1C0WA 3IWZA 2DQRA 3LSHA 3TOAA 4DQ2A 2KL4A 2GXBA 2BY0A 4E7ZA 1I27A 1SFXA 1R1UA 1J9IA 1QZEA 3FXKA 4XN0A 4L0ZB 2XROA 1FYKA 4HRIA 2E19A 4XLHA 2M8GX 2K4JA 4CZZA 1K7AA 1VTNC 5EZHA 1B72B 2IAIA 2XAJA 2KIFA 3E5XA 2B7EA 4Q47A 4IHYA 5B1BH 2LR8A 1NG6A 4G7OF 2XAUA 1VQ9I 3JRFA 4PGHA 5IP6A 4QIWN 1S72I 4Q48A 2O8KA 5ICFA 2B0LA 2ICWG 2JA5J 4XKWA 2HEOA 4JBAA 1BJAA 2LLKA 3ML6A 4YRVA 5D6FA 2WY7Q 1HLVA 4KIBA 3ECOA 3LFUA 1TL8A 2VJ4A 4RLQA 2F48A 2DMTA 3GCMA 3H5NA 2FNAA 5FLVA 4F55A 2IS4A 3OYCA 1PP7U 2V1DA 4O6JA 1W7PA 1D8KA 3F6OA 3VYTB 3C18A 2BZTA 2F5FA 1YW8A 3FF5A 3RKXA 4F7ZA 5KVRA 4KN4X 1NHAA 1QRYA 2XGEA 3ESWB 4E70A 3CZ6A 1MBFA 1X1DA 5DM7F 3JAMK 4ZZLA 3R60A 5D5XB 3E6MA 1ZAOA 2IRFG 2C6YA 3A01B 4U0WA 5D5VB 1ZHFA 2Z16A 2ZKZA 3VEPA 4C3HJ 5FKLA 4IEJA 4NC8A 4DZJA 4M74A 2DJIA 3QU6A 4KIGA 5H2FC 1HC8A 1T6SA 2VN2A 3WGGA 3IC7A 1HDDC 4F93B 2ZMEC 3M7GA 2IXSA 1WQ2A 4H4KC 1J5YA 3DLAA 1BI0A 1HSJA 2VC1A 3C3WA 3OY9A 1BI1A 1O57A 2XGDA 3IAS2 5ERIA 1IXSB 3HZJA 5TGTA 5LHGA 3HUGB 4L9TA 2NS0A 3O6BB 4UUTA 2FMYA 2Z2SB 5LGTA 3JTHA 2ADUA 2MSYA 1AKHB 4ZDOA 1AOYA 1XC5A 3HRSA 3GTQJ 4KUMA 4LIVA 2HU9A 3O3KA 1JKRC 4U0YA 3S2HJ 3WG7H 3R6SA 4HZFA 5EGOB 2VT3A 1FMWA 3J80K 3QOPA 6PAXA 4A5MA 4HLXA 1Z3XA 2LH9A 1XB4A 4GFBA 2JN6A 3DKYA 4C3JJ 1PJRA 2QZ8A 4B1RA 1WJEA 2X48A 1R23A 2Q2EA 3OYLA 1A5JA 2JJ7A 1ZTRA 3ZXSA 2A5WA 3H0DA 2HZTA 5LRSA 2JZYA 4QPOA 1RKTA 1VQPI 2Q1ZB 1QZYA 4YELA 5FRMA 1E3PA 1YW7A 1RI7A 4II3A 1IXRC 1IRZA 2XAHA 1KQ9A 4Y13A 4BNCA 2O0YA 2CQ7A 2QVOA 3NARA 2QA4I 2K27A 5C44J 2O7OA 4A0YA 5HLTA 1F5TA 2VBXA 2FQ4A 2M87A 3JW4A 3ERED 1JGSA 2XPUA 5J4YA 1XGNA 4Z6YA 4B4CA 2BGCA 3L1PA 1GVJA 3D5RC 3GFIA 4HLYA 2DTZA 2STTA 3G2BA 2L3DA 3WGIA 1MBEA 3LSPA 1MNEA 1BC8C 2R4GA 4NC6A 1LDDA 1FPQA 3CJNA 3WTWC 2EIKH 2BY1A 1YE9A 3CUQB 5D4RA 4U7BA 1B72A 3KYCB 5K7ZA 2CQXA 3E6DA 5CQGA 2X0LA 1FNNA 3JRHA 1U3EM 1MMDA 5M5WJ 4N4OB 3JR9A 1Z67A 1OYWA 2GXGA 5FRNA 3K2AA 2ME0A 3I64A 4RMNA 3NWSA 3CCVI 3IRRA 3Q9SA 2L4AA 1MJAA 2E36A 5BMZA 3S1NJ 3DPLC 4RS8A 5EDNA 1B6AA 1GLNA 1I6XA 5HNHA 2E7WA 1A36A 3G3ZA 2EINH 1MJ9A 3TBIA 3BQYA 2W84A 1TW3A 1OISA 3L7WA 4GO1A 5C3EJ 3GTMJ 2HTSA 1LFPA 1Y8RB 1EH7A 3K4CA 2NVYJ 1QQIA 3WE3A 1HW2A 1OR7A 4U87A 1VQ5I 3BZCA 1X2MA 1TC3C 4A6EA 1FBQA 2OTJI 3TW6A 1W36C 3ABTA 3L00A 1E2XA 1UZCA 1U78A 3EUKL 4BQQA 5L3FA 1R4MB 4ESJA 4GYGA 2STWA 4ABZA 5EJCA 2KJCA 2E1MC 2LY2A 2JVHA 3JREA 1MSEC 4M72A 3HOUJ 2FOWA 3W3CA 3PQKA 3OYBA 2GIZA 5FLXZ 3FXLA 1MSFC 3V4GA 5A2QZ 2QSHX 1VZ0A 2OZUA 3GZ6A 1IDYA 4R1HA 1G3YA 2HQAA 3ZMTA 2E2IJ 1B4AA 2AQFA 3FWEA 3OIQA 3M8JA 2KRFA 2ZXWH 4EATA 3REOA 2R7OA 2VJIA 1T98A 2EZKA 1ZGAA 2HVQA 5GAGJ 3HSRA 3FHNA 4L5JA 3SQNA 2DA1A 4QWQA 1U9NA 1TW2A 4M9SA 1UMQA 2XPVA 2LSOA 3K70D 4A3JJ 1BR1A 2F6CA 2BHZA 4DYCA 4KT6A 1JKQC 1MBHA 3OSFA 2AXLA 3LSJA 4E4HA 1BOAA 3KEOA 3CCSI 4A3EJ 3IHUA 1V5FA 2M2EA 2VBZA 2N8GA 2X1DA 4IRGA 4CA0A 1EH8A 3HRUA 2CUFA 3PIOF 3OSGA 1I1SA 5DUKA 2I10A 2OCEA 3PNVA 5J6XA 4M3GA 1PUEE 4M9ZA 4IHSA 1HQCA 5CYVA 3QP5A 2K9QA 5E3NA 1IC8A 3LSKA 4C30A 4D9JA 4I09A 2W82A 1P2FA 3LSTA 2TRTA 4PJJA 4P1WA 1VFCA 1PYVA 3OOUA 2K02A 4KIFA 5J1YA 5DYMA 4GCVA 5F0HA 3OIOA 2VXZA 3Q9VA 4P5OA 3JRCA 3LSRA 4MLOA 3CQZJ 4XKCA 4ESBA 1RUOA 1QPIA 1I1GA 3JSPA 2LY1A 3VPRA 3IKTA 1U5TB 3WTTC 1APLC 1UG2A 4DGWB 2K4BA 3BJAA 2NOGA 4FISA 5LGUA 1B8IA 2P7CB 4HPQA 4HX7A 3T5XA 2IT0A 3F23A 1IZ1A 4BE2A 3BTLA 1IV6A 4UUSB 4E7KA 3GVAA 1J09A 4MFEA 3HSEA 4F92B 1XD7A 2EB7A 3PSIA 3GEZA 4QTRA 3OS1A 3KP5A 1P7IA 3G1LA 1B1BA 3A0BC 4HDUA 1F1ZA 4XK4A 2PG4A 2HQ5A 2M9HA 1OCRH 3HB9A 4XLFA 3HRMA 3V7RA 3ZCOA 1Q1HA 4UVCA 3W6JB 3CMEI 2DN0A 2AHQA 1GXQA 1FEXA 2F5VA 3BTJA 1YI2I 4XOPA 1P92A 1P4XA 3GLLA 1F4KA 2FBIA 4ZYDA 2KLOA 4LLLA 1X1AA 1ZKGA 2KISA 2NRAC 1ON2A 5L3GA 4WXDA 4MGRA 4J19A 3CDIA 2LVSA 2KRHA 2VJ5A 3OR1C 2Z1DA 1ONVA 3F22A 5GP9A 1ETOA 1JE8A 1P6RA 3B02A 9ANTA 2K3FA 4ZZDA 2AQEA 2A07F 5K7HA 2M0MA 4L0YB 2KMUA 3PQJA 1ZH5A 3EPZA 5EZGA 1YG2A 4YFKF 3MMYB 4A3BJ 1KA8A 2ACJA 3VB2A 3KLNA 2EV6A 1SC7A 1WJ5A 2VPRA 5JI6A 5D8KB 1S8NA 5HNFA 5ED4A 1X2NA 3EETA 3FX3A 2R5YB 2NVQJ 3DU6A 3E5UA 1WSUA 2NAZA 4WX9A 3AG1H 2ELJA 2FJ1A 2P81A 4BBRJ 2JRMA 4EJOA 3K10A 1BA5A 4EGYA 2ZO4A 3CCRI 3HL2A 2JMWA 1O3TA 2FF4A 3H9JA 2DU9A 4P9UA 1JUPA 1MMAA 1RNLA 5FO5A 1U8BA 4LK0F 2VIXA 2QSFX 1XDUA 2OU2A 4F3QA 1VQOI 1T8IA 2W1OA 1OCOH 1A35A 4HBLA 1ZELA 2B63J 5H20A 2E7XA 1KU9A 3I53A 3HGGA 1ODDA 3RJPA 2EK5A 2AO9A 4RDUA 4LG0A 2DBBA 1FZPB 3BZKA 4E7SA 2Q0OA 3AG3H 1AKHA 2FQ3A 1U9OA 4AIKA 3DU5A 1YJ9I 4M3FA 5DS9A 3I54A 2PMUA 2VE9A 3L2QA 1FIPA 1IO2A 2RN7A 4WXCA 5M5XJ 4YG2F 1LQ1A 3ZP5A 3KP2A 2DYRH 1X58A 1MIJA 3V7SA 2IVMA 1XS9A 3UNGC 2L01A 4G7ZF 4LJZF 3BCBA 2CQNA 4MEXF 4UNOA 2PQ8A 2MD0A 4NQWB 5HDKA 2FUG2 2WB1N 1QPMA 3K4JA 3HEFA 3FXOA 5LRRA 3WODF 3CDLA 4DJAA 5CVIA 2NOJB 2VQCA 4ZTJA 4BKXA 5JLXA 2M30A 1D3YA 2MA3A 2ESNA 1P4WA 2GXAA 4A69C 3ERMA 4P96A 4Y52J 4A93J 2EILH 2WB1A 3CCYA 1Y1VJ 5EEAA 1DGRM 1V55H 2VBYA 1U5TA 4D0PA 2HYFA 3W6KB 3LWFA 5HLGA 2PI0A 4LITA 1XG1A 1LPQA 1TBXA 2DJNA 1P7JA 3CF5F 1V5GA 1ENHA 3T8TA 4HV5A 1I5ZA 4OIPF 2DO7A 2K9SA 1LE8B 1HCRA 1ZYRF 2QBYA 1HW1A 1G6NA 2KFDA 2GZWA 5KK1A 5GADJ 2UUZA 1X19A 5DCMA 2A68F 2IGNA 3JAMZ 2COMA 2VBWA 3MD2A 1VQNI 4MQ9F 5JVGF 4MIMA 3ZOBA 3ZQ7A 2K5CA 4XORA 4RB2C 3ISPA 4WK8F 3S2DJ 2XB5A 1TLHB 3TQNA 1HKTA 2BOLA 2XRNA 4HF0A 4D5CA 3FHZA 1F9NA 2M8EA 5M3FJ 3BG3A 3MKLA 2XDVA 1YTYA 1SFKA 3FZVA 5CVVA 3ZQHA 2DA2A 5JHUA 3RKQA 2ZXJA 2BVLA 2K40A 2LREA 2CW8A 3QQAA 1D0ZA 4ZYAA 5EG0B 3HOYJ 2P7VB 3R0JA 1KQ8A 3TO7A 4BEHB 2P6SA 2YS9A 2ELKA 1R5HA 1DGWY 5IPAA 1OLTA 4Y7NJ 1D5YA 1LFBA 4M6XA 3OYAA 5E8IA 1FOXA 4MTDA 2DA3A 3BY6A 2IW5A 3SZTA 3TP0A 4CCNA 5DUIA 1SAXA 4JOMA 4IL6C 2FD5A 4BHPA 2PJPA 3QPHA 1ON1A 3CC2I 4XKBA 1YRNB 1D0XA 2MD5A 3B73A 2NS7A 3HIFA 4LLGF 2V7FA 3A02A 1FSEA 4AD9A 1OFCX 2DMNA 2PFBA 2P4WA 1DQUA 3NQOA 5D4SA 1MMSA 2XGXA 3I0TA 4XLEA 4AVPA 4AIJA 3HYIA 1T39A 2W57A 3SFIA 3WTVC 3M4OJ 2HOSA 2OC6A 1WI3A 2LDUA 2RREA 3FKJA 4I02A 5TJJA 4RAZA 1W0TA 1YW9A 4O3MA 3UKGA 2Z33A 2HNHA 5K5QA 1AU7A 3H0GJ 1OYIA 3ONQA 4BL0B 5GTIC 2H1KA 3KEYA 3LA3A 5AONA 1BR4A 3E6CC 1TWCJ 3DKWA 2KIQA 1SD7A 1YOVB 4PK4A 1D5VA 3S3NA 4QPQA 1FP2A 4V2GA 3OYDA 4RLFA 5K5OA 3E6BA 2ZNZA 3KP6A 3AKZA 1FT9A 1UCRA 1B9MA 3Q0UA 3K0LA 4D7NA 4FCYA 3A1YA 1IUYA 2MYSA 4A3LJ 1KU2A 1I6HJ 4PCQA 2HDCA 5IT9Z 2ZFUA 4OAZA 2CFXA 5HS9A 3IWFA 4KFCA 2HYGD 1EF4A 3V8KA 2E71A 4HEA2 3K4BA 2BVMA 4D5FA 1TQPA 3BT9A 4IO9F 2XKPA 3DBLB 3CMMA 4XMYA 2HYJA 3CP2A 1LVKA 1UHWA 1WH5A 1RR8C 5F0CA 3DF8A 4BDYA 1X3ZB 3M1EA 3EYYA 2UXNA 2QSGX 3UR3C 3V42A 2VODA 3VFZA 2OCCH 4FE4A 5M3MJ 1QHGA 3CC7I 1QGPA 4XM3A 3NRVA 1LB2A 3ABLH 3OIPA 4AC0A 5BPDA 3QYEA 3MZHA 3A4CA 2PN6A 3JRIA 2F4MB 2LKXA 2VPLA 2JA7J 4XIDA 4NBQA 2HOEA 2QYOA 5AIQA 4L18B 4MQVA 1GHCA 4UVAA 2EPFA 3E0JB 2RAEA 3OYHA 1K61A 2KDZA 1X4OA 2K9MA 4YIFA 4EJTA 5DCMB 4K2EA 1FWZA 4OOIA 4RAFA 2EFNA 2LNBA 1I50J 4LFUA 3PO2J 5ILSA 2WV1A 2VKEA 4ZYGA 1VQ8I 2E2HJ 1POGA 4HF2A 4DOZA 5F1RA 4OIRF 2IEKA 2XB0X 1LFUP 1V4RA 4IOCF 5FLXK 3ZR8X 1Z6RA 1UJ8A 2FX0A 2RC4A 2O3FA 3I3LA 2R7RA 2BEOA 3IH2A 3GWZA 1YHQI 5FB2A 4IPAA 2R7WA 1Z05A 2MBFA 2P5VA 5EG0A 3TEDA 4KDPA 2KT0A 3U1KA 4RB0A 4DYQA 2H6CA 3K6GA 4XRFA 3WTXC 5DTDA 4Y15A 1QNTA 5EYRA 2XSDC 4XQFA 1XMKA 4RGRA 5D6EA 4CZCA 2JA8J 1BBYA 2HGCA 2Y2ZA 2VQGA 5FD5A 1R5ID 2MC3A 1YYVA 5HS7A 4EQQA 3GTLJ 1G59A 1R1VA 2EIJH 3D0SA 4NDLA 1TT0A 3C7JA 2ZB9A 1NTCA 4FE7A 3FIWA 3BR3A 3J7AO 1S7OA 4ZDLA 1SFUA 4BHBA 1T2KA 4ON0A 1DU6A 3QODA 1MNDA 3QAHA 1X3WB 3C2HA 3D5SC 3KLOA 2WAEA 1JXSA 3H3UA 2OPTA 2E35A 3VWBA 1H8AC 4BXUA 1RUNA 2WA0A 5JR3A 3QRFF 3ULQB 2K3PA 4IXAA 2PX9A 4N0BA 3R4KA 3MKZA 4E7JA 2QENA 1G3WA 3DEWA 5E3MA 3BG6A 4BJTA 1TQIA 4Q5SF 2CUEA 3TO6A 5F1JA 2LG4A 4J01A 1Z6TA 4XBFA 2F4IA 2DFFA 2VB6A 1O7LA 1E3HA 2A5YB 5LLQA 2DTRA 3VYUB 4HYEA 2W24A 3NEUA 3DCFA 1ZREA 2ZSIB 2MABA 4U88A 4N9HA 2P8TA 2XSJC 4E6KG 4MNUA 5BOXA 1REPC 1SD5A 5D5UB 1XSDA 4M73A 2R92J 5DCFA 4BQNA 3W2WA 3S16J 1W5CC 2L9RA 3W6VA 4GXOA 3HBLA 1R4NB 3HSFA 5LHHA 1SVOA 4LOCA 4UHTA 3OYFA 1X3UA 1FX7A 1USSA 3BJ6A 1U5TC 2X51A 1JT6A 4CDGA 3ZQLA 4KMUX 4CGZA 2EBIA 3I5UA 1OJLA 3P9CA 3T8RA 4CYCB 3HUGA 3HRTA 1WJBA 4DW6A 3GTJJ 1Y0NA 2ZC2A 4BBSJ 1YFHA 4BXXJ 4XR6A 2HPIA 3LA7A 4JX6A 2R93J 3FKIJ 3HOXJ 3OV8A 1E3OC 1T33A 2LBFA 3JCUC 4B48A 3M3YJ 2EV0A 1P9QC 2K85A 2CUZA 4GYIA 2ZJQF 2L54A 2A6EF 5IYBJ 1S7AA 4M71A 2X85A 4L9NA 3X2QH 4N9IA 1ZG5A 3ZQFA 3ZN0A 2GIVA 2L9VA 3K1PA 5F08A 5GAEJ 3BP8A 4RB3C 2KPMA 2DMQA 2UWMA 1SMYF 2L4MA 5IOZA 1T38A 4IQ4A 5FFZA 3DLLF 2EA4A 1S29A 2XAQA 2ID3A 2PJRA 2KQRA 3GZ5A 3LA2A 5JLWA 4IZZA 1XGOA 2OBPA 2QBYB 1UAAA 1ITYA 2V4JC 5EEGA 3SDGA 2DT5A 3U21A 2IPQX 4XRSA 2XPWA 2R7UA 3BC8A 4XSZF 2VOPA 4UV9A 2M7BA 1JUMA 5CPRB 1DUXC 1D0YA 3KFWX 3OYEA 3F72A 3HTUA 1W5TA 1MH3A 3BROA 1FYLA 2FMLA 3SEQA 2QGUA 1R49A 2NVTJ 4BY1J 2E34A 1Y6IA 3BR2A 3MKWB 1D1AA 2IGKA 3ZQGA 1IUFA 2W7NA 1KYWA 1K6OA 2NXNB 2OAZA 4CO8A 3MFKA 2LKPA 3SJMA 3BR5A 3DXJF 2X4HA 3CO6C 4WCGA 2R0QC 1IW7F 2F2EA 1ZLJA 4FQGA 3L9FA 4YFXF 2V9KA 2VI6A 5BPIA 2EWNA 1V5EA 4G9YA 1Z3YA 1F36A 2XVCA 5FJ8J 1XMAA 2FXAA 3J7ZI 3S1RJ 1W0UA 1SMTA 1EA3A 4EV0A 3LAJA 1T56A 1DDNA 3AL0B 2KRCA 2E5ZA 3KZIC 2CWEA 1SAUA 2QKMB 3F3XA 1ZGWA 2D2WA 1R71A 2WY8Q 2RV8A 2DAOA 3G1MA 2YX7A 2A05A 3KP4A 3HPGA 1LJ9A 1K83J 2XASA 3G71I 1IRXA 1IAWA 3TDZC 4A0XA 4LB6B
chains in the Genus database with same CATH topology
3MN2A 2Y0SN 2Y9YA 4M3FA 5DS9A 3Q0WA 3A03A 1FIPA 4HNVA 5M5XJ 1GUUA 1ZK8A 3FK6A 2HOTA 4JYKA 1X58A 5GPCA 1XS9A 3S14J 3BR1A 5FKNA 5M5YJ 4A3GJ 1ZR4A 1WPKA 3FK7A 3IH4A 3C2BA 1B8IB 1GV2A 4S0HB 2HI3A 1MH4A 2XGCA 2WB1N 3HEFA 2QF7A 4UUSA 2LK2A 3CDLA 2DMPA 4FTHA 5F0FA 4BKXA 5JLXA 2LD5A 5FLMJ 2E1OA 2VUMJ 2EZHA 4A69C 4IHXA 4Y52J 2ID6A 2LY9A 4A93J 3CCYA 2CJJA 2E19A 1Y1VJ 2M8GX 5EEAA 1H88C 2XRLA 3QPLA 5EZHA 1B72B 2IAIA 1XG1A 3HKZN 3A01A 3PO3J 2DJNA 1P7JA 3MVPA 1ENHA 1ETKA 4IHYA 2K9SA 2LR8A 4JP0A 1LE8B 1HCRA 3TP3A 3JRFA 5IP6A 4QIWN 2TCTA 2O8KA 2JA5J 3BG5A 2HDDA 2LLKA 1BL0A 1JTXA 4MIMA 3ZOBA 3S2DJ 1HLVA 3E7LA 2XB5A 4G12A 1FJLA 2DMTA 2LP0A 4M3DA 4D5CA 5FLVA 5M3FJ 3BG3A 3MKLA 2HXIA 5IYDJ 3ZQHA 2R5ZA 1QRYA 2DA2A 3RKQA 2XGEA 2K9NA 1MBFA 2K40A 5GPAA 1Z0XA 3QQAA 5EG0B 3HOYJ 2JK3A 3A01B 4A3MJ 4C3HJ 2YS9A 5FKLA 2ELKA 4IEJA 5FKKA 3HOVJ 4DZJA 1JTYA 5IPAA 1SFOJ 4Y7NJ 1D5YA 1LFBA 3ZQCA 2Y30A 2L0KA 1HDDC 2DA3A 3TP0A 3Q0VA 4M3EA 2HOAA 4A3KJ 2EH3A 2FD5A 1Y1WJ 4XICA 1YRNB 2XGDA 2NS7A 2QCOA 3A02A 1OFCX 1BJZA 4DYRA 1AHDP 2DMNA 4UUTA 1ZQ3P 3JRDA 2NS8A 1OCTC 2MSYA 1AKHB 1HOMA 1ETWA 1XC5A 1RPWA 3M4OJ 3SFIA 3GTQJ 2PMZN 2HOSA 1JKRC 3S2HJ 1RKWA 1WI3A 2DA4A 1W0TA 5EGOB 3UKGA 5FKOA 4D7MA 1AU7A 2H1KA 3H0GJ 3BR0A 3S15J 1MBJA 3I4NJ 4RBOA 4GFBA 2JN6A 4C3JJ 4B1RA 2X48A 1GVDA 1A5JA 1TWCJ 3HOZJ 2JJ7A 1ZTRA 4V2GA 1F43A 2DA5A 1ETXA 1RKTA 1NK2P 4DZPA 1IDZA 3Q0UA 3LOCA 4D7NA 4FCYA 2NVXJ 3GTGJ 3I4MJ 4A3LJ 2GM4A 1I6HJ 1QVTA 2R5YA 1IRZA 3LSGA 1EF4A 3NARA 5C44J 2O7OA 4D5FA 3BT9A 2FQ4A 2JWTA 3GTOJ 2HYJA 1WH5A 2XPUA 1WGXA 5F0CA 4B4CA 3GTPJ 5J1RA 2CQQA 3L1PA 2DTZA 1TWAJ 4FE4A 5M3MJ 2ME6A 5C4XJ 1MBEA 3LSPA 4AC0A 3JRIA 2LKXA 1B72A 2CU7A 3TW7A 1TWHJ 1GDTA 5K7ZA 3HOWJ 2CQXA 2JA7J 4XIDA 2YU9J 4W97A 4CYCA 3NAUA 3JRHA 4XRSG 5M5WJ 3JR9A 2RAEA 1S7EA 1K61A 2KDZA 3K2AA 2ME0A 5F27A 1ETQA 1TWFJ 4IHWA 1HF0A 3H3VK 1I50J 3PO2J 3S1NJ 1PUFA 2WV1A 4I76A 5F04A 1VNDA 2EZLA 2VKEA 5EDNA 3LNQA 2E2HJ 1POGA 5E3LA 3D1NI 1ORKA 3BQYA 1JJ6C 1HDPA 5E3OA 2IEKA 2XB0X 5C3EJ 1LFUP 3GTMJ 1BW6A 2FX0A 4XRMA 2NVYJ 3RQIA 2G0EA 4AUXA 3IH2A 2R5ZB 1X2MA 1TC3C 4JX5A 2X9DA 4B3AA 1JKPC 3F0CA 1FIAA 3TW6A 5EG0A 2ECBA 3TEDA 2KT0A 2ECCA 4DYQA 1U78A 4A3FJ 3WHBA 5DTDA 1I3QJ 5EYRA 4BY7J 2XSDC 4ABZA 1GT0C 3JREA 2JA8J 4JX4A 1MSEC 3HOUJ 2Y2ZA 3K7AJ 4X6AJ 2L7ZA 4A3IJ 3GTLJ 1MSFC 4NDLA 1IDYA 3BR6A 2DMUA 2EQRA 2ZB9A 4W1UA 1NTCA 2COBA 2E2IJ 1IG7A 4FE7A 3FIWA 3BR3A 1JUSA 5C4JJ 3JRAA 1IGNA 1DU6A 2EZKA 4I6ZA 5EF6A 2M0CA 2MG4A 2DA1A 1OCPA 1U9NA 2OPTA 1H8AC 1UMQA 2XPVA 4A3JJ 2HXOA 2Y9ZA 1R9TJ 4DYCA 5IOYA 2GBYA 3G1OA 5J1UA 2R7ZJ 3DEWA 5E3MA 1JKQC 3S1MJ 1LE8A 1MBHA 2CUEA 5F1JA 3OSFA 1BW5A 2GLOA 2CRGA 3LSJA 4A3EJ 4MFDA 3DCFA 3GBGA 2M2EA 2N8GA 4EEFG 1IJWC 2DA7A 3O8GA 2CUFA 3OSGA 2X6OA 2I10A 4M3GA 3S17J 1RETA 2R92J 2K9QA 5E3NA 1IC8A 1NK3P 3RZOJ 2MGQA 3S16J 2TRTA 2L9RA 3W6VA 3HBLA 1VFCA 3OOUA 4LOCA 5J1YA 5F0HA 3JRBA 3BG9A 3OIOA 3S1QJ 2DA6A 3QPSA 1YRNA 3ZQLA 3JRCA 1JT6A 3LSRA 4MLOA 2EBIA 3CQZJ 1H89C 1OJLA 3PM1A 4AYBN 1QPIA 4CYCB 2D5VA 4DW6A 3O8HA 3GTJJ 1JKOC 4BBSJ 4BXXJ 2W48A 4JX6A 3VPRA 2R93J 1GV5A 3BTIA 3FKIJ 3HOXJ 1APLC 1JJ8C 2O9LA 1UG2A 5HODA 1E3OC 1T33A 4FISA 2NOGA 1B8IA 3BTCA 3M3YJ 3BTLA 2WAQN 1IV6A 4UUSB 2Y31A 4MO7A 5IYBJ 1JT0A 1WCMJ 4MFEA 3ZQFA 1MNMC 1G2HA 4QTRA 2IBDA 1P7IA 3G1LA 3HGYA 2JA6J 5F08A 4A3CJ 4XK4A 2HQ5A 2M9HA 4V2FA 3HB9A 2DMQA 1QVUA 2DN0A 5IOZA 2AHQA 1FEXA 3BTJA 2YUSA 1Z77A 1MBGA 2ID3A 2LFBA 1PUFB 5JLWA 5IYCJ 1ZKGA 5EGOA 2EZIA 3BQZA 4QSHA 1RR7A 1ITYA 3SDGA 1JGGA 4J19A 1VI0A 2LVSA 2VKVA 1ETVA 4XRSA 3IV5A 1WH7A 1SANA 2XPWA 4C3IJ 5GP9A 1ETOA 1JUMA 4X1EA 9ANTA 1FTZA 5J3LA 1MH3A 5K7HA 5K7FA 2NVTJ 4BY1J 3WHCA 5EZGA 3BR2A 5IP7J 4A3BJ 3ZQGA 1IUFA 5IP9J 3RZDJ 5FKMA 2LTPA 2E2JJ 4A3DJ 4C2MJ 2VPRA 2L7MP 4M6VA 3SJMA 3BR5A 1X2NA 2OF7A 2R5YB 2NVQJ 3IH3A 2H8RA 2R0QC 4M3BA 3GTKJ 2MW8A 1MBKA 2FJ1A 2P81A 4BBRJ 3B6CA 3FISA 1A6IA 3HM5A 1ETYA 1BA5A 4L5EA 2VI6A 3B6AA 1O4XA 1F36A 5FJ8J 3CMYA 2JMWA 3HDDA 1DU0A 1JUPA 3S1RJ 1W0UA 1T56A 2L7FP 1TWGJ 1VF9A 1U8BA 1CQTA 1UHSA 1ZGWA 5BNGA 2M34A 3ZQIA 2B63J 3JRGA 3Q3SA 1RESA 4IHVA 3G1MA 3HGGA 2AO9A 4RDUA 1K83J 1Q1VA 1ZR2A 1FTTA 1AKHA 1U9OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3MN2 A;  2Y0S N;  2Y9Y A;  4M3F A;  5DS9 A;  3Q0W A;  3A03 A;  1FIP A;  4HNV A;  5M5X J;  1GUU A;  1ZK8 A;  3FK6 A;  2HOT A;  4JYK A;  1X58 A;  5GPC A;  1XS9 A;  3S14 J;  3BR1 A;  5FKN A;  5M5Y J;  4A3G J;  1ZR4 A;  1WPK A;  3FK7 A;  3IH4 A;  3C2B A;  1B8I B;  1GV2 A;  4S0H B;  2HI3 A;  1MH4 A;  2XGC A;  2WB1 N;  3HEF A;  2QF7 A;  4UUS A;  2LK2 A;  3CDL A;  2DMP A;  4FTH A;  5F0F A;  4BKX A;  5JLX A;  2LD5 A;  5FLM J;  2E1O A;  2VUM J;  2EZH A;  4A69 C;  4IHX A;  4Y52 J;  2ID6 A;  2LY9 A;  4A93 J;  3CCY A;  2CJJ A;  2E19 A;  1Y1V J;  2M8G X;  5EEA A;  1H88 C;  2XRL A;  3QPL A;  5EZH A;  1B72 B;  2IAI A;  1XG1 A;  3HKZ N;  3A01 A;  3PO3 J;  2DJN A;  1P7J A;  3MVP A;  1ENH A;  1ETK A;  4IHY A;  2K9S A;  2LR8 A;  4JP0 A;  1LE8 B;  1HCR A;  3TP3 A;  3JRF A;  5IP6 A;  4QIW N;  2TCT A;  2O8K A;  2JA5 J;  3BG5 A;  2HDD A;  2LLK A;  1BL0 A;  1JTX A;  4MIM A;  3ZOB A;  3S2D J;  1HLV A;  3E7L A;  2XB5 A;  4G12 A;  1FJL A;  2DMT A;  2LP0 A;  4M3D A;  4D5C A;  5FLV A;  5M3F J;  3BG3 A;  3MKL A;  2HXI A;  5IYD J;  3ZQH A;  2R5Z A;  1QRY A;  2DA2 A;  3RKQ A;  2XGE A;  2K9N A;  1MBF A;  2K40 A;  5GPA A;  1Z0X A;  3QQA A;  5EG0 B;  3HOY J;  2JK3 A;  3A01 B;  4A3M J;  4C3H J;  2YS9 A;  5FKL A;  2ELK A;  4IEJ A;  5FKK A;  3HOV J;  4DZJ A;  1JTY A;  5IPA A;  1SFO J;  4Y7N J;  1D5Y A;  1LFB A;  3ZQC A;  2Y30 A;  2L0K A;  1HDD C;  2DA3 A;  3TP0 A;  3Q0V A;  4M3E A;  2HOA A;  4A3K J;  2EH3 A;  2FD5 A;  1Y1W J;  4XIC A;  1YRN B;  2XGD A;  2NS7 A;  2QCO A;  3A02 A;  1OFC X;  1BJZ A;  4DYR A;  1AHD P;  2DMN A;  4UUT A;  1ZQ3 P;  3JRD A;  2NS8 A;  1OCT C;  2MSY A;  1AKH B;  1HOM A;  1ETW A;  1XC5 A;  1RPW A;  3M4O J;  3SFI A;  3GTQ J;  2PMZ N;  2HOS A;  1JKR C;  3S2H J;  1RKW A;  1WI3 A;  2DA4 A;  1W0T A;  5EGO B;  3UKG A;  5FKO A;  4D7M A;  1AU7 A;  2H1K A;  3H0G J;  3BR0 A;  3S15 J;  1MBJ A;  3I4N J;  4RBO A;  4GFB A;  2JN6 A;  4C3J J;  4B1R A;  2X48 A;  1GVD A;  1A5J A;  1TWC J;  3HOZ J;  2JJ7 A;  1ZTR A;  4V2G A;  1F43 A;  2DA5 A;  1ETX A;  1RKT A;  1NK2 P;  4DZP A;  1IDZ A;  3Q0U A;  3LOC A;  4D7N A;  4FCY A;  2NVX J;  3GTG J;  3I4M J;  4A3L J;  2GM4 A;  1I6H J;  1QVT A;  2R5Y A;  1IRZ A;  3LSG A;  1EF4 A;  3NAR A;  5C44 J;  2O7O A;  4D5F A;  3BT9 A;  2FQ4 A;  2JWT A;  3GTO J;  2HYJ A;  1WH5 A;  2XPU A;  1WGX A;  5F0C A;  4B4C A;  3GTP J;  5J1R A;  2CQQ A;  3L1P A;  2DTZ A;  1TWA J;  4FE4 A;  5M3M J;  2ME6 A;  5C4X J;  1MBE A;  3LSP A;  4AC0 A;  3JRI A;  2LKX A;  1B72 A;  2CU7 A;  3TW7 A;  1TWH J;  1GDT A;  5K7Z A;  3HOW J;  2CQX A;  2JA7 J;  4XID A;  2YU9 J;  4W97 A;  4CYC A;  3NAU A;  3JRH A;  4XRS G;  5M5W J;  3JR9 A;  2RAE A;  1S7E A;  1K61 A;  2KDZ A;  3K2A A;  2ME0 A;  5F27 A;  1ETQ A;  1TWF J;  4IHW A;  1HF0 A;  3H3V K;  1I50 J;  3PO2 J;  3S1N J;  1PUF A;  2WV1 A;  4I76 A;  5F04 A;  1VND A;  2EZL A;  2VKE A;  5EDN A;  3LNQ A;  2E2H J;  1POG A;  5E3L A;  3D1N I;  1ORK A;  3BQY A;  1JJ6 C;  1HDP A;  5E3O A;  2IEK A;  2XB0 X;  5C3E J;  1LFU P;  3GTM J;  1BW6 A;  2FX0 A;  4XRM A;  2NVY J;  3RQI A;  2G0E A;  4AUX A;  3IH2 A;  2R5Z B;  1X2M A;  1TC3 C;  4JX5 A;  2X9D A;  4B3A A;  1JKP C;  3F0C A;  1FIA A;  3TW6 A;  5EG0 A;  2ECB A;  3TED A;  2KT0 A;  2ECC A;  4DYQ A;  1U78 A;  4A3F J;  3WHB A;  5DTD A;  1I3Q J;  5EYR A;  4BY7 J;  2XSD C;  4ABZ A;  1GT0 C;  3JRE A;  2JA8 J;  4JX4 A;  1MSE C;  3HOU J;  2Y2Z A;  3K7A J;  4X6A J;  2L7Z A;  4A3I J;  3GTL J;  1MSF C;  4NDL A;  1IDY A;  3BR6 A;  2DMU A;  2EQR A;  2ZB9 A;  4W1U A;  1NTC A;  2COB A;  2E2I J;  1IG7 A;  4FE7 A;  3FIW A;  3BR3 A;  1JUS A;  5C4J J;  3JRA A;  1IGN A;  1DU6 A;  2EZK A;  4I6Z A;  5EF6 A;  2M0C A;  2MG4 A;  2DA1 A;  1OCP A;  1U9N A;  2OPT A;  1H8A C;  1UMQ A;  2XPV A;  4A3J J;  2HXO A;  2Y9Z A;  1R9T J;  4DYC A;  5IOY A;  2GBY A;  3G1O A;  5J1U A;  2R7Z J;  3DEW A;  5E3M A;  1JKQ C;  3S1M J;  1LE8 A;  1MBH A;  2CUE A;  5F1J A;  3OSF A;  1BW5 A;  2GLO A;  2CRG A;  3LSJ A;  4A3E J;  4MFD A;  3DCF A;  3GBG A;  2M2E A;  2N8G A;  4EEF G;  1IJW C;  2DA7 A;  3O8G A;  2CUF A;  3OSG A;  2X6O A;  2I10 A;  4M3G A;  3S17 J;  1RET A;  2R92 J;  2K9Q A;  5E3N A;  1IC8 A;  1NK3 P;  3RZO J;  2MGQ A;  3S16 J;  2TRT A;  2L9R A;  3W6V A;  3HBL A;  1VFC A;  3OOU A;  4LOC A;  5J1Y A;  5F0H A;  3JRB A;  3BG9 A;  3OIO A;  3S1Q J;  2DA6 A;  3QPS A;  1YRN A;  3ZQL A;  3JRC A;  1JT6 A;  3LSR A;  4MLO A;  2EBI A;  3CQZ J;  1H89 C;  1OJL A;  3PM1 A;  4AYB N;  1QPI A;  4CYC B;  2D5V A;  4DW6 A;  3O8H A;  3GTJ J;  1JKO C;  4BBS J;  4BXX J;  2W48 A;  4JX6 A;  3VPR A;  2R93 J;  1GV5 A;  3BTI A;  3FKI J;  3HOX J;  1APL C;  1JJ8 C;  2O9L A;  1UG2 A;  5HOD A;  1E3O C;  1T33 A;  4FIS A;  2NOG A;  1B8I A;  3BTC A;  3M3Y J;  3BTL A;  2WAQ N;  1IV6 A;  4UUS B;  2Y31 A;  4MO7 A;  5IYB J;  1JT0 A;  1WCM J;  4MFE A;  3ZQF A;  1MNM C;  1G2H A;  4QTR A;  2IBD A;  1P7I A;  3G1L A;  3HGY A;  2JA6 J;  5F08 A;  4A3C J;  4XK4 A;  2HQ5 A;  2M9H A;  4V2F A;  3HB9 A;  2DMQ A;  1QVU A;  2DN0 A;  5IOZ A;  2AHQ A;  1FEX A;  3BTJ A;  2YUS A;  1Z77 A;  1MBG A;  2ID3 A;  2LFB A;  1PUF B;  5JLW A;  5IYC J;  1ZKG A;  5EGO A;  2EZI A;  3BQZ A;  4QSH A;  1RR7 A;  1ITY A;  3SDG A;  1JGG A;  4J19 A;  1VI0 A;  2LVS A;  2VKV A;  1ETV A;  4XRS A;  3IV5 A;  1WH7 A;  1SAN A;  2XPW A;  4C3I J;  5GP9 A;  1ETO A;  1JUM A;  4X1E A;  9ANT A;  1FTZ A;  5J3L A;  1MH3 A;  5K7H A;  5K7F A;  2NVT J;  4BY1 J;  3WHC A;  5EZG A;  3BR2 A;  5IP7 J;  4A3B J;  3ZQG A;  1IUF A;  5IP9 J;  3RZD J;  5FKM A;  2LTP A;  2E2J J;  4A3D J;  4C2M J;  2VPR A;  2L7M P;  4M6V A;  3SJM A;  3BR5 A;  1X2N A;  2OF7 A;  2R5Y B;  2NVQ J;  3IH3 A;  2H8R A;  2R0Q C;  4M3B A;  3GTK J;  2MW8 A;  1MBK A;  2FJ1 A;  2P81 A;  4BBR J;  3B6C A;  3FIS A;  1A6I A;  3HM5 A;  1ETY A;  1BA5 A;  4L5E A;  2VI6 A;  3B6A A;  1O4X A;  1F36 A;  5FJ8 J;  3CMY A;  2JMW A;  3HDD A;  1DU0 A;  1JUP A;  3S1R J;  1W0U A;  1T56 A;  2L7F P;  1TWG J;  1VF9 A;  1U8B A;  1CQT A;  1UHS A;  1ZGW A;  5BNG A;  2M34 A;  3ZQI A;  2B63 J;  3JRG A;  3Q3S A;  1RES A;  4IHV A;  3G1M A;  3HGG A;  2AO9 A;  4RDU A;  1K83 J;  1Q1V A;  1ZR2 A;  1FTT A;  1AKH A;  1U9O A; 
#chains in the Genus database with same CATH topology
 3MN2 A;  4HQE A;  2D45 A;  4FX4 A;  2Y9Y A;  1B9N A;  2VKH A;  1O3R A;  4RGS A;  3ASO H;  1ZG3 A;  1GUU A;  1S9H A;  1HXD A;  5H6R A;  1XTA A;  2R7S A;  4JYK A;  2YPR A;  3QU3 A;  1KGS A;  5HVQ C;  3S14 J;  4A3G J;  4KA4 A;  3DWL E;  1ZR4 A;  1WPK A;  5HDG A;  2Y0S A;  3C2B A;  3EQL F;  1GV2 A;  2Z3Y A;  4UVB A;  2DQL A;  2K7L A;  1B59 A;  4DIQ A;  3DV8 A;  2JUG A;  4EJV A;  1KU7 A;  3OWT A;  2LK2 A;  2X6X A;  2LOO A;  2DMP A;  1YIT I;  2IS1 A;  4LIU A;  3KZZ A;  1LEA A;  2WAF A;  5F0F A;  3DPU A;  4BE1 A;  5FLM J;  4X0G A;  1AWC A;  1MKM A;  3FMQ A;  3V8J A;  5B1A H;  1ERD A;  3F21 A;  3C2G A;  4I98 B;  3I59 A;  5ILV A;  4WWC A;  3KZY A;  2XRL A;  3QPL A;  1IF1 A;  2ELH A;  2K9L A;  3HKZ N;  3K2Z A;  5DDG A;  3PO3 J;  3MVP A;  2LBF B;  1XGS A;  1IN7 A;  2HQR A;  3TP3 A;  1FY7 A;  1S3J A;  5J40 A;  1UB9 A;  5FGM A;  1ZAR A;  1T08 B;  2TCT A;  2CGP A;  1ZRC A;  4C2U A;  1YIO A;  2RNJ A;  1J0R A;  3COA C;  4NQW A;  1QU3 A;  3E7L A;  1FJL A;  4G12 A;  1K78 B;  1J59 A;  3I56 I;  2CUJ A;  4M3D A;  2LP0 A;  3HXL A;  2QQ9 A;  4OAY A;  1QO0 D;  2HXI A;  3M1C A;  1X1C A;  4I01 A;  5FRO A;  2R5Z A;  3E3V A;  3WGH A;  2K9N A;  2QUF A;  1Z0X A;  1IRG A;  1XCV A;  2H27 A;  2JK3 A;  5IT9 K;  1LUJ B;  3GYH X;  4A3M J;  2RDP A;  4DNC A;  3HOV J;  3QYB A;  5HLI A;  1DPU A;  1AA7 A;  3OYM A;  2W85 A;  3SZG A;  2ZSH B;  1SFO J;  4ZYH A;  2EFW A;  3ZQC A;  1YO5 C;  1BC7 C;  2L0K A;  1DP7 P;  4PFO A;  3K70 C;  2DOE A;  3CDH A;  3Q0V A;  5FFX A;  4DBQ A;  4ZTF A;  4I0B A;  2HOA A;  4A3K J;  2EH3 A;  2IGO A;  4H0E A;  3BCA A;  5CLS A;  1Y1W J;  2CS3 A;  2OTL I;  4NHJ A;  1MZB A;  1BN5 A;  4IJA A;  4XIC A;  1IN4 A;  3K4M A;  1FP1 D;  3OYG A;  1ZRD A;  4CXF A;  1PP8 F;  1BJZ A;  1AHD P;  5J4V A;  4BE0 A;  2DDA A;  3L2V A;  5DD8 A;  2NS8 A;  1OCT C;  4V19 K;  4PJM A;  4AM3 A;  3ECH A;  4ZJZ A;  2WAD A;  1ETW A;  5CVU A;  2R7D A;  3MKY B;  4Y17 A;  2QKL B;  2JUC A;  3R61 A;  4AIH A;  2JVG A;  2PMZ N;  4O5V A;  4FHT A;  2WWY A;  3H9Q A;  4WF2 A;  1O7F A;  1OR7 C;  1ZGJ A;  2EJR A;  2M1B A;  2DA4 A;  3H92 A;  3WE2 A;  1YJW I;  4HST A;  2DOF A;  1KU3 A;  3K4N A;  3BR0 A;  1R58 A;  3I4N J;  1TP4 A;  1BR2 A;  4L9J A;  4CCM A;  2HVS A;  5LHI A;  3HTS B;  2DOA A;  3ABU A;  1W36 D;  2YSR A;  5E8G A;  3GME A;  4ZDP A;  3VDX A;  4A6D A;  3CP8 A;  3HOZ J;  4RAY A;  2HQN A;  3U1D A;  3NWT A;  5IT3 A;  2KP6 A;  2E1C A;  2IS2 A;  3DTE A;  4BQO A;  1JI8 A;  4DZP A;  5LD2 C;  4L9V A;  2YR2 A;  3PJR A;  3OS0 A;  2F5E A;  2H1L A;  4LK1 F;  3OR2 C;  5LEJ A;  2DDB A;  2A6T A;  2EA2 A;  3E97 A;  4ZYE A;  1G3T A;  3EUH A;  2KIU A;  1K4S A;  2KKO A;  1JHH A;  2R5Y A;  2L9S A;  2CSO A;  3RYP A;  3DP7 A;  4LD5 A;  2W4S A;  3DBH B;  1Y8Q B;  3P9K A;  5L3C A;  3GTO J;  2EFP A;  2X1C A;  3TOB A;  3DFG A;  3TO9 A;  4EGZ A;  3GTP J;  2BHY A;  5J1R A;  1SFE A;  3WU0 A;  1XDS A;  5DM6 F;  4I99 C;  3L2W A;  1TWA J;  5IY5 H;  4LG3 A;  2ME6 A;  3G6E I;  4DBR A;  2P6T A;  3I59 B;  1UST A;  5LFA A;  3PUF A;  1DP3 A;  3F9K A;  1BM9 A;  5ICE A;  4CCK A;  3TW7 A;  1GDT A;  2L7K A;  2HVR A;  2YU9 J;  4CYC A;  3I71 A;  1VQ7 I;  4IRI A;  3NAU A;  2YU3 A;  4XRS G;  5KAI C;  5J47 A;  3HOT A;  4IRH A;  5F27 A;  4CHU A;  1ETQ A;  3J7Y J;  1TWF J;  3Q5F A;  4MHG A;  5E1W A;  1HF0 A;  1CF7 A;  2FBH A;  4GGG A;  2EZL A;  1U8R A;  2LF7 A;  5E3L A;  3A2K A;  3BLY A;  1HDP A;  2KDO A;  5E3O A;  1H9G A;  3KX2 A;  1XSV A;  3DEU A;  2DFH A;  2CH0 A;  5B3S H;  3GZN B;  4XRM A;  2DT7 B;  3AL0 C;  3LL7 A;  3PIP F;  3TMO A;  2R5Z B;  3DEE A;  2OV7 A;  2KHM A;  2M7A A;  2QWW A;  3GFJ A;  5E1X A;  4I0A A;  4JX5 A;  5CKT A;  3TKY A;  2CMP A;  1MGT A;  1SVM A;  2NYX A;  1WKM A;  2ECB A;  2X6W A;  1HW5 A;  4G6D A;  2ECC A;  5J8C A;  4XL9 A;  3FM5 A;  2PJR B;  3DTI A;  3WHB A;  1I3Q J;  2VQH A;  3FXQ A;  3K69 A;  3S93 A;  3TDU C;  3WU2 C;  3H35 A;  2HS5 A;  3M8F A;  1I39 A;  4R79 A;  1SD4 A;  4JX4 A;  4KYW A;  1R5G A;  1R00 A;  1W1W E;  3L2U A;  4HAM A;  3RPU A;  1LDJ A;  4EM0 B;  3K7A J;  4X6A J;  3M8E A;  4A3I J;  5K5R A;  1EKE A;  2D1V A;  2DMU A;  2EQR A;  2COB A;  1N25 A;  1JUS A;  5E17 F;  1R6R A;  3BPX A;  2H8W A;  2DCE A;  4ETS A;  3FXR A;  1WZ2 A;  1Z21 A;  4B09 A;  2A61 A;  3AG4 H;  3N4M A;  2VON A;  3WG9 A;  2V6E A;  3BDD A;  3OYI A;  3ROU A;  3GF2 A;  3GW2 A;  1R9T J;  5E18 F;  3GFM A;  3GLX A;  2Z9O A;  2ZME B;  3HPH A;  4Y33 A;  3IL2 A;  3JSO A;  4PJL A;  1Z7L A;  4EMS A;  2UZK A;  1BW5 A;  2HZD A;  2CRG A;  2IGM A;  4ANJ A;  3SHF A;  4HQM A;  4MFD A;  4B44 A;  1FMV A;  4CH7 A;  3FXU A;  4EEF G;  3RDI A;  4BEH A;  2OA4 A;  2RNG A;  2XHK A;  2X6O A;  2Q8K A;  1O3S A;  3S17 J;  1EH6 A;  4KN7 X;  2E1M B;  4ITV A;  2RVC A;  1ZG1 A;  4IHT A;  1W5S A;  2MGQ A;  5KHD A;  5GAH J;  3GFL A;  3L2C A;  2ZXI A;  3JRB A;  1YS7 A;  1HBX G;  3BG9 A;  4KMF A;  4UUV A;  2Y69 H;  4FET A;  4N4N B;  4BJ6 C;  3OMY A;  3QPS A;  4AU7 A;  1YRN A;  2JTV A;  1TNT A;  4PJ0 C;  3S3M A;  1IN5 A;  3FBI B;  3GUD A;  4RB1 A;  2DK8 A;  1VQM I;  2D5V A;  2B9S A;  4BYY A;  1JHF A;  4CCJ A;  2Z99 A;  4S05 A;  1JKO C;  2W48 A;  5CJ9 A;  4FAS D;  5LBQ A;  3C1D A;  2L5Q A;  5D5W B;  3S2W A;  3BTI A;  3LFK A;  4HNT A;  2HDW A;  5KAF C;  2FOK A;  3IKV A;  2ZBK A;  2M3A A;  4G6T B;  3BJO A;  3MZY A;  1T0F A;  1OYY A;  1D1C A;  1G3S A;  3MZ8 A;  2G9W A;  2WAQ N;  1LVA A;  4MO7 A;  4PDK A;  1KZH A;  1JT0 A;  1X1P A;  1WCM J;  5ICG A;  1I3A A;  4D1Q A;  1OCC H;  1FBS A;  2VLA A;  2ZCW A;  2M4K A;  3DBR B;  1QZZ A;  3H9G A;  5D8L B;  3P5J A;  1G2H A;  2XAF A;  3G73 A;  2FU4 A;  4A3C J;  2X1E A;  4V2F A;  3CUQ C;  3LSM A;  2BV6 A;  2AS5 F;  2W00 A;  3CC4 I;  2V26 A;  4XN3 A;  1TT5 B;  3RYR A;  2YUS A;  1MBG A;  1G4D A;  1T0F C;  1PDN C;  2LFB A;  4C2T A;  2VXD A;  1CF7 B;  4G7H F;  4JQF A;  3WTU C;  3CCL I;  3EDP A;  2O6G E;  5EGO A;  2EZI A;  4QSH A;  1RR7 A;  4A0Z A;  1BIA A;  4GRI A;  3FXJ A;  1JGG A;  4HG2 A;  3VYR B;  3HC7 A;  3ZMD A;  3KET A;  4GDF A;  1ETV A;  4OWR B;  2MC4 A;  1SAN A;  3LQQ A;  4KIT B;  2M5W A;  3FMR A;  2IJL A;  1KON A;  3QPT A;  1IRF A;  2DPD A;  1RIO H;  5J3L A;  1M1E B;  2OJE D;  3BPV A;  2FBK A;  3WHC A;  3MAJ A;  1PVE A;  1UEL B;  2CFO A;  5FKM A;  3WTS C;  2CV1 A;  2LTP A;  2J5O A;  3QWL A;  5CVJ A;  2L7M P;  4M6V A;  2NNN A;  2IS6 A;  2Y75 A;  4IVN A;  3U2R A;  2L9N A;  1CGP A;  4KIS A;  2A69 F;  1MBK A;  2O03 A;  3IAM 2;  4PSX A;  1QA6 A;  2D1H A;  1A6I A;  3K1M A;  3HM5 A;  2R7X A;  4L5E A;  2LC2 A;  3B6A A;  5B66 C;  3LAP A;  2ZJR F;  4J00 A;  3CMY A;  1WVR A;  1DU0 A;  1XSX A;  1H0M A;  1A31 A;  2JQ7 A;  1VF9 A;  4ENK A;  1LDK B;  4M9X A;  3ZN1 A;  3ZMS A;  1E0E A;  5BNG A;  2M34 A;  3ZQI A;  4P9F A;  3ABM H;  4BXF A;  3D5L A;  2H94 A;  1RES A;  4IHV A;  4YIR X;  1IN8 A;  3HKZ A;  4C9Y A;  2XAG A;  3OYJ A;  1Q1V A;  1ZR2 A;  4UB6 C;  1FTT A;  2P0W A;  2M4G A;  3CCU I;  2GWR A;  3FDY A;  1H9T A;  2V6C A;  1OPC A;  1OQY A;  3Q0W A;  4XLC A;  3VSL A;  4HNV A;  5F64 A;  2P5L C;  3KIO A;  5DV5 A;  2VT2 A;  3IP4 B;  2R7Q A;  1WRJ A;  3ASN H;  2V1N A;  4XOT A;  1ZLK A;  4IQJ A;  5TIS C;  2GA1 A;  2HI3 A;  2O5R A;  1MH4 A;  2XUB A;  3MWM A;  2XGC A;  4A12 A;  3F8F A;  2QF7 A;  2VOO A;  3CLO A;  1WI9 A;  3KE2 A;  1J75 A;  2KZV A;  4FTH A;  2RQP A;  2RKH A;  2LMD A;  3KEQ A;  2LD5 A;  3BOQ A;  3CCJ I;  2E1O A;  2ETH A;  2J5P A;  3IRQ A;  2R7T A;  3WU1 B;  2EZH A;  2VUM J;  1MJB A;  3DPT A;  4IHX A;  4NC7 A;  2ID6 A;  2LY9 A;  5E79 C;  2V1X A;  2CJJ A;  5ICC A;  1LNW A;  1Y39 A;  1H88 C;  4RAG A;  3JTG A;  3L2R A;  4BAC A;  4ZC3 A;  3A01 A;  2KJB A;  5TRD A;  4OIQ F;  1FOY A;  3N97 A;  3ZMU A;  3KPH A;  1NG7 A;  3AG2 H;  1ETK A;  4AYB A;  1SD6 A;  4I7H A;  4EM2 A;  3H36 A;  3H5A A;  4JP0 A;  2PMH A;  1E17 A;  2O61 A;  3GO5 A;  2GOM A;  3OL4 A;  2I8D A;  5K1Y A;  1S6L A;  4OIN F;  3HHG A;  3BG5 A;  2BY2 A;  1V3F A;  2HDD A;  3J80 Z;  1BL0 A;  1JTX A;  2GA2 A;  3QOE A;  2FE3 A;  3FMS A;  5KCM A;  3BWG A;  1STZ A;  2BXY A;  4ENN A;  2CQK A;  3RKY A;  2PMZ A;  4ESF A;  3N05 A;  4HOB A;  3ZRG A;  3GXO A;  5IYD J;  1WWX A;  2BW3 A;  2V9V A;  3DKX A;  1WFX A;  3LMM A;  5GPA A;  1YS6 A;  2E5N A;  2XKO A;  3CO7 C;  3EUH C;  2OZ6 A;  3CLQ A;  5BQT A;  1X1B A;  3G4S I;  1L0O C;  2KZG A;  3CJT B;  3CF2 A;  2ISZ A;  1YX3 A;  5FKK A;  3V8L A;  1JTY A;  4U7D A;  3CCQ I;  4ZH4 F;  2MH9 A;  2X6Y A;  4B3X A;  4BHC A;  2Y30 A;  4PGG A;  4BDZ A;  1A04 A;  1UFM A;  2CV2 A;  3RCO A;  2VC0 A;  4PZJ A;  4YEJ A;  4M3E A;  3MCZ A;  2GQQ A;  3DTK A;  3CUO A;  4TV7 A;  3AFH A;  3P7N A;  5B5E C;  1N77 A;  2V1U A;  2R7F A;  3RSN A;  1P4A A;  4E7L A;  3PL8 A;  5E20 A;  2GOX B;  4NUB A;  1D1B A;  3K9T A;  2QCO A;  2W25 A;  1OCZ H;  1R1T A;  4HNU A;  5HS8 A;  4DYR A;  1BI3 A;  1ZQ3 P;  1K6Y A;  1WJA A;  1VQK I;  2QQA A;  3JRD A;  1Z9C A;  1HOM A;  1WJF A;  2OUM A;  1RPW A;  5HOO A;  4EJU A;  2G7H A;  4HX8 A;  2PBI A;  5JHF A;  1RKW A;  4M6Y A;  4BJ5 C;  1SEU A;  3W2V A;  1TNS A;  2HKO A;  3RKW A;  1DPR A;  1RZ4 A;  2LF8 A;  2VJJ A;  5L3E A;  5FKO A;  4D7M A;  2DW4 A;  1IV8 A;  3S15 J;  3H1C A;  3ZMZ A;  1XMX A;  1MBJ A;  2FSW A;  4RBO A;  3OS2 A;  3FM3 A;  3K4K A;  2BBY A;  4Y3O A;  5AIP A;  3DQV C;  1GVD A;  3F6V A;  3SXY A;  3IUO A;  2LYC A;  3VOE A;  1N78 A;  2UV1 A;  5L3B A;  1F43 A;  2FNP A;  2RGV A;  4B8X A;  2DA5 A;  1ETX A;  1TQM A;  1NK2 P;  1RRJ A;  1MDM B;  4LMY A;  1IDZ A;  2E60 A;  4AVZ A;  2ZME A;  3LOC A;  4XON A;  3OL3 A;  2NVX J;  3GTG J;  3I4M J;  3F8M A;  2MLK A;  4B47 A;  1OMI A;  1Y0U A;  2GM4 A;  5DEQ A;  3OOP A;  1QVT A;  4HX4 A;  3CD6 I;  2XF7 A;  2QQB A;  2V79 A;  3LSG A;  3M07 A;  2OD5 A;  3PFI A;  1XPX A;  1FOW A;  2EIM H;  4E7I A;  1UG0 A;  3QP6 A;  4FX0 A;  2JWT A;  2MLG A;  4UB8 C;  4PJN A;  4EVI A;  1WGX A;  4OIO F;  2CQQ A;  4KNY A;  2CO5 A;  1YLF A;  3KCC A;  2K86 A;  3PFY A;  3ZQQ A;  3P9I A;  3H5R A;  5C4X J;  3OYN A;  1FSH A;  1U2W A;  4XLN F;  3RI4 A;  4HA8 A;  2WC2 A;  1MMG A;  1U6G A;  3W2A A;  4IKF A;  2CU7 A;  5FD6 A;  1TWH J;  3EUA A;  2XF6 A;  4KJZ A;  5EEH A;  2ZJ2 A;  3HOW J;  1W7P B;  2DT6 A;  4W97 A;  1Z91 A;  5L3D A;  3HHH A;  5BS6 A;  4Z2Y A;  2ISY A;  3F8B A;  1ACI A;  3ELK A;  3E1S A;  1S7E A;  2HTJ A;  3MEX A;  3PUB A;  2IA2 A;  1XCB A;  4Y4R A;  4IHW A;  5CVR A;  3F8N A;  1J2X A;  3H3V K;  4PFP A;  2DI3 A;  2JPB A;  1PUF A;  4I76 A;  5F04 A;  3LNQ A;  1VND A;  1FC3 A;  1GXP A;  4ASN A;  1L3L A;  4MTE A;  2IP2 A;  3CES A;  3HJE A;  1ZRF A;  4G8X A;  1UHM A;  3D1N I;  4IOA F;  1ORK A;  4PUS A;  1JJ6 C;  1WJC A;  4G6Q A;  1BIB A;  1VQL I;  4CCO A;  4Q4Z F;  2RQQ A;  2TDX A;  1BW6 A;  1W4M A;  3J7A Y;  1LKX A;  2P5K A;  3S8P A;  2PLY A;  3RQI A;  2LRD A;  2G0E A;  2Y0M A;  4AUX A;  2BW3 B;  4HSR A;  4P55 A;  3ZPL A;  3LQR A;  2VQL A;  2X9D A;  3QYF A;  1R7J A;  4B3A A;  1JKP C;  3F0C A;  4S04 A;  1FIA A;  1KYZ A;  3I9V 2;  4UXN A;  2GAU A;  2O8X A;  3RIR A;  2IA1 A;  2FEZ A;  4BUP A;  4A3F J;  2KIM A;  4BY7 J;  1GT0 C;  3RPQ A;  2UXX A;  2H09 A;  5HLH A;  1T95 A;  5CQE A;  2VAS A;  4A5N A;  1ULY A;  1X4P A;  2L7Z A;  3PNY A;  2NVU B;  2MH2 A;  2WAQ A;  2WTE A;  3BR6 A;  2FRH A;  3ZGK A;  5J8F A;  4W1U A;  2VE8 A;  1IG7 A;  3EYI A;  2HKX A;  3BG7 A;  4U0V A;  1WJD A;  4MEY F;  4IX7 A;  5C4J J;  4OMY A;  3JRA A;  3I58 A;  1TZL A;  1IGN A;  2EFO A;  4ENJ A;  3CJQ B;  5LGN A;  3I55 I;  1QHH D;  2Q2E B;  4I6Z A;  4YII A;  5EF6 A;  2M0C A;  2MG4 A;  2QLZ A;  1K78 A;  1OCP A;  3L09 A;  4A2U A;  2HXO A;  5ILU A;  3T0Y A;  2Y9Z A;  1HST A;  3S32 A;  3SDB A;  1N75 A;  5IOY A;  2GBY A;  2PEX A;  3G1O A;  5J1U A;  3H3Z A;  1G8X A;  4AWX B;  1O3Q A;  2R7Z J;  3S1M J;  1FLI A;  1LE8 A;  3WTY C;  4BS9 A;  1IN6 A;  2VL8 A;  4OMZ A;  2GLO A;  1KQ0 A;  3KYD B;  2ESH A;  2QQ8 A;  3S3O A;  3KP3 A;  1BI2 A;  2F5D A;  3GBG A;  4FT8 A;  5KNL A;  2DOD A;  4BGD A;  1IJW C;  4QLC U;  2DA7 A;  3O8G A;  4UY8 I;  2R3S A;  3CJR B;  4WXH A;  2HR3 A;  1RET A;  1FYM A;  3RQ4 A;  5JFR A;  3R0A A;  4CYD A;  3J81 Z;  1NK3 P;  3RZO J;  4II2 A;  4I2O A;  3LSI A;  3WTZ A;  1MDM A;  4RM2 A;  1BOB A;  4B43 A;  4RGU A;  5F6F A;  4LGW A;  2G7U A;  2WBM A;  3S1Q J;  3BZ6 A;  2DA6 A;  2LKS A;  3HOS A;  1MD0 A;  3CUQ A;  1H89 C;  1EJ9 A;  2CYY A;  2HWV A;  3PM1 A;  4AYB N;  2L2O A;  3O8H A;  4XLA A;  4E7H A;  1IXC A;  1GV5 A;  2QEX I;  2O9L A;  1JJ8 C;  3K1N A;  5HOD A;  4XLP F;  2DFI A;  3VSK A;  3J81 K;  5A2Q K;  4BQA A;  3BTC A;  1WHU A;  3SZP A;  2Y31 A;  2Y48 A;  2DLL A;  4R8H A;  2BY3 A;  2ZJP F;  4RM3 A;  1MNM C;  2XIG A;  4NNJ A;  2DPU A;  3KP7 A;  2IBD A;  2JA6 J;  3HGY A;  2WV0 A;  1YIJ I;  2CV0 A;  2MFZ A;  4NB5 A;  3SEZ A;  1QVU A;  5GTH C;  3SYT A;  4RGX A;  2JSP A;  2V9P A;  2CG4 A;  2IA0 A;  3GX4 X;  1Z7U A;  4KT5 C;  1Z77 A;  3M9A A;  4BU2 A;  4KIC A;  1PUF B;  2JSC A;  3U9G A;  1W7P D;  5IYC J;  3CMA I;  2CW0 F;  2ZNY A;  1FOK A;  3BQZ A;  1XGM A;  2OQR A;  1FBU A;  3K4L A;  1LEB A;  1VI0 A;  2M45 A;  2VKV A;  3KYL A;  3IV5 A;  1WH7 A;  2VKD A;  4C3I J;  1MMN A;  3CTA A;  3FBN B;  2DYS H;  3PSF A;  1YQA A;  1D8J A;  4X1E A;  1FTZ A;  2JA2 A;  4XKV A;  4AID A;  1HKS A;  2I5U A;  4BH9 A;  3VYS B;  5K7F A;  4HV6 A;  5HDN A;  1YJN I;  1VQ6 I;  2JRT A;  2E1N A;  5IP7 J;  4XSX F;  2BYV E;  4RA2 A;  2BXZ A;  2JT1 A;  3O2P E;  3SFZ A;  4BAY A;  5IP9 J;  3RZD J;  3TGN A;  1R36 A;  2FA5 A;  4LG0 B;  2E2J J;  4A3D J;  4C2M J;  1NH3 A;  2DK5 A;  2R7V A;  2OF7 A;  4LLN A;  1ZN2 A;  4L5I A;  1XX5 A;  4CCL A;  3IH3 A;  2XF5 A;  3FXM A;  2H8R A;  4M3B A;  1K4T A;  3GTK J;  2MW8 A;  3B6C A;  3FIS A;  4OU0 A;  5LEK A;  1QBJ A;  1ETY A;  2F5C A;  1V54 H;  5E1Z B;  1HKQ A;  5DD4 A;  2XC7 A;  1Y56 A;  2QM3 A;  1O4X A;  4EJW A;  2A6H F;  3A0H C;  5H6Q A;  3HDD A;  5JVT A;  4F91 B;  4F52 A;  2L7F P;  1TTY A;  1TWG J;  1Z1D A;  2BE5 F;  3F8C A;  1A6Q A;  1MW7 A;  1CQT A;  2HFH A;  4YFN F;  1HA8 A;  3CCM I;  3CCE I;  2DXI A;  2JPC A;  1UHS A;  2CW7 A;  4XNF A;  1RC9 A;  1S5L C;  3Q3S A;  4IF4 A;  3JRG A;  2L02 A;  4UV8 A;  3VOD A;  1VQ4 I;  3OYK A;  2EV5 A;  1XN7 A;  2YX4 A;  2OQG A;  2Z5U A;  2EFQ A;  2XV4 S;  4JK1 X;  3AAF A;  2NNY A;  3V7C A;  2Y0S N;  4G94 A;  4LB5 A;  3PNT A;  4CIC A;  1EV7 A;  2DFE A;  4CSW A;  3A03 A;  4HF1 A;  1YX5 A;  1ZK8 A;  1SVL A;  3FK6 A;  1U0J A;  4EM1 A;  3MQ0 A;  3TL4 X;  2HOT A;  2ZXH A;  5GPC A;  4HDV A;  4HW0 A;  3BR1 A;  3E5Q A;  5FKN A;  5M5Y J;  2HPM A;  1R22 A;  2H6B A;  3FK7 A;  3IH4 A;  4PSW A;  1OKR A;  3RTR A;  2F4O B;  3I4P A;  3T1B A;  1B8I B;  4S0H B;  1K79 A;  3RPU D;  4ENM A;  3ZMV A;  2A3S A;  2AXT C;  2ZFW A;  4CUG A;  3HG9 A;  1J7K A;  3ABK H;  4UUS A;  1C0W A;  3IWZ A;  2DQR A;  3LSH A;  3TOA A;  4DQ2 A;  2KL4 A;  2GXB A;  2BY0 A;  4E7Z A;  1I27 A;  1SFX A;  1R1U A;  1J9I A;  1QZE A;  3FXK A;  4XN0 A;  4L0Z B;  2XRO A;  1FYK A;  4HRI A;  2E19 A;  4XLH A;  2M8G X;  2K4J A;  4CZZ A;  1K7A A;  1VTN C;  5EZH A;  1B72 B;  2IAI A;  2XAJ A;  2KIF A;  3E5X A;  2B7E A;  4Q47 A;  4IHY A;  5B1B H;  2LR8 A;  1NG6 A;  4G7O F;  2XAU A;  1VQ9 I;  3JRF A;  4PGH A;  5IP6 A;  4QIW N;  1S72 I;  4Q48 A;  2O8K A;  5ICF A;  2B0L A;  2ICW G;  2JA5 J;  4XKW A;  2HEO A;  4JBA A;  1BJA A;  2LLK A;  3ML6 A;  4YRV A;  5D6F A;  2WY7 Q;  1HLV A;  4KIB A;  3ECO A;  3LFU A;  1TL8 A;  2VJ4 A;  4RLQ A;  2F48 A;  2DMT A;  3GCM A;  3H5N A;  2FNA A;  5FLV A;  4F55 A;  2IS4 A;  3OYC A;  1PP7 U;  2V1D A;  4O6J A;  1W7P A;  1D8K A;  3F6O A;  3VYT B;  3C18 A;  2BZT A;  2F5F A;  1YW8 A;  3FF5 A;  3RKX A;  4F7Z A;  5KVR A;  4KN4 X;  1NHA A;  1QRY A;  2XGE A;  3ESW B;  4E70 A;  3CZ6 A;  1MBF A;  1X1D A;  5DM7 F;  3JAM K;  4ZZL A;  3R60 A;  5D5X B;  3E6M A;  1ZAO A;  2IRF G;  2C6Y A;  3A01 B;  4U0W A;  5D5V B;  1ZHF A;  2Z16 A;  2ZKZ A;  3VEP A;  4C3H J;  5FKL A;  4IEJ A;  4NC8 A;  4DZJ A;  4M74 A;  2DJI A;  3QU6 A;  4KIG A;  5H2F C;  1HC8 A;  1T6S A;  2VN2 A;  3WGG A;  3IC7 A;  1HDD C;  4F93 B;  2ZME C;  3M7G A;  2IXS A;  1WQ2 A;  4H4K C;  1J5Y A;  3DLA A;  1BI0 A;  1HSJ A;  2VC1 A;  3C3W A;  3OY9 A;  1BI1 A;  1O57 A;  2XGD A;  3IAS 2;  5ERI A;  1IXS B;  3HZJ A;  5TGT A;  5LHG A;  3HUG B;  4L9T A;  2NS0 A;  3O6B B;  4UUT A;  2FMY A;  2Z2S B;  5LGT A;  3JTH A;  2ADU A;  2MSY A;  1AKH B;  4ZDO A;  1AOY A;  1XC5 A;  3HRS A;  3GTQ J;  4KUM A;  4LIV A;  2HU9 A;  3O3K A;  1JKR C;  4U0Y A;  3S2H J;  3WG7 H;  3R6S A;  4HZF A;  5EGO B;  2VT3 A;  1FMW A;  3J80 K;  3QOP A;  6PAX A;  4A5M A;  4HLX A;  1Z3X A;  2LH9 A;  1XB4 A;  4GFB A;  2JN6 A;  3DKY A;  4C3J J;  1PJR A;  2QZ8 A;  4B1R A;  1WJE A;  2X48 A;  1R23 A;  2Q2E A;  3OYL A;  1A5J A;  2JJ7 A;  1ZTR A;  3ZXS A;  2A5W A;  3H0D A;  2HZT A;  5LRS A;  2JZY A;  4QPO A;  1RKT A;  1VQP I;  2Q1Z B;  1QZY A;  4YEL A;  5FRM A;  1E3P A;  1YW7 A;  1RI7 A;  4II3 A;  1IXR C;  1IRZ A;  2XAH A;  1KQ9 A;  4Y13 A;  4BNC A;  2O0Y A;  2CQ7 A;  2QVO A;  3NAR A;  2QA4 I;  2K27 A;  5C44 J;  2O7O A;  4A0Y A;  5HLT A;  1F5T A;  2VBX A;  2FQ4 A;  2M87 A;  3JW4 A;  3ERE D;  1JGS A;  2XPU A;  5J4Y A;  1XGN A;  4Z6Y A;  4B4C A;  2BGC A;  3L1P A;  1GVJ A;  3D5R C;  3GFI A;  4HLY A;  2DTZ A;  2STT A;  3G2B A;  2L3D A;  3WGI A;  1MBE A;  3LSP A;  1MNE A;  1BC8 C;  2R4G A;  4NC6 A;  1LDD A;  1FPQ A;  3CJN A;  3WTW C;  2EIK H;  2BY1 A;  1YE9 A;  3CUQ B;  5D4R A;  4U7B A;  1B72 A;  3KYC B;  5K7Z A;  2CQX A;  3E6D A;  5CQG A;  2X0L A;  1FNN A;  3JRH A;  1U3E M;  1MMD A;  5M5W J;  4N4O B;  3JR9 A;  1Z67 A;  1OYW A;  2GXG A;  5FRN A;  3K2A A;  2ME0 A;  3I64 A;  4RMN A;  3NWS A;  3CCV I;  3IRR A;  3Q9S A;  2L4A A;  1MJA A;  2E36 A;  5BMZ A;  3S1N J;  3DPL C;  4RS8 A;  5EDN A;  1B6A A;  1GLN A;  1I6X A;  5HNH A;  2E7W A;  1A36 A;  3G3Z A;  2EIN H;  1MJ9 A;  3TBI A;  3BQY A;  2W84 A;  1TW3 A;  1OIS A;  3L7W A;  4GO1 A;  5C3E J;  3GTM J;  2HTS A;  1LFP A;  1Y8R B;  1EH7 A;  3K4C A;  2NVY J;  1QQI A;  3WE3 A;  1HW2 A;  1OR7 A;  4U87 A;  1VQ5 I;  3BZC A;  1X2M A;  1TC3 C;  4A6E A;  1FBQ A;  2OTJ I;  3TW6 A;  1W36 C;  3ABT A;  3L00 A;  1E2X A;  1UZC A;  1U78 A;  3EUK L;  4BQQ A;  5L3F A;  1R4M B;  4ESJ A;  4GYG A;  2STW A;  4ABZ A;  5EJC A;  2KJC A;  2E1M C;  2LY2 A;  2JVH A;  3JRE A;  1MSE C;  4M72 A;  3HOU J;  2FOW A;  3W3C A;  3PQK A;  3OYB A;  2GIZ A;  5FLX Z;  3FXL A;  1MSF C;  3V4G A;  5A2Q Z;  2QSH X;  1VZ0 A;  2OZU A;  3GZ6 A;  1IDY A;  4R1H A;  1G3Y A;  2HQA A;  3ZMT A;  2E2I J;  1B4A A;  2AQF A;  3FWE A;  3OIQ A;  3M8J A;  2KRF A;  2ZXW H;  4EAT A;  3REO A;  2R7O A;  2VJI A;  1T98 A;  2EZK A;  1ZGA A;  2HVQ A;  5GAG J;  3HSR A;  3FHN A;  4L5J A;  3SQN A;  2DA1 A;  4QWQ A;  1U9N A;  1TW2 A;  4M9S A;  1UMQ A;  2XPV A;  2LSO A;  3K70 D;  4A3J J;  1BR1 A;  2F6C A;  2BHZ A;  4DYC A;  4KT6 A;  1JKQ C;  1MBH A;  3OSF A;  2AXL A;  3LSJ A;  4E4H A;  1BOA A;  3KEO A;  3CCS I;  4A3E J;  3IHU A;  1V5F A;  2M2E A;  2VBZ A;  2N8G A;  2X1D A;  4IRG A;  4CA0 A;  1EH8 A;  3HRU A;  2CUF A;  3PIO F;  3OSG A;  1I1S A;  5DUK A;  2I10 A;  2OCE A;  3PNV A;  5J6X A;  4M3G A;  1PUE E;  4M9Z A;  4IHS A;  1HQC A;  5CYV A;  3QP5 A;  2K9Q A;  5E3N A;  1IC8 A;  3LSK A;  4C30 A;  4D9J A;  4I09 A;  2W82 A;  1P2F A;  3LST A;  2TRT A;  4PJJ A;  4P1W A;  1VFC A;  1PYV A;  3OOU A;  2K02 A;  4KIF A;  5J1Y A;  5DYM A;  4GCV A;  5F0H A;  3OIO A;  2VXZ A;  3Q9V A;  4P5O A;  3JRC A;  3LSR A;  4MLO A;  3CQZ J;  4XKC A;  4ESB A;  1RUO A;  1QPI A;  1I1G A;  3JSP A;  2LY1 A;  3VPR A;  3IKT A;  1U5T B;  3WTT C;  1APL C;  1UG2 A;  4DGW B;  2K4B A;  3BJA A;  2NOG A;  4FIS A;  5LGU A;  1B8I A;  2P7C B;  4HPQ A;  4HX7 A;  3T5X A;  2IT0 A;  3F23 A;  1IZ1 A;  4BE2 A;  3BTL A;  1IV6 A;  4UUS B;  4E7K A;  3GVA A;  1J09 A;  4MFE A;  3HSE A;  4F92 B;  1XD7 A;  2EB7 A;  3PSI A;  3GEZ A;  4QTR A;  3OS1 A;  3KP5 A;  1P7I A;  3G1L A;  1B1B A;  3A0B C;  4HDU A;  1F1Z A;  4XK4 A;  2PG4 A;  2HQ5 A;  2M9H A;  1OCR H;  3HB9 A;  4XLF A;  3HRM A;  3V7R A;  3ZCO A;  1Q1H A;  4UVC A;  3W6J B;  3CME I;  2DN0 A;  2AHQ A;  1GXQ A;  1FEX A;  2F5V A;  3BTJ A;  1YI2 I;  4XOP A;  1P92 A;  1P4X A;  3GLL A;  1F4K A;  2FBI A;  4ZYD A;  2KLO A;  4LLL A;  1X1A A;  1ZKG A;  2KIS A;  2NRA C;  1ON2 A;  5L3G A;  4WXD A;  4MGR A;  4J19 A;  3CDI A;  2LVS A;  2KRH A;  2VJ5 A;  3OR1 C;  2Z1D A;  1ONV A;  3F22 A;  5GP9 A;  1ETO A;  1JE8 A;  1P6R A;  3B02 A;  9ANT A;  2K3F A;  4ZZD A;  2AQE A;  2A07 F;  5K7H A;  2M0M A;  4L0Y B;  2KMU A;  3PQJ A;  1ZH5 A;  3EPZ A;  5EZG A;  1YG2 A;  4YFK F;  3MMY B;  4A3B J;  1KA8 A;  2ACJ A;  3VB2 A;  3KLN A;  2EV6 A;  1SC7 A;  1WJ5 A;  2VPR A;  5JI6 A;  5D8K B;  1S8N A;  5HNF A;  5ED4 A;  1X2N A;  3EET A;  3FX3 A;  2R5Y B;  2NVQ J;  3DU6 A;  3E5U A;  1WSU A;  2NAZ A;  4WX9 A;  3AG1 H;  2ELJ A;  2FJ1 A;  2P81 A;  4BBR J;  2JRM A;  4EJO A;  3K10 A;  1BA5 A;  4EGY A;  2ZO4 A;  3CCR I;  3HL2 A;  2JMW A;  1O3T A;  2FF4 A;  3H9J A;  2DU9 A;  4P9U A;  1JUP A;  1MMA A;  1RNL A;  5FO5 A;  1U8B A;  4LK0 F;  2VIX A;  2QSF X;  1XDU A;  2OU2 A;  4F3Q A;  1VQO I;  1T8I A;  2W1O A;  1OCO H;  1A35 A;  4HBL A;  1ZEL A;  2B63 J;  5H20 A;  2E7X A;  1KU9 A;  3I53 A;  3HGG A;  1ODD A;  3RJP A;  2EK5 A;  2AO9 A;  4RDU A;  4LG0 A;  2DBB A;  1FZP B;  3BZK A;  4E7S A;  2Q0O A;  3AG3 H;  1AKH A;  2FQ3 A;  1U9O A;  4AIK A;  3DU5 A;  1YJ9 I;  4M3F A;  5DS9 A;  3I54 A;  2PMU A;  2VE9 A;  3L2Q A;  1FIP A;  1IO2 A;  2RN7 A;  4WXC A;  5M5X J;  4YG2 F;  1LQ1 A;  3ZP5 A;  3KP2 A;  2DYR H;  1X58 A;  1MIJ A;  3V7S A;  2IVM A;  1XS9 A;  3UNG C;  2L01 A;  4G7Z F;  4LJZ F;  3BCB A;  2CQN A;  4MEX F;  4UNO A;  2PQ8 A;  2MD0 A;  4NQW B;  5HDK A;  2FUG 2;  2WB1 N;  1QPM A;  3K4J A;  3HEF A;  3FXO A;  5LRR A;  3WOD F;  3CDL A;  4DJA A;  5CVI A;  2NOJ B;  2VQC A;  4ZTJ A;  4BKX A;  5JLX A;  2M30 A;  1D3Y A;  2MA3 A;  2ESN A;  1P4W A;  2GXA A;  4A69 C;  3ERM A;  4P96 A;  4Y52 J;  4A93 J;  2EIL H;  2WB1 A;  3CCY A;  1Y1V J;  5EEA A;  1DGR M;  1V55 H;  2VBY A;  1U5T A;  4D0P A;  2HYF A;  3W6K B;  3LWF A;  5HLG A;  2PI0 A;  4LIT A;  1XG1 A;  1LPQ A;  1TBX A;  2DJN A;  1P7J A;  3CF5 F;  1V5G A;  1ENH A;  3T8T A;  4HV5 A;  1I5Z A;  4OIP F;  2DO7 A;  2K9S A;  1LE8 B;  1HCR A;  1ZYR F;  2QBY A;  1HW1 A;  1G6N A;  2KFD A;  2GZW A;  5KK1 A;  5GAD J;  2UUZ A;  1X19 A;  5DCM A;  2A68 F;  2IGN A;  3JAM Z;  2COM A;  2VBW A;  3MD2 A;  1VQN I;  4MQ9 F;  5JVG F;  4MIM A;  3ZOB A;  3ZQ7 A;  2K5C A;  4XOR A;  4RB2 C;  3ISP A;  4WK8 F;  3S2D J;  2XB5 A;  1TLH B;  3TQN A;  1HKT A;  2BOL A;  2XRN A;  4HF0 A;  4D5C A;  3FHZ A;  1F9N A;  2M8E A;  5M3F J;  3BG3 A;  3MKL A;  2XDV A;  1YTY A;  1SFK A;  3FZV A;  5CVV A;  3ZQH A;  2DA2 A;  5JHU A;  3RKQ A;  2ZXJ A;  2BVL A;  2K40 A;  2LRE A;  2CW8 A;  3QQA A;  1D0Z A;  4ZYA A;  5EG0 B;  3HOY J;  2P7V B;  3R0J A;  1KQ8 A;  3TO7 A;  4BEH B;  2P6S A;  2YS9 A;  2ELK A;  1R5H A;  1DGW Y;  5IPA A;  1OLT A;  4Y7N J;  1D5Y A;  1LFB A;  4M6X A;  3OYA A;  5E8I A;  1FOX A;  4MTD A;  2DA3 A;  3BY6 A;  2IW5 A;  3SZT A;  3TP0 A;  4CCN A;  5DUI A;  1SAX A;  4JOM A;  4IL6 C;  2FD5 A;  4BHP A;  2PJP A;  3QPH A;  1ON1 A;  3CC2 I;  4XKB A;  1YRN B;  1D0X A;  2MD5 A;  3B73 A;  2NS7 A;  3HIF A;  4LLG F;  2V7F A;  3A02 A;  1FSE A;  4AD9 A;  1OFC X;  2DMN A;  2PFB A;  2P4W A;  1DQU A;  3NQO A;  5D4S A;  1MMS A;  2XGX A;  3I0T A;  4XLE A;  4AVP A;  4AIJ A;  3HYI A;  1T39 A;  2W57 A;  3SFI A;  3WTV C;  3M4O J;  2HOS A;  2OC6 A;  1WI3 A;  2LDU A;  2RRE A;  3FKJ A;  4I02 A;  5TJJ A;  4RAZ A;  1W0T A;  1YW9 A;  4O3M A;  3UKG A;  2Z33 A;  2HNH A;  5K5Q A;  1AU7 A;  3H0G J;  1OYI A;  3ONQ A;  4BL0 B;  5GTI C;  2H1K A;  3KEY A;  3LA3 A;  5AON A;  1BR4 A;  3E6C C;  1TWC J;  3DKW A;  2KIQ A;  1SD7 A;  1YOV B;  4PK4 A;  1D5V A;  3S3N A;  4QPQ A;  1FP2 A;  4V2G A;  3OYD A;  4RLF A;  5K5O A;  3E6B A;  2ZNZ A;  3KP6 A;  3AKZ A;  1FT9 A;  1UCR A;  1B9M A;  3Q0U A;  3K0L A;  4D7N A;  4FCY A;  3A1Y A;  1IUY A;  2MYS A;  4A3L J;  1KU2 A;  1I6H J;  4PCQ A;  2HDC A;  5IT9 Z;  2ZFU A;  4OAZ A;  2CFX A;  5HS9 A;  3IWF A;  4KFC A;  2HYG D;  1EF4 A;  3V8K A;  2E71 A;  4HEA 2;  3K4B A;  2BVM A;  4D5F A;  1TQP A;  3BT9 A;  4IO9 F;  2XKP A;  3DBL B;  3CMM A;  4XMY A;  2HYJ A;  3CP2 A;  1LVK A;  1UHW A;  1WH5 A;  1RR8 C;  5F0C A;  3DF8 A;  4BDY A;  1X3Z B;  3M1E A;  3EYY A;  2UXN A;  2QSG X;  3UR3 C;  3V42 A;  2VOD A;  3VFZ A;  2OCC H;  4FE4 A;  5M3M J;  1QHG A;  3CC7 I;  1QGP A;  4XM3 A;  3NRV A;  1LB2 A;  3ABL H;  3OIP A;  4AC0 A;  5BPD A;  3QYE A;  3MZH A;  3A4C A;  2PN6 A;  3JRI A;  2F4M B;  2LKX A;  2VPL A;  2JA7 J;  4XID A;  4NBQ A;  2HOE A;  2QYO A;  5AIQ A;  4L18 B;  4MQV A;  1GHC A;  4UVA A;  2EPF A;  3E0J B;  2RAE A;  3OYH A;  1K61 A;  2KDZ A;  1X4O A;  2K9M A;  4YIF A;  4EJT A;  5DCM B;  4K2E A;  1FWZ A;  4OOI A;  4RAF A;  2EFN A;  2LNB A;  1I50 J;  4LFU A;  3PO2 J;  5ILS A;  2WV1 A;  2VKE A;  4ZYG A;  1VQ8 I;  2E2H J;  1POG A;  4HF2 A;  4DOZ A;  5F1R A;  4OIR F;  2IEK A;  2XB0 X;  1LFU P;  1V4R A;  4IOC F;  5FLX K;  3ZR8 X;  1Z6R A;  1UJ8 A;  2FX0 A;  2RC4 A;  2O3F A;  3I3L A;  2R7R A;  2BEO A;  3IH2 A;  3GWZ A;  1YHQ I;  5FB2 A;  4IPA A;  2R7W A;  1Z05 A;  2MBF A;  2P5V A;  5EG0 A;  3TED A;  4KDP A;  2KT0 A;  3U1K A;  4RB0 A;  4DYQ A;  2H6C A;  3K6G A;  4XRF A;  3WTX C;  5DTD A;  4Y15 A;  1QNT A;  5EYR A;  2XSD C;  4XQF A;  1XMK A;  4RGR A;  5D6E A;  4CZC A;  2JA8 J;  1BBY A;  2HGC A;  2Y2Z A;  2VQG A;  5FD5 A;  1R5I D;  2MC3 A;  1YYV A;  5HS7 A;  4EQQ A;  3GTL J;  1G59 A;  1R1V A;  2EIJ H;  3D0S A;  4NDL A;  1TT0 A;  3C7J A;  2ZB9 A;  1NTC A;  4FE7 A;  3FIW A;  3BR3 A;  3J7A O;  1S7O A;  4ZDL A;  1SFU A;  4BHB A;  1T2K A;  4ON0 A;  1DU6 A;  3QOD A;  1MND A;  3QAH A;  1X3W B;  3C2H A;  3D5S C;  3KLO A;  2WAE A;  1JXS A;  3H3U A;  2OPT A;  2E35 A;  3VWB A;  1H8A C;  4BXU A;  1RUN A;  2WA0 A;  5JR3 A;  3QRF F;  3ULQ B;  2K3P A;  4IXA A;  2PX9 A;  4N0B A;  3R4K A;  3MKZ A;  4E7J A;  2QEN A;  1G3W A;  3DEW A;  5E3M A;  3BG6 A;  4BJT A;  1TQI A;  4Q5S F;  2CUE A;  3TO6 A;  5F1J A;  2LG4 A;  4J01 A;  1Z6T A;  4XBF A;  2F4I A;  2DFF A;  2VB6 A;  1O7L A;  1E3H A;  2A5Y B;  5LLQ A;  2DTR A;  3VYU B;  4HYE A;  2W24 A;  3NEU A;  3DCF A;  1ZRE A;  2ZSI B;  2MAB A;  4U88 A;  4N9H A;  2P8T A;  2XSJ C;  4E6K G;  4MNU A;  5BOX A;  1REP C;  1SD5 A;  5D5U B;  1XSD A;  4M73 A;  2R92 J;  5DCF A;  4BQN A;  3W2W A;  3S16 J;  1W5C C;  2L9R A;  3W6V A;  4GXO A;  3HBL A;  1R4N B;  3HSF A;  5LHH A;  1SVO A;  4LOC A;  4UHT A;  3OYF A;  1X3U A;  1FX7 A;  1USS A;  3BJ6 A;  1U5T C;  2X51 A;  1JT6 A;  4CDG A;  3ZQL A;  4KMU X;  4CGZ A;  2EBI A;  3I5U A;  1OJL A;  3P9C A;  3T8R A;  4CYC B;  3HUG A;  3HRT A;  1WJB A;  4DW6 A;  3GTJ J;  1Y0N A;  2ZC2 A;  4BBS J;  1YFH A;  4BXX J;  4XR6 A;  2HPI A;  3LA7 A;  4JX6 A;  2R93 J;  3FKI J;  3HOX J;  3OV8 A;  1E3O C;  1T33 A;  2LBF A;  3JCU C;  4B48 A;  3M3Y J;  2EV0 A;  1P9Q C;  2K85 A;  2CUZ A;  4GYI A;  2ZJQ F;  2L54 A;  2A6E F;  5IYB J;  1S7A A;  4M71 A;  2X85 A;  4L9N A;  3X2Q H;  4N9I A;  1ZG5 A;  3ZQF A;  3ZN0 A;  2GIV A;  2L9V A;  3K1P A;  5F08 A;  5GAE J;  3BP8 A;  4RB3 C;  2KPM A;  2DMQ A;  2UWM A;  1SMY F;  2L4M A;  5IOZ A;  1T38 A;  4IQ4 A;  5FFZ A;  3DLL F;  2EA4 A;  1S29 A;  2XAQ A;  2ID3 A;  2PJR A;  2KQR A;  3GZ5 A;  3LA2 A;  5JLW A;  4IZZ A;  1XGO A;  2OBP A;  2QBY B;  1UAA A;  1ITY A;  2V4J C;  5EEG A;  3SDG A;  2DT5 A;  3U21 A;  2IPQ X;  4XRS A;  2XPW A;  2R7U A;  3BC8 A;  4XSZ F;  2VOP A;  4UV9 A;  2M7B A;  1JUM A;  5CPR B;  1DUX C;  1D0Y A;  3KFW X;  3OYE A;  3F72 A;  3HTU A;  1W5T A;  1MH3 A;  3BRO A;  1FYL A;  2FML A;  3SEQ A;  2QGU A;  1R49 A;  2NVT J;  4BY1 J;  2E34 A;  1Y6I A;  3BR2 A;  3MKW B;  1D1A A;  2IGK A;  3ZQG A;  1IUF A;  2W7N A;  1KYW A;  1K6O A;  2NXN B;  2OAZ A;  4CO8 A;  3MFK A;  2LKP A;  3SJM A;  3BR5 A;  3DXJ F;  2X4H A;  3CO6 C;  4WCG A;  2R0Q C;  1IW7 F;  2F2E A;  1ZLJ A;  4FQG A;  3L9F A;  4YFX F;  2V9K A;  2VI6 A;  5BPI A;  2EWN A;  1V5E A;  4G9Y A;  1Z3Y A;  1F36 A;  2XVC A;  5FJ8 J;  1XMA A;  2FXA A;  3J7Z I;  3S1R J;  1W0U A;  1SMT A;  1EA3 A;  4EV0 A;  3LAJ A;  1T56 A;  1DDN A;  3AL0 B;  2KRC A;  2E5Z A;  3KZI C;  2CWE A;  1SAU A;  2QKM B;  3F3X A;  1ZGW A;  2D2W A;  1R71 A;  2WY8 Q;  2RV8 A;  2DAO A;  3G1M A;  2YX7 A;  2A05 A;  3KP4 A;  3HPG A;  1LJ9 A;  1K83 J;  2XAS A;  3G71 I;  1IRX A;  1IAW A;  3TDZ C;  4A0X A;  4LB6 B; 
#chains in the Genus database with same CATH homology
 3MN2 A;  2Y0S N;  2Y9Y A;  4M3F A;  5DS9 A;  3Q0W A;  3A03 A;  1FIP A;  4HNV A;  5M5X J;  1GUU A;  1ZK8 A;  3FK6 A;  2HOT A;  4JYK A;  1X58 A;  5GPC A;  1XS9 A;  3S14 J;  3BR1 A;  5FKN A;  5M5Y J;  4A3G J;  1ZR4 A;  1WPK A;  3FK7 A;  3IH4 A;  3C2B A;  1B8I B;  1GV2 A;  4S0H B;  2HI3 A;  1MH4 A;  2XGC A;  2WB1 N;  3HEF A;  2QF7 A;  4UUS A;  2LK2 A;  3CDL A;  2DMP A;  4FTH A;  5F0F A;  4BKX A;  5JLX A;  2LD5 A;  5FLM J;  2E1O A;  2VUM J;  2EZH A;  4A69 C;  4IHX A;  4Y52 J;  2ID6 A;  2LY9 A;  4A93 J;  3CCY A;  2CJJ A;  2E19 A;  1Y1V J;  2M8G X;  5EEA A;  1H88 C;  2XRL A;  3QPL A;  5EZH A;  1B72 B;  2IAI A;  1XG1 A;  3HKZ N;  3A01 A;  3PO3 J;  2DJN A;  1P7J A;  3MVP A;  1ENH A;  1ETK A;  4IHY A;  2K9S A;  2LR8 A;  4JP0 A;  1LE8 B;  1HCR A;  3TP3 A;  3JRF A;  5IP6 A;  4QIW N;  2TCT A;  2O8K A;  2JA5 J;  3BG5 A;  2HDD A;  2LLK A;  1BL0 A;  1JTX A;  4MIM A;  3ZOB A;  3S2D J;  1HLV A;  3E7L A;  2XB5 A;  4G12 A;  1FJL A;  2DMT A;  2LP0 A;  4M3D A;  4D5C A;  5FLV A;  5M3F J;  3BG3 A;  3MKL A;  2HXI A;  5IYD J;  3ZQH A;  2R5Z A;  1QRY A;  2DA2 A;  3RKQ A;  2XGE A;  2K9N A;  1MBF A;  2K40 A;  5GPA A;  1Z0X A;  3QQA A;  5EG0 B;  3HOY J;  2JK3 A;  3A01 B;  4A3M J;  4C3H J;  2YS9 A;  5FKL A;  2ELK A;  4IEJ A;  5FKK A;  3HOV J;  4DZJ A;  1JTY A;  5IPA A;  1SFO J;  4Y7N J;  1D5Y A;  1LFB A;  3ZQC A;  2Y30 A;  2L0K A;  1HDD C;  2DA3 A;  3TP0 A;  3Q0V A;  4M3E A;  2HOA A;  4A3K J;  2EH3 A;  2FD5 A;  1Y1W J;  4XIC A;  1YRN B;  2XGD A;  2NS7 A;  2QCO A;  3A02 A;  1OFC X;  1BJZ A;  4DYR A;  1AHD P;  2DMN A;  4UUT A;  1ZQ3 P;  3JRD A;  2NS8 A;  1OCT C;  2MSY A;  1AKH B;  1HOM A;  1ETW A;  1XC5 A;  1RPW A;  3M4O J;  3SFI A;  3GTQ J;  2PMZ N;  2HOS A;  1JKR C;  3S2H J;  1RKW A;  1WI3 A;  2DA4 A;  1W0T A;  5EGO B;  3UKG A;  5FKO A;  4D7M A;  1AU7 A;  2H1K A;  3H0G J;  3BR0 A;  3S15 J;  1MBJ A;  3I4N J;  4RBO A;  4GFB A;  2JN6 A;  4C3J J;  4B1R A;  2X48 A;  1GVD A;  1A5J A;  1TWC J;  3HOZ J;  2JJ7 A;  1ZTR A;  4V2G A;  1F43 A;  2DA5 A;  1ETX A;  1RKT A;  1NK2 P;  4DZP A;  1IDZ A;  3Q0U A;  3LOC A;  4D7N A;  4FCY A;  2NVX J;  3GTG J;  3I4M J;  4A3L J;  2GM4 A;  1I6H J;  1QVT A;  2R5Y A;  1IRZ A;  3LSG A;  1EF4 A;  3NAR A;  5C44 J;  2O7O A;  4D5F A;  3BT9 A;  2FQ4 A;  2JWT A;  3GTO J;  2HYJ A;  1WH5 A;  2XPU A;  1WGX A;  5F0C A;  4B4C A;  3GTP J;  5J1R A;  2CQQ A;  3L1P A;  2DTZ A;  1TWA J;  4FE4 A;  5M3M J;  2ME6 A;  5C4X J;  1MBE A;  3LSP A;  4AC0 A;  3JRI A;  2LKX A;  1B72 A;  2CU7 A;  3TW7 A;  1TWH J;  1GDT A;  5K7Z A;  3HOW J;  2CQX A;  2JA7 J;  4XID A;  2YU9 J;  4W97 A;  4CYC A;  3NAU A;  3JRH A;  4XRS G;  5M5W J;  3JR9 A;  2RAE A;  1S7E A;  1K61 A;  2KDZ A;  3K2A A;  2ME0 A;  5F27 A;  1ETQ A;  1TWF J;  4IHW A;  1HF0 A;  3H3V K;  1I50 J;  3PO2 J;  3S1N J;  1PUF A;  2WV1 A;  4I76 A;  5F04 A;  1VND A;  2EZL A;  2VKE A;  5EDN A;  3LNQ A;  2E2H J;  1POG A;  5E3L A;  3D1N I;  1ORK A;  3BQY A;  1JJ6 C;  1HDP A;  5E3O A;  2IEK A;  2XB0 X;  5C3E J;  1LFU P;  3GTM J;  1BW6 A;  2FX0 A;  4XRM A;  2NVY J;  3RQI A;  2G0E A;  4AUX A;  3IH2 A;  2R5Z B;  1X2M A;  1TC3 C;  4JX5 A;  2X9D A;  4B3A A;  1JKP C;  3F0C A;  1FIA A;  3TW6 A;  5EG0 A;  2ECB A;  3TED A;  2KT0 A;  2ECC A;  4DYQ A;  1U78 A;  4A3F J;  3WHB A;  5DTD A;  1I3Q J;  5EYR A;  4BY7 J;  2XSD C;  4ABZ A;  1GT0 C;  3JRE A;  2JA8 J;  4JX4 A;  1MSE C;  3HOU J;  2Y2Z A;  3K7A J;  4X6A J;  2L7Z A;  4A3I J;  3GTL J;  1MSF C;  4NDL A;  1IDY A;  3BR6 A;  2DMU A;  2EQR A;  2ZB9 A;  4W1U A;  1NTC A;  2COB A;  2E2I J;  1IG7 A;  4FE7 A;  3FIW A;  3BR3 A;  1JUS A;  5C4J J;  3JRA A;  1IGN A;  1DU6 A;  2EZK A;  4I6Z A;  5EF6 A;  2M0C A;  2MG4 A;  2DA1 A;  1OCP A;  1U9N A;  2OPT A;  1H8A C;  1UMQ A;  2XPV A;  4A3J J;  2HXO A;  2Y9Z A;  1R9T J;  4DYC A;  5IOY A;  2GBY A;  3G1O A;  5J1U A;  2R7Z J;  3DEW A;  5E3M A;  1JKQ C;  3S1M J;  1LE8 A;  1MBH A;  2CUE A;  5F1J A;  3OSF A;  1BW5 A;  2GLO A;  2CRG A;  3LSJ A;  4A3E J;  4MFD A;  3DCF A;  3GBG A;  2M2E A;  2N8G A;  4EEF G;  1IJW C;  2DA7 A;  3O8G A;  2CUF A;  3OSG A;  2X6O A;  2I10 A;  4M3G A;  3S17 J;  1RET A;  2R92 J;  2K9Q A;  5E3N A;  1IC8 A;  1NK3 P;  3RZO J;  2MGQ A;  3S16 J;  2TRT A;  2L9R A;  3W6V A;  3HBL A;  1VFC A;  3OOU A;  4LOC A;  5J1Y A;  5F0H A;  3JRB A;  3BG9 A;  3OIO A;  3S1Q J;  2DA6 A;  3QPS A;  1YRN A;  3ZQL A;  3JRC A;  1JT6 A;  3LSR A;  4MLO A;  2EBI A;  3CQZ J;  1H89 C;  1OJL A;  3PM1 A;  4AYB N;  1QPI A;  4CYC B;  2D5V A;  4DW6 A;  3O8H A;  3GTJ J;  1JKO C;  4BBS J;  4BXX J;  2W48 A;  4JX6 A;  3VPR A;  2R93 J;  1GV5 A;  3BTI A;  3FKI J;  3HOX J;  1APL C;  1JJ8 C;  2O9L A;  1UG2 A;  5HOD A;  1E3O C;  1T33 A;  4FIS A;  2NOG A;  1B8I A;  3BTC A;  3M3Y J;  3BTL A;  2WAQ N;  1IV6 A;  4UUS B;  2Y31 A;  4MO7 A;  5IYB J;  1JT0 A;  1WCM J;  4MFE A;  3ZQF A;  1MNM C;  1G2H A;  4QTR A;  2IBD A;  1P7I A;  3G1L A;  3HGY A;  2JA6 J;  5F08 A;  4A3C J;  4XK4 A;  2HQ5 A;  2M9H A;  4V2F A;  3HB9 A;  2DMQ A;  1QVU A;  2DN0 A;  5IOZ A;  2AHQ A;  1FEX A;  3BTJ A;  2YUS A;  1Z77 A;  1MBG A;  2ID3 A;  2LFB A;  1PUF B;  5JLW A;  5IYC J;  1ZKG A;  5EGO A;  2EZI A;  3BQZ A;  4QSH A;  1RR7 A;  1ITY A;  3SDG A;  1JGG A;  4J19 A;  1VI0 A;  2LVS A;  2VKV A;  1ETV A;  4XRS A;  3IV5 A;  1WH7 A;  1SAN A;  2XPW A;  4C3I J;  5GP9 A;  1ETO A;  1JUM A;  4X1E A;  9ANT A;  1FTZ A;  5J3L A;  1MH3 A;  5K7H A;  5K7F A;  2NVT J;  4BY1 J;  3WHC A;  5EZG A;  3BR2 A;  5IP7 J;  4A3B J;  3ZQG A;  1IUF A;  5IP9 J;  3RZD J;  5FKM A;  2LTP A;  2E2J J;  4A3D J;  4C2M J;  2VPR A;  2L7M P;  4M6V A;  3SJM A;  3BR5 A;  1X2N A;  2OF7 A;  2R5Y B;  2NVQ J;  3IH3 A;  2H8R A;  2R0Q C;  4M3B A;  3GTK J;  2MW8 A;  1MBK A;  2FJ1 A;  2P81 A;  4BBR J;  3B6C A;  3FIS A;  1A6I A;  3HM5 A;  1ETY A;  1BA5 A;  4L5E A;  2VI6 A;  3B6A A;  1O4X A;  1F36 A;  5FJ8 J;  3CMY A;  2JMW A;  3HDD A;  1DU0 A;  1JUP A;  3S1R J;  1W0U A;  1T56 A;  2L7F P;  1TWG J;  1VF9 A;  1U8B A;  1CQT A;  1UHS A;  1ZGW A;  5BNG A;  2M34 A;  3ZQI A;  2B63 J;  3JRG A;  3Q3S A;  1RES A;  4IHV A;  3G1M A;  3HGG A;  2AO9 A;  4RDU A;  1K83 J;  1Q1V A;  1ZR2 A;  1FTT A;  1AKH A;  1U9O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...