1K83J

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k83J00
1ETQA 3OIOA 1RPWA 4RDUA 1PUFB 1QPIA 3JRCA 1U9OA 3JRFA 2E1OA 1OCPA 5EZGA 1ETYA 3HDDA 1T56A 5F04A 5EGOB 4D5CA 5EDNA 2DMQA 4A3FJ 1TWFJ 4XRSA 2MGQA 3Q0VA 1JTXA 2IBDA 2EZHA 2JN6A 4IEJA 1HOMA 3HOZJ 3SJMA 3HBLA 3UKGA 1BJZA 3S1QJ 2O9LA 1OFCX 1UMQA 2K9SA 1FIPA 2W48A 5JLXA 1MSEC 4AUXA 2AO9A 2JWTA 1QRYA 1ZR4A 1HDDC 3OOUA 3ZQCA 2CU7A 3GTMJ 1WH7A 2K40A 3Q3SA 3SDGA 3RKQA 3IH4A 3D1NI 2VKVA 1LFUP 2XRLA 4X6AJ 4FTHA 3Q0UA 1ETOA 1FEXA 1DU6A 4UUSB 4XIDA 2E2IJ 2NS8A 3BR0A 5J1YA 1X2NA 3TW6A 4D5FA 4IHWA 3I4MJ 1LE8A 5M3FJ 4B3AA 3HOUJ 3W6VA 2B63J 1WI3A 2K9NA 1GVDA 3OSFA 2HXIA 2L9RA 2LP0A 3WHBA 4X1EA 1JKPC 3HOYJ 1GUUA 2JJ7A 2O8KA 2E19A 5F0CA 4M6VA 2ME0A 1MBFA 1GV2A 3DCFA 2WV1A 4V2GA 5EG0A 5FLVA 2R7ZJ 3MKLA 2HYJA 3SFIA 2FD5A 3HOWJ 2R93J 2FJ1A 3LSJA 5IP6A 4B1RA 1WCMJ 4A3MJ 1NK2P 4M3EA 2R0QC 3BR6A 1IUFA 3B6CA 4NDLA 3HKZN 1LE8B 3GTGJ 2M9HA 1CQTA 3JR9A 1ZQ3P 2X48A 1H88C 1IRZA 2X9DA 2IAIA 5F0HA 1H8AC 5E3NA 1T33A 3LNQA 3BR5A 2IEKA 1BL0A 3ZQHA 4JYKA 1I3QJ 4I76A 2LTPA 2CJJA 2VKEA 5M3MJ 1IG7A 3DEWA 4MO7A 2YU9J 2ECBA 5FKOA 1OJLA 4XRSG 5EG0B 4I6ZA 1ETWA 2EZKA 2ZB9A 1JJ6C 3L1PA 4CYCB 3I4NJ 3WHCA 1ZGWA 1DU0A 3G1MA 1TWGJ 3ZQGA 2JA6J 3K2AA 4Y7NJ 3PO2J 2E2HJ 1HLVA 4JX6A 1QVTA 3BQZA 4W1UA 4A69C 3ZOBA 2VI6A 3S1NJ 1IDZA 2OPTA 4D7MA 3HOXJ 3RQIA 4MIMA 5DTDA 1ITYA 3BR2A 5C3EJ 2XPUA 3LSRA 3A02A 1U8BA 1MBKA 4BBSJ 1RKTA 1U78A 2WB1N 2K9QA 1D5YA 2H8RA 2Y31A 1JT0A 1GT0C 3RZDJ 2XPWA 2L0KA 2LKXA 1XC5A 1WH5A 5F0FA 2TCTA 2HOTA 2HQ5A 1RKWA 3MN2A 2HXOA 3QPLA 4FE7A 1HCRA 3JRHA 5E3MA 2E2JJ 1VNDA 5BNGA 3ZQFA 2N8GA 5C44J 5M5XJ 2NVTJ 1O4XA 5GPAA 3S2HJ 4XK4A 3E7LA 4HNVA 4QIWN 4JP0A 2EBIA 2Y9YA 2R5YB 3HM5A 5JLWA 2DA5A 1HDPA 3PM1A 2WAQN 3TP3A 4CYCA 4DYRA 5EYRA 3GTQJ 2P81A 1ZR2A 4QTRA 4C3JJ 2CUFA 2LVSA 1JUMA 2LD5A 2NVXJ 1A6IA 3F0CA 2GLOA 5C4JJ 1JUSA 1R9TJ 1XG1A 3HGGA 1GV5A 1HF0A 3CDLA 4DYQA 1TWHJ 4IHYA 2AHQA 5J1UA 5K7ZA 2M0CA 2R5YA 3BT9A 1ENHA 3VPRA 1WGXA 2M2EA 3TW7A 4C2MJ 1H89C 4BKXA 2GBYA 3S15J 2LK2A 4A3CJ 1MH4A 2Y9ZA 2I10A 4J19A 2Y0SN 4A3DJ 5FKNA 1MNMC 3HEFA 3A03A 1MBJA 1Q1VA 5EEAA 5C4XJ 5E3LA 2JK3A 3QQAA 1Z77A 3JREA 1VI0A 4S0HB 4DW6A 3FISA 5M5YJ 4A3BJ 1OCTC 4DZJA 3H0GJ 5IOZA 2YUSA 5GPCA 2DMPA 2XGCA 3B6AA 3BR3A 4FE4A 2DMNA 4UUTA 3JRIA 1EF4A 3IH2A 4BXXJ 1MH3A 1UG2A 3BR1A 1BW6A 3FIWA 1MBHA 2XSDC 1MBGA 2EZLA 3TP0A 4BBRJ 2MSYA 1IJWC 3HGYA 3IV5A 5EZHA 3O8HA 5HODA 2HOSA 2DMUA 1JUPA 1U9NA 4M3FA 5F27A 2Y30A 5GP9A 1X58A 3CQZJ 4MLOA 5FKKA 3JRBA 1MSFC 2ME6A 4A3GJ 1S7EA 1JT6A 3FKIJ 3BQYA 4LOCA 3ZQLA 4C3HJ 5M5WJ 3PO3J 1UHSA 2RAEA 2XGEA 4IHVA 1ETVA 3OSGA 2R92J 5K7FA 2PMZN 1ETKA 2LY9A 2LR8A 2LFBA 2M8GX 2QF7A 2NVYJ 3S14J 2Y2ZA 3BTJA 5IYCJ 2OF7A 1IDYA 5IP9J 1A5JA 3HOVJ 3S2DJ 1IGNA 1AU7A 1APLC 2L7ZA 3BG9A 1SFOJ 1I6HJ 1AKHB 4A3IJ 2M34A 4JX5A 2EH3A 1JKQC 3IH3A 1K61A 3G1LA 2H1KA 2FQ4A 2NOGA 3GBGA 1JKOC 3TEDA 4Y52J 1FIAA 5J1RA 4A3EJ 3FK6A 1B8IA 5K7HA 1ZK8A 1WPKA 1NTCA 2XB0X 2DA3A 4DYCA 1ZKGA 3JRGA 4A3JJ 4EEFG 1VFCA 2CRGA 4W97A 3K7AJ 5FKMA 1TWCJ 1ORKA 4G12A 5EF6A 1GDTA 3JRDA 1BW5A 3GTPJ 2DA1A 4BY7J 9ANTA 4FCYA 3QPSA 2G0EA 1JKRC 2CQXA 1FTZA 1IV6A 1AKHA 3JRAA 1X2MA 4AC0A 4AYBN 2DA2A 1B8IB 2CUEA 2XPVA 2EZIA 4B4CA 2LLKA 3O8GA 4XRMA 1W0UA 1F43A 3NARA 4M3BA 1JGGA 4L5EA 3NAUA 1VF9A 2DMTA 1YRNA 2DTZA 1K83J 3BTIA 2CQQA 2R5ZB 2JMWA 3MVPA 1JTYA 3GTJJ 2NVQJ 2FX0A 3S1RJ 2ID6A 3GTLJ 3S16J 2XB5A 2DA4A 4MFEA 4C3IJ 4BY1J 4D7NA 5FKLA 3M3YJ 1B72B 2KDZA 3M4OJ 3RZOJ 5IYDJ 1TWAJ 1ZTRA 5IOYA 2X6OA 2HOAA 2D5VA 3BTLA 1F36A 4RBOA 3CCYA 4MFDA 1PUFA 2MG4A 2R5ZA 2JA7J 5F08A 1JJ8C 4M3DA 3LSPA 2JA5J 2HDDA 1G2HA 1SANA 3C2BA 4JX4A 2COBA 3HB9A 5E3OA 5IYBJ 1FTTA 3Q0WA 5DS9A 1RR7A 4IHXA 3H3VK 4DZPA 3A01B 1B72A 3G1OA 5IPAA 2GM4A 1MBEA 1P7JA 4A3LJ 2EQRA 1I50J 2ELKA 1ETXA 1W0TA 2ID3A 3BG3A 4FISA 4XICA 1E3OC 3S17J 4V2FA 3LOCA 2VUMJ 1XS9A 1FJLA 2DA7A 3CMYA 3GTKJ 5J3LA 1IC8A 2NS7A 4A93J 2JA8J 2DJNA 3BTCA 4A3KJ 2DN0A 1YRNB 4GFBA 1Z0XA 2ECCA 1Y1WJ 1TC3C 3BG5A 1RETA 4UUSA 3A01A 1BA5A 2TRTA 1QVUA 3ZQIA 4M3GA 2HI3A 3FK7A 4QSHA 3LSGA 3S1MJ 5FJ8J 5EGOA 1LFBA 2XGDA 5F1JA 1P7IA 2L7MP 2YS9A 3GTOJ 1POGA 1NK3P 1RESA 2MW8A 5FLMJ 1AHDP 5IP7J 4ABZA 2KT0A 2O7OA 2QCOA 2DA6A 2L7FP 2VPRA 1Y1VJ
chains in the Genus database with same CATH superfamily
2VQLA 3RYPA 2MA3A 2DT7B 3G3ZA 1BIAA 1RPWA 2DYRH 5B1BH 4NHJA 1U9OA 3JRFA 2E1OA 1OCPA 4NBQA 4U0YA 4F91B 4F52A 3W6JB 2YPRA 1SVLA 1T56A 1WJEA 5EGOB 3KZYA 1ZHFA 2DMQA 2CS3A 2J5PA 4K2EA 4XRSA 5JVGF 4A3FJ 2PJRA 4F92B 1JTXA 3DBHB 1X3UA 2EZHA 3A1YA 3AG1H 3P9IA 3WTWC 2HYGD 1RC9A 3I56I 1LNWA 2DPDA 2GXGA 2OAZA 3S1QJ 4Y15A 1BI2A 4ZJZA 1ZH5A 3SYTA 3CD6I 2ZKZA 1MSEC 4AU7A 4F7ZA 1ZARA 2DFEA 2QENA 3GTMJ 4GGGA 1FWZA 3J80Z 2R3SA 2Z3YA 1VTNC 3EYIA 5LRRA 3ESWB 1JXSA 2DAOA 2HWVA 3CCSI 4IRGA 3MD2A 1VZ0A 2HVRA 1IN5A 1KU2A 5L3EA 2JPBA 2NS8A 3BR0A 2BY0A 5FD5A 1BR4A 2ESHA 3RIRA 1X2NA 1IN4A 2GIZA 1QZZA 4HV5A 4LLGF 4M74A 3AG4H 1LB2A 2L4MA 2GA1A 1H9GA 3W6VA 1WI3A 2K9NA 2X6XA 4BHPA 2ISZA 1T0FC 1YOVB 1OCCH 2JJ7A 3OV8A 1BR1A 1D1CA 1P4AA 2E5NA 2M4GA 2Z5UA 4L9TA 2L3DA 3F8NA 2Q2EB 4Y17A 1WJFA 5KVRA 5J47A 1O3TA 4V2GA 3SZTA 2BGCA 1FMWA 4ZTJA 5ICEA 3R6SA 2F4IA 5HS8A 3MKLA 1HW2A 2HYJA 3SFIA 4RLFA 3E6BA 3HOWJ 3HPGA 3E0JB 5EEHA 3EUAA 3LSJA 3FX3A 5BS6A 4A3MJ 5DUKA 3V7RA 4NC8A 5KNLA 2R0QC 2O6GE 4NDLA 5ICCA 3IUOA 3O2PE 2O3FA 2NNYA 3DKWA 3OYKA 1L3LA 3CJQB 1ZQ3P 4R79A 4I01A 3OYIA 2DOFA 1FYKA 3I3LA 3HHHA 3CC2I 1SVMA 1S29A 2BW3A 3ABLH 3BR5A 4Q48A 3ZQHA 1I3QJ 2O0YA 4RB2C 2RKHA 2X6WA 3I9V2 4BH9A 4U88A 3BC8A 2A61A 3DEWA 3EDPA 3SFZA 2ECBA 5FLXK 2BE5F 4IRIA 2DBBA 1OJLA 4I6ZA 3GXOA 2LG4A 3L1PA 2DCEA 3I4NJ 2GA2A 4IQ4A 1EH8A 3WHCA 2QBYA 3G1MA 3ZQGA 1GHCA 2F48A 4HA8A 1D5VA 1MW7A 3PUBA 1OMIA 3KP2A 1AOYA 2E2HJ 1HLVA 4JX6A 1QVTA 3BQZA 4KMUX 4A69C 3ZOBA 3GF2A 2K9LA 3BCBA 5DTDA 1Y39A 3H0DA 1Y56A 2R7UA 3A02A 1U8BA 2G7HA 3OYEA 1RKTA 3H9QA 3ZQQA 4I7HA 2H8RA 2QKLB 4FT8A 2V9VA 2K85A 1QHHD 2HZTA 2KIUA 3WTUC 5LFAA 1GT0C 4XKBA 3KP6A 4PSWA 4ZDLA 1TQIA 2PLYA 1UELB 4ENJA 1CF7A 3LQQA 2EA4A 1D1AA 2LKXA 1R71A 5F0FA 1CGPA 3HYIA 2TCTA 2ELJA 3FBIB 3MN2A 4ZDPA 1HXDA 4AM3A 1J2XA 3QPLA 1MMSA 3CCMI 2E7WA 2VPLA 4LB6B 1SMTA 3ZQFA 1S72I 2E7XA 1KZHA 1O4XA 4KISA 3WU0A 4JQFA 3Q5FA 3DTKA 1G3SA 4CHUA 4QPOA 3CC7I 1U0JA 2P5KA 2Y9YA 2GXAA 1TTYA 2EA2A 4CCKA 2R5YB 1OR7A 3KZIC 1HBXG 1ZG1A 2DFFA 5EYRA 3GTQJ 4YIFA 3VSKA 2K4JA 4XONA 1HW5A 3WE3A 4OMZA 2EPFA 3IRQA 4PGHA 2V79A 2IA1A 2LY1A 1R22A 4U0WA 4C3JJ 4V19K 2IJLA 2LD5A 4QWQA 4UB6C 1KGSA 3ABMH 3VOEA 1GV5A 1HF0A 1RI7A 3CDLA 1TBXA 2XF7A 1R7JA 2AHQA 2CG4A 1NG6A 4IF4A 3MKYB 3N4MA 4QLCU 1OQYA 1KA8A 4GRIA 1H0MA 4YRVA 2H6BA 3VPRA 1MMDA 1T39A 2KP6A 2EFPA 3F9KA 3T0YA 2QUFA 3VDXA 3E6DA 1A31A 4C2MJ 1H89C 3S3NA 1BI1A 3V8JA 4JK1X 3VWBA 3FXKA 3L9FA 4A3CJ 4LG3A 2I10A 3U1KA 4J19A 2Y0SN 4XLAA 3F6OA 1MNMC 3BWGA 2MH2A 1Q1VA 5C4XJ 2R7TA 4A12A 1JE8A 3CO7C 3R4KA 4MEYF 2DT5A 2G7UA 5E8IA 2QGUA 2DYSH 3GLLA 3FISA 5M5YJ 2JVHA 4A6EA 3GZ5A 4L0YB 2VBZA 2YX7A 4KN7X 2DMPA 3OYAA 2XGCA 3W2AA 4FE4A 4UUTA 2DMNA 3TDZC 2WAFA 4CZCA 2LF8A 3G71I 4EQQA 1R6RA 2HVSA 2XSDC 1MBGA 1OLTA 3DPUA 2M7BA 2F4MB 2MLKA 3HGYA 2HFHA 5CVIA 1WWXA 5HODA 4KMFA 4E7KA 3IAS2 5H2FC 1JUPA 1U9NA 4M3FA 2Y30A 1YJWI 2QSGX 1X58A 5LHGA 2OZ6A 3BLYA 3JRBA 3S3OA 1IXRC 1BI0A 1UG0A 1MSFC 1SD7A 2DFHA 4IVNA 1JT6A 1B4AA 3GCMA 1ZELA 3BQYA 5ICFA 3ASNH 2A5YB 1Z9CA 1RIOH 1UHSA 2RAEA 3OOPA 2IVMA 2UZKA 3PIOF 4A6DA 2ZMEB 2LR8A 1TW3A 3C18A 4ZTFA 4O3MA 1HA8A 2NVYJ 3K1PA 2Y2ZA 3BTJA 1U5TA 5DCMB 3HZJA 1PP7U 3HOVJ 3VYSB 2QSFX 4UNOA 4CICA 1MKMA 1NHAA 3BG9A 2UXNA 2XHKA 4GYIA 2ZNZA 2XC7A 2Z99A 3J81K 2VBWA 1FIAA 5J1RA 4IQJA 4Q4ZF 4RB1A 1S7OA 1XGOA 1SFUA 3JRGA 3CCEI 4PSXA 1UHMA 3NWTA 3MZHA 4BQAA 2HZDA 2CRGA 1EJ9A 1ORKA 2ZMEA 1UJ8A 4ZZLA 1ZGJA 2HDCA 2ZMEC 3QODA 4FCYA 2F5EA 2G0EA 3QYBA 1UAAA 2CYYA 4C2UA 1IN7A 3KFWX 1G59A 2M5WA 3AG3H 3BG7A 4AYBN 1A36A 2EV0A 1VQ4I 4XRMA 2LLKA 2OU2A 3J7YJ 5F6FA 1Z7UA 2ZXIA 4KT5C 4PK4A 2VE8A 3V8LA 3FXJA 3JSOA 2DT6A 3BPVA 3HRMA 4ASNA 3CF2A 1VF9A 2DOAA 3GWZA 1YRNA 4G6QA 3BY6A 4BDZA 4FX0A 3BTIA 4G8XA 4EVIA 5GAEJ 2JMWA 2RQPA 3DXJF 1JTYA 3HRTA 2IGKA 2LOOA 2FX0A 2VIXA 4XSZF 1SD5A 3A0BC 4LLLA 4L5IA 4MFEA 4WCGA 4C3IJ 4ESFA 3O3KA 2WAEA 4B3XA 2D45A 3TQNA 1X4PA 3BJAA 2LBFB 3CESA 3M3YJ 4BACA 1DPUA 3FF5A 3RZOJ 1WI9A 3MZYA 2P5LC 4N9IA 4O5VA 5IT9Z 4AYBA 5IOYA 2BY1A 2BBYA 2X6OA 2HOAA 3CP8A 3N97A 2CQ7A 2ZFWA 2LYCA 2PG4A 2D1VA 4AVPA 4H0EA 4MFDA 1PUFA 1DPRA 2MG4A 2Y0MA 2GAUA 2QVOA 2WWYA 3K9TA 3UR3C 5HNFA 1R4MB 3IP4B 1SANA 3C2BA 5E3OA 2COBA 3HB9A 1ZLJA 3OL3A 4CCLA 3K4BA 4YELA 4OIRF 4CUGA 5HDNA 5DS9A 1QA6A 2M4KA 1TZLA 4Q5SF 1ZRFA 3JTGA 3OYBA 4N0BA 2IGOA 3ZPLA 1A04A 1W0TA 1R5GA 1FY7A 4BQNA 3OYCA 1P4XA 3Q9VA 3E97A 3MCZA 4XICA 1E3OC 3HTSB 1MDMA 3LOCA 4RAZA 2KJCA 1XMXA 1O7LA 1K79A 5DCFA 3AFHA 5HS7A 5J4VA 3JSPA 1WZ2A 4A93J 2DJNA 3KEQA 2FSWA 3HIFA 3ZMUA 3BG5A 4EM1A 2C6YA 4UY8I 2GIVA 4UUSA 2QYOA 1FSEA 2TRTA 5E1WA 1T95A 3F22A 4M9ZA 3TO9A 4ESBA 3CLQA 3FK7A 2FBHA 4QSHA 2A05A 3ZR8X 2AS5F 3I58A 2XGDA 3EUKL 4BE1A 1QGPA 3SEZA 2A68F 2W24A 1RESA 2LMDA 4HDUA 1R49A 2ZJ2A 1MDMB 1AHDP 3RI4A 2KT0A 1MMGA 5FROA 3J7AO 4EATA 4IOCF 3F72A 1BJAA 3FDYA 5L3CA 2VPRA 1WRJA 4LK1F 3C2GA 1Y1VJ 4ZYDA 3I59A 2DK5A 2BY2A 4CO8A 2RQQA 3QYEA 1ETQA 4AWXB 1QPIA 2W1OA 3K1NA 5ILVA 3HTUA 3HJEA 3GMEA 5HS9A 5E18F 5EZGA 1SD4A 1W5CC 2DW4A 4P5OA 1OKRA 3OYNA 4ZYHA 1XGNA 3LA2A 2V9KA 2V1UA 2DQLA 3Q0VA 3DF8A 3GLXA 4G94A 4HOBA 3WTXC 3OYDA 3K4JA 4IEJA 1HOMA 3ZGKA 2P4WA 1YFHA 4HAMA 5DDGA 5ILSA 4OU0A 2K9SA 4I0AA 3HPHA 3DU5A 2COMA 4AVZA 3E5XA 2HOEA 4AUXA 2AO9A 2X1CA 1ZR4A 1TL8A 3I5UA 5AIQA 1WH7A 2XKPA 3IH4A 3KYDB 2QLZA 2VJ4A 3D1NI 5ILUA 4J00A 3LFKA 2CV2A 3OR2C 2HR3A 1LFUP 3KP5A 2OZUA 3Q0UA 1ETOA 4HSTA 4WXCA 1U6GA 3MAJA 1R23A 4XIDA 4LG0B 3HUGA 3PNYA 1MMNA 3HOUJ 1YO5C 3ECHA 2B63J 1R4NB 2FUG2 2HXIA 5CVRA 2Z1DA 3WHBA 3CCQI 3HHGA 3HOYJ 1GUUA 4EMSA 5KHDA 5LRSA 4M6VA 1IN8A 1ZGAA 2ME0A 2ADUA 1WKMA 1SAUA 2JVGA 1XCVA 3PFYA 3RKYA 3KP7A 4E6KG 3P7NA 2LH9A 5FLVA 3CJRB 2R93J 5H6QA 1FOXA 1LUJB 2W7NA 3SQNA 2CW7A 4CZZA 2R7SA 4LITA 1NK2P 2QQ9A 2MABA 2V6EA 2CV1A 2QWWA 4RGSA 2W85A 3HKZN 4HZFA 3GTGJ 2M9HA 4XSXF 1T08B 1X3WB 1IRZA 3F8MA 3S93A 3E6CC 1VQ9I 1O57A 1H8AC 1RUNA 5CQGA 3LNQA 4BHBA 1OCZH 4JYKA 1REPC 3CTAA 1VQLI 2W25A 4F55A 1DQUA 1R1VA 3EYYA 2EZKA 4HBLA 3WG9A 1JJ6C 4ZC3A 3HG9A 2FRHA 1IF1A 4YIRX 1VQPI 3K2AA 1K78A 3WTYC 3WGGA 4E70A 3PO2J 3RPQA 1FC3A 1T0FA 2RV8A 2O8XA 3TL4X 4WK8F 4W1UA 3PJRA 4PZJA 1IDZA 2OPTA 4ANJA 3HOXJ 3RQIA 4PFOA 2MH9A 4OMYA 4Y33A 4RB0A 4PDKA 1IW7F 2XAFA 4A2UA 2XPUA 4DQ2A 2ZCWA 3R60A 1ACIA 1U78A 4RMNA 2K9QA 3G6EI 2DXIA 3FM5A 3MKZA 1QHGA 1D8KA 3RKXA 3GX4X 2Q2EA 2EWNA 4ZYAA 4R1HA 3RZDJ 1FOYA 1T6SA 1YW8A 4OWRB 4YIIA 4U87A 1N77A 4Q47A 3SZPA 3VODA 4XOTA 1BBYA 3LMMA 3MQ0A 1IUYA 1WH5A 5IT3A 1D3YA 2Z2SB 1W36D 3MKWB 2P7VB 2QQAA 3HC7A 2HXOA 4F93B 3A0HC 1HCRA 2IT0A 4OINF 1ZRCA 1VNDA 3ULQB 2N8GA 5C44J 4B48A 2NVTJ 4RB3C 4B44A 2MD5A 1XMKA 3VYUB 4XK4A 4ETSA 4HNVA 4QIWN 4RAFA 2CUZA 2JUCA 2PMZA 3VEPA 4CCJA 4XKCA 2NVUB 2BVLA 2DA5A 2VT3A 3KEOA 4CYCA 4DYRA 1G8XA 4E7IA 2H94A 2WY7Q 4B8XA 2LC2A 2P81A 2WAQA 1K6YA 2FNAA 4KNYA 3C2HA 3AKZA 3F6VA 4NUBA 1G3WA 1XGMA 1BC7C 2NRAC 4G9YA 2BOLA 3PQKA 2NVXJ 1BI3A 3F0CA 2HVQA 3K6GA 4EJWA 2XKOA 1MNEA 1R9TJ 1E2XA 3DQVC 3ONQA 2IS6A 5J1UA 4XLPF 1XD7A 5ICGA 2M0CA 1V3FA 2CFXA 2XVCA 5FO5A 3H9JA 2WBMA 1XDUA 2FMLA 1XTAA 4JBAA 1DP3A 4RA2A 3ZXSA 1T38A 3TOAA 3I54A 2MFZA 2GBYA 2K9MA 3QWLA 1U5TB 1QQIA 1CF7B 1W7PB 3S2WA 4LGWA 4FQGA 2IS4A 4KFCA 4XNFA 1N75A 5EEAA 2VQCA 3Q9SA 3DKYA 4N9HA 5E3LA 2JK3A 4HLYA 4NNJA 1Z77A 2WB1A 4P55A 1VI0A 3JREA 1YE9A 4D0PA 5EEGA 2GXBA 1YX3A 4BXFA 4MTEA 2DTRA 3COAC 4HV6A 5L3DA 5L3FA 1O3RA 3GVAA 2JZYA 3JRIA 2IGMA 3CJTB 1LVAA 1L0OC 2L5QA 3RSNA 1MH3A 1UG2A 2ZXHA 3DLLF 2BEOA 1BW6A 1OR7C 1VQKI 3K69A 3X2QH 3CCVI 4EV0A 1GXQA 4OIPF 1I1GA 1S9HA 1IJWC 2OC6A 3HSRA 3RKWA 1YYVA 2DMUA 3PFIA 5BQTA 2HPMA 2EINH 5F27A 1LDKB 1B59A 2PJPA 2XF5A 4NB5A 3LAJA 4EM2A 4LK0F 1Z91A 4LOCA 3U1DA 3ZQLA 5GAHJ 2CQNA 5M5WJ 2K4BA 3ROUA 2OTJI 3QP6A 1D0XA 4IHVA 1WJBA 2XGEA 4P96A 4BAYA 4FASD 3CMEI 3OSGA 2R92J 2OUMA 1AWCA 4GDFA 1EH6A 1Z21A 1ETKA 2LY9A 5DV5A 1V54H 5E20A 1S7AA 2EFQA 2A6EF 3C3WA 1DGWY 5IYCJ 1K4TA 2OF7A 1IDYA 5IP9J 2XAJA 1X1AA 3S2DJ 1IGNA 3DFGA 2LBFA 2A69F 1SFOJ 1I6HJ 1AKHB 2M34A 5KCMA 1JKQC 2H1KA 3G1LA 2NOGA 4U7BA 3TEDA 4DJAA 3QP5A 3FK6A 3OYLA 3TMOA 1ZK8A 1YIOA 1NTCA 2AQEA 2EV5A 3V42A 2X0LA 5CVVA 1D0YA 1EH7A 3BG6A 5E79C 3HXLA 4XLCA 3CCLI 5B66C 1Z05A 4YEJA 3ABUA 3K7AJ 5FKMA 1IAWA 1NG7A 4IJAA 5CQEA 3F8CA 4HX4A 4G12A 1GDTA 5JR3A 3JRDA 2JRMA 4FETA 2IXSA 2F5DA 1I5ZA 3M1CA 5F64A 4BY7J 4BS9A 4BDYA 4BE0A 3QPSA 3ZN1A 2CQXA 1QZYA 2QSHX 2E60A 3JW4A 4UHTA 5F1RA 1IV6A 5JHFA 2ZXJA 1PVEA 4O6JA 4CXFA 1ZG5A 2OCCH 1SD6A 2DA2A 4HNTA 4J01A 1QU3A 2LY2A 4B4CA 3WTVC 1W36C 3O8GA 1KONA 3NQOA 1D8JA 1F43A 2V4JC 6PAXA 1WJDA 3E1SA 1JHHA 1MJ9A 4M3BA 1J0RA 2ETHA 3EPZA 4L5EA 2XAQA 4ZH4F 2Y69H 4EJVA 2JUGA 2CQQA 3ABKH 2R5ZB 4ON0A 3H92A 2A5WA 3MVPA 4N4NB 2OQGA 3E5QA 2NVQJ 3B73A 5FFXA 4XOPA 4F3QA 2ID6A 1W1WE 4BL0B 2PMUA 5LGTA 2VL8A 5DCMA 2DA4A 1SAXA 1IV8A 1R00A 1IO2A 2R7VA 4E7JA 3M4OJ 4KITB 5IYDJ 2KJBA 4IL6C 5E8GA 2HGCA 4Y4RA 5HNHA 2D5VA 1KQ0A 1F36A 3WTTC 3I59B 3T8TA 3CCYA 2H09A 3RQ4A 4E7ZA 2D1HA 4WXDA 2R5ZA 2CFOA 1JJ8C 3VSLA 3LSPA 1LPQA 4XRFA 2VT2A 2HDDA 3GZ6A 3OIQA 5IY5H 5FFZA 4PJNA 1PYVA 5BPDA 1SEUA 3Q0WA 3DTEA 1ZN2A 3PL8A 4LLNA 2ISYA 4HPQA 1BR2A 1LQ1A 4II2A 1HKQA 2V9PA 3CUOA 4DZPA 3PSIA 3A01B 1WSUA 1B72A 5TISC 5IPAA 3OYJA 2ELKA 1ETXA 1E3HA 5LEJA 2VONA 1VQ6I 4BJ6C 5AIPA 1JHFA 4FISA 3KP4A 2M1BA 2V1XA 2IW5A 4LB5A 3S17J 2HTSA 1LEAA 4BUPA 3BDDA 2IP2A 2ICWG 5B5EC 1EKEA 5J3LA 1IC8A 2NS7A 2FBIA 2JA2A 2UV1A 2JA8J 1YRNB 3R0AA 4GFBA 2ECCA 5JI6A 1TC3C 2D2WA 1BC8C 2MC3A 1BOAA 2R7WA 3G4SI 3A01A 1P92A 4LMYA 5LGNA 3ZQIA 3FXRA 3CMAI 2IS2A 4L9VA 5EGOA 1P9QC 1LFBA 4C30A 3W2VA 1Z3YA 2P6SA 2MC4A 2XSJC 2YS9A 4AIDA 2PJRB 4ENNA 3H5NA 3NWSA 1NK3P 5FLMJ 1I3AA 1FOWA 3ABTA 2BHYA 4HYEA 3H35A 5E1XA 2DA6A 4BGDA 1V5FA 2ZSIB 3L2WA 1V55H 1E0EA 1J7KA 2A6TA 2KIQA 2FF4A 3OIOA 2F4OB 1YW7A 2HKXA 4EJUA 4RDUA 4LD5A 1PUFB 3JRCA 4MHGA 2UUZA 3SHFA 4KN4X 2KLOA 3DEUA 2KZGA 3HDDA 1FYMA 4XLHA 1LKXA 2YSRA 3G2BA 4D5CA 2ZBKA 1K7AA 2MGQA 3CCJI 1U2WA 2STWA 2FQ3A 3ML6A 4P9FA 3HOZJ 5AONA 2GOXB 4MQ9F 3TGNA 2M3AA 3HBLA 3UKGA 1O3QA 1OFCX 2WY8Q 1I39A 1B9MA 1FIPA 2HQRA 5D5UB 2W48A 1QO0D 2OTLI 3HOTA 2JWTA 1QRYA 2F5VA 3F3XA 1MGTA 2ZFUA 3OOUA 3ZP5A 3H5AA 2NS0A 4BE2A 2K5CA 3Q3SA 3SDGA 3OMYA 2FMYA 1WJ5A 2VKVA 2XGXA 4FTHA 4X6AJ 1S5LC 1DU6A 4NQWA 1W4MA 4UUSB 2NAZA 4IHSA 2E2IJ 2OBPA 5D5WB 4CYDA 5HVQC 4ESJA 3QRFF 4UB8C 3BCAA 1LJ9A 4UV9A 3TW6A 3I4MJ 4IHWA 1LE8A 5M3FJ 4B3AA 1PUEE 2O5RA 3LSMA 4HEA2 1OCRH 3ZRGA 3OSFA 3MZ8A 4OAYA 2DU9A 3TO6A 2H8WA 2KIFA 3A2KA 1MJBA 2AXTC 1JKPC 2Q0OA 2DK8A 2WTEA 2E19A 5F0CA 3ZMZA 5CYVA 1MBFA 1GV2A 1EV7A 1PDNC 2V7FA 3ZMSA 2PFBA 2V6CA 2EILH 2FD5A 3DTIA 4E7HA 3OIPA 4PJJA 5IP6A 4AIKA 4B1RA 4IRHA 2K3FA 2R7QA 1TQPA 3BZ6A 3BR6A 3WGIA 1R5ID 1IUFA 1Z6TA 2RC4A 3MEXA 4BNCA 1ONVA 2KKOA 2VASA 1LE8B 1YX5A 3ZMDA 2IAIA 1J9IA 1IRGA 4IO9F 3OYFA 4YFNF 5F0HA 1FSHA 2L7KA 3GEZA 5E3NA 2IEKA 4XR6A 1UHWA 4U0VA 3K4CA 2CJJA 2VKEA 5M3MJ 4BYYA 2YU9J 4MO7A 3CCUI 3OS2A 2K02A 3CF5F 4DOZA 2ZB9A 1G4DA 4CYCB 1Y0UA 1S8NA 1ZGWA 1DU0A 3CO6C 4G7OF 2CW8A 4UVCA 3LSHA 2VBYA 5D6EA 2ZJRF 3NRVA 2Z9OA 3HRSA 1ZLKA 1J09A 2E1NA 3VFZA 3PUFA 4IX7A 2VQHA 4B09A 2VI6A 2GQQA 3RTRA 2BW3B 3MFKA 4LG0A 3ZN0A 4D7MA 1YHQI 1R1UA 1XMAA 2F5FA 3K1MA 1YJNI 3BR2A 1ITYA 5LEKA 2L02A 4BBSJ 2BXZA 5A2QZ 2XAHA 1D5YA 1DP7P 1HSJA 2Y31A 3CUQA 2EIMH 4I0BA 1KU9A 1JT0A 1DDNA 4KIGA 2JSPA 2QQ8A 4XQFA 2XRNA 4A0XA 4HQEA 4HX7A 1NH3A 2QBYB 2Y0SA 4D1QA 1QBJA 2VJJA 4ZZDA 3MWMA 4M6YA 4HF2A 1X4OA 2JPCA 3WTSC 2L0KA 3KEYA 5GAGJ 1LVKA 4Z6YA 2FU4A 2HOTA 2M8EA 2PN6A 2HQ5A 1MJAA 1USTA 1RKWA 2VC1A 2O8KA 2LDUA 4EM0B 4FE7A 4CDGA 2WV0A 3W2WA 5CKTA 5LBQA 2E2JJ 5BNGA 2FOWA 1T2KA 4MTDA 1W5TA 5M5XJ 3IRRA 3AL0B 3CUQB 2F5CA 3R61A 5GPAA 3S2HJ 3E7LA 2OQRA 5H6RA 4JP0A 3I4PA 3BOQA 4YFKF 1XCBA 2EBIA 2HTJA 2OV7A 3FMRA 3QPTA 2XROA 1JGSA 3LSIA 1J5YA 1WHUA 1KYZA 1V5GA 5JLWA 1D1BA 2F2EA 3FZVA 2XIGA 2GOMA 4A5NA 3K0LA 5HLHA 1IRFA 3H3ZA 3M9AA 4GO1A 3TOBA 3M7GA 1A35A 3FWEA 3W3CA 2PMHA 1MNDA 4BEHB 2CUFA 1JUMA 1R1TA 2Q1ZB 2HDWA 1MD0A 4M71A 1JUSA 5C4JJ 1XG1A 1FBUA 1XB4A 1YS6A 5J40A 4BU2A 4G7HF 2XAGA 5DYMA 1TWHJ 4IHYA 2CUJA 4XLFA 3K4LA 4UVAA 2R5YA 3DLAA 3QYFA 3W6KB 3BT9A 1ENHA 4OIQF 1TNTA 4WX9A 3TKYA 4IXAA 2JTVA 2HQNA 3KYLA 1RZ4A 4LIUA 1A6QA 2DLLA 3FMSA 3H1CA 5DD8A 2ZJQF 4BJ5C 3TW7A 2CMPA 3F23A 4BKXA 5FB2A 4RGRA 2DI3A 2LK2A 1XDSA 2KL4A 2ZO4A 1MH4A 2L2OA 2FA5A 2XAUA 1X19A 4A3DJ 2DODA 3M8FA 3GFMA 3HEFA 2XUBA 3A03A 1MBJA 2FXAA 1RNLA 4I99C 2NXNB 1U3EM 3FXQA 2IS1A 1OYWA 5FD6A 3QQAA 1J59A 3LWFA 5E17F 5TJJA 1OCOH 2DO7A 1LDJA 3M8JA 4EGYA 1OCTC 4UVBA 3H0GJ 1WVRA 5IOZA 3OS0A 4XKVA 2M87A 2EIKH 5CVUA 2E35A 3B6AA 5IT9K 1HKTA 2Z33A 3DPTA 1EF4A 2ELHA 1YJ9I 3IH2A 4BXXJ 1LFPA 1EA3A 2ZXWH 4JOMA 3FXUA 3J7AY 3S8PA 3BR1A 1MBHA 2NNNA 4L0ZB 1TP4A 2EZLA 3D5LA 4HRIA 3H36A 4EJOA 2LKPA 3TP0A 4BBRJ 4ENMA 2VXDA 2VOPA 5EZHA 3BZCA 5LHIA 2HOSA 3V7CA 4HF0A 2HEOA 3CQZJ 3PIPF 2CO5A 2ESNA 5D4RA 3K70C 1FOKA 4EJTA 5B1AH 3FBNB 2IPQX 4C3HJ 5DD4A 3PO3J 2ZSHB 1ETVA 2B7EA 1TT0A 4KJZA 1ZREA 2VJIA 5K7FA 2QKMB 3L2QA 4P1WA 2PMZN 2HQAA 2M8GX 1X1CA 5JFRA 1X1BA 2MD0A 3L09A 3N05A 2HPIA 2YR2A 4OOIA 1X1DA 3CZ6A 4HQMA 2E1MC 2E5ZA 1W7PA 4PGGA 4A0YA 1F4KA 2HU9A 3QAHA 4JX5A 2EH3A 1HKSA 2FQ4A 3GBGA 3KIOA 1BN5A 1TLHB 1JKOC 4RM2A 4A3EJ 1O3SA 1B8IA 4GXOA 5K7HA 2YX4A 4KDPA 2VXZA 3FMQA 4DYCA 1ZKGA 2M7AA 3FM3A 4UXNA 4EEFG 2R7FA 2M0MA 3GFLA 1VFCA 1OYIA 3ZMVA 2E34A 3QOPA 5EF6A 1KYWA 5BOXA 4XLNF 1OISA 3GTPJ 3BJ6A 9ANTA 3CC4I 3IHUA 4XMYA 1JKRC 4C2TA 3VYTB 3I71A 3M1EA 1FTZA 4QPQA 3K70D 1U8RA 2VODA 5HLTA 3ERMA 2HYFA 3PSFA 4AC0A 3KPHA 1B8IB 4LJZF 1F1ZA 2EZIA 1R58A 3C7JA 3T5XA 1VQ8I 2O03A 2AXLA 4HNUA 1R5HA 2JT1A 1YW9A 1JGGA 3ELKA 2NYXA 2X1EA 5KAFC 1FBQA 3KYCB 3NAUA 3I0TA 2X1DA 1UZCA 3HRUA 3K2ZA 2W00A 1FT9A 2H27A 3JCUC 1DUXC 3RCOA 2PEXA 2PI0A 2QM3A 5HLGA 2ZJPF 1BOBA 3GTJJ 2KISA 2L01A 5JVTA 3DBLB 3S1RJ 4HG2A 2I5UA 3LL7A 3S16J 4PJMA 1TW2A 3IC7A 4FX4A 4L9JA 4D7NA 3KE2A 3ERED 2MLGA 2LRDA 2KDZA 1T8IA 1TWAJ 1ZTRA 3L2VA 1Z67A 2MBFA 4PUSA 1OYYA 2R4GA 3EETA 1Y0NA 2P6TA 1FBSA 1ULYA 1Y8QB 3PNVA 2JA5J 4XL9A 3FXLA 4JX4A 3FXOA 5IYBJ 3CUQC 1UB9A 1RR7A 3J80K 1HW1A 5A2QK 1YI2I 4KICA 3G1OA 2GM4A 4A3LJ 2EQRA 1RR8C 2KRFA 1SVOA 4I98B 4WWCA 1MMAA 3BG3A 3LFUA 1VQ7I 4Y3OA 2E71A 2O61A 3CCRI 4HF1A 3ZMTA 2H6CA 2BYVE 4V2FA 3HL2A 5ED4A 5KK1A 3ZCOA 1WQ2A 2P5VA 1FJLA 3CMYA 3GTKJ 3H9GA 5GTHC 1XSXA 1H9TA 4X0GA 2L54A 4A3KJ 2DN0A 4AD9A 1Z0XA 2RNJA 2XF6A 1XN7A 2L9VA 2DPUA 2DDBA 2EJRA 4Y13A 3S1MJ 2FOKA 1STZA 2HI3A 5FJ8J 3KX2A 1G3TA 1Y8RB 4MNUA 2X85A 2RDPA 5F1JA 4BHCA 1P7IA 1Z7LA 2L7MP 4FHTA 3GTOJ 3SZGA 2K3PA 5IP7J 5HDGA 2P8TA 3KLNA 5J8FA 1I27A 2O7OA 3OYMA 2QCOA 2Y75A 2L7FP 4M73A 1I6XA 4E7LA 2EIJH 3E6MA 4CCNA 5D6FA 2VQGA 3DEEA 2DFIA 3FHNA 4G6TB 2FE3A 1KU7A 1Z3XA 1X1PA 1ETYA 2A6HF 4KA4A 3VB2A 2W84A 2BHZA 4L5JA 5F04A 3ZQ7A 5EDNA 2XV4S 4M9XA 1V5EA 3P9CA 1TWFJ 4XKWA 3DP7A 2ZNYA 2IBDA 3H3UA 4GCVA 5L3GA 2JN6A 2KRHA 4H4KC 1IZ1A 4RLQA 4LIVA 2VOOA 2KQRA 1S3JA 4DGWB 1QNTA 3SJMA 1BJZA 2O9LA 3JAMK 1UMQA 1S6LA 2KPMA 2MYSA 5JLXA 3BZKA 3S32A 1ZYRF 3M8EA 4CCMA 1HDDC 2H1LA 2VKDA 4MEXF 3ZQCA 2CU7A 4B47A 3QOEA 4N4OB 4E4HA 2K40A 3OYGA 3D0SA 1SC7A 2V1NA 3RKQA 1FP1D 2KFDA 1FLIA 3LSTA 3VYRB 2XRLA 4YFXF 5LGUA 1FEXA 5K5QA 4UUVA 4KIFA 4IPAA 2V1DA 1BIBA 1DGRM 1U5TC 4G7ZF 2W82A 2RNGA 5CPRB 5J1YA 4IZZA 1V4RA 4D5FA 2Q8KA 1XX5A 3IAM2 1Q1HA 1GVDA 3RDIA 4P9UA 2L9RA 2LP0A 3PNTA 3K4KA 3T1BA 4X1EA 1LDDA 1Z6RA 1VQ5I 3DCFA 2WV1A 3KZZA 1FZPB 2UXXA 5EG0A 2BVMA 4HW0A 2WA0A 5DUIA 1YG2A 2R7ZJ 1I1SA 5HOOA 2GWRA 1VQOI 2FJ1A 3EUHA 2KIMA 1N78A 3U2RA 1WCMJ 1XSVA 2RGVA 2M45A 4M3EA 4PJ0C 4BJTA 3B6CA 3S3MA 3GFJA 3GZNB 1MIJA 2IGNA 1CQTA 3JR9A 1JI8A 2X48A 1H88C 2X9DA 4Z2YA 3ISPA 4RS8A 1ERDA 2VKHA 2X6YA 3CLOA 2K86A 1T33A 1GLNA 4D9JA 3OYHA 1BL0A 4I76A 2LTPA 3JTHA 1IXCA 2W4SA 4WXHA 1IG7A 2R7OA 1F5TA 5FKOA 2DQRA 1YLFA 1AA7A 1ODDA 3BPXA 1ETWA 1MZBA 3R0JA 4M6XA 4XRSG 4XN0A 1N25A 1UCRA 1WJCA 4ZYEA 1TWGJ 3F21A 2EK5A 2M30A 3U9GA 4Y7NJ 2BY3A 2JA6J 1YIJI 4PJLA 3WU1B 1TT5B 2QZ8A 4IOAF 5LD2C 3H5RA 4BEHA 4NQWB 2W57A 2VLAA 2L9SA 3S1NJ 1R36A 4XBFA 4BXUA 4MIMA 5HLIA 4IHTA 2PBIA 1QZEA 5C3EJ 3SDBA 4HDVA 5J6XA 3LSRA 1MBKA 3E5UA 2FNPA 3L2CA 2WB1N 3BROA 4OIOF 1YTYA 1USSA 3IWFA 3O6BB 5TGTA 4LFUA 1X3ZB 3J81Z 1W7PD 2VBXA 1UFMA 2G9WA 2XPWA 5E1ZB 3M07A 2IRFG 3A4CA 5D8KB 1M1EB 1K78B 3L2UA 4M72A 3HKZA 3DWLE 2HS5A 1KQ9A 5ERIA 1XC5A 3RYRA 1KU3A 2QEXI 2F6CA 4IKFA 1G3YA 4CGZA 2R7RA 2RREA 4YG2F 4S05A 2LNBA 3GUDA 4CA0A 3JRHA 5E3MA 5KAIC 4RGXA 3FKJA 3B02A 2LF7A 1RRJA 1QPMA 3BP8A 2KHMA 2V26A 2VC0A 5DM7F 3HM5A 1IRXA 5JHUA 4AIJA 1HDPA 3PM1A 2WAQN 2B9SA 3TP3A 2LREA 2PX9A 4I09A 3GYHX 3V7SA 3NEUA 4RAYA 3QPHA 3K4MA 4UV8A 5EJCA 5BMZA 1B9NA 4TV7A 1F9NA 1ZR2A 5FRNA 2EV6A 4QTRA 4BQOA 2LVSA 2TDXA 3V4GA 1A6IA 3D5SC 2GLOA 1VQMI 3ASOH 4DNCA 3HGGA 3AG2H 1XGSA 2JRTA 5D5XB 4DYQA 2J5OA 3RJPA 2DOEA 5K7ZA 2LKSA 5HDKA 1K4SA 4RAGA 3I64A 2QQBA 1ZAOA 1ON1A 1WGXA 2WADA 3WE2A 2M2EA 2RVCA 4L9NA 1C0WA 3WTZA 4WF2A 3S15J 1WJAA 2RN7A 3J7ZI 3LAPA 3GW2A 2Y9ZA 5D5VB 2K7LA 5FKNA 1G6NA 4S04A 1FNNA 3REOA 2HNHA 3EQLF 4DIQA 4XORA 4S0HB 3C1DA 2GZWA 4DW6A 1XSDA 4A3BJ 4BQQA 3SEQA 2L4AA 4DZJA 5J8CA 3L2RA 5K1YA 4HSRA 2E1MB 2YUSA 5GPCA 3TDUC 2JSCA 1PP8F 1P4WA 3BR3A 3LA7A 2ZC2A 3CDIA 2XDVA 1SFXA 1ON2A 3OR1C 3DU6A 3GO5A 2CW0F 2DDAA 2CQKA 4M9SA 4G6DA 3FIWA 2I8DA 1B6AA 2NOJB 3LQRA 4CSWA 1TNSA 1YQAA 1YS7A 3WG7H 2MSYA 3P9KA 3IV5A 3O8HA 3E3VA 3BJOA 2P7CB 3K10A 3CDHA 3DBRB 4I02A 2X4HA 2EFNA 5CLSA 5GP9A 3L7WA 4MLOA 3TO7A 5K5RA 3OL4A 5FKKA 3SXYA 2ME6A 4MGRA 4A3GJ 1S7EA 3WGHA 3CP2A 3FKIJ 1FMVA 3GFIA 3I53A 2B0LA 3KP3A 1E3PA 4B43A 1IN6A 3HSFA 5K5OA 1SMYF 2Y48A 2A07F 2LFBA 2R7XA 2EB7A 2QF7A 2VE9A 1GXPA 3S14J 3RPUD 4KUMA 1A5JA 1AU7A 3L00A 1APLC 2L7ZA 2X51A 3CMMA 4XLEA 4A3IJ 4EGZA 3D5RC 3IH3A 1K61A 3F8BA 1PJRA 4Y52J 1GVJA 2PQ8A 5FLXZ 1WPKA 4L18B 2XB0X 4ZDOA 2DA3A 2BZTA 5LHHA 4II3A 4A3JJ 3IWZA 1IXSB 4PCQA 4W97A 2EFOA 2A3SA 2LSOA 1TWCJ 4XM3A 3F8FA 2ACJA 1BW5A 4DBRA 4GYGA 4PFPA 2BV6A 2UWMA 5LLQA 1BM9A 4NC7A 5DEQA 2DA1A 2R7DA 4KYWA 3HOSA 3DKXA 5H20A 3RPUA 1O7FA 1ZRDA 4RM3A 5D4SA 2VB6A 3KETA 2KZVA 1AKHA 3JRAA 2CH0A 2E1CA 2VN2A 1X2MA 4KIBA 2Z16A 2KDOA 2CSOA 2CV0A 2P0WA 3G73A 1FPQA 2CUEA 2XPVA 1W0UA 1HSTA 4ITVA 3OY9A 3LSKA 1SFKA 5FGMA 3FXMA 3NARA 4DBQA 1W5SA 3WU2C 1RUOA 2DMTA 2OD5A 2DTZA 1K83J 5DM6F 2DJIA 3DPLC 3U21A 1KQ8A 3TBIA 1FP2A 2OJED 1J75A 4AIHA 3T8RA 3GTLJ 1HC8A 1B1BA 1WFXA 3PQJA 5D8LB 1TQMA 3KCCA 4C9YA 4HLXA 2XB5A 5CVJA 2CGPA 4BY1J 1FX7A 1Z1DA 2BXYA 1OPCA 2STTA 5FKLA 3OS1A 4KT6A 1B72B 1VQNI 2JQ7A 1ZG3A 3OWTA 4A5MA 3KLOA 2FEZA 4MQVA 2OCEA 4OAZA 3BTLA 1LEBA 4RBOA 4I2OA 4RGUA 1FYLA 1E17A 2AQFA 3FHZA 3V8KA 2JA7J 5F08A 2E36A 4M3DA 1SFEA 4CCOA 2EFWA 1G2HA 2OA4A 5BPIA 3HSEA 2IA2A 1FTTA 5L3BA 1Y6IA 2YU3A 3H3VK 5J4YA 4IHXA 5GTIC 3WODF 5B3SH 2XASA 1P2FA 1MBEA 1P7JA 1I50J 3QU3A 2ID3A 4R8HA 3AAFA 3AL0C 3K4NA 4HX8A 1YITI 1P6RA 5TRDA 2KRCA 1T98A 2IA0A 2VUMJ 3P5JA 1HQCA 1XS9A 3IL2A 3JAMZ 2DA7A 1D0ZA 4E7SA 3I55I 3QU6A 3BTCA 3DV8A 5CJ9A 4A0ZA 1Y1WJ 3IKVA 1RETA 2CWEA 1BA5A 4ZYGA 1XPXA 1QVUA 3UNGC 4M3GA 3CJNA 3HUGB 3LSGA 5GADJ 4NC6A 2WC2A 2HKOA 1K6OA 1POGA 2KMUA 4ENKA 2MW8A 5FRMA 3EUHC 2L9NA 4ABZA 3ECOA 2K27A 3LA3A 4XN3A 2QA4I 3IKTA 3MMYB 4CH7A 2FBKA 5EG0B 2VJ5A 4U7DA
chains in the Genus database with same CATH topology
1ETQA 3OIOA 1RPWA 4RDUA 1PUFB 1QPIA 3JRCA 1U9OA 3JRFA 2E1OA 1OCPA 5EZGA 1ETYA 3HDDA 1T56A 5F04A 5EGOB 4D5CA 5EDNA 2DMQA 4A3FJ 1TWFJ 4XRSA 2MGQA 3Q0VA 1JTXA 2IBDA 2EZHA 2JN6A 4IEJA 1HOMA 3HOZJ 3SJMA 3HBLA 3UKGA 1BJZA 3S1QJ 2O9LA 1OFCX 1UMQA 2K9SA 1FIPA 2W48A 5JLXA 1MSEC 4AUXA 2AO9A 2JWTA 1QRYA 1ZR4A 1HDDC 3OOUA 3ZQCA 2CU7A 3GTMJ 1WH7A 2K40A 3Q3SA 3SDGA 3RKQA 3IH4A 3D1NI 2VKVA 1LFUP 2XRLA 4X6AJ 4FTHA 3Q0UA 1ETOA 1FEXA 1DU6A 4UUSB 4XIDA 2E2IJ 2NS8A 3BR0A 5J1YA 1X2NA 3TW6A 4D5FA 4IHWA 3I4MJ 1LE8A 5M3FJ 4B3AA 3HOUJ 3W6VA 2B63J 1WI3A 2K9NA 1GVDA 3OSFA 2HXIA 2L9RA 2LP0A 3WHBA 4X1EA 1JKPC 3HOYJ 1GUUA 2JJ7A 2O8KA 2E19A 5F0CA 4M6VA 2ME0A 1MBFA 1GV2A 3DCFA 2WV1A 4V2GA 5EG0A 5FLVA 2R7ZJ 3MKLA 2HYJA 3SFIA 2FD5A 3HOWJ 2R93J 2FJ1A 3LSJA 5IP6A 4B1RA 1WCMJ 4A3MJ 1NK2P 4M3EA 2R0QC 3BR6A 1IUFA 3B6CA 4NDLA 3HKZN 1LE8B 3GTGJ 2M9HA 1CQTA 3JR9A 1ZQ3P 2X48A 1H88C 1IRZA 2X9DA 2IAIA 5F0HA 1H8AC 5E3NA 1T33A 3LNQA 3BR5A 2IEKA 1BL0A 3ZQHA 4JYKA 1I3QJ 4I76A 2LTPA 2CJJA 2VKEA 5M3MJ 1IG7A 3DEWA 4MO7A 2YU9J 2ECBA 5FKOA 1OJLA 4XRSG 5EG0B 4I6ZA 1ETWA 2EZKA 2ZB9A 1JJ6C 3L1PA 4CYCB 3I4NJ 3WHCA 1ZGWA 1DU0A 3G1MA 1TWGJ 3ZQGA 2JA6J 3K2AA 4Y7NJ 3PO2J 2E2HJ 1HLVA 4JX6A 1QVTA 3BQZA 4W1UA 4A69C 3ZOBA 2VI6A 3S1NJ 1IDZA 2OPTA 4D7MA 3HOXJ 3RQIA 4MIMA 5DTDA 1ITYA 3BR2A 5C3EJ 2XPUA 3LSRA 3A02A 1U8BA 1MBKA 4BBSJ 1RKTA 1U78A 2WB1N 2K9QA 1D5YA 2H8RA 2Y31A 1JT0A 1GT0C 3RZDJ 2XPWA 2L0KA 2LKXA 1XC5A 1WH5A 5F0FA 2TCTA 2HOTA 2HQ5A 1RKWA 3MN2A 2HXOA 3QPLA 4FE7A 1HCRA 3JRHA 5E3MA 2E2JJ 1VNDA 5BNGA 3ZQFA 2N8GA 5C44J 5M5XJ 2NVTJ 1O4XA 5GPAA 3S2HJ 4XK4A 3E7LA 4HNVA 4QIWN 4JP0A 2EBIA 2Y9YA 2R5YB 3HM5A 5JLWA 2DA5A 1HDPA 3PM1A 2WAQN 3TP3A 4CYCA 4DYRA 5EYRA 3GTQJ 2P81A 1ZR2A 4QTRA 4C3JJ 2CUFA 2LVSA 1JUMA 2LD5A 2NVXJ 1A6IA 3F0CA 2GLOA 5C4JJ 1JUSA 1R9TJ 1XG1A 3HGGA 1GV5A 1HF0A 3CDLA 4DYQA 1TWHJ 4IHYA 2AHQA 5J1UA 5K7ZA 2M0CA 2R5YA 3BT9A 1ENHA 3VPRA 1WGXA 2M2EA 3TW7A 4C2MJ 1H89C 4BKXA 2GBYA 3S15J 2LK2A 4A3CJ 1MH4A 2Y9ZA 2I10A 4J19A 2Y0SN 4A3DJ 5FKNA 1MNMC 3HEFA 3A03A 1MBJA 1Q1VA 5EEAA 5C4XJ 5E3LA 2JK3A 3QQAA 1Z77A 3JREA 1VI0A 4S0HB 4DW6A 3FISA 5M5YJ 4A3BJ 1OCTC 4DZJA 3H0GJ 5IOZA 2YUSA 5GPCA 2DMPA 2XGCA 3B6AA 3BR3A 4FE4A 2DMNA 4UUTA 3JRIA 1EF4A 3IH2A 4BXXJ 1MH3A 1UG2A 3BR1A 1BW6A 3FIWA 1MBHA 2XSDC 1MBGA 2EZLA 3TP0A 4BBRJ 2MSYA 1IJWC 3HGYA 3IV5A 5EZHA 3O8HA 5HODA 2HOSA 2DMUA 1JUPA 1U9NA 4M3FA 5F27A 2Y30A 5GP9A 1X58A 3CQZJ 4MLOA 5FKKA 3JRBA 1MSFC 2ME6A 4A3GJ 1S7EA 1JT6A 3FKIJ 3BQYA 4LOCA 3ZQLA 4C3HJ 5M5WJ 3PO3J 1UHSA 2RAEA 2XGEA 4IHVA 1ETVA 3OSGA 2R92J 5K7FA 2PMZN 1ETKA 2LY9A 2LR8A 2LFBA 2M8GX 2QF7A 2NVYJ 3S14J 2Y2ZA 3BTJA 5IYCJ 2OF7A 1IDYA 5IP9J 1A5JA 3HOVJ 3S2DJ 1IGNA 1AU7A 1APLC 2L7ZA 3BG9A 1SFOJ 1I6HJ 1AKHB 4A3IJ 2M34A 4JX5A 2EH3A 1JKQC 3IH3A 1K61A 3G1LA 2H1KA 2FQ4A 2NOGA 3GBGA 1JKOC 3TEDA 4Y52J 1FIAA 5J1RA 4A3EJ 3FK6A 1B8IA 5K7HA 1ZK8A 1WPKA 1NTCA 2XB0X 2DA3A 4DYCA 1ZKGA 3JRGA 4A3JJ 4EEFG 1VFCA 2CRGA 4W97A 3K7AJ 5FKMA 1TWCJ 1ORKA 4G12A 5EF6A 1GDTA 3JRDA 1BW5A 3GTPJ 2DA1A 4BY7J 9ANTA 4FCYA 3QPSA 2G0EA 1JKRC 2CQXA 1FTZA 1IV6A 1AKHA 3JRAA 1X2MA 4AC0A 4AYBN 2DA2A 1B8IB 2CUEA 2XPVA 2EZIA 4B4CA 2LLKA 3O8GA 4XRMA 1W0UA 1F43A 3NARA 4M3BA 1JGGA 4L5EA 3NAUA 1VF9A 2DMTA 1YRNA 2DTZA 1K83J 3BTIA 2CQQA 2R5ZB 2JMWA 3MVPA 1JTYA 3GTJJ 2NVQJ 2FX0A 3S1RJ 2ID6A 3GTLJ 3S16J 2XB5A 2DA4A 4MFEA 4C3IJ 4BY1J 4D7NA 5FKLA 3M3YJ 1B72B 2KDZA 3M4OJ 3RZOJ 5IYDJ 1TWAJ 1ZTRA 5IOYA 2X6OA 2HOAA 2D5VA 3BTLA 1F36A 4RBOA 3CCYA 4MFDA 1PUFA 2MG4A 2R5ZA 2JA7J 5F08A 1JJ8C 4M3DA 3LSPA 2JA5J 2HDDA 1G2HA 1SANA 3C2BA 4JX4A 2COBA 3HB9A 5E3OA 5IYBJ 1FTTA 3Q0WA 5DS9A 1RR7A 4IHXA 3H3VK 4DZPA 3A01B 1B72A 3G1OA 5IPAA 2GM4A 1MBEA 1P7JA 4A3LJ 2EQRA 1I50J 2ELKA 1ETXA 1W0TA 2ID3A 3BG3A 4FISA 4XICA 1E3OC 3S17J 4V2FA 3LOCA 2VUMJ 1XS9A 1FJLA 2DA7A 3CMYA 3GTKJ 5J3LA 1IC8A 2NS7A 4A93J 2JA8J 2DJNA 3BTCA 4A3KJ 2DN0A 1YRNB 4GFBA 1Z0XA 2ECCA 1Y1WJ 1TC3C 3BG5A 1RETA 4UUSA 3A01A 1BA5A 2TRTA 1QVUA 3ZQIA 4M3GA 2HI3A 3FK7A 4QSHA 3LSGA 3S1MJ 5FJ8J 5EGOA 1LFBA 2XGDA 5F1JA 1P7IA 2L7MP 2YS9A 3GTOJ 1POGA 1NK3P 1RESA 2MW8A 5FLMJ 1AHDP 5IP7J 4ABZA 2KT0A 2O7OA 2QCOA 2DA6A 2L7FP 2VPRA 1Y1VJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1ETQ A;  3OIO A;  1RPW A;  4RDU A;  1PUF B;  1QPI A;  3JRC A;  1U9O A;  3JRF A;  2E1O A;  1OCP A;  5EZG A;  1ETY A;  3HDD A;  1T56 A;  5F04 A;  5EGO B;  4D5C A;  5EDN A;  2DMQ A;  4A3F J;  1TWF J;  4XRS A;  2MGQ A;  3Q0V A;  1JTX A;  2IBD A;  2EZH A;  2JN6 A;  4IEJ A;  1HOM A;  3HOZ J;  3SJM A;  3HBL A;  3UKG A;  1BJZ A;  3S1Q J;  2O9L A;  1OFC X;  1UMQ A;  2K9S A;  1FIP A;  2W48 A;  5JLX A;  1MSE C;  4AUX A;  2AO9 A;  2JWT A;  1QRY A;  1ZR4 A;  1HDD C;  3OOU A;  3ZQC A;  2CU7 A;  3GTM J;  1WH7 A;  2K40 A;  3Q3S A;  3SDG A;  3RKQ A;  3IH4 A;  3D1N I;  2VKV A;  1LFU P;  2XRL A;  4X6A J;  4FTH A;  3Q0U A;  1ETO A;  1FEX A;  1DU6 A;  4UUS B;  4XID A;  2E2I J;  2NS8 A;  3BR0 A;  5J1Y A;  1X2N A;  3TW6 A;  4D5F A;  4IHW A;  3I4M J;  1LE8 A;  5M3F J;  4B3A A;  3HOU J;  3W6V A;  2B63 J;  1WI3 A;  2K9N A;  1GVD A;  3OSF A;  2HXI A;  2L9R A;  2LP0 A;  3WHB A;  4X1E A;  1JKP C;  3HOY J;  1GUU A;  2JJ7 A;  2O8K A;  2E19 A;  5F0C A;  4M6V A;  2ME0 A;  1MBF A;  1GV2 A;  3DCF A;  2WV1 A;  4V2G A;  5EG0 A;  5FLV A;  2R7Z J;  3MKL A;  2HYJ A;  3SFI A;  2FD5 A;  3HOW J;  2R93 J;  2FJ1 A;  3LSJ A;  5IP6 A;  4B1R A;  1WCM J;  4A3M J;  1NK2 P;  4M3E A;  2R0Q C;  3BR6 A;  1IUF A;  3B6C A;  4NDL A;  3HKZ N;  1LE8 B;  3GTG J;  2M9H A;  1CQT A;  3JR9 A;  1ZQ3 P;  2X48 A;  1H88 C;  1IRZ A;  2X9D A;  2IAI A;  5F0H A;  1H8A C;  5E3N A;  1T33 A;  3LNQ A;  3BR5 A;  2IEK A;  1BL0 A;  3ZQH A;  4JYK A;  1I3Q J;  4I76 A;  2LTP A;  2CJJ A;  2VKE A;  5M3M J;  1IG7 A;  3DEW A;  4MO7 A;  2YU9 J;  2ECB A;  5FKO A;  1OJL A;  4XRS G;  5EG0 B;  4I6Z A;  1ETW A;  2EZK A;  2ZB9 A;  1JJ6 C;  3L1P A;  4CYC B;  3I4N J;  3WHC A;  1ZGW A;  1DU0 A;  3G1M A;  1TWG J;  3ZQG A;  2JA6 J;  3K2A A;  4Y7N J;  3PO2 J;  2E2H J;  1HLV A;  4JX6 A;  1QVT A;  3BQZ A;  4W1U A;  4A69 C;  3ZOB A;  2VI6 A;  3S1N J;  1IDZ A;  2OPT A;  4D7M A;  3HOX J;  3RQI A;  4MIM A;  5DTD A;  1ITY A;  3BR2 A;  5C3E J;  2XPU A;  3LSR A;  3A02 A;  1U8B A;  1MBK A;  4BBS J;  1RKT A;  1U78 A;  2WB1 N;  2K9Q A;  1D5Y A;  2H8R A;  2Y31 A;  1JT0 A;  1GT0 C;  3RZD J;  2XPW A;  2L0K A;  2LKX A;  1XC5 A;  1WH5 A;  5F0F A;  2TCT A;  2HOT A;  2HQ5 A;  1RKW A;  3MN2 A;  2HXO A;  3QPL A;  4FE7 A;  1HCR A;  3JRH A;  5E3M A;  2E2J J;  1VND A;  5BNG A;  3ZQF A;  2N8G A;  5C44 J;  5M5X J;  2NVT J;  1O4X A;  5GPA A;  3S2H J;  4XK4 A;  3E7L A;  4HNV A;  4QIW N;  4JP0 A;  2EBI A;  2Y9Y A;  2R5Y B;  3HM5 A;  5JLW A;  2DA5 A;  1HDP A;  3PM1 A;  2WAQ N;  3TP3 A;  4CYC A;  4DYR A;  5EYR A;  3GTQ J;  2P81 A;  1ZR2 A;  4QTR A;  4C3J J;  2CUF A;  2LVS A;  1JUM A;  2LD5 A;  2NVX J;  1A6I A;  3F0C A;  2GLO A;  5C4J J;  1JUS A;  1R9T J;  1XG1 A;  3HGG A;  1GV5 A;  1HF0 A;  3CDL A;  4DYQ A;  1TWH J;  4IHY A;  2AHQ A;  5J1U A;  5K7Z A;  2M0C A;  2R5Y A;  3BT9 A;  1ENH A;  3VPR A;  1WGX A;  2M2E A;  3TW7 A;  4C2M J;  1H89 C;  4BKX A;  2GBY A;  3S15 J;  2LK2 A;  4A3C J;  1MH4 A;  2Y9Z A;  2I10 A;  4J19 A;  2Y0S N;  4A3D J;  5FKN A;  1MNM C;  3HEF A;  3A03 A;  1MBJ A;  1Q1V A;  5EEA A;  5C4X J;  5E3L A;  2JK3 A;  3QQA A;  1Z77 A;  3JRE A;  1VI0 A;  4S0H B;  4DW6 A;  3FIS A;  5M5Y J;  4A3B J;  1OCT C;  4DZJ A;  3H0G J;  5IOZ A;  2YUS A;  5GPC A;  2DMP A;  2XGC A;  3B6A A;  3BR3 A;  4FE4 A;  2DMN A;  4UUT A;  3JRI A;  1EF4 A;  3IH2 A;  4BXX J;  1MH3 A;  1UG2 A;  3BR1 A;  1BW6 A;  3FIW A;  1MBH A;  2XSD C;  1MBG A;  2EZL A;  3TP0 A;  4BBR J;  2MSY A;  1IJW C;  3HGY A;  3IV5 A;  5EZH A;  3O8H A;  5HOD A;  2HOS A;  2DMU A;  1JUP A;  1U9N A;  4M3F A;  5F27 A;  2Y30 A;  5GP9 A;  1X58 A;  3CQZ J;  4MLO A;  5FKK A;  3JRB A;  1MSF C;  2ME6 A;  4A3G J;  1S7E A;  1JT6 A;  3FKI J;  3BQY A;  4LOC A;  3ZQL A;  4C3H J;  5M5W J;  3PO3 J;  1UHS A;  2RAE A;  2XGE A;  4IHV A;  1ETV A;  3OSG A;  2R92 J;  5K7F A;  2PMZ N;  1ETK A;  2LY9 A;  2LR8 A;  2LFB A;  2M8G X;  2QF7 A;  2NVY J;  3S14 J;  2Y2Z A;  3BTJ A;  5IYC J;  2OF7 A;  1IDY A;  5IP9 J;  1A5J A;  3HOV J;  3S2D J;  1IGN A;  1AU7 A;  1APL C;  2L7Z A;  3BG9 A;  1SFO J;  1I6H J;  1AKH B;  4A3I J;  2M34 A;  4JX5 A;  2EH3 A;  1JKQ C;  3IH3 A;  1K61 A;  3G1L A;  2H1K A;  2FQ4 A;  2NOG A;  3GBG A;  1JKO C;  3TED A;  4Y52 J;  1FIA A;  5J1R A;  4A3E J;  3FK6 A;  1B8I A;  5K7H A;  1ZK8 A;  1WPK A;  1NTC A;  2XB0 X;  2DA3 A;  4DYC A;  1ZKG A;  3JRG A;  4A3J J;  4EEF G;  1VFC A;  2CRG A;  4W97 A;  3K7A J;  5FKM A;  1TWC J;  1ORK A;  4G12 A;  5EF6 A;  1GDT A;  3JRD A;  1BW5 A;  3GTP J;  2DA1 A;  4BY7 J;  9ANT A;  4FCY A;  3QPS A;  2G0E A;  1JKR C;  2CQX A;  1FTZ A;  1IV6 A;  1AKH A;  3JRA A;  1X2M A;  4AC0 A;  4AYB N;  2DA2 A;  1B8I B;  2CUE A;  2XPV A;  2EZI A;  4B4C A;  2LLK A;  3O8G A;  4XRM A;  1W0U A;  1F43 A;  3NAR A;  4M3B A;  1JGG A;  4L5E A;  3NAU A;  1VF9 A;  2DMT A;  1YRN A;  2DTZ A;  1K83 J;  3BTI A;  2CQQ A;  2R5Z B;  2JMW A;  3MVP A;  1JTY A;  3GTJ J;  2NVQ J;  2FX0 A;  3S1R J;  2ID6 A;  3GTL J;  3S16 J;  2XB5 A;  2DA4 A;  4MFE A;  4C3I J;  4BY1 J;  4D7N A;  5FKL A;  3M3Y J;  1B72 B;  2KDZ A;  3M4O J;  3RZO J;  5IYD J;  1TWA J;  1ZTR A;  5IOY A;  2X6O A;  2HOA A;  2D5V A;  3BTL A;  1F36 A;  4RBO A;  3CCY A;  4MFD A;  1PUF A;  2MG4 A;  2R5Z A;  2JA7 J;  5F08 A;  1JJ8 C;  4M3D A;  3LSP A;  2JA5 J;  2HDD A;  1G2H A;  1SAN A;  3C2B A;  4JX4 A;  2COB A;  3HB9 A;  5E3O A;  5IYB J;  1FTT A;  3Q0W A;  5DS9 A;  1RR7 A;  4IHX A;  3H3V K;  4DZP A;  3A01 B;  1B72 A;  3G1O A;  5IPA A;  2GM4 A;  1MBE A;  1P7J A;  4A3L J;  2EQR A;  1I50 J;  2ELK A;  1ETX A;  1W0T A;  2ID3 A;  3BG3 A;  4FIS A;  4XIC A;  1E3O C;  3S17 J;  4V2F A;  3LOC A;  2VUM J;  1XS9 A;  1FJL A;  2DA7 A;  3CMY A;  3GTK J;  5J3L A;  1IC8 A;  2NS7 A;  4A93 J;  2JA8 J;  2DJN A;  3BTC A;  4A3K J;  2DN0 A;  1YRN B;  4GFB A;  1Z0X A;  2ECC A;  1Y1W J;  1TC3 C;  3BG5 A;  1RET A;  4UUS A;  3A01 A;  1BA5 A;  2TRT A;  1QVU A;  3ZQI A;  4M3G A;  2HI3 A;  3FK7 A;  4QSH A;  3LSG A;  3S1M J;  5FJ8 J;  5EGO A;  1LFB A;  2XGD A;  5F1J A;  1P7I A;  2L7M P;  2YS9 A;  3GTO J;  1POG A;  1NK3 P;  1RES A;  2MW8 A;  5FLM J;  1AHD P;  5IP7 J;  4ABZ A;  2KT0 A;  2O7O A;  2QCO A;  2DA6 A;  2L7F P;  2VPR A;  1Y1V J; 
#chains in the Genus database with same CATH topology
 2VQL A;  3RYP A;  2MA3 A;  2DT7 B;  3G3Z A;  1BIA A;  1RPW A;  2DYR H;  5B1B H;  4NHJ A;  1U9O A;  3JRF A;  2E1O A;  1OCP A;  4NBQ A;  4U0Y A;  4F91 B;  4F52 A;  3W6J B;  2YPR A;  1SVL A;  1T56 A;  1WJE A;  5EGO B;  3KZY A;  1ZHF A;  2DMQ A;  2CS3 A;  2J5P A;  4K2E A;  4XRS A;  5JVG F;  4A3F J;  2PJR A;  4F92 B;  1JTX A;  3DBH B;  1X3U A;  2EZH A;  3A1Y A;  3AG1 H;  3P9I A;  3WTW C;  2HYG D;  1RC9 A;  3I56 I;  1LNW A;  2DPD A;  2GXG A;  2OAZ A;  3S1Q J;  4Y15 A;  1BI2 A;  4ZJZ A;  1ZH5 A;  3SYT A;  3CD6 I;  2ZKZ A;  1MSE C;  4AU7 A;  4F7Z A;  1ZAR A;  2DFE A;  2QEN A;  3GTM J;  4GGG A;  1FWZ A;  3J80 Z;  2R3S A;  2Z3Y A;  1VTN C;  3EYI A;  5LRR A;  3ESW B;  1JXS A;  2DAO A;  2HWV A;  3CCS I;  4IRG A;  3MD2 A;  1VZ0 A;  2HVR A;  1IN5 A;  1KU2 A;  5L3E A;  2JPB A;  2NS8 A;  3BR0 A;  2BY0 A;  5FD5 A;  1BR4 A;  2ESH A;  3RIR A;  1X2N A;  1IN4 A;  2GIZ A;  1QZZ A;  4HV5 A;  4LLG F;  4M74 A;  3AG4 H;  1LB2 A;  2L4M A;  2GA1 A;  1H9G A;  3W6V A;  1WI3 A;  2K9N A;  2X6X A;  4BHP A;  2ISZ A;  1T0F C;  1YOV B;  1OCC H;  2JJ7 A;  3OV8 A;  1BR1 A;  1D1C A;  1P4A A;  2E5N A;  2M4G A;  2Z5U A;  4L9T A;  2L3D A;  3F8N A;  2Q2E B;  4Y17 A;  1WJF A;  5KVR A;  5J47 A;  1O3T A;  4V2G A;  3SZT A;  2BGC A;  1FMW A;  4ZTJ A;  5ICE A;  3R6S A;  2F4I A;  5HS8 A;  3MKL A;  1HW2 A;  2HYJ A;  3SFI A;  4RLF A;  3E6B A;  3HOW J;  3HPG A;  3E0J B;  5EEH A;  3EUA A;  3LSJ A;  3FX3 A;  5BS6 A;  4A3M J;  5DUK A;  3V7R A;  4NC8 A;  5KNL A;  2R0Q C;  2O6G E;  4NDL A;  5ICC A;  3IUO A;  3O2P E;  2O3F A;  2NNY A;  3DKW A;  3OYK A;  1L3L A;  3CJQ B;  1ZQ3 P;  4R79 A;  4I01 A;  3OYI A;  2DOF A;  1FYK A;  3I3L A;  3HHH A;  3CC2 I;  1SVM A;  1S29 A;  2BW3 A;  3ABL H;  3BR5 A;  4Q48 A;  3ZQH A;  1I3Q J;  2O0Y A;  4RB2 C;  2RKH A;  2X6W A;  3I9V 2;  4BH9 A;  4U88 A;  3BC8 A;  2A61 A;  3DEW A;  3EDP A;  3SFZ A;  2ECB A;  5FLX K;  2BE5 F;  4IRI A;  2DBB A;  1OJL A;  4I6Z A;  3GXO A;  2LG4 A;  3L1P A;  2DCE A;  3I4N J;  2GA2 A;  4IQ4 A;  1EH8 A;  3WHC A;  2QBY A;  3G1M A;  3ZQG A;  1GHC A;  2F48 A;  4HA8 A;  1D5V A;  1MW7 A;  3PUB A;  1OMI A;  3KP2 A;  1AOY A;  2E2H J;  1HLV A;  4JX6 A;  1QVT A;  3BQZ A;  4KMU X;  4A69 C;  3ZOB A;  3GF2 A;  2K9L A;  3BCB A;  5DTD A;  1Y39 A;  3H0D A;  1Y56 A;  2R7U A;  3A02 A;  1U8B A;  2G7H A;  3OYE A;  1RKT A;  3H9Q A;  3ZQQ A;  4I7H A;  2H8R A;  2QKL B;  4FT8 A;  2V9V A;  2K85 A;  1QHH D;  2HZT A;  2KIU A;  3WTU C;  5LFA A;  1GT0 C;  4XKB A;  3KP6 A;  4PSW A;  4ZDL A;  1TQI A;  2PLY A;  1UEL B;  4ENJ A;  1CF7 A;  3LQQ A;  2EA4 A;  1D1A A;  2LKX A;  1R71 A;  5F0F A;  1CGP A;  3HYI A;  2TCT A;  2ELJ A;  3FBI B;  3MN2 A;  4ZDP A;  1HXD A;  4AM3 A;  1J2X A;  3QPL A;  1MMS A;  3CCM I;  2E7W A;  2VPL A;  4LB6 B;  1SMT A;  3ZQF A;  1S72 I;  2E7X A;  1KZH A;  1O4X A;  4KIS A;  3WU0 A;  4JQF A;  3Q5F A;  3DTK A;  1G3S A;  4CHU A;  4QPO A;  3CC7 I;  1U0J A;  2P5K A;  2Y9Y A;  2GXA A;  1TTY A;  2EA2 A;  4CCK A;  2R5Y B;  1OR7 A;  3KZI C;  1HBX G;  1ZG1 A;  2DFF A;  5EYR A;  3GTQ J;  4YIF A;  3VSK A;  2K4J A;  4XON A;  1HW5 A;  3WE3 A;  4OMZ A;  2EPF A;  3IRQ A;  4PGH A;  2V79 A;  2IA1 A;  2LY1 A;  1R22 A;  4U0W A;  4C3J J;  4V19 K;  2IJL A;  2LD5 A;  4QWQ A;  4UB6 C;  1KGS A;  3ABM H;  3VOE A;  1GV5 A;  1HF0 A;  1RI7 A;  3CDL A;  1TBX A;  2XF7 A;  1R7J A;  2AHQ A;  2CG4 A;  1NG6 A;  4IF4 A;  3MKY B;  3N4M A;  4QLC U;  1OQY A;  1KA8 A;  4GRI A;  1H0M A;  4YRV A;  2H6B A;  3VPR A;  1MMD A;  1T39 A;  2KP6 A;  2EFP A;  3F9K A;  3T0Y A;  2QUF A;  3VDX A;  3E6D A;  1A31 A;  4C2M J;  1H89 C;  3S3N A;  1BI1 A;  3V8J A;  4JK1 X;  3VWB A;  3FXK A;  3L9F A;  4A3C J;  4LG3 A;  2I10 A;  3U1K A;  4J19 A;  2Y0S N;  4XLA A;  3F6O A;  1MNM C;  3BWG A;  2MH2 A;  1Q1V A;  5C4X J;  2R7T A;  4A12 A;  1JE8 A;  3CO7 C;  3R4K A;  4MEY F;  2DT5 A;  2G7U A;  5E8I A;  2QGU A;  2DYS H;  3GLL A;  3FIS A;  5M5Y J;  2JVH A;  4A6E A;  3GZ5 A;  4L0Y B;  2VBZ A;  2YX7 A;  4KN7 X;  2DMP A;  3OYA A;  2XGC A;  3W2A A;  4FE4 A;  4UUT A;  2DMN A;  3TDZ C;  2WAF A;  4CZC A;  2LF8 A;  3G71 I;  4EQQ A;  1R6R A;  2HVS A;  2XSD C;  1MBG A;  1OLT A;  3DPU A;  2M7B A;  2F4M B;  2MLK A;  3HGY A;  2HFH A;  5CVI A;  1WWX A;  5HOD A;  4KMF A;  4E7K A;  3IAS 2;  5H2F C;  1JUP A;  1U9N A;  4M3F A;  2Y30 A;  1YJW I;  2QSG X;  1X58 A;  5LHG A;  2OZ6 A;  3BLY A;  3JRB A;  3S3O A;  1IXR C;  1BI0 A;  1UG0 A;  1MSF C;  1SD7 A;  2DFH A;  4IVN A;  1JT6 A;  1B4A A;  3GCM A;  1ZEL A;  3BQY A;  5ICF A;  3ASN H;  2A5Y B;  1Z9C A;  1RIO H;  1UHS A;  2RAE A;  3OOP A;  2IVM A;  2UZK A;  3PIO F;  4A6D A;  2ZME B;  2LR8 A;  1TW3 A;  3C18 A;  4ZTF A;  4O3M A;  1HA8 A;  2NVY J;  3K1P A;  2Y2Z A;  3BTJ A;  1U5T A;  5DCM B;  3HZJ A;  1PP7 U;  3HOV J;  3VYS B;  2QSF X;  4UNO A;  4CIC A;  1MKM A;  1NHA A;  3BG9 A;  2UXN A;  2XHK A;  4GYI A;  2ZNZ A;  2XC7 A;  2Z99 A;  3J81 K;  2VBW A;  1FIA A;  5J1R A;  4IQJ A;  4Q4Z F;  4RB1 A;  1S7O A;  1XGO A;  1SFU A;  3JRG A;  3CCE I;  4PSX A;  1UHM A;  3NWT A;  3MZH A;  4BQA A;  2HZD A;  2CRG A;  1EJ9 A;  1ORK A;  2ZME A;  1UJ8 A;  4ZZL A;  1ZGJ A;  2HDC A;  2ZME C;  3QOD A;  4FCY A;  2F5E A;  2G0E A;  3QYB A;  1UAA A;  2CYY A;  4C2U A;  1IN7 A;  3KFW X;  1G59 A;  2M5W A;  3AG3 H;  3BG7 A;  4AYB N;  1A36 A;  2EV0 A;  1VQ4 I;  4XRM A;  2LLK A;  2OU2 A;  3J7Y J;  5F6F A;  1Z7U A;  2ZXI A;  4KT5 C;  4PK4 A;  2VE8 A;  3V8L A;  3FXJ A;  3JSO A;  2DT6 A;  3BPV A;  3HRM A;  4ASN A;  3CF2 A;  1VF9 A;  2DOA A;  3GWZ A;  1YRN A;  4G6Q A;  3BY6 A;  4BDZ A;  4FX0 A;  3BTI A;  4G8X A;  4EVI A;  5GAE J;  2JMW A;  2RQP A;  3DXJ F;  1JTY A;  3HRT A;  2IGK A;  2LOO A;  2FX0 A;  2VIX A;  4XSZ F;  1SD5 A;  3A0B C;  4LLL A;  4L5I A;  4MFE A;  4WCG A;  4C3I J;  4ESF A;  3O3K A;  2WAE A;  4B3X A;  2D45 A;  3TQN A;  1X4P A;  3BJA A;  2LBF B;  3CES A;  3M3Y J;  4BAC A;  1DPU A;  3FF5 A;  3RZO J;  1WI9 A;  3MZY A;  2P5L C;  4N9I A;  4O5V A;  5IT9 Z;  4AYB A;  5IOY A;  2BY1 A;  2BBY A;  2X6O A;  2HOA A;  3CP8 A;  3N97 A;  2CQ7 A;  2ZFW A;  2LYC A;  2PG4 A;  2D1V A;  4AVP A;  4H0E A;  4MFD A;  1PUF A;  1DPR A;  2MG4 A;  2Y0M A;  2GAU A;  2QVO A;  2WWY A;  3K9T A;  3UR3 C;  5HNF A;  1R4M B;  3IP4 B;  1SAN A;  3C2B A;  5E3O A;  2COB A;  3HB9 A;  1ZLJ A;  3OL3 A;  4CCL A;  3K4B A;  4YEL A;  4OIR F;  4CUG A;  5HDN A;  5DS9 A;  1QA6 A;  2M4K A;  1TZL A;  4Q5S F;  1ZRF A;  3JTG A;  3OYB A;  4N0B A;  2IGO A;  3ZPL A;  1A04 A;  1W0T A;  1R5G A;  1FY7 A;  4BQN A;  3OYC A;  1P4X A;  3Q9V A;  3E97 A;  3MCZ A;  4XIC A;  1E3O C;  3HTS B;  1MDM A;  3LOC A;  4RAZ A;  2KJC A;  1XMX A;  1O7L A;  1K79 A;  5DCF A;  3AFH A;  5HS7 A;  5J4V A;  3JSP A;  1WZ2 A;  4A93 J;  2DJN A;  3KEQ A;  2FSW A;  3HIF A;  3ZMU A;  3BG5 A;  4EM1 A;  2C6Y A;  4UY8 I;  2GIV A;  4UUS A;  2QYO A;  1FSE A;  2TRT A;  5E1W A;  1T95 A;  3F22 A;  4M9Z A;  3TO9 A;  4ESB A;  3CLQ A;  3FK7 A;  2FBH A;  4QSH A;  2A05 A;  3ZR8 X;  2AS5 F;  3I58 A;  2XGD A;  3EUK L;  4BE1 A;  1QGP A;  3SEZ A;  2A68 F;  2W24 A;  1RES A;  2LMD A;  4HDU A;  1R49 A;  2ZJ2 A;  1MDM B;  1AHD P;  3RI4 A;  2KT0 A;  1MMG A;  5FRO A;  3J7A O;  4EAT A;  4IOC F;  3F72 A;  1BJA A;  3FDY A;  5L3C A;  2VPR A;  1WRJ A;  4LK1 F;  3C2G A;  1Y1V J;  4ZYD A;  3I59 A;  2DK5 A;  2BY2 A;  4CO8 A;  2RQQ A;  3QYE A;  1ETQ A;  4AWX B;  1QPI A;  2W1O A;  3K1N A;  5ILV A;  3HTU A;  3HJE A;  3GME A;  5HS9 A;  5E18 F;  5EZG A;  1SD4 A;  1W5C C;  2DW4 A;  4P5O A;  1OKR A;  3OYN A;  4ZYH A;  1XGN A;  3LA2 A;  2V9K A;  2V1U A;  2DQL A;  3Q0V A;  3DF8 A;  3GLX A;  4G94 A;  4HOB A;  3WTX C;  3OYD A;  3K4J A;  4IEJ A;  1HOM A;  3ZGK A;  2P4W A;  1YFH A;  4HAM A;  5DDG A;  5ILS A;  4OU0 A;  2K9S A;  4I0A A;  3HPH A;  3DU5 A;  2COM A;  4AVZ A;  3E5X A;  2HOE A;  4AUX A;  2AO9 A;  2X1C A;  1ZR4 A;  1TL8 A;  3I5U A;  5AIQ A;  1WH7 A;  2XKP A;  3IH4 A;  3KYD B;  2QLZ A;  2VJ4 A;  3D1N I;  5ILU A;  4J00 A;  3LFK A;  2CV2 A;  3OR2 C;  2HR3 A;  1LFU P;  3KP5 A;  2OZU A;  3Q0U A;  1ETO A;  4HST A;  4WXC A;  1U6G A;  3MAJ A;  1R23 A;  4XID A;  4LG0 B;  3HUG A;  3PNY A;  1MMN A;  3HOU J;  1YO5 C;  3ECH A;  2B63 J;  1R4N B;  2FUG 2;  2HXI A;  5CVR A;  2Z1D A;  3WHB A;  3CCQ I;  3HHG A;  3HOY J;  1GUU A;  4EMS A;  5KHD A;  5LRS A;  4M6V A;  1IN8 A;  1ZGA A;  2ME0 A;  2ADU A;  1WKM A;  1SAU A;  2JVG A;  1XCV A;  3PFY A;  3RKY A;  3KP7 A;  4E6K G;  3P7N A;  2LH9 A;  5FLV A;  3CJR B;  2R93 J;  5H6Q A;  1FOX A;  1LUJ B;  2W7N A;  3SQN A;  2CW7 A;  4CZZ A;  2R7S A;  4LIT A;  1NK2 P;  2QQ9 A;  2MAB A;  2V6E A;  2CV1 A;  2QWW A;  4RGS A;  2W85 A;  3HKZ N;  4HZF A;  3GTG J;  2M9H A;  4XSX F;  1T08 B;  1X3W B;  1IRZ A;  3F8M A;  3S93 A;  3E6C C;  1VQ9 I;  1O57 A;  1H8A C;  1RUN A;  5CQG A;  3LNQ A;  4BHB A;  1OCZ H;  4JYK A;  1REP C;  3CTA A;  1VQL I;  2W25 A;  4F55 A;  1DQU A;  1R1V A;  3EYY A;  2EZK A;  4HBL A;  3WG9 A;  1JJ6 C;  4ZC3 A;  3HG9 A;  2FRH A;  1IF1 A;  4YIR X;  1VQP I;  3K2A A;  1K78 A;  3WTY C;  3WGG A;  4E70 A;  3PO2 J;  3RPQ A;  1FC3 A;  1T0F A;  2RV8 A;  2O8X A;  3TL4 X;  4WK8 F;  4W1U A;  3PJR A;  4PZJ A;  1IDZ A;  2OPT A;  4ANJ A;  3HOX J;  3RQI A;  4PFO A;  2MH9 A;  4OMY A;  4Y33 A;  4RB0 A;  4PDK A;  1IW7 F;  2XAF A;  4A2U A;  2XPU A;  4DQ2 A;  2ZCW A;  3R60 A;  1ACI A;  1U78 A;  4RMN A;  2K9Q A;  3G6E I;  2DXI A;  3FM5 A;  3MKZ A;  1QHG A;  1D8K A;  3RKX A;  3GX4 X;  2Q2E A;  2EWN A;  4ZYA A;  4R1H A;  3RZD J;  1FOY A;  1T6S A;  1YW8 A;  4OWR B;  4YII A;  4U87 A;  1N77 A;  4Q47 A;  3SZP A;  3VOD A;  4XOT A;  1BBY A;  3LMM A;  3MQ0 A;  1IUY A;  1WH5 A;  5IT3 A;  1D3Y A;  2Z2S B;  1W36 D;  3MKW B;  2P7V B;  2QQA A;  3HC7 A;  2HXO A;  4F93 B;  3A0H C;  1HCR A;  2IT0 A;  4OIN F;  1ZRC A;  1VND A;  3ULQ B;  2N8G A;  5C44 J;  4B48 A;  2NVT J;  4RB3 C;  4B44 A;  2MD5 A;  1XMK A;  3VYU B;  4XK4 A;  4ETS A;  4HNV A;  4QIW N;  4RAF A;  2CUZ A;  2JUC A;  2PMZ A;  3VEP A;  4CCJ A;  4XKC A;  2NVU B;  2BVL A;  2DA5 A;  2VT3 A;  3KEO A;  4CYC A;  4DYR A;  1G8X A;  4E7I A;  2H94 A;  2WY7 Q;  4B8X A;  2LC2 A;  2P81 A;  2WAQ A;  1K6Y A;  2FNA A;  4KNY A;  3C2H A;  3AKZ A;  3F6V A;  4NUB A;  1G3W A;  1XGM A;  1BC7 C;  2NRA C;  4G9Y A;  2BOL A;  3PQK A;  2NVX J;  1BI3 A;  3F0C A;  2HVQ A;  3K6G A;  4EJW A;  2XKO A;  1MNE A;  1R9T J;  1E2X A;  3DQV C;  3ONQ A;  2IS6 A;  5J1U A;  4XLP F;  1XD7 A;  5ICG A;  2M0C A;  1V3F A;  2CFX A;  2XVC A;  5FO5 A;  3H9J A;  2WBM A;  1XDU A;  2FML A;  1XTA A;  4JBA A;  1DP3 A;  4RA2 A;  3ZXS A;  1T38 A;  3TOA A;  3I54 A;  2MFZ A;  2GBY A;  2K9M A;  3QWL A;  1U5T B;  1QQI A;  1CF7 B;  1W7P B;  3S2W A;  4LGW A;  4FQG A;  2IS4 A;  4KFC A;  4XNF A;  1N75 A;  5EEA A;  2VQC A;  3Q9S A;  3DKY A;  4N9H A;  5E3L A;  2JK3 A;  4HLY A;  4NNJ A;  1Z77 A;  2WB1 A;  4P55 A;  1VI0 A;  3JRE A;  1YE9 A;  4D0P A;  5EEG A;  2GXB A;  1YX3 A;  4BXF A;  4MTE A;  2DTR A;  3COA C;  4HV6 A;  5L3D A;  5L3F A;  1O3R A;  3GVA A;  2JZY A;  3JRI A;  2IGM A;  3CJT B;  1LVA A;  1L0O C;  2L5Q A;  3RSN A;  1MH3 A;  1UG2 A;  2ZXH A;  3DLL F;  2BEO A;  1BW6 A;  1OR7 C;  1VQK I;  3K69 A;  3X2Q H;  3CCV I;  4EV0 A;  1GXQ A;  4OIP F;  1I1G A;  1S9H A;  1IJW C;  2OC6 A;  3HSR A;  3RKW A;  1YYV A;  2DMU A;  3PFI A;  5BQT A;  2HPM A;  2EIN H;  5F27 A;  1LDK B;  1B59 A;  2PJP A;  2XF5 A;  4NB5 A;  3LAJ A;  4EM2 A;  4LK0 F;  1Z91 A;  4LOC A;  3U1D A;  3ZQL A;  5GAH J;  2CQN A;  5M5W J;  2K4B A;  3ROU A;  2OTJ I;  3QP6 A;  1D0X A;  4IHV A;  1WJB A;  2XGE A;  4P96 A;  4BAY A;  4FAS D;  3CME I;  3OSG A;  2R92 J;  2OUM A;  1AWC A;  4GDF A;  1EH6 A;  1Z21 A;  1ETK A;  2LY9 A;  5DV5 A;  1V54 H;  5E20 A;  1S7A A;  2EFQ A;  2A6E F;  3C3W A;  1DGW Y;  5IYC J;  1K4T A;  2OF7 A;  1IDY A;  5IP9 J;  2XAJ A;  1X1A A;  3S2D J;  1IGN A;  3DFG A;  2LBF A;  2A69 F;  1SFO J;  1I6H J;  1AKH B;  2M34 A;  5KCM A;  1JKQ C;  2H1K A;  3G1L A;  2NOG A;  4U7B A;  3TED A;  4DJA A;  3QP5 A;  3FK6 A;  3OYL A;  3TMO A;  1ZK8 A;  1YIO A;  1NTC A;  2AQE A;  2EV5 A;  3V42 A;  2X0L A;  5CVV A;  1D0Y A;  1EH7 A;  3BG6 A;  5E79 C;  3HXL A;  4XLC A;  3CCL I;  5B66 C;  1Z05 A;  4YEJ A;  3ABU A;  3K7A J;  5FKM A;  1IAW A;  1NG7 A;  4IJA A;  5CQE A;  3F8C A;  4HX4 A;  4G12 A;  1GDT A;  5JR3 A;  3JRD A;  2JRM A;  4FET A;  2IXS A;  2F5D A;  1I5Z A;  3M1C A;  5F64 A;  4BY7 J;  4BS9 A;  4BDY A;  4BE0 A;  3QPS A;  3ZN1 A;  2CQX A;  1QZY A;  2QSH X;  2E60 A;  3JW4 A;  4UHT A;  5F1R A;  1IV6 A;  5JHF A;  2ZXJ A;  1PVE A;  4O6J A;  4CXF A;  1ZG5 A;  2OCC H;  1SD6 A;  2DA2 A;  4HNT A;  4J01 A;  1QU3 A;  2LY2 A;  4B4C A;  3WTV C;  1W36 C;  3O8G A;  1KON A;  3NQO A;  1D8J A;  1F43 A;  2V4J C;  6PAX A;  1WJD A;  3E1S A;  1JHH A;  1MJ9 A;  4M3B A;  1J0R A;  2ETH A;  3EPZ A;  4L5E A;  2XAQ A;  4ZH4 F;  2Y69 H;  4EJV A;  2JUG A;  2CQQ A;  3ABK H;  2R5Z B;  4ON0 A;  3H92 A;  2A5W A;  3MVP A;  4N4N B;  2OQG A;  3E5Q A;  2NVQ J;  3B73 A;  5FFX A;  4XOP A;  4F3Q A;  2ID6 A;  1W1W E;  4BL0 B;  2PMU A;  5LGT A;  2VL8 A;  5DCM A;  2DA4 A;  1SAX A;  1IV8 A;  1R00 A;  1IO2 A;  2R7V A;  4E7J A;  3M4O J;  4KIT B;  5IYD J;  2KJB A;  4IL6 C;  5E8G A;  2HGC A;  4Y4R A;  5HNH A;  2D5V A;  1KQ0 A;  1F36 A;  3WTT C;  3I59 B;  3T8T A;  3CCY A;  2H09 A;  3RQ4 A;  4E7Z A;  2D1H A;  4WXD A;  2R5Z A;  2CFO A;  1JJ8 C;  3VSL A;  3LSP A;  1LPQ A;  4XRF A;  2VT2 A;  2HDD A;  3GZ6 A;  3OIQ A;  5IY5 H;  5FFZ A;  4PJN A;  1PYV A;  5BPD A;  1SEU A;  3Q0W A;  3DTE A;  1ZN2 A;  3PL8 A;  4LLN A;  2ISY A;  4HPQ A;  1BR2 A;  1LQ1 A;  4II2 A;  1HKQ A;  2V9P A;  3CUO A;  4DZP A;  3PSI A;  3A01 B;  1WSU A;  1B72 A;  5TIS C;  5IPA A;  3OYJ A;  2ELK A;  1ETX A;  1E3H A;  5LEJ A;  2VON A;  1VQ6 I;  4BJ6 C;  5AIP A;  1JHF A;  4FIS A;  3KP4 A;  2M1B A;  2V1X A;  2IW5 A;  4LB5 A;  3S17 J;  2HTS A;  1LEA A;  4BUP A;  3BDD A;  2IP2 A;  2ICW G;  5B5E C;  1EKE A;  5J3L A;  1IC8 A;  2NS7 A;  2FBI A;  2JA2 A;  2UV1 A;  2JA8 J;  1YRN B;  3R0A A;  4GFB A;  2ECC A;  5JI6 A;  1TC3 C;  2D2W A;  1BC8 C;  2MC3 A;  1BOA A;  2R7W A;  3G4S I;  3A01 A;  1P92 A;  4LMY A;  5LGN A;  3ZQI A;  3FXR A;  3CMA I;  2IS2 A;  4L9V A;  5EGO A;  1P9Q C;  1LFB A;  4C30 A;  3W2V A;  1Z3Y A;  2P6S A;  2MC4 A;  2XSJ C;  2YS9 A;  4AID A;  2PJR B;  4ENN A;  3H5N A;  3NWS A;  1NK3 P;  5FLM J;  1I3A A;  1FOW A;  3ABT A;  2BHY A;  4HYE A;  3H35 A;  5E1X A;  2DA6 A;  4BGD A;  1V5F A;  2ZSI B;  3L2W A;  1V55 H;  1E0E A;  1J7K A;  2A6T A;  2KIQ A;  2FF4 A;  3OIO A;  2F4O B;  1YW7 A;  2HKX A;  4EJU A;  4RDU A;  4LD5 A;  1PUF B;  3JRC A;  4MHG A;  2UUZ A;  3SHF A;  4KN4 X;  2KLO A;  3DEU A;  2KZG A;  3HDD A;  1FYM A;  4XLH A;  1LKX A;  2YSR A;  3G2B A;  4D5C A;  2ZBK A;  1K7A A;  2MGQ A;  3CCJ I;  1U2W A;  2STW A;  2FQ3 A;  3ML6 A;  4P9F A;  3HOZ J;  5AON A;  2GOX B;  4MQ9 F;  3TGN A;  2M3A A;  3HBL A;  3UKG A;  1O3Q A;  1OFC X;  2WY8 Q;  1I39 A;  1B9M A;  1FIP A;  2HQR A;  5D5U B;  2W48 A;  1QO0 D;  2OTL I;  3HOT A;  2JWT A;  1QRY A;  2F5V A;  3F3X A;  1MGT A;  2ZFU A;  3OOU A;  3ZP5 A;  3H5A A;  2NS0 A;  4BE2 A;  2K5C A;  3Q3S A;  3SDG A;  3OMY A;  2FMY A;  1WJ5 A;  2VKV A;  2XGX A;  4FTH A;  4X6A J;  1S5L C;  1DU6 A;  4NQW A;  1W4M A;  4UUS B;  2NAZ A;  4IHS A;  2E2I J;  2OBP A;  5D5W B;  4CYD A;  5HVQ C;  4ESJ A;  3QRF F;  4UB8 C;  3BCA A;  1LJ9 A;  4UV9 A;  3TW6 A;  3I4M J;  4IHW A;  1LE8 A;  5M3F J;  4B3A A;  1PUE E;  2O5R A;  3LSM A;  4HEA 2;  1OCR H;  3ZRG A;  3OSF A;  3MZ8 A;  4OAY A;  2DU9 A;  3TO6 A;  2H8W A;  2KIF A;  3A2K A;  1MJB A;  2AXT C;  1JKP C;  2Q0O A;  2DK8 A;  2WTE A;  2E19 A;  5F0C A;  3ZMZ A;  5CYV A;  1MBF A;  1GV2 A;  1EV7 A;  1PDN C;  2V7F A;  3ZMS A;  2PFB A;  2V6C A;  2EIL H;  2FD5 A;  3DTI A;  4E7H A;  3OIP A;  4PJJ A;  5IP6 A;  4AIK A;  4B1R A;  4IRH A;  2K3F A;  2R7Q A;  1TQP A;  3BZ6 A;  3BR6 A;  3WGI A;  1R5I D;  1IUF A;  1Z6T A;  2RC4 A;  3MEX A;  4BNC A;  1ONV A;  2KKO A;  2VAS A;  1LE8 B;  1YX5 A;  3ZMD A;  2IAI A;  1J9I A;  1IRG A;  4IO9 F;  3OYF A;  4YFN F;  5F0H A;  1FSH A;  2L7K A;  3GEZ A;  5E3N A;  2IEK A;  4XR6 A;  1UHW A;  4U0V A;  3K4C A;  2CJJ A;  2VKE A;  5M3M J;  4BYY A;  2YU9 J;  4MO7 A;  3CCU I;  3OS2 A;  2K02 A;  3CF5 F;  4DOZ A;  2ZB9 A;  1G4D A;  4CYC B;  1Y0U A;  1S8N A;  1ZGW A;  1DU0 A;  3CO6 C;  4G7O F;  2CW8 A;  4UVC A;  3LSH A;  2VBY A;  5D6E A;  2ZJR F;  3NRV A;  2Z9O A;  3HRS A;  1ZLK A;  1J09 A;  2E1N A;  3VFZ A;  3PUF A;  4IX7 A;  2VQH A;  4B09 A;  2VI6 A;  2GQQ A;  3RTR A;  2BW3 B;  3MFK A;  4LG0 A;  3ZN0 A;  4D7M A;  1YHQ I;  1R1U A;  1XMA A;  2F5F A;  3K1M A;  1YJN I;  3BR2 A;  1ITY A;  5LEK A;  2L02 A;  4BBS J;  2BXZ A;  5A2Q Z;  2XAH A;  1D5Y A;  1DP7 P;  1HSJ A;  2Y31 A;  3CUQ A;  2EIM H;  4I0B A;  1KU9 A;  1JT0 A;  1DDN A;  4KIG A;  2JSP A;  2QQ8 A;  4XQF A;  2XRN A;  4A0X A;  4HQE A;  4HX7 A;  1NH3 A;  2QBY B;  2Y0S A;  4D1Q A;  1QBJ A;  2VJJ A;  4ZZD A;  3MWM A;  4M6Y A;  4HF2 A;  1X4O A;  2JPC A;  3WTS C;  2L0K A;  3KEY A;  5GAG J;  1LVK A;  4Z6Y A;  2FU4 A;  2HOT A;  2M8E A;  2PN6 A;  2HQ5 A;  1MJA A;  1UST A;  1RKW A;  2VC1 A;  2O8K A;  2LDU A;  4EM0 B;  4FE7 A;  4CDG A;  2WV0 A;  3W2W A;  5CKT A;  5LBQ A;  2E2J J;  5BNG A;  2FOW A;  1T2K A;  4MTD A;  1W5T A;  5M5X J;  3IRR A;  3AL0 B;  3CUQ B;  2F5C A;  3R61 A;  5GPA A;  3S2H J;  3E7L A;  2OQR A;  5H6R A;  4JP0 A;  3I4P A;  3BOQ A;  4YFK F;  1XCB A;  2EBI A;  2HTJ A;  2OV7 A;  3FMR A;  3QPT A;  2XRO A;  1JGS A;  3LSI A;  1J5Y A;  1WHU A;  1KYZ A;  1V5G A;  5JLW A;  1D1B A;  2F2E A;  3FZV A;  2XIG A;  2GOM A;  4A5N A;  3K0L A;  5HLH A;  1IRF A;  3H3Z A;  3M9A A;  4GO1 A;  3TOB A;  3M7G A;  1A35 A;  3FWE A;  3W3C A;  2PMH A;  1MND A;  4BEH B;  2CUF A;  1JUM A;  1R1T A;  2Q1Z B;  2HDW A;  1MD0 A;  4M71 A;  1JUS A;  5C4J J;  1XG1 A;  1FBU A;  1XB4 A;  1YS6 A;  5J40 A;  4BU2 A;  4G7H F;  2XAG A;  5DYM A;  1TWH J;  4IHY A;  2CUJ A;  4XLF A;  3K4L A;  4UVA A;  2R5Y A;  3DLA A;  3QYF A;  3W6K B;  3BT9 A;  1ENH A;  4OIQ F;  1TNT A;  4WX9 A;  3TKY A;  4IXA A;  2JTV A;  2HQN A;  3KYL A;  1RZ4 A;  4LIU A;  1A6Q A;  2DLL A;  3FMS A;  3H1C A;  5DD8 A;  2ZJQ F;  4BJ5 C;  3TW7 A;  2CMP A;  3F23 A;  4BKX A;  5FB2 A;  4RGR A;  2DI3 A;  2LK2 A;  1XDS A;  2KL4 A;  2ZO4 A;  1MH4 A;  2L2O A;  2FA5 A;  2XAU A;  1X19 A;  4A3D J;  2DOD A;  3M8F A;  3GFM A;  3HEF A;  2XUB A;  3A03 A;  1MBJ A;  2FXA A;  1RNL A;  4I99 C;  2NXN B;  1U3E M;  3FXQ A;  2IS1 A;  1OYW A;  5FD6 A;  3QQA A;  1J59 A;  3LWF A;  5E17 F;  5TJJ A;  1OCO H;  2DO7 A;  1LDJ A;  3M8J A;  4EGY A;  1OCT C;  4UVB A;  3H0G J;  1WVR A;  5IOZ A;  3OS0 A;  4XKV A;  2M87 A;  2EIK H;  5CVU A;  2E35 A;  3B6A A;  5IT9 K;  1HKT A;  2Z33 A;  3DPT A;  1EF4 A;  2ELH A;  1YJ9 I;  3IH2 A;  4BXX J;  1LFP A;  1EA3 A;  2ZXW H;  4JOM A;  3FXU A;  3J7A Y;  3S8P A;  3BR1 A;  1MBH A;  2NNN A;  4L0Z B;  1TP4 A;  2EZL A;  3D5L A;  4HRI A;  3H36 A;  4EJO A;  2LKP A;  3TP0 A;  4BBR J;  4ENM A;  2VXD A;  2VOP A;  5EZH A;  3BZC A;  5LHI A;  2HOS A;  3V7C A;  4HF0 A;  2HEO A;  3CQZ J;  3PIP F;  2CO5 A;  2ESN A;  5D4R A;  3K70 C;  1FOK A;  4EJT A;  5B1A H;  3FBN B;  2IPQ X;  4C3H J;  5DD4 A;  3PO3 J;  2ZSH B;  1ETV A;  2B7E A;  1TT0 A;  4KJZ A;  1ZRE A;  2VJI A;  5K7F A;  2QKM B;  3L2Q A;  4P1W A;  2PMZ N;  2HQA A;  2M8G X;  1X1C A;  5JFR A;  1X1B A;  2MD0 A;  3L09 A;  3N05 A;  2HPI A;  2YR2 A;  4OOI A;  1X1D A;  3CZ6 A;  4HQM A;  2E1M C;  2E5Z A;  1W7P A;  4PGG A;  4A0Y A;  1F4K A;  2HU9 A;  3QAH A;  4JX5 A;  2EH3 A;  1HKS A;  2FQ4 A;  3GBG A;  3KIO A;  1BN5 A;  1TLH B;  1JKO C;  4RM2 A;  4A3E J;  1O3S A;  1B8I A;  4GXO A;  5K7H A;  2YX4 A;  4KDP A;  2VXZ A;  3FMQ A;  4DYC A;  1ZKG A;  2M7A A;  3FM3 A;  4UXN A;  4EEF G;  2R7F A;  2M0M A;  3GFL A;  1VFC A;  1OYI A;  3ZMV A;  2E34 A;  3QOP A;  5EF6 A;  1KYW A;  5BOX A;  4XLN F;  1OIS A;  3GTP J;  3BJ6 A;  9ANT A;  3CC4 I;  3IHU A;  4XMY A;  1JKR C;  4C2T A;  3VYT B;  3I71 A;  3M1E A;  1FTZ A;  4QPQ A;  3K70 D;  1U8R A;  2VOD A;  5HLT A;  3ERM A;  2HYF A;  3PSF A;  4AC0 A;  3KPH A;  1B8I B;  4LJZ F;  1F1Z A;  2EZI A;  1R58 A;  3C7J A;  3T5X A;  1VQ8 I;  2O03 A;  2AXL A;  4HNU A;  1R5H A;  2JT1 A;  1YW9 A;  1JGG A;  3ELK A;  2NYX A;  2X1E A;  5KAF C;  1FBQ A;  3KYC B;  3NAU A;  3I0T A;  2X1D A;  1UZC A;  3HRU A;  3K2Z A;  2W00 A;  1FT9 A;  2H27 A;  3JCU C;  1DUX C;  3RCO A;  2PEX A;  2PI0 A;  2QM3 A;  5HLG A;  2ZJP F;  1BOB A;  3GTJ J;  2KIS A;  2L01 A;  5JVT A;  3DBL B;  3S1R J;  4HG2 A;  2I5U A;  3LL7 A;  3S16 J;  4PJM A;  1TW2 A;  3IC7 A;  4FX4 A;  4L9J A;  4D7N A;  3KE2 A;  3ERE D;  2MLG A;  2LRD A;  2KDZ A;  1T8I A;  1TWA J;  1ZTR A;  3L2V A;  1Z67 A;  2MBF A;  4PUS A;  1OYY A;  2R4G A;  3EET A;  1Y0N A;  2P6T A;  1FBS A;  1ULY A;  1Y8Q B;  3PNV A;  2JA5 J;  4XL9 A;  3FXL A;  4JX4 A;  3FXO A;  5IYB J;  3CUQ C;  1UB9 A;  1RR7 A;  3J80 K;  1HW1 A;  5A2Q K;  1YI2 I;  4KIC A;  3G1O A;  2GM4 A;  4A3L J;  2EQR A;  1RR8 C;  2KRF A;  1SVO A;  4I98 B;  4WWC A;  1MMA A;  3BG3 A;  3LFU A;  1VQ7 I;  4Y3O A;  2E71 A;  2O61 A;  3CCR I;  4HF1 A;  3ZMT A;  2H6C A;  2BYV E;  4V2F A;  3HL2 A;  5ED4 A;  5KK1 A;  3ZCO A;  1WQ2 A;  2P5V A;  1FJL A;  3CMY A;  3GTK J;  3H9G A;  5GTH C;  1XSX A;  1H9T A;  4X0G A;  2L54 A;  4A3K J;  2DN0 A;  4AD9 A;  1Z0X A;  2RNJ A;  2XF6 A;  1XN7 A;  2L9V A;  2DPU A;  2DDB A;  2EJR A;  4Y13 A;  3S1M J;  2FOK A;  1STZ A;  2HI3 A;  5FJ8 J;  3KX2 A;  1G3T A;  1Y8R B;  4MNU A;  2X85 A;  2RDP A;  5F1J A;  4BHC A;  1P7I A;  1Z7L A;  2L7M P;  4FHT A;  3GTO J;  3SZG A;  2K3P A;  5IP7 J;  5HDG A;  2P8T A;  3KLN A;  5J8F A;  1I27 A;  2O7O A;  3OYM A;  2QCO A;  2Y75 A;  2L7F P;  4M73 A;  1I6X A;  4E7L A;  2EIJ H;  3E6M A;  4CCN A;  5D6F A;  2VQG A;  3DEE A;  2DFI A;  3FHN A;  4G6T B;  2FE3 A;  1KU7 A;  1Z3X A;  1X1P A;  1ETY A;  2A6H F;  4KA4 A;  3VB2 A;  2W84 A;  2BHZ A;  4L5J A;  5F04 A;  3ZQ7 A;  5EDN A;  2XV4 S;  4M9X A;  1V5E A;  3P9C A;  1TWF J;  4XKW A;  3DP7 A;  2ZNY A;  2IBD A;  3H3U A;  4GCV A;  5L3G A;  2JN6 A;  2KRH A;  4H4K C;  1IZ1 A;  4RLQ A;  4LIV A;  2VOO A;  2KQR A;  1S3J A;  4DGW B;  1QNT A;  3SJM A;  1BJZ A;  2O9L A;  3JAM K;  1UMQ A;  1S6L A;  2KPM A;  2MYS A;  5JLX A;  3BZK A;  3S32 A;  1ZYR F;  3M8E A;  4CCM A;  1HDD C;  2H1L A;  2VKD A;  4MEX F;  3ZQC A;  2CU7 A;  4B47 A;  3QOE A;  4N4O B;  4E4H A;  2K40 A;  3OYG A;  3D0S A;  1SC7 A;  2V1N A;  3RKQ A;  1FP1 D;  2KFD A;  1FLI A;  3LST A;  3VYR B;  2XRL A;  4YFX F;  5LGU A;  1FEX A;  5K5Q A;  4UUV A;  4KIF A;  4IPA A;  2V1D A;  1BIB A;  1DGR M;  1U5T C;  4G7Z F;  2W82 A;  2RNG A;  5CPR B;  5J1Y A;  4IZZ A;  1V4R A;  4D5F A;  2Q8K A;  1XX5 A;  3IAM 2;  1Q1H A;  1GVD A;  3RDI A;  4P9U A;  2L9R A;  2LP0 A;  3PNT A;  3K4K A;  3T1B A;  4X1E A;  1LDD A;  1Z6R A;  1VQ5 I;  3DCF A;  2WV1 A;  3KZZ A;  1FZP B;  2UXX A;  5EG0 A;  2BVM A;  4HW0 A;  2WA0 A;  5DUI A;  1YG2 A;  2R7Z J;  1I1S A;  5HOO A;  2GWR A;  1VQO I;  2FJ1 A;  3EUH A;  2KIM A;  1N78 A;  3U2R A;  1WCM J;  1XSV A;  2RGV A;  2M45 A;  4M3E A;  4PJ0 C;  4BJT A;  3B6C A;  3S3M A;  3GFJ A;  3GZN B;  1MIJ A;  2IGN A;  1CQT A;  3JR9 A;  1JI8 A;  2X48 A;  1H88 C;  2X9D A;  4Z2Y A;  3ISP A;  4RS8 A;  1ERD A;  2VKH A;  2X6Y A;  3CLO A;  2K86 A;  1T33 A;  1GLN A;  4D9J A;  3OYH A;  1BL0 A;  4I76 A;  2LTP A;  3JTH A;  1IXC A;  2W4S A;  4WXH A;  1IG7 A;  2R7O A;  1F5T A;  5FKO A;  2DQR A;  1YLF A;  1AA7 A;  1ODD A;  3BPX A;  1ETW A;  1MZB A;  3R0J A;  4M6X A;  4XRS G;  4XN0 A;  1N25 A;  1UCR A;  1WJC A;  4ZYE A;  1TWG J;  3F21 A;  2EK5 A;  2M30 A;  3U9G A;  4Y7N J;  2BY3 A;  2JA6 J;  1YIJ I;  4PJL A;  3WU1 B;  1TT5 B;  2QZ8 A;  4IOA F;  5LD2 C;  3H5R A;  4BEH A;  4NQW B;  2W57 A;  2VLA A;  2L9S A;  3S1N J;  1R36 A;  4XBF A;  4BXU A;  4MIM A;  5HLI A;  4IHT A;  2PBI A;  1QZE A;  5C3E J;  3SDB A;  4HDV A;  5J6X A;  3LSR A;  1MBK A;  3E5U A;  2FNP A;  3L2C A;  2WB1 N;  3BRO A;  4OIO F;  1YTY A;  1USS A;  3IWF A;  3O6B B;  5TGT A;  4LFU A;  1X3Z B;  3J81 Z;  1W7P D;  2VBX A;  1UFM A;  2G9W A;  2XPW A;  5E1Z B;  3M07 A;  2IRF G;  3A4C A;  5D8K B;  1M1E B;  1K78 B;  3L2U A;  4M72 A;  3HKZ A;  3DWL E;  2HS5 A;  1KQ9 A;  5ERI A;  1XC5 A;  3RYR A;  1KU3 A;  2QEX I;  2F6C A;  4IKF A;  1G3Y A;  4CGZ A;  2R7R A;  2RRE A;  4YG2 F;  4S05 A;  2LNB A;  3GUD A;  4CA0 A;  3JRH A;  5E3M A;  5KAI C;  4RGX A;  3FKJ A;  3B02 A;  2LF7 A;  1RRJ A;  1QPM A;  3BP8 A;  2KHM A;  2V26 A;  2VC0 A;  5DM7 F;  3HM5 A;  1IRX A;  5JHU A;  4AIJ A;  1HDP A;  3PM1 A;  2WAQ N;  2B9S A;  3TP3 A;  2LRE A;  2PX9 A;  4I09 A;  3GYH X;  3V7S A;  3NEU A;  4RAY A;  3QPH A;  3K4M A;  4UV8 A;  5EJC A;  5BMZ A;  1B9N A;  4TV7 A;  1F9N A;  1ZR2 A;  5FRN A;  2EV6 A;  4QTR A;  4BQO A;  2LVS A;  2TDX A;  3V4G A;  1A6I A;  3D5S C;  2GLO A;  1VQM I;  3ASO H;  4DNC A;  3HGG A;  3AG2 H;  1XGS A;  2JRT A;  5D5X B;  4DYQ A;  2J5O A;  3RJP A;  2DOE A;  5K7Z A;  2LKS A;  5HDK A;  1K4S A;  4RAG A;  3I64 A;  2QQB A;  1ZAO A;  1ON1 A;  1WGX A;  2WAD A;  3WE2 A;  2M2E A;  2RVC A;  4L9N A;  1C0W A;  3WTZ A;  4WF2 A;  3S15 J;  1WJA A;  2RN7 A;  3J7Z I;  3LAP A;  3GW2 A;  2Y9Z A;  5D5V B;  2K7L A;  5FKN A;  1G6N A;  4S04 A;  1FNN A;  3REO A;  2HNH A;  3EQL F;  4DIQ A;  4XOR A;  4S0H B;  3C1D A;  2GZW A;  4DW6 A;  1XSD A;  4A3B J;  4BQQ A;  3SEQ A;  2L4A A;  4DZJ A;  5J8C A;  3L2R A;  5K1Y A;  4HSR A;  2E1M B;  2YUS A;  5GPC A;  3TDU C;  2JSC A;  1PP8 F;  1P4W A;  3BR3 A;  3LA7 A;  2ZC2 A;  3CDI A;  2XDV A;  1SFX A;  1ON2 A;  3OR1 C;  3DU6 A;  3GO5 A;  2CW0 F;  2DDA A;  2CQK A;  4M9S A;  4G6D A;  3FIW A;  2I8D A;  1B6A A;  2NOJ B;  3LQR A;  4CSW A;  1TNS A;  1YQA A;  1YS7 A;  3WG7 H;  2MSY A;  3P9K A;  3IV5 A;  3O8H A;  3E3V A;  3BJO A;  2P7C B;  3K10 A;  3CDH A;  3DBR B;  4I02 A;  2X4H A;  2EFN A;  5CLS A;  5GP9 A;  3L7W A;  4MLO A;  3TO7 A;  5K5R A;  3OL4 A;  5FKK A;  3SXY A;  2ME6 A;  4MGR A;  4A3G J;  1S7E A;  3WGH A;  3CP2 A;  3FKI J;  1FMV A;  3GFI A;  3I53 A;  2B0L A;  3KP3 A;  1E3P A;  4B43 A;  1IN6 A;  3HSF A;  5K5O A;  1SMY F;  2Y48 A;  2A07 F;  2LFB A;  2R7X A;  2EB7 A;  2QF7 A;  2VE9 A;  1GXP A;  3S14 J;  3RPU D;  4KUM A;  1A5J A;  1AU7 A;  3L00 A;  1APL C;  2L7Z A;  2X51 A;  3CMM A;  4XLE A;  4A3I J;  4EGZ A;  3D5R C;  3IH3 A;  1K61 A;  3F8B A;  1PJR A;  4Y52 J;  1GVJ A;  2PQ8 A;  5FLX Z;  1WPK A;  4L18 B;  2XB0 X;  4ZDO A;  2DA3 A;  2BZT A;  5LHH A;  4II3 A;  4A3J J;  3IWZ A;  1IXS B;  4PCQ A;  4W97 A;  2EFO A;  2A3S A;  2LSO A;  1TWC J;  4XM3 A;  3F8F A;  2ACJ A;  1BW5 A;  4DBR A;  4GYG A;  4PFP A;  2BV6 A;  2UWM A;  5LLQ A;  1BM9 A;  4NC7 A;  5DEQ A;  2DA1 A;  2R7D A;  4KYW A;  3HOS A;  3DKX A;  5H20 A;  3RPU A;  1O7F A;  1ZRD A;  4RM3 A;  5D4S A;  2VB6 A;  3KET A;  2KZV A;  1AKH A;  3JRA A;  2CH0 A;  2E1C A;  2VN2 A;  1X2M A;  4KIB A;  2Z16 A;  2KDO A;  2CSO A;  2CV0 A;  2P0W A;  3G73 A;  1FPQ A;  2CUE A;  2XPV A;  1W0U A;  1HST A;  4ITV A;  3OY9 A;  3LSK A;  1SFK A;  5FGM A;  3FXM A;  3NAR A;  4DBQ A;  1W5S A;  3WU2 C;  1RUO A;  2DMT A;  2OD5 A;  2DTZ A;  1K83 J;  5DM6 F;  2DJI A;  3DPL C;  3U21 A;  1KQ8 A;  3TBI A;  1FP2 A;  2OJE D;  1J75 A;  4AIH A;  3T8R A;  3GTL J;  1HC8 A;  1B1B A;  1WFX A;  3PQJ A;  5D8L B;  1TQM A;  3KCC A;  4C9Y A;  4HLX A;  2XB5 A;  5CVJ A;  2CGP A;  4BY1 J;  1FX7 A;  1Z1D A;  2BXY A;  1OPC A;  2STT A;  5FKL A;  3OS1 A;  4KT6 A;  1B72 B;  1VQN I;  2JQ7 A;  1ZG3 A;  3OWT A;  4A5M A;  3KLO A;  2FEZ A;  4MQV A;  2OCE A;  4OAZ A;  3BTL A;  1LEB A;  4RBO A;  4I2O A;  4RGU A;  1FYL A;  1E17 A;  2AQF A;  3FHZ A;  3V8K A;  2JA7 J;  5F08 A;  2E36 A;  4M3D A;  1SFE A;  4CCO A;  2EFW A;  1G2H A;  2OA4 A;  5BPI A;  3HSE A;  2IA2 A;  1FTT A;  5L3B A;  1Y6I A;  2YU3 A;  3H3V K;  5J4Y A;  4IHX A;  5GTI C;  3WOD F;  5B3S H;  2XAS A;  1P2F A;  1MBE A;  1P7J A;  1I50 J;  3QU3 A;  2ID3 A;  4R8H A;  3AAF A;  3AL0 C;  3K4N A;  4HX8 A;  1YIT I;  1P6R A;  5TRD A;  2KRC A;  1T98 A;  2IA0 A;  2VUM J;  3P5J A;  1HQC A;  1XS9 A;  3IL2 A;  3JAM Z;  2DA7 A;  1D0Z A;  4E7S A;  3I55 I;  3QU6 A;  3BTC A;  3DV8 A;  5CJ9 A;  4A0Z A;  1Y1W J;  3IKV A;  1RET A;  2CWE A;  1BA5 A;  4ZYG A;  1XPX A;  1QVU A;  3UNG C;  4M3G A;  3CJN A;  3HUG B;  3LSG A;  5GAD J;  4NC6 A;  2WC2 A;  2HKO A;  1K6O A;  1POG A;  2KMU A;  4ENK A;  2MW8 A;  5FRM A;  3EUH C;  2L9N A;  4ABZ A;  3ECO A;  2K27 A;  3LA3 A;  4XN3 A;  2QA4 I;  3IKT A;  3MMY B;  4CH7 A;  2FBK A;  5EG0 B;  2VJ5 A;  4U7D A; 
#chains in the Genus database with same CATH homology
 1ETQ A;  3OIO A;  1RPW A;  4RDU A;  1PUF B;  1QPI A;  3JRC A;  1U9O A;  3JRF A;  2E1O A;  1OCP A;  5EZG A;  1ETY A;  3HDD A;  1T56 A;  5F04 A;  5EGO B;  4D5C A;  5EDN A;  2DMQ A;  4A3F J;  1TWF J;  4XRS A;  2MGQ A;  3Q0V A;  1JTX A;  2IBD A;  2EZH A;  2JN6 A;  4IEJ A;  1HOM A;  3HOZ J;  3SJM A;  3HBL A;  3UKG A;  1BJZ A;  3S1Q J;  2O9L A;  1OFC X;  1UMQ A;  2K9S A;  1FIP A;  2W48 A;  5JLX A;  1MSE C;  4AUX A;  2AO9 A;  2JWT A;  1QRY A;  1ZR4 A;  1HDD C;  3OOU A;  3ZQC A;  2CU7 A;  3GTM J;  1WH7 A;  2K40 A;  3Q3S A;  3SDG A;  3RKQ A;  3IH4 A;  3D1N I;  2VKV A;  1LFU P;  2XRL A;  4X6A J;  4FTH A;  3Q0U A;  1ETO A;  1FEX A;  1DU6 A;  4UUS B;  4XID A;  2E2I J;  2NS8 A;  3BR0 A;  5J1Y A;  1X2N A;  3TW6 A;  4D5F A;  4IHW A;  3I4M J;  1LE8 A;  5M3F J;  4B3A A;  3HOU J;  3W6V A;  2B63 J;  1WI3 A;  2K9N A;  1GVD A;  3OSF A;  2HXI A;  2L9R A;  2LP0 A;  3WHB A;  4X1E A;  1JKP C;  3HOY J;  1GUU A;  2JJ7 A;  2O8K A;  2E19 A;  5F0C A;  4M6V A;  2ME0 A;  1MBF A;  1GV2 A;  3DCF A;  2WV1 A;  4V2G A;  5EG0 A;  5FLV A;  2R7Z J;  3MKL A;  2HYJ A;  3SFI A;  2FD5 A;  3HOW J;  2R93 J;  2FJ1 A;  3LSJ A;  5IP6 A;  4B1R A;  1WCM J;  4A3M J;  1NK2 P;  4M3E A;  2R0Q C;  3BR6 A;  1IUF A;  3B6C A;  4NDL A;  3HKZ N;  1LE8 B;  3GTG J;  2M9H A;  1CQT A;  3JR9 A;  1ZQ3 P;  2X48 A;  1H88 C;  1IRZ A;  2X9D A;  2IAI A;  5F0H A;  1H8A C;  5E3N A;  1T33 A;  3LNQ A;  3BR5 A;  2IEK A;  1BL0 A;  3ZQH A;  4JYK A;  1I3Q J;  4I76 A;  2LTP A;  2CJJ A;  2VKE A;  5M3M J;  1IG7 A;  3DEW A;  4MO7 A;  2YU9 J;  2ECB A;  5FKO A;  1OJL A;  4XRS G;  5EG0 B;  4I6Z A;  1ETW A;  2EZK A;  2ZB9 A;  1JJ6 C;  3L1P A;  4CYC B;  3I4N J;  3WHC A;  1ZGW A;  1DU0 A;  3G1M A;  1TWG J;  3ZQG A;  2JA6 J;  3K2A A;  4Y7N J;  3PO2 J;  2E2H J;  1HLV A;  4JX6 A;  1QVT A;  3BQZ A;  4W1U A;  4A69 C;  3ZOB A;  2VI6 A;  3S1N J;  1IDZ A;  2OPT A;  4D7M A;  3HOX J;  3RQI A;  4MIM A;  5DTD A;  1ITY A;  3BR2 A;  5C3E J;  2XPU A;  3LSR A;  3A02 A;  1U8B A;  1MBK A;  4BBS J;  1RKT A;  1U78 A;  2WB1 N;  2K9Q A;  1D5Y A;  2H8R A;  2Y31 A;  1JT0 A;  1GT0 C;  3RZD J;  2XPW A;  2L0K A;  2LKX A;  1XC5 A;  1WH5 A;  5F0F A;  2TCT A;  2HOT A;  2HQ5 A;  1RKW A;  3MN2 A;  2HXO A;  3QPL A;  4FE7 A;  1HCR A;  3JRH A;  5E3M A;  2E2J J;  1VND A;  5BNG A;  3ZQF A;  2N8G A;  5C44 J;  5M5X J;  2NVT J;  1O4X A;  5GPA A;  3S2H J;  4XK4 A;  3E7L A;  4HNV A;  4QIW N;  4JP0 A;  2EBI A;  2Y9Y A;  2R5Y B;  3HM5 A;  5JLW A;  2DA5 A;  1HDP A;  3PM1 A;  2WAQ N;  3TP3 A;  4CYC A;  4DYR A;  5EYR A;  3GTQ J;  2P81 A;  1ZR2 A;  4QTR A;  4C3J J;  2CUF A;  2LVS A;  1JUM A;  2LD5 A;  2NVX J;  1A6I A;  3F0C A;  2GLO A;  5C4J J;  1JUS A;  1R9T J;  1XG1 A;  3HGG A;  1GV5 A;  1HF0 A;  3CDL A;  4DYQ A;  1TWH J;  4IHY A;  2AHQ A;  5J1U A;  5K7Z A;  2M0C A;  2R5Y A;  3BT9 A;  1ENH A;  3VPR A;  1WGX A;  2M2E A;  3TW7 A;  4C2M J;  1H89 C;  4BKX A;  2GBY A;  3S15 J;  2LK2 A;  4A3C J;  1MH4 A;  2Y9Z A;  2I10 A;  4J19 A;  2Y0S N;  4A3D J;  5FKN A;  1MNM C;  3HEF A;  3A03 A;  1MBJ A;  1Q1V A;  5EEA A;  5C4X J;  5E3L A;  2JK3 A;  3QQA A;  1Z77 A;  3JRE A;  1VI0 A;  4S0H B;  4DW6 A;  3FIS A;  5M5Y J;  4A3B J;  1OCT C;  4DZJ A;  3H0G J;  5IOZ A;  2YUS A;  5GPC A;  2DMP A;  2XGC A;  3B6A A;  3BR3 A;  4FE4 A;  2DMN A;  4UUT A;  3JRI A;  1EF4 A;  3IH2 A;  4BXX J;  1MH3 A;  1UG2 A;  3BR1 A;  1BW6 A;  3FIW A;  1MBH A;  2XSD C;  1MBG A;  2EZL A;  3TP0 A;  4BBR J;  2MSY A;  1IJW C;  3HGY A;  3IV5 A;  5EZH A;  3O8H A;  5HOD A;  2HOS A;  2DMU A;  1JUP A;  1U9N A;  4M3F A;  5F27 A;  2Y30 A;  5GP9 A;  1X58 A;  3CQZ J;  4MLO A;  5FKK A;  3JRB A;  1MSF C;  2ME6 A;  4A3G J;  1S7E A;  1JT6 A;  3FKI J;  3BQY A;  4LOC A;  3ZQL A;  4C3H J;  5M5W J;  3PO3 J;  1UHS A;  2RAE A;  2XGE A;  4IHV A;  1ETV A;  3OSG A;  2R92 J;  5K7F A;  2PMZ N;  1ETK A;  2LY9 A;  2LR8 A;  2LFB A;  2M8G X;  2QF7 A;  2NVY J;  3S14 J;  2Y2Z A;  3BTJ A;  5IYC J;  2OF7 A;  1IDY A;  5IP9 J;  1A5J A;  3HOV J;  3S2D J;  1IGN A;  1AU7 A;  1APL C;  2L7Z A;  3BG9 A;  1SFO J;  1I6H J;  1AKH B;  4A3I J;  2M34 A;  4JX5 A;  2EH3 A;  1JKQ C;  3IH3 A;  1K61 A;  3G1L A;  2H1K A;  2FQ4 A;  2NOG A;  3GBG A;  1JKO C;  3TED A;  4Y52 J;  1FIA A;  5J1R A;  4A3E J;  3FK6 A;  1B8I A;  5K7H A;  1ZK8 A;  1WPK A;  1NTC A;  2XB0 X;  2DA3 A;  4DYC A;  1ZKG A;  3JRG A;  4A3J J;  4EEF G;  1VFC A;  2CRG A;  4W97 A;  3K7A J;  5FKM A;  1TWC J;  1ORK A;  4G12 A;  5EF6 A;  1GDT A;  3JRD A;  1BW5 A;  3GTP J;  2DA1 A;  4BY7 J;  9ANT A;  4FCY A;  3QPS A;  2G0E A;  1JKR C;  2CQX A;  1FTZ A;  1IV6 A;  1AKH A;  3JRA A;  1X2M A;  4AC0 A;  4AYB N;  2DA2 A;  1B8I B;  2CUE A;  2XPV A;  2EZI A;  4B4C A;  2LLK A;  3O8G A;  4XRM A;  1W0U A;  1F43 A;  3NAR A;  4M3B A;  1JGG A;  4L5E A;  3NAU A;  1VF9 A;  2DMT A;  1YRN A;  2DTZ A;  1K83 J;  3BTI A;  2CQQ A;  2R5Z B;  2JMW A;  3MVP A;  1JTY A;  3GTJ J;  2NVQ J;  2FX0 A;  3S1R J;  2ID6 A;  3GTL J;  3S16 J;  2XB5 A;  2DA4 A;  4MFE A;  4C3I J;  4BY1 J;  4D7N A;  5FKL A;  3M3Y J;  1B72 B;  2KDZ A;  3M4O J;  3RZO J;  5IYD J;  1TWA J;  1ZTR A;  5IOY A;  2X6O A;  2HOA A;  2D5V A;  3BTL A;  1F36 A;  4RBO A;  3CCY A;  4MFD A;  1PUF A;  2MG4 A;  2R5Z A;  2JA7 J;  5F08 A;  1JJ8 C;  4M3D A;  3LSP A;  2JA5 J;  2HDD A;  1G2H A;  1SAN A;  3C2B A;  4JX4 A;  2COB A;  3HB9 A;  5E3O A;  5IYB J;  1FTT A;  3Q0W A;  5DS9 A;  1RR7 A;  4IHX A;  3H3V K;  4DZP A;  3A01 B;  1B72 A;  3G1O A;  5IPA A;  2GM4 A;  1MBE A;  1P7J A;  4A3L J;  2EQR A;  1I50 J;  2ELK A;  1ETX A;  1W0T A;  2ID3 A;  3BG3 A;  4FIS A;  4XIC A;  1E3O C;  3S17 J;  4V2F A;  3LOC A;  2VUM J;  1XS9 A;  1FJL A;  2DA7 A;  3CMY A;  3GTK J;  5J3L A;  1IC8 A;  2NS7 A;  4A93 J;  2JA8 J;  2DJN A;  3BTC A;  4A3K J;  2DN0 A;  1YRN B;  4GFB A;  1Z0X A;  2ECC A;  1Y1W J;  1TC3 C;  3BG5 A;  1RET A;  4UUS A;  3A01 A;  1BA5 A;  2TRT A;  1QVU A;  3ZQI A;  4M3G A;  2HI3 A;  3FK7 A;  4QSH A;  3LSG A;  3S1M J;  5FJ8 J;  5EGO A;  1LFB A;  2XGD A;  5F1J A;  1P7I A;  2L7M P;  2YS9 A;  3GTO J;  1POG A;  1NK3 P;  1RES A;  2MW8 A;  5FLM J;  1AHD P;  5IP7 J;  4ABZ A;  2KT0 A;  2O7O A;  2QCO A;  2DA6 A;  2L7F P;  2VPR A;  1Y1V J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...