1K83J

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k83J00
2M34A 3TP3A 2KDZA 1VI0A 2R5YA 5K7ZA 1DU0A 2E2IJ 3G1OA 2Y9ZA 1QVUA 2ECBA 3WHCA 1GV5A 3HM5A 2DN0A 1A5JA 1FEXA 1P7IA 4A3LJ 5EZGA 4XIDA 1F36A 3S1NJ 4BY1J 2JWTA 2LY9A 4BBRJ 3JRHA 2DA1A 1F43A 5C3EJ 3S1QJ 3IH3A 2Y2ZA 5M3FJ 4CYCB 3Q0VA 4BXXJ 1AKHB 3PO2J 2HOTA 2ECCA 3DEWA 3GTJJ 1ZK8A 1WH5A 4I6ZA 2KT0A 2VUMJ 2TCTA 1HCRA 1CQTA 2M0CA 3HB9A 4MO7A 4UUSA 2ID3A 3SFIA 1VF9A 2XGDA 4LOCA 2NVQJ 2L7MP 2CRGA 3A01A 3BR5A 4FE4A 1T56A 2M2EA 3G1MA 5IP9J 2NVYJ 2YS9A 1PUFA 2OF7A 3GTMJ 2AO9A 5FKKA 4A3EJ 3BR0A 3HDDA 2DMPA 1OFCX 5J1RA 2JJ7A 1TWHJ 2N8GA 3Q3SA 1O4XA 2R7ZJ 2FX0A 1HDPA 2HI3A 1XG1A 2FJ1A 2WB1N 2Y31A 4JP0A 3WHBA 5J1YA 1NK3P 5EG0A 3HOUJ 2CQXA 4MIMA 2HXIA 5IP7J 3ZQGA 1YRNB 2E2JJ 4GFBA 5HODA 1VNDA 4C2MJ 2XB0X 1OCTC 2VPRA 5K7FA 2ME6A 1JT6A 2HYJA 2R93J 1X2MA 4MFEA 3K2AA 2XRLA 5FKMA 1UMQA 1ZGWA 3PM1A 2K9QA 5F1JA 3OSFA 1APLC 2QF7A 2K9NA 2DMTA 3MN2A 3JREA 4AUXA 4W1UA 4L5EA 5FLMJ 1HDDC 3IH2A 3JRCA 2R5ZB 1ZQ3P 2FD5A 4CYCA 5FKNA 3LSRA 1ORKA 1AKHA 1RKTA 2LTPA 5FJ8J 1Z0XA 4A3BJ 3Q0UA 2WV1A 3HOWJ 1MNMC 2XSDC 5E3OA 1BL0A 4JX6A 4DZJA 4A3CJ 3JRGA 4X6AJ 3O8HA 4M3GA 1GDTA 4UUTA 1X58A 1S7EA 2DA2A 2CJJA 3BQZA 2MGQA 5EZHA 1HOMA 2LP0A 1ENHA 1H89C 4IHXA 1U8BA 2G0EA 2XPWA 5IPAA 3HGYA 2DA6A 1G2HA 2XGEA 1SANA 2ID6A 1ETWA 4J19A 3S1RJ 1U9OA 4B4CA 3E7LA 2XB5A 5GPAA 2LD5A 2XPUA 2MW8A 3S2DJ 1JKPC 3TW6A 2E2HJ 4V2FA 1X2NA 2Y0SN 1MBEA 1ZR4A 3F0CA 1RESA 5C4XJ 3LSGA 4QSHA 1I3QJ 1Q1VA 3ZQLA 1JTYA 1AHDP 4FCYA 5IOZA 4FE7A 3BR3A 3D1NI 2DA4A 4DYQA 1MH3A 5JLXA 5GPCA 2H1KA 1IGNA 2GM4A 2DMQA 1IG7A 1TWAJ 1JJ6C 4JX5A 5E3LA 3GTLJ 1RPWA 4DZPA 2D5VA 5J1UA 1U9NA 1LE8A 1ETYA 1K61A 5J3LA 1GUUA 4M6VA 3HEFA 5E3MA 1H88C 4A3DJ 2VKVA 5M5XJ 1FTZA 5DS9A 4XRSA 2EZKA 1ETOA 1NTCA 3BR6A 2DA3A 3HGGA 3OOUA 5IYCJ 1GVDA 2TRTA 2LKXA 3S17J 1IV6A 2JA7J 4XICA 2QCOA 4XRSG 2LK2A 1E3OC 1QVTA 2YUSA 3A02A 3HOYJ 2I10A 1BW5A 2L7ZA 3MVPA 4FISA 1UG2A 1Y1WJ 3S1MJ 1JT0A 2K9SA 4NDLA 1FTTA 5E3NA 2HDDA 1HLVA 4M3BA 3DCFA 5IYBJ 1IRZA 2HOSA 2LVSA 1FIAA 3GTQJ 4D5CA 5IYDJ 3JRIA 4I76A 3M4OJ 4V2GA 1WPKA 1IDZA 4S0HB 3GTOJ 2RAEA 3OIOA 2IBDA 3ZQHA 1BJZA 1RKWA 2Y9YA 2NOGA 3FK6A 2DA7A 4FTHA 4W97A 3FISA 5EF6A 2NVTJ 3LSPA 1K83J 1H8AC 1T33A 4XRMA 1FIPA 1MBKA 3BT9A 2X48A 5F04A 2EQRA 4A93J 3CDLA 2EH3A 2O9LA 2R5YB 1OJLA 4Y7NJ 1GV2A 1XC5A 2IEKA 1MBFA 4IHVA 5EEAA 5EGOB 3LNQA 1MBHA 4Y52J 5IOYA 4A69C 3BTLA 3ZOBA 1MBJA 1JTXA 2VI6A 2EZIA 4B1RA 3W6VA 1ETKA 4D7MA 5M5YJ 2YU9J 5M5WJ 1JGGA 2E19A 2NS8A 2OPTA 1ITYA 2E1OA 3B6CA 5F27A 5FLVA 3HOZJ 2EZHA 1MBGA 3TW7A 3UKGA 2M9HA 1BA5A 1ZTRA 4IHYA 2ZB9A 2DMNA 2NVXJ 1ZKGA 2JA8J 4A3FJ 3BR1A 1RETA 2GLOA 1RR7A 4M3FA 3CMYA 2HQ5A 4X1EA 1JKRC 2FQ4A 4BY7J 3ZQIA 4UUSB 1R9TJ 1JUSA 1ZR2A 1YRNA 5F0FA 3A01B 2JK3A 4IHWA 3OSGA 1WH7A 2P81A 5F08A 4MLOA 1PUFB 1WI3A 5EDNA 1I6HJ 3ZQFA 2ME0A 3FKIJ 1JUPA 3K7AJ 2VKEA 9ANTA 1W0TA 1IJWC 3BG9A 3BG5A 4AC0A 3QPLA 3QPSA 3IV5A 2R5ZA 4A3JJ 1POGA 1WCMJ 2DTZA 3BTIA 3MKLA 1MSEC 5JLWA 1IUFA 1B72B 3ZQCA 5EG0B 2IAIA 3C2BA 4HNVA 2HOAA 1I50J 1MSFC 5GP9A 5EGOA 1QPIA 4XK4A 2COBA 2ELKA 2L0KA 2NS7A 1EF4A 2DA5A 3S15J 3S2HJ 2W48A 5C4JJ 1B8IB 3PO3J 1NK2P 3BQYA 4JX4A 1ETVA 2O8KA 4M3DA 3BTCA 1QRYA 1IC8A 3RZDJ 3I4MJ 2XGCA 4C3JJ 1OCPA 1FJLA 1A6IA 4DYCA 3JR9A 3CQZJ 2LR8A 3GBGA 1W0UA 3GTPJ 4D7NA 1VFCA 1SFOJ 1P7JA 3S14J 1JUMA 1Z77A 4QTRA 2LFBA 3BR2A 3RQIA 3JRFA 2L7FP 2JA5J 2R0QC 1Y1VJ 1GT0C 3FK7A 2PMZN 3LOCA 1ETQA 1LFBA 3TP0A 4DW6A 2CUEA 2H8RA 2R92J 5DTDA 4BBSJ 2EZLA 2X9DA 2WAQN 4QIWN 1IDYA 2DJNA 4G12A 5IP6A 4BKXA 3M3YJ 2JN6A 1JKQC 3HOVJ 4AYBN 3IH4A 2DMUA 4MFDA 3GTKJ 1B72A 3QQAA 3O8GA 3H3VK 2XPVA 3SDGA 5F0HA 3B6AA 4B3AA 5M3MJ 2EBIA 3L1PA 4RBOA 3LSJA 2LLKA 1WGXA 4DYRA 3S16J 2JA6J 3RZOJ 3CCYA 4JYKA 3BG3A 3FIWA 3NARA 2CUFA 4RDUA 5FKOA 3SJMA 4C3IJ 1BW6A 1TWGJ 2MSYA 2B63J 1B8IA 2JMWA 3HKZN 4EEFG 1LE8B 2AHQA 2O7OA 2CQQA 3A03A 3HBLA 1MH4A 5K7HA 3VPRA 1HF0A 5FKLA 4IEJA 4A3KJ 1D5YA 1TWCJ 3BTJA 3NAUA 2K40A 3G1LA 5EYRA 4A3MJ 1XS9A 4C3HJ 1TWFJ 1JKOC 2L9RA 2Y30A 3H0GJ 2GBYA 4ABZA 1U78A 1LFUP 5BNGA 4A3GJ 2CU7A 1TC3C 3JRAA 3RKQA 4A3IJ 1UHSA 2X6OA 2MG4A 1JJ8C 3TEDA 1DU6A 4D5FA 3GTGJ 3JRBA 1AU7A 5C44J 2HXOA 4M3EA 3Q0WA 3JRDA 3I4NJ 2M8GX 5F0CA 1ETXA 3HOXJ
chains in the Genus database with same CATH superfamily
4TV7A 1QPMA 3CCMI 3QWLA 3CESA 3H36A 2Y9ZA 4HYEA 2RKHA 4Q4ZF 3UNGC 3A2KA 1VQKI 3R4KA 1GV5A 4CUGA 4PCQA 4AM3A 1FEXA 2L02A 1Z1DA 4NBQA 4A0YA 3O2PE 4CDGA 4UB6C 1F36A 5GADJ 3F6VA 1FOWA 4LIVA 5DCFA 3VFZA 3JAMK 5E8GA 1BR1A 3BC8A 2DA1A 1Z3XA 2HS5A 4I99C 3S1QJ 3IH3A 2JPCA 1D8KA 1SVOA 3R61A 2HQRA 1HSJA 4OOIA 4XKCA 2RDPA 3DEWA 4U0VA 3GTJJ 4I6ZA 3J7ZI 2YSRA 1HCRA 5ICCA 3EUHA 4HOBA 1CQTA 3KETA 3F6OA 3HB9A 1R5HA 4UUSA 4QPOA 1VF9A 2NVQJ 3V42A 3EYYA 3GW2A 4CHUA 2CRGA 4OIQF 2NOJB 3F21A 2W24A 3RYPA 1ZG3A 1T56A 2M2EA 3G1MA 4FE4A 4HSTA 2NVYJ 1BC7C 1HKQA 3E6DA 1KU2A 4GXOA 2DO7A 1D8JA 2PX9A 4A3EJ 5L3DA 2QYOA 2HDCA 2L5QA 4L9VA 2XGXA 1TWHJ 3AKZA 3HUGB 3OYAA 3CZ6A 4PJJA 4RAGA 1XG1A 4PUSA 3D5LA 1IXCA 2A05A 5HS9A 1BR2A 2CQXA 5HLIA 2OU2A 3CDHA 3ZQGA 5IP7J 2E71A 1YRNB 1RUNA 2E2JJ 4UV9A 2VT2A 1VNDA 1VZ0A 3DEEA 2OA4A 5AONA 4R79A 5K7FA 3RKYA 2DQRA 2ME6A 3KP4A 2HYJA 2K02A 3Q9VA 3BJ6A 2XRLA 4XM3A 1UMQA 5HLGA 3OS1A 1ZGWA 1K79A 3SZPA 3U21A 2QF7A 5E1WA 1OYWA 3CCSI 2LOOA 1APLC 1FPQA 2V1UA 5AIPA 1PYVA 2V26A 1RIOH 3JRCA 2XKPA 1ZQ3P 2OBPA 2ICWG 4XNFA 1ORKA 1FC3A 2WBMA 4S05A 1AKHA 1RKTA 2K9MA 3EUKL 4LIUA 3RKWA 3SYTA 3W2WA 3AL0B 2FA5A 2L9SA 3K4KA 2E1MB 1VQ7I 3Q0UA 2IP2A 3C2GA 2HVSA 1BL0A 4WXCA 2VBZA 2EPFA 1O7FA 3KEOA 3W3CA 2DYRH 3O8HA 4M3GA 1YX3A 3T8RA 3K4JA 1ZAOA 2CSOA 3BQZA 1KQ9A 4HQEA 3QYEA 2MGQA 4BAYA 2O6GE 5IPAA 1YI2I 1S29A 1SANA 2ID6A 1TNTA 2JT1A 2X4HA 3NWSA 4GYGA 1IN5A 3ZMVA 1U9OA 1VQ5I 2H6BA 4EM2A 4KIBA 2EK5A 4V2FA 3IAS2 4YFNF 5DV5A 2CFOA 2LG4A 3KP2A 1ZR4A 1A36A 4B48A 3LSGA 3AG2H 4QSHA 3QPTA 4U0YA 1B9MA 2VONA 2Q2EA 4F7ZA 2VC0A 4FCYA 5IOZA 5A2QZ 4L0YB 3GLLA 1S9HA 2KJBA 3BR3A 2M1BA 4NHJA 4UB8C 2FE3A 4EM0B 2ZCWA 5JLXA 5GAEJ 2CMPA 1IGNA 2FNAA 2IVMA 2D2WA 3KYLA 4JX5A 5E3LA 3HPHA 4CICA 3EYIA 4EJOA 4PGHA 2KP6A 4I02A 1U9NA 2WB1A 4FX0A 2V9VA 3T5XA 1WVRA 1ETYA 5LGUA 3LFUA 1MJAA 3OOPA 4E7SA 4IL6C 4M6VA 4E4HA 3HEFA 3KP5A 5E3MA 1TT0A 3FXKA 3IHUA 4HZFA 3P5JA 4L9JA 4WXDA 3L9FA 1OCCH 5FFXA 5K5RA 4EATA 2E36A 2OD5A 3MZ8A 1FTZA 2CYYA 1W36D 2A5YB 1C0WA 2P5VA 2LKXA 2AS5F 2MLGA 1LNWA 4GO1A 3CMMA 4M71A 2JA7J 2QBYA 2JUCA 1W36C 3SXYA 4KA4A 3K2ZA 4G9YA 3HOYJ 3VEPA 2EFWA 3CUOA 5FLXK 3VWBA 4XONA 2CW7A 4FISA 4I0AA 4CYDA 3H0DA 4FHTA 3RI4A 1IAWA 3IRRA 2EIKH 4KN7X 5JR3A 4IRIA 5D8KB 2IW5A 3E5QA 3MKWB 4IF4A 2DT6A 1FBQA 3ABKH 1N77A 3GFJA 3KCCA 1MJBA 1BIBA 1WPKA 4CSWA 4II3A 5JI6A 1FYKA 1REPC 2CV1A 2XF5A 2DI3A 2CW0F 5D4RA 3GTOJ 2IBDA 1SFKA 3ASNH 5D5VB 1ZG1A 2K4JA 2F6CA 1IRXA 1K6YA 1USSA 2JPBA 2R7WA 3LSKA 2Y9YA 3T8TA 3EETA 2DA7A 4W97A 3IL2A 2J5PA 1MBKA 1YS7A 3BT9A 4HX8A 3ZR8X 1S6LA 4A93J 1KQ0A 2EH3A 2F5VA 5EEHA 2UUZA 3DKXA 2GXGA 2VQHA 1BR4A 2BXZA 2IEKA 3A1YA 3FXQA 1MBFA 3I5UA 4PJMA 3PNTA 5CVJA 2XROA 4J01A 2QGUA 4UNOA 4PFOA 4IOCF 1E3PA 1SAUA 1KYWA 2KQRA 4XLPF 4HF2A 3I53A 4XQFA 1O3QA 5M5YJ 5H2FC 5ICGA 2P6TA 3NWTA 2NS8A 2OPTA 1LVKA 2PN6A 2EZHA 2LDUA 3HOSA 4J00A 1FOYA 1X19A 4IPAA 2LH9A 2UXNA 4IHYA 3RJPA 1V3FA 3GZ6A 1D5VA 2EIJH 4AVPA 1LEAA 1RR7A 2K9LA 4A12A 3S3NA 5FD5A 3TQNA 4GCVA 3E6BA 4M9SA 1X3ZB 2FQ4A 2RV8A 3FF5A 3QU6A 4BY7J 3ZQIA 5ED4A 1W5CC 3S2WA 1R71A 2UWMA 4LK0F 4UUSB 3E6CC 2OZUA 3LSTA 2Y69H 2ZMEC 3GXOA 2ETHA 3F23A 2P81A 3CMEI 2E1NA 1BOAA 3K4NA 2F2EA 2STTA 4XKBA 1R36A 2RVCA 5ICFA 4BYYA 5J4VA 1ONVA 2ME0A 4FQGA 1ACIA 2VKEA 1VQ4I 3N4MA 1WJFA 1B9NA 4M6YA 2F4OB 2Z2SB 4P9UA 2R5ZA 3H3ZA 2DTZA 1G8XA 3BTIA 1SMYF 5HDNA 3DKYA 3HTUA 5B66C 1Z7LA 4HLXA 3FMQA 2R7TA 2XIGA 1OYYA 4LJZF 4E7ZA 1J59A 2CQKA 3BJOA 2MH2A 4XK4A 3BP8A 3SZGA 1W7PA 3SFZA 2COBA 3REOA 3L2CA 1V54H 5KAIC 3GWZA 1G3WA 4LB6B 4YFKF 5LGNA 3J7YJ 3TDZC 4HNUA 2MD0A 5C4JJ 3H9GA 1B8IB 1NK2P 4CXFA 5FFZA 3GCMA 4JX4A 2M3AA 5E20A 2O8KA 1OKRA 1MMDA 1OMIA 2QSFX 2W7NA 2ZFWA 2LREA 3RZDJ 1A31A 3ABMH 4EV0A 2DOFA 3JR9A 2LR8A 3LFKA 4D7NA 4BS9A 3IWFA 2XKOA 3DTIA 3OYNA 2KZGA 4DJAA 1QZZA 2L7FP 2JA5J 2R0QC 2KIFA 3BWGA 1GT0C 2HOEA 2MC4A 1LFPA 3VDXA 1H9GA 3QOPA 3K10A 5CLSA 1TP4A 2A69F 2R92J 1YOVB 3J80K 4BBSJ 1I1GA 3WU0A 2WY8Q 5IT9Z 2HTSA 3FXMA 4Y15A 1X1PA 2DJNA 5IP6A 3P7NA 3L2UA 1QHGA 3AG4H 2Q8KA 4BQQA 1VQ8I 4MFDA 2HFHA 4YIRX 3WTXC 3GTKJ 2BOLA 2KRCA 3DTKA 3SDGA 4ZYGA 5L3FA 4B3AA 2EBIA 2V1NA 3VODA 4RBOA 4AIDA 4B43A 3L1PA 1OCOH 4PFPA 4I01A 4EJTA 2JA6J 2VASA 1S3JA 3CCYA 2HKOA 1Y8RB 2XAUA 4YFXF 1WJCA 4CCJA 2MSYA 2RN7A 3MEXA 2D1HA 1ZRDA 2JMWA 5TISC 3HKZN 3RPUA 2W25A 1YYVA 1U0JA 2QKLB 4IVNA 2K3FA 2EWNA 1IRFA 5B3SH 1YG2A 2L2OA 2DT7B 3FDYA 3A03A 2EV5A 2NVUB 5DM6F 1Z6TA 3H3UA 1SD5A 3CJRB 4BH9A 4WWCA 1R1TA 4XRFA 3QU3A 1VTNC 4BXFA 4F3QA 1MMGA 2ISYA 3FX3A 4L5JA 3WTZA 3KYDB 1TWCJ 3BTJA 2K40A 1OLTA 3H5AA 4P5OA 1JI8A 3BCBA 2QZ8A 4A5MA 2JVHA 1FBUA 1LDKB 3PIOF 4IOAF 1A6QA 4PJLA 4BNCA 3TDUC 5FD6A 2H8WA 2QBYB 3CC2I 5BPIA 4A3GJ 3JRAA 4BEHB 5DM7F 1VQOI 4NC6A 5B1AH 5LD2C 3BOQA 2Q1ZB 3CLQA 3CCLI 5KK1A 2R3SA 2FOWA 5C44J 1AU7A 3DKWA 3I4NJ 3Q0WA 2EFQA 1DPUA 3I0TA 1WQ2A 3HOXJ 2M34A 1DU0A 3NEUA 1VI0A 2CG4A 2V9PA 5CJ9A 2ESNA 2HKXA 2DXIA 4RB1A 4HDVA 2AXTC 1A5JA 3JW4A 4G7ZF 2FRHA 4A3LJ 5EZGA 1L3LA 4N0BA 1W5TA 2KFDA 4BY1J 2RREA 4A0ZA 1TW3A 2LY9A 3JRHA 2H09A 1MDMA 1S7OA 3HG9A 1IXRC 5CVIA 1NG6A 4S04A 1DGWY 1AWCA 2PMHA 3OIQA 4BHPA 1HKTA 2X6XA 5KNLA 1ZK8A 3I54A 2XAQA 1FZPB 2KT0A 2X1DA 1KYZA 5L3EA 2TCTA 2IA2A 2LKSA 2OZ6A 2MBFA 1Y0NA 5LHGA 4LOCA 1K4SA 4BXUA 2C6YA 2WV0A 2A6EF 2VT3A 3BR5A 2Z16A 3KEYA 5HVQC 3BPXA 3IRQA 4ZH4F 5FKKA 4RB2C 3E1SA 4D1QA 2EINH 4II2A 3OR2C 3BDDA 2G9WA 3O6BB 1OFCX 3SDBA 5J1RA 1XCBA 2JJ7A 1WJAA 5GTIC 2EA4A 2R7ZJ 1HDPA 4D0PA 3FM3A 2WB1N 1N78A 4P55A 4ZYHA 5TGTA 5EG0A 4PGGA 4QWQA 4MHGA 3BG7A 2V6EA 1GHCA 1DP3A 2COMA 2V7FA 4GFBA 2A68F 4KFCA 3WU1B 4C2MJ 3ZQQA 1BC8C 2VPRA 3BZCA 2JZYA 1JT6A 2PMUA 2RQPA 2ZXHA 3FZVA 1X2MA 3K6GA 1LUJB 3HTSB 3GEZA 3PM1A 5F1JA 4AIJA 4WXHA 3MN2A 3WGGA 4AUXA 4BUPA 1X4OA 4Q47A 5FLMJ 2R5ZB 2HQNA 2FD5A 5EJCA 4CYCA 3E0JB 4ENKA 4L5IA 1S8NA 3OYBA 2ZJRF 2E1CA 5FJ8J 2LTPA 1Z0XA 3ROUA 2WV1A 3VYUB 3BZ6A 2QKMB 5E3OA 2XSDC 4HDUA 2R7FA 2V1DA 3OYDA 3S3MA 4DZJA 1T8IA 4F52A 2GWRA 4MEYF 1N25A 3FHNA 3WTWC 3OS2A 1W7PB 1GDTA 1S7EA 3FXUA 1VQNI 2K3PA 1R23A 3CUQA 4O5VA 1USTA 2CWEA 3ML6A 2W82A 3VB2A 5JHFA 1O3RA 1YE9A 2OCCH 1U8BA 2G0EA 5K5OA 4IHSA 1UG0A 2DA6A 4C9YA 1WSUA 1G2HA 1MJ9A 2BZTA 2RGVA 3F8CA 1ETWA 4J19A 4XORA 3S1RJ 3OYLA 3VYSB 4B4CA 2MD5A 3RKXA 2XB5A 2VXZA 1YW7A 1Y0UA 1VQ6I 3CF2A 3M07A 1ZARA 1ZLJA 3ECHA 4WCGA 1JKPC 2OTJI 1JXSA 3W2VA 1FWZA 1X2NA 2Y0SN 2IA0A 3AG3H 3GFMA 4P9FA 4UXNA 3KYCB 3GO5A 4R8HA 1I3QJ 1XGSA 1JTYA 3HC7A 1D1BA 1FP2A 2BY2A 2QENA 4OIRF 1LVAA 2X6WA 1H0MA 3W2AA 2XF7A 4G8XA 4DYQA 2FXAA 1MH3A 2YX7A 5CYVA 1TWAJ 3FMRA 4PSWA 1PP8F 2VE8A 1WHUA 2DJIA 1F9NA 1U5TB 4ITVA 1LE8A 1Z05A 3CO7C 2KPMA 4DNCA 1IUYA 5TJJA 1D0YA 2KL4A 3ZCOA 4A3DJ 3HOTA 1FY7A 3T0YA 3F8FA 2L9VA 5M5XJ 2EZKA 3HL2A 2IA1A 3OR1C 4KMFA 2Y0MA 3DFGA 1ETOA 1LJ9A 3J81Z 2JTVA 1J9IA 3I59A 3HGGA 2VXDA 3ZMDA 4CCOA 2OQGA 5D6EA 3S17J 1MMSA 1R5GA 3GX4X 2LK2A 4L9TA 1QVTA 3A02A 1O3TA 4E7KA 4LK1F 3CTAA 2XVCA 1BW5A 1TZLA 3M1CA 4HPQA 3CC7I 3S1MJ 3U2RA 2IRFG 4NDLA 4P96A 1Y8QB 4BQOA 1T2KA 1FTTA 3ZXSA 3ZGKA 2ZC2A 2HDDA 4M3BA 1IRZA 2LVSA 1FIAA 3A0HC 3OYGA 3M4OJ 4V2GA 5DUKA 3FHZA 1ZHFA 5DD4A 2IPQX 2RQQA 4M9XA 2O0YA 4HQMA 1IDZA 2E7WA 3M7GA 2YX4A 2K85A 3OIOA 4FETA 4S0HB 4M72A 2L3DA 4CH7A 2DFHA 3ZMUA 1RKWA 2NOGA 3RTRA 4C2UA 3FISA 2OC6A 2VKDA 5J8FA 3DPTA 4XRMA 1OPCA 4KDPA 2EQRA 1WRJA 4FT8A 4Z2YA 2MABA 4RA2A 4KT6A 3KEQA 3DF8A 1IO2A 4EQQA 3ERED 2ZFUA 3G2BA 4BE1A 2DPDA 4M9ZA 4F92B 5EGOB 1MBHA 2VE9A 4M73A 4A69C 3BTLA 3HRMA 3ZOBA 5F6FA 3C7JA 1VQLI 2VI6A 3KP7A 2PG4A 3I4PA 2DFEA 2DU9A 3LSMA 1ETKA 4HEA2 2YU9J 5M5WJ 1JGGA 5KVRA 4YRVA 2IS2A 2E19A 2WA0A 3B6CA 5FLVA 3OL4A 1E3HA 4MGRA 1G3TA 1TNSA 2HQAA 1ZTRA 2ZB9A 2DMNA 1NG7A 1Y6IA 3QAHA 3OYJA 2JA8J 3FMSA 4A3FJ 3BR1A 1D1AA 1ZH5A 4M3FA 3CMYA 6PAXA 3K70D 1JKRC 1DUXC 2OTLI 3U1KA 4HAMA 2EFNA 2ZXIA 3CJTB 4AVZA 3K70C 2QVOA 5IT3A 3K4BA 1WH7A 3R0AA 3MD2A 5EDNA 3B73A 3TL4X 1B1BA 2GQQA 5BPDA 5HOOA 2JRTA 1JUPA 2W57A 3K7AJ 1YITI 1YX5A 3HRTA 5ICEA 1W0TA 3QPHA 1FSHA 2VJ5A 4AC0A 2ZSHB 3QPLA 4XLAA 4EMSA 2BE5F 1V5EA 3QPSA 3E5UA 4HA8A 4CZCA 3OYHA 4A3JJ 1POGA 1WCMJ 1PP7U 2K7LA 3MKLA 1MSEC 1B72B 3ZQCA 5EG0B 3C2BA 1ZELA 2NS0A 1STZA 3CJQB 1EA3A 1MD0A 5GP9A 3MMYB 1XGOA 1BIAA 4OIOF 3AL0C 2A5WA 2E1MC 2GOMA 1QHHD 1XPXA 4A6DA 2QWWA 2IT0A 3EUAA 2GA1A 2NS7A 4X0GA 3S15J 1TQMA 3G4SI 3I58A 3PO3J 4XL9A 2BY1A 5LHIA 1R1VA 3ASOH 4NUBA 4OU0A 4G6TB 1QRYA 4NQWA 3NRVA 1OCPA 4PSXA 1FJLA 2XAJA 3OMYA 2E60A 2I8DA 4U0WA 1SFOJ 3F3XA 4KICA 1OR7A 3S14J 1Z77A 3MZYA 2QEXI 4QTRA 3KZYA 1KGSA 5FO5A 3RIRA 2XAHA 3PQKA 2PMZN 1R22A 2D45A 5D5XB 5J47A 1XDSA 3CUQB 2H8RA 1YIJI 1UELB 4B47A 3OYIA 4HSRA 3ZMTA 2DCEA 1Z3YA 3HSEA 1XMKA 2L01A 4U7DA 4QIWN 2DQLA 1IDYA 4XLCA 2DTRA 5L3CA 3SEZA 2JN6A 3I56I 1JKQC 2BGCA 3HOVJ 2K86A 2ELHA 4CCKA 4AYBN 3IH4A 2OQRA 2PFBA 3QQAA 4XN0A 3V8JA 5F0HA 1YW9A 3J7AY 1GLNA 1D1CA 2XHKA 1DQUA 3VYTB 4L9NA 3CCQI 2STWA 2BVLA 3OL3A 1HC8A 1CF7A 2H27A 4B3XA 5FKOA 4RDUA 4MQVA 5J8CA 2XAFA 2R7SA 4XKWA 3F8BA 3X2QH 2L4MA 2VJJA 1XSVA 3AFHA 1I1SA 1IN6A 3BCAA 2FQ3A 4G7HF 1E0EA 1EH6A 4IX7A 3WG9A 1LE8B 1BJAA 2CQNA 2O7OA 2CQQA 3HBLA 2CUZA 2P7CB 2RC4A 4HV5A 3H1CA 1HF0A 3BLYA 2OAZA 2O8XA 1UAAA 2DK5A 2XRNA 2HDWA 3V4GA 2JSPA 4YIIA 5EYRA 2ADUA 1YW8A 1JKOC 2L9RA 5DCMA 1PUEE 3H0GJ 4OMZA 4IRGA 3TGNA 4ABZA 3S32A 4ZTFA 1U78A 4IQJA 3OYFA 4E6KG 2LY1A 2Q0OA 1JJ8C 3TEDA 5CKTA 5KAFC 3WTVC 5J4YA 1SMTA 4K2EA 3K9TA 4M3EA 2EIMH 2QUFA 3TMOA 3CMAI 3V7CA 2KDZA 5K7ZA 2FBHA 4OIPF 2WY7Q 4KIFA 2KIUA 4IO9F 1VQMI 4I7HA 4LGWA 1EV7A 2NXNB 3JAMZ 2I5UA 3CDIA 3K69A 1U8RA 3VSLA 2W1OA 3HM5A 4XLEA 2OCEA 1YJWI 1Z6RA 1D0ZA 4ENNA 4RLQA 2WAQA 4XSXF 1EKEA 1AA7A 3S1NJ 2JWTA 5J6XA 2BEOA 2O3FA 2EV0A 4C30A 1T39A 4IKFA 4IJAA 2QM3A 4NNJA 1F43A 3IKTA 3HIFA 2HVRA 1CGPA 2Y2ZA 3DP7A 3GYHX 1XSDA 3ULQB 4BXXJ 1G3YA 1X3WB 5D4SA 1AKHB 3PO2J 2HOTA 2ZJPF 5E1ZB 4ZTJA 1X3UA 1WH5A 2VUMJ 5D5WB 3ZP5A 3BZKA 5BS6A 2M0CA 3DEUA 3RCOA 2W4SA 5HNFA 1OISA 2L4AA 2XGDA 2ZXJA 1UB9A 3PFYA 3ISPA 2ZO4A 4CA0A 3EUHC 3A01A 4MTDA 1ZRCA 1SFUA 5IP9J 2E5NA 4MQ9F 1U6GA 3GZNB 1S7AA 3I3LA 4L0ZB 2OF7A 2DODA 2AO9A 1P9QC 1FOXA 5L3BA 2UV1A 5BQTA 3BR0A 1ZREA 3J7AO 1KU9A 2K4BA 1MIJA 1FYLA 4UY8I 4YELA 2N8GA 1YHQI 5KHDA 2DAOA 2FX0A 2HI3A 2LF7A 2Y31A 3WHBA 2W84A 3PNYA 3TO9A 1J09A 4MIMA 2HXIA 1KA8A 2UXXA 2HYFA 2RNJA 2IGKA 5HODA 5DEQA 2Q2EB 5CQEA 3K1NA 1W4MA 4MFEA 3LQQA 2M4GA 2K9NA 5FGMA 4BJ6C 1Y56A 2FNPA 4W1UA 4E70A 4EGYA 4L5EA 5DD8A 3IH2A 4I09A 4ZYDA 1I3AA 2G7HA 2KIMA 4AIHA 2W00A 1R00A 5FKNA 3H9QA 3LSRA 5JFRA 4WX9A 2HZDA 2P0WA 3IP4B 3HOWJ 4JX6A 1UHMA 3FXRA 2IXSA 1MKMA 3JRGA 4X6AJ 1DP7P 3G6EI 5F1RA 5IY5H 1XB4A 4UUTA 2PI0A 3MAJA 2CJJA 3WTTC 2HEOA 4R1HA 2DOEA 3EQLF 3V8KA 4ENMA 1D0XA 1HOMA 2LP0A 4G94A 2LMDA 3RSNA 2A3SA 4IHXA 1U3EM 2EA2A 4NQWB 2XPWA 3Q5FA 3HGYA 1WI9A 1YTYA 2AXLA 4ETSA 2IS1A 2MH9A 2F48A 2Z1DA 1WZ2A 3CCUI 3D5RC 4M74A 4KT5C 3OYEA 2JRMA 5LFAA 2ESHA 3IKVA 2AQFA 2XPUA 3CCVI 1V55H 2FBKA 4E7LA 2E2HJ 3U1DA 2ZJ2A 1QO0D 2HNHA 1JGSA 1WJDA 1MBEA 3DWLE 4PJ0C 5B1BH 2PQ8A 3F0CA 2XV4S 5ILUA 4F91B 1AHDP 5LBQA 1MZBA 4G6QA 2QQAA 5E79C 2FU4A 3PSFA 4DGWB 2DA4A 3COAC 1MMAA 3LMMA 1G59A 4HW0A 2WC2A 1K4TA 1W1WE 2CUJA 2DMQA 2O61A 1IG7A 1JJ6C 1ZN2A 3GTLJ 2ACJA 2YPRA 1RPWA 4RGRA 5A2QK 2L54A 5CVVA 4KMUX 4Y3OA 2ZKZA 4L18B 2DDBA 4OWRB 4KJZA 1K61A 2XDVA 4A0XA 1S72I 4HX7A 1HKSA 2L9NA 3QODA 2IGNA 1H88C 1KU7A 1GVJA 3ABLH 2VKVA 1ZG5A 2BXYA 1CF7B 1TQPA 4JOMA 2E5ZA 1TQIA 1FNNA 4AD9A 3KP3A 1SFEA 3KE2A 1NTCA 4YG2F 2PEXA 2DA3A 4PJNA 2M7AA 5LLQA 2QQBA 2OV7A 3G71I 3DXJF 3GF2A 1IV6A 2YU3A 4ZYAA 3JTHA 4XICA 3D5SC 2QCOA 2VJIA 3PIPF 4ZC3A 2I10A 2L7ZA 3FXOA 3MVPA 4RGSA 1RZ4A 1UG2A 3MKZA 1Y1WJ 1W5SA 1JT0A 1G4DA 1TTYA 4KISA 2BBYA 3RPQA 1T98A 3DCFA 3LA2A 5IYBJ 2L7KA 1HBXG 3GTQJ 3PUBA 2A6TA 3JRIA 2QLZA 3FBNB 4I76A 4ZZLA 4FX4A 3F8MA 3DBLB 5DCMB 1V5GA 3W6KB 2PJPA 1XMAA 2VBXA 4UHTA 1FYMA 3FKJA 5HS8A 2DOAA 1D3YA 4ZDLA 5EF6A 2NVTJ 3LSPA 1K83J 2B7EA 2ZNZA 3GVAA 1FIPA 4G6DA 1MMNA 2X48A 3IAM2 3E6MA 3QRFF 5F04A 4Q5SF 2VQLA 4N4OB 4HLYA 1BOBA 3HYIA 1X1DA 1OJLA 4Y7NJ 3LQRA 3HSFA 2BW3A 2M87A 4IHVA 3LNQA 3Q9SA 4Y52J 2LRDA 2EFOA 1F5TA 1MBJA 3PNVA 1FBSA 1R5ID 3FWEA 5ILSA 3W6VA 4D7MA 4BQNA 3LSIA 5CVUA 1TL8A 3KZIC 2PJRA 1ZYRF 3OYKA 4LB5A 1ITYA 1U2WA 5F27A 1Y39A 3F8NA 1Z67A 3UKGA 2M9HA 1BA5A 4RS8A 2LSOA 4BDZA 1ZKGA 3FXJA 3CO6C 1S5LC 2IGOA 5E18F 2GLOA 1FP1D 3C3WA 3CC4I 4X1EA 2XASA 2R7VA 3H5NA 2ZMEA 1K78A 3SZTA 2VQCA 2Y48A 3QYBA 5LEKA 1P4WA 3LAJA 4EJVA 5F0FA 5HDGA 1LDJA 3A01B 4IHWA 2VC1A 2CQ7A 5F08A 4MLOA 2CV0A 2M5WA 4O6JA 1R58A 1WI3A 2LBFA 2KRFA 3H35A 4PZJA 3IUOA 4BACA 3WGIA 3C2HA 3W6JB 3ZQFA 2DFIA 2M30A 3FKIJ 3MQ0A 4DIQA 1YQAA 4UVCA 3ABTA 2GAUA 2AQEA 2WTEA 2KRHA 4N9HA 3I55I 1IUFA 2X1CA 2MLKA 2BY0A 3I71A 2H94A 2QA4I 1YJ9I 5H6RA 3S3OA 2HOAA 2Z33A 4RAZA 2FMLA 1JE8A 2NNNA 3IWZA 2CW8A 4IXAA 1W7PD 3WODF 4BHCA 2VJ4A 2ELKA 5B5EC 2B0LA 5GAGJ 3ZPLA 3HRSA 2L0KA 5GAHJ 3GZ5A 5HDKA 3A4CA 3E5XA 2KISA 4RB3C 2W48A 2M7BA 3MFKA 1MW7A 2XC7A 1FMVA 1RUOA 2X85A 5CPRB 3KZZA 4XKVA 3IC7A 4M3DA 3BTCA 1IC8A 2EJRA 3I4MJ 2XGCA 1JHFA 5EEGA 3LA7A 1A6IA 4DYCA 1BI1A 1W0UA 3GBGA 2LF8A 4E7HA 1E2XA 3CP8A 4Y13A 3VOEA 1ODDA 1UFMA 3J80Z 3WG7H 2VB6A 2LFBA 3BR2A 3RQIA 3JRFA 2DK8A 4IRHA 3FK7A 2E7XA 4HG2A 4KITB 3LOCA 3D0SA 3P9KA 1QZYA 2G7UA 3TP0A 2TDXA 3HKZA 3ZMSA 4DW6A 1YFHA 5DTDA 1DGRM 3I64A 3QOEA 2EZLA 2X9DA 1QBJA 2WAQN 1UCRA 4XSZF 1WFXA 3M8FA 3QP6A 4BHBA 4EM1A 2GZWA 4G12A 3BG6A 4BKXA 3GMEA 4HF1A 3HJEA 3F9KA 1FOKA 2JSCA 3OYMA 1V4RA 5D5UB 3CD6I 3H3VK 5IT9K 3PJRA 3B6AA 5M3MJ 3GFLA 2Z9OA 3LSJA 2M8EA 3S16J 1U5TC 1SVLA 1HA8A 3QP5A 1P92A 4EJWA 3ZN1A 4JYKA 3BG3A 3FIWA 3E3VA 3NARA 2CUFA 3R0JA 4JK1X 3JTGA 3KX2A 3SJMA 1EH7A 1TWGJ 3P9IA 4I0BA 2X51A 4ASNA 2F4IA 3RPUD 3MWMA 2B63J 3TKYA 1PJRA 1B8IA 4WK8F 2FBIA 1A35A 5ERIA 2CFXA 2ZNYA 2K27A 3LA3A 1MDMB 1P4AA 3F22A 3ABUA 2ZXWH 4XMYA 2QSHX 2AHQA 2E34A 3JSPA 1R1UA 1J0RA 3U9GA 1MH4A 1O3SA 5LEJA 3VPRA 3DBHB 2Z3YA 3DV8A 4BQAA 1Z91A 4I2OA 4DBQA 4E7JA 2Z5UA 3DBRB 1G6NA 1YIOA 4KIGA 1KQ8A 3NAUA 3OV8A 4P1WA 3ECOA 5LGTA 4EVIA 4A3MJ 1QU3A 1HSTA 4C3HJ 1ON2A 1TWFJ 3LL7A 2V4JC 4GGGA 2M4KA 3LWFA 3L2RA 2R4GA 4ZDOA 2LKPA 1V5FA 3AAFA 4NB5A 1TC3C 1SAXA 3DTEA 3RKQA 1O57A 4A3IJ 1F1ZA 1SEUA 2X6OA 2MG4A 2BYVE 3HZJA 3B02A 4EJUA 2YR2A 1PVEA 4D5FA 3JRBA 5TRDA 5E17F 2HXOA 2DDAA 2LC2A 3LSHA 4CCNA 2M8GX 1I50J 1X4PA 5F0CA 1ETXA 3WE3A 1VQPI 3TP3A 1R49A 2R5YA 1QA6A 2E2IJ 3RYRA 3G1OA 1QVUA 3JSOA 3KLNA 2GXBA 2ECBA 3WHCA 4LG0A 3CF5F 1FMWA 4ZZDA 2M0MA 2DN0A 3CCEI 1P7IA 2BVMA 3KIOA 2IGMA 3QYFA 1MNEA 3K1MA 1T6SA 4XIDA 2VL8A 4HV6A 2H1LA 4KNYA 3O3KA 2VPLA 4B44A 3GFIA 4BBRJ 5D8LB 2DFFA 5C3EJ 4XLHA 1I6XA 1SD7A 3OS0A 4ZDPA 1XSXA 3TOBA 1EH8A 1RC9A 5ILVA 4LLNA 3G73A 5M3FJ 1KU3A 5FRMA 1B6AA 4CYCB 3Q0VA 4UUVA 2H6CA 3DPUA 4CZZA 2ECCA 4Y33A 1OCRH 2QSGX 2BW3B 1KONA 3HSRA 4Y4RA 2VKHA 2K5CA 3N97A 2V9KA 4RLFA 4YIFA 1XX5A 4Z6YA 3C1DA 4BDYA 4MO7A 4AWXB 2ID3A 3SFIA 2DLLA 3VSKA 2L7MP 1T0FC 2VN2A 4GDFA 2PJRB 2UZKA 2YS9A 1PUFA 3GTMJ 4BEHA 3GLXA 4AIKA 2GXAA 4F93B 4OAYA 3HDDA 2DMPA 3H9JA 1FX7A 3KP6A 5H20A 5JVGF 3OY9A 3C18A 4LFUA 4KN4X 2CO5A 3KPHA 1IXSB 3Q3SA 4LLLA 3UR3C 4RGUA 5BOXA 3PSIA 1O4XA 3S93A 2FJ1A 3H5RA 2ZMEB 1XCVA 1SD4A 2M45A 4JP0A 4NC7A 4A6EA 5J1YA 1K78B 1NK3P 1LDDA 5DDGA 4XLNF 3HOUJ 3PUFA 4XN3A 2DW4A 3OIPA 5HNHA 1GXQA 2XB0X 4UVBA 2LBFB 1OCTC 3V8LA 2B9SA 2R93J 2RNGA 5DYMA 3K2AA 5FKMA 1VQ9I 2K9QA 3OSFA 3HHGA 1PDNC 2DMTA 3JREA 2EFPA 2VODA 4D9JA 1TBXA 1XDUA 4LITA 1HDDC 2GIVA 1KZHA 4BE0A 3M1EA 3F72A 3NQOA 4N9IA 4JQFA 2Y0SA 2ZJQF 2WAEA 2WADA 3MCZA 4A3BJ 1I5ZA 3WU2C 4F55A 5HLHA 2PBIA 1MNMC 1IN7A 1BN5A 1K7AA 3WGHA 3VYRB 5JVTA 4A3CJ 1SC7A 4RGXA 4I98B 3CLOA 3TO7A 5K1YA 4RAYA 1X58A 3N05A 4LD5A 2DA2A 2JUGA 2MA3A 1RI7A 1T08B 4OMYA 1T95A 1UZCA 3I59B 5LRRA 5EZHA 5DUIA 3L2VA 2HR3A 1LEBA 1ENHA 3WTYC 1R4MB 1H89C 3H92A 2XSJC 3CUQC 2VOOA 1RNLA 2XGEA 2R7DA 1Q1HA 3M9AA 2VOPA 1ZGAA 4RB0A 1Z9CA 1DPRA 1P2FA 3PQJA 1IV8A 3DPLC 3E7LA 5GPAA 1MNDA 4DBRA 2LD5A 3MKYB 2MW8A 3S2DJ 1J7KA 1UHWA 2FOKA 3TW6A 4CO8A 2O03A 2F4MB 4HF0A 5FROA 3V7RA 4ON0A 5L3GA 3CCRI 1ZRFA 2BHZA 2X0LA 1RESA 3HPGA 3R6SA 2NNYA 3ZQ7A 5C4XJ 1Q1VA 3ZQLA 4M6XA 2F5FA 2FEZA 5KCMA 4V19K 2HGCA 1F4KA 4FE7A 3D1NI 2R7XA 1Z7UA 2HPIA 3DU6A 2PLYA 5GPCA 2H1KA 2GM4A 4HX4A 4GRIA 3S8PA 4DZPA 2D5VA 3RDIA 5LHHA 2EB7A 4DOZA 5J1UA 2KKOA 4UVAA 4WF2A 2P5LC 1B4AA 4E7IA 1ERDA 1OCZH 3TBIA 4CCMA 2BHYA 5J3LA 1GUUA 3T1BA 1SVMA 2OJED 4B8XA 1QQIA 1FSEA 1HXDA 1LKXA 1IZ1A 2CH0A 2NRAC 2HWVA 4FASD 3KFWX 4U7BA 5DS9A 4XRSA 4Q48A 1XMXA 3MZHA 3EPZA 1BI2A 4GYIA 3BR6A 2D1VA 3HXLA 3OOUA 4ESJA 5IYCJ 1GVDA 2TRTA 3TO6A 3OYCA 4PDKA 1QGPA 1NH3A 4XRSG 5GTHC 1OYIA 3PFIA 3FBIB 1E3OC 2YUSA 1P6RA 3J81K 5K5QA 4B09A 4IZZA 2K9SA 2GA2A 3WE2A 3ZRGA 5E3NA 2FSWA 2HU9A 4OINF 1HLVA 1M1EB 2F5DA 2HOSA 4D5CA 5IYDJ 1X1CA 4HRIA 5CQGA 2RAEA 1H9TA 1IW7F 2P5KA 3ZQHA 1QNTA 3SHFA 1BJZA 4H4KC 2LYCA 2X6YA 4O3MA 3FK6A 2KLOA 2R7OA 5FB2A 4FTHA 1FLIA 1H8AC 1T33A 2E35A 2QQ9A 1U5TA 3CCJI 3CDLA 1ON1A 3ESWB 3G3ZA 3K0LA 2LY2A 2VQGA 2O9LA 2R5YB 4QLCU 2VBYA 3FM5A 1GV2A 1XC5A 2OUMA 4LG0B 4ESFA 1IF1A 4ESBA 4XOTA 4XR6A 5EEAA 1TLHB 5IOYA 2IJLA 1E17A 1IN4A 2VBWA 1JTXA 2EZIA 4B1RA 4RMNA 2MFZA 2FMYA 2A61A 3K1PA 2FF4A 1B59A 5H6QA 3ZN0A 1IRGA 4CCLA 2GIZA 2E1OA 5LRSA 4EGZA 3HOZJ 1G3SA 1MBGA 3SQNA 3TW7A 5E1XA 5AIQA 4LG3A 4BGDA 1R7JA 2NVXJ 3PL8A 5HS7A 1RETA 2P8TA 3HUGA 4BE2A 2BY3A 2HQ5A 3TOAA 1MGTA 2HPMA 2ELJA 2VLAA 2P4WA 1R9TJ 1BM9A 1JUSA 2GOXB 1WJBA 1ZR2A 4AU7A 2ISZA 1J75A 1YRNA 4A5NA 1XGNA 2HVQA 2JK3A 3OSGA 2XUBA 1XGMA 3K4LA 1PUFB 3ERMA 4A2UA 2A07F 1I6HJ 4BJ5C 2CV2A 3GUDA 5J40A 9ANTA 1LB2A 2KZVA 4ZYEA 3BROA 1IJWC 3BG9A 3BG5A 4KUMA 1DDNA 3IV5A 1XTAA 1ZLKA 4NC8A 4KYWA 3FXLA 4HBLA 5JLWA 3KLOA 4N4NB 2IAIA 2PMZA 4U88A 1AOYA 4HNVA 3WTSC 2DT5A 4YEJA 5D6FA 1MSFC 5EGOA 3HRUA 1N75A 2CGPA 1SFXA 3SEQA 5HLTA 1QPIA 1YLFA 4JBAA 4ENJA 2R7QA 3RQ4A 2HYGD 2IS4A 1EF4A 1BI3A 2DA5A 3M8JA 1RRJA 2IS6A 3S2HJ 3OWTA 3M8EA 5FLXZ 3BQYA 1WKMA 4AYBA 1ETVA 2A6HF 1GXPA 4RM2A 3BJAA 3V7SA 1ULYA 3BPVA 1LPQA 2W85A 4C3JJ 2F5EA 3DQVC 1HW1A 2MYSA 3CQZJ 1K6OA 3P9CA 3ELKA 3GTPJ 3HHHA 1VFCA 2DBBA 1P7JA 1T0FA 1JUMA 2QQ8A 3CP2A 4IQ4A 1A04A 2BV6A 1TW2A 3R60A 4MEXF 1Y1VJ 2X1EA 1OR7C 4XLFA 1EJ9A 1NHAA 1I39A 2R7UA 1ETQA 1LFBA 5F64A 2CUEA 3A0BC 1IN8A 4RAFA 4H0EA 4MTEA 2CS3A 2KMUA 2V6CA 1LQ1A 1R6RA 4UV8A 2ZSIB 3AG1H 2KIQA 1X1AA 2EV6A 3M3YJ 1BBYA 1XD7A 1SD6A 2FUG2 2DMUA 1B72A 2R7RA 4ANJA 3O8GA 2XPVA 1HW5A 1L0OC 3DU5A 5JHUA 2JA2A 2NAZA 3BY6A 2LLKA 1WGXA 4DYRA 1YS6A 3RZOJ 4IHTA 2O5RA 1Z21A 1HQCA 1FT9A 1QZEA 2J5OA 3I9V2 1WJEA 1O7LA 2Y75A 1BW6A 4C3IJ 3L2QA 4DQ2A 1TT5B 4LLGF 3DLAA 1RR8C 4XOPA 2MC3A 1T38A 2JQ7A 2P6SA 2KJCA 4EEFG 3L09A 2DPUA 3WTUC 4QPQA 2WWYA 2ZBKA 2XF6A 5BMZA 2HZTA 5K7HA 4OAZA 2JVGA 4ZJZA 5E8IA 2EILH 5FKLA 4IEJA 4Y17A 1I27A 2V1XA 3L00A 3L2WA 4A3KJ 4U87A 1X1BA 5FRNA 4PK4A 2P7VB 1XN7A 3E97A 2NYXA 3L7WA 2HTJA 1WWXA 3ZMZA 1D5YA 1OQYA 2DYSH 2F5CA 2VIXA 3K4MA 2XAGA 3G1LA 3EDPA 1J5YA 3JCUC 4RM3A 1XS9A 4BL0B 1UJ8A 2KDOA 2V79A 3K4CA 3DLLF 2Y30A 1WJ5A 2GBYA 4XBFA 1LFUP 4BJTA 3ONQA 2Z99A 5BNGA 2CU7A 1YO5C 3LAPA 1R4NB 1J2XA 1UHSA 1P4XA 2LNBA 5CVRA 4C2TA 4CGZA 1ZGJA 2KHMA 1YJNI 4LMYA 1BI0A 4MNUA 1JHHA 4HNTA 4G7OF 1DU6A 3GTGJ 3CJNA 4BU2A 3JRDA 1HW2A 2WAFA
chains in the Genus database with same CATH topology
2M34A 3TP3A 2KDZA 1VI0A 2R5YA 5K7ZA 1DU0A 2E2IJ 3G1OA 2Y9ZA 1QVUA 2ECBA 3WHCA 1GV5A 3HM5A 2DN0A 1A5JA 1FEXA 1P7IA 4A3LJ 5EZGA 4XIDA 1F36A 3S1NJ 4BY1J 2JWTA 2LY9A 4BBRJ 3JRHA 2DA1A 1F43A 5C3EJ 3S1QJ 3IH3A 2Y2ZA 5M3FJ 4CYCB 3Q0VA 4BXXJ 1AKHB 3PO2J 2HOTA 2ECCA 3DEWA 3GTJJ 1ZK8A 1WH5A 4I6ZA 2KT0A 2VUMJ 2TCTA 1HCRA 1CQTA 2M0CA 3HB9A 4MO7A 4UUSA 2ID3A 3SFIA 1VF9A 2XGDA 4LOCA 2NVQJ 2L7MP 2CRGA 3A01A 3BR5A 4FE4A 1T56A 2M2EA 3G1MA 5IP9J 2NVYJ 2YS9A 1PUFA 2OF7A 3GTMJ 2AO9A 5FKKA 4A3EJ 3BR0A 3HDDA 2DMPA 1OFCX 5J1RA 2JJ7A 1TWHJ 2N8GA 3Q3SA 1O4XA 2R7ZJ 2FX0A 1HDPA 2HI3A 1XG1A 2FJ1A 2WB1N 2Y31A 4JP0A 3WHBA 5J1YA 1NK3P 5EG0A 3HOUJ 2CQXA 4MIMA 2HXIA 5IP7J 3ZQGA 1YRNB 2E2JJ 4GFBA 5HODA 1VNDA 4C2MJ 2XB0X 1OCTC 2VPRA 5K7FA 2ME6A 1JT6A 2HYJA 2R93J 1X2MA 4MFEA 3K2AA 2XRLA 5FKMA 1UMQA 1ZGWA 3PM1A 2K9QA 5F1JA 3OSFA 1APLC 2QF7A 2K9NA 2DMTA 3MN2A 3JREA 4AUXA 4W1UA 4L5EA 5FLMJ 1HDDC 3IH2A 3JRCA 2R5ZB 1ZQ3P 2FD5A 4CYCA 5FKNA 3LSRA 1ORKA 1AKHA 1RKTA 2LTPA 5FJ8J 1Z0XA 4A3BJ 3Q0UA 2WV1A 3HOWJ 1MNMC 2XSDC 5E3OA 1BL0A 4JX6A 4DZJA 4A3CJ 3JRGA 4X6AJ 3O8HA 4M3GA 1GDTA 4UUTA 1X58A 1S7EA 2DA2A 2CJJA 3BQZA 2MGQA 5EZHA 1HOMA 2LP0A 1ENHA 1H89C 4IHXA 1U8BA 2G0EA 2XPWA 5IPAA 3HGYA 2DA6A 1G2HA 2XGEA 1SANA 2ID6A 1ETWA 4J19A 3S1RJ 1U9OA 4B4CA 3E7LA 2XB5A 5GPAA 2LD5A 2XPUA 2MW8A 3S2DJ 1JKPC 3TW6A 2E2HJ 4V2FA 1X2NA 2Y0SN 1MBEA 1ZR4A 3F0CA 1RESA 5C4XJ 3LSGA 4QSHA 1I3QJ 1Q1VA 3ZQLA 1JTYA 1AHDP 4FCYA 5IOZA 4FE7A 3BR3A 3D1NI 2DA4A 4DYQA 1MH3A 5JLXA 5GPCA 2H1KA 1IGNA 2GM4A 2DMQA 1IG7A 1TWAJ 1JJ6C 4JX5A 5E3LA 3GTLJ 1RPWA 4DZPA 2D5VA 5J1UA 1U9NA 1LE8A 1ETYA 1K61A 5J3LA 1GUUA 4M6VA 3HEFA 5E3MA 1H88C 4A3DJ 2VKVA 5M5XJ 1FTZA 5DS9A 4XRSA 2EZKA 1ETOA 1NTCA 3BR6A 2DA3A 3HGGA 3OOUA 5IYCJ 1GVDA 2TRTA 2LKXA 3S17J 1IV6A 2JA7J 4XICA 2QCOA 4XRSG 2LK2A 1E3OC 1QVTA 2YUSA 3A02A 3HOYJ 2I10A 1BW5A 2L7ZA 3MVPA 4FISA 1UG2A 1Y1WJ 3S1MJ 1JT0A 2K9SA 4NDLA 1FTTA 5E3NA 2HDDA 1HLVA 4M3BA 3DCFA 5IYBJ 1IRZA 2HOSA 2LVSA 1FIAA 3GTQJ 4D5CA 5IYDJ 3JRIA 4I76A 3M4OJ 4V2GA 1WPKA 1IDZA 4S0HB 3GTOJ 2RAEA 3OIOA 2IBDA 3ZQHA 1BJZA 1RKWA 2Y9YA 2NOGA 3FK6A 2DA7A 4FTHA 4W97A 3FISA 5EF6A 2NVTJ 3LSPA 1K83J 1H8AC 1T33A 4XRMA 1FIPA 1MBKA 3BT9A 2X48A 5F04A 2EQRA 4A93J 3CDLA 2EH3A 2O9LA 2R5YB 1OJLA 4Y7NJ 1GV2A 1XC5A 2IEKA 1MBFA 4IHVA 5EEAA 5EGOB 3LNQA 1MBHA 4Y52J 5IOYA 4A69C 3BTLA 3ZOBA 1MBJA 1JTXA 2VI6A 2EZIA 4B1RA 3W6VA 1ETKA 4D7MA 5M5YJ 2YU9J 5M5WJ 1JGGA 2E19A 2NS8A 2OPTA 1ITYA 2E1OA 3B6CA 5F27A 5FLVA 3HOZJ 2EZHA 1MBGA 3TW7A 3UKGA 2M9HA 1BA5A 1ZTRA 4IHYA 2ZB9A 2DMNA 2NVXJ 1ZKGA 2JA8J 4A3FJ 3BR1A 1RETA 2GLOA 1RR7A 4M3FA 3CMYA 2HQ5A 4X1EA 1JKRC 2FQ4A 4BY7J 3ZQIA 4UUSB 1R9TJ 1JUSA 1ZR2A 1YRNA 5F0FA 3A01B 2JK3A 4IHWA 3OSGA 1WH7A 2P81A 5F08A 4MLOA 1PUFB 1WI3A 5EDNA 1I6HJ 3ZQFA 2ME0A 3FKIJ 1JUPA 3K7AJ 2VKEA 9ANTA 1W0TA 1IJWC 3BG9A 3BG5A 4AC0A 3QPLA 3QPSA 3IV5A 2R5ZA 4A3JJ 1POGA 1WCMJ 2DTZA 3BTIA 3MKLA 1MSEC 5JLWA 1IUFA 1B72B 3ZQCA 5EG0B 2IAIA 3C2BA 4HNVA 2HOAA 1I50J 1MSFC 5GP9A 5EGOA 1QPIA 4XK4A 2COBA 2ELKA 2L0KA 2NS7A 1EF4A 2DA5A 3S15J 3S2HJ 2W48A 5C4JJ 1B8IB 3PO3J 1NK2P 3BQYA 4JX4A 1ETVA 2O8KA 4M3DA 3BTCA 1QRYA 1IC8A 3RZDJ 3I4MJ 2XGCA 4C3JJ 1OCPA 1FJLA 1A6IA 4DYCA 3JR9A 3CQZJ 2LR8A 3GBGA 1W0UA 3GTPJ 4D7NA 1VFCA 1SFOJ 1P7JA 3S14J 1JUMA 1Z77A 4QTRA 2LFBA 3BR2A 3RQIA 3JRFA 2L7FP 2JA5J 2R0QC 1Y1VJ 1GT0C 3FK7A 2PMZN 3LOCA 1ETQA 1LFBA 3TP0A 4DW6A 2CUEA 2H8RA 2R92J 5DTDA 4BBSJ 2EZLA 2X9DA 2WAQN 4QIWN 1IDYA 2DJNA 4G12A 5IP6A 4BKXA 3M3YJ 2JN6A 1JKQC 3HOVJ 4AYBN 3IH4A 2DMUA 4MFDA 3GTKJ 1B72A 3QQAA 3O8GA 3H3VK 2XPVA 3SDGA 5F0HA 3B6AA 4B3AA 5M3MJ 2EBIA 3L1PA 4RBOA 3LSJA 2LLKA 1WGXA 4DYRA 3S16J 2JA6J 3RZOJ 3CCYA 4JYKA 3BG3A 3FIWA 3NARA 2CUFA 4RDUA 5FKOA 3SJMA 4C3IJ 1BW6A 1TWGJ 2MSYA 2B63J 1B8IA 2JMWA 3HKZN 4EEFG 1LE8B 2AHQA 2O7OA 2CQQA 3A03A 3HBLA 1MH4A 5K7HA 3VPRA 1HF0A 5FKLA 4IEJA 4A3KJ 1D5YA 1TWCJ 3BTJA 3NAUA 2K40A 3G1LA 5EYRA 4A3MJ 1XS9A 4C3HJ 1TWFJ 1JKOC 2L9RA 2Y30A 3H0GJ 2GBYA 4ABZA 1U78A 1LFUP 5BNGA 4A3GJ 2CU7A 1TC3C 3JRAA 3RKQA 4A3IJ 1UHSA 2X6OA 2MG4A 1JJ8C 3TEDA 1DU6A 4D5FA 3GTGJ 3JRBA 1AU7A 5C44J 2HXOA 4M3EA 3Q0WA 3JRDA 3I4NJ 2M8GX 5F0CA 1ETXA 3HOXJ
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2M34 A;  3TP3 A;  2KDZ A;  1VI0 A;  2R5Y A;  5K7Z A;  1DU0 A;  2E2I J;  3G1O A;  2Y9Z A;  1QVU A;  2ECB A;  3WHC A;  1GV5 A;  3HM5 A;  2DN0 A;  1A5J A;  1FEX A;  1P7I A;  4A3L J;  5EZG A;  4XID A;  1F36 A;  3S1N J;  4BY1 J;  2JWT A;  2LY9 A;  4BBR J;  3JRH A;  2DA1 A;  1F43 A;  5C3E J;  3S1Q J;  3IH3 A;  2Y2Z A;  5M3F J;  4CYC B;  3Q0V A;  4BXX J;  1AKH B;  3PO2 J;  2HOT A;  2ECC A;  3DEW A;  3GTJ J;  1ZK8 A;  1WH5 A;  4I6Z A;  2KT0 A;  2VUM J;  2TCT A;  1HCR A;  1CQT A;  2M0C A;  3HB9 A;  4MO7 A;  4UUS A;  2ID3 A;  3SFI A;  1VF9 A;  2XGD A;  4LOC A;  2NVQ J;  2L7M P;  2CRG A;  3A01 A;  3BR5 A;  4FE4 A;  1T56 A;  2M2E A;  3G1M A;  5IP9 J;  2NVY J;  2YS9 A;  1PUF A;  2OF7 A;  3GTM J;  2AO9 A;  5FKK A;  4A3E J;  3BR0 A;  3HDD A;  2DMP A;  1OFC X;  5J1R A;  2JJ7 A;  1TWH J;  2N8G A;  3Q3S A;  1O4X A;  2R7Z J;  2FX0 A;  1HDP A;  2HI3 A;  1XG1 A;  2FJ1 A;  2WB1 N;  2Y31 A;  4JP0 A;  3WHB A;  5J1Y A;  1NK3 P;  5EG0 A;  3HOU J;  2CQX A;  4MIM A;  2HXI A;  5IP7 J;  3ZQG A;  1YRN B;  2E2J J;  4GFB A;  5HOD A;  1VND A;  4C2M J;  2XB0 X;  1OCT C;  2VPR A;  5K7F A;  2ME6 A;  1JT6 A;  2HYJ A;  2R93 J;  1X2M A;  4MFE A;  3K2A A;  2XRL A;  5FKM A;  1UMQ A;  1ZGW A;  3PM1 A;  2K9Q A;  5F1J A;  3OSF A;  1APL C;  2QF7 A;  2K9N A;  2DMT A;  3MN2 A;  3JRE A;  4AUX A;  4W1U A;  4L5E A;  5FLM J;  1HDD C;  3IH2 A;  3JRC A;  2R5Z B;  1ZQ3 P;  2FD5 A;  4CYC A;  5FKN A;  3LSR A;  1ORK A;  1AKH A;  1RKT A;  2LTP A;  5FJ8 J;  1Z0X A;  4A3B J;  3Q0U A;  2WV1 A;  3HOW J;  1MNM C;  2XSD C;  5E3O A;  1BL0 A;  4JX6 A;  4DZJ A;  4A3C J;  3JRG A;  4X6A J;  3O8H A;  4M3G A;  1GDT A;  4UUT A;  1X58 A;  1S7E A;  2DA2 A;  2CJJ A;  3BQZ A;  2MGQ A;  5EZH A;  1HOM A;  2LP0 A;  1ENH A;  1H89 C;  4IHX A;  1U8B A;  2G0E A;  2XPW A;  5IPA A;  3HGY A;  2DA6 A;  1G2H A;  2XGE A;  1SAN A;  2ID6 A;  1ETW A;  4J19 A;  3S1R J;  1U9O A;  4B4C A;  3E7L A;  2XB5 A;  5GPA A;  2LD5 A;  2XPU A;  2MW8 A;  3S2D J;  1JKP C;  3TW6 A;  2E2H J;  4V2F A;  1X2N A;  2Y0S N;  1MBE A;  1ZR4 A;  3F0C A;  1RES A;  5C4X J;  3LSG A;  4QSH A;  1I3Q J;  1Q1V A;  3ZQL A;  1JTY A;  1AHD P;  4FCY A;  5IOZ A;  4FE7 A;  3BR3 A;  3D1N I;  2DA4 A;  4DYQ A;  1MH3 A;  5JLX A;  5GPC A;  2H1K A;  1IGN A;  2GM4 A;  2DMQ A;  1IG7 A;  1TWA J;  1JJ6 C;  4JX5 A;  5E3L A;  3GTL J;  1RPW A;  4DZP A;  2D5V A;  5J1U A;  1U9N A;  1LE8 A;  1ETY A;  1K61 A;  5J3L A;  1GUU A;  4M6V A;  3HEF A;  5E3M A;  1H88 C;  4A3D J;  2VKV A;  5M5X J;  1FTZ A;  5DS9 A;  4XRS A;  2EZK A;  1ETO A;  1NTC A;  3BR6 A;  2DA3 A;  3HGG A;  3OOU A;  5IYC J;  1GVD A;  2TRT A;  2LKX A;  3S17 J;  1IV6 A;  2JA7 J;  4XIC A;  2QCO A;  4XRS G;  2LK2 A;  1E3O C;  1QVT A;  2YUS A;  3A02 A;  3HOY J;  2I10 A;  1BW5 A;  2L7Z A;  3MVP A;  4FIS A;  1UG2 A;  1Y1W J;  3S1M J;  1JT0 A;  2K9S A;  4NDL A;  1FTT A;  5E3N A;  2HDD A;  1HLV A;  4M3B A;  3DCF A;  5IYB J;  1IRZ A;  2HOS A;  2LVS A;  1FIA A;  3GTQ J;  4D5C A;  5IYD J;  3JRI A;  4I76 A;  3M4O J;  4V2G A;  1WPK A;  1IDZ A;  4S0H B;  3GTO J;  2RAE A;  3OIO A;  2IBD A;  3ZQH A;  1BJZ A;  1RKW A;  2Y9Y A;  2NOG A;  3FK6 A;  2DA7 A;  4FTH A;  4W97 A;  3FIS A;  5EF6 A;  2NVT J;  3LSP A;  1K83 J;  1H8A C;  1T33 A;  4XRM A;  1FIP A;  1MBK A;  3BT9 A;  2X48 A;  5F04 A;  2EQR A;  4A93 J;  3CDL A;  2EH3 A;  2O9L A;  2R5Y B;  1OJL A;  4Y7N J;  1GV2 A;  1XC5 A;  2IEK A;  1MBF A;  4IHV A;  5EEA A;  5EGO B;  3LNQ A;  1MBH A;  4Y52 J;  5IOY A;  4A69 C;  3BTL A;  3ZOB A;  1MBJ A;  1JTX A;  2VI6 A;  2EZI A;  4B1R A;  3W6V A;  1ETK A;  4D7M A;  5M5Y J;  2YU9 J;  5M5W J;  1JGG A;  2E19 A;  2NS8 A;  2OPT A;  1ITY A;  2E1O A;  3B6C A;  5F27 A;  5FLV A;  3HOZ J;  2EZH A;  1MBG A;  3TW7 A;  3UKG A;  2M9H A;  1BA5 A;  1ZTR A;  4IHY A;  2ZB9 A;  2DMN A;  2NVX J;  1ZKG A;  2JA8 J;  4A3F J;  3BR1 A;  1RET A;  2GLO A;  1RR7 A;  4M3F A;  3CMY A;  2HQ5 A;  4X1E A;  1JKR C;  2FQ4 A;  4BY7 J;  3ZQI A;  4UUS B;  1R9T J;  1JUS A;  1ZR2 A;  1YRN A;  5F0F A;  3A01 B;  2JK3 A;  4IHW A;  3OSG A;  1WH7 A;  2P81 A;  5F08 A;  4MLO A;  1PUF B;  1WI3 A;  5EDN A;  1I6H J;  3ZQF A;  2ME0 A;  3FKI J;  1JUP A;  3K7A J;  2VKE A;  9ANT A;  1W0T A;  1IJW C;  3BG9 A;  3BG5 A;  4AC0 A;  3QPL A;  3QPS A;  3IV5 A;  2R5Z A;  4A3J J;  1POG A;  1WCM J;  2DTZ A;  3BTI A;  3MKL A;  1MSE C;  5JLW A;  1IUF A;  1B72 B;  3ZQC A;  5EG0 B;  2IAI A;  3C2B A;  4HNV A;  2HOA A;  1I50 J;  1MSF C;  5GP9 A;  5EGO A;  1QPI A;  4XK4 A;  2COB A;  2ELK A;  2L0K A;  2NS7 A;  1EF4 A;  2DA5 A;  3S15 J;  3S2H J;  2W48 A;  5C4J J;  1B8I B;  3PO3 J;  1NK2 P;  3BQY A;  4JX4 A;  1ETV A;  2O8K A;  4M3D A;  3BTC A;  1QRY A;  1IC8 A;  3RZD J;  3I4M J;  2XGC A;  4C3J J;  1OCP A;  1FJL A;  1A6I A;  4DYC A;  3JR9 A;  3CQZ J;  2LR8 A;  3GBG A;  1W0U A;  3GTP J;  4D7N A;  1VFC A;  1SFO J;  1P7J A;  3S14 J;  1JUM A;  1Z77 A;  4QTR A;  2LFB A;  3BR2 A;  3RQI A;  3JRF A;  2L7F P;  2JA5 J;  2R0Q C;  1Y1V J;  1GT0 C;  3FK7 A;  2PMZ N;  3LOC A;  1ETQ A;  1LFB A;  3TP0 A;  4DW6 A;  2CUE A;  2H8R A;  2R92 J;  5DTD A;  4BBS J;  2EZL A;  2X9D A;  2WAQ N;  4QIW N;  1IDY A;  2DJN A;  4G12 A;  5IP6 A;  4BKX A;  3M3Y J;  2JN6 A;  1JKQ C;  3HOV J;  4AYB N;  3IH4 A;  2DMU A;  4MFD A;  3GTK J;  1B72 A;  3QQA A;  3O8G A;  3H3V K;  2XPV A;  3SDG A;  5F0H A;  3B6A A;  4B3A A;  5M3M J;  2EBI A;  3L1P A;  4RBO A;  3LSJ A;  2LLK A;  1WGX A;  4DYR A;  3S16 J;  2JA6 J;  3RZO J;  3CCY A;  4JYK A;  3BG3 A;  3FIW A;  3NAR A;  2CUF A;  4RDU A;  5FKO A;  3SJM A;  4C3I J;  1BW6 A;  1TWG J;  2MSY A;  2B63 J;  1B8I A;  2JMW A;  3HKZ N;  4EEF G;  1LE8 B;  2AHQ A;  2O7O A;  2CQQ A;  3A03 A;  3HBL A;  1MH4 A;  5K7H A;  3VPR A;  1HF0 A;  5FKL A;  4IEJ A;  4A3K J;  1D5Y A;  1TWC J;  3BTJ A;  3NAU A;  2K40 A;  3G1L A;  5EYR A;  4A3M J;  1XS9 A;  4C3H J;  1TWF J;  1JKO C;  2L9R A;  2Y30 A;  3H0G J;  2GBY A;  4ABZ A;  1U78 A;  1LFU P;  5BNG A;  4A3G J;  2CU7 A;  1TC3 C;  3JRA A;  3RKQ A;  4A3I J;  1UHS A;  2X6O A;  2MG4 A;  1JJ8 C;  3TED A;  1DU6 A;  4D5F A;  3GTG J;  3JRB A;  1AU7 A;  5C44 J;  2HXO A;  4M3E A;  3Q0W A;  3JRD A;  3I4N J;  2M8G X;  5F0C A;  1ETX A;  3HOX J; 
#chains in the Genus database with same CATH topology
 4TV7 A;  1QPM A;  3CCM I;  3QWL A;  3CES A;  3H36 A;  2Y9Z A;  4HYE A;  2RKH A;  4Q4Z F;  3UNG C;  3A2K A;  1VQK I;  3R4K A;  1GV5 A;  4CUG A;  4PCQ A;  4AM3 A;  1FEX A;  2L02 A;  1Z1D A;  4NBQ A;  4A0Y A;  3O2P E;  4CDG A;  4UB6 C;  1F36 A;  5GAD J;  3F6V A;  1FOW A;  4LIV A;  5DCF A;  3VFZ A;  3JAM K;  5E8G A;  1BR1 A;  3BC8 A;  2DA1 A;  1Z3X A;  2HS5 A;  4I99 C;  3S1Q J;  3IH3 A;  2JPC A;  1D8K A;  1SVO A;  3R61 A;  2HQR A;  1HSJ A;  4OOI A;  4XKC A;  2RDP A;  3DEW A;  4U0V A;  3GTJ J;  4I6Z A;  3J7Z I;  2YSR A;  1HCR A;  5ICC A;  3EUH A;  4HOB A;  1CQT A;  3KET A;  3F6O A;  3HB9 A;  1R5H A;  4UUS A;  4QPO A;  1VF9 A;  2NVQ J;  3V42 A;  3EYY A;  3GW2 A;  4CHU A;  2CRG A;  4OIQ F;  2NOJ B;  3F21 A;  2W24 A;  3RYP A;  1ZG3 A;  1T56 A;  2M2E A;  3G1M A;  4FE4 A;  4HST A;  2NVY J;  1BC7 C;  1HKQ A;  3E6D A;  1KU2 A;  4GXO A;  2DO7 A;  1D8J A;  2PX9 A;  4A3E J;  5L3D A;  2QYO A;  2HDC A;  2L5Q A;  4L9V A;  2XGX A;  1TWH J;  3AKZ A;  3HUG B;  3OYA A;  3CZ6 A;  4PJJ A;  4RAG A;  1XG1 A;  4PUS A;  3D5L A;  1IXC A;  2A05 A;  5HS9 A;  1BR2 A;  2CQX A;  5HLI A;  2OU2 A;  3CDH A;  3ZQG A;  5IP7 J;  2E71 A;  1YRN B;  1RUN A;  2E2J J;  4UV9 A;  2VT2 A;  1VND A;  1VZ0 A;  3DEE A;  2OA4 A;  5AON A;  4R79 A;  5K7F A;  3RKY A;  2DQR A;  2ME6 A;  3KP4 A;  2HYJ A;  2K02 A;  3Q9V A;  3BJ6 A;  2XRL A;  4XM3 A;  1UMQ A;  5HLG A;  3OS1 A;  1ZGW A;  1K79 A;  3SZP A;  3U21 A;  2QF7 A;  5E1W A;  1OYW A;  3CCS I;  2LOO A;  1APL C;  1FPQ A;  2V1U A;  5AIP A;  1PYV A;  2V26 A;  1RIO H;  3JRC A;  2XKP A;  1ZQ3 P;  2OBP A;  2ICW G;  4XNF A;  1ORK A;  1FC3 A;  2WBM A;  4S05 A;  1AKH A;  1RKT A;  2K9M A;  3EUK L;  4LIU A;  3RKW A;  3SYT A;  3W2W A;  3AL0 B;  2FA5 A;  2L9S A;  3K4K A;  2E1M B;  1VQ7 I;  3Q0U A;  2IP2 A;  3C2G A;  2HVS A;  1BL0 A;  4WXC A;  2VBZ A;  2EPF A;  1O7F A;  3KEO A;  3W3C A;  2DYR H;  3O8H A;  4M3G A;  1YX3 A;  3T8R A;  3K4J A;  1ZAO A;  2CSO A;  3BQZ A;  1KQ9 A;  4HQE A;  3QYE A;  2MGQ A;  4BAY A;  2O6G E;  5IPA A;  1YI2 I;  1S29 A;  1SAN A;  2ID6 A;  1TNT A;  2JT1 A;  2X4H A;  3NWS A;  4GYG A;  1IN5 A;  3ZMV A;  1U9O A;  1VQ5 I;  2H6B A;  4EM2 A;  4KIB A;  2EK5 A;  4V2F A;  3IAS 2;  4YFN F;  5DV5 A;  2CFO A;  2LG4 A;  3KP2 A;  1ZR4 A;  1A36 A;  4B48 A;  3LSG A;  3AG2 H;  4QSH A;  3QPT A;  4U0Y A;  1B9M A;  2VON A;  2Q2E A;  4F7Z A;  2VC0 A;  4FCY A;  5IOZ A;  5A2Q Z;  4L0Y B;  3GLL A;  1S9H A;  2KJB A;  3BR3 A;  2M1B A;  4NHJ A;  4UB8 C;  2FE3 A;  4EM0 B;  2ZCW A;  5JLX A;  5GAE J;  2CMP A;  1IGN A;  2FNA A;  2IVM A;  2D2W A;  3KYL A;  4JX5 A;  5E3L A;  3HPH A;  4CIC A;  3EYI A;  4EJO A;  4PGH A;  2KP6 A;  4I02 A;  1U9N A;  2WB1 A;  4FX0 A;  2V9V A;  3T5X A;  1WVR A;  1ETY A;  5LGU A;  3LFU A;  1MJA A;  3OOP A;  4E7S A;  4IL6 C;  4M6V A;  4E4H A;  3HEF A;  3KP5 A;  5E3M A;  1TT0 A;  3FXK A;  3IHU A;  4HZF A;  3P5J A;  4L9J A;  4WXD A;  3L9F A;  1OCC H;  5FFX A;  5K5R A;  4EAT A;  2E36 A;  2OD5 A;  3MZ8 A;  1FTZ A;  2CYY A;  1W36 D;  2A5Y B;  1C0W A;  2P5V A;  2LKX A;  2AS5 F;  2MLG A;  1LNW A;  4GO1 A;  3CMM A;  4M71 A;  2JA7 J;  2QBY A;  2JUC A;  1W36 C;  3SXY A;  4KA4 A;  3K2Z A;  4G9Y A;  3HOY J;  3VEP A;  2EFW A;  3CUO A;  5FLX K;  3VWB A;  4XON A;  2CW7 A;  4FIS A;  4I0A A;  4CYD A;  3H0D A;  4FHT A;  3RI4 A;  1IAW A;  3IRR A;  2EIK H;  4KN7 X;  5JR3 A;  4IRI A;  5D8K B;  2IW5 A;  3E5Q A;  3MKW B;  4IF4 A;  2DT6 A;  1FBQ A;  3ABK H;  1N77 A;  3GFJ A;  3KCC A;  1MJB A;  1BIB A;  1WPK A;  4CSW A;  4II3 A;  5JI6 A;  1FYK A;  1REP C;  2CV1 A;  2XF5 A;  2DI3 A;  2CW0 F;  5D4R A;  3GTO J;  2IBD A;  1SFK A;  3ASN H;  5D5V B;  1ZG1 A;  2K4J A;  2F6C A;  1IRX A;  1K6Y A;  1USS A;  2JPB A;  2R7W A;  3LSK A;  2Y9Y A;  3T8T A;  3EET A;  2DA7 A;  4W97 A;  3IL2 A;  2J5P A;  1MBK A;  1YS7 A;  3BT9 A;  4HX8 A;  3ZR8 X;  1S6L A;  4A93 J;  1KQ0 A;  2EH3 A;  2F5V A;  5EEH A;  2UUZ A;  3DKX A;  2GXG A;  2VQH A;  1BR4 A;  2BXZ A;  2IEK A;  3A1Y A;  3FXQ A;  1MBF A;  3I5U A;  4PJM A;  3PNT A;  5CVJ A;  2XRO A;  4J01 A;  2QGU A;  4UNO A;  4PFO A;  4IOC F;  1E3P A;  1SAU A;  1KYW A;  2KQR A;  4XLP F;  4HF2 A;  3I53 A;  4XQF A;  1O3Q A;  5M5Y J;  5H2F C;  5ICG A;  2P6T A;  3NWT A;  2NS8 A;  2OPT A;  1LVK A;  2PN6 A;  2EZH A;  2LDU A;  3HOS A;  4J00 A;  1FOY A;  1X19 A;  4IPA A;  2LH9 A;  2UXN A;  4IHY A;  3RJP A;  1V3F A;  3GZ6 A;  1D5V A;  2EIJ H;  4AVP A;  1LEA A;  1RR7 A;  2K9L A;  4A12 A;  3S3N A;  5FD5 A;  3TQN A;  4GCV A;  3E6B A;  4M9S A;  1X3Z B;  2FQ4 A;  2RV8 A;  3FF5 A;  3QU6 A;  4BY7 J;  3ZQI A;  5ED4 A;  1W5C C;  3S2W A;  1R71 A;  2UWM A;  4LK0 F;  4UUS B;  3E6C C;  2OZU A;  3LST A;  2Y69 H;  2ZME C;  3GXO A;  2ETH A;  3F23 A;  2P81 A;  3CME I;  2E1N A;  1BOA A;  3K4N A;  2F2E A;  2STT A;  4XKB A;  1R36 A;  2RVC A;  5ICF A;  4BYY A;  5J4V A;  1ONV A;  2ME0 A;  4FQG A;  1ACI A;  2VKE A;  1VQ4 I;  3N4M A;  1WJF A;  1B9N A;  4M6Y A;  2F4O B;  2Z2S B;  4P9U A;  2R5Z A;  3H3Z A;  2DTZ A;  1G8X A;  3BTI A;  1SMY F;  5HDN A;  3DKY A;  3HTU A;  5B66 C;  1Z7L A;  4HLX A;  3FMQ A;  2R7T A;  2XIG A;  1OYY A;  4LJZ F;  4E7Z A;  1J59 A;  2CQK A;  3BJO A;  2MH2 A;  4XK4 A;  3BP8 A;  3SZG A;  1W7P A;  3SFZ A;  2COB A;  3REO A;  3L2C A;  1V54 H;  5KAI C;  3GWZ A;  1G3W A;  4LB6 B;  4YFK F;  5LGN A;  3J7Y J;  3TDZ C;  4HNU A;  2MD0 A;  5C4J J;  3H9G A;  1B8I B;  1NK2 P;  4CXF A;  5FFZ A;  3GCM A;  4JX4 A;  2M3A A;  5E20 A;  2O8K A;  1OKR A;  1MMD A;  1OMI A;  2QSF X;  2W7N A;  2ZFW A;  2LRE A;  3RZD J;  1A31 A;  3ABM H;  4EV0 A;  2DOF A;  3JR9 A;  2LR8 A;  3LFK A;  4D7N A;  4BS9 A;  3IWF A;  2XKO A;  3DTI A;  3OYN A;  2KZG A;  4DJA A;  1QZZ A;  2L7F P;  2JA5 J;  2R0Q C;  2KIF A;  3BWG A;  1GT0 C;  2HOE A;  2MC4 A;  1LFP A;  3VDX A;  1H9G A;  3QOP A;  3K10 A;  5CLS A;  1TP4 A;  2A69 F;  2R92 J;  1YOV B;  3J80 K;  4BBS J;  1I1G A;  3WU0 A;  2WY8 Q;  5IT9 Z;  2HTS A;  3FXM A;  4Y15 A;  1X1P A;  2DJN A;  5IP6 A;  3P7N A;  3L2U A;  1QHG A;  3AG4 H;  2Q8K A;  4BQQ A;  1VQ8 I;  4MFD A;  2HFH A;  4YIR X;  3WTX C;  3GTK J;  2BOL A;  2KRC A;  3DTK A;  3SDG A;  4ZYG A;  5L3F A;  4B3A A;  2EBI A;  2V1N A;  3VOD A;  4RBO A;  4AID A;  4B43 A;  3L1P A;  1OCO H;  4PFP A;  4I01 A;  4EJT A;  2JA6 J;  2VAS A;  1S3J A;  3CCY A;  2HKO A;  1Y8R B;  2XAU A;  4YFX F;  1WJC A;  4CCJ A;  2MSY A;  2RN7 A;  3MEX A;  2D1H A;  1ZRD A;  2JMW A;  5TIS C;  3HKZ N;  3RPU A;  2W25 A;  1YYV A;  1U0J A;  2QKL B;  4IVN A;  2K3F A;  2EWN A;  1IRF A;  5B3S H;  1YG2 A;  2L2O A;  2DT7 B;  3FDY A;  3A03 A;  2EV5 A;  2NVU B;  5DM6 F;  1Z6T A;  3H3U A;  1SD5 A;  3CJR B;  4BH9 A;  4WWC A;  1R1T A;  4XRF A;  3QU3 A;  1VTN C;  4BXF A;  4F3Q A;  1MMG A;  2ISY A;  3FX3 A;  4L5J A;  3WTZ A;  3KYD B;  1TWC J;  3BTJ A;  2K40 A;  1OLT A;  3H5A A;  4P5O A;  1JI8 A;  3BCB A;  2QZ8 A;  4A5M A;  2JVH A;  1FBU A;  1LDK B;  3PIO F;  4IOA F;  1A6Q A;  4PJL A;  4BNC A;  3TDU C;  5FD6 A;  2H8W A;  2QBY B;  3CC2 I;  5BPI A;  4A3G J;  3JRA A;  4BEH B;  5DM7 F;  1VQO I;  4NC6 A;  5B1A H;  5LD2 C;  3BOQ A;  2Q1Z B;  3CLQ A;  3CCL I;  5KK1 A;  2R3S A;  2FOW A;  5C44 J;  1AU7 A;  3DKW A;  3I4N J;  3Q0W A;  2EFQ A;  1DPU A;  3I0T A;  1WQ2 A;  3HOX J;  2M34 A;  1DU0 A;  3NEU A;  1VI0 A;  2CG4 A;  2V9P A;  5CJ9 A;  2ESN A;  2HKX A;  2DXI A;  4RB1 A;  4HDV A;  2AXT C;  1A5J A;  3JW4 A;  4G7Z F;  2FRH A;  4A3L J;  5EZG A;  1L3L A;  4N0B A;  1W5T A;  2KFD A;  4BY1 J;  2RRE A;  4A0Z A;  1TW3 A;  2LY9 A;  3JRH A;  2H09 A;  1MDM A;  1S7O A;  3HG9 A;  1IXR C;  5CVI A;  1NG6 A;  4S04 A;  1DGW Y;  1AWC A;  2PMH A;  3OIQ A;  4BHP A;  1HKT A;  2X6X A;  5KNL A;  1ZK8 A;  3I54 A;  2XAQ A;  1FZP B;  2KT0 A;  2X1D A;  1KYZ A;  5L3E A;  2TCT A;  2IA2 A;  2LKS A;  2OZ6 A;  2MBF A;  1Y0N A;  5LHG A;  4LOC A;  1K4S A;  4BXU A;  2C6Y A;  2WV0 A;  2A6E F;  2VT3 A;  3BR5 A;  2Z16 A;  3KEY A;  5HVQ C;  3BPX A;  3IRQ A;  4ZH4 F;  5FKK A;  4RB2 C;  3E1S A;  4D1Q A;  2EIN H;  4II2 A;  3OR2 C;  3BDD A;  2G9W A;  3O6B B;  1OFC X;  3SDB A;  5J1R A;  1XCB A;  2JJ7 A;  1WJA A;  5GTI C;  2EA4 A;  2R7Z J;  1HDP A;  4D0P A;  3FM3 A;  2WB1 N;  1N78 A;  4P55 A;  4ZYH A;  5TGT A;  5EG0 A;  4PGG A;  4QWQ A;  4MHG A;  3BG7 A;  2V6E A;  1GHC A;  1DP3 A;  2COM A;  2V7F A;  4GFB A;  2A68 F;  4KFC A;  3WU1 B;  4C2M J;  3ZQQ A;  1BC8 C;  2VPR A;  3BZC A;  2JZY A;  1JT6 A;  2PMU A;  2RQP A;  2ZXH A;  3FZV A;  1X2M A;  3K6G A;  1LUJ B;  3HTS B;  3GEZ A;  3PM1 A;  5F1J A;  4AIJ A;  4WXH A;  3MN2 A;  3WGG A;  4AUX A;  4BUP A;  1X4O A;  4Q47 A;  5FLM J;  2R5Z B;  2HQN A;  2FD5 A;  5EJC A;  4CYC A;  3E0J B;  4ENK A;  4L5I A;  1S8N A;  3OYB A;  2ZJR F;  2E1C A;  5FJ8 J;  2LTP A;  1Z0X A;  3ROU A;  2WV1 A;  3VYU B;  3BZ6 A;  2QKM B;  5E3O A;  2XSD C;  4HDU A;  2R7F A;  2V1D A;  3OYD A;  3S3M A;  4DZJ A;  1T8I A;  4F52 A;  2GWR A;  4MEY F;  1N25 A;  3FHN A;  3WTW C;  3OS2 A;  1W7P B;  1GDT A;  1S7E A;  3FXU A;  1VQN I;  2K3P A;  1R23 A;  3CUQ A;  4O5V A;  1UST A;  2CWE A;  3ML6 A;  2W82 A;  3VB2 A;  5JHF A;  1O3R A;  1YE9 A;  2OCC H;  1U8B A;  2G0E A;  5K5O A;  4IHS A;  1UG0 A;  2DA6 A;  4C9Y A;  1WSU A;  1G2H A;  1MJ9 A;  2BZT A;  2RGV A;  3F8C A;  1ETW A;  4J19 A;  4XOR A;  3S1R J;  3OYL A;  3VYS B;  4B4C A;  2MD5 A;  3RKX A;  2XB5 A;  2VXZ A;  1YW7 A;  1Y0U A;  1VQ6 I;  3CF2 A;  3M07 A;  1ZAR A;  1ZLJ A;  3ECH A;  4WCG A;  1JKP C;  2OTJ I;  1JXS A;  3W2V A;  1FWZ A;  1X2N A;  2Y0S N;  2IA0 A;  3AG3 H;  3GFM A;  4P9F A;  4UXN A;  3KYC B;  3GO5 A;  4R8H A;  1I3Q J;  1XGS A;  1JTY A;  3HC7 A;  1D1B A;  1FP2 A;  2BY2 A;  2QEN A;  4OIR F;  1LVA A;  2X6W A;  1H0M A;  3W2A A;  2XF7 A;  4G8X A;  4DYQ A;  2FXA A;  1MH3 A;  2YX7 A;  5CYV A;  1TWA J;  3FMR A;  4PSW A;  1PP8 F;  2VE8 A;  1WHU A;  2DJI A;  1F9N A;  1U5T B;  4ITV A;  1LE8 A;  1Z05 A;  3CO7 C;  2KPM A;  4DNC A;  1IUY A;  5TJJ A;  1D0Y A;  2KL4 A;  3ZCO A;  4A3D J;  3HOT A;  1FY7 A;  3T0Y A;  3F8F A;  2L9V A;  5M5X J;  2EZK A;  3HL2 A;  2IA1 A;  3OR1 C;  4KMF A;  2Y0M A;  3DFG A;  1ETO A;  1LJ9 A;  3J81 Z;  2JTV A;  1J9I A;  3I59 A;  3HGG A;  2VXD A;  3ZMD A;  4CCO A;  2OQG A;  5D6E A;  3S17 J;  1MMS A;  1R5G A;  3GX4 X;  2LK2 A;  4L9T A;  1QVT A;  3A02 A;  1O3T A;  4E7K A;  4LK1 F;  3CTA A;  2XVC A;  1BW5 A;  1TZL A;  3M1C A;  4HPQ A;  3CC7 I;  3S1M J;  3U2R A;  2IRF G;  4NDL A;  4P96 A;  1Y8Q B;  4BQO A;  1T2K A;  1FTT A;  3ZXS A;  3ZGK A;  2ZC2 A;  2HDD A;  4M3B A;  1IRZ A;  2LVS A;  1FIA A;  3A0H C;  3OYG A;  3M4O J;  4V2G A;  5DUK A;  3FHZ A;  1ZHF A;  5DD4 A;  2IPQ X;  2RQQ A;  4M9X A;  2O0Y A;  4HQM A;  1IDZ A;  2E7W A;  3M7G A;  2YX4 A;  2K85 A;  3OIO A;  4FET A;  4S0H B;  4M72 A;  2L3D A;  4CH7 A;  2DFH A;  3ZMU A;  1RKW A;  2NOG A;  3RTR A;  4C2U A;  3FIS A;  2OC6 A;  2VKD A;  5J8F A;  3DPT A;  4XRM A;  1OPC A;  4KDP A;  2EQR A;  1WRJ A;  4FT8 A;  4Z2Y A;  2MAB A;  4RA2 A;  4KT6 A;  3KEQ A;  3DF8 A;  1IO2 A;  4EQQ A;  3ERE D;  2ZFU A;  3G2B A;  4BE1 A;  2DPD A;  4M9Z A;  4F92 B;  5EGO B;  1MBH A;  2VE9 A;  4M73 A;  4A69 C;  3BTL A;  3HRM A;  3ZOB A;  5F6F A;  3C7J A;  1VQL I;  2VI6 A;  3KP7 A;  2PG4 A;  3I4P A;  2DFE A;  2DU9 A;  3LSM A;  1ETK A;  4HEA 2;  2YU9 J;  5M5W J;  1JGG A;  5KVR A;  4YRV A;  2IS2 A;  2E19 A;  2WA0 A;  3B6C A;  5FLV A;  3OL4 A;  1E3H A;  4MGR A;  1G3T A;  1TNS A;  2HQA A;  1ZTR A;  2ZB9 A;  2DMN A;  1NG7 A;  1Y6I A;  3QAH A;  3OYJ A;  2JA8 J;  3FMS A;  4A3F J;  3BR1 A;  1D1A A;  1ZH5 A;  4M3F A;  3CMY A;  6PAX A;  3K70 D;  1JKR C;  1DUX C;  2OTL I;  3U1K A;  4HAM A;  2EFN A;  2ZXI A;  3CJT B;  4AVZ A;  3K70 C;  2QVO A;  5IT3 A;  3K4B A;  1WH7 A;  3R0A A;  3MD2 A;  5EDN A;  3B73 A;  3TL4 X;  1B1B A;  2GQQ A;  5BPD A;  5HOO A;  2JRT A;  1JUP A;  2W57 A;  3K7A J;  1YIT I;  1YX5 A;  3HRT A;  5ICE A;  1W0T A;  3QPH A;  1FSH A;  2VJ5 A;  4AC0 A;  2ZSH B;  3QPL A;  4XLA A;  4EMS A;  2BE5 F;  1V5E A;  3QPS A;  3E5U A;  4HA8 A;  4CZC A;  3OYH A;  4A3J J;  1POG A;  1WCM J;  1PP7 U;  2K7L A;  3MKL A;  1MSE C;  1B72 B;  3ZQC A;  5EG0 B;  3C2B A;  1ZEL A;  2NS0 A;  1STZ A;  3CJQ B;  1EA3 A;  1MD0 A;  5GP9 A;  3MMY B;  1XGO A;  1BIA A;  4OIO F;  3AL0 C;  2A5W A;  2E1M C;  2GOM A;  1QHH D;  1XPX A;  4A6D A;  2QWW A;  2IT0 A;  3EUA A;  2GA1 A;  2NS7 A;  4X0G A;  3S15 J;  1TQM A;  3G4S I;  3I58 A;  3PO3 J;  4XL9 A;  2BY1 A;  5LHI A;  1R1V A;  3ASO H;  4NUB A;  4OU0 A;  4G6T B;  1QRY A;  4NQW A;  3NRV A;  1OCP A;  4PSX A;  1FJL A;  2XAJ A;  3OMY A;  2E60 A;  2I8D A;  4U0W A;  1SFO J;  3F3X A;  4KIC A;  1OR7 A;  3S14 J;  1Z77 A;  3MZY A;  2QEX I;  4QTR A;  3KZY A;  1KGS A;  5FO5 A;  3RIR A;  2XAH A;  3PQK A;  2PMZ N;  1R22 A;  2D45 A;  5D5X B;  5J47 A;  1XDS A;  3CUQ B;  2H8R A;  1YIJ I;  1UEL B;  4B47 A;  3OYI A;  4HSR A;  3ZMT A;  2DCE A;  1Z3Y A;  3HSE A;  1XMK A;  2L01 A;  4U7D A;  4QIW N;  2DQL A;  1IDY A;  4XLC A;  2DTR A;  5L3C A;  3SEZ A;  2JN6 A;  3I56 I;  1JKQ C;  2BGC A;  3HOV J;  2K86 A;  2ELH A;  4CCK A;  4AYB N;  3IH4 A;  2OQR A;  2PFB A;  3QQA A;  4XN0 A;  3V8J A;  5F0H A;  1YW9 A;  3J7A Y;  1GLN A;  1D1C A;  2XHK A;  1DQU A;  3VYT B;  4L9N A;  3CCQ I;  2STW A;  2BVL A;  3OL3 A;  1HC8 A;  1CF7 A;  2H27 A;  4B3X A;  5FKO A;  4RDU A;  4MQV A;  5J8C A;  2XAF A;  2R7S A;  4XKW A;  3F8B A;  3X2Q H;  2L4M A;  2VJJ A;  1XSV A;  3AFH A;  1I1S A;  1IN6 A;  3BCA A;  2FQ3 A;  4G7H F;  1E0E A;  1EH6 A;  4IX7 A;  3WG9 A;  1LE8 B;  1BJA A;  2CQN A;  2O7O A;  2CQQ A;  3HBL A;  2CUZ A;  2P7C B;  2RC4 A;  4HV5 A;  3H1C A;  1HF0 A;  3BLY A;  2OAZ A;  2O8X A;  1UAA A;  2DK5 A;  2XRN A;  2HDW A;  3V4G A;  2JSP A;  4YII A;  5EYR A;  2ADU A;  1YW8 A;  1JKO C;  2L9R A;  5DCM A;  1PUE E;  3H0G J;  4OMZ A;  4IRG A;  3TGN A;  4ABZ A;  3S32 A;  4ZTF A;  1U78 A;  4IQJ A;  3OYF A;  4E6K G;  2LY1 A;  2Q0O A;  1JJ8 C;  3TED A;  5CKT A;  5KAF C;  3WTV C;  5J4Y A;  1SMT A;  4K2E A;  3K9T A;  4M3E A;  2EIM H;  2QUF A;  3TMO A;  3CMA I;  3V7C A;  2KDZ A;  5K7Z A;  2FBH A;  4OIP F;  2WY7 Q;  4KIF A;  2KIU A;  4IO9 F;  1VQM I;  4I7H A;  4LGW A;  1EV7 A;  2NXN B;  3JAM Z;  2I5U A;  3CDI A;  3K69 A;  1U8R A;  3VSL A;  2W1O A;  3HM5 A;  4XLE A;  2OCE A;  1YJW I;  1Z6R A;  1D0Z A;  4ENN A;  4RLQ A;  2WAQ A;  4XSX F;  1EKE A;  1AA7 A;  3S1N J;  2JWT A;  5J6X A;  2BEO A;  2O3F A;  2EV0 A;  4C30 A;  1T39 A;  4IKF A;  4IJA A;  2QM3 A;  4NNJ A;  1F43 A;  3IKT A;  3HIF A;  2HVR A;  1CGP A;  2Y2Z A;  3DP7 A;  3GYH X;  1XSD A;  3ULQ B;  4BXX J;  1G3Y A;  1X3W B;  5D4S A;  1AKH B;  3PO2 J;  2HOT A;  2ZJP F;  5E1Z B;  4ZTJ A;  1X3U A;  1WH5 A;  2VUM J;  5D5W B;  3ZP5 A;  3BZK A;  5BS6 A;  2M0C A;  3DEU A;  3RCO A;  2W4S A;  5HNF A;  1OIS A;  2L4A A;  2XGD A;  2ZXJ A;  1UB9 A;  3PFY A;  3ISP A;  2ZO4 A;  4CA0 A;  3EUH C;  3A01 A;  4MTD A;  1ZRC A;  1SFU A;  5IP9 J;  2E5N A;  4MQ9 F;  1U6G A;  3GZN B;  1S7A A;  3I3L A;  4L0Z B;  2OF7 A;  2DOD A;  2AO9 A;  1P9Q C;  1FOX A;  5L3B A;  2UV1 A;  5BQT A;  3BR0 A;  1ZRE A;  3J7A O;  1KU9 A;  2K4B A;  1MIJ A;  1FYL A;  4UY8 I;  4YEL A;  2N8G A;  1YHQ I;  5KHD A;  2DAO A;  2FX0 A;  2HI3 A;  2LF7 A;  2Y31 A;  3WHB A;  2W84 A;  3PNY A;  3TO9 A;  1J09 A;  4MIM A;  2HXI A;  1KA8 A;  2UXX A;  2HYF A;  2RNJ A;  2IGK A;  5HOD A;  5DEQ A;  2Q2E B;  5CQE A;  3K1N A;  1W4M A;  4MFE A;  3LQQ A;  2M4G A;  2K9N A;  5FGM A;  4BJ6 C;  1Y56 A;  2FNP A;  4W1U A;  4E70 A;  4EGY A;  4L5E A;  5DD8 A;  3IH2 A;  4I09 A;  4ZYD A;  1I3A A;  2G7H A;  2KIM A;  4AIH A;  2W00 A;  1R00 A;  5FKN A;  3H9Q A;  3LSR A;  5JFR A;  4WX9 A;  2HZD A;  2P0W A;  3IP4 B;  3HOW J;  4JX6 A;  1UHM A;  3FXR A;  2IXS A;  1MKM A;  3JRG A;  4X6A J;  1DP7 P;  3G6E I;  5F1R A;  5IY5 H;  1XB4 A;  4UUT A;  2PI0 A;  3MAJ A;  2CJJ A;  3WTT C;  2HEO A;  4R1H A;  2DOE A;  3EQL F;  3V8K A;  4ENM A;  1D0X A;  1HOM A;  2LP0 A;  4G94 A;  2LMD A;  3RSN A;  2A3S A;  4IHX A;  1U3E M;  2EA2 A;  4NQW B;  2XPW A;  3Q5F A;  3HGY A;  1WI9 A;  1YTY A;  2AXL A;  4ETS A;  2IS1 A;  2MH9 A;  2F48 A;  2Z1D A;  1WZ2 A;  3CCU I;  3D5R C;  4M74 A;  4KT5 C;  3OYE A;  2JRM A;  5LFA A;  2ESH A;  3IKV A;  2AQF A;  2XPU A;  3CCV I;  1V55 H;  2FBK A;  4E7L A;  2E2H J;  3U1D A;  2ZJ2 A;  1QO0 D;  2HNH A;  1JGS A;  1WJD A;  1MBE A;  3DWL E;  4PJ0 C;  5B1B H;  2PQ8 A;  3F0C A;  2XV4 S;  5ILU A;  4F91 B;  1AHD P;  5LBQ A;  1MZB A;  4G6Q A;  2QQA A;  5E79 C;  2FU4 A;  3PSF A;  4DGW B;  2DA4 A;  3COA C;  1MMA A;  3LMM A;  1G59 A;  4HW0 A;  2WC2 A;  1K4T A;  1W1W E;  2CUJ A;  2DMQ A;  2O61 A;  1IG7 A;  1JJ6 C;  1ZN2 A;  3GTL J;  2ACJ A;  2YPR A;  1RPW A;  4RGR A;  5A2Q K;  2L54 A;  5CVV A;  4KMU X;  4Y3O A;  2ZKZ A;  4L18 B;  2DDB A;  4OWR B;  4KJZ A;  1K61 A;  2XDV A;  4A0X A;  1S72 I;  4HX7 A;  1HKS A;  2L9N A;  3QOD A;  2IGN A;  1H88 C;  1KU7 A;  1GVJ A;  3ABL H;  2VKV A;  1ZG5 A;  2BXY A;  1CF7 B;  1TQP A;  4JOM A;  2E5Z A;  1TQI A;  1FNN A;  4AD9 A;  3KP3 A;  1SFE A;  3KE2 A;  1NTC A;  4YG2 F;  2PEX A;  2DA3 A;  4PJN A;  2M7A A;  5LLQ A;  2QQB A;  2OV7 A;  3G71 I;  3DXJ F;  3GF2 A;  1IV6 A;  2YU3 A;  4ZYA A;  3JTH A;  4XIC A;  3D5S C;  2QCO A;  2VJI A;  3PIP F;  4ZC3 A;  2I10 A;  2L7Z A;  3FXO A;  3MVP A;  4RGS A;  1RZ4 A;  1UG2 A;  3MKZ A;  1Y1W J;  1W5S A;  1JT0 A;  1G4D A;  1TTY A;  4KIS A;  2BBY A;  3RPQ A;  1T98 A;  3DCF A;  3LA2 A;  5IYB J;  2L7K A;  1HBX G;  3GTQ J;  3PUB A;  2A6T A;  3JRI A;  2QLZ A;  3FBN B;  4I76 A;  4ZZL A;  4FX4 A;  3F8M A;  3DBL B;  5DCM B;  1V5G A;  3W6K B;  2PJP A;  1XMA A;  2VBX A;  4UHT A;  1FYM A;  3FKJ A;  5HS8 A;  2DOA A;  1D3Y A;  4ZDL A;  5EF6 A;  2NVT J;  3LSP A;  1K83 J;  2B7E A;  2ZNZ A;  3GVA A;  1FIP A;  4G6D A;  1MMN A;  2X48 A;  3IAM 2;  3E6M A;  3QRF F;  5F04 A;  4Q5S F;  2VQL A;  4N4O B;  4HLY A;  1BOB A;  3HYI A;  1X1D A;  1OJL A;  4Y7N J;  3LQR A;  3HSF A;  2BW3 A;  2M87 A;  4IHV A;  3LNQ A;  3Q9S A;  4Y52 J;  2LRD A;  2EFO A;  1F5T A;  1MBJ A;  3PNV A;  1FBS A;  1R5I D;  3FWE A;  5ILS A;  3W6V A;  4D7M A;  4BQN A;  3LSI A;  5CVU A;  1TL8 A;  3KZI C;  2PJR A;  1ZYR F;  3OYK A;  4LB5 A;  1ITY A;  1U2W A;  5F27 A;  1Y39 A;  3F8N A;  1Z67 A;  3UKG A;  2M9H A;  1BA5 A;  4RS8 A;  2LSO A;  4BDZ A;  1ZKG A;  3FXJ A;  3CO6 C;  1S5L C;  2IGO A;  5E18 F;  2GLO A;  1FP1 D;  3C3W A;  3CC4 I;  4X1E A;  2XAS A;  2R7V A;  3H5N A;  2ZME A;  1K78 A;  3SZT A;  2VQC A;  2Y48 A;  3QYB A;  5LEK A;  1P4W A;  3LAJ A;  4EJV A;  5F0F A;  5HDG A;  1LDJ A;  3A01 B;  4IHW A;  2VC1 A;  2CQ7 A;  5F08 A;  4MLO A;  2CV0 A;  2M5W A;  4O6J A;  1R58 A;  1WI3 A;  2LBF A;  2KRF A;  3H35 A;  4PZJ A;  3IUO A;  4BAC A;  3WGI A;  3C2H A;  3W6J B;  3ZQF A;  2DFI A;  2M30 A;  3FKI J;  3MQ0 A;  4DIQ A;  1YQA A;  4UVC A;  3ABT A;  2GAU A;  2AQE A;  2WTE A;  2KRH A;  4N9H A;  3I55 I;  1IUF A;  2X1C A;  2MLK A;  2BY0 A;  3I71 A;  2H94 A;  2QA4 I;  1YJ9 I;  5H6R A;  3S3O A;  2HOA A;  2Z33 A;  4RAZ A;  2FML A;  1JE8 A;  2NNN A;  3IWZ A;  2CW8 A;  4IXA A;  1W7P D;  3WOD F;  4BHC A;  2VJ4 A;  2ELK A;  5B5E C;  2B0L A;  5GAG J;  3ZPL A;  3HRS A;  2L0K A;  5GAH J;  3GZ5 A;  5HDK A;  3A4C A;  3E5X A;  2KIS A;  4RB3 C;  2W48 A;  2M7B A;  3MFK A;  1MW7 A;  2XC7 A;  1FMV A;  1RUO A;  2X85 A;  5CPR B;  3KZZ A;  4XKV A;  3IC7 A;  4M3D A;  3BTC A;  1IC8 A;  2EJR A;  3I4M J;  2XGC A;  1JHF A;  5EEG A;  3LA7 A;  1A6I A;  4DYC A;  1BI1 A;  1W0U A;  3GBG A;  2LF8 A;  4E7H A;  1E2X A;  3CP8 A;  4Y13 A;  3VOE A;  1ODD A;  1UFM A;  3J80 Z;  3WG7 H;  2VB6 A;  2LFB A;  3BR2 A;  3RQI A;  3JRF A;  2DK8 A;  4IRH A;  3FK7 A;  2E7X A;  4HG2 A;  4KIT B;  3LOC A;  3D0S A;  3P9K A;  1QZY A;  2G7U A;  3TP0 A;  2TDX A;  3HKZ A;  3ZMS A;  4DW6 A;  1YFH A;  5DTD A;  1DGR M;  3I64 A;  3QOE A;  2EZL A;  2X9D A;  1QBJ A;  2WAQ N;  1UCR A;  4XSZ F;  1WFX A;  3M8F A;  3QP6 A;  4BHB A;  4EM1 A;  2GZW A;  4G12 A;  3BG6 A;  4BKX A;  3GME A;  4HF1 A;  3HJE A;  3F9K A;  1FOK A;  2JSC A;  3OYM A;  1V4R A;  5D5U B;  3CD6 I;  3H3V K;  5IT9 K;  3PJR A;  3B6A A;  5M3M J;  3GFL A;  2Z9O A;  3LSJ A;  2M8E A;  3S16 J;  1U5T C;  1SVL A;  1HA8 A;  3QP5 A;  1P92 A;  4EJW A;  3ZN1 A;  4JYK A;  3BG3 A;  3FIW A;  3E3V A;  3NAR A;  2CUF A;  3R0J A;  4JK1 X;  3JTG A;  3KX2 A;  3SJM A;  1EH7 A;  1TWG J;  3P9I A;  4I0B A;  2X51 A;  4ASN A;  2F4I A;  3RPU D;  3MWM A;  2B63 J;  3TKY A;  1PJR A;  1B8I A;  4WK8 F;  2FBI A;  1A35 A;  5ERI A;  2CFX A;  2ZNY A;  2K27 A;  3LA3 A;  1MDM B;  1P4A A;  3F22 A;  3ABU A;  2ZXW H;  4XMY A;  2QSH X;  2AHQ A;  2E34 A;  3JSP A;  1R1U A;  1J0R A;  3U9G A;  1MH4 A;  1O3S A;  5LEJ A;  3VPR A;  3DBH B;  2Z3Y A;  3DV8 A;  4BQA A;  1Z91 A;  4I2O A;  4DBQ A;  4E7J A;  2Z5U A;  3DBR B;  1G6N A;  1YIO A;  4KIG A;  1KQ8 A;  3NAU A;  3OV8 A;  4P1W A;  3ECO A;  5LGT A;  4EVI A;  4A3M J;  1QU3 A;  1HST A;  4C3H J;  1ON2 A;  1TWF J;  3LL7 A;  2V4J C;  4GGG A;  2M4K A;  3LWF A;  3L2R A;  2R4G A;  4ZDO A;  2LKP A;  1V5F A;  3AAF A;  4NB5 A;  1TC3 C;  1SAX A;  3DTE A;  3RKQ A;  1O57 A;  4A3I J;  1F1Z A;  1SEU A;  2X6O A;  2MG4 A;  2BYV E;  3HZJ A;  3B02 A;  4EJU A;  2YR2 A;  1PVE A;  4D5F A;  3JRB A;  5TRD A;  5E17 F;  2HXO A;  2DDA A;  2LC2 A;  3LSH A;  4CCN A;  2M8G X;  1I50 J;  1X4P A;  5F0C A;  1ETX A;  3WE3 A;  1VQP I;  3TP3 A;  1R49 A;  2R5Y A;  1QA6 A;  2E2I J;  3RYR A;  3G1O A;  1QVU A;  3JSO A;  3KLN A;  2GXB A;  2ECB A;  3WHC A;  4LG0 A;  3CF5 F;  1FMW A;  4ZZD A;  2M0M A;  2DN0 A;  3CCE I;  1P7I A;  2BVM A;  3KIO A;  2IGM A;  3QYF A;  1MNE A;  3K1M A;  1T6S A;  4XID A;  2VL8 A;  4HV6 A;  2H1L A;  4KNY A;  3O3K A;  2VPL A;  4B44 A;  3GFI A;  4BBR J;  5D8L B;  2DFF A;  5C3E J;  4XLH A;  1I6X A;  1SD7 A;  3OS0 A;  4ZDP A;  1XSX A;  3TOB A;  1EH8 A;  1RC9 A;  5ILV A;  4LLN A;  3G73 A;  5M3F J;  1KU3 A;  5FRM A;  1B6A A;  4CYC B;  3Q0V A;  4UUV A;  2H6C A;  3DPU A;  4CZZ A;  2ECC A;  4Y33 A;  1OCR H;  2QSG X;  2BW3 B;  1KON A;  3HSR A;  4Y4R A;  2VKH A;  2K5C A;  3N97 A;  2V9K A;  4RLF A;  4YIF A;  1XX5 A;  4Z6Y A;  3C1D A;  4BDY A;  4MO7 A;  4AWX B;  2ID3 A;  3SFI A;  2DLL A;  3VSK A;  2L7M P;  1T0F C;  2VN2 A;  4GDF A;  2PJR B;  2UZK A;  2YS9 A;  1PUF A;  3GTM J;  4BEH A;  3GLX A;  4AIK A;  2GXA A;  4F93 B;  4OAY A;  3HDD A;  2DMP A;  3H9J A;  1FX7 A;  3KP6 A;  5H20 A;  5JVG F;  3OY9 A;  3C18 A;  4LFU A;  4KN4 X;  2CO5 A;  3KPH A;  1IXS B;  3Q3S A;  4LLL A;  3UR3 C;  4RGU A;  5BOX A;  3PSI A;  1O4X A;  3S93 A;  2FJ1 A;  3H5R A;  2ZME B;  1XCV A;  1SD4 A;  2M45 A;  4JP0 A;  4NC7 A;  4A6E A;  5J1Y A;  1K78 B;  1NK3 P;  1LDD A;  5DDG A;  4XLN F;  3HOU J;  3PUF A;  4XN3 A;  2DW4 A;  3OIP A;  5HNH A;  1GXQ A;  2XB0 X;  4UVB A;  2LBF B;  1OCT C;  3V8L A;  2B9S A;  2R93 J;  2RNG A;  5DYM A;  3K2A A;  5FKM A;  1VQ9 I;  2K9Q A;  3OSF A;  3HHG A;  1PDN C;  2DMT A;  3JRE A;  2EFP A;  2VOD A;  4D9J A;  1TBX A;  1XDU A;  4LIT A;  1HDD C;  2GIV A;  1KZH A;  4BE0 A;  3M1E A;  3F72 A;  3NQO A;  4N9I A;  4JQF A;  2Y0S A;  2ZJQ F;  2WAE A;  2WAD A;  3MCZ A;  4A3B J;  1I5Z A;  3WU2 C;  4F55 A;  5HLH A;  2PBI A;  1MNM C;  1IN7 A;  1BN5 A;  1K7A A;  3WGH A;  3VYR B;  5JVT A;  4A3C J;  1SC7 A;  4RGX A;  4I98 B;  3CLO A;  3TO7 A;  5K1Y A;  4RAY A;  1X58 A;  3N05 A;  4LD5 A;  2DA2 A;  2JUG A;  2MA3 A;  1RI7 A;  1T08 B;  4OMY A;  1T95 A;  1UZC A;  3I59 B;  5LRR A;  5EZH A;  5DUI A;  3L2V A;  2HR3 A;  1LEB A;  1ENH A;  3WTY C;  1R4M B;  1H89 C;  3H92 A;  2XSJ C;  3CUQ C;  2VOO A;  1RNL A;  2XGE A;  2R7D A;  1Q1H A;  3M9A A;  2VOP A;  1ZGA A;  4RB0 A;  1Z9C A;  1DPR A;  1P2F A;  3PQJ A;  1IV8 A;  3DPL C;  3E7L A;  5GPA A;  1MND A;  4DBR A;  2LD5 A;  3MKY B;  2MW8 A;  3S2D J;  1J7K A;  1UHW A;  2FOK A;  3TW6 A;  4CO8 A;  2O03 A;  2F4M B;  4HF0 A;  5FRO A;  3V7R A;  4ON0 A;  5L3G A;  3CCR I;  1ZRF A;  2BHZ A;  2X0L A;  1RES A;  3HPG A;  3R6S A;  2NNY A;  3ZQ7 A;  5C4X J;  1Q1V A;  3ZQL A;  4M6X A;  2F5F A;  2FEZ A;  5KCM A;  4V19 K;  2HGC A;  1F4K A;  4FE7 A;  3D1N I;  2R7X A;  1Z7U A;  2HPI A;  3DU6 A;  2PLY A;  5GPC A;  2H1K A;  2GM4 A;  4HX4 A;  4GRI A;  3S8P A;  4DZP A;  2D5V A;  3RDI A;  5LHH A;  2EB7 A;  4DOZ A;  5J1U A;  2KKO A;  4UVA A;  4WF2 A;  2P5L C;  1B4A A;  4E7I A;  1ERD A;  1OCZ H;  3TBI A;  4CCM A;  2BHY A;  5J3L A;  1GUU A;  3T1B A;  1SVM A;  2OJE D;  4B8X A;  1QQI A;  1FSE A;  1HXD A;  1LKX A;  1IZ1 A;  2CH0 A;  2NRA C;  2HWV A;  4FAS D;  3KFW X;  4U7B A;  5DS9 A;  4XRS A;  4Q48 A;  1XMX A;  3MZH A;  3EPZ A;  1BI2 A;  4GYI A;  3BR6 A;  2D1V A;  3HXL A;  3OOU A;  4ESJ A;  5IYC J;  1GVD A;  2TRT A;  3TO6 A;  3OYC A;  4PDK A;  1QGP A;  1NH3 A;  4XRS G;  5GTH C;  1OYI A;  3PFI A;  3FBI B;  1E3O C;  2YUS A;  1P6R A;  3J81 K;  5K5Q A;  4B09 A;  4IZZ A;  2K9S A;  2GA2 A;  3WE2 A;  3ZRG A;  5E3N A;  2FSW A;  2HU9 A;  4OIN F;  1HLV A;  1M1E B;  2F5D A;  2HOS A;  4D5C A;  5IYD J;  1X1C A;  4HRI A;  5CQG A;  2RAE A;  1H9T A;  1IW7 F;  2P5K A;  3ZQH A;  1QNT A;  3SHF A;  1BJZ A;  4H4K C;  2LYC A;  2X6Y A;  4O3M A;  3FK6 A;  2KLO A;  2R7O A;  5FB2 A;  4FTH A;  1FLI A;  1H8A C;  1T33 A;  2E35 A;  2QQ9 A;  1U5T A;  3CCJ I;  3CDL A;  1ON1 A;  3ESW B;  3G3Z A;  3K0L A;  2LY2 A;  2VQG A;  2O9L A;  2R5Y B;  4QLC U;  2VBY A;  3FM5 A;  1GV2 A;  1XC5 A;  2OUM A;  4LG0 B;  4ESF A;  1IF1 A;  4ESB A;  4XOT A;  4XR6 A;  5EEA A;  1TLH B;  5IOY A;  2IJL A;  1E17 A;  1IN4 A;  2VBW A;  1JTX A;  2EZI A;  4B1R A;  4RMN A;  2MFZ A;  2FMY A;  2A61 A;  3K1P A;  2FF4 A;  1B59 A;  5H6Q A;  3ZN0 A;  1IRG A;  4CCL A;  2GIZ A;  2E1O A;  5LRS A;  4EGZ A;  3HOZ J;  1G3S A;  1MBG A;  3SQN A;  3TW7 A;  5E1X A;  5AIQ A;  4LG3 A;  4BGD A;  1R7J A;  2NVX J;  3PL8 A;  5HS7 A;  1RET A;  2P8T A;  3HUG A;  4BE2 A;  2BY3 A;  2HQ5 A;  3TOA A;  1MGT A;  2HPM A;  2ELJ A;  2VLA A;  2P4W A;  1R9T J;  1BM9 A;  1JUS A;  2GOX B;  1WJB A;  1ZR2 A;  4AU7 A;  2ISZ A;  1J75 A;  1YRN A;  4A5N A;  1XGN A;  2HVQ A;  2JK3 A;  3OSG A;  2XUB A;  1XGM A;  3K4L A;  1PUF B;  3ERM A;  4A2U A;  2A07 F;  1I6H J;  4BJ5 C;  2CV2 A;  3GUD A;  5J40 A;  9ANT A;  1LB2 A;  2KZV A;  4ZYE A;  3BRO A;  1IJW C;  3BG9 A;  3BG5 A;  4KUM A;  1DDN A;  3IV5 A;  1XTA A;  1ZLK A;  4NC8 A;  4KYW A;  3FXL A;  4HBL A;  5JLW A;  3KLO A;  4N4N B;  2IAI A;  2PMZ A;  4U88 A;  1AOY A;  4HNV A;  3WTS C;  2DT5 A;  4YEJ A;  5D6F A;  1MSF C;  5EGO A;  3HRU A;  1N75 A;  2CGP A;  1SFX A;  3SEQ A;  5HLT A;  1QPI A;  1YLF A;  4JBA A;  4ENJ A;  2R7Q A;  3RQ4 A;  2HYG D;  2IS4 A;  1EF4 A;  1BI3 A;  2DA5 A;  3M8J A;  1RRJ A;  2IS6 A;  3S2H J;  3OWT A;  3M8E A;  5FLX Z;  3BQY A;  1WKM A;  4AYB A;  1ETV A;  2A6H F;  1GXP A;  4RM2 A;  3BJA A;  3V7S A;  1ULY A;  3BPV A;  1LPQ A;  2W85 A;  4C3J J;  2F5E A;  3DQV C;  1HW1 A;  2MYS A;  3CQZ J;  1K6O A;  3P9C A;  3ELK A;  3GTP J;  3HHH A;  1VFC A;  2DBB A;  1P7J A;  1T0F A;  1JUM A;  2QQ8 A;  3CP2 A;  4IQ4 A;  1A04 A;  2BV6 A;  1TW2 A;  3R60 A;  4MEX F;  1Y1V J;  2X1E A;  1OR7 C;  4XLF A;  1EJ9 A;  1NHA A;  1I39 A;  2R7U A;  1ETQ A;  1LFB A;  5F64 A;  2CUE A;  3A0B C;  1IN8 A;  4RAF A;  4H0E A;  4MTE A;  2CS3 A;  2KMU A;  2V6C A;  1LQ1 A;  1R6R A;  4UV8 A;  2ZSI B;  3AG1 H;  2KIQ A;  1X1A A;  2EV6 A;  3M3Y J;  1BBY A;  1XD7 A;  1SD6 A;  2FUG 2;  2DMU A;  1B72 A;  2R7R A;  4ANJ A;  3O8G A;  2XPV A;  1HW5 A;  1L0O C;  3DU5 A;  5JHU A;  2JA2 A;  2NAZ A;  3BY6 A;  2LLK A;  1WGX A;  4DYR A;  1YS6 A;  3RZO J;  4IHT A;  2O5R A;  1Z21 A;  1HQC A;  1FT9 A;  1QZE A;  2J5O A;  3I9V 2;  1WJE A;  1O7L A;  2Y75 A;  1BW6 A;  4C3I J;  3L2Q A;  4DQ2 A;  1TT5 B;  4LLG F;  3DLA A;  1RR8 C;  4XOP A;  2MC3 A;  1T38 A;  2JQ7 A;  2P6S A;  2KJC A;  4EEF G;  3L09 A;  2DPU A;  3WTU C;  4QPQ A;  2WWY A;  2ZBK A;  2XF6 A;  5BMZ A;  2HZT A;  5K7H A;  4OAZ A;  2JVG A;  4ZJZ A;  5E8I A;  2EIL H;  5FKL A;  4IEJ A;  4Y17 A;  1I27 A;  2V1X A;  3L00 A;  3L2W A;  4A3K J;  4U87 A;  1X1B A;  5FRN A;  4PK4 A;  2P7V B;  1XN7 A;  3E97 A;  2NYX A;  3L7W A;  2HTJ A;  1WWX A;  3ZMZ A;  1D5Y A;  1OQY A;  2DYS H;  2F5C A;  2VIX A;  3K4M A;  2XAG A;  3G1L A;  3EDP A;  1J5Y A;  3JCU C;  4RM3 A;  1XS9 A;  4BL0 B;  1UJ8 A;  2KDO A;  2V79 A;  3K4C A;  3DLL F;  2Y30 A;  1WJ5 A;  2GBY A;  4XBF A;  1LFU P;  4BJT A;  3ONQ A;  2Z99 A;  5BNG A;  2CU7 A;  1YO5 C;  3LAP A;  1R4N B;  1J2X A;  1UHS A;  1P4X A;  2LNB A;  5CVR A;  4C2T A;  4CGZ A;  1ZGJ A;  2KHM A;  1YJN I;  4LMY A;  1BI0 A;  4MNU A;  1JHH A;  4HNT A;  4G7O F;  1DU6 A;  3GTG J;  3CJN A;  4BU2 A;  3JRD A;  1HW2 A;  2WAF A; 
#chains in the Genus database with same CATH homology
 2M34 A;  3TP3 A;  2KDZ A;  1VI0 A;  2R5Y A;  5K7Z A;  1DU0 A;  2E2I J;  3G1O A;  2Y9Z A;  1QVU A;  2ECB A;  3WHC A;  1GV5 A;  3HM5 A;  2DN0 A;  1A5J A;  1FEX A;  1P7I A;  4A3L J;  5EZG A;  4XID A;  1F36 A;  3S1N J;  4BY1 J;  2JWT A;  2LY9 A;  4BBR J;  3JRH A;  2DA1 A;  1F43 A;  5C3E J;  3S1Q J;  3IH3 A;  2Y2Z A;  5M3F J;  4CYC B;  3Q0V A;  4BXX J;  1AKH B;  3PO2 J;  2HOT A;  2ECC A;  3DEW A;  3GTJ J;  1ZK8 A;  1WH5 A;  4I6Z A;  2KT0 A;  2VUM J;  2TCT A;  1HCR A;  1CQT A;  2M0C A;  3HB9 A;  4MO7 A;  4UUS A;  2ID3 A;  3SFI A;  1VF9 A;  2XGD A;  4LOC A;  2NVQ J;  2L7M P;  2CRG A;  3A01 A;  3BR5 A;  4FE4 A;  1T56 A;  2M2E A;  3G1M A;  5IP9 J;  2NVY J;  2YS9 A;  1PUF A;  2OF7 A;  3GTM J;  2AO9 A;  5FKK A;  4A3E J;  3BR0 A;  3HDD A;  2DMP A;  1OFC X;  5J1R A;  2JJ7 A;  1TWH J;  2N8G A;  3Q3S A;  1O4X A;  2R7Z J;  2FX0 A;  1HDP A;  2HI3 A;  1XG1 A;  2FJ1 A;  2WB1 N;  2Y31 A;  4JP0 A;  3WHB A;  5J1Y A;  1NK3 P;  5EG0 A;  3HOU J;  2CQX A;  4MIM A;  2HXI A;  5IP7 J;  3ZQG A;  1YRN B;  2E2J J;  4GFB A;  5HOD A;  1VND A;  4C2M J;  2XB0 X;  1OCT C;  2VPR A;  5K7F A;  2ME6 A;  1JT6 A;  2HYJ A;  2R93 J;  1X2M A;  4MFE A;  3K2A A;  2XRL A;  5FKM A;  1UMQ A;  1ZGW A;  3PM1 A;  2K9Q A;  5F1J A;  3OSF A;  1APL C;  2QF7 A;  2K9N A;  2DMT A;  3MN2 A;  3JRE A;  4AUX A;  4W1U A;  4L5E A;  5FLM J;  1HDD C;  3IH2 A;  3JRC A;  2R5Z B;  1ZQ3 P;  2FD5 A;  4CYC A;  5FKN A;  3LSR A;  1ORK A;  1AKH A;  1RKT A;  2LTP A;  5FJ8 J;  1Z0X A;  4A3B J;  3Q0U A;  2WV1 A;  3HOW J;  1MNM C;  2XSD C;  5E3O A;  1BL0 A;  4JX6 A;  4DZJ A;  4A3C J;  3JRG A;  4X6A J;  3O8H A;  4M3G A;  1GDT A;  4UUT A;  1X58 A;  1S7E A;  2DA2 A;  2CJJ A;  3BQZ A;  2MGQ A;  5EZH A;  1HOM A;  2LP0 A;  1ENH A;  1H89 C;  4IHX A;  1U8B A;  2G0E A;  2XPW A;  5IPA A;  3HGY A;  2DA6 A;  1G2H A;  2XGE A;  1SAN A;  2ID6 A;  1ETW A;  4J19 A;  3S1R J;  1U9O A;  4B4C A;  3E7L A;  2XB5 A;  5GPA A;  2LD5 A;  2XPU A;  2MW8 A;  3S2D J;  1JKP C;  3TW6 A;  2E2H J;  4V2F A;  1X2N A;  2Y0S N;  1MBE A;  1ZR4 A;  3F0C A;  1RES A;  5C4X J;  3LSG A;  4QSH A;  1I3Q J;  1Q1V A;  3ZQL A;  1JTY A;  1AHD P;  4FCY A;  5IOZ A;  4FE7 A;  3BR3 A;  3D1N I;  2DA4 A;  4DYQ A;  1MH3 A;  5JLX A;  5GPC A;  2H1K A;  1IGN A;  2GM4 A;  2DMQ A;  1IG7 A;  1TWA J;  1JJ6 C;  4JX5 A;  5E3L A;  3GTL J;  1RPW A;  4DZP A;  2D5V A;  5J1U A;  1U9N A;  1LE8 A;  1ETY A;  1K61 A;  5J3L A;  1GUU A;  4M6V A;  3HEF A;  5E3M A;  1H88 C;  4A3D J;  2VKV A;  5M5X J;  1FTZ A;  5DS9 A;  4XRS A;  2EZK A;  1ETO A;  1NTC A;  3BR6 A;  2DA3 A;  3HGG A;  3OOU A;  5IYC J;  1GVD A;  2TRT A;  2LKX A;  3S17 J;  1IV6 A;  2JA7 J;  4XIC A;  2QCO A;  4XRS G;  2LK2 A;  1E3O C;  1QVT A;  2YUS A;  3A02 A;  3HOY J;  2I10 A;  1BW5 A;  2L7Z A;  3MVP A;  4FIS A;  1UG2 A;  1Y1W J;  3S1M J;  1JT0 A;  2K9S A;  4NDL A;  1FTT A;  5E3N A;  2HDD A;  1HLV A;  4M3B A;  3DCF A;  5IYB J;  1IRZ A;  2HOS A;  2LVS A;  1FIA A;  3GTQ J;  4D5C A;  5IYD J;  3JRI A;  4I76 A;  3M4O J;  4V2G A;  1WPK A;  1IDZ A;  4S0H B;  3GTO J;  2RAE A;  3OIO A;  2IBD A;  3ZQH A;  1BJZ A;  1RKW A;  2Y9Y A;  2NOG A;  3FK6 A;  2DA7 A;  4FTH A;  4W97 A;  3FIS A;  5EF6 A;  2NVT J;  3LSP A;  1K83 J;  1H8A C;  1T33 A;  4XRM A;  1FIP A;  1MBK A;  3BT9 A;  2X48 A;  5F04 A;  2EQR A;  4A93 J;  3CDL A;  2EH3 A;  2O9L A;  2R5Y B;  1OJL A;  4Y7N J;  1GV2 A;  1XC5 A;  2IEK A;  1MBF A;  4IHV A;  5EEA A;  5EGO B;  3LNQ A;  1MBH A;  4Y52 J;  5IOY A;  4A69 C;  3BTL A;  3ZOB A;  1MBJ A;  1JTX A;  2VI6 A;  2EZI A;  4B1R A;  3W6V A;  1ETK A;  4D7M A;  5M5Y J;  2YU9 J;  5M5W J;  1JGG A;  2E19 A;  2NS8 A;  2OPT A;  1ITY A;  2E1O A;  3B6C A;  5F27 A;  5FLV A;  3HOZ J;  2EZH A;  1MBG A;  3TW7 A;  3UKG A;  2M9H A;  1BA5 A;  1ZTR A;  4IHY A;  2ZB9 A;  2DMN A;  2NVX J;  1ZKG A;  2JA8 J;  4A3F J;  3BR1 A;  1RET A;  2GLO A;  1RR7 A;  4M3F A;  3CMY A;  2HQ5 A;  4X1E A;  1JKR C;  2FQ4 A;  4BY7 J;  3ZQI A;  4UUS B;  1R9T J;  1JUS A;  1ZR2 A;  1YRN A;  5F0F A;  3A01 B;  2JK3 A;  4IHW A;  3OSG A;  1WH7 A;  2P81 A;  5F08 A;  4MLO A;  1PUF B;  1WI3 A;  5EDN A;  1I6H J;  3ZQF A;  2ME0 A;  3FKI J;  1JUP A;  3K7A J;  2VKE A;  9ANT A;  1W0T A;  1IJW C;  3BG9 A;  3BG5 A;  4AC0 A;  3QPL A;  3QPS A;  3IV5 A;  2R5Z A;  4A3J J;  1POG A;  1WCM J;  2DTZ A;  3BTI A;  3MKL A;  1MSE C;  5JLW A;  1IUF A;  1B72 B;  3ZQC A;  5EG0 B;  2IAI A;  3C2B A;  4HNV A;  2HOA A;  1I50 J;  1MSF C;  5GP9 A;  5EGO A;  1QPI A;  4XK4 A;  2COB A;  2ELK A;  2L0K A;  2NS7 A;  1EF4 A;  2DA5 A;  3S15 J;  3S2H J;  2W48 A;  5C4J J;  1B8I B;  3PO3 J;  1NK2 P;  3BQY A;  4JX4 A;  1ETV A;  2O8K A;  4M3D A;  3BTC A;  1QRY A;  1IC8 A;  3RZD J;  3I4M J;  2XGC A;  4C3J J;  1OCP A;  1FJL A;  1A6I A;  4DYC A;  3JR9 A;  3CQZ J;  2LR8 A;  3GBG A;  1W0U A;  3GTP J;  4D7N A;  1VFC A;  1SFO J;  1P7J A;  3S14 J;  1JUM A;  1Z77 A;  4QTR A;  2LFB A;  3BR2 A;  3RQI A;  3JRF A;  2L7F P;  2JA5 J;  2R0Q C;  1Y1V J;  1GT0 C;  3FK7 A;  2PMZ N;  3LOC A;  1ETQ A;  1LFB A;  3TP0 A;  4DW6 A;  2CUE A;  2H8R A;  2R92 J;  5DTD A;  4BBS J;  2EZL A;  2X9D A;  2WAQ N;  4QIW N;  1IDY A;  2DJN A;  4G12 A;  5IP6 A;  4BKX A;  3M3Y J;  2JN6 A;  1JKQ C;  3HOV J;  4AYB N;  3IH4 A;  2DMU A;  4MFD A;  3GTK J;  1B72 A;  3QQA A;  3O8G A;  3H3V K;  2XPV A;  3SDG A;  5F0H A;  3B6A A;  4B3A A;  5M3M J;  2EBI A;  3L1P A;  4RBO A;  3LSJ A;  2LLK A;  1WGX A;  4DYR A;  3S16 J;  2JA6 J;  3RZO J;  3CCY A;  4JYK A;  3BG3 A;  3FIW A;  3NAR A;  2CUF A;  4RDU A;  5FKO A;  3SJM A;  4C3I J;  1BW6 A;  1TWG J;  2MSY A;  2B63 J;  1B8I A;  2JMW A;  3HKZ N;  4EEF G;  1LE8 B;  2AHQ A;  2O7O A;  2CQQ A;  3A03 A;  3HBL A;  1MH4 A;  5K7H A;  3VPR A;  1HF0 A;  5FKL A;  4IEJ A;  4A3K J;  1D5Y A;  1TWC J;  3BTJ A;  3NAU A;  2K40 A;  3G1L A;  5EYR A;  4A3M J;  1XS9 A;  4C3H J;  1TWF J;  1JKO C;  2L9R A;  2Y30 A;  3H0G J;  2GBY A;  4ABZ A;  1U78 A;  1LFU P;  5BNG A;  4A3G J;  2CU7 A;  1TC3 C;  3JRA A;  3RKQ A;  4A3I J;  1UHS A;  2X6O A;  2MG4 A;  1JJ8 C;  3TED A;  1DU6 A;  4D5F A;  3GTG J;  3JRB A;  1AU7 A;  5C44 J;  2HXO A;  4M3E A;  3Q0W A;  3JRD A;  3I4N J;  2M8G X;  5F0C A;  1ETX A;  3HOX J; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...