1K83J

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k83J00
3ZQFA 3JRIA 2W48A 1AKHA 5DTDA 3H3VK 2ELKA 4QIWN 5F0FA 1QRYA 3HGGA 5J3LA 2D5VA 2DMQA 5FKMA 4RDUA 3S16J 1CQTA 3HOVJ 1ETVA 2NVXJ 1LFBA 4D5FA 1K61A 4A3FJ 1MBFA 4M3DA 1O4XA 1H8AC 2XB5A 5EZHA 3CCYA 4ABZA 3OSGA 4XRMA 3BR3A 4MLOA 5M3FJ 2O7OA 1YRNB 2HDDA 3SJMA 1EF4A 5C44J 4DYQA 5J1YA 3Q3SA 2ID6A 1MBGA 5IPAA 1ITYA 4QSHA 3BG5A 3HOWJ 2VI6A 1T56A 5M3MJ 1ORKA 2H8RA 1JKRC 3HOYJ 4Y52J 2EQRA 2AO9A 4AYBN 1JKQC 1JKPC 2K9SA 1ETXA 2FD5A 2FQ4A 5DS9A 1ENHA 2LLKA 3I4MJ 1RETA 4D7NA 1B72A 5IYBJ 2XPWA 5E3NA 2E2IJ 5IP6A 3C2BA 4M3GA 3GTQJ 1K83J 3TP3A 3TW6A 3NAUA 4D7MA 2DA4A 2DA3A 4X1EA 3K7AJ 3WHBA 1APLC 2NVYJ 3IH4A 1BJZA 4BXXJ 2XGEA 2K9NA 1R9TJ 3HM5A 4S0HB 2E2JJ 2LP0A 1H88C 4M3BA 5FJ8J 2XGDA 4M6VA 2N8GA 3CQZJ 3ZQIA 1NTCA 1DU6A 1Y1VJ 2M9HA 4JX6A 2LD5A 3S1QJ 2YUSA 3JRHA 2FX0A 2IEKA 4A3LJ 3ZQHA 5GPAA 3FK7A 1JGGA 2L7MP 2L0KA 1BL0A 3BG3A 2DMUA 4IHYA 1HOMA 5E3LA 2EZIA 2YU9J 1XG1A 4FE4A 3E7LA 2HI3A 2YS9A 5FKOA 1GT0C 1HDPA 1MBKA 2FJ1A 1WGXA 1P7JA 1GV5A 2HXOA 4JP0A 5FLVA 3JRFA 3TEDA 2GBYA 1DU0A 3QPLA 2ECBA 1IDYA 4XIDA 1ETYA 2M34A 2COBA 2CU7A 2R5YB 2LVSA 2DJNA 5FKLA 5C4XJ 2Y0SN 1G2HA 2EZKA 1ETKA 3QQAA 1QVTA 3BQYA 3TP0A 4A69C 4A3MJ 2HOTA 5J1UA 3A01B 1U9OA 1IUFA 2OF7A 3G1MA 3BR6A 4BBSJ 2DA7A 2JJ7A 3SFIA 1UMQA 1RESA 2CQXA 3CMYA 1NK2P 1ZTRA 2R5ZB 3M4OJ 2Y9YA 4V2FA 2ME6A 1GUUA 4C3HJ 5EGOB 2PMZN 1JTYA 2NS7A 5HODA 1JUPA 1RKTA 2K40A 3BR2A 3HBLA 4A3JJ 4G12A 2VUMJ 2CUFA 3HB9A 4A3KJ 4A3EJ 1PUFA 1JUSA 1UHSA 1Z0XA 2JWTA 2R5YA 4C2MJ 1X2NA 2GLOA 3S1NJ 1AHDP 5F0HA 1U78A 5F27A 3FISA 1GDTA 3DCFA 4MIMA 2GM4A 5K7FA 4UUSB 3IV5A 4W1UA 5F04A 1OCPA 1FIAA 2EZHA 4B3AA 2LTPA 2HXIA 2VKVA 4C3IJ 3HOUJ 1W0TA 2R5ZA 2K9QA 4CYCB 3JRAA 2XPVA 2R92J 2JA6J 1BA5A 4A93J 3D1NI 3HOXJ 1MBEA 2ME0A 3LOCA 3QPSA 3I4NJ 4W97A 1H89C 1IJWC 1D5YA 3LSJA 4A3GJ 3FKIJ 5IYDJ 4DZJA 2JK3A 2EH3A 3F0CA 1MNMC 1BW6A 1IRZA 1RPWA 5K7HA 4JYKA 5EG0B 4DYRA 3BG9A 5GPCA 1Q1VA 1MH4A 5E3OA 5M5WJ 1YRNA 2NVQJ 2XSDC 1LE8B 2LY9A 1HF0A 4B1RA 5GP9A 3HOZJ 1P7IA 3HGYA 2MG4A 1JT0A 1JJ8C 4CYCA 2DMTA 2CRGA 2P81A 3BR1A 1B8IB 3ZQGA 3GTGJ 1FTZA 2NS8A 4MFDA 4AUXA 1VNDA 1U8BA 1I50J 1TC3C 5F1JA 2G0EA 2KDZA 4MO7A 3LSRA 3SDGA 2QCOA 3JRGA 3GTMJ 3CDLA 1QPIA 3OIOA 2MSYA 3GTLJ 3Q0VA 1ZK8A 1IG7A 3MN2A 3HDDA 4X6AJ 5EDNA 3LSGA 5IOYA 4FISA 1A5JA 3BQZA 3G1OA 2X6OA 3TW7A 3A02A 2M0CA 3W6VA 3BTCA 1AU7A 4FTHA 2M2EA 5FLMJ 4C3JJ 4NDLA 3NARA 1MSEC 3RKQA 4A3DJ 3GBGA 1JJ6C 2R7ZJ 5F0CA 4B4CA 3S2HJ 2JMWA 1I6HJ 4QTRA 1MBHA 4A3IJ 2ECCA 1OCTC 2OPTA 2E19A 5BNGA 2HOAA 2X48A 4HNVA 2E2HJ 3BTLA 2R93J 4J19A 2NOGA 1ZR2A 4IHVA 3GTJJ 1Z77A 5IOZA 2R0QC 4M3EA 4DZPA 1B8IA 2CUEA 2DMNA 4XICA 1JT6A 1W0UA 3PO3J 1JTXA 4V2GA 4XRSA 4MFEA 1XC5A 2RAEA 2XB0X 1UG2A 2L7FP 3MKLA 4JX4A 3JRCA 1HCRA 2HQ5A 1LFUP 2E1OA 4UUTA 3O8HA 4IEJA 1F43A 3GTPJ 1FTTA 3UKGA 2JA7J 3O8GA 4XRSG 2JA8J 2XPUA 2EZLA 2MGQA 3A03A 3S15J 3B6CA 4I6ZA 3IH3A 3A01A 2AHQA 5JLXA 3H0GJ 5JLWA 1F36A 1QVUA 1HLVA 1A6IA 4I76A 3ZOBA 1RR7A 1TWFJ 4GFBA 3HEFA 4DYCA 1ZGWA 1TWGJ 2Y2ZA 1GVDA 2DN0A 2XGCA 1FEXA 1POGA 4L5EA 5EF6A 1IDZA 3B6AA 3ZQLA 5EGOA 4RBOA 2XRLA 2CQQA 3FIWA 3Q0UA 4BBRJ 2TCTA 2X9DA 5K7ZA 5IP7J 2I10A 3OSFA 2B63J 3S17J 1MH3A 5F08A 2IBDA 3JREA 2M8GX 1VF9A 3RQIA 3M3YJ 5E3MA 3HKZN 1OJLA 4A3BJ 4FCYA 3PM1A 2DA6A 3Q0WA 1E3OC 3S1RJ 4AC0A 2LK2A 1TWAJ 5M5YJ 3BTJA 3DEWA 9ANTA 2ZB9A 1T33A 1X58A 4BY7J 2WAQN 4UUSA 4BKXA 5J1RA 3PO2J 3JRDA 1ZKGA 1S7EA 2WB1N 1FIPA 2LR8A 3VPRA 2L9RA 5IYCJ 1MSFC 3S1MJ 1ETWA 5IP9J 2CJJA 1WPKA 3S2DJ 1X2MA 1XS9A 4EEFG 1VI0A 3G1LA 2EBIA 3BTIA 3GTOJ 3ZQCA 1IGNA 3LNQA 1JKOC 5EZGA 5FKKA 2O9LA 1WI3A 2Y31A 3BT9A 3GTKJ 2DA1A 4A3CJ 3L1PA 1I3QJ 1U9NA 2L7ZA 3K2AA 3RZOJ 4D5CA 2DTZA 1WH7A 1AKHB 3OOUA 4LOCA 3LSPA 5C4JJ 1BW5A 4Y7NJ 1ETQA 4IHXA 3RZDJ 1JUMA 5C3EJ 2HYJA 2WV1A 1Y1WJ 4JX5A 2QF7A 1PUFB 4DW6A 5EG0A 3MVPA 2IAIA 4BY1J 2ID3A 1IC8A 2KT0A 1TWCJ 1WCMJ 2DA2A 1LE8A 2Y30A 1SANA 1WH5A 5FKNA 1FJLA 2TRTA 1TWHJ 2LFBA 1HDDC 1ZQ3P 4FE7A 2JN6A 3FK6A 1IV6A 2JA5J 2DA5A 3BR5A 1ETOA 3JR9A 2NVTJ 1OFCX 2MW8A 5M5XJ 3JRBA 3WHCA 2DMPA 4IHWA 3S14J 1VFCA 1MBJA 2VKEA 1NK3P 1SFOJ 2HOSA 5EYRA 3BR0A 2LKXA 1RKWA 2Y9ZA 5EEAA 4M3FA 1ZR4A 2H1KA 3IH2A 1B72B 1GV2A 2VPRA 2O8KA 4XK4A
chains in the Genus database with same CATH superfamily
4CDGA 3RKWA 3ZQFA 3W3CA 3CLOA 3JRIA 1AKHA 5DTDA 3MKYB 1BOBA 2ZJPF 1OR7C 4FX4A 1QRYA 2IA1A 5J3LA 4XLHA 3PJRA 1R5ID 5CLSA 2D5VA 5FKMA 1A36A 1CQTA 5HS9A 4D5FA 3VDXA 2FEZA 3D0SA 3DPLC 1O4XA 1XGNA 3CLQA 3KZZA 1XCBA 3K4MA 3R0AA 1P4WA 2R7OA 4XRMA 4BS9A 3WU1B 4MLOA 1CF7B 1D5VA 4UXNA 4DYQA 3KFWX 3Q3SA 3K4BA 1YW8A 2LNBA 4IPAA 4CGZA 5IPAA 2XRNA 1O3RA 3HOWJ 1T56A 1U5TC 3IWZA 4KIBA 1UAAA 1JKRC 4Y52J 1VQPI 1J0RA 1T0FA 1LPQA 1MD0A 1JKQC 1FP2A 3CF5F 1QPMA 2EILH 2XC7A 1ENHA 2LLKA 3FXQA 1RETA 5B66C 1B72A 3PUBA 3I4MJ 5IYBJ 1G8XA 3JTHA 1GXPA 3TP3A 1RC9A 4E7KA 3BCBA 5LHGA 4D7MA 4RB2C 2DA4A 2IA0A 3IP4B 4FASD 3GLXA 2K9NA 2B7EA 3HM5A 3RQ4A 3S2WA 1MMDA 4M6VA 2OQGA 2QBYB 3OMYA 2CFXA 2AQFA 1NTCA 3QYFA 2M9HA 2VL8A 2D45A 2WBMA 3OL3A 3JRHA 4E7LA 3OIPA 5E79C 5GPAA 1JGGA 4RGXA 4OU0A 1ODDA 2DMUA 4C30A 4YELA 3OYNA 4IHYA 1HOMA 1YIOA 2YU9J 2EZIA 3DTEA 3H9GA 4YFNF 2JZYA 3PFIA 4G9YA 2EINH 2V79A 3E7LA 5FROA 2YS9A 5FKOA 4AIHA 4G6DA 5ILSA 1FPQA 2FJ1A 3AL0B 3ZQQA 4IX7A 2LC2A 1MGTA 1ZREA 3EDPA 1LUJB 4XSXF 3K1NA 4AD9A 2X51A 3JRFA 3G4SI 4D0PA 1NH3A 3H0DA 4XKBA 1IDYA 2W1OA 1IW7F 3HJEA 5FKLA 1R4NB 4KISA 2L5QA 3BZKA 2EZKA 5GTHC 4ZTFA 3E6CC 1SD6A 4M9ZA 2RNGA 3BY6A 3ASOH 4O6JA 4E7JA 4ENNA 4AVZA 1U9OA 2FMLA 3S3MA 2ZC2A 3V8KA 1X1BA 3B73A 1R58A 4HV6A 1RESA 3E5QA 4RA2A 5CJ9A 1QZZA 2VT3A 3G73A 3E6DA 2A68F 2QZ8A 4CCLA 4PFPA 3U1DA 3M4OJ 2Y9YA 3O2PE 4V2FA 2A05A 2ME6A 4MTEA 4B3XA 3R6SA 2Y0SA 2EK5A 5EGOB 2PMZN 5D8KB 3DEEA 3FMRA 2OCEA 1R1UA 2K86A 4P1WA 1JUPA 3BR2A 3FXKA 3OS2A 1XB4A 4G12A 1LJ9A 1MJ9A 2OZ6A 1Z3XA 3KLOA 2DBBA 3SYTA 3AG3H 3BWGA 3CP8A 1T98A 1LB2A 2W24A 4L5IA 4HSRA 4TV7A 5DEQA 3U2RA 2VXZA 2GLOA 2OZUA 4Q5SF 3S1NJ 5LFAA 1R1VA 4HLXA 1ZRFA 3ML6A 2BBYA 2ZMEA 2IT0A 2HYGD 1ZN2A 1YTYA 3FISA 4PGGA 4A0ZA 2LH9A 4FT8A 4MIMA 2GM4A 2DXIA 3WTYC 2XKOA 1JGSA 2BVMA 1J75A 2X6YA 3TQNA 5CVRA 4WCGA 2R7TA 1A6QA 4HX8A 2HXIA 1D0ZA 1W0TA 2R5ZA 4OWRB 1H9TA 3JW4A 4UVAA 1R23A 1BC7C 4E7ZA 2R92J 2EIMH 2W00A 1D1BA 3KZIC 5BPIA 4H0EA 1JXSA 3CCSI 1UCRA 1ZLJA 2H1LA 4YIFA 2ME0A 3SZPA 2IXSA 4DJAA 2QA4I 2CQNA 3LA2A 1KYWA 1SVLA 1TW2A 3IWFA 3FHNA 3BLYA 4C2TA 1T8IA 3TOBA 3R0JA 4Y13A 5D6FA 2K3FA 1OCOH 4AIKA 1MNMC 2KIUA 3GX4X 1OCCH 4F3QA 4K2EA 3Q9VA 1IRZA 1OPCA 1RPWA 5K7HA 4ZYHA 4BXUA 1KQ8A 2OUMA 3BG9A 4H4KC 4Q47A 2LY9A 4XMYA 3HOZJ 2QWWA 4NQWB 3I64A 4XLNF 4E6KG 3HGYA 3LL7A 4UVBA 3QPTA 4F91B 3WTWC 4BAYA 1JJ8C 2JQ7A 1OCRH 2BE5F 1QZYA 1OQYA 3BR1A 3VEPA 2LG4A 1RIOH 1B8IB 3V42A 3GTGJ 4JK1X 2LF8A 2HNHA 3KP2A 4AUXA 2VBXA 5KCMA 2KPMA 2CGPA 2VC1A 2E5NA 2IGOA 1MMSA 5TJJA 2CV2A 3CMMA 2I8DA 2X1CA 2YR2A 3FXOA 3HUGA 3SDGA 4BQNA 4OMZA 1S7OA 2A6HF 2DTRA 5JI6A 4YG2F 2MSYA 2YPRA 4KUMA 3OY9A 1HBXG 3EYIA 2JT1A 2BZTA 3RTRA 4LG3A 4X6AJ 3C7JA 3LSGA 5IOYA 2IGNA 4FISA 1SVMA 3GW2A 4XOTA 3TW7A 3A02A 3HOTA 3FHZA 2M0CA 3W6VA 3BTCA 1AU7A 3HPGA 4NDLA 3KEYA 4DBQA 3RKQA 3NEUA 1JJ6C 3WTVC 2R7ZJ 4B4CA 4BQOA 4PJNA 1I6HJ 3GZ5A 4UY8I 1MBHA 4A3IJ 2ECCA 4PUSA 1K6OA 2VKHA 5E1ZB 3J7AO 5L3DA 5BNGA 4I7HA 2E2HJ 4CCNA 3RKYA 4C9YA 4NHJA 2BY2A 3LAPA 3GTJJ 1Z77A 3C3WA 4E4HA 5IOZA 3N05A 2CUEA 2DMNA 3FDYA 5LLQA 1W0UA 2CO5A 2YU3A 3FF5A 2L54A 1RZ4A 4ZYGA 1R36A 2XB0X 3WU0A 1UG2A 5E8IA 5LBQA 1PVEA 2Y48A 1RRJA 3C18A 1TT0A 4XLEA 3CJQB 3EUAA 3GTPJ 4M9SA 1J5YA 3CF2A 2M30A 2XPUA 3PSFA 4LK0F 1IXCA 1R5HA 3SXYA 4EM1A 2AHQA 3A01A 2DPDA 1LEAA 1HSJA 4GCVA 1D0XA 5JLWA 4RB1A 1N77A 1QVUA 1XN7A 1W5SA 1O3TA 1ZGWA 1SMYF 4AU7A 3VYSB 1DPRA 2EA2A 3ABKH 4IHTA 1O3SA 1XD7A 3F3XA 3L2QA 5E1XA 5B5EC 5EF6A 1Z1DA 2JA2A 2D2WA 3ZQLA 4C2UA 4RAFA 3EYYA 1MNDA 2UWMA 4PCQA 2WC2A 3DQVC 5ERIA 4KA4A 2HFHA 2ZCWA 3WG7H 3Q0UA 4LLLA 1N25A 5LRRA 3K6GA 4BE0A 2XAGA 3KETA 1G59A 4I0AA 3OSFA 3S17J 3JAMZ 2E1CA 2C6YA 3M1CA 4G8XA 1WJFA 1YW9A 2IGMA 2A61A 2M8GX 2QUFA 2WY8Q 1UB9A 5E20A 4BYYA 3M3YJ 5E3MA 3HXLA 1EH7A 3PQJA 2NAZA 4CICA 1PUEE 2LK2A 4HNUA 4HW0A 4ZYAA 3SZTA 1R49A 3DEWA 2GXBA 1X58A 5J4VA 3ECOA 2COMA 2ESHA 3FMQA 2ZNYA 2E36A 1XSDA 1O7LA 1VQ5I 1IRFA 1UG0A 1HXDA 4OIPF 4RMNA 2HQAA 2A07F 5DD8A 3ISPA 2VBYA 5K5OA 2KFDA 4AIDA 3W6KB 2XHKA 2V1NA 4E7HA 2CUJA 3JSPA 5L3GA 3K4CA 1VI0A 3G1LA 3BTIA 3ZQCA 3CUQA 5EZGA 1J09A 3V7CA 2O9LA 4PZJA 3S32A 1I3QJ 3L1PA 2JVHA 2BW3B 2VT2A 1DQUA 2WB1A 5TISC 1T2KA 2XDVA 4B44A 2JSCA 5ILVA 2FUG2 1WZ2A 1HKSA 4FQGA 3KP3A 1EKEA 5HDKA 3PFYA 4RB0A 1HA8A 2A5WA 3C1DA 4RB3C 2GA1A 4II2A 4XN3A 2O3FA 1FNNA 5EG0A 2M45A 3CCVI 4BY1J 2KT0A 3K4NA 3PL8A 1TWCJ 4WXCA 1E2XA 3DV8A 4EJTA 1HSTA 1LE8A 3SFZA 3GFLA 2Y30A 5LRSA 1SANA 4U0VA 1WH5A 1UHMA 3QYBA 3AKZA 1FYMA 2HVQA 3H5AA 2Q1ZB 4ETSA 1YJNI 4JBAA 5KAFC 3JRBA 1U8RA 1ZHFA 4GYGA 1IN4A 2AXLA 2JUCA 3IKVA 3RSNA 2KZGA 4AIJA 5EEAA 1ZR4A 1YFHA 1W7PA 1YX3A 3LMMA 1GVJA 2XGXA 2O8KA 1AWCA 5CVIA 3ZPLA 2VKDA 4RAYA 2CV0A 3Q5FA 1QNTA 4PJMA 4A6DA 3CUOA 1VZ0A 3H3VK 3KE2A 4GRIA 4QIWN 2BV6A 1KYZA 2QQBA 3HGGA 4AVPA 3K9TA 3BROA 2DMQA 4RDUA 1YIJI 4L5JA 3V8JA 2Q2EA 1LFBA 2Y75A 3F8MA 2CMPA 1K61A 4A3FJ 1FBSA 2XB5A 1QO0D 2F4IA 2PEXA 4ABZA 2HVRA 1J2XA 1VQOI 3KLNA 3Q9SA 4P9FA 3FMSA 1MIJA 2O7OA 5KHDA 5J1YA 2KRHA 3ABTA 2ID6A 2LF7A 2R7QA 5KNLA 4A12A 2CV1A 3U1KA 3VYUB 2ZNZA 3BG5A 4IXAA 3KP7A 5HS7A 1BI0A 3FXUA 3S93A 5M3MJ 4KT5C 1MJBA 1HC8A 5CQGA 3TO9A 2H8RA 2Z5UA 5IT9Z 4HBLA 4A2UA 3CCJI 2OV7A 1YW7A 3CZ6A 2AO9A 1VQMI 2HOEA 1I39A 2FD5A 4HF1A 1MMAA 2ZSIB 2NRAC 3K4KA 2DODA 5E3NA 5EEHA 3TOAA 3C2BA 1VQ8I 3J80K 3LFUA 4XRFA 1YYVA 5EJCA 5LEJA 2DA3A 3H35A 1L0OC 4BXXJ 2XGEA 4F7ZA 1R9TJ 4G7ZF 3HRMA 5LGNA 2F48A 4G94A 3BG6A 4KFCA 2O8XA 5FJ8J 2RV8A 2BHYA 2CW7A 3L00A 2CFOA 2N8GA 2G7HA 1W1WE 3CQZJ 3L2RA 4IVNA 4KN4X 4JX6A 4CSWA 1XGMA 4AYBA 2HYFA 5FGMA 3HRTA 1BM9A 2MBFA 3H3ZA 2KIMA 2R7UA 4A3LJ 3BJOA 2CUZA 3ERMA 1CF7A 2L7MP 3FXJA 3BDDA 4HX4A 1BL0A 2STTA 3MMYB 4XN0A 2ACJA 3ZQ7A 5E3LA 3D5SC 3R60A 5D8LB 3WODF 1FOWA 4FE4A 5H6RA 5FRMA 3DLLF 3K2ZA 2VQGA 1ZGJA 1GT0C 2KDOA 2RDPA 1P7JA 1GV5A 3MAJA 4HEA2 2O6GE 2H8WA 4ENKA 2HXOA 1BI2A 2DOAA 2GBYA 1DU0A 3QPLA 1AOYA 4N0BA 3VYTB 2XAJA 1BIAA 1X1PA 2R5YB 4EGYA 4HLYA 2P6TA 1G2HA 4L9TA 2KJBA 3KP5A 1VQ6I 3GZNB 1FT9A 4ZJZA 2XAQA 3BOQA 3K1MA 4EM0B 5J8FA 5CVJA 1DP3A 2F5DA 5J1UA 5L3FA 4XR6A 1TQPA 2OF7A 2GA2A 4QLCU 3F6OA 4BBSJ 1ULYA 1BI3A 4KT6A 3ECHA 2E7WA 2CQXA 2VASA 1ZTRA 2L4AA 3DU5A 4GYIA 3E97A 4KMUX 3ZMVA 4ZDPA 5HDNA 1NG7A 3ZXSA 4ESBA 2VODA 3CESA 3ESWB 1JTYA 2NS7A 2WA0A 4I2OA 3G3ZA 3ONQA 2BHZA 3I4PA 2GOXB 2VUMJ 2CUFA 1QGPA 1WJ5A 3HB9A 5BQTA 1FC3A 1U2WA 3L2UA 2OU2A 2F4MB 2EB7A 4A3EJ 4I01A 1WJDA 2EIJH 3QYEA 5JHUA 4J00A 4RLQA 1FBUA 4C2MJ 1X2NA 3DBHB 2EWNA 2XKPA 1KU9A 1K78B 3DF8A 4PSWA 5F6FA 1ZELA 2RN7A 2EFOA 5FO5A 4MQ9F 5CQEA 1WKMA 4I99C 3KX2A 1P2FA 3GO5A 5F27A 5BOXA 2DW4A 3OYHA 3DCFA 1Y8QB 1GDTA 2O61A 3BP8A 1R6RA 3L2WA 3L9FA 4BL0B 3AG1H 5ICCA 4PJLA 2P6SA 4C3IJ 3FWEA 4BEHA 3CD6I 4CYCB 1EV7A 3JRAA 3SDBA 3WTXC 1Y6IA 3CJRB 3I3LA 4HV5A 3H3UA 3MWMA 1YJ9I 2ADUA 1G3SA 2B0LA 5FD5A 3ZP5A 1I6XA 2ELJA 2QYOA 1BI1A 5A2QK 4DIQA 3LOCA 2DPUA 2HZDA 3GCMA 3HPHA 4N9IA 2HDCA 3H1CA 3LSMA 4I0BA 2D1VA 1USSA 4A3GJ 3MD2A 3FKIJ 4QWQA 3T8RA 4DZJA 1C0WA 2KHMA 2R7FA 3KPHA 4BJ6C 2MH2A 3EQLF 2L01A 4XOPA 2K9LA 2KZVA 3TGNA 3R61A 1B9NA 4JYKA 1X3ZB 4Y15A 2QKMB 3HHHA 3EUHC 2MABA 5GPCA 1Q1VA 1MH4A 1KU2A 5E3OA 5M5WJ 3M8JA 3QOPA 2XSDC 3E5XA 1YRNA 5HLGA 1FX7A 5GP9A 2Z16A 2DCEA 2QSFX 2DYSH 1IO2A 1R5GA 4FHTA 3IL2A 3CO7C 4DOZA 1WJCA 2DMTA 3J7YJ 3ELKA 2VQCA 3V4GA 4NC7A 5J47A 1KQ0A 3T8TA 1FTZA 4IO9F 1VNDA 1U8BA 2AXTC 2Z1DA 2W84A 1OISA 3I9V2 2DFFA 2FBIA 3VYRB 1ONVA 3ZN0A 2KDZA 1MDMB 3RYPA 2M4GA 3LSRA 3LSIA 2QCOA 2XAHA 2MD5A 3JRGA 3CDLA 4EM2A 3GTMJ 1DP7P 3OIOA 1YI2I 2EA4A 2W85A 1LFPA 2VXDA 3M7GA 1ZK8A 1SMTA 3M8FA 3MN2A 3MFKA 3HDDA 2WWYA 4BDYA 2UXXA 3BQZA 1TQMA 2R7DA 5LHIA 2ZSHB 3K70C 3I54A 4BNCA 2MYSA 1OYYA 4MHGA 5FLMJ 3F8FA 3NARA 4ZZDA 4A3DJ 2IS4A 3N97A 1VQ4I 3GBGA 2FRHA 4Y3OA 3I56I 3BZ6A 3DKYA 4A5MA 2OPTA 4IOAF 4PK4A 5DCFA 3FM5A 5IY5H 3T1BA 4HNVA 1Y0NA 3ZCOA 4YIRX 4CHUA 1EH8A 2NOGA 3MEXA 1ZR2A 3DKWA 4CCMA 3V7RA 2DDBA 3A1YA 1JHHA 3CCRI 1B8IA 3K0LA 3IAM2 1TZLA 3K69A 4XICA 2QKLB 1LDKB 2H27A 3ULQB 1WQ2A 4V2GA 3TKYA 3GWZA 4JX4A 1OCZH 1HCRA 1MZBA 1MW7A 4PGHA 3O8HA 1IV8A 4XSZF 1F43A 4Y33A 2HR3A 1FTTA 3OYIA 3O8GA 4XRSG 2STWA 4I09A 5JFRA 3IRRA 2MGQA 1RUOA 3S15J 4I6ZA 5D5WB 2V26A 3IH3A 4BUPA 3I59A 3KIOA 2ISYA 3QODA 1F36A 1HLVA 4I76A 3ZOBA 1TWFJ 3HEFA 4DYCA 4ITVA 1TWGJ 2Y2ZA 2YX7A 5D5XB 1P4AA 2E1MB 4LB6B 1BR4A 1I1GA 3ZMUA 1YHQI 1H9GA 2H6BA 1HW1A 2G7UA 1V5EA 5GTIC 1SEUA 4BQAA 2CQQA 2VBWA 5FLXK 4EQQA 2R3SA 2P5KA 3D5RC 2GIVA 2K27A 1BIBA 2Z2SB 2JRTA 2D1HA 2XVCA 2TCTA 3RKXA 4PFOA 1OMIA 3GFIA 2DO7A 2B63J 1MH3A 2ELHA 2LY1A 3RJPA 2MC3A 3TMOA 2WTEA 4A3BJ 5DCMA 1Q1HA 3KZYA 1WJBA 4N4OB 2DA6A 1W7PD 2DLLA 2EJRA 3ABMH 2FNPA 3LA7A 1IRGA 1E3OC 3S1RJ 2BY0A 3E5UA 3VB2A 1TWAJ 5M5YJ 3OL4A 2HTJA 1E3HA 9ANTA 2ZB9A 4JOMA 1QHGA 3PNYA 1T33A 4Z6YA 4BY7J 5HVQC 4UUSA 1W36C 4BKXA 2XF6A 1WFXA 4GGGA 2EPFA 1S7EA 3TL4X 1ERDA 3E3VA 2HKOA 4U7BA 3WTUC 2L9RA 1MSFC 3HSEA 3CO6C 3S1MJ 1TNTA 2V6EA 1TL8A 1G3TA 2QQAA 3HKZA 3NWSA 1SFXA 5D5UB 1X2MA 1X3UA 3G6EI 1XS9A 2HU9A 1T38A 2EBIA 1PJRA 1IGNA 1IRXA 1V5FA 4M6XA 2K9MA 1DGRM 2GZWA 4MNUA 3OYJA 5FKKA 4V19K 1WI3A 2WAQA 3BJAA 4M9XA 1DUXC 1U9NA 2X1DA 3BCAA 2EV5A 4D5CA 2DTZA 3OOUA 2V9VA 1S3JA 2UZKA 1B6AA 4IQ4A 5C4JJ 1ETQA 4IHXA 1JE8A 3S3NA 1JUMA 5FD6A 2OD5A 2HYJA 4Y17A 2WV1A 3VFZA 3QP6A 3CC4I 4R8HA 5F64A 2PMUA 3O3KA 2KL4A 5AIQA 1BJAA 2M8EA 2MFZA 3HG9A 1U6GA 2M3AA 1R71A 2EIKH 2R7WA 1FYLA 4L0ZB 1JHFA 1TWHJ 1BN5A 1ZQ3P 2FOWA 2JN6A 3FK6A 1IV6A 5CKTA 3TBIA 2XSJC 1OR7A 1YS6A 1ETOA 3BR5A 5B1BH 2W7NA 1FYKA 2HPMA 3QP5A 2P7CB 2MW8A 5M5XJ 1X1AA 3PNTA 4B09A 3AFHA 1MBJA 3J81K 2VKEA 2HOSA 1XGSA 3SZGA 3BR0A 4YFXF 3A0BC 2Y9ZA 2XF7A 4BE1A 1PDNC 1LEBA 4IL6C 4U0WA 4BHPA 3F22A 2V1DA 1GV2A 2MA3A 2M7AA 5BS6A 2WADA 1KQ9A 2VPRA 3LA3A 1V55H 4C3HJ 1GLNA 1G4DA 2BW3A 3OV8A 2DI3A 2IW5A 2ELKA 1ZRDA 3G71I 5AIPA 2BXYA 2DYRH 1U5TA 4L18B 2WAEA 3HOVJ 2VPLA 5L3EA 1ETVA 3WTTC 2NVXJ 1FOKA 2HEOA 3M1EA 3I53A 3ZMTA 4OIQF 1MBFA 1H8AC 4KN7X 3RPUA 2M1BA 2CH0A 3BR3A 1SFKA 2PLYA 3ZR8X 4R79A 2VOOA 2HDDA 4GDFA 5HLTA 3W2VA 2Z9OA 3OWTA 3KEOA 1ITYA 4QSHA 1OLTA 3MQ0A 5BPDA 1YS7A 2VI6A 1ORKA 3H9QA 2DT7B 3HOYJ 5TGTA 2Z3YA 3J7AY 3HYIA 1JKPC 1T95A 2ZXIA 1ETXA 2K9SA 3IRQA 2FQ4A 5DS9A 2EV0A 1LNWA 4UV9A 2QSHX 4D7NA 2L9SA 3C2HA 1WHUA 3C2GA 2E2IJ 1RNLA 5IP6A 4M3GA 3GTQJ 1ON1A 2NXNB 3TW6A 3HUGB 1YLFA 3NAUA 3SQNA 4X1EA 1IZ1A 3K7AJ 3WHBA 3BC8A 1FWZA 1BJZA 2M5WA 4RAGA 3MZHA 4BHBA 2FSWA 2ZJ2A 4MGRA 2E2JJ 1H88C 4M3BA 1HKTA 4IRGA 3W2WA 4MTDA 1DU6A 2DU9A 1Y1VJ 3ABLH 3S1QJ 1T0FC 2YUSA 1MNEA 1MMGA 2F2EA 2L9NA 1B9MA 2IEKA 2P4WA 4LMYA 3WTSC 4KYWA 2R7XA 2LKPA 3FBNB 4IKFA 2QENA 1XG1A 5CPRB 2FBKA 4IOCF 1IXSB 2RNJA 4EVIA 1ZARA 3OYKA 1MBKA 1SD4A 5FFXA 3J80Z 2RKHA 2EFWA 3DBLB 1FMWA 2E1MC 5H2FC 3GMEA 3M8EA 4JP0A 4D1QA 2NNNA 2LOOA 2P5VA 1SAXA 5ICFA 3BPXA 4XIDA 1ETYA 3OYGA 2LVSA 2DJNA 5C4XJ 2Y0SN 3PUFA 4CZCA 1Z91A 2VJ4A 2HVSA 1ETKA 4XL9A 3TP0A 4CCJA 4RGUA 2HOTA 1HW5A 1ZG5A 2DT5A 4HA8A 2W4SA 3A01B 3FBIB 4WX9A 1IUFA 3G1MA 4LG0A 2A5YB 3BR6A 3EUKL 4U0YA 2JJ7A 1F1ZA 3OYLA 1TBXA 1UMQA 2EFQA 4UV8A 2FXAA 3CMYA 5GAEJ 3OYDA 3EPZA 3F8NA 3VOEA 3KP6A 3T0YA 3I55I 3DP7A 3RIRA 3IUOA 3QWLA 2OAZA 1BR1A 2X85A 4IRIA 2R7VA 4OAZA 2F5EA 1WVRA 2BGCA 4U87A 2QM3A 1E3PA 4P55A 1Z3YA 4HSTA 3HSFA 5E8GA 2VJJA 4LITA 1N75A 2CG4A 2K40A 1ZG3A 2V9KA 2X6WA 3TDUC 5EEGA 3PSIA 3U9GA 5FRNA 4RLFA 1QZEA 4A3KJ 4NC6A 1XSXA 1PUFA 1ZH5A 2KMUA 1JUSA 2DQRA 2JWTA 2R5YA 2E60A 3ZN1A 1AHDP 3JAMK 1YG2A 2PMZA 2V4JC 4HYEA 1W5CC 1U0JA 3E1SA 1Z7LA 3F21A 3IHUA 5B1AH 3NRVA 5DV5A 3IV5A 5F04A 1OCPA 1FIAA 3K1PA 2E7XA 2LTPA 4B3AA 2VKVA 2XUBA 4ON0A 1R4MB 3COAC 2PBIA 3SEZA 2FOKA 2KKOA 4YEJA 2P8TA 2F5FA 4MEYF 2JA6J 1BA5A 4WK8F 3HOXJ 3X2QH 3CMEI 1IUYA 2LYCA 3QPHA 3QPSA 3I4NJ 4W97A 4HZFA 1H89C 2LBFB 2ZMEC 4ZDOA 2FQ3A 2BXZA 2JTVA 1IJWC 1D5YA 5IT3A 5KVRA 4XLCA 4M72A 5D4SA 1GXQA 2HPIA 4Z2YA 5B3SH 3U21A 3K10A 4OIRF 2BY3A 4UVCA 2X0LA 2JK3A 3GEZA 3QU6A 4KIGA 2XROA 1XTAA 4RGRA 1K78A 3MKZA 2K7LA 1MJAA 4G7OF 5EG0B 1A31A 2VJ5A 2HTSA 4A5NA 3FXLA 4CA0A 2MC4A 4E7IA 1LE8B 2ZKZA 3OYBA 3CMAI 5JR3A 3FXMA 3I71A 2A69F 2O03A 3WGIA 1VQKI 2MG4A 2OC6A 2G9WA 5A2QZ 4ENJA 1FMVA 4Q4ZF 4CYCA 2DFEA 3F6VA 2P81A 1T08B 4NNJA 3ZQGA 2A6TA 3CJNA 4I02A 4MFDA 5J8CA 2FBHA 2V6CA 3NQOA 3BZCA 1TC3C 5J6XA 4U88A 2G0EA 2DFHA 2R7SA 2GXAA 2FU4A 1W7PB 1D8JA 1IN6A 1SFEA 1UZCA 2VN2A 3GTLJ 1IG7A 2KIFA 1YE9A 2H6CA 2VE8A 5EDNA 2ISZA 1A5JA 3ERED 2QBYA 3G1OA 2X6OA 2ZBKA 2RC4A 1XMAA 1S29A 4S04A 2IGKA 2JPBA 2PJRB 3L2CA 3GVAA 3TO7A 3S2HJ 2JMWA 2KJCA 4QTRA 4A6EA 2VJIA 4XORA 4LLGF 2RQQA 2E19A 4XNFA 1O7FA 1Y8RB 2HOAA 5D5VB 3MCZA 2IVMA 5J40A 3WG9A 2B9SA 4BGDA 1PP8F 4CCKA 2Q8KA 4IHVA 2OBPA 4RGSA 1W4MA 4DZPA 1T39A 4II3A 3N4MA 1DDNA 3ASNH 4MFEA 2XAFA 2RAEA 3JRCA 4XKVA 2L7FP 3MKLA 4A0XA 2HQ5A 1LFUP 2E1OA 2PG4A 4U7DA 4UUTA 1TP4A 1X4PA 4IEJA 1A35A 4KMFA 5IT9K 1SD5A 2KP6A 2PQ8A 3BG7A 4R1HA 3DTIA 1STZA 2JA8J 1B1BA 1ZRCA 3DPTA 4DBRA 3IC7A 3BPVA 4HOBA 1EA3A 5H6QA 1I5ZA 3RDIA 1JI8A 3H0GJ 3WTZA 4GFBA 4GXOA 4ZDLA 2GWRA 4EJWA 5DUKA 2YSRA 1MMNA 2XIGA 2DN0A 3K4JA 4B8XA 4IQJA 2KQRA 1POGA 3HL2A 4RAZA 5FB2A 5KK1A 1IDZA 4EGZA 2FF4A 1IN7A 3UR3C 5EGOA 2QEXI 2XRLA 2ZO4A 3KYCB 1F5TA 3FIWA 3DU6A 1TLHB 3L7WA 3OYEA 4CYDA 4BBRJ 3V7SA 1RUNA 5HNFA 1UELB 5LHHA 1V5GA 2R4GA 2I10A 4L9NA 3OR1C 5F08A 2E35A 1LDDA 2IBDA 3P5JA 3ZRGA 4XLFA 1VF9A 4ESJA 4FCYA 4JQFA 5HOOA 3LFKA 3GUDA 1VQNI 4LIUA 2ZXWH 2V1XA 3ROUA 4XQFA 5E18F 2O5RA 4MEXF 5J1RA 3VWBA 1ON2A 1ZKGA 2WB1N 4BACA 1IF1A 2RGVA 4HNTA 1WJAA 5FLXZ 5IYCJ 1FOYA 4A0YA 5ED4A 2K85A 2M0MA 3F9KA 3S2DJ 5HDGA 4RM3A 2UUZA 2P5LC 3RPUD 1HQCA 2W82A 3S8PA 4ZC3A 1P92A 4EMSA 1W5TA 5JHFA 2KRFA 4KJZA 3LNQA 3A4CA 4RM2A 1DPUA 2Y31A 4HF2A 3BT9A 1T6SA 2JSPA 4A3CJ 3FXRA 2BY1A 2L7ZA 1SD7A 3DWLE 3K2AA 1AKHB 3AG4H 2HWVA 1BW5A 2JUGA 4Y7NJ 2A3SA 1D3YA 4G6QA 4BE2A 3HC7A 2L7KA 3OS1A 4UUVA 3KCCA 4PJ0C 4UHTA 1IN5A 1F9NA 4PSXA 4JX5A 2X1EA 3LSTA 4L9JA 4XKCA 1Z05A 5L3CA 2XV4S 1LDJA 2E1NA 1IC8A 1WCMJ 2DA2A 1YQAA 4HX7A 4LGWA 1X19A 4BXFA 3CUQC 5FKNA 3HRUA 1FJLA 2TRTA 4NQWA 5ICEA 3MKWB 2LFBA 3OYCA 1UHWA 4QPQA 2JA5J 2HS5A 2W25A 4O5VA 2LREA 2DAOA 3F8BA 1TNSA 3WHCA 3DPUA 4Y4RA 4CCOA 4IHWA 1VFCA 3H92A 2K4JA 1NK3P 4BEHB 1KU7A 5EYRA 4LFUA 1SFUA 1XDSA 2Y69H 2LKSA 4M74A 1RKWA 4NC8A 5HLIA 4M3FA 1R7JA 2X6XA 2NVUB 2M7BA 5KAIC 1B72B 1AA7A 1QHHD 4M6YA 2VQHA 3LSHA 2F4OB 1IN8A 1Z6TA 3GFMA 4XK4A 3ZMSA 2BYVE 2W48A 2P7VB 2LRDA 1SAUA 1VTNC 4BDZA 5F0FA 1YO5C 1VQ7I 3I58A 3E0JB 3K70D 1XCVA 1I3AA 2OCCH 2Y0MA 3H9JA 1D8KA 3S16J 1XSVA 1GHCA 3QU3A 4EV0A 4P9UA 3CCMI 5DM6F 2FMYA 4M3DA 5EZHA 3CCYA 3OSGA 3B02A 4HG2A 1EH6A 2IA2A 3EETA 4B43A 2WY7Q 3A0HC 5M3FJ 3J81Z 1YRNB 2LSOA 3CDIA 3HZJA 5C44J 1P6RA 3VSKA 4I98B 3SJMA 1EF4A 3VODA 1SVOA 1MBGA 3A2KA 3WE3A 4FX0A 2NOJB 1E17A 1I1SA 2IS6A 1J9IA 4UB8C 1WRJA 5ICGA 1XX5A 2EQRA 2H94A 2RQPA 3TDZC 2TDXA 4AYBN 2V1UA 3CCEI 2ICWG 3P9CA 2XPWA 1HKQA 4KICA 3WU2C 2W57A 1K83J 2KLOA 4BJTA 2HDWA 2MLKA 2ZXHA 2MLGA 3HOSA 1APLC 2NVYJ 2JRMA 3IH4A 3L09A 1X4OA 2PFBA 3DEUA 4NBQA 1J7KA 4MQVA 4S0HB 2LP0A 2L9VA 1G3YA 2XGDA 1PYVA 3GLLA 3ZQIA 2ZJRF 2LD5A 3WGHA 3H5NA 3CC2I 4ENMA 2FX0A 3ZGKA 4LK1F 4WXDA 4WXHA 3ZQHA 1LVKA 5GAHJ 3FK7A 1G3WA 1P9QC 2NYXA 1OYWA 2L0KA 4LLNA 3BG3A 1LKXA 5FFZA 2QSGX 4DNCA 3CDHA 3CJTB 4M73A 2ZJQF 3JCUC 5K5QA 1Z9CA 1LVAA 2OQRA 5DDGA 4ZTJA 4BJ5C 2HI3A 1G6NA 4HDVA 3OR2C 4YFKF 1V3FA 1R1TA 3KYLA 2PI0A 1F4KA 2UV1A 1HDPA 4GO1A 1WGXA 4F55A 3K4LA 2CW8A 3CC7I 1O57A 1R00A 5FLVA 2LMDA 1FSEA 1KA8A 3HIFA 3TEDA 3PQKA 3HTSB 3GF2A 1X3WB 2ECBA 3T5XA 3CCLI 2M34A 2COBA 1FY7A 2CU7A 4HDUA 4DGWB 2OJED 3H36A 2K02A 2M4KA 2CYYA 4DQ2A 4UNOA 3QQAA 3GYHX 1QVTA 3FZVA 3GXOA 2J5OA 1W36D 3BQYA 4RS8A 1YOVB 2ZMEB 1WJEA 3RYRA 4A69C 5GADJ 4A3MJ 2EFPA 2QQ8A 1KGSA 3G2BA 2ZFWA 3FKJA 3I59B 4OAYA 4ZYEA 2DA7A 2GOMA 4WF2A 3SFIA 2EV6A 4N4NB 4XM3A 4LD5A 3JTGA 1NK2P 2R5ZB 4IHSA 2L02A 3WGGA 1KZHA 2NS0A 4WWCA 1GUUA 5DD4A 2EFNA 2CQ7A 1FLIA 4ZZLA 2A6EF 2DJIA 4NB5A 1TT5B 5HODA 3DFGA 2QQ9A 4A3JJ 1RKTA 2RREA 2X4HA 3HBLA 2VOPA 4HF0A 1K6YA 4F52A 2GQQA 3LQQA 4IF4A 2AS5F 4E7SA 2V7FA 4CH7A 4S05A 2DK5A 2KISA 2Q0OA 3IKTA 3PIPF 1UHSA 5JVTA 1Z0XA 2Z33A 5DCMB 1ZLKA 1EJ9A 3M9AA 2QVOA 4M71A 5H20A 5F0HA 1S8NA 1X1CA 4ASNA 1U78A 2KRCA 5CVUA 3AL0C 5K7FA 4UUSB 1QBJA 2OTLI 4W1UA 5HNHA 2EZHA 4XLPF 3QAHA 3HOUJ 2IS2A 3CCQI 1KONA 5D4RA 2K9QA 3REOA 2VBZA 3TO6A 4KNYA 2XPVA 3LSKA 3E6MA 2DDAA 4OINF 1BR2A 1BBYA 4A93J 3D1NI 4F92B 1MBEA 1UFMA 4BU2A 3EUHA 2HZTA 1YX5A 2OA4A 1WWXA 3DKXA 5HS8A 5K1YA 1Y39A 4BQQA 3S3OA 2ZFUA 2MH9A 2L3DA 3LSJA 4CO8A 2IRFG 4ZYDA 4XONA 5ILUA 1CGPA 5K5RA 1ZAOA 5IYDJ 2GAUA 1O3QA 2GXGA 2VONA 1YITI 1V4RA 2FA5A 1ACIA 2DOEA 2EH3A 3F0CA 4G7HF 3SEQA 2V9PA 1XDUA 3DLAA 1USTA 3R4KA 3P9KA 2AQEA 4EJVA 1BW6A 2XF5A 1FOXA 5LGTA 5LD2C 5J4YA 1ZGAA 3SHFA 3W6JB 4DYRA 6PAXA 2NVQJ 2XAUA 2O0YA 1D0YA 2BVLA 1HF0A 4B1RA 4ZH4F 2CSOA 1P7IA 1S7AA 4IJAA 1B59A 4O3MA 1Y0UA 1RR8C 1JT0A 3PIOF 4XBFA 2CRGA 2HGCA 2RVCA 2VC0A 2E71A 4KIFA 4LB5A 4J01A 4CUGA 2NS8A 3OS0A 1I50J 3ABUA 2K5CA 1QQIA 1NG6A 5F1JA 2LY2A 2QLZA 1K79A 4MO7A 2LBFA 1X1DA 1YJWI 1QPIA 2PJPA 2PX9A 3BJ6A 5CVVA 3Q0VA 3QRFF 5GAGJ 1OYIA 1E0EA 2KIQA 5LEKA 3W2AA 2VB6A 1WI9A 3F72A 3F8CA 1QA6A 3CTAA 1D1AA 1Z6RA 2UXNA 4FETA 4FTHA 4YIIA 4NUBA 1KU3A 3HSRA 2PN6A 3DBRB 2GIZA 5HLHA 1U5TB 2M2EA 4HQEA 4C3JJ 2CQKA 3IAS2 1MSEC 3DTKA 4B47A 5E1WA 1IAWA 5F0CA 2HQNA 4P96A 5F1RA 5DM7F 3OYFA 1K4SA 1OCTC 1UJ8A 2BOLA 1MKMA 3WE2A 2X48A 3AAFA 3JSOA 1FP1D 4B48A 3BTLA 1XMKA 2R93J 4IRHA 3GZ6A 4J19A 4BH9A 1R22A 4P5OA 1TW3A 2R0QC 1XGOA 2WV0A 3LQRA 4M3EA 4Q48A 1N78A 1JT6A 3PO3J 1JTXA 4OOIA 4XRSA 2M87A 1XC5A 2K3PA 3J7ZI 5DUIA 3UKGA 3PNVA 2JA7J 3LWFA 1I27A 2CW0F 2EZLA 2LDUA 4BHCA 2E34A 3A03A 2DT6A 4XLAA 3B6CA 3RCOA 4EJUA 1IXRC 1TQIA 5JLXA 2IP2A 4PJJA 1A6IA 4HAMA 3V8LA 1RR7A 2F5VA 3O6BB 2FE3A 3LAJA 2J5PA 2P0WA 4KITB 2PJRA 2CS3A 1Z7UA 1GVDA 2H09A 2JVGA 4EJOA 1FZPB 2XGCA 1FEXA 2OTJI 1OKRA 2L2OA 4N9HA 2L4MA 4L5EA 3L2VA 3B6AA 2CWEA 1ZYRF 4RBOA 1QU3A 2E5ZA 3E6BA 4PDKA 3ZMDA 2MD0A 1V54H 3H5RA 3F23A 3CUQB 2DOFA 2F6CA 5L3BA 1DGWY 3RI4A 3I5UA 1K4TA 2DK8A 2X9DA 5DYMA 5IP7J 5K7ZA 4LIVA 4ESFA 2ETHA 4LJZF 2F5CA 3JREA 5BMZA 2YX4A 1Z21A 3RQIA 3OOPA 1LQ1A 3FX3A 3HKZN 4HPQA 1OJLA 4HRIA 3UNGC 1TTYA 3PM1A 5TRDA 3QOEA 3OYAA 1XMXA 4ANJA 3Q0WA 4AC0A 2NNYA 1VQLI 3BTJA 4L9VA 1S72I 1Z67A 2WAFA 3FM3A 3GFJA 3M07A 4L0YB 1FBQA 2WAQN 2VLAA 3PO2J 3JRDA 1FIPA 2LR8A 2FNAA 3VPRA 4LG0B 2IPQX 2BEOA 1ETWA 2HQRA 4G6TB 1U3EM 2PMHA 4F93B 5IP9J 3MZ8A 1S6LA 2VE9A 2CJJA 1VQ9I 1WPKA 2ZXJA 1ZG1A 1D1CA 1REPC 4EEFG 1WSUA 4X0GA 1FSHA 2JPCA 3GTOJ 1JKOC 3P7NA 2XASA 1H0MA 5E17F 2Z99A 1P4XA 2DFIA 1J59A 3CCUI 1BOAA 1NHAA 3HTUA 1S5LC 3CP2A 3VSLA 3GTKJ 2DA1A 3DXJF 1Y56A 3I0TA 3KP4A 3ZMZA 3RZOJ 1WH7A 4LOCA 4HQMA 3LSPA 3KYDB 4CXFA 4CZZA 3RZDJ 1PP7U 3KEQA 5C3EJ 5CYVA 1Y1WJ 3MZYA 3NWTA 2QF7A 1PUFB 4DW6A 2Q2EB 4E70A 3MVPA 2IAIA 2ID3A 4KDPA 4OIOF 2I5UA 1XPXA 1M1EB 4AWXB 3D5LA 1B4AA 4YRVA 1HDDC 5D6EA 4FE7A 3AG2H 4D9JA 1K7AA 3P9IA 2DA5A 3JR9A 2R7RA 1S9HA 2NVTJ 2QGUA 1OFCX 2IS1A 2HKXA 2IJLA 4EATA 2DMPA 3HHGA 3S14J 1SC7A 4XKWA 1A04A 5JVGF 1SFOJ 4QPOA 2DQLA 5AONA 3OYMA 5LGUA 3OIQA 3HRSA 2LKXA 1HW2A 2VIXA 1MDMA 3RPQA 1BC8C 1L3LA 2H1KA 3IH2A 2ESNA 4UB6C 4OMYA 1RI7A 4IZZA 2K4BA 4AM3A 2VQLA
chains in the Genus database with same CATH topology
3ZQFA 3JRIA 2W48A 1AKHA 5DTDA 3H3VK 2ELKA 4QIWN 5F0FA 1QRYA 3HGGA 5J3LA 2D5VA 2DMQA 5FKMA 4RDUA 3S16J 1CQTA 3HOVJ 1ETVA 2NVXJ 1LFBA 4D5FA 1K61A 4A3FJ 1MBFA 4M3DA 1O4XA 1H8AC 2XB5A 5EZHA 3CCYA 4ABZA 3OSGA 4XRMA 3BR3A 4MLOA 5M3FJ 2O7OA 1YRNB 2HDDA 3SJMA 1EF4A 5C44J 4DYQA 5J1YA 3Q3SA 2ID6A 1MBGA 5IPAA 1ITYA 4QSHA 3BG5A 3HOWJ 2VI6A 1T56A 5M3MJ 1ORKA 2H8RA 1JKRC 3HOYJ 4Y52J 2EQRA 2AO9A 4AYBN 1JKQC 1JKPC 2K9SA 1ETXA 2FD5A 2FQ4A 5DS9A 1ENHA 2LLKA 3I4MJ 1RETA 4D7NA 1B72A 5IYBJ 2XPWA 5E3NA 2E2IJ 5IP6A 3C2BA 4M3GA 3GTQJ 1K83J 3TP3A 3TW6A 3NAUA 4D7MA 2DA4A 2DA3A 4X1EA 3K7AJ 3WHBA 1APLC 2NVYJ 3IH4A 1BJZA 4BXXJ 2XGEA 2K9NA 1R9TJ 3HM5A 4S0HB 2E2JJ 2LP0A 1H88C 4M3BA 5FJ8J 2XGDA 4M6VA 2N8GA 3CQZJ 3ZQIA 1NTCA 1DU6A 1Y1VJ 2M9HA 4JX6A 2LD5A 3S1QJ 2YUSA 3JRHA 2FX0A 2IEKA 4A3LJ 3ZQHA 5GPAA 3FK7A 1JGGA 2L7MP 2L0KA 1BL0A 3BG3A 2DMUA 4IHYA 1HOMA 5E3LA 2EZIA 2YU9J 1XG1A 4FE4A 3E7LA 2HI3A 2YS9A 5FKOA 1GT0C 1HDPA 1MBKA 2FJ1A 1WGXA 1P7JA 1GV5A 2HXOA 4JP0A 5FLVA 3JRFA 3TEDA 2GBYA 1DU0A 3QPLA 2ECBA 1IDYA 4XIDA 1ETYA 2M34A 2COBA 2CU7A 2R5YB 2LVSA 2DJNA 5FKLA 5C4XJ 2Y0SN 1G2HA 2EZKA 1ETKA 3QQAA 1QVTA 3BQYA 3TP0A 4A69C 4A3MJ 2HOTA 5J1UA 3A01B 1U9OA 1IUFA 2OF7A 3G1MA 3BR6A 4BBSJ 2DA7A 2JJ7A 3SFIA 1UMQA 1RESA 2CQXA 3CMYA 1NK2P 1ZTRA 2R5ZB 3M4OJ 2Y9YA 4V2FA 2ME6A 1GUUA 4C3HJ 5EGOB 2PMZN 1JTYA 2NS7A 5HODA 1JUPA 1RKTA 2K40A 3BR2A 3HBLA 4A3JJ 4G12A 2VUMJ 2CUFA 3HB9A 4A3KJ 4A3EJ 1PUFA 1JUSA 1UHSA 1Z0XA 2JWTA 2R5YA 4C2MJ 1X2NA 2GLOA 3S1NJ 1AHDP 5F0HA 1U78A 5F27A 3FISA 1GDTA 3DCFA 4MIMA 2GM4A 5K7FA 4UUSB 3IV5A 4W1UA 5F04A 1OCPA 1FIAA 2EZHA 4B3AA 2LTPA 2HXIA 2VKVA 4C3IJ 3HOUJ 1W0TA 2R5ZA 2K9QA 4CYCB 3JRAA 2XPVA 2R92J 2JA6J 1BA5A 4A93J 3D1NI 3HOXJ 1MBEA 2ME0A 3LOCA 3QPSA 3I4NJ 4W97A 1H89C 1IJWC 1D5YA 3LSJA 4A3GJ 3FKIJ 5IYDJ 4DZJA 2JK3A 2EH3A 3F0CA 1MNMC 1BW6A 1IRZA 1RPWA 5K7HA 4JYKA 5EG0B 4DYRA 3BG9A 5GPCA 1Q1VA 1MH4A 5E3OA 5M5WJ 1YRNA 2NVQJ 2XSDC 1LE8B 2LY9A 1HF0A 4B1RA 5GP9A 3HOZJ 1P7IA 3HGYA 2MG4A 1JT0A 1JJ8C 4CYCA 2DMTA 2CRGA 2P81A 3BR1A 1B8IB 3ZQGA 3GTGJ 1FTZA 2NS8A 4MFDA 4AUXA 1VNDA 1U8BA 1I50J 1TC3C 5F1JA 2G0EA 2KDZA 4MO7A 3LSRA 3SDGA 2QCOA 3JRGA 3GTMJ 3CDLA 1QPIA 3OIOA 2MSYA 3GTLJ 3Q0VA 1ZK8A 1IG7A 3MN2A 3HDDA 4X6AJ 5EDNA 3LSGA 5IOYA 4FISA 1A5JA 3BQZA 3G1OA 2X6OA 3TW7A 3A02A 2M0CA 3W6VA 3BTCA 1AU7A 4FTHA 2M2EA 5FLMJ 4C3JJ 4NDLA 3NARA 1MSEC 3RKQA 4A3DJ 3GBGA 1JJ6C 2R7ZJ 5F0CA 4B4CA 3S2HJ 2JMWA 1I6HJ 4QTRA 1MBHA 4A3IJ 2ECCA 1OCTC 2OPTA 2E19A 5BNGA 2HOAA 2X48A 4HNVA 2E2HJ 3BTLA 2R93J 4J19A 2NOGA 1ZR2A 4IHVA 3GTJJ 1Z77A 5IOZA 2R0QC 4M3EA 4DZPA 1B8IA 2CUEA 2DMNA 4XICA 1JT6A 1W0UA 3PO3J 1JTXA 4V2GA 4XRSA 4MFEA 1XC5A 2RAEA 2XB0X 1UG2A 2L7FP 3MKLA 4JX4A 3JRCA 1HCRA 2HQ5A 1LFUP 2E1OA 4UUTA 3O8HA 4IEJA 1F43A 3GTPJ 1FTTA 3UKGA 2JA7J 3O8GA 4XRSG 2JA8J 2XPUA 2EZLA 2MGQA 3A03A 3S15J 3B6CA 4I6ZA 3IH3A 3A01A 2AHQA 5JLXA 3H0GJ 5JLWA 1F36A 1QVUA 1HLVA 1A6IA 4I76A 3ZOBA 1RR7A 1TWFJ 4GFBA 3HEFA 4DYCA 1ZGWA 1TWGJ 2Y2ZA 1GVDA 2DN0A 2XGCA 1FEXA 1POGA 4L5EA 5EF6A 1IDZA 3B6AA 3ZQLA 5EGOA 4RBOA 2XRLA 2CQQA 3FIWA 3Q0UA 4BBRJ 2TCTA 2X9DA 5K7ZA 5IP7J 2I10A 3OSFA 2B63J 3S17J 1MH3A 5F08A 2IBDA 3JREA 2M8GX 1VF9A 3RQIA 3M3YJ 5E3MA 3HKZN 1OJLA 4A3BJ 4FCYA 3PM1A 2DA6A 3Q0WA 1E3OC 3S1RJ 4AC0A 2LK2A 1TWAJ 5M5YJ 3BTJA 3DEWA 9ANTA 2ZB9A 1T33A 1X58A 4BY7J 2WAQN 4UUSA 4BKXA 5J1RA 3PO2J 3JRDA 1ZKGA 1S7EA 2WB1N 1FIPA 2LR8A 3VPRA 2L9RA 5IYCJ 1MSFC 3S1MJ 1ETWA 5IP9J 2CJJA 1WPKA 3S2DJ 1X2MA 1XS9A 4EEFG 1VI0A 3G1LA 2EBIA 3BTIA 3GTOJ 3ZQCA 1IGNA 3LNQA 1JKOC 5EZGA 5FKKA 2O9LA 1WI3A 2Y31A 3BT9A 3GTKJ 2DA1A 4A3CJ 3L1PA 1I3QJ 1U9NA 2L7ZA 3K2AA 3RZOJ 4D5CA 2DTZA 1WH7A 1AKHB 3OOUA 4LOCA 3LSPA 5C4JJ 1BW5A 4Y7NJ 1ETQA 4IHXA 3RZDJ 1JUMA 5C3EJ 2HYJA 2WV1A 1Y1WJ 4JX5A 2QF7A 1PUFB 4DW6A 5EG0A 3MVPA 2IAIA 4BY1J 2ID3A 1IC8A 2KT0A 1TWCJ 1WCMJ 2DA2A 1LE8A 2Y30A 1SANA 1WH5A 5FKNA 1FJLA 2TRTA 1TWHJ 2LFBA 1HDDC 1ZQ3P 4FE7A 2JN6A 3FK6A 1IV6A 2JA5J 2DA5A 3BR5A 1ETOA 3JR9A 2NVTJ 1OFCX 2MW8A 5M5XJ 3JRBA 3WHCA 2DMPA 4IHWA 3S14J 1VFCA 1MBJA 2VKEA 1NK3P 1SFOJ 2HOSA 5EYRA 3BR0A 2LKXA 1RKWA 2Y9ZA 5EEAA 4M3FA 1ZR4A 2H1KA 3IH2A 1B72B 1GV2A 2VPRA 2O8KA 4XK4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ZQF A;  3JRI A;  2W48 A;  1AKH A;  5DTD A;  3H3V K;  2ELK A;  4QIW N;  5F0F A;  1QRY A;  3HGG A;  5J3L A;  2D5V A;  2DMQ A;  5FKM A;  4RDU A;  3S16 J;  1CQT A;  3HOV J;  1ETV A;  2NVX J;  1LFB A;  4D5F A;  1K61 A;  4A3F J;  1MBF A;  4M3D A;  1O4X A;  1H8A C;  2XB5 A;  5EZH A;  3CCY A;  4ABZ A;  3OSG A;  4XRM A;  3BR3 A;  4MLO A;  5M3F J;  2O7O A;  1YRN B;  2HDD A;  3SJM A;  1EF4 A;  5C44 J;  4DYQ A;  5J1Y A;  3Q3S A;  2ID6 A;  1MBG A;  5IPA A;  1ITY A;  4QSH A;  3BG5 A;  3HOW J;  2VI6 A;  1T56 A;  5M3M J;  1ORK A;  2H8R A;  1JKR C;  3HOY J;  4Y52 J;  2EQR A;  2AO9 A;  4AYB N;  1JKQ C;  1JKP C;  2K9S A;  1ETX A;  2FD5 A;  2FQ4 A;  5DS9 A;  1ENH A;  2LLK A;  3I4M J;  1RET A;  4D7N A;  1B72 A;  5IYB J;  2XPW A;  5E3N A;  2E2I J;  5IP6 A;  3C2B A;  4M3G A;  3GTQ J;  1K83 J;  3TP3 A;  3TW6 A;  3NAU A;  4D7M A;  2DA4 A;  2DA3 A;  4X1E A;  3K7A J;  3WHB A;  1APL C;  2NVY J;  3IH4 A;  1BJZ A;  4BXX J;  2XGE A;  2K9N A;  1R9T J;  3HM5 A;  4S0H B;  2E2J J;  2LP0 A;  1H88 C;  4M3B A;  5FJ8 J;  2XGD A;  4M6V A;  2N8G A;  3CQZ J;  3ZQI A;  1NTC A;  1DU6 A;  1Y1V J;  2M9H A;  4JX6 A;  2LD5 A;  3S1Q J;  2YUS A;  3JRH A;  2FX0 A;  2IEK A;  4A3L J;  3ZQH A;  5GPA A;  3FK7 A;  1JGG A;  2L7M P;  2L0K A;  1BL0 A;  3BG3 A;  2DMU A;  4IHY A;  1HOM A;  5E3L A;  2EZI A;  2YU9 J;  1XG1 A;  4FE4 A;  3E7L A;  2HI3 A;  2YS9 A;  5FKO A;  1GT0 C;  1HDP A;  1MBK A;  2FJ1 A;  1WGX A;  1P7J A;  1GV5 A;  2HXO A;  4JP0 A;  5FLV A;  3JRF A;  3TED A;  2GBY A;  1DU0 A;  3QPL A;  2ECB A;  1IDY A;  4XID A;  1ETY A;  2M34 A;  2COB A;  2CU7 A;  2R5Y B;  2LVS A;  2DJN A;  5FKL A;  5C4X J;  2Y0S N;  1G2H A;  2EZK A;  1ETK A;  3QQA A;  1QVT A;  3BQY A;  3TP0 A;  4A69 C;  4A3M J;  2HOT A;  5J1U A;  3A01 B;  1U9O A;  1IUF A;  2OF7 A;  3G1M A;  3BR6 A;  4BBS J;  2DA7 A;  2JJ7 A;  3SFI A;  1UMQ A;  1RES A;  2CQX A;  3CMY A;  1NK2 P;  1ZTR A;  2R5Z B;  3M4O J;  2Y9Y A;  4V2F A;  2ME6 A;  1GUU A;  4C3H J;  5EGO B;  2PMZ N;  1JTY A;  2NS7 A;  5HOD A;  1JUP A;  1RKT A;  2K40 A;  3BR2 A;  3HBL A;  4A3J J;  4G12 A;  2VUM J;  2CUF A;  3HB9 A;  4A3K J;  4A3E J;  1PUF A;  1JUS A;  1UHS A;  1Z0X A;  2JWT A;  2R5Y A;  4C2M J;  1X2N A;  2GLO A;  3S1N J;  1AHD P;  5F0H A;  1U78 A;  5F27 A;  3FIS A;  1GDT A;  3DCF A;  4MIM A;  2GM4 A;  5K7F A;  4UUS B;  3IV5 A;  4W1U A;  5F04 A;  1OCP A;  1FIA A;  2EZH A;  4B3A A;  2LTP A;  2HXI A;  2VKV A;  4C3I J;  3HOU J;  1W0T A;  2R5Z A;  2K9Q A;  4CYC B;  3JRA A;  2XPV A;  2R92 J;  2JA6 J;  1BA5 A;  4A93 J;  3D1N I;  3HOX J;  1MBE A;  2ME0 A;  3LOC A;  3QPS A;  3I4N J;  4W97 A;  1H89 C;  1IJW C;  1D5Y A;  3LSJ A;  4A3G J;  3FKI J;  5IYD J;  4DZJ A;  2JK3 A;  2EH3 A;  3F0C A;  1MNM C;  1BW6 A;  1IRZ A;  1RPW A;  5K7H A;  4JYK A;  5EG0 B;  4DYR A;  3BG9 A;  5GPC A;  1Q1V A;  1MH4 A;  5E3O A;  5M5W J;  1YRN A;  2NVQ J;  2XSD C;  1LE8 B;  2LY9 A;  1HF0 A;  4B1R A;  5GP9 A;  3HOZ J;  1P7I A;  3HGY A;  2MG4 A;  1JT0 A;  1JJ8 C;  4CYC A;  2DMT A;  2CRG A;  2P81 A;  3BR1 A;  1B8I B;  3ZQG A;  3GTG J;  1FTZ A;  2NS8 A;  4MFD A;  4AUX A;  1VND A;  1U8B A;  1I50 J;  1TC3 C;  5F1J A;  2G0E A;  2KDZ A;  4MO7 A;  3LSR A;  3SDG A;  2QCO A;  3JRG A;  3GTM J;  3CDL A;  1QPI A;  3OIO A;  2MSY A;  3GTL J;  3Q0V A;  1ZK8 A;  1IG7 A;  3MN2 A;  3HDD A;  4X6A J;  5EDN A;  3LSG A;  5IOY A;  4FIS A;  1A5J A;  3BQZ A;  3G1O A;  2X6O A;  3TW7 A;  3A02 A;  2M0C A;  3W6V A;  3BTC A;  1AU7 A;  4FTH A;  2M2E A;  5FLM J;  4C3J J;  4NDL A;  3NAR A;  1MSE C;  3RKQ A;  4A3D J;  3GBG A;  1JJ6 C;  2R7Z J;  5F0C A;  4B4C A;  3S2H J;  2JMW A;  1I6H J;  4QTR A;  1MBH A;  4A3I J;  2ECC A;  1OCT C;  2OPT A;  2E19 A;  5BNG A;  2HOA A;  2X48 A;  4HNV A;  2E2H J;  3BTL A;  2R93 J;  4J19 A;  2NOG A;  1ZR2 A;  4IHV A;  3GTJ J;  1Z77 A;  5IOZ A;  2R0Q C;  4M3E A;  4DZP A;  1B8I A;  2CUE A;  2DMN A;  4XIC A;  1JT6 A;  1W0U A;  3PO3 J;  1JTX A;  4V2G A;  4XRS A;  4MFE A;  1XC5 A;  2RAE A;  2XB0 X;  1UG2 A;  2L7F P;  3MKL A;  4JX4 A;  3JRC A;  1HCR A;  2HQ5 A;  1LFU P;  2E1O A;  4UUT A;  3O8H A;  4IEJ A;  1F43 A;  3GTP J;  1FTT A;  3UKG A;  2JA7 J;  3O8G A;  4XRS G;  2JA8 J;  2XPU A;  2EZL A;  2MGQ A;  3A03 A;  3S15 J;  3B6C A;  4I6Z A;  3IH3 A;  3A01 A;  2AHQ A;  5JLX A;  3H0G J;  5JLW A;  1F36 A;  1QVU A;  1HLV A;  1A6I A;  4I76 A;  3ZOB A;  1RR7 A;  1TWF J;  4GFB A;  3HEF A;  4DYC A;  1ZGW A;  1TWG J;  2Y2Z A;  1GVD A;  2DN0 A;  2XGC A;  1FEX A;  1POG A;  4L5E A;  5EF6 A;  1IDZ A;  3B6A A;  3ZQL A;  5EGO A;  4RBO A;  2XRL A;  2CQQ A;  3FIW A;  3Q0U A;  4BBR J;  2TCT A;  2X9D A;  5K7Z A;  5IP7 J;  2I10 A;  3OSF A;  2B63 J;  3S17 J;  1MH3 A;  5F08 A;  2IBD A;  3JRE A;  2M8G X;  1VF9 A;  3RQI A;  3M3Y J;  5E3M A;  3HKZ N;  1OJL A;  4A3B J;  4FCY A;  3PM1 A;  2DA6 A;  3Q0W A;  1E3O C;  3S1R J;  4AC0 A;  2LK2 A;  1TWA J;  5M5Y J;  3BTJ A;  3DEW A;  9ANT A;  2ZB9 A;  1T33 A;  1X58 A;  4BY7 J;  2WAQ N;  4UUS A;  4BKX A;  5J1R A;  3PO2 J;  3JRD A;  1ZKG A;  1S7E A;  2WB1 N;  1FIP A;  2LR8 A;  3VPR A;  2L9R A;  5IYC J;  1MSF C;  3S1M J;  1ETW A;  5IP9 J;  2CJJ A;  1WPK A;  3S2D J;  1X2M A;  1XS9 A;  4EEF G;  1VI0 A;  3G1L A;  2EBI A;  3BTI A;  3GTO J;  3ZQC A;  1IGN A;  3LNQ A;  1JKO C;  5EZG A;  5FKK A;  2O9L A;  1WI3 A;  2Y31 A;  3BT9 A;  3GTK J;  2DA1 A;  4A3C J;  3L1P A;  1I3Q J;  1U9N A;  2L7Z A;  3K2A A;  3RZO J;  4D5C A;  2DTZ A;  1WH7 A;  1AKH B;  3OOU A;  4LOC A;  3LSP A;  5C4J J;  1BW5 A;  4Y7N J;  1ETQ A;  4IHX A;  3RZD J;  1JUM A;  5C3E J;  2HYJ A;  2WV1 A;  1Y1W J;  4JX5 A;  2QF7 A;  1PUF B;  4DW6 A;  5EG0 A;  3MVP A;  2IAI A;  4BY1 J;  2ID3 A;  1IC8 A;  2KT0 A;  1TWC J;  1WCM J;  2DA2 A;  1LE8 A;  2Y30 A;  1SAN A;  1WH5 A;  5FKN A;  1FJL A;  2TRT A;  1TWH J;  2LFB A;  1HDD C;  1ZQ3 P;  4FE7 A;  2JN6 A;  3FK6 A;  1IV6 A;  2JA5 J;  2DA5 A;  3BR5 A;  1ETO A;  3JR9 A;  2NVT J;  1OFC X;  2MW8 A;  5M5X J;  3JRB A;  3WHC A;  2DMP A;  4IHW A;  3S14 J;  1VFC A;  1MBJ A;  2VKE A;  1NK3 P;  1SFO J;  2HOS A;  5EYR A;  3BR0 A;  2LKX A;  1RKW A;  2Y9Z A;  5EEA A;  4M3F A;  1ZR4 A;  2H1K A;  3IH2 A;  1B72 B;  1GV2 A;  2VPR A;  2O8K A;  4XK4 A; 
#chains in the Genus database with same CATH topology
 4CDG A;  3RKW A;  3ZQF A;  3W3C A;  3CLO A;  3JRI A;  1AKH A;  5DTD A;  3MKY B;  1BOB A;  2ZJP F;  1OR7 C;  4FX4 A;  1QRY A;  2IA1 A;  5J3L A;  4XLH A;  3PJR A;  1R5I D;  5CLS A;  2D5V A;  5FKM A;  1A36 A;  1CQT A;  5HS9 A;  4D5F A;  3VDX A;  2FEZ A;  3D0S A;  3DPL C;  1O4X A;  1XGN A;  3CLQ A;  3KZZ A;  1XCB A;  3K4M A;  3R0A A;  1P4W A;  2R7O A;  4XRM A;  4BS9 A;  3WU1 B;  4MLO A;  1CF7 B;  1D5V A;  4UXN A;  4DYQ A;  3KFW X;  3Q3S A;  3K4B A;  1YW8 A;  2LNB A;  4IPA A;  4CGZ A;  5IPA A;  2XRN A;  1O3R A;  3HOW J;  1T56 A;  1U5T C;  3IWZ A;  4KIB A;  1UAA A;  1JKR C;  4Y52 J;  1VQP I;  1J0R A;  1T0F A;  1LPQ A;  1MD0 A;  1JKQ C;  1FP2 A;  3CF5 F;  1QPM A;  2EIL H;  2XC7 A;  1ENH A;  2LLK A;  3FXQ A;  1RET A;  5B66 C;  1B72 A;  3PUB A;  3I4M J;  5IYB J;  1G8X A;  3JTH A;  1GXP A;  3TP3 A;  1RC9 A;  4E7K A;  3BCB A;  5LHG A;  4D7M A;  4RB2 C;  2DA4 A;  2IA0 A;  3IP4 B;  4FAS D;  3GLX A;  2K9N A;  2B7E A;  3HM5 A;  3RQ4 A;  3S2W A;  1MMD A;  4M6V A;  2OQG A;  2QBY B;  3OMY A;  2CFX A;  2AQF A;  1NTC A;  3QYF A;  2M9H A;  2VL8 A;  2D45 A;  2WBM A;  3OL3 A;  3JRH A;  4E7L A;  3OIP A;  5E79 C;  5GPA A;  1JGG A;  4RGX A;  4OU0 A;  1ODD A;  2DMU A;  4C30 A;  4YEL A;  3OYN A;  4IHY A;  1HOM A;  1YIO A;  2YU9 J;  2EZI A;  3DTE A;  3H9G A;  4YFN F;  2JZY A;  3PFI A;  4G9Y A;  2EIN H;  2V79 A;  3E7L A;  5FRO A;  2YS9 A;  5FKO A;  4AIH A;  4G6D A;  5ILS A;  1FPQ A;  2FJ1 A;  3AL0 B;  3ZQQ A;  4IX7 A;  2LC2 A;  1MGT A;  1ZRE A;  3EDP A;  1LUJ B;  4XSX F;  3K1N A;  4AD9 A;  2X51 A;  3JRF A;  3G4S I;  4D0P A;  1NH3 A;  3H0D A;  4XKB A;  1IDY A;  2W1O A;  1IW7 F;  3HJE A;  5FKL A;  1R4N B;  4KIS A;  2L5Q A;  3BZK A;  2EZK A;  5GTH C;  4ZTF A;  3E6C C;  1SD6 A;  4M9Z A;  2RNG A;  3BY6 A;  3ASO H;  4O6J A;  4E7J A;  4ENN A;  4AVZ A;  1U9O A;  2FML A;  3S3M A;  2ZC2 A;  3V8K A;  1X1B A;  3B73 A;  1R58 A;  4HV6 A;  1RES A;  3E5Q A;  4RA2 A;  5CJ9 A;  1QZZ A;  2VT3 A;  3G73 A;  3E6D A;  2A68 F;  2QZ8 A;  4CCL A;  4PFP A;  3U1D A;  3M4O J;  2Y9Y A;  3O2P E;  4V2F A;  2A05 A;  2ME6 A;  4MTE A;  4B3X A;  3R6S A;  2Y0S A;  2EK5 A;  5EGO B;  2PMZ N;  5D8K B;  3DEE A;  3FMR A;  2OCE A;  1R1U A;  2K86 A;  4P1W A;  1JUP A;  3BR2 A;  3FXK A;  3OS2 A;  1XB4 A;  4G12 A;  1LJ9 A;  1MJ9 A;  2OZ6 A;  1Z3X A;  3KLO A;  2DBB A;  3SYT A;  3AG3 H;  3BWG A;  3CP8 A;  1T98 A;  1LB2 A;  2W24 A;  4L5I A;  4HSR A;  4TV7 A;  5DEQ A;  3U2R A;  2VXZ A;  2GLO A;  2OZU A;  4Q5S F;  3S1N J;  5LFA A;  1R1V A;  4HLX A;  1ZRF A;  3ML6 A;  2BBY A;  2ZME A;  2IT0 A;  2HYG D;  1ZN2 A;  1YTY A;  3FIS A;  4PGG A;  4A0Z A;  2LH9 A;  4FT8 A;  4MIM A;  2GM4 A;  2DXI A;  3WTY C;  2XKO A;  1JGS A;  2BVM A;  1J75 A;  2X6Y A;  3TQN A;  5CVR A;  4WCG A;  2R7T A;  1A6Q A;  4HX8 A;  2HXI A;  1D0Z A;  1W0T A;  2R5Z A;  4OWR B;  1H9T A;  3JW4 A;  4UVA A;  1R23 A;  1BC7 C;  4E7Z A;  2R92 J;  2EIM H;  2W00 A;  1D1B A;  3KZI C;  5BPI A;  4H0E A;  1JXS A;  3CCS I;  1UCR A;  1ZLJ A;  2H1L A;  4YIF A;  2ME0 A;  3SZP A;  2IXS A;  4DJA A;  2QA4 I;  2CQN A;  3LA2 A;  1KYW A;  1SVL A;  1TW2 A;  3IWF A;  3FHN A;  3BLY A;  4C2T A;  1T8I A;  3TOB A;  3R0J A;  4Y13 A;  5D6F A;  2K3F A;  1OCO H;  4AIK A;  1MNM C;  2KIU A;  3GX4 X;  1OCC H;  4F3Q A;  4K2E A;  3Q9V A;  1IRZ A;  1OPC A;  1RPW A;  5K7H A;  4ZYH A;  4BXU A;  1KQ8 A;  2OUM A;  3BG9 A;  4H4K C;  4Q47 A;  2LY9 A;  4XMY A;  3HOZ J;  2QWW A;  4NQW B;  3I64 A;  4XLN F;  4E6K G;  3HGY A;  3LL7 A;  4UVB A;  3QPT A;  4F91 B;  3WTW C;  4BAY A;  1JJ8 C;  2JQ7 A;  1OCR H;  2BE5 F;  1QZY A;  1OQY A;  3BR1 A;  3VEP A;  2LG4 A;  1RIO H;  1B8I B;  3V42 A;  3GTG J;  4JK1 X;  2LF8 A;  2HNH A;  3KP2 A;  4AUX A;  2VBX A;  5KCM A;  2KPM A;  2CGP A;  2VC1 A;  2E5N A;  2IGO A;  1MMS A;  5TJJ A;  2CV2 A;  3CMM A;  2I8D A;  2X1C A;  2YR2 A;  3FXO A;  3HUG A;  3SDG A;  4BQN A;  4OMZ A;  1S7O A;  2A6H F;  2DTR A;  5JI6 A;  4YG2 F;  2MSY A;  2YPR A;  4KUM A;  3OY9 A;  1HBX G;  3EYI A;  2JT1 A;  2BZT A;  3RTR A;  4LG3 A;  4X6A J;  3C7J A;  3LSG A;  5IOY A;  2IGN A;  4FIS A;  1SVM A;  3GW2 A;  4XOT A;  3TW7 A;  3A02 A;  3HOT A;  3FHZ A;  2M0C A;  3W6V A;  3BTC A;  1AU7 A;  3HPG A;  4NDL A;  3KEY A;  4DBQ A;  3RKQ A;  3NEU A;  1JJ6 C;  3WTV C;  2R7Z J;  4B4C A;  4BQO A;  4PJN A;  1I6H J;  3GZ5 A;  4UY8 I;  1MBH A;  4A3I J;  2ECC A;  4PUS A;  1K6O A;  2VKH A;  5E1Z B;  3J7A O;  5L3D A;  5BNG A;  4I7H A;  2E2H J;  4CCN A;  3RKY A;  4C9Y A;  4NHJ A;  2BY2 A;  3LAP A;  3GTJ J;  1Z77 A;  3C3W A;  4E4H A;  5IOZ A;  3N05 A;  2CUE A;  2DMN A;  3FDY A;  5LLQ A;  1W0U A;  2CO5 A;  2YU3 A;  3FF5 A;  2L54 A;  1RZ4 A;  4ZYG A;  1R36 A;  2XB0 X;  3WU0 A;  1UG2 A;  5E8I A;  5LBQ A;  1PVE A;  2Y48 A;  1RRJ A;  3C18 A;  1TT0 A;  4XLE A;  3CJQ B;  3EUA A;  3GTP J;  4M9S A;  1J5Y A;  3CF2 A;  2M30 A;  2XPU A;  3PSF A;  4LK0 F;  1IXC A;  1R5H A;  3SXY A;  4EM1 A;  2AHQ A;  3A01 A;  2DPD A;  1LEA A;  1HSJ A;  4GCV A;  1D0X A;  5JLW A;  4RB1 A;  1N77 A;  1QVU A;  1XN7 A;  1W5S A;  1O3T A;  1ZGW A;  1SMY F;  4AU7 A;  3VYS B;  1DPR A;  2EA2 A;  3ABK H;  4IHT A;  1O3S A;  1XD7 A;  3F3X A;  3L2Q A;  5E1X A;  5B5E C;  5EF6 A;  1Z1D A;  2JA2 A;  2D2W A;  3ZQL A;  4C2U A;  4RAF A;  3EYY A;  1MND A;  2UWM A;  4PCQ A;  2WC2 A;  3DQV C;  5ERI A;  4KA4 A;  2HFH A;  2ZCW A;  3WG7 H;  3Q0U A;  4LLL A;  1N25 A;  5LRR A;  3K6G A;  4BE0 A;  2XAG A;  3KET A;  1G59 A;  4I0A A;  3OSF A;  3S17 J;  3JAM Z;  2E1C A;  2C6Y A;  3M1C A;  4G8X A;  1WJF A;  1YW9 A;  2IGM A;  2A61 A;  2M8G X;  2QUF A;  2WY8 Q;  1UB9 A;  5E20 A;  4BYY A;  3M3Y J;  5E3M A;  3HXL A;  1EH7 A;  3PQJ A;  2NAZ A;  4CIC A;  1PUE E;  2LK2 A;  4HNU A;  4HW0 A;  4ZYA A;  3SZT A;  1R49 A;  3DEW A;  2GXB A;  1X58 A;  5J4V A;  3ECO A;  2COM A;  2ESH A;  3FMQ A;  2ZNY A;  2E36 A;  1XSD A;  1O7L A;  1VQ5 I;  1IRF A;  1UG0 A;  1HXD A;  4OIP F;  4RMN A;  2HQA A;  2A07 F;  5DD8 A;  3ISP A;  2VBY A;  5K5O A;  2KFD A;  4AID A;  3W6K B;  2XHK A;  2V1N A;  4E7H A;  2CUJ A;  3JSP A;  5L3G A;  3K4C A;  1VI0 A;  3G1L A;  3BTI A;  3ZQC A;  3CUQ A;  5EZG A;  1J09 A;  3V7C A;  2O9L A;  4PZJ A;  3S32 A;  1I3Q J;  3L1P A;  2JVH A;  2BW3 B;  2VT2 A;  1DQU A;  2WB1 A;  5TIS C;  1T2K A;  2XDV A;  4B44 A;  2JSC A;  5ILV A;  2FUG 2;  1WZ2 A;  1HKS A;  4FQG A;  3KP3 A;  1EKE A;  5HDK A;  3PFY A;  4RB0 A;  1HA8 A;  2A5W A;  3C1D A;  4RB3 C;  2GA1 A;  4II2 A;  4XN3 A;  2O3F A;  1FNN A;  5EG0 A;  2M45 A;  3CCV I;  4BY1 J;  2KT0 A;  3K4N A;  3PL8 A;  1TWC J;  4WXC A;  1E2X A;  3DV8 A;  4EJT A;  1HST A;  1LE8 A;  3SFZ A;  3GFL A;  2Y30 A;  5LRS A;  1SAN A;  4U0V A;  1WH5 A;  1UHM A;  3QYB A;  3AKZ A;  1FYM A;  2HVQ A;  3H5A A;  2Q1Z B;  4ETS A;  1YJN I;  4JBA A;  5KAF C;  3JRB A;  1U8R A;  1ZHF A;  4GYG A;  1IN4 A;  2AXL A;  2JUC A;  3IKV A;  3RSN A;  2KZG A;  4AIJ A;  5EEA A;  1ZR4 A;  1YFH A;  1W7P A;  1YX3 A;  3LMM A;  1GVJ A;  2XGX A;  2O8K A;  1AWC A;  5CVI A;  3ZPL A;  2VKD A;  4RAY A;  2CV0 A;  3Q5F A;  1QNT A;  4PJM A;  4A6D A;  3CUO A;  1VZ0 A;  3H3V K;  3KE2 A;  4GRI A;  4QIW N;  2BV6 A;  1KYZ A;  2QQB A;  3HGG A;  4AVP A;  3K9T A;  3BRO A;  2DMQ A;  4RDU A;  1YIJ I;  4L5J A;  3V8J A;  2Q2E A;  1LFB A;  2Y75 A;  3F8M A;  2CMP A;  1K61 A;  4A3F J;  1FBS A;  2XB5 A;  1QO0 D;  2F4I A;  2PEX A;  4ABZ A;  2HVR A;  1J2X A;  1VQO I;  3KLN A;  3Q9S A;  4P9F A;  3FMS A;  1MIJ A;  2O7O A;  5KHD A;  5J1Y A;  2KRH A;  3ABT A;  2ID6 A;  2LF7 A;  2R7Q A;  5KNL A;  4A12 A;  2CV1 A;  3U1K A;  3VYU B;  2ZNZ A;  3BG5 A;  4IXA A;  3KP7 A;  5HS7 A;  1BI0 A;  3FXU A;  3S93 A;  5M3M J;  4KT5 C;  1MJB A;  1HC8 A;  5CQG A;  3TO9 A;  2H8R A;  2Z5U A;  5IT9 Z;  4HBL A;  4A2U A;  3CCJ I;  2OV7 A;  1YW7 A;  3CZ6 A;  2AO9 A;  1VQM I;  2HOE A;  1I39 A;  2FD5 A;  4HF1 A;  1MMA A;  2ZSI B;  2NRA C;  3K4K A;  2DOD A;  5E3N A;  5EEH A;  3TOA A;  3C2B A;  1VQ8 I;  3J80 K;  3LFU A;  4XRF A;  1YYV A;  5EJC A;  5LEJ A;  2DA3 A;  3H35 A;  1L0O C;  4BXX J;  2XGE A;  4F7Z A;  1R9T J;  4G7Z F;  3HRM A;  5LGN A;  2F48 A;  4G94 A;  3BG6 A;  4KFC A;  2O8X A;  5FJ8 J;  2RV8 A;  2BHY A;  2CW7 A;  3L00 A;  2CFO A;  2N8G A;  2G7H A;  1W1W E;  3CQZ J;  3L2R A;  4IVN A;  4KN4 X;  4JX6 A;  4CSW A;  1XGM A;  4AYB A;  2HYF A;  5FGM A;  3HRT A;  1BM9 A;  2MBF A;  3H3Z A;  2KIM A;  2R7U A;  4A3L J;  3BJO A;  2CUZ A;  3ERM A;  1CF7 A;  2L7M P;  3FXJ A;  3BDD A;  4HX4 A;  1BL0 A;  2STT A;  3MMY B;  4XN0 A;  2ACJ A;  3ZQ7 A;  5E3L A;  3D5S C;  3R60 A;  5D8L B;  3WOD F;  1FOW A;  4FE4 A;  5H6R A;  5FRM A;  3DLL F;  3K2Z A;  2VQG A;  1ZGJ A;  1GT0 C;  2KDO A;  2RDP A;  1P7J A;  1GV5 A;  3MAJ A;  4HEA 2;  2O6G E;  2H8W A;  4ENK A;  2HXO A;  1BI2 A;  2DOA A;  2GBY A;  1DU0 A;  3QPL A;  1AOY A;  4N0B A;  3VYT B;  2XAJ A;  1BIA A;  1X1P A;  2R5Y B;  4EGY A;  4HLY A;  2P6T A;  1G2H A;  4L9T A;  2KJB A;  3KP5 A;  1VQ6 I;  3GZN B;  1FT9 A;  4ZJZ A;  2XAQ A;  3BOQ A;  3K1M A;  4EM0 B;  5J8F A;  5CVJ A;  1DP3 A;  2F5D A;  5J1U A;  5L3F A;  4XR6 A;  1TQP A;  2OF7 A;  2GA2 A;  4QLC U;  3F6O A;  4BBS J;  1ULY A;  1BI3 A;  4KT6 A;  3ECH A;  2E7W A;  2CQX A;  2VAS A;  1ZTR A;  2L4A A;  3DU5 A;  4GYI A;  3E97 A;  4KMU X;  3ZMV A;  4ZDP A;  5HDN A;  1NG7 A;  3ZXS A;  4ESB A;  2VOD A;  3CES A;  3ESW B;  1JTY A;  2NS7 A;  2WA0 A;  4I2O A;  3G3Z A;  3ONQ A;  2BHZ A;  3I4P A;  2GOX B;  2VUM J;  2CUF A;  1QGP A;  1WJ5 A;  3HB9 A;  5BQT A;  1FC3 A;  1U2W A;  3L2U A;  2OU2 A;  2F4M B;  2EB7 A;  4A3E J;  4I01 A;  1WJD A;  2EIJ H;  3QYE A;  5JHU A;  4J00 A;  4RLQ A;  1FBU A;  4C2M J;  1X2N A;  3DBH B;  2EWN A;  2XKP A;  1KU9 A;  1K78 B;  3DF8 A;  4PSW A;  5F6F A;  1ZEL A;  2RN7 A;  2EFO A;  5FO5 A;  4MQ9 F;  5CQE A;  1WKM A;  4I99 C;  3KX2 A;  1P2F A;  3GO5 A;  5F27 A;  5BOX A;  2DW4 A;  3OYH A;  3DCF A;  1Y8Q B;  1GDT A;  2O61 A;  3BP8 A;  1R6R A;  3L2W A;  3L9F A;  4BL0 B;  3AG1 H;  5ICC A;  4PJL A;  2P6S A;  4C3I J;  3FWE A;  4BEH A;  3CD6 I;  4CYC B;  1EV7 A;  3JRA A;  3SDB A;  3WTX C;  1Y6I A;  3CJR B;  3I3L A;  4HV5 A;  3H3U A;  3MWM A;  1YJ9 I;  2ADU A;  1G3S A;  2B0L A;  5FD5 A;  3ZP5 A;  1I6X A;  2ELJ A;  2QYO A;  1BI1 A;  5A2Q K;  4DIQ A;  3LOC A;  2DPU A;  2HZD A;  3GCM A;  3HPH A;  4N9I A;  2HDC A;  3H1C A;  3LSM A;  4I0B A;  2D1V A;  1USS A;  4A3G J;  3MD2 A;  3FKI J;  4QWQ A;  3T8R A;  4DZJ A;  1C0W A;  2KHM A;  2R7F A;  3KPH A;  4BJ6 C;  2MH2 A;  3EQL F;  2L01 A;  4XOP A;  2K9L A;  2KZV A;  3TGN A;  3R61 A;  1B9N A;  4JYK A;  1X3Z B;  4Y15 A;  2QKM B;  3HHH A;  3EUH C;  2MAB A;  5GPC A;  1Q1V A;  1MH4 A;  1KU2 A;  5E3O A;  5M5W J;  3M8J A;  3QOP A;  2XSD C;  3E5X A;  1YRN A;  5HLG A;  1FX7 A;  5GP9 A;  2Z16 A;  2DCE A;  2QSF X;  2DYS H;  1IO2 A;  1R5G A;  4FHT A;  3IL2 A;  3CO7 C;  4DOZ A;  1WJC A;  2DMT A;  3J7Y J;  3ELK A;  2VQC A;  3V4G A;  4NC7 A;  5J47 A;  1KQ0 A;  3T8T A;  1FTZ A;  4IO9 F;  1VND A;  1U8B A;  2AXT C;  2Z1D A;  2W84 A;  1OIS A;  3I9V 2;  2DFF A;  2FBI A;  3VYR B;  1ONV A;  3ZN0 A;  2KDZ A;  1MDM B;  3RYP A;  2M4G A;  3LSR A;  3LSI A;  2QCO A;  2XAH A;  2MD5 A;  3JRG A;  3CDL A;  4EM2 A;  3GTM J;  1DP7 P;  3OIO A;  1YI2 I;  2EA4 A;  2W85 A;  1LFP A;  2VXD A;  3M7G A;  1ZK8 A;  1SMT A;  3M8F A;  3MN2 A;  3MFK A;  3HDD A;  2WWY A;  4BDY A;  2UXX A;  3BQZ A;  1TQM A;  2R7D A;  5LHI A;  2ZSH B;  3K70 C;  3I54 A;  4BNC A;  2MYS A;  1OYY A;  4MHG A;  5FLM J;  3F8F A;  3NAR A;  4ZZD A;  4A3D J;  2IS4 A;  3N97 A;  1VQ4 I;  3GBG A;  2FRH A;  4Y3O A;  3I56 I;  3BZ6 A;  3DKY A;  4A5M A;  2OPT A;  4IOA F;  4PK4 A;  5DCF A;  3FM5 A;  5IY5 H;  3T1B A;  4HNV A;  1Y0N A;  3ZCO A;  4YIR X;  4CHU A;  1EH8 A;  2NOG A;  3MEX A;  1ZR2 A;  3DKW A;  4CCM A;  3V7R A;  2DDB A;  3A1Y A;  1JHH A;  3CCR I;  1B8I A;  3K0L A;  3IAM 2;  1TZL A;  3K69 A;  4XIC A;  2QKL B;  1LDK B;  2H27 A;  3ULQ B;  1WQ2 A;  4V2G A;  3TKY A;  3GWZ A;  4JX4 A;  1OCZ H;  1HCR A;  1MZB A;  1MW7 A;  4PGH A;  3O8H A;  1IV8 A;  4XSZ F;  1F43 A;  4Y33 A;  2HR3 A;  1FTT A;  3OYI A;  3O8G A;  4XRS G;  2STW A;  4I09 A;  5JFR A;  3IRR A;  2MGQ A;  1RUO A;  3S15 J;  4I6Z A;  5D5W B;  2V26 A;  3IH3 A;  4BUP A;  3I59 A;  3KIO A;  2ISY A;  3QOD A;  1F36 A;  1HLV A;  4I76 A;  3ZOB A;  1TWF J;  3HEF A;  4DYC A;  4ITV A;  1TWG J;  2Y2Z A;  2YX7 A;  5D5X B;  1P4A A;  2E1M B;  4LB6 B;  1BR4 A;  1I1G A;  3ZMU A;  1YHQ I;  1H9G A;  2H6B A;  1HW1 A;  2G7U A;  1V5E A;  5GTI C;  1SEU A;  4BQA A;  2CQQ A;  2VBW A;  5FLX K;  4EQQ A;  2R3S A;  2P5K A;  3D5R C;  2GIV A;  2K27 A;  1BIB A;  2Z2S B;  2JRT A;  2D1H A;  2XVC A;  2TCT A;  3RKX A;  4PFO A;  1OMI A;  3GFI A;  2DO7 A;  2B63 J;  1MH3 A;  2ELH A;  2LY1 A;  3RJP A;  2MC3 A;  3TMO A;  2WTE A;  4A3B J;  5DCM A;  1Q1H A;  3KZY A;  1WJB A;  4N4O B;  2DA6 A;  1W7P D;  2DLL A;  2EJR A;  3ABM H;  2FNP A;  3LA7 A;  1IRG A;  1E3O C;  3S1R J;  2BY0 A;  3E5U A;  3VB2 A;  1TWA J;  5M5Y J;  3OL4 A;  2HTJ A;  1E3H A;  9ANT A;  2ZB9 A;  4JOM A;  1QHG A;  3PNY A;  1T33 A;  4Z6Y A;  4BY7 J;  5HVQ C;  4UUS A;  1W36 C;  4BKX A;  2XF6 A;  1WFX A;  4GGG A;  2EPF A;  1S7E A;  3TL4 X;  1ERD A;  3E3V A;  2HKO A;  4U7B A;  3WTU C;  2L9R A;  1MSF C;  3HSE A;  3CO6 C;  3S1M J;  1TNT A;  2V6E A;  1TL8 A;  1G3T A;  2QQA A;  3HKZ A;  3NWS A;  1SFX A;  5D5U B;  1X2M A;  1X3U A;  3G6E I;  1XS9 A;  2HU9 A;  1T38 A;  2EBI A;  1PJR A;  1IGN A;  1IRX A;  1V5F A;  4M6X A;  2K9M A;  1DGR M;  2GZW A;  4MNU A;  3OYJ A;  5FKK A;  4V19 K;  1WI3 A;  2WAQ A;  3BJA A;  4M9X A;  1DUX C;  1U9N A;  2X1D A;  3BCA A;  2EV5 A;  4D5C A;  2DTZ A;  3OOU A;  2V9V A;  1S3J A;  2UZK A;  1B6A A;  4IQ4 A;  5C4J J;  1ETQ A;  4IHX A;  1JE8 A;  3S3N A;  1JUM A;  5FD6 A;  2OD5 A;  2HYJ A;  4Y17 A;  2WV1 A;  3VFZ A;  3QP6 A;  3CC4 I;  4R8H A;  5F64 A;  2PMU A;  3O3K A;  2KL4 A;  5AIQ A;  1BJA A;  2M8E A;  2MFZ A;  3HG9 A;  1U6G A;  2M3A A;  1R71 A;  2EIK H;  2R7W A;  1FYL A;  4L0Z B;  1JHF A;  1TWH J;  1BN5 A;  1ZQ3 P;  2FOW A;  2JN6 A;  3FK6 A;  1IV6 A;  5CKT A;  3TBI A;  2XSJ C;  1OR7 A;  1YS6 A;  1ETO A;  3BR5 A;  5B1B H;  2W7N A;  1FYK A;  2HPM A;  3QP5 A;  2P7C B;  2MW8 A;  5M5X J;  1X1A A;  3PNT A;  4B09 A;  3AFH A;  1MBJ A;  3J81 K;  2VKE A;  2HOS A;  1XGS A;  3SZG A;  3BR0 A;  4YFX F;  3A0B C;  2Y9Z A;  2XF7 A;  4BE1 A;  1PDN C;  1LEB A;  4IL6 C;  4U0W A;  4BHP A;  3F22 A;  2V1D A;  1GV2 A;  2MA3 A;  2M7A A;  5BS6 A;  2WAD A;  1KQ9 A;  2VPR A;  3LA3 A;  1V55 H;  4C3H J;  1GLN A;  1G4D A;  2BW3 A;  3OV8 A;  2DI3 A;  2IW5 A;  2ELK A;  1ZRD A;  3G71 I;  5AIP A;  2BXY A;  2DYR H;  1U5T A;  4L18 B;  2WAE A;  3HOV J;  2VPL A;  5L3E A;  1ETV A;  3WTT C;  2NVX J;  1FOK A;  2HEO A;  3M1E A;  3I53 A;  3ZMT A;  4OIQ F;  1MBF A;  1H8A C;  4KN7 X;  3RPU A;  2M1B A;  2CH0 A;  3BR3 A;  1SFK A;  2PLY A;  3ZR8 X;  4R79 A;  2VOO A;  2HDD A;  4GDF A;  5HLT A;  3W2V A;  2Z9O A;  3OWT A;  3KEO A;  1ITY A;  4QSH A;  1OLT A;  3MQ0 A;  5BPD A;  1YS7 A;  2VI6 A;  1ORK A;  3H9Q A;  2DT7 B;  3HOY J;  5TGT A;  2Z3Y A;  3J7A Y;  3HYI A;  1JKP C;  1T95 A;  2ZXI A;  1ETX A;  2K9S A;  3IRQ A;  2FQ4 A;  5DS9 A;  2EV0 A;  1LNW A;  4UV9 A;  2QSH X;  4D7N A;  2L9S A;  3C2H A;  1WHU A;  3C2G A;  2E2I J;  1RNL A;  5IP6 A;  4M3G A;  3GTQ J;  1ON1 A;  2NXN B;  3TW6 A;  3HUG B;  1YLF A;  3NAU A;  3SQN A;  4X1E A;  1IZ1 A;  3K7A J;  3WHB A;  3BC8 A;  1FWZ A;  1BJZ A;  2M5W A;  4RAG A;  3MZH A;  4BHB A;  2FSW A;  2ZJ2 A;  4MGR A;  2E2J J;  1H88 C;  4M3B A;  1HKT A;  4IRG A;  3W2W A;  4MTD A;  1DU6 A;  2DU9 A;  1Y1V J;  3ABL H;  3S1Q J;  1T0F C;  2YUS A;  1MNE A;  1MMG A;  2F2E A;  2L9N A;  1B9M A;  2IEK A;  2P4W A;  4LMY A;  3WTS C;  4KYW A;  2R7X A;  2LKP A;  3FBN B;  4IKF A;  2QEN A;  1XG1 A;  5CPR B;  2FBK A;  4IOC F;  1IXS B;  2RNJ A;  4EVI A;  1ZAR A;  3OYK A;  1MBK A;  1SD4 A;  5FFX A;  3J80 Z;  2RKH A;  2EFW A;  3DBL B;  1FMW A;  2E1M C;  5H2F C;  3GME A;  3M8E A;  4JP0 A;  4D1Q A;  2NNN A;  2LOO A;  2P5V A;  1SAX A;  5ICF A;  3BPX A;  4XID A;  1ETY A;  3OYG A;  2LVS A;  2DJN A;  5C4X J;  2Y0S N;  3PUF A;  4CZC A;  1Z91 A;  2VJ4 A;  2HVS A;  1ETK A;  4XL9 A;  3TP0 A;  4CCJ A;  4RGU A;  2HOT A;  1HW5 A;  1ZG5 A;  2DT5 A;  4HA8 A;  2W4S A;  3A01 B;  3FBI B;  4WX9 A;  1IUF A;  3G1M A;  4LG0 A;  2A5Y B;  3BR6 A;  3EUK L;  4U0Y A;  2JJ7 A;  1F1Z A;  3OYL A;  1TBX A;  1UMQ A;  2EFQ A;  4UV8 A;  2FXA A;  3CMY A;  5GAE J;  3OYD A;  3EPZ A;  3F8N A;  3VOE A;  3KP6 A;  3T0Y A;  3I55 I;  3DP7 A;  3RIR A;  3IUO A;  3QWL A;  2OAZ A;  1BR1 A;  2X85 A;  4IRI A;  2R7V A;  4OAZ A;  2F5E A;  1WVR A;  2BGC A;  4U87 A;  2QM3 A;  1E3P A;  4P55 A;  1Z3Y A;  4HST A;  3HSF A;  5E8G A;  2VJJ A;  4LIT A;  1N75 A;  2CG4 A;  2K40 A;  1ZG3 A;  2V9K A;  2X6W A;  3TDU C;  5EEG A;  3PSI A;  3U9G A;  5FRN A;  4RLF A;  1QZE A;  4A3K J;  4NC6 A;  1XSX A;  1PUF A;  1ZH5 A;  2KMU A;  1JUS A;  2DQR A;  2JWT A;  2R5Y A;  2E60 A;  3ZN1 A;  1AHD P;  3JAM K;  1YG2 A;  2PMZ A;  2V4J C;  4HYE A;  1W5C C;  1U0J A;  3E1S A;  1Z7L A;  3F21 A;  3IHU A;  5B1A H;  3NRV A;  5DV5 A;  3IV5 A;  5F04 A;  1OCP A;  1FIA A;  3K1P A;  2E7X A;  2LTP A;  4B3A A;  2VKV A;  2XUB A;  4ON0 A;  1R4M B;  3COA C;  2PBI A;  3SEZ A;  2FOK A;  2KKO A;  4YEJ A;  2P8T A;  2F5F A;  4MEY F;  2JA6 J;  1BA5 A;  4WK8 F;  3HOX J;  3X2Q H;  3CME I;  1IUY A;  2LYC A;  3QPH A;  3QPS A;  3I4N J;  4W97 A;  4HZF A;  1H89 C;  2LBF B;  2ZME C;  4ZDO A;  2FQ3 A;  2BXZ A;  2JTV A;  1IJW C;  1D5Y A;  5IT3 A;  5KVR A;  4XLC A;  4M72 A;  5D4S A;  1GXQ A;  2HPI A;  4Z2Y A;  5B3S H;  3U21 A;  3K10 A;  4OIR F;  2BY3 A;  4UVC A;  2X0L A;  2JK3 A;  3GEZ A;  3QU6 A;  4KIG A;  2XRO A;  1XTA A;  4RGR A;  1K78 A;  3MKZ A;  2K7L A;  1MJA A;  4G7O F;  5EG0 B;  1A31 A;  2VJ5 A;  2HTS A;  4A5N A;  3FXL A;  4CA0 A;  2MC4 A;  4E7I A;  1LE8 B;  2ZKZ A;  3OYB A;  3CMA I;  5JR3 A;  3FXM A;  3I71 A;  2A69 F;  2O03 A;  3WGI A;  1VQK I;  2MG4 A;  2OC6 A;  2G9W A;  5A2Q Z;  4ENJ A;  1FMV A;  4Q4Z F;  4CYC A;  2DFE A;  3F6V A;  2P81 A;  1T08 B;  4NNJ A;  3ZQG A;  2A6T A;  3CJN A;  4I02 A;  4MFD A;  5J8C A;  2FBH A;  2V6C A;  3NQO A;  3BZC A;  1TC3 C;  5J6X A;  4U88 A;  2G0E A;  2DFH A;  2R7S A;  2GXA A;  2FU4 A;  1W7P B;  1D8J A;  1IN6 A;  1SFE A;  1UZC A;  2VN2 A;  3GTL J;  1IG7 A;  2KIF A;  1YE9 A;  2H6C A;  2VE8 A;  5EDN A;  2ISZ A;  1A5J A;  3ERE D;  2QBY A;  3G1O A;  2X6O A;  2ZBK A;  2RC4 A;  1XMA A;  1S29 A;  4S04 A;  2IGK A;  2JPB A;  2PJR B;  3L2C A;  3GVA A;  3TO7 A;  3S2H J;  2JMW A;  2KJC A;  4QTR A;  4A6E A;  2VJI A;  4XOR A;  4LLG F;  2RQQ A;  2E19 A;  4XNF A;  1O7F A;  1Y8R B;  2HOA A;  5D5V B;  3MCZ A;  2IVM A;  5J40 A;  3WG9 A;  2B9S A;  4BGD A;  1PP8 F;  4CCK A;  2Q8K A;  4IHV A;  2OBP A;  4RGS A;  1W4M A;  4DZP A;  1T39 A;  4II3 A;  3N4M A;  1DDN A;  3ASN H;  4MFE A;  2XAF A;  2RAE A;  3JRC A;  4XKV A;  2L7F P;  3MKL A;  4A0X A;  2HQ5 A;  1LFU P;  2E1O A;  2PG4 A;  4U7D A;  4UUT A;  1TP4 A;  1X4P A;  4IEJ A;  1A35 A;  4KMF A;  5IT9 K;  1SD5 A;  2KP6 A;  2PQ8 A;  3BG7 A;  4R1H A;  3DTI A;  1STZ A;  2JA8 J;  1B1B A;  1ZRC A;  3DPT A;  4DBR A;  3IC7 A;  3BPV A;  4HOB A;  1EA3 A;  5H6Q A;  1I5Z A;  3RDI A;  1JI8 A;  3H0G J;  3WTZ A;  4GFB A;  4GXO A;  4ZDL A;  2GWR A;  4EJW A;  5DUK A;  2YSR A;  1MMN A;  2XIG A;  2DN0 A;  3K4J A;  4B8X A;  4IQJ A;  2KQR A;  1POG A;  3HL2 A;  4RAZ A;  5FB2 A;  5KK1 A;  1IDZ A;  4EGZ A;  2FF4 A;  1IN7 A;  3UR3 C;  5EGO A;  2QEX I;  2XRL A;  2ZO4 A;  3KYC B;  1F5T A;  3FIW A;  3DU6 A;  1TLH B;  3L7W A;  3OYE A;  4CYD A;  4BBR J;  3V7S A;  1RUN A;  5HNF A;  1UEL B;  5LHH A;  1V5G A;  2R4G A;  2I10 A;  4L9N A;  3OR1 C;  5F08 A;  2E35 A;  1LDD A;  2IBD A;  3P5J A;  3ZRG A;  4XLF A;  1VF9 A;  4ESJ A;  4FCY A;  4JQF A;  5HOO A;  3LFK A;  3GUD A;  1VQN I;  4LIU A;  2ZXW H;  2V1X A;  3ROU A;  4XQF A;  5E18 F;  2O5R A;  4MEX F;  5J1R A;  3VWB A;  1ON2 A;  1ZKG A;  2WB1 N;  4BAC A;  1IF1 A;  2RGV A;  4HNT A;  1WJA A;  5FLX Z;  5IYC J;  1FOY A;  4A0Y A;  5ED4 A;  2K85 A;  2M0M A;  3F9K A;  3S2D J;  5HDG A;  4RM3 A;  2UUZ A;  2P5L C;  3RPU D;  1HQC A;  2W82 A;  3S8P A;  4ZC3 A;  1P92 A;  4EMS A;  1W5T A;  5JHF A;  2KRF A;  4KJZ A;  3LNQ A;  3A4C A;  4RM2 A;  1DPU A;  2Y31 A;  4HF2 A;  3BT9 A;  1T6S A;  2JSP A;  4A3C J;  3FXR A;  2BY1 A;  2L7Z A;  1SD7 A;  3DWL E;  3K2A A;  1AKH B;  3AG4 H;  2HWV A;  1BW5 A;  2JUG A;  4Y7N J;  2A3S A;  1D3Y A;  4G6Q A;  4BE2 A;  3HC7 A;  2L7K A;  3OS1 A;  4UUV A;  3KCC A;  4PJ0 C;  4UHT A;  1IN5 A;  1F9N A;  4PSX A;  4JX5 A;  2X1E A;  3LST A;  4L9J A;  4XKC A;  1Z05 A;  5L3C A;  2XV4 S;  1LDJ A;  2E1N A;  1IC8 A;  1WCM J;  2DA2 A;  1YQA A;  4HX7 A;  4LGW A;  1X19 A;  4BXF A;  3CUQ C;  5FKN A;  3HRU A;  1FJL A;  2TRT A;  4NQW A;  5ICE A;  3MKW B;  2LFB A;  3OYC A;  1UHW A;  4QPQ A;  2JA5 J;  2HS5 A;  2W25 A;  4O5V A;  2LRE A;  2DAO A;  3F8B A;  1TNS A;  3WHC A;  3DPU A;  4Y4R A;  4CCO A;  4IHW A;  1VFC A;  3H92 A;  2K4J A;  1NK3 P;  4BEH B;  1KU7 A;  5EYR A;  4LFU A;  1SFU A;  1XDS A;  2Y69 H;  2LKS A;  4M74 A;  1RKW A;  4NC8 A;  5HLI A;  4M3F A;  1R7J A;  2X6X A;  2NVU B;  2M7B A;  5KAI C;  1B72 B;  1AA7 A;  1QHH D;  4M6Y A;  2VQH A;  3LSH A;  2F4O B;  1IN8 A;  1Z6T A;  3GFM A;  4XK4 A;  3ZMS A;  2BYV E;  2W48 A;  2P7V B;  2LRD A;  1SAU A;  1VTN C;  4BDZ A;  5F0F A;  1YO5 C;  1VQ7 I;  3I58 A;  3E0J B;  3K70 D;  1XCV A;  1I3A A;  2OCC H;  2Y0M A;  3H9J A;  1D8K A;  3S16 J;  1XSV A;  1GHC A;  3QU3 A;  4EV0 A;  4P9U A;  3CCM I;  5DM6 F;  2FMY A;  4M3D A;  5EZH A;  3CCY A;  3OSG A;  3B02 A;  4HG2 A;  1EH6 A;  2IA2 A;  3EET A;  4B43 A;  2WY7 Q;  3A0H C;  5M3F J;  3J81 Z;  1YRN B;  2LSO A;  3CDI A;  3HZJ A;  5C44 J;  1P6R A;  3VSK A;  4I98 B;  3SJM A;  1EF4 A;  3VOD A;  1SVO A;  1MBG A;  3A2K A;  3WE3 A;  4FX0 A;  2NOJ B;  1E17 A;  1I1S A;  2IS6 A;  1J9I A;  4UB8 C;  1WRJ A;  5ICG A;  1XX5 A;  2EQR A;  2H94 A;  2RQP A;  3TDZ C;  2TDX A;  4AYB N;  2V1U A;  3CCE I;  2ICW G;  3P9C A;  2XPW A;  1HKQ A;  4KIC A;  3WU2 C;  2W57 A;  1K83 J;  2KLO A;  4BJT A;  2HDW A;  2MLK A;  2ZXH A;  2MLG A;  3HOS A;  1APL C;  2NVY J;  2JRM A;  3IH4 A;  3L09 A;  1X4O A;  2PFB A;  3DEU A;  4NBQ A;  1J7K A;  4MQV A;  4S0H B;  2LP0 A;  2L9V A;  1G3Y A;  2XGD A;  1PYV A;  3GLL A;  3ZQI A;  2ZJR F;  2LD5 A;  3WGH A;  3H5N A;  3CC2 I;  4ENM A;  2FX0 A;  3ZGK A;  4LK1 F;  4WXD A;  4WXH A;  3ZQH A;  1LVK A;  5GAH J;  3FK7 A;  1G3W A;  1P9Q C;  2NYX A;  1OYW A;  2L0K A;  4LLN A;  3BG3 A;  1LKX A;  5FFZ A;  2QSG X;  4DNC A;  3CDH A;  3CJT B;  4M73 A;  2ZJQ F;  3JCU C;  5K5Q A;  1Z9C A;  1LVA A;  2OQR A;  5DDG A;  4ZTJ A;  4BJ5 C;  2HI3 A;  1G6N A;  4HDV A;  3OR2 C;  4YFK F;  1V3F A;  1R1T A;  3KYL A;  2PI0 A;  1F4K A;  2UV1 A;  1HDP A;  4GO1 A;  1WGX A;  4F55 A;  3K4L A;  2CW8 A;  3CC7 I;  1O57 A;  1R00 A;  5FLV A;  2LMD A;  1FSE A;  1KA8 A;  3HIF A;  3TED A;  3PQK A;  3HTS B;  3GF2 A;  1X3W B;  2ECB A;  3T5X A;  3CCL I;  2M34 A;  2COB A;  1FY7 A;  2CU7 A;  4HDU A;  4DGW B;  2OJE D;  3H36 A;  2K02 A;  2M4K A;  2CYY A;  4DQ2 A;  4UNO A;  3QQA A;  3GYH X;  1QVT A;  3FZV A;  3GXO A;  2J5O A;  1W36 D;  3BQY A;  4RS8 A;  1YOV B;  2ZME B;  1WJE A;  3RYR A;  4A69 C;  5GAD J;  4A3M J;  2EFP A;  2QQ8 A;  1KGS A;  3G2B A;  2ZFW A;  3FKJ A;  3I59 B;  4OAY A;  4ZYE A;  2DA7 A;  2GOM A;  4WF2 A;  3SFI A;  2EV6 A;  4N4N B;  4XM3 A;  4LD5 A;  3JTG A;  1NK2 P;  2R5Z B;  4IHS A;  2L02 A;  3WGG A;  1KZH A;  2NS0 A;  4WWC A;  1GUU A;  5DD4 A;  2EFN A;  2CQ7 A;  1FLI A;  4ZZL A;  2A6E F;  2DJI A;  4NB5 A;  1TT5 B;  5HOD A;  3DFG A;  2QQ9 A;  4A3J J;  1RKT A;  2RRE A;  2X4H A;  3HBL A;  2VOP A;  4HF0 A;  1K6Y A;  4F52 A;  2GQQ A;  3LQQ A;  4IF4 A;  2AS5 F;  4E7S A;  2V7F A;  4CH7 A;  4S05 A;  2DK5 A;  2KIS A;  2Q0O A;  3IKT A;  3PIP F;  1UHS A;  5JVT A;  1Z0X A;  2Z33 A;  5DCM B;  1ZLK A;  1EJ9 A;  3M9A A;  2QVO A;  4M71 A;  5H20 A;  5F0H A;  1S8N A;  1X1C A;  4ASN A;  1U78 A;  2KRC A;  5CVU A;  3AL0 C;  5K7F A;  4UUS B;  1QBJ A;  2OTL I;  4W1U A;  5HNH A;  2EZH A;  4XLP F;  3QAH A;  3HOU J;  2IS2 A;  3CCQ I;  1KON A;  5D4R A;  2K9Q A;  3REO A;  2VBZ A;  3TO6 A;  4KNY A;  2XPV A;  3LSK A;  3E6M A;  2DDA A;  4OIN F;  1BR2 A;  1BBY A;  4A93 J;  3D1N I;  4F92 B;  1MBE A;  1UFM A;  4BU2 A;  3EUH A;  2HZT A;  1YX5 A;  2OA4 A;  1WWX A;  3DKX A;  5HS8 A;  5K1Y A;  1Y39 A;  4BQQ A;  3S3O A;  2ZFU A;  2MH9 A;  2L3D A;  3LSJ A;  4CO8 A;  2IRF G;  4ZYD A;  4XON A;  5ILU A;  1CGP A;  5K5R A;  1ZAO A;  5IYD J;  2GAU A;  1O3Q A;  2GXG A;  2VON A;  1YIT I;  1V4R A;  2FA5 A;  1ACI A;  2DOE A;  2EH3 A;  3F0C A;  4G7H F;  3SEQ A;  2V9P A;  1XDU A;  3DLA A;  1UST A;  3R4K A;  3P9K A;  2AQE A;  4EJV A;  1BW6 A;  2XF5 A;  1FOX A;  5LGT A;  5LD2 C;  5J4Y A;  1ZGA A;  3SHF A;  3W6J B;  4DYR A;  6PAX A;  2NVQ J;  2XAU A;  2O0Y A;  1D0Y A;  2BVL A;  1HF0 A;  4B1R A;  4ZH4 F;  2CSO A;  1P7I A;  1S7A A;  4IJA A;  1B59 A;  4O3M A;  1Y0U A;  1RR8 C;  1JT0 A;  3PIO F;  4XBF A;  2CRG A;  2HGC A;  2RVC A;  2VC0 A;  2E71 A;  4KIF A;  4LB5 A;  4J01 A;  4CUG A;  2NS8 A;  3OS0 A;  1I50 J;  3ABU A;  2K5C A;  1QQI A;  1NG6 A;  5F1J A;  2LY2 A;  2QLZ A;  1K79 A;  4MO7 A;  2LBF A;  1X1D A;  1YJW I;  1QPI A;  2PJP A;  2PX9 A;  3BJ6 A;  5CVV A;  3Q0V A;  3QRF F;  5GAG J;  1OYI A;  1E0E A;  2KIQ A;  5LEK A;  3W2A A;  2VB6 A;  1WI9 A;  3F72 A;  3F8C A;  1QA6 A;  3CTA A;  1D1A A;  1Z6R A;  2UXN A;  4FET A;  4FTH A;  4YII A;  4NUB A;  1KU3 A;  3HSR A;  2PN6 A;  3DBR B;  2GIZ A;  5HLH A;  1U5T B;  2M2E A;  4HQE A;  4C3J J;  2CQK A;  3IAS 2;  1MSE C;  3DTK A;  4B47 A;  5E1W A;  1IAW A;  5F0C A;  2HQN A;  4P96 A;  5F1R A;  5DM7 F;  3OYF A;  1K4S A;  1OCT C;  1UJ8 A;  2BOL A;  1MKM A;  3WE2 A;  2X48 A;  3AAF A;  3JSO A;  1FP1 D;  4B48 A;  3BTL A;  1XMK A;  2R93 J;  4IRH A;  3GZ6 A;  4J19 A;  4BH9 A;  1R22 A;  4P5O A;  1TW3 A;  2R0Q C;  1XGO A;  2WV0 A;  3LQR A;  4M3E A;  4Q48 A;  1N78 A;  1JT6 A;  3PO3 J;  1JTX A;  4OOI A;  4XRS A;  2M87 A;  1XC5 A;  2K3P A;  3J7Z I;  5DUI A;  3UKG A;  3PNV A;  2JA7 J;  3LWF A;  1I27 A;  2CW0 F;  2EZL A;  2LDU A;  4BHC A;  2E34 A;  3A03 A;  2DT6 A;  4XLA A;  3B6C A;  3RCO A;  4EJU A;  1IXR C;  1TQI A;  5JLX A;  2IP2 A;  4PJJ A;  1A6I A;  4HAM A;  3V8L A;  1RR7 A;  2F5V A;  3O6B B;  2FE3 A;  3LAJ A;  2J5P A;  2P0W A;  4KIT B;  2PJR A;  2CS3 A;  1Z7U A;  1GVD A;  2H09 A;  2JVG A;  4EJO A;  1FZP B;  2XGC A;  1FEX A;  2OTJ I;  1OKR A;  2L2O A;  4N9H A;  2L4M A;  4L5E A;  3L2V A;  3B6A A;  2CWE A;  1ZYR F;  4RBO A;  1QU3 A;  2E5Z A;  3E6B A;  4PDK A;  3ZMD A;  2MD0 A;  1V54 H;  3H5R A;  3F23 A;  3CUQ B;  2DOF A;  2F6C A;  5L3B A;  1DGW Y;  3RI4 A;  3I5U A;  1K4T A;  2DK8 A;  2X9D A;  5DYM A;  5IP7 J;  5K7Z A;  4LIV A;  4ESF A;  2ETH A;  4LJZ F;  2F5C A;  3JRE A;  5BMZ A;  2YX4 A;  1Z21 A;  3RQI A;  3OOP A;  1LQ1 A;  3FX3 A;  3HKZ N;  4HPQ A;  1OJL A;  4HRI A;  3UNG C;  1TTY A;  3PM1 A;  5TRD A;  3QOE A;  3OYA A;  1XMX A;  4ANJ A;  3Q0W A;  4AC0 A;  2NNY A;  1VQL I;  3BTJ A;  4L9V A;  1S72 I;  1Z67 A;  2WAF A;  3FM3 A;  3GFJ A;  3M07 A;  4L0Y B;  1FBQ A;  2WAQ N;  2VLA A;  3PO2 J;  3JRD A;  1FIP A;  2LR8 A;  2FNA A;  3VPR A;  4LG0 B;  2IPQ X;  2BEO A;  1ETW A;  2HQR A;  4G6T B;  1U3E M;  2PMH A;  4F93 B;  5IP9 J;  3MZ8 A;  1S6L A;  2VE9 A;  2CJJ A;  1VQ9 I;  1WPK A;  2ZXJ A;  1ZG1 A;  1D1C A;  1REP C;  4EEF G;  1WSU A;  4X0G A;  1FSH A;  2JPC A;  3GTO J;  1JKO C;  3P7N A;  2XAS A;  1H0M A;  5E17 F;  2Z99 A;  1P4X A;  2DFI A;  1J59 A;  3CCU I;  1BOA A;  1NHA A;  3HTU A;  1S5L C;  3CP2 A;  3VSL A;  3GTK J;  2DA1 A;  3DXJ F;  1Y56 A;  3I0T A;  3KP4 A;  3ZMZ A;  3RZO J;  1WH7 A;  4LOC A;  4HQM A;  3LSP A;  3KYD B;  4CXF A;  4CZZ A;  3RZD J;  1PP7 U;  3KEQ A;  5C3E J;  5CYV A;  1Y1W J;  3MZY A;  3NWT A;  2QF7 A;  1PUF B;  4DW6 A;  2Q2E B;  4E70 A;  3MVP A;  2IAI A;  2ID3 A;  4KDP A;  4OIO F;  2I5U A;  1XPX A;  1M1E B;  4AWX B;  3D5L A;  1B4A A;  4YRV A;  1HDD C;  5D6E A;  4FE7 A;  3AG2 H;  4D9J A;  1K7A A;  3P9I A;  2DA5 A;  3JR9 A;  2R7R A;  1S9H A;  2NVT J;  2QGU A;  1OFC X;  2IS1 A;  2HKX A;  2IJL A;  4EAT A;  2DMP A;  3HHG A;  3S14 J;  1SC7 A;  4XKW A;  1A04 A;  5JVG F;  1SFO J;  4QPO A;  2DQL A;  5AON A;  3OYM A;  5LGU A;  3OIQ A;  3HRS A;  2LKX A;  1HW2 A;  2VIX A;  1MDM A;  3RPQ A;  1BC8 C;  1L3L A;  2H1K A;  3IH2 A;  2ESN A;  4UB6 C;  4OMY A;  1RI7 A;  4IZZ A;  2K4B A;  4AM3 A;  2VQL A; 
#chains in the Genus database with same CATH homology
 3ZQF A;  3JRI A;  2W48 A;  1AKH A;  5DTD A;  3H3V K;  2ELK A;  4QIW N;  5F0F A;  1QRY A;  3HGG A;  5J3L A;  2D5V A;  2DMQ A;  5FKM A;  4RDU A;  3S16 J;  1CQT A;  3HOV J;  1ETV A;  2NVX J;  1LFB A;  4D5F A;  1K61 A;  4A3F J;  1MBF A;  4M3D A;  1O4X A;  1H8A C;  2XB5 A;  5EZH A;  3CCY A;  4ABZ A;  3OSG A;  4XRM A;  3BR3 A;  4MLO A;  5M3F J;  2O7O A;  1YRN B;  2HDD A;  3SJM A;  1EF4 A;  5C44 J;  4DYQ A;  5J1Y A;  3Q3S A;  2ID6 A;  1MBG A;  5IPA A;  1ITY A;  4QSH A;  3BG5 A;  3HOW J;  2VI6 A;  1T56 A;  5M3M J;  1ORK A;  2H8R A;  1JKR C;  3HOY J;  4Y52 J;  2EQR A;  2AO9 A;  4AYB N;  1JKQ C;  1JKP C;  2K9S A;  1ETX A;  2FD5 A;  2FQ4 A;  5DS9 A;  1ENH A;  2LLK A;  3I4M J;  1RET A;  4D7N A;  1B72 A;  5IYB J;  2XPW A;  5E3N A;  2E2I J;  5IP6 A;  3C2B A;  4M3G A;  3GTQ J;  1K83 J;  3TP3 A;  3TW6 A;  3NAU A;  4D7M A;  2DA4 A;  2DA3 A;  4X1E A;  3K7A J;  3WHB A;  1APL C;  2NVY J;  3IH4 A;  1BJZ A;  4BXX J;  2XGE A;  2K9N A;  1R9T J;  3HM5 A;  4S0H B;  2E2J J;  2LP0 A;  1H88 C;  4M3B A;  5FJ8 J;  2XGD A;  4M6V A;  2N8G A;  3CQZ J;  3ZQI A;  1NTC A;  1DU6 A;  1Y1V J;  2M9H A;  4JX6 A;  2LD5 A;  3S1Q J;  2YUS A;  3JRH A;  2FX0 A;  2IEK A;  4A3L J;  3ZQH A;  5GPA A;  3FK7 A;  1JGG A;  2L7M P;  2L0K A;  1BL0 A;  3BG3 A;  2DMU A;  4IHY A;  1HOM A;  5E3L A;  2EZI A;  2YU9 J;  1XG1 A;  4FE4 A;  3E7L A;  2HI3 A;  2YS9 A;  5FKO A;  1GT0 C;  1HDP A;  1MBK A;  2FJ1 A;  1WGX A;  1P7J A;  1GV5 A;  2HXO A;  4JP0 A;  5FLV A;  3JRF A;  3TED A;  2GBY A;  1DU0 A;  3QPL A;  2ECB A;  1IDY A;  4XID A;  1ETY A;  2M34 A;  2COB A;  2CU7 A;  2R5Y B;  2LVS A;  2DJN A;  5FKL A;  5C4X J;  2Y0S N;  1G2H A;  2EZK A;  1ETK A;  3QQA A;  1QVT A;  3BQY A;  3TP0 A;  4A69 C;  4A3M J;  2HOT A;  5J1U A;  3A01 B;  1U9O A;  1IUF A;  2OF7 A;  3G1M A;  3BR6 A;  4BBS J;  2DA7 A;  2JJ7 A;  3SFI A;  1UMQ A;  1RES A;  2CQX A;  3CMY A;  1NK2 P;  1ZTR A;  2R5Z B;  3M4O J;  2Y9Y A;  4V2F A;  2ME6 A;  1GUU A;  4C3H J;  5EGO B;  2PMZ N;  1JTY A;  2NS7 A;  5HOD A;  1JUP A;  1RKT A;  2K40 A;  3BR2 A;  3HBL A;  4A3J J;  4G12 A;  2VUM J;  2CUF A;  3HB9 A;  4A3K J;  4A3E J;  1PUF A;  1JUS A;  1UHS A;  1Z0X A;  2JWT A;  2R5Y A;  4C2M J;  1X2N A;  2GLO A;  3S1N J;  1AHD P;  5F0H A;  1U78 A;  5F27 A;  3FIS A;  1GDT A;  3DCF A;  4MIM A;  2GM4 A;  5K7F A;  4UUS B;  3IV5 A;  4W1U A;  5F04 A;  1OCP A;  1FIA A;  2EZH A;  4B3A A;  2LTP A;  2HXI A;  2VKV A;  4C3I J;  3HOU J;  1W0T A;  2R5Z A;  2K9Q A;  4CYC B;  3JRA A;  2XPV A;  2R92 J;  2JA6 J;  1BA5 A;  4A93 J;  3D1N I;  3HOX J;  1MBE A;  2ME0 A;  3LOC A;  3QPS A;  3I4N J;  4W97 A;  1H89 C;  1IJW C;  1D5Y A;  3LSJ A;  4A3G J;  3FKI J;  5IYD J;  4DZJ A;  2JK3 A;  2EH3 A;  3F0C A;  1MNM C;  1BW6 A;  1IRZ A;  1RPW A;  5K7H A;  4JYK A;  5EG0 B;  4DYR A;  3BG9 A;  5GPC A;  1Q1V A;  1MH4 A;  5E3O A;  5M5W J;  1YRN A;  2NVQ J;  2XSD C;  1LE8 B;  2LY9 A;  1HF0 A;  4B1R A;  5GP9 A;  3HOZ J;  1P7I A;  3HGY A;  2MG4 A;  1JT0 A;  1JJ8 C;  4CYC A;  2DMT A;  2CRG A;  2P81 A;  3BR1 A;  1B8I B;  3ZQG A;  3GTG J;  1FTZ A;  2NS8 A;  4MFD A;  4AUX A;  1VND A;  1U8B A;  1I50 J;  1TC3 C;  5F1J A;  2G0E A;  2KDZ A;  4MO7 A;  3LSR A;  3SDG A;  2QCO A;  3JRG A;  3GTM J;  3CDL A;  1QPI A;  3OIO A;  2MSY A;  3GTL J;  3Q0V A;  1ZK8 A;  1IG7 A;  3MN2 A;  3HDD A;  4X6A J;  5EDN A;  3LSG A;  5IOY A;  4FIS A;  1A5J A;  3BQZ A;  3G1O A;  2X6O A;  3TW7 A;  3A02 A;  2M0C A;  3W6V A;  3BTC A;  1AU7 A;  4FTH A;  2M2E A;  5FLM J;  4C3J J;  4NDL A;  3NAR A;  1MSE C;  3RKQ A;  4A3D J;  3GBG A;  1JJ6 C;  2R7Z J;  5F0C A;  4B4C A;  3S2H J;  2JMW A;  1I6H J;  4QTR A;  1MBH A;  4A3I J;  2ECC A;  1OCT C;  2OPT A;  2E19 A;  5BNG A;  2HOA A;  2X48 A;  4HNV A;  2E2H J;  3BTL A;  2R93 J;  4J19 A;  2NOG A;  1ZR2 A;  4IHV A;  3GTJ J;  1Z77 A;  5IOZ A;  2R0Q C;  4M3E A;  4DZP A;  1B8I A;  2CUE A;  2DMN A;  4XIC A;  1JT6 A;  1W0U A;  3PO3 J;  1JTX A;  4V2G A;  4XRS A;  4MFE A;  1XC5 A;  2RAE A;  2XB0 X;  1UG2 A;  2L7F P;  3MKL A;  4JX4 A;  3JRC A;  1HCR A;  2HQ5 A;  1LFU P;  2E1O A;  4UUT A;  3O8H A;  4IEJ A;  1F43 A;  3GTP J;  1FTT A;  3UKG A;  2JA7 J;  3O8G A;  4XRS G;  2JA8 J;  2XPU A;  2EZL A;  2MGQ A;  3A03 A;  3S15 J;  3B6C A;  4I6Z A;  3IH3 A;  3A01 A;  2AHQ A;  5JLX A;  3H0G J;  5JLW A;  1F36 A;  1QVU A;  1HLV A;  1A6I A;  4I76 A;  3ZOB A;  1RR7 A;  1TWF J;  4GFB A;  3HEF A;  4DYC A;  1ZGW A;  1TWG J;  2Y2Z A;  1GVD A;  2DN0 A;  2XGC A;  1FEX A;  1POG A;  4L5E A;  5EF6 A;  1IDZ A;  3B6A A;  3ZQL A;  5EGO A;  4RBO A;  2XRL A;  2CQQ A;  3FIW A;  3Q0U A;  4BBR J;  2TCT A;  2X9D A;  5K7Z A;  5IP7 J;  2I10 A;  3OSF A;  2B63 J;  3S17 J;  1MH3 A;  5F08 A;  2IBD A;  3JRE A;  2M8G X;  1VF9 A;  3RQI A;  3M3Y J;  5E3M A;  3HKZ N;  1OJL A;  4A3B J;  4FCY A;  3PM1 A;  2DA6 A;  3Q0W A;  1E3O C;  3S1R J;  4AC0 A;  2LK2 A;  1TWA J;  5M5Y J;  3BTJ A;  3DEW A;  9ANT A;  2ZB9 A;  1T33 A;  1X58 A;  4BY7 J;  2WAQ N;  4UUS A;  4BKX A;  5J1R A;  3PO2 J;  3JRD A;  1ZKG A;  1S7E A;  2WB1 N;  1FIP A;  2LR8 A;  3VPR A;  2L9R A;  5IYC J;  1MSF C;  3S1M J;  1ETW A;  5IP9 J;  2CJJ A;  1WPK A;  3S2D J;  1X2M A;  1XS9 A;  4EEF G;  1VI0 A;  3G1L A;  2EBI A;  3BTI A;  3GTO J;  3ZQC A;  1IGN A;  3LNQ A;  1JKO C;  5EZG A;  5FKK A;  2O9L A;  1WI3 A;  2Y31 A;  3BT9 A;  3GTK J;  2DA1 A;  4A3C J;  3L1P A;  1I3Q J;  1U9N A;  2L7Z A;  3K2A A;  3RZO J;  4D5C A;  2DTZ A;  1WH7 A;  1AKH B;  3OOU A;  4LOC A;  3LSP A;  5C4J J;  1BW5 A;  4Y7N J;  1ETQ A;  4IHX A;  3RZD J;  1JUM A;  5C3E J;  2HYJ A;  2WV1 A;  1Y1W J;  4JX5 A;  2QF7 A;  1PUF B;  4DW6 A;  5EG0 A;  3MVP A;  2IAI A;  4BY1 J;  2ID3 A;  1IC8 A;  2KT0 A;  1TWC J;  1WCM J;  2DA2 A;  1LE8 A;  2Y30 A;  1SAN A;  1WH5 A;  5FKN A;  1FJL A;  2TRT A;  1TWH J;  2LFB A;  1HDD C;  1ZQ3 P;  4FE7 A;  2JN6 A;  3FK6 A;  1IV6 A;  2JA5 J;  2DA5 A;  3BR5 A;  1ETO A;  3JR9 A;  2NVT J;  1OFC X;  2MW8 A;  5M5X J;  3JRB A;  3WHC A;  2DMP A;  4IHW A;  3S14 J;  1VFC A;  1MBJ A;  2VKE A;  1NK3 P;  1SFO J;  2HOS A;  5EYR A;  3BR0 A;  2LKX A;  1RKW A;  2Y9Z A;  5EEA A;  4M3F A;  1ZR4 A;  2H1K A;  3IH2 A;  1B72 B;  1GV2 A;  2VPR A;  2O8K A;  4XK4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...