1K83J

Crystal structure of yeast rna polymerase ii complexed with the inhibitor alpha amanitin
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural Basis of Transcription: Alpha-Amanitin-RNA Polymerase II Cocrystal at 2.8 A Resolution.
pubmed doi rcsb
molecule tags Transcription/toxin
molecule keywords DNA-DIRECTED RNA POLYMERASE II LARGEST SUBUNIT
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2001-10-22

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 1k83J00
1HCRA 3HDDA 2DMNA 2M9HA 5FLMJ 3H0GJ 4IEJA 5EYRA 1ORKA 4HNVA 2X6OA 2DA5A 4MO7A 5GP9A 4FISA 1TWAJ 1AKHA 2RAEA 3FIWA 1X58A 2ID3A 1WCMJ 1A5JA 3HKZN 1SANA 5DTDA 5JLWA 2MG4A 4MFDA 5IYCJ 3CQZJ 5DS9A 3FK6A 4IHWA 3HOVJ 2FJ1A 5F27A 1U9NA 2HXOA 3D1NI 4V2FA 1MBGA 3TP3A 3GTKJ 4S0HB 3BR0A 4MLOA 2NVTJ 2L0KA 3BTJA 3M3YJ 1RKWA 1Y1VJ 5M5WJ 1VFCA 2JA8J 1UG2A 2Y2ZA 2NS8A 2OPTA 3RZDJ 3A02A 1H88C 1W0TA 4B1RA 4DYQA 2CU7A 2ME0A 4V2GA 3GTQJ 5EEAA 2E1OA 2JJ7A 3MN2A 2HI3A 2L9RA 4A3KJ 1UMQA 1QRYA 5F04A 3FK7A 3GTGJ 1ETYA 5F0HA 2XGCA 1Z0XA 5EG0A 4M3GA 4UUSB 1HF0A 4GFBA 1ETQA 4D5CA 3I4NJ 2R5ZB 2JK3A 3NARA 2IBDA 1JGGA 1YRNA 1RKTA 1B72A 2L7ZA 1IG7A 1IGNA 1WPKA 2R5YA 1B8IA 3HB9A 2VUMJ 1W0UA 1EF4A 5F1JA 1LE8B 2O9LA 2HOAA 1JJ8C 1GVDA 5K7ZA 2E19A 4M3FA 2M2EA 3G1OA 2O7OA 4FCYA 3O8HA 3S14J 4QIWN 1BL0A 5E3MA 2E2IJ 2P81A 1K83J 3Q3SA 2WB1N 2FQ4A 3HGGA 1IDYA 2LFBA 1ETWA 5EZHA 1F43A 3BG5A 1MH3A 3PO2J 2LK2A 2JWTA 1T33A 2K9QA 4IHVA 1ETOA 1E3OC 1ZR2A 2EZIA 5IOZA 3SJMA 4RDUA 5C4XJ 2G0EA 2DMQA 2EH3A 1TWCJ 1ETVA 2FD5A 1RR7A 2HXIA 5EDNA 1APLC 1GV2A 1WH7A 1RETA 1ZK8A 2LVSA 3HM5A 2DN0A 4BY1J 2R92J 2DA6A 3TW6A 2Y9ZA 4B4CA 4DYCA 1X2MA 4IHXA 1JTXA 2YUSA 3O8GA 4AYBN 2EZKA 2JN6A 1MBJA 3FKIJ 3K2AA 4XRSA 4QTRA 5FKLA 3A01B 2CQXA 2DA7A 1JKRC 4QSHA 1I6HJ 4XICA 2EZLA 4JX6A 3L1PA 3ZQGA 3S16J 1JUPA 2JA7J 1Y1WJ 1NK3P 2X48A 1FIAA 1XC5A 2XB5A 1GDTA 2E2HJ 3IH3A 3ZQLA 3HBLA 1PUFA 3BQZA 2W48A 1MBHA 1VNDA 1I50J 3IH2A 3BTCA 1ETKA 3LSRA 2PMZN 1O4XA 5F0CA 2CRGA 1NK2P 5M5XJ 4I6ZA 2X9DA 4A3IJ 4XRSG 2CUEA 3SFIA 2ECCA 1JT0A 4I76A 2MGQA 3RKQA 4A3FJ 2Y30A 2DTZA 5F0FA 1ZGWA 3JRAA 3I4MJ 2Y9YA 1MBKA 2JA6J 3BG3A 9ANTA 1ZQ3P 1BW5A 4A3CJ 2MW8A 2K40A 1SFOJ 3CMYA 3HGYA 1AHDP 3B6AA 1LE8A 2VKVA 1LFUP 1Q1VA 2ZB9A 2CQQA 4B3AA 2M34A 3IH4A 3LOCA 1B8IB 4CYCB 4W97A 4C3JJ 5J1UA 1XS9A 3OIOA 1ENHA 2ID6A 2XPUA 3GBGA 1IRZA 2LLKA 5EZGA 2HOSA 1I3QJ 1JT6A 2K9NA 1VF9A 4UUSA 3S2DJ 1JKQC 4JX5A 3S15J 4UUTA 2XGEA 2TCTA 1P7IA 2ELKA 1MSEC 1MBEA 3HOYJ 3ZQCA 1IUFA 3DEWA 4Y7NJ 5M5YJ 3MKLA 2XRLA 3RQIA 1FIPA 1WGXA 3BTIA 2DJNA 3JRIA 2AHQA 1JKOC 3S2HJ 3W6VA 4JP0A 4FTHA 3JRFA 2DMTA 5EGOB 4X6AJ 1LFBA 4M6VA 2E2JJ 3S1MJ 2DMPA 4DW6A 1OCPA 2NOGA 1GV5A 2NS7A 1Z77A 5K7FA 1WI3A 2EZHA 4A3DJ 5IYBJ 2N8GA 3TEDA 1FEXA 3ZQHA 5GPAA 1H89C 1IC8A 2GLOA 2WAQN 1AU7A 4W1UA 4X1EA 1U9OA 1AKHB 4MIMA 4LOCA 3UKGA 1ZR4A 4FE4A 3B6CA 1HDPA 1JTYA 4A3MJ 1H8AC 3QPLA 1HDDC 1WH5A 4BXXJ 3PO3J 1IJWC 5EGOA 1U78A 5J1RA 2B63J 1OJLA 3CDLA 5C3EJ 5M3FJ 2D5VA 3LSPA 1P7JA 4A69C 3ZQIA 3SDGA 3GTMJ 5IYDJ 1OCTC 5IP6A 1FTTA 3G1LA 3F0CA 5IP9J 1MH4A 2HQ5A 3BT9A 4M3EA 1IDZA 2NVQJ 2DA4A 4FE7A 3JRDA 2HYJA 3GTJJ 2R5YB 2XGDA 5HODA 3OSGA 3C2BA 2VPRA 1NTCA 2IEKA 2R5ZA 2LD5A 1BW6A 4XRMA 1T56A 5K7HA 1JUSA 1ETXA 4A3BJ 3ZQFA 3JRGA 2O8KA 3JREA 1TWHJ 2LR8A 2NVXJ 5E3OA 3Q0UA 3GTPJ 1G2HA 4C2MJ 2AO9A 4BY7J 5E3NA 5FJ8J 1HLVA 1TC3C 3BR3A 3MVPA 5FKNA 3ZOBA 4C3HJ 2HDDA 1QVTA 2H8RA 4D7MA 5EF6A 4D5FA 3BR6A 3OSFA 2ECBA 4BBRJ 3K7AJ 4M3BA 4A3EJ 2KDZA 1D5YA 3HOZJ 2COBA 3HEFA 3QQAA 3BQYA 3LNQA 4XIDA 2EBIA 3QPSA 2DA3A 4ABZA 1K61A 2MSYA 3G1MA 1RPWA 4AC0A 2LP0A 1ZTRA 2WV1A 4MFEA 5IP7J 4A3JJ 2I10A 3IV5A 2XPWA 1QPIA 2R7ZJ 2LKXA 3TW7A 4EEFG 2QF7A 1MNMC 4AUXA 3CCYA 3BR2A 5F08A 5FKKA 3BR5A 2R0QC 3Q0WA 1PUFB 4IHYA 3HOUJ 2NVYJ 4RBOA 1IV6A 4G12A 1R9TJ 5GPCA 2CUFA 5J1YA 1ZKGA 2LTPA 3JRHA 1DU6A 2CJJA 2K9SA 3LSJA 3GTLJ 5J3LA 5C4JJ 4DZPA 3GTOJ 3NAUA 1MSFC 4M3DA 1TWFJ 5FLVA 3RZOJ 3WHBA 1RESA 2Y31A 1GT0C 4A3LJ 3S17J 1MBFA 5IOYA 2VKEA 3BTLA 2L7FP 2XSDC 2DA1A 3JR9A 1CQTA 5BNGA 2M0CA 4JX4A 4CYCA 1QVUA 1A6IA 2XB0X 1POGA 4BKXA 3HOXJ 4C3IJ 2DMUA 5JLXA 5C44J 5M3MJ 3JRCA 3FISA 1S7EA 4DZJA 3Q0VA 3OOUA 2IAIA 2OF7A 2H1KA 4Y52J 1BJZA 4J19A 2TRTA 3M4OJ 1DU0A 1U8BA 2Y0SN 3BG9A 3PM1A 2QCOA 3A03A 1JUMA 2LY9A 1TWGJ 4BBSJ 1GUUA 2ME6A 3S1RJ 4XK4A 1VI0A 4D7NA 3S1QJ 1B72B 5IPAA 1YRNB 1UHSA 5E3LA 2GM4A 2HOTA 4DYRA 3VPRA 1XG1A 2R93J 3S1NJ 5EG0B 4A93J 2FX0A 4L5EA 4NDLA 3BR1A 1F36A 1HOMA 2KT0A 4JYKA 3TP0A 2JA5J 1ITYA 3LSGA 1FJLA 2YU9J 1FTZA 3WHCA 1JJ6C 3H3VK 2M8GX 2GBYA 1JKPC 2L7MP 2YS9A 3A01A 2VI6A 2JMWA 3DCFA 1BA5A 2DA2A 2EQRA 5FKMA 2XPVA 3HOWJ 1X2NA 5FKOA 4A3GJ 3E7LA 1OFCX 3JRBA
chains in the Genus database with same CATH superfamily
4E7IA 3HDDA 2DMNA 2ADUA 2A6EF 2EA2A 5FLMJ 1FOYA 3BPVA 4IEJA 2DO7A 1ORKA 4HNVA 4B48A 2HZTA 2ZMEC 4DBRA 4FISA 2PG4A 1TWAJ 3E0JB 3I59A 3WG7H 1AKHA 2RAEA 1X58A 2R7QA 2HTSA 3F8BA 4F7ZA 2M45A 2V1NA 3ABTA 4P1WA 2V1UA 2JSPA 2MG4A 1FBUA 3FK6A 1SEUA 1YW9A 4CCJA 3ONQA 3HJEA 3HOVJ 3LSIA 3D1NI 3TP3A 3S3MA 1HXDA 4S0HB 2DFHA 2OD5A 2NVTJ 2B0LA 5IY5H 2W85A 3HHHA 2H8WA 3E97A 4XKCA 2QUFA 1RKWA 1Y1VJ 3L00A 5M5WJ 5LFAA 3DTKA 2Y2ZA 5H2FC 1TW3A 4S04A 3EQLF 2EV5A 2CU7A 4D0PA 3WU0A 2Z33A 3H5NA 4EGZA 1BM9A 4O6JA 4KN7X 4ETSA 1X4PA 3R60A 2E1OA 3MN2A 1J9IA 1FMWA 2HI3A 2V9VA 1G59A 1U6GA 4QPOA 4FX4A 3S3NA 1R36A 3FDYA 2JQ7A 1STZA 5F04A 2V9KA 3FK7A 4U87A 4M6XA 4BEHA 1R6RA 3GTGJ 3G73A 2VJ4A 5D5UB 4AIDA 3L2VA 4PJMA 3CC7I 1HF0A 1I3AA 3OS2A 3L2WA 2RN7A 1H9TA 2CGPA 2O0YA 1LDKB 2R3SA 2LH9A 1WPKA 2K9MA 4B3XA 4EATA 3Q9VA 4O3MA 1ZN2A 1FC3A 5BPIA 1ZH5A 4NUBA 1VQKI 3DKWA 5BPDA 4NC7A 1JJ8C 1OCOH 4RLQA 1YX5A 4P55A 4M3FA 2WC2A 3KP3A 3G1OA 4JQFA 4LLLA 2O7OA 4FCYA 1XMXA 3IC7A 2IA2A 1MJBA 3QU3A 5E3MA 1Y56A 2HTJA 1KQ9A 1VQOI 1QNTA 1MMGA 3VYUB 2ZJQF 2V1DA 3P7NA 2TDXA 4KUMA 3B73A 1WJCA 5K5OA 1T33A 1ETOA 3K6GA 4WXCA 3CD6I 4A6EA 1R1VA 1B6AA 3SJMA 2G0EA 2EH3A 1ETVA 1RR7A 2CYYA 1R4NB 1RNLA 3LSHA 4UB8C 5D8KB 5EDNA 4PFPA 3QYBA 1APLC 3H5AA 2Q8KA 2LVSA 2MC4A 4YIRX 3QRFF 2CW0F 1V4RA 2DA6A 3K1NA 1S5LC 2Y9ZA 1U5TA 3CJRB 4RGRA 2LC2A 2IGKA 1LDDA 3OYNA 3OYHA 3O8GA 1OCZH 1XGMA 1IZ1A 1C0WA 3JCUC 4X0GA 3F23A 4XRSA 2JVGA 3MFKA 1YLFA 4FASD 4HF0A 3LA2A 2QEXI 1JKRC 4XBFA 1XSXA 4HAMA 1IXSB 1UELB 4UHTA 4CH7A 4OAZA 4XKBA 5GTIC 3QPTA 4E7LA 3RPUA 2VT3A 5ED4A 2XB5A 1AWCA 5ICFA 4GRIA 4KN4X 2E2HJ 4I2OA 2DI3A 2DCEA 2G7HA 3FZVA 3MCZA 1NG7A 4NHJA 2CUZA 4ZJZA 3IH2A 3BTCA 1ETKA 3QPHA 3LSRA 3CMEI 2O5RA 3VEPA 1O4XA 5F0CA 4YFKF 3F8MA 1NK2P 3LSMA 4XORA 2V6CA 1S3JA 4A3IJ 4XRSG 1Z9CA 2CUEA 3DPTA 3SFIA 2DBBA 5J6XA 3LAJA 1HSJA 5HDKA 1JT0A 4RGUA 1TW2A 2ICWG 2DXIA 3ESWB 1J09A 2HNHA 3FM3A 1E3HA 3DWLE 1YO5C 3CC4I 1BN5A 2A6TA 3J7AY 3BJOA 5HS7A 4AYBA 3M8FA 1BOAA 1ZGWA 3CP8A 3JRAA 3F22A 3I4MJ 2Z1DA 2UV1A 4Z6YA 3BG3A 4BJTA 4BGDA 9ANTA 3A2KA 1D5VA 4XOPA 2E36A 5HNHA 1ZQ3P 4II3A 2I5UA 2HQNA 4MEXF 1BW5A 2MW8A 3CCJI 2E1MC 1LE8A 3JW4A 1TZLA 2R7WA 4DIQA 3MKYB 2PMUA 4LLGF 1LFUP 2GOXB 1Q1VA 3DEUA 4G8XA 2CQQA 3OL4A 4B3AA 3TDZC 1XPXA 4W97A 4IX7A 1XS9A 3K2ZA 3HRUA 2IS4A 1ENHA 2IS1A 2STWA 1IRZA 4QPQA 4CICA 1I3QJ 2QENA 3IL2A 4KMUX 3DU5A 1BJAA 5ICCA 4CHUA 4UUSA 5JFRA 4BH9A 2XGEA 1P7IA 3IRRA 2ZC2A 4E7KA 4L0ZB 1ZG1A 3QAHA 3CMAI 1Z3YA 3E1SA 4YELA 1PUEE 4BHPA 1QQIA 3HL2A 3HUGB 5LD2C 1E3PA 1FIPA 1WGXA 4E7HA 3JRIA 3GFJA 3IKVA 4PGGA 1JKOC 2B7EA 3W6VA 4XNFA 2KQRA 3ABLH 2R7TA 3M8EA 1LFPA 1OLTA 1QZEA 4HV5A 2NOGA 5D6FA 4UV8A 3K4JA 3ZMTA 1PJRA 2DT7B 1VQMI 3ROUA 2OUMA 3KYDB 2LMDA 4A3DJ 4NQWA 1USTA 2K9LA 3TEDA 4MTEA 4M9SA 3ZQHA 2G9WA 5HLTA 1AU7A 2D1HA 2MYSA 4BU2A 1Y8QB 2KIFA 2VB6A 1QO0D 4AVPA 4NQWB 2GA1A 2HKXA 2Y0SA 3RJPA 3UKGA 2ESNA 3EPZA 1DGRM 2FE3A 4FE4A 4CO8A 1IRXA 2X1DA 2VPLA 3NEUA 1JTYA 3M7GA 1ACIA 4A3MJ 3CUQB 4IXAA 4I02A 1OMIA 3PO3J 4G7ZF 1OJLA 5C3EJ 1D1BA 5M3FJ 1J7KA 1P7JA 3KP6A 4PFOA 4ITVA 4N4NB 3HUGA 1XN7A 3F0CA 1K78B 2HQ5A 3AAFA 3LWFA 3PIPF 1VQ5I 2DA4A 3BC8A 3GTJJ 2R5YB 5A2QK 5K1YA 1ZREA 5HODA 3OSGA 2VPRA 4UY8I 1D0YA 1FBSA 1NTCA 5GTHC 4KIFA 2FOKA 1ETXA 1LVKA 2QWWA 3I56I 4A3BJ 3JRGA 1VQ4I 3WE2A 1X19A 1I1SA 2DODA 4C2MJ 5D6EA 5E3NA 5FJ8J 1TC3C 3BR3A 2OBPA 4B8XA 3ZOBA 3BOQA 1EH8A 5J40A 1Z05A 2XAUA 4L5IA 4D7MA 2Q1ZB 3GXOA 4RS8A 3E3VA 3KETA 1O3SA 4HSRA 4S05A 1HW1A 5B1AH 1HBXG 2K4JA 3K4LA 5KAIC 2GOMA 3SHFA 1D5YA 2FF4A 4IL6C 3BQYA 3PNTA 2H6BA 2XRNA 4XIDA 5D4SA 1X3WB 4EJOA 2ZBKA 4EQQA 1K61A 2MSYA 4AC0A 1V5EA 4BDZA 4Q47A 3F6VA 2LG4A 2WV1A 2DLLA 5E8IA 4MFEA 1K79A 4K2EA 2XPWA 2R7ZJ 1SD7A 2LKXA 4OIQF 1B4AA 1MNMC 1ULYA 2HVQA 4AUXA 4CCMA 2EFPA 3PJRA 1R1UA 3BR2A 4M9XA 4BXFA 4BJ6C 4WWCA 3CF2A 4IHYA 1WJEA 1HQCA 2ELHA 2JRMA 4M6YA 2F5CA 1HKSA 1IV6A 4G12A 5GPCA 1WSUA 3BZCA 1UG0A 2LTPA 3JRHA 1WJBA 2EWNA 4HDUA 1DU6A 3VYRB 3DV8A 4XONA 1D1CA 1NG6A 3TMOA 4HW0A 2BGCA 3CCLI 5BQTA 1U5TB 4LB5A 2V6EA 1P92A 4M71A 2P5LC 4FHTA 3RZOJ 1WI9A 3T8TA 4IKFA 1OPCA 4EM1A 4BL0B 1VQNI 2KJBA 3BTLA 3KYCB 2L7FP 2QSFX 4XN3A 2HVRA 2M8EA 3S32A 1TNSA 5D8LB 4XSZF 3RCOA 3SXYA 2QYOA 1F4KA 2DW4A 4KT6A 4RAGA 4JX4A 2AS5F 1IN7A 1IXCA 4LIVA 4ZTJA 1WJ5A 2XDVA 2ZO4A 3WTSC 3FXKA 5E17F 4C3IJ 1SVOA 2W25A 3DBLB 5BS6A 2JZYA 1XCBA 3L2RA 5L3DA 2PI0A 3AG3H 3ABUA 5JVGF 4CCKA 2F5DA 2HOEA 4NBQA 1IUYA 2IAIA 2OF7A 4Y52J 2ZJRF 3LFUA 2FEZA 4J19A 1VQ9I 2LF7A 4BJ5C 3BJAA 1L3LA 1DU0A 3O3KA 4BHBA 2HU9A 3T8RA 4BYYA 5HLHA 5D5VB 2V1XA 2EV0A 3LSTA 1OYYA 4KITB 4RA2A 2VBXA 3BROA 2W7NA 4D7NA 3S1QJ 1Q1HA 4LLNA 1R71A 2GM4A 2HOTA 5LHIA 3J81K 3KEOA 3S1NJ 2FQ3A 4UNOA 4L0YB 2KP6A 3PSIA 2VIXA 2CG4A 3KEYA 4JYKA 1FWZA 4RB2C 1MMAA 2JA5J 3LSGA 3M1EA 1HKQA 2RQPA 1BR4A 1FP1D 4PGHA 3GZ5A 1OCCH 2M8GX 2L7MP 2WV0A 4RGSA 1SVMA 2RV8A 3A01A 2VI6A 1BA5A 2W84A 1AOYA 2QGUA 2GIVA 2CV2A 2L02A 3E7LA 1W5TA 2JA6J 2VBWA 5GAHJ 4HQEA 2M9HA 2FSWA 5EYRA 1B9NA 3EUKL 2DA5A 2O03A 4LB6B 4ZDPA 4M73A 3HKZN 5LGTA 5DTDA 2AQFA 4BAYA 5CLSA 3LMMA 4XN0A 5F27A 2HXOA 2DFFA 4V2FA 3GTKJ 3DQVC 4NC8A 4XMYA 3BR0A 4XQFA 2KIMA 3BTJA 3I3LA 3KIOA 4MTDA 3M3YJ 1IN4A 3E6CC 2B9SA 3VB2A 2ETHA 4UV9A 1VFCA 1Y0NA 2BW3A 1UG2A 5KHDA 2NS8A 1QHHD 2FU4A 2JPBA 2OPTA 5KAFC 5HS9A 3J81Z 2KIUA 2QA4I 3FXJA 2L7KA 1O7FA 1XGNA 4B1RA 2BVLA 2LREA 4DYQA 1T38A 4XR6A 3NWSA 3G6EI 3GTQJ 2MD5A 2WAFA 2JJ7A 2L9RA 4A3KJ 1GVJA 4EJWA 1OYWA 1YW7A 3CJTB 4AIJA 1EJ9A 1UMQA 1QRYA 2ZMEB 4U88A 1BIBA 3ERMA 3M1CA 2DK5A 5ILSA 2HQRA 4XLPF 4XLHA 5AIQA 4CXFA 1OR7A 1Z0XA 4F3QA 4OMYA 1YS6A 2A68F 4HZFA 3VDXA 1I39A 4OMZA 2R5ZB 3NARA 2IBDA 1JGGA 1FYLA 1XGSA 1T98A 1R58A 1YRNA 2XKOA 4PZJA 4E6KG 1K4SA 1B72A 2BY2A 3QOPA 4BQNA 5F1RA 2QZ8A 3GCMA 3LQQA 1GLNA 4BNCA 3HB9A 4GCVA 1UB9A 2FRHA 1D0ZA 2VUMJ 1W0UA 2UUZA 2J5OA 3KEQA 3FMRA 4HRIA 1GVDA 3OS0A 5K7ZA 1KONA 4BDYA 2H27A 1IXRC 1U2WA 3RPUD 3O8HA 3S14J 4PUSA 1K83J 3Q3SA 4HDVA 1ETWA 1YQAA 5DCFA 2RC4A 2LK2A 2JWTA 3QODA 4RAYA 3E6DA 3F6OA 5EEHA 1KYWA 3CESA 3LSKA 4ENMA 1TWCJ 1FSEA 2RQQA 3ZP5A 2FD5A 2HXIA 2CQKA 3HM5A 2OQRA 1K7AA 4BY1J 4KIGA 2H6CA 4GXOA 4WX9A 4C30A 3TW6A 3TGNA 2QBYB 4N4OB 4MNUA 3MD2A 4HA8A 1JTXA 2YUSA 3I4PA 3WTZA 4AYBN 2JN6A 1MBJA 3FKIJ 4EMSA 1V3FA 1S29A 2Q2EB 2DA7A 1I6HJ 1HSTA 3C3WA 2EZLA 2DOEA 2F4IA 3L1PA 3ZQGA 3CMMA 3P5JA 3O2PE 4Q4ZF 1NK3P 2K5CA 1TP4A 2H94A 2X48A 2Y48A 3RSNA 3BP8A 3NWTA 4HX4A 3IH3A 3ZQLA 1O3QA 3HBLA 3KFWX 2W48A 3BQZA 4BQQA 4EM0B 1I50J 2KJCA 4YIFA 5CPRB 2P8TA 1XD7A 3COAC 1RR8C 1T08B 2CWEA 1PP7U 1SAUA 1Z1DA 5ILUA 2C6YA 1KU3A 2E1NA 2XUBA 2ECCA 2EFOA 1Z3XA 2RVCA 3MAJA 1ZRCA 3D5LA 3H5RA 4QWQA 2H1LA 3OYMA 2HEOA 1GXQA 2MGQA 1MJ9A 1WRJA 1BC8C 2DTZA 2BXZA 3SZPA 2X6XA 5AIPA 3CLOA 3P9IA 1KU2A 1MBKA 1WJDA 2A3SA 2WAEA 3FM5A 4RB0A 3ECOA 1MMSA 4HNUA 2ZXJA 3PUBA 4OWRB 4A3CJ 1F9NA 3ZXSA 3CMYA 4II2A 2IW5A 3SQNA 5HDNA 3I9V2 2ZXHA 4KA4A 3ASNH 3K9TA 3TO9A 1JE8A 2Z9OA 5J1UA 3W2VA 5HNFA 2DPUA 2EJRA 2ID6A 2XPUA 3ZMZA 3FXMA 3GBGA 5EZGA 4RGXA 3EUHC 5LLQA 2K9NA 2CQNA 2X1EA 4UUTA 4WK8F 1WJAA 1P4XA 3BPXA 4L5JA 5H20A 1IUFA 4G6DA 5J8FA 5CYVA 3C18A 2EFNA 2ZMEA 4OINF 5M5YJ 1BI2A 4LJZF 4P9FA 4N0BA 3KP4A 2VOOA 5F6FA 2DJNA 5CJ9A 2VODA 3RYPA 3K0LA 3S2HJ 2DDAA 2QKLB 2ZNZA 3JRFA 5EGOB 4ZYGA 1F1ZA 2F4OB 1DPUA 2AXTC 4X6AJ 2BOLA 4M6VA 3RTRA 2E2JJ 2ELJA 2MLKA 1DPRA 3I53A 4CGZA 1X4OA 2FMYA 3OYLA 3ZMVA 2Z99A 1O57A 3S8PA 1RRJA 3BJ6A 4E70A 3OR2C 4WF2A 1FX7A 1JI8A 5JI6A 2CFOA 1HA8A 5IYBJ 1S8NA 2KL4A 1FEXA 5GPAA 1G4DA 4DBQA 1RZ4A 2GIZA 1H89C 4HLXA 2WA0A 4PSXA 3RYRA 2GLOA 2OCCH 2WAQN 4Y33A 4W1UA 1XB4A 4X1EA 3QYFA 4U7BA 1DUXC 3BG7A 3E6MA 3CDIA 4L9JA 2P0WA 3IAS2 4HV6A 1ZR4A 2CUJA 3ZN1A 3BWGA 2DOFA 3ZQQA 4HF2A 2DQLA 4G7HF 1R00A 3CTAA 3D0SA 1ON1A 1G3YA 3I0TA 1KQ0A 1U78A 3BCBA 5J1RA 2ZFUA 5HDGA 3CDLA 4U7DA 2O61A 2D5VA 4AIKA 4A0XA 1BC7C 2QQ8A 3DKXA 4MGRA 5L3FA 2E5ZA 5DD4A 5IP6A 1FTTA 2E7XA 2VN2A 5BOXA 1MH4A 2PJRA 4FE7A 3JRDA 3ERED 3KX2A 2GXBA 3N05A 3FBNB 1UHWA 2M4GA 4BQOA 1IN6A 1MJAA 2W00A 2R5ZA 1BW6A 4XRMA 2XSJC 3E6BA 1JUSA 4LD5A 4RAZA 4XLAA 3J7ZI 1G2HA 3GVAA 5L3EA 3OY9A 1WWXA 3MVPA 1B59A 2A5YB 1QVTA 3J7YJ 3CUQC 3F72A 4UVAA 1YYVA 3PIOF 1OR7C 2ECBA 2GA2A 4B47A 1N77A 2KISA 4M3BA 3FXQA 4A3EJ 2XVCA 1K4TA 2FUG2 2CFXA 3HOZJ 2KFDA 3CCSI 2BW3B 2NS0A 1FYKA 2OCEA 1EKEA 2M7BA 4A2UA 4ESFA 4ABZA 3CCVI 2FMLA 4ZYEA 1LPQA 2D2WA 2VASA 4RMNA 2P6SA 2LP0A 1ZTRA 4A3JJ 5IP7J 3C1DA 4GDFA 3R0JA 3IV5A 2CV0A 4BXUA 1IRGA 1GHCA 3WTVC 1ONVA 2JT1A 1OYIA 3TOBA 3HSEA 4XL9A 1LQ1A 2NXNB 2IS6A 5DD8A 5HOOA 3GFIA 1WKMA 3CCYA 5FKKA 3WTXC 2IT0A 4F93B 4ZYHA 3Q0WA 1PUFB 1O3RA 2CS3A 3HOUJ 3SEZA 1A35A 2NVYJ 5HLIA 1R9TJ 3E5XA 2VJIA 1FT9A 5B66C 1XMAA 1ZARA 3KLOA 4F55A 2LYCA 1BI0A 1P9QC 4WXHA 1ZRFA 1YG2A 3OYBA 1S7AA 4Q48A 2KHMA 3NAUA 2PBIA 2W1OA 1KQ8A 1XSDA 2NYXA 3D5SC 3LA7A 3P9CA 3W2WA 3WHBA 1GT0C 3MKZA 5FD5A 3DEEA 3W3CA 1ZLKA 2VKEA 2YX7A 1P6RA 3GX4X 1T2KA 4C2UA 1CQTA 5BNGA 4KICA 4JBAA 4CYCA 3K4CA 5E79C 1A6IA 4G9YA 2LBFA 3FXUA 3V7CA 3OYFA 3HOXJ 2DMUA 3K1PA 4XLNF 5JLXA 3RPQA 2KZVA 4KDPA 4UVBA 4LG0B 5GAGJ 5M3MJ 2IPQX 3OOUA 3OOPA 2EIJH 4LGWA 2MH2A 4B09A 3FMQA 1H0MA 1Y8RB 2M30A 3DBRB 4CA0A 1YI2I 3BG9A 3PSFA 3S2WA 3RKXA 1FPQA 1YIJI 2YSRA 3DKYA 3U21A 1MIJA 3FXRA 1QHGA 2XGXA 3RQ4A 5F64A 4HNTA 3CCRI 2ME6A 3K4MA 3TDUC 1SAXA 4XK4A 1VI0A 3H92A 5E3LA 3WG9A 3K69A 4G6TB 2M4KA 3VPRA 1XG1A 2KRFA 1DDNA 5EG0B 4A93J 3HRMA 3OS1A 2FX0A 2E7WA 1HOMA 3TP0A 2QQBA 3OWTA 3K70C 2IVMA 5FRNA 1SMYF 5LHHA 1OQYA 2MA3A 4HOBA 2GBYA 5LEJA 1JKPC 2YS9A 4E7SA 3DCFA 2LKSA 5D5XB 5FKMA 3MZ8A 2NNYA 3JSPA 2PLYA 4A3GJ 3M9AA 3DTEA 3C2GA 5KNLA 2NNNA 3JRBA 2GXAA 3F8NA 1IF1A 3AG4H 5CQEA 1HC8A 5AONA 5B5EC 5GP9A 1O7LA 2EA4A 2CV1A 1FSHA 2K3PA 2D1VA 1WCMJ 4A0ZA 1TBXA 1TQMA 3L2QA 2NOJB 1UZCA 2GZWA 4YEJA 3X2QH 4JOMA 4MFDA 5IYCJ 3CQZJ 5DS9A 2GWRA 2WAQA 2K86A 2MFZA 1OKRA 4OU0A 1U9NA 2P7VB 4A5NA 1MBGA 3WTUC 2HDCA 4MLOA 2L0KA 3VODA 5DCMA 1S9HA 4ENJA 1J2XA 2XV4S 3S93A 2BYVE 2Y0MA 4I0BA 2BXYA 1BBYA 2DFEA 4XRFA 4DOZA 3A02A 2ME0A 4P96A 4V2GA 2VJJA 5L3GA 1DP7P 1TNTA 4ZDOA 4FQGA 3W6JB 2WY7Q 3F3XA 4ZTFA 1X1BA 2E5NA 1SFXA 3R6SA 2VONA 5FD6A 5F0HA 3M07A 2BVMA 2KMUA 2VLAA 2FBKA 2DT6A 2M3AA 4UUSB 3HSFA 3R4KA 3I4NJ 1IV8A 2OTJI 2JK3A 3I55I 5B1BH 2R4GA 5HVQC 2BBYA 2R5YA 2WTEA 3T1BA 1EF4A 3I64A 1LE8B 2V4JC 3FKJA 2O9LA 3AKZA 4TV7A 3A0HC 2H09A 3W2AA 2L4MA 2QSHX 2E19A 3E5QA 5KCMA 1YJWI 2M2EA 3MEXA 1O3TA 1N78A 1BR1A 2FNAA 3I5UA 3OYJA 3T0YA 3WU1B 1XSVA 3CUQA 4QIWN 2RREA 4WXDA 2WB1N 2FQ4A 3HGGA 3FHZA 2M1BA 2LFBA 3J80Z 3FX3A 2UWMA 2G7UA 1I27A 1TQIA 2M87A 3BDDA 3FHNA 2Y69H 1MH3A 4GGGA 1R7JA 3IRQA 2UZKA 1YS7A 3PO2J 3TO6A 2I8DA 4AVZA 4IHVA 3HRTA 3WTWC 4E7JA 4A5MA 5TGTA 3HOTA 5IOZA 4RDUA 4EJTA 3FF5A 5LEKA 1IAWA 2DMQA 5C4XJ 3L9FA 3G4SI 3GEZA 4G94A 4HX7A 4YRVA 2HPIA 3A4CA 3DXJF 2XAGA 5E18F 4J01A 2DN0A 3KZIC 3IP4B 1YOVB 4P9UA 2ACJA 2R92J 3EDPA 4B4CA 3ABKH 1X2MA 4IHXA 1XMKA 2EIKH 1X1PA 1N25A 4M9ZA 3K2AA 2V26A 1EV7A 5FKLA 2EPFA 4F52A 3OR1C 4QSHA 1MMDA 3PNVA 3G2BA 3PUFA 4GYIA 4UUVA 2JA7J 3KP5A 1SD5A 1EH6A 4IZZA 3CP2A 4MEYF 5IT3A 1W7PA 2E60A 1FIAA 2XIGA 2R7SA 2PJPA 1GDTA 3HHGA 5J47A 1Y6IA 1GXPA 4EV0A 3KLNA 2PQ8A 3BZKA 2BY0A 3BZ6A 3CO6C 4Y13A 2CRGA 5M5XJ 4IOAF 2E1CA 2X9DA 3KPHA 3CDHA 5KVRA 2Z3YA 4LK1F 2QSGX 3F8FA 4LMYA 1XCVA 4JK1X 4XKVA 2Y30A 4I09A 3OL3A 3CCEI 5F0FA 3QWLA 2UXXA 5LGNA 2Y9YA 2IJLA 3DPUA 2F48A 3V42A 2DYSH 2F4MB 3KZZA 3U1DA 5B3SH 4EM2A 2A5WA 1R23A 1USSA 4LG0A 1SD6A 3ECHA 2Y75A 1UCRA 2KPMA 4OOIA 1KA8A 2K40A 3V8KA 5LGUA 1J59A 1SFOJ 3HGYA 3B6AA 2ZNYA 2F5VA 2VKVA 3F9KA 3H0DA 5BMZA 4ZZDA 1TT5B 3GLXA 2M34A 3IH4A 3LOCA 1D8KA 5J8CA 4CYCB 2VE9A 1Z7LA 4C3JJ 2E34A 1G8XA 4ESBA 4IHSA 3F21A 5DM6F 1MGTA 3O6BB 4NB5A 1JT6A 3S15J 4JX5A 5HLGA 2HPMA 1QZZA 2M0MA 2RNGA 2TCTA 2K4BA 2DDBA 3OMYA 3ZQCA 3TL4X 4BEHB 5D4RA 1DP3A 2BZTA 3CC2I 1V5GA 3RQIA 4F92B 5GAEJ 2RDPA 5K5RA 4IJAA 2FBIA 5EEGA 1A31A 2DMTA 2K85A 1LFBA 4HBLA 3S1MJ 2DMPA 1OCPA 4LITA 1GV5A 2NS7A 4YG2F 1W5CC 1Z77A 2DTRA 2DYRH 4RAFA 2WY8Q 3HYIA 5K7FA 1WI3A 3S3OA 2EZHA 3KP7A 2N8GA 1MD0A 1VQ7I 3REOA 4OAYA 2J5PA 2VXDA 3ZCOA 1WVRA 2X6WA 1W36D 5LBQA 2OTLI 3SZTA 2F5EA 3AG2H 5CQGA 3WODF 1AKHB 1LNWA 2GXGA 1Z21A 4PSWA 1BR2A 4KFCA 1S7OA 3I58A 2LDUA 2VQCA 1HDPA 2IGOA 1VZ0A 4XKWA 1EA3A 1H8AC 3QPLA 3V7RA 1HDDC 5E1WA 2KZGA 4BXXJ 1IJWC 2B63J 4F91B 1Z6RA 2IGMA 3EUAA 1JXSA 3ZQIA 1W5SA 3SDGA 2QM3A 5LRSA 1YFHA 3EUHA 1QPMA 2Z2SB 1OCTC 1WJFA 1XDSA 5IP9J 2WADA 1IDZA 2L5QA 2D45A 2NVQJ 1LEBA 4KIBA 3N97A 2YPRA 3HG9A 3PQJA 5TISC 1WZ2A 2HYGD 3QP5A 3C2BA 1REPC 1V5FA 3H1CA 2ISYA 1XX5A 2K27A 2LD5A 3U1KA 2X4HA 4ZYDA 2CO5A 5K7HA 2KIQA 2BEOA 2L9SA 3BY6A 5FFZA 3ZQFA 4DGWB 5JHUA 1QBJA 3CCQI 2LR8A 2NVXJ 4A0YA 3WGGA 5FFXA 2FOWA 2AO9A 4XLEA 3ML6A 4YFXF 1HLVA 1SFEA 5LRRA 5ILVA 4YIIA 4KNYA 5JVTA 1X1CA 2H8RA 5EF6A 1ZRDA 3ELKA 2L9NA 2HZDA 3HXLA 4D5FA 5GADJ 3EYIA 3BR6A 2WBMA 4L18B 4I98B 2WWYA 4Y17A 4BBRJ 2W57A 5FGMA 2KDZA 1BI3A 1MNDA 2A6HF 3GZNB 3CCUI 3LNQA 5TRDA 1T0FC 1A04A 3OYDA 2KKOA 4L9NA 4A6DA 4HQMA 4EJUA 3G1MA 1RPWA 2PN6A 1Z67A 4XLCA 4D1QA 2I10A 1Y39A 1RC9A 1QU3A 4I01A 2YX4A 2VC1A 1LDJA 1E0EA 2VJ5A 3TW7A 4EEFG 2FA5A 2M5WA 3JAMZ 4MQ9F 3OYIA 3WGHA 3KCCA 2QF7A 3K10A 1L0OC 1I1GA 3I59B 3GLLA 3H3ZA 1FP2A 1S72I 3HOSA 4CYDA 3SDBA 3F8CA 1Z7UA 5DEQA 2LF8A 2ZJ2A 2P5VA 1W7PB 1IO2A 3RKWA 1TL8A 2K3FA 3ISPA 3ZN0A 3GYHX 1FOXA 2CUFA 2COMA 5A2QZ 5J1YA 2OZ6A 2ZJPF 3VYTB 4IRIA 4RLFA 3ABMH 2MC3A 2JUCA 4AIHA 2CJJA 1U0JA 1X1DA 3LSJA 3GTLJ 5J3LA 4OIOF 5C4JJ 4DZPA 1DGWY 1X3UA 4BE1A 2A07F 2AQEA 1UAAA 1R4MB 1TWFJ 3PL8A 4LIUA 3HSRA 2K7LA 4B43A 4A3LJ 2Y31A 4PJLA 2BY3A 3S17J 3B02A 3OYAA 2XC7A 3GFLA 5H6RA 2CMPA 1YJNI 3I54A 1RI7A 4WCGA 2XB0X 1YHQI 1POGA 1ZG5A 2XAHA 3TQNA 4BKXA 1Z91A 3DLLF 1XTAA 1VQ6I 1LUJB 3RI4A 4I0AA 3FISA 3JRCA 1WHUA 1ZG3A 3IHUA 4DZJA 3KYLA 3MMYB 3Q0VA 1MNEA 3AFHA 3WGIA 2H1KA 4RB3C 1BJZA 4LK0F 4QLCU 2TRTA 3M4OJ 1PP8F 1U8BA 1VQPI 2Y0SN 1HW5A 2V79A 3GFMA 2QCOA 1CF7B 2BY1A 2BHYA 3BG6A 3DTIA 2LY9A 2K02A 4BBSJ 3GO5A 3S1RJ 4CZZA 1JGSA 4ZC3A 2STTA 2LSOA 5IPAA 3U2RA 1UHSA 2EFQA 2W82A 1K6OA 3ASOH 1YTYA 4DYRA 3FXLA 3L09A 4NNJA 2R93J 1FYMA 3SZGA 4IRGA 1P4WA 4L5EA 4NDLA 4Q5SF 1F36A 1R5GA 3DF8A 2KT0A 2QKMB 2RNJA 2GAUA 1ITYA 2DK8A 2EFWA 4EGYA 2VT2A 3WHCA 1JJ6C 3OV8A 1FJLA 2YU9J 3FBIB 1AA7A 4HSTA 3H3VK 2HYFA 1D1AA 3QU6A 4AWXB 1YE9A 3QYEA 3K4BA 3QP6A 1R1TA 2FXAA 2FNPA 5E8GA 3HOWJ 1X2NA 5FKOA 2IA1A 3GZ6A 1UFMA 1PYVA 3L7WA 2QBYA 4ON0A 2VBZA 5K5QA 4ESJA 1HCRA 1ZAOA 3IAM2 3FWEA 2EV6A 3H0GJ 3VFZA 3WE3A 5DCMB 2JRTA 2X6OA 3VSLA 3LFKA 4MO7A 4EVIA 2RKHA 4CCLA 3FIWA 2ID3A 5FRMA 3JSOA 3ZMSA 1A5JA 1Y0UA 2XKPA 2HQAA 1SANA 2HFHA 5JLWA 3OYEA 1ZELA 2L01A 4C9YA 4G7OF 4IHWA 2VQLA 2FJ1A 4BUPA 2CW7A 4IPAA 2NAZA 2VBYA 1QGPA 1R49A 2IXSA 3PNYA 3UNGC 1H9GA 2QVOA 3CUOA 3V8JA 5L3BA 2HVSA 3RKYA 2QLZA 2JA8J 4IO9F 2LY2A 4E7ZA 3RZDJ 2VL8A 2IRFG 3R61A 2EINH 2LRDA 2R7OA 2XAQA 1W0TA 2VXZA 1H88C 4OIRF 2X0LA 3ZRGA 5EEAA 5DYMA 3Q5FA 2NRAC 4PJJA 3PQKA 3FMSA 5DDGA 3HPGA 2L9VA 2ZXWH 4CZCA 2R7VA 3HRSA 4UVCA 1ETYA 2HS5A 4FX0A 1HW2A 3OYKA 2EILH 3DP7A 2XGCA 4DQ2A 1MMNA 5EG0A 4M3GA 4CCNA 4GFBA 1ETQA 4D5CA 2VQGA 4PCQA 1P2FA 1TT0A 1RKTA 3P9KA 1BI1A 2L7ZA 1DQUA 1IG7A 1IGNA 4H4KC 1B8IA 1MDMB 6PAXA 1VQLI 1T0FA 3MKWB 5F1JA 1I5ZA 1FY7A 3FXOA 2HOAA 3TBIA 2XAJA 4I7HA 5DUIA 1FNNA 1T6SA 4ANJA 5E1XA 1NHAA 5CVVA 3ULQB 1BL0A 2E2IJ 5DV5A 2P81A 2VQHA 3MQ0A 1IDYA 2ZSHB 4EJVA 1OISA 1A36A 5EZHA 3V4GA 1F43A 3BG5A 2OV7A 2MH9A 4BHCA 2CH0A 3HC7A 2VC0A 1X3ZB 3OIQA 2LBFB 4L9TA 2K9QA 2M7AA 1E3OC 4PK4A 1ZR2A 2PMHA 3K4KA 4RB1A 2EZIA 3DBHB 4KJZA 3U9GA 5E20A 1J0RA 2DPDA 3SYTA 1GV2A 4IF4A 1LKXA 2O6GE 1WH7A 1E17A 1RETA 3ZPLA 1ZK8A 3GWZA 4HPQA 5FO5A 2P4WA 2HWVA 5J4VA 4DYCA 2F5FA 2XF7A 2LKPA 3BLYA 1UJ8A 4FT8A 1FBQA 2NVUB 3HKZA 3J7AO 3WU2C 2CSOA 1R5ID 2EZKA 2R7FA 4QTRA 4BE2A 4H0EA 4I99C 2CQXA 5L3CA 2BV6A 3A01B 2EK5A 4XLFA 3MZYA 4ZDLA 4XICA 2XF5A 4JX6A 4R1HA 3S16J 1JUPA 1RIOH 1Y1WJ 1YX3A 3KP2A 3HTUA 1B9MA 2Z16A 3LAPA 1XC5A 4BS9A 2V7FA 1JHFA 1ZHFA 2E1MB 3TKYA 2PX9A 3VYSB 1ZYRF 1PUFA 1MBHA 1VNDA 4A12A 4PDKA 1LB2A 1ERDA 5J4YA 5FLXK 2PMZN 1WQ2A 2HGCA 1ZGAA 1U5TC 5DM7F 5HS8A 2O3FA 2JPCA 4MHGA 4I6ZA 3VWBA 2L4AA 2R7UA 1TQPA 1G3WA 1LEAA 4I76A 2WB1A 1T39A 3EETA 2X85A 4UB6C 3G71I 3RKQA 1KU7A 4A3FJ 1YW8A 3A0BC 4RM2A 5CKTA 1W7PD 3GF2A 4AM3A 3GW2A 3SEQA 3IKTA 4IVNA 1U3EM 5CVJA 2MBFA 2XHKA 1AHDP 1T8IA 4J00A 1W1WE 3BCAA 1EH7A 5ICEA 2ZB9A 2OQGA 2L2OA 1MDMA 2XROA 1B8IB 3OIOA 2DT5A 4KMFA 1FZPB 2LLKA 4M74A 3H3UA 2HOSA 1TTYA 1YIOA 3UR3C 5CVIA 1VF9A 3S2DJ 3C2HA 1JKQC 4IRHA 2CQ7A 1KGSA 2ELKA 4N9HA 1MSEC 1MBEA 2ISZA 2A61A 1SVLA 3D5RC 4PJNA 3HOYJ 3DEWA 2PJRB 3CZ6A 2ZCWA 4Y7NJ 1RUNA 1WFXA 1XGOA 2XRLA 1TLHB 3MKLA 5E1ZB 1ZLJA 3HIFA 3WTYC 3BTIA 3V8LA 2DJIA 3H9QA 2AHQA 1KU9A 2HKOA 4JP0A 4FTHA 3AL0C 1P4AA 3CLQA 4XSXF 4CCOA 3JTGA 4ZYAA 2KDOA 1I6XA 2VKDA 1YITI 2KRHA 2P7CB 1ODDA 3G3ZA 2UXNA 4DW6A 2CW8A 4BACA 2FBHA 3KZYA 1G3TA 3A1YA 2BHZA 1U8RA 3ZGKA 4IQJA 2BE5F 3RIRA 1IC8A 2X6YA 4PJ0C 2V9PA 2QQAA 4Y3OA 4L9VA 4U0VA 3NRVA 2LOOA 1U9OA 4MIMA 1QA6A 4LOCA 4Y15A 5CVRA 4LG3A 2R7XA 2X1CA 3WTTC 1FOKA 1VQ8I 3DPLC 3Q9SA 3B6CA 4CSWA 2JSCA 3I71A 4HG2A 1XDUA 1WH5A 1D3YA 1SFKA 3J80K 5EGOA 3GMEA 4B44A 3LSPA 3IWZA 4M72A 3DU6A 4A69C 2DFIA 3GTMJ 3IWFA 5IYDJ 2KLOA 2OC6A 4R8HA 3G1LA 1OCRH 3HTSB 3BT9A 2X51A 4M3EA 3JTHA 3ZQ7A 1J5YA 1MZBA 5JR3A 3HPHA 3HZJA 2HYJA 4KT5C 2XGDA 5H6QA 1R22A 1ON2A 4N9IA 3NQOA 3DLAA 4GO1A 2IEKA 1E2XA 2P6TA 1T56A 3LQRA 1VTNC 2W4SA 2XF6A 3JREA 2O8KA 5IT9K 1TWHJ 2F2EA 2IS2A 5FROA 2HR3A 5E3OA 3Q0UA 3GTPJ 3L2UA 5ERIA 1BOBA 4AU7A 4BY7J 5JHFA 4BE0A 1K78A 3K1MA 5FKNA 4C3HJ 4BQAA 1BIAA 3C7JA 2HDDA 3N4MA 5TJJA 4AD9A 3VOEA 5FB2A 1PVEA 2PEXA 4IQ4A 4V19K 4ENKA 5IT9Z 4CUGA 3OSFA 1F5TA 3W6KB 3PFIA 3K7AJ 1RUOA 2MABA 1LVAA 1MW7A 4Z2YA 2COBA 3HEFA 3QQAA 2YR2A 2ESHA 4U0YA 4KYWA 2ZKZA 2EBIA 2OZUA 1W36C 3QPSA 5D5WB 2DA3A 4U0WA 4O5VA 1JHHA 1SFUA 2R7RA 1FMVA 2W24A 1QPIA 2A05A 3H9JA 2A69F 2RGVA 2JVHA 4C2TA 3AG1H 5ICGA 4R79A 2OU2A 4RM3A 1SMTA 3OYCA 1V54H 2YU3A 2PMZA 3KE2A 4KISA 4GYGA 3K70D 3SFZA 5F08A 2EIMH 1KZHA 3BR5A 1YJ9I 2DAOA 2R0QC 2IP2A 1IN5A 3M8JA 2L54A 1K6YA 4DJAA 3LA3A 4RBOA 3CF5F 2Q0OA 3T5XA 4MQVA 3TO7A 1ZKGA 2VOPA 2JTVA 3CO7C 5EJCA 1LJ9A 1IRFA 2Q2EA 4HYEA 4D9JA 3GUDA 2F6CA 3RDIA 2K9SA 4DNCA 3H35A 4ZH4F 2L3DA 1NH3A 3GTOJ 2JA2A 1MSFC 2JUGA 3TOAA 1ZGJA 4M3DA 5FLVA 1S6LA 1HKTA 2EB7A 2IA0A 1M1EB 1W4MA 3VSKA 1T95A 1PDNC 1RESA 2ZSIB 1MBFA 1R5HA 5IOYA 2VKHA 3OIPA 2P5KA 1MKMA 2XSDC 2DA1A 3AL0B 4YFNF 1J75A 3JR9A 4P5OA 2QQ9A 4UXNA 2R7DA 4XOTA 1QZYA 2M0CA 5FLXZ 1QVUA 4OIPF 3V7SA 3MZHA 2VE8A 3QOEA 2E71A 3CJNA 1CF7A 2DQRA 4HLYA 2LNBA 1FLIA 4FETA 4E4HA 3L2CA 5C44J 1FOWA 3K4NA 1N75A 3PFYA 1SC7A 1S7EA 3ZMDA 3DFGA 1IW7F 2OAZA 2ZFWA 2XAFA 2ZXIA 1D0XA 4HX8A 4CDGA 1IN8A 2OA4A 2MD0A 4IOCF 3PM1A 2OJED 2O8XA 4IHTA 1G3SA 3A03A 2LY1A 1JUMA 3H36A 5LHGA 2E35A 1CGPA 1TWGJ 3LL7A 4ZZLA 1SD4A 1GUUA 2DU9A 1X1AA 3EYYA 3MWMA 2KRCA 1B72B 2AXLA 1YRNB 2XASA 3H9GA 4ENNA 4HEA2 4G6QA 2PFBA 3ZMUA 4NC6A 4LFUA 4Y4RA 1D8JA 3IUOA 3OYGA 4XM3A 3CJQB 2HDWA 3ZR8X 1A6QA 3BR1A 3CCMI 3E5UA 3JAMK 1FTZA 3R0AA 5DUKA 1B1BA 4HF1A 5KK1A 2IGNA 1V55H 1KYZA 2GQQA 2DOAA 2JMWA 1Z6TA 2DA2A 5CVUA 2EQRA 2XPVA 1G6NA 2MLGA 1UHMA 2Z5UA 4ASNA 1OFCX
chains in the Genus database with same CATH topology
1HCRA 3HDDA 2DMNA 2M9HA 5FLMJ 3H0GJ 4IEJA 5EYRA 1ORKA 4HNVA 2X6OA 2DA5A 4MO7A 5GP9A 4FISA 1TWAJ 1AKHA 2RAEA 3FIWA 1X58A 2ID3A 1WCMJ 1A5JA 3HKZN 1SANA 5DTDA 5JLWA 2MG4A 4MFDA 5IYCJ 3CQZJ 5DS9A 3FK6A 4IHWA 3HOVJ 2FJ1A 5F27A 1U9NA 2HXOA 3D1NI 4V2FA 1MBGA 3TP3A 3GTKJ 4S0HB 3BR0A 4MLOA 2NVTJ 2L0KA 3BTJA 3M3YJ 1RKWA 1Y1VJ 5M5WJ 1VFCA 2JA8J 1UG2A 2Y2ZA 2NS8A 2OPTA 3RZDJ 3A02A 1H88C 1W0TA 4B1RA 4DYQA 2CU7A 2ME0A 4V2GA 3GTQJ 5EEAA 2E1OA 2JJ7A 3MN2A 2HI3A 2L9RA 4A3KJ 1UMQA 1QRYA 5F04A 3FK7A 3GTGJ 1ETYA 5F0HA 2XGCA 1Z0XA 5EG0A 4M3GA 4UUSB 1HF0A 4GFBA 1ETQA 4D5CA 3I4NJ 2R5ZB 2JK3A 3NARA 2IBDA 1JGGA 1YRNA 1RKTA 1B72A 2L7ZA 1IG7A 1IGNA 1WPKA 2R5YA 1B8IA 3HB9A 2VUMJ 1W0UA 1EF4A 5F1JA 1LE8B 2O9LA 2HOAA 1JJ8C 1GVDA 5K7ZA 2E19A 4M3FA 2M2EA 3G1OA 2O7OA 4FCYA 3O8HA 3S14J 4QIWN 1BL0A 5E3MA 2E2IJ 2P81A 1K83J 3Q3SA 2WB1N 2FQ4A 3HGGA 1IDYA 2LFBA 1ETWA 5EZHA 1F43A 3BG5A 1MH3A 3PO2J 2LK2A 2JWTA 1T33A 2K9QA 4IHVA 1ETOA 1E3OC 1ZR2A 2EZIA 5IOZA 3SJMA 4RDUA 5C4XJ 2G0EA 2DMQA 2EH3A 1TWCJ 1ETVA 2FD5A 1RR7A 2HXIA 5EDNA 1APLC 1GV2A 1WH7A 1RETA 1ZK8A 2LVSA 3HM5A 2DN0A 4BY1J 2R92J 2DA6A 3TW6A 2Y9ZA 4B4CA 4DYCA 1X2MA 4IHXA 1JTXA 2YUSA 3O8GA 4AYBN 2EZKA 2JN6A 1MBJA 3FKIJ 3K2AA 4XRSA 4QTRA 5FKLA 3A01B 2CQXA 2DA7A 1JKRC 4QSHA 1I6HJ 4XICA 2EZLA 4JX6A 3L1PA 3ZQGA 3S16J 1JUPA 2JA7J 1Y1WJ 1NK3P 2X48A 1FIAA 1XC5A 2XB5A 1GDTA 2E2HJ 3IH3A 3ZQLA 3HBLA 1PUFA 3BQZA 2W48A 1MBHA 1VNDA 1I50J 3IH2A 3BTCA 1ETKA 3LSRA 2PMZN 1O4XA 5F0CA 2CRGA 1NK2P 5M5XJ 4I6ZA 2X9DA 4A3IJ 4XRSG 2CUEA 3SFIA 2ECCA 1JT0A 4I76A 2MGQA 3RKQA 4A3FJ 2Y30A 2DTZA 5F0FA 1ZGWA 3JRAA 3I4MJ 2Y9YA 1MBKA 2JA6J 3BG3A 9ANTA 1ZQ3P 1BW5A 4A3CJ 2MW8A 2K40A 1SFOJ 3CMYA 3HGYA 1AHDP 3B6AA 1LE8A 2VKVA 1LFUP 1Q1VA 2ZB9A 2CQQA 4B3AA 2M34A 3IH4A 3LOCA 1B8IB 4CYCB 4W97A 4C3JJ 5J1UA 1XS9A 3OIOA 1ENHA 2ID6A 2XPUA 3GBGA 1IRZA 2LLKA 5EZGA 2HOSA 1I3QJ 1JT6A 2K9NA 1VF9A 4UUSA 3S2DJ 1JKQC 4JX5A 3S15J 4UUTA 2XGEA 2TCTA 1P7IA 2ELKA 1MSEC 1MBEA 3HOYJ 3ZQCA 1IUFA 3DEWA 4Y7NJ 5M5YJ 3MKLA 2XRLA 3RQIA 1FIPA 1WGXA 3BTIA 2DJNA 3JRIA 2AHQA 1JKOC 3S2HJ 3W6VA 4JP0A 4FTHA 3JRFA 2DMTA 5EGOB 4X6AJ 1LFBA 4M6VA 2E2JJ 3S1MJ 2DMPA 4DW6A 1OCPA 2NOGA 1GV5A 2NS7A 1Z77A 5K7FA 1WI3A 2EZHA 4A3DJ 5IYBJ 2N8GA 3TEDA 1FEXA 3ZQHA 5GPAA 1H89C 1IC8A 2GLOA 2WAQN 1AU7A 4W1UA 4X1EA 1U9OA 1AKHB 4MIMA 4LOCA 3UKGA 1ZR4A 4FE4A 3B6CA 1HDPA 1JTYA 4A3MJ 1H8AC 3QPLA 1HDDC 1WH5A 4BXXJ 3PO3J 1IJWC 5EGOA 1U78A 5J1RA 2B63J 1OJLA 3CDLA 5C3EJ 5M3FJ 2D5VA 3LSPA 1P7JA 4A69C 3ZQIA 3SDGA 3GTMJ 5IYDJ 1OCTC 5IP6A 1FTTA 3G1LA 3F0CA 5IP9J 1MH4A 2HQ5A 3BT9A 4M3EA 1IDZA 2NVQJ 2DA4A 4FE7A 3JRDA 2HYJA 3GTJJ 2R5YB 2XGDA 5HODA 3OSGA 3C2BA 2VPRA 1NTCA 2IEKA 2R5ZA 2LD5A 1BW6A 4XRMA 1T56A 5K7HA 1JUSA 1ETXA 4A3BJ 3ZQFA 3JRGA 2O8KA 3JREA 1TWHJ 2LR8A 2NVXJ 5E3OA 3Q0UA 3GTPJ 1G2HA 4C2MJ 2AO9A 4BY7J 5E3NA 5FJ8J 1HLVA 1TC3C 3BR3A 3MVPA 5FKNA 3ZOBA 4C3HJ 2HDDA 1QVTA 2H8RA 4D7MA 5EF6A 4D5FA 3BR6A 3OSFA 2ECBA 4BBRJ 3K7AJ 4M3BA 4A3EJ 2KDZA 1D5YA 3HOZJ 2COBA 3HEFA 3QQAA 3BQYA 3LNQA 4XIDA 2EBIA 3QPSA 2DA3A 4ABZA 1K61A 2MSYA 3G1MA 1RPWA 4AC0A 2LP0A 1ZTRA 2WV1A 4MFEA 5IP7J 4A3JJ 2I10A 3IV5A 2XPWA 1QPIA 2R7ZJ 2LKXA 3TW7A 4EEFG 2QF7A 1MNMC 4AUXA 3CCYA 3BR2A 5F08A 5FKKA 3BR5A 2R0QC 3Q0WA 1PUFB 4IHYA 3HOUJ 2NVYJ 4RBOA 1IV6A 4G12A 1R9TJ 5GPCA 2CUFA 5J1YA 1ZKGA 2LTPA 3JRHA 1DU6A 2CJJA 2K9SA 3LSJA 3GTLJ 5J3LA 5C4JJ 4DZPA 3GTOJ 3NAUA 1MSFC 4M3DA 1TWFJ 5FLVA 3RZOJ 3WHBA 1RESA 2Y31A 1GT0C 4A3LJ 3S17J 1MBFA 5IOYA 2VKEA 3BTLA 2L7FP 2XSDC 2DA1A 3JR9A 1CQTA 5BNGA 2M0CA 4JX4A 4CYCA 1QVUA 1A6IA 2XB0X 1POGA 4BKXA 3HOXJ 4C3IJ 2DMUA 5JLXA 5C44J 5M3MJ 3JRCA 3FISA 1S7EA 4DZJA 3Q0VA 3OOUA 2IAIA 2OF7A 2H1KA 4Y52J 1BJZA 4J19A 2TRTA 3M4OJ 1DU0A 1U8BA 2Y0SN 3BG9A 3PM1A 2QCOA 3A03A 1JUMA 2LY9A 1TWGJ 4BBSJ 1GUUA 2ME6A 3S1RJ 4XK4A 1VI0A 4D7NA 3S1QJ 1B72B 5IPAA 1YRNB 1UHSA 5E3LA 2GM4A 2HOTA 4DYRA 3VPRA 1XG1A 2R93J 3S1NJ 5EG0B 4A93J 2FX0A 4L5EA 4NDLA 3BR1A 1F36A 1HOMA 2KT0A 4JYKA 3TP0A 2JA5J 1ITYA 3LSGA 1FJLA 2YU9J 1FTZA 3WHCA 1JJ6C 3H3VK 2M8GX 2GBYA 1JKPC 2L7MP 2YS9A 3A01A 2VI6A 2JMWA 3DCFA 1BA5A 2DA2A 2EQRA 5FKMA 2XPVA 3HOWJ 1X2NA 5FKOA 4A3GJ 3E7LA 1OFCX 3JRBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1HCR A;  3HDD A;  2DMN A;  2M9H A;  5FLM J;  3H0G J;  4IEJ A;  5EYR A;  1ORK A;  4HNV A;  2X6O A;  2DA5 A;  4MO7 A;  5GP9 A;  4FIS A;  1TWA J;  1AKH A;  2RAE A;  3FIW A;  1X58 A;  2ID3 A;  1WCM J;  1A5J A;  3HKZ N;  1SAN A;  5DTD A;  5JLW A;  2MG4 A;  4MFD A;  5IYC J;  3CQZ J;  5DS9 A;  3FK6 A;  4IHW A;  3HOV J;  2FJ1 A;  5F27 A;  1U9N A;  2HXO A;  3D1N I;  4V2F A;  1MBG A;  3TP3 A;  3GTK J;  4S0H B;  3BR0 A;  4MLO A;  2NVT J;  2L0K A;  3BTJ A;  3M3Y J;  1RKW A;  1Y1V J;  5M5W J;  1VFC A;  2JA8 J;  1UG2 A;  2Y2Z A;  2NS8 A;  2OPT A;  3RZD J;  3A02 A;  1H88 C;  1W0T A;  4B1R A;  4DYQ A;  2CU7 A;  2ME0 A;  4V2G A;  3GTQ J;  5EEA A;  2E1O A;  2JJ7 A;  3MN2 A;  2HI3 A;  2L9R A;  4A3K J;  1UMQ A;  1QRY A;  5F04 A;  3FK7 A;  3GTG J;  1ETY A;  5F0H A;  2XGC A;  1Z0X A;  5EG0 A;  4M3G A;  4UUS B;  1HF0 A;  4GFB A;  1ETQ A;  4D5C A;  3I4N J;  2R5Z B;  2JK3 A;  3NAR A;  2IBD A;  1JGG A;  1YRN A;  1RKT A;  1B72 A;  2L7Z A;  1IG7 A;  1IGN A;  1WPK A;  2R5Y A;  1B8I A;  3HB9 A;  2VUM J;  1W0U A;  1EF4 A;  5F1J A;  1LE8 B;  2O9L A;  2HOA A;  1JJ8 C;  1GVD A;  5K7Z A;  2E19 A;  4M3F A;  2M2E A;  3G1O A;  2O7O A;  4FCY A;  3O8H A;  3S14 J;  4QIW N;  1BL0 A;  5E3M A;  2E2I J;  2P81 A;  1K83 J;  3Q3S A;  2WB1 N;  2FQ4 A;  3HGG A;  1IDY A;  2LFB A;  1ETW A;  5EZH A;  1F43 A;  3BG5 A;  1MH3 A;  3PO2 J;  2LK2 A;  2JWT A;  1T33 A;  2K9Q A;  4IHV A;  1ETO A;  1E3O C;  1ZR2 A;  2EZI A;  5IOZ A;  3SJM A;  4RDU A;  5C4X J;  2G0E A;  2DMQ A;  2EH3 A;  1TWC J;  1ETV A;  2FD5 A;  1RR7 A;  2HXI A;  5EDN A;  1APL C;  1GV2 A;  1WH7 A;  1RET A;  1ZK8 A;  2LVS A;  3HM5 A;  2DN0 A;  4BY1 J;  2R92 J;  2DA6 A;  3TW6 A;  2Y9Z A;  4B4C A;  4DYC A;  1X2M A;  4IHX A;  1JTX A;  2YUS A;  3O8G A;  4AYB N;  2EZK A;  2JN6 A;  1MBJ A;  3FKI J;  3K2A A;  4XRS A;  4QTR A;  5FKL A;  3A01 B;  2CQX A;  2DA7 A;  1JKR C;  4QSH A;  1I6H J;  4XIC A;  2EZL A;  4JX6 A;  3L1P A;  3ZQG A;  3S16 J;  1JUP A;  2JA7 J;  1Y1W J;  1NK3 P;  2X48 A;  1FIA A;  1XC5 A;  2XB5 A;  1GDT A;  2E2H J;  3IH3 A;  3ZQL A;  3HBL A;  1PUF A;  3BQZ A;  2W48 A;  1MBH A;  1VND A;  1I50 J;  3IH2 A;  3BTC A;  1ETK A;  3LSR A;  2PMZ N;  1O4X A;  5F0C A;  2CRG A;  1NK2 P;  5M5X J;  4I6Z A;  2X9D A;  4A3I J;  4XRS G;  2CUE A;  3SFI A;  2ECC A;  1JT0 A;  4I76 A;  2MGQ A;  3RKQ A;  4A3F J;  2Y30 A;  2DTZ A;  5F0F A;  1ZGW A;  3JRA A;  3I4M J;  2Y9Y A;  1MBK A;  2JA6 J;  3BG3 A;  9ANT A;  1ZQ3 P;  1BW5 A;  4A3C J;  2MW8 A;  2K40 A;  1SFO J;  3CMY A;  3HGY A;  1AHD P;  3B6A A;  1LE8 A;  2VKV A;  1LFU P;  1Q1V A;  2ZB9 A;  2CQQ A;  4B3A A;  2M34 A;  3IH4 A;  3LOC A;  1B8I B;  4CYC B;  4W97 A;  4C3J J;  5J1U A;  1XS9 A;  3OIO A;  1ENH A;  2ID6 A;  2XPU A;  3GBG A;  1IRZ A;  2LLK A;  5EZG A;  2HOS A;  1I3Q J;  1JT6 A;  2K9N A;  1VF9 A;  4UUS A;  3S2D J;  1JKQ C;  4JX5 A;  3S15 J;  4UUT A;  2XGE A;  2TCT A;  1P7I A;  2ELK A;  1MSE C;  1MBE A;  3HOY J;  3ZQC A;  1IUF A;  3DEW A;  4Y7N J;  5M5Y J;  3MKL A;  2XRL A;  3RQI A;  1FIP A;  1WGX A;  3BTI A;  2DJN A;  3JRI A;  2AHQ A;  1JKO C;  3S2H J;  3W6V A;  4JP0 A;  4FTH A;  3JRF A;  2DMT A;  5EGO B;  4X6A J;  1LFB A;  4M6V A;  2E2J J;  3S1M J;  2DMP A;  4DW6 A;  1OCP A;  2NOG A;  1GV5 A;  2NS7 A;  1Z77 A;  5K7F A;  1WI3 A;  2EZH A;  4A3D J;  5IYB J;  2N8G A;  3TED A;  1FEX A;  3ZQH A;  5GPA A;  1H89 C;  1IC8 A;  2GLO A;  2WAQ N;  1AU7 A;  4W1U A;  4X1E A;  1U9O A;  1AKH B;  4MIM A;  4LOC A;  3UKG A;  1ZR4 A;  4FE4 A;  3B6C A;  1HDP A;  1JTY A;  4A3M J;  1H8A C;  3QPL A;  1HDD C;  1WH5 A;  4BXX J;  3PO3 J;  1IJW C;  5EGO A;  1U78 A;  5J1R A;  2B63 J;  1OJL A;  3CDL A;  5C3E J;  5M3F J;  2D5V A;  3LSP A;  1P7J A;  4A69 C;  3ZQI A;  3SDG A;  3GTM J;  5IYD J;  1OCT C;  5IP6 A;  1FTT A;  3G1L A;  3F0C A;  5IP9 J;  1MH4 A;  2HQ5 A;  3BT9 A;  4M3E A;  1IDZ A;  2NVQ J;  2DA4 A;  4FE7 A;  3JRD A;  2HYJ A;  3GTJ J;  2R5Y B;  2XGD A;  5HOD A;  3OSG A;  3C2B A;  2VPR A;  1NTC A;  2IEK A;  2R5Z A;  2LD5 A;  1BW6 A;  4XRM A;  1T56 A;  5K7H A;  1JUS A;  1ETX A;  4A3B J;  3ZQF A;  3JRG A;  2O8K A;  3JRE A;  1TWH J;  2LR8 A;  2NVX J;  5E3O A;  3Q0U A;  3GTP J;  1G2H A;  4C2M J;  2AO9 A;  4BY7 J;  5E3N A;  5FJ8 J;  1HLV A;  1TC3 C;  3BR3 A;  3MVP A;  5FKN A;  3ZOB A;  4C3H J;  2HDD A;  1QVT A;  2H8R A;  4D7M A;  5EF6 A;  4D5F A;  3BR6 A;  3OSF A;  2ECB A;  4BBR J;  3K7A J;  4M3B A;  4A3E J;  2KDZ A;  1D5Y A;  3HOZ J;  2COB A;  3HEF A;  3QQA A;  3BQY A;  3LNQ A;  4XID A;  2EBI A;  3QPS A;  2DA3 A;  4ABZ A;  1K61 A;  2MSY A;  3G1M A;  1RPW A;  4AC0 A;  2LP0 A;  1ZTR A;  2WV1 A;  4MFE A;  5IP7 J;  4A3J J;  2I10 A;  3IV5 A;  2XPW A;  1QPI A;  2R7Z J;  2LKX A;  3TW7 A;  4EEF G;  2QF7 A;  1MNM C;  4AUX A;  3CCY A;  3BR2 A;  5F08 A;  5FKK A;  3BR5 A;  2R0Q C;  3Q0W A;  1PUF B;  4IHY A;  3HOU J;  2NVY J;  4RBO A;  1IV6 A;  4G12 A;  1R9T J;  5GPC A;  2CUF A;  5J1Y A;  1ZKG A;  2LTP A;  3JRH A;  1DU6 A;  2CJJ A;  2K9S A;  3LSJ A;  3GTL J;  5J3L A;  5C4J J;  4DZP A;  3GTO J;  3NAU A;  1MSF C;  4M3D A;  1TWF J;  5FLV A;  3RZO J;  3WHB A;  1RES A;  2Y31 A;  1GT0 C;  4A3L J;  3S17 J;  1MBF A;  5IOY A;  2VKE A;  3BTL A;  2L7F P;  2XSD C;  2DA1 A;  3JR9 A;  1CQT A;  5BNG A;  2M0C A;  4JX4 A;  4CYC A;  1QVU A;  1A6I A;  2XB0 X;  1POG A;  4BKX A;  3HOX J;  4C3I J;  2DMU A;  5JLX A;  5C44 J;  5M3M J;  3JRC A;  3FIS A;  1S7E A;  4DZJ A;  3Q0V A;  3OOU A;  2IAI A;  2OF7 A;  2H1K A;  4Y52 J;  1BJZ A;  4J19 A;  2TRT A;  3M4O J;  1DU0 A;  1U8B A;  2Y0S N;  3BG9 A;  3PM1 A;  2QCO A;  3A03 A;  1JUM A;  2LY9 A;  1TWG J;  4BBS J;  1GUU A;  2ME6 A;  3S1R J;  4XK4 A;  1VI0 A;  4D7N A;  3S1Q J;  1B72 B;  5IPA A;  1YRN B;  1UHS A;  5E3L A;  2GM4 A;  2HOT A;  4DYR A;  3VPR A;  1XG1 A;  2R93 J;  3S1N J;  5EG0 B;  4A93 J;  2FX0 A;  4L5E A;  4NDL A;  3BR1 A;  1F36 A;  1HOM A;  2KT0 A;  4JYK A;  3TP0 A;  2JA5 J;  1ITY A;  3LSG A;  1FJL A;  2YU9 J;  1FTZ A;  3WHC A;  1JJ6 C;  3H3V K;  2M8G X;  2GBY A;  1JKP C;  2L7M P;  2YS9 A;  3A01 A;  2VI6 A;  2JMW A;  3DCF A;  1BA5 A;  2DA2 A;  2EQR A;  5FKM A;  2XPV A;  3HOW J;  1X2N A;  5FKO A;  4A3G J;  3E7L A;  1OFC X;  3JRB A; 
#chains in the Genus database with same CATH topology
 4E7I A;  3HDD A;  2DMN A;  2ADU A;  2A6E F;  2EA2 A;  5FLM J;  1FOY A;  3BPV A;  4IEJ A;  2DO7 A;  1ORK A;  4HNV A;  4B48 A;  2HZT A;  2ZME C;  4DBR A;  4FIS A;  2PG4 A;  1TWA J;  3E0J B;  3I59 A;  3WG7 H;  1AKH A;  2RAE A;  1X58 A;  2R7Q A;  2HTS A;  3F8B A;  4F7Z A;  2M45 A;  2V1N A;  3ABT A;  4P1W A;  2V1U A;  2JSP A;  2MG4 A;  1FBU A;  3FK6 A;  1SEU A;  1YW9 A;  4CCJ A;  3ONQ A;  3HJE A;  3HOV J;  3LSI A;  3D1N I;  3TP3 A;  3S3M A;  1HXD A;  4S0H B;  2DFH A;  2OD5 A;  2NVT J;  2B0L A;  5IY5 H;  2W85 A;  3HHH A;  2H8W A;  3E97 A;  4XKC A;  2QUF A;  1RKW A;  1Y1V J;  3L00 A;  5M5W J;  5LFA A;  3DTK A;  2Y2Z A;  5H2F C;  1TW3 A;  4S04 A;  3EQL F;  2EV5 A;  2CU7 A;  4D0P A;  3WU0 A;  2Z33 A;  3H5N A;  4EGZ A;  1BM9 A;  4O6J A;  4KN7 X;  4ETS A;  1X4P A;  3R60 A;  2E1O A;  3MN2 A;  1J9I A;  1FMW A;  2HI3 A;  2V9V A;  1G59 A;  1U6G A;  4QPO A;  4FX4 A;  3S3N A;  1R36 A;  3FDY A;  2JQ7 A;  1STZ A;  5F04 A;  2V9K A;  3FK7 A;  4U87 A;  4M6X A;  4BEH A;  1R6R A;  3GTG J;  3G73 A;  2VJ4 A;  5D5U B;  4AID A;  3L2V A;  4PJM A;  3CC7 I;  1HF0 A;  1I3A A;  3OS2 A;  3L2W A;  2RN7 A;  1H9T A;  2CGP A;  2O0Y A;  1LDK B;  2R3S A;  2LH9 A;  1WPK A;  2K9M A;  4B3X A;  4EAT A;  3Q9V A;  4O3M A;  1ZN2 A;  1FC3 A;  5BPI A;  1ZH5 A;  4NUB A;  1VQK I;  3DKW A;  5BPD A;  4NC7 A;  1JJ8 C;  1OCO H;  4RLQ A;  1YX5 A;  4P55 A;  4M3F A;  2WC2 A;  3KP3 A;  3G1O A;  4JQF A;  4LLL A;  2O7O A;  4FCY A;  1XMX A;  3IC7 A;  2IA2 A;  1MJB A;  3QU3 A;  5E3M A;  1Y56 A;  2HTJ A;  1KQ9 A;  1VQO I;  1QNT A;  1MMG A;  3VYU B;  2ZJQ F;  2V1D A;  3P7N A;  2TDX A;  4KUM A;  3B73 A;  1WJC A;  5K5O A;  1T33 A;  1ETO A;  3K6G A;  4WXC A;  3CD6 I;  4A6E A;  1R1V A;  1B6A A;  3SJM A;  2G0E A;  2EH3 A;  1ETV A;  1RR7 A;  2CYY A;  1R4N B;  1RNL A;  3LSH A;  4UB8 C;  5D8K B;  5EDN A;  4PFP A;  3QYB A;  1APL C;  3H5A A;  2Q8K A;  2LVS A;  2MC4 A;  4YIR X;  3QRF F;  2CW0 F;  1V4R A;  2DA6 A;  3K1N A;  1S5L C;  2Y9Z A;  1U5T A;  3CJR B;  4RGR A;  2LC2 A;  2IGK A;  1LDD A;  3OYN A;  3OYH A;  3O8G A;  1OCZ H;  1XGM A;  1IZ1 A;  1C0W A;  3JCU C;  4X0G A;  3F23 A;  4XRS A;  2JVG A;  3MFK A;  1YLF A;  4FAS D;  4HF0 A;  3LA2 A;  2QEX I;  1JKR C;  4XBF A;  1XSX A;  4HAM A;  1IXS B;  1UEL B;  4UHT A;  4CH7 A;  4OAZ A;  4XKB A;  5GTI C;  3QPT A;  4E7L A;  3RPU A;  2VT3 A;  5ED4 A;  2XB5 A;  1AWC A;  5ICF A;  4GRI A;  4KN4 X;  2E2H J;  4I2O A;  2DI3 A;  2DCE A;  2G7H A;  3FZV A;  3MCZ A;  1NG7 A;  4NHJ A;  2CUZ A;  4ZJZ A;  3IH2 A;  3BTC A;  1ETK A;  3QPH A;  3LSR A;  3CME I;  2O5R A;  3VEP A;  1O4X A;  5F0C A;  4YFK F;  3F8M A;  1NK2 P;  3LSM A;  4XOR A;  2V6C A;  1S3J A;  4A3I J;  4XRS G;  1Z9C A;  2CUE A;  3DPT A;  3SFI A;  2DBB A;  5J6X A;  3LAJ A;  1HSJ A;  5HDK A;  1JT0 A;  4RGU A;  1TW2 A;  2ICW G;  2DXI A;  3ESW B;  1J09 A;  2HNH A;  3FM3 A;  1E3H A;  3DWL E;  1YO5 C;  3CC4 I;  1BN5 A;  2A6T A;  3J7A Y;  3BJO A;  5HS7 A;  4AYB A;  3M8F A;  1BOA A;  1ZGW A;  3CP8 A;  3JRA A;  3F22 A;  3I4M J;  2Z1D A;  2UV1 A;  4Z6Y A;  3BG3 A;  4BJT A;  4BGD A;  9ANT A;  3A2K A;  1D5V A;  4XOP A;  2E36 A;  5HNH A;  1ZQ3 P;  4II3 A;  2I5U A;  2HQN A;  4MEX F;  1BW5 A;  2MW8 A;  3CCJ I;  2E1M C;  1LE8 A;  3JW4 A;  1TZL A;  2R7W A;  4DIQ A;  3MKY B;  2PMU A;  4LLG F;  1LFU P;  2GOX B;  1Q1V A;  3DEU A;  4G8X A;  2CQQ A;  3OL4 A;  4B3A A;  3TDZ C;  1XPX A;  4W97 A;  4IX7 A;  1XS9 A;  3K2Z A;  3HRU A;  2IS4 A;  1ENH A;  2IS1 A;  2STW A;  1IRZ A;  4QPQ A;  4CIC A;  1I3Q J;  2QEN A;  3IL2 A;  4KMU X;  3DU5 A;  1BJA A;  5ICC A;  4CHU A;  4UUS A;  5JFR A;  4BH9 A;  2XGE A;  1P7I A;  3IRR A;  2ZC2 A;  4E7K A;  4L0Z B;  1ZG1 A;  3QAH A;  3CMA I;  1Z3Y A;  3E1S A;  4YEL A;  1PUE E;  4BHP A;  1QQI A;  3HL2 A;  3HUG B;  5LD2 C;  1E3P A;  1FIP A;  1WGX A;  4E7H A;  3JRI A;  3GFJ A;  3IKV A;  4PGG A;  1JKO C;  2B7E A;  3W6V A;  4XNF A;  2KQR A;  3ABL H;  2R7T A;  3M8E A;  1LFP A;  1OLT A;  1QZE A;  4HV5 A;  2NOG A;  5D6F A;  4UV8 A;  3K4J A;  3ZMT A;  1PJR A;  2DT7 B;  1VQM I;  3ROU A;  2OUM A;  3KYD B;  2LMD A;  4A3D J;  4NQW A;  1UST A;  2K9L A;  3TED A;  4MTE A;  4M9S A;  3ZQH A;  2G9W A;  5HLT A;  1AU7 A;  2D1H A;  2MYS A;  4BU2 A;  1Y8Q B;  2KIF A;  2VB6 A;  1QO0 D;  4AVP A;  4NQW B;  2GA1 A;  2HKX A;  2Y0S A;  3RJP A;  3UKG A;  2ESN A;  3EPZ A;  1DGR M;  2FE3 A;  4FE4 A;  4CO8 A;  1IRX A;  2X1D A;  2VPL A;  3NEU A;  1JTY A;  3M7G A;  1ACI A;  4A3M J;  3CUQ B;  4IXA A;  4I02 A;  1OMI A;  3PO3 J;  4G7Z F;  1OJL A;  5C3E J;  1D1B A;  5M3F J;  1J7K A;  1P7J A;  3KP6 A;  4PFO A;  4ITV A;  4N4N B;  3HUG A;  1XN7 A;  3F0C A;  1K78 B;  2HQ5 A;  3AAF A;  3LWF A;  3PIP F;  1VQ5 I;  2DA4 A;  3BC8 A;  3GTJ J;  2R5Y B;  5A2Q K;  5K1Y A;  1ZRE A;  5HOD A;  3OSG A;  2VPR A;  4UY8 I;  1D0Y A;  1FBS A;  1NTC A;  5GTH C;  4KIF A;  2FOK A;  1ETX A;  1LVK A;  2QWW A;  3I56 I;  4A3B J;  3JRG A;  1VQ4 I;  3WE2 A;  1X19 A;  1I1S A;  2DOD A;  4C2M J;  5D6E A;  5E3N A;  5FJ8 J;  1TC3 C;  3BR3 A;  2OBP A;  4B8X A;  3ZOB A;  3BOQ A;  1EH8 A;  5J40 A;  1Z05 A;  2XAU A;  4L5I A;  4D7M A;  2Q1Z B;  3GXO A;  4RS8 A;  3E3V A;  3KET A;  1O3S A;  4HSR A;  4S05 A;  1HW1 A;  5B1A H;  1HBX G;  2K4J A;  3K4L A;  5KAI C;  2GOM A;  3SHF A;  1D5Y A;  2FF4 A;  4IL6 C;  3BQY A;  3PNT A;  2H6B A;  2XRN A;  4XID A;  5D4S A;  1X3W B;  4EJO A;  2ZBK A;  4EQQ A;  1K61 A;  2MSY A;  4AC0 A;  1V5E A;  4BDZ A;  4Q47 A;  3F6V A;  2LG4 A;  2WV1 A;  2DLL A;  5E8I A;  4MFE A;  1K79 A;  4K2E A;  2XPW A;  2R7Z J;  1SD7 A;  2LKX A;  4OIQ F;  1B4A A;  1MNM C;  1ULY A;  2HVQ A;  4AUX A;  4CCM A;  2EFP A;  3PJR A;  1R1U A;  3BR2 A;  4M9X A;  4BXF A;  4BJ6 C;  4WWC A;  3CF2 A;  4IHY A;  1WJE A;  1HQC A;  2ELH A;  2JRM A;  4M6Y A;  2F5C A;  1HKS A;  1IV6 A;  4G12 A;  5GPC A;  1WSU A;  3BZC A;  1UG0 A;  2LTP A;  3JRH A;  1WJB A;  2EWN A;  4HDU A;  1DU6 A;  3VYR B;  3DV8 A;  4XON A;  1D1C A;  1NG6 A;  3TMO A;  4HW0 A;  2BGC A;  3CCL I;  5BQT A;  1U5T B;  4LB5 A;  2V6E A;  1P92 A;  4M71 A;  2P5L C;  4FHT A;  3RZO J;  1WI9 A;  3T8T A;  4IKF A;  1OPC A;  4EM1 A;  4BL0 B;  1VQN I;  2KJB A;  3BTL A;  3KYC B;  2L7F P;  2QSF X;  4XN3 A;  2HVR A;  2M8E A;  3S32 A;  1TNS A;  5D8L B;  4XSZ F;  3RCO A;  3SXY A;  2QYO A;  1F4K A;  2DW4 A;  4KT6 A;  4RAG A;  4JX4 A;  2AS5 F;  1IN7 A;  1IXC A;  4LIV A;  4ZTJ A;  1WJ5 A;  2XDV A;  2ZO4 A;  3WTS C;  3FXK A;  5E17 F;  4C3I J;  1SVO A;  2W25 A;  3DBL B;  5BS6 A;  2JZY A;  1XCB A;  3L2R A;  5L3D A;  2PI0 A;  3AG3 H;  3ABU A;  5JVG F;  4CCK A;  2F5D A;  2HOE A;  4NBQ A;  1IUY A;  2IAI A;  2OF7 A;  4Y52 J;  2ZJR F;  3LFU A;  2FEZ A;  4J19 A;  1VQ9 I;  2LF7 A;  4BJ5 C;  3BJA A;  1L3L A;  1DU0 A;  3O3K A;  4BHB A;  2HU9 A;  3T8R A;  4BYY A;  5HLH A;  5D5V B;  2V1X A;  2EV0 A;  3LST A;  1OYY A;  4KIT B;  4RA2 A;  2VBX A;  3BRO A;  2W7N A;  4D7N A;  3S1Q J;  1Q1H A;  4LLN A;  1R71 A;  2GM4 A;  2HOT A;  5LHI A;  3J81 K;  3KEO A;  3S1N J;  2FQ3 A;  4UNO A;  4L0Y B;  2KP6 A;  3PSI A;  2VIX A;  2CG4 A;  3KEY A;  4JYK A;  1FWZ A;  4RB2 C;  1MMA A;  2JA5 J;  3LSG A;  3M1E A;  1HKQ A;  2RQP A;  1BR4 A;  1FP1 D;  4PGH A;  3GZ5 A;  1OCC H;  2M8G X;  2L7M P;  2WV0 A;  4RGS A;  1SVM A;  2RV8 A;  3A01 A;  2VI6 A;  1BA5 A;  2W84 A;  1AOY A;  2QGU A;  2GIV A;  2CV2 A;  2L02 A;  3E7L A;  1W5T A;  2JA6 J;  2VBW A;  5GAH J;  4HQE A;  2M9H A;  2FSW A;  5EYR A;  1B9N A;  3EUK L;  2DA5 A;  2O03 A;  4LB6 B;  4ZDP A;  4M73 A;  3HKZ N;  5LGT A;  5DTD A;  2AQF A;  4BAY A;  5CLS A;  3LMM A;  4XN0 A;  5F27 A;  2HXO A;  2DFF A;  4V2F A;  3GTK J;  3DQV C;  4NC8 A;  4XMY A;  3BR0 A;  4XQF A;  2KIM A;  3BTJ A;  3I3L A;  3KIO A;  4MTD A;  3M3Y J;  1IN4 A;  3E6C C;  2B9S A;  3VB2 A;  2ETH A;  4UV9 A;  1VFC A;  1Y0N A;  2BW3 A;  1UG2 A;  5KHD A;  2NS8 A;  1QHH D;  2FU4 A;  2JPB A;  2OPT A;  5KAF C;  5HS9 A;  3J81 Z;  2KIU A;  2QA4 I;  3FXJ A;  2L7K A;  1O7F A;  1XGN A;  4B1R A;  2BVL A;  2LRE A;  4DYQ A;  1T38 A;  4XR6 A;  3NWS A;  3G6E I;  3GTQ J;  2MD5 A;  2WAF A;  2JJ7 A;  2L9R A;  4A3K J;  1GVJ A;  4EJW A;  1OYW A;  1YW7 A;  3CJT B;  4AIJ A;  1EJ9 A;  1UMQ A;  1QRY A;  2ZME B;  4U88 A;  1BIB A;  3ERM A;  3M1C A;  2DK5 A;  5ILS A;  2HQR A;  4XLP F;  4XLH A;  5AIQ A;  4CXF A;  1OR7 A;  1Z0X A;  4F3Q A;  4OMY A;  1YS6 A;  2A68 F;  4HZF A;  3VDX A;  1I39 A;  4OMZ A;  2R5Z B;  3NAR A;  2IBD A;  1JGG A;  1FYL A;  1XGS A;  1T98 A;  1R58 A;  1YRN A;  2XKO A;  4PZJ A;  4E6K G;  1K4S A;  1B72 A;  2BY2 A;  3QOP A;  4BQN A;  5F1R A;  2QZ8 A;  3GCM A;  3LQQ A;  1GLN A;  4BNC A;  3HB9 A;  4GCV A;  1UB9 A;  2FRH A;  1D0Z A;  2VUM J;  1W0U A;  2UUZ A;  2J5O A;  3KEQ A;  3FMR A;  4HRI A;  1GVD A;  3OS0 A;  5K7Z A;  1KON A;  4BDY A;  2H27 A;  1IXR C;  1U2W A;  3RPU D;  3O8H A;  3S14 J;  4PUS A;  1K83 J;  3Q3S A;  4HDV A;  1ETW A;  1YQA A;  5DCF A;  2RC4 A;  2LK2 A;  2JWT A;  3QOD A;  4RAY A;  3E6D A;  3F6O A;  5EEH A;  1KYW A;  3CES A;  3LSK A;  4ENM A;  1TWC J;  1FSE A;  2RQQ A;  3ZP5 A;  2FD5 A;  2HXI A;  2CQK A;  3HM5 A;  2OQR A;  1K7A A;  4BY1 J;  4KIG A;  2H6C A;  4GXO A;  4WX9 A;  4C30 A;  3TW6 A;  3TGN A;  2QBY B;  4N4O B;  4MNU A;  3MD2 A;  4HA8 A;  1JTX A;  2YUS A;  3I4P A;  3WTZ A;  4AYB N;  2JN6 A;  1MBJ A;  3FKI J;  4EMS A;  1V3F A;  1S29 A;  2Q2E B;  2DA7 A;  1I6H J;  1HST A;  3C3W A;  2EZL A;  2DOE A;  2F4I A;  3L1P A;  3ZQG A;  3CMM A;  3P5J A;  3O2P E;  4Q4Z F;  1NK3 P;  2K5C A;  1TP4 A;  2H94 A;  2X48 A;  2Y48 A;  3RSN A;  3BP8 A;  3NWT A;  4HX4 A;  3IH3 A;  3ZQL A;  1O3Q A;  3HBL A;  3KFW X;  2W48 A;  3BQZ A;  4BQQ A;  4EM0 B;  1I50 J;  2KJC A;  4YIF A;  5CPR B;  2P8T A;  1XD7 A;  3COA C;  1RR8 C;  1T08 B;  2CWE A;  1PP7 U;  1SAU A;  1Z1D A;  5ILU A;  2C6Y A;  1KU3 A;  2E1N A;  2XUB A;  2ECC A;  2EFO A;  1Z3X A;  2RVC A;  3MAJ A;  1ZRC A;  3D5L A;  3H5R A;  4QWQ A;  2H1L A;  3OYM A;  2HEO A;  1GXQ A;  2MGQ A;  1MJ9 A;  1WRJ A;  1BC8 C;  2DTZ A;  2BXZ A;  3SZP A;  2X6X A;  5AIP A;  3CLO A;  3P9I A;  1KU2 A;  1MBK A;  1WJD A;  2A3S A;  2WAE A;  3FM5 A;  4RB0 A;  3ECO A;  1MMS A;  4HNU A;  2ZXJ A;  3PUB A;  4OWR B;  4A3C J;  1F9N A;  3ZXS A;  3CMY A;  4II2 A;  2IW5 A;  3SQN A;  5HDN A;  3I9V 2;  2ZXH A;  4KA4 A;  3ASN H;  3K9T A;  3TO9 A;  1JE8 A;  2Z9O A;  5J1U A;  3W2V A;  5HNF A;  2DPU A;  2EJR A;  2ID6 A;  2XPU A;  3ZMZ A;  3FXM A;  3GBG A;  5EZG A;  4RGX A;  3EUH C;  5LLQ A;  2K9N A;  2CQN A;  2X1E A;  4UUT A;  4WK8 F;  1WJA A;  1P4X A;  3BPX A;  4L5J A;  5H20 A;  1IUF A;  4G6D A;  5J8F A;  5CYV A;  3C18 A;  2EFN A;  2ZME A;  4OIN F;  5M5Y J;  1BI2 A;  4LJZ F;  4P9F A;  4N0B A;  3KP4 A;  2VOO A;  5F6F A;  2DJN A;  5CJ9 A;  2VOD A;  3RYP A;  3K0L A;  3S2H J;  2DDA A;  2QKL B;  2ZNZ A;  3JRF A;  5EGO B;  4ZYG A;  1F1Z A;  2F4O B;  1DPU A;  2AXT C;  4X6A J;  2BOL A;  4M6V A;  3RTR A;  2E2J J;  2ELJ A;  2MLK A;  1DPR A;  3I53 A;  4CGZ A;  1X4O A;  2FMY A;  3OYL A;  3ZMV A;  2Z99 A;  1O57 A;  3S8P A;  1RRJ A;  3BJ6 A;  4E70 A;  3OR2 C;  4WF2 A;  1FX7 A;  1JI8 A;  5JI6 A;  2CFO A;  1HA8 A;  5IYB J;  1S8N A;  2KL4 A;  1FEX A;  5GPA A;  1G4D A;  4DBQ A;  1RZ4 A;  2GIZ A;  1H89 C;  4HLX A;  2WA0 A;  4PSX A;  3RYR A;  2GLO A;  2OCC H;  2WAQ N;  4Y33 A;  4W1U A;  1XB4 A;  4X1E A;  3QYF A;  4U7B A;  1DUX C;  3BG7 A;  3E6M A;  3CDI A;  4L9J A;  2P0W A;  3IAS 2;  4HV6 A;  1ZR4 A;  2CUJ A;  3ZN1 A;  3BWG A;  2DOF A;  3ZQQ A;  4HF2 A;  2DQL A;  4G7H F;  1R00 A;  3CTA A;  3D0S A;  1ON1 A;  1G3Y A;  3I0T A;  1KQ0 A;  1U78 A;  3BCB A;  5J1R A;  2ZFU A;  5HDG A;  3CDL A;  4U7D A;  2O61 A;  2D5V A;  4AIK A;  4A0X A;  1BC7 C;  2QQ8 A;  3DKX A;  4MGR A;  5L3F A;  2E5Z A;  5DD4 A;  5IP6 A;  1FTT A;  2E7X A;  2VN2 A;  5BOX A;  1MH4 A;  2PJR A;  4FE7 A;  3JRD A;  3ERE D;  3KX2 A;  2GXB A;  3N05 A;  3FBN B;  1UHW A;  2M4G A;  4BQO A;  1IN6 A;  1MJA A;  2W00 A;  2R5Z A;  1BW6 A;  4XRM A;  2XSJ C;  3E6B A;  1JUS A;  4LD5 A;  4RAZ A;  4XLA A;  3J7Z I;  1G2H A;  3GVA A;  5L3E A;  3OY9 A;  1WWX A;  3MVP A;  1B59 A;  2A5Y B;  1QVT A;  3J7Y J;  3CUQ C;  3F72 A;  4UVA A;  1YYV A;  3PIO F;  1OR7 C;  2ECB A;  2GA2 A;  4B47 A;  1N77 A;  2KIS A;  4M3B A;  3FXQ A;  4A3E J;  2XVC A;  1K4T A;  2FUG 2;  2CFX A;  3HOZ J;  2KFD A;  3CCS I;  2BW3 B;  2NS0 A;  1FYK A;  2OCE A;  1EKE A;  2M7B A;  4A2U A;  4ESF A;  4ABZ A;  3CCV I;  2FML A;  4ZYE A;  1LPQ A;  2D2W A;  2VAS A;  4RMN A;  2P6S A;  2LP0 A;  1ZTR A;  4A3J J;  5IP7 J;  3C1D A;  4GDF A;  3R0J A;  3IV5 A;  2CV0 A;  4BXU A;  1IRG A;  1GHC A;  3WTV C;  1ONV A;  2JT1 A;  1OYI A;  3TOB A;  3HSE A;  4XL9 A;  1LQ1 A;  2NXN B;  2IS6 A;  5DD8 A;  5HOO A;  3GFI A;  1WKM A;  3CCY A;  5FKK A;  3WTX C;  2IT0 A;  4F93 B;  4ZYH A;  3Q0W A;  1PUF B;  1O3R A;  2CS3 A;  3HOU J;  3SEZ A;  1A35 A;  2NVY J;  5HLI A;  1R9T J;  3E5X A;  2VJI A;  1FT9 A;  5B66 C;  1XMA A;  1ZAR A;  3KLO A;  4F55 A;  2LYC A;  1BI0 A;  1P9Q C;  4WXH A;  1ZRF A;  1YG2 A;  3OYB A;  1S7A A;  4Q48 A;  2KHM A;  3NAU A;  2PBI A;  2W1O A;  1KQ8 A;  1XSD A;  2NYX A;  3D5S C;  3LA7 A;  3P9C A;  3W2W A;  3WHB A;  1GT0 C;  3MKZ A;  5FD5 A;  3DEE A;  3W3C A;  1ZLK A;  2VKE A;  2YX7 A;  1P6R A;  3GX4 X;  1T2K A;  4C2U A;  1CQT A;  5BNG A;  4KIC A;  4JBA A;  4CYC A;  3K4C A;  5E79 C;  1A6I A;  4G9Y A;  2LBF A;  3FXU A;  3V7C A;  3OYF A;  3HOX J;  2DMU A;  3K1P A;  4XLN F;  5JLX A;  3RPQ A;  2KZV A;  4KDP A;  4UVB A;  4LG0 B;  5GAG J;  5M3M J;  2IPQ X;  3OOU A;  3OOP A;  2EIJ H;  4LGW A;  2MH2 A;  4B09 A;  3FMQ A;  1H0M A;  1Y8R B;  2M30 A;  3DBR B;  4CA0 A;  1YI2 I;  3BG9 A;  3PSF A;  3S2W A;  3RKX A;  1FPQ A;  1YIJ I;  2YSR A;  3DKY A;  3U21 A;  1MIJ A;  3FXR A;  1QHG A;  2XGX A;  3RQ4 A;  5F64 A;  4HNT A;  3CCR I;  2ME6 A;  3K4M A;  3TDU C;  1SAX A;  4XK4 A;  1VI0 A;  3H92 A;  5E3L A;  3WG9 A;  3K69 A;  4G6T B;  2M4K A;  3VPR A;  1XG1 A;  2KRF A;  1DDN A;  5EG0 B;  4A93 J;  3HRM A;  3OS1 A;  2FX0 A;  2E7W A;  1HOM A;  3TP0 A;  2QQB A;  3OWT A;  3K70 C;  2IVM A;  5FRN A;  1SMY F;  5LHH A;  1OQY A;  2MA3 A;  4HOB A;  2GBY A;  5LEJ A;  1JKP C;  2YS9 A;  4E7S A;  3DCF A;  2LKS A;  5D5X B;  5FKM A;  3MZ8 A;  2NNY A;  3JSP A;  2PLY A;  4A3G J;  3M9A A;  3DTE A;  3C2G A;  5KNL A;  2NNN A;  3JRB A;  2GXA A;  3F8N A;  1IF1 A;  3AG4 H;  5CQE A;  1HC8 A;  5AON A;  5B5E C;  5GP9 A;  1O7L A;  2EA4 A;  2CV1 A;  1FSH A;  2K3P A;  2D1V A;  1WCM J;  4A0Z A;  1TBX A;  1TQM A;  3L2Q A;  2NOJ B;  1UZC A;  2GZW A;  4YEJ A;  3X2Q H;  4JOM A;  4MFD A;  5IYC J;  3CQZ J;  5DS9 A;  2GWR A;  2WAQ A;  2K86 A;  2MFZ A;  1OKR A;  4OU0 A;  1U9N A;  2P7V B;  4A5N A;  1MBG A;  3WTU C;  2HDC A;  4MLO A;  2L0K A;  3VOD A;  5DCM A;  1S9H A;  4ENJ A;  1J2X A;  2XV4 S;  3S93 A;  2BYV E;  2Y0M A;  4I0B A;  2BXY A;  1BBY A;  2DFE A;  4XRF A;  4DOZ A;  3A02 A;  2ME0 A;  4P96 A;  4V2G A;  2VJJ A;  5L3G A;  1DP7 P;  1TNT A;  4ZDO A;  4FQG A;  3W6J B;  2WY7 Q;  3F3X A;  4ZTF A;  1X1B A;  2E5N A;  1SFX A;  3R6S A;  2VON A;  5FD6 A;  5F0H A;  3M07 A;  2BVM A;  2KMU A;  2VLA A;  2FBK A;  2DT6 A;  2M3A A;  4UUS B;  3HSF A;  3R4K A;  3I4N J;  1IV8 A;  2OTJ I;  2JK3 A;  3I55 I;  5B1B H;  2R4G A;  5HVQ C;  2BBY A;  2R5Y A;  2WTE A;  3T1B A;  1EF4 A;  3I64 A;  1LE8 B;  2V4J C;  3FKJ A;  2O9L A;  3AKZ A;  4TV7 A;  3A0H C;  2H09 A;  3W2A A;  2L4M A;  2QSH X;  2E19 A;  3E5Q A;  5KCM A;  1YJW I;  2M2E A;  3MEX A;  1O3T A;  1N78 A;  1BR1 A;  2FNA A;  3I5U A;  3OYJ A;  3T0Y A;  3WU1 B;  1XSV A;  3CUQ A;  4QIW N;  2RRE A;  4WXD A;  2WB1 N;  2FQ4 A;  3HGG A;  3FHZ A;  2M1B A;  2LFB A;  3J80 Z;  3FX3 A;  2UWM A;  2G7U A;  1I27 A;  1TQI A;  2M87 A;  3BDD A;  3FHN A;  2Y69 H;  1MH3 A;  4GGG A;  1R7J A;  3IRQ A;  2UZK A;  1YS7 A;  3PO2 J;  3TO6 A;  2I8D A;  4AVZ A;  4IHV A;  3HRT A;  3WTW C;  4E7J A;  4A5M A;  5TGT A;  3HOT A;  5IOZ A;  4RDU A;  4EJT A;  3FF5 A;  5LEK A;  1IAW A;  2DMQ A;  5C4X J;  3L9F A;  3G4S I;  3GEZ A;  4G94 A;  4HX7 A;  4YRV A;  2HPI A;  3A4C A;  3DXJ F;  2XAG A;  5E18 F;  4J01 A;  2DN0 A;  3KZI C;  3IP4 B;  1YOV B;  4P9U A;  2ACJ A;  2R92 J;  3EDP A;  4B4C A;  3ABK H;  1X2M A;  4IHX A;  1XMK A;  2EIK H;  1X1P A;  1N25 A;  4M9Z A;  3K2A A;  2V26 A;  1EV7 A;  5FKL A;  2EPF A;  4F52 A;  3OR1 C;  4QSH A;  1MMD A;  3PNV A;  3G2B A;  3PUF A;  4GYI A;  4UUV A;  2JA7 J;  3KP5 A;  1SD5 A;  1EH6 A;  4IZZ A;  3CP2 A;  4MEY F;  5IT3 A;  1W7P A;  2E60 A;  1FIA A;  2XIG A;  2R7S A;  2PJP A;  1GDT A;  3HHG A;  5J47 A;  1Y6I A;  1GXP A;  4EV0 A;  3KLN A;  2PQ8 A;  3BZK A;  2BY0 A;  3BZ6 A;  3CO6 C;  4Y13 A;  2CRG A;  5M5X J;  4IOA F;  2E1C A;  2X9D A;  3KPH A;  3CDH A;  5KVR A;  2Z3Y A;  4LK1 F;  2QSG X;  3F8F A;  4LMY A;  1XCV A;  4JK1 X;  4XKV A;  2Y30 A;  4I09 A;  3OL3 A;  3CCE I;  5F0F A;  3QWL A;  2UXX A;  5LGN A;  2Y9Y A;  2IJL A;  3DPU A;  2F48 A;  3V42 A;  2DYS H;  2F4M B;  3KZZ A;  3U1D A;  5B3S H;  4EM2 A;  2A5W A;  1R23 A;  1USS A;  4LG0 A;  1SD6 A;  3ECH A;  2Y75 A;  1UCR A;  2KPM A;  4OOI A;  1KA8 A;  2K40 A;  3V8K A;  5LGU A;  1J59 A;  1SFO J;  3HGY A;  3B6A A;  2ZNY A;  2F5V A;  2VKV A;  3F9K A;  3H0D A;  5BMZ A;  4ZZD A;  1TT5 B;  3GLX A;  2M34 A;  3IH4 A;  3LOC A;  1D8K A;  5J8C A;  4CYC B;  2VE9 A;  1Z7L A;  4C3J J;  2E34 A;  1G8X A;  4ESB A;  4IHS A;  3F21 A;  5DM6 F;  1MGT A;  3O6B B;  4NB5 A;  1JT6 A;  3S15 J;  4JX5 A;  5HLG A;  2HPM A;  1QZZ A;  2M0M A;  2RNG A;  2TCT A;  2K4B A;  2DDB A;  3OMY A;  3ZQC A;  3TL4 X;  4BEH B;  5D4R A;  1DP3 A;  2BZT A;  3CC2 I;  1V5G A;  3RQI A;  4F92 B;  5GAE J;  2RDP A;  5K5R A;  4IJA A;  2FBI A;  5EEG A;  1A31 A;  2DMT A;  2K85 A;  1LFB A;  4HBL A;  3S1M J;  2DMP A;  1OCP A;  4LIT A;  1GV5 A;  2NS7 A;  4YG2 F;  1W5C C;  1Z77 A;  2DTR A;  2DYR H;  4RAF A;  2WY8 Q;  3HYI A;  5K7F A;  1WI3 A;  3S3O A;  2EZH A;  3KP7 A;  2N8G A;  1MD0 A;  1VQ7 I;  3REO A;  4OAY A;  2J5P A;  2VXD A;  3ZCO A;  1WVR A;  2X6W A;  1W36 D;  5LBQ A;  2OTL I;  3SZT A;  2F5E A;  3AG2 H;  5CQG A;  3WOD F;  1AKH B;  1LNW A;  2GXG A;  1Z21 A;  4PSW A;  1BR2 A;  4KFC A;  1S7O A;  3I58 A;  2LDU A;  2VQC A;  1HDP A;  2IGO A;  1VZ0 A;  4XKW A;  1EA3 A;  1H8A C;  3QPL A;  3V7R A;  1HDD C;  5E1W A;  2KZG A;  4BXX J;  1IJW C;  2B63 J;  4F91 B;  1Z6R A;  2IGM A;  3EUA A;  1JXS A;  3ZQI A;  1W5S A;  3SDG A;  2QM3 A;  5LRS A;  1YFH A;  3EUH A;  1QPM A;  2Z2S B;  1OCT C;  1WJF A;  1XDS A;  5IP9 J;  2WAD A;  1IDZ A;  2L5Q A;  2D45 A;  2NVQ J;  1LEB A;  4KIB A;  3N97 A;  2YPR A;  3HG9 A;  3PQJ A;  5TIS C;  1WZ2 A;  2HYG D;  3QP5 A;  3C2B A;  1REP C;  1V5F A;  3H1C A;  2ISY A;  1XX5 A;  2K27 A;  2LD5 A;  3U1K A;  2X4H A;  4ZYD A;  2CO5 A;  5K7H A;  2KIQ A;  2BEO A;  2L9S A;  3BY6 A;  5FFZ A;  3ZQF A;  4DGW B;  5JHU A;  1QBJ A;  3CCQ I;  2LR8 A;  2NVX J;  4A0Y A;  3WGG A;  5FFX A;  2FOW A;  2AO9 A;  4XLE A;  3ML6 A;  4YFX F;  1HLV A;  1SFE A;  5LRR A;  5ILV A;  4YII A;  4KNY A;  5JVT A;  1X1C A;  2H8R A;  5EF6 A;  1ZRD A;  3ELK A;  2L9N A;  2HZD A;  3HXL A;  4D5F A;  5GAD J;  3EYI A;  3BR6 A;  2WBM A;  4L18 B;  4I98 B;  2WWY A;  4Y17 A;  4BBR J;  2W57 A;  5FGM A;  2KDZ A;  1BI3 A;  1MND A;  2A6H F;  3GZN B;  3CCU I;  3LNQ A;  5TRD A;  1T0F C;  1A04 A;  3OYD A;  2KKO A;  4L9N A;  4A6D A;  4HQM A;  4EJU A;  3G1M A;  1RPW A;  2PN6 A;  1Z67 A;  4XLC A;  4D1Q A;  2I10 A;  1Y39 A;  1RC9 A;  1QU3 A;  4I01 A;  2YX4 A;  2VC1 A;  1LDJ A;  1E0E A;  2VJ5 A;  3TW7 A;  4EEF G;  2FA5 A;  2M5W A;  3JAM Z;  4MQ9 F;  3OYI A;  3WGH A;  3KCC A;  2QF7 A;  3K10 A;  1L0O C;  1I1G A;  3I59 B;  3GLL A;  3H3Z A;  1FP2 A;  1S72 I;  3HOS A;  4CYD A;  3SDB A;  3F8C A;  1Z7U A;  5DEQ A;  2LF8 A;  2ZJ2 A;  2P5V A;  1W7P B;  1IO2 A;  3RKW A;  1TL8 A;  2K3F A;  3ISP A;  3ZN0 A;  3GYH X;  1FOX A;  2CUF A;  2COM A;  5A2Q Z;  5J1Y A;  2OZ6 A;  2ZJP F;  3VYT B;  4IRI A;  4RLF A;  3ABM H;  2MC3 A;  2JUC A;  4AIH A;  2CJJ A;  1U0J A;  1X1D A;  3LSJ A;  3GTL J;  5J3L A;  4OIO F;  5C4J J;  4DZP A;  1DGW Y;  1X3U A;  4BE1 A;  2A07 F;  2AQE A;  1UAA A;  1R4M B;  1TWF J;  3PL8 A;  4LIU A;  3HSR A;  2K7L A;  4B43 A;  4A3L J;  2Y31 A;  4PJL A;  2BY3 A;  3S17 J;  3B02 A;  3OYA A;  2XC7 A;  3GFL A;  5H6R A;  2CMP A;  1YJN I;  3I54 A;  1RI7 A;  4WCG A;  2XB0 X;  1YHQ I;  1POG A;  1ZG5 A;  2XAH A;  3TQN A;  4BKX A;  1Z91 A;  3DLL F;  1XTA A;  1VQ6 I;  1LUJ B;  3RI4 A;  4I0A A;  3FIS A;  3JRC A;  1WHU A;  1ZG3 A;  3IHU A;  4DZJ A;  3KYL A;  3MMY B;  3Q0V A;  1MNE A;  3AFH A;  3WGI A;  2H1K A;  4RB3 C;  1BJZ A;  4LK0 F;  4QLC U;  2TRT A;  3M4O J;  1PP8 F;  1U8B A;  1VQP I;  2Y0S N;  1HW5 A;  2V79 A;  3GFM A;  2QCO A;  1CF7 B;  2BY1 A;  2BHY A;  3BG6 A;  3DTI A;  2LY9 A;  2K02 A;  4BBS J;  3GO5 A;  3S1R J;  4CZZ A;  1JGS A;  4ZC3 A;  2STT A;  2LSO A;  5IPA A;  3U2R A;  1UHS A;  2EFQ A;  2W82 A;  1K6O A;  3ASO H;  1YTY A;  4DYR A;  3FXL A;  3L09 A;  4NNJ A;  2R93 J;  1FYM A;  3SZG A;  4IRG A;  1P4W A;  4L5E A;  4NDL A;  4Q5S F;  1F36 A;  1R5G A;  3DF8 A;  2KT0 A;  2QKM B;  2RNJ A;  2GAU A;  1ITY A;  2DK8 A;  2EFW A;  4EGY A;  2VT2 A;  3WHC A;  1JJ6 C;  3OV8 A;  1FJL A;  2YU9 J;  3FBI B;  1AA7 A;  4HST A;  3H3V K;  2HYF A;  1D1A A;  3QU6 A;  4AWX B;  1YE9 A;  3QYE A;  3K4B A;  3QP6 A;  1R1T A;  2FXA A;  2FNP A;  5E8G A;  3HOW J;  1X2N A;  5FKO A;  2IA1 A;  3GZ6 A;  1UFM A;  1PYV A;  3L7W A;  2QBY A;  4ON0 A;  2VBZ A;  5K5Q A;  4ESJ A;  1HCR A;  1ZAO A;  3IAM 2;  3FWE A;  2EV6 A;  3H0G J;  3VFZ A;  3WE3 A;  5DCM B;  2JRT A;  2X6O A;  3VSL A;  3LFK A;  4MO7 A;  4EVI A;  2RKH A;  4CCL A;  3FIW A;  2ID3 A;  5FRM A;  3JSO A;  3ZMS A;  1A5J A;  1Y0U A;  2XKP A;  2HQA A;  1SAN A;  2HFH A;  5JLW A;  3OYE A;  1ZEL A;  2L01 A;  4C9Y A;  4G7O F;  4IHW A;  2VQL A;  2FJ1 A;  4BUP A;  2CW7 A;  4IPA A;  2NAZ A;  2VBY A;  1QGP A;  1R49 A;  2IXS A;  3PNY A;  3UNG C;  1H9G A;  2QVO A;  3CUO A;  3V8J A;  5L3B A;  2HVS A;  3RKY A;  2QLZ A;  2JA8 J;  4IO9 F;  2LY2 A;  4E7Z A;  3RZD J;  2VL8 A;  2IRF G;  3R61 A;  2EIN H;  2LRD A;  2R7O A;  2XAQ A;  1W0T A;  2VXZ A;  1H88 C;  4OIR F;  2X0L A;  3ZRG A;  5EEA A;  5DYM A;  3Q5F A;  2NRA C;  4PJJ A;  3PQK A;  3FMS A;  5DDG A;  3HPG A;  2L9V A;  2ZXW H;  4CZC A;  2R7V A;  3HRS A;  4UVC A;  1ETY A;  2HS5 A;  4FX0 A;  1HW2 A;  3OYK A;  2EIL H;  3DP7 A;  2XGC A;  4DQ2 A;  1MMN A;  5EG0 A;  4M3G A;  4CCN A;  4GFB A;  1ETQ A;  4D5C A;  2VQG A;  4PCQ A;  1P2F A;  1TT0 A;  1RKT A;  3P9K A;  1BI1 A;  2L7Z A;  1DQU A;  1IG7 A;  1IGN A;  4H4K C;  1B8I A;  1MDM B;  6PAX A;  1VQL I;  1T0F A;  3MKW B;  5F1J A;  1I5Z A;  1FY7 A;  3FXO A;  2HOA A;  3TBI A;  2XAJ A;  4I7H A;  5DUI A;  1FNN A;  1T6S A;  4ANJ A;  5E1X A;  1NHA A;  5CVV A;  3ULQ B;  1BL0 A;  2E2I J;  5DV5 A;  2P81 A;  2VQH A;  3MQ0 A;  1IDY A;  2ZSH B;  4EJV A;  1OIS A;  1A36 A;  5EZH A;  3V4G A;  1F43 A;  3BG5 A;  2OV7 A;  2MH9 A;  4BHC A;  2CH0 A;  3HC7 A;  2VC0 A;  1X3Z B;  3OIQ A;  2LBF B;  4L9T A;  2K9Q A;  2M7A A;  1E3O C;  4PK4 A;  1ZR2 A;  2PMH A;  3K4K A;  4RB1 A;  2EZI A;  3DBH B;  4KJZ A;  3U9G A;  5E20 A;  1J0R A;  2DPD A;  3SYT A;  1GV2 A;  4IF4 A;  1LKX A;  2O6G E;  1WH7 A;  1E17 A;  1RET A;  3ZPL A;  1ZK8 A;  3GWZ A;  4HPQ A;  5FO5 A;  2P4W A;  2HWV A;  5J4V A;  4DYC A;  2F5F A;  2XF7 A;  2LKP A;  3BLY A;  1UJ8 A;  4FT8 A;  1FBQ A;  2NVU B;  3HKZ A;  3J7A O;  3WU2 C;  2CSO A;  1R5I D;  2EZK A;  2R7F A;  4QTR A;  4BE2 A;  4H0E A;  4I99 C;  2CQX A;  5L3C A;  2BV6 A;  3A01 B;  2EK5 A;  4XLF A;  3MZY A;  4ZDL A;  4XIC A;  2XF5 A;  4JX6 A;  4R1H A;  3S16 J;  1JUP A;  1RIO H;  1Y1W J;  1YX3 A;  3KP2 A;  3HTU A;  1B9M A;  2Z16 A;  3LAP A;  1XC5 A;  4BS9 A;  2V7F A;  1JHF A;  1ZHF A;  2E1M B;  3TKY A;  2PX9 A;  3VYS B;  1ZYR F;  1PUF A;  1MBH A;  1VND A;  4A12 A;  4PDK A;  1LB2 A;  1ERD A;  5J4Y A;  5FLX K;  2PMZ N;  1WQ2 A;  2HGC A;  1ZGA A;  1U5T C;  5DM7 F;  5HS8 A;  2O3F A;  2JPC A;  4MHG A;  4I6Z A;  3VWB A;  2L4A A;  2R7U A;  1TQP A;  1G3W A;  1LEA A;  4I76 A;  2WB1 A;  1T39 A;  3EET A;  2X85 A;  4UB6 C;  3G71 I;  3RKQ A;  1KU7 A;  4A3F J;  1YW8 A;  3A0B C;  4RM2 A;  5CKT A;  1W7P D;  3GF2 A;  4AM3 A;  3GW2 A;  3SEQ A;  3IKT A;  4IVN A;  1U3E M;  5CVJ A;  2MBF A;  2XHK A;  1AHD P;  1T8I A;  4J00 A;  1W1W E;  3BCA A;  1EH7 A;  5ICE A;  2ZB9 A;  2OQG A;  2L2O A;  1MDM A;  2XRO A;  1B8I B;  3OIO A;  2DT5 A;  4KMF A;  1FZP B;  2LLK A;  4M74 A;  3H3U A;  2HOS A;  1TTY A;  1YIO A;  3UR3 C;  5CVI A;  1VF9 A;  3S2D J;  3C2H A;  1JKQ C;  4IRH A;  2CQ7 A;  1KGS A;  2ELK A;  4N9H A;  1MSE C;  1MBE A;  2ISZ A;  2A61 A;  1SVL A;  3D5R C;  4PJN A;  3HOY J;  3DEW A;  2PJR B;  3CZ6 A;  2ZCW A;  4Y7N J;  1RUN A;  1WFX A;  1XGO A;  2XRL A;  1TLH B;  3MKL A;  5E1Z B;  1ZLJ A;  3HIF A;  3WTY C;  3BTI A;  3V8L A;  2DJI A;  3H9Q A;  2AHQ A;  1KU9 A;  2HKO A;  4JP0 A;  4FTH A;  3AL0 C;  1P4A A;  3CLQ A;  4XSX F;  4CCO A;  3JTG A;  4ZYA A;  2KDO A;  1I6X A;  2VKD A;  1YIT I;  2KRH A;  2P7C B;  1ODD A;  3G3Z A;  2UXN A;  4DW6 A;  2CW8 A;  4BAC A;  2FBH A;  3KZY A;  1G3T A;  3A1Y A;  2BHZ A;  1U8R A;  3ZGK A;  4IQJ A;  2BE5 F;  3RIR A;  1IC8 A;  2X6Y A;  4PJ0 C;  2V9P A;  2QQA A;  4Y3O A;  4L9V A;  4U0V A;  3NRV A;  2LOO A;  1U9O A;  4MIM A;  1QA6 A;  4LOC A;  4Y15 A;  5CVR A;  4LG3 A;  2R7X A;  2X1C A;  3WTT C;  1FOK A;  1VQ8 I;  3DPL C;  3Q9S A;  3B6C A;  4CSW A;  2JSC A;  3I71 A;  4HG2 A;  1XDU A;  1WH5 A;  1D3Y A;  1SFK A;  3J80 K;  5EGO A;  3GME A;  4B44 A;  3LSP A;  3IWZ A;  4M72 A;  3DU6 A;  4A69 C;  2DFI A;  3GTM J;  3IWF A;  5IYD J;  2KLO A;  2OC6 A;  4R8H A;  3G1L A;  1OCR H;  3HTS B;  3BT9 A;  2X51 A;  4M3E A;  3JTH A;  3ZQ7 A;  1J5Y A;  1MZB A;  5JR3 A;  3HPH A;  3HZJ A;  2HYJ A;  4KT5 C;  2XGD A;  5H6Q A;  1R22 A;  1ON2 A;  4N9I A;  3NQO A;  3DLA A;  4GO1 A;  2IEK A;  1E2X A;  2P6T A;  1T56 A;  3LQR A;  1VTN C;  2W4S A;  2XF6 A;  3JRE A;  2O8K A;  5IT9 K;  1TWH J;  2F2E A;  2IS2 A;  5FRO A;  2HR3 A;  5E3O A;  3Q0U A;  3GTP J;  3L2U A;  5ERI A;  1BOB A;  4AU7 A;  4BY7 J;  5JHF A;  4BE0 A;  1K78 A;  3K1M A;  5FKN A;  4C3H J;  4BQA A;  1BIA A;  3C7J A;  2HDD A;  3N4M A;  5TJJ A;  4AD9 A;  3VOE A;  5FB2 A;  1PVE A;  2PEX A;  4IQ4 A;  4V19 K;  4ENK A;  5IT9 Z;  4CUG A;  3OSF A;  1F5T A;  3W6K B;  3PFI A;  3K7A J;  1RUO A;  2MAB A;  1LVA A;  1MW7 A;  4Z2Y A;  2COB A;  3HEF A;  3QQA A;  2YR2 A;  2ESH A;  4U0Y A;  4KYW A;  2ZKZ A;  2EBI A;  2OZU A;  1W36 C;  3QPS A;  5D5W B;  2DA3 A;  4U0W A;  4O5V A;  1JHH A;  1SFU A;  2R7R A;  1FMV A;  2W24 A;  1QPI A;  2A05 A;  3H9J A;  2A69 F;  2RGV A;  2JVH A;  4C2T A;  3AG1 H;  5ICG A;  4R79 A;  2OU2 A;  4RM3 A;  1SMT A;  3OYC A;  1V54 H;  2YU3 A;  2PMZ A;  3KE2 A;  4KIS A;  4GYG A;  3K70 D;  3SFZ A;  5F08 A;  2EIM H;  1KZH A;  3BR5 A;  1YJ9 I;  2DAO A;  2R0Q C;  2IP2 A;  1IN5 A;  3M8J A;  2L54 A;  1K6Y A;  4DJA A;  3LA3 A;  4RBO A;  3CF5 F;  2Q0O A;  3T5X A;  4MQV A;  3TO7 A;  1ZKG A;  2VOP A;  2JTV A;  3CO7 C;  5EJC A;  1LJ9 A;  1IRF A;  2Q2E A;  4HYE A;  4D9J A;  3GUD A;  2F6C A;  3RDI A;  2K9S A;  4DNC A;  3H35 A;  4ZH4 F;  2L3D A;  1NH3 A;  3GTO J;  2JA2 A;  1MSF C;  2JUG A;  3TOA A;  1ZGJ A;  4M3D A;  5FLV A;  1S6L A;  1HKT A;  2EB7 A;  2IA0 A;  1M1E B;  1W4M A;  3VSK A;  1T95 A;  1PDN C;  1RES A;  2ZSI B;  1MBF A;  1R5H A;  5IOY A;  2VKH A;  3OIP A;  2P5K A;  1MKM A;  2XSD C;  2DA1 A;  3AL0 B;  4YFN F;  1J75 A;  3JR9 A;  4P5O A;  2QQ9 A;  4UXN A;  2R7D A;  4XOT A;  1QZY A;  2M0C A;  5FLX Z;  1QVU A;  4OIP F;  3V7S A;  3MZH A;  2VE8 A;  3QOE A;  2E71 A;  3CJN A;  1CF7 A;  2DQR A;  4HLY A;  2LNB A;  1FLI A;  4FET A;  4E4H A;  3L2C A;  5C44 J;  1FOW A;  3K4N A;  1N75 A;  3PFY A;  1SC7 A;  1S7E A;  3ZMD A;  3DFG A;  1IW7 F;  2OAZ A;  2ZFW A;  2XAF A;  2ZXI A;  1D0X A;  4HX8 A;  4CDG A;  1IN8 A;  2OA4 A;  2MD0 A;  4IOC F;  3PM1 A;  2OJE D;  2O8X A;  4IHT A;  1G3S A;  3A03 A;  2LY1 A;  1JUM A;  3H36 A;  5LHG A;  2E35 A;  1CGP A;  1TWG J;  3LL7 A;  4ZZL A;  1SD4 A;  1GUU A;  2DU9 A;  1X1A A;  3EYY A;  3MWM A;  2KRC A;  1B72 B;  2AXL A;  1YRN B;  2XAS A;  3H9G A;  4ENN A;  4HEA 2;  4G6Q A;  2PFB A;  3ZMU A;  4NC6 A;  4LFU A;  4Y4R A;  1D8J A;  3IUO A;  3OYG A;  4XM3 A;  3CJQ B;  2HDW A;  3ZR8 X;  1A6Q A;  3BR1 A;  3CCM I;  3E5U A;  3JAM K;  1FTZ A;  3R0A A;  5DUK A;  1B1B A;  4HF1 A;  5KK1 A;  2IGN A;  1V55 H;  1KYZ A;  2GQQ A;  2DOA A;  2JMW A;  1Z6T A;  2DA2 A;  5CVU A;  2EQR A;  2XPV A;  1G6N A;  2MLG A;  1UHM A;  2Z5U A;  4ASN A;  1OFC X; 
#chains in the Genus database with same CATH homology
 1HCR A;  3HDD A;  2DMN A;  2M9H A;  5FLM J;  3H0G J;  4IEJ A;  5EYR A;  1ORK A;  4HNV A;  2X6O A;  2DA5 A;  4MO7 A;  5GP9 A;  4FIS A;  1TWA J;  1AKH A;  2RAE A;  3FIW A;  1X58 A;  2ID3 A;  1WCM J;  1A5J A;  3HKZ N;  1SAN A;  5DTD A;  5JLW A;  2MG4 A;  4MFD A;  5IYC J;  3CQZ J;  5DS9 A;  3FK6 A;  4IHW A;  3HOV J;  2FJ1 A;  5F27 A;  1U9N A;  2HXO A;  3D1N I;  4V2F A;  1MBG A;  3TP3 A;  3GTK J;  4S0H B;  3BR0 A;  4MLO A;  2NVT J;  2L0K A;  3BTJ A;  3M3Y J;  1RKW A;  1Y1V J;  5M5W J;  1VFC A;  2JA8 J;  1UG2 A;  2Y2Z A;  2NS8 A;  2OPT A;  3RZD J;  3A02 A;  1H88 C;  1W0T A;  4B1R A;  4DYQ A;  2CU7 A;  2ME0 A;  4V2G A;  3GTQ J;  5EEA A;  2E1O A;  2JJ7 A;  3MN2 A;  2HI3 A;  2L9R A;  4A3K J;  1UMQ A;  1QRY A;  5F04 A;  3FK7 A;  3GTG J;  1ETY A;  5F0H A;  2XGC A;  1Z0X A;  5EG0 A;  4M3G A;  4UUS B;  1HF0 A;  4GFB A;  1ETQ A;  4D5C A;  3I4N J;  2R5Z B;  2JK3 A;  3NAR A;  2IBD A;  1JGG A;  1YRN A;  1RKT A;  1B72 A;  2L7Z A;  1IG7 A;  1IGN A;  1WPK A;  2R5Y A;  1B8I A;  3HB9 A;  2VUM J;  1W0U A;  1EF4 A;  5F1J A;  1LE8 B;  2O9L A;  2HOA A;  1JJ8 C;  1GVD A;  5K7Z A;  2E19 A;  4M3F A;  2M2E A;  3G1O A;  2O7O A;  4FCY A;  3O8H A;  3S14 J;  4QIW N;  1BL0 A;  5E3M A;  2E2I J;  2P81 A;  1K83 J;  3Q3S A;  2WB1 N;  2FQ4 A;  3HGG A;  1IDY A;  2LFB A;  1ETW A;  5EZH A;  1F43 A;  3BG5 A;  1MH3 A;  3PO2 J;  2LK2 A;  2JWT A;  1T33 A;  2K9Q A;  4IHV A;  1ETO A;  1E3O C;  1ZR2 A;  2EZI A;  5IOZ A;  3SJM A;  4RDU A;  5C4X J;  2G0E A;  2DMQ A;  2EH3 A;  1TWC J;  1ETV A;  2FD5 A;  1RR7 A;  2HXI A;  5EDN A;  1APL C;  1GV2 A;  1WH7 A;  1RET A;  1ZK8 A;  2LVS A;  3HM5 A;  2DN0 A;  4BY1 J;  2R92 J;  2DA6 A;  3TW6 A;  2Y9Z A;  4B4C A;  4DYC A;  1X2M A;  4IHX A;  1JTX A;  2YUS A;  3O8G A;  4AYB N;  2EZK A;  2JN6 A;  1MBJ A;  3FKI J;  3K2A A;  4XRS A;  4QTR A;  5FKL A;  3A01 B;  2CQX A;  2DA7 A;  1JKR C;  4QSH A;  1I6H J;  4XIC A;  2EZL A;  4JX6 A;  3L1P A;  3ZQG A;  3S16 J;  1JUP A;  2JA7 J;  1Y1W J;  1NK3 P;  2X48 A;  1FIA A;  1XC5 A;  2XB5 A;  1GDT A;  2E2H J;  3IH3 A;  3ZQL A;  3HBL A;  1PUF A;  3BQZ A;  2W48 A;  1MBH A;  1VND A;  1I50 J;  3IH2 A;  3BTC A;  1ETK A;  3LSR A;  2PMZ N;  1O4X A;  5F0C A;  2CRG A;  1NK2 P;  5M5X J;  4I6Z A;  2X9D A;  4A3I J;  4XRS G;  2CUE A;  3SFI A;  2ECC A;  1JT0 A;  4I76 A;  2MGQ A;  3RKQ A;  4A3F J;  2Y30 A;  2DTZ A;  5F0F A;  1ZGW A;  3JRA A;  3I4M J;  2Y9Y A;  1MBK A;  2JA6 J;  3BG3 A;  9ANT A;  1ZQ3 P;  1BW5 A;  4A3C J;  2MW8 A;  2K40 A;  1SFO J;  3CMY A;  3HGY A;  1AHD P;  3B6A A;  1LE8 A;  2VKV A;  1LFU P;  1Q1V A;  2ZB9 A;  2CQQ A;  4B3A A;  2M34 A;  3IH4 A;  3LOC A;  1B8I B;  4CYC B;  4W97 A;  4C3J J;  5J1U A;  1XS9 A;  3OIO A;  1ENH A;  2ID6 A;  2XPU A;  3GBG A;  1IRZ A;  2LLK A;  5EZG A;  2HOS A;  1I3Q J;  1JT6 A;  2K9N A;  1VF9 A;  4UUS A;  3S2D J;  1JKQ C;  4JX5 A;  3S15 J;  4UUT A;  2XGE A;  2TCT A;  1P7I A;  2ELK A;  1MSE C;  1MBE A;  3HOY J;  3ZQC A;  1IUF A;  3DEW A;  4Y7N J;  5M5Y J;  3MKL A;  2XRL A;  3RQI A;  1FIP A;  1WGX A;  3BTI A;  2DJN A;  3JRI A;  2AHQ A;  1JKO C;  3S2H J;  3W6V A;  4JP0 A;  4FTH A;  3JRF A;  2DMT A;  5EGO B;  4X6A J;  1LFB A;  4M6V A;  2E2J J;  3S1M J;  2DMP A;  4DW6 A;  1OCP A;  2NOG A;  1GV5 A;  2NS7 A;  1Z77 A;  5K7F A;  1WI3 A;  2EZH A;  4A3D J;  5IYB J;  2N8G A;  3TED A;  1FEX A;  3ZQH A;  5GPA A;  1H89 C;  1IC8 A;  2GLO A;  2WAQ N;  1AU7 A;  4W1U A;  4X1E A;  1U9O A;  1AKH B;  4MIM A;  4LOC A;  3UKG A;  1ZR4 A;  4FE4 A;  3B6C A;  1HDP A;  1JTY A;  4A3M J;  1H8A C;  3QPL A;  1HDD C;  1WH5 A;  4BXX J;  3PO3 J;  1IJW C;  5EGO A;  1U78 A;  5J1R A;  2B63 J;  1OJL A;  3CDL A;  5C3E J;  5M3F J;  2D5V A;  3LSP A;  1P7J A;  4A69 C;  3ZQI A;  3SDG A;  3GTM J;  5IYD J;  1OCT C;  5IP6 A;  1FTT A;  3G1L A;  3F0C A;  5IP9 J;  1MH4 A;  2HQ5 A;  3BT9 A;  4M3E A;  1IDZ A;  2NVQ J;  2DA4 A;  4FE7 A;  3JRD A;  2HYJ A;  3GTJ J;  2R5Y B;  2XGD A;  5HOD A;  3OSG A;  3C2B A;  2VPR A;  1NTC A;  2IEK A;  2R5Z A;  2LD5 A;  1BW6 A;  4XRM A;  1T56 A;  5K7H A;  1JUS A;  1ETX A;  4A3B J;  3ZQF A;  3JRG A;  2O8K A;  3JRE A;  1TWH J;  2LR8 A;  2NVX J;  5E3O A;  3Q0U A;  3GTP J;  1G2H A;  4C2M J;  2AO9 A;  4BY7 J;  5E3N A;  5FJ8 J;  1HLV A;  1TC3 C;  3BR3 A;  3MVP A;  5FKN A;  3ZOB A;  4C3H J;  2HDD A;  1QVT A;  2H8R A;  4D7M A;  5EF6 A;  4D5F A;  3BR6 A;  3OSF A;  2ECB A;  4BBR J;  3K7A J;  4M3B A;  4A3E J;  2KDZ A;  1D5Y A;  3HOZ J;  2COB A;  3HEF A;  3QQA A;  3BQY A;  3LNQ A;  4XID A;  2EBI A;  3QPS A;  2DA3 A;  4ABZ A;  1K61 A;  2MSY A;  3G1M A;  1RPW A;  4AC0 A;  2LP0 A;  1ZTR A;  2WV1 A;  4MFE A;  5IP7 J;  4A3J J;  2I10 A;  3IV5 A;  2XPW A;  1QPI A;  2R7Z J;  2LKX A;  3TW7 A;  4EEF G;  2QF7 A;  1MNM C;  4AUX A;  3CCY A;  3BR2 A;  5F08 A;  5FKK A;  3BR5 A;  2R0Q C;  3Q0W A;  1PUF B;  4IHY A;  3HOU J;  2NVY J;  4RBO A;  1IV6 A;  4G12 A;  1R9T J;  5GPC A;  2CUF A;  5J1Y A;  1ZKG A;  2LTP A;  3JRH A;  1DU6 A;  2CJJ A;  2K9S A;  3LSJ A;  3GTL J;  5J3L A;  5C4J J;  4DZP A;  3GTO J;  3NAU A;  1MSF C;  4M3D A;  1TWF J;  5FLV A;  3RZO J;  3WHB A;  1RES A;  2Y31 A;  1GT0 C;  4A3L J;  3S17 J;  1MBF A;  5IOY A;  2VKE A;  3BTL A;  2L7F P;  2XSD C;  2DA1 A;  3JR9 A;  1CQT A;  5BNG A;  2M0C A;  4JX4 A;  4CYC A;  1QVU A;  1A6I A;  2XB0 X;  1POG A;  4BKX A;  3HOX J;  4C3I J;  2DMU A;  5JLX A;  5C44 J;  5M3M J;  3JRC A;  3FIS A;  1S7E A;  4DZJ A;  3Q0V A;  3OOU A;  2IAI A;  2OF7 A;  2H1K A;  4Y52 J;  1BJZ A;  4J19 A;  2TRT A;  3M4O J;  1DU0 A;  1U8B A;  2Y0S N;  3BG9 A;  3PM1 A;  2QCO A;  3A03 A;  1JUM A;  2LY9 A;  1TWG J;  4BBS J;  1GUU A;  2ME6 A;  3S1R J;  4XK4 A;  1VI0 A;  4D7N A;  3S1Q J;  1B72 B;  5IPA A;  1YRN B;  1UHS A;  5E3L A;  2GM4 A;  2HOT A;  4DYR A;  3VPR A;  1XG1 A;  2R93 J;  3S1N J;  5EG0 B;  4A93 J;  2FX0 A;  4L5E A;  4NDL A;  3BR1 A;  1F36 A;  1HOM A;  2KT0 A;  4JYK A;  3TP0 A;  2JA5 J;  1ITY A;  3LSG A;  1FJL A;  2YU9 J;  1FTZ A;  3WHC A;  1JJ6 C;  3H3V K;  2M8G X;  2GBY A;  1JKP C;  2L7M P;  2YS9 A;  3A01 A;  2VI6 A;  2JMW A;  3DCF A;  1BA5 A;  2DA2 A;  2EQR A;  5FKM A;  2XPV A;  3HOW J;  1X2N A;  5FKO A;  4A3G J;  3E7L A;  1OFC X;  3JRB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...