3D5LA

Crystal structure of regulatory protein recx
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
LAKISKIEAQKRKGRYNIYLDGKYAFPVAESVLIQFRLMKGTELDEKQIAAIATADQQAKAYSRMLDYLSYQMRTESDIVKKLKEIDTPEEFVEPILKKLRGQQLIDDHAYAASYVRTMINTDLKGPGIIRQHLRQKGIGESDIDDALTQFTPEVQAELAKKLALKLFRRYRNQPERRREQKVQQGLTTKGFSSSVYEMIKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA repair regulatory protein RecX.
rcsb
source organism Lactobacillus reuteri
molecule tags Signaling protein
molecule keywords Regulatory protein RecX
total genus 74
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA03
1.10.10.2800 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5lA01
4KN7X 1ZHFA 1UHMA 4IJAA 4B8XA 3F6VA 4IRHA 3EYIA 3HRTA 4FT8A 2H6BA 5HLGA 1IRFA 1YW9A 2VC1A 4EVIA 2O3FA 3MAJA 1P4XA 1FC3A 5H20A 3L2CA 1QO0D 4BHBA 1LEAA 1KU3A 2ZJ2A 1VTNC 3P9IA 3ZP5A 1QZYA 4EV0A 4LG0A 1MD0A 4ZYDA 4G9YA 2VBWA 3CUOA 2LDUA 2K27A 5HLHA 3QP5A 4A6DA 4A6EA 2VC0A 3RPUA 3QPHA 1MKMA 1R1VA 2QQAA 3FWEA 1QBJA 2A6HF 2HWVA 3J81Z 4CYDA 3LAPA 2EFQA 2DT5A 3E97A 3V4GA 1JHFA 5FO5A 4NHJA 3T8TA 4KT5C 2H09A 2M5WA 4ASNA 1WKMA 2P6SA 2JSCA 5IT3A 1WI9A 3GZ6A 1ZREA 3VB2A 5KVRA 4YIIA 4GXOA 4LLNA 4RAYA 5CVUA 2IJLA 5DCFA 5CVJA 2G9WA 3LA2A 4HW0A 4IHTA 3DEUA 3MWMA 4L0ZB 2M87A 2IPQX 3TDZC 3N97A 5D5UB 3BROA 3QOPA 4RGRA 4LLLA 4LFUA 4G8XA 2AS5F 2V1XA 1W7PD 2BBYA 2XKPA 3C3WA 2ZXJA 2GXBA 1YG2A 2E1NA 3U1DA 4M9SA 3RKXA 1FSHA 5H6RA 4MQVA 4JBAA 1O7FA 1WWXA 2YU3A 3L09A 1J9IA 4U0YA 4ESJA 2DPUA 4HX4A 5K1YA 2GA1A 3ABTA 1C0WA 1IXSB 1Z7UA 1BIBA 2HKOA 1FYKA 2CQKA 2XAGA 2WC2A 4G94A 3ERED 2HGCA 3G73A 3SQNA 2BGCA 3KZYA 5ILVA 2FNPA 2YR2A 4G7HF 1XGNA 2OU2A 5HS7A 1G3TA 2H94A 4ENJA 5CLSA 4LK1F 1PUEE 1LJ9A 1TQPA 2RNJA 2UZKA 2HFHA 3HUGA 5E18F 5AIPA 3I54A 2JPBA 2ZFWA 1T38A 3CJNA 3WTWC 2K7LA 5DYMA 1K7AA 4HDUA 5LHGA 2PFBA 3TO9A 3BJAA 2ETHA 3KP6A 2YX7A 2FSWA 4QLCU 3CDHA 3HSFA 1NHAA 4HAMA 3U9GA 1BIAA 2BEOA 1U2WA 2QUFA 1GXPA 5D6FA 1L0OC 3R4KA 3SXYA 3RJPA 2NYXA 2XROA 5LEJA 2W57A 2V1DA 1SFXA 2V79A 1YO5C 3RPQA 5BOXA 3ZMZA 5FLXK 2BE5F 1IAWA 4MHGA 1B59A 2DK8A 3QP6A 1GHCA 1ZN2A 2L3DA 1YS7A 3ECHA 3REOA 2Z33A 4HYEA 3P9CA 2IW5A 1RZ4A 3E6CC 1Z9CA 5DUIA 1AWCA 4UXNA 1EH6A 3ISPA 1FNNA 4OIPF 2EB7A 1WQ2A 3CLOA 4U0WA 5AONA 3WTZA 3EUHA 3F6OA 4GCVA 3V8LA 3KP7A 1XMAA 3KLNA 4R8HA 2PLYA 2WTEA 3ZN0A 3ZN1A 2WWYA 2GQQA 4Z2YA 4KIGA 1S29A 1WSUA 3BPXA 3H92A 2FOKA 3IL2A 1L3LA 5IT9K 1MDMA 3K69A 2CWEA 1F1ZA 5LRRA 5CJ9A 1B9MA 2W24A 3FM3A 3HHGA 4L9JA 4OIOF 1RI7A 1QNTA 1Z91A 4HQMA 3WE2A 3J80Z 1B6AA 3GZ5A 2H27A 1OYIA 5JHUA 2A07F 4AIKA 3GO5A 3P7NA 2FBIA 3O3KA 2KRFA 1SAXA 1OKRA 2Y75A 2LKPA 4LB5A 3CUQB 1KQ8A 1SD4A 4G6DA 1RUOA 4OINF 2A61A 3CO6C 3WU1B 2M30A 1B9NA 4MQ9F 1MJBA 2DI3A 3PQKA 5A2QK 2QYOA 1FP1D 4G6QA 3F22A 3MCZA 5HS9A 1TQMA 2GA2A 3WTSC 3LA3A 2XAJA 4L9TA 2EA2A 5L3CA 3HTSB 5D5VB 2VOOA 3MQ0A 5K5RA 2ISYA 2K4JA 3KCCA 4XBFA 3VEPA 4A12A 1SMYF 2LF7A 3NRVA 1ZH5A 3RYRA 1KGSA 5BPIA 5A2QZ 4DQ2A 4UV8A 3N4MA 1SD6A 1XN7A 1WRJA 1ULYA 1KQ9A 4WXCA 3WU0A 3K0LA 4HF2A 4ZYEA 5EEHA 4LLGF 1ZLKA 2LSOA 4S04A 4A0ZA 2KJBA 5L3EA 4A0YA 4HDVA 2R3SA 3VODA 5J8CA 5F64A 1CGPA 2ESHA 2O0YA 4YFNF 2X0LA 3V7RA 1J59A 5E8IA 3MEXA 4P9UA 4ENMA 1R1TA 3QPTA 5JR3A 1PDNC 3MZHA 4EGZA 2EFNA 3JW4A 3F8NA 2FQ3A 1F9NA 3DPTA 3R0AA 2ELHA 4HX7A 4WX9A 2C6YA 4GYIA 2XKOA 2P5LC 2A5YB 4DNCA 3IKTA 1T98A 2XIGA 2F5CA 4XSZF 4MTEA 4PDKA 1SFUA 1XCVA 2HR3A 3LAJA 3ECOA 3JSPA 5H6QA 3GEZA 1YTYA 2IA0A 1LNWA 3GF2A 1HKQA 4LD5A 1XD7A 3C1DA 3F21A 2P8TA 3DXJF 1UB9A 3F8CA 4BHPA 4HBLA 2DPDA 3BJOA 2MD5A 2VBYA 4O3MA 3CUQC 1HW5A 5ILSA 3RYPA 4ZZDA 4L5JA 3GYHX 2KIUA 2MBFA 2P6TA 4MTDA 1JE8A 3V8JA 1YYVA 3O2PE 2XV4S 3F8BA 5LGTA 2Z3YA 1W7PB 4HZFA 2F2EA 1LVAA 2EK5A 4I7HA 1D8JA 2QQ9A 3BJ6A 4LG0B 1R36A 1BI1A 4GGGA 2O8XA 2QZ8A 3P9KA 3TO6A 5JVTA 2Q2EA 2ESNA 1BC7C 2ZCWA 3ROUA 2RVCA 4D0PA 3NEUA 1DP7P 2CYYA 4O6JA 1T0FA 1U6GA 2DQRA 5K5OA 3F23A 1HW1A 3WTUC 1Q1HA 1HKTA 3ZMVA 3IC7A 2FRHA 1DPUA 2UXNA 4KMUX 4ZYHA 1XMKA 2RQPA 5DEQA 2O6GE 1J5YA 4KIFA 3K9TA 2VONA 2EFPA 2XHKA 5D4SA 2PBIA 2Q0OA 1ZRCA 4KMFA 2M45A 2RGVA 1K78A 1TTYA 2AXLA 1XGMA 3WTTC 3ZMDA 4HV6A 2OQRA 4M6YA 3COAC 1FZPB 1IXCA 2EV5A 2RC4A 3WGIA 2OD5A 1O3TA 4GO1A 5DCMB 3FXQA 4FHTA 4MEYF 3Q5FA 1FWZA 2FEZA 1KYZA 4QWQA 4A5MA 3GUDA 2VE9A 4EM2A 1B1BA 4UVCA 2Y0MA 3HSRA 1RUNA 1J7KA 1ZG5A 3M7GA 1BN5A 1I1GA 2ADUA 3ZMTA 2R7FA 3L7WA 1IXRC 2V9VA 1ZGJA 1FSEA 2O61A 4XLPF 4U7DA 3IWZA 1G4DA 5LLQA 3WTXC 4HA8A 2KJCA 1ZAOA 2ZNZA 4BAYA 1O3RA 3EYYA 1KQ0A 1F4KA 2PJPA 3JSOA 4JQFA 2F5DA 4K2EA 3WGHA 1XDSA 1FT9A 3OOPA 4HLYA 4ESBA 4I01A 1E17A 5CYVA 5L3DA 1YLFA 3H3UA 4L9NA 4HQEA 1R00A 2XRNA 1SFEA 5FB2A 3GFMA 2XAQA 2EA4A 3PFIA 3KLOA 1XGSA 2IT0A 3J7AO 3E6BA 5ICEA 2NS0A 1T6SA 5FD5A 5ICFA 2COMA 3I0TA 2DLLA 3IKVA 2PQ8A 1LB2A 1TNTA 3C18A 1J0RA 3KP4A 1CF7A 4EM1A 1I6XA 2DBBA 5FFZA 2KKOA 1ZGAA 1W5SA 5LHHA 4Y17A 5ILUA 2W85A 4L0YB 3W6JB 1XDUA 3FX3A 2XASA 3TOAA 3BPVA 1LDJA 2D1VA 2VT2A 1HBXG 4RGXA 5AIQA 1D3YA 1H9GA 3RIRA 3IWFA 2W25A 2MH9A 1OPCA 3GFLA 3HSEA 2PG4A 1YS6A 2H6CA 3DQVC 4EJTA 3MFKA 4G7OF 1K79A 4FX0A 1KU2A 3V7CA 3W6KB 4EMSA 4BQAA 1G3YA 3ZMUA 3BDDA 5E17F 4HF0A 2DQLA 4UVAA 4IHSA 4AIHA 1H9TA 3IRQA 2OBPA 4M71A 3HRMA 5D5WB 3I71A 1HSTA 1CF7B 3TQNA 2ZMEA 4Q4ZF 3GFJA 2IA1A 1FX7A 3CUQA 1BI2A 4WK8F 4EJVA 4PGHA 3F72A 1D8KA 4GYGA 3BZ6A 4UV9A 1R58A 1S7AA 5L3GA 4RB1A 4AWXB 3ZQ7A 5D5XB 2PMUA 2A3SA 2R7DA 2Z5UA 5LRSA 4ENNA 5D8KB 2Q8KA 3KE2A 4KFCA 3IRRA 2HYGD 5LGUA 1ZG3A 5E8GA 5LGNA 2UWMA 1FBQA 3E5QA 4M73A 3DFGA 2IP2A 5HDGA 1O7LA 4PCQA 2TDXA 1KU7A 5LBQA 1QPMA 1EH7A 4RGUA 2MLGA 1LQ1A 1JGSA 3IHUA 4M9XA 2X4HA 2J5PA 1KU9A 2D45A 2VE8A 3KETA 5BMZA 1OYYA 1OYWA 4RB0A 2A68F 1ON1A 4G7ZF 5J8FA 4ENKA 3I59A 4PZJA 4OIRF 1IN7A 1REPC 3DKWA 1MZBA 4L5IA 4RAZA 5HDKA 2HYFA 2M8EA 4CGZA 1T2KA 5DDGA 3QU3A 2CO5A 4LGWA 3T5XA 2HEOA 1MJAA 1IRGA 1SD5A 5HOOA 3U2RA 2Z99A 2DW4A 1QQIA 2NNYA 3FXRA 2JT1A 1IF1A 1ODDA 3MZYA 4OMZA 4CXFA 4MGRA 2OAZA 2QQBA 1W5TA 1DPRA 3LA7A 2HTJA 1UCRA 1SMTA 5CVVA 5ICCA 1MGTA 3OV8A 5ICGA 2HOEA 2VT3A 3BOQA 4EQQA 4NB5A 1FY7A 3JAMK 2FMLA 4YG2F 3LSTA 2EV0A 3FMRA 1G3WA 2HDCA 1U5TC 4UHTA 4IPAA 4U7BA 4WXDA 2VBXA 3WTVC 3E3VA 3HIFA 5DD4A 2HQRA 5JFRA 1U8RA 1RIOH 2L01A 1FPQA 5L3BA 1R1UA 3FXUA 4KUMA 3V8KA 4A5NA 4EM0B 4UVBA 1TBXA 3WGGA 2GZWA 2RDPA 5KK1A 4JK1X 5ERIA 3TGNA 1ON2A 4YFKF 3HTUA 3D0SA 2FA5A 3M8EA 1X3UA 4WXHA 1R5HA 4HX8A 4Q5SF 2HTSA 4LJZF 4HOBA 2A69F 5E1WA 4KN4X 3VFZA 1PP8F 3SZPA 2JZYA 1XB4A 1IUYA 1TNSA 4Y13A 2O03A 5FFXA 3EETA 3I58A 1P4AA 2KIMA 4PGGA 1TW2A 5BS6A 4KNYA 4CHUA 1OMIA 3BY6A 2QM3A 1FYMA 3L9FA 2XUBA 1JHHA 2ISZA 3FMSA 3R60A 1QZZA 3I4PA 1V4RA 5HS8A 4P55A 2NNNA 4AIJA 1ZYRF 2IVMA 1ZRDA 4N9HA 2VN2A 1F5TA 3M9AA 5DUKA 3R61A 3D5LA 2JRTA 3E5UA 3I64A 2J5OA 4H0EA 2RKHA 4CZZA 1XGOA 5F1RA 4BHCA 1HQCA 2K02A 2IA2A 3CTAA 3TOBA 5FLXZ 1TW3A 2FF4A 1IN5A 3M8FA 4BYYA 4U88A 3JTGA 1QGPA 2FBKA 3T8RA 1BI3A 2NRAC 2PI0A 3O6BB 1S8NA 3WODF 2MLKA 1DUXC 3SZTA 5D4RA 4I02A 2D1HA 1V3FA 2OA4A 1J2XA 2F5FA 1ZRFA 3RTRA 2HKXA 4IRIA 2MA3A 2PMHA 1R5GA 3B73A 3S2WA 3HYIA 3HOSA 5TJJA 5E20A 1XSXA 3R0JA 4ZZLA 4ETSA 4A2UA 2A6EF 3RKYA 1R22A 4M74A 2G7HA 4ZH4F 5L3FA 2GWRA 1BOAA 1BI0A 2MH2A 1BJAA 1ONVA 4HLXA 4F7ZA 3KP5A 1U5TA 3QRFF 1W7PA 4IF4A 4I2OA 4RS8A 2BV6A 5FGMA 2PN6A 2FMYA 1IZ1A 2P5KA 2QVOA 3DV8A 5J6XA 1IN6A 4R1HA 2QENA 4O5VA 2Z9OA 1SD7A 3LWFA 4U0VA 2QBYA 2ZO4A 3KZZA 3ML6A 5K5QA 3ZPLA 4OMYA 5CVRA 3F8MA 2DO7A 5E1XA 5LEKA 1G3SA 1FP2A 3K2ZA 2DFIA 1Z05A 4EJUA 1DDNA 4BXUA 4P96A 3FF5A 2OQGA 1IW7F 4UUVA 4TV7A 1ZG1A 5ED4A 2STWA 4P5OA 4I98B 6PAXA 5HVQC 2XAHA 3SHFA 3QU6A 3DP7A 2P5VA 1FBUA 1D5VA 1YQAA 1HW2A 2CG4A 2UXXA 3LQQA 3RKWA 1FOKA 4IRGA 2VXZA 1IN4A 4KIBA 2XGXA 4UNOA 4RGSA 3HHHA 3KFWX 4ESFA 3FZVA 1TLHB 2HZTA 2HQNA 4M9ZA 2FBHA 1ZARA 5LHIA 2GXGA 3GX4X 2QWWA 1RNLA 3GWZA 3BP8A 3ABUA 4L18B 1R23A 1USTA 3ELKA 4M72A 3TKYA 1LDDA 1O57A 3GXOA 1H0MA 2VOPA 3KP2A 1XSDA 2WV0A 4XSXF 1U3EM 5IT9Z 1MJ9A 3FHZA 1LDKB 1FYLA 1R7JA 1I1SA 4HV5A 5HLIA 4KDPA 4WWCA 4KYWA 1BC8C 3E5XA 3R6SA 3TO7A 1YW7A 4EJOA 5DD8A 1XSVA 2F5EA 5DV5A 4ZYGA 2EWNA 3KP3A 4RB2C 3NQOA 5BQTA 1HXDA 2ZBKA 4BNCA 2EV6A 1P6RA 1O3SA 1FBSA 3K1PA 1GXQA 2VBZA 2B0LA 2QLZA 4IXAA 2CGPA 1T39A 5CVIA 4I0AA 4R79A 2PEXA 2STTA 4RB3C 4B09A 2ACJA 2OZUA 1W4MA 3GLXA 3GFIA 1B4AA 1S3JA 2FXAA 4OOIA 4N9IA 2VODA 3EDPA 4FX4A 2V6CA 1YIOA 4S05A 2K4BA 3GW2A 3TDUC 2XVCA 3RDIA 3KEOA 3Q9SA 4CDGA 4P9FA 1K6OA 5D6EA 1S7OA 2MC3A 3E6DA 2LNBA 2DU9A 3E6MA 2L02A 2JTVA 1O3QA 4OU0A 1FLIA 1LEBA 1XCBA 2GAUA 1PP7U 5BPDA 5E1ZB 3WG9A 2W84A 1KA8A 1P4WA 4HF1A 2XAFA 2FNAA 3SFZA 3QAHA 1U5TB 4I0BA 4Y15A 3RI4A 3Q9VA 3G3ZA 1P2FA 3HOTA 4KA4A 3GVAA 1KYWA 2HS5A 1TQIA 3ULQB 2D2WA 4Q47A 2DAOA 2CFXA 1JXSA 4AVPA 3DPLC 1OR7A 3K1MA 4CO8A 3C7JA 2L54A 4A0XA 1I27A 3V7SA 3FM5A 3LQRA 4NQWA 2FE3A 1EH8A 1MDMB 3J80K 1BBYA 1GVJA 3HRUA 2P7VB 5D8LB 3F3XA 2KIFA 2L4MA 2V1UA 3JAMZ 3BWGA 4OIQF 1UHWA 3L00A 4M6XA 4IVNA 3ZMSA 2OZ6A 2LF8A 3PQJA 1Y0UA 1U78A 5DCMA 5F6FA 3T1BA 1AOYA 4L9VA 2E7WA 5JI6A 1E2XA 3WE3A 4XLNF 2P4WA 4BH9A 2RV8A 1Z1DA 4CICA 3FMQA 2YSRA 2ZKZA 3WTYC 2E7XA 1Z6TA 4LMYA 3I53A 4AD9A 4EGYA 2EFOA 4E70A 3DF8A 4KICA 2GIVA 1J75A 4WCGA 2YX4A 1USSA 1UFMA 2M1BA 3M1EA 2NAZA 4LB6B 3CO7C 1BM9A 4EJWA 2IRFG 3K1NA 3VOEA 4MEXF 5FD6A 3LFKA 3J81K 4WF2A 1I5ZA 5EEGA 1YFHA 3F8FA 1P92A 1K78B 2K86A 2E1CA 2G7UA 2CW0F 3HRSA 1ZLJA 5TRDA 4XRFA 3AAFA 2Y48A 3JTHA 1G6NA 4I09A 1HSJA 2ZNYA 2CSOA 2RN7A 1EV7A 2EFWA 3I5UA 3B02A 3KEQA 2DTRA 4LK0F 3I59B 1S6LA 2QBYB 1IN8A 1A04A 3H3ZA 2JPCA 2EJRA 1STZA 2ZMEB 4YIFA 2L4AA 4MNUA 4ON0A 2YPRA 1Z6RA 3T0YA 4Q48A 1HKSA 5HDNA 4N0BA 2BYVE 2FU4A 3EQLF 2P7CB 1YW8A 2DK5A 4YFXF
chains in the Genus database with same CATH superfamily
2H1LA 4KN7X 1S7EA 4UUSB 5JLWA 2HOTA 2KPMA 3FXJA 2KZGA 1ZHFA 1UHMA 2BY1A 4IJAA 4B8XA 3F6VA 4IRHA 3EYIA 4UUSA 1VQNI 3HRTA 4NC6A 4FT8A 2H6BA 5HLGA 2DA1A 2EILH 1IRFA 3HG9A 2R5YB 1YW9A 2VC1A 4EVIA 2K9LA 2O3FA 2CJJA 2JSPA 3MAJA 1P4XA 1FC3A 5H20A 4DBQA 1MSFC 3L2CA 1QO0D 4BHBA 1LEAA 1KU3A 3HOZJ 2ZJ2A 1VTNC 2ZSHB 2LC2A 3P9IA 3ZP5A 1ZGWA 2V6EA 5IY5H 3W2AA 3PNVA 1QZYA 4EV0A 3OL3A 4LG0A 1P9QC 3BR5A 1MD0A 4ZYDA 4BE1A 4G9YA 2VBWA 1ITYA 2XSDC 2JVGA 3CUOA 2MW8A 2MGQA 2LDUA 4B3XA 2K27A 1HCRA 5HLHA 3QP5A 1R4MB 1MMAA 3S2DJ 2Y31A 4A6DA 4A6EA 2VC0A 3RPUA 1MIJA 3CC7I 2CW7A 3QPHA 1MKMA 1R1VA 2QQAA 2AO9A 3FWEA 1WJBA 3K6GA 1QBJA 1MMGA 3QPSA 2A6HF 2HWVA 2IEKA 1JKQC 3J81Z 3E1SA 1F43A 4CYDA 3O8GA 2CV1A 3LAPA 2EFQA 2DT5A 3E97A 3FDYA 4UB8C 2NVTJ 4IL6C 4PJ0C 4Y7NJ 1JUPA 3OYEA 3TMOA 3V4GA 1JHFA 5FO5A 4NHJA 1GT0C 3T8TA 2R5ZB 3CF5F 4KT5C 1OISA 2H09A 2DDAA 2M5WA 4J01A 4ASNA 5B5EC 1WKMA 2P6SA 2XB0X 3VDXA 2JSCA 5IT3A 1D0YA 4PSWA 1LE8A 1WI9A 3GZ6A 1ZREA 3VB2A 3HOVJ 5KVRA 4YIIA 4GXOA 1SFKA 4XL9A 5HLTA 4LLNA 4RAYA 4A69C 1ZR2A 2BXZA 5CVUA 2IJLA 1MNMC 5DCFA 5CVJA 2G9WA 3LA2A 4HW0A 4IHTA 1XG1A 2NVQJ 3DEUA 3MWMA 4L0ZB 2M87A 4ZYAA 2IPQX 5K7ZA 3CCLI 3TDZC 3N97A 5D5UB 3BROA 2KISA 2L7KA 5M3MJ 3QOPA 4RGRA 4LLLA 4LFUA 4G8XA 2AS5F 2V1XA 1W7PD 1Z7LA 2BBYA 3OIQA 2XKPA 2ZMEC 3C3WA 2ZXJA 2GXBA 1AU7A 3G71I 2AQEA 1IV6A 1YG2A 2E1NA 3U1DA 4M9SA 2WB1N 3RKXA 3WU2C 1FSHA 5H6RA 2DMUA 4MQVA 4JBAA 1O7FA 1WWXA 1ETWA 3CD6I 3FKIJ 5LD2C 1UJ8A 2YU3A 3L09A 1J9IA 4U0YA 4ESJA 2DPUA 2CV0A 3JRGA 4HX4A 2GOMA 5K1YA 2GA1A 3ABTA 1C0WA 1ETOA 1DU6A 1IXSB 1E3HA 2X85A 1Z7UA 1BR1A 1FOWA 1BIBA 2HKOA 3GTGJ 1DQUA 3KX2A 1X1AA 3G2BA 5FJ8J 1FYKA 2CQKA 2XAGA 3S1RJ 3S15J 5F04A 2AHQA 2WC2A 2W00A 1Y6IA 4G94A 4M6VA 3ERED 5E3LA 2HGCA 5IP6A 1JUSA 3G73A 5FRNA 2XGCA 3L1PA 5M3FJ 5FLMJ 3SQNA 2BGCA 3KZYA 2WAQN 1RC9A 5ILVA 3AKZA 2OV7A 2FNPA 2YR2A 2FX0A 4PFOA 4G7HF 1XGNA 2OU2A 2NVXJ 5HS7A 1G3TA 3BTIA 2H8WA 2H94A 3RZOJ 4ENJA 5CLSA 4LK1F 1PUEE 5B66C 1W36C 4RLQA 3BQZA 3SZGA 4I99C 1K4SA 2BW3A 1LJ9A 3B6CA 3BR3A 1TQPA 2RNJA 3GLLA 4PJLA 2HZDA 1D0ZA 1UZCA 2UZKA 1RETA 2HFHA 3HUGA 5E18F 5AIPA 3OYCA 4YIRX 1X1DA 1DGRM 5IPAA 3NWTA 3OIOA 3I54A 2R7VA 2JPBA 2ZFWA 5EDNA 4Y3OA 1T38A 1OQYA 2V9KA 3CJNA 4LG3A 2E19A 2ZSIB 3WTWC 2K7LA 5DYMA 3NWSA 1ORKA 2X48A 1K7AA 3ABKH 2HVRA 3OYNA 4XRSA 4HDUA 4BE0A 4F3QA 5LHGA 1WH5A 2PFBA 3TO9A 4DOZA 3FXKA 3BJAA 4BQQA 3CP2A 2ETHA 2V7FA 3OYGA 3PL8A 3W6VA 3KP6A 4XMYA 2YX7A 2FSWA 3CDHA 3QWLA 4ZC3A 4QLCU 3HSFA 1NHAA 2F4MB 3OOUA 4HAMA 3U9GA 1X58A 1BIAA 2KQRA 2BEOA 5C44J 2R92J 1U2WA 2QUFA 1GXPA 5D6FA 1L0OC 1SVLA 2LK2A 3R4KA 3SXYA 3RJPA 2NYXA 2XROA 3VYTB 2HPMA 2BHYA 3W3CA 5LEJA 2W57A 2V1DA 3OYFA 1SFXA 3L2RA 4IQJA 2V79A 1TT0A 1YO5C 3RPQA 5BOXA 3ZMZA 3PUFA 5EEAA 4BY7J 1GV2A 5FLXK 3ASNH 2BE5F 1IAWA 1OCCH 2LP0A 4BDYA 4MHGA 1B59A 2DK8A 5F0CA 2Q1ZB 3QP6A 3DEWA 1TC3C 1A35A 1QZEA 3QPLA 3BG3A 4ZDOA 1GHCA 1ZN2A 2L3DA 5IOZA 1VQ5I 1XTAA 1YS7A 3ECHA 3REOA 2Z33A 2JQ7A 3BG9A 4HYEA 3P9CA 4C3JJ 3SFIA 2BOLA 2IW5A 4EEFG 1RZ4A 2Z16A 3E6CC 4XN0A 1LUJB 1Z9CA 5DUIA 5F27A 4FASD 3A01B 3H3VK 1AWCA 2GXAA 4B47A 4UXNA 1EH6A 3BLYA 1PYVA 3IH3A 3ISPA 1FNNA 2MFZA 4B48A 4OIPF 2EB7A 3BR6A 4FETA 2K5CA 1WQ2A 2I8DA 1TT5B 3CLOA 4U0WA 5AONA 1SC7A 4LIVA 3WTZA 2X9DA 3EUHA 2JRMA 3F6OA 4UB6C 2VKHA 1B8IB 2E2IJ 3H9JA 3GTKJ 4GCVA 3V8LA 5B3SH 3KP7A 1WJEA 3I4NJ 1XMAA 3KLNA 4R8HA 2PLYA 2WTEA 3ZN0A 4M3BA 1GDTA 2DA6A 1AKHA 4AU7A 1T56A 3ZN1A 3GTPJ 2WWYA 2GQQA 4Z2YA 4KIGA 1S29A 2R7QA 1IG7A 1WJFA 1WSUA 3BPXA 3PM1A 4OWRB 3PJRA 3H9GA 3BG6A 3H92A 2DFHA 2OCEA 2FOKA 3IL2A 1L3LA 4XLFA 5IT9K 1AA7A 1LE8B 2X6XA 1MDMA 3WG7H 4CCMA 3K69A 2JWTA 3RPUD 2CWEA 4MFDA 4A93J 3OYMA 1X4OA 3RSNA 3A2KA 1XC5A 2HYJA 1F1ZA 5LRRA 4IQ4A 5CJ9A 4IEJA 1B9MA 2W24A 3FM3A 3HHGA 4L9JA 1VQKI 1RI7A 1Z91A 1QNTA 4HQMA 3WE2A 3J80Z 4OIOF 2ZJPF 1B6AA 3GZ5A 2H27A 1OYIA 5JHUA 1SEUA 2A07F 4XM3A 4C3HJ 4AIKA 1H8AC 1OCRH 3GO5A 3P7NA 2FBIA 4JX6A 3O3KA 2KRFA 1UMQA 1SAXA 1OKRA 2Y75A 2BZTA 1HF0A 1JTXA 4QPOA 1NTCA 2DYSH 2LKPA 4LB5A 3ONQA 3CUQB 1KQ8A 2HVSA 1SD4A 4G6DA 2VI6A 1RUOA 1S5LC 4OINF 2P0WA 2A61A 2WY8Q 3CO6C 4IO9F 1HA8A 1TWCJ 4HPQA 3WU1B 4E4HA 3K70C 1DP3A 3TL4X 1WCMJ 2M30A 1B9NA 4AYBA 5M5WJ 4MQ9F 4AUXA 3ESWB 1MJBA 2DI3A 1IJWC 1MSEC 1Y8RB 4E7SA 3PQKA 5A2QK 2QYOA 4AIDA 1FP1D 1SVOA 4G6QA 3F22A 2OTLI 3MCZA 5HS9A 1TQMA 2GA2A 4PJMA 3WTSC 1PUFB 3LA3A 2NOJB 2XAJA 1N75A 4L9TA 2EA2A 5L3CA 1IC8A 3HTSB 5D5VB 2VOOA 1Y1VJ 2KP6A 4AVZA 3MQ0A 5K5RA 2ISYA 4RM2A 5KHDA 2K4JA 3KCCA 4XBFA 3VEPA 4PSXA 1ZK8A 3OYKA 4A12A 3MVPA 1SMYF 4DGWB 2L0KA 3K7AJ 2LLKA 2LF7A 1PJRA 3NRVA 1KZHA 1ENHA 1ZH5A 4D5FA 4RAGA 3L2VA 3RYRA 1KGSA 5BPIA 5A2QZ 4DQ2A 1R9TJ 4UV8A 1SD6A 5JLXA 3N4MA 1XN7A 4DZPA 1WRJA 1ULYA 1KQ9A 1LFPA 2IXSA 3K4LA 4WXCA 3Q0WA 3WU0A 3K0LA 3SJMA 2KLOA 4NQWB 1H89C 1LVKA 2E60A 4HF2A 5F0FA 4ZYEA 5EEHA 1VF9A 4LLGF 1ZLKA 3AL0C 3FXMA 2JA6J 2DA2A 2W7NA 2LSOA 2PX9A 4FCYA 3S1NJ 4S04A 4A0ZA 2NS8A 2KJBA 3PIPF 5L3EA 4A0YA 1RKTA 4HDVA 2JA8J 2Y9ZA 2R3SA 1IUFA 3RQ4A 2JUGA 3VODA 5J8CA 5F64A 4IZZA 1CGPA 2ESHA 2O0YA 3A03A 4YFNF 2X0LA 3V7RA 2LY9A 1J59A 5E8IA 1TWHJ 3SYTA 1ZKGA 3MEXA 4P9UA 4XNFA 2CUFA 3IH4A 4ENMA 1I39A 1R1TA 2LKSA 3QPTA 1RRJA 5JR3A 1TL8A 1EJ9A 3DBRB 1Z67A 4OAZA 1PDNC 3AL0B 3MZHA 4EGZA 2EFNA 3JW4A 3F8NA 3ZQFA 3HBLA 5GPCA 2FQ3A 1F9NA 3DPTA 4LOCA 5B1BH 1MMDA 3R0AA 3H1CA 2ELHA 4HX7A 4WX9A 2C6YA 4GYIA 2GLOA 5EG0B 3EUKL 2XKOA 2CU7A 2P5LC 5CPRB 2ECBA 2A5YB 2A5WA 4DNCA 3IKTA 1T98A 2XIGA 2F5CA 4XSZF 4F91B 2Y69H 4PDKA 4MTEA 3C2GA 1I3AA 2Y0SA 1XCVA 2HR3A 3LAJA 1WJAA 1YJ9I 2R5ZA 1SFUA 3ECOA 1A6IA 3JSPA 5H6QA 1QU3A 3FBNB 2IGOA 3GEZA 2B7EA 2E36A 1MBFA 5E3OA 1YTYA 3C2HA 3OY9A 2R7UA 3OL4A 2LBFB 2IA0A 1LNWA 3OS1A 4MIMA 4C3IJ 3LSIA 2BHZA 4A3KJ 3GF2A 1HKQA 3BZCA 3CF2A 4LD5A 3HPHA 1XD7A 2NXNB 4XOTA 1FIAA 4NUBA 5K7HA 1AKHB 2IS2A 3C1DA 3F21A 4C30A 4BXXJ 2P8TA 3DXJF 2OJED 3ZQLA 1UB9A 3F8CA 4BHPA 3PNTA 4HBLA 1FOYA 1MBKA 3BJOA 3QOEA 5EZHA 2DPDA 2MD5A 2VBYA 2D5VA 4CCNA 2VJ5A 1D1CA 1PUFA 2LFBA 4O3MA 1X19A 2E1OA 3ZQQA 3CUQC 1V55H 1KONA 2CUJA 1HW5A 5ILSA 2HQAA 3RYPA 4ZZDA 2ELJA 1VFCA 5FKMA 4L5JA 1EA3A 3M8JA 2KIUA 3GYHX 2MBFA 2M0MA 2P6TA 4MTDA 1JE8A 3V8JA 3IAS2 4E7JA 2NOGA 1YYVA 2XF5A 2KL4A 2KDOA 3O2PE 4XICA 3CCSI 3PUBA 2QKLB 2XV4S 3F8BA 5LGTA 3GTJJ 3BTJA 2Z3YA 1W7PB 4HZFA 2WAQA 4MFEA 4ZTFA 1OCZH 4HEA2 1FJLA 2F2EA 4G12A 1LVAA 2EK5A 2KHMA 3FXLA 4UUTA 4Y52J 4I7HA 1D8JA 2QQ9A 2EZLA 4XRSG 3SEQA 1JT0A 1MBEA 4L5EA 4LITA 5M5XJ 3BJ6A 4LG0B 1R36A 1BI1A 2DFFA 3GTMJ 1IRZA 4GGGA 4QPQA 2O8XA 1NK2P 2LY1A 2QZ8A 1VNDA 2E1MC 5IYDJ 3S93A 2Z2SB 1I6HJ 3P9KA 3TO6A 5FKOA 1U0JA 2Z1DA 5JVTA 2Q2EA 1A6QA 2ESNA 2LD5A 4XR6A 1BC7C 3I3LA 2ZCWA 2DMPA 4XLHA 5FKLA 3ROUA 2RVCA 1R6RA 3G1OA 4D0PA 3NEUA 1FMVA 1DP7P 2HPIA 2CYYA 4O6JA 3PO3J 4FE7A 1T0FA 1U6GA 2A6TA 4BBRJ 5C4JJ 2DQRA 5K5OA 2M7AA 3M07A 4DIQA 3F23A 1HW1A 3DWLE 3WTUC 3HM5A 1Q1HA 1HKTA 2LBFA 3ZMVA 3IC7A 1GV5A 1X2NA 2FRHA 4DYCA 1R49A 2CQQA 3CCYA 1DPUA 1WVRA 3AG3H 2UXNA 1ZR4A 4KMUX 4BXFA 4ZYHA 1MBJA 1XMKA 4PFPA 3QYEA 1OCTC 2RQPA 3O8HA 5DEQA 1SANA 2O6GE 1J5YA 4KIFA 3K9TA 4C2UA 2VONA 2EFPA 2XHKA 5D4SA 3A01A 2EIJH 2PBIA 2Q0OA 1ZRCA 4KMFA 2M45A 2RGVA 1K78A 1TTYA 3WHCA 2AXLA 1XGMA 1YX5A 3WTTC 1RR7A 3ZMDA 2DN0A 2OQRA 2E5ZA 4HV6A 4M6YA 3COAC 1FZPB 1VQ9I 1IXCA 4BS9A 3VWBA 3ERMA 2EV5A 2RC4A 3WGIA 2OD5A 5E3MA 1O3TA 4GO1A 1JJ8C 1BW6A 3DU5A 5DCMB 3FXQA 2EQRA 4FHTA 3CCJI 3K4MA 4MEYF 1XX5A 3VYSB 3Q5FA 1FWZA 1KYZA 2FEZA 4QWQA 4A5MA 3HOUJ 1W1WE 2DFEA 3JRDA 1YE9A 4QIWN 3GUDA 2VE9A 3S8PA 2CH0A 4EM2A 1X2MA 1B1BA 1A36A 4UVCA 4KISA 1QHHD 2Y0MA 3HSRA 2K40A 2CQ7A 1VI0A 2GOXB 1Z3XA 1RUNA 1J7KA 1ZG5A 3M7GA 1WI3A 1HDPA 3ZCOA 1G59A 1BN5A 1I1GA 2ADUA 3ZMTA 2R7FA 3L7WA 1IXRC 3KYDB 2DOFA 4RA2A 2V9VA 2M9HA 2MYSA 1ZGJA 1FSEA 1MBGA 2V26A 2O61A 2R5YA 5FKNA 5IP9J 1OLTA 4XLPF 4U7DA 2E2JJ 3IWZA 2R7SA 1G4DA 2I5UA 5LLQA 2WAEA 3WTXC 3PFYA 4HA8A 2KJCA 1ZAOA 2ZNZA 3D5SC 2IGNA 4BAYA 1O3RA 2RNGA 3EYYA 4XN3A 3BTCA 1KQ0A 3QQAA 3I56I 1F4KA 2LVSA 2PJPA 3JSOA 4JQFA 2F5DA 2EINH 4K2EA 3GBGA 5HODA 3IP4B 3HB9A 2O5RA 3LFUA 1XDSA 3WGHA 1FT9A 3OOPA 1S9HA 3DLAA 4ESBA 4I01A 4HLYA 2PJRB 1E17A 3G4SI 5CYVA 5L3DA 5TISC 1YLFA 4B4CA 3H3UA 4L9NA 1J09A 2EIKH 4NDLA 4BEHB 4HNVA 4HQEA 4CZCA 4C9YA 5J1UA 1R00A 5EYRA 2XRNA 1SFEA 5FB2A 3GFMA 4A3MJ 2XAQA 2EA4A 3OIPA 3A0HC 3PFIA 1LPQA 3KLOA 1XMXA 1XGSA 2EZIA 4DW6A 2VB6A 4IKFA 2BVMA 5EG0A 3AG4H 2IT0A 3J7AO 3E6BA 5ICEA 1V5GA 2NS0A 1T6SA 5FD5A 5ICFA 4D1QA 2IS1A 2COMA 3I0TA 4YEJA 2DLLA 1XPXA 3IKVA 4I6ZA 3GTQJ 4G6TB 2PQ8A 1LB2A 2JN6A 3EUAA 3OSGA 1P7IA 3C2BA 1TNTA 3C18A 1J0RA 3KP4A 4EM1A 1CF7A 1I6XA 1N77A 2DBBA 1TWGJ 2ZJRF 5FFZA 2KKOA 1ZGAA 2F4IA 1W5SA 1N78A 1BA5A 3JCUC 3PIOF 4QSHA 5LHHA 4Y17A 5ILUA 2W85A 3AFHA 2Y30A 1YJNI 2AXTC 4L0YB 3W6JB 1XDUA 3FX3A 2ECCA 2HDWA 2XASA 2DMQA 2XPWA 3TOAA 3BPVA 1LKXA 2WV1A 1LDJA 1EKEA 2VIXA 2D1VA 3NARA 2VT2A 1HBXG 2K85A 4RGXA 5AIQA 5H2FC 1D3YA 1H9GA 2WADA 2NS7A 3RIRA 3IWFA 2W25A 3GFLA 1OPCA 2MH9A 2XPUA 5EJCA 3CC4I 4AM3A 2QA4I 4U87A 2M4KA 3HSEA 2PG4A 1YS6A 2H6CA 3DQVC 4EJTA 5TGTA 5M5YJ 3MFKA 1FEXA 1BR2A 2E34A 4G7OF 3H5RA 2YUSA 1K79A 4FX0A 1B8IA 3CMAI 2DOEA 1KU2A 1Y39A 3V7CA 1W36D 3EPZA 3W6KB 1TWFJ 4EMSA 4BQAA 4JX4A 1G3YA 3ZMUA 3H5AA 3DBHB 1VQLI 3VSKA 4NBQA 3BDDA 5E17F 3UR3C 4IOCF 4HF0A 2DQLA 2DODA 2Q2EB 4E7IA 4I76A 2KZVA 1DU0A 1ETXA 4UVAA 4D7MA 2M34A 4IHSA 4AIHA 1H9TA 4ANJA 3IRQA 2OBPA 4M71A 2HU9A 2K9SA 3HRMA 3W2WA 5D5WB 1JI8A 3I71A 3E0JB 1HLVA 1HSTA 3HPGA 1CF7B 3TQNA 2A05A 2QQ8A 2ZMEA 4NC8A 4Q4ZF 3CCEI 4F93B 3GFJA 2IA1A 1FX7A 3CUQA 3OS0A 5BNGA 1BI2A 4WK8F 1MMNA 4EJVA 2L9VA 4D7NA 4PGHA 3F72A 3CMYA 1U8BA 1D8KA 4GYGA 3LMMA 3BZ6A 3ZRGA 3CCUI 2CFOA 3LL7A 3CCVI 4UV9A 1R58A 4QTRA 4CCOA 1S7AA 2H1KA 4Z6YA 5L3GA 2ME0A 4RB1A 1X3WB 4AWXB 1BR4A 3K4BA 2LTPA 3TW7A 3ZQ7A 5D5XB 2IGMA 5JHFA 2PMUA 3JRFA 1GVDA 2A3SA 2R7DA 2Z5UA 4BEHA 3FXOA 5LRSA 4FQGA 5D8KB 4ENNA 2Q8KA 3CZ6A 4XKBA 1RR8C 3KE2A 5C4XJ 3A0BC 1QA6A 4KFCA 4PJNA 5FROA 1Y8QB 3IRRA 3LSKA 2HYGD 2QGUA 1OCPA 5LGUA 1YRNA 1HC8A 1ZG3A 5E8GA 2EZHA 2G0EA 4XORA 4CH7A 2ZXHA 5LGNA 2BXYA 3FKJA 2UWMA 1FBQA 3E5QA 4M73A 3BR1A 2QEXI 3DFGA 3HGGA 4BY1J 1W0TA 2IP2A 5HDGA 1JKPC 3I55I 1YI2I 1F36A 1O7LA 1UHSA 4PCQA 5DTDA 2QSHX 2TDXA 2IS4A 1KU7A 2F48A 3J7AY 5LBQA 4KJZA 1QPMA 3HUGB 1QPIA 1RPWA 1EH7A 4RGUA 2NVYJ 5GAHJ 2MLGA 3UNGC 3S3NA 1LQ1A 2IGKA 1JGSA 1QHGA 1R71A 2R0QC 3IHUA 4M9XA 3DTEA 2R4GA 2X4HA 2J5PA 1JT6A 2O7OA 2M4GA 1HDDC 1KU9A 4XOPA 2W48A 4XRMA 2D45A 2VE8A 5FLVA 3KETA 5BMZA 2VL8A 5J4VA 1OYYA 1OYWA 4RB0A 2BY2A 2A68F 3DTIA 3MZ8A 1ON1A 1E0EA 1DGWY 4G7ZF 5J8FA 4ENKA 2QF7A 3BG7A 3CMMA 5GADJ 3I59A 2B63J 4PZJA 4M3GA 1IN7A 4OIRF 2HNHA 3DKWA 1MZBA 4L5IA 1REPC 2XDVA 1IV8A 1XS9A 4RAZA 2P81A 1YHQI 1POGA 2F6CA 2VKEA 5HDKA 3DKXA 4N4NB 2CQXA 2HYFA 2M8EA 2VJ4A 4CGZA 1T2KA 2HXIA 3OS2A 3JRIA 5DDGA 2HQ5A 2K9MA 4HSTA 4CCLA 3MN2A 3QU3A 2L9SA 2CO5A 1MH3A 3QODA 4LGWA 3T5XA 2HEOA 4D5CA 1MJAA 2K3FA 1IRGA 1SD5A 5HOOA 3U2RA 3FHNA 2E5NA 1MBHA 1QRYA 2X6WA 1MMSA 3CJTB 3TW6A 3GTLJ 2AQFA 2Z99A 2DW4A 1QQIA 2NNYA 2LG4A 3FXRA 1E3OC 2JT1A 2E1MB 1T95A 1Q1VA 4FISA 4OAYA 2COBA 3HEFA 1D0XA 1IF1A 4J19A 1ODDA 3MZYA 4OMZA 4GDFA 3OR2C 3NAUA 2OF7A 4CYCA 4CXFA 2QKMB 4MGRA 2OAZA 2QQBA 1W5TA 1DPRA 1ZELA 3HDDA 1N25A 3LA7A 3PSIA 2HI3A 2HTJA 1UCRA 1SMTA 5CVVA 5ICCA 3FK7A 1MGTA 3OV8A 5ICGA 2HOEA 2VT3A 3ABMH 4BUPA 3BOQA 2WB1A 4A3BJ 4BJ6C 4EQQA 4NB5A 1FY7A 4YELA 3X2QH 2LYCA 3JAMK 3TP0A 4XKWA 2FMLA 4YG2F 3LSTA 2DJNA 4CA0A 2EV0A 4HNTA 3FMRA 4MO7A 1G3WA 5J1RA 1IDYA 2HDCA 1Y0NA 1U5TC 4CCKA 2JA2A 4UHTA 3KPHA 4IPAA 4U7BA 4CUGA 4WXDA 3LSRA 2VBXA 3DPUA 3BC8A 2X6YA 3WTVC 2ID6A 3E3VA 3HIFA 5DD4A 2HQRA 3K4NA 1T33A 4II2A 2IBDA 5JFRA 3LNQA 1U8RA 1NG6A 1RIOH 2L01A 2EIMH 1A5JA 1TZLA 1FPQA 2NVUB 5L3BA 2CQNA 1R1UA 2KRCA 2ME6A 4C2TA 3OMYA 2W4SA 2M7BA 3FXUA 4A3DJ 4KUMA 3V8KA 3ASOH 1E3PA 4A5NA 1VZ0A 2M0CA 3M1CA 4UVBA 1TBXA 4EM0B 3BG5A 2GZWA 3WGGA 1FTTA 2RDPA 5KK1A 4JK1X 5ERIA 3TGNA 1ON2A 1YIJI 2DT6A 4RBOA 4DZJA 3DU6A 2M8GX 3FIWA 1LFUP 2E2HJ 4YFKF 3MKZA 3HTUA 3D0SA 1OCOH 2FA5A 3M8EA 3KIOA 1X3UA 2DOAA 1R5HA 4WXHA 3VPRA 3BR0A 4HX8A 3HKZN 4Q5SF 3CQZJ 2VQLA 2HTSA 3SDGA 4LJZF 2XPVA 4IHXA 4HOBA 3H35A 2A69F 5E1WA 3A4CA 4KN4X 1WGXA 4C2MJ 3CCQI 2B9SA 1D5YA 3S16J 3VFZA 1X4PA 1PP8F 3SZPA 2JZYA 4BJ5C 4YRVA 5GAEJ 1XB4A 4A3CJ 4V19K 4A3LJ 4E7HA 1IUYA 1TNSA 5KAFC 4Y13A 3HXLA 2R93J 2LREA 2O03A 3EETA 5FFXA 2FD5A 5E79C 2K9QA 3JREA 1X1BA 3I58A 2OPTA 5K7FA 3K70D 4A3JJ 3V42A 1P4AA 4AC0A 2KIMA 2CRGA 5IYBJ 4PGGA 1TW2A 4P1WA 5BS6A 4KNYA 3JRBA 4CHUA 1OMIA 3A1YA 2X1DA 3BY6A 2W82A 3BTLA 3LSHA 2QM3A 1FYMA 3L9FA 2XUBA 1JHHA 2ISZA 4XLCA 3ZOBA 3FMSA 4HG2A 3M3YJ 3R60A 3H0GJ 2LRDA 1QZZA 4JX5A 4HNUA 3SEZA 3I4PA 2KFDA 1IRXA 1V4RA 5HS8A 1OR7C 4P55A 1YJWI 4CYCB 4M3DA 2NNNA 3BCAA 4AIJA 3A02A 1ZYRF 2IVMA 3KYCB 3ZQHA 3OYDA 1ZRDA 1OFCX 4N9HA 5GAGJ 3IAM2 2L7ZA 2VN2A 4M3FA 3M9AA 3L2UA 5DUKA 3R61A 4W1UA 1F5TA 3D5LA 2JRTA 5FRMA 3E5UA 2LY2A 2OUMA 3I64A 3QYFA 4CSWA 2J5OA 4H0EA 2RKHA 2DT7B 4CZZA 3GZNB 4V2GA 3HOXJ 3OYJA 3OYHA 1XGOA 3S3OA 5F1RA 1GUUA 3CJRB 4BHCA 1CQTA 3I9V2 3J7ZI 1HQCA 4B43A 2K02A 2IA2A 3ABLH 3CTAA 1UAAA 3TOBA 5FLXZ 4RLFA 3I4MJ 1TW3A 2FF4A 1IN5A 3M8FA 1VQ6I 2X1EA 4DBRA 3S32A 1PVEA 4ABZA 4BYYA 2VPRA 1I3QJ 4U88A 1K4TA 3JTGA 3BCBA 1QGPA 4DYQA 2FBKA 3T8RA 1BI3A 2NRAC 2PI0A 3K4CA 3O6BB 4PK4A 2E71A 1UELB 1S8NA 1X1PA 1BJZA 4XK4A 2HOAA 3WODF 4BGDA 5C3EJ 3LSPA 2ICWG 2MLKA 4FTHA 1DUXC 1Y56A 3SZTA 5D4RA 4I02A 4IX7A 2D1HA 1V3FA 2OA4A 4B1RA 1J2XA 2KRHA 2F5FA 2KT0A 1ZRFA 2BW3B 3RTRA 2HKXA 3DTKA 5GTHC 4IRIA 2MA3A 2LMDA 2PMHA 1T8IA 1K83J 3WHBA 3JR9A 1R5GA 3B73A 3S2WA 3HYIA 5EGOA 3VSLA 3HOSA 3Q0UA 2GM4A 1VQ8I 3HZJA 5TJJA 4IHYA 5CQGA 5DM6F 5E20A 2BY0A 1W5CC 1FOXA 2F4OB 3F9KA 1JUMA 1XSXA 4DYRA 3R0JA 4ZZLA 4ETSA 4KITB 3U21A 3VYUB 4A2UA 2A6EF 3RKYA 1R22A 4M74A 2G7HA 4ZH4F 5L3FA 2GWRA 1BOAA 3RQIA 1BI0A 1WFXA 2MH2A 1K61A 3DBLB 3D1NI 1BJAA 1ONVA 2I10A 4HLXA 4XONA 3U1KA 3HKZA 4F7ZA 2DTZA 5DM7F 3KP5A 5CQEA 1NK3P 1U5TA 2HXOA 3QRFF 1W7PA 1YITI 1Z0XA 4IF4A 4I2OA 5IYCJ 4RS8A 2BV6A 3E7LA 5FGMA 2PN6A 2FMYA 2FJ1A 2DMTA 2RQQA 1IZ1A 3Q3SA 4CCJA 3OYBA 2P5KA 3HC7A 2QVOA 3AG2H 3DV8A 5J6XA 1IN6A 4R1HA 2QENA 4ZTJA 1P7JA 4O5VA 2Z9OA 1SD7A 3LWFA 4U0VA 2QBYA 2KIQA 3LSJA 3TBIA 1TWAJ 2ZO4A 3CESA 3KZZA 4ITVA 3ML6A 5K5QA 3ZPLA 4OMYA 5CVRA 3F8MA 2DO7A 3OYLA 5E1XA 5KAIC 2R7OA 2XSJC 5J1YA 1ACIA 1G3SA 5LEKA 3MMYB 4BQOA 2TCTA 1FP2A 3K2ZA 2DFIA 1Z05A 4EJUA 5DS9A 1DDNA 1V5FA 2FUG2 4BXUA 4X1EA 2ZFUA 4P96A 3FF5A 4X6AJ 4HSRA 1U9NA 4DJAA 2OQGA 3GMEA 2GBYA 1IW7F 4UUVA 4TV7A 4XKCA 2V1NA 2IS6A 1BOBA 3AG1H 1ZG1A 5ED4A 3JRHA 2STWA 2ELKA 4P5OA 4I98B 3HL2A 6PAXA 5HVQC 2XAHA 3SHFA 3QU6A 2MD0A 2UUZA 2PJRA 1R5ID 1ETVA 3DP7A 1WPKA 2P5VA 1FBUA 1ETYA 1D5VA 3ZQCA 4F52A 1YQAA 2JK3A 2HDDA 3UKGA 1HW2A 4BDZA 2CG4A 2UXXA 3LQQA 3RKWA 3CCMI 1FOKA 4IRGA 2VXZA 1D1BA 5J40A 4RDUA 1IN4A 2WY7Q 4KIBA 2R7RA 2LR8A 2VKDA 3LOCA 2XGXA 4UNOA 4RGSA 3CMEI 4F92B 2XGDA 2CUZA 3B6AA 1RKWA 3HHHA 3KFWX 4ESFA 3FZVA 1TLHB 1LFBA 2HZTA 3LSMA 2HQNA 4NC7A 2K9NA 4M9ZA 5F1JA 2FBHA 5GP9A 3IV5A 3EUHC 1ZARA 5LHIA 2GXGA 3GX4X 2TRTA 2QWWA 1RNLA 4FE4A 1UG2A 3GWZA 3BP8A 3ABUA 3S2HJ 3G1LA 4L18B 1R23A 1USTA 3ELKA 4M72A 1I50J 2VQGA 3TKYA 1LDDA 4E7ZA 1O57A 3TP3A 1VQ4I 3GXOA 1H0MA 1IDZA 2JA7J 3RCOA 3CJQB 3HGYA 2ZB9A 2VOPA 3KP2A 1EF4A 1XSDA 1H88C 4IHWA 2QSFX 2ZJQF 2WV0A 4XSXF 2DXIA 1U3EM 5IT9Z 1MJ9A 1ERDA 3FHZA 1LDKB 3PNYA 1FYLA 2W1OA 5IOYA 1R7JA 1G8XA 2DA5A 1VQPI 1I1SA 4Y4RA 4HV5A 5HLIA 3K2AA 4KDPA 3S14J 1YRNB 4WWCA 4KYWA 2M2EA 1BC8C 2F5VA 3E5XA 3R6SA 4BU2A 4IHVA 3TO7A 5J3LA 1YW7A 2O8KA 3FISA 3BR2A 4PJJA 1B72A 4EJOA 5DD8A 3L2WA 3GTOJ 3W2VA 2VKVA 1XSVA 2MC4A 2F5EA 3ZR8X 5HNFA 3HOWJ 4RM3A 2OC6A 2X51A 2PMZA 3ZQIA 3D5RC 2Y2ZA 3ZXSA 5DV5A 4ZYGA 2EWNA 3KP3A 1WZ2A 4RB2C 3NQOA 5BQTA 2FQ4A 1HXDA 1SAUA 1FMWA 4AYBN 2OTJI 2ZBKA 4BNCA 2EV6A 1P6RA 1O3SA 1Y1WJ 1FBSA 3K1PA 3JRCA 3N05A 1GXQA 2QCOA 2VBZA 4JP0A 2XGEA 2B0LA 3KEYA 1Z77A 2DA7A 1MH4A 1WJCA 4GFBA 1JKRC 2BY3A 1WJDA 2QLZA 4IXAA 2PMZN 2CGPA 4EATA 1T39A 2EPFA 4XQFA 4BBSJ 1ZTRA 3IH2A 5IP7J 2LH9A 2R7ZJ 5LFAA 2L9RA 4B3AA 2JUCA 5CVIA 2L7MP 4I0AA 4R79A 2PEXA 3RKQA 2STTA 1BW5A 4RB3C 4B09A 2DCEA 2ACJA 3H9QA 2OZUA 1ETQA 1W4MA 3GLXA 1V54H 3GFIA 1B4AA 3HOYJ 1S3JA 2FXAA 3PSFA 2KDZA 2Y9YA 3OYAA 3K4JA 3MKLA 4M3EA 4OOIA 4N9IA 2VODA 4BKXA 3EDPA 4FX4A 1A31A 2V6CA 3FBIB 1YIOA 3CLQA 4S05A 3PO2J 2K4BA 4S0HB 3GW2A 3TDUC 1G2HA 2XVCA 3RDIA 3KEOA 3Q9SA 4Y33A 3H36A 4CDGA 1B72B 2ID3A 1UG0A 1OJLA 1GLNA 4P9FA 3CC2I 4BE2A 1K6OA 1T0FC 5D6EA 2MG4A 1APLC 2JMWA 3JRAA 1S7OA 2RAEA 2V4JC 2MC3A 3E6DA 2ZC2A 1JGGA 2LNBA 3DEEA 2VJJA 2DU9A 3E6MA 2L02A 3BT9A 2JTVA 1O3QA 4OU0A 2XAUA 1FLIA 1LEBA 1NG7A 2H8RA 1XCBA 2GAUA 3OR1C 4BJTA 1Z3YA 1PP7U 2XF7A 5BPDA 3CP8A 4E6KG 5E1ZB 3WG9A 5EF6A 9ANTA 3M4OJ 4PUSA 2W84A 4A3GJ 1IGNA 1KA8A 4N4OB 1D1AA 4XKVA 1P4WA 5F08A 2VQHA 1HOMA 4HF1A 2XAFA 1AHDP 2FNAA 3G1MA 2L9NA 1U9OA 3QAHA 2DA4A 3SFZA 1U5TB 2MABA 4JYKA 2KMUA 2VPLA 1SVMA 4I0BA 1JKOC 3MKYB 4UY8I 4JOMA 1BL0A 4Y15A 3RI4A 3Q9VA 3G3ZA 1P2FA 3HOTA 5JVGF 2E35A 3GVAA 4KA4A 1KYWA 4MLOA 2HS5A 1TQIA 3ULQB 1YOVB 2D2WA 4Q47A 2ZXWH 2DAOA 5KCMA 2CFXA 5KNLA 2HOSA 1S72I 1JXSA 2M3AA 4AVPA 3DPLC 4NNJA 1OR7A 1QVTA 3KZIC 3K1MA 4CO8A 3OSFA 2ZXIA 1VQMI 3C7JA 3CDLA 2L54A 4A0XA 3DLLF 1I27A 4BL0B 3V7SA 2L2OA 3FM5A 3DCFA 3S1QJ 3LQRA 1SFOJ 4LIUA 4NQWA 2FE3A 1O4XA 3J7YJ 2LOOA 3GCMA 3S1MJ 1EH8A 1MDMB 4J00A 2VASA 2DMNA 3J80K 2L5QA 4HRIA 2DDBA 1BBYA 1GVJA 3HRUA 2P7VB 1VQOI 5D8LB 1TP4A 4X0GA 4XIDA 2R7WA 1QVUA 2WBMA 3F3XA 3S17J 2KIFA 2L4MA 3H5NA 2V1UA 2GIZA 5EZGA 1M1EB 3JAMZ 4ZDPA 3BWGA 2K3PA 4E7LA 2VXDA 2CMPA 1UHWA 4OIQF 3L00A 4M6XA 4IVNA 2R7TA 3ZMSA 2OZ6A 2LF8A 3PQJA 1Y0UA 4IOAF 1U78A 2IAIA 2EH3A 2VUMJ 4RAFA 2EZKA 3MD2A 2QSGX 3CCRI 2RREA 5DCMA 5F6FA 3T1BA 1AOYA 2VJIA 2VQCA 2O9LA 2YS9A 2XB5A 4L9VA 3DKYA 2E7WA 5JI6A 1E2XA 3WE3A 1WHUA 4XLNF 2P4WA 3OYIA 2N8GA 4BH9A 2RV8A 1Z1DA 4CICA 4A3EJ 3FK6A 3FMQA 4ZDLA 3H0DA 2WAFA 2EBIA 4II3A 5FKKA 1K6YA 5GTIC 2X1CA 3QYBA 1X1CA 2YSRA 4D9JA 3K10A 2ZKZA 1V5EA 2E7XA 3WTYC 1Z6TA 5B1AH 4LMYA 3LSGA 3I53A 3P5JA 4AD9A 5J47A 4EGYA 2EFOA 4E70A 3DF8A 3IUOA 4KICA 2GIVA 1J75A 2CS3A 4WCGA 2CUEA 2YX4A 1USSA 2JJ7A 4XLEA 3ZGKA 1UFMA 3CDIA 2M1BA 4A3FJ 3M1EA 2NAZA 4LB6B 2FOWA 5HNHA 3CO7C 1ZQ3P 2OCCH 1BM9A 2XC7A 4EJWA 2CV2A 1MW7A 2WA0A 5F0HA 5CKTA 4E7KA 2IRFG 2JA5J 3K1NA 4F55A 1FIPA 3VOEA 1NH3A 1RESA 4A3IJ 3SDBA 4MEXF 5FD6A 3MKWB 2XF6A 2XRLA 3LFKA 3J81K 4WF2A 1YX3A 1I5ZA 5EEGA 1YFHA 3F8FA 1W0UA 1P92A 1K78B 4KT6A 3KYLA 3F0CA 2LKXA 2K86A 1R4NB 3BQYA 2HVQA 2E1CA 2G7UA 3S3MA 4RMNA 2CW0F 5J4YA 3HRSA 1ZLJA 5TRDA 1Z21A 4XRFA 2X6OA 1MNDA 3AAFA 4XLAA 5E3NA 2CW8A 4H4KC 2Y48A 3RZDJ 2L7FP 4BQNA 3JTHA 5GPAA 1G6NA 1FTZA 4I09A 1HSJA 1MNEA 4GRIA 2ZNYA 4V2FA 2YU9J 2CSOA 2MSYA 2RN7A 4BACA 2DYRH 2UV1A 1EV7A 2EFWA 3I5UA 3B02A 4W97A 3KEQA 2DTRA 4LK0F 3HJEA 3L2QA 1WJ5A 2Y0SN 3BZKA 3I59B 2VLAA 1S6LA 3VYRB 2QBYB 3G6EI 2V9PA 1IN8A 1A04A 3H3ZA 1JTYA 2JPCA 2EJRA 4B44A 1STZA 2ZMEB 4YIFA 2L4AA 2DJIA 4MNUA 1JJ6C 1IO2A 4ON0A 2R7XA 5EGOB 3ZQGA 2YPRA 1Z6RA 3OWTA 3TEDA 3T0YA 4Q48A 1HKSA 4ZJZA 5HDNA 1X3ZB 2BVLA 4N0BA 2BYVE 2FU4A 3EQLF 1ETKA 2P7CB 1YW8A 1T08B 1WH7A 2JVHA 3Q0VA 1VQ7I 3K4KA 2DA3A 2DK5A 4YFXF
chains in the Genus database with same CATH topology
4KN7X 2KPMA 1ZHFA 1UHMA 4IJAA 4B8XA 3F6VA 4IRHA 3EYIA 3HRTA 4FT8A 2H6BA 5HLGA 3HG9A 1IRFA 1YW9A 2VC1A 4EVIA 2O3FA 2K9LA 3MAJA 2JSPA 1P4XA 1FC3A 5H20A 4DBQA 3L2CA 1QO0D 4BHBA 1LEAA 1KU3A 2ZJ2A 1VTNC 3P9IA 3ZP5A 2LC2A 2ZSHB 2V6EA 3W2AA 3PNVA 1QZYA 4EV0A 4LG0A 3OL3A 1P9QC 1MD0A 4ZYDA 4BE1A 4G9YA 2VBWA 2JVGA 3CUOA 2LDUA 4B3XA 2K27A 5HLHA 3QP5A 1MMAA 4A6DA 4A6EA 2VC0A 3RPUA 2CW7A 3QPHA 1MKMA 1R1VA 2QQAA 3FWEA 1QBJA 1WJBA 3K6GA 1MMGA 2A6HF 2HWVA 3J81Z 3E1SA 4CYDA 2CV1A 3LAPA 2EFQA 2DT5A 3E97A 3FDYA 3OYEA 3TMOA 3V4GA 1JHFA 5FO5A 4NHJA 3T8TA 4KT5C 2H09A 2M5WA 4J01A 4ASNA 1WKMA 2P6SA 3VDXA 2JSCA 5IT3A 1D0YA 4PSWA 1WI9A 3GZ6A 1ZREA 3VB2A 5KVRA 4YIIA 4GXOA 1SFKA 4XL9A 5HLTA 4LLNA 4RAYA 5CVUA 2IJLA 5DCFA 5CVJA 2G9WA 3LA2A 4HW0A 4IHTA 3DEUA 3MWMA 4L0ZB 2M87A 4ZYAA 2IPQX 3TDZC 3N97A 5D5UB 3BROA 2L7KA 3QOPA 4RGRA 4LLLA 4LFUA 4G8XA 2AS5F 2V1XA 1W7PD 1Z7LA 2BBYA 3OIQA 2XKPA 3C3WA 2ZXJA 2GXBA 2AQEA 1YG2A 2E1NA 3U1DA 4M9SA 3RKXA 1FSHA 5H6RA 4MQVA 4JBAA 1O7FA 1WWXA 5LD2C 2YU3A 3L09A 1J9IA 4U0YA 4ESJA 2DPUA 2CV0A 4HX4A 5K1YA 2GOMA 2GA1A 3ABTA 1C0WA 1IXSB 2X85A 1Z7UA 1BR1A 1BIBA 2HKOA 1DQUA 3KX2A 1X1AA 3G2BA 1FYKA 2CQKA 2XAGA 2WC2A 2W00A 1Y6IA 4G94A 3ERED 2HGCA 3G73A 5FRNA 3SQNA 2BGCA 3KZYA 3AKZA 5ILVA 2OV7A 2FNPA 2YR2A 4PFOA 4G7HF 1XGNA 2OU2A 5HS7A 1G3TA 2H94A 4ENJA 5CLSA 4LK1F 1PUEE 1W36C 4RLQA 3SZGA 2BW3A 1LJ9A 1TQPA 2RNJA 4PJLA 2HZDA 1D0ZA 2UZKA 2HFHA 3HUGA 5E18F 5AIPA 3OYCA 1X1DA 1DGRM 3NWTA 3I54A 2R7VA 2JPBA 2ZFWA 4Y3OA 1T38A 2V9KA 3CJNA 4LG3A 2ZSIB 3WTWC 2K7LA 5DYMA 3NWSA 1K7AA 2HVRA 3OYNA 4HDUA 4BE0A 4F3QA 5LHGA 2PFBA 3TO9A 4DOZA 3BJAA 4BQQA 3CP2A 2ETHA 2V7FA 3OYGA 3PL8A 3KP6A 4XMYA 2YX7A 2FSWA 4QLCU 3CDHA 4ZC3A 3HSFA 1NHAA 3OOUA 4HAMA 3U9GA 1BIAA 2KQRA 2BEOA 1U2WA 2QUFA 1GXPA 5D6FA 1L0OC 3R4KA 3SXYA 3RJPA 2NYXA 2XROA 3VYTB 2HPMA 3W3CA 5LEJA 2W57A 2V1DA 3OYFA 1SFXA 3L2RA 4IQJA 2V79A 1YO5C 1TT0A 3RPQA 5BOXA 3ZMZA 5FLXK 2BE5F 1IAWA 4BDYA 4MHGA 1B59A 2DK8A 2Q1ZB 3QP6A 4ZDOA 1GHCA 1ZN2A 2L3DA 1YS7A 3ECHA 3REOA 2Z33A 4HYEA 3P9CA 2IW5A 2BOLA 1RZ4A 2Z16A 3E6CC 4XN0A 1Z9CA 5DUIA 4FASD 1AWCA 4B47A 4UXNA 1EH6A 3BLYA 1PYVA 3ISPA 1FNNA 2MFZA 4B48A 4OIPF 2EB7A 4FETA 2K5CA 1WQ2A 3CLOA 2I8DA 4U0WA 5AONA 4LIVA 3WTZA 3EUHA 3F6OA 2VKHA 3H9JA 4GCVA 3V8LA 3KP7A 1WJEA 1XMAA 3KLNA 4R8HA 2PLYA 2WTEA 3ZN0A 4AU7A 3ZN1A 2WWYA 2GQQA 4Z2YA 4KIGA 1S29A 2R7QA 1WJFA 1WSUA 3BPXA 4OWRB 3PJRA 3H9GA 3BG6A 3H92A 2FOKA 3IL2A 1L3LA 5IT9K 4XLFA 1AA7A 1MDMA 2X6XA 4CCMA 3K69A 3RPUD 2CWEA 3OYMA 1X4OA 3RSNA 3A2KA 1F1ZA 5LRRA 4IQ4A 5CJ9A 1B9MA 2W24A 3FM3A 3HHGA 4L9JA 4OIOF 1RI7A 1QNTA 1Z91A 4HQMA 3WE2A 3J80Z 1B6AA 3GZ5A 2H27A 1OYIA 5JHUA 2A07F 4AIKA 4XM3A 3GO5A 3P7NA 2FBIA 3O3KA 2KRFA 1SAXA 1OKRA 2Y75A 4QPOA 2LKPA 4LB5A 3ONQA 3CUQB 1KQ8A 2HVSA 1SD4A 4G6DA 1RUOA 4OINF 2P0WA 2A61A 2WY8Q 3CO6C 1HA8A 4HPQA 3WU1B 4E4HA 3K70C 1DP3A 3TL4X 2M30A 1B9NA 4AYBA 4MQ9F 1MJBA 2DI3A 4E7SA 3PQKA 5A2QK 2QYOA 1FP1D 4G6QA 3F22A 3MCZA 5HS9A 1TQMA 2GA2A 4PJMA 3WTSC 3LA3A 2NOJB 2XAJA 4L9TA 1N75A 2EA2A 5L3CA 3HTSB 5D5VB 2VOOA 2KP6A 4AVZA 3MQ0A 5K5RA 2ISYA 4RM2A 5KHDA 2K4JA 3KCCA 4XBFA 3VEPA 4PSXA 3OYKA 4A12A 1SMYF 4DGWB 2LF7A 3NRVA 1PJRA 1ZH5A 3L2VA 3RYRA 1KGSA 5BPIA 5A2QZ 4DQ2A 4UV8A 3N4MA 1SD6A 1XN7A 1WRJA 1ULYA 1KQ9A 1LFPA 2IXSA 3K4LA 4WXCA 3WU0A 3K0LA 2KLOA 4NQWB 1LVKA 2E60A 4HF2A 4ZYEA 5EEHA 4LLGF 1ZLKA 3AL0C 2W7NA 2LSOA 4S04A 4A0ZA 2KJBA 5L3EA 4A0YA 4HDVA 2R3SA 3RQ4A 3VODA 5J8CA 2JUGA 5F64A 4IZZA 1CGPA 2ESHA 2O0YA 4YFNF 2X0LA 3V7RA 1J59A 5E8IA 3SYTA 3MEXA 4P9UA 4XNFA 4ENMA 1R1TA 3QPTA 5JR3A 4OAZA 1PDNC 3AL0B 3MZHA 4EGZA 2EFNA 3JW4A 3F8NA 2FQ3A 1F9NA 3DPTA 1MMDA 3R0AA 2ELHA 4HX7A 4WX9A 2C6YA 4GYIA 3EUKL 2XKOA 2P5LC 5CPRB 2A5YB 2A5WA 4DNCA 3IKTA 1T98A 2XIGA 2F5CA 4XSZF 4F91B 4MTEA 4PDKA 3C2GA 1SFUA 1XCVA 2HR3A 3LAJA 2Y0SA 1WJAA 3ECOA 3JSPA 5H6QA 1QU3A 3FBNB 2IGOA 3GEZA 1YTYA 3C2HA 3OY9A 2R7UA 3OL4A 2LBFB 2IA0A 1LNWA 3OS1A 3LSIA 3GF2A 1HKQA 4LD5A 3CF2A 3HPHA 1XD7A 4XOTA 4NUBA 2IS2A 3C1DA 3F21A 4C30A 2P8TA 3DXJF 1UB9A 3F8CA 4BHPA 4HBLA 2DPDA 3PNTA 3BJOA 3QOEA 2MD5A 2VBYA 4CCNA 2VJ5A 1D1CA 4O3MA 1X19A 3ZQQA 3CUQC 1KONA 2CUJA 1HW5A 5ILSA 3RYPA 2HQAA 4ZZDA 2ELJA 4L5JA 3GYHX 1EA3A 2KIUA 3M8JA 2MBFA 2M0MA 2P6TA 4MTDA 1JE8A 3V8JA 3IAS2 4E7JA 1YYVA 2XF5A 3O2PE 2KDOA 2KL4A 3PUBA 2QKLB 2XV4S 3F8BA 5LGTA 2Z3YA 1W7PB 4HZFA 2WAQA 4ZTFA 4HEA2 2F2EA 1LVAA 2EK5A 2KHMA 4I7HA 1D8JA 2QQ9A 3SEQA 4LITA 3BJ6A 4LG0B 1R36A 1BI1A 4GGGA 4QPQA 2O8XA 2LY1A 2QZ8A 2E1MC 3S93A 2Z2SB 3P9KA 3TO6A 1U0JA 2Z1DA 5JVTA 2Q2EA 2ESNA 4XR6A 1BC7C 3I3LA 2ZCWA 4XLHA 3ROUA 2RVCA 1R6RA 4D0PA 3NEUA 1DP7P 1FMVA 2HPIA 2CYYA 4O6JA 1T0FA 1U6GA 2A6TA 2DQRA 5K5OA 2M7AA 4DIQA 3F23A 1HW1A 3DWLE 3WTUC 1Q1HA 1HKTA 2LBFA 3ZMVA 3IC7A 2FRHA 1DPUA 2UXNA 4KMUX 4BXFA 4ZYHA 1XMKA 4PFPA 3QYEA 2RQPA 5DEQA 2O6GE 1J5YA 4KIFA 3K9TA 2VONA 4C2UA 2EFPA 2XHKA 5D4SA 2PBIA 2Q0OA 1ZRCA 4KMFA 2M45A 2RGVA 1K78A 1TTYA 2AXLA 1XGMA 3WTTC 1YX5A 3ZMDA 4HV6A 2OQRA 4M6YA 3COAC 2E5ZA 1FZPB 1IXCA 4BS9A 3VWBA 2EV5A 2RC4A 3WGIA 2OD5A 1O3TA 4GO1A 3DU5A 5DCMB 3FXQA 4FHTA 4MEYF 3K4MA 3Q5FA 3VYSB 1FWZA 2FEZA 1KYZA 4QWQA 4A5MA 1YE9A 3GUDA 2VE9A 4EM2A 2CH0A 3S8PA 1B1BA 4UVCA 4KISA 1QHHD 2Y0MA 3HSRA 1RUNA 1Z3XA 2GOXB 1J7KA 1ZG5A 3M7GA 3ZCOA 1G59A 1BN5A 1I1GA 2ADUA 3ZMTA 2R7FA 3L7WA 1IXRC 2V9VA 2MYSA 1ZGJA 1FSEA 2V26A 2O61A 4XLPF 1OLTA 4U7DA 3IWZA 2R7SA 1G4DA 5LLQA 2WAEA 3WTXC 3PFYA 4HA8A 2KJCA 1ZAOA 2ZNZA 4BAYA 1O3RA 2IGNA 3D5SC 2RNGA 3EYYA 4XN3A 1KQ0A 1F4KA 2PJPA 3JSOA 4JQFA 2F5DA 4K2EA 3GBGA 3IP4B 3WGHA 2O5RA 3LFUA 1XDSA 1FT9A 3OOPA 1S9HA 4HLYA 4ESBA 4I01A 1E17A 3DLAA 2PJRB 5CYVA 5L3DA 1YLFA 3H3UA 4L9NA 1J09A 4HQEA 4BEHB 4CZCA 4C9YA 1R00A 2XRNA 1SFEA 5FB2A 3GFMA 2XAQA 2EA4A 3OIPA 3PFIA 3KLOA 1XGSA 2VB6A 4IKFA 2BVMA 2IT0A 3J7AO 3E6BA 5ICEA 1V5GA 2NS0A 1T6SA 5FD5A 5ICFA 4D1QA 2IS1A 2COMA 3I0TA 4YEJA 2DLLA 3IKVA 4G6TB 2PQ8A 1LB2A 3EUAA 1TNTA 3C18A 1J0RA 3KP4A 1CF7A 4EM1A 1I6XA 1N77A 2DBBA 5FFZA 2KKOA 1ZGAA 2F4IA 1W5SA 1N78A 5LHHA 4Y17A 5ILUA 2W85A 3AFHA 4L0YB 3W6JB 1XDUA 3FX3A 2HDWA 2XASA 3TOAA 3BPVA 1LKXA 1LDJA 2VIXA 2D1VA 2VT2A 1HBXG 4RGXA 5AIQA 1D3YA 1H9GA 2WADA 3RIRA 3IWFA 2W25A 2MH9A 1OPCA 3GFLA 4U87A 2M4KA 3HSEA 2PG4A 1YS6A 2H6CA 3DQVC 4EJTA 5TGTA 3MFKA 1BR2A 4G7OF 3H5RA 1K79A 4FX0A 1KU2A 3V7CA 1W36D 3EPZA 3W6KB 4EMSA 4BQAA 1G3YA 3ZMUA 3H5AA 3VSKA 3BDDA 5E17F 3UR3C 4HF0A 2DQLA 2Q2EB 4E7IA 2KZVA 4UVAA 4IHSA 4AIHA 1H9TA 4ANJA 3IRQA 2OBPA 4M71A 2HU9A 3HRMA 3W2WA 5D5WB 1JI8A 3I71A 3E0JB 1HSTA 3HPGA 1CF7B 3TQNA 2ZMEA 4NC8A 4Q4ZF 4F93B 3GFJA 2IA1A 1FX7A 3CUQA 3OS0A 1BI2A 4WK8F 1MMNA 4EJVA 4PGHA 3F72A 1D8KA 4GYGA 3LMMA 3BZ6A 3ZRGA 2CFOA 3LL7A 4UV9A 1R58A 4CCOA 1S7AA 5L3GA 4RB1A 4AWXB 1BR4A 3K4BA 3ZQ7A 5D5XB 2IGMA 5JHFA 2PMUA 2A3SA 2R7DA 2Z5UA 5LRSA 4ENNA 4BEHA 5D8KB 2Q8KA 3CZ6A 4XKBA 3KE2A 4KFCA 4PJNA 5FROA 3IRRA 3LSKA 2HYGD 5LGUA 1ZG3A 5E8GA 4XORA 4CH7A 5LGNA 2ZXHA 3FKJA 2UWMA 1FBQA 3E5QA 4M73A 3DFGA 2IP2A 5HDGA 1O7LA 4PCQA 2TDXA 2IS4A 1KU7A 3J7AY 5LBQA 4KJZA 1QPMA 3HUGB 1EH7A 4RGUA 2MLGA 3UNGC 1LQ1A 3S3NA 2IGKA 1JGSA 1QHGA 3IHUA 4M9XA 3DTEA 2R4GA 2X4HA 2J5PA 2M4GA 1KU9A 4XOPA 2D45A 2VE8A 3KETA 5BMZA 2VL8A 1OYYA 1OYWA 4RB0A 2A68F 3DTIA 1ON1A 1E0EA 1DGWY 4G7ZF 5J8FA 4ENKA 3BG7A 3CMMA 3I59A 4PZJA 4OIRF 1IN7A 1REPC 3DKWA 1MZBA 4L5IA 2HNHA 2XDVA 4RAZA 2F6CA 5HDKA 3DKXA 4N4NB 2HYFA 2M8EA 2VJ4A 4CGZA 1T2KA 3OS2A 5DDGA 2K9MA 4HSTA 4CCLA 3QU3A 2L9SA 2CO5A 3QODA 4LGWA 3T5XA 2HEOA 1MJAA 1IRGA 1SD5A 5HOOA 3U2RA 3FHNA 2E5NA 2X6WA 2AQFA 2Z99A 2DW4A 1QQIA 2NNYA 2LG4A 3FXRA 2JT1A 2E1MB 1T95A 4OAYA 1IF1A 1D0XA 1ODDA 3MZYA 4OMZA 3OR2C 4CXFA 2QKMB 4MGRA 2OAZA 2QQBA 1W5TA 1DPRA 1ZELA 3LA7A 3PSIA 2HTJA 1UCRA 1SMTA 5CVVA 5ICCA 1MGTA 3OV8A 5ICGA 2HOEA 2VT3A 4BUPA 3BOQA 2WB1A 4BJ6C 4EQQA 4NB5A 1FY7A 4YELA 2LYCA 3JAMK 4XKWA 2FMLA 4YG2F 3LSTA 4CA0A 2EV0A 4HNTA 3FMRA 1G3WA 2HDCA 1U5TC 4CCKA 2JA2A 4UHTA 4IPAA 4U7BA 4CUGA 4WXDA 2VBXA 3DPUA 3BC8A 2X6YA 3WTVC 3E3VA 3HIFA 5DD4A 2HQRA 3K4NA 4II2A 5JFRA 1U8RA 1RIOH 1NG6A 2L01A 1TZLA 1FPQA 5L3BA 1R1UA 2KRCA 4C2TA 3OMYA 2W4SA 2M7BA 3FXUA 4KUMA 3V8KA 4A5NA 4EM0B 1VZ0A 4UVBA 3M1CA 1TBXA 3WGGA 2GZWA 2RDPA 5KK1A 4JK1X 5ERIA 3TGNA 1ON2A 2DT6A 3DU6A 4YFKF 3MKZA 3HTUA 3D0SA 2FA5A 3M8EA 1X3UA 4WXHA 1R5HA 2DOAA 4HX8A 4Q5SF 2VQLA 2HTSA 4LJZF 4HOBA 3H35A 2A69F 5E1WA 3A4CA 4KN4X 3VFZA 1PP8F 1X4PA 3SZPA 2JZYA 4BJ5C 4YRVA 1XB4A 4E7HA 1IUYA 1TNSA 4Y13A 3HXLA 2O03A 2LREA 5FFXA 3EETA 1X1BA 3I58A 3K70D 3V42A 1P4AA 2KIMA 4PGGA 1TW2A 4P1WA 5BS6A 4KNYA 4CHUA 1OMIA 3A1YA 2X1DA 3BY6A 2W82A 3LSHA 2QM3A 1FYMA 3L9FA 2XUBA 1JHHA 2ISZA 4XLCA 3FMSA 4HG2A 3R60A 2LRDA 1QZZA 4HNUA 3SEZA 3I4PA 1IRXA 1V4RA 5HS8A 1OR7C 4P55A 2NNNA 3BCAA 4AIJA 1ZYRF 2IVMA 3OYDA 1ZRDA 4N9HA 3IAM2 2VN2A 1F5TA 3M9AA 5DUKA 3R61A 3L2UA 3D5LA 2JRTA 5FRMA 3E5UA 2LY2A 3I64A 2OUMA 3QYFA 4CSWA 2J5OA 4H0EA 2RKHA 2DT7B 4CZZA 3OYJA 3OYHA 1XGOA 3S3OA 5F1RA 3CJRB 4BHCA 3I9V2 1HQCA 4B43A 2K02A 2IA2A 3CTAA 1UAAA 3TOBA 5FLXZ 4RLFA 1TW3A 2FF4A 1IN5A 3M8FA 2X1EA 4DBRA 3S32A 4BYYA 4U88A 3JTGA 3BCBA 1QGPA 2FBKA 3T8RA 1BI3A 2NRAC 2PI0A 3K4CA 3O6BB 4PK4A 1UELB 1S8NA 4BGDA 3WODF 2MLKA 1DUXC 1Y56A 3SZTA 5D4RA 4I02A 4IX7A 2D1HA 1V3FA 2OA4A 1J2XA 2KRHA 2F5FA 1ZRFA 2BW3B 3RTRA 2HKXA 3DTKA 4IRIA 2MA3A 2PMHA 1R5GA 3B73A 3S2WA 3HYIA 3VSLA 3HOSA 5TJJA 5CQGA 5E20A 3F9KA 1XSXA 3R0JA 4ZZLA 4ETSA 4KITB 3U21A 3VYUB 4A2UA 2A6EF 3RKYA 1R22A 4M74A 2G7HA 4ZH4F 5L3FA 2GWRA 1BOAA 1BI0A 1WFXA 2MH2A 1BJAA 1ONVA 4HLXA 4F7ZA 4XONA 3HKZA 3KP5A 5CQEA 1U5TA 3QRFF 1W7PA 4IF4A 4I2OA 4RS8A 2BV6A 5FGMA 2PN6A 2FMYA 2RQQA 1IZ1A 3OYBA 4CCJA 2P5KA 3HC7A 2QVOA 3DV8A 5J6XA 1IN6A 4R1HA 2QENA 4ZTJA 4O5VA 2Z9OA 1SD7A 3LWFA 4U0VA 2QBYA 3TBIA 2ZO4A 3CESA 3KZZA 4ITVA 3ML6A 5K5QA 3ZPLA 4OMYA 5CVRA 3F8MA 2DO7A 3OYLA 5E1XA 2R7OA 2XSJC 5LEKA 1G3SA 3MMYB 4BQOA 1FP2A 3K2ZA 2DFIA 1Z05A 4EJUA 1DDNA 1V5FA 2FUG2 4BXUA 4P96A 2ZFUA 3FF5A 4HSRA 4DJAA 2OQGA 1IW7F 4UUVA 4TV7A 4XKCA 2V1NA 2IS6A 1ZG1A 1BOBA 5ED4A 2STWA 4P5OA 4I98B 3HL2A 6PAXA 5HVQC 2XAHA 3SHFA 3QU6A 2MD0A 2UUZA 2PJRA 3DP7A 2P5VA 1FBUA 1D5VA 4F52A 1YQAA 1HW2A 4BDZA 2CG4A 2UXXA 3LQQA 3RKWA 1FOKA 4IRGA 2VXZA 1D1BA 1IN4A 4KIBA 2WY7Q 2R7RA 2VKDA 2XGXA 4UNOA 4RGSA 4F92B 2CUZA 3HHHA 3KFWX 4ESFA 3FZVA 1TLHB 2HZTA 3LSMA 2HQNA 4NC7A 4M9ZA 2FBHA 3EUHC 1ZARA 5LHIA 2GXGA 3GX4X 2QWWA 1RNLA 3GWZA 3BP8A 3ABUA 4L18B 1R23A 1USTA 3ELKA 4M72A 2VQGA 3TKYA 4E7ZA 1LDDA 1O57A 3GXOA 1H0MA 3RCOA 3CJQB 2VOPA 3KP2A 1XSDA 2WV0A 4XSXF 2DXIA 1U3EM 5IT9Z 1MJ9A 1ERDA 3FHZA 1LDKB 3PNYA 1FYLA 2W1OA 1R7JA 1G8XA 1I1SA 4Y4RA 4HV5A 5HLIA 4KDPA 4WWCA 4KYWA 1BC8C 2F5VA 3E5XA 3R6SA 4BU2A 3TO7A 1YW7A 4PJJA 4EJOA 5DD8A 3L2WA 3W2VA 1XSVA 2MC4A 2F5EA 3ZR8X 5HNFA 4RM3A 2OC6A 2X51A 2PMZA 3D5RC 3ZXSA 5DV5A 4ZYGA 2EWNA 3KP3A 4RB2C 3NQOA 5BQTA 1HXDA 1SAUA 1FMWA 2ZBKA 4BNCA 2EV6A 1P6RA 1O3SA 1FBSA 3K1PA 3N05A 1GXQA 2VBZA 3KEYA 2B0LA 1WJCA 1WJDA 2QLZA 4IXAA 2CGPA 4EATA 1T39A 4XQFA 2LH9A 5LFAA 5CVIA 4I0AA 4R79A 2PEXA 2STTA 4RB3C 4B09A 2DCEA 2ACJA 3H9QA 2OZUA 1W4MA 3GLXA 3GFIA 1B4AA 1S3JA 2FXAA 3PSFA 3OYAA 3K4JA 4OOIA 4N9IA 2VODA 3EDPA 4FX4A 2V6CA 3FBIB 1YIOA 4S05A 2K4BA 3GW2A 3TDUC 2XVCA 3RDIA 3KEOA 3Q9SA 4Y33A 4CDGA 1UG0A 4P9FA 1GLNA 4BE2A 1K6OA 5D6EA 1T0FC 1S7OA 2V4JC 2MC3A 3E6DA 2LNBA 3DEEA 2VJJA 2DU9A 3E6MA 2L02A 2JTVA 1O3QA 4OU0A 2XAUA 1FLIA 1LEBA 1NG7A 1XCBA 2GAUA 3OR1C 4BJTA 1Z3YA 1PP7U 5BPDA 2XF7A 3CP8A 4E6KG 5E1ZB 3WG9A 4PUSA 2W84A 1KA8A 4N4OB 1D1AA 4XKVA 1P4WA 2VQHA 4HF1A 2XAFA 2FNAA 2L9NA 3SFZA 3QAHA 1U5TB 2MABA 2KMUA 2VPLA 4I0BA 3MKYB 4JOMA 4Y15A 3RI4A 3Q9VA 3G3ZA 1P2FA 3HOTA 4KA4A 3GVAA 1KYWA 4MLOA 2HS5A 1TQIA 3ULQB 2D2WA 4Q47A 2DAOA 5KCMA 2CFXA 1JXSA 5KNLA 2M3AA 4AVPA 3DPLC 4NNJA 1OR7A 3K1MA 4CO8A 2ZXIA 3C7JA 2L54A 4A0XA 1I27A 4BL0B 3V7SA 3FM5A 2L2OA 3LQRA 4LIUA 4NQWA 2FE3A 2LOOA 1EH8A 1MDMB 4J00A 2VASA 3J80K 2L5QA 4HRIA 1BBYA 1GVJA 3HRUA 2P7VB 5D8LB 4X0GA 2R7WA 2WBMA 3F3XA 2KIFA 2L4MA 2V1UA 3H5NA 3JAMZ 4ZDPA 3BWGA 2K3PA 4E7LA 2VXDA 4OIQF 1UHWA 2CMPA 3L00A 4M6XA 4IVNA 2R7TA 3ZMSA 2OZ6A 2LF8A 3PQJA 1Y0UA 1U78A 3MD2A 5DCMA 5F6FA 2RREA 3T1BA 1AOYA 2VJIA 2VQCA 4L9VA 3DKYA 2E7WA 5JI6A 1E2XA 3WE3A 4XLNF 2P4WA