3D5LA

Crystal structure of regulatory protein recx
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
LAKISKIEAQKRKGRYNIYLDGKYAFPVAESVLIQFRLMKGTELDEKQIAAIATADQQAKAYSRMLDYLSYQMRTESDIVKKLKEIDTPEEFVEPILKKLRGQQLIDDHAYAASYVRTMINTDLKGPGIIRQHLRQKGIGESDIDDALTQFTPEVQAELAKKLALKLFRRYRNQPERRREQKVQQGLTTKGFSSSVYEMIKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Signaling protein
molecule keywords Regulatory protein RecX
publication title Crystal structure of DNA repair regulatory protein RecX.
rcsb
source organism Lactobacillus reuteri
total genus 74
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA03
1.10.10.2800 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5lA01
4ZZLA 4ZYHA 2XASA 3M7GA 4GO1A 4O6JA 4AIJA 3E97A 4IXAA 2VOPA 1UCRA 1FSHA 4UV9A 3CDHA 2FU4A 2LNBA 2P5VA 2NNYA 4IVNA 2FBKA 2KRFA 2O0YA 3IC7A 3R6SA 5JR3A 2HKOA 1BM9A 3IRRA 1OPCA 1R00A 4HDVA 4ENKA 2P5KA 1F9NA 1P2FA 1RI7A 5E17F 2Q0OA 2EV5A 4MQ9F 1TNSA 4AIKA 1YS7A 4WK8F 5A2QZ 1VTNC 1FNNA 4HOBA 3IWZA 4PGGA 5FLXZ 4G6DA 5H6QA 4P9UA 1S8NA 1R1VA 2RNJA 3I71A 1AOYA 2A61A 2XUBA 5CVIA 5D4RA 1Q1HA 5HLIA 1Z1DA 3GW2A 3M8FA 4B09A 4IRHA 3WTUC 3RDIA 2A3SA 2FXAA 4HX4A 4IJAA 5L3CA 2VONA 2W57A 3CUQB 1I27A 4ENJA 2OAZA 2L4MA 2P8TA 1BC7C 5J8FA 1KQ9A 3K2ZA 2O61A 3LA3A 3GLXA 3HOSA 4WWCA 1UHMA 4IHTA 1XCVA 3WTWC 1V4RA 4HV5A 3C3WA 4S05A 2GA2A 4BXUA 4YFKF 1KU3A 4HQEA 1FBQA 2DK5A 3ECHA 1L3LA 2LF8A 4CO8A 2UZKA 5FGMA 3ROUA 3H3ZA 2R3SA 3LA7A 1XDUA 4KFCA 5LHIA 3P7NA 2BE5F 4HZFA 3M1EA 4LLGF 3HSRA 3Q9SA 2VODA 3V7RA 4U7DA 1S7OA 2XAJA 1QNTA 2EWNA 5E20A 2V79A 5BPIA 5DD8A 5ILUA 4HAMA 4LJZF 4BHBA 1Y0UA 3HTSB 1I1GA 4N0BA 3QRFF 4NQWA 2MLKA 4H0EA 5HDKA 2HS5A 3QP5A 3NQOA 3I5UA 3SZTA 4HA8A 5EEHA 3I58A 2VN2A 2OBPA 5CJ9A 5LRRA 2Y75A 3L09A 1W7PD 1Z6TA 3QPTA 1ZLJA 2DBBA 1YYVA 4LK1F 1SAXA 4PDKA 3N97A 3KP6A 2E7WA 2O03A 4N9IA 2EFOA 4Q5SF 3LQQA 2RV8A 1YS6A 4UV8A 1WKMA 5ICFA 5IT9Z 5LBQA 2EA2A 3LWFA 4HLXA 1QZYA 1TW3A 4G8XA 3TOAA 1YTYA 5BMZA 2PMUA 1LDKB 1IUYA 2VBXA 1UFMA 4I7HA 1J7KA 2LF7A 1FYLA 4L18B 2BV6A 5LHHA 1ONVA 3OOPA 5ILSA 1HKQA 4HX8A 3I53A 4LLLA 4RGSA 2Z99A 1WWXA 1E2XA 3J81Z 2EFQA 3PFIA 2RN7A 2VC0A 4ESBA 2HZTA 1O3QA 1TBXA 2EV0A 1TNTA 3BP8A 1TLHB 2COMA 1BJAA 1SMTA 4DNCA 3DF8A 1ODDA 4Y15A 2H6BA 4FHTA 3L9FA 3HHGA 1FWZA 2GWRA 2K86A 1FP2A 4ETSA 3JAMZ 1K78B 1O3TA 2KIFA 4NHJA 3V8LA 3TDZC 1FP1D 1WRJA 3EUHA 4LGWA 1JHHA 4LG0A 2OZUA 2RVCA 3ERED 3RI4A 3KEOA 2XAFA 5ERIA 1YW9A 2PI0A 3F8BA 5K5OA 5DCFA 2CG4A 2X0LA 1ZGAA 2CW0F 2BYVE 2ZCWA 3R61A 1E17A 1KU2A 1IXRC 3ZQ7A 1REPC 5TJJA 2ZKZA 3J80Z 3L2CA 3EETA 4P55A 5D4SA 1IN5A 1QQIA 3DXJF 3O2PE 3SHFA 1KGSA 3QU6A 4RB0A 3JTHA 1GVJA 5BPDA 1PP8F 2G9WA 4FX0A 2TDXA 5CYVA 2UXNA 5ICCA 3I59A 3HRTA 3WG9A 4MGRA 2D1VA 2P7VB 4M9XA 2E7XA 2PG4A 4A6EA 3GF2A 1CGPA 3GVAA 4ZYDA 3ZMTA 4A5NA 2V1UA 4BQAA 4F7ZA 3DFGA 3IHUA 2DQLA 2Z5UA 4RS8A 2ZO4A 3HSEA 1H0MA 4KNYA 3F8MA 2P5LC 4ZYGA 1R22A 4IPAA 2MD5A 5ED4A 3ZP5A 5D5WB 4S04A 4LK0F 3G73A 3T5XA 3GO5A 5HVQC 1R1UA 3GX4X 2NYXA 1IZ1A 4LD5A 2CWEA 1IXCA 2YX7A 3E6MA 3WODF 2FMLA 1IAWA 1QBJA 1EH7A 5LEKA 5JFRA 1ZREA 2F5FA 4CHUA 1MJAA 1HKTA 3FX3A 3KZZA 2PFBA 4KN4X 2KJCA 4OMYA 3VOEA 1LEBA 2P4WA 1MGTA 2XAQA 1HSJA 2EFWA 3T8TA 1BOAA 3E5QA 2DTRA 3RIRA 2A68F 4WXHA 1SMYF 3RYPA 1T0FA 2CO5A 3CUOA 4KIBA 5HLGA 4ASNA 5D5UB 1ZRCA 3FMRA 1FBSA 3F8CA 1Z6RA 2ACJA 4Q47A 3TKYA 1MZBA 3DV8A 2OQRA 3PQJA 3R0JA 1W7PA 1T38A 2XRNA 3K69A 3MCZA 1BN5A 4JK1X 4LG0B 2DPDA 3REOA 3RJPA 3SZPA 2VT3A 2H94A 2A69F 3F72A 5D8LB 4O5VA 3LA2A 2A6HF 1XSDA 3QOPA 2PMHA 3GZ6A 3BPXA 1MKMA 2P6SA 4ENNA 1SFUA 5JHUA 1YW7A 4WX9A 2F5DA 4QWQA 2MC3A 1G3TA 3EYIA 3I0TA 3BJ6A 3KEQA 2FBIA 3BPVA 3GZ5A 3NEUA 3F8FA 4HF0A 2FNPA 5CVRA 2W85A 4M72A 1IN4A 3I59B 3ZMZA 3TO7A 1R5GA 5L3DA 1BIAA 4I0AA 2Q2EA 4MTEA 5K5RA 2IVMA 1BI3A 3V4GA 5HS8A 2ZMEB 4EJOA 1FLIA 2HOEA 1XMKA 4MEYF 1XGNA 1W4MA 1F4KA 3KLNA 1RUOA 3NRVA 2FSWA 2QZ8A 2QQBA 3V7CA 1MDMB 3SFZA 3E5UA 1I6XA 4A0XA 5J8CA 4OOIA 2MH2A 2ZNZA 4KUMA 1BI1A 2EA4A 2GZWA 1IRGA 3D5LA 3ML6A 1ZGJA 3EQLF 1KU7A 5AIQA 3WE3A 2FRHA 3HRSA 5E8IA 2FOKA 1S7AA 2E1CA 2M8EA 2QUFA 4CYDA 4U0WA 1LVAA 4EJUA 4L5JA 4ENMA 4I09A 2J5OA 3RTRA 3BY6A 4R79A 1ZARA 2ZXJA 2IA2A 2HKXA 2ETHA 4L9VA 3MEXA 1R23A 2OZ6A 3RKWA 1IN8A 3EYYA 1HW2A 1FPQA 2UXXA 5F1RA 2K7LA 4RB1A 1CF7A 2QVOA 4YG2F 3C7JA 4I01A 5A2QK 4M74A 2CQKA 3U2RA 2IP2A 2FQ3A 1LB2A 4P5OA 4LB5A 4RB2C 2ADUA 2NAZA 3BROA 3KP7A 1FX7A 3TOBA 3HYIA 5L3GA 5HDGA 2Y0MA 4HV6A 1SD4A 3IWFA 4LMYA 1O3SA 4Q48A 2K4JA 2KKOA 2ZNYA 1IXSB 2L54A 2FE3A 4U88A 2VC1A 3OV8A 5D6FA 4G7HF 2Y48A 2HR3A 4CICA 1KYZA 4XLPF 3QU3A 4EGZA 2WC2A 3TO6A 4OU0A 4EJWA 2XKPA 1ZH5A 1BIBA 3EDPA 3KETA 1OR7A 1FY7A 5CVUA 2D1HA 1LQ1A 2WV0A 1SFEA 1OKRA 1T6SA 3FXQA 3H92A 1XSXA 1HXDA 2FMYA 3ZMDA 4L0YB 2V1DA 3T0YA 4JBAA 2GQQA 2RQPA 1XMAA 2YPRA 3WU1B 5LEJA 3KFWX 2ELHA 3B02A 5HS9A 4ZZDA 1DPRA 4FT8A 1XCBA 4RAZA 3ISPA 2EJRA 3KLOA 2HWVA 2HYGD 4KICA 1EH6A 2HEOA 1J2XA 1DP7P 2DFIA 2F5EA 3CLOA 2IA0A 1XD7A 1HKSA 1U5TA 4A0YA 3CO6C 2GAUA 4UNOA 1TQMA 1F1ZA 4I2OA 1WQ2A 2PJPA 4HYEA 4G7OF 4MEXF 2ESNA 2YX4A 1FSEA 4KN7X 1U5TC 1JHFA 4YFXF 4D0PA 2FNAA 5LLQA 1J5YA 1HW5A 1OYWA 1V3FA 4A6DA 2BEOA 1KQ8A 4U0YA 5BS6A 4L0ZB 3K1PA 3P9CA 3U1DA 3H3UA 1AWCA 1ZAOA 2Z9OA 1Z05A 2VT2A 4RB3C 3CJNA 2VE9A 3HHHA 3L00A 1GHCA 1FYKA 1CF7B 1JXSA 3CTAA 4L9TA 4EM0B 5F64A 4KDPA 1G3SA 1TQIA 2QQAA 3F3XA 3RKYA 5IT9K 1YIOA 3HSFA 3LQRA 2GIVA 4PCQA 2VXZA 5HOOA 3LAJA 3HRUA 1S6LA 5IT3A 1USSA 1RZ4A 5D8KB 2XKOA 4NB5A 4XSZF 5E8GA 3BOQA 2HDCA 5DCMA 3C18A 4HBLA 1IRFA 1Z91A 3RYRA 1ULYA 2L3DA 1RIOH 1OYIA 2M5WA 4P96A 3CO7C 3QP6A 2R7DA 1T39A 5LHGA 2QBYA 1KA8A 3GWZA 1HW1A 2H6CA 3JTGA 1LJ9A 4CGZA 2HQNA 2YU3A 1C0WA 3HIFA 4BYYA 1A04A 3TO9A 1DUXC 3WTZA 2L01A 5BOXA 3ZN1A 2L4AA 2QENA 3HUGA 3QAHA 1NHAA 2KJBA 3T8RA 1TTYA 3G3ZA 2EV6A 3S2WA 3K0LA 1YW8A 3E3VA 2O6GE 1LDDA 4EV0A 2V1XA 3JAMK 4HDUA 1SD6A 3WTXC 3GUDA 3GFMA 5FFXA 2NS0A 1D5VA 2O8XA 4JQFA 4WF2A 2FEZA 1FC3A 3MQ0A 1STZA 2V6CA 1ZN2A 5E1XA 5DD4A 5K5QA 4MHGA 1ON2A 2X4HA 3DPLC 4UVBA 4L9JA 2HFHA 4OMZA 5L3EA 2E1NA 2IPQX 3DP7A 5K1YA 1UB9A 1WI9A 1T2KA 2HQRA 3ULQB 3J80K 1BBYA 3BJAA 3IKTA 1J0RA 4ZH4F 1U6GA 2ZJ2A 3SXYA 3GYHX 4M71A 1YO5C 2W84A 3ABTA 2K02A 3FF5A 5AONA 2PLYA 3WTTC 3Q9VA 3SQNA 1PDNC 5EEGA 1F5TA 1U78A 3L7WA 2IA1A 1BC8C 3ZMUA 3U9GA 2JTVA 3F21A 2QWWA 3K9TA 2NNNA 4A5MA 3CUQA 3KP2A 1ZYRF 4GYGA 1LEAA 4O3MA 2ISYA 1H9GA 1EH8A 1G6NA 2QQ9A 4EVIA 3IKVA 4U7BA 4EMSA 5E1ZB 2L02A 4ZYEA 1SD5A 1O7LA 3P9IA 4KMUX 2DO7A 3W6KB 5DCMB 4MNUA 1L0OC 4XSXF 4I98B 2LKPA 2VBYA 1OYYA 5ILVA 2CGPA 4K2EA 4M6YA 2YR2A 1SFXA 2JZYA 1K6OA 3FM5A 2OU2A 4R8HA 2B0LA 3V8JA 4AIHA 3HOTA 3MWMA 1D8JA 4MTDA 3WGGA 3O3KA 2W24A 2LSOA 1K79A 4WXDA 2IJLA 4G7ZF 2MLGA 3F8NA 3C1DA 2AS5F 1WSUA 1XN7A 5DEQA 1TQPA 4HX7A 3GFLA 3TQNA 4L9NA 4RGUA 3P9KA 2VOOA 2CYYA 3MAJA 1U2WA 4I02A 2JPCA 4KT5C 1IN6A 1ZG1A 3IRQA 1G3YA 4RAYA 3T1BA 2EFNA 5AIPA 4UVAA 3WGHA 1OMIA 3KZYA 2VBWA 3WTVC 5FD6A 3FMQA 2Z3YA 2ZFWA 1EV7A 3F6VA 2Q8KA 2XGXA 4ESFA 3KP5A 2XAGA 2BGCA 3BDDA 3ELKA 2A5YB 2XAHA 3F6OA 3I64A 2WWYA 2MA3A 2EK5A 1XGOA 2GA1A 1P4WA 1X3UA 2DI3A 4BH9A 2MH9A 4OINF 5TRDA 2A07F 3K1MA 2F2EA 3R0AA 1B4AA 3RPUA 3KCCA 3JSOA 1B1BA 3GXOA 4FX4A 3LSTA 2RC4A 4L5IA 2PN6A 2IW5A 3N4MA 2H27A 3ZN0A 2AXLA 1S3JA 3DKWA 2XVCA 4GYIA 1J9IA 4HLYA 2V9VA 1J75A 3VB2A 1IF1A 1ZRDA 2DU9A 5FLXK 1QGPA 2RGVA 2EFPA 4DQ2A 3WE2A 4G94A 2DLLA 5FB2A 3V7SA 3JSPA 5ICEA 3BWGA 1FOKA 3BZ6A 3MZHA 5CVVA 1W7PB 2VBZA 4CZZA 5BQTA 3ZMVA 4HF2A 3O6BB 4YIFA 4GXOA 1R1TA 2XV4S 4KMFA 4EM1A 5E18F 2K4BA 3F23A 1K78A 1O7FA 3ZPLA 1MJ9A 3KP4A 5F6FA 4Y13A 2FA5A 5JI6A 1HBXG 1G4DA 4GGGA 1Z9CA 2HTJA 6PAXA 3GFJA 3GEZA 1ZRFA 1RNLA 3LFKA 1TW2A 4M9SA 4G9YA 4M9ZA 2QLZA 2HGCA 4IF4A 2R7FA 4BHPA 1GXPA 3BJOA 5LRSA 4IRGA 4RGRA 1ON1A 2P6TA 4Z2YA 3FXUA 2CSOA 1YG2A 5D5VB 4KYWA 2D2WA 2LDUA 4WCGA 4OIOF 4B8XA 5LGUA 1JGSA 1XSVA 2RDPA 1H9TA 3KP3A 3J7AO 1QZZA 5E1WA 2M30A 1W5SA 1BI0A 5J6XA 3TDUC 1I5ZA 1O3RA 3HRMA 3V8KA 4BHCA 5DUIA 1UHWA 3K1NA 2C6YA 1U8RA 5CLSA 2M87A 3RPQA 3F22A 4UXNA 1BI2A 1QO0D 2OD5A 1RUNA 2PBIA 2Z33A 2CFXA 3JW4A 2XHKA 3LAPA 1DDNA 2W25A 5CVJA 1XGMA 3FWEA 2BBYA 1YFHA 1D8KA 1U3EM 3AAFA 1ZG5A 2JSCA 1J59A 4HF1A 4Y17A 5HLHA 3GFIA 4LLNA 1B6AA 2GXBA 4XLNF 3WTYC 2MBFA 4UUVA 4E70A 5FFZA 2M1BA 4UVCA 1LNWA 2YSRA 3DQVC 2OA4A 4IHSA 3TGNA 5KVRA 5FO5A 1SD7A 1ZHFA 2JRTA 4LFUA 2QM3A 4OIQF 4A2UA 4EJTA 4A0ZA 1B59A 1FT9A 3MFKA 2KIMA 4P9FA 4EJVA 2P7CB 4PGHA 1S29A 2IT0A 2QYOA 4R1HA 3DPTA 4BNCA 4TV7A 2DT5A 2GXGA 1P4XA 4KA4A 3J81K 3WTSC 2G7HA 4AD9A 3D0SA 5HDNA 4A12A 5D6EA 2NRAC 3WGIA 2FBHA 3WU0A 2G7UA 2HTSA 4G6QA 2JPBA 3PQKA 3Q5FA 1QPMA 5KK1A 1KU9A 1FYMA 1XB4A 1P6RA 1PUEE 2J5PA 1USTA 4XRFA 1FBUA 3FZVA 2STWA 2ISZA 4RGXA 2FF4A 1ZG3A 5LGNA 3E6BA 1XGSA 2RKHA 2DK8A 1I1SA 1G3WA 1GXQA 1PP7U 5FD5A 3COAC 3RKXA 4HW0A 5D5XB 4WXCA 2H09A 1B9NA 3IL2A 2K27A 1FZPB 3VFZA 2VE8A 5HS7A 2D45A 4XBFA 5JVTA 2DAOA 5DYMA 4ESJA 4KIGA 1U5TB 4M6XA 4EGYA 2ZMEA 1ZLKA 1MD0A 1Z7UA 1R7JA 4ON0A 4BAYA 4KIFA 2IRFG 1R36A 1MDMA 3DEUA 4CXFA 2JT1A 2M45A 3HTUA 4OIPF 1DPUA 5DV5A 2EB7A 2DPUA 1LDJA 2XIGA 1YQAA 5H6RA 3M9AA 2STTA 3M8EA 4PZJA 4QLCU 4AVPA 4IRIA 3MZYA 4YIIA 1P4AA 4CDGA 2O3FA 4I0BA 5L3BA 1IN7A 3I4PA 2A6EF 3ABUA 2HYFA 4N9HA 3FXRA 1KYWA 1HSTA 5ICGA 2PQ8A 1YLFA 3B73A 5LGTA 2ESHA 1MJBA 5H20A 1XDSA 1W5TA 4Q4ZF 3CUQC 1R58A 5DDGA 4LB6B 3VEPA 1D3YA 3R60A 3I54A 1B9MA 4U0VA 3E6DA 1IW7F 4AWXB 2PEXA 3E6CC 3ECOA 3FHZA 4UHTA 2OQGA 1K7AA 2QBYB 3W6JB 2ZBKA 3FMSA 2DQRA 3QPHA 3KE2A 1O57A 4OIRF 5L3FA 2KIUA 1JE8A 4EM2A 1T98A 2XROA 1KQ0A 5DUKA 1P92A 3ZMSA 4M73A 4YFNF 3FM3A 1R5HA 3R4KA 2F5CA 2WTEA 4EQQA 3E5XA 2UWMA 1HQCA 4HQMA 4GCVA 3VODA 4MQVA 2DW4A
chains in the Genus database with same CATH superfamily
3LL7A 4ZZLA 2Y0SN 4XK4A 4ZYHA 1MBEA 3S3MA 2QQ8A 2XASA 3M7GA 1VI0A 2KIQA 4GO1A 4O6JA 1I3QJ 1ZELA 1F43A 4AIJA 2KZVA 3E97A 4IXAA 3Q0UA 2VOPA 1UCRA 1FSHA 4UV9A 3CDHA 2FU4A 3PM1A 2IGMA 1XG1A 2LNBA 1WJAA 2RREA 2XGCA 1R49A 2EBIA 2JJ7A 3K10A 2P5VA 2NNYA 4IVNA 1I50J 2FBKA 3BG3A 2KRFA 2O0YA 2DCEA 3IC7A 4ZTFA 3HKZN 3R6SA 3V42A 2HKOA 5JR3A 2HOSA 1BM9A 1UAAA 3IRRA 1OPCA 3A2KA 1R00A 4HDVA 5GAHJ 4ENKA 4XL9A 2P5KA 1RESA 1F9NA 1P2FA 1RI7A 2FOWA 5E17F 1WH5A 2EV5A 2Q0OA 2EPFA 4E7JA 4MQ9F 1XS9A 1WCMJ 1TNSA 3JRDA 2MD0A 4AIKA 4ITVA 1YS7A 2OPTA 2VJIA 3CCYA 2IS6A 2L7KA 4WK8F 1WJCA 5A2QZ 1VTNC 1FNNA 2R93J 3AG4H 2W00A 4HOBA 3DEEA 1VQ4I 2KRCA 3IWZA 1TWAJ 4PGGA 5DTDA 5FLXZ 3PNTA 4G6DA 4PFPA 5H6QA 4P9UA 1S8NA 1R1VA 4RM2A 2RNJA 3I71A 1AOYA 1RR8C 5B66C 3ZXSA 5EYRA 3CMEI 5TGTA 2A61A 2F48A 2XUBA 2XAUA 3BG5A 5CVIA 2W48A 3GCMA 5D4RA 2VB6A 5EGOB 1Q1HA 2E34A 1U9NA 5HLIA 1Z1DA 3GW2A 1JUMA 3M8FA 4B09A 5E3LA 2W1OA 4IRHA 1QVUA 3WTUC 3RDIA 2A3SA 3KYLA 3AG2H 2DFEA 2FXAA 3S32A 1N75A 1Y1VJ 4HX4A 4IJAA 5L3CA 2HVRA 4JOMA 2VONA 3JRIA 2W57A 4B4CA 4UY8I 3CUQB 3BR2A 2VQLA 1I27A 4ENJA 2OC6A 1X1PA 4D9JA 2OCEA 5GTIC 2DFFA 1GT0C 2CJJA 2OAZA 4ZC3A 2L4MA 2P8TA 1BC7C 2A6TA 5J8FA 2QSHX 2Y9YA 5FLMJ 1X1CA 3DKYA 3PUBA 2O5RA 1SEUA 2H8RA 5M3MJ 1KQ9A 2WV1A 2DXIA 3K2ZA 2O61A 3LA3A 3GLXA 3HOSA 4AIDA 4WWCA 2NVQJ 1UHMA 1JKPC 4IHVA 3D5RC 4IHTA 1W5CC 3W2AA 2K40A 1XCVA 3NARA 3WTWC 1V4RA 4NBQA 3L2WA 2R4GA 2QKLB 1BA5A 4HV5A 1NG7A 5HLTA 3C3WA 4S05A 3GTQJ 2GA2A 4BXUA 2MC4A 4IHXA 4YFKF 3BZCA 2CQXA 3CCEI 1KU3A 4F3QA 4HQEA 1IV8A 1FBQA 3HZJA 2DK5A 3ECHA 3K4MA 4E4HA 1L3LA 3BR0A 2LF8A 4CO8A 3PNVA 4A3KJ 3A01B 2UZKA 4FTHA 5FGMA 3ROUA 3H3ZA 2R3SA 2Q1ZB 4DZPA 3OSFA 2F4OB 3LA7A 1XDUA 4KFCA 5LHIA 1WJEA 3CCQI 2W82A 4AYBA 2LVSA 2BE5F 3P7NA 5EJCA 5EG0A 4XRMA 4HZFA 1TT5B 3M1EA 4LLGF 1PYVA 3HSRA 3Q9SA 1UG2A 2VODA 3V7RA 2LK2A 4CCLA 4U7DA 1S7OA 2K85A 2XAJA 4G12A 5CKTA 1QNTA 2EWNA 5E20A 2GOMA 3W6VA 2V79A 4E7HA 5DD8A 5BPIA 1LFUP 2JWTA 4HAMA 2LTPA 5ILUA 4LJZF 4M3FA 4BHBA 1S7EA 1Y0UA 3HTSB 1I1GA 4N0BA 2X1CA 2LY2A 1YRNB 3QRFF 2EILH 4XKBA 2NS7A 4NQWA 2GBYA 1YX5A 2MLKA 3K2AA 4H0EA 5HDKA 4MFDA 2HS5A 3AL0C 2WADA 2JUGA 3FXKA 3OIOA 4BEHB 3MN2A 3QP5A 3NQOA 5HODA 3I5UA 4FCYA 2VQGA 4XLCA 3SZTA 2M34A 2FUG2 4HA8A 5EEHA 3I58A 3HG9A 2VN2A 2OBPA 5CJ9A 1UHSA 5LRRA 5DM7F 2Y75A 3L09A 4HEA2 1W7PD 1Z6TA 3QPTA 1ZLJA 2TCTA 2DBBA 1YYVA 4LK1F 1SAXA 4BJ5C 2DOAA 1IRZA 4A3EJ 1MIJA 4PDKA 3N97A 3KP6A 2LBFA 2E7WA 3D5SC 2V6EA 1VQLI 2O03A 4N9IA 1POGA 1O4XA 1HLVA 2EFOA 3CJQB 4Q5SF 2R7UA 4JX5A 4D1QA 4AU7A 3LQQA 2RV8A 2NVTJ 3PUFA 4A3CJ 1X3WB 1YS6A 3CF5F 4UV8A 1WKMA 5ICFA 4IX7A 5IYDJ 5IT9Z 4B1RA 2EA2A 5LBQA 3LWFA 4HLXA 4AUXA 1QZYA 1TW3A 4G8XA 1WVRA 3TOAA 1YTYA 5BMZA 2PMUA 3FK6A 1M1EB 3DBLB 3VSLA 2OF7A 1LDKB 1IUYA 2VBXA 2AQFA 2BHYA 3S16J 4DZJA 1UFMA 4I7HA 1J7KA 2LC2A 2LF7A 3H9GA 4I76A 1FYLA 4L18B 1QHHD 1JKQC 2BV6A 2B63J 1UG0A 5LHHA 1ONVA 3OOPA 5ILSA 1HKQA 4HX8A 3I53A 3OYCA 4LLLA 4NC8A 2M7AA 3CCUI 2HOTA 4RGSA 1H8AC 4MFEA 4CZCA 2BHZA 2Z99A 2FJ1A 1WWXA 3IUOA 2DA4A 1E2XA 3KIOA 3J81Z 2V9KA 2EFQA 3PFIA 2RN7A 2UUZA 5EZHA 4LIVA 4BQNA 2VC0A 3OS0A 1IRXA 4ESBA 2HZTA 1O3QA 1TBXA 2EV0A 2IS1A 2O7OA 5F08A 1TNTA 3BP8A 2ECBA 2ZB9A 1HA8A 2CS3A 1TLHB 3MKWB 4F92B 2COMA 4XQFA 2PJRA 4W1UA 3CCSI 2W4SA 1BJAA 4BDZA 3TP0A 2IGKA 3LSGA 2XGDA 3BCBA 1SMTA 2KQRA 4DNCA 3DF8A 1ODDA 2E5ZA 4FQGA 4A3LJ 4A93J 4Y15A 2H6BA 4FHTA 3K4BA 2W7NA 3L9FA 3NWTA 1UMQA 3HHGA 3CLQA 2DODA 2GIZA 2LMDA 1FWZA 2GWRA 2K86A 1FP2A 2EIKH 2JRMA 4ETSA 3JAMZ 1K78B 3U1KA 1O3TA 2KIFA 2WB1N 4NHJA 3V8LA 1OCCH 2KRHA 1R4MB 2DN0A 3L2QA 1AKHA 4GFBA 3TDZC 2E1MB 3TBIA 1FP1D 1WRJA 3EUHA 1VQNI 4LGWA 1JHHA 3OY9A 1FOWA 4LG0A 1NTCA 2OZUA 2RVCA 3ERED 2R7SA 1RKTA 3RI4A 3KEOA 1LE8B 4IL6C 1GDTA 2JA8J 2XAFA 5ERIA 1YW9A 4IHYA 2VKEA 2PI0A 2XRLA 2LFBA 3F8BA 3ZQGA 4FISA 4XKCA 5EG0B 2MSYA 3HGGA 5JLXA 1SVMA 5K5OA 2R7OA 5DCFA 4F52A 2R5YA 1K4SA 2CG4A 5IYCJ 4BL0B 3EUHC 1Y8RB 2X0LA 1ZGAA 2CW0F 3HOZJ 2BYVE 3OYMA 1K61A 3S14J 2ZCWA 3R61A 3AL0B 1PJRA 1E17A 1ACIA 2DA1A 1ETKA 5B3SH 2LY9A 1KU2A 4DYCA 1IXRC 1AA7A 3ZQ7A 1REPC 2VKDA 5TJJA 1WGXA 2ZKZA 3BTLA 1R5ID 3ZCOA 3J80Z 3L2CA 1MH3A 3EETA 4P55A 5D4SA 1IN5A 1QQIA 3DXJF 2L2OA 3O2PE 3SHFA 3SYTA 5KAFC 1UELB 1KGSA 3S93A 3QU6A 1A5JA 1Y56A 4RB0A 5IY5H 5M5XJ 3JTHA 2MABA 4EATA 1GVJA 5BPDA 1PP8F 1R4NB 1VQMI 4C30A 3OYJA 2G9WA 5J1UA 4UUTA 4FX0A 2PX9A 4RMNA 2TDXA 4M3BA 5CYVA 2DDAA 3CESA 2UXNA 5ICCA 3I55I 4RA2A 1PUFA 2WAEA 5KHDA 3I59A 3A03A 1WPKA 3HRTA 4MGRA 3WG9A 3DEWA 2D1VA 2P7VB 5KAIC 4M9XA 4A3IJ 3H0GJ 2E7XA 1FOXA 2PG4A 2LR8A 4A6EA 2JVHA 3GF2A 1CGPA 3GVAA 4ZYDA 3LSKA 3HOUJ 4J00A 4A3MJ 4F91B 2X6WA 1JGGA 3OYEA 1N25A 3ZMTA 2GM4A 2VJ5A 2LBFB 4A5NA 1IV6A 4BQQA 1VQ9I 3ZR8X 2V1UA 4BQAA 3IH2A 1VZ0A 5IPAA 1X4OA 2BVMA 4F7ZA 3DFGA 3UKGA 1WJ5A 3IHUA 2DQLA 2KPMA 1XX5A 2Z5UA 4RS8A 2ZO4A 3HSEA 1H0MA 3BZKA 4XOTA 4E6KG 2K3FA 4KNYA 3F8MA 2P5LC 3HPGA 4ZYGA 5J4VA 1R22A 3U21A 2LH9A 4IPAA 2MD5A 5ED4A 2CW8A 2PMZA 3ZP5A 1V5GA 5D5WB 4S04A 3OYDA 4LK0F 3D1NI 1OLTA 1DQUA 3G73A 1VFCA 2CV0A 2KT0A 1JT6A 4Z6YA 3T5XA 3GO5A 5HVQC 1JUSA 1R1UA 3GX4X 2NYXA 4XKVA 1IZ1A 4LD5A 1MNMC 2M7BA 2RQQA 5C4JJ 2CWEA 2WA0A 1IXCA 2YX7A 3E6MA 3K4CA 3WODF 2VKHA 2LD5A 3OS2A 1I3AA 5F27A 2FMLA 1IAWA 1QBJA 3CC4I 3QYFA 1EH7A 5LEKA 2CFOA 5JFRA 1A31A 2M2EA 2LOOA 1ZREA 2F5FA 4DYQA 4CHUA 1MJAA 3VYTB 1HKTA 2XB0X 3FX3A 3KZZA 1YX3A 4HSTA 1BR2A 2PFBA 3H36A 1BJZA 4KN4X 2I10A 3VYSB 3ZQFA 4ZDLA 2KJCA 3G6EI 4OMYA 3GTLJ 3VOEA 1LEBA 3OYBA 3L2RA 3RQ4A 4NC7A 2P4WA 1MGTA 2XAQA 3LSJA 4Y33A 1HSJA 2PJRB 2EFWA 3T8TA 3WHCA 2V7FA 2E71A 1ZQ3P 1BOAA 3E5QA 3ZQQA 3AG1H 1B72B 2DTRA 3BQZA 3RIRA 2A68F 1IUFA 1T08B 1MSFC 1IG7A 4WXHA 1SMYF 1D0ZA 1TWHJ 4BBRJ 3CJTB 3RYPA 1R6RA 1T0FA 2CO5A 2P81A 1E3HA 3CUOA 3ABMH 1FEXA 4KIBA 4A69C 5FKMA 5HLGA 2KLOA 4ASNA 5D5UB 1ETQA 1ZRCA 3FMRA 4PJNA 1FBSA 2DMPA 3F8CA 1Z6RA 2ACJA 3ESWB 3B6AA 4Q47A 3TKYA 3X2QH 2HZDA 1MZBA 3DV8A 2OQRA 3PQJA 4BACA 1AKHB 3R0JA 1W7PA 1OCPA 1T38A 1T0FC 2XRNA 1U9OA 2KDZA 3S15J 3K69A 3MCZA 1BN5A 4JK1X 4LG0B 2DPDA 5FKLA 2DMQA 1VQ8I 3CDLA 3REOA 1T95A 4CCMA 5F0HA 1MNDA 4RAFA 2FX0A 3RJPA 4D5FA 4OAZA 3SZPA 3CD6I 2VT3A 3VYUB 1GUUA 3BTJA 2Y9ZA 3VWBA 1QU3A 2H94A 3CMYA 3HOVJ 1RPWA 4AVZA 1DU0A 2A69F 3PIOF 3HJEA 3F72A 2V9PA 5D8LB 1T56A 2R7TA 4O5VA 3PL8A 4L5EA 3LA2A 5E3NA 2A6HF 1XSDA 2VUMJ 2HNHA 3QOPA 2PMHA 3GZ6A 3BPXA 1MKMA 2P6SA 4ENNA 1SFUA 5JHUA 1YW7A 3RZOJ 1KONA 1Z21A 2A05A 4RLQA 2F5DA 3FBIB 4WX9A 4QWQA 2MC3A 2M0CA 1G3TA 3EYIA 1Y39A 3I0TA 3BJ6A 3KEQA 4OAYA 2FBIA 3UR3C 3BPVA 4DIQA 3GZ5A 4XNFA 3I4NJ 3NEUA 3QOEA 3F8FA 1MMAA 4HF0A 3QQAA 2FNPA 3BC8A 2ZC2A 3CP2A 5CVRA 2W85A 4QTRA 4M72A 4XIDA 2EINH 4JX6A 1X1AA 1IN4A 3BG7A 3I59B 3M07A 3ZMZA 3TO7A 3S17J 1R5GA 5L3DA 1LVKA 1BIAA 3BQYA 3HBLA 4I0AA 3HDDA 4RBOA 2JA5J 2Q2EA 4MTEA 4HNTA 5K5RA 2IVMA 2KL4A 4XM3A 1BI3A 3UNGC 4UB6C 2K3PA 4B43A 3MD2A 2TRTA 2E2JJ 4X0GA 1QVTA 4S0HB 3V4GA 3CJRB 5H2FC 3PIPF 3TEDA 3OYFA 5HS8A 3HGYA 2ZMEB 3M1CA 4EJOA 3LNQA 1TWCJ 1FLIA 2HOEA 1XMKA 4XONA 4MEYF 1XGNA 1W4MA 1F4KA 1ZR2A 2IAIA 3KLNA 1RUOA 3NRVA 2FSWA 2QZ8A 1P9QC 2QQBA 3V7CA 1MDMB 3SFZA 2HI3A 4XRSA 3E5UA 1I6XA 4A0XA 4ANJA 5J8CA 4OOIA 4NDLA 2MH2A 4RM3A 1QA6A 2ZNZA 4KUMA 1H89C 1BI1A 2EA4A 3VDXA 3K70D 2GZWA 3O8HA 1IRGA 1G59A 3D5LA 3ML6A 1ZGJA 3PSFA 3CMAI 3EQLF 1KU7A 3SZGA 5AIQA 1ZR4A 2BW3B 2CUFA 2FRHA 3HRSA 3WE3A 3ZRGA 1R9TJ 5E8IA 2FOKA 3OS1A 1GV5A 1S7AA 2HPMA 3HM5A 3QPSA 2E1CA 2VASA 2M8EA 2QUFA 1XMXA 3ZOBA 4CYDA 1ZGWA 2X1DA 3K4KA 4U0WA 1LVAA 3S1RJ 3J7YJ 4EJUA 3I4MJ 4L5JA 4ZJZA 4ENMA 4I09A 2J5OA 1NH3A 3RTRA 3BY6A 4R79A 1ZARA 5EF6A 3K4JA 2ZXJA 4CYCA 2IA2A 2HKXA 2ETHA 3H9JA 3MEXA 1R23A 2OZ6A 4L9VA 3RKWA 1IN8A 3EYYA 1HW2A 1FPQA 2UXXA 5F1RA 2I5UA 1ERDA 2K7LA 4XKWA 4RB1A 2ZXWH 2M8GX 2QVOA 3OWTA 3C7JA 4YG2F 1CF7A 4I01A 2H1LA 5A2QK 1X2NA 2GOXB 4M74A 4IOAF 2XF6A 4A3BJ 3ERMA 2R7XA 3GBGA 2CQKA 2VLAA 1D1CA 3U2RA 2IP2A 2VPLA 2XSJC 2FQ3A 1LB2A 4P5OA 3OYLA 4LB5A 4RB2C 2ADUA 4HNVA 3VPRA 3CCRI 2NAZA 1IO2A 3KX2A 4UUSB 3BROA 2PMZN 3KP7A 1D1BA 1FX7A 2KP6A 3TOBA 4RAGA 2ZSHB 3HYIA 2X1EA 5L3GA 2CRGA 1Z67A 3IV5A 3S1MJ 3VSKA 5HDGA 2Y0MA 4CH7A 4HV6A 5J1RA 1H88C 1SD4A 2BOLA 3IWFA 4LMYA 1YJWI 1O3SA 1RETA 2DA5A 1HDPA 3CZ6A 4Q48A 4AM3A 1VQ6I 2KHMA 2K4JA 2KKOA 5F1JA 2ZNYA 1IXSB 2L54A 2FE3A 4U88A 3L2UA 2VC1A 3CCJI 3OV8A 4XLFA 5D6FA 4G7HF 2Y48A 3Q0WA 3Q3SA 4PJLA 3PO3J 2HR3A 4CICA 4GRIA 1KYZA 3A4CA 2X85A 4XLPF 4X1EA 3ONQA 2EZIA 3QU3A 4EGZA 1NG6A 2OCCH 2WC2A 1YIJI 1HOMA 2JMWA 3TO6A 1V5EA 1JT0A 4OU0A 3G1OA 2QCOA 4EJWA 4E7SA 1G2HA 4BS9A 2XKPA 2WAQA 2YUSA 3G4SI 4IKFA 1ZH5A 1JKOC 1BIBA 3EDPA 3IH4A 3WU2C 3KETA 1OR7A 4PJJA 1FY7A 2EZLA 2L7MP 1X58A 5CVUA 2D1HA 1LQ1A 2WV0A 1ETYA 1SFEA 1OKRA 1T6SA 3FXQA 2QSFX 3H92A 3DTEA 1XSXA 1HXDA 1Z7LA 3TP3A 2FMYA 3H9QA 3ZMDA 4L0YB 2V1DA 3T0YA 2MG4A 3CMMA 4JBAA 3S2HJ 2GQQA 2RQPA 1VQKI 1XMAA 2YPRA 1OR7C 2O9LA 3WU1B 4II3A 1FOYA 3KFWX 5LEJA 2Z16A 2ELHA 5B1AH 1MBJA 3B02A 5HS9A 2LG4A 4ZZDA 3E0JB 1DPRA 4RDUA 5IP9J 4FT8A 1XCBA 2L7ZA 3GLLA 4EEFG 3PJRA 4RAZA 3ISPA 2EJRA 4V19K 3KLOA 2HWVA 1E0EA 2L9NA 2HYGD 4KICA 2JA7J 3M3YJ 1EH6A 3H0DA 1Y0NA 2HEOA 1J2XA 5KNLA 1DP7P 1IJWC 1FJLA 2AHQA 2QGUA 2OUMA 2DFIA 2F5EA 3DKXA 3CLOA 4A3JJ 2NVXJ 2A5WA 2IA0A 1XD7A 1HKSA 3DU6A 3BG9A 2P0WA 1U5TA 4A0YA 3CO6C 2GAUA 4UNOA 1TQMA 3ASOH 2VQCA 1F1ZA 4I2OA 1WQ2A 2PJPA 1LFBA 1SAUA 4HYEA 3KYDB 4G7OF 5JHFA 4MEXF 1Z3XA 1BL0A 1EF4A 2ESNA 2YX4A 1FSEA 4KN7X 1U5TC 2WY7Q 3W3CA 4U87A 4XLAA 1JHFA 4YFXF 4D0PA 4QPQA 4PK4A 2FNAA 2R5ZA 3KPHA 1A36A 5LLQA 4XMYA 2DFHA 2CUEA 1J5YA 1HW5A 1OYWA 2K5CA 1DP3A 1V3FA 4A6DA 4FE4A 1Z77A 2BEOA 5FKOA 2VJ4A 5FROA 1KQ8A 2E36A 5FJ8J 5C4XJ 4YIRX 4U0YA 5BS6A 2DJIA 4L0ZB 3K1PA 3DLLF 5LD2C 3P9CA 3U1DA 3H3UA 4XLEA 3S3OA 1ZAOA 1AWCA 3E7LA 2Z9OA 1Z05A 4XN3A 2VT2A 4RB3C 3CJNA 3I56I 2VE9A 3HHHA 3CC7I 2UV1A 3K7AJ 3G1MA 3L00A 1FYKA 1CF7B 1GHCA 1JXSA 3CTAA 2R7VA 2DOEA 4L9TA 4EM0B 5F64A 4KDPA 5EEAA 1G3SA 1TQIA 2QQAA 3F3XA 3ZQHA 4XOPA 3RKYA 2QKMB 5IT9K 2K9MA 3DWLE 5J40A 2HDDA 1YIOA 3MKLA 2Y69H 3KZIC 4B3AA 3HSFA 4CCOA 3LQRA 4PJ0C 2ZXIA 2GIVA 4PCQA 2VXZA 3I9V2 3OIPA 2Y0SA 5HOOA 4IQJA 3LAJA 4MIMA 3HRUA 3BR3A 1S6LA 1WJBA 5IT3A 1USSA 3HC7A 1W36D 1RZ4A 3FIWA 1A6IA 4G6TB 5D8KB 2XKOA 4BGDA 2VIXA 1S9HA 4NB5A 4ZDPA 4XSZF 4AC0A 5E8GA 3BOQA 1K4TA 4A3GJ 3GTJJ 2HDCA 5DCMA 5LFAA 3C18A 4M6VA 4HBLA 1IRFA 1GLNA 1Z91A 3RYRA 1ULYA 2L3DA 3H5RA 2R7WA 1RIOH 1OYIA 4HNUA 2M5WA 3RPUD 4P96A 2E60A 3CO7C 3OL3A 2N8GA 3HKZA 4PSXA 3QP6A 9ANTA 2R7DA 3E1SA 4Y4RA 1T39A 5LHGA 2GXAA 2QBYA 3MVPA 3MKZA 1KA8A 3GWZA 1Y8QB 4M3GA 1HW1A 1WJFA 2KDOA 4X6AJ 2M9HA 2H6CA 3M8JA 1LKXA 3JTGA 1LJ9A 4BUPA 4CGZA 2HQNA 2YU3A 1A35A 1U0JA 1C0WA 4H4KC 3HIFA 5E79C 4BYYA 1A04A 3TO9A 3FKJA 1DUXC 4XN0A 3WTZA 2L01A 2XDVA 2BY3A 4NQWB 3S1NJ 1DU6A 3PSIA 5BOXA 3ZN1A 2L4AA 2QENA 3FXJA 3M4OJ 3HUGA 2XPUA 2WY8Q 3QAHA 1OQYA 1NHAA 2F5VA 2KJBA 2VKVA 5C44J 3T8RA 1TTYA 1MBHA 3G3ZA 2EV6A 3S2WA 1MBGA 3K70C 3LFUA 4N4NB 2DMNA 3K0LA 1NK3P 1YW8A 3E3VA 2O6GE 1LDDA 1FMWA 2RNGA 4EV0A 2ECCA 1A6QA 2V1XA 4HSRA 5J4YA 3JAMK 2OJED 4HDUA 2BXZA 4B48A 1Q1VA 1SD6A 2VPRA 3WTXC 3GUDA 3GFMA 3OYIA 1WZ2A 2QEXI 4BE2A 5FFXA 3BT9A 2NS0A 1D5VA 2O8XA 3IAM2 4JQFA 1VQ5I 2HVQA 2FEZA 3FKIJ 4WF2A 1FC3A 3WG7H 4LOCA 1FTZA 3MQ0A 2DT6A 1STZA 2V6CA 2LRDA 3RSNA 1X2MA 1ZN2A 5E1XA 4YRVA 2KFDA 5DD4A 5CPRB 4YEJA 3OL4A 2DA7A 1BW6A 4MHGA 5K5QA 1CQTA 1ZK8A 1ON2A 1HCRA 2X6XA 2ZJPF 4AYBN 2X4HA 3CCLI 3DPLC 4UVBA 4L9JA 2HVSA 2IEKA 3HEFA 2CUZA 2HFHA 2ICWG 3A0BC 3I3LA 5DM6F 4OMZA 5L3EA 2E1NA 2IPQX 3DP7A 2E5NA 1K6YA 2MYSA 3SEZA 3MKYB 5K1YA 1UB9A 1F36A 1WI9A 1XTAA 2LP0A 1T2KA 2HQRA 3ULQB 1JTXA 2DA2A 1BBYA 3BJAA 3J80K 3IKTA 1J0RA 4ZH4F 3S1QJ 2DYSH 1U6GA 1X4PA 3NWSA 5GTHC 2ZJ2A 2LKXA 2WAQN 3SXYA 3FHNA 4NUBA 3S2DJ 3GYHX 4M71A 1FIAA 2R92J 2QA4I 5HNFA 1YO5C 2JSPA 2X6OA 1AHDP 2W84A 4C9YA 2R5ZB 3ABTA 2K02A 2CQQA 1QPIA 3FF5A 3QYBA 5AONA 2PLYA 4MO7A 3WTTC 3Q9VA 3SQNA 5EGOA 5EEGA 1PDNC 1YHQI 3OIQA 4D7NA 1F5TA 1W1WE 3MMYB 1MH4A 3L7WA 2DT7B 2IA1A 2YS9A 5K7HA 1U78A 5FKKA 1BC8C 3ZMUA 3G1LA 3U9GA 1IC8A 2E19A 2M0MA 5EDNA 3SDGA 2JTVA 2DA6A 3F21A 3HB9A 1WFXA 2QWWA 4BE1A 1Y1WJ 3JRBA 3K9TA 2NNNA 4A5MA 3CUQA 3KP2A 3DBHB 1ORKA 1ZYRF 4GDFA 4GYGA 5CQGA 1LEAA 4O3MA 2ISYA 4NNJA 3ASNH 2HYJA 3LOCA 1H9GA 3JREA 1EH8A 1G6NA 3K4LA 2K9LA 2QQ9A 4EVIA 3F0CA 4CCKA 3IKVA 4U7BA 4EMSA 5E1ZB 2L02A 3G2BA 4ZYEA 1TL8A 1SD5A 1T33A 4CA0A 1O7LA 3P9IA 1J09A 5B1BH 4KMUX 2DO7A 4BQOA 2MFZA 4PJMA 3W6KB 5DCMB 1P7IA 3FK7A 3FBNB 5J1YA 4B47A 4MNUA 1L0OC 4XSXF 5FRMA 2DOFA 1X1DA 4I98B 2LKPA 2VBYA 3ZQLA 1OYYA 1UJ8A 1X3ZB 1RR7A 5ILVA 2L0KA 2HQ5A 2CGPA 2IS2A 4K2EA 4M6YA 2YR2A 2X51A 1SFXA 2ID3A 2JZYA 2R5YB 2KZGA 2K9SA 5JVGF 1K6OA 3CQZJ 3FM5A 2OU2A 5F0FA 3A01A 4CUGA 4R8HA 2B0LA 3V8JA 3ZQIA 4AIHA 1X1BA 3PFYA 1OCTC 3HOTA 3MWMA 1D8JA 4MTDA 3WGGA 3JCUC 2W24A 3O3KA 5JLWA 2LSOA 4LG3A 1MBFA 2VXDA 1ETOA 2EIJH 1K79A 3BLYA 2ZFUA 4WXDA 2IJLA 1U8BA 4G7ZF 2MLGA 3F8NA 3HPHA 3C1DA 5B5EC 5F04A 2AS5F 3HUGB 1WSUA 5GAEJ 1XN7A 1MBKA 4N4OB 1KZHA 5DEQA 1TQPA 4HX7A 1JJ6C 3GFLA 3HXLA 3TQNA 3OSGA 2NVYJ 4L9NA 4RGUA 3P9KA 2VOOA 2CYYA 3MAJA 4BY1J 3LSPA 2ZJRF 4DYRA 4CSWA 1U2WA 1PUFB 2BZTA 2HQAA 1YRNA 4I02A 1MMNA 2MGQA 1YE9A 1WH7A 2JPCA 4KT5C 1IN6A 1ETVA 1ZG1A 3IRQA 4D7MA 1IDYA 1IDZA 1G3YA 4CCJA 4RAYA 2R7RA 3CCVI 3LSHA 3T1BA 2EFNA 5AIPA 4BEHA 4UVAA 3WGHA 5GPAA 1OMIA 3N05A 1DGRM 1S72I 3KZYA 4KJZA 2M4GA 1T8IA 2VBWA 3OMYA 3J7ZI 3WTVC 4ZDOA 5K7ZA 5FD6A 3FMQA 1MW7A 2Z3YA 2ZFWA 1B8IA 1EV7A 3A0HC 3F6VA 2Q8KA 5GPCA 1VNDA 2XGXA 4ESFA 3KP5A 2XAGA 2BGCA 3B6CA 2JK3A 3BDDA 2EZHA 3ELKA 2A5YB 2XAHA 3FXOA 2JN6A 3F6OA 3I64A 2M4KA 3HOYJ 2WWYA 2L5QA 2MA3A 2O8KA 1TWFJ 3W2VA 4C3JJ 3GMEA 2VJJA 4UB8C 2EK5A 4C2TA 2F6CA 1XGOA 2Y30A 3DLAA 2GA1A 1P4WA 1X3UA 2DI3A 4BXFA 4HRIA 4BH9A 2BVLA 2MH9A 4OINF 5TRDA 2A07F 4A3DJ 3K1MA 5C3EJ 3QWLA 4I99C 2CV2A 2F2EA 2XPWA 3R0AA 1B4AA 3RPUA 2WB1A 3KCCA 3JSOA 1B1BA 3GXOA 2CU7A 3SJMA 3LSTA 4FX4A 1W36C 2RC4A 4L5IA 4DBQA 2PN6A 2IW5A 1SFKA 3N4MA 2E2IJ 2H27A 3ZN0A 3CDIA 2AXLA 1S3JA 3DKWA 2XSDC 2JQ7A 4E7LA 2XVCA 4GYIA 2ELJA 1J9IA 4BKXA 4XORA 4ZYAA 4HLYA 2V9VA 1LPQA 1J75A 1S5LC 2NOJB 4W97A 3QYEA 3VB2A 1IF1A 4JYKA 1ZRDA 2DU9A 5FLXK 2Z1DA 3ABKH 3BR1A 1QGPA 2RGVA 1FMVA 2EFPA 4DQ2A 3WE2A 3FISA 4FASD 4G94A 3CC2I 2EIMH 1N78A 2DLLA 2EQRA 5FB2A 3V7SA 3JSPA 3P5JA 5ICEA 1RC9A 2OV7A 4E7KA 3BWGA 1FOKA 3BZ6A 1I39A 3MZHA 5CVVA 4MLOA 1W7PB 2VBZA 4CZZA 4DBRA 1VQOI 5FKNA 2KISA 2VQHA 5BQTA 2D5VA 3NAUA 3ZMVA 4HF2A 3O6BB 4YIFA 3LSIA 4GXOA 4J01A 1R1TA 3H1CA 2XV4S 4BJ6C 3H3VK 4PSWA 1YJNI 4KMFA 4EM1A 2HXOA 4V2FA 2OTJI 5E18F 2K4BA 3DPUA 3KYCB 1X19A 2E1OA 2ELKA 3F23A 1K78A 1O7FA 3ZPLA 1MJ9A 3KP4A 1VF9A 5F6FA 4Y13A 2FA5A 4DGWB 5JI6A 1HBXG 1G4DA 2IS4A 4GGGA 5CQEA 3SFIA 1HF0A 2XC7A 3DCFA 4C3HJ 1ETXA 4C3IJ 2HU9A 1SC7A 3KEYA 1Z9CA 1D0YA 4FETA 1LE8A 5GAGJ 2HTJA 6PAXA 3GFJA 3GEZA 2IBDA 1ZRFA 1OCOH 1RNLA 3BG6A 2M3AA 3RQIA 2E1MC 3RKQA 3LFKA 4M3DA 3RCOA 3HOWJ 1OISA 1ZTRA 3FDYA 1TW2A 4M9SA 4NC6A 3F9KA 4G9YA 4M9ZA 2QLZA 2RAEA 2HGCA 1QHGA 4IF4A 1BW5A 2ID6A 2R7FA 4BHPA 1VQ7I 1APLC 3W2WA 2H8WA 1GXPA 2ZSIB 5IOZA 3L2VA 3BJOA 5LRSA 2FQ4A 4IRGA 4RGRA 2Q2EB 1ON1A 4JP0A 2P6TA 3AG3H 4Z2YA 3FXUA 2DJNA 1JUPA 2CSOA 1YG2A 3SDBA 5D5VB 3LSRA 4KYWA 3CF2A 1GVDA 3LMMA 2D2WA 1B8IB 1VQPI 2LDUA 4WCGA 4OIOF 4B8XA 5LGUA 1JGSA 3GTKJ 1ZKGA 1XSVA 1RKWA 2HXIA 2RDPA 4Y3OA 1W0TA 1H9TA 3AKZA 3KP3A 3J7AO 5M3FJ 1QZZA 5E1WA 3JRAA 2XF5A 4LIUA 2ZJQF 2M30A 1TP4A 1W5SA 1E3PA 2AO9A 2NS8A 1QRYA 1BI0A 2CMPA 1I6HJ 2LKSA 3S8PA 3TMOA 5J6XA 3ZGKA 3TDUC 3QPLA 2Y31A 1I5ZA 3VYRB 3ZQCA 1O3RA 2OTLI 4ABZA 3DTKA 3HRMA 3V8KA 4BHCA 3PO2J 1V55H 1LUJB 2CUJA 1UHWA 5DUIA 2R7ZJ 3K1NA 2C6YA 1U8RA 1Y6IA 5CLSA 2M87A 3RPQA 4IZZA 3F22A 1JJ8C 2HDWA 4IEJA 4UXNA 1BI2A 2DMTA 2XGEA 1OCZH 1RRJA 2DMUA 3BR6A 3K4NA 1QO0D 2V4JC 2OD5A 5BNGA 2NXNB 1RUNA 2PBIA 2IGOA 2Z33A 1YITI 2L9RA 3C2GA 2CFXA 4CYCB 2WAFA 3JW4A 5IYBJ 4C2UA 3S3NA 2XHKA 3LAPA 1DDNA 2W25A 5CVJA 1XGMA 5IP7J 3FWEA 2XPVA 2MW8A 2AQEA 3O8GA 2BBYA 1YFHA 1D8KA 1U3EM 3AAFA 1ZG5A 4IHWA 2JSCA 4IOCF 1J59A 4HF1A 3PNYA 3WHBA 4Y17A 5HLHA 3GFIA 2CQNA 1NK2P 4LLNA 3JRFA 4CCNA 3EUAA 2B9SA 3LSMA 1JI8A 1ITYA 1TT0A 3L1PA 1B6AA 2GXBA 2JVGA 4XLNF 3H5AA 3WTYC 2MBFA 2R7QA 1OJLA 4E70A 4UUVA 3DTIA 2M1BA 5FFZA 4UVCA 1LNWA 3QODA 2YSRA 3DQVC 1K83J 2OA4A 4YELA 2BXYA 2XB5A 4IHSA 3TGNA 5KVRA 1BR4A 5M5WJ 1AU7A 1V5FA 5FO5A 3DU5A 1SD7A 1ZHFA 3RZDJ 2JRTA 3H5NA 1MMGA 4LFUA 1B72A 2QM3A 4OIQF 2XF7A 4A2UA 4EJTA 3FXLA 2LREA 4A0ZA 1DGWY 1B59A 1FT9A 5J47A 3MFKA 1QZEA 2KIMA 4P9FA 4EJVA 2IXSA 2P7CB 4B44A 4P1WA 4PGHA 1S29A 1MNEA 2IT0A 2QYOA 2H1KA 4HPQA 4R1HA 3DPTA 4BNCA 4TV7A 2DT5A 2GXGA 4KITB 1P4XA 4KA4A 3A02A 3J81K 3WTSC 2G7HA 2NOGA 1SFOJ 4AD9A 2CV1A 3VODA 3OYAA 3ABLH 3D0SA 5HDNA 2R0QC 4A12A 5D6EA 2NRAC 3WGIA 4I6ZA 2FBHA 3WU0A 2G7UA 2HTSA 4G6QA 2JPBA 4D5CA 3IAS2 4IO9F 3TW7A 3PQKA 1UZCA 3Q5FA 1QPMA 5KK1A 1KU9A 1FYMA 5FLVA 1XB4A 1P6RA 4KT6A 4B3XA 1Z3YA 1N77A 3JRGA 2FD5A 4LITA 1PUEE 2J5PA 1USTA 4F93B 4XRFA 4XR6A 3CCMI 1FBUA 3FZVA 2DTZA 2STWA 2ISZA 4RGXA 2FF4A 3IH3A 3GZNB 1ZG3A 5LGNA 3E6BA 1XGSA 3G71I 2EZKA 4DW6A 2IGNA 2RKHA 2DK8A 2JUCA 1I1SA 1G3WA 2V26A 1SANA 3JRCA 2CH0A 4RLFA 3Q0VA 1BOBA 3C2BA 1GXQA 1PP7U 1FIPA 5FD5A 1HDDC 3COAC 3MZ8A 3RKXA 4HW0A 1V54H 3HOXJ 1OCRH 5D5XB 4WXCA 2X9DA 2H09A 1B9NA 3TL4X 1YJ9I 1Z0XA 4BBSJ 3IL2A 3OYHA 2KMUA 2K27A 1FTTA 1LFPA 3EPZA 1FZPB 3VFZA 4JX4A 2VE8A 2JA6J 5HS7A 1P7JA 2D45A 4XBFA 1G8XA 5JVTA 2DYRH 4F55A 2E35A 3AFHA 1ETWA 2DAOA 5DYMA 3GTGJ 4ESJA 4KISA 3OOUA 4KIGA 1U5TB 4M6XA 3BTCA 4E7ZA 4EGYA 2ZMEA 1ZLKA 2YU9J 4BDYA 1MD0A 4ZTJA 2BY1A 1Z7UA 3OR2C 1R7JA 3HL2A 4ON0A 2CW7A 1R71A 4IQ4A 3JR9A 2EH3A 4A3FJ 4BAYA 4KIFA 2IRFG 1R36A 4V2GA 1MDMA 3DEUA 4CXFA 1GV2A 3SEQA 5HNHA 2JT1A 4XICA 4BE0A 2M45A 3HTUA 1MSEC 3GTMJ 1W0UA 4OIPF 1DPUA 5DV5A 4QPOA 2LY1A 2ZMEC 2EB7A 5EZGA 2DPUA 2VI6A 4PFOA 1LDJA 2I8DA 2XIGA 2WBMA 4II2A 1YQAA 5H6RA 4DJAA 2BW3A 3M9AA 3BCAA 2STTA 3M8EA 4PZJA 5J3LA 3CP8A 4AVPA 4QLCU 1PVEA 1WJDA 3EUKL 4E7IA 2HPIA 4BU2A 4IRIA 1ENHA 2G0EA 3MZYA 4YIIA 1P4AA 4QSHA 4C2MJ 4CDGA 1BR1A 2O3FA 2ZXHA 2X48A 3BTIA 4I0BA 5L3BA 1IN7A 3I4PA 2A6EF 4OWRB 3ABUA 2HYFA 2HOAA 4N9HA 3GTOJ 1XC5A 3FXRA 1KYWA 1HSTA 5ICGA 2PQ8A 1YLFA 3B73A 5LGTA 1IGNA 5KCMA 5FRNA 4BJTA 2ESHA 2ME0A 5DS9A 1MJBA 5H20A 1XDSA 1W5TA 3OYKA 2VL8A 1SVOA 1TC3C 2L7FP 5TISC 2K9QA 4Q4ZF 2F4MB 5E3MA 2DA3A 2JA2A 2LYCA 3CUQC 1R58A 5DDGA 5IP6A 4M3EA 4J19A 1HC8A 2Y2ZA 3C2HA 1JKRC 2CQ7A 4HG2A 1D0XA 4LB6B 4Y52J 1D5YA 3VEPA 1D3YA 3R60A 3I54A 1B9MA 1TZLA 2COBA 4U0VA 2E2HJ 3OR1C 1WHUA 2X6YA 3IP4B 5E3OA 1MMSA 2L9VA 3E6DA 4BXXJ 5K7FA 1IW7F 3J7AY 4AWXB 2PEXA 4DOZA 3OYGA 5GADJ 3E6CC 2GLOA 4UUSA 2F4IA 2Z2SB 3TW6A 2BY0A 3GTPJ 3JRHA 3ECOA 3FHZA 1D1AA 4PUSA 4UHTA 3H35A 2AXTC 2OQGA 1K7AA 1EA3A 2QBYB 3W6JB 2ZBKA 3FMSA 1OFCX 2ME6A 2DQRA 3FXMA 3A1YA 3QPHA 1MMDA 2QF7A 5F0CA 3KE2A 1E3OC 5GP9A 2B7EA 4XRSG 1O57A 1EKEA 4OIRF 3OYNA 2K9NA 2V1NA 5L3FA 4Y7NJ 2KIUA 1JE8A 4EM2A 1T98A 1TWGJ 1XPXA 1YI2I 2QSGX 2XROA 1EJ9A 1KQ0A 5DUKA 4FE7A 2DDBA 1P92A 5M5YJ 3ZMSA 4BY7J 4M73A 4YFNF 1SVLA 3FM3A 4XLHA 1R5HA 5IOYA 2LLKA 2L9SA 3R4KA 3K6GA 2F5CA 2WTEA 4QIWN 4EQQA 1YOVB 3DBRB 3E5XA 2NVUB 3BR5A 2UWMA 1HQCA 1JTYA 4HQMA 1WI3A 4GCVA 4MQVA 2BY2A 2DW4A
chains in the Genus database with same CATH topology
3LL7A 4ZZLA 4ZYHA 3S3MA 2XASA 3M7GA 4GO1A 4O6JA 1ZELA 4AIJA 2KZVA 3E97A 4IXAA 2VOPA 1UCRA 1FSHA 4UV9A 3CDHA 2FU4A 2IGMA 2LNBA 1WJAA 2RREA 3K10A 2P5VA 2NNYA 4IVNA 2FBKA 4ZTFA 2KRFA 2O0YA 2DCEA 3IC7A 3R6SA 5JR3A 2HKOA 3V42A 1BM9A 1UAAA 3IRRA 1OPCA 3A2KA 1R00A 4HDVA 4ENKA 4XL9A 2P5KA 1F9NA 1P2FA 1RI7A 5E17F 2Q0OA 2EV5A 4E7JA 4MQ9F 1TNSA 4AIKA 2MD0A 4ITVA 1YS7A 2VJIA 2IS6A 4WK8F 2L7KA 1WJCA 5A2QZ 1VTNC 1FNNA 2W00A 4HOBA 3DEEA 2KRCA 3IWZA 4PGGA 5FLXZ 4G6DA 3PNTA 5H6QA 4PFPA 4P9UA 1S8NA 1R1VA 4RM2A 2RNJA 3I71A 1AOYA 3ZXSA 5TGTA 2A61A 2XUBA 2XAUA 5CVIA 5D4RA 2VB6A 1Q1HA 5HLIA 1Z1DA 3GW2A 3M8FA 4B09A 2W1OA 4IRHA 3WTUC 3RDIA 2A3SA 3KYLA 2FXAA 3S32A 1N75A 4HX4A 4IJAA 5L3CA 2VONA 4JOMA 2HVRA 2W57A 3CUQB 2VQLA 1I27A 4ENJA 2OC6A 4D9JA 2OAZA 4ZC3A 2L4MA 2P8TA 1BC7C 2A6TA 5J8FA 1X1CA 3DKYA 3PUBA 2O5RA 1KQ9A 2DXIA 3K2ZA 2O61A 3LA3A 3GLXA 3HOSA 4WWCA 1UHMA 3D5RC 4IHTA 3W2AA 1XCVA 3WTWC 1V4RA 3L2WA 2R4GA 2QKLB 4HV5A 1NG7A 5HLTA 3C3WA 4S05A 2GA2A 4BXUA 2MC4A 4YFKF 1KU3A 4HQEA 4F3QA 1FBQA 2DK5A 3ECHA 3K4MA 4E4HA 1L3LA 2LF8A 4CO8A 3PNVA 2UZKA 5FGMA 3ROUA 3H3ZA 2R3SA 2Q1ZB 3LA7A 1XDUA 4KFCA 5LHIA 1WJEA 2W82A 4AYBA 3P7NA 2BE5F 4HZFA 3M1EA 4LLGF 1PYVA 3HSRA 3Q9SA 2VODA 3V7RA 4U7DA 4CCLA 1S7OA 2XAJA 5CKTA 1QNTA 2EWNA 5E20A 2GOMA 2V79A 5BPIA 5DD8A 4E7HA 5ILUA 4HAMA 4LJZF 4BHBA 1Y0UA 3HTSB 1I1GA 4N0BA 2X1CA 2LY2A 3QRFF 4XKBA 4NQWA 2MLKA 1YX5A 4H0EA 5HDKA 2HS5A 3AL0C 2WADA 2JUGA 4BEHB 3QP5A 3NQOA 3I5UA 2VQGA 4XLCA 3SZTA 2FUG2 4HA8A 5EEHA 3I58A 3HG9A 2VN2A 2OBPA 5CJ9A 5LRRA 2Y75A 3L09A 4HEA2 1W7PD 1Z6TA 3QPTA 1ZLJA 2DBBA 1YYVA 4LK1F 1SAXA 4BJ5C 2DOAA 4PDKA 3N97A 3KP6A 2LBFA 2E7WA 3D5SC 2V6EA 2O03A 4N9IA 2EFOA 3CJQB 4Q5SF 2R7UA 4D1QA 4AU7A 3LQQA 2RV8A 1YS6A 4UV8A 1WKMA 5ICFA 4IX7A 5IT9Z 5LBQA 2EA2A 3LWFA 4HLXA 1QZYA 1TW3A 4G8XA 3TOAA 1YTYA 5BMZA 2PMUA 3VSLA 1LDKB 1IUYA 2VBXA 2AQFA 1UFMA 4I7HA 1J7KA 2LC2A 2LF7A 1FYLA 3H9GA 4L18B 1QHHD 2BV6A 1UG0A 5LHHA 1ONVA 3OOPA 5ILSA 1HKQA 4HX8A 3I53A 3OYCA 4LLLA 4NC8A 2M7AA 4RGSA 4CZCA 2Z99A 1WWXA 3IUOA 1E2XA 3J81Z 2V9KA 2EFQA 3PFIA 2RN7A 2UUZA 4LIVA 4BQNA 2VC0A 3OS0A 4ESBA 1IRXA 2HZTA 1O3QA 1TBXA 2EV0A 2IS1A 1TNTA 3BP8A 1HA8A 2CS3A 1TLHB 3MKWB 4F92B 2COMA 4XQFA 2PJRA 2W4SA 1BJAA 4BDZA 2IGKA 3LSGA 3BCBA 1SMTA 2KQRA 4DNCA 3DF8A 1ODDA 2E5ZA 4Y15A 2H6BA 4FHTA 3K4BA 2W7NA 3L9FA 3NWTA 3HHGA 1FWZA 2GWRA 2K86A 1FP2A 4ETSA 3JAMZ 1K78B 1O3TA 2KIFA 4NHJA 3V8LA 2KRHA 3L2QA 3TDZC 2E1MB 3TBIA 1FP1D 1WRJA 3EUHA 4LGWA 1JHHA 3OY9A 4LG0A 2OZUA 2RVCA 3ERED 2R7SA 3RI4A 3KEOA 2XAFA 5ERIA 1YW9A 2PI0A 3F8BA 4XKCA 5K5OA 5DCFA 2R7OA 4F52A 2CG4A 4BL0B 3EUHC 2X0LA 1ZGAA 2CW0F 2BYVE 3OYMA 2ZCWA 3R61A 3AL0B 1PJRA 1E17A 1KU2A 1IXRC 1AA7A 3ZQ7A 1REPC 2VKDA 5TJJA 2ZKZA 3ZCOA 3J80Z 3L2CA 3EETA 4P55A 5D4SA 1IN5A 1QQIA 3DXJF 3O2PE 3SHFA 2L2OA 3SYTA 1UELB 1KGSA 3S93A 3QU6A 4RB0A 1Y56A 3JTHA 2MABA 4EATA 1GVJA 5BPDA 1PP8F 4C30A 3OYJA 2G9WA 4FX0A 4RMNA 2TDXA 5CYVA 3CESA 2UXNA 5ICCA 2WAEA 5KHDA 3I59A 3HRTA 3WG9A 4MGRA 2D1VA 2P7VB 4M9XA 2E7XA 2PG4A 4A6EA 2JVHA 3GF2A 1CGPA 3GVAA 4ZYDA 3LSKA 4J00A 4F91B 2X6WA 3OYEA 3ZMTA 2VJ5A 2LBFB 4A5NA 4BQQA 3ZR8X 2V1UA 4BQAA 1VZ0A 1X4OA 2BVMA 4F7ZA 3DFGA 1WJ5A 3IHUA 2DQLA 2KPMA 2Z5UA 4RS8A 2ZO4A 3HSEA 1H0MA 4XOTA 4E6KG 4KNYA 3F8MA 2P5LC 4ZYGA 3HPGA 1R22A 3U21A 4IPAA 2LH9A 2MD5A 5ED4A 2CW8A 3ZP5A 2PMZA 1V5GA 5D5WB 4S04A 3OYDA 4LK0F 1OLTA 1DQUA 3G73A 2CV0A 3T5XA 3GO5A 5HVQC 1R1UA 3GX4X 2NYXA 4XKVA 1IZ1A 4LD5A 2M7BA 2RQQA 2CWEA 2WA0A 1IXCA 2YX7A 3E6MA 3WODF 3K4CA 2VKHA 3OS2A 2FMLA 1IAWA 1QBJA 3QYFA 1EH7A 5LEKA 2CFOA 5JFRA 2LOOA 1ZREA 2F5FA 4CHUA 1MJAA 1HKTA 3VYTB 3FX3A 3KZZA 1YX3A 4HSTA 1BR2A 2PFBA 4KN4X 3VYSB 4ZDLA 2KJCA 4OMYA 3VOEA 1LEBA 3OYBA 3L2RA 3RQ4A 4NC7A 2P4WA 1MGTA 2XAQA 4Y33A 1HSJA 2PJRB 2EFWA 3T8TA 2V7FA 1BOAA 3E5QA 3ZQQA 2DTRA 3RIRA 2A68F 4WXHA 1SMYF 1D0ZA 3RYPA 1R6RA 1T0FA 2CO5A 3CUOA 4KIBA 5HLGA 2KLOA 4ASNA 5D5UB 1ZRCA 3FMRA 4PJNA 1FBSA 3F8CA 1Z6RA 2ACJA 4Q47A 3TKYA 2HZDA 1MZBA 3DV8A 2OQRA 3PQJA 4BACA 3R0JA 1W7PA 1T38A 1T0FC 2XRNA 3K69A 3MCZA 1BN5A 4JK1X 4LG0B 2DPDA 3REOA 1T95A 4CCMA 1MNDA 3RJPA 4OAZA 3SZPA 2VT3A 3VYUB 3VWBA 1QU3A 2H94A 4AVZA 2A69F 3F72A 5D8LB 2R7TA 4O5VA 3PL8A 3LA2A 2A6HF 1XSDA 3QOPA 2HNHA 2PMHA 3GZ6A 3BPXA 1MKMA 2P6SA 4ENNA 1SFUA 5JHUA 1YW7A 1KONA 4WX9A 1Z21A 4RLQA 2F5DA 3FBIB 4QWQA 2MC3A 1G3TA 3EYIA 3I0TA 3BJ6A 3KEQA 4OAYA 2FBIA 3UR3C 3BPVA 4DIQA 3GZ5A 4XNFA 3NEUA 3QOEA 3F8FA 1MMAA 4HF0A 2FNPA 3BC8A 3CP2A 5CVRA 2W85A 4M72A 1X1AA 1IN4A 3BG7A 3I59B 3ZMZA 3TO7A 1R5GA 5L3DA 1LVKA 1BIAA 4I0AA 2Q2EA 4MTEA 5K5RA 4HNTA 2IVMA 2KL4A 4XM3A 1BI3A 3UNGC 2K3PA 4B43A 3MD2A 4X0GA 3V4GA 3CJRB 3OYFA 5HS8A 2ZMEB 3M1CA 4EJOA 1FLIA 2HOEA 1XMKA 4XONA 4MEYF 1XGNA 1W4MA 1F4KA 3KLNA 1RUOA 3NRVA 2FSWA 2QZ8A 2QQBA 1P9QC 3V7CA 1MDMB 3SFZA 3E5UA 1I6XA 4A0XA 4ANJA 5J8CA 4OOIA 2MH2A 4RM3A 2ZNZA 4KUMA 1BI1A 2EA4A 3VDXA 3K70D 2GZWA 1IRGA 1G59A 3D5LA 3ML6A 1ZGJA 3PSFA 3EQLF 1KU7A 3SZGA 5AIQA 3WE3A 2BW3B 2FRHA 3HRSA 3ZRGA 5E8IA 2FOKA 3OS1A 1S7AA 2HPMA 2E1CA 2VASA 2M8EA 2QUFA 4CYDA 2X1DA 3K4KA 4U0WA 1LVAA 4EJUA 4L5JA 4ZJZA 4ENMA 4I09A 2J5OA 3RTRA 3BY6A 4R79A 1ZARA 3K4JA 2ZXJA 2IA2A 2HKXA 2ETHA 4L9VA 3MEXA 1R23A 2OZ6A 3H9JA 3RKWA 1IN8A 3EYYA 1HW2A 1FPQA 2UXXA 5F1RA 1ERDA 2K7LA 4RB1A 1CF7A 4XKWA 2QVOA 4YG2F 3OWTA 3C7JA 4I01A 5A2QK 2GOXB 4M74A 2XF6A 2R7XA 3GBGA 2CQKA 2VLAA 1D1CA 3U2RA 2IP2A 2VPLA 2XSJC 2FQ3A 1LB2A 4P5OA 3OYLA 4LB5A 4RB2C 2ADUA 2NAZA 3KX2A 3BROA 3KP7A 1D1BA 1FX7A 2KP6A 3TOBA 2ZSHB 3HYIA 2X1EA 5L3GA 3VSKA 5HDGA 2Y0MA 4CH7A 4HV6A 1SD4A 3IWFA 2BOLA 4LMYA 1O3SA 3CZ6A 4Q48A 2KHMA 2K4JA 2KKOA 2ZNYA 1IXSB 2L54A 2FE3A 4U88A 3L2UA 2VC1A 3OV8A 4XLFA 5D6FA 4G7HF 2Y48A 4PJLA 2HR3A 4CICA 4GRIA 1KYZA 3A4CA 4XLPF 2X85A 3ONQA 3QU3A 4EGZA 1NG6A 2WC2A 3TO6A 1V5EA 4OU0A 4EJWA 4E7SA 4BS9A 2XKPA 2WAQA 4IKFA 1ZH5A 1BIBA 3EDPA 3KETA 1OR7A 4PJJA 1FY7A 5CVUA 2D1HA 1LQ1A 2WV0A 1SFEA 1OKRA 1T6SA 3FXQA 3H92A 3DTEA 1XSXA 1HXDA 1Z7LA 2FMYA 3H9QA 3ZMDA 4L0YB 2V1DA 3T0YA 3CMMA 4JBAA 2GQQA 2RQPA 1XMAA 2YPRA 1OR7C 3WU1B 4II3A 5LEJA 3KFWX 2Z16A 2ELHA 3B02A 5HS9A 4ZZDA 2LG4A 3E0JB 1DPRA 4FT8A 1XCBA 3PJRA 4RAZA 3ISPA 2EJRA 3KLOA 2HWVA 1E0EA 2L9NA 2HYGD 4KICA 1EH6A 2HEOA 3H0DA 1J2XA 5KNLA 1DP7P 2OUMA 2DFIA 2F5EA 3DKXA 3CLOA 2A5WA 2IA0A 1XD7A 1HKSA 3DU6A 2P0WA 1U5TA 4A0YA 3CO6C 2GAUA 4UNOA 1TQMA 2VQCA 1F1ZA 4I2OA 1WQ2A 2PJPA 4HYEA 4G7OF 1SAUA 4MEXF 5JHFA 1Z3XA 2ESNA 2YX4A 1FSEA 4KN7X 1U5TC 2WY7Q 3W3CA 4U87A 4XLAA 1JHFA 4YFXF 4D0PA 4QPQA 4PK4A 2FNAA 5LLQA 4XMYA 1J5YA 1HW5A 1OYWA 2K5CA 1DP3A 1V3FA 4A6DA 2BEOA 2VJ4A 5FROA 1KQ8A 4U0YA 5BS6A 2DJIA 4L0ZB 3K1PA 5LD2C 3P9CA 3U1DA 3H3UA 4XLEA 1AWCA 1ZAOA 3S3OA 2Z9OA 1Z05A 4XN3A 2VT2A 4RB3C 3CJNA 2VE9A 3HHHA 3L00A 1GHCA 2UV1A 1FYKA 1CF7B 1JXSA 3CTAA 2R7VA 4L9TA 4EM0B 5F64A 4KDPA 1G3SA 1TQIA 2QQAA 3F3XA 4XOPA 3RKYA 2QKMB 5IT9K 2K9MA 3DWLE 1YIOA 3HSFA 4CCOA 3LQRA 2ZXIA 2GIVA 4PCQA 2VXZA 3I9V2 3OIPA 2Y0SA 5HOOA 4IQJA 3LAJA 3HRUA 1S6LA 1WJBA 5IT3A 1USSA 3HC7A 1W36D 1RZ4A 4G6TB 5D8KB 2XKOA 4BGDA 4NB5A 1S9HA 2VIXA 4ZDPA 4XSZF 5E8GA 3BOQA 2HDCA 5DCMA 5LFAA 3C18A 4HBLA 1IRFA 1Z91A 3RYRA 1GLNA 1ULYA 2L3DA 3H5RA 1RIOH 2R7WA 1OYIA 4HNUA 2M5WA 3RPUD 4P96A 2E60A 3CO7C 3OL3A 3HKZA 4PSXA 3QP6A 2R7DA 3E1SA 4Y4RA 1T39A 5LHGA 2QBYA 3MKZA 1KA8A 3GWZA 1HW1A 1WJFA 2KDOA 2H6CA 3M8JA 1LKXA 3JTGA 1LJ9A 4CGZA 4BUPA 2HQNA 2YU3A 1U0JA 1C0WA 4H4KC 3HIFA 4BYYA 1A04A 3TO9A 3FKJA 1DUXC 4XN0A 3WTZA 2L01A 2XDVA 4NQWB 3PSIA 5BOXA 3ZN1A 2L4AA 2QENA 3HUGA 2WY8Q 3QAHA 1NHAA 2KJBA 2F5VA 3T8RA 1TTYA 3G3ZA 2EV6A 3S2WA 3K70C 3LFUA 4N4NB 3K0LA 1YW8A 3E3VA 2O6GE 1LDDA 1FMWA 2RNGA 4EV0A 2V1XA 4HSRA 3JAMK 4HDUA 4B48A 1SD6A 3WTXC 3OYIA 3GUDA 3GFMA 4BE2A 5FFXA 2NS0A 1D5VA 2O8XA 3IAM2 4JQFA 4WF2A 2FEZA 2HVQA 1FC3A 3MQ0A 2DT6A 1STZA 2V6CA 2LRDA 3RSNA 1ZN2A 5E1XA 4YRVA 5DD4A 5CPRB 4YEJA 3OL4A 5K5QA 4MHGA 1ON2A 2X6XA 2X4HA 3DPLC 4UVBA 4L9JA 2HVSA 2CUZA 2HFHA 3I3LA 4OMZA 5L3EA 2E1NA 2IPQX 3DP7A 2E5NA 1K6YA 2MYSA 3SEZA 3MKYB 5K1YA 1UB9A 1WI9A 1T2KA 2HQRA 3ULQB 3J80K 1BBYA 3BJAA 3IKTA 1J0RA 4ZH4F 1U6GA 1X4PA 3NWSA 2ZJ2A 3SXYA 3FHNA 4NUBA 3GYHX 4M71A 5HNFA 1YO5C 2JSPA 2W84A 4C9YA 3ABTA 2K02A 3FF5A 3QYBA 5AONA 2PLYA 3WTTC 3Q9VA 3SQNA 1PDNC 5EEGA 3OIQA 1F5TA 1U78A 3MMYB 3L7WA 2IA1A 2DT7B 1BC8C 3ZMUA 3U9GA 2M0MA 2JTVA 3F21A 2QWWA 1WFXA 4BE1A 3K9TA 2NNNA 4A5MA 3CUQA 3KP2A 1ZYRF 4GYGA 5CQGA 1LEAA 4O3MA 2ISYA 4NNJA 1H9GA 1EH8A 1G6NA 3K4LA 2K9LA 2QQ9A 4EVIA 4CCKA 3IKVA 4U7BA 4EMSA 5E1ZB 2L02A 3G2BA 4ZYEA 1SD5A 4CA0A 1O7LA 3P9IA 1J09A 4KMUX 2DO7A 4BQOA 2MFZA 4PJMA 3W6KB 5DCMB 3FBNB 4B47A 4MNUA 1L0OC 4XSXF 5FRMA 1X1DA 4I98B 2LKPA 2VBYA 1OYYA 5ILVA 2CGPA 2IS2A 4K2EA 4M6YA 2YR2A 2X51A 1SFXA 2JZYA 1K6OA 3FM5A 2OU2A 4CUGA 4R8HA 2B0LA 3V8JA 4AIHA 1X1BA 3PFYA 3HOTA 3MWMA 1D8JA 4MTDA 3WGGA 3O3KA 2W24A 2LSOA 4LG3A 2VXDA 1K79A 3BLYA 2ZFUA 4WXDA 2IJLA 4G7ZF 2MLGA 3F8NA 3HPHA 3C1DA 2AS5F 1WSUA 3HUGB 1XN7A 4N4OB 5DEQA 1TQPA 4HX7A 3GFLA 3HXLA 3TQNA 4L9NA 4RGUA 3P9KA 2VOOA 2CYYA 3MAJA 4CSWA 1U2WA 2HQAA 4I02A 1MMNA 1YE9A 2JPCA 4KT5C 1IN6A 1ZG1A 3IRQA 1G3YA 4CCJA 4RAYA 2R7RA 3LSHA 3T1BA 2EFNA 5AIPA 4BEHA 4UVAA 3WGHA 1OMIA 3N05A 1DGRM 3KZYA 4KJZA 2M4GA 2VBWA 3OMYA 3WTVC 4ZDOA 5FD6A 3FMQA 2Z3YA 1MW7A 2ZFWA 1EV7A 3F6VA 2Q8KA 2XGXA 4ESFA 3KP5A 2XAGA 2BGCA 3BDDA 3ELKA 2A5YB 2XAHA 3F6OA 3I64A 2M4KA 2WWYA 2L5QA 2MA3A 3W2VA 2VJJA 2EK5A 4C2TA 2F6CA 1XGOA 3DLAA 2GA1A 1P4WA 1X3UA 2DI3A 4BXFA 4HRIA 4BH9A 2MH9A 2BVLA 4OINF 5TRDA 2A07F 3K1MA 2CV2A 2F2EA 3R0AA 1B4AA 3RPUA 2WB1A 3KCCA 3JSOA 1B1BA 3GXOA 4FX4A 3LSTA 1W36C 2RC4A 4L5IA 4DBQA 2PN6A 2IW5A 1SFKA 3N4MA 2H27A 3ZN0A 2AXLA 1S3JA 3DKWA 4E7LA 2XVCA 4GYIA 2ELJA 1J9IA 4XORA 4ZYAA 4HLYA 2V9VA 1J75A 2NOJB 3QYEA 3VB2A 1IF1A 1ZRDA 2DU9A 5FLXK 2Z1DA 1QGPA 2RGVA 1FMVA 2EFPA 4DQ2A 3WE2A 4FASD 4G94A 1N78A 2DLLA 5FB2A 3V7SA 3JSPA 5ICEA 2OV7A 4E7KA 3BWGA 1FOKA 3BZ6A 3MZHA 5CVVA 4MLOA 1W7PB 2VBZA 4CZZA 4DBRA 5BQTA 2VQHA 3ZMVA 4HF2A 3O6BB 4YIFA 3LSIA 4GXOA 4J01A 1R1TA 4BJ6C 2XV4S 4PSWA 4KMFA 4EM1A 5E18F 2K4BA 3DPUA 1X19A 3F23A 1K78A 1O7FA 3ZPLA 1MJ9A 3KP4A 5F6FA 4Y13A 2FA5A 4DGWB 5JI6A 1HBXG 1G4DA 2IS4A 4GGGA 5CQEA 2XC7A 2HU9A 3KEYA 1Z9CA 1D0YA 4FETA 2HTJA 6PAXA 3GFJA 3GEZA 1ZRFA 1RNLA 3BG6A 2M3AA 2E1MC 3LFKA 3RCOA 3FDYA 1TW2A 4M9SA 3F9KA 4G9YA 4M9ZA 2QLZA 2HGCA 4IF4A 1QHGA 2R7FA 4BHPA 3W2WA 1GXPA 2ZSIB 3L2VA 3BJOA 5LRSA 4IRGA 4RGRA 2Q2EB 1ON1A 2P6TA 4Z2YA 3FXUA 2CSOA 1YG2A 3SDBA 5D5VB 4KYWA 3CF2A 3LMMA 2D2WA 2LDUA 4WCGA 4OIOF 4B8XA 5LGUA 1JGSA 1XSVA 2RDPA 4Y3OA 1H9TA 3AKZA 3KP3A 3J7AO 1QZZA 5E1WA 2XF5A 4LIUA 2M30A 1W5SA 1BI0A 2CMPA 3S8PA 3TMOA 5J6XA 3ZGKA 3TDUC 1I5ZA 3VYRB 1O3RA 3DTKA 3HRMA 3V8KA 4BHCA 5DUIA 1UHWA 2CUJA 3K1NA 2C6YA 1U8RA 1Y6IA 5CLSA 2M87A 3RPQA 4IZZA 3F22A 2HDWA 4UXNA 1BI2A 3K4NA 1QO0D 2V4JC 2OD5A 1RUNA 2PBIA 2IGOA 2Z33A 3C2GA 2CFXA 2WAFA 3JW4A 4C2UA 3S3NA 2XHKA 3LAPA 1DDNA 2W25A 5CVJA 1XGMA 3FWEA 2AQEA 2BBYA 1YFHA 1D8KA 1U3EM 3AAFA 1ZG5A 2JSCA 1J59A 4HF1A 3PNYA 4Y17A 5HLHA 3GFIA 4LLNA 4CCNA 3EUAA 3LSMA 1JI8A 1TT0A 1B6AA 2GXBA 4XLNF 3WTYC 2JVGA 3H5AA 2MBFA 2R7QA 4UUVA 4E70A 5FFZA 2M1BA 3DTIA 4UVCA 1LNWA 3QODA 2YSRA 3DQVC 2OA4A 4YELA 4IHSA 3TGNA 5KVRA 1BR4A 1V5FA 5FO5A 3DU5A 1SD7A 1ZHFA 2JRTA 3H5NA 1MMGA 4LFUA 2QM3A 4OIQF 2XF7A 4A2UA 4EJTA 4A0ZA 2LREA 1DGWY 1B59A 1FT9A 3MFKA 2KIMA 4P9FA 4EJVA 2IXSA 2P7CB 4B44A 4P1WA 4PGHA 1S29A 1MNEA 2IT0A 2QYOA 4HPQA 4R1HA 3DPTA 4BNCA 4TV7A 2DT5A 2GXGA 4KITB 1P4XA 4KA4A 3J81K 3WTSC 2G7HA 4AD9A 2CV1A 3OYAA 3D0SA 5HDNA 4A12A 5D6EA 2NRAC 3WGIA 2FBHA 3WU0A 2G7UA 2HTSA 4G6QA 2JPBA 3IAS2 3PQKA 3Q5FA 1QPMA 5KK1A 1KU9A 1FYMA 1XB4A 1P6RA 4KT6A 4B3XA 1Z3YA 1N77A 4LITA 1PUEE 2J5PA 1USTA 4F93B 4XRFA 4XR6A 1FBUA 3FZVA 2STWA 2ISZA 4RGXA 2FF4A 1ZG3A 5LGNA 3E6BA 1XGSA 2IGNA 2RKHA 2DK8A 1I1SA 1G3WA 2V26A 2CH0A 4RLFA 1BOBA 1GXQA 1PP7U 5FD5A 3COAC 3RKXA 4HW0A 5D5XB 4WXCA 3TL4X 2H09A 1B9NA 3IL2A 3OYHA 2KMUA 2K27A 1LFPA 1FZPB 3EPZA 3VFZA 2VE8A 5HS7A 2D45A 4XBFA 1G8XA 5JVTA 4F55A 3AFHA 2DAOA 5DYMA 4ESJA 4KISA 3OOUA 4KIGA 1U5TB 4M6XA 4EGYA 4E7ZA 2ZMEA 1ZLKA 4BDYA 1MD0A 4ZTJA 1Z7UA 3OR2C 1R7JA 3HL2A 4ON0A 2CW7A 4IQ4A 4BAYA 4KIFA 2IRFG 1R36A 1MDMA 3DEUA