3D5LA

Crystal structure of regulatory protein recx
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
LAKISKIEAQKRKGRYNIYLDGKYAFPVAESVLIQFRLMKGTELDEKQIAAIATADQQAKAYSRMLDYLSYQMRTESDIVKKLKEIDTPEEFVEPILKKLRGQQLIDDHAYAASYVRTMINTDLKGPGIIRQHLRQKGIGESDIDDALTQFTPEVQAELAKKLALKLFRRYRNQPERRREQKVQQGLTTKGFSSSVYEMIKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA repair regulatory protein RecX.
rcsb
source organism Lactobacillus reuteri
molecule tags Signaling protein
molecule keywords Regulatory protein RecX
total genus 74
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA03
1.10.10.2800 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5lA01
3ABUA 2O03A 4HLYA 4HF0A 5CLSA 3RTRA 5FFXA 3QPHA 1SMYF 1I5ZA 3E97A 4LK1F 4LG0B 3CUQC 5DEQA 1TW2A 2V1DA 1S7AA 1FSEA 4IRIA 4ENKA 3EUHA 1QPMA 3E5UA 3WTZA 4YFXF 3MCZA 4Y17A 1FYKA 4U7BA 1HBXG 5J6XA 2CW0F 4JBAA 4KIGA 2VODA 5L3CA 3WU0A 1PP8F 4EGYA 1YS7A 2IRFG 4GYGA 3F23A 2QUFA 4BH9A 4ESJA 2QZ8A 3DP7A 1WQ2A 3BDDA 2UXNA 4A0YA 4YG2F 5LBQA 3R6SA 1S29A 1GXPA 1EH7A 3J7AO 1SD5A 2V1UA 1BI3A 2DFIA 2YU3A 2NAZA 3KCCA 4I0AA 4P96A 2DQRA 3CLOA 1XCBA 2FSWA 2KKOA 2F2EA 3KP2A 4OIOF 2FU4A 4GGGA 1LVAA 2EA4A 4HF1A 3L2CA 2G7HA 2P7CB 3J80K 1YW9A 3O6BB 2CWEA 1ZLKA 2QQBA 3ZN1A 4I09A 4AD9A 5ICFA 3ZMTA 2HGCA 3FMRA 3V7SA 2QQ9A 3GF2A 2ZMEA 2OZUA 2A5YB 3WGIA 4P9UA 4EJWA 4MHGA 3KLNA 3T8TA 4M74A 5FGMA 2BYVE 5LLQA 3HHGA 1XDSA 1OKRA 1IRFA 1IXRC 3ZMSA 4NHJA 3TKYA 3MZYA 4EM2A 2X4HA 4I0BA 2DAOA 3M9AA 1IN5A 1LQ1A 1OMIA 2GAUA 3R4KA 4LMYA 1KQ8A 1FYMA 2O6GE 3EDPA 3RYPA 2A6EF 3KZYA 4A6DA 1YW7A 4IXAA 3N4MA 4BQAA 2XKPA 2PQ8A 2VONA 2Y0MA 3ZMUA 5LHIA 3ZP5A 4RAZA 3GUDA 3FHZA 2EV6A 3F21A 3ZMDA 2KIMA 1FC3A 2XASA 2ADUA 4M9XA 3F8CA 2ZFWA 4R79A 1TBXA 1I6XA 2NS0A 3WTYC 3U9GA 4G7ZF 3QPTA 2NRAC 5D5XB 3LFKA 2CO5A 3F3XA 1HKQA 4U0YA 4FHTA 1O3QA 2G9WA 2EFNA 2XHKA 2IW5A 2XAJA 1RNLA 4CXFA 4U7DA 1BBYA 2FOKA 1W5SA 2KJBA 1O3RA 1IUYA 1HW2A 1GXQA 2OAZA 4HQMA 2P5VA 3QOPA 2PEXA 4RGUA 1IN8A 4P5OA 1L0OC 1YTYA 4B09A 2FQ3A 2COMA 1KYZA 2JT1A 2PJPA 3ZMVA 4L0ZB 5LHHA 1ZG5A 1TQIA 1H0MA 3N97A 2V9VA 5IT9K 1KU3A 5DCMB 3DPLC 3G73A 5BOXA 3NRVA 5D4SA 3LA3A 2XAFA 3I58A 2K4JA 3L00A 4XSXF 3U2RA 4OIPF 3CUQB 3TOBA 4CZZA 4KN4X 2H94A 3GLXA 4Y15A 3WODF 1O3SA 1MD0A 2LF7A 4UVCA 2RV8A 1D8KA 2KRFA 2QENA 1QZYA 5ICCA 3TO6A 2HKOA 4AIKA 2TDXA 1ZGJA 1LB2A 1R58A 3KEOA 1OYWA 4PZJA 1XDUA 4P55A 1EH6A 2QBYB 4KT5C 1XGOA 1J0RA 3T0YA 3RYRA 3E6BA 1FY7A 1FSHA 5LGUA 1U78A 3FXUA 3K9TA 4RB1A 3FM5A 3SZTA 4MEXF 1ODDA 4HDUA 4U0VA 5BQTA 1TTYA 4MGRA 1SFXA 5HLHA 2BE5F 3K1MA 4UXNA 1W5TA 2PLYA 2HFHA 2H6CA 2MBFA 3BWGA 3MEXA 2Z3YA 3T8RA 3Q9VA 3HHHA 3F22A 2WTEA 1UCRA 1BC7C 2VBZA 2RDPA 2VC0A 1REPC 2GA1A 4OMYA 2J5PA 3BPVA 1T6SA 1RUNA 4A12A 3F6OA 3F8NA 3IWZA 2V6CA 1MDMA 1Z6RA 3L9FA 2ETHA 1OYYA 1T39A 2ZJ2A 3KP6A 4EM0B 3K69A 4CYDA 1XD7A 4EJUA 2E7XA 3GX4X 1YO5C 1T38A 5L3BA 5AIQA 4EJOA 3D5LA 3HRTA 5CVJA 1LDJA 1G4DA 1U6GA 2Z99A 1FP2A 1S3JA 1ZARA 1F9NA 2CSOA 1J5YA 2DW4A 2HWVA 3VEPA 4A0ZA 1I1SA 5H6QA 2PG4A 3TDUC 3MFKA 1IN7A 3FWEA 1G3SA 2HOEA 2QM3A 3ERED 5K5RA 1E17A 3ECHA 5DD4A 2EB7A 2EWNA 2D1HA 3HOTA 5LGTA 1Z6TA 1QQIA 3BPXA 1R5GA 2VT3A 4BXUA 1U2WA 2PN6A 4LJZF 3LA2A 4EMSA 5BMZA 2QQAA 4TV7A 3HIFA 2XV4S 3DXJF 3ZMZA 3NEUA 2VOPA 4I98B 2A07F 3ROUA 1HW5A 1G3YA 4CGZA 2QVOA 2UWMA 5E20A 1B4AA 3MAJA 5D8KB 4HZFA 4ENJA 4ZZLA 2H27A 3IC7A 2L4MA 3GFJA 3M8EA 4ZZDA 2OU2A 2LF8A 3R0AA 4R1HA 5DV5A 2MH2A 3HTSB 1QBJA 1TQMA 5HLGA 2CFXA 4ZYHA 2CYYA 3QU3A 1YW8A 3I59A 1HSTA 1U5TC 2YSRA 2RKHA 1C0WA 1MJBA 2HS5A 4IVNA 5BPIA 3HSEA 3CUQA 2LDUA 3V8KA 3IKVA 2P6SA 2Z33A 1K6OA 3M7GA 3AAFA 1TQPA 3GW2A 1BC8C 4PGHA 4BHBA 1E2XA 5DCMA 1CGPA 1SFEA 3QAHA 3E5XA 4G6DA 3DKWA 4Q48A 2UXXA 4N9IA 2NYXA 2R3SA 3C7JA 4A5NA 4GYIA 4H0EA 4HX4A 3T1BA 4RB3C 1PDNC 2HEOA 1EV7A 4YFKF 2EFWA 2HYGD 3KEQA 3F8MA 3QU6A 3I54A 4LLLA 3TO7A 2M1BA 1JXSA 2Q2EA 2VE9A 2EV0A 3VODA 3R61A 2MA3A 3PFIA 5F1RA 2HYFA 2ISYA 1BI0A 1K78B 4Q47A 2B0LA 3HOSA 2JRTA 1WKMA 4KA4A 1WSUA 4FT8A 3WE2A 1F5TA 5IT3A 5TRDA 5HDKA 3PQJA 5DCFA 5CYVA 3H3UA 2VBYA 1ZG1A 1QNTA 1J75A 3EETA 2UZKA 3BJOA 1H9TA 1FBUA 2P5KA 1R36A 2DTRA 1W7PD 1XSXA 5F6FA 4ESFA 4IJAA 4L5IA 1U8RA 2VC1A 1WI9A 1XMKA 5A2QZ 3SFZA 3WGGA 2A69F 3I0TA 1KQ0A 2JPBA 4OU0A 3F8FA 2ZBKA 1FYLA 1O57A 1DP7P 1Y0UA 2EFOA 3QP6A 1IAWA 2DBBA 1IW7F 3OV8A 3KP3A 3Q9SA 3WTSC 5L3GA 2Q0OA 1FOKA 3V7CA 3SZPA 2GXBA 2IA0A 5DD8A 2VBWA 3KE2A 3RI4A 1ZRDA 2FBHA 5HOOA 1Q1HA 1ZRFA 4A2UA 3LAJA 4U88A 2ESNA 1YFHA 2HTSA 4WK8F 4Q5SF 2W57A 1FPQA 5HVQC 1P92A 1YIOA 5D4RA 5BS6A 1IN6A 3WE3A 5FD6A 1CF7A 1XSDA 1Z05A 2ESHA 5HS8A 4RB0A 4RGRA 1ZAOA 1J9IA 2OBPA 3GZ5A 2VOOA 2OQRA 1EH8A 1UB9A 4IHSA 1XCVA 4IHTA 3KFWX 3CUOA 3BZ6A 1MGTA 2ZNYA 2V79A 1JGSA 1YYVA 1S6LA 4I01A 4ZYDA 4UUVA 1D3YA 4HBLA 1XMAA 1SD4A 1W4MA 1XSVA 3COAC 5CVVA 1XGMA 2JTVA 5JVTA 2GA2A 2WV0A 1T98A 1R1TA 2IA2A 3J80Z 4BYYA 3C3WA 4CHUA 1ZHFA 4YIIA 4AIJA 1R23A 3GZ6A 4IRGA 5KK1A 4LGWA 3LQRA 4Z2YA 4L5JA 4WCGA 3I4PA 5HLIA 1JHHA 1RI7A 1DPUA 3E5QA 2J5OA 4KIBA 1S7OA 2MLKA 3B73A 4EM1A 2FMLA 1UFMA 2Q8KA 4EJVA 4DNCA 2OA4A 1W7PB 2JZYA 3FX3A 2KIFA 3F72A 2HZTA 2DLLA 4KMUX 3C18A 3GWZA 3ULQB 1K78A 5H20A 3S2WA 2FA5A 2IJLA 4JQFA 1T0FA 1AOYA 1ZREA 1F4KA 4LLNA 2CGPA 3M1EA 4IF4A 4MEYF 3DQVC 1P4XA 5HDGA 3QRFF 4HA8A 5L3DA 4QLCU 4XRFA 1FX7A 4KN7X 3D0SA 4G94A 1BOAA 1R1UA 5BPDA 2RQPA 4EJTA 2RNJA 4DQ2A 3DF8A 2P8TA 1ON1A 2ZCWA 4M6XA 1FBQA 2VBXA 2O61A 4LD5A 2VN2A 4PCQA 4OOIA 1LDKB 2IVMA 4O3MA 3MZHA 3E3VA 5FLXK 1D5VA 4QWQA 3TDZC 2D1VA 2L3DA 3HUGA 1A04A 2FNAA 3KP7A 1P4AA 2JSCA 4IPAA 5DDGA 1IXCA 4KYWA 3DPTA 4YFNF 3BJAA 4JK1X 1USTA 2GQQA 4ZYGA 4ENMA 4BAYA 3W6JB 3L7WA 2K27A 1FWZA 3EQLF 5LGNA 5ILSA 2E1NA 1HQCA 1Z1DA 4RGXA 3HSRA 2L54A 3DFGA 2AXLA 3DV8A 1Z91A 3BY6A 4ZYEA 3FXRA 2E7WA 4E70A 4A5MA 2R7FA 4KUMA 2ZNZA 3GFIA 3K1PA 2IPQX 3QP5A 3IL2A 1R00A 4RB2C 4BNCA 4MTEA 2Z5UA 3BJ6A 1KA8A 2EK5A 3WG9A 3WTWC 4HAMA 2EA2A 4HX7A 2H6BA 1W7PA 5D6FA 3CO6C 3SXYA 1K7AA 3FM3A 3U1DA 3RKWA 3TQNA 4G6QA 2L01A 1T2KA 4LFUA 1KQ9A 1SMTA 3LQQA 4L0YB 2QWWA 2DI3A 3C1DA 5K5OA 3ZN0A 1OR7A 1UHWA 3VOEA 5ICEA 2RC4A 3GYHX 1J7KA 1ZLJA 2L02A 5AIPA 5DUKA 2A61A 1G3TA 1MKMA 1WWXA 2WC2A 2CQKA 4HLXA 3ELKA 2E1CA 1SFUA 3KETA 3E6DA 1OYIA 3FZVA 1LEBA 3ABTA 5FFZA 4S05A 3TGNA 3RJPA 6PAXA 5DYMA 4LB5A 3NQOA 3ZPLA 5D5WB 3Q5FA 1ZRCA 3HRMA 2ZO4A 5AONA 2F5FA 2XUBA 4ENNA 1D8JA 3JAMZ 2MC3A 1RZ4A 1XGNA 2HQRA 2EJRA 2PI0A 5CJ9A 3IWFA 1IN4A 4UVBA 3WTXC 2Y48A 4G7HF 1X3UA 2P7VB 3LSTA 4MQVA 1FLIA 3KP4A 1S8NA 1YQAA 3RIRA 2F5DA 3K0LA 2EV5A 2EFQA 5F64A 3VB2A 2PMHA 4LK0F 5IT9Z 4HDVA 4NB5A 3WTVC 3P9IA 1LDDA 4ZH4F 2FMYA 3SHFA 4HQEA 3K1NA 1Z7UA 2KJCA 5ED4A 3RKXA 2XROA 1G6NA 4EV0A 3G3ZA 2A68F 5K1YA 5K5QA 3BOQA 2W85A 2P4WA 2XAQA 2MD5A 3TOAA 2FF4A 3GFLA 1ZYRF 4WXCA 4G8XA 1R22A 4LB6B 4KIFA 4O6JA 2OZ6A 4P9FA 2IA1A 1KU2A 3DEUA 4HYEA 1DPRA 2LSOA 3GFMA 1B1BA 3CO7C 2NNYA 1TLHB 4A0XA 2HDCA 3JTHA 1IZ1A 1UHMA 5ICGA 4ASNA 3R0JA 4FX0A 3V4GA 4UVAA 2M87A 1BM9A 3EYYA 4D0PA 2V1XA 3E6MA 3BP8A 1U3EM 4MTDA 4EQQA 1ZG3A 1R7JA 3FXQA 2DK5A 2MLGA 2P5LC 4RAYA 2BV6A 3LWFA 4L9TA 2DT5A 4WXDA 4L9JA 5HDNA 3M8FA 4M6YA 1RIOH 4K2EA 3GVAA 4BHCA 2G7UA 1MDMB 3FMQA 5FD5A 3JSOA 2YPRA 4HX8A 4FX4A 4L18B 1I27A 1BN5A 3JAMK 3P9CA 2CG4A 2O8XA 4MNUA 2ACJA 4IRHA 2Z9OA 4LLGF 3LAPA 1FNNA 3B02A 4M72A 2YR2A 1CF7B 1MZBA 1BIAA 2XAHA 2DO7A 2VT2A 1MJAA 3IKTA 4OIQF 2R7DA 2D2WA 5E1XA 5FB2A 4GXOA 3IHUA 3WTTC 4LG0A 3WGHA 4WWCA 2JPCA 1O7FA 4XBFA 2IT0A 1ZH5A 1FP1D 4ESBA 3W6KB 2HKXA 4L9VA 5JHUA 2RGVA 2PFBA 5LEJA 5JFRA 3OOPA 3K2ZA 3O2PE 4M9ZA 1HKTA 3MWMA 1IRGA 1KU9A 2XKOA 1YLFA 1XGSA 2A6HF 3GO5A 5ILUA 2BBYA 4HV6A 4BHPA 3I59B 1ON2A 3FF5A 2O3FA 5D8LB 4OMZA 2D45A 1JHFA 2BGCA 1Z9CA 3O3KA 2GXGA 1B59A 1SD7A 5EEGA 4O5VA 1P6RA 3RDIA 5L3FA 3VFZA 3JSPA 1LJ9A 5CVUA 4M73A 1B6AA 2ISZA 1O7LA 1BIBA 2FBIA 4CICA 1KGSA 5E8GA 1TNTA 1U5TA 4Q4ZF 2W24A 3HYIA 3ML6A 5D5UB 2FBKA 4KFCA 4WX9A 3CJNA 2GWRA 4KICA 3I64A 1MJ9A 3E6CC 1ZN2A 3LA7A 3REOA 5H6RA 4RS8A 5ILVA 1RUOA 2STWA 3JW4A 5ERIA 3ZQ7A 2VXZA 3L09A 1KYWA 1P4WA 1QO0D 3HRSA 2GZWA 4N0BA 3ISPA 4M71A 5J8CA 1DDNA 2W25A 4AVPA 2RN7A 1QZZA 4I7HA 1SAXA 2M45A 4HW0A 2DK8A 3V8JA 3KLOA 4MQ9F 2K4BA 4UNOA 2KIUA 1SD6A 4GO1A 4B8XA 1LEAA 5L3EA 2YX4A 3RKYA 3KZZA 1ONVA 1BI2A 1USSA 5LHGA 1I1GA 1P2FA 5E1ZB 2HR3A 4G9YA 2QLZA 1V4RA 1O3TA 1JE8A 1NHAA 5D6EA 2F5EA 2XIGA 2DPDA 1V3FA 1F1ZA 5D5VB 1GVJA 4UV8A 2C6YA 3V8LA 4EGZA 3P9KA 2LNBA 1FT9A 3I71A 4AWXB 1TNSA 4OIRF 5LRSA 4N9HA 4U0WA 2QYOA 2K02A 2STTA 5KVRA 1L3LA 4L9NA 3TO9A 1PUEE 1YS6A 1BI1A 2QBYA 2FRHA 2K86A 3HTUA 1HKSA 3V7RA 2X0LA 4HOBA 4YIFA 1YG2A 2RVCA 4S04A 5A2QK 2W84A 1H9GA 1KU7A 2EFPA 4UV9A 2K7LA 3CTAA 3MQ0A 5FLXZ 1K79A 5E8IA 4G7OF 2GIVA 4WF2A 5EEHA 2YX7A 5J8FA 2XVCA 2NNNA 2M8EA 3H3ZA 3WU1B 2FXAA 5HS7A 2OQGA 5LRRA 2Y75A 1XB4A 2DQLA 3JTGA 2A3SA 1J2XA 3IRRA 3HSFA 3GXOA 1HW1A 5CVIA 5JI6A 4RGSA 4I2OA 4M9SA 3EYIA 3SQNA 1PP7U 1STZA 2HQNA 1IF1A 3GEZA 2WWYA 4A6EA 3P7NA 1ULYA 4NQWA 2F5CA 1AWCA 1R5HA 4HF2A 4KMFA 4UHTA 2LKPA 1XN7A 2ELHA 3PQKA 5HS9A 1QGPA 5DUIA 1DUXC 4XLPF 4R8HA 1G3WA 3RPUA 4AIHA 5CVRA 4WXHA 2DU9A 3F8BA 3I5UA 1BJAA 2DPUA 4CDGA 1VTNC 2BEOA 4PDKA 2FNPA 3J81Z 3RPQA 2HTJA 1IXSB 5E17F 1GHCA 5E18F 3BROA 4KDPA 2O0YA 2M5WA 2M30A 4GCVA 4Y13A 2FEZA 1J59A 5TJJA 2XRNA 1U5TB 2PBIA 4HV5A 5JR3A 1HSJA 1FZPB 1LNWA 3J81K 1B9MA 1ZGAA 4OINF 3ECOA 3WTUC 2H09A 2XAGA 2AS5F 3T5XA 2MH9A 2IP2A 4EVIA 3FMSA 2P6TA 1B9NA 1OPCA 2ZMEB 4I02A 4PGGA 2ZXJA 2PMUA 1HXDA 5LEKA 1TW3A 4XSZF 2OD5A 4XLNF 4CO8A 3I53A 3KP5A 2L4AA 2ZKZA 3CDHA 1R1VA 2VE8A 5FO5A 2XGXA 2FE3A 1FBSA 3H92A 3IRQA 3HRUA 3F6VA 4ON0A 4ETSA 4F7ZA 4KNYA 1WRJA 3R60A 5E1WA
chains in the Genus database with same CATH superfamily
3ABUA 2O03A 5JLXA 4XICA 4HLYA 1ZGWA 2KT0A 4HF0A 4NC8A 5CLSA 3RTRA 1MNEA 5FFXA 4DW6A 3QPHA 2EZKA 2E2IJ 2E5NA 1BJZA 1SMYF 1I5ZA 3E97A 3LSKA 4LK1F 4LG0B 3CUQC 5DEQA 2R7TA 1TW2A 2V1DA 4CUGA 2OC6A 1S7AA 1FSEA 1IUFA 4IRIA 4ENKA 3EUHA 1WJ5A 3A2KA 3OYNA 1QPMA 3E5UA 3WTZA 4YFXF 3MCZA 4Y17A 4E7JA 1FYKA 3RSNA 3A4CA 2XAUA 4U7BA 1HBXG 5J6XA 2CW0F 4JBAA 4KIGA 2VODA 3PIPF 5L3CA 3WU0A 1PP8F 1UG0A 2WA0A 1YS7A 4EGYA 2IRFG 4GYGA 4D7NA 5B5EC 3HOXJ 2RNGA 3OYJA 2I10A 3F23A 2QUFA 5DTDA 4BH9A 4ESJA 3OYFA 5F0FA 2QZ8A 2VJ5A 3DP7A 2X6XA 3OYHA 1VFCA 1WQ2A 3BDDA 2UXNA 4A0YA 2ZJQF 4YG2F 2OF7A 4HNUA 4PUSA 3RQ4A 5LBQA 2HYJA 4DYCA 3R6SA 1S29A 1GXPA 1EH7A 2M9HA 3J7AO 1K4TA 1SD5A 2V1UA 2NVYJ 1A6QA 1BI3A 2DFIA 3FIWA 2YU3A 4QPOA 2NAZA 3KCCA 4I0AA 4P96A 2DQRA 2OCCH 3CLOA 2JA6J 4IX7A 3PUFA 2V6EA 1XCBA 2FSWA 2KKOA 3QYFA 5FLMJ 2F2EA 3KP2A 3OL4A 3ZQQA 2JUCA 4OIOF 1A6IA 3IH3A 2CV1A 1SAUA 2FU4A 2VKVA 2ZXWH 1JKQC 2R7SA 4GGGA 4II3A 1LVAA 3TP0A 2EA4A 3K4BA 4HF1A 3L2CA 2G7HA 3EPZA 2P7CB 3J80K 1YW9A 3H5NA 3O6BB 2BY3A 1Z3XA 2CWEA 2LYCA 1QHHD 2QQBA 1X1AA 3ZN1A 4I09A 1ZLKA 4AD9A 5ICFA 4PJ0C 3ZMTA 2HGCA 3FMRA 5FKNA 2HDDA 2IS1A 3V7SA 2QQ9A 3GF2A 2ZMEA 3NARA 2OZUA 2JA5J 1RESA 2A5YB 2DMNA 3WGIA 4RLFA 4P9UA 4EJWA 4MHGA 2DJIA 3KLNA 3T8TA 3LSJA 3L2QA 4M74A 4MFEA 1ZR4A 5FGMA 2BYVE 5LLQA 3HHGA 1TT0A 1QHGA 3FKIJ 1XDSA 4HPQA 2KQRA 3KX2A 1OKRA 2QKMB 1IRFA 4N4OB 1IXRC 3ZR8X 3ZMSA 4B1RA 2E1MB 4NHJA 1VQ8I 3TKYA 2VQCA 3GTLJ 3MZYA 4EM2A 3A1YA 3GCMA 1U9NA 2R5ZB 4BQOA 2X4HA 4I0BA 2DAOA 2KL4A 3M9AA 3O8HA 4PSWA 2L7ZA 1X19A 1FTZA 3N05A 1IN5A 1PVEA 1OMIA 3ONQA 3GTJJ 2GAUA 4D9JA 3L2WA 3R4KA 2EIKH 4LMYA 1KQ8A 1FYMA 2O6GE 1OCCH 2NXNB 3EDPA 3RYPA 5J1RA 2A6EF 3KZYA 4A6DA 1YW7A 4IXAA 1T33A 3N4MA 4BQAA 3S1MJ 2XKPA 1X1BA 3OYEA 2PQ8A 1R6RA 2VONA 2Y0MA 3TL4X 1P7JA 3ZMUA 2IAIA 3O8GA 5LHIA 3GTMJ 1RPWA 2L9NA 4RAZA 3K10A 3ZP5A 3S1QJ 4IOAF 5FROA 3P5JA 3CF5F 4A3FJ 1WJDA 3GUDA 3J7ZI 5EZGA 3MKZA 1AKHA 1BOBA 2EILH 4KITB 2ZJRF 1VQMI 3FXLA 1GUUA 3ASNH 3FHZA 3JR9A 2EV6A 3F21A 3ZMDA 1VF9A 3IP4B 2KIMA 4XOTA 1FC3A 1ZKGA 2ZFUA 2XASA 2DFHA 3BZCA 2ADUA 3FK6A 4M9XA 4F93B 3F8CA 1V5EA 4HRIA 2VI6A 4UUTA 2ZFWA 2VPLA 1VQ6I 3CMAI 4R79A 1TBXA 3QODA 1W36D 2BW3B 1GV2A 5M5YJ 1IV6A 5FKMA 3VSKA 1I6XA 2NS0A 3WTYC 4V2FA 3FDYA 3RCOA 3U9GA 2DDBA 4I76A 4G7ZF 3AG3H 3QPTA 2NRAC 2XSJC 5D5XB 2M8GX 3LFKA 2CV2A 2CO5A 3F3XA 2DCEA 4Y4RA 2KP6A 1HKQA 2IS6A 4XQFA 1ETQA 4U0YA 4FHTA 1O3QA 3OOUA 2G9WA 1LUJB 2EFNA 2LC2A 2XHKA 2NVXJ 3I4NJ 3L2UA 5M3MJ 2IW5A 2XAJA 1RNLA 4CXFA 2K3PA 4E7LA 1UZCA 2X6OA 4U7DA 1BBYA 2FOKA 4DBRA 2FJ1A 1W5SA 2KJBA 4A3CJ 2QSFX 3JRGA 1O3RA 1IUYA 3OYMA 1HW2A 4F3QA 1GXQA 3SDBA 2OAZA 1FMWA 4HQMA 2P5VA 3QOPA 2PEXA 1YRNA 4RGUA 3CCRI 1MNMC 1IN8A 4P5OA 1L0OC 1YTYA 4B09A 1GDTA 3ZQFA 2FQ3A 2COMA 1FJLA 1KYZA 2AQEA 2JT1A 3KYDB 2PJPA 3ZMVA 3H5AA 2M3AA 3KIOA 4XNFA 3W6VA 1JKRC 4L0ZB 2K40A 5LHHA 2DMPA 3HC7A 1EJ9A 3H9GA 1ZG5A 1TQIA 3MKWB 2F4IA 2RAEA 2GBYA 3LSHA 1H0MA 3N97A 4BE1A 4E6KG 2V9VA 1Y1WJ 3SEQA 2HPIA 2DTZA 2EIJH 3NWTA 2JJ7A 2E60A 2LKXA 5IT9K 1KU3A 2E1OA 5DCMB 3H5RA 3DPLC 3G73A 2BOLA 5BOXA 3NRVA 5LFAA 3MZ8A 5D4SA 4XN3A 4DJAA 4C3HJ 2Z2SB 3LA3A 2XAFA 2HI3A 3OIOA 3I58A 2K4JA 2XSDC 3H0GJ 1Y1VJ 3L00A 4XSXF 3U2RA 4OIPF 2KLOA 4BY1J 5IOZA 4MIMA 3CUQB 3OS1A 2JVGA 3TOBA 4CZZA 4KN4X 4RM2A 2H94A 2F6CA 3BR0A 3GMEA 3DKXA 3GLXA 3GTGJ 2W82A 4Y15A 3WODF 1O3SA 1MD0A 3ZOBA 2LF7A 1D1BA 4UVCA 4XM3A 2RV8A 1D0XA 2COBA 4W1UA 2VKHA 3CP8A 1T0FC 3CP2A 1D8KA 2LY1A 2KRFA 1MH3A 3OY9A 2QENA 3IAS2 4BUPA 4BBSJ 1QZYA 1TWCJ 2AO9A 5ICCA 4Y52J 3TO6A 4FTHA 2HKOA 4AIKA 2TDXA 3JREA 1ZGJA 1LB2A 2A6TA 1R58A 1UJ8A 2AHQA 3KEOA 2CQQA 1OYWA 4A3BJ 4PZJA 1ENHA 1XDUA 4P55A 1EH6A 2QBYB 4KT5C 1XGOA 1J0RA 3T0YA 1TWHJ 3RYRA 3BQYA 3E6BA 2NOJB 1FY7A 4LIUA 1FSHA 5LGUA 1U78A 3FXUA 3K4MA 3JRIA 3FXMA 3K9TA 4RB1A 3BR5A 3J7YJ 1ETKA 3FM5A 5JHFA 2L9VA 3SZTA 4MEXF 3CC4I 1JTYA 1ODDA 4HDUA 2D5VA 2WV1A 4U0VA 3JCUC 5BQTA 1TTYA 1IV8A 1VQKI 4MGRA 1SFXA 5HLHA 2BE5F 3K1MA 4UXNA 4J19A 1W5TA 2HFHA 2PLYA 4E7SA 2H6CA 3DKYA 2MBFA 3BWGA 3MEXA 4N4NB 2Z3YA 3S1RJ 3T8RA 1V55H 4FE7A 5B3SH 3OL3A 3HHHA 3Q9VA 3F22A 2QA4I 2WTEA 3B6AA 1UCRA 2CW8A 1BC7C 2VBZA 1JUPA 2WAEA 2RDPA 2VC0A 4OAZA 1REPC 2GA1A 2MGQA 2Z1DA 4LITA 4OMYA 2J5PA 4XLFA 3BPVA 4A69C 1T6SA 2HXIA 1RUNA 4A12A 3F6OA 3CCMI 5M5XJ 3F8NA 5JLWA 3IWZA 1ZK8A 2V6CA 1MDMA 1Z6RA 3DCFA 3PJRA 3L9FA 3BR6A 2ETHA 4PFOA 1OYYA 3M4OJ 1T39A 2ZJ2A 3KP6A 4EM0B 3K69A 2VLAA 5GAHJ 4CYDA 1XD7A 4EJUA 2E7XA 3GX4X 1YO5C 2F4MB 1MMNA 1T38A 5L3BA 2Y30A 1JI8A 5AIQA 2EQRA 3WHBA 1UG2A 4EJOA 3OYDA 3D5LA 3HRTA 4F55A 5CVJA 1LDJA 1G4DA 3IUOA 1U6GA 2Z99A 1FP2A 1S3JA 1ZARA 2WB1N 2LR8A 1D1CA 1VQ5I 3ABKH 2HXOA 1F9NA 2PJRA 3QQAA 2CSOA 1J5YA 2DW4A 2HWVA 3VEPA 2O8KA 1A35A 4A0ZA 2TCTA 1I1SA 5H6QA 2PG4A 3S8PA 3TDUC 3MFKA 1R9TJ 1IN7A 1UHSA 2WADA 3FWEA 1G3SA 2HOEA 4YELA 1LQ1A 3ASOH 1FIAA 4XOPA 4X1EA 3BTLA 2M2EA 3Q0VA 1K4SA 2QM3A 2VJIA 3ERED 5K5RA 4PJLA 3ECHA 5DD4A 1E17A 2EB7A 2KIQA 2EWNA 2D1HA 2XGDA 1R4MB 4U87A 4E7IA 1B8IA 4KISA 3HOTA 5LGTA 1Z6TA 1QQIA 3BPXA 5K7HA 1R5GA 2VT3A 5F27A 2DODA 3Q3SA 4BXUA 2E2JJ 5C4JJ 1S72I 1U2WA 3OYCA 5FKKA 4X6AJ 1QVTA 2PN6A 4LJZF 2WAFA 1TWGJ 3BG3A 4BQQA 3LA2A 2EH3A 5F04A 3CCYA 4EMSA 1B72A 5DM6F 3CCJI 3K7AJ 5BMZA 2V26A 2BY1A 2QQAA 4IHYA 3S3OA 5J4YA 4TV7A 5IYCJ 1WJAA 1LE8A 3HIFA 1NG6A 2XV4S 3DXJF 1I3QJ 3ZMZA 3NEUA 2VOPA 1WFXA 5CQGA 3RZDJ 4I98B 2V7FA 5KAIC 2A07F 2DMQA 3ROUA 1HW5A 1MMGA 1V5GA 1G3YA 1NK2P 4CGZA 1X58A 2QVOA 2UWMA 5EGOB 1E3HA 5E20A 2XF7A 5CKTA 1B4AA 3MAJA 3S3NA 3NWSA 4HZFA 5D8KB 4ENJA 1LFBA 4ZZLA 2H27A 3IC7A 3VDXA 2L4MA 3GFJA 3M8EA 1GLNA 4V19K 3W3CA 4ZZDA 2VKDA 2OU2A 1APLC 2DOAA 4RBOA 2LBFB 2OTLI 1BW6A 2LF8A 3R0AA 4R1HA 3QOEA 5EDNA 1ZQ3P 2ELJA 5DV5A 3VPRA 4BKXA 2MH2A 3HTSB 3AL0B 3GTQJ 2E5ZA 4B48A 1QBJA 3LFUA 1YJWI 1TQMA 4MFDA 5HLGA 3I3LA 4BJTA 1ORKA 4CCNA 2CFXA 4XR6A 1YJNI 4ZYHA 2GXAA 2CYYA 4M3GA 3QU3A 2DT6A 1YW8A 2HZDA 4DYQA 2UV1A 3JRHA 3I59A 1HSTA 1U5TC 2YSRA 2RKHA 5TGTA 1C0WA 3H1CA 1MJBA 1X4PA 2JA7J 2HS5A 4IVNA 5BPIA 3HSEA 3CUQA 3IAM2 5GADJ 5HNHA 5B1AH 2K5CA 4UB8C 2V9KA 2LDUA 4CCJA 3DTIA 3V8KA 3IKVA 3PNTA 3DU5A 2ID6A 1IO2A 4EEFG 2P6SA 2Z33A 1K6OA 2LD5A 1MBGA 3M7GA 3AAFA 3KPHA 1TQPA 3GW2A 1BC8C 4PGHA 4BHBA 3HPGA 1E2XA 5DCMA 4BGDA 1SFEA 3H35A 1CGPA 3X2QH 2O5RA 3QAHA 3E5XA 4G6DA 5GPAA 4A3IJ 1HLVA 3FXKA 2Z16A 1IG7A 3CJRB 3DKWA 4Q48A 2UXXA 3IH2A 3JRCA 2K9MA 5FLVA 4N9IA 2NYXA 2R3SA 3C7JA 5LD2C 4A5NA 4GYIA 5IYDJ 4H0EA 1MMSA 1X1CA 1X1PA 3S17J 4HX4A 3T1BA 4DOZA 1IRXA 4RB3C 1SANA 1ITYA 1W0UA 3ZQCA 1PDNC 2HEOA 2R92J 4ZTJA 5F0HA 1EV7A 4YFKF 2EFWA 4E7ZA 2HYGD 3KEQA 2GLOA 1SFKA 2ZSIB 3F8MA 3QU6A 2KRCA 3LL7A 1N25A 4HNVA 4J00A 3QPLA 4BE2A 3I54A 4LLLA 3TO7A 4M3BA 1U0JA 1WGXA 2WAQA 2Y0SA 2M1BA 2R7UA 1I39A 1VQ4I 1JXSA 5J1YA 2Q2EA 3LSIA 5EZHA 2QQ8A 2VE9A 1LVKA 2ECCA 2EV0A 3VODA 2DT7B 3R61A 4CCLA 2CQNA 2MA3A 3PFIA 5F1RA 2HYFA 2ISYA 3NAUA 3ZQHA 1WZ2A 3A01A 1Q1VA 1BI0A 1K78B 4Q47A 4KT6A 3A0BC 2BY2A 2DMTA 2BZTA 3SJMA 2B0LA 1VNDA 2GM4A 3HOSA 2JRTA 1WKMA 4KA4A 1WSUA 1TT5B 4FT8A 3WE2A 3BR2A 1H8AC 1F5TA 5IT3A 2OCEA 2NVTJ 4XK4A 5TRDA 5HDKA 2R7ZJ 3PQJA 5DCFA 2Y9ZA 4LIVA 5CYVA 3H3UA 3C2HA 2VBYA 5FJ8J 3L2VA 1ZG1A 4IHXA 4QPQA 1QNTA 4PJNA 4IZZA 1J75A 2CRGA 3EETA 2UZKA 3BJOA 1S7EA 1H9TA 1FBUA 2VASA 2P5KA 3CDLA 1R36A 2HQ5A 3QYBA 2E2HJ 2DTRA 4ZDPA 1W7PD 1XSXA 5F6FA 1MBKA 4ESFA 4IJAA 4L5IA 2R0QC 1U8RA 3AG2H 4DZPA 2R93J 2VC1A 1WI9A 4YIRX 1XMKA 5A2QZ 2FQ4A 1VI0A 2L7MP 3BCBA 3SFZA 1U8BA 3HOUJ 2R5YA 1K83J 3WGGA 1E0EA 1BR1A 2A69F 3I0TA 3UNGC 1KQ0A 2JPBA 1ETYA 4OU0A 3ZQGA 2BVLA 2JUGA 3WG7H 1K6YA 3F8FA 2ZBKA 3CCVI 2LOOA 3WHCA 2HVSA 2R5ZA 3W2AA 1FYLA 1O57A 1DP7P 1Y0UA 2EFOA 3QP6A 1IAWA 3TW7A 4GDFA 2DBBA 1IW7F 2UUZA 2TRTA 1RRJA 3HKZA 3OV8A 4XL9A 3LSMA 3UKGA 1G8XA 3FHNA 1VQPI 3KP3A 3Q9SA 3WTSC 2E36A 5L3GA 2Q0OA 1FOKA 1YI2I 3S2HJ 2ZC2A 4XKCA 1CQTA 3V7CA 4DYRA 1W5CC 3SZPA 2GXBA 1PJRA 2W7NA 3FK7A 2IA0A 2VQHA 5DD8A 2VBWA 4B43A 3KE2A 4IOCF 3RI4A 1VQ7I 2MD0A 1ZRDA 3W2WA 3GTOJ 2FBHA 5HOOA 1Q1HA 1MIJA 1ZRFA 1VQ9I 2WB1A 5KAFC 4A2UA 3LAJA 1DU6A 4U88A 1D0ZA 2ESNA 3JRDA 1YFHA 2HTSA 1ZR2A 4WK8F 3DTKA 4Q5SF 4PSXA 1W36C 2W57A 1FPQA 5HVQC 2IGMA 1P92A 1Y39A 1YIOA 2ECBA 1FOYA 5D4RA 5BS6A 1IN6A 3WE3A 5FD6A 1CF7A 1XSDA 3PUBA 1Z05A 2ESHA 2GOXB 2WBMA 5E79C 5HS8A 3OMYA 3HZJA 4B3AA 1YRNB 3MKYB 2Y69H 4RB0A 2O9LA 4DBQA 4RGRA 1ZAOA 5BNGA 3HDDA 1N78A 1J9IA 3RPUD 1SC7A 2OBPA 3GZ5A 4BXFA 2KISA 4JYKA 2VOOA 2NS7A 2OQRA 1EH8A 1OCOH 4AM3A 1OCZH 1UB9A 4IHSA 1XCVA 2VL8A 3MD2A 4IHTA 3KFWX 3CUOA 3D5SC 3BZ6A 1MGTA 2ZNYA 2V79A 1JGSA 1YYVA 2IEKA 1S6LA 4I01A 4ZYDA 1YX3A 4UUVA 1ERDA 1D3YA 4HBLA 2ZXHA 1XMAA 2O7OA 3AG4H 1SD4A 1W4MA 1M1EB 2ME0A 1VZ0A 2H1KA 1XSVA 4KJZA 3COAC 3VWBA 2JSPA 3HXLA 1XGMA 5CVVA 2DA4A 2JTVA 5JVTA 2GA2A 2LFBA 3JRFA 2WV0A 4RLQA 1T98A 1DGWY 1R1TA 2CQ7A 2IA2A 3J80Z 3L1PA 4BYYA 3C3WA 1P9QC 4CHUA 1ZHFA 3BTCA 4YIIA 2CUFA 5EF6A 4AIJA 1R23A 3GZ6A 4IRGA 5KK1A 1AHDP 2E71A 2QCOA 2CUEA 2WAQN 4LGWA 3LQRA 2CFOA 4Z2YA 4L5JA 4WCGA 3I4PA 3Q0WA 2LREA 2FOWA 5HLIA 1JHHA 1WPKA 3U21A 1RI7A 2XF6A 3QWLA 3E5QA 1DPUA 2J5OA 4KIBA 1S7OA 3BTJA 3HBLA 2MLKA 3B73A 1ETVA 3PNVA 4EM1A 2FMLA 1UFMA 3M8JA 2VUMJ 4B47A 2Q8KA 4EJVA 4BEHA 1GT0C 5EYRA 1FMVA 3KEYA 4DNCA 2OA4A 4JP0A 1W7PB 2JZYA 1X2MA 3FX3A 1YIJI 4ZDLA 2KIFA 2HOAA 2PMZN 3F72A 2V9PA 5C4XJ 2HZTA 3VSLA 2DLLA 4JOMA 4NUBA 3SEZA 3C18A 3DBLB 4KMUX 3GWZA 2KPMA 3ULQB 4X0GA 1YITI 1XPXA 1K78A 3A01B 5H20A 3S2WA 3HOVJ 4HSRA 2X85A 1X2NA 2BVMA 2FA5A 2E1MC 2IJLA 2LH9A 1FIPA 3ERMA 4PJMA 4JQFA 3GTPJ 3ABMH 1T0FA 1EA3A 4F52A 1AOYA 4A3LJ 3CCEI 3OYIA 1ZREA 1F4KA 4LLNA 3I56I 1Z77A 4FE4A 2CGPA 3M1EA 4IF4A 4MEYF 3DQVC 3S1NJ 1P4XA 5KHDA 5HDGA 3QRFF 4HA8A 2HOSA 1Y6IA 4XKBA 4AUXA 4Y33A 5L3DA 2NVUB 1FOXA 4QLCU 1TL8A 1HF0A 4XRFA 1FX7A 4KN7X 3D0SA 4G94A 2RREA 3CCUI 1BOAA 1R1UA 1T56A 2Y2ZA 5BPDA 1N75A 2RQPA 1YHQI 4RM3A 2A5WA 1UAAA 4EJTA 2NVQJ 2RNJA 2X1CA 4DQ2A 1YX5A 3PM1A 3DF8A 2P8TA 2ZSHB 1NTCA 5FRMA 1ON1A 1TP4A 5GTHC 2ZCWA 4M6XA 1JGGA 4B4CA 1FBQA 2K9LA 4XIDA 2VBXA 2E34A 5E3OA 4LD5A 3C2GA 2O61A 1W0TA 2VN2A 2MW8A 5FRNA 5FKLA 3HUGB 3K4LA 2LG4A 2X6YA 4RA2A 3KYCB 1RKWA 1MH4A 4PCQA 4OOIA 1SVOA 1N77A 2DXIA 4MLOA 1LDKB 2CMPA 3BG6A 2IVMA 4O3MA 4BY7J 3MN2A 3MZHA 3E3VA 5FLXK 1D5VA 1POGA 2EZLA 3M3YJ 4QWQA 4FASD 3CMEI 3TDZC 1MBFA 2D1VA 2L3DA 1Z7LA 3JRAA 3A02A 2LP0A 3HUGA 2ELKA 1A04A 2FNAA 3KP7A 2W48A 2DOEA 4ZC3A 1S5LC 1P4AA 2JSCA 2L9RA 4IPAA 1IXCA 1Z67A 1I50J 5DDGA 4KYWA 3DPTA 4YFNF 5HODA 3VYSB 2W4SA 2XB5A 1FTTA 2P81A 3BJAA 3PFYA 4JK1X 4XORA 1USTA 1Y56A 2GQQA 3BZKA 3KZIC 1A36A 4D7MA 2L9SA 4ZYGA 1T08B 4ENMA 3QPSA 5E3NA 5GPCA 2VPRA 4BAYA 3W6JB 3L7WA 2K85A 1OFCX 1FWZA 2K27A 3EQLF 5LGNA 5ILSA 2HVRA 2E1NA 1XX5A 2KFDA 4YRVA 1HQCA 4C3JJ 1Z1DA 4RGXA 3HSRA 1T8IA 5M5WJ 1F36A 2L54A 2H8RA 1WH7A 3DFGA 2AXLA 2IS4A 3DV8A 1S9HA 2W1OA 1JT0A 1Z91A 4XLHA 2F4OB 5C44J 3BY6A 4ZYEA 2JA8J 3FBIB 2IBDA 3FXRA 2E7WA 4E70A 4A5MA 2CUZA 3HJEA 5IPAA 3CC7I 3TBIA 4IL6C 1F43A 2R7FA 4KUMA 2ZNZA 2DYSH 2QSGX 1TZLA 2CJJA 3EUAA 3GFIA 2DDAA 3K1PA 2IPQX 5K7FA 3QP5A 1HDDC 3IL2A 1R00A 3CJTB 4RB2C 4BNCA 3S93A 4MTEA 1E3OC 4M3FA 2Z5UA 3BJ6A 1KA8A 2EK5A 3OYGA 3CD6I 1UMQA 3F0CA 3V42A 3WG9A 3WTWC 5EG0A 4HAMA 1EF4A 2EA2A 3DLAA 4HX7A 3DEWA 1MMAA 3S2DJ 1R5ID 2H6BA 3IV5A 1W7PA 4W97A 4UUSA 3S14J 3DBHB 1JKOC 5D6FA 3TW6A 3CO6C 3SXYA 3LNQA 1K7AA 3FM3A 4C30A 2VQGA 3U1DA 3RKWA 3TQNA 2XGCA 4G6QA 2L01A 1G59A 3HOZJ 1T2KA 3BR1A 4LFUA 3H36A 1QPIA 4HEA2 1WI3A 4CA0A 1KQ9A 1SMTA 2DN0A 3LQQA 1PUFA 4UUSB 1D1AA 5IYBJ 4CCKA 2KDOA 5M3FJ 5E3LA 1Y0NA 4XRSG 4PJJA 2QWWA 4L0YB 2DI3A 2CUJA 4IKFA 3C1DA 2XF5A 1XC5A 4XMYA 1HDPA 3EUHC 3SZGA 4A3KJ 5K5OA 3ZN0A 1X4OA 1OR7A 4D5CA 4BE0A 1UHWA 3VOEA 2L2OA 5ICEA 3H9QA 2DA7A 2OJED 2RC4A 3GYHX 1J7KA 1ZLJA 2L02A 2VJ4A 4RDUA 3H0DA 5AIPA 4AVZA 5EEAA 4CYCB 4GRIA 5DUKA 3OIQA 3TP3A 2A61A 1G3TA 2ID3A 1MKMA 1WWXA 2WC2A 1VQLI 2CQKA 2R7OA 2W00A 3K4KA 4HLXA 1QU3A 3ELKA 2E1CA 2QKLB 1SFUA 1XG1A 2GIZA 2KZVA 3KETA 4Y3OA 3E6DA 1OYIA 3FZVA 4AU7A 4ITVA 5GAEJ 1LEBA 4ZJZA 4BDZA 2EZHA 5IP9J 4OWRB 3ABTA 3I9V2 5FFZA 4S05A 2DFEA 3TGNA 2VIXA 1X1DA 3DU6A 2F5VA 3RJPA 6PAXA 2DFFA 4C2TA 5J40A 5JVGF 4OAYA 5DYMA 4LB5A 3NQOA 2XPVA 2L7KA 3ZPLA 5D5WB 3Q5FA 2KDZA 1ZRCA 4QIWN 1IJWC 1MSEC 3HRMA 2HQAA 2IGKA 4NDLA 2FX0A 2ZO4A 5AONA 2F5FA 2XUBA 2YUSA 2CU7A 4ENNA 1D8JA 3JAMZ 2XGEA 4QSHA 4A3EJ 2GOMA 3ZGKA 3G4SI 2MC3A 1RZ4A 2BXZA 2V1NA 3G2BA 4G12A 5KCMA 4BU2A 2L5QA 4ABZA 1XGNA 1QRYA 2HQRA 3I55I 1UELB 4ANJA 4BL0B 2EJRA 2PI0A 4M3DA 4MO7A 2HVQA 3D5RC 1RR8C 1JJ8C 1XTAA 4RAGA 3PIOF 1SVMA 2LTPA 5CJ9A 2BY0A 4NC7A 3IWFA 1IN4A 4UVBA 3WTXC 2Y48A 4G7HF 3M07A 5IY5H 2HDWA 4E7HA 3AG1H 1X3UA 4DIQA 2P7VB 3LSTA 4MQVA 2WY8Q 4NQWB 2QSHX 1I6HJ 1FLIA 3KP4A 1S8NA 2ZXIA 1YQAA 2RQQA 1K61A 3RIRA 2F5DA 1NH3A 3K0LA 2EV5A 3G71I 2EFQA 5F64A 3VB2A 2PMHA 1WJBA 4LK0F 2XDVA 5IT9Z 4HDVA 4NB5A 5HNFA 5B66C 3WTVC 3OR1C 3P9IA 3AL0C 1LDDA 4XKVA 3E0JB 2R7WA 1HCRA 4BXXJ 4ZH4F 2FMYA 4NC6A 3SHFA 2B63J 4HQEA 3K1NA 1H88C 1Z7UA 1OISA 1IRZA 1ETWA 2KJCA 2LKSA 1GVDA 1P7IA 5ED4A 5TISC 3RKXA 1X3WB 4C3IJ 2XROA 1G6NA 1AU7A 1RETA 4EV0A 3PO2J 3G3ZA 2A68F 3G1OA 5K1YA 5C3EJ 1J09A 5K5QA 4E7KA 3DTEA 2IGOA 2DA3A 2R7QA 3BOQA 5J1UA 4BQNA 3LOCA 2W85A 3GTKJ 2P4WA 2XAQA 2CW7A 3HOWJ 2LRDA 2MD5A 3TOAA 3EUKL 2FF4A 2X6WA 5J3LA 3GZNB 3GFLA 1ZYRF 4C2MJ 3CMYA 3F9KA 4WXCA 3SFIA 1IC8A 3M1CA 2JWTA 4G8XA 3K2AA 4BBRJ 1R22A 3DLLF 1V54H 1HOMA 1R49A 3ZRGA 4C2UA 3VYUB 3S32A 4LB6B 4BEHB 3BG9A 4KIFA 2E19A 4O6JA 2OZ6A 4FCYA 4P9FA 4Y7NJ 2IA1A 1KU2A 3DEUA 4S0HB 4XLAA 4HYEA 5F0CA 1DPRA 2LSOA 3GFMA 1B1BA 3CO7C 4M6VA 4XKWA 2NNYA 4A3JJ 4HNTA 1ZELA 1R71A 1TLHB 1OLTA 3ESWB 4A0XA 2HDCA 4V2GA 3JTHA 1IZ1A 1MNDA 1UHMA 1LFUP 3HB9A 5ICGA 4A3DJ 4ASNA 3R0JA 3OWTA 4FX0A 3S15J 3V4GA 4UVAA 2JVHA 2M87A 1BM9A 3EYYA 1R4NB 3FKJA 4D0PA 2V1XA 1FOWA 3E6MA 3BP8A 2I8DA 1U3EM 4MTDA 4EQQA 3VYRB 1ZG3A 1R7JA 3FXQA 2DK5A 3K4CA 5GTIC 2JMWA 2MLGA 4L5EA 2P5LC 2CV0A 4RAYA 2BV6A 3LWFA 4L9TA 2DT5A 1SVLA 4WXDA 1OJLA 1Y8RB 4L9JA 5HDNA 3M8FA 4M6YA 1RIOH 2OUMA 1VQNI 4K2EA 3GVAA 4BHCA 2G7UA 1MDMB 2LY9A 1MSFC 4BJ5C 4IQJA 3HKZN 3FMQA 5FD5A 3JSOA 2YPRA 2M34A 4HX8A 4FX4A 2M0MA 1W1WE 3ZQLA 4L18B 1I27A 1ETXA 1BN5A 4LG3A 3JAMK 1BR4A 3P9CA 2CG4A 2A05A 2O8XA 4MNUA 4B3XA 2ACJA 4IRHA 4HSTA 4JX4A 4DGWB 5IP7J 2Z9OA 1YOVB 4G6TB 2EPFA 3C2BA 4LLGF 3LAPA 1DGRM 1FNNA 3B02A 3DPUA 4M72A 2BW3A 2YR2A 3K4NA 1CF7B 1MZBA 1BIAA 2XAHA 2VT2A 3CQZJ 2DO7A 1EKEA 2EZIA 2L0KA 4B44A 3OS0A 2QEXI 2PJRB 1MJAA 3IKTA 2OTJI 4OIQF 4BDYA 2R7DA 2D2WA 5E1XA 5FB2A 4GXOA 1LPQA 1DQUA 1TWFJ 3IHUA 1U9OA 3S3MA 3WTTC 4LG0A 3WGHA 4WWCA 3VYTB 2JPCA 1O7FA 1ETOA 2YS9A 4XBFA 2IT0A 1ZH5A 1FP1D 1QVUA 4ESBA 4CZCA 3W6KB 2HKXA 3MVPA 4L9VA 3W2VA 5JHUA 1BR2A 2RGVA 2PFBA 2LVSA 2X1EA 5LEJA 5JFRA 3OOPA 3K2ZA 2IXSA 2VB6A 1DP3A 3CC2I 3AFHA 2PMZA 3G6EI 1G2HA 3O2PE 4F92B 4M9ZA 1HKTA 3MWMA 4XLEA 2DA1A 3OYAA 1IRGA 2ICWG 1KU9A 2XKOA 1YLFA 1XGSA 2A6HF 5CQEA 4BJ6C 3K6GA 4AIDA 3CCQI 3ZQIA 3I4MJ 3GO5A 5ILUA 2VXDA 2LMDA 5EJCA 2BBYA 5EG0B 1TC3C 3BT9A 4HV6A 4BHPA 3AKZA 3I59B 1ON2A 3FF5A 2O3FA 5D8LB 4DZJA 1XS9A 4OMZA 2FD5A 3MMYB 2D45A 2Y31A 2AQFA 3HGGA 2AXTC 1JHFA 2QF7A 3OR2C 2DOFA 2BGCA 2VQLA 4CYCA 1Z9CA 3OYBA 3O3KA 2GXGA 4FQGA 5GP9A 3ZXSA 1BL0A 4IHVA 1B59A 2ME6A 3H3VK 3BR3A 1SD7A 3HL2A 2JK3A 3FBNB 5EEGA 1GV5A 3H9JA 2Y9YA 4CH7A 4Z6YA 4O5VA 1P6RA 3A03A 3RDIA 5L3FA 3VFZA 4ZDOA 2MYSA 2HOTA 3JSPA 1LJ9A 1YE9A 5CVUA 3BCAA 2ZMEC 4M73A 1B6AA 1RR7A 3OYLA 2ISZA 2ZB9A 5EGOA 1O7LA 1BIBA 2FBIA 1PUFB 4CICA 1NK3P 3SYTA 4F91B 1OR7C 1KGSA 5E8GA 1Z3YA 2R7XA 1TNTA 1U5TA 4AYBN 2W24A 4Q4ZF 2PX9A 1IDZA 3HYIA 3ML6A 5D5UB 3CMMA 1WVRA 2EINH 2FBKA 1WHUA 4KFCA 4IO9F 4ZTFA 4WX9A 4RMNA 3CJNA 2GWRA 2XRLA 4E4HA 1B8IB 4KICA 3I64A 1A31A 2DJNA 1B72B 1MJ9A 2K3FA 2DMUA 1D0YA 2EIMH 3E6CC 1ZN2A 3LA7A 3REOA 1X3ZB 1BA5A 1HC8A 1BW5A 5H6RA 4RS8A 5ILVA 1PYVA 3K70D 5KNLA 3A0HC 4D1QA 1RUOA 2STWA 3JW4A 5ERIA 1WH5A 3ZQ7A 2M7BA 2VXZA 3GLLA 1KYWA 3L09A 1P4WA 3PSIA 4II2A 1QO0D 3LMMA 3CF2A 3HRSA 1I3AA 4HG2A 5HLTA 1H89C 2GZWA 4N0BA 2M4GA 3RQIA 3ISPA 3G1MA 2DA5A 5H2FC 4M71A 5J8CA 3KYLA 1LKXA 1DDNA 2W25A 3BLYA 4AVPA 2F48A 1NG7A 2RN7A 1QZZA 4I7HA 1SAXA 1HA8A 3U1KA 3CESA 1E3PA 2M45A 3B6CA 3GBGA 4HW0A 2K9NA 2DK8A 4I6ZA 3V8JA 5J47A 3KLOA 4CCMA 2XC7A 1MBEA 4MQ9F 1OQYA 2K4BA 2H8WA 4BACA 1ZTRA 2HPMA 5IOYA 2CS3A 3PL8A 4UNOA 4YEJA 2KIUA 4EATA 4UY8I 1SD6A 1Z0XA 4GO1A 4B8XA 3TMOA 1LEAA 2VKEA 5B1BH 1JTXA 3LSRA 2BHYA 4GFBA 2IGNA 2JRMA 5L3EA 2YX4A 3RKYA 1JT6A 3KZZA 2MC4A 1ONVA 3OYKA 1BI2A 3DBRB 4P1WA 1USSA 5LHGA 1A5JA 4I99C 2JN6A 1OCPA 1I1GA 1P2FA 2BHZA 3UR3C 2KMUA 4LOCA 2HR3A 4G9YA 5E1ZB 4XONA 3FXJA 2QLZA 5DM7F 1V4RA 1O3TA 1SFOJ 1JE8A 5E3MA 1NHAA 5D6EA 4ZYAA 2F5EA 2XIGA 2XB0X 2DPDA 1OCTC 1V3FA 3PNYA 1F1ZA 5D5VB 1SEUA 2LBFA 3HEFA 4XN0A 1WJEA 1GVJA 4UV8A 2MABA 2C6YA 3V8LA 2OV7A 4EGZA 3P9KA 1QA6A 2B7EA 2LNBA 4AYBA 1FT9A 3I71A 3BC8A 3CCSI 4AWXB 1TNSA 3LSGA 4OIRF 2X9DA 5LRSA 4N9HA 1JJ6C 4U0WA 2QYOA 2K02A 3PO3J 4C9YA 2M4KA 2STTA 5KVRA 3QYEA 5F1JA 1L3LA 4L9NA 1T95A 2KHMA 2EBIA 3TO9A 3OSGA 1PUEE 4A93J 1TWAJ 3RKQA 3MKLA 3FXOA 4NNJA 1YS6A 2KZGA 1BI1A 2R5YB 2QBYA 2FRHA 2K86A 3HTUA 1HKSA 3V7RA 1JKPC 3CCLI 2NOGA 2X0LA 4HOBA 1QZEA 4YIFA 1YG2A 2RVCA 4S04A 5A2QK 2W84A 1H9GA 1KU7A 2EFPA 2IS2A 4UV9A 2M0CA 2K7LA 1RC9A 3Q0UA 9ANTA 1ACIA 3CTAA 3ZCOA 1VQOI 2DA2A 3MQ0A 5FLXZ 1K79A 5E8IA 4G7OF 1LFPA 2X48A 2FUG2 2GIVA 3BG7A 3HOYJ 4WF2A 5EEHA 2YX7A 3HGYA 3OS2A 1DU0A 5J8FA 2XVCA 1D5YA 2NNNA 2M8EA 3ABLH 1LE8B 3LSPA 3WU2C 3H3ZA 3WU1B 2FXAA 5HS7A 4AC0A 3K70C 2OQGA 4FETA 5LRRA 2Y75A 2LY2A 2G0EA 4JX6A 5DS9A 1XB4A 3CZ6A 2DQLA 2R4GA 3JTGA 2A3SA 1J2XA 4D5FA 3IRRA 2JA2A 2K9QA 1Y8QB 2XPUA 3HSFA 4RAFA 3GXOA 1HW1A 5CVIA 5JI6A 4RGSA 4I2OA 4M9SA 3EYIA 3SQNA 1PP7U 1STZA 2NS8A 2Q2EB 1RKTA 2HQNA 2Q1ZB 1IF1A 3GEZA 3TEDA 2WWYA 4A6EA 2V4JC 3P7NA 1ULYA 3CLQA 2YU9J 4NQWA 2F5CA 2H1LA 1AWCA 1R5HA 4HF2A 4PK4A 4CCOA 4A3MJ 4KMFA 2E35A 4UHTA 2LKPA 1XN7A 2ELHA 3PQKA 5K7ZA 3E1SA 5HS9A 1QGPA 5DUIA 1DUXC 2KRHA 4XLPF 1V5FA 1JUMA 4R8HA 4QTRA 3CJQB 2ZJPF 1G3WA 3RPUA 4BS9A 2XPWA 3DEEA 4AIHA 1IGNA 5CVRA 2K9SA 3S16J 2HU9A 2X51A 3FISA 4WXHA 5CPRB 2DU9A 2QGUA 3F8BA 3I5UA 1BJAA 3DWLE 2L7FP 1O4XA 2DPUA 4M3EA 4CDGA 2N8GA 1VTNC 2BEOA 3SDGA 2R7VA 4XRSA 3HG9A 4PDKA 2FNPA 3J81Z 3E7LA 2WY7Q 1OCRH 3RPQA 2HTJA 1YJ9I 1IXSB 1MBJA 3D1NI 5E17F 2LLKA 3L2RA 1GHCA 3BTIA 1WJFA 5E18F 5FKOA 3BROA 4KDPA 2M7AA 2BXYA 2O0YA 1FEXA 2M5WA 2M30A 4GCVA 4JX5A 4Y13A 2MG4A 2FEZA 3HM5A 1J59A 3PSFA 5TJJA 2XRNA 1U5TB 2PBIA 4FISA 4HV5A 5JR3A 1HSJA 2LK2A 1FZPB 1KZHA 1AKHB 1LNWA 3J81K 1B9MA 1ZGAA 2P0WA 1IDYA 3BG5A 4OINF 3ECOA 3WTUC 2H09A 2DYRH 2CH0A 1JUSA 3G1LA 5F08A 1MBHA 2XAGA 2AS5F 3IH4A 4H4KC 2X1DA 1WJCA 4UB6C 3T5XA 2I5UA 2MH9A 2IP2A 4EVIA 3FMSA 3OIPA 2OPTA 2P6TA 1B9NA 1OPCA 2ZMEB 4I02A 4PFPA 1Z21A 4PGGA 2ZXJA 1WCMJ 2Y0SN 2PMUA 1HXDA 2R7RA 3RZOJ 5LEKA 4NBQA 1TW3A 4IEJA 4XSZF 2OD5A 4XLNF 1AA7A 2DA6A 4CO8A 5GAGJ 2B9SA 3I53A 4CSWA 4J01A 4IHWA 5IP6A 2VJJA 3KP5A 2L4AA 3OSFA 3JRBA 2HNHA 4XRMA 2ZKZA 1XMXA 3CDHA 1R1VA 2VE8A 1MMDA 4IQ4A 5FO5A 3CDIA 1KONA 2XGXA 3BQZA 1MW7A 2FE3A 2MSYA 1FBSA 4A3GJ 2JQ7A 3K4JA 3H92A 3IRQA 2CQXA 3HRUA 3J7AY 2MFZA 3F6VA 4ON0A 4ETSA 4F7ZA 4KNYA 1WRJA 3R60A 3HPHA 5E1WA 5J4VA 4XLCA
chains in the Genus database with same CATH topology
3ABUA 2O03A 4HLYA 4HF0A 4NC8A 5CLSA 3RTRA 1MNEA 5FFXA 3QPHA 2E5NA 1SMYF 1I5ZA 3E97A 4LK1F 3LSKA 4LG0B 3CUQC 5DEQA 2R7TA 1TW2A 2V1DA 4CUGA 2OC6A 1S7AA 1FSEA 4IRIA 4ENKA 3EUHA 1WJ5A 3A2KA 3OYNA 1QPMA 3E5UA 3WTZA 4YFXF 3MCZA 4Y17A 4E7JA 1FYKA 3RSNA 3A4CA 4U7BA 1HBXG 2XAUA 5J6XA 2CW0F 4JBAA 4KIGA 2VODA 5L3CA 3WU0A 1PP8F 1UG0A 4EGYA 1YS7A 2WA0A 2IRFG 4GYGA 2RNGA 3OYJA 3F23A 2QUFA 4BH9A 4ESJA 3OYFA 2QZ8A 2VJ5A 3DP7A 2X6XA 3OYHA 1WQ2A 3BDDA 2UXNA 4A0YA 4YG2F 5LBQA 4HNUA 4PUSA 3RQ4A 3R6SA 1S29A 1GXPA 1EH7A 3J7AO 1SD5A 2V1UA 1BI3A 2DFIA 2YU3A 4QPOA 2NAZA 3KCCA 4I0AA 4P96A 2DQRA 3CLOA 4IX7A 2V6EA 1XCBA 2FSWA 2KKOA 3QYFA 2F2EA 3KP2A 3OL4A 3ZQQA 4OIOF 2CV1A 1SAUA 2FU4A 2R7SA 4GGGA 4II3A 1LVAA 2EA4A 4HF1A 3K4BA 3L2CA 2G7HA 2P7CB 3EPZA 3J80K 1YW9A 3O6BB 3H5NA 1Z3XA 2CWEA 1ZLKA 2QQBA 3ZN1A 1QHHD 1X1AA 4I09A 2LYCA 4AD9A 5ICFA 3ZMTA 2HGCA 3FMRA 2IS1A 3V7SA 2QQ9A 3GF2A 2ZMEA 2OZUA 2A5YB 3WGIA 4RLFA 4P9UA 4EJWA 4MHGA 3KLNA 3T8TA 2DJIA 3L2QA 4M74A 5FGMA 2BYVE 5LLQA 3HHGA 1TT0A 1QHGA 1XDSA 4HPQA 2KQRA 3KX2A 1OKRA 2QKMB 1IRFA 4N4OB 1IXRC 3ZR8X 3ZMSA 2E1MB 4NHJA 3TKYA 2VQCA 3MZYA 4EM2A 3A1YA 4BQOA 2X4HA 4I0BA 2DAOA 2KL4A 3M9AA 4PSWA 1X19A 3N05A 1IN5A 1LQ1A 1OMIA 3ONQA 2GAUA 4D9JA 3L2WA 3R4KA 4LMYA 1KQ8A 1FYMA 2O6GE 3EDPA 3RYPA 2A6EF 3KZYA 4A6DA 1YW7A 4IXAA 3N4MA 4BQAA 2XKPA 1X1BA 3OYEA 2PQ8A 2VONA 1R6RA 2Y0MA 3TL4X 3ZMUA 5LHIA 3ZP5A 4RAZA 2L9NA 3K10A 5FROA 1WJDA 3GUDA 3MKZA 1BOBA 4KITB 3FHZA 2EV6A 3F21A 3ZMDA 3IP4B 2KIMA 4XOTA 1FC3A 2ZFUA 2XASA 2ADUA 4M9XA 4F93B 3F8CA 1V5EA 4HRIA 2ZFWA 2VPLA 4R79A 1TBXA 3QODA 1W36D 2BW3B 3VSKA 1I6XA 2NS0A 3WTYC 3FDYA 3RCOA 3U9GA 4G7ZF 3QPTA 2NRAC 2XSJC 5D5XB 3LFKA 2CV2A 2CO5A 3F3XA 2DCEA 4Y4RA 2KP6A 1HKQA 2IS6A 4XQFA 4U0YA 4FHTA 1O3QA 3OOUA 2G9WA 2EFNA 2XHKA 2LC2A 3L2UA 2IW5A 2XAJA 1RNLA 4CXFA 2K3PA 4E7LA 4U7DA 1BBYA 2FOKA 4DBRA 1W5SA 2KJBA 1O3RA 1IUYA 1HW2A 3OYMA 4F3QA 1GXQA 3SDBA 2OAZA 1FMWA 4HQMA 2P5VA 3QOPA 2PEXA 4RGUA 1IN8A 4P5OA 1L0OC 1YTYA 4B09A 2FQ3A 2COMA 1KYZA 2JT1A 2AQEA 2PJPA 3ZMVA 3H5AA 2M3AA 4XNFA 4L0ZB 5LHHA 3HC7A 3H9GA 1ZG5A 1TQIA 3MKWB 2F4IA 3LSHA 1H0MA 3N97A 4BE1A 4E6KG 2V9VA 3SEQA 2HPIA 3NWTA 2E60A 5IT9K 1KU3A 5DCMB 3H5RA 3DPLC 3G73A 2BOLA 5BOXA 3NRVA 5LFAA 5D4SA 4XN3A 4DJAA 2Z2SB 3LA3A 2XAFA 3I58A 2K4JA 3L00A 4XSXF 3U2RA 4OIPF 2KLOA 3CUQB 3OS1A 2JVGA 3TOBA 4CZZA 4KN4X 4RM2A 2H94A 2F6CA 3DKXA 3GLXA 2W82A 4Y15A 3WODF 1O3SA 1MD0A 2LF7A 1D1BA 4UVCA 4XM3A 2RV8A 1D0XA 2VKHA 3CP8A 1T0FC 2LY1A 1D8KA 3CP2A 2KRFA 3OY9A 2QENA 3IAS2 4BUPA 1QZYA 5ICCA 3TO6A 2HKOA 4AIKA 2TDXA 1ZGJA 1LB2A 2A6TA 1R58A 3KEOA 1OYWA 4PZJA 1XDUA 4P55A 1EH6A 2QBYB 4KT5C 1XGOA 1J0RA 3T0YA 3RYRA 3E6BA 2NOJB 1FY7A 4LIUA 1FSHA 5LGUA 1U78A 3FXUA 3K4MA 3K9TA 4RB1A 3FM5A 5JHFA 3SZTA 4MEXF 1ODDA 4HDUA 4U0VA 5BQTA 1TTYA 4MGRA 1SFXA 5HLHA 2BE5F 3K1MA 4UXNA 1W5TA 2PLYA 2HFHA 4E7SA 2H6CA 3DKYA 2MBFA 3BWGA 3MEXA 4N4NB 2Z3YA 3T8RA 3Q9VA 3HHHA 3F22A 3OL3A 2WTEA 1UCRA 2CW8A 1BC7C 2VBZA 2WAEA 2RDPA 2VC0A 4OAZA 1REPC 2GA1A 2Z1DA 4LITA 4OMYA 2J5PA 4XLFA 3BPVA 1T6SA 1RUNA 4A12A 3F6OA 3F8NA 3IWZA 2V6CA 1MDMA 1Z6RA 3PJRA 3L9FA 2ETHA 4PFOA 1OYYA 1T39A 2ZJ2A 3KP6A 4EM0B 3K69A 2VLAA 4CYDA 1XD7A 4EJUA 2E7XA 3GX4X 1YO5C 1MMNA 1T38A 5L3BA 1JI8A 5AIQA 4EJOA 3OYDA 3D5LA 3HRTA 4F55A 5CVJA 1LDJA 1G4DA 3IUOA 1U6GA 2Z99A 1FP2A 1S3JA 1ZARA 1D1CA 1F9NA 2PJRA 2CSOA 1J5YA 2DW4A 2HWVA 3VEPA 4A0ZA 1I1SA 5H6QA 2PG4A 3TDUC 3MFKA 3S8PA 1IN7A 2WADA 3FWEA 1G3SA 2HOEA 4YELA 4XOPA 2QM3A 2VJIA 3ERED 5K5RA 1E17A 3ECHA 5DD4A 4PJLA 2EB7A 2EWNA 2D1HA 4E7IA 4U87A 4KISA 3HOTA 5LGTA 1Z6TA 1QQIA 3BPXA 1R5GA 2VT3A 4BXUA 1U2WA 3OYCA 2PN6A 4LJZF 2WAFA 4BQQA 3LA2A 4EMSA 5BMZA 2V26A 2QQAA 3S3OA 4TV7A 1WJAA 3HIFA 2XV4S 1NG6A 3DXJF 3ZMZA 3NEUA 2VOPA 1WFXA 5CQGA 4I98B 2V7FA 2A07F 3ROUA 1HW5A 1MMGA 1V5GA 1G3YA 4CGZA 2QVOA 2UWMA 5E20A 2XF7A 5CKTA 1B4AA 3MAJA 3S3NA 5D8KB 4HZFA 3NWSA 4ENJA 4ZZLA 2H27A 3IC7A 3VDXA 2L4MA 3GFJA 3M8EA 1GLNA 3W3CA 4ZZDA 2VKDA 2OU2A 2DOAA 2LBFB 2LF8A 3R0AA 4R1HA 3QOEA 2ELJA 5DV5A 2MH2A 3HTSB 3AL0B 2E5ZA 4B48A 1QBJA 3LFUA 1TQMA 5HLGA 3I3LA 4BJTA 4CCNA 2CFXA 4XR6A 4ZYHA 2CYYA 3QU3A 2DT6A 1YW8A 2HZDA 2UV1A 3I59A 1HSTA 1U5TC 2YSRA 2RKHA 5TGTA 1C0WA 1MJBA 1X4PA 2HS5A 4IVNA 5BPIA 3HSEA 3CUQA 3IAM2 5HNHA 2K5CA 4CCJA 2V9KA 2LDUA 3DTIA 3V8KA 3IKVA 3PNTA 3DU5A 2P6SA 2Z33A 1K6OA 3M7GA 3AAFA 1TQPA 3GW2A 1BC8C 4PGHA 4BHBA 3HPGA 1E2XA 5DCMA 1CGPA 1SFEA 3H35A 4BGDA 2O5RA 3QAHA 3E5XA 4G6DA 2Z16A 3CJRB 3DKWA 4Q48A 2UXXA 2K9MA 4N9IA 2NYXA 2R3SA 3C7JA 5LD2C 4A5NA 4GYIA 4H0EA 1X1CA 4HX4A 3T1BA 4DOZA 1IRXA 4RB3C 1PDNC 2HEOA 4ZTJA 1EV7A 4YFKF 2EFWA 4E7ZA 2HYGD 3KEQA 1SFKA 3F8MA 2ZSIB 3QU6A 2KRCA 3LL7A 4J00A 4BE2A 3I54A 4LLLA 3TO7A 1U0JA 2WAQA 2Y0SA 2M1BA 2R7UA 1JXSA 2Q2EA 3LSIA 2VE9A 1LVKA 2EV0A 3VODA 3R61A 2DT7B 4CCLA 2MA3A 3PFIA 5F1RA 2HYFA 2ISYA 1BI0A 1K78B 4Q47A 4KT6A 2B0LA 3HOSA 2JRTA 1WKMA 4KA4A 1WSUA 4FT8A 3WE2A 1F5TA 5IT3A 5TRDA 5HDKA 3PQJA 5DCFA 5CYVA 4LIVA 3H3UA 3C2HA 2VBYA 3L2VA 1ZG1A 4QPQA 1QNTA 4PJNA 4IZZA 1J75A 3EETA 2UZKA 3BJOA 1H9TA 1FBUA 2VASA 2P5KA 1R36A 3QYBA 2DTRA 4ZDPA 1W7PD 1XSXA 5F6FA 4ESFA 4IJAA 4L5IA 1U8RA 2VC1A 1WI9A 1XMKA 5A2QZ 3BCBA 3SFZA 3WGGA 1E0EA 2A69F 1BR1A 3I0TA 3UNGC 1KQ0A 2JPBA 4OU0A 2BVLA 2JUGA 1K6YA 3F8FA 2ZBKA 2LOOA 2HVSA 3W2AA 1FYLA 1O57A 1DP7P 1Y0UA 2EFOA 3QP6A 1IAWA 2DBBA 1IW7F 2UUZA 3HKZA 3OV8A 4XL9A 3LSMA 1G8XA 3FHNA 3KP3A 3Q9SA 3WTSC 5L3GA 2Q0OA 1FOKA 4XKCA 3V7CA 3SZPA 2GXBA 1PJRA 2W7NA 2IA0A 2VQHA 5DD8A 2VBWA 4B43A 3KE2A 3RI4A 2MD0A 1ZRDA 3W2WA 2FBHA 5HOOA 1Q1HA 1ZRFA 2WB1A 4A2UA 3LAJA 4U88A 1D0ZA 2ESNA 1YFHA 2HTSA 4WK8F 4Q5SF 3DTKA 4PSXA 1W36C 2W57A 1FPQA 5HVQC 2IGMA 1P92A 1YIOA 5D4RA 5BS6A 1IN6A 3WE3A 5FD6A 1CF7A 1XSDA 3PUBA 1Z05A 2ESHA 2GOXB 2WBMA 5HS8A 3OMYA 3MKYB 4RB0A 4DBQA 4RGRA 1ZAOA 1N78A 1J9IA 3RPUD 2OBPA 3GZ5A 4BXFA 2VOOA 2OQRA 1EH8A 1UB9A 4IHSA 1XCVA 2VL8A 3MD2A 4IHTA 3KFWX 3CUOA 3D5SC 3BZ6A 1MGTA 2ZNYA 2V79A 1JGSA 1YYVA 1S6LA 4I01A 4ZYDA 1YX3A 4UUVA 1ERDA 1D3YA 4HBLA 2ZXHA 1XMAA 1SD4A 1W4MA 1VZ0A 1XSVA 3COAC 4KJZA 3VWBA 2JSPA 5CVVA 1XGMA 3HXLA 2JTVA 5JVTA 2GA2A 2WV0A 4RLQA 1T98A 1DGWY 1R1TA 2IA2A 3J80Z 4BYYA 3C3WA 1P9QC 4CHUA 1ZHFA 4YIIA 4AIJA 1R23A 3GZ6A 4IRGA 5KK1A 4LGWA 3LQRA 2CFOA 4Z2YA 4L5JA 4WCGA 3I4PA 2LREA 5HLIA 1JHHA 3U21A 1RI7A 1DPUA 2XF6A 3E5QA 2J5OA 4KIBA 1S7OA 2MLKA 3B73A 3PNVA 4EM1A 2FMLA 1UFMA 3M8JA 4B47A 2Q8KA 4EJVA 4BEHA 1FMVA 3KEYA 4DNCA 2OA4A 1W7PB 2JZYA 3FX3A 4ZDLA 2KIFA 3F72A 2HZTA 3VSLA 2DLLA 4JOMA 4NUBA 3SEZA 4KMUX 3C18A 3GWZA 3ULQB 2KPMA 4X0GA 1K78A 5H20A 3S2WA 4HSRA 2X85A 2BVMA 2FA5A 2E1MC 2IJLA 2LH9A 4PJMA 4JQFA 1T0FA 1EA3A 4F52A 1AOYA 1ZREA 3OYIA 1F4KA 4LLNA 2CGPA 3M1EA 4IF4A 4MEYF 3DQVC 1P4XA 5KHDA 5HDGA 3QRFF 4HA8A 1Y6IA 4XKBA 4Y33A 5L3DA 4QLCU 4XRFA 1FX7A 4KN7X 3D0SA 4G94A 2RREA 1BOAA 1R1UA 5BPDA 2RQPA 1N75A 4RM3A 2A5WA 4EJTA 1UAAA 2RNJA 2X1CA 4DQ2A 1YX5A 3DF8A 2P8TA 2ZSHB 5FRMA 1ON1A 2ZCWA 4M6XA 1FBQA 2K9LA 2VBXA 2O61A 4LD5A 3C2GA 2VN2A 5FRNA 3HUGB 3K4LA 2LG4A 2X6YA 4PCQA 4OOIA 1N77A 2DXIA 4MLOA 1LDKB 2CMPA 3BG6A 2IVMA 4O3MA 3MZHA 3E3VA 5FLXK 1D5VA 4QWQA 4FASD 3TDZC 2D1VA 2L3DA 1Z7LA 3HUGA 1A04A 2FNAA 3KP7A 4ZC3A 1P4AA 2JSCA 4IPAA 5DDGA 1IXCA 4KYWA 3DPTA 4YFNF 3VYSB 2W4SA 3BJAA 4JK1X 3PFYA 4XORA 1USTA 2GQQA 1Y56A 2L9SA 4ZYGA 4ENMA 4BAYA 3W6JB 3L7WA 2K27A 1FWZA 3EQLF 5LGNA 5ILSA 2HVRA 2E1NA 4YRVA 1HQCA 1Z1DA 4RGXA 3HSRA 2L54A 3DFGA 2AXLA 2IS4A 3DV8A 1S9HA 2W1OA 1Z91A 4XLHA 3BY6A 4ZYEA 3FBIB 3FXRA 2E7WA 4E70A 4A5MA 2CUZA 3TBIA 2R7FA 4KUMA 2ZNZA 3GFIA 1TZLA 3EUAA 3K1PA 2IPQX 3QP5A 3IL2A 1R00A 4RB2C 4BNCA 3S93A 4MTEA 2Z5UA 3BJ6A 1KA8A 2EK5A 3OYGA 3WG9A 3V42A 3WTWC 4HAMA 2EA2A 3DLAA 4HX7A 1MMAA 2H6BA 1W7PA 5D6FA 3CO6C 3SXYA 1K7AA 3FM3A 4C30A 2VQGA 3U1DA 3RKWA 3TQNA 4G6QA 2L01A 1G59A 1T2KA 4LFUA 4HEA2 4CA0A 1KQ9A 1SMTA 3LQQA 1D1AA 4CCKA 2KDOA 4L0YB 2QWWA 4PJJA 2DI3A 2CUJA 4IKFA 3C1DA 2XF5A 4XMYA 3EUHC 3SZGA 5K5OA 3ZN0A 1X4OA 1OR7A 4BE0A 1UHWA 3VOEA 2L2OA 5ICEA 2RC4A 3H9QA 3GYHX 1J7KA 1ZLJA 2L02A 2VJ4A 3H0DA 5AIPA 4AVZA 5DUKA 4GRIA 3OIQA 2A61A 1G3TA 1MKMA 1WWXA 2WC2A 2CQKA 2R7OA 2W00A 3K4KA 4HLXA 1QU3A 3ELKA 2E1CA 1SFUA 2QKLB 2KZVA 3KETA 4Y3OA 3E6DA 1OYIA 3FZVA 4AU7A 4ITVA 1LEBA 4ZJZA 4BDZA 4OWRB 3ABTA 5FFZA 4S05A 3I9V2 3TGNA 2VIXA 1X1DA 3DU6A 3RJPA 2F5VA 6PAXA 4C2TA 5DYMA 4LB5A 4OAYA 3NQOA 3ZPLA 2L7KA 5D5WB 3Q5FA 1ZRCA 3HRMA 2HQAA 2IGKA 2ZO4A 5AONA 2F5FA 2XUBA 4ENNA 1D8JA 3JAMZ 2GOMA 3ZGKA 2MC3A 1RZ4A 2V1NA 3G2BA 4BU2A 5KCMA 2L5QA 1XGNA 2HQRA 1UELB 4ANJA 4BL0B 2EJRA 2PI0A 2HVQA 3D5RC 5CJ9A 4NC7A 3IWFA 1IN4A 4UVBA 3WTXC 2Y48A 4G7HF 2HDWA 4E7HA 1X3UA 4DIQA 2P7VB 3LSTA 4MQVA 1FLIA 2WY8Q 4NQWB 3KP4A 1S8NA 2ZXIA 1YQAA 2RQQA 3RIRA 2F5DA 3K0LA 2EV5A 2EFQA 5F64A 3VB2A 2PMHA 1WJBA 4LK0F 5IT9Z 2XDVA 4HDVA 4NB5A 5HNFA 3WTVC 3OR1C 3P9IA 3AL0C 1LDDA 4XKVA 3E0JB 2R7WA 4ZH4F 2FMYA 3SHFA 4HQEA 3K1NA 1Z7UA 2KJCA 5ED4A 3RKXA 2XROA 1G6NA 4EV0A 3G3ZA 2A68F 5K1YA 5K5QA 1J09A 4E7KA 2IGOA 3DTEA 2R7QA 3BOQA 4BQNA 2W85A 2P4WA 2XAQA 2CW7A 2LRDA 2MD5A 3TOAA 3EUKL 2FF4A 2X6WA 3GFLA 1ZYRF 4WXCA 3F9KA 3M1CA 4G8XA 1R22A 3ZRGA 4C2UA 3VYUB 3S32A 4LB6B 4BEHB 4KIFA 4O6JA 2OZ6A 4P9FA 2IA1A 1KU2A 3DEUA 4XLAA 4HYEA 1DPRA 2LSOA 3GFMA 1B1BA 3CO7C 2NNYA 4XKWA 4HNTA 1ZELA 1TLHB 4A0XA 2HDCA 1OLTA 3JTHA 1IZ1A 1UHMA 1MNDA 5ICGA 4ASNA 3R0JA 3OWTA 4FX0A 3V4GA 4UVAA 2JVHA 2M87A 1BM9A 3EYYA 3FKJA 4D0PA 2V1XA 3E6MA 3BP8A 2I8DA 1U3EM 4MTDA 4EQQA 3VYRB 1ZG3A 1R7JA 3FXQA 2DK5A 3K4CA 2MLGA 2P5LC 2CV0A 4RAYA 2BV6A 3LWFA 4L9TA 2DT5A 4WXDA 4L9JA 5HDNA 3M8FA 4M6YA 1RIOH 2OUMA 4K2EA 3GVAA 4BHCA 2G7UA 1MDMB 4BJ5C 4IQJA 3FMQA 5FD5A 3JSOA 2YPRA 4HX8A 4FX4A 2M0MA 4L18B 1I27A 1BN5A 4LG3A 3JAMK 3P9CA 1BR4A 2CG4A 2O8XA 4MNUA 4B3XA 2ACJA 4IRHA 2Z9OA 4HSTA 4DGWB 4G6TB 4LLGF 3LAPA 1FNNA 1DGRM 3B02A 4M72A 3DPUA 2YR2A 2BW3A 3K4NA 1CF7B 1MZBA 1BIAA 2XAHA 2DO7A 2VT2A 3OS0A 2PJRB 4B44A 1MJAA 3IKTA 4OIQF 4BDYA 2R7DA 2D2WA 5E1XA 5FB2A 4GXOA 1DQUA 3IHUA 3S3MA 3WTTC 4LG0A 3WGHA 4WWCA 3VYTB 2JPCA 1O7FA 4XBFA 2IT0A 1ZH5A 1FP1D 4ESBA 4CZCA 3W6KB 2HKXA 4L9VA 3W2VA 5JHUA 1BR2A 2RGVA 2PFBA 2X1EA 5LEJA 5JFRA 3OOPA 3K2ZA 2IXSA 2VB6A 1DP3A 3AFHA 2PMZA 3O2PE 4F92B 4M9ZA 1HKTA 3MWMA 4XLEA 3OYAA 1IRGA 1KU9A 2XKOA 1YLFA 1XGSA 2A6HF 5CQEA 4BJ6C 3K6GA 3GO5A 5ILUA 2VXDA 2BBYA 4HV6A 4BHPA 3AKZA 3I59B 1ON2A 3FF5A 2O3FA 5D8LB 4OMZA 3MMYB 2D45A 2AQFA 1JHFA 3OR2C 2BGCA 2VQLA 1Z9CA 3OYBA 3O3KA 2GXGA 3ZXSA 1B59A 1SD7A 3HL2A 3FBNB 5EEGA 3H9JA 4CH7A 4O5VA 1P6RA 3RDIA 5L3FA 3VFZA 4ZDOA 2MYSA 3JSPA 1LJ9A 1YE9A 5CVUA 3BCAA 3OYLA 4M73A 1B6AA 2ISZA 1O7LA 1BIBA 2FBIA 4CICA 3SYTA 4F91B 1OR7C 1KGSA 5E8GA 1Z3YA 2R7XA 1TNTA 1U5TA 4Q4ZF 2W24A 3HYIA 3ML6A 5D5UB 3CMMA 2FBKA 4KFCA 4ZTFA 4WX9A 4RMNA 3CJNA 2GWRA 4E4HA 4KICA 3I64A 1MJ9A 1D0YA 3E6CC 1ZN2A 3LA7A 3REOA 5H6RA 4RS8A 5ILVA 1PYVA 3K70D 5KNLA 4D1QA 1RUOA 2STWA 3JW4A 5ERIA 3ZQ7A 2M7BA 2VXZA 3L09A 1KYWA 1P4WA 3PSIA 4II2A 1QO0D 3LMMA 3CF2A 3HRSA 4HG2A 5HLTA 2GZWA 4N0BA 2M4GA 3ISPA 4M71A 5J8CA 3KYLA 1LKXA 1DDNA 2W25A 3BLYA 4AVPA 2RN7A 1NG7A 1QZZA 4I7HA 1SAXA 1HA8A 3CESA 2M45A 3GBGA 4HW0A 2DK8A 3V8JA 3KLOA 4CCMA 2XC7A 4MQ9F 2K4BA 4BACA 2HPMA 2CS3A 3PL8A 4UNOA 4YEJA 2KIUA 4EATA 1SD6A 4GO1A 4B8XA 3TMOA 1LEAA 2IGNA 5L3EA 2YX4A 3RKYA 3KZZA 2MC4A 1ONVA 3OYKA 1BI2A 4P1WA 1USSA 5LHGA 1I1GA 1P2FA 3UR3C 2KMUA 5E1ZB 2HR3A 4G9YA 4XONA 2QLZA 1V4RA 1O3TA 1JE8A 1NHAA 5D6EA 4ZYAA 2F5EA 2XIGA 2DPDA 1V3FA 3PNYA 1F1ZA 5D5VB 2LBFA 4XN0A 1WJEA 1GVJA 4UV8A 2MABA 2C6YA 3V8LA 2OV7A 4EGZA 3P9KA 2LNBA 4AYBA 1FT9A 3I71A 3BC8A 4AWXB 1TNSA 3LSGA 4OIRF 5LRSA 4N9HA 4U0WA 2QYOA 2K02A 4C9YA 2STTA 2M4KA 5KVRA 3QYEA 1L3LA 4L9NA 1T95A 2KHMA 3TO9A 1PUEE 4NNJA 1YS6A 1BI1A 2QBYA 2FRHA 2K86A 3HTUA 1HKSA 3V7RA 2X0LA 4HOBA 4YIFA 1YG2A 2RVCA 4S04A 5A2QK 2W84A 1H9GA 1KU7A 2EFPA 2IS2A 4UV9A 2K7LA 3CTAA 3ZCOA 3MQ0A 5FLXZ 1K79A 5E8IA 4G7OF 1LFPA 2FUG2 2GIVA 3BG7A 4WF2A 5EEHA 2YX7A 3OS2A 5J8FA 2XVCA 2NNNA 2M8EA 3H3ZA 3WU1B 2FXAA 5HS7A 3K70C 2OQGA 4FETA 5LRRA 2Y75A 2LY2A 1XB4A 3CZ6A 2DQLA 2R4GA 3JTGA 2A3SA 1J2XA 3IRRA 2JA2A 3HSFA 3GXOA 1HW1A 5CVIA 5JI6A 4RGSA 4I2OA 4M9SA 3EYIA 3SQNA 1PP7U 1STZA 2Q2EB 2HQNA 2Q1ZB 1IF1A 3GEZA 2WWYA 4A6EA