3D5LA

Crystal structure of regulatory protein recx
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
LAKISKIEAQKRKGRYNIYLDGKYAFPVAESVLIQFRLMKGTELDEKQIAAIATADQQAKAYSRMLDYLSYQMRTESDIVKKLKEIDTPEEFVEPILKKLRGQQLIDDHAYAASYVRTMINTDLKGPGIIRQHLRQKGIGESDIDDALTQFTPEVQAELAKKLALKLFRRYRNQPERRREQKVQQGLTTKGFSSSVYEMIKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Crystal structure of DNA repair regulatory protein RecX.
rcsb
source organism Lactobacillus reuteri
molecule tags Signaling protein
molecule keywords Regulatory protein RecX
total genus 74
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA03
1.10.10.2800 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5lA01
1QGPA 2P5LC 5JVTA 4A6EA 2ZCWA 1F5TA 5LRRA 1KU7A 1WRJA 1L3LA 1J59A 5LGTA 3P7NA 1W5TA 4A5NA 4I98B 3HHGA 4GYIA 3ZN1A 2ZBKA 4DNCA 3G3ZA 2QUFA 3ZN0A 4LK1F 2XVCA 4HF2A 1R5HA 3HIFA 3Q9VA 5FLXZ 3LA7A 5DEQA 2IVMA 2DO7A 3SZTA 2DLLA 3FM3A 1XB4A 3LFKA 3HHHA 4I0AA 4LMYA 4BH9A 3VODA 4LG0B 1OR7A 1XDUA 2QENA 1H9TA 2ZNZA 3FMRA 1K6OA 2DQRA 1XSDA 3ZPLA 3V7CA 4L18B 4HBLA 1T2KA 1P4AA 1YIOA 3GF2A 1DP7P 1AWCA 1HW5A 1IN4A 1BM9A 4Q47A 4M6XA 4HF0A 5D6FA 4RGUA 4KMUX 4A0YA 1MJ9A 3QPHA 4PGHA 1B6AA 3G73A 1YFHA 1R1VA 1XDSA 3EDPA 2EFOA 4IPAA 1Q1HA 1TQIA 4XSXF 5BQTA 1YYVA 4HX4A 1W7PA 5HS7A 2HDCA 1G3SA 4KIFA 4EJVA 4U7DA 3SFZA 4ETSA 4BNCA 1XCBA 2DW4A 3TO9A 1J2XA 5BOXA 1ON2A 4BHBA 5JR3A 1V3FA 1R7JA 1PP8F 1HKTA 2P6SA 2E1CA 1DPRA 2XIGA 1SD4A 1J7KA 1SMTA 5KVRA 1H9GA 5LGNA 3VB2A 1Z9CA 4MGRA 5HDGA 3J81Z 3FMQA 3WE3A 1R23A 3WTZA 4ZH4F 4QWQA 3W6JB 5ILVA 5ILUA 2P6TA 5CLSA 1D8KA 2K4BA 4P9UA 1SAXA 3FF5A 2XAFA 1ZARA 5ILSA 3F6VA 2JT1A 2F2EA 2OQRA 5DDGA 2B0LA 1XGOA 2HKXA 3R4KA 2A3SA 4RGXA 4OIRF 3KCCA 2G7UA 4EJTA 3MAJA 4CICA 3DV8A 3F72A 3GFMA 1MJBA 5EEGA 5LBQA 2XAHA 4NHJA 5E8IA 3QU6A 3GFLA 3DF8A 2VBXA 1K7AA 1HKSA 2EFPA 4LG0A 2NRAC 5TJJA 4N0BA 4IJAA 3TKYA 3O3KA 5DCFA 2BEOA 3ZMVA 2DFIA 1ZGAA 2QM3A 4O6JA 3QRFF 1USTA 3BJ6A 1FP1D 3RKYA 2XASA 2RNJA 3C3WA 4OIOF 5LHGA 2KIFA 1LDKB 3Q9SA 3F3XA 2HQRA 4RGSA 1WKMA 2W85A 4LJZF 4BHCA 5H6QA 4DQ2A 3FHZA 2HR3A 3ECHA 4A5MA 1EH7A 5F1RA 1Z1DA 1SFEA 1TTYA 1TQMA 4BQAA 1SFUA 3F8FA 2V6CA 2M30A 3WE2A 3FMSA 5E1XA 1FLIA 1S7OA 2J5PA 6PAXA 3ULQB 5D5XB 2XAQA 3R61A 3I64A 1PDNC 2IRFG 4RGRA 2M8EA 4MNUA 2A07F 1O3QA 1IRGA 4HOBA 2PJPA 3IL2A 3M7GA 4HDVA 3EYYA 3O6BB 3CUQC 2IJLA 2JPBA 3CDHA 2O03A 4A2UA 1ZH5A 2OBPA 1DPUA 2PMUA 2LF7A 3F22A 3BROA 2XV4S 1BIAA 4UV8A 5A2QK 2O8XA 3H3ZA 1TLHB 3DEUA 3MWMA 2LNBA 3BPVA 5FO5A 2E1NA 3BY6A 2JPCA 2NNNA 2VBYA 1F1ZA 1QZYA 2FMYA 4Y13A 5HS9A 2UXNA 2L02A 1BI2A 2FNPA 1L0OC 2FMLA 3HYIA 5FGMA 3ECOA 4TV7A 2MH9A 4U88A 2X0LA 3GUDA 1W4MA 4ESJA 2VODA 5E1WA 2ISZA 4UVAA 4EGYA 1MZBA 1AOYA 2CO5A 3ELKA 3J81K 2UWMA 5BPDA 1ZG3A 4Y17A 3ZMUA 2E7WA 5CVUA 3HTUA 3J7AO 3ZMTA 2JRTA 3GWZA 1GXQA 3E97A 5KK1A 2O0YA 4M71A 4HLXA 1D5VA 4WCGA 1S29A 5EEHA 4M9SA 4XLPF 2P8TA 3ZMDA 1F9NA 2FBIA 3F8CA 1IN5A 3PQJA 1CF7B 2STWA 4XLNF 4MTEA 2H6BA 4HDUA 5DD4A 3IHUA 1QPMA 3IKVA 1OYIA 1IN8A 5HLHA 2WV0A 3D0SA 4G6DA 2VOPA 4ZZLA 1WWXA 3HTSB 1YW8A 2HYGD 4M74A 4D0PA 5E17F 2K86A 2V1DA 2TDXA 2ADUA 1W5SA 1OYYA 3QU3A 5L3DA 4KIBA 3J80K 1NHAA 2K4JA 1HSTA 3LA2A 1C0WA 2H09A 3K9TA 1KYZA 5D8KB 1KYWA 3N97A 5LHIA 2MLKA 4ZYHA 1ZHFA 2OQGA 1DDNA 4EJUA 1BJAA 3IWZA 3B73A 3JSPA 3KP6A 3DKWA 5HDNA 1MGTA 4HW0A 1P2FA 2ZJ2A 5FD6A 1LDJA 4UVBA 3WG9A 1IAWA 2KJBA 2ZFWA 4A12A 5LEJA 1IXCA 1ZRDA 4XRFA 3KP3A 3NRVA 3GX4X 2VONA 3E3VA 2QZ8A 2Y48A 3TGNA 1S8NA 1YQAA 2V1XA 5IT9K 4YFXF 2JZYA 4EM2A 5ICEA 1IW7F 1BI0A 3M8EA 4WX9A 3RYRA 4IXAA 2A68F 2FU4A 1J5YA 1S6LA 3JSOA 3IKTA 3P9KA 1S7AA 4MEYF 5FD5A 3V7SA 2DPUA 3T8RA 3O2PE 4P9FA 1O7FA 4IRGA 3WU1B 3CTAA 2FA5A 2KJCA 1O3SA 5DCMA 3LAJA 5L3BA 4LLNA 5L3CA 2WWYA 2HTSA 1XMKA 3FXQA 1R1TA 2UXXA 5E20A 2H6CA 3F8MA 3V8JA 2ZXJA 4B8XA 4HLYA 2FF4A 1OPCA 3JTGA 5BS6A 1O3TA 3TOBA 1T0FA 4ENMA 4LGWA 1IN6A 3T0YA 4GGGA 3KLOA 4L0YB 1JXSA 5D5WB 1JE8A 1YLFA 2L54A 1ZLJA 1D8JA 4PCQA 1G3YA 4YIFA 4UV9A 3E6MA 3HRTA 4QLCU 1KQ9A 2D45A 3E5UA 4BXUA 3KLNA 4JBAA 4A0ZA 3GFIA 3V4GA 1QQIA 2DQLA 3ROUA 4FX0A 1FBSA 3T8TA 1WI9A 3ZQ7A 1HBXG 1W7PB 4MQ9F 1MKMA 2FNAA 1PUEE 1USSA 3D5LA 3K69A 3DPLC 2QBYB 3I59B 1V4RA 4Q4ZF 3GZ5A 2QQBA 1RUOA 3KEQA 1FBQA 3ABTA 3ZMZA 2QLZA 3L9FA 1HXDA 3TO7A 4S05A 1A04A 5TRDA 1FNNA 4P5OA 4UHTA 3R0AA 3RKXA 3HRSA 4RS8A 4A0XA 1YW9A 1I5ZA 4AWXB 3LQRA 5BPIA 4O3MA 1FBUA 4KNYA 5K5RA 2D1VA 2V79A 3WGHA 1TNSA 3OV8A 3FX3A 1FP2A 3HOSA 1S3JA 3GLXA 2XUBA 2D2WA 2L4MA 1KA8A 2PFBA 3FWEA 2COMA 3K1MA 2OAZA 2DTRA 3V8LA 5DUIA 3HRMA 4ENJA 2F5EA 3BJAA 1U2WA 2A6HF 1ZRFA 3L09A 3MQ0A 1FSEA 2IP2A 1BN5A 1XGNA 2RC4A 5E18F 3DPTA 2DT5A 4AIKA 1XSVA 1Z6RA 3NQOA 4FT8A 3WTXC 1HW2A 3DFGA 3FXUA 1CGPA 3BWGA 4CHUA 2BE5F 4M73A 2OZUA 1ZG5A 2RKHA 2EWNA 2NS0A 4G6QA 3LAPA 4KICA 1ZG1A 1YO5C 4UVCA 5ICFA 5D6EA 4G7OF 3RDIA 2PLYA 3M8FA 2K7LA 2XKOA 2FE3A 2K02A 4B09A 1UFMA 2LF8A 2RN7A 1DUXC 1XMAA 4KT5C 1Z91A 2K27A 2W25A 3SZPA 4RB0A 1JHHA 3WTVC 3CUQA 2KRFA 2M45A 1FX7A 4GXOA 2G7HA 1XD7A 5LGUA 1RI7A 1T38A 3K0LA 3KP7A 4YG2F 4KN7X 2JSCA 2P5KA 3BOQA 1FYMA 3N4MA 1D3YA 4UNOA 5F64A 1U78A 1YTYA 4MEXF 4ESBA 4CXFA 1FYKA 4Q5SF 2BV6A 1P4WA 1R1UA 2GAUA 2O6GE 2HWVA 4LLLA 3KP2A 4HQEA 4OIQF 5D4RA 2ETHA 2BYVE 1OKRA 2P5VA 2FOKA 3T1BA 2MA3A 3DQVC 2L3DA 1FSHA 4RB3C 4XBFA 4OMZA 4KYWA 3I71A 2EFNA 4WWCA 3FZVA 3EYIA 3ML6A 3NEUA 2M1BA 3JAMZ 2FSWA 2HKOA 1IXRC 3SXYA 4L5IA 2CSOA 2RDPA 2XROA 3M1EA 3MCZA 2ELHA 4ON0A 1TW3A 4R8HA 2MBFA 3RKWA 2EFWA 3E5QA 2J5OA 2YSRA 1IF1A 2M87A 2Z3YA 5LHHA 4YFKF 4H0EA 3Q5FA 2JTVA 1KU3A 3WGIA 2Q0OA 2UZKA 5CVVA 1LB2A 4L9JA 2YX4A 4IRHA 2Z9OA 1KQ8A 3T5XA 2ZO4A 2CYYA 2FXAA 2FBKA 1IRFA 2PBIA 3MZYA 3REOA 2ZMEA 3ERED 2Q8KA 1Z05A 2ESNA 1G3WA 4WF2A 2RV8A 3P9CA 1YW7A 1ZN2A 3RYPA 1KGSA 4HQMA 2EV6A 3R0JA 3RPQA 2XAJA 4CGZA 1G3TA 3FXRA 4KDPA 4U0YA 1RNLA 4I02A 5J8CA 2X4HA 4UXNA 2HFHA 3KP5A 4IF4A 1XGMA 4G7HF 4HZFA 2OZ6A 1FC3A 1E17A 1XCVA 3MZHA 3J80Z 4I01A 2LKPA 1LEAA 3IWFA 1ZREA 4ZYDA 2CQKA 2D1HA 2EK5A 3HUGA 4MTDA 2DK8A 1P4XA 3GVAA 4P55A 4HF1A 3ZMSA 2MLGA 1YS6A 3EUHA 2W57A 3CO7C 3QOPA 1H0MA 5AIQA 1U6GA 4KUMA 3QP6A 1HW1A 3I59A 5ERIA 1BI1A 2DPDA 1TBXA 3BPXA 1G4DA 4ENNA 1QO0D 4KN4X 2DBBA 3WTTC 4L9VA 3F8BA 3HRUA 2OD5A 1B59A 2HGCA 4N9IA 4WXCA 3GYHX 1REPC 3DP7A 4L9NA 3RTRA 3K2ZA 1XGSA 4RAYA 4LB5A 3RJPA 2GA2A 3R60A 1GVJA 3GZ6A 2H27A 2W24A 5HS8A 2HQNA 4EMSA 5DCMB 1BC8C 2QQAA 4M9ZA 1LQ1A 1KU2A 1ZYRF 3RPUA 4LD5A 2VT2A 1HSJA 4Q48A 1P92A 1SD7A 2QQ9A 3F6OA 2IA1A 4LK0F 4OINF 1GXPA 5DYMA 4L5JA 2NAZA 1HQCA 5A2QZ 1UHMA 2XAGA 5ICCA 5LEKA 4AD9A 4K2EA 3QAHA 4M9XA 3VFZA 4UUVA 4IRIA 5ICGA 2MD5A 1JHFA 4CDGA 4RAZA 2EFQA 3AAFA 3E5XA 4GO1A 3WTUC 3KZZA 2GA1A 3FM5A 4ASNA 1UCRA 4U0WA 2VC1A 2RVCA 2PMHA 3SHFA 2EB7A 2PEXA 4A6DA 3LA3A 1B9MA 2VXZA 2PN6A 3LSTA 1Y0UA 5AIPA 1JGSA 4ESFA 3IRQA 2Z33A 5DV5A 2HOEA 1EH6A 2F5DA 1R22A 2AS5F 2HZTA 2EV0A 1X3UA 1BBYA 2O61A 1STZA 2EV5A 1ZAOA 3WODF 2PG4A 2STTA 2VT3A 2YX7A 3HSRA 3L7WA 3PQKA 3L2CA 5L3FA 4KFCA 3WU0A 3ZP5A 1KU9A 2GIVA 3QPTA 2PQ8A 4G94A 2A6EF 3GEZA 5DUKA 4NQWA 2YPRA 4XSZF 3MFKA 1R36A 4R1HA 2FEZA 1QBJA 3BZ6A 2WC2A 1FOKA 4WXDA 2ACJA 1FY7A 3H3UA 3TQNA 1TW2A 5CVRA 4RB2C 1XN7A 1RIOH 1KQ0A 3KEOA 4MQVA 2G9WA 3KZYA 2EA4A 2AXLA 2QYOA 1I1SA 4ZZDA 1VTNC 5L3GA 4IHTA 1MDMA 1FT9A 3PFIA 4EGZA 4OU0A 3VOEA 3U1DA 4JQFA 2V1UA 5D5UB 1W7PD 1FYLA 3IRRA 4AIHA 3CLOA 2CWEA 5K5OA 5FFXA 2HS5A 1IN7A 4IVNA 1TNTA 2HTJA 2L4AA 4EVIA 3LWFA 2DK5A 4L9TA 3W6KB 1J0RA 1K78A 1O3RA 3GW2A 2FBHA 2ZMEB 3U9GA 4EM0B 4CYDA 3K1NA 2XRNA 2H94A 3I54A 5HVQC 5HOOA 2GZWA 1U3EM 1IXSB 2IA0A 2FRHA 5HLIA 4BYYA 5HLGA 1LEBA 4HX7A 5JI6A 4OMYA 4Z2YA 5D8LB 1SFXA 3V8KA 2Y75A 4JK1X 2A69F 2GWRA 2P7VB 2DI3A 4HV5A 4PGGA 1CF7A 2ZKZA 3LQQA 5J8FA 1LNWA 3SQNA 1OYWA 3H92A 4I7HA 4LLGF 4S04A 2YU3A 2GXGA 1Z7UA 3E6CC 1LJ9A 4F7ZA 2M5WA 1U8RA 2IT0A 1F4KA 1T6SA 2OU2A 5FB2A 4ENKA 4LB6B 5J6XA 2LSOA 2XGXA 2DU9A 4N9HA 2RQPA 1QZZA 3IC7A 2A5YB 2R7FA 2RGVA 1U5TC 2VBZA 2O3FA 2R3SA 1O57A 4I09A 5CVIA 3U2RA 4KMFA 2E7XA 3S2WA 2VOOA 4U7BA 1O7LA 1IUYA 5D5VB 4G8XA 2V9VA 2CGPA 4R79A 2KIMA 4EV0A 1ODDA 2L01A 4I0BA 2LDUA 3F21A 2VC0A 3KP4A 1U5TA 2F5FA 5JFRA 1HKQA 2HYFA 4HAMA 2IA2A 1I1GA 3EQLF 4E70A 3DXJF 1EV7A 2NNYA 3BJOA 2EA2A 3KFWX 5E8GA 1RZ4A 3WTSC 3JAMK 2BGCA 5ED4A 2QVOA 3I4PA 3JW4A 4KA4A 2IW5A 1OMIA 2XHKA 3HSEA 1B1BA 2QWWA 4NB5A 1SD6A 5CJ9A 4G7ZF 1K79A 1GHCA 5D4SA 4LFUA 2P7CB 4M72A 3COAC 4ZYGA 1I6XA 3QP5A 3OOPA 2R7DA 5IT9Z 5L3EA 1BOAA 2A61A 5JHUA 4PDKA 3JTHA 1J75A 3EETA 3M9AA 1BC7C 5F6FA 3P9IA 4O5VA 4HA8A 1QNTA 2ISYA 3GO5A 1LDDA 3I53A 3E6DA 2EJRA 2HEOA 5K1YA 4PZJA 1WQ2A 2KKOA 2ZNYA 1FPQA 3CUOA 5E1ZB 3I5UA 3F23A 1XSXA 5AONA 4EJOA 1LVAA 2MC3A 3VEPA 2VE9A 4I2OA 4HV6A 4G9YA 2MH2A 1J9IA 1T39A 3I0TA 3KETA 3ISPA 2DAOA 3CJNA 4YFNF 3K1PA 5CYVA 3RI4A 4WXHA 2YR2A 4M6YA 1ZGJA 3GFJA 3C18A 3R6SA 1U5TB 4EM1A 1FZPB 1PP7U 3TO6A 1WSUA 1ZLKA 3E6BA 3KE2A 2BBYA 2PI0A 3GXOA 2CFXA 5FLXK 4AVPA 1P6RA 1R5GA 3TDUC 4P96A 2NYXA 1YG2A 5LLQA 3CO6C 1ON1A 3ABUA 3BDDA 2QBYA 4CZZA 5BMZA 4WK8F 1B9NA 2CG4A 1RUNA 4OOIA 4L0ZB 1MD0A 2IPQX 2GQQA 4ZYEA 4IHSA 2C6YA 4Y15A 3WTWC 1E2XA 4HYEA 2XKPA 3F8NA 3C1DA 3BP8A 5H6RA 2Z5UA 4GYGA 1MJAA 2FQ3A 3WTYC 1FWZA 4OIPF 1BIBA 4RB1A 1SMYF 4FX4A 2VBWA 1I27A 2VN2A 3L00A 5K5QA 4U0VA 2CW0F 1YS7A 2P4WA 1R00A 2ESHA 3C7JA 4MHGA 5CVJA 2GXBA 1MDMB 3HOTA 5LRSA 2WTEA 5H20A 2Q2EA 4BAYA 2OA4A 4GCVA 4CO8A 1R58A 1SD5A 2Y0MA 4YIIA 1UHWA 2VE8A 3RIRA 5IT3A 3I58A 1T98A 2F5CA 3TDZC 5DD8A 1ONVA 2KIUA 5FFZA 1Z6TA 3V7RA 4FHTA 1IZ1A 3TOAA 1TQPA 3B02A 2Z99A 4AIJA 1K78B 1B4AA 3CUQB 4EJWA 1G6NA 3MEXA 1ZRCA 1UB9A 2W84A 1EH8A 3HSFA 4HX8A 1ULYA 4KIGA 1BI3A 5HDKA 3WGGA 4EQQA 4BHPA
chains in the Genus database with same CATH superfamily
1QGPA 2P5LC 3OYKA 5JVTA 4XN3A 4A6EA 1A31A 2ZCWA 4FISA 1F5TA 2BXZA 5LRRA 3FIWA 4RAFA 1KU7A 1VQ8I 1YI2I 2Y31A 1WRJA 1M1EB 3TP0A 1L3LA 1J59A 2W00A 2NS8A 2PMZN 5C3EJ 2NOJB 5LGTA 4M3FA 1D0ZA 3P7NA 1W5TA 1MIJA 4A5NA 4I98B 3HHGA 2M34A 1XG1A 2XC7A 1VQ9I 3OL3A 2XGDA 4GYIA 3ZN1A 2R93J 2ZBKA 4DNCA 3G3ZA 2DA2A 2A5WA 3CJQB 2QUFA 3ZN0A 1BW6A 3P5JA 4LK1F 2XVCA 3JRDA 4HF2A 1R5HA 3HIFA 3C2BA 4D7MA 3HJEA 3Q9VA 5FLXZ 3W2WA 3LA7A 5DEQA 2IVMA 2DO7A 3SZTA 3ABLH 3M1CA 3GTMJ 1ZR2A 4AIDA 2FUG2 2DLLA 3FM3A 1XB4A 1Z3YA 4J01A 3LFKA 3HHHA 4XLAA 3GTLJ 4I0AA 4LMYA 2R5ZA 4BH9A 3VODA 4QPQA 4XKVA 1QVTA 4NQWB 4LG0B 1OR7A 1XDUA 2F5VA 2QENA 3CJTB 2W7NA 2ZNZA 1H9TA 1X1AA 3CP8A 3FMRA 1B8IB 1YX5A 3QPSA 1K6OA 2DQRA 1XSDA 3ZPLA 3V7CA 4L18B 4HBLA 2KRCA 5CPRB 2Y0SN 3K4JA 3ZQGA 1T2KA 3I4NJ 1Z21A 1P4AA 1YIOA 3GF2A 4MIMA 1DP7P 1AWCA 1HW5A 1IN4A 1BM9A 3A0BC 5B1BH 4Q47A 4M6XA 4HF0A 5D6FA 4F91B 1GDTA 3HBLA 3LMMA 4RGUA 4KMUX 4A0YA 1MJ9A 1S9HA 3ESWB 3QPHA 1QU3A 2BXYA 4PGHA 3ZCOA 1B6AA 5IP9J 3G73A 2YUSA 2Y9ZA 1YFHA 1VQKI 1MNEA 1X4OA 1R1VA 2VASA 2MD0A 1V5FA 3FDYA 5M3MJ 1NK3P 1XDSA 3EDPA 2EFOA 4IPAA 1Q1HA 1ZGWA 3G2BA 3QOEA 1TQIA 1LE8B 4XSXF 5BQTA 3LSPA 1YYVA 2FJ1A 3WHCA 1JT0A 1SFOJ 4ABZA 2DJNA 2Y69H 3OWTA 4I76A 4OAZA 3C2HA 4HX4A 3HM5A 2LP0A 1W7PA 5GAEJ 5HS7A 1G3SA 2ELJA 2HDCA 3SFIA 1PUFA 2HVQA 3JRFA 4KIFA 2QGUA 4EJVA 3HPGA 4CCLA 2HXOA 4U7DA 1OFCX 3FXLA 3HC7A 5F0CA 3SFZA 4ETSA 1S5LC 2NOGA 5JLXA 4BNCA 1FIAA 1XCBA 2H1LA 2DFEA 3Q0VA 4IKFA 3TW6A 2Z1DA 2DW4A 3TO9A 1J2XA 5BOXA 4EEFG 1ON2A 4BHBA 5JR3A 1V3FA 3IH4A 1R7JA 1ETQA 1PP8F 3MKZA 2P6SA 1HKTA 2E1CA 1DPRA 2XIGA 1SD4A 1J7KA 4UB8C 2LG4A 1SMTA 4OWRB 5KVRA 1H9GA 3AL0B 1WJFA 5LGNA 3VB2A 3G1OA 1Z9CA 4MGRA 4BQNA 5HDGA 3J81Z 3FMQA 3WE3A 2F4MB 1R23A 1MBEA 3WTZA 4ZH4F 4QWQA 3W6JB 5ILVA 2CW8A 5ILUA 2P6TA 3CF2A 3ERMA 5CLSA 2DDBA 1EJ9A 1YOVB 3NWTA 1JKRC 1D8KA 5IYBJ 2K4BA 2RAEA 4P9UA 4QSHA 2LTPA 2M8GX 1SAXA 4CSWA 3FF5A 2XAFA 1VF9A 1ETWA 1ZARA 5ILSA 3F6VA 4CCKA 2JT1A 2F2EA 2OQRA 4PSWA 1RR8C 1SC7A 5DDGA 2B0LA 4LITA 3B6AA 1XGOA 2HZDA 2RNGA 5E3MA 5DM6F 1UMQA 2JA2A 2X1CA 5FLMJ 1YRNB 2HKXA 1TZLA 3R4KA 1A5JA 2YS9A 3M8JA 2A3SA 3MKYB 4RGXA 3A0HC 2VQLA 4OIRF 2QKLB 1RRJA 3OYHA 2DA4A 3KCCA 4FCYA 2G7UA 2HOAA 5TGTA 4EJTA 3MAJA 4CICA 3DV8A 3F72A 4UY8I 3GFMA 2M7AA 1SAUA 1MBHA 2HQ5A 1MJBA 5EEGA 3BLYA 4XLFA 5LBQA 2FX0A 3D5SC 2XAHA 4C3IJ 4NHJA 5E8IA 4E4HA 3QU6A 3GFLA 3DF8A 2VBXA 1K7AA 1HKSA 2EFPA 2L7FP 4LG0A 1S7EA 2NRAC 1GV5A 2WA0A 3G1LA 5F0FA 4XK4A 5TJJA 2EZHA 3H9GA 4N0BA 2MGQA 4IJAA 3O3KA 5DCFA 2BEOA 3TKYA 3ZMVA 2DFIA 3K4BA 4X6AJ 1ZGAA 4XKWA 2QM3A 4O6JA 3QRFF 4RBOA 3J7AY 1USTA 3JRAA 4G6TB 3CCSI 1HA8A 3BJ6A 1OCPA 1FP1D 3RKYA 2XASA 2RNJA 3AKZA 3C3WA 4OIOF 4DYCA 3S1RJ 5LHGA 4BEHA 3QYBA 2KIFA 1LDKB 3Q9SA 4XLEA 2CUJA 3F3XA 2MW8A 2HQRA 4RGSA 1A35A 1WKMA 2W85A 4LJZF 4BHCA 5H6QA 4DQ2A 3L2RA 2HR3A 3FHZA 2CUEA 4HEA2 2W4SA 3ECHA 4A5MA 1HCRA 4PK4A 3DEWA 1VQOI 1EH7A 5F1RA 2EILH 1Z1DA 1SFEA 1TTYA 3LSMA 1TQMA 4BQAA 1SFUA 3PUBA 1IG7A 2M3AA 1APLC 3F8FA 5EG0A 2V6CA 2M30A 3GBGA 2HDDA 3WE2A 3Q0WA 3FMSA 3PIPF 5E1XA 1ENHA 3EUKL 3K7AJ 2EIKH 1LFPA 1BR2A 2P81A 3O8GA 1FLIA 1S7OA 2HOTA 3SDBA 2J5PA 1F43A 4IO9F 3OR1C 2LH9A 5IOYA 6PAXA 3SEQA 3ULQB 5D5XB 2XAQA 3VPRA 2CQQA 3R61A 3I64A 4XKCA 1PDNC 1NTCA 4I99C 5F08A 2IRFG 1R49A 4RGRA 2M8EA 4MNUA 3FISA 2XB5A 2L0KA 1YITI 2A07F 1O3QA 1IRGA 4HOBA 2PJPA 2B7EA 3IL2A 4Y4RA 3H1CA 1MBFA 3M7GA 2JVHA 1JKQC 4HDVA 3EYYA 3O6BB 4PUSA 1ORKA 2VQCA 1VNDA 3CUQC 2IJLA 2JPBA 3CDHA 2O03A 4A2UA 2OJED 2OBPA 1ZH5A 1DPUA 2PMUA 2TRTA 5FKNA 4F93B 1B8IA 2KMUA 2LF7A 3F22A 3BROA 3BTLA 3ZQIA 2XV4S 1BIAA 4UV8A 5IYCJ 5A2QK 2Y9YA 1EF4A 2X6XA 2O8XA 3H3ZA 1TLHB 3SYTA 1R6RA 3DEUA 3GTPJ 3MWMA 2LNBA 3BPVA 5FO5A 2E1NA 1D5YA 3DBHB 3BY6A 2JPCA 2NNNA 2DCEA 1T95A 1BA5A 2VBYA 1F1ZA 1QZYA 1YHQI 2FMYA 4Y13A 4DZPA 5HS9A 1W0TA 2UXNA 1MH3A 4E7LA 5E3LA 2L02A 3H9QA 1BI2A 1L0OC 2FNPA 2FMLA 1AKHA 3HYIA 2R7XA 1J09A 3ECOA 5FGMA 4TV7A 2MH9A 4U88A 2X0LA 3VYUB 4AYBN 5JHFA 3EUAA 3GUDA 3CQZJ 2DMPA 3RQ4A 1W4MA 2Q1ZB 3DBLB 4ESJA 3HL2A 2VODA 3HOVJ 2AXTC 1DGRM 3FBNB 1P9QC 3PFYA 2KIQA 3BCAA 2E34A 5E1WA 3HGYA 2ISZA 4UVAA 4EGYA 2EBIA 1MZBA 1AOYA 2CO5A 3E7LA 4ZDLA 3CCQI 3ELKA 3NAUA 5F0HA 3J81K 2OCCH 2UWMA 5BPDA 1ZG3A 3S3OA 4Y17A 1SEUA 3ZMUA 2E7WA 3GTOJ 5CVUA 3HTUA 2KLOA 3OYJA 3J7AO 3ZMTA 2R7UA 2JRTA 3ZOBA 4G12A 2CFOA 1GXQA 3GWZA 3E97A 5KK1A 2O0YA 3SEZA 1QA6A 4M71A 4RM3A 4CYCB 3K4NA 1JI8A 4HLXA 1WJCA 1D5VA 2GOXB 3VSKA 4WCGA 1S29A 2LR8A 4M9SA 5EEHA 4XLPF 1YJ9I 2P8TA 4LG3A 3H9JA 3ZMDA 5IP7J 1F9NA 2FBIA 3F8CA 1IN5A 3PQJA 2E1OA 4XKBA 5J4VA 3DPUA 1X19A 1JT6A 1CF7B 2STWA 1QHGA 1TL8A 3GTQJ 4HSTA 4XLNF 4MTEA 1LVKA 3IAM2 1OCTC 2H6BA 2Y30A 1Y8RB 4HDUA 1B72B 3OS0A 4A3CJ 5DD4A 4D7NA 3IHUA 1QPMA 1VQ6I 3IKVA 2F6CA 1OYIA 2RQQA 1IN8A 3HUGB 5HLHA 2WV0A 3D0SA 4G6DA 2VOPA 2DOEA 4I6ZA 4ZZLA 1MBGA 2F4IA 4ZYAA 1WWXA 4ZJZA 4PFOA 3HTSB 1YW8A 2HI3A 2HYGD 2XF6A 1DGWY 3IP4B 4M74A 4D0PA 2ZJRF 4L5EA 4AVZA 4MFEA 3X2QH 3S15J 2GLOA 3DKYA 5E17F 2VIXA 2K86A 3E1SA 2V1DA 5IOZA 4BS9A 3ZR8X 1VQ4I 2TDXA 1YRNA 2ADUA 3BT9A 2JMWA 1FIPA 4DYRA 3FK6A 1W5SA 1OYYA 4OAYA 3QU3A 5L3DA 4KIBA 2H1KA 3J80K 3JRHA 1NHAA 2K4JA 1HSTA 3LA2A 4UUSB 1W36C 1C0WA 1JUPA 2H09A 3K9TA 1UZCA 1I6HJ 1KYZA 5D8KB 1KYWA 3N97A 2XRLA 3CMAI 5LHIA 4XM3A 2MLKA 3OIPA 4ZYHA 1XTAA 1ZHFA 2OQGA 1DDNA 4EJUA 2DA7A 5B1AH 1BJAA 3IWZA 2W82A 3B73A 3OMYA 3JSPA 3KP6A 1UELB 2BHZA 3DKWA 5HDNA 2DMUA 4XQFA 1MGTA 4HW0A 4D5FA 4QIWN 1P2FA 2ZJ2A 5FD6A 1LDJA 1K6YA 1WVRA 4MFDA 4UVBA 4S0HB 2P0WA 3HPHA 3RQIA 3HG9A 3WG9A 2KT0A 1IAWA 3DWLE 2KJBA 3OS1A 2ZFWA 4A12A 3LSIA 5LEJA 2KDOA 3MN2A 1VQ7I 1IXCA 1ZRDA 2H8RA 1IRZA 5LFAA 3KYDB 4XRFA 3KP3A 2DYSH 3D5RC 3NRVA 3OYEA 2CJJA 3HB9A 5C4XJ 1Y1WJ 1ERDA 2A6TA 3GTKJ 3OYGA 3GX4X 2VONA 3S17J 3E3VA 2QZ8A 1W1WE 4N4OB 1MMAA 4KT6A 2Y48A 4B3XA 4BGDA 3TGNA 1S8NA 1YQAA 2V1XA 4BY7J 4YFXF 5IT9K 1X3ZB 2JZYA 1YX3A 4EM2A 4BY1J 2EIJH 5ICEA 4NBQA 1IW7F 1BI0A 1IC8A 3IUOA 2LY2A 3ZXSA 5CQEA 2WV1A 3AG1H 3M8EA 4WX9A 5GTIC 3RYRA 2JA7J 4IXAA 2A68F 2FU4A 3MVPA 1PJRA 1J5YA 1S6LA 3JSOA 4Y33A 4PJ0C 3IKTA 3PNYA 3P9KA 1S7AA 4MEYF 1FJLA 5FD5A 3V7SA 4HRIA 4BE0A 2DPUA 3T8RA 1W0UA 3O2PE 4P9FA 1O7FA 4IRGA 3FK7A 3WU1B 3PM1A 3CTAA 2FA5A 2KJCA 1JKOC 1O3SA 5DCMA 1IUFA 3LAJA 1WJDA 3B6CA 1YJNI 5L3BA 3VSLA 4LLNA 5L3CA 1SVOA 1Y8QB 2WWYA 3CDIA 2HTSA 1XMKA 3FXQA 3LOCA 3FXMA 1R1TA 3K6GA 2UXXA 4B4CA 2DOFA 5E20A 2H6CA 3F8MA 4BUPA 3V8JA 5DS9A 2K40A 2M4KA 2ZXJA 4B8XA 4HLYA 2FF4A 1OPCA 3JTGA 5BS6A 1G8XA 3JRBA 3HDDA 1O3TA 3TOBA 2QKMB 3L2VA 1T0FA 4ENMA 1WFXA 4BQOA 4DW6A 4LGWA 1IN6A 1HOMA 3T0YA 4GGGA 3KLOA 1LFUP 2JJ7A 2BY3A 4L0YB 2F48A 1JXSA 1IV8A 4XOTA 5D5WB 4A3IJ 1VQ5I 1WZ2A 3FXKA 1JE8A 1YLFA 2L54A 4C30A 3JRIA 3BZCA 1ZLJA 5C44J 1ZKGA 4D1QA 1BR1A 2MYSA 5CKTA 5F04A 5B66C 1D8JA 4PCQA 1JTYA 1G3YA 1TWCJ 2EZKA 4UV9A 4YIFA 3K70D 3E6MA 3HRTA 2N8GA 4QLCU 2R7QA 3K4KA 3RPUD 1KQ9A 2D45A 2LY1A 3E5UA 4XRSA 4BXUA 1JUMA 3PNTA 3KLNA 4JBAA 2E5NA 4X1EA 4A0ZA 3GFIA 3V4GA 4BJTA 1QQIA 2DQLA 3ROUA 4FX0A 3CCUI 1FBSA 2LOOA 3T8TA 1N25A 4D5CA 4F92B 1WI9A 4DOZA 3ZQ7A 3OIQA 1QPIA 1D1CA 1OJLA 2RREA 3ZQLA 1HBXG 4ITVA 1W7PB 4NC6A 2KP6A 4MQ9F 3BTJA 1U0JA 1MKMA 2X6YA 2FNAA 1FMWA 2DODA 5DM7F 3RKQA 1PUEE 2R4GA 1USSA 2X48A 3D5LA 4GDFA 3K69A 4BU2A 4CUGA 3DPLC 4NNJA 1ZR4A 2QBYB 3I59B 4XL9A 1V4RA 4Q4ZF 3GZ5A 2QQBA 1RUOA 3KEQA 2ID3A 2DT7B 3F9KA 2OC6A 2V9PA 1FBQA 3ABTA 3OY9A 3ZMZA 2QLZA 1RPWA 2VKHA 3L9FA 1OCRH 1HXDA 3VYSB 3TO7A 5KAIC 4S05A 2QSGX 3G4SI 4M3GA 1A04A 5TRDA 1FNNA 2WAQN 3ZQCA 1ETVA 4P5OA 4UHTA 3R0AA 1CQTA 2DN0A 1KZHA 4IL6C 4QPOA 3RKXA 3BZKA 4W97A 3HRSA 2V4JC 4RS8A 3DLLF 4FE7A 5B5EC 2WBMA 1GT0C 2XSDC 4A0XA 1YW9A 2OV7A 1I5ZA 4AWXB 3LQRA 5BPIA 2YU9J 3HOUJ 4O3MA 3HZJA 4A3EJ 1BJZA 1IGNA 1FBUA 4KNYA 3ZQQA 3LSJA 4BJ5C 5K5RA 2D1VA 2VJ5A 4LIUA 2V79A 3AFHA 5EYRA 3WGHA 1TNSA 3F0CA 3FX3A 3OV8A 1ZQ3P 3OYDA 1FP2A 3HOSA 1WH7A 1S3JA 1SANA 2ZJQF 3GLXA 3FKIJ 5EGOB 5M3FJ 2DFHA 2GOMA 2XUBA 3GZNB 3EUHC 1NG6A 2KZGA 2Q2EB 2D2WA 2L4MA 1KA8A 2PFBA 2VI6A 3FWEA 2COMA 4YEJA 3OSFA 3K1MA 2OAZA 1UG2A 4E6KG 2ICWG 2DTRA 2XF7A 4BBSJ 2MABA 2DA6A 3V8LA 5DUIA 3S16J 3HRMA 4ENJA 2F5EA 3BJAA 1U2WA 5GPCA 2A6HF 3M3YJ 1ZRFA 3L09A 3MQ0A 1FSEA 2IP2A 3L2QA 1TWGJ 1BN5A 1XGNA 2RC4A 4UUTA 5E18F 2O5RA 3DPTA 1MMDA 2DT5A 4AIKA 1XSVA 1Z6RA 4BACA 2K9SA 2JWTA 3NQOA 4A69C 4FT8A 3MKLA 4LIVA 3WTXC 4C3HJ 1N75A 2EPFA 3O8HA 2ZXHA 4FTHA 2HVRA 1HW2A 3DTEA 3OYBA 4EATA 3DFGA 3FXUA 1CGPA 4CCOA 3BWGA 2E1MB 2ECCA 4CHUA 3OYFA 2BE5F 4M73A 5KHDA 2OZUA 1ZG5A 2ZJPF 1YJWI 2DA3A 2RKHA 2EWNA 2NS0A 2IS4A 4G6QA 3LAPA 4KICA 1H8AC 1ZG1A 1YO5C 2COBA 4UVCA 5ICFA 3TP3A 5D6EA 4G7OF 2LRDA 2Y2ZA 3SDGA 3RDIA 1MH4A 4DBQA 2PLYA 3M8FA 2R7VA 2K7LA 1E3PA 2XKOA 3Q3SA 4B47A 2FE3A 2K02A 2LVSA 4B09A 4IOCF 4DIQA 1D0XA 1UFMA 2XGEA 3DLAA 4B43A 2LF8A 4B44A 3E0JB 4CCMA 1MBJA 2RN7A 1DUXC 1XMAA 4KT5C 1Z91A 1V54H 3FKJA 2K27A 2W25A 3A4CA 3SZPA 4MO7A 2KQRA 2IXSA 4RB0A 1JHHA 1MMGA 4XONA 3CCEI 4A3BJ 1OR7C 3WTVC 5GAGJ 3GLLA 3CUQA 4IHYA 1P7IA 2KRFA 2M45A 1FX7A 4GXOA 2VJJA 2BVMA 4CZCA 1YIJI 1T8IA 5KAFC 2G7HA 1XD7A 3CZ6A 5LGUA 1ITYA 1RI7A 1T38A 3K0LA 2BHYA 3PSIA 3KP7A 2CW7A 4YG2F 4KN7X 2JSCA 5HNFA 5IPAA 2B63J 2P5KA 2WB1A 1TWFJ 3BOQA 4GFBA 1FYMA 3N4MA 1D3YA 4UNOA 3HKZA 4RA2A 5F64A 3DU5A 3GTGJ 1U78A 1YTYA 3I9V2 4MEXF 4ESBA 4CXFA 3MZ8A 1RKWA 1FYKA 4Q5SF 3ZQFA 2XDVA 3A1YA 1G2HA 1X3WB 1Y6IA 3OYNA 1WJEA 2BV6A 2CUFA 1P4WA 3IAS2 3MKWB 1R1UA 2GAUA 2O6GE 4E7JA 2HWVA 4XN0A 4LLLA 2CMPA 3KP2A 4A3FJ 1WHUA 4IQJA 4HQEA 3S3MA 2ID6A 2EINH 2JUGA 4YIRX 1YE9A 4A93J 5M5YJ 4OIQF 5D4RA 2ETHA 2BYVE 1OKRA 3AG2H 2P5VA 5F27A 2FOKA 3S8PA 3I3LA 3T1BA 2MA3A 3DQVC 2DOAA 3WHBA 5K7FA 3HKZN 2L3DA 3CC2I 3BQZA 1FSHA 4IZZA 2ZXIA 2CV0A 4KJZA 4IHWA 1IO2A 2JA5J 3K4LA 4RB3C 3CCMI 1R71A 3H5RA 4IOAF 1T0FC 2QA4I 2L7ZA 3G71I 1I50J 5EGOA 1DQUA 4XBFA 5J4YA 4OMZA 4KYWA 3I71A 4NUBA 2EFNA 4WWCA 3FZVA 3I55I 2JVGA 9ANTA 3HGGA 3EYIA 3ML6A 3NEUA 1X1BA 2M1BA 3JAMZ 3H0DA 2FSWA 2HKOA 1WJ5A 4QTRA 1WH5A 1IXRC 3SXYA 4V2GA 4L5IA 2LFBA 2CSOA 2RDPA 1X2NA 3CC7I 1Z7LA 2XROA 3M1EA 3MCZA 1IV6A 4DYQA 1PUFB 2HPIA 2ELHA 4ON0A 1TW3A 4R8HA 2MBFA 3RKWA 2EFWA 3E5QA 2J5OA 1TT5B 2Z2SB 5EEAA 2YSRA 3GMEA 1IF1A 2M87A 1DU6A 1GLNA 4II3A 2Z3YA 3K4MA 1A6QA 5E79C 2VQGA 5LHHA 4YFKF 3GTJJ 4H0EA 1FOXA 3IH2A 3Q5FA 2JTVA 5FLVA 1KU3A 2CRGA 3WGIA 1VFCA 1K4TA 2Q0OA 2VB6A 2E1MC 2UZKA 5CVVA 1LB2A 4L9JA 1ZELA 1AKHB 4HPQA 2K3FA 1W36D 2YX4A 4IRHA 2Z9OA 1KQ8A 1FEXA 3T5XA 2ZO4A 2CYYA 1XMXA 2FXAA 2FBKA 1IRFA 2PBIA 3MZYA 2IBDA 1HLVA 3REOA 2ZMEA 3ERED 2Q8KA 1Z05A 2ESNA 2X1EA 1G3WA 1FOYA 1RC9A 2PX9A 2EIMH 2IS1A 4A3JJ 4WF2A 2RV8A 3P9CA 5IYDJ 1Y0NA 1YW7A 1ZN2A 3RYPA 3S1QJ 1KGSA 1UG0A 4HQMA 1VQPI 2EV6A 3R0JA 3IH3A 3KIOA 1AHDP 3RPQA 1VQLI 2XAJA 4CGZA 3I56I 1G3TA 3HOZJ 2K9QA 1XS9A 3FXRA 4KDPA 4CYCA 3A2KA 4U0YA 1RNLA 4I02A 2R7OA 5J8CA 2X4HA 3OS2A 2FD5A 1LFBA 1A36A 1RKTA 4UXNA 4ANJA 1N77A 2HFHA 2LC2A 3KP5A 4BXXJ 4IF4A 1XGMA 4G7HF 1ACIA 4P1WA 4HZFA 2OZ6A 1FC3A 1SFKA 1E17A 1XCVA 3MZHA 3J80Z 1MMNA 2DJIA 4I01A 2LKPA 1LEAA 3IWFA 1P7JA 1ZREA 4BJ6C 4CCJA 4ZYDA 2CQKA 2ECBA 2QSFX 2D1HA 4IHXA 1NK2P 4AM3A 3LFUA 2EK5A 3HUGA 3LSGA 2H8WA 3FXOA 4MTDA 2DK8A 4YELA 2F4OB 1BL0A 2KPMA 1BOBA 1P4XA 3HEFA 5B3SH 3LSRA 1XX5A 3GVAA 4P55A 4HF1A 2E71A 3ZMSA 2MLGA 3A02A 4KISA 3S1MJ 1X4PA 1YS6A 3SZGA 4Y52J 3EUHA 3L2WA 1SVMA 2I8DA 2W57A 3CO7C 2HNHA 1GVDA 3QOPA 2DT6A 1QZEA 2LY9A 4ZC3A 1H0MA 1JJ6C 1U9OA 3CF5F 4J00A 1QRYA 3W2AA 2K3PA 5AIQA 1U6GA 2CQNA 4KUMA 2QSHX 1U9NA 3QP6A 2ZSHB 1TP4A 1SVLA 1HW1A 3I59A 3LSHA 5ERIA 1BI1A 2DPDA 5M5WJ 2DYRH 1X1CA 1TBXA 3BPXA 1G4DA 2E60A 4ENNA 4Z6YA 1QO0D 1HDDC 2K9MA 4KN4X 3TMOA 1RR7A 2DBBA 2XPVA 2V9KA 3WTTC 5EG0B 4BQQA 4HNTA 2DMNA 3F8BA 3HRUA 4L9VA 2OD5A 1B59A 2HGCA 4N9IA 3OL4A 4WXCA 2X1DA 1JKPC 3GYHX 2CUZA 4DJAA 3BCBA 1REPC 3DP7A 4L9NA 3HXLA 3W3CA 3RTRA 3V42A 3K2ZA 1GUUA 1XGSA 5KNLA 2LBFA 2FQ4A 4RAYA 4LB5A 2JA6J 2LLKA 3KX2A 4FQGA 3RJPA 2V6EA 4BEHB 5GAHJ 2VUMJ 4H4KC 2GA2A 5J47A 3R60A 1GVJA 1GV2A 2VKEA 2W24A 3GZ6A 2H27A 2PJRA 2LREA 4F3QA 2HU9A 1OLTA 5HS8A 2HQNA 4EMSA 5DCMB 1WCMJ 4JX4A 1BC8C 4F52A 2QQAA 4M9ZA 3HOXJ 1BR4A 1LQ1A 2NVXJ 1KU2A 2L7MP 1ZYRF 3RPUA 3BR2A 4LD5A 1IDZA 3ONQA 2VT2A 1Y56A 1HSJA 4Q48A 3DKXA 3OOUA 1P92A 1Z0XA 2JSPA 3CMMA 4C2UA 1SD7A 3IV5A 2QQ9A 3JRCA 3F6OA 3FXJA 2IA1A 4HNUA 3BG5A 3MD2A 4BKXA 4LK0F 4OINF 1GXPA 2TCTA 5DYMA 2NS7A 4L5JA 4NC8A 3PO3J 3FBIB 2NAZA 1HQCA 2ZSIB 3KZIC 5A2QZ 1UHMA 2M2EA 2XAGA 1X1DA 3RCOA 1VZ0A 5LD2C 5ICCA 2CH0A 2XSJC 3BR0A 3KPHA 3U1KA 5LEKA 4AD9A 2R7RA 4K2EA 3QAHA 4M9XA 5J3LA 2R7WA 2M0CA 2DDAA 3NARA 2HDWA 5FKOA 3VFZA 4UUVA 4IRIA 5ICGA 2MD5A 1JHFA 4BXFA 3H35A 4CDGA 2GXAA 4RAZA 3AG4H 2EFQA 3AAFA 4JX6A 3E5XA 4GO1A 3WTUC 2JRMA 1ETKA 3KZZA 3W2VA 2EH3A 3CCYA 2GA1A 3FM5A 3QYFA 1W5CC 4NDLA 4ASNA 1UCRA 4U0WA 1TWAJ 2VC1A 5HLTA 2RVCA 2PMHA 3SHFA 2WY8Q 4U87A 2QF7A 2MC4A 2EB7A 2E2JJ 2I10A 2PEXA 4A6DA 1Z67A 2LMDA 3MMYB 3AL0C 3LA3A 1B9MA 3L1PA 2VXZA 5EZGA 2IGMA 3C2GA 2PN6A 4PJJA 3LSTA 1LPQA 2JUCA 1Y0UA 5AIPA 5EDNA 1JGSA 4ESFA 2VKDA 3IRQA 2O9LA 1HC8A 2Z33A 2CQXA 1VQNI 5DV5A 2JQ7A 3OYLA 3CMEI 2QEXI 2OUMA 1OISA 3CP2A 2HOEA 1E0EA 4YRVA 4BBRJ 1ETYA 1EH6A 2V26A 2F5DA 4RAGA 1R22A 2AS5F 1IDYA 2IGOA 2IGNA 3BC8A 2HZTA 2EV0A 4D9JA 3ZGKA 1X3UA 1BBYA 4C2MJ 3PNVA 5J1YA 1STZA 2O61A 2EV5A 2OCEA 1E3HA 5F1JA 1EA3A 1ZAOA 3WODF 2PG4A 1B72A 2STTA 4ZDOA 1D1BA 2XGCA 2VT3A 1TWHJ 2YX7A 1PVEA 3HSRA 3L7WA 3PQKA 3BG7A 3L2CA 3TL4X 3EPZA 3K10A 5L3FA 2BW3B 4ZTFA 3VYTB 3WU0A 1KU9A 2GIVA 3ZP5A 4KFCA 3QPTA 5J1RA 3TEDA 2PQ8A 4G94A 2A6EF 3S32A 1VQMI 2HXIA 3GEZA 5DUKA 4B3AA 3OSGA 4X0GA 5IP6A 2CV1A 2ZFUA 4NQWA 2YPRA 3SJMA 4XSZF 3MFKA 2VPLA 1R36A 2VQHA 4R1HA 2FEZA 3OYAA 4XMYA 2OF7A 1QBJA 1VI0A 3BZ6A 1ETXA 1Z3XA 2WC2A 1FOKA 4WXDA 2ACJA 1FY7A 1V55H 3H3UA 3N05A 5J1UA 4A3GJ 3TQNA 2KRHA 2B9SA 3ZRGA 2HYJA 4JX5A 2HOSA 3H5NA 1TW2A 5CVRA 5FKMA 4RLFA 1X1PA 2K9LA 4RB2C 1XN7A 1HF0A 3J7ZI 1A6IA 1RIOH 1KQ0A 1RESA 4XLHA 3KEOA 4CCNA 4IEJA 4MQVA 2CV2A 2G9WA 3KZYA 2EA4A 2R0QC 4A3MJ 2AXLA 1DU0A 4W1UA 3QPLA 3UNGC 3S3NA 2QYOA 2NVQJ 1I1SA 4ZZDA 2MFZA 1NH3A 1VTNC 5L3GA 4IHTA 1I3AA 1MDMA 4M3BA 1FMVA 5FKLA 3BTCA 2E2HJ 2O8KA 1FT9A 3PFIA 2EZLA 1POGA 4XIDA 4EGZA 1WJBA 1H89C 4OU0A 3VOEA 2ME0A 3U1DA 1ZTRA 4JQFA 1T56A 2V1UA 2XPWA 5D5UB 4RMNA 1W7PD 1FYLA 3IRRA 1OCZH 3WU2C 4AIHA 2DA1A 3CLOA 2CWEA 5FFXA 5K5OA 2HS5A 3OR2C 2NVYJ 1IN7A 3OIOA 4IVNA 1TNTA 3BR6A 4E7KA 2HTJA 2L4AA 2WB1N 4EVIA 3LWFA 3DU6A 1FTZA 2DK5A 3DEEA 2L9VA 4L9TA 3W6KB 3CCRI 1J0RA 3PSFA 1K78A 1X58A 3JREA 2AHQA 1O3RA 3GW2A 3JR9A 2FBHA 2ZMEB 3U9GA 4EM0B 4PJLA 5K7ZA 4CYDA 3K1NA 2XRNA 2H94A 2L9RA 3I54A 5HVQC 5HOOA 2GZWA 2K5CA 1U3EM 4BL0B 2K9NA 3BR5A 1D0YA 1Z77A 1IXSB 4A3KJ 2IA0A 2FRHA 5HLIA 4BYYA 5HLGA 5E3OA 4F55A 4II2A 2IS6A 2BW3A 3AG3H 1LEBA 2O7OA 4HX7A 3CC4I 2ZC2A 5JI6A 4OMYA 2R7TA 3WG7H 2XPUA 2CU7A 2BOLA 4Z2YA 5D8LB 1SFXA 4IX7A 3V8KA 2E2IJ 2OTJI 4PSXA 3TBIA 2Y75A 4JK1X 3KEYA 1S72I 2A69F 1OCOH 5DTDA 1I39A 1IJWC 2GWRA 2ZXWH 3UKGA 1X2MA 2P7VB 2DI3A 2UUZA 4FASD 1K4SA 4HV5A 4PGGA 3RSNA 1K83J 5KCMA 1CF7A 1NG7A 5GP9A 2K85A 2ZKZA 2KHMA 3LQQA 2BY2A 5J8FA 1LNWA 3SQNA 4AU7A 2JA8J 2BVLA 1OYWA 3H92A 4I7HA 4UUSA 4LLGF 2CQ7A 3DTIA 5FROA 3CMYA 2UV1A 4S04A 2YU3A 5J40A 3TW7A 2X85A 2GXGA 3KYCB 1Z7UA 4XR6A 1LJ9A 3E6CC 4LOCA 2DA5A 4F7ZA 2M5WA 2KFDA 4BE1A 1U8RA 1F4KA 2IT0A 1T6SA 2LYCA 2OU2A 5FB2A 4ENKA 4LB6B 2HPMA 5J6XA 2LSOA 2XGXA 2R5ZB 2DU9A 2L7KA 2RQPA 1OCCH 2W48A 4N9HA 4B1RA 1QZZA 3IC7A 2A5YB 2R7FA 3DTKA 2RGVA 5BNGA 3G6EI 2NXNB 1MSFC 3FHNA 2R5YA 1U5TC 5GTHC 5JLWA 4PFPA 2VBZA 5C4JJ 1T08B 3QWLA 4J19A 4BDYA 2O3FA 2R3SA 1O57A 4I09A 5CVIA 3U21A 3CD6I 2R92J 1LUJB 1MNMC 2M4GA 3U2RA 4KMFA 3A03A 3NWSA 2M9HA 3CLQA 4Y3OA 2E7XA 3S2WA 2VOOA 2IEKA 4NC7A 4DGWB 4U7BA 3GCMA 1O7LA 1IUYA 3ZQHA 3BG9A 3J7YJ 4C3JJ 5D5VB 2A05A 4E7SA 4G8XA 2V9VA 5H2FC 4R79A 2CGPA 2KZVA 5IY5H 2KIMA 4EV0A 1ODDA 2L01A 4I0BA 2X51A 2LDUA 3F21A 2VC0A 3KP4A 3QODA 1U5TA 2AQFA 2F5FA 5JFRA 1HKQA 2HYFA 2HVSA 4HAMA 1V5EA 2LD5A 1R5ID 2IA2A 1JUSA 3S2HJ 2LKXA 4XRSG 1I1GA 3DCFA 3EQLF 2L5QA 1I3QJ 3BR3A 3DXJF 4E70A 3K70C 3S2DJ 1EV7A 2E36A 2NNYA 3BJOA 3OYMA 4M3DA 2EA2A 3KFWX 3BR1A 4DZJA 5E8GA 2KDZA 2V1NA 3BQYA 1JGGA 1RZ4A 3WTSC 3CCJI 4ZDPA 3JAMK 2MG4A 2BGCA 2GIZA 5ED4A 4RDUA 2QVOA 3I4PA 3JW4A 1F36A 4HNVA 4KA4A 4E7ZA 2IW5A 1OMIA 1DP3A 1WJAA 3HOYJ 3K4CA 4M3EA 2XHKA 1WI3A 2WADA 3HSEA 2OPTA 3PL8A 4PJMA 3QYEA 1B1BA 2QWWA 1QHHD 1SD6A 4NB5A 3CCVI 2HQAA 5CJ9A 3PJRA 4G7ZF 1K79A 1G59A 2IGKA 2IAIA 2KISA 3I4MJ 5D4SA 1N78A 1GHCA 2WAEA 4LFUA 2P7CB 5M5XJ 4HG2A 4M72A 4C2TA 4M6VA 4C9YA 4ZYGA 5HODA 5TISC 4RM2A 3COAC 3JCUC 2L2OA 1Q1VA 1I6XA 3PUFA 3QP5A 4JYKA 3OOPA 2R7DA 2WAFA 3UR3C 5IT9Z 5L3EA 1BOAA 2A61A 5JHUA 3OYIA 4KITB 4PDKA 4ZTJA 3JTHA 1E3OC 1J75A 3EETA 3M9AA 2VLAA 1BC7C 5F6FA 1MMSA 3P9IA 4O5VA 2WAQA 4HA8A 1QNTA 2ISYA 3GO5A 2X6OA 1K61A 2W1OA 2BY1A 2QQ8A 4XLCA 1LDDA 3ASNH 3I53A 1V5GA 1UHSA 2OTLI 3CESA 1ZK8A 3E6DA 4AC0A 3PIOF 2EJRA 2HEOA 2L9NA 2FOWA 1ETOA 5K1YA 4PZJA 1WQ2A 2KKOA 2ZNYA 4AUXA 1FPQA 3CUOA 5E1ZB 1MBKA 3I5UA 3F23A 1XSXA 3S1NJ 5AONA 3CCLI 4EJOA 1LVAA 2KL4A 2MC3A 2Z16A 3D1NI 4IHVA 3VEPA 2VE9A 4I2OA 3M4OJ 5GPAA 4HV6A 1D1AA 1OQYA 4G9YA 2MH2A 3CJRB 3S14J 1J9IA 3VDXA 2BZTA 3RZOJ 3A01B 1T39A 2GM4A 2R7SA 5EZHA 2ZB9A 2ME6A 3I0TA 2V7FA 3BTIA 3KETA 2DXIA 3ISPA 3Q0UA 2DAOA 2VPRA 4AYBA 1JJ8C 3CJNA 4GRIA 4YFNF 4UB6C 2NVTJ 1FOWA 3K1PA 5CYVA 3RI4A 2DMTA 4WXHA 3JRGA 2YR2A 4M6YA 4E7HA 1ZGJA 1KONA 3GFJA 3C18A 3R6SA 1EKEA 1U5TB 4EM1A 1FZPB 2E19A 3W6VA 5E3NA 1PP7U 3ABKH 2D5VA 3H3VK 3TO6A 4XICA 2LKSA 1WSUA 1ZLKA 3E6BA 1MSEC 3PO2J 2R5YB 4FETA 3KE2A 2BBYA 2PI0A 3GXOA 2CFXA 2MSYA 3LNQA 1HDPA 3L2UA 5FLXK 2LBFB 4AVPA 1TT0A 1P6RA 1R5GA 1R4NB 3ASOH 3TDUC 4IQ4A 4P96A 5EJCA 4DBRA 3H36A 2JK3A 2I5UA 2NYXA 1YG2A 3QQAA 2DTZA 5LLQA 2X9DA 2VJ4A 3CO6C 5FRNA 1ON1A 2GBYA 5CQGA 3ABUA 3BDDA 3H0GJ 4HSRA 1MW7A 2XAUA 4CZZA 5BMZA 2QBYA 4WK8F 1MNDA 1B9NA 2CG4A 1AU7A 4RLQA 4XOPA 4OOIA 1RUNA 4L0ZB 1MD0A 2IPQX 2GQQA 4ZYEA 1XC5A 4IHSA 2CS3A 2X6WA 2C6YA 2M0MA 4Y15A 1R9TJ 5JVGF 3WTWC 1R4MB 1E2XA 2Y0SA 2XF5A 4HYEA 4JP0A 2XKPA 5FKKA 3HOWJ 3F8NA 3C1DA 3BP8A 5HNHA 2EQRA 5H6RA 5FJ8J 5GADJ 2Z5UA 2M7BA 4GYGA 1AA7A 1MJAA 2FQ3A 3WTYC 5EF6A 2VL8A 1FWZA 3LL7A 4OIPF 1BIBA 1XPXA 4RB1A 1SMYF 2VKVA 2PJRB 2G0EA 4FX4A 2JN6A 1BW5A 2VBWA 3S93A 1I27A 2VN2A 3L00A 2ELKA 5K7HA 5K5QA 4U0VA 1Y1VJ 4CA0A 2CW0F 4BDZA 1YS7A 2P4WA 1R00A 2ESHA 3C7JA 3VWBA 2ZMEC 4XORA 4MHGA 5CVJA 2GXBA 1MDMB 3M07A 4V19K 2BY0A 3HOTA 5LRSA 2E5ZA 2WTEA 3VYRB 2AO9A 1O4XA 3KYLA 5H20A 2Q2EA 4V2FA 4BAYA 2OA4A 4GCVA 4A3LJ 1RETA 4MLOA 4N4NB 4CO8A 1QVUA 1R58A 1SD5A 2Y0MA 4YIIA 2PMZA 3A01A 1UHWA 2VE8A 3RIRA 3G1MA 2DFFA 2VXDA 2EZIA 5IT3A 3I58A 4XNFA 1U8BA 4Y7NJ 1T98A 2F5CA 3TDZC 3BG6A 3CDLA 5DD8A 1ONVA 2KIUA 5FFZA 3OYCA 1WGXA 1TC3C 1Z6TA 3V7RA 4FHTA 1T33A 1IZ1A 2VJIA 3TOAA 4JOMA 1LKXA 1Y39A 1TQPA 3DBRB 3B02A 4BE2A 3H5AA 1IRXA 2Z99A 1WPKA 2NVUB 2AQEA 2QCOA 4AIJA 4CH7A 1K78B 1JTXA 2LK2A 3LSKA 1PYVA 3K2AA 2E35A 1B4AA 3BG3A 1LE8A 5FRMA 3ABMH 3RZDJ 1H88C 1UJ8A 3CUQB 4EJWA 1G6NA 2XB0X 4FE4A 4A3DJ 3MEXA 1ZRCA 1UB9A 2W84A 1EH8A 4B48A 3HSFA 4HX8A 2WY7Q 1ULYA 4PJNA 4KIGA 1BI3A 5HDKA 2DMQA 3WGGA 2R7ZJ 2IS2A 4EQQA 4E7IA 1FTTA 4XRMA 1UAAA 4BHPA 2L9SA
chains in the Genus database with same CATH topology
1QGPA 2P5LC 3OYKA 5JVTA 4XN3A 4A6EA 2ZCWA 1F5TA 5LRRA 1KU7A 1WRJA 1L3LA 1J59A 2W00A 2NOJB 5LGTA 1D0ZA 3P7NA 1W5TA 4A5NA 4I98B 3HHGA 2XC7A 3OL3A 4GYIA 3ZN1A 2ZBKA 4DNCA 3G3ZA 2A5WA 3CJQB 2QUFA 3ZN0A 4LK1F 2XVCA 4HF2A 1R5HA 3HIFA 3Q9VA 5FLXZ 3W2WA 3LA7A 5DEQA 2IVMA 2DO7A 3SZTA 3M1CA 2FUG2 2DLLA 3FM3A 1XB4A 1Z3YA 4J01A 3LFKA 3HHHA 4XLAA 4I0AA 4LMYA 4BH9A 3VODA 4QPQA 4XKVA 4NQWB 4LG0B 1OR7A 1XDUA 2QENA 2F5VA 1H9TA 2W7NA 2ZNZA 1X1AA 3CP8A 3FMRA 1YX5A 1K6OA 2DQRA 1XSDA 3ZPLA 3V7CA 4L18B 4HBLA 2KRCA 5CPRB 3K4JA 1T2KA 1Z21A 1P4AA 1YIOA 3GF2A 1DP7P 1AWCA 1HW5A 1IN4A 1BM9A 4Q47A 4M6XA 4HF0A 5D6FA 4F91B 3LMMA 4RGUA 4KMUX 4A0YA 1MJ9A 1S9HA 3QPHA 1QU3A 4PGHA 3ZCOA 1B6AA 3G73A 1YFHA 1MNEA 1X4OA 1R1VA 2VASA 2MD0A 1V5FA 3FDYA 1XDSA 3EDPA 2EFOA 4IPAA 1Q1HA 3G2BA 3QOEA 1TQIA 4XSXF 5BQTA 1YYVA 3OWTA 4OAZA 3C2HA 4HX4A 1W7PA 5HS7A 2HDCA 1G3SA 2ELJA 2HVQA 4KIFA 4EJVA 3HPGA 4CCLA 4U7DA 3HC7A 3SFZA 4ETSA 4BNCA 1XCBA 4IKFA 2Z1DA 2DW4A 3TO9A 1J2XA 5BOXA 1ON2A 4BHBA 5JR3A 1V3FA 1R7JA 1PP8F 1HKTA 2P6SA 3MKZA 2E1CA 1DPRA 2XIGA 1SD4A 1J7KA 2LG4A 1SMTA 5KVRA 4OWRB 1H9GA 3AL0B 1WJFA 5LGNA 3VB2A 1Z9CA 4MGRA 4BQNA 5HDGA 3J81Z 3FMQA 3WE3A 1R23A 3WTZA 4ZH4F 4QWQA 3W6JB 5ILVA 2CW8A 5ILUA 2P6TA 3CF2A 5CLSA 3NWTA 1D8KA 2K4BA 4P9UA 1SAXA 4CSWA 3FF5A 2XAFA 1ZARA 5ILSA 3F6VA 4CCKA 2JT1A 2F2EA 2OQRA 4PSWA 5DDGA 2B0LA 4LITA 1XGOA 2HZDA 2RNGA 2JA2A 2X1CA 2HKXA 1TZLA 3R4KA 3MKYB 3M8JA 2A3SA 4RGXA 2VQLA 4OIRF 2QKLB 3OYHA 3KCCA 2G7UA 5TGTA 4EJTA 3MAJA 4CICA 3DV8A 3F72A 3GFMA 2M7AA 1SAUA 1MJBA 5EEGA 3BLYA 4XLFA 5LBQA 3D5SC 2XAHA 4NHJA 5E8IA 4E4HA 3QU6A 3GFLA 3DF8A 2VBXA 1K7AA 1HKSA 2EFPA 4LG0A 2NRAC 2WA0A 5TJJA 3H9GA 4N0BA 4IJAA 3TKYA 3O3KA 5DCFA 2BEOA 3ZMVA 2DFIA 3K4BA 1ZGAA 4XKWA 2QM3A 4O6JA 3QRFF 3J7AY 1USTA 4G6TB 1HA8A 3BJ6A 1FP1D 3RKYA 2XASA 2RNJA 3AKZA 3C3WA 4OIOF 5LHGA 4BEHA 3QYBA 2KIFA 1LDKB 3Q9SA 4XLEA 3F3XA 2CUJA 2HQRA 4RGSA 1WKMA 2W85A 4LJZF 4BHCA 5H6QA 4DQ2A 3FHZA 2HR3A 3L2RA 4HEA2 2W4SA 3ECHA 4A5MA 4PK4A 1EH7A 5F1RA 1Z1DA 1SFEA 1TTYA 3LSMA 1TQMA 4BQAA 1SFUA 3PUBA 2M3AA 3F8FA 2V6CA 2M30A 3GBGA 3WE2A 3FMSA 5E1XA 3EUKL 1LFPA 1BR2A 1FLIA 1S7OA 3SDBA 2J5PA 3OR1C 2LH9A 6PAXA 3ULQB 5D5XB 3SEQA 2XAQA 3R61A 3I64A 4XKCA 1PDNC 2IRFG 4RGRA 2M8EA 4MNUA 2A07F 1O3QA 1IRGA 4HOBA 2PJPA 3IL2A 4Y4RA 3M7GA 2JVHA 4HDVA 3EYYA 3O6BB 4PUSA 2VQCA 3CUQC 2IJLA 2JPBA 3CDHA 2O03A 4A2UA 1ZH5A 2OBPA 1DPUA 2PMUA 4F93B 2LF7A 2KMUA 3F22A 3BROA 2XV4S 1BIAA 4UV8A 5A2QK 2X6XA 2O8XA 3H3ZA 1TLHB 3SYTA 1R6RA 3DEUA 3MWMA 2LNBA 3BPVA 5FO5A 2E1NA 3BY6A 2JPCA 2NNNA 2DCEA 1T95A 2VBYA 1F1ZA 1QZYA 2FMYA 4Y13A 5HS9A 2UXNA 4E7LA 2L02A 3H9QA 1BI2A 2FNPA 1L0OC 2FMLA 3HYIA 2R7XA 5FGMA 3ECOA 1J09A 4TV7A 2MH9A 4U88A 2X0LA 3VYUB 5JHFA 3EUAA 3GUDA 3RQ4A 1W4MA 2Q1ZB 4ESJA 3HL2A 2VODA 1DGRM 3FBNB 1P9QC 3PFYA 5E1WA 3BCAA 2ISZA 4UVAA 4EGYA 1MZBA 1AOYA 2CO5A 4ZDLA 3ELKA 3J81K 2UWMA 5BPDA 1ZG3A 3S3OA 4Y17A 3ZMUA 2E7WA 5CVUA 3HTUA 3J7AO 2KLOA 3OYJA 3ZMTA 2R7UA 2JRTA 3GWZA 1GXQA 2CFOA 3E97A 5KK1A 2O0YA 3SEZA 4M71A 4RM3A 3K4NA 1JI8A 4HLXA 1D5VA 1WJCA 2GOXB 3VSKA 4WCGA 1S29A 5EEHA 4M9SA 4XLPF 2P8TA 4LG3A 3H9JA 3ZMDA 1F9NA 2FBIA 3F8CA 1IN5A 3PQJA 4XKBA 3DPUA 1X19A 1CF7B 2STWA 1QHGA 4HSTA 4XLNF 4MTEA 1LVKA 3IAM2 2H6BA 4HDUA 3OS0A 5DD4A 3IHUA 1QPMA 3IKVA 2F6CA 1OYIA 2RQQA 1IN8A 3HUGB 5HLHA 2WV0A 3D0SA 4G6DA 2VOPA 4ZZLA 2F4IA 4ZYAA 1WWXA 4ZJZA 4PFOA 3HTSB 1YW8A 2HYGD 2XF6A 1DGWY 3IP4B 4M74A 4D0PA 4AVZA 5E17F 3DKYA 2VIXA 2K86A 3E1SA 2V1DA 4BS9A 3ZR8X 2TDXA 2ADUA 1W5SA 1OYYA 4OAYA 3QU3A 5L3DA 4KIBA 3J80K 1NHAA 2K4JA 1HSTA 3LA2A 1W36C 1C0WA 2H09A 3K9TA 1KYZA 5D8KB 1KYWA 3N97A 5LHIA 4XM3A 2MLKA 4ZYHA 3OIPA 1ZHFA 2OQGA 1DDNA 4EJUA 1BJAA 3IWZA 2W82A 3B73A 3OMYA 3JSPA 3KP6A 3DKWA 5HDNA 1UELB 4XQFA 1MGTA 4HW0A 1P2FA 2ZJ2A 5FD6A 1LDJA 1K6YA 4UVBA 2P0WA 3HPHA 3HG9A 3WG9A 1IAWA 3DWLE 2KJBA 3OS1A 2ZFWA 4A12A 3LSIA 5LEJA 2KDOA 1IXCA 1ZRDA 5LFAA 4XRFA 3KP3A 3D5RC 3NRVA 3OYEA 1ERDA 2A6TA 3OYGA 3GX4X 2VONA 3E3VA 2QZ8A 4N4OB 1MMAA 4KT6A 2Y48A 4B3XA 4BGDA 3TGNA 1S8NA 1YQAA 2V1XA 5IT9K 4YFXF 2JZYA 4EM2A 1YX3A 5ICEA 1IW7F 1BI0A 3IUOA 2LY2A 3ZXSA 5CQEA 3M8EA 4WX9A 3RYRA 4IXAA 2A68F 2FU4A 1PJRA 1J5YA 1S6LA 3JSOA 4Y33A 3IKTA 3PNYA 3P9KA 1S7AA 4MEYF 4HRIA 5FD5A 3V7SA 4BE0A 2DPUA 3T8RA 3O2PE 4P9FA 1O7FA 4IRGA 3WU1B 3CTAA 2FA5A 2KJCA 1O3SA 5DCMA 3LAJA 1WJDA 5L3BA 3VSLA 4LLNA 5L3CA 2WWYA 2HTSA 1XMKA 3FXQA 1R1TA 3K6GA 2UXXA 5E20A 2H6CA 3F8MA 4BUPA 3V8JA 2ZXJA 4B8XA 2M4KA 4HLYA 2FF4A 1OPCA 3JTGA 5BS6A 1G8XA 1O3TA 3TOBA 2QKMB 3L2VA 1T0FA 4ENMA 1WFXA 4BQOA 4LGWA 1IN6A 3T0YA 4GGGA 3KLOA 4L0YB 1JXSA 5D5WB 4XOTA 1JE8A 1YLFA 2L54A 4C30A 1ZLJA 4D1QA 1BR1A 2MYSA 5CKTA 1D8JA 4PCQA 1G3YA 4YIFA 4UV9A 3K70D 3E6MA 3HRTA 4QLCU 2R7QA 3K4KA 3RPUD 1KQ9A 2D45A 2LY1A 3E5UA 4BXUA 3PNTA 3KLNA 4JBAA 2E5NA 4A0ZA 3GFIA 3V4GA 4BJTA 1QQIA 2DQLA 3ROUA 4FX0A 1FBSA 2LOOA 3T8TA 4F92B 1WI9A 4DOZA 3ZQ7A 3OIQA 1D1CA 2RREA 1HBXG 4ITVA 1W7PB 2KP6A 4MQ9F 1U0JA 1MKMA 2X6YA 2FNAA 1FMWA 1PUEE 2R4GA 1USSA 3D5LA 3K69A 4BU2A 4CUGA 3DPLC 4NNJA 2QBYB 3I59B 4XL9A 1V4RA 4Q4ZF 3GZ5A 2QQBA 1RUOA 3KEQA 2DT7B 3F9KA 2OC6A 1FBQA 3ABTA 3OY9A 3ZMZA 2QLZA 2VKHA 3L9FA 1HXDA 3VYSB 3TO7A 4S05A 1A04A 5TRDA 1FNNA 4P5OA 4UHTA 3R0AA 3RKXA 4QPOA 3HRSA 2V4JC 4RS8A 2WBMA 4A0XA 1YW9A 2OV7A 1I5ZA 4AWXB 3LQRA 5BPIA 4O3MA 1FBUA 4KNYA 3ZQQA 4BJ5C 5K5RA 2D1VA 2VJ5A 4LIUA 2V79A 3AFHA 3WGHA 1TNSA 3OV8A 3FX3A 3OYDA 1FP2A 3HOSA 1S3JA 3GLXA 2XUBA 2GOMA 3EUHC 1NG6A 2Q2EB 2D2WA 2L4MA 1KA8A 2PFBA 3FWEA 2COMA 4YEJA 3K1MA 2OAZA 4E6KG 2DTRA 2XF7A 2MABA 3V8LA 5DUIA 3HRMA 4ENJA 2F5EA 3BJAA 1U2WA 2A6HF 1ZRFA 3L09A 3MQ0A 1FSEA 2IP2A 3L2QA 1BN5A 1XGNA 2RC4A 5E18F 2O5RA 3DPTA 1MMDA 2DT5A 4AIKA 1XSVA 1Z6RA 4BACA 3NQOA 4FT8A 4LIVA 3WTXC 1N75A 2ZXHA 2HVRA 1HW2A 3DTEA 3OYBA 4EATA 3DFGA 3FXUA 1CGPA 4CCOA 3BWGA 2E1MB 4CHUA 3OYFA 2BE5F 4M73A 5KHDA 2OZUA 1ZG5A 2RKHA 2EWNA 2NS0A 2IS4A 4G6QA 3LAPA 4KICA 1ZG1A 1YO5C 4UVCA 5ICFA 5D6EA 4G7OF 2LRDA 4DBQA 3RDIA 2PLYA 3M8FA 2R7VA 2K7LA 2XKOA 4B47A 2FE3A 2K02A 4B09A 4DIQA 1D0XA 1UFMA 3DLAA 4B43A 2LF8A 4B44A 3E0JB 4CCMA 2RN7A 1DUXC 1XMAA 4KT5C 1Z91A 3FKJA 2K27A 2W25A 3SZPA 3A4CA 2KQRA 2IXSA 4RB0A 1JHHA 1MMGA 4XONA 1OR7C 3WTVC 3CUQA 2KRFA 2M45A 1FX7A 4GXOA 2VJJA 2BVMA 4CZCA 2G7HA 1XD7A 5LGUA 3CZ6A 1RI7A 1T38A 3K0LA 3PSIA 3KP7A 4YG2F 2CW7A 4KN7X 2JSCA 5HNFA 2P5KA 2WB1A 3BOQA 1FYMA 3N4MA 1D3YA 4UNOA 3HKZA 5F64A 3DU5A 1U78A 1YTYA 4MEXF 3I9V2 4ESBA 4CXFA 1FYKA 4Q5SF 2XDVA 3A1YA 1Y6IA 3OYNA 1WJEA 2BV6A 3IAS2 1P4WA 3MKWB 1R1UA 2GAUA 2O6GE 4E7JA 2HWVA 4XN0A 4LLLA 2CMPA 3KP2A 4IQJA 4HQEA 3S3MA 2JUGA 1YE9A 4OIQF 5D4RA 2ETHA 2BYVE 1OKRA 2P5VA 2FOKA 3S8PA 3I3LA 3T1BA 2MA3A 3DQVC 2DOAA 2L3DA 1FSHA 4IZZA 2ZXIA 2CV0A 4KJZA 3K4LA 4RB3C 3H5RA 1T0FC 1DQUA 4XBFA 4OMZA 4KYWA 3I71A 4NUBA 2EFNA 4WWCA 3FZVA 2JVGA 3EYIA 3ML6A 3NEUA 1X1BA 2M1BA 3JAMZ 3H0DA 2FSWA 2HKOA 1WJ5A 1IXRC 3SXYA 4L5IA 2CSOA 2RDPA 2XROA 1Z7LA 3M1EA 3MCZA 2HPIA 2ELHA 4ON0A 1TW3A 4R8HA 2MBFA 3RKWA 2EFWA 3E5QA 2J5OA 2Z2SB 2YSRA 1IF1A 2M87A 1GLNA 4II3A 2Z3YA 5LHHA 3K4MA 2VQGA 4YFKF 4H0EA 3Q5FA 2JTVA 1KU3A 3WGIA 2Q0OA 2VB6A 2E1MC 2UZKA 5CVVA 1LB2A 4L9JA 1ZELA 4HPQA 1W36D 2YX4A 4IRHA 2Z9OA 1KQ8A 3T5XA 2ZO4A 2CYYA 2FXAA 2FBKA 1IRFA 2PBIA 3MZYA 3REOA 2ZMEA 3ERED 2Q8KA 1Z05A 2ESNA 2X1EA 1G3WA 2IS1A 4WF2A 2RV8A 3P9CA 1YW7A 1ZN2A 3RYPA 1KGSA 4HQMA 1UG0A 2EV6A 3R0JA 3RPQA 2XAJA 4CGZA 1G3TA 3FXRA 4KDPA 3A2KA 4U0YA 1RNLA 4I02A 2R7OA 5J8CA 2X4HA 3OS2A 4UXNA 4ANJA 1N77A 2HFHA 2LC2A 3KP5A 4IF4A 1XGMA 4G7HF 4P1WA 4HZFA 2OZ6A 1FC3A 1SFKA 1E17A 1XCVA 3MZHA 3J80Z 1MMNA 2DJIA 4I01A 2LKPA 1LEAA 3IWFA 1ZREA 4BJ6C 4CCJA 4ZYDA 2CQKA 2D1HA 3LFUA 2EK5A 3HUGA 3LSGA 4MTDA 2DK8A 4YELA 2KPMA 1BOBA 1P4XA 3GVAA 4P55A 4HF1A 3ZMSA 2MLGA 4KISA 1X4PA 1YS6A 3SZGA 3EUHA 3L2WA 2I8DA 2W57A 3CO7C 2HNHA 3QOPA 2DT6A 4ZC3A 1H0MA 4J00A 3W2AA 2K3PA 5AIQA 1U6GA 4KUMA 3QP6A 2ZSHB 1HW1A 3I59A 5ERIA 3LSHA 1BI1A 2DPDA 1X1CA 1TBXA 3BPXA 1G4DA 2E60A 4ENNA 1QO0D 4KN4X 2K9MA 3TMOA 2DBBA 2V9KA 3WTTC 4BQQA 4HNTA 4L9VA 3F8BA 3HRUA 2OD5A 1B59A 2HGCA 4N9IA 3OL4A 4WXCA 2X1DA 3GYHX 2CUZA 4DJAA 3BCBA 1REPC 3DP7A 4L9NA 3HXLA 3RTRA 3W3CA 3V42A 3K2ZA 1XGSA 5KNLA 2LBFA 4RAYA 4LB5A 3KX2A 2V6EA 3RJPA 4BEHB 4H4KC 2GA2A 3R60A 1GVJA 3GZ6A 2H27A 2W24A 2PJRA 2LREA 4F3QA 2HU9A 1OLTA 5HS8A 2HQNA 4EMSA 5DCMB 1BC8C 4F52A 2QQAA 4M9ZA 1BR4A 1LQ1A 1KU2A 1ZYRF 3RPUA 4LD5A 3ONQA 2VT2A 1Y56A 1HSJA 4Q48A 3DKXA 3OOUA 1P92A 2JSPA 3CMMA 4C2UA 1SD7A 2QQ9A 3F6OA 2IA1A 4HNUA 3MD2A 4LK0F 4OINF 1GXPA 5DYMA 4L5JA 4NC8A 3FBIB 2NAZA 1HQCA 5A2QZ 2ZSIB 1UHMA 2XAGA 1X1DA 3RCOA 1VZ0A 5LD2C 5ICCA 2CH0A 2XSJC 5LEKA 4AD9A 2R7RA 4K2EA 3QAHA 4M9XA 2R7WA 3VFZA 2HDWA 4UUVA 4IRIA 5ICGA 2MD5A 1JHFA 4BXFA 4CDGA 3H35A 4RAZA 2EFQA 3AAFA 3E5XA 4GO1A 3WTUC 3KZZA 3W2VA 2GA1A 3FM5A 3QYFA 4ASNA 1UCRA 4U0WA 2VC1A 5HLTA 2RVCA 2PMHA 3SHFA 2WY8Q 4U87A 2MC4A 2EB7A 2PEXA 4A6DA 3MMYB 3AL0C 3LA3A 1B9MA 2VXZA 2IGMA 3C2GA 2PN6A 4PJJA 3LSTA 1Y0UA 5AIPA 1JGSA 4ESFA 3IRQA 2VKDA 2Z33A 5DV5A 3OYLA 2OUMA 3CP2A 2HOEA 1E0EA 4YRVA 1EH6A 2V26A 2F5DA 1R22A 2AS5F 2IGOA 2IGNA 3BC8A 2HZTA 2EV0A 4D9JA 3ZGKA 1X3UA 1BBYA 3PNVA 2O61A 1STZA 2EV5A 1EA3A 1ZAOA 3WODF 2PG4A 4ZDOA 2STTA 1D1BA 2VT3A 2YX7A 3HSRA 3L7WA 3PQKA 3BG7A 3L2CA 3TL4X 3EPZA 5L3FA 3K10A 4KFCA 2BW3B 3WU0A 3ZP5A 1KU9A 2GIVA 3VYTB 4ZTFA 3QPTA 2PQ8A 4G94A 2A6EF 3S32A 3GEZA 5DUKA 2CV1A 4X0GA 2ZFUA 4NQWA 2YPRA 4XSZF 3MFKA 2VPLA 1R36A 4R1HA 2VQHA 2FEZA 3OYAA 4XMYA 1QBJA 3BZ6A 1Z3XA 2WC2A 1FOKA 4WXDA 2ACJA 1FY7A 3H3UA 3N05A 3TQNA 2KRHA 3ZRGA 3H5NA 1TW2A 5CVRA 4RLFA 2K9LA 4RB2C 1XN7A 1RIOH 1KQ0A 4XLHA 3KEOA 4CCNA 4MQVA 2CV2A 2G9WA 3KZYA 2EA4A 2AXLA 3UNGC 3S3NA 2QYOA 1I1SA 4ZZDA 2MFZA 1VTNC 5L3GA 4IHTA 1MDMA 1FMVA 1FT9A 3PFIA 4EGZA 1WJBA 4OU0A 3VOEA 3U1DA 4JQFA 2V1UA 5D5UB 4RMNA 1W7PD 1FYLA 3IRRA 4AIHA 3CLOA 2CWEA 5K5OA 5FFXA 2HS5A 3OR2C 1IN7A 4IVNA 1TNTA 4E7KA 2HTJA 2L4AA 4EVIA 3LWFA 3DU6A 2DK5A 3DEEA 4L9TA 3W6KB 1J0RA 3PSFA 1K78A 1O3RA 3GW2A 2FBHA 2ZMEB 3U9GA 4EM0B 4PJLA 4CYDA 3K1NA 2XRNA 2H94A 3I54A 5HVQC 5HOOA 2GZWA 1U3EM 2K5CA 4BL0B 1D0YA 1IXSB 2IA0A 2FRHA 5HLIA 4BYYA 5HLGA 4F55A 4II2A 2IS6A 2BW3A 1LEBA 4HX7A 5JI6A 4OMYA 2R7TA 2BOLA 4Z2YA 5D8LB 1SFXA 4IX7A 3V8KA 4PSXA 3TBIA 2Y75A 4JK1X 3KEYA 2A69F 2GWRA 2P7VB 2DI3A 2UUZA 4FASD 4HV5A 4PGGA 3RSNA 5KCMA 1CF7A 1NG7A 2ZKZA 2KHMA 3LQQA 5J8FA 1LNWA 3SQNA 4AU7A 2BVLA 1OYWA 3H92A 4I7HA 4LLGF 5FROA 3DTIA 4S04A 2UV1A 2YU3A 2X85A 2GXGA 1Z7UA 3E6CC 1LJ9A 4XR6A 4F7ZA 2M5WA 4BE1A 1U8RA 2IT0A 1F4KA 1T6SA 2OU2A 2LYCA 5FB2A 4ENKA 4LB6B 2HPMA 5J6XA 2LSOA 2XGXA 2DU9A 4N9HA 2RQPA 2L7KA 1QZZA 3IC7A 2A5YB 2R7FA 3DTKA 2RGVA 3FHNA 1U5TC 4PFPA 2VBZA 4BDYA 2O3FA 2R3SA 1O57A 4I09A 5CVIA 3U21A 2M4GA 3U2RA 4KMFA 3NWSA 4Y3OA 2E7XA 3S2WA 2VOOA 4NC7A 4DGWB 4U7BA 1O7LA 1IUYA 5D5VB 4E7SA 4G8XA 2V9VA 2CGPA 4R79A 2KZVA 2KIMA 4EV0A 1ODDA 2L01A 4I0BA 2X51A 2LDUA 3F21A 2VC0A 3KP4A 3QODA 1U5TA 2AQFA 2F5FA 5JFRA 1HKQA 2HYFA 2HVSA 4HAMA 1V5EA 2IA2A 1I1GA 3EQLF 2L5QA 4E70A 3DXJF 3K70C 1EV7A 2NNYA 3BJOA 3OYMA 2EA2A 3KFWX 5E8GA 2V1NA 1RZ4A 3WTSC 4ZDPA 3JAMK 2BGCA 5ED4A 2QVOA 3I4PA 3JW4A 4KA4A 4E7ZA 2IW5A 1OMIA 1DP3A 1WJAA 3K4CA 2XHKA 2WADA 3HSEA 3PL8A 4PJMA 3QYEA 1B1BA 2QWWA 4NB5A 1SD6A 1QHHD 2HQAA 5CJ9A 3PJRA 4G7ZF 1K79A 1G59A 2IGKA 1GHCA 1N78A 5D4SA 2WAEA 4LFUA 2P7CB 4HG2A 4M72A 4C2TA 4C9YA 3COAC 4ZYGA 4RM2A 2L2OA 1I6XA 3QP5A 3OOPA 2R7DA 2WAFA 5IT9Z 3UR3C 5L3EA 1BOAA 2A61A 5JHUA 3OYIA 4KITB 4PDKA 4ZTJA 3JTHA 1J75A 3EETA 3M9AA 2VLAA 1BC7C 5F6FA 3P9IA 4O5VA 2WAQA 4HA8A 1QNTA 2ISYA 3GO5A 2W1OA 4XLCA 1LDDA 3I53A 1V5GA 3CESA 3E6DA 2EJRA 2HEOA 2L9NA 5K1YA 4PZJA 1WQ2A 2KKOA 2ZNYA 1FPQA 3CUOA 5E1ZB 3I5UA 3F23A 1XSXA 5AONA 4EJOA 1LVAA 2MC3A 2KL4A 2Z16A 3VEPA 2VE9A 4I2OA 4HV6A 1D1AA 4G9YA 2MH2A 1J9IA 3CJRB 3VDXA 1T39A 2R7SA 3I0TA 2V7FA 3KETA 2DXIA 3ISPA 2DAOA 4AYBA 3CJNA 4GRIA 4YFNF 3K1PA 5CYVA 3RI4A 4WXHA 2YR2A 4M6YA 4E7HA 1ZGJA 1KONA 3GFJA 3C18A 3R6SA 1U5TB 4EM1A 1FZPB 1PP7U 3TO6A 1WSUA 1ZLKA 3E6BA 4FETA 3KE2A 2BBYA 2PI0A 3GXOA 2CFXA 3L2UA 5FLXK 4AVPA 2LBFB 1TT0A 1P6RA 1R5GA 3TDUC 4P96A 4IQ4A 4DBRA 2NYXA 1YG2A 5LLQA 3CO6C 2VJ4A 5FRNA 1ON1A 5CQGA 3ABUA 3BDDA 4HSRA