3D5LA

Crystal structure of regulatory protein recx
Total Genus 74
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
74
sequence length
203
structure length
203
Chain Sequence
LAKISKIEAQKRKGRYNIYLDGKYAFPVAESVLIQFRLMKGTELDEKQIAAIATADQQAKAYSRMLDYLSYQMRTESDIVKKLKEIDTPEEFVEPILKKLRGQQLIDDHAYAASYVRTMINTDLKGPGIIRQHLRQKGIGESDIDDALTQFTPEVQAELAKKLALKLFRRYRNQPERRREQKVQQGLTTKGFSSSVYEMIKDE
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Regulatory protein RecX
publication title Crystal structure of DNA repair regulatory protein RecX.
rcsb
source organism Lactobacillus reuteri
molecule tags Signaling protein
total genus 74
structure length 203
sequence length 203
chains with identical sequence B
ec nomenclature
pdb deposition date 2008-05-16

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF02631 RecX RecX family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 3d5lA03
1.10.10.2800 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 3d5lA01
3J80Z 3E5UA 4GYGA 2H09A 4A12A 2ETHA 4HDVA 5F6FA 2XAJA 3M9AA 2HOEA 2NNYA 4NHJA 2IRFG 3HOSA 3JTGA 3M8EA 2STTA 5E17F 2DQRA 2VOOA 2IVMA 1FSEA 4RGXA 3R4KA 2IJLA 1IF1A 3GWZA 2OZUA 5KVRA 1KU3A 4ZZDA 4JQFA 1J59A 1BC8C 1PUEE 3GO5A 2L4MA 3ABUA 1FYLA 3TKYA 2VT3A 4EM0B 4Z2YA 2QENA 3ZMVA 2VC1A 2BEOA 1SD6A 4B09A 3JTHA 1W7PD 3HOTA 1GHCA 4BQAA 3WTYC 4O6JA 1T6SA 1R1UA 4OMYA 2KIMA 1SMTA 4BYYA 2EFNA 4F7ZA 4WK8F 3L00A 1KA8A 1O3RA 1H0MA 3LQRA 3FWEA 5H6QA 1IN4A 3RKWA 1U6GA 3MAJA 1FBSA 3K1PA 1O7FA 2FBKA 2HTJA 2GA2A 3KETA 3E5XA 1YFHA 4LLLA 3KP5A 2VBXA 1F1ZA 3M1EA 3KP3A 2OU2A 3WTXC 2K27A 1ZLJA 3O6BB 5BPIA 4U0WA 4MEXF 2RGVA 4UHTA 3GW2A 4ZYEA 2HR3A 5HDKA 5DD4A 2MLKA 4IHSA 1Z9CA 5LHHA 3HRSA 2WC2A 1B4AA 2Z9OA 4OINF 1KYZA 3HYIA 3C3WA 3FMRA 2UXNA 1FNNA 1FPQA 3I0TA 5LHGA 2QBYA 4CDGA 4IXAA 1O7LA 1C0WA 3EETA 3BOQA 1U78A 2XV4S 3F8BA 2FMYA 1Q1HA 2BBYA 2LSOA 3IWZA 3LFKA 5DUKA 3P9KA 2ZFWA 1Z91A 3BJ6A 2QBYB 2E7XA 1RZ4A 1ZH5A 4O5VA 3ROUA 1TLHB 1RI7A 4LMYA 4XSXF 4G8XA 1HBXG 2DO7A 3WGIA 1IZ1A 3U9GA 3QU3A 5D5WB 2UXXA 2RKHA 1YO5C 5BPDA 1XGSA 3E6MA 1FX7A 2OD5A 4GCVA 1U3EM 4U0VA 3FXQA 5KK1A 2XHKA 2COMA 2DAOA 3LSTA 1P4AA 2EJRA 1LVAA 3MCZA 2K7LA 2OA4A 1T38A 1ZG3A 5HLHA 2FRHA 3BROA 3COAC 4LB5A 1BI3A 4HLYA 3LA7A 1R7JA 1HQCA 2Q0OA 4UUVA 4RB0A 2ISZA 3FX3A 2Q2EA 1BOAA 2HEOA 4HX8A 2BGCA 3HHGA 4L0YB 1ULYA 2VC0A 3ELKA 3ZN1A 1T39A 4ETSA 2QLZA 2M87A 4PZJA 5ICEA 2IT0A 3JAMK 3F8MA 4I01A 1HSJA 2QQ9A 2CW0F 5E8IA 4G9YA 3TO7A 5FFZA 1FBUA 4UNOA 2LKPA 3BDDA 4YFXF 3QPHA 3JW4A 2QQAA 1DUXC 2Z3YA 4KUMA 4M6YA 4ZYHA 1JHFA 3M8FA 1Z6RA 1B9MA 1WQ2A 5H20A 2G7UA 1RUOA 4U88A 3L09A 3CUQC 2GXGA 1MKMA 2HKXA 3JAMZ 4LGWA 4M6XA 3I58A 2OAZA 4A0ZA 4KDPA 5K5RA 3F21A 1JHHA 5CVJA 1KGSA 4EJOA 1R1VA 1S6LA 5DYMA 2JT1A 3FM5A 2JPBA 2DLLA 4CHUA 5LEKA 1EH8A 2GWRA 1QPMA 1HKTA 2UZKA 3WU1B 4ENKA 2Z99A 1TW3A 1OPCA 5BS6A 3GEZA 2MH2A 4UV8A 3PFIA 4RGSA 2A69F 5L3FA 2CFXA 1GVJA 4A6DA 3DP7A 1JE8A 1MGTA 3K1NA 1MD0A 2NYXA 1YW8A 1IRGA 2VBWA 1YS6A 1ZHFA 1KQ9A 4YIFA 2YR2A 4MEYF 4A6EA 3RKYA 3L2CA 2K4JA 4WX9A 2RNJA 2XKPA 2DT5A 3WGHA 4OIPF 2PFBA 3HRMA 3FXUA 2JPCA 3R0JA 3U1DA 3W6JB 3FMQA 2EV6A 1CF7A 3ZMZA 4P5OA 4ESBA 1P6RA 3NQOA 4L9VA 4AWXB 1FT9A 1SFXA 4IRIA 5CJ9A 5AIQA 1RIOH 1J7KA 1IN6A 2L02A 4EVIA 4HV6A 4PGHA 1J5YA 1S29A 1I1GA 1QQIA 3Q9SA 5D8LB 4XRFA 4BHCA 1FSHA 4YG2F 1CF7B 3P9CA 3TDUC 2GZWA 3KZYA 3R61A 1OYIA 3GFMA 1W5SA 3I53A 3LWFA 4IPAA 4Y17A 3P9IA 4CXFA 1ZG1A 2IP2A 4NQWA 1B9NA 1YIOA 1REPC 2Z33A 2VONA 3ZMTA 3V7RA 3Q9VA 4HZFA 4D0PA 2BV6A 2EFWA 4S05A 1WSUA 2NRAC 3RTRA 3WG9A 3HTSB 2QZ8A 4EJWA 2CSOA 2OZ6A 2G9WA 3R6SA 2VOPA 1TBXA 4G6DA 2E7WA 2CYYA 5ILSA 2GIVA 2VBZA 4IRHA 2F5CA 1BIAA 3GLXA 5E20A 2W84A 3T8TA 4AVPA 4L18B 2WV0A 1RNLA 1TQMA 3DV8A 2EA4A 4HQEA 4FHTA 2CWEA 1V4RA 4ESFA 4KIGA 4E70A 4LG0A 3K9TA 1YS7A 4DQ2A 1O57A 3SZTA 4HF1A 1Z1DA 1HSTA 4P96A 3N97A 1WRJA 2XROA 1J0RA 2DK8A 2FNPA 4ENJA 4CO8A 4BXUA 1I5ZA 1P4WA 2PBIA 1UHMA 3V8LA 2AXLA 3ML6A 3I59A 2HS5A 3WE3A 2FXAA 4LG0B 4FT8A 1HXDA 5FD6A 4EM1A 1LB2A 5LRRA 4OOIA 2DPUA 1SAXA 3BY6A 2DPDA 3IRQA 2MC3A 4FX0A 2FNAA 2R3SA 4HOBA 3WU0A 3B02A 5CLSA 3I59B 5EEHA 2DTRA 2JTVA 3BPVA 3TOAA 3P7NA 2IA0A 3E6BA 3V4GA 4I0BA 4BH9A 3KP2A 5LRSA 3ZQ7A 5JI6A 2VT2A 3NEUA 2ZBKA 2FQ3A 1E17A 4KA4A 2HGCA 4OIRF 1PP7U 4M9XA 3AAFA 1S7AA 5BMZA 5ICCA 2V79A 1KU7A 2LDUA 1BBYA 2D1VA 3BWGA 3EQLF 5D4RA 2KJCA 4KN7X 2XAFA 3HSEA 4KFCA 4YIIA 2NNNA 1V3FA 1MJAA 3LAPA 1QZZA 1ODDA 3S2WA 5LBQA 4M73A 1SFUA 5HDNA 1EH6A 3GFLA 1FBQA 2A61A 5HS8A 2QVOA 3ZMSA 4HLXA 1ZYRF 1IN8A 2P8TA 2H94A 2MLGA 2QUFA 2HTSA 5DCMA 3RPQA 1BI0A 3EUHA 5BQTA 1BM9A 2F5FA 5LGTA 5FB2A 4OU0A 4MTDA 2M45A 2J5PA 3KFWX 1D8JA 3RPUA 4L0ZB 3MEXA 5DD8A 4RB3C 2LNBA 1B1BA 4R8HA 3RIRA 1SD4A 1G6NA 1FYKA 5CYVA 1KU2A 5DCMB 3SZPA 3D5LA 2PLYA 3L9FA 5LLQA 2NS0A 4KNYA 4NB5A 1OKRA 2O6GE 4Q4ZF 2L3DA 1HKSA 4Y15A 1J2XA 3V8KA 3BPXA 4L5IA 3FM3A 3QAHA 1FOKA 3I5UA 3FF5A 1HW5A 5D4SA 1XCVA 2A3SA 4I2OA 2FBIA 2RQPA 1XD7A 1SFEA 4RB1A 2GXBA 1XGMA 3ULQB 1D5VA 2O61A 3J81K 2Y0MA 3H92A 4ESJA 5DV5A 2ZXJA 1R36A 5HOOA 3KE2A 3LAJA 3GFJA 4ZZLA 1IW7F 4R1HA 4M71A 4KMFA 2JSCA 2HYFA 3F6VA 5F64A 1HW2A 2K02A 4FX4A 2M30A 4I7HA 5K5QA 3TOBA 4ZYGA 3WTSC 3DPLC 2OBPA 1TTYA 3RDIA 4BHPA 1YLFA 5HLGA 4G7ZF 4EQQA 3HRUA 5F1RA 5BOXA 4G94A 4EJVA 3H3ZA 3J81Z 1R5HA 3MWMA 3F6OA 3T8RA 4M74A 1WWXA 2M5WA 4HF0A 2E1CA 1IXCA 1LNWA 4WXCA 2RV8A 3DXJF 2TDXA 2IA1A 3EYYA 3MZYA 2A6HF 1USTA 2P5KA 2KJBA 3W6KB 4HW0A 4QLCU 4WCGA 1S8NA 3M7GA 1G3SA 4U7BA 1FLIA 3V8JA 1R58A 2ESNA 1D8KA 2HYGD 3WTTC 4IJAA 4BNCA 5D6FA 1YW7A 2CO5A 3HHHA 2PQ8A 2V9VA 3PQKA 4P9FA 2ISYA 3JSOA 3ZN0A 4I0AA 2XAQA 1I27A 1R5GA 4N0BA 4I09A 2D45A 2MD5A 1O3TA 2CG4A 2Q8KA 1HW1A 4EV0A 5FO5A 4WF2A 3VOEA 2FU4A 5LEJA 2WWYA 1OMIA 2VE9A 2ADUA 2GQQA 2EFOA 3LA2A 2MBFA 5E18F 1DPRA 1LDJA 4BAYA 2KRFA 1DPUA 1FP1D 1K78A 1XGNA 3O2PE 3TO9A 5HDGA 4CYDA 2VE8A 3V7SA 3GYHX 2ACJA 2P7CB 1YQAA 2XVCA 2FA5A 1XSDA 3WGGA 2XIGA 1J9IA 1R00A 2HDCA 3RYPA 1E2XA 1BIBA 5D5UB 2H6BA 1T98A 4LK1F 1O3QA 2Y75A 2OQGA 1K78B 1QNTA 3KEOA 3KP4A 4KIFA 3CO7C 2M8EA 4B8XA 1EV7A 2ZJ2A 4ZYDA 3CLOA 4MQVA 1P2FA 1K79A 1F5TA 3FXRA 5J6XA 4HF2A 2LF7A 1DDNA 2VBYA 2P4WA 3U2RA 4EMSA 1S3JA 2ZCWA 3E6CC 2ELHA 2HWVA 1XSXA 5AONA 2ZNZA 4YFNF 4Q47A 5D5VB 4G7HF 4OMZA 3G3ZA 3K2ZA 3B73A 2W25A 2EV5A 1L3LA 5LHIA 3K69A 2XKOA 2YU3A 2JZYA 3IWFA 5AIPA 4ON0A 4RB2C 2XUBA 2IA2A 5DEQA 4A0XA 1O3SA 2NAZA 4I02A 3GXOA 4OIOF 4WXDA 4PDKA 1S7OA 3E3VA 1FP2A 1ZRCA 1OR7A 4EJTA 4CGZA 2DFIA 1JGSA 2KIFA 4LB6B 1B6AA 2F2EA 1TQPA 4XLPF 1I6XA 5CVUA 3RJPA 4A5NA 3PQJA 2FMLA 4IRGA 1W4MA 2YX7A 1K7AA 3QRFF 5A2QK 3QP5A 1D3YA 3GUDA 4HDUA 4GGGA 2KKOA 1IXRC 1ONVA 1XN7A 2RDPA 4EJUA 3NRVA 5ICFA 2CGPA 2QQBA 4MQ9F 3FZVA 2RN7A 1F4KA 1FWZA 1R22A 4I98B 2YX4A 3T1BA 3IC7A 1BN5A 3WTWC 1U5TA 4HA8A 3QU6A 1CGPA 4AD9A 3DQVC 3ZP5A 2FSWA 2L01A 2EK5A 2YSRA 1FZPB 4RAZA 3K0LA 4O3MA 5L3GA 1STZA 4P9UA 2AS5F 2R7FA 5HS7A 2Y48A 1F9NA 3E97A 4KT5C 1U5TB 4U0YA 1ZRDA 3ERED 1J75A 4K2EA 2PMUA 3WTZA 2H6CA 5EEGA 1LEAA 3GZ6A 5IT9K 1USSA 2PG4A 2X0LA 3LQQA 1ON2A 3F72A 5JVTA 4H0EA 1QGPA 1ON1A 4N9HA 4LD5A 3OOPA 3J7AO 2FF4A 1W5TA 4Q48A 1VTNC 4IF4A 2E1NA 4HBLA 3F8NA 2EV0A 1QZYA 2W24A 5FD5A 2XGXA 4UVCA 1U8RA 2HFHA 2V6CA 3I64A 1XDUA 3H3UA 2VODA 5IT9Z 5ED4A 4QWQA 3JSPA 3IKVA 3ISPA 3I54A 2BE5F 5ICGA 5E1XA 3KP6A 5E1ZB 3IHUA 4R79A 2DK5A 3T0YA 4MTEA 1YG2A 2ZNYA 2DI3A 3GVAA 4N9IA 1ZLKA 2LF8A 4UVAA 3KLNA 2P5LC 1QBJA 5LGUA 4IVNA 2EFPA 1ZRFA 4WWCA 2D2WA 2PJPA 1RUNA 1ZARA 2O03A 5D6EA 3SQNA 1R23A 3SXYA 1KQ8A 1QO0D 1ZGJA 3I71A 3F8CA 5FLXK 4PCQA 4Q5SF 4EGZA 3CUOA 3F23A 2W57A 3FMSA 4M9ZA 3QOPA 5FGMA 5E1WA 3O3KA 3C1DA 4ASNA 2MA3A 1SMYF 1X3UA 3GZ5A 1H9GA 1WKMA 2ZMEA 3E5QA 2P6SA 5D8KB 5FLXZ 5TJJA 2C6YA 3KCCA 1FC3A 3OV8A 1XB4A 2JRTA 2FEZA 5IT3A 2V1UA 2ZMEB 4LJZF 1A04A 4M72A 1LDKB 5L3DA 4HX4A 4TV7A 3ZPLA 1HKQA 4LLGF 5J8FA 1IN5A 1BJAA 4ZH4F 4RGRA 2EFQA 3DEUA 1UFMA 5L3CA 4XLNF 1ZG5A 2XAHA 3HSRA 3T5XA 3IKTA 1ZREA 2CQKA 1FYMA 2EA2A 4ENNA 3DFGA 4UXNA 1AWCA 1BI1A 2FBHA 3F3XA 2W85A 4IHTA 3G73A 3HUGA 1Z6TA 1L0OC 1AOYA 1LEBA 1XDSA 2L54A 2QM3A 4YFKF 1MJ9A 1UHWA 1G3YA 3MQ0A 5ILVA 1ZGAA 1FY7A 1LQ1A 4HQMA 4MNUA 1Z05A 3DKWA 5HVQC 1IN7A 2DQLA 4EM2A 1MZBA 2B0LA 2P5VA 1BC7C 1TW2A 4OIQF 3WODF 4A2UA 4RGUA 1T2KA 1P92A 1K6OA 2XASA 1Y0UA 4LLNA 1YTYA 1OYYA 1ZN2A 1I1SA 4HX7A 2QYOA 4RAYA 2O8XA 2P7VB 3WTVC 3R0AA 3KEQA 2IW5A 2XAGA 3EYIA 3ABTA 2H27A 2A6EF 2DBBA 4G6QA 1T0FA 3QP6A 1BI2A 2QWWA 3CUQA 5JR3A 3HTUA 3K1MA 2STWA 2UWMA 4DNCA 3VFZA 4ENMA 1KU9A 3EDPA 1XSVA 3VODA 3CO6C 1YW9A 1YYVA 1G3TA 2V1XA 3MZHA 4P55A 1IRFA 2VN2A 3DF8A 4MGRA 3CUQB 3Q5FA 4Y13A 2ZKZA 2R7DA 3ECHA 3BP8A 2YPRA 3IRRA 4JBAA 5H6RA 3E6DA 5K5OA 3DPTA 1P4XA 4HAMA 4A0YA 5E8GA 4L9NA 5ILUA 2A68F 1DP7P 1SD7A 3VEPA 3GF2A 5ERIA 2PI0A 4AIJA 3IL2A 2RC4A 1IAWA 2Z5UA 1TNTA 2XRNA 4KIBA 5DUIA 1W7PA 3C18A 3TQNA 4WXHA 3WTUC 4KN4X 2GA1A 5D5XB 2HQNA 1R1TA 3HRTA 3KP7A 4XSZF 3D0SA 2K86A 4U7DA 1XCBA 3CTAA 3SFZA 3ECOA 1XGOA 4M9SA 2GAUA 4KYWA 1GXQA 5DCFA 3ZMDA 4LFUA 4GXOA 1GXPA 1W7PB 5DDGA 4AIHA 1JXSA 4L9TA 2IPQX 4A5MA 3N4MA 3TDZC 4CZZA 2O0YA 5JHUA 5J8CA 2J5OA 4L5JA 4EGYA 1TNSA 3MFKA 3GX4X 3SHFA 1UB9A 5JFRA 2PN6A 2HQRA 3C7JA 3R60A 2WTEA 2A5YB 2PEXA 1Z7UA 2V1DA 2HKOA 2G7HA 3QPTA 1OYWA 4LK0F 2O3FA 1IUYA 1PP8F 4PGGA 1XMAA 1MDMA 4HYEA 2FE3A 2FOKA 3KZZA 1LDDA 3F22A 5HS9A 4G7OF 2K4BA 3CDHA 3V7CA 4MHGA 5HLIA 3KLOA 3ZMUA 2HZTA 2OQRA 4HV5A 4GO1A 3TO6A 2P6TA 6PAXA 1MDMB 5LGNA 3BZ6A 1ZAOA 5CVRA 3CJNA 5K1YA 4L9JA 2DU9A 3HSFA 1SD5A 1PDNC 2X4HA 3WE2A 1G4DA 3L7WA 2L4AA 2EWNA 5CVVA 2M1BA 3I4PA 2A07F 3HIFA 4KMUX 2F5EA 1XMKA 4KICA 3F8FA 3BJAA 1U2WA 5L3EA 3RKXA 3BJOA 2VXZA 3TGNA 4XBFA 1G3WA 2EB7A 1LJ9A 2BYVE 1UCRA 1EH7A 4JK1X 3RI4A 2MH9A 2F5DA 2ESHA 3GFIA 1KYWA 4CICA 2DW4A 4UV9A 3J80K 2ZO4A 3LA3A 5A2QZ 4BHBA 1WI9A 1NHAA 5TRDA 1KQ0A 2D1HA 1U5TC 3REOA 5L3BA 4GYIA 4RS8A 1H9TA 3VB2A 1IXSB 5FFXA 4S04A 1TQIA 2KIUA 1MJBA 2PMHA 4AIKA 2RVCA 5CVIA 4UVBA 3RYRA 1B59A 3FHZA
chains in the Genus database with same CATH superfamily
1DGWY 1N78A 4NUBA 3J80Z 3E5UA 2PMZA 4PFPA 4BL0B 2HVRA 2Y9ZA 1YIJI 4GYGA 3JRHA 1IC8A 2F6CA 2H09A 1WPKA 4A12A 1KONA 1YE9A 5K7FA 2ETHA 2IS4A 4ZDPA 4HDVA 5F6FA 2W00A 2H1KA 1UELB 2XAJA 3M9AA 2GOMA 3FXMA 2HOEA 2NNYA 4NHJA 2IRFG 3HOSA 3JTGA 3M8EA 5LD2C 4NC6A 2STTA 5E17F 2DQRA 2VOOA 2KDZA 2IVMA 5DS9A 1FSEA 4RGXA 5GAHJ 3DBHB 3R4KA 5KCMA 2IJLA 3ZOBA 1IF1A 2Y2ZA 3GWZA 5IYBJ 2OZUA 3N05A 5C4XJ 1ETYA 2X1DA 3MVPA 1KU3A 5KVRA 4ZZDA 4JQFA 1J59A 1BC8C 1PUEE 3GO5A 2L4MA 4IQJA 4V19K 1Z3YA 2JN6A 3ABUA 2CQNA 1FYLA 3BR3A 3TKYA 1Y6IA 2VT3A 4EM0B 1MNMC 4Z2YA 3FKJA 3WG7H 2QENA 4FE7A 1WJCA 5GAGJ 3ZMVA 2VC1A 2BEOA 1SD6A 4JX4A 4B09A 2H8WA 1W7PD 3JTHA 3MN2A 4PUSA 3HOTA 3PNYA 1GHCA 2XSJC 4BQAA 3WTYC 3BR0A 5CQGA 4O6JA 1T6SA 3DTEA 1R1UA 1X19A 2JWTA 2W1OA 4OMYA 1JUPA 3KYCB 2KIMA 1SFKA 3I3LA 1RETA 3OSFA 3G1OA 3S2DJ 4XLHA 4IOCF 1SMTA 3J7YJ 4A69C 4BYYA 4B48A 2EFNA 3GMEA 4F7ZA 4C3IJ 4WK8F 3L00A 2CH0A 1KA8A 5IP7J 4HG2A 1O3RA 1H0MA 3LQRA 4XK4A 2E36A 1TZLA 2RNGA 3FWEA 5H6QA 3M3YJ 1IN4A 4W97A 1GDTA 2ECCA 3S17J 2YU9J 3CP2A 3RKWA 1U6GA 3MAJA 1FBSA 2CJJA 4PJ0C 3K1PA 4HNTA 5GPAA 1O7FA 1PYVA 2FBKA 3IP4B 2HTJA 3CCSI 2GA2A 3KETA 3E5XA 1T08B 1R49A 2JVGA 1YFHA 1MIJA 3SYTA 4LLLA 2VUMJ 1H88C 3KP5A 2VBXA 1F1ZA 3M1EA 3KP3A 2H8RA 2OU2A 2XF6A 1Y1VJ 3BZCA 3WTXC 3KYLA 2K27A 1ZLJA 3O6BB 4AM3A 3MKLA 1FTZA 2L9NA 5BPIA 4CCLA 3F9KA 3VPRA 2K3FA 3PUBA 4U0WA 4MEXF 2ECBA 2RGVA 4UHTA 3GW2A 2DDAA 2IBDA 1VQ8I 4ZYEA 4BACA 3CLQA 2HR3A 5HDKA 3ZXSA 1G2HA 5DD4A 3WHCA 2MLKA 4IHSA 1Z9CA 5LHHA 4E7JA 5E3MA 3HRSA 3K4LA 2WC2A 1B4AA 2Z9OA 4OINF 2QA4I 1KYZA 3HYIA 3C3WA 3FMRA 2UXNA 1FNNA 4BJTA 1FPQA 3I0TA 1MBEA 4IO9F 5LHGA 2QBYA 2Y0SN 4CDGA 4IXAA 4E4HA 3J7ZI 4DOZA 3RSNA 4B44A 2HVSA 4AYBA 1O7LA 2R7RA 5EZHA 1BR4A 3K4KA 1LFBA 2X51A 1NTCA 3CCLI 1C0WA 3EETA 3BOQA 3KPHA 1U78A 4B47A 1QHGA 2XV4S 3F8BA 2FMYA 3PO3J 1F36A 2WADA 1V5EA 1Y8QB 1Q1HA 2LY2A 1IO2A 2BBYA 2LSOA 3CCQI 3IWZA 3LFKA 2VKHA 5DUKA 1W36D 3P9KA 2ZFWA 2A6TA 2X6WA 1Z91A 3BJ6A 2QBYB 1GLNA 4L5EA 2CFOA 2E7XA 3CQZJ 3GZNB 4BXFA 1RZ4A 2MD0A 1ZH5A 4O5VA 4BQQA 3D5SC 5J3LA 3ROUA 1TLHB 1RI7A 4XKBA 3HOXJ 1MBFA 3S8PA 4LMYA 4XSXF 2R7SA 4G8XA 3ASNH 1HBXG 2DO7A 3WGIA 5F0HA 1IZ1A 2DOEA 1S72I 2NOJB 3U9GA 3QU3A 2LVSA 3BTCA 5D5WB 2UXXA 4ABZA 2RKHA 1YO5C 3GTQJ 5BPDA 1XGSA 3E6MA 2ME0A 1FX7A 4B4CA 2OD5A 1YJNI 3GTKJ 4GCVA 1EJ9A 4HEA2 1U3EM 2CV0A 1RKWA 4U0VA 3H1CA 4C30A 3U1KA 3FXQA 3RQIA 2EIJH 2XHKA 5KK1A 2COMA 2DAOA 3LSTA 2DA6A 1P4AA 1YOVB 2EJRA 5GTHC 3LSPA 1LVAA 3MCZA 4AU7A 2K7LA 2OA4A 1T38A 1MMDA 1LFPA 1ZG3A 5HLHA 2FRHA 3BROA 3COAC 4LB5A 1BI3A 4HLYA 1ETVA 2V4JC 1R7JA 3LA7A 3PIPF 3GCMA 3PFYA 1HQCA 2M34A 2Q0OA 3ABKH 4UUVA 4RB0A 2DODA 3AFHA 5FLMJ 2ISZA 4FE4A 1XC5A 2Q2EA 3FX3A 1BOAA 2EZLA 3X2QH 2I8DA 2HEOA 2CUJA 4XOTA 4HX8A 2BGCA 3HHGA 2LR8A 1CQTA 2E1MB 4L0YB 2EZIA 2E1MC 1H89C 1ULYA 2VC0A 2XGCA 3ELKA 4CCKA 3ZN1A 1ZKGA 2R93J 1T39A 4ETSA 2QLZA 2DT7B 2M87A 3NARA 3GTPJ 4PZJA 5ICEA 4A3BJ 1DQUA 2IT0A 3JAMK 2M0CA 3F8MA 2M7AA 4AUXA 4I01A 2Y69H 1HSJA 1D0YA 1X1BA 1LVKA 3CJQB 4DBQA 2QQ9A 1POGA 2X6XA 2CW0F 2Q2EB 4BY7J 3IAM2 3DEWA 5E8IA 4G9YA 3TO7A 5FFZA 5DTDA 1FBUA 4UNOA 2MW8A 3BDDA 2LKPA 1N25A 4YFXF 3QPHA 3JW4A 3K4NA 2QQAA 4BE2A 2KLOA 3FXOA 1DUXC 3S2HJ 1F43A 2Z3YA 4KUMA 1OCRH 4M6YA 5EJCA 3QOEA 4XLEA 3P5JA 4LG3A 4ZYHA 4FASD 2VI6A 1RR8C 1GT0C 1HDDC 1JHFA 3M8FA 1Z6RA 1B9MA 1WQ2A 2EIMH 1MMAA 4PJMA 4Y7NJ 2OUMA 5H20A 2G7UA 1RUOA 4QSHA 4U88A 2Z16A 4KT6A 1MMSA 3L09A 2DA2A 2O5RA 3CUQC 5EG0A 2GXGA 3VYUB 1AHDP 1MKMA 2HKXA 3JAMZ 4E7IA 3W6VA 4LGWA 4M6XA 3I58A 2OAZA 4A0ZA 2CV2A 4BQNA 4KDPA 3CCYA 5K5RA 1WH7A 2X9DA 4XRSA 3F21A 3KZIC 1JHHA 5CVJA 1JUSA 2GIZA 1KGSA 4EJOA 3LSIA 1R1VA 1S6LA 2WY8Q 5DYMA 2JT1A 3FM5A 5M5XJ 2JPBA 5TGTA 2DLLA 1W0UA 4CHUA 2LY9A 5LEKA 4FTHA 5C44J 1ZQ3P 1EH8A 2HQAA 3CMYA 1ZR4A 1R4MB 2GWRA 1QPMA 3JR9A 1HKTA 1Y8RB 2XPWA 2YUSA 2UZKA 3WU1B 1WHUA 4C3HJ 3CCJI 4ENKA 1B72A 2R4GA 2Z99A 1WJ5A 1FOYA 3I4MJ 3FBIB 1TW3A 1OPCA 1IV6A 5BS6A 1PJRA 1VQ9I 3GEZA 2KISA 2MH2A 3SJMA 4FQGA 5EGOA 2CW8A 4IHWA 4XICA 4UV8A 3CC4I 3PFIA 3OS2A 1X1PA 3I55I 3RKQA 3H9JA 2RQQA 4RGSA 2A69F 3QPSA 5L3FA 2ZJPF 1FIPA 2LD5A 2BY3A 2CFXA 3CC7I 1GVJA 4A6DA 2HXOA 3DP7A 3AG2H 3SDBA 1JE8A 4LITA 1MGTA 5F08A 3K1NA 3L2RA 1D0XA 3L2WA 1HCRA 1MD0A 2NYXA 1YW8A 1IRGA 2VBWA 1YS6A 3DU5A 3MKZA 2ME6A 1ZHFA 1KQ9A 4YIFA 1DP3A 2YR2A 5EGOB 4MEYF 1QPIA 4A6EA 3RKYA 3L2CA 2K4JA 2VL8A 4WX9A 4CYCA 2K9MA 2W7NA 4RA2A 2RNJA 2FOWA 2LTPA 2Y30A 2XKPA 2DT5A 3CJTB 3WGHA 4FISA 4OIPF 1D1CA 1XTAA 1YX3A 2PFBA 3HRMA 2OF7A 3FXUA 2JPCA 2BVMA 3LMMA 3R0JA 4C9YA 3U1DA 2IEKA 3W6JB 3FMQA 2EV6A 1CF7A 1KZHA 3ZMZA 4P5OA 4ESBA 1I6HJ 2KDOA 1P6RA 3NQOA 4L9VA 4AWXB 2LG4A 2WAFA 2E5NA 1FT9A 3QYBA 1SFXA 2V26A 4IRIA 4CYCB 2CQ7A 5DM6F 1VQ6I 5CJ9A 2DA5A 5AIQA 1RIOH 2QKLB 1J7KA 1IN6A 3DKXA 1YJWI 3VYTB 2L02A 4HSTA 2IS1A 4EVIA 4HV6A 4F92B 5IPAA 4PGHA 1J5YA 4E7HA 3ZQLA 1S29A 1X2NA 3L2QA 1I1GA 1QQIA 2E35A 3Q9SA 5D8LB 1OCOH 4XRFA 4BHCA 3H0DA 5M3FJ 3S32A 1K61A 1OCTC 2E34A 1WJFA 3ZQQA 3DPUA 1FSHA 4YG2F 1CF7B 3P9CA 3TDUC 2NOGA 2GZWA 1MMGA 3KZYA 3VSLA 3R61A 3ZQFA 1OYIA 2AQFA 2BHZA 1W5SA 3GFMA 3WU2C 3I53A 1YI2I 2XAUA 3LWFA 4AVZA 3LFUA 4IPAA 1X1DA 4Y17A 2K5CA 3P9IA 1LKXA 3EUKL 4OWRB 2KIQA 4CXFA 5E3NA 2KQRA 4YEJA 2LOOA 1ZG1A 3HOZJ 1WH5A 1FOWA 2IP2A 4NQWA 1B9NA 1Z0XA 1YIOA 1REPC 2Z33A 2VONA 4Y3OA 3ZMTA 4A3GJ 1UAAA 3MKYB 1RR7A 1VF9A 3ONQA 3V7RA 1TWHJ 3Q9VA 2CS3A 3UKGA 3MKWB 4MIMA 3HZJA 4HZFA 3E7LA 4D0PA 2ZJRF 2BV6A 2EFWA 3ZCOA 4S05A 2BW3A 3J7AY 1WSUA 2E1OA 1H8AC 2NRAC 3RTRA 3WG9A 3BR1A 3HTSB 2QZ8A 2DMQA 4EJWA 3SEZA 2XPUA 2CSOA 2LLKA 4PK4A 2OZ6A 2G9WA 4NQWB 3R6SA 3BR2A 4DYCA 1TBXA 2VOPA 4G6DA 1U0JA 2OPTA 2E7WA 3S1MJ 2CYYA 5ILSA 2GIVA 3CCRI 2VBZA 1R9TJ 4IRHA 2F5CA 1BIAA 2BVLA 3GLXA 5E20A 1OCZH 2W84A 3T8TA 4AVPA 4L18B 2WV0A 1RNLA 2BW3B 1TQMA 4ITVA 3DV8A 2EA4A 4HQEA 4FHTA 5BNGA 2CWEA 1V4RA 1MNDA 1Y0NA 4ESFA 4RLQA 4KIGA 2AHQA 2OV7A 3FBNB 2KP6A 4LG0A 4E70A 1LFUP 3K9TA 1YS7A 1QRYA 4DQ2A 2ELKA 2IGOA 1O57A 3SZTA 3TP0A 4HF1A 2FUG2 3B6CA 1O4XA 1Z1DA 1HSTA 4P96A 3N97A 1WRJA 2XROA 1J0RA 2JA6J 2DK8A 2FNPA 4IQ4A 4HSRA 4ENJA 4CO8A 5J1RA 1LE8A 3RZOJ 4BXUA 2K9NA 2KZVA 2BY2A 1I5ZA 2LY1A 1VQ5I 1P4WA 2FJ1A 1ORKA 2PBIA 4E7LA 1UHMA 2K3PA 3V8LA 2AXLA 3ML6A 1MH3A 2DMTA 3ZQGA 2FX0A 2HU9A 3I59A 3S16J 3JRCA 2HS5A 2M7BA 3WE3A 2FXAA 4A3IJ 4DIQA 4LG0B 4FT8A 1HXDA 2ELJA 5FD6A 4EM1A 5EDNA 5HNHA 2XF5A 5LRRA 1LB2A 1N75A 4OOIA 2DPUA 1SAXA 3BY6A 2DPDA 1LE8B 3IRQA 4B1RA 2MC3A 2OTJI 3DWLE 4FX0A 5F04A 2FNAA 4D7NA 1SVLA 2R3SA 4OAYA 4HOBA 3CP8A 3WU0A 1XX5A 3ERMA 3B02A 3NWSA 5CLSA 4A3LJ 4CCOA 3I59B 5EEHA 2DTRA 2DYRH 4ZTFA 3SEQA 2JTVA 3BPVA 3TOAA 3P7NA 2E2HJ 2IA0A 4W1UA 3E6BA 2FQ4A 3Q0WA 3V4GA 4I0BA 1SFOJ 4BH9A 3DEEA 2MABA 3KP2A 5LRSA 3BG7A 3ZQ7A 5JI6A 2I5UA 2VT2A 3NEUA 2HDWA 2JJ7A 2ZBKA 2FQ3A 4BU2A 1SVMA 2XC7A 1E17A 2P81A 4UB6C 1WGXA 4KA4A 3A03A 2HGCA 1X1AA 4OIRF 4I99C 4BXXJ 1VQOI 5B1AH 1PP7U 3ESWB 4M9XA 3AAFA 2CRGA 4XL9A 2XSDC 1S7AA 5BMZA 5ICCA 2V79A 5GAEJ 2BY1A 1KU7A 4F91B 4BBSJ 2LDUA 4XKVA 1BBYA 2D1VA 4YRVA 3BWGA 3BG3A 3BZKA 1V5FA 2ZB9A 3EQLF 5D4RA 2KJCA 4KN7X 3S3NA 2UUZA 3L2UA 2K40A 2JA8J 4MLOA 2XAFA 3HSEA 4KFCA 2JA5J 1RC9A 2HDDA 4YIIA 2NNNA 1V3FA 1MJAA 1S7EA 1UG0A 5FKLA 3LAPA 2PMZN 3K2AA 3Q3SA 1QZZA 1ODDA 3OYNA 3S2WA 2Y0SA 5LBQA 4M73A 2XB5A 1SFUA 5HDNA 3AG4H 3HOWJ 2VQCA 1IJWC 1WI3A 4IHYA 1EH6A 3GFLA 1FBQA 2A61A 1GVDA 5HS8A 2QVOA 3ZMSA 1HA8A 4HLXA 4CCJA 1ZYRF 1IN8A 4QTRA 3OR2C 2P8TA 1WFXA 2FD5A 2CQQA 4UUTA 2LKXA 2A05A 2H94A 2X1EA 2NVTJ 2MLGA 3DTKA 2QSHX 2QUFA 2DCEA 2HTSA 5DCMA 2LKSA 3G71I 3RPQA 5LFAA 3HEFA 3H5RA 2D5VA 1BI0A 3EUHA 2JUCA 5BQTA 1BM9A 2F5FA 5LGTA 2HVQA 1V5GA 4ZDLA 5FB2A 1PVEA 4OU0A 4MTDA 1TWGJ 2M45A 2J5PA 3KFWX 1D8JA 3RPUA 1X4PA 4L0ZB 3MEXA 3OOUA 5DD8A 2VKVA 4RB3C 2GXAA 1A5JA 4ZC3A 2LNBA 2XGEA 1B1BA 4R8HA 3RIRA 4C3JJ 3JRFA 1SD4A 4CUGA 1G6NA 4Y33A 1QVTA 1FYKA 1DGRM 5CYVA 1KU2A 3D1NI 1X3WB 5DCMB 3SZPA 4D9JA 2HOAA 2LYCA 3D5LA 2PLYA 1NK3P 3L9FA 5LLQA 2NS0A 3EUHC 4B3XA 4KNYA 4NB5A 1OKRA 3AG1H 2O6GE 9ANTA 4Q4ZF 2L3DA 4DZJA 1HKSA 4Y15A 3TBIA 1NH3A 1X2MA 1J2XA 3DLAA 3V8KA 1MMNA 4E7KA 1MNEA 4LIUA 3BPXA 3EUAA 3TMOA 1JUMA 2AO9A 4L5IA 3FM3A 2QQ8A 2DA4A 3QAHA 1FOKA 1IG7A 3I5UA 3FF5A 4NC8A 2X6OA 5B1BH 1HW5A 5D4SA 1XCVA 1FEXA 2A3SA 3OYCA 4I2OA 2FBIA 2RQPA 4M3BA 1XD7A 1VFCA 1SFEA 1BJZA 4XM3A 4RB1A 2GXBA 1XGMA 3ULQB 1D5VA 5JHFA 2O61A 3L2VA 2BXZA 3J81K 2R7XA 2L2OA 2Y0MA 3H92A 4ESJA 5DV5A 2ZXJA 3BCAA 1MBHA 3G6EI 1T56A 5JLXA 3OY9A 3ZQCA 4Y52J 1Q1VA 4XOPA 4BEHA 1R4NB 1R36A 2V7FA 5HOOA 3KE2A 3LAJA 4CCNA 3GFJA 1U9OA 4ZZLA 2VPLA 1IW7F 4R1HA 2CUFA 4M71A 4KMFA 4JYKA 2JSCA 5EF6A 1K83J 3V42A 2HYFA 3F6VA 4ZTJA 2VASA 5F64A 2K02A 4FX4A 2LFBA 2M30A 1HW2A 2O8KA 2CMPA 4I7HA 3E1SA 4M6VA 5K5QA 3TOBA 4U87A 3LSHA 1XG1A 5HODA 2KL4A 1U9NA 4ZYGA 3WTSC 3DPLC 4G6TB 3O8HA 2E71A 2OBPA 2OC6A 1TTYA 3RDIA 2LREA 4BHPA 3A4CA 1YITI 1YLFA 2MGQA 5HLGA 4G7ZF 4EQQA 3LSRA 3HRUA 5F1RA 1LUJB 3G4SI 5J4VA 4BEHB 1X1CA 5BOXA 2LMDA 2HXIA 4G94A 4EJVA 3H3ZA 3J81Z 1R5HA 2JK3A 3MWMA 3ZRGA 3OL3A 4F55A 2CW7A 3F6OA 3T8RA 3AG3H 4M74A 3HL2A 1WWXA 2H1LA 1R6RA 4MFEA 2M5WA 4HF0A 1X58A 4XKWA 3SFIA 1VQLI 2E1CA 1JGGA 2TCTA 4OAZA 1IXCA 2ZC2A 3S1NJ 1BA5A 1LNWA 3K70C 1S9HA 4WXCA 1ZTRA 2RV8A 4QPQA 4JOMA 3DXJF 2TDXA 2F4MB 2IA1A 1E0EA 2R7TA 3EYYA 2DOAA 3QQAA 2DXIA 3OYHA 1TWCJ 3MZYA 4QIWN 5KHDA 2A6HF 2E19A 1USTA 2L0KA 2P5KA 4ZYAA 2K9SA 2KJBA 1AKHA 3W6KB 1I3AA 2XGDA 4HW0A 2WAQA 4QLCU 1WJAA 4WCGA 1MSEC 3BQZA 3PNVA 3HG9A 3LSMA 3PSFA 1S8NA 2JA2A 3M7GA 1G3SA 4U7BA 2E2JJ 1FLIA 2M4GA 4UB8C 1JTYA 3V8JA 2R92J 3I9V2 1R58A 4RM2A 2ESNA 5IP9J 3A01A 3CCMI 1FTTA 4AC0A 1D8KA 3M07A 2HYGD 4BGDA 3WTTC 4IJAA 5J40A 3VWBA 4BNCA 5FRNA 5D6FA 1A6IA 1R71A 1YW7A 2CO5A 3HHHA 2VJIA 2PQ8A 4CZCA 2V9VA 1AKHB 4UUSA 3PQKA 4P9FA 2ISYA 4V2GA 3JSOA 1MBJA 3ZN0A 2WB1A 1MH4A 2I10A 2XAQA 3QYEA 4I0AA 1I27A 1R5GA 4N0BA 2OJED 4I09A 2D45A 2MD5A 4A3KJ 1G4DA 1O3TA 5E3LA 3A01B 2CG4A 2Q8KA 3HXLA 4M3EA 1HW1A 4XORA 4EV0A 5FO5A 4WF2A 3VOEA 2FU4A 3C2BA 5LEJA 2Y31A 2WWYA 1OMIA 2QSFX 2VE9A 1TL8A 2ADUA 4UUSB 2GQQA 2EFOA 4XN3A 2M3AA 3TW7A 2XF7A 2E60A 3ASOH 4GDFA 5FKOA 2W82A 3LA2A 4DZPA 2MBFA 2K85A 4XLFA 5E18F 1DPRA 2DFHA 4HPQA 1LDJA 4Z6YA 3K10A 4BAYA 2KRFA 2Z2SB 5TISC 1DPUA 1FP1D 3HGYA 2DT6A 1K78A 3B6AA 4A3DJ 1XGNA 3O2PE 3TO9A 1IDYA 5HDGA 3TP3A 4CYDA 3ABMH 1IV8A 5EEAA 2VE8A 3V7SA 3GYHX 4ANJA 1FIAA 2ACJA 2P7CB 1YQAA 2XVCA 2FA5A 3BTIA 2NS8A 1XSDA 1JT0A 1OFCX 3WGGA 1TC3C 2V9PA 1WCMJ 2XIGA 3CC2I 3HC7A 1J9IA 5F0CA 1R00A 5JLWA 2HDCA 3RYPA 3OR1C 4XR6A 1E2XA 1BIBA 4JP0A 1S5LC 2H6BA 5D5UB 1T98A 5B66C 4LK1F 3CMEI 1OCCH 1O3QA 2Y75A 3ZQIA 1WJDA 2OQGA 3FHNA 5KNLA 1K78B 3MZ8A 1QNTA 2EINH 4DW6A 3KEOA 3KP4A 3S1QJ 5IP6A 4BJ5C 4KIFA 3CO7C 2M8EA 4B8XA 1EV7A 1G59A 2ZJ2A 2R7UA 4ZYDA 2KHMA 3G1MA 3DTIA 2HOSA 3HJEA 3CCEI 3K6GA 3VSKA 3CLOA 4MQVA 1ENHA 1P2FA 1JKQC 1K79A 1F5TA 3FXRA 3H36A 4CSWA 2L9RA 1ETKA 5J6XA 1V54H 4HF2A 2M9HA 4BDYA 3BG9A 2LF7A 2VPRA 2IGNA 1DDNA 2VBYA 1IDZA 2P4WA 3C2HA 2NS7A 3U2RA 3VYRB 4N4NB 3G2BA 2L7ZA 3S15J 3FXJA 2VLAA 2WA0A 4EMSA 3IH3A 2O7OA 1S3JA 2N8GA 2DA7A 1OJLA 2ZCWA 3E6CC 2ELHA 4RMNA 2HWVA 1IRXA 1XSXA 5AONA 2ZNZA 1YX5A 4D7MA 3F0CA 3W3CA 4XMYA 2DFEA 4YFNF 4Q47A 2NVQJ 2O9LA 4A3EJ 2WAEA 4HNUA 5D5VB 5GP9A 4RM3A 1ZGWA 2EZKA 3UNGC 4G7HF 4OMZA 3HBLA 3G3ZA 3K2ZA 3OYJA 3B73A 2W25A 2EV5A 1L3LA 5LHIA 4XRMA 3K69A 2XKOA 3DBRB 2YU3A 3H0GJ 2VQLA 2JZYA 3IWFA 5AIPA 4ON0A 2NVXJ 4FCYA 1Z7LA 3LOCA 4RB2C 2BXYA 2XUBA 1B8IA 2IA2A 1Z67A 2W4SA 5DEQA 5J4YA 4A0XA 1O3SA 2NAZA 4I02A 3GXOA 4OIOF 4FETA 4WXDA 4PDKA 3CZ6A 1S7OA 3PL8A 3E3VA 1FP2A 3UR3C 1ZRCA 2M4KA 1OR7A 4EJTA 2QGUA 3PUFA 5F0FA 3DLLF 1WZ2A 1E3OC 2GLOA 4HNVA 3K7AJ 4CGZA 2DFIA 4XIDA 3K70D 1JGSA 2KIFA 4LB6B 1B6AA 2F2EA 2V1NA 3OYFA 2RAEA 5E3OA 4BE0A 1B8IB 1TQPA 4XLPF 1I6XA 1UG2A 2IAIA 3OIPA 2GBYA 5CVUA 3VDXA 3K4BA 3RJPA 4A5NA 3PQJA 2WY7Q 2FMLA 5IOZA 2VJ4A 4IRGA 1W4MA 2YX7A 1OR7C 2VKEA 1K7AA 1IGNA 3QRFF 5A2QK 1ZR2A 2M2EA 3QP5A 1D3YA 3GUDA 4HDUA 4GGGA 4PSWA 2KKOA 2PJRA 1IXRC 1ONVA 4DJAA 2GM4A 1XN7A 2RDPA 2ID3A 4EJUA 3NRVA 3SDGA 5ICFA 1HF0A 2QQBA 2CGPA 4MQ9F 4NC7A 3FZVA 4IHVA 2RN7A 1F4KA 1FWZA 1R22A 1NG7A 4I98B 4B43A 2YX4A 4IEJA 3T1BA 2LBFA 3FISA 3IC7A 3LNQA 1BN5A 3WTWC 3CDIA 1U5TA 2ZXHA 4HA8A 3QU6A 1CGPA 4AD9A 3DQVC 3ZP5A 2FSWA 2L01A 1IRZA 2B63J 4RAGA 2EK5A 2YSRA 1AA7A 1FZPB 3O8GA 4RAZA 3K0LA 4O3MA 2PJRB 2HPMA 2M0MA 4DBRA 3FXKA 2KRCA 3PSIA 5L3GA 1FMVA 1SVOA 4JX5A 1JI8A 1STZA 4P9UA 1W5CC 2AS5F 1D1AA 2R7FA 5HS7A 3K4JA 2Y48A 1F9NA 4X6AJ 3IH4A 2R5ZA 3E97A 2V9KA 4KT5C 1M1EB 2LBFB 2LK2A 1WJEA 2MFZA 1U5TB 4U0YA 3PIOF 3OYEA 1QU3A 3AKZA 4CA0A 1ZRDA 3ERED 3KYDB 1J75A 4K2EA 1GV2A 2PMUA 5H2FC 2QF7A 3WTZA 1VQNI 2H6CA 5EEGA 1LEAA 3GLLA 3GZ6A 5IT9K 1USSA 2L7MP 3FKIJ 3H9GA 3KEYA 2HOTA 3HOVJ 2PG4A 2V6EA 1VNDA 2IGMA 2X0LA 3LQQA 1ON2A 3F72A 2WBMA 5JVTA 1QGPA 4H0EA 1RESA 4BKXA 1ON1A 2R5ZB 1BR2A 4N9HA 1EA3A 4LD5A 3OOPA 3J7AO 2ICWG 4XLAA 2FF4A 1W5TA 4Q48A 2WV1A 4DGWB 1VTNC 4IF4A 3OS1A 1HC8A 2CUEA 2E1NA 4HBLA 2JRMA 5JVGF 3A0HC 3ZQHA 3F8NA 2EV0A 1QZYA 2W24A 5FD5A 2XGXA 2X1CA 2ZSHB 4UVCA 1U8RA 2HFHA 2AXTC 2V6CA 3IUOA 3I64A 1XDUA 1P7JA 3NAUA 2HPIA 3H3UA 4XN0A 3OYIA 2VODA 4D5CA 1NG6A 1JT6A 5IT9Z 2VB6A 5ED4A 4YIRX 4QWQA 3W2VA 4F3QA 3JSPA 3BTJA 3IKVA 1SANA 3I54A 3ISPA 5IY5H 1QHHD 4GRIA 2BE5F 5ICGA 1EKEA 5E1XA 3KP6A 2ZJQF 2VQHA 5E1ZB 1SEUA 1DU0A 3IHUA 4R79A 2DK5A 2CV1A 3DKYA 3T0YA 3CMAI 4IZZA 4MTEA 4IHXA 1R5ID 3OYMA 3HKZN 1VQKI 3CD6I 1AU7A 1BW6A 1LPQA 1YG2A 4A93J 1Y39A 4EATA 2ZNYA 3A1YA 4ZJZA 2DI3A 4I76A 3GVAA 2MC4A 4N9IA 2R7OA 1ZLKA 1BR1A 2LF8A 4UVAA 3KLNA 2P5LC 1QBJA 5M5WJ 5LGUA 1OISA 1D5YA 1XPXA 1OLTA 2DJNA 4IVNA 2EFPA 4F93B 5J1UA 1ZRFA 4N4OB 4WWCA 2D2WA 2PJPA 1RUNA 1ZARA 1UHSA 3S93A 2O03A 5D6EA 3SQNA 2MYSA 1R23A 1I3QJ 2ZFUA 2ZXWH 3SXYA 2IS6A 1KQ8A 3OYLA 3TL4X 1QO0D 2HYJA 1ZGJA 2QEXI 1T8IA 3I71A 3GTOJ 2VJJA 3F8CA 2L7FP 4X1EA 5FLXK 4PCQA 5GTIC 4BS9A 4Q5SF 2W48A 4EGZA 1ETOA 2E5ZA 3BLYA 3CUOA 3F23A 5C3EJ 2W57A 4XKCA 4II3A 5B5EC 1YHQI 1JJ6C 1YJ9I 3FMSA 3PM1A 2OCEA 4M9ZA 3QOPA 4V2FA 5FGMA 4PFOA 5E1WA 3O3KA 3H35A 4RDUA 1Y56A 3I4NJ 5FROA 5J47A 3C1DA 4ASNA 1DU6A 2MA3A 3QPLA 1SMYF 1X3UA 3GZ5A 3M8JA 5M3MJ 1D1BA 1H9GA 2R7ZJ 2JQ7A 1QA6A 3SZGA 1A6QA 3OIOA 1VQ7I 1TT0A 1WKMA 2EILH 1HLVA 3K4CA 2ZMEA 3E5QA 1E3HA 1GUUA 3JCUC 2R7QA 4RAFA 3RCOA 5J1YA 2P6SA 1G8XA 3HDDA 1JKRC 5D8KB 2LP0A 3C2GA 4X0GA 3S1RJ 5FLXZ 5TJJA 3OWTA 1GV5A 2IS2A 2C6YA 2NXNB 2LRDA 3S14J 2DA3A 4C2UA 3LSJA 1BOBA 4P1WA 1J09A 2VKDA 1P9QC 1ZK8A 1BW5A 3KCCA 1I39A 3OYGA 1Y1WJ 1FC3A 3OV8A 1XB4A 2JRTA 2FEZA 5IT3A 2V1UA 2ZMEB 4LJZF 2QCOA 2ZMEC 4DYRA 2JA7J 4PJJA 2EPFA 1A04A 1Z21A 4M3DA 4M72A 5FKKA 5IYDJ 3CCUI 3GBGA 1LDKB 3GTLJ 5L3DA 1FOXA 4HX4A 4TV7A 3ZPLA 1HKQA 4LLGF 3Q0UA 5J8FA 1IN5A 3DU6A 1BJAA 1ZELA 4ZH4F 3JRIA 4RGRA 2EFQA 3DEUA 3A02A 1UFMA 1X3ZB 5L3CA 4A3JJ 1T95A 4XLNF 2Y9YA 3CF2A 2L9VA 5CQEA 4D5FA 1ZG5A 2XAHA 3HSRA 2PX9A 3FHZA 3BC8A 3T5XA 4I6ZA 3IKTA 1ZREA 2CQKA 1MSFC 3TW6A 1FYMA 2EA2A 4ENNA 2NVUB 3DFGA 4UXNA 2F48A 4A3FJ 1AWCA 1BI1A 2FBHA 2DYSH 3F3XA 1T33A 2B7EA 2W85A 2MG4A 2DMUA 3OYDA 3G1LA 4XONA 4IHTA 3G73A 3DCFA 3EPZA 4BJ6C 4BUPA 1HOMA 3OYKA 3E0JB 3HUGA 1Z6TA 2EZHA 4KJZA 4F52A 1L0OC 4HRIA 1AOYA 1LEBA 3ZR8X 1XDSA 2L54A 4AYBN 2QM3A 4YFKF 3RZDJ 2MSYA 2E2IJ 5B3SH 4UY8I 1MJ9A 3JRBA 2ZXIA 1UHWA 1QVUA 4IKFA 1G3YA 3MQ0A 5ILVA 2X6YA 1ZGAA 1FY7A 5EYRA 3CDLA 1LQ1A 4HQMA 4BY1J 4MNUA 1Z05A 4ZDOA 3DKWA 1K4TA 5HVQC 1A36A 1IN7A 2DQLA 4EM2A 3OIQA 4E7ZA 1MZBA 2B0LA 3HUGB 3LL7A 2P5VA 2K9LA 2IGKA 1BC7C 1OCPA 1TW2A 3WODF 5FJ8J 4OIQF 1ERDA 3Q0VA 1UJ8A 1VQ4I 4JX6A 4A2UA 4G12A 4RGUA 1T2KA 1P92A 1K6OA 2XASA 1Y0UA 5GADJ 4LLNA 2DJIA 1W1WE 4XQFA 3A2KA 3LSGA 2R7WA 1YTYA 1OYYA 3IAS2 1ZN2A 4QPOA 1I1SA 4HX7A 2QYOA 1BL0A 1ETXA 4RAYA 4B3AA 5C4JJ 2O8XA 1A35A 1JTXA 2QKMB 2B9SA 5FLVA 2P7VB 3WTVC 5K7HA 3GTGJ 3HPHA 2QSGX 3BG6A 2KRHA 2BOLA 2XRLA 3KEQA 3R0AA 2IW5A 2XAGA 2RREA 3EYIA 1VQMI 3ABTA 2H27A 2A6EF 5F1JA 2DBBA 4G6QA 2R0QC 1T0FA 3QP6A 2EQRA 1BI2A 2F4IA 2QWWA 4A3CJ 1ETQA 2F5VA 3CUQA 5JR3A 3OYBA 3HTUA 3HM5A 3K1MA 2STWA 3QYFA 2HNHA 1YRNA 4PSXA 2UWMA 4DNCA 3VFZA 4ENMA 1KU9A 2HI3A 4BE1A 4S0HB 5CKTA 4RBOA 3EDPA 4II2A 3CF5F 1XSVA 4IX7A 3VODA 3CCVI 1XMXA 3CO6C 1YW9A 3H9QA 2L5QA 2BHYA 1YYVA 1JKOC 4BDZA 2JMWA 3VYSB 1G3TA 2L9SA 2V1XA 2NVYJ 4GFBA 2L7KA 4Y4RA 3MZHA 4H4KC 4P55A 4XLCA 1IRFA 2VN2A 3HB9A 3DF8A 1T0FC 4MGRA 3RQ4A 2G0EA 3CUQB 4A3MJ 3Q5FA 4Y13A 2ZKZA 3OMYA 2R7DA 1YRNB 1K4SA 3ECHA 4PJLA 3JRAA 3BP8A 2YPRA 3IRRA 1K6YA 2CU7A 4JBAA 3FXLA 4LOCA 5H6RA 3E6DA 5K5OA 1ITYA 3DPTA 1P4XA 1EF4A 2DFFA 1Z77A 4XNFA 2WAQN 1U8BA 5KAFC 4HAMA 4A0YA 5E8GA 1MBGA 3QODA 2A5WA 4L9NA 5ILUA 2A68F 2XB0X 1DP7P 1HDPA 4CH7A 1SD7A 3VEPA 3GF2A 5DM7F 5ERIA 2DOFA 5EG0B 5FRMA 4CCMA 2PI0A 2Q1ZB 4AIJA 4DYQA 3BTLA 3IL2A 2RC4A 1IAWA 2Z5UA 3DBLB 1TNTA 4J00A 2XRNA 3CESA 4KIBA 2X48A 5DUIA 1W7PA 3C18A 3TQNA 2P0WA 4WXHA 2VJ5A 1SAUA 1MW7A 3TEDA 3MMYB 3WTUC 4KN4X 2UV1A 3I56I 2WB1N 3BCBA 2GA1A 5E79C 4M3FA 3IV5A 5D5XB 2HQNA 2BZTA 5KAIC 3RPUD 1R1TA 3HRTA 3KP7A 4XSZF 3JRDA 1SC7A 1VZ0A 3D0SA 2F4OB 1TP4A 2K86A 3CMMA 4U7DA 3OSGA 1XCBA 1JKPC 3HOYJ 3CTAA 3SFZA 4RLFA 3ECOA 3D5RC 3PNTA 1XGOA 2XPVA 4EEFG 3FK6A 1A31A 4M9SA 2GAUA 2BY0A 3AL0B 1B72B 3AL0C 2EIKH 4KYWA 1GXQA 3A0BC 3BQYA 5DCFA 4MO7A 3ZMDA 4LFUA 4GXOA 1GXPA 1W7PB 2OTLI 3U21A 2DMNA 5DDGA 4AIHA 5HLTA 1JXSA 4L9TA 3S3MA 4M3GA 4NDLA 5HNFA 4PJNA 2IPQX 4A5MA 3N4MA 3TDZC 2K9QA 4CZZA 1RPWA 2KPMA 2O0YA 5JHUA 3HOUJ 4IL6C 4NBQA 5J8CA 2J5OA 4L5JA 2LH9A 4EGYA 2Z1DA 4D1QA 1TNSA 4J01A 1OQYA 3ABLH 3MFKA 3FIWA 2JVHA 3GX4X 3SHFA 4YELA 1UB9A 1FJLA 2DMPA 5IOYA 2PN6A 2HQRA 5JFRA 2IXSA 3C7JA 3R60A 4C2TA 2GOXB 2WTEA 2A5YB 5IYCJ 1APLC 1N77A 2PEXA 1Z7UA 3NWTA 2V1DA 2HKOA 1JJ8C 2G7HA 3QPTA 1OYWA 4LK0F 2O3FA 2HZDA 1IUYA 1TT5B 5CPRB 1PP8F 4PGGA 1XMAA 1MDMA 4HYEA 2FE3A 2FOKA 3KZZA 4KITB 1V55H 3K4MA 5GPCA 1LDDA 3HGGA 1PUFA 3F22A 3KX2A 1TWFJ 3W2WA 5HS9A 4G7OF 2K4BA 3CDHA 2KMUA 1W0TA 1TWAJ 5K7ZA 3BR5A 3V7CA 4J19A 4MHGA 1WVRA 5HLIA 3KLOA 3H5AA 3ZMUA 1P7IA 3S3OA 1XS9A 2HZTA 2OQRA 4HV5A 3OYAA 4GO1A 3TO6A 2P6TA 2JUGA 5EZGA 6PAXA 3FDYA 1MDMB 2KZGA 3BR6A 2KT0A 5LGNA 1ACIA 3BZ6A 1ZAOA 2KFDA 5FKMA 2VXDA 4NNJA 1VQPI 5CVRA 1PUFB 3CJNA 5K1YA 4L9JA 3WHBA 2DU9A 4BQOA 3HSFA 4XRSG 1SD5A 5M5YJ 1PDNC 2R5YA 2X4HA 3CJRB 3KIOA 3WE2A 4BBRJ 3L7WA 1E3PA 2L4AA 2EWNA 2AQEA 2HQ5A 3H3VK 5CVVA 4E7SA 1VI0A 2M1BA 3I4PA 2A07F 3HPGA 3HIFA 4KMUX 2X85A 2OCCH 4LIVA 1RKTA 3BG5A 1WJBA 2F5EA 4KISA 1XMKA 4KICA 3JREA 3F8FA 3BJAA 2XDVA 1U2WA 5L3EA 1Z3XA 1D0ZA 3RKXA 3BJOA 2VXZA 2COBA 3TGNA 4XBFA 4C2MJ 1G3WA 2EB7A 1LJ9A 1UZCA 2BYVE 3GTJJ 2CUZA 1UCRA 2TRTA 4IOAF 4MFDA 1W36C 3OL4A 1EH7A 4AIDA 4JK1X 2ID6A 5FKNA 3IH2A 2R5YB 3RI4A 3JRGA 3FK7A 2MH9A 2F5DA 2ESHA 3GFIA 1KYWA 1ETWA 4CICA 2DW4A 4UV9A 3J80K 2R7VA 1RRJA 2ZO4A 3LA3A 2DDBA 5A2QZ 3PO2J 2ZSIB 3GTMJ 2DTZA 4BHBA 1WI9A 1NHAA 1UMQA 2VQGA 5TRDA 1KQ0A 3L1PA 2LC2A 3ZGKA 2D1HA 2VIXA 3W2AA 2EBIA 1U5TC 4E6KG 3REOA 1IUFA 5L3BA 2DA1A 4GYIA 4RS8A 3BT9A 3M1CA 1H9TA 5F27A 3VB2A 3M4OJ 1MBKA 1QZEA 1IXSB 5FFXA 4S04A 1TQIA 2KIUA 3QWLA 1MJBA 1NK2P 1I50J 3HKZA 2PMHA 4AIKA 3PJRA 2RVCA 1FMWA 2DN0A 3OS0A 2JSPA 5CVIA 3H5NA 2EH3A 2M8GX 4UVBA 3RYRA 1X4OA 3LSKA 3MD2A 1B59A 2YS9A 2CQXA
chains in the Genus database with same CATH topology
1DGWY 1N78A 4NUBA 3J80Z 3E5UA 2PMZA 4PFPA 4BL0B 2HVRA 4GYGA 2F6CA 2H09A 4A12A 1KONA 1YE9A 2ETHA 2IS4A 4HDVA 4ZDPA 5F6FA 2W00A 1UELB 2XAJA 3M9AA 2GOMA 2HOEA 2NNYA 4NHJA 2IRFG 3HOSA 3JTGA 3M8EA 5LD2C 2STTA 5E17F 2DQRA 2VOOA 2IVMA 1FSEA 4RGXA 3R4KA 5KCMA 2IJLA 1IF1A 3GWZA 2OZUA 3N05A 2X1DA 5KVRA 1KU3A 4ZZDA 4JQFA 1J59A 1BC8C 1PUEE 3GO5A 2L4MA 4IQJA 3ABUA 1Z3YA 1FYLA 3TKYA 1Y6IA 2VT3A 4EM0B 4Z2YA 3FKJA 2QENA 1WJCA 3ZMVA 2VC1A 2BEOA 1SD6A 4B09A 3JTHA 1W7PD 4PUSA 3HOTA 3PNYA 1GHCA 2XSJC 4BQAA 3WTYC 5CQGA 4O6JA 1T6SA 3DTEA 1R1UA 1X19A 2W1OA 4OMYA 2KIMA 1SFKA 3I3LA 4XLHA 1SMTA 4BYYA 4B48A 2EFNA 4F7ZA 4WK8F 3L00A 2CH0A 1KA8A 4HG2A 1O3RA 1H0MA 3LQRA 3FWEA 1TZLA 5H6QA 2RNGA 1IN4A 3CP2A 3RKWA 1U6GA 3MAJA 1FBSA 4HNTA 3K1PA 1O7FA 2FBKA 1PYVA 3IP4B 2HTJA 2GA2A 3KETA 3E5XA 2JVGA 1YFHA 3SYTA 4LLLA 3KP5A 2VBXA 1F1ZA 3M1EA 3KP3A 2OU2A 3WTXC 2XF6A 3KYLA 2K27A 1ZLJA 3O6BB 2L9NA 5BPIA 4CCLA 3F9KA 3PUBA 4U0WA 4MEXF 2RGVA 4UHTA 3GW2A 4ZYEA 4BACA 2HR3A 5HDKA 3ZXSA 5DD4A 2MLKA 4IHSA 1Z9CA 5LHHA 4E7JA 3HRSA 3K4LA 2WC2A 1B4AA 2Z9OA 4OINF 1KYZA 3HYIA 3C3WA 3FMRA 2UXNA 1FNNA 4BJTA 1FPQA 3I0TA 5LHGA 2QBYA 4E4HA 4CDGA 4IXAA 4DOZA 3RSNA 4B44A 2HVSA 4AYBA 1O7LA 2R7RA 1BR4A 3K4KA 2X51A 1C0WA 3EETA 3BOQA 1U78A 4B47A 2XV4S 3F8BA 1QHGA 2FMYA 2WADA 1V5EA 1Q1HA 2LY2A 2BBYA 2LSOA 3IWZA 3LFKA 5DUKA 2VKHA 1W36D 3P9KA 2ZFWA 2A6TA 2X6WA 1Z91A 3BJ6A 2QBYB 1GLNA 2E7XA 2CFOA 4BXFA 1RZ4A 1ZH5A 2MD0A 4O5VA 4BQQA 3D5SC 3ROUA 1TLHB 1RI7A 4XKBA 3S8PA 4LMYA 4XSXF 2R7SA 4G8XA 1HBXG 2DO7A 3WGIA 1IZ1A 2NOJB 3U9GA 3QU3A 5D5WB 2UXXA 2RKHA 1YO5C 5BPDA 1XGSA 3E6MA 1FX7A 2OD5A 4GCVA 4HEA2 1U3EM 2CV0A 4U0VA 4C30A 3FXQA 5KK1A 2XHKA 2COMA 2DAOA 3LSTA 1P4AA 2EJRA 1LVAA 3MCZA 4AU7A 2K7LA 2OA4A 1T38A 1MMDA 1ZG3A 1LFPA 5HLHA 2FRHA 3BROA 3COAC 4LB5A 1BI3A 4HLYA 2V4JC 3LA7A 1R7JA 3PFYA 1HQCA 2Q0OA 4UUVA 4RB0A 3AFHA 2ISZA 3FX3A 2Q2EA 1BOAA 2HEOA 2I8DA 2CUJA 4XOTA 4HX8A 2BGCA 3HHGA 4L0YB 2E1MB 2E1MC 1ULYA 2VC0A 3ELKA 4CCKA 3ZN1A 1T39A 4ETSA 2QLZA 2DT7B 2M87A 4PZJA 5ICEA 1DQUA 2IT0A 3JAMK 3F8MA 2M7AA 4I01A 1HSJA 1D0YA 1X1BA 1LVKA 3CJQB 4DBQA 2QQ9A 2X6XA 2CW0F 2Q2EB 3IAM2 5E8IA 4G9YA 3TO7A 5FFZA 1FBUA 4UNOA 2LKPA 3BDDA 4YFXF 3QPHA 3JW4A 3K4NA 2QQAA 4BE2A 2KLOA 1DUXC 2Z3YA 4KUMA 4M6YA 3QOEA 4XLEA 4LG3A 4ZYHA 4FASD 1JHFA 3M8FA 1Z6RA 1B9MA 1WQ2A 1MMAA 4PJMA 2OUMA 5H20A 2G7UA 1RUOA 4U88A 2Z16A 4KT6A 3L09A 2O5RA 3CUQC 2GXGA 3VYUB 1MKMA 2HKXA 3JAMZ 4E7IA 4LGWA 4M6XA 3I58A 2OAZA 4A0ZA 2CV2A 4BQNA 4KDPA 5K5RA 3F21A 1JHHA 5CVJA 1KGSA 4EJOA 3LSIA 1R1VA 1S6LA 2WY8Q 5DYMA 2JT1A 3FM5A 2JPBA 5TGTA 2DLLA 4CHUA 5LEKA 1EH8A 2HQAA 2GWRA 1QPMA 1HKTA 2UZKA 3WU1B 4ENKA 2Z99A 2R4GA 1WJ5A 3FBIB 1TW3A 1OPCA 5BS6A 1PJRA 3GEZA 2MH2A 2CW8A 4UV8A 3PFIA 3OS2A 3H9JA 2RQQA 4RGSA 2A69F 5L3FA 2CFXA 1GVJA 4A6DA 3DP7A 1JE8A 3SDBA 4LITA 1MGTA 3K1NA 3L2RA 1D0XA 3L2WA 1MD0A 2NYXA 1YW8A 1IRGA 2VBWA 1YS6A 3DU5A 3MKZA 1ZHFA 1KQ9A 4YIFA 1DP3A 2YR2A 4MEYF 4A6EA 3RKYA 3L2CA 2K4JA 4WX9A 2VL8A 2K9MA 2W7NA 2RNJA 2XKPA 2DT5A 3WGHA 4OIPF 1D1CA 2PFBA 1YX3A 3HRMA 3FXUA 2JPCA 2BVMA 3R0JA 3LMMA 4C9YA 3U1DA 3W6JB 3FMQA 2EV6A 1CF7A 3ZMZA 4P5OA 4ESBA 2KDOA 1P6RA 3NQOA 4L9VA 4AWXB 2LG4A 2WAFA 2E5NA 1FT9A 3QYBA 1SFXA 4IRIA 2V26A 5CJ9A 5AIQA 1RIOH 2QKLB 1J7KA 1IN6A 3DKXA 3VYTB 2L02A 4HSTA 2IS1A 4EVIA 4HV6A 4F92B 4PGHA 1J5YA 4E7HA 1S29A 3L2QA 1I1GA 1QQIA 3Q9SA 5D8LB 3H0DA 4XRFA 4BHCA 3S32A 1WJFA 3ZQQA 3DPUA 1FSHA 4YG2F 1CF7B 3P9CA 3TDUC 2GZWA 3KZYA 1MMGA 3VSLA 3R61A 1OYIA 2AQFA 3GFMA 1W5SA 3I53A 2XAUA 3LWFA 4AVZA 4IPAA 3LFUA 1X1DA 4Y17A 3P9IA 2K5CA 1LKXA 3EUKL 4OWRB 4CXFA 2KQRA 4YEJA 1ZG1A 2LOOA 2IP2A 4NQWA 1B9NA 1YIOA 1REPC 2Z33A 2VONA 4Y3OA 3ZMTA 1UAAA 3MKYB 3V7RA 3ONQA 3Q9VA 2CS3A 3MKWB 4HZFA 4D0PA 2BV6A 2EFWA 3ZCOA 4S05A 2BW3A 3J7AY 1WSUA 2NRAC 3RTRA 3WG9A 3HTSB 2QZ8A 4EJWA 3SEZA 2CSOA 4PK4A 2OZ6A 2G9WA 3R6SA 4NQWB 2VOPA 1TBXA 4G6DA 1U0JA 2E7WA 2CYYA 5ILSA 2GIVA 2VBZA 4IRHA 2F5CA 1BIAA 2BVLA 3GLXA 5E20A 2W84A 3T8TA 4AVPA 4L18B 2WV0A 1RNLA 2BW3B 1TQMA 4ITVA 3DV8A 2EA4A 4HQEA 4FHTA 2CWEA 1V4RA 1MNDA 4ESFA 4RLQA 4KIGA 2OV7A 4E70A 4LG0A 2KP6A 3FBNB 3K9TA 1YS7A 4DQ2A 2IGOA 1O57A 3SZTA 4HF1A 2FUG2 1Z1DA 1HSTA 4P96A 3N97A 1WRJA 2XROA 1J0RA 2DK8A 2FNPA 4IQ4A 4HSRA 4ENJA 4CO8A 4BXUA 2KZVA 1I5ZA 2LY1A 1P4WA 2PBIA 4E7LA 1UHMA 3V8LA 2K3PA 2AXLA 3ML6A 2HU9A 3I59A 2HS5A 2M7BA 3WE3A 2FXAA 4LG0B 4DIQA 4FT8A 1HXDA 5FD6A 2ELJA 4EM1A 5HNHA 1LB2A 5LRRA 2XF5A 1N75A 4OOIA 2DPUA 1SAXA 3BY6A 2DPDA 3IRQA 2MC3A 3DWLE 4FX0A 2FNAA 2R3SA 4OAYA 4HOBA 3CP8A 3WU0A 3B02A 3NWSA 5CLSA 4CCOA 3I59B 5EEHA 2DTRA 4ZTFA 3SEQA 2JTVA 3BPVA 3TOAA 3P7NA 2IA0A 3E6BA 3V4GA 4I0BA 4BH9A 3DEEA 2MABA 3KP2A 5LRSA 3BG7A 3ZQ7A 5JI6A 2VT2A 3NEUA 2ZBKA 2HDWA 2FQ3A 4BU2A 2XC7A 1E17A 4KA4A 2HGCA 1X1AA 4OIRF 1PP7U 4M9XA 3AAFA 4XL9A 1S7AA 5BMZA 5ICCA 2V79A 1KU7A 4F91B 2LDUA 4XKVA 1BBYA 2D1VA 4YRVA 3BWGA 3EQLF 5D4RA 1V5FA 2KJCA 4KN7X 3S3NA 2UUZA 3L2UA 4MLOA 2XAFA 3HSEA 4KFCA 4YIIA 2NNNA 1V3FA 1MJAA 1UG0A 3LAPA 1QZZA 1ODDA 3OYNA 3S2WA 2Y0SA 5LBQA 4M73A 1SFUA 5HDNA 2VQCA 1EH6A 3GFLA 1FBQA 2A61A 5HS8A 2QVOA 3ZMSA 1HA8A 4HLXA 4CCJA 1ZYRF 1IN8A 3OR2C 2P8TA 1WFXA 2H94A 2X1EA 2MLGA 3DTKA 2QUFA 2DCEA 2HTSA 5DCMA 3RPQA 5LFAA 3H5RA 1BI0A 3EUHA 5BQTA 1BM9A 2F5FA 5LGTA 2HVQA 1V5GA 4ZDLA 5FB2A 4OU0A 4MTDA 2M45A 2J5PA 3KFWX 1D8JA 3RPUA 1X4PA 4L0ZB 3MEXA 3OOUA 5DD8A 4RB3C 4ZC3A 2LNBA 1B1BA 4R8HA 3RIRA 1SD4A 4CUGA 1G6NA 4Y33A 1FYKA 1DGRM 5CYVA 1KU2A 5DCMB 3SZPA 4D9JA 3D5LA 2LYCA 2PLYA 3L9FA 5LLQA 2NS0A 3EUHC 4B3XA 4KNYA 4NB5A 1OKRA 2O6GE 4Q4ZF 2L3DA 1HKSA 4Y15A 3TBIA 1J2XA 3DLAA 3V8KA 1MMNA 4E7KA 1MNEA 4LIUA 3BPXA 3EUAA 3TMOA 4L5IA 3FM3A 3QAHA 1FOKA 3I5UA 3FF5A 4NC8A 1HW5A 5D4SA 1XCVA 2A3SA 3OYCA 4I2OA 2FBIA 2RQPA 1XD7A 1SFEA 4XM3A 4RB1A 2GXBA 1XGMA 3ULQB 1D5VA 2O61A 5JHFA 3L2VA 3J81K 2R7XA 2Y0MA 2L2OA 3H92A 4ESJA 5DV5A 2ZXJA 3BCAA 3OY9A 4XOPA 4BEHA 1R36A 2V7FA 5HOOA 3KE2A 3LAJA 4CCNA 3GFJA 4ZZLA 2VPLA 1IW7F 4R1HA 4M71A 4KMFA 2JSCA 3V42A 2HYFA 3F6VA 4ZTJA 5F64A 1HW2A 2K02A 4FX4A 2VASA 2M30A 4I7HA 5K5QA 2CMPA 3E1SA 3TOBA 4U87A 3LSHA 2KL4A 4ZYGA 3WTSC 3DPLC 4G6TB 2OBPA 2OC6A 1TTYA 3RDIA 4BHPA 2LREA 3A4CA 1YLFA 5HLGA 4G7ZF 4EQQA 3HRUA 5F1RA 5BOXA 1X1CA 4BEHB 4G94A 4EJVA 3H3ZA 3J81Z 1R5HA 3MWMA 3ZRGA 3OL3A 4F55A 3F6OA 3T8RA 2CW7A 3HL2A 4M74A 1WWXA 1R6RA 4XKWA 2M5WA 4HF0A 2E1CA 4OAZA 1IXCA 1LNWA 3K70C 4WXCA 1S9HA 2RV8A 4QPQA 4JOMA 3DXJF 2TDXA 2IA1A 1E0EA 3EYYA 2DOAA 2DXIA 3OYHA 3MZYA 5KHDA 2A6HF 1USTA 2P5KA 4ZYAA 2KJBA 3W6KB 4HW0A 2WAQA 4QLCU 4WCGA 1WJAA 3PNVA 3HG9A 3LSMA 3PSFA 1S8NA 2JA2A 3M7GA 1G3SA 4U7BA 1FLIA 2M4GA 3V8JA 3I9V2 1R58A 4RM2A 2ESNA 1D8KA 2HYGD 4BGDA 3WTTC 4IJAA 3VWBA 4BNCA 5FRNA 5D6FA 1YW7A 2CO5A 3HHHA 2PQ8A 2VJIA 4CZCA 2V9VA 3PQKA 4P9FA 2ISYA 3JSOA 3ZN0A 2WB1A 4I0AA 2XAQA 3QYEA 1I27A 1R5GA 4N0BA 4I09A 2D45A 2MD5A 1O3TA 2CG4A 2Q8KA 3HXLA 1HW1A 4EV0A 4XORA 5FO5A 4WF2A 3VOEA 2FU4A 5LEJA 2WWYA 1OMIA 2VE9A 2ADUA 2GQQA 2EFOA 4XN3A 2M3AA 2XF7A 2E60A 3LA2A 2W82A 2MBFA 4XLFA 5E18F 1DPRA 4HPQA 1LDJA 3K10A 4BAYA 2KRFA 2Z2SB 1DPUA 1FP1D 1K78A 2DT6A 2R7TA 1XGNA 3O2PE 3TO9A 5HDGA 4CYDA 2VE8A 3V7SA 3GYHX 4ANJA 2ACJA 2P7CB 1YQAA 2XVCA 2FA5A 1XSDA 3WGGA 2XIGA 1J9IA 3HC7A 1R00A 2HDCA 3RYPA 3OR1C 4XR6A 1E2XA 1BIBA 5D5UB 2H6BA 1T98A 4LK1F 1O3QA 2Y75A 1WJDA 2OQGA 3FHNA 5KNLA 1K78B 1QNTA 3KEOA 3KP4A 4BJ5C 4KIFA 3CO7C 2M8EA 4B8XA 1EV7A 1G59A 2ZJ2A 2R7UA 4ZYDA 2KHMA 3DTIA 3K6GA 3VSKA 3CLOA 4MQVA 1P2FA 1K79A 1F5TA 3FXRA 4CSWA 5J6XA 4HF2A 4BDYA 2LF7A 1DDNA 2IGNA 2VBYA 2P4WA 3C2HA 3U2RA 3VYRB 4N4NB 3G2BA 2VLAA 2WA0A 4EMSA 1S3JA 2ZCWA 3E6CC 2ELHA 4RMNA 2HWVA 1IRXA 1XSXA 5AONA 2ZNZA 1YX5A 3W3CA 4XMYA 4YFNF 4Q47A 5D5VB 2WAEA 4HNUA 4RM3A 4G7HF 3UNGC 4OMZA 3G3ZA 3K2ZA 3OYJA 3B73A 2W25A 2EV5A 1L3LA 5LHIA 3K69A 2XKOA 2YU3A 2VQLA 2JZYA 3IWFA 5AIPA 4ON0A 1Z7LA 4RB2C 2XUBA 2IA2A 2W4SA 5DEQA 4A0XA 1O3SA 2NAZA 4I02A 3GXOA 4OIOF 4WXDA 4FETA 4PDKA 3CZ6A 1S7OA 3PL8A 3E3VA 1FP2A 3UR3C 1ZRCA 2M4KA 1OR7A 4EJTA 4CGZA 2DFIA 3K70D 1JGSA 2KIFA 4LB6B 1B6AA 2F2EA 2V1NA 3OYFA 4BE0A 1TQPA 4XLPF 1I6XA 3OIPA 5CVUA 3VDXA 3K4BA 3RJPA 4A5NA 3PQJA 2WY7Q 2FMLA 2VJ4A 4IRGA 1W4MA 2YX7A 1OR7C 1K7AA 3QRFF 5A2QK 3QP5A 1D3YA 3GUDA 4HDUA 4GGGA 4PSWA 2KKOA 2PJRA 1IXRC 1ONVA 4DJAA 1XN7A 2RDPA 4EJUA 3NRVA 5ICFA 2CGPA 2QQBA 4MQ9F 4NC7A 3FZVA 2RN7A 1F4KA 1FWZA 1R22A 1NG7A 4I98B 4B43A 2YX4A 3T1BA 2LBFA 3IC7A 1BN5A 3WTWC 1U5TA 4HA8A 2ZXHA 3QU6A 1CGPA 4AD9A 3DQVC 3ZP5A 2FSWA 2L01A 2EK5A 2YSRA 1AA7A 1FZPB 4RAZA 3K0LA 4O3MA 2PJRB 2HPMA 2M0MA 4DBRA 2KRCA 3PSIA 5L3GA 1FMVA 1JI8A 1STZA 4P9UA 2AS5F 1D1AA 2R7FA 5HS7A 3K4JA 2Y48A 1F9NA 3E97A 2V9KA 4KT5C 2LBFB 1WJEA 2MFZA 1U5TB 4U0YA 1QU3A 3OYEA 3AKZA 4CA0A 1ZRDA 3ERED 1J75A 4K2EA 2PMUA 3WTZA 2H6CA 5EEGA 1LEAA 3GZ6A 5IT9K 1USSA 3H9GA 3KEYA 2PG4A 2V6EA 2IGMA 2X0LA 3LQQA 1ON2A 3F72A 5JVTA 4H0EA 1QGPA 2WBMA 1ON1A 1BR2A 4N9HA 1EA3A 4LD5A 3OOPA 3J7AO 4XLAA 2FF4A 1W5TA 4Q48A 4DGWB 1VTNC 4IF4A 3OS1A 2E1NA 4HBLA 3F8NA 2EV0A 1QZYA 2W24A 5FD5A 2XGXA 2X1CA 2ZSHB 4UVCA 1U8RA 2HFHA 2V6CA 3IUOA 3I64A 1XDUA 4XN0A 2HPIA 3H3UA 3OYIA 2VODA 1NG6A 5IT9Z 5ED4A 2VB6A 4QWQA 3JSPA 3W2VA 4F3QA 3IKVA 3ISPA 3I54A 1QHHD 4GRIA 2BE5F 5ICGA 5E1XA 3KP6A 5E1ZB 2VQHA 3IHUA 4R79A 2DK5A 2CV1A 3DKYA 3T0YA 4IZZA 4MTEA 3OYMA 1YG2A 4EATA 2ZNYA 3A1YA 4ZJZA 2DI3A 3GVAA 2MC4A 4N9IA 2R7OA 1ZLKA 1BR1A 2LF8A 4UVAA 3KLNA 2P5LC 1QBJA 5LGUA 1OLTA 4IVNA 2EFPA 4F93B 1ZRFA 4N4OB 4WWCA 2D2WA 2PJPA 1RUNA 1ZARA 3S93A 2O03A 5D6EA 3SQNA 2MYSA 1R23A 2ZFUA 3SXYA 2IS6A 1KQ8A 3OYLA 3TL4X 1QO0D 1ZGJA 3I71A 2VJJA 3F8CA 5FLXK 4PCQA 4BS9A 4Q5SF 4EGZA 2E5ZA 3BLYA 3CUOA 3F23A 2W57A 4XKCA 4II3A 3FMSA 4M9ZA 3QOPA 5FGMA 5E1WA 4PFOA 3O3KA 3H35A 1Y56A 5FROA 3C1DA 4ASNA 2MA3A 1SMYF 1X3UA 3GZ5A 3M8JA 1D1BA 1H9GA 3SZGA 1TT0A 1WKMA 3K4CA 2ZMEA 3E5QA 3RCOA 2R7QA 2P6SA 1G8XA 5D8KB 3C2GA 4X0GA 5FLXZ 5TJJA 3OWTA 2IS2A 2C6YA 2LRDA 4C2UA 4P1WA 1BOBA 1J09A 2VKDA 1P9QC 3KCCA 3OYGA 1FC3A 3OV8A 1XB4A 2JRTA 2FEZA 5IT3A 2V1UA 2ZMEB 4LJZF 4PJJA 1A04A 1Z21A 4M72A 3GBGA 1LDKB 5L3DA 4HX4A 4TV7A 3ZPLA 1HKQA 4LLGF 5J8FA 1IN5A 3DU6A 1BJAA 1ZELA 4ZH4F 4RGRA 2EFQA 3DEUA 1UFMA 5L3CA 1T95A 4XLNF 3CF2A 5CQEA 1ZG5A 2XAHA 3HSRA 3T5XA 3BC8A 3IKTA 1ZREA 2CQKA 1FYMA 2EA2A 4ENNA 3DFGA 4UXNA 1AWCA 1BI1A 2FBHA 3F3XA 2W85A 3OYDA 4IHTA 4XONA 3G73A 3EPZA 4BJ6C 4BUPA 3OYKA 3E0JB 3HUGA 1Z6TA 4KJZA 4F52A 1L0OC 4HRIA 1AOYA 1LEBA 3ZR8X 1XDSA 2L54A 2QM3A 4YFKF 1MJ9A 2ZXIA 1UHWA 4IKFA 1G3YA 3MQ0A 5ILVA 2X6YA 1ZGAA 1FY7A 1LQ1A 4HQMA 4MNUA 1Z05A 4ZDOA 3DKWA 5HVQC 1IN7A 2DQLA 4EM2A 3OIQA 4E7ZA 1MZBA 2B0LA 3HUGB 3LL7A 2P5VA 2K9LA 2IGKA 1BC7C 1TW2A 4OIQF 3WODF 1ERDA 4A2UA 4RGUA 1T2KA 1P92A 1K6OA 2XASA 1Y0UA 4LLNA 2DJIA 4XQFA 3A2KA 3LSGA 2R7WA 1YTYA 1OYYA 3IAS2 1ZN2A 1I1SA 4QPOA 4HX7A 2QYOA 4RAYA 2O8XA 2QKMB 2P7VB 3WTVC 3HPHA 3BG6A 2KRHA 3R0AA 3KEQA 2BOLA 2IW5A 2XAGA 3EYIA 2RREA 3ABTA 2H27A 2A6EF 2DBBA 4G6QA 1T0FA 3QP6A 1BI2A 2F4IA 2QWWA 3CUQA 2F5VA 5JR3A 3OYBA 3HTUA 3K1MA 2STWA 3QYFA 2HNHA 4PSXA 2UWMA 4DNCA 3VFZA 4ENMA 1KU9A 4BE1A 5CKTA 3EDPA 4II2A 1XSVA 4IX7A 3VODA 3CO6C 1YW9A 3H9QA 2L5QA 1YYVA 4BDZA 3VYSB 1G3TA 2L9SA 2V1XA 2L7KA 4Y4RA 3MZHA 4H4KC 4P55A 4XLCA 1IRFA 2VN2A 3DF8A 1T0FC 4MGRA 3RQ4A 3CUQB 3Q5FA 4Y13A 2ZKZA 3OMYA 2R7DA 3ECHA 4PJLA 3BP8A 2YPRA 3IRRA 1K6YA 4JBAA 5H6RA 3E6DA 5K5OA 3DPTA 1P4XA 4XNFA 4HAMA 4A0YA 5E8GA 3QODA 4L9NA 2A5WA 5ILUA 2A68F 1DP7P 4CH7A 1SD7A 3VEPA 3GF2A 5ERIA 5FRMA 2PI0A 4CCMA 4AIJA 2Q1ZB 3IL2A 2RC4A 1IAWA 2Z5UA 1TNTA 4J00A 2XRNA 4KIBA 3CESA 5DUIA 1W7PA 3C18A 3TQNA 2P0WA 4WXHA 2VJ5A 1SAUA 1MW7A 3MMYB 3WTUC 4KN4X 2UV1A 3BCBA 2GA1A 5D5XB 2HQNA 3RPUD 1R1TA 3HRTA 3KP7A 4XSZF 1VZ0A 3D0SA 3CMMA 2K86A 4U7DA 1XCBA 3CTAA 3SFZA 4RLFA 3ECOA 3D5RC 3PNTA 1XGOA 4M9SA 2GAUA 3AL0B 3AL0C 4KYWA 1GXQA 5DCFA 3ZMDA 4LFUA 4GXOA 1GXPA 1W7PB 3U21A 5DDGA 4AIHA 5HLTA 1JXSA 4L9TA 3S3MA 5HNFA 4PJNA 2IPQX 4A5MA 3N4MA 3TDZC 4CZZA 2KPMA 2O0YA 5JHUA 5J8CA 2J5OA 4L5JA 2LH9A 4EGYA 2Z1DA 4D1QA 1TNSA 4J01A 3MFKA 2JVHA 3GX4X 3SHFA 4YELA 1UB9A 5JFRA 2PN6A 2HQRA 2IXSA 3C7JA 3R60A 4C2TA 2GOXB 2WTEA 2A5YB 1N77A 2PEXA 1Z7UA 3NWTA 2V1DA 2HKOA 2G7HA 3QPTA 1OYWA 4LK0F 2O3FA 2HZDA 1IUYA 5CPRB 1PP8F