4NC8A

N-terminal domain of delta-subunit of rna polymerase complexed with nickel ions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
KQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit delta
publication title X-ray vs. NMR structure of N-terminal domain of delta-subunit of RNA polymerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 23
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nc8A00
4NC7A 4NC8A 2KRCA 2M4KA
chains in the Genus database with same CATH superfamily
2LY9A 5K5RA 1SMYF 1CF7B 3IWZA 2IGMA 4EEFG 4U7BA 3IH4A 3I64A 2KHMA 4ENKA 3LAJA 4XKCA 1JTXA 3W2AA 1Z77A 3ZCOA 2A5WA 4KN4X 3WU1B 4EATA 4N0BA 3S17J 1WI9A 3DBLB 2YX7A 3FKJA 3MWMA 2WY7Q 3B6AA 1S9HA 5J1YA 1IUFA 3GWZA 5KNLA 1BBYA 4J01A 4EJUA 4X6AJ 3G2BA 3PO3J 1WFXA 5CVJA 3KIOA 2M30A 2RVCA 3IHUA 1HF0A 2HU9A 3JRGA 1HA8A 1WJCA 1YHQI 5D8KB 4RGXA 2A61A 5GP9A 4CO8A 5IP9J 1ZHFA 3BG9A 3LWFA 1QPIA 4E7HA 2ID3A 5HDGA 3W6JB 2O9LA 1EA3A 2DK8A 1Z3XA 2HR3A 3PJRA 2CQKA 1IRFA 2YPRA 1IRGA 2IA0A 3GBGA 2XF5A 4IF4A 3GTJJ 1JJ8C 1KQ9A 1EV7A 4M3DA 2NVUB 2L7MP 1Y1WJ 3J7AY 3ZRGA 4JBAA 1Y0UA 2O0YA 2B7EA 1I1SA 3C2HA 2PEXA 4JYKA 5DCFA 3MZHA 4LB5A 2WTEA 3OYCA 5K1YA 1FYKA 2EFQA 1TBXA 1W5TA 3IWFA 3CUQC 1ZREA 2O03A 2DMUA 1YI2I 1IUYA 3MKYB 1XGOA 2DT7B 1D8KA 2VT3A 2E71A 1BL0A 3DWLE 1HKQA 2DFEA 3I4NJ 1I39A 3TMOA 1F43A 2DW4A 4B4CA 2KIMA 4ASNA 3BZKA 2LYCA 3LFUA 3K1MA 1F36A 3HRMA 3W2WA 4UUTA 3WTXC 2ELKA 4UHTA 1P7IA 3MZ8A 1MZBA 2GXAA 3M1CA 2M8GX 3EUAA 1PJRA 3WU2C 1IN5A 5D5UB 1FPQA 1WVRA 5D6EA 4OWRB 2PJPA 2VN2A 3F8CA 1LE8A 4BXFA 4BE2A 1LEBA 1BW6A 2MG4A 3WE3A 1YX5A 1V5EA 4L5JA 4EVIA 2XAGA 1V3FA 2PBIA 2KDOA 3GLXA 9ANTA 4DJAA 2E1OA 2G7UA 5JHUA 2DDBA 5F6FA 1FSEA 2K4JA 2ZXWH 2KQRA 5HDNA 1SD7A 2M3AA 5IYCJ 2XPUA 2R7WA 3RPQA 3HOYJ 4BH9A 3K9TA 2L3DA 4XN3A 4NBQA 4AUXA 1WJAA 1GDTA 1T38A 3M1EA 5CYVA 2PX9A 4Y3OA 4LLGF 3BWGA 3LSHA 3EETA 4EJWA 2PI0A 3KFWX 3H35A 3TP3A 1R00A 5TISC 3ZMDA 3DPLC 2IEKA 2D1HA 2KRCA 2Z9OA 2XKPA 4BBRJ 1Y6IA 3SFIA 2B9SA 1LE8B 3GTQJ 1A31A 2MYSA 1J09A 3LSGA 1TWGJ 1P4WA 5CVVA 5EG0A 3LMMA 3KP6A 1RZ4A 1LJ9A 4M71A 1UHSA 3L2WA 1GHCA 1TQIA 1LKXA 1IW7F 3DPUA 1T39A 4I09A 4MFEA 4Y33A 1MBJA 1NTCA 4JP0A 2YU3A 1EJ9A 1TQPA 4LD5A 5CLSA 2VPLA 4HSRA 2E1MC 5DYMA 2ZKZA 3K4MA 1R5GA 2QQBA 4J19A 4E7SA 3M3YJ 3H92A 1LPQA 3ZGKA 1XS9A 1W4MA 2VQHA 4GYIA 1MNEA 5A2QK 1U5TA 2ACJA 3BQZA 2CU7A 1FMWA 5KAIC 4WXDA 3DCFA 2DQRA 4G7OF 1QHGA 4A3MJ 2HQNA 1ZG3A 3PNTA 4LB6B 3V7SA 4F7ZA 4MO7A 2MW8A 3GZ6A 1P4AA 4I6ZA 3VYSB 4AYBN 3ZQGA 4IEJA 4RBOA 2W25A 2JJ7A 1OR7A 4PK4A 4E7LA 4P9FA 3CMEI 5EG0B 1O4XA 1U2WA 1AHDP 4U0WA 3ZQFA 2HPIA 1TWHJ 1UCRA 4UVAA 3I55I 4M9XA 2D5VA 3E97A 3VYTB 2F5FA 2STWA 3WG7H 1Q1VA 1PUEE 4BHBA 3HHHA 1N75A 1REPC 3GO5A 1WJEA 3BR5A 4I76A 5BMZA 3J7ZI 1Z05A 1WRJA 1R58A 1Y39A 1ETXA 3CMAI 5M5XJ 4KT6A 1U5TB 4BY1J 2QCOA 3CJNA 5C4JJ 2Y75A 3EYIA 2QYOA 1UFMA 1TZLA 4A3FJ 5CKTA 1XDSA 2FNAA 1ITYA 4EM2A 2QQ9A 4M74A 1GXPA 3DPTA 3JAMK 3MFKA 3EYYA 1YX3A 4ON0A 3JTGA 1B6AA 2M34A 3I71A 5EZHA 3PUBA 5IY5H 2K86A 4DZJA 4CZZA 2M4KA 2DOFA 3GTKJ 2FQ3A 4XRSA 1JKOC 3DU6A 5HLTA 2BOLA 5L3EA 4WWCA 2R7ZJ 5JVTA 3OIPA 4ZDOA 5IT9K 2HVQA 1I5ZA 2M4GA 3CTAA 4D1QA 4WF2A 3QRFF 2IPQX 2UV1A 3WTZA 3R4KA 5ICGA 1Z21A 4RLQA 2TCTA 3RZOJ 1V54H 1XGNA 3CLQA 2HQ5A 3BTIA 1LFUP 1BC8C 1T0FA 2MSYA 2V1DA 2QWWA 3QU6A 1MMNA 3QODA 3T8TA 3RKWA 1L0OC 2FOWA 1U8BA 3HOVJ 5C44J 3O2PE 1FTTA 1W0UA 1MMAA 1B8IA 4LG3A 3OL3A 5KK1A 1ZELA 5HLGA 4MHGA 1XB4A 1JUSA 5IP7J 1JHHA 3OYLA 5L3BA 3SZGA 5BS6A 3HG9A 4NDLA 3M07A 1XMKA 2JA2A 4Y17A 4G9YA 2DT5A 2L02A 2WV0A 1EH7A 4A3KJ 2CRGA 3I54A 5TGTA 3RKQA 2XB0X 2UXXA 3BP8A 1IGNA 1YYVA 5CVUA 2PMHA 3ZQCA 1D5VA 4A5MA 4IXAA 1TWFJ 2JSCA 2RREA 3SHFA 4RM3A 5B66C 2Z5UA 5F64A 2DMTA 1B9NA 4RGUA 2O8KA 2VT2A 4AIKA 4CA0A 1LNWA 2OQRA 2Y0MA 1WZ2A 5KAFC 3LA7A 2F5DA 1QZYA 2M1BA 3KE2A 4HNTA 5IOZA 3H36A 4A3DJ 2LF7A 4MQ9F 1D0XA 1B8IB 4OMYA 2EFOA 3LQRA 5JFRA 4OAYA 1S29A 3KEYA 4NNJA 3J81Z 4ZYAA 1AKHA 4P55A 3FISA 1KU9A 5CQEA 1V55H 3KYLA 1IN6A 2KDZA 2W4SA 2E1NA 2XSJC 1MBGA 1TNSA 3AL0C 1FC3A 3FK6A 3RPUD 4MIMA 2UWMA 4A5NA 1O3SA 1TLHB 2EA2A 4E6KG 3WGHA 2ZMEA 1FEXA 1Z1DA 1HC8A 2FA5A 4CCLA 4RS8A 2HYJA 3Q3SA 3JW4A 1ZGAA 4XM3A 2XGXA 2ZXJA 3U1KA 2A07F 1P92A 4F92B 2F5CA 1RUOA 2KPMA 3V42A 5F08A 3D5RC 1R49A 3PUFA 2NVTJ 4QIWN 1POGA 5LGUA 3JRDA 3MKLA 2ZC2A 4BDYA 2JPCA 3HOXJ 1D5YA 3GTMJ 1N78A 2EJRA 4XKVA 2BVLA 1E17A 1VQPI 2XAFA 4QPQA 4WXCA 4C3JJ 2NRAC 2OPTA 4YIIA 4I7HA 2OAZA 2AXLA 3MD2A 1AKHB 2GLOA 2D2WA 5F04A 1BI0A 2QBYA 3BR1A 2JZYA 2J5PA 1GLNA 4PJ0C 2H8WA 2Y2ZA 3S2HJ 3IAM2 2EBIA 4RB3C 3D5LA 3IRQA 3ZQLA 3FDYA 3DBRB 2JUGA 4LK1F 1STZA 4RGRA 1WGXA 1SVLA 4IRHA 3S32A 2ZFUA 4B3AA 4BXXJ 1D1AA 5JVGF 2QGUA 1JGSA 2ZMEB 4D5FA 5HVQC 1VF9A 2IXSA 3K69A 4MTDA 3BQYA 1BJZA 1YIJI 3BG7A 4M6YA 2X85A 1R1TA 5J8CA 2L9VA 3M4OJ 3OYMA 2VKEA 1XSDA 1LB2A 1KQ0A 3MZYA 3BG6A 3KP5A 2VOOA 2LY1A 2XASA 2LLKA 1PUFA 5H20A 4OU0A 1A36A 3UR3C 4ETSA 1JKQC 1MKMA 5E3LA 2MGQA 3FXUA 4HQEA 5FKLA 1PDNC 2HZDA 5E8IA 3KP7A 2P5KA 3K6GA 4HA8A 4FT8A 3R60A 1IAWA 2D45A 2QBYB 2E2HJ 4L18B 2OD5A 4BYYA 4FX4A 3OL4A 1IV8A 3BROA 4RAFA 3W3CA 4GDFA 1HW2A 1TWCJ 1RPWA 2DJIA 1LDDA 1I6HJ 3GYHX 3D1NI 1SFOJ 4HF0A 1UHMA 1RESA 2ECBA 4L9TA 2ETHA 5A2QZ 3WHCA 3OYHA 2DXIA 3CDIA 1LDJA 1I1GA 5EEHA 1R22A 4XLPF 2PFBA 1FIAA 4BHPA 2KIUA 2BY1A 2CQNA 2F6CA 2OA4A 3AG3H 4I2OA 1J7KA 5ICCA 4AIJA 4HV6A 3LAPA 1WPKA 3G1OA 3HUGA 1WHUA 2JWTA 3V8LA 3ZN0A 1PUFB 2HVSA 2STTA 1ZH5A 4W1UA 5FLVA 4V19K 4V2FA 2VE8A 5DV5A 4B8XA 5FFXA 3G1LA 1DP3A 4BJ6C 3ZQ7A 3OSFA 1FX7A 1GUUA 3COAC 2X6YA 2JVGA 1T8IA 4HOBA 1O57A 4IVNA 4XLNF 4ZJZA 5EDNA 3ZMTA 6PAXA 1ZRFA 3LNQA 1PYVA 3BJAA 3QU3A 2IJLA 1ETYA 2BHYA 1Y56A 2VL8A 4X1EA 3WHBA 1R23A 1SD6A 2VIXA 3QYFA 3OYAA 1MNMC 2Y69H 3HTSB 1KU7A 3CDLA 4WXHA 3OYDA 5AIQA 3A4CA 1IO2A 3S16J 4A0ZA 2FF4A 1I3QJ 3WG9A 2OUMA 3FK7A 3JAMZ 2DOEA 3GEZA 3TW7A 1G3WA 2CFXA 3HUGB 3RI4A 2XAHA 4G7HF 1FT9A 1XCBA 1H9GA 5J40A 3QPHA 3CUOA 2AO9A 3F72A 4IKFA 1GV5A 1UELB 1MMDA 1IN4A 5IT9Z 1R5ID 1S8NA 1QPMA 3H9JA 4A3GJ 2V9PA 2Y31A 1SFXA 3S1RJ 2B63J 1FOXA 1IXRC 1HOMA 4ZYDA 2X1DA 1X1AA 4HX7A 1KU2A 5B3SH 4HX4A 2PJRA 2W57A 3JRIA 2JRMA 3TEDA 2FBHA 1E3HA 3PNYA 3Q0WA 1O3RA 1JUPA 3BCAA 4CCMA 1MJBA 2BVMA 1K61A 2IS1A 2BHZA 1LVKA 3RYPA 4N9IA 2W82A 4DBQA 3RCOA 2PG4A 1SVMA 4EM1A 4A3EJ 1HKSA 1OCTC 1B72A 2JA6J 2BXYA 5M5WJ 2L7ZA 1U9NA 3K1PA 3P7NA 4XR6A 1WSUA 3QP6A 3SEQA 1YOVB 3OYGA 4XLAA 3DKXA 4UNOA 1WWXA 1ULYA 4BJ5C 2ISYA 3RQ4A 2HVRA 3OOUA 2RDPA 1OISA 4GGGA 1IN8A 4YEJA 2W00A 1IN7A 1UG2A 4AIHA 2V9VA 1QA6A 2O7OA 2DFHA 3W6KB 2WAQN 1FOWA 2VJ4A 3CD6I 5DD4A 3N4MA 3I3LA 2K3FA 1FP2A 5IP6A 3RPUA 2UZKA 2OZUA 3G3ZA 4KN7X 5CVIA 2ZJQF 1FOKA 2XAUA 4HEA2 2IVMA 1AU7A 2HOEA 5ILSA 1X4OA 3A2KA 3DLAA 2DA3A 4GRIA 1R71A 2CGPA 4Q4ZF 2FX0A 5BNGA 2PJRB 3A1YA 2HNHA 3L2QA 4JX6A 5LHGA 2F4MB 5H2FC 5HOOA 1YTYA 3E0JB 2R93J 2YU9J 2RQPA 4DNCA 2EILH 3HHGA 4BNCA 3ZQHA 2XSDC 3ISPA 1UMQA 1B72B 1RC9A 2EV0A 5F0CA 4Y15A 4C3IJ 2JT1A 4FETA 4RAYA 5L3CA 4B47A 5KHDA 5D4RA 5F27A 1QVTA 2E5ZA 3F21A 2Z3YA 2R5YA 1B1BA 1LFBA 3FX3A 3CCUI 4A12A 3B73A 1ZK8A 2BYVE 2P6SA 4S04A 2O61A 4PSWA 4I0AA 4XN0A 3OYNA 1ZG1A 1TC3C 3JRBA 2LK2A 4HRIA 1RETA 1QU3A 3IV5A 4HX8A 2DN0A 4IO9F 1UB9A 2AXTC 2P7CB 2X1EA 2DA1A 5DM6F 1MBFA 1XMXA 1IC8A 4RA2A 2DFIA 4BEHA 1PVEA 1UAAA 2M7BA 2F2EA 2L2OA 4B43A 1N25A 3CCVI 4ENMA 4XMYA 3MKWB 2PLYA 2NS7A 1O3QA 2B0LA 1FSHA 4RMNA 2V1UA 3K70C 1F9NA 1VQNI 4I99C 4BQOA 2FSWA 4XQFA 3TO9A 3E5XA 3CC2I 2K85A 2PMZA 2M0CA 4M6VA 1S72I 1G3YA 1WKMA 2WA0A 1SAXA 4F55A 2VKHA 4M73A 3NWTA 4IHTA 1XC5A 1R1UA 2HPMA 1I27A 2TDXA 1E3OC 4KJZA 3CF2A 2XAQA 3BTLA 3ELKA 4TV7A 2DPUA 3HTUA 1XSXA 2R5YB 2R3SA 2WAFA 3FXLA 4C9YA 5J8FA 2Z33A 4EM0B 3J7AO 3J80K 4NQWA 2LNBA 3LQQA 4AC0A 3HL2A 4L0ZB 1ZRDA 4D5CA 2FUG2 4I01A 1ZR4A 3K10A 5DCMA 1E2XA 2IGOA 1SAUA 2CV2A 1VQ6I 1NHAA 3ZQQA 4CH7A 1NG6A 4JX5A 3Q9SA 3HJEA 2R5ZA 4DYCA 1ON2A 4FISA 2P81A 4XK4A 3QYEA 3JR9A 2LTPA 3HBLA 3WODF 1LDKB 1XD7A 2OV7A 1LVAA 2NAZA 4XKBA 4IZZA 2HWVA 3KEQA 2W84A 5DUKA 3GFMA 2ZCWA 1TL8A 2VQLA 2IP2A 5K7ZA 2WY8Q 3I58A 4Q47A 1R1VA 2DLLA 4PSXA 1A5JA 1ETOA 4IOCF 2VJJA 4E7JA 1J5YA 4M72A 3PL8A 4XOTA 1K4TA 1ERDA 3QP5A 5JLWA 1I50J 2WAEA 1HDPA 2V79A 1XSVA 4LIVA 1ON1A 4RAZA 3CF5F 4HPQA 3OS1A 3BZCA 2X1CA 2XGDA 4NQWB 2E2JJ 2EIMH 3S15J 3FXQA 4D0PA 3CCLI 5DCMB 3DFGA 4RLFA 1Q1HA 3OOPA 2LSOA 3OYJA 4YFXF 1S7EA 2E36A 5CJ9A 4G12A 4ZZLA 3H9GA 3CCSI 1XCVA 2ZJPF 2R5ZB 1SD5A 4FASD 3DQVC 5FJ8J 3C1DA 3ESWB 3IKTA 2LF8A 2WWYA 4HZFA 3SEZA 4FQGA 1FLIA 3GCMA 3JSOA 1FIPA 3FXRA 3HB9A 1BOAA 5E79C 2XF6A 2HXIA 3MQ0A 2RKHA 3Q0UA 3HOZJ 5LEKA 3CCYA 5L3GA 3QYBA 2JUCA 4I02A 3U1DA 1K78A 1F5TA 3GW2A 1Y1VJ 4HF2A 2LRDA 4MGRA 4XLFA 2L4AA 3GUDA 3VEPA 2XAJA 3NWSA 3VFZA 3ECOA 3MEXA 1FJLA 3P9CA 4ZDPA 2OC6A 3U2RA 4BQAA 2XV4S 3BR0A 2HQAA 5LGNA 2X0LA 4KDPA 3KPHA 4CYDA 1VQOI 1VQ7I 3BC8A 4YG2F 5FD5A 2DOAA 3WTWC 2GOXB 3SJMA 1E0EA 2VBWA 2FMLA 3DEEA 4G7ZF 1MSFC 2F4IA 2BY2A 4U88A 2EK5A 3K1NA 2CQQA 3CMYA 1XX5A 2K5CA 3MCZA 5LFAA 1PP7U 2WC2A 1O7FA 3A0BC 3C2BA 5E20A 2R7SA 2AQFA 2L7KA 4I0BA 2XB5A 2Z2SB 2EV6A 3L2RA 4ZYEA 2LFBA 4R1HA 2DCEA 4X0GA 1K78B 5HDKA 2JSPA 3VPRA 5D5XB 1AWCA 3KETA 4HDUA 4RM2A 2LBFA 2MD5A 4J00A 3K70D 4LLLA 1BA5A 1KGSA 2QQ8A 4L9JA 2KZGA 4BQQA 3HRUA 3H5AA 2A69F 3HOWJ 4N4OB 1ZGJA 4BUPA 2OBPA 1SFUA 1DUXC 4CCJA 1VQLI 4DGWB 3H0DA 1DQUA 2RAEA 2RN7A 4GXOA 1T08B 5ILUA 3PQJA 4CCOA 1Y8RB 3HDDA 2XRLA 2KFDA 3JTHA 2L54A 3CCJI 3GZ5A 1KYWA 2WV1A 1HCRA 2O6GE 1YRNA 1MD0A 3JRHA 1LUJB 4BE1A 4D7MA 2M9HA 1GXQA 3G73A 4IJAA 2GAUA 3ABUA 1V5FA 2MC3A 5LRSA 1B9MA 1JE8A 3EUHA 3OR2C 2RV8A 2G9WA 2R92J 2G0EA 2Y9YA 2EIKH 4UY8I 3Q9VA 3H3VK 4AVZA 2I10A 5E1XA 2VQGA 3OIQA 4IHXA 2OCEA 2DT6A 3L2UA 3HRSA 2VQCA 5HS9A 4A2UA 2LBFB 4DOZA 3NRVA 4P9UA 5C4XJ 1ACIA 3BTCA 1V4RA 1FWZA 3WU0A 3ABKH 3ROUA 4A6DA 5LHIA 1Z7LA 2CV0A 4C2TA 4IQJA 1EF4A 1HKTA 2DU9A 3L00A 5DS9A 2CW0F 2DMNA 2HS5A 4YELA 3KYCB 3A0HC 1ZR2A 2QQAA 3S3NA 4EJOA 3WTTC 3C3WA 3HSRA 4HG2A 4K2EA 3OYKA 2ZNZA 2DMPA 1G4DA 3MAJA 2OF7A 3FKIJ 2P7VB 2VB6A 3PIPF 1IF1A 3DXJF 5B5EC 1YRNB 2R7FA 3HIFA 2COMA 5C3EJ 2Y30A 1RKTA 2HKOA 3GTPJ 1Z6TA 5LHHA 4MEXF 3AG2H 1VNDA 2ZBKA 3FBIB 4OOIA 5GTHC 1QQIA 3E6BA 2CS3A 1USSA 2MH9A 5E3NA 4IHVA 3ZR8X 2I8DA 1X2NA 5CQGA 1Z91A 1NG7A 1YIOA 3TOAA 2PN6A 2MABA 4ZH4F 1MBHA 1YQAA 3K4KA 3X2QH 1IDYA 3TP0A 2IS2A 5E17F 4ITVA 5FLMJ 3RTRA 2KZVA 4A3JJ 4Y4RA 2WB1A 4LK0F 2Y0SA 3BOQA 3HGYA 5DEQA 3ZPLA 1ORKA 4KIFA 2ZXHA 3F23A 1X58A 1JTYA 2CUEA 3PSIA 3TDUC 4EGZA 2R7DA 3P9IA 4AU7A 1J59A 4MLOA 3GLLA 1MMGA 2L0KA 2IGNA 1XG1A 3J80Z 4KMFA 5EEAA 4PJLA 4A3IJ 2KRHA 2VI6A 2CW8A 2VODA 2H6CA 3W2VA 2ADUA 1ZKGA 2HOAA 2L5QA 4LLNA 3RJPA 1MJ9A 3ZMUA 3FM5A 5J1RA 2RC4A 2XGCA 3BPVA 2H1LA 1AA7A 2MLGA 3CC4I 2NOJB 2EIJH 4M3FA 2E7WA 2CW7A 1S5LC 1D0YA 2LKPA 4BY7J 4Y52J 4ESBA 1KONA 5FLXK 2ME0A 1FNNA 1F4KA 3L1PA 3RZDJ 3HKZA 3NEUA 2ZO4A 1MH3A 2HEOA 4XRSG 5BPIA 1BI1A 1U5TC 2BEOA 1VQ4I 2HDWA 2QF7A 3L2VA 3IH3A 1OCOH 4FE4A 1ZG5A 3GF2A 3H9QA 2FXAA 2FMYA 1S3JA 2IRFG 4DYQA 1MGTA 1B59A 1ONVA 2HQRA 3K7AJ 5FKKA 5FRMA 1OR7C 2R0QC 2DBBA 4B44A 1JGGA 1H89C 1RUNA 1KZHA 1DGWY 3UNGC 3LOCA 4NC8A 4Z2YA 4QLCU 3CO7C 2YR2A 1APLC 3DEUA 2AQEA 5GADJ 1OMIA 1DPRA 1MH4A 4EV0A 4FX0A 3WTSC 3T5XA 3F8MA 3O8GA 5AIPA 4UV9A 2A3SA 2GXGA 3M9AA 4V2GA 2MLKA 3SQNA 2BW3A 5L3DA 5F0HA 3H5NA 3QQAA 3FMSA 1SD4A 2Z99A 5FROA 4GYGA 4DYRA 3O3KA 2E7XA 2UXNA 2WBMA 1WJBA 2DA5A 3HPHA 3H5RA 4ESFA 4QPOA 5JI6A 1DU0A 4O3MA 4ABZA 1O7LA 3VOEA 5E3OA 2NVQJ 2J5OA 1K6OA 1ODDA 3GFLA 3OIOA 1UJ8A 4DBRA 3OR1C 3KP3A 2QKMB 4FHTA 3ZMSA 2VC1A 4QWQA 2OCCH 1HSTA 3A01A 3K2ZA 4A3CJ 2I5UA 5KVRA 4ANJA 4OIPF 4HW0A 2QEXI 4ENNA 1MIJA 2JMWA 2A6HF 1XMAA 2AHQA 4ZTFA 1DDNA 3IP4B 4BQNA 1TW2A 5BPDA 1BM9A 3PNVA 2C6YA 3S1MJ 3V8KA 1KU3A 3HOTA 1VQ9I 2K3PA 3RKXA 4HBLA 3LSKA 3RKYA 1HQCA 2P5VA 3IRRA 1D8JA 3KEOA 2BW3B 1T0FC 2XPWA 4II2A 2L9NA 2JTVA 2LVSA 3CUQA 1XDUA 1T98A 2JA8J 2OTJI 4C30A 1RKWA 1G3SA 1QRYA 1FMVA 5HNFA 5IT3A 3VB2A 3FM3A 2XKOA 5CPRB 1D3YA 2R7OA 4CGZA 3FIWA 2LG4A 1V5GA 1CGPA 3IUOA 1J2XA 2BBYA 3A01B 3RQIA 4C3HJ 2CQXA 4A93J 1D0ZA 4IRIA 3AG1H 3QPTA 5DD8A 2KISA 2XRNA 3O8HA 2HTJA 3DBHB 5FD6A 1VFCA 1VQKI 1AOYA 4UB6C 4PGHA 3OYBA 4U7DA 2EZIA 2VASA 4B48A 1BIBA 4A0XA 1JT0A 4AIDA 3FHZA 3SDBA 5IPAA 3J7YJ 3S1NJ 3DTKA 2HOTA 3L7WA 3VYUB 3KLNA 3AKZA 4QSHA 1S6LA 3QWLA 4HF1A 5JR3A 5J1UA 2KJCA 2BE5F 1A04A 2H09A 3ASOH 1HW5A 1HW1A 1XGSA 1MBKA 5H6RA 3T1BA 1PP8F 2KP6A 3CZ6A 2EA4A 3CUQB 4XIDA 4BDZA 3RDIA 4RB0A 2JA7J 2R7TA 1BOBA 4HYEA 3A02A 2VBZA 4E4HA 1IRZA 1R6RA 2ZB9A 2QSHX 1U0JA 3QOEA 4E70A 1BN5A 4FCYA 1BC7C 1SVOA 1ENHA 1K79A 2H27A 2NVYJ 3NARA 1J75A 1CQTA 4U87A 5E18F 1LEAA 2FQ4A 2NXNB 3JSPA 1MDMA 2DQLA 2DA4A 1O3TA 2PMZN 1R4MB 3BCBA 2KL4A 3CDHA 3I53A 1X2MA 3JREA 3N05A 3S1QJ 3QPSA 5HS7A 4PCQA 1IXSB 4BE0A 1R5HA 3ZOBA 2L01A 3S8PA 1YJWI 1NK2P 2ESHA 2JK3A 2FD5A 2ZMEC 3I9V2 3LSPA 4WK8F 2RGVA 2F5VA 4UUSA 1RNLA 3BJ6A 3PM1A 4L0YB 2EB7A 3PQKA 5F0FA 3AG4H 4BS9A 5D5WB 2LREA 2K9NA 1YS6A 1EH8A 3DTIA 5GPAA 1TWAJ 1FP1D 4Q48A 2YS9A 2V7FA 4OIRF 2CYYA 2DODA 1FOYA 2CUFA 3BR6A 2K27A 3OY9A 1K6YA 1NK3P 3D5SC 2GWRA 2CWEA 3DP7A 3F0CA 1F1ZA 2HZTA 2VKDA 4HDVA 1ETVA 1FYLA 3FMQA 2N8GA 4EMSA 3CO6C 2HXOA 3K0LA 4IL6C 3L9FA 3LA3A 5D6FA 1X1CA 5IOYA 4ZC3A 4F52A 2KT0A 2QUFA 3BPXA 2QVOA 3WGGA 4UXNA 5IYDJ 3CLOA 4RB1A 2P4WA 4A3BJ 2BGCA 2CUZA 1IV6A 3G71I 1X3UA 1K4SA 3LFKA 1TT5B 5HNHA 2F4OB 3HEFA 3F8NA 5TRDA 2EZHA 2RNGA 4UUSB 2MFZA 4PFPA 2P8TA 4KIBA 1H0MA 4YFNF 2ZJRF 2VE9A 2HYGD 1JI8A 2UUZA 1QBJA 3TW6A 2FU4A 2CO5A 4P96A 2DYSH 2HTSA 1TW3A 1SANA 3K4NA 3CCRI 2E1MB 3EPZA 3BLYA 1XTAA 5FKNA 4R79A 5F1RA 5J3LA 3IC7A 3WTVC 3E6DA 3E7LA 3ML6A 3DTEA 2OJED 5E1WA 1DU6A 2FJ1A 2X48A 3I0TA 2E35A 3E1SA 3AFHA 4DIQA 1IZ1A 4E7ZA 1W1WE 1BI2A 3H1CA 3T0YA 4PUSA 3BJOA 5AONA 3FZVA 4F3QA 2R7RA 4FTHA 1FZPB 5GPCA 1K83J 2V1NA 2XUBA 3V8JA 2DDAA 3M7GA 1I3AA 5FLXZ 2Q0OA 4XOPA 3WTYC 1FYMA 2X6OA 4AWXB 5JLXA 1YJNI 2ZSHB 5M3MJ 1WI3A 1ETQA 3OS0A 3IAS2 4ZYGA 3L2CA 4IHSA 4KMUX 4BACA 3HGGA 2GIVA 5EGOA 2ICWG 2O3FA 3B02A 3ASNH 2EPFA 2EFWA 2XPVA 1TQMA 1UZCA 3K4LA 2JQ7A 2ZXIA 3K4JA 3IL2A 3JRAA 1QZZA 3P5JA 2MA3A 5DM7F 2CMPA 4XONA 3TDZC 3F3XA 3ULQB 5LRRA 5K5OA 2Y9ZA 2GBYA 3R6SA 4IX7A 1BI3A 3ZN1A 3J81K 2BXZA 2HKXA 4JOMA 4OAZA 3FWEA 3M8EA 4LITA 3R61A 3KP2A 2DA2A 2JRTA 4CYCA 4BEHB 4PJJA 1WJ5A 4O5VA 4M9SA 1D1BA 4UVCA 1IJWC 3TKYA 2TRTA 4EQQA 2M7AA 3L09A 1G6NA 2E1CA 4HAMA 3F9KA 3HPGA 2XF7A 3N97A 3F8FA 1DP7P 2M5WA 3E5QA 1P9QC 3RSNA 1SEUA 4IPAA 1VQ8I 1J9IA 1Z9CA 1OQYA 3MKZA 1YO5C 4GFBA 1X4PA 3GXOA 4YFKF 3VODA 2ZNYA 2BY0A 3DKYA 5BQTA 3WTUC 2WAQA 3TO6A 2XHKA 1EH6A 1YJ9I 4LJZF 5D4SA 1USTA 4BGDA 4IHWA 3AAFA 4KA4A 4G6DA 4ZZDA 4I98B 3K2AA 5EGOB 1IRXA 2Z16A 2NYXA 3HOUJ 4JX4A 4G94A 2JN6A 2YSRA 3EDPA 1U3EM 5HS8A 4H4KC 1YG2A 2IBDA 3CMMA 3E5UA 2O8XA 3SXYA 3ZXSA 1QNTA 1KA8A 2ISZA 2CH0A 4HNVA 3C2GA 2JPBA 2DAOA 2NNYA 1R9TJ 4U0VA 1ZARA 1MBEA 1YW9A 4LOCA 4CYCB 3JRFA 2IT0A 1FTZA 3RIRA 2L9SA 1FBUA 2LKSA 2ZFWA 2RNJA 1HSJA 5TJJA 5DDGA 1BR4A 1G3TA 1VI0A 3QPLA 3P9KA 4GO1A 2BY3A 2QSGX 2GZWA 2P0WA 4CCNA 5HODA 3REOA 4KICA 2K4BA 5M3FJ 5E3MA 1R4NB 1I6XA 1P2FA 2IW5A 2QSFX 2V1XA 4XLEA 1OFCX 5E8GA 2NS8A 3I4MJ 2KJBA 2MC4A 5B1AH 2VOPA 2NOGA 2K40A 2EQRA 5IYBJ 3LSJA 4IHYA 2X4HA 1G8XA 5GAHJ 2EINH 4UV8A 4OIQF 4EGYA 5M5YJ 2VJIA 4KYWA 1OLTA 1QGPA 2JA5J 1SFEA 4RB2C 2IS4A 1W7PD 3BR2A 4DQ2A 4CXFA 4KUMA 2ECCA 3O6BB 4G8XA 2CSOA 2GA2A 1YE9A 3FXKA 1H88C 2R7VA 5HLHA 1Y0NA 1T33A 2Y48A 2ID6A 4S05A 2LR8A 1QZEA 1Z67A 4B3XA 3DV8A 3GMEA 4ENJA 3F6VA 2YUSA 3PIOF 5D5VB 2XGEA 2K7LA 2CUJA 3C7JA 3H3UA 1VTNC 2HGCA 3TL4X 2NNNA 2ELHA 5CVRA 3TGNA 3AL0B 4CHUA 4HLXA 3CCQI 1BR2A 3E3VA 1BW5A 1SMTA 3KZYA 4CDGA 4CUGA 4EJVA 2NVXJ 1MMSA 2LH9A 5ICFA 3FXOA 1Z3YA 3KYDB 2FNPA 4NC6A 4D9JA 2XIGA 3E6CC 2FOKA 2KIQA 3GTLJ 3S2WA 4P5OA 2WB1N 1N77A 1DGRM 4ZTJA 3LSRA 4CICA 4RDUA 4BL0B 3HM5A 2Y0SN 3E6MA 2PQ8A 3CJTB 3PSFA 4RGSA 4MTEA 2ZJ2A 2FBKA 3MMYB 4KITB 2LOOA 3ECHA 2VONA 3F6OA 1BR1A 4LG0A 3WE2A 3CQZJ 3PO2J 1M1EB 2K9SA 2VXZA 2BV6A 1FBSA 1ETWA 3VWBA 4HQMA 2X6XA 2GM4A 2DMQA 4PDKA 3ONQA 5K7HA 4U0YA 1RIOH 3Q0VA 1HBXG 3Q5FA 4B09A 1T2KA 4UUVA 2HYFA 2LMDA 2KRFA 3BT9A 2V6CA 3FXJA 3ABLH 4M3GA 4YIRX 3GTGJ 4PGGA 1ZTRA 1SC7A 3LL7A 4PJMA 1GV2A 4G6QA 4L9VA 1ZYRF 4L5EA 3DLLF 4F91B 1OKRA 1X1PA 3M8JA 4GCVA 2ME6A 3HKZN 1W5CC 1G2HA 1OCRH 2BZTA 3QOPA 2H1KA 1OCZH 2OZ6A 1JKPC 2L4MA 2CJJA 2D1VA 1NH3A 3D0SA 4HV5A 2DO7A 1QHHD 2COBA 2G7HA 2Q8KA 3OMYA 1RR8C 3ZMVA 4LG0B 3LSMA 1OCCH 4AM3A 2R4GA 2VBYA 2ESNA 3MN2A 4OMZA 3FHNA 3ZQIA 5LBQA 2DA7A 4NUBA 5FRNA 3FBNB 1RR7A 1WH7A 2EV5A 2EFNA 3MVPA 3EUKL 3U9GA 1P6RA 2XVCA 5D8LB 2V4JC 3R0AA 3I56I 5EJCA 5EEGA 1OYIA 3T8RA 2VLAA 4XRFA 4KT5C 1U6GA 4MNUA 3KCCA 4NHJA 2P6TA 3GX4X 5ILVA 4WX9A 1U8RA 4BKXA 4CSWA 1TT0A 3SZTA 2GOMA 2FRHA 1UHWA 2R7XA 3KX2A 1MSEC 3K4CA 4AYBA 1SFKA 2DFFA 4N4NB 1RI7A 3LSTA 1D1CA 3S3MA 2Q2EA 2IGKA 4O6JA 3I4PA 3PFIA 5EYRA 2ELJA 3VYRB 4XICA 3FF5A 2VXDA 5J4YA 4L9NA 5K5QA 3G1MA 1T56A 4XKWA 3SFZA 2LKXA 2M45A 3CC7I 4WCGA 4MFDA 2A05A 1H8AC 1TTYA 2R7QA 5L3FA 2A6TA 1ZGWA 4EJTA 2EZKA 3UKGA 5K7FA 3TQNA 1MW7A 4W97A 4DW6A 1VQ5I 3CCEI 1WJFA 2VPRA 3S93A 4CZCA 1YW7A 4C2UA 1TP4A 2QM3A 4IQ4A 3CJQB 4AVPA 2M0MA 4XORA 2CQ7A 1S7OA 1YITI 1Z7UA 3IH2A 5FKOA 4HSTA 3CESA 1A6IA 2NS0A 1ZLJA 2HOSA 1E3PA 3ABTA 4MQVA 3ZMZA 4XSXF 3ERMA 2OTLI 1YW8A 2Q2EB 1R36A 5EF6A 2E2IJ 3HXLA 1A35A 4M6XA 2DTZA 5LLQA 4XSZF 2VUMJ 1ZQ3P 1X3ZB 1MNDA 2VC0A 1WQ2A 5FO5A 2XROA 5LD2C 1GVJA 2K02A 1P4XA 2L7FP 2W24A 3C18A 2DPDA 3IKVA 3HZJA 4A69C 4Y7NJ 3GTOJ 3G6EI 1LFPA 1QO0D 2K9LA 3V4GA 5LEJA 4MEYF 1OJLA 4A0YA 4P1WA 4BAYA 2E19A 2GXBA 3ZP5A 3M8FA 2LP0A 5BOXA 2DJNA 2GIZA 4H0EA 3KZZA 2YX4A 2L9RA 3OWTA 3FMRA 1ETKA 3H0GJ 4DZPA 1J0RA 3DEWA 1K7AA 2MBFA 4BHCA 4LIUA 2DI3A 2A68F 1W7PA 2E34A 2MH2A 4IOAF 2VKVA 3K4BA 3TBIA 2M2EA 1JUMA 3GFIA 2F48A 1W36C 4S0HB 5FKMA 3JCUC 2CG4A 3CJRB 3LSIA 3VSLA 2V26A 4NC7A 2XDVA 1FY7A 3KLOA 1VZ0A 4LFUA 1WJDA 3R0JA 4II3A 5J6XA 4HNUA 5H6QA 4FE7A 4HLYA 1KYZA 2IA2A 3NAUA 2WADA 5LGTA 4OINF 2AS5F 4PJNA 2DK5A 3KZIC 5J47A 1JJ6C 1Z6RA 2IA1A 4XNFA 2DYRH 1ZLKA 3A03A 3JRCA 1OCPA 4L5IA 5ERIA 5E1ZB 4BU2A 3OYIA 1G59A 3DF8A 1JT6A 1JHFA 3SDGA 1ZRCA 2F5EA 1OYWA 4XLHA 2RQQA 4E7KA 3I5UA 4JQFA 4A6EA 5ED4A 1UG0A 3EUHC 3VDXA 2K9MA 3V7CA 1VQMI 1JXSA 1W7PB 4BBSJ 4F93B 2DTRA 2P5LC 2E5NA 4LGWA 3S14J 2LD5A 1X3WB 3TOBA 5ICEA 1YS7A 2KIFA 3CP2A 2X6WA 4D7NA 3F8BA 2A5YB 2JVHA 1LQ1A 2HI3A 3VSKA 1HDDC 1HXDA 4CCKA 1KQ8A 2ZSIB 4BJTA 2LDUA 3F22A 4Z6YA 5JHFA 4XBFA 1ZN2A 3V7RA 5GAGJ 4A3LJ 1YLFA 5F1JA 1P7JA 5KCMA 1DPUA 2R7UA 1TNTA 2VBXA 4KIGA 1IG7A 3ABMH 2FE3A 2W85A 3BG5A 4Q5SF 3HSEA 2GA1A 3OS2A 2H8RA 3WGIA 3BY6A 4C2MJ 3EQLF 2HFHA 2H94A 4RAGA 2W1OA 1A6QA 2W48A 3B6CA 3BDDA 4M9ZA 2FEZA 4BXUA 5GAEJ 2IS6A 1XGMA 1Z0XA 2W7NA 2CV1A 4M3EA 2QLZA 1W5SA 4JK1X 3SZPA 1XPXA 2KKOA 3HYIA 4XRMA 4QTRA 3CCMI 1X19A 3DU5A 1QVUA 2O5RA 2K9QA 4LMYA 3GZNB 3RYRA 2QENA 1Y8QB 2KLOA 3H3ZA 4ZDLA 3BG3A 5B1BH 3GVAA 1JKRC 1OYYA 3DKWA 2EH3A 5FFZA 2H6BA 3U21A 2X9DA 3KP4A 3W6VA 3GFJA 4UVBA 3HRTA 3ERED 4KFCA 1ZAOA 2VJ5A 3S2DJ 3OSGA 4PZJA 2EWNA 2V6EA 4NB5A 4YRVA 5DUIA 3LA2A 1C0WA 1BIAA 3HSFA 1OPCA 1H9TA 2HDCA 4N9HA 3I59A 4IRGA 1U9OA 3G4SI 2OQGA 2EZLA 3BZ6A 2Q1ZB 4XLCA 1T6SA 3CP8A 1CF7A 3BTJA 1HLVA 1B4AA 1BJAA 2IAIA 1EKEA 1X1BA 2QKLB 2QZ8A 1WCMJ 2DA6A 1MJAA 2V9KA 3OV8A 1IDZA 1RRJA 2M8EA 3QAHA 1R7JA 5J4VA 1WH5A 4ESJA 2XC7A 3S3OA 2GQQA 2Z1DA 1XN7A 3NQOA 3PFYA 5FGMA 2KMUA 1GVDA 1IXCA 2LY2A 4PFOA 4M3BA 1T95A 2PMUA 4XL9A 3SYTA 4B1RA 4YIFA 4Y13A 4ZYHA 2HDDA 4R8HA 1S7AA 2M87A 5FB2A 3BR3A 4KISA 5EZGA 1X1DA 2FBIA 2OU2A 2QA4I 4KNYA 1MDMB 4UB8C 3OYEA 4AD9A 3HOSA 3OYFA 5DTDA 1W0TA 2A6EF 3FXMA 2MD0A 1W36D 4E7IA 2EFPA 3TO7A 4OIOF 1U78A 2X51A 1FBQA 1L3LA 3I59B 2CFOA 5HLIA 4G6TB 1GT0C 5GTIC 3HC7A 1YFHA 2E60A 2LC2A
chains in the Genus database with same CATH topology
2IGMA 4U7BA 2DXIA 3FBIB 3OYHA 2KHMA 2CS3A 1G8XA 4XKCA 3ZR8X 3W2AA 2I8DA 3ZCOA 2A5WA 5CQGA 2F6CA 4EATA 2VJIA 1NG7A 1OLTA 2MABA 3FKJA 3K4KA 2HVSA 2IS2A 2WY7Q 1S9HA 2IS4A 4ITVA 5KNLA 3RTRA 2KZVA 4J01A 4Y4RA 2WB1A 3G2BA 1WFXA 2HU9A 2Y0SA 1DP3A 4BJ6C 1HA8A 1YE9A 1WJCA 2ZXHA 2R7VA 2X6YA 2JVGA 3PSIA 4B3XA 4ZJZA 4E7HA 4AU7A 4MLOA 2CUJA 1PYVA 1EA3A 3TL4X 1Z3XA 3PJRA 1MMGA 3AL0B 2VL8A 2IGNA 1Y56A 3GBGA 2XF5A 1BR2A 4PJLA 2VIXA 3QYFA 4CUGA 2KRHA 3OYAA 2CW8A 3J7AY 3W2VA 2LH9A 3ZRGA 1Z3YA 2L5QA 3OYDA 3A4CA 4D9JA 2OUMA 3C2HA 4P5OA 1AA7A 1N77A 1DGRM 4ZTJA 2NOJB 2CW7A 1D0YA 4BL0B 3HUGB 3OYCA 1KONA 3PSFA 3HKZA 3MMYB 4IKFA 1UELB 3MKYB 4KITB 2LOOA 1MMDA 2DT7B 1BR1A 3DWLE 2HDWA 3TMOA 3H9JA 3L2VA 2LYCA 2VXZA 3LFUA 3VWBA 3W2WA 2X6XA 3ONQA 2X1DA 3H9QA 1X1AA 3M1CA 3EUAA 2PJRA 1PJRA 3PNYA 3BCAA 4CCMA 4OWRB 2BVMA 5FRMA 1OR7C 2IS1A 4B44A 1LVKA 4BXFA 4DBQA 2W82A 4BE2A 3RCOA 1DGWY 3UNGC 3LL7A 4NC8A 1YX5A 1V5EA 4PJMA 2KDOA 4XR6A 4F91B 4DJAA 2AQEA 3M8JA 3SEQA 3OYGA 4XLAA 3DKXA 4BJ5C 3RQ4A 2HVRA 3OOUA 2KQRA 2BW3A 3H5NA 2M3AA 2R7WA 5FROA 4YEJA 2W00A 1QHHD 4XN3A 2WBMA 1WJBA 3HPHA 3OMYA 1WJAA 3H5RA 4QPOA 2VJ4A 3I3LA 3LSMA 2R4GA 3FHNA 4Y3OA 4NUBA 2XAUA 3LSHA 4HEA2 3OR1C 4DBRA 5FRNA 3FBNB 2QKMB 3A2KA 1X4OA 3H35A 3DLAA 4GRIA 3EUKL 2V4JC 3DPLC 2PJRB 3A1YA 4ANJA 2HNHA 2KRCA 3L2QA 2VLAA 5HOOA 3E0JB 1Y6IA 4ZTFA 3IP4B 2MYSA 1J09A 4BQNA 3LSGA 4CSWA 1TT0A 2GOMA 3PNVA 3LMMA 2R7XA 3KX2A 3HOTA 3K4CA 4AYBA 2K3PA 1SFKA 4N4NB 3LSKA 3L2WA 1D1CA 1LKXA 3S3MA 4FETA 3DPUA 4Y33A 4B47A 5KHDA 2IGKA 3VYRB 2BW3B 2ELJA 2VPLA 1T0FC 4HSRA 2E1MC 2E5ZA 4II2A 2L9NA 2VXDA 3K4MA 4XKWA 4E7SA 3ZGKA 4PSWA 4XN0A 4C30A 3OYNA 2VQHA 2R7QA 4HRIA 2A6TA 1MNEA 1QU3A 1FMVA 5HNFA 1FMWA 1MW7A 2X1EA 5CPRB 2R7OA 1WJFA 3S93A 4CZCA 4C2UA 2LG4A 1V5GA 4BEHA 1UAAA 2M7BA 1QHGA 2L2OA 4IQ4A 3CJQB 3IUOA 4B43A 3PNTA 1D0ZA 2M0MA 4XMYA 3MKWB 4XORA 3VYSB 4HSTA 4RMNA 3CESA 3OYBA 3K70C 2VASA 4PK4A 4B48A 4BQOA 4E7LA 4XQFA 3SDBA 2PMZA 3DTKA 2WA0A 2HPIA 4F55A 3VYUB 2VKHA 3AKZA 3NWTA 2Q2EB 2HPMA 3VYTB 3HXLA 4KJZA 3CF2A 1N75A 1MNDA 2KP6A 3CZ6A 1WJEA 2WAFA 5LD2C 4C9YA 4BDZA 2R7TA 1BOBA 4E4HA 1LFPA 1R6RA 1U0JA 2K9LA 3QOEA 4KT6A 3HL2A 2FUG2 4P1WA 3K10A 1TZLA 5CKTA 2IGOA 1SAUA 2CV2A 3DPTA 4U87A 3ZQQA 1YX3A 4CH7A 1NG6A 3BCBA 2KL4A 3N05A 3PUBA 3QYEA 4BE0A 3OWTA 2M4KA 1LDKB 3S8PA 2OV7A 3DU6A 5HLTA 2BOLA 4XKBA 4IZZA 3I9V2 4LIUA 3OIPA 4ZDOA 2HVQA 2VQLA 2F5VA 2M4GA 2WY8Q 4D1QA 3K4BA 2UV1A 4BS9A 4PSXA 3TBIA 2LREA 1Z21A 3DTIA 4RLQA 2VJJA 1W36C 4E7JA 3PL8A 4XOTA 1ERDA 2V7FA 2WAEA 3CJRB 3LSIA 3VSLA 2V26A 4LIVA 4NC7A 1MMNA 2XDVA 3QODA 4HPQA 3OS1A 3OY9A 1K6YA 2X1CA 3D5SC 1VZ0A 4NQWB 1WJDA 1MMAA 4II3A 4HNUA 4LG3A 3OL3A 1ZELA 4RLFA 2WADA 2VKDA 3OYJA 3OYLA 4PJNA 1X1CA 3SZGA 3H9GA 4ZC3A 3HG9A 4XNFA 4F52A 4FASD 2JA2A 3DQVC 4BU2A 3OYIA 1G59A 3SEZA 2CUZA 4XLHA 2RQQA 4E7KA 5TGTA 4JQFA 5HNHA 1UG0A 3EUHC 3VDXA 2K9MA 2RNGA 2XF6A 2MFZA 4PFPA 4F93B 2E5NA 2RREA 4RM3A 3QYBA 1JI8A 2UUZA 3CP2A 2X6WA 3K4NA 2JVHA 4CA0A 2E1MB 2LRDA 3VSKA 3EPZA 3BLYA 4XLFA 4R79A 4CCKA 3NWSA 4HNTA 3DTEA 2ZSIB 4BJTA 1D0XA 3AFHA 3E1SA 4ZDPA 5JHFA 4DIQA 2OC6A 3HC7A 4OAYA 3KEYA 4E7ZA 5KCMA 2R7UA 4NNJA 4PUSA 2HQAA 4ZYAA 5CQEA 4F3QA 2R7RA 3KYLA 3BC8A 3OS2A 2DOAA 2V1NA 2GOXB 1E0EA 2W4SA 4XOPA 2W1OA 2XSJC 3DEEA 2F4IA 3AL0C 3RPUD 2ZSHB 2IS6A 3OS0A 2UWMA 3IAS2 4E6KG 2W7NA 4BACA 2CV1A 2K5CA 4CCLA 5LFAA 4XM3A 2R7SA 3K4LA 1X19A 2AQFA 2L7KA 3DU5A 2Z2SB 2ZXIA 3K4JA 4F92B 2O5RA 3L2RA 2KPMA 2DCEA 3V42A 4X0GA 2CMPA 4XONA 2JSPA 3D5RC 2KLOA 4IX7A 4ZDLA 4RM2A 2LBFA 4BDYA 1N78A 4JOMA 4J00A 4OAZA 3K70D 3U21A 4LITA 4XKVA 4BQQA 2BVLA 4QPQA 3H5AA 4BEHB 4PJJA 2VJ5A 1WJ5A 4N4OB 1D1BA 4BUPA 2M7AA 3MD2A 4CCJA 4DGWB 3H0DA 3F9KA 1DQUA 2XF7A 3HPGA 2V6EA 4YRVA 4CCOA 1P9QC 1GLNA 3RSNA 3IAM2 3MKZA 1X4PA 3D5LA 3FDYA 2JUGA 3DKYA 4BE1A 2WAQA 4XLCA 2Q1ZB 3CP8A 3S32A 2ZFUA 4BGDA 1D1AA 1V5FA 5HVQC 3OR2C 1X1BA 2IXSA 2QKLB 1IRXA 2V9KA 2Z16A 3BG7A 2X85A 4AVZA 2XC7A 3S3OA 2VQGA 2Z1DA 3OIQA 2DT6A 3OYMA 3PFYA 4H4KC 3L2UA 2KMUA 3BG6A 2VQCA 2LY1A 2LY2A 3CMMA 4PFOA 1T95A 4XL9A 3SYTA 2LBFB 3ZXSA 4DOZA 3UR3C 2CH0A 4KISA 3C2GA 1X1DA 2HZDA 2CV0A 1Z7LA 2L9SA 4C2TA 4IQJA 3K6GA 1BR4A 4YELA 3OYEA 3HOSA 3OYFA 3S3NA 2P0WA 4CCNA 1W36D 2MD0A 4E7IA 4HG2A 3OYKA 3OL4A 3W3CA 2VB6A 2X51A 2DJIA 2CFOA 4XLEA 4G6TB 2MC4A 2E60A 2LC2A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC7 A;  4NC8 A;  2KRC A;  2M4K A; 
#chains in the Genus database with same CATH topology
 2LY9 A;  5K5R A;  1SMY F;  1CF7 B;  3IWZ A;  2IGM A;  4EEF G;  4U7B A;  3IH4 A;  3I64 A;  2KHM A;  4ENK A;  3LAJ A;  4XKC A;  1JTX A;  3W2A A;  1Z77 A;  3ZCO A;  2A5W A;  4KN4 X;  3WU1 B;  4EAT A;  4N0B A;  3S17 J;  1WI9 A;  3DBL B;  2YX7 A;  3FKJ A;  3MWM A;  2WY7 Q;  3B6A A;  1S9H A;  5J1Y A;  1IUF A;  3GWZ A;  5KNL A;  1BBY A;  4J01 A;  4EJU A;  4X6A J;  3G2B A;  3PO3 J;  1WFX A;  5CVJ A;  3KIO A;  2M30 A;  2RVC A;  3IHU A;  1HF0 A;  2HU9 A;  3JRG A;  1HA8 A;  1WJC A;  1YHQ I;  5D8K B;  4RGX A;  2A61 A;  5GP9 A;  4CO8 A;  5IP9 J;  1ZHF A;  3BG9 A;  3LWF A;  1QPI A;  4E7H A;  2ID3 A;  5HDG A;  3W6J B;  2O9L A;  1EA3 A;  2DK8 A;  1Z3X A;  2HR3 A;  3PJR A;  2CQK A;  1IRF A;  2YPR A;  1IRG A;  2IA0 A;  3GBG A;  2XF5 A;  4IF4 A;  3GTJ J;  1JJ8 C;  1KQ9 A;  1EV7 A;  4M3D A;  2NVU B;  2L7M P;  1Y1W J;  3J7A Y;  3ZRG A;  4JBA A;  1Y0U A;  2O0Y A;  2B7E A;  1I1S A;  3C2H A;  2PEX A;  4JYK A;  5DCF A;  3MZH A;  4LB5 A;  2WTE A;  3OYC A;  5K1Y A;  1FYK A;  2EFQ A;  1TBX A;  1W5T A;  3IWF A;  3CUQ C;  1ZRE A;  2O03 A;  2DMU A;  1YI2 I;  1IUY A;  3MKY B;  1XGO A;  2DT7 B;  1D8K A;  2VT3 A;  2E71 A;  1BL0 A;  3DWL E;  1HKQ A;  2DFE A;  3I4N J;  1I39 A;  3TMO A;  1F43 A;  2DW4 A;  4B4C A;  2KIM A;  4ASN A;  3BZK A;  2LYC A;  3LFU A;  3K1M A;  1F36 A;  3HRM A;  3W2W A;  4UUT A;  3WTX C;  2ELK A;  4UHT A;  1P7I A;  3MZ8 A;  1MZB A;  2GXA A;  3M1C A;  2M8G X;  3EUA A;  1PJR A;  3WU2 C;  1IN5 A;  5D5U B;  1FPQ A;  1WVR A;  5D6E A;  4OWR B;  2PJP A;  2VN2 A;  3F8C A;  1LE8 A;  4BXF A;  4BE2 A;  1LEB A;  1BW6 A;  2MG4 A;  3WE3 A;  1YX5 A;  1V5E A;  4L5J A;  4EVI A;  2XAG A;  1V3F A;  2PBI A;  2KDO A;  3GLX A;  9ANT A;  4DJA A;  2E1O A;  2G7U A;  5JHU A;  2DDB A;  5F6F A;  1FSE A;  2K4J A;  2ZXW H;  2KQR A;  5HDN A;  1SD7 A;  2M3A A;  5IYC J;  2XPU A;  2R7W A;  3RPQ A;  3HOY J;  4BH9 A;  3K9T A;  2L3D A;  4XN3 A;  4NBQ A;  4AUX A;  1WJA A;  1GDT A;  1T38 A;  3M1E A;  5CYV A;  2PX9 A;  4Y3O A;  4LLG F;  3BWG A;  3LSH A;  3EET A;  4EJW A;  2PI0 A;  3KFW X;  3H35 A;  3TP3 A;  1R00 A;  5TIS C;  3ZMD A;  3DPL C;  2IEK A;  2D1H A;  2KRC A;  2Z9O A;  2XKP A;  4BBR J;  1Y6I A;  3SFI A;  2B9S A;  1LE8 B;  3GTQ J;  1A31 A;  2MYS A;  1J09 A;  3LSG A;  1TWG J;  1P4W A;  5CVV A;  5EG0 A;  3LMM A;  3KP6 A;  1RZ4 A;  1LJ9 A;  4M71 A;  1UHS A;  3L2W A;  1GHC A;  1TQI A;  1LKX A;  1IW7 F;  3DPU A;  1T39 A;  4I09 A;  4MFE A;  4Y33 A;  1MBJ A;  1NTC A;  4JP0 A;  2YU3 A;  1EJ9 A;  1TQP A;  4LD5 A;  5CLS A;  2VPL A;  4HSR A;  2E1M C;  5DYM A;  2ZKZ A;  3K4M A;  1R5G A;  2QQB A;  4J19 A;  4E7S A;  3M3Y J;  3H92 A;  1LPQ A;  3ZGK A;  1XS9 A;  1W4M A;  2VQH A;  4GYI A;  1MNE A;  5A2Q K;  1U5T A;  2ACJ A;  3BQZ A;  2CU7 A;  1FMW A;  5KAI C;  4WXD A;  3DCF A;  2DQR A;  4G7O F;  1QHG A;  4A3M J;  2HQN A;  1ZG3 A;  3PNT A;  4LB6 B;  3V7S A;  4F7Z A;  4MO7 A;  2MW8 A;  3GZ6 A;  1P4A A;  4I6Z A;  3VYS B;  4AYB N;  3ZQG A;  4IEJ A;  4RBO A;  2W25 A;  2JJ7 A;  1OR7 A;  4PK4 A;  4E7L A;  4P9F A;  3CME I;  5EG0 B;  1O4X A;  1U2W A;  1AHD P;  4U0W A;  3ZQF A;  2HPI A;  1TWH J;  1UCR A;  4UVA A;  3I55 I;  4M9X A;  2D5V A;  3E97 A;  3VYT B;  2F5F A;  2STW A;  3WG7 H;  1Q1V A;  1PUE E;  4BHB A;  3HHH A;  1N75 A;  1REP C;  3GO5 A;  1WJE A;  3BR5 A;  4I76 A;  5BMZ A;  3J7Z I;  1Z05 A;  1WRJ A;  1R58 A;  1Y39 A;  1ETX A;  3CMA I;  5M5X J;  4KT6 A;  1U5T B;  4BY1 J;  2QCO A;  3CJN A;  5C4J J;  2Y75 A;  3EYI A;  2QYO A;  1UFM A;  1TZL A;  4A3F J;  5CKT A;  1XDS A;  2FNA A;  1ITY A;  4EM2 A;  2QQ9 A;  4M74 A;  1GXP A;  3DPT A;  3JAM K;  3MFK A;  3EYY A;  1YX3 A;  4ON0 A;  3JTG A;  1B6A A;  2M34 A;  3I71 A;  5EZH A;  3PUB A;  5IY5 H;  2K86 A;  4DZJ A;  4CZZ A;  2M4K A;  2DOF A;  3GTK J;  2FQ3 A;  4XRS A;  1JKO C;  3DU6 A;  5HLT A;  2BOL A;  5L3E A;  4WWC A;  2R7Z J;  5JVT A;  3OIP A;  4ZDO A;  5IT9 K;  2HVQ A;  1I5Z A;  2M4G A;  3CTA A;  4D1Q A;  4WF2 A;  3QRF F;  2IPQ X;  2UV1 A;  3WTZ A;  3R4K A;  5ICG A;  1Z21 A;  4RLQ A;  2TCT A;  3RZO J;  1V54 H;  1XGN A;  3CLQ A;  2HQ5 A;  3BTI A;  1LFU P;  1BC8 C;  1T0F A;  2MSY A;  2V1D A;  2QWW A;  3QU6 A;  1MMN A;  3QOD A;  3T8T A;  3RKW A;  1L0O C;  2FOW A;  1U8B A;  3HOV J;  5C44 J;  3O2P E;  1FTT A;  1W0U A;  1MMA A;  1B8I A;  4LG3 A;  3OL3 A;  5KK1 A;  1ZEL A;  5HLG A;  4MHG A;  1XB4 A;  1JUS A;  5IP7 J;  1JHH A;  3OYL A;  5L3B A;  3SZG A;  5BS6 A;  3HG9 A;  4NDL A;  3M07 A;  1XMK A;  2JA2 A;  4Y17 A;  4G9Y A;  2DT5 A;  2L02 A;  2WV0 A;  1EH7 A;  4A3K J;  2CRG A;  3I54 A;  5TGT A;  3RKQ A;  2XB0 X;  2UXX A;  3BP8 A;  1IGN A;  1YYV A;  5CVU A;  2PMH A;  3ZQC A;  1D5V A;  4A5M A;  4IXA A;  1TWF J;  2JSC A;  2RRE A;  3SHF A;  4RM3 A;  5B66 C;  2Z5U A;  5F64 A;  2DMT A;  1B9N A;  4RGU A;  2O8K A;  2VT2 A;  4AIK A;  4CA0 A;  1LNW A;  2OQR A;  2Y0M A;  1WZ2 A;  5KAF C;  3LA7 A;  2F5D A;  1QZY A;  2M1B A;  3KE2 A;  4HNT A;  5IOZ A;  3H36 A;  4A3D J;  2LF7 A;  4MQ9 F;  1D0X A;  1B8I B;  4OMY A;  2EFO A;  3LQR A;  5JFR A;  4OAY A;  1S29 A;  3KEY A;  4NNJ A;  3J81 Z;  4ZYA A;  1AKH A;  4P55 A;  3FIS A;  1KU9 A;  5CQE A;  1V55 H;  3KYL A;  1IN6 A;  2KDZ A;  2W4S A;  2E1N A;  2XSJ C;  1MBG A;  1TNS A;  3AL0 C;  1FC3 A;  3FK6 A;  3RPU D;  4MIM A;  2UWM A;  4A5N A;  1O3S A;  1TLH B;  2EA2 A;  4E6K G;  3WGH A;  2ZME A;  1FEX A;  1Z1D A;  1HC8 A;  2FA5 A;  4CCL A;  4RS8 A;  2HYJ A;  3Q3S A;  3JW4 A;  1ZGA A;  4XM3 A;  2XGX A;  2ZXJ A;  3U1K A;  2A07 F;  1P92 A;  4F92 B;  2F5C A;  1RUO A;  2KPM A;  3V42 A;  5F08 A;  3D5R C;  1R49 A;  3PUF A;  2NVT J;  4QIW N;  1POG A;  5LGU A;  3JRD A;  3MKL A;  2ZC2 A;  4BDY A;  2JPC A;  3HOX J;  1D5Y A;  3GTM J;  1N78 A;  2EJR A;  4XKV A;  2BVL A;  1E17 A;  1VQP I;  2XAF A;  4QPQ A;  4WXC A;  4C3J J;  2NRA C;  2OPT A;  4YII A;  4I7H A;  2OAZ A;  2AXL A;  3MD2 A;  1AKH B;  2GLO A;  2D2W A;  5F04 A;  1BI0 A;  2QBY A;  3BR1 A;  2JZY A;  2J5P A;  1GLN A;  4PJ0 C;  2H8W A;  2Y2Z A;  3S2H J;  3IAM 2;  2EBI A;  4RB3 C;  3D5L A;  3IRQ A;  3ZQL A;  3FDY A;  3DBR B;  2JUG A;  4LK1 F;  1STZ A;  4RGR A;  1WGX A;  1SVL A;  4IRH A;  3S32 A;  2ZFU A;  4B3A A;  4BXX J;  1D1A A;  5JVG F;  2QGU A;  1JGS A;  2ZME B;  4D5F A;  5HVQ C;  1VF9 A;  2IXS A;  3K69 A;  4MTD A;  3BQY A;  1BJZ A;  1YIJ I;  3BG7 A;  4M6Y A;  2X85 A;  1R1T A;  5J8C A;  2L9V A;  3M4O J;  3OYM A;  2VKE A;  1XSD A;  1LB2 A;  1KQ0 A;  3MZY A;  3BG6 A;  3KP5 A;  2VOO A;  2LY1 A;  2XAS A;  2LLK A;  1PUF A;  5H20 A;  4OU0 A;  1A36 A;  3UR3 C;  4ETS A;  1JKQ C;  1MKM A;  5E3L A;  2MGQ A;  3FXU A;  4HQE A;  5FKL A;  1PDN C;  2HZD A;  5E8I A;  3KP7 A;  2P5K A;  3K6G A;  4HA8 A;  4FT8 A;  3R60 A;  1IAW A;  2D45 A;  2QBY B;  2E2H J;  4L18 B;  2OD5 A;  4BYY A;  4FX4 A;  3OL4 A;  1IV8 A;  3BRO A;  4RAF A;  3W3C A;  4GDF A;  1HW2 A;  1TWC J;  1RPW A;  2DJI A;  1LDD A;  1I6H J;  3GYH X;  3D1N I;  1SFO J;  4HF0 A;  1UHM A;  1RES A;  2ECB A;  4L9T A;  2ETH A;  5A2Q Z;  3WHC A;  3OYH A;  2DXI A;  3CDI A;  1LDJ A;  1I1G A;  5EEH A;  1R22 A;  4XLP F;  2PFB A;  1FIA A;  4BHP A;  2KIU A;  2BY1 A;  2CQN A;  2F6C A;  2OA4 A;  3AG3 H;  4I2O A;  1J7K A;  5ICC A;  4AIJ A;  4HV6 A;  3LAP A;  1WPK A;  3G1O A;  3HUG A;  1WHU A;  2JWT A;  3V8L A;  3ZN0 A;  1PUF B;  2HVS A;  2STT A;  1ZH5 A;  4W1U A;  5FLV A;  4V19 K;  4V2F A;  2VE8 A;  5DV5 A;  4B8X A;  5FFX A;  3G1L A;  1DP3 A;  4BJ6 C;  3ZQ7 A;  3OSF A;  1FX7 A;  1GUU A;  3COA C;  2X6Y A;  2JVG A;  1T8I A;  4HOB A;  1O57 A;  4IVN A;  4XLN F;  4ZJZ A;  5EDN A;  3ZMT A;  6PAX A;  1ZRF A;  3LNQ A;  1PYV A;  3BJA A;  3QU3 A;  2IJL A;  1ETY A;  2BHY A;  1Y56 A;  2VL8 A;  4X1E A;  3WHB A;  1R23 A;  1SD6 A;  2VIX A;  3QYF A;  3OYA A;  1MNM C;  2Y69 H;  3HTS B;  1KU7 A;  3CDL A;  4WXH A;  3OYD A;  5AIQ A;  3A4C A;  1IO2 A;  3S16 J;  4A0Z A;  2FF4 A;  1I3Q J;  3WG9 A;  2OUM A;  3FK7 A;  3JAM Z;  2DOE A;  3GEZ A;  3TW7 A;  1G3W A;  2CFX A;  3HUG B;  3RI4 A;  2XAH A;  4G7H F;  1FT9 A;  1XCB A;  1H9G A;  5J40 A;  3QPH A;  3CUO A;  2AO9 A;  3F72 A;  4IKF A;  1GV5 A;  1UEL B;  1MMD A;  1IN4 A;  5IT9 Z;  1R5I D;  1S8N A;  1QPM A;  3H9J A;  4A3G J;  2V9P A;  2Y31 A;  1SFX A;  3S1R J;  2B63 J;  1FOX A;  1IXR C;  1HOM A;  4ZYD A;  2X1D A;  1X1A A;  4HX7 A;  1KU2 A;  5B3S H;  4HX4 A;  2PJR A;  2W57 A;  3JRI A;  2JRM A;  3TED A;  2FBH A;  1E3H A;  3PNY A;  3Q0W A;  1O3R A;  1JUP A;  3BCA A;  4CCM A;  1MJB A;  2BVM A;  1K61 A;  2IS1 A;  2BHZ A;  1LVK A;  3RYP A;  4N9I A;  2W82 A;  4DBQ A;  3RCO A;  2PG4 A;  1SVM A;  4EM1 A;  4A3E J;  1HKS A;  1OCT C;  1B72 A;  2JA6 J;  2BXY A;  5M5W J;  2L7Z A;  1U9N A;  3K1P A;  3P7N A;  4XR6 A;  1WSU A;  3QP6 A;  3SEQ A;  1YOV B;  3OYG A;  4XLA A;  3DKX A;  4UNO A;  1WWX A;  1ULY A;  4BJ5 C;  2ISY A;  3RQ4 A;  2HVR A;  3OOU A;  2RDP A;  1OIS A;  4GGG A;  1IN8 A;  4YEJ A;  2W00 A;  1IN7 A;  1UG2 A;  4AIH A;  2V9V A;  1QA6 A;  2O7O A;  2DFH A;  3W6K B;  2WAQ N;  1FOW A;  2VJ4 A;  3CD6 I;  5DD4 A;  3N4M A;  3I3L A;  2K3F A;  1FP2 A;  5IP6 A;  3RPU A;  2UZK A;  2OZU A;  3G3Z A;  4KN7 X;  5CVI A;  2ZJQ F;  1FOK A;  2XAU A;  4HEA 2;  2IVM A;  1AU7 A;  2HOE A;  5ILS A;  1X4O A;  3A2K A;  3DLA A;  2DA3 A;  4GRI A;  1R71 A;  2CGP A;  4Q4Z F;  2FX0 A;  5BNG A;  2PJR B;  3A1Y A;  2HNH A;  3L2Q A;  4JX6 A;  5LHG A;  2F4M B;  5H2F C;  5HOO A;  1YTY A;  3E0J B;  2R93 J;  2YU9 J;  2RQP A;  4DNC A;  2EIL H;  3HHG A;  4BNC A;  3ZQH A;  2XSD C;  3ISP A;  1UMQ A;  1B72 B;  1RC9 A;  2EV0 A;  5F0C A;  4Y15 A;  4C3I J;  2JT1 A;  4FET A;  4RAY A;  5L3C A;  4B47 A;  5KHD A;  5D4R A;  5F27 A;  1QVT A;  2E5Z A;  3F21 A;  2Z3Y A;  2R5Y A;  1B1B A;  1LFB A;  3FX3 A;  3CCU I;  4A12 A;  3B73 A;  1ZK8 A;  2BYV E;  2P6S A;  4S04 A;  2O61 A;  4PSW A;  4I0A A;  4XN0 A;  3OYN A;  1ZG1 A;  1TC3 C;  3JRB A;  2LK2 A;  4HRI A;  1RET A;  1QU3 A;  3IV5 A;  4HX8 A;  2DN0 A;  4IO9 F;  1UB9 A;  2AXT C;  2P7C B;  2X1E A;  2DA1 A;  5DM6 F;  1MBF A;  1XMX A;  1IC8 A;  4RA2 A;  2DFI A;  4BEH A;  1PVE A;  1UAA A;  2M7B A;  2F2E A;  2L2O A;  4B43 A;  1N25 A;  3CCV I;  4ENM A;  4XMY A;  3MKW B;  2PLY A;  2NS7 A;  1O3Q A;  2B0L A;  1FSH A;  4RMN A;  2V1U A;  3K70 C;  1F9N A;  1VQN I;  4I99 C;  4BQO A;  2FSW A;  4XQF A;  3TO9 A;  3E5X A;  3CC2 I;  2K85 A;  2PMZ A;  2M0C A;  4M6V A;  1S72 I;  1G3Y A;  1WKM A;  2WA0 A;  1SAX A;  4F55 A;  2VKH A;  4M73 A;  3NWT A;  4IHT A;  1XC5 A;  1R1U A;  2HPM A;  1I27 A;  2TDX A;  1E3O C;  4KJZ A;  3CF2 A;  2XAQ A;  3BTL A;  3ELK A;  4TV7 A;  2DPU A;  3HTU A;  1XSX A;  2R5Y B;  2R3S A;  2WAF A;  3FXL A;  4C9Y A;  5J8F A;  2Z33 A;  4EM0 B;  3J7A O;  3J80 K;  4NQW A;  2LNB A;  3LQQ A;  4AC0 A;  3HL2 A;  4L0Z B;  1ZRD A;  4D5C A;  2FUG 2;  4I01 A;  1ZR4 A;  3K10 A;  5DCM A;  1E2X A;  2IGO A;  1SAU A;  2CV2 A;  1VQ6 I;  1NHA A;  3ZQQ A;  4CH7 A;  1NG6 A;  4JX5 A;  3Q9S A;  3HJE A;  2R5Z A;  4DYC A;  1ON2 A;  4FIS A;  2P81 A;  4XK4 A;  3QYE A;  3JR9 A;  2LTP A;  3HBL A;  3WOD F;  1LDK B;  1XD7 A;  2OV7 A;  1LVA A;  2NAZ A;  4XKB A;  4IZZ A;  2HWV A;  3KEQ A;  2W84 A;  5DUK A;  3GFM A;  2ZCW A;  1TL8 A;  2VQL A;  2IP2 A;  5K7Z A;  2WY8 Q;  3I58 A;  4Q47 A;  1R1V A;  2DLL A;  4PSX A;  1A5J A;  1ETO A;  4IOC F;  2VJJ A;  4E7J A;  1J5Y A;  4M72 A;  3PL8 A;  4XOT A;  1K4T A;  1ERD A;  3QP5 A;  5JLW A;  1I50 J;  2WAE A;  1HDP A;  2V79 A;  1XSV A;  4LIV A;  1ON1 A;  4RAZ A;  3CF5 F;  4HPQ A;  3OS1 A;  3BZC A;  2X1C A;  2XGD A;  4NQW B;  2E2J J;  2EIM H;  3S15 J;  3FXQ A;  4D0P A;  3CCL I;  5DCM B;  3DFG A;  4RLF A;  1Q1H A;  3OOP A;  2LSO A;  3OYJ A;  4YFX F;  1S7E A;  2E36 A;  5CJ9 A;  4G12 A;  4ZZL A;  3H9G A;  3CCS I;  1XCV A;  2ZJP F;  2R5Z B;  1SD5 A;  4FAS D;  3DQV C;  5FJ8 J;  3C1D A;  3ESW B;  3IKT A;  2LF8 A;  2WWY A;  4HZF A;  3SEZ A;  4FQG A;  1FLI A;  3GCM A;  3JSO A;  1FIP A;  3FXR A;  3HB9 A;  1BOA A;  5E79 C;  2XF6 A;  2HXI A;  3MQ0 A;  2RKH A;  3Q0U A;  3HOZ J;  5LEK A;  3CCY A;  5L3G A;  3QYB A;  2JUC A;  4I02 A;  3U1D A;  1K78 A;  1F5T A;  3GW2 A;  1Y1V J;  4HF2 A;  2LRD A;  4MGR A;  4XLF A;  2L4A A;  3GUD A;  3VEP A;  2XAJ A;  3NWS A;  3VFZ A;  3ECO A;  3MEX A;  1FJL A;  3P9C A;  4ZDP A;  2OC6 A;  3U2R A;  4BQA A;  2XV4 S;  3BR0 A;  2HQA A;  5LGN A;  2X0L A;  4KDP A;  3KPH A;  4CYD A;  1VQO I;  1VQ7 I;  3BC8 A;  4YG2 F;  5FD5 A;  2DOA A;  3WTW C;  2GOX B;  3SJM A;  1E0E A;  2VBW A;  2FML A;  3DEE A;  4G7Z F;  1MSF C;  2F4I A;  2BY2 A;  4U88 A;  2EK5 A;  3K1N A;  2CQQ A;  3CMY A;  1XX5 A;  2K5C A;  3MCZ A;  5LFA A;  1PP7 U;  2WC2 A;  1O7F A;  3A0B C;  3C2B A;  5E20 A;  2R7S A;  2AQF A;  2L7K A;  4I0B A;  2XB5 A;  2Z2S B;  2EV6 A;  3L2R A;  4ZYE A;  2LFB A;  4R1H A;  2DCE A;  4X0G A;  1K78 B;  5HDK A;  2JSP A;  3VPR A;  5D5X B;  1AWC A;  3KET A;  4HDU A;  4RM2 A;  2LBF A;  2MD5 A;  4J00 A;  3K70 D;  4LLL A;  1BA5 A;  1KGS A;  2QQ8 A;  4L9J A;  2KZG A;  4BQQ A;  3HRU A;  3H5A A;  2A69 F;  3HOW J;  4N4O B;  1ZGJ A;  4BUP A;  2OBP A;  1SFU A;  1DUX C;  4CCJ A;  1VQL I;  4DGW B;  3H0D A;  1DQU A;  2RAE A;  2RN7 A;  4GXO A;  1T08 B;  5ILU A;  3PQJ A;  4CCO A;  1Y8R B;  3HDD A;  2XRL A;  2KFD A;  3JTH A;  2L54 A;  3CCJ I;  3GZ5 A;  1KYW A;  2WV1 A;  1HCR A;  2O6G E;  1YRN A;  1MD0 A;  3JRH A;  1LUJ B;  4BE1 A;  4D7M A;  2M9H A;  1GXQ A;  3G73 A;  4IJA A;  2GAU A;  3ABU A;  1V5F A;  2MC3 A;  5LRS A;  1B9M A;  1JE8 A;  3EUH A;  3OR2 C;  2RV8 A;  2G9W A;  2R92 J;  2G0E A;  2Y9Y A;  2EIK H;  4UY8 I;  3Q9V A;  3H3V K;  4AVZ A;  2I10 A;  5E1X A;  2VQG A;  3OIQ A;  4IHX A;  2OCE A;  2DT6 A;  3L2U A;  3HRS A;  2VQC A;  5HS9 A;  4A2U A;  2LBF B;  4DOZ A;  3NRV A;  4P9U A;  5C4X J;  1ACI A;  3BTC A;  1V4R A;  1FWZ A;  3WU0 A;  3ABK H;  3ROU A;  4A6D A;  5LHI A;  1Z7L A;  2CV0 A;  4C2T A;  4IQJ A;  1EF4 A;  1HKT A;  2DU9 A;  3L00 A;  5DS9 A;  2CW0 F;  2DMN A;  2HS5 A;  4YEL A;  3KYC B;  3A0H C;  1ZR2 A;  2QQA A;  3S3N A;  4EJO A;  3WTT C;  3C3W A;  3HSR A;  4HG2 A;  4K2E A;  3OYK A;  2ZNZ A;  2DMP A;  1G4D A;  3MAJ A;  2OF7 A;  3FKI J;  2P7V B;  2VB6 A;  3PIP F;  1IF1 A;  3DXJ F;  5B5E C;  1YRN B;  2R7F A;  3HIF A;  2COM A;  5C3E J;  2Y30 A;  1RKT A;  2HKO A;  3GTP J;  1Z6T A;  5LHH A;  4MEX F;  3AG2 H;  1VND A;  2ZBK A;  3FBI B;  4OOI A;  5GTH C;  1QQI A;  3E6B A;  2CS3 A;  1USS A;  2MH9 A;  5E3N A;  4IHV A;  3ZR8 X;  2I8D A;  1X2N A;  5CQG A;  1Z91 A;  1NG7 A;  1YIO A;  3TOA A;  2PN6 A;  2MAB A;  4ZH4 F;  1MBH A;  1YQA A;  3K4K A;  3X2Q H;  1IDY A;  3TP0 A;  2IS2 A;  5E17 F;  4ITV A;  5FLM J;  3RTR A;  2KZV A;  4A3J J;  4Y4R A;  2WB1 A;  4LK0 F;  2Y0S A;  3BOQ A;  3HGY A;  5DEQ A;  3ZPL A;  1ORK A;  4KIF A;  2ZXH A;  3F23 A;  1X58 A;  1JTY A;  2CUE A;  3PSI A;  3TDU C;  4EGZ A;  2R7D A;  3P9I A;  4AU7 A;  1J59 A;  4MLO A;  3GLL A;  1MMG A;  2L0K A;  2IGN A;  1XG1 A;  3J80 Z;  4KMF A;  5EEA A;  4PJL A;  4A3I J;  2KRH A;  2VI6 A;  2CW8 A;  2VOD A;  2H6C A;  3W2V A;  2ADU A;  1ZKG A;  2HOA A;  2L5Q A;  4LLN A;  3RJP A;  1MJ9 A;  3ZMU A;  3FM5 A;  5J1R A;  2RC4 A;  2XGC A;  3BPV A;  2H1L A;  1AA7 A;  2MLG A;  3CC4 I;  2NOJ B;  2EIJ H;  4M3F A;  2E7W A;  2CW7 A;  1S5L C;  1D0Y A;  2LKP A;  4BY7 J;  4Y52 J;  4ESB A;  1KON A;  5FLX K;  2ME0 A;  1FNN A;  1F4K A;  3L1P A;  3RZD J;  3HKZ A;  3NEU A;  2ZO4 A;  1MH3 A;  2HEO A;  4XRS G;  5BPI A;  1BI1 A;  1U5T C;  2BEO A;  1VQ4 I;  2HDW A;  2QF7 A;  3L2V A;  3IH3 A;  1OCO H;  4FE4 A;  1ZG5 A;  3GF2 A;  3H9Q A;  2FXA A;  2FMY A;  1S3J A;  2IRF G;  4DYQ A;  1MGT A;  1B59 A;  1ONV A;  2HQR A;  3K7A J;  5FKK A;  5FRM A;  1OR7 C;  2R0Q C;  2DBB A;  4B44 A;  1JGG A;  1H89 C;  1RUN A;  1KZH A;  1DGW Y;  3UNG C;  3LOC A;  4NC8 A;  4Z2Y A;  4QLC U;  3CO7 C;  2YR2 A;  1APL C;  3DEU A;  2AQE A;  5GAD J;  1OMI A;  1DPR A;  1MH4 A;  4EV0 A;  4FX0 A;  3WTS C;  3T5X A;  3F8M A;  3O8G A;  5AIP A;  4UV9 A;  2A3S A;  2GXG A;  3M9A A;  4V2G A;  2MLK A;  3SQN A;  2BW3 A;  5L3D A;  5F0H A;  3H5N A;  3QQA A;  3FMS A;  1SD4 A;  2Z99 A;  5FRO A;  4GYG A;  4DYR A;  3O3K A;  2E7X A;  2UXN A;  2WBM A;  1WJB A;  2DA5 A;  3HPH A;  3H5R A;  4ESF A;  4QPO A;  5JI6 A;  1DU0 A;  4O3M A;  4ABZ A;  1O7L A;  3VOE A;  5E3O A;  2NVQ J;  2J5O A;  1K6O A;  1ODD A;  3GFL A;  3OIO A;  1UJ8 A;  4DBR A;  3OR1 C;  3KP3 A;  2QKM B;  4FHT A;  3ZMS A;  2VC1 A;  4QWQ A;  2OCC H;  1HST A;  3A01 A;  3K2Z A;  4A3C J;  2I5U A;  5KVR A;  4ANJ A;  4OIP F;  4HW0 A;  2QEX I;  4ENN A;  1MIJ A;  2JMW A;  2A6H F;  1XMA A;  2AHQ A;  4ZTF A;  1DDN A;  3IP4 B;  4BQN A;  1TW2 A;  5BPD A;  1BM9 A;  3PNV A;  2C6Y A;  3S1M J;  3V8K A;  1KU3 A;  3HOT A;  1VQ9 I;  2K3P A;  3RKX A;  4HBL A;  3LSK A;  3RKY A;  1HQC A;  2P5V A;  3IRR A;  1D8J A;  3KEO A;  2BW3 B;  1T0F C;  2XPW A;  4II2 A;  2L9N A;  2JTV A;  2LVS A;  3CUQ A;  1XDU A;  1T98 A;  2JA8 J;  2OTJ I;  4C30 A;  1RKW A;  1G3S A;  1QRY A;  1FMV A;  5HNF A;  5IT3 A;  3VB2 A;  3FM3 A;  2XKO A;  5CPR B;  1D3Y A;  2R7O A;  4CGZ A;  3FIW A;  2LG4 A;  1V5G A;  1CGP A;  3IUO A;  1J2X A;  2BBY A;  3A01 B;  3RQI A;  4C3H J;  2CQX A;  4A93 J;  1D0Z A;  4IRI A;  3AG1 H;  3QPT A;  5DD8 A;  2KIS A;  2XRN A;  3O8H A;  2HTJ A;  3DBH B;  5FD6 A;  1VFC A;  1VQK I;  1AOY A;  4UB6 C;  4PGH A;  3OYB A;  4U7D A;  2EZI A;  2VAS A;  4B48 A;  1BIB A;  4A0X A;  1JT0 A;  4AID A;  3FHZ A;  3SDB A;  5IPA A;  3J7Y J;  3S1N J;  3DTK A;  2HOT A;  3L7W A;  3VYU B;  3KLN A;  3AKZ A;  4QSH A;  1S6L A;  3QWL A;  4HF1 A;  5JR3 A;  5J1U A;  2KJC A;  2BE5 F;  1A04 A;  2H09 A;  3ASO H;  1HW5 A;  1HW1 A;  1XGS A;  1MBK A;  5H6R A;  3T1B A;  1PP8 F;  2KP6 A;  3CZ6 A;  2EA4 A;  3CUQ B;  4XID A;  4BDZ A;  3RDI A;  4RB0 A;  2JA7 J;  2R7T A;  1BOB A;  4HYE A;  3A02 A;  2VBZ A;  4E4H A;  1IRZ A;  1R6R A;  2ZB9 A;  2QSH X;  1U0J A;  3QOE A;  4E70 A;  1BN5 A;  4FCY A;  1BC7 C;  1SVO A;  1ENH A;  1K79 A;  2H27 A;  2NVY J;  3NAR A;  1J75 A;  1CQT A;  4U87 A;  5E18 F;  1LEA A;  2FQ4 A;  2NXN B;  3JSP A;  1MDM A;  2DQL A;  2DA4 A;  1O3T A;  2PMZ N;  1R4M B;  3BCB A;  2KL4 A;  3CDH A;  3I53 A;  1X2M A;  3JRE A;  3N05 A;  3S1Q J;  3QPS A;  5HS7 A;  4PCQ A;  1IXS B;  4BE0 A;  1R5H A;  3ZOB A;  2L01 A;  3S8P A;  1YJW I;  1NK2 P;  2ESH A;  2JK3 A;  2FD5 A;  2ZME C;  3I9V 2;  3LSP A;  4WK8 F;  2RGV A;  2F5V A;  4UUS A;  1RNL A;  3BJ6 A;  3PM1 A;  4L0Y B;  2EB7 A;  3PQK A;  5F0F A;  3AG4 H;  4BS9 A;  5D5W B;  2LRE A;  2K9N A;  1YS6 A;  1EH8 A;  3DTI A;  5GPA A;  1TWA J;  1FP1 D;  4Q48 A;  2YS9 A;  2V7F A;  4OIR F;  2CYY A;  2DOD A;  1FOY A;  2CUF A;  3BR6 A;  2K27 A;  3OY9 A;  1K6Y A;  1NK3 P;  3D5S C;  2GWR A;  2CWE A;  3DP7 A;  3F0C A;  1F1Z A;  2HZT A;  2VKD A;  4HDV A;  1ETV A;  1FYL A;  3FMQ A;  2N8G A;  4EMS A;  3CO6 C;  2HXO A;  3K0L A;  4IL6 C;  3L9F A;  3LA3 A;  5D6F A;  1X1C A;  5IOY A;  4ZC3 A;  4F52 A;  2KT0 A;  2QUF A;  3BPX A;  2QVO A;  3WGG A;  4UXN A;  5IYD J;  3CLO A;  4RB1 A;  2P4W A;  4A3B J;  2BGC A;  2CUZ A;  1IV6 A;  3G71 I;  1X3U A;  1K4S A;  3LFK A;  1TT5 B;  5HNH A;  2F4O B;  3HEF A;  3F8N A;  5TRD A;  2EZH A;  2RNG A;  4UUS B;  2MFZ A;  4PFP A;  2P8T A;  4KIB A;  1H0M A;  4YFN F;  2ZJR F;  2VE9 A;  2HYG D;  1JI8 A;  2UUZ A;  1QBJ A;  3TW6 A;  2FU4 A;  2CO5 A;  4P96 A;  2DYS H;  2HTS A;  1TW3 A;  1SAN A;  3K4N A;  3CCR I;  2E1M B;  3EPZ A;  3BLY A;  1XTA A;  5FKN A;  4R79 A;  5F1R A;  5J3L A;  3IC7 A;  3WTV C;  3E6D A;  3E7L A;  3ML6 A;  3DTE A;  2OJE D;  5E1W A;  1DU6 A;  2FJ1 A;  2X48 A;  3I0T A;  2E35 A;  3E1S A;  3AFH A;  4DIQ A;  1IZ1 A;  4E7Z A;  1W1W E;  1BI2 A;  3H1C A;  3T0Y A;  4PUS A;  3BJO A;  5AON A;  3FZV A;  4F3Q A;  2R7R A;  4FTH A;  1FZP B;  5GPC A;  1K83 J;  2V1N A;  2XUB A;  3V8J A;  2DDA A;  3M7G A;  1I3A A;  5FLX Z;  2Q0O A;  4XOP A;  3WTY C;  1FYM A;  2X6O A;  4AWX B;  5JLX A;  1YJN I;  2ZSH B;  5M3M J;  1WI3 A;  1ETQ A;  3OS0 A;  3IAS 2;  4ZYG A;  3L2C A;  4IHS A;  4KMU X;  4BAC A;  3HGG A;  2GIV A;  5EGO A;  2ICW G;  2O3F A;  3B02 A;  3ASN H;  2EPF A;  2EFW A;  2XPV A;  1TQM A;  1UZC A;  3K4L A;  2JQ7 A;  2ZXI A;  3K4J A;  3IL2 A;  3JRA A;  1QZZ A;  3P5J A;  2MA3 A;  5DM7 F;  2CMP A;  4XON A;  3TDZ C;  3F3X A;  3ULQ B;  5LRR A;  5K5O A;  2Y9Z A;  2GBY A;  3R6S A;  4IX7 A;  1BI3 A;  3ZN1 A;  3J81 K;  2BXZ A;  2HKX A;  4JOM A;  4OAZ A;  3FWE A;  3M8E A;  4LIT A;  3R61 A;  3KP2 A;  2DA2 A;  2JRT A;  4CYC A;  4BEH B;  4PJJ A;  1WJ5 A;  4O5V A;  4M9S A;  1D1B A;  4UVC A;  1IJW C;  3TKY A;  2TRT A;  4EQQ A;  2M7A A;  3L09 A;  1G6N A;  2E1C A;  4HAM A;  3F9K A;  3HPG A;  2XF7 A;  3N97 A;  3F8F A;  1DP7 P;  2M5W A;  3E5Q A;  1P9Q C;  3RSN A;  1SEU A;  4IPA A;  1VQ8 I;  1J9I A;  1Z9C A;  1OQY A;  3MKZ A;  1YO5 C;  4GFB A;  1X4P A;  3GXO A;  4YFK F;  3VOD A;  2ZNY A;  2BY0 A;  3DKY A;  5BQT A;  3WTU C;  2WAQ A;  3TO6 A;  2XHK A;  1EH6 A;  1YJ9 I;  4LJZ F;  5D4S A;  1UST A;  4BGD A;  4IHW A;  3AAF A;  4KA4 A;  4G6D A;  4ZZD A;  4I98 B;  3K2A A;  5EGO B;  1IRX A;  2Z16 A;  2NYX A;  3HOU J;  4JX4 A;  4G94 A;  2JN6 A;  2YSR A;  3EDP A;  1U3E M;  5HS8 A;  4H4K C;  1YG2 A;  2IBD A;  3CMM A;  3E5U A;  2O8X A;  3SXY A;  3ZXS A;  1QNT A;  1KA8 A;  2ISZ A;  2CH0 A;  4HNV A;  3C2G A;  2JPB A;  2DAO A;  2NNY A;  1R9T J;  4U0V A;  1ZAR A;  1MBE A;  1YW9 A;  4LOC A;  4CYC B;  3JRF A;  2IT0 A;  1FTZ A;  3RIR A;  2L9S A;  1FBU A;  2LKS A;  2ZFW A;  2RNJ A;  1HSJ A;  5TJJ A;  5DDG A;  1BR4 A;  1G3T A;  1VI0 A;  3QPL A;  3P9K A;  4GO1 A;  2BY3 A;  2QSG X;  2GZW A;  2P0W A;  4CCN A;  5HOD A;  3REO A;  4KIC A;  2K4B A;  5M3F J;  5E3M A;  1R4N B;  1I6X A;  1P2F A;  2IW5 A;  2QSF X;  2V1X A;  4XLE A;  1OFC X;  5E8G A;  2NS8 A;  3I4M J;  2KJB A;  2MC4 A;  5B1A H;  2VOP A;  2NOG A;  2K40 A;  2EQR A;  5IYB J;  3LSJ A;  4IHY A;  2X4H A;  1G8X A;  5GAH J;  2EIN H;  4UV8 A;  4OIQ F;  4EGY A;  5M5Y J;  2VJI A;  4KYW A;  1OLT A;  1QGP A;  2JA5 J;  1SFE A;  4RB2 C;  2IS4 A;  1W7P D;  3BR2 A;  4DQ2 A;  4CXF A;  4KUM A;  2ECC A;  3O6B B;  4G8X A;  2CSO A;  2GA2 A;  1YE9 A;  3FXK A;  1H88 C;  2R7V A;  5HLH A;  1Y0N A;  1T33 A;  2Y48 A;  2ID6 A;  4S05 A;  2LR8 A;  1QZE A;  1Z67 A;  4B3X A;  3DV8 A;  3GME A;  4ENJ A;  3F6V A;  2YUS A;  3PIO F;  5D5V B;  2XGE A;  2K7L A;  2CUJ A;  3C7J A;  3H3U A;  1VTN C;  2HGC A;  3TL4 X;  2NNN A;  2ELH A;  5CVR A;  3TGN A;  3AL0 B;  4CHU A;  4HLX A;  3CCQ I;  1BR2 A;  3E3V A;  1BW5 A;  1SMT A;  3KZY A;  4CDG A;  4CUG A;  4EJV A;  2NVX J;  1MMS A;  2LH9 A;  5ICF A;  3FXO A;  1Z3Y A;  3KYD B;  2FNP A;  4NC6 A;  4D9J A;  2XIG A;  3E6C C;  2FOK A;  2KIQ A;  3GTL J;  3S2W A;  4P5O A;  2WB1 N;  1N77 A;  1DGR M;  4ZTJ A;  3LSR A;  4CIC A;  4RDU A;  4BL0 B;  3HM5 A;  2Y0S N;  3E6M A;  2PQ8 A;  3CJT B;  3PSF A;  4RGS A;  4MTE A;  2ZJ2 A;  2FBK A;  3MMY B;  4KIT B;  2LOO A;  3ECH A;  2VON A;  3F6O A;  1BR1 A;  4LG0 A;  3WE2 A;  3CQZ J;  3PO2 J;  1M1E B;  2K9S A;  2VXZ A;  2BV6 A;  1FBS A;  1ETW A;  3VWB A;  4HQM A;  2X6X A;  2GM4 A;  2DMQ A;  4PDK A;  3ONQ A;  5K7H A;  4U0Y A;  1RIO H;  3Q0V A;  1HBX G;  3Q5F A;  4B09 A;  1T2K A;  4UUV A;  2HYF A;  2LMD A;  2KRF A;  3BT9 A;  2V6C A;  3FXJ A;  3ABL H;  4M3G A;  4YIR X;  3GTG J;  4PGG A;  1ZTR A;  1SC7 A;  3LL7 A;  4PJM A;  1GV2 A;  4G6Q A;  4L9V A;  1ZYR F;  4L5E A;  3DLL F;  4F91 B;  1OKR A;  1X1P A;  3M8J A;  4GCV A;  2ME6 A;  3HKZ N;  1W5C C;  1G2H A;  1OCR H;  2BZT A;  3QOP A;  2H1K A;  1OCZ H;  2OZ6 A;  1JKP C;  2L4M A;  2CJJ A;  2D1V A;  1NH3 A;  3D0S A;  4HV5 A;  2DO7 A;  1QHH D;  2COB A;  2G7H A;  2Q8K A;  3OMY A;  1RR8 C;  3ZMV A;  4LG0 B;  3LSM A;  1OCC H;  4AM3 A;  2R4G A;  2VBY A;  2ESN A;  3MN2 A;  4OMZ A;  3FHN A;  3ZQI A;  5LBQ A;  2DA7 A;  4NUB A;  5FRN A;  3FBN B;  1RR7 A;  1WH7 A;  2EV5 A;  2EFN A;  3MVP A;  3EUK L;  3U9G A;  1P6R A;  2XVC A;  5D8L B;  2V4J C;  3R0A A;  3I56 I;  5EJC A;  5EEG A;  1OYI A;  3T8R A;  2VLA A;  4XRF A;  4KT5 C;  1U6G A;  4MNU A;  3KCC A;  4NHJ A;  2P6T A;  3GX4 X;  5ILV A;  4WX9 A;  1U8R A;  4BKX A;  4CSW A;  1TT0 A;  3SZT A;  2GOM A;  2FRH A;  1UHW A;  2R7X A;  3KX2 A;  1MSE C;  3K4C A;  4AYB A;  1SFK A;  2DFF A;  4N4N B;  1RI7 A;  3LST A;  1D1C A;  3S3M A;  2Q2E A;  2IGK A;  4O6J A;  3I4P A;  3PFI A;  5EYR A;  2ELJ A;  3VYR B;  4XIC A;  3FF5 A;  2VXD A;  5J4Y A;  4L9N A;  5K5Q A;  3G1M A;  1T56 A;  4XKW A;  3SFZ A;  2LKX A;  2M45 A;  3CC7 I;  4WCG A;  4MFD A;  2A05 A;  1H8A C;  1TTY A;  2R7Q A;  5L3F A;  2A6T A;  1ZGW A;  4EJT A;  2EZK A;  3UKG A;  5K7F A;  3TQN A;  1MW7 A;  4W97 A;  4DW6 A;  1VQ5 I;  3CCE I;  1WJF A;  2VPR A;  3S93 A;  4CZC A;  1YW7 A;  4C2U A;  1TP4 A;  2QM3 A;  4IQ4 A;  3CJQ B;  4AVP A;  2M0M A;  4XOR A;  2CQ7 A;  1S7O A;  1YIT I;  1Z7U A;  3IH2 A;  5FKO A;  4HST A;  3CES A;  1A6I A;  2NS0 A;  1ZLJ A;  2HOS A;  1E3P A;  3ABT A;  4MQV A;  3ZMZ A;  4XSX F;  3ERM A;  2OTL I;  1YW8 A;  2Q2E B;  1R36 A;  5EF6 A;  2E2I J;  3HXL A;  1A35 A;  4M6X A;  2DTZ A;  5LLQ A;  4XSZ F;  2VUM J;  1ZQ3 P;  1X3Z B;  1MND A;  2VC0 A;  1WQ2 A;  5FO5 A;  2XRO A;  5LD2 C;  1GVJ A;  2K02 A;  1P4X A;  2L7F P;  2W24 A;  3C18 A;  2DPD A;  3IKV A;  3HZJ A;  4A69 C;  4Y7N J;  3GTO J;  3G6E I;  1LFP A;  1QO0 D;  2K9L A;  3V4G A;  5LEJ A;  4MEY F;  1OJL A;  4A0Y A;  4P1W A;  4BAY A;  2E19 A;  2GXB A;  3ZP5 A;  3M8F A;  2LP0 A;  5BOX A;  2DJN A;  2GIZ A;  4H0E A;  3KZZ A;  2YX4 A;  2L9R A;  3OWT A;  3FMR A;  1ETK A;  3H0G J;  4DZP A;  1J0R A;  3DEW A;  1K7A A;  2MBF A;  4BHC A;  4LIU A;  2DI3 A;  2A68 F;  1W7P A;  2E34 A;  2MH2 A;  4IOA F;  2VKV A;  3K4B A;  3TBI A;  2M2E A;  1JUM A;  3GFI A;  2F48 A;  1W36 C;  4S0H B;  5FKM A;  3JCU C;  2CG4 A;  3CJR B;  3LSI A;  3VSL A;  2V26 A;  4NC7 A;  2XDV A;  1FY7 A;  3KLO A;  1VZ0 A;  4LFU A;  1WJD A;  3R0J A;  4II3 A;  5J6X A;  4HNU A;  5H6Q A;  4FE7 A;  4HLY A;  1KYZ A;  2IA2 A;  3NAU A;  2WAD A;  5LGT A;  4OIN F;  2AS5 F;  4PJN A;  2DK5 A;  3KZI C;  5J47 A;  1JJ6 C;  1Z6R A;  2IA1 A;  4XNF A;  2DYR H;  1ZLK A;  3A03 A;  3JRC A;  1OCP A;  4L5I A;  5ERI A;  5E1Z B;  4BU2 A;  3OYI A;  1G59 A;  3DF8 A;  1JT6 A;  1JHF A;  3SDG A;  1ZRC A;  2F5E A;  1OYW A;  4XLH A;  2RQQ A;  4E7K A;  3I5U A;  4JQF A;  4A6E A;  5ED4 A;  1UG0 A;  3EUH C;  3VDX A;  2K9M A;  3V7C A;  1VQM I;  1JXS A;  1W7P B;  4BBS J;  4F93 B;  2DTR A;  2P5L C;  2E5N A;  4LGW A;  3S14 J;  2LD5 A;  1X3W B;  3TOB A;  5ICE A;  1YS7 A;  2KIF A;  3CP2 A;  2X6W A;  4D7N A;  3F8B A;  2A5Y B;  2JVH A;  1LQ1 A;  2HI3 A;  3VSK A;  1HDD C;  1HXD A;  4CCK A;  1KQ8 A;  2ZSI B;  4BJT A;  2LDU A;  3F22 A;  4Z6Y A;  5JHF A;  4XBF A;  1ZN2 A;  3V7R A;  5GAG J;  4A3L J;  1YLF A;  5F1J A;  1P7J A;  5KCM A;  1DPU A;  2R7U A;  1TNT A;  2VBX A;  4KIG A;  1IG7 A;  3ABM H;  2FE3 A;  2W85 A;  3BG5 A;  4Q5S F;  3HSE A;  2GA1 A;  3OS2 A;  2H8R A;  3WGI A;  3BY6 A;  4C2M J;  3EQL F;  2HFH A;  2H94 A;  4RAG A;  2W1O A;  1A6Q A;  2W48 A;  3B6C A;  3BDD A;  4M9Z A;  2FEZ A;  4BXU A;  5GAE J;  2IS6 A;  1XGM A;  1Z0X A;  2W7N A;  2CV1 A;  4M3E A;  2QLZ A;  1W5S A;  4JK1 X;  3SZP A;  1XPX A;  2KKO A;  3HYI A;  4XRM A;  4QTR A;  3CCM I;  1X19 A;  3DU5 A;  1QVU A;  2O5R A;  2K9Q A;  4LMY A;  3GZN B;  3RYR A;  2QEN A;  1Y8Q B;  2KLO A;  3H3Z A;  4ZDL A;  3BG3 A;  5B1B H;  3GVA A;  1JKR C;  1OYY A;  3DKW A;  2EH3 A;  5FFZ A;  2H6B A;  3U21 A;  2X9D A;  3KP4 A;  3W6V A;  3GFJ A;  4UVB A;  3HRT A;  3ERE D;  4KFC A;  1ZAO A;  2VJ5 A;  3S2D J;  3OSG A;  4PZJ A;  2EWN A;  2V6E A;  4NB5 A;  4YRV A;  5DUI A;  3LA2 A;  1C0W A;  1BIA A;  3HSF A;  1OPC A;  1H9T A;  2HDC A;  4N9H A;  3I59 A;  4IRG A;  1U9O A;  3G4S I;  2OQG A;  2EZL A;  3BZ6 A;  2Q1Z B;  4XLC A;  1T6S A;  3CP8 A;  1CF7 A;  3BTJ A;  1HLV A;  1B4A A;  1BJA A;  2IAI A;  1EKE A;  1X1B A;  2QKL B;  2QZ8 A;  1WCM J;  2DA6 A;  1MJA A;  2V9K A;  3OV8 A;  1IDZ A;  1RRJ A;  2M8E A;  3QAH A;  1R7J A;  5J4V A;  1WH5 A;  4ESJ A;  2XC7 A;  3S3O A;  2GQQ A;  2Z1D A;  1XN7 A;  3NQO A;  3PFY A;  5FGM A;  2KMU A;  1GVD A;  1IXC A;  2LY2 A;  4PFO A;  4M3B A;  1T95 A;  2PMU A;  4XL9 A;  3SYT A;  4B1R A;  4YIF A;  4Y13 A;  4ZYH A;  2HDD A;  4R8H A;  1S7A A;  2M87 A;  5FB2 A;  3BR3 A;  4KIS A;  5EZG A;  1X1D A;  2FBI A;  2OU2 A;  2QA4 I;  4KNY A;  1MDM B;  4UB8 C;  3OYE A;  4AD9 A;  3HOS A;  3OYF A;  5DTD A;  1W0T A;  2A6E F;  3FXM A;  2MD0 A;  1W36 D;  4E7I A;  2EFP A;  3TO7 A;  4OIO F;  1U78 A;  2X51 A;  1FBQ A;  1L3L A;  3I59 B;  2CFO A;  5HLI A;  4G6T B;  1GT0 C;  5GTI C;  3HC7 A;  1YFH A;  2E60 A;  2LC2 A; 
#chains in the Genus database with same CATH homology
 2IGM A;  4U7B A;  2DXI A;  3FBI B;  3OYH A;  2KHM A;  2CS3 A;  1G8X A;  4XKC A;  3ZR8 X;  3W2A A;  2I8D A;  3ZCO A;  2A5W A;  5CQG A;  2F6C A;  4EAT A;  2VJI A;  1NG7 A;  1OLT A;  2MAB A;  3FKJ A;  3K4K A;  2HVS A;  2IS2 A;  2WY7 Q;  1S9H A;  2IS4 A;  4ITV A;  5KNL A;  3RTR A;  2KZV A;  4J01 A;  4Y4R A;  2WB1 A;  3G2B A;  1WFX A;  2HU9 A;  2Y0S A;  1DP3 A;  4BJ6 C;  1HA8 A;  1YE9 A;  1WJC A;  2ZXH A;  2R7V A;  2X6Y A;  2JVG A;  3PSI A;  4B3X A;  4ZJZ A;  4E7H A;  4AU7 A;  4MLO A;  2CUJ A;  1PYV A;  1EA3 A;  3TL4 X;  1Z3X A;  3PJR A;  1MMG A;  3AL0 B;  2VL8 A;  2IGN A;  1Y56 A;  3GBG A;  2XF5 A;  1BR2 A;  4PJL A;  2VIX A;  3QYF A;  4CUG A;  2KRH A;  3OYA A;  2CW8 A;  3J7A Y;  3W2V A;  2LH9 A;  3ZRG A;  1Z3Y A;  2L5Q A;  3OYD A;  3A4C A;  4D9J A;  2OUM A;  3C2H A;  4P5O A;  1AA7 A;  1N77 A;  1DGR M;  4ZTJ A;  2NOJ B;  2CW7 A;  1D0Y A;  4BL0 B;  3HUG B;  3OYC A;  1KON A;  3PSF A;  3HKZ A;  3MMY B;  4IKF A;  1UEL B;  3MKY B;  4KIT B;  2LOO A;  1MMD A;  2DT7 B;  1BR1 A;  3DWL E;  2HDW A;  3TMO A;  3H9J A;  3L2V A;  2LYC A;  2VXZ A;  3LFU A;  3VWB A;  3W2W A;  2X6X A;  3ONQ A;  2X1D A;  3H9Q A;  1X1A A;  3M1C A;  3EUA A;  2PJR A;  1PJR A;  3PNY A;  3BCA A;  4CCM A;  4OWR B;  2BVM A;  5FRM A;  1OR7 C;  2IS1 A;  4B44 A;  1LVK A;  4BXF A;  4DBQ A;  2W82 A;  4BE2 A;  3RCO A;  1DGW Y;  3UNG C;  3LL7 A;  4NC8 A;  1YX5 A;  1V5E A;  4PJM A;  2KDO A;  4XR6 A;  4F91 B;  4DJA A;  2AQE A;  3M8J A;  3SEQ A;  3OYG A;  4XLA A;  3DKX A;  4BJ5 C;  3RQ4 A;  2HVR A;  3OOU A;  2KQR A;  2BW3 A;  3H5N A;  2M3A A;  2R7W A;  5FRO A;  4YEJ A;  2W00 A;  1QHH D;  4XN3 A;  2WBM A;  1WJB A;  3HPH A;  3OMY A;  1WJA A;  3H5R A;  4QPO A;  2VJ4 A;  3I3L A;  3LSM A;  2R4G A;  3FHN A;  4Y3O A;  4NUB A;  2XAU A;  3LSH A;  4HEA 2;  3OR1 C;  4DBR A;  5FRN A;  3FBN B;  2QKM B;  3A2K A;  1X4O A;  3H35 A;  3DLA A;  4GRI A;  3EUK L;  2V4J C;  3DPL C;  2PJR B;  3A1Y A;  4ANJ A;  2HNH A;  2KRC A;  3L2Q A;  2VLA A;  5HOO A;  3E0J B;  1Y6I A;  4ZTF A;  3IP4 B;  2MYS A;  1J09 A;  4BQN A;  3LSG A;  4CSW A;  1TT0 A;  2GOM A;  3PNV A;  3LMM A;  2R7X A;  3KX2 A;  3HOT A;  3K4C A;  4AYB A;  2K3P A;  1SFK A;  4N4N B;  3LSK A;  3L2W A;  1D1C A;  1LKX A;  3S3M A;  4FET A;  3DPU A;  4Y33 A;  4B47 A;  5KHD A;  2IGK A;  3VYR B;  2BW3 B;  2ELJ A;  2VPL A;  1T0F C;  4HSR A;  2E1M C;  2E5Z A;  4II2 A;  2L9N A;  2VXD A;  3K4M A;  4XKW A;  4E7S A;  3ZGK A;  4PSW A;  4XN0 A;  4C30 A;  3OYN A;  2VQH A;  2R7Q A;  4HRI A;  2A6T A;  1MNE A;  1QU3 A;  1FMV A;  5HNF A;  1FMW A;  1MW7 A;  2X1E A;  5CPR B;  2R7O A;  1WJF A;  3S93 A;  4CZC A;  4C2U A;  2LG4 A;  1V5G A;  4BEH A;  1UAA A;  2M7B A;  1QHG A;  2L2O A;  4IQ4 A;  3CJQ B;  3IUO A;  4B43 A;  3PNT A;  1D0Z A;  2M0M A;  4XMY A;  3MKW B;  4XOR A;  3VYS B;  4HST A;  4RMN A;  3CES A;  3OYB A;  3K70 C;  2VAS A;  4PK4 A;  4B48 A;  4BQO A;  4E7L A;  4XQF A;  3SDB A;  2PMZ A;  3DTK A;  2WA0 A;  2HPI A;  4F55 A;  3VYU B;  2VKH A;  3AKZ A;  3NWT A;  2Q2E B;  2HPM A;  3VYT B;  3HXL A;  4KJZ A;  3CF2 A;  1N75 A;  1MND A;  2KP6 A;  3CZ6 A;  1WJE A;  2WAF A;  5LD2 C;  4C9Y A;  4BDZ A;  2R7T A;  1BOB A;  4E4H A;  1LFP A;  1R6R A;  1U0J A;  2K9L A;  3QOE A;  4KT6 A;  3HL2 A;  2FUG 2;  4P1W A;  3K10 A;  1TZL A;  5CKT A;  2IGO A;  1SAU A;  2CV2 A;  3DPT A;  4U87 A;  3ZQQ A;  1YX3 A;  4CH7 A;  1NG6 A;  3BCB A;  2KL4 A;  3N05 A;  3PUB A;  3QYE A;  4BE0 A;  3OWT A;  2M4K A;  1LDK B;  3S8P A;  2OV7 A;  3DU6 A;  5HLT A;  2BOL A;  4XKB A;  4IZZ A;  3I9V 2;  4LIU A;  3OIP A;  4ZDO A;  2HVQ A;  2VQL A;  2F5V A;  2M4G A;  2WY8 Q;  4D1Q A;  3K4B A;  2UV1 A;  4BS9 A;  4PSX A;  3TBI A;  2LRE A;  1Z21 A;  3DTI A;  4RLQ A;  2VJJ A;  1W36 C;  4E7J A;  3PL8 A;  4XOT A;  1ERD A;  2V7F A;  2WAE A;  3CJR B;  3LSI A;  3VSL A;  2V26 A;  4LIV A;  4NC7 A;  1MMN A;  2XDV A;  3QOD A;  4HPQ A;  3OS1 A;  3OY9 A;  1K6Y A;  2X1C A;  3D5S C;  1VZ0 A;  4NQW B;  1WJD A;  1MMA A;  4II3 A;  4HNU A;  4LG3 A;  3OL3 A;  1ZEL A;  4RLF A;  2WAD A;  2VKD A;  3OYJ A;  3OYL A;  4PJN A;  1X1C A;  3SZG A;  3H9G A;  4ZC3 A;  3HG9 A;  4XNF A;  4F52 A;  4FAS D;  2JA2 A;  3DQV C;  4BU2 A;  3OYI A;  1G59 A;  3SEZ A;  2CUZ A;  4XLH A;  2RQQ A;  4E7K A;  5TGT A;  4JQF A;  5HNH A;  1UG0 A;  3EUH C;  3VDX A;  2K9M A;  2RNG A;  2XF6 A;  2MFZ A;  4PFP A;  4F93 B;  2E5N A;  2RRE A;  4RM3 A;  3QYB A;  1JI8 A;  2UUZ A;  3CP2 A;  2X6W A;  3K4N A;  2JVH A;  4CA0 A;  2E1M B;  2LRD A;  3VSK A;  3EPZ A;  3BLY A;  4XLF A;  4R79 A;  4CCK A;  3NWS A;  4HNT A;  3DTE A;  2ZSI B;  4BJT A;  1D0X A;  3AFH A;  3E1S A;  4ZDP A;  5JHF A;  4DIQ A;  2OC6 A;  3HC7 A;  4OAY A;  3KEY A;  4E7Z A;  5KCM A;  2R7U A;  4NNJ A;  4PUS A;  2HQA A;  4ZYA A;  5CQE A;  4F3Q A;  2R7R A;  3KYL A;  3BC8 A;  3OS2 A;  2DOA A;  2V1N A;  2GOX B;  1E0E A;  2W4S A;  4XOP A;  2W1O A;  2XSJ C;  3DEE A;  2F4I A;  3AL0 C;  3RPU D;  2ZSH B;  2IS6 A;  3OS0 A;  2UWM A;  3IAS 2;  4E6K G;  2W7N A;  4BAC A;  2CV1 A;  2K5C A;  4CCL A;  5LFA A;  4XM3 A;  2R7S A;  3K4L A;  1X19 A;  2AQF A;  2L7K A;  3DU5 A;  2Z2S B;  2ZXI A;  3K4J A;  4F92 B;  2O5R A;  3L2R A;  2KPM A;  2DCE A;  3V42 A;  4X0G A;  2CMP A;  4XON A;  2JSP A;  3D5R C;  2KLO A;  4IX7 A;  4ZDL A;  4RM2 A;  2LBF A;  4BDY A;  1N78 A;  4JOM A;  4J00 A;  4OAZ A;  3K70 D;  3U21 A;  4LIT A;  4XKV A;  4BQQ A;  2BVL A;  4QPQ A;  3H5A A;  4BEH B;  4PJJ A;  2VJ5 A;  1WJ5 A;  4N4O B;  1D1B A;  4BUP A;  2M7A A;  3MD2 A;  4CCJ A;  4DGW B;  3H0D A;  3F9K A;  1DQU A;  2XF7 A;  3HPG A;  2V6E A;  4YRV A;  4CCO A;  1P9Q C;  1GLN A;  3RSN A;  3IAM 2;  3MKZ A;  1X4P A;  3D5L A;  3FDY A;  2JUG A;  3DKY A;  4BE1 A;  2WAQ A;  4XLC A;  2Q1Z B;  3CP8 A;  3S32 A;  2ZFU A;  4BGD A;  1D1A A;  1V5F A;  5HVQ C;  3OR2 C;  1X1B A;  2IXS A;  2QKL B;  1IRX A;  2V9K A;  2Z16 A;  3BG7 A;  2X85 A;  4AVZ A;  2XC7 A;  3S3O A;  2VQG A;  2Z1D A;  3OIQ A;  2DT6 A;  3OYM A;  3PFY A;  4H4K C;  3L2U A;  2KMU A;  3BG6 A;  2VQC A;  2LY1 A;  2LY2 A;  3CMM A;  4PFO A;  1T95 A;  4XL9 A;  3SYT A;  2LBF B;  3ZXS A;  4DOZ A;  3UR3 C;  2CH0 A;  4KIS A;  3C2G A;  1X1D A;  2HZD A;  2CV0 A;  1Z7L A;  2L9S A;  4C2T A;  4IQJ A;  3K6G A;  1BR4 A;  4YEL A;  3OYE A;  3HOS A;  3OYF A;  3S3N A;  2P0W A;  4CCN A;  1W36 D;  2MD0 A;  4E7I A;  4HG2 A;  3OYK A;  3OL4 A;  3W3C A;  2VB6 A;  2X51 A;  2DJI A;  2CFO A;  4XLE A;  4G6T B;  2MC4 A;  2E60 A;  2LC2 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...