4NC8A

N-terminal domain of delta-subunit of rna polymerase complexed with nickel ions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
KQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-directed RNA polymerase subunit delta
publication title X-ray vs. NMR structure of N-terminal domain of delta-subunit of RNA polymerase.
pubmed doi rcsb
source organism Bacillus subtilis
molecule tags Transcription
total genus 23
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nc8A00
4NC8A 4NC7A 2KRCA 2M4KA
chains in the Genus database with same CATH superfamily
4LLLA 1ZLKA 4KYWA 4HNTA 5M5WJ 1S5LC 2BHZA 4BKXA 2L7ZA 5CJ9A 1FT9A 3RYRA 3U1KA 2DN0A 3DP7A 3V8KA 5AIPA 2EINH 2QYOA 1G3TA 2F2EA 4NQWB 1JUMA 3A4CA 4CZZA 2BV6A 2Y9YA 1IW7F 1NK2P 1R1VA 5H6QA 4A2UA 4BXFA 4A3DJ 2CSOA 1WQ2A 1X3ZB 4GXOA 3M1CA 5KHDA 3JRFA 2RVCA 4OINF 2H09A 2ELJA 2MA3A 2VBYA 4OU0A 1BW6A 2W85A 3HYIA 2JA5J 2VUMJ 2UZKA 4MO7A 3AG1H 4HNVA 4V19K 2KIMA 1DP3A 2CQQA 4CCOA 4D7NA 4XBFA 4CZCA 4LFUA 3MAJA 4IRIA 1XS9A 3HGGA 2EPFA 5A2QZ 3OY9A 3Q0WA 2BXYA 2L02A 1MNEA 2XRLA 2DLLA 2FQ3A 5FJ8J 3HUGB 5LLQA 4U7BA 1MBKA 3QP6A 4ESJA 3HOWJ 1K6OA 1FEXA 4MFDA 5F04A 2H94A 2KQRA 2L4AA 4XLNF 1OQYA 4S04A 2BW3B 2F5CA 5BNGA 1K78A 2L5QA 4EGZA 4JX5A 4IF4A 1JKPC 1I39A 2D5VA 2MBFA 2WY7Q 1JT0A 3IHUA 3TW6A 3CCQI 1WCMJ 2L9SA 3I64A 1HCRA 1EF4A 3IL2A 1RZ4A 2D1VA 2R4GA 4ZTFA 5E3MA 1EJ9A 2ID3A 3JSOA 4L0YB 1ZR2A 1SFUA 3A03A 2KRFA 4GDFA 4JQFA 5CVUA 3DCFA 3HJEA 3OR2C 1APLC 1TQIA 2M34A 2W4SA 1B4AA 2YX4A 4I09A 1ZREA 1B59A 1XCBA 4GFBA 2QKMB 2QBYB 2A6EF 2QUFA 1ETYA 4WK8F 3DKXA 2A5WA 3F8BA 3N97A 1D1CA 1XGOA 4QPQA 2LD5A 3VOEA 3G73A 1HLVA 3IV5A 1V5FA 1LPQA 1HW2A 4UNOA 2E35A 5ICEA 2CJJA 2QQ9A 3HGYA 3MWMA 1PP8F 4HX7A 2HZTA 2CUFA 3I59B 3CESA 1R7JA 3AKZA 4IPAA 4N9HA 1YW9A 1KONA 3BTCA 3FXMA 1ORKA 2QSGX 3JTGA 3OS1A 2E7WA 2JUGA 4RLQA 4CXFA 1Z67A 1OCOH 1YW8A 5DEQA 4J19A 4BACA 4XOPA 3REOA 1SD7A 3WTYC 4FQGA 3FMQA 4I7HA 3VYTB 2CG4A 3UKGA 2ZO4A 4P9FA 3I4PA 3RZOJ 1R58A 4LITA 5EDNA 5E8IA 1ETQA 4M6VA 1WGXA 2DMNA 2K02A 4WX9A 2MABA 2QGUA 3R0AA 4EM1A 3V7CA 3TP0A 3LFKA 1FBUA 3KCCA 3GTOJ 1JKQC 1ZGWA 3HOTA 2C6YA 3WTWC 1FJLA 2IS2A 1FSHA 3CCVI 2R7SA 3H3VK 3GFIA 1MIJA 3HUGA 5L3FA 1ZGJA 2Q0OA 1HW1A 1IN8A 4D1QA 3MKZA 1DP7P 1JHFA 2EQRA 4E70A 1GT0C 3GW2A 4CCJA 3OIQA 1IJWC 4CICA 1N25A 4J00A 4BQAA 1OCTC 1D3YA 4L0ZB 3RCOA 3NARA 4KN4X 4MFEA 1F36A 2VE8A 1XDUA 4ZH4F 1R71A 3W6JB 4BE1A 1DUXC 2DYRH 1YX3A 2LY9A 2M0CA 4YIRX 5IP6A 1F9NA 4HSTA 1SVOA 1Z1DA 1AKHB 5D4SA 1GLNA 1OJLA 2DPDA 1P7JA 2XF5A 2E34A 2Z3YA 4EM2A 1UFMA 2RGVA 2V7FA 1ETKA 3KEQA 3PNYA 3HKZA 4BY1J 2ZMEA 3QU6A 3OYKA 1SVMA 2IVMA 2QQ8A 2VBWA 2HI3A 3KP4A 5K5RA 1XN7A 1KU7A 1NH3A 1V4RA 3SYTA 3K6GA 3TDUC 4BXUA 4B3XA 3U2RA 4CSWA 5FB2A 3ABMH 4P1WA 4BDYA 2LOOA 4BDZA 3BR1A 1F5TA 2E1NA 3KEYA 4A3KJ 3DEEA 2TCTA 1UJ8A 2R3SA 2XGEA 2IXSA 5LRRA 1U9OA 1YJNI 1IC8A 1LQ1A 2E60A 4CO8A 3LQQA 2QENA 4A6DA 3SEQA 3S2WA 4J01A 3TGNA 3LSKA 1BJAA 2GXAA 3I59A 5EG0A 4DGWB 3M8EA 3PM1A 1LDJA 1TP4A 3DEUA 4AIJA 2G7UA 2WC2A 4HV6A 3JRBA 1P9QC 2DMTA 3OYCA 1W7PD 2CO5A 3J7AO 5L3CA 3KYDB 1X2NA 1XX5A 4PFOA 3RQIA 4DZPA 5HLTA 3IC7A 5CYVA 2X9DA 4IOCF 1YRNB 1K79A 3OMYA 3E6DA 2QZ8A 1JTYA 3G6EI 3DTEA 2VASA 4IL6C 3M8JA 5CPRB 3HKZN 4BY7J 3SJMA 2KIQA 4ZYAA 3TOAA 1E3PA 5IY5H 3HSEA 2EZKA 2CQKA 3P9KA 2KIFA 3J80K 2XF6A 3MFKA 1LE8B 4UHTA 1SFXA 5AIQA 6PAXA 1P4AA 2H6BA 4EVIA 2VLAA 1VFCA 3IH3A 4W1UA 4HQEA 4IO9F 4D5CA 5LEJA 1WRJA 4RGUA 2IGNA 1IF1A 4LB6B 4M71A 3IP4B 3GTMJ 1AHDP 1TT5B 4L5EA 3Q0VA 5DCMB 2IS4A 4EV0A 1T33A 2MH2A 3L2UA 2E1OA 5HLIA 3MVPA 4LG3A 4WXDA 3AFHA 3ZR8X 4OMYA 3R6SA 4DOZA 5GPAA 3CO6C 3SDGA 2XPVA 4C2UA 1MGTA 4L9TA 3I54A 2IEKA 4WWCA 2Y48A 1X4PA 5GAHJ 2LMDA 3B6CA 3BJ6A 2JN6A 5L3EA 5C44J 2DBBA 4I01A 2E2JJ 3S1RJ 2R93J 2JJ7A 4HAMA 4QWQA 2R7VA 3PNVA 1VQLI 2LY1A 2CMPA 3L1PA 3LNQA 1FP2A 2VC1A 1M1EB 3K69A 4RS8A 3BP8A 1VQ9I 2STWA 5E17F 5IT3A 4H0EA 1CF7B 2ZKZA 4ZZLA 1ERDA 3VYRB 1BJZA 1WJAA 3COAC 4JK1X 4XICA 2L9VA 3SHFA 4YFKF 2Q8KA 3U1DA 2E5NA 1QPIA 3RJPA 4CYCB 2CUJA 2VKEA 2M7BA 1UELB 2FU4A 5J3LA 1FX7A 2M3AA 4BEHB 3DWLE 4NC7A 2PG4A 2L0KA 1QHGA 5CQGA 4UB8C 3CQZJ 2XAUA 4I98B 5E1ZB 5JLXA 4HBLA 3WHCA 4MEXF 1Z7LA 4F92B 3B02A 1NG7A 2L9NA 1QZZA 3P9IA 3IRRA 3LAJA 2ME6A 4XSZF 4YG2F 1VQPI 5EZHA 3OL4A 2VPLA 3GO5A 3HTUA 3R60A 3FHNA 1W4MA 1G3SA 1HBXG 2P5LC 1HW5A 1N77A 2K9NA 1ZQ3P 4IQ4A 2HOEA 2VJ4A 2PX9A 3HOXJ 1A6IA 4QTRA 4XONA 2WV1A 3CLOA 2K9LA 1A36A 1FIPA 5DM7F 3R61A 1VTNC 2R7ZJ 3LSIA 4D5FA 3TMOA 2EV0A 2FD5A 4CDGA 1R9TJ 3RSNA 2IA1A 4MQVA 2XGCA 3ZP5A 2L7FP 1U5TA 3K2AA 1B8IB 1SD5A 2XGDA 3CCEI 4F91B 4KIGA 4BGDA 4LGWA 1J5YA 4XLFA 5DCMA 2IA0A 4PCQA 4YIIA 1MD0A 2VKVA 1J59A 3FK6A 1MMGA 3PQKA 2IJLA 3ZMZA 2BVMA 1W7PB 3ZN0A 5LGTA 1TLHB 1HKSA 1S3JA 3GTPJ 4EEFG 3CMAI 1I5ZA 2VXDA 4I0BA 3L2WA 3FXUA 3SEZA 1J2XA 1FWZA 4HA8A 2NVQJ 2Q2EB 3OIPA 3IAM2 2WV0A 4P96A 3C2BA 5CLSA 2O3FA 2W25A 4N9IA 5DTDA 2KP6A 1QNTA 1TQPA 2EH3A 3F9KA 1X3WB 2XHKA 1O7LA 2CQXA 4CYDA 1MJAA 3CF2A 1W1WE 3H3ZA 1WSUA 1Z91A 4A3FJ 1SD4A 2FBIA 5IT9Z 1IGNA 1OLTA 4M6XA 1MMAA 1OMIA 4IHYA 2EIKH 4D9JA 3EETA 5F08A 1SANA 2K7LA 1MNDA 2LTPA 4B48A 3ZQIA 2ECBA 1ON1A 4A5MA 2HVSA 4HPQA 4YIFA 4BEHA 1UZCA 2EFOA 2RQQA 4IXAA 3LL7A 2HPMA 2BY2A 2V1UA 2LLKA 1MH4A 3FXJA 2F48A 4ENMA 1UHMA 2ZSIB 3BR3A 3J7ZI 2R7RA 5LGUA 1TW2A 2CUZA 1O3TA 1MJ9A 1MMSA 1AOYA 1R6RA 4X1EA 5F1JA 2EFWA 3HOZJ 4R79A 2ZB9A 3H0DA 3OR1C 1F43A 5EEGA 5L3DA 3PSFA 4IHWA 4PUSA 2OA4A 2LREA 4Q48A 3WE2A 4KMUX 4A0ZA 4B09A 3BG5A 2JVHA 2D2WA 1O3RA 3L7WA 3LAPA 2HQ5A 4JX6A 5J8CA 2A6HF 2DA7A 3TBIA 1Z9CA 1XSDA 2V1DA 2QWWA 2X1CA 3GF2A 1FOKA 1S29A 1W5SA 3H92A 3NEUA 4FISA 2WAFA 4LMYA 4MNUA 3ELKA 3VSLA 2OAZA 3OV8A 2ZBKA 2CRGA 1PVEA 1IXCA 4Y3OA 1JE8A 4UUVA 5AONA 2BZTA 3QYEA 4AD9A 2PJRB 3HOVJ 4OIOF 3HB9A 2JMWA 4A12A 3PJRA 1VF9A 5B66C 5B3SH 1IDYA 5L3GA 2GOXB 3S8PA 4N4NB 4Q5SF 2XSDC 1AU7A 4P55A 2ZMEC 3RPQA 1YG2A 4DNCA 4F52A 2VT2A 4B44A 2RDPA 1HKQA 2Y9ZA 1IRXA 2JSCA 4ZDLA 1YOVB 1UG2A 2IA2A 4ANJA 1OISA 1ETVA 2XB5A 3RQ4A 3I53A 3LA7A 4I76A 4RGXA 2EIJH 3ZQQA 2GIZA 4GO1A 3ZMUA 2E19A 4XLAA 3V4GA 5M3FJ 5E3LA 5DUKA 4B4CA 1BN5A 2IBDA 1J09A 4E6KG 3ASOH 4IJAA 5HDGA 2L2OA 4M6YA 5C4JJ 2OJED 2XAGA 3BY6A 4UV8A 2DU9A 3PO3J 1W5CC 2L54A 1YLFA 2NS8A 2LF7A 2IT0A 1YTYA 4HDVA 1ZARA 4I6ZA 1RPWA 1D1AA 2DA3A 3KZZA 2VONA 2XAFA 4E7ZA 3CCMI 1BR1A 2VKHA 5K5QA 1WFXA 2GBYA 2CH0A 3WHBA 5TRDA 1Y1WJ 4DBRA 3I4MJ 4HF2A 4MEYF 4M9ZA 4JP0A 1I1GA 4IQJA 3F8CA 2D45A 2OCCH 1YIOA 2HQAA 1ETXA 4XLEA 3WTTC 4W97A 1IN4A 4UVCA 2JA7J 2HYJA 4XRSG 4FCYA 1JI8A 4BQQA 1ZKGA 2DCEA 4WXCA 1HDDC 4ETSA 1LVAA 1ZLJA 4FTHA 4KT5C 2X85A 2A07F 2J5PA 4LIVA 4R1HA 3JRGA 1K78B 2DOAA 1UHSA 1R5GA 3ONQA 2WA0A 1NHAA 4Z2YA 4AVPA 3BR0A 2PEXA 2GZWA 2F5EA 1I27A 2OCEA 2L4MA 3C2GA 3HRMA 4RAFA 5DDGA 2ISYA 1LNWA 3PFIA 1ZN2A 2K9SA 2R92J 1W5TA 2TDXA 3F8NA 4KDPA 1IV6A 4G9YA 3K4CA 2V79A 3U9GA 1FSEA 2H8RA 3FWEA 1K4SA 1TNSA 3S3NA 3CC2I 4HLYA 4HRIA 5DS9A 1D5VA 5J4VA 2ME0A 4XN0A 1HKTA 2OUMA 2VB6A 2BEOA 3TW7A 4XL9A 4DYQA 2QF7A 3M4OJ 1ULYA 2M2EA 4G8XA 3VYSB 4FX4A 4E7LA 4WCGA 4UVAA 2MC4A 2KJCA 3ZCOA 5FRNA 3CUOA 2M30A 4HX4A 1MNMC 3NWSA 5HDKA 3MCZA 4PFPA 5GAEJ 1BIAA 4L9JA 2QA4I 1YW7A 2Y0SN 2YR2A 2RQPA 1Z6RA 1NG6A 2DAOA 2MLKA 2MD0A 1SFKA 3BROA 2NVUB 2YS9A 2LYCA 4B8XA 5K5OA 3FXOA 1V3FA 3CMMA 1BM9A 2XDVA 4N0BA 1KQ9A 4QLCU 4G7HF 1YX5A 3G1MA 4BJ6C 2DJIA 3FXLA 2M4GA 3E0JB 4XR6A 4PZJA 4C30A 4HLXA 1C0WA 5FLVA 3EUHA 1OKRA 4AIDA 1H9GA 2WAQA 4OMZA 4Y15A 4I02A 2HOSA 5HNHA 5IYBJ 2D1HA 4YFNF 4OAZA 3S14J 2ZSHB 2E2HJ 2JPBA 5F0FA 5J1YA 1FC3A 3BTIA 4MQ9F 3IWZA 1FMVA 1IO2A 1IRZA 1Y8RB 4EJWA 2P81A 5E18F 2R5ZA 5LHHA 2YU3A 1QA6A 3FK7A 2ZFWA 2P5VA 1SFEA 3WU1B 4DYRA 2FOKA 2G0EA 4PSXA 3CZ6A 3JAMK 2COMA 2DOFA 3H35A 1U5TC 3BQYA 4V2FA 2W82A 1POGA 2FJ1A 2DTZA 2X1DA 4F55A 2NOJB 1MBEA 3B73A 2VI6A 3AAFA 2O8KA 1BI1A 2DFEA 2PQ8A 1YJWI 1B9MA 1FOWA 2KHMA 4UB6C 1B9NA 2ZMEB 1U78A 1JGGA 1WVRA 2B0LA 1ZGAA 3ZQGA 3J81Z 5BOXA 2WAQN 2LR8A 4KMFA 5DV5A 5C4XJ 2EFPA 3T1BA 1WH7A 1XB4A 1STZA 2LBFB 4B47A 1R5HA 2V6CA 1QBJA 1LVKA 3KYLA 2FUG2 5CQEA 3OYAA 1DDNA 4G6QA 4PSWA 2H8WA 2FBHA 1T0FA 3HHHA 4EM0B 2QKLB 2I8DA 4F3QA 5EG0B 3KLNA 3GXOA 4KIBA 1ZYRF 2XROA 2W7NA 5H6RA 4BE0A 2OTLI 3FMRA 2I5UA 3ULQB 3U21A 2ADUA 2P4WA 2WWYA 1IUFA 1MBHA 2FQ4A 2KISA 3HBLA 1D1BA 1O3SA 4AM3A 1RESA 4M3GA 4M74A 2LF8A 3TOBA 3VYUB 3GFJA 1ZK8A 1ZTRA 4FASD 9ANTA 1S72I 2NVYJ 2V1XA 1EKEA 1YITI 3KZYA 4I99C 1KGSA 4EJUA 4OOIA 3G1OA 2K40A 4ZYDA 2EZIA 3E5XA 4A3MJ 1J7KA 1HXDA 5DD4A 2K4BA 2ZJ2A 5HLGA 5F1RA 3F22A 3I71A 2X6WA 3PIOF 3OOUA 2M0MA 3E7LA 5E3NA 1U3EM 3IH2A 4Y4RA 5DCFA 3TO6A 1O4XA 4Q47A 4ENNA 1JJ6C 2K4JA 3VPRA 5J1UA 1ZRDA 4XLPF 5D6EA 3OYDA 3H9GA 1QHHD 3BC8A 1TWCJ 4HOBA 2F5FA 1FNNA 2DA2A 2VQHA 2I10A 3HRSA 1JTXA 3WG9A 3F21A 3JCUC 3CJQB 1LFUP 3AG3H 3BTJA 4U0VA 4C3HJ 4BBSJ 4QPOA 5F0HA 5KCMA 4HDUA 1V5GA 4BJTA 4HNUA 3BT9A 5EEHA 1T2KA 5FRMA 5A2QK 5JVGF 1P4XA 3G3ZA 2R7XA 1DGWY 1WJBA 1R1TA 3IH4A 3TP3A 4KICA 3CCSI 2M8GX 2FMLA 1RUNA 4NC8A 3Q9VA 2IGOA 2NNNA 5FLXZ 2FBKA 1YYVA 2Z16A 1HA8A 2LBFA 1QZYA 3M07A 3GEZA 1GV5A 3HG9A 2ZJPF 4LG0B 1J0RA 4G94A 4Q4ZF 4Y13A 3K70C 2X6YA 2PBIA 1IRGA 3WTUC 3BCBA 2MG4A 2E2IJ 3A1YA 2COBA 3S3OA 2XKPA 4E7HA 2CGPA 3I9V2 2LC2A 3VB2A 3KE2A 2KZGA 1WWXA 2WB1A 3LA2A 1YJ9I 4XLHA 4IVNA 4EATA 3CO7C 3NRVA 3TO9A 1YO5C 2HDDA 2PJPA 3MZYA 2ID6A 2VODA 3J81K 1WH5A 2R7DA 3CC7I 3K9TA 2DFHA 5IOZA 1BI2A 1QU3A 1X1BA 3OYJA 5HDNA 4O5VA 1X1PA 3LMMA 4Y52J 2O9LA 2LDUA 5H2FC 3PNTA 3QODA 1TC3C 2OD5A 3K4BA 3OOPA 3K4LA 1SAXA 1D0ZA 1UCRA 2BVLA 1Q1VA 1Y56A 3HDDA 1XMAA 3FM3A 3RKWA 2X48A 3CP8A 1UB9A 3K70D 2EA4A 5M5XJ 5ICCA 5GP9A 5FKLA 3KIOA 1U5TB 2RREA 3V8LA 3F0CA 1T95A 5KNLA 4FT8A 1KQ8A 2A5YB 1MSFC 5CKTA 1LUJB 3VODA 2NAZA 3V7SA 4L18B 3WGIA 4JYKA 4KFCA 1VQOI 4ENJA 2XGXA 3ZMSA 1N75A 4BQOA 2ZFUA 4HQMA 4KA4A 3SQNA 2RN7A 1F1ZA 4ON0A 2YX7A 2WB1N 5ILUA 2R7QA 5FKOA 2HQRA 3K10A 4X6AJ 2BXZA 1FY7A 5LFAA 1SFOJ 3N4MA 1S7AA 3BDDA 1USTA 5B1BH 4OIRF 4A3IJ 1R49A 2NVXJ 4B3AA 3PO2J 2KDZA 3TDZC 3ZMDA 1H89C 2ICWG 3CJTB 2HDWA 3PUFA 4L9VA 5HNFA 2DA6A 4OWRB 1LDDA 2V26A 2E71A 3TL4X 2DA5A 3T8RA 5F0CA 4U7DA 1WKMA 1IXSB 2VOPA 2F4IA 1T6SA 2QSFX 4LG0A 3I55I 1T39A 2HXOA 2P5KA 1VQKI 2HEOA 2WAEA 4XSXF 1U0JA 1HDPA 1NTCA 1XGMA 2KL4A 2PMZA 3HEFA 2R5YB 1X3UA 1YFHA 1PUEE 1MZBA 3SZTA 3A0HC 1HOMA 4AVZA 1FBQA 5ILSA 3K1NA 3FXKA 1TL8A 3KP6A 4AUXA 2CW7A 2GXBA 2W84A 3WTXC 3CTAA 4AWXB 3JRIA 1K4TA 1T08B 3ABKH 3GFMA 1U6GA 3T5XA 3F8FA 4OAYA 3BG3A 2JWTA 2VJIA 3FDYA 3EUHC 2K3PA 4UVBA 5ICFA 3HRUA 4BUPA 2FNPA 2EB7A 2M9HA 1T98A 1HC8A 4DYCA 1D0YA 4XKVA 1FBSA 1VQ4I 1ACIA 1CGPA 2UXXA 1DPUA 3PUBA 3P9CA 4ZYHA 4ZZDA 3GMEA 2HYFA 4RAZA 1N78A 2XPWA 3GWZA 1SD6A 1I3AA 1S8NA 1XGSA 4RB2C 1BOAA 1QZEA 2JRTA 2W24A 5K1YA 5BPIA 4IOAF 1I6HJ 1Y0NA 2PMZN 4IEJA 3HPHA 1QVTA 2OTJI 2K5CA 3ECHA 5EYRA 4U87A 4C9YA 4YEJA 3SZGA 3LQRA 3CDHA 1JUSA 4WXHA 2O6GE 3E97A 3H3UA 3J7AY 2DFFA 3HOUJ 1XCVA 2MH9A 3FXRA 2BY1A 2XRNA 3FBIB 2IPQX 2DXIA 2RC4A 2LVSA 4MGRA 2GQQA 2AXLA 2NOGA 1R23A 3NWTA 2JUCA 3QQAA 1FTZA 2M87A 1U8BA 2DK8A 2V9PA 4PGHA 3H1CA 1JGSA 3QYBA 4NB5A 1Z3XA 3E3VA 3L2RA 1GXQA 3E1SA 1T0FC 2DQLA 4M9XA 3ZN1A 1BL0A 1ENHA 4M72A 1A6QA 1U8RA 4BQNA 1OYIA 2R5YA 1XMXA 3HXLA 2XUBA 2O5RA 2K86A 5FROA 2JA8J 1I50J 1ZHFA 2HYGD 3BWGA 4A5NA 2DT5A 5FD5A 1BA5A 3I5UA 2E36A 1ZG5A 4M3EA 2HOAA 4BU2A 1H88C 2XV4S 4A3LJ 2GLOA 4MTEA 4XORA 1T8IA 1VQ6I 2MW8A 1UAAA 4UV9A 1CQTA 2OZUA 4C3JJ 5LBQA 2H1KA 3H5AA 1LJ9A 1FMWA 2EJRA 2QQAA 4KIFA 1UG0A 1WI9A 4MIMA 1R00A 2NXNB 3EUKL 4QIWN 3BG9A 3SZPA 4CH7A 3FKIJ 2IRFG 4C3IJ 3ZQCA 2HKOA 5E79C 3FM5A 3ZMTA 2OPTA 2EWNA 3RKYA 3UR3C 2QCOA 4U0WA 2DFIA 5IP9J 2DT6A 3DPTA 2BYVE 4GRIA 3QRFF 2B9SA 3KYCB 1ITYA 3QPSA 4MHGA 3BG6A 4RM2A 3M7GA 3G2BA 2O0YA 4M3BA 5F6FA 4GCVA 1E2XA 2OBPA 3K7AJ 4M3DA 1QVUA 2GA1A 1PDNC 4KNYA 1RR7A 3LSMA 3ZQLA 2Y0MA 4IHSA 3OIOA 1XD7A 2M7AA 5E1XA 2BGCA 5ICGA 5M3MJ 3BLYA 2DMPA 2RV8A 3OYFA 1ON2A 2HOTA 1XDSA 3E5UA 1Y39A 5IP7J 4BYYA 3HL2A 3S1NJ 4HSRA 2HNHA 1OCZH 2K9QA 1VZ0A 4KT6A 2ZXHA 1XGNA 5LD2C 4HF1A 4R8HA 3UNGC 3QPLA 1B72B 1VNDA 5J1RA 3G1LA 2ESHA 1WJEA 4LK1F 2VL8A 4UXNA 3FZVA 3S15J 1TBXA 2CV2A 3D5RC 2V9VA 2WADA 3C7JA 1WJFA 2K85A 4B43A 4HX8A 3EUAA 2W57A 5HS9A 3P5JA 3L9FA 1T38A 1DGRM 2F5VA 4KJZA 3A2KA 1ZAOA 3HRTA 2L7MP 5GPCA 1RUOA 2F4OB 4MLOA 1I6XA 4XM3A 2X51A 5E1WA 1RKTA 4A0XA 3WTVC 4A3CJ 2R7TA 1BIBA 2X6OA 4A3BJ 1MKMA 4XKCA 3F8MA 1LEAA 2TRTA 2Z33A 2AQFA 1KU9A 2E1CA 1IAWA 2LH9A 1I3QJ 4RB0A 1G4DA 4U0YA 1WI3A 5IT9K 1BC8C 2E1MC 3K4MA 2HVRA 3DEWA 4IX7A 2IGKA 1XPXA 1E3OC 1OCRH 1MDMA 2Y75A 4JOMA 3O6BB 2DI3A 1BR2A 2R5ZB 4RGSA 1J75A 1TZLA 4II2A 4NNJA 1S7OA 4L5JA 3K4KA 2BY0A 3WU2C 3H9QA 4YRVA 4RB1A 1XMKA 1TT0A 3KP3A 1MBFA 2Z5UA 3D1NI 1MMDA 5D5VB 3OYHA 1NK3P 5DM6F 4RLFA 1Z77A 3KP2A 2CS3A 5EGOA 3KZIC 4G12A 4CA0A 2P7CB 1TTYA 4I2OA 3ECOA 4BH9A 2IW5A 3H0GJ 3GLXA 3NQOA 1O3QA 2J5OA 4E7KA 3DLLF 5IOYA 3IAS2 5E20A 1E0EA 1WJCA 3GZNB 4PJNA 1GHCA 5J40A 2XVCA 3IRQA 2JQ7A 1FYMA 1VQ7I 3JTHA 2ZJRF 3FHZA 2QSHX 2VOOA 1VQ5I 2XAJA 3BJAA 2P0WA 4NC6A 2GAUA 1YHQI 2IP2A 1FPQA 2NS0A 1B6AA 2OC6A 3CUQA 4XKBA 1B72A 1X2MA 2UUZA 4RAGA 1ZH5A 3DU6A 4M3FA 4A3JJ 5TISC 1RRJA 5LRSA 2DPUA 1GVJA 3QOEA 1ZRFA 2A6TA 3GFLA 1R1UA 2QVOA 1BC7C 5ED4A 2XPUA 5HS8A 3S3MA 4BHCA 3IKVA 3GTJJ 5HLHA 2MFZA 3ZQ7A 5D8LB 1IXRC 3MEXA 1LDKB 3CCLI 2HXIA 2XB0X 4BS9A 4CCKA 3E6MA 1LFPA 5CVVA 3BZ6A 2WTEA 2VQLA 4L9NA 3MKLA 5GADJ 3MQ0A 4CGZA 2ZCWA 2R0QC 3FMSA 2FX0A 2ZXWH 1YE9A 3QP5A 4IHVA 3ZMVA 5JFRA 3LSPA 3L00A 3GBGA 4DJAA 1S6LA 5C3EJ 1RI7A 2IS1A 2OU2A 2KFDA 3I4NJ 3RPUA 4XNFA 2IS6A 3W6VA 1D5YA 2EA2A 4BAYA 4L5IA 5IYDJ 2BBYA 2M4KA 3BCAA 3ERMA 5FGMA 4Z6YA 2VJJA 1PUFB 2XSJC 2AO9A 2UV1A 5CVJA 4DIQA 4DQ2A 4PJMA 2KKOA 3S16J 1X1DA 1G59A 2KMUA 2HKXA 2MGQA 2O7OA 2LK2A 2LKXA 3X2QH 3A0BC 2PI0A 2MYSA 4EGYA 2M1BA 2CQ7A 2BHYA 3KLOA 4M73A 2OZ6A 2RKHA 1O7FA 3DTKA 4CCNA 3S1MJ 5FD6A 2ZJQF 2CFXA 4HYEA 4GGGA 5HVQC 2HTJA 4HF0A 3FKJA 1BI3A 3MZHA 3Q3SA 2PFBA 3D5LA 2GXGA 4ABZA 4CHUA 4RAYA 3JRCA 3WODF 2JZYA 3TKYA 4AIHA 1R5ID 3I0TA 3ERED 2YPRA 3OS0A 1ZELA 4IRGA 3LA3A 3KPHA 3M3YJ 2HPIA 1ZG3A 1S9HA 3TO7A 3VEPA 4G6DA 4KISA 4P5OA 5DYMA 3MZ8A 4LLGF 2UWMA 2K27A 4X0GA 3DQVC 3RI4A 1V5EA 1FOYA 4OIPF 5FFZA 3OL3A 3JRAA 3K1MA 2BE5F 3ISPA 3ZXSA 4DBQA 1YS7A 5J4YA 1Y6IA 2O03A 3K2ZA 2FOWA 2X6XA 3S93A 4JBAA 1W0UA 4BHBA 1Q1HA 3DLAA 4CUGA 2KZVA 3J80Z 2DK5A 5J47A 1YI2I 4XRFA 2AHQA 2H1LA 1LB2A 4B1RA 2CQNA 1V55H 4NUBA 2JVGA 1VI0A 3H9JA 2DJNA 2E1MB 4XRSA 2XF7A 4NQWA 4AC0A 4ZTJA 4OIQF 3OSFA 2VT3A 3ASNH 2AQEA 2OV7A 1IUYA 2ELHA 2NNYA 3CF5F 1A5JA 2OQRA 4ZC3A 4A3EJ 3CP2A 2LSOA 2VBXA 2XC7A 3KFWX 5LEKA 1TNTA 1V54H 3WGGA 3W6KB 5L3BA 3G4SI 2GWRA 1Z7UA 2LP0A 3PQJA 2PN6A 4DW6A 5IYCJ 2EBIA 1PUFA 2PMHA 3PIPF 1Z21A 2VN2A 5D5WB 2NYXA 4LLNA 2KRCA 2F5DA 3ABTA 2XIGA 2DW4A 3HSRA 1R36A 4PGGA 1FTTA 2GIVA 5EZGA 5TGTA 2FF4A 3E6CC 1IZ1A 3AG2H 3GTKJ 5JHFA 3CMEI 3RKQA 3EYYA 4NHJA 5JVTA 2ECCA 2L9RA 3OYGA 4EJTA 3EYIA 3GYHX 2BW3A 1K61A 5EJCA 3L09A 1OR7A 1Y0UA 2A61A 2ZXJA 3LSGA 5BQTA 4CCLA 2AS5F 3KP5A 2IAIA 2QEXI 1KYWA 2NVTJ 3ABLH 4NDLA 4E7SA 3IKTA 4E7IA 3L2QA 5EF6A 3GVAA 4I0AA 3HM5A 3M9AA 3ZGKA 4ESFA 3KX2A 3DU5A 3DKWA 3M8FA 4U88A 2R7WA 5KVRA 4IHXA 2LNBA 1IN7A 2G9WA 3GZ6A 1ZR4A 4IKFA 3GTLJ 3R4KA 4LOCA 1ETOA 2X0LA 2VKDA 2R7FA 3GCMA 4ZDOA 3AG4H 3DFGA 4KITB 5BPDA 4IRHA 2QBYA 3FF5A 3CC4I 5F64A 3OYMA 1L0OC 3OYLA 2HFHA 3C18A 3HC7A 5ILVA 1SC7A 5FKNA 3HOSA 2E7XA 4ITVA 1ODDA 4XMYA 3JRDA 1PYVA 3S1QJ 2DTRA 4FX0A 2K3FA 4GYGA 1KA8A 4FE7A 3BPXA 5B1AH 4ZYEA 5FLMJ 3MN2A 1YQAA 3Q9SA 1KU3A 3BG7A 1B1BA 1EA3A 3HHGA 2JRMA 5K7HA 1WZ2A 4H4KC 3T0YA 4EMSA 3O8HA 1OYWA 4M9SA 3C2HA 2E5ZA 5TJJA 3D5SC 4HEA2 4FHTA 5E8GA 3NAUA 1ZRCA 1JKOC 3ZPLA 3BR5A 4II3A 2EV5A 2BOLA 5D5UB 3PL8A 3RYPA 1A04A 2DA1A 2VIXA 1EH8A 2ESNA 2CWEA 2N8GA 3RTRA 2O8XA 3VDXA 3S2DJ 2F6CA 2HR3A 3OYBA 4JX4A 1XG1A 4C2MJ 1DU0A 1VQNI 3Q5FA 3D0SA 3ESWB 1BOBA 3LWFA 3QPHA 4HW0A 2W1OA 3HZJA 3W3CA 4UY8I 4GYIA 2A68F 3SFIA 3WU0A 2R7UA 1K6YA 3FX3A 1BR4A 4LJZF 5GAGJ 4FE4A 1SVLA 1MW7A 2FE3A 1ETWA 2YUSA 2L01A 5FFXA 2VJ5A 4XKWA 3L2CA 3HTSB 3GTGJ 3V7RA 1D8KA 5M5YJ 1F4KA 3GZ5A 1D8JA 3BJOA 5JR3A 1EV7A 2RNJA 1Z3YA 4N4OB 1TWGJ 3KEOA 1L3LA 3O8GA 4CCMA 5HOOA 1H0MA 1DQUA 4ZJZA 4D7MA 1FLIA 3CCJI 1IV8A 5DD8A 3CUQC 1OPCA 2STTA 4BHPA 4EJVA 1AKHA 2KLOA 2V1NA 3WTSC 4WF2A 4G7OF 1LKXA 2DT7B 4RGRA 1U9NA 1USSA 5FKMA 2G7HA 5FO5A 1SMTA 2R7OA 1RETA 3MKYB 4AIKA 2HDCA 3K0LA 5LHGA 2M8EA 4RMNA 3H5RA 2MSYA 3LOCA 2M5WA 2QQBA 2LKSA 3QOPA 1SAUA 3DBHB 3FBNB 3G71I 1XTAA 1RIOH 2NRAC 2DODA 1JKRC 3Q0UA 3GX4X 2EIMH 3CCUI 4A93J 3VFZA 4DZJA 1K7AA 2KDOA 3JREA 4Y7NJ 1BW5A 1BBYA 4BNCA 3F6OA 1UMQA 5FLXK 2LKPA 5CVIA 5F27A 4EQQA 2ZNYA 2KIUA 2V6EA 1KU2A 4E4HA 3HSFA 5H20A 3E5QA 3FISA 4PK4A 4RA2A 1WJDA 4XRMA 5J8FA 2CW0F 2W48A 2FRHA 2B7EA 1JT6A 4F93B 1IG7A 3C3WA 4ESBA 2CFOA 3ROUA 1A35A 2HGCA 4G6TB 1K83J 2CYYA 4C2TA 2RNGA 2OQGA 1WHUA 4D0PA 1YRNA 4Y33A 2MD5A 2V9KA 3K4JA 3IWFA 3MKWB 3CDIA 1MSEC 2YSRA 1EH6A 1HSTA 1LEBA 3PFYA 1X19A 3SFZA 2MLGA 2FNAA 3CD6I 1MMNA 5HS7A 3ZRGA 1D0XA 1X1AA 5LGNA 1Y8QB 5D5XB 2ETHA 3BR6A 3E6BA 1QQIA 4NBQA 1LE8A 3H5NA 3HIFA 3JR9A 4HZFA 4AU7A 2DYSH 4PJ0C 3CDLA 4XN3A 2CV1A 3K4NA 5CVRA 3OYEA 2FMYA 3W2VA 2CUEA 1FZPB 3WGHA 3QPTA 3LSJA 5J6XA 2Z9OA 2Y31A 5KK1A 3ABUA 2JT1A 2L3DA 3A02A 3MD2A 3GUDA 1XSVA 3BTLA 3A01B 2ZNZA 4P9UA 2JPCA 1E3HA 3SXYA 5B5EC 1GDTA 3F72A 4UUTA 3RPUD 4YELA 3OWTA 1PJRA 1S7EA 1IDZA 3HOYJ 1MJBA 1Z0XA 1Y1VJ 2Y30A 2DQRA 3N05A 2QM3A 4O6JA 3QYFA 5E3OA 3BZCA 3VSKA 2Y2ZA 2LY2A 1P92A 3EPZA 1TWHJ 2HVQA 3AL0C 2ELKA 4S0HB 5IPAA 3OYIA 4E7JA 3DXJF 1U2WA 5D4RA 3V8JA 5ERIA 2DDBA 2NS7A 3QAHA 3S32A 2QLZA 3V42A 1R4MB 1RR8C 3ZQHA 1W36C 2P7VB 3CJRB 2LFBA 1VQ8I 1IN5A 4UUSB 1X58A 3ZOBA 3DBRB 1O57A 2FSWA 2MC3A 3FIWA 3FXQA 1HSJA 2HTSA 1DU6A 1CF7A 5JI6A 4ZYGA 3W2WA 5LHIA 4KUMA 1VQMI 4FETA 3CLQA 3I58A 5HODA 3JRHA 3B6AA 2JTVA 3DPLC 4TV7A 1QPMA 4BL0B 2VQCA 3K1PA 1T56A 1RNLA 3KETA 3TEDA 4CYCA 2LG4A 1GUUA 2H6CA 2KPMA 2V4JC 2X1EA 5EEAA 3OSGA 2H27A 2JSPA 1MBGA 1GVDA 3CCRI 1FP1D 2HZDA 2JK3A 3GLLA 1MDMB 1AA7A 1G3YA 4HG2A 3L2VA 1REPC 2PLYA 1LFBA 4RB3C 2EZLA 2XASA 2XAHA 4XQFA 3I56I 4O3MA 4ASNA 1TWFJ 2Z1DA 1G8XA 5JHUA 1FYKA 1QO0D 1W36D 2HQNA 5EGOB 1W0TA 1XC5A 1E17A 1X4OA 2FEZA 2HWVA 2IGMA 1TWAJ 4PDKA 4BE2A 3WE3A 3DKYA 1P2FA 3DF8A 3W2AA 2XAQA 4PJJA 4ZDPA 3EDPA 1JJ8C 5JLWA 4S05A 1PP7U 2CU7A 2ZC2A 2RAEA 1B8IA 3R0JA 2DMQA 5D6FA 4XIDA 3A01A 2JA6J 1X1CA 3SDBA 4IZZA 3IUOA 1P4WA 2CW8A 3I3LA 1H8AC 1OR7C 2P6SA 3DV8A 5D8KB 3CUQB 1ONVA 2VPRA 4QSHA 4LK0F 1W7PA 2Y69H 3JW4A 3LFUA 2DOEA 1J9IA 1IN6A 1HF0A 1QGPA 1JUPA 2LRDA 2XKOA 1H9TA 2Q2EA 3S2HJ 1HQCA 3ML6A 2VC0A 2PMUA 4BBRJ 4A6EA 2JA2A 3MMYB 4AYBA 2ACJA 1A31A 4F7ZA 2DDAA 3O2PE 2HU9A 1P7IA 4UUSA 3BPVA 1KYZA 3J7YJ 2HS5A 4KN7X 4XLCA 2EZHA 1P6RA 4XK4A 2WY8Q 3KP7A 2ISZA 4YFXF 3OS2A 4RBOA 3BR2A 2KJBA 2DMUA 3QU3A 4BJ5C 1ZG1A 1GXPA 3S17J 1IRFA 1YS6A 3CMYA 1TQMA 4A0YA 3OYNA 1OCPA 2P8TA 3C1DA 3T8TA 5K7ZA 2EFQA 5KAIC 4LB5A 2VBZA 3RKXA 2K9MA 2X4HA 1MBJA 1GV2A 1FIAA 3M1EA 4V2GA 1XSXA 3P7NA 2Z99A 2P6TA 3JAMZ 4ENKA 2A3SA 4Y17A 3RZDJ 1RKWA 1SMYF 3HPGA 1FOXA 1KZHA 3F6VA 4A3GJ 1RC9A 3RIRA 2GM4A 4K2EA 1OCCH 3F23A 4G7ZF 3F3XA 4HV5A 5KAFC 2OF7A 2VQGA 2DO7A 4A69C 4AYBN 1WPKA 3VWBA 1R22A 2CV0A 2O61A 2ZXIA 3LSTA 1SEUA 2BY3A 2EFNA 3WG7H 1JHHA 3DBLB 4PJLA 5GTIC 1TW3A 3QWLA 3LSRA 2UXNA 2L7KA 4LIUA 3PSIA 3CJNA 3GTQJ 2Y0SA 2EILH 2A05A 1QRYA 2Z2SB 2YU9J 3LSHA 3H36A 2Q1ZB 2FA5A 1I1SA 1G3WA 3BOQA 1G6NA 3BZKA 1KQ0A 2DA4A 5DUIA 3CCYA 4RM3A 1FYLA 2B63J 1AWCA 2PJRA 3AL0B 1OFCX 2EK5A 1WJ5A 4EJOA 1G2HA 1MH3A 2VXZA 3EQLF 4LD5A 5GTHC 2WBMA 4XOTA 2VE9A 2M45A 4MTDA 3DPUA 5BMZA 2W00A 3TQNA 2GA2A 2A69F 2FXAA 3ZQFA 4BXXJ 5BS6A 1DPRA 4IHTA 1Z6TA 1BI0A 1OYYA 5FKKA 2AXTC 1JXSA 1Z05A 3O3KA 4RDUA 2GOMA 3RDIA 3JSPA 2KRHA 3BQZA 1R4NB 2F4MB 3DTIA 1EH7A 1UHWA 3WTZA 1YIJI 2KT0A 2EV6A 5K7FA
chains in the Genus database with same CATH topology
2WAFA 4AVZA 4HNTA 5TGTA 3VSLA 5JHFA 2CW7A 4Y3OA 2PJRB 3QYEA 3OYGA 4NQWB 3A4CA 2BW3A 3PJRA 2GOXB 4OAYA 3LSGA 4BXFA 4CCLA 2VJIA 3FDYA 3S8PA 4N4NB 3EUHC 3M1CA 2K3PA 5KHDA 4BUPA 2ELJA 4E7SA 4E7IA 3L2QA 1D0YA 4XKVA 4F52A 4B44A 3ZGKA 3KX2A 1IRXA 3DU5A 4ZDLA 2R7WA 1DP3A 4ANJA 3RQ4A 4CCOA 3PUBA 4CZCA 4IKFA 3ZQQA 2VKDA 4XLAA 3OY9A 1N78A 4ZDOA 4KITB 1MNEA 1J09A 3HUGB 4U7BA 4E6KG 3OYMA 3HPHA 3OYLA 2K5CA 2L2OA 4U87A 3HC7A 4C9YA 2KQRA 4YEJA 3SZGA 3HOSA 2BW3B 4ITVA 4XMYA 1PYVA 3J7AY 2L5QA 1D1AA 2WY7Q 3BG7A 3FBIB 2L9SA 2DXIA 4E7ZA 1EA3A 1BR1A 2VKHA 1WFXA 4H4KC 2CH0A 4DBRA 2R4GA 3NWTA 4ZTFA 3C2HA 2E5ZA 3D5SC 4HEA2 4IQJA 4II3A 2HQAA 4JQFA 2BOLA 3PL8A 4XLEA 2VIXA 3OR2C 2W4SA 3QYBA 1JI8A 3RTRA 1Z3XA 4BQQA 2QKMB 3L2RA 2DCEA 3E1SA 3VDXA 2F6CA 1T0FC 3OYBA 3DKXA 2A5WA 1D1CA 4QPQA 4BQNA 2X85A 3HXLA 1BOBA 1V5FA 2O5RA 4LIVA 2DOAA 2W1OA 3W3CA 5FROA 2R7UA 3ONQA 1K6YA 1BR4A 2WA0A 3CESA 3AKZA 1MW7A 4BU2A 2VJ5A 4XKWA 1KONA 3C2GA 4XORA 3OS1A 1UAAA 1Z3YA 4N4OB 2JUGA 4RLQA 3H5AA 4CCMA 5HOOA 1FMWA 3K4CA 4BACA 4XOPA 1DQUA 4ZJZA 1UG0A 3EUKL 3VYTB 2KLOA 2V1NA 4CH7A 3S3NA 1LKXA 2DT7B 4HRIA 4LITA 4XN0A 2OUMA 2VB6A 2R7OA 3MKYB 4XL9A 3UR3C 4RMNA 2MABA 2DT6A 3H5RA 3DPTA 4GRIA 3VYSB 4E7LA 3BG6A 4RM2A 2MC4A 2IS2A 1SAUA 3FBNB 3ZCOA 3HOTA 5FRNA 3G2BA 3NWSA 2R7SA 4PFPA 3MKZA 4D1QA 3LSMA 1NG6A 4CCJA 3OIQA 2KDOA 4J00A 2M7AA 2MD0A 3RCOA 1SFKA 2LYCA 2V6EA 4E4HA 4BE1A 4PK4A 3BLYA 1WJDA 3CMMA 2XDVA 1YX3A 3OYFA 1YX5A 4BJ6C 2DJIA 4HSTA 2M4GA 3E0JB 4XR6A 3HL2A 4C30A 1GLNA 4F93B 4HSRA 2XF5A 2HNHA 1VZ0A 2CFOA 2V7FA 4KT6A 2ZXHA 5LD2C 4G6TB 2WAQA 3UNGC 3PNYA 5HNHA 4C2TA 2RNGA 3HKZA 4OAZA 2ZSHB 4Y33A 1WJEA 2V9KA 3K4JA 3OYKA 2VL8A 3MKWB 1FMVA 2CV2A 3D5RC 3PFYA 1X19A 2WADA 1WJFA 3SYTA 3K6GA 4CSWA 1MMNA 3ZRGA 4B3XA 1D0XA 1X1AA 4B43A 3EUAA 4P1WA 4BDYA 2LOOA 4BDZA 3KEYA 1DGRM 2F5VA 3DEEA 4KJZA 3A2KA 4PSXA 3H5NA 2IXSA 3CZ6A 4AU7A 3H35A 4XN3A 2CV1A 2E60A 3K4NA 3OYEA 4MLOA 3SEQA 2W82A 3W2VA 4XM3A 2X1DA 4J01A 4F55A 3LSKA 2NOJB 2X51A 4DGWB 2R7TA 3MD2A 4XKCA 2AQFA 1P9QC 2LH9A 3RPUD 4YELA 3OWTA 3OYCA 1PJRA 2KHMA 4PFOA 5HLTA 3N05A 2E1MC 3K4MA 3QYFA 2HVRA 3OMYA 3VSKA 4IX7A 2IGKA 2LY2A 3EPZA 2HVQA 3AL0C 3DTEA 2VASA 3OYIA 4JOMA 3M8JA 5CPRB 4E7JA 1BR2A 4ZYAA 1TZLA 4II2A 4NNJA 3S32A 3K4KA 4B47A 4YRVA 3H9QA 2LBFB 3V42A 1TT0A 2XF6A 1W36C 1LVKA 3KYLA 2FUG2 3CJRB 5CQEA 3OYAA 1MMDA 3OYHA 4PSWA 2VLAA 4RLFA 2CS3A 2QKLB 2I8DA 4F3QA 4CA0A 2IGNA 3W2WA 3IP4B 2W7NA 4FETA 4BE0A 4E7KA 3DPLC 3U21A 2IS4A 4BL0B 2VQCA 3IAS2 1E0EA 3L2UA 1WJCA 1D1BA 2LG4A 4PJNA 2V4JC 2KPMA 2X1EA 4LG3A 2JSPA 3AFHA 3ZR8X 4DOZA 3VYUB 2HZDA 4FASD 1AA7A 4HG2A 4C2UA 2P0WA 3L2VA 1X4PA 2OC6A 4XKBA 4XQFA 2UUZA 3DU6A 2R7VA 2Z1DA 3PNVA 1G8XA 2LY1A 2CMPA 3QOEA 2A6TA 1W36D 2X6WA 3OOUA 2M0MA 1ERDA 4Y4RA 3VYRB 1X4OA 3S3MA 2IGMA 1WJAA 2MFZA 4BE2A 1LDKB 3DKYA 4BS9A 4CCKA 3W2AA 4PJJA 1LFPA 4ZDPA 2E5NA 3OYDA 3H9GA 2VQLA 1QHHD 3BC8A 2CUJA 2VQHA 2M7BA 1UELB 1YE9A 3CJQB 2M3AA 4BEHB 3DWLE 4NC7A 1QHGA 4QPOA 1X1CA 5CQGA 5KCMA 3SDBA 3GBGA 1V5GA 3IUOA 2XAUA 4IZZA 4DJAA 2CW8A 4BJTA 3I3LA 1OR7C 4HNUA 1Z7LA 4F92B 2IS1A 5FRMA 1NG7A 2L9NA 2R7XA 1DGWY 3LFUA 1WJBA 3OL4A 4XNFA 2VPLA 2IS6A 3FHNA 2LRDA 1N77A 4NC8A 2IGOA 4IQ4A 2VJ4A 2Z16A 1HA8A 2LBFA 4XONA 2JA2A 3MMYB 4AYBA 2M4KA 2K9LA 3BCAA 2VJJA 2HU9A 3HG9A 3K70C 2X6YA 2XSJC 2UV1A 3LSIA 4XLCA 3TMOA 4DIQA 4PJMA 1X1DA 1G59A 3BCBA 2WY8Q 3RSNA 3A1YA 2KMUA 3OS2A 3S3OA 4E7HA 2MYSA 3I9V2 4BJ5C 2LC2A 4F91B 4BGDA 4XLFA 2WB1A 3OYNA 4XLHA 4EATA 3DTKA 4CCNA 1MMGA 2BVMA 2K9MA 5HVQC 2VXDA 3FKJA 3L2WA 1QU3A 1X1BA 3SEZA 3OYJA 2Q2EB 3LMMA 3IAM2 3D5LA 3OIPA 3HPGA 3PNTA 3QODA 2KP6A 3K4BA 3K4LA 1D0ZA 3F9KA 3OS0A 1ZELA 2BVLA 1Y56A 2HPIA 3CF2A 1S9HA 4KISA 2VQGA 3CP8A 4P5OA 3VWBA 3K70D 2CV0A 2ZXIA 2UWMA 2RREA 4PJLA 4X0GA 1T95A 5KNLA 1OLTA 3DQVC 1V5EA 5CKTA 1MMAA 3OL3A 4D9JA 2L7KA 3ZXSA 4DBQA 4LIUA 1N75A 4BQOA 1Y6IA 1MNDA 2ZFUA 3PSIA 4B48A 2X6XA 2Y0SA 3S93A 2Z2SB 3LSHA 2Q1ZB 4HPQA 2HVSA 3DLAA 4BEHA 2KZVA 4CUGA 2R7QA 2RQQA 3K10A 3LL7A 2HPMA 4NUBA 2JVGA 3H9JA 5LFAA 2E1MB 4RM3A 2XF7A 2ZSIB 2R7RA 2PJRA 3AL0B 1WJ5A 2CUZA 4ZTJA 2VXZA 1R6RA 2AQEA 2OV7A 2WBMA 4R79A 4XOTA 3H0DA 3OR1C 4ZC3A 3DPUA 2W00A 3CP2A 2XC7A 3PSFA 2HDWA 4PUSA 2LREA 5HNFA 4OWRB 2V26A 3TL4X 2JVHA 2F4IA 1Z21A 3TBIA 2GOMA 2KRHA 2KRCA 2X1CA 2WAEA 1U0JA 3DTIA 2PMZA 2KL4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC8 A;  4NC7 A;  2KRC A;  2M4K A; 
#chains in the Genus database with same CATH topology
 4LLL A;  1ZLK A;  4KYW A;  4HNT A;  5M5W J;  1S5L C;  2BHZ A;  4BKX A;  2L7Z A;  5CJ9 A;  1FT9 A;  3RYR A;  3U1K A;  2DN0 A;  3DP7 A;  3V8K A;  5AIP A;  2EIN H;  2QYO A;  1G3T A;  2F2E A;  4NQW B;  1JUM A;  3A4C A;  4CZZ A;  2BV6 A;  2Y9Y A;  1IW7 F;  1NK2 P;  1R1V A;  5H6Q A;  4A2U A;  4BXF A;  4A3D J;  2CSO A;  1WQ2 A;  1X3Z B;  4GXO A;  3M1C A;  5KHD A;  3JRF A;  2RVC A;  4OIN F;  2H09 A;  2ELJ A;  2MA3 A;  2VBY A;  4OU0 A;  1BW6 A;  2W85 A;  3HYI A;  2JA5 J;  2VUM J;  2UZK A;  4MO7 A;  3AG1 H;  4HNV A;  4V19 K;  2KIM A;  1DP3 A;  2CQQ A;  4CCO A;  4D7N A;  4XBF A;  4CZC A;  4LFU A;  3MAJ A;  4IRI A;  1XS9 A;  3HGG A;  2EPF A;  5A2Q Z;  3OY9 A;  3Q0W A;  2BXY A;  2L02 A;  1MNE A;  2XRL A;  2DLL A;  2FQ3 A;  5FJ8 J;  3HUG B;  5LLQ A;  4U7B A;  1MBK A;  3QP6 A;  4ESJ A;  3HOW J;  1K6O A;  1FEX A;  4MFD A;  5F04 A;  2H94 A;  2KQR A;  2L4A A;  4XLN F;  1OQY A;  4S04 A;  2BW3 B;  2F5C A;  5BNG A;  1K78 A;  2L5Q A;  4EGZ A;  4JX5 A;  4IF4 A;  1JKP C;  1I39 A;  2D5V A;  2MBF A;  2WY7 Q;  1JT0 A;  3IHU A;  3TW6 A;  3CCQ I;  1WCM J;  2L9S A;  3I64 A;  1HCR A;  1EF4 A;  3IL2 A;  1RZ4 A;  2D1V A;  2R4G A;  4ZTF A;  5E3M A;  1EJ9 A;  2ID3 A;  3JSO A;  4L0Y B;  1ZR2 A;  1SFU A;  3A03 A;  2KRF A;  4GDF A;  4JQF A;  5CVU A;  3DCF A;  3HJE A;  3OR2 C;  1APL C;  1TQI A;  2M34 A;  2W4S A;  1B4A A;  2YX4 A;  4I09 A;  1ZRE A;  1B59 A;  1XCB A;  4GFB A;  2QKM B;  2QBY B;  2A6E F;  2QUF A;  1ETY A;  4WK8 F;  3DKX A;  2A5W A;  3F8B A;  3N97 A;  1D1C A;  1XGO A;  4QPQ A;  2LD5 A;  3VOE A;  3G73 A;  1HLV A;  3IV5 A;  1V5F A;  1LPQ A;  1HW2 A;  4UNO A;  2E35 A;  5ICE A;  2CJJ A;  2QQ9 A;  3HGY A;  3MWM A;  1PP8 F;  4HX7 A;  2HZT A;  2CUF A;  3I59 B;  3CES A;  1R7J A;  3AKZ A;  4IPA A;  4N9H A;  1YW9 A;  1KON A;  3BTC A;  3FXM A;  1ORK A;  2QSG X;  3JTG A;  3OS1 A;  2E7W A;  2JUG A;  4RLQ A;  4CXF A;  1Z67 A;  1OCO H;  1YW8 A;  5DEQ A;  4J19 A;  4BAC A;  4XOP A;  3REO A;  1SD7 A;  3WTY C;  4FQG A;  3FMQ A;  4I7H A;  3VYT B;  2CG4 A;  3UKG A;  2ZO4 A;  4P9F A;  3I4P A;  3RZO J;  1R58 A;  4LIT A;  5EDN A;  5E8I A;  1ETQ A;  4M6V A;  1WGX A;  2DMN A;  2K02 A;  4WX9 A;  2MAB A;  2QGU A;  3R0A A;  4EM1 A;  3V7C A;  3TP0 A;  3LFK A;  1FBU A;  3KCC A;  3GTO J;  1JKQ C;  1ZGW A;  3HOT A;  2C6Y A;  3WTW C;  1FJL A;  2IS2 A;  1FSH A;  3CCV I;  2R7S A;  3H3V K;  3GFI A;  1MIJ A;  3HUG A;  5L3F A;  1ZGJ A;  2Q0O A;  1HW1 A;  1IN8 A;  4D1Q A;  3MKZ A;  1DP7 P;  1JHF A;  2EQR A;  4E70 A;  1GT0 C;  3GW2 A;  4CCJ A;  3OIQ A;  1IJW C;  4CIC A;  1N25 A;  4J00 A;  4BQA A;  1OCT C;  1D3Y A;  4L0Z B;  3RCO A;  3NAR A;  4KN4 X;  4MFE A;  1F36 A;  2VE8 A;  1XDU A;  4ZH4 F;  1R71 A;  3W6J B;  4BE1 A;  1DUX C;  2DYR H;  1YX3 A;  2LY9 A;  2M0C A;  4YIR X;  5IP6 A;  1F9N A;  4HST A;  1SVO A;  1Z1D A;  1AKH B;  5D4S A;  1GLN A;  1OJL A;  2DPD A;  1P7J A;  2XF5 A;  2E34 A;  2Z3Y A;  4EM2 A;  1UFM A;  2RGV A;  2V7F A;  1ETK A;  3KEQ A;  3PNY A;  3HKZ A;  4BY1 J;  2ZME A;  3QU6 A;  3OYK A;  1SVM A;  2IVM A;  2QQ8 A;  2VBW A;  2HI3 A;  3KP4 A;  5K5R A;  1XN7 A;  1KU7 A;  1NH3 A;  1V4R A;  3SYT A;  3K6G A;  3TDU C;  4BXU A;  4B3X A;  3U2R A;  4CSW A;  5FB2 A;  3ABM H;  4P1W A;  4BDY A;  2LOO A;  4BDZ A;  3BR1 A;  1F5T A;  2E1N A;  3KEY A;  4A3K J;  3DEE A;  2TCT A;  1UJ8 A;  2R3S A;  2XGE A;  2IXS A;  5LRR A;  1U9O A;  1YJN I;  1IC8 A;  1LQ1 A;  2E60 A;  4CO8 A;  3LQQ A;  2QEN A;  4A6D A;  3SEQ A;  3S2W A;  4J01 A;  3TGN A;  3LSK A;  1BJA A;  2GXA A;  3I59 A;  5EG0 A;  4DGW B;  3M8E A;  3PM1 A;  1LDJ A;  1TP4 A;  3DEU A;  4AIJ A;  2G7U A;  2WC2 A;  4HV6 A;  3JRB A;  1P9Q C;  2DMT A;  3OYC A;  1W7P D;  2CO5 A;  3J7A O;  5L3C A;  3KYD B;  1X2N A;  1XX5 A;  4PFO A;  3RQI A;  4DZP A;  5HLT A;  3IC7 A;  5CYV A;  2X9D A;  4IOC F;  1YRN B;  1K79 A;  3OMY A;  3E6D A;  2QZ8 A;  1JTY A;  3G6E I;  3DTE A;  2VAS A;  4IL6 C;  3M8J A;  5CPR B;  3HKZ N;  4BY7 J;  3SJM A;  2KIQ A;  4ZYA A;  3TOA A;  1E3P A;  5IY5 H;  3HSE A;  2EZK A;  2CQK A;  3P9K A;  2KIF A;  3J80 K;  2XF6 A;  3MFK A;  1LE8 B;  4UHT A;  1SFX A;  5AIQ A;  6PAX A;  1P4A A;  2H6B A;  4EVI A;  2VLA A;  1VFC A;  3IH3 A;  4W1U A;  4HQE A;  4IO9 F;  4D5C A;  5LEJ A;  1WRJ A;  4RGU A;  2IGN A;  1IF1 A;  4LB6 B;  4M71 A;  3IP4 B;  3GTM J;  1AHD P;  1TT5 B;  4L5E A;  3Q0V A;  5DCM B;  2IS4 A;  4EV0 A;  1T33 A;  2MH2 A;  3L2U A;  2E1O A;  5HLI A;  3MVP A;  4LG3 A;  4WXD A;  3AFH A;  3ZR8 X;  4OMY A;  3R6S A;  4DOZ A;  5GPA A;  3CO6 C;  3SDG A;  2XPV A;  4C2U A;  1MGT A;  4L9T A;  3I54 A;  2IEK A;  4WWC A;  2Y48 A;  1X4P A;  5GAH J;  2LMD A;  3B6C A;  3BJ6 A;  2JN6 A;  5L3E A;  5C44 J;  2DBB A;  4I01 A;  2E2J J;  3S1R J;  2R93 J;  2JJ7 A;  4HAM A;  4QWQ A;  2R7V A;  3PNV A;  1VQL I;  2LY1 A;  2CMP A;  3L1P A;  3LNQ A;  1FP2 A;  2VC1 A;  1M1E B;  3K69 A;  4RS8 A;  3BP8 A;  1VQ9 I;  2STW A;  5E17 F;  5IT3 A;  4H0E A;  1CF7 B;  2ZKZ A;  4ZZL A;  1ERD A;  3VYR B;  1BJZ A;  1WJA A;  3COA C;  4JK1 X;  4XIC A;  2L9V A;  3SHF A;  4YFK F;  2Q8K A;  3U1D A;  2E5N A;  1QPI A;  3RJP A;  4CYC B;  2CUJ A;  2VKE A;  2M7B A;  1UEL B;  2FU4 A;  5J3L A;  1FX7 A;  2M3A A;  4BEH B;  3DWL E;  4NC7 A;  2PG4 A;  2L0K A;  1QHG A;  5CQG A;  4UB8 C;  3CQZ J;  2XAU A;  4I98 B;  5E1Z B;  5JLX A;  4HBL A;  3WHC A;  4MEX F;  1Z7L A;  4F92 B;  3B02 A;  1NG7 A;  2L9N A;  1QZZ A;  3P9I A;  3IRR A;  3LAJ A;  2ME6 A;  4XSZ F;  4YG2 F;  1VQP I;  5EZH A;  3OL4 A;  2VPL A;  3GO5 A;  3HTU A;  3R60 A;  3FHN A;  1W4M A;  1G3S A;  1HBX G;  2P5L C;  1HW5 A;  1N77 A;  2K9N A;  1ZQ3 P;  4IQ4 A;  2HOE A;  2VJ4 A;  2PX9 A;  3HOX J;  1A6I A;  4QTR A;  4XON A;  2WV1 A;  3CLO A;  2K9L A;  1A36 A;  1FIP A;  5DM7 F;  3R61 A;  1VTN C;  2R7Z J;  3LSI A;  4D5F A;  3TMO A;  2EV0 A;  2FD5 A;  4CDG A;  1R9T J;  3RSN A;  2IA1 A;  4MQV A;  2XGC A;  3ZP5 A;  2L7F P;  1U5T A;  3K2A A;  1B8I B;  1SD5 A;  2XGD A;  3CCE I;  4F91 B;  4KIG A;  4BGD A;  4LGW A;  1J5Y A;  4XLF A;  5DCM A;  2IA0 A;  4PCQ A;  4YII A;  1MD0 A;  2VKV A;  1J59 A;  3FK6 A;  1MMG A;  3PQK A;  2IJL A;  3ZMZ A;  2BVM A;  1W7P B;  3ZN0 A;  5LGT A;  1TLH B;  1HKS A;  1S3J A;  3GTP J;  4EEF G;  3CMA I;  1I5Z A;  2VXD A;  4I0B A;  3L2W A;  3FXU A;  3SEZ A;  1J2X A;  1FWZ A;  4HA8 A;  2NVQ J;  2Q2E B;  3OIP A;  3IAM 2;  2WV0 A;  4P96 A;  3C2B A;  5CLS A;  2O3F A;  2W25 A;  4N9I A;  5DTD A;  2KP6 A;  1QNT A;  1TQP A;  2EH3 A;  3F9K A;  1X3W B;  2XHK A;  1O7L A;  2CQX A;  4CYD A;  1MJA A;  3CF2 A;  1W1W E;  3H3Z A;  1WSU A;  1Z91 A;  4A3F J;  1SD4 A;  2FBI A;  5IT9 Z;  1IGN A;  1OLT A;  4M6X A;  1MMA A;  1OMI A;  4IHY A;  2EIK H;  4D9J A;  3EET A;  5F08 A;  1SAN A;  2K7L A;  1MND A;  2LTP A;  4B48 A;  3ZQI A;  2ECB A;  1ON1 A;  4A5M A;  2HVS A;  4HPQ A;  4YIF A;  4BEH A;  1UZC A;  2EFO A;  2RQQ A;  4IXA A;  3LL7 A;  2HPM A;  2BY2 A;  2V1U A;  2LLK A;  1MH4 A;  3FXJ A;  2F48 A;  4ENM A;  1UHM A;  2ZSI B;  3BR3 A;  3J7Z I;  2R7R A;  5LGU A;  1TW2 A;  2CUZ A;  1O3T A;  1MJ9 A;  1MMS A;  1AOY A;  1R6R A;  4X1E A;  5F1J A;  2EFW A;  3HOZ J;  4R79 A;  2ZB9 A;  3H0D A;  3OR1 C;  1F43 A;  5EEG A;  5L3D A;  3PSF A;  4IHW A;  4PUS A;  2OA4 A;  2LRE A;  4Q48 A;  3WE2 A;  4KMU X;  4A0Z A;  4B09 A;  3BG5 A;  2JVH A;  2D2W A;  1O3R A;  3L7W A;  3LAP A;  2HQ5 A;  4JX6 A;  5J8C A;  2A6H F;  2DA7 A;  3TBI A;  1Z9C A;  1XSD A;  2V1D A;  2QWW A;  2X1C A;  3GF2 A;  1FOK A;  1S29 A;  1W5S A;  3H92 A;  3NEU A;  4FIS A;  2WAF A;  4LMY A;  4MNU A;  3ELK A;  3VSL A;  2OAZ A;  3OV8 A;  2ZBK A;  2CRG A;  1PVE A;  1IXC A;  4Y3O A;  1JE8 A;  4UUV A;  5AON A;  2BZT A;  3QYE A;  4AD9 A;  2PJR B;  3HOV J;  4OIO F;  3HB9 A;  2JMW A;  4A12 A;  3PJR A;  1VF9 A;  5B66 C;  5B3S H;  1IDY A;  5L3G A;  2GOX B;  3S8P A;  4N4N B;  4Q5S F;  2XSD C;  1AU7 A;  4P55 A;  2ZME C;  3RPQ A;  1YG2 A;  4DNC A;  4F52 A;  2VT2 A;  4B44 A;  2RDP A;  1HKQ A;  2Y9Z A;  1IRX A;  2JSC A;  4ZDL A;  1YOV B;  1UG2 A;  2IA2 A;  4ANJ A;  1OIS A;  1ETV A;  2XB5 A;  3RQ4 A;  3I53 A;  3LA7 A;  4I76 A;  4RGX A;  2EIJ H;  3ZQQ A;  2GIZ A;  4GO1 A;  3ZMU A;  2E19 A;  4XLA A;  3V4G A;  5M3F J;  5E3L A;  5DUK A;  4B4C A;  1BN5 A;  2IBD A;  1J09 A;  4E6K G;  3ASO H;  4IJA A;  5HDG A;  2L2O A;  4M6Y A;  5C4J J;  2OJE D;  2XAG A;  3BY6 A;  4UV8 A;  2DU9 A;  3PO3 J;  1W5C C;  2L54 A;  1YLF A;  2NS8 A;  2LF7 A;  2IT0 A;  1YTY A;  4HDV A;  1ZAR A;  4I6Z A;  1RPW A;  1D1A A;  2DA3 A;  3KZZ A;  2VON A;  2XAF A;  4E7Z A;  3CCM I;  1BR1 A;  2VKH A;  5K5Q A;  1WFX A;  2GBY A;  2CH0 A;  3WHB A;  5TRD A;  1Y1W J;  4DBR A;  3I4M J;  4HF2 A;  4MEY F;  4M9Z A;  4JP0 A;  1I1G A;  4IQJ A;  3F8C A;  2D45 A;  2OCC H;  1YIO A;  2HQA A;  1ETX A;  4XLE A;  3WTT C;  4W97 A;  1IN4 A;  4UVC A;  2JA7 J;  2HYJ A;  4XRS G;  4FCY A;  1JI8 A;  4BQQ A;  1ZKG A;  2DCE A;  4WXC A;  1HDD C;  4ETS A;  1LVA A;  1ZLJ A;  4FTH A;  4KT5 C;  2X85 A;  2A07 F;  2J5P A;  4LIV A;  4R1H A;  3JRG A;  1K78 B;  2DOA A;  1UHS A;  1R5G A;  3ONQ A;  2WA0 A;  1NHA A;  4Z2Y A;  4AVP A;  3BR0 A;  2PEX A;  2GZW A;  2F5E A;  1I27 A;  2OCE A;  2L4M A;  3C2G A;  3HRM A;  4RAF A;  5DDG A;  2ISY A;  1LNW A;  3PFI A;  1ZN2 A;  2K9S A;  2R92 J;  1W5T A;  2TDX A;  3F8N A;  4KDP A;  1IV6 A;  4G9Y A;  3K4C A;  2V79 A;  3U9G A;  1FSE A;  2H8R A;  3FWE A;  1K4S A;  1TNS A;  3S3N A;  3CC2 I;  4HLY A;  4HRI A;  5DS9 A;  1D5V A;  5J4V A;  2ME0 A;  4XN0 A;  1HKT A;  2OUM A;  2VB6 A;  2BEO A;  3TW7 A;  4XL9 A;  4DYQ A;  2QF7 A;  3M4O J;  1ULY A;  2M2E A;  4G8X A;  3VYS B;  4FX4 A;  4E7L A;  4WCG A;  4UVA A;  2MC4 A;  2KJC A;  3ZCO A;  5FRN A;  3CUO A;  2M30 A;  4HX4 A;  1MNM C;  3NWS A;  5HDK A;  3MCZ A;  4PFP A;  5GAE J;  1BIA A;  4L9J A;  2QA4 I;  1YW7 A;  2Y0S N;  2YR2 A;  2RQP A;  1Z6R A;  1NG6 A;  2DAO A;  2MLK A;  2MD0 A;  1SFK A;  3BRO A;  2NVU B;  2YS9 A;  2LYC A;  4B8X A;  5K5O A;  3FXO A;  1V3F A;  3CMM A;  1BM9 A;  2XDV A;  4N0B A;  1KQ9 A;  4QLC U;  4G7H F;  1YX5 A;  3G1M A;  4BJ6 C;  2DJI A;  3FXL A;  2M4G A;  3E0J B;  4XR6 A;  4PZJ A;  4C30 A;  4HLX A;  1C0W A;  5FLV A;  3EUH A;  1OKR A;  4AID A;  1H9G A;  2WAQ A;  4OMZ A;  4Y15 A;  4I02 A;  2HOS A;  5HNH A;  5IYB J;  2D1H A;  4YFN F;  4OAZ A;  3S14 J;  2ZSH B;  2E2H J;  2JPB A;  5F0F A;  5J1Y A;  1FC3 A;  3BTI A;  4MQ9 F;  3IWZ A;  1FMV A;  1IO2 A;  1IRZ A;  1Y8R B;  4EJW A;  2P81 A;  5E18 F;  2R5Z A;  5LHH A;  2YU3 A;  1QA6 A;  3FK7 A;  2ZFW A;  2P5V A;  1SFE A;  3WU1 B;  4DYR A;  2FOK A;  2G0E A;  4PSX A;  3CZ6 A;  3JAM K;  2COM A;  2DOF A;  3H35 A;  1U5T C;  3BQY A;  4V2F A;  2W82 A;  1POG A;  2FJ1 A;  2DTZ A;  2X1D A;  4F55 A;  2NOJ B;  1MBE A;  3B73 A;  2VI6 A;  3AAF A;  2O8K A;  1BI1 A;  2DFE A;  2PQ8 A;  1YJW I;  1B9M A;  1FOW A;  2KHM A;  4UB6 C;  1B9N A;  2ZME B;  1U78 A;  1JGG A;  1WVR A;  2B0L A;  1ZGA A;  3ZQG A;  3J81 Z;  5BOX A;  2WAQ N;  2LR8 A;  4KMF A;  5DV5 A;  5C4X J;  2EFP A;  3T1B A;  1WH7 A;  1XB4 A;  1STZ A;  2LBF B;  4B47 A;  1R5H A;  2V6C A;  1QBJ A;  1LVK A;  3KYL A;  2FUG 2;  5CQE A;  3OYA A;  1DDN A;  4G6Q A;  4PSW A;  2H8W A;  2FBH A;  1T0F A;  3HHH A;  4EM0 B;  2QKL B;  2I8D A;  4F3Q A;  5EG0 B;  3KLN A;  3GXO A;  4KIB A;  1ZYR F;  2XRO A;  2W7N A;  5H6R A;  4BE0 A;  2OTL I;  3FMR A;  2I5U A;  3ULQ B;  3U21 A;  2ADU A;  2P4W A;  2WWY A;  1IUF A;  1MBH A;  2FQ4 A;  2KIS A;  3HBL A;  1D1B A;  1O3S A;  4AM3 A;  1RES A;  4M3G A;  4M74 A;  2LF8 A;  3TOB A;  3VYU B;  3GFJ A;  1ZK8 A;  1ZTR A;  4FAS D;  9ANT A;  1S72 I;  2NVY J;  2V1X A;  1EKE A;  1YIT I;  3KZY A;  4I99 C;  1KGS A;  4EJU A;  4OOI A;  3G1O A;  2K40 A;  4ZYD A;  2EZI A;  3E5X A;  4A3M J;  1J7K A;  1HXD A;  5DD4 A;  2K4B A;  2ZJ2 A;  5HLG A;  5F1R A;  3F22 A;  3I71 A;  2X6W A;  3PIO F;  3OOU A;  2M0M A;  3E7L A;  5E3N A;  1U3E M;  3IH2 A;  4Y4R A;  5DCF A;  3TO6 A;  1O4X A;  4Q47 A;  4ENN A;  1JJ6 C;  2K4J A;  3VPR A;  5J1U A;  1ZRD A;  4XLP F;  5D6E A;  3OYD A;  3H9G A;  1QHH D;  3BC8 A;  1TWC J;  4HOB A;  2F5F A;  1FNN A;  2DA2 A;  2VQH A;  2I10 A;  3HRS A;  1JTX A;  3WG9 A;  3F21 A;  3JCU C;  3CJQ B;  1LFU P;  3AG3 H;  3BTJ A;  4U0V A;  4C3H J;  4BBS J;  4QPO A;  5F0H A;  5KCM A;  4HDU A;  1V5G A;  4BJT A;  4HNU A;  3BT9 A;  5EEH A;  1T2K A;  5FRM A;  5A2Q K;  5JVG F;  1P4X A;  3G3Z A;  2R7X A;  1DGW Y;  1WJB A;  1R1T A;  3IH4 A;  3TP3 A;  4KIC A;  3CCS I;  2M8G X;  2FML A;  1RUN A;  4NC8 A;  3Q9V A;  2IGO A;  2NNN A;  5FLX Z;  2FBK A;  1YYV A;  2Z16 A;  1HA8 A;  2LBF A;  1QZY A;  3M07 A;  3GEZ A;  1GV5 A;  3HG9 A;  2ZJP F;  4LG0 B;  1J0R A;  4G94 A;  4Q4Z F;  4Y13 A;  3K70 C;  2X6Y A;  2PBI A;  1IRG A;  3WTU C;  3BCB A;  2MG4 A;  2E2I J;  3A1Y A;  2COB A;  3S3O A;  2XKP A;  4E7H A;  2CGP A;  3I9V 2;  2LC2 A;  3VB2 A;  3KE2 A;  2KZG A;  1WWX A;  2WB1 A;  3LA2 A;  1YJ9 I;  4XLH A;  4IVN A;  4EAT A;  3CO7 C;  3NRV A;  3TO9 A;  1YO5 C;  2HDD A;  2PJP A;  3MZY A;  2ID6 A;  2VOD A;  3J81 K;  1WH5 A;  2R7D A;  3CC7 I;  3K9T A;  2DFH A;  5IOZ A;  1BI2 A;  1QU3 A;  1X1B A;  3OYJ A;  5HDN A;  4O5V A;  1X1P A;  3LMM A;  4Y52 J;  2O9L A;  2LDU A;  5H2F C;  3PNT A;  3QOD A;  1TC3 C;  2OD5 A;  3K4B A;  3OOP A;  3K4L A;  1SAX A;  1D0Z A;  1UCR A;  2BVL A;  1Q1V A;  1Y56 A;  3HDD A;  1XMA A;  3FM3 A;  3RKW A;  2X48 A;  3CP8 A;  1UB9 A;  3K70 D;  2EA4 A;  5M5X J;  5ICC A;  5GP9 A;  5FKL A;  3KIO A;  1U5T B;  2RRE A;  3V8L A;  3F0C A;  1T95 A;  5KNL A;  4FT8 A;  1KQ8 A;  2A5Y B;  1MSF C;  5CKT A;  1LUJ B;  3VOD A;  2NAZ A;  3V7S A;  4L18 B;  3WGI A;  4JYK A;  4KFC A;  1VQO I;  4ENJ A;  2XGX A;  3ZMS A;  1N75 A;  4BQO A;  2ZFU A;  4HQM A;  4KA4 A;  3SQN A;  2RN7 A;  1F1Z A;  4ON0 A;  2YX7 A;  2WB1 N;  5ILU A;  2R7Q A;  5FKO A;  2HQR A;  3K10 A;  4X6A J;  2BXZ A;  1FY7 A;  5LFA A;  1SFO J;  3N4M A;  1S7A A;  3BDD A;  1UST A;  5B1B H;  4OIR F;  4A3I J;  1R49 A;  2NVX J;  4B3A A;  3PO2 J;  2KDZ A;  3TDZ C;  3ZMD A;  1H89 C;  2ICW G;  3CJT B;  2HDW A;  3PUF A;  4L9V A;  5HNF A;  2DA6 A;  4OWR B;  1LDD A;  2V26 A;  2E71 A;  3TL4 X;  2DA5 A;  3T8R A;  5F0C A;  4U7D A;  1WKM A;  1IXS B;  2VOP A;  2F4I A;  1T6S A;  2QSF X;  4LG0 A;  3I55 I;  1T39 A;  2HXO A;  2P5K A;  1VQK I;  2HEO A;  2WAE A;  4XSX F;  1U0J A;  1HDP A;  1NTC A;  1XGM A;  2KL4 A;  2PMZ A;  3HEF A;  2R5Y B;  1X3U A;  1YFH A;  1PUE E;  1MZB A;  3SZT A;  3A0H C;  1HOM A;  4AVZ A;  1FBQ A;  5ILS A;  3K1N A;  3FXK A;  1TL8 A;  3KP6 A;  4AUX A;  2CW7 A;  2GXB A;  2W84 A;  3WTX C;  3CTA A;  4AWX B;  3JRI A;  1K4T A;  1T08 B;  3ABK H;  3GFM A;  1U6G A;  3T5X A;  3F8F A;  4OAY A;  3BG3 A;  2JWT A;  2VJI A;  3FDY A;  3EUH C;  2K3P A;  4UVB A;  5ICF A;  3HRU A;  4BUP A;  2FNP A;  2EB7 A;  2M9H A;  1T98 A;  1HC8 A;  4DYC A;  1D0Y A;  4XKV A;  1FBS A;  1VQ4 I;  1ACI A;  1CGP A;  2UXX A;  1DPU A;  3PUB A;  3P9C A;  4ZYH A;  4ZZD A;  3GME A;  2HYF A;  4RAZ A;  1N78 A;  2XPW A;  3GWZ A;  1SD6 A;  1I3A A;  1S8N A;  1XGS A;  4RB2 C;  1BOA A;  1QZE A;  2JRT A;  2W24 A;  5K1Y A;  5BPI A;  4IOA F;  1I6H J;  1Y0N A;  2PMZ N;  4IEJ A;  3HPH A;  1QVT A;  2OTJ I;  2K5C A;  3ECH A;  5EYR A;  4U87 A;  4C9Y A;  4YEJ A;  3SZG A;  3LQR A;  3CDH A;  1JUS A;  4WXH A;  2O6G E;  3E97 A;  3H3U A;  3J7A Y;  2DFF A;  3HOU J;  1XCV A;  2MH9 A;  3FXR A;  2BY1 A;  2XRN A;  3FBI B;  2IPQ X;  2DXI A;  2RC4 A;  2LVS A;  4MGR A;  2GQQ A;  2AXL A;  2NOG A;  1R23 A;  3NWT A;  2JUC A;  3QQA A;  1FTZ A;  2M87 A;  1U8B A;  2DK8 A;  2V9P A;  4PGH A;  3H1C A;  1JGS A;  3QYB A;  4NB5 A;  1Z3X A;  3E3V A;  3L2R A;  1GXQ A;  3E1S A;  1T0F C;  2DQL A;  4M9X A;  3ZN1 A;  1BL0 A;  1ENH A;  4M72 A;  1A6Q A;  1U8R A;  4BQN A;  1OYI A;  2R5Y A;  1XMX A;  3HXL A;  2XUB A;  2O5R A;  2K86 A;  5FRO A;  2JA8 J;  1I50 J;  1ZHF A;  2HYG D;  3BWG A;  4A5N A;  2DT5 A;  5FD5 A;  1BA5 A;  3I5U A;  2E36 A;  1ZG5 A;  4M3E A;  2HOA A;  4BU2 A;  1H88 C;  2XV4 S;  4A3L J;  2GLO A;  4MTE A;  4XOR A;  1T8I A;  1VQ6 I;  2MW8 A;  1UAA A;  4UV9 A;  1CQT A;  2OZU A;  4C3J J;  5LBQ A;  2H1K A;  3H5A A;  1LJ9 A;  1FMW A;  2EJR A;  2QQA A;  4KIF A;  1UG0 A;  1WI9 A;  4MIM A;  1R00 A;  2NXN B;  3EUK L;  4QIW N;  3BG9 A;  3SZP A;  4CH7 A;  3FKI J;  2IRF G;  4C3I J;  3ZQC A;  2HKO A;  5E79 C;  3FM5 A;  3ZMT A;  2OPT A;  2EWN A;  3RKY A;  3UR3 C;  2QCO A;  4U0W A;  2DFI A;  5IP9 J;  2DT6 A;  3DPT A;  2BYV E;  4GRI A;  3QRF F;  2B9S A;  3KYC B;  1ITY A;  3QPS A;  4MHG A;  3BG6 A;  4RM2 A;  3M7G A;  3G2B A;  2O0Y A;  4M3B A;  5F6F A;  4GCV A;  1E2X A;  2OBP A;  3K7A J;  4M3D A;  1QVU A;  2GA1 A;  1PDN C;  4KNY A;  1RR7 A;  3LSM A;  3ZQL A;  2Y0M A;  4IHS A;  3OIO A;  1XD7 A;  2M7A A;  5E1X A;  2BGC A;  5ICG A;  5M3M J;  3BLY A;  2DMP A;  2RV8 A;  3OYF A;  1ON2 A;  2HOT A;  1XDS A;  3E5U A;  1Y39 A;  5IP7 J;  4BYY A;  3HL2 A;  3S1N J;  4HSR A;  2HNH A;  1OCZ H;  2K9Q A;  1VZ0 A;  4KT6 A;  2ZXH A;  1XGN A;  5LD2 C;  4HF1 A;  4R8H A;  3UNG C;  3QPL A;  1B72 B;  1VND A;  5J1R A;  3G1L A;  2ESH A;  1WJE A;  4LK1 F;  2VL8 A;  4UXN A;  3FZV A;  3S15 J;  1TBX A;  2CV2 A;  3D5R C;  2V9V A;  2WAD A;  3C7J A;  1WJF A;  2K85 A;  4B43 A;  4HX8 A;  3EUA A;  2W57 A;  5HS9 A;  3P5J A;  3L9F A;  1T38 A;  1DGR M;  2F5V A;  4KJZ A;  3A2K A;  1ZAO A;  3HRT A;  2L7M P;  5GPC A;  1RUO A;  2F4O B;  4MLO A;  1I6X A;  4XM3 A;  2X51 A;  5E1W A;  1RKT A;  4A0X A;  3WTV C;  4A3C J;  2R7T A;  1BIB A;  2X6O A;  4A3B J;  1MKM A;  4XKC A;  3F8M A;  1LEA A;  2TRT A;  2Z33 A;  2AQF A;  1KU9 A;  2E1C A;  1IAW A;  2LH9 A;  1I3Q J;  4RB0 A;  1G4D A;  4U0Y A;  1WI3 A;  5IT9 K;  1BC8 C;  2E1M C;  3K4M A;  2HVR A;  3DEW A;  4IX7 A;  2IGK A;  1XPX A;  1E3O C;  1OCR H;  1MDM A;  2Y75 A;  4JOM A;  3O6B B;  2DI3 A;  1BR2 A;  2R5Z B;  4RGS A;  1J75 A;  1TZL A;  4II2 A;  4NNJ A;  1S7O A;  4L5J A;  3K4K A;  2BY0 A;  3WU2 C;  3H9Q A;  4YRV A;  4RB1 A;  1XMK A;  1TT0 A;  3KP3 A;  1MBF A;  2Z5U A;  3D1N I;  1MMD A;  5D5V B;  3OYH A;  1NK3 P;  5DM6 F;  4RLF A;  1Z77 A;  3KP2 A;  2CS3 A;  5EGO A;  3KZI C;  4G12 A;  4CA0 A;  2P7C B;  1TTY A;  4I2O A;  3ECO A;  4BH9 A;  2IW5 A;  3H0G J;  3GLX A;  3NQO A;  1O3Q A;  2J5O A;  4E7K A;  3DLL F;  5IOY A;  3IAS 2;  5E20 A;  1E0E A;  1WJC A;  3GZN B;  4PJN A;  1GHC A;  5J40 A;  2XVC A;  3IRQ A;  2JQ7 A;  1FYM A;  1VQ7 I;  3JTH A;  2ZJR F;  3FHZ A;  2QSH X;  2VOO A;  1VQ5 I;  2XAJ A;  3BJA A;  2P0W A;  4NC6 A;  2GAU A;  1YHQ I;  2IP2 A;  1FPQ A;  2NS0 A;  1B6A A;  2OC6 A;  3CUQ A;  4XKB A;  1B72 A;  1X2M A;  2UUZ A;  4RAG A;  1ZH5 A;  3DU6 A;  4M3F A;  4A3J J;  5TIS C;  1RRJ A;  5LRS A;  2DPU A;  1GVJ A;  3QOE A;  1ZRF A;  2A6T A;  3GFL A;  1R1U A;  2QVO A;  1BC7 C;  5ED4 A;  2XPU A;  5HS8 A;  3S3M A;  4BHC A;  3IKV A;  3GTJ J;  5HLH A;  2MFZ A;  3ZQ7 A;  5D8L B;  1IXR C;  3MEX A;  1LDK B;  3CCL I;  2HXI A;  2XB0 X;  4BS9 A;  4CCK A;  3E6M A;  1LFP A;  5CVV A;  3BZ6 A;  2WTE A;  2VQL A;  4L9N A;  3MKL A;  5GAD J;  3MQ0 A;  4CGZ A;  2ZCW A;  2R0Q C;  3FMS A;  2FX0 A;  2ZXW H;  1YE9 A;  3QP5 A;  4IHV A;  3ZMV A;  5JFR A;  3LSP A;  3L00 A;  3GBG A;  4DJA A;  1S6L A;  5C3E J;  1RI7 A;  2IS1 A;  2OU2 A;  2KFD A;  3I4N J;  3RPU A;  4XNF A;  2IS6 A;  3W6V A;  1D5Y A;  2EA2 A;  4BAY A;  4L5I A;  5IYD J;  2BBY A;  2M4K A;  3BCA A;  3ERM A;  5FGM A;  4Z6Y A;  2VJJ A;  1PUF B;  2XSJ C;  2AO9 A;  2UV1 A;  5CVJ A;  4DIQ A;  4DQ2 A;  4PJM A;  2KKO A;  3S16 J;  1X1D A;  1G59 A;  2KMU A;  2HKX A;  2MGQ A;  2O7O A;  2LK2 A;  2LKX A;  3X2Q H;  3A0B C;  2PI0 A;  2MYS A;  4EGY A;  2M1B A;  2CQ7 A;  2BHY A;  3KLO A;  4M73 A;  2OZ6 A;  2RKH A;  1O7F A;  3DTK A;  4CCN A;  3S1M J;  5FD6 A;  2ZJQ F;  2CFX A;  4HYE A;  4GGG A;  5HVQ C;  2HTJ A;  4HF0 A;  3FKJ A;  1BI3 A;  3MZH A;  3Q3S A;  2PFB A;  3D5L A;  2GXG A;  4ABZ A;  4CHU A;  4RAY A;  3JRC A;  3WOD F;  2JZY A;  3TKY A;  4AIH A;  1R5I D;  3I0T A;  3ERE D;  2YPR A;  3OS0 A;  1ZEL A;  4IRG A;  3LA3 A;  3KPH A;  3M3Y J;  2HPI A;  1ZG3 A;  1S9H A;  3TO7 A;  3VEP A;  4G6D A;  4KIS A;  4P5O A;  5DYM A;  3MZ8 A;  4LLG F;  2UWM A;  2K27 A;  4X0G A;  3DQV C;  3RI4 A;  1V5E A;  1FOY A;  4OIP F;  5FFZ A;  3OL3 A;  3JRA A;  3K1M A;  2BE5 F;  3ISP A;  3ZXS A;  4DBQ A;  1YS7 A;  5J4Y A;  1Y6I A;  2O03 A;  3K2Z A;  2FOW A;  2X6X A;  3S93 A;  4JBA A;  1W0U A;  4BHB A;  1Q1H A;  3DLA A;  4CUG A;  2KZV A;  3J80 Z;  2DK5 A;  5J47 A;  1YI2 I;  4XRF A;  2AHQ A;  2H1L A;  1LB2 A;  4B1R A;  2CQN A;  1V55 H;  4NUB A;  2JVG A;  1VI0 A;  3H9J A;  2DJN A;  2E1M B;  4XRS A;  2XF7 A;  4NQW A;  4AC0 A;  4ZTJ A;  4OIQ F;  3OSF A;  2VT3 A;  3ASN H;  2AQE A;  2OV7 A;  1IUY A;  2ELH A;  2NNY A;  3CF5 F;  1A5J A;  2OQR A;  4ZC3 A;  4A3E J;  3CP2 A;  2LSO A;  2VBX A;  2XC7 A;  3KFW X;  5LEK A;  1TNT A;  1V54 H;  3WGG A;  3W6K B;  5L3B A;  3G4S I;  2GWR A;  1Z7U A;  2LP0 A;  3PQJ A;  2PN6 A;  4DW6 A;  5IYC J;  2EBI A;  1PUF A;  2PMH A;  3PIP F;  1Z21 A;  2VN2 A;  5D5W B;  2NYX A;  4LLN A;  2KRC A;  2F5D A;  3ABT A;  2XIG A;  2DW4 A;  3HSR A;  1R36 A;  4PGG A;  1FTT A;  2GIV A;  5EZG A;  5TGT A;  2FF4 A;  3E6C C;  1IZ1 A;  3AG2 H;  3GTK J;  5JHF A;  3CME I;  3RKQ A;  3EYY A;  4NHJ A;  5JVT A;  2ECC A;  2L9R A;  3OYG A;  4EJT A;  3EYI A;  3GYH X;  2BW3 A;  1K61 A;  5EJC A;  3L09 A;  1OR7 A;  1Y0U A;  2A61 A;  2ZXJ A;  3LSG A;  5BQT A;  4CCL A;  2AS5 F;  3KP5 A;  2IAI A;  2QEX I;  1KYW A;  2NVT J;  3ABL H;  4NDL A;  4E7S A;  3IKT A;  4E7I A;  3L2Q A;  5EF6 A;  3GVA A;  4I0A A;  3HM5 A;  3M9A A;  3ZGK A;  4ESF A;  3KX2 A;  3DU5 A;  3DKW A;  3M8F A;  4U88 A;  2R7W A;  5KVR A;  4IHX A;  2LNB A;  1IN7 A;  2G9W A;  3GZ6 A;  1ZR4 A;  4IKF A;  3GTL J;  3R4K A;  4LOC A;  1ETO A;  2X0L A;  2VKD A;  2R7F A;  3GCM A;  4ZDO A;  3AG4 H;  3DFG A;  4KIT B;  5BPD A;  4IRH A;  2QBY A;  3FF5 A;  3CC4 I;  5F64 A;  3OYM A;  1L0O C;  3OYL A;  2HFH A;  3C18 A;  3HC7 A;  5ILV A;  1SC7 A;  5FKN A;  3HOS A;  2E7X A;  4ITV A;  1ODD A;  4XMY A;  3JRD A;  1PYV A;  3S1Q J;  2DTR A;  4FX0 A;  2K3F A;  4GYG A;  1KA8 A;  4FE7 A;  3BPX A;  5B1A H;  4ZYE A;  5FLM J;  3MN2 A;  1YQA A;  3Q9S A;  1KU3 A;  3BG7 A;  1B1B A;  1EA3 A;  3HHG A;  2JRM A;  5K7H A;  1WZ2 A;  4H4K C;  3T0Y A;  4EMS A;  3O8H A;  1OYW A;  4M9S A;  3C2H A;  2E5Z A;  5TJJ A;  3D5S C;  4HEA 2;  4FHT A;  5E8G A;  3NAU A;  1ZRC A;  1JKO C;  3ZPL A;  3BR5 A;  4II3 A;  2EV5 A;  2BOL A;  5D5U B;  3PL8 A;  3RYP A;  1A04 A;  2DA1 A;  2VIX A;  1EH8 A;  2ESN A;  2CWE A;  2N8G A;  3RTR A;  2O8X A;  3VDX A;  3S2D J;  2F6C A;  2HR3 A;  3OYB A;  4JX4 A;  1XG1 A;  4C2M J;  1DU0 A;  1VQN I;  3Q5F A;  3D0S A;  3ESW B;  1BOB A;  3LWF A;  3QPH A;  4HW0 A;  2W1O A;  3HZJ A;  3W3C A;  4UY8 I;  4GYI A;  2A68 F;  3SFI A;  3WU0 A;  2R7U A;  1K6Y A;  3FX3 A;  1BR4 A;  4LJZ F;  5GAG J;  4FE4 A;  1SVL A;  1MW7 A;  2FE3 A;  1ETW A;  2YUS A;  2L01 A;  5FFX A;  2VJ5 A;  4XKW A;  3L2C A;  3HTS B;  3GTG J;  3V7R A;  1D8K A;  5M5Y J;  1F4K A;  3GZ5 A;  1D8J A;  3BJO A;  5JR3 A;  1EV7 A;  2RNJ A;  1Z3Y A;  4N4O B;  1TWG J;  3KEO A;  1L3L A;  3O8G A;  4CCM A;  5HOO A;  1H0M A;  1DQU A;  4ZJZ A;  4D7M A;  1FLI A;  3CCJ I;  1IV8 A;  5DD8 A;  3CUQ C;  1OPC A;  2STT A;  4BHP A;  4EJV A;  1AKH A;  2KLO A;  2V1N A;  3WTS C;  4WF2 A;  4G7O F;  1LKX A;  2DT7 B;  4RGR A;  1U9N A;  1USS A;  5FKM A;  2G7H A;  5FO5 A;  1SMT A;  2R7O A;  1RET A;  3MKY B;  4AIK A;  2HDC A;  3K0L A;  5LHG A;  2M8E A;  4RMN A;  3H5R A;  2MSY A;  3LOC A;  2M5W A;  2QQB A;  2LKS A;  3QOP A;  1SAU A;  3DBH B;  3FBN B;  3G71 I;  1XTA A;  1RIO H;  2NRA C;  2DOD A;  1JKR C;  3Q0U A;  3GX4 X;  2EIM H;  3CCU I;  4A93 J;  3VFZ A;  4DZJ A;  1K7A A;  2KDO A;  3JRE A;  4Y7N J;  1BW5 A;  1BBY A;  4BNC A;  3F6O A;  1UMQ A;  5FLX K;  2LKP A;  5CVI A;  5F27 A;  4EQQ A;  2ZNY A;  2KIU A;  2V6E A;  1KU2 A;  4E4H A;  3HSF A;  5H20 A;  3E5Q A;  3FIS A;  4PK4 A;  4RA2 A;  1WJD A;  4XRM A;  5J8F A;  2CW0 F;  2W48 A;  2FRH A;  2B7E A;  1JT6 A;  4F93 B;  1IG7 A;  3C3W A;  4ESB A;  2CFO A;  3ROU A;  1A35 A;  2HGC A;  4G6T B;  1K83 J;  2CYY A;  4C2T A;  2RNG A;  2OQG A;  1WHU A;  4D0P A;  1YRN A;  4Y33 A;  2MD5 A;  2V9K A;  3K4J A;  3IWF A;  3MKW B;  3CDI A;  1MSE C;  2YSR A;  1EH6 A;  1HST A;  1LEB A;  3PFY A;  1X19 A;  3SFZ A;  2MLG A;  2FNA A;  3CD6 I;  1MMN A;  5HS7 A;  3ZRG A;  1D0X A;  1X1A A;  5LGN A;  1Y8Q B;  5D5X B;  2ETH A;  3BR6 A;  3E6B A;  1QQI A;  4NBQ A;  1LE8 A;  3H5N A;  3HIF A;  3JR9 A;  4HZF A;  4AU7 A;  2DYS H;  4PJ0 C;  3CDL A;  4XN3 A;  2CV1 A;  3K4N A;  5CVR A;  3OYE A;  2FMY A;  3W2V A;  2CUE A;  1FZP B;  3WGH A;  3QPT A;  3LSJ A;  5J6X A;  2Z9O A;  2Y31 A;  5KK1 A;  3ABU A;  2JT1 A;  2L3D A;  3A02 A;  3MD2 A;  3GUD A;  1XSV A;  3BTL A;  3A01 B;  2ZNZ A;  4P9U A;  2JPC A;  1E3H A;  3SXY A;  5B5E C;  1GDT A;  3F72 A;  4UUT A;  3RPU D;  4YEL A;  3OWT A;  1PJR A;  1S7E A;  1IDZ A;  3HOY J;  1MJB A;  1Z0X A;  1Y1V J;  2Y30 A;  2DQR A;  3N05 A;  2QM3 A;  4O6J A;  3QYF A;  5E3O A;  3BZC A;  3VSK A;  2Y2Z A;  2LY2 A;  1P92 A;  3EPZ A;  1TWH J;  2HVQ A;  3AL0 C;  2ELK A;  4S0H B;  5IPA A;  3OYI A;  4E7J A;  3DXJ F;  1U2W A;  5D4R A;  3V8J A;  5ERI A;  2DDB A;  2NS7 A;  3QAH A;  3S32 A;  2QLZ A;  3V42 A;  1R4M B;  1RR8 C;  3ZQH A;  1W36 C;  2P7V B;  3CJR B;  2LFB A;  1VQ8 I;  1IN5 A;  4UUS B;  1X58 A;  3ZOB A;  3DBR B;  1O57 A;  2FSW A;  2MC3 A;  3FIW A;  3FXQ A;  1HSJ A;  2HTS A;  1DU6 A;  1CF7 A;  5JI6 A;  4ZYG A;  3W2W A;  5LHI A;  4KUM A;  1VQM I;  4FET A;  3CLQ A;  3I58 A;  5HOD A;  3JRH A;  3B6A A;  2JTV A;  3DPL C;  4TV7 A;  1QPM A;  4BL0 B;  2VQC A;  3K1P A;  1T56 A;  1RNL A;  3KET A;  3TED A;  4CYC A;  2LG4 A;  1GUU A;  2H6C A;  2KPM A;  2V4J C;  2X1E A;  5EEA A;  3OSG A;  2H27 A;  2JSP A;  1MBG A;  1GVD A;  3CCR I;  1FP1 D;  2HZD A;  2JK3 A;  3GLL A;  1MDM B;  1AA7 A;  1G3Y A;  4HG2 A;  3L2V A;  1REP C;  2PLY A;  1LFB A;  4RB3 C;  2EZL A;  2XAS A;  2XAH A;  4XQF A;  3I56 I;  4O3M A;  4ASN A;  1TWF J;  2Z1D A;  1G8X A;  5JHU A;  1FYK A;  1QO0 D;  1W36 D;  2HQN A;  5EGO B;  1W0T A;  1XC5 A;  1E17 A;  1X4O A;  2FEZ A;  2HWV A;  2IGM A;  1TWA J;  4PDK A;  4BE2 A;  3WE3 A;  3DKY A;  1P2F A;  3DF8 A;  3W2A A;  2XAQ A;  4PJJ A;  4ZDP A;  3EDP A;  1JJ8 C;  5JLW A;  4S05 A;  1PP7 U;  2CU7 A;  2ZC2 A;  2RAE A;  1B8I A;  3R0J A;  2DMQ A;  5D6F A;  4XID A;  3A01 A;  2JA6 J;  1X1C A;  3SDB A;  4IZZ A;  3IUO A;  1P4W A;  2CW8 A;  3I3L A;  1H8A C;  1OR7 C;  2P6S A;  3DV8 A;  5D8K B;  3CUQ B;  1ONV A;  2VPR A;  4QSH A;  4LK0 F;  1W7P A;  2Y69 H;  3JW4 A;  3LFU A;  2DOE A;  1J9I A;  1IN6 A;  1HF0 A;  1QGP A;  1JUP A;  2LRD A;  2XKO A;  1H9T A;  2Q2E A;  3S2H J;  1HQC A;  3ML6 A;  2VC0 A;  2PMU A;  4BBR J;  4A6E A;  2JA2 A;  3MMY B;  4AYB A;  2ACJ A;  1A31 A;  4F7Z A;  2DDA A;  3O2P E;  2HU9 A;  1P7I A;  4UUS A;  3BPV A;  1KYZ A;  3J7Y J;  2HS5 A;  4KN7 X;  4XLC A;  2EZH A;  1P6R A;  4XK4 A;  2WY8 Q;  3KP7 A;  2ISZ A;  4YFX F;  3OS2 A;  4RBO A;  3BR2 A;  2KJB A;  2DMU A;  3QU3 A;  4BJ5 C;  1ZG1 A;  1GXP A;  3S17 J;  1IRF A;  1YS6 A;  3CMY A;  1TQM A;  4A0Y A;  3OYN A;  1OCP A;  2P8T A;  3C1D A;  3T8T A;  5K7Z A;  2EFQ A;  5KAI C;  4LB5 A;  2VBZ A;  3RKX A;  2K9M A;  2X4H A;  1MBJ A;  1GV2 A;  1FIA A;  3M1E A;  4V2G A;  1XSX A;  3P7N A;  2Z99 A;  2P6T A;  3JAM Z;  4ENK A;  2A3S A;  4Y17 A;  3RZD J;  1RKW A;  1SMY F;  3HPG A;  1FOX A;  1KZH A;  3F6V A;  4A3G J;  1RC9 A;  3RIR A;  2GM4 A;  4K2E A;  1OCC H;  3F23 A;  4G7Z F;  3F3X A;  4HV5 A;  5KAF C;  2OF7 A;  2VQG A;  2DO7 A;  4A69 C;  4AYB N;  1WPK A;  3VWB A;  1R22 A;  2CV0 A;  2O61 A;  2ZXI A;  3LST A;  1SEU A;  2BY3 A;  2EFN A;  3WG7 H;  1JHH A;  3DBL B;  4PJL A;  5GTI C;  1TW3 A;  3QWL A;  3LSR A;  2UXN A;  2L7K A;  4LIU A;  3PSI A;  3CJN A;  3GTQ J;  2Y0S A;  2EIL H;  2A05 A;  1QRY A;  2Z2S B;  2YU9 J;  3LSH A;  3H36 A;  2Q1Z B;  2FA5 A;  1I1S A;  1G3W A;  3BOQ A;  1G6N A;  3BZK A;  1KQ0 A;  2DA4 A;  5DUI A;  3CCY A;  4RM3 A;  1FYL A;  2B63 J;  1AWC A;  2PJR A;  3AL0 B;  1OFC X;  2EK5 A;  1WJ5 A;  4EJO A;  1G2H A;  1MH3 A;  2VXZ A;  3EQL F;  4LD5 A;  5GTH C;  2WBM A;  4XOT A;  2VE9 A;  2M45 A;  4MTD A;  3DPU A;  5BMZ A;  2W00 A;  3TQN A;  2GA2 A;  2A69 F;  2FXA A;  3ZQF A;  4BXX J;  5BS6 A;  1DPR A;  4IHT A;  1Z6T A;  1BI0 A;  1OYY A;  5FKK A;  2AXT C;  1JXS A;  1Z05 A;  3O3K A;  4RDU A;  2GOM A;  3RDI A;  3JSP A;  2KRH A;  3BQZ A;  1R4N B;  2F4M B;  3DTI A;  1EH7 A;  1UHW A;  3WTZ A;  1YIJ I;  2KT0 A;  2EV6 A;  5K7F A; 
#chains in the Genus database with same CATH homology
 2WAF A;  4AVZ A;  4HNT A;  5TGT A;  3VSL A;  5JHF A;  2CW7 A;  4Y3O A;  2PJR B;  3QYE A;  3OYG A;  4NQW B;  3A4C A;  2BW3 A;  3PJR A;  2GOX B;  4OAY A;  3LSG A;  4BXF A;  4CCL A;  2VJI A;  3FDY A;  3S8P A;  4N4N B;  3EUH C;  3M1C A;  2K3P A;  5KHD A;  4BUP A;  2ELJ A;  4E7S A;  4E7I A;  3L2Q A;  1D0Y A;  4XKV A;  4F52 A;  4B44 A;  3ZGK A;  3KX2 A;  1IRX A;  3DU5 A;  4ZDL A;  2R7W A;  1DP3 A;  4ANJ A;  3RQ4 A;  4CCO A;  3PUB A;  4CZC A;  4IKF A;  3ZQQ A;  2VKD A;  4XLA A;  3OY9 A;  1N78 A;  4ZDO A;  4KIT B;  1MNE A;  1J09 A;  3HUG B;  4U7B A;  4E6K G;  3OYM A;  3HPH A;  3OYL A;  2K5C A;  2L2O A;  4U87 A;  3HC7 A;  4C9Y A;  2KQR A;  4YEJ A;  3SZG A;  3HOS A;  2BW3 B;  4ITV A;  4XMY A;  1PYV A;  3J7A Y;  2L5Q A;  1D1A A;  2WY7 Q;  3BG7 A;  3FBI B;  2L9S A;  2DXI A;  4E7Z A;  1EA3 A;  1BR1 A;  2VKH A;  1WFX A;  4H4K C;  2CH0 A;  4DBR A;  2R4G A;  3NWT A;  4ZTF A;  3C2H A;  2E5Z A;  3D5S C;  4HEA 2;  4IQJ A;  4II3 A;  2HQA A;  4JQF A;  2BOL A;  3PL8 A;  4XLE A;  2VIX A;  3OR2 C;  2W4S A;  3QYB A;  1JI8 A;  3RTR A;  1Z3X A;  4BQQ A;  2QKM B;  3L2R A;  2DCE A;  3E1S A;  3VDX A;  2F6C A;  1T0F C;  3OYB A;  3DKX A;  2A5W A;  1D1C A;  4QPQ A;  4BQN A;  2X85 A;  3HXL A;  1BOB A;  1V5F A;  2O5R A;  4LIV A;  2DOA A;  2W1O A;  3W3C A;  5FRO A;  2R7U A;  3ONQ A;  1K6Y A;  1BR4 A;  2WA0 A;  3CES A;  3AKZ A;  1MW7 A;  4BU2 A;  2VJ5 A;  4XKW A;  1KON A;  3C2G A;  4XOR A;  3OS1 A;  1UAA A;  1Z3Y A;  4N4O B;  2JUG A;  4RLQ A;  3H5A A;  4CCM A;  5HOO A;  1FMW A;  3K4C A;  4BAC A;  4XOP A;  1DQU A;  4ZJZ A;  1UG0 A;  3EUK L;  3VYT B;  2KLO A;  2V1N A;  4CH7 A;  3S3N A;  1LKX A;  2DT7 B;  4HRI A;  4LIT A;  4XN0 A;  2OUM A;  2VB6 A;  2R7O A;  3MKY B;  4XL9 A;  3UR3 C;  4RMN A;  2MAB A;  2DT6 A;  3H5R A;  3DPT A;  4GRI A;  3VYS B;  4E7L A;  3BG6 A;  4RM2 A;  2MC4 A;  2IS2 A;  1SAU A;  3FBN B;  3ZCO A;  3HOT A;  5FRN A;  3G2B A;  3NWS A;  2R7S A;  4PFP A;  3MKZ A;  4D1Q A;  3LSM A;  1NG6 A;  4CCJ A;  3OIQ A;  2KDO A;  4J00 A;  2M7A A;  2MD0 A;  3RCO A;  1SFK A;  2LYC A;  2V6E A;  4E4H A;  4BE1 A;  4PK4 A;  3BLY A;  1WJD A;  3CMM A;  2XDV A;  1YX3 A;  3OYF A;  1YX5 A;  4BJ6 C;  2DJI A;  4HST A;  2M4G A;  3E0J B;  4XR6 A;  3HL2 A;  4C30 A;  1GLN A;  4F93 B;  4HSR A;  2XF5 A;  2HNH A;  1VZ0 A;  2CFO A;  2V7F A;  4KT6 A;  2ZXH A;  5LD2 C;  4G6T B;  2WAQ A;  3UNG C;  3PNY A;  5HNH A;  4C2T A;  2RNG A;  3HKZ A;  4OAZ A;  2ZSH B;  4Y33 A;  1WJE A;  2V9K A;  3K4J A;  3OYK A;  2VL8 A;  3MKW B;  1FMV A;  2CV2 A;  3D5R C;  3PFY A;  1X19 A;  2WAD A;  1WJF A;  3SYT A;  3K6G A;  4CSW A;  1MMN A;  3ZRG A;  4B3X A;  1D0X A;  1X1A A;  4B43 A;  3EUA A;  4P1W A;  4BDY A;  2LOO A;  4BDZ A;  3KEY A;  1DGR M;  2F5V A;  3DEE A;  4KJZ A;  3A2K A;  4PSX A;  3H5N A;  2IXS A;  3CZ6 A;  4AU7 A;  3H35 A;  4XN3 A;  2CV1 A;  2E60 A;  3K4N A;  3OYE A;  4MLO A;  3SEQ A;  2W82 A;  3W2V A;  4XM3 A;  2X1D A;  4J01 A;  4F55 A;  3LSK A;  2NOJ B;  2X51 A;  4DGW B;  2R7T A;  3MD2 A;  4XKC A;  2AQF A;  1P9Q C;  2LH9 A;  3RPU D;  4YEL A;  3OWT A;  3OYC A;  1PJR A;  2KHM A;  4PFO A;  5HLT A;  3N05 A;  2E1M C;  3K4M A;  3QYF A;  2HVR A;  3OMY A;  3VSK A;  4IX7 A;  2IGK A;  2LY2 A;  3EPZ A;  2HVQ A;  3AL0 C;  3DTE A;  2VAS A;  3OYI A;  4JOM A;  3M8J A;  5CPR B;  4E7J A;  1BR2 A;  4ZYA A;  1TZL A;  4II2 A;  4NNJ A;  3S32 A;  3K4K A;  4B47 A;  4YRV A;  3H9Q A;  2LBF B;  3V42 A;  1TT0 A;  2XF6 A;  1W36 C;  1LVK A;  3KYL A;  2FUG 2;  3CJR B;  5CQE A;  3OYA A;  1MMD A;  3OYH A;  4PSW A;  2VLA A;  4RLF A;  2CS3 A;  2QKL B;  2I8D A;  4F3Q A;  4CA0 A;  2IGN A;  3W2W A;  3IP4 B;  2W7N A;  4FET A;  4BE0 A;  4E7K A;  3DPL C;  3U21 A;  2IS4 A;  4BL0 B;  2VQC A;  3IAS 2;  1E0E A;  3L2U A;  1WJC A;  1D1B A;  2LG4 A;  4PJN A;  2V4J C;  2KPM A;  2X1E A;  4LG3 A;  2JSP A;  3AFH A;  3ZR8 X;  4DOZ A;  3VYU B;  2HZD A;  4FAS D;  1AA7 A;  4HG2 A;  4C2U A;  2P0W A;  3L2V A;  1X4P A;  2OC6 A;  4XKB A;  4XQF A;  2UUZ A;  3DU6 A;  2R7V A;  2Z1D A;  3PNV A;  1G8X A;  2LY1 A;  2CMP A;  3QOE A;  2A6T A;  1W36 D;  2X6W A;  3OOU A;  2M0M A;  1ERD A;  4Y4R A;  3VYR B;  1X4O A;  3S3M A;  2IGM A;  1WJA A;  2MFZ A;  4BE2 A;  1LDK B;  3DKY A;  4BS9 A;  4CCK A;  3W2A A;  4PJJ A;  1LFP A;  4ZDP A;  2E5N A;  3OYD A;  3H9G A;  2VQL A;  1QHH D;  3BC8 A;  2CUJ A;  2VQH A;  2M7B A;  1UEL B;  1YE9 A;  3CJQ B;  2M3A A;  4BEH B;  3DWL E;  4NC7 A;  1QHG A;  4QPO A;  1X1C A;  5CQG A;  5KCM A;  3SDB A;  3GBG A;  1V5G A;  3IUO A;  2XAU A;  4IZZ A;  4DJA A;  2CW8 A;  4BJT A;  3I3L A;  1OR7 C;  4HNU A;  1Z7L A;  4F92 B;  2IS1 A;  5FRM A;  1NG7 A;  2L9N A;  2R7X A;  1DGW Y;  3LFU A;  1WJB A;  3OL4 A;  4XNF A;  2VPL A;  2IS6 A;  3FHN A;  2LRD A;  1N77 A;  4NC8 A;  2IGO A;  4IQ4 A;  2VJ4 A;  2Z16 A;  1HA8 A;  2LBF A;  4XON A;  2JA2 A;  3MMY B;  4AYB A;  2M4K A;  2K9L A;  3BCA A;  2VJJ A;  2HU9 A;  3HG9 A;  3K70 C;  2X6Y A;  2XSJ C;  2UV1 A;  3LSI A;  4XLC A;  3TMO A;  4DIQ A;  4PJM A;  1X1D A;  1G59 A;  3BCB A;  2WY8 Q;  3RSN A;  3A1Y A;  2KMU A;  3OS2 A;  3S3O A;  4E7H A;  2MYS A;  3I9V 2;  4BJ5 C;  2LC2 A;  4F91 B;  4BGD A;  4XLF A;  2WB1 A;  3OYN A;  4XLH A;  4EAT A;  3DTK A;  4CCN A;  1MMG A;  2BVM A;  2K9M A;  5HVQ C;  2VXD A;  3FKJ A;  3L2W A;  1QU3 A;  1X1B A;  3SEZ A;  3OYJ A;  2Q2E B;  3LMM A;  3IAM 2;  3D5L A;  3OIP A;  3HPG A;  3PNT A;  3QOD A;  2KP6 A;  3K4B A;  3K4L A;  1D0Z A;  3F9K A;  3OS0 A;  1ZEL A;  2BVL A;  1Y56 A;  2HPI A;  3CF2 A;  1S9H A;  4KIS A;  2VQG A;  3CP8 A;  4P5O A;  3VWB A;  3K70 D;  2CV0 A;  2ZXI A;  2UWM A;  2RRE A;  4PJL A;  4X0G A;  1T95 A;  5KNL A;  1OLT A;  3DQV C;  1V5E A;  5CKT A;  1MMA A;  3OL3 A;  4D9J A;  2L7K A;  3ZXS A;  4DBQ A;  4LIU A;  1N75 A;  4BQO A;  1Y6I A;  1MND A;  2ZFU A;  3PSI A;  4B48 A;  2X6X A;  2Y0S A;  3S93 A;  2Z2S B;  3LSH A;  2Q1Z B;  4HPQ A;  2HVS A;  3DLA A;  4BEH A;  2KZV A;  4CUG A;  2R7Q A;  2RQQ A;  3K10 A;  3LL7 A;  2HPM A;  4NUB A;  2JVG A;  3H9J A;  5LFA A;  2E1M B;  4RM3 A;  2XF7 A;  2ZSI B;  2R7R A;  2PJR A;  3AL0 B;  1WJ5 A;  2CUZ A;  4ZTJ A;  2VXZ A;  1R6R A;  2AQE A;  2OV7 A;  2WBM A;  4R79 A;  4XOT A;  3H0D A;  3OR1 C;  4ZC3 A;  3DPU A;  2W00 A;  3CP2 A;  2XC7 A;  3PSF A;  2HDW A;  4PUS A;  2LRE A;  5HNF A;  4OWR B;  2V26 A;  3TL4 X;  2JVH A;  2F4I A;  1Z21 A;  3TBI A;  2GOM A;  2KRH A;  2KRC A;  2X1C A;  2WAE A;  1U0J A;  3DTI A;  2PMZ A;  2KL4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...