4NC8A

N-terminal domain of delta-subunit of rna polymerase complexed with nickel ions
Total Genus 23
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
23
sequence length
79
structure length
79
Chain Sequence
KQYSQEELKEMALVEIAHELFEEHKKPVPFQELLNEIASLLGVKKEELGDRIAQFYTDLNIDGRFLALSDQTWGLRSWY
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-directed RNA polymerase subunit delta
publication title X-ray vs. NMR structure of N-terminal domain of delta-subunit of RNA polymerase.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 23
structure length 79
sequence length 79
chains with identical sequence B
ec nomenclature
pdb deposition date 2013-10-24

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05066 HARE-HTH HB1, ASXL, restriction endonuclease HTH domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.1250 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 4nc8A00
4NC7A 4NC8A 2M4KA 2KRCA
chains in the Genus database with same CATH superfamily
4CUGA 3REOA 4G6DA 2OD5A 4XKVA 3V42A 3K6GA 3OYGA 5ICCA 3ONQA 4IHXA 1MD0A 3FXOA 3U21A 2ECBA 3DPTA 2PBIA 2QBYA 2BEOA 2G7HA 3G71I 4Y15A 5IPAA 2PMZA 2JWTA 4UY8I 5DM6F 1MH3A 2XF5A 4M72A 5C3EJ 1RKTA 1VQMI 3K70D 3PFYA 1IGNA 2A6EF 4FTHA 1QHGA 3HRMA 2LKPA 3QPLA 3IH3A 4Y4RA 2ICWG 4RGXA 3CDHA 3SZPA 1J59A 3CCMI 3J7AY 2K85A 3T8TA 3RPUD 4ABZA 4PGGA 5K7HA 1H0MA 1GVJA 3TW7A 4B09A 5D5WB 4IKFA 1Z7UA 3JSOA 4P9FA 1HDPA 5E1XA 3E7LA 2D5VA 1UFMA 1DP7P 1IJWC 1ITYA 2KJCA 1UG2A 4CCNA 4M9ZA 2HPIA 4X1EA 4EGZA 3FXQA 1BL0A 4BS9A 5E18F 3ABUA 3LSJA 4A3MJ 2H94A 3L2RA 2NOGA 2QENA 3E6DA 3O3KA 2EQRA 1PP8F 2N8GA 1G59A 4E7SA 1YTYA 5ICFA 4EATA 2LSOA 3GTGJ 2WAQN 2KIQA 3FK6A 2Y75A 4PGHA 4XLPF 2O03A 1N78A 1G6NA 4LFUA 1TBXA 2VB6A 3ECOA 4L5JA 2GA2A 4ZZDA 1YFHA 1OPCA 2VJJA 2STTA 1LDJA 1X1CA 2ZFWA 2V1XA 2CGPA 1O57A 3N05A 1N25A 4TV7A 3K2ZA 1LUJB 1XSVA 5L3GA 1SAUA 3BZCA 1NG7A 3T1BA 5K5RA 4CZZA 3QOPA 1OISA 4ZH4F 2O5RA 1R71A 1X4PA 5H2FC 1OCCH 2P0WA 2R7WA 2ME0A 1S29A 1SFUA 4KA4A 3VYRB 4FQGA 1D0YA 1JHHA 2ZSIB 4U87A 3VWBA 1YW8A 3CUQC 3I5UA 2MG4A 4XNFA 4GDFA 2X1CA 2DOEA 1VQ9I 2VUMJ 2R7QA 3PUFA 2GBYA 1VQ4I 2VXZA 3GW2A 1GV2A 3GO5A 3CUOA 2QKMB 2VJIA 3F22A 5JVGF 3LFKA 1RRJA 4G7ZF 3CJNA 1TC3C 2M7AA 2LRDA 3IWZA 2QF7A 2WBMA 2ZMEB 2JPCA 4D0PA 2V7FA 3SEZA 3RSNA 4ZJZA 5BMZA 2X4HA 1HSTA 4IQ4A 3HC7A 3V7CA 4BNCA 3S3NA 2R7TA 3J7YJ 1BIAA 2I5UA 2IGOA 2F4MB 3CP8A 4F93B 4HYEA 4IHSA 2VPLA 3CF5F 4C30A 1SEUA 2LMDA 2CQKA 2A69F 2ELHA 4F92B 3BPXA 4ETSA 1R5HA 2LF8A 4IVNA 2OV7A 2KISA 5FLXZ 3HSEA 4HG2A 1MBHA 3LL7A 3S93A 3JAMK 3LSRA 1GXQA 1VQ8I 4EV0A 4FISA 3GXOA 4RA2A 1MZBA 1JUSA 4EJWA 1UHMA 2ZMEA 4QPQA 2Z9OA 3FXMA 4YEJA 4E7LA 1FPQA 4M6VA 3EETA 4OMZA 1GHCA 1H89C 4M73A 3K69A 3OIOA 1V5GA 4IXAA 5BPIA 3I59A 1HA8A 2R0QC 2ZNYA 3ISPA 3Q0WA 1FP2A 1J5YA 1P7IA 2X6OA 4E4HA 2XASA 3QPHA 1YJNI 2OC6A 4NC8A 3G1OA 3GUDA 4XN0A 1YE9A 1XSXA 5EEHA 4HX4A 4DYCA 4OIOF 2WY8Q 1UHWA 3RJPA 1SD5A 3TDZC 1I6XA 1YIJI 3C2HA 2EFWA 2L2OA 4BBSJ 4XSXF 3IKVA 4C3JJ 1Y6IA 3EPZA 1R1TA 4EEFG 4NDLA 1G2HA 2PN6A 3OYCA 2LD5A 1PUEE 4JK1X 1UJ8A 2EFOA 4PCQA 1OYWA 3LAJA 2QSGX 2EJRA 2VT2A 2IRFG 2LKXA 1QA6A 3W2VA 2OA4A 1FBQA 5B3SH 5CQGA 5DD8A 1A6QA 3OYLA 1ODDA 1R23A 4CDGA 1U5TC 5CVJA 4XMYA 3E5UA 2CV0A 1GV5A 2WV0A 2GIZA 3SZGA 3HL2A 2BVMA 5E8IA 1MSEC 4E6KG 1R4MB 4H4KC 1WSUA 1KGSA 2ELJA 3DFGA 2OUMA 4UUSA 1R9TJ 2B63J 3DU5A 4Q47A 2PG4A 4GFBA 1EKEA 4HV6A 3PSFA 4HBLA 3QP5A 3Q3SA 1TWCJ 4U88A 5D8KB 1IRFA 3C18A 1RNLA 4BU2A 1Z77A 1OYIA 2UV1A 1QHHD 3V8JA 2BGCA 3H36A 2JRMA 5EJCA 2DDAA 2L3DA 4OIRF 2P4WA 3KEYA 3CJTB 3DKWA 2ZJ2A 4RAFA 1K4SA 2KJBA 1LDKB 3DEEA 5CYVA 4IHYA 1P9QC 1MNMC 1DGRM 2MGQA 4IRGA 1OR7A 3QQAA 4FHTA 1X1BA 5EGOB 2RV8A 2LTPA 3LA3A 3HIFA 1OFCX 4AM3A 2E1CA 2NAZA 4M6XA 1SMYF 2K40A 2GA1A 2O9LA 2F5FA 2KIMA 1O7LA 4NB5A 3I3LA 3PUBA 5HLHA 3A0HC 2HDDA 5J1UA 3T5XA 2LY2A 2DQRA 1WJ5A 1JE8A 1O3RA 1XTAA 4D5CA 2XGDA 2Y69H 3HRSA 3U2RA 2R5ZB 2L9NA 4PJLA 4AC0A 3G4SI 1OCTC 5E8GA 1LEAA 3RI4A 2CQNA 2DCEA 2HOSA 1FYKA 5AONA 4PSXA 4L18B 3KFWX 2K9MA 1B8IB 1VQLI 4QIWN 2KRFA 3K1PA 2PX9A 2CRGA 4LG0A 5LHGA 3J80Z 4OIPF 1IZ1A 1RETA 2YX7A 4RDUA 1FSEA 3KCCA 1YW7A 3NWSA 1MBKA 4HF2A 2HI3A 3WTUC 5J8FA 3G73A 2HXOA 3O6BB 3QYBA 3SFZA 5GADJ 3ESWB 3HDDA 1LVAA 4UB6C 2CUJA 1WPKA 2K7LA 2L7KA 4XRFA 5DD4A 2VQHA 3OYKA 4WWCA 4I7HA 1IUYA 4CH7A 3FXRA 3V8KA 4MTEA 5A2QZ 2NS7A 4FE4A 3ASOH 2HTSA 4HOBA 3ABMH 4HF1A 4RGUA 3CCJI 4N0BA 2YR2A 4HNTA 1JJ6C 3OOPA 4I99C 5F6FA 3BG5A 1FSHA 4UVCA 4HRIA 3W3CA 2DN0A 2BW3B 4JX5A 5AIPA 3P9CA 1WH7A 2HFHA 4BDZA 2BE5F 1K4TA 1JKQC 1T6SA 3ML6A 1T98A 4BJTA 5K5OA 1SD6A 2XB5A 1W5SA 2P5LC 4M9XA 2XVCA 1OQYA 1TLHB 3BROA 1Z9CA 2HQRA 2LKSA 2AO9A 5J1YA 1FOKA 2K02A 5HVQC 4E7JA 2PJPA 4BL0B 5DYMA 2RDPA 4BQNA 2FNPA 3H5NA 3BOQA 2JA6J 1DPUA 2XUBA 2UXXA 2XSJC 4AIJA 1T8IA 4UHTA 1R5GA 4DZJA 2BW3A 2GXGA 1APLC 3WG7H 5LRSA 3K1NA 1W7PB 3KYDB 3WHBA 4KICA 3IAM2 1IC8A 3MAJA 3CCVI 4A3LJ 1ETKA 2MW8A 4NC6A 4JQFA 1TQIA 5K7FA 1HXDA 4AU7A 4DNCA 1MMSA 1QO0D 4YRVA 4AIKA 2NXNB 2CUZA 4Y7NJ 3BTCA 2K3PA 4EJUA 4HNVA 2HQAA 2DOAA 3PNYA 1AOYA 3GTJJ 4MLOA 2JA7J 3CLOA 2JMWA 2PLYA 4I0AA 5FKOA 2IEKA 3ASNH 2RN7A 3HPHA 3WHCA 4KNYA 1XMAA 2XRNA 3LSHA 5HS8A 3TO9A 2PI0A 4WF2A 2HVQA 4KT6A 2FXAA 3IWFA 4O5VA 3IUOA 2KRCA 3LSTA 3CDLA 4ENNA 2HVSA 1MW7A 3X2QH 4I6ZA 1I3AA 1HQCA 4QWQA 5HLGA 4BE1A 2LH9A 1IV8A 4C3HJ 3ZQGA 1EH8A 3NRVA 2W1OA 5ED4A 1R1VA 2DJNA 3PNTA 2L7ZA 2KHMA 2NVUB 3E3VA 2F48A 3LSMA 5LEKA 3C7JA 2DA5A 3TOAA 5F0HA 1ZRFA 1K78B 4RB0A 4D7MA 1LEBA 3VYUB 3M07A 5JLWA 2ZMEC 1B59A 3FBIB 3D5LA 1H9GA 3BQZA 2LBFB 5HLIA 3KETA 2IJLA 3QODA 2KIUA 2V4JC 4HZFA 3A4CA 4ON0A 4PJNA 2WV1A 2STWA 1I1SA 1QPIA 3DTKA 1P6RA 4A0ZA 3HOTA 5LHHA 1TQPA 3ZQQA 2EH3A 3NAUA 2JJ7A 2XF7A 1YO5C 4KFCA 3PSIA 4BJ6C 2KDOA 2LNBA 2M4GA 2P81A 1OLTA 1W5TA 1TT5B 4L5EA 1MSFC 3TL4X 3MFKA 3CC7I 2XKPA 1NK2P 1ENHA 1D1CA 2QGUA 4RGRA 4BDYA 4KISA 1RIOH 2J5OA 1PVEA 3IHUA 2BHYA 2HVRA 1WCMJ 3BY6A 4XLCA 3HKZN 2FE3A 2WC2A 4UUTA 3HSRA 2JZYA 2DPUA 4XIDA 2LREA 2O3FA 2LDUA 1B6AA 1K61A 1YRNB 1WJBA 2IA1A 3QWLA 1MBFA 3MMYB 4ZYGA 3E6MA 3IC7A 2D1HA 3PJRA 4LGWA 5CVIA 2X6YA 1DU0A 1FLIA 3FM3A 1SVOA 1XGNA 1D5VA 4RB2C 2GOMA 5M3FJ 2XIGA 4RAZA 4ZYDA 3WG9A 3HZJA 2MSYA 2Z99A 2VI6A 2W48A 1PDNC 2WY7Q 4EVIA 2H1LA 1IRZA 2V6EA 1Z6TA 1TP4A 1X3WB 3BJAA 3DU6A 4CCLA 1SFOJ 3HOZJ 5IT9Z 2HZDA 2CG4A 1U78A 1SVLA 3I4NJ 3BDDA 2VQGA 3H92A 3BLYA 1A31A 1KU3A 1KU9A 4CYCB 1J9IA 4QTRA 1TW3A 5E1WA 4V2FA 5B1AH 4XLNF 5IOYA 5HDNA 1YRNA 2NS0A 2BY3A 3OSFA 2CU7A 2W25A 3VSKA 2YSRA 2DMPA 2HS5A 3BZKA 2IGNA 2NOJB 1HBXG 3ABKH 1V5FA 4HEA2 5E3LA 3H5RA 5K1YA 2GAUA 1RPWA 3MVPA 4GGGA 1Z3YA 1OR7C 3L2UA 3GTQJ 2ELKA 3DBLB 4L9VA 3GLXA 1OYYA 3JTGA 2FQ3A 3LA2A 5DCMB 5IP6A 1S9HA 4Y13A 2DFIA 4MQVA 3SFIA 4BGDA 1DDNA 2K27A 4IF4A 1V5EA 1QQIA 5CVUA 4FE7A 1U8RA 4BYYA 3S1MJ 1MDMA 4UV8A 1KZHA 4OAZA 1V3FA 1LVKA 3VDXA 2KZGA 3WU0A 2W7NA 1F5TA 3KP5A 5HS9A 2PJRB 2ZCWA 2NNNA 2EZKA 2FRHA 3G1LA 5CLSA 4PSWA 2CS3A 4ZZLA 1ZRCA 3ZQFA 3MWMA 4KN7X 4AVPA 4NUBA 2ISZA 3GMEA 2CW8A 4FETA 3SHFA 1BI2A 3I4PA 1KQ8A 1DP3A 2DK8A 3LWFA 4EM0B 5KAFC 3OYJA 1PJRA 3NWTA 3T8RA 1AU7A 1JKRC 3F8MA 2F2EA 1FMWA 1E3HA 4E7ZA 3BJ6A 2GXAA 2RVCA 3ZMVA 1G3SA 4LLNA 2ZKZA 2K5CA 2NRAC 1Y0UA 5EYRA 4RM2A 1YIOA 1BOAA 3JAMZ 4A6DA 1UELB 4A3DJ 1YITI 2L5QA 1BA5A 3BTJA 1JT0A 2PJRA 3CQZJ 2ZNZA 3OYAA 1MNEA 1BW6A 3KP3A 4DQ2A 1VFCA 4Y3OA 1RUNA 2MD0A 5JI6A 3ZXSA 1R4NB 3KP4A 2MH2A 2XAJA 4YFNF 1X19A 1F43A 1SAXA 2CUFA 2L9VA 4EJVA 3DEWA 2RNGA 3DPLC 2A3SA 5F0FA 2AS5F 3D0SA 2R7XA 3JR9A 2VIXA 2EZHA 3H9QA 1YJWI 2FQ4A 4HW0A 4CCOA 3B73A 2E1MB 1JTYA 4EGYA 1D8JA 1A36A 2EIKH 2KDZA 3O2PE 3FXLA 5ILVA 2HPMA 3CO7C 4ZC3A 1QBJA 1YG2A 2X9DA 3IH2A 3Q9VA 2IPQX 3KZIC 2UUZA 1A35A 4XRSG 4MEXF 2VC1A 4XLHA 3ZQCA 1JHFA 2BVLA 5GAGJ 3GX4X 3CD6I 1ZELA 1S7EA 1JUPA 2DAOA 5EEGA 5EF6A 5DUIA 2GLOA 2M7BA 2DA6A 3QU6A 2H8RA 5JHUA 4WXCA 1R36A 3GZNB 2ISYA 2HYGD 1D1AA 2KIFA 3BR2A 5IY5H 2Z3YA 2LY1A 1Z21A 4Y17A 5FGMA 3FMRA 1VI0A 2DT6A 1X1AA 2HKOA 4P9UA 2EILH 4G94A 3CF2A 4RS8A 4A69C 1IDYA 2WA0A 5LEJA 2R7DA 1OCRH 6PAXA 2M8GX 3MCZA 4PJ0C 1YW9A 1YOVB 1YYVA 1Z91A 3GZ6A 2ZBKA 2XAHA 3HSFA 3KYLA 4G6QA 4XKWA 2QUFA 1SD4A 2QKLB 3IP4B 4ESBA 3K7AJ 3CCRI 4ENJA 1JKOC 1HW5A 3F21A 5B1BH 3U1KA 3RYPA 3OYFA 4XONA 3K4JA 3S1QJ 3E0JB 3BR3A 2ADUA 2LC2A 4C2TA 1K79A 2X6XA 5D6EA 5FO5A 3BG7A 3J81Z 2XAUA 1FOXA 1BOBA 1F36A 2YUSA 3H9JA 3HOUJ 3OY9A 3K70C 1OCPA 4M71A 2DMNA 3OOUA 4HX7A 3MZYA 3M3YJ 4NC7A 1T2KA 5D5XB 1BC8C 4B43A 5M5WJ 2O61A 2DA4A 1J7KA 4IOAF 3HG9A 2BZTA 2QEXI 1R22A 1AWCA 3I56I 2XGXA 1SC7A 2M3AA 4R79A 2YPRA 2V9KA 2FBKA 2HNHA 5E3NA 2ZJPF 2AXTC 5EG0B 2E1OA 5KCMA 2CWEA 4KIFA 3QYEA 1QPMA 1WH5A 2D2WA 4L9TA 4PDKA 4FCYA 1BR4A 2OQGA 1FJLA 3O8HA 3OL3A 3DKYA 2R92J 2XAGA 3OIQA 4A3GJ 1P7JA 4Q5SF 2OPTA 2XC7A 3IH4A 4P1WA 4CA0A 3L09A 2E2JJ 3DXJF 3KLOA 5AIQA 2L0KA 3DBHB 4A3KJ 4LOCA 4BUPA 1TWGJ 2HKXA 2JPBA 3EUHA 3HOYJ 4U0VA 2EK5A 2M45A 2EZIA 3IAS2 3OR1C 3UR3C 1ZLJA 2HYFA 3L00A 1YS6A 2X51A 1FY7A 3M8FA 4ZYAA 3CCEI 2ID3A 3HOVJ 1IRXA 3KLNA 3MZHA 2Z2SB 1ZAOA 2BY1A 2HGCA 1IO2A 2M34A 4XQFA 3DTEA 2F5DA 3EUAA 4OMYA 4XORA 4HLXA 2FOKA 1MJAA 1EH6A 2QWWA 5GPCA 3MKYB 4B3AA 3WTTC 5FRMA 3OYBA 2DT7B 1G3YA 1XMXA 4M74A 2ZO4A 2ZFUA 3LQQA 1ZKGA 4HPQA 4ZYHA 1O3SA 1WJEA 2V9VA 3GCMA 4O6JA 4AD9A 2OAZA 3RDIA 2OBPA 4IL6C 3QAHA 3G6EI 2IA2A 4KIBA 1ERDA 2DFEA 2X85A 4J00A 4H0EA 3DLAA 1I5ZA 1P4XA 1SVMA 3H5AA 3MKWB 4HAMA 3BC8A 3S2DJ 5J47A 4IX7A 1ZG1A 1MIJA 3DWLE 1ZTRA 3K9TA 1ZGWA 4M3FA 2DPDA 5FB2A 3OYMA 4PFPA 1P92A 2R7RA 1F1ZA 1A6IA 4BKXA 4BJ5C 4F55A 4DYQA 1KQ9A 1OJLA 1QZEA 2DJIA 4IPAA 1JT6A 3K4CA 3HM5A 1MMDA 4X0GA 2ECCA 1SFEA 3H9GA 4KUMA 3F72A 5DM7F 1BR1A 3MD2A 2BXZA 3I55I 5JHFA 4DW6A 2O8KA 3HYIA 2H8WA 3K2AA 1XD7A 1XGMA 1BC7C 4WCGA 3RCOA 1RI7A 3CCUI 2R7OA 3FBNB 4I98B 1U3EM 1UB9A 4N4OB 3ZQIA 1FZPB 4ESFA 1QGPA 4E7HA 2FF4A 3HUGB 1R6RA 4S0HB 3L2QA 1E0EA 5E79C 5HDKA 2ZSHB 5M3MJ 2JK3A 2VOOA 2L7FP 1BI1A 1T0FA 3HB9A 2HWVA 2K3FA 3HEFA 1N77A 1Y1VJ 1J09A 3JSPA 3ZP5A 4MNUA 1STZA 3OYNA 1USSA 1A04A 2R7SA 5FKMA 4KT5C 1ETVA 4IJAA 2A6HF 4YFXF 4D5FA 2R5YB 3H0GJ 4DBRA 2KP6A 3SYTA 5HODA 2W85A 3K10A 1ZN2A 4LK1F 3FK7A 2JUCA 3K0LA 1FYLA 3A1YA 2R7VA 3HUGA 4AYBA 4YIRX 3GFLA 2YX4A 4RLFA 1Y8QB 3I54A 2JT1A 3QPTA 2XB0X 1SFKA 1WI9A 2AQEA 5H6RA 4UUVA 5EGOA 3AFHA 3CDIA 4HDVA 2QSHX 1XC5A 5DUKA 4I09A 1LE8B 1D5YA 3JRBA 4KIGA 3PQKA 4HV5A 2EWNA 4EJTA 1FBUA 1Q1VA 3C1DA 3FXUA 1ZG5A 2CYYA 3K4MA 3A0BC 3A01B 3ZQHA 5FFZA 4ZDLA 2Y31A 2R5YA 1LB2A 1XCBA 4IO9F 4IEJA 3V8LA 1IN6A 2UXNA 3FHZA 1REPC 3OYDA 3N4MA 2Q8KA 2ZXJA 5FLMJ 3W2WA 4BHPA 3CMYA 1I27A 4G12A 4F7ZA 2DU9A 1I50J 2FD5A 3B6CA 4AUXA 2DMUA 2XF6A 3JREA 2R5ZA 5E17F 2W4SA 2DYRH 1O3TA 2R7UA 2EFPA 4LLGF 1YX5A 3KEOA 1QNTA 2HR3A 2DQLA 1B8IA 1LE8A 1K83J 4YELA 4LIVA 4LD5A 2O7OA 2HQ5A 1AA7A 1GVDA 2IA0A 5L3BA 5GTHC 1VTNC 2VT3A 4XLAA 5TISC 3H3ZA 1K7AA 2M4KA 3ZCOA 2MBFA 4CXFA 1JJ8C 2GOXB 3SQNA 2CV2A 3ERMA 2E34A 1ON1A 2CH0A 1S3JA 2IXSA 3QRFF 3FIWA 2HZTA 1VQOI 5FD6A 3JRDA 4GO1A 3GYHX 2JSCA 2BXYA 1J75A 4EMSA 3FMSA 1CQTA 2DFHA 1U6GA 3HGGA 2LR8A 4N9HA 2P6SA 1T38A 4M3BA 4BEHB 4KYWA 5D4RA 2E1MC 4NQWB 1KQ0A 3CCYA 1FC3A 1Z7LA 2W57A 1IV6A 1XMKA 4B1RA 5C4JJ 4U0YA 1MMGA 2IBDA 2EIMH 3S1NJ 5EEAA 4IHVA 3DQVC 3QU3A 5ILSA 3GFIA 5BQTA 1DUXC 4L0YB 3S3MA 4OINF 1Z6RA 3FKIJ 2VN2A 1MBJA 2EA4A 2NYXA 1NH3A 1HW2A 2GXBA 2PFBA 3D5SC 4AWXB 3KZZA 2O0YA 5L3FA 1BBYA 4MFEA 1YI2I 5CJ9A 3P9IA 4C2UA 2Q2EB 2VQCA 1EJ9A 1ZRDA 3R0AA 4BXUA 4GRIA 2X6WA 1FNNA 5F0CA 1B4AA 1F9NA 1GUUA 2F5EA 3S15J 2JUGA 3M1CA 3R4KA 2BYVE 3VPRA 2JRTA 1UMQA 4BEHA 4M6YA 4MQ9F 4NQWA 1WHUA 1LJ9A 1E17A 2CJJA 2NVXJ 2L4AA 4U7BA 2WB1N 2HOTA 2M8EA 2QVOA 3FZVA 2J5PA 3P5JA 1KYWA 3PM1A 1ETOA 3CUQB 5JLXA 5F1JA 4G6TB 2E5NA 2KRHA 3Q5FA 1FMVA 1NG6A 2XKOA 1JGGA 3EUKL 3SJMA 1TL8A 2K86A 2DT5A 3U1DA 2HQNA 1LQ1A 1KONA 1BI0A 3I4MJ 2DDBA 3TO7A 1W7PA 1O3QA 3DP7A 3BJOA 5LFAA 1D0ZA 4HSRA 4RBOA 1WJAA 2A5YB 4IRHA 2FX0A 2Q2EA 4B48A 5GTIC 4EM1A 2ZC2A 1ULYA 2M0MA 1VZ0A 5KK1A 1B1BA 3RQIA 2ESNA 4D7NA 3K4NA 2XDVA 1GLNA 4XK4A 3I0TA 2JA2A 4OIQF 1BJZA 4G7OF 3EYIA 1SMTA 3CCLI 3EUHC 3F3XA 1P4AA 3QP6A 3M8EA 5KAIC 3F6OA 4QSHA 1XGOA 2EV0A 5TGTA 4P96A 5IYDJ 4L0ZB 5KHDA 3OWTA 1UAAA 3BPVA 2NVYJ 3OYEA 4A0YA 2E7WA 1ORKA 3H3UA 3TQNA 2DI3A 2PEXA 2A05A 4MHGA 1A5JA 3HBLA 5FFXA 1G4DA 3E6CC 2R3SA 4PFOA 3TW6A 4P55A 2EV6A 2FU4A 3DCFA 3NEUA 1CF7B 2VJ4A 2X1EA 4BACA 4LITA 1K78A 4CCJA 1TQMA 4AIDA 3SDBA 1ZR4A 3MN2A 2EFQA 2LBFA 2E19A 4RGSA 3L2VA 3K4BA 1U2WA 4DIQA 3K1MA 3GVAA 2B9SA 2UWMA 2F5VA 2L54A 4UVAA 4HQEA 5A2QK 1X1PA 3HXLA 1VNDA 2VBYA 4D9JA 3UKGA 3JW4A 3RYRA 5LRRA 3CJRB 3I53A 4O3MA 2LYCA 1FT9A 2RNJA 2AQFA 3F0CA 1Q1HA 3ZPLA 2IGMA 3LSKA 2Z1DA 2BOLA 1FEXA 3OR2C 1Y56A 4JP0A 3IL2A 5L3DA 4JX4A 2LF7A 5IT3A 1D8KA 4XKCA 4ZTFA 2MC4A 5GPAA 2G7UA 2FA5A 2COMA 1U5TB 1Y0NA 2QZ8A 3SZTA 4XICA 2WB1A 3M4OJ 1LKXA 1UCRA 5F1RA 4PK4A 3AG1H 3KE2A 3F9KA 4IOCF 4BHCA 5J8CA 2Y30A 1IRGA 5K5QA 2Y48A 4Q48A 1IN7A 1IN5A 1T56A 3GBGA 3FDYA 4LIUA 2QLZA 2OCCH 3ZRGA 4LMYA 4E70A 3HTSB 3TGNA 4DYRA 3ZMUA 4CGZA 3CMAI 2OQRA 2H09A 1EF4A 1T0FC 3S17J 4DGWB 1UZCA 4I0BA 1JUMA 1IUFA 2P8TA 1ETYA 2HXIA 1MNDA 1I6HJ 1YX3A 5L3EA 2E35A 4V19K 1TTYA 2RC4A 4A3JJ 2W82A 3HGYA 3BR5A 3H1CA 3J7AO 2FUG2 1SD7A 2RQPA 4ZDPA 2V9PA 4C9YA 4CYCA 3WE2A 3D1NI 5BS6A 3VSLA 5B66C 1Z05A 4ZTJA 5HS7A 1FP1D 5H20A 3L9FA 4A3CJ 4G7HF 1MH4A 3WGGA 4HA8A 4UVBA 2ID6A 3TOBA 2DA2A 2K9QA 1BN5A 5ERIA 3F6VA 2FNAA 3HHHA 1NK3P 2QQ8A 2JVGA 1SFXA 5DV5A 5F04A 1MGTA 2FJ1A 5GP9A 3ZMTA 4FX4A 4M3EA 1ZR2A 2KLOA 2XPWA 3HHGA 4OWRB 5ILUA 4WX9A 2JSPA 4G8XA 4XL9A 3DKXA 2VKHA 5IYBJ 1ACIA 2DK5A 2OCEA 3TP0A 3R0JA 1XG1A 2L9SA 5DCMA 2O6GE 5CPRB 2HOEA 2R7FA 5CVRA 4XR6A 2Q1ZB 5HOOA 4PJMA 3JRFA 2BY0A 2MFZA 1TT0A 1X1DA 3CCSI 2QSFX 3ABTA 2CW0F 2K4BA 5FLVA 3KYCB 2V26A 5D8LB 1U0JA 2XHKA 2L02A 2P5VA 2CQQA 3S1RJ 2QBYB 4JYKA 1ZH5A 2OTLI 1H9TA 4P5OA 4RLQA 4II2A 2QQBA 2LK2A 4WXHA 1S6LA 4HQMA 2FMLA 1W7PD 3V7SA 3EYYA 2X48A 5J40A 1FOYA 3CESA 2VE9A 5LLQA 1E3PA 1HKSA 4EQQA 1I1GA 5DS9A 3G2BA 2CV1A 1Z3XA 5E3OA 3B02A 3GTKJ 2VQLA 5J4YA 2XPVA 3JRHA 2ZXWH 1W5CC 3BG9A 2G0EA 2E1NA 3R6SA 2Y0SN 4Q4ZF 4YIFA 2MC3A 1X58A 2IVMA 3ZQ7A 3OS0A 3WTVC 1HDDC 1E3OC 3MKZA 4LJZF 3CMEI 1B72B 1RC9A 4Y33A 3TMOA 3OS2A 4DZPA 3QPSA 1WQ2A 2MABA 3W6JB 1KU7A 2HOAA 3N97A 4KN4X 1AKHB 1EA3A 2A68F 4M9SA 3C2GA 3CP2A 2QCOA 3MZ8A 3G3ZA 2FBIA 1T95A 3Q0VA 1JI8A 4WXDA 5IT9K 5LD2C 1YQAA 2DTZA 1FIPA 5BNGA 1GDTA 3PO2J 1Z67A 1FOWA 2VBWA 3GFMA 1YHQI 3DLLF 3ZMDA 2VKDA 2B7EA 4S04A 4L9NA 4E7IA 3SDGA 1K6YA 1NHAA 3CCQI 1B72A 4A5MA 2L01A 5EZHA 1FIAA 3Q0UA 3ZGKA 2V79A 1JKPC 5F27A 4UXNA 5DTDA 5J1RA 3FKJA 1C0WA 4N9IA 1ETQA 2LY9A 1XGSA 1R00A 3AG4H 3VODA 1AKHA 1WZ2A 1IW7F 2I8DA 2F4OB 3MEXA 4BQQA 3H35A 3B6AA 4C2MJ 2UZKA 1MBGA 1X2NA 1Y39A 1ON2A 1OCZH 1XX5A 2RQQA 3F8BA 1LPQA 1UHSA 3PIOF 1IXCA 1S8NA 2KFDA 3JTHA 4I01A 2F4IA 4XN3A 4A3BJ 5HDGA 2EV5A 4ZYEA 2EPFA 2E5ZA 4A0XA 2WAFA 1ZGAA 4D1QA 1ZYRF 4KJZA 3TEDA 2R7ZJ 2YU9J 3IRQA 2BV6A 2ZXHA 3PIPF 4ENKA 4BY7J 2Y2ZA 1X4OA 3L2CA 2GZWA 1ZQ3P 3GWZA 5H6QA 3LMMA 3PQJA 2KPMA 4MO7A 1N75A 1MJ9A 2Y9YA 1IAWA 2ME6A 3VEPA 1IN4A 1BR2A 2K9LA 3BCAA 3HOSA 5E20A 2JQ7A 4F91B 5LGUA 3LFUA 2QM3A 5J6XA 4JOMA 2HDCA 3M7GA 3F8FA 4BAYA 4CO8A 1TW2A 2KMUA 1WJDA 3OMYA 2VOPA 1AHDP 3WTYC 2M1BA 5TRDA 3KPHA 3RIRA 1POGA 1DQUA 1WI3A 1X3ZB 3OSGA 4HSTA 2TCTA 3I59B 2DMTA 3ZMSA 1VQNI 3DV8A 4B8XA 2Y0SA 4XOTA 2ACJA 1Z1DA 3AL0B 3TO6A 3AG3H 1X3UA 2VASA 4RB3C 1ZHFA 1XDSA 4AYBN 5LGTA 4W1UA 1T08B 3SXYA 5EG0A 2L7MP 3GTMJ 1ETXA 1FYMA 3RKQA 3S16J 3L2WA 2DFFA 3OS1A 5M5XJ 5FKLA 1X2MA 1TWFJ 1VF9A 1XCVA 4C3IJ 2LLKA 2XAFA 2XROA 4M3DA 4PZJA 2TRTA 1IG7A 3P7NA 1SANA 4B4CA 1ONVA 2L9RA 2JA5J 2IT0A 3OV8A 1GXPA 2P6TA 5HNHA 2GM4A 1ZK8A 2MH9A 4S05A 3AAFA 1XDUA 1HKTA 4DJAA 3LQRA 4GYIA 3ZN0A 3S2HJ 4MIMA 3D5RC 1BJAA 2MLKA 4WK8F 2JTVA 5FKKA 2LVSA 3GTOJ 2G9WA 1TZLA 2OJED 1P4WA 2IS1A 3DBRB 2Y9ZA 2WAQA 4KITB 2WWYA 3WGIA 2BBYA 4NNJA 3F8CA 4ANJA 3OIPA 4F3QA 2Y0MA 1WVRA 4UUSB 2ZJRF 3I58A 3HTUA 1R49A 1R58A 1BW5A 1J2XA 5E1ZB 3I9V2 1USTA 2MA3A 1H88C 1P2FA 4E7KA 1NTCA 2JA8J 4CCKA 3G1MA 1V54H 4XBFA 3V7RA 4A5NA 2CQ7A 4RMNA 1ZGJA 1WRJA 4KDPA 2Z5UA 3J7ZI 3E97A 2M30A 4KMUX 5F64A 2LOOA 1TWAJ 2K9NA 2HYJA 3JRAA 4F52A 2JN6A 2ZXIA 1W0TA 2WAEA 1EH7A 3PL8A 5JR3A 2V1UA 2GWRA 1VQPI 2VKEA 3IRRA 5C44J 2FMYA 2M5WA 3LSGA 2AXLA 4QLCU 2E36A 3R61A 1F4KA 2ESHA 1IN8A 4OAYA 2A61A 3IV5A 3RKWA 5BPDA 3RTRA 3W2AA 3R60A 5FROA 1FX7A 1Z0XA 2Q0OA 4BE0A 3M8JA 3S2WA 5IP7J 5L3CA 2VJ5A 3OYHA 4G9YA 3J81K 1JXSA 3K4LA 2M2EA 3CTAA 1D0XA 3L1PA 3H3VK 3PNVA 2KZVA 3EQLF 3OYIA 3JRGA 1L0OC 2MYSA 1WJFA 2X1DA 1PP7U 4AIHA 4XOPA 4KMFA 2V1DA 4XKBA 3ERED 3GLLA 1WWXA 2VBZA 2EB7A 1OMIA 1BI3A 1Y8RB 3CO6C 1WFXA 4LG0B 2A5WA 3GEZA 3E6BA 5JVTA 2A6TA 3JRCA 5FD5A 4FASD 1EV7A 2DA7A 4L9JA 5DDGA 2IS6A 5J3LA 4BBRJ 1G8XA 1OKRA 2TDXA 3E1SA 2Z33A 5FLXK 1WJCA 4LB5A 4M3GA 1MMAA 3WE3A 3ZMZA 2EBIA 4A3IJ 3QOEA 3CC2I 1CGPA 4I76A 3C2BA 2NVQJ 3BQYA 3P9KA 1B9MA 1J0RA 3ELKA 2D45A 2COBA 3ZQLA 5HNFA 3CZ6A 1FBSA 3COAC 3DEUA 3FX3A 1W0UA 4HLYA 1LFPA 1HSJA 1U9NA 3I64A 3M1EA 1S5LC 4XM3A 1LFBA 5D5VB 3F8NA 4B47A 2HDWA 3HRUA 4CICA 1HF0A 1MJBA 2WTEA 5D4SA 2DTRA 4XSZF 1HLVA 1XB4A 2YU3A 1WKMA 1FWZA 1L3LA 2VE8A 2NNYA 1QRYA 3PFIA 4U0WA 4ESJA 4Z6YA 3E5XA 3WTSC 1XS9A 4V2GA 2CFOA 4MEYF 2E2IJ 1VQ6I 2IS4A 1S7AA 3BT9A 1B9NA 3A01A 2XGEA 3S32A 1IDZA 3MKLA 1HOMA 3LOCA 1RZ4A 2YS9A 1QZZA 3VOEA 3HRTA 3QYFA 3BZ6A 2A07F 2VONA 3VYTB 4DOZA 3JCUC 2M9HA 5M5YJ 3KIOA 3KP7A 2E60A 2D1VA 2CQXA 4RM3A 3ABLH 2FSWA 2R93J 2O8XA 4OOIA 4IHTA 4R8HA 5FJ8J 2IAIA 2K4JA 2HTJA 3LAPA 3I71A 4BXFA 4B3XA 2DA1A 3BR6A 5KVRA 3A03A 1IF1A 1QVUA 4XLFA 4LK0F 2LG4A 4GCVA 1HC8A 5JFRA 4J01A 3W6KB 5FKNA 4PJJA 3BG3A 4CSWA 2VL8A 5IP9J 2KL4A 5GAEJ 3IKTA 3BCBA 3M9AA 1IXRC 3GTPJ 3RZOJ 2EA2A 4JBAA 2IGKA 2M87A 3DF8A 4N4NB 3EDPA 3FXKA 2E71A 2EINH 5D5UB 4JX6A 3ZR8X 1O4XA 4QPOA 4R1HA 1PYVA 3JRIA 4UNOA 3LSIA 3BR0A 4B44A 3RPQA 2F6CA 2W84A 1TNTA 2KKOA 1T33A 3V4GA 5GAHJ 3HOWJ 3VB2A 5TJJA 1D1BA 1XPXA 1H8AC 4U7DA 4EM2A 4ZDOA 1VQ5I 3ZOBA 4Z2YA 5B5EC 5DEQA 5FRNA 1I39A 4GXOA 3UNGC 2K9SA 1ZLKA 3CMMA 3T0YA 2FOWA 5LGNA 5E3MA 4W97A 3BR1A 2LP0A 3TP3A 1LNWA 2IP2A 1RUOA 2OU2A 5F08A 3F23A 2VLAA 1JTXA 1W36D 3AKZA 2H1KA 3FXJA 1I3QJ 3WU2C 3VFZA 1PUFB 4MFDA 5HLTA 2PMHA 3C3WA 2DBBA 2DMQA 3CLQA 2V6CA 3Q9SA 1XSDA 3PO3J 3MQ0A 4L5IA 5CVVA 3HPGA 2CFXA 3CUQA 2NVTJ 1E2XA 2DXIA 3FISA 1JGSA 1R1UA 3FM5A 4CCMA 4YG2F 2QYOA 3E5QA 1WGXA 4X6AJ 4CYDA 2IW5A 2C6YA 2DA3A 3BTIA 5EZGA 2XSDC 3FMQA 4A2UA 4ASNA 3H0DA 3BTLA 2DOFA 1R5ID 2QQAA 4DBQA 2OTJI 3RPUA 2XPUA 2CUEA 1KYZA 3J80K 4ENMA 3ROUA 1HW1A 5LBQA 4NHJA 1PUFA 1U8BA 3ZN1A 1FTZA 3DPUA 1VQKI 3TDUC 4BQAA 3O8GA 5CQEA 3W6VA 2RREA 1OCOH 1RR7A 1U9OA 4HX8A 2L4MA 1TWHJ 1K6OA 2XGCA 2XAQA 3AL0C 2OZ6A 2DO7A 4CHUA 3WTWC 2PMUA 3ECHA 2XRLA 3FF5A 1ZARA 1ETWA 2F5CA 1HCRA 3U9GA 1R7JA 1LDDA 3GFJA 3A02A 4A12A 2VBXA 1QVTA 2DYSH 4BQOA 2NS8A 2B0LA 3BP8A 9ANTA 2FBHA 2QA4I 1T39A 2M0CA 4IQJA 2FEZA 5J4VA 3ULQB 3RKYA 4I2OA 3WTXC 2H6BA 1O7FA 1KU2A 2VPRA 1W36C 3RZDJ 4BY1J 1CF7A 3RKXA 3LA7A 5K7ZA 4XRSA 2HEOA 3HOXJ 2OZUA 1XN7A 1QU3A 4IZZA 5BOXA 2PQ8A 1QZYA 4LG3A 2X0LA 1DPRA 4OU0A 2IS2A 2PMZN 2OF7A 2MLGA 1BM9A 2EZLA 2W24A 4A6EA 1MKMA 3KP2A 3SEQA 1FTTA 1ZREA 2DW4A 1W4MA 4J19A 2MD5A 2AHQA 5D6FA 4HF0A 1G3TA 3BG6A 2CW7A 2KQRA 3GTLJ 2DLLA 2GIVA 4RB1A 2P7VB 3WODF 1YS7A 2CO5A 4LB6B 1YJ9I 2RKHA 4HDUA 4RAGA 1V4RA 4CZCA 1S7OA 2KT0A 3VYSB 3LNQA 1ZG3A 4A3FJ 4A93J 3CJQB 2RGVA 4HNUA 1S72I 2VKVA 1MDMB 3FHNA 4LLLA 3K4KA 2VC0A 4BHBA 4XRMA 4XLEA 3FWEA 1U5TA 4FT8A 3WTZA 4AVZA 2LFBA 3CC4I 5C4XJ 1MBEA 2I10A 3S8PA 3DTIA 4RAYA 5KNLA 1RESA 4A3EJ 3GF2A 3HJEA 1MMNA 1UG0A 4BXXJ 2R4GA 1LFUP 1DGWY 1IXSB 4MTDA 2RAEA 4YFKF 4ITVA 4II3A 1TNSA 1RKWA 4K2EA 3TKYA 2JVHA 1W1WE 5IYCJ 3LSPA 5DCFA 3NARA 2ETHA 1RR8C 2H6CA 2VXDA 4MGRA 5CKTA 1VQ7I 3BWGA 3OL4A 1HKQA 4Y52J 3WGHA 4UB8C 4BE2A 2VODA 2W00A 2DODA 3TBIA 5EDNA 2P7CB 2HU9A 2Z16A 1DU6A 1GT0C 4UV9A 3A2KA 1G3WA 3KZYA 3WU1B 2ZB9A 2XV4S 3GZ5A 4YIIA 1KA8A 2E7XA 3L7WA 2V1NA 5ICEA 5ICGA 3NQOA 4IRIA 2GQQA 2EFNA 2CMPA 2CSOA 5IOZA 5LHIA 3S14J 1V55H 2P5KA 4NBQA 3KEQA 4I02A 2BHZA 4BH9A 3RQ4A 1BIBA 4GYGA 1M1EB 3AG2H 2QQ9A 4FX0A 2BY2A 3HKZA 3KP6A 2H27A 1D3YA 3S3OA 2E2HJ 4IHWA 1YLFA 2EIJH 3KX2A 1Y1WJ 2WADA 2ZJQF 4EJOA 4PUSA
chains in the Genus database with same CATH topology
4CUGA 2XF7A 3OS1A 3PSIA 4XKVA 3V42A 2KDOA 4BJ6C 2M4GA 3K6GA 2XF6A 3OYGA 3ONQA 2W4SA 1OLTA 3U21A 3TL4X 3DPTA 2R7UA 1YX5A 1D1CA 2PMZA 4BDYA 5HNHA 4KISA 2XF5A 4YELA 4LIVA 2HVRA 1AA7A 4XLCA 3PFYA 4DJAA 3K70D 4XLAA 1QHGA 2M4KA 3ZCOA 3D5RC 2GOXB 2LREA 2CV2A 4Y4RA 1WJBA 2CH0A 3MMYB 2IXSA 1TZLA 3J7AY 2IS1A 2WAQA 3RPUD 4KITB 3PJRA 2X6YA 4NNJA 4IKFA 4ANJA 3OIPA 4F3QA 4BEHB 2GOMA 2E1MC 4NQWB 2WY7Q 1Z7LA 2V6EA 3I9V2 4CCNA 2HPIA 4CCLA 3DU6A 1MMGA 4E7KA 2HZDA 4BS9A 4CCKA 3L2RA 3DQVC 3S3MA 2VQGA 4RMNA 1G59A 4E7SA 3BLYA 4EATA 3D5SC 2LOOA 4F52A 1N78A 2ZXIA 3VSKA 2WAEA 3PL8A 4C2UA 2VB6A 2Q2EB 2VQCA 2IGNA 2VJJA 2X6WA 4GRIA 1X1CA 2JUGA 2NOJB 3M1CA 1V5FA 4HEA2 3N05A 3LSGA 4BEHA 3H5RA 1Z3YA 1OR7C 3L2UA 4OAYA 4U7BA 1SAUA 1NG7A 3RTRA 3W2AA 5FROA 2O5RA 4G6TB 1X4PA 1S9HA 2E5NA 2KRHA 2P0WA 1FMVA 1NG6A 3M8JA 4BGDA 2R7WA 4BE0A 1V5EA 3EUKL 2VJ5A 3VYRB 3OYHA 1KONA 1D0YA 3K4LA 1D0XA 2ZSIB 4U87A 3PNVA 3VWBA 2KZVA 3OYIA 4XNFA 5LFAA 1D0ZA 2MYSA 2X1CA 1WJFA 1LVKA 2R7QA 1WJAA 2X1DA 4HSRA 4OAZA 3VDXA 2W7NA 4XOPA 2VXZA 4B48A 4XKBA 2QKMB 2VJIA 2PJRB 2M7AA 2LRDA 1WFXA 2WBMA 2A5WA 2M0MA 4PSWA 1VZ0A 2CS3A 2V7FA 3SEZA 3RSNA 4ZJZA 4IQ4A 3K4NA 3HC7A 2XDVA 1GLNA 3S3NA 2R7TA 4NUBA 2IGOA 3CP8A 2A6TA 4F93B 2JA2A 2VPLA 2CW8A 4FETA 4FASD 4C30A 1DP3A 2IS6A 3OYJA 1PJRA 3NWTA 3EUHC 1G8XA 3E1SA 1FMWA 4F92B 4E7ZA 1WJCA 1MMAA 5TGTA 2OV7A 4HG2A 3LL7A 3S93A 3QOEA 2K5CA 3OWTA 5KHDA 1UAAA 4RM2A 3OYEA 1UELB 2L5QA 2PJRA 5HNFA 3CZ6A 3OYAA 1MNEA 1LFPA 4PFOA 4QPQA 4Y3OA 2MD0A 4XM3A 4YEJA 3ZXSA 4E7LA 4B47A 1X19A 2HDWA 2VJ4A 2X1EA 4BACA 4LITA 4CCJA 3SDBA 2RNGA 1V5GA 3DPLC 2R7XA 2LBFA 1HA8A 2VIXA 3L2VA 2CFOA 3K4BA 2IS4A 3H9QA 2UWMA 4DIQA 4E4HA 3S32A 2F5VA 4CCOA 2E1MB 2OC6A 4NC8A 3HXLA 4D9JA 3QYFA 4XN0A 1YE9A 3VYTB 2HPMA 4DOZA 3CJRB 4ZC3A 2WY8Q 2E60A 2LYCA 4RM3A 2UUZA 2AQFA 4XLHA 3C2HA 2IGMA 2BVLA 3LSKA 2L2OA 2BOLA 2Z1DA 3OR2C 1Y56A 1ZELA 1Y6IA 4BXFA 3EPZA 4B3XA 4XKCA 2M7BA 4ZTFA 3OYCA 2MC4A 4XLFA 2LG4A 2WB1A 4J01A 4PJJA 3W2VA 1LKXA 4CSWA 2VL8A 5CQGA 1D1AA 2LY1A 4PK4A 2KL4A 3OYLA 3BCBA 3F9KA 1Z21A 2IGKA 2DT6A 4XMYA 4N4NB 1X1AA 3GBGA 2CV0A 3FDYA 4LIUA 3CF2A 3ZRGA 2WA0A 3SZGA 3HL2A 2BVMA 4E6KG 4H4KC 3ZR8X 4QPOA 1PYVA 2ELJA 2OUMA 3LSIA 4B44A 3DU5A 3KYLA 1T0FC 3PSFA 2F6CA 4XKWA 4DGWB 2QKLB 3IP4B 1MNDA 1YX3A 4BU2A 2W82A 1D1BA 2UV1A 1QHHD 3OYFA 4XONA 4ZDOA 2FUG2 3K4JA 3E0JB 4ZDPA 2LC2A 4C9YA 4C2TA 3KEYA 2X6XA 3VSLA 3BG7A 5FRNA 3UNGC 4ZTJA 2XAUA 3CMMA 1LDKB 3DEEA 1P9QC 1BOBA 3H9JA 1DGRM 3OY9A 3K70C 3OOUA 1X1BA 4NC7A 2VLAA 1W36D 2JVGA 4B43A 3AKZA 2KLOA 4OWRB 3HG9A 5HLTA 2JSPA 4XL9A 3DKXA 2VKHA 2M3AA 3I3LA 4R79A 3PUBA 3HPGA 2L9SA 2LY2A 2V9KA 2DXIA 2HNHA 5CPRB 4CCMA 4XR6A 2Q1ZB 5HOOA 1WJ5A 5KCMA 4PJMA 3QYEA 2MFZA 1TT0A 1X1DA 1BR4A 2V26A 3OL3A 3DKYA 1U0JA 3H0DA 2L9NA 3OIQA 4PJLA 2DCEA 2XC7A 4DBQA 4P1WA 4CA0A 4PSXA 2K9MA 4P5OA 4RLQA 4II2A 4BUPA 3DPUA 3IAS2 3OR1C 3UR3C 3NWSA 5CQEA 2X51A 4ZYAA 3CESA 3QYBA 2RREA 1IRXA 2Z2SB 2CUJA 3G2BA 2CV1A 1Z3XA 3AL0C 2L7KA 4XQFA 3DTEA 2VQHA 2VQLA 3OYKA 3EUAA 4CH7A 4XORA 5FRMA 3MKYB 3OYBA 4BQOA 2DT7B 4HNTA 3OS0A 2ZFUA 4HPQA 4IQJA 3MKZA 4HRIA 1WJEA 3W3CA 3TMOA 2BW3B 4Y33A 3OS2A 4BDZA 1W36C 2MABA 1ERDA 2X85A 4BJTA 4J00A 3DLAA 3H5AA 3MKWB 3BC8A 1EA3A 1QU3A 4IX7A 4IZZA 3C2GA 3CP2A 3DWLE 4LG3A 2IS2A 1T95A 1JI8A 3OYMA 4PFPA 3SEQA 5HVQC 4E7JA 4BL0B 2R7RA 5LD2C 4BQNA 3H5NA 3BG6A 4BJ5C 2CW7A 2KQRA 4F55A 2XSJC 2DJIA 2VKDA 3K4CA 4X0GA 1MMDA 4E7IA 1K6YA 3H9GA 1BR1A 3MD2A 2BW3A 3ZGKA 5JHFA 4CZCA 3VYSB 3CJQB 4HNUA 3RCOA 3FKJA 3FHNA 3K4KA 2R7OA 3FBNB 3IAM2 4XLEA 4AVZA 4N4OB 3S8PA 3DTIA 2I8DA 5KNLA 4BQQA 4JQFA 1MMNA 1UG0A 3HUGB 1R6RA 3H35A 4AU7A 4E7HA 2R4GA 3L2QA 1DGWY 1E0EA 4YRVA 2ZSHB 2RQQA 2CUZA 2K3PA 2HQAA 2DOAA 4ITVA 4II3A 3PNYA 1N77A 4XN3A 2F4IA 1J09A 2JVHA 4MLOA 3OYNA 2E5ZA 2WAFA 2R7SA 4D1QA 2VXDA 4KJZA 3HPHA 2ZXHA 5CKTA 3OL4A 1X4OA 4DBRA 2KP6A 3LMMA 3LSHA 3SYTA 2KPMA 1N75A 4BE2A 2HVQA 3K10A 4KT6A 2W00A 3TBIA 1BR2A 2K9LA 3BCAA 3IUOA 3HOSA 2KRCA 2HU9A 2Z16A 2HVSA 1MW7A 3A1YA 2R7VA 3A2KA 4F91B 4AYBA 3LFUA 4BE1A 2LH9A 4JOMA 4RLFA 2W1OA 1SFKA 2AQEA 2V1NA 3PNTA 2KMUA 2KHMA 1WJDA 3LSMA 3OMYA 3AFHA 2CMPA 3VYUB 1DQUA 3FBIB 3D5LA 4HSTA 2LBFB 3RQ4A 2Y0SA 4XOTA 3QODA 3AL0B 2V4JC 3K4MA 4ZDLA 3A4CA 2VASA 4PJNA 3HKZA 3OYDA 3S3OA 3W2WA 3KX2A 3DTKA 3HOTA 2WADA 3ZQQA 3L2WA 4PUSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NC7 A;  4NC8 A;  2M4K A;  2KRC A; 
#chains in the Genus database with same CATH topology
 4CUG A;  3REO A;  4G6D A;  2OD5 A;  4XKV A;  3V42 A;  3K6G A;  3OYG A;  5ICC A;  3ONQ A;  4IHX A;  1MD0 A;  3FXO A;  3U21 A;  2ECB A;  3DPT A;  2PBI A;  2QBY A;  2BEO A;  2G7H A;  3G71 I;  4Y15 A;  5IPA A;  2PMZ A;  2JWT A;  4UY8 I;  5DM6 F;  1MH3 A;  2XF5 A;  4M72 A;  5C3E J;  1RKT A;  1VQM I;  3K70 D;  3PFY A;  1IGN A;  2A6E F;  4FTH A;  1QHG A;  3HRM A;  2LKP A;  3QPL A;  3IH3 A;  4Y4R A;  2ICW G;  4RGX A;  3CDH A;  3SZP A;  1J59 A;  3CCM I;  3J7A Y;  2K85 A;  3T8T A;  3RPU D;  4ABZ A;  4PGG A;  5K7H A;  1H0M A;  1GVJ A;  3TW7 A;  4B09 A;  5D5W B;  4IKF A;  1Z7U A;  3JSO A;  4P9F A;  1HDP A;  5E1X A;  3E7L A;  2D5V A;  1UFM A;  1DP7 P;  1IJW C;  1ITY A;  2KJC A;  1UG2 A;  4CCN A;  4M9Z A;  2HPI A;  4X1E A;  4EGZ A;  3FXQ A;  1BL0 A;  4BS9 A;  5E18 F;  3ABU A;  3LSJ A;  4A3M J;  2H94 A;  3L2R A;  2NOG A;  2QEN A;  3E6D A;  3O3K A;  2EQR A;  1PP8 F;  2N8G A;  1G59 A;  4E7S A;  1YTY A;  5ICF A;  4EAT A;  2LSO A;  3GTG J;  2WAQ N;  2KIQ A;  3FK6 A;  2Y75 A;  4PGH A;  4XLP F;  2O03 A;  1N78 A;  1G6N A;  4LFU A;  1TBX A;  2VB6 A;  3ECO A;  4L5J A;  2GA2 A;  4ZZD A;  1YFH A;  1OPC A;  2VJJ A;  2STT A;  1LDJ A;  1X1C A;  2ZFW A;  2V1X A;  2CGP A;  1O57 A;  3N05 A;  1N25 A;  4TV7 A;  3K2Z A;  1LUJ B;  1XSV A;  5L3G A;  1SAU A;  3BZC A;  1NG7 A;  3T1B A;  5K5R A;  4CZZ A;  3QOP A;  1OIS A;  4ZH4 F;  2O5R A;  1R71 A;  1X4P A;  5H2F C;  1OCC H;  2P0W A;  2R7W A;  2ME0 A;  1S29 A;  1SFU A;  4KA4 A;  3VYR B;  4FQG A;  1D0Y A;  1JHH A;  2ZSI B;  4U87 A;  3VWB A;  1YW8 A;  3CUQ C;  3I5U A;  2MG4 A;  4XNF A;  4GDF A;  2X1C A;  2DOE A;  1VQ9 I;  2VUM J;  2R7Q A;  3PUF A;  2GBY A;  1VQ4 I;  2VXZ A;  3GW2 A;  1GV2 A;  3GO5 A;  3CUO A;  2QKM B;  2VJI A;  3F22 A;  5JVG F;  3LFK A;  1RRJ A;  4G7Z F;  3CJN A;  1TC3 C;  2M7A A;  2LRD A;  3IWZ A;  2QF7 A;  2WBM A;  2ZME B;  2JPC A;  4D0P A;  2V7F A;  3SEZ A;  3RSN A;  4ZJZ A;  5BMZ A;  2X4H A;  1HST A;  4IQ4 A;  3HC7 A;  3V7C A;  4BNC A;  3S3N A;  2R7T A;  3J7Y J;  1BIA A;  2I5U A;  2IGO A;  2F4M B;  3CP8 A;  4F93 B;  4HYE A;  4IHS A;  2VPL A;  3CF5 F;  4C30 A;  1SEU A;  2LMD A;  2CQK A;  2A69 F;  2ELH A;  4F92 B;  3BPX A;  4ETS A;  1R5H A;  2LF8 A;  4IVN A;  2OV7 A;  2KIS A;  5FLX Z;  3HSE A;  4HG2 A;  1MBH A;  3LL7 A;  3S93 A;  3JAM K;  3LSR A;  1GXQ A;  1VQ8 I;  4EV0 A;  4FIS A;  3GXO A;  4RA2 A;  1MZB A;  1JUS A;  4EJW A;  1UHM A;  2ZME A;  4QPQ A;  2Z9O A;  3FXM A;  4YEJ A;  4E7L A;  1FPQ A;  4M6V A;  3EET A;  4OMZ A;  1GHC A;  1H89 C;  4M73 A;  3K69 A;  3OIO A;  1V5G A;  4IXA A;  5BPI A;  3I59 A;  1HA8 A;  2R0Q C;  2ZNY A;  3ISP A;  3Q0W A;  1FP2 A;  1J5Y A;  1P7I A;  2X6O A;  4E4H A;  2XAS A;  3QPH A;  1YJN I;  2OC6 A;  4NC8 A;  3G1O A;  3GUD A;  4XN0 A;  1YE9 A;  1XSX A;  5EEH A;  4HX4 A;  4DYC A;  4OIO F;  2WY8 Q;  1UHW A;  3RJP A;  1SD5 A;  3TDZ C;  1I6X A;  1YIJ I;  3C2H A;  2EFW A;  2L2O A;  4BBS J;  4XSX F;  3IKV A;  4C3J J;  1Y6I A;  3EPZ A;  1R1T A;  4EEF G;  4NDL A;  1G2H A;  2PN6 A;  3OYC A;  2LD5 A;  1PUE E;  4JK1 X;  1UJ8 A;  2EFO A;  4PCQ A;  1OYW A;  3LAJ A;  2QSG X;  2EJR A;  2VT2 A;  2IRF G;  2LKX A;  1QA6 A;  3W2V A;  2OA4 A;  1FBQ A;  5B3S H;  5CQG A;  5DD8 A;  1A6Q A;  3OYL A;  1ODD A;  1R23 A;  4CDG A;  1U5T C;  5CVJ A;  4XMY A;  3E5U A;  2CV0 A;  1GV5 A;  2WV0 A;  2GIZ A;  3SZG A;  3HL2 A;  2BVM A;  5E8I A;  1MSE C;  4E6K G;  1R4M B;  4H4K C;  1WSU A;  1KGS A;  2ELJ A;  3DFG A;  2OUM A;  4UUS A;  1R9T J;  2B63 J;  3DU5 A;  4Q47 A;  2PG4 A;  4GFB A;  1EKE A;  4HV6 A;  3PSF A;  4HBL A;  3QP5 A;  3Q3S A;  1TWC J;  4U88 A;  5D8K B;  1IRF A;  3C18 A;  1RNL A;  4BU2 A;  1Z77 A;  1OYI A;  2UV1 A;  1QHH D;  3V8J A;  2BGC A;  3H36 A;  2JRM A;  5EJC A;  2DDA A;  2L3D A;  4OIR F;  2P4W A;  3KEY A;  3CJT B;  3DKW A;  2ZJ2 A;  4RAF A;  1K4S A;  2KJB A;  1LDK B;  3DEE A;  5CYV A;  4IHY A;  1P9Q C;  1MNM C;  1DGR M;  2MGQ A;  4IRG A;  1OR7 A;  3QQA A;  4FHT A;  1X1B A;  5EGO B;  2RV8 A;  2LTP A;  3LA3 A;  3HIF A;  1OFC X;  4AM3 A;  2E1C A;  2NAZ A;  4M6X A;  1SMY F;  2K40 A;  2GA1 A;  2O9L A;  2F5F A;  2KIM A;  1O7L A;  4NB5 A;  3I3L A;  3PUB A;  5HLH A;  3A0H C;  2HDD A;  5J1U A;  3T5X A;  2LY2 A;  2DQR A;  1WJ5 A;  1JE8 A;  1O3R A;  1XTA A;  4D5C A;  2XGD A;  2Y69 H;  3HRS A;  3U2R A;  2R5Z B;  2L9N A;  4PJL A;  4AC0 A;  3G4S I;  1OCT C;  5E8G A;  1LEA A;  3RI4 A;  2CQN A;  2DCE A;  2HOS A;  1FYK A;  5AON A;  4PSX A;  4L18 B;  3KFW X;  2K9M A;  1B8I B;  1VQL I;  4QIW N;  2KRF A;  3K1P A;  2PX9 A;  2CRG A;  4LG0 A;  5LHG A;  3J80 Z;  4OIP F;  1IZ1 A;  1RET A;  2YX7 A;  4RDU A;  1FSE A;  3KCC A;  1YW7 A;  3NWS A;  1MBK A;  4HF2 A;  2HI3 A;  3WTU C;  5J8F A;  3G73 A;  2HXO A;  3O6B B;  3QYB A;  3SFZ A;  5GAD J;  3ESW B;  3HDD A;  1LVA A;  4UB6 C;  2CUJ A;  1WPK A;  2K7L A;  2L7K A;  4XRF A;  5DD4 A;  2VQH A;  3OYK A;  4WWC A;  4I7H A;  1IUY A;  4CH7 A;  3FXR A;  3V8K A;  4MTE A;  5A2Q Z;  2NS7 A;  4FE4 A;  3ASO H;  2HTS A;  4HOB A;  3ABM H;  4HF1 A;  4RGU A;  3CCJ I;  4N0B A;  2YR2 A;  4HNT A;  1JJ6 C;  3OOP A;  4I99 C;  5F6F A;  3BG5 A;  1FSH A;  4UVC A;  4HRI A;  3W3C A;  2DN0 A;  2BW3 B;  4JX5 A;  5AIP A;  3P9C A;  1WH7 A;  2HFH A;  4BDZ A;  2BE5 F;  1K4T A;  1JKQ C;  1T6S A;  3ML6 A;  1T98 A;  4BJT A;  5K5O A;  1SD6 A;  2XB5 A;  1W5S A;  2P5L C;  4M9X A;  2XVC A;  1OQY A;  1TLH B;  3BRO A;  1Z9C A;  2HQR A;  2LKS A;  2AO9 A;  5J1Y A;  1FOK A;  2K02 A;  5HVQ C;  4E7J A;  2PJP A;  4BL0 B;  5DYM A;  2RDP A;  4BQN A;  2FNP A;  3H5N A;  3BOQ A;  2JA6 J;  1DPU A;  2XUB A;  2UXX A;  2XSJ C;  4AIJ A;  1T8I A;  4UHT A;  1R5G A;  4DZJ A;  2BW3 A;  2GXG A;  1APL C;  3WG7 H;  5LRS A;  3K1N A;  1W7P B;  3KYD B;  3WHB A;  4KIC A;  3IAM 2;  1IC8 A;  3MAJ A;  3CCV I;  4A3L J;  1ETK A;  2MW8 A;  4NC6 A;  4JQF A;  1TQI A;  5K7F A;  1HXD A;  4AU7 A;  4DNC A;  1MMS A;  1QO0 D;  4YRV A;  4AIK A;  2NXN B;  2CUZ A;  4Y7N J;  3BTC A;  2K3P A;  4EJU A;  4HNV A;  2HQA A;  2DOA A;  3PNY A;  1AOY A;  3GTJ J;  4MLO A;  2JA7 J;  3CLO A;  2JMW A;  2PLY A;  4I0A A;  5FKO A;  2IEK A;  3ASN H;  2RN7 A;  3HPH A;  3WHC A;  4KNY A;  1XMA A;  2XRN A;  3LSH A;  5HS8 A;  3TO9 A;  2PI0 A;  4WF2 A;  2HVQ A;  4KT6 A;  2FXA A;  3IWF A;  4O5V A;  3IUO A;  2KRC A;  3LST A;  3CDL A;  4ENN A;  2HVS A;  1MW7 A;  3X2Q H;  4I6Z A;  1I3A A;  1HQC A;  4QWQ A;  5HLG A;  4BE1 A;  2LH9 A;  1IV8 A;  4C3H J;  3ZQG A;  1EH8 A;  3NRV A;  2W1O A;  5ED4 A;  1R1V A;  2DJN A;  3PNT A;  2L7Z A;  2KHM A;  2NVU B;  3E3V A;  2F48 A;  3LSM A;  5LEK A;  3C7J A;  2DA5 A;  3TOA A;  5F0H A;  1ZRF A;  1K78 B;  4RB0 A;  4D7M A;  1LEB A;  3VYU B;  3M07 A;  5JLW A;  2ZME C;  1B59 A;  3FBI B;  3D5L A;  1H9G A;  3BQZ A;  2LBF B;  5HLI A;  3KET A;  2IJL A;  3QOD A;  2KIU A;  2V4J C;  4HZF A;  3A4C A;  4ON0 A;  4PJN A;  2WV1 A;  2STW A;  1I1S A;  1QPI A;  3DTK A;  1P6R A;  4A0Z A;  3HOT A;  5LHH A;  1TQP A;  3ZQQ A;  2EH3 A;  3NAU A;  2JJ7 A;  2XF7 A;  1YO5 C;  4KFC A;  3PSI A;  4BJ6 C;  2KDO A;  2LNB A;  2M4G A;  2P81 A;  1OLT A;  1W5T A;  1TT5 B;  4L5E A;  1MSF C;  3TL4 X;  3MFK A;  3CC7 I;  2XKP A;  1NK2 P;  1ENH A;  1D1C A;  2QGU A;  4RGR A;  4BDY A;  4KIS A;  1RIO H;  2J5O A;  1PVE A;  3IHU A;  2BHY A;  2HVR A;  1WCM J;  3BY6 A;  4XLC A;  3HKZ N;  2FE3 A;  2WC2 A;  4UUT A;  3HSR A;  2JZY A;  2DPU A;  4XID A;  2LRE A;  2O3F A;  2LDU A;  1B6A A;  1K61 A;  1YRN B;  1WJB A;  2IA1 A;  3QWL A;  1MBF A;  3MMY B;  4ZYG A;  3E6M A;  3IC7 A;  2D1H A;  3PJR A;  4LGW A;  5CVI A;  2X6Y A;  1DU0 A;  1FLI A;  3FM3 A;  1SVO A;  1XGN A;  1D5V A;  4RB2 C;  2GOM A;  5M3F J;  2XIG A;  4RAZ A;  4ZYD A;  3WG9 A;  3HZJ A;  2MSY A;  2Z99 A;  2VI6 A;  2W48 A;  1PDN C;  2WY7 Q;  4EVI A;  2H1L A;  1IRZ A;  2V6E A;  1Z6T A;  1TP4 A;  1X3W B;  3BJA A;  3DU6 A;  4CCL A;  1SFO J;  3HOZ J;  5IT9 Z;  2HZD A;  2CG4 A;  1U78 A;  1SVL A;  3I4N J;  3BDD A;  2VQG A;  3H92 A;  3BLY A;  1A31 A;  1KU3 A;  1KU9 A;  4CYC B;  1J9I A;  4QTR A;  1TW3 A;  5E1W A;  4V2F A;  5B1A H;  4XLN F;  5IOY A;  5HDN A;  1YRN A;  2NS0 A;  2BY3 A;  3OSF A;  2CU7 A;  2W25 A;  3VSK A;  2YSR A;  2DMP A;  2HS5 A;  3BZK A;  2IGN A;  2NOJ B;  1HBX G;  3ABK H;  1V5F A;  4HEA 2;  5E3L A;  3H5R A;  5K1Y A;  2GAU A;  1RPW A;  3MVP A;  4GGG A;  1Z3Y A;  1OR7 C;  3L2U A;  3GTQ J;  2ELK A;  3DBL B;  4L9V A;  3GLX A;  1OYY A;  3JTG A;  2FQ3 A;  3LA2 A;  5DCM B;  5IP6 A;  1S9H A;  4Y13 A;  2DFI A;  4MQV A;  3SFI A;  4BGD A;  1DDN A;  2K27 A;  4IF4 A;  1V5E A;  1QQI A;  5CVU A;  4FE7 A;  1U8R A;  4BYY A;  3S1M J;  1MDM A;  4UV8 A;  1KZH A;  4OAZ A;  1V3F A;  1LVK A;  3VDX A;  2KZG A;  3WU0 A;  2W7N A;  1F5T A;  3KP5 A;  5HS9 A;  2PJR B;  2ZCW A;  2NNN A;  2EZK A;  2FRH A;  3G1L A;  5CLS A;  4PSW A;  2CS3 A;  4ZZL A;  1ZRC A;  3ZQF A;  3MWM A;  4KN7 X;  4AVP A;  4NUB A;  2ISZ A;  3GME A;  2CW8 A;  4FET A;  3SHF A;  1BI2 A;  3I4P A;  1KQ8 A;  1DP3 A;  2DK8 A;  3LWF A;  4EM0 B;  5KAF C;  3OYJ A;  1PJR A;  3NWT A;  3T8R A;  1AU7 A;  1JKR C;  3F8M A;  2F2E A;  1FMW A;  1E3H A;  4E7Z A;  3BJ6 A;  2GXA A;  2RVC A;  3ZMV A;  1G3S A;  4LLN A;  2ZKZ A;  2K5C A;  2NRA C;  1Y0U A;  5EYR A;  4RM2 A;  1YIO A;  1BOA A;  3JAM Z;  4A6D A;  1UEL B;  4A3D J;  1YIT I;  2L5Q A;  1BA5 A;  3BTJ A;  1JT0 A;  2PJR A;  3CQZ J;  2ZNZ A;  3OYA A;  1MNE A;  1BW6 A;  3KP3 A;  4DQ2 A;  1VFC A;  4Y3O A;  1RUN A;  2MD0 A;  5JI6 A;  3ZXS A;  1R4N B;  3KP4 A;  2MH2 A;  2XAJ A;  4YFN F;  1X19 A;  1F43 A;  1SAX A;  2CUF A;  2L9V A;  4EJV A;  3DEW A;  2RNG A;  3DPL C;  2A3S A;  5F0F A;  2AS5 F;  3D0S A;  2R7X A;  3JR9 A;  2VIX A;  2EZH A;  3H9Q A;  1YJW I;  2FQ4 A;  4HW0 A;  4CCO A;  3B73 A;  2E1M B;  1JTY A;  4EGY A;  1D8J A;  1A36 A;  2EIK H;  2KDZ A;  3O2P E;  3FXL A;  5ILV A;  2HPM A;  3CO7 C;  4ZC3 A;  1QBJ A;  1YG2 A;  2X9D A;  3IH2 A;  3Q9V A;  2IPQ X;  3KZI C;  2UUZ A;  1A35 A;  4XRS G;  4MEX F;  2VC1 A;  4XLH A;  3ZQC A;  1JHF A;  2BVL A;  5GAG J;  3GX4 X;  3CD6 I;  1ZEL A;  1S7E A;  1JUP A;  2DAO A;  5EEG A;  5EF6 A;  5DUI A;  2GLO A;  2M7B A;  2DA6 A;  3QU6 A;  2H8R A;  5JHU A;  4WXC A;  1R36 A;  3GZN B;  2ISY A;  2HYG D;  1D1A A;  2KIF A;  3BR2 A;  5IY5 H;  2Z3Y A;  2LY1 A;  1Z21 A;  4Y17 A;  5FGM A;  3FMR A;  1VI0 A;  2DT6 A;  1X1A A;  2HKO A;  4P9U A;  2EIL H;  4G94 A;  3CF2 A;  4RS8 A;  4A69 C;  1IDY A;  2WA0 A;  5LEJ A;  2R7D A;  1OCR H;  6PAX A;  2M8G X;  3MCZ A;  4PJ0 C;  1YW9 A;  1YOV B;  1YYV A;  1Z91 A;  3GZ6 A;  2ZBK A;  2XAH A;  3HSF A;  3KYL A;  4G6Q A;  4XKW A;  2QUF A;  1SD4 A;  2QKL B;  3IP4 B;  4ESB A;  3K7A J;  3CCR I;  4ENJ A;  1JKO C;  1HW5 A;  3F21 A;  5B1B H;  3U1K A;  3RYP A;  3OYF A;  4XON A;  3K4J A;  3S1Q J;  3E0J B;  3BR3 A;  2ADU A;  2LC2 A;  4C2T A;  1K79 A;  2X6X A;  5D6E A;  5FO5 A;  3BG7 A;  3J81 Z;  2XAU A;  1FOX A;  1BOB A;  1F36 A;  2YUS A;  3H9J A;  3HOU J;  3OY9 A;  3K70 C;  1OCP A;  4M71 A;  2DMN A;  3OOU A;  4HX7 A;  3MZY A;  3M3Y J;  4NC7 A;  1T2K A;  5D5X B;  1BC8 C;  4B43 A;  5M5W J;  2O61 A;  2DA4 A;  1J7K A;  4IOA F;  3HG9 A;  2BZT A;  2QEX I;  1R22 A;  1AWC A;  3I56 I;  2XGX A;  1SC7 A;  2M3A A;  4R79 A;  2YPR A;  2V9K A;  2FBK A;  2HNH A;  5E3N A;  2ZJP F;  2AXT C;  5EG0 B;  2E1O A;  5KCM A;  2CWE A;  4KIF A;  3QYE A;  1QPM A;  1WH5 A;  2D2W A;  4L9T A;  4PDK A;  4FCY A;  1BR4 A;  2OQG A;  1FJL A;  3O8H A;  3OL3 A;  3DKY A;  2R92 J;  2XAG A;  3OIQ A;  4A3G J;  1P7J A;  4Q5S F;  2OPT A;  2XC7 A;  3IH4 A;  4P1W A;  4CA0 A;  3L09 A;  2E2J J;  3DXJ F;  3KLO A;  5AIQ A;  2L0K A;  3DBH B;  4A3K J;  4LOC A;  4BUP A;  1TWG J;  2HKX A;  2JPB A;  3EUH A;  3HOY J;  4U0V A;  2EK5 A;  2M45 A;  2EZI A;  3IAS 2;  3OR1 C;  3UR3 C;  1ZLJ A;  2HYF A;  3L00 A;  1YS6 A;  2X51 A;  1FY7 A;  3M8F A;  4ZYA A;  3CCE I;  2ID3 A;  3HOV J;  1IRX A;  3KLN A;  3MZH A;  2Z2S B;  1ZAO A;  2BY1 A;  2HGC A;  1IO2 A;  2M34 A;  4XQF A;  3DTE A;  2F5D A;  3EUA A;  4OMY A;  4XOR A;  4HLX A;  2FOK A;  1MJA A;  1EH6 A;  2QWW A;  5GPC A;  3MKY B;  4B3A A;  3WTT C;  5FRM A;  3OYB A;  2DT7 B;  1G3Y A;  1XMX A;  4M74 A;  2ZO4 A;  2ZFU A;  3LQQ A;  1ZKG A;  4HPQ A;  4ZYH A;  1O3S A;  1WJE A;  2V9V A;  3GCM A;  4O6J A;  4AD9 A;  2OAZ A;  3RDI A;  2OBP A;  4IL6 C;  3QAH A;  3G6E I;  2IA2 A;  4KIB A;  1ERD A;  2DFE A;  2X85 A;  4J00 A;  4H0E A;  3DLA A;  1I5Z A;  1P4X A;  1SVM A;  3H5A A;  3MKW B;  4HAM A;  3BC8 A;  3S2D J;  5J47 A;  4IX7 A;  1ZG1 A;  1MIJ A;  3DWL E;  1ZTR A;  3K9T A;  1ZGW A;  4M3F A;  2DPD A;  5FB2 A;  3OYM A;  4PFP A;  1P92 A;  2R7R A;  1F1Z A;  1A6I A;  4BKX A;  4BJ5 C;  4F55 A;  4DYQ A;  1KQ9 A;  1OJL A;  1QZE A;  2DJI A;  4IPA A;  1JT6 A;  3K4C A;  3HM5 A;  1MMD A;  4X0G A;  2ECC A;  1SFE A;  3H9G A;  4KUM A;  3F72 A;  5DM7 F;  1BR1 A;  3MD2 A;  2BXZ A;  3I55 I;  5JHF A;  4DW6 A;  2O8K A;  3HYI A;  2H8W A;  3K2A A;  1XD7 A;  1XGM A;  1BC7 C;  4WCG A;  3RCO A;  1RI7 A;  3CCU I;  2R7O A;  3FBN B;  4I98 B;  1U3E M;  1UB9 A;  4N4O B;  3ZQI A;  1FZP B;  4ESF A;  1QGP A;  4E7H A;  2FF4 A;  3HUG B;  1R6R A;  4S0H B;  3L2Q A;  1E0E A;  5E79 C;  5HDK A;  2ZSH B;  5M3M J;  2JK3 A;  2VOO A;  2L7F P;  1BI1 A;  1T0F A;  3HB9 A;  2HWV A;  2K3F A;  3HEF A;  1N77 A;  1Y1V J;  1J09 A;  3JSP A;  3ZP5 A;  4MNU A;  1STZ A;  3OYN A;  1USS A;  1A04 A;  2R7S A;  5FKM A;  4KT5 C;  1ETV A;  4IJA A;  2A6H F;  4YFX F;  4D5F A;  2R5Y B;  3H0G J;  4DBR A;  2KP6 A;  3SYT A;  5HOD A;  2W85 A;  3K10 A;  1ZN2 A;  4LK1 F;  3FK7 A;  2JUC A;  3K0L A;  1FYL A;  3A1Y A;  2R7V A;  3HUG A;  4AYB A;  4YIR X;  3GFL A;  2YX4 A;  4RLF A;  1Y8Q B;  3I54 A;  2JT1 A;  3QPT A;  2XB0 X;  1SFK A;  1WI9 A;  2AQE A;  5H6R A;  4UUV A;  5EGO A;  3AFH A;  3CDI A;  4HDV A;  2QSH X;  1XC5 A;  5DUK A;  4I09 A;  1LE8 B;  1D5Y A;  3JRB A;  4KIG A;  3PQK A;  4HV5 A;  2EWN A;  4EJT A;  1FBU A;  1Q1V A;  3C1D A;  3FXU A;  1ZG5 A;  2CYY A;  3K4M A;  3A0B C;  3A01 B;  3ZQH A;  5FFZ A;  4ZDL A;  2Y31 A;  2R5Y A;  1LB2 A;  1XCB A;  4IO9 F;  4IEJ A;  3V8L A;  1IN6 A;  2UXN A;  3FHZ A;  1REP C;  3OYD A;  3N4M A;  2Q8K A;  2ZXJ A;  5FLM J;  3W2W A;  4BHP A;  3CMY A;  1I27 A;  4G12 A;  4F7Z A;  2DU9 A;  1I50 J;  2FD5 A;  3B6C A;  4AUX A;  2DMU A;  2XF6 A;  3JRE A;  2R5Z A;  5E17 F;  2W4S A;  2DYR H;  1O3T A;  2R7U A;  2EFP A;  4LLG F;  1YX5 A;  3KEO A;  1QNT A;  2HR3 A;  2DQL A;  1B8I A;  1LE8 A;  1K83 J;  4YEL A;  4LIV A;  4LD5 A;  2O7O A;  2HQ5 A;  1AA7 A;  1GVD A;  2IA0 A;  5L3B A;  5GTH C;  1VTN C;  2VT3 A;  4XLA A;  5TIS C;  3H3Z A;  1K7A A;  2M4K A;  3ZCO A;  2MBF A;  4CXF A;  1JJ8 C;  2GOX B;  3SQN A;  2CV2 A;  3ERM A;  2E34 A;  1ON1 A;  2CH0 A;  1S3J A;  2IXS A;  3QRF F;  3FIW A;  2HZT A;  1VQO I;  5FD6 A;  3JRD A;  4GO1 A;  3GYH X;  2JSC A;  2BXY A;  1J75 A;  4EMS A;  3FMS A;  1CQT A;  2DFH A;  1U6G A;  3HGG A;  2LR8 A;  4N9H A;  2P6S A;  1T38 A;  4M3B A;  4BEH B;  4KYW A;  5D4R A;  2E1M C;  4NQW B;  1KQ0 A;  3CCY A;  1FC3 A;  1Z7L A;  2W57 A;  1IV6 A;  1XMK A;  4B1R A;  5C4J J;  4U0Y A;  1MMG A;  2IBD A;  2EIM H;  3S1N J;  5EEA A;  4IHV A;  3DQV C;  3QU3 A;  5ILS A;  3GFI A;  5BQT A;  1DUX C;  4L0Y B;  3S3M A;  4OIN F;  1Z6R A;  3FKI J;  2VN2 A;  1MBJ A;  2EA4 A;  2NYX A;  1NH3 A;  1HW2 A;  2GXB A;  2PFB A;  3D5S C;  4AWX B;  3KZZ A;  2O0Y A;  5L3F A;  1BBY A;  4MFE A;  1YI2 I;  5CJ9 A;  3P9I A;  4C2U A;  2Q2E B;  2VQC A;  1EJ9 A;  1ZRD A;  3R0A A;  4BXU A;  4GRI A;  2X6W A;  1FNN A;  5F0C A;  1B4A A;  1F9N A;  1GUU A;  2F5E A;  3S15 J;  2JUG A;  3M1C A;  3R4K A;  2BYV E;  3VPR A;  2JRT A;  1UMQ A;  4BEH A;  4M6Y A;  4MQ9 F;  4NQW A;  1WHU A;  1LJ9 A;  1E17 A;  2CJJ A;  2NVX J;  2L4A A;  4U7B A;  2WB1 N;  2HOT A;  2M8E A;  2QVO A;  3FZV A;  2J5P A;  3P5J A;  1KYW A;  3PM1 A;  1ETO A;  3CUQ B;  5JLX A;  5F1J A;  4G6T B;  2E5N A;  2KRH A;  3Q5F A;  1FMV A;  1NG6 A;  2XKO A;  1JGG A;  3EUK L;  3SJM A;  1TL8 A;  2K86 A;  2DT5 A;  3U1D A;  2HQN A;  1LQ1 A;  1KON A;  1BI0 A;  3I4M J;  2DDB A;  3TO7 A;  1W7P A;  1O3Q A;  3DP7 A;  3BJO A;  5LFA A;  1D0Z A;  4HSR A;  4RBO A;  1WJA A;  2A5Y B;  4IRH A;  2FX0 A;  2Q2E A;  4B48 A;  5GTI C;  4EM1 A;  2ZC2 A;  1ULY A;  2M0M A;  1VZ0 A;  5KK1 A;  1B1B A;  3RQI A;  2ESN A;  4D7N A;  3K4N A;  2XDV A;  1GLN A;  4XK4 A;  3I0T A;  2JA2 A;  4OIQ F;  1BJZ A;  4G7O F;  3EYI A;  1SMT A;  3CCL I;  3EUH C;  3F3X A;  1P4A A;  3QP6 A;  3M8E A;  5KAI C;  3F6O A;  4QSH A;  1XGO A;  2EV0 A;  5TGT A;  4P96 A;  5IYD J;  4L0Z B;  5KHD A;  3OWT A;  1UAA A;  3BPV A;  2NVY J;  3OYE A;  4A0Y A;  2E7W A;  1ORK A;  3H3U A;  3TQN A;  2DI3 A;  2PEX A;  2A05 A;  4MHG A;  1A5J A;  3HBL A;  5FFX A;  1G4D A;  3E6C C;  2R3S A;  4PFO A;  3TW6 A;  4P55 A;  2EV6 A;  2FU4 A;  3DCF A;  3NEU A;  1CF7 B;  2VJ4 A;  2X1E A;  4BAC A;  4LIT A;  1K78 A;  4CCJ A;  1TQM A;  4AID A;  3SDB A;  1ZR4 A;  3MN2 A;  2EFQ A;  2LBF A;  2E19 A;  4RGS A;  3L2V A;  3K4B A;  1U2W A;  4DIQ A;  3K1M A;  3GVA A;  2B9S A;  2UWM A;  2F5V A;  2L54 A;  4UVA A;  4HQE A;  5A2Q K;  1X1P A;  3HXL A;  1VND A;  2VBY A;  4D9J A;  3UKG A;  3JW4 A;  3RYR A;  5LRR A;  3CJR B;  3I53 A;  4O3M A;  2LYC A;  1FT9 A;  2RNJ A;  2AQF A;  3F0C A;  1Q1H A;  3ZPL A;  2IGM A;  3LSK A;  2Z1D A;  2BOL A;  1FEX A;  3OR2 C;  1Y56 A;  4JP0 A;  3IL2 A;  5L3D A;  4JX4 A;  2LF7 A;  5IT3 A;  1D8K A;  4XKC A;  4ZTF A;  2MC4 A;  5GPA A;  2G7U A;  2FA5 A;  2COM A;  1U5T B;  1Y0N A;  2QZ8 A;  3SZT A;  4XIC A;  2WB1 A;  3M4O J;  1LKX A;  1UCR A;  5F1R A;  4PK4 A;  3AG1 H;  3KE2 A;  3F9K A;  4IOC F;  4BHC A;  5J8C A;  2Y30 A;  1IRG A;  5K5Q A;  2Y48 A;  4Q48 A;  1IN7 A;  1IN5 A;  1T56 A;  3GBG A;  3FDY A;  4LIU A;  2QLZ A;  2OCC H;  3ZRG A;  4LMY A;  4E70 A;  3HTS B;  3TGN A;  4DYR A;  3ZMU A;  4CGZ A;  3CMA I;  2OQR A;  2H09 A;  1EF4 A;  1T0F C;  3S17 J;  4DGW B;  1UZC A;  4I0B A;  1JUM A;  1IUF A;  2P8T A;  1ETY A;  2HXI A;  1MND A;  1I6H J;  1YX3 A;  5L3E A;  2E35 A;  4V19 K;  1TTY A;  2RC4 A;  4A3J J;  2W82 A;  3HGY A;  3BR5 A;  3H1C A;  3J7A O;  2FUG 2;  1SD7 A;  2RQP A;  4ZDP A;  2V9P A;  4C9Y A;  4CYC A;  3WE2 A;  3D1N I;  5BS6 A;  3VSL A;  5B66 C;  1Z05 A;  4ZTJ A;  5HS7 A;  1FP1 D;  5H20 A;  3L9F A;  4A3C J;  4G7H F;  1MH4 A;  3WGG A;  4HA8 A;  4UVB A;  2ID6 A;  3TOB A;  2DA2 A;  2K9Q A;  1BN5 A;  5ERI A;  3F6V A;  2FNA A;  3HHH A;  1NK3 P;  2QQ8 A;  2JVG A;  1SFX A;  5DV5 A;  5F04 A;  1MGT A;  2FJ1 A;  5GP9 A;  3ZMT A;  4FX4 A;  4M3E A;  1ZR2 A;  2KLO A;  2XPW A;  3HHG A;  4OWR B;  5ILU A;  4WX9 A;  2JSP A;  4G8X A;  4XL9 A;  3DKX A;  2VKH A;  5IYB J;  1ACI A;  2DK5 A;  2OCE A;  3TP0 A;  3R0J A;  1XG1 A;  2L9S A;  5DCM A;  2O6G E;  5CPR B;  2HOE A;  2R7F A;  5CVR A;  4XR6 A;  2Q1Z B;  5HOO A;  4PJM A;  3JRF A;  2BY0 A;  2MFZ A;  1TT0 A;  1X1D A;  3CCS I;  2QSF X;  3ABT A;  2CW0 F;  2K4B A;  5FLV A;  3KYC B;  2V26 A;  5D8L B;  1U0J A;  2XHK A;  2L02 A;  2P5V A;  2CQQ A;  3S1R J;  2QBY B;  4JYK A;  1ZH5 A;  2OTL I;  1H9T A;  4P5O A;  4RLQ A;  4II2 A;  2QQB A;  2LK2 A;  4WXH A;  1S6L A;  4HQM A;  2FML A;  1W7P D;  3V7S A;  3EYY A;  2X48 A;  5J40 A;  1FOY A;  3CES A;  2VE9 A;  5LLQ A;  1E3P A;  1HKS A;  4EQQ A;  1I1G A;  5DS9 A;  3G2B A;  2CV1 A;  1Z3X A;  5E3O A;  3B02 A;  3GTK J;  2VQL A;  5J4Y A;  2XPV A;  3JRH A;  2ZXW H;  1W5C C;  3BG9 A;  2G0E A;  2E1N A;  3R6S A;  2Y0S N;  4Q4Z F;  4YIF A;  2MC3 A;  1X58 A;  2IVM A;  3ZQ7 A;  3OS0 A;  3WTV C;  1HDD C;  1E3O C;  3MKZ A;  4LJZ F;  3CME I;  1B72 B;  1RC9 A;  4Y33 A;  3TMO A;  3OS2 A;  4DZP A;  3QPS A;  1WQ2 A;  2MAB A;  3W6J B;  1KU7 A;  2HOA A;  3N97 A;  4KN4 X;  1AKH B;  1EA3 A;  2A68 F;  4M9S A;  3C2G A;  3CP2 A;  2QCO A;  3MZ8 A;  3G3Z A;  2FBI A;  1T95 A;  3Q0V A;  1JI8 A;  4WXD A;  5IT9 K;  5LD2 C;  1YQA A;  2DTZ A;  1FIP A;  5BNG A;  1GDT A;  3PO2 J;  1Z67 A;  1FOW A;  2VBW A;  3GFM A;  1YHQ I;  3DLL F;  3ZMD A;  2VKD A;  2B7E A;  4S04 A;  4L9N A;  4E7I A;  3SDG A;  1K6Y A;  1NHA A;  3CCQ I;  1B72 A;  4A5M A;  2L01 A;  5EZH A;  1FIA A;  3Q0U A;  3ZGK A;  2V79 A;  1JKP C;  5F27 A;  4UXN A;  5DTD A;  5J1R A;  3FKJ A;  1C0W A;  4N9I A;  1ETQ A;  2LY9 A;  1XGS A;  1R00 A;  3AG4 H;  3VOD A;  1AKH A;  1WZ2 A;  1IW7 F;  2I8D A;  2F4O B;  3MEX A;  4BQQ A;  3H35 A;  3B6A A;  4C2M J;  2UZK A;  1MBG A;  1X2N A;  1Y39 A;  1ON2 A;  1OCZ H;  1XX5 A;  2RQQ A;  3F8B A;  1LPQ A;  1UHS A;  3PIO F;  1IXC A;  1S8N A;  2KFD A;  3JTH A;  4I01 A;  2F4I A;  4XN3 A;  4A3B J;  5HDG A;  2EV5 A;  4ZYE A;  2EPF A;  2E5Z A;  4A0X A;  2WAF A;  1ZGA A;  4D1Q A;  1ZYR F;  4KJZ A;  3TED A;  2R7Z J;  2YU9 J;  3IRQ A;  2BV6 A;  2ZXH A;  3PIP F;  4ENK A;  4BY7 J;  2Y2Z A;  1X4O A;  3L2C A;  2GZW A;  1ZQ3 P;  3GWZ A;  5H6Q A;  3LMM A;  3PQJ A;  2KPM A;  4MO7 A;  1N75 A;  1MJ9 A;  2Y9Y A;  1IAW A;  2ME6 A;  3VEP A;  1IN4 A;  1BR2 A;  2K9L A;  3BCA A;  3HOS A;  5E20 A;  2JQ7 A;  4F91 B;  5LGU A;  3LFU A;  2QM3 A;  5J6X A;  4JOM A;  2HDC A;  3M7G A;  3F8F A;  4BAY A;  4CO8 A;  1TW2 A;  2KMU A;  1WJD A;  3OMY A;  2VOP A;  1AHD P;  3WTY C;  2M1B A;  5TRD A;  3KPH A;  3RIR A;  1POG A;  1DQU A;  1WI3 A;  1X3Z B;  3OSG A;  4HST A;  2TCT A;  3I59 B;  2DMT A;  3ZMS A;  1VQN I;  3DV8 A;  4B8X A;  2Y0S A;  4XOT A;  2ACJ A;  1Z1D A;  3AL0 B;  3TO6 A;  3AG3 H;  1X3U A;  2VAS A;  4RB3 C;  1ZHF A;  1XDS A;  4AYB N;  5LGT A;  4W1U A;  1T08 B;  3SXY A;  5EG0 A;  2L7M P;  3GTM J;  1ETX A;  1FYM A;  3RKQ A;  3S16 J;  3L2W A;  2DFF A;  3OS1 A;  5M5X J;  5FKL A;  1X2M A;  1TWF J;  1VF9 A;  1XCV A;  4C3I J;  2LLK A;  2XAF A;  2XRO A;  4M3D A;  4PZJ A;  2TRT A;  1IG7 A;  3P7N A;  1SAN A;  4B4C A;  1ONV A;  2L9R A;  2JA5 J;  2IT0 A;  3OV8 A;  1GXP A;  2P6T A;  5HNH A;  2GM4 A;  1ZK8 A;  2MH9 A;  4S05 A;  3AAF A;  1XDU A;  1HKT A;  4DJA A;  3LQR A;  4GYI A;  3ZN0 A;  3S2H J;  4MIM A;  3D5R C;  1BJA A;  2MLK A;  4WK8 F;  2JTV A;  5FKK A;  2LVS A;  3GTO J;  2G9W A;  1TZL A;  2OJE D;  1P4W A;  2IS1 A;  3DBR B;  2Y9Z A;  2WAQ A;  4KIT B;  2WWY A;  3WGI A;  2BBY A;  4NNJ A;  3F8C A;  4ANJ A;  3OIP A;  4F3Q A;  2Y0M A;  1WVR A;  4UUS B;  2ZJR F;  3I58 A;  3HTU A;  1R49 A;  1R58 A;  1BW5 A;  1J2X A;  5E1Z B;  3I9V 2;  1UST A;  2MA3 A;  1H88 C;  1P2F A;  4E7K A;  1NTC A;  2JA8 J;  4CCK A;  3G1M A;  1V54 H;  4XBF A;  3V7R A;  4A5N A;  2CQ7 A;  4RMN A;  1ZGJ A;  1WRJ A;  4KDP A;  2Z5U A;  3J7Z I;  3E97 A;  2M30 A;  4KMU X;  5F64 A;  2LOO A;  1TWA J;  2K9N A;  2HYJ A;  3JRA A;  4F52 A;  2JN6 A;  2ZXI A;  1W0T A;  2WAE A;  1EH7 A;  3PL8 A;  5JR3 A;  2V1U A;  2GWR A;  1VQP I;  2VKE A;  3IRR A;  5C44 J;  2FMY A;  2M5W A;  3LSG A;  2AXL A;  4QLC U;  2E36 A;  3R61 A;  1F4K A;  2ESH A;  1IN8 A;  4OAY A;  2A61 A;  3IV5 A;  3RKW A;  5BPD A;  3RTR A;  3W2A A;  3R60 A;  5FRO A;  1FX7 A;  1Z0X A;  2Q0O A;  4BE0 A;  3M8J A;  3S2W A;  5IP7 J;  5L3C A;  2VJ5 A;  3OYH A;  4G9Y A;  3J81 K;  1JXS A;  3K4L A;  2M2E A;  3CTA A;  1D0X A;  3L1P A;  3H3V K;  3PNV A;  2KZV A;  3EQL F;  3OYI A;  3JRG A;  1L0O C;  2MYS A;  1WJF A;  2X1D A;  1PP7 U;  4AIH A;  4XOP A;  4KMF A;  2V1D A;  4XKB A;  3ERE D;  3GLL A;  1WWX A;  2VBZ A;  2EB7 A;  1OMI A;  1BI3 A;  1Y8R B;  3CO6 C;  1WFX A;  4LG0 B;  2A5W A;  3GEZ A;  3E6B A;  5JVT A;  2A6T A;  3JRC A;  5FD5 A;  4FAS D;  1EV7 A;  2DA7 A;  4L9J A;  5DDG A;  2IS6 A;  5J3L A;  4BBR J;  1G8X A;  1OKR A;  2TDX A;  3E1S A;  2Z33 A;  5FLX K;  1WJC A;  4LB5 A;  4M3G A;  1MMA A;  3WE3 A;  3ZMZ A;  2EBI A;  4A3I J;  3QOE A;  3CC2 I;  1CGP A;  4I76 A;  3C2B A;  2NVQ J;  3BQY A;  3P9K A;  1B9M A;  1J0R A;  3ELK A;  2D45 A;  2COB A;  3ZQL A;  5HNF A;  3CZ6 A;  1FBS A;  3COA C;  3DEU A;  3FX3 A;  1W0U A;  4HLY A;  1LFP A;  1HSJ A;  1U9N A;  3I64 A;  3M1E A;  1S5L C;  4XM3 A;  1LFB A;  5D5V B;  3F8N A;  4B47 A;  2HDW A;  3HRU A;  4CIC A;  1HF0 A;  1MJB A;  2WTE A;  5D4S A;  2DTR A;  4XSZ F;  1HLV A;  1XB4 A;  2YU3 A;  1WKM A;  1FWZ A;  1L3L A;  2VE8 A;  2NNY A;  1QRY A;  3PFI A;  4U0W A;  4ESJ A;  4Z6Y A;  3E5X A;  3WTS C;  1XS9 A;  4V2G A;  2CFO A;  4MEY F;  2E2I J;  1VQ6 I;  2IS4 A;  1S7A A;  3BT9 A;  1B9N A;  3A01 A;  2XGE A;  3S32 A;  1IDZ A;  3MKL A;  1HOM A;  3LOC A;  1RZ4 A;  2YS9 A;  1QZZ A;  3VOE A;  3HRT A;  3QYF A;  3BZ6 A;  2A07 F;  2VON A;  3VYT B;  4DOZ A;  3JCU C;  2M9H A;  5M5Y J;  3KIO A;  3KP7 A;  2E60 A;  2D1V A;  2CQX A;  4RM3 A;  3ABL H;  2FSW A;  2R93 J;  2O8X A;  4OOI A;  4IHT A;  4R8H A;  5FJ8 J;  2IAI A;  2K4J A;  2HTJ A;  3LAP A;  3I71 A;  4BXF A;  4B3X A;  2DA1 A;  3BR6 A;  5KVR A;  3A03 A;  1IF1 A;  1QVU A;  4XLF A;  4LK0 F;  2LG4 A;  4GCV A;  1HC8 A;  5JFR A;  4J01 A;  3W6K B;  5FKN A;  4PJJ A;  3BG3 A;  4CSW A;  2VL8 A;  5IP9 J;  2KL4 A;  5GAE J;  3IKT A;  3BCB A;  3M9A A;  1IXR C;  3GTP J;  3RZO J;  2EA2 A;  4JBA A;  2IGK A;  2M87 A;  3DF8 A;  4N4N B;  3EDP A;  3FXK A;  2E71 A;  2EIN H;  5D5U B;  4JX6 A;  3ZR8 X;  1O4X A;  4QPO A;  4R1H A;  1PYV A;  3JRI A;  4UNO A;  3LSI A;  3BR0 A;  4B44 A;  3RPQ A;  2F6C A;  2W84 A;  1TNT A;  2KKO A;  1T33 A;  3V4G A;  5GAH J;  3HOW J;  3VB2 A;  5TJJ A;  1D1B A;  1XPX A;  1H8A C;  4U7D A;  4EM2 A;  4ZDO A;  1VQ5 I;  3ZOB A;  4Z2Y A;  5B5E C;  5DEQ A;  5FRN A;  1I39 A;  4GXO A;  3UNG C;  2K9S A;  1ZLK A;  3CMM A;  3T0Y A;  2FOW A;  5LGN A;  5E3M A;  4W97 A;  3BR1 A;  2LP0 A;  3TP3 A;  1LNW A;  2IP2 A;  1RUO A;  2OU2 A;  5F08 A;  3F23 A;  2VLA A;  1JTX A;  1W36 D;  3AKZ A;  2H1K A;  3FXJ A;  1I3Q J;  3WU2 C;  3VFZ A;  1PUF B;  4MFD A;  5HLT A;  2PMH A;  3C3W A;  2DBB A;  2DMQ A;  3CLQ A;  2V6C A;  3Q9S A;  1XSD A;  3PO3 J;  3MQ0 A;  4L5I A;  5CVV A;  3HPG A;  2CFX A;  3CUQ A;  2NVT J;  1E2X A;  2DXI A;  3FIS A;  1JGS A;  1R1U A;  3FM5 A;  4CCM A;  4YG2 F;  2QYO A;  3E5Q A;  1WGX A;  4X6A J;  4CYD A;  2IW5 A;  2C6Y A;  2DA3 A;  3BTI A;  5EZG A;  2XSD C;  3FMQ A;  4A2U A;  4ASN A;  3H0D A;  3BTL A;  2DOF A;  1R5I D;  2QQA A;  4DBQ A;  2OTJ I;  3RPU A;  2XPU A;  2CUE A;  1KYZ A;  3J80 K;  4ENM A;  3ROU A;  1HW1 A;  5LBQ A;  4NHJ A;  1PUF A;  1U8B A;  3ZN1 A;  1FTZ A;  3DPU A;  1VQK I;  3TDU C;  4BQA A;  3O8G A;  5CQE A;  3W6V A;  2RRE A;  1OCO H;  1RR7 A;  1U9O A;  4HX8 A;  2L4M A;  1TWH J;  1K6O A;  2XGC A;  2XAQ A;  3AL0 C;  2OZ6 A;  2DO7 A;  4CHU A;  3WTW C;  2PMU A;  3ECH A;  2XRL A;  3FF5 A;  1ZAR A;  1ETW A;  2F5C A;  1HCR A;  3U9G A;  1R7J A;  1LDD A;  3GFJ A;  3A02 A;  4A12 A;  2VBX A;  1QVT A;  2DYS H;  4BQO A;  2NS8 A;  2B0L A;  3BP8 A;  9ANT A;  2FBH A;  2QA4 I;  1T39 A;  2M0C A;  4IQJ A;  2FEZ A;  5J4V A;  3ULQ B;  3RKY A;  4I2O A;  3WTX C;  2H6B A;  1O7F A;  1KU2 A;  2VPR A;  1W36 C;  3RZD J;  4BY1 J;  1CF7 A;  3RKX A;  3LA7 A;  5K7Z A;  4XRS A;  2HEO A;  3HOX J;  2OZU A;  1XN7 A;  1QU3 A;  4IZZ A;  5BOX A;  2PQ8 A;  1QZY A;  4LG3 A;  2X0L A;  1DPR A;  4OU0 A;  2IS2 A;  2PMZ N;  2OF7 A;  2MLG A;  1BM9 A;  2EZL A;  2W24 A;  4A6E A;  1MKM A;  3KP2 A;  3SEQ A;  1FTT A;  1ZRE A;  2DW4 A;  1W4M A;  4J19 A;  2MD5 A;  2AHQ A;  5D6F A;  4HF0 A;  1G3T A;  3BG6 A;  2CW7 A;  2KQR A;  3GTL J;  2DLL A;  2GIV A;  4RB1 A;  2P7V B;  3WOD F;  1YS7 A;  2CO5 A;  4LB6 B;  1YJ9 I;  2RKH A;  4HDU A;  4RAG A;  1V4R A;  4CZC A;  1S7O A;  2KT0 A;  3VYS B;  3LNQ A;  1ZG3 A;  4A3F J;  4A93 J;  3CJQ B;  2RGV A;  4HNU A;  1S72 I;  2VKV A;  1MDM B;  3FHN A;  4LLL A;  3K4K A;  2VC0 A;  4BHB A;  4XRM A;  4XLE A;  3FWE A;  1U5T A;  4FT8 A;  3WTZ A;  4AVZ A;  2LFB A;  3CC4 I;  5C4X J;  1MBE A;  2I10 A;  3S8P A;  3DTI A;  4RAY A;  5KNL A;  1RES A;  4A3E J;  3GF2 A;  3HJE A;  1MMN A;  1UG0 A;  4BXX J;  2R4G A;  1LFU P;  1DGW Y;  1IXS B;  4MTD A;  2RAE A;  4YFK F;  4ITV A;  4II3 A;  1TNS A;  1RKW A;  4K2E A;  3TKY A;  2JVH A;  1W1W E;  5IYC J;  3LSP A;  5DCF A;  3NAR A;  2ETH A;  1RR8 C;  2H6C A;  2VXD A;  4MGR A;  5CKT A;  1VQ7 I;  3BWG A;  3OL4 A;  1HKQ A;  4Y52 J;  3WGH A;  4UB8 C;  4BE2 A;  2VOD A;  2W00 A;  2DOD A;  3TBI A;  5EDN A;  2P7C B;  2HU9 A;  2Z16 A;  1DU6 A;  1GT0 C;  4UV9 A;  3A2K A;  1G3W A;  3KZY A;  3WU1 B;  2ZB9 A;  2XV4 S;  3GZ5 A;  4YII A;  1KA8 A;  2E7X A;  3L7W A;  2V1N A;  5ICE A;  5ICG A;  3NQO A;  4IRI A;  2GQQ A;  2EFN A;  2CMP A;  2CSO A;  5IOZ A;  5LHI A;  3S14 J;  1V55 H;  2P5K A;  4NBQ A;  3KEQ A;  4I02 A;  2BHZ A;  4BH9 A;  3RQ4 A;  1BIB A;  4GYG A;  1M1E B;  3AG2 H;  2QQ9 A;  4FX0 A;  2BY2 A;  3HKZ A;  3KP6 A;  2H27 A;  1D3Y A;  3S3O A;  2E2H J;  4IHW A;  1YLF A;  2EIJ H;  3KX2 A;  1Y1W J;  2WAD A;  2ZJQ F;  4EJO A;  4PUS A; 
#chains in the Genus database with same CATH homology
 4CUG A;  2XF7 A;  3OS1 A;  3PSI A;  4XKV A;  3V42 A;  2KDO A;  4BJ6 C;  2M4G A;  3K6G A;  2XF6 A;  3OYG A;  3ONQ A;  2W4S A;  1OLT A;  3U21 A;  3TL4 X;  3DPT A;  2R7U A;  1YX5 A;  1D1C A;  2PMZ A;  4BDY A;  5HNH A;  4KIS A;  2XF5 A;  4YEL A;  4LIV A;  2HVR A;  1AA7 A;  4XLC A;  3PFY A;  4DJA A;  3K70 D;  4XLA A;  1QHG A;  2M4K A;  3ZCO A;  3D5R C;  2GOX B;  2LRE A;  2CV2 A;  4Y4R A;  1WJB A;  2CH0 A;  3MMY B;  2IXS A;  1TZL A;  3J7A Y;  2IS1 A;  2WAQ A;  3RPU D;  4KIT B;  3PJR A;  2X6Y A;  4NNJ A;  4IKF A;  4ANJ A;  3OIP A;  4F3Q A;  4BEH B;  2GOM A;  2E1M C;  4NQW B;  2WY7 Q;  1Z7L A;  2V6E A;  3I9V 2;  4CCN A;  2HPI A;  4CCL A;  3DU6 A;  1MMG A;  4E7K A;  2HZD A;  4BS9 A;  4CCK A;  3L2R A;  3DQV C;  3S3M A;  2VQG A;  4RMN A;  1G59 A;  4E7S A;  3BLY A;  4EAT A;  3D5S C;  2LOO A;  4F52 A;  1N78 A;  2ZXI A;  3VSK A;  2WAE A;  3PL8 A;  4C2U A;  2VB6 A;  2Q2E B;  2VQC A;  2IGN A;  2VJJ A;  2X6W A;  4GRI A;  1X1C A;  2JUG A;  2NOJ B;  3M1C A;  1V5F A;  4HEA 2;  3N05 A;  3LSG A;  4BEH A;  3H5R A;  1Z3Y A;  1OR7 C;  3L2U A;  4OAY A;  4U7B A;  1SAU A;  1NG7 A;  3RTR A;  3W2A A;  5FRO A;  2O5R A;  4G6T B;  1X4P A;  1S9H A;  2E5N A;  2KRH A;  2P0W A;  1FMV A;  1NG6 A;  3M8J A;  4BGD A;  2R7W A;  4BE0 A;  1V5E A;  3EUK L;  2VJ5 A;  3VYR B;  3OYH A;  1KON A;  1D0Y A;  3K4L A;  1D0X A;  2ZSI B;  4U87 A;  3PNV A;  3VWB A;  2KZV A;  3OYI A;  4XNF A;  5LFA A;  1D0Z A;  2MYS A;  2X1C A;  1WJF A;  1LVK A;  2R7Q A;  1WJA A;  2X1D A;  4HSR A;  4OAZ A;  3VDX A;  2W7N A;  4XOP A;  2VXZ A;  4B48 A;  4XKB A;  2QKM B;  2VJI A;  2PJR B;  2M7A A;  2LRD A;  1WFX A;  2WBM A;  2A5W A;  2M0M A;  4PSW A;  1VZ0 A;  2CS3 A;  2V7F A;  3SEZ A;  3RSN A;  4ZJZ A;  4IQ4 A;  3K4N A;  3HC7 A;  2XDV A;  1GLN A;  3S3N A;  2R7T A;  4NUB A;  2IGO A;  3CP8 A;  2A6T A;  4F93 B;  2JA2 A;  2VPL A;  2CW8 A;  4FET A;  4FAS D;  4C30 A;  1DP3 A;  2IS6 A;  3OYJ A;  1PJR A;  3NWT A;  3EUH C;  1G8X A;  3E1S A;  1FMW A;  4F92 B;  4E7Z A;  1WJC A;  1MMA A;  5TGT A;  2OV7 A;  4HG2 A;  3LL7 A;  3S93 A;  3QOE A;  2K5C A;  3OWT A;  5KHD A;  1UAA A;  4RM2 A;  3OYE A;  1UEL B;  2L5Q A;  2PJR A;  5HNF A;  3CZ6 A;  3OYA A;  1MNE A;  1LFP A;  4PFO A;  4QPQ A;  4Y3O A;  2MD0 A;  4XM3 A;  4YEJ A;  3ZXS A;  4E7L A;  4B47 A;  1X19 A;  2HDW A;  2VJ4 A;  2X1E A;  4BAC A;  4LIT A;  4CCJ A;  3SDB A;  2RNG A;  1V5G A;  3DPL C;  2R7X A;  2LBF A;  1HA8 A;  2VIX A;  3L2V A;  2CFO A;  3K4B A;  2IS4 A;  3H9Q A;  2UWM A;  4DIQ A;  4E4H A;  3S32 A;  2F5V A;  4CCO A;  2E1M B;  2OC6 A;  4NC8 A;  3HXL A;  4D9J A;  3QYF A;  4XN0 A;  1YE9 A;  3VYT B;  2HPM A;  4DOZ A;  3CJR B;  4ZC3 A;  2WY8 Q;  2E60 A;  2LYC A;  4RM3 A;  2UUZ A;  2AQF A;  4XLH A;  3C2H A;  2IGM A;  2BVL A;  3LSK A;  2L2O A;  2BOL A;  2Z1D A;  3OR2 C;  1Y56 A;  1ZEL A;  1Y6I A;  4BXF A;  3EPZ A;  4B3X A;  4XKC A;  2M7B A;  4ZTF A;  3OYC A;  2MC4 A;  4XLF A;  2LG4 A;  2WB1 A;  4J01 A;  4PJJ A;  3W2V A;  1LKX A;  4CSW A;  2VL8 A;  5CQG A;  1D1A A;  2LY1 A;  4PK4 A;  2KL4 A;  3OYL A;  3BCB A;  3F9K A;  1Z21 A;  2IGK A;  2DT6 A;  4XMY A;  4N4N B;  1X1A A;  3GBG A;  2CV0 A;  3FDY A;  4LIU A;  3CF2 A;  3ZRG A;  2WA0 A;  3SZG A;  3HL2 A;  2BVM A;  4E6K G;  4H4K C;  3ZR8 X;  4QPO A;  1PYV A;  2ELJ A;  2OUM A;  3LSI A;  4B44 A;  3DU5 A;  3KYL A;  1T0F C;  3PSF A;  2F6C A;  4XKW A;  4DGW B;  2QKL B;  3IP4 B;  1MND A;  1YX3 A;  4BU2 A;  2W82 A;  1D1B A;  2UV1 A;  1QHH D;  3OYF A;  4XON A;  4ZDO A;  2FUG 2;  3K4J A;  3E0J B;  4ZDP A;  2LC2 A;  4C9Y A;  4C2T A;  3KEY A;  2X6X A;  3VSL A;  3BG7 A;  5FRN A;  3UNG C;  4ZTJ A;  2XAU A;  3CMM A;  1LDK B;  3DEE A;  1P9Q C;  1BOB A;  3H9J A;  1DGR M;  3OY9 A;  3K70 C;  3OOU A;  1X1B A;  4NC7 A;  2VLA A;  1W36 D;  2JVG A;  4B43 A;  3AKZ A;  2KLO A;  4OWR B;  3HG9 A;  5HLT A;  2JSP A;  4XL9 A;  3DKX A;  2VKH A;  2M3A A;  3I3L A;  4R79 A;  3PUB A;  3HPG A;  2L9S A;  2LY2 A;  2V9K A;  2DXI A;  2HNH A;  5CPR B;  4CCM A;  4XR6 A;  2Q1Z B;  5HOO A;  1WJ5 A;  5KCM A;  4PJM A;  3QYE A;  2MFZ A;  1TT0 A;  1X1D A;  1BR4 A;  2V26 A;  3OL3 A;  3DKY A;  1U0J A;  3H0D A;  2L9N A;  3OIQ A;  4PJL A;  2DCE A;  2XC7 A;  4DBQ A;  4P1W A;  4CA0 A;  4PSX A;  2K9M A;  4P5O A;  4RLQ A;  4II2 A;  4BUP A;  3DPU A;  3IAS 2;  3OR1 C;  3UR3 C;  3NWS A;  5CQE A;  2X51 A;  4ZYA A;  3CES A;  3QYB A;  2RRE A;  1IRX A;  2Z2S B;  2CUJ A;  3G2B A;  2CV1 A;  1Z3X A;  3AL0 C;  2L7K A;  4XQF A;  3DTE A;  2VQH A;  2VQL A;  3OYK A;  3EUA A;  4CH7 A;  4XOR A;  5FRM A;  3MKY B;  3OYB A;  4BQO A;  2DT7 B;  4HNT A;  3OS0 A;  2ZFU A;  4HPQ A;  4IQJ A;  3MKZ A;  4HRI A;  1WJE A;  3W3C A;  3TMO A;  2BW3 B;  4Y33 A;  3OS2 A;  4BDZ A;  1W36 C;  2MAB A;  1ERD A;  2X85 A;  4BJT A;  4J00 A;  3DLA A;  3H5A A;  3MKW B;  3BC8 A;  1EA3 A;  1QU3 A;  4IX7 A;  4IZZ A;  3C2G A;  3CP2 A;  3DWL E;  4LG3 A;  2IS2 A;  1T95 A;  1JI8 A;  3OYM A;  4PFP A;  3SEQ A;  5HVQ C;  4E7J A;  4BL0 B;  2R7R A;  5LD2 C;  4BQN A;  3H5N A;  3BG6 A;  4BJ5 C;  2CW7 A;  2KQR A;  4F55 A;  2XSJ C;  2DJI A;  2VKD A;  3K4C A;  4X0G A;  1MMD A;  4E7I A;  1K6Y A;  3H9G A;  1BR1 A;  3MD2 A;  2BW3 A;  3ZGK A;  5JHF A;  4CZC A;  3VYS B;  3CJQ B;  4HNU A;  3RCO A;  3FKJ A;  3FHN A;  3K4K A;  2R7O A;  3FBN B;  3IAM 2;  4XLE A;  4AVZ A;  4N4O B;  3S8P A;  3DTI A;  2I8D A;  5KNL A;  4BQQ A;  4JQF A;  1MMN A;  1UG0 A;  3HUG B;  1R6R A;  3H35 A;  4AU7 A;  4E7H A;  2R4G A;  3L2Q A;  1DGW Y;  1E0E A;  4YRV A;  2ZSH B;  2RQQ A;  2CUZ A;  2K3P A;  2HQA A;  2DOA A;  4ITV A;  4II3 A;  3PNY A;  1N77 A;  4XN3 A;  2F4I A;  1J09 A;  2JVH A;  4MLO A;  3OYN A;  2E5Z A;  2WAF A;  2R7S A;  4D1Q A;  2VXD A;  4KJZ A;  3HPH A;  2ZXH A;  5CKT A;  3OL4 A;  1X4O A;  4DBR A;  2KP6 A;  3LMM A;  3LSH A;  3SYT A;  2KPM A;  1N75 A;  4BE2 A;  2HVQ A;  3K10 A;  4KT6 A;  2W00 A;  3TBI A;  1BR2 A;  2K9L A;  3BCA A;  3IUO A;  3HOS A;  2KRC A;  2HU9 A;  2Z16 A;  2HVS A;  1MW7 A;  3A1Y A;  2R7V A;  3A2K A;  4F91 B;  4AYB A;  3LFU A;  4BE1 A;  2LH9 A;  4JOM A;  4RLF A;  2W1O A;  1SFK A;  2AQE A;  2V1N A;  3PNT A;  2KMU A;  2KHM A;  1WJD A;  3LSM A;  3OMY A;  3AFH A;  2CMP A;  3VYU B;  1DQU A;  3FBI B;  3D5L A;  4HST A;  2LBF B;  3RQ4 A;  2Y0S A;  4XOT A;  3QOD A;  3AL0 B;  2V4J C;  3K4M A;  4ZDL A;  3A4C A;  2VAS A;  4PJN A;  3HKZ A;  3OYD A;  3S3O A;  3W2W A;  3KX2 A;  3DTK A;  3HOT A;  2WAD A;  3ZQQ A;  3L2W A;  4PUS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...