2AQEA

Structural and functional analysis of ada2 alpha swirm domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
GSNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords Transcriptional adaptor 2, Ada2 alpha
publication title Structure and chromosomal DNA binding of the SWIRM domain
pubmed doi rcsb
source organism Mus musculus
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2aqeA00
2AQEA 2AQFA 2DCEA 2ELJA 2CUJA
chains in the Genus database with same CATH superfamily
2JVHA 1IRFA 5CVVA 2JUCA 3H5RA 4L18B 3CC4I 2HNHA 2DXIA 2PG4A 2P7CB 5JVTA 1R6RA 2VXZA 1JKOC 3M8EA 4XOTA 1W7PD 1XS9A 5M3MJ 3F8MA 2WV0A 2Z3YA 3PUFA 5FKMA 2OD5A 2L02A 4B8XA 2KZVA 4WCGA 5J1YA 3MZYA 2G7UA 4XBFA 2XAJA 1FC3A 5EG0B 3QYBA 2VOOA 1P9QC 3VFZA 4RBOA 4J01A 2BY0A 3C18A 3BG9A 5J1UA 1O57A 4F93B 3LFKA 2XROA 3HTUA 2J5OA 1O7LA 4I6ZA 2LY1A 2ZB9A 2W85A 3D5SC 2ZXIA 3DP7A 1UG0A 3K1MA 1W5CC 3L2QA 4XSXF 2GOXB 4CCMA 2H94A 1WJEA 3ZCOA 3L2UA 1LEAA 4MIMA 2JSPA 3JRIA 3PFYA 2VJIA 4IQ4A 1EH8A 3W2AA 1I6XA 4W97A 5TRDA 2HTJA 3K4LA 2VQGA 2MABA 5IPAA 1VQ9I 4IRIA 1VQ5I 1SD6A 2ZJRF 1H9GA 2CWEA 1R36A 2XB0X 3DKYA 4HF0A 5E1WA 3LL7A 1I3QJ 2UZKA 4E7IA 3OMYA 5FKOA 1DU6A 1TNTA 4P5OA 2KZGA 3HPHA 4G8XA 5HS7A 1W7PA 1LE8A 1BC8C 4G7HF 4EVIA 4MEXF 1R58A 4LOCA 3WHCA 5CQGA 1TL8A 1SFOJ 2BHYA 2FMYA 1G3SA 3FF5A 3SEQA 4BBRJ 4NDLA 1FBUA 2FE3A 4I7HA 1BL0A 2AS5F 5A2QZ 4EGZA 4FE4A 2Y75A 5J8FA 2IGOA 2CG4A 3PQJA 3WG9A 1DDNA 1GT0C 4ZJZA 4AU7A 1GVJA 4XKWA 4U0VA 3QODA 3LSTA 4ZDPA 4BDZA 4P55A 3VYSB 1IZ1A 2IA2A 3H9QA 4XKBA 2ZJ2A 1K83J 5D4SA 1YOVB 3RYRA 2CS3A 2LREA 1BI1A 3SXYA 2PMUA 1WI9A 3J81K 1ZRDA 3BZKA 2NYXA 1F36A 3E1SA 1SD4A 2EH3A 2FSWA 4PSWA 3K70C 1IXCA 1VQPI 1RKTA 1HA8A 2VBXA 2K9QA 2HEOA 3KP7A 3TGNA 1OCOH 2V1DA 4MHGA 3M4OJ 2E71A 3LSKA 3VODA 1Y8RB 3IHUA 2V9KA 3I4PA 3ZMUA 3BJ6A 5KHDA 1MMGA 3W6VA 2GA2A 5EZGA 3VYRB 5CJ9A 2E34A 4LD5A 2RNGA 2DK5A 3OSGA 3VSLA 3HGYA 2ZNYA 5L3FA 4XM3A 5ILUA 4LG3A 5KCMA 3OYFA 2XAFA 1GV5A 3WHBA 1X19A 4N0BA 4HF1A 4XL9A 1RI7A 1SVOA 2VBWA 3BLYA 1TWHJ 4A3DJ 2BY3A 2VIXA 1G3YA 2XAUA 3PFIA 2NVYJ 1WKMA 4CGZA 4CDGA 1ZGJA 3E6DA 3LSJA 5E79C 3V7RA 1HF0A 2ID6A 5FRNA 4D5FA 2ISYA 1D0ZA 2MYSA 4NHJA 3E5UA 3EYYA 4M3DA 1MZBA 2JUGA 2XPUA 2MFZA 4ESJA 2GA1A 4XQFA 4C2MJ 1ZGWA 2D1HA 3S16J 1BIBA 2DMPA 3N05A 2BOLA 2LVSA 4KYWA 2FXAA 4YFXF 1FIAA 1RC9A 1IN5A 2ME0A 4MNUA 2IBDA 1M1EB 2Y30A 3IH3A 1X2NA 2QWWA 3L9FA 4MO7A 4ITVA 1P2FA 1YS6A 1KU7A 2O8XA 3CC2I 4UY8I 4WXCA 1XGMA 3GFIA 4Z2YA 2BHZA 2CJJA 2R3SA 2W1OA 2OUMA 5J40A 3R61A 3H36A 4KITB 1V3FA 3CJNA 2EZHA 2K9LA 4IEJA 2TRTA 5JI6A 2OF7A 2KJCA 2O9LA 2XF7A 1TQIA 2A68F 3B6CA 3AL0C 4ZH4F 2P8TA 5K1YA 4BGDA 1EH7A 3I53A 2GZWA 1BA5A 1Z6TA 2KHMA 5DTDA 4IHYA 2NVUB 2F6CA 4F3QA 2MA3A 2VBZA 1XMXA 2I5UA 2CRGA 3F22A 2M7BA 2DQRA 4D7MA 3OL4A 3E0JB 2KJBA 2JSCA 4BU2A 4PJNA 3RKWA 1A31A 4LIUA 2Y69H 1MD0A 1J09A 2XC7A 4RAZA 5IP9J 3RI4A 5LGNA 2P4WA 3MKYB 1H89C 3ABTA 3LSRA 4DJAA 4KMFA 2G7HA 1W4MA 4HSRA 3HIFA 2HYGD 5CLSA 3FBIB 1SMTA 3GLLA 3QPSA 2IS1A 4X6AJ 1LE8B 3M9AA 2DJIA 2QBYB 2VC1A 3DBLB 2FBKA 2WAEA 1QO0D 3WU2C 3S1MJ 3JSPA 1BR4A 3RSNA 3RYPA 2WB1A 4FHTA 3U2RA 2VL8A 2ZXJA 4KUMA 2DT6A 3H92A 2E1CA 4ON0A 2GBYA 3K1NA 4UHTA 2OAZA 3BC8A 3ZN1A 2LKXA 3HOZJ 5L3BA 1HKSA 3V7CA 2JT1A 1TQMA 2EFWA 2DYRH 2L9RA 5HDKA 4AIJA 1AWCA 3FM5A 2M0MA 2LKPA 2OCCH 3G1LA 5F0HA 3FIWA 3RQIA 1PYVA 2DFIA 2XKOA 1YQAA 3OYKA 2VUMJ 3B6AA 4OAYA 2M4KA 3OSFA 2MGQA 4Q47A 3S3OA 3DWLE 2GXBA 4DW6A 1IRXA 1MNMC 2P5KA 2B63J 1F1ZA 3WGHA 5M3FJ 2HQAA 2ZKZA 2OBPA 2OPTA 2WWYA 2DN0A 1GV2A 3IKTA 1D1AA 1S9HA 1KYZA 4HNTA 2K7LA 4RGSA 5CVUA 4ESFA 3A4CA 1WH5A 3GVAA 1L3LA 1S72I 3BR0A 5BOXA 5ILSA 2IJLA 1NK2P 5FLVA 1ETXA 2ZMEB 5D6EA 3I55I 4ENNA 2H8WA 1U78A 1Z0XA 3B02A 3NRVA 3QPHA 3OS0A 2PMZN 4IO9F 3JRBA 4XLEA 4I01A 9ANTA 3CP2A 2X0LA 3HSFA 4HSTA 5EYRA 1K79A 2VQLA 3TKYA 3A02A 4RLQA 3DEUA 3HDDA 2Z99A 2DFHA 3A03A 3C2GA 5E8GA 4EATA 2M8EA 1BJAA 2R7FA 3JRCA 5IP7J 1USTA 1SC7A 1QVUA 2HOTA 3ASNH 1W5SA 1YW8A 5IYDJ 4L9NA 2UXXA 1D1CA 2A6HF 1U8RA 3K4CA 4IOAF 2W00A 1SEUA 4XLCA 3SZTA 3K4BA 3BJOA 1T0FC 3F8CA 1K61A 1X1PA 5DS9A 1HCRA 5J4YA 4A93J 3E5QA 4EM0B 4ZZDA 2OQGA 3A1YA 3FMRA 3ISPA 2R7VA 1WJCA 3H35A 3H5NA 4BUPA 2ELJA 3ZQ7A 2WADA 3R0JA 1QPMA 3MFKA 4EJVA 2RNJA 3RTRA 5JHFA 4BXFA 5IT9K 1ZELA 1VQ7I 2LP0A 3HOXJ 4HLYA 1EF4A 2NNNA 5GAEJ 2WC2A 1SFEA 2XPVA 1JUMA 1S3JA 4DIQA 2LDUA 2CUFA 1HOMA 3IH2A 1KGSA 3Q0VA 4CHUA 4KICA 3MKZA 1XSXA 2O7OA 4BS9A 4U0WA 4CCOA 1EJ9A 5L3CA 4DBQA 4F52A 1J7KA 3QRFF 2EFOA 3TW6A 3OYDA 2GM4A 4LK1F 2Q2EA 2KMUA 3QAHA 4L0YB 4NC7A 1MBEA 1F4KA 4H0EA 2DU9A 4HF2A 3CTAA 4HQEA 4BXXJ 2EWNA 3DEEA 2ZJQF 2CMPA 2YS9A 3OV8A 4ZYEA 5FLMJ 4KIBA 4JP0A 2Z16A 3DXJF 3F0CA 2X6OA 1X2MA 1G8XA 4MQ9F 3HG9A 3CC7I 4ZC3A 5EGOB 2O0YA 5D5WB 1YRNA 1E3OC 2CW8A 1B72A 3CF5F 2BGCA 2IVMA 1WJ5A 1ZRCA 2K85A 1USSA 2DI3A 3A01A 5ICCA 4D5CA 3ZQFA 4IHXA 1O3SA 5E3LA 5HDNA 4I0BA 1BI0A 1JT6A 2VJJA 2XPWA 2QUFA 1Y0UA 3MKWB 1ZR2A 1TNSA 1PP7U 1MW7A 3L00A 3GFLA 2V9VA 2IEKA 1LKXA 3J81Z 2M4GA 4AYBN 4HX7A 3HXLA 4ZYGA 5FB2A 2EQRA 4CCJA 1HSTA 1A04A 2CSOA 3SFZA 3O2PE 1JT0A 1YJWI 1E17A 1LDDA 3HM5A 5EG0A 4KISA 2BXZA 4PZJA 3Q0WA 3W6KB 4OOIA 1B8IA 3NARA 2R5YB 4G12A 4A3FJ 2JTVA 2XDVA 2NOJB 5TGTA 2O03A 2VPRA 4A3MJ 5FO5A 1WCMJ 3BQYA 2JA7J 1P92A 3HGGA 2A6EF 2ECBA 1W0UA 4LLLA 4A3LJ 2MBFA 1VNDA 2QVOA 2QZ8A 4FX0A 1Q1HA 1LDKB 2Y0SA 3ZGKA 2R7RA 4Y13A 2VT2A 4E70A 1ODDA 1HDDC 2I10A 2M5WA 2UV1A 4WK8F 5FKKA 2BXYA 3PO3J 1IXSB 2GAUA 2WA0A 3V7SA 4AVPA 2COBA 5AONA 2QF7A 1OQYA 4BHCA 4FASD 2WY7Q 2H8RA 3HTSB 2XKPA 1XGSA 2XGEA 4QPQA 2V6EA 2JK3A 5E20A 3P9KA 2X6XA 2YPRA 4OWRB 1T2KA 4A0ZA 3OIQA 4A12A 2Y0MA 2ZXWH 4HEA2 3ZQIA 3IP4B 6PAXA 2CH0A 2FUG2 2K3FA 4UVCA 1XDSA 1KQ9A 1RZ4A 3I4NJ 2IGKA 2OTLI 3P5JA 5C4JJ 3BTJA 2VLAA 3ECHA 1Y39A 3IL2A 1FT9A 2BY2A 2DAOA 3KEYA 1XX5A 3E7LA 4CA0A 1Y56A 3ZQGA 5D8KB 3FXRA 5B66C 1HC8A 2O61A 1QVTA 3TDUC 2Q0OA 4PCQA 2K5CA 4GCVA 4H4KC 3TOAA 2O8KA 4UB8C 2A05A 3C2BA 1Z3YA 2L9VA 2HWVA 2DMUA 2KIQA 2NS8A 2ZSHB 3CJQB 1B59A 4II3A 1F5TA 5HS8A 3IRQA 3CCQI 2KDZA 3EDPA 1QBJA 3LQRA 2EIKH 2DA7A 2BE5F 2MD5A 5F0CA 2MH9A 3OR1C 1P7JA 3LSGA 1JGGA 1DP3A 2MLKA 1TW3A 2ME6A 2L7FP 4B1RA 4JX4A 3CP8A 2QKMB 5LEKA 2Z33A 1J5YA 3ECOA 2E1NA 1WRJA 3KLOA 4M72A 3T5XA 4ZDLA 4WF2A 2FNPA 3K6GA 4A3EJ 2RREA 1YW7A 3CLOA 4LK0F 2BW3B 1STZA 3KFWX 3HUGB 3HYIA 2QENA 2Q2EB 1VZ0A 3MZ8A 4HPQA 5F0FA 1KZHA 4F92B 3TO6A 2VB6A 1X4OA 4KIFA 2YU3A 2W24A 3GCMA 3WGGA 4LB5A 1JUPA 4K2EA 5D8LB 5HODA 1XD7A 4PGHA 1O3TA 2KLOA 2HI3A 4HLXA 2F5FA 3PNTA 2JA6J 1JHFA 3J80Z 2CQQA 3KEOA 4DZPA 5IOZA 1YRNB 1B72B 3EUAA 2EIJH 3F72A 4PFOA 2HOAA 3K4NA 3S3NA 1R5ID 5DCFA 2R93J 3OWTA 2MW8A 2DA3A 2DPUA 5K5OA 1IUYA 2E35A 5ILVA 3BWGA 2JWTA 3FKJA 1S29A 5GPAA 3QPLA 4N4OB 1XDUA 4RM2A 1T38A 1J0RA 2FA5A 2K86A 3L09A 1IDZA 1I5ZA 2HYFA 1FYKA 3LOCA 2XAHA 4BH9A 5LFAA 3M3YJ 2L7MP 2XVCA 2FJ1A 4YEJA 5KAFC 4JOMA 1LDJA 5H2FC 5D5VB 3MN2A 4A3KJ 2QM3A 1B8IB 1U5TB 2G9WA 2CQ7A 1JE8A 2EIMH 3H1CA 1FYMA 2F4OB 4S0HB 4N4NB 1MMDA 1OCRH 4QWQA 3BT9A 2V1NA 4HNVA 2EA4A 1X1CA 1UG2A 2WAFA 4Y3OA 1KQ8A 2BV6A 4UV8A 2H09A 3TQNA 4YIRX 2W48A 5LEJA 1OCTC 3QOEA 2Z2SB 1XC5A 4Q4ZF 5D6FA 5E3NA 1FMWA 5E3OA 3TP0A 2CUZA 1RRJA 3HHHA 1PUEE 2EFPA 2EK5A 1IW7F 4DOZA 1VQOI 4DGWB 2L7ZA 2HVQA 2F4IA 4A6EA 4P1WA 1H0MA 2QBYA 1ACIA 3WTXC 3BR1A 5LBQA 2CUEA 4KFCA 2KRHA 1SFKA 3CDLA 1G3WA 2NVXJ 2AHQA 3KYLA 2JA5J 2VQHA 1A6IA 3BROA 3I64A 3VWBA 2PN6A 4DNCA 4L9VA 4CZCA 3A01B 3N4MA 2PFBA 3FK7A 2K4BA 1T98A 3LA7A 3KP6A 3RJPA 1DUXC 3I5UA 1VFCA 1MBHA 1MKMA 1XMAA 1OYWA 2KKOA 4FISA 2KL4A 1ETVA 2QGUA 3GX4X 3LSPA 2XAQA 1MBFA 1X58A 2YSRA 2M7AA 3G4SI 4BY7J 2JPBA 4O5VA 1S7OA 4RM3A 2CFXA 3JRHA 1MJAA 2B7EA 3DPUA 5CVIA 5DV5A 3U1DA 5HLTA 2UWMA 3EPZA 3LFUA 3KZIC 1P4AA 4IHSA 2COMA 2R7QA 3RQ4A 1JJ8C 4BJTA 4WWCA 1X3WB 5KAIC 3H0DA 3HOVJ 5B1BH 2LFBA 4GRIA 2DJNA 2LSOA 3OS1A 2EJRA 1R23A 4ENMA 3CCLI 1VQ6I 4Y17A 2KIUA 2X1EA 5E3MA 1ETYA 3LA3A 3RKXA 4BQOA 1E2XA 2ZC2A 3WTSC 3HSRA 5CQEA 3PNYA 4EM1A 5K5QA 2K9NA 1F9NA 4DZJA 3EUHA 5LD2C 1IC8A 2ZMEA 1NHAA 4AIKA 2E5ZA 1GHCA 1I1GA 3FXKA 2DT7B 3OYJA 1RR8C 4B09A 2W84A 2NAZA 5FLXK 1LVAA 1KONA 3ZOBA 2DODA 2VBYA 1P7IA 2IPQX 2VKVA 1KYWA 5FD5A 5HLHA 4A3GJ 1FIPA 5M5WJ 3D0SA 4A0XA 1WFXA 1XSDA 2PEXA 3FMSA 4B47A 4BHBA 2D5VA 2R7DA 4BQNA 4BHPA 2VQCA 3V42A 4XK4A 5FGMA 3U9GA 3CMYA 1S7EA 2A6TA 3F8NA 2W57A 4IHWA 1VI0A 2VI6A 3FM3A 1ZH5A 5AIPA 2FNAA 4M74A 2N8GA 3LQQA 3SQNA 2K40A 3CUQA 3O3KA 2EILH 2JPCA 3BG7A 3LNQA 4IRGA 2Y48A 3GTMJ 3BTCA 1XGNA 4QLCU 3GXOA 4GXOA 2KP6A 2KQRA 1BW5A 1BM9A 4BJ5C 4JK1X 5GAGJ 4UUVA 1HQCA 1XB4A 1R1TA 2P0WA 2DFEA 5AIQA 3RPUD 2HDDA 2CW0F 3C3WA 3KIOA 4M6YA 1P6RA 4XIDA 3JAMK 2V1XA 4BDYA 3OS2A 3DLAA 3K2AA 1ENHA 3QU6A 1EKEA 1V55H 3DCFA 4LIVA 2F5VA 4A3BJ 2DOFA 4C2TA 3ZXSA 5LGUA 5JFRA 1D8KA 4XR6A 4M6VA 5DCMB 3J7AO 3S17J 1UHSA 1IGNA 4MTEA 1RIOH 4AUXA 1MSFC 1AOYA 3ZMSA 2OC6A 3WTTC 4BQQA 2VC0A 1GVDA 4IVNA 2YX7A 1HXDA 3ZR8X 4IPAA 1FOYA 1R1UA 1XCVA 1DPUA 2DMTA 5F08A 3SZPA 2HQ5A 1FSEA 2MSYA 5LHGA 3BG3A 3GBGA 3IH4A 3VYUB 5J47A 3HPGA 1S8NA 2NNYA 1ZAOA 4BJ6C 3J7AY 1IN7A 2OU2A 5ICFA 4RS8A 3EYIA 4IHTA 1MNEA 3OOPA 4B4CA 3S2HJ 3M8FA 2NXNB 1FZPB 1MMNA 5LGTA 2FF4A 3C7JA 1FY7A 3IWFA 3QP5A 2OZUA 4DYCA 4PDKA 5J3LA 5JLXA 4YG2F 1ETWA 5BMZA 4LG0B 2LY2A 5EGOA 2LOOA 3RPUA 3LAPA 3JRDA 1FYLA 4L0ZB 4XLHA 1IUFA 2V26A 1G3TA 2E19A 2OJED 5D5XB 3AG4H 2V79A 3PM1A 4OINF 4DYQA 3H9JA 2PMZA 3B73A 3BG6A 3ASOH 2ISZA 2QA4I 5KVRA 1QHGA 3S32A 4A3JJ 1V5GA 3MD2A 4YFKF 1PP8F 3CO6C 1AKHB 4NC8A 1V54H 3HRMA 4AC0A 3IUOA 3OYCA 2BZTA 3I3LA 4UB6C 3DFGA 2LMDA 4P9UA 1HW5A 3D5RC 2HU9A 5TJJA 1Y8QB 4X1EA 5IYCJ 1WJAA 1JHHA 1WHUA 2ESNA 5EZHA 4NNJA 1OLTA 3BPXA 4Y52J 3CDHA 2HXOA 4M3FA 2QSHX 2M3AA 2E36A 2R5YA 1LFPA 2X6WA 1U8BA 3GFMA 4ZYAA 4CH7A 1KA8A 3ERED 1H9TA 1HBXG 3CCJI 2VKDA 3VEPA 1KU3A 5HLIA 3KP5A 3VDXA 4KIGA 2LBFB 1ERDA 2HYJA 4XN0A 5DDGA 3D5LA 4I02A 4IKFA 1K7AA 3ZP5A 3E6BA 1R22A 1WJDA 3LA2A 5E1XA 2PBIA 1LEBA 4B43A 2O6GE 4BBSJ 2CV0A 2HFHA 1B4AA 3GFJA 1JKPC 2LLKA 2E2IJ 3IAM2 2HDCA 1OISA 1IO2A 2EV5A 1SANA 4ZZLA 1UELB 4PJLA 1MH4A 2EPFA 3PO2J 4CCKA 2L2OA 3M8JA 1Z6RA 4RB3C 3LSMA 4RGUA 4Q48A 4M9ZA 4QIWN 4CSWA 5CKTA 3RPQA 1UFMA 3OOUA 1BW6A 1D5VA 3OYGA 2HOEA 2KFDA 2YU9J 2RQPA 1YX3A 3CUQB 1K6OA 2QQ8A 1LNWA 5E8IA 4CZZA 1SVLA 3S14J 5FRMA 4MFEA 5DEQA 3AKZA 2W82A 1X4PA 3CCUI 2FEZA 2ECCA 2Z5UA 3SFIA 5B5EC 4AWXB 2P7VB 1N77A 2F5EA 1MBGA 2XAGA 3HSEA 4NB5A 2BBYA 3W2VA 3H9GA 3Q5FA 4CYDA 4DBRA 5EEGA 3BG5A 1FJLA 1ORKA 2YX4A 3WTUC 4HBLA 4G94A 1FOXA 1VQLI 2KRFA 3G1MA 5BPDA 2HQRA 3SZGA 1JTXA 2XGCA 3BR5A 2FMLA 2L9NA 5KNLA 2H1KA 4IX7A 1WVRA 2FOKA 5IP6A 3BZCA 3TP3A 3CCEI 1YJNI 3KP4A 1SAXA 5C4XJ 5A2QK 1EA3A 4I09A 2QSGX 2XSJC 4R8HA 1IV8A 3OYEA 3ZQLA 2CU7A 3GUDA 3KP3A 4CCLA 4AYBA 1DQUA 4BY1J 3FZVA 2BW3A 1Z05A 2OTJI 1QZYA 1U2WA 3F23A 4Y33A 3G71I 1D0YA 3HUGA 1J59A 1WJBA 1BOBA 4RB1A 2LD5A 3I0TA 5F27A 5DUKA 3GTPJ 1IG7A 3GZNB 1QQIA 1U9OA 3VOEA 3RZDJ 1W36D 3T1BA 1NG6A 4MQVA 5CYVA 1MSEC 3RIRA 2DYSH 4RMNA 3L2WA 1C0WA 3L7WA 3FX3A 2IT0A 3WTWC 2CYYA 5F1RA 1MDMB 4C3IJ 2EFNA 5E17F 4FETA 4BE2A 3SDGA 4B48A 1SFXA 1OMIA 3CCVI 3T0YA 1W5TA 3ZPLA 1R5GA 3DF8A 1XSVA 4M71A 3E3VA 3I59B 4PJMA 4RLFA 2FQ3A 3FBNB 5C44J 2IGNA 2F2EA 3J7YJ 3F21A 2X51A 1LQ1A 3IAS2 4OIPF 1SD7A 3BTLA 1QA6A 3J7ZI 5DM6F 3LSIA 2M45A 3VYTB 3HHGA 2B0LA 1QHHD 1QU3A 1G2HA 1ZTRA 2RQQA 2CV2A 3OYHA 1T6SA 3PL8A 3JRGA 1CF7B 2F4MB 1F43A 4CICA 1RPWA 4MEYF 4IL6C 3V8JA 3MEXA 4MTDA 3K7AJ 1ZG3A 4G6DA 2DA4A 2HDWA 2DDAA 3DU5A 1PUFB 3DPLC 1FSHA 4ZDOA 4E7SA 4XRMA 1GXPA 2XF5A 3NEUA 1Y0NA 5B1AH 3WTVC 3S1QJ 4F91B 1U5TA 1BC7C 1ZARA 3H3VK 1O3RA 1QGPA 4PSXA 2OV7A 4W1UA 3TDZC 3GMEA 1ZRFA 1IDYA 2QEXI 4DQ2A 1IAWA 2RKHA 1Z3XA 3F8FA 3GO5A 5IYBJ 1Z7LA 3G6EI 3E5XA 1I27A 2WAQN 1TZLA 1BR1A 2R7TA 5GAHJ 1MJ9A 2KIFA 2E1OA 3ROUA 2A5WA 3GTLJ 3GTOJ 1U0JA 2JVGA 5L3EA 2AQEA 4XMYA 2A3SA 4Y4RA 2HZDA 2Q1ZB 1IJWC 4OIRF 2QQAA 4HA8A 3W2WA 2NRAC 2VT3A 4A5NA 2DTZA 3KX2A 4C9YA 5DD8A 4CUGA 5H20A 3IWZA 1Z9CA 5HDGA 1ZG1A 3EQLF 3KLNA 2H6CA 1RETA 2G0EA 1IRGA 1FP1D 3TMOA 1QZEA 4OIQF 3I4MJ 3FMQA 3BQZA 5M5XJ 2ADUA 4IHVA 3PIPF 3KCCA 3TO7A 2HVSA 3QU3A 4GYGA 1SMYF 4LB6B 4GYIA 1POGA 4I99C 1TTYA 5LHHA 1W36C 4HRIA 1U5TC 1YIOA 2XGDA 4HV6A 2IP2A 3O6BB 3EUKL 3H0GJ 1K78B 1MMSA 2X1DA 4G6TB 4HZFA 3R0AA 4JBAA 2M34A 3W6JB 1K4SA 3K10A 4ZTFA 3BR6A 1BIAA 2QQBA 4C30A 4BKXA 3KYDB 5J1RA 1YS7A 2F5DA 2ZBKA 2FRHA 3FWEA 1HDPA 1UB9A 2LF8A 4AIDA 4XLFA 2ZSIB 1OR7A 1TBXA 2BY1A 2CQNA 3PUBA 2DCEA 4V2FA 3PJRA 3QPTA 4EV0A 2IW5A 2QSFX 2LK2A 1J75A 2ZCWA 1NG7A 3K4JA 2E7XA 1OYYA 1R7JA 4WXDA 1VQ8I 1W0TA 5LHIA 1GDTA 3ZRGA 3AFHA 2V9PA 2Y9YA 1Y1VJ 1FLIA 2HZTA 1I1SA 2VJ4A 1PDNC 1D5YA 3OIOA 4HYEA 4A3IJ 1Y1WJ 4KNYA 4E7LA 2R92J 5CPRB 3ABLH 3KZZA 2BEOA 1XG1A 3GEZA 3PSIA 4R79A 2DLLA 2XV4S 3Q0UA 3RZOJ 1WGXA 4KMUX 1DPRA 4U0YA 5EJCA 1SFUA 2TDXA 2NS7A 2D1VA 5H6RA 3OYAA 3BY6A 1ETKA 3T8RA 5K5RA 2HOSA 4A69C 3BCAA 4HAMA 4QPOA 1RUOA 2HKXA 3GW2A 4DYRA 2MC3A 2DT5A 4RA2A 1R71A 4D7NA 2H27A 1ULYA 3HRUA 2PMHA 2DA6A 3JW4A 2IXSA 2UXNA 4KDPA 2FOWA 4KT5C 3ERMA 2FQ4A 1G59A 1Z7UA 4OU0A 3JRFA 1UJ8A 4BACA 2AO9A 3VB2A 2QYOA 2M8GX 3DBHB 4I0AA 1YHQI 4HW0A 3F3XA 3FXUA 3GTJJ 2HVRA 4I98B 3K70D 4ZTJA 1P4XA 5JLWA 2V6CA 3MQ0A 4M73A 5TISC 2LYCA 4Z6YA 1X3UA 1DGRM 5K7ZA 2VE9A 1IRZA 1PJRA 1S7AA 3ABKH 4Y7NJ 2UUZA 2EZKA 2JA2A 3HRSA 1O4XA 5DCMA 1TP4A 1BR2A 5F04A 4LGWA 2K3PA 2JMWA 3HKZN 2LTPA 4GO1A 1REPC 4U7DA 2ZFWA 1ON2A 3BPVA 2HXIA 4KN4X 2QCOA 1OJLA 3S2WA 1KU2A 4O3MA 3CCRI 3PSFA 1FWZA 5GADJ 4OIOF 1DGWY 2EZIA 1G4DA 2L0KA 3C2HA 1LPQA 3S1NJ 3N97A 1MH3A 4B44A 4EJTA 3NQOA 1ITYA 4UVAA 1AU7A 4UNOA 5ERIA 4RAFA 3BZ6A 1VQNI 1X3ZB 3WTZA 1WSUA 3ZQHA 3OY9A 3SJMA 1HW1A 2DMQA 1D1BA 4QSHA 3FDYA 2I8DA 4M3BA 4LG0A 3SEZA 3S1RJ 3GF2A 4E7JA 4OMYA 5DD4A 3BR2A 2WTEA 5E18F 4G7ZF 4E7KA 5CVJA 4G6QA 2OCEA 3RKQA 2DBBA 4LFUA 4XRSA 1YW9A 2X48A 4I2OA 1ETQA 1AA7A 3K2ZA 4PUSA 4M6XA 1AKHA 3OIPA 2GWRA 3V4GA 1I3AA 1QRYA 2Y2ZA 4ENKA 2CQKA 1JUSA 3VSKA 4EJUA 1N78A 3LWFA 3O8HA 2VONA 2LR8A 2CGPA 2FBIA 3KPHA 4GGGA 3MCZA 5B3SH 4NBQA 2E1MB 5JVGF 2DDBA 3DQVC 3WU1B 2ACJA 4XORA 2DOEA 2CW7A 1YX5A 4IXAA 4CYCA 5IT9Z 4PFPA 1FBSA 3QYFA 1WH7A 2HQNA 2J5PA 4L5JA 3TL4X 4RB2C 1TT5B 1G6NA 1I50J 4M9SA 1H8AC 3ML6A 4PK4A 3H5AA 3RDIA 3HOSA 2PJPA 4AVZA 1VQ4I 3X2QH 1U6GA 3NWSA 2L7KA 4XNFA 1IN8A 1ZGAA 3R4KA 2MH2A 4ENJA 1ZN2A 2LBFA 2X4HA 3I56I 3CMAI 1TT0A 2IS2A 2DQLA 2VOPA 1JKQC 4BE1A 4HG2A 2OA4A 2BVLA 5ICEA 3CESA 3HC7A 1QPIA 1UMQA 4IQJA 1ZHFA 4OMZA 4E6KG 2NVTJ 2W7NA 2F5CA 1MBKA 2VASA 3CZ6A 4D9JA 2DFFA 3GZ6A 5GP9A 4XICA 5D5UB 3CDIA 2XB5A 3BJAA 2MD0A 2V1UA 3WU0A 4E7HA 4GFBA 4GDFA 3GZ5A 1JGSA 2VKHA 1N75A 4J19A 1LUJB 2L5QA 5K7FA 1HW2A 3L2CA 2GXGA 3Q3SA 4M3GA 1D8JA 3DEWA 2ZXHA 1BN5A 3F9KA 3QOPA 1YG2A 2BVMA 5HNFA 3JREA 2R4GA 1QZZA 1VF9A 1DP7P 1SD5A 2STTA 5BQTA 3CMEI 3JCUC 1ZKGA 2RGVA 3KETA 4LITA 5EEAA 2GOMA 1B9MA 2CUJA 4ANJA 5LRSA 4L5EA 3MWMA 3KEQA 2XSDC 2HKOA 2DA5A 4XLNF 1QNTA 3RKYA 3BOQA 2EB7A 4ZYDA 3OYIA 1RESA 3GTQJ 5HOOA 3JTGA 2R5ZB 4RAGA 3TBIA 4D0PA 2RV8A 2LH9A 4EGYA 2W25A 4XLPF 1CGPA 3E97A 2CQXA 4XLAA 2VJ5A 2AXTC 3HOYJ 3CUOA 4UUTA 2DA1A 4XRSG 4ABZA 5ED4A 3G73A 2ICWG 3DLLF 2KRCA 1EV7A 5BNGA 2ELHA 3DU6A 1HSJA 3K69A 1T56A 3EUHC 2LNBA 1BI2A 2ZMEC 3AG1H 3JRAA 1WZ2A 3AG3H 1VQKI 4JYKA 2DTRA 2ELKA 2QQ9A 1LJ9A 1R9TJ 2ESHA 2CV1A 5HLGA 2PJRA 2WBMA 2E2JJ 1L0OC 1YLFA 3MKLA 3ZMZA 2JJ7A 2M2EA 5FJ8J 2CO5A 1XN7A 2IGMA 3K4KA 3LMMA 3WE3A 2EA2A 2FD5A 2M9HA 2Z9OA 5BS6A 1IN4A 3IKVA 1RKWA 4FT8A 5L3GA 2K9MA 2V7FA 4TV7A 1D3YA 5HNHA 1I6HJ 3NWTA 2VE8A 2GIZA 5DUIA 3I71A 3CUQC 3OR2C 3I9V2 3DKWA 4B3AA 2A07F 4NC6A 1O3QA 4CXFA 3MAJA 1SAUA 4IOCF 1X1AA 3ZN0A 3FISA 1UZCA 3OYBA 5EDNA 3COAC 1MDMA 2DO7A 1J9IA 2VKEA 3M7GA 1TWCJ 1Z77A 3K1PA 2IA0A 3DPTA 4FQGA 1XCBA 3MZHA 2EINH 2B9SA 3WODF 2ZO4A 1IV6A 3WG7H 1FTZA 1MGTA 3I59A 3M07A 4XONA 2YUSA 1KU9A 3F6OA 3CD6I 1UHWA 2P5LC 3V8LA 4BE0A 4I76A 5E1ZB 1DU0A 1ZREA 3AG2H 2L4MA 1WPKA 5F6FA 2LF7A 4C3HJ 2A61A 2IRFG 4P9FA 2P81A 5JR3A 4YIFA 1CF7A 3CMMA 1GXQA 2O3FA 4E7ZA 1HKTA 1XGOA 3PIOF 2PI0A 1GUUA 1W7PB 3P9CA 1ETOA 3W3CA 3CLQA 2FU4A 1YFHA 2TCTA 3ELKA 1PUFA 1KQ0A 3KP2A 1LB2A 1Q1VA 1ZYRF 4CYCB 3CCMI 3J80K 2VPLA 2HPMA 1IN6A 2ID3A 4KT6A 1R5HA 2E60A 4NQWA 4U87A 1RUNA 4G7OF 3FHZA 2RC4A 5FROA 1TWGJ 5F1JA 5LRRA 1U9NA 1APLC 2D2WA 3CQZJ 2AXLA 2M30A 2A69F 4YRVA 4HX8A 3RCOA 1S6LA 4FCYA 2OQRA 1YE9A 1UHMA 1Z21A 4RB0A 2MC4A 4L5IA 2LC2A 3FXJA 4IF4A 3UR3C 1B6AA 4XSZF 2DW4A 2JN6A 5FFXA 2C6YA 4EEFG 4IJAA 2W4SA 1T0FA 3FXMA 3A0HC 4EQQA 1BI3A 4AM3A 2KPMA 3BP8A 3G2BA 2DMNA 2BYVE 4YIIA 1FOWA 3E6MA 2Z1DA 4Q5SF 4RGXA 2ZJPF 1JI8A 3K9TA 2HGCA 1FOKA 2XUBA 5ICGA 2O5RA 1NK3P 1E3PA 4BYYA 2DK8A 2DA2A 2JA8J 1MMAA 4AD9A 2PQ8A 3I54A 4II2A 2F48A 5DYMA 5D4RA 2NS0A 2DOAA 3CO7C 2L54A 1A36A 2WB1N 1SVMA 3CCYA 2KDOA 2HTSA 5FKNA 1ONVA 3HZJA 4A2UA 4RDUA 1ZLKA 4BQAA 3AL0B 1E3HA 3HOWJ 3NAUA 4LMYA 1MBJA 2E5NA 5FFZA 1TWFJ 3S2DJ 1FPQA 1FEXA 1K78A 4UUSA 4HOBA 3JSOA 2X85A 4C3JJ 3ULQB 1T8IA 4U88A 2X9DA 3S3MA 3F6VA 5C3EJ 1A35A 1MJBA 1JTYA 4XKCA 3REOA 1LVKA 1WI3A 3K4MA 3GTKJ 1D0XA 4LLGF 3O8GA 3R6SA 2HS5A 3CJTB 3ONQA 1BJZA 3M1CA 3OYLA 2L01A 2VODA 3QWLA 2JRTA 2PJRB 1Z91A 3GLXA 1T33A 4C2UA 2NOGA 3V8KA 1IXRC 3TOBA 2ETHA 3TO9A 4M9XA 1Z1DA 4EMSA 1ZLJA 2V4JC 4JX6A 2X1CA 1TQPA 1Z67A 2IA1A 4ETSA 1I39A 3CJRB 2PX9A 2PLYA 4M3EA 3UNGC 3BTIA 4BAYA 2XRLA 1WJFA 4HX4A 5GTHC 1R1VA 1YI2I 2ZNZA 4JQFA 4S05A 4X0GA 2RAEA 3HBLA 2R7SA 4JX5A 3UKGA 4RAYA 3L2RA 1TW2A 3PQKA 4HV5A 4LJZF 3ZMVA 4XKVA 3GYHX 3T8TA 4XOPA 4YFNF 3S15J 2D45A 2WAQA 1W1WE 2XRNA 1R49A 5EEHA 1OYIA 5HS9A 3A0BC 3G1OA 4HDVA 4J00A 1TLHB 3HJEA 1K4TA 4MGRA 3SDBA 1VQMI 1V5EA 4P96A 1OCCH 3OYMA 1OFCX 3U1KA 5CVRA 2VN2A 2NVQJ 2KISA 3KZYA 2P6SA 2HPIA 3AAFA 2HR3A 4KJZA 2WV1A 1GLNA 2KT0A 3BDDA 4ASNA 2XHKA 5GTIC 2M1BA 2R7XA 2Q8KA 4EM2A 1NTCA 3LAJA 2QKLB 1JKRC 2R7UA 1IF1A 1XMKA 5FD6A 1MNDA 3L2VA 2GLOA 1X1BA 4L9JA 2L3DA 3ZMTA 1A5JA 5J4VA 2A5YB 3M1EA 4G9YA 4RGRA 3L1PA 4UXNA 5HVQC 4BEHA 3FXQA 4E4HA 4O6JA 3S93A 5LLQA 3OYNA 1FX7A 4IRHA 1T08B 2XF6A 1FNNA 4UV9A 1R4MB 2GXAA 1FBQA 2OZ6A 4NQWB 2CFOA 3WE2A 4QTRA 2P6TA 4KN7X 4S04A 3EETA 3HRTA 4KA4A 2KIMA 4R1HA 1YIJI 3HL2A 3CF2A 2RN7A 4Y15A 4V19K 2EFQA 4HNUA 1RR7A 1BBYA 3GWZA 4FX4A 4CO8A 4L9TA 2R7ZJ 3QYEA 2EZLA 4F55A 2P5VA 5M5YJ 2MLGA 3DTEA 5KK1A 4HDUA 4WXHA 5FLXZ 3KE2A 4EJWA 1T39A 1LFUP 3K0LA 1U3EM 3DBRB 5FKLA 3HEFA 3FKIJ 3FXOA 3ESWB 2GQQA 1V5FA 4MLOA 4A0YA 4BXUA 5DM7F 2LRDA 3VPRA 3H3UA 5IOYA 1YITI 3WTYC 5IY5H 4V2GA 5JHUA 1HKQA 1OPCA 4ESBA 4PJJA 4EJOA 2H1LA 4AIHA 3FHNA 3BCBA 3HOUJ 5BPIA 4XN3A 2XASA 5H6QA 3ZQCA 3IC7A 4HQMA 1LFBA 4N9IA 3SHFA 2Y9ZA 4PJ0C 3KYCB 2WY8Q 4PGGA 3FXLA 2DPDA 1FP2A 2JRMA 1N25A 3Q9SA 3C1DA 5K7HA 3E6CC 1TWAJ 3PNVA 1K6YA 1PVEA 1UCRA 1O7FA 4IZZA 1B1BA 2M0CA 1TC3C 1XTAA 1J2XA 2LY9A 3I58A 3MMYB 4UUSB 4D1QA 2XIGA 1ZQ3P 2GIVA 4BL0B 3U21A 3JAMZ 1CQTA 2STWA 1EH6A 4FE7A 5J6XA 2LG4A 3R60A 2E7WA 2JQ7A 3H3ZA 3GTGJ 3JTHA 1ON1A 4B3XA 1YTYA 2H6BA 2K27A 1YJ9I 4MFDA 4BNCA 2YR2A 4CCNA 2IS4A 3HOTA 2K9SA 2EV6A 2EBIA 3CCSI 2X6YA 3P9IA 1P4WA 3WGIA 2R7WA 3IRRA 1OCZH 2FBHA 2FX0A 1V4RA 2RDPA 4ZYHA 1JXSA 2Y0SN 3ABMH 3P7NA 1H88C 5EF6A 2K4JA 2L4AA 2ZFUA 4LLNA 1R00A 1RNLA 1B9NA 2IS6A 3S8PA 3A2KA 3HKZA 4WX9A 3ABUA 1BOAA 1YO5C 2IAIA 1YYVA 3JR9A 1VTNC 4U7BA 3QQAA 3DTKA 4OAZA 2E1MC 2AQFA 3ZQQA 3G3ZA 4A6DA 1OCPA 3MVPA 5F64A 1X1DA 2M87A 1WQ2A 1WWXA 3FK6A 2LKSA 3Q9VA 5J8CA 2E2HJ 1UAAA 3TEDA 2VXDA 3BR3A 1HLVA 1AHDP 3OL3A 1MIJA 3QP6A 4UVBA 1E0EA 3IV5A 1ZK8A 2QLZA 3DTIA 3SYTA 2Y31A 2R0QC 2EV0A 3LSHA 5L3DA 4FTHA 1OR7C 4A5MA 2R5ZA 1OKRA 3ZMDA 1R4NB 1ZG5A 4A3CJ 3TW7A 4F7ZA 2XGXA 4N9HA 1NH3A 3DKXA 1JJ6C 1XPXA 1ZR4A 3DV8A 1FMVA 4BEHB 3HB9A 3D1NI 1A6QA 1Y6IA 2K02A 5GPCA 1T95A 4YELA 2MG4A 1S5LC 2JZYA 4NUBA 1FTTA 4XRFA 2L9SA 3F8BA 5IT3A 2RVCA 2R7OA
chains in the Genus database with same CATH topology
2JVHA 2XDVA 3IAM2 2NOJB 5TGTA 3H5RA 3OYIA 1UELB 4PJLA 2HNHA 5HOOA 2DXIA 3TBIA 1R6RA 2VXZA 4CCKA 2L2OA 2LH9A 4XOTA 3M8JA 3LSMA 4XLAA 2VJ5A 1LDKB 2Y0SA 2KZVA 5CKTA 3ZGKA 4CSWA 2R7RA 2KRCA 2UV1A 3OOUA 3DU6A 3QYBA 2WA0A 1P9QC 3OYGA 1YX3A 3EUHC 4J01A 4FASD 2WY7Q 4F93B 5FRMA 4QPQA 3AKZA 2W82A 2V6EA 1X4PA 2CV1A 2PJRA 2WBMA 2X6XA 2LY1A 4OWRB 1N77A 3OIQA 3D5SC 2ZXIA 4HEA2 1UG0A 2IGMA 3IP4B 2CH0A 2FUG2 3K4KA 3W2VA 3H9GA 3LMMA 4DBRA 3L2QA 2IGKA 2GOXB 4CCMA 1WJEA 2VLAA 3ZCOA 3L2UA 3SZGA 2JSPA 3PFYA 2VJIA 2K9MA 4IQ4A 2V7FA 3W2AA 5HNHA 3KEYA 2L9NA 5KNLA 3K4LA 2VQGA 2MABA 3NWTA 4CA0A 4IX7A 1Y56A 3OR2C 3I9V2 1EA3A 3DKYA 2XSJC 1SAUA 3LL7A 1X1AA 2K5CA 4H4KC 4E7IA 3OYEA 1Z3YA 3OMYA 3OYBA 4CCLA 4AYBA 4P5OA 3HPHA 3CJQB 2ZSHB 4II3A 1DQUA 3DPTA 2BW3A 5CQGA 4Y33A 1D0YA 3SEQA 4XONA 1WJBA 1BOBA 3OR1C 3LSGA 1DP3A 1W36D 4BE0A 1NG6A 3CP8A 2QKMB 2IGOA 4RMNA 3L2WA 4ZJZA 4AU7A 3CMMA 4ZDLA 4XKWA 4E7ZA 4FETA 3K6GA 4BE2A 3QODA 4BDZA 4ZDPA 2RREA 3VYSB 3W3CA 4B48A 2BW3B 3H9QA 4XKBA 2CS3A 2LREA 3HUGB 4PJMA 2Q2EB 1VZ0A 4RLFA 2VPLA 3FBNB 4HPQA 2HPMA 2IGNA 3E1SA 4KT6A 2X51A 2E60A 3IAS2 4PSWA 4U87A 3K70C 4F92B 1HA8A 3LSIA 3VYTB 5FROA 2VB6A 1QHHD 1X4OA 3LSKA 1QU3A 2RQQA 2CV2A 3OYHA 2V9KA 5KHDA 3PL8A 4YRVA 3RCOA 2KLOA 1MMGA 3VYRB 3PNTA 1YE9A 2RNGA 2HDWA 1Z21A 3DU5A 2MC4A 3VSLA 3DPLC 2LC2A 4ZDOA 4XM3A 3EUAA 3UR3C 4E7SA 4LG3A 4PFOA 5KCMA 3OYFA 2XF5A 1X19A 3K4NA 3S3NA 4F91B 4XL9A 2W4SA 3OWTA 3BLYA 4PSXA 2OV7A 2VIXA 2KPMA 2XAUA 3G2BA 3FKJA 1Z3XA 4N4OB 1Z7LA 4RM2A 2Z1DA 1TZLA 1BR1A 2R7TA 1JI8A 5FRNA 5LFAA 2O5RA 2MYSA 1D0ZA 2A5WA 1MMAA 1U0JA 4YEJA 2JVGA 4II2A 2AQEA 4JOMA 4XMYA 2JUGA 2DOAA 2HZDA 2MFZA 4Y4RA 4XQFA 2Q1ZB 2KDOA 3W2WA 3N05A 3AL0B 2BOLA 3KX2A 4N4NB 4C9YA 1MMDA 2E5NA 4CUGA 2V1NA 1X1CA 2WAFA 4Y3OA 2X85A 3TMOA 4ITVA 3QOEA 3S3MA 2Z2SB 1FMWA 2CUZA 2W1OA 2OUMA 4XKCA 2HVSA 4KITB 1LVKA 2K9LA 3K4MA 1D0XA 1W36C 4HRIA 2XF7A 3ONQA 3OYLA 3M1CA 3AL0C 3EUKL 4DOZA 4ANJA 4DGWB 4BGDA 2PJRB 4C2UA 2KHMA 2X1DA 4G6TB 2HVQA 2F4IA 2V4JC 2F6CA 4P1WA 2X1CA 4F3QA 3CJRB 3K10A 4ZTFA 2KRHA 3UNGC 1SFKA 2M7BA 3OL4A 3E0JB 1WJFA 4C30A 3KYLA 4JQFA 4BU2A 4PJNA 2VQHA 4X0GA 3VWBA 4LIUA 2R7SA 4CZCA 1J09A 2XC7A 4XLFA 2ZSIB 3L2RA 3PUBA 3MKYB 2DCEA 3PJRA 4XKVA 4DJAA 4HSRA 4XOPA 2WAQA 3FBIB 1NG7A 2KL4A 3K4JA 4J00A 3SDBA 2M7AA 2IS1A 1V5EA 3OYMA 3ZRGA 3AFHA 2DJIA 4RM3A 2VJ4A 2WAEA 3DPUA 5HLTA 1BR4A 3RSNA 2HPIA 2UWMA 2WB1A 4KJZA 3EPZA 2VL8A 1GLNA 3LFUA 2DT6A 4E7LA 2R7XA 2R7QA 5CPRB 3RQ4A 4BJTA 2QKLB 2R7UA 1MNDA 3L2VA 3H0DA 3BC8A 1X1BA 3PSIA 4GRIA 4R79A 3OS1A 2M0MA 2X1EA 4BQOA 5HVQC 3OYAA 5CQEA 3PNYA 1PYVA 4BEHA 4E4HA 3OYKA 3S93A 3OYNA 4OAYA 5LD2C 3BCAA 4QPOA 2M4KA 2E5ZA 2XF6A 3OYJA 2DT7B 3S3OA 3DWLE 4NQWB 2CFOA 1IRXA 1KONA 2HQAA 3HL2A 3CF2A 2IXSA 1D1AA 1WFXA 1S9HA 4HNUA 4B47A 4HNTA 4BQNA 1G59A 2VQCA 3A4CA 4BACA 3V42A 3QYEA 4F55A 2A6TA 2HVRA 3DTEA 3K70D 4ZTJA 2LYCA 1DGRM 3BG7A 3OS0A 1PJRA 2UUZA 4XLEA 1V5FA 2JA2A 4MLOA 2LRDA 3CP2A 2KP6A 2KQRA 1BR2A 4BJ5C 4HSTA 2K3PA 2VQLA 2P0WA 4RLQA 3RPUD 3C2GA 4PJJA 4EATA 3FHNA 3BCBA 4BDYA 4XN3A 3OS2A 3PSFA 3DLAA 1DGWY 4LIVA 3C2HA 1D1CA 2F5VA 4B44A 2WY8Q 3K4CA 4C2TA 3ZXSA 2W00A 4XLCA 4XR6A 3K4BA 1T0FC 3PNVA 1K6YA 4IZZA 3OY9A 1D1BA 3FDYA 2I8DA 3MMYB 3SEZA 2OC6A 4BQQA 3A1YA 4D1QA 4E7JA 4BL0B 3U21A 2R7VA 1WJCA 3H35A 3H5NA 3ZR8X 4E7KA 4BUPA 2ELJA 2WADA 2LG4A 3GBGA 3VYUB 3RTRA 3HPGA 5JHFA 4BXFA 1ZELA 4BJ6C 1AA7A 3J7AY 4B3XA 4PUSA 1MNEA 3OIPA 4CCNA 1MMNA 2IS4A 3HOTA 3VSKA 4DIQA 1N78A 2X6YA 2LY2A 2R7WA 3MKZA 2LOOA 4BS9A 4CCOA 2E1MB 4DBQA 3DQVC 4F52A 4XLHA 2V26A 4XORA 3OYDA 2CW7A 1YX5A 4PFPA 2KMUA 3QYFA 4NC7A 3TL4X 3H9JA 2PMZA 3BG6A 4PK4A 3H5AA 3HOSA 2ZFUA 1QHGA 4AVZA 3S32A 1V5GA 3DEEA 3MD2A 2CMPA 4NC8A 2IS6A 3NWSA 3S8PA 3A2KA 2L7KA 4XNFA 3HKZA 2Z16A 3IUOA 3OYCA 1G8XA 2LBFA 3HG9A 3I3LA 1TT0A 4U7BA 4ZC3A 3D5RC 2HU9A 2IS2A 3DTKA 4OAZA 2E1MC 4BE1A 4HG2A 2AQFA 2CW8A 2BVLA 3CESA 3HC7A 1WJAA 3ZQQA 4IQJA 4NNJA 1OLTA 1X1DA 2M3AA 4E6KG 1WJ5A 1UAAA 2W7NA 1LFPA 2X6WA 2VASA 2VXDA 3CZ6A 4D9JA 4ZYAA 3OL3A 4CH7A 1E0EA 3DTIA 3SYTA 2MD0A 2VJJA 2VKDA 3LSHA 4E7HA 1OR7C 3MKWB 2VKHA 1MW7A 1N75A 3VDXA 2L5QA 2LBFB 1ERDA 1LKXA 4XN0A 3D5LA 4IKFA 2M4GA 3HXLA 2ZXHA 3F9KA 4CCJA 3DKXA 2BVMA 5HNFA 2R4GA 1WJDA 1FMVA 4BEHB 4KISA 1Y6IA 4B43A 1T95A 4YELA 2CV0A 4NUBA 4LITA 2GOMA 2L9SA 2CUJA 2R7OA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2AQE A;  2AQF A;  2DCE A;  2ELJ A;  2CUJ A; 
#chains in the Genus database with same CATH topology
 2JVH A;  1IRF A;  5CVV A;  2JUC A;  3H5R A;  4L18 B;  3CC4 I;  2HNH A;  2DXI A;  2PG4 A;  2P7C B;  5JVT A;  1R6R A;  2VXZ A;  1JKO C;  3M8E A;  4XOT A;  1W7P D;  1XS9 A;  5M3M J;  3F8M A;  2WV0 A;  2Z3Y A;  3PUF A;  5FKM A;  2OD5 A;  2L02 A;  4B8X A;  2KZV A;  4WCG A;  5J1Y A;  3MZY A;  2G7U A;  4XBF A;  2XAJ A;  1FC3 A;  5EG0 B;  3QYB A;  2VOO A;  1P9Q C;  3VFZ A;  4RBO A;  4J01 A;  2BY0 A;  3C18 A;  3BG9 A;  5J1U A;  1O57 A;  4F93 B;  3LFK A;  2XRO A;  3HTU A;  2J5O A;  1O7L A;  4I6Z A;  2LY1 A;  2ZB9 A;  2W85 A;  3D5S C;  2ZXI A;  3DP7 A;  1UG0 A;  3K1M A;  1W5C C;  3L2Q A;  4XSX F;  2GOX B;  4CCM A;  2H94 A;  1WJE A;  3ZCO A;  3L2U A;  1LEA A;  4MIM A;  2JSP A;  3JRI A;  3PFY A;  2VJI A;  4IQ4 A;  1EH8 A;  3W2A A;  1I6X A;  4W97 A;  5TRD A;  2HTJ A;  3K4L A;  2VQG A;  2MAB A;  5IPA A;  1VQ9 I;  4IRI A;  1VQ5 I;  1SD6 A;  2ZJR F;  1H9G A;  2CWE A;  1R36 A;  2XB0 X;  3DKY A;  4HF0 A;  5E1W A;  3LL7 A;  1I3Q J;  2UZK A;  4E7I A;  3OMY A;  5FKO A;  1DU6 A;  1TNT A;  4P5O A;  2KZG A;  3HPH A;  4G8X A;  5HS7 A;  1W7P A;  1LE8 A;  1BC8 C;  4G7H F;  4EVI A;  4MEX F;  1R58 A;  4LOC A;  3WHC A;  5CQG A;  1TL8 A;  1SFO J;  2BHY A;  2FMY A;  1G3S A;  3FF5 A;  3SEQ A;  4BBR J;  4NDL A;  1FBU A;  2FE3 A;  4I7H A;  1BL0 A;  2AS5 F;  5A2Q Z;  4EGZ A;  4FE4 A;  2Y75 A;  5J8F A;  2IGO A;  2CG4 A;  3PQJ A;  3WG9 A;  1DDN A;  1GT0 C;  4ZJZ A;  4AU7 A;  1GVJ A;  4XKW A;  4U0V A;  3QOD A;  3LST A;  4ZDP A;  4BDZ A;  4P55 A;  3VYS B;  1IZ1 A;  2IA2 A;  3H9Q A;  4XKB A;  2ZJ2 A;  1K83 J;  5D4S A;  1YOV B;  3RYR A;  2CS3 A;  2LRE A;  1BI1 A;  3SXY A;  2PMU A;  1WI9 A;  3J81 K;  1ZRD A;  3BZK A;  2NYX A;  1F36 A;  3E1S A;  1SD4 A;  2EH3 A;  2FSW A;  4PSW A;  3K70 C;  1IXC A;  1VQP I;  1RKT A;  1HA8 A;  2VBX A;  2K9Q A;  2HEO A;  3KP7 A;  3TGN A;  1OCO H;  2V1D A;  4MHG A;  3M4O J;  2E71 A;  3LSK A;  3VOD A;  1Y8R B;  3IHU A;  2V9K A;  3I4P A;  3ZMU A;  3BJ6 A;  5KHD A;  1MMG A;  3W6V A;  2GA2 A;  5EZG A;  3VYR B;  5CJ9 A;  2E34 A;  4LD5 A;  2RNG A;  2DK5 A;  3OSG A;  3VSL A;  3HGY A;  2ZNY A;  5L3F A;  4XM3 A;  5ILU A;  4LG3 A;  5KCM A;  3OYF A;  2XAF A;  1GV5 A;  3WHB A;  1X19 A;  4N0B A;  4HF1 A;  4XL9 A;  1RI7 A;  1SVO A;  2VBW A;  3BLY A;  1TWH J;  4A3D J;  2BY3 A;  2VIX A;  1G3Y A;  2XAU A;  3PFI A;  2NVY J;  1WKM A;  4CGZ A;  4CDG A;  1ZGJ A;  3E6D A;  3LSJ A;  5E79 C;  3V7R A;  1HF0 A;  2ID6 A;  5FRN A;  4D5F A;  2ISY A;  1D0Z A;  2MYS A;  4NHJ A;  3E5U A;  3EYY A;  4M3D A;  1MZB A;  2JUG A;  2XPU A;  2MFZ A;  4ESJ A;  2GA1 A;  4XQF A;  4C2M J;  1ZGW A;  2D1H A;  3S16 J;  1BIB A;  2DMP A;  3N05 A;  2BOL A;  2LVS A;  4KYW A;  2FXA A;  4YFX F;  1FIA A;  1RC9 A;  1IN5 A;  2ME0 A;  4MNU A;  2IBD A;  1M1E B;  2Y30 A;  3IH3 A;  1X2N A;  2QWW A;  3L9F A;  4MO7 A;  4ITV A;  1P2F A;  1YS6 A;  1KU7 A;  2O8X A;  3CC2 I;  4UY8 I;  4WXC A;  1XGM A;  3GFI A;  4Z2Y A;  2BHZ A;  2CJJ A;  2R3S A;  2W1O A;  2OUM A;  5J40 A;  3R61 A;  3H36 A;  4KIT B;  1V3F A;  3CJN A;  2EZH A;  2K9L A;  4IEJ A;  2TRT A;  5JI6 A;  2OF7 A;  2KJC A;  2O9L A;  2XF7 A;  1TQI A;  2A68 F;  3B6C A;  3AL0 C;  4ZH4 F;  2P8T A;  5K1Y A;  4BGD A;  1EH7 A;  3I53 A;  2GZW A;  1BA5 A;  1Z6T A;  2KHM A;  5DTD A;  4IHY A;  2NVU B;  2F6C A;  4F3Q A;  2MA3 A;  2VBZ A;  1XMX A;  2I5U A;  2CRG A;  3F22 A;  2M7B A;  2DQR A;  4D7M A;  3OL4 A;  3E0J B;  2KJB A;  2JSC A;  4BU2 A;  4PJN A;  3RKW A;  1A31 A;  4LIU A;  2Y69 H;  1MD0 A;  1J09 A;  2XC7 A;  4RAZ A;  5IP9 J;  3RI4 A;  5LGN A;  2P4W A;  3MKY B;  1H89 C;  3ABT A;  3LSR A;  4DJA A;  4KMF A;  2G7H A;  1W4M A;  4HSR A;  3HIF A;  2HYG D;  5CLS A;  3FBI B;  1SMT A;  3GLL A;  3QPS A;  2IS1 A;  4X6A J;  1LE8 B;  3M9A A;  2DJI A;  2QBY B;  2VC1 A;  3DBL B;  2FBK A;  2WAE A;  1QO0 D;  3WU2 C;  3S1M J;  3JSP A;  1BR4 A;  3RSN A;  3RYP A;  2WB1 A;  4FHT A;  3U2R A;  2VL8 A;  2ZXJ A;  4KUM A;  2DT6 A;  3H92 A;  2E1C A;  4ON0 A;  2GBY A;  3K1N A;  4UHT A;  2OAZ A;  3BC8 A;  3ZN1 A;  2LKX A;  3HOZ J;  5L3B A;  1HKS A;  3V7C A;  2JT1 A;  1TQM A;  2EFW A;  2DYR H;  2L9R A;  5HDK A;  4AIJ A;  1AWC A;  3FM5 A;  2M0M A;  2LKP A;  2OCC H;  3G1L A;  5F0H A;  3FIW A;  3RQI A;  1PYV A;  2DFI A;  2XKO A;  1YQA A;  3OYK A;  2VUM J;  3B6A A;  4OAY A;  2M4K A;  3OSF A;  2MGQ A;  4Q47 A;  3S3O A;  3DWL E;  2GXB A;  4DW6 A;  1IRX A;  1MNM C;  2P5K A;  2B63 J;  1F1Z A;  3WGH A;  5M3F J;  2HQA A;  2ZKZ A;  2OBP A;  2OPT A;  2WWY A;  2DN0 A;  1GV2 A;  3IKT A;  1D1A A;  1S9H A;  1KYZ A;  4HNT A;  2K7L A;  4RGS A;  5CVU A;  4ESF A;  3A4C A;  1WH5 A;  3GVA A;  1L3L A;  1S72 I;  3BR0 A;  5BOX A;  5ILS A;  2IJL A;  1NK2 P;  5FLV A;  1ETX A;  2ZME B;  5D6E A;  3I55 I;  4ENN A;  2H8W A;  1U78 A;  1Z0X A;  3B02 A;  3NRV A;  3QPH A;  3OS0 A;  2PMZ N;  4IO9 F;  3JRB A;  4XLE A;  4I01 A;  9ANT A;  3CP2 A;  2X0L A;  3HSF A;  4HST A;  5EYR A;  1K79 A;  2VQL A;  3TKY A;  3A02 A;  4RLQ A;  3DEU A;  3HDD A;  2Z99 A;  2DFH A;  3A03 A;  3C2G A;  5E8G A;  4EAT A;  2M8E A;  1BJA A;  2R7F A;  3JRC A;  5IP7 J;  1UST A;  1SC7 A;  1QVU A;  2HOT A;  3ASN H;  1W5S A;  1YW8 A;  5IYD J;  4L9N A;  2UXX A;  1D1C A;  2A6H F;  1U8R A;  3K4C A;  4IOA F;  2W00 A;  1SEU A;  4XLC A;  3SZT A;  3K4B A;  3BJO A;  1T0F C;  3F8C A;  1K61 A;  1X1P A;  5DS9 A;  1HCR A;  5J4Y A;  4A93 J;  3E5Q A;  4EM0 B;  4ZZD A;  2OQG A;  3A1Y A;  3FMR A;  3ISP A;  2R7V A;  1WJC A;  3H35 A;  3H5N A;  4BUP A;  2ELJ A;  3ZQ7 A;  2WAD A;  3R0J A;  1QPM A;  3MFK A;  4EJV A;  2RNJ A;  3RTR A;  5JHF A;  4BXF A;  5IT9 K;  1ZEL A;  1VQ7 I;  2LP0 A;  3HOX J;  4HLY A;  1EF4 A;  2NNN A;  5GAE J;  2WC2 A;  1SFE A;  2XPV A;  1JUM A;  1S3J A;  4DIQ A;  2LDU A;  2CUF A;  1HOM A;  3IH2 A;  1KGS A;  3Q0V A;  4CHU A;  4KIC A;  3MKZ A;  1XSX A;  2O7O A;  4BS9 A;  4U0W A;  4CCO A;  1EJ9 A;  5L3C A;  4DBQ A;  4F52 A;  1J7K A;  3QRF F;  2EFO A;  3TW6 A;  3OYD A;  2GM4 A;  4LK1 F;  2Q2E A;  2KMU A;  3QAH A;  4L0Y B;  4NC7 A;  1MBE A;  1F4K A;  4H0E A;  2DU9 A;  4HF2 A;  3CTA A;  4HQE A;  4BXX J;  2EWN A;  3DEE A;  2ZJQ F;  2CMP A;  2YS9 A;  3OV8 A;  4ZYE A;  5FLM J;  4KIB A;  4JP0 A;  2Z16 A;  3DXJ F;  3F0C A;  2X6O A;  1X2M A;  1G8X A;  4MQ9 F;  3HG9 A;  3CC7 I;  4ZC3 A;  5EGO B;  2O0Y A;  5D5W B;  1YRN A;  1E3O C;  2CW8 A;  1B72 A;  3CF5 F;  2BGC A;  2IVM A;  1WJ5 A;  1ZRC A;  2K85 A;  1USS A;  2DI3 A;  3A01 A;  5ICC A;  4D5C A;  3ZQF A;  4IHX A;  1O3S A;  5E3L A;  5HDN A;  4I0B A;  1BI0 A;  1JT6 A;  2VJJ A;  2XPW A;  2QUF A;  1Y0U A;  3MKW B;  1ZR2 A;  1TNS A;  1PP7 U;  1MW7 A;  3L00 A;  3GFL A;  2V9V A;  2IEK A;  1LKX A;  3J81 Z;  2M4G A;  4AYB N;  4HX7 A;  3HXL A;  4ZYG A;  5FB2 A;  2EQR A;  4CCJ A;  1HST A;  1A04 A;  2CSO A;  3SFZ A;  3O2P E;  1JT0 A;  1YJW I;  1E17 A;  1LDD A;  3HM5 A;  5EG0 A;  4KIS A;  2BXZ A;  4PZJ A;  3Q0W A;  3W6K B;  4OOI A;  1B8I A;  3NAR A;  2R5Y B;  4G12 A;  4A3F J;  2JTV A;  2XDV A;  2NOJ B;  5TGT A;  2O03 A;  2VPR A;  4A3M J;  5FO5 A;  1WCM J;  3BQY A;  2JA7 J;  1P92 A;  3HGG A;  2A6E F;  2ECB A;  1W0U A;  4LLL A;  4A3L J;  2MBF A;  1VND A;  2QVO A;  2QZ8 A;  4FX0 A;  1Q1H A;  1LDK B;  2Y0S A;  3ZGK A;  2R7R A;  4Y13 A;  2VT2 A;  4E70 A;  1ODD A;  1HDD C;  2I10 A;  2M5W A;  2UV1 A;  4WK8 F;  5FKK A;  2BXY A;  3PO3 J;  1IXS B;  2GAU A;  2WA0 A;  3V7S A;  4AVP A;  2COB A;  5AON A;  2QF7 A;  1OQY A;  4BHC A;  4FAS D;  2WY7 Q;  2H8R A;  3HTS B;  2XKP A;  1XGS A;  2XGE A;  4QPQ A;  2V6E A;  2JK3 A;  5E20 A;  3P9K A;  2X6X A;  2YPR A;  4OWR B;  1T2K A;  4A0Z A;  3OIQ A;  4A12 A;  2Y0M A;  2ZXW H;  4HEA 2;  3ZQI A;  3IP4 B;  6PAX A;  2CH0 A;  2FUG 2;  2K3F A;  4UVC A;  1XDS A;  1KQ9 A;  1RZ4 A;  3I4N J;  2IGK A;  2OTL I;  3P5J A;  5C4J J;  3BTJ A;  2VLA A;  3ECH A;  1Y39 A;  3IL2 A;  1FT9 A;  2BY2 A;  2DAO A;  3KEY A;  1XX5 A;  3E7L A;  4CA0 A;  1Y56 A;  3ZQG A;  5D8K B;  3FXR A;  5B66 C;  1HC8 A;  2O61 A;  1QVT A;  3TDU C;  2Q0O A;  4PCQ A;  2K5C A;  4GCV A;  4H4K C;  3TOA A;  2O8K A;  4UB8 C;  2A05 A;  3C2B A;  1Z3Y A;  2L9V A;  2HWV A;  2DMU A;  2KIQ A;  2NS8 A;  2ZSH B;  3CJQ B;  1B59 A;  4II3 A;  1F5T A;  5HS8 A;  3IRQ A;  3CCQ I;  2KDZ A;  3EDP A;  1QBJ A;  3LQR A;  2EIK H;  2DA7 A;  2BE5 F;  2MD5 A;  5F0C A;  2MH9 A;  3OR1 C;  1P7J A;  3LSG A;  1JGG A;  1DP3 A;  2MLK A;  1TW3 A;  2ME6 A;  2L7F P;  4B1R A;  4JX4 A;  3CP8 A;  2QKM B;  5LEK A;  2Z33 A;  1J5Y A;  3ECO A;  2E1N A;  1WRJ A;  3KLO A;  4M72 A;  3T5X A;  4ZDL A;  4WF2 A;  2FNP A;  3K6G A;  4A3E J;  2RRE A;  1YW7 A;  3CLO A;  4LK0 F;  2BW3 B;  1STZ A;  3KFW X;  3HUG B;  3HYI A;  2QEN A;  2Q2E B;  1VZ0 A;  3MZ8 A;  4HPQ A;  5F0F A;  1KZH A;  4F92 B;  3TO6 A;  2VB6 A;  1X4O A;  4KIF A;  2YU3 A;  2W24 A;  3GCM A;  3WGG A;  4LB5 A;  1JUP A;  4K2E A;  5D8L B;  5HOD A;  1XD7 A;  4PGH A;  1O3T A;  2KLO A;  2HI3 A;  4HLX A;  2F5F A;  3PNT A;  2JA6 J;  1JHF A;  3J80 Z;  2CQQ A;  3KEO A;  4DZP A;  5IOZ A;  1YRN B;  1B72 B;  3EUA A;  2EIJ H;  3F72 A;  4PFO A;  2HOA A;  3K4N A;  3S3N A;  1R5I D;  5DCF A;  2R93 J;  3OWT A;  2MW8 A;  2DA3 A;  2DPU A;  5K5O A;  1IUY A;  2E35 A;  5ILV A;  3BWG A;  2JWT A;  3FKJ A;  1S29 A;  5GPA A;  3QPL A;  4N4O B;  1XDU A;  4RM2 A;  1T38 A;  1J0R A;  2FA5 A;  2K86 A;  3L09 A;  1IDZ A;  1I5Z A;  2HYF A;  1FYK A;  3LOC A;  2XAH A;  4BH9 A;  5LFA A;  3M3Y J;  2L7M P;  2XVC A;  2FJ1 A;  4YEJ A;  5KAF C;  4JOM A;  1LDJ A;  5H2F C;  5D5V B;  3MN2 A;  4A3K J;  2QM3 A;  1B8I B;  1U5T B;  2G9W A;  2CQ7 A;  1JE8 A;  2EIM H;  3H1C A;  1FYM A;  2F4O B;  4S0H B;  4N4N B;  1MMD A;  1OCR H;  4QWQ A;  3BT9 A;  2V1N A;  4HNV A;  2EA4 A;  1X1C A;  1UG2 A;  2WAF A;  4Y3O A;  1KQ8 A;  2BV6 A;  4UV8 A;  2H09 A;  3TQN A;  4YIR X;  2W48 A;  5LEJ A;  1OCT C;  3QOE A;  2Z2S B;  1XC5 A;  4Q4Z F;  5D6F A;  5E3N A;  1FMW A;  5E3O A;  3TP0 A;  2CUZ A;  1RRJ A;  3HHH A;  1PUE E;  2EFP A;  2EK5 A;  1IW7 F;  4DOZ A;  1VQO I;  4DGW B;  2L7Z A;  2HVQ A;  2F4I A;  4A6E A;  4P1W A;  1H0M A;  2QBY A;  1ACI A;  3WTX C;  3BR1 A;  5LBQ A;  2CUE A;  4KFC A;  2KRH A;  1SFK A;  3CDL A;  1G3W A;  2NVX J;  2AHQ A;  3KYL A;  2JA5 J;  2VQH A;  1A6I A;  3BRO A;  3I64 A;  3VWB A;  2PN6 A;  4DNC A;  4L9V A;  4CZC A;  3A01 B;  3N4M A;  2PFB A;  3FK7 A;  2K4B A;  1T98 A;  3LA7 A;  3KP6 A;  3RJP A;  1DUX C;  3I5U A;  1VFC A;  1MBH A;  1MKM A;  1XMA A;  1OYW A;  2KKO A;  4FIS A;  2KL4 A;  1ETV A;  2QGU A;  3GX4 X;  3LSP A;  2XAQ A;  1MBF A;  1X58 A;  2YSR A;  2M7A A;  3G4S I;  4BY7 J;  2JPB A;  4O5V A;  1S7O A;  4RM3 A;  2CFX A;  3JRH A;  1MJA A;  2B7E A;  3DPU A;  5CVI A;  5DV5 A;  3U1D A;  5HLT A;  2UWM A;  3EPZ A;  3LFU A;  3KZI C;  1P4A A;  4IHS A;  2COM A;  2R7Q A;  3RQ4 A;  1JJ8 C;  4BJT A;  4WWC A;  1X3W B;  5KAI C;  3H0D A;  3HOV J;  5B1B H;  2LFB A;  4GRI A;  2DJN A;  2LSO A;  3OS1 A;  2EJR A;  1R23 A;  4ENM A;  3CCL I;  1VQ6 I;  4Y17 A;  2KIU A;  2X1E A;  5E3M A;  1ETY A;  3LA3 A;  3RKX A;  4BQO A;  1E2X A;  2ZC2 A;  3WTS C;  3HSR A;  5CQE A;  3PNY A;  4EM1 A;  5K5Q A;  2K9N A;  1F9N A;  4DZJ A;  3EUH A;  5LD2 C;  1IC8 A;  2ZME A;  1NHA A;  4AIK A;  2E5Z A;  1GHC A;  1I1G A;  3FXK A;  2DT7 B;  3OYJ A;  1RR8 C;  4B09 A;  2W84 A;  2NAZ A;  5FLX K;  1LVA A;  1KON A;  3ZOB A;  2DOD A;  2VBY A;  1P7I A;  2IPQ X;  2VKV A;  1KYW A;  5FD5 A;  5HLH A;  4A3G J;  1FIP A;  5M5W J;  3D0S A;  4A0X A;  1WFX A;  1XSD A;  2PEX A;  3FMS A;  4B47 A;  4BHB A;  2D5V A;  2R7D A;  4BQN A;  4BHP A;  2VQC A;  3V42 A;  4XK4 A;  5FGM A;  3U9G A;  3CMY A;  1S7E A;  2A6T A;  3F8N A;  2W57 A;  4IHW A;  1VI0 A;  2VI6 A;  3FM3 A;  1ZH5 A;  5AIP A;  2FNA A;  4M74 A;  2N8G A;  3LQQ A;  3SQN A;  2K40 A;  3CUQ A;  3O3K A;  2EIL H;  2JPC A;  3BG7 A;  3LNQ A;  4IRG A;  2Y48 A;  3GTM J;  3BTC A;  1XGN A;  4QLC U;  3GXO A;  4GXO A;  2KP6 A;  2KQR A;  1BW5 A;  1BM9 A;  4BJ5 C;  4JK1 X;  5GAG J;  4UUV A;  1HQC A;  1XB4 A;  1R1T A;  2P0W A;  2DFE A;  5AIQ A;  3RPU D;  2HDD A;  2CW0 F;  3C3W A;  3KIO A;  4M6Y A;  1P6R A;  4XID A;  3JAM K;  2V1X A;  4BDY A;  3OS2 A;  3DLA A;  3K2A A;  1ENH A;  3QU6 A;  1EKE A;  1V55 H;  3DCF A;  4LIV A;  2F5V A;  4A3B J;  2DOF A;  4C2T A;  3ZXS A;  5LGU A;  5JFR A;  1D8K A;  4XR6 A;  4M6V A;  5DCM B;  3J7A O;  3S17 J;  1UHS A;  1IGN A;  4MTE A;  1RIO H;  4AUX A;  1MSF C;  1AOY A;  3ZMS A;  2OC6 A;  3WTT C;  4BQQ A;  2VC0 A;  1GVD A;  4IVN A;  2YX7 A;  1HXD A;  3ZR8 X;  4IPA A;  1FOY A;  1R1U A;  1XCV A;  1DPU A;  2DMT A;  5F08 A;  3SZP A;  2HQ5 A;  1FSE A;  2MSY A;  5LHG A;  3BG3 A;  3GBG A;  3IH4 A;  3VYU B;  5J47 A;  3HPG A;  1S8N A;  2NNY A;  1ZAO A;  4BJ6 C;  3J7A Y;  1IN7 A;  2OU2 A;  5ICF A;  4RS8 A;  3EYI A;  4IHT A;  1MNE A;  3OOP A;  4B4C A;  3S2H J;  3M8F A;  2NXN B;  1FZP B;  1MMN A;  5LGT A;  2FF4 A;  3C7J A;  1FY7 A;  3IWF A;  3QP5 A;  2OZU A;  4DYC A;  4PDK A;  5J3L A;  5JLX A;  4YG2 F;  1ETW A;  5BMZ A;  4LG0 B;  2LY2 A;  5EGO A;  2LOO A;  3RPU A;  3LAP A;  3JRD A;  1FYL A;  4L0Z B;  4XLH A;  1IUF A;  2V26 A;  1G3T A;  2E19 A;  2OJE D;  5D5X B;  3AG4 H;  2V79 A;  3PM1 A;  4OIN F;  4DYQ A;  3H9J A;  2PMZ A;  3B73 A;  3BG6 A;  3ASO H;  2ISZ A;  2QA4 I;  5KVR A;  1QHG A;  3S32 A;  4A3J J;  1V5G A;  3MD2 A;  4YFK F;  1PP8 F;  3CO6 C;  1AKH B;  4NC8 A;  1V54 H;  3HRM A;  4AC0 A;  3IUO A;  3OYC A;  2BZT A;  3I3L A;  4UB6 C;  3DFG A;  2LMD A;  4P9U A;  1HW5 A;  3D5R C;  2HU9 A;  5TJJ A;  1Y8Q B;  4X1E A;  5IYC J;  1WJA A;  1JHH A;  1WHU A;  2ESN A;  5EZH A;  4NNJ A;  1OLT A;  3BPX A;  4Y52 J;  3CDH A;  2HXO A;  4M3F A;  2QSH X;  2M3A A;  2E36 A;  2R5Y A;  1LFP A;  2X6W A;  1U8B A;  3GFM A;  4ZYA A;  4CH7 A;  1KA8 A;  3ERE D;  1H9T A;  1HBX G;  3CCJ I;  2VKD A;  3VEP A;  1KU3 A;  5HLI A;  3KP5 A;  3VDX A;  4KIG A;  2LBF B;  1ERD A;  2HYJ A;  4XN0 A;  5DDG A;  3D5L A;  4I02 A;  4IKF A;  1K7A A;  3ZP5 A;  3E6B A;  1R22 A;  1WJD A;  3LA2 A;  5E1X A;  2PBI A;  1LEB A;  4B43 A;  2O6G E;  4BBS J;  2CV0 A;  2HFH A;  1B4A A;  3GFJ A;  1JKP C;  2LLK A;  2E2I J;  3IAM 2;  2HDC A;  1OIS A;  1IO2 A;  2EV5 A;  1SAN A;  4ZZL A;  1UEL B;  4PJL A;  1MH4 A;  2EPF A;  3PO2 J;  4CCK A;  2L2O A;  3M8J A;  1Z6R A;  4RB3 C;  3LSM A;  4RGU A;  4Q48 A;  4M9Z A;  4QIW N;  4CSW A;  5CKT A;  3RPQ A;  1UFM A;  3OOU A;  1BW6 A;  1D5V A;  3OYG A;  2HOE A;  2KFD A;  2YU9 J;  2RQP A;  1YX3 A;  3CUQ B;  1K6O A;  2QQ8 A;  1LNW A;  5E8I A;  4CZZ A;  1SVL A;  3S14 J;  5FRM A;  4MFE A;  5DEQ A;  3AKZ A;  2W82 A;  1X4P A;  3CCU I;  2FEZ A;  2ECC A;  2Z5U A;  3SFI A;  5B5E C;  4AWX B;  2P7V B;  1N77 A;  2F5E A;  1MBG A;  2XAG A;  3HSE A;  4NB5 A;  2BBY A;  3W2V A;  3H9G A;  3Q5F A;  4CYD A;  4DBR A;  5EEG A;  3BG5 A;  1FJL A;  1ORK A;  2YX4 A;  3WTU C;  4HBL A;  4G94 A;  1FOX A;  1VQL I;  2KRF A;  3G1M A;  5BPD A;  2HQR A;  3SZG A;  1JTX A;  2XGC A;  3BR5 A;  2FML A;  2L9N A;  5KNL A;  2H1K A;  4IX7 A;  1WVR A;  2FOK A;  5IP6 A;  3BZC A;  3TP3 A;  3CCE I;  1YJN I;  3KP4 A;  1SAX A;  5C4X J;  5A2Q K;  1EA3 A;  4I09 A;  2QSG X;  2XSJ C;  4R8H A;  1IV8 A;  3OYE A;  3ZQL A;  2CU7 A;  3GUD A;  3KP3 A;  4CCL A;  4AYB A;  1DQU A;  4BY1 J;  3FZV A;  2BW3 A;  1Z05 A;  2OTJ I;  1QZY A;  1U2W A;  3F23 A;  4Y33 A;  3G71 I;  1D0Y A;  3HUG A;  1J59 A;  1WJB A;  1BOB A;  4RB1 A;  2LD5 A;  3I0T A;  5F27 A;  5DUK A;  3GTP J;  1IG7 A;  3GZN B;  1QQI A;  1U9O A;  3VOE A;  3RZD J;  1W36 D;  3T1B A;  1NG6 A;  4MQV A;  5CYV A;  1MSE C;  3RIR A;  2DYS H;  4RMN A;  3L2W A;  1C0W A;  3L7W A;  3FX3 A;  2IT0 A;  3WTW C;  2CYY A;  5F1R A;  1MDM B;  4C3I J;  2EFN A;  5E17 F;  4FET A;  4BE2 A;  3SDG A;  4B48 A;  1SFX A;  1OMI A;  3CCV I;  3T0Y A;  1W5T A;  3ZPL A;  1R5G A;  3DF8 A;  1XSV A;  4M71 A;  3E3V A;  3I59 B;  4PJM A;  4RLF A;  2FQ3 A;  3FBN B;  5C44 J;  2IGN A;  2F2E A;  3J7Y J;  3F21 A;  2X51 A;  1LQ1 A;  3IAS 2;  4OIP F;  1SD7 A;  3BTL A;  1QA6 A;  3J7Z I;  5DM6 F;  3LSI A;  2M45 A;  3VYT B;  3HHG A;  2B0L A;  1QHH D;  1QU3 A;  1G2H A;  1ZTR A;  2RQQ A;  2CV2 A;  3OYH A;  1T6S A;  3PL8 A;  3JRG A;  1CF7 B;  2F4M B;  1F43 A;  4CIC A;  1RPW A;  4MEY F;  4IL6 C;  3V8J A;  3MEX A;  4MTD A;  3K7A J;  1ZG3 A;  4G6D A;  2DA4 A;  2HDW A;  2DDA A;  3DU5 A;  1PUF B;  3DPL C;  1FSH A;  4ZDO A;  4E7S A;  4XRM A;  1GXP A;  2XF5 A;  3NEU A;  1Y0N A;  5B1A H;  3WTV C;  3S1Q J;  4F91 B;  1U5T A;  1BC7 C;  1ZAR A;  3H3V K;  1O3R A;  1QGP A;  4PSX A;  2OV7 A;  4W1U A;  3TDZ C;  3GME A;  1ZRF A;  1IDY A;  2QEX I;  4DQ2 A;  1IAW A;  2RKH A;  1Z3X A;  3F8F A;  3GO5 A;  5IYB J;  1Z7L A;  3G6E I;  3E5X A;  1I27 A;  2WAQ N;  1TZL A;  1BR1 A;  2R7T A;  5GAH J;  1MJ9 A;  2KIF A;  2E1O A;  3ROU A;  2A5W A;  3GTL J;  3GTO J;  1U0J A;  2JVG A;  5L3E A;  2AQE A;  4XMY A;  2A3S A;  4Y4R A;  2HZD A;  2Q1Z B;  1IJW C;  4OIR F;  2QQA A;  4HA8 A;  3W2W A;  2NRA C;  2VT3 A;  4A5N A;  2DTZ A;  3KX2 A;  4C9Y A;  5DD8 A;  4CUG A;  5H20 A;  3IWZ A;  1Z9C A;  5HDG A;  1ZG1 A;  3EQL F;  3KLN A;  2H6C A;  1RET A;  2G0E A;  1IRG A;  1FP1 D;  3TMO A;  1QZE A;  4OIQ F;  3I4M J;  3FMQ A;  3BQZ A;  5M5X J;  2ADU A;  4IHV A;  3PIP F;  3KCC A;  3TO7 A;  2HVS A;  3QU3 A;  4GYG A;  1SMY F;  4LB6 B;  4GYI A;  1POG A;  4I99 C;  1TTY A;  5LHH A;  1W36 C;  4HRI A;  1U5T C;  1YIO A;  2XGD A;  4HV6 A;  2IP2 A;  3O6B B;  3EUK L;  3H0G J;  1K78 B;  1MMS A;  2X1D A;  4G6T B;  4HZF A;  3R0A A;  4JBA A;  2M34 A;  3W6J B;  1K4S A;  3K10 A;  4ZTF A;  3BR6 A;  1BIA A;  2QQB A;  4C30 A;  4BKX A;  3KYD B;  5J1R A;  1YS7 A;  2F5D A;  2ZBK A;  2FRH A;  3FWE A;  1HDP A;  1UB9 A;  2LF8 A;  4AID A;  4XLF A;  2ZSI B;  1OR7 A;  1TBX A;  2BY1 A;  2CQN A;  3PUB A;  2DCE A;  4V2F A;  3PJR A;  3QPT A;  4EV0 A;  2IW5 A;  2QSF X;  2LK2 A;  1J75 A;  2ZCW A;  1NG7 A;  3K4J A;  2E7X A;  1OYY A;  1R7J A;  4WXD A;  1VQ8 I;  1W0T A;  5LHI A;  1GDT A;  3ZRG A;  3AFH A;  2V9P A;  2Y9Y A;  1Y1V J;  1FLI A;  2HZT A;  1I1S A;  2VJ4 A;  1PDN C;  1D5Y A;  3OIO A;  4HYE A;  4A3I J;  1Y1W J;  4KNY A;  4E7L A;  2R92 J;  5CPR B;  3ABL H;  3KZZ A;  2BEO A;  1XG1 A;  3GEZ A;  3PSI A;  4R79 A;  2DLL A;  2XV4 S;  3Q0U A;  3RZO J;  1WGX A;  4KMU X;  1DPR A;  4U0Y A;  5EJC A;  1SFU A;  2TDX A;  2NS7 A;  2D1V A;  5H6R A;  3OYA A;  3BY6 A;  1ETK A;  3T8R A;  5K5R A;  2HOS A;  4A69 C;  3BCA A;  4HAM A;  4QPO A;  1RUO A;  2HKX A;  3GW2 A;  4DYR A;  2MC3 A;  2DT5 A;  4RA2 A;  1R71 A;  4D7N A;  2H27 A;  1ULY A;  3HRU A;  2PMH A;  2DA6 A;  3JW4 A;  2IXS A;  2UXN A;  4KDP A;  2FOW A;  4KT5 C;  3ERM A;  2FQ4 A;  1G59 A;  1Z7U A;  4OU0 A;  3JRF A;  1UJ8 A;  4BAC A;  2AO9 A;  3VB2 A;  2QYO A;  2M8G X;  3DBH B;  4I0A A;  1YHQ I;  4HW0 A;  3F3X A;  3FXU A;  3GTJ J;  2HVR A;  4I98 B;  3K70 D;  4ZTJ A;  1P4X A;  5JLW A;  2V6C A;  3MQ0 A;  4M73 A;  5TIS C;  2LYC A;  4Z6Y A;  1X3U A;  1DGR M;  5K7Z A;  2VE9 A;  1IRZ A;  1PJR A;  1S7A A;  3ABK H;  4Y7N J;  2UUZ A;  2EZK A;  2JA2 A;  3HRS A;  1O4X A;  5DCM A;  1TP4 A;  1BR2 A;  5F04 A;  4LGW A;  2K3P A;  2JMW A;  3HKZ N;  2LTP A;  4GO1 A;  1REP C;  4U7D A;  2ZFW A;  1ON2 A;  3BPV A;  2HXI A;  4KN4 X;  2QCO A;  1OJL A;  3S2W A;  1KU2 A;  4O3M A;  3CCR I;  3PSF A;  1FWZ A;  5GAD J;  4OIO F;  1DGW Y;  2EZI A;  1G4D A;  2L0K A;  3C2H A;  1LPQ A;  3S1N J;  3N97 A;  1MH3 A;  4B44 A;  4EJT A;  3NQO A;  1ITY A;  4UVA A;  1AU7 A;  4UNO A;  5ERI A;  4RAF A;  3BZ6 A;  1VQN I;  1X3Z B;  3WTZ A;  1WSU A;  3ZQH A;  3OY9 A;  3SJM A;  1HW1 A;  2DMQ A;  1D1B A;  4QSH A;  3FDY A;  2I8D A;  4M3B A;  4LG0 A;  3SEZ A;  3S1R J;  3GF2 A;  4E7J A;  4OMY A;  5DD4 A;  3BR2 A;  2WTE A;  5E18 F;  4G7Z F;  4E7K A;  5CVJ A;  4G6Q A;  2OCE A;  3RKQ A;  2DBB A;  4LFU A;  4XRS A;  1YW9 A;  2X48 A;  4I2O A;  1ETQ A;  1AA7 A;  3K2Z A;  4PUS A;  4M6X A;  1AKH A;  3OIP A;  2GWR A;  3V4G A;  1I3A A;  1QRY A;  2Y2Z A;  4ENK A;  2CQK A;  1JUS A;  3VSK A;  4EJU A;  1N78 A;  3LWF A;  3O8H A;  2VON A;  2LR8 A;  2CGP A;  2FBI A;  3KPH A;  4GGG A;  3MCZ A;  5B3S H;  4NBQ A;  2E1M B;  5JVG F;  2DDB A;  3DQV C;  3WU1 B;  2ACJ A;  4XOR A;  2DOE A;  2CW7 A;  1YX5 A;  4IXA A;  4CYC A;  5IT9 Z;  4PFP A;  1FBS A;  3QYF A;  1WH7 A;  2HQN A;  2J5P A;  4L5J A;  3TL4 X;  4RB2 C;  1TT5 B;  1G6N A;  1I50 J;  4M9S A;  1H8A C;  3ML6 A;  4PK4 A;  3H5A A;  3RDI A;  3HOS A;  2PJP A;  4AVZ A;  1VQ4 I;  3X2Q H;  1U6G A;  3NWS A;  2L7K A;  4XNF A;  1IN8 A;  1ZGA A;  3R4K A;  2MH2 A;  4ENJ A;  1ZN2 A;  2LBF A;  2X4H A;  3I56 I;  3CMA I;  1TT0 A;  2IS2 A;  2DQL A;  2VOP A;  1JKQ C;  4BE1 A;  4HG2 A;  2OA4 A;  2BVL A;  5ICE A;  3CES A;  3HC7 A;  1QPI A;  1UMQ A;  4IQJ A;  1ZHF A;  4OMZ A;  4E6K G;  2NVT J;  2W7N A;  2F5C A;  1MBK A;  2VAS A;  3CZ6 A;  4D9J A;  2DFF A;  3GZ6 A;  5GP9 A;  4XIC A;  5D5U B;  3CDI A;  2XB5 A;  3BJA A;  2MD0 A;  2V1U A;  3WU0 A;  4E7H A;  4GFB A;  4GDF A;  3GZ5 A;  1JGS A;  2VKH A;  1N75 A;  4J19 A;  1LUJ B;  2L5Q A;  5K7F A;  1HW2 A;  3L2C A;  2GXG A;  3Q3S A;  4M3G A;  1D8J A;  3DEW A;  2ZXH A;  1BN5 A;  3F9K A;  3QOP A;  1YG2 A;  2BVM A;  5HNF A;  3JRE A;  2R4G A;  1QZZ A;  1VF9 A;  1DP7 P;  1SD5 A;  2STT A;  5BQT A;  3CME I;  3JCU C;  1ZKG A;  2RGV A;  3KET A;  4LIT A;  5EEA A;  2GOM A;  1B9M A;  2CUJ A;  4ANJ A;  5LRS A;  4L5E A;  3MWM A;  3KEQ A;  2XSD C;  2HKO A;  2DA5 A;  4XLN F;  1QNT A;  3RKY A;  3BOQ A;  2EB7 A;  4ZYD A;  3OYI A;  1RES A;  3GTQ J;  5HOO A;  3JTG A;  2R5Z B;  4RAG A;  3TBI A;  4D0P A;  2RV8 A;  2LH9 A;  4EGY A;  2W25 A;  4XLP F;  1CGP A;  3E97 A;  2CQX A;  4XLA A;  2VJ5 A;  2AXT C;  3HOY J;  3CUO A;  4UUT A;  2DA1 A;  4XRS G;  4ABZ A;  5ED4 A;  3G73 A;  2ICW G;  3DLL F;  2KRC A;  1EV7 A;  5BNG A;  2ELH A;  3DU6 A;  1HSJ A;  3K69 A;  1T56 A;  3EUH C;  2LNB A;  1BI2 A;  2ZME C;  3AG1 H;  3JRA A;  1WZ2 A;  3AG3 H;  1VQK I;  4JYK A;  2DTR A;  2ELK A;  2QQ9 A;  1LJ9 A;  1R9T J;  2ESH A;  2CV1 A;  5HLG A;  2PJR A;  2WBM A;  2E2J J;  1L0O C;  1YLF A;  3MKL A;  3ZMZ A;  2JJ7 A;  2M2E A;  5FJ8 J;  2CO5 A;  1XN7 A;  2IGM A;  3K4K A;  3LMM A;  3WE3 A;  2EA2 A;  2FD5 A;  2M9H A;  2Z9O A;  5BS6 A;  1IN4 A;  3IKV A;  1RKW A;  4FT8 A;  5L3G A;  2K9M A;  2V7F A;  4TV7 A;  1D3Y A;  5HNH A;  1I6H J;  3NWT A;  2VE8 A;  2GIZ A;  5DUI A;  3I71 A;  3CUQ C;  3OR2 C;  3I9V 2;  3DKW A;  4B3A A;  2A07 F;  4NC6 A;  1O3Q A;  4CXF A;  3MAJ A;  1SAU A;  4IOC F;  1X1A A;  3ZN0 A;  3FIS A;  1UZC A;  3OYB A;  5EDN A;  3COA C;  1MDM A;  2DO7 A;  1J9I A;  2VKE A;  3M7G A;  1TWC J;  1Z77 A;  3K1P A;  2IA0 A;  3DPT A;  4FQG A;  1XCB A;  3MZH A;  2EIN H;  2B9S A;  3WOD F;  2ZO4 A;  1IV6 A;  3WG7 H;  1FTZ A;  1MGT A;  3I59 A;  3M07 A;  4XON A;  2YUS A;  1KU9 A;  3F6O A;  3CD6 I;  1UHW A;  2P5L C;  3V8L A;  4BE0 A;  4I76 A;  5E1Z B;  1DU0 A;  1ZRE A;  3AG2 H;  2L4M A;  1WPK A;  5F6F A;  2LF7 A;  4C3H J;  2A61 A;  2IRF G;  4P9F A;  2P81 A;  5JR3 A;  4YIF A;  1CF7 A;  3CMM A;  1GXQ A;  2O3F A;  4E7Z A;  1HKT A;  1XGO A;  3PIO F;  2PI0 A;  1GUU A;  1W7P B;  3P9C A;  1ETO A;  3W3C A;  3CLQ A;  2FU4 A;  1YFH A;  2TCT A;  3ELK A;  1PUF A;  1KQ0 A;  3KP2 A;  1LB2 A;  1Q1V A;  1ZYR F;  4CYC B;  3CCM I;  3J80 K;  2VPL A;  2HPM A;  1IN6 A;  2ID3 A;  4KT6 A;  1R5H A;  2E60 A;  4NQW A;  4U87 A;  1RUN A;  4G7O F;  3FHZ A;  2RC4 A;  5FRO A;  1TWG J;  5F1J A;  5LRR A;  1U9N A;  1APL C;  2D2W A;  3CQZ J;  2AXL A;  2M30 A;  2A69 F;  4YRV A;  4HX8 A;  3RCO A;  1S6L A;  4FCY A;  2OQR A;  1YE9 A;  1UHM A;  1Z21 A;  4RB0 A;  2MC4 A;  4L5I A;  2LC2 A;  3FXJ A;  4IF4 A;  3UR3 C;  1B6A A;  4XSZ F;  2DW4 A;  2JN6 A;  5FFX A;  2C6Y A;  4EEF G;  4IJA A;  2W4S A;  1T0F A;  3FXM A;  3A0H C;  4EQQ A;  1BI3 A;  4AM3 A;  2KPM A;  3BP8 A;  3G2B A;  2DMN A;  2BYV E;  4YII A;  1FOW A;  3E6M A;  2Z1D A;  4Q5S F;  4RGX A;  2ZJP F;  1JI8 A;  3K9T A;  2HGC A;  1FOK A;  2XUB A;  5ICG A;  2O5R A;  1NK3 P;  1E3P A;  4BYY A;  2DK8 A;  2DA2 A;  2JA8 J;  1MMA A;  4AD9 A;  2PQ8 A;  3I54 A;  4II2 A;  2F48 A;  5DYM A;  5D4R A;  2NS0 A;  2DOA A;  3CO7 C;  2L54 A;  1A36 A;  2WB1 N;  1SVM A;  3CCY A;  2KDO A;  2HTS A;  5FKN A;  1ONV A;  3HZJ A;  4A2U A;  4RDU A;  1ZLK A;  4BQA A;  3AL0 B;  1E3H A;  3HOW J;  3NAU A;  4LMY A;  1MBJ A;  2E5N A;  5FFZ A;  1TWF J;  3S2D J;  1FPQ A;  1FEX A;  1K78 A;  4UUS A;  4HOB A;  3JSO A;  2X85 A;  4C3J J;  3ULQ B;  1T8I A;  4U88 A;  2X9D A;  3S3M A;  3F6V A;  5C3E J;  1A35 A;  1MJB A;  1JTY A;  4XKC A;  3REO A;  1LVK A;  1WI3 A;  3K4M A;  3GTK J;  1D0X A;  4LLG F;  3O8G A;  3R6S A;  2HS5 A;  3CJT B;  3ONQ A;  1BJZ A;  3M1C A;  3OYL A;  2L01 A;  2VOD A;  3QWL A;  2JRT A;  2PJR B;  1Z91 A;  3GLX A;  1T33 A;  4C2U A;  2NOG A;  3V8K A;  1IXR C;  3TOB A;  2ETH A;  3TO9 A;  4M9X A;  1Z1D A;  4EMS A;  1ZLJ A;  2V4J C;  4JX6 A;  2X1C A;  1TQP A;  1Z67 A;  2IA1 A;  4ETS A;  1I39 A;  3CJR B;  2PX9 A;  2PLY A;  4M3E A;  3UNG C;  3BTI A;  4BAY A;  2XRL A;  1WJF A;  4HX4 A;  5GTH C;  1R1V A;  1YI2 I;  2ZNZ A;  4JQF A;  4S05 A;  4X0G A;  2RAE A;  3HBL A;  2R7S A;  4JX5 A;  3UKG A;  4RAY A;  3L2R A;  1TW2 A;  3PQK A;  4HV5 A;  4LJZ F;  3ZMV A;  4XKV A;  3GYH X;  3T8T A;  4XOP A;  4YFN F;  3S15 J;  2D45 A;  2WAQ A;  1W1W E;  2XRN A;  1R49 A;  5EEH A;  1OYI A;  5HS9 A;  3A0B C;  3G1O A;  4HDV A;  4J00 A;  1TLH B;  3HJE A;  1K4T A;  4MGR A;  3SDB A;  1VQM I;  1V5E A;  4P96 A;  1OCC H;  3OYM A;  1OFC X;  3U1K A;  5CVR A;  2VN2 A;  2NVQ J;  2KIS A;  3KZY A;  2P6S A;  2HPI A;  3AAF A;  2HR3 A;  4KJZ A;  2WV1 A;  1GLN A;  2KT0 A;  3BDD A;  4ASN A;  2XHK A;  5GTI C;  2M1B A;  2R7X A;  2Q8K A;  4EM2 A;  1NTC A;  3LAJ A;  2QKL B;  1JKR C;  2R7U A;  1IF1 A;  1XMK A;  5FD6 A;  1MND A;  3L2V A;  2GLO A;  1X1B A;  4L9J A;  2L3D A;  3ZMT A;  1A5J A;  5J4V A;  2A5Y B;  3M1E A;  4G9Y A;  4RGR A;  3L1P A;  4UXN A;  5HVQ C;  4BEH A;  3FXQ A;  4E4H A;  4O6J A;  3S93 A;  5LLQ A;  3OYN A;  1FX7 A;  4IRH A;  1T08 B;  2XF6 A;  1FNN A;  4UV9 A;  1R4M B;  2GXA A;  1FBQ A;  2OZ6 A;  4NQW B;  2CFO A;  3WE2 A;  4QTR A;  2P6T A;  4KN7 X;  4S04 A;  3EET A;  3HRT A;  4KA4 A;  2KIM A;  4R1H A;  1YIJ I;  3HL2 A;  3CF2 A;  2RN7 A;  4Y15 A;  4V19 K;  2EFQ A;  4HNU A;  1RR7 A;  1BBY A;  3GWZ A;  4FX4 A;  4CO8 A;  4L9T A;  2R7Z J;  3QYE A;  2EZL A;  4F55 A;  2P5V A;  5M5Y J;  2MLG A;  3DTE A;  5KK1 A;  4HDU A;  4WXH A;  5FLX Z;  3KE2 A;  4EJW A;  1T39 A;  1LFU P;  3K0L A;  1U3E M;  3DBR B;  5FKL A;  3HEF A;  3FKI J;  3FXO A;  3ESW B;  2GQQ A;  1V5F A;  4MLO A;  4A0Y A;  4BXU A;  5DM7 F;  2LRD A;  3VPR A;  3H3U A;  5IOY A;  1YIT I;  3WTY C;  5IY5 H;  4V2G A;  5JHU A;  1HKQ A;  1OPC A;  4ESB A;  4PJJ A;  4EJO A;  2H1L A;  4AIH A;  3FHN A;  3BCB A;  3HOU J;  5BPI A;  4XN3 A;  2XAS A;  5H6Q A;  3ZQC A;  3IC7 A;  4HQM A;  1LFB A;  4N9I A;  3SHF A;  2Y9Z A;  4PJ0 C;  3KYC B;  2WY8 Q;  4PGG A;  3FXL A;  2DPD A;  1FP2 A;  2JRM A;  1N25 A;  3Q9S A;  3C1D A;  5K7H A;  3E6C C;  1TWA J;  3PNV A;  1K6Y A;  1PVE A;  1UCR A;  1O7F A;  4IZZ A;  1B1B A;  2M0C A;  1TC3 C;  1XTA A;  1J2X A;  2LY9 A;  3I58 A;  3MMY B;  4UUS B;  4D1Q A;  2XIG A;  1ZQ3 P;  2GIV A;  4BL0 B;  3U21 A;  3JAM Z;  1CQT A;  2STW A;  1EH6 A;  4FE7 A;  5J6X A;  2LG4 A;  3R60 A;  2E7W A;  2JQ7 A;  3H3Z A;  3GTG J;  3JTH A;  1ON1 A;  4B3X A;  1YTY A;  2H6B A;  2K27 A;  1YJ9 I;  4MFD A;  4BNC A;  2YR2 A;  4CCN A;  2IS4 A;  3HOT A;  2K9S A;  2EV6 A;  2EBI A;  3CCS I;  2X6Y A;  3P9I A;  1P4W A;  3WGI A;  2R7W A;  3IRR A;  1OCZ H;  2FBH A;  2FX0 A;  1V4R A;  2RDP A;  4ZYH A;  1JXS A;  2Y0S N;  3ABM H;  3P7N A;  1H88 C;  5EF6 A;  2K4J A;  2L4A A;  2ZFU A;  4LLN A;  1R00 A;  1RNL A;  1B9N A;  2IS6 A;  3S8P A;  3A2K A;  3HKZ A;  4WX9 A;  3ABU A;  1BOA A;  1YO5 C;  2IAI A;  1YYV A;  3JR9 A;  1VTN C;  4U7B A;  3QQA A;  3DTK A;  4OAZ A;  2E1M C;  2AQF A;  3ZQQ A;  3G3Z A;  4A6D A;  1OCP A;  3MVP A;  5F64 A;  1X1D A;  2M87 A;  1WQ2 A;  1WWX A;  3FK6 A;  2LKS A;  3Q9V A;  5J8C A;  2E2H J;  1UAA A;  3TED A;  2VXD A;  3BR3 A;  1HLV A;  1AHD P;  3OL3 A;  1MIJ A;  3QP6 A;  4UVB A;  1E0E A;  3IV5 A;  1ZK8 A;  2QLZ A;  3DTI A;  3SYT A;  2Y31 A;  2R0Q C;  2EV0 A;  3LSH A;  5L3D A;  4FTH A;  1OR7 C;  4A5M A;  2R5Z A;  1OKR A;  3ZMD A;  1R4N B;  1ZG5 A;  4A3C J;  3TW7 A;  4F7Z A;  2XGX A;  4N9H A;  1NH3 A;  3DKX A;  1JJ6 C;  1XPX A;  1ZR4 A;  3DV8 A;  1FMV A;  4BEH B;  3HB9 A;  3D1N I;  1A6Q A;  1Y6I A;  2K02 A;  5GPC A;  1T95 A;  4YEL A;  2MG4 A;  1S5L C;  2JZY A;  4NUB A;  1FTT A;  4XRF A;  2L9S A;  3F8B A;  5IT3 A;  2RVC A;  2R7O A; 
#chains in the Genus database with same CATH homology
 2JVH A;  2XDV A;  3IAM 2;  2NOJ B;  5TGT A;  3H5R A;  3OYI A;  1UEL B;  4PJL A;  2HNH A;  5HOO A;  2DXI A;  3TBI A;  1R6R A;  2VXZ A;  4CCK A;  2L2O A;  2LH9 A;  4XOT A;  3M8J A;  3LSM A;  4XLA A;  2VJ5 A;  1LDK B;  2Y0S A;  2KZV A;  5CKT A;  3ZGK A;  4CSW A;  2R7R A;  2KRC A;  2UV1 A;  3OOU A;  3DU6 A;  3QYB A;  2WA0 A;  1P9Q C;  3OYG A;  1YX3 A;  3EUH C;  4J01 A;  4FAS D;  2WY7 Q;  4F93 B;  5FRM A;  4QPQ A;  3AKZ A;  2W82 A;  2V6E A;  1X4P A;  2CV1 A;  2PJR A;  2WBM A;  2X6X A;  2LY1 A;  4OWR B;  1N77 A;  3OIQ A;  3D5S C;  2ZXI A;  4HEA 2;  1UG0 A;  2IGM A;  3IP4 B;  2CH0 A;  2FUG 2;  3K4K A;  3W2V A;  3H9G A;  3LMM A;  4DBR A;  3L2Q A;  2IGK A;  2GOX B;  4CCM A;  1WJE A;  2VLA A;  3ZCO A;  3L2U A;  3SZG A;  2JSP A;  3PFY A;  2VJI A;  2K9M A;  4IQ4 A;  2V7F A;  3W2A A;  5HNH A;  3KEY A;  2L9N A;  5KNL A;  3K4L A;  2VQG A;  2MAB A;  3NWT A;  4CA0 A;  4IX7 A;  1Y56 A;  3OR2 C;  3I9V 2;  1EA3 A;  3DKY A;  2XSJ C;  1SAU A;  3LL7 A;  1X1A A;  2K5C A;  4H4K C;  4E7I A;  3OYE A;  1Z3Y A;  3OMY A;  3OYB A;  4CCL A;  4AYB A;  4P5O A;  3HPH A;  3CJQ B;  2ZSH B;  4II3 A;  1DQU A;  3DPT A;  2BW3 A;  5CQG A;  4Y33 A;  1D0Y A;  3SEQ A;  4XON A;  1WJB A;  1BOB A;  3OR1 C;  3LSG A;  1DP3 A;  1W36 D;  4BE0 A;  1NG6 A;  3CP8 A;  2QKM B;  2IGO A;  4RMN A;  3L2W A;  4ZJZ A;  4AU7 A;  3CMM A;  4ZDL A;  4XKW A;  4E7Z A;  4FET A;  3K6G A;  4BE2 A;  3QOD A;  4BDZ A;  4ZDP A;  2RRE A;  3VYS B;  3W3C A;  4B48 A;  2BW3 B;  3H9Q A;  4XKB A;  2CS3 A;  2LRE A;  3HUG B;  4PJM A;  2Q2E B;  1VZ0 A;  4RLF A;  2VPL A;  3FBN B;  4HPQ A;  2HPM A;  2IGN A;  3E1S A;  4KT6 A;  2X51 A;  2E60 A;  3IAS 2;  4PSW A;  4U87 A;  3K70 C;  4F92 B;  1HA8 A;  3LSI A;  3VYT B;  5FRO A;  2VB6 A;  1QHH D;  1X4O A;  3LSK A;  1QU3 A;  2RQQ A;  2CV2 A;  3OYH A;  2V9K A;  5KHD A;  3PL8 A;  4YRV A;  3RCO A;  2KLO A;  1MMG A;  3VYR B;  3PNT A;  1YE9 A;  2RNG A;  2HDW A;  1Z21 A;  3DU5 A;  2MC4 A;  3VSL A;  3DPL C;  2LC2 A;  4ZDO A;  4XM3 A;  3EUA A;  3UR3 C;  4E7S A;  4LG3 A;  4PFO A;  5KCM A;  3OYF A;  2XF5 A;  1X19 A;  3K4N A;  3S3N A;  4F91 B;  4XL9 A;  2W4S A;  3OWT A;  3BLY A;  4PSX A;  2OV7 A;  2VIX A;  2KPM A;  2XAU A;  3G2B A;  3FKJ A;  1Z3X A;  4N4O B;  1Z7L A;  4RM2 A;  2Z1D A;  1TZL A;  1BR1 A;  2R7T A;  1JI8 A;  5FRN A;  5LFA A;  2O5R A;  2MYS A;  1D0Z A;  2A5W A;  1MMA A;  1U0J A;  4YEJ A;  2JVG A;  4II2 A;  2AQE A;  4JOM A;  4XMY A;  2JUG A;  2DOA A;  2HZD A;  2MFZ A;  4Y4R A;  4XQF A;  2Q1Z B;  2KDO A;  3W2W A;  3N05 A;  3AL0 B;  2BOL A;  3KX2 A;  4N4N B;  4C9Y A;  1MMD A;  2E5N A;  4CUG A;  2V1N A;  1X1C A;  2WAF A;  4Y3O A;  2X85 A;  3TMO A;  4ITV A;  3QOE A;  3S3M A;  2Z2S B;  1FMW A;  2CUZ A;  2W1O A;  2OUM A;  4XKC A;  2HVS A;  4KIT B;  1LVK A;  2K9L A;  3K4M A;  1D0X A;  1W36 C;  4HRI A;  2XF7 A;  3ONQ A;  3OYL A;  3M1C A;  3AL0 C;  3EUK L;  4DOZ A;  4ANJ A;  4DGW B;  4BGD A;  2PJR B;  4C2U A;  2KHM A;  2X1D A;  4G6T B;  2HVQ A;  2F4I A;  2V4J C;  2F6C A;  4P1W A;  2X1C A;  4F3Q A;  3CJR B;  3K10 A;  4ZTF A;  2KRH A;  3UNG C;  1SFK A;  2M7B A;  3OL4 A;  3E0J B;  1WJF A;  4C30 A;  3KYL A;  4JQF A;  4BU2 A;  4PJN A;  2VQH A;  4X0G A;  3VWB A;  4LIU A;  2R7S A;  4CZC A;  1J09 A;  2XC7 A;  4XLF A;  2ZSI B;  3L2R A;  3PUB A;  3MKY B;  2DCE A;  3PJR A;  4XKV A;  4DJA A;  4HSR A;  4XOP A;  2WAQ A;  3FBI B;  1NG7 A;  2KL4 A;  3K4J A;  4J00 A;  3SDB A;  2M7A A;  2IS1 A;  1V5E A;  3OYM A;  3ZRG A;  3AFH A;  2DJI A;  4RM3 A;  2VJ4 A;  2WAE A;  3DPU A;  5HLT A;  1BR4 A;  3RSN A;  2HPI A;  2UWM A;  2WB1 A;  4KJZ A;  3EPZ A;  2VL8 A;  1GLN A;  3LFU A;  2DT6 A;  4E7L A;  2R7X A;  2R7Q A;  5CPR B;  3RQ4 A;  4BJT A;  2QKL B;  2R7U A;  1MND A;  3L2V A;  3H0D A;  3BC8 A;  1X1B A;  3PSI A;  4GRI A;  4R79 A;  3OS1 A;  2M0M A;  2X1E A;  4BQO A;  5HVQ C;  3OYA A;  5CQE A;  3PNY A;  1PYV A;  4BEH A;  4E4H A;  3OYK A;  3S93 A;  3OYN A;  4OAY A;  5LD2 C;  3BCA A;  4QPO A;  2M4K A;  2E5Z A;  2XF6 A;  3OYJ A;  2DT7 B;  3S3O A;  3DWL E;  4NQW B;  2CFO A;  1IRX A;  1KON A;  2HQA A;  3HL2 A;  3CF2 A;  2IXS A;  1D1A A;  1WFX A;  1S9H A;  4HNU A;  4B47 A;  4HNT A;  4BQN A;  1G59 A;  2VQC A;  3A4C A;  4BAC A;  3V42 A;  3QYE A;  4F55 A;  2A6T A;  2HVR A;  3DTE A;  3K70 D;  4ZTJ A;  2LYC A;  1DGR M;  3BG7 A;  3OS0 A;  1PJR A;  2UUZ A;  4XLE A;  1V5F A;  2JA2 A;  4MLO A;  2LRD A;  3CP2 A;  2KP6 A;  2KQR A;  1BR2 A;  4BJ5 C;  4HST A;  2K3P A;  2VQL A;  2P0W A;  4RLQ A;  3RPU D;  3C2G A;  4PJJ A;  4EAT A;  3FHN A;  3BCB A;  4BDY A;  4XN3 A;  3OS2 A;  3PSF A;  3DLA A;  1DGW Y;  4LIV A;  3C2H A;  1D1C A;  2F5V A;  4B44 A;  2WY8 Q;  3K4C A;  4C2T A;  3ZXS A;  2W00 A;  4XLC A;  4XR6 A;  3K4B A;  1T0F C;  3PNV A;  1K6Y A;  4IZZ A;  3OY9 A;  1D1B A;  3FDY A;  2I8D A;  3MMY B;  3SEZ A;  2OC6 A;  4BQQ A;  3A1Y A;  4D1Q A;  4E7J A;  4BL0 B;  3U21 A;  2R7V A;  1WJC A;  3H35 A;  3H5N A;  3ZR8 X;  4E7K A;  4BUP A;  2ELJ A;  2WAD A;  2LG4 A;  3GBG A;  3VYU B;  3RTR A;  3HPG A;  5JHF A;  4BXF A;  1ZEL A;  4BJ6 C;  1AA7 A;  3J7A Y;  4B3X A;  4PUS A;  1MNE A;  3OIP A;  4CCN A;  1MMN A;  2IS4 A;  3HOT A;  3VSK A;  4DIQ A;  1N78 A;  2X6Y A;  2LY2 A;  2R7W A;  3MKZ A;  2LOO A;  4BS9 A;  4CCO A;  2E1M B;  4DBQ A;  3DQV C;  4F52 A;  4XLH A;  2V26 A;  4XOR A;  3OYD A;  2CW7 A;  1YX5 A;  4PFP A;  2KMU A;  3QYF A;  4NC7 A;  3TL4 X;  3H9J A;  2PMZ A;  3BG6 A;  4PK4 A;  3H5A A;  3HOS A;  2ZFU A;  1QHG A;  4AVZ A;  3S32 A;  1V5G A;  3DEE A;  3MD2 A;  2CMP A;  4NC8 A;  2IS6 A;  3NWS A;  3S8P A;  3A2K A;  2L7K A;  4XNF A;  3HKZ A;  2Z16 A;  3IUO A;  3OYC A;  1G8X A;  2LBF A;  3HG9 A;  3I3L A;  1TT0 A;  4U7B A;  4ZC3 A;  3D5R C;  2HU9 A;  2IS2 A;  3DTK A;  4OAZ A;  2E1M C;  4BE1 A;  4HG2 A;  2AQF A;  2CW8 A;  2BVL A;  3CES A;  3HC7 A;  1WJA A;  3ZQQ A;  4IQJ A;  4NNJ A;  1OLT A;  1X1D A;  2M3A A;  4E6K G;  1WJ5 A;  1UAA A;  2W7N A;  1LFP A;  2X6W A;  2VAS A;  2VXD A;  3CZ6 A;  4D9J A;  4ZYA A;  3OL3 A;  4CH7 A;  1E0E A;  3DTI A;  3SYT A;  2MD0 A;  2VJJ A;  2VKD A;  3LSH A;  4E7H A;  1OR7 C;  3MKW B;  2VKH A;  1MW7 A;  1N75 A;  3VDX A;  2L5Q A;  2LBF B;  1ERD A;  1LKX A;  4XN0 A;  3D5L A;  4IKF A;  2M4G A;  3HXL A;  2ZXH A;  3F9K A;  4CCJ A;  3DKX A;  2BVM A;  5HNF A;  2R4G A;  1WJD A;  1FMV A;  4BEH B;  4KIS A;  1Y6I A;  4B43 A;  1T95 A;  4YEL A;  2CV0 A;  4NUB A;  4LIT A;  2GOM A;  2L9S A;  2CUJ A;  2R7O A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...