2AQEA

Structural and functional analysis of ada2 alpha swirm domain
Total Genus 18
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
18
sequence length
90
structure length
90
Chain Sequence
GSNSGRRSAPPLNLTGLPGTEKLNEKEKELCQVVRLVPGAYLEYKSALLNECHKQGGLRLAQARALIKIDVNKTRKIYDFLIREGYITKA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Transcriptional adaptor 2, Ada2 alpha
publication title Structure and chromosomal DNA binding of the SWIRM domain
pubmed doi rcsb
source organism Mus musculus
molecule tags Transcription
total genus 18
structure length 90
sequence length 90
ec nomenclature
pdb deposition date 2005-08-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04433 SWIRM SWIRM domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.780 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Arc Repressor Mutant, subunit A 2aqeA00
2ELJA 2AQEA 2DCEA 2AQFA 2CUJA
chains in the Genus database with same CATH superfamily
2LG4A 1X58A 4YIFA 1MMGA 5BQTA 1K4SA 3OMYA 3G3ZA 1S6LA 1XGMA 4D9JA 5LRSA 5EZHA 4M71A 2QCOA 2VQHA 5JLWA 2O8KA 2B0LA 3GF2A 2CUJA 3I53A 1ZK8A 3CDHA 4RAGA 3S17J 4EJUA 2NAZA 2GWRA 2BYVE 2K40A 5J4VA 5GAGJ 5FKMA 4KYWA 4KITB 1GV2A 2DMNA 2LK2A 4XLAA 3TP0A 4R79A 1JKQC 3VWBA 1YQAA 3K4KA 4HOBA 2EPFA 3UR3C 2DFHA 2HQNA 2VKVA 5IP9J 1BN5A 1YS7A 4ZTJA 1Z6TA 3K4BA 3O6BB 1W5TA 3G1MA 2R7QA 4PZJA 2CGPA 1T56A 3H3ZA 1K7AA 1G3SA 3IUOA 3W2WA 1UAAA 1AKHA 3KP4A 1ENHA 1X2MA 1RUNA 3E6MA 3R0JA 3M8JA 4HNUA 1HDPA 2A5YB 3KIOA 2PLYA 3PO2J 3GTLJ 3P5JA 4ESFA 4L0YB 2CW8A 1FYKA 1X1AA 3CMYA 4QIWN 3J7AY 2HQAA 2JVGA 4GO1A 3LSGA 1N77A 1J9IA 4B44A 3SDBA 1AOYA 1D0YA 3K0LA 1ULYA 3OSFA 2H8WA 2M5WA 4KFCA 2XAFA 1MDMA 1WGXA 1MIJA 2F4MB 2LRDA 2M0MA 2BY3A 4E7HA 4IJAA 4RAZA 4P9UA 1XDSA 2XHKA 2ZJQF 3AAFA 3DCFA 2G7UA 1IZ1A 1VQLI 2NVQJ 5M5YJ 2CFXA 3WG9A 1RKTA 4Y52J 2LF7A 4ZYAA 2E1NA 2L9SA 3DEEA 4F93B 2R7XA 3S2WA 1ACIA 4UVBA 2VPRA 2IA2A 4HAMA 4OIOF 2X4HA 4YFKF 1YITI 3DBLB 4RAFA 3KP2A 4G6TB 1SC7A 3ULQB 1J2XA 2EJRA 4EM2A 4RB1A 1B72A 3BCAA 5EEHA 2X6WA 3S15J 4DZPA 4FCYA 4TV7A 1MSEC 2I8DA 3ZR8X 5DCMB 3AG1H 5LRRA 2CW0F 1GLNA 3CQZJ 1NTCA 2QQBA 5E8GA 4CDGA 5C4JJ 4MFEA 5F6FA 1K78B 2Y0MA 3F22A 2LY1A 2KZGA 2AQEA 3IH2A 1Y56A 4GCVA 1R5ID 5H20A 1QNTA 2NS8A 2CQQA 4N4NB 3CCRI 3CMEI 1A31A 2XKPA 2ISZA 2WTEA 5CVIA 4IHSA 4S04A 2MLKA 1G8XA 1SD4A 4BBSJ 3OS1A 1MJAA 3CUQB 3TDUC 3BR0A 2KMUA 3T0YA 2DFFA 3PO3J 2Y0SN 3NARA 1ZHFA 4HQMA 1Y39A 2K86A 1MH4A 4G7OF 2BVLA 3W6JB 3ML6A 3LOCA 5CQEA 3DTKA 4AU7A 2P6SA 4A6DA 1IDZA 3MVPA 4X1EA 2F4IA 2HDCA 2HOSA 1FLIA 4Y33A 2BOLA 1W1WE 2GAUA 3ZMSA 3VEPA 3GWZA 1N75A 5LHGA 3N4MA 5FKKA 4JX4A 5K7ZA 4U7DA 4CH7A 2ZXJA 5F0FA 1BW6A 2E34A 1GT0C 2COBA 3LQRA 4YIIA 4EGYA 2AXLA 4KIBA 2ZB9A 4PJNA 1T39A 2FF4A 4KIFA 4DGWB 2DXIA 1H89C 3VYTB 4YELA 5B5EC 1OLTA 4JBAA 4LD5A 1LNWA 4QPQA 2HXIA 4HF0A 1ZELA 4XLPF 3RTRA 2KZVA 4NC8A 3OYMA 1R5GA 5TGTA 2CQ7A 3HBLA 3OYHA 1V3FA 3LAPA 3L09A 2DK8A 1X2NA 1G6NA 2KRFA 3AG3H 1G4DA 4IRHA 2Z1DA 4UVAA 4BE0A 3CC2I 2ZBKA 1OPCA 3H5RA 2HYJA 4XM3A 3F8NA 5E3OA 1J0RA 2VQGA 1MMDA 3FZVA 2MD5A 2IS4A 1OYIA 4AVZA 2BW3B 2Q1ZB 3DU5A 2QF7A 3WG7H 2CUEA 5A2QK 1HSTA 1P92A 2MG4A 4Z2YA 5ICFA 2DOFA 2VBYA 3JRFA 3GXOA 3SZPA 2KIFA 3PFIA 1OISA 3NWTA 4CO8A 4ZJZA 1AA7A 4I98B 2LOOA 3IV5A 2R7VA 3I4MJ 1MJBA 1FBQA 1FOXA 3DLAA 1F1ZA 1JKRC 1XGOA 4WCGA 2ZNYA 1UHMA 1Z3XA 1R23A 2VKHA 2WB1A 1YIOA 3BY6A 4RB0A 5J8CA 1D8KA 1G2HA 2M8GX 2QSFX 3DV8A 1BM9A 3M07A 4M9XA 4EMSA 4FETA 1MNEA 3HIFA 3E1SA 3GCMA 4FTHA 4CSWA 4A6EA 4ABZA 1Z05A 4MGRA 4L9VA 1IF1A 2A3SA 1ZN2A 4OAYA 4ZYDA 2CJJA 2FBIA 3GFMA 1TTYA 3JR9A 2FMLA 1RNLA 1QU3A 3ECHA 4EGZA 3ZOBA 1LVKA 1SD5A 2OZ6A 1KQ0A 1PUEE 1E2XA 5ILSA 4P96A 2W84A 4ZDLA 2GLOA 1GHCA 4J19A 3HOSA 1QHGA 1T38A 1XD7A 4BHCA 2RGVA 2Y69H 5B1BH 4BJ5C 4XORA 4L9JA 1HW5A 4HRIA 5ICEA 3ERMA 3KZIC 3BTIA 4BJ6C 4BJTA 2A68F 2YPRA 2R7WA 3GTPJ 4P5OA 4NC6A 5DCMA 1D8JA 5HLGA 1ZRCA 4LOCA 4XRSA 1KU7A 2DMUA 1P7JA 3FIWA 3ONQA 4ENKA 1K78A 1V54H 3CJTB 4A3DJ 3GBGA 2GZWA 3W6KB 4QLCU 5FLVA 2HXOA 1RKWA 3D5SC 4KN4X 2GXBA 3FDYA 3JAMZ 3P9IA 4Y17A 1V5FA 2HYFA 4RGRA 3L2QA 1W7PB 3GO5A 4HW0A 3TOAA 1YW7A 1TQIA 1UFMA 3CUQA 3GFLA 1U78A 1ETXA 4NB5A 1Z7UA 3HSEA 3S32A 3KE2A 3CDLA 3PQKA 2M3AA 4U87A 2QEXI 2JK3A 3BLYA 1X4PA 2ECBA 2M8EA 2OA4A 3E7LA 5JI6A 1QZZA 3F23A 2I10A 4HNVA 2EV5A 2ZKZA 4Z6YA 3R61A 1WHUA 4PJLA 1JE8A 2R7UA 5BMZA 3W3CA 2R5YB 4ENNA 3BZKA 4UUTA 1N25A 3RKXA 1LVAA 2LYCA 2J5PA 1SVLA 5FGMA 1KGSA 3WHBA 3S1RJ 1YO5C 4KT6A 4ZDOA 3QYEA 1LEBA 5HODA 2W4SA 1T2KA 5LD2C 4Y13A 3HC7A 2F6CA 3QPTA 1O3RA 3BC8A 3OYIA 2ELJA 1U9NA 2XAQA 4C2MJ 2EBIA 4F92B 3HGYA 3D1NI 4BKXA 5FFZA 4XOTA 3CCVI 1CF7B 1IC8A 2HKOA 2IGOA 2QQ9A 4QTRA 3FMSA 2WV0A 5IYCJ 1AHDP 1JUPA 4IOCF 1ZTRA 2QGUA 3LSMA 2MSYA 4BYYA 1DPUA 5GPAA 2R5ZB 1TQMA 4ENJA 2DFEA 2YSRA 3E3VA 2FMYA 2XAHA 1XMXA 3J7AO 3V7CA 2ICWG 2WY8Q 3F6OA 3JRDA 4ZZDA 4G7HF 3AL0C 1USTA 4RA2A 4F7ZA 1MBKA 2BW3A 2DU9A 3BP8A 1JUSA 3HPHA 4HV6A 5D6FA 5HOOA 2OZUA 2XB5A 3OL3A 1QBJA 3ZXSA 1I5ZA 1VQNI 3SHFA 1ETQA 2BY0A 2QM3A 2KDOA 3CLOA 4PUSA 3ABKH 3K4CA 2EFQA 5LHIA 2PJRB 2JJ7A 3FBIB 1MBGA 1X19A 4BY1J 2MC4A 4QPOA 1A6IA 5DV5A 2H6BA 3GW2A 3RQ4A 2LD5A 2VJJA 1Y6IA 1TWFJ 4S0HB 2WA0A 4ZC3A 4E4HA 2H1KA 2V1NA 2W48A 3IP4B 4L9NA 3U21A 2OCCH 1MH3A 3NRVA 4AWXB 4OOIA 5J1YA 2XV4S 1DGRM 1P4XA 2LVSA 1F9NA 4HZFA 2CUFA 4Q5SF 2KIMA 3BT9A 4L5IA 1W36D 5IP6A 3GEZA 3FBNB 1FP2A 3C2BA 4I02A 5HS9A 4YFNF 4H0EA 2UWMA 1PP7U 3P7NA 1R36A 2OD5A 1T6SA 2AQFA 2DA4A 4FHTA 2HPMA 4XN0A 1BIBA 2E71A 2E36A 3PNVA 3QP5A 3F6VA 1TQPA 4DYRA 1I1SA 2X6XA 5D5XB 1W36C 4S05A 6PAXA 3OS0A 3CCLI 4U0WA 3DFGA 2HGCA 5HLHA 2MC3A 3BCBA 2K3FA 3MKWB 1I6XA 4B8XA 4A3GJ 4JQFA 3F8BA 4F55A 2JN6A 3JTGA 1T08B 2YX7A 5C3EJ 2IAIA 3A2KA 1XB4A 5FD6A 1ZREA 1U8BA 2Z3YA 4PSXA 2KQRA 1DPRA 3HRMA 4CCLA 4LGWA 2JPCA 3AL0B 2L01A 3BTLA 2XPWA 3I71A 3OYCA 1C0WA 2H27A 3JRBA 4A0XA 3P9CA 2EIMH 3WE2A 3HOTA 1W7PA 2WAFA 3K9TA 2Y9YA 1S72I 1IO2A 3MFKA 4AVPA 4Y7NJ 3I4PA 3H9JA 1BR1A 1XDUA 3FM3A 2VODA 2HPIA 5ED4A 1EKEA 1BL0A 3DP7A 3ZQLA 3Q3SA 2JRMA 3KEQA 1LDJA 2VI6A 3ZCOA 4EJTA 1B9NA 3CD6I 3BPVA 4DW6A 3L7WA 2R5YA 1YTYA 1MJ9A 2YS9A 1BI3A 3WTXC 2Z9OA 1I50J 1WQ2A 4HG2A 4RGXA 4KMUX 1ZH5A 5CQGA 2Z16A 4CCJA 3JREA 3FKJA 4XRMA 2W1OA 1B9MA 5HNHA 4DYCA 4E7LA 3TW6A 3IKVA 4PGGA 4WK8F 1FBUA 3U9GA 2HTJA 3OV8A 1E0EA 2IGMA 4PK4A 2ESNA 2HNHA 4JX6A 1YRNB 3KP5A 2XGXA 3GZNB 2RQQA 3H9QA 5ERIA 2ZFUA 3JW4A 4O5VA 1J09A 4XRFA 2VB6A 1MBEA 4FX0A 3B6AA 4LB6B 3FWEA 3CESA 4O3MA 4UB6C 3GVAA 2Q0OA 2O9LA 3FKIJ 3TO6A 5E1ZB 2R5ZA 1EV7A 2MBFA 2WV1A 2X1DA 4Q4ZF 5DD8A 1DP7P 4H4KC 3ZN0A 2DW4A 2O03A 4FE4A 1ON2A 5IT9K 1Z3YA 1SMTA 1ERDA 4EEFG 1TWAJ 1Q1VA 5GAEJ 4UUSB 4GRIA 1G3TA 1OYWA 2JA6J 5D5WB 3FXUA 4XNFA 2WAQA 1VQOI 2HZTA 2X9DA 5F64A 3K6GA 3CCUI 5L3BA 3F8MA 2A6HF 2DQLA 1UG0A 2FX0A 4LIUA 1IW7F 1QVUA 2JWTA 3ZN1A 2PJRA 1ZRDA 2DJIA 3LSRA 3V7RA 2W85A 4AUXA 3OYJA 3TP3A 1B4AA 1FC3A 3SYTA 4X6AJ 3HM5A 5DM6F 3HTUA 3TL4X 4ZZLA 4C3HJ 1ON1A 2R3SA 3EUKL 1R1VA 4ITVA 4CA0A 4A3MJ 2HQ5A 4IPAA 1SEUA 2BXYA 4AYBA 2FJ1A 4GGGA 3U1KA 4XRSG 2DT6A 5IYBJ 4YG2F 2PMUA 1F5TA 4HLYA 3JTHA 1YLFA 3WGHA 2R4GA 2TRTA 1MW7A 1ZG3A 4BS9A 2K85A 1XG1A 2VJ5A 1DP3A 2VE8A 2F2EA 2ID3A 1HKQA 2ESHA 4Q48A 2EWNA 1QHHD 2R7OA 1R71A 3J80K 4BXXJ 4NDLA 4MEYF 3LWFA 4A5MA 3TDZC 1WJCA 3QOPA 2JA2A 2JSCA 2BV6A 2Y31A 2PN6A 1TNTA 3BG6A 2VBXA 2V26A 3WU0A 4AM3A 4WXHA 3S93A 2VBZA 1WZ2A 2VT3A 2R7RA 5AIPA 1GXPA 3HOWJ 5CVJA 5K7FA 2MW8A 2EFWA 3HOUJ 2EFPA 3ZMZA 2E5NA 2MD0A 3PNTA 3C2HA 1H8AC 1WH5A 1G3YA 3C1DA 3EQLF 3IKTA 3JCUC 2FBHA 2NXNB 5J4YA 3M8FA 1R1TA 2D2WA 2LLKA 4HV5A 2CMPA 2IGKA 3UKGA 3ZQQA 3ERED 2IP2A 1FWZA 3MN2A 2XKOA 1ETYA 1VZ0A 2ZXWH 5K5RA 4M3BA 3V8LA 2STTA 4OWRB 5BOXA 3IWZA 3LA7A 1I27A 4HA8A 3FMRA 3CJNA 4D5FA 4FT8A 1T98A 5JVTA 2MH9A 3GUDA 4NC7A 2K02A 3IH3A 2WB1N 3R4KA 2XAUA 3OYEA 5D5UB 3IRQA 1HQCA 5F0HA 4UHTA 3GTJJ 1IN5A 2XPUA 3E0JB 2ADUA 3OYAA 3OYNA 2GA1A 3TQNA 3L2VA 3CUQC 1IN8A 2STWA 2JA7J 4JYKA 2E1CA 3AKZA 3RYPA 3OR2C 3A1YA 5GAHJ 2DYSH 3MD2A 3KLNA 4HLXA 2HOTA 3L2RA 1Z21A 1Z1DA 1X3UA 2EIJH 3TGNA 4BQQA 2NOJB 2RN7A 5C44J 4UY8I 1A36A 1H88C 2FD5A 2K9MA 1YRNA 1EA3A 5GTHC 2H6CA 5ICGA 4IHTA 2K3PA 3KPHA 1WSUA 1U8RA 3BR3A 3CJRB 3VFZA 3H3VK 4M6VA 3BJOA 3JRGA 3F3XA 5FRMA 2V1UA 2IJLA 2V4JC 4A3BJ 1BA5A 2V9VA 1L0OC 2V9PA 2LC2A 5GTIC 4R1HA 4E7KA 2E35A 4XLCA 4HSTA 3PL8A 2KFDA 1XCVA 2JUCA 2P5LC 3K4LA 2PQ8A 3ZQIA 4XLFA 2CQXA 5IY5H 2K9NA 4UUSA 1IV6A 3B6CA 4CICA 3BQZA 5CVVA 1RRJA 4XR6A 4L18B 2DA7A 3TW7A 3HGGA 2BE5F 4A93J 1QRYA 1ITYA 1O57A 4MQ9F 5K5QA 1EH7A 3KETA 3NEUA 2GQQA 5M5WJ 1JJ8C 4BXFA 2CV0A 4A3CJ 5M5XJ 3OYDA 2DI3A 4LMYA 4KN7X 4FASD 3CCYA 2W82A 1U6GA 2M9HA 1B59A 2FRHA 4CXFA 3T5XA 4IHXA 2YU9J 1X3ZB 4B4CA 1JKPC 1I39A 4IHVA 1R1UA 2MH2A 1LB2A 2VQLA 4B3AA 3HUGB 1MBHA 3FXKA 3LSKA 4UVCA 1Z0XA 2M4KA 2CV1A 3KZYA 3DF8A 3WTWC 2PI0A 1H0MA 4A3IJ 4HQEA 2M87A 4DZJA 4XMYA 4IOAF 3FHZA 1DU6A 2DK5A 4FE7A 4L0ZB 3L2CA 1Y8QB 5DS9A 2K27A 3G71I 1U0JA 4UV9A 3NQOA 4WF2A 4J01A 4GDFA 1VNDA 1XN7A 2EIKH 1TW3A 4I0AA 2X6OA 3S1QJ 2DA5A 2XDVA 2L2OA 3EPZA 4II2A 4ON0A 4BEHB 1WWXA 4MO7A 3R6SA 2E60A 3GMEA 1BI1A 1R4MB 2ZSIB 1IAWA 2FXAA 3OIOA 3H36A 4BUPA 2XRLA 2VC0A 4BE2A 2QA4I 2JSPA 1RR7A 5GPCA 3CP8A 3O3KA 2HQRA 4A3EJ 1S29A 1FX7A 3IC7A 1ONVA 2FOWA 5HS7A 3S16J 3M7GA 1D1BA 2F5VA 4D0PA 3HDDA 1Y8RB 1IRXA 2W24A 3DPLC 3LMMA 1Z9CA 3FISA 3MWMA 1YX3A 4OIPF 3S2DJ 5B66C 2OQRA 5IYDJ 1FIAA 1SFKA 2P81A 1I3QJ 1W7PD 2W00A 1OCRH 5CLSA 2ID6A 2LKXA 2B63J 1JI8A 3A03A 1Z67A 2LFBA 4PCQA 2BBYA 2DYRH 4JOMA 3DPTA 3VOEA 3ZPLA 1W4MA 5TISC 2BVMA 1BOAA 4ZYEA 1S5LC 3CC7I 2QZ8A 4F3QA 4A3JJ 1TNSA 1OR7A 3GTGJ 4YRVA 3I56I 3HL2A 2XIGA 4BY7J 3A01A 2WC2A 2L4MA 3MKYB 2JQ7A 4XN3A 3G1LA 1XMKA 4IQ4A 2HVRA 1Z77A 1SAUA 1SMYF 2K9QA 1QA6A 4IRIA 1ZR4A 4CCOA 1D1CA 3B02A 3F8CA 3KFWX 3BDDA 2XC7A 3HXLA 3K2ZA 2DA1A 1GDTA 3I0TA 3QPLA 2PBIA 2DOAA 3LQQA 3BG5A 3ABLH 1LE8B 1UHSA 1XSXA 1VTNC 1LDKB 1KU9A 2QQAA 1POGA 1B1BA 2L54A 2OTJI 5FO5A 2PX9A 2G0EA 3WGGA 1IJWC 3H0DA 4BXUA 2IA0A 4I76A 2VE9A 3K70D 4ANJA 2LBFB 4E7IA 3BOQA 2L7ZA 1UZCA 3FXOA 2L3DA 3QWLA 2M1BA 3D0SA 2DT5A 4PJJA 2NNYA 2EV6A 3C3WA 2DMTA 1IN4A 1V4RA 2ME6A 2VXDA 3QYFA 1ZRFA 2F48A 4N9HA 1OQYA 1TL8A 2E1MB 2A61A 4DIQA 2B9SA 1CGPA 3Q0WA 1LDDA 4HEA2 4YEJA 3K70C 1LQ1A 4E7JA 3R0AA 1GVJA 4R8HA 3CCQI 5IT9Z 1UG2A 1FJLA 3I59B 2O61A 3N97A 2JPBA 2NYXA 1WCMJ 5M3FJ 5E20A 4E7ZA 2H94A 3F72A 4Y3OA 1R7JA 2XGEA 4M3DA 2DAOA 1IGNA 2CO5A 2H8RA 5HNFA 1TLHB 1UCRA 3DLLF 1U9OA 4AC0A 5D8LB 5E8IA 2LSOA 3TO9A 5DTDA 3OSGA 5ILVA 2KLOA 1KA8A 1YJWI 2YUSA 4KT5C 2K4BA 1WRJA 3HTSB 1FP1D 3HB9A 3I3LA 2CU7A 2VQCA 5TRDA 3HUGA 1F36A 2PFBA 2LMDA 3IHUA 2C6YA 3MKLA 3ZP5A 3X2QH 1VQ5I 2EZIA 1UHWA 3NWSA 2F5DA 3OYGA 5EDNA 2RAEA 1VQKI 2DMPA 3FK7A 2QKMB 4G6QA 5F1JA 1JJ6C 1EH6A 1E3HA 5KAIC 5E3NA 1BC7C 2ZJPF 1S7EA 2FQ3A 2BGCA 3KX2A 3SEZA 1B8IB 2VJIA 1BOBA 4XLNF 1U2WA 1XC5A 5HDNA 1JKOC 3H0GJ 1P9QC 2P6TA 3J80Z 4BEHA 5EJCA 4AIJA 3TOBA 3KZZA 3VYSB 1JTYA 4RMNA 3S3MA 4A0YA 1OYYA 4N0BA 3ZMUA 1EJ9A 3Q0UA 2A5WA 2KIUA 1D1AA 1BR4A 1ETOA 3HG9A 2V6EA 3Q5FA 4Q47A 4FQGA 5J3LA 1SFUA 1KYWA 1FBSA 2IXSA 2L4AA 4KIGA 3IAM2 1LEAA 1OKRA 2M7AA 2DDBA 1QVTA 3A02A 2E19A 2WAQN 3CCMI 3F8FA 3JRHA 4PGHA 2QQ8A 3RPQA 2LKSA 5JHFA 1YYVA 5LLQA 5K5OA 1SAXA 4JX5A 3WU2C 1ZARA 3OWTA 5B3SH 3H5AA 3MZYA 2BHYA 2HDDA 2VKEA 1HW1A 2XAGA 2JRTA 1YW8A 2AO9A 2VL8A 1JGGA 3CC4I 1SFEA 3MMYB 3OYBA 2EH3A 1OJLA 3MCZA 4PFOA 2FE3A 3BQYA 1SFOJ 3N05A 1FTZA 3CF2A 1UJ8A 4PFPA 3C18A 1HA8A 1BI0A 5DDGA 2BXZA 1HBXG 1MMAA 1HW2A 4MFDA 1R00A 4AYBN 4BU2A 4KISA 4I01A 3EDPA 2KRCA 2HVQA 3MEXA 3SEQA 1KZHA 4DQ2A 2CV2A 2ZXIA 2XF6A 2M2EA 1PDNC 3PSFA 3A4CA 5LEKA 4B1RA 4MIMA 5J40A 2IPQX 3KYCB 3T1BA 2D1HA 4L5EA 3TEDA 1LE8A 1L3LA 2EA4A 3KEOA 3E6CC 2XVCA 1HLVA 3E5QA 4IKFA 4XIDA 3K1MA 4M6XA 1IXCA 1RETA 5DUKA 3FHNA 2LBFA 1IV8A 3WGIA 3GTOJ 3RZDJ 1K79A 4LLLA 4IHYA 3MAJA 1SD7A 1O3SA 3I4NJ 3COAC 1I3AA 5JVGF 2NVTJ 3BR6A 2B7EA 1T33A 5HS8A 1VFCA 3LNQA 2NOGA 5F1RA 2RNGA 1XX5A 3LA2A 1GVDA 4WX9A 2P7CB 4IZZA 2EILH 5EEAA 2L7MP 4G6DA 3I55I 1KQ9A 1YE9A 1SD6A 4C3JJ 2KDZA 3I59A 1TC3C 2UUZA 4OINF 2YX4A 5LEJA 1Q1HA 4MQVA 3I64A 4RB2C 1K6YA 3SXYA 5J1RA 4ZH4F 2Z99A 2FUG2 2JT1A 3OIQA 4CGZA 2ZJ2A 4AIDA 4RM2A 2MA3A 2L9NA 5AONA 4MTDA 5ILUA 1VQMI 4C9YA 3HRSA 3H9GA 1T0FA 1QPMA 2PJPA 2CH0A 3BR2A 2CQNA 2X51A 3PQJA 1OCZH 5TJJA 1HCRA 3HSFA 2QKLB 4WWCA 4IVNA 3W2VA 3Q0VA 1EF4A 5IOYA 1MNDA 4RS8A 3LSIA 5E17F 1V5GA 2OU2A 3BROA 3JRCA 2EB7A 3BJAA 2M0CA 5J1UA 1FOWA 2KT0A 2M45A 1K4TA 1WI9A 2BEOA 2PMZA 3O8HA 2XPVA 3QODA 4IEJA 2DJNA 2O5RA 1IUFA 3RDIA 5CPRB 2LY9A 1B8IA 3RI4A 2XSDC 2ACJA 1HF0A 2HWVA 3WE3A 3HHGA 3VSKA 2GM4A 2FU4A 9ANTA 1XGSA 1R4NB 4NUBA 1LFBA 3EUAA 4WXDA 4RGUA 3WTUC 4B47A 2KISA 3HKZA 4W97A 1G59A 2IS6A 4EATA 3L1PA 5CKTA 4XSZF 4DOZA 5BS6A 4X0GA 1FSHA 1YJNI 4KJZA 1P6RA 1PYVA 2QSGX 3L00A 5D5VB 3UNGC 1DUXC 3CCJI 5HDGA 1X3WB 2ZFWA 1PJRA 2QBYB 3Q9VA 1UB9A 1MD0A 2JMWA 5J47A 4CUGA 2DOEA 3S14J 3MZ8A 3DTIA 3QOEA 2PMHA 1HXDA 1MSFC 2DA6A 2JZYA 3SJMA 1O3TA 4I2OA 5ICCA 1VQ8I 3QPHA 2CW7A 1V5EA 2K9LA 1XTAA 4E70A 3FK6A 5JR3A 2OV7A 3FX3A 4KDPA 2F5CA 1E3OC 2R7TA 1BR2A 3LSJA 4I7HA 3ZQHA 4LG0B 2XAJA 4M72A 4XLHA 3CF5F 2P8TA 1KONA 2M7BA 4Y4RA 2XGDA 1USSA 2LREA 4QWQA 1JUMA 2UZKA 1H9TA 3K1NA 3K1PA 3E6BA 2W25A 1DU0A 2NVXJ 2J5OA 1ZLKA 2KPMA 4M9ZA 2IS1A 2HEOA 4LK0F 3W6VA 1ZKGA 3NAUA 1KU2A 1QPIA 3OYKA 2HS5A 4II3A 3OYFA 1TBXA 1OR7C 2D5VA 4JP0A 2IT0A 3F0CA 2DBBA 1D0ZA 1PUFA 4A12A 1RC9A 4B09A 4I6ZA 1HC8A 4XKBA 1IUYA 2DA2A 4UB8C 2XASA 1I6HJ 1U5TA 4NNJA 5IT3A 2L7FP 2X48A 2NVUB 2OTLI 2FEZA 2X85A 3BZ6A 2DPDA 1O3QA 3HOZJ 1D5YA 2FQ4A 1ZG1A 3BG9A 3PFYA 5HVQC 1TWGJ 5E3LA 3KLOA 1HKSA 2COMA 3VYRB 5L3GA 4A3FJ 4Y15A 1DGWY 1RI7A 2HFHA 1LJ9A 2JTVA 3PIOF 3BR1A 2GXAA 3FXMA 2OAZA 5K7HA 2IBDA 1PP8F 5BPDA 4B3XA 3PNYA 1E3PA 1A04A 2WADA 2Z5UA 2QSHX 4OMZA 4UUVA 1SVOA 1ZAOA 2IRFG 2HOEA 2MGQA 4BHPA 3K7AJ 2K9SA 1Y0NA 3ECOA 3I58A 1REPC 2L02A 2E7WA 2E2HJ 4UV8A 3ZQGA 1CQTA 2ECCA 3GTKJ 1S9HA 5FKNA 4PDKA 1M1EB 4EVIA 1WH7A 3WODF 3FXRA 2LF8A 2XB0X 3A0HC 3SZGA 1XSDA 4EM0B 3RKWA 2PG4A 4LFUA 1OCOH 2EFNA 2R7DA 2FNPA 5FLMJ 2ME0A 4U0VA 3C7JA 3M8EA 1WFXA 3HJEA 3SQNA 4D7MA 1GUUA 3DBRB 2ZCWA 1IN6A 1ODDA 3GX4X 4A69C 2KRHA 2EINH 2XUBA 2LKPA 2EA2A 4D5CA 3OL4A 1VQ7I 3GFIA 2HDWA 3PUBA 5HLTA 2OCEA 2XGCA 2ZMEB 4RB3C 3V8KA 1XS9A 2BY2A 1JT6A 1Z6RA 2FBKA 2K7LA 3A01B 3M4OJ 3OY9A 2CFOA 1MBJA 4IO9F 3WTTC 2RQPA 4DBQA 2IGNA 4IL6C 3H1CA 4ZDPA 1P4WA 2FSWA 1YIJI 2DODA 2HVSA 1Z91A 2V7FA 2DQRA 3E5UA 3VODA 1JHHA 1R5HA 5IOZA 1WJEA 3BTCA 4G7ZF 2WWYA 3WHCA 1JTXA 2UXXA 3QP6A 3QRFF 3VDXA 4LLNA 2QBYA 3HRUA 4BGDA 3HYIA 4HYEA 4HDVA 3W2AA 4G12A 1W5SA 2VIXA 2XRNA 2L5QA 5F0CA 3O2PE 2XROA 1FPQA 3AG2H 4A5NA 5KAFC 1F43A 3M3YJ 5L3DA 2BHZA 1DDNA 2VUMJ 3QQAA 1D0XA 2V6CA 1IXSB 3IAS2 1FZPB 2QYOA 2NS0A 5FKLA 1ZG5A 5EF6A 2A69F 2VLAA 3J7ZI 3G73A 4HNTA 3BTJA 3DEWA 2DT7B 2ZXHA 4CZCA 4LG0A 3SFIA 3ASOH 2LTPA 1VQ4I 4ETSA 3GTQJ 2V9KA 1RUOA 2XSJC 4XQFA 1MKMA 2D1VA 2F5FA 2M34A 4CYDA 5KHDA 2OC6A 3ZMDA 2KL4A 3MKZA 2DMQA 1IDYA 3S3NA 4EQQA 1JGSA 1ZYRF 2DPUA 1FEXA 1MMNA 2IS2A 3ABTA 2GOXB 5FLXK 4B43A 1ZLJA 5C4XJ 1WJFA 2MYSA 4ASNA 4BACA 3GFJA 1AU7A 3JSOA 1IRFA 1A5JA 3SFZA 3ZRGA 1OMIA 2OJED 4IF4A 5E79C 3U1DA 3AFHA 4PJ0C 2L0KA 2GXGA 4OIRF 3BG3A 3K2AA 3V4GA 4DBRA 1AWCA 3S2HJ 2AHQA 4EV0A 4AIKA 4XOPA 1WJ5A 2KHMA 2VBWA 3EYYA 3Q9SA 2XF5A 5LGUA 3DEUA 4I09A 4M74A 3HOVJ 4KICA 1BJZA 2VXZA 3ABMH 3H3UA 5CVRA 3QYBA 5KVRA 4RBOA 4NQWB 5B1AH 5LFAA 3ZGKA 5FRNA 3HPGA 1QO0D 3HRTA 3WTSC 2GIZA 3KP3A 4BDYA 4V19K 1J75A 3OS2A 2E2IJ 2DN0A 4AD9A 2HTSA 1XPXA 3QU6A 4LG3A 5FJ8J 1FNNA 3IH4A 2E1MC 2H09A 1F4KA 1ZGWA 5F04A 3ZMTA 3GTMJ 4HX8A 4UXNA 3PM1A 1W0UA 2WAEA 2UXNA 3BPXA 5HLIA 1FT9A 3PSIA 2DTRA 4HX4A 4ZTFA 4ENMA 5FFXA 3EYIA 1IRZA 1D3YA 5LBQA 1T8IA 2CYYA 4DYQA 2P7VB 3D5LA 5D8KB 1SANA 5E1WA 2EQRA 2O7OA 1QZEA 2ZC2A 2LR8A 1X1PA 4N9IA 1FY7A 4M3EA 2YR2A 1T0FC 1YG2A 2HOAA 4AIHA 5L3EA 1ZR2A 1R9TJ 2VASA 2X1EA 1JXSA 3RPUA 2ZMEA 4CCNA 4XL9A 1LUJB 4KA4A 1WJBA 5E1XA 5F27A 1TWCJ 2ZNZA 4ZYHA 3RSNA 3DBHB 2GBYA 1BC8C 1P4AA 4EJVA 3G2BA 1KYZA 1O7LA 2LH9A 3CMMA 4HF1A 3DPUA 2Q2EB 3J81K 2RDPA 4U7BA 1J59A 1S7OA 2EV0A 3OIPA 2JA8J 4QSHA 1YOVB 4J00A 4XBFA 2HR3A 2RC4A 1NK3P 5DYMA 3MZHA 3GYHX 1HSJA 1TT5B 2FNAA 1QQIA 3I5UA 3KP7A 3O8GA 2ZO4A 3B73A 4OU0A 3RJPA 3SDGA 4EJWA 2RV8A 1TT0A 4U88A 2WY7Q 3DU6A 5LHHA 4F91B 1APLC 3BJ6A 3E5XA 3HZJA 2JA5J 3ZQCA 3KP6A 3EUHA 3KCCA 1T95A 1R49A 1MZBA 1TZLA 3E97A 1LPQA 3J7YJ 4XKVA 4XICA 1OCCH 1FOYA 1SFXA 2TCTA 2L7KA 4CHUA 1YS6A 3RYRA 1VF9A 4YFXF 4G9YA 3M9AA 3D5RC 2F4OB 2R92J 1RIOH 2KKOA 2VT2A 2P0WA 2EZLA 3GZ5A 3S1MJ 1VQ6I 3I54A 3ZQFA 1YJ9I 2VN2A 1X1BA 2DTZA 1BBYA 2PMZN 3LFUA 1WJDA 4IQJA 3FM5A 1XSVA 1XGNA 2W7NA 3CLQA 5M3MJ 1I1GA 4KUMA 4A0ZA 1VQ9I 1Y0UA 5EG0B 2D45A 3ABUA 2IVMA 1ZGJA 5J8FA 2A07F 1RZ4A 2GA2A 3VSLA 3JRIA 3K10A 2VOPA 2Q8KA 2OBPA 3IL2A 1O7FA 2LP0A 3HKZN 4RGSA 2TDXA 3A0BC 3S3OA 1TP4A 3C2GA 1NG6A 4C2TA 4YIRX 3GZ6A 3TO7A 5CVUA 1WJAA 3LA3A 4NHJA 4BHBA 5KNLA 4D1QA 2EK5A 1H9GA 3K4JA 2E2JJ 1S3JA 3K4MA 2E5ZA 4RDUA 4DJAA 4M6YA 5L3FA 3GLLA 3LSTA 3TBIA 4LK1F 4A2UA 1SVMA 2VPLA 3T8RA 4XKWA 4NQWA 4WXCA 3RKQA 4CZZA 2X6YA 3OOPA 4E6KG 1G3WA 3ROUA 1U5TC 5DD4A 4LLGF 1WPKA 2ELKA 3OYLA 4XK4A 1U3EM 1XCBA 4V2GA 1BW5A 2KJCA 3AG4H 1X1CA 4XLEA 3RIRA 4RM3A 2ELHA 4RLQA 3CCSI 1VI0A 4DNCA 1NHAA 4LITA 5J6XA 2Y48A 2Y9ZA 2Y0SA 4NBQA 4M73A 2IA1A 3FXLA 5D6EA 2HU9A 4OIQF 3CP2A 4HSRA 3RKYA 1E17A 2CUZA 3E6DA 5F08A 3S1NJ 2L9VA 4BAYA 2V1XA 3HEFA 4HX7A 3FXQA 3L9FA 2Y75A 1ETWA 4HF2A 2F5EA 2ISYA 5EGOB 4KNYA 3OOUA 1Z7LA 1FMVA 2NS7A 1W5CC 1MNMC 2RNJA 1KU3A 2QWWA 3BR5A 2X0LA 5L3CA 2RVCA 3HOXJ 3U2RA 4M9SA 3WTYC 3OR1C 4LB5A 1FTTA 3PJRA 4FISA 1A6QA 5IPAA 1TWHJ 3DKYA 3CDIA 2DA3A 2Q2EA 1JT0A 3P9KA 2M30A 2OPTA 4OMYA 4G8XA 1WVRA 1ORKA 2MLGA 3CJQB 3V7SA 1QZYA 4C30A 1FYMA 2CSOA 4XKCA 2CQKA 2NNNA 3M1EA 3PIPF 4RLFA 1PUFB 2EZHA 1S8NA 2FOKA 2JVHA 3BWGA 5EEGA 4MEXF 4ESBA 4ESJA 2AS5F 1BI2A 2LNBA 3CCEI 4CYCB 4LIVA 2QUFA 3GLXA 1DQUA 2AXTC 1RPWA 1U5TB 4GFBA 4MTEA 2R7FA 4EM1A 3R60A 2LDUA 4F52A 3KYLA 3RZOJ 3H35A 3FMQA 5LGNA 3L2UA 2GIVA 1RESA 2VONA 4B48A 3QPSA 5DCFA 3HHHA 3V42A 1J7KA 1HKTA 3K4NA 1N78A 1ZGAA 2DDAA 3T8TA 3H92A 4XSXF 2PEXA 3SZTA 1HOMA 1A35A 2P5VA 1NK2P 4W1UA 3VB2A 4M3FA 4A3LJ 1O4XA 2EZKA 1R58A 4HBLA 2VC1A 4D7NA 5BPIA 3CMAI 1RR8C 4IX7A 5GP9A 5EYRA 2WBMA 4EJOA 4IHWA 2CS3A 1NG7A 4ZYGA 3CO7C 2O0YA 1YHQI 4BDZA 3ELKA 3MQ0A 5D4RA 2Y30A 2Z33A 2O8XA 5EG0A 3KEYA 2CRGA 3ZQ7A 1X4OA 2RKHA 3G4SI 3EETA 5KK1A 2NVYJ 5EZGA 4GYIA 3QU3A 2Z2SB 2ZJRF 2V1DA 3ESWB 4HPQA 5FLXZ 1IRGA 4CCMA 2MABA 2G7HA 2K5CA 1X1DA 1GXQA 2I5UA 1S7AA 2LY2A 3IRRA 3G6EI 2NRAC 2A05A 1W0TA 1Y1VJ 3DQVC 2A6EF 3I9V2 5FROA 1JHFA 5AIQA 5FD5A 4MHGA 2BZTA 3JRAA 1BIAA 2R93J 2OUMA 4BQNA 3KYDB 5HDKA 5K1YA 3JSPA 5FKOA 4G94A 2X1CA 3ISPA 2OQGA 3RQIA 3WTVC 5E18F 3WU1B 2ETHA 2HZDA 3M1CA 1AKHB 2W57A 2HYGD 2KP6A 4P55A 1YI2I 2O6GE 4V2FA 5JLXA 3V8JA 1KQ8A 3VYUB 1V55H 2YU3A 3IWFA 4HDUA 3F21A 4IRGA 2CWEA 1VQPI 4MNUA 3K69A 1FOKA 3PUFA 4GXOA 2HKXA 1D5VA 2IW5A 1FSEA 3FXJA 1Y1WJ 1YFHA 3VPRA 3G1OA 1IG7A 1P7IA 1NH3A 1MDMB 4KMFA 1LKXA 1TW2A 4BH9A 4CCKA 4C3IJ 5DUIA 2HI3A 1WKMA 2UV1A 1QGPA 3BZCA 3DXJF 1P2FA 4XONA 1ETKA 1J5YA 5E3MA 4FX4A 2VKDA 4GYGA 2FA5A 2DLLA 2M4GA 5H2FC 2DCEA 1YW9A 3DKXA 3H5NA 2E1OA 4MLOA 1LFUP 1CF7A 1FMWA 1MGTA 3TMOA 3REOA 1PVEA 2RREA 3LFKA 5EGOA 2BY1A 4N4OB 5IP7J 2O3FA 1K83J 5JFRA 3DWLE 5LGTA 1WI3A 3RPUD 4I0BA 1K61A 4P1WA 2V79A 2QENA 3CZ6A 4LJZF 3DTEA 3LSPA 2OF7A 5DEQA 2P4WA 1UMQA 2QVOA 1HDDC 4E7SA 4L9TA 5BNGA 4OAZA 1B72B 4UNOA 3WTZA 1YX5A 5CYVA 2A6TA 2N8GA 3J81Z 2ZSHB 5CJ9A 5D4SA 4IXAA 3ZMVA 2ZMEC 4I99C 5DM7F 1R6RA 5A2QZ 4PJMA 1IXRC 2VOOA 1OCPA 4JK1X 1UELB 2MFZA 2GOMA 4RAYA 2K4JA 2KIQA 5H6RA 3CTAA 3F9KA 4BQAA 4U0YA 1MMSA 4O6JA 4CYCA 3CO6C 2E7XA 3JAMK 1LFPA 2DO7A 2R0QC 1R22A 2R7SA 2DFIA 2CG4A 5KCMA 3LL7A 1OFCX 4K2EA 5JHUA 1ZQ3P 1STZA 3ASNH 1OCTC 1EH8A 2JUGA 2G9WA 2R7ZJ 5H6QA 4C2UA 1BJAA 1GV5A 4BBRJ 4BNCA 4M3GA 2EFOA 3RCOA 4PSWA 4BQOA 1K6OA 4A3KJ 1FYLA 2P5KA 5FB2A 2Y2ZA 4P9FA 3LAJA 2H1LA 3TKYA 3CUOA 2L9RA 1MBFA 4BL0B 2IEKA 2KJBA 2XF7A 5GADJ 1FIPA 3EUHC 1B6AA 2QLZA 3HOYJ 3L2WA 3HSRA 2VJ4A 3S8PA 4BE1A 3QAHA 3BG7A 3DKWA 1ETVA 3LSHA 1IN7A 4L5JA 3FF5A 1XMAA
chains in the Genus database with same CATH topology
2LG4A 4BDYA 3OS2A 3HOTA 2WAFA 1MMGA 3OMYA 4LG3A 3KX2A 3SEZA 2VJIA 4D9JA 3H9JA 1BOBA 1BR1A 2E1MC 2HPIA 1P9QC 2VQHA 2WAEA 4BEHA 2CUJA 3PSIA 3ZCOA 3VYSB 4RMNA 3S3MA 4ZTFA 2A5WA 4KITB 1D1AA 4XLAA 4R79A 1BR4A 3VWBA 3HG9A 2V6EA 3D5LA 3K4KA 2IXSA 3UR3C 3IAM2 2M7AA 4ZTJA 4HG2A 3K4BA 5CQGA 2Z16A 4CCJA 2R7QA 3FKJA 2W1OA 1T0FC 3IUOA 3W2WA 1UAAA 5JHFA 2VASA 4E7LA 2X1EA 1E0EA 3M8JA 3OWTA 4HNUA 4CCNA 4XL9A 2IGMA 3H5AA 4PK4A 2HNHA 1WJBA 2CW8A 2RQQA 1X1AA 3H9QA 2VL8A 2ZFUA 3J7AY 3MMYB 1J09A 2VB6A 2HQAA 3OYBA 2JVGA 1N77A 3LSGA 3RSNA 4B44A 3G2BA 3CESA 4PFOA 2LH9A 3SDBA 3CMMA 1D0YA 3DPUA 2Q2EB 3N05A 3CF2A 4PFPA 4U7BA 1HA8A 1MMAA 2LRDA 2M0MA 4E7HA 4BU2A 3OIPA 4KISA 2KRCA 4J00A 2X1DA 4H4KC 2HVQA 3SEQA 1Z3YA 2ZXIA 2CV2A 1ERDA 2XF6A 3PSFA 3A4CA 4GRIA 4ZYAA 1TT0A 2L9SA 3DEEA 4F93B 2R7XA 2WY7Q 4XNFA 2WAQA 3DU6A 4F91B 3K6GA 4IKFA 1T95A 1TZLA 1UG0A 4G6TB 4LIUA 4XKVA 3FHNA 2LBFA 2PJRA 3BCAA 2DJIA 2L7KA 2X6WA 3OYJA 3D5RC 3SYTA 2I8DA 3ZR8X 1GLNA 3TL4X 2P0WA 2RNGA 3EUKL 4ITVA 4CA0A 1X1BA 2LY1A 4IZZA 2AQEA 4AYBA 1Y56A 1WJDA 1YE9A 3LFUA 4IQJA 2DT6A 2UUZA 2W7NA 4N4NB 2R4GA 1MW7A 4BS9A 1K6YA 2VJ5A 2FUG2 1G8XA 3OIQA 1DP3A 4RM2A 3OS1A 3VSLA 2L9NA 3K10A 1QHHD 2R7OA 2KMUA 1WJCA 2JA2A 3S3OA 4C9YA 3C2GA 1NG6A 3H9GA 4C2TA 3BG6A 2V26A 1WJAA 3S93A 5KNLA 2CH0A 4D1QA 2R7RA 2BVLA 3K4JA 5CQEA 3DTKA 3K4MA 4AU7A 2E5ZA 2X51A 4DJAA 2E5NA 2MD0A 2QKLB 3PNTA 2F4IA 3C2HA 3W2VA 3TBIA 4Y33A 2BOLA 1MNDA 3LSIA 2VPLA 1V5GA 4XKWA 1N75A 2X6YA 4CH7A 2CMPA 2IGKA 4E6KG 3ZQQA 2PMZA 3QODA 4PJNA 3OYLA 1VZ0A 2O5RA 4DGWB 5CPRB 2DXIA 3VYTB 4YELA 4OWRB 1OLTA 1X1CA 4XLEA 4QPQA 3VSKA 1ZELA 3RTRA 4NC7A 4NUBA 4RM3A 2KZVA 3EUAA 4RLQA 4NC8A 2XAUA 4LITA 3HKZA 5TGTA 4B47A 3OYMA 3OYEA 1G59A 2IS6A 4EATA 2Y0SA 3OYHA 5CKTA 4X0GA 4DOZA 3E0JB 3OYAA 4KJZA 3OYNA 2HU9A 2Z1DA 4BE0A 3L2VA 1PYVA 3H5RA 3CP2A 4HSRA 4XM3A 2CUZA 3AKZA 3UNGC 2VQGA 3OR2C 3A1YA 1PJRA 1MMDA 3MD2A 2IS4A 3L2RA 1Z21A 4AVZA 4CUGA 2BW3B 2Q1ZB 3DU5A 4BQQA 3OOUA 1Z7LA 1FMVA 2NOJB 3DTIA 3QOEA 2K9MA 1EA3A 2K3PA 3CJRB 3OR1C 3PJRA 2CW7A 1V5EA 2K9LA 3NWTA 5FRMA 4ZJZA 1AA7A 2OV7A 2LOOA 2R7VA 2V4JC 3DKYA 3DLAA 2R7TA 1Z3XA 1BR2A 2LC2A 2VKHA 2WB1A 3CJQB 4E7KA 4C30A 4XLCA 4HSTA 4XLHA 3PL8A 1KONA 2M7BA 4XKCA 4Y4RA 4FETA 1MNEA 2LREA 3K4LA 4RLFA 4XLFA 2JVHA 3E1SA 4CSWA 2KPMA 4LIVA 2IS1A 1DQUA 4OAYA 3KYLA 4F52A 3H35A 4XR6A 3OYKA 3L2UA 1QU3A 4II3A 4B48A 3OYFA 1LVKA 1OR7C 3V42A 1D0ZA 3K4NA 1N78A 4BXFA 2CV0A 4ZDLA 3OYDA 4XKBA 4FASD 3HOSA 1QHGA 2W82A 4BJ5C 4XORA 4NNJA 4HRIA 2X85A 4BJ6C 4BJTA 2R7WA 4P5OA 3PFYA 2VQLA 5HVQC 3VYRB 4IX7A 3HUGB 2WBMA 3LSKA 3ONQA 2CS3A 2M4KA 1NG7A 1DGWY 2CV1A 3GBGA 4BDZA 3D5SC 3FDYA 3PNYA 4B3XA 4XMYA 2WADA 3KEYA 1V5FA 1U0JA 3L2QA 1X4OA 4J01A 3S32A 2Z2SB 4U87A 2M3AA 2XDVA 4HPQA 2L2OA 3BLYA 1X4PA 3EPZA 4II2A 4CCMA 1S9HA 2MABA 4BEHB 2E60A 2K5CA 1X1DA 2ZSIB 3SZGA 4PJLA 2R7UA 4BUPA 2LY2A 4BE2A 2JSPA 3W3CA 3CP8A 3DQVC 3I9V2 5FROA 1WFXA 2LYCA 2OUMA 4BQNA 1D1BA 2F5VA 1IRXA 2KRHA 4KT6A 2X1CA 3DPLC 3QYEA 4ZDOA 3LMMA 2W4SA 1YX3A 3OL4A 5LD2C 2HZDA 3M1CA 3HC7A 2F6CA 1SFKA 2HDWA 2KP6A 3PUBA 5HLTA 3BC8A 3OYIA 2ELJA 3VYUB 2W00A 4F92B 3OY9A 2CFOA 1JI8A 4XOTA 4DBQA 2IGNA 4ZDPA 4JOMA 3DPTA 2IGOA 2BVMA 2HVSA 2V7FA 4F3QA 1LKXA 3LSMA 4CCKA 1WJEA 4YRVA 3HL2A 3MKYB 2UV1A 4XN3A 4XONA 4IQ4A 3VDXA 2HVRA 2VKDA 2M4GA 1SAUA 2DCEA 3DKXA 3H5NA 4BGDA 4MLOA 2WY8Q 1FMWA 1D1CA 4CCOA 3W2AA 3AL0C 2VIXA 3TMOA 2XC7A 2BW3A 2L5QA 2RREA 3HXLA 2DOAA 3HPHA 4N4OB 5HOOA 3OL3A 3DWLE 3RPUD 3ZXSA 1LDKB 4P1WA 3CZ6A 1D0XA 3DTEA 2KDOA 3IAS2 3H0DA 4PUSA 4E7SA 3K70D 3K4CA 2VLAA 4ANJA 2LBFB 4E7IA 4OAZA 2PJRB 4HNTA 3FBIB 1YX5A 1X19A 2MC4A 4PJJA 2DT7B 4QPOA 2A6TA 2ZXHA 3RQ4A 4CZCA 2ZSHB 2VJJA 1Y6IA 2VXDA 3QYFA 2WA0A 2V9KA 4ZC3A 4E4HA 1R6RA 2V1NA 2XSJC 2E1MB 4PJMA 4DIQA 4XQFA 1UELB 2MFZA 2GOMA 3IP4B 4HEA2 3U21A 5HNHA 4YEJA 3K70C 4E7JA 1DGRM 3F9KA 5KHDA 2OC6A 1W36D 2KL4A 1LFPA 3MKZA 3S3NA 3FBNB 2R7SA 2UWMA 5KCMA 3LL7A 4E7ZA 2AQFA 4Y3OA 1MMNA 2IS2A 2HPMA 2GOXB 4XN0A 4B43A 2JUGA 3PNVA 1WJFA 2MYSA 5HNFA 4BACA 2X6XA 1W36C 4C2UA 3OS0A 3RCOA 3ZRGA 4PSWA 4BQOA 3AFHA 4DBRA 2KLOA 3BCBA 3MKWB 4XOPA 1WJ5A 2KHMA 4JQFA 4BL0B 3I3LA 4F55A 2VQCA 2XF7A 2XF5A 3EUHC 3A2KA 2VXZA 3QYBA 3L2WA 2VJ4A 4PSXA 2KQRA 3S8PA 4NQWB 3NWSA 4CCLA 4BE1A 3BG7A 5LFAA 3OYGA 3ZGKA 5FRNA 3HPGA 3AL0B 3LSHA 3OYCA 2QKMB
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ELJ A;  2AQE A;  2DCE A;  2AQF A;  2CUJ A; 
#chains in the Genus database with same CATH topology
 2LG4 A;  1X58 A;  4YIF A;  1MMG A;  5BQT A;  1K4S A;  3OMY A;  3G3Z A;  1S6L A;  1XGM A;  4D9J A;  5LRS A;  5EZH A;  4M71 A;  2QCO A;  2VQH A;  5JLW A;  2O8K A;  2B0L A;  3GF2 A;  2CUJ A;  3I53 A;  1ZK8 A;  3CDH A;  4RAG A;  3S17 J;  4EJU A;  2NAZ A;  2GWR A;  2BYV E;  2K40 A;  5J4V A;  5GAG J;  5FKM A;  4KYW A;  4KIT B;  1GV2 A;  2DMN A;  2LK2 A;  4XLA A;  3TP0 A;  4R79 A;  1JKQ C;  3VWB A;  1YQA A;  3K4K A;  4HOB A;  2EPF A;  3UR3 C;  2DFH A;  2HQN A;  2VKV A;  5IP9 J;  1BN5 A;  1YS7 A;  4ZTJ A;  1Z6T A;  3K4B A;  3O6B B;  1W5T A;  3G1M A;  2R7Q A;  4PZJ A;  2CGP A;  1T56 A;  3H3Z A;  1K7A A;  1G3S A;  3IUO A;  3W2W A;  1UAA A;  1AKH A;  3KP4 A;  1ENH A;  1X2M A;  1RUN A;  3E6M A;  3R0J A;  3M8J A;  4HNU A;  1HDP A;  2A5Y B;  3KIO A;  2PLY A;  3PO2 J;  3GTL J;  3P5J A;  4ESF A;  4L0Y B;  2CW8 A;  1FYK A;  1X1A A;  3CMY A;  4QIW N;  3J7A Y;  2HQA A;  2JVG A;  4GO1 A;  3LSG A;  1N77 A;  1J9I A;  4B44 A;  3SDB A;  1AOY A;  1D0Y A;  3K0L A;  1ULY A;  3OSF A;  2H8W A;  2M5W A;  4KFC A;  2XAF A;  1MDM A;  1WGX A;  1MIJ A;  2F4M B;  2LRD A;  2M0M A;  2BY3 A;  4E7H A;  4IJA A;  4RAZ A;  4P9U A;  1XDS A;  2XHK A;  2ZJQ F;  3AAF A;  3DCF A;  2G7U A;  1IZ1 A;  1VQL I;  2NVQ J;  5M5Y J;  2CFX A;  3WG9 A;  1RKT A;  4Y52 J;  2LF7 A;  4ZYA A;  2E1N A;  2L9S A;  3DEE A;  4F93 B;  2R7X A;  3S2W A;  1ACI A;  4UVB A;  2VPR A;  2IA2 A;  4HAM A;  4OIO F;  2X4H A;  4YFK F;  1YIT I;  3DBL B;  4RAF A;  3KP2 A;  4G6T B;  1SC7 A;  3ULQ B;  1J2X A;  2EJR A;  4EM2 A;  4RB1 A;  1B72 A;  3BCA A;  5EEH A;  2X6W A;  3S15 J;  4DZP A;  4FCY A;  4TV7 A;  1MSE C;  2I8D A;  3ZR8 X;  5DCM B;  3AG1 H;  5LRR A;  2CW0 F;  1GLN A;  3CQZ J;  1NTC A;  2QQB A;  5E8G A;  4CDG A;  5C4J J;  4MFE A;  5F6F A;  1K78 B;  2Y0M A;  3F22 A;  2LY1 A;  2KZG A;  2AQE A;  3IH2 A;  1Y56 A;  4GCV A;  1R5I D;  5H20 A;  1QNT A;  2NS8 A;  2CQQ A;  4N4N B;  3CCR I;  3CME I;  1A31 A;  2XKP A;  2ISZ A;  2WTE A;  5CVI A;  4IHS A;  4S04 A;  2MLK A;  1G8X A;  1SD4 A;  4BBS J;  3OS1 A;  1MJA A;  3CUQ B;  3TDU C;  3BR0 A;  2KMU A;  3T0Y A;  2DFF A;  3PO3 J;  2Y0S N;  3NAR A;  1ZHF A;  4HQM A;  1Y39 A;  2K86 A;  1MH4 A;  4G7O F;  2BVL A;  3W6J B;  3ML6 A;  3LOC A;  5CQE A;  3DTK A;  4AU7 A;  2P6S A;  4A6D A;  1IDZ A;  3MVP A;  4X1E A;  2F4I A;  2HDC A;  2HOS A;  1FLI A;  4Y33 A;  2BOL A;  1W1W E;  2GAU A;  3ZMS A;  3VEP A;  3GWZ A;  1N75 A;  5LHG A;  3N4M A;  5FKK A;  4JX4 A;  5K7Z A;  4U7D A;  4CH7 A;  2ZXJ A;  5F0F A;  1BW6 A;  2E34 A;  1GT0 C;  2COB A;  3LQR A;  4YII A;  4EGY A;  2AXL A;  4KIB A;  2ZB9 A;  4PJN A;  1T39 A;  2FF4 A;  4KIF A;  4DGW B;  2DXI A;  1H89 C;  3VYT B;  4YEL A;  5B5E C;  1OLT A;  4JBA A;  4LD5 A;  1LNW A;  4QPQ A;  2HXI A;  4HF0 A;  1ZEL A;  4XLP F;  3RTR A;  2KZV A;  4NC8 A;  3OYM A;  1R5G A;  5TGT A;  2CQ7 A;  3HBL A;  3OYH A;  1V3F A;  3LAP A;  3L09 A;  2DK8 A;  1X2N A;  1G6N A;  2KRF A;  3AG3 H;  1G4D A;  4IRH A;  2Z1D A;  4UVA A;  4BE0 A;  3CC2 I;  2ZBK A;  1OPC A;  3H5R A;  2HYJ A;  4XM3 A;  3F8N A;  5E3O A;  1J0R A;  2VQG A;  1MMD A;  3FZV A;  2MD5 A;  2IS4 A;  1OYI A;  4AVZ A;  2BW3 B;  2Q1Z B;  3DU5 A;  2QF7 A;  3WG7 H;  2CUE A;  5A2Q K;  1HST A;  1P92 A;  2MG4 A;  4Z2Y A;  5ICF A;  2DOF A;  2VBY A;  3JRF A;  3GXO A;  3SZP A;  2KIF A;  3PFI A;  1OIS A;  3NWT A;  4CO8 A;  4ZJZ A;  1AA7 A;  4I98 B;  2LOO A;  3IV5 A;  2R7V A;  3I4M J;  1MJB A;  1FBQ A;  1FOX A;  3DLA A;  1F1Z A;  1JKR C;  1XGO A;  4WCG A;  2ZNY A;  1UHM A;  1Z3X A;  1R23 A;  2VKH A;  2WB1 A;  1YIO A;  3BY6 A;  4RB0 A;  5J8C A;  1D8K A;  1G2H A;  2M8G X;  2QSF X;  3DV8 A;  1BM9 A;  3M07 A;  4M9X A;  4EMS A;  4FET A;  1MNE A;  3HIF A;  3E1S A;  3GCM A;  4FTH A;  4CSW A;  4A6E A;  4ABZ A;  1Z05 A;  4MGR A;  4L9V A;  1IF1 A;  2A3S A;  1ZN2 A;  4OAY A;  4ZYD A;  2CJJ A;  2FBI A;  3GFM A;  1TTY A;  3JR9 A;  2FML A;  1RNL A;  1QU3 A;  3ECH A;  4EGZ A;  3ZOB A;  1LVK A;  1SD5 A;  2OZ6 A;  1KQ0 A;  1PUE E;  1E2X A;  5ILS A;  4P96 A;  2W84 A;  4ZDL A;  2GLO A;  1GHC A;  4J19 A;  3HOS A;  1QHG A;  1T38 A;  1XD7 A;  4BHC A;  2RGV A;  2Y69 H;  5B1B H;  4BJ5 C;  4XOR A;  4L9J A;  1HW5 A;  4HRI A;  5ICE A;  3ERM A;  3KZI C;  3BTI A;  4BJ6 C;  4BJT A;  2A68 F;  2YPR A;  2R7W A;  3GTP J;  4P5O A;  4NC6 A;  5DCM A;  1D8J A;  5HLG A;  1ZRC A;  4LOC A;  4XRS A;  1KU7 A;  2DMU A;  1P7J A;  3FIW A;  3ONQ A;  4ENK A;  1K78 A;  1V54 H;  3CJT B;  4A3D J;  3GBG A;  2GZW A;  3W6K B;  4QLC U;  5FLV A;  2HXO A;  1RKW A;  3D5S C;  4KN4 X;  2GXB A;  3FDY A;  3JAM Z;  3P9I A;  4Y17 A;  1V5F A;  2HYF A;  4RGR A;  3L2Q A;  1W7P B;  3GO5 A;  4HW0 A;  3TOA A;  1YW7 A;  1TQI A;  1UFM A;  3CUQ A;  3GFL A;  1U78 A;  1ETX A;  4NB5 A;  1Z7U A;  3HSE A;  3S32 A;  3KE2 A;  3CDL A;  3PQK A;  2M3A A;  4U87 A;  2QEX I;  2JK3 A;  3BLY A;  1X4P A;  2ECB A;  2M8E A;  2OA4 A;  3E7L A;  5JI6 A;  1QZZ A;  3F23 A;  2I10 A;  4HNV A;  2EV5 A;  2ZKZ A;  4Z6Y A;  3R61 A;  1WHU A;  4PJL A;  1JE8 A;  2R7U A;  5BMZ A;  3W3C A;  2R5Y B;  4ENN A;  3BZK A;  4UUT A;  1N25 A;  3RKX A;  1LVA A;  2LYC A;  2J5P A;  1SVL A;  5FGM A;  1KGS A;  3WHB A;  3S1R J;  1YO5 C;  4KT6 A;  4ZDO A;  3QYE A;  1LEB A;  5HOD A;  2W4S A;  1T2K A;  5LD2 C;  4Y13 A;  3HC7 A;  2F6C A;  3QPT A;  1O3R A;  3BC8 A;  3OYI A;  2ELJ A;  1U9N A;  2XAQ A;  4C2M J;  2EBI A;  4F92 B;  3HGY A;  3D1N I;  4BKX A;  5FFZ A;  4XOT A;  3CCV I;  1CF7 B;  1IC8 A;  2HKO A;  2IGO A;  2QQ9 A;  4QTR A;  3FMS A;  2WV0 A;  5IYC J;  1AHD P;  1JUP A;  4IOC F;  1ZTR A;  2QGU A;  3LSM A;  2MSY A;  4BYY A;  1DPU A;  5GPA A;  2R5Z B;  1TQM A;  4ENJ A;  2DFE A;  2YSR A;  3E3V A;  2FMY A;  2XAH A;  1XMX A;  3J7A O;  3V7C A;  2ICW G;  2WY8 Q;  3F6O A;  3JRD A;  4ZZD A;  4G7H F;  3AL0 C;  1UST A;  4RA2 A;  4F7Z A;  1MBK A;  2BW3 A;  2DU9 A;  3BP8 A;  1JUS A;  3HPH A;  4HV6 A;  5D6F A;  5HOO A;  2OZU A;  2XB5 A;  3OL3 A;  1QBJ A;  3ZXS A;  1I5Z A;  1VQN I;  3SHF A;  1ETQ A;  2BY0 A;  2QM3 A;  2KDO A;  3CLO A;  4PUS A;  3ABK H;  3K4C A;  2EFQ A;  5LHI A;  2PJR B;  2JJ7 A;  3FBI B;  1MBG A;  1X19 A;  4BY1 J;  2MC4 A;  4QPO A;  1A6I A;  5DV5 A;  2H6B A;  3GW2 A;  3RQ4 A;  2LD5 A;  2VJJ A;  1Y6I A;  1TWF J;  4S0H B;  2WA0 A;  4ZC3 A;  4E4H A;  2H1K A;  2V1N A;  2W48 A;  3IP4 B;  4L9N A;  3U21 A;  2OCC H;  1MH3 A;  3NRV A;  4AWX B;  4OOI A;  5J1Y A;  2XV4 S;  1DGR M;  1P4X A;  2LVS A;  1F9N A;  4HZF A;  2CUF A;  4Q5S F;  2KIM A;  3BT9 A;  4L5I A;  1W36 D;  5IP6 A;  3GEZ A;  3FBN B;  1FP2 A;  3C2B A;  4I02 A;  5HS9 A;  4YFN F;  4H0E A;  2UWM A;  1PP7 U;  3P7N A;  1R36 A;  2OD5 A;  1T6S A;  2AQF A;  2DA4 A;  4FHT A;  2HPM A;  4XN0 A;  1BIB A;  2E71 A;  2E36 A;  3PNV A;  3QP5 A;  3F6V A;  1TQP A;  4DYR A;  1I1S A;  2X6X A;  5D5X B;  1W36 C;  4S05 A;  6PAX A;  3OS0 A;  3CCL I;  4U0W A;  3DFG A;  2HGC A;  5HLH A;  2MC3 A;  3BCB A;  2K3F A;  3MKW B;  1I6X A;  4B8X A;  4A3G J;  4JQF A;  3F8B A;  4F55 A;  2JN6 A;  3JTG A;  1T08 B;  2YX7 A;  5C3E J;  2IAI A;  3A2K A;  1XB4 A;  5FD6 A;  1ZRE A;  1U8B A;  2Z3Y A;  4PSX A;  2KQR A;  1DPR A;  3HRM A;  4CCL A;  4LGW A;  2JPC A;  3AL0 B;  2L01 A;  3BTL A;  2XPW A;  3I71 A;  3OYC A;  1C0W A;  2H27 A;  3JRB A;  4A0X A;  3P9C A;  2EIM H;  3WE2 A;  3HOT A;  1W7P A;  2WAF A;  3K9T A;  2Y9Y A;  1S72 I;  1IO2 A;  3MFK A;  4AVP A;  4Y7N J;  3I4P A;  3H9J A;  1BR1 A;  1XDU A;  3FM3 A;  2VOD A;  2HPI A;  5ED4 A;  1EKE A;  1BL0 A;  3DP7 A;  3ZQL A;  3Q3S A;  2JRM A;  3KEQ A;  1LDJ A;  2VI6 A;  3ZCO A;  4EJT A;  1B9N A;  3CD6 I;  3BPV A;  4DW6 A;  3L7W A;  2R5Y A;  1YTY A;  1MJ9 A;  2YS9 A;  1BI3 A;  3WTX C;  2Z9O A;  1I50 J;  1WQ2 A;  4HG2 A;  4RGX A;  4KMU X;  1ZH5 A;  5CQG A;  2Z16 A;  4CCJ A;  3JRE A;  3FKJ A;  4XRM A;  2W1O A;  1B9M A;  5HNH A;  4DYC A;  4E7L A;  3TW6 A;  3IKV A;  4PGG A;  4WK8 F;  1FBU A;  3U9G A;  2HTJ A;  3OV8 A;  1E0E A;  2IGM A;  4PK4 A;  2ESN A;  2HNH A;  4JX6 A;  1YRN B;  3KP5 A;  2XGX A;  3GZN B;  2RQQ A;  3H9Q A;  5ERI A;  2ZFU A;  3JW4 A;  4O5V A;  1J09 A;  4XRF A;  2VB6 A;  1MBE A;  4FX0 A;  3B6A A;  4LB6 B;  3FWE A;  3CES A;  4O3M A;  4UB6 C;  3GVA A;  2Q0O A;  2O9L A;  3FKI J;  3TO6 A;  5E1Z B;  2R5Z A;  1EV7 A;  2MBF A;  2WV1 A;  2X1D A;  4Q4Z F;  5DD8 A;  1DP7 P;  4H4K C;  3ZN0 A;  2DW4 A;  2O03 A;  4FE4 A;  1ON2 A;  5IT9 K;  1Z3Y A;  1SMT A;  1ERD A;  4EEF G;  1TWA J;  1Q1V A;  5GAE J;  4UUS B;  4GRI A;  1G3T A;  1OYW A;  2JA6 J;  5D5W B;  3FXU A;  4XNF A;  2WAQ A;  1VQO I;  2HZT A;  2X9D A;  5F64 A;  3K6G A;  3CCU I;  5L3B A;  3F8M A;  2A6H F;  2DQL A;  1UG0 A;  2FX0 A;  4LIU A;  1IW7 F;  1QVU A;  2JWT A;  3ZN1 A;  2PJR A;  1ZRD A;  2DJI A;  3LSR A;  3V7R A;  2W85 A;  4AUX A;  3OYJ A;  3TP3 A;  1B4A A;  1FC3 A;  3SYT A;  4X6A J;  3HM5 A;  5DM6 F;  3HTU A;  3TL4 X;  4ZZL A;  4C3H J;  1ON1 A;  2R3S A;  3EUK L;  1R1V A;  4ITV A;  4CA0 A;  4A3M J;  2HQ5 A;  4IPA A;  1SEU A;  2BXY A;  4AYB A;  2FJ1 A;  4GGG A;  3U1K A;  4XRS G;  2DT6 A;  5IYB J;  4YG2 F;  2PMU A;  1F5T A;  4HLY A;  3JTH A;  1YLF A;  3WGH A;  2R4G A;  2TRT A;  1MW7 A;  1ZG3 A;  4BS9 A;  2K85 A;  1XG1 A;  2VJ5 A;  1DP3 A;  2VE8 A;  2F2E A;  2ID3 A;  1HKQ A;  2ESH A;  4Q48 A;  2EWN A;  1QHH D;  2R7O A;  1R71 A;  3J80 K;  4BXX J;  4NDL A;  4MEY F;  3LWF A;  4A5M A;  3TDZ C;  1WJC A;  3QOP A;  2JA2 A;  2JSC A;  2BV6 A;  2Y31 A;  2PN6 A;  1TNT A;  3BG6 A;  2VBX A;  2V26 A;  3WU0 A;  4AM3 A;  4WXH A;  3S93 A;  2VBZ A;  1WZ2 A;  2VT3 A;  2R7R A;  5AIP A;  1GXP A;  3HOW J;  5CVJ A;  5K7F A;  2MW8 A;  2EFW A;  3HOU J;  2EFP A;  3ZMZ A;  2E5N A;  2MD0 A;  3PNT A;  3C2H A;  1H8A C;  1WH5 A;  1G3Y A;  3C1D A;  3EQL F;  3IKT A;  3JCU C;  2FBH A;  2NXN B;  5J4Y A;  3M8F A;  1R1T A;  2D2W A;  2LLK A;  4HV5 A;  2CMP A;  2IGK A;  3UKG A;  3ZQQ A;  3ERE D;  2IP2 A;  1FWZ A;  3MN2 A;  2XKO A;  1ETY A;  1VZ0 A;  2ZXW H;  5K5R A;  4M3B A;  3V8L A;  2STT A;  4OWR B;  5BOX A;  3IWZ A;  3LA7 A;  1I27 A;  4HA8 A;  3FMR A;  3CJN A;  4D5F A;  4FT8 A;  1T98 A;  5JVT A;  2MH9 A;  3GUD A;  4NC7 A;  2K02 A;  3IH3 A;  2WB1 N;  3R4K A;  2XAU A;  3OYE A;  5D5U B;  3IRQ A;  1HQC A;  5F0H A;  4UHT A;  3GTJ J;  1IN5 A;  2XPU A;  3E0J B;  2ADU A;  3OYA A;  3OYN A;  2GA1 A;  3TQN A;  3L2V A;  3CUQ C;  1IN8 A;  2STW A;  2JA7 J;  4JYK A;  2E1C A;  3AKZ A;  3RYP A;  3OR2 C;  3A1Y A;  5GAH J;  2DYS H;  3MD2 A;  3KLN A;  4HLX A;  2HOT A;  3L2R A;  1Z21 A;  1Z1D A;  1X3U A;  2EIJ H;  3TGN A;  4BQQ A;  2NOJ B;  2RN7 A;  5C44 J;  4UY8 I;  1A36 A;  1H88 C;  2FD5 A;  2K9M A;  1YRN A;  1EA3 A;  5GTH C;  2H6C A;  5ICG A;  4IHT A;  2K3P A;  3KPH A;  1WSU A;  1U8R A;  3BR3 A;  3CJR B;  3VFZ A;  3H3V K;  4M6V A;  3BJO A;  3JRG A;  3F3X A;  5FRM A;  2V1U A;  2IJL A;  2V4J C;  4A3B J;  1BA5 A;  2V9V A;  1L0O C;  2V9P A;  2LC2 A;  5GTI C;  4R1H A;  4E7K A;  2E35 A;  4XLC A;  4HST A;  3PL8 A;  2KFD A;  1XCV A;  2JUC A;  2P5L C;  3K4L A;  2PQ8 A;  3ZQI A;  4XLF A;  2CQX A;  5IY5 H;  2K9N A;  4UUS A;  1IV6 A;  3B6C A;  4CIC A;  3BQZ A;  5CVV A;  1RRJ A;  4XR6 A;  4L18 B;  2DA7 A;  3TW7 A;  3HGG A;  2BE5 F;  4A93 J;  1QRY A;  1ITY A;  1O57 A;  4MQ9 F;  5K5Q A;  1EH7 A;  3KET A;  3NEU A;  2GQQ A;  5M5W J;  1JJ8 C;  4BXF A;  2CV0 A;  4A3C J;  5M5X J;  3OYD A;  2DI3 A;  4LMY A;  4KN7 X;  4FAS D;  3CCY A;  2W82 A;  1U6G A;  2M9H A;  1B59 A;  2FRH A;  4CXF A;  3T5X A;  4IHX A;  2YU9 J;  1X3Z B;  4B4C A;  1JKP C;  1I39 A;  4IHV A;  1R1U A;  2MH2 A;  1LB2 A;  2VQL A;  4B3A A;  3HUG B;  1MBH A;  3FXK A;  3LSK A;  4UVC A;  1Z0X A;  2M4K A;  2CV1 A;  3KZY A;  3DF8 A;  3WTW C;  2PI0 A;  1H0M A;  4A3I J;  4HQE A;  2M87 A;  4DZJ A;  4XMY A;  4IOA F;  3FHZ A;  1DU6 A;  2DK5 A;  4FE7 A;  4L0Z B;  3L2C A;  1Y8Q B;  5DS9 A;  2K27 A;  3G71 I;  1U0J A;  4UV9 A;  3NQO A;  4WF2 A;  4J01 A;  4GDF A;  1VND A;  1XN7 A;  2EIK H;  1TW3 A;  4I0A A;  2X6O A;  3S1Q J;  2DA5 A;  2XDV A;  2L2O A;  3EPZ A;  4II2 A;  4ON0 A;  4BEH B;  1WWX A;  4MO7 A;  3R6S A;  2E60 A;  3GME A;  1BI1 A;  1R4M B;  2ZSI B;  1IAW A;  2FXA A;  3OIO A;  3H36 A;  4BUP A;  2XRL A;  2VC0 A;  4BE2 A;  2QA4 I;  2JSP A;  1RR7 A;  5GPC A;  3CP8 A;  3O3K A;  2HQR A;  4A3E J;  1S29 A;  1FX7 A;  3IC7 A;  1ONV A;  2FOW A;  5HS7 A;  3S16 J;  3M7G A;  1D1B A;  2F5V A;  4D0P A;  3HDD A;  1Y8R B;  1IRX A;  2W24 A;  3DPL C;  3LMM A;  1Z9C A;  3FIS A;  3MWM A;  1YX3 A;  4OIP F;  3S2D J;  5B66 C;  2OQR A;  5IYD J;  1FIA A;  1SFK A;  2P81 A;  1I3Q J;  1W7P D;  2W00 A;  1OCR H;  5CLS A;  2ID6 A;  2LKX A;  2B63 J;  1JI8 A;  3A03 A;  1Z67 A;  2LFB A;  4PCQ A;  2BBY A;  2DYR H;  4JOM A;  3DPT A;  3VOE A;  3ZPL A;  1W4M A;  5TIS C;  2BVM A;  1BOA A;  4ZYE A;  1S5L C;  3CC7 I;  2QZ8 A;  4F3Q A;  4A3J J;  1TNS A;  1OR7 A;  3GTG J;  4YRV A;  3I56 I;  3HL2 A;  2XIG A;  4BY7 J;  3A01 A;  2WC2 A;  2L4M A;  3MKY B;  2JQ7 A;  4XN3 A;  3G1L A;  1XMK A;  4IQ4 A;  2HVR A;  1Z77 A;  1SAU A;  1SMY F;  2K9Q A;  1QA6 A;  4IRI A;  1ZR4 A;  4CCO A;  1D1C A;  3B02 A;  3F8C A;  3KFW X;  3BDD A;  2XC7 A;  3HXL A;  3K2Z A;  2DA1 A;  1GDT A;  3I0T A;  3QPL A;  2PBI A;  2DOA A;  3LQQ A;  3BG5 A;  3ABL H;  1LE8 B;  1UHS A;  1XSX A;  1VTN C;  1LDK B;  1KU9 A;  2QQA A;  1POG A;  1B1B A;  2L54 A;  2OTJ I;  5FO5 A;  2PX9 A;  2G0E A;  3WGG A;  1IJW C;  3H0D A;  4BXU A;  2IA0 A;  4I76 A;  2VE9 A;  3K70 D;  4ANJ A;  2LBF B;  4E7I A;  3BOQ A;  2L7Z A;  1UZC A;  3FXO A;  2L3D A;  3QWL A;  2M1B A;  3D0S A;  2DT5 A;  4PJJ A;  2NNY A;  2EV6 A;  3C3W A;  2DMT A;  1IN4 A;  1V4R A;  2ME6 A;  2VXD A;  3QYF A;  1ZRF A;  2F48 A;  4N9H A;  1OQY A;  1TL8 A;  2E1M B;  2A61 A;  4DIQ A;  2B9S A;  1CGP A;  3Q0W A;  1LDD A;  4HEA 2;  4YEJ A;  3K70 C;  1LQ1 A;  4E7J A;  3R0A A;  1GVJ A;  4R8H A;  3CCQ I;  5IT9 Z;  1UG2 A;  1FJL A;  3I59 B;  2O61 A;  3N97 A;  2JPB A;  2NYX A;  1WCM J;  5M3F J;  5E20 A;  4E7Z A;  2H94 A;  3F72 A;  4Y3O A;  1R7J A;  2XGE A;  4M3D A;  2DAO A;  1IGN A;  2CO5 A;  2H8R A;  5HNF A;  1TLH B;  1UCR A;  3DLL F;  1U9O A;  4AC0 A;  5D8L B;  5E8I A;  2LSO A;  3TO9 A;  5DTD A;  3OSG A;  5ILV A;  2KLO A;  1KA8 A;  1YJW I;  2YUS A;  4KT5 C;  2K4B A;  1WRJ A;  3HTS B;  1FP1 D;  3HB9 A;  3I3L A;  2CU7 A;  2VQC A;  5TRD A;  3HUG A;  1F36 A;  2PFB A;  2LMD A;  3IHU A;  2C6Y A;  3MKL A;  3ZP5 A;  3X2Q H;  1VQ5 I;  2EZI A;  1UHW A;  3NWS A;  2F5D A;  3OYG A;  5EDN A;  2RAE A;  1VQK I;  2DMP A;  3FK7 A;  2QKM B;  4G6Q A;  5F1J A;  1JJ6 C;  1EH6 A;  1E3H A;  5KAI C;  5E3N A;  1BC7 C;  2ZJP F;  1S7E A;  2FQ3 A;  2BGC A;  3KX2 A;  3SEZ A;  1B8I B;  2VJI A;  1BOB A;  4XLN F;  1U2W A;  1XC5 A;  5HDN A;  1JKO C;  3H0G J;  1P9Q C;  2P6T A;  3J80 Z;  4BEH A;  5EJC A;  4AIJ A;  3TOB A;  3KZZ A;  3VYS B;  1JTY A;  4RMN A;  3S3M A;  4A0Y A;  1OYY A;  4N0B A;  3ZMU A;  1EJ9 A;  3Q0U A;  2A5W A;  2KIU A;  1D1A A;  1BR4 A;  1ETO A;  3HG9 A;  2V6E A;  3Q5F A;  4Q47 A;  4FQG A;  5J3L A;  1SFU A;  1KYW A;  1FBS A;  2IXS A;  2L4A A;  4KIG A;  3IAM 2;  1LEA A;  1OKR A;  2M7A A;  2DDB A;  1QVT A;  3A02 A;  2E19 A;  2WAQ N;  3CCM I;  3F8F A;  3JRH A;  4PGH A;  2QQ8 A;  3RPQ A;  2LKS A;  5JHF A;  1YYV A;  5LLQ A;  5K5O A;  1SAX A;  4JX5 A;  3WU2 C;  1ZAR A;  3OWT A;  5B3S H;  3H5A A;  3MZY A;  2BHY A;  2HDD A;  2VKE A;  1HW1 A;  2XAG A;  2JRT A;  1YW8 A;  2AO9 A;  2VL8 A;  1JGG A;  3CC4 I;  1SFE A;  3MMY B;  3OYB A;  2EH3 A;  1OJL A;  3MCZ A;  4PFO A;  2FE3 A;  3BQY A;  1SFO J;  3N05 A;  1FTZ A;  3CF2 A;  1UJ8 A;  4PFP A;  3C18 A;  1HA8 A;  1BI0 A;  5DDG A;  2BXZ A;  1HBX G;  1MMA A;  1HW2 A;  4MFD A;  1R00 A;  4AYB N;  4BU2 A;  4KIS A;  4I01 A;  3EDP A;  2KRC A;  2HVQ A;  3MEX A;  3SEQ A;  1KZH A;  4DQ2 A;  2CV2 A;  2ZXI A;  2XF6 A;  2M2E A;  1PDN C;  3PSF A;  3A4C A;  5LEK A;  4B1R A;  4MIM A;  5J40 A;  2IPQ X;  3KYC B;  3T1B A;  2D1H A;  4L5E A;  3TED A;  1LE8 A;  1L3L A;  2EA4 A;  3KEO A;  3E6C C;  2XVC A;  1HLV A;  3E5Q A;  4IKF A;  4XID A;  3K1M A;  4M6X A;  1IXC A;  1RET A;  5DUK A;  3FHN A;  2LBF A;  1IV8 A;  3WGI A;  3GTO J;  3RZD J;  1K79 A;  4LLL A;  4IHY A;  3MAJ A;  1SD7 A;  1O3S A;  3I4N J;  3COA C;  1I3A A;  5JVG F;  2NVT J;  3BR6 A;  2B7E A;  1T33 A;  5HS8 A;  1VFC A;  3LNQ A;  2NOG A;  5F1R A;  2RNG A;  1XX5 A;  3LA2 A;  1GVD A;  4WX9 A;  2P7C B;  4IZZ A;  2EIL H;  5EEA A;  2L7M P;  4G6D A;  3I55 I;  1KQ9 A;  1YE9 A;  1SD6 A;  4C3J J;  2KDZ A;  3I59 A;  1TC3 C;  2UUZ A;  4OIN F;  2YX4 A;  5LEJ A;  1Q1H A;  4MQV A;  3I64 A;  4RB2 C;  1K6Y A;  3SXY A;  5J1R A;  4ZH4 F;  2Z99 A;  2FUG 2;  2JT1 A;  3OIQ A;  4CGZ A;  2ZJ2 A;  4AID A;  4RM2 A;  2MA3 A;  2L9N A;  5AON A;  4MTD A;  5ILU A;  1VQM I;  4C9Y A;  3HRS A;  3H9G A;  1T0F A;  1QPM A;  2PJP A;  2CH0 A;  3BR2 A;  2CQN A;  2X51 A;  3PQJ A;  1OCZ H;  5TJJ A;  1HCR A;  3HSF A;  2QKL B;  4WWC A;  4IVN A;  3W2V A;  3Q0V A;  1EF4 A;  5IOY A;  1MND A;  4RS8 A;  3LSI A;  5E17 F;  1V5G A;  2OU2 A;  3BRO A;  3JRC A;  2EB7 A;  3BJA A;  2M0C A;  5J1U A;  1FOW A;  2KT0 A;  2M45 A;  1K4T A;  1WI9 A;  2BEO A;  2PMZ A;  3O8H A;  2XPV A;  3QOD A;  4IEJ A;  2DJN A;  2O5R A;  1IUF A;  3RDI A;  5CPR B;  2LY9 A;  1B8I A;  3RI4 A;  2XSD C;  2ACJ A;  1HF0 A;  2HWV A;  3WE3 A;  3HHG A;  3VSK A;  2GM4 A;  2FU4 A;  9ANT A;  1XGS A;  1R4N B;  4NUB A;  1LFB A;  3EUA A;  4WXD A;  4RGU A;  3WTU C;  4B47 A;  2KIS A;  3HKZ A;  4W97 A;  1G59 A;  2IS6 A;  4EAT A;  3L1P A;  5CKT A;  4XSZ F;  4DOZ A;  5BS6 A;  4X0G A;  1FSH A;  1YJN I;  4KJZ A;  1P6R A;  1PYV A;  2QSG X;  3L00 A;  5D5V B;  3UNG C;  1DUX C;  3CCJ I;  5HDG A;  1X3W B;  2ZFW A;  1PJR A;  2QBY B;  3Q9V A;  1UB9 A;  1MD0 A;  2JMW A;  5J47 A;  4CUG A;  2DOE A;  3S14 J;  3MZ8 A;  3DTI A;  3QOE A;  2PMH A;  1HXD A;  1MSF C;  2DA6 A;  2JZY A;  3SJM A;  1O3T A;  4I2O A;  5ICC A;  1VQ8 I;  3QPH A;  2CW7 A;  1V5E A;  2K9L A;  1XTA A;  4E70 A;  3FK6 A;  5JR3 A;  2OV7 A;  3FX3 A;  4KDP A;  2F5C A;  1E3O C;  2R7T A;  1BR2 A;  3LSJ A;  4I7H A;  3ZQH A;  4LG0 B;  2XAJ A;  4M72 A;  4XLH A;  3CF5 F;  2P8T A;  1KON A;  2M7B A;  4Y4R A;  2XGD A;  1USS A;  2LRE A;  4QWQ A;  1JUM A;  2UZK A;  1H9T A;  3K1N A;  3K1P A;  3E6B A;  2W25 A;  1DU0 A;  2NVX J;  2J5O A;  1ZLK A;  2KPM A;  4M9Z A;  2IS1 A;  2HEO A;  4LK0 F;  3W6V A;  1ZKG A;  3NAU A;  1KU2 A;  1QPI A;  3OYK A;  2HS5 A;  4II3 A;  3OYF A;  1TBX A;  1OR7 C;  2D5V A;  4JP0 A;  2IT0 A;  3F0C A;  2DBB A;  1D0Z A;  1PUF A;  4A12 A;  1RC9 A;  4B09 A;  4I6Z A;  1HC8 A;  4XKB A;  1IUY A;  2DA2 A;  4UB8 C;  2XAS A;  1I6H J;  1U5T A;  4NNJ A;  5IT3 A;  2L7F P;  2X48 A;  2NVU B;  2OTL I;  2FEZ A;  2X85 A;  3BZ6 A;  2DPD A;  1O3Q A;  3HOZ J;  1D5Y A;  2FQ4 A;  1ZG1 A;  3BG9 A;  3PFY A;  5HVQ C;  1TWG J;  5E3L A;  3KLO A;  1HKS A;  2COM A;  3VYR B;  5L3G A;  4A3F J;  4Y15 A;  1DGW Y;  1RI7 A;  2HFH A;  1LJ9 A;  2JTV A;  3PIO F;  3BR1 A;  2GXA A;  3FXM A;  2OAZ A;  5K7H A;  2IBD A;  1PP8 F;  5BPD A;  4B3X A;  3PNY A;  1E3P A;  1A04 A;  2WAD A;  2Z5U A;  2QSH X;  4OMZ A;  4UUV A;  1SVO A;  1ZAO A;  2IRF G;  2HOE A;  2MGQ A;  4BHP A;  3K7A J;  2K9S A;  1Y0N A;  3ECO A;  3I58 A;  1REP C;  2L02 A;  2E7W A;  2E2H J;  4UV8 A;  3ZQG A;  1CQT A;  2ECC A;  3GTK J;  1S9H A;  5FKN A;  4PDK A;  1M1E B;  4EVI A;  1WH7 A;  3WOD F;  3FXR A;  2LF8 A;  2XB0 X;  3A0H C;  3SZG A;  1XSD A;  4EM0 B;  3RKW A;  2PG4 A;  4LFU A;  1OCO H;  2EFN A;  2R7D A;  2FNP A;  5FLM J;  2ME0 A;  4U0V A;  3C7J A;  3M8E A;  1WFX A;  3HJE A;  3SQN A;  4D7M A;  1GUU A;  3DBR B;  2ZCW A;  1IN6 A;  1ODD A;  3GX4 X;  4A69 C;  2KRH A;  2EIN H;  2XUB A;  2LKP A;  2EA2 A;  4D5C A;  3OL4 A;  1VQ7 I;  3GFI A;  2HDW A;  3PUB A;  5HLT A;  2OCE A;  2XGC A;  2ZME B;  4RB3 C;  3V8K A;  1XS9 A;  2BY2 A;  1JT6 A;  1Z6R A;  2FBK A;  2K7L A;  3A01 B;  3M4O J;  3OY9 A;  2CFO A;  1MBJ A;  4IO9 F;  3WTT C;  2RQP A;  4DBQ A;  2IGN A;  4IL6 C;  3H1C A;  4ZDP A;  1P4W A;  2FSW A;  1YIJ I;  2DOD A;  2HVS A;  1Z91 A;  2V7F A;  2DQR A;  3E5U A;  3VOD A;  1JHH A;  1R5H A;  5IOZ A;  1WJE A;  3BTC A;  4G7Z F;  2WWY A;  3WHC A;  1JTX A;  2UXX A;  3QP6 A;  3QRF F;  3VDX A;  4LLN A;  2QBY A;  3HRU A;  4BGD A;  3HYI A;  4HYE A;  4HDV A;  3W2A A;  4G12 A;  1W5S A;  2VIX A;  2XRN A;  2L5Q A;  5F0C A;  3O2P E;  2XRO A;  1FPQ A;  3AG2 H;  4A5N A;  5KAF C;  1F43 A;  3M3Y J;  5L3D A;  2BHZ A;  1DDN A;  2VUM J;  3QQA A;  1D0X A;  2V6C A;  1IXS B;  3IAS 2;  1FZP B;  2QYO A;  2NS0 A;  5FKL A;  1ZG5 A;  5EF6 A;  2A69 F;  2VLA A;  3J7Z I;  3G73 A;  4HNT A;  3BTJ A;  3DEW A;  2DT7 B;  2ZXH A;  4CZC A;  4LG0 A;  3SFI A;  3ASO H;  2LTP A;  1VQ4 I;  4ETS A;  3GTQ J;  2V9K A;  1RUO A;  2XSJ C;  4XQF A;  1MKM A;  2D1V A;  2F5F A;  2M34 A;  4CYD A;  5KHD A;  2OC6 A;  3ZMD A;  2KL4 A;  3MKZ A;  2DMQ A;  1IDY A;  3S3N A;  4EQQ A;  1JGS A;  1ZYR F;  2DPU A;  1FEX A;  1MMN A;  2IS2 A;  3ABT A;  2GOX B;  5FLX K;  4B43 A;  1ZLJ A;  5C4X J;  1WJF A;  2MYS A;  4ASN A;  4BAC A;  3GFJ A;  1AU7 A;  3JSO A;  1IRF A;  1A5J A;  3SFZ A;  3ZRG A;  1OMI A;  2OJE D;  4IF4 A;  5E79 C;  3U1D A;  3AFH A;  4PJ0 C;  2L0K A;  2GXG A;  4OIR F;  3BG3 A;  3K2A A;  3V4G A;  4DBR A;  1AWC A;  3S2H J;  2AHQ A;  4EV0 A;  4AIK A;  4XOP A;  1WJ5 A;  2KHM A;  2VBW A;  3EYY A;  3Q9S A;  2XF5 A;  5LGU A;  3DEU A;  4I09 A;  4M74 A;  3HOV J;  4KIC A;  1BJZ A;  2VXZ A;  3ABM H;  3H3U A;  5CVR A;  3QYB A;  5KVR A;  4RBO A;  4NQW B;  5B1A H;  5LFA A;  3ZGK A;  5FRN A;  3HPG A;  1QO0 D;  3HRT A;  3WTS C;  2GIZ A;  3KP3 A;  4BDY A;  4V19 K;  1J75 A;  3OS2 A;  2E2I J;  2DN0 A;  4AD9 A;  2HTS A;  1XPX A;  3QU6 A;  4LG3 A;  5FJ8 J;  1FNN A;  3IH4 A;  2E1M C;  2H09 A;  1F4K A;  1ZGW A;  5F04 A;  3ZMT A;  3GTM J;  4HX8 A;  4UXN A;  3PM1 A;  1W0U A;  2WAE A;  2UXN A;  3BPX A;  5HLI A;  1FT9 A;  3PSI A;  2DTR A;  4HX4 A;  4ZTF A;  4ENM A;  5FFX A;  3EYI A;  1IRZ A;  1D3Y A;  5LBQ A;  1T8I A;  2CYY A;  4DYQ A;  2P7V B;  3D5L A;  5D8K B;  1SAN A;  5E1W A;  2EQR A;  2O7O A;  1QZE A;  2ZC2 A;  2LR8 A;  1X1P A;  4N9I A;  1FY7 A;  4M3E A;  2YR2 A;  1T0F C;  1YG2 A;  2HOA A;  4AIH A;  5L3E A;  1ZR2 A;  1R9T J;  2VAS A;  2X1E A;  1JXS A;  3RPU A;  2ZME A;  4CCN A;  4XL9 A;  1LUJ B;  4KA4 A;  1WJB A;  5E1X A;  5F27 A;  1TWC J;  2ZNZ A;  4ZYH A;  3RSN A;  3DBH B;  2GBY A;  1BC8 C;  1P4A A;  4EJV A;  3G2B A;  1KYZ A;  1O7L A;  2LH9 A;  3CMM A;  4HF1 A;  3DPU A;  2Q2E B;  3J81 K;  2RDP A;  4U7B A;  1J59 A;  1S7O A;  2EV0 A;  3OIP A;  2JA8 J;  4QSH A;  1YOV B;  4J00 A;  4XBF A;  2HR3 A;  2RC4 A;  1NK3 P;  5DYM A;  3MZH A;  3GYH X;  1HSJ A;  1TT5 B;  2FNA A;  1QQI A;  3I5U A;  3KP7 A;  3O8G A;  2ZO4 A;  3B73 A;  4OU0 A;  3RJP A;  3SDG A;  4EJW A;  2RV8 A;  1TT0 A;  4U88 A;  2WY7 Q;  3DU6 A;  5LHH A;  4F91 B;  1APL C;  3BJ6 A;  3E5X A;  3HZJ A;  2JA5 J;  3ZQC A;  3KP6 A;  3EUH A;  3KCC A;  1T95 A;  1R49 A;  1MZB A;  1TZL A;  3E97 A;  1LPQ A;  3J7Y J;  4XKV A;  4XIC A;  1OCC H;  1FOY A;  1SFX A;  2TCT A;  2L7K A;  4CHU A;  1YS6 A;  3RYR A;  1VF9 A;  4YFX F;  4G9Y A;  3M9A A;  3D5R C;  2F4O B;  2R92 J;  1RIO H;  2KKO A;  2VT2 A;  2P0W A;  2EZL A;  3GZ5 A;  3S1M J;  1VQ6 I;  3I54 A;  3ZQF A;  1YJ9 I;  2VN2 A;  1X1B A;  2DTZ A;  1BBY A;  2PMZ N;  3LFU A;  1WJD A;  4IQJ A;  3FM5 A;  1XSV A;  1XGN A;  2W7N A;  3CLQ A;  5M3M J;  1I1G A;  4KUM A;  4A0Z A;  1VQ9 I;  1Y0U A;  5EG0 B;  2D45 A;  3ABU A;  2IVM A;  1ZGJ A;  5J8F A;  2A07 F;  1RZ4 A;  2GA2 A;  3VSL A;  3JRI A;  3K10 A;  2VOP A;  2Q8K A;  2OBP A;  3IL2 A;  1O7F A;  2LP0 A;  3HKZ N;  4RGS A;  2TDX A;  3A0B C;  3S3O A;  1TP4 A;  3C2G A;  1NG6 A;  4C2T A;  4YIR X;  3GZ6 A;  3TO7 A;  5CVU A;  1WJA A;  3LA3 A;  4NHJ A;  4BHB A;  5KNL A;  4D1Q A;  2EK5 A;  1H9G A;  3K4J A;  2E2J J;  1S3J A;  3K4M A;  2E5Z A;  4RDU A;  4DJA A;  4M6Y A;  5L3F A;  3GLL A;  3LST A;  3TBI A;  4LK1 F;  4A2U A;  1SVM A;  2VPL A;  3T8R A;  4XKW A;  4NQW A;  4WXC A;  3RKQ A;  4CZZ A;  2X6Y A;  3OOP A;  4E6K G;  1G3W A;  3ROU A;  1U5T C;  5DD4 A;  4LLG F;  1WPK A;  2ELK A;  3OYL A;  4XK4 A;  1U3E M;  1XCB A;  4V2G A;  1BW5 A;  2KJC A;  3AG4 H;  1X1C A;  4XLE A;  3RIR A;  4RM3 A;  2ELH A;  4RLQ A;  3CCS I;  1VI0 A;  4DNC A;  1NHA A;  4LIT A;  5J6X A;  2Y48 A;  2Y9Z A;  2Y0S A;  4NBQ A;  4M73 A;  2IA1 A;  3FXL A;  5D6E A;  2HU9 A;  4OIQ F;  3CP2 A;  4HSR A;  3RKY A;  1E17 A;  2CUZ A;  3E6D A;  5F08 A;  3S1N J;  2L9V A;  4BAY A;  2V1X A;  3HEF A;  4HX7 A;  3FXQ A;  3L9F A;  2Y75 A;  1ETW A;  4HF2 A;  2F5E A;  2ISY A;  5EGO B;  4KNY A;  3OOU A;  1Z7L A;  1FMV A;  2NS7 A;  1W5C C;  1MNM C;  2RNJ A;  1KU3 A;  2QWW A;  3BR5 A;  2X0L A;  5L3C A;  2RVC A;  3HOX J;  3U2R A;  4M9S A;  3WTY C;  3OR1 C;  4LB5 A;  1FTT A;  3PJR A;  4FIS A;  1A6Q A;  5IPA A;  1TWH J;  3DKY A;  3CDI A;  2DA3 A;  2Q2E A;  1JT0 A;  3P9K A;  2M30 A;  2OPT A;  4OMY A;  4G8X A;  1WVR A;  1ORK A;  2MLG A;  3CJQ B;  3V7S A;  1QZY A;  4C30 A;  1FYM A;  2CSO A;  4XKC A;  2CQK A;  2NNN A;  3M1E A;  3PIP F;  4RLF A;  1PUF B;  2EZH A;  1S8N A;  2FOK A;  2JVH A;  3BWG A;  5EEG A;  4MEX F;  4ESB A;  4ESJ A;  2AS5 F;  1BI2 A;  2LNB A;  3CCE I;  4CYC B;  4LIV A;  2QUF A;  3GLX A;  1DQU A;  2AXT C;  1RPW A;  1U5T B;  4GFB A;  4MTE A;  2R7F A;  4EM1 A;  3R60 A;  2LDU A;  4F52 A;  3KYL A;  3RZO J;  3H35 A;  3FMQ A;  5LGN A;  3L2U A;  2GIV A;  1RES A;  2VON A;  4B48 A;  3QPS A;  5DCF A;  3HHH A;  3V42 A;  1J7K A;  1HKT A;  3K4N A;  1N78 A;  1ZGA A;  2DDA A;  3T8T A;  3H92 A;  4XSX F;  2PEX A;  3SZT A;  1HOM A;  1A35 A;  2P5V A;  1NK2 P;  4W1U A;  3VB2 A;  4M3F A;  4A3L J;  1O4X A;  2EZK A;  1R58 A;  4HBL A;  2VC1 A;  4D7N A;  5BPI A;  3CMA I;  1RR8 C;  4IX7 A;  5GP9 A;  5EYR A;  2WBM A;  4EJO A;  4IHW A;  2CS3 A;  1NG7 A;  4ZYG A;  3CO7 C;  2O0Y A;  1YHQ I;  4BDZ A;  3ELK A;  3MQ0 A;  5D4R A;  2Y30 A;  2Z33 A;  2O8X A;  5EG0 A;  3KEY A;  2CRG A;  3ZQ7 A;  1X4O A;  2RKH A;  3G4S I;  3EET A;  5KK1 A;  2NVY J;  5EZG A;  4GYI A;  3QU3 A;  2Z2S B;  2ZJR F;  2V1D A;  3ESW B;  4HPQ A;  5FLX Z;  1IRG A;  4CCM A;  2MAB A;  2G7H A;  2K5C A;  1X1D A;  1GXQ A;  2I5U A;  1S7A A;  2LY2 A;  3IRR A;  3G6E I;  2NRA C;  2A05 A;  1W0T A;  1Y1V J;  3DQV C;  2A6E F;  3I9V 2;  5FRO A;  1JHF A;  5AIQ A;  5FD5 A;  4MHG A;  2BZT A;  3JRA A;  1BIA A;  2R93 J;  2OUM A;  4BQN A;  3KYD B;  5HDK A;  5K1Y A;  3JSP A;  5FKO A;  4G94 A;  2X1C A;  3ISP A;  2OQG A;  3RQI A;  3WTV C;  5E18 F;  3WU1 B;  2ETH A;  2HZD A;  3M1C A;  1AKH B;  2W57 A;  2HYG D;  2KP6 A;  4P55 A;  1YI2 I;  2O6G E;  4V2F A;  5JLX A;  3V8J A;  1KQ8 A;  3VYU B;  1V55 H;  2YU3 A;  3IWF A;  4HDU A;  3F21 A;  4IRG A;  2CWE A;  1VQP I;  4MNU A;  3K69 A;  1FOK A;  3PUF A;  4GXO A;  2HKX A;  1D5V A;  2IW5 A;  1FSE A;  3FXJ A;  1Y1W J;  1YFH A;  3VPR A;  3G1O A;  1IG7 A;  1P7I A;  1NH3 A;  1MDM B;  4KMF A;  1LKX A;  1TW2 A;  4BH9 A;  4CCK A;  4C3I J;  5DUI A;  2HI3 A;  1WKM A;  2UV1 A;  1QGP A;  3BZC A;  3DXJ F;  1P2F A;  4XON A;  1ETK A;  1J5Y A;  5E3M A;  4FX4 A;  2VKD A;  4GYG A;  2FA5 A;  2DLL A;  2M4G A;  5H2F C;  2DCE A;  1YW9 A;  3DKX A;  3H5N A;  2E1O A;  4MLO A;  1LFU P;  1CF7 A;  1FMW A;  1MGT A;  3TMO A;  3REO A;  1PVE A;  2RRE A;  3LFK A;  5EGO A;  2BY1 A;  4N4O B;  5IP7 J;  2O3F A;  1K83 J;  5JFR A;  3DWL E;  5LGT A;  1WI3 A;  3RPU D;  4I0B A;  1K61 A;  4P1W A;  2V79 A;  2QEN A;  3CZ6 A;  4LJZ F;  3DTE A;  3LSP A;  2OF7 A;  5DEQ A;  2P4W A;  1UMQ A;  2QVO A;  1HDD C;  4E7S A;  4L9T A;  5BNG A;  4OAZ A;  1B72 B;  4UNO A;  3WTZ A;  1YX5 A;  5CYV A;  2A6T A;  2N8G A;  3J81 Z;  2ZSH B;  5CJ9 A;  5D4S A;  4IXA A;  3ZMV A;  2ZME C;  4I99 C;  5DM7 F;  1R6R A;  5A2Q Z;  4PJM A;  1IXR C;  2VOO A;  1OCP A;  4JK1 X;  1UEL B;  2MFZ A;  2GOM A;  4RAY A;  2K4J A;  2KIQ A;  5H6R A;  3CTA A;  3F9K A;  4BQA A;  4U0Y A;  1MMS A;  4O6J A;  4CYC A;  3CO6 C;  2E7X A;  3JAM K;  1LFP A;  2DO7 A;  2R0Q C;  1R22 A;  2R7S A;  2DFI A;  2CG4 A;  5KCM A;  3LL7 A;  1OFC X;  4K2E A;  5JHU A;  1ZQ3 P;  1STZ A;  3ASN H;  1OCT C;  1EH8 A;  2JUG A;  2G9W A;  2R7Z J;  5H6Q A;  4C2U A;  1BJA A;  1GV5 A;  4BBR J;  4BNC A;  4M3G A;  2EFO A;  3RCO A;  4PSW A;  4BQO A;  1K6O A;  4A3K J;  1FYL A;  2P5K A;  5FB2 A;  2Y2Z A;  4P9F A;  3LAJ A;  2H1L A;  3TKY A;  3CUO A;  2L9R A;  1MBF A;  4BL0 B;  2IEK A;  2KJB A;  2XF7 A;  5GAD J;  1FIP A;  3EUH C;  1B6A A;  2QLZ A;  3HOY J;  3L2W A;  3HSR A;  2VJ4 A;  3S8P A;  4BE1 A;  3QAH A;  3BG7 A;  3DKW A;  1ETV A;  3LSH A;  1IN7 A;  4L5J A;  3FF5 A;  1XMA A; 
#chains in the Genus database with same CATH homology
 2LG4 A;  4BDY A;  3OS2 A;  3HOT A;  2WAF A;  1MMG A;  3OMY A;  4LG3 A;  3KX2 A;  3SEZ A;  2VJI A;  4D9J A;  3H9J A;  1BOB A;  1BR1 A;  2E1M C;  2HPI A;  1P9Q C;  2VQH A;  2WAE A;  4BEH A;  2CUJ A;  3PSI A;  3ZCO A;  3VYS B;  4RMN A;  3S3M A;  4ZTF A;  2A5W A;  4KIT B;  1D1A A;  4XLA A;  4R79 A;  1BR4 A;  3VWB A;  3HG9 A;  2V6E A;  3D5L A;  3K4K A;  2IXS A;  3UR3 C;  3IAM 2;  2M7A A;  4ZTJ A;  4HG2 A;  3K4B A;  5CQG A;  2Z16 A;  4CCJ A;  2R7Q A;  3FKJ A;  2W1O A;  1T0F C;  3IUO A;  3W2W A;  1UAA A;  5JHF A;  2VAS A;  4E7L A;  2X1E A;  1E0E A;  3M8J A;  3OWT A;  4HNU A;  4CCN A;  4XL9 A;  2IGM A;  3H5A A;  4PK4 A;  2HNH A;  1WJB A;  2CW8 A;  2RQQ A;  1X1A A;  3H9Q A;  2VL8 A;  2ZFU A;  3J7A Y;  3MMY B;  1J09 A;  2VB6 A;  2HQA A;  3OYB A;  2JVG A;  1N77 A;  3LSG A;  3RSN A;  4B44 A;  3G2B A;  3CES A;  4PFO A;  2LH9 A;  3SDB A;  3CMM A;  1D0Y A;  3DPU A;  2Q2E B;  3N05 A;  3CF2 A;  4PFP A;  4U7B A;  1HA8 A;  1MMA A;  2LRD A;  2M0M A;  4E7H A;  4BU2 A;  3OIP A;  4KIS A;  2KRC A;  4J00 A;  2X1D A;  4H4K C;  2HVQ A;  3SEQ A;  1Z3Y A;  2ZXI A;  2CV2 A;  1ERD A;  2XF6 A;  3PSF A;  3A4C A;  4GRI A;  4ZYA A;  1TT0 A;  2L9S A;  3DEE A;  4F93 B;  2R7X A;  2WY7 Q;  4XNF A;  2WAQ A;  3DU6 A;  4F91 B;  3K6G A;  4IKF A;  1T95 A;  1TZL A;  1UG0 A;  4G6T B;  4LIU A;  4XKV A;  3FHN A;  2LBF A;  2PJR A;  3BCA A;  2DJI A;  2L7K A;  2X6W A;  3OYJ A;  3D5R C;  3SYT A;  2I8D A;  3ZR8 X;  1GLN A;  3TL4 X;  2P0W A;  2RNG A;  3EUK L;  4ITV A;  4CA0 A;  1X1B A;  2LY1 A;  4IZZ A;  2AQE A;  4AYB A;  1Y56 A;  1WJD A;  1YE9 A;  3LFU A;  4IQJ A;  2DT6 A;  2UUZ A;  2W7N A;  4N4N B;  2R4G A;  1MW7 A;  4BS9 A;  1K6Y A;  2VJ5 A;  2FUG 2;  1G8X A;  3OIQ A;  1DP3 A;  4RM2 A;  3OS1 A;  3VSL A;  2L9N A;  3K10 A;  1QHH D;  2R7O A;  2KMU A;  1WJC A;  2JA2 A;  3S3O A;  4C9Y A;  3C2G A;  1NG6 A;  3H9G A;  4C2T A;  3BG6 A;  2V26 A;  1WJA A;  3S93 A;  5KNL A;  2CH0 A;  4D1Q A;  2R7R A;  2BVL A;  3K4J A;  5CQE A;  3DTK A;  3K4M A;  4AU7 A;  2E5Z A;  2X51 A;  4DJA A;  2E5N A;  2MD0 A;  2QKL B;  3PNT A;  2F4I A;  3C2H A;  3W2V A;  3TBI A;  4Y33 A;  2BOL A;  1MND A;  3LSI A;  2VPL A;  1V5G A;  4XKW A;  1N75 A;  2X6Y A;  4CH7 A;  2CMP A;  2IGK A;  4E6K G;  3ZQQ A;  2PMZ A;  3QOD A;  4PJN A;  3OYL A;  1VZ0 A;  2O5R A;  4DGW B;  5CPR B;  2DXI A;  3VYT B;  4YEL A;  4OWR B;  1OLT A;  1X1C A;  4XLE A;  4QPQ A;  3VSK A;  1ZEL A;  3RTR A;  4NC7 A;  4NUB A;  4RM3 A;  2KZV A;  3EUA A;  4RLQ A;  4NC8 A;  2XAU A;  4LIT A;  3HKZ A;  5TGT A;  4B47 A;  3OYM A;  3OYE A;  1G59 A;  2IS6 A;  4EAT A;  2Y0S A;  3OYH A;  5CKT A;  4X0G A;  4DOZ A;  3E0J B;  3OYA A;  4KJZ A;  3OYN A;  2HU9 A;  2Z1D A;  4BE0 A;  3L2V A;  1PYV A;  3H5R A;  3CP2 A;  4HSR A;  4XM3 A;  2CUZ A;  3AKZ A;  3UNG C;  2VQG A;  3OR2 C;  3A1Y A;  1PJR A;  1MMD A;  3MD2 A;  2IS4 A;  3L2R A;  1Z21 A;  4AVZ A;  4CUG A;  2BW3 B;  2Q1Z B;  3DU5 A;  4BQQ A;  3OOU A;  1Z7L A;  1FMV A;  2NOJ B;  3DTI A;  3QOE A;  2K9M A;  1EA3 A;  2K3P A;  3CJR B;  3OR1 C;  3PJR A;  2CW7 A;  1V5E A;  2K9L A;  3NWT A;  5FRM A;  4ZJZ A;  1AA7 A;  2OV7 A;  2LOO A;  2R7V A;  2V4J C;  3DKY A;  3DLA A;  2R7T A;  1Z3X A;  1BR2 A;  2LC2 A;  2VKH A;  2WB1 A;  3CJQ B;  4E7K A;  4C30 A;  4XLC A;  4HST A;  4XLH A;  3PL8 A;  1KON A;  2M7B A;  4XKC A;  4Y4R A;  4FET A;  1MNE A;  2LRE A;  3K4L A;  4RLF A;  4XLF A;  2JVH A;  3E1S A;  4CSW A;  2KPM A;  4LIV A;  2IS1 A;  1DQU A;  4OAY A;  3KYL A;  4F52 A;  3H35 A;  4XR6 A;  3OYK A;  3L2U A;  1QU3 A;  4II3 A;  4B48 A;  3OYF A;  1LVK A;  1OR7 C;  3V42 A;  1D0Z A;  3K4N A;  1N78 A;  4BXF A;  2CV0 A;  4ZDL A;  3OYD A;  4XKB A;  4FAS D;  3HOS A;  1QHG A;  2W82 A;  4BJ5 C;  4XOR A;  4NNJ A;  4HRI A;  2X85 A;  4BJ6 C;  4BJT A;  2R7W A;  4P5O A;  3PFY A;  2VQL A;  5HVQ C;  3VYR B;  4IX7 A;  3HUG B;  2WBM A;  3LSK A;  3ONQ A;  2CS3 A;  2M4K A;  1NG7 A;  1DGW Y;  2CV1 A;  3GBG A;  4BDZ A;  3D5S C;  3FDY A;  3PNY A;  4B3X A;  4XMY A;  2WAD A;  3KEY A;  1V5F A;  1U0J A;  3L2Q A;  1X4O A;  4J01 A;  3S32 A;  2Z2S B;  4U87 A;  2M3A A;  2XDV A;  4HPQ A;  2L2O A;  3BLY A;  1X4P A;  3EPZ A;  4II2 A;  4CCM A;  1S9H A;  2MAB A;  4BEH B;  2E60 A;  2K5C A;  1X1D A;  2ZSI B;  3SZG A;  4PJL A;  2R7U A;  4BUP A;  2LY2 A;  4BE2 A;  2JSP A;  3W3C A;  3CP8 A;  3DQV C;  3I9V 2;  5FRO A;  1WFX A;  2LYC A;  2OUM A;  4BQN A;  1D1B A;  2F5V A;  1IRX A;  2KRH A;  4KT6 A;  2X1C A;  3DPL C;  3QYE A;  4ZDO A;  3LMM A;  2W4S A;  1YX3 A;  3OL4 A;  5LD2 C;  2HZD A;  3M1C A;  3HC7 A;  2F6C A;  1SFK A;  2HDW A;  2KP6 A;  3PUB A;  5HLT A;  3BC8 A;  3OYI A;  2ELJ A;  3VYU B;  2W00 A;  4F92 B;  3OY9 A;  2CFO A;  1JI8 A;  4XOT A;  4DBQ A;  2IGN A;  4ZDP A;  4JOM A;  3DPT A;  2IGO A;  2BVM A;  2HVS A;  2V7F A;  4F3Q A;  1LKX A;  3LSM A;  4CCK A;  1WJE A;  4YRV A;  3HL2 A;  3MKY B;  2UV1 A;  4XN3 A;  4XON A;  4IQ4 A;  3VDX A;  2HVR A;  2VKD A;  2M4G A;  1SAU A;  2DCE A;  3DKX A;  3H5N A;  4BGD A;  4MLO A;  2WY8 Q;  1FMW A;  1D1C A;  4CCO A;  3W2A A;  3AL0 C;  2VIX A;  3TMO A;  2XC7 A;  2BW3 A;  2L5Q A;  2RRE A;  3HXL A;  2DOA A;  3HPH A;  4N4O B;  5HOO A;  3OL3 A;  3DWL E;  3RPU D;  3ZXS A;  1LDK B;  4P1W A;  3CZ6 A;  1D0X A;  3DTE A;  2KDO A;  3IAS 2;  3H0D A;  4PUS A;  4E7S A;  3K70 D;  3K4C A;  2VLA A;  4ANJ A;  2LBF B;  4E7I A;  4OAZ A;  2PJR B;  4HNT A;  3FBI B;  1YX5 A;  1X19 A;  2MC4 A;  4PJJ A;  2DT7 B;  4QPO A;  2A6T A;  2ZXH A;  3RQ4 A;  4CZC A;  2ZSH B;  2VJJ A;  1Y6I A;  2VXD A;  3QYF A;  2WA0 A;  2V9K A;  4ZC3 A;  4E4H A;  1R6R A;  2V1N A;  2XSJ C;  2E1M B;  4PJM A;  4DIQ A;  4XQF A;  1UEL B;  2MFZ A;  2GOM A;  3IP4 B;  4HEA 2;  3U21 A;  5HNH A;  4YEJ A;  3K70 C;  4E7J A;  1DGR M;  3F9K A;  5KHD A;  2OC6 A;  1W36 D;  2KL4 A;  1LFP A;  3MKZ A;  3S3N A;  3FBN B;  2R7S A;  2UWM A;  5KCM A;  3LL7 A;  4E7Z A;  2AQF A;  4Y3O A;  1MMN A;  2IS2 A;  2HPM A;  2GOX B;  4XN0 A;  4B43 A;  2JUG A;  3PNV A;  1WJF A;  2MYS A;  5HNF A;  4BAC A;  2X6X A;  1W36 C;  4C2U A;  3OS0 A;  3RCO A;  3ZRG A;  4PSW A;  4BQO A;  3AFH A;  4DBR A;  2KLO A;  3BCB A;  3MKW B;  4XOP A;  1WJ5 A;  2KHM A;  4JQF A;  4BL0 B;  3I3L A;  4F55 A;  2VQC A;  2XF7 A;  2XF5 A;  3EUH C;  3A2K A;  2VXZ A;  3QYB A;  3L2W A;  2VJ4 A;  4PSX A;  2KQR A;  3S8P A;  4NQW B;  3NWS A;  4CCL A;  4BE1 A;  3BG7 A;  5LFA A;  3OYG A;  3ZGK A;  5FRN A;  3HPG A;  3AL0 B;  3LSH A;  3OYC A;  2QKM B; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...