2ZMEA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
b'AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITA'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords Vacuolar-sorting protein SNF8
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04157 EAP30 EAP30/Vps36 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zmeA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zmeA03
3ROUA 5JVTA 4HYEA 3SHFA 3NEUA 3O3KA 1ZREA 1BI3A 4XBFA 1L3LA 4M9SA 1S8NA 4EM0B 3F8MA 4AWXB 1DPUA 1FC3A 2O6GE 3RJPA 1CF7A 2F5DA 2EFWA 5A2QZ 3PQKA 2MD5A 1IRGA 1SAXA 1YW9A 3RKXA 3K0LA 1PDNC 3LAJA 3EETA 2Y75A 2EA2A 2G7UA 2QQAA 1OYIA 4IVNA 1XN7A 1P4AA 4M6YA 5FLXK 2RDPA 2M87A 3M1EA 3DKWA 4KUMA 1FX7A 5LRRA 3QRFF 3LQQA 4N9HA 3WU1B 1U78A 3BJ6A 4HX8A 2RN7A 1J75A 4G8XA 1I1SA 1G3TA 2A61A 2YX7A 4KT5C 1U6GA 3L2CA 3KZYA 4G94A 4O6JA 1JE8A 4HV5A 5D5UB 3GX4X 5JHUA 4MHGA 5ILUA 5LGTA 4MQVA 1LEBA 2CG4A 1SD6A 4RB2C 4K2EA 2FBHA 1KU2A 2VT2A 1R5GA 3BROA 4HDUA 1ZLJA 4L5IA 2ZMEB 1Z6TA 1HSJA 4UVAA 1UCRA 3HTUA 2DT5A 4GYIA 1IUYA 2A3SA 3EQLF 5DUIA 4MTEA 2WTEA 2DLLA 4HAMA 1UB9A 2FU4A 3TOAA 1W7PD 1G3SA 4S05A 3HRSA 2Y48A 2Z5UA 4LK1F 4BHBA 5HLHA 1PP8F 2V1XA 4I0AA 4RGXA 2M30A 2ZXJA 1U5TA 2F5FA 2KRFA 4N9IA 2HYFA 4HX7A 1T38A 3KP3A 5HS7A 1FP2A 2DO7A 3AAFA 2YX4A 3GW2A 4IXAA 3MWMA 3LAPA 4GCVA 2W57A 3GFIA 3QOPA 2W24A 3R0JA 4HX4A 1QZZA 1IRFA 4GYGA 3M8FA 5HVQC 1ON1A 5DCMB 3JSPA 5CYVA 2CGPA 4H0EA 1KQ9A 3WTZA 4WK8F 2CSOA 1J5YA 1TBXA 1B59A 4XLPF 3DP7A 2H6CA 2GIVA 1AOYA 1DP7P 5L3FA 3G73A 2KIFA 2UXXA 5ERIA 3RDIA 5A2QK 2A69F 1KA8A 3IWZA 1J9IA 2O0YA 3FM5A 1GXPA 5F6FA 3HHGA 2MH2A 3RKYA 2DFIA 1YW8A 5E1ZB 2P8TA 1K79A 4RGUA 3GZ6A 3WU0A 1D3YA 2DK8A 3ZN1A 2KJCA 3QPHA 5CVVA 1B6AA 3I59B 1USSA 3VB2A 1FBUA 4XLNF 4Q47A 4Z2YA 2RQPA 1ZARA 3TDUC 4OIRF 5TRDA 5DD8A 4M6XA 2FXAA 5DEQA 1J2XA 4O5VA 1Z9CA 2V1DA 4MGRA 1O7LA 2VE9A 4P9FA 3ECOA 4GXOA 3TGNA 1GVJA 4MEYF 3BWGA 1ZYRF 1HW1A 4AIKA 3GXOA 3LQRA 1FY7A 3TQNA 3KEOA 2RC4A 3JW4A 3E6DA 3IKVA 2CW0F 3F8BA 5D8LB 4UV9A 2P6TA 4G7ZF 1HKTA 4EMSA 4P9UA 1YW7A 2HDCA 4EM2A 2Z33A 5H20A 3ZMDA 3ZN0A 2PMUA 4M9XA 2R7DA 4BYYA 2YSRA 5E18F 3REOA 3WGIA 2CO5A 4RAYA 4A5MA 5CJ9A 4RB0A 2OQRA 4NHJA 2HWVA 3RPUA 3FXRA 2LNBA 4M72A 3RPQA 2UWMA 2KJBA 2X0LA 1CGPA 2K02A 5AONA 1SFXA 4LFUA 3ZMTA 4CDGA 5IT3A 1OR7A 4EVIA 3KETA 3Q5FA 4ZYHA 1OKRA 1Y0UA 5E17F 1BI1A 2H6BA 1B9NA 2VT3A 5E1XA 3P9CA 4I7HA 2STTA 2FSWA 4I98B 2NNNA 4OOIA 1FZPB 1BI0A 4NB5A 3F72A 1YIOA 3GFLA 2EWNA 4L5JA 1K78A 2W25A 2OQGA 3WTTC 5K1YA 2OZ6A 3ZMSA 2AXLA 1SD4A 2NAZA 3QAHA 1LDKB 2FOKA 4FHTA 3LA3A 2HKXA 4EV0A 2FNAA 2JSCA 2VBYA 4HDVA 1KQ8A 1D5VA 5J6XA 4LG0A 5HS8A 3FXQA 2XKPA 2OBPA 1XD7A 4AIJA 1KU9A 4HF2A 4HF0A 5J8CA 4M73A 2J5PA 2B0LA 5LHIA 2HFHA 2EFOA 4UVBA 2FBIA 2WWYA 5D4SA 4PGGA 5HDNA 4L9VA 3HIFA 3NQOA 1J7KA 4P5OA 5HDGA 1S7OA 3F3XA 1W7PA 1IZ1A 2BBYA 3H3ZA 1IF1A 4JQFA 2UZKA 5L3EA 2QM3A 4I01A 2Q2EA 3JSOA 3WG9A 4U7BA 5ICCA 3E6CC 2NNYA 1E17A 3K1NA 1T2KA 2YR2A 5L3GA 1B9MA 4TV7A 4RGSA 3MCZA 3LSTA 2PN6A 2FQ3A 2XKOA 2M8EA 4NQWA 3MAJA 3I54A 4ZZDA 1PP7U 2V1UA 4BQAA 1BIAA 1T39A 3I4PA 3JTGA 2L54A 1ZGAA 2QZ8A 2BEOA 2EFNA 1F1ZA 3EYIA 2OD5A 1WKMA 3DPLC 4U88A 3COAC 4FT8A 4Q4ZF 4M74A 5HOOA 4A6EA 3SZTA 4UVCA 3E97A 1XSXA 1B1BA 4QLCU 4LD5A 4KIBA 1AWCA 2DK5A 2VONA 4CO8A 3EYYA 2Z3YA 1LEAA 3K1PA 2P6SA 1ON2A 2MLKA 5JFRA 2PBIA 5AIQA 1GHCA 2RNJA 2YPRA 3TDZC 4Y17A 3WGHA 1RZ4A 3B73A 4ETSA 1ODDA 4WXCA 4GGGA 6PAXA 3I5UA 3TO9A 4LJZF 4ESFA 4AD9A 3WTSC 2FMYA 3LWFA 2FF4A 1Z1DA 4EJWA 3QU6A 4OINF 4UUVA 4KDPA 4ESJA 4B09A 1WRJA 1XCVA 3WTYC 1STZA 5D6EA 2LDUA 3IWFA 3CTAA 1FP1D 3H92A 2H94A 4OU0A 3GLXA 2H09A 4OIOF 4KYWA 1UFMA 3LA2A 1WI9A 5LLQA 3F22A 4PGHA 3V4GA 3CUQB 2ESNA 1DPRA 1P4XA 2FEZA 4OIQF 3G3ZA 2XHKA 2Z99A 1ZRDA 3BJAA 1HKSA 3WTVC 4EGYA 5FB2A 2XVCA 1EH6A 3ULQB 3GYHX 1XSDA 2E1CA 1RUNA 1G3YA 2K7LA 2MA3A 1TW2A 4HBLA 4ASNA 2HQRA 4LGWA 1O57A 1U8RA 3WGGA 4XSXF 5BPDA 5IT9Z 1HW5A 4CICA 1EV7A 2A68F 3W6KB 5DD4A 4EJTA 3ERED 2IA2A 1O7FA 3R6SA 2VXZA 4YFNF 3HRTA 3BPXA 1IN6A 1R1TA 2ESHA 4LB6B 2VBWA 2GWRA 5CVRA 2QVOA 1FLIA 2PQ8A 2LF8A 3E6BA 1TNTA 2O03A 2EV5A 1Z91A 5BS6A 4U7DA 2JRTA 2XAHA 1HBXG 4HLXA 1ZGJA 3WTUC 1BM9A 1FYMA 1R1UA 1TW3A 2QBYA 3HOTA 3CDHA 2WC2A 3J7AO 5BOXA 5KK1A 2DI3A 5LGUA 3FZVA 1ZH5A 3RYPA 3KZZA 1GXQA 3WODF 3CUQC 2QWWA 1JHHA 1P92A 3F8CA 2BE5F 2OA4A 3ZQ7A 3K1MA 1KQ0A 4DNCA 4IRHA 4L9TA 1FOKA 4EGZA 4ENMA 2HTSA 3M9AA 3WTWC 1G6NA 2ETHA 3L00A 5BPIA 4UXNA 2QYOA 1KU3A 3GO5A 4Q48A 3N4MA 1IN7A 2XAGA 2PI0A 1XGNA 2EFQA 4ESBA 2V9VA 5D8KB 3J81Z 2E7WA 1LNWA 1F5TA 5E20A 2M45A 3L09A 4R79A 3QP6A 1HQCA 1LJ9A 3I71A 4FX4A 3ZMVA 1YG2A 2VBZA 3F6VA 3T1BA 1I6XA 2M5WA 4EQQA 5LEJA 2K4BA 3TO7A 2GXGA 2P5LC 1QBJA 2L3DA 1WSUA 3BJOA 3F23A 3DQVC 4KN7X 5K5RA 1U2WA 1YS7A 2STWA 4IRIA 1XDUA 5FFZA 5LEKA 2VN2A 2WV0A 3OV8A 1TQIA 4LMYA 2X4HA 1MDMB 3O6BB 2IRFG 2GA2A 3HTSB 4EJVA 2KIMA 1H9TA 4HW0A 1XB4A 2FRHA 3HHHA 1FYKA 3RKWA 5IT9K 2HS5A 1KU7A 4F7ZA 3RI4A 1MGTA 3DF8A 5F1RA 2A5YB 4IHTA 4BHPA 2DQLA 1P4WA 3C1DA 2LF7A 3V7RA 1RI7A 2JPCA 1REPC 4WXHA 3E6MA 3DV8A 4AIHA 4XSZF 3V8JA 5D6FA 2ZMEA 2CFXA 3H3UA 3SZPA 3QPTA 1C0WA 1T6SA 4A0YA 1Z7UA 3E3VA 1ULYA 3HRMA 3KP4A 2ELHA 1FT9A 5ILSA 2YU3A 4OMZA 2HTJA 1LQ1A 1V4RA 2MH9A 2OU2A 1QQIA 1TLHB 3DXJF 4I02A 2EFPA 1FNNA 1YLFA 2XROA 2V79A 4UV8A 2CWEA 3B02A 3V7CA 3BOQA 3KCCA 2BYVE 1SD5A 1W5TA 1SMTA 1R5HA 1UHWA 4MTDA 2PMHA 4IPAA 3ZP5A 2XAQA 5BMZA 5DCMA 1MZBA 2PEXA 4WXDA 3BPVA 3RTRA 1TNSA 2MBFA 3KP6A 2IA0A 4HLYA 3J81K 4MEXF 1QGPA 1ZG5A 4ZYEA 3IHUA 5HLGA 2A07F 3SXYA 3T5XA 5BQTA 2DQRA 4O3MA 1SMYF 2FBKA 2M1BA 3IC7A 4Y13A 1IXSB 1ZLKA 1BJAA 2HYGD 1IXCA 4LLGF 1O3QA 1R36A 4M71A 3R61A 1I27A 3HRUA 1CF7B 2ISZA 2VOPA 2IJLA 5DV5A 4M9ZA 4LB5A 2K4JA 4EJOA 4LK0F 1YTYA 5LHGA 4G7HF 3I59A 3R4KA 4UHTA 4B8XA 2IT0A 3M7GA 3WE3A 5E8GA 1U3EM 5DCFA 2XGXA 5CVUA 2NS0A 1ZHFA 3CLOA 1I5ZA 3C18A 2L02A 1O3TA 4HOBA 1DDNA 1OPCA 1WQ2A 4BHCA 5EEGA 1YFHA 3IKTA 3E5XA 2CYYA 1BI2A 4IF4A 3PQJA 4L18B 2ZBKA 1TQPA 5FD5A 2QUFA 3MQ0A 4EM1A 5ILVA 1BIBA 1TQMA 1XGOA 1BBYA 2ZKZA 5DUKA 4LLNA 1MJ9A 4KMFA 2UXNA 4HA8A 1HSTA 3QU3A 4P96A 2F5CA 3FMSA 2D1HA 2EJRA 1F4KA 1SFEA 1A04A 1O3SA 3JAMZ 5ICEA 2COMA 1YYVA 1W4MA 1NHAA 1U5TB 3KP5A 4CHUA 1D8JA 5CVIA 4KNYA 4BXUA 3KE2A 1J59A 2G7HA 2D1VA 1BC7C 5L3BA 2MLGA 1KYZA 2CQKA 2JPBA 2TDXA 3VODA 3K9TA 3FMQA 3KFWX 3I58A 2IVMA 5KVRA 2L4AA 2VC0A 5JR3A 3FM3A 4KIFA 1P6RA 2ZNYA 1ZAOA 3HOSA 2P5VA 2XIGA 2QENA 5D5VB 3I53A 2EK5A 4S04A 3GF2A 2O61A 2ZFWA 4RS8A 2XUBA 4ON0A 2DPDA 2Q0OA 1UHMA 3V8LA 2DW4A 1FSHA 2ADUA 1K7AA 3P7NA 3GEZA 1USTA 3OOPA 4R8HA 4ZYGA 4YIIA 5FFXA 1J0RA 3LA7A 4HZFA 3D0SA 3MZHA 5CLSA 1W5SA 2L01A 2G9WA 1QO0D 4HQEA 2IP2A 3E5QA 3RYRA 1S3JA 1FSEA 1FPQA 3F6OA 5ICGA 3U2RA 2QQ9A 4EJUA 3BP8A 4IHSA 3KLOA 1OYYA 2K27A 5LBQA 1HW2A 3U9GA 3JTHA 1O3RA 2PJPA 1V3FA 5AIPA 1QZYA 2R3SA 3ML6A 4KICA 4YIFA 3GWZA 1U5TC 4D0PA 3RIRA 2PG4A 3F8NA 3E5UA 3K2ZA 2KKOA 1R58A 2VC1A 3J80Z 4CGZA 1R1VA 2ZCWA 1LDDA 5HDKA 3SFZA 1FBSA 1IN4A 3QP5A 3T8RA 1XMKA 1RNLA 2P4WA 1BC8C 3VEPA 1ZG3A 2BV6A 2DTRA 1OYWA 1S6LA 3VOEA 1QPMA 3ABTA 2AS5F 3IL2A 2ZJ2A 3JAMK 2V6CA 3MZYA 2JT1A 1EH8A 4WCGA 2HOEA 4I0BA 1I1GA 2O3FA 3T8TA 2E7XA 1XCBA 2ACJA 2A6EF 2EV0A 2RVCA 2DU9A 3MFKA 4RGRA 2HGCA 5LHHA 3R0AA 3Q9VA 3IRQA 4DQ2A 1H0MA 1R7JA 3NRVA 1JHFA 3MEXA 3HSFA 5LRSA 5FO5A 3FHZA 3BDDA 2A6HF 2DPUA 2XASA 1MKMA 2IA1A 2FA5A 4CXFA 2Z9OA 3TOBA 4U0WA 3M8EA 5CVJA 3FXUA 5D5XB 3FMRA 2XAFA 1R00A 3KP2A 3V8KA 3ZPLA 2BGCA 2NYXA 1IAWA 2NRAC 4JBAA 5EEHA 4PCQA 4ZYDA 2QLZA 2GXBA 1K78B 4MQ9F 2ZNZA 4MNUA 4IJAA 2O8XA 1F9NA 5D5WB 4ZH4F 1ZRCA 5DDGA 1QNTA 1S29A 4YFXF 2GAUA 2GZWA 4A12A 5E8IA 2GA1A 2PFBA 4GO1A 1L0OC 5F64A 3CUQA 3CO7C 4LG0B 2W85A 4YFKF 4N0BA 4L9JA 3F21A 4PDKA 3ZMZA 3EDPA 1KYWA 4RAZA 2VE8A 1HXDA 2EV6A 4A0XA 2F5EA 3J80K 3F8FA 1X3UA 2VBXA 1W7PB 2ZO4A 1R23A 4KMUX 5ED4A 5H6RA 5L3DA 4A0ZA 1SFUA 2P7VB 4WX9A 1MJAA 2E1NA 2RV8A 3L9FA 5J8FA 3TKYA 4FX0A 1LVAA 2XAJA 2IW5A 3WE2A 3DPTA 3SQNA 1LB2A 2HQNA 4A2UA 4L9NA 4JK1X 5K5QA 4KIGA 3K69A 1EH7A 4KN4X 3TO6A 2LSOA 1RUOA 1KGSA 4AVPA 3KP7A 1VTNC 4P55A 4HV6A 3CO6C 4G6QA 5HLIA 1K6OA 3ZMUA 4KA4A 2QQBA 3P9KA 4KFCA 3VFZA 3FWEA 3R60A 4I2OA 3T0YA 5H6QA 3Q9SA 1FYLA 4G6DA 1T0FA 1YS6A 3KEQA 1IXRC 3GFJA 3CJNA 2Y0MA 1D8KA 2D2WA 2L4MA 2GQQA 1JGSA 1BOAA 3S2WA 1XSVA 1Z6RA 2HZTA 1ZRFA 3EUHA 4ENKA 1XGMA 2IPQX 4I09A 2OAZA 5HS9A 3BY6A 3D5LA 4A5NA 1G4DA 1B4AA 4E70A 2FMLA 4U0YA 3W6JB 3GZ5A 3BZ6A 4CZZA 4IRGA 5FD6A 5DYMA 4PZJA 3GVAA 2RGVA 3DEUA 1G3WA 1ZG1A 1E2XA 2MC3A 1DUXC 1BN5A 4HQMA 2EB7A 2KIUA 5LGNA 1H9GA 2VODA 2EA4A 3LFKA 4OIPF 1YQAA 2JTVA 4YG2F 3IRRA 4WWCA 1R22A 1MD0A 4R1HA 2HEOA 4ZZLA 5FGMA 3HUGA 2R7FA 3ABUA 4ENJA 1PUEE 1MDMA 1Q1HA 3C7JA 3ECHA 3O2PE 4RB3C 2ISYA 2DAOA 4OMYA 3CUOA 3C3WA 2K86A 4G9YA 2Q8KA 3FF5A 2JZYA 2FNPA 1HKQA 2LKPA 4BNCA 5FLXZ 5L3CA 3DFGA 2F2EA 2HR3A 2RKHA 3I64A 5E1WA 4BAYA 1MJBA 3ISPA 1LDJA 3GUDA 3N97A 3GFMA 2VOOA 1YO5C 1ZN2A 2J5OA 4ENNA 3L7WA 2P5KA 4A6DA 3P9IA 1XDSA 1SD7A 4HF1A 2FE3A 4LLLA 2H27A 1WWXA 1S7AA 3U1DA 4CYDA 4Q5SF 1XGSA 1RIOH 1JXSA 1P2FA 1OMIA 1IW7F 1XMAA 3V7SA 4U0VA 5JI6A 3KLNA 4QWQA 5TJJA 3PFIA 4WF2A 3HSEA 2QBYB 2HKOA 2XV4S 1IN5A 2OZUA 4XRFA 4BH9A 3I0TA 1TTYA 2P7CB 1IN8A 4UNOA 1ONVA 2XRNA 1T98A 3FX3A 1FWZA 4RB1A 4L0ZB 2DBBA 1FBQA 4Y15A 3WTXC 3ELKA 2C6YA 4L0YB 3HYIA 5K5OA 1Z05A 2PLYA 2W84A 2D45A 3HSRA 5ICFA 5D4RA 4G7OF
chains in the Genus database with same CATH superfamily
1JT0A 2EZHA 3ROUA 4B4CA 5DS9A 5JVTA 4HYEA 3SHFA 3JRAA 1W5CC 3NEUA 2K3FA 2VKVA 3O3KA 1FIAA 1ZREA 3CZ6A 3RPUD 1BI3A 2F5VA 3LSIA 4XBFA 1L3LA 4M9SA 1S8NA 2KP6A 2QA4I 3GCMA 3ABMH 4EM0B 3F8MA 3G1LA 4BEHB 4AWXB 1DPUA 1XC5A 4DYRA 1FC3A 1U9OA 2M9HA 1I50J 1M1EB 2CMPA 3H35A 2O6GE 1U8BA 4A93J 5C4XJ 3RJPA 1CF7A 3KIOA 2F5DA 4F55A 2EFWA 5A2QZ 2AO9A 1E3PA 3PQKA 3AG1H 4I76A 5GPCA 3RZDJ 2MD5A 3AL0C 4EEFG 1T8IA 1IRGA 1SAXA 4GRIA 1YW9A 4F3QA 3CCVI 3RKXA 2OC6A 3K0LA 3UNGC 1PDNC 2VPRA 2P0WA 3LAJA 3EETA 1IV8A 2Y75A 2M0MA 2KDZA 2EA2A 2DA4A 2G7UA 2QQAA 1DU0A 1OYIA 1MBFA 1XN7A 1P4AA 2CH0A 4IVNA 5GTIC 2VIXA 3JRHA 4M6YA 5FLXK 3DEEA 2RDPA 4X1EA 2X1CA 4IHWA 2M87A 1VQOI 1MBEA 3MKZA 4XNFA 1WPKA 3M1EA 3DKWA 4KUMA 1FX7A 5LRRA 3QRFF 3LQQA 2VKDA 4N9HA 3N05A 1T08B 3WU1B 2KIQA 1U78A 3BJ6A 2E36A 4HX8A 4A3BJ 2LKSA 2E1MB 2RN7A 2M7BA 1J75A 4G8XA 1I1SA 2JK3A 1G3TA 2A61A 2YX7A 1ITYA 1G2HA 1Z3YA 4KT5C 4NC6A 4E7LA 1U6GA 2DMUA 5F08A 3V42A 3S2HJ 3L2CA 2QEXI 3KZYA 4G94A 2E5ZA 4HNUA 1QRYA 4O6JA 2LC2A 4HV5A 3BZCA 4ZDPA 1JE8A 5D5UB 5F0HA 3D5RC 3U1KA 4FETA 3GX4X 4F92B 3DBHB 2R4GA 4MHGA 5JHUA 5LGTA 5ILUA 4MQVA 1LEBA 4BE2A 2CG4A 1SD6A 3HOWJ 4RB2C 3VYRB 1UZCA 4K2EA 5J1RA 2FBHA 1KU2A 3VDXA 2VT2A 1R5GA 3BROA 4HDUA 1ZLJA 3CCEI 4L5IA 2ZMEB 1Z6TA 1HSJA 2E35A 2RQQA 4UVAA 4DBRA 1UCRA 3HEFA 2JRMA 1VQNI 5EF6A 3HTUA 2DT5A 5M5WJ 4GYIA 3H36A 2DODA 2JA5J 1IUYA 2A3SA 3EQLF 1FTZA 5IP7J 5DUIA 3A01A 4MTEA 2WTEA 2DLLA 2JN6A 4HAMA 3BTJA 4NUBA 4XK4A 5M5XJ 1UB9A 3OYNA 2FU4A 3GBGA 4AVZA 4LOCA 3TOAA 1W7PD 3MZ8A 2GLOA 2PJRB 1G3SA 4S05A 3HRSA 2Y48A 2W00A 2Z5UA 3OL4A 4LK1F 4BHBA 3OYJA 5HLHA 1PP8F 1A36A 2V1XA 2Y2ZA 4I0AA 3VWBA 4RGXA 2F6CA 2M30A 1GLNA 2ZXJA 1U5TA 1G59A 1KZHA 4OAYA 4BJ6C 1IV6A 5GAGJ 1K83J 2F5FA 2KRFA 2KFDA 4N9IA 2HYFA 4HX7A 1FTTA 1T38A 1V54H 1XMXA 2FX0A 3KP3A 5HS7A 3ZQHA 1FP2A 2DO7A 4B3XA 1U9NA 2CW7A 4BQQA 2YX4A 3GW2A 4IXAA 3AAFA 4A3FJ 4HSRA 3MWMA 3B6AA 3LAPA 4GCVA 2W57A 2JVGA 3GFIA 3QOPA 2W24A 3R0JA 4XONA 3TL4X 1OCCH 5GAHJ 4HX4A 3ZQQA 1QZZA 2CUJA 1IRFA 4GYGA 5TGTA 3M8FA 5HVQC 1ON1A 1JTYA 4HNVA 2K5CA 5DCMB 4B3AA 3JSPA 3HZJA 5CYVA 2HDDA 1ZR4A 2JA7J 5F27A 3TBIA 4DW6A 2QKLB 5J1UA 2CGPA 4H0EA 1KQ9A 3ABLH 3K4MA 3WTZA 4DYCA 2CV0A 4CSWA 4WK8F 2CSOA 3S15J 1J5YA 1TBXA 1B59A 2EH3A 2N8GA 3BR1A 3DP7A 3TP0A 4XLPF 3I4MJ 2BXYA 2H8WA 2H6CA 2GIVA 3I9V2 2M7AA 2H1KA 3OSGA 1AOYA 1DP7P 1WJEA 4IZZA 4II2A 4U87A 5L3FA 3G73A 4BE0A 2YUSA 4X6AJ 3PO2J 2KIFA 2E1MC 2UXXA 5ERIA 3RDIA 1X2MA 5A2QK 2A69F 1S7EA 4BJ5C 2R7SA 1KA8A 4IOAF 3IWZA 1J9IA 2O0YA 1LFUP 3FM5A 3DBLB 2IGNA 3J7ZI 1GXPA 4XLEA 5F6FA 4RLFA 3HHGA 2MH2A 3RKYA 1PJRA 2DFIA 1VQ9I 4DIQA 2KL4A 1YW8A 5E1ZB 4M3DA 2RNGA 4W1UA 1HLVA 2P8TA 3HL2A 2Q1ZB 1K79A 4RGUA 3CJRB 2V9PA 2R7WA 3GZ6A 3WU0A 2VXDA 1IRXA 3H0GJ 1NK3P 4HNTA 1D3YA 2DK8A 2R7XA 3ZN1A 1LFBA 2I10A 2L9SA 2KJCA 3H5RA 3QPHA 1ETWA 1V55H 4DYQA 3A1YA 2ZMEC 4G12A 4MIMA 5CVVA 5KNLA 4J19A 3A2KA 2QF7A 4CA0A 2KMUA 1B6AA 3I59B 2NXNB 3SYTA 1USSA 3VB2A 1JUSA 1FBUA 4XMYA 4XLNF 2DYSH 4Q47A 1IDYA 4Z2YA 2AXTC 1ZARA 2RQPA 3TDUC 4OIRF 5TRDA 5DD8A 4BXFA 4M6XA 2FXAA 2R5ZA 2O9LA 1JI8A 3FBNB 4RMNA 5DEQA 1J2XA 4AYBA 4O5VA 4AU7A 3F9KA 1Z9CA 2WY7Q 2V1DA 3FXJA 1GVDA 1OCPA 4MGRA 4C30A 1O7LA 1Y8QB 2VE9A 1UMQA 2A05A 3HB9A 4HSTA 4D5CA 4P9FA 3ECOA 4GXOA 2L7KA 1GVJA 3TGNA 4MEYF 1DGWY 2WY8Q 3ZCOA 1QZEA 3BWGA 1ZYRF 4XKCA 3GTPJ 4QTRA 2R7ZJ 1HW1A 4AIKA 3GTLJ 2HXOA 2QSGX 3C2GA 3GXOA 3LQRA 2I5UA 3AG4H 2DA3A 1P7IA 1JJ6C 1FY7A 2KDOA 3TQNA 4RDUA 1WFXA 5J4YA 3KEOA 2RC4A 3JW4A 3E6DA 3IKVA 2Y9YA 2CW0F 2DOAA 2IGOA 2JMWA 2LR8A 3BTIA 2M2EA 3S8PA 4BXXJ 1X58A 4E7SA 3S1QJ 3F8BA 4A3GJ 2R7RA 1AKHB 1I6HJ 5D8LB 4UV9A 2P6TA 1X19A 2ZSHB 4G7ZF 1HKTA 4RA2A 2L5QA 4EMSA 3ONQA 1SVOA 5FLMJ 4P9UA 1YW7A 1XG1A 2HDCA 4EM2A 2Z33A 5H20A 3EPZA 3ZMDA 2DFFA 4BJTA 1D0YA 2IXSA 2PMUA 3ZN0A 5JLWA 4M9XA 2R7DA 2NVYJ 1T56A 2YSRA 3LMMA 4BYYA 5E18F 4PJJA 5FLVA 3BT9A 2IS1A 3REOA 3WGIA 3S14J 2WAFA 2CO5A 3OL3A 3SDGA 4RAYA 4A5MA 1SAUA 2HOTA 4JX6A 5CJ9A 4YEJA 4RB0A 2OQRA 4NHJA 2WAEA 4E4HA 2HWVA 2TCTA 1AA7A 3FXRA 3RPUA 2R7UA 2LNBA 4M72A 3RPQA 4W97A 2HXIA 2UWMA 5HNFA 2KJBA 1JUPA 2X0LA 4ANJA 2VLAA 1CGPA 2K02A 5AONA 2CUZA 1SFXA 4LFUA 1BL0A 3NWTA 3ZMTA 4CDGA 1RETA 3IH3A 5IT3A 2L7MP 2XF6A 1IUFA 2X6OA 3HOUJ 1OR7A 4BGDA 2QGUA 2V6EA 4EVIA 2O5RA 3ASOH 2CQ7A 3KETA 3Q5FA 1YRNB 1GV5A 5FKNA 1ZELA 3CDIA 3HPHA 4NC7A 4PK4A 1VQ8I 4ZYHA 1YHQI 2BY2A 1Z0XA 2VQLA 1WH5A 3OYBA 2GOMA 1OKRA 4E7KA 3FXOA 2HZDA 2LOOA 3IP4B 1Y0UA 5E17F 3HBLA 4E6KG 1BI1A 3KYDB 2H6BA 3SEQA 1B9NA 2VT3A 1KONA 1WVRA 5E1XA 1MBKA 3HM5A 3PNVA 3P9CA 4I7HA 2STTA 2A6TA 2FSWA 4I98B 2NNNA 4OOIA 1FZPB 3ZXSA 1BI0A 4NB5A 3F72A 1YIOA 3GFLA 2EWNA 2E2JJ 4M3EA 4L5JA 1K78A 4YRVA 2W25A 2OQGA 3WTTC 5K1YA 2OZ6A 4PUSA 3SZGA 5GP9A 3ZMSA 2AXLA 1SD4A 3HGYA 2NAZA 3QAHA 3OYCA 2EIMH 1LDKB 1PYVA 2RAEA 1TP4A 2FOKA 3GTKJ 1ZKGA 4FHTA 3LA3A 2AQFA 2QSHX 2HKXA 3OIPA 2R92J 2ZSIB 1VZ0A 4EV0A 2FNAA 2JSCA 2VBYA 5J4VA 4HDVA 1Q1VA 1KQ8A 1D5VA 4LG0A 5HS8A 5J6XA 3AG2H 3FXQA 1D1BA 2CRGA 2DMNA 1UAAA 4ABZA 2XKPA 1N77A 2OBPA 1XD7A 4BQNA 1OJLA 4AIJA 1KU9A 1OQYA 4XKWA 4HF2A 4HF0A 4CH7A 2O7OA 4M73A 5J8CA 4CCKA 2J5PA 2B0LA 2ECCA 4OWRB 5LHIA 4IEJA 2HFHA 2EFOA 4UVBA 3JRGA 2FBIA 2WWYA 3BR6A 5D4SA 3DLLF 2E5NA 4PGGA 5HDNA 4E7JA 3OSFA 4L9VA 3HIFA 3NQOA 3DTIA 4IL6C 1J7KA 4XN0A 4P5OA 2K9SA 1S7OA 3BG3A 5HDGA 3F3XA 1W7PA 1IZ1A 2BBYA 3H3ZA 4M3GA 4JQFA 1IF1A 5H2FC 2UZKA 3E0JB 3GLLA 5L3EA 5E3OA 2QM3A 4I01A 2Q2EA 2LH9A 5F1JA 3JSOA 2QCOA 3WG9A 4U7BA 5ICCA 3E6CC 2NNYA 3HXLA 1RR7A 3M8JA 1W0TA 1E17A 2KRHA 3K1NA 1T2KA 1P7JA 2YR2A 5L3GA 1B9MA 4TV7A 5IOYA 4RGSA 3JRFA 4ZDOA 3MCZA 1ZR2A 1W1WE 1WZ2A 4RAFA 1D1CA 4QIWN 3LSTA 2PN6A 3PIPF 3QPLA 2FQ3A 2XKOA 5KAIC 4L5EA 2M8EA 4NQWA 3W2VA 4YIRX 3KZIC 3MAJA 3L2VA 2V4JC 2IS2A 3I54A 2E2IJ 1H88C 4ZZDA 1A35A 1PP7U 2V1UA 1FEXA 1APLC 4BQAA 4BACA 1BIAA 1T39A 2X6WA 2ZJQF 3IV5A 3I4PA 3JTGA 2L54A 1ZGAA 2QZ8A 2BEOA 2KQRA 2EFNA 3AG3H 1F1ZA 3EYIA 2XB0X 2OD5A 3G1OA 3P5JA 1WKMA 3S16J 4B47A 2LKXA 1SVLA 3CP2A 1BR2A 3DPLC 1QVTA 4U88A 2LFBA 1GV2A 2FD5A 3ERMA 3COAC 4FT8A 2DA6A 4Q4ZF 4M74A 2ID6A 3RCOA 5HOOA 4M3FA 4A6EA 4BU2A 4FTHA 3OYAA 3SZTA 5C3EJ 4UVCA 2XSJC 4Y7NJ 1LFPA 3E97A 1XSXA 2NVUB 1B1BA 1WH7A 4QLCU 3IH4A 4LD5A 4MFDA 1IRZA 4KIBA 1AWCA 3FK6A 1PUFA 2DK5A 4PJNA 5FKMA 2VONA 4XORA 3WHBA 4CO8A 2L0KA 3EYYA 3OYMA 2Z3YA 3ZRGA 2CQQA 1LEAA 4XQFA 3K1PA 2P6SA 3FHNA 1RR8C 3LSHA 1ON2A 4DZJA 2MLKA 5JFRA 2DTZA 3UR3C 2PBIA 5AIQA 3OS0A 1GHCA 1BR4A 2RNJA 3BQZA 5CQGA 1TWCJ 2YPRA 2XSDC 1E3HA 3BG9A 3TDZC 4Y17A 3WGHA 1YRNA 1RZ4A 3B73A 4AIDA 4ETSA 2IBDA 1ODDA 1YJ9I 4WXCA 2M4KA 2KRCA 2BZTA 4GGGA 6PAXA 3I5UA 5IYCJ 3S3MA 3TO9A 3O8HA 1XTAA 4A3KJ 1MMAA 4LJZF 5F0CA 4ESFA 4AD9A 3WTSC 2VKEA 3H5NA 1OFCX 2FMYA 2Y30A 3LWFA 2L7FP 2FF4A 4C3HJ 1Z1DA 3C2BA 4EJWA 3M07A 1Y39A 3QU6A 4OINF 3FXKA 4UUVA 4KDPA 5EZHA 1UG2A 2KLOA 4ESJA 4B09A 1MH4A 2P81A 1WRJA 1XCVA 3WTYC 1STZA 5D6EA 1GT0C 2LDUA 3IWFA 3CTAA 2X9DA 2HU9A 3G1MA 1FP1D 2IS6A 2DOEA 3H92A 2EZLA 2L7ZA 2H94A 4OU0A 2CFOA 3GLXA 1VQPI 2H09A 5E3NA 4OIOF 4KYWA 1UFMA 3LA2A 1WI9A 5LLQA 3F22A 4PGHA 3BQYA 3QYBA 5E3LA 3DLAA 3V4GA 3CUQB 3PSIA 3RZOJ 3HOVJ 2ESNA 1K61A 1DPRA 1P4XA 1H89C 2FEZA 3GTMJ 3DCFA 3H0DA 3CJTB 1Z7LA 4OIQF 3G3ZA 1H8AC 2XHKA 2Z99A 1ZRDA 2W48A 3BCBA 5HLTA 3S32A 2PMZN 3S3OA 1VF9A 1HKSA 3BJAA 2XF7A 3DTKA 3NARA 5GAEJ 3WTVC 4FCYA 3K4LA 1V5EA 3KPHA 5FROA 4EGYA 2FUG2 5FB2A 3JCUC 1B72A 2XGDA 1NG7A 2XVCA 1EH6A 1AU7A 3MVPA 3ULQB 1W0UA 3GYHX 1XSDA 2E1CA 2DMPA 1RUNA 2E34A 1WJFA 3O8GA 4QSHA 2R7QA 1G3YA 1QVUA 2XAUA 2LRDA 2K7LA 1MMNA 2MA3A 3DU5A 1TW2A 4HBLA 1WJDA 3OOUA 4XKBA 4ASNA 2HQRA 4LGWA 1EA3A 1O57A 1U8RA 3OYGA 3WGGA 3H9QA 4XSXF 3ZQGA 5BPDA 4CUGA 5IT9Z 2W4SA 1HW5A 2Y9ZA 4CICA 3RKQA 4MLOA 1LE8A 2HI3A 1EV7A 3PFYA 3DKXA 2A68F 4UUSB 1LUJB 3W6KB 5DD4A 3LNQA 4EJTA 4M6VA 3ERED 1WJBA 5JLXA 2Y0SN 3MKYB 3H9GA 2IA2A 1O7FA 3A0BC 3CMMA 3R6SA 3VSKA 2VXZA 4YFNF 3HRTA 4AC0A 1SVMA 2JA8J 3CMAI 3BPXA 3W2AA 1IN6A 1R1TA 2ESHA 2K9NA 4LB6B 3DEWA 3CCLI 2GM4A 3S1MJ 2VBWA 2GWRA 5CVRA 4ZJZA 2K9QA 2R0QC 2QVOA 4DBQA 1FLIA 2VJ4A 2XRLA 2XPVA 2PQ8A 2AHQA 4CCMA 1A5JA 2LF8A 3E6BA 2IGMA 4Y33A 1TNTA 2ECBA 2O03A 2PMZA 2EV5A 2CW8A 1Z91A 1DP3A 5BS6A 4IOCF 2ZXHA 1X2NA 5IYBJ 5DM7F 4U7DA 2ME0A 2BY0A 2JRTA 2XAHA 1HBXG 3ASNH 4HLXA 1JKPC 1ZGJA 3WTUC 3OYEA 1BM9A 1FYMA 1R1UA 1TW3A 2QBYA 2FOWA 2K40A 3KX2A 1EF4A 4B48A 2Z16A 3HOTA 3CDHA 2WC2A 3J7AO 5BOXA 1W36C 5KK1A 2DI3A 4XRSA 5LGUA 3FZVA 4B44A 1VFCA 1SC7A 4G6TB 3CQZJ 2ZFUA 2LMDA 5EGOB 1ZH5A 3RYPA 3KZZA 3KEYA 1GXQA 3WODF 4MO7A 3CUQC 1BJZA 4I99C 2K85A 2QWWA 5M3MJ 2VUMJ 1JHHA 1P92A 3LFUA 2FQ4A 3F8CA 2BE5F 3I55I 4HG2A 2DT7B 1X1DA 4C3JJ 3CCMI 3S1NJ 2OA4A 3ZQ7A 3K1MA 1KQ0A 4DNCA 2EQRA 2BW3B 4IRHA 2Y0SA 4L9TA 4Z6YA 4EGZA 1EJ9A 1FOKA 4ENMA 2HTSA 2HPIA 4A69C 3M9AA 2LP0A 3S93A 3WTWC 4ZTFA 1G6NA 2ETHA 3L00A 5BPIA 3ZOBA 1ETOA 2HYJA 2QYOA 1KU3A 4UXNA 5KHDA 3GO5A 4Q48A 3OIOA 3IAS2 3N4MA 1FJLA 1IN7A 4S0HB 2XAGA 2PI0A 1XGNA 2EFQA 3MKWB 4ESBA 2V9VA 4ZYAA 4LIVA 3SDBA 4XLFA 5D8KB 3J81Z 2E7WA 3PIOF 3LSPA 1LNWA 1ZQ3P 1F5TA 1MNEA 3FK7A 1E3OC 4J01A 3QQAA 5E20A 2M45A 4BEHA 3OYHA 3L09A 4R79A 1SFOJ 2D5VA 2EIKH 1NK2P 2OTJI 3QP6A 1HQCA 1HCRA 1G8XA 1LJ9A 4XN3A 1MBJA 3I71A 4FX4A 3ZMVA 1YG2A 2VBZA 3F6VA 3T1BA 1I6XA 2M0CA 2M5WA 4EQQA 2KISA 2K4BA 3BR3A 4XL9A 5LEJA 3TO7A 2IGKA 2XC7A 4PFPA 3TEDA 3CLQA 2GXGA 2DFEA 2P5LC 1QBJA 2L3DA 1WSUA 3CMEI 3AFHA 3CDLA 3BJOA 1TT5B 3F23A 4IHYA 1YX5A 3DQVC 4KN7X 1HA8A 5K5RA 2FJ1A 1U2WA 1YS7A 2STWA 4IRIA 3HUGB 1XDUA 5FFZA 5LEKA 2VN2A 2WV0A 2MC4A 3OV8A 3WU2C 1TQIA 4LMYA 2X4HA 2X6XA 1MDMB 1GUUA 1JGGA 2X51A 1XS9A 3O6BB 2IRFG 4N4OB 1IJWC 2GA2A 3HTSB 3J7AY 1DU6A 4EJVA 2KIMA 2L9NA 4A3IJ 2DJIA 1H9TA 4HW0A 1XB4A 2FRHA 3HHHA 2VKHA 1FYKA 3K4NA 2ZJRF 3CCYA 3RKWA 5IT9K 1K4TA 2HS5A 4ZC3A 1KU7A 2IS4A 2LY1A 4XM3A 4F7ZA 5EG0B 3RI4A 1T33A 1MGTA 3DF8A 2W82A 5F1RA 2VASA 2DN0A 2A5YB 4IHTA 1T0FC 4BHPA 1TL8A 2UV1A 2DQLA 1P4WA 2Y69H 2LF7A 3C1DA 2B63J 2L9VA 2OJED 3V7RA 1R9TJ 1RI7A 1OCZH 2JPCA 1F36A 1REPC 4WXHA 2DDBA 3LSRA 1BOBA 1POGA 3DV8A 3E6MA 4AIHA 4XSZF 1DQUA 3V8JA 2XPWA 5D6FA 1VQ5I 2ZMEA 2CFXA 1FIPA 3CCQI 3H3UA 4V19K 3SZPA 2EINH 2MYSA 4QPQA 3QPTA 1C0WA 3EUHC 3FDYA 1T6SA 4A0YA 1BW6A 1Z7UA 4PSXA 4BDYA 3QYEA 2X85A 3E3VA 1ULYA 4HEA2 3HRMA 3KP4A 2ELHA 1FT9A 4ZTJA 2HVSA 5ILSA 2PJRA 2YU3A 2CUFA 1WCMJ 4OMZA 2HTJA 1LQ1A 3GMEA 1V4RA 1YJNI 2MH9A 1Z67A 2OU2A 1OCOH 1QQIA 1TLHB 4B1RA 5M5YJ 1VQ7I 3DXJF 4HPQA 4I02A 3D5SC 1ENHA 2EFPA 1FNNA 1YLFA 2XROA 2V79A 2DA1A 4UV8A 2CWEA 3B02A 3V7CA 3BOQA 3KCCA 5J47A 2BYVE 1SD5A 1W5TA 1SMTA 1R5HA 1UHWA 2RREA 4MTDA 1MNMC 2HVRA 1DGRM 2PMHA 4IPAA 1RC9A 3ZP5A 2DXIA 2XAQA 2XPUA 4D7NA 3GTOJ 3IAM2 3HGGA 5BMZA 5DCMA 1I39A 1MZBA 2PEXA 3A0HC 4WXDA 3BPVA 2H8RA 3RTRA 4F91B 2M4GA 1TNSA 1ETKA 2MBFA 2R93J 2CJJA 2IA0A 3KP6A 4HLYA 5GPAA 3J81K 4MEXF 1Y6IA 1QGPA 2LY2A 1ZG5A 2WAQN 4ZYEA 2BW3A 1ETYA 4BUPA 4KISA 3IHUA 5HLGA 2A07F 3SXYA 1B8IB 3T5XA 5BQTA 5J3LA 2DQRA 2DYRH 3WG7H 4O3MA 1OCTC 1SMYF 2FBKA 2M1BA 2I8DA 1Y0NA 3IC7A 1NTCA 3OS1A 4Y13A 2E71A 1IXSB 3LSMA 4LIUA 1ZLKA 1BJAA 3PNTA 4ZDLA 2DJNA 3K4BA 4Y52J 3ESWB 2HYGD 2Y31A 1JKQC 2WB1N 1IXCA 2LTPA 4LLGF 4QPOA 1O3QA 1R36A 3OYKA 3L2RA 4M71A 3R61A 2R5YB 2DT6A 2DCEA 4IHXA 4PJ0C 1I27A 3HRUA 1CF7B 2QSFX 2ISZA 1X3ZB 2E19A 2GBYA 2ZC2A 1Y1WJ 2V26A 3ABKH 3BCAA 4PJLA 5K7HA 2VOPA 2IJLA 5DV5A 4M9ZA 4LB5A 1Y8RB 2ID3A 3JRDA 3LSJA 2WA0A 2K4JA 3RQ4A 3I3LA 4EJOA 1WHUA 4LK0F 1YTYA 2K9LA 3E1SA 5LHGA 5EEAA 3LL7A 4G7HF 3I59A 3HOZJ 4DOZA 4DZPA 2BHYA 4IQ4A 3R4KA 2V9KA 4UHTA 4B8XA 3DPUA 2IT0A 2LY9A 2HPMA 3Q0WA 3M7GA 3WE3A 1JUMA 5E8GA 1U3EM 2LG4A 5DCFA 1SFKA 2XGXA 1MSFC 5CVUA 3ZR8X 2NS0A 1ZHFA 2VB6A 3OMYA 3A4CA 3CLOA 1I5ZA 1I3QJ 3C18A 3VPRA 2L02A 2CS3A 5E3MA 1O3TA 4HOBA 1X3WB 2MG4A 1DDNA 3S17J 1OPCA 1WQ2A 4BHCA 5EEGA 5TISC 1W36D 1Z3XA 1YFHA 1VQ6I 1X4PA 2HNHA 3IKTA 3E5XA 2R7VA 3ZQIA 2CV2A 1RKWA 2CYYA 3H9JA 1BI2A 4IF4A 4XLAA 3FIWA 4E7ZA 5KAFC 3CCUI 3PQJA 4XKVA 4L18B 5FRNA 2ZBKA 1TQPA 5FD5A 2QUFA 3MQ0A 3BG5A 4EM1A 3Q0VA 5ILVA 1BIBA 3I4NJ 3KYCB 2Z2SB 1TQMA 1XGOA 1BBYA 3OR2C 2ZKZA 1K6YA 2LREA 5DUKA 3TMOA 4XRMA 4LLNA 1MJ9A 2F4MB 2M3AA 3BG7A 4KMFA 2UXNA 4HA8A 1AKHA 4XOPA 1HSTA 3FXLA 1LPQA 2BOLA 5EJCA 3A01B 3QU3A 5GTHC 4II3A 4P96A 9ANTA 2F5CA 3FMSA 1YJWI 2A5WA 2HOSA 1D1AA 2G0EA 4EATA 4RBOA 2XDVA 3M1CA 1X1CA 2D1HA 2EJRA 4KITB 3MD2A 1F4KA 1AHDP 5F04A 1SFEA 1A04A 2ZXWH 1O3SA 1PVEA 1WI3A 2JA6J 3JAMZ 5ICEA 3X2QH 2COMA 1TT0A 1YYVA 4ITVA 3VYTB 1W4MA 1NHAA 1U5TB 3KP5A 4JX4A 4FASD 4CHUA 1D8JA 5CVIA 4IHVA 4RAGA 2JUCA 2CQNA 1ERDA 4PSWA 4KNYA 4BXUA 3KE2A 1J59A 5DM6F 2G7HA 2D1VA 1BC7C 5L3BA 2DA2A 2GOXB 1RKTA 1SANA 2MLGA 3CMYA 1KYZA 2JJ7A 4HRIA 3CF5F 3G4SI 2CQKA 1RRJA 3VYUB 2JPBA 2TDXA 3VODA 1WJAA 3K9TA 3G71I 1FOXA 2W1OA 3FMQA 1MBGA 4D7MA 2HVQA 3I58A 3KFWX 1ZK8A 2DA7A 2IVMA 3L2UA 2OF7A 3S1RJ 4F52A 3PO3J 5KVRA 2L4AA 1ACIA 5M3FJ 5IP9J 2VC0A 5JR3A 3FM3A 4KIFA 1P6RA 1MW7A 3MMYB 5FRMA 2ZNYA 4RM2A 1ZAOA 3HOSA 2P5VA 5GADJ 3SFIA 1UG0A 2XIGA 1HOMA 2QENA 3BR2A 5D5VB 3I53A 3K4JA 4BQOA 2EK5A 3AKZA 4S04A 2MD0A 3GF2A 2O61A 2ZFWA 4RS8A 2XUBA 2BY1A 4ON0A 2DPDA 4YELA 1IG7A 5IY5H 1MH3A 2Q0OA 1UHMA 3V8LA 2DW4A 1FSHA 4AUXA 1YX3A 1R4MB 2ADUA 3GTGJ 2CUEA 1K7AA 3QOEA 3P7NA 3GEZA 3LSGA 5HNHA 1USTA 1MBHA 1MNDA 3K70C 3OOPA 3PUBA 4R8HA 4ZYGA 4IO9F 4YIIA 2ELKA 2VJ5A 4FQGA 5FFXA 1J0RA 5FKKA 3LA7A 1A6QA 3B6CA 3DTEA 4HZFA 3UKGA 3D0SA 2MW8A 5CLSA 3MZHA 1W5SA 2BVLA 2L01A 3FISA 2G9WA 1QO0D 4HQEA 1BA5A 2IP2A 3S3NA 1Z21A 5JHFA 1FOYA 2R5YA 5JVGF 3JR9A 2ME6A 3E5QA 1F43A 3RYRA 1S3JA 1FSEA 1FPQA 3H3VK 1HDPA 2HDWA 3F6OA 5ICGA 3A03A 3U2RA 2QQ9A 3C2HA 2NOGA 2EZIA 4EJUA 3BP8A 2NVXJ 3KLOA 4IHSA 1OYYA 2K27A 3ZGKA 2VJIA 1GDTA 4B43A 2V7FA 4FE7A 5LBQA 3OYDA 3SEZA 4E7HA 1HW2A 2EZKA 4BKXA 3U9GA 3JTHA 3PJRA 3RQIA 1O3RA 2PJPA 4N4NB 2M34A 1V3FA 2R5ZB 5AIPA 1QZYA 2R3SA 1S72I 1BR1A 3ML6A 4KICA 3HKZN 1UHSA 4YIFA 3GWZA 3CC2I 1SEUA 1U5TC 1QA6A 4D0PA 2HQ5A 1YE9A 3RIRA 1YIJI 2PG4A 2ZB9A 3F8NA 3E5UA 3K2ZA 4H4KC 2KKOA 1R58A 2VC1A 2LBFB 3J80Z 1R1VA 4CGZA 2ZCWA 5B3SH 1LDDA 5HDKA 3LSKA 3SFZA 1FBSA 1IN4A 3QP5A 3A02A 3T8RA 3F0CA 3ZQLA 1A31A 3HPGA 1XMKA 2OCCH 1RNLA 2P4WA 1BC8C 3VEPA 1ZG3A 2BV6A 1R71A 2BXZA 2DTRA 1OYWA 1S6LA 4BBRJ 3NWSA 3VOEA 4IQJA 4XLCA 1QPMA 3ABTA 2AS5F 2E60A 3IL2A 4A3JJ 2ZJ2A 3JAMK 2V6CA 3MZYA 2JT1A 1EH8A 4CCLA 1X1AA 4WCGA 2HOEA 4I0BA 1I1GA 2BHZA 5IOZA 1HDDC 2O3FA 4BL0B 3T8TA 2E7XA 1XCBA 2ACJA 2A6EF 4UUTA 2EV0A 3QYFA 2QKMB 2RVCA 1R49A 2DU9A 3MFKA 4RGRA 2HGCA 5LHHA 1JKRC 3R0AA 3Q9VA 3IRQA 4DQ2A 3ZQCA 1H0MA 1R7JA 3HKZA 4MFEA 1WJ5A 3NRVA 3KYLA 1JHFA 2X1DA 3MEXA 2K3PA 3HSFA 5C44J 2E2HJ 5LRSA 2JVHA 5FO5A 4CCJA 3FHZA 4BY1J 1S9HA 2CU7A 2OTLI 4CYCB 3JRBA 3BDDA 4D9JA 2F4OB 2A6HF 2DPUA 2XASA 2KPMA 1VNDA 1MKMA 2IA1A 3W3CA 2FA5A 4M3BA 4X0GA 1V5FA 5IP6A 4CXFA 2Z9OA 3HDDA 1MMSA 3TOBA 2OCEA 4U0WA 4D1QA 3M8EA 5CVJA 3FXUA 3MN2A 5D5XB 1VQLI 3FMRA 1TZLA 4I6ZA 2XAFA 1MSEC 1R00A 3KP2A 3V8KA 3CCRI 3ZPLA 2BGCA 1Y56A 2OV7A 2YU9J 2NYXA 3M4OJ 4GDFA 1IAWA 2NRAC 1ZGWA 3CD6I 1TWAJ 4JBAA 5EEHA 2KZVA 1RESA 5F0FA 4E7IA 4PCQA 1IGNA 1HF0A 4C2MJ 3G2BA 4AYBN 4ZYDA 5CPRB 2QLZA 2NVTJ 2GXBA 2VI6A 3RSNA 3K7AJ 3JRIA 5EDNA 3OYLA 3K2AA 1K78B 4MQ9F 4DJAA 2ZNZA 4MNUA 4LITA 4IJAA 2O8XA 3JREA 1F9NA 1JKOC 4XICA 5D5WB 1UELB 4XOTA 4XRSG 4ZH4F 3LOCA 4UB8C 4BS9A 1ZRCA 5DDGA 1QNTA 5J40A 2F48A 1R5ID 1S29A 4RLQA 3D1NI 4YFXF 3IH2A 4Y3OA 2GAUA 2X6YA 2MGQA 1FOWA 2GZWA 4A12A 5E8IA 3K6GA 1VQMI 3CC7I 4BBSJ 2NVQJ 2L2OA 2GA1A 2PFBA 2EILH 1L0OC 2X1EA 4GO1A 3OS2A 4A3LJ 2TRTA 1WGXA 3EUAA 5F64A 3CUQA 3W2WA 3L2QA 3CO7C 4LG0B 2W85A 3PUFA 3E7LA 2V1NA 4YFKF 4C9YA 1N75A 3CP8A 4N0BA 4CCNA 4L9JA 2WADA 1QHGA 3MKLA 3F21A 1ETQA 4PDKA 3ZMZA 3K4CA 3IUOA 2LVSA 5FKOA 5LFAA 2XGEA 3EDPA 1NG6A 1KYWA 3I56I 4KJZA 4RAZA 2VE8A 1HXDA 2EV6A 4A0XA 4XLHA 2F5EA 2GIZA 3J80K 2COBA 2OPTA 1IC8A 2DFHA 3F8FA 1X3UA 1O4XA 5E79C 2VBXA 5FJ8J 1W7PB 2ZO4A 1FMVA 3BZKA 1OISA 4KT6A 1R23A 4KMUX 4IKFA 3FKIJ 5K7FA 1Z77A 3PM1A 5IPAA 2EIJH 1FMWA 2NS8A 2JA2A 5ED4A 3OYFA 5H6RA 3DWLE 2Q2EB 1JJ8C 5L3DA 4A0ZA 1SFUA 2P7VB 4WX9A 4BY7J 3VYSB 1MJAA 2E1NA 2RV8A 3H5AA 1U0JA 3L9FA 5J8FA 1ZTRA 1D0XA 1UJ8A 2LBFA 3DU6A 3TKYA 4FX0A 1OLTA 1LVAA 2XAJA 1T95A 2IW5A 3WE2A 1YOVB 1OR7C 3DPTA 3SQNA 2YS9A 4UUSA 4P1WA 3G6EI 2XGCA 1LB2A 3BR5A 3Q3SA 4GFBA 2HQNA 3CJQB 4A2UA 4L9NA 3FBIB 2DMQA 4JK1X 5K5QA 4NQWB 3PNYA 4RM3A 5B1AH 4KIGA 4PFOA 2KHMA 3K69A 1QPIA 1EH7A 3BC8A 4KN4X 3TO6A 1ORKA 2LSOA 5LD2C 1RUOA 1KGSA 4AVPA 3KP7A 4A3MJ 1VTNC 3HOYJ 1HC8A 4P55A 2MFZA 4HV6A 1VI0A 3CO6C 2X48A 2CV1A 1RPWA 4G6QA 5HLIA 5B66C 1K6OA 2JWTA 3ZMUA 4JX5A 2MSYA 3K70D 1OCRH 2QQBA 4KA4A 1YI2I 2B9SA 3P9KA 1JTXA 4KFCA 1X4OA 2LK2A 2B7EA 1MMDA 5B5EC 3VFZA 3FWEA 4XR6A 3R60A 1VQKI 4I2OA 4JP0A 1D5YA 3T0YA 2VPLA 5H6QA 3Q9SA 1FYLA 4G6DA 4C2UA 1T0FA 2PX9A 3DBRB 4V2FA 3L2WA 1X1BA 3U21A 1QHHD 3QPSA 1PUFB 2VL8A 2EPFA 1YS6A 2IAIA 3KEQA 3TW6A 1IXRC 5EGOA 4UY8I 2KZGA 4CYCA 2WV1A 3GFJA 3CJNA 4PJMA 2Y0MA 1D8KA 2D2WA 2W7NA 2L4MA 3H1CA 2GQQA 1JGSA 4CZCA 3GZNB 2LYCA 2VQGA 2CQXA 1Y1VJ 1IO2A 1IDZA 1R4NB 1BOAA 3S2WA 1XSVA 2LLKA 1Z6RA 3HC7A 2O8KA 2HZTA 1ZRFA 4OAZA 4NBQA 3EUHA 4ENKA 4IX7A 3EUKL 1P9QC 1XGMA 3J7YJ 4XIDA 1LVKA 2IPQX 1S5LC 1A6IA 4I09A 2ICWG 4NNJA 2OAZA 1J09A 5HS9A 3BY6A 3D5LA 4A5NA 1G4DA 1B4AA 4E70A 2FMLA 4U0YA 3W6JB 3GZ5A 3QWLA 2DOFA 3CCSI 1TC3C 1XX5A 4UB6C 3BZ6A 4CZZA 4IRGA 3W6VA 2BY3A 3K10A 5FD6A 5DYMA 4PZJA 1ETVA 2DDAA 3JRCA 2JSPA 3GVAA 3GTJJ 2RGVA 1TWGJ 1G3WA 3DEUA 3M3YJ 1ZG1A 1E2XA 4FE4A 2MC3A 1DUXC 1BN5A 4HQMA 1VQ4I 2EB7A 4CCOA 2KIUA 5LGNA 1K4SA 1H9GA 5C4JJ 2ZJPF 1BW5A 2VODA 2EA4A 3HG9A 5B1BH 5HODA 3LFKA 3ZQFA 4OIPF 1YQAA 2JTVA 2K9MA 4YG2F 2KT0A 3VSLA 3IRRA 4WWCA 1R22A 3CESA 1TWFJ 5EYRA 3CC4I 1MD0A 4R1HA 3K4KA 2JUGA 2HEOA 2VJJA 3OIQA 4ZZLA 5FGMA 3HUGA 2R7FA 4A3EJ 2HQAA 2WAQA 3ABUA 3OYIA 4ENJA 1PUEE 1MDMA 1Q1HA 5FKLA 2OUMA 3C7JA 3ECHA 1B72B 1X1PA 3O2PE 2L9RA 4RB3C 2ISYA 2EBIA 5IYDJ 2DAOA 2ZXIA 4NDLA 3OY9A 5EZGA 4OMYA 3CUOA 2MABA 3C3WA 2K86A 1TWHJ 4G9YA 2Q8KA 2VQHA 3FF5A 2JZYA 3WHCA 2JQ7A 1E0EA 2NS7A 2FNPA 1HKQA 2LKPA 4BNCA 5EG0A 5FLXZ 5L3CA 3HOXJ 3DFGA 2BVMA 2WB1A 3PSFA 3CCJI 5K7ZA 2F2EA 2LD5A 2HR3A 1XPXA 2RKHA 3I64A 2XF5A 5E1WA 3SJMA 2M8GX 5DTDA 4BAYA 2QQ8A 1MJBA 3ISPA 1LE8B 3AL0B 1LDJA 3GUDA 3N97A 1LKXA 2WBMA 3GFMA 4F93B 2VOOA 1YO5C 1D0ZA 1ZN2A 4A3DJ 2J5OA 4C3IJ 4D5FA 4ENNA 2R7OA 3L7WA 2P5KA 1YITI 1CQTA 3BLYA 4A6DA 1V5GA 3P9IA 4Y4RA 2Z1DA 5CQEA 4BDZA 1XDSA 4FISA 1SD7A 2H1LA 4HF1A 2E1OA 2FE3A 4LLLA 2NOJB 2H27A 2F4IA 5KCMA 1N78A 3HJEA 4A3CJ 1WWXA 1S7AA 3U1DA 4CYDA 2DA5A 3BG6A 1XGSA 5CKTA 4C2TA 4AM3A 4Q5SF 2VQCA 1NH3A 1RIOH 1QU3A 3OWTA 1JXSA 1P2FA 5J1YA 3BTCA 2AQEA 1OMIA 1R6RA 1IW7F 1XMAA 2IEKA 1ETXA 3V7SA 4U0VA 5JI6A 3KLNA 3TW7A 4QWQA 5TJJA 3PFIA 4WF2A 3HSEA 3GTQJ 2QBYB 1JT6A 4NC8A 1N25A 1MMGA 3QODA 2HKOA 1MIJA 2XV4S 3BTLA 1IN5A 3DKYA 4BE1A 2OZUA 3S2DJ 4LG3A 4XRFA 4BH9A 3I0TA 3Q0UA 1TTYA 2UUZA 2P7CB 3PL8A 3BR0A 2HOAA 1IN8A 4UNOA 1ONVA 1EKEA 3TP3A 2R7TA 2XRNA 4V2GA 1T98A 3FX3A 1FWZA 4J00A 3L1PA 3FKJA 1I3AA 4RB1A 4L0ZB 3OR1C 2DBBA 1FBQA 3NAUA 4Y15A 3FXMA 3WTXC 3CF2A 3ELKA 2C6YA 4JOMA 1WJCA 2DMTA 4L0YB 3HYIA 5K5OA 1Z05A 2PLYA 4JYKA 2GXAA 2W84A 2D45A 3HSRA 5ICFA 5D4RA 5BNGA 2XB5A 4DGWB 1B8IA 2ELJA 4G7OF
chains in the Genus database with same CATH topology
3ROUA 5JVTA 4HYEA 3SHFA 3NEUA 3O3KA 1ZREA 1BI3A 4XBFA 1L3LA 4M9SA 1S8NA 4EM0B 3F8MA 4AWXB 1DPUA 1FC3A 2O6GE 3RJPA 1CF7A 2F5DA 2EFWA 5A2QZ 3PQKA 2MD5A 1IRGA 1SAXA 1YW9A 3RKXA 3K0LA 1PDNC 3LAJA 3EETA 2Y75A 2EA2A 2G7UA 2QQAA 1OYIA 4IVNA 1XN7A 1P4AA 4M6YA 5FLXK 2RDPA 2M87A 3M1EA 3DKWA 4KUMA 1FX7A 5LRRA 3QRFF 3LQQA 4N9HA 3WU1B 1U78A 3BJ6A 4HX8A 2RN7A 1J75A 4G8XA 1I1SA 1G3TA 2A61A 2YX7A 4KT5C 1U6GA 3L2CA 3KZYA 4G94A 4O6JA 1JE8A 4HV5A 5D5UB 3GX4X 5JHUA 4MHGA 5ILUA 5LGTA 4MQVA 1LEBA 2CG4A 1SD6A 4RB2C 4K2EA 2FBHA 1KU2A 2VT2A 1R5GA 3BROA 4HDUA 1ZLJA 4L5IA 2ZMEB 1Z6TA 1HSJA 4UVAA 1UCRA 3HTUA 2DT5A 4GYIA 1IUYA 2A3SA 3EQLF 5DUIA 4MTEA 2WTEA 2DLLA 4HAMA 1UB9A 2FU4A 3TOAA 1W7PD 1G3SA 4S05A 3HRSA 2Y48A 2Z5UA 4LK1F 4BHBA 5HLHA 1PP8F 2V1XA 4I0AA 4RGXA 2M30A 2ZXJA 1U5TA 2F5FA 2KRFA 4N9IA 2HYFA 4HX7A 1T38A 3KP3A 5HS7A 1FP2A 2DO7A 3AAFA 2YX4A 3GW2A 4IXAA 3MWMA 3LAPA 4GCVA 2W57A 3GFIA 3QOPA 2W24A 3R0JA 4HX4A 1QZZA 1IRFA 4GYGA 3M8FA 5HVQC 1ON1A 5DCMB 3JSPA 5CYVA 2CGPA 4H0EA 1KQ9A 3WTZA 4WK8F 2CSOA 1J5YA 1TBXA 1B59A 4XLPF 3DP7A 2H6CA 2GIVA 1AOYA 1DP7P 5L3FA 3G73A 2KIFA 2UXXA 5ERIA 3RDIA 5A2QK 2A69F 1KA8A 3IWZA 1J9IA 2O0YA 3FM5A 1GXPA 5F6FA 3HHGA 2MH2A 3RKYA 2DFIA 1YW8A 5E1ZB 2P8TA 1K79A 4RGUA 3GZ6A 3WU0A 1D3YA 2DK8A 3ZN1A 2KJCA 3QPHA 5CVVA 1B6AA 3I59B 1USSA 3VB2A 1FBUA 4XLNF 4Q47A 4Z2YA 2RQPA 1ZARA 3TDUC 4OIRF 5TRDA 5DD8A 4M6XA 2FXAA 5DEQA 1J2XA 4O5VA 1Z9CA 2V1DA 4MGRA 1O7LA 2VE9A 4P9FA 3ECOA 4GXOA 3TGNA 1GVJA 4MEYF 3BWGA 1ZYRF 1HW1A 4AIKA 3GXOA 3LQRA 1FY7A 3TQNA 3KEOA 2RC4A 3JW4A 3E6DA 3IKVA 2CW0F 3F8BA 5D8LB 4UV9A 2P6TA 4G7ZF 1HKTA 4EMSA 4P9UA 1YW7A 2HDCA 4EM2A 2Z33A 5H20A 3ZMDA 3ZN0A 2PMUA 4M9XA 2R7DA 4BYYA 2YSRA 5E18F 3REOA 3WGIA 2CO5A 4RAYA 4A5MA 5CJ9A 4RB0A 2OQRA 4NHJA 2HWVA 3RPUA 3FXRA 2LNBA 4M72A 3RPQA 2UWMA 2KJBA 2X0LA 1CGPA 2K02A 5AONA 1SFXA 4LFUA 3ZMTA 4CDGA 5IT3A 1OR7A 4EVIA 3KETA 3Q5FA 4ZYHA 1OKRA 1Y0UA 5E17F 1BI1A 2H6BA 1B9NA 2VT3A 5E1XA 3P9CA 4I7HA 2STTA 2FSWA 4I98B 2NNNA 4OOIA 1FZPB 1BI0A 4NB5A 3F72A 1YIOA 3GFLA 2EWNA 4L5JA 1K78A 2W25A 2OQGA 3WTTC 5K1YA 2OZ6A 3ZMSA 2AXLA 1SD4A 2NAZA 3QAHA 1LDKB 2FOKA 4FHTA 3LA3A 2HKXA 4EV0A 2FNAA 2JSCA 2VBYA 4HDVA 1KQ8A 1D5VA 5J6XA 4LG0A 5HS8A 3FXQA 2XKPA 2OBPA 1XD7A 4AIJA 1KU9A 4HF2A 4HF0A 5J8CA 4M73A 2J5PA 2B0LA 5LHIA 2HFHA 2EFOA 4UVBA 2FBIA 2WWYA 5D4SA 4PGGA 5HDNA 4L9VA 3HIFA 3NQOA 1J7KA 4P5OA 5HDGA 1S7OA 3F3XA 1W7PA 1IZ1A 2BBYA 3H3ZA 1IF1A 4JQFA 2UZKA 5L3EA 2QM3A 4I01A 2Q2EA 3JSOA 3WG9A 4U7BA 5ICCA 3E6CC 2NNYA 1E17A 3K1NA 1T2KA 2YR2A 5L3GA 1B9MA 4TV7A 4RGSA 3MCZA 3LSTA 2PN6A 2FQ3A 2XKOA 2M8EA 4NQWA 3MAJA 3I54A 4ZZDA 1PP7U 2V1UA 4BQAA 1BIAA 1T39A 3I4PA 3JTGA 2L54A 1ZGAA 2QZ8A 2BEOA 2EFNA 1F1ZA 3EYIA 2OD5A 1WKMA 3DPLC 4U88A 3COAC 4FT8A 4Q4ZF 4M74A 5HOOA 4A6EA 3SZTA 4UVCA 3E97A 1XSXA 1B1BA 4QLCU 4LD5A 4KIBA 1AWCA 2DK5A 2VONA 4CO8A 3EYYA 2Z3YA 1LEAA 3K1PA 2P6SA 1ON2A 2MLKA 5JFRA 2PBIA 5AIQA 1GHCA 2RNJA 2YPRA 3TDZC 4Y17A 3WGHA 1RZ4A 3B73A 4ETSA 1ODDA 4WXCA 4GGGA 6PAXA 3I5UA 3TO9A 4LJZF 4ESFA 4AD9A 3WTSC 2FMYA 3LWFA 2FF4A 1Z1DA 4EJWA 3QU6A 4OINF 4UUVA 4KDPA 4ESJA 4B09A 1WRJA 1XCVA 3WTYC 1STZA 5D6EA 2LDUA 3IWFA 3CTAA 1FP1D 3H92A 2H94A 4OU0A 3GLXA 2H09A 4OIOF 4KYWA 1UFMA 3LA2A 1WI9A 5LLQA 3F22A 4PGHA 3V4GA 3CUQB 2ESNA 1DPRA 1P4XA 2FEZA 4OIQF 3G3ZA 2XHKA 2Z99A 1ZRDA 3BJAA 1HKSA 3WTVC 4EGYA 5FB2A 2XVCA 1EH6A 3ULQB 3GYHX 1XSDA 2E1CA 1RUNA 1G3YA 2K7LA 2MA3A 1TW2A 4HBLA 4ASNA 2HQRA 4LGWA 1O57A 1U8RA 3WGGA 4XSXF 5BPDA 5IT9Z 1HW5A 4CICA 1EV7A 2A68F 3W6KB 5DD4A 4EJTA 3ERED 2IA2A 1O7FA 3R6SA 2VXZA 4YFNF 3HRTA 3BPXA 1IN6A 1R1TA 2ESHA 4LB6B 2VBWA 2GWRA 5CVRA 2QVOA 1FLIA 2PQ8A 2LF8A 3E6BA 1TNTA 2O03A 2EV5A 1Z91A 5BS6A 4U7DA 2JRTA 2XAHA 1HBXG 4HLXA 1ZGJA 3WTUC 1BM9A 1FYMA 1R1UA 1TW3A 2QBYA 3HOTA 3CDHA 2WC2A 3J7AO 5BOXA 5KK1A 2DI3A 5LGUA 3FZVA 1ZH5A 3RYPA 3KZZA 1GXQA 3WODF 3CUQC 2QWWA 1JHHA 1P92A 3F8CA 2BE5F 2OA4A 3ZQ7A 3K1MA 1KQ0A 4DNCA 4IRHA 4L9TA 1FOKA 4EGZA 4ENMA 2HTSA 3M9AA 3WTWC 1G6NA 2ETHA 3L00A 5BPIA 4UXNA 2QYOA 1KU3A 3GO5A 4Q48A 3N4MA 1IN7A 2XAGA 2PI0A 1XGNA 2EFQA 4ESBA 2V9VA 5D8KB 3J81Z 2E7WA 1LNWA 1F5TA 5E20A 2M45A 3L09A 4R79A 3QP6A 1HQCA 1LJ9A 3I71A 4FX4A 3ZMVA 1YG2A 2VBZA 3F6VA 3T1BA 1I6XA 2M5WA 4EQQA 5LEJA 2K4BA 3TO7A 2GXGA 2P5LC 1QBJA 2L3DA 1WSUA 3BJOA 3F23A 3DQVC 4KN7X 5K5RA 1U2WA 1YS7A 2STWA 4IRIA 1XDUA 5FFZA 5LEKA 2VN2A 2WV0A 3OV8A 1TQIA 4LMYA 2X4HA 1MDMB 3O6BB 2IRFG 2GA2A 3HTSB 4EJVA 2KIMA 1H9TA 4HW0A 1XB4A 2FRHA 3HHHA 1FYKA 3RKWA 5IT9K 2HS5A 1KU7A 4F7ZA 3RI4A 1MGTA 3DF8A 5F1RA 2A5YB 4IHTA 4BHPA 2DQLA 1P4WA 3C1DA 2LF7A 3V7RA 1RI7A 2JPCA 1REPC 4WXHA 3E6MA 3DV8A 4AIHA 4XSZF 3V8JA 5D6FA 2ZMEA 2CFXA 3H3UA 3SZPA 3QPTA 1C0WA 1T6SA 4A0YA 1Z7UA 3E3VA 1ULYA 3HRMA 3KP4A 2ELHA 1FT9A 5ILSA 2YU3A 4OMZA 2HTJA 1LQ1A 1V4RA 2MH9A 2OU2A 1QQIA 1TLHB 3DXJF 4I02A 2EFPA 1FNNA 1YLFA 2XROA 2V79A 4UV8A 2CWEA 3B02A 3V7CA 3BOQA 3KCCA 2BYVE 1SD5A 1W5TA 1SMTA 1R5HA 1UHWA 4MTDA 2PMHA 4IPAA 3ZP5A 2XAQA 5BMZA 5DCMA 1MZBA 2PEXA 4WXDA 3BPVA 3RTRA 1TNSA 2MBFA 3KP6A 2IA0A 4HLYA 3J81K 4MEXF 1QGPA 1ZG5A 4ZYEA 3IHUA 5HLGA 2A07F 3SXYA 3T5XA 5BQTA 2DQRA 4O3MA 1SMYF 2FBKA 2M1BA 3IC7A 4Y13A 1IXSB 1ZLKA 1BJAA 2HYGD 1IXCA 4LLGF 1O3QA 1R36A 4M71A 3R61A 1I27A 3HRUA 1CF7B 2ISZA 2VOPA 2IJLA 5DV5A 4M9ZA 4LB5A 2K4JA 4EJOA 4LK0F 1YTYA 5LHGA 4G7HF 3I59A 3R4KA 4UHTA 4B8XA 2IT0A 3M7GA 3WE3A 5E8GA 1U3EM 5DCFA 2XGXA 5CVUA 2NS0A 1ZHFA 3CLOA 1I5ZA 3C18A 2L02A 1O3TA 4HOBA 1DDNA 1OPCA 1WQ2A 4BHCA 5EEGA 1YFHA 3IKTA 3E5XA 2CYYA 1BI2A 4IF4A 3PQJA 4L18B 2ZBKA 1TQPA 5FD5A 2QUFA 3MQ0A 4EM1A 5ILVA 1BIBA 1TQMA 1XGOA 1BBYA 2ZKZA 5DUKA 4LLNA 1MJ9A 4KMFA 2UXNA 4HA8A 1HSTA 3QU3A 4P96A 2F5CA 3FMSA 2D1HA 2EJRA 1F4KA 1SFEA 1A04A 1O3SA 3JAMZ 5ICEA 2COMA 1YYVA 1W4MA 1NHAA 1U5TB 3KP5A 4CHUA 1D8JA 5CVIA 4KNYA 4BXUA 3KE2A 1J59A 2G7HA 2D1VA 1BC7C 5L3BA 2MLGA 1KYZA 2CQKA 2JPBA 2TDXA 3VODA 3K9TA 3FMQA 3KFWX 3I58A 2IVMA 5KVRA 2L4AA 2VC0A 5JR3A 3FM3A 4KIFA 1P6RA 2ZNYA 1ZAOA 3HOSA 2P5VA 2XIGA 2QENA 5D5VB 3I53A 2EK5A 4S04A 3GF2A 2O61A 2ZFWA 4RS8A 2XUBA 4ON0A 2DPDA 2Q0OA 1UHMA 3V8LA 2DW4A 1FSHA 2ADUA 1K7AA 3P7NA 3GEZA 1USTA 3OOPA 4R8HA 4ZYGA 4YIIA 5FFXA 1J0RA 3LA7A 4HZFA 3D0SA 3MZHA 5CLSA 1W5SA 2L01A 2G9WA 1QO0D 4HQEA 2IP2A 3E5QA 3RYRA 1S3JA 1FSEA 1FPQA 3F6OA 5ICGA 3U2RA 2QQ9A 4EJUA 3BP8A 4IHSA 3KLOA 1OYYA 2K27A 5LBQA 1HW2A 3U9GA 3JTHA 1O3RA 2PJPA 1V3FA 5AIPA 1QZYA 2R3SA 3ML6A 4KICA 4YIFA 3GWZA 1U5TC 4D0PA 3RIRA 2PG4A 3F8NA 3E5UA 3K2ZA 2KKOA 1R58A 2VC1A 3J80Z 4CGZA 1R1VA 2ZCWA 1LDDA 5HDKA 3SFZA 1FBSA 1IN4A 3QP5A 3T8RA 1XMKA 1RNLA 2P4WA 1BC8C 3VEPA 1ZG3A 2BV6A 2DTRA 1OYWA 1S6LA 3VOEA 1QPMA 3ABTA 2AS5F 3IL2A 2ZJ2A 3JAMK 2V6CA 3MZYA 2JT1A 1EH8A 4WCGA 2HOEA 4I0BA 1I1GA 2O3FA 3T8TA 2E7XA 1XCBA 2ACJA 2A6EF 2EV0A 2RVCA 2DU9A 3MFKA 4RGRA 2HGCA 5LHHA 3R0AA 3Q9VA 3IRQA 4DQ2A 1H0MA 1R7JA 3NRVA 1JHFA 3MEXA 3HSFA 5LRSA 5FO5A 3FHZA 3BDDA 2A6HF 2DPUA 2XASA 1MKMA 2IA1A 2FA5A 4CXFA 2Z9OA 3TOBA 4U0WA 3M8EA 5CVJA 3FXUA 5D5XB 3FMRA 2XAFA 1R00A 3KP2A 3V8KA 3ZPLA 2BGCA 2NYXA 1IAWA 2NRAC 4JBAA 5EEHA 4PCQA 4ZYDA 2QLZA 2GXBA 1K78B 4MQ9F 2ZNZA 4MNUA 4IJAA 2O8XA 1F9NA 5D5WB 4ZH4F 1ZRCA 5DDGA 1QNTA 1S29A 4YFXF 2GAUA 2GZWA 4A12A 5E8IA 2GA1A 2PFBA 4GO1A 1L0OC 5F64A 3CUQA 3CO7C 4LG0B 2W85A 4YFKF 4N0BA 4L9JA 3F21A 4PDKA 3ZMZA 3EDPA 1KYWA 4RAZA 2VE8A 1HXDA 2EV6A 4A0XA 2F5EA 3J80K 3F8FA 1X3UA 2VBXA 1W7PB 2ZO4A 1R23A 4KMUX 5ED4A 5H6RA 5L3DA 4A0ZA 1SFUA 2P7VB 4WX9A 1MJAA 2E1NA 2RV8A 3L9FA 5J8FA 3TKYA 4FX0A 1LVAA 2XAJA 2IW5A 3WE2A 3DPTA 3SQNA 1LB2A 2HQNA 4A2UA 4L9NA 4JK1X 5K5QA 4KIGA 3K69A 1EH7A 4KN4X 3TO6A 2LSOA 1RUOA 1KGSA 4AVPA 3KP7A 1VTNC 4P55A 4HV6A 3CO6C 4G6QA 5HLIA 1K6OA 3ZMUA 4KA4A 2QQBA 3P9KA 4KFCA 3VFZA 3FWEA 3R60A 4I2OA 3T0YA 5H6QA 3Q9SA 1FYLA 4G6DA 1T0FA 1YS6A 3KEQA 1IXRC 3GFJA 3CJNA 2Y0MA 1D8KA 2D2WA 2L4MA 2GQQA 1JGSA 1BOAA 3S2WA 1XSVA 1Z6RA 2HZTA 1ZRFA 3EUHA 4ENKA 1XGMA 2IPQX 4I09A 2OAZA 5HS9A 3BY6A 3D5LA 4A5NA 1G4DA 1B4AA 4E70A 2FMLA 4U0YA 3W6JB 3GZ5A 3BZ6A 4CZZA 4IRGA 5FD6A 5DYMA 4PZJA 3GVAA 2RGVA 3DEUA 1G3WA 1ZG1A 1E2XA 2MC3A 1DUXC 1BN5A 4HQMA 2EB7A 2KIUA 5LGNA 1H9GA 2VODA 2EA4A 3LFKA 4OIPF 1YQAA 2JTVA 4YG2F 3IRRA 4WWCA 1R22A 1MD0A 4R1HA 2HEOA 4ZZLA 5FGMA 3HUGA 2R7FA 3ABUA 4ENJA 1PUEE 1MDMA 1Q1HA 3C7JA 3ECHA 3O2PE 4RB3C 2ISYA 2DAOA 4OMYA 3CUOA 3C3WA 2K86A 4G9YA 2Q8KA 3FF5A 2JZYA 2FNPA 1HKQA 2LKPA 4BNCA 5FLXZ 5L3CA 3DFGA 2F2EA 2HR3A 2RKHA 3I64A 5E1WA 4BAYA 1MJBA 3ISPA 1LDJA 3GUDA 3N97A 3GFMA 2VOOA 1YO5C 1ZN2A 2J5OA 4ENNA 3L7WA 2P5KA 4A6DA 3P9IA 1XDSA 1SD7A 4HF1A 2FE3A 4LLLA 2H27A 1WWXA 1S7AA 3U1DA 4CYDA 4Q5SF 1XGSA 1RIOH 1JXSA 1P2FA 1OMIA 1IW7F 1XMAA 3V7SA 4U0VA 5JI6A 3KLNA 4QWQA 5TJJA 3PFIA 4WF2A 3HSEA 2QBYB 2HKOA 2XV4S 1IN5A 2OZUA 4XRFA 4BH9A 3I0TA 1TTYA 2P7CB 1IN8A 4UNOA 1ONVA 2XRNA 1T98A 3FX3A 1FWZA 4RB1A 4L0ZB 2DBBA 1FBQA 4Y15A 3WTXC 3ELKA 2C6YA 4L0YB 3HYIA 5K5OA 1Z05A 2PLYA 2W84A 2D45A 3HSRA 5ICFA 5D4RA 4G7OF
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3ROU A;  5JVT A;  4HYE A;  3SHF A;  3NEU A;  3O3K A;  1ZRE A;  1BI3 A;  4XBF A;  1L3L A;  4M9S A;  1S8N A;  4EM0 B;  3F8M A;  4AWX B;  1DPU A;  1FC3 A;  2O6G E;  3RJP A;  1CF7 A;  2F5D A;  2EFW A;  5A2Q Z;  3PQK A;  2MD5 A;  1IRG A;  1SAX A;  1YW9 A;  3RKX A;  3K0L A;  1PDN C;  3LAJ A;  3EET A;  2Y75 A;  2EA2 A;  2G7U A;  2QQA A;  1OYI A;  4IVN A;  1XN7 A;  1P4A A;  4M6Y A;  5FLX K;  2RDP A;  2M87 A;  3M1E A;  3DKW A;  4KUM A;  1FX7 A;  5LRR A;  3QRF F;  3LQQ A;  4N9H A;  3WU1 B;  1U78 A;  3BJ6 A;  4HX8 A;  2RN7 A;  1J75 A;  4G8X A;  1I1S A;  1G3T A;  2A61 A;  2YX7 A;  4KT5 C;  1U6G A;  3L2C A;  3KZY A;  4G94 A;  4O6J A;  1JE8 A;  4HV5 A;  5D5U B;  3GX4 X;  5JHU A;  4MHG A;  5ILU A;  5LGT A;  4MQV A;  1LEB A;  2CG4 A;  1SD6 A;  4RB2 C;  4K2E A;  2FBH A;  1KU2 A;  2VT2 A;  1R5G A;  3BRO A;  4HDU A;  1ZLJ A;  4L5I A;  2ZME B;  1Z6T A;  1HSJ A;  4UVA A;  1UCR A;  3HTU A;  2DT5 A;  4GYI A;  1IUY A;  2A3S A;  3EQL F;  5DUI A;  4MTE A;  2WTE A;  2DLL A;  4HAM A;  1UB9 A;  2FU4 A;  3TOA A;  1W7P D;  1G3S A;  4S05 A;  3HRS A;  2Y48 A;  2Z5U A;  4LK1 F;  4BHB A;  5HLH A;  1PP8 F;  2V1X A;  4I0A A;  4RGX A;  2M30 A;  2ZXJ A;  1U5T A;  2F5F A;  2KRF A;  4N9I A;  2HYF A;  4HX7 A;  1T38 A;  3KP3 A;  5HS7 A;  1FP2 A;  2DO7 A;  3AAF A;  2YX4 A;  3GW2 A;  4IXA A;  3MWM A;  3LAP A;  4GCV A;  2W57 A;  3GFI A;  3QOP A;  2W24 A;  3R0J A;  4HX4 A;  1QZZ A;  1IRF A;  4GYG A;  3M8F A;  5HVQ C;  1ON1 A;  5DCM B;  3JSP A;  5CYV A;  2CGP A;  4H0E A;  1KQ9 A;  3WTZ A;  4WK8 F;  2CSO A;  1J5Y A;  1TBX A;  1B59 A;  4XLP F;  3DP7 A;  2H6C A;  2GIV A;  1AOY A;  1DP7 P;  5L3F A;  3G73 A;  2KIF A;  2UXX A;  5ERI A;  3RDI A;  5A2Q K;  2A69 F;  1KA8 A;  3IWZ A;  1J9I A;  2O0Y A;  3FM5 A;  1GXP A;  5F6F A;  3HHG A;  2MH2 A;  3RKY A;  2DFI A;  1YW8 A;  5E1Z B;  2P8T A;  1K79 A;  4RGU A;  3GZ6 A;  3WU0 A;  1D3Y A;  2DK8 A;  3ZN1 A;  2KJC A;  3QPH A;  5CVV A;  1B6A A;  3I59 B;  1USS A;  3VB2 A;  1FBU A;  4XLN F;  4Q47 A;  4Z2Y A;  2RQP A;  1ZAR A;  3TDU C;  4OIR F;  5TRD A;  5DD8 A;  4M6X A;  2FXA A;  5DEQ A;  1J2X A;  4O5V A;  1Z9C A;  2V1D A;  4MGR A;  1O7L A;  2VE9 A;  4P9F A;  3ECO A;  4GXO A;  3TGN A;  1GVJ A;  4MEY F;  3BWG A;  1ZYR F;  1HW1 A;  4AIK A;  3GXO A;  3LQR A;  1FY7 A;  3TQN A;  3KEO A;  2RC4 A;  3JW4 A;  3E6D A;  3IKV A;  2CW0 F;  3F8B A;  5D8L B;  4UV9 A;  2P6T A;  4G7Z F;  1HKT A;  4EMS A;  4P9U A;  1YW7 A;  2HDC A;  4EM2 A;  2Z33 A;  5H20 A;  3ZMD A;  3ZN0 A;  2PMU A;  4M9X A;  2R7D A;  4BYY A;  2YSR A;  5E18 F;  3REO A;  3WGI A;  2CO5 A;  4RAY A;  4A5M A;  5CJ9 A;  4RB0 A;  2OQR A;  4NHJ A;  2HWV A;  3RPU A;  3FXR A;  2LNB A;  4M72 A;  3RPQ A;  2UWM A;  2KJB A;  2X0L A;  1CGP A;  2K02 A;  5AON A;  1SFX A;  4LFU A;  3ZMT A;  4CDG A;  5IT3 A;  1OR7 A;  4EVI A;  3KET A;  3Q5F A;  4ZYH A;  1OKR A;  1Y0U A;  5E17 F;  1BI1 A;  2H6B A;  1B9N A;  2VT3 A;  5E1X A;  3P9C A;  4I7H A;  2STT A;  2FSW A;  4I98 B;  2NNN A;  4OOI A;  1FZP B;  1BI0 A;  4NB5 A;  3F72 A;  1YIO A;  3GFL A;  2EWN A;  4L5J A;  1K78 A;  2W25 A;  2OQG A;  3WTT C;  5K1Y A;  2OZ6 A;  3ZMS A;  2AXL A;  1SD4 A;  2NAZ A;  3QAH A;  1LDK B;  2FOK A;  4FHT A;  3LA3 A;  2HKX A;  4EV0 A;  2FNA A;  2JSC A;  2VBY A;  4HDV A;  1KQ8 A;  1D5V A;  5J6X A;  4LG0 A;  5HS8 A;  3FXQ A;  2XKP A;  2OBP A;  1XD7 A;  4AIJ A;  1KU9 A;  4HF2 A;  4HF0 A;  5J8C A;  4M73 A;  2J5P A;  2B0L A;  5LHI A;  2HFH A;  2EFO A;  4UVB A;  2FBI A;  2WWY A;  5D4S A;  4PGG A;  5HDN A;  4L9V A;  3HIF A;  3NQO A;  1J7K A;  4P5O A;  5HDG A;  1S7O A;  3F3X A;  1W7P A;  1IZ1 A;  2BBY A;  3H3Z A;  1IF1 A;  4JQF A;  2UZK A;  5L3E A;  2QM3 A;  4I01 A;  2Q2E A;  3JSO A;  3WG9 A;  4U7B A;  5ICC A;  3E6C C;  2NNY A;  1E17 A;  3K1N A;  1T2K A;  2YR2 A;  5L3G A;  1B9M A;  4TV7 A;  4RGS A;  3MCZ A;  3LST A;  2PN6 A;  2FQ3 A;  2XKO A;  2M8E A;  4NQW A;  3MAJ A;  3I54 A;  4ZZD A;  1PP7 U;  2V1U A;  4BQA A;  1BIA A;  1T39 A;  3I4P A;  3JTG A;  2L54 A;  1ZGA A;  2QZ8 A;  2BEO A;  2EFN A;  1F1Z A;  3EYI A;  2OD5 A;  1WKM A;  3DPL C;  4U88 A;  3COA C;  4FT8 A;  4Q4Z F;  4M74 A;  5HOO A;  4A6E A;  3SZT A;  4UVC A;  3E97 A;  1XSX A;  1B1B A;  4QLC U;  4LD5 A;  4KIB A;  1AWC A;  2DK5 A;  2VON A;  4CO8 A;  3EYY A;  2Z3Y A;  1LEA A;  3K1P A;  2P6S A;  1ON2 A;  2MLK A;  5JFR A;  2PBI A;  5AIQ A;  1GHC A;  2RNJ A;  2YPR A;  3TDZ C;  4Y17 A;  3WGH A;  1RZ4 A;  3B73 A;  4ETS A;  1ODD A;  4WXC A;  4GGG A;  6PAX A;  3I5U A;  3TO9 A;  4LJZ F;  4ESF A;  4AD9 A;  3WTS C;  2FMY A;  3LWF A;  2FF4 A;  1Z1D A;  4EJW A;  3QU6 A;  4OIN F;  4UUV A;  4KDP A;  4ESJ A;  4B09 A;  1WRJ A;  1XCV A;  3WTY C;  1STZ A;  5D6E A;  2LDU A;  3IWF A;  3CTA A;  1FP1 D;  3H92 A;  2H94 A;  4OU0 A;  3GLX A;  2H09 A;  4OIO F;  4KYW A;  1UFM A;  3LA2 A;  1WI9 A;  5LLQ A;  3F22 A;  4PGH A;  3V4G A;  3CUQ B;  2ESN A;  1DPR A;  1P4X A;  2FEZ A;  4OIQ F;  3G3Z A;  2XHK A;  2Z99 A;  1ZRD A;  3BJA A;  1HKS A;  3WTV C;  4EGY A;  5FB2 A;  2XVC A;  1EH6 A;  3ULQ B;  3GYH X;  1XSD A;  2E1C A;  1RUN A;  1G3Y A;  2K7L A;  2MA3 A;  1TW2 A;  4HBL A;  4ASN A;  2HQR A;  4LGW A;  1O57 A;  1U8R A;  3WGG A;  4XSX F;  5BPD A;  5IT9 Z;  1HW5 A;  4CIC A;  1EV7 A;  2A68 F;  3W6K B;  5DD4 A;  4EJT A;  3ERE D;  2IA2 A;  1O7F A;  3R6S A;  2VXZ A;  4YFN F;  3HRT A;  3BPX A;  1IN6 A;  1R1T A;  2ESH A;  4LB6 B;  2VBW A;  2GWR A;  5CVR A;  2QVO A;  1FLI A;  2PQ8 A;  2LF8 A;  3E6B A;  1TNT A;  2O03 A;  2EV5 A;  1Z91 A;  5BS6 A;  4U7D A;  2JRT A;  2XAH A;  1HBX G;  4HLX A;  1ZGJ A;  3WTU C;  1BM9 A;  1FYM A;  1R1U A;  1TW3 A;  2QBY A;  3HOT A;  3CDH A;  2WC2 A;  3J7A O;  5BOX A;  5KK1 A;  2DI3 A;  5LGU A;  3FZV A;  1ZH5 A;  3RYP A;  3KZZ A;  1GXQ A;  3WOD F;  3CUQ C;  2QWW A;  1JHH A;  1P92 A;  3F8C A;  2BE5 F;  2OA4 A;  3ZQ7 A;  3K1M A;  1KQ0 A;  4DNC A;  4IRH A;  4L9T A;  1FOK A;  4EGZ A;  4ENM A;  2HTS A;  3M9A A;  3WTW C;  1G6N A;  2ETH A;  3L00 A;  5BPI A;  4UXN A;  2QYO A;  1KU3 A;  3GO5 A;  4Q48 A;  3N4M A;  1IN7 A;  2XAG A;  2PI0 A;  1XGN A;  2EFQ A;  4ESB A;  2V9V A;  5D8K B;  3J81 Z;  2E7W A;  1LNW A;  1F5T A;  5E20 A;  2M45 A;  3L09 A;  4R79 A;  3QP6 A;  1HQC A;  1LJ9 A;  3I71 A;  4FX4 A;  3ZMV A;  1YG2 A;  2VBZ A;  3F6V A;  3T1B A;  1I6X A;  2M5W A;  4EQQ A;  5LEJ A;  2K4B A;  3TO7 A;  2GXG A;  2P5L C;  1QBJ A;  2L3D A;  1WSU A;  3BJO A;  3F23 A;  3DQV C;  4KN7 X;  5K5R A;  1U2W A;  1YS7 A;  2STW A;  4IRI A;  1XDU A;  5FFZ A;  5LEK A;  2VN2 A;  2WV0 A;  3OV8 A;  1TQI A;  4LMY A;  2X4H A;  1MDM B;  3O6B B;  2IRF G;  2GA2 A;  3HTS B;  4EJV A;  2KIM A;  1H9T A;  4HW0 A;  1XB4 A;  2FRH A;  3HHH A;  1FYK A;  3RKW A;  5IT9 K;  2HS5 A;  1KU7 A;  4F7Z A;  3RI4 A;  1MGT A;  3DF8 A;  5F1R A;  2A5Y B;  4IHT A;  4BHP A;  2DQL A;  1P4W A;  3C1D A;  2LF7 A;  3V7R A;  1RI7 A;  2JPC A;  1REP C;  4WXH A;  3E6M A;  3DV8 A;  4AIH A;  4XSZ F;  3V8J A;  5D6F A;  2ZME A;  2CFX A;  3H3U A;  3SZP A;  3QPT A;  1C0W A;  1T6S A;  4A0Y A;  1Z7U A;  3E3V A;  1ULY A;  3HRM A;  3KP4 A;  2ELH A;  1FT9 A;  5ILS A;  2YU3 A;  4OMZ A;  2HTJ A;  1LQ1 A;  1V4R A;  2MH9 A;  2OU2 A;  1QQI A;  1TLH B;  3DXJ F;  4I02 A;  2EFP A;  1FNN A;  1YLF A;  2XRO A;  2V79 A;  4UV8 A;  2CWE A;  3B02 A;  3V7C A;  3BOQ A;  3KCC A;  2BYV E;  1SD5 A;  1W5T A;  1SMT A;  1R5H A;  1UHW A;  4MTD A;  2PMH A;  4IPA A;  3ZP5 A;  2XAQ A;  5BMZ A;  5DCM A;  1MZB A;  2PEX A;  4WXD A;  3BPV A;  3RTR A;  1TNS A;  2MBF A;  3KP6 A;  2IA0 A;  4HLY A;  3J81 K;  4MEX F;  1QGP A;  1ZG5 A;  4ZYE A;  3IHU A;  5HLG A;  2A07 F;  3SXY A;  3T5X A;  5BQT A;  2DQR A;  4O3M A;  1SMY F;  2FBK A;  2M1B A;  3IC7 A;  4Y13 A;  1IXS B;  1ZLK A;  1BJA A;  2HYG D;  1IXC A;  4LLG F;  1O3Q A;  1R36 A;  4M71 A;  3R61 A;  1I27 A;  3HRU A;  1CF7 B;  2ISZ A;  2VOP A;  2IJL A;  5DV5 A;  4M9Z A;  4LB5 A;  2K4J A;  4EJO A;  4LK0 F;  1YTY A;  5LHG A;  4G7H F;  3I59 A;  3R4K A;  4UHT A;  4B8X A;  2IT0 A;  3M7G A;  3WE3 A;  5E8G A;  1U3E M;  5DCF A;  2XGX A;  5CVU A;  2NS0 A;  1ZHF A;  3CLO A;  1I5Z A;  3C18 A;  2L02 A;  1O3T A;  4HOB A;  1DDN A;  1OPC A;  1WQ2 A;  4BHC A;  5EEG A;  1YFH A;  3IKT A;  3E5X A;  2CYY A;  1BI2 A;  4IF4 A;  3PQJ A;  4L18 B;  2ZBK A;  1TQP A;  5FD5 A;  2QUF A;  3MQ0 A;  4EM1 A;  5ILV A;  1BIB A;  1TQM A;  1XGO A;  1BBY A;  2ZKZ A;  5DUK A;  4LLN A;  1MJ9 A;  4KMF A;  2UXN A;  4HA8 A;  1HST A;  3QU3 A;  4P96 A;  2F5C A;  3FMS A;  2D1H A;  2EJR A;  1F4K A;  1SFE A;  1A04 A;  1O3S A;  3JAM Z;  5ICE A;  2COM A;  1YYV A;  1W4M A;  1NHA A;  1U5T B;  3KP5 A;  4CHU A;  1D8J A;  5CVI A;  4KNY A;  4BXU A;  3KE2 A;  1J59 A;  2G7H A;  2D1V A;  1BC7 C;  5L3B A;  2MLG A;  1KYZ A;  2CQK A;  2JPB A;  2TDX A;  3VOD A;  3K9T A;  3FMQ A;  3KFW X;  3I58 A;  2IVM A;  5KVR A;  2L4A A;  2VC0 A;  5JR3 A;  3FM3 A;  4KIF A;  1P6R A;  2ZNY A;  1ZAO A;  3HOS A;  2P5V A;  2XIG A;  2QEN A;  5D5V B;  3I53 A;  2EK5 A;  4S04 A;  3GF2 A;  2O61 A;  2ZFW A;  4RS8 A;  2XUB A;  4ON0 A;  2DPD A;  2Q0O A;  1UHM A;  3V8L A;  2DW4 A;  1FSH A;  2ADU A;  1K7A A;  3P7N A;  3GEZ A;  1UST A;  3OOP A;  4R8H A;  4ZYG A;  4YII A;  5FFX A;  1J0R A;  3LA7 A;  4HZF A;  3D0S A;  3MZH A;  5CLS A;  1W5S A;  2L01 A;  2G9W A;  1QO0 D;  4HQE A;  2IP2 A;  3E5Q A;  3RYR A;  1S3J A;  1FSE A;  1FPQ A;  3F6O A;  5ICG A;  3U2R A;  2QQ9 A;  4EJU A;  3BP8 A;  4IHS A;  3KLO A;  1OYY A;  2K27 A;  5LBQ A;  1HW2 A;  3U9G A;  3JTH A;  1O3R A;  2PJP A;  1V3F A;  5AIP A;  1QZY A;  2R3S A;  3ML6 A;  4KIC A;  4YIF A;  3GWZ A;  1U5T C;  4D0P A;  3RIR A;  2PG4 A;  3F8N A;  3E5U A;  3K2Z A;  2KKO A;  1R58 A;  2VC1 A;  3J80 Z;  4CGZ A;  1R1V A;  2ZCW A;  1LDD A;  5HDK A;  3SFZ A;  1FBS A;  1IN4 A;  3QP5 A;  3T8R A;  1XMK A;  1RNL A;  2P4W A;  1BC8 C;  3VEP A;  1ZG3 A;  2BV6 A;  2DTR A;  1OYW A;  1S6L A;  3VOE A;  1QPM A;  3ABT A;  2AS5 F;  3IL2 A;  2ZJ2 A;  3JAM K;  2V6C A;  3MZY A;  2JT1 A;  1EH8 A;  4WCG A;  2HOE A;  4I0B A;  1I1G A;  2O3F A;  3T8T A;  2E7X A;  1XCB A;  2ACJ A;  2A6E F;  2EV0 A;  2RVC A;  2DU9 A;  3MFK A;  4RGR A;  2HGC A;  5LHH A;  3R0A A;  3Q9V A;  3IRQ A;  4DQ2 A;  1H0M A;  1R7J A;  3NRV A;  1JHF A;  3MEX A;  3HSF A;  5LRS A;  5FO5 A;  3FHZ A;  3BDD A;  2A6H F;  2DPU A;  2XAS A;  1MKM A;  2IA1 A;  2FA5 A;  4CXF A;  2Z9O A;  3TOB A;  4U0W A;  3M8E A;  5CVJ A;  3FXU A;  5D5X B;  3FMR A;  2XAF A;  1R00 A;  3KP2 A;  3V8K A;  3ZPL A;  2BGC A;  2NYX A;  1IAW A;  2NRA C;  4JBA A;  5EEH A;  4PCQ A;  4ZYD A;  2QLZ A;  2GXB A;  1K78 B;  4MQ9 F;  2ZNZ A;  4MNU A;  4IJA A;  2O8X A;  1F9N A;  5D5W B;  4ZH4 F;  1ZRC A;  5DDG A;  1QNT A;  1S29 A;  4YFX F;  2GAU A;  2GZW A;  4A12 A;  5E8I A;  2GA1 A;  2PFB A;  4GO1 A;  1L0O C;  5F64 A;  3CUQ A;  3CO7 C;  4LG0 B;  2W85 A;  4YFK F;  4N0B A;  4L9J A;  3F21 A;  4PDK A;  3ZMZ A;  3EDP A;  1KYW A;  4RAZ A;  2VE8 A;  1HXD A;  2EV6 A;  4A0X A;  2F5E A;  3J80 K;  3F8F A;  1X3U A;  2VBX A;  1W7P B;  2ZO4 A;  1R23 A;  4KMU X;  5ED4 A;  5H6R A;  5L3D A;  4A0Z A;  1SFU A;  2P7V B;  4WX9 A;  1MJA A;  2E1N A;  2RV8 A;  3L9F A;  5J8F A;  3TKY A;  4FX0 A;  1LVA A;  2XAJ A;  2IW5 A;  3WE2 A;  3DPT A;  3SQN A;  1LB2 A;  2HQN A;  4A2U A;  4L9N A;  4JK1 X;  5K5Q A;  4KIG A;  3K69 A;  1EH7 A;  4KN4 X;  3TO6 A;  2LSO A;  1RUO A;  1KGS A;  4AVP A;  3KP7 A;  1VTN C;  4P55 A;  4HV6 A;  3CO6 C;  4G6Q A;  5HLI A;  1K6O A;  3ZMU A;  4KA4 A;  2QQB A;  3P9K A;  4KFC A;  3VFZ A;  3FWE A;  3R60 A;  4I2O A;  3T0Y A;  5H6Q A;  3Q9S A;  1FYL A;  4G6D A;  1T0F A;  1YS6 A;  3KEQ A;  1IXR C;  3GFJ A;  3CJN A;  2Y0M A;  1D8K A;  2D2W A;  2L4M A;  2GQQ A;  1JGS A;  1BOA A;  3S2W A;  1XSV A;  1Z6R A;  2HZT A;  1ZRF A;  3EUH A;  4ENK A;  1XGM A;  2IPQ X;  4I09 A;  2OAZ A;  5HS9 A;  3BY6 A;  3D5L A;  4A5N A;  1G4D A;  1B4A A;  4E70 A;  2FML A;  4U0Y A;  3W6J B;  3GZ5 A;  3BZ6 A;  4CZZ A;  4IRG A;  5FD6 A;  5DYM A;  4PZJ A;  3GVA A;  2RGV A;  3DEU A;  1G3W A;  1ZG1 A;  1E2X A;  2MC3 A;  1DUX C;  1BN5 A;  4HQM A;  2EB7 A;  2KIU A;  5LGN A;  1H9G A;  2VOD A;  2EA4 A;  3LFK A;  4OIP F;  1YQA A;  2JTV A;  4YG2 F;  3IRR A;  4WWC A;  1R22 A;  1MD0 A;  4R1H A;  2HEO A;  4ZZL A;  5FGM A;  3HUG A;  2R7F A;  3ABU A;  4ENJ A;  1PUE E;  1MDM A;  1Q1H A;  3C7J A;  3ECH A;  3O2P E;  4RB3 C;  2ISY A;  2DAO A;  4OMY A;  3CUO A;  3C3W A;  2K86 A;  4G9Y A;  2Q8K A;  3FF5 A;  2JZY A;  2FNP A;  1HKQ A;  2LKP A;  4BNC A;  5FLX Z;  5L3C A;  3DFG A;  2F2E A;  2HR3 A;  2RKH A;  3I64 A;  5E1W A;  4BAY A;  1MJB A;  3ISP A;  1LDJ A;  3GUD A;  3N97 A;  3GFM A;  2VOO A;  1YO5 C;  1ZN2 A;  2J5O A;  4ENN A;  3L7W A;  2P5K A;  4A6D A;  3P9I A;  1XDS A;  1SD7 A;  4HF1 A;  2FE3 A;  4LLL A;  2H27 A;  1WWX A;  1S7A A;  3U1D A;  4CYD A;  4Q5S F;  1XGS A;  1RIO H;  1JXS A;  1P2F A;  1OMI A;  1IW7 F;  1XMA A;  3V7S A;  4U0V A;  5JI6 A;  3KLN A;  4QWQ A;  5TJJ A;  3PFI A;  4WF2 A;  3HSE A;  2QBY B;  2HKO A;  2XV4 S;  1IN5 A;  2OZU A;  4XRF A;  4BH9 A;  3I0T A;  1TTY A;  2P7C B;  1IN8 A;  4UNO A;  1ONV A;  2XRN A;  1T98 A;  3FX3 A;  1FWZ A;  4RB1 A;  4L0Z B;  2DBB A;  1FBQ A;  4Y15 A;  3WTX C;  3ELK A;  2C6Y A;  4L0Y B;  3HYI A;  5K5O A;  1Z05 A;  2PLY A;  2W84 A;  2D45 A;  3HSR A;  5ICF A;  5D4R A;  4G7O F; 
#chains in the Genus database with same CATH topology
 1JT0 A;  2EZH A;  3ROU A;  4B4C A;  5DS9 A;  5JVT A;  4HYE A;  3SHF A;  3JRA A;  1W5C C;  3NEU A;  2K3F A;  2VKV A;  3O3K A;  1FIA A;  1ZRE A;  3CZ6 A;  3RPU D;  1BI3 A;  2F5V A;  3LSI A;  4XBF A;  1L3L A;  4M9S A;  1S8N A;  2KP6 A;  2QA4 I;  3GCM A;  3ABM H;  4EM0 B;  3F8M A;  3G1L A;  4BEH B;  4AWX B;  1DPU A;  1XC5 A;  4DYR A;  1FC3 A;  1U9O A;  2M9H A;  1I50 J;  1M1E B;  2CMP A;  3H35 A;  2O6G E;  1U8B A;  4A93 J;  5C4X J;  3RJP A;  1CF7 A;  3KIO A;  2F5D A;  4F55 A;  2EFW A;  5A2Q Z;  2AO9 A;  1E3P A;  3PQK A;  3AG1 H;  4I76 A;  5GPC A;  3RZD J;  2MD5 A;  3AL0 C;  4EEF G;  1T8I A;  1IRG A;  1SAX A;  4GRI A;  1YW9 A;  4F3Q A;  3CCV I;  3RKX A;  2OC6 A;  3K0L A;  3UNG C;  1PDN C;  2VPR A;  2P0W A;  3LAJ A;  3EET A;  1IV8 A;  2Y75 A;  2M0M A;  2KDZ A;  2EA2 A;  2DA4 A;  2G7U A;  2QQA A;  1DU0 A;  1OYI A;  1MBF A;  1XN7 A;  1P4A A;  2CH0 A;  4IVN A;  5GTI C;  2VIX A;  3JRH A;  4M6Y A;  5FLX K;  3DEE A;  2RDP A;  4X1E A;  2X1C A;  4IHW A;  2M87 A;  1VQO I;  1MBE A;  3MKZ A;  4XNF A;  1WPK A;  3M1E A;  3DKW A;  4KUM A;  1FX7 A;  5LRR A;  3QRF F;  3LQQ A;  2VKD A;  4N9H A;  3N05 A;  1T08 B;  3WU1 B;  2KIQ A;  1U78 A;  3BJ6 A;  2E36 A;  4HX8 A;  4A3B J;  2LKS A;  2E1M B;  2RN7 A;  2M7B A;  1J75 A;  4G8X A;  1I1S A;  2JK3 A;  1G3T A;  2A61 A;  2YX7 A;  1ITY A;  1G2H A;  1Z3Y A;  4KT5 C;  4NC6 A;  4E7L A;  1U6G A;  2DMU A;  5F08 A;  3V42 A;  3S2H J;  3L2C A;  2QEX I;  3KZY A;  4G94 A;  2E5Z A;  4HNU A;  1QRY A;  4O6J A;  2LC2 A;  4HV5 A;  3BZC A;  4ZDP A;  1JE8 A;  5D5U B;  5F0H A;  3D5R C;  3U1K A;  4FET A;  3GX4 X;  4F92 B;  3DBH B;  2R4G A;  4MHG A;  5JHU A;  5LGT A;  5ILU A;  4MQV A;  1LEB A;  4BE2 A;  2CG4 A;  1SD6 A;  3HOW J;  4RB2 C;  3VYR B;  1UZC A;  4K2E A;  5J1R A;  2FBH A;  1KU2 A;  3VDX A;  2VT2 A;  1R5G A;  3BRO A;  4HDU A;  1ZLJ A;  3CCE I;  4L5I A;  2ZME B;  1Z6T A;  1HSJ A;  2E35 A;  2RQQ A;  4UVA A;  4DBR A;  1UCR A;  3HEF A;  2JRM A;  1VQN I;  5EF6 A;  3HTU A;  2DT5 A;  5M5W J;  4GYI A;  3H36 A;  2DOD A;  2JA5 J;  1IUY A;  2A3S A;  3EQL F;  1FTZ A;  5IP7 J;  5DUI A;  3A01 A;  4MTE A;  2WTE A;  2DLL A;  2JN6 A;  4HAM A;  3BTJ A;  4NUB A;  4XK4 A;  5M5X J;  1UB9 A;  3OYN A;  2FU4 A;  3GBG A;  4AVZ A;  4LOC A;  3TOA A;  1W7P D;  3MZ8 A;  2GLO A;  2PJR B;  1G3S A;  4S05 A;  3HRS A;  2Y48 A;  2W00 A;  2Z5U A;  3OL4 A;  4LK1 F;  4BHB A;  3OYJ A;  5HLH A;  1PP8 F;  1A36 A;  2V1X A;  2Y2Z A;  4I0A A;  3VWB A;  4RGX A;  2F6C A;  2M30 A;  1GLN A;  2ZXJ A;  1U5T A;  1G59 A;  1KZH A;  4OAY A;  4BJ6 C;  1IV6 A;  5GAG J;  1K83 J;  2F5F A;  2KRF A;  2KFD A;  4N9I A;  2HYF A;  4HX7 A;  1FTT A;  1T38 A;  1V54 H;  1XMX A;  2FX0 A;  3KP3 A;  5HS7 A;  3ZQH A;  1FP2 A;  2DO7 A;  4B3X A;  1U9N A;  2CW7 A;  4BQQ A;  2YX4 A;  3GW2 A;  4IXA A;  3AAF A;  4A3F J;  4HSR A;  3MWM A;  3B6A A;  3LAP A;  4GCV A;  2W57 A;  2JVG A;  3GFI A;  3QOP A;  2W24 A;  3R0J A;  4XON A;  3TL4 X;  1OCC H;  5GAH J;  4HX4 A;  3ZQQ A;  1QZZ A;  2CUJ A;  1IRF A;  4GYG A;  5TGT A;  3M8F A;  5HVQ C;  1ON1 A;  1JTY A;  4HNV A;  2K5C A;  5DCM B;  4B3A A;  3JSP A;  3HZJ A;  5CYV A;  2HDD A;  1ZR4 A;  2JA7 J;  5F27 A;  3TBI A;  4DW6 A;  2QKL B;  5J1U A;  2CGP A;  4H0E A;  1KQ9 A;  3ABL H;  3K4M A;  3WTZ A;  4DYC A;  2CV0 A;  4CSW A;  4WK8 F;  2CSO A;  3S15 J;  1J5Y A;  1TBX A;  1B59 A;  2EH3 A;  2N8G A;  3BR1 A;  3DP7 A;  3TP0 A;  4XLP F;  3I4M J;  2BXY A;  2H8W A;  2H6C A;  2GIV A;  3I9V 2;  2M7A A;  2H1K A;  3OSG A;  1AOY A;  1DP7 P;  1WJE A;  4IZZ A;  4II2 A;  4U87 A;  5L3F A;  3G73 A;  4BE0 A;  2YUS A;  4X6A J;  3PO2 J;  2KIF A;  2E1M C;  2UXX A;  5ERI A;  3RDI A;  1X2M A;  5A2Q K;  2A69 F;  1S7E A;  4BJ5 C;  2R7S A;  1KA8 A;  4IOA F;  3IWZ A;  1J9I A;  2O0Y A;  1LFU P;  3FM5 A;  3DBL B;  2IGN A;  3J7Z I;  1GXP A;  4XLE A;  5F6F A;  4RLF A;  3HHG A;  2MH2 A;  3RKY A;  1PJR A;  2DFI A;  1VQ9 I;  4DIQ A;  2KL4 A;  1YW8 A;  5E1Z B;  4M3D A;  2RNG A;  4W1U A;  1HLV A;  2P8T A;  3HL2 A;  2Q1Z B;  1K79 A;  4RGU A;  3CJR B;  2V9P A;  2R7W A;  3GZ6 A;  3WU0 A;  2VXD A;  1IRX A;  3H0G J;  1NK3 P;  4HNT A;  1D3Y A;  2DK8 A;  2R7X A;  3ZN1 A;  1LFB A;  2I10 A;  2L9S A;  2KJC A;  3H5R A;  3QPH A;  1ETW A;  1V55 H;  4DYQ A;  3A1Y A;  2ZME C;  4G12 A;  4MIM A;  5CVV A;  5KNL A;  4J19 A;  3A2K A;  2QF7 A;  4CA0 A;  2KMU A;  1B6A A;  3I59 B;  2NXN B;  3SYT A;  1USS A;  3VB2 A;  1JUS A;  1FBU A;  4XMY A;  4XLN F;  2DYS H;  4Q47 A;  1IDY A;  4Z2Y A;  2AXT C;  1ZAR A;  2RQP A;  3TDU C;  4OIR F;  5TRD A;  5DD8 A;  4BXF A;  4M6X A;  2FXA A;  2R5Z A;  2O9L A;  1JI8 A;  3FBN B;  4RMN A;  5DEQ A;  1J2X A;  4AYB A;  4O5V A;  4AU7 A;  3F9K A;  1Z9C A;  2WY7 Q;  2V1D A;  3FXJ A;  1GVD A;  1OCP A;  4MGR A;  4C30 A;  1O7L A;  1Y8Q B;  2VE9 A;  1UMQ A;  2A05 A;  3HB9 A;  4HST A;  4D5C A;  4P9F A;  3ECO A;  4GXO A;  2L7K A;  1GVJ A;  3TGN A;  4MEY F;  1DGW Y;  2WY8 Q;  3ZCO A;  1QZE A;  3BWG A;  1ZYR F;  4XKC A;  3GTP J;  4QTR A;  2R7Z J;  1HW1 A;  4AIK A;  3GTL J;  2HXO A;  2QSG X;  3C2G A;  3GXO A;  3LQR A;  2I5U A;  3AG4 H;  2DA3 A;  1P7I A;  1JJ6 C;  1FY7 A;  2KDO A;  3TQN A;  4RDU A;  1WFX A;  5J4Y A;  3KEO A;  2RC4 A;  3JW4 A;  3E6D A;  3IKV A;  2Y9Y A;  2CW0 F;  2DOA A;  2IGO A;  2JMW A;  2LR8 A;  3BTI A;  2M2E A;  3S8P A;  4BXX J;  1X58 A;  4E7S A;  3S1Q J;  3F8B A;  4A3G J;  2R7R A;  1AKH B;  1I6H J;  5D8L B;  4UV9 A;  2P6T A;  1X19 A;  2ZSH B;  4G7Z F;  1HKT A;  4RA2 A;  2L5Q A;  4EMS A;  3ONQ A;  1SVO A;  5FLM J;  4P9U A;  1YW7 A;  1XG1 A;  2HDC A;  4EM2 A;  2Z33 A;  5H20 A;  3EPZ A;  3ZMD A;  2DFF A;  4BJT A;  1D0Y A;  2IXS A;  2PMU A;  3ZN0 A;  5JLW A;  4M9X A;  2R7D A;  2NVY J;  1T56 A;  2YSR A;  3LMM A;  4BYY A;  5E18 F;  4PJJ A;  5FLV A;  3BT9 A;  2IS1 A;  3REO A;  3WGI A;  3S14 J;  2WAF A;  2CO5 A;  3OL3 A;  3SDG A;  4RAY A;  4A5M A;  1SAU A;  2HOT A;  4JX6 A;  5CJ9 A;  4YEJ A;  4RB0 A;  2OQR A;  4NHJ A;  2WAE A;  4E4H A;  2HWV A;  2TCT A;  1AA7 A;  3FXR A;  3RPU A;  2R7U A;  2LNB A;  4M72 A;  3RPQ A;  4W97 A;  2HXI A;  2UWM A;  5HNF A;  2KJB A;  1JUP A;  2X0L A;  4ANJ A;  2VLA A;  1CGP A;  2K02 A;  5AON A;  2CUZ A;  1SFX A;  4LFU A;  1BL0 A;  3NWT A;  3ZMT A;  4CDG A;  1RET A;  3IH3 A;  5IT3 A;  2L7M P;  2XF6 A;  1IUF A;  2X6O A;  3HOU J;  1OR7 A;  4BGD A;  2QGU A;  2V6E A;  4EVI A;  2O5R A;  3ASO H;  2CQ7 A;  3KET A;  3Q5F A;  1YRN B;  1GV5 A;  5FKN A;  1ZEL A;  3CDI A;  3HPH A;  4NC7 A;  4PK4 A;  1VQ8 I;  4ZYH A;  1YHQ I;  2BY2 A;  1Z0X A;  2VQL A;  1WH5 A;  3OYB A;  2GOM A;  1OKR A;  4E7K A;  3FXO A;  2HZD A;  2LOO A;  3IP4 B;  1Y0U A;  5E17 F;  3HBL A;  4E6K G;  1BI1 A;  3KYD B;  2H6B A;  3SEQ A;  1B9N A;  2VT3 A;  1KON A;  1WVR A;  5E1X A;  1MBK A;  3HM5 A;  3PNV A;  3P9C A;  4I7H A;  2STT A;  2A6T A;  2FSW A;  4I98 B;  2NNN A;  4OOI A;  1FZP B;  3ZXS A;  1BI0 A;  4NB5 A;  3F72 A;  1YIO A;  3GFL A;  2EWN A;  2E2J J;  4M3E A;  4L5J A;  1K78 A;  4YRV A;  2W25 A;  2OQG A;  3WTT C;  5K1Y A;  2OZ6 A;  4PUS A;  3SZG A;  5GP9 A;  3ZMS A;  2AXL A;  1SD4 A;  3HGY A;  2NAZ A;  3QAH A;  3OYC A;  2EIM H;  1LDK B;  1PYV A;  2RAE A;  1TP4 A;  2FOK A;  3GTK J;  1ZKG A;  4FHT A;  3LA3 A;  2AQF A;  2QSH X;  2HKX A;  3OIP A;  2R92 J;  2ZSI B;  1VZ0 A;  4EV0 A;  2FNA A;  2JSC A;  2VBY A;  5J4V A;  4HDV A;  1Q1V A;  1KQ8 A;  1D5V A;  4LG0 A;  5HS8 A;  5J6X A;  3AG2 H;  3FXQ A;  1D1B A;  2CRG A;  2DMN A;  1UAA A;  4ABZ A;  2XKP A;  1N77 A;  2OBP A;  1XD7 A;  4BQN A;  1OJL A;  4AIJ A;  1KU9 A;  1OQY A;  4XKW A;  4HF2 A;  4HF0 A;  4CH7 A;  2O7O A;  4M73 A;  5J8C A;  4CCK A;  2J5P A;  2B0L A;  2ECC A;  4OWR B;  5LHI A;  4IEJ A;  2HFH A;  2EFO A;  4UVB A;  3JRG A;  2FBI A;  2WWY A;  3BR6 A;  5D4S A;  3DLL F;  2E5N A;  4PGG A;  5HDN A;  4E7J A;  3OSF A;  4L9V A;  3HIF A;  3NQO A;  3DTI A;  4IL6 C;  1J7K A;  4XN0 A;  4P5O A;  2K9S A;  1S7O A;  3BG3 A;  5HDG A;  3F3X A;  1W7P A;  1IZ1 A;  2BBY A;  3H3Z A;  4M3G A;  4JQF A;  1IF1 A;  5H2F C;  2UZK A;  3E0J B;  3GLL A;  5L3E A;  5E3O A;  2QM3 A;  4I01 A;  2Q2E A;  2LH9 A;  5F1J A;  3JSO A;  2QCO A;  3WG9 A;  4U7B A;  5ICC A;  3E6C C;  2NNY A;  3HXL A;  1RR7 A;  3M8J A;  1W0T A;  1E17 A;  2KRH A;  3K1N A;  1T2K A;  1P7J A;  2YR2 A;  5L3G A;  1B9M A;  4TV7 A;  5IOY A;  4RGS A;  3JRF A;  4ZDO A;  3MCZ A;  1ZR2 A;  1W1W E;  1WZ2 A;  4RAF A;  1D1C A;  4QIW N;  3LST A;  2PN6 A;  3PIP F;  3QPL A;  2FQ3 A;  2XKO A;  5KAI C;  4L5E A;  2M8E A;  4NQW A;  3W2V A;  4YIR X;  3KZI C;  3MAJ A;  3L2V A;  2V4J C;  2IS2 A;  3I54 A;  2E2I J;  1H88 C;  4ZZD A;  1A35 A;  1PP7 U;  2V1U A;  1FEX A;  1APL C;  4BQA A;  4BAC A;  1BIA A;  1T39 A;  2X6W A;  2ZJQ F;  3IV5 A;  3I4P A;  3JTG A;  2L54 A;  1ZGA A;  2QZ8 A;  2BEO A;  2KQR A;  2EFN A;  3AG3 H;  1F1Z A;  3EYI A;  2XB0 X;  2OD5 A;  3G1O A;  3P5J A;  1WKM A;  3S16 J;  4B47 A;  2LKX A;  1SVL A;  3CP2 A;  1BR2 A;  3DPL C;  1QVT A;  4U88 A;  2LFB A;  1GV2 A;  2FD5 A;  3ERM A;  3COA C;  4FT8 A;  2DA6 A;  4Q4Z F;  4M74 A;  2ID6 A;  3RCO A;  5HOO A;  4M3F A;  4A6E A;  4BU2 A;  4FTH A;  3OYA A;  3SZT A;  5C3E J;  4UVC A;  2XSJ C;  4Y7N J;  1LFP A;  3E97 A;  1XSX A;  2NVU B;  1B1B A;  1WH7 A;  4QLC U;  3IH4 A;  4LD5 A;  4MFD A;  1IRZ A;  4KIB A;  1AWC A;  3FK6 A;  1PUF A;  2DK5 A;  4PJN A;  5FKM A;  2VON A;  4XOR A;  3WHB A;  4CO8 A;  2L0K A;  3EYY A;  3OYM A;  2Z3Y A;  3ZRG A;  2CQQ A;  1LEA A;  4XQF A;  3K1P A;  2P6S A;  3FHN A;  1RR8 C;  3LSH A;  1ON2 A;  4DZJ A;  2MLK A;  5JFR A;  2DTZ A;  3UR3 C;  2PBI A;  5AIQ A;  3OS0 A;  1GHC A;  1BR4 A;  2RNJ A;  3BQZ A;  5CQG A;  1TWC J;  2YPR A;  2XSD C;  1E3H A;  3BG9 A;  3TDZ C;  4Y17 A;  3WGH A;  1YRN A;  1RZ4 A;  3B73 A;  4AID A;  4ETS A;  2IBD A;  1ODD A;  1YJ9 I;  4WXC A;  2M4K A;  2KRC A;  2BZT A;  4GGG A;  6PAX A;  3I5U A;  5IYC J;  3S3M A;  3TO9 A;  3O8H A;  1XTA A;  4A3K J;  1MMA A;  4LJZ F;  5F0C A;  4ESF A;  4AD9 A;  3WTS C;  2VKE A;  3H5N A;  1OFC X;  2FMY A;  2Y30 A;  3LWF A;  2L7F P;  2FF4 A;  4C3H J;  1Z1D A;  3C2B A;  4EJW A;  3M07 A;  1Y39 A;  3QU6 A;  4OIN F;  3FXK A;  4UUV A;  4KDP A;  5EZH A;  1UG2 A;  2KLO A;  4ESJ A;  4B09 A;  1MH4 A;  2P81 A;  1WRJ A;  1XCV A;  3WTY C;  1STZ A;  5D6E A;  1GT0 C;  2LDU A;  3IWF A;  3CTA A;  2X9D A;  2HU9 A;  3G1M A;  1FP1 D;  2IS6 A;  2DOE A;  3H92 A;  2EZL A;  2L7Z A;  2H94 A;  4OU0 A;  2CFO A;  3GLX A;  1VQP I;  2H09 A;  5E3N A;  4OIO F;  4KYW A;  1UFM A;  3LA2 A;  1WI9 A;  5LLQ A;  3F22 A;  4PGH A;  3BQY A;  3QYB A;  5E3L A;  3DLA A;  3V4G A;  3CUQ B;  3PSI A;  3RZO J;  3HOV J;  2ESN A;  1K61 A;  1DPR A;  1P4X A;  1H89 C;  2FEZ A;  3GTM J;  3DCF A;  3H0D A;  3CJT B;  1Z7L A;  4OIQ F;  3G3Z A;  1H8A C;  2XHK A;  2Z99 A;  1ZRD A;  2W48 A;  3BCB A;  5HLT A;  3S32 A;  2PMZ N;  3S3O A;  1VF9 A;  1HKS A;  3BJA A;  2XF7 A;  3DTK A;  3NAR A;  5GAE J;  3WTV C;  4FCY A;  3K4L A;  1V5E A;  3KPH A;  5FRO A;  4EGY A;  2FUG 2;  5FB2 A;  3JCU C;  1B72 A;  2XGD A;  1NG7 A;  2XVC A;  1EH6 A;  1AU7 A;  3MVP A;  3ULQ B;  1W0U A;  3GYH X;  1XSD A;  2E1C A;  2DMP A;  1RUN A;  2E34 A;  1WJF A;  3O8G A;  4QSH A;  2R7Q A;  1G3Y A;  1QVU A;  2XAU A;  2LRD A;  2K7L A;  1MMN A;  2MA3 A;  3DU5 A;  1TW2 A;  4HBL A;  1WJD A;  3OOU A;  4XKB A;  4ASN A;  2HQR A;  4LGW A;  1EA3 A;  1O57 A;  1U8R A;  3OYG A;  3WGG A;  3H9Q A;  4XSX F;  3ZQG A;  5BPD A;  4CUG A;  5IT9 Z;  2W4S A;  1HW5 A;  2Y9Z A;  4CIC A;  3RKQ A;  4MLO A;  1LE8 A;  2HI3 A;  1EV7 A;  3PFY A;  3DKX A;  2A68 F;  4UUS B;  1LUJ B;  3W6K B;  5DD4 A;  3LNQ A;  4EJT A;  4M6V A;  3ERE D;  1WJB A;  5JLX A;  2Y0S N;  3MKY B;  3H9G A;  2IA2 A;  1O7F A;  3A0B C;  3CMM A;  3R6S A;  3VSK A;  2VXZ A;  4YFN F;  3HRT A;  4AC0 A;  1SVM A;  2JA8 J;  3CMA I;  3BPX A;  3W2A A;  1IN6 A;  1R1T A;  2ESH A;  2K9N A;  4LB6 B;  3DEW A;  3CCL I;  2GM4 A;  3S1M J;  2VBW A;  2GWR A;  5CVR A;  4ZJZ A;  2K9Q A;  2R0Q C;  2QVO A;  4DBQ A;  1FLI A;  2VJ4 A;  2XRL A;  2XPV A;  2PQ8 A;  2AHQ A;  4CCM A;  1A5J A;  2LF8 A;  3E6B A;  2IGM A;  4Y33 A;  1TNT A;  2ECB A;  2O03 A;  2PMZ A;  2EV5 A;  2CW8 A;  1Z91 A;  1DP3 A;  5BS6 A;  4IOC F;  2ZXH A;  1X2N A;  5IYB J;  5DM7 F;  4U7D A;  2ME0 A;  2BY0 A;  2JRT A;  2XAH A;  1HBX G;  3ASN H;  4HLX A;  1JKP C;  1ZGJ A;  3WTU C;  3OYE A;  1BM9 A;  1FYM A;  1R1U A;  1TW3 A;  2QBY A;  2FOW A;  2K40 A;  3KX2 A;  1EF4 A;  4B48 A;  2Z16 A;  3HOT A;  3CDH A;  2WC2 A;  3J7A O;  5BOX A;  1W36 C;  5KK1 A;  2DI3 A;  4XRS A;  5LGU A;  3FZV A;  4B44 A;  1VFC A;  1SC7 A;  4G6T B;  3CQZ J;  2ZFU A;  2LMD A;  5EGO B;  1ZH5 A;  3RYP A;  3KZZ A;  3KEY A;  1GXQ A;  3WOD F;  4MO7 A;  3CUQ C;  1BJZ A;  4I99 C;  2K85 A;  2QWW A;  5M3M J;  2VUM J;  1JHH A;  1P92 A;  3LFU A;  2FQ4 A;  3F8C A;  2BE5 F;  3I55 I;  4HG2 A;  2DT7 B;  1X1D A;  4C3J J;  3CCM I;  3S1N J;  2OA4 A;  3ZQ7 A;  3K1M A;  1KQ0 A;  4DNC A;  2EQR A;  2BW3 B;  4IRH A;  2Y0S A;  4L9T A;  4Z6Y A;  4EGZ A;  1EJ9 A;  1FOK A;  4ENM A;  2HTS A;  2HPI A;  4A69 C;  3M9A A;  2LP0 A;  3S93 A;  3WTW C;  4ZTF A;  1G6N A;  2ETH A;  3L00 A;  5BPI A;  3ZOB A;  1ETO A;  2HYJ A;  2QYO A;  1KU3 A;  4UXN A;  5KHD A;  3GO5 A;  4Q48 A;  3OIO A;  3IAS 2;  3N4M A;  1FJL A;  1IN7 A;  4S0H B;  2XAG A;  2PI0 A;  1XGN A;  2EFQ A;  3MKW B;  4ESB A;  2V9V A;  4ZYA A;  4LIV A;  3SDB A;  4XLF A;  5D8K B;  3J81 Z;  2E7W A;  3PIO F;  3LSP A;  1LNW A;  1ZQ3 P;  1F5T A;  1MNE A;  3FK7 A;  1E3O C;  4J01 A;  3QQA A;  5E20 A;  2M45 A;  4BEH A;  3OYH A;  3L09 A;  4R79 A;  1SFO J;  2D5V A;  2EIK H;  1NK2 P;  2OTJ I;  3QP6 A;  1HQC A;  1HCR A;  1G8X A;  1LJ9 A;  4XN3 A;  1MBJ A;  3I71 A;  4FX4 A;  3ZMV A;  1YG2 A;  2VBZ A;  3F6V A;  3T1B A;  1I6X A;  2M0C A;  2M5W A;  4EQQ A;  2KIS A;  2K4B A;  3BR3 A;  4XL9 A;  5LEJ A;  3TO7 A;  2IGK A;  2XC7 A;  4PFP A;  3TED A;  3CLQ A;  2GXG A;  2DFE A;  2P5L C;  1QBJ A;  2L3D A;  1WSU A;  3CME I;  3AFH A;  3CDL A;  3BJO A;  1TT5 B;  3F23 A;  4IHY A;  1YX5 A;  3DQV C;  4KN7 X;  1HA8 A;  5K5R A;  2FJ1 A;  1U2W A;  1YS7 A;  2STW A;  4IRI A;  3HUG B;  1XDU A;  5FFZ A;  5LEK A;  2VN2 A;  2WV0 A;  2MC4 A;  3OV8 A;  3WU2 C;  1TQI A;  4LMY A;  2X4H A;  2X6X A;  1MDM B;  1GUU A;  1JGG A;  2X51 A;  1XS9 A;  3O6B B;  2IRF G;  4N4O B;  1IJW C;  2GA2 A;  3HTS B;  3J7A Y;  1DU6 A;  4EJV A;  2KIM A;  2L9N A;  4A3I J;  2DJI A;  1H9T A;  4HW0 A;  1XB4 A;  2FRH A;  3HHH A;  2VKH A;  1FYK A;  3K4N A;  2ZJR F;  3CCY A;  3RKW A;  5IT9 K;  1K4T A;  2HS5 A;  4ZC3 A;  1KU7 A;  2IS4 A;  2LY1 A;  4XM3 A;  4F7Z A;  5EG0 B;  3RI4 A;  1T33 A;  1MGT A;  3DF8 A;  2W82 A;  5F1R A;  2VAS A;  2DN0 A;  2A5Y B;  4IHT A;  1T0F C;  4BHP A;  1TL8 A;  2UV1 A;  2DQL A;  1P4W A;  2Y69 H;  2LF7 A;  3C1D A;  2B63 J;  2L9V A;  2OJE D;  3V7R A;  1R9T J;  1RI7 A;  1OCZ H;  2JPC A;  1F36 A;  1REP C;  4WXH A;  2DDB A;  3LSR A;  1BOB A;  1POG A;  3DV8 A;  3E6M A;  4AIH A;  4XSZ F;  1DQU A;  3V8J A;  2XPW A;  5D6F A;  1VQ5 I;  2ZME A;  2CFX A;  1FIP A;  3CCQ I;  3H3U A;  4V19 K;  3SZP A;  2EIN H;  2MYS A;  4QPQ A;  3QPT A;  1C0W A;  3EUH C;  3FDY A;  1T6S A;  4A0Y A;  1BW6 A;  1Z7U A;  4PSX A;  4BDY A;  3QYE A;  2X85 A;  3E3V A;  1ULY A;  4HEA 2;  3HRM A;  3KP4 A;  2ELH A;  1FT9 A;  4ZTJ A;  2HVS A;  5ILS A;  2PJR A;  2YU3 A;  2CUF A;  1WCM J;  4OMZ A;  2HTJ A;  1LQ1 A;  3GME A;  1V4R A;  1YJN I;  2MH9 A;  1Z67 A;  2OU2 A;  1OCO H;  1QQI A;  1TLH B;  4B1R A;  5M5Y J;  1VQ7 I;  3DXJ F;  4HPQ A;  4I02 A;  3D5S C;  1ENH A;  2EFP A;  1FNN A;  1YLF A;  2XRO A;  2V79 A;  2DA1 A;  4UV8 A;  2CWE A;  3B02 A;  3V7C A;  3BOQ A;  3KCC A;  5J47 A;  2BYV E;  1SD5 A;  1W5T A;  1SMT A;  1R5H A;  1UHW A;  2RRE A;  4MTD A;  1MNM C;  2HVR A;  1DGR M;  2PMH A;  4IPA A;  1RC9 A;  3ZP5 A;  2DXI A;  2XAQ A;  2XPU A;  4D7N A;  3GTO J;  3IAM 2;  3HGG A;  5BMZ A;  5DCM A;  1I39 A;  1MZB A;  2PEX A;  3A0H C;  4WXD A;  3BPV A;  2H8R A;  3RTR A;  4F91 B;  2M4G A;  1TNS A;  1ETK A;  2MBF A;  2R93 J;  2CJJ A;  2IA0 A;  3KP6 A;  4HLY A;  5GPA A;  3J81 K;  4MEX F;  1Y6I A;  1QGP A;  2LY2 A;  1ZG5 A;  2WAQ N;  4ZYE A;  2BW3 A;  1ETY A;  4BUP A;  4KIS A;  3IHU A;  5HLG A;  2A07 F;  3SXY A;  1B8I B;  3T5X A;  5BQT A;  5J3L A;  2DQR A;  2DYR H;  3WG7 H;  4O3M A;  1OCT C;  1SMY F;  2FBK A;  2M1B A;  2I8D A;  1Y0N A;  3IC7 A;  1NTC A;  3OS1 A;  4Y13 A;  2E71 A;  1IXS B;  3LSM A;  4LIU A;  1ZLK A;  1BJA A;  3PNT A;  4ZDL A;  2DJN A;  3K4B A;  4Y52 J;  3ESW B;  2HYG D;  2Y31 A;  1JKQ C;  2WB1 N;  1IXC A;  2LTP A;  4LLG F;  4QPO A;  1O3Q A;  1R36 A;  3OYK A;  3L2R A;  4M71 A;  3R61 A;  2R5Y B;  2DT6 A;  2DCE A;  4IHX A;  4PJ0 C;  1I27 A;  3HRU A;  1CF7 B;  2QSF X;  2ISZ A;  1X3Z B;  2E19 A;  2GBY A;  2ZC2 A;  1Y1W J;  2V26 A;  3ABK H;  3BCA A;  4PJL A;  5K7H A;  2VOP A;  2IJL A;  5DV5 A;  4M9Z A;  4LB5 A;  1Y8R B;  2ID3 A;  3JRD A;  3LSJ A;  2WA0 A;  2K4J A;  3RQ4 A;  3I3L A;  4EJO A;  1WHU A;  4LK0 F;  1YTY A;  2K9L A;  3E1S A;  5LHG A;  5EEA A;  3LL7 A;  4G7H F;  3I59 A;  3HOZ J;  4DOZ A;  4DZP A;  2BHY A;  4IQ4 A;  3R4K A;  2V9K A;  4UHT A;  4B8X A;  3DPU A;  2IT0 A;  2LY9 A;  2HPM A;  3Q0W A;  3M7G A;  3WE3 A;  1JUM A;  5E8G A;  1U3E M;  2LG4 A;  5DCF A;  1SFK A;  2XGX A;  1MSF C;  5CVU A;  3ZR8 X;  2NS0 A;  1ZHF A;  2VB6 A;  3OMY A;  3A4C A;  3CLO A;  1I5Z A;  1I3Q J;  3C18 A;  3VPR A;  2L02 A;  2CS3 A;  5E3M A;  1O3T A;  4HOB A;  1X3W B;  2MG4 A;  1DDN A;  3S17 J;  1OPC A;  1WQ2 A;  4BHC A;  5EEG A;  5TIS C;  1W36 D;  1Z3X A;  1YFH A;  1VQ6 I;  1X4P A;  2HNH A;  3IKT A;  3E5X A;  2R7V A;  3ZQI A;  2CV2 A;  1RKW A;  2CYY A;  3H9J A;  1BI2 A;  4IF4 A;  4XLA A;  3FIW A;  4E7Z A;  5KAF C;  3CCU I;  3PQJ A;  4XKV A;  4L18 B;  5FRN A;  2ZBK A;  1TQP A;  5FD5 A;  2QUF A;  3MQ0 A;  3BG5 A;  4EM1 A;  3Q0V A;  5ILV A;  1BIB A;  3I4N J;  3KYC B;  2Z2S B;  1TQM A;  1XGO A;  1BBY A;  3OR2 C;  2ZKZ A;  1K6Y A;  2LRE A;  5DUK A;  3TMO A;  4XRM A;  4LLN A;  1MJ9 A;  2F4M B;  2M3A A;  3BG7 A;  4KMF A;  2UXN A;  4HA8 A;  1AKH A;  4XOP A;  1HST A;  3FXL A;  1LPQ A;  2BOL A;  5EJC A;  3A01 B;  3QU3 A;  5GTH C;  4II3 A;  4P96 A;  9ANT A;  2F5C A;  3FMS A;  1YJW I;  2A5W A;  2HOS A;  1D1A A;  2G0E A;  4EAT A;  4RBO A;  2XDV A;  3M1C A;  1X1C A;  2D1H A;  2EJR A;  4KIT B;  3MD2 A;  1F4K A;  1AHD P;  5F04 A;  1SFE A;  1A04 A;  2ZXW H;  1O3S A;  1PVE A;  1WI3 A;  2JA6 J;  3JAM Z;  5ICE A;  3X2Q H;  2COM A;  1TT0 A;  1YYV A;  4ITV A;  3VYT B;  1W4M A;  1NHA A;  1U5T B;  3KP5 A;  4JX4 A;  4FAS D;  4CHU A;  1D8J A;  5CVI A;  4IHV A;  4RAG A;  2JUC A;  2CQN A;  1ERD A;  4PSW A;  4KNY A;  4BXU A;  3KE2 A;  1J59 A;  5DM6 F;  2G7H A;  2D1V A;  1BC7 C;  5L3B A;  2DA2 A;  2GOX B;  1RKT A;  1SAN A;  2MLG A;  3CMY A;  1KYZ A;  2JJ7 A;  4HRI A;  3CF5 F;  3G4S I;  2CQK A;  1RRJ A;  3VYU B;  2JPB A;  2TDX A;  3VOD A;  1WJA A;  3K9T A;  3G71 I;  1FOX A;  2W1O A;  3FMQ A;  1MBG A;  4D7M A;  2HVQ A;  3I58 A;  3KFW X;  1ZK8 A;  2DA7 A;  2IVM A;  3L2U A;  2OF7 A;  3S1R J;  4F52 A;  3PO3 J;  5KVR A;  2L4A A;  1ACI A;  5M3F J;  5IP9 J;  2VC0 A;  5JR3 A;  3FM3 A;  4KIF A;  1P6R A;  1MW7 A;  3MMY B;  5FRM A;  2ZNY A;  4RM2 A;  1ZAO A;  3HOS A;  2P5V A;  5GAD J;  3SFI A;  1UG0 A;  2XIG A;  1HOM A;  2QEN A;  3BR2 A;  5D5V B;  3I53 A;  3K4J A;  4BQO A;  2EK5 A;  3AKZ A;  4S04 A;  2MD0 A;  3GF2 A;  2O61 A;  2ZFW A;  4RS8 A;  2XUB A;  2BY1 A;  4ON0 A;  2DPD A;  4YEL A;  1IG7 A;  5IY5 H;  1MH3 A;  2Q0O A;  1UHM A;  3V8L A;  2DW4 A;  1FSH A;  4AUX A;  1YX3 A;  1R4M B;  2ADU A;  3GTG J;  2CUE A;  1K7A A;  3QOE A;  3P7N A;  3GEZ A;  3LSG A;  5HNH A;  1UST A;  1MBH A;  1MND A;  3K70 C;  3OOP A;  3PUB A;  4R8H A;  4ZYG A;  4IO9 F;  4YII A;  2ELK A;  2VJ5 A;  4FQG A;  5FFX A;  1J0R A;  5FKK A;  3LA7 A;  1A6Q A;  3B6C A;  3DTE A;  4HZF A;  3UKG A;  3D0S A;  2MW8 A;  5CLS A;  3MZH A;  1W5S A;  2BVL A;  2L01 A;  3FIS A;  2G9W A;  1QO0 D;  4HQE A;  1BA5 A;  2IP2 A;  3S3N A;  1Z21 A;  5JHF A;  1FOY A;  2R5Y A;  5JVG F;  3JR9 A;  2ME6 A;  3E5Q A;  1F43 A;  3RYR A;  1S3J A;  1FSE A;  1FPQ A;  3H3V K;  1HDP A;  2HDW A;  3F6O A;  5ICG A;  3A03 A;  3U2R A;  2QQ9 A;  3C2H A;  2NOG A;  2EZI A;  4EJU A;  3BP8 A;  2NVX J;  3KLO A;  4IHS A;  1OYY A;  2K27 A;  3ZGK A;  2VJI A;  1GDT A;  4B43 A;  2V7F A;  4FE7 A;  5LBQ A;  3OYD A;  3SEZ A;  4E7H A;  1HW2 A;  2EZK A;  4BKX A;  3U9G A;  3JTH A;  3PJR A;  3RQI A;  1O3R A;  2PJP A;  4N4N B;  2M34 A;  1V3F A;  2R5Z B;  5AIP A;  1QZY A;  2R3S A;  1S72 I;  1BR1 A;  3ML6 A;  4KIC A;  3HKZ N;  1UHS A;  4YIF A;  3GWZ A;  3CC2 I;  1SEU A;  1U5T C;  1QA6 A;  4D0P A;  2HQ5 A;  1YE9 A;  3RIR A;  1YIJ I;  2PG4 A;  2ZB9 A;  3F8N A;  3E5U A;  3K2Z A;  4H4K C;  2KKO A;  1R58 A;  2VC1 A;  2LBF B;  3J80 Z;  1R1V A;  4CGZ A;  2ZCW A;  5B3S H;  1LDD A;  5HDK A;  3LSK A;  3SFZ A;  1FBS A;  1IN4 A;  3QP5 A;  3A02 A;  3T8R A;  3F0C A;  3ZQL A;  1A31 A;  3HPG A;  1XMK A;  2OCC H;  1RNL A;  2P4W A;  1BC8 C;  3VEP A;  1ZG3 A;  2BV6 A;  1R71 A;  2BXZ A;  2DTR A;  1OYW A;  1S6L A;  4BBR J;  3NWS A;  3VOE A;  4IQJ A;  4XLC A;  1QPM A;  3ABT A;  2AS5 F;  2E60 A;  3IL2 A;  4A3J J;  2ZJ2 A;  3JAM K;  2V6C A;  3MZY A;  2JT1 A;  1EH8 A;  4CCL A;  1X1A A;  4WCG A;  2HOE A;  4I0B A;  1I1G A;  2BHZ A;  5IOZ A;  1HDD C;  2O3F A;  4BL0 B;  3T8T A;  2E7X A;  1XCB A;  2ACJ A;  2A6E F;  4UUT A;  2EV0 A;  3QYF A;  2QKM B;  2RVC A;  1R49 A;  2DU9 A;  3MFK A;  4RGR A;  2HGC A;  5LHH A;  1JKR C;  3R0A A;  3Q9V A;  3IRQ A;  4DQ2 A;  3ZQC A;  1H0M A;  1R7J A;  3HKZ A;  4MFE A;  1WJ5 A;  3NRV A;  3KYL A;  1JHF A;  2X1D A;  3MEX A;  2K3P A;  3HSF A;  5C44 J;  2E2H J;  5LRS A;  2JVH A;  5FO5 A;  4CCJ A;  3FHZ A;  4BY1 J;  1S9H A;  2CU7 A;  2OTL I;  4CYC B;  3JRB A;  3BDD A;  4D9J A;  2F4O B;  2A6H F;  2DPU A;  2XAS A;  2KPM A;  1VND A;  1MKM A;  2IA1 A;  3W3C A;  2FA5 A;  4M3B A;  4X0G A;  1V5F A;  5IP6 A;  4CXF A;  2Z9O A;  3HDD A;  1MMS A;  3TOB A;  2OCE A;  4U0W A;  4D1Q A;  3M8E A;  5CVJ A;  3FXU A;  3MN2 A;  5D5X B;  1VQL I;  3FMR A;  1TZL A;  4I6Z A;  2XAF A;  1MSE C;  1R00 A;  3KP2 A;  3V8K A;  3CCR I;  3ZPL A;  2BGC A;  1Y56 A;  2OV7 A;  2YU9 J;  2NYX A;  3M4O J;  4GDF A;  1IAW A;  2NRA C;  1ZGW A;  3CD6 I;  1TWA J;  4JBA A;  5EEH A;  2KZV A;  1RES A;  5F0F A;  4E7I A;  4PCQ A;  1IGN A;  1HF0 A;  4C2M J;  3G2B A;  4AYB N;  4ZYD A;  5CPR B;  2QLZ A;  2NVT J;  2GXB A;  2VI6 A;  3RSN A;  3K7A J;  3JRI A;  5EDN A;  3OYL A;  3K2A A;  1K78 B;  4MQ9 F;  4DJA A;  2ZNZ A;  4MNU A;  4LIT A;  4IJA A;  2O8X A;  3JRE A;  1F9N A;  1JKO C;  4XIC A;  5D5W B;  1UEL B;  4XOT A;  4XRS G;  4ZH4 F;  3LOC A;  4UB8 C;  4BS9 A;  1ZRC A;  5DDG A;  1QNT A;  5J40 A;  2F48 A;  1R5I D;  1S29 A;  4RLQ A;  3D1N I;  4YFX F;  3IH2 A;  4Y3O A;  2GAU A;  2X6Y A;  2MGQ A;  1FOW A;  2GZW A;  4A12 A;  5E8I A;  3K6G A;  1VQM I;  3CC7 I;  4BBS J;  2NVQ J;  2L2O A;  2GA1 A;  2PFB A;  2EIL H;  1L0O C;  2X1E A;  4GO1 A;  3OS2 A;  4A3L J;  2TRT A;  1WGX A;  3EUA A;  5F64 A;  3CUQ A;  3W2W A;  3L2Q A;  3CO7 C;  4LG0 B;  2W85 A;  3PUF A;  3E7L A;  2V1N A;  4YFK F;  4C9Y A;  1N75 A;  3CP8 A;  4N0B A;  4CCN A;  4L9J A;  2WAD A;  1QHG A;  3MKL A;  3F21 A;  1ETQ A;  4PDK A;  3ZMZ A;  3K4C A;  3IUO A;  2LVS A;  5FKO A;  5LFA A;  2XGE A;  3EDP A;  1NG6 A;  1KYW A;  3I56 I;  4KJZ A;  4RAZ A;  2VE8 A;  1HXD A;  2EV6 A;  4A0X A;  4XLH A;  2F5E A;  2GIZ A;  3J80 K;  2COB A;  2OPT A;  1IC8 A;  2DFH A;  3F8F A;  1X3U A;  1O4X A;  5E79 C;  2VBX A;  5FJ8 J;  1W7P B;  2ZO4 A;  1FMV A;  3BZK A;  1OIS A;  4KT6 A;  1R23 A;  4KMU X;  4IKF A;  3FKI J;  5K7F A;  1Z77 A;  3PM1 A;  5IPA A;  2EIJ H;  1FMW A;  2NS8 A;  2JA2 A;  5ED4 A;  3OYF A;  5H6R A;  3DWL E;  2Q2E B;  1JJ8 C;  5L3D A;  4A0Z A;  1SFU A;  2P7V B;  4WX9 A;  4BY7 J;  3VYS B;  1MJA A;  2E1N A;  2RV8 A;  3H5A A;  1U0J A;  3L9F A;  5J8F A;  1ZTR A;  1D0X A;  1UJ8 A;  2LBF A;  3DU6 A;  3TKY A;  4FX0 A;  1OLT A;  1LVA A;  2XAJ A;  1T95 A;  2IW5 A;  3WE2 A;  1YOV B;  1OR7 C;  3DPT A;  3SQN A;  2YS9 A;  4UUS A;  4P1W A;  3G6E I;  2XGC A;  1LB2 A;  3BR5 A;  3Q3S A;  4GFB A;  2HQN A;  3CJQ B;  4A2U A;  4L9N A;  3FBI B;  2DMQ A;  4JK1 X;  5K5Q A;  4NQW B;  3PNY A;  4RM3 A;  5B1A H;  4KIG A;  4PFO A;  2KHM A;  3K69 A;  1QPI A;  1EH7 A;  3BC8 A;  4KN4 X;  3TO6 A;  1ORK A;  2LSO A;  5LD2 C;  1RUO A;  1KGS A;  4AVP A;  3KP7 A;  4A3M J;  1VTN C;  3HOY J;  1HC8 A;  4P55 A;  2MFZ A;  4HV6 A;  1VI0 A;  3CO6 C;  2X48 A;  2CV1 A;  1RPW A;  4G6Q A;  5HLI A;  5B66 C;  1K6O A;  2JWT A;  3ZMU A;  4JX5 A;  2MSY A;  3K70 D;  1OCR H;  2QQB A;  4KA4 A;  1YI2 I;  2B9S A;  3P9K A;  1JTX A;  4KFC A;  1X4O A;  2LK2 A;  2B7E A;  1MMD A;  5B5E C;  3VFZ A;  3FWE A;  4XR6 A;  3R60 A;  1VQK I;  4I2O A;  4JP0 A;  1D5Y A;  3T0Y A;  2VPL A;  5H6Q A;  3Q9S A;  1FYL A;  4G6D A;  4C2U A;  1T0F A;  2PX9 A;  3DBR B;  4V2F A;  3L2W A;  1X1B A;  3U21 A;  1QHH D;  3QPS A;  1PUF B;  2VL8 A;  2EPF A;  1YS6 A;  2IAI A;  3KEQ A;  3TW6 A;  1IXR C;  5EGO A;  4UY8 I;  2KZG A;  4CYC A;  2WV1 A;  3GFJ A;  3CJN A;  4PJM A;  2Y0M A;  1D8K A;  2D2W A;  2W7N A;  2L4M A;  3H1C A;  2GQQ A;  1JGS A;  4CZC A;  3GZN B;  2LYC A;  2VQG A;  2CQX A;  1Y1V J;  1IO2 A;  1IDZ A;  1R4N B;  1BOA A;  3S2W A;  1XSV A;  2LLK A;  1Z6R A;  3HC7 A;  2O8K A;  2HZT A;  1ZRF A;  4OAZ A;  4NBQ A;  3EUH A;  4ENK A;  4IX7 A;  3EUK L;  1P9Q C;  1XGM A;  3J7Y J;  4XID A;  1LVK A;  2IPQ X;  1S5L C;  1A6I A;  4I09 A;  2ICW G;  4NNJ A;  2OAZ A;  1J09 A;  5HS9 A;  3BY6 A;  3D5L A;  4A5N A;  1G4D A;  1B4A A;  4E70 A;  2FML A;  4U0Y A;  3W6J B;  3GZ5 A;  3QWL A;  2DOF A;  3CCS I;  1TC3 C;  1XX5 A;  4UB6 C;  3BZ6 A;  4CZZ A;  4IRG A;  3W6V A;  2BY3 A;  3K10 A;  5FD6 A;  5DYM A;  4PZJ A;  1ETV A;  2DDA A;  3JRC A;  2JSP A;  3GVA A;  3GTJ J;  2RGV A;  1TWG J;  1G3W A;  3DEU A;  3M3Y J;  1ZG1 A;  1E2X A;  4FE4 A;  2MC3 A;  1DUX C;  1BN5 A;  4HQM A;  1VQ4 I;  2EB7 A;  4CCO A;  2KIU A;  5LGN A;  1K4S A;  1H9G A;  5C4J J;  2ZJP F;  1BW5 A;  2VOD A;  2EA4 A;  3HG9 A;  5B1B H;  5HOD A;  3LFK A;  3ZQF A;  4OIP F;  1YQA A;  2JTV A;  2K9M A;  4YG2 F;  2KT0 A;  3VSL A;  3IRR A;  4WWC A;  1R22 A;  3CES A;  1TWF J;  5EYR A;  3CC4 I;  1MD0 A;  4R1H A;  3K4K A;  2JUG A;  2HEO A;  2VJJ A;  3OIQ A;  4ZZL A;  5FGM A;  3HUG A;  2R7F A;  4A3E J;  2HQA A;  2WAQ A;  3ABU A;  3OYI A;  4ENJ A;  1PUE E;  1MDM A;  1Q1H A;  5FKL A;  2OUM A;  3C7J A;  3ECH A;  1B72 B;  1X1P A;  3O2P E;  2L9R A;  4RB3 C;  2ISY A;  2EBI A;  5IYD J;  2DAO A;  2ZXI A;  4NDL A;  3OY9 A;  5EZG A;  4OMY A;  3CUO A;  2MAB A;  3C3W A;  2K86 A;  1TWH J;  4G9Y A;  2Q8K A;  2VQH A;  3FF5 A;  2JZY A;  3WHC A;  2JQ7 A;  1E0E A;  2NS7 A;  2FNP A;  1HKQ A;  2LKP A;  4BNC A;  5EG0 A;  5FLX Z;  5L3C A;  3HOX J;  3DFG A;  2BVM A;  2WB1 A;  3PSF A;  3CCJ I;  5K7Z A;  2F2E A;  2LD5 A;  2HR3 A;  1XPX A;  2RKH A;  3I64 A;  2XF5 A;  5E1W A;  3SJM A;  2M8G X;  5DTD A;  4BAY A;  2QQ8 A;  1MJB A;  3ISP A;  1LE8 B;  3AL0 B;  1LDJ A;  3GUD A;  3N97 A;  1LKX A;  2WBM A;  3GFM A;  4F93 B;  2VOO A;  1YO5 C;  1D0Z A;  1ZN2 A;  4A3D J;  2J5O A;  4C3I J;  4D5F A;  4ENN A;  2R7O A;  3L7W A;  2P5K A;  1YIT I;  1CQT A;  3BLY A;  4A6D A;  1V5G A;  3P9I A;  4Y4R A;  2Z1D A;  5CQE A;  4BDZ A;  1XDS A;  4FIS A;  1SD7 A;  2H1L A;  4HF1 A;  2E1O A;  2FE3 A;  4LLL A;  2NOJ B;  2H27 A;  2F4I A;  5KCM A;  1N78 A;  3HJE A;  4A3C J;  1WWX A;  1S7A A;  3U1D A;  4CYD A;  2DA5 A;  3BG6 A;  1XGS A;  5CKT A;  4C2T A;  4AM3 A;  4Q5S F;  2VQC A;  1NH3 A;  1RIO H;  1QU3 A;  3OWT A;  1JXS A;  1P2F A;  5J1Y A;  3BTC A;  2AQE A;  1OMI A;  1R6R A;  1IW7 F;  1XMA A;  2IEK A;  1ETX A;  3V7S A;  4U0V A;  5JI6 A;  3KLN A;  3TW7 A;  4QWQ A;  5TJJ A;  3PFI A;  4WF2 A;  3HSE A;  3GTQ J;  2QBY B;  1JT6 A;  4NC8 A;  1N25 A;  1MMG A;  3QOD A;  2HKO A;  1MIJ A;  2XV4 S;  3BTL A;  1IN5 A;  3DKY A;  4BE1 A;  2OZU A;  3S2D J;  4LG3 A;  4XRF A;  4BH9 A;  3I0T A;  3Q0U A;  1TTY A;  2UUZ A;  2P7C B;  3PL8 A;  3BR0 A;  2HOA A;  1IN8 A;  4UNO A;  1ONV A;  1EKE A;  3TP3 A;  2R7T A;  2XRN A;  4V2G A;  1T98 A;  3FX3 A;  1FWZ A;  4J00 A;  3L1P A;  3FKJ A;  1I3A A;  4RB1 A;  4L0Z B;  3OR1 C;  2DBB A;  1FBQ A;  3NAU A;  4Y15 A;  3FXM A;  3WTX C;  3CF2 A;  3ELK A;  2C6Y A;  4JOM A;  1WJC A;  2DMT A;  4L0Y B;  3HYI A;  5K5O A;  1Z05 A;  2PLY A;  4JYK A;  2GXA A;  2W84 A;  2D45 A;  3HSR A;  5ICF A;  5D4R A;  5BNG A;  2XB5 A;  4DGW B;  1B8I A;  2ELJ A;  4G7O F; 
#chains in the Genus database with same CATH homology
 3ROU A;  5JVT A;  4HYE A;  3SHF A;  3NEU A;  3O3K A;  1ZRE A;  1BI3 A;  4XBF A;  1L3L A;  4M9S A;  1S8N A;  4EM0 B;  3F8M A;  4AWX B;  1DPU A;  1FC3 A;  2O6G E;  3RJP A;  1CF7 A;  2F5D A;  2EFW A;  5A2Q Z;  3PQK A;  2MD5 A;  1IRG A;  1SAX A;  1YW9 A;  3RKX A;  3K0L A;  1PDN C;  3LAJ A;  3EET A;  2Y75 A;  2EA2 A;  2G7U A;  2QQA A;  1OYI A;  4IVN A;  1XN7 A;  1P4A A;  4M6Y A;  5FLX K;  2RDP A;  2M87 A;  3M1E A;  3DKW A;  4KUM A;  1FX7 A;  5LRR A;  3QRF F;  3LQQ A;  4N9H A;  3WU1 B;  1U78 A;  3BJ6 A;  4HX8 A;  2RN7 A;  1J75 A;  4G8X A;  1I1S A;  1G3T A;  2A61 A;  2YX7 A;  4KT5 C;  1U6G A;  3L2C A;  3KZY A;  4G94 A;  4O6J A;  1JE8 A;  4HV5 A;  5D5U B;  3GX4 X;  5JHU A;  4MHG A;  5ILU A;  5LGT A;  4MQV A;  1LEB A;  2CG4 A;  1SD6 A;  4RB2 C;  4K2E A;  2FBH A;  1KU2 A;  2VT2 A;  1R5G A;  3BRO A;  4HDU A;  1ZLJ A;  4L5I A;  2ZME B;  1Z6T A;  1HSJ A;  4UVA A;  1UCR A;  3HTU A;  2DT5 A;  4GYI A;  1IUY A;  2A3S A;  3EQL F;  5DUI A;  4MTE A;  2WTE A;  2DLL A;  4HAM A;  1UB9 A;  2FU4 A;  3TOA A;  1W7P D;  1G3S A;  4S05 A;  3HRS A;  2Y48 A;  2Z5U A;  4LK1 F;  4BHB A;  5HLH A;  1PP8 F;  2V1X A;  4I0A A;  4RGX A;  2M30 A;  2ZXJ A;  1U5T A;  2F5F A;  2KRF A;  4N9I A;  2HYF A;  4HX7 A;  1T38 A;  3KP3 A;  5HS7 A;  1FP2 A;  2DO7 A;  3AAF A;  2YX4 A;  3GW2 A;  4IXA A;  3MWM A;  3LAP A;  4GCV A;  2W57 A;  3GFI A;  3QOP A;  2W24 A;  3R0J A;  4HX4 A;  1QZZ A;  1IRF A;  4GYG A;  3M8F A;  5HVQ C;  1ON1 A;  5DCM B;  3JSP A;  5CYV A;  2CGP A;  4H0E A;  1KQ9 A;  3WTZ A;  4WK8 F;  2CSO A;  1J5Y A;  1TBX A;  1B59 A;  4XLP F;  3DP7 A;  2H6C A;  2GIV A;  1AOY A;  1DP7 P;  5L3F A;  3G73 A;  2KIF A;  2UXX A;  5ERI A;  3RDI A;  5A2Q K;  2A69 F;  1KA8 A;  3IWZ A;  1J9I A;  2O0Y A;  3FM5 A;  1GXP A;  5F6F A;  3HHG A;  2MH2 A;  3RKY A;  2DFI A;  1YW8 A;  5E1Z B;  2P8T A;  1K79 A;  4RGU A;  3GZ6 A;  3WU0 A;  1D3Y A;  2DK8 A;  3ZN1 A;  2KJC A;  3QPH A;  5CVV A;  1B6A A;  3I59 B;  1USS A;  3VB2 A;  1FBU A;  4XLN F;  4Q47 A;  4Z2Y A;  2RQP A;  1ZAR A;  3TDU C;  4OIR F;  5TRD A;  5DD8 A;  4M6X A;  2FXA A;  5DEQ A;  1J2X A;  4O5V A;  1Z9C A;  2V1D A;  4MGR A;  1O7L A;  2VE9 A;  4P9F A;  3ECO A;  4GXO A;  3TGN A;  1GVJ A;  4MEY F;  3BWG A;  1ZYR F;  1HW1 A;  4AIK A;  3GXO A;  3LQR A;  1FY7 A;  3TQN A;  3KEO A;  2RC4 A;  3JW4 A;  3E6D A;  3IKV A;  2CW0 F;  3F8B A;  5D8L B;  4UV9 A;  2P6T A;  4G7Z F;  1HKT A;  4EMS A;  4P9U A;  1YW7 A;  2HDC A;  4EM2 A;  2Z33 A;  5H20 A;  3ZMD A;  3ZN0 A;  2PMU A;  4M9X A;  2R7D A;  4BYY A;  2YSR A;  5E18 F;  3REO A;  3WGI A;  2CO5 A;  4RAY A;  4A5M A;  5CJ9 A;  4RB0 A;  2OQR A;  4NHJ A;  2HWV A;  3RPU A;  3FXR A;  2LNB A;  4M72 A;  3RPQ A;  2UWM A;  2KJB A;  2X0L A;  1CGP A;  2K02 A;  5AON A;  1SFX A;  4LFU A;  3ZMT A;  4CDG A;  5IT3 A;  1OR7 A;  4EVI A;  3KET A;  3Q5F A;  4ZYH A;  1OKR A;  1Y0U A;  5E17 F;  1BI1 A;  2H6B A;  1B9N A;  2VT3 A;  5E1X A;  3P9C A;  4I7H A;  2STT A;  2FSW A;  4I98 B;  2NNN A;  4OOI A;  1FZP B;  1BI0 A;  4NB5 A;  3F72 A;  1YIO A;  3GFL A;  2EWN A;  4L5J A;  1K78 A;  2W25 A;  2OQG A;  3WTT C;  5K1Y A;  2OZ6 A;  3ZMS A;  2AXL A;  1SD4 A;  2NAZ A;  3QAH A;  1LDK B;  2FOK A;  4FHT A;  3LA3 A;  2HKX A;  4EV0 A;  2FNA A;  2JSC A;  2VBY A;  4HDV A;  1KQ8 A;  1D5V A;  5J6X A;  4LG0 A;  5HS8 A;  3FXQ A;  2XKP A;  2OBP A;  1XD7 A;  4AIJ A;  1KU9 A;  4HF2 A;  4HF0 A;  5J8C A;  4M73 A;  2J5P A;  2B0L A;  5LHI A;  2HFH A;  2EFO A;  4UVB A;  2FBI A;  2WWY A;  5D4S A;  4PGG A;  5HDN A;  4L9V A;  3HIF A;  3NQO A;  1J7K A;  4P5O A;  5HDG A;  1S7O A;  3F3X A;  1W7P A;  1IZ1 A;  2BBY A;  3H3Z A;  1IF1 A;  4JQF A;  2UZK A;  5L3E A;  2QM3 A;  4I01 A;  2Q2E A;  3JSO A;  3WG9 A;  4U7B A;  5ICC A;  3E6C C;  2NNY A;  1E17 A;  3K1N A;  1T2K A;  2YR2 A;  5L3G A;  1B9M A;  4TV7 A;  4RGS A;  3MCZ A;  3LST A;  2PN6 A;  2FQ3 A;  2XKO A;  2M8E A;  4NQW A;  3MAJ A;  3I54 A;  4ZZD A;  1PP7 U;  2V1U A;  4BQA A;  1BIA A;  1T39 A;  3I4P A;  3JTG A;  2L54 A;  1ZGA A;  2QZ8 A;  2BEO A;  2EFN A;  1F1Z A;  3EYI A;  2OD5 A;  1WKM A;  3DPL C;  4U88 A;  3COA C;  4FT8 A;  4Q4Z F;  4M74 A;  5HOO A;  4A6E A;  3SZT A;  4UVC A;  3E97 A;  1XSX A;  1B1B A;  4QLC U;  4LD5 A;  4KIB A;  1AWC A;  2DK5 A;  2VON A;  4CO8 A;  3EYY A;  2Z3Y A;  1LEA A;  3K1P A;  2P6S A;  1ON2 A;  2MLK A;  5JFR A;  2PBI A;  5AIQ A;  1GHC A;  2RNJ A;  2YPR A;  3TDZ C;  4Y17 A;  3WGH A;  1RZ4 A;  3B73 A;  4ETS A;  1ODD A;  4WXC A;  4GGG A;  6PAX A;  3I5U A;  3TO9 A;  4LJZ F;  4ESF A;  4AD9 A;  3WTS C;  2FMY A;  3LWF A;  2FF4 A;  1Z1D A;  4EJW A;  3QU6 A;  4OIN F;  4UUV A;  4KDP A;  4ESJ A;  4B09 A;  1WRJ A;  1XCV A;  3WTY C;  1STZ A;  5D6E A;  2LDU A;  3IWF A;  3CTA A;  1FP1 D;  3H92 A;  2H94 A;  4OU0 A;  3GLX A;  2H09 A;  4OIO F;  4KYW A;  1UFM A;  3LA2 A;  1WI9 A;  5LLQ A;  3F22 A;  4PGH A;  3V4G A;  3CUQ B;  2ESN A;  1DPR A;  1P4X A;  2FEZ A;  4OIQ F;  3G3Z A;  2XHK A;  2Z99 A;  1ZRD A;  3BJA A;  1HKS A;  3WTV C;  4EGY A;  5FB2 A;  2XVC A;  1EH6 A;  3ULQ B;  3GYH X;  1XSD A;  2E1C A;  1RUN A;  1G3Y A;  2K7L A;  2MA3 A;  1TW2 A;  4HBL A;  4ASN A;  2HQR A;  4LGW A;  1O57 A;  1U8R A;  3WGG A;  4XSX F;  5BPD A;  5IT9 Z;  1HW5 A;  4CIC A;  1EV7 A;  2A68 F;  3W6K B;  5DD4 A;  4EJT A;  3ERE D;  2IA2 A;  1O7F A;  3R6S A;  2VXZ A;  4YFN F;  3HRT A;  3BPX A;  1IN6 A;  1R1T A;  2ESH A;  4LB6 B;  2VBW A;  2GWR A;  5CVR A;  2QVO A;  1FLI A;  2PQ8 A;  2LF8 A;  3E6B A;  1TNT A;  2O03 A;  2EV5 A;  1Z91 A;  5BS6 A;  4U7D A;  2JRT A;  2XAH A;  1HBX G;  4HLX A;  1ZGJ A;  3WTU C;  1BM9 A;  1FYM A;  1R1U A;  1TW3 A;  2QBY A;  3HOT A;  3CDH A;  2WC2 A;  3J7A O;  5BOX A;  5KK1 A;  2DI3 A;  5LGU A;  3FZV A;  1ZH5 A;  3RYP A;  3KZZ A;  1GXQ A;  3WOD F;  3CUQ C;  2QWW A;  1JHH A;  1P92 A;  3F8C A;  2BE5 F;  2OA4 A;  3ZQ7 A;  3K1M A;  1KQ0 A;  4DNC A;  4IRH A;  4L9T A;  1FOK A;  4EGZ A;  4ENM A;  2HTS A;  3M9A A;  3WTW C;  1G6N A;  2ETH A;  3L00 A;  5BPI A;  4UXN A;  2QYO A;  1KU3 A;  3GO5 A;  4Q48 A;  3N4M A;  1IN7 A;  2XAG A;  2PI0 A;  1XGN A;  2EFQ A;  4ESB A;  2V9V A;  5D8K B;  3J81 Z;  2E7W A;  1LNW A;  1F5T A;  5E20 A;  2M45 A;  3L09 A;  4R79 A;  3QP6 A;  1HQC A;  1LJ9 A;  3I71 A;  4FX4 A;  3ZMV A;  1YG2 A;  2VBZ A;  3F6V A;  3T1B A;  1I6X A;  2M5W A;  4EQQ A;  5LEJ A;  2K4B A;  3TO7 A;  2GXG A;  2P5L C;  1QBJ A;  2L3D A;  1WSU A;  3BJO A;  3F23 A;  3DQV C;  4KN7 X;  5K5R A;  1U2W A;  1YS7 A;  2STW A;  4IRI A;  1XDU A;  5FFZ A;  5LEK A;  2VN2 A;  2WV0 A;  3OV8 A;  1TQI A;  4LMY A;  2X4H A;  1MDM B;  3O6B B;  2IRF G;  2GA2 A;  3HTS B;  4EJV A;  2KIM A;  1H9T A;  4HW0 A;  1XB4 A;  2FRH A;  3HHH A;  1FYK A;  3RKW A;  5IT9 K;  2HS5 A;  1KU7 A;  4F7Z A;  3RI4 A;  1MGT A;  3DF8 A;  5F1R A;  2A5Y B;  4IHT A;  4BHP A;  2DQL A;  1P4W A;  3C1D A;  2LF7 A;  3V7R A;  1RI7 A;  2JPC A;  1REP C;  4WXH A;  3E6M A;  3DV8 A;  4AIH A;  4XSZ F;  3V8J A;  5D6F A;  2ZME A;  2CFX A;  3H3U A;  3SZP A;  3QPT A;  1C0W A;  1T6S A;  4A0Y A;  1Z7U A;  3E3V A;  1ULY A;  3HRM A;  3KP4 A;  2ELH A;  1FT9 A;  5ILS A;  2YU3 A;  4OMZ A;  2HTJ A;  1LQ1 A;  1V4R A;  2MH9 A;  2OU2 A;  1QQI A;  1TLH B;  3DXJ F;  4I02 A;  2EFP A;  1FNN A;  1YLF A;  2XRO A;  2V79 A;  4UV8 A;  2CWE A;  3B02 A;  3V7C A;  3BOQ A;  3KCC A;  2BYV E;  1SD5 A;  1W5T A;  1SMT A;  1R5H A;  1UHW A;  4MTD A;  2PMH A;  4IPA A;  3ZP5 A;  2XAQ A;  5BMZ A;  5DCM A;  1MZB A;  2PEX A;  4WXD A;  3BPV A;  3RTR A;  1TNS A;  2MBF A;  3KP6 A;  2IA0 A;  4HLY A;  3J81 K;  4MEX F;  1QGP A;  1ZG5 A;  4ZYE A;  3IHU A;  5HLG A;  2A07 F;  3SXY A;  3T5X A;  5BQT A;  2DQR A;  4O3M A;  1SMY F;  2FBK A;  2M1B A;  3IC7 A;  4Y13 A;  1IXS B;  1ZLK A;  1BJA A;  2HYG D;  1IXC A;  4LLG F;  1O3Q A;  1R36 A;  4M71 A;  3R61 A;  1I27 A;  3HRU A;  1CF7 B;  2ISZ A;  2VOP A;  2IJL A;  5DV5 A;  4M9Z A;  4LB5 A;  2K4J A;  4EJO A;  4LK0 F;  1YTY A;  5LHG A;  4G7H F;  3I59 A;  3R4K A;  4UHT A;  4B8X A;  2IT0 A;  3M7G A;  3WE3 A;  5E8G A;  1U3E M;  5DCF A;  2XGX A;  5CVU A;  2NS0 A;  1ZHF A;  3CLO A;  1I5Z A;  3C18 A;  2L02 A;  1O3T A;  4HOB A;  1DDN A;  1OPC A;  1WQ2 A;  4BHC A;  5EEG A;  1YFH A;  3IKT A;  3E5X A;  2CYY A;  1BI2 A;  4IF4 A;  3PQJ A;  4L18 B;  2ZBK A;  1TQP A;  5FD5 A;  2QUF A;  3MQ0 A;  4EM1 A;  5ILV A;  1BIB A;  1TQM A;  1XGO A;  1BBY A;  2ZKZ A;  5DUK A;  4LLN A;  1MJ9 A;  4KMF A;  2UXN A;  4HA8 A;  1HST A;  3QU3 A;  4P96 A;  2F5C A;  3FMS A;  2D1H A;  2EJR A;  1F4K A;  1SFE A;  1A04 A;  1O3S A;  3JAM Z;  5ICE A;  2COM A;  1YYV A;  1W4M A;  1NHA A;  1U5T B;  3KP5 A;  4CHU A;  1D8J A;  5CVI A;  4KNY A;  4BXU A;  3KE2 A;  1J59 A;  2G7H A;  2D1V A;  1BC7 C;  5L3B A;  2MLG A;  1KYZ A;  2CQK A;  2JPB A;  2TDX A;  3VOD A;  3K9T A;  3FMQ A;  3KFW X;  3I58 A;  2IVM A;  5KVR A;  2L4A A;  2VC0 A;  5JR3 A;  3FM3 A;  4KIF A;  1P6R A;  2ZNY A;  1ZAO A;  3HOS A;  2P5V A;  2XIG A;  2QEN A;  5D5V B;  3I53 A;  2EK5 A;  4S04 A;  3GF2 A;  2O61 A;  2ZFW A;  4RS8 A;  2XUB A;  4ON0 A;  2DPD A;  2Q0O A;  1UHM A;  3V8L A;  2DW4 A;  1FSH A;  2ADU A;  1K7A A;  3P7N A;  3GEZ A;  1UST A;  3OOP A;  4R8H A;  4ZYG A;  4YII A;  5FFX A;  1J0R A;  3LA7 A;  4HZF A;  3D0S A;  3MZH A;  5CLS A;  1W5S A;  2L01 A;  2G9W A;  1QO0 D;  4HQE A;  2IP2 A;  3E5Q A;  3RYR A;  1S3J A;  1FSE A;  1FPQ A;  3F6O A;  5ICG A;  3U2R A;  2QQ9 A;  4EJU A;  3BP8 A;  4IHS A;  3KLO A;  1OYY A;  2K27 A;  5LBQ A;  1HW2 A;  3U9G A;  3JTH A;  1O3R A;  2PJP A;  1V3F A;  5AIP A;  1QZY A;  2R3S A;  3ML6 A;  4KIC A;  4YIF A;  3GWZ A;  1U5T C;  4D0P A;  3RIR A;  2PG4 A;  3F8N A;  3E5U A;  3K2Z A;  2KKO A;  1R58 A;  2VC1 A;  3J80 Z;  4CGZ A;  1R1V A;  2ZCW A;  1LDD A;  5HDK A;  3SFZ A;  1FBS A;  1IN4 A;  3QP5 A;  3T8R A;  1XMK A;  1RNL A;  2P4W A;  1BC8 C;  3VEP A;  1ZG3 A;  2BV6 A;  2DTR A;  1OYW A;  1S6L A;  3VOE A;  1QPM A;  3ABT A;  2AS5 F;  3IL2 A;  2ZJ2 A;  3JAM K;  2V6C A;  3MZY A;  2JT1 A;  1EH8 A;  4WCG A;  2HOE A;  4I0B A;  1I1G A;  2O3F A;  3T8T A;  2E7X A;  1XCB A;  2ACJ A;  2A6E F;  2EV0 A;  2RVC A;  2DU9 A;  3MFK A;  4RGR A;  2HGC A;  5LHH A;  3R0A A;  3Q9V A;  3IRQ A;  4DQ2 A;  1H0M A;  1R7J A;  3NRV A;  1JHF A;  3MEX A;  3HSF A;  5LRS A;  5FO5 A;  3FHZ A;  3BDD A;  2A6H F;  2DPU A;  2XAS A;  1MKM A;  2IA1 A;  2FA5 A;  4CXF A;  2Z9O A;  3TOB A;  4U0W A;  3M8E A;  5CVJ A;  3FXU A;  5D5X B;  3FMR A;  2XAF A;  1R00 A;  3KP2 A;  3V8K A;  3ZPL A;  2BGC A;  2NYX A;  1IAW A;  2NRA C;  4JBA A;  5EEH A;  4PCQ A;  4ZYD A;  2QLZ A;  2GXB A;  1K78 B;  4MQ9 F;  2ZNZ A;  4MNU A;  4IJA A;  2O8X A;  1F9N A;  5D5W B;  4ZH4 F;  1ZRC A;  5DDG A;  1QNT A;  1S29 A;  4YFX F;  2GAU A;  2GZW A;  4A12 A;  5E8I A;  2GA1 A;  2PFB A;  4GO1 A;  1L0O C;  5F64 A;  3CUQ A;  3CO7 C;  4LG0 B;  2W85 A;  4YFK F;  4N0B A;  4L9J A;  3F21 A;  4PDK A;  3ZMZ A;  3EDP A;  1KYW A;  4RAZ A;  2VE8 A;  1HXD A;  2EV6 A;  4A0X A;  2F5E A;  3J80 K;  3F8F A;  1X3U A;  2VBX A;  1W7P B;  2ZO4 A;  1R23 A;  4KMU X;  5ED4 A;  5H6R A;  5L3D A;  4A0Z A;  1SFU A;  2P7V B;  4WX9 A;  1MJA A;  2E1N A;  2RV8 A;  3L9F A;  5J8F A;  3TKY A;  4FX0 A;  1LVA A;  2XAJ A;  2IW5 A;  3WE2 A;  3DPT A;  3SQN A;  1LB2 A;  2HQN A;  4A2U A;  4L9N A;  4JK1 X;  5K5Q A;  4KIG A;  3K69 A;  1EH7 A;  4KN4 X;  3TO6 A;  2LSO A;  1RUO A;  1KGS A;  4AVP A;  3KP7 A;  1VTN C;  4P55 A;  4HV6 A;  3CO6 C;  4G6Q A;  5HLI A;  1K6O A;  3ZMU A;  4KA4 A;  2QQB A;  3P9K A;  4KFC A;  3VFZ A;  3FWE A;  3R60 A;  4I2O A;  3T0Y A;  5H6Q A;  3Q9S A;  1FYL A;  4G6D A;  1T0F A;  1YS6 A;  3KEQ A;  1IXR C;  3GFJ A;  3CJN A;  2Y0M A;  1D8K A;  2D2W A;  2L4M A;  2GQQ A;  1JGS A;  1BOA A;  3S2W A;  1XSV A;  1Z6R A;  2HZT A;  1ZRF A;  3EUH A;  4ENK A;  1XGM A;  2IPQ X;  4I09 A;  2OAZ A;  5HS9 A;  3BY6 A;  3D5L A;  4A5N A;  1G4D A;  1B4A A;  4E70 A;  2FML A;  4U0Y A;  3W6J B;  3GZ5 A;  3BZ6 A;  4CZZ A;  4IRG A;  5FD6 A;  5DYM A;  4PZJ A;  3GVA A;  2RGV A;  3DEU A;  1G3W A;  1ZG1 A;  1E2X A;  2MC3 A;  1DUX C;  1BN5 A;  4HQM A;  2EB7 A;  2KIU A;  5LGN A;  1H9G A;  2VOD A;  2EA4 A;  3LFK A;  4OIP F;  1YQA A;  2JTV A;  4YG2 F;  3IRR A;  4WWC A;  1R22 A;  1MD0 A;  4R1H A;  2HEO A;  4ZZL A;  5FGM A;  3HUG A;  2R7F A;  3ABU A;  4ENJ A;  1PUE E;  1MDM A;  1Q1H A;  3C7J A;  3ECH A;  3O2P E;  4RB3 C;  2ISY A;  2DAO A;  4OMY A;  3CUO A;  3C3W A;  2K86 A;  4G9Y A;  2Q8K A;  3FF5 A;  2JZY A;  2FNP A;  1HKQ A;  2LKP A;  4BNC A;  5FLX Z;  5L3C A;  3DFG A;  2F2E A;  2HR3 A;  2RKH A;  3I64 A;  5E1W A;  4BAY A;  1MJB A;  3ISP A;  1LDJ A;  3GUD A;  3N97 A;  3GFM A;  2VOO A;  1YO5 C;  1ZN2 A;  2J5O A;  4ENN A;  3L7W A;  2P5K A;  4A6D A;  3P9I A;  1XDS A;  1SD7 A;  4HF1 A;  2FE3 A;  4LLL A;  2H27 A;  1WWX A;  1S7A A;  3U1D A;  4CYD A;  4Q5S F;  1XGS A;  1RIO H;  1JXS A;  1P2F A;  1OMI A;  1IW7 F;  1XMA A;  3V7S A;  4U0V A;  5JI6 A;  3KLN A;  4QWQ A;  5TJJ A;  3PFI A;  4WF2 A;  3HSE A;  2QBY B;  2HKO A;  2XV4 S;  1IN5 A;  2OZU A;  4XRF A;  4BH9 A;  3I0T A;  1TTY A;  2P7C B;  1IN8 A;  4UNO A;  1ONV A;  2XRN A;  1T98 A;  3FX3 A;  1FWZ A;  4RB1 A;  4L0Z B;  2DBB A;  1FBQ A;  4Y15 A;  3WTX C;  3ELK A;  2C6Y A;  4L0Y B;  3HYI A;  5K5O A;  1Z05 A;  2PLY A;  2W84 A;  2D45 A;  3HSR A;  5ICF A;  5D4R A;  4G7O F; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...