2ZMEA

Integrated structural and functional model of the human escrt-ii complex
Total Genus 69
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
69
sequence length
217
structure length
217
Chain Sequence
AQMSKQLDMFKTNLEEFASKHKQEIRKNPEFRVQFQDMCATIGVDPLASGKGFWSEMLGVGDFYYELGVQIIEVCLALKHRNGGLITLEELHQQVLKGRGKFAQDVSQDDLIRAIKKLKALGTGFGIIPVGGTYLIQSVPAELNMDHTVVLQLAEKNGYVTVSEIKASLKWETERARQVLEHLLKEGLAWLDLQAPGEAHYWLPALFTDLYSQEITA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Integrated structural model and membrane targeting mechanism of the human ESCRT-II complex
pubmed doi rcsb
source organism Homo sapiens
molecule tags Protein transport
molecule keywords Vacuolar-sorting protein SNF8
total genus 69
structure length 217
sequence length 217
ec nomenclature
pdb deposition date 2008-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF04157 EAP30 EAP30/Vps36 family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zmeA02
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2zmeA03
4NQWA 4G9YA 4KA4A 2V79A 1UFMA 5CLSA 2P5LC 1FC3A 2X4HA 3L00A 3F21A 4O3MA 3QU6A 3IC7A 2W85A 3HRTA 5DCFA 5BPIA 3H3ZA 4MNUA 3VOEA 1I27A 3CUOA 5DUKA 3C7JA 3RKXA 1I1SA 3QAHA 4IRHA 4QWQA 1W5SA 1OYIA 4EMSA 3PQKA 3CJNA 2FNAA 4FHTA 1YW8A 3V7RA 1USSA 2QQBA 3GLXA 3K1MA 4PZJA 4G7OF 3QRFF 1XD7A 1H9GA 5K5RA 1YW7A 2K27A 3MWMA 1G3YA 1KU7A 4WXHA 2P6TA 2L54A 3IWZA 1YW9A 3P7NA 5E1WA 4Y13A 1HXDA 4LB6B 4UV8A 3HYIA 1SFUA 5HS8A 1IF1A 2PG4A 4KMUX 3BY6A 2P4WA 2IA2A 3QOPA 4OINF 2XIGA 2KJCA 3S2WA 4CYDA 2QQAA 2WTEA 5EEGA 3ECOA 3KP3A 4R79A 3DPLC 5IT3A 1BC7C 3EUHA 2PI0A 3V8KA 1CGPA 5ICEA 2PN6A 2Z9OA 1IZ1A 5D4RA 3FMQA 1R1VA 1K79A 4L0YB 2HS5A 1T0FA 4RB2C 3E5UA 3I54A 4U0WA 3TO7A 2XAHA 4Q4ZF 1SFEA 4U7DA 1J9IA 3SXYA 3MZHA 3FM5A 2WV0A 1KU3A 1K78B 2IJLA 5ILSA 2Z99A 4BQAA 3K1NA 1YTYA 1R23A 3SQNA 2KIFA 3WTSC 4U0YA 1KU2A 3J7AO 3C18A 3F22A 2VC0A 4ON0A 1ZN2A 1W7PA 3WE3A 2M87A 2A61A 2IW5A 1TW3A 2XAJA 3RI4A 1MJBA 3M7GA 5FLXZ 5L3DA 3QPTA 3RIRA 5FLXK 4BAYA 5JR3A 4G8XA 1IXCA 2R7DA 1XDUA 1HW5A 2HTJA 1FOKA 2M5WA 1LEAA 1HKTA 4UV9A 5ILUA 1IXRC 4PGHA 1ZGJA 3HTUA 2Q8KA 4UVAA 5ICFA 3MCZA 2HQNA 2JPBA 2ZBKA 3M8EA 1O57A 2A69F 2ACJA 3P9IA 1QO0D 3ZMSA 3TQNA 3BP8A 4IPAA 4EJUA 1R7JA 5HLIA 5LRSA 3LA2A 1QBJA 2LF7A 4KUMA 4ENKA 4RGUA 1YQAA 3T1BA 3ZPLA 1QGPA 2W25A 4IJAA 4HLYA 2X0LA 4A6DA 5J8CA 2L4AA 4MEXF 5CYVA 2P8TA 4XSXF 5LHHA 2RVCA 3HRUA 4EM2A 1FT9A 3R61A 2PEXA 1QQIA 4DNCA 5KVRA 5DD4A 4ETSA 4L9TA 5TJJA 2HYFA 4WF2A 3WTVC 3WU0A 4IRGA 1S7OA 1Z6TA 2ZNZA 4YFXF 3HSRA 3ZMVA 4ENJA 2YSRA 2V1DA 3EETA 3WTZA 3TO9A 1FWZA 1KYZA 4M74A 3F23A 1ZGAA 2M45A 3HOTA 2VBWA 4I98B 1ZLJA 5D6EA 4LGWA 3F3XA 2O0YA 3IKTA 2E1NA 2A3SA 3K1PA 5LEKA 2FMLA 3GFIA 4EJOA 5JI6A 5D6FA 3FHZA 2PFBA 5CVRA 4MGRA 1IN6A 1PP8F 1G3WA 4HAMA 1QZZA 3HRSA 3WODF 1LQ1A 3M9AA 3H92A 3JSPA 4AIKA 4KICA 5LGUA 3ZN1A 4L9JA 3R0JA 1FYMA 3OOPA 1ZG1A 1D8JA 1TLHB 5JFRA 3E6MA 2FEZA 2B0LA 1TBXA 1B1BA 3N4MA 1ZRDA 1FBUA 5E20A 3E97A 4LG0B 3LQRA 3OV8A 3KEQA 4A0XA 1P4AA 2MA3A 2M30A 4KYWA 3F8BA 2EFOA 2MH2A 2RNJA 3REOA 3CLOA 1F1ZA 2QZ8A 1ON1A 2O8XA 1BI0A 2GQQA 2P7CB 4ZYGA 2D2WA 1R5HA 2DO7A 1GHCA 3U2RA 4UHTA 5HLHA 4PDKA 3KP4A 2O03A 4EGZA 3JSOA 3C1DA 4OMYA 3K2ZA 3B02A 1G4DA 2CSOA 2KIUA 1WSUA 6PAXA 1ULYA 3BROA 3LA7A 1LDJA 1KQ0A 5ICGA 5D8LB 1RI7A 2EFQA 2XVCA 2CO5A 3G3ZA 4JK1X 4WCGA 5F1RA 2Z5UA 5BMZA 5JVTA 1J0RA 5FFXA 2MLKA 2HOEA 1CF7B 4MEYF 4ZH4F 3T8TA 1KU9A 3DQVC 1JHHA 1S3JA 1SD4A 2A07F 4KDPA 3JAMZ 4I09A 4OIOF 4ZYHA 3GZ5A 2GXBA 4QLCU 5H20A 2CWEA 3F8MA 3RYRA 3V4GA 1TQPA 3K9TA 3GFJA 2ZXJA 1EH6A 5H6RA 2ESHA 5IT9Z 2G7UA 5DDGA 3V7CA 1G3SA 5BPDA 2RQPA 3WTUC 3GUDA 5HVQC 2DU9A 1Z05A 4S04A 3ABTA 2M8EA 1YO5C 2V1XA 4TV7A 2E1CA 3BJAA 2LF8A 4K2EA 2VOPA 1B6AA 4KIFA 3RKWA 2KJBA 4H0EA 4G6QA 1TQMA 2UXXA 2F2EA 4KNYA 2WC2A 1BIBA 2DK5A 5AIQA 3JTGA 4G7HF 1Z1DA 4EVIA 4S05A 3HOSA 2LSOA 3ZMTA 3GW2A 3KP6A 2Z33A 1WWXA 1MJAA 1IXSB 3GYHX 1W7PB 3ZMZA 5FO5A 2D1VA 3WTYC 1E2XA 1OKRA 1I1GA 1R58A 4FX0A 4HW0A 4HF1A 2QQ9A 1EH7A 3O3KA 3I53A 4L5IA 1HSTA 3EDPA 2OD5A 1AWCA 4HBLA 4RGSA 4OIPF 4L5JA 2VBZA 1KA8A 4EM1A 4RAYA 3RKYA 3DFGA 2W84A 1SD5A 3TDZC 1J59A 2TDXA 4N0BA 2ZFWA 3RDIA 2FBKA 1I6XA 1UHMA 4MTDA 2RN7A 3F8FA 3F72A 2KRFA 2ISZA 5LEJA 1MDMB 2YU3A 3W6KB 4I0BA 4XRFA 4KT5C 5DCMB 5LHGA 2EFPA 1PDNC 3VEPA 1HW1A 1OR7A 5CVUA 5L3GA 3IL2A 1C0WA 3ZP5A 1XGNA 3RJPA 5A2QK 5A2QZ 3J80K 2A68F 2IPQX 1REPC 3ML6A 3IRQA 1LEBA 1NHAA 3FF5A 4LD5A 3ELKA 2PJPA 5DYMA 3LWFA 5AONA 1ZARA 3TOBA 3ZMDA 4ZZDA 2PQ8A 1MJ9A 1DPUA 2FOKA 4KIBA 1WRJA 2XAGA 2EJRA 3HIFA 2NNYA 5DCMA 2EWNA 2W24A 2L02A 3ZN0A 5FD6A 3I58A 5F6FA 1I5ZA 3DF8A 3DP7A 1KQ9A 1D5VA 1IN7A 2EV5A 4L0ZB 3N97A 4CHUA 1DP7P 2OBPA 1U5TB 5K1YA 1U78A 1P92A 1SD6A 1Z7UA 4RAZA 3W6JB 4EJTA 4Y15A 4L9NA 1IAWA 2XKPA 4Y17A 1Q1HA 2GAUA 1T6SA 5DV5A 4ESFA 2GWRA 3RTRA 2MBFA 3L2CA 1BBYA 1FBSA 4EV0A 4HV5A 2P5KA 4M9XA 3HHHA 1R5GA 1GXQA 2IA0A 5CVJA 1IW7F 1TW2A 3IHUA 4HV6A 3R0AA 4U0VA 2LNBA 1LVAA 4Q47A 2LKPA 4XLPF 1MGTA 5H6QA 3U9GA 2ZJ2A 2EFNA 2DI3A 4P9FA 4UNOA 5LGNA 3QP6A 3GX4X 3WG9A 1R36A 4I7HA 3BWGA 4A0ZA 4BHCA 1HW2A 3NEUA 2YX4A 4HX7A 4G94A 1UB9A 3DV8A 2H27A 4OIQF 2DT5A 2QVOA 2XKOA 3GFMA 3SFZA 1Y0UA 3V7SA 4LG0A 1IRFA 3HSEA 1U2WA 1U3EM 2OA4A 3HUGA 3FXRA 2JT1A 1F5TA 1EH8A 3LAJA 2AXLA 4MQVA 2ZNYA 5E1XA 3I71A 4RS8A 2H6CA 2BBYA 2QUFA 1TTYA 4I02A 5HOOA 2IRFG 2FQ3A 4IRIA 2QYOA 2UZKA 2XRNA 4EGYA 1GXPA 2VE9A 2ISYA 2ESNA 1T39A 3EQLF 4YG2F 2FMYA 3F6OA 4KN4X 4N9IA 2FA5A 4PGGA 3M8FA 2PMUA 3BPVA 4ASNA 2P5VA 5L3EA 1ZYRF 5EEHA 2P7VB 2W57A 3FZVA 5J8FA 4U7BA 5IT9K 4RB3C 5HDGA 1TNTA 2IP2A 1LNWA 2IT0A 3E6DA 1FP1D 2R3SA 3J81K 1Z91A 2YR2A 1FBQA 4F7ZA 2O6GE 2FU4A 2V9VA 4M73A 1O7LA 1WQ2A 3VFZA 4GYGA 1XMAA 5K5QA 4G6DA 3DXJF 2NNNA 2DFIA 4M72A 5TRDA 4Z2YA 4CO8A 5ILVA 1R22A 2F5DA 5L3CA 5ED4A 3BPXA 2J5OA 4A6EA 2QBYB 1L0OC 2JPCA 2RDPA 3Q9VA 1W7PD 1R1TA 3BOQA 3KEOA 5D5VB 5HDNA 5CVIA 2K4BA 1BI2A 1OPCA 4P55A 2DK8A 2K7LA 1P2FA 4B09A 3GVAA 4LLGF 2VBXA 1MKMA 2MLGA 1XGOA 1K7AA 2ZO4A 4RGXA 3TKYA 4EJWA 1DDNA 1USTA 2V6CA 3BDDA 1BM9A 5HDKA 4M6XA 3I59B 1RUNA 2OU2A 2FRHA 3Q9SA 1B4AA 1FZPB 1J2XA 2O3FA 4RGRA 1XCBA 4XSZF 3EYYA 3O2PE 4MHGA 3F6VA 2ZMEA 2Y48A 4ZYDA 4BYYA 2Q0OA 5L3FA 3P9CA 1B9MA 3AAFA 1SFXA 1SMYF 3MEXA 4HLXA 3GXOA 2H09A 4UXNA 4N9HA 1BOAA 1IN8A 2WWYA 4Q48A 3ROUA 3TOAA 3T0YA 4O6JA 4IHSA 3G73A 5E8IA 3ISPA 2HTSA 5HS7A 4BHBA 1O3QA 1ODDA 1ZG3A 1UCRA 2KKOA 5E1ZB 1IRGA 2FF4A 5BS6A 1ONVA 1T38A 3FM3A 1IN4A 2XUBA 2VOOA 1ZHFA 1F9NA 2DBBA 1HKQA 2MD5A 2XV4S 4U88A 5ERIA 3I59A 1S8NA 3IWFA 3FXQA 1UHWA 1STZA 1WKMA 4AIJA 1U8RA 2DQRA 4GGGA 3KCCA 4L9VA 1BJAA 3WTTC 3KZZA 3B73A 2XAFA 4FX4A 1TQIA 2EK5A 4HDUA 4KN7X 4OU0A 3GWZA 2Q2EA 2BE5F 3CUQC 4R8HA 4UVCA 2F5CA 2K4JA 1R1UA 1XSXA 4BNCA 1J75A 3LAPA 4LMYA 1HKSA 3WE2A 4JBAA 4A5MA 2XHKA 2K86A 3QPHA 1A04A 3T5XA 1YS7A 4HF2A 2P6SA 1KQ8A 4WX9A 2BGCA 5HS9A 2ADUA 5D5WB 4CGZA 2OZ6A 3T8RA 3M1EA 1HQCA 2HDCA 4HYEA 1RZ4A 2HZTA 4CDGA 2OQGA 1XCVA 3I64A 3LFKA 1QPMA 2HYGD 3J81Z 3WGIA 3ECHA 3GF2A 1LB2A 1U5TA 3KP5A 3V8JA 4ESJA 1W5TA 2HWVA 2GIVA 2VC1A 3NQOA 4P5OA 1R00A 2ELHA 1XMKA 3ULQB 2L4MA 5CVVA 2NAZA 4LB5A 1KGSA 2RC4A 2PLYA 2XGXA 3FX3A 3Q5FA 1GVJA 3R6SA 3K69A 4JQFA 3WGHA 1HSJA 3CUQB 3E6BA 3MFKA 2NYXA 1LDKB 2MH9A 4XBFA 1HBXG 5FD5A 3EYIA 4KIGA 4ZYEA 1OMIA 2Z3YA 1B9NA 3HSFA 1YIOA 2V1UA 3HHGA 1XSVA 3GEZA 2DQLA 5E8GA 2HGCA 3CTAA 4CZZA 3KP7A 3PFIA 2OQRA 1OYWA 1Z6RA 3IKVA 4OMZA 2RKHA 3HRMA 5HLGA 4A12A 3NRVA 2STTA 2G7HA 3I5UA 3E5XA 1BN5A 5ICCA 1E17A 1FX7A 2YPRA 5DEQA 3RYPA 4RB1A 1FYKA 1CF7A 2CW0F 1MDMA 4YFKF 2VBYA 4LK1F 4HOBA 3KLOA 2UWMA 4G7ZF 5CJ9A 4UVBA 4WXDA 2EA4A 3JTHA 2VT3A 3CO6C 2L3DA 1XDSA 1MD0A 1K78A 4WWCA 5D5UB 3GO5A 3H3UA 1JXSA 4ESBA 1MZBA 2HR3A 2VE8A 3CUQA 1TNSA 1DUXC 3CO7C 4HQMA 3L09A 3J80Z 4CXFA 3JW4A 4MTEA 1EV7A 1F4KA 1YS6A 3U1DA 3FMRA 2A6EF 5LGTA 1FY7A 1ON2A 2DPUA 3L7WA 2UXNA 2JTVA 4GXOA 5K5OA 4HX8A 2HEOA 2A6HF 4KFCA 1V4RA 5E17F 5LHIA 3D5LA 3LA3A 3PQJA 1JHFA 1ZG5A 2L01A 2GA2A 1O3RA 3LSTA 3MZYA 4AD9A 4ENNA 1FYLA 4HDVA 3IRRA 3WTXC 2CYYA 2QBYA 2IA1A 3KE2A 5LLQA 4ENMA 4UUVA 2HFHA 1J5YA 1VTNC 2DAOA 3GZ6A 4KMFA 3ABUA 1O3TA 1P4XA 4HF0A 2JRTA 2DW4A 1B59A 3F8CA 2DPDA 4MQ9F 2K02A 4FT8A 2YX7A 4HX4A 5LRRA 2LDUA 4M9ZA 5FFZA 4L18B 3SHFA 1ZREA 4I0AA 2O61A 5D8KB 4A2UA 4A5NA 5BQTA 2ZKZA 2IVMA 2QWWA 1IUYA 4M71A 3ERED 4P96A 1P6RA 1V3FA 2QM3A 3BZ6A 3DKWA 5L3BA 1XGSA 2DLLA 2RGVA 3P9KA 4O5VA 5FB2A 2XASA 2QLZA 4WK8F 4XLNF 3F8NA 4LK0F 3E6CC 2VODA 3VB2A 1D3YA 3V8LA 1P4WA 1DPRA 1H9TA 1Z9CA 4IVNA 4HQEA 1SAXA 3HTSB 1AOYA 1BI3A 1ZRCA 3SZTA 2HKXA 2F5EA 2JZYA 1FPQA 3CDHA 4EM0B 4OIRF 1YYVA 2J5PA 1QNTA 1PP7U 4B8XA 4IHTA 4GCVA 2OAZA 5DD8A 3RPUA 4Q5SF 1XB4A 5D4SA 4BHPA 2FXAA 1ZLKA 1SMTA 5D5XB 4ZZLA 4LJZF 1SD7A 2NRAC 1LJ9A 1KYWA 4EQQA 4GYIA 1YFHA 2C6YA 1FLIA 3MQ0A 1G6NA 2CQKA 2QENA 2EFWA 3I4PA 3WU1B 3SZPA 4YFNF 3WTWC 1QZYA 1ZRFA 1T2KA 3TGNA 2FNPA 4R1HA 3KFWX 2GXGA 1LDDA 2VXZA 2D1HA 2F5FA 1ZH5A 1O3SA 4M6YA 3QP5A 4YIIA 5LBQA 2CG4A 4RB0A 5J6XA 1T98A 3R4KA 2ZMEB 1IN5A 4NHJA 1U5TC 4P9UA 2VONA 2PBIA 3BJOA 3WGGA 2AS5F 4BH9A 2E7WA 3D0SA 2XROA 1U6GA 4YIFA 2EA2A 2D45A 4I01A 1FNNA 4IXAA 3COAC 4E70A 1BC8C 3C3WA 4PCQA 4EJVA 1O7FA 1FP2A 1FSEA 2CFXA 1H0MA 2EV0A 2MC3A 1RUOA 1D8KA 2GA1A 3FXUA 2JSCA 5BOXA 1JGSA 1S6LA 4BXUA 1RIOH 1OYYA 2XAQA 3TDUC 3GFLA 2BYVE 1FSHA 1S7AA 2FE3A 1XN7A 2VN2A 2FBHA 3TO6A 2PMHA 3DEUA 2KIMA 1G3TA 2VT2A 3KLNA 2FBIA 2HKOA 3MAJA 3R60A 3BJ6A 3VODA 4AVPA 2BEOA 2M1BA 2H6BA 2ZCWA 3K0LA 4OOIA 5E18F 4AWXB 1PUEE 5DUIA 3E3VA 3KETA 4LLLA 3ZMUA 4M9SA 3RPQA 2G9WA 5JHUA 1JE8A 4WXCA 2DTRA 1S29A 3I0TA 4CICA 2ETHA 5AIPA 2OZUA 1XSDA 1X3UA 4DQ2A 2EV6A 2Y0MA 5KK1A 4HZFA 1WI9A 1L3LA 2R7FA 2NS0A 2COMA 4HA8A 1BI1A 3JAMK 1YG2A 1ZAOA 5F64A 4IF4A 4A0YA 1K6OA 3L9FA 4D0PA 4NB5A 1RNLA 3ZQ7A 2CGPA 1W4MA 1BIAA 2H94A 1J7KA 2GZWA 3FWEA 2Y75A 5FGMA 3FMSA 4LLNA 3DPTA 2FSWA 4AIHA 3O6BB 3KP2A 2A5YB 1YLFA 4GO1A 3LQQA 3E5QA 3KZYA 2E7XA 2RV8A 1XGMA 4I2OA 3QU3A 2BV6A 2STWA 2EB7A 4LFUA 2HQRA
chains in the Genus database with same CATH superfamily
4XNFA 3F0CA 4NQWA 1XC5A 4G9YA 4KA4A 5J40A 2V79A 1UFMA 2ZSHB 5CLSA 4XMYA 2P5LC 1FC3A 1P9QC 3LNQA 2X4HA 3L00A 4BXXJ 1DGRM 5FKMA 4PJLA 3F21A 4O3MA 5FKLA 3QU6A 3IC7A 2W85A 5EF6A 3HRTA 5DCFA 5BPIA 3H3ZA 2K9MA 3DKXA 4MNUA 3VOEA 1I27A 3CUOA 5DUKA 1MMGA 1BOBA 3C7JA 3RKXA 1I1SA 2P81A 3QAHA 3OL4A 4IRHA 4QWQA 1DU0A 1W5SA 2EINH 3K7AJ 1OYIA 4EMSA 5DM7F 2H8WA 2PJRA 2Y9YA 1N78A 3PQKA 3CJNA 2FNAA 4FHTA 1YW8A 3V7RA 2Y31A 4E6KG 1USSA 3K70D 2HPMA 2QQBA 3GLXA 1IC8A 3K1MA 4PZJA 2DOEA 4G7OF 5FLVA 2ICWG 4Y3OA 2ME6A 2NVYJ 3QRFF 2B9SA 5IP7J 2R7XA 1XD7A 2IEKA 1H9GA 5EYRA 5K5RA 1ETWA 1YW7A 3OY9A 3CP8A 4BQOA 4FETA 2K27A 3MWMA 2XGEA 3W2WA 1G3YA 1KU7A 4WXHA 1WI3A 2P6TA 2ZXIA 3QPLA 4A3KJ 3OR1C 2L54A 4DZPA 3OIPA 3L2UA 2KDZA 1T0FC 3IWZA 4BQQA 5M3MJ 1YW9A 3OYDA 1B8IB 3P7NA 5E1WA 4Y13A 2H1KA 1HXDA 1ORKA 2VLAA 4LB6B 4UV8A 2K85A 5EGOA 3HYIA 2XSJC 1SFUA 5HS8A 1IF1A 2E5NA 2PG4A 2IGNA 2M7AA 5GPAA 4KMUX 1JJ6C 1Y1WJ 2DODA 3I9V2 3BY6A 2P4WA 2IA2A 3QOPA 4OINF 2XIGA 2KJCA 4HG2A 2BXYA 4HNVA 3S2WA 4EATA 4CYDA 2NS7A 2QQAA 2WTEA 4MFEA 5EEGA 3ECOA 3KP3A 4R79A 1WFXA 3DTEA 4UUSA 3DPLC 5IT3A 1SANA 1O4XA 1BC7C 5HNFA 3EUHA 3PJRA 2PI0A 1AU7A 3V8KA 4M3GA 3UKGA 1CGPA 3H5AA 4A3GJ 5ICEA 4B43A 2IAIA 2PN6A 2JQ7A 2Z9OA 1IZ1A 2VQLA 5D4RA 3FMQA 3J7AY 3H9QA 1WZ2A 3S1RJ 2E71A 3W2VA 1R1VA 1K79A 3PUFA 4BY7J 1ZQ3P 4L0YB 2HS5A 2FJ1A 1T0FA 2BHYA 4RB2C 3L2RA 3E5UA 3I54A 4MIMA 4U0WA 3TO7A 2FD5A 2XAHA 3OYNA 2WAFA 3LSPA 3Q0WA 4V2FA 4F3QA 4Q4ZF 1SFEA 4BDZA 4DJAA 3M1CA 4F93B 3PO3J 4U7DA 1J9IA 1K6YA 3SXYA 3MZHA 4AYBA 1T56A 2LREA 3FM5A 5EGOB 2WV0A 2WBMA 2QF7A 1KU3A 2EQRA 4RAFA 4XKWA 2NOGA 1JJ8C 1K78B 2OF7A 2IJLA 3ABKH 1YJ9I 3GMEA 2M2EA 5ILSA 2Z99A 3V42A 4BQAA 3K1NA 1YTYA 1R23A 3SQNA 1TP4A 2KIFA 2YS9A 3WTSC 3A0BC 4U0YA 1KU2A 2R0QC 3C18A 3J7AO 4FE4A 3F22A 1VQ8I 2VC0A 4ON0A 1ZN2A 1W7PA 2IS2A 3WE3A 4PSXA 2M87A 2A61A 3J7ZI 2IW5A 2XGDA 2DA1A 2HXOA 1TW3A 2XAJA 2I8DA 1DGWY 1MJBA 3RI4A 3M7GA 5FLXZ 5L3DA 3QPTA 3RIRA 1A36A 5FLXK 4BAYA 5JR3A 4G8XA 3CJRB 3HGGA 3OYBA 1IXCA 2R7DA 4IZZA 1XDUA 3ZRGA 1OLTA 1HW5A 2K9SA 4C30A 2IGKA 2HTJA 3I4MJ 1DU6A 1FOKA 2DYRH 1R9TJ 1VQ9I 2M5WA 2L9NA 2X1EA 2QCOA 1LEAA 3ZGKA 1XPXA 1HKTA 2KLOA 4UV9A 3LFUA 5ILUA 1IXRC 2M8GX 4PGHA 1ZGJA 3HTUA 2Q8KA 4UVAA 4ZDPA 5ICFA 4XONA 3MCZA 2HQNA 2JPBA 5E3MA 2ZBKA 3M8EA 1X4PA 1O57A 1LPQA 2MYSA 3HKZA 2LG4A 1I50J 1FMVA 2A69F 3P9IA 4CUGA 2ACJA 2L9RA 1QO0D 2LLKA 3ZMSA 3TQNA 3BP8A 3PNTA 4IPAA 4EJUA 2DXIA 1R7JA 5HLIA 2Z16A 5LRSA 4A3DJ 4E7IA 3LA2A 1QBJA 1JGGA 3FISA 3S3OA 2LF7A 5K7ZA 4DYRA 4KUMA 3TMOA 4ENKA 1B72B 1QZEA 3PFYA 4RGUA 4C2MJ 4A3JJ 3TW7A 1YQAA 3T1BA 3ZPLA 2XGCA 4D1QA 2QSGX 2CQXA 1QGPA 2W25A 3DWLE 4IJAA 4HLYA 2F6CA 2X0LA 4A6DA 3HL2A 5J8CA 1BR2A 2L4AA 2WAQN 1UG0A 5IOZA 1NH3A 4MEXF 5CYVA 3FKJA 2P8TA 4XSXF 5LHHA 1UZCA 2RVCA 5EJCA 4D7MA 1AKHA 3HRUA 4EM2A 1FT9A 2R7WA 1V5EA 3R61A 2PEXA 2FX0A 1PJRA 1ERDA 1QQIA 4DNCA 5KVRA 2A6TA 4ZJZA 5E3NA 2ZMEC 4U87A 3S16J 5DD4A 2X6YA 4XLEA 4ETSA 2NVQJ 4L9TA 2HNHA 2ECBA 5TJJA 2HYFA 4WF2A 2X1CA 5FKKA 3WTVC 4XLCA 3EPZA 3WU0A 4IRGA 1S7OA 1Z6TA 2ZNZA 3HOVJ 2CUZA 4YFXF 1WCMJ 5JVGF 3HSRA 3ZMVA 1MW7A 1OCCH 1WGXA 4ENJA 2VIXA 2YSRA 2V1DA 4QTRA 1B72A 4A3IJ 3GTGJ 2DYSH 5F0CA 3EETA 5GADJ 1ZELA 3WTZA 4FQGA 3TO9A 2PMZN 1ETKA 1FWZA 4HPQA 1KYZA 4M74A 2QKLB 3F23A 4RMNA 1ZGAA 1HLVA 3EUHC 1WJAA 2M45A 3HOTA 2VBWA 4I98B 1ZLJA 5D6EA 4LGWA 3F3XA 2XDVA 1PVEA 2O0YA 2VXDA 3IKTA 2E1NA 5FKNA 1N75A 2A3SA 3K1PA 5LEKA 1AKHB 2VJJA 2FMLA 4ABZA 2DFFA 3GFIA 1WJCA 4EJOA 2D5VA 4IQJA 5JI6A 4ZDOA 3SEQA 5D6FA 3WG7H 3FHZA 2DCEA 4E7ZA 2PFBA 5CVRA 2OTLI 2TRTA 5GTHC 1HOMA 4MGRA 1IN6A 2BY1A 4AUXA 1PP8F 1G3WA 1TL8A 4J01A 4HAMA 1QZZA 3HRSA 3WODF 2JJ7A 1IDYA 1IG7A 2ELJA 5IPAA 1LQ1A 3SZGA 2LK2A 3M9AA 3H92A 2XF6A 3JSPA 4AIKA 4KICA 5LGUA 3QYEA 3ZN1A 1K61A 4L9JA 3I56I 3R0JA 1WJ5A 2LTPA 3S8PA 1MNEA 3LOCA 3G1LA 1FYMA 1SVMA 3K4CA 2GOMA 3OOPA 1ZG1A 1D8JA 1TLHB 5JFRA 1X2NA 5IYBJ 4DW6A 1YE9A 2RREA 3OOUA 3E6MA 2FEZA 2B0LA 1TBXA 1B1BA 2BZTA 1OCTC 3N4MA 1ZRDA 1X3ZB 2W7NA 1FBUA 3BR3A 2CV0A 5E20A 3K6GA 3E97A 3LQRA 4LG0B 3KEQA 3OV8A 1SFOJ 3D5RC 3OS2A 4RAGA 3CCMI 3P5JA 4A0XA 4A3FJ 1P4AA 4IO9F 4E7LA 1MSEC 1VQ4I 2KT0A 2K5CA 2BY0A 3DPUA 2MA3A 2M30A 4KYWA 9ANTA 3LSJA 2DA5A 4E7KA 2HVSA 3F8BA 1JT6A 3A03A 3OWTA 1R71A 2EFOA 2MH2A 2RNJA 2PMZA 3REOA 3CLOA 3TP0A 3ZQHA 1F1ZA 2QZ8A 1ON1A 5J1UA 2O8XA 1BI0A 2L7FP 2GQQA 2P7CB 3W2AA 4ZYGA 2VQCA 4NQWB 1SVLA 2D2WA 1LKXA 3RQIA 4V19K 1R5HA 2DO7A 2MG4A 2Z2SB 3PNVA 2AO9A 1MBEA 4Y4RA 4LOCA 1XTAA 4YIRX 1GHCA 2AXTC 1OFCX 3BR5A 2I10A 3K4BA 4UHTA 3U2RA 5HLHA 4PDKA 2RNGA 3HJEA 3KP4A 1X1PA 3CCSI 3W6VA 1GUUA 2O03A 1UELB 4XK4A 3FKIJ 1Z7LA 4EGZA 3JSOA 3C1DA 1RR7A 1Y0NA 1Z21A 4OMYA 3OS1A 3K2ZA 2CUFA 3B02A 3Q3SA 1G4DA 2CSOA 2HVQA 2NVTJ 1MBJA 2KIUA 2PJRB 1WSUA 1BW6A 6PAXA 1ZK8A 1ULYA 3BROA 4A69C 2V4JC 5KAFC 2R4GA 3LA7A 1LDJA 1KQ0A 3GZNB 5ICGA 5D8LB 1RI7A 2EFQA 2XVCA 1CQTA 2CO5A 1DP3A 3G3ZA 2HU9A 4JK1X 4B4CA 4CCNA 4WCGA 5F1RA 2Z5UA 5BMZA 4QIWN 5JVTA 1J0RA 5FFXA 3HB9A 2R7QA 2MLKA 2HOEA 3BQZA 3BR6A 1CF7B 4MEYF 4ZH4F 1UHSA 1RRJA 3T8TA 1KU9A 2R7UA 3DQVC 2L9SA 4AU7A 1JHHA 1NK2P 1V5FA 1S3JA 1SD4A 2A07F 4KDPA 2CW8A 4ZYAA 3A01B 3JAMZ 2W48A 4I09A 4I76A 4BEHA 4OIOF 4ZYHA 3DBRB 3GZ5A 4BJ6C 3VYUB 2GXBA 2V26A 4QLCU 5H20A 5J47A 2CWEA 4BU2A 3IP4B 3F8MA 3RYRA 3V4GA 1TQPA 1WJDA 2WY8Q 3K9TA 4RLFA 3GFJA 2ZXJA 1EH6A 1D0ZA 5H6RA 2ESHA 4N4OB 5IT9Z 3OYCA 4I99C 2G7UA 5DDGA 3V7CA 5F1JA 2K9LA 2R7RA 1G3SA 2G0EA 5BPDA 2RQPA 1QPIA 3WTUC 3ESWB 2DA6A 3GUDA 5J3LA 4YRVA 4AIDA 2O8KA 3PUBA 3CDLA 1N25A 5HVQC 3HOUJ 3GTKJ 2DU9A 1Z05A 2Q2EB 3FDYA 3TP3A 4C3JJ 4S04A 4YEJA 1UAAA 2IS1A 3ABTA 2XSDC 2DMQA 3S17J 2M8EA 1YO5C 2V1XA 3K4MA 4TV7A 2E1CA 2Q1ZB 2ZSIB 3BJAA 2LF8A 2WB1N 4K2EA 2VOPA 1B6AA 4KIFA 3RKWA 1KZHA 2KJBA 1WVRA 4QPOA 2LBFA 4H0EA 4G6QA 4DYQA 1TQMA 2UXXA 2CU7A 3CDIA 3MZ8A 2M4GA 1D0XA 2F2EA 3RPUD 4I6ZA 4KNYA 4XN3A 2WC2A 3CCRI 2VKEA 3FBIB 2JA8J 3PNYA 1BIBA 3FIWA 2DK5A 5AIQA 3JTGA 2OCCH 4G7HF 2N8GA 1Z1DA 2L7ZA 2F4IA 4M3BA 4EVIA 4S05A 3HOSA 2LSOA 4DOZA 4W97A 3ZMTA 3GW2A 3S1QJ 1Y6IA 3KP6A 1Z77A 2Z33A 3C2HA 1WWXA 1MJAA 1VNDA 1IXSB 2DOFA 3GYHX 1UJ8A 1W7PB 3JREA 3HG9A 3ZMZA 5FO5A 1T8IA 1Z3YA 2D1VA 4DYCA 1GV2A 3WTYC 1E2XA 5CPRB 1OJLA 1OKRA 1JKQC 3EUAA 2KISA 1I1GA 1R58A 3LSHA 2BVMA 3K70C 4FX0A 2ID3A 4HW0A 3CCYA 4HF1A 1VZ0A 2QQ9A 5F0HA 1EH7A 3O3KA 1VF9A 2ZJPF 3I53A 1DQUA 4XIDA 2UUZA 1HSTA 3CJTB 4L5IA 1APLC 3EDPA 2OD5A 1AWCA 3CESA 4HBLA 4RGSA 1TC3C 2CJJA 4OIPF 3CLQA 4L5JA 2VBZA 4PFPA 1KA8A 4EM1A 4BJ5C 4RAYA 3RKYA 3CP2A 2K3PA 3DFGA 4D9JA 2W84A 1VFCA 1VI0A 3LSGA 1SD5A 1X4OA 2AQEA 1OR7C 3Q0VA 3TDZC 1YIJI 1J59A 2TDXA 4OAYA 1D5YA 1VQLI 4N0BA 2ZFWA 3RDIA 4CSWA 2FBKA 1I6XA 1UHMA 4CZCA 4MTDA 2RN7A 2V1NA 3F8FA 2DDAA 2ZJRF 3QYBA 4XKCA 3F72A 2KRFA 2ISZA 4AYBN 5LEJA 3KYLA 2OPTA 2YU3A 4FTHA 1MDMB 3W6KB 4I0BA 4XRFA 2CMPA 4KT5C 1X1CA 2KPMA 5DCMB 5LHGA 2EFPA 2LR8A 2UV1A 1PDNC 3OYAA 2XF7A 3VEPA 1BW5A 2XPVA 5GPCA 1HW1A 1HA8A 1OR7A 2DMTA 4XQFA 3GLLA 5HLTA 2JN6A 5CVUA 4IX7A 5L3GA 2KRHA 3IL2A 1C0WA 3ZP5A 5TISC 1XGNA 1R4NB 2FQ4A 4GRIA 4QPQA 4KJZA 3RJPA 3KEYA 5A2QK 5A2QZ 3J80K 5LFAA 1JUSA 2A68F 2IPQX 2O5RA 1REPC 1VQ5I 3ML6A 3IRQA 1LEBA 2AHQA 2KZVA 1RETA 3AG4H 1LFBA 3ERMA 1FIPA 1NHAA 2YU9J 2CRGA 3FF5A 4BS9A 2VB6A 3ZQLA 2OV7A 4LD5A 1FOWA 4BBSJ 3A1YA 3ELKA 2Y30A 2PJPA 2H1LA 1IRZA 5DYMA 3LWFA 5AONA 2QGUA 3I55I 1ZARA 4PJJA 4IOAF 1WH5A 3TOBA 3PIOF 3ZMDA 5LD2C 2JVHA 2NOJB 4ZZDA 4Y33A 2CH0A 2TCTA 1LVKA 2CW7A 5CKTA 1ZR4A 2PQ8A 1MJ9A 4P1WA 4II2A 1DPUA 2FOKA 2L5QA 4KIBA 1WRJA 2LOOA 2XAGA 4AM3A 2EJRA 2BW3A 4NUBA 2L2OA 1V54H 3DBLB 3ZCOA 2ZXWH 3DEWA 3HIFA 2NNYA 5DCMA 2EWNA 1R6RA 2L02A 2W24A 3ZN0A 5FD6A 4C3HJ 3I58A 5F6FA 3JRCA 2BHZA 4FCYA 3KYDB 1I5ZA 2V9PA 2DMNA 2X9DA 3DF8A 3DP7A 1KQ9A 1D5VA 1IN7A 2EV5A 3HBLA 4HNUA 4L0ZB 3N97A 3LSRA 1W5CC 4FASD 3ZR8X 4CHUA 1QHHD 1DP7P 2OBPA 3CZ6A 2VKVA 3CCJI 5DM6F 2R7TA 1U5TB 4JYKA 2JA6J 5K1YA 4XOTA 1U78A 3G4SI 1P92A 1SD6A 1Z7UA 2V7FA 3M8JA 4RAZA 1VQNI 1BA5A 3W6JB 1LFPA 4EJTA 1JUPA 5FLMJ 4Y15A 4II3A 5H2FC 4L9NA 2JUCA 1IAWA 3CC4I 1F43A 2XKPA 4Y17A 1Q1HA 2GAUA 2Y0SN 3HOWJ 5E79C 1T6SA 1A35A 5DV5A 4ESFA 1SFKA 2GWRA 3RTRA 2JWTA 3C2BA 2MBFA 3L2CA 1BBYA 1FBSA 4EV0A 1IGNA 4HV5A 1JKRC 1ETQA 2P5KA 3PSIA 4M9XA 3HHHA 1R5GA 1GXQA 1MBKA 2IA0A 3FXOA 4LIUA 5CVJA 1IW7F 1TW2A 3IHUA 4HV6A 2MABA 3R0AA 3HUGB 4U0VA 4M3DA 1UMQA 3TBIA 2LNBA 2DA4A 1YRNB 4KISA 1LVAA 4E7JA 3J7YJ 3MKWB 4Q47A 5EDNA 2LKPA 4XLPF 1MGTA 5H6QA 3U9GA 1QU3A 2ZJ2A 5B66C 2EFNA 2DI3A 1GLNA 2PX9A 4P9FA 3BG5A 2NVUB 4UNOA 3HEFA 4BXFA 4HEA2 5LGNA 5B1AH 1D1BA 4RA2A 3H5NA 3QP6A 4IOCF 3GX4X 3WG9A 3CQZJ 3G2BA 1R36A 4I7HA 3BWGA 2KQRA 2CS3A 4A0ZA 2MC4A 4BHCA 1T33A 2R93J 1HC8A 2IS6A 4ITVA 1HW2A 3NEUA 2YX4A 1A31A 4HX7A 2DFHA 2DJNA 4G94A 2HXIA 1SVOA 1UB9A 4B48A 2JRMA 3DV8A 2H27A 3B6CA 3BT9A 3CF5F 4OIQF 4CCKA 1Y8RB 2DT5A 4UUTA 2QVOA 2XKOA 3GFMA 3QWLA 1VQ6I 3SFZA 1Y0UA 3V7SA 2HZDA 4LG0A 1IRFA 3HSEA 2B63J 1U2WA 1X1DA 2WY7Q 2E35A 3SYTA 1U3EM 4MFDA 2O7OA 2OA4A 3HDDA 2R5YB 1POGA 3SDGA 1JUMA 3HUGA 3FXRA 5IYCJ 2JT1A 3PIPF 2VASA 1F5TA 3IAS2 1EH8A 3LAJA 2AXLA 3LSIA 3S1MJ 1IRXA 1EA3A 1ETOA 1LE8A 2IS4A 4B1RA 2XB5A 2ZNYA 4MQVA 5E1XA 3I71A 4RS8A 2H6CA 3BLYA 5B5EC 3L2QA 1NG6A 2BBYA 3DKYA 3F9KA 2QUFA 1QA6A 1TTYA 4I02A 5HOOA 3OYJA 5B1BH 1VQMI 3H36A 2FQ3A 2IRFG 4IRIA 2L9VA 2QYOA 4BE2A 4NC7A 2F4OB 2CUEA 1OCOH 2XRNA 2UZKA 5FJ8J 4EGYA 1GXPA 4RM2A 3WHCA 2VE9A 2ISYA 3OR2C 2ESNA 5B3SH 1T39A 2JMWA 3EQLF 2FOWA 1R4MB 4YG2F 5KCMA 2FMYA 3F6OA 4KN4X 4N9IA 1E0EA 2FA5A 3G1MA 4FE7A 4PGGA 2FUG2 1ZKGA 3M8FA 1VQ7I 4D7NA 2XRLA 2DN0A 2PMUA 3BPVA 3K4JA 4ASNA 2LY2A 1NTCA 1FIAA 5C4JJ 2LFBA 2P5VA 2JUGA 3AG2H 5L3EA 1TWCJ 1ZYRF 5EEHA 2P7VB 2W57A 3FZVA 4UB8C 2CV2A 5J8FA 4JP0A 4PJ0C 4U7BA 3L2VA 5IT9K 4E7SA 4J00A 4RB3C 5HDGA 1TNTA 3AL0C 2M34A 1FMWA 3WHBA 1JT0A 2IP2A 1LNWA 2ZFUA 5M5XJ 2IT0A 2YUSA 3BTLA 3E6DA 1FP1D 2R3SA 3J81K 2MW8A 1Z91A 2YR2A 5JLXA 4DIQA 1FBQA 2VL8A 2VJ5A 3GTJJ 4F7ZA 2O6GE 2FU4A 2V9VA 4M73A 1O7LA 1WQ2A 2A5WA 3KYCB 5E3OA 3VFZA 4GYGA 3GBGA 2K9NA 1XMAA 5K5QA 4G6DA 2E2JJ 2KDOA 1Z3XA 3DXJF 4BGDA 2R5ZA 1WJBA 3L1PA 3VYRB 2NNNA 2DFIA 4M72A 2Y9ZA 5TRDA 4Z2YA 4CO8A 3IUOA 1YOVB 5ILVA 1R22A 2F5DA 5L3CA 5ED4A 3BPXA 2J5OA 4A6EA 2QBYB 1L0OC 2JPCA 4AVZA 2R7ZJ 2RDPA 4BJTA 5TGTA 3Q9VA 3CMYA 1W7PD 3HPGA 3FXKA 1R1TA 3BOQA 3KEOA 5D5VB 5HDNA 3DTIA 3MMYB 5CVIA 2K4BA 5M3FJ 1AA7A 1BI2A 1OPCA 1MBGA 4P55A 2DK8A 2Z1DA 4ZC3A 2K7LA 1YITI 3DU6A 1P2FA 5JLWA 4B09A 3GVAA 2DT7B 4LLGF 2VBXA 2IGOA 2F4MB 3C2GA 1X3WB 1MKMA 3CCLI 2CQ7A 2MLGA 1XGOA 1K7AA 1Y8QB 2E36A 2ZO4A 4RGXA 3TKYA 4EJWA 1ENHA 1DDNA 3JRAA 3BQYA 1USTA 2V6CA 3BDDA 3NWSA 3W3CA 1BM9A 5HDKA 4M6XA 1FTTA 3I59B 5J1RA 3IH4A 1RUNA 1A6IA 4F55A 2OU2A 4XKVA 2FRHA 3G6EI 3Q9SA 2V9KA 3D1NI 2HPIA 1B4AA 3OYFA 1FZPB 2K9QA 5IP9J 2ZJQF 3K10A 1ACIA 1J2XA 2O3FA 4RGRA 2CV1A 1XCBA 2OCEA 4XSZF 3EYYA 2B7EA 3CCUI 2M3AA 2RQQA 2BOLA 3O2PE 3F6VA 4MHGA 3X2QH 1WJEA 3OYHA 2ZMEA 2Y48A 4ZYDA 2DA3A 2DTZA 4BYYA 2Q0OA 5L3FA 2KP6A 2W82A 3P9CA 5IP6A 1B9MA 3AAFA 3OYKA 1SFXA 2HI3A 5J4VA 1SMYF 3MEXA 4HLXA 3GXOA 1QHGA 1Z0XA 2M7BA 2H09A 2EZIA 4XRMA 4UXNA 1OCZH 4N9HA 2WADA 1EF4A 3H3VK 1BOAA 4D5FA 2R5ZB 1IN8A 3ZOBA 1BJZA 5FROA 2WWYA 4LIVA 1G8XA 4Q48A 3ROUA 3B6AA 3TOAA 3T0YA 4O6JA 5F08A 2BY3A 4IHSA 2RAEA 3G73A 5F0FA 2NXNB 5E8IA 3S3NA 1JKOC 3ISPA 2JA5J 4PFOA 2HTSA 5HS7A 1MMNA 4BHBA 1O3QA 1ODDA 1ZG3A 1UCRA 2KKOA 3VWBA 5E1ZB 2R92J 4AC0A 1IRGA 2FF4A 2QSHX 4NDLA 1NK3P 3HM5A 2LYCA 5BS6A 3AFHA 1ONVA 3MVPA 3DBHB 1T38A 2JK3A 3RCOA 3OIQA 3FM3A 2F5VA 4XLHA 1Y39A 1IN4A 2XUBA 1IV6A 2VOOA 3JRDA 1ZHFA 3RZDJ 1F9NA 2DBBA 1HKQA 2MD5A 2XV4S 3KZIC 3JCUC 4U88A 2M9HA 3K2AA 2W1OA 3FXMA 5ERIA 1K4SA 3DLAA 1K4TA 3I59A 3BR2A 1S8NA 3CMAI 3IWFA 1IUFA 3AKZA 1Y56A 3FXQA 1N77A 1UHWA 3BG7A 3CF2A 1STZA 1WKMA 2IXSA 4BEHB 3QPSA 4D5CA 1XX5A 1M1EB 2ZB9A 4A93J 1V5GA 4DGWB 4AIJA 3VSKA 4B47A 2ECCA 1U8RA 4HNTA 3H0DA 3HOZJ 2DQRA 4GGGA 3KCCA 2E2HJ 4L9VA 1BJAA 3WTTC 2I5UA 2MGQA 3KZZA 3B73A 3O8GA 1MH3A 4HRIA 3CCVI 3BR1A 2XAFA 4FX4A 1TQIA 2EK5A 4IHVA 1ETVA 4HDUA 2M0MA 2CQNA 4CCOA 1WPKA 3BTCA 2L7KA 3VDXA 5J4YA 4KN7X 3K4LA 4OU0A 3GWZA 3SJMA 2V6EA 2Q2EA 3OMYA 2BE5F 3CUQC 4R8HA 4UVCA 2XC7A 3S3MA 1SEUA 3PM1A 2F5CA 3DU5A 2QQ8A 2M4KA 2K4JA 1ZTRA 1R1UA 1XSXA 4BNCA 3CMMA 1J75A 1FJLA 3JRGA 3OSGA 1R49A 2HOTA 3LAPA 4LMYA 1IV8A 1HKSA 3WE2A 3IV5A 4JBAA 4A5MA 5FKOA 4A3BJ 2XHKA 2K86A 3QPHA 2XAUA 1A04A 3T5XA 1YS7A 4HF2A 2P6SA 3MD2A 1KQ8A 4WX9A 2DDBA 5GAHJ 2BGCA 5HS9A 2ADUA 2XPWA 5D5WB 3NAUA 4CGZA 2OZ6A 3T8RA 3M1EA 1HQCA 2HDCA 3ZQFA 1MSFC 4HYEA 4BUPA 1RZ4A 2HZTA 4CDGA 2OQGA 1XCVA 1QVUA 3I64A 3RQ4A 4MO7A 3LFKA 1J09A 1QPMA 2HYGD 2ZXHA 3ONQA 2VJIA 3J81Z 3WGIA 3ECHA 3GF2A 3BZKA 1LB2A 1U5TA 3KP5A 3V8JA 1W5TA 3ZQQA 4ESJA 2HWVA 4L5EA 4RDUA 2BXZA 4XL9A 2GIVA 4NC6A 2VC1A 3NQOA 3K4NA 4P5OA 1R00A 4JX6A 2ELHA 1XMKA 3ULQB 1W36D 2L4MA 5CVVA 2NAZA 1MMSA 1W0TA 4LB5A 1KGSA 1MNDA 2RC4A 2PLYA 2XGXA 3FX3A 4QSHA 1GVDA 5E3LA 2NVXJ 4LITA 2DFEA 4BL0B 2M0CA 4A3LJ 3Q5FA 1U9OA 5C4XJ 1GVJA 3R6SA 1OISA 2LRDA 4C2TA 4Y52J 5C3EJ 3BTIA 3K69A 4JQFA 1X19A 3WGHA 1HSJA 4IL6C 3CUQB 3BTJA 1YX5A 3S2DJ 3E6BA 1YRNA 3IAM2 3FK6A 2NS8A 1T08B 3MFKA 1GT0C 2NYXA 2R7SA 2MD0A 2WV1A 3ASNH 2EIJH 5M5WJ 2HQ5A 3RKQA 1U8BA 4PK4A 1LDKB 2L0KA 2MH9A 4XBFA 1HBXG 5FD5A 3EYIA 4KIGA 1E3PA 4ZYEA 1OMIA 2Z3YA 1Q1VA 1B9NA 3HSFA 4B44A 5BNGA 4BKXA 2E1MB 1MBFA 1YIOA 2V1UA 3HHGA 1XS9A 1XSVA 1H8AC 3GEZA 2DQLA 4XM3A 3BCAA 3CD6I 5E8GA 2HGCA 3CTAA 3H9GA 1G59A 4CZZA 3KP7A 3PFIA 3H35A 3SFIA 1D0YA 2OQRA 2EILH 3HOXJ 5KNLA 1OYWA 1Z6RA 4UUSB 3IKVA 4A3EJ 1D1AA 2HQAA 3VSLA 4B3XA 4OMZA 2RKHA 2IBDA 3HRMA 5HLGA 3A4CA 4LG3A 4A12A 3NRVA 2STTA 2G7HA 3I5UA 4DZJA 3S32A 3E5XA 1BN5A 5ICCA 1E17A 2E1MC 4N4NB 2W00A 1FX7A 3QODA 3RSNA 3UNGC 2YPRA 2KZGA 3MKZA 2HVRA 1MNMC 2DJIA 5CQEA 3A02A 3HGYA 5DEQA 2GXAA 2EBIA 4EEFG 3RYPA 5HODA 4RB1A 4M3FA 2HDDA 1W1WE 3CC2I 1FYKA 2KRCA 3PO2J 1TWFJ 1LE8B 1CF7A 2CW0F 3LMMA 1MDMA 3QOEA 3KPHA 4XLFA 4YFKF 2VBYA 4LK1F 2DOAA 2XF5A 4HOBA 1QRYA 3KLOA 4W1UA 2UWMA 4G7ZF 5CJ9A 2E5ZA 4UVBA 4WXDA 2EA4A 3JTHA 2VT3A 3CO6C 1RKWA 2L3DA 3LL7A 4ZDLA 1XDSA 3HZJA 5EZGA 1MD0A 2E2IJ 1K78A 4WWCA 3OSFA 5D5UB 3GO5A 3H3UA 1JXSA 4ESBA 2ID6A 1MZBA 2HR3A 2VE8A 3CUQA 1TNSA 1MH4A 3OYIA 1DUXC 1GDTA 2BW3B 3CO7C 3E1SA 4IKFA 4HQMA 3L09A 3TEDA 1HDDC 2E34A 1RKTA 4B3AA 4CXFA 3J80Z 1OCRH 2KHMA 3JW4A 2X6OA 4XORA 4MTEA 2LH9A 1EV7A 2VQGA 1F4KA 1FOYA 1YS6A 3U1DA 3FMRA 2A6EF 5LGTA 4C3IJ 3JRHA 1FY7A 3JRIA 3MKYB 1ON2A 2DPUA 3L7WA 4XLAA 3FHNA 2BVLA 2KL4A 3ZXSA 2UXNA 4PSWA 2JTVA 2A05A 4GXOA 1RESA 5K5OA 2QKMB 4HX8A 2X1DA 1YX3A 2DMUA 4XRSG 2HEOA 4IHWA 2R7OA 4X1EA 1F36A 2A6HF 4KFCA 1V4RA 4XR6A 5E17F 5LHIA 3NWTA 4NBQA 1U0JA 3GTPJ 2QA4I 1H89C 3D5LA 3LA3A 1TWAJ 1S7EA 3PQJA 4CCLA 1JHFA 1ETYA 1ZG5A 2L01A 1R5ID 1I6HJ 4ZTFA 3Q0UA 2GA2A 3OIOA 2JA2A 5HNHA 1X1AA 1O3RA 5IYDJ 3BC8A 3LSTA 5GAEJ 3MZYA 4AD9A 4ENNA 3S2HJ 1FOXA 1OCPA 1FYLA 4HDVA 4BE0A 1QVTA 4BY1J 3M07A 3H1CA 1XG1A 3FK7A 3IRRA 1FTZA 1IDZA 3ABMH 3WTXC 2CYYA 2QBYA 3CCEI 1RC9A 2IA1A 1U9NA 2MFZA 2OC6A 3KE2A 4FISA 2HFHA 5LLQA 4ENMA 1J5YA 4UUVA 1G2HA 1VTNC 2DAOA 3GZ6A 2H8RA 4KMFA 3ABUA 1O3TA 4UB6C 4C2UA 1P4XA 4HF0A 2JRTA 3SDBA 2DW4A 5F04A 1B59A 1HF0A 1KONA 1JI8A 1JTYA 3F8CA 5KAIC 1H88C 2DPDA 1BL0A 1YJWI 4MQ9F 2OUMA 5IOYA 2K02A 4FT8A 1TT0A 4XKBA 2VUMJ 3ZQIA 2YX7A 4HX4A 2GIZA 2WAEA 1NG7A 5LRRA 4X0GA 2LDUA 2QSFX 2W4SA 2L7MP 2WA0A 3IH2A 3DEEA 1I3QJ 3FXJA 4M9ZA 5FFZA 4L18B 3SHFA 1ZR2A 1B8IA 2HOSA 3BG6A 4I0AA 1ZREA 2O61A 1X2MA 5D8KB 3LSMA 4A2UA 3QQAA 1X58A 1OQYA 1S5LC 3A01A 3MN2A 1MIJA 4A5NA 5BQTA 5J1YA 4V2GA 3ABLH 1YI2I 5FRNA 3M4OJ 2GLOA 2ZKZA 3GTMJ 2IVMA 3ASOH 1WH7A 5GTIC 2F48A 3KIOA 2QWWA 2EPFA 1BR1A 1IUYA 4XRSA 3BZCA 4YELA 2Y2ZA 4M71A 4GDFA 3G71I 3ERED 4P96A 1P6RA 4F91B 2LY9A 2VKDA 3H9JA 2COBA 3I3LA 3BG3A 1V3FA 3NARA 3HKZN 2QM3A 3JR9A 3LSKA 3AL0B 3BZ6A 3DKWA 1K83J 5L3BA 1XGSA 2DLLA 2RGVA 2QEXI 3P9KA 3JRFA 4O5VA 2LD5A 4A3MJ 5FB2A 2XASA 2QLZA 4WK8F 4XLNF 3F8NA 2VPRA 4LK0F 3CMEI 3E6CC 2GOXB 1IO2A 3DTKA 3HPHA 4G6TB 4HSTA 2VODA 3VB2A 1D3YA 2JVGA 3V8LA 3D5SC 1P4WA 1DPRA 1H9TA 1RPWA 2VI6A 1Z9CA 3UR3C 3E7LA 4PUSA 4IVNA 5FRMA 4HQEA 1SAXA 3HTSB 1AOYA 1BI3A 1ZRCA 3SZTA 3GTQJ 5DS9A 2HKXA 3PSFA 2F5EA 4JX5A 2VKHA 2JZYA 1FPQA 1MMAA 2OJED 4OWRB 1S72I 3S1NJ 3CDHA 4EM0B 4RBOA 3A0HC 5GP9A 4OIRF 1YYVA 2J5PA 1QNTA 1YJNI 1PP7U 2GM4A 2VQHA 4B8XA 4ZTJA 4IHTA 3CJQB 4GCVA 3GTLJ 2OAZA 4NC8A 5DD8A 2DMPA 3RPUA 4Q5SF 1XB4A 2ME0A 3FXLA 5D4SA 4BHPA 4J19A 4A3CJ 2FXAA 1ZLKA 2EZLA 3FBNB 1SMTA 1A6QA 5D5XB 2E60A 4ZZLA 3O8HA 1Z67A 4LJZF 1TWGJ 1X1BA 4F92B 1SD7A 3AG1H 1EJ9A 4MLOA 1LJ9A 1KYWA 2NRAC 4EQQA 1TWHJ 4BDYA 2Y69H 4GYIA 3A2KA 4Y7NJ 1YFHA 4CH7A 1RR8C 2VPLA 4IEJA 1TT5B 1PUFA 2DA2A 2MSYA 4E7HA 2C6YA 1FLIA 3MQ0A 4XICA 1G6NA 1UG2A 2CQKA 1P7JA 3CCQI 3S14J 2QENA 3OYEA 2EH3A 1VQKI 2EFWA 4E4HA 2ZC2A 5M5YJ 3I4PA 2HYJA 3WU1B 4XN0A 3SZPA 4YFNF 3WTWC 2HDWA 2EZHA 1QZYA 4OAZA 3TL4X 4JOMA 1ZRFA 2KMUA 1MBHA 5KHDA 1JKPC 1T2KA 2X51A 2P0WA 3BG9A 3E0JB 3OYLA 2O9LA 3TGNA 2FNPA 4R1HA 3KFWX 3L2WA 1I3AA 2GXGA 2LC2A 5EG0A 4DBRA 3VYSB 1LDDA 2VXZA 2D1HA 2F5FA 1ZH5A 1O3SA 3HOYJ 1XMXA 4CCJA 4HSRA 3K4KA 5EZHA 3JRBA 3ZQGA 4M6YA 3QP5A 4YIIA 5LBQA 3HXLA 2CG4A 4RB0A 3R4KA 1T98A 5J6XA 2ZMEB 1IN5A 4C9YA 4NHJA 1S9HA 4CYCB 4RLQA 1U5TC 4P9UA 2VONA 2LP0A 1LUJB 3MKLA 3I4NJ 2PBIA 3BJOA 1SC7A 2X85A 3WGGA 2AS5F 4BH9A 2JA7J 2E7WA 3D0SA 1E3HA 1U6GA 2XROA 4IHYA 1I39A 4M6VA 4DBQA 4YIFA 3G1OA 1SAUA 2X6XA 2X6WA 2EA2A 2D45A 4I01A 3BR0A 1FNNA 4IXAA 3COAC 2DA7A 4PJMA 1HCRA 4E70A 1BC8C 5DTDA 3C3WA 4PCQA 4RM3A 4EJVA 4KITB 1O7FA 3AG3H 3GCMA 1FP2A 1FSEA 2CFXA 1H0MA 1JTXA 2EV0A 1D1CA 2MC3A 1RUOA 4IQ4A 1D8KA 2E19A 2GA1A 2JSCA 3FXUA 1JGSA 1S6LA 3KX2A 4BXUA 5C44J 5BOXA 1RIOH 5F27A 3BCBA 1OYYA 1E3OC 4G12A 2XAQA 3QYFA 3TDUC 2K3FA 3HC7A 3N05A 2DT6A 1GV5A 3GFLA 2BYVE 3OL3A 3S15J 1FSHA 4GFBA 3OYGA 1PUFB 1S7AA 5EG0B 2LY1A 1V55H 1ZGWA 2FE3A 1ITYA 1XN7A 1HDPA 3U1KA 3U21A 3WU2C 4XOPA 2VN2A 2FBHA 2R5YA 1TZLA 1W0UA 3TO6A 1A5JA 5GAGJ 2CFOA 4IHXA 1YHQI 3VYTB 2X48A 2PMHA 3DEUA 2XB0X 1WJFA 2KIMA 5JHFA 1G3TA 2VT2A 2EIMH 2Y0SA 3KLNA 1EKEA 2FBIA 2HKOA 3MAJA 3R60A 2R7VA 4X6AJ 3BJ6A 3VODA 4AVPA 2BEOA 2M1BA 3GTOJ 2H6BA 2CUJA 2ZCWA 3OYMA 2LKXA 4M3EA 3K0LA 2GBYA 4OOIA 2WB1A 4ANJA 5E18F 4AWXB 1PUEE 2IGMA 3M3YJ 5CQGA 5DUIA 3E3VA 3KETA 4PJNA 4LLLA 3ZMUA 5K7HA 4M9SA 3RPQA 1BR4A 2G9WA 5JHUA 5K7FA 2K40A 4Z6YA 1JE8A 1IJWC 2WAQA 3TW6A 4WXCA 4CYCA 3DLLF 1Y1VJ 2BY2A 2DTRA 4H4KC 1T95A 1S29A 3I0TA 4CICA 2ETHA 4NNJA 1P7IA 2OZUA 5AIPA 1XSDA 1X3UA 3OS0A 4DQ2A 2HOAA 2LBFB 2EV6A 2Y0MA 5KK1A 3CC7I 4BE1A 3RZOJ 4HZFA 1WI9A 2R7FA 1L3LA 2NS0A 2COMA 4HA8A 1BI1A 1YG2A 1ZAOA 3JAMK 5F64A 4IF4A 4A0YA 1K6OA 1VQOI 4BBRJ 1AHDP 3L9FA 4D0PA 2AQFA 2EZKA 2KFDA 4KT6A 4NB5A 3S93A 1RNLA 2CQQA 2OTJI 3ZQCA 3ZQ7A 3IH3A 2CGPA 1ETXA 3PL8A 1W4MA 4CA0A 1BIAA 4CCMA 3DCFA 2H94A 3H0GJ 1J7KA 1FEXA 5EEAA 2GZWA 1WHUA 4BACA 3FWEA 2Y75A 5FGMA 3FMSA 2VJ4A 1MMDA 3DPTA 2FSWA 4LLNA 4AIHA 3O6BB 2LKSA 4S0HB 2ELKA 4F52A 2LVSA 3KP2A 2A5YB 1YLFA 1W36C 4GO1A 3SEZA 3LQQA 3E5QA 3KZYA 3H5RA 2EIKH 2E7XA 1VQPI 1PYVA 2LMDA 2RV8A 2KIQA 1XGMA 1LFUP 3EUKL 4JX4A 4I2OA 2E1OA 3VPRA 3QU3A 2JSPA 4BQNA 4UY8I 2BV6A 2STWA 2EB7A 4LFUA 5IY5H 2HQRA 2XPUA
chains in the Genus database with same CATH topology
4NQWA 4G9YA 4KA4A 2V79A 1UFMA 5CLSA 2P5LC 1FC3A 2X4HA 3L00A 3F21A 4O3MA 3QU6A 3IC7A 2W85A 3HRTA 5DCFA 5BPIA 3H3ZA 4MNUA 3VOEA 1I27A 3CUOA 5DUKA 3C7JA 3RKXA 1I1SA 3QAHA 4IRHA 4QWQA 1W5SA 1OYIA 4EMSA 3PQKA 3CJNA 2FNAA 4FHTA 1YW8A 3V7RA 1USSA 2QQBA 3GLXA 3K1MA 4PZJA 4G7OF 3QRFF 1XD7A 1H9GA 5K5RA 1YW7A 2K27A 3MWMA 1G3YA 1KU7A 4WXHA 2P6TA 2L54A 3IWZA 1YW9A 3P7NA 5E1WA 4Y13A 1HXDA 4LB6B 4UV8A 3HYIA 1SFUA 5HS8A 1IF1A 2PG4A 4KMUX 3BY6A 2P4WA 2IA2A 3QOPA 4OINF 2XIGA 2KJCA 3S2WA 4CYDA 2QQAA 2WTEA 5EEGA 3ECOA 3KP3A 4R79A 3DPLC 5IT3A 1BC7C 3EUHA 2PI0A 3V8KA 1CGPA 5ICEA 2PN6A 2Z9OA 1IZ1A 5D4RA 3FMQA 1R1VA 1K79A 4L0YB 2HS5A 1T0FA 4RB2C 3E5UA 3I54A 4U0WA 3TO7A 2XAHA 4Q4ZF 1SFEA 4U7DA 1J9IA 3SXYA 3MZHA 3FM5A 2WV0A 1KU3A 1K78B 2IJLA 5ILSA 2Z99A 4BQAA 3K1NA 1YTYA 1R23A 3SQNA 2KIFA 3WTSC 4U0YA 1KU2A 3J7AO 3C18A 3F22A 2VC0A 4ON0A 1ZN2A 1W7PA 3WE3A 2M87A 2A61A 2IW5A 1TW3A 2XAJA 3RI4A 1MJBA 3M7GA 5FLXZ 5L3DA 3QPTA 3RIRA 5FLXK 4BAYA 5JR3A 4G8XA 1IXCA 2R7DA 1XDUA 1HW5A 2HTJA 1FOKA 2M5WA 1LEAA 1HKTA 4UV9A 5ILUA 1IXRC 4PGHA 1ZGJA 3HTUA 2Q8KA 4UVAA 5ICFA 3MCZA 2HQNA 2JPBA 2ZBKA 3M8EA 1O57A 2A69F 2ACJA 3P9IA 1QO0D 3ZMSA 3TQNA 3BP8A 4IPAA 4EJUA 1R7JA 5HLIA 5LRSA 3LA2A 1QBJA 2LF7A 4KUMA 4ENKA 4RGUA 1YQAA 3T1BA 3ZPLA 1QGPA 2W25A 4IJAA 4HLYA 2X0LA 4A6DA 5J8CA 2L4AA 4MEXF 5CYVA 2P8TA 4XSXF 5LHHA 2RVCA 3HRUA 4EM2A 1FT9A 3R61A 2PEXA 1QQIA 4DNCA 5KVRA 5DD4A 4ETSA 4L9TA 5TJJA 2HYFA 4WF2A 3WTVC 3WU0A 4IRGA 1S7OA 1Z6TA 2ZNZA 4YFXF 3HSRA 3ZMVA 4ENJA 2YSRA 2V1DA 3EETA 3WTZA 3TO9A 1FWZA 1KYZA 4M74A 3F23A 1ZGAA 2M45A 3HOTA 2VBWA 4I98B 1ZLJA 5D6EA 4LGWA 3F3XA 2O0YA 3IKTA 2E1NA 2A3SA 3K1PA 5LEKA 2FMLA 3GFIA 4EJOA 5JI6A 5D6FA 3FHZA 2PFBA 5CVRA 4MGRA 1IN6A 1PP8F 1G3WA 4HAMA 1QZZA 3HRSA 3WODF 1LQ1A 3M9AA 3H92A 3JSPA 4AIKA 4KICA 5LGUA 3ZN1A 4L9JA 3R0JA 1FYMA 3OOPA 1ZG1A 1D8JA 1TLHB 5JFRA 3E6MA 2FEZA 2B0LA 1TBXA 1B1BA 3N4MA 1ZRDA 1FBUA 5E20A 3E97A 4LG0B 3LQRA 3OV8A 3KEQA 4A0XA 1P4AA 2MA3A 2M30A 4KYWA 3F8BA 2EFOA 2MH2A 2RNJA 3REOA 3CLOA 1F1ZA 2QZ8A 1ON1A 2O8XA 1BI0A 2GQQA 2P7CB 4ZYGA 2D2WA 1R5HA 2DO7A 1GHCA 3U2RA 4UHTA 5HLHA 4PDKA 3KP4A 2O03A 4EGZA 3JSOA 3C1DA 4OMYA 3K2ZA 3B02A 1G4DA 2CSOA 2KIUA 1WSUA 6PAXA 1ULYA 3BROA 3LA7A 1LDJA 1KQ0A 5ICGA 5D8LB 1RI7A 2EFQA 2XVCA 2CO5A 3G3ZA 4JK1X 4WCGA 5F1RA 2Z5UA 5BMZA 5JVTA 1J0RA 5FFXA 2MLKA 2HOEA 1CF7B 4MEYF 4ZH4F 3T8TA 1KU9A 3DQVC 1JHHA 1S3JA 1SD4A 2A07F 4KDPA 3JAMZ 4I09A 4OIOF 4ZYHA 3GZ5A 2GXBA 4QLCU 5H20A 2CWEA 3F8MA 3RYRA 3V4GA 1TQPA 3K9TA 3GFJA 2ZXJA 1EH6A 5H6RA 2ESHA 5IT9Z 2G7UA 5DDGA 3V7CA 1G3SA 5BPDA 2RQPA 3WTUC 3GUDA 5HVQC 2DU9A 1Z05A 4S04A 3ABTA 2M8EA 1YO5C 2V1XA 4TV7A 2E1CA 3BJAA 2LF8A 4K2EA 2VOPA 1B6AA 4KIFA 3RKWA 2KJBA 4H0EA 4G6QA 1TQMA 2UXXA 2F2EA 4KNYA 2WC2A 1BIBA 2DK5A 5AIQA 3JTGA 4G7HF 1Z1DA 4EVIA 4S05A 3HOSA 2LSOA 3ZMTA 3GW2A 3KP6A 2Z33A 1WWXA 1MJAA 1IXSB 3GYHX 1W7PB 3ZMZA 5FO5A 2D1VA 3WTYC 1E2XA 1OKRA 1I1GA 1R58A 4FX0A 4HW0A 4HF1A 2QQ9A 1EH7A 3O3KA 3I53A 4L5IA 1HSTA 3EDPA 2OD5A 1AWCA 4HBLA 4RGSA 4OIPF 4L5JA 2VBZA 1KA8A 4EM1A 4RAYA 3RKYA 3DFGA 2W84A 1SD5A 3TDZC 1J59A 2TDXA 4N0BA 2ZFWA 3RDIA 2FBKA 1I6XA 1UHMA 4MTDA 2RN7A 3F8FA 3F72A 2KRFA 2ISZA 5LEJA 1MDMB 2YU3A 3W6KB 4I0BA 4XRFA 4KT5C 5DCMB 5LHGA 2EFPA 1PDNC 3VEPA 1HW1A 1OR7A 5CVUA 5L3GA 3IL2A 1C0WA 3ZP5A 1XGNA 3RJPA 5A2QK 5A2QZ 3J80K 2A68F 2IPQX 1REPC 3ML6A 3IRQA 1LEBA 1NHAA 3FF5A 4LD5A 3ELKA 2PJPA 5DYMA 3LWFA 5AONA 1ZARA 3TOBA 3ZMDA 4ZZDA 2PQ8A 1MJ9A 1DPUA 2FOKA 4KIBA 1WRJA 2XAGA 2EJRA 3HIFA 2NNYA 5DCMA 2EWNA 2W24A 2L02A 3ZN0A 5FD6A 3I58A 5F6FA 1I5ZA 3DF8A 3DP7A 1KQ9A 1D5VA 1IN7A 2EV5A 4L0ZB 3N97A 4CHUA 1DP7P 2OBPA 1U5TB 5K1YA 1U78A 1P92A 1SD6A 1Z7UA 4RAZA 3W6JB 4EJTA 4Y15A 4L9NA 1IAWA 2XKPA 4Y17A 1Q1HA 2GAUA 1T6SA 5DV5A 4ESFA 2GWRA 3RTRA 2MBFA 3L2CA 1BBYA 1FBSA 4EV0A 4HV5A 2P5KA 4M9XA 3HHHA 1R5GA 1GXQA 2IA0A 5CVJA 1IW7F 1TW2A 3IHUA 4HV6A 3R0AA 4U0VA 2LNBA 1LVAA 4Q47A 2LKPA 4XLPF 1MGTA 5H6QA 3U9GA 2ZJ2A 2EFNA 2DI3A 4P9FA 4UNOA 5LGNA 3QP6A 3GX4X 3WG9A 1R36A 4I7HA 3BWGA 4A0ZA 4BHCA 1HW2A 3NEUA 2YX4A 4HX7A 4G94A 1UB9A 3DV8A 2H27A 4OIQF 2DT5A 2QVOA 2XKOA 3GFMA 3SFZA 1Y0UA 3V7SA 4LG0A 1IRFA 3HSEA 1U2WA 1U3EM 2OA4A 3HUGA 3FXRA 2JT1A 1F5TA 1EH8A 3LAJA 2AXLA 4MQVA 2ZNYA 5E1XA 3I71A 4RS8A 2H6CA 2BBYA 2QUFA 1TTYA 4I02A 5HOOA 2IRFG 2FQ3A 4IRIA 2QYOA 2UZKA 2XRNA 4EGYA 1GXPA 2VE9A 2ISYA 2ESNA 1T39A 3EQLF 4YG2F 2FMYA 3F6OA 4KN4X 4N9IA 2FA5A 4PGGA 3M8FA 2PMUA 3BPVA 4ASNA 2P5VA 5L3EA 1ZYRF 5EEHA 2P7VB 2W57A 3FZVA 5J8FA 4U7BA 5IT9K 4RB3C 5HDGA 1TNTA 2IP2A 1LNWA 2IT0A 3E6DA 1FP1D 2R3SA 3J81K 1Z91A 2YR2A 1FBQA 4F7ZA 2O6GE 2FU4A 2V9VA 4M73A 1O7LA 1WQ2A 3VFZA 4GYGA 1XMAA 5K5QA 4G6DA 3DXJF 2NNNA 2DFIA 4M72A 5TRDA 4Z2YA 4CO8A 5ILVA 1R22A 2F5DA 5L3CA 5ED4A 3BPXA 2J5OA 4A6EA 2QBYB 1L0OC 2JPCA 2RDPA 3Q9VA 1W7PD 1R1TA 3BOQA 3KEOA 5D5VB 5HDNA 5CVIA 2K4BA 1BI2A 1OPCA 4P55A 2DK8A 2K7LA 1P2FA 4B09A 3GVAA 4LLGF 2VBXA 1MKMA 2MLGA 1XGOA 1K7AA 2ZO4A 4RGXA 3TKYA 4EJWA 1DDNA 1USTA 2V6CA 3BDDA 1BM9A 5HDKA 4M6XA 3I59B 1RUNA 2OU2A 2FRHA 3Q9SA 1B4AA 1FZPB 1J2XA 2O3FA 4RGRA 1XCBA 4XSZF 3EYYA 3O2PE 4MHGA 3F6VA 2ZMEA 2Y48A 4ZYDA 4BYYA 2Q0OA 5L3FA 3P9CA 1B9MA 3AAFA 1SFXA 1SMYF 3MEXA 4HLXA 3GXOA 2H09A 4UXNA 4N9HA 1BOAA 1IN8A 2WWYA 4Q48A 3ROUA 3TOAA 3T0YA 4O6JA 4IHSA 3G73A 5E8IA 3ISPA 2HTSA 5HS7A 4BHBA 1O3QA 1ODDA 1ZG3A 1UCRA 2KKOA 5E1ZB 1IRGA 2FF4A 5BS6A 1ONVA 1T38A 3FM3A 1IN4A 2XUBA 2VOOA 1ZHFA 1F9NA 2DBBA 1HKQA 2MD5A 2XV4S 4U88A 5ERIA 3I59A 1S8NA 3IWFA 3FXQA 1UHWA 1STZA 1WKMA 4AIJA 1U8RA 2DQRA 4GGGA 3KCCA 4L9VA 1BJAA 3WTTC 3KZZA 3B73A 2XAFA 4FX4A 1TQIA 2EK5A 4HDUA 4KN7X 4OU0A 3GWZA 2Q2EA 2BE5F 3CUQC 4R8HA 4UVCA 2F5CA 2K4JA 1R1UA 1XSXA 4BNCA 1J75A 3LAPA 4LMYA 1HKSA 3WE2A 4JBAA 4A5MA 2XHKA 2K86A 3QPHA 1A04A 3T5XA 1YS7A 4HF2A 2P6SA 1KQ8A 4WX9A 2BGCA 5HS9A 2ADUA 5D5WB 4CGZA 2OZ6A 3T8RA 3M1EA 1HQCA 2HDCA 4HYEA 1RZ4A 2HZTA 4CDGA 2OQGA 1XCVA 3I64A 3LFKA 1QPMA 2HYGD 3J81Z 3WGIA 3ECHA 3GF2A 1LB2A 1U5TA 3KP5A 3V8JA 4ESJA 1W5TA 2HWVA 2GIVA 2VC1A 3NQOA 4P5OA 1R00A 2ELHA 1XMKA 3ULQB 2L4MA 5CVVA 2NAZA 4LB5A 1KGSA 2RC4A 2PLYA 2XGXA 3FX3A 3Q5FA 1GVJA 3R6SA 3K69A 4JQFA 3WGHA 1HSJA 3CUQB 3E6BA 3MFKA 2NYXA 1LDKB 2MH9A 4XBFA 1HBXG 5FD5A 3EYIA 4KIGA 4ZYEA 1OMIA 2Z3YA 1B9NA 3HSFA 1YIOA 2V1UA 3HHGA 1XSVA 3GEZA 2DQLA 5E8GA 2HGCA 3CTAA 4CZZA 3KP7A 3PFIA 2OQRA 1OYWA 1Z6RA 3IKVA 4OMZA 2RKHA 3HRMA 5HLGA 4A12A 3NRVA 2STTA 2G7HA 3I5UA 3E5XA 1BN5A 5ICCA 1E17A 1FX7A 2YPRA 5DEQA 3RYPA 4RB1A 1FYKA 1CF7A 2CW0F 1MDMA 4YFKF 2VBYA 4LK1F 4HOBA 3KLOA 2UWMA 4G7ZF 5CJ9A 4UVBA 4WXDA 2EA4A 3JTHA 2VT3A 3CO6C 2L3DA 1XDSA 1MD0A 1K78A 4WWCA 5D5UB 3GO5A 3H3UA 1JXSA 4ESBA 1MZBA 2HR3A 2VE8A 3CUQA 1TNSA 1DUXC 3CO7C 4HQMA 3L09A 3J80Z 4CXFA 3JW4A 4MTEA 1EV7A 1F4KA 1YS6A 3U1DA 3FMRA 2A6EF 5LGTA 1FY7A 1ON2A 2DPUA 3L7WA 2UXNA 2JTVA 4GXOA 5K5OA 4HX8A 2HEOA 2A6HF 4KFCA 1V4RA 5E17F 5LHIA 3D5LA 3LA3A 3PQJA 1JHFA 1ZG5A 2L01A 2GA2A 1O3RA 3LSTA 3MZYA 4AD9A 4ENNA 1FYLA 4HDVA 3IRRA 3WTXC 2CYYA 2QBYA 2IA1A 3KE2A 5LLQA 4ENMA 4UUVA 2HFHA 1J5YA 1VTNC 2DAOA 3GZ6A 4KMFA 3ABUA 1O3TA 1P4XA 4HF0A 2JRTA 2DW4A 1B59A 3F8CA 2DPDA 4MQ9F 2K02A 4FT8A 2YX7A 4HX4A 5LRRA 2LDUA 4M9ZA 5FFZA 4L18B 3SHFA 1ZREA 4I0AA 2O61A 5D8KB 4A2UA 4A5NA 5BQTA 2ZKZA 2IVMA 2QWWA 1IUYA 4M71A 3ERED 4P96A 1P6RA 1V3FA 2QM3A 3BZ6A 3DKWA 5L3BA 1XGSA 2DLLA 2RGVA 3P9KA 4O5VA 5FB2A 2XASA 2QLZA 4WK8F 4XLNF 3F8NA 4LK0F 3E6CC 2VODA 3VB2A 1D3YA 3V8LA 1P4WA 1DPRA 1H9TA 1Z9CA 4IVNA 4HQEA 1SAXA 3HTSB 1AOYA 1BI3A 1ZRCA 3SZTA 2HKXA 2F5EA 2JZYA 1FPQA 3CDHA 4EM0B 4OIRF 1YYVA 2J5PA 1QNTA 1PP7U 4B8XA 4IHTA 4GCVA 2OAZA 5DD8A 3RPUA 4Q5SF 1XB4A 5D4SA 4BHPA 2FXAA 1ZLKA 1SMTA 5D5XB 4ZZLA 4LJZF 1SD7A 2NRAC 1LJ9A 1KYWA 4EQQA 4GYIA 1YFHA 2C6YA 1FLIA 3MQ0A 1G6NA 2CQKA 2QENA 2EFWA 3I4PA 3WU1B 3SZPA 4YFNF 3WTWC 1QZYA 1ZRFA 1T2KA 3TGNA 2FNPA 4R1HA 3KFWX 2GXGA 1LDDA 2VXZA 2D1HA 2F5FA 1ZH5A 1O3SA 4M6YA 3QP5A 4YIIA 5LBQA 2CG4A 4RB0A 5J6XA 1T98A 3R4KA 2ZMEB 1IN5A 4NHJA 1U5TC 4P9UA 2VONA 2PBIA 3BJOA 3WGGA 2AS5F 4BH9A 2E7WA 3D0SA 2XROA 1U6GA 4YIFA 2EA2A 2D45A 4I01A 1FNNA 4IXAA 3COAC 4E70A 1BC8C 3C3WA 4PCQA 4EJVA 1O7FA 1FP2A 1FSEA 2CFXA 1H0MA 2EV0A 2MC3A 1RUOA 1D8KA 2GA1A 3FXUA 2JSCA 5BOXA 1JGSA 1S6LA 4BXUA 1RIOH 1OYYA 2XAQA 3TDUC 3GFLA 2BYVE 1FSHA 1S7AA 2FE3A 1XN7A 2VN2A 2FBHA 3TO6A 2PMHA 3DEUA 2KIMA 1G3TA 2VT2A 3KLNA 2FBIA 2HKOA 3MAJA 3R60A 3BJ6A 3VODA 4AVPA 2BEOA 2M1BA 2H6BA 2ZCWA 3K0LA 4OOIA 5E18F 4AWXB 1PUEE 5DUIA 3E3VA 3KETA 4LLLA 3ZMUA 4M9SA 3RPQA 2G9WA 5JHUA 1JE8A 4WXCA 2DTRA 1S29A 3I0TA 4CICA 2ETHA 5AIPA 2OZUA 1XSDA 1X3UA 4DQ2A 2EV6A 2Y0MA 5KK1A 4HZFA 1WI9A 1L3LA 2R7FA 2NS0A 2COMA 4HA8A 1BI1A 3JAMK 1YG2A 1ZAOA 5F64A 4IF4A 4A0YA 1K6OA 3L9FA 4D0PA 4NB5A 1RNLA 3ZQ7A 2CGPA 1W4MA 1BIAA 2H94A 1J7KA 2GZWA 3FWEA 2Y75A 5FGMA 3FMSA 4LLNA 3DPTA 2FSWA 4AIHA 3O6BB 3KP2A 2A5YB 1YLFA 4GO1A 3LQQA 3E5QA 3KZYA 2E7XA 2RV8A 1XGMA 4I2OA 3QU3A 2BV6A 2STWA 2EB7A 4LFUA 2HQRA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4NQW A;  4G9Y A;  4KA4 A;  2V79 A;  1UFM A;  5CLS A;  2P5L C;  1FC3 A;  2X4H A;  3L00 A;  3F21 A;  4O3M A;  3QU6 A;  3IC7 A;  2W85 A;  3HRT A;  5DCF A;  5BPI A;  3H3Z A;  4MNU A;  3VOE A;  1I27 A;  3CUO A;  5DUK A;  3C7J A;  3RKX A;  1I1S A;  3QAH A;  4IRH A;  4QWQ A;  1W5S A;  1OYI A;  4EMS A;  3PQK A;  3CJN A;  2FNA A;  4FHT A;  1YW8 A;  3V7R A;  1USS A;  2QQB A;  3GLX A;  3K1M A;  4PZJ A;  4G7O F;  3QRF F;  1XD7 A;  1H9G A;  5K5R A;  1YW7 A;  2K27 A;  3MWM A;  1G3Y A;  1KU7 A;  4WXH A;  2P6T A;  2L54 A;  3IWZ A;  1YW9 A;  3P7N A;  5E1W A;  4Y13 A;  1HXD A;  4LB6 B;  4UV8 A;  3HYI A;  1SFU A;  5HS8 A;  1IF1 A;  2PG4 A;  4KMU X;  3BY6 A;  2P4W A;  2IA2 A;  3QOP A;  4OIN F;  2XIG A;  2KJC A;  3S2W A;  4CYD A;  2QQA A;  2WTE A;  5EEG A;  3ECO A;  3KP3 A;  4R79 A;  3DPL C;  5IT3 A;  1BC7 C;  3EUH A;  2PI0 A;  3V8K A;  1CGP A;  5ICE A;  2PN6 A;  2Z9O A;  1IZ1 A;  5D4R A;  3FMQ A;  1R1V A;  1K79 A;  4L0Y B;  2HS5 A;  1T0F A;  4RB2 C;  3E5U A;  3I54 A;  4U0W A;  3TO7 A;  2XAH A;  4Q4Z F;  1SFE A;  4U7D A;  1J9I A;  3SXY A;  3MZH A;  3FM5 A;  2WV0 A;  1KU3 A;  1K78 B;  2IJL A;  5ILS A;  2Z99 A;  4BQA A;  3K1N A;  1YTY A;  1R23 A;  3SQN A;  2KIF A;  3WTS C;  4U0Y A;  1KU2 A;  3J7A O;  3C18 A;  3F22 A;  2VC0 A;  4ON0 A;  1ZN2 A;  1W7P A;  3WE3 A;  2M87 A;  2A61 A;  2IW5 A;  1TW3 A;  2XAJ A;  3RI4 A;  1MJB A;  3M7G A;  5FLX Z;  5L3D A;  3QPT A;  3RIR A;  5FLX K;  4BAY A;  5JR3 A;  4G8X A;  1IXC A;  2R7D A;  1XDU A;  1HW5 A;  2HTJ A;  1FOK A;  2M5W A;  1LEA A;  1HKT A;  4UV9 A;  5ILU A;  1IXR C;  4PGH A;  1ZGJ A;  3HTU A;  2Q8K A;  4UVA A;  5ICF A;  3MCZ A;  2HQN A;  2JPB A;  2ZBK A;  3M8E A;  1O57 A;  2A69 F;  2ACJ A;  3P9I A;  1QO0 D;  3ZMS A;  3TQN A;  3BP8 A;  4IPA A;  4EJU A;  1R7J A;  5HLI A;  5LRS A;  3LA2 A;  1QBJ A;  2LF7 A;  4KUM A;  4ENK A;  4RGU A;  1YQA A;  3T1B A;  3ZPL A;  1QGP A;  2W25 A;  4IJA A;  4HLY A;  2X0L A;  4A6D A;  5J8C A;  2L4A A;  4MEX F;  5CYV A;  2P8T A;  4XSX F;  5LHH A;  2RVC A;  3HRU A;  4EM2 A;  1FT9 A;  3R61 A;  2PEX A;  1QQI A;  4DNC A;  5KVR A;  5DD4 A;  4ETS A;  4L9T A;  5TJJ A;  2HYF A;  4WF2 A;  3WTV C;  3WU0 A;  4IRG A;  1S7O A;  1Z6T A;  2ZNZ A;  4YFX F;  3HSR A;  3ZMV A;  4ENJ A;  2YSR A;  2V1D A;  3EET A;  3WTZ A;  3TO9 A;  1FWZ A;  1KYZ A;  4M74 A;  3F23 A;  1ZGA A;  2M45 A;  3HOT A;  2VBW A;  4I98 B;  1ZLJ A;  5D6E A;  4LGW A;  3F3X A;  2O0Y A;  3IKT A;  2E1N A;  2A3S A;  3K1P A;  5LEK A;  2FML A;  3GFI A;  4EJO A;  5JI6 A;  5D6F A;  3FHZ A;  2PFB A;  5CVR A;  4MGR A;  1IN6 A;  1PP8 F;  1G3W A;  4HAM A;  1QZZ A;  3HRS A;  3WOD F;  1LQ1 A;  3M9A A;  3H92 A;  3JSP A;  4AIK A;  4KIC A;  5LGU A;  3ZN1 A;  4L9J A;  3R0J A;  1FYM A;  3OOP A;  1ZG1 A;  1D8J A;  1TLH B;  5JFR A;  3E6M A;  2FEZ A;  2B0L A;  1TBX A;  1B1B A;  3N4M A;  1ZRD A;  1FBU A;  5E20 A;  3E97 A;  4LG0 B;  3LQR A;  3OV8 A;  3KEQ A;  4A0X A;  1P4A A;  2MA3 A;  2M30 A;  4KYW A;  3F8B A;  2EFO A;  2MH2 A;  2RNJ A;  3REO A;  3CLO A;  1F1Z A;  2QZ8 A;  1ON1 A;  2O8X A;  1BI0 A;  2GQQ A;  2P7C B;  4ZYG A;  2D2W A;  1R5H A;  2DO7 A;  1GHC A;  3U2R A;  4UHT A;  5HLH A;  4PDK A;  3KP4 A;  2O03 A;  4EGZ A;  3JSO A;  3C1D A;  4OMY A;  3K2Z A;  3B02 A;  1G4D A;  2CSO A;  2KIU A;  1WSU A;  6PAX A;  1ULY A;  3BRO A;  3LA7 A;  1LDJ A;  1KQ0 A;  5ICG A;  5D8L B;  1RI7 A;  2EFQ A;  2XVC A;  2CO5 A;  3G3Z A;  4JK1 X;  4WCG A;  5F1R A;  2Z5U A;  5BMZ A;  5JVT A;  1J0R A;  5FFX A;  2MLK A;  2HOE A;  1CF7 B;  4MEY F;  4ZH4 F;  3T8T A;  1KU9 A;  3DQV C;  1JHH A;  1S3J A;  1SD4 A;  2A07 F;  4KDP A;  3JAM Z;  4I09 A;  4OIO F;  4ZYH A;  3GZ5 A;  2GXB A;  4QLC U;  5H20 A;  2CWE A;  3F8M A;  3RYR A;  3V4G A;  1TQP A;  3K9T A;  3GFJ A;  2ZXJ A;  1EH6 A;  5H6R A;  2ESH A;  5IT9 Z;  2G7U A;  5DDG A;  3V7C A;  1G3S A;  5BPD A;  2RQP A;  3WTU C;  3GUD A;  5HVQ C;  2DU9 A;  1Z05 A;  4S04 A;  3ABT A;  2M8E A;  1YO5 C;  2V1X A;  4TV7 A;  2E1C A;  3BJA A;  2LF8 A;  4K2E A;  2VOP A;  1B6A A;  4KIF A;  3RKW A;  2KJB A;  4H0E A;  4G6Q A;  1TQM A;  2UXX A;  2F2E A;  4KNY A;  2WC2 A;  1BIB A;  2DK5 A;  5AIQ A;  3JTG A;  4G7H F;  1Z1D A;  4EVI A;  4S05 A;  3HOS A;  2LSO A;  3ZMT A;  3GW2 A;  3KP6 A;  2Z33 A;  1WWX A;  1MJA A;  1IXS B;  3GYH X;  1W7P B;  3ZMZ A;  5FO5 A;  2D1V A;  3WTY C;  1E2X A;  1OKR A;  1I1G A;  1R58 A;  4FX0 A;  4HW0 A;  4HF1 A;  2QQ9 A;  1EH7 A;  3O3K A;  3I53 A;  4L5I A;  1HST A;  3EDP A;  2OD5 A;  1AWC A;  4HBL A;  4RGS A;  4OIP F;  4L5J A;  2VBZ A;  1KA8 A;  4EM1 A;  4RAY A;  3RKY A;  3DFG A;  2W84 A;  1SD5 A;  3TDZ C;  1J59 A;  2TDX A;  4N0B A;  2ZFW A;  3RDI A;  2FBK A;  1I6X A;  1UHM A;  4MTD A;  2RN7 A;  3F8F A;  3F72 A;  2KRF A;  2ISZ A;  5LEJ A;  1MDM B;  2YU3 A;  3W6K B;  4I0B A;  4XRF A;  4KT5 C;  5DCM B;  5LHG A;  2EFP A;  1PDN C;  3VEP A;  1HW1 A;  1OR7 A;  5CVU A;  5L3G A;  3IL2 A;  1C0W A;  3ZP5 A;  1XGN A;  3RJP A;  5A2Q K;  5A2Q Z;  3J80 K;  2A68 F;  2IPQ X;  1REP C;  3ML6 A;  3IRQ A;  1LEB A;  1NHA A;  3FF5 A;  4LD5 A;  3ELK A;  2PJP A;  5DYM A;  3LWF A;  5AON A;  1ZAR A;  3TOB A;  3ZMD A;  4ZZD A;  2PQ8 A;  1MJ9 A;  1DPU A;  2FOK A;  4KIB A;  1WRJ A;  2XAG A;  2EJR A;  3HIF A;  2NNY A;  5DCM A;  2EWN A;  2W24 A;  2L02 A;  3ZN0 A;  5FD6 A;  3I58 A;  5F6F A;  1I5Z A;  3DF8 A;  3DP7 A;  1KQ9 A;  1D5V A;  1IN7 A;  2EV5 A;  4L0Z B;  3N97 A;  4CHU A;  1DP7 P;  2OBP A;  1U5T B;  5K1Y A;  1U78 A;  1P92 A;  1SD6 A;  1Z7U A;  4RAZ A;  3W6J B;  4EJT A;  4Y15 A;  4L9N A;  1IAW A;  2XKP A;  4Y17 A;  1Q1H A;  2GAU A;  1T6S A;  5DV5 A;  4ESF A;  2GWR A;  3RTR A;  2MBF A;  3L2C A;  1BBY A;  1FBS A;  4EV0 A;  4HV5 A;  2P5K A;  4M9X A;  3HHH A;  1R5G A;  1GXQ A;  2IA0 A;  5CVJ A;  1IW7 F;  1TW2 A;  3IHU A;  4HV6 A;  3R0A A;  4U0V A;  2LNB A;  1LVA A;  4Q47 A;  2LKP A;  4XLP F;  1MGT A;  5H6Q A;  3U9G A;  2ZJ2 A;  2EFN A;  2DI3 A;  4P9F A;  4UNO A;  5LGN A;  3QP6 A;  3GX4 X;  3WG9 A;  1R36 A;  4I7H A;  3BWG A;  4A0Z A;  4BHC A;  1HW2 A;  3NEU A;  2YX4 A;  4HX7 A;  4G94 A;  1UB9 A;  3DV8 A;  2H27 A;  4OIQ F;  2DT5 A;  2QVO A;  2XKO A;  3GFM A;  3SFZ A;  1Y0U A;  3V7S A;  4LG0 A;  1IRF A;  3HSE A;  1U2W A;  1U3E M;  2OA4 A;  3HUG A;  3FXR A;  2JT1 A;  1F5T A;  1EH8 A;  3LAJ A;  2AXL A;  4MQV A;  2ZNY A;  5E1X A;  3I71 A;  4RS8 A;  2H6C A;  2BBY A;  2QUF A;  1TTY A;  4I02 A;  5HOO A;  2IRF G;  2FQ3 A;  4IRI A;  2QYO A;  2UZK A;  2XRN A;  4EGY A;  1GXP A;  2VE9 A;  2ISY A;  2ESN A;  1T39 A;  3EQL F;  4YG2 F;  2FMY A;  3F6O A;  4KN4 X;  4N9I A;  2FA5 A;  4PGG A;  3M8F A;  2PMU A;  3BPV A;  4ASN A;  2P5V A;  5L3E A;  1ZYR F;  5EEH A;  2P7V B;  2W57 A;  3FZV A;  5J8F A;  4U7B A;  5IT9 K;  4RB3 C;  5HDG A;  1TNT A;  2IP2 A;  1LNW A;  2IT0 A;  3E6D A;  1FP1 D;  2R3S A;  3J81 K;  1Z91 A;  2YR2 A;  1FBQ A;  4F7Z A;  2O6G E;  2FU4 A;  2V9V A;  4M73 A;  1O7L A;  1WQ2 A;  3VFZ A;  4GYG A;  1XMA A;  5K5Q A;  4G6D A;  3DXJ F;  2NNN A;  2DFI A;  4M72 A;  5TRD A;  4Z2Y A;  4CO8 A;  5ILV A;  1R22 A;  2F5D A;  5L3C A;  5ED4 A;  3BPX A;  2J5O A;  4A6E A;  2QBY B;  1L0O C;  2JPC A;  2RDP A;  3Q9V A;  1W7P D;  1R1T A;  3BOQ A;  3KEO A;  5D5V B;  5HDN A;  5CVI A;  2K4B A;  1BI2 A;  1OPC A;  4P55 A;  2DK8 A;  2K7L A;  1P2F A;  4B09 A;  3GVA A;  4LLG F;  2VBX A;  1MKM A;  2MLG A;  1XGO A;  1K7A A;  2ZO4 A;  4RGX A;  3TKY A;  4EJW A;  1DDN A;  1UST A;  2V6C A;  3BDD A;  1BM9 A;  5HDK A;  4M6X A;  3I59 B;  1RUN A;  2OU2 A;  2FRH A;  3Q9S A;  1B4A A;  1FZP B;  1J2X A;  2O3F A;  4RGR A;  1XCB A;  4XSZ F;  3EYY A;  3O2P E;  4MHG A;  3F6V A;  2ZME A;  2Y48 A;  4ZYD A;  4BYY A;  2Q0O A;  5L3F A;  3P9C A;  1B9M A;  3AAF A;  1SFX A;  1SMY F;  3MEX A;  4HLX A;  3GXO A;  2H09 A;  4UXN A;  4N9H A;  1BOA A;  1IN8 A;  2WWY A;  4Q48 A;  3ROU A;  3TOA A;  3T0Y A;  4O6J A;  4IHS A;  3G73 A;  5E8I A;  3ISP A;  2HTS A;  5HS7 A;  4BHB A;  1O3Q A;  1ODD A;  1ZG3 A;  1UCR A;  2KKO A;  5E1Z B;  1IRG A;  2FF4 A;  5BS6 A;  1ONV A;  1T38 A;  3FM3 A;  1IN4 A;  2XUB A;  2VOO A;  1ZHF A;  1F9N A;  2DBB A;  1HKQ A;  2MD5 A;  2XV4 S;  4U88 A;  5ERI A;  3I59 A;  1S8N A;  3IWF A;  3FXQ A;  1UHW A;  1STZ A;  1WKM A;  4AIJ A;  1U8R A;  2DQR A;  4GGG A;  3KCC A;  4L9V A;  1BJA A;  3WTT C;  3KZZ A;  3B73 A;  2XAF A;  4FX4 A;  1TQI A;  2EK5 A;  4HDU A;  4KN7 X;  4OU0 A;  3GWZ A;  2Q2E A;  2BE5 F;  3CUQ C;  4R8H A;  4UVC A;  2F5C A;  2K4J A;  1R1U A;  1XSX A;  4BNC A;  1J75 A;  3LAP A;  4LMY A;  1HKS A;  3WE2 A;  4JBA A;  4A5M A;  2XHK A;  2K86 A;  3QPH A;  1A04 A;  3T5X A;  1YS7 A;  4HF2 A;  2P6S A;  1KQ8 A;  4WX9 A;  2BGC A;  5HS9 A;  2ADU A;  5D5W B;  4CGZ A;  2OZ6 A;  3T8R A;  3M1E A;  1HQC A;  2HDC A;  4HYE A;  1RZ4 A;  2HZT A;  4CDG A;  2OQG A;  1XCV A;  3I64 A;  3LFK A;  1QPM A;  2HYG D;  3J81 Z;  3WGI A;  3ECH A;  3GF2 A;  1LB2 A;  1U5T A;  3KP5 A;  3V8J A;  4ESJ A;  1W5T A;  2HWV A;  2GIV A;  2VC1 A;  3NQO A;  4P5O A;  1R00 A;  2ELH A;  1XMK A;  3ULQ B;  2L4M A;  5CVV A;  2NAZ A;  4LB5 A;  1KGS A;  2RC4 A;  2PLY A;  2XGX A;  3FX3 A;  3Q5F A;  1GVJ A;  3R6S A;  3K69 A;  4JQF A;  3WGH A;  1HSJ A;  3CUQ B;  3E6B A;  3MFK A;  2NYX A;  1LDK B;  2MH9 A;  4XBF A;  1HBX G;  5FD5 A;  3EYI A;  4KIG A;  4ZYE A;  1OMI A;  2Z3Y A;  1B9N A;  3HSF A;  1YIO A;  2V1U A;  3HHG A;  1XSV A;  3GEZ A;  2DQL A;  5E8G A;  2HGC A;  3CTA A;  4CZZ A;  3KP7 A;  3PFI A;  2OQR A;  1OYW A;  1Z6R A;  3IKV A;  4OMZ A;  2RKH A;  3HRM A;  5HLG A;  4A12 A;  3NRV A;  2STT A;  2G7H A;  3I5U A;  3E5X A;  1BN5 A;  5ICC A;  1E17 A;  1FX7 A;  2YPR A;  5DEQ A;  3RYP A;  4RB1 A;  1FYK A;  1CF7 A;  2CW0 F;  1MDM A;  4YFK F;  2VBY A;  4LK1 F;  4HOB A;  3KLO A;  2UWM A;  4G7Z F;  5CJ9 A;  4UVB A;  4WXD A;  2EA4 A;  3JTH A;  2VT3 A;  3CO6 C;  2L3D A;  1XDS A;  1MD0 A;  1K78 A;  4WWC A;  5D5U B;  3GO5 A;  3H3U A;  1JXS A;  4ESB A;  1MZB A;  2HR3 A;  2VE8 A;  3CUQ A;  1TNS A;  1DUX C;  3CO7 C;  4HQM A;  3L09 A;  3J80 Z;  4CXF A;  3JW4 A;  4MTE A;  1EV7 A;  1F4K A;  1YS6 A;  3U1D A;  3FMR A;  2A6E F;  5LGT A;  1FY7 A;  1ON2 A;  2DPU A;  3L7W A;  2UXN A;  2JTV A;  4GXO A;  5K5O A;  4HX8 A;  2HEO A;  2A6H F;  4KFC A;  1V4R A;  5E17 F;  5LHI A;  3D5L A;  3LA3 A;  3PQJ A;  1JHF A;  1ZG5 A;  2L01 A;  2GA2 A;  1O3R A;  3LST A;  3MZY A;  4AD9 A;  4ENN A;  1FYL A;  4HDV A;  3IRR A;  3WTX C;  2CYY A;  2QBY A;  2IA1 A;  3KE2 A;  5LLQ A;  4ENM A;  4UUV A;  2HFH A;  1J5Y A;  1VTN C;  2DAO A;  3GZ6 A;  4KMF A;  3ABU A;  1O3T A;  1P4X A;  4HF0 A;  2JRT A;  2DW4 A;  1B59 A;  3F8C A;  2DPD A;  4MQ9 F;  2K02 A;  4FT8 A;  2YX7 A;  4HX4 A;  5LRR A;  2LDU A;  4M9Z A;  5FFZ A;  4L18 B;  3SHF A;  1ZRE A;  4I0A A;  2O61 A;  5D8K B;  4A2U A;  4A5N A;  5BQT A;  2ZKZ A;  2IVM A;  2QWW A;  1IUY A;  4M71 A;  3ERE D;  4P96 A;  1P6R A;  1V3F A;  2QM3 A;  3BZ6 A;  3DKW A;  5L3B A;  1XGS A;  2DLL A;  2RGV A;  3P9K A;  4O5V A;  5FB2 A;  2XAS A;  2QLZ A;  4WK8 F;  4XLN F;  3F8N A;  4LK0 F;  3E6C C;  2VOD A;  3VB2 A;  1D3Y A;  3V8L A;  1P4W A;  1DPR A;  1H9T A;  1Z9C A;  4IVN A;  4HQE A;  1SAX A;  3HTS B;  1AOY A;  1BI3 A;  1ZRC A;  3SZT A;  2HKX A;  2F5E A;  2JZY A;  1FPQ A;  3CDH A;  4EM0 B;  4OIR F;  1YYV A;  2J5P A;  1QNT A;  1PP7 U;  4B8X A;  4IHT A;  4GCV A;  2OAZ A;  5DD8 A;  3RPU A;  4Q5S F;  1XB4 A;  5D4S A;  4BHP A;  2FXA A;  1ZLK A;  1SMT A;  5D5X B;  4ZZL A;  4LJZ F;  1SD7 A;  2NRA C;  1LJ9 A;  1KYW A;  4EQQ A;  4GYI A;  1YFH A;  2C6Y A;  1FLI A;  3MQ0 A;  1G6N A;  2CQK A;  2QEN A;  2EFW A;  3I4P A;  3WU1 B;  3SZP A;  4YFN F;  3WTW C;  1QZY A;  1ZRF A;  1T2K A;  3TGN A;  2FNP A;  4R1H A;  3KFW X;  2GXG A;  1LDD A;  2VXZ A;  2D1H A;  2F5F A;  1ZH5 A;  1O3S A;  4M6Y A;  3QP5 A;  4YII A;  5LBQ A;  2CG4 A;  4RB0 A;  5J6X A;  1T98 A;  3R4K A;  2ZME B;  1IN5 A;  4NHJ A;  1U5T C;  4P9U A;  2VON A;  2PBI A;  3BJO A;  3WGG A;  2AS5 F;  4BH9 A;  2E7W A;  3D0S A;  2XRO A;  1U6G A;  4YIF A;  2EA2 A;  2D45 A;  4I01 A;  1FNN A;  4IXA A;  3COA C;  4E70 A;  1BC8 C;  3C3W A;  4PCQ A;  4EJV A;  1O7F A;  1FP2 A;  1FSE A;  2CFX A;  1H0M A;  2EV0 A;  2MC3 A;  1RUO A;  1D8K A;  2GA1 A;  3FXU A;  2JSC A;  5BOX A;  1JGS A;  1S6L A;  4BXU A;  1RIO H;  1OYY A;  2XAQ A;  3TDU C;  3GFL A;  2BYV E;  1FSH A;  1S7A A;  2FE3 A;  1XN7 A;  2VN2 A;  2FBH A;  3TO6 A;  2PMH A;  3DEU A;  2KIM A;  1G3T A;  2VT2 A;  3KLN A;  2FBI A;  2HKO A;  3MAJ A;  3R60 A;  3BJ6 A;  3VOD A;  4AVP A;  2BEO A;  2M1B A;  2H6B A;  2ZCW A;  3K0L A;  4OOI A;  5E18 F;  4AWX B;  1PUE E;  5DUI A;  3E3V A;  3KET A;  4LLL A;  3ZMU A;  4M9S A;  3RPQ A;  2G9W A;  5JHU A;  1JE8 A;  4WXC A;  2DTR A;  1S29 A;  3I0T A;  4CIC A;  2ETH A;  5AIP A;  2OZU A;  1XSD A;  1X3U A;  4DQ2 A;  2EV6 A;  2Y0M A;  5KK1 A;  4HZF A;  1WI9 A;  1L3L A;  2R7F A;  2NS0 A;  2COM A;  4HA8 A;  1BI1 A;  3JAM K;  1YG2 A;  1ZAO A;  5F64 A;  4IF4 A;  4A0Y A;  1K6O A;  3L9F A;  4D0P A;  4NB5 A;  1RNL A;  3ZQ7 A;  2CGP A;  1W4M A;  1BIA A;  2H94 A;  1J7K A;  2GZW A;  3FWE A;  2Y75 A;  5FGM A;  3FMS A;  4LLN A;  3DPT A;  2FSW A;  4AIH A;  3O6B B;  3KP2 A;  2A5Y B;  1YLF A;  4GO1 A;  3LQQ A;  3E5Q A;  3KZY A;  2E7X A;  2RV8 A;  1XGM A;  4I2O A;  3QU3 A;  2BV6 A;  2STW A;  2EB7 A;  4LFU A;  2HQR A; 
#chains in the Genus database with same CATH topology
 4XNF A;  3F0C A;  4NQW A;  1XC5 A;  4G9Y A;  4KA4 A;  5J40 A;  2V79 A;  1UFM A;  2ZSH B;  5CLS A;  4XMY A;  2P5L C;  1FC3 A;  1P9Q C;  3LNQ A;  2X4H A;  3L00 A;  4BXX J;  1DGR M;  5FKM A;  4PJL A;  3F21 A;  4O3M A;  5FKL A;  3QU6 A;  3IC7 A;  2W85 A;  5EF6 A;  3HRT A;  5DCF A;  5BPI A;  3H3Z A;  2K9M A;  3DKX A;  4MNU A;  3VOE A;  1I27 A;  3CUO A;  5DUK A;  1MMG A;  1BOB A;  3C7J A;  3RKX A;  1I1S A;  2P81 A;  3QAH A;  3OL4 A;  4IRH A;  4QWQ A;  1DU0 A;  1W5S A;  2EIN H;  3K7A J;  1OYI A;  4EMS A;  5DM7 F;  2H8W A;  2PJR A;  2Y9Y A;  1N78 A;  3PQK A;  3CJN A;  2FNA A;  4FHT A;  1YW8 A;  3V7R A;  2Y31 A;  4E6K G;  1USS A;  3K70 D;  2HPM A;  2QQB A;  3GLX A;  1IC8 A;  3K1M A;  4PZJ A;  2DOE A;  4G7O F;  5FLV A;  2ICW G;  4Y3O A;  2ME6 A;  2NVY J;  3QRF F;  2B9S A;  5IP7 J;  2R7X A;  1XD7 A;  2IEK A;  1H9G A;  5EYR A;  5K5R A;  1ETW A;  1YW7 A;  3OY9 A;  3CP8 A;  4BQO A;  4FET A;  2K27 A;  3MWM A;  2XGE A;  3W2W A;  1G3Y A;  1KU7 A;  4WXH A;  1WI3 A;  2P6T A;  2ZXI A;  3QPL A;  4A3K J;  3OR1 C;  2L54 A;  4DZP A;  3OIP A;  3L2U A;  2KDZ A;  1T0F C;  3IWZ A;  4BQQ A;  5M3M J;  1YW9 A;  3OYD A;  1B8I B;  3P7N A;  5E1W A;  4Y13 A;  2H1K A;  1HXD A;  1ORK A;  2VLA A;  4LB6 B;  4UV8 A;  2K85 A;  5EGO A;  3HYI A;  2XSJ C;  1SFU A;  5HS8 A;  1IF1 A;  2E5N A;  2PG4 A;  2IGN A;  2M7A A;  5GPA A;  4KMU X;  1JJ6 C;  1Y1W J;  2DOD A;  3I9V 2;  3BY6 A;  2P4W A;  2IA2 A;  3QOP A;  4OIN F;  2XIG A;  2KJC A;  4HG2 A;  2BXY A;  4HNV A;  3S2W A;  4EAT A;  4CYD A;  2NS7 A;  2QQA A;  2WTE A;  4MFE A;  5EEG A;  3ECO A;  3KP3 A;  4R79 A;  1WFX A;  3DTE A;  4UUS A;  3DPL C;  5IT3 A;  1SAN A;  1O4X A;  1BC7 C;  5HNF A;  3EUH A;  3PJR A;  2PI0 A;  1AU7 A;  3V8K A;  4M3G A;  3UKG A;  1CGP A;  3H5A A;  4A3G J;  5ICE A;  4B43 A;  2IAI A;  2PN6 A;  2JQ7 A;  2Z9O A;  1IZ1 A;  2VQL A;  5D4R A;  3FMQ A;  3J7A Y;  3H9Q A;  1WZ2 A;  3S1R J;  2E71 A;  3W2V A;  1R1V A;  1K79 A;  3PUF A;  4BY7 J;  1ZQ3 P;  4L0Y B;  2HS5 A;  2FJ1 A;  1T0F A;  2BHY A;  4RB2 C;  3L2R A;  3E5U A;  3I54 A;  4MIM A;  4U0W A;  3TO7 A;  2FD5 A;  2XAH A;  3OYN A;  2WAF A;  3LSP A;  3Q0W A;  4V2F A;  4F3Q A;  4Q4Z F;  1SFE A;  4BDZ A;  4DJA A;  3M1C A;  4F93 B;  3PO3 J;  4U7D A;  1J9I A;  1K6Y A;  3SXY A;  3MZH A;  4AYB A;  1T56 A;  2LRE A;  3FM5 A;  5EGO B;  2WV0 A;  2WBM A;  2QF7 A;  1KU3 A;  2EQR A;  4RAF A;  4XKW A;  2NOG A;  1JJ8 C;  1K78 B;  2OF7 A;  2IJL A;  3ABK H;  1YJ9 I;  3GME A;  2M2E A;  5ILS A;  2Z99 A;  3V42 A;  4BQA A;  3K1N A;  1YTY A;  1R23 A;  3SQN A;  1TP4 A;  2KIF A;  2YS9 A;  3WTS C;  3A0B C;  4U0Y A;  1KU2 A;  2R0Q C;  3C18 A;  3J7A O;  4FE4 A;  3F22 A;  1VQ8 I;  2VC0 A;  4ON0 A;  1ZN2 A;  1W7P A;  2IS2 A;  3WE3 A;  4PSX A;  2M87 A;  2A61 A;  3J7Z I;  2IW5 A;  2XGD A;  2DA1 A;  2HXO A;  1TW3 A;  2XAJ A;  2I8D A;  1DGW Y;  1MJB A;  3RI4 A;  3M7G A;  5FLX Z;  5L3D A;  3QPT A;  3RIR A;  1A36 A;  5FLX K;  4BAY A;  5JR3 A;  4G8X A;  3CJR B;  3HGG A;  3OYB A;  1IXC A;  2R7D A;  4IZZ A;  1XDU A;  3ZRG A;  1OLT A;  1HW5 A;  2K9S A;  4C30 A;  2IGK A;  2HTJ A;  3I4M J;  1DU6 A;  1FOK A;  2DYR H;  1R9T J;  1VQ9 I;  2M5W A;  2L9N A;  2X1E A;  2QCO A;  1LEA A;  3ZGK A;  1XPX A;  1HKT A;  2KLO A;  4UV9 A;  3LFU A;  5ILU A;  1IXR C;  2M8G X;  4PGH A;  1ZGJ A;  3HTU A;  2Q8K A;  4UVA A;  4ZDP A;  5ICF A;  4XON A;  3MCZ A;  2HQN A;  2JPB A;  5E3M A;  2ZBK A;  3M8E A;  1X4P A;  1O57 A;  1LPQ A;  2MYS A;  3HKZ A;  2LG4 A;  1I50 J;  1FMV A;  2A69 F;  3P9I A;  4CUG A;  2ACJ A;  2L9R A;  1QO0 D;  2LLK A;  3ZMS A;  3TQN A;  3BP8 A;  3PNT A;  4IPA A;  4EJU A;  2DXI A;  1R7J A;  5HLI A;  2Z16 A;  5LRS A;  4A3D J;  4E7I A;  3LA2 A;  1QBJ A;  1JGG A;  3FIS A;  3S3O A;  2LF7 A;  5K7Z A;  4DYR A;  4KUM A;  3TMO A;  4ENK A;  1B72 B;  1QZE A;  3PFY A;  4RGU A;  4C2M J;  4A3J J;  3TW7 A;  1YQA A;  3T1B A;  3ZPL A;  2XGC A;  4D1Q A;  2QSG X;  2CQX A;  1QGP A;  2W25 A;  3DWL E;  4IJA A;  4HLY A;  2F6C A;  2X0L A;  4A6D A;  3HL2 A;  5J8C A;  1BR2 A;  2L4A A;  2WAQ N;  1UG0 A;  5IOZ A;  1NH3 A;  4MEX F;  5CYV A;  3FKJ A;  2P8T A;  4XSX F;  5LHH A;  1UZC A;  2RVC A;  5EJC A;  4D7M A;  1AKH A;  3HRU A;  4EM2 A;  1FT9 A;  2R7W A;  1V5E A;  3R61 A;  2PEX A;  2FX0 A;  1PJR A;  1ERD A;  1QQI A;  4DNC A;  5KVR A;  2A6T A;  4ZJZ A;  5E3N A;  2ZME C;  4U87 A;  3S16 J;  5DD4 A;  2X6Y A;  4XLE A;  4ETS A;  2NVQ J;  4L9T A;  2HNH A;  2ECB A;  5TJJ A;  2HYF A;  4WF2 A;  2X1C A;  5FKK A;  3WTV C;  4XLC A;  3EPZ A;  3WU0 A;  4IRG A;  1S7O A;  1Z6T A;  2ZNZ A;  3HOV J;  2CUZ A;  4YFX F;  1WCM J;  5JVG F;  3HSR A;  3ZMV A;  1MW7 A;  1OCC H;  1WGX A;  4ENJ A;  2VIX A;  2YSR A;  2V1D A;  4QTR A;  1B72 A;  4A3I J;  3GTG J;  2DYS H;  5F0C A;  3EET A;  5GAD J;  1ZEL A;  3WTZ A;  4FQG A;  3TO9 A;  2PMZ N;  1ETK A;  1FWZ A;  4HPQ A;  1KYZ A;  4M74 A;  2QKL B;  3F23 A;  4RMN A;  1ZGA A;  1HLV A;  3EUH C;  1WJA A;  2M45 A;  3HOT A;  2VBW A;  4I98 B;  1ZLJ A;  5D6E A;  4LGW A;  3F3X A;  2XDV A;  1PVE A;  2O0Y A;  2VXD A;  3IKT A;  2E1N A;  5FKN A;  1N75 A;  2A3S A;  3K1P A;  5LEK A;  1AKH B;  2VJJ A;  2FML A;  4ABZ A;  2DFF A;  3GFI A;  1WJC A;  4EJO A;  2D5V A;  4IQJ A;  5JI6 A;  4ZDO A;  3SEQ A;  5D6F A;  3WG7 H;  3FHZ A;  2DCE A;  4E7Z A;  2PFB A;  5CVR A;  2OTL I;  2TRT A;  5GTH C;  1HOM A;  4MGR A;  1IN6 A;  2BY1 A;  4AUX A;  1PP8 F;  1G3W A;  1TL8 A;  4J01 A;  4HAM A;  1QZZ A;  3HRS A;  3WOD F;  2JJ7 A;  1IDY A;  1IG7 A;  2ELJ A;  5IPA A;  1LQ1 A;  3SZG A;  2LK2 A;  3M9A A;  3H92 A;  2XF6 A;  3JSP A;  4AIK A;  4KIC A;  5LGU A;  3QYE A;  3ZN1 A;  1K61 A;  4L9J A;  3I56 I;  3R0J A;  1WJ5 A;  2LTP A;  3S8P A;  1MNE A;  3LOC A;  3G1L A;  1FYM A;  1SVM A;  3K4C A;  2GOM A;  3OOP A;  1ZG1 A;  1D8J A;  1TLH B;  5JFR A;  1X2N A;  5IYB J;  4DW6 A;  1YE9 A;  2RRE A;  3OOU A;  3E6M A;  2FEZ A;  2B0L A;  1TBX A;  1B1B A;  2BZT A;  1OCT C;  3N4M A;  1ZRD A;  1X3Z B;  2W7N A;  1FBU A;  3BR3 A;  2CV0 A;  5E20 A;  3K6G A;  3E97 A;  3LQR A;  4LG0 B;  3KEQ A;  3OV8 A;  1SFO J;  3D5R C;  3OS2 A;  4RAG A;  3CCM I;  3P5J A;  4A0X A;  4A3F J;  1P4A A;  4IO9 F;  4E7L A;  1MSE C;  1VQ4 I;  2KT0 A;  2K5C A;  2BY0 A;  3DPU A;  2MA3 A;  2M30 A;  4KYW A;  9ANT A;  3LSJ A;  2DA5 A;  4E7K A;  2HVS A;  3F8B A;  1JT6 A;  3A03 A;  3OWT A;  1R71 A;  2EFO A;  2MH2 A;  2RNJ A;  2PMZ A;  3REO A;  3CLO A;  3TP0 A;  3ZQH A;  1F1Z A;  2QZ8 A;  1ON1 A;  5J1U A;  2O8X A;  1BI0 A;  2L7F P;  2GQQ A;  2P7C B;  3W2A A;  4ZYG A;  2VQC A;  4NQW B;  1SVL A;  2D2W A;  1LKX A;  3RQI A;  4V19 K;  1R5H A;  2DO7 A;  2MG4 A;  2Z2S B;  3PNV A;  2AO9 A;  1MBE A;  4Y4R A;  4LOC A;  1XTA A;  4YIR X;  1GHC A;  2AXT C;  1OFC X;  3BR5 A;  2I10 A;  3K4B A;  4UHT A;  3U2R A;  5HLH A;  4PDK A;  2RNG A;  3HJE A;  3KP4 A;  1X1P A;  3CCS I;  3W6V A;  1GUU A;  2O03 A;  1UEL B;  4XK4 A;  3FKI J;  1Z7L A;  4EGZ A;  3JSO A;  3C1D A;  1RR7 A;  1Y0N A;  1Z21 A;  4OMY A;  3OS1 A;  3K2Z A;  2CUF A;  3B02 A;  3Q3S A;  1G4D A;  2CSO A;  2HVQ A;  2NVT J;  1MBJ A;  2KIU A;  2PJR B;  1WSU A;  1BW6 A;  6PAX A;  1ZK8 A;  1ULY A;  3BRO A;  4A69 C;  2V4J C;  5KAF C;  2R4G A;  3LA7 A;  1LDJ A;  1KQ0 A;  3GZN B;  5ICG A;  5D8L B;  1RI7 A;  2EFQ A;  2XVC A;  1CQT A;  2CO5 A;  1DP3 A;  3G3Z A;  2HU9 A;  4JK1 X;  4B4C A;  4CCN A;  4WCG A;  5F1R A;  2Z5U A;  5BMZ A;  4QIW N;  5JVT A;  1J0R A;  5FFX A;  3HB9 A;  2R7Q A;  2MLK A;  2HOE A;  3BQZ A;  3BR6 A;  1CF7 B;  4MEY F;  4ZH4 F;  1UHS A;  1RRJ A;  3T8T A;  1KU9 A;  2R7U A;  3DQV C;  2L9S A;  4AU7 A;  1JHH A;  1NK2 P;  1V5F A;  1S3J A;  1SD4 A;  2A07 F;  4KDP A;  2CW8 A;  4ZYA A;  3A01 B;  3JAM Z;  2W48 A;  4I09 A;  4I76 A;  4BEH A;  4OIO F;  4ZYH A;  3DBR B;  3GZ5 A;  4BJ6 C;  3VYU B;  2GXB A;  2V26 A;  4QLC U;  5H20 A;  5J47 A;  2CWE A;  4BU2 A;  3IP4 B;  3F8M A;  3RYR A;  3V4G A;  1TQP A;  1WJD A;  2WY8 Q;  3K9T A;  4RLF A;  3GFJ A;  2ZXJ A;  1EH6 A;  1D0Z A;  5H6R A;  2ESH A;  4N4O B;  5IT9 Z;  3OYC A;  4I99 C;  2G7U A;  5DDG A;  3V7C A;  5F1J A;  2K9L A;  2R7R A;  1G3S A;  2G0E A;  5BPD A;  2RQP A;  1QPI A;  3WTU C;  3ESW B;  2DA6 A;  3GUD A;  5J3L A;  4YRV A;  4AID A;  2O8K A;  3PUB A;  3CDL A;  1N25 A;  5HVQ C;  3HOU J;  3GTK J;  2DU9 A;  1Z05 A;  2Q2E B;  3FDY A;  3TP3 A;  4C3J J;  4S04 A;  4YEJ A;  1UAA A;  2IS1 A;  3ABT A;  2XSD C;  2DMQ A;  3S17 J;  2M8E A;  1YO5 C;  2V1X A;  3K4M A;  4TV7 A;  2E1C A;  2Q1Z B;  2ZSI B;  3BJA A;  2LF8 A;  2WB1 N;  4K2E A;  2VOP A;  1B6A A;  4KIF A;  3RKW A;  1KZH A;  2KJB A;  1WVR A;  4QPO A;  2LBF A;  4H0E A;  4G6Q A;  4DYQ A;  1TQM A;  2UXX A;  2CU7 A;  3CDI A;  3MZ8 A;  2M4G A;  1D0X A;  2F2E A;  3RPU D;  4I6Z A;  4KNY A;  4XN3 A;  2WC2 A;  3CCR I;  2VKE A;  3FBI B;  2JA8 J;  3PNY A;  1BIB A;  3FIW A;  2DK5 A;  5AIQ A;  3JTG A;  2OCC H;  4G7H F;  2N8G A;  1Z1D A;  2L7Z A;  2F4I A;  4M3B A;  4EVI A;  4S05 A;  3HOS A;  2LSO A;  4DOZ A;  4W97 A;  3ZMT A;  3GW2 A;  3S1Q J;  1Y6I A;  3KP6 A;  1Z77 A;  2Z33 A;  3C2H A;  1WWX A;  1MJA A;  1VND A;  1IXS B;  2DOF A;  3GYH X;  1UJ8 A;  1W7P B;  3JRE A;  3HG9 A;  3ZMZ A;  5FO5 A;  1T8I A;  1Z3Y A;  2D1V A;  4DYC A;  1GV2 A;  3WTY C;  1E2X A;  5CPR B;  1OJL A;  1OKR A;  1JKQ C;  3EUA A;  2KIS A;  1I1G A;  1R58 A;  3LSH A;  2BVM A;  3K70 C;  4FX0 A;  2ID3 A;  4HW0 A;  3CCY A;  4HF1 A;  1VZ0 A;  2QQ9 A;  5F0H A;  1EH7 A;  3O3K A;  1VF9 A;  2ZJP F;  3I53 A;  1DQU A;  4XID A;  2UUZ A;  1HST A;  3CJT B;  4L5I A;  1APL C;  3EDP A;  2OD5 A;  1AWC A;  3CES A;  4HBL A;  4RGS A;  1TC3 C;  2CJJ A;  4OIP F;  3CLQ A;  4L5J A;  2VBZ A;  4PFP A;  1KA8 A;  4EM1 A;  4BJ5 C;  4RAY A;  3RKY A;  3CP2 A;  2K3P A;  3DFG A;  4D9J A;  2W84 A;  1VFC A;  1VI0 A;  3LSG A;  1SD5 A;  1X4O A;  2AQE A;  1OR7 C;  3Q0V A;  3TDZ C;  1YIJ I;  1J59 A;  2TDX A;  4OAY A;  1D5Y A;  1VQL I;  4N0B A;  2ZFW A;  3RDI A;  4CSW A;  2FBK A;  1I6X A;  1UHM A;  4CZC A;  4MTD A;  2RN7 A;  2V1N A;  3F8F A;  2DDA A;  2ZJR F;  3QYB A;  4XKC A;  3F72 A;  2KRF A;  2ISZ A;  4AYB N;  5LEJ A;  3KYL A;  2OPT A;  2YU3 A;  4FTH A;  1MDM B;  3W6K B;  4I0B A;  4XRF A;  2CMP A;  4KT5 C;  1X1C A;  2KPM A;  5DCM B;  5LHG A;  2EFP A;  2LR8 A;  2UV1 A;  1PDN C;  3OYA A;  2XF7 A;  3VEP A;  1BW5 A;  2XPV A;  5GPC A;  1HW1 A;  1HA8 A;  1OR7 A;  2DMT A;  4XQF A;  3GLL A;  5HLT A;  2JN6 A;  5CVU A;  4IX7 A;  5L3G A;  2KRH A;  3IL2 A;  1C0W A;  3ZP5 A;  5TIS C;  1XGN A;  1R4N B;  2FQ4 A;  4GRI A;  4QPQ A;  4KJZ A;  3RJP A;  3KEY A;  5A2Q K;  5A2Q Z;  3J80 K;  5LFA A;  1JUS A;  2A68 F;  2IPQ X;  2O5R A;  1REP C;  1VQ5 I;  3ML6 A;  3IRQ A;  1LEB A;  2AHQ A;  2KZV A;  1RET A;  3AG4 H;  1LFB A;  3ERM A;  1FIP A;  1NHA A;  2YU9 J;  2CRG A;  3FF5 A;  4BS9 A;  2VB6 A;  3ZQL A;  2OV7 A;  4LD5 A;  1FOW A;  4BBS J;  3A1Y A;  3ELK A;  2Y30 A;  2PJP A;  2H1L A;  1IRZ A;  5DYM A;  3LWF A;  5AON A;  2QGU A;  3I55 I;  1ZAR A;  4PJJ A;  4IOA F;  1WH5 A;  3TOB A;  3PIO F;  3ZMD A;  5LD2 C;  2JVH A;  2NOJ B;  4ZZD A;  4Y33 A;  2CH0 A;  2TCT A;  1LVK A;  2CW7 A;  5CKT A;  1ZR4 A;  2PQ8 A;  1MJ9 A;  4P1W A;  4II2 A;  1DPU A;  2FOK A;  2L5Q A;  4KIB A;  1WRJ A;  2LOO A;  2XAG A;  4AM3 A;  2EJR A;  2BW3 A;  4NUB A;  2L2O A;  1V54 H;  3DBL B;  3ZCO A;  2ZXW H;  3DEW A;  3HIF A;  2NNY A;  5DCM A;  2EWN A;  1R6R A;  2L02 A;  2W24 A;  3ZN0 A;  5FD6 A;  4C3H J;  3I58 A;  5F6F A;  3JRC A;  2BHZ A;  4FCY A;  3KYD B;  1I5Z A;  2V9P A;  2DMN A;  2X9D A;  3DF8 A;  3DP7 A;  1KQ9 A;  1D5V A;  1IN7 A;  2EV5 A;  3HBL A;  4HNU A;  4L0Z B;  3N97 A;  3LSR A;  1W5C C;  4FAS D;  3ZR8 X;  4CHU A;  1QHH D;  1DP7 P;  2OBP A;  3CZ6 A;  2VKV A;  3CCJ I;  5DM6 F;  2R7T A;  1U5T B;  4JYK A;  2JA6 J;  5K1Y A;  4XOT A;  1U78 A;  3G4S I;  1P92 A;  1SD6 A;  1Z7U A;  2V7F A;  3M8J A;  4RAZ A;  1VQN I;  1BA5 A;  3W6J B;  1LFP A;  4EJT A;  1JUP A;  5FLM J;  4Y15 A;  4II3 A;  5H2F C;  4L9N A;  2JUC A;  1IAW A;  3CC4 I;  1F43 A;  2XKP A;  4Y17 A;  1Q1H A;  2GAU A;  2Y0S N;  3HOW J;  5E79 C;  1T6S A;  1A35 A;  5DV5 A;  4ESF A;  1SFK A;  2GWR A;  3RTR A;  2JWT A;  3C2B A;  2MBF A;  3L2C A;  1BBY A;  1FBS A;  4EV0 A;  1IGN A;  4HV5 A;  1JKR C;  1ETQ A;  2P5K A;  3PSI A;  4M9X A;  3HHH A;  1R5G A;  1GXQ A;  1MBK A;  2IA0 A;  3FXO A;  4LIU A;  5CVJ A;  1IW7 F;  1TW2 A;  3IHU A;  4HV6 A;  2MAB A;  3R0A A;  3HUG B;  4U0V A;  4M3D A;  1UMQ A;  3TBI A;  2LNB A;  2DA4 A;  1YRN B;  4KIS A;  1LVA A;  4E7J A;  3J7Y J;  3MKW B;  4Q47 A;  5EDN A;  2LKP A;  4XLP F;  1MGT A;  5H6Q A;  3U9G A;  1QU3 A;  2ZJ2 A;  5B66 C;  2EFN A;  2DI3 A;  1GLN A;  2PX9 A;  4P9F A;  3BG5 A;  2NVU B;  4UNO A;  3HEF A;  4BXF A;  4HEA 2;  5LGN A;  5B1A H;  1D1B A;  4RA2 A;  3H5N A;  3QP6 A;  4IOC F;  3GX4 X;  3WG9 A;  3CQZ J;  3G2B A;  1R36 A;  4I7H A;  3BWG A;  2KQR A;  2CS3 A;  4A0Z A;  2MC4 A;  4BHC A;  1T33 A;  2R93 J;  1HC8 A;  2IS6 A;  4ITV A;  1HW2 A;  3NEU A;  2YX4 A;  1A31 A;  4HX7 A;  2DFH A;  2DJN A;  4G94 A;  2HXI A;  1SVO A;  1UB9 A;  4B48 A;  2JRM A;  3DV8 A;  2H27 A;  3B6C A;  3BT9 A;  3CF5 F;  4OIQ F;  4CCK A;  1Y8R B;  2DT5 A;  4UUT A;  2QVO A;  2XKO A;  3GFM A;  3QWL A;  1VQ6 I;  3SFZ A;  1Y0U A;  3V7S A;  2HZD A;  4LG0 A;  1IRF A;  3HSE A;  2B63 J;  1U2W A;  1X1D A;  2WY7 Q;  2E35 A;  3SYT A;  1U3E M;  4MFD A;  2O7O A;  2OA4 A;  3HDD A;  2R5Y B;  1POG A;  3SDG A;  1JUM A;  3HUG A;  3FXR A;  5IYC J;  2JT1 A;  3PIP F;  2VAS A;  1F5T A;  3IAS 2;  1EH8 A;  3LAJ A;  2AXL A;  3LSI A;  3S1M J;  1IRX A;  1EA3 A;  1ETO A;  1LE8 A;  2IS4 A;  4B1R A;  2XB5 A;  2ZNY A;  4MQV A;  5E1X A;  3I71 A;  4RS8 A;  2H6C A;  3BLY A;  5B5E C;  3L2Q A;  1NG6 A;  2BBY A;  3DKY A;  3F9K A;  2QUF A;  1QA6 A;  1TTY A;  4I02 A;  5HOO A;  3OYJ A;  5B1B H;  1VQM I;  3H36 A;  2FQ3 A;  2IRF G;  4IRI A;  2L9V A;  2QYO A;  4BE2 A;  4NC7 A;  2F4O B;  2CUE A;  1OCO H;  2XRN A;  2UZK A;  5FJ8 J;  4EGY A;  1GXP A;  4RM2 A;  3WHC A;  2VE9 A;  2ISY A;  3OR2 C;  2ESN A;  5B3S H;  1T39 A;  2JMW A;  3EQL F;  2FOW A;  1R4M B;  4YG2 F;  5KCM A;  2FMY A;  3F6O A;  4KN4 X;  4N9I A;  1E0E A;  2FA5 A;  3G1M A;  4FE7 A;  4PGG A;  2FUG 2;  1ZKG A;  3M8F A;  1VQ7 I;  4D7N A;  2XRL A;  2DN0 A;  2PMU A;  3BPV A;  3K4J A;  4ASN A;  2LY2 A;  1NTC A;  1FIA A;  5C4J J;  2LFB A;  2P5V A;  2JUG A;  3AG2 H;  5L3E A;  1TWC J;  1ZYR F;  5EEH A;  2P7V B;  2W57 A;  3FZV A;  4UB8 C;  2CV2 A;  5J8F A;  4JP0 A;  4PJ0 C;  4U7B A;  3L2V A;  5IT9 K;  4E7S A;  4J00 A;  4RB3 C;  5HDG A;  1TNT A;  3AL0 C;  2M34 A;  1FMW A;  3WHB A;  1JT0 A;  2IP2 A;  1LNW A;  2ZFU A;  5M5X J;  2IT0 A;  2YUS A;  3BTL A;  3E6D A;  1FP1 D;  2R3S A;  3J81 K;  2MW8 A;  1Z91 A;  2YR2 A;  5JLX A;  4DIQ A;  1FBQ A;  2VL8 A;  2VJ5 A;  3GTJ J;  4F7Z A;  2O6G E;  2FU4 A;  2V9V A;  4M73 A;  1O7L A;  1WQ2 A;  2A5W A;  3KYC B;  5E3O A;  3VFZ A;  4GYG A;  3GBG A;  2K9N A;  1XMA A;  5K5Q A;  4G6D A;  2E2J J;  2KDO A;  1Z3X A;  3DXJ F;  4BGD A;  2R5Z A;  1WJB A;  3L1P A;  3VYR B;  2NNN A;  2DFI A;  4M72 A;  2Y9Z A;  5TRD A;  4Z2Y A;  4CO8 A;  3IUO A;  1YOV B;  5ILV A;  1R22 A;  2F5D A;  5L3C A;  5ED4 A;  3BPX A;  2J5O A;  4A6E A;  2QBY B;  1L0O C;  2JPC A;  4AVZ A;  2R7Z J;  2RDP A;  4BJT A;  5TGT A;  3Q9V A;  3CMY A;  1W7P D;  3HPG A;  3FXK A;  1R1T A;  3BOQ A;  3KEO A;  5D5V B;  5HDN A;  3DTI A;  3MMY B;  5CVI A;  2K4B A;  5M3F J;  1AA7 A;  1BI2 A;  1OPC A;  1MBG A;  4P55 A;  2DK8 A;  2Z1D A;  4ZC3 A;  2K7L A;  1YIT I;  3DU6 A;  1P2F A;  5JLW A;  4B09 A;  3GVA A;  2DT7 B;  4LLG F;  2VBX A;  2IGO A;  2F4M B;  3C2G A;  1X3W B;  1MKM A;  3CCL I;  2CQ7 A;  2MLG A;  1XGO A;  1K7A A;  1Y8Q B;  2E36 A;  2ZO4 A;  4RGX A;  3TKY A;  4EJW A;  1ENH A;  1DDN A;  3JRA A;  3BQY A;  1UST A;  2V6C A;  3BDD A;  3NWS A;  3W3C A;  1BM9 A;  5HDK A;  4M6X A;  1FTT A;  3I59 B;  5J1R A;  3IH4 A;  1RUN A;  1A6I A;  4F55 A;  2OU2 A;  4XKV A;  2FRH A;  3G6E I;  3Q9S A;  2V9K A;  3D1N I;  2HPI A;  1B4A A;  3OYF A;  1FZP B;  2K9Q A;  5IP9 J;  2ZJQ F;  3K10 A;  1ACI A;  1J2X A;  2O3F A;  4RGR A;  2CV1 A;  1XCB A;  2OCE A;  4XSZ F;  3EYY A;  2B7E A;  3CCU I;  2M3A A;  2RQQ A;  2BOL A;  3O2P E;  3F6V A;  4MHG A;  3X2Q H;  1WJE A;  3OYH A;  2ZME A;  2Y48 A;  4ZYD A;  2DA3 A;  2DTZ A;  4BYY A;  2Q0O A;  5L3F A;  2KP6 A;  2W82 A;  3P9C A;  5IP6 A;  1B9M A;  3AAF A;  3OYK A;  1SFX A;  2HI3 A;  5J4V A;  1SMY F;  3MEX A;  4HLX A;  3GXO A;  1QHG A;  1Z0X A;  2M7B A;  2H09 A;  2EZI A;  4XRM A;  4UXN A;  1OCZ H;  4N9H A;  2WAD A;  1EF4 A;  3H3V K;  1BOA A;  4D5F A;  2R5Z B;  1IN8 A;  3ZOB A;  1BJZ A;  5FRO A;  2WWY A;  4LIV A;  1G8X A;  4Q48 A;  3ROU A;  3B6A A;  3TOA A;  3T0Y A;  4O6J A;  5F08 A;  2BY3 A;  4IHS A;  2RAE A;  3G73 A;  5F0F A;  2NXN B;  5E8I A;  3S3N A;  1JKO C;  3ISP A;  2JA5 J;  4PFO A;  2HTS A;  5HS7 A;  1MMN A;  4BHB A;  1O3Q A;  1ODD A;  1ZG3 A;  1UCR A;  2KKO A;  3VWB A;  5E1Z B;  2R92 J;  4AC0 A;  1IRG A;  2FF4 A;  2QSH X;  4NDL A;  1NK3 P;  3HM5 A;  2LYC A;  5BS6 A;  3AFH A;  1ONV A;  3MVP A;  3DBH B;  1T38 A;  2JK3 A;  3RCO A;  3OIQ A;  3FM3 A;  2F5V A;  4XLH A;  1Y39 A;  1IN4 A;  2XUB A;  1IV6 A;  2VOO A;  3JRD A;  1ZHF A;  3RZD J;  1F9N A;  2DBB A;  1HKQ A;  2MD5 A;  2XV4 S;  3KZI C;  3JCU C;  4U88 A;  2M9H A;  3K2A A;  2W1O A;  3FXM A;  5ERI A;  1K4S A;  3DLA A;  1K4T A;  3I59 A;  3BR2 A;  1S8N A;  3CMA I;  3IWF A;  1IUF A;  3AKZ A;  1Y56 A;  3FXQ A;  1N77 A;  1UHW A;  3BG7 A;  3CF2 A;  1STZ A;  1WKM A;  2IXS A;  4BEH B;  3QPS A;  4D5C A;  1XX5 A;  1M1E B;  2ZB9 A;  4A93 J;  1V5G A;  4DGW B;  4AIJ A;  3VSK A;  4B47 A;  2ECC A;  1U8R A;  4HNT A;  3H0D A;  3HOZ J;  2DQR A;  4GGG A;  3KCC A;  2E2H J;  4L9V A;  1BJA A;  3WTT C;  2I5U A;  2MGQ A;  3KZZ A;  3B73 A;  3O8G A;  1MH3 A;  4HRI A;  3CCV I;  3BR1 A;  2XAF A;  4FX4 A;  1TQI A;  2EK5 A;  4IHV A;  1ETV A;  4HDU A;  2M0M A;  2CQN A;  4CCO A;  1WPK A;  3BTC A;  2L7K A;  3VDX A;  5J4Y A;  4KN7 X;  3K4L A;  4OU0 A;  3GWZ A;  3SJM A;  2V6E A;  2Q2E A;  3OMY A;  2BE5 F;  3CUQ C;  4R8H A;  4UVC A;  2XC7 A;  3S3M A;  1SEU A;  3PM1 A;  2F5C A;  3DU5 A;  2QQ8 A;  2M4K A;  2K4J A;  1ZTR A;  1R1U A;  1XSX A;  4BNC A;  3CMM A;  1J75 A;  1FJL A;  3JRG A;  3OSG A;  1R49 A;  2HOT A;  3LAP A;  4LMY A;  1IV8 A;  1HKS A;  3WE2 A;  3IV5 A;  4JBA A;  4A5M A;  5FKO A;  4A3B J;  2XHK A;  2K86 A;  3QPH A;  2XAU A;  1A04 A;  3T5X A;  1YS7 A;  4HF2 A;  2P6S A;  3MD2 A;  1KQ8 A;  4WX9 A;  2DDB A;  5GAH J;  2BGC A;  5HS9 A;  2ADU A;  2XPW A;  5D5W B;  3NAU A;  4CGZ A;  2OZ6 A;  3T8R A;  3M1E A;  1HQC A;  2HDC A;  3ZQF A;  1MSF C;  4HYE A;  4BUP A;  1RZ4 A;  2HZT A;  4CDG A;  2OQG A;  1XCV A;  1QVU A;  3I64 A;  3RQ4 A;  4MO7 A;  3LFK A;  1J09 A;  1QPM A;  2HYG D;  2ZXH A;  3ONQ A;  2VJI A;  3J81 Z;  3WGI A;  3ECH A;  3GF2 A;  3BZK A;  1LB2 A;  1U5T A;  3KP5 A;  3V8J A;  1W5T A;  3ZQQ A;  4ESJ A;  2HWV A;  4L5E A;  4RDU A;  2BXZ A;  4XL9 A;  2GIV A;  4NC6 A;  2VC1 A;  3NQO A;  3K4N A;  4P5O A;  1R00 A;  4JX6 A;  2ELH A;  1XMK A;  3ULQ B;  1W36 D;  2L4M A;  5CVV A;  2NAZ A;  1MMS A;  1W0T A;  4LB5 A;  1KGS A;  1MND A;  2RC4 A;  2PLY A;  2XGX A;  3FX3 A;  4QSH A;  1GVD A;  5E3L A;  2NVX J;  4LIT A;  2DFE A;  4BL0 B;  2M0C A;  4A3L J;  3Q5F A;  1U9O A;  5C4X J;  1GVJ A;  3R6S A;  1OIS A;  2LRD A;  4C2T A;  4Y52 J;  5C3E J;  3BTI A;  3K69 A;  4JQF A;  1X19 A;  3WGH A;  1HSJ A;  4IL6 C;  3CUQ B;  3BTJ A;  1YX5 A;  3S2D J;  3E6B A;  1YRN A;  3IAM 2;  3FK6 A;  2NS8 A;  1T08 B;  3MFK A;  1GT0 C;  2NYX A;  2R7S A;  2MD0 A;  2WV1 A;  3ASN H;  2EIJ H;  5M5W J;  2HQ5 A;  3RKQ A;  1U8B A;  4PK4 A;  1LDK B;  2L0K A;  2MH9 A;  4XBF A;  1HBX G;  5FD5 A;  3EYI A;  4KIG A;  1E3P A;  4ZYE A;  1OMI A;  2Z3Y A;  1Q1V A;  1B9N A;  3HSF A;  4B44 A;  5BNG A;  4BKX A;  2E1M B;  1MBF A;  1YIO A;  2V1U A;  3HHG A;  1XS9 A;  1XSV A;  1H8A C;  3GEZ A;  2DQL A;  4XM3 A;  3BCA A;  3CD6 I;  5E8G A;  2HGC A;  3CTA A;  3H9G A;  1G59 A;  4CZZ A;  3KP7 A;  3PFI A;  3H35 A;  3SFI A;  1D0Y A;  2OQR A;  2EIL H;  3HOX J;  5KNL A;  1OYW A;  1Z6R A;  4UUS B;  3IKV A;  4A3E J;  1D1A A;  2HQA A;  3VSL A;  4B3X A;  4OMZ A;  2RKH A;  2IBD A;  3HRM A;  5HLG A;  3A4C A;  4LG3 A;  4A12 A;  3NRV A;  2STT A;  2G7H A;  3I5U A;  4DZJ A;  3S32 A;  3E5X A;  1BN5 A;  5ICC A;  1E17 A;  2E1M C;  4N4N B;  2W00 A;  1FX7 A;  3QOD A;  3RSN A;  3UNG C;  2YPR A;  2KZG A;  3MKZ A;  2HVR A;  1MNM C;  2DJI A;  5CQE A;  3A02 A;  3HGY A;  5DEQ A;  2GXA A;  2EBI A;  4EEF G;  3RYP A;  5HOD A;  4RB1 A;  4M3F A;  2HDD A;  1W1W E;  3CC2 I;  1FYK A;  2KRC A;  3PO2 J;  1TWF J;  1LE8 B;  1CF7 A;  2CW0 F;  3LMM A;  1MDM A;  3QOE A;  3KPH A;  4XLF A;  4YFK F;  2VBY A;  4LK1 F;  2DOA A;  2XF5 A;  4HOB A;  1QRY A;  3KLO A;  4W1U A;  2UWM A;  4G7Z F;  5CJ9 A;  2E5Z A;  4UVB A;  4WXD A;  2EA4 A;  3JTH A;  2VT3 A;  3CO6 C;  1RKW A;  2L3D A;  3LL7 A;  4ZDL A;  1XDS A;  3HZJ A;  5EZG A;  1MD0 A;  2E2I J;  1K78 A;  4WWC A;  3OSF A;  5D5U B;  3GO5 A;  3H3U A;  1JXS A;  4ESB A;  2ID6 A;  1MZB A;  2HR3 A;  2VE8 A;  3CUQ A;  1TNS A;  1MH4 A;  3OYI A;  1DUX C;  1GDT A;  2BW3 B;  3CO7 C;  3E1S A;  4IKF A;  4HQM A;  3L09 A;  3TED A;  1HDD C;  2E34 A;  1RKT A;  4B3A A;  4CXF A;  3J80 Z;  1OCR H;  2KHM A;  3JW4 A;  2X6O A;  4XOR A;  4MTE A;  2LH9 A;  1EV7 A;  2VQG A;  1F4K A;  1FOY A;  1YS6 A;  3U1D A;  3FMR A;  2A6E F;  5LGT A;  4C3I J;  3JRH A;  1FY7 A;  3JRI A;  3MKY B;  1ON2 A;  2DPU A;  3L7W A;  4XLA A;  3FHN A;  2BVL A;  2KL4 A;  3ZXS A;  2UXN A;  4PSW A;  2JTV A;  2A05 A;  4GXO A;  1RES A;  5K5O A;  2QKM B;  4HX8 A;  2X1D A;  1YX3 A;  2DMU A;  4XRS G;  2HEO A;  4IHW A;  2R7O A;  4X1E A;  1F36 A;  2A6H F;  4KFC A;  1V4R A;  4XR6 A;  5E17 F;  5LHI A;  3NWT A;  4NBQ A;  1U0J A;  3GTP J;  2QA4 I;  1H89 C;  3D5L A;  3LA3 A;  1TWA J;  1S7E A;  3PQJ A;  4CCL A;  1JHF A;  1ETY A;  1ZG5 A;  2L01 A;  1R5I D;  1I6H J;  4ZTF A;  3Q0U A;  2GA2 A;  3OIO A;  2JA2 A;  5HNH A;  1X1A A;  1O3R A;  5IYD J;  3BC8 A;  3LST A;  5GAE J;  3MZY A;  4AD9 A;  4ENN A;  3S2H J;  1FOX A;  1OCP A;  1FYL A;  4HDV A;  4BE0 A;  1QVT A;  4BY1 J;  3M07 A;  3H1C A;  1XG1 A;  3FK7 A;  3IRR A;  1FTZ A;  1IDZ A;  3ABM H;  3WTX C;  2CYY A;  2QBY A;  3CCE I;  1RC9 A;  2IA1 A;  1U9N A;  2MFZ A;  2OC6 A;  3KE2 A;  4FIS A;  2HFH A;  5LLQ A;  4ENM A;  1J5Y A;  4UUV A;  1G2H A;  1VTN C;  2DAO A;  3GZ6 A;  2H8R A;  4KMF A;  3ABU A;  1O3T A;  4UB6 C;  4C2U A;  1P4X A;  4HF0 A;  2JRT A;  3SDB A;  2DW4 A;  5F04 A;  1B59 A;  1HF0 A;  1KON A;  1JI8 A;  1JTY A;  3F8C A;  5KAI C;  1H88 C;  2DPD A;  1BL0 A;  1YJW I;  4MQ9 F;  2OUM A;  5IOY A;  2K02 A;  4FT8 A;  1TT0 A;  4XKB A;  2VUM J;  3ZQI A;  2YX7 A;  4HX4 A;  2GIZ A;  2WAE A;  1NG7 A;  5LRR A;  4X0G A;  2LDU A;  2QSF X;  2W4S A;  2L7M P;  2WA0 A;  3IH2 A;  3DEE A;  1I3Q J;  3FXJ A;  4M9Z A;  5FFZ A;  4L18 B;  3SHF A;  1ZR2 A;  1B8I A;  2HOS A;  3BG6 A;  4I0A A;  1ZRE A;  2O61 A;  1X2M A;  5D8K B;  3LSM A;  4A2U A;  3QQA A;  1X58 A;  1OQY A;  1S5L C;  3A01 A;  3MN2 A;  1MIJ A;  4A5N A;  5BQT A;  5J1Y A;  4V2G A;  3ABL H;  1YI2 I;  5FRN A;  3M4O J;  2GLO A;  2ZKZ A;  3GTM J;  2IVM A;  3ASO H;  1WH7 A;  5GTI C;  2F48 A;  3KIO A;  2QWW A;  2EPF A;  1BR1 A;  1IUY A;  4XRS A;  3BZC A;  4YEL A;  2Y2Z A;  4M71 A;  4GDF A;  3G71 I;  3ERE D;  4P96 A;  1P6R A;  4F91 B;  2LY9 A;  2VKD A;  3H9J A;  2COB A;  3I3L A;  3BG3 A;  1V3F A;  3NAR A;  3HKZ N;  2QM3 A;  3JR9 A;  3LSK A;  3AL0 B;  3BZ6 A;  3DKW A;  1K83 J;  5L3B A;  1XGS A;  2DLL A;  2RGV A;  2QEX I;  3P9K A;  3JRF A;  4O5V A;  2LD5 A;  4A3M J;  5FB2 A;  2XAS A;  2QLZ A;  4WK8 F;  4XLN F;  3F8N A;  2VPR A;  4LK0 F;  3CME I;  3E6C C;  2GOX B;  1IO2 A;  3DTK A;  3HPH A;  4G6T B;  4HST A;  2VOD A;  3VB2 A;  1D3Y A;  2JVG A;  3V8L A;  3D5S C;  1P4W A;  1DPR A;  1H9T A;  1RPW A;  2VI6 A;  1Z9C A;  3UR3 C;  3E7L A;  4PUS A;  4IVN A;  5FRM A;  4HQE A;  1SAX A;  3HTS B;  1AOY A;  1BI3 A;  1ZRC A;  3SZT A;  3GTQ J;  5DS9 A;  2HKX A;  3PSF A;  2F5E A;  4JX5 A;  2VKH A;  2JZY A;  1FPQ A;  1MMA A;  2OJE D;  4OWR B;  1S72 I;  3S1N J;  3CDH A;  4EM0 B;  4RBO A;  3A0H C;  5GP9 A;  4OIR F;  1YYV A;  2J5P A;  1QNT A;  1YJN I;  1PP7 U;  2GM4 A;  2VQH A;  4B8X A;  4ZTJ A;  4IHT A;  3CJQ B;  4GCV A;  3GTL J;  2OAZ A;  4NC8 A;  5DD8 A;  2DMP A;  3RPU A;  4Q5S F;  1XB4 A;  2ME0 A;  3FXL A;  5D4S A;  4BHP A;  4J19 A;  4A3C J;  2FXA A;  1ZLK A;  2EZL A;  3FBN B;  1SMT A;  1A6Q A;  5D5X B;  2E60 A;  4ZZL A;  3O8H A;  1Z67 A;  4LJZ F;  1TWG J;  1X1B A;  4F92 B;  1SD7 A;  3AG1 H;  1EJ9 A;  4MLO A;  1LJ9 A;  1KYW A;  2NRA C;  4EQQ A;  1TWH J;  4BDY A;  2Y69 H;  4GYI A;  3A2K A;  4Y7N J;  1YFH A;  4CH7 A;  1RR8 C;  2VPL A;  4IEJ A;  1TT5 B;  1PUF A;  2DA2 A;  2MSY A;  4E7H A;  2C6Y A;  1FLI A;  3MQ0 A;  4XIC A;  1G6N A;  1UG2 A;  2CQK A;  1P7J A;  3CCQ I;  3S14 J;  2QEN A;  3OYE A;  2EH3 A;  1VQK I;  2EFW A;  4E4H A;  2ZC2 A;  5M5Y J;  3I4P A;  2HYJ A;  3WU1 B;  4XN0 A;  3SZP A;  4YFN F;  3WTW C;  2HDW A;  2EZH A;  1QZY A;  4OAZ A;  3TL4 X;  4JOM A;  1ZRF A;  2KMU A;  1MBH A;  5KHD A;  1JKP C;  1T2K A;  2X51 A;  2P0W A;  3BG9 A;  3E0J B;  3OYL A;  2O9L A;  3TGN A;  2FNP A;  4R1H A;  3KFW X;  3L2W A;  1I3A A;  2GXG A;  2LC2 A;  5EG0 A;  4DBR A;  3VYS B;  1LDD A;  2VXZ A;  2D1H A;  2F5F A;  1ZH5 A;  1O3S A;  3HOY J;  1XMX A;  4CCJ A;  4HSR A;  3K4K A;  5EZH A;  3JRB A;  3ZQG A;  4M6Y A;  3QP5 A;  4YII A;  5LBQ A;  3HXL A;  2CG4 A;  4RB0 A;  3R4K A;  1T98 A;  5J6X A;  2ZME B;  1IN5 A;  4C9Y A;  4NHJ A;  1S9H A;  4CYC B;  4RLQ A;  1U5T C;  4P9U A;  2VON A;  2LP0 A;  1LUJ B;  3MKL A;  3I4N J;  2PBI A;  3BJO A;  1SC7 A;  2X85 A;  3WGG A;  2AS5 F;  4BH9 A;  2JA7 J;  2E7W A;  3D0S A;  1E3H A;  1U6G A;  2XRO A;  4IHY A;  1I39 A;  4M6V A;  4DBQ A;  4YIF A;  3G1O A;  1SAU A;  2X6X A;  2X6W A;  2EA2 A;  2D45 A;  4I01 A;  3BR0 A;  1FNN A;  4IXA A;  3COA C;  2DA7 A;  4PJM A;  1HCR A;  4E70 A;  1BC8 C;  5DTD A;  3C3W A;  4PCQ A;  4RM3 A;  4EJV A;  4KIT B;  1O7F A;  3AG3 H;  3GCM A;  1FP2 A;  1FSE A;  2CFX A;  1H0M A;  1JTX A;  2EV0 A;  1D1C A;  2MC3 A;  1RUO A;  4IQ4 A;  1D8K A;  2E19 A;  2GA1 A;  2JSC A;  3FXU A;  1JGS A;  1S6L A;  3KX2 A;  4BXU A;  5C44 J;  5BOX A;  1RIO H;  5F27 A;  3BCB A;  1OYY A;  1E3O C;  4G12 A;  2XAQ A;  3QYF A;  3TDU C;  2K3F A;  3HC7 A;  3N05 A;  2DT6 A;  1GV5 A;  3GFL A;  2BYV E;  3OL3 A;  3S15 J;  1FSH A;  4GFB A;  3OYG A;  1PUF B;  1S7A A;  5EG0 B;  2LY1 A;  1V55 H;  1ZGW A;  2FE3 A;  1ITY A;  1XN7 A;  1HDP A;  3U1K A;  3U21 A;  3WU2 C;  4XOP A;  2VN2 A;  2FBH A;  2R5Y A;  1TZL A;  1W0U A;  3TO6 A;  1A5J A;  5GAG J;  2CFO A;  4IHX A;  1YHQ I;  3VYT B;  2X48 A;  2PMH A;  3DEU A;  2XB0 X;  1WJF A;  2KIM A;  5JHF A;  1G3T A;  2VT2 A;  2EIM H;  2Y0S A;  3KLN A;  1EKE A;  2FBI A;  2HKO A;  3MAJ A;  3R60 A;  2R7V A;  4X6A J;  3BJ6 A;  3VOD A;  4AVP A;  2BEO A;  2M1B A;  3GTO J;  2H6B A;  2CUJ A;  2ZCW A;  3OYM A;  2LKX A;  4M3E A;  3K0L A;  2GBY A;  4OOI A;  2WB1 A;  4ANJ A;  5E18 F;  4AWX B;  1PUE E;  2IGM A;  3M3Y J;  5CQG A;  5DUI A;  3E3V A;  3KET A;  4PJN A;  4LLL A;  3ZMU A;  5K7H A;  4M9S A;  3RPQ A;  1BR4 A;  2G9W A;  5JHU A;  5K7F A;  2K40 A;  4Z6Y A;  1JE8 A;  1IJW C;  2WAQ A;  3TW6 A;  4WXC A;  4CYC A;  3DLL F;  1Y1V J;  2BY2 A;  2DTR A;  4H4K C;  1T95 A;  1S29 A;  3I0T A;  4CIC A;  2ETH A;  4NNJ A;  1P7I A;  2OZU A;  5AIP A;  1XSD A;  1X3U A;  3OS0 A;  4DQ2 A;  2HOA A;  2LBF B;  2EV6 A;  2Y0M A;  5KK1 A;  3CC7 I;  4BE1 A;  3RZO J;  4HZF A;  1WI9 A;  2R7F A;  1L3L A;  2NS0 A;  2COM A;  4HA8 A;  1BI1 A;  1YG2 A;  1ZAO A;  3JAM K;  5F64 A;  4IF4 A;  4A0Y A;  1K6O A;  1VQO I;  4BBR J;  1AHD P;  3L9F A;  4D0P A;  2AQF A;  2EZK A;  2KFD A;  4KT6 A;  4NB5 A;  3S93 A;  1RNL A;  2CQQ A;  2OTJ I;  3ZQC A;  3ZQ7 A;  3IH3 A;  2CGP A;  1ETX A;  3PL8 A;  1W4M A;  4CA0 A;  1BIA A;  4CCM A;  3DCF A;  2H94 A;  3H0G J;  1J7K A;  1FEX A;  5EEA A;  2GZW A;  1WHU A;  4BAC A;  3FWE A;  2Y75 A;  5FGM A;  3FMS A;  2VJ4 A;  1MMD A;  3DPT A;  2FSW A;  4LLN A;  4AIH A;  3O6B B;  2LKS A;  4S0H B;  2ELK A;  4F52 A;  2LVS A;  3KP2 A;  2A5Y B;  1YLF A;  1W36 C;  4GO1 A;  3SEZ A;  3LQQ A;  3E5Q A;  3KZY A;  3H5R A;  2EIK H;  2E7X A;  1VQP I;  1PYV A;  2LMD A;  2RV8 A;  2KIQ A;  1XGM A;  1LFU P;  3EUK L;  4JX4 A;  4I2O A;  2E1O A;  3VPR A;  3QU3 A;  2JSP A;  4BQN A;  4UY8 I;  2BV6 A;  2STW A;  2EB7 A;  4LFU A;  5IY5 H;  2HQR A;  2XPU A; 
#chains in the Genus database with same CATH homology
 4NQW A;  4G9Y A;  4KA4 A;  2V79 A;  1UFM A;  5CLS A;  2P5L C;  1FC3 A;  2X4H A;  3L00 A;  3F21 A;  4O3M A;  3QU6 A;  3IC7 A;  2W85 A;  3HRT A;  5DCF A;  5BPI A;  3H3Z A;  4MNU A;  3VOE A;  1I27 A;  3CUO A;  5DUK A;  3C7J A;  3RKX A;  1I1S A;  3QAH A;  4IRH A;  4QWQ A;  1W5S A;  1OYI A;  4EMS A;  3PQK A;  3CJN A;  2FNA A;  4FHT A;  1YW8 A;  3V7R A;  1USS A;  2QQB A;  3GLX A;  3K1M A;  4PZJ A;  4G7O F;  3QRF F;  1XD7 A;  1H9G A;  5K5R A;  1YW7 A;  2K27 A;  3MWM A;  1G3Y A;  1KU7 A;  4WXH A;  2P6T A;  2L54 A;  3IWZ A;  1YW9 A;  3P7N A;  5E1W A;  4Y13 A;  1HXD A;  4LB6 B;  4UV8 A;  3HYI A;  1SFU A;  5HS8 A;  1IF1 A;  2PG4 A;  4KMU X;  3BY6 A;  2P4W A;  2IA2 A;  3QOP A;  4OIN F;  2XIG A;  2KJC A;  3S2W A;  4CYD A;  2QQA A;  2WTE A;  5EEG A;  3ECO A;  3KP3 A;  4R79 A;  3DPL C;  5IT3 A;  1BC7 C;  3EUH A;  2PI0 A;  3V8K A;  1CGP A;  5ICE A;  2PN6 A;  2Z9O A;  1IZ1 A;  5D4R A;  3FMQ A;  1R1V A;  1K79 A;  4L0Y B;  2HS5 A;  1T0F A;  4RB2 C;  3E5U A;  3I54 A;  4U0W A;  3TO7 A;  2XAH A;  4Q4Z F;  1SFE A;  4U7D A;  1J9I A;  3SXY A;  3MZH A;  3FM5 A;  2WV0 A;  1KU3 A;  1K78 B;  2IJL A;  5ILS A;  2Z99 A;  4BQA A;  3K1N A;  1YTY A;  1R23 A;  3SQN A;  2KIF A;  3WTS C;  4U0Y A;  1KU2 A;  3J7A O;  3C18 A;  3F22 A;  2VC0 A;  4ON0 A;  1ZN2 A;  1W7P A;  3WE3 A;  2M87 A;  2A61 A;  2IW5 A;  1TW3 A;  2XAJ A;  3RI4 A;  1MJB A;  3M7G A;  5FLX Z;  5L3D A;  3QPT A;  3RIR A;  5FLX K;  4BAY A;  5JR3 A;  4G8X A;  1IXC A;  2R7D A;  1XDU A;  1HW5 A;  2HTJ A;  1FOK A;  2M5W A;  1LEA A;  1HKT A;  4UV9 A;  5ILU A;  1IXR C;  4PGH A;  1ZGJ A;  3HTU A;  2Q8K A;  4UVA A;  5ICF A;  3MCZ A;  2HQN A;  2JPB A;  2ZBK A;  3M8E A;  1O57 A;  2A69 F;  2ACJ A;  3P9I A;  1QO0 D;  3ZMS A;  3TQN A;  3BP8 A;  4IPA A;  4EJU A;  1R7J A;  5HLI A;  5LRS A;  3LA2 A;  1QBJ A;  2LF7 A;  4KUM A;  4ENK A;  4RGU A;  1YQA A;  3T1B A;  3ZPL A;  1QGP A;  2W25 A;  4IJA A;  4HLY A;  2X0L A;  4A6D A;  5J8C A;  2L4A A;  4MEX F;  5CYV A;  2P8T A;  4XSX F;  5LHH A;  2RVC A;  3HRU A;  4EM2 A;  1FT9 A;  3R61 A;  2PEX A;  1QQI A;  4DNC A;  5KVR A;  5DD4 A;  4ETS A;  4L9T A;  5TJJ A;  2HYF A;  4WF2 A;  3WTV C;  3WU0 A;  4IRG A;  1S7O A;  1Z6T A;  2ZNZ A;  4YFX F;  3HSR A;  3ZMV A;  4ENJ A;  2YSR A;  2V1D A;  3EET A;  3WTZ A;  3TO9 A;  1FWZ A;  1KYZ A;  4M74 A;  3F23 A;  1ZGA A;  2M45 A;  3HOT A;  2VBW A;  4I98 B;  1ZLJ A;  5D6E A;  4LGW A;  3F3X A;  2O0Y A;  3IKT A;  2E1N A;  2A3S A;  3K1P A;  5LEK A;  2FML A;  3GFI A;  4EJO A;  5JI6 A;  5D6F A;  3FHZ A;  2PFB A;  5CVR A;  4MGR A;  1IN6 A;  1PP8 F;  1G3W A;  4HAM A;  1QZZ A;  3HRS A;  3WOD F;  1LQ1 A;  3M9A A;  3H92 A;  3JSP A;  4AIK A;  4KIC A;  5LGU A;  3ZN1 A;  4L9J A;  3R0J A;  1FYM A;  3OOP A;  1ZG1 A;  1D8J A;  1TLH B;  5JFR A;  3E6M A;  2FEZ A;  2B0L A;  1TBX A;  1B1B A;  3N4M A;  1ZRD A;  1FBU A;  5E20 A;  3E97 A;  4LG0 B;  3LQR A;  3OV8 A;  3KEQ A;  4A0X A;  1P4A A;  2MA3 A;  2M30 A;  4KYW A;  3F8B A;  2EFO A;  2MH2 A;  2RNJ A;  3REO A;  3CLO A;  1F1Z A;  2QZ8 A;  1ON1 A;  2O8X A;  1BI0 A;  2GQQ A;  2P7C B;  4ZYG A;  2D2W A;  1R5H A;  2DO7 A;  1GHC A;  3U2R A;  4UHT A;  5HLH A;  4PDK A;  3KP4 A;  2O03 A;  4EGZ A;  3JSO A;  3C1D A;  4OMY A;  3K2Z A;  3B02 A;  1G4D A;  2CSO A;  2KIU A;  1WSU A;  6PAX A;  1ULY A;  3BRO A;  3LA7 A;  1LDJ A;  1KQ0 A;  5ICG A;  5D8L B;  1RI7 A;  2EFQ A;  2XVC A;  2CO5 A;  3G3Z A;  4JK1 X;  4WCG A;  5F1R A;  2Z5U A;  5BMZ A;  5JVT A;  1J0R A;  5FFX A;  2MLK A;  2HOE A;  1CF7 B;  4MEY F;  4ZH4 F;  3T8T A;  1KU9 A;  3DQV C;  1JHH A;  1S3J A;  1SD4 A;  2A07 F;  4KDP A;  3JAM Z;  4I09 A;  4OIO F;  4ZYH A;  3GZ5 A;  2GXB A;  4QLC U;  5H20 A;  2CWE A;  3F8M A;  3RYR A;  3V4G A;  1TQP A;  3K9T A;  3GFJ A;  2ZXJ A;  1EH6 A;  5H6R A;  2ESH A;  5IT9 Z;  2G7U A;  5DDG A;  3V7C A;  1G3S A;  5BPD A;  2RQP A;  3WTU C;  3GUD A;  5HVQ C;  2DU9 A;  1Z05 A;  4S04 A;  3ABT A;  2M8E A;  1YO5 C;  2V1X A;  4TV7 A;  2E1C A;  3BJA A;  2LF8 A;  4K2E A;  2VOP A;  1B6A A;  4KIF A;  3RKW A;  2KJB A;  4H0E A;  4G6Q A;  1TQM A;  2UXX A;  2F2E A;  4KNY A;  2WC2 A;  1BIB A;  2DK5 A;  5AIQ A;  3JTG A;  4G7H F;  1Z1D A;  4EVI A;  4S05 A;  3HOS A;  2LSO A;  3ZMT A;  3GW2 A;  3KP6 A;  2Z33 A;  1WWX A;  1MJA A;  1IXS B;  3GYH X;  1W7P B;  3ZMZ A;  5FO5 A;  2D1V A;  3WTY C;  1E2X A;  1OKR A;  1I1G A;  1R58 A;  4FX0 A;  4HW0 A;  4HF1 A;  2QQ9 A;  1EH7 A;  3O3K A;  3I53 A;  4L5I A;  1HST A;  3EDP A;  2OD5 A;  1AWC A;  4HBL A;  4RGS A;  4OIP F;  4L5J A;  2VBZ A;  1KA8 A;  4EM1 A;  4RAY A;  3RKY A;  3DFG A;  2W84 A;  1SD5 A;  3TDZ C;  1J59 A;  2TDX A;  4N0B A;  2ZFW A;  3RDI A;  2FBK A;  1I6X A;  1UHM A;  4MTD A;  2RN7 A;  3F8F A;  3F72 A;  2KRF A;  2ISZ A;  5LEJ A;  1MDM B;  2YU3 A;  3W6K B;  4I0B A;  4XRF A;  4KT5 C;  5DCM B;  5LHG A;  2EFP A;  1PDN C;  3VEP A;  1HW1 A;  1OR7 A;  5CVU A;  5L3G A;  3IL2 A;  1C0W A;  3ZP5 A;  1XGN A;  3RJP A;  5A2Q K;  5A2Q Z;  3J80 K;  2A68 F;  2IPQ X;  1REP C;  3ML6 A;  3IRQ A;  1LEB A;  1NHA A;  3FF5 A;  4LD5 A;  3ELK A;  2PJP A;  5DYM A;  3LWF A;  5AON A;  1ZAR A;  3TOB A;  3ZMD A;  4ZZD A;  2PQ8 A;  1MJ9 A;  1DPU A;  2FOK A;  4KIB A;  1WRJ A;  2XAG A;  2EJR A;  3HIF A;  2NNY A;  5DCM A;  2EWN A;  2W24 A;  2L02 A;  3ZN0 A;  5FD6 A;  3I58 A;  5F6F A;  1I5Z A;  3DF8 A;  3DP7 A;  1KQ9 A;  1D5V A;  1IN7 A;  2EV5 A;  4L0Z B;  3N97 A;  4CHU A;  1DP7 P;  2OBP A;  1U5T B;  5K1Y A;  1U78 A;  1P92 A;  1SD6 A;  1Z7U A;  4RAZ A;  3W6J B;  4EJT A;  4Y15 A;  4L9N A;  1IAW A;  2XKP A;  4Y17 A;  1Q1H A;  2GAU A;  1T6S A;  5DV5 A;  4ESF A;  2GWR A;  3RTR A;  2MBF A;  3L2C A;  1BBY A;  1FBS A;  4EV0 A;  4HV5 A;  2P5K A;  4M9X A;  3HHH A;  1R5G A;  1GXQ A;  2IA0 A;  5CVJ A;  1IW7 F;  1TW2 A;  3IHU A;  4HV6 A;  3R0A A;  4U0V A;  2LNB A;  1LVA A;  4Q47 A;  2LKP A;  4XLP F;  1MGT A;  5H6Q A;  3U9G A;  2ZJ2 A;  2EFN A;  2DI3 A;  4P9F A;  4UNO A;  5LGN A;  3QP6 A;  3GX4 X;  3WG9 A;  1R36 A;  4I7H A;  3BWG A;  4A0Z A;  4BHC A;  1HW2 A;  3NEU A;  2YX4 A;  4HX7 A;  4G94 A;  1UB9 A;  3DV8 A;  2H27 A;  4OIQ F;  2DT5 A;  2QVO A;  2XKO A;  3GFM A;  3SFZ A;  1Y0U A;  3V7S A;  4LG0 A;  1IRF A;  3HSE A;  1U2W A;  1U3E M;  2OA4 A;  3HUG A;  3FXR A;  2JT1 A;  1F5T A;  1EH8 A;  3LAJ A;  2AXL A;  4MQV A;  2ZNY A;  5E1X A;  3I71 A;  4RS8 A;  2H6C A;  2BBY A;  2QUF A;  1TTY A;  4I02 A;  5HOO A;  2IRF G;  2FQ3 A;  4IRI A;  2QYO A;  2UZK A;  2XRN A;  4EGY A;  1GXP A;  2VE9 A;  2ISY A;  2ESN A;  1T39 A;  3EQL F;  4YG2 F;  2FMY A;  3F6O A;  4KN4 X;  4N9I A;  2FA5 A;  4PGG A;  3M8F A;  2PMU A;  3BPV A;  4ASN A;  2P5V A;  5L3E A;  1ZYR F;  5EEH A;  2P7V B;  2W57 A;  3FZV A;  5J8F A;  4U7B A;  5IT9 K;  4RB3 C;  5HDG A;  1TNT A;  2IP2 A;  1LNW A;  2IT0 A;  3E6D A;  1FP1 D;  2R3S A;  3J81 K;  1Z91 A;  2YR2 A;  1FBQ A;  4F7Z A;  2O6G E;  2FU4 A;  2V9V A;  4M73 A;  1O7L A;  1WQ2 A;  3VFZ A;  4GYG A;  1XMA A;  5K5Q A;  4G6D A;  3DXJ F;  2NNN A;  2DFI A;  4M72 A;  5TRD A;  4Z2Y A;  4CO8 A;  5ILV A;  1R22 A;  2F5D A;  5L3C A;  5ED4 A;  3BPX A;  2J5O A;  4A6E A;  2QBY B;  1L0O C;  2JPC A;  2RDP A;  3Q9V A;  1W7P D;  1R1T A;  3BOQ A;  3KEO A;  5D5V B;  5HDN A;  5CVI A;  2K4B A;  1BI2 A;  1OPC A;  4P55 A;  2DK8 A;  2K7L A;  1P2F A;  4B09 A;  3GVA A;  4LLG F;  2VBX A;  1MKM A;  2MLG A;  1XGO A;  1K7A A;  2ZO4 A;  4RGX A;  3TKY A;  4EJW A;  1DDN A;  1UST A;  2V6C A;  3BDD A;  1BM9 A;  5HDK A;  4M6X A;  3I59 B;  1RUN A;  2OU2 A;  2FRH A;  3Q9S A;  1B4A A;  1FZP B;  1J2X A;  2O3F A;  4RGR A;  1XCB A;  4XSZ F;  3EYY A;  3O2P E;  4MHG A;  3F6V A;  2ZME A;  2Y48 A;  4ZYD A;  4BYY A;  2Q0O A;  5L3F A;  3P9C A;  1B9M A;  3AAF A;  1SFX A;  1SMY F;  3MEX A;  4HLX A;  3GXO A;  2H09 A;  4UXN A;  4N9H A;  1BOA A;  1IN8 A;  2WWY A;  4Q48 A;  3ROU A;  3TOA A;  3T0Y A;  4O6J A;  4IHS A;  3G73 A;  5E8I A;  3ISP A;  2HTS A;  5HS7 A;  4BHB A;  1O3Q A;  1ODD A;  1ZG3 A;  1UCR A;  2KKO A;  5E1Z B;  1IRG A;  2FF4 A;  5BS6 A;  1ONV A;  1T38 A;  3FM3 A;  1IN4 A;  2XUB A;  2VOO A;  1ZHF A;  1F9N A;  2DBB A;  1HKQ A;  2MD5 A;  2XV4 S;  4U88 A;  5ERI A;  3I59 A;  1S8N A;  3IWF A;  3FXQ A;  1UHW A;  1STZ A;  1WKM A;  4AIJ A;  1U8R A;  2DQR A;  4GGG A;  3KCC A;  4L9V A;  1BJA A;  3WTT C;  3KZZ A;  3B73 A;  2XAF A;  4FX4 A;  1TQI A;  2EK5 A;  4HDU A;  4KN7 X;  4OU0 A;  3GWZ A;  2Q2E A;  2BE5 F;  3CUQ C;  4R8H A;  4UVC A;  2F5C A;  2K4J A;  1R1U A;  1XSX A;  4BNC A;  1J75 A;  3LAP A;  4LMY A;  1HKS A;  3WE2 A;  4JBA A;  4A5M A;  2XHK A;  2K86 A;  3QPH A;  1A04 A;  3T5X A;  1YS7 A;  4HF2 A;  2P6S A;  1KQ8 A;  4WX9 A;  2BGC A;  5HS9 A;  2ADU A;  5D5W B;  4CGZ A;  2OZ6 A;  3T8R A;  3M1E A;  1HQC A;  2HDC A;  4HYE A;  1RZ4 A;  2HZT A;  4CDG A;  2OQG A;  1XCV A;  3I64 A;  3LFK A;  1QPM A;  2HYG D;  3J81 Z;  3WGI A;  3ECH A;  3GF2 A;  1LB2 A;  1U5T A;  3KP5 A;  3V8J A;  4ESJ A;  1W5T A;  2HWV A;  2GIV A;  2VC1 A;  3NQO A;  4P5O A;  1R00 A;  2ELH A;  1XMK A;  3ULQ B;  2L4M A;  5CVV A;  2NAZ A;  4LB5 A;  1KGS A;  2RC4 A;  2PLY A;  2XGX A;  3FX3 A;  3Q5F A;  1GVJ A;  3R6S A;  3K69 A;  4JQF A;  3WGH A;  1HSJ A;  3CUQ B;  3E6B A;  3MFK A;  2NYX A;  1LDK B;  2MH9 A;  4XBF A;  1HBX G;  5FD5 A;  3EYI A;  4KIG A;  4ZYE A;  1OMI A;  2Z3Y A;  1B9N A;  3HSF A;  1YIO A;  2V1U A;  3HHG A;  1XSV A;  3GEZ A;  2DQL A;  5E8G A;  2HGC A;  3CTA A;  4CZZ A;  3KP7 A;  3PFI A;  2OQR A;  1OYW A;  1Z6R A;  3IKV A;  4OMZ A;  2RKH A;  3HRM A;  5HLG A;  4A12 A;  3NRV A;  2STT A;  2G7H A;  3I5U A;  3E5X A;  1BN5 A;  5ICC A;  1E17 A;  1FX7 A;  2YPR A;  5DEQ A;  3RYP A;  4RB1 A;  1FYK A;  1CF7 A;  2CW0 F;  1MDM A;  4YFK F;  2VBY A;  4LK1 F;  4HOB A;  3KLO A;  2UWM A;  4G7Z F;  5CJ9 A;  4UVB A;  4WXD A;  2EA4 A;  3JTH A;  2VT3 A;  3CO6 C;  2L3D A;  1XDS A;  1MD0 A;  1K78 A;  4WWC A;  5D5U B;  3GO5 A;  3H3U A;  1JXS A;  4ESB A;  1MZB A;  2HR3 A;  2VE8 A;  3CUQ A;  1TNS A;  1DUX C;  3CO7 C;  4HQM A;  3L09 A;  3J80 Z;  4CXF A;  3JW4 A;  4MTE A;  1EV7 A;  1F4K A;  1YS6 A;  3U1D A;  3FMR A;  2A6E F;  5LGT A;  1FY7 A;  1ON2 A;  2DPU A;  3L7W A;  2UXN A;  2JTV A;  4GXO A;  5K5O A;  4HX8 A;  2HEO A;  2A6H F;  4KFC A;  1V4R A;  5E17 F;  5LHI A;  3D5L A;  3LA3 A;  3PQJ A;  1JHF A;  1ZG5 A;  2L01 A;  2GA2 A;  1O3R A;  3LST A;  3MZY A;  4AD9 A;  4ENN A;  1FYL A;  4HDV A;  3IRR A;  3WTX C;  2CYY A;  2QBY A;  2IA1 A;  3KE2 A;  5LLQ A;  4ENM A;  4UUV A;  2HFH A;  1J5Y A;  1VTN C;  2DAO A;  3GZ6 A;  4KMF A;  3ABU A;  1O3T A;  1P4X A;  4HF0 A;  2JRT A;  2DW4 A;  1B59 A;  3F8C A;  2DPD A;  4MQ9 F;  2K02 A;  4FT8 A;  2YX7 A;  4HX4 A;  5LRR A;  2LDU A;  4M9Z A;  5FFZ A;  4L18 B;  3SHF A;  1ZRE A;  4I0A A;  2O61 A;  5D8K B;  4A2U A;  4A5N A;  5BQT A;  2ZKZ A;  2IVM A;  2QWW A;  1IUY A;  4M71 A;  3ERE D;  4P96 A;  1P6R A;  1V3F A;  2QM3 A;  3BZ6 A;  3DKW A;  5L3B A;  1XGS A;  2DLL A;  2RGV A;  3P9K A;  4O5V A;  5FB2 A;  2XAS A;  2QLZ A;  4WK8 F;  4XLN F;  3F8N A;  4LK0 F;  3E6C C;  2VOD A;  3VB2 A;  1D3Y A;  3V8L A;  1P4W A;  1DPR A;  1H9T A;  1Z9C A;  4IVN A;  4HQE A;  1SAX A;  3HTS B;  1AOY A;  1BI3 A;  1ZRC A;  3SZT A;  2HKX A;  2F5E A;  2JZY A;  1FPQ A;  3CDH A;  4EM0 B;  4OIR F;  1YYV A;  2J5P A;  1QNT A;  1PP7 U;  4B8X A;  4IHT A;  4GCV A;  2OAZ A;  5DD8 A;  3RPU A;  4Q5S F;  1XB4 A;  5D4S A;  4BHP A;  2FXA A;  1ZLK A;  1SMT A;  5D5X B;  4ZZL A;  4LJZ F;  1SD7 A;  2NRA C;  1LJ9 A;  1KYW A;  4EQQ A;  4GYI A;  1YFH A;  2C6Y A;  1FLI A;  3MQ0 A;  1G6N A;  2CQK A;  2QEN A;  2EFW A;  3I4P A;  3WU1 B;  3SZP A;  4YFN F;  3WTW C;  1QZY A;  1ZRF A;  1T2K A;  3TGN A;  2FNP A;  4R1H A;  3KFW X;  2GXG A;  1LDD A;  2VXZ A;  2D1H A;  2F5F A;  1ZH5 A;  1O3S A;  4M6Y A;  3QP5 A;  4YII A;  5LBQ A;  2CG4 A;  4RB0 A;  5J6X A;  1T98 A;  3R4K A;  2ZME B;  1IN5 A;  4NHJ A;  1U5T C;  4P9U A;  2VON A;  2PBI A;  3BJO A;  3WGG A;  2AS5 F;  4BH9 A;  2E7W A;  3D0S A;  2XRO A;  1U6G A;  4YIF A;  2EA2 A;  2D45 A;  4I01 A;  1FNN A;  4IXA A;  3COA C;  4E70 A;  1BC8 C;  3C3W A;  4PCQ A;  4EJV A;  1O7F A;  1FP2 A;  1FSE A;  2CFX A;  1H0M A;  2EV0 A;  2MC3 A;  1RUO A;  1D8K A;  2GA1 A;  3FXU A;  2JSC A;  5BOX A;  1JGS A;  1S6L A;  4BXU A;  1RIO H;  1OYY A;  2XAQ A;  3TDU C;  3GFL A;  2BYV E;  1FSH A;  1S7A A;  2FE3 A;  1XN7 A;  2VN2 A;  2FBH A;  3TO6 A;  2PMH A;  3DEU A;  2KIM A;  1G3T A;  2VT2 A;  3KLN A;  2FBI A;  2HKO A;  3MAJ A;  3R60 A;  3BJ6 A;  3VOD A;  4AVP A;  2BEO A;  2M1B A;  2H6B A;  2ZCW A;  3K0L A;  4OOI A;  5E18 F;  4AWX B;  1PUE E;  5DUI A;  3E3V A;  3KET A;  4LLL A;  3ZMU A;  4M9S A;  3RPQ A;  2G9W A;  5JHU A;  1JE8 A;  4WXC A;  2DTR A;  1S29 A;  3I0T A;  4CIC A;  2ETH A;  5AIP A;  2OZU A;  1XSD A;  1X3U A;  4DQ2 A;  2EV6 A;  2Y0M A;  5KK1 A;  4HZF A;  1WI9 A;  1L3L A;  2R7F A;  2NS0 A;  2COM A;  4HA8 A;  1BI1 A;  3JAM K;  1YG2 A;  1ZAO A;  5F64 A;  4IF4 A;  4A0Y A;  1K6O A;  3L9F A;  4D0P A;  4NB5 A;  1RNL A;  3ZQ7 A;  2CGP A;  1W4M A;  1BIA A;  2H94 A;  1J7K A;  2GZW A;  3FWE A;  2Y75 A;  5FGM A;  3FMS A;  4LLN A;  3DPT A;  2FSW A;  4AIH A;  3O6B B;  3KP2 A;  2A5Y B;  1YLF A;  4GO1 A;  3LQQ A;  3E5Q A;  3KZY A;  2E7X A;  2RV8 A;  1XGM A;  4I2O A;  3QU3 A;  2BV6 A;  2STW A;  2EB7 A;  4LFU A;  2HQR A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...