4EGZA

Crystal structure of arar(dbd) in complex with operator orr3
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
81
structure length
81
Chain Sequence
LEVLFQGPLGSEFMLPKYAQVKEEISSWINQGKILPDQKIPTENELMQQFGVSRHTIRKAIGDLVSQGLLYSVQGGGTFVA
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription/dna
molecule keywords Arabinose metabolism transcriptional repressor
publication title Spacing between core recognition motifs determines relative orientation of AraR monomers on bipartite operators.
pubmed doi rcsb
source organism Bacillus subtilis
total genus 22
structure length 81
sequence length 81
chains with identical sequence B
ec nomenclature
pdb deposition date 2012-04-02

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00392 GntR Bacterial regulatory proteins, gntR family
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4egzA00
5HLGA 3MCZA 2K4JA 5CLSA 2P7CB 5FD5A 1FX7A 4KIBA 1YLFA 2LNBA 1P6RA 1YQAA 1QQIA 3LFKA 1LJ9A 3KP7A 3TO9A 1HXDA 2W25A 4EM0B 2VODA 5ED4A 1IRFA 3F8MA 2COMA 2EB7A 1K6OA 2KJCA 1I1SA 4XRFA 5L3CA 2KJBA 4O6JA 4EJUA 1P2FA 4ON0A 3C7JA 1O3TA 3HIFA 4E70A 4LK0F 4A5NA 3K1NA 3TQNA 4A12A 2Z5UA 3KP6A 4KA4A 3HHGA 3J81Z 1T6SA 2A5YB 2V1UA 3BPXA 3L09A 3OV8A 4U88A 4L5IA 1KU7A 1FOKA 4ENJA 3CUQB 3GF2A 2E7WA 3PQKA 5L3BA 3HRSA 2D45A 1YW9A 3TO7A 4YFXF 4BHBA 2HEOA 4KT5C 5ICGA 5HVQC 1G6NA 1ZG5A 1T2KA 4I7HA 4ESFA 2ELHA 1BM9A 3J81K 5HS9A 1Z6TA 1V3FA 4Y15A 4Q5SF 2Z9OA 4KMFA 4BNCA 3QU6A 1SD6A 2YX7A 5H20A 1QO0D 3K69A 4XSZF 1B4AA 3JAMZ 2FA5A 4KN4X 4UVAA 4LGWA 3KCCA 1JXSA 1XSDA 2WV0A 2A6EF 2FSWA 5A2QZ 2O61A 2O3FA 1I5ZA 2PMUA 1K78B 1Z91A 4ENKA 1RZ4A 1S7AA 2OQGA 1BN5A 1SFXA 3HYIA 3O2PE 1XCBA 4LG0B 2K27A 2F2EA 4GGGA 1U5TA 3TOBA 3JAMK 1O57A 2ZJ2A 1IRGA 2ZXJA 1LNWA 2KRFA 3EQLF 5EEGA 1HSTA 1WRJA 2MBFA 4EM1A 2EWNA 2FEZA 2EJRA 1VTNC 3I58A 1Y0UA 1HKTA 3MQ0A 2BBYA 2BE5F 3DEUA 1XCVA 4Q4ZF 2M8EA 4P9FA 4B09A 2DLLA 1GXPA 2HYGD 1ZGJA 3C3WA 2RGVA 5ICEA 2CO5A 4ZYDA 2PBIA 5HS8A 1S3JA 1AWCA 2R7FA 2XAJA 2GXGA 4OOIA 4BHCA 1BIBA 2A68F 2JTVA 3HRMA 1R7JA 3WTUC 1ZLJA 4M74A 1FNNA 3U1DA 3E5QA 2MLGA 4HZFA 4YIFA 1H9TA 4HDUA 3ULQB 1ZARA 3U2RA 5D5WB 1R5GA 4WXCA 3COAC 2D1VA 2DPUA 2H6CA 1L0OC 3RKWA 3RYPA 1RIOH 3FMQA 3E5XA 3P7NA 5E18F 1OYWA 2KKOA 3R6SA 3F6VA 2W24A 5D8LB 4EJVA 1FPQA 2HQNA 3TDUC 2O03A 1FP2A 4A6EA 1ZLKA 1IN5A 3NRVA 4HLYA 2HWVA 2ISZA 3CJNA 4G6DA 1KQ8A 2IA0A 1WQ2A 2QQBA 2HDCA 4WXHA 4RB2C 5H6QA 4I02A 3K1MA 2HFHA 4EMSA 5LHGA 1KQ9A 1SD4A 4RB3C 4LD5A 2K02A 2EV0A 3F23A 4NQWA 2Y0MA 3DPLC 4HLXA 5KK1A 5CVVA 1F4KA 3KZYA 3L9FA 3QAHA 5DUIA 1TLHB 2EFQA 5BQTA 1WSUA 1TW2A 3LA2A 3G3ZA 1U78A 2V9VA 3R0JA 4WK8F 1S8NA 4L5JA 3LAPA 2EFNA 1R5HA 2NNNA 4HAMA 2VT2A 3T8RA 1KU9A 1IXSB 5D8KB 2VC0A 2UWMA 3FZVA 2PLYA 1U3EM 1BI3A 2GA1A 3B73A 1O3QA 4G94A 4WWCA 3IRQA 4NHJA 4KFCA 2H6BA 2ADUA 4MNUA 1UCRA 2LSOA 3QPHA 1IXRC 4UVCA 1HW2A 2QYOA 4HOBA 1ZRFA 4IJAA 3ZN0A 2F5EA 1YIOA 4CZZA 3WTWC 2F5CA 2CYYA 2DAOA 3IKVA 4LK1F 2B0LA 1ON1A 4Y17A 3LA3A 1XN7A 3SFZA 3KFWX 1ONVA 4EQQA 5F64A 1TBXA 3ZMSA 2EFWA 3WU0A 3F3XA 2XROA 4P9UA 5JI6A 2XV4S 2XIGA 4G6QA 3KEOA 2P4WA 2V1DA 2GAUA 2W57A 3I59A 3WGGA 2PQ8A 4H0EA 3Q5FA 1SMYF 4KIGA 3AAFA 3ZMDA 5KVRA 4DNCA 2XHKA 3M7GA 4IHSA 3R4KA 2QWWA 5ERIA 3WTZA 1JE8A 4RAZA 1KU2A 1UHMA 2STTA 1QZZA 2L01A 3CLOA 3T8TA 5FGMA 2E1NA 2L54A 1E17A 2ESHA 3TOAA 4LFUA 4EV0A 1D8KA 5D4SA 1EH7A 2MLKA 4KDPA 1K79A 4EM2A 4EGYA 1MJ9A 6PAXA 2J5OA 1U8RA 2IT0A 3I4PA 1FBSA 4CGZA 3HTUA 3RPUA 4BQAA 1HKQA 3CUQC 3L2CA 4RGUA 1DUXC 3W6JB 3TO6A 3LQRA 2H09A 3QPTA 3SZPA 1T98A 4R8HA 1JHHA 1R00A 1R58A 3VODA 3MAJA 3IL2A 4EGZA 4IVNA 2OU2A 2XUBA 3MEXA 1JGSA 1QZYA 1T0FA 3FF5A 1HQCA 3VOEA 4KNYA 2K86A 1BOAA 3K1PA 3G73A 4AWXB 2YX4A 1LDDA 3IKTA 1IN4A 1J9IA 3CTAA 1ZH5A 5LGNA 4HQMA 2FMLA 2HTJA 1TW3A 1T39A 2QQAA 1I27A 5HDGA 3ZQ7A 4D0PA 4I2OA 1HSJA 1LDKB 1FYMA 3DKWA 2RV8A 3F8CA 2QVOA 2VN2A 5L3GA 3BJAA 2ZCWA 2BEOA 2M30A 2DBBA 4CHUA 2FBKA 5J8FA 1MGTA 2VOPA 4R79A 1ZRCA 3WGHA 1IUYA 3LQQA 5CVRA 4UV8A 2JT1A 4BYYA 3GZ5A 1SD7A 1KGSA 4BH9A 5IT3A 3CUOA 2KIUA 4I0AA 1FLIA 3RYRA 5ILVA 2ISYA 1FSEA 5D6EA 5LLQA 1QPMA 4AVPA 2P6TA 5FO5A 2IW5A 1TTYA 2FQ3A 2NS0A 2EA2A 1XMKA 1EV7A 2XAHA 3WE3A 2R3SA 2L4MA 2M87A 5DD8A 2MD5A 2RQPA 2RNJA 5LGTA 3WU1B 2P5LC 3ELKA 3D0SA 3HSRA 3HSEA 1IN7A 5LHIA 2BGCA 4HYEA 3I59B 1FBUA 1R1TA 1B1BA 1CGPA 2VBXA 3L00A 3RDIA 3MZYA 5DYMA 3SHFA 3DP7A 1PP7U 2AXLA 4MTEA 4FHTA 5D5UB 2OA4A 5DCMA 3M9AA 4G7HF 1LQ1A 3KE2A 3V8KA 2NNYA 3CO7C 4P55A 4EJOA 5E1XA 2FBHA 2PN6A 3R0AA 4L9VA 3FX3A 3T1BA 3W6KB 3ERED 3EETA 4U7BA 1MJBA 3J80K 2V79A 2HGCA 1J5YA 5CVJA 1XGMA 1BI0A 3DQVC 1EH6A 2STWA 2ESNA 2NRAC 2G7UA 3P9IA 4A0YA 3K9TA 2WC2A 1YG2A 3RJPA 5HOOA 3R61A 3GLXA 3KP3A 3REOA 4Q47A 3I5UA 4WXDA 4CICA 5TJJA 3HTSB 2ZKZA 5DCFA 1WKMA 4N9HA 3K0LA 1A04A 1BI1A 1ZN2A 3RI4A 2X0LA 2CWEA 3NEUA 5LEKA 1ZG3A 3H3ZA 2FBIA 2FE3A 2M1BA 4PGGA 2IPQX 4HX7A 4GYIA 4R1HA 4QLCU 4UV9A 5L3DA 3FXQA 3KP4A 3FMSA 2XVCA 3BDDA 4HDVA 1B9NA 1TQMA 1Z1DA 2VE8A 5K5RA 2CGPA 3N97A 1GXQA 2DPDA 2ZNYA 5LEJA 3E5UA 3BZ6A 1P4XA 3V4GA 4BHPA 4IXAA 1FC3A 2IVMA 5HDKA 3TGNA 5F1RA 2TDXA 1FYLA 1XSVA 4RGXA 2EV6A 3N4MA 2PMHA 1XDUA 2OQRA 1E2XA 4LB5A 3D5LA 2QBYA 1SAXA 1H0MA 1B59A 3GUDA 3WTVC 1IXCA 1XGOA 2HQRA 5HLHA 3IRRA 3I64A 1MKMA 5L3FA 2QZ8A 4S05A 2FU4A 3GEZA 4XBFA 1OMIA 4YFKF 4AIHA 1ZYRF 2CW0F 2DK5A 2KIFA 4OIPF 1MDMA 3L7WA 5FB2A 4ASNA 3DF8A 4KICA 2MA3A 4M9XA 1HW5A 2RC4A 1D8JA 3JSOA 1YS7A 3WTSC 1YW7A 1DDNA 4GO1A 1FSHA 4ZZLA 2DFIA 1L3LA 1MJAA 1R22A 5H6RA 2MH9A 4IRGA 2VE9A 3GFMA 2GQQA 2IA1A 5HS7A 2P7VB 3HUGA 2M5WA 1J59A 2W85A 4ZZDA 1AOYA 4EJWA 4MTDA 1KA8A 3HHHA 2O6GE 1H9GA 3LAJA 1OPCA 2Z99A 1G3YA 3ZMZA 4PZJA 4G7OF 3FM5A 4OIQF 1RUNA 2J5PA 5DCMB 4L9NA 1C0WA 1G3SA 1Z7UA 3I0TA 4I01A 5D6FA 1K7AA 1R23A 4I0BA 2X4HA 4RGRA 3ECOA 4UNOA 4ZYEA 3F8BA 4WX9A 2OAZA 3HOTA 2FRHA 2VBZA 3B02A 4RB0A 2HZTA 2IA2A 3RIRA 4ZH4F 4JBAA 3RPQA 3U9GA 1F5TA 3HRTA 1U5TB 1ZREA 2XAGA 2JRTA 4HA8A 2PI0A 1MZBA 2VXZA 4ZYGA 4XLPF 3QOPA 3BPVA 4WF2A 4P96A 4UVBA 3ZPLA 4L9JA 3GWZA 1FWZA 1W5TA 4IF4A 2L3DA 5HDNA 2WWYA 1G3WA 3VEPA 3PQJA 4HV6A 4M6XA 2Q2EA 2UXNA 3KP5A 5DV5A 4G7ZF 2A6HF 1J2XA 5HLIA 3LSTA 2E1CA 3WODF 2XRNA 4YIIA 4HX4A 1UFMA 4AD9A 3F22A 4FT8A 2A3SA 2E7XA 2QQ9A 4FX0A 4JQFA 3SXYA 1FT9A 4OMYA 3K2ZA 3LWFA 5DDGA 4IPAA 1U2WA 1EH8A 3RKXA 2EFOA 1YS6A 4UHTA 3JTHA 2QM3A 2FXAA 2IP2A 2ZMEA 4HBLA 4RB1A 2QBYB 4MHGA 5LGUA 4ESJA 2KIMA 2LDUA 2L02A 1PP8F 4KIFA 2H27A 3BROA 5IT9K 2G9WA 1XB4A 3DV8A 3H3UA 2Q8KA 2XAFA 4LLNA 2K4BA 2DQLA 4GXOA 3BWGA 4PCQA 4FX4A 3BOQA 5JHUA 2IRFG 1MDMB 2DI3A 3QRFF 2UXXA 1MD0A 1REPC 2A07F 5ILUA 1BC8C 4F7ZA 4KN7X 3HOSA 1USTA 2DO7A 1XGSA 1IZ1A 2GA2A 5E20A 5ICCA 1BBYA 2GXBA 1BJAA 3SZTA 1V4RA 2PJPA 3BJ6A 4DQ2A 2F5FA 4A2UA 1P92A 2FNAA 3GFJA 3WG9A 1BI2A 4A6DA 2IJLA 4RS8A 3DXJF 5BPDA 2ETHA 2CG4A 1RNLA 5BMZA 1O3SA 3KZZA 3TKYA 3RTRA 1YW8A 3V7SA 1YFHA 2FMYA 1S29A 3ZMVA 2GIVA 1GHCA 1G4DA 1U6GA 4Q48A 1YO5C 1DPUA 2Y75A 4MQVA 2H94A 2D2WA 3BJOA 1YTYA 4MEYF 1Z6RA 2OD5A 4O3MA 2Y48A 3F6OA 1XMAA 2CFXA 4Z2YA 1HBXG 5EEHA 4YG2F 3WTXC 3FM3A 4XSXF 5FLXZ 3JW4A 2P8TA 5CJ9A 2LKPA 4EJTA 5ICFA 3MZHA 1RUOA 2JZYA 4TV7A 3GXOA 3V7CA 2XAQA 4HW0A 3T0YA 1B9MA 1F9NA 4JK1X 3VB2A 3P9KA 5D5XB 2WTEA 2BYVE 4B8XA 4ESBA 2EV5A 2AS5F 2QUFA 3JTGA 3ISPA 3EDPA 2K7LA 3F8NA 2RDPA 3GX4X 4L0ZB 1UB9A 1USSA 3J80Z 2YR2A 5FLXK 4RAYA 3FWEA 3KLOA 2NYXA 4KMUX 4WCGA 3E6BA 2HS5A 4M6YA 5J8CA 2G7HA 3E6MA 1RI7A 3ROUA 2FNPA 1LEBA 5LRRA 5CVUA 5LHHA 4HF0A 4U0YA 3E6CC 1G3TA 2JPBA 3ABTA 3DPTA 4RGSA 2XASA 3GZ6A 1QGPA 2MH2A 5BOXA 2MC3A 3FMRA 3IHUA 5FFXA 2D1HA 2VONA 4A5MA 1IN8A 2ZMEB 3ZMUA 2DQRA 3RKYA 3GVAA 3ZP5A 2P5KA 1OKRA 1P4AA 3F72A 2PG4A 3FHZA 1XGNA 4I98B 4MQ9F 4P5OA 1LDJA 3KP2A 5LRSA 1I1GA 5JFRA 4G9YA 1Z05A 4MEXF 4IRIA 2DTRA 5K1YA 1FP1D 3HSFA 1XSXA 4M72A 3SQNA 5A2QK 2PFBA 1TNSA 4L0YB 4M9ZA 5AONA 3VFZA 2HYFA 4LLGF 1ULYA 4OU0A 1O7LA 1XD7A 2HTSA 1ZHFA 2VOOA 4PGHA 5FFZA 1PDNC 3O6BB 2RKHA 1BC7C 5F6FA 1D5VA 3FXRA 4KYWA 4K2EA 2HOEA 4M9SA 1KYWA 1ZGAA 1NHAA 3MWMA 4XLNF 3V8JA 2XKPA 3T5XA 3GFIA 4NB5A 3TDZC 2ACJA 3Q9VA 1YYVA 4EVIA 3GFLA 1U5TC 1O3RA 4ENNA 2ZNZA 5E17F 3ECHA 4M71A 2QENA 3BY6A 2EFPA 3E3VA 3EYIA 3I71A 4M73A 1FYKA 2A69F 4I09A 2LF8A 5TRDA 4UUVA 3BP8A 4HV5A 2DW4A 2VBWA 1FBQA 4A0XA 3O3KA 2P6SA 2EA4A 2Z3YA 2Q0OA 5JR3A 1QBJA 3ZN1A 3QP6A 1LVAA 4G8XA 2LF7A 4HF2A 2NAZA 2FOKA 3E97A 5E8GA 3PFIA 1J7KA 1OR7A 1OYYA 1ZAOA 3IWFA 4OIOF 3GO5A 3QU3A 1F1ZA 3I54A 2FF4A 2OZUA 1W7PA 3CDHA 2ZFWA 1CF7A 4OINF 1T38A 2DK8A 4KUMA 4UXNA 3NQOA 1BIAA 3V8LA 2QLZA 4CXFA 4HX8A 2GZWA 1ODDA 3M8FA 3WE2A 3HRUA 1Z9CA 1W5SA 3JSPA 1DP7P 3ML6A 3Q9SA 1GVJA 1TQIA 4S04A 2W84A 4ZYHA 4N0BA 4L9TA 3C18A 2ZO4A 5DD4A 2R7DA 3OOPA 1IW7F 3M8EA 4IRHA 2O8XA 1S6LA 4IHTA 3V7RA 1ON2A 3CO6C 1WI9A 1FZPB 1PUEE 4PDKA 1SFUA 5J6XA 2DT5A 2VC1A 2CQKA 2PEXA 4CO8A 4BAYA 3F21A 4CYDA 5LBQA 3WTYC 1IAWA 2RN7A 1J0RA 1J75A 2OZ6A 4Y13A 5D5VB 1LB2A 3P9CA 3C1DA 4BXUA 3QP5A 5BPIA 1TQPA 2ZBKA 2YPRA 4GYGA 3WTTC 4QWQA 1KYZA 2M45A 4OIRF 3R60A 1KQ0A 3CUQA 5K5OA 3ZMTA 3EYYA 5AIPA 3KEQA 2CSOA 2L4AA 1DPRA 1SFEA 4A0ZA 3M1EA 5CYVA 1W7PD 2EK5A 5ILSA 4ETSA 5FD6A 5L3EA 4LLLA 2C6YA 3IWZA 3EUHA 2Z33A 2BV6A 1XDSA 1P4WA 2V6CA 3DFGA 5AIQA 1S7OA 5CVIA 3H92A 4ENMA 5DUKA 1OYIA 1HKSA 5JVTA 5IT9Z 3S2WA 1KU3A 1STZA 4GCVA 5E1ZB 2JSCA 3J7AO 2XKOA 3IC7A 4MGRA 1LEAA 2YSRA 2VBYA 1K78A 2OBPA 4LB6B 4U0WA 1IN6A 2UZKA 1SMTA 4LMYA 4O5VA 2A61A 2F5DA 4LG0A 2RVCA 4CDGA 1B6AA 1TNTA 2P5VA 2XGXA 5K5QA 3FXUA 1SD5A 1O7FA 2V1XA 3MFKA 1I6XA 2O0YA 3WGIA 4AIJA 1HW1A 1UHWA 1R36A 5DEQA 1ZG1A 4L18B 3LA7A 5E8IA 1Q1HA 4OMZA 2DU9A 3I53A 3F8FA 2GWRA 3KETA 4AIKA 3E6DA 2YU3A 4LJZF 2HKXA 2VT3A 1R1UA 4U7DA 1JHFA 2HR3A 1R1VA 3GW2A 1ZRDA 4U0VA 5BS6A 4HQEA 1D3YA 3KLNA 4YFNF 1W4MA 5D4RA 1QNTA 3ABUA 4HF1A 1W7PB 1WWXA 2HKOA 5E1WA 1CF7B 3GYHX 1FY7A 4N9IA 1IF1A 1X3UA 2JPCA
chains in the Genus database with same CATH superfamily
5HLGA 4MLOA 4FISA 2W82A 2ZMEC 2K4JA 3MCZA 4N4NB 5CLSA 2P7CB 5FD5A 1FX7A 1ZELA 5K7ZA 4KIBA 2R0QC 1ETQA 4FQGA 1YLFA 3PO2J 3ZQGA 2LNBA 2H8RA 1P6RA 1YQAA 3G1LA 1QQIA 2R5ZB 3LFKA 1LJ9A 1B8IB 1RESA 3KP7A 4CCMA 4PK4A 4D1QA 3TO9A 1HXDA 2Z16A 2QF7A 5IYBJ 2W25A 4HPQA 4EM0B 1NH3A 2F48A 1SEUA 2VODA 5E3LA 4CCNA 2FJ1A 5ED4A 1IRFA 3F8MA 3CF2A 2COMA 2EB7A 3G6EI 1K6OA 2KJCA 4CUGA 1I1SA 5HODA 1VQLI 3DU5A 1JT6A 1B72B 4V2GA 4XRFA 5L3CA 4BJTA 2ZXHA 2KJBA 2JVGA 4O6JA 4EJUA 1P2FA 3RPUD 4ON0A 3FKJA 3C7JA 2G0EA 3OYIA 4XQFA 1O3TA 2DMPA 3HIFA 4CCOA 4E70A 3J7AY 3OR2C 4LK0F 4A5NA 2VQCA 4DZPA 4XLAA 3K1NA 3TQNA 4A12A 1I50J 5EYRA 2Z5UA 1N78A 3KP6A 4KA4A 3HHGA 3VYTB 3J81Z 1T6SA 5HNHA 3CLQA 2A5YB 2ZXIA 2V1UA 5J1YA 3BPXA 3BG7A 3L09A 3OV8A 4U88A 3CCLI 4BEHB 4L5IA 1KU7A 1FOKA 4ENJA 3AG4H 4UUSA 2V9KA 3CUQB 4D7NA 2ELKA 3GF2A 2QKMB 2E7WA 3PQKA 5L3BA 4XR6A 3HRSA 2D45A 1YW9A 3TO7A 1X1AA 3PNYA 4BHBA 4YFXF 2HEOA 2YS9A 2Q2EB 3FBIB 4KT5C 4IEJA 5ICGA 5B1BH 2EILH 2JJ7A 2KRHA 5HVQC 1G6NA 4FE7A 1FEXA 1ZG5A 1T2KA 4I7HA 4ESFA 5F0CA 1TWHJ 1HLVA 2K9QA 2JVHA 2ELHA 1Z3YA 1YOVB 1BM9A 2VPRA 3J81K 5HS9A 1Z6TA 1V3FA 4Y15A 4Q5SF 2R7XA 2Z9OA 3I4NJ 4KMFA 1OQYA 1TWGJ 4BNCA 4XORA 1FTZA 3QU6A 1SD6A 2YX7A 5H20A 4BBRJ 1QO0D 3K69A 3JRIA 4XSZF 1POGA 1N75A 1HC8A 2K3PA 1B4AA 3OL3A 3BZKA 3JAMZ 3HOVJ 2FA5A 4KN4X 4UVAA 4LGWA 3GZNB 3KCCA 3HXLA 3DEWA 1JXSA 4B3AA 4LIVA 1XSDA 2JUCA 4AUXA 2DT6A 2KZGA 1ZR2A 3PNTA 1ZGWA 1VQ4I 2WV0A 4BXXJ 2A6EF 2FSWA 2VKEA 3IH3A 3S32A 5A2QZ 5C4XJ 2O61A 2O3FA 1I5ZA 1JJ8C 4B3XA 2PMUA 1K78B 1Z91A 2HYJA 1RZ4A 4ENKA 1S7AA 2OQGA 4PJNA 1I39A 1BN5A 1SFXA 3HYIA 3O2PE 1XCBA 4PJJA 3BQZA 4LG0B 1GDTA 2K27A 2LY2A 3M8JA 4Y3OA 1MMDA 2F2EA 3AKZA 3A01B 4GGGA 1I6HJ 3W6VA 1U5TA 3TOBA 3JAMK 2K9MA 2KZVA 1O57A 2KPMA 2ZJ2A 1V5FA 1IRGA 2ZXJA 1LNWA 1BJZA 2E36A 2KRFA 3EQLF 4CSWA 5EEGA 1HSTA 2DMTA 2QA4I 1WRJA 2CQQA 4MO7A 2MBFA 4EM1A 2EWNA 3N05A 1JI8A 2KRCA 5E3MA 2DMNA 2FEZA 2EJRA 1MBKA 2CUFA 5EEAA 5HLTA 3GTQJ 3Q0UA 2LMDA 2LG4A 1VTNC 3I58A 3CF5F 4KT6A 1APLC 1Y0UA 2LC2A 1HKTA 3MQ0A 2BBYA 2BE5F 3DEUA 1T95A 1XCVA 4Q4ZF 2M8EA 4P9FA 1ERDA 4B09A 3QODA 2DLLA 4BJ5C 2Y9ZA 1GXPA 2HYGD 2W00A 1ZGJA 3C3WA 4XM3A 3QYEA 4E7LA 3EPZA 2RGVA 2M9HA 5ICEA 1TWAJ 2CO5A 2MYSA 4ZYDA 2R7SA 2PBIA 5HS8A 1Y56A 4XONA 1S3JA 5KAIC 2VJJA 1AWCA 3DU6A 2R7FA 4PFOA 1WJ5A 5CQGA 2XAJA 2PJRA 3G2BA 2GXGA 2JWTA 3VYUB 4OOIA 4BHCA 3I56I 1BIBA 2A68F 2QSFX 2JTVA 4BS9A 4M3GA 3HRMA 3BC8A 1R7JA 4HNUA 3WTUC 4IOAF 3RSNA 1ZLJA 3M1CA 4C3IJ 2WAEA 1VQ5I 1MMGA 4M74A 1N25A 1FNNA 1OCCH 3U1DA 3E5QA 3ONQA 1W36D 2MLGA 4HZFA 4YIFA 1H9TA 2DA2A 4HDUA 1TZLA 2MGQA 2XPVA 3ULQB 3CP2A 1ZARA 3JRGA 3U2RA 2DJNA 4B48A 5D5WB 1R5GA 4WXCA 1OLTA 3COAC 2D1VA 2DPUA 2H6CA 1L0OC 3RKWA 2E5NA 2CQXA 3RYPA 1RIOH 3FMQA 3E5XA 3P7NA 5E18F 1OYWA 2KKOA 2WY7Q 3R6SA 3F6VA 1G8XA 2W24A 5D8LB 4EJVA 1FPQA 2HQNA 3H0GJ 2O03A 4W1UA 2KMUA 1FP2A 3TDUC 4A6EA 1MNMC 1ZLKA 1R6RA 1QRYA 1IN5A 3H5NA 3BR2A 3NRVA 5FKLA 4HLYA 3F9KA 2HWVA 2ISZA 3CJNA 1MW7A 4G6DA 4P1WA 1KQ8A 1OCRH 2IA0A 4XRMA 1WQ2A 2F4IA 2QQBA 2HDCA 4RLFA 5CKTA 4GRIA 1JKOC 4WXHA 2X1CA 2WB1N 5F27A 2LTPA 1XMXA 3PO3J 4RB2C 1Y39A 4II2A 2EZHA 5H6QA 2JMWA 4I02A 3K1MA 2HFHA 4EMSA 3MN2A 3QWLA 5LHGA 1KQ9A 1SD4A 2BHZA 3CCUI 4RB3C 3OSFA 4LD5A 2K02A 3S3NA 2EV0A 2JA6J 2R7VA 5M3FJ 3F23A 4NQWA 2MC4A 1VQKI 2Y0MA 3DPLC 3RQ4A 5F1JA 2LY9A 4UUSB 4HLXA 4XN0A 5CVVA 3C2GA 5KK1A 1F4KA 3OOUA 3KZYA 3L9FA 3H9GA 3QAHA 5DUIA 1TLHB 4IX7A 2EFQA 5BQTA 1WSUA 1I3AA 1TW2A 3LA2A 4A3IJ 3G3ZA 1U78A 1MIJA 3LL7A 3GTOJ 2V9VA 3VSLA 2M0MA 3R0JA 1T33A 4WK8F 2OCCH 1S8NA 2DMUA 4L5JA 2EFNA 3LAPA 1R5HA 3OYEA 2NNNA 4HAMA 2VT2A 2Q1ZB 3T8RA 1KU9A 1LVKA 1W0TA 4PFPA 1IXSB 3P5JA 5D8KB 3MKLA 1PJRA 1FIAA 1PVEA 1JUMA 2F6CA 2VC0A 2UWMA 1GVDA 2HI3A 2L0KA 3FZVA 3GCMA 2PLYA 3KYLA 1U3EM 1BI3A 2GA1A 3B73A 2BY3A 1O3QA 1VQ9I 4G94A 2DA5A 4WWCA 3IRQA 1EA3A 4NHJA 4KFCA 2H6BA 3PM1A 2IGNA 3BCAA 4AM3A 2IS1A 2ADUA 4MNUA 4JOMA 3FK7A 1UCRA 2LSOA 3QPHA 1IXRC 2QCOA 4UVCA 3JRBA 1HW2A 2TRTA 4RLQA 1DP3A 2X6XA 2QYOA 1VQ7I 3KZIC 2I8DA 4HOBA 1ZRFA 2B9SA 2M3AA 4FCYA 1X1BA 4IJAA 3ZN0A 2A5WA 2F5EA 1YIOA 1N77A 2OF7A 2F5VA 1ZK8A 4CZZA 3WTWC 2KDOA 2F5CA 3VDXA 4E7HA 2HNHA 2CYYA 1U0JA 2DAOA 3IKVA 4LK1F 2WAFA 2E1OA 2B0LA 3A1YA 5IPAA 2XF7A 4ITVA 1ON1A 3AG3H 4XK4A 4Y17A 4I76A 3LA3A 1SFKA 1XN7A 3SFZA 2XB5A 3KFWX 1ONVA 1BR2A 4AIDA 1VZ0A 1WJFA 4MFDA 4EQQA 5F64A 3H0DA 3VPRA 1TBXA 3ZMSA 2EFWA 3WU0A 3F3XA 3L2RA 2XROA 3UNGC 3LSKA 1SANA 3K4LA 4P9UA 5JI6A 1ITYA 2XV4S 2XIGA 4G6QA 3KEOA 2P4WA 3O8GA 2V1DA 2GAUA 3JCUC 2W57A 2ELJA 1YJNI 4X0GA 4BE1A 3DLAA 3I59A 3WGGA 2L9RA 1FMVA 2B7EA 3DBHB 5M5XJ 2PQ8A 4H0EA 3Q5FA 3CMMA 4E7ZA 2E2HJ 4CCLA 1SMYF 3S16J 4KIGA 3AAFA 3OS0A 3ZMDA 2DFEA 3BR3A 3JR9A 1Y8RB 2Y0SN 5KVRA 2COBA 3K70C 4DNCA 2XHKA 4CZCA 3DTIA 3M7GA 4IHSA 3PIPF 3IH2A 2PJRB 1A36A 3R4KA 2QWWA 3SFIA 5ERIA 3WTZA 2O8KA 5FKOA 1JE8A 3K10A 4RAZA 1G2HA 3CCJI 2DFHA 1KU2A 4JX6A 1UHMA 3OL4A 3SDGA 2ZJPF 3BZCA 4FE4A 2STTA 3H3VK 1QZZA 2L01A 3CLOA 3T8TA 5FGMA 2E1NA 2L54A 4XKCA 4D7MA 1MMAA 1VQOI 1XS9A 1E17A 2ESHA 5CQEA 3TOAA 1VQ6I 5E79C 3DBRB 4LFUA 4CH7A 4EV0A 1D8KA 2X1DA 5D4SA 1EH7A 4BQOA 2MLKA 2BXZA 5F08A 2IAIA 1EJ9A 4KDPA 1IDZA 3I3LA 1K79A 4D9JA 4EM2A 1JTXA 4EGYA 1MJ9A 4BUPA 2J5OA 4IZZA 1U8RA 1TC3C 2IT0A 2AO9A 6PAXA 3I4PA 1FBSA 2W48A 4CGZA 3HTUA 3RPUA 3M3YJ 4BQAA 2VIXA 3MVPA 3QPSA 2HOSA 1S9HA 2IS6A 1HKQA 3CUQC 5HNFA 3L2CA 2CW8A 2CV2A 4RGUA 1NK3P 2ME0A 1WHUA 1WVRA 3W6JB 3TO6A 1DUXC 3LQRA 2H09A 1X58A 3QPTA 1VI0A 3TMOA 3SZPA 1T98A 3HGGA 4R8HA 3HG9A 3S15J 1JHHA 4PJLA 2XDVA 4A3FJ 3S3OA 4L5EA 1P7JA 1R00A 1IJWC 1R58A 3VODA 2RQQA 2WB1A 4JX5A 3ABLH 3MAJA 5GAGJ 3IL2A 4DJAA 4EGZA 2VPLA 4IVNA 1BL0A 2OU2A 2XUBA 3MEXA 3OMYA 1FOXA 4BY1J 2HPMA 3J7YJ 3JRAA 1FOYA 4QPOA 3OR1C 1JGSA 1QZYA 1T0FA 3FF5A 1HQCA 2WAQN 3VOEA 3PUBA 4KNYA 4JYKA 2K86A 4XIDA 1BOAA 3K1PA 3G73A 4AWXB 2YX4A 4NBQA 4NQWB 4XOTA 3LSGA 1LDDA 2RREA 3IKTA 3BR6A 1IN4A 1IV8A 2IEKA 1PYVA 4HNVA 1J9IA 3CTAA 2M34A 1ZH5A 2M7AA 5LGNA 4HQMA 2FMLA 2L9VA 2HTJA 1U9NA 4NUBA 2M4GA 1TW3A 2KISA 2VQGA 3BCBA 3PL8A 3HOYJ 4DYQA 2CQ7A 1T39A 3CCSI 2QQAA 1I27A 1V54H 4RAGA 5HDGA 3ZQ7A 4D0PA 1RRJA 4I2OA 3AL0B 3KPHA 4IHWA 3OY9A 4BDYA 1HSJA 1LDKB 2DJIA 2XC7A 2E2JJ 2JRMA 2RNGA 4S0HB 1FYMA 3DKWA 2RV8A 3F8CA 1PUFA 2QVOA 2VN2A 4Y33A 2Y69H 4PJ0C 5L3GA 2DA7A 3BJAA 5B5EC 1SAUA 4BQQA 3OIPA 2ZCWA 1A6QA 2BEOA 1NTCA 1QA6A 3CC7I 2M30A 3L2UA 2DBBA 3HPGA 3CMAI 4CHUA 4ABZA 2GM4A 2FBKA 5J8FA 1MGTA 3S1QJ 2VOPA 1ENHA 3DKXA 4R79A 1ZRCA 3WGHA 1IV6A 2LYCA 2CUZA 1IUYA 1K4SA 3LQQA 5CVRA 1NK2P 2YUSA 4UV8A 4IQJA 4C3HJ 2JT1A 3Q0VA 4AU7A 4BYYA 3GZ5A 1SD7A 3JREA 3L1PA 3CD6I 1KGSA 4BH9A 3RZOJ 1H89C 3ZGKA 1JGGA 5IT3A 3CC2I 2CS3A 3CUOA 2X51A 4DW6A 1RKTA 2KIUA 4I0AA 1FLIA 3RYRA 5GPCA 4M3DA 3FK6A 1FMWA 2ISYA 5ILVA 1Z7LA 2W7NA 1FSEA 5D6EA 1A5JA 5LLQA 1QPMA 3BR5A 4AVPA 3BG5A 5J1RA 1TWCJ 2P6TA 5FO5A 2IW5A 1TTYA 4G6TB 2FQ3A 2NS0A 2EA2A 5TISC 1XMKA 2V26A 1EV7A 4MFEA 2XAHA 1E3HA 5M5YJ 2CUEA 3WE3A 1R4MB 2QSGX 2R3SA 1UJ8A 3HKZN 1BR1A 2L4MA 2E71A 2M87A 3DTKA 5DD8A 4F55A 1X4OA 2MD5A 1GT0C 1J09A 2RQPA 2RNJA 2XRLA 3H36A 4XN3A 5LGTA 3WU1B 2P5LC 3ELKA 2EINH 4XNFA 4LOCA 3SEQA 3D0SA 2HDWA 3HSRA 3W2VA 1YIJI 3HSEA 1IN7A 4KISA 4JP0A 2B63J 5LHIA 2BGCA 1P7IA 4HYEA 2NVUB 3I59B 1FBUA 1R1TA 1B1BA 1CGPA 3ZQCA 2VBXA 2MSYA 3L00A 2E1MC 3RDIA 3MZYA 4D5CA 5DYMA 2DA3A 3ZXSA 1QHGA 3SHFA 1OCPA 3DP7A 4BE2A 1MBJA 1PP7U 2AXLA 2UV1A 4FHTA 3BG6A 4MTEA 5D5UB 2OA4A 2Y0SA 3F0CA 5DCMA 2K3FA 1NG6A 3M9AA 2JQ7A 4G7HF 1LQ1A 3KE2A 3V8KA 2NNYA 4RDUA 1Y6IA 4U87A 3CO7C 1X1CA 3PNVA 4P55A 4EJOA 5E1XA 4A3JJ 2FBHA 3GTPJ 2NVYJ 2BY1A 2PN6A 3R0AA 3FX3A 4L9VA 4YEJA 5EDNA 3ZQLA 3S1MJ 3T1BA 4M6VA 2JN6A 4LIUA 3W6KB 4RMNA 3ERED 1JUPA 3EETA 4U7BA 5KAFC 1MJBA 2XF5A 3J80K 3B6AA 1JKRC 2V79A 2HGCA 1J5YA 2HZDA 2BW3A 2HXIA 1WCMJ 3MKZA 5CVJA 1YITI 1XGMA 1LUJB 5IOYA 2VJ5A 1BI0A 2AQFA 3DQVC 1EH6A 2DYSH 2STWA 2Y30A 2ESNA 2KIQA 2NRAC 2G7UA 3U21A 4OWRB 3P9IA 4A0YA 3K9TA 4GFBA 4B44A 3QOEA 3S3MA 1UMQA 2WC2A 1ORKA 1IC8A 2K5CA 1YG2A 3RJPA 5C4JJ 1IO2A 2R5YB 5HOOA 3R61A 3CESA 2DA4A 3GLXA 3KP3A 3REOA 3LSMA 2O9LA 2QEXI 4Q47A 3I5UA 4WXDA 3OSGA 4CICA 2W1OA 5TJJA 1ETXA 1M1EB 1WPKA 2ZKZA 5DCFA 3HTSB 2JA8J 3CCEI 3CC4I 1WKMA 4N9HA 3K0LA 1A04A 1BI1A 2L2OA 1ZN2A 5J3LA 4A3BJ 2CH0A 2AXTC 3RI4A 5B3SH 2JA2A 2CWEA 2X0LA 2CW7A 3NEUA 5LEKA 2XGDA 3PFYA 3AFHA 2VL8A 3SEZA 3JRCA 1ZG3A 4II3A 3H3ZA 1UHSA 1KONA 1FJLA 2FBIA 2FE3A 2M1BA 4F92B 1E0EA 4PGGA 2IPQX 2JK3A 4HX7A 4GYIA 4R1HA 4QLCU 4UV9A 4A3GJ 5L3DA 3FXQA 5GAHJ 3ZR8X 2NOJB 4C2UA 1Y8QB 3KP4A 3FMSA 3FXJA 2XVCA 5FROA 1WI3A 3BTCA 3BDDA 1R5ID 4HDVA 1B9NA 1TQMA 1Z1DA 2VE8A 5K5RA 2WAQA 5JHFA 4M3BA 2CGPA 5J40A 1JKPC 3EUAA 3H35A 3N97A 1GXQA 2DPDA 1IRXA 3BR1A 4DBRA 2ZNYA 5LEJA 3E5UA 1ACIA 2IBDA 3BZ6A 3EUKL 1MSFC 1FIPA 2RAEA 1P4XA 3V4GA 3NARA 1ETWA 1WJCA 4QIWN 4BHPA 3OYMA 4IXAA 4F3QA 1FC3A 2IVMA 5HDKA 3TGNA 5F1RA 2TDXA 1FYLA 4LITA 1MBHA 1XSVA 4RGXA 2EV6A 1VQPI 3TP0A 3N4MA 2PMHA 1XDUA 3K4NA 2VB6A 4BQNA 2NOGA 1D5YA 2OQRA 1E2XA 5JLWA 4LB5A 3D5LA 2QBYA 2EIMH 1SAXA 5KHDA 1H0MA 2OJED 1VFCA 1B59A 2O5RA 3GUDA 3WTVC 3LNQA 1IXCA 1QVTA 1XGOA 2HQRA 3DBLB 5HLHA 4G12A 3IRRA 2W4SA 1Z3XA 3I64A 1CQTA 2VJ4A 3A4CA 1PUFB 1MKMA 1TP4A 3O8HA 2HQ5A 3I4MJ 3K6GA 4FTHA 5L3FA 2EZIA 1KZHA 2QZ8A 4S05A 2FU4A 2R7RA 3AG1H 1XX5A 2DA1A 4D5FA 3G4SI 2FUG2 2XF6A 3SDBA 3GEZA 4XBFA 1T08B 2LKXA 1OMIA 2ME6A 4YFKF 4AIHA 4YIRX 3BTIA 3CMEI 2L9SA 3KIOA 3MKYB 4UUTA 1ZYRF 1MBGA 2CW0F 2DK5A 2ZSIB 1LFUP 2KIFA 4OIPF 1MDMA 3L7WA 4A3DJ 5FB2A 4ASNA 3DF8A 4KICA 5IYCJ 2BZTA 2MA3A 4M9XA 3GTKJ 2DOEA 3H5AA 1HW5A 2RC4A 4JX4A 1D8JA 3JSOA 4XLCA 1YS7A 3HJEA 2L7FP 4BL0B 3S8PA 4DOZA 3WTSC 3OYFA 1YW7A 3OYKA 1DDNA 4GO1A 1FSHA 4ZZLA 3H1CA 3CCQI 2DFIA 4Y52J 4J19A 1L3LA 1WH7A 2VI6A 5BNGA 1MJAA 3DEEA 1R22A 2KFDA 5H6RA 2MH9A 2R93J 4A3LJ 1K6YA 1U8BA 3WHCA 2EBIA 1UG2A 2ZFUA 3CMYA 2MD0A 4IRGA 2VE9A 3HKZA 3GFMA 2GQQA 2IA1A 5HS7A 1RPWA 2P7VB 5TGTA 2OPTA 3HUGA 1GUUA 2M5WA 2XSJC 3KYCB 1J59A 2W85A 4MIMA 4ZZDA 3OS2A 3LSJA 1AOYA 4EJWA 3D1NI 1Z77A 4MTDA 1KA8A 3HHHA 4A93J 2O6GE 1H9GA 3LAJA 3LSIA 3BQYA 4A69C 3L2QA 5H2FC 1HDPA 3GLLA 1WGXA 3TW7A 1OPCA 4M3EA 4E7KA 2Z99A 5IP6A 3W2WA 1G3YA 3ZMZA 4PZJA 4G7OF 2XGEA 3FM5A 1RUNA 4OIQF 2J5PA 5DCMB 4L9NA 1C0WA 2CV1A 1G3SA 1Z7UA 3HPHA 2BY0A 2ZSHB 1ETOA 1T8IA 3I0TA 4I01A 3OYHA 5D6FA 3SJMA 1K7AA 1GV2A 1R23A 1JUSA 2X4HA 4I0BA 1B8IA 2QQ8A 4RGRA 1IDYA 5DS9A 3ECOA 4UNOA 2HOAA 2WY8Q 3F8BA 4ZYEA 4WX9A 2OAZA 2XPUA 3WU2C 3HOTA 2FRHA 2VBZA 4B43A 3B02A 4RB0A 3S14J 2BY2A 2E34A 3NWTA 4IOCF 2HZTA 2IA2A 4B1RA 3RIRA 4ZH4F 2DFFA 4JBAA 4F52A 5IP9J 2FOWA 3RPQA 3U9GA 1BW6A 3A03A 1F5TA 3A0BC 2BW3B 3HRTA 2IS2A 1U5TB 2EIKH 1FOWA 1ZREA 2L7MP 3E1SA 2XAGA 2JRTA 4HA8A 2PI0A 1OR7C 1SC7A 3OYAA 4DBQA 5EG0A 1MZBA 2UUZA 1D1AA 1W5CC 2K9NA 1O4XA 1SFOJ 4XKVA 2VXZA 3G1MA 4ZYGA 3I55I 2XAUA 4XLPF 2E2IJ 2XGCA 3BPVA 2VKVA 3BG9A 3QOPA 4ANJA 2L7KA 1H88C 3KX2A 4P96A 4UVBA 4WF2A 3ZPLA 4L9JA 3GWZA 2OUMA 1FWZA 2CQNA 1W5TA 3HC7A 4BGDA 4IF4A 3S17J 2L3DA 1QVUA 4H4KC 5HDNA 2WWYA 1G3WA 1K61A 4A3CJ 3VEPA 1UELB 3PQJA 4HV6A 4M6XA 4E4HA 2Q2EA 3C2HA 2UXNA 1SVOA 3KP5A 5DV5A 3L2VA 4G7ZF 3LSPA 1XG1A 2A6HF 1J2XA 5HLIA 1UZCA 5DM6F 3K4MA 4CA0A 3LSTA 4XOPA 2QKLB 2E1CA 5IOZA 2X9DA 2XRNA 3WODF 4YIIA 5GTHC 5E3OA 3M07A 4HX4A 1UFMA 3OYJA 2LRDA 1GLNA 4DYRA 4AD9A 3F22A 3A02A 5GPAA 4FT8A 2A3SA 1AU7A 2E7XA 2QQ9A 4FX0A 3QYFA 4JQFA 3HOZJ 4J00A 1OCTC 4QPQA 2KDZA 3SXYA 3IP4B 1FT9A 1UG0A 4OMYA 3K2ZA 3LWFA 2Z2SB 5DDGA 2CMPA 4IPAA 3G71I 1U2WA 3CJTB 1EH8A 2I10A 3RKXA 3D5RC 5B1AH 4AYBN 2EFOA 1YS6A 3K70D 3K4CA 3ASOH 2FX0A 4UHTA 4E6KG 3JTHA 4NC8A 1RR8C 5JVGF 2QM3A 2FXAA 4PJMA 4M3FA 3HBLA 1BA5A 2IP2A 2ZMEA 4HBLA 3ZQIA 4RB1A 2QBYB 3Q0WA 3NAUA 4MHGA 1RR7A 5LGUA 1SVLA 4CCKA 2HOTA 2HVRA 4ESJA 2F4OB 1LE8A 2KIMA 2LDUA 1MBFA 2L02A 1PP8F 4KIFA 1ZTRA 2H27A 1OISA 1R71A 3BROA 1JJ6C 1UAAA 5IT9K 5DTDA 2G9WA 1XB4A 3DV8A 2ECCA 3H3UA 2Q8KA 2X1EA 2XAFA 4LLNA 2K4BA 2DA6A 2DQLA 4GXOA 3LSHA 3S1NJ 2E19A 3BWGA 4PCQA 4ZYAA 3DTEA 5GP9A 4FX4A 2M2EA 2H1KA 2LP0A 1SVMA 2EQRA 3AG2H 3EUHC 4CCJA 3BOQA 3OYCA 3W2AA 3HM5A 5JHUA 2IRFG 5B66C 1MDMB 2DI3A 2N8GA 4J01A 4AC0A 3OYDA 1TT0A 3QRFF 4OAZA 2GIZA 3C2BA 4W97A 2UXXA 5IY5H 2JSPA 1MD0A 3TW6A 2KL4A 1WH5A 1REPC 2A07F 1LFBA 4IHXA 1JTYA 5ILUA 1BC8C 4F7ZA 4KN7X 1LPQA 2H1LA 4NDLA 3HOSA 1USTA 2VASA 4YRVA 2BHYA 1WJAA 2DO7A 1XGSA 2VKHA 1IZ1A 2GA2A 5E20A 1WJDA 4QSHA 5ICCA 3IUOA 2EZKA 4AVZA 2VQLA 5FRNA 1BBYA 5GAEJ 2GXBA 1BJAA 3SZTA 1V4RA 2PJPA 3BJ6A 4DQ2A 2F5FA 3HUGB 3GBGA 2R7WA 3PSFA 1W1WE 1DQUA 3SYTA 4A2UA 1P92A 2FNAA 3GFJA 3WG9A 1D0YA 1ZQ3P 3GTGJ 2OTJI 3I9V2 5LD2C 1BI2A 4A6DA 2X85A 2IJLA 4RS8A 3DXJF 1X2NA 5BPDA 2ETHA 2CG4A 1RNLA 5FJ8J 5BMZA 1WJEA 1X19A 3FXMA 2VXDA 4UB6C 4DIQA 3FXOA 5K7FA 1O3SA 4RBOA 1ETVA 3KZZA 3TKYA 4BE0A 3OYGA 3RTRA 1YW8A 4BJ6C 3V7SA 1X3ZB 2LKSA 1YFHA 1H8AC 2OV7A 2HDDA 2FMYA 1S29A 2BVMA 2VLAA 1Y0NA 3ZMVA 2GIVA 2MABA 3BR0A 1QHHD 2H8WA 2ZJQF 1X1PA 2X6WA 4XICA 1GHCA 1G4DA 1U6GA 1S72I 4Q48A 1YO5C 1DPUA 2V6EA 2CFOA 3FISA 1S7EA 3ASNH 2Y75A 3BLYA 2E35A 4XKBA 4MQVA 2H94A 2D2WA 3BJOA 1YTYA 4NC7A 2DMQA 4MEYF 2DTZA 1Z6RA 2OD5A 4O3MA 1EF4A 2Y48A 4ZTJA 3LMMA 3F6OA 1XMAA 2CFXA 3ZQQA 1MNDA 2ID3A 5EJCA 4Z2YA 1HBXG 5JLXA 5EEHA 3ERMA 2DT7B 4YG2F 4XRSA 3WTXC 3KYDB 1V5GA 3FM3A 4IQ4A 3TEDA 2K40A 3DWLE 4XSXF 5EG0B 5FLXZ 3JW4A 2M4KA 4NNJA 1T0FC 2P8TA 1QPIA 3QYBA 3S93A 5CJ9A 2LKPA 4EATA 4EJTA 2Y31A 2Y9YA 5ICFA 1U9OA 3PSIA 3NWSA 1XPXA 3MZHA 1RUOA 2JZYA 4TV7A 4F93B 4A3KJ 3GXOA 3LOCA 1X1DA 2XAQA 1TWFJ 4HW0A 3V7CA 3T0YA 4B47A 1B9MA 2IS4A 1F9NA 4JK1X 3VB2A 3P9KA 5D5XB 1XC5A 2WTEA 2BYVE 3BT9A 4B8XA 4ESBA 2EV5A 2AS5F 2QUFA 4BU2A 3L2WA 3JTGA 4BKXA 1AA7A 3ISPA 3EDPA 2DDAA 2I5UA 2K7LA 3F8NA 2AHQA 2RDPA 3GX4X 5FLVA 1A31A 4L0ZB 1UB9A 1USSA 3J80Z 2R7QA 3HDDA 2LFBA 2YR2A 2OCEA 5FLXK 4X1EA 3OS1A 1V5EA 4RAYA 2KLOA 5J4VA 3FWEA 3KLOA 4LG3A 1MH4A 4BACA 2NYXA 4KMUX 4KJZA 4WCGA 1FTTA 4F91B 5F0FA 3E6BA 4ZDLA 2D5VA 2HS5A 1X3WB 4M6YA 5J8CA 2G7HA 3PUFA 3E6MA 1RI7A 3ROUA 1GV5A 2FNPA 2ID6A 3X2QH 1LEBA 3V42A 2CUJA 5LRRA 5CVUA 2KT0A 5LHHA 4HF0A 3VWBA 3GTLJ 4U0YA 3E6CC 1G3TA 2LREA 2JPBA 5FKNA 5EGOA 2L9NA 3ABTA 3DPTA 4PSWA 4RGSA 3VSKA 1X4PA 1E3OC 2XASA 3GZ6A 1QGPA 2MH2A 3FKIJ 2MC3A 5BOXA 4AYBA 1HA8A 5GADJ 3K4BA 3FMRA 2BXYA 5DM7F 1OJLA 2X48A 3IHUA 5FFXA 2D1HA 2VONA 4C2TA 1EKEA 2JUGA 1JT0A 4A5MA 1IN8A 2ZMEB 3ZMUA 3JRDA 5FRMA 1VQMI 2YU9J 1YJ9I 2DQRA 3RKYA 3GVAA 3ZP5A 2P5KA 1OKRA 3CDLA 1P4AA 1LE8B 3F72A 2PG4A 3FHZA 1XGNA 2V1NA 4I98B 3VYSB 4X6AJ 4MQ9F 1RC9A 3GMEA 4ZTFA 4HSTA 4P5OA 1LDJA 3KP2A 1HOMA 3DLLF 1R4NB 5LRSA 4XKWA 1I1GA 1D0ZA 4XLEA 5JFRA 4G9YA 4PSXA 1Z05A 4MEXF 3HB9A 2DTRA 5K1YA 1FP1D 1MBEA 4IRIA 2AQEA 1TL8A 2R4GA 3HSFA 1Q1VA 1XSXA 4M72A 2DODA 3BTJA 3SQNA 4V19K 5A2QK 1OCZH 3ZOBA 2PFBA 3ABKH 2XSDC 2M8GX 2V4JC 4YELA 1TNSA 2KP6A 3IV5A 4L0YB 3E0JB 4M9ZA 2MW8A 3H5RA 2X6YA 3TL4X 1VNDA 5AONA 4HEA2 3VFZA 2HYFA 2KHMA 1JKQC 3M4OJ 3ZRGA 4LLGF 1Y1VJ 1ULYA 1MH3A 4OU0A 2GOXB 1O7LA 2LK2A 1YE9A 4ZJZA 2QSHX 4QTRA 4ZC3A 1XD7A 2HTSA 1ZHFA 3HOXJ 2JA5J 4C30A 2VOOA 4PGHA 1W36C 4Z6YA 2V7FA 5FFZA 1PDNC 2M7BA 2BVLA 3O6BB 1DU0A 2RKHA 1BC7C 2L7ZA 2LBFA 2VJIA 3FXRA 5F6FA 5K7HA 1D5VA 4KYWA 1DGRM 4K2EA 2E5ZA 2HOEA 3SZGA 3FXKA 2IGOA 1D0XA 4M9SA 1KYWA 4RM2A 1WFXA 1R49A 1ZGAA 3QPLA 3TP3A 1NHAA 3MWMA 4XLNF 3V8JA 2VKDA 2XKPA 3OWTA 3T5XA 3GFIA 4NB5A 3TDZC 2ACJA 3Q9VA 1YYVA 4EVIA 2LD5A 1MMSA 3GFLA 3LFUA 1U5TC 1O3RA 5EZGA 4ENNA 3D5SC 4BDZA 5M5WJ 3K4KA 2EIJH 3A0HC 2ZNZA 2GLOA 5E17F 1W0UA 3ECHA 4M71A 1IRZA 2QENA 3BY6A 3CQZJ 3CJQB 3H9QA 5J4YA 2EFPA 3E3VA 3EYIA 3MD2A 3IH4A 2E1MB 4E7IA 3I71A 4M73A 1A35A 3ZQFA 1FYKA 2A69F 4CYCA 2IGKA 4B4CA 4I09A 2LF8A 2HPIA 1HF0A 3FDYA 5TRDA 4UUVA 3BP8A 4HRIA 4HV5A 4XLHA 2DW4A 2NXNB 1WJBA 4DYCA 2R7OA 4A3EJ 2VBWA 2HU9A 1HDDC 1D1CA 2MG4A 1FBQA 1RKWA 4A0XA 3S2DJ 1HCRA 3S2HJ 2WV1A 3O3KA 2P6SA 2CV0A 1F43A 1DU6A 2EA4A 4C9YA 4C3JJ 2GBYA 5C3EJ 3HL2A 2Z3YA 3OYLA 5LFAA 2PMZN 1ETYA 3W3CA 2Q0OA 5JR3A 2K85A 1QBJA 3ZN1A 1LKXA 3QP6A 3DCFA 1LVAA 4G8XA 1Z67A 1VF9A 4A3MJ 2LF7A 1ZR4A 4HF2A 1YRNA 2NAZA 1OCOH 1R9TJ 2FOKA 2R7UA 3E97A 2R7TA 4V2FA 5E8GA 3PFIA 2E60A 1MSEC 1J7KA 1OR7A 1OYYA 1LFPA 1RETA 5IYDJ 1ZAOA 4KITB 3IWFA 4OIOF 2HVQA 3GO5A 3QU3A 1V55H 2XB0X 1F1ZA 3B6CA 3I54A 2FF4A 2HQAA 1YI2I 1MMNA 2OZUA 3U1KA 2ZXWH 1W7PA 3CDHA 3IAS2 2EZLA 3TBIA 3FHNA 2CRGA 1YHQI 2R92J 1AKHA 2ZFWA 2GXAA 1CF7A 5E3NA 4OINF 1YJWI 4EEFG 2IGMA 2LY1A 2A6TA 3K2AA 4RAFA 2DYRH 1T38A 1A6IA 2DK8A 1VQ8I 4KUMA 2DXIA 4UXNA 3NQOA 1BIAA 3V8LA 3MZ8A 3DKYA 1I3QJ 2QLZA 4CXFA 4XLFA 5CPRB 4HX8A 5C44J 2GZWA 1ODDA 3M8FA 3UKGA 3WE2A 1YX5A 3IAM2 3HGYA 3HRUA 1Z9CA 1W5SA 2NS7A 3JSPA 1TT5B 4Y4RA 1DP7P 3ML6A 3S1RJ 3DPUA 5M3MJ 2NS8A 3Q9SA 1GVJA 2HXOA 3OYBA 2R5ZA 1TQIA 4S04A 2W84A 4ZYHA 3GTMJ 4N0BA 4L9TA 2LLKA 3C18A 3OIOA 2ZO4A 5DD4A 5FKMA 4RM3A 3CCYA 2R7DA 4N4OB 3OOPA 2DOFA 1IW7F 3M8EA 4ZDOA 4IRHA 2A05A 3K7AJ 2O8XA 1S6LA 4DZJA 4IHTA 3V7RA 1ON2A 1OFCX 3CO6C 5EGOB 1WI9A 2M0CA 1FZPB 1PUEE 4PDKA 1SFUA 1B72A 5J6XA 2DT5A 2PX9A 2VC1A 1BR4A 2CQKA 2PEXA 4CO8A 4BAYA 4BXFA 3F21A 2LOOA 4CYDA 3HEFA 5LBQA 3WTYC 1G59A 1IAWA 2RN7A 1J0RA 2CU7A 1J75A 2OZ6A 5J47A 1NG7A 4Y13A 5D5VB 1LB2A 3P9CA 4OAYA 3C1DA 1E3PA 3Q3SA 3ABMH 5F04A 5KCMA 2X6OA 2XPWA 3QP5A 3WHBA 4BXUA 5BPIA 1TQPA 3WG7H 2QGUA 2ZBKA 2WBMA 2DOAA 2YPRA 4GYGA 3WTTC 4QWQA 3CZ6A 3FBNB 1IGNA 1KYZA 2M45A 4XL9A 5FKKA 4OIRF 3R60A 4BEHA 1KQ0A 3CUQA 5K5OA 1F36A 3ESWB 2DDBA 3ZMTA 4FETA 1QZEA 3EYYA 4UB8C 5AIPA 3CP8A 3VYRB 3KEQA 2CSOA 2BOLA 3K4JA 1X2MA 2L4AA 2NVQJ 1DPRA 1SFEA 1P9QC 4A0ZA 2OTLI 3M1EA 3CCVI 3PJRA 3G1OA 5CYVA 3AL0C 1W7PD 2EK5A 5ILSA 4ETSA 3JRHA 5FD6A 3MMYB 4PUSA 5L3EA 4LLLA 2C6YA 3IWZA 3EUHA 2Z33A 2BV6A 2V9PA 1XDSA 2ZC2A 3JRFA 1P4WA 2V6CA 1BOBA 1VQNI 3DFGA 5AIQA 1S7OA 2WADA 4I6ZA 3OYNA 4ZDPA 1QU3A 2HVSA 2EPFA 5CVIA 2ICWG 1K4TA 4E7JA 2LR8A 3H92A 3RZDJ 4ENMA 5DUKA 1OYIA 1HKSA 3BTLA 4HG2A 5JVTA 1S5LC 3FIWA 5IT9Z 3S2WA 1KU3A 1STZA 4GCVA 1IUFA 4RA2A 2LBFB 2TCTA 5E1ZB 3KEYA 2JSCA 1IG7A 3J7AO 2ZB9A 2XKOA 3IC7A 4MGRA 2L5QA 4FASD 3BG3A 1LEAA 2YSRA 3RKQA 2NVTJ 4IO9F 2VBYA 4Y7NJ 2VQHA 1K78A 3OIQA 2OBPA 2FQ4A 4LB6B 2P0WA 4U0WA 1IN6A 1SMTA 4LMYA 2UZKA 4O5VA 2A61A 2F5DA 4LG0A 2RVCA 2DCEA 1K83J 4CDGA 3A01A 1B6AA 3CCRI 2K9SA 2LH9A 2OC6A 5IP7J 3MKWB 4BBSJ 2F4MB 3HZJA 1TNTA 2GOMA 2P5VA 2XGXA 5K5QA 3FXUA 3HOUJ 1BW5A 1SD5A 2O7OA 1O7FA 2V1XA 4CYCB 3ZCOA 3MFKA 4IL6C 1I6XA 2KQRA 2O0YA 3GTJJ 3WGIA 4AIJA 1AHDP 4NC6A 2R5YA 3PIOF 5EZHA 1HW1A 1UHWA 2NVXJ 1R36A 1D1BA 5DEQA 2K9LA 2ZJRF 1ZG1A 3CCMI 4L18B 3LA7A 2FD5A 4IHYA 1ZKGA 5E8IA 2Z1DA 1Q1HA 3CJRB 4OMZA 4E7SA 2DU9A 3I53A 3FXLA 4IKFA 1T56A 2JA7J 3F8FA 2PMZA 2GWRA 2DN0A 1Y1WJ 1YX3A 2R7ZJ 2P81A 3KETA 4XMYA 4XRSG 4C2MJ 1YRNB 3QQAA 4AIKA 5EF6A 3E6DA 1Z0XA 2YU3A 4LJZF 2HKXA 2VT3A 1R1UA 4U7DA 4UY8I 1JHFA 1ETKA 5F0HA 3RCOA 2HR3A 1R1VA 2EH3A 3GW2A 1ZRDA 4U0VA 2IXSA 5BS6A 4HQEA 1DGWY 1D3YA 3KLNA 4YFNF 1W4MA 5D4RA 1QNTA 3ABUA 4HF1A 4IHVA 3HOWJ 5KNLA 2WA0A 2MFZA 1W7PB 3J7ZI 1WWXA 2HKOA 5E1WA 4DGWB 3H9JA 9ANTA 4HNTA 3E7LA 1AKHB 1MNEA 1CF7B 3GYHX 1FY7A 4BY7J 3UR3C 3RQIA 3ZQHA 3LSRA 2Y2ZA 1Z21A 4HSRA 4N9IA 5GTIC 2CJJA 4I99C 2LVSA 5FLMJ 1WZ2A 5J1UA 1IF1A 1XTAA 3CDIA 1X3UA 2ECBA 2JPCA 2VUMJ 3A2KA 4GDFA
chains in the Genus database with same CATH topology
5HLGA 3MCZA 2K4JA 5CLSA 2P7CB 5FD5A 1FX7A 4KIBA 1YLFA 2LNBA 1P6RA 1YQAA 1QQIA 3LFKA 1LJ9A 3KP7A 3TO9A 1HXDA 2W25A 4EM0B 2VODA 5ED4A 1IRFA 3F8MA 2COMA 2EB7A 1K6OA 2KJCA 1I1SA 4XRFA 5L3CA 2KJBA 4O6JA 4EJUA 1P2FA 4ON0A 3C7JA 1O3TA 3HIFA 4E70A 4LK0F 4A5NA 3K1NA 3TQNA 4A12A 2Z5UA 3KP6A 4KA4A 3HHGA 3J81Z 1T6SA 2A5YB 2V1UA 3BPXA 3L09A 3OV8A 4U88A 4L5IA 1KU7A 1FOKA 4ENJA 3CUQB 3GF2A 2E7WA 3PQKA 5L3BA 3HRSA 2D45A 1YW9A 3TO7A 4YFXF 4BHBA 2HEOA 4KT5C 5ICGA 5HVQC 1G6NA 1ZG5A 1T2KA 4I7HA 4ESFA 2ELHA 1BM9A 3J81K 5HS9A 1Z6TA 1V3FA 4Y15A 4Q5SF 2Z9OA 4KMFA 4BNCA 3QU6A 1SD6A 2YX7A 5H20A 1QO0D 3K69A 4XSZF 1B4AA 3JAMZ 2FA5A 4KN4X 4UVAA 4LGWA 3KCCA 1JXSA 1XSDA 2WV0A 2A6EF 2FSWA 5A2QZ 2O61A 2O3FA 1I5ZA 2PMUA 1K78B 1Z91A 4ENKA 1RZ4A 1S7AA 2OQGA 1BN5A 1SFXA 3HYIA 3O2PE 1XCBA 4LG0B 2K27A 2F2EA 4GGGA 1U5TA 3TOBA 3JAMK 1O57A 2ZJ2A 1IRGA 2ZXJA 1LNWA 2KRFA 3EQLF 5EEGA 1HSTA 1WRJA 2MBFA 4EM1A 2EWNA 2FEZA 2EJRA 1VTNC 3I58A 1Y0UA 1HKTA 3MQ0A 2BBYA 2BE5F 3DEUA 1XCVA 4Q4ZF 2M8EA 4P9FA 4B09A 2DLLA 1GXPA 2HYGD 1ZGJA 3C3WA 2RGVA 5ICEA 2CO5A 4ZYDA 2PBIA 5HS8A 1S3JA 1AWCA 2R7FA 2XAJA 2GXGA 4OOIA 4BHCA 1BIBA 2A68F 2JTVA 3HRMA 1R7JA 3WTUC 1ZLJA 4M74A 1FNNA 3U1DA 3E5QA 2MLGA 4HZFA 4YIFA 1H9TA 4HDUA 3ULQB 1ZARA 3U2RA 5D5WB 1R5GA 4WXCA 3COAC 2D1VA 2DPUA 2H6CA 1L0OC 3RKWA 3RYPA 1RIOH 3FMQA 3E5XA 3P7NA 5E18F 1OYWA 2KKOA 3R6SA 3F6VA 2W24A 5D8LB 4EJVA 1FPQA 2HQNA 3TDUC 2O03A 1FP2A 4A6EA 1ZLKA 1IN5A 3NRVA 4HLYA 2HWVA 2ISZA 3CJNA 4G6DA 1KQ8A 2IA0A 1WQ2A 2QQBA 2HDCA 4WXHA 4RB2C 5H6QA 4I02A 3K1MA 2HFHA 4EMSA 5LHGA 1KQ9A 1SD4A 4RB3C 4LD5A 2K02A 2EV0A 3F23A 4NQWA 2Y0MA 3DPLC 4HLXA 5KK1A 5CVVA 1F4KA 3KZYA 3L9FA 3QAHA 5DUIA 1TLHB 2EFQA 5BQTA 1WSUA 1TW2A 3LA2A 3G3ZA 1U78A 2V9VA 3R0JA 4WK8F 1S8NA 4L5JA 3LAPA 2EFNA 1R5HA 2NNNA 4HAMA 2VT2A 3T8RA 1KU9A 1IXSB 5D8KB 2VC0A 2UWMA 3FZVA 2PLYA 1U3EM 1BI3A 2GA1A 3B73A 1O3QA 4G94A 4WWCA 3IRQA 4NHJA 4KFCA 2H6BA 2ADUA 4MNUA 1UCRA 2LSOA 3QPHA 1IXRC 4UVCA 1HW2A 2QYOA 4HOBA 1ZRFA 4IJAA 3ZN0A 2F5EA 1YIOA 4CZZA 3WTWC 2F5CA 2CYYA 2DAOA 3IKVA 4LK1F 2B0LA 1ON1A 4Y17A 3LA3A 1XN7A 3SFZA 3KFWX 1ONVA 4EQQA 5F64A 1TBXA 3ZMSA 2EFWA 3WU0A 3F3XA 2XROA 4P9UA 5JI6A 2XV4S 2XIGA 4G6QA 3KEOA 2P4WA 2V1DA 2GAUA 2W57A 3I59A 3WGGA 2PQ8A 4H0EA 3Q5FA 1SMYF 4KIGA 3AAFA 3ZMDA 5KVRA 4DNCA 2XHKA 3M7GA 4IHSA 3R4KA 2QWWA 5ERIA 3WTZA 1JE8A 4RAZA 1KU2A 1UHMA 2STTA 1QZZA 2L01A 3CLOA 3T8TA 5FGMA 2E1NA 2L54A 1E17A 2ESHA 3TOAA 4LFUA 4EV0A 1D8KA 5D4SA 1EH7A 2MLKA 4KDPA 1K79A 4EM2A 4EGYA 1MJ9A 6PAXA 2J5OA 1U8RA 2IT0A 3I4PA 1FBSA 4CGZA 3HTUA 3RPUA 4BQAA 1HKQA 3CUQC 3L2CA 4RGUA 1DUXC 3W6JB 3TO6A 3LQRA 2H09A 3QPTA 3SZPA 1T98A 4R8HA 1JHHA 1R00A 1R58A 3VODA 3MAJA 3IL2A 4EGZA 4IVNA 2OU2A 2XUBA 3MEXA 1JGSA 1QZYA 1T0FA 3FF5A 1HQCA 3VOEA 4KNYA 2K86A 1BOAA 3K1PA 3G73A 4AWXB 2YX4A 1LDDA 3IKTA 1IN4A 1J9IA 3CTAA 1ZH5A 5LGNA 4HQMA 2FMLA 2HTJA 1TW3A 1T39A 2QQAA 1I27A 5HDGA 3ZQ7A 4D0PA 4I2OA 1HSJA 1LDKB 1FYMA 3DKWA 2RV8A 3F8CA 2QVOA 2VN2A 5L3GA 3BJAA 2ZCWA 2BEOA 2M30A 2DBBA 4CHUA 2FBKA 5J8FA 1MGTA 2VOPA 4R79A 1ZRCA 3WGHA 1IUYA 3LQQA 5CVRA 4UV8A 2JT1A 4BYYA 3GZ5A 1SD7A 1KGSA 4BH9A 5IT3A 3CUOA 2KIUA 4I0AA 1FLIA 3RYRA 5ILVA 2ISYA 1FSEA 5D6EA 5LLQA 1QPMA 4AVPA 2P6TA 5FO5A 2IW5A 1TTYA 2FQ3A 2NS0A 2EA2A 1XMKA 1EV7A 2XAHA 3WE3A 2R3SA 2L4MA 2M87A 5DD8A 2MD5A 2RQPA 2RNJA 5LGTA 3WU1B 2P5LC 3ELKA 3D0SA 3HSRA 3HSEA 1IN7A 5LHIA 2BGCA 4HYEA 3I59B 1FBUA 1R1TA 1B1BA 1CGPA 2VBXA 3L00A 3RDIA 3MZYA 5DYMA 3SHFA 3DP7A 1PP7U 2AXLA 4MTEA 4FHTA 5D5UB 2OA4A 5DCMA 3M9AA 4G7HF 1LQ1A 3KE2A 3V8KA 2NNYA 3CO7C 4P55A 4EJOA 5E1XA 2FBHA 2PN6A 3R0AA 4L9VA 3FX3A 3T1BA 3W6KB 3ERED 3EETA 4U7BA 1MJBA 3J80K 2V79A 2HGCA 1J5YA 5CVJA 1XGMA 1BI0A 3DQVC 1EH6A 2STWA 2ESNA 2NRAC 2G7UA 3P9IA 4A0YA 3K9TA 2WC2A 1YG2A 3RJPA 5HOOA 3R61A 3GLXA 3KP3A 3REOA 4Q47A 3I5UA 4WXDA 4CICA 5TJJA 3HTSB 2ZKZA 5DCFA 1WKMA 4N9HA 3K0LA 1A04A 1BI1A 1ZN2A 3RI4A 2X0LA 2CWEA 3NEUA 5LEKA 1ZG3A 3H3ZA 2FBIA 2FE3A 2M1BA 4PGGA 2IPQX 4HX7A 4GYIA 4R1HA 4QLCU 4UV9A 5L3DA 3FXQA 3KP4A 3FMSA 2XVCA 3BDDA 4HDVA 1B9NA 1TQMA 1Z1DA 2VE8A 5K5RA 2CGPA 3N97A 1GXQA 2DPDA 2ZNYA 5LEJA 3E5UA 3BZ6A 1P4XA 3V4GA 4BHPA 4IXAA 1FC3A 2IVMA 5HDKA 3TGNA 5F1RA 2TDXA 1FYLA 1XSVA 4RGXA 2EV6A 3N4MA 2PMHA 1XDUA 2OQRA 1E2XA 4LB5A 3D5LA 2QBYA 1SAXA 1H0MA 1B59A 3GUDA 3WTVC 1IXCA 1XGOA 2HQRA 5HLHA 3IRRA 3I64A 1MKMA 5L3FA 2QZ8A 4S05A 2FU4A 3GEZA 4XBFA 1OMIA 4YFKF 4AIHA 1ZYRF 2CW0F 2DK5A 2KIFA 4OIPF 1MDMA 3L7WA 5FB2A 4ASNA 3DF8A 4KICA 2MA3A 4M9XA 1HW5A 2RC4A 1D8JA 3JSOA 1YS7A 3WTSC 1YW7A 1DDNA 4GO1A 1FSHA 4ZZLA 2DFIA 1L3LA 1MJAA 1R22A 5H6RA 2MH9A 4IRGA 2VE9A 3GFMA 2GQQA 2IA1A 5HS7A 2P7VB 3HUGA 2M5WA 1J59A 2W85A 4ZZDA 1AOYA 4EJWA 4MTDA 1KA8A 3HHHA 2O6GE 1H9GA 3LAJA 1OPCA 2Z99A 1G3YA 3ZMZA 4PZJA 4G7OF 3FM5A 4OIQF 1RUNA 2J5PA 5DCMB 4L9NA 1C0WA 1G3SA 1Z7UA 3I0TA 4I01A 5D6FA 1K7AA 1R23A 4I0BA 2X4HA 4RGRA 3ECOA 4UNOA 4ZYEA 3F8BA 4WX9A 2OAZA 3HOTA 2FRHA 2VBZA 3B02A 4RB0A 2HZTA 2IA2A 3RIRA 4ZH4F 4JBAA 3RPQA 3U9GA 1F5TA 3HRTA 1U5TB 1ZREA 2XAGA 2JRTA 4HA8A 2PI0A 1MZBA 2VXZA 4ZYGA 4XLPF 3QOPA 3BPVA 4WF2A 4P96A 4UVBA 3ZPLA 4L9JA 3GWZA 1FWZA 1W5TA 4IF4A 2L3DA 5HDNA 2WWYA 1G3WA 3VEPA 3PQJA 4HV6A 4M6XA 2Q2EA 2UXNA 3KP5A 5DV5A 4G7ZF 2A6HF 1J2XA 5HLIA 3LSTA 2E1CA 3WODF 2XRNA 4YIIA 4HX4A 1UFMA 4AD9A 3F22A 4FT8A 2A3SA 2E7XA 2QQ9A 4FX0A 4JQFA 3SXYA 1FT9A 4OMYA 3K2ZA 3LWFA 5DDGA 4IPAA 1U2WA 1EH8A 3RKXA 2EFOA 1YS6A 4UHTA 3JTHA 2QM3A 2FXAA 2IP2A 2ZMEA 4HBLA 4RB1A 2QBYB 4MHGA 5LGUA 4ESJA 2KIMA 2LDUA 2L02A 1PP8F 4KIFA 2H27A 3BROA 5IT9K 2G9WA 1XB4A 3DV8A 3H3UA 2Q8KA 2XAFA 4LLNA 2K4BA 2DQLA 4GXOA 3BWGA 4PCQA 4FX4A 3BOQA 5JHUA 2IRFG 1MDMB 2DI3A 3QRFF 2UXXA 1MD0A 1REPC 2A07F 5ILUA 1BC8C 4F7ZA 4KN7X 3HOSA 1USTA 2DO7A 1XGSA 1IZ1A 2GA2A 5E20A 5ICCA 1BBYA 2GXBA 1BJAA 3SZTA 1V4RA 2PJPA 3BJ6A 4DQ2A 2F5FA 4A2UA 1P92A 2FNAA 3GFJA 3WG9A 1BI2A 4A6DA 2IJLA 4RS8A 3DXJF 5BPDA 2ETHA 2CG4A 1RNLA 5BMZA 1O3SA 3KZZA 3TKYA 3RTRA 1YW8A 3V7SA 1YFHA 2FMYA 1S29A 3ZMVA 2GIVA 1GHCA 1G4DA 1U6GA 4Q48A 1YO5C 1DPUA 2Y75A 4MQVA 2H94A 2D2WA 3BJOA 1YTYA 4MEYF 1Z6RA 2OD5A 4O3MA 2Y48A 3F6OA 1XMAA 2CFXA 4Z2YA 1HBXG 5EEHA 4YG2F 3WTXC 3FM3A 4XSXF 5FLXZ 3JW4A 2P8TA 5CJ9A 2LKPA 4EJTA 5ICFA 3MZHA 1RUOA 2JZYA 4TV7A 3GXOA 3V7CA 2XAQA 4HW0A 3T0YA 1B9MA 1F9NA 4JK1X 3VB2A 3P9KA 5D5XB 2WTEA 2BYVE 4B8XA 4ESBA 2EV5A 2AS5F 2QUFA 3JTGA 3ISPA 3EDPA 2K7LA 3F8NA 2RDPA 3GX4X 4L0ZB 1UB9A 1USSA 3J80Z 2YR2A 5FLXK 4RAYA 3FWEA 3KLOA 2NYXA 4KMUX 4WCGA 3E6BA 2HS5A 4M6YA 5J8CA 2G7HA 3E6MA 1RI7A 3ROUA 2FNPA 1LEBA 5LRRA 5CVUA 5LHHA 4HF0A 4U0YA 3E6CC 1G3TA 2JPBA 3ABTA 3DPTA 4RGSA 2XASA 3GZ6A 1QGPA 2MH2A 5BOXA 2MC3A 3FMRA 3IHUA 5FFXA 2D1HA 2VONA 4A5MA 1IN8A 2ZMEB 3ZMUA 2DQRA 3RKYA 3GVAA 3ZP5A 2P5KA 1OKRA 1P4AA 3F72A 2PG4A 3FHZA 1XGNA 4I98B 4MQ9F 4P5OA 1LDJA 3KP2A 5LRSA 1I1GA 5JFRA 4G9YA 1Z05A 4MEXF 4IRIA 2DTRA 5K1YA 1FP1D 3HSFA 1XSXA 4M72A 3SQNA 5A2QK 2PFBA 1TNSA 4L0YB 4M9ZA 5AONA 3VFZA 2HYFA 4LLGF 1ULYA 4OU0A 1O7LA 1XD7A 2HTSA 1ZHFA 2VOOA 4PGHA 5FFZA 1PDNC 3O6BB 2RKHA 1BC7C 5F6FA 1D5VA 3FXRA 4KYWA 4K2EA 2HOEA 4M9SA 1KYWA 1ZGAA 1NHAA 3MWMA 4XLNF 3V8JA 2XKPA 3T5XA 3GFIA 4NB5A 3TDZC 2ACJA 3Q9VA 1YYVA 4EVIA 3GFLA 1U5TC 1O3RA 4ENNA 2ZNZA 5E17F 3ECHA 4M71A 2QENA 3BY6A 2EFPA 3E3VA 3EYIA 3I71A 4M73A 1FYKA 2A69F 4I09A 2LF8A 5TRDA 4UUVA 3BP8A 4HV5A 2DW4A 2VBWA 1FBQA 4A0XA 3O3KA 2P6SA 2EA4A 2Z3YA 2Q0OA 5JR3A 1QBJA 3ZN1A 3QP6A 1LVAA 4G8XA 2LF7A 4HF2A 2NAZA 2FOKA 3E97A 5E8GA 3PFIA 1J7KA 1OR7A 1OYYA 1ZAOA 3IWFA 4OIOF 3GO5A 3QU3A 1F1ZA 3I54A 2FF4A 2OZUA 1W7PA 3CDHA 2ZFWA 1CF7A 4OINF 1T38A 2DK8A 4KUMA 4UXNA 3NQOA 1BIAA 3V8LA 2QLZA 4CXFA 4HX8A 2GZWA 1ODDA 3M8FA 3WE2A 3HRUA 1Z9CA 1W5SA 3JSPA 1DP7P 3ML6A 3Q9SA 1GVJA 1TQIA 4S04A 2W84A 4ZYHA 4N0BA 4L9TA 3C18A 2ZO4A 5DD4A 2R7DA 3OOPA 1IW7F 3M8EA 4IRHA 2O8XA 1S6LA 4IHTA 3V7RA 1ON2A 3CO6C 1WI9A 1FZPB 1PUEE 4PDKA 1SFUA 5J6XA 2DT5A 2VC1A 2CQKA 2PEXA 4CO8A 4BAYA 3F21A 4CYDA 5LBQA 3WTYC 1IAWA 2RN7A 1J0RA 1J75A 2OZ6A 4Y13A 5D5VB 1LB2A 3P9CA 3C1DA 4BXUA 3QP5A 5BPIA 1TQPA 2ZBKA 2YPRA 4GYGA 3WTTC 4QWQA 1KYZA 2M45A 4OIRF 3R60A 1KQ0A 3CUQA 5K5OA 3ZMTA 3EYYA 5AIPA 3KEQA 2CSOA 2L4AA 1DPRA 1SFEA 4A0ZA 3M1EA 5CYVA 1W7PD 2EK5A 5ILSA 4ETSA 5FD6A 5L3EA 4LLLA 2C6YA 3IWZA 3EUHA 2Z33A 2BV6A 1XDSA 1P4WA 2V6CA 3DFGA 5AIQA 1S7OA 5CVIA 3H92A 4ENMA 5DUKA 1OYIA 1HKSA 5JVTA 5IT9Z 3S2WA 1KU3A 1STZA 4GCVA 5E1ZB 2JSCA 3J7AO 2XKOA 3IC7A 4MGRA 1LEAA 2YSRA 2VBYA 1K78A 2OBPA 4LB6B 4U0WA 1IN6A 2UZKA 1SMTA 4LMYA 4O5VA 2A61A 2F5DA 4LG0A 2RVCA 4CDGA 1B6AA 1TNTA 2P5VA 2XGXA 5K5QA 3FXUA 1SD5A 1O7FA 2V1XA 3MFKA 1I6XA 2O0YA 3WGIA 4AIJA 1HW1A 1UHWA 1R36A 5DEQA 1ZG1A 4L18B 3LA7A 5E8IA 1Q1HA 4OMZA 2DU9A 3I53A 3F8FA 2GWRA 3KETA 4AIKA 3E6DA 2YU3A 4LJZF 2HKXA 2VT3A 1R1UA 4U7DA 1JHFA 2HR3A 1R1VA 3GW2A 1ZRDA 4U0VA 5BS6A 4HQEA 1D3YA 3KLNA 4YFNF 1W4MA 5D4RA 1QNTA 3ABUA 4HF1A 1W7PB 1WWXA 2HKOA 5E1WA 1CF7B 3GYHX 1FY7A 4N9IA 1IF1A 1X3UA 2JPCA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5HLG A;  3MCZ A;  2K4J A;  5CLS A;  2P7C B;  5FD5 A;  1FX7 A;  4KIB A;  1YLF A;  2LNB A;  1P6R A;  1YQA A;  1QQI A;  3LFK A;  1LJ9 A;  3KP7 A;  3TO9 A;  1HXD A;  2W25 A;  4EM0 B;  2VOD A;  5ED4 A;  1IRF A;  3F8M A;  2COM A;  2EB7 A;  1K6O A;  2KJC A;  1I1S A;  4XRF A;  5L3C A;  2KJB A;  4O6J A;  4EJU A;  1P2F A;  4ON0 A;  3C7J A;  1O3T A;  3HIF A;  4E70 A;  4LK0 F;  4A5N A;  3K1N A;  3TQN A;  4A12 A;  2Z5U A;  3KP6 A;  4KA4 A;  3HHG A;  3J81 Z;  1T6S A;  2A5Y B;  2V1U A;  3BPX A;  3L09 A;  3OV8 A;  4U88 A;  4L5I A;  1KU7 A;  1FOK A;  4ENJ A;  3CUQ B;  3GF2 A;  2E7W A;  3PQK A;  5L3B A;  3HRS A;  2D45 A;  1YW9 A;  3TO7 A;  4YFX F;  4BHB A;  2HEO A;  4KT5 C;  5ICG A;  5HVQ C;  1G6N A;  1ZG5 A;  1T2K A;  4I7H A;  4ESF A;  2ELH A;  1BM9 A;  3J81 K;  5HS9 A;  1Z6T A;  1V3F A;  4Y15 A;  4Q5S F;  2Z9O A;  4KMF A;  4BNC A;  3QU6 A;  1SD6 A;  2YX7 A;  5H20 A;  1QO0 D;  3K69 A;  4XSZ F;  1B4A A;  3JAM Z;  2FA5 A;  4KN4 X;  4UVA A;  4LGW A;  3KCC A;  1JXS A;  1XSD A;  2WV0 A;  2A6E F;  2FSW A;  5A2Q Z;  2O61 A;  2O3F A;  1I5Z A;  2PMU A;  1K78 B;  1Z91 A;  4ENK A;  1RZ4 A;  1S7A A;  2OQG A;  1BN5 A;  1SFX A;  3HYI A;  3O2P E;  1XCB A;  4LG0 B;  2K27 A;  2F2E A;  4GGG A;  1U5T A;  3TOB A;  3JAM K;  1O57 A;  2ZJ2 A;  1IRG A;  2ZXJ A;  1LNW A;  2KRF A;  3EQL F;  5EEG A;  1HST A;  1WRJ A;  2MBF A;  4EM1 A;  2EWN A;  2FEZ A;  2EJR A;  1VTN C;  3I58 A;  1Y0U A;  1HKT A;  3MQ0 A;  2BBY A;  2BE5 F;  3DEU A;  1XCV A;  4Q4Z F;  2M8E A;  4P9F A;  4B09 A;  2DLL A;  1GXP A;  2HYG D;  1ZGJ A;  3C3W A;  2RGV A;  5ICE A;  2CO5 A;  4ZYD A;  2PBI A;  5HS8 A;  1S3J A;  1AWC A;  2R7F A;  2XAJ A;  2GXG A;  4OOI A;  4BHC A;  1BIB A;  2A68 F;  2JTV A;  3HRM A;  1R7J A;  3WTU C;  1ZLJ A;  4M74 A;  1FNN A;  3U1D A;  3E5Q A;  2MLG A;  4HZF A;  4YIF A;  1H9T A;  4HDU A;  3ULQ B;  1ZAR A;  3U2R A;  5D5W B;  1R5G A;  4WXC A;  3COA C;  2D1V A;  2DPU A;  2H6C A;  1L0O C;  3RKW A;  3RYP A;  1RIO H;  3FMQ A;  3E5X A;  3P7N A;  5E18 F;  1OYW A;  2KKO A;  3R6S A;  3F6V A;  2W24 A;  5D8L B;  4EJV A;  1FPQ A;  2HQN A;  3TDU C;  2O03 A;  1FP2 A;  4A6E A;  1ZLK A;  1IN5 A;  3NRV A;  4HLY A;  2HWV A;  2ISZ A;  3CJN A;  4G6D A;  1KQ8 A;  2IA0 A;  1WQ2 A;  2QQB A;  2HDC A;  4WXH A;  4RB2 C;  5H6Q A;  4I02 A;  3K1M A;  2HFH A;  4EMS A;  5LHG A;  1KQ9 A;  1SD4 A;  4RB3 C;  4LD5 A;  2K02 A;  2EV0 A;  3F23 A;  4NQW A;  2Y0M A;  3DPL C;  4HLX A;  5KK1 A;  5CVV A;  1F4K A;  3KZY A;  3L9F A;  3QAH A;  5DUI A;  1TLH B;  2EFQ A;  5BQT A;  1WSU A;  1TW2 A;  3LA2 A;  3G3Z A;  1U78 A;  2V9V A;  3R0J A;  4WK8 F;  1S8N A;  4L5J A;  3LAP A;  2EFN A;  1R5H A;  2NNN A;  4HAM A;  2VT2 A;  3T8R A;  1KU9 A;  1IXS B;  5D8K B;  2VC0 A;  2UWM A;  3FZV A;  2PLY A;  1U3E M;  1BI3 A;  2GA1 A;  3B73 A;  1O3Q A;  4G94 A;  4WWC A;  3IRQ A;  4NHJ A;  4KFC A;  2H6B A;  2ADU A;  4MNU A;  1UCR A;  2LSO A;  3QPH A;  1IXR C;  4UVC A;  1HW2 A;  2QYO A;  4HOB A;  1ZRF A;  4IJA A;  3ZN0 A;  2F5E A;  1YIO A;  4CZZ A;  3WTW C;  2F5C A;  2CYY A;  2DAO A;  3IKV A;  4LK1 F;  2B0L A;  1ON1 A;  4Y17 A;  3LA3 A;  1XN7 A;  3SFZ A;  3KFW X;  1ONV A;  4EQQ A;  5F64 A;  1TBX A;  3ZMS A;  2EFW A;  3WU0 A;  3F3X A;  2XRO A;  4P9U A;  5JI6 A;  2XV4 S;  2XIG A;  4G6Q A;  3KEO A;  2P4W A;  2V1D A;  2GAU A;  2W57 A;  3I59 A;  3WGG A;  2PQ8 A;  4H0E A;  3Q5F A;  1SMY F;  4KIG A;  3AAF A;  3ZMD A;  5KVR A;  4DNC A;  2XHK A;  3M7G A;  4IHS A;  3R4K A;  2QWW A;  5ERI A;  3WTZ A;  1JE8 A;  4RAZ A;  1KU2 A;  1UHM A;  2STT A;  1QZZ A;  2L01 A;  3CLO A;  3T8T A;  5FGM A;  2E1N A;  2L54 A;  1E17 A;  2ESH A;  3TOA A;  4LFU A;  4EV0 A;  1D8K A;  5D4S A;  1EH7 A;  2MLK A;  4KDP A;  1K79 A;  4EM2 A;  4EGY A;  1MJ9 A;  6PAX A;  2J5O A;  1U8R A;  2IT0 A;  3I4P A;  1FBS A;  4CGZ A;  3HTU A;  3RPU A;  4BQA A;  1HKQ A;  3CUQ C;  3L2C A;  4RGU A;  1DUX C;  3W6J B;  3TO6 A;  3LQR A;  2H09 A;  3QPT A;  3SZP A;  1T98 A;  4R8H A;  1JHH A;  1R00 A;  1R58 A;  3VOD A;  3MAJ A;  3IL2 A;  4EGZ A;  4IVN A;  2OU2 A;  2XUB A;  3MEX A;  1JGS A;  1QZY A;  1T0F A;  3FF5 A;  1HQC A;  3VOE A;  4KNY A;  2K86 A;  1BOA A;  3K1P A;  3G73 A;  4AWX B;  2YX4 A;  1LDD A;  3IKT A;  1IN4 A;  1J9I A;  3CTA A;  1ZH5 A;  5LGN A;  4HQM A;  2FML A;  2HTJ A;  1TW3 A;  1T39 A;  2QQA A;  1I27 A;  5HDG A;  3ZQ7 A;  4D0P A;  4I2O A;  1HSJ A;  1LDK B;  1FYM A;  3DKW A;  2RV8 A;  3F8C A;  2QVO A;  2VN2 A;  5L3G A;  3BJA A;  2ZCW A;  2BEO A;  2M30 A;  2DBB A;  4CHU A;  2FBK A;  5J8F A;  1MGT A;  2VOP A;  4R79 A;  1ZRC A;  3WGH A;  1IUY A;  3LQQ A;  5CVR A;  4UV8 A;  2JT1 A;  4BYY A;  3GZ5 A;  1SD7 A;  1KGS A;  4BH9 A;  5IT3 A;  3CUO A;  2KIU A;  4I0A A;  1FLI A;  3RYR A;  5ILV A;  2ISY A;  1FSE A;  5D6E A;  5LLQ A;  1QPM A;  4AVP A;  2P6T A;  5FO5 A;  2IW5 A;  1TTY A;  2FQ3 A;  2NS0 A;  2EA2 A;  1XMK A;  1EV7 A;  2XAH A;  3WE3 A;  2R3S A;  2L4M A;  2M87 A;  5DD8 A;  2MD5 A;  2RQP A;  2RNJ A;  5LGT A;  3WU1 B;  2P5L C;  3ELK A;  3D0S A;  3HSR A;  3HSE A;  1IN7 A;  5LHI A;  2BGC A;  4HYE A;  3I59 B;  1FBU A;  1R1T A;  1B1B A;  1CGP A;  2VBX A;  3L00 A;  3RDI A;  3MZY A;  5DYM A;  3SHF A;  3DP7 A;  1PP7 U;  2AXL A;  4MTE A;  4FHT A;  5D5U B;  2OA4 A;  5DCM A;  3M9A A;  4G7H F;  1LQ1 A;  3KE2 A;  3V8K A;  2NNY A;  3CO7 C;  4P55 A;  4EJO A;  5E1X A;  2FBH A;  2PN6 A;  3R0A A;  4L9V A;  3FX3 A;  3T1B A;  3W6K B;  3ERE D;  3EET A;  4U7B A;  1MJB A;  3J80 K;  2V79 A;  2HGC A;  1J5Y A;  5CVJ A;  1XGM A;  1BI0 A;  3DQV C;  1EH6 A;  2STW A;  2ESN A;  2NRA C;  2G7U A;  3P9I A;  4A0Y A;  3K9T A;  2WC2 A;  1YG2 A;  3RJP A;  5HOO A;  3R61 A;  3GLX A;  3KP3 A;  3REO A;  4Q47 A;  3I5U A;  4WXD A;  4CIC A;  5TJJ A;  3HTS B;  2ZKZ A;  5DCF A;  1WKM A;  4N9H A;  3K0L A;  1A04 A;  1BI1 A;  1ZN2 A;  3RI4 A;  2X0L A;  2CWE A;  3NEU A;  5LEK A;  1ZG3 A;  3H3Z A;  2FBI A;  2FE3 A;  2M1B A;  4PGG A;  2IPQ X;  4HX7 A;  4GYI A;  4R1H A;  4QLC U;  4UV9 A;  5L3D A;  3FXQ A;  3KP4 A;  3FMS A;  2XVC A;  3BDD A;  4HDV A;  1B9N A;  1TQM A;  1Z1D A;  2VE8 A;  5K5R A;  2CGP A;  3N97 A;  1GXQ A;  2DPD A;  2ZNY A;  5LEJ A;  3E5U A;  3BZ6 A;  1P4X A;  3V4G A;  4BHP A;  4IXA A;  1FC3 A;  2IVM A;  5HDK A;  3TGN A;  5F1R A;  2TDX A;  1FYL A;  1XSV A;  4RGX A;  2EV6 A;  3N4M A;  2PMH A;  1XDU A;  2OQR A;  1E2X A;  4LB5 A;  3D5L A;  2QBY A;  1SAX A;  1H0M A;  1B59 A;  3GUD A;  3WTV C;  1IXC A;  1XGO A;  2HQR A;  5HLH A;  3IRR A;  3I64 A;  1MKM A;  5L3F A;  2QZ8 A;  4S05 A;  2FU4 A;  3GEZ A;  4XBF A;  1OMI A;  4YFK F;  4AIH A;  1ZYR F;  2CW0 F;  2DK5 A;  2KIF A;  4OIP F;  1MDM A;  3L7W A;  5FB2 A;  4ASN A;  3DF8 A;  4KIC A;  2MA3 A;  4M9X A;  1HW5 A;  2RC4 A;  1D8J A;  3JSO A;  1YS7 A;  3WTS C;  1YW7 A;  1DDN A;  4GO1 A;  1FSH A;  4ZZL A;  2DFI A;  1L3L A;  1MJA A;  1R22 A;  5H6R A;  2MH9 A;  4IRG A;  2VE9 A;  3GFM A;  2GQQ A;  2IA1 A;  5HS7 A;  2P7V B;  3HUG A;  2M5W A;  1J59 A;  2W85 A;  4ZZD A;  1AOY A;  4EJW A;  4MTD A;  1KA8 A;  3HHH A;  2O6G E;  1H9G A;  3LAJ A;  1OPC A;  2Z99 A;  1G3Y A;  3ZMZ A;  4PZJ A;  4G7O F;  3FM5 A;  4OIQ F;  1RUN A;  2J5P A;  5DCM B;  4L9N A;  1C0W A;  1G3S A;  1Z7U A;  3I0T A;  4I01 A;  5D6F A;  1K7A A;  1R23 A;  4I0B A;  2X4H A;  4RGR A;  3ECO A;  4UNO A;  4ZYE A;  3F8B A;  4WX9 A;  2OAZ A;  3HOT A;  2FRH A;  2VBZ A;  3B02 A;  4RB0 A;  2HZT A;  2IA2 A;  3RIR A;  4ZH4 F;  4JBA A;  3RPQ A;  3U9G A;  1F5T A;  3HRT A;  1U5T B;  1ZRE A;  2XAG A;  2JRT A;  4HA8 A;  2PI0 A;  1MZB A;  2VXZ A;  4ZYG A;  4XLP F;  3QOP A;  3BPV A;  4WF2 A;  4P96 A;  4UVB A;  3ZPL A;  4L9J A;  3GWZ A;  1FWZ A;  1W5T A;  4IF4 A;  2L3D A;  5HDN A;  2WWY A;  1G3W A;  3VEP A;  3PQJ A;  4HV6 A;  4M6X A;  2Q2E A;  2UXN A;  3KP5 A;  5DV5 A;  4G7Z F;  2A6H F;  1J2X A;  5HLI A;  3LST A;  2E1C A;  3WOD F;  2XRN A;  4YII A;  4HX4 A;  1UFM A;  4AD9 A;  3F22 A;  4FT8 A;  2A3S A;  2E7X A;  2QQ9 A;  4FX0 A;  4JQF A;  3SXY A;  1FT9 A;  4OMY A;  3K2Z A;  3LWF A;  5DDG A;  4IPA A;  1U2W A;  1EH8 A;  3RKX A;  2EFO A;  1YS6 A;  4UHT A;  3JTH A;  2QM3 A;  2FXA A;  2IP2 A;  2ZME A;  4HBL A;  4RB1 A;  2QBY B;  4MHG A;  5LGU A;  4ESJ A;  2KIM A;  2LDU A;  2L02 A;  1PP8 F;  4KIF A;  2H27 A;  3BRO A;  5IT9 K;  2G9W A;  1XB4 A;  3DV8 A;  3H3U A;  2Q8K A;  2XAF A;  4LLN A;  2K4B A;  2DQL A;  4GXO A;  3BWG A;  4PCQ A;  4FX4 A;  3BOQ A;  5JHU A;  2IRF G;  1MDM B;  2DI3 A;  3QRF F;  2UXX A;  1MD0 A;  1REP C;  2A07 F;  5ILU A;  1BC8 C;  4F7Z A;  4KN7 X;  3HOS A;  1UST A;  2DO7 A;  1XGS A;  1IZ1 A;  2GA2 A;  5E20 A;  5ICC A;  1BBY A;  2GXB A;  1BJA A;  3SZT A;  1V4R A;  2PJP A;  3BJ6 A;  4DQ2 A;  2F5F A;  4A2U A;  1P92 A;  2FNA A;  3GFJ A;  3WG9 A;  1BI2 A;  4A6D A;  2IJL A;  4RS8 A;  3DXJ F;  5BPD A;  2ETH A;  2CG4 A;  1RNL A;  5BMZ A;  1O3S A;  3KZZ A;  3TKY A;  3RTR A;  1YW8 A;  3V7S A;  1YFH A;  2FMY A;  1S29 A;  3ZMV A;  2GIV A;  1GHC A;  1G4D A;  1U6G A;  4Q48 A;  1YO5 C;  1DPU A;  2Y75 A;  4MQV A;  2H94 A;  2D2W A;  3BJO A;  1YTY A;  4MEY F;  1Z6R A;  2OD5 A;  4O3M A;  2Y48 A;  3F6O A;  1XMA A;  2CFX A;  4Z2Y A;  1HBX G;  5EEH A;  4YG2 F;  3WTX C;  3FM3 A;  4XSX F;  5FLX Z;  3JW4 A;  2P8T A;  5CJ9 A;  2LKP A;  4EJT A;  5ICF A;  3MZH A;  1RUO A;  2JZY A;  4TV7 A;  3GXO A;  3V7C A;  2XAQ A;  4HW0 A;  3T0Y A;  1B9M A;  1F9N A;  4JK1 X;  3VB2 A;  3P9K A;  5D5X B;  2WTE A;  2BYV E;  4B8X A;  4ESB A;  2EV5 A;  2AS5 F;  2QUF A;  3JTG A;  3ISP A;  3EDP A;  2K7L A;  3F8N A;  2RDP A;  3GX4 X;  4L0Z B;  1UB9 A;  1USS A;  3J80 Z;  2YR2 A;  5FLX K;  4RAY A;  3FWE A;  3KLO A;  2NYX A;  4KMU X;  4WCG A;  3E6B A;  2HS5 A;  4M6Y A;  5J8C A;  2G7H A;  3E6M A;  1RI7 A;  3ROU A;  2FNP A;  1LEB A;  5LRR A;  5CVU A;  5LHH A;  4HF0 A;  4U0Y A;  3E6C C;  1G3T A;  2JPB A;  3ABT A;  3DPT A;  4RGS A;  2XAS A;  3GZ6 A;  1QGP A;  2MH2 A;  5BOX A;  2MC3 A;  3FMR A;  3IHU A;  5FFX A;  2D1H A;  2VON A;  4A5M A;  1IN8 A;  2ZME B;  3ZMU A;  2DQR A;  3RKY A;  3GVA A;  3ZP5 A;  2P5K A;  1OKR A;  1P4A A;  3F72 A;  2PG4 A;  3FHZ A;  1XGN A;  4I98 B;  4MQ9 F;  4P5O A;  1LDJ A;  3KP2 A;  5LRS A;  1I1G A;  5JFR A;  4G9Y A;  1Z05 A;  4MEX F;  4IRI A;  2DTR A;  5K1Y A;  1FP1 D;  3HSF A;  1XSX A;  4M72 A;  3SQN A;  5A2Q K;  2PFB A;  1TNS A;  4L0Y B;  4M9Z A;  5AON A;  3VFZ A;  2HYF A;  4LLG F;  1ULY A;  4OU0 A;  1O7L A;  1XD7 A;  2HTS A;  1ZHF A;  2VOO A;  4PGH A;  5FFZ A;  1PDN C;  3O6B B;  2RKH A;  1BC7 C;  5F6F A;  1D5V A;  3FXR A;  4KYW A;  4K2E A;  2HOE A;  4M9S A;  1KYW A;  1ZGA A;  1NHA A;  3MWM A;  4XLN F;  3V8J A;  2XKP A;  3T5X A;  3GFI A;  4NB5 A;  3TDZ C;  2ACJ A;  3Q9V A;  1YYV A;  4EVI A;  3GFL A;  1U5T C;  1O3R A;  4ENN A;  2ZNZ A;  5E17 F;  3ECH A;  4M71 A;  2QEN A;  3BY6 A;  2EFP A;  3E3V A;  3EYI A;  3I71 A;  4M73 A;  1FYK A;  2A69 F;  4I09 A;  2LF8 A;  5TRD A;  4UUV A;  3BP8 A;  4HV5 A;  2DW4 A;  2VBW A;  1FBQ A;  4A0X A;  3O3K A;  2P6S A;  2EA4 A;  2Z3Y A;  2Q0O A;  5JR3 A;  1QBJ A;  3ZN1 A;  3QP6 A;  1LVA A;  4G8X A;  2LF7 A;  4HF2 A;  2NAZ A;  2FOK A;  3E97 A;  5E8G A;  3PFI A;  1J7K A;  1OR7 A;  1OYY A;  1ZAO A;  3IWF A;  4OIO F;  3GO5 A;  3QU3 A;  1F1Z A;  3I54 A;  2FF4 A;  2OZU A;  1W7P A;  3CDH A;  2ZFW A;  1CF7 A;  4OIN F;  1T38 A;  2DK8 A;  4KUM A;  4UXN A;  3NQO A;  1BIA A;  3V8L A;  2QLZ A;  4CXF A;  4HX8 A;  2GZW A;  1ODD A;  3M8F A;  3WE2 A;  3HRU A;  1Z9C A;  1W5S A;  3JSP A;  1DP7 P;  3ML6 A;  3Q9S A;  1GVJ A;  1TQI A;  4S04 A;  2W84 A;  4ZYH A;  4N0B A;  4L9T A;  3C18 A;  2ZO4 A;  5DD4 A;  2R7D A;  3OOP A;  1IW7 F;  3M8E A;  4IRH A;  2O8X A;  1S6L A;  4IHT A;  3V7R A;  1ON2 A;  3CO6 C;  1WI9 A;  1FZP B;  1PUE E;  4PDK A;  1SFU A;  5J6X A;  2DT5 A;  2VC1 A;  2CQK A;  2PEX A;  4CO8 A;  4BAY A;  3F21 A;  4CYD A;  5LBQ A;  3WTY C;  1IAW A;  2RN7 A;  1J0R A;  1J75 A;  2OZ6 A;  4Y13 A;  5D5V B;  1LB2 A;  3P9C A;  3C1D A;  4BXU A;  3QP5 A;  5BPI A;  1TQP A;  2ZBK A;  2YPR A;  4GYG A;  3WTT C;  4QWQ A;  1KYZ A;  2M45 A;  4OIR F;  3R60 A;  1KQ0 A;  3CUQ A;  5K5O A;  3ZMT A;  3EYY A;  5AIP A;  3KEQ A;  2CSO A;  2L4A A;  1DPR A;  1SFE A;  4A0Z A;  3M1E A;  5CYV A;  1W7P D;  2EK5 A;  5ILS A;  4ETS A;  5FD6 A;  5L3E A;  4LLL A;  2C6Y A;  3IWZ A;  3EUH A;  2Z33 A;  2BV6 A;  1XDS A;  1P4W A;  2V6C A;  3DFG A;  5AIQ A;  1S7O A;  5CVI A;  3H92 A;  4ENM A;  5DUK A;  1OYI A;  1HKS A;  5JVT A;  5IT9 Z;  3S2W A;  1KU3 A;  1STZ A;  4GCV A;  5E1Z B;  2JSC A;  3J7A O;  2XKO A;  3IC7 A;  4MGR A;  1LEA A;  2YSR A;  2VBY A;  1K78 A;  2OBP A;  4LB6 B;  4U0W A;  1IN6 A;  2UZK A;  1SMT A;  4LMY A;  4O5V A;  2A61 A;  2F5D A;  4LG0 A;  2RVC A;  4CDG A;  1B6A A;  1TNT A;  2P5V A;  2XGX A;  5K5Q A;  3FXU A;  1SD5 A;  1O7F A;  2V1X A;  3MFK A;  1I6X A;  2O0Y A;  3WGI A;  4AIJ A;  1HW1 A;  1UHW A;  1R36 A;  5DEQ A;  1ZG1 A;  4L18 B;  3LA7 A;  5E8I A;  1Q1H A;  4OMZ A;  2DU9 A;  3I53 A;  3F8F A;  2GWR A;  3KET A;  4AIK A;  3E6D A;  2YU3 A;  4LJZ F;  2HKX A;  2VT3 A;  1R1U A;  4U7D A;  1JHF A;  2HR3 A;  1R1V A;  3GW2 A;  1ZRD A;  4U0V A;  5BS6 A;  4HQE A;  1D3Y A;  3KLN A;  4YFN F;  1W4M A;  5D4R A;  1QNT A;  3ABU A;  4HF1 A;  1W7P B;  1WWX A;  2HKO A;  5E1W A;  1CF7 B;  3GYH X;  1FY7 A;  4N9I A;  1IF1 A;  1X3U A;  2JPC A; 
#chains in the Genus database with same CATH topology
 5HLG A;  4MLO A;  4FIS A;  2W82 A;  2ZME C;  2K4J A;  3MCZ A;  4N4N B;  5CLS A;  2P7C B;  5FD5 A;  1FX7 A;  1ZEL A;  5K7Z A;  4KIB A;  2R0Q C;  1ETQ A;  4FQG A;  1YLF A;  3PO2 J;  3ZQG A;  2LNB A;  2H8R A;  1P6R A;  1YQA A;  3G1L A;  1QQI A;  2R5Z B;  3LFK A;  1LJ9 A;  1B8I B;  1RES A;  3KP7 A;  4CCM A;  4PK4 A;  4D1Q A;  3TO9 A;  1HXD A;  2Z16 A;  2QF7 A;  5IYB J;  2W25 A;  4HPQ A;  4EM0 B;  1NH3 A;  2F48 A;  1SEU A;  2VOD A;  5E3L A;  4CCN A;  2FJ1 A;  5ED4 A;  1IRF A;  3F8M A;  3CF2 A;  2COM A;  2EB7 A;  3G6E I;  1K6O A;  2KJC A;  4CUG A;  1I1S A;  5HOD A;  1VQL I;  3DU5 A;  1JT6 A;  1B72 B;  4V2G A;  4XRF A;  5L3C A;  4BJT A;  2ZXH A;  2KJB A;  2JVG A;  4O6J A;  4EJU A;  1P2F A;  3RPU D;  4ON0 A;  3FKJ A;  3C7J A;  2G0E A;  3OYI A;  4XQF A;  1O3T A;  2DMP A;  3HIF A;  4CCO A;  4E70 A;  3J7A Y;  3OR2 C;  4LK0 F;  4A5N A;  2VQC A;  4DZP A;  4XLA A;  3K1N A;  3TQN A;  4A12 A;  1I50 J;  5EYR A;  2Z5U A;  1N78 A;  3KP6 A;  4KA4 A;  3HHG A;  3VYT B;  3J81 Z;  1T6S A;  5HNH A;  3CLQ A;  2A5Y B;  2ZXI A;  2V1U A;  5J1Y A;  3BPX A;  3BG7 A;  3L09 A;  3OV8 A;  4U88 A;  3CCL I;  4BEH B;  4L5I A;  1KU7 A;  1FOK A;  4ENJ A;  3AG4 H;  4UUS A;  2V9K A;  3CUQ B;  4D7N A;  2ELK A;  3GF2 A;  2QKM B;  2E7W A;  3PQK A;  5L3B A;  4XR6 A;  3HRS A;  2D45 A;  1YW9 A;  3TO7 A;  1X1A A;  3PNY A;  4BHB A;  4YFX F;  2HEO A;  2YS9 A;  2Q2E B;  3FBI B;  4KT5 C;  4IEJ A;  5ICG A;  5B1B H;  2EIL H;  2JJ7 A;  2KRH A;  5HVQ C;  1G6N A;  4FE7 A;  1FEX A;  1ZG5 A;  1T2K A;  4I7H A;  4ESF A;  5F0C A;  1TWH J;  1HLV A;  2K9Q A;  2JVH A;  2ELH A;  1Z3Y A;  1YOV B;  1BM9 A;  2VPR A;  3J81 K;  5HS9 A;  1Z6T A;  1V3F A;  4Y15 A;  4Q5S F;  2R7X A;  2Z9O A;  3I4N J;  4KMF A;  1OQY A;  1TWG J;  4BNC A;  4XOR A;  1FTZ A;  3QU6 A;  1SD6 A;  2YX7 A;  5H20 A;  4BBR J;  1QO0 D;  3K69 A;  3JRI A;  4XSZ F;  1POG A;  1N75 A;  1HC8 A;  2K3P A;  1B4A A;  3OL3 A;  3BZK A;  3JAM Z;  3HOV J;  2FA5 A;  4KN4 X;  4UVA A;  4LGW A;  3GZN B;  3KCC A;  3HXL A;  3DEW A;  1JXS A;  4B3A A;  4LIV A;  1XSD A;  2JUC A;  4AUX A;  2DT6 A;  2KZG A;  1ZR2 A;  3PNT A;  1ZGW A;  1VQ4 I;  2WV0 A;  4BXX J;  2A6E F;  2FSW A;  2VKE A;  3IH3 A;  3S32 A;  5A2Q Z;  5C4X J;  2O61 A;  2O3F A;  1I5Z A;  1JJ8 C;  4B3X A;  2PMU A;  1K78 B;  1Z91 A;  2HYJ A;  1RZ4 A;  4ENK A;  1S7A A;  2OQG A;  4PJN A;  1I39 A;  1BN5 A;  1SFX A;  3HYI A;  3O2P E;  1XCB A;  4PJJ A;  3BQZ A;  4LG0 B;  1GDT A;  2K27 A;  2LY2 A;  3M8J A;  4Y3O A;  1MMD A;  2F2E A;  3AKZ A;  3A01 B;  4GGG A;  1I6H J;  3W6V A;  1U5T A;  3TOB A;  3JAM K;  2K9M A;  2KZV A;  1O57 A;  2KPM A;  2ZJ2 A;  1V5F A;  1IRG A;  2ZXJ A;  1LNW A;  1BJZ A;  2E36 A;  2KRF A;  3EQL F;  4CSW A;  5EEG A;  1HST A;  2DMT A;  2QA4 I;  1WRJ A;  2CQQ A;  4MO7 A;  2MBF A;  4EM1 A;  2EWN A;  3N05 A;  1JI8 A;  2KRC A;  5E3M A;  2DMN A;  2FEZ A;  2EJR A;  1MBK A;  2CUF A;  5EEA A;  5HLT A;  3GTQ J;  3Q0U A;  2LMD A;  2LG4 A;  1VTN C;  3I58 A;  3CF5 F;  4KT6 A;  1APL C;  1Y0U A;  2LC2 A;  1HKT A;  3MQ0 A;  2BBY A;  2BE5 F;  3DEU A;  1T95 A;  1XCV A;  4Q4Z F;  2M8E A;  4P9F A;  1ERD A;  4B09 A;  3QOD A;  2DLL A;  4BJ5 C;  2Y9Z A;  1GXP A;  2HYG D;  2W00 A;  1ZGJ A;  3C3W A;  4XM3 A;  3QYE A;  4E7L A;  3EPZ A;  2RGV A;  2M9H A;  5ICE A;  1TWA J;  2CO5 A;  2MYS A;  4ZYD A;  2R7S A;  2PBI A;  5HS8 A;  1Y56 A;  4XON A;  1S3J A;  5KAI C;  2VJJ A;  1AWC A;  3DU6 A;  2R7F A;  4PFO A;  1WJ5 A;  5CQG A;  2XAJ A;  2PJR A;  3G2B A;  2GXG A;  2JWT A;  3VYU B;  4OOI A;  4BHC A;  3I56 I;  1BIB A;  2A68 F;  2QSF X;  2JTV A;  4BS9 A;  4M3G A;  3HRM A;  3BC8 A;  1R7J A;  4HNU A;  3WTU C;  4IOA F;  3RSN A;  1ZLJ A;  3M1C A;  4C3I J;  2WAE A;  1VQ5 I;  1MMG A;  4M74 A;  1N25 A;  1FNN A;  1OCC H;  3U1D A;  3E5Q A;  3ONQ A;  1W36 D;  2MLG A;  4HZF A;  4YIF A;  1H9T A;  2DA2 A;  4HDU A;  1TZL A;  2MGQ A;  2XPV A;  3ULQ B;  3CP2 A;  1ZAR A;  3JRG A;  3U2R A;  2DJN A;  4B48 A;  5D5W B;  1R5G A;  4WXC A;  1OLT A;  3COA C;  2D1V A;  2DPU A;  2H6C A;  1L0O C;  3RKW A;  2E5N A;  2CQX A;  3RYP A;  1RIO H;  3FMQ A;  3E5X A;  3P7N A;  5E18 F;  1OYW A;  2KKO A;  2WY7 Q;  3R6S A;  3F6V A;  1G8X A;  2W24 A;  5D8L B;  4EJV A;  1FPQ A;  2HQN A;  3H0G J;  2O03 A;  4W1U A;  2KMU A;  1FP2 A;  3TDU C;  4A6E A;  1MNM C;  1ZLK A;  1R6R A;  1QRY A;  1IN5 A;  3H5N A;  3BR2 A;  3NRV A;  5FKL A;  4HLY A;  3F9K A;  2HWV A;  2ISZ A;  3CJN A;  1MW7 A;  4G6D A;  4P1W A;  1KQ8 A;  1OCR H;  2IA0 A;  4XRM A;  1WQ2 A;  2F4I A;  2QQB A;  2HDC A;  4RLF A;  5CKT A;  4GRI A;  1JKO C;  4WXH A;  2X1C A;  2WB1 N;  5F27 A;  2LTP A;  1XMX A;  3PO3 J;  4RB2 C;  1Y39 A;  4II2 A;  2EZH A;  5H6Q A;  2JMW A;  4I02 A;  3K1M A;  2HFH A;  4EMS A;  3MN2 A;  3QWL A;  5LHG A;  1KQ9 A;  1SD4 A;  2BHZ A;  3CCU I;  4RB3 C;  3OSF A;  4LD5 A;  2K02 A;  3S3N A;  2EV0 A;  2JA6 J;  2R7V A;  5M3F J;  3F23 A;  4NQW A;  2MC4 A;  1VQK I;  2Y0M A;  3DPL C;  3RQ4 A;  5F1J A;  2LY9 A;  4UUS B;  4HLX A;  4XN0 A;  5CVV A;  3C2G A;  5KK1 A;  1F4K A;  3OOU A;  3KZY A;  3L9F A;  3H9G A;  3QAH A;  5DUI A;  1TLH B;  4IX7 A;  2EFQ A;  5BQT A;  1WSU A;  1I3A A;  1TW2 A;  3LA2 A;  4A3I J;  3G3Z A;  1U78 A;  1MIJ A;  3LL7 A;  3GTO J;  2V9V A;  3VSL A;  2M0M A;  3R0J A;  1T33 A;  4WK8 F;  2OCC H;  1S8N A;  2DMU A;  4L5J A;  2EFN A;  3LAP A;  1R5H A;  3OYE A;  2NNN A;  4HAM A;  2VT2 A;  2Q1Z B;  3T8R A;  1KU9 A;  1LVK A;  1W0T A;  4PFP A;  1IXS B;  3P5J A;  5D8K B;  3MKL A;  1PJR A;  1FIA A;  1PVE A;  1JUM A;  2F6C A;  2VC0 A;  2UWM A;  1GVD A;  2HI3 A;  2L0K A;  3FZV A;  3GCM A;  2PLY A;  3KYL A;  1U3E M;  1BI3 A;  2GA1 A;  3B73 A;  2BY3 A;  1O3Q A;  1VQ9 I;  4G94 A;  2DA5 A;  4WWC A;  3IRQ A;  1EA3 A;  4NHJ A;  4KFC A;  2H6B A;  3PM1 A;  2IGN A;  3BCA A;  4AM3 A;  2IS1 A;  2ADU A;  4MNU A;  4JOM A;  3FK7 A;  1UCR A;  2LSO A;  3QPH A;  1IXR C;  2QCO A;  4UVC A;  3JRB A;  1HW2 A;  2TRT A;  4RLQ A;  1DP3 A;  2X6X A;  2QYO A;  1VQ7 I;  3KZI C;  2I8D A;  4HOB A;  1ZRF A;  2B9S A;  2M3A A;  4FCY A;  1X1B A;  4IJA A;  3ZN0 A;  2A5W A;  2F5E A;  1YIO A;  1N77 A;  2OF7 A;  2F5V A;  1ZK8 A;  4CZZ A;  3WTW C;  2KDO A;  2F5C A;  3VDX A;  4E7H A;  2HNH A;  2CYY A;  1U0J A;  2DAO A;  3IKV A;  4LK1 F;  2WAF A;  2E1O A;  2B0L A;  3A1Y A;  5IPA A;  2XF7 A;  4ITV A;  1ON1 A;  3AG3 H;  4XK4 A;  4Y17 A;  4I76 A;  3LA3 A;  1SFK A;  1XN7 A;  3SFZ A;  2XB5 A;  3KFW X;  1ONV A;  1BR2 A;  4AID A;  1VZ0 A;  1WJF A;  4MFD A;  4EQQ A;  5F64 A;  3H0D A;  3VPR A;  1TBX A;  3ZMS A;  2EFW A;  3WU0 A;  3F3X A;  3L2R A;  2XRO A;  3UNG C;  3LSK A;  1SAN A;  3K4L A;  4P9U A;  5JI6 A;  1ITY A;  2XV4 S;  2XIG A;  4G6Q A;  3KEO A;  2P4W A;  3O8G A;  2V1D A;  2GAU A;  3JCU C;  2W57 A;  2ELJ A;  1YJN I;  4X0G A;  4BE1 A;  3DLA A;  3I59 A;  3WGG A;  2L9R A;  1FMV A;  2B7E A;  3DBH B;  5M5X J;  2PQ8 A;  4H0E A;  3Q5F A;  3CMM A;  4E7Z A;  2E2H J;  4CCL A;  1SMY F;  3S16 J;  4KIG A;  3AAF A;  3OS0 A;  3ZMD A;  2DFE A;  3BR3 A;  3JR9 A;  1Y8R B;  2Y0S N;  5KVR A;  2COB A;  3K70 C;  4DNC A;  2XHK A;  4CZC A;  3DTI A;  3M7G A;  4IHS A;  3PIP F;  3IH2 A;  2PJR B;  1A36 A;  3R4K A;  2QWW A;  3SFI A;  5ERI A;  3WTZ A;  2O8K A;  5FKO A;  1JE8 A;  3K10 A;  4RAZ A;  1G2H A;  3CCJ I;  2DFH A;  1KU2 A;  4JX6 A;  1UHM A;  3OL4 A;  3SDG A;  2ZJP F;  3BZC A;  4FE4 A;  2STT A;  3H3V K;  1QZZ A;  2L01 A;  3CLO A;  3T8T A;  5FGM A;  2E1N A;  2L54 A;  4XKC A;  4D7M A;  1MMA A;  1VQO I;  1XS9 A;  1E17 A;  2ESH A;  5CQE A;  3TOA A;  1VQ6 I;  5E79 C;  3DBR B;  4LFU A;  4CH7 A;  4EV0 A;  1D8K A;  2X1D A;  5D4S A;  1EH7 A;  4BQO A;  2MLK A;  2BXZ A;  5F08 A;  2IAI A;  1EJ9 A;  4KDP A;  1IDZ A;  3I3L A;  1K79 A;  4D9J A;  4EM2 A;  1JTX A;  4EGY A;  1MJ9 A;  4BUP A;  2J5O A;  4IZZ A;  1U8R A;  1TC3 C;  2IT0 A;  2AO9 A;  6PAX A;  3I4P A;  1FBS A;  2W48 A;  4CGZ A;  3HTU A;  3RPU A;  3M3Y J;  4BQA A;  2VIX A;  3MVP A;  3QPS A;  2HOS A;  1S9H A;  2IS6 A;  1HKQ A;  3CUQ C;  5HNF A;  3L2C A;  2CW8 A;  2CV2 A;  4RGU A;  1NK3 P;  2ME0 A;  1WHU A;  1WVR A;  3W6J B;  3TO6 A;  1DUX C;  3LQR A;  2H09 A;  1X58 A;  3QPT A;  1VI0 A;  3TMO A;  3SZP A;  1T98 A;  3HGG A;  4R8H A;  3HG9 A;  3S15 J;  1JHH A;  4PJL A;  2XDV A;  4A3F J;  3S3O A;  4L5E A;  1P7J A;  1R00 A;  1IJW C;  1R58 A;  3VOD A;  2RQQ A;  2WB1 A;  4JX5 A;  3ABL H;  3MAJ A;  5GAG J;  3IL2 A;  4DJA A;  4EGZ A;  2VPL A;  4IVN A;  1BL0 A;  2OU2 A;  2XUB A;  3MEX A;  3OMY A;  1FOX A;  4BY1 J;  2HPM A;  3J7Y J;  3JRA A;  1FOY A;  4QPO A;  3OR1 C;  1JGS A;  1QZY A;  1T0F A;  3FF5 A;  1HQC A;  2WAQ N;  3VOE A;  3PUB A;  4KNY A;  4JYK A;  2K86 A;  4XID A;  1BOA A;  3K1P A;  3G73 A;  4AWX B;  2YX4 A;  4NBQ A;  4NQW B;  4XOT A;  3LSG A;  1LDD A;  2RRE A;  3IKT A;  3BR6 A;  1IN4 A;  1IV8 A;  2IEK A;  1PYV A;  4HNV A;  1J9I A;  3CTA A;  2M34 A;  1ZH5 A;  2M7A A;  5LGN A;  4HQM A;  2FML A;  2L9V A;  2HTJ A;  1U9N A;  4NUB A;  2M4G A;  1TW3 A;  2KIS A;  2VQG A;  3BCB A;  3PL8 A;  3HOY J;  4DYQ A;  2CQ7 A;  1T39 A;  3CCS I;  2QQA A;  1I27 A;  1V54 H;  4RAG A;  5HDG A;  3ZQ7 A;  4D0P A;  1RRJ A;  4I2O A;  3AL0 B;  3KPH A;  4IHW A;  3OY9 A;  4BDY A;  1HSJ A;  1LDK B;  2DJI A;  2XC7 A;  2E2J J;  2JRM A;  2RNG A;  4S0H B;  1FYM A;  3DKW A;  2RV8 A;  3F8C A;  1PUF A;  2QVO A;  2VN2 A;  4Y33 A;  2Y69 H;  4PJ0 C;  5L3G A;  2DA7 A;  3BJA A;  5B5E C;  1SAU A;  4BQQ A;  3OIP A;  2ZCW A;  1A6Q A;  2BEO A;  1NTC A;  1QA6 A;  3CC7 I;  2M30 A;  3L2U A;  2DBB A;  3HPG A;  3CMA I;  4CHU A;  4ABZ A;  2GM4 A;  2FBK A;  5J8F A;  1MGT A;  3S1Q J;  2VOP A;  1ENH A;  3DKX A;  4R79 A;  1ZRC A;  3WGH A;  1IV6 A;  2LYC A;  2CUZ A;  1IUY A;  1K4S A;  3LQQ A;  5CVR A;  1NK2 P;  2YUS A;  4UV8 A;  4IQJ A;  4C3H J;  2JT1 A;  3Q0V A;  4AU7 A;  4BYY A;  3GZ5 A;  1SD7 A;  3JRE A;  3L1P A;  3CD6 I;  1KGS A;  4BH9 A;  3RZO J;  1H89 C;  3ZGK A;  1JGG A;  5IT3 A;  3CC2 I;  2CS3 A;  3CUO A;  2X51 A;  4DW6 A;  1RKT A;  2KIU A;  4I0A A;  1FLI A;  3RYR A;  5GPC A;  4M3D A;  3FK6 A;  1FMW A;  2ISY A;  5ILV A;  1Z7L A;  2W7N A;  1FSE A;  5D6E A;  1A5J A;  5LLQ A;  1QPM A;  3BR5 A;  4AVP A;  3BG5 A;  5J1R A;  1TWC J;  2P6T A;  5FO5 A;  2IW5 A;  1TTY A;  4G6T B;  2FQ3 A;  2NS0 A;  2EA2 A;  5TIS C;  1XMK A;  2V26 A;  1EV7 A;  4MFE A;  2XAH A;  1E3H A;  5M5Y J;  2CUE A;  3WE3 A;  1R4M B;  2QSG X;  2R3S A;  1UJ8 A;  3HKZ N;  1BR1 A;  2L4M A;  2E71 A;  2M87 A;  3DTK A;  5DD8 A;  4F55 A;  1X4O A;  2MD5 A;  1GT0 C;  1J09 A;  2RQP A;  2RNJ A;  2XRL A;  3H36 A;  4XN3 A;  5LGT A;  3WU1 B;  2P5L C;  3ELK A;  2EIN H;  4XNF A;  4LOC A;  3SEQ A;  3D0S A;  2HDW A;  3HSR A;  3W2V A;  1YIJ I;  3HSE A;  1IN7 A;  4KIS A;  4JP0 A;  2B63 J;  5LHI A;  2BGC A;  1P7I A;  4HYE A;  2NVU B;  3I59 B;  1FBU A;  1R1T A;  1B1B A;  1CGP A;  3ZQC A;  2VBX A;  2MSY A;  3L00 A;  2E1M C;  3RDI A;  3MZY A;  4D5C A;  5DYM A;  2DA3 A;  3ZXS A;  1QHG A;  3SHF A;  1OCP A;  3DP7 A;  4BE2 A;  1MBJ A;  1PP7 U;  2AXL A;  2UV1 A;  4FHT A;  3BG6 A;  4MTE A;  5D5U B;  2OA4 A;  2Y0S A;  3F0C A;  5DCM A;  2K3F A;  1NG6 A;  3M9A A;  2JQ7 A;  4G7H F;  1LQ1 A;  3KE2 A;  3V8K A;  2NNY A;  4RDU A;  1Y6I A;  4U87 A;  3CO7 C;  1X1C A;  3PNV A;  4P55 A;  4EJO A;  5E1X A;  4A3J J;  2FBH A;  3GTP J;  2NVY J;  2BY1 A;  2PN6 A;  3R0A A;  3FX3 A;  4L9V A;  4YEJ A;  5EDN A;  3ZQL A;  3S1M J;  3T1B A;  4M6V A;  2JN6 A;  4LIU A;  3W6K B;  4RMN A;  3ERE D;  1JUP A;  3EET A;  4U7B A;  5KAF C;  1MJB A;  2XF5 A;  3J80 K;  3B6A A;  1JKR C;  2V79 A;  2HGC A;  1J5Y A;  2HZD A;  2BW3 A;  2HXI A;  1WCM J;  3MKZ A;  5CVJ A;  1YIT I;  1XGM A;  1LUJ B;  5IOY A;  2VJ5 A;  1BI0 A;  2AQF A;  3DQV C;  1EH6 A;  2DYS H;  2STW A;  2Y30 A;  2ESN A;  2KIQ A;  2NRA C;  2G7U A;  3U21 A;  4OWR B;  3P9I A;  4A0Y A;  3K9T A;  4GFB A;  4B44 A;  3QOE A;  3S3M A;  1UMQ A;  2WC2 A;  1ORK A;  1IC8 A;  2K5C A;  1YG2 A;  3RJP A;  5C4J J;  1IO2 A;  2R5Y B;  5HOO A;  3R61 A;  3CES A;  2DA4 A;  3GLX A;  3KP3 A;  3REO A;  3LSM A;  2O9L A;  2QEX I;  4Q47 A;  3I5U A;  4WXD A;  3OSG A;  4CIC A;  2W1O A;  5TJJ A;  1ETX A;  1M1E B;  1WPK A;  2ZKZ A;  5DCF A;  3HTS B;  2JA8 J;  3CCE I;  3CC4 I;  1WKM A;  4N9H A;  3K0L A;  1A04 A;  1BI1 A;  2L2O A;  1ZN2 A;  5J3L A;  4A3B J;  2CH0 A;  2AXT C;  3RI4 A;  5B3S H;  2JA2 A;  2CWE A;  2X0L A;  2CW7 A;  3NEU A;  5LEK A;  2XGD A;  3PFY A;  3AFH A;  2VL8 A;  3SEZ A;  3JRC A;  1ZG3 A;  4II3 A;  3H3Z A;  1UHS A;  1KON A;  1FJL A;  2FBI A;  2FE3 A;  2M1B A;  4F92 B;  1E0E A;  4PGG A;  2IPQ X;  2JK3 A;  4HX7 A;  4GYI A;  4R1H A;  4QLC U;  4UV9 A;  4A3G J;  5L3D A;  3FXQ A;  5GAH J;  3ZR8 X;  2NOJ B;  4C2U A;  1Y8Q B;  3KP4 A;  3FMS A;  3FXJ A;  2XVC A;  5FRO A;  1WI3 A;  3BTC A;  3BDD A;  1R5I D;  4HDV A;  1B9N A;  1TQM A;  1Z1D A;  2VE8 A;  5K5R A;  2WAQ A;  5JHF A;  4M3B A;  2CGP A;  5J40 A;  1JKP C;  3EUA A;  3H35 A;  3N97 A;  1GXQ A;  2DPD A;  1IRX A;  3BR1 A;  4DBR A;  2ZNY A;  5LEJ A;  3E5U A;  1ACI A;  2IBD A;  3BZ6 A;  3EUK L;  1MSF C;  1FIP A;  2RAE A;  1P4X A;  3V4G A;  3NAR A;  1ETW A;  1WJC A;  4QIW N;  4BHP A;  3OYM A;  4IXA A;  4F3Q A;  1FC3 A;  2IVM A;  5HDK A;  3TGN A;  5F1R A;  2TDX A;  1FYL A;  4LIT A;  1MBH A;  1XSV A;  4RGX A;  2EV6 A;  1VQP I;  3TP0 A;  3N4M A;  2PMH A;  1XDU A;  3K4N A;  2VB6 A;  4BQN A;  2NOG A;  1D5Y A;  2OQR A;  1E2X A;  5JLW A;  4LB5 A;  3D5L A;  2QBY A;  2EIM H;  1SAX A;  5KHD A;  1H0M A;  2OJE D;  1VFC A;  1B59 A;  2O5R A;  3GUD A;  3WTV C;  3LNQ A;  1IXC A;  1QVT A;  1XGO A;  2HQR A;  3DBL B;  5HLH A;  4G12 A;  3IRR A;  2W4S A;  1Z3X A;  3I64 A;  1CQT A;  2VJ4 A;  3A4C A;  1PUF B;  1MKM A;  1TP4 A;  3O8H A;  2HQ5 A;  3I4M J;  3K6G A;  4FTH A;  5L3F A;  2EZI A;  1KZH A;  2QZ8 A;  4S05 A;  2FU4 A;  2R7R A;  3AG1 H;  1XX5 A;  2DA1 A;  4D5F A;  3G4S I;  2FUG 2;  2XF6 A;  3SDB A;  3GEZ A;  4XBF A;  1T08 B;  2LKX A;  1OMI A;  2ME6 A;  4YFK F;  4AIH A;  4YIR X;  3BTI A;  3CME I;  2L9S A;  3KIO A;  3MKY B;  4UUT A;  1ZYR F;  1MBG A;  2CW0 F;  2DK5 A;  2ZSI B;  1LFU P;  2KIF A;  4OIP F;  1MDM A;  3L7W A;  4A3D J;  5FB2 A;  4ASN A;  3DF8 A;  4KIC A;  5IYC J;  2BZT A;  2MA3 A;  4M9X A;  3GTK J;  2DOE A;  3H5A A;  1HW5 A;  2RC4 A;  4JX4 A;  1D8J A;  3JSO A;  4XLC A;  1YS7 A;  3HJE A;  2L7F P;  4BL0 B;  3S8P A;  4DOZ A;  3WTS C;  3OYF A;  1YW7 A;  3OYK A;  1DDN A;  4GO1 A;  1FSH A;  4ZZL A;  3H1C A;  3CCQ I;  2DFI A;  4Y52 J;  4J19 A;  1L3L A;  1WH7 A;  2VI6 A;  5BNG A;  1MJA A;  3DEE A;  1R22 A;  2KFD A;  5H6R A;  2MH9 A;  2R93 J;  4A3L J;  1K6Y A;  1U8B A;  3WHC A;  2EBI A;  1UG2 A;  2ZFU A;  3CMY A;  2MD0 A;  4IRG A;  2VE9 A;  3HKZ A;  3GFM A;  2GQQ A;  2IA1 A;  5HS7 A;  1RPW A;  2P7V B;  5TGT A;  2OPT A;  3HUG A;  1GUU A;  2M5W A;  2XSJ C;  3KYC B;  1J59 A;  2W85 A;  4MIM A;  4ZZD A;  3OS2 A;  3LSJ A;  1AOY A;  4EJW A;  3D1N I;  1Z77 A;  4MTD A;  1KA8 A;  3HHH A;  4A93 J;  2O6G E;  1H9G A;  3LAJ A;  3LSI A;  3BQY A;  4A69 C;  3L2Q A;  5H2F C;  1HDP A;  3GLL A;  1WGX A;  3TW7 A;  1OPC A;  4M3E A;  4E7K A;  2Z99 A;  5IP6 A;  3W2W A;  1G3Y A;  3ZMZ A;  4PZJ A;  4G7O F;  2XGE A;  3FM5 A;  1RUN A;  4OIQ F;  2J5P A;  5DCM B;  4L9N A;  1C0W A;  2CV1 A;  1G3S A;  1Z7U A;  3HPH A;  2BY0 A;  2ZSH B;  1ETO A;  1T8I A;  3I0T A;  4I01 A;  3OYH A;  5D6F A;  3SJM A;  1K7A A;  1GV2 A;  1R23 A;  1JUS A;  2X4H A;  4I0B A;  1B8I A;  2QQ8 A;  4RGR A;  1IDY A;  5DS9 A;  3ECO A;  4UNO A;  2HOA A;  2WY8 Q;  3F8B A;  4ZYE A;  4WX9 A;  2OAZ A;  2XPU A;  3WU2 C;  3HOT A;  2FRH A;  2VBZ A;  4B43 A;  3B02 A;  4RB0 A;  3S14 J;  2BY2 A;  2E34 A;  3NWT A;  4IOC F;  2HZT A;  2IA2 A;  4B1R A;  3RIR A;  4ZH4 F;  2DFF A;  4JBA A;  4F52 A;  5IP9 J;  2FOW A;  3RPQ A;  3U9G A;  1BW6 A;  3A03 A;  1F5T A;  3A0B C;  2BW3 B;  3HRT A;  2IS2 A;  1U5T B;  2EIK H;  1FOW A;  1ZRE A;  2L7M P;  3E1S A;  2XAG A;  2JRT A;  4HA8 A;  2PI0 A;  1OR7 C;  1SC7 A;  3OYA A;  4DBQ A;  5EG0 A;  1MZB A;  2UUZ A;  1D1A A;  1W5C C;  2K9N A;  1O4X A;  1SFO J;  4XKV A;  2VXZ A;  3G1M A;  4ZYG A;  3I55 I;  2XAU A;  4XLP F;  2E2I J;  2XGC A;  3BPV A;  2VKV A;  3BG9 A;  3QOP A;  4ANJ A;  2L7K A;  1H88 C;  3KX2 A;  4P96 A;  4UVB A;  4WF2 A;  3ZPL A;  4L9J A;  3GWZ A;  2OUM A;  1FWZ A;  2CQN A;  1W5T A;  3HC7 A;  4BGD A;  4IF4 A;  3S17 J;  2L3D A;  1QVU A;  4H4K C;  5HDN A;  2WWY A;  1G3W A;  1K61 A;  4A3C J;  3VEP A;  1UEL B;  3PQJ A;  4HV6 A;  4M6X A;  4E4H A;  2Q2E A;  3C2H A;  2UXN A;  1SVO A;  3KP5 A;  5DV5 A;  3L2V A;  4G7Z F;  3LSP A;  1XG1 A;  2A6H F;  1J2X A;  5HLI A;  1UZC A;  5DM6 F;  3K4M A;  4CA0 A;  3LST A;  4XOP A;  2QKL B;  2E1C A;  5IOZ A;  2X9D A;  2XRN A;  3WOD F;  4YII A;  5GTH C;  5E3O A;  3M07 A;  4HX4 A;  1UFM A;  3OYJ A;  2LRD A;  1GLN A;  4DYR A;  4AD9 A;  3F22 A;  3A02 A;  5GPA A;  4FT8 A;  2A3S A;  1AU7 A;  2E7X A;  2QQ9 A;  4FX0 A;  3QYF A;  4JQF A;  3HOZ J;  4J00 A;  1OCT C;  4QPQ A;  2KDZ A;  3SXY A;  3IP4 B;  1FT9 A;  1UG0 A;  4OMY A;  3K2Z A;  3LWF A;  2Z2S B;  5DDG A;  2CMP A;  4IPA A;  3G71 I;  1U2W A;  3CJT B;  1EH8 A;  2I10 A;  3RKX A;  3D5R C;  5B1A H;  4AYB N;  2EFO A;  1YS6 A;  3K70 D;  3K4C A;  3ASO H;  2FX0 A;  4UHT A;  4E6K G;  3JTH A;  4NC8 A;  1RR8 C;  5JVG F;  2QM3 A;  2FXA A;  4PJM A;  4M3F A;  3HBL A;  1BA5 A;  2IP2 A;  2ZME A;  4HBL A;  3ZQI A;  4RB1 A;  2QBY B;  3Q0W A;  3NAU A;  4MHG A;  1RR7 A;  5LGU A;  1SVL A;  4CCK A;  2HOT A;  2HVR A;  4ESJ A;  2F4O B;  1LE8 A;  2KIM A;  2LDU A;  1MBF A;  2L02 A;  1PP8 F;  4KIF A;  1ZTR A;  2H27 A;  1OIS A;  1R71 A;  3BRO A;  1JJ6 C;  1UAA A;  5IT9 K;  5DTD A;  2G9W A;  1XB4 A;  3DV8 A;  2ECC A;  3H3U A;  2Q8K A;  2X1E A;  2XAF A;  4LLN A;  2K4B A;  2DA6 A;  2DQL A;  4GXO A;  3LSH A;  3S1N J;  2E19 A;  3BWG A;  4PCQ A;  4ZYA A;  3DTE A;  5GP9 A;  4FX4 A;  2M2E A;  2H1K A;  2LP0 A;  1SVM A;  2EQR A;  3AG2 H;  3EUH C;  4CCJ A;  3BOQ A;  3OYC A;  3W2A A;  3HM5 A;  5JHU A;  2IRF G;  5B66 C;  1MDM B;  2DI3 A;  2N8G A;  4J01 A;  4AC0 A;  3OYD A;  1TT0 A;  3QRF F;  4OAZ A;  2GIZ A;  3C2B A;  4W97 A;  2UXX A;  5IY5 H;  2JSP A;  1MD0 A;  3TW6 A;  2KL4 A;  1WH5 A;  1REP C;  2A07 F;  1LFB A;  4IHX A;  1JTY A;  5ILU A;  1BC8 C;  4F7Z A;  4KN7 X;  1LPQ A;  2H1L A;  4NDL A;  3HOS A;  1UST A;  2VAS A;  4YRV A;  2BHY A;  1WJA A;  2DO7 A;  1XGS A;  2VKH A;  1IZ1 A;  2GA2 A;  5E20 A;  1WJD A;  4QSH A;  5ICC A;  3IUO A;  2EZK A;  4AVZ A;  2VQL A;  5FRN A;  1BBY A;  5GAE J;  2GXB A;  1BJA A;  3SZT A;  1V4R A;  2PJP A;  3BJ6 A;  4DQ2 A;  2F5F A;  3HUG B;  3GBG A;  2R7W A;  3PSF A;  1W1W E;  1DQU A;  3SYT A;  4A2U A;  1P92 A;  2FNA A;  3GFJ A;  3WG9 A;  1D0Y A;  1ZQ3 P;  3GTG J;  2OTJ I;  3I9V 2;  5LD2 C;  1BI2 A;  4A6D A;  2X85 A;  2IJL A;  4RS8 A;  3DXJ F;  1X2N A;  5BPD A;  2ETH A;  2CG4 A;  1RNL A;  5FJ8 J;  5BMZ A;  1WJE A;  1X19 A;  3FXM A;  2VXD A;  4UB6 C;  4DIQ A;  3FXO A;  5K7F A;  1O3S A;  4RBO A;  1ETV A;  3KZZ A;  3TKY A;  4BE0 A;  3OYG A;  3RTR A;  1YW8 A;  4BJ6 C;  3V7S A;  1X3Z B;  2LKS A;  1YFH A;  1H8A C;  2OV7 A;  2HDD A;  2FMY A;  1S29 A;  2BVM A;  2VLA A;  1Y0N A;  3ZMV A;  2GIV A;  2MAB A;  3BR0 A;  1QHH D;  2H8W A;  2ZJQ F;  1X1P A;  2X6W A;  4XIC A;  1GHC A;  1G4D A;  1U6G A;  1S72 I;  4Q48 A;  1YO5 C;  1DPU A;  2V6E A;  2CFO A;  3FIS A;  1S7E A;  3ASN H;  2Y75 A;  3BLY A;  2E35 A;  4XKB A;  4MQV A;  2H94 A;  2D2W A;  3BJO A;  1YTY A;  4NC7 A;  2DMQ A;  4MEY F;  2DTZ A;  1Z6R A;  2OD5 A;  4O3M A;  1EF4 A;  2Y48 A;  4ZTJ A;  3LMM A;  3F6O A;  1XMA A;  2CFX A;  3ZQQ A;  1MND A;  2ID3 A;  5EJC A;  4Z2Y A;  1HBX G;  5JLX A;  5EEH A;  3ERM A;  2DT7 B;  4YG2 F;  4XRS A;  3WTX C;  3KYD B;  1V5G A;  3FM3 A;  4IQ4 A;  3TED A;  2K40 A;  3DWL E;  4XSX F;  5EG0 B;  5FLX Z;  3JW4 A;  2M4K A;  4NNJ A;  1T0F C;  2P8T A;  1QPI A;  3QYB A;  3S93 A;  5CJ9 A;  2LKP A;  4EAT A;  4EJT A;  2Y31 A;  2Y9Y A;  5ICF A;  1U9O A;  3PSI A;  3NWS A;  1XPX A;  3MZH A;  1RUO A;  2JZY A;  4TV7 A;  4F93 B;  4A3K J;  3GXO A;  3LOC A;  1X1D A;  2XAQ A;  1TWF J;  4HW0 A;  3V7C A;  3T0Y A;  4B47 A;  1B9M A;  2IS4 A;  1F9N A;  4JK1 X;  3VB2 A;  3P9K A;  5D5X B;  1XC5 A;  2WTE A;  2BYV E;  3BT9 A;  4B8X A;  4ESB A;  2EV5 A;  2AS5 F;  2QUF A;  4BU2 A;  3L2W A;  3JTG A;  4BKX A;  1AA7 A;  3ISP A;  3EDP A;  2DDA A;  2I5U A;  2K7L A;  3F8N A;  2AHQ A;  2RDP A;  3GX4 X;  5FLV A;  1A31 A;  4L0Z B;  1UB9 A;  1USS A;  3J80 Z;  2R7Q A;  3HDD A;  2LFB A;  2YR2 A;  2OCE A;  5FLX K;  4X1E A;  3OS1 A;  1V5E A;  4RAY A;  2KLO A;  5J4V A;  3FWE A;  3KLO A;  4LG3 A;  1MH4 A;  4BAC A;  2NYX A;  4KMU X;  4KJZ A;  4WCG A;  1FTT A;  4F91 B;  5F0F A;  3E6B A;  4ZDL A;  2D5V A;  2HS5 A;  1X3W B;  4M6Y A;  5J8C A;  2G7H A;  3PUF A;  3E6M A;  1RI7 A;  3ROU A;  1GV5 A;  2FNP A;  2ID6 A;  3X2Q H;  1LEB A;  3V42 A;  2CUJ A;  5LRR A;  5CVU A;  2KT0 A;  5LHH A;  4HF0 A;  3VWB A;  3GTL J;  4U0Y A;  3E6C C;  1G3T A;  2LRE A;  2JPB A;  5FKN A;  5EGO A;  2L9N A;  3ABT A;  3DPT A;  4PSW A;  4RGS A;  3VSK A;  1X4P A;  1E3O C;  2XAS A;  3GZ6 A;  1QGP A;  2MH2 A;  3FKI J;  2MC3 A;  5BOX A;  4AYB A;  1HA8 A;  5GAD J;  3K4B A;  3FMR A;  2BXY A;  5DM7 F;  1OJL A;  2X48 A;  3IHU A;  5FFX A;  2D1H A;  2VON A;  4C2T A;  1EKE A;  2JUG A;  1JT0 A;  4A5M A;  1IN8 A;  2ZME B;  3ZMU A;  3JRD A;  5FRM A;  1VQM I;  2YU9 J;  1YJ9 I;  2DQR A;  3RKY A;  3GVA A;  3ZP5 A;  2P5K A;  1OKR A;  3CDL A;  1P4A A;  1LE8 B;  3F72 A;  2PG4 A;  3FHZ A;  1XGN A;  2V1N A;  4I98 B;  3VYS B;  4X6A J;  4MQ9 F;  1RC9 A;  3GME A;  4ZTF A;  4HST A;  4P5O A;  1LDJ A;  3KP2 A;  1HOM A;  3DLL F;  1R4N B;  5LRS A;  4XKW A;  1I1G A;  1D0Z A;  4XLE A;  5JFR A;  4G9Y A;  4PSX A;  1Z05 A;  4MEX F;  3HB9 A;  2DTR A;  5K1Y A;  1FP1 D;  1MBE A;  4IRI A;  2AQE A;  1TL8 A;  2R4G A;  3HSF A;  1Q1V A;  1XSX A;  4M72 A;  2DOD A;  3BTJ A;  3SQN A;  4V19 K;  5A2Q K;  1OCZ H;  3ZOB A;  2PFB A;  3ABK H;  2XSD C;  2M8G X;  2V4J C;  4YEL A;  1TNS A;  2KP6 A;  3IV5 A;  4L0Y B;  3E0J B;  4M9Z A;  2MW8 A;  3H5R A;  2X6Y A;  3TL4 X;  1VND A;  5AON A;  4HEA 2;  3VFZ A;  2HYF A;  2KHM A;  1JKQ C;  3M4O J;  3ZRG A;  4LLG F;  1Y1V J;  1ULY A;  1MH3 A;  4OU0 A;  2GOX B;  1O7L A;  2LK2 A;  1YE9 A;  4ZJZ A;  2QSH X;  4QTR A;  4ZC3 A;  1XD7 A;  2HTS A;  1ZHF A;  3HOX J;  2JA5 J;  4C30 A;  2VOO A;  4PGH A;  1W36 C;  4Z6Y A;  2V7F A;  5FFZ A;  1PDN C;  2M7B A;  2BVL A;  3O6B B;  1DU0 A;  2RKH A;  1BC7 C;  2L7Z A;  2LBF A;  2VJI A;  3FXR A;  5F6F A;  5K7H A;  1D5V A;  4KYW A;  1DGR M;  4K2E A;  2E5Z A;  2HOE A;  3SZG A;  3FXK A;  2IGO A;  1D0X A;  4M9S A;  1KYW A;  4RM2 A;  1WFX A;  1R49 A;  1ZGA A;  3QPL A;  3TP3 A;  1NHA A;  3MWM A;  4XLN F;  3V8J A;  2VKD A;  2XKP A;  3OWT A;  3T5X A;  3GFI A;  4NB5 A;  3TDZ C;  2ACJ A;  3Q9V A;  1YYV A;  4EVI A;  2LD5 A;  1MMS A;  3GFL A;  3LFU A;  1U5T C;  1O3R A;  5EZG A;  4ENN A;  3D5S C;  4BDZ A;  5M5W J;  3K4K A;  2EIJ H;  3A0H C;  2ZNZ A;  2GLO A;  5E17 F;  1W0U A;  3ECH A;  4M71 A;  1IRZ A;  2QEN A;  3BY6 A;  3CQZ J;  3CJQ B;  3H9Q A;  5J4Y A;  2EFP A;  3E3V A;  3EYI A;  3MD2 A;  3IH4 A;  2E1M B;  4E7I A;  3I71 A;  4M73 A;  1A35 A;  3ZQF A;  1FYK A;  2A69 F;  4CYC A;  2IGK A;  4B4C A;  4I09 A;  2LF8 A;  2HPI A;  1HF0 A;  3FDY A;  5TRD A;  4UUV A;  3BP8 A;  4HRI A;  4HV5 A;  4XLH A;  2DW4 A;  2NXN B;  1WJB A;  4DYC A;  2R7O A;  4A3E J;  2VBW A;  2HU9 A;  1HDD C;  1D1C A;  2MG4 A;  1FBQ A;  1RKW A;  4A0X A;  3S2D J;  1HCR A;  3S2H J;  2WV1 A;  3O3K A;  2P6S A;  2CV0 A;  1F43 A;  1DU6 A;  2EA4 A;  4C9Y A;  4C3J J;  2GBY A;  5C3E J;  3HL2 A;  2Z3Y A;  3OYL A;  5LFA A;  2PMZ N;  1ETY A;  3W3C A;  2Q0O A;  5JR3 A;  2K85 A;  1QBJ A;  3ZN1 A;  1LKX A;  3QP6 A;  3DCF A;  1LVA A;  4G8X A;  1Z67 A;  1VF9 A;  4A3M J;  2LF7 A;  1ZR4 A;  4HF2 A;  1YRN A;  2NAZ A;  1OCO H;  1R9T J;  2FOK A;  2R7U A;  3E97 A;  2R7T A;  4V2F A;  5E8G A;  3PFI A;  2E60 A;  1MSE C;  1J7K A;  1OR7 A;  1OYY A;  1LFP A;  1RET A;  5IYD J;  1ZAO A;  4KIT B;  3IWF A;  4OIO F;  2HVQ A;  3GO5 A;  3QU3 A;  1V55 H;  2XB0 X;  1F1Z A;  3B6C A;  3I54 A;  2FF4 A;  2HQA A;  1YI2 I;  1MMN A;  2OZU A;  3U1K A;  2ZXW H;  1W7P A;  3CDH A;  3IAS 2;  2EZL A;  3TBI A;  3FHN A;  2CRG A;  1YHQ I;  2R92 J;  1AKH A;  2ZFW A;  2GXA A;  1CF7 A;  5E3N A;  4OIN F;  1YJW I;  4EEF G;  2IGM A;  2LY1 A;  2A6T A;  3K2A A;  4RAF A;  2DYR H;  1T38 A;  1A6I A;  2DK8 A;  1VQ8 I;  4KUM A;  2DXI A;  4UXN A;  3NQO A;  1BIA A;  3V8L A;  3MZ8 A;  3DKY A;  1I3Q J;  2QLZ A;  4CXF A;  4XLF A;  5CPR B;  4HX8 A;  5C44 J;  2GZW A;  1ODD A;  3M8F A;  3UKG A;  3WE2 A;  1YX5 A;  3IAM 2;  3HGY A;  3HRU A;  1Z9C A;  1W5S A;  2NS7 A;  3JSP A;  1TT5 B;  4Y4R A;  1DP7 P;  3ML6 A;  3S1R J;  3DPU A;  5M3M J;  2NS8 A;  3Q9S A;  1GVJ A;  2HXO A;  3OYB A;  2R5Z A;  1TQI A;  4S04 A;  2W84 A;  4ZYH A;  3GTM J;  4N0B A;  4L9T A;  2LLK A;  3C18 A;  3OIO A;  2ZO4 A;  5DD4 A;  5FKM A;  4RM3 A;  3CCY A;  2R7D A;  4N4O B;  3OOP A;  2DOF A;  1IW7 F;  3M8E A;  4ZDO A;  4IRH A;  2A05 A;  3K7A J;  2O8X A;  1S6L A;  4DZJ A;  4IHT A;  3V7R A;  1ON2 A;  1OFC X;  3CO6 C;  5EGO B;  1WI9 A;  2M0C A;  1FZP B;  1PUE E;  4PDK A;  1SFU A;  1B72 A;  5J6X A;  2DT5 A;  2PX9 A;  2VC1 A;  1BR4 A;  2CQK A;  2PEX A;  4CO8 A;  4BAY A;  4BXF A;  3F21 A;  2LOO A;  4CYD A;  3HEF A;  5LBQ A;  3WTY C;  1G59 A;  1IAW A;  2RN7 A;  1J0R A;  2CU7 A;  1J75 A;  2OZ6 A;  5J47 A;  1NG7 A;  4Y13 A;  5D5V B;  1LB2 A;  3P9C A;  4OAY A;  3C1D A;  1E3P A;  3Q3S A;  3ABM H;  5F04 A;  5KCM A;  2X6O A;  2XPW A;  3QP5 A;  3WHB A;  4BXU A;  5BPI A;  1TQP A;  3WG7 H;  2QGU A;  2ZBK A;  2WBM A;  2DOA A;  2YPR A;  4GYG A;  3WTT C;  4QWQ A;  3CZ6 A;  3FBN B;  1IGN A;  1KYZ A;  2M45 A;  4XL9 A;  5FKK A;  4OIR F;  3R60 A;  4BEH A;  1KQ0 A;  3CUQ A;  5K5O A;  1F36 A;  3ESW B;  2DDB A;  3ZMT A;  4FET A;  1QZE A;  3EYY A;  4UB8 C;  5AIP A;  3CP8 A;  3VYR B;  3KEQ A;  2CSO A;  2BOL A;  3K4J A;  1X2M A;  2L4A A;  2NVQ J;  1DPR A;  1SFE A;  1P9Q C;  4A0Z A;  2OTL I;  3M1E A;  3CCV I;  3PJR A;  3G1O A;  5CYV A;  3AL0 C;  1W7P D;  2EK5 A;  5ILS A;  4ETS A;  3JRH A;  5FD6 A;  3MMY B;  4PUS A;  5L3E A;  4LLL A;  2C6Y A;  3IWZ A;  3EUH A;  2Z33 A;  2BV6 A;  2V9P A;  1XDS A;  2ZC2 A;  3JRF A;  1P4W A;  2V6C A;  1BOB A;  1VQN I;  3DFG A;  5AIQ A;  1S7O A;  2WAD A;  4I6Z A;  3OYN A;  4ZDP A;  1QU3 A;  2HVS A;  2EPF A;  5CVI A;  2ICW G;  1K4T A;  4E7J A;  2LR8 A;  3H92 A;  3RZD J;  4ENM A;  5DUK A;  1OYI A;  1HKS A;  3BTL A;  4HG2 A;  5JVT A;  1S5L C;  3FIW A;  5IT9 Z;  3S2W A;  1KU3 A;  1STZ A;  4GCV A;  1IUF A;  4RA2 A;  2LBF B;  2TCT A;  5E1Z B;  3KEY A;  2JSC A;  1IG7 A;  3J7A O;  2ZB9 A;  2XKO A;  3IC7 A;  4MGR A;  2L5Q A;  4FAS D;  3BG3 A;  1LEA A;  2YSR A;  3RKQ A;  2NVT J;  4IO9 F;  2VBY A;  4Y7N J;  2VQH A;  1K78 A;  3OIQ A;  2OBP A;  2FQ4 A;  4LB6 B;  2P0W A;  4U0W A;  1IN6 A;  1SMT A;  4LMY A;  2UZK A;  4O5V A;  2A61 A;  2F5D A;  4LG0 A;  2RVC A;  2DCE A;  1K83 J;  4CDG A;  3A01 A;  1B6A A;  3CCR I;  2K9S A;  2LH9 A;  2OC6 A;  5IP7 J;  3MKW B;  4BBS J;  2F4M B;  3HZJ A;  1TNT A;  2GOM A;  2P5V A;  2XGX A;  5K5Q A;  3FXU A;  3HOU J;  1BW5 A;  1SD5 A;  2O7O A;  1O7F A;  2V1X A;  4CYC B;  3ZCO A;  3MFK A;  4IL6 C;  1I6X A;  2KQR A;  2O0Y A;  3GTJ J;  3WGI A;  4AIJ A;  1AHD P;  4NC6 A;  2R5Y A;  3PIO F;  5EZH A;  1HW1 A;  1UHW A;  2NVX J;  1R36 A;  1D1B A;  5DEQ A;  2K9L A;  2ZJR F;  1ZG1 A;  3CCM I;  4L18 B;  3LA7 A;  2FD5 A;  4IHY A;  1ZKG A;  5E8I A;  2Z1D A;  1Q1H A;  3CJR B;  4OMZ A;  4E7S A;  2DU9 A;  3I53 A;  3FXL A;  4IKF A;  1T56 A;  2JA7 J;  3F8F A;  2PMZ A;  2GWR A;  2DN0 A;  1Y1W J;  1YX3 A;  2R7Z J;  2P81 A;  3KET A;  4XMY A;  4XRS G;  4C2M J;  1YRN B;  3QQA A;  4AIK A;  5EF6 A;  3E6D A;  1Z0X A;  2YU3 A;  4LJZ F;  2HKX A;  2VT3 A;  1R1U A;  4U7D A;  4UY8 I;  1JHF A;  1ETK A;  5F0H A;  3RCO A;  2HR3 A;  1R1V A;  2EH3 A;  3GW2 A;  1ZRD A;  4U0V A;  2IXS A;  5BS6 A;  4HQE A;  1DGW Y;  1D3Y A;  3KLN A;  4YFN F;  1W4M A;  5D4R A;  1QNT A;  3ABU A;  4HF1 A;  4IHV A;  3HOW J;  5KNL A;  2WA0 A;  2MFZ A;  1W7P B;  3J7Z I;  1WWX A;  2HKO A;  5E1W A;  4DGW B;  3H9J A;  9ANT A;  4HNT A;  3E7L A;  1AKH B;  1MNE A;  1CF7 B;  3GYH X;  1FY7 A;  4BY7 J;  3UR3 C;  3RQI A;  3ZQH A;  3LSR A;  2Y2Z A;  1Z21 A;  4HSR A;  4N9I A;  5GTI C;  2CJJ A;  4I99 C;  2LVS A;  5FLM J;  1WZ2 A;  5J1U A;  1IF1 A;  1XTA A;  3CDI A;  1X3U A;  2ECB A;  2JPC A;  2VUM J;  3A2K A;  4GDF A; 
#chains in the Genus database with same CATH homology
 5HLG A;  3MCZ A;  2K4J A;  5CLS A;  2P7C B;  5FD5 A;  1FX7 A;  4KIB A;  1YLF A;  2LNB A;  1P6R A;  1YQA A;  1QQI A;  3LFK A;  1LJ9 A;  3KP7 A;  3TO9 A;  1HXD A;  2W25 A;  4EM0 B;  2VOD A;  5ED4 A;  1IRF A;  3F8M A;  2COM A;  2EB7 A;  1K6O A;  2KJC A;  1I1S A;  4XRF A;  5L3C A;  2KJB A;  4O6J A;  4EJU A;  1P2F A;  4ON0 A;  3C7J A;  1O3T A;  3HIF A;  4E70 A;  4LK0 F;  4A5N A;  3K1N A;  3TQN A;  4A12 A;  2Z5U A;  3KP6 A;  4KA4 A;  3HHG A;  3J81 Z;  1T6S A;  2A5Y B;  2V1U A;  3BPX A;  3L09 A;  3OV8 A;  4U88 A;  4L5I A;  1KU7 A;  1FOK A;  4ENJ A;  3CUQ B;  3GF2 A;  2E7W A;  3PQK A;  5L3B A;  3HRS A;  2D45 A;  1YW9 A;  3TO7 A;  4YFX F;  4BHB A;  2HEO A;  4KT5 C;  5ICG A;  5HVQ C;  1G6N A;  1ZG5 A;  1T2K A;  4I7H A;  4ESF A;  2ELH A;  1BM9 A;  3J81 K;  5HS9 A;  1Z6T A;  1V3F A;  4Y15 A;  4Q5S F;  2Z9O A;  4KMF A;  4BNC A;  3QU6 A;  1SD6 A;  2YX7 A;  5H20 A;  1QO0 D;  3K69 A;  4XSZ F;  1B4A A;  3JAM Z;  2FA5 A;  4KN4 X;  4UVA A;  4LGW A;  3KCC A;  1JXS A;  1XSD A;  2WV0 A;  2A6E F;  2FSW A;  5A2Q Z;  2O61 A;  2O3F A;  1I5Z A;  2PMU A;  1K78 B;  1Z91 A;  4ENK A;  1RZ4 A;  1S7A A;  2OQG A;  1BN5 A;  1SFX A;  3HYI A;  3O2P E;  1XCB A;  4LG0 B;  2K27 A;  2F2E A;  4GGG A;  1U5T A;  3TOB A;  3JAM K;  1O57 A;  2ZJ2 A;  1IRG A;  2ZXJ A;  1LNW A;  2KRF A;  3EQL F;  5EEG A;  1HST A;  1WRJ A;  2MBF A;  4EM1 A;  2EWN A;  2FEZ A;  2EJR A;  1VTN C;  3I58 A;  1Y0U A;  1HKT A;  3MQ0 A;  2BBY A;  2BE5 F;  3DEU A;  1XCV A;  4Q4Z F;  2M8E A;  4P9F A;  4B09 A;  2DLL A;  1GXP A;  2HYG D;  1ZGJ A;  3C3W A;  2RGV A;  5ICE A;  2CO5 A;  4ZYD A;  2PBI A;  5HS8 A;  1S3J A;  1AWC A;  2R7F A;  2XAJ A;  2GXG A;  4OOI A;  4BHC A;  1BIB A;  2A68 F;  2JTV A;  3HRM A;  1R7J A;  3WTU C;  1ZLJ A;  4M74 A;  1FNN A;  3U1D A;  3E5Q A;  2MLG A;  4HZF A;  4YIF A;  1H9T A;  4HDU A;  3ULQ B;  1ZAR A;  3U2R A;  5D5W B;  1R5G A;  4WXC A;  3COA C;  2D1V A;  2DPU A;  2H6C A;  1L0O C;  3RKW A;  3RYP A;  1RIO H;  3FMQ A;  3E5X A;  3P7N A;  5E18 F;  1OYW A;  2KKO A;  3R6S A;  3F6V A;  2W24 A;  5D8L B;  4EJV A;  1FPQ A;  2HQN A;  3TDU C;  2O03 A;  1FP2 A;  4A6E A;  1ZLK A;  1IN5 A;  3NRV A;  4HLY A;  2HWV A;  2ISZ A;  3CJN A;  4G6D A;  1KQ8 A;  2IA0 A;  1WQ2 A;  2QQB A;  2HDC A;  4WXH A;  4RB2 C;  5H6Q A;  4I02 A;  3K1M A;  2HFH A;  4EMS A;  5LHG A;  1KQ9 A;  1SD4 A;  4RB3 C;  4LD5 A;  2K02 A;  2EV0 A;  3F23 A;  4NQW A;  2Y0M A;  3DPL C;  4HLX A;  5KK1 A;  5CVV A;  1F4K A;  3KZY A;  3L9F A;  3QAH A;  5DUI A;  1TLH B;  2EFQ A;  5BQT A;  1WSU A;  1TW2 A;  3LA2 A;  3G3Z A;  1U78 A;  2V9V A;  3R0J A;  4WK8 F;  1S8N A;  4L5J A;  3LAP A;  2EFN A;  1R5H A;  2NNN A;  4HAM A;  2VT2 A;  3T8R A;  1KU9 A;  1IXS B;  5D8K B;  2VC0 A;  2UWM A;  3FZV A;  2PLY A;  1U3E M;  1BI3 A;  2GA1 A;  3B73 A;  1O3Q A;  4G94 A;  4WWC A;  3IRQ A;  4NHJ A;  4KFC A;  2H6B A;  2ADU A;  4MNU A;  1UCR A;  2LSO A;  3QPH A;  1IXR C;  4UVC A;  1HW2 A;  2QYO A;  4HOB A;  1ZRF A;  4IJA A;  3ZN0 A;  2F5E A;  1YIO A;  4CZZ A;  3WTW C;  2F5C A;  2CYY A;  2DAO A;  3IKV A;  4LK1 F;  2B0L A;  1ON1 A;  4Y17 A;  3LA3 A;  1XN7 A;  3SFZ A;  3KFW X;  1ONV A;  4EQQ A;  5F64 A;  1TBX A;  3ZMS A;  2EFW A;  3WU0 A;  3F3X A;  2XRO A;  4P9U A;  5JI6 A;  2XV4 S;  2XIG A;  4G6Q A;  3KEO A;  2P4W A;  2V1D A;  2GAU A;  2W57 A;  3I59 A;  3WGG A;  2PQ8 A;  4H0E A;  3Q5F A;  1SMY F;  4KIG A;  3AAF A;  3ZMD A;  5KVR A;  4DNC A;  2XHK A;  3M7G A;  4IHS A;  3R4K A;  2QWW A;  5ERI A;  3WTZ A;  1JE8 A;  4RAZ A;  1KU2 A;  1UHM A;  2STT A;  1QZZ A;  2L01 A;  3CLO A;  3T8T A;  5FGM A;  2E1N A;  2L54 A;  1E17 A;  2ESH A;  3TOA A;  4LFU A;  4EV0 A;  1D8K A;  5D4S A;  1EH7 A;  2MLK A;  4KDP A;  1K79 A;  4EM2 A;  4EGY A;  1MJ9 A;  6PAX A;  2J5O A;  1U8R A;  2IT0 A;  3I4P A;  1FBS A;  4CGZ A;  3HTU A;  3RPU A;  4BQA A;  1HKQ A;  3CUQ C;  3L2C A;  4RGU A;  1DUX C;  3W6J B;  3TO6 A;  3LQR A;  2H09 A;  3QPT A;  3SZP A;  1T98 A;  4R8H A;  1JHH A;  1R00 A;  1R58 A;  3VOD A;  3MAJ A;  3IL2 A;  4EGZ A;  4IVN A;  2OU2 A;  2XUB A;  3MEX A;  1JGS A;  1QZY A;  1T0F A;  3FF5 A;  1HQC A;  3VOE A;  4KNY A;  2K86 A;  1BOA A;  3K1P A;  3G73 A;  4AWX B;  2YX4 A;  1LDD A;  3IKT A;  1IN4 A;  1J9I A;  3CTA A;  1ZH5 A;  5LGN A;  4HQM A;  2FML A;  2HTJ A;  1TW3 A;  1T39 A;  2QQA A;  1I27 A;  5HDG A;  3ZQ7 A;  4D0P A;  4I2O A;  1HSJ A;  1LDK B;  1FYM A;  3DKW A;  2RV8 A;  3F8C A;  2QVO A;  2VN2 A;  5L3G A;  3BJA A;  2ZCW A;  2BEO A;  2M30 A;  2DBB A;  4CHU A;  2FBK A;  5J8F A;  1MGT A;  2VOP A;  4R79 A;  1ZRC A;  3WGH A;  1IUY A;  3LQQ A;  5CVR A;  4UV8 A;  2JT1 A;  4BYY A;  3GZ5 A;  1SD7 A;  1KGS A;  4BH9 A;  5IT3 A;  3CUO A;  2KIU A;  4I0A A;  1FLI A;  3RYR A;  5ILV A;  2ISY A;  1FSE A;  5D6E A;  5LLQ A;  1QPM A;  4AVP A;  2P6T A;  5FO5 A;  2IW5 A;  1TTY A;  2FQ3 A;  2NS0 A;  2EA2 A;  1XMK A;  1EV7 A;  2XAH A;  3WE3 A;  2R3S A;  2L4M A;  2M87 A;  5DD8 A;  2MD5 A;  2RQP A;  2RNJ A;  5LGT A;  3WU1 B;  2P5L C;  3ELK A;  3D0S A;  3HSR A;  3HSE A;  1IN7 A;  5LHI A;  2BGC A;  4HYE A;  3I59 B;  1FBU A;  1R1T A;  1B1B A;  1CGP A;  2VBX A;  3L00 A;  3RDI A;  3MZY A;  5DYM A;  3SHF A;  3DP7 A;  1PP7 U;  2AXL A;  4MTE A;  4FHT A;  5D5U B;  2OA4 A;  5DCM A;  3M9A A;  4G7H F;  1LQ1 A;  3KE2 A;  3V8K A;  2NNY A;  3CO7 C;  4P55 A;  4EJO A;  5E1X A;  2FBH A;  2PN6 A;  3R0A A;  4L9V A;  3FX3 A;  3T1B A;  3W6K B;  3ERE D;  3EET A;  4U7B A;  1MJB A;  3J80 K;  2V79 A;  2HGC A;  1J5Y A;  5CVJ A;  1XGM A;  1BI0 A;  3DQV C;  1EH6 A;  2STW A;  2ESN A;  2NRA C;  2G7U A;  3P9I A;  4A0Y A;  3K9T A;  2WC2 A;  1YG2 A;  3RJP A;  5HOO A;  3R61 A;  3GLX A;  3KP3 A;  3REO A;  4Q47 A;  3I5U A;  4WXD A;  4CIC A;  5TJJ A;  3HTS B;  2ZKZ A;  5DCF A;  1WKM A;  4N9H A;  3K0L A;  1A04 A;  1BI1 A;  1ZN2 A;  3RI4 A;  2X0L A;  2CWE A;  3NEU A;  5LEK A;  1ZG3 A;  3H3Z A;  2FBI A;  2FE3 A;  2M1B A;  4PGG A;  2IPQ X;  4HX7 A;  4GYI A;  4R1H A;  4QLC U;  4UV9 A;  5L3D A;  3FXQ A;  3KP4 A;  3FMS A;  2XVC A;  3BDD A;  4HDV A;  1B9N A;  1TQM A;  1Z1D A;  2VE8 A;  5K5R A;  2CGP A;  3N97 A;  1GXQ A;  2DPD A;  2ZNY A;  5LEJ A;  3E5U A;  3BZ6 A;  1P4X A;  3V4G A;  4BHP A;  4IXA A;  1FC3 A;  2IVM A;  5HDK A;  3TGN A;  5F1R A;  2TDX A;  1FYL A;  1XSV A;  4RGX A;  2EV6 A;  3N4M A;  2PMH A;  1XDU A;  2OQR A;  1E2X A;  4LB5 A;  3D5L A;  2QBY A;  1SAX A;  1H0M A;  1B59 A;  3GUD A;  3WTV C;  1IXC A;  1XGO A;  2HQR A;  5HLH A;  3IRR A;  3I64 A;  1MKM A;  5L3F A;  2QZ8 A;  4S05 A;  2FU4 A;  3GEZ A;  4XBF A;  1OMI A;  4YFK F;  4AIH A;  1ZYR F;  2CW0 F;  2DK5 A;  2KIF A;  4OIP F;  1MDM A;  3L7W A;  5FB2 A;  4ASN A;  3DF8 A;  4KIC A;  2MA3 A;  4M9X A;  1HW5 A;  2RC4 A;  1D8J A;  3JSO A;  1YS7 A;  3WTS C;  1YW7 A;  1DDN A;  4GO1 A;  1FSH A;  4ZZL A;  2DFI A;  1L3L A;  1MJA A;  1R22 A;  5H6R A;  2MH9 A;  4IRG A;  2VE9 A;  3GFM A;  2GQQ A;  2IA1 A;  5HS7 A;  2P7V B;  3HUG A;  2M5W A;  1J59 A;  2W85 A;  4ZZD A;  1AOY A;  4EJW A;  4MTD A;  1KA8 A;  3HHH A;  2O6G E;  1H9G A;  3LAJ A;  1OPC A;  2Z99 A;  1G3Y A;  3ZMZ A;  4PZJ A;  4G7O F;  3FM5 A;  4OIQ F;  1RUN A;  2J5P A;  5DCM B;  4L9N A;  1C0W A;  1G3S A;  1Z7U A;  3I0T A;  4I01 A;  5D6F A;  1K7A A;  1R23 A;  4I0B A;  2X4H A;  4RGR A;  3ECO A;  4UNO A;  4ZYE A;  3F8B A;  4WX9 A;  2OAZ A;  3HOT A;  2FRH A;  2VBZ A;  3B02 A;  4RB0 A;  2HZT A;  2IA2 A;  3RIR A;  4ZH4 F;  4JBA A;  3RPQ A;  3U9G A;  1F5T A;  3HRT A;  1U5T B;  1ZRE A;  2XAG A;  2JRT A;  4HA8 A;  2PI0 A;  1MZB A;  2VXZ A;  4ZYG A;  4XLP F;  3QOP A;  3BPV A;  4WF2 A;  4P96 A;  4UVB A;  3ZPL A;  4L9J A;  3GWZ A;  1FWZ A;  1W5T A;  4IF4 A;  2L3D A;  5HDN A;  2WWY A;  1G3W A;  3VEP A;  3PQJ A;  4HV6 A;  4M6X A;  2Q2E A;  2UXN A;  3KP5 A;  5DV5 A;  4G7Z F;  2A6H F;  1J2X A;  5HLI A;  3LST A;  2E1C A;  3WOD F;  2XRN A;  4YII A;  4HX4 A;  1UFM A;  4AD9 A;  3F22 A;  4FT8 A;  2A3S A;  2E7X A;  2QQ9 A;  4FX0 A;  4JQF A;  3SXY A;  1FT9 A;  4OMY A;  3K2Z A;  3LWF A;  5DDG A;  4IPA A;  1U2W A;  1EH8 A;  3RKX A;  2EFO A;  1YS6 A;  4UHT A;  3JTH A;  2QM3 A;  2FXA A;  2IP2 A;  2ZME A;  4HBL A;  4RB1 A;  2QBY B;  4MHG A;  5LGU A;  4ESJ A;  2KIM A;  2LDU A;  2L02 A;  1PP8 F;  4KIF A;  2H27 A;  3BRO A;  5IT9 K;  2G9W A;  1XB4 A;  3DV8 A;  3H3U A;  2Q8K A;  2XAF A;  4LLN A;  2K4B A;  2DQL A;  4GXO A;  3BWG A;  4PCQ A;  4FX4 A;  3BOQ A;  5JHU A;  2IRF G;  1MDM B;  2DI3 A;  3QRF F;  2UXX A;  1MD0 A;  1REP C;  2A07 F;  5ILU A;  1BC8 C;  4F7Z A;  4KN7 X;  3HOS A;  1UST A;  2DO7 A;  1XGS A;  1IZ1 A;  2GA2 A;  5E20 A;  5ICC A;  1BBY A;  2GXB A;  1BJA A;  3SZT A;  1V4R A;  2PJP A;  3BJ6 A;  4DQ2 A;  2F5F A;  4A2U A;  1P92 A;  2FNA A;  3GFJ A;  3WG9 A;  1BI2 A;  4A6D A;  2IJL A;  4RS8 A;  3DXJ F;  5BPD A;  2ETH A;  2CG4 A;  1RNL A;  5BMZ A;  1O3S A;  3KZZ A;  3TKY A;  3RTR A;  1YW8 A;  3V7S A;  1YFH A;  2FMY A;  1S29 A;  3ZMV A;  2GIV A;  1GHC A;  1G4D A;  1U6G A;  4Q48 A;  1YO5 C;  1DPU A;  2Y75 A;  4MQV A;  2H94 A;  2D2W A;  3BJO A;  1YTY A;  4MEY F;  1Z6R A;  2OD5 A;  4O3M A;  2Y48 A;  3F6O A;  1XMA A;  2CFX A;  4Z2Y A;  1HBX G;  5EEH A;  4YG2 F;  3WTX C;  3FM3 A;  4XSX F;  5FLX Z;  3JW4 A;  2P8T A;  5CJ9 A;  2LKP A;  4EJT A;  5ICF A;  3MZH A;  1RUO A;  2JZY A;  4TV7 A;  3GXO A;  3V7C A;  2XAQ A;  4HW0 A;  3T0Y A;  1B9M A;  1F9N A;  4JK1 X;  3VB2 A;  3P9K A;  5D5X B;  2WTE A;  2BYV E;  4B8X A;  4ESB A;  2EV5 A;  2AS5 F;  2QUF A;  3JTG A;  3ISP A;  3EDP A;  2K7L A;  3F8N A;  2RDP A;  3GX4 X;  4L0Z B;  1UB9 A;  1USS A;  3J80 Z;  2YR2 A;  5FLX K;  4RAY A;  3FWE A;  3KLO A;  2NYX A;  4KMU X;  4WCG A;  3E6B A;  2HS5 A;  4M6Y A;  5J8C A;  2G7H A;  3E6M A;  1RI7 A;  3ROU A;  2FNP A;  1LEB A;  5LRR A;  5CVU A;  5LHH A;  4HF0 A;  4U0Y A;  3E6C C;  1G3T A;  2JPB A;  3ABT A;  3DPT A;  4RGS A;  2XAS A;  3GZ6 A;  1QGP A;  2MH2 A;  5BOX A;  2MC3 A;  3FMR A;  3IHU A;  5FFX A;  2D1H A;  2VON A;  4A5M A;  1IN8 A;  2ZME B;  3ZMU A;  2DQR A;  3RKY A;  3GVA A;  3ZP5 A;  2P5K A;  1OKR A;  1P4A A;  3F72 A;  2PG4 A;  3FHZ A;  1XGN A;  4I98 B;  4MQ9 F;  4P5O A;  1LDJ A;  3KP2 A;  5LRS A;  1I1G A;  5JFR A;  4G9Y A;  1Z05 A;  4MEX F;  4IRI A;  2DTR A;  5K1Y A;  1FP1 D;  3HSF A;  1XSX A;  4M72 A;  3SQN A;  5A2Q K;  2PFB A;  1TNS A;  4L0Y B;  4M9Z A;  5AON A;  3VFZ A;  2HYF A;  4LLG F;  1ULY A;  4OU0 A;  1O7L A;  1XD7 A;  2HTS A;  1ZHF A;  2VOO A;  4PGH A;  5FFZ A;  1PDN C;  3O6B B;  2RKH A;  1BC7 C;  5F6F A;  1D5V A;  3FXR A;  4KYW A;  4K2E A;  2HOE A;  4M9S A;  1KYW A;  1ZGA A;  1NHA A;  3MWM A;  4XLN F;  3V8J A;  2XKP A;  3T5X A;  3GFI A;  4NB5 A;  3TDZ C;  2ACJ A;  3Q9V A;  1YYV A;  4EVI A;  3GFL A;  1U5T C;  1O3R A;  4ENN A;  2ZNZ A;  5E17 F;  3ECH A;  4M71 A;  2QEN A;  3BY6 A;  2EFP A;  3E3V A;  3EYI A;  3I71 A;  4M73 A;  1FYK A;  2A69 F;  4I09 A;  2LF8 A;  5TRD A;  4UUV A;  3BP8 A;  4HV5 A;  2DW4 A;  2VBW A;  1FBQ A;  4A0X A;  3O3K A;  2P6S A;  2EA4 A;  2Z3Y A;  2Q0O A;  5JR3 A;  1QBJ A;  3ZN1 A;  3QP6 A;  1LVA A;  4G8X A;  2LF7 A;  4HF2 A;  2NAZ A;  2FOK A;  3E97 A;  5E8G A;  3PFI A;  1J7K A;  1OR7 A;  1OYY A;  1ZAO A;  3IWF A;  4OIO F;  3GO5 A;  3QU3 A;  1F1Z A;  3I54 A;  2FF4 A;  2OZU A;  1W7P A;  3CDH A;  2ZFW A;  1CF7 A;  4OIN F;  1T38 A;  2DK8 A;  4KUM A;  4UXN A;  3NQO A;  1BIA A;  3V8L A;  2QLZ A;  4CXF A;  4HX8 A;  2GZW A;  1ODD A;  3M8F A;  3WE2 A;  3HRU A;  1Z9C A;  1W5S A;  3JSP A;  1DP7 P;  3ML6 A;  3Q9S A;  1GVJ A;  1TQI A;  4S04 A;  2W84 A;  4ZYH A;  4N0B A;  4L9T A;  3C18 A;  2ZO4 A;  5DD4 A;  2R7D A;  3OOP A;  1IW7 F;  3M8E A;  4IRH A;  2O8X A;  1S6L A;  4IHT A;  3V7R A;  1ON2 A;  3CO6 C;  1WI9 A;  1FZP B;  1PUE E;  4PDK A;  1SFU A;  5J6X A;  2DT5 A;  2VC1 A;  2CQK A;  2PEX A;  4CO8 A;  4BAY A;  3F21 A;  4CYD A;  5LBQ A;  3WTY C;  1IAW A;  2RN7 A;  1J0R A;  1J75 A;  2OZ6 A;  4Y13 A;  5D5V B;  1LB2 A;  3P9C A;  3C1D A;  4BXU A;  3QP5 A;  5BPI A;  1TQP A;  2ZBK A;  2YPR A;  4GYG A;  3WTT C;  4QWQ A;  1KYZ A;  2M45 A;  4OIR F;  3R60 A;  1KQ0 A;  3CUQ A;  5K5O A;  3ZMT A;  3EYY A;  5AIP A;  3KEQ A;  2CSO A;  2L4A A;  1DPR A;  1SFE A;  4A0Z A;  3M1E A;  5CYV A;  1W7P D;  2EK5 A;  5ILS A;  4ETS A;  5FD6 A;  5L3E A;  4LLL A;  2C6Y A;  3IWZ A;  3EUH A;  2Z33 A;  2BV6 A;  1XDS A;  1P4W A;  2V6C A;  3DFG A;  5AIQ A;  1S7O A;  5CVI A;  3H92 A;  4ENM A;  5DUK A;  1OYI A;  1HKS A;  5JVT A;  5IT9 Z;  3S2W A;  1KU3 A;  1STZ A;  4GCV A;  5E1Z B;  2JSC A;  3J7A O;  2XKO A;  3IC7 A;  4MGR A;  1LEA A;  2YSR A;  2VBY A;  1K78 A;  2OBP A;  4LB6 B;  4U0W A;  1IN6 A;  2UZK A;  1SMT A;  4LMY A;  4O5V A;  2A61 A;  2F5D A;  4LG0 A;  2RVC A;  4CDG A;  1B6A A;  1TNT A;  2P5V A;  2XGX A;  5K5Q A;  3FXU A;  1SD5 A;  1O7F A;  2V1X A;  3MFK A;  1I6X A;  2O0Y A;  3WGI A;  4AIJ A;  1HW1 A;  1UHW A;  1R36 A;  5DEQ A;  1ZG1 A;  4L18 B;  3LA7 A;  5E8I A;  1Q1H A;  4OMZ A;  2DU9 A;  3I53 A;  3F8F A;  2GWR A;  3KET A;  4AIK A;  3E6D A;  2YU3 A;  4LJZ F;  2HKX A;  2VT3 A;  1R1U A;  4U7D A;  1JHF A;  2HR3 A;  1R1V A;  3GW2 A;  1ZRD A;  4U0V A;  5BS6 A;  4HQE A;  1D3Y A;  3KLN A;  4YFN F;  1W4M A;  5D4R A;  1QNT A;  3ABU A;  4HF1 A;  1W7P B;  1WWX A;  2HKO A;  5E1W A;  1CF7 B;  3GYH X;  1FY7 A;  4N9I A;  1IF1 A;  1X3U A;  2JPC A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...