2KISA

Solution structure of ca150 ff1 domain and ff1-ff2 interdomain linker
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
GAMGSLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation regulator 1
publication title Structural studies of FF domains of the transcription factor CA150 provide insights into the organization of FF domain tandem arrays.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kisA00
2B7EA 2E71A 2JUCA 2KISA 2KIQA 2KZGA 1UZCA 2DOFA 2K85A 2L9VA 2LKSA 4FQGA 2DOEA 2CQNA 2KFDA 2DODA
chains in the Genus database with same CATH superfamily
1X3WB 1Y8RB 1W1WE 3DBLB 4UXNA 2IVMA 2WB1N 4ETSA 1LB2A 4L5EA 5BOXA 4HW0A 3ZQHA 4NB5A 1TZLA 2MSYA 1LDJA 4GCVA 5IT9K 2Q1ZB 1SFEA 2CQQA 1U5TC 5AIQA 1IDZA 2DK5A 2MW8A 4CGZA 1XMXA 3OYEA 4BE0A 2XGCA 2ZSIB 5J4VA 1P4AA 2WV0A 4J00A 4G9YA 3GTGJ 3MD2A 2IT0A 2JN6A 1KU3A 4M3DA 2ELHA 4ZYDA 4Y3OA 4MEXF 4I7HA 4B48A 4C2MJ 1P92A 4FE4A 5EZGA 4E7LA 3RTRA 4XMYA 2VI6A 1F5TA 1RUOA 3M9AA 3I53A 1T95A 3G71I 2D1HA 4M9ZA 3H3UA 3HEFA 3M1EA 2MABA 2E1OA 3QYEA 5HODA 4D0PA 4M71A 2HQRA 3BG9A 4ITVA 1Y39A 5FRNA 4Y4RA 1FLIA 3K1PA 1DPRA 4EGZA 1J0RA 3HUGB 4G6QA 2E34A 2CQXA 2M45A 1YITI 2EFQA 4ZYEA 2ZFUA 4QWQA 3HL2A 4UHTA 1W7PB 1TWFJ 2RNGA 1EF4A 1ZRFA 2BEOA 2Y0MA 2PMUA 1ZQ3P 5GP9A 3LL7A 2G7UA 1VQ4I 1IN5A 1PVEA 1FSHA 1HW1A 3LSTA 3OYMA 2OCCH 3OYBA 1FBSA 4LOCA 4MLOA 1ON1A 3BJ6A 1WJFA 4ENKA 4A3GJ 2FRHA 3J7YJ 3KX2A 1EA3A 4FQGA 2CGPA 4C2TA 1QGPA 1USTA 3F72A 2XAJA 2KDOA 1XPXA 3O2PE 4XN0A 2YPRA 3S1RJ 1X3UA 2NVXJ 5A2QK 1YO5C 4XIDA 1ZREA 3HM5A 1KZHA 1AA7A 1YRNA 1UZCA 1RKTA 3C2HA 2V9PA 4XQFA 3HOZJ 3ZGKA 1BR1A 2P6TA 3C2BA 3HB9A 5KK1A 1QZYA 5K7FA 1YW9A 5ILUA 2KIQA 4E7IA 3JSOA 3AAFA 2GAUA 2QVOA 5J4YA 3TW7A 5JFRA 1HDDC 3I3LA 3RYPA 3BDDA 2R4GA 2F5CA 1KU7A 2IS4A 1HXDA 3A01A 4E7JA 2LSOA 3HHHA 4XR6A 1BA5A 5K5OA 2WAQN 1X4PA 2V4JC 4BE2A 4M9XA 5CQEA 5L3FA 3K70D 4ZZLA 4HX7A 1RUNA 3CO7C 1FOKA 3RZOJ 3KYCB 4YIFA 3EDPA 3KP6A 1H89C 4V2FA 3F8MA 3UNGC 3LOCA 2OC6A 3FM3A 3KP4A 3PNVA 1QPIA 1ZRCA 4Y7NJ 1U8RA 3VWBA 3CCLI 3OSFA 2FJ1A 3PUFA 3CP8A 1AKHA 3OYIA 2FBKA 4BDYA 3CUQA 3KCCA 1YW8A 1CF7B 1RKWA 3OL3A 1D1AA 2NS0A 2DMTA 3LSMA 3EUKL 1XGSA 5D5VB 1LVAA 4M74A 4AM3A 2M2EA 3OS1A 2WAEA 3O8HA 4XRSA 3S2HJ 1MIJA 2NS7A 2E2IJ 3WHCA 1RNLA 2QBYB 2P8TA 1VFCA 1IDYA 3Q0WA 3PUBA 1Y0UA 4ZYGA 3FDYA 4AIDA 4M73A 4BJ6C 4RBOA 5JHFA 3HTUA 2HOEA 3HOWJ 3E6DA 2I5UA 1A6QA 1F1ZA 1B9NA 2XV4S 3HPGA 1X1CA 3RKXA 4HLYA 2JVHA 1S7OA 5HS8A 1IUFA 1IW7F 2CFOA 2KLOA 3HRTA 2XASA 3L2UA 1AWCA 3ZP5A 2BYVE 1DUXC 4BY7J 2M5WA 1NK3P 3KPHA 1ORKA 3MZ8A 4ASNA 3JRHA 1BW5A 4XLFA 4IOCF 2Z1DA 2R3SA 2F4MB 2YU9J 3IH2A 3VYTB 1V3FA 4IHXA 2EJRA 3B6CA 4ESJA 5FD6A 2O61A 3OYHA 3TDUC 3I64A 1VQ6I 2L7FP 1LKXA 1R1VA 4AIHA 2V1NA 4IXAA 2QQ9A 5DCMA 1NTCA 2K02A 2H8RA 2R7DA 3JRCA 3FMRA 4IHTA 4UB8C 4KDPA 2M3AA 3DPTA 2DT6A 5BPDA 1WZ2A 4F93B 2HKXA 1BM9A 1ZLKA 4UUVA 1NHAA 3RSNA 1ON2A 1R58A 5F1RA 4BQQA 1YIOA 2ISYA 3VODA 1VQNI 3MFKA 5LFAA 5CVRA 2VKHA 4LG0B 1GXPA 3CLOA 3IKVA 4EV0A 4CZCA 3J7ZI 4BXUA 3GTLJ 1STZA 3WTXC 1GDTA 3LAPA 1B59A 2VKVA 5FKMA 3BZKA 4U7BA 2QQ8A 1SAXA 2MYSA 1JKPC 1HOMA 4HEA2 2XPWA 3FXMA 1WGXA 2ME0A 2F5VA 4W1UA 2JRTA 3JW4A 2WAFA 3V7SA 4U87A 4MFEA 2DK8A 3RKWA 2H27A 3AG1H 3EUHC 2KHMA 4EMSA 1PP7U 1TC3C 3DF8A 2IA1A 2VBYA 1KU9A 2RDPA 4F55A 1WPKA 4HG2A 4NC8A 2V1UA 2M8EA 4A6DA 1BC8C 4CICA 1JTYA 3OWTA 4L9VA 3HG9A 1FYMA 1IXRC 1S5LC 4I98B 4ZC3A 4CXFA 1KYWA 2YU3A 4F91B 1SFOJ 3IWZA 3HSFA 4AD9A 2QSGX 2Q2EA 2EV0A 4JX4A 1QNTA 2STTA 3PL8A 4RGUA 2OQRA 3WGHA 3ULQB 1LUJB 2VIXA 3HHGA 3L7WA 1LE8B 5BQTA 2CMPA 3QOEA 1N78A 3M1CA 4XLPF 4AIKA 1IC8A 4BS9A 2Z16A 5FFZA 3TQNA 3CESA 2GWRA 3OIOA 3K4LA 3L2CA 1VQMI 2X0LA 4NQWB 3F22A 4I6ZA 2KISA 1MNMC 3RQ4A 1ODDA 3GTOJ 2ZMEB 1LDDA 2K3PA 2MBFA 1IG7A 2B9SA 4BKXA 2HXIA 1TNTA 1TW3A 4CO8A 2O03A 2BXYA 2JA2A 2O5RA 3BR5A 3GLLA 2YR2A 3S32A 4BDZA 3BY6A 1MBGA 1IXSB 2K5CA 2QA4I 5D6FA 4MGRA 2LNBA 5E3MA 3KIOA 4A2UA 3I4PA 2YSRA 3U21A 2DTRA 1OPCA 2XF6A 4PZJA 4F52A 2E60A 3GTJJ 3SQNA 1DP3A 3E0JB 3OYLA 1G3YA 5K5RA 4BHPA 2JMWA 5CYVA 3HKZN 1V5FA 4I99C 1OJLA 2CFXA 5D8KB 2V79A 1YS6A 5D5WB 1QRYA 1B72A 2ECCA 5GPCA 1X1PA 1Q1VA 3OYNA 3ZOBA 3JRBA 1KYZA 5B66C 3BLYA 1PDNC 1EH8A 2K7LA 4WXCA 3U9GA 3K2ZA 5FB2A 2E2JJ 3GFJA 2C6YA 1DU0A 2EZHA 3G6EI 2NXNB 1I3AA 2W82A 3TMOA 1HA8A 3PO2J 2RREA 2WY7Q 3KP5A 3CJNA 1WJEA 2L4AA 2HDDA 2FF4A 4U7DA 4PJNA 3GMEA 4CCMA 3JTGA 1MMDA 4OINF 1FT9A 1OYYA 2XDVA 1U5TB 4RB0A 2XAHA 3H1CA 1KQ0A 1MDMB 3U1DA 3L2QA 1Z9CA 1HW5A 2X6XA 4IRIA 2HYJA 2X1EA 4CYCB 1X1AA 1ZR2A 2P7VB 3BQYA 2LD5A 2CW7A 1J09A 1R5ID 5JI6A 1ZLJA 4XKWA 1APLC 3I4NJ 1Z21A 5DM7F 1Z1DA 3UR3C 3N4MA 3LQQA 4A3IJ 4GRIA 5IYCJ 2IGKA 2JVGA 2EK5A 2OU2A 2LKSA 3NWSA 2M0CA 2XRNA 3DQVC 1O3SA 2RN7A 3GVAA 2R5YA 2QF7A 1BJAA 2WV1A 4CZZA 1S7AA 1BOAA 5E3NA 3L09A 1E2XA 1TWGJ 2HQ5A 2L0KA 1FIAA 1N75A 1ZH5A 1IF1A 2VE9A 1DU6A 2XF7A 2KPMA 2A05A 2CJJA 1H88C 2HZTA 2YX7A 3FKIJ 2VJ5A 2DN0A 2KJCA 1S7EA 2VT3A 3S3NA 1RZ4A 4LLGF 1FOWA 2EFOA 3D5SC 4WX9A 5LD2C 1YLFA 3FK6A 3H5NA 2BY0A 4OAYA 1P6RA 2HPMA 1R5GA 1TQMA 1IN4A 1FX7A 2KRFA 3LSPA 2M7AA 3DFGA 5GAGJ 2HR3A 3GYHX 3HTSB 1VQKI 4K2EA 4WK8F 2PBIA 1G3WA 3TGNA 1Z3YA 5EG0A 2QYOA 4IOAF 1WFXA 3V42A 1XS9A 2HS5A 4OIQF 3JAMZ 4HV6A 4IF4A 2L9VA 2EZIA 4B8XA 2DTZA 4P55A 3BTCA 2XAQA 2M4KA 4IQJA 3PJRA 4WCGA 4C2UA 1ETYA 2ZB9A 3A0HC 1D3YA 4A5NA 1FC3A 4LK0F 4EATA 1J9IA 1W0TA 1AOYA 1GXQA 1ACIA 3DPLC 2HOTA 2LFBA 1D5VA 3REOA 1WKMA 3JTHA 1PYVA 3BPXA 1A6IA 2ECBA 3FXRA 2A69F 2BHZA 4I76A 3V8LA 4CCKA 1HBXG 2XC7A 2JUCA 3ABKH 2FD5A 2LG4A 1SVOA 4XM3A 2NYXA 3C2GA 3ECHA 1FEXA 1D8JA 5K1YA 3F6OA 1R5HA 4XONA 3W2AA 1RC9A 1O3TA 1T6SA 3ZN0A 1XCVA 4PSWA 3TOAA 2LREA 3EQLF 3DU6A 2QENA 1H9GA 1VF9A 2FOKA 2N8GA 1MBEA 3Q9SA 4RM2A 1S3JA 2YUSA 1ETVA 3IAS2 4XKBA 4IHWA 4G7HF 1XB4A 4YG2F 4FX0A 1Z6TA 1MH3A 2D5VA 1R49A 4CSWA 2GZWA 1VTNC 2R7SA 1IO2A 3V4GA 1WSUA 3OV8A 3M3YJ 3TEDA 1OYWA 4G8XA 4ESFA 4XRSG 2ZNYA 1JXSA 4M72A 2OF7A 1OCRH 3CDLA 4UUSB 2ADUA 5TJJA 5B1AH 2FMLA 1HC8A 1ZG3A 3F8CA 4HNTA 2QSFX 2P5VA 2HVRA 2QGUA 5E18F 1TBXA 2X4HA 4WWCA 2E35A 1J7KA 3LSGA 2LVSA 5DS9A 4GXOA 5E3LA 2BZTA 2XB0X 2BY1A 3AKZA 3IRQA 2XF5A 3MQ0A 1ZHFA 3I71A 4XOPA 1UHSA 2ZMEC 5B1BH 1W0UA 1G4DA 4A6EA 4IKFA 4PDKA 1W7PD 3MN2A 2CQNA 2Y31A 3OIPA 3R60A 4E70A 3ABMH 3HOXJ 2RQPA 4XLAA 2BBYA 2VJIA 2EFWA 2HKOA 2IEKA 4UVAA 3JR9A 3MCZA 1CQTA 5DV5A 1B8IA 5CLSA 2R7WA 2G0EA 1SD6A 1XDUA 5EGOB 2AHQA 3E5QA 1CGPA 4FX4A 3CF2A 2CW0F 3FXUA 4FT8A 2DYSH 3MKZA 2JA5J 2IA2A 3HZJA 5HDGA 4BYYA 1Z6RA 2VC0A 4XICA 4B43A 1WHUA 2I10A 2OA4A 2ZSHB 1XN7A 2VQGA 5KCMA 5M5YJ 5FD5A 2AXLA 1MNEA 2K86A 1ZARA 2A68F 1Y56A 2OJED 3FM5A 3ONQA 2M30A 1OCCH 3CCJI 1UFMA 3SEZA 2LDUA 4BH9A 1FMWA 4H0EA 2W57A 5FLMJ 2VQLA 3KETA 1B4AA 2F5DA 2KMUA 2KFDA 4YFNF 1LEAA 2EPFA 2Z2SB 2VBXA 1L3LA 3RQIA 1K78A 1V54H 2HZDA 1PP8F 5GADJ 2HOSA 5FLXZ 3VDXA 3E97A 2ZXHA 3I54A 2VPLA 5ICGA 4KISA 3FBIB 4YFKF 4BQOA 1GT0C 4F7ZA 1YOVB 4ENMA 2KJBA 3S1MJ 1ONVA 1QPMA 4QPOA 3ASNH 3TDZC 1U6GA 4XBFA 1OLTA 3OYKA 1W5SA 3OSGA 2JSCA 2FQ3A 4RB2C 3HC7A 3HOTA 3HUGA 4XSZF 2HNHA 1SFXA 3HOSA 2GXBA 3H92A 5GTHC 4NHJA 4Z6YA 5ICFA 2P6SA 1XSDA 2Z99A 2LBFB 1W7PA 1HLVA 3CQZJ 5F08A 2ZJPF 1XGMA 3FXKA 4P9UA 2ME6A 5LEKA 2K40A 2YX4A 3AL0B 3FZVA 1OISA 5E8IA 1ZG1A 2XGXA 2WY8Q 2CRGA 1MSFC 2O0YA 5FKOA 3NQOA 2EILH 3ZN1A 2STWA 2WBMA 2Y69H 3J81Z 5F1JA 1GVDA 3JAMK 1OMIA 2BY2A 5E1XA 2D2WA 3N97A 2CUZA 3TO6A 3HBLA 3VFZA 3H0GJ 3FHNA 1LQ1A 3P7NA 3GCMA 3WTVC 3VOEA 3FXQA 3ERMA 2R92J 3U1KA 3QQAA 1YJWI 4P1WA 3ZQ7A 2K9SA 4ABZA 1SEUA 1XTAA 4BHCA 3B73A 2A6HF 2ZJRF 3LSKA 3DTKA 3DWLE 2FX0A 5D4SA 2VE8A 2FMYA 3SEQA 2BGCA 3L00A 4N0BA 1RETA 1HQCA 1SMTA 2QSHX 3RPUA 3K1NA 4A0YA 2KZVA 1TQPA 1ZELA 4HDUA 3BG3A 1A04A 1FBQA 4XLHA 3T8RA 2CQKA 1T8IA 1X2MA 3K4CA 4KIBA 3QWLA 3S2WA 2VLAA 3F0CA 2ICWG 4DW6A 1PJRA 5IY5H 2XIGA 4A12A 2IS1A 1BIAA 4KN7X 2P7CB 1RPWA 2X6YA 3ZMZA 1LFBA 2VQHA 3BCBA 5ICEA 4MTDA 2ZJQF 4CHUA 2IXSA 4RS8A 5CVIA 5D6EA 5EEAA 1XD7A 3LSIA 4Q48A 1R36A 2WAQA 1MMGA 1CF7A 2RNJA 4C3IJ 1WCMJ 2VB6A 4KMFA 4XRMA 4C3JJ 5HDKA 3KEQA 2DYRH 3DXJF 1MMAA 2ZXIA 3BR3A 2CG4A 3BQZA 3CLQA 4M3BA 2QKMB 2QBYA 4G7OF 3WTWC 1WI3A 2L9RA 4DYCA 4UV8A 1A35A 1Z0XA 3X2QH 1WJDA 3LMMA 1YE9A 4ON0A 4B47A 2GOMA 1XG1A 3OY9A 4NUBA 1AHDP 2MLGA 4KT6A 4DJAA 2DFFA 4XN3A 5HLIA 5EEGA 1KU2A 1KA8A 5L3BA 1GUUA 3KP7A 3NRVA 4KMUX 3I56I 1KGSA 2EBIA 2XPUA 3AG2H 4CCOA 3GWZA 4MNUA 3E6MA 3K69A 1QHGA 5LBQA 5BMZA 4DBRA 5KAFC 5FJ8J 3GFLA 3BG5A 3E3VA 5GAEJ 2GM4A 1MJ9A 5FKKA 4HF0A 4P9FA 2BVMA 1Z7UA 3V8KA 2PMZN 1L0OC 1RR7A 3DV8A 3GZ5A 1T2KA 5ERIA 2Z33A 2DO7A 3C18A 1ETWA 1OFCX 3L2RA 5K5QA 2DCEA 3SHFA 1C0WA 4JQFA 4YELA 3R0AA 1J59A 4GFBA 1JI8A 2NVQJ 5HLGA 2P81A 3OYDA 2V26A 1MMNA 1ZN2A 2ID6A 2HDWA 2MGQA 4MQ9F 2RKHA 4ZDPA 1REPC 3QPLA 3NAUA 1LEBA 3ZCOA 5H6QA 4D5CA 4NDLA 2MC3A 2HPIA 4OAZA 1RR8C 4V2GA 4IHSA 2UV1A 4A3EJ 3H35A 2VASA 2DDBA 2RC4A 3MMYB 3P9CA 5D4RA 3BP8A 3ABLH 5FLXK 2M4GA 1YJ9I 2KIFA 3WE3A 4IQ4A 2V6CA 2H8WA 2MA3A 2DLLA 2BHYA 3I58A 1R1TA 5GPAA 2ISZA 2O8KA 4ZTFA 2DAOA 2DMNA 2K9QA 3IWFA 4MIMA 2PJRB 2MH2A 4PSXA 2DDAA 3Q0UA 1A31A 3OR1C 2GXAA 3HPHA 4M6XA 4OIOF 4XKCA 2BW3B 2EINH 1DDNA 4II3A 3H9QA 4H4KC 3WTUC 1W36C 1XGNA 3SXYA 4D1QA 1G6NA 2L02A 3ZMUA 4BEHB 3L1PA 1YHQI 2B7EA 1F43A 1OR7C 1LFPA 1UJ8A 2XPVA 5LHIA 1IGNA 1DP7P 2IW5A 1LE8A 3TP3A 2M9HA 4ENNA 4ZTJA 5LEJA 4IHYA 2H6BA 2V7FA 2FOWA 1VQOI 1VQLI 3FF5A 3DKWA 4RLQA 4LK1F 1K79A 2A61A 3TL4X 4NQWA 2KRCA 3Q0VA 2ZMEA 2R7FA 3CCQI 2MFZA 4N9IA 5JHUA 5DYMA 4XORA 4CCLA 1EJ9A 4PFOA 1FTTA 2UXXA 4M3GA 2VXZA 3JRIA 3DBHB 4YEJA 5L3GA 5E17F 2NOJB 5C4JJ 3WGIA 4GGGA 1A5JA 1ETQA 4KJZA 4AU7A 2PMHA 3AL0C 3AG4H 2DT7B 2WADA 4YRVA 2E71A 4P96A 4BL0B 4OMYA 4EJUA 4DYRA 4L18B 1BJZA 2ZCWA 2W1OA 2JJ7A 4FTHA 3ML6A 4EM2A 3M8FA 4BXFA 1UELB 3ZPLA 4G12A 4QLCU 1U0JA 3SZGA 1FOXA 5HDNA 2NOGA 3G4SI 3G1OA 2LLKA 3HJEA 2O8XA 4KUMA 2EWNA 2L54A 2LYCA 3FK7A 2M1BA 1PUEE 1U9OA 4OU0A 2DJIA 4JX6A 4U88A 1HSJA 2PLYA 4AWXB 3O3KA 1SANA 1JKOC 3H0DA 5BS6A 1ETKA 3J80Z 2VL8A 2XUBA 3MZHA 1E3PA 2Q8KA 4I2OA 2P0WA 1IRXA 1XMKA 2X6OA 4EJWA 3CJTB 1VZ0A 1WQ2A 4AYBA 1EV7A 5HS7A 4P5OA 2FEZA 2D1VA 4O6JA 2LF8A 4I0BA 1JJ8C 3D0SA 4HA8A 1GV5A 9ANTA 1LVKA 1N77A 1LNWA 1SD4A 4ESBA 1IZ1A 2LH9A 5IP9J 2R5ZB 3EUAA 4KIFA 4HPQA 2OZUA 2VBZA 3Q3SA 2QWWA 3JCUC 5IP7J 2TRTA 5FKNA 1BI2A 3T1BA 1U5TA 4XOTA 1IXCA 1I39A 1OCOH 2ZJ2A 1MDMA 1O4XA 3IAM2 1S8NA 3PSIA 4KIGA 4NBQA 3S14J 4CYCA 2QUFA 4QIWN 2K9LA 3HIFA 3LFUA 2Y0SA 4YFXF 3AG3H 4HX4A 1GHCA 5CKTA 4DOZA 2M34A 3BG6A 4PJMA 4IRGA 3K10A 5LHHA 2ETHA 4HF1A 2IP2A 4S0HB 1I27A 4KT5C 4ZDOA 3GEZA 1ZK8A 1P2FA 2K85A 3LA3A 2VOPA 2DODA 2L01A 4M6VA 1D0YA 1UHMA 4A3KJ 1IAWA 2ESHA 3GZNB 5IPAA 1VQ5I 5BPIA 2DI3A 2HTJA 2DMQA 3ABTA 1LFUP 5J1RA 5J3LA 5LGUA 4EJTA 2KRHA 2JZYA 5B5EC 2EIKH 5LRRA 3DKXA 1VI0A 5M5WJ 4FASD 4XLCA 5E79C 1TP4A 4UVCA 2IGNA 2K4BA 3I59B 4F3QA 3H5AA 1WJAA 1MKMA 3WU0A 2WWYA 4A3MJ 4AVPA 1R9TJ 2O7OA 2LY1A 5M3FJ 2JTVA 4B4CA 2COBA 3V7CA 3ZMVA 1BN5A 4LD5A 2VBWA 1JE8A 1JUMA 2E7XA 4RB3C 2NNYA 4X0GA 2QCOA 4ENJA 3SDGA 1QA6A 1J2XA 2GBYA 2PN6A 2VONA 2FA5A 4KYWA 4M9SA 1XGOA 2DOAA 4HV5A 1TWHJ 3M07A 3WHBA 1B1BA 3HOYJ 4B44A 1H9TA 3BT9A 1O3RA 1XCBA 3IV5A 3S1NJ 1YJNI 2NVTJ 4FHTA 4N9HA 3GF2A 3H3ZA 1K4SA 2V6EA 2LF7A 4KFCA 2NAZA 4PJJA 3NWTA 1FWZA 5LHGA 1YTYA 3SJMA 5C44J 4A0XA 2AQEA 4PGGA 3RCOA 2OPTA 1JJ6C 1MD0A 2IJLA 2R93J 5C4XJ 4UV9A 2MD5A 3KZIC 1RIOH 3CUQC 1I6XA 3I0TA 4A69C 2Y9YA 5FLVA 4CYDA 1UB9A 2P5KA 1VQ7I 3EYYA 4HF2A 2CSOA 2WA0A 3VYRB 1YX5A 4Y52J 2PG4A 2ELJA 1BC7C 4HX8A 5JLXA 2CUJA 2R5YB 2CQ7A 2JWTA 3M8JA 1D0XA 4HSRA 1B6AA 5F0FA 3QPSA 5FRMA 3N05A 4BQNA 2E5NA 2R7TA 2ZFWA 3CCUI 3M4OJ 2M0MA 2A6EF 3CCYA 5H6RA 2R7UA 2H94A 1JGGA 3QU3A 5ICCA 1QBJA 4RAYA 4LJZF 4JOMA 4UNOA 2DA3A 3BC8A 4LB6B 4RMNA 2PQ8A 3A1YA 1FBUA 2W48A 4W97A 4UUSA 1R7JA 4A93J 3R0JA 1W36D 2ESNA 3SZTA 4DZJA 1PUFB 1SVLA 1T38A 5DEQA 1DGWY 2L9NA 4DZPA 2A07F 4TV7A 5FO5A 3VYUB 1X1BA 3A2KA 3S16J 3PQJA 3U2RA 3AFHA 5D8LB 4XSXF 2ID3A 1TQIA 1UAAA 1U9NA 1V4RA 3FHZA 3M7GA 1U3EM 1YG2A 4BXXJ 4BY1J 2OZ6A 1KONA 1XX5A 5EYRA 4F92B 3JRGA 3UKGA 2IBDA 2E1MC 4BQAA 1BR4A 3E5UA 1S72I 2KQRA 5DD8A 1WVRA 3ABUA 3J80K 3LFKA 5KVRA 1R00A 2HXOA 1I1GA 5JVTA 5IOZA 3FXOA 2DPUA 4QPQA 1NH3A 1Z7LA 2Y30A 3P9KA 1UCRA 5DUIA 3FXJA 2XSDC 4FETA 2FNPA 3KLNA 2M8GX 2ZXJA 4Y33A 4G6TB 3B6AA 2QZ8A 3BTLA 3IRRA 1YI2I 4MO7A 3FIWA 1XDSA 4BU2A 1ETXA 3ZRGA 3MVPA 5ILVA 3D5LA 2WC2A 3ZR8X 3K4JA 1QHHD 1EH7A 2DU9A 4DYQA 2OAZA 4PK4A 5FFXA 1POGA 4HQEA 5BNGA 4V19K 5KHDA 3J7AY 1V55H 3CMEI 3R4KA 2VT2A 5ED4A 1R23A 1ZG5A 4LITA 1JHHA 1P7JA 1IN6A 3LNQA 3VSLA 2XB5A 3RZDJ 1TLHB 1Q1HA 1O3QA 3EUHA 4IO9F 5HLHA 5L3CA 3FISA 2KDZA 1WJ5A 4L5JA 4R1HA 5DTDA 2JSPA 5FROA 4EM1A 1XSXA 2FSWA 2HTSA 3G1MA 5EZHA 4DBQA 3WTTC 4PJLA 3CMMA 4A3BJ 1NG7A 3PFYA 5H2FC 2NVYJ 5EF6A 4I02A 1Y1WJ 3RIRA 3EETA 2K9NA 2DA1A 3LWFA 4MEYF 1O7LA 4IVNA 3I4MJ 1IN7A 3FKJA 3PNTA 3L2WA 3OYFA 2X51A 3KEOA 4RAFA 3V7RA 5CJ9A 3WG9A 1HW2A 2KT0A 1FSEA 2VODA 4KA4A 5CPRB 3DEUA 3MAJA 3WODF 2WB1A 3BOQA 4S04A 3CUOA 3FX3A 2QM3A 4XK4A 2HVSA 2DT5A 4DGWB 1R71A 3BWGA 1BI1A 3DCFA 2V9VA 4B1RA 2RAEA 1YIJI 3CTAA 2GXGA 1P4XA 2LC2A 4U0YA 2VJJA 3RKYA 1XC5A 3DEWA 4Q5SF 3R6SA 2VKDA 2LRDA 1Z3XA 1ENHA 1U78A 3CCMI 3V8JA 2VXDA 4A3FJ 3KFWX 3EYIA 4HAMA 2XAFA 1MGTA 1X1DA 3HRMA 3H5RA 3SFIA 4ZYHA 3EPZA 5IYDJ 3IP4B 3NEUA 2IGOA 2F6CA 1FZPB 2F48A 1AU7A 1SVMA 1Z91A 1GVJA 2CV1A 2V9KA 2LY2A 5EEHA 3WG7H 3PQKA 3IUOA 5TGTA 2HI3A 4BJ5C 1IRFA 2HOAA 1X2NA 4C3HJ 1I6HJ 3SFZA 4D9JA 1K78B 3T5XA 1MBKA 3BTIA 4XL9A 4L0ZB 3ZQQA 3FMQA 1R4NB 3K4KA 1JKRC 2K3FA 1K6YA 1P4WA 1ZGWA 4ZJZA 5LGNA 4BBRJ 2ZXWH 3ZQLA 3G1LA 2HWVA 1H0MA 3JREA 3GXOA 3K9TA 4BACA 2GIZA 1DPUA 1FMVA 2E19A 4EJVA 4RAGA 4X1EA 2AO9A 3MWMA 2VPRA 3HGYA 1BBYA 2LR8A 3K0LA 2L5QA 1FP2A 3GO5A 3TKYA 3W3CA 4D7NA 3F6VA 3WTSC 4LG3A 2Z3YA 4GO1A 1IRGA 2XKPA 2OBPA 2H6CA 1T0FC 3OYGA 1M1EB 4J19A 2QQBA 1DGRM 4CCJA 4HYEA 3ZQGA 4CCNA 3QAHA 4M6YA 1FIPA 3OYCA 1K61A 1MBHA 4L9TA 3MKLA 3GTQJ 2GQQA 1D5YA 3IL2A 4IZZA 1QZEA 2QLZA 3PNYA 3ELKA 2E5ZA 2L4MA 3W6KB 2K27A 4II2A 1S29A 4GDFA 5IT3A 3SZPA 2A3SA 4LLLA 2JK3A 4JP0A 2EFNA 3W2WA 3MZYA 3VYSB 3DLAA 3TW6A 1Y6IA 5TISC 4HDVA 3ROUA 2DA6A 5M3MJ 3C3WA 3HSEA 3IH3A 5E20A 1FJLA 1BIBA 2CUEA 4I01A 2JA6J 3M8EA 2PJPA 2X48A 2DFEA 3OYJA 3E5XA 4IX7A 2RV8A 2D45A 1P7IA 3DPUA 4B3XA 2DXIA 4XRFA 1YX3A 3CMAI 3KZYA 3HRSA 5JVGF 4YIIA 3IH4A 3CJRB 3LA2A 4OOIA 3BR6A 2LP0A 2J5OA 2KP6A 3BR1A 1XMAA 1HSTA 2DA4A 4WXHA 3GFMA 3CCEI 1K6OA 4RGXA 3SYTA 3S3MA 3KLOA 4DNCA 1YRNB 4UB6C 3GLXA 4C9YA 6PAXA 4OMZA 2UXNA 4S05A 1SD7A 3GW2A 4Z2YA 1BL0A 4UUTA 2A5WA 3W6VA 4BBSJ 2HQNA 1W5TA 1QQIA 5F0HA 3I9V2 2CS3A 1WWXA 1R22A 1WJCA 3RPQA 2PMZA 2FXAA 2TCTA 3KP2A 3GFIA 2CH0A 3H9JA 3A01B 1LPQA 1QU3A 1VNDA 3K2AA 1LJ9A 2NS8A 2EZLA 5J47A 1ZGJA 2R7VA 1WRJA 1I1SA 3CMYA 1JKQC 2W85A 3IKTA 3GTMJ 3QPHA 3BG7A 3K7AJ 2X1DA 1HDPA 2MC4A 4C30A 5KAIC 1O7FA 2DMPA 3LQRA 2V1DA 5E8GA 2GLOA 4HZFA 3K1MA 2Z9OA 2PJRA 2V1XA 2H1LA 2J5PA 4GYGA 4HBLA 4PFPA 4LG0A 2H09A 1X4OA 2YS9A 1Z77A 1AKHB 3HGGA 2H1KA 2F4OB 4J01A 1K4TA 3PSFA 2GIVA 2EZKA 3CUQB 1WH5A 2CU7A 3BR2A 1Z05A 2BW3A 3J7AO 1QVTA 2F4IA 4BJTA 1UG2A 3F23A 5H20A 5HS9A 2L2OA 3I55I 3BCAA 4PUSA 2DA2A 5HLTA 1G2HA 4Y13A 4BEHA 2OTLI 4OWRB 5ILSA 3K4NA 3L2VA 2NRAC 5J40A 2Y48A 2ZBKA 5HOOA 1P9QC 4IRHA 1ULYA 2HEOA 3CC7I 3GUDA 2NNNA 2E36A 1ZKGA 3MKWB 2VUMJ 3QRFF 4I09A 2OD5A 3E6BA 5M5XJ 3OR2C 4HRIA 5D5UB 2XAUA 2FBHA 5F27A 1IN8A 3WU1B 3OIQA 1OCPA 2CYYA 3JRAA 1YW7A 1YFHA 1OCZH 1GLNA 2HYGD 4LIUA 5HVQC 4RLFA 3CO6C 3HOUJ 4OIRF 2PI0A 5CVUA 2EV5A 1Z67A 3GX4X 1BW6A 4JK1X 2DFHA 1DQUA 2K9MA 4IHVA 3S93A 1WI9A 5IOYA 3J81K 4RB1A 2KL4A 4E6KG 2UWMA 3C1DA 3F8FA 4BUPA 1E17A 3F3XA 5DCMB 4EEFG 4KN4X 5LRSA 2PFBA 1SD5A 3KZZA 2E1MB 3QYBA 2L9SA 2W00A 1OKRA 4XLEA 3ISPA 2QEXI 5K7ZA 1F4KA 1USSA 4XNFA 1MNDA 1LDKB 2L3DA 3ECOA 2A6TA 3T0YA 4LB5A 2JT1A 2EA2A 1FP1D 3W6JB 2B0LA 4EVIA 2Q0OA 2G9WA 1N25A 2UZKA 3HYIA 4A0ZA 3BJOA 2ELKA 1D0ZA 1XSVA 5L3EA 3LSJA 4G7ZF 1E3HA 2UUZA 3GZ6A 1Y1VJ 2DBBA 4XLNF 4G6DA 2R7QA 1NG6A 3K4BA 1D8KA 2EV6A 3NARA 2R5ZA 1D1BA 4MTEA 1V5GA 1YYVA 3BZ6A 5DD4A 4O3MA 4JX5A 4U0WA 4RGSA 2K4JA 2LK2A 1HKQA 3DP7A 1FYKA 1SAUA 3QYFA 4FE7A 3BTJA 1G59A 2XGDA 1X19A 4RGRA 4LLNA 4Y17A 3IC7A 1UMQA 3PM1A 2JA8J 4ZZDA 3D1NI 3R61A 1ZTRA 3ZMSA 3A4CA 2IGMA 1TTYA 4LMYA 1HCRA 2ZKZA 4MFDA 4YIRX 2DW4A 1UG0A 2OTJI 1QVUA 3WU2C 2EB7A 2LKPA 3OYAA 3E6CC 3S2DJ 2RQQA 2IA0A 1R6RA 3ASOH 3WGGA 3A02A 2R7OA 4EQQA 3HKZA 2HU9A 2P4WA 1FOYA 3DEEA 3F8BA 1Y0NA 2VC1A 5TRDA 2KKOA 3COAC 2Q2EB 2AXTC 1FNNA 2Y2ZA 4JBAA 5D5XB 4BGDA 3G73A 3D5RC 1T33A 3ZMDA 3TO7A 2FE3A 3K6GA 3QU6A 4D5FA 2DOFA 2DQRA 4R79A 3P9IA 3QP5A 2COMA 2CV2A 3S17J 3T8TA 1JTXA 2QQAA 3WTZA 2JRMA 1RRJA 2FQ4A 4HLXA 4AYBN 4BE1A 1W4MA 3GBGA 1G3TA 4IJAA 1JUPA 2MG4A 3PO3J 4LFUA 5DM6F 5F6FA 2JPCA 4CA0A 1NK2P 1B9MA 2X6WA 4IEJA 3W2VA 3CD6I 3ZQIA 2CO5A 4B3AA 4HNUA 1VQ8I 2E1NA 2KZGA 3I59A 2E1CA 1FTZA 1EKEA 2OQGA 1OQYA 4AUXA 1QZZA 4X6AJ 5E3OA 4KITB 4Q4ZF 1RESA 2VQCA 2JQ7A 1MJBA 5LLQA 2EQRA 2JA7J 3B02A 4N4OB 4A3DJ 1HKTA 1ZAOA 3CDIA 4HNVA 5CVVA 4CUGA 1ERDA 3BZCA 3KEYA 4RA2A 1ZRDA 4E7HA 5DCFA 2I8DA 1BOBA 2LKXA 1OCTC 2Y0SN 4JYKA 1A36A 4LIVA 1E3OC 1HF0A 4WXDA 3OS2A 3H9GA 3F21A 3CCVI 1JT6A 4ZH4F 3KP3A 2BOLA 4IL6C 3VEPA 1I3QJ 3MEXA 2IAIA 2CWEA 3Q9VA 2DFIA 5CVJA 2Y9ZA 1ZYRF 3H36A 4EM0B 2R0QC 1KQ8A 2OCEA 1B72B 2LMDA 5F0CA 4Q47A 1K83J 3CDHA 2MH9A 1TWAJ 4KICA 3ZQCA 3FXLA 5J6XA 1T0FA 4M3EA 2CV0A 2GA1A 2VJ4A 2LTPA 2BVLA 1BI3A 4I0AA 4A3CJ 1W5CC 4R8HA 4IPAA 3LAJA 2B63J 5E1ZB 5IYBJ 3CZ6A 2AQFA 3E7LA 1U8BA 1TWCJ 2PX9A 3O6BB 3TP0A 3QP6A 1T98A 2W24A 1JUSA 2KIUA 2M87A 4D7MA 2DPDA 3G3ZA 3OMYA 3QODA 1IJWC 3DU5A 4ZYAA 2DOEA 3QPTA 4PJ0C 1ZGAA 2DA7A 2KIMA 3FMSA 2Y75A 3P5JA 5F04A 2O6GE 1MH4A 4NC6A 1MZBA 4MQVA 3RJPA 2GA2A 5GAHJ 2X9DA 1T39A 3F9KA 1MBFA 4Y15A 1S9HA 5IT9Z 1S6LA 3O8GA 4A5MA 1QO0D 2MLKA 3VPRA 5B3SH 5JLWA 3FWEA 3RI4A 3GTPJ 1F36A 2E7WA 3LA7A 3S1QJ 2FUG2 3CJQB 2ACJA 1WJBA 4ZDLA 3BPVA 3FBNB 4E4HA 1T56A 4PCQA 2DMUA 2CW8A 4MHGA 1YS7A 1PUFA 2R7ZJ 4A3JJ 2VN2A 3S8PA 3A0BC 5FKLA 4QSHA 2XHKA 1UHWA 3ESWB 3ZMTA 3PIOF 1J75A 1FPQA 1TW2A 2QKLB 2AS5F 1G3SA 3BJAA 1BR2A 1D1CA 2L7KA 4CH7A 3HDDA 5IP6A 2Z5UA 4A3LJ 2XSJC 2WTEA 1IRZA 2RVCA 3DLLF 3S15J 3BR0A 1RI7A 3G2BA 4M3FA 4O5VA 3HRUA 2XROA 3S3OA 3DTIA 1MMSA 1X3ZB 2BY3A 3VSKA 2W25A 1TT0A 4AC0A 3LSRA 1JGSA 2F2EA 2HVQA 1HKSA 2ZC2A 1ETOA 4LGWA 4AVZA 3OOUA 3HOVJ 3A03A 5CQGA 2MD0A 2FU4A 5KNLA 5FGMA 1G8XA 4EGYA 4OIPF 2BE5F 4FISA 2ZO4A 2LY9A 4G94A 4L5IA 3RKQA 3CC2I 1FYLA 3BROA 3K70C 5J8CA 2O9LA 1O57A 4U0VA 4B09A 4UY8I 3C7JA 3Q5FA 2F5FA 3L9FA 1OYIA 1BI0A 2EH3A 3CP2A 5E1WA 5EG0B 1SC7A 2IPQX 2OUMA 1T08B 4EJOA 2X1CA 4KNYA 2XKOA 1ITYA 1JT0A 3ERED 2HGCA 2JUGA 3RYRA 4N4NB 2CUFA 5A2QZ 2XGEA 2G7HA 4XKVA 2EIJH 3VB2A 5L3DA 4PGHA 5HNFA 1IV8A 2A5YB 5JR3A 5C3EJ 1TNSA 4BNCA 2TDXA 1EH6A 3RDIA 3CC4I 1E0EA 2EIMH 1I50J 2GOXB 5EJCA 5AONA 5J8FA 4E7ZA 1FY7A 1KQ9A 5J1UA 4E7KA 3F8NA 2R7XA 5EGOA 3MKYB 2W7NA 4NNJA 3OOPA 3ZQFA 2P5LC 1MJAA 2XVCA 4BHBA 3CCRI 1X58A 2HYFA 4L9JA 2VKEA 1SFUA 4HOBA 4BAYA 3JRFA 1MSEC 2HFHA 1IUYA 1JHFA 1IV6A 4GYIA 1WH7A 2O3FA 4NC7A 2DA5A 1TL8A 5HNHA 3DBRB 2L7ZA 2DQLA 3DKYA 1MW7A 3TO9A 1VQPI 3QOPA 2ZNZA 3PFIA 2BXZA 1SMYF 1YQAA 3CF5F 3OS0A 3DTEA 2JPBA 1ZR4A 2F5EA 2HDCA 4E7SA 5LGTA 2X85A 2EA4A 2HQAA 4RM3A 4FCYA 1VQ9I 1OR7A 4L9NA 4L0YB 1MBJA 2FNAA 5EDNA 3CCSI 3E1SA 4HQMA 2IRFG 1K7AA 3OL4A 2W4SA 2DJNA 3I5UA 5GTIC 2XRLA 5F64A 3JRDA 2IS6A 3K4MA 2OV7A 1R4MB 4AIJA 5J1YA 3GTKJ 3HXLA 3TBIA 1R1UA 3JSPA 2L7MP 2LBFA 2LOOA 4DIQA 5AIPA 3WTYC 2EFPA 1J5YA 2RGVA 2IS2A 1I5ZA 3IHUA 4HSTA 1U2WA 2NVUB 3TOBA 2VOOA 4ANJA 5K7HA 2W84A 2XAGA 4QTRA 3ZXSA 4UVBA 2E2HJ 1SFKA 4WF2A 2R7RA 1TT5B 3KYDB 3SDBA 3KYLA 3H3VK 2M7BA 2PEXA 3PIPF 1Y8QB 2FBIA 1B8IB 3HSRA 3KE2A 3LSHA 1H8AC 3WE2A 4CDGA 4RDUA 1F9NA 4RAZA 1V5EA 3RPUD 5DDGA 1GV2A 4DQ2A 5DUKA 2BV6A
chains in the Genus database with same CATH topology
2B7EA 2E71A 2JUCA 2KISA 2KIQA 2KZGA 1UZCA 2DOFA 2K85A 2L9VA 2LKSA 4FQGA 2DOEA 2CQNA 2KFDA 2DODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  2E71 A;  2JUC A;  2KIS A;  2KIQ A;  2KZG A;  1UZC A;  2DOF A;  2K85 A;  2L9V A;  2LKS A;  4FQG A;  2DOE A;  2CQN A;  2KFD A;  2DOD A; 
#chains in the Genus database with same CATH topology
 1X3W B;  1Y8R B;  1W1W E;  3DBL B;  4UXN A;  2IVM A;  2WB1 N;  4ETS A;  1LB2 A;  4L5E A;  5BOX A;  4HW0 A;  3ZQH A;  4NB5 A;  1TZL A;  2MSY A;  1LDJ A;  4GCV A;  5IT9 K;  2Q1Z B;  1SFE A;  2CQQ A;  1U5T C;  5AIQ A;  1IDZ A;  2DK5 A;  2MW8 A;  4CGZ A;  1XMX A;  3OYE A;  4BE0 A;  2XGC A;  2ZSI B;  5J4V A;  1P4A A;  2WV0 A;  4J00 A;  4G9Y A;  3GTG J;  3MD2 A;  2IT0 A;  2JN6 A;  1KU3 A;  4M3D A;  2ELH A;  4ZYD A;  4Y3O A;  4MEX F;  4I7H A;  4B48 A;  4C2M J;  1P92 A;  4FE4 A;  5EZG A;  4E7L A;  3RTR A;  4XMY A;  2VI6 A;  1F5T A;  1RUO A;  3M9A A;  3I53 A;  1T95 A;  3G71 I;  2D1H A;  4M9Z A;  3H3U A;  3HEF A;  3M1E A;  2MAB A;  2E1O A;  3QYE A;  5HOD A;  4D0P A;  4M71 A;  2HQR A;  3BG9 A;  4ITV A;  1Y39 A;  5FRN A;  4Y4R A;  1FLI A;  3K1P A;  1DPR A;  4EGZ A;  1J0R A;  3HUG B;  4G6Q A;  2E34 A;  2CQX A;  2M45 A;  1YIT I;  2EFQ A;  4ZYE A;  2ZFU A;  4QWQ A;  3HL2 A;  4UHT A;  1W7P B;  1TWF J;  2RNG A;  1EF4 A;  1ZRF A;  2BEO A;  2Y0M A;  2PMU A;  1ZQ3 P;  5GP9 A;  3LL7 A;  2G7U A;  1VQ4 I;  1IN5 A;  1PVE A;  1FSH A;  1HW1 A;  3LST A;  3OYM A;  2OCC H;  3OYB A;  1FBS A;  4LOC A;  4MLO A;  1ON1 A;  3BJ6 A;  1WJF A;  4ENK A;  4A3G J;  2FRH A;  3J7Y J;  3KX2 A;  1EA3 A;  4FQG A;  2CGP A;  4C2T A;  1QGP A;  1UST A;  3F72 A;  2XAJ A;  2KDO A;  1XPX A;  3O2P E;  4XN0 A;  2YPR A;  3S1R J;  1X3U A;  2NVX J;  5A2Q K;  1YO5 C;  4XID A;  1ZRE A;  3HM5 A;  1KZH A;  1AA7 A;  1YRN A;  1UZC A;  1RKT A;  3C2H A;  2V9P A;  4XQF A;  3HOZ J;  3ZGK A;  1BR1 A;  2P6T A;  3C2B A;  3HB9 A;  5KK1 A;  1QZY A;  5K7F A;  1YW9 A;  5ILU A;  2KIQ A;  4E7I A;  3JSO A;  3AAF A;  2GAU A;  2QVO A;  5J4Y A;  3TW7 A;  5JFR A;  1HDD C;  3I3L A;  3RYP A;  3BDD A;  2R4G A;  2F5C A;  1KU7 A;  2IS4 A;  1HXD A;  3A01 A;  4E7J A;  2LSO A;  3HHH A;  4XR6 A;  1BA5 A;  5K5O A;  2WAQ N;  1X4P A;  2V4J C;  4BE2 A;  4M9X A;  5CQE A;  5L3F A;  3K70 D;  4ZZL A;  4HX7 A;  1RUN A;  3CO7 C;  1FOK A;  3RZO J;  3KYC B;  4YIF A;  3EDP A;  3KP6 A;  1H89 C;  4V2F A;  3F8M A;  3UNG C;  3LOC A;  2OC6 A;  3FM3 A;  3KP4 A;  3PNV A;  1QPI A;  1ZRC A;  4Y7N J;  1U8R A;  3VWB A;  3CCL I;  3OSF A;  2FJ1 A;  3PUF A;  3CP8 A;  1AKH A;  3OYI A;  2FBK A;  4BDY A;  3CUQ A;  3KCC A;  1YW8 A;  1CF7 B;  1RKW A;  3OL3 A;  1D1A A;  2NS0 A;  2DMT A;  3LSM A;  3EUK L;  1XGS A;  5D5V B;  1LVA A;  4M74 A;  4AM3 A;  2M2E A;  3OS1 A;  2WAE A;  3O8H A;  4XRS A;  3S2H J;  1MIJ A;  2NS7 A;  2E2I J;  3WHC A;  1RNL A;  2QBY B;  2P8T A;  1VFC A;  1IDY A;  3Q0W A;  3PUB A;  1Y0U A;  4ZYG A;  3FDY A;  4AID A;  4M73 A;  4BJ6 C;  4RBO A;  5JHF A;  3HTU A;  2HOE A;  3HOW J;  3E6D A;  2I5U A;  1A6Q A;  1F1Z A;  1B9N A;  2XV4 S;  3HPG A;  1X1C A;  3RKX A;  4HLY A;  2JVH A;  1S7O A;  5HS8 A;  1IUF A;  1IW7 F;  2CFO A;  2KLO A;  3HRT A;  2XAS A;  3L2U A;  1AWC A;  3ZP5 A;  2BYV E;  1DUX C;  4BY7 J;  2M5W A;  1NK3 P;  3KPH A;  1ORK A;  3MZ8 A;  4ASN A;  3JRH A;  1BW5 A;  4XLF A;  4IOC F;  2Z1D A;  2R3S A;  2F4M B;  2YU9 J;  3IH2 A;  3VYT B;  1V3F A;  4IHX A;  2EJR A;  3B6C A;  4ESJ A;  5FD6 A;  2O61 A;  3OYH A;  3TDU C;  3I64 A;  1VQ6 I;  2L7F P;  1LKX A;  1R1V A;  4AIH A;  2V1N A;  4IXA A;  2QQ9 A;  5DCM A;  1NTC A;  2K02 A;  2H8R A;  2R7D A;  3JRC A;  3FMR A;  4IHT A;  4UB8 C;  4KDP A;  2M3A A;  3DPT A;  2DT6 A;  5BPD A;  1WZ2 A;  4F93 B;  2HKX A;  1BM9 A;  1ZLK A;  4UUV A;  1NHA A;  3RSN A;  1ON2 A;  1R58 A;  5F1R A;  4BQQ A;  1YIO A;  2ISY A;  3VOD A;  1VQN I;  3MFK A;  5LFA A;  5CVR A;  2VKH A;  4LG0 B;  1GXP A;  3CLO A;  3IKV A;  4EV0 A;  4CZC A;  3J7Z I;  4BXU A;  3GTL J;  1STZ A;  3WTX C;  1GDT A;  3LAP A;  1B59 A;  2VKV A;  5FKM A;  3BZK A;  4U7B A;  2QQ8 A;  1SAX A;  2MYS A;  1JKP C;  1HOM A;  4HEA 2;  2XPW A;  3FXM A;  1WGX A;  2ME0 A;  2F5V A;  4W1U A;  2JRT A;  3JW4 A;  2WAF A;  3V7S A;  4U87 A;  4MFE A;  2DK8 A;  3RKW A;  2H27 A;  3AG1 H;  3EUH C;  2KHM A;  4EMS A;  1PP7 U;  1TC3 C;  3DF8 A;  2IA1 A;  2VBY A;  1KU9 A;  2RDP A;  4F55 A;  1WPK A;  4HG2 A;  4NC8 A;  2V1U A;  2M8E A;  4A6D A;  1BC8 C;  4CIC A;  1JTY A;  3OWT A;  4L9V A;  3HG9 A;  1FYM A;  1IXR C;  1S5L C;  4I98 B;  4ZC3 A;  4CXF A;  1KYW A;  2YU3 A;  4F91 B;  1SFO J;  3IWZ A;  3HSF A;  4AD9 A;  2QSG X;  2Q2E A;  2EV0 A;  4JX4 A;  1QNT A;  2STT A;  3PL8 A;  4RGU A;  2OQR A;  3WGH A;  3ULQ B;  1LUJ B;  2VIX A;  3HHG A;  3L7W A;  1LE8 B;  5BQT A;  2CMP A;  3QOE A;  1N78 A;  3M1C A;  4XLP F;  4AIK A;  1IC8 A;  4BS9 A;  2Z16 A;  5FFZ A;  3TQN A;  3CES A;  2GWR A;  3OIO A;  3K4L A;  3L2C A;  1VQM I;  2X0L A;  4NQW B;  3F22 A;  4I6Z A;  2KIS A;  1MNM C;  3RQ4 A;  1ODD A;  3GTO J;  2ZME B;  1LDD A;  2K3P A;  2MBF A;  1IG7 A;  2B9S A;  4BKX A;  2HXI A;  1TNT A;  1TW3 A;  4CO8 A;  2O03 A;  2BXY A;  2JA2 A;  2O5R A;  3BR5 A;  3GLL A;  2YR2 A;  3S32 A;  4BDZ A;  3BY6 A;  1MBG A;  1IXS B;  2K5C A;  2QA4 I;  5D6F A;  4MGR A;  2LNB A;  5E3M A;  3KIO A;  4A2U A;  3I4P A;  2YSR A;  3U21 A;  2DTR A;  1OPC A;  2XF6 A;  4PZJ A;  4F52 A;  2E60 A;  3GTJ J;  3SQN A;  1DP3 A;  3E0J B;  3OYL A;  1G3Y A;  5K5R A;  4BHP A;  2JMW A;  5CYV A;  3HKZ N;  1V5F A;  4I99 C;  1OJL A;  2CFX A;  5D8K B;  2V79 A;  1YS6 A;  5D5W B;  1QRY A;  1B72 A;  2ECC A;  5GPC A;  1X1P A;  1Q1V A;  3OYN A;  3ZOB A;  3JRB A;  1KYZ A;  5B66 C;  3BLY A;  1PDN C;  1EH8 A;  2K7L A;  4WXC A;  3U9G A;  3K2Z A;  5FB2 A;  2E2J J;  3GFJ A;  2C6Y A;  1DU0 A;  2EZH A;  3G6E I;  2NXN B;  1I3A A;  2W82 A;  3TMO A;  1HA8 A;  3PO2 J;  2RRE A;  2WY7 Q;  3KP5 A;  3CJN A;  1WJE A;  2L4A A;  2HDD A;  2FF4 A;  4U7D A;  4PJN A;  3GME A;  4CCM A;  3JTG A;  1MMD A;  4OIN F;  1FT9 A;  1OYY A;  2XDV A;  1U5T B;  4RB0 A;  2XAH A;  3H1C A;  1KQ0 A;  1MDM B;  3U1D A;  3L2Q A;  1Z9C A;  1HW5 A;  2X6X A;  4IRI A;  2HYJ A;  2X1E A;  4CYC B;  1X1A A;  1ZR2 A;  2P7V B;  3BQY A;  2LD5 A;  2CW7 A;  1J09 A;  1R5I D;  5JI6 A;  1ZLJ A;  4XKW A;  1APL C;  3I4N J;  1Z21 A;  5DM7 F;  1Z1D A;  3UR3 C;  3N4M A;  3LQQ A;  4A3I J;  4GRI A;  5IYC J;  2IGK A;  2JVG A;  2EK5 A;  2OU2 A;  2LKS A;  3NWS A;  2M0C A;  2XRN A;  3DQV C;  1O3S A;  2RN7 A;  3GVA A;  2R5Y A;  2QF7 A;  1BJA A;  2WV1 A;  4CZZ A;  1S7A A;  1BOA A;  5E3N A;  3L09 A;  1E2X A;  1TWG J;  2HQ5 A;  2L0K A;  1FIA A;  1N75 A;  1ZH5 A;  1IF1 A;  2VE9 A;  1DU6 A;  2XF7 A;  2KPM A;  2A05 A;  2CJJ A;  1H88 C;  2HZT A;  2YX7 A;  3FKI J;  2VJ5 A;  2DN0 A;  2KJC A;  1S7E A;  2VT3 A;  3S3N A;  1RZ4 A;  4LLG F;  1FOW A;  2EFO A;  3D5S C;  4WX9 A;  5LD2 C;  1YLF A;  3FK6 A;  3H5N A;  2BY0 A;  4OAY A;  1P6R A;  2HPM A;  1R5G A;  1TQM A;  1IN4 A;  1FX7 A;  2KRF A;  3LSP A;  2M7A A;  3DFG A;  5GAG J;  2HR3 A;  3GYH X;  3HTS B;  1VQK I;  4K2E A;  4WK8 F;  2PBI A;  1G3W A;  3TGN A;  1Z3Y A;  5EG0 A;  2QYO A;  4IOA F;  1WFX A;  3V42 A;  1XS9 A;  2HS5 A;  4OIQ F;  3JAM Z;  4HV6 A;  4IF4 A;  2L9V A;  2EZI A;  4B8X A;  2DTZ A;  4P55 A;  3BTC A;  2XAQ A;  2M4K A;  4IQJ A;  3PJR A;  4WCG A;  4C2U A;  1ETY A;  2ZB9 A;  3A0H C;  1D3Y A;  4A5N A;  1FC3 A;  4LK0 F;  4EAT A;  1J9I A;  1W0T A;  1AOY A;  1GXQ A;  1ACI A;  3DPL C;  2HOT A;  2LFB A;  1D5V A;  3REO A;  1WKM A;  3JTH A;  1PYV A;  3BPX A;  1A6I A;  2ECB A;  3FXR A;  2A69 F;  2BHZ A;  4I76 A;  3V8L A;  4CCK A;  1HBX G;  2XC7 A;  2JUC A;  3ABK H;  2FD5 A;  2LG4 A;  1SVO A;  4XM3 A;  2NYX A;  3C2G A;  3ECH A;  1FEX A;  1D8J A;  5K1Y A;  3F6O A;  1R5H A;  4XON A;  3W2A A;  1RC9 A;  1O3T A;  1T6S A;  3ZN0 A;  1XCV A;  4PSW A;  3TOA A;  2LRE A;  3EQL F;  3DU6 A;  2QEN A;  1H9G A;  1VF9 A;  2FOK A;  2N8G A;  1MBE A;  3Q9S A;  4RM2 A;  1S3J A;  2YUS A;  1ETV A;  3IAS 2;  4XKB A;  4IHW A;  4G7H F;  1XB4 A;  4YG2 F;  4FX0 A;  1Z6T A;  1MH3 A;  2D5V A;  1R49 A;  4CSW A;  2GZW A;  1VTN C;  2R7S A;  1IO2 A;  3V4G A;  1WSU A;  3OV8 A;  3M3Y J;  3TED A;  1OYW A;  4G8X A;  4ESF A;  4XRS G;  2ZNY A;  1JXS A;  4M72 A;  2OF7 A;  1OCR H;  3CDL A;  4UUS B;  2ADU A;  5TJJ A;  5B1A H;  2FML A;  1HC8 A;  1ZG3 A;  3F8C A;  4HNT A;  2QSF X;  2P5V A;  2HVR A;  2QGU A;  5E18 F;  1TBX A;  2X4H A;  4WWC A;  2E35 A;  1J7K A;  3LSG A;  2LVS A;  5DS9 A;  4GXO A;  5E3L A;  2BZT A;  2XB0 X;  2BY1 A;  3AKZ A;  3IRQ A;  2XF5 A;  3MQ0 A;  1ZHF A;  3I71 A;  4XOP A;  1UHS A;  2ZME C;  5B1B H;  1W0U A;  1G4D A;  4A6E A;  4IKF A;  4PDK A;  1W7P D;  3MN2 A;  2CQN A;  2Y31 A;  3OIP A;  3R60 A;  4E70 A;  3ABM H;  3HOX J;  2RQP A;  4XLA A;  2BBY A;  2VJI A;  2EFW A;  2HKO A;  2IEK A;  4UVA A;  3JR9 A;  3MCZ A;  1CQT A;  5DV5 A;  1B8I A;  5CLS A;  2R7W A;  2G0E A;  1SD6 A;  1XDU A;  5EGO B;  2AHQ A;  3E5Q A;  1CGP A;  4FX4 A;  3CF2 A;  2CW0 F;  3FXU A;  4FT8 A;  2DYS H;  3MKZ A;  2JA5 J;  2IA2 A;  3HZJ A;  5HDG A;  4BYY A;  1Z6R A;  2VC0 A;  4XIC A;  4B43 A;  1WHU A;  2I10 A;  2OA4 A;  2ZSH B;  1XN7 A;  2VQG A;  5KCM A;  5M5Y J;  5FD5 A;  2AXL A;  1MNE A;  2K86 A;  1ZAR A;  2A68 F;  1Y56 A;  2OJE D;  3FM5 A;  3ONQ A;  2M30 A;  1OCC H;  3CCJ I;  1UFM A;  3SEZ A;  2LDU A;  4BH9 A;  1FMW A;  4H0E A;  2W57 A;  5FLM J;  2VQL A;  3KET A;  1B4A A;  2F5D A;  2KMU A;  2KFD A;  4YFN F;  1LEA A;  2EPF A;  2Z2S B;  2VBX A;  1L3L A;  3RQI A;  1K78 A;  1V54 H;  2HZD A;  1PP8 F;  5GAD J;  2HOS A;  5FLX Z;  3VDX A;  3E97 A;  2ZXH A;  3I54 A;  2VPL A;  5ICG A;  4KIS A;  3FBI B;  4YFK F;  4BQO A;  1GT0 C;  4F7Z A;  1YOV B;  4ENM A;  2KJB A;  3S1M J;  1ONV A;  1QPM A;  4QPO A;  3ASN H;  3TDZ C;  1U6G A;  4XBF A;  1OLT A;  3OYK A;  1W5S A;  3OSG A;  2JSC A;  2FQ3 A;  4RB2 C;  3HC7 A;  3HOT A;  3HUG A;  4XSZ F;  2HNH A;  1SFX A;  3HOS A;  2GXB A;  3H92 A;  5GTH C;  4NHJ A;  4Z6Y A;  5ICF A;  2P6S A;  1XSD A;  2Z99 A;  2LBF B;  1W7P A;  1HLV A;  3CQZ J;  5F08 A;  2ZJP F;  1XGM A;  3FXK A;  4P9U A;  2ME6 A;  5LEK A;  2K40 A;  2YX4 A;  3AL0 B;  3FZV A;  1OIS A;  5E8I A;  1ZG1 A;  2XGX A;  2WY8 Q;  2CRG A;  1MSF C;  2O0Y A;  5FKO A;  3NQO A;  2EIL H;  3ZN1 A;  2STW A;  2WBM A;  2Y69 H;  3J81 Z;  5F1J A;  1GVD A;  3JAM K;  1OMI A;  2BY2 A;  5E1X A;  2D2W A;  3N97 A;  2CUZ A;  3TO6 A;  3HBL A;  3VFZ A;  3H0G J;  3FHN A;  1LQ1 A;  3P7N A;  3GCM A;  3WTV C;  3VOE A;  3FXQ A;  3ERM A;  2R92 J;  3U1K A;  3QQA A;  1YJW I;  4P1W A;  3ZQ7 A;  2K9S A;  4ABZ A;  1SEU A;  1XTA A;  4BHC A;  3B73 A;  2A6H F;  2ZJR F;  3LSK A;  3DTK A;  3DWL E;  2FX0 A;  5D4S A;  2VE8 A;  2FMY A;  3SEQ A;  2BGC A;  3L00 A;  4N0B A;  1RET A;  1HQC A;  1SMT A;  2QSH X;  3RPU A;  3K1N A;  4A0Y A;  2KZV A;  1TQP A;  1ZEL A;  4HDU A;  3BG3 A;  1A04 A;  1FBQ A;  4XLH A;  3T8R A;  2CQK A;  1T8I A;  1X2M A;  3K4C A;  4KIB A;  3QWL A;  3S2W A;  2VLA A;  3F0C A;  2ICW G;  4DW6 A;  1PJR A;  5IY5 H;  2XIG A;  4A12 A;  2IS1 A;  1BIA A;  4KN7 X;  2P7C B;  1RPW A;  2X6Y A;  3ZMZ A;  1LFB A;  2VQH A;  3BCB A;  5ICE A;  4MTD A;  2ZJQ F;  4CHU A;  2IXS A;  4RS8 A;  5CVI A;  5D6E A;  5EEA A;  1XD7 A;  3LSI A;  4Q48 A;  1R36 A;  2WAQ A;  1MMG A;  1CF7 A;  2RNJ A;  4C3I J;  1WCM J;  2VB6 A;  4KMF A;  4XRM A;  4C3J J;  5HDK A;  3KEQ A;  2DYR H;  3DXJ F;  1MMA A;  2ZXI A;  3BR3 A;  2CG4 A;  3BQZ A;  3CLQ A;  4M3B A;  2QKM B;  2QBY A;  4G7O F;  3WTW C;  1WI3 A;  2L9R A;  4DYC A;  4UV8 A;  1A35 A;  1Z0X A;  3X2Q H;  1WJD A;  3LMM A;  1YE9 A;  4ON0 A;  4B47 A;  2GOM A;  1XG1 A;  3OY9 A;  4NUB A;  1AHD P;  2MLG A;  4KT6 A;  4DJA A;  2DFF A;  4XN3 A;  5HLI A;  5EEG A;  1KU2 A;  1KA8 A;  5L3B A;  1GUU A;  3KP7 A;  3NRV A;  4KMU X;  3I56 I;  1KGS A;  2EBI A;  2XPU A;  3AG2 H;  4CCO A;  3GWZ A;  4MNU A;  3E6M A;  3K69 A;  1QHG A;  5LBQ A;  5BMZ A;  4DBR A;  5KAF C;  5FJ8 J;  3GFL A;  3BG5 A;  3E3V A;  5GAE J;  2GM4 A;  1MJ9 A;  5FKK A;  4HF0 A;  4P9F A;  2BVM A;  1Z7U A;  3V8K A;  2PMZ N;  1L0O C;  1RR7 A;  3DV8 A;  3GZ5 A;  1T2K A;  5ERI A;  2Z33 A;  2DO7 A;  3C18 A;  1ETW A;  1OFC X;  3L2R A;  5K5Q A;  2DCE A;  3SHF A;  1C0W A;  4JQF A;  4YEL A;  3R0A A;  1J59 A;  4GFB A;  1JI8 A;  2NVQ J;  5HLG A;  2P81 A;  3OYD A;  2V26 A;  1MMN A;  1ZN2 A;  2ID6 A;  2HDW A;  2MGQ A;  4MQ9 F;  2RKH A;  4ZDP A;  1REP C;  3QPL A;  3NAU A;  1LEB A;  3ZCO A;  5H6Q A;  4D5C A;  4NDL A;  2MC3 A;  2HPI A;  4OAZ A;  1RR8 C;  4V2G A;  4IHS A;  2UV1 A;  4A3E J;  3H35 A;  2VAS A;  2DDB A;  2RC4 A;  3MMY B;  3P9C A;  5D4R A;  3BP8 A;  3ABL H;  5FLX K;  2M4G A;  1YJ9 I;  2KIF A;  3WE3 A;  4IQ4 A;  2V6C A;  2H8W A;  2MA3 A;  2DLL A;  2BHY A;  3I58 A;  1R1T A;  5GPA A;  2ISZ A;  2O8K A;  4ZTF A;  2DAO A;  2DMN A;  2K9Q A;  3IWF A;  4MIM A;  2PJR B;  2MH2 A;  4PSX A;  2DDA A;  3Q0U A;  1A31 A;  3OR1 C;  2GXA A;  3HPH A;  4M6X A;  4OIO F;  4XKC A;  2BW3 B;  2EIN H;  1DDN A;  4II3 A;  3H9Q A;  4H4K C;  3WTU C;  1W36 C;  1XGN A;  3SXY A;  4D1Q A;  1G6N A;  2L02 A;  3ZMU A;  4BEH B;  3L1P A;  1YHQ I;  2B7E A;  1F43 A;  1OR7 C;  1LFP A;  1UJ8 A;  2XPV A;  5LHI A;  1IGN A;  1DP7 P;  2IW5 A;  1LE8 A;  3TP3 A;  2M9H A;  4ENN A;  4ZTJ A;  5LEJ A;  4IHY A;  2H6B A;  2V7F A;  2FOW A;  1VQO I;  1VQL I;  3FF5 A;  3DKW A;  4RLQ A;  4LK1 F;  1K79 A;  2A61 A;  3TL4 X;  4NQW A;  2KRC A;  3Q0V A;  2ZME A;  2R7F A;  3CCQ I;  2MFZ A;  4N9I A;  5JHU A;  5DYM A;  4XOR A;  4CCL A;  1EJ9 A;  4PFO A;  1FTT A;  2UXX A;  4M3G A;  2VXZ A;  3JRI A;  3DBH B;  4YEJ A;  5L3G A;  5E17 F;  2NOJ B;  5C4J J;  3WGI A;  4GGG A;  1A5J A;  1ETQ A;  4KJZ A;  4AU7 A;  2PMH A;  3AL0 C;  3AG4 H;  2DT7 B;  2WAD A;  4YRV A;  2E71 A;  4P96 A;  4BL0 B;  4OMY A;  4EJU A;  4DYR A;  4L18 B;  1BJZ A;  2ZCW A;  2W1O A;  2JJ7 A;  4FTH A;  3ML6 A;  4EM2 A;  3M8F A;  4BXF A;  1UEL B;  3ZPL A;  4G12 A;  4QLC U;  1U0J A;  3SZG A;  1FOX A;  5HDN A;  2NOG A;  3G4S I;  3G1O A;  2LLK A;  3HJE A;  2O8X A;  4KUM A;  2EWN A;  2L54 A;  2LYC A;  3FK7 A;  2M1B A;  1PUE E;  1U9O A;  4OU0 A;  2DJI A;  4JX6 A;  4U88 A;  1HSJ A;  2PLY A;  4AWX B;  3O3K A;  1SAN A;  1JKO C;  3H0D A;  5BS6 A;  1ETK A;  3J80 Z;  2VL8 A;  2XUB A;  3MZH A;  1E3P A;  2Q8K A;  4I2O A;  2P0W A;  1IRX A;  1XMK A;  2X6O A;  4EJW A;  3CJT B;  1VZ0 A;  1WQ2 A;  4AYB A;  1EV7 A;  5HS7 A;  4P5O A;  2FEZ A;  2D1V A;  4O6J A;  2LF8 A;  4I0B A;  1JJ8 C;  3D0S A;  4HA8 A;  1GV5 A;  9ANT A;  1LVK A;  1N77 A;  1LNW A;  1SD4 A;  4ESB A;  1IZ1 A;  2LH9 A;  5IP9 J;  2R5Z B;  3EUA A;  4KIF A;  4HPQ A;  2OZU A;  2VBZ A;  3Q3S A;  2QWW A;  3JCU C;  5IP7 J;  2TRT A;  5FKN A;  1BI2 A;  3T1B A;  1U5T A;  4XOT A;  1IXC A;  1I39 A;  1OCO H;  2ZJ2 A;  1MDM A;  1O4X A;  3IAM 2;  1S8N A;  3PSI A;  4KIG A;  4NBQ A;  3S14 J;  4CYC A;  2QUF A;  4QIW N;  2K9L A;  3HIF A;  3LFU A;  2Y0S A;  4YFX F;  3AG3 H;  4HX4 A;  1GHC A;  5CKT A;  4DOZ A;  2M34 A;  3BG6 A;  4PJM A;  4IRG A;  3K10 A;  5LHH A;  2ETH A;  4HF1 A;  2IP2 A;  4S0H B;  1I27 A;  4KT5 C;  4ZDO A;  3GEZ A;  1ZK8 A;  1P2F A;  2K85 A;  3LA3 A;  2VOP A;  2DOD A;  2L01 A;  4M6V A;  1D0Y A;  1UHM A;  4A3K J;  1IAW A;  2ESH A;  3GZN B;  5IPA A;  1VQ5 I;  5BPI A;  2DI3 A;  2HTJ A;  2DMQ A;  3ABT A;  1LFU P;  5J1R A;  5J3L A;  5LGU A;  4EJT A;  2KRH A;  2JZY A;  5B5E C;  2EIK H;  5LRR A;  3DKX A;  1VI0 A;  5M5W J;  4FAS D;  4XLC A;  5E79 C;  1TP4 A;  4UVC A;  2IGN A;  2K4B A;  3I59 B;  4F3Q A;  3H5A A;  1WJA A;  1MKM A;  3WU0 A;  2WWY A;  4A3M J;  4AVP A;  1R9T J;  2O7O A;  2LY1 A;  5M3F J;  2JTV A;  4B4C A;  2COB A;  3V7C A;  3ZMV A;  1BN5 A;  4LD5 A;  2VBW A;  1JE8 A;  1JUM A;  2E7X A;  4RB3 C;  2NNY A;  4X0G A;  2QCO A;  4ENJ A;  3SDG A;  1QA6 A;  1J2X A;  2GBY A;  2PN6 A;  2VON A;  2FA5 A;  4KYW A;  4M9S A;  1XGO A;  2DOA A;  4HV5 A;  1TWH J;  3M07 A;  3WHB A;  1B1B A;  3HOY J;  4B44 A;  1H9T A;  3BT9 A;  1O3R A;  1XCB A;  3IV5 A;  3S1N J;  1YJN I;  2NVT J;  4FHT A;  4N9H A;  3GF2 A;  3H3Z A;  1K4S A;  2V6E A;  2LF7 A;  4KFC A;  2NAZ A;  4PJJ A;  3NWT A;  1FWZ A;  5LHG A;  1YTY A;  3SJM A;  5C44 J;  4A0X A;  2AQE A;  4PGG A;  3RCO A;  2OPT A;  1JJ6 C;  1MD0 A;  2IJL A;  2R93 J;  5C4X J;  4UV9 A;  2MD5 A;  3KZI C;  1RIO H;  3CUQ C;  1I6X A;  3I0T A;  4A69 C;  2Y9Y A;  5FLV A;  4CYD A;  1UB9 A;  2P5K A;  1VQ7 I;  3EYY A;  4HF2 A;  2CSO A;  2WA0 A;  3VYR B;  1YX5 A;  4Y52 J;  2PG4 A;  2ELJ A;  1BC7 C;  4HX8 A;  5JLX A;  2CUJ A;  2R5Y B;  2CQ7 A;  2JWT A;  3M8J A;  1D0X A;  4HSR A;  1B6A A;  5F0F A;  3QPS A;  5FRM A;  3N05 A;  4BQN A;  2E5N A;  2R7T A;  2ZFW A;  3CCU I;  3M4O J;  2M0M A;  2A6E F;  3CCY A;  5H6R A;  2R7U A;  2H94 A;  1JGG A;  3QU3 A;  5ICC A;  1QBJ A;  4RAY A;  4LJZ F;  4JOM A;  4UNO A;  2DA3 A;  3BC8 A;  4LB6 B;  4RMN A;  2PQ8 A;  3A1Y A;  1FBU A;  2W48 A;  4W97 A;  4UUS A;  1R7J A;  4A93 J;  3R0J A;  1W36 D;  2ESN A;  3SZT A;  4DZJ A;  1PUF B;  1SVL A;  1T38 A;  5DEQ A;  1DGW Y;  2L9N A;  4DZP A;  2A07 F;  4TV7 A;  5FO5 A;  3VYU B;  1X1B A;  3A2K A;  3S16 J;  3PQJ A;  3U2R A;  3AFH A;  5D8L B;  4XSX F;  2ID3 A;  1TQI A;  1UAA A;  1U9N A;  1V4R A;  3FHZ A;  3M7G A;  1U3E M;  1YG2 A;  4BXX J;  4BY1 J;  2OZ6 A;  1KON A;  1XX5 A;  5EYR A;  4F92 B;  3JRG A;  3UKG A;  2IBD A;  2E1M C;  4BQA A;  1BR4 A;  3E5U A;  1S72 I;  2KQR A;  5DD8 A;  1WVR A;  3ABU A;  3J80 K;  3LFK A;  5KVR A;  1R00 A;  2HXO A;  1I1G A;  5JVT A;  5IOZ A;  3FXO A;  2DPU A;  4QPQ A;  1NH3 A;  1Z7L A;  2Y30 A;  3P9K A;  1UCR A;  5DUI A;  3FXJ A;  2XSD C;  4FET A;  2FNP A;  3KLN A;  2M8G X;  2ZXJ A;  4Y33 A;  4G6T B;  3B6A A;  2QZ8 A;  3BTL A;  3IRR A;  1YI2 I;  4MO7 A;  3FIW A;  1XDS A;  4BU2 A;  1ETX A;  3ZRG A;  3MVP A;  5ILV A;  3D5L A;  2WC2 A;  3ZR8 X;  3K4J A;  1QHH D;  1EH7 A;  2DU9 A;  4DYQ A;  2OAZ A;  4PK4 A;  5FFX A;  1POG A;  4HQE A;  5BNG A;  4V19 K;  5KHD A;  3J7A Y;  1V55 H;  3CME I;  3R4K A;  2VT2 A;  5ED4 A;  1R23 A;  1ZG5 A;  4LIT A;  1JHH A;  1P7J A;  1IN6 A;  3LNQ A;  3VSL A;  2XB5 A;  3RZD J;  1TLH B;  1Q1H A;  1O3Q A;  3EUH A;  4IO9 F;  5HLH A;  5L3C A;  3FIS A;  2KDZ A;  1WJ5 A;  4L5J A;  4R1H A;  5DTD A;  2JSP A;  5FRO A;  4EM1 A;  1XSX A;  2FSW A;  2HTS A;  3G1M A;  5EZH A;  4DBQ A;  3WTT C;  4PJL A;  3CMM A;  4A3B J;  1NG7 A;  3PFY A;  5H2F C;  2NVY J;  5EF6 A;  4I02 A;  1Y1W J;  3RIR A;  3EET A;  2K9N A;  2DA1 A;  3LWF A;  4MEY F;  1O7L A;  4IVN A;  3I4M J;  1IN7 A;  3FKJ A;  3PNT A;  3L2W A;  3OYF A;  2X51 A;  3KEO A;  4RAF A;  3V7R A;  5CJ9 A;  3WG9 A;  1HW2 A;  2KT0 A;  1FSE A;  2VOD A;  4KA4 A;  5CPR B;  3DEU A;  3MAJ A;  3WOD F;  2WB1 A;  3BOQ A;  4S04 A;  3CUO A;  3FX3 A;  2QM3 A;  4XK4 A;  2HVS A;  2DT5 A;  4DGW B;  1R71 A;  3BWG A;  1BI1 A;  3DCF A;  2V9V A;  4B1R A;  2RAE A;  1YIJ I;  3CTA A;  2GXG A;  1P4X A;  2LC2 A;  4U0Y A;  2VJJ A;  3RKY A;  1XC5 A;  3DEW A;  4Q5S F;  3R6S A;  2VKD A;  2LRD A;  1Z3X A;  1ENH A;  1U78 A;  3CCM I;  3V8J A;  2VXD A;  4A3F J;  3KFW X;  3EYI A;  4HAM A;  2XAF A;  1MGT A;  1X1D A;  3HRM A;  3H5R A;  3SFI A;  4ZYH A;  3EPZ A;  5IYD J;  3IP4 B;  3NEU A;  2IGO A;  2F6C A;  1FZP B;  2F48 A;  1AU7 A;  1SVM A;  1Z91 A;  1GVJ A;  2CV1 A;  2V9K A;  2LY2 A;  5EEH A;  3WG7 H;  3PQK A;  3IUO A;  5TGT A;  2HI3 A;  4BJ5 C;  1IRF A;  2HOA A;  1X2N A;  4C3H J;  1I6H J;  3SFZ A;  4D9J A;  1K78 B;  3T5X A;  1MBK A;  3BTI A;  4XL9 A;  4L0Z B;  3ZQQ A;  3FMQ A;  1R4N B;  3K4K A;  1JKR C;  2K3F A;  1K6Y A;  1P4W A;  1ZGW A;  4ZJZ A;  5LGN A;  4BBR J;  2ZXW H;  3ZQL A;  3G1L A;  2HWV A;  1H0M A;  3JRE A;  3GXO A;  3K9T A;  4BAC A;  2GIZ A;  1DPU A;  1FMV A;  2E19 A;  4EJV A;  4RAG A;  4X1E A;  2AO9 A;  3MWM A;  2VPR A;  3HGY A;  1BBY A;  2LR8 A;  3K0L A;  2L5Q A;  1FP2 A;  3GO5 A;  3TKY A;  3W3C A;  4D7N A;  3F6V A;  3WTS C;  4LG3 A;  2Z3Y A;  4GO1 A;  1IRG A;  2XKP A;  2OBP A;  2H6C A;  1T0F C;  3OYG A;  1M1E B;  4J19 A;  2QQB A;  1DGR M;  4CCJ A;  4HYE A;  3ZQG A;  4CCN A;  3QAH A;  4M6Y A;  1FIP A;  3OYC A;  1K61 A;  1MBH A;  4L9T A;  3MKL A;  3GTQ J;  2GQQ A;  1D5Y A;  3IL2 A;  4IZZ A;  1QZE A;  2QLZ A;  3PNY A;  3ELK A;  2E5Z A;  2L4M A;  3W6K B;  2K27 A;  4II2 A;  1S29 A;  4GDF A;  5IT3 A;  3SZP A;  2A3S A;  4LLL A;  2JK3 A;  4JP0 A;  2EFN A;  3W2W A;  3MZY A;  3VYS B;  3DLA A;  3TW6 A;  1Y6I A;  5TIS C;  4HDV A;  3ROU A;  2DA6 A;  5M3M J;  3C3W A;  3HSE A;  3IH3 A;  5E20 A;  1FJL A;  1BIB A;  2CUE A;  4I01 A;  2JA6 J;  3M8E A;  2PJP A;  2X48 A;  2DFE A;  3OYJ A;  3E5X A;  4IX7 A;  2RV8 A;  2D45 A;  1P7I A;  3DPU A;  4B3X A;  2DXI A;  4XRF A;  1YX3 A;  3CMA I;  3KZY A;  3HRS A;  5JVG F;  4YII A;  3IH4 A;  3CJR B;  3LA2 A;  4OOI A;  3BR6 A;  2LP0 A;  2J5O A;  2KP6 A;  3BR1 A;  1XMA A;  1HST A;  2DA4 A;  4WXH A;  3GFM A;  3CCE I;  1K6O A;  4RGX A;  3SYT A;  3S3M A;  3KLO A;  4DNC A;  1YRN B;  4UB6 C;  3GLX A;  4C9Y A;  6PAX A;  4OMZ A;  2UXN A;  4S05 A;  1SD7 A;  3GW2 A;  4Z2Y A;  1BL0 A;  4UUT A;  2A5W A;  3W6V A;  4BBS J;  2HQN A;  1W5T A;  1QQI A;  5F0H A;  3I9V 2;  2CS3 A;  1WWX A;  1R22 A;  1WJC A;  3RPQ A;  2PMZ A;  2FXA A;  2TCT A;  3KP2 A;  3GFI A;  2CH0 A;  3H9J A;  3A01 B;  1LPQ A;  1QU3 A;  1VND A;  3K2A A;  1LJ9 A;  2NS8 A;  2EZL A;  5J47 A;  1ZGJ A;  2R7V A;  1WRJ A;  1I1S A;  3CMY A;  1JKQ C;  2W85 A;  3IKT A;  3GTM J;  3QPH A;  3BG7 A;  3K7A J;  2X1D A;  1HDP A;  2MC4 A;  4C30 A;  5KAI C;  1O7F A;  2DMP A;  3LQR A;  2V1D A;  5E8G A;  2GLO A;  4HZF A;  3K1M A;  2Z9O A;  2PJR A;  2V1X A;  2H1L A;  2J5P A;  4GYG A;  4HBL A;  4PFP A;  4LG0 A;  2H09 A;  1X4O A;  2YS9 A;  1Z77 A;  1AKH B;  3HGG A;  2H1K A;  2F4O B;  4J01 A;  1K4T A;  3PSF A;  2GIV A;  2EZK A;  3CUQ B;  1WH5 A;  2CU7 A;  3BR2 A;  1Z05 A;  2BW3 A;  3J7A O;  1QVT A;  2F4I A;  4BJT A;  1UG2 A;  3F23 A;  5H20 A;  5HS9 A;  2L2O A;  3I55 I;  3BCA A;  4PUS A;  2DA2 A;  5HLT A;  1G2H A;  4Y13 A;  4BEH A;  2OTL I;  4OWR B;  5ILS A;  3K4N A;  3L2V A;  2NRA C;  5J40 A;  2Y48 A;  2ZBK A;  5HOO A;  1P9Q C;  4IRH A;  1ULY A;  2HEO A;  3CC7 I;  3GUD A;  2NNN A;  2E36 A;  1ZKG A;  3MKW B;  2VUM J;  3QRF F;  4I09 A;  2OD5 A;  3E6B A;  5M5X J;  3OR2 C;  4HRI A;  5D5U B;  2XAU A;  2FBH A;  5F27 A;  1IN8 A;  3WU1 B;  3OIQ A;  1OCP A;  2CYY A;  3JRA A;  1YW7 A;  1YFH A;  1OCZ H;  1GLN A;  2HYG D;  4LIU A;  5HVQ C;  4RLF A;  3CO6 C;  3HOU J;  4OIR F;  2PI0 A;  5CVU A;  2EV5 A;  1Z67 A;  3GX4 X;  1BW6 A;  4JK1 X;  2DFH A;  1DQU A;  2K9M A;  4IHV A;  3S93 A;  1WI9 A;  5IOY A;  3J81 K;  4RB1 A;  2KL4 A;  4E6K G;  2UWM A;  3C1D A;  3F8F A;  4BUP A;  1E17 A;  3F3X A;  5DCM B;  4EEF G;  4KN4 X;  5LRS A;  2PFB A;  1SD5 A;  3KZZ A;  2E1M B;  3QYB A;  2L9S A;  2W00 A;  1OKR A;  4XLE A;  3ISP A;  2QEX I;  5K7Z A;  1F4K A;  1USS A;  4XNF A;  1MND A;  1LDK B;  2L3D A;  3ECO A;  2A6T A;  3T0Y A;  4LB5 A;  2JT1 A;  2EA2 A;  1FP1 D;  3W6J B;  2B0L A;  4EVI A;  2Q0O A;  2G9W A;  1N25 A;  2UZK A;  3HYI A;  4A0Z A;  3BJO A;  2ELK A;  1D0Z A;  1XSV A;  5L3E A;  3LSJ A;  4G7Z F;  1E3H A;  2UUZ A;  3GZ6 A;  1Y1V J;  2DBB A;  4XLN F;  4G6D A;  2R7Q A;  1NG6 A;  3K4B A;  1D8K A;  2EV6 A;  3NAR A;  2R5Z A;  1D1B A;  4MTE A;  1V5G A;  1YYV A;  3BZ6 A;  5DD4 A;  4O3M A;  4JX5 A;  4U0W A;  4RGS A;  2K4J A;  2LK2 A;  1HKQ A;  3DP7 A;  1FYK A;  1SAU A;  3QYF A;  4FE7 A;  3BTJ A;  1G59 A;  2XGD A;  1X19 A;  4RGR A;  4LLN A;  4Y17 A;  3IC7 A;  1UMQ A;  3PM1 A;  2JA8 J;  4ZZD A;  3D1N I;  3R61 A;  1ZTR A;  3ZMS A;  3A4C A;  2IGM A;  1TTY A;  4LMY A;  1HCR A;  2ZKZ A;  4MFD A;  4YIR X;  2DW4 A;  1UG0 A;  2OTJ I;  1QVU A;  3WU2 C;  2EB7 A;  2LKP A;  3OYA A;  3E6C C;  3S2D J;  2RQQ A;  2IA0 A;  1R6R A;  3ASO H;  3WGG A;  3A02 A;  2R7O A;  4EQQ A;  3HKZ A;  2HU9 A;  2P4W A;  1FOY A;  3DEE A;  3F8B A;  1Y0N A;  2VC1 A;  5TRD A;  2KKO A;  3COA C;  2Q2E B;  2AXT C;  1FNN A;  2Y2Z A;  4JBA A;  5D5X B;  4BGD A;  3G73 A;  3D5R C;  1T33 A;  3ZMD A;  3TO7 A;  2FE3 A;  3K6G A;  3QU6 A;  4D5F A;  2DOF A;  2DQR A;  4R79 A;  3P9I A;  3QP5 A;  2COM A;  2CV2 A;  3S17 J;  3T8T A;  1JTX A;  2QQA A;  3WTZ A;  2JRM A;  1RRJ A;  2FQ4 A;  4HLX A;  4AYB N;  4BE1 A;  1W4M A;  3GBG A;  1G3T A;  4IJA A;  1JUP A;  2MG4 A;  3PO3 J;  4LFU A;  5DM6 F;  5F6F A;  2JPC A;  4CA0 A;  1NK2 P;  1B9M A;  2X6W A;  4IEJ A;  3W2V A;  3CD6 I;  3ZQI A;  2CO5 A;  4B3A A;  4HNU A;  1VQ8 I;  2E1N A;  2KZG A;  3I59 A;  2E1C A;  1FTZ A;  1EKE A;  2OQG A;  1OQY A;  4AUX A;  1QZZ A;  4X6A J;  5E3O A;  4KIT B;  4Q4Z F;  1RES A;  2VQC A;  2JQ7 A;  1MJB A;  5LLQ A;  2EQR A;  2JA7 J;  3B02 A;  4N4O B;  4A3D J;  1HKT A;  1ZAO A;  3CDI A;  4HNV A;  5CVV A;  4CUG A;  1ERD A;  3BZC A;  3KEY A;  4RA2 A;  1ZRD A;  4E7H A;  5DCF A;  2I8D A;  1BOB A;  2LKX A;  1OCT C;  2Y0S N;  4JYK A;  1A36 A;  4LIV A;  1E3O C;  1HF0 A;  4WXD A;  3OS2 A;  3H9G A;  3F21 A;  3CCV I;  1JT6 A;  4ZH4 F;  3KP3 A;  2BOL A;  4IL6 C;  3VEP A;  1I3Q J;  3MEX A;  2IAI A;  2CWE A;  3Q9V A;  2DFI A;  5CVJ A;  2Y9Z A;  1ZYR F;  3H36 A;  4EM0 B;  2R0Q C;  1KQ8 A;  2OCE A;  1B72 B;  2LMD A;  5F0C A;  4Q47 A;  1K83 J;  3CDH A;  2MH9 A;  1TWA J;  4KIC A;  3ZQC A;  3FXL A;  5J6X A;  1T0F A;  4M3E A;  2CV0 A;  2GA1 A;  2VJ4 A;  2LTP A;  2BVL A;  1BI3 A;  4I0A A;  4A3C J;  1W5C C;  4R8H A;  4IPA A;  3LAJ A;  2B63 J;  5E1Z B;  5IYB J;  3CZ6 A;  2AQF A;  3E7L A;  1U8B A;  1TWC J;  2PX9 A;  3O6B B;  3TP0 A;  3QP6 A;  1T98 A;  2W24 A;  1JUS A;  2KIU A;  2M87 A;  4D7M A;  2DPD A;  3G3Z A;  3OMY A;  3QOD A;  1IJW C;  3DU5 A;  4ZYA A;  2DOE A;  3QPT A;  4PJ0 C;  1ZGA A;  2DA7 A;  2KIM A;  3FMS A;  2Y75 A;  3P5J A;  5F04 A;  2O6G E;  1MH4 A;  4NC6 A;  1MZB A;  4MQV A;  3RJP A;  2GA2 A;  5GAH J;  2X9D A;  1T39 A;  3F9K A;  1MBF A;  4Y15 A;  1S9H A;  5IT9 Z;  1S6L A;  3O8G A;  4A5M A;  1QO0 D;  2MLK A;  3VPR A;  5B3S H;  5JLW A;  3FWE A;  3RI4 A;  3GTP J;  1F36 A;  2E7W A;  3LA7 A;  3S1Q J;  2FUG 2;  3CJQ B;  2ACJ A;  1WJB A;  4ZDL A;  3BPV A;  3FBN B;  4E4H A;  1T56 A;  4PCQ A;  2DMU A;  2CW8 A;  4MHG A;  1YS7 A;  1PUF A;  2R7Z J;  4A3J J;  2VN2 A;  3S8P A;  3A0B C;  5FKL A;  4QSH A;  2XHK A;  1UHW A;  3ESW B;  3ZMT A;  3PIO F;  1J75 A;  1FPQ A;  1TW2 A;  2QKL B;  2AS5 F;  1G3S A;  3BJA A;  1BR2 A;  1D1C A;  2L7K A;  4CH7 A;  3HDD A;  5IP6 A;  2Z5U A;  4A3L J;  2XSJ C;  2WTE A;  1IRZ A;  2RVC A;  3DLL F;  3S15 J;  3BR0 A;  1RI7 A;  3G2B A;  4M3F A;  4O5V A;  3HRU A;  2XRO A;  3S3O A;  3DTI A;  1MMS A;  1X3Z B;  2BY3 A;  3VSK A;  2W25 A;  1TT0 A;  4AC0 A;  3LSR A;  1JGS A;  2F2E A;  2HVQ A;  1HKS A;  2ZC2 A;  1ETO A;  4LGW A;  4AVZ A;  3OOU A;  3HOV J;  3A03 A;  5CQG A;  2MD0 A;  2FU4 A;  5KNL A;  5FGM A;  1G8X A;  4EGY A;  4OIP F;  2BE5 F;  4FIS A;  2ZO4 A;  2LY9 A;  4G94 A;  4L5I A;  3RKQ A;  3CC2 I;  1FYL A;  3BRO A;  3K70 C;  5J8C A;  2O9L A;  1O57 A;  4U0V A;  4B09 A;  4UY8 I;  3C7J A;  3Q5F A;  2F5F A;  3L9F A;  1OYI A;  1BI0 A;  2EH3 A;  3CP2 A;  5E1W A;  5EG0 B;  1SC7 A;  2IPQ X;  2OUM A;  1T08 B;  4EJO A;  2X1C A;  4KNY A;  2XKO A;  1ITY A;  1JT0 A;  3ERE D;  2HGC A;  2JUG A;  3RYR A;  4N4N B;  2CUF A;  5A2Q Z;  2XGE A;  2G7H A;  4XKV A;  2EIJ H;  3VB2 A;  5L3D A;  4PGH A;  5HNF A;  1IV8 A;  2A5Y B;  5JR3 A;  5C3E J;  1TNS A;  4BNC A;  2TDX A;  1EH6 A;  3RDI A;  3CC4 I;  1E0E A;  2EIM H;  1I50 J;  2GOX B;  5EJC A;  5AON A;  5J8F A;  4E7Z A;  1FY7 A;  1KQ9 A;  5J1U A;  4E7K A;  3F8N A;  2R7X A;  5EGO A;  3MKY B;  2W7N A;  4NNJ A;  3OOP A;  3ZQF A;  2P5L C;  1MJA A;  2XVC A;  4BHB A;  3CCR I;  1X58 A;  2HYF A;  4L9J A;  2VKE A;  1SFU A;  4HOB A;  4BAY A;  3JRF A;  1MSE C;  2HFH A;  1IUY A;  1JHF A;  1IV6 A;  4GYI A;  1WH7 A;  2O3F A;  4NC7 A;  2DA5 A;  1TL8 A;  5HNH A;  3DBR B;  2L7Z A;  2DQL A;  3DKY A;  1MW7 A;  3TO9 A;  1VQP I;  3QOP A;  2ZNZ A;  3PFI A;  2BXZ A;  1SMY F;  1YQA A;  3CF5 F;  3OS0 A;  3DTE A;  2JPB A;  1ZR4 A;  2F5E A;  2HDC A;  4E7S A;  5LGT A;  2X85 A;  2EA4 A;  2HQA A;  4RM3 A;  4FCY A;  1VQ9 I;  1OR7 A;  4L9N A;  4L0Y B;  1MBJ A;  2FNA A;  5EDN A;  3CCS I;  3E1S A;  4HQM A;  2IRF G;  1K7A A;  3OL4 A;  2W4S A;  2DJN A;  3I5U A;  5GTI C;  2XRL A;  5F64 A;  3JRD A;  2IS6 A;  3K4M A;  2OV7 A;  1R4M B;  4AIJ A;  5J1Y A;  3GTK J;  3HXL A;  3TBI A;  1R1U A;  3JSP A;  2L7M P;  2LBF A;  2LOO A;  4DIQ A;  5AIP A;  3WTY C;  2EFP A;  1J5Y A;  2RGV A;  2IS2 A;  1I5Z A;  3IHU A;  4HST A;  1U2W A;  2NVU B;  3TOB A;  2VOO A;  4ANJ A;  5K7H A;  2W84 A;  2XAG A;  4QTR A;  3ZXS A;  4UVB A;  2E2H J;  1SFK A;  4WF2 A;  2R7R A;  1TT5 B;  3KYD B;  3SDB A;  3KYL A;  3H3V K;  2M7B A;  2PEX A;  3PIP F;  1Y8Q B;  2FBI A;  1B8I B;  3HSR A;  3KE2 A;  3LSH A;  1H8A C;  3WE2 A;  4CDG A;  4RDU A;  1F9N A;  4RAZ A;  1V5E A;  3RPU D;  5DDG A;  1GV2 A;  4DQ2 A;  5DUK A;  2BV6 A; 
#chains in the Genus database with same CATH homology
 2B7E A;  2E71 A;  2JUC A;  2KIS A;  2KIQ A;  2KZG A;  1UZC A;  2DOF A;  2K85 A;  2L9V A;  2LKS A;  4FQG A;  2DOE A;  2CQN A;  2KFD A;  2DOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...