2KISA

Solution structure of ca150 ff1 domain and ff1-ff2 interdomain linker
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
GAMGSLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcription elongation regulator 1
publication title Structural studies of FF domains of the transcription factor CA150 provide insights into the organization of FF domain tandem arrays.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kisA00
4FQGA 2LKSA 2E71A 2DOEA 2DOFA 2KISA 2KZGA 2KFDA 2K85A 2CQNA 2JUCA 2B7EA 2KIQA 1UZCA 2DODA 2L9VA
chains in the Genus database with same CATH superfamily
2LH9A 3A4CA 3PL8A 3BTCA 5D6EA 4ENKA 3WGIA 5CQEA 1ETYA 1S5LC 4B48A 1JHFA 3J80Z 3COAC 1YRNA 4ZZDA 2GIVA 4XLPF 4B8XA 3PJRA 3KFWX 4JX6A 4EM0B 3WTUC 1ZR2A 4PSWA 2DODA 3MKZA 5K5QA 2IW5A 4IZZA 4A3KJ 3X2QH 1QHGA 2LRDA 5JLXA 4RGUA 2DW4A 1ETVA 4BEHB 1F4KA 2KDZA 3CQZJ 1GHCA 1I6HJ 1T0FC 3CTAA 5B3SH 1TT5B 4RGRA 1BC7C 3GTOJ 5GAGJ 3BDDA 3C18A 5H20A 3I59A 4IPAA 1ZRFA 1ETQA 3CLQA 1ETKA 1U9OA 1UELB 3RKXA 2B9SA 3GTMJ 2F2EA 2XGEA 3HRTA 5D6FA 2DOAA 3FISA 3GBGA 2ESHA 3KZIC 1WH5A 2ISZA 3WE2A 2ZC2A 2XKOA 3PNYA 2KP6A 4AUXA 2CRGA 1PP7U 5M5WJ 3HRSA 5DYMA 3ONQA 2ETHA 3ZQCA 3G3ZA 3RKYA 4AIDA 1HW5A 3PFYA 4JP0A 3G1LA 4NC8A 4KITB 2CV2A 3OSFA 2M87A 2YPRA 3CUQA 1USSA 2TDXA 4P96A 2DXIA 2KLOA 3IAM2 3HDDA 3IRQA 2JVGA 3LSKA 4FCYA 3HHGA 1SVMA 3E6BA 5KAIC 4NNJA 4ZZLA 2D5VA 1TW2A 4HNVA 2QSFX 2O7OA 1K78B 1ZELA 3NWSA 2WV0A 4EM1A 2K9LA 1WJEA 4EGYA 5F08A 1FLIA 5BPIA 2EFOA 4XRFA 4FHTA 1ZG1A 1BA5A 1X58A 1JT0A 1SFKA 2V9VA 2VQCA 2PJRA 5B1AH 3ZQGA 3CO6C 2DMTA 2LY2A 2XAUA 3SXYA 2M7BA 5LLQA 1YE9A 2DOEA 2BV6A 2FBKA 1VQKI 1X2MA 5E79C 1D8KA 1ETXA 5C4XJ 3QPLA 2VQGA 3CCRI 1BIBA 2QKMB 1QA6A 3HOVJ 1ZR4A 5H6QA 2HPMA 1NTCA 3VB2A 2W25A 2ZXJA 3WTXC 1KYZA 3UR3C 3DEWA 4II3A 5EEHA 2Z33A 4BE0A 3B73A 1PJRA 2HZDA 1JUPA 2ZXHA 5BMZA 3BTIA 2WADA 1LQ1A 2DT7B 4LB5A 2QSHX 1N25A 1U2WA 2GOMA 1MDMA 3BG5A 2RVCA 2F48A 5FJ8J 4IHSA 3TEDA 4RMNA 3OS0A 1EV7A 4PJLA 3P9KA 2E7WA 5FRMA 4LITA 1RKWA 2Q0OA 3EUAA 4JBAA 2V1NA 2ELJA 3O6BB 3K9TA 2XROA 2XC7A 2E71A 2Y30A 1QZYA 1X1PA 3GWZA 4D1QA 1GVJA 4GYIA 2HDWA 2LFBA 5D8LB 1T98A 3I56I 5IT9K 1MH4A 2IS1A 1CGPA 4A93J 1ZH5A 4HV6A 4CCJA 1GUUA 2DT5A 2M1BA 4FISA 2Y75A 1QVTA 1YI2I 3IV5A 4C9YA 1SMYF 2E2JJ 1K7AA 2BHZA 4IF4A 5TJJA 2IP2A 4XORA 2DFEA 1IRFA 3K7AJ 2PFBA 2E19A 3SJMA 2O5RA 3VYSB 2KJBA 4XOTA 2K4JA 3TDZC 3L2WA 2X6OA 4DW6A 2M45A 2M30A 5DV5A 3HSRA 1VQLI 1PDNC 2DA6A 3F8NA 3DPUA 4LLGF 4MO7A 1IXCA 2W00A 3FBIB 4M6YA 3HUGA 4CCMA 1RRJA 1U8BA 2OF7A 4ETSA 1BW5A 3CC4I 3M3YJ 1LFBA 1OCZH 4C30A 2OTJI 4UV9A 3E97A 3WG9A 3E5XA 4MFDA 3K4BA 2KRFA 4BS9A 2X4HA 2VQLA 2NYXA 2XPVA 3K69A 3ZCOA 1XSXA 2GAUA 2X1EA 1W5SA 3RYPA 2NAZA 5H6RA 3E7LA 5HDKA 2ME0A 4RDUA 3JTHA 3HOZJ 4M9XA 2WAEA 4RA2A 3G1OA 2MC4A 4M9SA 4M6XA 4CICA 1VQ4I 4G7OF 3GFLA 1YRNB 2X9DA 2OCCH 3F8MA 1J75A 1J5YA 3E0JB 3P7NA 2QLZA 3CDHA 4BE1A 4YEJA 1TLHB 1LFUP 3LWFA 1U9NA 3LSGA 3S1MJ 2BW3A 2MA3A 2LC2A 4WWCA 2CQXA 3P5JA 2R5ZA 2P6SA 2NVXJ 4F93B 2VJ5A 2Z99A 4PJNA 3OYFA 3LA2A 1CF7A 3BTLA 3O8GA 5BS6A 4I7HA 1LKXA 4RB0A 1R71A 3UKGA 5EEGA 4HAMA 3V8KA 5IT9Z 4D9JA 4CYCB 1TWAJ 3LAPA 3I59B 2MD0A 5E1XA 3SDBA 1U5TB 3L09A 4YFXF 1S7OA 2L2OA 2N8GA 4CCKA 3HJEA 2XSDC 1Z0XA 1ZARA 2DQRA 4OIQF 2F5VA 1S9HA 4MQVA 4OIPF 1ZAOA 4JX4A 2L9NA 2XF6A 3L2UA 3N4MA 1WJBA 3TW7A 3GO5A 1ZK8A 1R4MB 2NVUB 3OIQA 3CZ6A 3NQOA 1YJ9I 1MNEA 2IBDA 2R7OA 1FYKA 2ZXIA 2MBFA 3HG9A 4XOPA 4Y13A 1M1EB 1VNDA 5HDNA 2NXNB 3JCUC 5J3LA 3ZMDA 4ZDPA 4MEXF 4R79A 1TP4A 4ZJZA 5CLSA 1RKTA 4EV0A 1MMSA 1OCTC 3F22A 2FA5A 4L5EA 1LE8A 2QSGX 1W7PA 3QOEA 1FBUA 4Y7NJ 1F36A 3ABMH 1KQ0A 2G7UA 5BOXA 3JRDA 3QODA 3FMRA 2E1MC 1RNLA 1Z1DA 3HOXJ 1EH6A 5LD2C 2W85A 1ZQ3P 2PJRB 4A5NA 3SFZA 3GTPJ 4Y17A 3BPXA 2P5KA 5JHFA 4E7KA 3K1MA 2V1UA 4BAYA 3MKLA 1JXSA 3RIRA 2K5CA 2IPQX 1G3TA 2DA3A 5CPRB 5FLXK 1G3WA 3WE3A 1TWGJ 1IG7A 3WODF 2X51A 3G6EI 4P9UA 3L1PA 5F04A 1I50J 3DLLF 2P7VB 3IH4A 5EF6A 5AONA 2XGCA 2FF4A 3HSFA 2K4BA 1X3ZB 1MD0A 3QWLA 1MDMB 2CW8A 4DBQA 3TP0A 5EGOA 5FKLA 3DU6A 1Z6RA 4BKXA 1RI7A 1DDNA 3B6AA 4PSXA 2P4WA 4XN3A 5D5UB 2QQ9A 1I3QJ 1BN5A 1W7PD 1ZREA 1R4NB 2BY2A 2WAQN 2COMA 3ZMVA 5LFAA 4X6AJ 5IPAA 2LF8A 3BZKA 3IKTA 4KYWA 3IP4B 2MSYA 3K2AA 5EYRA 1PUEE 2E2HJ 1MMDA 4A3FJ 3LA3A 2KPMA 3OIPA 3RQIA 4CZCA 2L9VA 3S3NA 2FNAA 2BEOA 4DNCA 5FFXA 1G3YA 4X1EA 3P9IA 2F5EA 3M7GA 3OL4A 3JR9A 4OWRB 4YG2F 4RM3A 1W36D 4OAZA 1GLNA 1P2FA 1YYVA 1Q1HA 2CUZA 4CO8A 4TV7A 1G6NA 1RIOH 2EFQA 2HU9A 2K40A 2QVOA 3ESWB 4W97A 1MJ9A 1ERDA 2VJJA 1P4WA 1P6RA 3JW4A 4QWQA 2XIGA 2IS2A 2QF7A 2XF7A 2M4KA 4PFOA 1S29A 3HUGB 2H1KA 3M8JA 5J40A 3U2RA 1QGPA 4A3GJ 2EWNA 3SEQA 2CH0A 3F6VA 4BXUA 1FYLA 1IC8A 1AA7A 4CA0A 2NOJB 3BTJA 2JTVA 2EA4A 4H4KC 4ITVA 4ZTFA 1YW8A 4DYQA 1UCRA 2CO5A 2CG4A 5FLXZ 3VWBA 4IQ4A 4OIOF 4HOBA 5DD8A 4G9YA 3MD2A 4BE2A 2Q8KA 3MAJA 5HNFA 4BY1J 2W24A 1R00A 2AXLA 2HTSA 4PGHA 2MH9A 1W0UA 1LNWA 3BP8A 3ABKH 4WF2A 2EV0A 3T0YA 4D7NA 3PQKA 4Z2YA 5M5XJ 3QYFA 1AHDP 3GF2A 4BY7J 1IXRC 1GV2A 3VEPA 3R4KA 5CVVA 2LTPA 1LDDA 4NBQA 2R7XA 3I4MJ 2DMNA 2XHKA 3KP5A 2KZVA 3WHBA 1MJBA 2KRCA 3TO6A 2R5ZB 2O3FA 2K3FA 1CF7B 1BOBA 2BVLA 2CW0F 5M5YJ 2O0YA 3RYRA 4KFCA 2W84A 2CYYA 3F21A 3SZPA 2E1NA 3TO7A 2IGOA 3FK6A 2QZ8A 2V1DA 1ZLKA 4GYGA 3CCSI 2F5CA 1JHHA 1ULYA 3NARA 3S16J 4A0YA 1S72I 2FXAA 1QO0D 1BL0A 1ZGWA 2FE3A 3BZ6A 4S04A 5DUKA 4UUSA 3OY9A 1RETA 2KFDA 2HI3A 2DCEA 2LK2A 2BHYA 4MQ9F 4RAZA 1APLC 3ZR8X 1E3OC 5KNLA 3J7AY 2PQ8A 1MMGA 2FEZA 2R93J 3ERED 1ONVA 1K78A 3HC7A 3VYRB 1LE8B 3QOPA 3L2QA 2XPWA 3DEEA 4AC0A 3V42A 3G1MA 4UHTA 4B3XA 5D5WB 2XDVA 3T5XA 2NRAC 3PM1A 2FMLA 1QNTA 4D0PA 2QYOA 1HDDC 3EUKL 4HX4A 5GPAA 1FT9A 4A5MA 1KYWA 1IW7F 1DPUA 3S2DJ 1R5HA 1WH7A 1Y0NA 5L3DA 1ZHFA 2P8TA 4HA8A 3W3CA 2XUBA 1RZ4A 2KIMA 5FGMA 2A61A 3TP3A 2VBWA 2A6TA 3HGGA 3SEZA 2PLYA 1JKQC 1J2XA 3IRRA 4MFEA 1IN7A 2ACJA 2DT6A 4AYBA 1SFEA 1OR7A 1XGOA 1V4RA 5FKKA 3ERMA 1VFCA 3FF5A 1XMKA 1WJFA 4MEYF 2XB0X 2R7SA 3M1EA 3D5SC 3HOYJ 1L3LA 2VLAA 5EGOB 1H0MA 1PUFA 2PMZN 2VASA 1HSJA 3A01A 5CVUA 3I4NJ 3R6SA 4HBLA 5JR3A 4Q4ZF 1WKMA 3WU0A 3GMEA 2XRNA 4EATA 2E1MB 2XF5A 3CF5F 3ABUA 3LSRA 1MBGA 4CCLA 3V8LA 5F0HA 2X0LA 2W82A 3PFIA 2I5UA 5DEQA 3CCMI 5FD5A 3ZP5A 5HODA 3S1RJ 3O8HA 2FQ3A 4BQOA 1RUOA 1SD4A 5GP9A 4DZPA 2NS8A 3L7WA 1G3SA 4A3CJ 2OZUA 1IF1A 1KA8A 1XDSA 2CUEA 3ZQHA 2R7VA 5CVIA 2JA7J 1T38A 2IAIA 2XAGA 3F3XA 3OYJA 2VT2A 4JYKA 3OMYA 5J1UA 2EIJH 1ENHA 2A5YB 2M7AA 5BQTA 3TOBA 4BXFA 1LDJA 1MGTA 1HQCA 4LMYA 2XRLA 4IJAA 3CD6I 1S7EA 3M8FA 5EDNA 2Q2EB 2ZNYA 5DD4A 4HX8A 1EH8A 4E7ZA 4G7ZF 4LOCA 1XB4A 4I0AA 3DFGA 1YX3A 3QU6A 1YLFA 1SD7A 2JJ7A 2QQ8A 3K4JA 4IX7A 2K9MA 1YIJI 2OTLI 2VKDA 4KMUX 2QQAA 2BOLA 1Z7UA 2JA2A 4A0ZA 4XRSG 3S2WA 3QP6A 2JT1A 1NG7A 2CS3A 1IDZA 3I71A 3FXOA 1NK3P 1G2HA 5E1ZB 2A68F 1E3PA 1PVEA 2JVHA 1E0EA 5ICGA 5ICEA 4XRSA 3H9JA 5J47A 1B72A 2QBYA 3RTRA 5E17F 2O6GE 2DAOA 4E4HA 5K1YA 2XSJC 3GLLA 4HX7A 1ZGAA 3MQ0A 1DGWY 2EV6A 3PQJA 1G59A 3WG7H 1B9MA 4A3EJ 4G6DA 5GTIC 3L2CA 2Z9OA 2ZSHB 4U0YA 4QIWN 1WSUA 1KGSA 3S2HJ 1JUSA 4B1RA 3AG2H 1WJDA 5D8KB 4YRVA 1LPQA 1I1SA 1YS7A 1WQ2A 3DLAA 4CYCA 4IRIA 1ORKA 1J59A 2KIUA 3CMMA 2DYSH 2FJ1A 5CVRA 2VJIA 1U5TA 5IYCJ 4HRIA 3S3OA 2HOAA 1OFCX 4A69C 2DO7A 2RN7A 1FP2A 2D1VA 1KU7A 2D1HA 1D1BA 2FSWA 4LLNA 1R36A 3OYCA 3LNQA 3U9GA 4RGSA 2KL4A 2ZJRF 2RNGA 2VJ4A 3KYCB 1QPIA 5FKMA 4WXDA 3OYMA 4FX4A 4GRIA 4Y3OA 5HS8A 3CCQI 3WHCA 3H5RA 4F3QA 4UB8C 2X85A 4CXFA 3MZHA 2MYSA 3BCAA 2Z3YA 3GXOA 3MN2A 3G4SI 4UUSB 4YIFA 2WC2A 3R61A 2BY1A 1BR1A 1XN7A 1T2KA 4JK1X 4YIIA 2BGCA 3GFJA 4ENNA 4I01A 2ME6A 2CJJA 2VIXA 3CJTB 4YFNF 1WFXA 2LKPA 4G6TB 2XAQA 2HYGD 4B3AA 2EFWA 3I64A 4ENJA 1XX5A 4LG0A 2QKLB 3P9CA 4HYEA 2VBZA 1T0FA 4U7BA 2O9LA 1V5GA 1JKPC 3W2AA 1FP1D 1QZEA 3DBHB 2OA4A 4M71A 3RDIA 4FT8A 3BROA 2ZXWH 4BYYA 1BM9A 3OYNA 3AL0B 3OYHA 1EF4A 3ZGKA 2H6CA 1Y0UA 4IHWA 1Y8RB 2QENA 1FZPB 4MTDA 2P81A 4A3BJ 1R49A 2V9KA 1JJ6C 2R7WA 2ID3A 3K4KA 2CQ7A 3JREA 1SANA 1H8AC 2RAEA 3FM5A 4IHYA 4I0BA 1MZBA 1I5ZA 3Q3SA 3B02A 3GCMA 4LLLA 1YHQI 1RR8C 2MC3A 2O03A 2NNYA 1DP7P 3LMMA 5F1RA 1XSVA 2YS9A 4XKWA 1BI0A 1PUFB 3BR1A 4XNFA 3DTEA 3IWZA 4I76A 2WY8Q 1YJNI 3A01B 1AU7A 1B9NA 3FK7A 1W1WE 3H1CA 4F55A 1YX5A 2LF7A 2A5WA 3FDYA 4XMYA 1IUFA 3SQNA 4XN0A 3QQAA 1KZHA 1GXQA 1X4PA 3G2BA 4XONA 3ZPLA 1IGNA 1QU3A 4F7ZA 4DYRA 1H89C 2OAZA 1I3AA 4RM2A 1IN5A 3ABLH 1HLVA 5M3MJ 2LDUA 1JTYA 1XGNA 3HXLA 5AIPA 1U8RA 2A07F 3WTTC 1USTA 2P7CB 3W6VA 1OYYA 3SZTA 4EJOA 2BXYA 1WI3A 2BE5F 4MHGA 4HNTA 1TTYA 2ZMEC 2MGQA 5E3LA 4CCOA 1R7JA 1IN8A 1YITI 1FSEA 1ZRDA 5HS7A 3OS1A 3HOWJ 3GTQJ 1IV6A 3TMOA 1LJ9A 4P55A 1UG0A 2R92J 2HKOA 1B4AA 2COBA 3WTYC 4DGWB 2IA1A 2ECBA 2YX4A 4HZFA 2Y48A 2KDOA 4A6EA 3J7AO 2MG4A 2GLOA 4G12A 4BUPA 4UVCA 4A3IJ 1GDTA 5LHHA 1D1AA 2V7FA 1FY7A 1OCOH 2E34A 3HB9A 5D4RA 4RAFA 5ILUA 4S0HB 1IN6A 2RQPA 2GBYA 3MKWB 4KJZA 2BXZA 1A6IA 1LB2A 1BC8C 2LR8A 4IVNA 3QYEA 1G8XA 2DOFA 2DI3A 5L3EA 3FXQA 2VODA 3JSOA 2DYRH 1FWZA 2ECCA 2R7RA 2VE8A 3A2KA 2IGKA 3OS2A 2E5NA 3MKYB 1TC3C 4GDFA 4HNUA 1LUJB 3QAHA 1TL8A 4NHJA 1MBJA 3K1NA 4M3EA 4EJUA 1QQIA 1B72B 2QBYB 2ELKA 2NVTJ 3OOPA 3C1DA 4IHTA 1OKRA 1SD6A 1X1BA 4XR6A 1HC8A 1W0TA 2CQNA 2X6WA 5E20A 1LEBA 3I58A 2EBIA 2Z1DA 3NAUA 1FMWA 3D5LA 2Z5UA 4R1HA 1O4XA 2UV1A 2PX9A 2Q1ZB 1WGXA 5GAHJ 2DPUA 2HGCA 3ZXSA 4IOCF 3JAMK 2IGMA 4ASNA 3I5UA 3D1NI 3IHUA 3REOA 2OQGA 3KEYA 4LD5A 3PO2J 1POGA 4II2A 3OWTA 5FFZA 3ELKA 4LFUA 2D2WA 3LSHA 2X1CA 3CC2I 5F64A 1F9NA 4JOMA 3I53A 1WWXA 4BDYA 4QPQA 2VT3A 4ZYAA 3J81K 1ZG3A 4HEA2 2GA1A 3WGHA 1R5ID 4GO1A 5DUIA 5D5VB 1P7JA 2MH2A 2VC0A 1SFXA 4KT6A 1X19A 4WXHA 4HDUA 3VFZA 1LVKA 2OQRA 1QZZA 1JUMA 5KHDA 4FE4A 2HNHA 3NRVA 4YELA 1OCCH 2JWTA 3I4PA 4IO9F 1S6LA 2GXBA 2CU7A 3EUHC 3DV8A 3W2VA 3GX4X 5K7HA 4RB3C 2VOPA 5C44J 1D0ZA 3ISPA 3MCZA 4LG0B 1BOAA 4QTRA 3GW2A 1QPMA 4QLCU 3SZGA 3LFKA 4OU0A 1U3EM 1DGRM 3RZOJ 3FZVA 2E35A 1FTZA 2ZFWA 1XCVA 1WI9A 3ASNH 4EVIA 2DU9A 3DF8A 3L2RA 2JA6J 3S14J 1BR2A 1Y6IA 3PIOF 2V1XA 2F4OB 1VQ9I 4EGZA 2AQFA 4CDGA 3LSIA 4RB1A 1S3JA 2GXGA 4PUSA 4E7LA 4HSTA 1L0OC 3F23A 2R7FA 3ZQQA 3R60A 1JKRC 5C3EJ 2M9HA 2GIZA 3OL3A 3TKYA 3HKZN 5A2QK 4O3MA 2LY9A 2LD5A 2PMUA 1AOYA 4KUMA 2MLKA 4AIJA 2HXIA 2DQLA 4BJTA 1FNNA 1HKQA 1YS6A 3SHFA 3BZCA 1Z7LA 4KMFA 3J7ZI 2RREA 4OAYA 1WZ2A 3KE2A 4CYDA 1MJAA 2R7QA 1UZCA 4K2EA 2EH3A 3M8EA 1ZKGA 1V3FA 1GXPA 1HDPA 1UHWA 2LBFA 5IP7J 4CSWA 4DQ2A 1NK2P 4AIKA 2R4GA 3F9KA 4C2MJ 1J9IA 1N75A 3C7JA 1F1ZA 2E5ZA 3J81Z 1W4MA 1XS9A 1N78A 3LOCA 2EIMH 2MLGA 5FRNA 2M0CA 5EJCA 4G8XA 3OYEA 3ZQFA 3DXJF 1KQ8A 1YFHA 2BZTA 3CJRB 3OR1C 3SDGA 3MZ8A 1SFUA 1YW7A 4GGGA 3NEUA 3EETA 3ZQIA 2XV4S 1P4XA 3RKQA 2EINH 1ON2A 1OYIA 4E7SA 3OYGA 1A35A 2K7LA 4V19K 4WK8F 3T8TA 3CDLA 5KK1A 1V5EA 2AS5F 3HOTA 1J09A 4BQNA 2XKPA 3K70C 1TNTA 1K61A 3GTLJ 4U0WA 2W1OA 5DS9A 5FROA 5HVQC 1E2XA 1AWCA 3ZMUA 3BR5A 1YJWI 1ON1A 1MKMA 2Q2EA 2VKHA 2EILH 1DP3A 1MH3A 2DDBA 4Q47A 3CLOA 4HDVA 2GOXB 4P5OA 1OCRH 1IRXA 1R1UA 2A05A 3KPHA 3SYTA 3BC8A 1A04A 2EZKA 2EJRA 3DEUA 4MIMA 4BHCA 2DFIA 1OCPA 2KIFA 2KIQA 3WTZA 4U88A 2OZ6A 3HGYA 5GAEJ 3BCBA 1Z77A 2M8EA 2HPIA 1BJZA 2RQQA 2KZGA 1IV8A 5ILSA 3ZMSA 2H6BA 3KX2A 5E18F 2DA5A 1BBYA 5A2QZ 2YR2A 3SFIA 2PN6A 1A31A 3TBIA 3UNGC 1HBXG 2GXAA 2DA2A 4MLOA 1YO5C 3KLNA 4IRHA 4XKVA 4KN4X 2EZHA 1QHHD 3BJ6A 4PK4A 2ZMEB 2E1CA 1H9GA 1GVDA 3WTVC 1P9QC 4MGRA 1ITYA 1R9TJ 2HQNA 2E36A 4UXNA 4ZTJA 4GFBA 2TCTA 3A03A 5J4VA 3S1NJ 1XC5A 3E3VA 3HHHA 4B4CA 2R5YA 2IT0A 3BOQA 1R1VA 3AG4H 4O6JA 2Y69H 2I10A 2JK3A 2VL8A 2KKOA 4EMSA 5DM6F 3HL2A 4ZYDA 1XGSA 1FTTA 4U7DA 1K4TA 4E7JA 3TDUC 1MW7A 1N77A 1ODDA 3F72A 1MSFC 3OYIA 2W57A 4GXOA 2HOTA 1IUYA 2CUJA 3QYBA 4Y4RA 2CV1A 2QQBA 2HR3A 1JKOC 3TL4X 1ZLJA 1AKHA 4IHXA 1JGSA 4HG2A 4RLFA 4KISA 1SVLA 4FASD 4A3JJ 4PFPA 2TRTA 1X1DA 5AIQA 2M3AA 2JPBA 1A6QA 1TQMA 1QRYA 3ULQB 1VQMI 3DKYA 3K0LA 2UXXA 1C0WA 1YTYA 2OPTA 2RNJA 1HW2A 4EM2A 3CUOA 3CCYA 2FU4A 3FXLA 4L9TA 4BACA 3BG9A 1XCBA 1Y8QB 3EDPA 2ZB9A 5LHGA 4HPQA 4B43A 4KIBA 4M9ZA 3ZMTA 1O3QA 3DP7A 4EEFG 1LEAA 3FHZA 1E17A 2B63J 3OYLA 1A36A 3RSNA 3WGGA 3H3VK 1ETWA 3M07A 1FC3A 3AFHA 3H36A 2QUFA 2J5OA 2VB6A 4BDZA 5TISC 2CV0A 3A1YA 1O7FA 1XTAA 4IEJA 4BJ5C 2VONA 1JT6A 1UFMA 2M8GX 1BI3A 3WTWC 3H9GA 3LSPA 2IS4A 3E6CC 1A5JA 3Q9VA 4G94A 2FOWA 4ANJA 3CESA 1TWFJ 5J1RA 2ICWG 1YW9A 3DTKA 3GLXA 4BH9A 1XGMA 4X0GA 1R23A 2NVQJ 3CCLI 1FEXA 4AWXB 4XQFA 3F8BA 2PJPA 3MWMA 1GV5A 2DA4A 2HYJA 1O3RA 4KT5C 3QU3A 1XG1A 2WWYA 4KIGA 2VXDA 3CMAI 2Y2ZA 2G0EA 3IH3A 3M1CA 3JTGA 3FHNA 2LBFB 4KICA 2LLKA 2FBIA 3GVAA 4N9HA 2KJCA 3FMQA 2V4JC 2AXTC 1NHAA 3ZN0A 5DCMA 2R7ZJ 1IRGA 4A3MJ 1D0YA 4RLQA 5TGTA 2OUMA 4M72A 4E6KG 3VDXA 3KP4A 5ICCA 3AAFA 5E3NA 5JHUA 1K6OA 3JRAA 1VQ8I 2ID6A 1B59A 2JUGA 1CQTA 4M74A 1OJLA 5LBQA 2KHMA 3AG1H 2CGPA 1F5TA 3HEFA 1NG6A 4HQEA 1B8IB 1NH3A 3IAS2 4HLYA 1BIAA 4CZZA 1R58A 2L7ZA 4UY8I 1LFPA 1K83J 4GCVA 2VPLA 4M3FA 5IP6A 2CFOA 1PP8F 2EB7A 1D5VA 4WCGA 2L7FP 2M34A 1MNMC 4E70A 1DPRA 2DK8A 2DTZA 1KQ9A 2VXZA 1Y1VJ 4L9VA 5E8IA 4L9NA 3KCCA 3MEXA 4BBSJ 2H09A 5KVRA 4NC6A 1WJAA 2E2IJ 5E1WA 3CP2A 5L3BA 3DTIA 3H5NA 4MNUA 3LQRA 2YU3A 3RI4A 1FBSA 3FX3A 2B0LA 2OV7A 2OCEA 1VQ7I 1TWHJ 4M6VA 2AQEA 4UNOA 3TO9A 3JRBA 2MABA 3FXUA 2L9RA 5ICFA 2P6TA 4XLFA 1TT0A 1UJ8A 3JSPA 1IO2A 4A0XA 5FB2A 4CHUA 5HS9A 3HKZA 5F0CA 5E3OA 5FLMJ 1MSEC 4OMYA 2OC6A 5HOOA 1HXDA 4IKFA 1FX7A 2HVRA 1WVRA 2P0WA 3F0CA 2BBYA 2OD5A 4DBRA 4UV8A 2IGNA 3GTJJ 3CUQC 3KZYA 4ENMA 3J7YJ 3BG7A 3JRCA 3U21A 3K4CA 3ZMZA 2LNBA 1UHSA 2R5YB 2WAQA 4HV5A 3ZN1A 5LEJA 4N9IA 4OINF 2HVQA 2RKHA 1FOKA 4ESJA 4OIRF 5TRDA 1S7AA 4RAGA 3IC7A 2EIKH 3C2BA 4RAYA 3CCJI 4L0ZB 2OU2A 3H0DA 1Z91A 2PG4A 2V9PA 2Y0MA 5EG0A 2IA0A 4XLHA 1MNDA 4E7IA 3LAJA 3KEOA 4D7MA 1FMVA 2FX0A 1SC7A 3S32A 2BYVE 4EJVA 2IJLA 2GA2A 5HNHA 2F6CA 3CJQB 1P7IA 5IY5H 1AKHB 5J1YA 3BG6A 3HOSA 4XLAA 3G71I 4MTEA 3PIPF 4LG3A 2XAHA 1LVAA 2DN0A 3ZOBA 3VOEA 2O8KA 2QA4I 5CVJA 4FE7A 2KISA 2H1LA 1MBKA 1OYWA 1V54H 1P4AA 2BVMA 2WB1N 3KLOA 5CYVA 5ERIA 1FOYA 2FNPA 3S8PA 3IKVA 4RBOA 3BLYA 2R7DA 3L2VA 4BU2A 3MZYA 2VOOA 2DTRA 2NS7A 1R1TA 4I99C 5GTHC 1V5FA 2L01A 5J8CA 4XRMA 3AKZA 2VE9A 1HKSA 1Z9CA 5J8FA 1YG2A 2PEXA 4L5JA 1K4SA 1VZ0A 4HQMA 3QPTA 2Z16A 5FO5A 5KAFC 4LJZF 1RUNA 3GYHX 1D8JA 1HKTA 2HTJA 1KU9A 2RV8A 4U87A 3JRFA 2YSRA 4KN7X 4BJ6C 1UHMA 1UAAA 2L54A 2AHQA 3F8CA 4V2GA 3FKIJ 2BY0A 2V6EA 3V7CA 1TZLA 2JA8J 2QCOA 2H27A 1HW1A 1O3SA 1ACIA 2F4IA 4A2UA 1HCRA 3BQZA 4C3JJ 3OIOA 1EJ9A 3VYTB 3KP7A 3MFKA 4WXCA 3RQ4A 4LB6B 1IXSB 2FBHA 2NVYJ 5F0FA 1WHUA 3K4MA 3HRUA 3VODA 4BGDA 2UZKA 4XKCA 6PAXA 2R3SA 1V55H 3VPRA 1VQ6I 4OMZA 2Y31A 4WX9A 2ZCWA 2RDPA 2LY1A 1RC9A 2DMUA 2ZO4A 4Q48A 4ZC3A 3GTGJ 3IWFA 1TQPA 3DPTA 4F91B 5K7ZA 2QEXI 2XAFA 4LK0F 1MBFA 2CSOA 2STWA 5DCMB 3ECHA 3DWLE 1Y1WJ 4H0EA 4IHVA 2EK5A 2EPFA 2M2EA 1MMAA 1H9TA 4ZDLA 2HDDA 1X3UA 3BPVA 2STTA 1T95A 2JSPA 3E6DA 4N0BA 3KYLA 4ZDOA 3O2PE 3QPHA 3GFIA 1VI0A 3BWGA 5IYBJ 4KIFA 2FOKA 3FWEA 4ABZA 4I6ZA 1UMQA 2L4AA 4L9JA 5FD6A 3H3UA 2VKVA 4XLEA 3HOUJ 2KMUA 3OR2C 1XSDA 3E6MA 2ZJPF 1DQUA 5L3GA 2W7NA 1I27A 3WTSC 1OLTA 1KONA 3W6JB 2A3SA 5F27A 2D45A 1DUXC 2LP0A 2DMQA 1MBEA 4AIHA 3BJOA 2DPDA 2KRHA 4UVBA 2AO9A 1UG2A 2HWVA 2MW8A 2Y0SN 2VC1A 4J19A 4M73A 1WJCA 4LIUA 1Z3XA 2CFXA 4L5IA 3HZJA 2HQAA 3ZRGA 3RJPA 2WTEA 5DCFA 2I8DA 1D0XA 2E7XA 2EFPA 2K86A 4FX0A 1TWCJ 3LA7A 2ISYA 3DCFA 3FBNB 4J01A 5B1BH 2J5PA 1TQIA 1YOVB 3N97A 3T1BA 4HF2A 3R0AA 2ZMEA 3RZDJ 3GTKJ 2G9WA 4RGXA 1U78A 2VI6A 2C6YA 5F1JA 1W5TA 4IXAA 4FQGA 4AYBN 2PMZA 4ZH4F 2RGVA 4FTHA 3HSEA 2WY7Q 3CCUI 3OSGA 4XKBA 1Z21A 3NWTA 4PDKA 2DFFA 1FOXA 2NNNA 2HEOA 4EJWA 2K85A 4KA4A 2X48A 1I1GA 5F6FA 2K9SA 3M9AA 2P5VA 2PI0A 5CKTA 3K6GA 2LKXA 4CGZA 4C2UA 2B7EA 3I9V2 2ZKZA 4EJTA 2CQKA 1T39A 3TGNA 3KP6A 1QBJA 3RPQA 4DIQA 4B47A 3L9FA 2JQ7A 4Z6YA 5EG0B 3LFUA 5ILVA 2VBXA 3F8FA 2DBBA 3LSTA 1MBHA 1BR4A 3BJAA 3JRIA 4A12A 2ZFUA 2KQRA 3H9QA 1JE8A 3KYDB 4XLCA 2HFHA 4BBRJ 4BQQA 3OOUA 1W36C 1JI8A 4XIDA 4PJMA 2ZBKA 2L9SA 1OISA 1ZGJA 2XGDA 1BI2A 3GZ5A 3ML6A 4I02A 4ZYHA 4L0YB 2HVSA 3ZQ7A 4ZYGA 5DDGA 2LYCA 1EKEA 2HZTA 1IRZA 3IUOA 1KU2A 3H3ZA 4Q5SF 2HYFA 3FXRA 5IOYA 3TW6A 2DA7A 2HQ5A 1UB9A 1WCMJ 1BW6A 4QSHA 3I55I 3Q0WA 3KETA 1XD7A 1Z6TA 5HLIA 2DJIA 3U1KA 2M4GA 1R6RA 4C3IJ 4HF1A 3CUQB 2YUSA 4S05A 4D5CA 5HLHA 5FLVA 3CMEI 4RS8A 1DU0A 4XL9A 4DZJA 2P5LC 4M3GA 3S93A 2JSCA 2O8XA 4B44A 3PO3J 1FIAA 3Q0UA 1G4DA 4Y15A 5E3MA 5FKOA 3C2HA 2UUZA 3BG3A 1IJWC 1T33A 4NB5A 2IVMA 5GPCA 2DJNA 2VPRA 2IEKA 4XK4A 2LKSA 4YFKF 1K79A 2K9NA 5EZHA 1JJ8C 2VUMJ 2LSOA 2LVSA 2ZNZA 5FKNA 4BHPA 2DFHA 3S17J 1QVUA 3A0HC 3FXJA 4BXXJ 3E5QA 3PUBA 4NQWA 3OYAA 1B1BA 3I54A 4LK1F 1IAWA 4I2OA 4AD9A 1SAXA 3H92A 3JAMZ 2JUCA 2ADUA 2L3DA 3DKXA 3HIFA 1T8IA 3BR0A 3EUHA 3W2WA 1HOMA 1EH7A 4XLNF 2PBIA 1Z05A 3H0GJ 5LGUA 2HDCA 5M3FJ 3W6KB 1FSHA 3TOAA 1OMIA 2GZWA 5L3CA 4XBFA 4IQJA 1FYMA 2EA2A 3PNVA 2Y9YA 3FM3A 2NOGA 2WAFA 3V7RA 4Y52J 4RB2C 3H5AA 3WU1B 3K2ZA 3N05A 2F5DA 2DDAA 2E1OA 2PMHA 5HLGA 3OYDA 5GADJ 2IRFG 3FXMA 3HM5A 3O3KA 1STZA 4XSZF 1U6GA 3HTUA 2K9QA 2YU9J 2JRTA 9ANTA 1YIOA 4I98B 5LGTA 3GZ6A 2OJED 1FPQA 2XASA 1HF0A 3PSFA 1IZ1A 4KDPA 5LHIA 1D5YA 3LL7A 1R5GA 5B5EC 3BY6A 4M3DA 3JRGA 5D4SA 2VKEA 3ZQLA 1P92A 3CP8A 1FBQA 2MD5A 2OBPA 5ED4A 1FOWA 3RCOA 4QPOA 1T6SA 3S3MA 3CMYA 1TBXA 1B8IA 3CJNA 4IL6C 5K5OA 5EZGA 1FIPA 3PUFA 2FQ4A 2R7UA 3H35A 2ELHA 1VQOI 2JRMA 3K10A 4N4NB 3AG3H 2V6CA 4YIRX 2EFNA 2LG4A 1OPCA 3KP3A 1X1AA 4XSXF 2WB1A 2DMPA 1IN4A 2XAJA 4AVPA 3HYIA 1W5CC 1JTXA 3BQYA 4W1UA 1XMAA 3Q0VA 5HLTA 3BR3A 2A6EF 4A3LJ 4DYCA 2DLLA 3VYUB 4AVZA 3RPUA 1VTNC 5DM7F 2K3PA 4AM3A 2CW7A 2FD5A 1RR7A 3MVPA 4CCNA 4A6DA 3D5RC 5KCMA 4DOZA 2HKXA 3L00A 1ZTRA 3EYYA 4J00A 2F4MB 3KIOA 3E5UA 3KZZA 2L4MA 4R8HA 3Q5FA 1K6YA 2JN6A 3I0TA 1TW3A 1XMXA 3FXKA 2E60A 2EZIA 2HOEA 4ESBA 4F52A 2HXOA 2V79A 2L02A 2GM4A 4NC7A 4NDLA 3RKWA 4C2TA 3HPGA 4UUVA 3ECOA 5JFRA 4BNCA 2LMDA 3TQNA 2IA2A 3K1PA 3V7SA 2VQHA 4BQAA 2JZYA 4N4OB 1IDYA 1WJ5A 2A6HF 2XB5A 2Z2SB 3A02A 4M3BA 4PJ0C 4BEHA 1U0JA 2HOSA 3GUDA 3QP5A 5DTDA 1X3WB 3OV8A 1RPWA 4G6QA 2BW3B 5LRSA 5LEKA 3M4OJ 1F43A 3A0BC 2CQQA 2G7HA 4O5VA 5D5XB 2IXSA 5CJ9A 1SD5A 1J0RA 3DBRB 2A69F 3ABTA 5E8GA 4HF0A 3AL0C 4UVAA 2L7KA 4OOIA 4E7HA 2R0QC 1S8NA 2YX7A 1VF9A 3RPUD 2DA1A 5JVTA 4FETA 1Z3YA 3CCEI 2GQQA 3HTSB 2EV5A 3CO7C 3K4NA 4HSRA 4P9FA 3BT9A 4Y33A 1KU3A 1VQNI 2L0KA 2X1DA 1D1CA 4CUGA 4G7HF 2Y9ZA 2EQRA 2M5WA 1OR7C 2NS0A 1R22A 5H2FC 4XM3A 2UXNA 2CWEA 3QPSA 3CDIA 3R0JA 5IOZA 3CF2A 1HSTA 3LSJA 4ESFA 3EYIA 4V2FA 3DBLB 3KP2A 4IRGA 3K70D 5B66C 1VQPI 2X6YA 2F5FA 4U0VA 4BL0B 3OYKA 5JI6A 1TNSA 4LIVA 1HA8A 1OQYA 2CUFA 5EEAA 2ZJQF 1Y39A 4CH7A 2QM3A 3PNTA 3VSLA 1W7PB 2Y0SA 1T56A 3ASOH 3EQLF 3D0SA 3DKWA 2FRHA 2M0MA 2KT0A 2FMYA 4B09A 3T8RA 4LGWA 5K5RA 3JRHA 1ZYRF 3LQQA 5LGNA 1Z67A 1O3TA 1MIJA 4PJJA 2QGUA 3HBLA 3HPHA 1T08B 2V26A 1RESA 4KNYA 1SAUA 1O57A 1SVOA 3BR6A 1D3YA 1X2NA 2HQRA 3OYBA 1WRJA 3GEZA 4L18B 4I09A 4BHBA 2VN2A 1I6XA 4ON0A 3V8JA 2XGXA 1PYVA 2K27A 4NQWB 1BJAA 2VBYA 4HW0A 1XPXA 3J80K 1ZRCA 3I3LA 2H94A 2WV1A 5BNGA 3IL2A 1XDUA 1FJLA 4XICA 2K02A 5IYDJ 1X4OA 4UB6C 5BPDA 3CC7I 5J6XA 3IH2A 5LRRA 5L3FA 2MFZA 2L5QA 1YQAA 3F6OA 4NUBA 4AU7A 2IS6A 3E1SA 1BI1A 2FUG2 4C3HJ 4IOAF 1DU6A 5IP9J 3EPZA 4ZYEA 2CMPA 2H8WA 3C2GA 1O7LA 1ZN2A 5JVGF 2EZLA 2W48A 1X1CA 4DJAA 2DK5A 4PCQA 2JA5J 1H88C 5C4JJ 3MMYB 2JPCA 2X6XA 2RC4A 2W4SA 1SEUA 3K4LA 3Q9SA 4F92B 1B6AA 2ZSIB 3G73A 3V4GA 1ZG5A 1ETOA 2XPUA 5JLWA 4HLXA 3GFMA 4P1WA 5K7FA 2H8RA 1Y56A 3ROUA 2ESNA 2HS5A 3KEQA 4JQFA 4PZJA 1JGGA 1REPC 3S1QJ 3BR2A 4UUTA 3CCVI 1WPKA 3HRMA 4A3DJ 3DQVC 2JMWA 3B6CA 3GZNB 3FKJA 2LOOA 4JX5A 1EA3A 5CQGA 2R7TA 3DPLC 2LREA 2O61A 1LDKB 2QWWA 5HDGA 3C3WA 1U5TC 5IT3A 5J4YA 1Q1VA 2BY3A 4PGGA 3VSKA 1I39A 2ZJ2A 1VQ5I 2WBMA 3QRFF 3FMSA 3WU2C 4D5FA 1SFOJ 3LSMA 3DU5A 3U1DA 3FIWA 2XVCA 1E3HA 4EQQA 3PSIA 1J7KA 2L7MP 2UWMA 2WA0A 3S15J 2GWRA 1GT0C 1SMTA 1MMNA
chains in the Genus database with same CATH topology
4FQGA 2LKSA 2E71A 2DOEA 2DOFA 2KISA 2KZGA 2KFDA 2K85A 2CQNA 2JUCA 2B7EA 2KIQA 1UZCA 2DODA 2L9VA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4FQG A;  2LKS A;  2E71 A;  2DOE A;  2DOF A;  2KIS A;  2KZG A;  2KFD A;  2K85 A;  2CQN A;  2JUC A;  2B7E A;  2KIQ A;  1UZC A;  2DOD A;  2L9V A; 
#chains in the Genus database with same CATH topology
 2LH9 A;  3A4C A;  3PL8 A;  3BTC A;  5D6E A;  4ENK A;  3WGI A;  5CQE A;  1ETY A;  1S5L C;  4B48 A;  1JHF A;  3J80 Z;  3COA C;  1YRN A;  4ZZD A;  2GIV A;  4XLP F;  4B8X A;  3PJR A;  3KFW X;  4JX6 A;  4EM0 B;  3WTU C;  1ZR2 A;  4PSW A;  2DOD A;  3MKZ A;  5K5Q A;  2IW5 A;  4IZZ A;  4A3K J;  3X2Q H;  1QHG A;  2LRD A;  5JLX A;  4RGU A;  2DW4 A;  1ETV A;  4BEH B;  1F4K A;  2KDZ A;  3CQZ J;  1GHC A;  1I6H J;  1T0F C;  3CTA A;  5B3S H;  1TT5 B;  4RGR A;  1BC7 C;  3GTO J;  5GAG J;  3BDD A;  3C18 A;  5H20 A;  3I59 A;  4IPA A;  1ZRF A;  1ETQ A;  3CLQ A;  1ETK A;  1U9O A;  1UEL B;  3RKX A;  2B9S A;  3GTM J;  2F2E A;  2XGE A;  3HRT A;  5D6F A;  2DOA A;  3FIS A;  3GBG A;  2ESH A;  3KZI C;  1WH5 A;  2ISZ A;  3WE2 A;  2ZC2 A;  2XKO A;  3PNY A;  2KP6 A;  4AUX A;  2CRG A;  1PP7 U;  5M5W J;  3HRS A;  5DYM A;  3ONQ A;  2ETH A;  3ZQC A;  3G3Z A;  3RKY A;  4AID A;  1HW5 A;  3PFY A;  4JP0 A;  3G1L A;  4NC8 A;  4KIT B;  2CV2 A;  3OSF A;  2M87 A;  2YPR A;  3CUQ A;  1USS A;  2TDX A;  4P96 A;  2DXI A;  2KLO A;  3IAM 2;  3HDD A;  3IRQ A;  2JVG A;  3LSK A;  4FCY A;  3HHG A;  1SVM A;  3E6B A;  5KAI C;  4NNJ A;  4ZZL A;  2D5V A;  1TW2 A;  4HNV A;  2QSF X;  2O7O A;  1K78 B;  1ZEL A;  3NWS A;  2WV0 A;  4EM1 A;  2K9L A;  1WJE A;  4EGY A;  5F08 A;  1FLI A;  5BPI A;  2EFO A;  4XRF A;  4FHT A;  1ZG1 A;  1BA5 A;  1X58 A;  1JT0 A;  1SFK A;  2V9V A;  2VQC A;  2PJR A;  5B1A H;  3ZQG A;  3CO6 C;  2DMT A;  2LY2 A;  2XAU A;  3SXY A;  2M7B A;  5LLQ A;  1YE9 A;  2DOE A;  2BV6 A;  2FBK A;  1VQK I;  1X2M A;  5E79 C;  1D8K A;  1ETX A;  5C4X J;  3QPL A;  2VQG A;  3CCR I;  1BIB A;  2QKM B;  1QA6 A;  3HOV J;  1ZR4 A;  5H6Q A;  2HPM A;  1NTC A;  3VB2 A;  2W25 A;  2ZXJ A;  3WTX C;  1KYZ A;  3UR3 C;  3DEW A;  4II3 A;  5EEH A;  2Z33 A;  4BE0 A;  3B73 A;  1PJR A;  2HZD A;  1JUP A;  2ZXH A;  5BMZ A;  3BTI A;  2WAD A;  1LQ1 A;  2DT7 B;  4LB5 A;  2QSH X;  1N25 A;  1U2W A;  2GOM A;  1MDM A;  3BG5 A;  2RVC A;  2F48 A;  5FJ8 J;  4IHS A;  3TED A;  4RMN A;  3OS0 A;  1EV7 A;  4PJL A;  3P9K A;  2E7W A;  5FRM A;  4LIT A;  1RKW A;  2Q0O A;  3EUA A;  4JBA A;  2V1N A;  2ELJ A;  3O6B B;  3K9T A;  2XRO A;  2XC7 A;  2E71 A;  2Y30 A;  1QZY A;  1X1P A;  3GWZ A;  4D1Q A;  1GVJ A;  4GYI A;  2HDW A;  2LFB A;  5D8L B;  1T98 A;  3I56 I;  5IT9 K;  1MH4 A;  2IS1 A;  1CGP A;  4A93 J;  1ZH5 A;  4HV6 A;  4CCJ A;  1GUU A;  2DT5 A;  2M1B A;  4FIS A;  2Y75 A;  1QVT A;  1YI2 I;  3IV5 A;  4C9Y A;  1SMY F;  2E2J J;  1K7A A;  2BHZ A;  4IF4 A;  5TJJ A;  2IP2 A;  4XOR A;  2DFE A;  1IRF A;  3K7A J;  2PFB A;  2E19 A;  3SJM A;  2O5R A;  3VYS B;  2KJB A;  4XOT A;  2K4J A;  3TDZ C;  3L2W A;  2X6O A;  4DW6 A;  2M45 A;  2M30 A;  5DV5 A;  3HSR A;  1VQL I;  1PDN C;  2DA6 A;  3F8N A;  3DPU A;  4LLG F;  4MO7 A;  1IXC A;  2W00 A;  3FBI B;  4M6Y A;  3HUG A;  4CCM A;  1RRJ A;  1U8B A;  2OF7 A;  4ETS A;  1BW5 A;  3CC4 I;  3M3Y J;  1LFB A;  1OCZ H;  4C30 A;  2OTJ I;  4UV9 A;  3E97 A;  3WG9 A;  3E5X A;  4MFD A;  3K4B A;  2KRF A;  4BS9 A;  2X4H A;  2VQL A;  2NYX A;  2XPV A;  3K69 A;  3ZCO A;  1XSX A;  2GAU A;  2X1E A;  1W5S A;  3RYP A;  2NAZ A;  5H6R A;  3E7L A;  5HDK A;  2ME0 A;  4RDU A;  3JTH A;  3HOZ J;  4M9X A;  2WAE A;  4RA2 A;  3G1O A;  2MC4 A;  4M9S A;  4M6X A;  4CIC A;  1VQ4 I;  4G7O F;  3GFL A;  1YRN B;  2X9D A;  2OCC H;  3F8M A;  1J75 A;  1J5Y A;  3E0J B;  3P7N A;  2QLZ A;  3CDH A;  4BE1 A;  4YEJ A;  1TLH B;  1LFU P;  3LWF A;  1U9N A;  3LSG A;  3S1M J;  2BW3 A;  2MA3 A;  2LC2 A;  4WWC A;  2CQX A;  3P5J A;  2R5Z A;  2P6S A;  2NVX J;  4F93 B;  2VJ5 A;  2Z99 A;  4PJN A;  3OYF A;  3LA2 A;  1CF7 A;  3BTL A;  3O8G A;  5BS6 A;  4I7H A;  1LKX A;  4RB0 A;  1R71 A;  3UKG A;  5EEG A;  4HAM A;  3V8K A;  5IT9 Z;  4D9J A;  4CYC B;  1TWA J;  3LAP A;  3I59 B;  2MD0 A;  5E1X A;  3SDB A;  1U5T B;  3L09 A;  4YFX F;  1S7O A;  2L2O A;  2N8G A;  4CCK A;  3HJE A;  2XSD C;  1Z0X A;  1ZAR A;  2DQR A;  4OIQ F;  2F5V A;  1S9H A;  4MQV A;  4OIP F;  1ZAO A;  4JX4 A;  2L9N A;  2XF6 A;  3L2U A;  3N4M A;  1WJB A;  3TW7 A;  3GO5 A;  1ZK8 A;  1R4M B;  2NVU B;  3OIQ A;  3CZ6 A;  3NQO A;  1YJ9 I;  1MNE A;  2IBD A;  2R7O A;  1FYK A;  2ZXI A;  2MBF A;  3HG9 A;  4XOP A;  4Y13 A;  1M1E B;  1VND A;  5HDN A;  2NXN B;  3JCU C;  5J3L A;  3ZMD A;  4ZDP A;  4MEX F;  4R79 A;  1TP4 A;  4ZJZ A;  5CLS A;  1RKT A;  4EV0 A;  1MMS A;  1OCT C;  3F22 A;  2FA5 A;  4L5E A;  1LE8 A;  2QSG X;  1W7P A;  3QOE A;  1FBU A;  4Y7N J;  1F36 A;  3ABM H;  1KQ0 A;  2G7U A;  5BOX A;  3JRD A;  3QOD A;  3FMR A;  2E1M C;  1RNL A;  1Z1D A;  3HOX J;  1EH6 A;  5LD2 C;  2W85 A;  1ZQ3 P;  2PJR B;  4A5N A;  3SFZ A;  3GTP J;  4Y17 A;  3BPX A;  2P5K A;  5JHF A;  4E7K A;  3K1M A;  2V1U A;  4BAY A;  3MKL A;  1JXS A;  3RIR A;  2K5C A;  2IPQ X;  1G3T A;  2DA3 A;  5CPR B;  5FLX K;  1G3W A;  3WE3 A;  1TWG J;  1IG7 A;  3WOD F;  2X51 A;  3G6E I;  4P9U A;  3L1P A;  5F04 A;  1I50 J;  3DLL F;  2P7V B;  3IH4 A;  5EF6 A;  5AON A;  2XGC A;  2FF4 A;  3HSF A;  2K4B A;  1X3Z B;  1MD0 A;  3QWL A;  1MDM B;  2CW8 A;  4DBQ A;  3TP0 A;  5EGO A;  5FKL A;  3DU6 A;  1Z6R A;  4BKX A;  1RI7 A;  1DDN A;  3B6A A;  4PSX A;  2P4W A;  4XN3 A;  5D5U B;  2QQ9 A;  1I3Q J;  1BN5 A;  1W7P D;  1ZRE A;  1R4N B;  2BY2 A;  2WAQ N;  2COM A;  3ZMV A;  5LFA A;  4X6A J;  5IPA A;  2LF8 A;  3BZK A;  3IKT A;  4KYW A;  3IP4 B;  2MSY A;  3K2A A;  5EYR A;  1PUE E;  2E2H J;  1MMD A;  4A3F J;  3LA3 A;  2KPM A;  3OIP A;  3RQI A;  4CZC A;  2L9V A;  3S3N A;  2FNA A;  2BEO A;  4DNC A;  5FFX A;  1G3Y A;  4X1E A;  3P9I A;  2F5E A;  3M7G A;  3OL4 A;  3JR9 A;  4OWR B;  4YG2 F;  4RM3 A;  1W36 D;  4OAZ A;  1GLN A;  1P2F A;  1YYV A;  1Q1H A;  2CUZ A;  4CO8 A;  4TV7 A;  1G6N A;  1RIO H;  2EFQ A;  2HU9 A;  2K40 A;  2QVO A;  3ESW B;  4W97 A;  1MJ9 A;  1ERD A;  2VJJ A;  1P4W A;  1P6R A;  3JW4 A;  4QWQ A;  2XIG A;  2IS2 A;  2QF7 A;  2XF7 A;  2M4K A;  4PFO A;  1S29 A;  3HUG B;  2H1K A;  3M8J A;  5J40 A;  3U2R A;  1QGP A;  4A3G J;  2EWN A;  3SEQ A;  2CH0 A;  3F6V A;  4BXU A;  1FYL A;  1IC8 A;  1AA7 A;  4CA0 A;  2NOJ B;  3BTJ A;  2JTV A;  2EA4 A;  4H4K C;  4ITV A;  4ZTF A;  1YW8 A;  4DYQ A;  1UCR A;  2CO5 A;  2CG4 A;  5FLX Z;  3VWB A;  4IQ4 A;  4OIO F;  4HOB A;  5DD8 A;  4G9Y A;  3MD2 A;  4BE2 A;  2Q8K A;  3MAJ A;  5HNF A;  4BY1 J;  2W24 A;  1R00 A;  2AXL A;  2HTS A;  4PGH A;  2MH9 A;  1W0U A;  1LNW A;  3BP8 A;  3ABK H;  4WF2 A;  2EV0 A;  3T0Y A;  4D7N A;  3PQK A;  4Z2Y A;  5M5X J;  3QYF A;  1AHD P;  3GF2 A;  4BY7 J;  1IXR C;  1GV2 A;  3VEP A;  3R4K A;  5CVV A;  2LTP A;  1LDD A;  4NBQ A;  2R7X A;  3I4M J;  2DMN A;  2XHK A;  3KP5 A;  2KZV A;  3WHB A;  1MJB A;  2KRC A;  3TO6 A;  2R5Z B;  2O3F A;  2K3F A;  1CF7 B;  1BOB A;  2BVL A;  2CW0 F;  5M5Y J;  2O0Y A;  3RYR A;  4KFC A;  2W84 A;  2CYY A;  3F21 A;  3SZP A;  2E1N A;  3TO7 A;  2IGO A;  3FK6 A;  2QZ8 A;  2V1D A;  1ZLK A;  4GYG A;  3CCS I;  2F5C A;  1JHH A;  1ULY A;  3NAR A;  3S16 J;  4A0Y A;  1S72 I;  2FXA A;  1QO0 D;  1BL0 A;  1ZGW A;  2FE3 A;  3BZ6 A;  4S04 A;  5DUK A;  4UUS A;  3OY9 A;  1RET A;  2KFD A;  2HI3 A;  2DCE A;  2LK2 A;  2BHY A;  4MQ9 F;  4RAZ A;  1APL C;  3ZR8 X;  1E3O C;  5KNL A;  3J7A Y;  2PQ8 A;  1MMG A;  2FEZ A;  2R93 J;  3ERE D;  1ONV A;  1K78 A;  3HC7 A;  3VYR B;  1LE8 B;  3QOP A;  3L2Q A;  2XPW A;  3DEE A;  4AC0 A;  3V42 A;  3G1M A;  4UHT A;  4B3X A;  5D5W B;  2XDV A;  3T5X A;  2NRA C;  3PM1 A;  2FML A;  1QNT A;  4D0P A;  2QYO A;  1HDD C;  3EUK L;  4HX4 A;  5GPA A;  1FT9 A;  4A5M A;  1KYW A;  1IW7 F;  1DPU A;  3S2D J;  1R5H A;  1WH7 A;  1Y0N A;  5L3D A;  1ZHF A;  2P8T A;  4HA8 A;  3W3C A;  2XUB A;  1RZ4 A;  2KIM A;  5FGM A;  2A61 A;  3TP3 A;  2VBW A;  2A6T A;  3HGG A;  3SEZ A;  2PLY A;  1JKQ C;  1J2X A;  3IRR A;  4MFE A;  1IN7 A;  2ACJ A;  2DT6 A;  4AYB A;  1SFE A;  1OR7 A;  1XGO A;  1V4R A;  5FKK A;  3ERM A;  1VFC A;  3FF5 A;  1XMK A;  1WJF A;  4MEY F;  2XB0 X;  2R7S A;  3M1E A;  3D5S C;  3HOY J;  1L3L A;  2VLA A;  5EGO B;  1H0M A;  1PUF A;  2PMZ N;  2VAS A;  1HSJ A;  3A01 A;  5CVU A;  3I4N J;  3R6S A;  4HBL A;  5JR3 A;  4Q4Z F;  1WKM A;  3WU0 A;  3GME A;  2XRN A;  4EAT A;  2E1M B;  2XF5 A;  3CF5 F;  3ABU A;  3LSR A;  1MBG A;  4CCL A;  3V8L A;  5F0H A;  2X0L A;  2W82 A;  3PFI A;  2I5U A;  5DEQ A;  3CCM I;  5FD5 A;  3ZP5 A;  5HOD A;  3S1R J;  3O8H A;  2FQ3 A;  4BQO A;  1RUO A;  1SD4 A;  5GP9 A;  4DZP A;  2NS8 A;  3L7W A;  1G3S A;  4A3C J;  2OZU A;  1IF1 A;  1KA8 A;  1XDS A;  2CUE A;  3ZQH A;  2R7V A;  5CVI A;  2JA7 J;  1T38 A;  2IAI A;  2XAG A;  3F3X A;  3OYJ A;  2VT2 A;  4JYK A;  3OMY A;  5J1U A;  2EIJ H;  1ENH A;  2A5Y B;  2M7A A;  5BQT A;  3TOB A;  4BXF A;  1LDJ A;  1MGT A;  1HQC A;  4LMY A;  2XRL A;  4IJA A;  3CD6 I;  1S7E A;  3M8F A;  5EDN A;  2Q2E B;  2ZNY A;  5DD4 A;  4HX8 A;  1EH8 A;  4E7Z A;  4G7Z F;  4LOC A;  1XB4 A;  4I0A A;  3DFG A;  1YX3 A;  3QU6 A;  1YLF A;  1SD7 A;  2JJ7 A;  2QQ8 A;  3K4J A;  4IX7 A;  2K9M A;  1YIJ I;  2OTL I;  2VKD A;  4KMU X;  2QQA A;  2BOL A;  1Z7U A;  2JA2 A;  4A0Z A;  4XRS G;  3S2W A;  3QP6 A;  2JT1 A;  1NG7 A;  2CS3 A;  1IDZ A;  3I71 A;  3FXO A;  1NK3 P;  1G2H A;  5E1Z B;  2A68 F;  1E3P A;  1PVE A;  2JVH A;  1E0E A;  5ICG A;  5ICE A;  4XRS A;  3H9J A;  5J47 A;  1B72 A;  2QBY A;  3RTR A;  5E17 F;  2O6G E;  2DAO A;  4E4H A;  5K1Y A;  2XSJ C;  3GLL A;  4HX7 A;  1ZGA A;  3MQ0 A;  1DGW Y;  2EV6 A;  3PQJ A;  1G59 A;  3WG7 H;  1B9M A;  4A3E J;  4G6D A;  5GTI C;  3L2C A;  2Z9O A;  2ZSH B;  4U0Y A;  4QIW N;  1WSU A;  1KGS A;  3S2H J;  1JUS A;  4B1R A;  3AG2 H;  1WJD A;  5D8K B;  4YRV A;  1LPQ A;  1I1S A;  1YS7 A;  1WQ2 A;  3DLA A;  4CYC A;  4IRI A;  1ORK A;  1J59 A;  2KIU A;  3CMM A;  2DYS H;  2FJ1 A;  5CVR A;  2VJI A;  1U5T A;  5IYC J;  4HRI A;  3S3O A;  2HOA A;  1OFC X;  4A69 C;  2DO7 A;  2RN7 A;  1FP2 A;  2D1V A;  1KU7 A;  2D1H A;  1D1B A;  2FSW A;  4LLN A;  1R36 A;  3OYC A;  3LNQ A;  3U9G A;  4RGS A;  2KL4 A;  2ZJR F;  2RNG A;  2VJ4 A;  3KYC B;  1QPI A;  5FKM A;  4WXD A;  3OYM A;  4FX4 A;  4GRI A;  4Y3O A;  5HS8 A;  3CCQ I;  3WHC A;  3H5R A;  4F3Q A;  4UB8 C;  2X85 A;  4CXF A;  3MZH A;  2MYS A;  3BCA A;  2Z3Y A;  3GXO A;  3MN2 A;  3G4S I;  4UUS B;  4YIF A;  2WC2 A;  3R61 A;  2BY1 A;  1BR1 A;  1XN7 A;  1T2K A;  4JK1 X;  4YII A;  2BGC A;  3GFJ A;  4ENN A;  4I01 A;  2ME6 A;  2CJJ A;  2VIX A;  3CJT B;  4YFN F;  1WFX A;  2LKP A;  4G6T B;  2XAQ A;  2HYG D;  4B3A A;  2EFW A;  3I64 A;  4ENJ A;  1XX5 A;  4LG0 A;  2QKL B;  3P9C A;  4HYE A;  2VBZ A;  1T0F A;  4U7B A;  2O9L A;  1V5G A;  1JKP C;  3W2A A;  1FP1 D;  1QZE A;  3DBH B;  2OA4 A;  4M71 A;  3RDI A;  4FT8 A;  3BRO A;  2ZXW H;  4BYY A;  1BM9 A;  3OYN A;  3AL0 B;  3OYH A;  1EF4 A;  3ZGK A;  2H6C A;  1Y0U A;  4IHW A;  1Y8R B;  2QEN A;  1FZP B;  4MTD A;  2P81 A;  4A3B J;  1R49 A;  2V9K A;  1JJ6 C;  2R7W A;  2ID3 A;  3K4K A;  2CQ7 A;  3JRE A;  1SAN A;  1H8A C;  2RAE A;  3FM5 A;  4IHY A;  4I0B A;  1MZB A;  1I5Z A;  3Q3S A;  3B02 A;  3GCM A;  4LLL A;  1YHQ I;  1RR8 C;  2MC3 A;  2O03 A;  2NNY A;  1DP7 P;  3LMM A;  5F1R A;  1XSV A;  2YS9 A;  4XKW A;  1BI0 A;  1PUF B;  3BR1 A;  4XNF A;  3DTE A;  3IWZ A;  4I76 A;  2WY8 Q;  1YJN I;  3A01 B;  1AU7 A;  1B9N A;  3FK7 A;  1W1W E;  3H1C A;  4F55 A;  1YX5 A;  2LF7 A;  2A5W A;  3FDY A;  4XMY A;  1IUF A;  3SQN A;  4XN0 A;  3QQA A;  1KZH A;  1GXQ A;  1X4P A;  3G2B A;  4XON A;  3ZPL A;  1IGN A;  1QU3 A;  4F7Z A;  4DYR A;  1H89 C;  2OAZ A;  1I3A A;  4RM2 A;  1IN5 A;  3ABL H;  1HLV A;  5M3M J;  2LDU A;  1JTY A;  1XGN A;  3HXL A;  5AIP A;  1U8R A;  2A07 F;  3WTT C;  1UST A;  2P7C B;  3W6V A;  1OYY A;  3SZT A;  4EJO A;  2BXY A;  1WI3 A;  2BE5 F;  4MHG A;  4HNT A;  1TTY A;  2ZME C;  2MGQ A;  5E3L A;  4CCO A;  1R7J A;  1IN8 A;  1YIT I;  1FSE A;  1ZRD A;  5HS7 A;  3OS1 A;  3HOW J;  3GTQ J;  1IV6 A;  3TMO A;  1LJ9 A;  4P55 A;  1UG0 A;  2R92 J;  2HKO A;  1B4A A;  2COB A;  3WTY C;  4DGW B;  2IA1 A;  2ECB A;  2YX4 A;  4HZF A;  2Y48 A;  2KDO A;  4A6E A;  3J7A O;  2MG4 A;  2GLO A;  4G12 A;  4BUP A;  4UVC A;  4A3I J;  1GDT A;  5LHH A;  1D1A A;  2V7F A;  1FY7 A;  1OCO H;  2E34 A;  3HB9 A;  5D4R A;  4RAF A;  5ILU A;  4S0H B;  1IN6 A;  2RQP A;  2GBY A;  3MKW B;  4KJZ A;  2BXZ A;  1A6I A;  1LB2 A;  1BC8 C;  2LR8 A;  4IVN A;  3QYE A;  1G8X A;  2DOF A;  2DI3 A;  5L3E A;  3FXQ A;  2VOD A;  3JSO A;  2DYR H;  1FWZ A;  2ECC A;  2R7R A;  2VE8 A;  3A2K A;  2IGK A;  3OS2 A;  2E5N A;  3MKY B;  1TC3 C;  4GDF A;  4HNU A;  1LUJ B;  3QAH A;  1TL8 A;  4NHJ A;  1MBJ A;  3K1N A;  4M3E A;  4EJU A;  1QQI A;  1B72 B;  2QBY B;  2ELK A;  2NVT J;  3OOP A;  3C1D A;  4IHT A;  1OKR A;  1SD6 A;  1X1B A;  4XR6 A;  1HC8 A;  1W0T A;  2CQN A;  2X6W A;  5E20 A;  1LEB A;  3I58 A;  2EBI A;  2Z1D A;  3NAU A;  1FMW A;  3D5L A;  2Z5U A;  4R1H A;  1O4X A;  2UV1 A;  2PX9 A;  2Q1Z B;  1WGX A;  5GAH J;  2DPU A;  2HGC A;  3ZXS A;  4IOC F;  3JAM K;  2IGM A;  4ASN A;  3I5U A;  3D1N I;  3IHU A;  3REO A;  2OQG A;  3KEY A;  4LD5 A;  3PO2 J;  1POG A;  4II2 A;  3OWT A;  5FFZ A;  3ELK A;  4LFU A;  2D2W A;  3LSH A;  2X1C A;  3CC2 I;  5F64 A;  1F9N A;  4JOM A;  3I53 A;  1WWX A;  4BDY A;  4QPQ A;  2VT3 A;  4ZYA A;  3J81 K;  1ZG3 A;  4HEA 2;  2GA1 A;  3WGH A;  1R5I D;  4GO1 A;  5DUI A;  5D5V B;  1P7J A;  2MH2 A;  2VC0 A;  1SFX A;  4KT6 A;  1X19 A;  4WXH A;  4HDU A;  3VFZ A;  1LVK A;  2OQR A;  1QZZ A;  1JUM A;  5KHD A;  4FE4 A;  2HNH A;  3NRV A;  4YEL A;  1OCC H;  2JWT A;  3I4P A;  4IO9 F;  1S6L A;  2GXB A;  2CU7 A;  3EUH C;  3DV8 A;  3W2V A;  3GX4 X;  5K7H A;  4RB3 C;  2VOP A;  5C44 J;  1D0Z A;  3ISP A;  3MCZ A;  4LG0 B;  1BOA A;  4QTR A;  3GW2 A;  1QPM A;  4QLC U;  3SZG A;  3LFK A;  4OU0 A;  1U3E M;  1DGR M;  3RZO J;  3FZV A;  2E35 A;  1FTZ A;  2ZFW A;  1XCV A;  1WI9 A;  3ASN H;  4EVI A;  2DU9 A;  3DF8 A;  3L2R A;  2JA6 J;  3S14 J;  1BR2 A;  1Y6I A;  3PIO F;  2V1X A;  2F4O B;  1VQ9 I;  4EGZ A;  2AQF A;  4CDG A;  3LSI A;  4RB1 A;  1S3J A;  2GXG A;  4PUS A;  4E7L A;  4HST A;  1L0O C;  3F23 A;  2R7F A;  3ZQQ A;  3R60 A;  1JKR C;  5C3E J;  2M9H A;  2GIZ A;  3OL3 A;  3TKY A;  3HKZ N;  5A2Q K;  4O3M A;  2LY9 A;  2LD5 A;  2PMU A;  1AOY A;  4KUM A;  2MLK A;  4AIJ A;  2HXI A;  2DQL A;  4BJT A;  1FNN A;  1HKQ A;  1YS6 A;  3SHF A;  3BZC A;  1Z7L A;  4KMF A;  3J7Z I;  2RRE A;  4OAY A;  1WZ2 A;  3KE2 A;  4CYD A;  1MJA A;  2R7Q A;  1UZC A;  4K2E A;  2EH3 A;  3M8E A;  1ZKG A;  1V3F A;  1GXP A;  1HDP A;  1UHW A;  2LBF A;  5IP7 J;  4CSW A;  4DQ2 A;  1NK2 P;  4AIK A;  2R4G A;  3F9K A;  4C2M J;  1J9I A;  1N75 A;  3C7J A;  1F1Z A;  2E5Z A;  3J81 Z;  1W4M A;  1XS9 A;  1N78 A;  3LOC A;  2EIM H;  2MLG A;  5FRN A;  2M0C A;  5EJC A;  4G8X A;  3OYE A;  3ZQF A;  3DXJ F;  1KQ8 A;  1YFH A;  2BZT A;  3CJR B;  3OR1 C;  3SDG A;  3MZ8 A;  1SFU A;  1YW7 A;  4GGG A;  3NEU A;  3EET A;  3ZQI A;  2XV4 S;  1P4X A;  3RKQ A;  2EIN H;  1ON2 A;  1OYI A;  4E7S A;  3OYG A;  1A35 A;  2K7L A;  4V19 K;  4WK8 F;  3T8T A;  3CDL A;  5KK1 A;  1V5E A;  2AS5 F;  3HOT A;  1J09 A;  4BQN A;  2XKP A;  3K70 C;  1TNT A;  1K61 A;  3GTL J;  4U0W A;  2W1O A;  5DS9 A;  5FRO A;  5HVQ C;  1E2X A;  1AWC A;  3ZMU A;  3BR5 A;  1YJW I;  1ON1 A;  1MKM A;  2Q2E A;  2VKH A;  2EIL H;  1DP3 A;  1MH3 A;  2DDB A;  4Q47 A;  3CLO A;  4HDV A;  2GOX B;  4P5O A;  1OCR H;  1IRX A;  1R1U A;  2A05 A;  3KPH A;  3SYT A;  3BC8 A;  1A04 A;  2EZK A;  2EJR A;  3DEU A;  4MIM A;  4BHC A;  2DFI A;  1OCP A;  2KIF A;  2KIQ A;  3WTZ A;  4U88 A;  2OZ6 A;  3HGY A;  5GAE J;  3BCB A;  1Z77 A;  2M8E A;  2HPI A;  1BJZ A;  2RQQ A;  2KZG A;  1IV8 A;  5ILS A;  3ZMS A;  2H6B A;  3KX2 A;  5E18 F;  2DA5 A;  1BBY A;  5A2Q Z;  2YR2 A;  3SFI A;  2PN6 A;  1A31 A;  3TBI A;  3UNG C;  1HBX G;  2GXA A;  2DA2 A;  4MLO A;  1YO5 C;  3KLN A;  4IRH A;  4XKV A;  4KN4 X;  2EZH A;  1QHH D;  3BJ6 A;  4PK4 A;  2ZME B;  2E1C A;  1H9G A;  1GVD A;  3WTV C;  1P9Q C;  4MGR A;  1ITY A;  1R9T J;  2HQN A;  2E36 A;  4UXN A;  4ZTJ A;  4GFB A;  2TCT A;  3A03 A;  5J4V A;  3S1N J;  1XC5 A;  3E3V A;  3HHH A;  4B4C A;  2R5Y A;  2IT0 A;  3BOQ A;  1R1V A;  3AG4 H;  4O6J A;  2Y69 H;  2I10 A;  2JK3 A;  2VL8 A;  2KKO A;  4EMS A;  5DM6 F;  3HL2 A;  4ZYD A;  1XGS A;  1FTT A;  4U7D A;  1K4T A;  4E7J A;  3TDU C;  1MW7 A;  1N77 A;  1ODD A;  3F72 A;  1MSF C;  3OYI A;  2W57 A;  4GXO A;  2HOT A;  1IUY A;  2CUJ A;  3QYB A;  4Y4R A;  2CV1 A;  2QQB A;  2HR3 A;  1JKO C;  3TL4 X;  1ZLJ A;  1AKH A;  4IHX A;  1JGS A;  4HG2 A;  4RLF A;  4KIS A;  1SVL A;  4FAS D;  4A3J J;  4PFP A;  2TRT A;  1X1D A;  5AIQ A;  2M3A A;  2JPB A;  1A6Q A;  1TQM A;  1QRY A;  3ULQ B;  1VQM I;  3DKY A;  3K0L A;  2UXX A;  1C0W A;  1YTY A;  2OPT A;  2RNJ A;  1HW2 A;  4EM2 A;  3CUO A;  3CCY A;  2FU4 A;  3FXL A;  4L9T A;  4BAC A;  3BG9 A;  1XCB A;  1Y8Q B;  3EDP A;  2ZB9 A;  5LHG A;  4HPQ A;  4B43 A;  4KIB A;  4M9Z A;  3ZMT A;  1O3Q A;  3DP7 A;  4EEF G;  1LEA A;  3FHZ A;  1E17 A;  2B63 J;  3OYL A;  1A36 A;  3RSN A;  3WGG A;  3H3V K;  1ETW A;  3M07 A;  1FC3 A;  3AFH A;  3H36 A;  2QUF A;  2J5O A;  2VB6 A;  4BDZ A;  5TIS C;  2CV0 A;  3A1Y A;  1O7F A;  1XTA A;  4IEJ A;  4BJ5 C;  2VON A;  1JT6 A;  1UFM A;  2M8G X;  1BI3 A;  3WTW C;  3H9G A;  3LSP A;  2IS4 A;  3E6C C;  1A5J A;  3Q9V A;  4G94 A;  2FOW A;  4ANJ A;  3CES A;  1TWF J;  5J1R A;  2ICW G;  1YW9 A;  3DTK A;  3GLX A;  4BH9 A;  1XGM A;  4X0G A;  1R23 A;  2NVQ J;  3CCL I;  1FEX A;  4AWX B;  4XQF A;  3F8B A;  2PJP A;  3MWM A;  1GV5 A;  2DA4 A;  2HYJ A;  1O3R A;  4KT5 C;  3QU3 A;  1XG1 A;  2WWY A;  4KIG A;  2VXD A;  3CMA I;  2Y2Z A;  2G0E A;  3IH3 A;  3M1C A;  3JTG A;  3FHN A;  2LBF B;  4KIC A;  2LLK A;  2FBI A;  3GVA A;  4N9H A;  2KJC A;  3FMQ A;  2V4J C;  2AXT C;  1NHA A;  3ZN0 A;  5DCM A;  2R7Z J;  1IRG A;  4A3M J;  1D0Y A;  4RLQ A;  5TGT A;  2OUM A;  4M72 A;  4E6K G;  3VDX A;  3KP4 A;  5ICC A;  3AAF A;  5E3N A;  5JHU A;  1K6O A;  3JRA A;  1VQ8 I;  2ID6 A;  1B59 A;  2JUG A;  1CQT A;  4M74 A;  1OJL A;  5LBQ A;  2KHM A;  3AG1 H;  2CGP A;  1F5T A;  3HEF A;  1NG6 A;  4HQE A;  1B8I B;  1NH3 A;  3IAS 2;  4HLY A;  1BIA A;  4CZZ A;  1R58 A;  2L7Z A;  4UY8 I;  1LFP A;  1K83 J;  4GCV A;  2VPL A;  4M3F A;  5IP6 A;  2CFO A;  1PP8 F;  2EB7 A;  1D5V A;  4WCG A;  2L7F P;  2M34 A;  1MNM C;  4E70 A;  1DPR A;  2DK8 A;  2DTZ A;  1KQ9 A;  2VXZ A;  1Y1V J;  4L9V A;  5E8I A;  4L9N A;  3KCC A;  3MEX A;  4BBS J;  2H09 A;  5KVR A;  4NC6 A;  1WJA A;  2E2I J;  5E1W A;  3CP2 A;  5L3B A;  3DTI A;  3H5N A;  4MNU A;  3LQR A;  2YU3 A;  3RI4 A;  1FBS A;  3FX3 A;  2B0L A;  2OV7 A;  2OCE A;  1VQ7 I;  1TWH J;  4M6V A;  2AQE A;  4UNO A;  3TO9 A;  3JRB A;  2MAB A;  3FXU A;  2L9R A;  5ICF A;  2P6T A;  4XLF A;  1TT0 A;  1UJ8 A;  3JSP A;  1IO2 A;  4A0X A;  5FB2 A;  4CHU A;  5HS9 A;  3HKZ A;  5F0C A;  5E3O A;  5FLM J;  1MSE C;  4OMY A;  2OC6 A;  5HOO A;  1HXD A;  4IKF A;  1FX7 A;  2HVR A;  1WVR A;  2P0W A;  3F0C A;  2BBY A;  2OD5 A;  4DBR A;  4UV8 A;  2IGN A;  3GTJ J;  3CUQ C;  3KZY A;  4ENM A;  3J7Y J;  3BG7 A;  3JRC A;  3U21 A;  3K4C A;  3ZMZ A;  2LNB A;  1UHS A;  2R5Y B;  2WAQ A;  4HV5 A;  3ZN1 A;  5LEJ A;  4N9I A;  4OIN F;  2HVQ A;  2RKH A;  1FOK A;  4ESJ A;  4OIR F;  5TRD A;  1S7A A;  4RAG A;  3IC7 A;  2EIK H;  3C2B A;  4RAY A;  3CCJ I;  4L0Z B;  2OU2 A;  3H0D A;  1Z91 A;  2PG4 A;  2V9P A;  2Y0M A;  5EG0 A;  2IA0 A;  4XLH A;  1MND A;  4E7I A;  3LAJ A;  3KEO A;  4D7M A;  1FMV A;  2FX0 A;  1SC7 A;  3S32 A;  2BYV E;  4EJV A;  2IJL A;  2GA2 A;  5HNH A;  2F6C A;  3CJQ B;  1P7I A;  5IY5 H;  1AKH B;  5J1Y A;  3BG6 A;  3HOS A;  4XLA A;  3G71 I;  4MTE A;  3PIP F;  4LG3 A;  2XAH A;  1LVA A;  2DN0 A;  3ZOB A;  3VOE A;  2O8K A;  2QA4 I;  5CVJ A;  4FE7 A;  2KIS A;  2H1L A;  1MBK A;  1OYW A;  1V54 H;  1P4A A;  2BVM A;  2WB1 N;  3KLO A;  5CYV A;  5ERI A;  1FOY A;  2FNP A;  3S8P A;  3IKV A;  4RBO A;  3BLY A;  2R7D A;  3L2V A;  4BU2 A;  3MZY A;  2VOO A;  2DTR A;  2NS7 A;  1R1T A;  4I99 C;  5GTH C;  1V5F A;  2L01 A;  5J8C A;  4XRM A;  3AKZ A;  2VE9 A;  1HKS A;  1Z9C A;  5J8F A;  1YG2 A;  2PEX A;  4L5J A;  1K4S A;  1VZ0 A;  4HQM A;  3QPT A;  2Z16 A;  5FO5 A;  5KAF C;  4LJZ F;  1RUN A;  3GYH X;  1D8J A;  1HKT A;  2HTJ A;  1KU9 A;  2RV8 A;  4U87 A;  3JRF A;  2YSR A;  4KN7 X;  4BJ6 C;  1UHM A;  1UAA A;  2L54 A;  2AHQ A;  3F8C A;  4V2G A;  3FKI J;  2BY0 A;  2V6E A;  3V7C A;  1TZL A;  2JA8 J;  2QCO A;  2H27 A;  1HW1 A;  1O3S A;  1ACI A;  2F4I A;  4A2U A;  1HCR A;  3BQZ A;  4C3J J;  3OIO A;  1EJ9 A;  3VYT B;  3KP7 A;  3MFK A;  4WXC A;  3RQ4 A;  4LB6 B;  1IXS B;  2FBH A;  2NVY J;  5F0F A;  1WHU A;  3K4M A;  3HRU A;  3VOD A;  4BGD A;  2UZK A;  4XKC A;  6PAX A;  2R3S A;  1V55 H;  3VPR A;  1VQ6 I;  4OMZ A;  2Y31 A;  4WX9 A;  2ZCW A;  2RDP A;  2LY1 A;  1RC9 A;  2DMU A;  2ZO4 A;  4Q48 A;  4ZC3 A;  3GTG J;  3IWF A;  1TQP A;  3DPT A;  4F91 B;  5K7Z A;  2QEX I;  2XAF A;  4LK0 F;  1MBF A;  2CSO A;  2STW A;  5DCM B;  3ECH A;  3DWL E;  1Y1W J;  4H0E A;  4IHV A;  2EK5 A;  2EPF A;  2M2E A;  1MMA A;  1H9T A;  4ZDL A;  2HDD A;  1X3U A;  3BPV A;  2STT A;  1T95 A;  2JSP A;  3E6D A;  4N0B A;  3KYL A;  4ZDO A;  3O2P E;  3QPH A;  3GFI A;  1VI0 A;  3BWG A;  5IYB J;  4KIF A;  2FOK A;  3FWE A;  4ABZ A;  4I6Z A;  1UMQ A;  2L4A A;  4L9J A;  5FD6 A;  3H3U A;  2VKV A;  4XLE A;  3HOU J;  2KMU A;  3OR2 C;  1XSD A;  3E6M A;  2ZJP F;  1DQU A;  5L3G A;  2W7N A;  1I27 A;  3WTS C;  1OLT A;  1KON A;  3W6J B;  2A3S A;  5F27 A;  2D45 A;  1DUX C;  2LP0 A;  2DMQ A;  1MBE A;  4AIH A;  3BJO A;  2DPD A;  2KRH A;  4UVB A;  2AO9 A;  1UG2 A;  2HWV A;  2MW8 A;  2Y0S N;  2VC1 A;  4J19 A;  4M73 A;  1WJC A;  4LIU A;  1Z3X A;  2CFX A;  4L5I A;  3HZJ A;  2HQA A;  3ZRG A;  3RJP A;  2WTE A;  5DCF A;  2I8D A;  1D0X A;  2E7X A;  2EFP A;  2K86 A;  4FX0 A;  1TWC J;  3LA7 A;  2ISY A;  3DCF A;  3FBN B;  4J01 A;  5B1B H;  2J5P A;  1TQI A;  1YOV B;  3N97 A;  3T1B A;  4HF2 A;  3R0A A;  2ZME A;  3RZD J;  3GTK J;  2G9W A;  4RGX A;  1U78 A;  2VI6 A;  2C6Y A;  5F1J A;  1W5T A;  4IXA A;  4FQG A;  4AYB N;  2PMZ A;  4ZH4 F;  2RGV A;  4FTH A;  3HSE A;  2WY7 Q;  3CCU I;  3OSG A;  4XKB A;  1Z21 A;  3NWT A;  4PDK A;  2DFF A;  1FOX A;  2NNN A;  2HEO A;  4EJW A;  2K85 A;  4KA4 A;  2X48 A;  1I1G A;  5F6F A;  2K9S A;  3M9A A;  2P5V A;  2PI0 A;  5CKT A;  3K6G A;  2LKX A;  4CGZ A;  4C2U A;  2B7E A;  3I9V 2;  2ZKZ A;  4EJT A;  2CQK A;  1T39 A;  3TGN A;  3KP6 A;  1QBJ A;  3RPQ A;  4DIQ A;  4B47 A;  3L9F A;  2JQ7 A;  4Z6Y A;  5EG0 B;  3LFU A;  5ILV A;  2VBX A;  3F8F A;  2DBB A;  3LST A;  1MBH A;  1BR4 A;  3BJA A;  3JRI A;  4A12 A;  2ZFU A;  2KQR A;  3H9Q A;  1JE8 A;  3KYD B;  4XLC A;  2HFH A;  4BBR J;  4BQQ A;  3OOU A;  1W36 C;  1JI8 A;  4XID A;  4PJM A;  2ZBK A;  2L9S A;  1OIS A;  1ZGJ A;  2XGD A;  1BI2 A;  3GZ5 A;  3ML6 A;  4I02 A;  4ZYH A;  4L0Y B;  2HVS A;  3ZQ7 A;  4ZYG A;  5DDG A;  2LYC A;  1EKE A;  2HZT A;  1IRZ A;  3IUO A;  1KU2 A;  3H3Z A;  4Q5S F;  2HYF A;  3FXR A;  5IOY A;  3TW6 A;  2DA7 A;  2HQ5 A;  1UB9 A;  1WCM J;  1BW6 A;  4QSH A;  3I55 I;  3Q0W A;  3KET A;  1XD7 A;  1Z6T A;  5HLI A;  2DJI A;  3U1K A;  2M4G A;  1R6R A;  4C3I J;  4HF1 A;  3CUQ B;  2YUS A;  4S05 A;  4D5C A;  5HLH A;  5FLV A;  3CME I;  4RS8 A;  1DU0 A;  4XL9 A;  4DZJ A;  2P5L C;  4M3G A;  3S93 A;  2JSC A;  2O8X A;  4B44 A;  3PO3 J;  1FIA A;  3Q0U A;  1G4D A;  4Y15 A;  5E3M A;  5FKO A;  3C2H A;  2UUZ A;  3BG3 A;  1IJW C;  1T33 A;  4NB5 A;  2IVM A;  5GPC A;  2DJN A;  2VPR A;  2IEK A;  4XK4 A;  2LKS A;  4YFK F;  1K79 A;  2K9N A;  5EZH A;  1JJ8 C;  2VUM J;  2LSO A;  2LVS A;  2ZNZ A;  5FKN A;  4BHP A;  2DFH A;  3S17 J;  1QVU A;  3A0H C;  3FXJ A;  4BXX J;  3E5Q A;  3PUB A;  4NQW A;  3OYA A;  1B1B A;  3I54 A;  4LK1 F;  1IAW A;  4I2O A;  4AD9 A;  1SAX A;  3H92 A;  3JAM Z;  2JUC A;  2ADU A;  2L3D A;  3DKX A;  3HIF A;  1T8I A;  3BR0 A;  3EUH A;  3W2W A;  1HOM A;  1EH7 A;  4XLN F;  2PBI A;  1Z05 A;  3H0G J;  5LGU A;  2HDC A;  5M3F J;  3W6K B;  1FSH A;  3TOA A;  1OMI A;  2GZW A;  5L3C A;  4XBF A;  4IQJ A;  1FYM A;  2EA2 A;  3PNV A;  2Y9Y A;  3FM3 A;  2NOG A;  2WAF A;  3V7R A;  4Y52 J;  4RB2 C;  3H5A A;  3WU1 B;  3K2Z A;  3N05 A;  2F5D A;  2DDA A;  2E1O A;  2PMH A;  5HLG A;  3OYD A;  5GAD J;  2IRF G;  3FXM A;  3HM5 A;  3O3K A;  1STZ A;  4XSZ F;  1U6G A;  3HTU A;  2K9Q A;  2YU9 J;  2JRT A;  9ANT A;  1YIO A;  4I98 B;  5LGT A;  3GZ6 A;  2OJE D;  1FPQ A;  2XAS A;  1HF0 A;  3PSF A;  1IZ1 A;  4KDP A;  5LHI A;  1D5Y A;  3LL7 A;  1R5G A;  5B5E C;  3BY6 A;  4M3D A;  3JRG A;  5D4S A;  2VKE A;  3ZQL A;  1P92 A;  3CP8 A;  1FBQ A;  2MD5 A;  2OBP A;  5ED4 A;  1FOW A;  3RCO A;  4QPO A;  1T6S A;  3S3M A;  3CMY A;  1TBX A;  1B8I A;  3CJN A;  4IL6 C;  5K5O A;  5EZG A;  1FIP A;  3PUF A;  2FQ4 A;  2R7U A;  3H35 A;  2ELH A;  1VQO I;  2JRM A;  3K10 A;  4N4N B;  3AG3 H;  2V6C A;  4YIR X;  2EFN A;  2LG4 A;  1OPC A;  3KP3 A;  1X1A A;  4XSX F;  2WB1 A;  2DMP A;  1IN4 A;  2XAJ A;  4AVP A;  3HYI A;  1W5C C;  1JTX A;  3BQY A;  4W1U A;  1XMA A;  3Q0V A;  5HLT A;  3BR3 A;  2A6E F;  4A3L J;  4DYC A;  2DLL A;  3VYU B;  4AVZ A;  3RPU A;  1VTN C;  5DM7 F;  2K3P A;  4AM3 A;  2CW7 A;  2FD5 A;  1RR7 A;  3MVP A;  4CCN A;  4A6D A;  3D5R C;  5KCM A;  4DOZ A;  2HKX A;  3L00 A;  1ZTR A;  3EYY A;  4J00 A;  2F4M B;  3KIO A;  3E5U A;  3KZZ A;  2L4M A;  4R8H A;  3Q5F A;  1K6Y A;  2JN6 A;  3I0T A;  1TW3 A;  1XMX A;  3FXK A;  2E60 A;  2EZI A;  2HOE A;  4ESB A;  4F52 A;  2HXO A;  2V79 A;  2L02 A;  2GM4 A;  4NC7 A;  4NDL A;  3RKW A;  4C2T A;  3HPG A;  4UUV A;  3ECO A;  5JFR A;  4BNC A;  2LMD A;  3TQN A;  2IA2 A;  3K1P A;  3V7S A;  2VQH A;  4BQA A;  2JZY A;  4N4O B;  1IDY A;  1WJ5 A;  2A6H F;  2XB5 A;  2Z2S B;  3A02 A;  4M3B A;  4PJ0 C;  4BEH A;  1U0J A;  2HOS A;  3GUD A;  3QP5 A;  5DTD A;  1X3W B;  3OV8 A;  1RPW A;  4G6Q A;  2BW3 B;  5LRS A;  5LEK A;  3M4O J;  1F43 A;  3A0B C;  2CQQ A;  2G7H A;  4O5V A;  5D5X B;  2IXS A;  5CJ9 A;  1SD5 A;  1J0R A;  3DBR B;  2A69 F;  3ABT A;  5E8G A;  4HF0 A;  3AL0 C;  4UVA A;  2L7K A;  4OOI A;  4E7H A;  2R0Q C;  1S8N A;  2YX7 A;  1VF9 A;  3RPU D;  2DA1 A;  5JVT A;  4FET A;  1Z3Y A;  3CCE I;  2GQQ A;  3HTS B;  2EV5 A;  3CO7 C;  3K4N A;  4HSR A;  4P9F A;  3BT9 A;  4Y33 A;  1KU3 A;  1VQN I;  2L0K A;  2X1D A;  1D1C A;  4CUG A;  4G7H F;  2Y9Z A;  2EQR A;  2M5W A;  1OR7 C;  2NS0 A;  1R22 A;  5H2F C;  4XM3 A;  2UXN A;  2CWE A;  3QPS A;  3CDI A;  3R0J A;  5IOZ A;  3CF2 A;  1HST A;  3LSJ A;  4ESF A;  3EYI A;  4V2F A;  3DBL B;  3KP2 A;  4IRG A;  3K70 D;  5B66 C;  1VQP I;  2X6Y A;  2F5F A;  4U0V A;  4BL0 B;  3OYK A;  5JI6 A;  1TNS A;  4LIV A;  1HA8 A;  1OQY A;  2CUF A;  5EEA A;  2ZJQ F;  1Y39 A;  4CH7 A;  2QM3 A;  3PNT A;  3VSL A;  1W7P B;  2Y0S A;  1T56 A;  3ASO H;  3EQL F;  3D0S A;  3DKW A;  2FRH A;  2M0M A;  2KT0 A;  2FMY A;  4B09 A;  3T8R A;  4LGW A;  5K5R A;  3JRH A;  1ZYR F;  3LQQ A;  5LGN A;  1Z67 A;  1O3T A;  1MIJ A;  4PJJ A;  2QGU A;  3HBL A;  3HPH A;  1T08 B;  2V26 A;  1RES A;  4KNY A;  1SAU A;  1O57 A;  1SVO A;  3BR6 A;  1D3Y A;  1X2N A;  2HQR A;  3OYB A;  1WRJ A;  3GEZ A;  4L18 B;  4I09 A;  4BHB A;  2VN2 A;  1I6X A;  4ON0 A;  3V8J A;  2XGX A;  1PYV A;  2K27 A;  4NQW B;  1BJA A;  2VBY A;  4HW0 A;  1XPX A;  3J80 K;  1ZRC A;  3I3L A;  2H94 A;  2WV1 A;  5BNG A;  3IL2 A;  1XDU A;  1FJL A;  4XIC A;  2K02 A;  5IYD J;  1X4O A;  4UB6 C;  5BPD A;  3CC7 I;  5J6X A;  3IH2 A;  5LRR A;  5L3F A;  2MFZ A;  2L5Q A;  1YQA A;  3F6O A;  4NUB A;  4AU7 A;  2IS6 A;  3E1S A;  1BI1 A;  2FUG 2;  4C3H J;  4IOA F;  1DU6 A;  5IP9 J;  3EPZ A;  4ZYE A;  2CMP A;  2H8W A;  3C2G A;  1O7L A;  1ZN2 A;  5JVG F;  2EZL A;  2W48 A;  1X1C A;  4DJA A;  2DK5 A;  4PCQ A;  2JA5 J;  1H88 C;  5C4J J;  3MMY B;  2JPC A;  2X6X A;  2RC4 A;  2W4S A;  1SEU A;  3K4L A;  3Q9S A;  4F92 B;  1B6A A;  2ZSI B;  3G73 A;  3V4G A;  1ZG5 A;  1ETO A;  2XPU A;  5JLW A;  4HLX A;  3GFM A;  4P1W A;  5K7F A;  2H8R A;  1Y56 A;  3ROU A;  2ESN A;  2HS5 A;  3KEQ A;  4JQF A;  4PZJ A;  1JGG A;  1REP C;  3S1Q J;  3BR2 A;  4UUT A;  3CCV I;  1WPK A;  3HRM A;  4A3D J;  3DQV C;  2JMW A;  3B6C A;  3GZN B;  3FKJ A;  2LOO A;  4JX5 A;  1EA3 A;  5CQG A;  2R7T A;  3DPL C;  2LRE A;  2O61 A;  1LDK B;  2QWW A;  5HDG A;  3C3W A;  1U5T C;  5IT3 A;  5J4Y A;  1Q1V A;  2BY3 A;  4PGG A;  3VSK A;  1I39 A;  2ZJ2 A;  1VQ5 I;  2WBM A;  3QRF F;  3FMS A;  3WU2 C;  4D5F A;  1SFO J;  3LSM A;  3DU5 A;  3U1D A;  3FIW A;  2XVC A;  1E3H A;  4EQQ A;  3PSI A;  1J7K A;  2L7M P;  2UWM A;  2WA0 A;  3S15 J;  2GWR A;  1GT0 C;  1SMT A;  1MMN A; 
#chains in the Genus database with same CATH homology
 4FQG A;  2LKS A;  2E71 A;  2DOE A;  2DOF A;  2KIS A;  2KZG A;  2KFD A;  2K85 A;  2CQN A;  2JUC A;  2B7E A;  2KIQ A;  1UZC A;  2DOD A;  2L9V A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...