2KISA

Solution structure of ca150 ff1 domain and ff1-ff2 interdomain linker
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
GAMGSLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural studies of FF domains of the transcription factor CA150 provide insights into the organization of FF domain tandem arrays.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Transcription regulator
molecule keywords Transcription elongation regulator 1
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kisA00
1UZCA 2E71A 2KZGA 2DOEA 2K85A 2KISA 2JUCA 2DOFA 2CQNA 2KIQA 4FQGA 2B7EA 2KFDA 2L9VA 2LKSA 2DODA
chains in the Genus database with same CATH superfamily
3KP5A 1Z0XA 4FE7A 4L0YB 5BPIA 1Z7UA 2DI3A 5FROA 3TMOA 1W5SA 2L54A 1HCRA 1D0ZA 1K83J 3FF5A 4GYGA 3UNGC 1YS7A 3W6VA 1U8BA 1OCPA 1DQUA 5BOXA 4J00A 1HKSA 2PX9A 4MQVA 4G6TB 1BI0A 4FQGA 1IXCA 4CCKA 2Y69H 3TGNA 5LGTA 2E36A 2R7ZJ 1UG2A 2EFNA 3MWMA 2MA3A 3FKJA 3O8HA 1T98A 2PMHA 5FRNA 1I27A 1YW9A 3F8CA 3OS2A 4NDLA 5L3DA 4AD9A 4Y7NJ 2M8EA 1K78B 3L2CA 4DQ2A 2NS8A 5D5UB 4PJJA 2M34A 5HLGA 3CCRI 1BJZA 2IA0A 2WC2A 3DTKA 2NAZA 2R92J 3FXLA 3DWLE 2R0QC 5IYDJ 5DM7F 1RR7A 1Z05A 4ENJA 5KHDA 1I5ZA 3DEEA 1Y8QB 3BTJA 2Q8KA 4RDUA 4AVZA 5DCFA 4FTHA 2KDOA 2VBWA 5E1WA 1O3TA 3WODF 4EQQA 5DEQA 3QODA 4LK0F 5JLWA 2XVCA 2CS3A 3A01B 4WCGA 1VZ0A 2EQRA 3L2QA 5K5OA 3KE2A 2GBYA 4LB6B 2VONA 3BR5A 2VKEA 1D8KA 2IA2A 3OSFA 3E3VA 4RGXA 3VEPA 1KU2A 4PGGA 1T8IA 2R5ZA 4G7ZF 2ACJA 4HSTA 2XAQA 1WJCA 3PNYA 3QP6A 1LFPA 2E1OA 2EBIA 1X19A 1B59A 2Y0MA 5ILSA 2L4AA 2ZXJA 2F5FA 4UHTA 1K4TA 5FB2A 4C2UA 3BPVA 4JX5A 3ZMDA 2V7FA 2DPUA 4ASNA 2YS9A 4LG0B 1XTAA 2JK3A 5JFRA 3S17J 4BL0B 1O7LA 4BQAA 4RGUA 1R4NB 3SHFA 1LQ1A 3I55I 3D5LA 4IRGA 5AIQA 3ZQLA 3GTKJ 2L7MP 2DT7B 4C30A 3JTGA 3J81K 1OISA 1EV7A 1BJAA 1FY7A 1JGGA 3M4OJ 2KISA 4D0PA 3LAPA 2L4MA 3TDZC 4XONA 1H88C 3LSJA 1U8RA 5FGMA 3DBHB 3HJEA 1S3JA 4Y3OA 2DXIA 3E5UA 3BR6A 1UHSA 2MD0A 1XMKA 1KYWA 3ELKA 3CC2I 1UJ8A 4CCMA 5KNLA 4E7LA 1MNEA 3HHHA 3M8EA 1B8IA 3BDDA 1NH3A 1CGPA 4RGRA 4FISA 2DT5A 4BJ5C 3J81Z 3WE3A 2F5DA 3ZMZA 3HOTA 1E2XA 2P7CB 4BDYA 1Z9CA 2XAGA 4MHGA 1ERDA 1G3SA 2NXNB 2BW3B 2GXGA 1MJBA 4B3XA 2CQKA 1J0RA 2VT2A 3L2WA 2STWA 3V8KA 4HF0A 3L7WA 4XRFA 2VB6A 5J47A 2M87A 3DQVC 3PM1A 1ZR2A 2VASA 1RKWA 2J5PA 2JUCA 1XSDA 3I56I 3SQNA 3ZN1A 2HXIA 4D7NA 3H92A 3MKZA 4F55A 5L3GA 2L7ZA 1PP8F 3IRRA 5H6RA 5E3MA 4FASD 1LDDA 1BIBA 2LRDA 1TLHB 4A3JJ 1HC8A 2FQ4A 2OA4A 3RI4A 2KP6A 3L09A 2IS4A 3SZTA 2N8GA 2FF4A 3IAM2 1YJWI 1VQ6I 2B0LA 4NC7A 2AS5F 4UB6C 3WTVC 1FX7A 2PN6A 1RZ4A 1ZRDA 1EA3A 1SANA 3IHUA 1BBYA 3J80K 3G71I 5KVRA 2X0LA 4KISA 3QRFF 3SZGA 2MGQA 1KQ0A 5EGOA 2E7XA 5LLQA 1PVEA 3A0HC 4A12A 3ML6A 4HNVA 1TC3C 5IY5H 2HOAA 4MEXF 4XLPF 2LD5A 1UG0A 1QZEA 4A3GJ 2XAFA 4GYIA 1ZGWA 3HB9A 1XX5A 1MJAA 1IAWA 1SFUA 4RLFA 4A2UA 1UELB 3NWTA 2ZSIB 1KQ9A 2CUEA 1ETVA 2A3SA 2K9QA 1IRXA 4II2A 4XKWA 3CC7I 2YSRA 5CPRB 1B8IB 1V5FA 4HA8A 1X2NA 1SFKA 3CJNA 5IT3A 4CYCA 3F8FA 3LSKA 3DBLB 2H94A 1WKMA 4HDVA 3WGHA 1OFCX 2BYVE 3RDIA 3RPUA 4BKXA 1WJDA 2HS5A 1P4XA 4PZJA 2MG4A 3Q9SA 4OMYA 3OY9A 3BOQA 2QM3A 2X9DA 2JSCA 3CD6I 1R58A 3MMYB 3RCOA 3RKWA 3JTHA 3EDPA 4LK1F 4AM3A 5BMZA 2HI3A 1SD6A 3CP2A 2G7UA 1KA8A 2CQ7A 2W57A 3A4CA 4BE1A 1MMSA 5C4XJ 3FXUA 3M1EA 1ACIA 3ZQ7A 4UY8I 1V4RA 3DKYA 3P5JA 2ELJA 1YHQI 1GLNA 3KZZA 2IS6A 2R7WA 5K7HA 4I0BA 5E3LA 1MBEA 1TL8A 1U5TC 1KU7A 3WTYC 5K7FA 4WXCA 1BW5A 3WGIA 3PFYA 3ABUA 4A0ZA 2EZHA 2V1NA 1VI0A 1NTCA 4PSXA 3W2VA 4E70A 5L3EA 2OCEA 2V6CA 1QHGA 2D5VA 1RC9A 2D1VA 2LMDA 3I59A 4I2OA 2NS0A 1BM9A 2PEXA 1P4WA 1BC7C 1MIJA 2CV0A 2PLYA 3HG9A 2DOAA 2EH3A 3ZOBA 2ZXHA 2V26A 3FK6A 2HQAA 4M3FA 4IEJA 2DCEA 5ICGA 3FBIB 3OYNA 1GXQA 2BOLA 3TP3A 3K1PA 2Q1ZB 1W36D 1FOKA 4MTEA 3F22A 4IQ4A 4I99C 4EEFG 2DJNA 1K4SA 3F8BA 2LY9A 2NVYJ 2X1DA 5IOYA 2EZIA 1I39A 3IP4B 3K70D 5H2FC 2AHQA 1AWCA 2IA1A 3K69A 3LSIA 1HDDC 3HRSA 2X6XA 2K3PA 2L9SA 4EM0B 5EF6A 2H6CA 2W24A 4PDKA 4BJTA 2GAUA 3B73A 1KONA 1B6AA 4RAGA 1KYZA 1JHHA 1UMQA 3VOEA 1T2KA 3OL4A 4AVPA 4BQOA 1RRJA 4FETA 1U5TB 4L9NA 2F2EA 3AL0C 3FMSA 2F5EA 3CQZJ 3A0BC 1JT6A 1V3FA 1FIAA 5D6FA 1SVOA 4XR6A 2XC7A 2DT6A 3ZXSA 3GTMJ 4I7HA 1QZYA 1G3WA 4I02A 4OAZA 3HOSA 3C2HA 3LQQA 1TWCJ 4E7KA 2M3AA 4OIOF 2RV8A 2OZUA 1JE8A 4BEHA 2IPQX 1XGMA 2DBBA 2R7XA 4FX0A 4CA0A 4ITVA 3G6EI 4ON0A 1J75A 3G1LA 5GAGJ 3OYAA 2CJJA 2XRLA 2W25A 2KDZA 3F8NA 3WU2C 1R5GA 2E35A 3PO3J 5HDKA 1MDMB 3V8LA 3BLYA 3FX3A 1X58A 1B72A 5K5RA 2I5UA 3LA3A 2QKLB 3GBGA 3IAS2 5HNFA 2X6YA 1MH4A 3SDGA 2L9RA 2HKOA 3HXLA 4AIDA 1YLFA 4WX9A 3OYMA 2BHZA 1RESA 4DGWB 3BQZA 5L3BA 4CYCB 1WI9A 5FLVA 2ZJRF 1UHWA 2WAFA 3EUHA 1R6RA 2W48A 3LNQA 3OYDA 1HDPA 5B5EC 2XASA 3WTWC 1IG7A 2NRAC 3MEXA 1VQMI 3M7GA 2C6YA 1TWHJ 3T8RA 4GFBA 2H6BA 4MEYF 4CCJA 3RKXA 4HX7A 2CYYA 1T0FA 1YYVA 4JOMA 2K9NA 2FQ3A 4QIWN 2UV1A 3IRQA 3AFHA 3I64A 3HBLA 5JHFA 3BR1A 1LEBA 6PAXA 3VB2A 4XSXF 1E17A 1PUEE 1IN6A 3ABKH 4MGRA 2ZFUA 3VSLA 3S1NJ 1FEXA 1ZARA 4A3DJ 3ECHA 5CJ9A 3HL2A 3RYPA 1XG1A 1H9TA 2KJBA 2XDVA 1Y8RB 1FBSA 3M1CA 2F4MB 1GDTA 3F6VA 4G94A 4YFXF 2R7QA 2Y31A 1IDZA 2IGKA 1YIOA 2QCOA 4CCOA 1L0OC 4XORA 5DUKA 4M6VA 3EUKL 3DTEA 2DU9A 5HVQC 2VQCA 2K7LA 4BU2A 4LIVA 1R00A 3R4KA 4YRVA 5FLXK 2ZXWH 4KNYA 2GIVA 1TQIA 1WFXA 1VQ7I 1IRZA 3CCJI 4L9JA 3UKGA 2DYRH 2HGCA 3FXOA 3FIWA 1O3RA 3S2DJ 4IKFA 4A3FJ 1IUFA 2R7RA 2ZSHB 2R5ZB 2HFHA 2QQ9A 2CQNA 4ABZA 3MZ8A 4HNTA 2M0MA 3MQ0A 3RZDJ 3DU6A 5FLXZ 2VOOA 4IXAA 4A3EJ 2HQRA 2R5YB 1DPUA 4JQFA 2FMLA 2V1DA 3GTGJ 1BR1A 2CQQA 2MC4A 2I10A 3RJPA 2D45A 4L9VA 2KJCA 5FLMJ 3E5QA 5FD6A 3MKYB 1YX3A 2R7SA 1LKXA 5FKLA 2E1NA 2EFQA 4F92B 4ZYGA 2HTSA 3RYRA 5LFAA 2VN2A 2KRHA 5D5WB 1K78A 3VYUB 4M9ZA 5BNGA 4IPAA 1FBQA 1B9NA 4AIHA 5BQTA 2E2HJ 5HNHA 3OOUA 1OJLA 2PI0A 3RPUD 3FDYA 5AONA 4N4NB 4R79A 1Z91A 3I59B 1PUFB 2DFEA 2XGDA 2QF7A 4XRMA 1LVAA 4V2FA 1ZKGA 1FP2A 1YOVB 2K5CA 4N9HA 4WXHA 3V42A 4F52A 5J1YA 5IP6A 2UXXA 2P81A 4XQFA 3RIRA 3KZYA 1A35A 2Q0OA 4L0ZB 1IV8A 4M3GA 1R23A 2XGXA 4RB0A 1QA6A 1RIOH 4EJUA 3CO7C 3LAJA 1U3EM 3H5NA 2PMZN 2ISYA 1Y1WJ 4HNUA 4OAYA 3COAC 2BE5F 2GOXB 3JCUC 4AIJA 4Q5SF 1HA8A 1PJRA 2NOGA 2ZC2A 3TKYA 2R7FA 3OL3A 1O57A 1Y0NA 2HEOA 1T95A 1F9NA 2K4JA 4HF2A 4HQMA 4YFNF 5EG0B 1WSUA 2HPMA 1MW7A 2K85A 5IP7J 4A93J 1AKHA 5EDNA 4BQNA 2BBYA 2O3FA 4IRHA 3HRMA 2LDUA 4N9IA 5E8IA 2NYXA 3G1MA 1HW2A 3I71A 3VDXA 1P92A 2JWTA 1L3LA 2LG4A 3CJQB 2YUSA 5LHHA 1A6IA 3WU1B 4XN0A 5F1JA 1CF7A 3I4PA 4I6ZA 5EGOB 2QEXI 1ETKA 3GWZA 4ZH4F 2XGEA 3BC8A 1D1CA 2MLKA 4N4OB 3OYCA 1OMIA 2DFFA 1XSXA 2A69F 2EZLA 3L2UA 3E6DA 1WJFA 2L9VA 4JX6A 2IT0A 4B43A 1IO2A 3JRBA 4Y4RA 4OIQF 3EQLF 1ZLKA 1S8NA 1S72I 3GX4X 2TDXA 2WB1N 5L3FA 1U2WA 3ONQA 4C2MJ 3H5RA 2OPTA 1VQPI 3S15J 4GGGA 2KZVA 4P1WA 2ME6A 4UUVA 2OC6A 1W7PA 2K3FA 1HQCA 1TW3A 4BHBA 3TDUC 1VQ8I 2QQ8A 4HRIA 3K0LA 3HUGA 3CUQB 3DBRB 1YRNB 2MW8A 3UR3C 1DP7P 4IHXA 4IRIA 1ZN2A 1GVDA 3KP3A 2V1XA 3Q5FA 2V9VA 4EJOA 4CYDA 2BY2A 5E8GA 2DDBA 3I58A 4LFUA 1HOMA 1BR2A 5DV5A 1YRNA 1UHMA 2CG4A 1W0UA 2GA1A 2A61A 5FD5A 1OCTC 3G2BA 2DQRA 5FRMA 3OMYA 2ME0A 5EZHA 2L3DA 1HKTA 1BIAA 4C2TA 1GV5A 5GAEJ 5D4SA 4NC8A 3HGYA 3JRGA 3CCSI 3SJMA 1F43A 2P5VA 2QKMB 3KIOA 3G1OA 2L7KA 1OYYA 2E71A 2FBIA 4Y13A 3CLQA 3FZVA 3H0GJ 4ZYAA 1VF9A 3LSPA 1YG2A 4HYEA 3B6AA 1J09A 5CQGA 1POGA 2KPMA 3G3ZA 3IKVA 1VFCA 4HLXA 4M6XA 2ELKA 3LSGA 1IXSB 2ZJPF 1SFOJ 3C1DA 5L3CA 1EJ9A 3CMAI 3HHGA 1HBXG 4P9FA 3PNTA 1X2MA 1V54H 2L5QA 1IGNA 1QBJA 4AC0A 2ZB9A 1BC8C 4Y52J 1S5LC 4ZDOA 3KP7A 1ZG5A 2LBFA 1W1WE 1UFMA 2VQHA 4S0HB 3WTSC 4NQWA 1G4DA 3GTPJ 1OCRH 1AKHB 2CW7A 4RBOA 4U88A 4MQ9F 4B3AA 2DJIA 4XL9A 5F64A 4HEA2 3RZOJ 3K7AJ 3PUBA 4YIIA 1QGPA 1ZK8A 3BT9A 5E20A 4LMYA 2QQAA 1MNMC 2W82A 1HSTA 1IUYA 4HQEA 1X3ZB 3BR2A 1H0MA 3K2AA 3TO9A 3U1DA 3CF2A 3GFMA 1T39A 1IZ1A 4IHSA 3TEDA 3KYCB 4KIBA 4Q47A 3A03A 4HZFA 1YI2I 4C9YA 5HDNA 3CCMI 2KFDA 2JPCA 2QENA 1K79A 1PDNC 1DU0A 1TNSA 4UB8C 1G59A 3GLXA 1GVJA 3KYLA 1WQ2A 1JT0A 2QSGX 5E18F 4CCLA 3C18A 2VJ4A 3H3VK 1K7AA 4V19K 2F4OB 1IN4A 3BG5A 3FXMA 4JX4A 4OIRF 1VQLI 4OIPF 4IOAF 5LHGA 3H9QA 5J1RA 2DAOA 2CWEA 1OYIA 2HNHA 2Z16A 4G9YA 4PSWA 2GA2A 5JI6A 1R49A 2R3SA 1ETXA 5TISC 3TL4X 3OOPA 4B1RA 3BTCA 1D5VA 2MSYA 2Z5UA 2FE3A 5F0CA 4WWCA 4ESJA 5FKKA 1U9OA 4XRSG 4P9UA 3DPUA 2XROA 2UZKA 1XCBA 3I54A 1SD5A 2H8RA 4ENKA 2EA4A 1J9IA 4L5IA 3R60A 4IO9F 4BGDA 3BWGA 4BDZA 4QPQA 2GXAA 2PQ8A 4RMNA 3E6BA 4KDPA 3SZPA 1SVLA 2DN0A 4PFPA 2HVSA 3FK7A 2VC0A 1B9MA 4ZJZA 1ZQ3P 1RNLA 4V2GA 2E5NA 3I3LA 4LGWA 2DOEA 3GTQJ 2EJRA 2R7DA 1W7PD 3B6CA 2LC2A 1AHDP 3GTLJ 3HSRA 5EEHA 1JKRC 2MD5A 2GXBA 1R1VA 4CO8A 2Z3YA 1P7IA 1TBXA 1C0WA 1T0FC 2FBHA 4XLCA 3ZMSA 4IZZA 2WADA 5KCMA 3VFZA 1P4AA 3WGGA 1LNWA 1JUMA 2HR3A 5GPCA 3N05A 1BR4A 2XPUA 4CUGA 4PGHA 2RQPA 2MH2A 2YX4A 4U7DA 3ZMTA 2B63J 1ZLJA 2HZDA 1BW6A 3ZN0A 1U6GA 1TQMA 2LFBA 3QPTA 4OMZA 2MC3A 2PFBA 3EUHC 1OR7A 1W5TA 3GTJJ 3W6KB 2P8TA 2KIUA 1SC7A 1KQ8A 3DEWA 4LOCA 3ZQCA 1IN5A 1OCOH 1ZR4A 2A5WA 4PCQA 1LDJA 1OLTA 2KRFA 2R7TA 4C3HJ 1XMXA 1BOBA 1ETOA 2RDPA 2FNAA 1XGOA 4XIDA 3AL0B 3ZQQA 3CC4I 5E79C 2Y2ZA 3KZIC 3IKTA 3T0YA 1AOYA 4A3BJ 4YIFA 2QUFA 1WVRA 3ECOA 1IW7F 2HU9A 3BP8A 2LKPA 4KJZA 1FSHA 4UNOA 4IHTA 1K6OA 2PJRA 2KIMA 3CMMA 3W6JB 2G9WA 2EFPA 2B7EA 4DYRA 5KAFC 3KP4A 5KAIC 4EMSA 3Q0VA 1YFHA 2JTVA 3CUQC 2IVMA 4DZPA 1DGWY 5J1UA 2IGOA 3K4NA 1HF0A 2ZKZA 4D5CA 4B4CA 1ENHA 3BR3A 1IXRC 4G12A 3WG7H 1O3QA 1J59A 1YS6A 1LUJB 4E4HA 3MKWB 3G73A 2VI6A 2H09A 3SFIA 1NK3P 2DMPA 2GOMA 2TRTA 4DBRA 1JI8A 1XSVA 3A02A 1IRFA 3M07A 3GXOA 3P7NA 2DFIA 1T33A 1PP7U 5GTHC 3FKIJ 2VQGA 2LH9A 5E3OA 5D4RA 2QSHX 2VE9A 2QYOA 5LD2C 2E1CA 2FEZA 3ZP5A 4BJ6C 3P9IA 1BI3A 1TWFJ 2NVUB 2NNNA 2F5VA 3GVAA 3Q0WA 1W0TA 1ULYA 3LWFA 4F7ZA 5J4VA 2RVCA 5DS9A 1FYLA 2OCCH 4I76A 4BHCA 3BJAA 4JP0A 4ZYDA 5GPAA 1NK2P 1W36C 2GLOA 3FM5A 4MLOA 3TBIA 3WHCA 1BI2A 2DK5A 2FSWA 3BROA 2XPVA 4KT5C 5LEJA 1G3TA 2IAIA 2OF7A 1MKMA 5GADJ 3JRDA 2X51A 2H8WA 3K70C 3LSTA 1LVKA 1E3OC 1HSJA 1QRYA 3BG9A 3TW7A 2M4GA 4UVCA 3PO2J 1IV6A 2DTRA 2BXYA 1D0YA 4JYKA 1ZHFA 1MH3A 5GAHJ 2F5CA 2QA4I 2WY7Q 1X1AA 1RETA 2L02A 2ZO4A 2Z2SB 3HZJA 1VQNI 1U5TA 4IVNA 2O5RA 3LL7A 1SAXA 1ON2A 2KHMA 2BY1A 2XB0X 4BBRJ 2VC1A 4P55A 1N75A 2XIGA 1BA5A 3L1PA 2GQQA 2HDCA 3E7LA 3IH4A 4FT8A 3ZCOA 2DW4A 1RPWA 1MBKA 4XM3A 4ZZLA 4KUMA 1TP4A 4M3DA 4E7JA 4WK8F 1V5GA 2CFXA 3QYEA 4L5JA 1HW1A 2FXAA 1CQTA 2F48A 3PJRA 1A31A 1R7JA 2EB7A 4EV0A 1MMNA 5K7ZA 4M9XA 5FKOA 3FISA 2JA2A 2DA6A 2OU2A 4J19A 5ICCA 2YU9J 5CVIA 5DD8A 4M9SA 4M3BA 2EIJH 1X4PA 4TV7A 3DP7A 1REPC 4A3CJ 3WG9A 3HOVJ 3QPLA 3HOXJ 3AG3H 1Y1VJ 3BTLA 1IDYA 1LDKB 1FLIA 1ZYRF 3OSGA 3HYIA 2W4SA 2LY2A 2VE8A 3GFLA 3V8JA 2Y0SA 5KK1A 2HZTA 3NARA 2LYCA 4LG0A 1S6LA 1E3HA 4BQQA 2RNGA 4HLYA 1S7AA 4XICA 1D8JA 4LJZF 3OYGA 3JRCA 2P6TA 3O8GA 2RNJA 3ROUA 2H27A 5IPAA 1S7EA 3K4KA 2E2IJ 3SEZA 1USSA 2V1UA 4ZTFA 1Y39A 2QLZA 3PIOF 3D5SC 5M5WJ 3S3MA 4A3KJ 4XN3A 3S2HJ 2IS2A 3KETA 1BL0A 2P6SA 1YE9A 3A1YA 2HOSA 2JJ7A 3WU0A 2XF5A 1Z3YA 2M4KA 3IV5A 3OS1A 2V9PA 5M5XJ 1YTYA 2XHKA 3J80Z 1RI7A 4G6DA 2RREA 4KIFA 2LOOA 2Y75A 4X1EA 2VXZA 4DW6A 3HDDA 1R1UA 1OYWA 3KEOA 2ICWG 3C2GA 1BOAA 3ULQB 2HOEA 5HDGA 2STTA 1MDMA 1D1BA 2AQFA 3KEQA 2A6TA 2XAHA 3FXJA 2LF8A 3D0SA 3CCQI 1JGSA 3DU5A 3OR2C 5TJJA 1Y56A 2L9NA 2BV6A 5LEKA 3DV8A 1R4MB 2JMWA 2LF7A 4XMYA 4UVAA 1SMTA 4UUSB 2AQEA 1F5TA 2LK2A 1QVUA 4C3JJ 1FTZA 3L2RA 2O0YA 1MSEC 4DZJA 1SMYF 1VNDA 3IUOA 2CUZA 2VOPA 3BCBA 3DCFA 2EFOA 2B9SA 4M72A 4L5EA 3HC7A 2L2OA 3OR1C 2HOTA 3TOAA 2DFHA 5HLIA 4CZCA 2BXZA 3HOWJ 1RR8C 2RN7A 3E97A 2WAQN 1KZHA 2OZ6A 4NQWB 4BUPA 3J7AO 1X1DA 3JSOA 3GF2A 3T1BA 5ED4A 1N77A 2O6GE 3ABLH 3FXQA 3SYTA 4BXFA 4PJNA 3QYFA 2AO9A 3F0CA 2OTLI 1S29A 3GW2A 2LR8A 2ID6A 2A05A 3OIPA 2COMA 4I01A 5LGUA 2OQGA 4M71A 3W3CA 2P5KA 2PMUA 2MFZA 4NC6A 1IC8A 4GDFA 4B09A 5K1YA 4XKBA 2PJRB 2K4BA 2ZBKA 4IX7A 4E7HA 4NNJA 3L2VA 1Z7LA 2BGCA 4A0YA 2QBYB 1X4OA 2J5OA 2FOKA 4U0WA 2ECBA 3S93A 3OYIA 2IBDA 5D6EA 3HPGA 1U0JA 4UV9A 3RPQA 4CXFA 3GZ5A 2Y30A 4KYWA 4RAYA 4CZZA 1FPQA 2EZKA 2V4JC 2A6EF 1F4KA 2O03A 4IHWA 2A5YB 2DQLA 2LREA 3KLNA 2OJED 1FOXA 2QBYA 2WBMA 2W84A 1ETYA 4HSRA 1EF4A 1W5CC 4D9JA 2EV6A 4OWRB 3DF8A 1BN5A 3VSKA 3CCVI 4XRSA 2O8KA 1K6YA 3P9CA 3BG3A 1WJEA 2P5LC 2ZJ2A 3MFKA 3K4CA 1WH5A 3QU6A 3CUQA 4C3IJ 2P0WA 1ITYA 3HPHA 2HDDA 3K4JA 4ESFA 4ZTJA 2FU4A 3K4BA 3MAJA 3O3KA 2F6CA 2VPRA 3HOYJ 5A2QK 3GFIA 5IYCJ 1J7KA 1ZG1A 3E6CC 2XB5A 1UAAA 4D5FA 3T5XA 2XGCA 3REOA 3L9FA 4HV5A 1WZ2A 1E3PA 1SFEA 3ISPA 2OAZA 5F0HA 1QPIA 3S2WA 4YG2F 5D5VB 1MBJA 2ADUA 2IW5A 4XLEA 2DA5A 1FNNA 1TZLA 3VYRB 1TWAJ 4U7BA 1OCZH 3GYHX 2W1OA 1P2FA 1OR7C 3AAFA 5A2QZ 3JSPA 4R8HA 4MTDA 2PJPA 1X1PA 2FMYA 4DBQA 2HDWA 3OYHA 3BZKA 3C2BA 1LJ9A 1G3YA 3CF5F 4XBFA 3FM3A 5EYRA 2HVQA 1WPKA 4M3EA 2GM4A 3LQRA 2OV7A 1ZELA 3HGGA 5H6QA 1EH7A 2VBZA 4ENMA 1GT0C 1FTTA 2A07F 1XB4A 4BS9A 2XSDC 2HYFA 1XN7A 1Q1HA 1ONVA 1R22A 4IF4A 2NVTJ 2BY0A 4QPOA 2HPIA 2M7AA 4DYQA 3HTSB 3F23A 1EH8A 2LNBA 5FKNA 1ODDA 2NS7A 4NB5A 3K9TA 3I53A 3O6BB 2JA6J 2JSPA 2OQRA 5B3SH 3S32A 2JVGA 2I8DA 2OBPA 3TO6A 3M8JA 5CQEA 4YELA 2CUJA 2OUMA 5J6XA 2KL4A 4S04A 5EJCA 2IRFG 2HQ5A 2W00A 1JKOC 4BXXJ 4R1HA 4W1UA 3OYBA 1USTA 4O3MA 4CSWA 3HKZA 1MJ9A 1U9NA 3H5AA 2V6EA 4BE0A 4UUTA 2DTZA 2QZ8A 3BG7A 3W2WA 4BYYA 2H1LA 3C3WA 2JRTA 2BW3A 2M9HA 4CHUA 3AG4H 2ZXIA 2LBFB 1I3QJ 3F21A 1QVTA 1Y0UA 1R5HA 2E5ZA 3DLAA 5K5QA 3CDIA 4BNCA 1WJAA 4BH9A 1A04A 4PUSA 3FHNA 5C44J 3CMYA 2FOWA 2NOJB 1RUNA 3S1MJ 2O7OA 2Q2EB 4MO7A 3FMQA 1GV2A 3PQKA 4KMUX 4LLLA 2EV5A 3HTUA 2WV0A 5F0FA 1FJLA 3W2AA 4LIUA 1LFUP 1FT9A 1ZAOA 2PG4A 1SFXA 2LY1A 3E6MA 3U1KA 3RKQA 2Z9OA 1N78A 4BHPA 2Y9YA 1TQPA 2GZWA 3Q3SA 5HS9A 3CLOA 1XD7A 1Z3XA 4XNFA 2EIKH 3GCMA 2M2EA 1HLVA 3K6GA 3JAMZ 3BJ6A 1JUPA 3OIOA 3BJOA 3VWBA 1FYKA 4A69C 1F1ZA 1FMVA 2CQXA 3GEZA 2KT0A 3LFUA 4AU7A 3OYFA 4BE2A 3SEQA 4A3LJ 2DMUA 3N97A 3M8FA 5F08A 5GTIC 3OYJA 1OCCH 2YX7A 3CCEI 2ISZA 2M8GX 3GMEA 3CTAA 2ELHA 1DPRA 1XMAA 3E0JB 4Y33A 1Z67A 2ZJQF 5F04A 3U9GA 3G4SI 3JAMK 3KFWX 1NG7A 4EVIA 3H9GA 2LSOA 1DP3A 2Z33A 3HUGB 5DDGA 1MSFC 2WV1A 2MYSA 2O8XA 1WWXA 2EILH 1VQOI 3S16J 2ZMEA 3LOCA 2FNPA 2O9LA 1J2XA 2FUG2 4UV8A 3QWLA 1I1SA 1Z6RA 2X48A 3EUAA 2CV1A 4GXOA 4QSHA 2RQQA 2ESNA 2VIXA 2EPFA 2W85A 4L9TA 2M5WA 1JTYA 1S9HA 3BY6A 4WXDA 4GO1A 3J7ZI 4A6EA 3E1SA 4Y15A 2CFOA 2R93J 2R7VA 3QQAA 3R6SA 5JVGF 3RSNA 1ZGAA 4IHVA 3R0JA 3V4GA 3CZ6A 2L0KA 2FJ1A 2Z99A 4ANJA 1T56A 1ZRFA 1YO5C 1F36A 1TT5B 1TTYA 4PJLA 3S1RJ 1A36A 3ZMVA 2HWVA 3LSMA 3HEFA 3IL2A 3WTXC 2BY3A 4NBQA 4QLCU 1XCVA 3MN2A 4U0VA 1AU7A 2DLLA 2E1MB 3HSEA 5J4YA 4KICA 5IT9K 4XOTA 1HW5A 2GWRA 1ZREA 1V55H 5M3MJ 1FZPB 2RKHA 2VJJA 2KRCA 4U87A 3N4MA 2M30A 4EJVA 4UXNA 3PUFA 2MBFA 1NHAA 1QZZA 1LB2A 3QOEA 3ERED 4LG3A 2JA7J 2YPRA 3ABTA 4RB1A 3ZMUA 1EH6A 1RKTA 4E7ZA 2JA8J 3EPZA 4EM2A 3F3XA 1WH7A 3SFZA 4XOPA 2G0EA 1TNTA 2WA0A 3PIPF 2R7UA 3ERMA 5IT9Z 4XLAA 3CESA 2RC4A 3OYKA 4KN4X 1X1BA 3OS0A 1M1EB 4RA2A 3MD2A 1NG6A 2CRGA 3QP5A 1YQAA 3HM5A 2DODA 2OTJI 3MCZA 2DMQA 1H9GA 2JA5J 5BPDA 2VJIA 2VXDA 1YX5A 5IYBJ 3H0DA 1D1AA 2V9KA 1T6SA 1S7OA 3RQ4A 2JT1A 3CDLA 2XKPA 2XSJC 1QPMA 4I98B 4CICA 2HKXA 1YW7A 1PUFA 1P9QC 3F6OA 3BPXA 2VKHA 1MD0A 2DMTA 4XLHA 5F1RA 4UUSA 2A68F 2VBYA 1Y6IA 1DDNA 2EFWA 1IJWC 3SDBA 2P4WA 1A6QA 4CGZA 4J01A 3H3UA 2VBXA 3I0TA 3H1CA 4KIGA 2K40A 3IH3A 4CH7A 3TP0A 2LKXA 4XSZF 1DU6A 3K2ZA 1FIPA 1FBUA 1EKEA 2GIZA 2R5YA 3VODA 4IQJA 5ILUA 2K27A 3IWFA 3KCCA 1BI1A 3CDHA 1WHUA 3FXKA 2XF6A 4NUBA 2MABA 3U2RA 1MNDA 2ZFWA 4CDGA 2BZTA 2ZNYA 5AIPA 4GRIA 4HOBA 2BVLA 2JVHA 4M6YA 4HAMA 3CUOA 4EJWA 1O7FA 3V7RA 4KFCA 1D0XA 2IGMA 3BCAA 2K9LA 3BR0A 5E1ZB 1QO0D 1UCRA 3D5RC 1J5YA 3L00A 3DFGA 4A5MA 2EIMH 3WE2A 1YIJI 2DA7A 2A6HF 3PSFA 5BS6A 2WY8Q 1T08B 5DCMA 4D1QA 5LGNA 5B66C 3TQNA 4ZDLA 4JK1X 1JHFA 2KZGA 2UUZA 3O2PE 3ZPLA 3ZR8X 3RQIA 2KKOA 1ORKA 1GUUA 1I3AA 1DGRM 4PJMA 5FFXA 2Y48A 1YITI 4P96A 1I1GA 3IH2A 2CW8A 4EGZA 3RKYA 2RGVA 4DJAA 5FO5A 1W7PB 3J7AY 3GUDA 4HPQA 4F91B 3GZ6A 4A5NA 1UB9A 4NHJA 3BQYA 1WJBA 2HYGD 4DIQA 2WB1A 1OQYA 2FX0A 2LP0A 4A6DA 3I4MJ 3S1QJ 2BVMA 3DKWA 1W4MA 1VQ5I 3KP6A 2NVXJ 1I50J 1R36A 2JZYA 4I0AA 3CJTB 1MBFA 2DK8A 3Q0UA 3EYYA 3QPSA 2XKOA 3IC7A 5IP9J 1B1BA 5FKMA 4PFOA 2DPDA 4L18B 1CF7B 2DA1A 3QU3A 1FP1D 4DOZA 2XPWA 1SVMA 4RAFA 1GXPA 2K86A 2PBIA 2X4HA 4OOIA 4E7SA 1JKPC 3MKLA 3OYEA 2CU7A 3NAUA 1WRJA 3HOUJ 1QHHD 1ZGJA 3PNVA 4RM2A 4KITB 3D1NI 2NNYA 1Q1VA 1VQ4I 1T38A 4AYBN 5EZGA 3NRVA 4F93B 4KMFA 2HTJA 4RM3A 4U0YA 4A3MJ 1DUXC 5M3FJ 3NEUA 2DMNA 2V79A 4P5OA 3X2QH 4AIKA 3RTRA 4X6AJ 1FOYA 2VLAA 3WHBA 2LVSA 3GO5A 4WF2A 2D2WA 3S8PA 4BACA 2Y9ZA 1FOWA 2R4GA 1MMGA 4IJAA 3ZQHA 5D8KB 3QPHA 5F27A 2QSFX 4YFKF 2ETHA 2XAJA 3JRIA 2DO7A 4O5VA 4B8XA 3JW4A 1KGSA 4A3IJ 2RAEA 4G7HF 3KP2A 3TW6A 3S3OA 5HOOA 3ZQFA 1U78A 4QWQA 1SAUA 4LLGF 4XLFA 1O4XA 2VJ5A 1O3SA 1XGNA 2CMPA 4II3A 1R5ID 1ETQA 2BHYA 4DYCA 4BBSJ 2IGNA 5DCMB 2E2JJ 1VTNC 3LA2A 1WI3A 4HBLA 4LB5A 4FE4A 3DTIA 2E1MC 1G6NA 3B02A 4OU0A 2F4IA 3JRAA 4XK4A 1OKRA 1JJ6C 2CUFA 2JN6A 1QNTA 2EWNA 4PK4A 3DEUA 3VYTB 3AG1H 4M73A 2LLKA 4QTRA 1JUSA 1YJNI 2CSOA 4RAZA 1QQIA 3EETA 2X6OA 3KLOA 5LRRA 4B48A 2KLOA 3M3YJ 4MFDA 3CJRB 3A01A 2EV0A 2KIFA 2ZMEB 3ZRGA 4G8XA 2CW0F 2VL8A 4BY7J 1P7JA 1Z6TA 3HOZJ 2Z1DA 1MMAA 2IJLA 2KQRA 4A0XA 2K02A 2TCTA 5C3EJ 3Q9VA 2LTPA 4AYBA 1AA7A 5EEAA 4IOCF 1D3YA 4G7OF 2W7NA 5CVVA 2OD5A 3PSIA 1ON1A 2H1KA 2X1CA 3I5UA 3K4MA 1FWZA 3DLLF 2ZCWA 2HQNA 3QAHA 4D7MA 2G7HA 1HKQA 3GTOJ 4EM1A 2ECCA 5HODA 3QYBA 1A5JA 5B1BH 1XDUA 1WGXA 2IP2A 2QQBA 3ABMH 5DYMA 5IOZA 4UVBA 2WAQA 1IRGA 3DPLC 3DKXA 2O61A 1JXSA 3CO6C 4ZZDA 3TO7A 2L01A 2EA2A 1Z77A 4LLNA 2P7VB 3H35A 2CV2A 5F6FA 3I9V2 3ASOH 2AXLA 3MVPA 2XV4S 1XC5A 2LKSA 5ILVA 2XRNA 4HG2A 3FXRA 3BZCA 4AUXA 1R9TJ 1XDSA 2YR2A 2FA5A 5HS8A 2L7FP 5H20A 3PL8A 3R61A 5TGTA 2M1BA 2KMUA 3ZGKA 2R7OA 1FC3A 1SD7A 3KYDB 4MIMA 3PQJA 4EJTA 3S3NA 5ICFA 3M9AA 1V5EA 1XGSA 3FBNB 5J40A 3E5XA 4CCNA 2JPBA 2BEOA 2X1EA 4IHYA 2DA4A 4YEJA 2PMZA 1STZA 3QOPA 4ZDPA 3FWEA 2VT3A 4BAYA 1LFBA 4FHTA 4LD5A 4HX4A 5J3LA 3HIFA 1K61A 2VPLA 1WJ5A 1TT0A 3C7JA 5D5XB 4M74A 4EATA 2IS1A 4N0BA 5CLSA 1QU3A 9ANTA 2QGUA 3GZNB 1Z1DA 1YJ9I 4HV6A 1G2HA 2MLGA 2KIQA 3LA7A 3AKZA 1OPCA 3ZQIA 3NQOA 3K1NA 2JQ7A 3T8TA 4YIRX 2ZNZA 2HYJA 1FSEA 2X85A 1ZRCA 1N25A 4ESBA 2DA2A 2MH9A 4DNCA 1SEUA 4BY1J 3IWZA 4FCYA 3FMRA 4O6JA 2AXTC 3HRUA 2DA3A 5ICEA 3HSFA 4KN7X 2XUBA 3GFJA 1LEAA 1G8XA 1MZBA 1X3WB 4KA4A 2HVRA 5CKTA 4Q48A 1JTXA 3LSHA 5GP9A 3BG6A 4F3QA 3H3ZA 4G6QA 4EGYA 3K4LA 1ZTRA 2VQLA 3K10A 1LPQA 3F9KA 1IN8A 3R0AA 1MGTA 3CP8A 3H36A 4ZC3A 2X6WA 1B72B 2QVOA 3OYLA 3OIQA 2E34A 1JJ8C 3J7YJ 3VPRA 5E3NA 4ENNA 2ID3A 1KU9A 1TW2A 2JRMA 3CMEI 4XLNF 2IEKA 4W97A 3U21A 2CO5A 5J8CA 4RLQA 1D5YA 4RB3C 5EEGA 1R71A 1WCMJ 1HXDA 2K9SA 4FX4A 5DTDA 1UZCA 4HW0A 1GHCA 3KX2A 2WWYA 1ETWA 1IN7A 1KU3A 5JLXA 2HXOA 3V7SA 4BEHB 4AWXB 4XKVA 3JRFA 3LMMA 4PJ0C 4X0GA 5CVUA 1XS9A 1IF1A 3NWSA 3AG2H 1I6HJ 3LSRA 1ZH5A 3OV8A 2D1HA 3S14J 3CCYA 4H0EA 5HLTA 3HKZN 2K9MA 4I09A 3CCUI 4K2EA 1R1TA 4ZYHA 1PYVA 5FFZA 3F72A 5CVRA 5JR3A 1H8AC 1LE8A 2DDAA 3SXYA 4B44A 3VYSB 2UXNA 5CYVA 3V7CA 4E7IA 1APLC 3EYIA 3BTIA 3K1MA 1X1CA 1ZG3A 1B4AA 2E19A 2DYSH 2VKDA 2QWWA 3F8MA 2UWMA 4JBAA 4ZYEA 1XPXA 1H89C 1JKQC 1MBGA 2XF7A 1RUOA 5B1AH 1SD4A 2XAUA 3WTZA 5J8FA 2CH0A 3KEYA 4BXUA 5LHIA 1MMDA 1TWGJ 5E17F 3ZQGA 2WAEA 3A2KA 3LFKA 3MZYA 2IXSA 5D8LB 3WTUC 2CGPA 1VQKI 3JREA 3DXJF 3HRTA 5HLHA 1X3UA 2EK5A 5TRDA 3H9JA 3DPTA 2COBA 4XKCA 4Y17A 3FHZA 5M5YJ 3GLLA 3BZ6A 4MNUA 2EINH 4HX8A 1MBHA 3P9KA 1VQ9I 2Y0SN 4RB2C 3I4NJ 1FMWA 2FD5A 2VKVA 2ZMEC 3CCLI 1E0EA 4ETSA 4MFEA 1LE8B 2E7WA 4RS8A 4S05A 5DD4A 5DM6F 3JR9A 5LRSA 2FBKA 1YW8A 3OWTA 2NVQJ 1FYMA 5ERIA 3MZHA 1Z21A 4KT6A 2E60A 5E1XA 5DUIA 4HF1A 5EG0A 2WTEA 4HDUA 4IL6C 2DOFA 2VODA 4H4KC 2M7BA 4Z6YA 4Q4ZF 4GCVA 2YU3A 4LITA 2VUMJ 4RGSA 5JHUA 5FJ8J 4Z2YA 1I6XA 3PFIA 2M0CA 5LBQA 4B47A 5CVJA 3WTTC 3ASNH 5HS7A 2M45A 2FRHA 4OINF 2JUGA 5C4JJ 3TOBA 5JVTA 2ESHA 4E6KG 3JRHA 3ESWB 3KPHA 2Q2EA 1P6RA
chains in the Genus database with same CATH topology
1UZCA 2E71A 2KZGA 2DOEA 2K85A 2KISA 2JUCA 2DOFA 2CQNA 2KIQA 4FQGA 2B7EA 2KFDA 2L9VA 2LKSA 2DODA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1UZC A;  2E71 A;  2KZG A;  2DOE A;  2K85 A;  2KIS A;  2JUC A;  2DOF A;  2CQN A;  2KIQ A;  4FQG A;  2B7E A;  2KFD A;  2L9V A;  2LKS A;  2DOD A; 
#chains in the Genus database with same CATH topology
 3KP5 A;  1Z0X A;  4FE7 A;  4L0Y B;  5BPI A;  1Z7U A;  2DI3 A;  5FRO A;  3TMO A;  1W5S A;  2L54 A;  1HCR A;  1D0Z A;  1K83 J;  3FF5 A;  4GYG A;  3UNG C;  1YS7 A;  3W6V A;  1U8B A;  1OCP A;  1DQU A;  5BOX A;  4J00 A;  1HKS A;  2PX9 A;  4MQV A;  4G6T B;  1BI0 A;  4FQG A;  1IXC A;  4CCK A;  2Y69 H;  3TGN A;  5LGT A;  2E36 A;  2R7Z J;  1UG2 A;  2EFN A;  3MWM A;  2MA3 A;  3FKJ A;  3O8H A;  1T98 A;  2PMH A;  5FRN A;  1I27 A;  1YW9 A;  3F8C A;  3OS2 A;  4NDL A;  5L3D A;  4AD9 A;  4Y7N J;  2M8E A;  1K78 B;  3L2C A;  4DQ2 A;  2NS8 A;  5D5U B;  4PJJ A;  2M34 A;  5HLG A;  3CCR I;  1BJZ A;  2IA0 A;  2WC2 A;  3DTK A;  2NAZ A;  2R92 J;  3FXL A;  3DWL E;  2R0Q C;  5IYD J;  5DM7 F;  1RR7 A;  1Z05 A;  4ENJ A;  5KHD A;  1I5Z A;  3DEE A;  1Y8Q B;  3BTJ A;  2Q8K A;  4RDU A;  4AVZ A;  5DCF A;  4FTH A;  2KDO A;  2VBW A;  5E1W A;  1O3T A;  3WOD F;  4EQQ A;  5DEQ A;  3QOD A;  4LK0 F;  5JLW A;  2XVC A;  2CS3 A;  3A01 B;  4WCG A;  1VZ0 A;  2EQR A;  3L2Q A;  5K5O A;  3KE2 A;  2GBY A;  4LB6 B;  2VON A;  3BR5 A;  2VKE A;  1D8K A;  2IA2 A;  3OSF A;  3E3V A;  4RGX A;  3VEP A;  1KU2 A;  4PGG A;  1T8I A;  2R5Z A;  4G7Z F;  2ACJ A;  4HST A;  2XAQ A;  1WJC A;  3PNY A;  3QP6 A;  1LFP A;  2E1O A;  2EBI A;  1X19 A;  1B59 A;  2Y0M A;  5ILS A;  2L4A A;  2ZXJ A;  2F5F A;  4UHT A;  1K4T A;  5FB2 A;  4C2U A;  3BPV A;  4JX5 A;  3ZMD A;  2V7F A;  2DPU A;  4ASN A;  2YS9 A;  4LG0 B;  1XTA A;  2JK3 A;  5JFR A;  3S17 J;  4BL0 B;  1O7L A;  4BQA A;  4RGU A;  1R4N B;  3SHF A;  1LQ1 A;  3I55 I;  3D5L A;  4IRG A;  5AIQ A;  3ZQL A;  3GTK J;  2L7M P;  2DT7 B;  4C30 A;  3JTG A;  3J81 K;  1OIS A;  1EV7 A;  1BJA A;  1FY7 A;  1JGG A;  3M4O J;  2KIS A;  4D0P A;  3LAP A;  2L4M A;  3TDZ C;  4XON A;  1H88 C;  3LSJ A;  1U8R A;  5FGM A;  3DBH B;  3HJE A;  1S3J A;  4Y3O A;  2DXI A;  3E5U A;  3BR6 A;  1UHS A;  2MD0 A;  1XMK A;  1KYW A;  3ELK A;  3CC2 I;  1UJ8 A;  4CCM A;  5KNL A;  4E7L A;  1MNE A;  3HHH A;  3M8E A;  1B8I A;  3BDD A;  1NH3 A;  1CGP A;  4RGR A;  4FIS A;  2DT5 A;  4BJ5 C;  3J81 Z;  3WE3 A;  2F5D A;  3ZMZ A;  3HOT A;  1E2X A;  2P7C B;  4BDY A;  1Z9C A;  2XAG A;  4MHG A;  1ERD A;  1G3S A;  2NXN B;  2BW3 B;  2GXG A;  1MJB A;  4B3X A;  2CQK A;  1J0R A;  2VT2 A;  3L2W A;  2STW A;  3V8K A;  4HF0 A;  3L7W A;  4XRF A;  2VB6 A;  5J47 A;  2M87 A;  3DQV C;  3PM1 A;  1ZR2 A;  2VAS A;  1RKW A;  2J5P A;  2JUC A;  1XSD A;  3I56 I;  3SQN A;  3ZN1 A;  2HXI A;  4D7N A;  3H92 A;  3MKZ A;  4F55 A;  5L3G A;  2L7Z A;  1PP8 F;  3IRR A;  5H6R A;  5E3M A;  4FAS D;  1LDD A;  1BIB A;  2LRD A;  1TLH B;  4A3J J;  1HC8 A;  2FQ4 A;  2OA4 A;  3RI4 A;  2KP6 A;  3L09 A;  2IS4 A;  3SZT A;  2N8G A;  2FF4 A;  3IAM 2;  1YJW I;  1VQ6 I;  2B0L A;  4NC7 A;  2AS5 F;  4UB6 C;  3WTV C;  1FX7 A;  2PN6 A;  1RZ4 A;  1ZRD A;  1EA3 A;  1SAN A;  3IHU A;  1BBY A;  3J80 K;  3G71 I;  5KVR A;  2X0L A;  4KIS A;  3QRF F;  3SZG A;  2MGQ A;  1KQ0 A;  5EGO A;  2E7X A;  5LLQ A;  1PVE A;  3A0H C;  4A12 A;  3ML6 A;  4HNV A;  1TC3 C;  5IY5 H;  2HOA A;  4MEX F;  4XLP F;  2LD5 A;  1UG0 A;  1QZE A;  4A3G J;  2XAF A;  4GYI A;  1ZGW A;  3HB9 A;  1XX5 A;  1MJA A;  1IAW A;  1SFU A;  4RLF A;  4A2U A;  1UEL B;  3NWT A;  2ZSI B;  1KQ9 A;  2CUE A;  1ETV A;  2A3S A;  2K9Q A;  1IRX A;  4II2 A;  4XKW A;  3CC7 I;  2YSR A;  5CPR B;  1B8I B;  1V5F A;  4HA8 A;  1X2N A;  1SFK A;  3CJN A;  5IT3 A;  4CYC A;  3F8F A;  3LSK A;  3DBL B;  2H94 A;  1WKM A;  4HDV A;  3WGH A;  1OFC X;  2BYV E;  3RDI A;  3RPU A;  4BKX A;  1WJD A;  2HS5 A;  1P4X A;  4PZJ A;  2MG4 A;  3Q9S A;  4OMY A;  3OY9 A;  3BOQ A;  2QM3 A;  2X9D A;  2JSC A;  3CD6 I;  1R58 A;  3MMY B;  3RCO A;  3RKW A;  3JTH A;  3EDP A;  4LK1 F;  4AM3 A;  5BMZ A;  2HI3 A;  1SD6 A;  3CP2 A;  2G7U A;  1KA8 A;  2CQ7 A;  2W57 A;  3A4C A;  4BE1 A;  1MMS A;  5C4X J;  3FXU A;  3M1E A;  1ACI A;  3ZQ7 A;  4UY8 I;  1V4R A;  3DKY A;  3P5J A;  2ELJ A;  1YHQ I;  1GLN A;  3KZZ A;  2IS6 A;  2R7W A;  5K7H A;  4I0B A;  5E3L A;  1MBE A;  1TL8 A;  1U5T C;  1KU7 A;  3WTY C;  5K7F A;  4WXC A;  1BW5 A;  3WGI A;  3PFY A;  3ABU A;  4A0Z A;  2EZH A;  2V1N A;  1VI0 A;  1NTC A;  4PSX A;  3W2V A;  4E70 A;  5L3E A;  2OCE A;  2V6C A;  1QHG A;  2D5V A;  1RC9 A;  2D1V A;  2LMD A;  3I59 A;  4I2O A;  2NS0 A;  1BM9 A;  2PEX A;  1P4W A;  1BC7 C;  1MIJ A;  2CV0 A;  2PLY A;  3HG9 A;  2DOA A;  2EH3 A;  3ZOB A;  2ZXH A;  2V26 A;  3FK6 A;  2HQA A;  4M3F A;  4IEJ A;  2DCE A;  5ICG A;  3FBI B;  3OYN A;  1GXQ A;  2BOL A;  3TP3 A;  3K1P A;  2Q1Z B;  1W36 D;  1FOK A;  4MTE A;  3F22 A;  4IQ4 A;  4I99 C;  4EEF G;  2DJN A;  1K4S A;  3F8B A;  2LY9 A;  2NVY J;  2X1D A;  5IOY A;  2EZI A;  1I39 A;  3IP4 B;  3K70 D;  5H2F C;  2AHQ A;  1AWC A;  2IA1 A;  3K69 A;  3LSI A;  1HDD C;  3HRS A;  2X6X A;  2K3P A;  2L9S A;  4EM0 B;  5EF6 A;  2H6C A;  2W24 A;  4PDK A;  4BJT A;  2GAU A;  3B73 A;  1KON A;  1B6A A;  4RAG A;  1KYZ A;  1JHH A;  1UMQ A;  3VOE A;  1T2K A;  3OL4 A;  4AVP A;  4BQO A;  1RRJ A;  4FET A;  1U5T B;  4L9N A;  2F2E A;  3AL0 C;  3FMS A;  2F5E A;  3CQZ J;  3A0B C;  1JT6 A;  1V3F A;  1FIA A;  5D6F A;  1SVO A;  4XR6 A;  2XC7 A;  2DT6 A;  3ZXS A;  3GTM J;  4I7H A;  1QZY A;  1G3W A;  4I02 A;  4OAZ A;  3HOS A;  3C2H A;  3LQQ A;  1TWC J;  4E7K A;  2M3A A;  4OIO F;  2RV8 A;  2OZU A;  1JE8 A;  4BEH A;  2IPQ X;  1XGM A;  2DBB A;  2R7X A;  4FX0 A;  4CA0 A;  4ITV A;  3G6E I;  4ON0 A;  1J75 A;  3G1L A;  5GAG J;  3OYA A;  2CJJ A;  2XRL A;  2W25 A;  2KDZ A;  3F8N A;  3WU2 C;  1R5G A;  2E35 A;  3PO3 J;  5HDK A;  1MDM B;  3V8L A;  3BLY A;  3FX3 A;  1X58 A;  1B72 A;  5K5R A;  2I5U A;  3LA3 A;  2QKL B;  3GBG A;  3IAS 2;  5HNF A;  2X6Y A;  1MH4 A;  3SDG A;  2L9R A;  2HKO A;  3HXL A;  4AID A;  1YLF A;  4WX9 A;  3OYM A;  2BHZ A;  1RES A;  4DGW B;  3BQZ A;  5L3B A;  4CYC B;  1WI9 A;  5FLV A;  2ZJR F;  1UHW A;  2WAF A;  3EUH A;  1R6R A;  2W48 A;  3LNQ A;  3OYD A;  1HDP A;  5B5E C;  2XAS A;  3WTW C;  1IG7 A;  2NRA C;  3MEX A;  1VQM I;  3M7G A;  2C6Y A;  1TWH J;  3T8R A;  4GFB A;  2H6B A;  4MEY F;  4CCJ A;  3RKX A;  4HX7 A;  2CYY A;  1T0F A;  1YYV A;  4JOM A;  2K9N A;  2FQ3 A;  4QIW N;  2UV1 A;  3IRQ A;  3AFH A;  3I64 A;  3HBL A;  5JHF A;  3BR1 A;  1LEB A;  6PAX A;  3VB2 A;  4XSX F;  1E17 A;  1PUE E;  1IN6 A;  3ABK H;  4MGR A;  2ZFU A;  3VSL A;  3S1N J;  1FEX A;  1ZAR A;  4A3D J;  3ECH A;  5CJ9 A;  3HL2 A;  3RYP A;  1XG1 A;  1H9T A;  2KJB A;  2XDV A;  1Y8R B;  1FBS A;  3M1C A;  2F4M B;  1GDT A;  3F6V A;  4G94 A;  4YFX F;  2R7Q A;  2Y31 A;  1IDZ A;  2IGK A;  1YIO A;  2QCO A;  4CCO A;  1L0O C;  4XOR A;  5DUK A;  4M6V A;  3EUK L;  3DTE A;  2DU9 A;  5HVQ C;  2VQC A;  2K7L A;  4BU2 A;  4LIV A;  1R00 A;  3R4K A;  4YRV A;  5FLX K;  2ZXW H;  4KNY A;  2GIV A;  1TQI A;  1WFX A;  1VQ7 I;  1IRZ A;  3CCJ I;  4L9J A;  3UKG A;  2DYR H;  2HGC A;  3FXO A;  3FIW A;  1O3R A;  3S2D J;  4IKF A;  4A3F J;  1IUF A;  2R7R A;  2ZSH B;  2R5Z B;  2HFH A;  2QQ9 A;  2CQN A;  4ABZ A;  3MZ8 A;  4HNT A;  2M0M A;  3MQ0 A;  3RZD J;  3DU6 A;  5FLX Z;  2VOO A;  4IXA A;  4A3E J;  2HQR A;  2R5Y B;  1DPU A;  4JQF A;  2FML A;  2V1D A;  3GTG J;  1BR1 A;  2CQQ A;  2MC4 A;  2I10 A;  3RJP A;  2D45 A;  4L9V A;  2KJC A;  5FLM J;  3E5Q A;  5FD6 A;  3MKY B;  1YX3 A;  2R7S A;  1LKX A;  5FKL A;  2E1N A;  2EFQ A;  4F92 B;  4ZYG A;  2HTS A;  3RYR A;  5LFA A;  2VN2 A;  2KRH A;  5D5W B;  1K78 A;  3VYU B;  4M9Z A;  5BNG A;  4IPA A;  1FBQ A;  1B9N A;  4AIH A;  5BQT A;  2E2H J;  5HNH A;  3OOU A;  1OJL A;  2PI0 A;  3RPU D;  3FDY A;  5AON A;  4N4N B;  4R79 A;  1Z91 A;  3I59 B;  1PUF B;  2DFE A;  2XGD A;  2QF7 A;  4XRM A;  1LVA A;  4V2F A;  1ZKG A;  1FP2 A;  1YOV B;  2K5C A;  4N9H A;  4WXH A;  3V42 A;  4F52 A;  5J1Y A;  5IP6 A;  2UXX A;  2P81 A;  4XQF A;  3RIR A;  3KZY A;  1A35 A;  2Q0O A;  4L0Z B;  1IV8 A;  4M3G A;  1R23 A;  2XGX A;  4RB0 A;  1QA6 A;  1RIO H;  4EJU A;  3CO7 C;  3LAJ A;  1U3E M;  3H5N A;  2PMZ N;  2ISY A;  1Y1W J;  4HNU A;  4OAY A;  3COA C;  2BE5 F;  2GOX B;  3JCU C;  4AIJ A;  4Q5S F;  1HA8 A;  1PJR A;  2NOG A;  2ZC2 A;  3TKY A;  2R7F A;  3OL3 A;  1O57 A;  1Y0N A;  2HEO A;  1T95 A;  1F9N A;  2K4J A;  4HF2 A;  4HQM A;  4YFN F;  5EG0 B;  1WSU A;  2HPM A;  1MW7 A;  2K85 A;  5IP7 J;  4A93 J;  1AKH A;  5EDN A;  4BQN A;  2BBY A;  2O3F A;  4IRH A;  3HRM A;  2LDU A;  4N9I A;  5E8I A;  2NYX A;  3G1M A;  1HW2 A;  3I71 A;  3VDX A;  1P92 A;  2JWT A;  1L3L A;  2LG4 A;  3CJQ B;  2YUS A;  5LHH A;  1A6I A;  3WU1 B;  4XN0 A;  5F1J A;  1CF7 A;  3I4P A;  4I6Z A;  5EGO B;  2QEX I;  1ETK A;  3GWZ A;  4ZH4 F;  2XGE A;  3BC8 A;  1D1C A;  2MLK A;  4N4O B;  3OYC A;  1OMI A;  2DFF A;  1XSX A;  2A69 F;  2EZL A;  3L2U A;  3E6D A;  1WJF A;  2L9V A;  4JX6 A;  2IT0 A;  4B43 A;  1IO2 A;  3JRB A;  4Y4R A;  4OIQ F;  3EQL F;  1ZLK A;  1S8N A;  1S72 I;  3GX4 X;  2TDX A;  2WB1 N;  5L3F A;  1U2W A;  3ONQ A;  4C2M J;  3H5R A;  2OPT A;  1VQP I;  3S15 J;  4GGG A;  2KZV A;  4P1W A;  2ME6 A;  4UUV A;  2OC6 A;  1W7P A;  2K3F A;  1HQC A;  1TW3 A;  4BHB A;  3TDU C;  1VQ8 I;  2QQ8 A;  4HRI A;  3K0L A;  3HUG A;  3CUQ B;  3DBR B;  1YRN B;  2MW8 A;  3UR3 C;  1DP7 P;  4IHX A;  4IRI A;  1ZN2 A;  1GVD A;  3KP3 A;  2V1X A;  3Q5F A;  2V9V A;  4EJO A;  4CYD A;  2BY2 A;  5E8G A;  2DDB A;  3I58 A;  4LFU A;  1HOM A;  1BR2 A;  5DV5 A;  1YRN A;  1UHM A;  2CG4 A;  1W0U A;  2GA1 A;  2A61 A;  5FD5 A;  1OCT C;  3G2B A;  2DQR A;  5FRM A;  3OMY A;  2ME0 A;  5EZH A;  2L3D A;  1HKT A;  1BIA A;  4C2T A;  1GV5 A;  5GAE J;  5D4S A;  4NC8 A;  3HGY A;  3JRG A;  3CCS I;  3SJM A;  1F43 A;  2P5V A;  2QKM B;  3KIO A;  3G1O A;  2L7K A;  1OYY A;  2E71 A;  2FBI A;  4Y13 A;  3CLQ A;  3FZV A;  3H0G J;  4ZYA A;  1VF9 A;  3LSP A;  1YG2 A;  4HYE A;  3B6A A;  1J09 A;  5CQG A;  1POG A;  2KPM A;  3G3Z A;  3IKV A;  1VFC A;  4HLX A;  4M6X A;  2ELK A;  3LSG A;  1IXS B;  2ZJP F;  1SFO J;  3C1D A;  5L3C A;  1EJ9 A;  3CMA I;  3HHG A;  1HBX G;  4P9F A;  3PNT A;  1X2M A;  1V54 H;  2L5Q A;  1IGN A;  1QBJ A;  4AC0 A;  2ZB9 A;  1BC8 C;  4Y52 J;  1S5L C;  4ZDO A;  3KP7 A;  1ZG5 A;  2LBF A;  1W1W E;  1UFM A;  2VQH A;  4S0H B;  3WTS C;  4NQW A;  1G4D A;  3GTP J;  1OCR H;  1AKH B;  2CW7 A;  4RBO A;  4U88 A;  4MQ9 F;  4B3A A;  2DJI A;  4XL9 A;  5F64 A;  4HEA 2;  3RZO J;  3K7A J;  3PUB A;  4YII A;  1QGP A;  1ZK8 A;  3BT9 A;  5E20 A;  4LMY A;  2QQA A;  1MNM C;  2W82 A;  1HST A;  1IUY A;  4HQE A;  1X3Z B;  3BR2 A;  1H0M A;  3K2A A;  3TO9 A;  3U1D A;  3CF2 A;  3GFM A;  1T39 A;  1IZ1 A;  4IHS A;  3TED A;  3KYC B;  4KIB A;  4Q47 A;  3A03 A;  4HZF A;  1YI2 I;  4C9Y A;  5HDN A;  3CCM I;  2KFD A;  2JPC A;  2QEN A;  1K79 A;  1PDN C;  1DU0 A;  1TNS A;  4UB8 C;  1G59 A;  3GLX A;  1GVJ A;  3KYL A;  1WQ2 A;  1JT0 A;  2QSG X;  5E18 F;  4CCL A;  3C18 A;  2VJ4 A;  3H3V K;  1K7A A;  4V19 K;  2F4O B;  1IN4 A;  3BG5 A;  3FXM A;  4JX4 A;  4OIR F;  1VQL I;  4OIP F;  4IOA F;  5LHG A;  3H9Q A;  5J1R A;  2DAO A;  2CWE A;  1OYI A;  2HNH A;  2Z16 A;  4G9Y A;  4PSW A;  2GA2 A;  5JI6 A;  1R49 A;  2R3S A;  1ETX A;  5TIS C;  3TL4 X;  3OOP A;  4B1R A;  3BTC A;  1D5V A;  2MSY A;  2Z5U A;  2FE3 A;  5F0C A;  4WWC A;  4ESJ A;  5FKK A;  1U9O A;  4XRS G;  4P9U A;  3DPU A;  2XRO A;  2UZK A;  1XCB A;  3I54 A;  1SD5 A;  2H8R A;  4ENK A;  2EA4 A;  1J9I A;  4L5I A;  3R60 A;  4IO9 F;  4BGD A;  3BWG A;  4BDZ A;  4QPQ A;  2GXA A;  2PQ8 A;  4RMN A;  3E6B A;  4KDP A;  3SZP A;  1SVL A;  2DN0 A;  4PFP A;  2HVS A;  3FK7 A;  2VC0 A;  1B9M A;  4ZJZ A;  1ZQ3 P;  1RNL A;  4V2G A;  2E5N A;  3I3L A;  4LGW A;  2DOE A;  3GTQ J;  2EJR A;  2R7D A;  1W7P D;  3B6C A;  2LC2 A;  1AHD P;  3GTL J;  3HSR A;  5EEH A;  1JKR C;  2MD5 A;  2GXB A;  1R1V A;  4CO8 A;  2Z3Y A;  1P7I A;  1TBX A;  1C0W A;  1T0F C;  2FBH A;  4XLC A;  3ZMS A;  4IZZ A;  2WAD A;  5KCM A;  3VFZ A;  1P4A A;  3WGG A;  1LNW A;  1JUM A;  2HR3 A;  5GPC A;  3N05 A;  1BR4 A;  2XPU A;  4CUG A;  4PGH A;  2RQP A;  2MH2 A;  2YX4 A;  4U7D A;  3ZMT A;  2B63 J;  1ZLJ A;  2HZD A;  1BW6 A;  3ZN0 A;  1U6G A;  1TQM A;  2LFB A;  3QPT A;  4OMZ A;  2MC3 A;  2PFB A;  3EUH C;  1OR7 A;  1W5T A;  3GTJ J;  3W6K B;  2P8T A;  2KIU A;  1SC7 A;  1KQ8 A;  3DEW A;  4LOC A;  3ZQC A;  1IN5 A;  1OCO H;  1ZR4 A;  2A5W A;  4PCQ A;  1LDJ A;  1OLT A;  2KRF A;  2R7T A;  4C3H J;  1XMX A;  1BOB A;  1ETO A;  2RDP A;  2FNA A;  1XGO A;  4XID A;  3AL0 B;  3ZQQ A;  3CC4 I;  5E79 C;  2Y2Z A;  3KZI C;  3IKT A;  3T0Y A;  1AOY A;  4A3B J;  4YIF A;  2QUF A;  1WVR A;  3ECO A;  1IW7 F;  2HU9 A;  3BP8 A;  2LKP A;  4KJZ A;  1FSH A;  4UNO A;  4IHT A;  1K6O A;  2PJR A;  2KIM A;  3CMM A;  3W6J B;  2G9W A;  2EFP A;  2B7E A;  4DYR A;  5KAF C;  3KP4 A;  5KAI C;  4EMS A;  3Q0V A;  1YFH A;  2JTV A;  3CUQ C;  2IVM A;  4DZP A;  1DGW Y;  5J1U A;  2IGO A;  3K4N A;  1HF0 A;  2ZKZ A;  4D5C A;  4B4C A;  1ENH A;  3BR3 A;  1IXR C;  4G12 A;  3WG7 H;  1O3Q A;  1J59 A;  1YS6 A;  1LUJ B;  4E4H A;  3MKW B;  3G73 A;  2VI6 A;  2H09 A;  3SFI A;  1NK3 P;  2DMP A;  2GOM A;  2TRT A;  4DBR A;  1JI8 A;  1XSV A;  3A02 A;  1IRF A;  3M07 A;  3GXO A;  3P7N A;  2DFI A;  1T33 A;  1PP7 U;  5GTH C;  3FKI J;  2VQG A;  2LH9 A;  5E3O A;  5D4R A;  2QSH X;  2VE9 A;  2QYO A;  5LD2 C;  2E1C A;  2FEZ A;  3ZP5 A;  4BJ6 C;  3P9I A;  1BI3 A;  1TWF J;  2NVU B;  2NNN A;  2F5V A;  3GVA A;  3Q0W A;  1W0T A;  1ULY A;  3LWF A;  4F7Z A;  5J4V A;  2RVC A;  5DS9 A;  1FYL A;  2OCC H;  4I76 A;  4BHC A;  3BJA A;  4JP0 A;  4ZYD A;  5GPA A;  1NK2 P;  1W36 C;  2GLO A;  3FM5 A;  4MLO A;  3TBI A;  3WHC A;  1BI2 A;  2DK5 A;  2FSW A;  3BRO A;  2XPV A;  4KT5 C;  5LEJ A;  1G3T A;  2IAI A;  2OF7 A;  1MKM A;  5GAD J;  3JRD A;  2X51 A;  2H8W A;  3K70 C;  3LST A;  1LVK A;  1E3O C;  1HSJ A;  1QRY A;  3BG9 A;  3TW7 A;  2M4G A;  4UVC A;  3PO2 J;  1IV6 A;  2DTR A;  2BXY A;  1D0Y A;  4JYK A;  1ZHF A;  1MH3 A;  5GAH J;  2F5C A;  2QA4 I;  2WY7 Q;  1X1A A;  1RET A;  2L02 A;  2ZO4 A;  2Z2S B;  3HZJ A;  1VQN I;  1U5T A;  4IVN A;  2O5R A;  3LL7 A;  1SAX A;  1ON2 A;  2KHM A;  2BY1 A;  2XB0 X;  4BBR J;  2VC1 A;  4P55 A;  1N75 A;  2XIG A;  1BA5 A;  3L1P A;  2GQQ A;  2HDC A;  3E7L A;  3IH4 A;  4FT8 A;  3ZCO A;  2DW4 A;  1RPW A;  1MBK A;  4XM3 A;  4ZZL A;  4KUM A;  1TP4 A;  4M3D A;  4E7J A;  4WK8 F;  1V5G A;  2CFX A;  3QYE A;  4L5J A;  1HW1 A;  2FXA A;  1CQT A;  2F48 A;  3PJR A;  1A31 A;  1R7J A;  2EB7 A;  4EV0 A;  1MMN A;  5K7Z A;  4M9X A;  5FKO A;  3FIS A;  2JA2 A;  2DA6 A;  2OU2 A;  4J19 A;  5ICC A;  2YU9 J;  5CVI A;  5DD8 A;  4M9S A;  4M3B A;  2EIJ H;  1X4P A;  4TV7 A;  3DP7 A;  1REP C;  4A3C J;  3WG9 A;  3HOV J;  3QPL A;  3HOX J;  3AG3 H;  1Y1V J;  3BTL A;  1IDY A;  1LDK B;  1FLI A;  1ZYR F;  3OSG A;  3HYI A;  2W4S A;  2LY2 A;  2VE8 A;  3GFL A;  3V8J A;  2Y0S A;  5KK1 A;  2HZT A;  3NAR A;  2LYC A;  4LG0 A;  1S6L A;  1E3H A;  4BQQ A;  2RNG A;  4HLY A;  1S7A A;  4XIC A;  1D8J A;  4LJZ F;  3OYG A;  3JRC A;  2P6T A;  3O8G A;  2RNJ A;  3ROU A;  2H27 A;  5IPA A;  1S7E A;  3K4K A;  2E2I J;  3SEZ A;  1USS A;  2V1U A;  4ZTF A;  1Y39 A;  2QLZ A;  3PIO F;  3D5S C;  5M5W J;  3S3M A;  4A3K J;  4XN3 A;  3S2H J;  2IS2 A;  3KET A;  1BL0 A;  2P6S A;  1YE9 A;  3A1Y A;  2HOS A;  2JJ7 A;  3WU0 A;  2XF5 A;  1Z3Y A;  2M4K A;  3IV5 A;  3OS1 A;  2V9P A;  5M5X J;  1YTY A;  2XHK A;  3J80 Z;  1RI7 A;  4G6D A;  2RRE A;  4KIF A;  2LOO A;  2Y75 A;  4X1E A;  2VXZ A;  4DW6 A;  3HDD A;  1R1U A;  1OYW A;  3KEO A;  2ICW G;  3C2G A;  1BOA A;  3ULQ B;  2HOE A;  5HDG A;  2STT A;  1MDM A;  1D1B A;  2AQF A;  3KEQ A;  2A6T A;  2XAH A;  3FXJ A;  2LF8 A;  3D0S A;  3CCQ I;  1JGS A;  3DU5 A;  3OR2 C;  5TJJ A;  1Y56 A;  2L9N A;  2BV6 A;  5LEK A;  3DV8 A;  1R4M B;  2JMW A;  2LF7 A;  4XMY A;  4UVA A;  1SMT A;  4UUS B;  2AQE A;  1F5T A;  2LK2 A;  1QVU A;  4C3J J;  1FTZ A;  3L2R A;  2O0Y A;  1MSE C;  4DZJ A;  1SMY F;  1VND A;  3IUO A;  2CUZ A;  2VOP A;  3BCB A;  3DCF A;  2EFO A;  2B9S A;  4M72 A;  4L5E A;  3HC7 A;  2L2O A;  3OR1 C;  2HOT A;  3TOA A;  2DFH A;  5HLI A;  4CZC A;  2BXZ A;  3HOW J;  1RR8 C;  2RN7 A;  3E97 A;  2WAQ N;  1KZH A;  2OZ6 A;  4NQW B;  4BUP A;  3J7A O;  1X1D A;  3JSO A;  3GF2 A;  3T1B A;  5ED4 A;  1N77 A;  2O6G E;  3ABL H;  3FXQ A;  3SYT A;  4BXF A;  4PJN A;  3QYF A;  2AO9 A;  3F0C A;  2OTL I;  1S29 A;  3GW2 A;  2LR8 A;  2ID6 A;  2A05 A;  3OIP A;  2COM A;  4I01 A;  5LGU A;  2OQG A;  4M71 A;  3W3C A;  2P5K A;  2PMU A;  2MFZ A;  4NC6 A;  1IC8 A;  4GDF A;  4B09 A;  5K1Y A;  4XKB A;  2PJR B;  2K4B A;  2ZBK A;  4IX7 A;  4E7H A;  4NNJ A;  3L2V A;  1Z7L A;  2BGC A;  4A0Y A;  2QBY B;  1X4O A;  2J5O A;  2FOK A;  4U0W A;  2ECB A;  3S93 A;  3OYI A;  2IBD A;  5D6E A;  3HPG A;  1U0J A;  4UV9 A;  3RPQ A;  4CXF A;  3GZ5 A;  2Y30 A;  4KYW A;  4RAY A;  4CZZ A;  1FPQ A;  2EZK A;  2V4J C;  2A6E F;  1F4K A;  2O03 A;  4IHW A;  2A5Y B;  2DQL A;  2LRE A;  3KLN A;  2OJE D;  1FOX A;  2QBY A;  2WBM A;  2W84 A;  1ETY A;  4HSR A;  1EF4 A;  1W5C C;  4D9J A;  2EV6 A;  4OWR B;  3DF8 A;  1BN5 A;  3VSK A;  3CCV I;  4XRS A;  2O8K A;  1K6Y A;  3P9C A;  3BG3 A;  1WJE A;  2P5L C;  2ZJ2 A;  3MFK A;  3K4C A;  1WH5 A;  3QU6 A;  3CUQ A;  4C3I J;  2P0W A;  1ITY A;  3HPH A;  2HDD A;  3K4J A;  4ESF A;  4ZTJ A;  2FU4 A;  3K4B A;  3MAJ A;  3O3K A;  2F6C A;  2VPR A;  3HOY J;  5A2Q K;  3GFI A;  5IYC J;  1J7K A;  1ZG1 A;  3E6C C;  2XB5 A;  1UAA A;  4D5F A;  3T5X A;  2XGC A;  3REO A;  3L9F A;  4HV5 A;  1WZ2 A;  1E3P A;  1SFE A;  3ISP A;  2OAZ A;  5F0H A;  1QPI A;  3S2W A;  4YG2 F;  5D5V B;  1MBJ A;  2ADU A;  2IW5 A;  4XLE A;  2DA5 A;  1FNN A;  1TZL A;  3VYR B;  1TWA J;  4U7B A;  1OCZ H;  3GYH X;  2W1O A;  1P2F A;  1OR7 C;  3AAF A;  5A2Q Z;  3JSP A;  4R8H A;  4MTD A;  2PJP A;  1X1P A;  2FMY A;  4DBQ A;  2HDW A;  3OYH A;  3BZK A;  3C2B A;  1LJ9 A;  1G3Y A;  3CF5 F;  4XBF A;  3FM3 A;  5EYR A;  2HVQ A;  1WPK A;  4M3E A;  2GM4 A;  3LQR A;  2OV7 A;  1ZEL A;  3HGG A;  5H6Q A;  1EH7 A;  2VBZ A;  4ENM A;  1GT0 C;  1FTT A;  2A07 F;  1XB4 A;  4BS9 A;  2XSD C;  2HYF A;  1XN7 A;  1Q1H A;  1ONV A;  1R22 A;  4IF4 A;  2NVT J;  2BY0 A;  4QPO A;  2HPI A;  2M7A A;  4DYQ A;  3HTS B;  3F23 A;  1EH8 A;  2LNB A;  5FKN A;  1ODD A;  2NS7 A;  4NB5 A;  3K9T A;  3I53 A;  3O6B B;  2JA6 J;  2JSP A;  2OQR A;  5B3S H;  3S32 A;  2JVG A;  2I8D A;  2OBP A;  3TO6 A;  3M8J A;  5CQE A;  4YEL A;  2CUJ A;  2OUM A;  5J6X A;  2KL4 A;  4S04 A;  5EJC A;  2IRF G;  2HQ5 A;  2W00 A;  1JKO C;  4BXX J;  4R1H A;  4W1U A;  3OYB A;  1UST A;  4O3M A;  4CSW A;  3HKZ A;  1MJ9 A;  1U9N A;  3H5A A;  2V6E A;  4BE0 A;  4UUT A;  2DTZ A;  2QZ8 A;  3BG7 A;  3W2W A;  4BYY A;  2H1L A;  3C3W A;  2JRT A;  2BW3 A;  2M9H A;  4CHU A;  3AG4 H;  2ZXI A;  2LBF B;  1I3Q J;  3F21 A;  1QVT A;  1Y0U A;  1R5H A;  2E5Z A;  3DLA A;  5K5Q A;  3CDI A;  4BNC A;  1WJA A;  4BH9 A;  1A04 A;  4PUS A;  3FHN A;  5C44 J;  3CMY A;  2FOW A;  2NOJ B;  1RUN A;  3S1M J;  2O7O A;  2Q2E B;  4MO7 A;  3FMQ A;  1GV2 A;  3PQK A;  4KMU X;  4LLL A;  2EV5 A;  3HTU A;  2WV0 A;  5F0F A;  1FJL A;  3W2A A;  4LIU A;  1LFU P;  1FT9 A;  1ZAO A;  2PG4 A;  1SFX A;  2LY1 A;  3E6M A;  3U1K A;  3RKQ A;  2Z9O A;  1N78 A;  4BHP A;  2Y9Y A;  1TQP A;  2GZW A;  3Q3S A;  5HS9 A;  3CLO A;  1XD7 A;  1Z3X A;  4XNF A;  2EIK H;  3GCM A;  2M2E A;  1HLV A;  3K6G A;  3JAM Z;  3BJ6 A;  1JUP A;  3OIO A;  3BJO A;  3VWB A;  1FYK A;  4A69 C;  1F1Z A;  1FMV A;  2CQX A;  3GEZ A;  2KT0 A;  3LFU A;  4AU7 A;  3OYF A;  4BE2 A;  3SEQ A;  4A3L J;  2DMU A;  3N97 A;  3M8F A;  5F08 A;  5GTI C;  3OYJ A;  1OCC H;  2YX7 A;  3CCE I;  2ISZ A;  2M8G X;  3GME A;  3CTA A;  2ELH A;  1DPR A;  1XMA A;  3E0J B;  4Y33 A;  1Z67 A;  2ZJQ F;  5F04 A;  3U9G A;  3G4S I;  3JAM K;  3KFW X;  1NG7 A;  4EVI A;  3H9G A;  2LSO A;  1DP3 A;  2Z33 A;  3HUG B;  5DDG A;  1MSF C;  2WV1 A;  2MYS A;  2O8X A;  1WWX A;  2EIL H;  1VQO I;  3S16 J;  2ZME A;  3LOC A;  2FNP A;  2O9L A;  1J2X A;  2FUG 2;  4UV8 A;  3QWL A;  1I1S A;  1Z6R A;  2X48 A;  3EUA A;  2CV1 A;  4GXO A;  4QSH A;  2RQQ A;  2ESN A;  2VIX A;  2EPF A;  2W85 A;  4L9T A;  2M5W A;  1JTY A;  1S9H A;  3BY6 A;  4WXD A;  4GO1 A;  3J7Z I;  4A6E A;  3E1S A;  4Y15 A;  2CFO A;  2R93 J;  2R7V A;  3QQA A;  3R6S A;  5JVG F;  3RSN A;  1ZGA A;  4IHV A;  3R0J A;  3V4G A;  3CZ6 A;  2L0K A;  2FJ1 A;  2Z99 A;  4ANJ A;  1T56 A;  1ZRF A;  1YO5 C;  1F36 A;  1TT5 B;  1TTY A;  4PJL A;  3S1R J;  1A36 A;  3ZMV A;  2HWV A;  3LSM A;  3HEF A;  3IL2 A;  3WTX C;  2BY3 A;  4NBQ A;  4QLC U;  1XCV A;  3MN2 A;  4U0V A;  1AU7 A;  2DLL A;  2E1M B;  3HSE A;  5J4Y A;  4KIC A;  5IT9 K;  4XOT A;  1HW5 A;  2GWR A;  1ZRE A;  1V55 H;  5M3M J;  1FZP B;  2RKH A;  2VJJ A;  2KRC A;  4U87 A;  3N4M A;  2M30 A;  4EJV A;  4UXN A;  3PUF A;  2MBF A;  1NHA A;  1QZZ A;  1LB2 A;  3QOE A;  3ERE D;  4LG3 A;  2JA7 J;  2YPR A;  3ABT A;  4RB1 A;  3ZMU A;  1EH6 A;  1RKT A;  4E7Z A;  2JA8 J;  3EPZ A;  4EM2 A;  3F3X A;  1WH7 A;  3SFZ A;  4XOP A;  2G0E A;  1TNT A;  2WA0 A;  3PIP F;  2R7U A;  3ERM A;  5IT9 Z;  4XLA A;  3CES A;  2RC4 A;  3OYK A;  4KN4 X;  1X1B A;  3OS0 A;  1M1E B;  4RA2 A;  3MD2 A;  1NG6 A;  2CRG A;  3QP5 A;  1YQA A;  3HM5 A;  2DOD A;  2OTJ I;  3MCZ A;  2DMQ A;  1H9G A;  2JA5 J;  5BPD A;  2VJI A;  2VXD A;  1YX5 A;  5IYB J;  3H0D A;  1D1A A;  2V9K A;  1T6S A;  1S7O A;  3RQ4 A;  2JT1 A;  3CDL A;  2XKP A;  2XSJ C;  1QPM A;  4I98 B;  4CIC A;  2HKX A;  1YW7 A;  1PUF A;  1P9Q C;  3F6O A;  3BPX A;  2VKH A;  1MD0 A;  2DMT A;  4XLH A;  5F1R A;  4UUS A;  2A68 F;  2VBY A;  1Y6I A;  1DDN A;  2EFW A;  1IJW C;  3SDB A;  2P4W A;  1A6Q A;  4CGZ A;  4J01 A;  3H3U A;  2VBX A;  3I0T A;  3H1C A;  4KIG A;  2K40 A;  3IH3 A;  4CH7 A;  3TP0 A;  2LKX A;  4XSZ F;  1DU6 A;  3K2Z A;  1FIP A;  1FBU A;  1EKE A;  2GIZ A;  2R5Y A;  3VOD A;  4IQJ A;  5ILU A;  2K27 A;  3IWF A;  3KCC A;  1BI1 A;  3CDH A;  1WHU A;  3FXK A;  2XF6 A;  4NUB A;  2MAB A;  3U2R A;  1MND A;  2ZFW A;  4CDG A;  2BZT A;  2ZNY A;  5AIP A;  4GRI A;  4HOB A;  2BVL A;  2JVH A;  4M6Y A;  4HAM A;  3CUO A;  4EJW A;  1O7F A;  3V7R A;  4KFC A;  1D0X A;  2IGM A;  3BCA A;  2K9L A;  3BR0 A;  5E1Z B;  1QO0 D;  1UCR A;  3D5R C;  1J5Y A;  3L00 A;  3DFG A;  4A5M A;  2EIM H;  3WE2 A;  1YIJ I;  2DA7 A;  2A6H F;  3PSF A;  5BS6 A;  2WY8 Q;  1T08 B;  5DCM A;  4D1Q A;  5LGN A;  5B66 C;  3TQN A;  4ZDL A;  4JK1 X;  1JHF A;  2KZG A;  2UUZ A;  3O2P E;  3ZPL A;  3ZR8 X;  3RQI A;  2KKO A;  1ORK A;  1GUU A;  1I3A A;  1DGR M;  4PJM A;  5FFX A;  2Y48 A;  1YIT I;  4P96 A;  1I1G A;  3IH2 A;  2CW8 A;  4EGZ A;  3RKY A;  2RGV A;  4DJA A;  5FO5 A;  1W7P B;  3J7A Y;  3GUD A;  4HPQ A;  4F91 B;  3GZ6 A;  4A5N A;  1UB9 A;  4NHJ A;  3BQY A;  1WJB A;  2HYG D;  4DIQ A;  2WB1 A;  1OQY A;  2FX0 A;  2LP0 A;  4A6D A;  3I4M J;  3S1Q J;  2BVM A;  3DKW A;  1W4M A;  1VQ5 I;  3KP6 A;  2NVX J;  1I50 J;  1R36 A;  2JZY A;  4I0A A;  3CJT B;  1MBF A;  2DK8 A;  3Q0U A;  3EYY A;  3QPS A;  2XKO A;  3IC7 A;  5IP9 J;  1B1B A;  5FKM A;  4PFO A;  2DPD A;  4L18 B;  1CF7 B;  2DA1 A;  3QU3 A;  1FP1 D;  4DOZ A;  2XPW A;  1SVM A;  4RAF A;  1GXP A;  2K86 A;  2PBI A;  2X4H A;  4OOI A;  4E7S A;  1JKP C;  3MKL A;  3OYE A;  2CU7 A;  3NAU A;  1WRJ A;  3HOU J;  1QHH D;  1ZGJ A;  3PNV A;  4RM2 A;  4KIT B;  3D1N I;  2NNY A;  1Q1V A;  1VQ4 I;  1T38 A;  4AYB N;  5EZG A;  3NRV A;  4F93 B;  4KMF A;  2HTJ A;  4RM3 A;  4U0Y A;  4A3M J;  1DUX C;  5M3F J;  3NEU A;  2DMN A;  2V79 A;  4P5O A;  3X2Q H;  4AIK A;  3RTR A;  4X6A J;  1FOY A;  2VLA A;  3WHB A;  2LVS A;  3GO5 A;  4WF2 A;  2D2W A;  3S8P A;  4BAC A;  2Y9Z A;  1FOW A;  2R4G A;  1MMG A;  4IJA A;  3ZQH A;  5D8K B;  3QPH A;  5F27 A;  2QSF X;  4YFK F;  2ETH A;  2XAJ A;  3JRI A;  2DO7 A;  4O5V A;  4B8X A;  3JW4 A;  1KGS A;  4A3I J;  2RAE A;  4G7H F;  3KP2 A;  3TW6 A;  3S3O A;  5HOO A;  3ZQF A;  1U78 A;  4QWQ A;  1SAU A;  4LLG F;  4XLF A;  1O4X A;  2VJ5 A;  1O3S A;  1XGN A;  2CMP A;  4II3 A;  1R5I D;  1ETQ A;  2BHY A;  4DYC A;  4BBS J;  2IGN A;  5DCM B;  2E2J J;  1VTN C;  3LA2 A;  1WI3 A;  4HBL A;  4LB5 A;  4FE4 A;  3DTI A;  2E1M C;  1G6N A;  3B02 A;  4OU0 A;  2F4I A;  3JRA A;  4XK4 A;  1OKR A;  1JJ6 C;  2CUF A;  2JN6 A;  1QNT A;  2EWN A;  4PK4 A;  3DEU A;  3VYT B;  3AG1 H;  4M73 A;  2LLK A;  4QTR A;  1JUS A;  1YJN I;  2CSO A;  4RAZ A;  1QQI A;  3EET A;  2X6O A;  3KLO A;  5LRR A;  4B48 A;  2KLO A;  3M3Y J;  4MFD A;  3CJR B;  3A01 A;  2EV0 A;  2KIF A;  2ZME B;  3ZRG A;  4G8X A;  2CW0 F;  2VL8 A;  4BY7 J;  1P7J A;  1Z6T A;  3HOZ J;  2Z1D A;  1MMA A;  2IJL A;  2KQR A;  4A0X A;  2K02 A;  2TCT A;  5C3E J;  3Q9V A;  2LTP A;  4AYB A;  1AA7 A;  5EEA A;  4IOC F;  1D3Y A;  4G7O F;  2W7N A;  5CVV A;  2OD5 A;  3PSI A;  1ON1 A;  2H1K A;  2X1C A;  3I5U A;  3K4M A;  1FWZ A;  3DLL F;  2ZCW A;  2HQN A;  3QAH A;  4D7M A;  2G7H A;  1HKQ A;  3GTO J;  4EM1 A;  2ECC A;  5HOD A;  3QYB A;  1A5J A;  5B1B H;  1XDU A;  1WGX A;  2IP2 A;  2QQB A;  3ABM H;  5DYM A;  5IOZ A;  4UVB A;  2WAQ A;  1IRG A;  3DPL C;  3DKX A;  2O61 A;  1JXS A;  3CO6 C;  4ZZD A;  3TO7 A;  2L01 A;  2EA2 A;  1Z77 A;  4LLN A;  2P7V B;  3H35 A;  2CV2 A;  5F6F A;  3I9V 2;  3ASO H;  2AXL A;  3MVP A;  2XV4 S;  1XC5 A;  2LKS A;  5ILV A;  2XRN A;  4HG2 A;  3FXR A;  3BZC A;  4AUX A;  1R9T J;  1XDS A;  2YR2 A;  2FA5 A;  5HS8 A;  2L7F P;  5H20 A;  3PL8 A;  3R61 A;  5TGT A;  2M1B A;  2KMU A;  3ZGK A;  2R7O A;  1FC3 A;  1SD7 A;  3KYD B;  4MIM A;  3PQJ A;  4EJT A;  3S3N A;  5ICF A;  3M9A A;  1V5E A;  1XGS A;  3FBN B;  5J40 A;  3E5X A;  4CCN A;  2JPB A;  2BEO A;  2X1E A;  4IHY A;  2DA4 A;  4YEJ A;  2PMZ A;  1STZ A;  3QOP A;  4ZDP A;  3FWE A;  2VT3 A;  4BAY A;  1LFB A;  4FHT A;  4LD5 A;  4HX4 A;  5J3L A;  3HIF A;  1K61 A;  2VPL A;  1WJ5 A;  1TT0 A;  3C7J A;  5D5X B;  4M74 A;  4EAT A;  2IS1 A;  4N0B A;  5CLS A;  1QU3 A;  9ANT A;  2QGU A;  3GZN B;  1Z1D A;  1YJ9 I;  4HV6 A;  1G2H A;  2MLG A;  2KIQ A;  3LA7 A;  3AKZ A;  1OPC A;  3ZQI A;  3NQO A;  3K1N A;  2JQ7 A;  3T8T A;  4YIR X;  2ZNZ A;  2HYJ A;  1FSE A;  2X85 A;  1ZRC A;  1N25 A;  4ESB A;  2DA2 A;  2MH9 A;  4DNC A;  1SEU A;  4BY1 J;  3IWZ A;  4FCY A;  3FMR A;  4O6J A;  2AXT C;  3HRU A;  2DA3 A;  5ICE A;  3HSF A;  4KN7 X;  2XUB A;  3GFJ A;  1LEA A;  1G8X A;  1MZB A;  1X3W B;  4KA4 A;  2HVR A;  5CKT A;  4Q48 A;  1JTX A;  3LSH A;  5GP9 A;  3BG6 A;  4F3Q A;  3H3Z A;  4G6Q A;  4EGY A;  3K4L A;  1ZTR A;  2VQL A;  3K10 A;  1LPQ A;  3F9K A;  1IN8 A;  3R0A A;  1MGT A;  3CP8 A;  3H36 A;  4ZC3 A;  2X6W A;  1B72 B;  2QVO A;  3OYL A;  3OIQ A;  2E34 A;  1JJ8 C;  3J7Y J;  3VPR A;  5E3N A;  4ENN A;  2ID3 A;  1KU9 A;  1TW2 A;  2JRM A;  3CME I;  4XLN F;  2IEK A;  4W97 A;  3U21 A;  2CO5 A;  5J8C A;  4RLQ A;  1D5Y A;  4RB3 C;  5EEG A;  1R71 A;  1WCM J;  1HXD A;  2K9S A;  4FX4 A;  5DTD A;  1UZC A;  4HW0 A;  1GHC A;  3KX2 A;  2WWY A;  1ETW A;  1IN7 A;  1KU3 A;  5JLX A;  2HXO A;  3V7S A;  4BEH B;  4AWX B;  4XKV A;  3JRF A;  3LMM A;  4PJ0 C;  4X0G A;  5CVU A;  1XS9 A;  1IF1 A;  3NWS A;  3AG2 H;  1I6H J;  3LSR A;  1ZH5 A;  3OV8 A;  2D1H A;  3S14 J;  3CCY A;  4H0E A;  5HLT A;  3HKZ N;  2K9M A;  4I09 A;  3CCU I;  4K2E A;  1R1T A;  4ZYH A;  1PYV A;  5FFZ A;  3F72 A;  5CVR A;  5JR3 A;  1H8A C;  1LE8 A;  2DDA A;  3SXY A;  4B44 A;  3VYS B;  2UXN A;  5CYV A;  3V7C A;  4E7I A;  1APL C;  3EYI A;  3BTI A;  3K1M A;  1X1C A;  1ZG3 A;  1B4A A;  2E19 A;  2DYS H;  2VKD A;  2QWW A;  3F8M A;  2UWM A;  4JBA A;  4ZYE A;  1XPX A;  1H89 C;  1JKQ C;  1MBG A;  2XF7 A;  1RUO A;  5B1A H;  1SD4 A;  2XAU A;  3WTZ A;  5J8F A;  2CH0 A;  3KEY A;  4BXU A;  5LHI A;  1MMD A;  1TWG J;  5E17 F;  3ZQG A;  2WAE A;  3A2K A;  3LFK A;  3MZY A;  2IXS A;  5D8L B;  3WTU C;  2CGP A;  1VQK I;  3JRE A;  3DXJ F;  3HRT A;  5HLH A;  1X3U A;  2EK5 A;  5TRD A;  3H9J A;  3DPT A;  2COB A;  4XKC A;  4Y17 A;  3FHZ A;  5M5Y J;  3GLL A;  3BZ6 A;  4MNU A;  2EIN H;  4HX8 A;  1MBH A;  3P9K A;  1VQ9 I;  2Y0S N;  4RB2 C;  3I4N J;  1FMW A;  2FD5 A;  2VKV A;  2ZME C;  3CCL I;  1E0E A;  4ETS A;  4MFE A;  1LE8 B;  2E7W A;  4RS8 A;  4S05 A;  5DD4 A;  5DM6 F;  3JR9 A;  5LRS A;  2FBK A;  1YW8 A;  3OWT A;  2NVQ J;  1FYM A;  5ERI A;  3MZH A;  1Z21 A;  4KT6 A;  2E60 A;  5E1X A;  5DUI A;  4HF1 A;  5EG0 A;  2WTE A;  4HDU A;  4IL6 C;  2DOF A;  2VOD A;  4H4K C;  2M7B A;  4Z6Y A;  4Q4Z F;  4GCV A;  2YU3 A;  4LIT A;  2VUM J;  4RGS A;  5JHU A;  5FJ8 J;  4Z2Y A;  1I6X A;  3PFI A;  2M0C A;  5LBQ A;  4B47 A;  5CVJ A;  3WTT C;  3ASN H;  5HS7 A;  2M45 A;  2FRH A;  4OIN F;  2JUG A;  5C4J J;  3TOB A;  5JVT A;  2ESH A;  4E6K G;  3JRH A;  3ESW B;  3KPH A;  2Q2E A;  1P6R A; 
#chains in the Genus database with same CATH homology
 1UZC A;  2E71 A;  2KZG A;  2DOE A;  2K85 A;  2KIS A;  2JUC A;  2DOF A;  2CQN A;  2KIQ A;  4FQG A;  2B7E A;  2KFD A;  2L9V A;  2LKS A;  2DOD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...