2KISA

Solution structure of ca150 ff1 domain and ff1-ff2 interdomain linker
Total Genus 21
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
21
sequence length
71
structure length
71
Chain Sequence
GAMGSLEARMKQFKDMLLERGVSAFSTWEKELHKIVFDPRYLLLNPKERKQVFDQYVKTRAEEERREKKNK
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulator
molecule keywords Transcription elongation regulator 1
publication title Structural studies of FF domains of the transcription factor CA150 provide insights into the organization of FF domain tandem arrays.
pubmed doi rcsb
source organism Homo sapiens
total genus 21
structure length 71
sequence length 71
ec nomenclature
pdb deposition date 2009-05-08

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF01846 FF FF domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.440 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A FF domain 2kisA00
2B7EA 2DOEA 2E71A 1UZCA 2JUCA 2LKSA 4FQGA 2KIQA 2DOFA 2L9VA 2KFDA 2KISA 2CQNA 2K85A 2DODA 2KZGA
chains in the Genus database with same CATH superfamily
3E5XA 3C18A 2JRTA 3D0SA 4O5VA 2X51A 1TT0A 3FHZA 1FY7A 3KP5A 1REPC 3GYHX 1ZHFA 2ZJPF 1I5ZA 2M2EA 1RUOA 3A1YA 4EJOA 2KIQA 1QVTA 1MD0A 3CJQB 4II3A 4L5EA 4PGHA 2O6GE 3BROA 2DN0A 4ZTJA 3BG6A 1MMDA 5K7FA 2L3DA 2A5YB 2LD5A 5CVRA 1JHHA 3A0BC 2E36A 3FX3A 2CW0F 1B9MA 4QWQA 4XLHA 3I4MJ 3ERED 5IYCJ 1IUYA 1VQ9I 4XSZF 3BG7A 3D1NI 2RQQA 1ACIA 3VPRA 2GXAA 3HTSB 3ULQB 3K0LA 5F0FA 1GDTA 1B6AA 5LFAA 5DCMA 2MH2A 4X6AJ 5GAEJ 5KVRA 2FU4A 4RAZA 2NYXA 3I71A 3OOPA 2WY7Q 4G9YA 3HPHA 2DA2A 1OQYA 2MBFA 3G4SI 1ZK8A 1BR2A 4LK0F 1ON2A 2DA6A 2M34A 5E1XA 3SEZA 4B3AA 4A93J 2M4GA 1T56A 2VKHA 2ZMEC 1VF9A 3HOUJ 2HVRA 2BXYA 3K4CA 4EJTA 4FETA 3J7YJ 3PM1A 2Y9YA 3HZJA 1G59A 2COBA 1V3FA 3P5JA 3N05A 3U9GA 3L2VA 4HF2A 1XGNA 5E3NA 1J59A 3H9JA 2R7ZJ 5DD8A 2FUG2 1XC5A 2CV0A 1KU7A 2BY0A 1J2XA 1R1UA 4XONA 1TWCJ 3BOQA 2QBYA 3ABTA 4N9HA 3OYDA 3NWTA 2YS9A 3M8EA 4A0XA 3OYJA 2VKDA 1XCBA 5M5XJ 1YX3A 1IV6A 3BZKA 1S9HA 1XMAA 2I8DA 2ZB9A 3KP4A 4XQFA 1O3TA 1S7AA 2H6CA 2V9VA 1I1GA 1JUPA 3GUDA 1E3OC 2JA7J 1ZGWA 3I54A 2G7UA 2O03A 4UUTA 4KFCA 3A2KA 2LY9A 4PSXA 2OD5A 1JTXA 1Z7UA 4ON0A 3N4MA 2VXDA 3S3NA 2XB0X 1K79A 3B6AA 2HDCA 4A3BJ 2IA1A 3DQVC 2VPLA 3HRUA 2DFHA 3F8CA 3DV8A 3EUHA 2E7WA 2VBWA 3R60A 4JBAA 4MLOA 4U88A 3TO6A 1P4WA 1P6RA 1LFBA 1LE8A 5DS9A 6PAXA 3DPLC 3BQZA 3LAPA 3RZOJ 3VYSB 2F4IA 1ZR4A 3FDYA 1UMQA 3P9CA 1IZ1A 2YX7A 2P7CB 4HQMA 4A3DJ 1F36A 1IDYA 3PIPF 4AUXA 5DYMA 1Z9CA 1Y6IA 3QQAA 1TW2A 4M9ZA 2LK2A 4BBRJ 2EBIA 2XGDA 4IHTA 2YU3A 1O57A 3DKWA 4XRSG 4GXOA 4E70A 1U8RA 4BACA 2X0LA 2JK3A 4CZCA 3A4CA 5FRNA 4KIGA 4S0HB 4D0PA 3WTTC 3ZQQA 3FXMA 2YU9J 1JE8A 3MKWB 1T0FA 1XPXA 2GIVA 3RPUD 3R0AA 3HL2A 5TJJA 4MEXF 4M3DA 2E1OA 2EFNA 3V8KA 3AAFA 3S3OA 3KX2A 2LMDA 4Q4ZF 3BP8A 1B72B 4EVIA 4DBQA 2HXIA 2CQXA 3ZMVA 4ABZA 2R7XA 4BS9A 2W48A 4R1HA 4UUVA 5F04A 1LKXA 1YJ9I 4A3FJ 2JPBA 1UELB 2DA4A 3J81Z 4JOMA 1B1BA 2JQ7A 1VQ7I 4O3MA 2CH0A 1KA8A 2JPCA 3JAMK 2OV7A 2CQNA 5FO5A 3HOVJ 3I64A 2D2WA 4X1EA 1X4PA 1YO5C 4MGRA 5KNLA 4AD9A 5D4SA 1IW7F 5EEAA 1IN6A 3V42A 2DA1A 3PSIA 1J09A 3MAJA 1P2FA 2PMZA 1R5GA 3E6MA 1FBQA 2KRHA 1MKMA 2Y31A 2H1KA 1SD6A 4F3QA 1U5TA 2EZKA 3SDBA 2EZHA 4BXXJ 4XKCA 2X48A 2XKPA 3GTPJ 2L5QA 1TZLA 3WTZA 4XOTA 2MGQA 1Z1DA 2KDOA 3P9IA 3RYPA 3CMYA 3WU0A 1VQ5I 2ACJA 1HDPA 2GOMA 4B4CA 1UB9A 1HKTA 2GQQA 4WWCA 2EFQA 1WZ2A 1WH7A 1R36A 2FXAA 5JVTA 3D5RC 2EINH 3WTWC 3LSKA 2LKXA 2ME0A 3FKJA 2HTJA 2R7WA 2D1VA 4FHTA 2H09A 2XRNA 3F8MA 2KPMA 1W4MA 5GP9A 1X1PA 4RB3C 1VQNI 1APLC 4F7ZA 2UV1A 5ILSA 3IWFA 1DU0A 2MA3A 4LGWA 2OQRA 5D6FA 1AOYA 2FQ3A 3TDUC 3RDIA 5IPAA 3LSHA 2MD0A 2CFXA 1LE8B 1RZ4A 4YFXF 4RLQA 1DPRA 1QBJA 5FLXZ 1JGSA 3SHFA 2HKOA 2XPUA 2A61A 3IHUA 1IRFA 1WPKA 5B3SH 2A6HF 1WJEA 4XICA 3OL4A 3OYMA 4CHUA 2DMQA 4DYQA 4HF1A 1U8BA 2HOTA 5FJ8J 5IT9K 1LDJA 1P7IA 2JZYA 4EATA 1XN7A 2K9LA 2OU2A 2UUZA 2Y75A 4CICA 4AYBA 4NC7A 4PFOA 5C3EJ 1JKOC 1ERDA 3M7GA 5HS7A 4ANJA 5LLQA 3CESA 1BOAA 4HNVA 5K7ZA 2DMNA 5LHIA 1R1VA 1UZCA 4Q47A 3SZTA 3M9AA 3E6DA 2ESHA 2KP6A 1FSEA 1OJLA 5CVJA 1X4OA 3ZGKA 3RZDJ 3KP6A 4I99C 1LDDA 2HEOA 1WKMA 3IUOA 1OYIA 1SAXA 2VODA 5KK1A 3U2RA 2AS5F 1MBHA 4A6EA 1BR1A 2X1DA 3D5SC 3ECHA 2CV1A 4KICA 1HDDC 1DPUA 4Z6YA 4M9SA 3CUQB 3C1DA 2OUMA 3LA7A 4HZFA 2IEKA 4DIQA 3K4LA 2K9QA 2P8TA 1OR7A 3WG9A 3ZPLA 3WE2A 3OYBA 5HNFA 2DMPA 1YJNI 2JWTA 4D5FA 1RUNA 2OTLI 1PP7U 1XSVA 2L4AA 4IF4A 2K7LA 3JRCA 2CUEA 2P81A 2MH9A 4IPAA 4FX4A 3CCUI 1RRJA 4M9XA 5L3CA 3CCJI 2LSOA 1WRJA 5CLSA 4WCGA 1FTTA 3J80K 3QRFF 4RM3A 2VJ4A 2Z33A 4A3LJ 4OAZA 5FB2A 3F6VA 4PJ0C 2LF7A 3I9V2 1JI8A 1JGGA 2GXGA 3CDLA 3S1NJ 2ZCWA 3G3ZA 4ENMA 1OCCH 1FYKA 2MC3A 1U5TB 4XLEA 2W82A 5A2QK 1F5TA 4U7DA 1R6RA 1R71A 2QSGX 4BQNA 1VTNC 4Q5SF 1S7OA 3O3KA 3ROUA 2H8WA 2L2OA 2ELJA 3G1LA 4M3GA 3QP6A 1SFEA 4MQVA 4HEA2 4HSTA 1IN5A 3CF2A 3PO2J 5B5EC 1VQ6I 1WWXA 4FE7A 1E3PA 2KJBA 5GPCA 3OYFA 1D8JA 4NUBA 2HKXA 3HPGA 3S32A 3CMMA 3DLAA 3JSPA 2ISYA 3SEQA 3DKYA 3W2VA 1TQIA 3F72A 5E1ZB 4XMYA 1FOKA 2NNYA 1BL0A 4G7HF 2R5YA 3WE3A 5JLXA 2Q8KA 1NG6A 3CP2A 3KP2A 2ZXWH 1XMXA 1SMYF 2A6TA 2VJJA 1Y39A 1QPMA 2PMZN 3MKYB 2JN6A 4Q48A 1FJLA 1FOYA 4GCVA 4EM1A 2F4OB 2DPDA 1S7EA 3BCAA 2W4SA 1K78B 2RN7A 2D1HA 1IC8A 1H0MA 1WHUA 2LREA 1RESA 4JP0A 2BVMA 3T0YA 3JRAA 1OYWA 3WU2C 2NVXJ 1S8NA 2DCEA 4XOPA 3CUQC 3JREA 2R7UA 3F0CA 3IRRA 5M3MJ 3L7WA 4BY7J 2ZMEA 4DOZA 3MEXA 3OY9A 3KP3A 2FBHA 4NDLA 3F6OA 3SQNA 3P9KA 5HLHA 1X2NA 3OYHA 1OCOH 4HDVA 4ENKA 1TW3A 4BU2A 3PQJA 2K3PA 2VT3A 1WI9A 1WJAA 3ZCOA 4N0BA 1MBGA 2FE3A 4HNTA 3R61A 1J7KA 5BS6A 4UB6C 3MN2A 2LLKA 3ESWB 1QRYA 1D3YA 2NNNA 2LKSA 5E18F 1XGSA 2MC4A 2L54A 4YFNF 5ICGA 1F9NA 1U6GA 3BR5A 2DFFA 3BT9A 4OINF 2KRCA 4F93B 3K1MA 1IRXA 2UZKA 1XG1A 1MNEA 5D6EA 4XRFA 1GT0C 1X2MA 2VIXA 1J5YA 5IT3A 4L18B 1QPIA 1JTYA 3OOUA 3NWSA 4HG2A 1YS7A 2ADUA 1D0XA 2JSPA 4OIOF 1Z6TA 3DTIA 4CO8A 2FSWA 5EZHA 2J5OA 3JRIA 4AYBN 2WAFA 4ASNA 3S14J 2RVCA 1I3AA 2UXNA 2E2HJ 2HDWA 4NQWA 3DFGA 2XPWA 3QPLA 2M3AA 5E3MA 2XGEA 3I53A 4NB5A 2DOAA 4XLCA 4Y17A 5EEHA 4CZZA 5LHHA 4P55A 4YIFA 2L9NA 3WGHA 1X3WB 1ZLKA 1AA7A 3C7JA 3CCMI 4AWXB 4PJMA 4GO1A 2IXSA 3K1NA 1S72I 1OPCA 5FGMA 1I1SA 3HC7A 5B1BH 1B8IB 1BJZA 5ILVA 1FIAA 2MW8A 1SEUA 5M3FJ 4C3IJ 2GLOA 3I58A 2K40A 3SXYA 2Z5UA 3L00A 2GA1A 2DOEA 2F6CA 2PQ8A 3RQ4A 5L3EA 3GTQJ 2MSYA 2ZJ2A 3L9FA 4RDUA 3BJ6A 2MG4A 3A0HC 1KONA 1UCRA 1XGMA 5F64A 1NK2P 2DYRH 4KMFA 1WCMJ 2VOOA 2BEOA 3RI4A 1KQ9A 4UUSB 4C3JJ 1B59A 1WJBA 5KAIC 1UHMA 3DBLB 1RNLA 2WA0A 1G3WA 4IHXA 1TWAJ 3K70D 2D45A 2QQ9A 4ZDLA 3ZMDA 1Y8RB 4U87A 1S29A 1Y1WJ 3R0JA 2VONA 3K9TA 3BCBA 2R5YB 1K7AA 4BEHA 1LEAA 2KJCA 5HS8A 1XDSA 1YQAA 3HEFA 3CCEI 1RPWA 2I10A 3E6BA 4I6ZA 1CGPA 4LLNA 3MVPA 2FJ1A 2R7FA 3ELKA 3K4JA 3CO7C 4HW0A 1W7PD 3HHHA 3ERMA 2GIZA 2V6CA 2XAUA 1F1ZA 2P5KA 1TWGJ 3H0DA 3FF5A 4IO9F 1OCZH 9ANTA 3VODA 3HRSA 3GLLA 2IT0A 5JVGF 4N4NB 1O3SA 2M30A 3M8FA 4PCQA 1HF0A 1YLFA 2PI0A 2OBPA 4A3MJ 5J47A 3L2UA 2QEXI 2X9DA 1FPQA 1Q1HA 1MBJA 4LJZF 1HXDA 4M6YA 1HQCA 2L4MA 2O8KA 2DFIA 1SD7A 3R4KA 2VKVA 2LY1A 3ZMZA 1MZBA 2OA4A 4C2UA 1K4TA 3H3UA 1JHFA 5FKOA 1T95A 2PEXA 2DA7A 4RB2C 2OCEA 4ZTFA 2STWA 2WY8Q 2XF7A 2X1CA 3OMYA 3RKXA 4E7IA 3CDIA 1V5EA 5A2QZ 3CMEI 4EJVA 4IQJA 1MJ9A 2DFEA 1PUEE 5DCFA 4BGDA 3I55I 3ASNH 2ZC2A 4IQ4A 4C30A 2X1EA 4WXHA 4IZZA 5J1RA 3O8HA 3OIPA 4NC8A 3GTLJ 3BQYA 4ZYGA 1O7LA 1L0OC 4TV7A 1UJ8A 3GTGJ 2R4GA 2OJED 5TRDA 2GXBA 3ASOH 5KHDA 1PJRA 3N97A 2FNAA 3CZ6A 4NQWB 4D5CA 2VI6A 1HCRA 4XR6A 3SDGA 2LG4A 1HA8A 5CYVA 3GTOJ 2XAHA 4PSWA 4LG3A 2M87A 2NAZA 5LEJA 3JRBA 2B63J 3DXJF 1XDUA 2VJIA 1B72A 3RKYA 3BZ6A 3FBNB 1GV2A 3FMQA 3KE2A 4FE4A 1XCVA 2HYFA 2HZTA 2RAEA 3K6GA 3GFMA 5ERIA 1I50J 3KIOA 2EILH 3VOEA 4ZYDA 1YHQI 2LFBA 1UHSA 3I5UA 2VQCA 4LMYA 4B43A 4IKFA 1LQ1A 2FOWA 3KFWX 3ZMTA 5J6XA 1SVOA 4B44A 4M73A 2XGCA 1EJ9A 1YIJI 3F3XA 4EQQA 4AM3A 1LB2A 2WBMA 1WGXA 3BTJA 3ZQGA 1BBYA 2IJLA 5KCMA 3MKZA 2DU9A 2F2EA 1V5GA 1ZG3A 3CC7I 1VQKI 1QHHD 2BBYA 1MGTA 3CCLI 4HDUA 2GAUA 2QZ8A 4E7KA 5GADJ 3LA3A 3LQQA 3WU1B 4BEHB 4BYYA 1A35A 2Y69H 1X58A 5TISC 3G1OA 4XORA 1U3EM 4BXUA 2UWMA 1D1BA 5EJCA 2A5WA 3HJEA 3TP3A 4GFBA 3S1RJ 2KQRA 4BL0B 2KDZA 2JVGA 2KISA 4MTDA 1KQ8A 1QHGA 2OZUA 4RGXA 4HRIA 4M6VA 3FMRA 3CO6C 4Y7NJ 2K5CA 4RM2A 4Z2YA 1D5YA 3RTRA 1ENHA 1MW7A 5E8GA 4KT6A 2ISZA 1ZKGA 2K9MA 1IRZA 5CKTA 1ONVA 4KUMA 2O8XA 3BPVA 4BJTA 1HW2A 5FKLA 1I6XA 4NHJA 3WTYC 3I59B 1MBKA 3TKYA 5GAHJ 2L7FP 2VOPA 1U9OA 2HTSA 2GBYA 1H8AC 3HOYJ 2DW4A 3JSOA 2KKOA 3COAC 2Z99A 3S3MA 2BHZA 4W1UA 2DDBA 2P6SA 3U1DA 3BTLA 3OYGA 3PL8A 4F55A 1BC7C 2LNBA 4MEYF 4Y3OA 3OS0A 2W7NA 3BLYA 1QO0D 1XS9A 2NOJB 3BPXA 3S16J 3S2WA 3ZQCA 2JRMA 1H89C 4DZPA 1JUMA 5H6RA 4BKXA 4KT5C 1RETA 4QSHA 4ENJA 3TGNA 4K2EA 1R49A 2LY2A 4EV0A 5FD5A 3HSFA 1JKQC 3BDDA 3OWTA 3LAJA 3M3YJ 1WQ2A 5DD4A 1LJ9A 2JVHA 1IUFA 3W2AA 1WJFA 1OLTA 3CCYA 3PFIA 1AWCA 2RV8A 2V79A 1IN7A 2W24A 2G7HA 2XPVA 1F43A 3IAM2 5HVQC 4EJWA 2HU9A 2K02A 2OF7A 3A01A 1J0RA 2RNJA 3S1MJ 1TT5B 4I01A 4GYGA 5HS9A 1ZH5A 1KU9A 3X2QH 1H9GA 2KMUA 1HBXG 1VQ4I 1BJAA 3LMMA 5AIQA 3CUQA 3H5RA 3A03A 2GWRA 2ECBA 1ZREA 1LEBA 4X0GA 5J3LA 1YRNA 4AIKA 2V9PA 2ZJQF 2O0YA 3EDPA 1VQ8I 1SANA 2VE9A 1USSA 2FBKA 2IGKA 2KT0A 4IVNA 4MTEA 4RB1A 1ZYRF 1LVKA 4Y33A 4F92B 3LSPA 1EH8A 1JT6A 3ABLH 1BOBA 2RC4A 3G73A 2L9VA 3CC4I 3VSLA 2V9KA 1U9NA 1IG7A 1B4AA 1K83J 2W00A 3CUOA 1FLIA 4BE0A 2G0EA 1ZG5A 2IP2A 3T1BA 1YOVB 3VWBA 4A12A 5LGTA 2WV1A 2B9SA 2NVTJ 5FKMA 4RS8A 2CQKA 3H5AA 1P9QC 2ZNZA 3OYEA 5HODA 4AVZA 4ZH4F 3CCRI 2TDXA 2PMUA 1JKRC 5HOOA 3RYRA 3GMEA 2AQEA 2M0MA 3C3WA 1ZGAA 5EZGA 4NNJA 1TWHJ 1Q1VA 3Q0UA 1X1DA 2K4BA 3UR3C 3SJMA 4JK1X 3LSGA 1DGRM 4IJAA 4N9IA 3ZQIA 1A04A 1C0WA 1Z3XA 2AXTC 4EEFG 2QQ8A 5JI6A 4IOAF 3PO3J 1MJBA 4U0VA 2L9SA 4XLFA 1VQMI 2X4HA 3GLXA 2MYSA 2CU7A 2LRDA 3RSNA 2CMPA 1FMWA 3LA2A 1FP2A 3RPUA 3NAUA 3O2PE 2IGNA 4I7HA 3DPTA 3PNYA 5D4RA 2E1CA 3K70C 4DW6A 3HB9A 4E7ZA 4KYWA 2ZNYA 2X85A 2F5EA 4HSRA 5M5YJ 2HNHA 3V8JA 2C6YA 1ZRDA 1GVDA 3FXJA 2PJRB 2LR8A 3FXKA 3RJPA 4A3GJ 3Q5FA 5LEKA 4CYDA 3FHNA 4WXCA 4H0EA 2DK5A 2JSCA 2COMA 2PLYA 1Z6RA 2OTJI 2CS3A 3CQZJ 3V7CA 5J8CA 3QPSA 4KIFA 4CGZA 2V1NA 1O4XA 3B73A 4I76A 1K78A 3CCVI 1KYWA 2RREA 2KRFA 3J7AO 2IA2A 4EGZA 5DM6F 1D0YA 4DBRA 3T5XA 2KZVA 3LOCA 4P96A 2CRGA 3ZRGA 4OOIA 3ZQLA 2JA8J 2HGCA 2JUGA 3AFHA 3M07A 1Z7LA 3W6KB 5L3GA 5LBQA 3HGGA 3HRTA 5CVIA 5BQTA 1ETYA 3DU5A 5IYBJ 5B66C 2BHYA 1OCRH 2V1DA 3H3VK 5BOXA 5CPRB 3WHCA 3LSRA 2NXNB 1JKPC 1UHWA 3I3LA 1YG2A 1ZGJA 3W3CA 2Y0MA 2HQ5A 5HLGA 2KL4A 3TO9A 4ETSA 2XVCA 2M5WA 3RCOA 1IRGA 5DEQA 3PJRA 5K5QA 1HKQA 5IOZA 3QPHA 3A01B 4IHYA 2FMLA 2H94A 4MFDA 5AONA 4YELA 4RA2A 4XL9A 4UVCA 4B09A 2VBYA 4EM0B 2E35A 3OS1A 2M9HA 3SZPA 3E1SA 5J4VA 2CQ7A 5LRRA 4I0BA 3I4NJ 3KCCA 1E2XA 1FT9A 3IWZA 4V2GA 3DBRB 2OCCH 1YRNB 3KEQA 4B3XA 1S5LC 2YR2A 4I98B 3AL0B 4ZDOA 1IXSB 2VN2A 3TP0A 2O3FA 2CGPA 4L5IA 2CW7A 2DQRA 4KN7X 3OL3A 2UXXA 3FXLA 4NC6A 4UB8C 1YYVA 4L9NA 3BG5A 2DA5A 2I5UA 4XK4A 4IRHA 3M1EA 2O61A 3SYTA 2GZWA 4DYCA 4F91B 2BXZA 3RKWA 1MIJA 2DT6A 3O6BB 4BH9A 1TL8A 3K2ZA 2ID3A 3MWMA 4M72A 3GTJJ 1ETWA 2NVQJ 1D0ZA 3NQOA 4JQFA 1YIOA 5IP9J 4HA8A 2RDPA 4N4OB 3HOXJ 4EGYA 2HYGD 2HDDA 4PDKA 1O3QA 1B8IA 2JMWA 4IHSA 2E34A 2MD5A 3KLOA 4I02A 2Y2ZA 2ZXJA 2OPTA 4MNUA 3WODF 1T2KA 1V5FA 2NS0A 3SZGA 3TQNA 1KU2A 2R5ZB 1ETOA 5CVUA 5KAFC 1XX5A 1O7FA 2CG4A 3KZYA 1LUJB 3VB2A 5F1RA 3L2QA 2CO5A 1EH6A 3JRGA 2PX9A 3FK6A 3AKZA 1F4KA 2FNPA 3QAHA 3BR6A 3KP7A 4G94A 1ZLJA 2M7BA 5C4XJ 1YTYA 2P6TA 3WGGA 2E2IJ 4UUSA 2DDAA 4GRIA 4CH7A 5JLWA 3CJTB 3VDXA 3FM3A 3S8PA 5FFZA 3MCZA 1USTA 1NG7A 2LBFB 4RB0A 4XN0A 3V8LA 2XC7A 4XRMA 5HDGA 1VFCA 1T8IA 3GCMA 1OMIA 5TGTA 3OYLA 4XLPF 3JW4A 4MIMA 1SD5A 4E6KG 2Y9ZA 2RGVA 4XNFA 3HOTA 1MSEC 3MMYB 1ZAOA 2E1MC 5K5OA 4AIJA 1YFHA 5M5WJ 2BY3A 2F5FA 4HAMA 3K4BA 1FMVA 3E5QA 4L9JA 4RLFA 3JTGA 1JXSA 1XTAA 4FASD 2A68F 4KN4X 4IEJA 3OS2A 1K6YA 1ZARA 3PUFA 2EZIA 2HOSA 3B6CA 2DMTA 4FT8A 2M8GX 1PP8F 2W1OA 2AO9A 2EQRA 3GZ6A 4D7NA 4ENNA 1BC8C 1WJCA 2E5NA 3MZYA 1MSFC 5F6FA 4Y15A 3AL0C 3BR0A 5CJ9A 1WJDA 4BY1J 1FP1D 2VQGA 3TO7A 4P9UA 3ZP5A 2P5VA 3FXRA 5F08A 5EF6A 2VBZA 1HKSA 1RC9A 3JAMZ 2L9RA 3LSIA 4FQGA 2EFPA 3FM5A 2XRLA 5LRSA 2HVQA 1SD4A 2Q0OA 2XSJC 4OIQF 4A3IJ 2IA0A 2XHKA 3U1KA 4OWRB 3K10A 3FXOA 3REOA 4E4HA 4LB6B 1YW9A 4HF0A 1Y56A 1TNTA 4HOBA 5ICCA 2Z2SB 1FC3A 4PJJA 4DZJA 4KNYA 3O8GA 2EWNA 1U2WA 2EA2A 1AHDP 4U0YA 2Y48A 3PUBA 1DUXC 3M1CA 3L09A 2W57A 5C44J 3OYKA 4C3HJ 4KJZA 1OFCX 4HV6A 2EK5A 1SAUA 4BE1A 1G3SA 1VQPI 5BMZA 5EGOA 3VYUB 4HLYA 2QM3A 1TLHB 4U0WA 4L0YB 3RQIA 1XSXA 2CUFA 2V4JC 2NS7A 4F52A 5EYRA 2VJ5A 2HOEA 4KMUX 4I2OA 3QP5A 3BTCA 3RIRA 3K69A 2V6EA 1FYMA 2CFOA 2L7MP 1FWZA 2WB1A 2V7FA 3J7ZI 3IKTA 5E8IA 4DQ2A 2JA2A 2EV6A 1LPQA 5FKNA 2ELKA 3FBIB 3VYRB 2LH9A 3BY6A 3TL4X 1RIOH 2HYJA 3V7SA 1IJWC 4G7OF 1LFPA 2KFDA 1W0UA 1KGSA 1D1AA 2QQAA 3K4NA 5D5UB 1VI0A 4E7HA 5H20A 1OCTC 4XIDA 3E7LA 2B0LA 1TC3C 3K4KA 1G3YA 3E6CC 2WAEA 2CJJA 2NOGA 4CCKA 5GPAA 4BQAA 3CLQA 4ESBA 4OMZA 4M3EA 2ZJRF 2DA3A 5IP6A 4HV5A 4M6XA 1RKWA 2LYCA 4RGSA 4A3CJ 5IT9Z 5LD2C 5E79C 2KLOA 5J1UA 1AU7A 4DJAA 5D8KB 2F5DA 3HTUA 2X6OA 3HUGA 2XROA 4ZYAA 3U21A 4HX7A 4XLNF 2PFBA 1HC8A 3KZZA 5FFXA 5ICFA 3ZQ7A 1OKRA 2BW3B 3DTKA 4YRVA 2GOXB 2XUBA 2L02A 3TW6A 1WFXA 3FIWA 1OCPA 5E3LA 1S6LA 2VC1A 5HDNA 1ETXA 2CW8A 2XGXA 2QA4I 3IKVA 4WK8F 4ZZDA 5FKKA 1STZA 4LOCA 3CMAI 1B9NA 4B8XA 4LG0B 2QCOA 3ISPA 4WXDA 3TDZC 3DPUA 3GW2A 3PSFA 3EUKL 3I59A 3J81K 5ED4A 3G2BA 4FISA 2HQRA 2ZKZA 3HSEA 3BR3A 4BNCA 3KEOA 4LIUA 3F22A 1T33A 2FA5A 1EKEA 3EYYA 3W6JB 4XBFA 5DUIA 3GFIA 4MQ9F 2XAQA 3OIQA 2R92J 2VPRA 2ETHA 2N8GA 2DQLA 2VQHA 3J80Z 1IGNA 2QYOA 1ETQA 5BPIA 2E60A 1I27A 2FEZA 1XGOA 1QA6A 1W36D 2V1UA 1X3ZB 4YEJA 1ZN2A 2DT5A 3NRVA 1BI2A 2Y30A 3IL2A 2F5CA 2JA5J 3K4MA 2NRAC 3ECOA 1R1TA 3MQ0A 1WI3A 3ZN1A 3EYIA 1YW7A 4II2A 2LVSA 2EZLA 4B1RA 2OZ6A 4A6DA 4GGGA 4ZC3A 1IV8A 2GA2A 1POGA 5EGOB 3CD6I 1IAWA 1W7PA 2HPMA 3E0JB 5J40A 1H9TA 1MMNA 4QLCU 2WC2A 1ZELA 3LSMA 5L3BA 1YS6A 2HPIA 3F8FA 4E7LA 3GTKJ 2QF7A 3QYBA 2IGOA 1HSTA 2E71A 2MLGA 2QENA 4JX4A 2ZFUA 2ZBKA 3C2HA 2DBBA 3HOSA 4G6DA 5BNGA 4G7ZF 3E5UA 5JHFA 4KISA 3BG9A 1TTYA 2QLZA 4L9TA 1SFUA 5FD6A 2R7VA 3JRFA 2EPFA 2R7RA 4CYCB 4BDYA 1D5VA 2RKHA 1U0JA 2Z16A 1P7JA 2F5VA 4S04A 3TOBA 5FLXK 1E0EA 4IL6C 1A6QA 2VASA 1ON1A 1LVAA 3MKLA 4LB5A 3LSTA 1IN4A 3V4GA 2FF4A 3OSGA 1QZEA 4DGWB 4ESJA 4UY8I 3J7AY 3PNVA 3CC2I 2QKMB 2HVSA 1R5ID 2DLLA 1L3LA 3WG7H 4RAYA 2IVMA 1OYYA 1XMKA 3HHGA 1BI3A 1X3UA 1YI2I 1FNNA 1FX7A 4BBSJ 5L3DA 3JCUC 3GVAA 4LLLA 1QVUA 3H1CA 2XDVA 2FRHA 4HX4A 4RGRA 3GX4X 3P7NA 2JA6J 2ELHA 2WB1N 1BW5A 2DT7B 1GXQA 4CCJA 1N78A 3E3VA 1FBSA 3HUGB 4NBQA 3EQLF 1X1CA 5ILUA 1OISA 5ICEA 1WSUA 1NK3P 2TCTA 3AG1H 1V54H 3HM5A 1FYLA 2O5RA 4PGGA 1MBEA 5K1YA 4UXNA 2ZXIA 1R4NB 3WTUC 2K3FA 5K7HA 2E5ZA 5LGUA 2PJRA 4A0ZA 4GYIA 4ZZLA 2Q2EB 2WADA 4KA4A 2H27A 2IS2A 2KIUA 2EB7A 5HNHA 2D5VA 3VFZA 3Q3SA 5DTDA 5JFRA 1FSHA 4HX8A 2E7XA 4FTHA 3DLLF 3BG3A 2Y0SA 5EG0B 4CCNA 3S17J 5F0CA 1Y1VJ 1ZRCA 3IH4A 2WWYA 3HIFA 3F23A 2L7ZA 4XRSA 3ABUA 1MDMB 2PMHA 3OYAA 2WAQA 2IRFG 3GFJA 3HSRA 3QOPA 4HNUA 1TQMA 3H36A 3MD2A 1SFXA 4G8XA 1PUFA 2IGMA 2EV5A 4A0YA 3QYEA 4FX0A 2EH3A 3M8JA 3FWEA 4PJNA 4A5MA 2NS8A 2JJ7A 3BTIA 2VT2A 4UV9A 5F1JA 4CA0A 4IHWA 3ABKH 4IRIA 4BQOA 4P1WA 2E19A 2VB6A 3ML6A 1MJAA 2LTPA 3KYCB 3BJOA 1JJ8C 5J8FA 3HGYA 3WTSC 2XAGA 1W7PB 3JRDA 3CJNA 1GVJA 3H92A 4D7MA 5B1AH 1ULYA 5E3OA 3FXUA 2CWEA 3DEEA 1IF1A 4J19A 4UHTA 3ZMUA 2H8RA 4GDFA 3IV5A 1ETKA 1MMSA 2HQAA 1MH3A 2DJNA 3ZXSA 2YUSA 4AIDA 2R7QA 1J75A 2LP0A 3DTEA 4CXFA 2IS4A 1X1BA 3TBIA 3NEUA 2CSOA 4RGUA 3WTVC 1N25A 4RBOA 4BJ5C 4XM3A 2DMUA 5EDNA 3QOEA 1QGPA 5EEGA 4QIWN 4IRGA 1MH4A 3KLNA 2ZXHA 3FXQA 4UV8A 1GLNA 5K5RA 5FRMA 3DU6A 2W25A 3V7RA 3DP7A 3WTXC 3HOZJ 3CCQI 2DI3A 4G12A 5CQGA 2BE5F 1MNDA 4R79A 1R5HA 4LITA 3G1MA 3AG3H 1UG2A 1P4XA 3FZVA 3WGIA 2F4MB 1ZG1A 1Z21A 2HWVA 2R3SA 5AIPA 1Z05A 1V55H 1VQLI 1ZQ3P 1I6HJ 3AG2H 1YE9A 2R5ZA 1Z91A 3MZ8A 5DCMB 2AQFA 3DBHB 4EM2A 5GTHC 3C2BA 4B47A 3QPTA 2XAJA 4A5NA 4ITVA 1UG0A 2HQNA 2XIGA 4OMYA 2VL8A 3DWLE 3DF8A 3W6VA 4OAYA 1SVLA 1BR4A 4J00A 2K4JA 4R8HA 3BR1A 2HI3A 3OIOA 1RR7A 1M1EB 4CUGA 4ZYEA 1JJ6C 2BZTA 3S2HJ 2QQBA 4P5OA 3JRHA 4Y52J 2RNGA 2IS6A 5DUKA 1ODDA 3K2AA 1ZR2A 2FX0A 2LBFA 3HDDA 1BM9A 4QPQA 4YG2F 3IAS2 1BI1A 2L0KA 2YPRA 3HKZA 2NVYJ 4HYEA 2DOFA 2QVOA 1CF7A 3FISA 2PG4A 2QBYB 2LC2A 2B7EA 1IDZA 2VKEA 4AU7A 1MMAA 1RKTA 2P4WA 1BA5A 4BHCA 1ETVA 1DP7P 1KU3A 2QSHX 2VBXA 4QPOA 4G6QA 5J4YA 4LFUA 1PVEA 2BOLA 4XKWA 2HXOA 2FMYA 3ZR8X 1A6IA 3F9KA 2K27A 1NTCA 3IP4B 2KIFA 1WVRA 3OYIA 3ZQFA 1GXPA 3Q0WA 1A31A 4I0AA 5CQEA 1SFKA 3GXOA 2M8EA 3H0GJ 4CCMA 2XB5A 3HOWJ 4RAFA 4D1QA 1PUFB 1KZHA 1W5SA 3H9QA 1G8XA 2MFZA 4ESFA 4J01A 2GM4A 4C2MJ 3L1PA 1J9IA 3LL7A 5FROA 3PQKA 1YW8A 1ZTRA 2XV4S 1FZPB 2X6WA 2PJPA 5H6QA 2TRTA 3GZNB 3F8BA 1R58A 1V4RA 2E1MB 3Q0VA 4PFPA 1E17A 4G6TB 1SFOJ 3TW7A 2EIJH 1PYVA 4BUPA 2HOAA 2W85A 3NARA 3EUAA 1Z0XA 2Y0SN 1XB4A 3Q9SA 1I3QJ 1HW1A 3OR1C 1QZYA 2HS5A 3CCSI 3G6EI 1W36C 1XSDA 1W1WE 2JT1A 2W84A 3DEWA 3LWFA 2FBIA 2IBDA 5DDGA 3FMSA 1R22A 2RQPA 5LGNA 1X1AA 4W97A 2P7VB 2WAQN 3HRMA 5HDKA 1IXCA 1HOMA 3QU6A 4U7BA 4AIHA 2DJIA 2EA4A 1Z3YA 3CDHA 3SFZA 3LNQA 2XF6A 3S1QJ 1UAAA 3S15J 3GEZA 1BIBA 4MHGA 2Z9OA 1GHCA 2QGUA 1BIAA 3GFLA 1D8KA 4XSXF 3B02A 3G71I 1SC7A 2M4KA 4HQEA 2WV0A 5IYDJ 5J1YA 3AG4H 1T98A 1FOXA 2ZSHB 2A3SA 2QKLB 3HYIA 1LFUP 1P4AA 2ZFWA 1YJWI 2BVLA 2DK8A 3F21A 3DCFA 3KZIC 1TWFJ 4PJLA 2A05A 1U78A 2BGCA 2G9WA 3OYNA 2ID6A 1CQTA 2PBIA 3BC8A 4L9VA 4OIPF 1VZ0A 3ZN0A 5LHGA 5D5WB 4E7SA 3L2RA 3EPZA 4O6JA 2F48A 4LLGF 1FIPA 5JR3A 3ONQA 1R7JA 3IRQA 3S93A 1W5CC 2IW5A 2P0WA 3QU3A 2BY2A 2K9SA 2E2JJ 4M71A 4PUSA 1W0TA 2JUCA 2OAZA 5HLIA 2DTZA 4YFKF 4KIBA 1DQUA 2EFOA 4D9JA 5IP7J 2IAIA 2JTVA 3HXLA 5GTIC 1FBUA 1G6NA 1VQOI 2K9NA 2AXLA 2V26A 3QYFA 1K61A 1FTZA 3EUHC 3CF5F 2X6YA 1I39A 3UNGC 1AKHA 1G2HA 4LIVA 4ZJZA 4S05A 1EA3A 2NVUB 2BYVE 5BPDA 3MFKA 2KIMA 2J5PA 2A6EF 2EFWA 2DYSH 1PDNC 4A3KJ 1WJ5A 1KYZA 3JR9A 2VQLA 1CF7B 1ORKA 3OV8A 2BW3A 4Y4RA 1H88C 3LSJA 3R6SA 2LDUA 3F8NA 2DO7A 1JUSA 2CUZA 2M0CA 5JHUA 2DTRA 3KYLA 3PNTA 5GAGJ 1D1CA 4BDZA 4ZYHA 5CVVA 2VE8A 4BE2A 4BAYA 2KHMA 4V2FA 3ZOBA 4Y13A 4AVPA 1T38A 4LG0A 4ZDPA 2EV0A 2DAOA 3C2GA 1QNTA 3L2CA 2YX4A 2M1BA 3H9GA 4LD5A 4BJ6C 4WX9A 3PIOF 4DNCA 2MLKA 4YIIA 3ZQHA 2DPUA 1N77A 1T0FC 4H4KC 4UVAA 4WF2A 1A36A 2XASA 2WTEA 3E97A 3IC7A 4EJUA 2QSFX 3CTAA 3VEPA 3UKGA 4M3FA 4BHPA 1RI7A 4L5JA 3HKZN 4KITB 4JX5A 1TQPA 2ICWG 1R00A 1DP3A 1UFMA 2R7OA 3CP8A 1DU6A 3RPQA 3I56I 4E7JA 4BQQA 3BZCA 1G4DA 2ECCA 5D8LB 2MABA 3VSKA 2XSDC 2P5LC 2VXZA 1T6SA 4MFEA 3OR2C 2EJRA 2QUFA 4M3BA 3LQRA 3K1PA 4XN3A 5F0HA 2FQ4A 3LFUA 3K7AJ 1GV5A 4CCLA 1TBXA 4IX7A 1LNWA 3H3ZA 1DGWY 4LK1F 3FK7A 3TOAA 4XKVA 1BI0A 3KEYA 4B48A 1O3RA 2AHQA 2EIMH 3KETA 3T8TA 2ME6A 1E3HA 3IH3A 5FLMJ 1U5TC 3GWZA 1RR8C 1NHAA 1G3TA 2FD5A 1YITI 2O7OA 2R7SA 4IOCF 1K4SA 4MO7A 2HR3A 1NH3A 5DM7F 4C9YA 2Q1ZB 4C2TA 1WH5A 4UNOA 2M45A 2CQQA 3GF2A 3M4OJ 4CYCA 2STTA 1MBFA 3GZ5A 2L7KA 3MZHA 5IY5H 2H6BA 4L0ZB 2O9LA 2V1XA 1Y8QB 1MMGA 2CV2A 1K6OA 2E1NA 3BWGA 2XAFA 4JX6A 3TMOA 2QWWA 4AC0A 3I4PA 3DEUA 1IO2A 2IS1A 2R7DA 3HG9A 1T39A 1TP4A 1Y0NA 5D5VB 3JTHA 3BJAA 1IXRC 3Q9VA 4A2UA 1AKHB 4CSWA 1GUUA 4FCYA 1BW6A 1P92A 2LKPA 4UVBA 3GO5A 3WHBA 2VLAA 1MNMC 2A07F 5IOYA 2YSRA 4RMNA 1HW5A 2PN6A 4HPQA 4BXFA 2ESNA 4XLAA 4EMSA 4M74A 1QZZA 4YIRX 2XF5A 2Z1DA 3LFKA 2KZGA 3CLOA 3DKXA 1S3JA 4IHVA 1KQ0A 1HSJA 4V19K 5FLVA 1R9TJ 2VC0A 3H35A 2LOOA 1VNDA 1Y0UA 1ITYA 2A69F 3CJRB 4RAGA 3OYCA 2X6XA 1JT0A 1ZRFA 1SMTA 1EV7A 2H1LA 5E17F 1EH7A 1A5JA 2L01A 1FEXA 2Q2EA 3KYDB 3EETA 3RKQA 5D5XB 3BR2A 5HLTA 1SVMA 1BN5A 3GBGA 4OIRF 2K85A 3L2WA 4PZJA 3A02A 1X19A 4A3EJ 1W5TA 4HLXA 1N75A 1QQIA 5EG0A 4I09A 3T8RA 2FOKA 1TNSA 5L3FA 1YX5A 2R7TA 2CYYA 2HFHA 2IPQX 1FOWA 2DXIA 2HZDA 1MDMA 3SFIA 2OC6A 1Z67A 3TEDA 1QU3A 4KDPA 2LF8A 3FKIJ 5F27A 4A3JJ 2ZMEB 4IXAA 2CUJA 1OR7C 1R4MB 3ABMH 3OSFA 2DODA 2ZSIB 4A69C 5E1WA 1LDKB 4JYKA 2VUMJ 3KPHA 3D5LA 3HBLA 2XKOA 3GTMJ 1DDNA 5DV5A 1IN8A 4CCOA 1XD7A 4XKBA 3IH2A 5C4JJ 5E20A 4CDGA 3VYTB 1EF4A 2M7AA 1R23A 2Z3YA 3H5NA 3PFYA 3ZMSA 5H2FC 2BY1A 4QTRA 1HLVA 4P9FA 2EIKH 2R93J 2BV6A 3QODA 3I0TA 2OQGA 2K86A 4OU0A 2R0QC 3QWLA 3W2WA 1Z77A 3S2DJ 4HBLA 4BHBA 2ZO4A 4DYRA 4PK4A 1T08B
chains in the Genus database with same CATH topology
2B7EA 2DOEA 2E71A 1UZCA 2JUCA 2LKSA 4FQGA 2KIQA 2DOFA 2L9VA 2KFDA 2KISA 2CQNA 2K85A 2DODA 2KZGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2B7E A;  2DOE A;  2E71 A;  1UZC A;  2JUC A;  2LKS A;  4FQG A;  2KIQ A;  2DOF A;  2L9V A;  2KFD A;  2KIS A;  2CQN A;  2K85 A;  2DOD A;  2KZG A; 
#chains in the Genus database with same CATH topology
 3E5X A;  3C18 A;  2JRT A;  3D0S A;  4O5V A;  2X51 A;  1TT0 A;  3FHZ A;  1FY7 A;  3KP5 A;  1REP C;  3GYH X;  1ZHF A;  2ZJP F;  1I5Z A;  2M2E A;  1RUO A;  3A1Y A;  4EJO A;  2KIQ A;  1QVT A;  1MD0 A;  3CJQ B;  4II3 A;  4L5E A;  4PGH A;  2O6G E;  3BRO A;  2DN0 A;  4ZTJ A;  3BG6 A;  1MMD A;  5K7F A;  2L3D A;  2A5Y B;  2LD5 A;  5CVR A;  1JHH A;  3A0B C;  2E36 A;  3FX3 A;  2CW0 F;  1B9M A;  4QWQ A;  4XLH A;  3I4M J;  3ERE D;  5IYC J;  1IUY A;  1VQ9 I;  4XSZ F;  3BG7 A;  3D1N I;  2RQQ A;  1ACI A;  3VPR A;  2GXA A;  3HTS B;  3ULQ B;  3K0L A;  5F0F A;  1GDT A;  1B6A A;  5LFA A;  5DCM A;  2MH2 A;  4X6A J;  5GAE J;  5KVR A;  2FU4 A;  4RAZ A;  2NYX A;  3I71 A;  3OOP A;  2WY7 Q;  4G9Y A;  3HPH A;  2DA2 A;  1OQY A;  2MBF A;  3G4S I;  1ZK8 A;  1BR2 A;  4LK0 F;  1ON2 A;  2DA6 A;  2M34 A;  5E1X A;  3SEZ A;  4B3A A;  4A93 J;  2M4G A;  1T56 A;  2VKH A;  2ZME C;  1VF9 A;  3HOU J;  2HVR A;  2BXY A;  3K4C A;  4EJT A;  4FET A;  3J7Y J;  3PM1 A;  2Y9Y A;  3HZJ A;  1G59 A;  2COB A;  1V3F A;  3P5J A;  3N05 A;  3U9G A;  3L2V A;  4HF2 A;  1XGN A;  5E3N A;  1J59 A;  3H9J A;  2R7Z J;  5DD8 A;  2FUG 2;  1XC5 A;  2CV0 A;  1KU7 A;  2BY0 A;  1J2X A;  1R1U A;  4XON A;  1TWC J;  3BOQ A;  2QBY A;  3ABT A;  4N9H A;  3OYD A;  3NWT A;  2YS9 A;  3M8E A;  4A0X A;  3OYJ A;  2VKD A;  1XCB A;  5M5X J;  1YX3 A;  1IV6 A;  3BZK A;  1S9H A;  1XMA A;  2I8D A;  2ZB9 A;  3KP4 A;  4XQF A;  1O3T A;  1S7A A;  2H6C A;  2V9V A;  1I1G A;  1JUP A;  3GUD A;  1E3O C;  2JA7 J;  1ZGW A;  3I54 A;  2G7U A;  2O03 A;  4UUT A;  4KFC A;  3A2K A;  2LY9 A;  4PSX A;  2OD5 A;  1JTX A;  1Z7U A;  4ON0 A;  3N4M A;  2VXD A;  3S3N A;  2XB0 X;  1K79 A;  3B6A A;  2HDC A;  4A3B J;  2IA1 A;  3DQV C;  2VPL A;  3HRU A;  2DFH A;  3F8C A;  3DV8 A;  3EUH A;  2E7W A;  2VBW A;  3R60 A;  4JBA A;  4MLO A;  4U88 A;  3TO6 A;  1P4W A;  1P6R A;  1LFB A;  1LE8 A;  5DS9 A;  6PAX A;  3DPL C;  3BQZ A;  3LAP A;  3RZO J;  3VYS B;  2F4I A;  1ZR4 A;  3FDY A;  1UMQ A;  3P9C A;  1IZ1 A;  2YX7 A;  2P7C B;  4HQM A;  4A3D J;  1F36 A;  1IDY A;  3PIP F;  4AUX A;  5DYM A;  1Z9C A;  1Y6I A;  3QQA A;  1TW2 A;  4M9Z A;  2LK2 A;  4BBR J;  2EBI A;  2XGD A;  4IHT A;  2YU3 A;  1O57 A;  3DKW A;  4XRS G;  4GXO A;  4E70 A;  1U8R A;  4BAC A;  2X0L A;  2JK3 A;  4CZC A;  3A4C A;  5FRN A;  4KIG A;  4S0H B;  4D0P A;  3WTT C;  3ZQQ A;  3FXM A;  2YU9 J;  1JE8 A;  3MKW B;  1T0F A;  1XPX A;  2GIV A;  3RPU D;  3R0A A;  3HL2 A;  5TJJ A;  4MEX F;  4M3D A;  2E1O A;  2EFN A;  3V8K A;  3AAF A;  3S3O A;  3KX2 A;  2LMD A;  4Q4Z F;  3BP8 A;  1B72 B;  4EVI A;  4DBQ A;  2HXI A;  2CQX A;  3ZMV A;  4ABZ A;  2R7X A;  4BS9 A;  2W48 A;  4R1H A;  4UUV A;  5F04 A;  1LKX A;  1YJ9 I;  4A3F J;  2JPB A;  1UEL B;  2DA4 A;  3J81 Z;  4JOM A;  1B1B A;  2JQ7 A;  1VQ7 I;  4O3M A;  2CH0 A;  1KA8 A;  2JPC A;  3JAM K;  2OV7 A;  2CQN A;  5FO5 A;  3HOV J;  3I64 A;  2D2W A;  4X1E A;  1X4P A;  1YO5 C;  4MGR A;  5KNL A;  4AD9 A;  5D4S A;  1IW7 F;  5EEA A;  1IN6 A;  3V42 A;  2DA1 A;  3PSI A;  1J09 A;  3MAJ A;  1P2F A;  2PMZ A;  1R5G A;  3E6M A;  1FBQ A;  2KRH A;  1MKM A;  2Y31 A;  2H1K A;  1SD6 A;  4F3Q A;  1U5T A;  2EZK A;  3SDB A;  2EZH A;  4BXX J;  4XKC A;  2X48 A;  2XKP A;  3GTP J;  2L5Q A;  1TZL A;  3WTZ A;  4XOT A;  2MGQ A;  1Z1D A;  2KDO A;  3P9I A;  3RYP A;  3CMY A;  3WU0 A;  1VQ5 I;  2ACJ A;  1HDP A;  2GOM A;  4B4C A;  1UB9 A;  1HKT A;  2GQQ A;  4WWC A;  2EFQ A;  1WZ2 A;  1WH7 A;  1R36 A;  2FXA A;  5JVT A;  3D5R C;  2EIN H;  3WTW C;  3LSK A;  2LKX A;  2ME0 A;  3FKJ A;  2HTJ A;  2R7W A;  2D1V A;  4FHT A;  2H09 A;  2XRN A;  3F8M A;  2KPM A;  1W4M A;  5GP9 A;  1X1P A;  4RB3 C;  1VQN I;  1APL C;  4F7Z A;  2UV1 A;  5ILS A;  3IWF A;  1DU0 A;  2MA3 A;  4LGW A;  2OQR A;  5D6F A;  1AOY A;  2FQ3 A;  3TDU C;  3RDI A;  5IPA A;  3LSH A;  2MD0 A;  2CFX A;  1LE8 B;  1RZ4 A;  4YFX F;  4RLQ A;  1DPR A;  1QBJ A;  5FLX Z;  1JGS A;  3SHF A;  2HKO A;  2XPU A;  2A61 A;  3IHU A;  1IRF A;  1WPK A;  5B3S H;  2A6H F;  1WJE A;  4XIC A;  3OL4 A;  3OYM A;  4CHU A;  2DMQ A;  4DYQ A;  4HF1 A;  1U8B A;  2HOT A;  5FJ8 J;  5IT9 K;  1LDJ A;  1P7I A;  2JZY A;  4EAT A;  1XN7 A;  2K9L A;  2OU2 A;  2UUZ A;  2Y75 A;  4CIC A;  4AYB A;  4NC7 A;  4PFO A;  5C3E J;  1JKO C;  1ERD A;  3M7G A;  5HS7 A;  4ANJ A;  5LLQ A;  3CES A;  1BOA A;  4HNV A;  5K7Z A;  2DMN A;  5LHI A;  1R1V A;  1UZC A;  4Q47 A;  3SZT A;  3M9A A;  3E6D A;  2ESH A;  2KP6 A;  1FSE A;  1OJL A;  5CVJ A;  1X4O A;  3ZGK A;  3RZD J;  3KP6 A;  4I99 C;  1LDD A;  2HEO A;  1WKM A;  3IUO A;  1OYI A;  1SAX A;  2VOD A;  5KK1 A;  3U2R A;  2AS5 F;  1MBH A;  4A6E A;  1BR1 A;  2X1D A;  3D5S C;  3ECH A;  2CV1 A;  4KIC A;  1HDD C;  1DPU A;  4Z6Y A;  4M9S A;  3CUQ B;  3C1D A;  2OUM A;  3LA7 A;  4HZF A;  2IEK A;  4DIQ A;  3K4L A;  2K9Q A;  2P8T A;  1OR7 A;  3WG9 A;  3ZPL A;  3WE2 A;  3OYB A;  5HNF A;  2DMP A;  1YJN I;  2JWT A;  4D5F A;  1RUN A;  2OTL I;  1PP7 U;  1XSV A;  2L4A A;  4IF4 A;  2K7L A;  3JRC A;  2CUE A;  2P81 A;  2MH9 A;  4IPA A;  4FX4 A;  3CCU I;  1RRJ A;  4M9X A;  5L3C A;  3CCJ I;  2LSO A;  1WRJ A;  5CLS A;  4WCG A;  1FTT A;  3J80 K;  3QRF F;  4RM3 A;  2VJ4 A;  2Z33 A;  4A3L J;  4OAZ A;  5FB2 A;  3F6V A;  4PJ0 C;  2LF7 A;  3I9V 2;  1JI8 A;  1JGG A;  2GXG A;  3CDL A;  3S1N J;  2ZCW A;  3G3Z A;  4ENM A;  1OCC H;  1FYK A;  2MC3 A;  1U5T B;  4XLE A;  2W82 A;  5A2Q K;  1F5T A;  4U7D A;  1R6R A;  1R71 A;  2QSG X;  4BQN A;  1VTN C;  4Q5S F;  1S7O A;  3O3K A;  3ROU A;  2H8W A;  2L2O A;  2ELJ A;  3G1L A;  4M3G A;  3QP6 A;  1SFE A;  4MQV A;  4HEA 2;  4HST A;  1IN5 A;  3CF2 A;  3PO2 J;  5B5E C;  1VQ6 I;  1WWX A;  4FE7 A;  1E3P A;  2KJB A;  5GPC A;  3OYF A;  1D8J A;  4NUB A;  2HKX A;  3HPG A;  3S32 A;  3CMM A;  3DLA A;  3JSP A;  2ISY A;  3SEQ A;  3DKY A;  3W2V A;  1TQI A;  3F72 A;  5E1Z B;  4XMY A;  1FOK A;  2NNY A;  1BL0 A;  4G7H F;  2R5Y A;  3WE3 A;  5JLX A;  2Q8K A;  1NG6 A;  3CP2 A;  3KP2 A;  2ZXW H;  1XMX A;  1SMY F;  2A6T A;  2VJJ A;  1Y39 A;  1QPM A;  2PMZ N;  3MKY B;  2JN6 A;  4Q48 A;  1FJL A;  1FOY A;  4GCV A;  4EM1 A;  2F4O B;  2DPD A;  1S7E A;  3BCA A;  2W4S A;  1K78 B;  2RN7 A;  2D1H A;  1IC8 A;  1H0M A;  1WHU A;  2LRE A;  1RES A;  4JP0 A;  2BVM A;  3T0Y A;  3JRA A;  1OYW A;  3WU2 C;  2NVX J;  1S8N A;  2DCE A;  4XOP A;  3CUQ C;  3JRE A;  2R7U A;  3F0C A;  3IRR A;  5M3M J;  3L7W A;  4BY7 J;  2ZME A;  4DOZ A;  3MEX A;  3OY9 A;  3KP3 A;  2FBH A;  4NDL A;  3F6O A;  3SQN A;  3P9K A;  5HLH A;  1X2N A;  3OYH A;  1OCO H;  4HDV A;  4ENK A;  1TW3 A;  4BU2 A;  3PQJ A;  2K3P A;  2VT3 A;  1WI9 A;  1WJA A;  3ZCO A;  4N0B A;  1MBG A;  2FE3 A;  4HNT A;  3R61 A;  1J7K A;  5BS6 A;  4UB6 C;  3MN2 A;  2LLK A;  3ESW B;  1QRY A;  1D3Y A;  2NNN A;  2LKS A;  5E18 F;  1XGS A;  2MC4 A;  2L54 A;  4YFN F;  5ICG A;  1F9N A;  1U6G A;  3BR5 A;  2DFF A;  3BT9 A;  4OIN F;  2KRC A;  4F93 B;  3K1M A;  1IRX A;  2UZK A;  1XG1 A;  1MNE A;  5D6E A;  4XRF A;  1GT0 C;  1X2M A;  2VIX A;  1J5Y A;  5IT3 A;  4L18 B;  1QPI A;  1JTY A;  3OOU A;  3NWS A;  4HG2 A;  1YS7 A;  2ADU A;  1D0X A;  2JSP A;  4OIO F;  1Z6T A;  3DTI A;  4CO8 A;  2FSW A;  5EZH A;  2J5O A;  3JRI A;  4AYB N;  2WAF A;  4ASN A;  3S14 J;  2RVC A;  1I3A A;  2UXN A;  2E2H J;  2HDW A;  4NQW A;  3DFG A;  2XPW A;  3QPL A;  2M3A A;  5E3M A;  2XGE A;  3I53 A;  4NB5 A;  2DOA A;  4XLC A;  4Y17 A;  5EEH A;  4CZZ A;  5LHH A;  4P55 A;  4YIF A;  2L9N A;  3WGH A;  1X3W B;  1ZLK A;  1AA7 A;  3C7J A;  3CCM I;  4AWX B;  4PJM A;  4GO1 A;  2IXS A;  3K1N A;  1S72 I;  1OPC A;  5FGM A;  1I1S A;  3HC7 A;  5B1B H;  1B8I B;  1BJZ A;  5ILV A;  1FIA A;  2MW8 A;  1SEU A;  5M3F J;  4C3I J;  2GLO A;  3I58 A;  2K40 A;  3SXY A;  2Z5U A;  3L00 A;  2GA1 A;  2DOE A;  2F6C A;  2PQ8 A;  3RQ4 A;  5L3E A;  3GTQ J;  2MSY A;  2ZJ2 A;  3L9F A;  4RDU A;  3BJ6 A;  2MG4 A;  3A0H C;  1KON A;  1UCR A;  1XGM A;  5F64 A;  1NK2 P;  2DYR H;  4KMF A;  1WCM J;  2VOO A;  2BEO A;  3RI4 A;  1KQ9 A;  4UUS B;  4C3J J;  1B59 A;  1WJB A;  5KAI C;  1UHM A;  3DBL B;  1RNL A;  2WA0 A;  1G3W A;  4IHX A;  1TWA J;  3K70 D;  2D45 A;  2QQ9 A;  4ZDL A;  3ZMD A;  1Y8R B;  4U87 A;  1S29 A;  1Y1W J;  3R0J A;  2VON A;  3K9T A;  3BCB A;  2R5Y B;  1K7A A;  4BEH A;  1LEA A;  2KJC A;  5HS8 A;  1XDS A;  1YQA A;  3HEF A;  3CCE I;  1RPW A;  2I10 A;  3E6B A;  4I6Z A;  1CGP A;  4LLN A;  3MVP A;  2FJ1 A;  2R7F A;  3ELK A;  3K4J A;  3CO7 C;  4HW0 A;  1W7P D;  3HHH A;  3ERM A;  2GIZ A;  2V6C A;  2XAU A;  1F1Z A;  2P5K A;  1TWG J;  3H0D A;  3FF5 A;  4IO9 F;  1OCZ H;  9ANT A;  3VOD A;  3HRS A;  3GLL A;  2IT0 A;  5JVG F;  4N4N B;  1O3S A;  2M30 A;  3M8F A;  4PCQ A;  1HF0 A;  1YLF A;  2PI0 A;  2OBP A;  4A3M J;  5J47 A;  3L2U A;  2QEX I;  2X9D A;  1FPQ A;  1Q1H A;  1MBJ A;  4LJZ F;  1HXD A;  4M6Y A;  1HQC A;  2L4M A;  2O8K A;  2DFI A;  1SD7 A;  3R4K A;  2VKV A;  2LY1 A;  3ZMZ A;  1MZB A;  2OA4 A;  4C2U A;  1K4T A;  3H3U A;  1JHF A;  5FKO A;  1T95 A;  2PEX A;  2DA7 A;  4RB2 C;  2OCE A;  4ZTF A;  2STW A;  2WY8 Q;  2XF7 A;  2X1C A;  3OMY A;  3RKX A;  4E7I A;  3CDI A;  1V5E A;  5A2Q Z;  3CME I;  4EJV A;  4IQJ A;  1MJ9 A;  2DFE A;  1PUE E;  5DCF A;  4BGD A;  3I55 I;  3ASN H;  2ZC2 A;  4IQ4 A;  4C30 A;  2X1E A;  4WXH A;  4IZZ A;  5J1R A;  3O8H A;  3OIP A;  4NC8 A;  3GTL J;  3BQY A;  4ZYG A;  1O7L A;  1L0O C;  4TV7 A;  1UJ8 A;  3GTG J;  2R4G A;  2OJE D;  5TRD A;  2GXB A;  3ASO H;  5KHD A;  1PJR A;  3N97 A;  2FNA A;  3CZ6 A;  4NQW B;  4D5C A;  2VI6 A;  1HCR A;  4XR6 A;  3SDG A;  2LG4 A;  1HA8 A;  5CYV A;  3GTO J;  2XAH A;  4PSW A;  4LG3 A;  2M87 A;  2NAZ A;  5LEJ A;  3JRB A;  2B63 J;  3DXJ F;  1XDU A;  2VJI A;  1B72 A;  3RKY A;  3BZ6 A;  3FBN B;  1GV2 A;  3FMQ A;  3KE2 A;  4FE4 A;  1XCV A;  2HYF A;  2HZT A;  2RAE A;  3K6G A;  3GFM A;  5ERI A;  1I50 J;  3KIO A;  2EIL H;  3VOE A;  4ZYD A;  1YHQ I;  2LFB A;  1UHS A;  3I5U A;  2VQC A;  4LMY A;  4B43 A;  4IKF A;  1LQ1 A;  2FOW A;  3KFW X;  3ZMT A;  5J6X A;  1SVO A;  4B44 A;  4M73 A;  2XGC A;  1EJ9 A;  1YIJ I;  3F3X A;  4EQQ A;  4AM3 A;  1LB2 A;  2WBM A;  1WGX A;  3BTJ A;  3ZQG A;  1BBY A;  2IJL A;  5KCM A;  3MKZ A;  2DU9 A;  2F2E A;  1V5G A;  1ZG3 A;  3CC7 I;  1VQK I;  1QHH D;  2BBY A;  1MGT A;  3CCL I;  4HDU A;  2GAU A;  2QZ8 A;  4E7K A;  5GAD J;  3LA3 A;  3LQQ A;  3WU1 B;  4BEH B;  4BYY A;  1A35 A;  2Y69 H;  1X58 A;  5TIS C;  3G1O A;  4XOR A;  1U3E M;  4BXU A;  2UWM A;  1D1B A;  5EJC A;  2A5W A;  3HJE A;  3TP3 A;  4GFB A;  3S1R J;  2KQR A;  4BL0 B;  2KDZ A;  2JVG A;  2KIS A;  4MTD A;  1KQ8 A;  1QHG A;  2OZU A;  4RGX A;  4HRI A;  4M6V A;  3FMR A;  3CO6 C;  4Y7N J;  2K5C A;  4RM2 A;  4Z2Y A;  1D5Y A;  3RTR A;  1ENH A;  1MW7 A;  5E8G A;  4KT6 A;  2ISZ A;  1ZKG A;  2K9M A;  1IRZ A;  5CKT A;  1ONV A;  4KUM A;  2O8X A;  3BPV A;  4BJT A;  1HW2 A;  5FKL A;  1I6X A;  4NHJ A;  3WTY C;  3I59 B;  1MBK A;  3TKY A;  5GAH J;  2L7F P;  2VOP A;  1U9O A;  2HTS A;  2GBY A;  1H8A C;  3HOY J;  2DW4 A;  3JSO A;  2KKO A;  3COA C;  2Z99 A;  3S3M A;  2BHZ A;  4W1U A;  2DDB A;  2P6S A;  3U1D A;  3BTL A;  3OYG A;  3PL8 A;  4F55 A;  1BC7 C;  2LNB A;  4MEY F;  4Y3O A;  3OS0 A;  2W7N A;  3BLY A;  1QO0 D;  1XS9 A;  2NOJ B;  3BPX A;  3S16 J;  3S2W A;  3ZQC A;  2JRM A;  1H89 C;  4DZP A;  1JUM A;  5H6R A;  4BKX A;  4KT5 C;  1RET A;  4QSH A;  4ENJ A;  3TGN A;  4K2E A;  1R49 A;  2LY2 A;  4EV0 A;  5FD5 A;  3HSF A;  1JKQ C;  3BDD A;  3OWT A;  3LAJ A;  3M3Y J;  1WQ2 A;  5DD4 A;  1LJ9 A;  2JVH A;  1IUF A;  3W2A A;  1WJF A;  1OLT A;  3CCY A;  3PFI A;  1AWC A;  2RV8 A;  2V79 A;  1IN7 A;  2W24 A;  2G7H A;  2XPV A;  1F43 A;  3IAM 2;  5HVQ C;  4EJW A;  2HU9 A;  2K02 A;  2OF7 A;  3A01 A;  1J0R A;  2RNJ A;  3S1M J;  1TT5 B;  4I01 A;  4GYG A;  5HS9 A;  1ZH5 A;  1KU9 A;  3X2Q H;  1H9G A;  2KMU A;  1HBX G;  1VQ4 I;  1BJA A;  3LMM A;  5AIQ A;  3CUQ A;  3H5R A;  3A03 A;  2GWR A;  2ECB A;  1ZRE A;  1LEB A;  4X0G A;  5J3L A;  1YRN A;  4AIK A;  2V9P A;  2ZJQ F;  2O0Y A;  3EDP A;  1VQ8 I;  1SAN A;  2VE9 A;  1USS A;  2FBK A;  2IGK A;  2KT0 A;  4IVN A;  4MTE A;  4RB1 A;  1ZYR F;  1LVK A;  4Y33 A;  4F92 B;  3LSP A;  1EH8 A;  1JT6 A;  3ABL H;  1BOB A;  2RC4 A;  3G73 A;  2L9V A;  3CC4 I;  3VSL A;  2V9K A;  1U9N A;  1IG7 A;  1B4A A;  1K83 J;  2W00 A;  3CUO A;  1FLI A;  4BE0 A;  2G0E A;  1ZG5 A;  2IP2 A;  3T1B A;  1YOV B;  3VWB A;  4A12 A;  5LGT A;  2WV1 A;  2B9S A;  2NVT J;  5FKM A;  4RS8 A;  2CQK A;  3H5A A;  1P9Q C;  2ZNZ A;  3OYE A;  5HOD A;  4AVZ A;  4ZH4 F;  3CCR I;  2TDX A;  2PMU A;  1JKR C;  5HOO A;  3RYR A;  3GME A;  2AQE A;  2M0M A;  3C3W A;  1ZGA A;  5EZG A;  4NNJ A;  1TWH J;  1Q1V A;  3Q0U A;  1X1D A;  2K4B A;  3UR3 C;  3SJM A;  4JK1 X;  3LSG A;  1DGR M;  4IJA A;  4N9I A;  3ZQI A;  1A04 A;  1C0W A;  1Z3X A;  2AXT C;  4EEF G;  2QQ8 A;  5JI6 A;  4IOA F;  3PO3 J;  1MJB A;  4U0V A;  2L9S A;  4XLF A;  1VQM I;  2X4H A;  3GLX A;  2MYS A;  2CU7 A;  2LRD A;  3RSN A;  2CMP A;  1FMW A;  3LA2 A;  1FP2 A;  3RPU A;  3NAU A;  3O2P E;  2IGN A;  4I7H A;  3DPT A;  3PNY A;  5D4R A;  2E1C A;  3K70 C;  4DW6 A;  3HB9 A;  4E7Z A;  4KYW A;  2ZNY A;  2X85 A;  2F5E A;  4HSR A;  5M5Y J;  2HNH A;  3V8J A;  2C6Y A;  1ZRD A;  1GVD A;  3FXJ A;  2PJR B;  2LR8 A;  3FXK A;  3RJP A;  4A3G J;  3Q5F A;  5LEK A;  4CYD A;  3FHN A;  4WXC A;  4H0E A;  2DK5 A;  2JSC A;  2COM A;  2PLY A;  1Z6R A;  2OTJ I;  2CS3 A;  3CQZ J;  3V7C A;  5J8C A;  3QPS A;  4KIF A;  4CGZ A;  2V1N A;  1O4X A;  3B73 A;  4I76 A;  1K78 A;  3CCV I;  1KYW A;  2RRE A;  2KRF A;  3J7A O;  2IA2 A;  4EGZ A;  5DM6 F;  1D0Y A;  4DBR A;  3T5X A;  2KZV A;  3LOC A;  4P96 A;  2CRG A;  3ZRG A;  4OOI A;  3ZQL A;  2JA8 J;  2HGC A;  2JUG A;  3AFH A;  3M07 A;  1Z7L A;  3W6K B;  5L3G A;  5LBQ A;  3HGG A;  3HRT A;  5CVI A;  5BQT A;  1ETY A;  3DU5 A;  5IYB J;  5B66 C;  2BHY A;  1OCR H;  2V1D A;  3H3V K;  5BOX A;  5CPR B;  3WHC A;  3LSR A;  2NXN B;  1JKP C;  1UHW A;  3I3L A;  1YG2 A;  1ZGJ A;  3W3C A;  2Y0M A;  2HQ5 A;  5HLG A;  2KL4 A;  3TO9 A;  4ETS A;  2XVC A;  2M5W A;  3RCO A;  1IRG A;  5DEQ A;  3PJR A;  5K5Q A;  1HKQ A;  5IOZ A;  3QPH A;  3A01 B;  4IHY A;  2FML A;  2H94 A;  4MFD A;  5AON A;  4YEL A;  4RA2 A;  4XL9 A;  4UVC A;  4B09 A;  2VBY A;  4EM0 B;  2E35 A;  3OS1 A;  2M9H A;  3SZP A;  3E1S A;  5J4V A;  2CQ7 A;  5LRR A;  4I0B A;  3I4N J;  3KCC A;  1E2X A;  1FT9 A;  3IWZ A;  4V2G A;  3DBR B;  2OCC H;  1YRN B;  3KEQ A;  4B3X A;  1S5L C;  2YR2 A;  4I98 B;  3AL0 B;  4ZDO A;  1IXS B;  2VN2 A;  3TP0 A;  2O3F A;  2CGP A;  4L5I A;  2CW7 A;  2DQR A;  4KN7 X;  3OL3 A;  2UXX A;  3FXL A;  4NC6 A;  4UB8 C;  1YYV A;  4L9N A;  3BG5 A;  2DA5 A;  2I5U A;  4XK4 A;  4IRH A;  3M1E A;  2O61 A;  3SYT A;  2GZW A;  4DYC A;  4F91 B;  2BXZ A;  3RKW A;  1MIJ A;  2DT6 A;  3O6B B;  4BH9 A;  1TL8 A;  3K2Z A;  2ID3 A;  3MWM A;  4M72 A;  3GTJ J;  1ETW A;  2NVQ J;  1D0Z A;  3NQO A;  4JQF A;  1YIO A;  5IP9 J;  4HA8 A;  2RDP A;  4N4O B;  3HOX J;  4EGY A;  2HYG D;  2HDD A;  4PDK A;  1O3Q A;  1B8I A;  2JMW A;  4IHS A;  2E34 A;  2MD5 A;  3KLO A;  4I02 A;  2Y2Z A;  2ZXJ A;  2OPT A;  4MNU A;  3WOD F;  1T2K A;  1V5F A;  2NS0 A;  3SZG A;  3TQN A;  1KU2 A;  2R5Z B;  1ETO A;  5CVU A;  5KAF C;  1XX5 A;  1O7F A;  2CG4 A;  3KZY A;  1LUJ B;  3VB2 A;  5F1R A;  3L2Q A;  2CO5 A;  1EH6 A;  3JRG A;  2PX9 A;  3FK6 A;  3AKZ A;  1F4K A;  2FNP A;  3QAH A;  3BR6 A;  3KP7 A;  4G94 A;  1ZLJ A;  2M7B A;  5C4X J;  1YTY A;  2P6T A;  3WGG A;  2E2I J;  4UUS A;  2DDA A;  4GRI A;  4CH7 A;  5JLW A;  3CJT B;  3VDX A;  3FM3 A;  3S8P A;  5FFZ A;  3MCZ A;  1UST A;  1NG7 A;  2LBF B;  4RB0 A;  4XN0 A;  3V8L A;  2XC7 A;  4XRM A;  5HDG A;  1VFC A;  1T8I A;  3GCM A;  1OMI A;  5TGT A;  3OYL A;  4XLP F;  3JW4 A;  4MIM A;  1SD5 A;  4E6K G;  2Y9Z A;  2RGV A;  4XNF A;  3HOT A;  1MSE C;  3MMY B;  1ZAO A;  2E1M C;  5K5O A;  4AIJ A;  1YFH A;  5M5W J;  2BY3 A;  2F5F A;  4HAM A;  3K4B A;  1FMV A;  3E5Q A;  4L9J A;  4RLF A;  3JTG A;  1JXS A;  1XTA A;  4FAS D;  2A68 F;  4KN4 X;  4IEJ A;  3OS2 A;  1K6Y A;  1ZAR A;  3PUF A;  2EZI A;  2HOS A;  3B6C A;  2DMT A;  4FT8 A;  2M8G X;  1PP8 F;  2W1O A;  2AO9 A;  2EQR A;  3GZ6 A;  4D7N A;  4ENN A;  1BC8 C;  1WJC A;  2E5N A;  3MZY A;  1MSF C;  5F6F A;  4Y15 A;  3AL0 C;  3BR0 A;  5CJ9 A;  1WJD A;  4BY1 J;  1FP1 D;  2VQG A;  3TO7 A;  4P9U A;  3ZP5 A;  2P5V A;  3FXR A;  5F08 A;  5EF6 A;  2VBZ A;  1HKS A;  1RC9 A;  3JAM Z;  2L9R A;  3LSI A;  4FQG A;  2EFP A;  3FM5 A;  2XRL A;  5LRS A;  2HVQ A;  1SD4 A;  2Q0O A;  2XSJ C;  4OIQ F;  4A3I J;  2IA0 A;  2XHK A;  3U1K A;  4OWR B;  3K10 A;  3FXO A;  3REO A;  4E4H A;  4LB6 B;  1YW9 A;  4HF0 A;  1Y56 A;  1TNT A;  4HOB A;  5ICC A;  2Z2S B;  1FC3 A;  4PJJ A;  4DZJ A;  4KNY A;  3O8G A;  2EWN A;  1U2W A;  2EA2 A;  1AHD P;  4U0Y A;  2Y48 A;  3PUB A;  1DUX C;  3M1C A;  3L09 A;  2W57 A;  5C44 J;  3OYK A;  4C3H J;  4KJZ A;  1OFC X;  4HV6 A;  2EK5 A;  1SAU A;  4BE1 A;  1G3S A;  1VQP I;  5BMZ A;  5EGO A;  3VYU B;  4HLY A;  2QM3 A;  1TLH B;  4U0W A;  4L0Y B;  3RQI A;  1XSX A;  2CUF A;  2V4J C;  2NS7 A;  4F52 A;  5EYR A;  2VJ5 A;  2HOE A;  4KMU X;  4I2O A;  3QP5 A;  3BTC A;  3RIR A;  3K69 A;  2V6E A;  1FYM A;  2CFO A;  2L7M P;  1FWZ A;  2WB1 A;  2V7F A;  3J7Z I;  3IKT A;  5E8I A;  4DQ2 A;  2JA2 A;  2EV6 A;  1LPQ A;  5FKN A;  2ELK A;  3FBI B;  3VYR B;  2LH9 A;  3BY6 A;  3TL4 X;  1RIO H;  2HYJ A;  3V7S A;  1IJW C;  4G7O F;  1LFP A;  2KFD A;  1W0U A;  1KGS A;  1D1A A;  2QQA A;  3K4N A;  5D5U B;  1VI0 A;  4E7H A;  5H20 A;  1OCT C;  4XID A;  3E7L A;  2B0L A;  1TC3 C;  3K4K A;  1G3Y A;  3E6C C;  2WAE A;  2CJJ A;  2NOG A;  4CCK A;  5GPA A;  4BQA A;  3CLQ A;  4ESB A;  4OMZ A;  4M3E A;  2ZJR F;  2DA3 A;  5IP6 A;  4HV5 A;  4M6X A;  1RKW A;  2LYC A;  4RGS A;  4A3C J;  5IT9 Z;  5LD2 C;  5E79 C;  2KLO A;  5J1U A;  1AU7 A;  4DJA A;  5D8K B;  2F5D A;  3HTU A;  2X6O A;  3HUG A;  2XRO A;  4ZYA A;  3U21 A;  4HX7 A;  4XLN F;  2PFB A;  1HC8 A;  3KZZ A;  5FFX A;  5ICF A;  3ZQ7 A;  1OKR A;  2BW3 B;  3DTK A;  4YRV A;  2GOX B;  2XUB A;  2L02 A;  3TW6 A;  1WFX A;  3FIW A;  1OCP A;  5E3L A;  1S6L A;  2VC1 A;  5HDN A;  1ETX A;  2CW8 A;  2XGX A;  2QA4 I;  3IKV A;  4WK8 F;  4ZZD A;  5FKK A;  1STZ A;  4LOC A;  3CMA I;  1B9N A;  4B8X A;  4LG0 B;  2QCO A;  3ISP A;  4WXD A;  3TDZ C;  3DPU A;  3GW2 A;  3PSF A;  3EUK L;  3I59 A;  3J81 K;  5ED4 A;  3G2B A;  4FIS A;  2HQR A;  2ZKZ A;  3HSE A;  3BR3 A;  4BNC A;  3KEO A;  4LIU A;  3F22 A;  1T33 A;  2FA5 A;  1EKE A;  3EYY A;  3W6J B;  4XBF A;  5DUI A;  3GFI A;  4MQ9 F;  2XAQ A;  3OIQ A;  2R92 J;  2VPR A;  2ETH A;  2N8G A;  2DQL A;  2VQH A;  3J80 Z;  1IGN A;  2QYO A;  1ETQ A;  5BPI A;  2E60 A;  1I27 A;  2FEZ A;  1XGO A;  1QA6 A;  1W36 D;  2V1U A;  1X3Z B;  4YEJ A;  1ZN2 A;  2DT5 A;  3NRV A;  1BI2 A;  2Y30 A;  3IL2 A;  2F5C A;  2JA5 J;  3K4M A;  2NRA C;  3ECO A;  1R1T A;  3MQ0 A;  1WI3 A;  3ZN1 A;  3EYI A;  1YW7 A;  4II2 A;  2LVS A;  2EZL A;  4B1R A;  2OZ6 A;  4A6D A;  4GGG A;  4ZC3 A;  1IV8 A;  2GA2 A;  1POG A;  5EGO B;  3CD6 I;  1IAW A;  1W7P A;  2HPM A;  3E0J B;  5J40 A;  1H9T A;  1MMN A;  4QLC U;  2WC2 A;  1ZEL A;  3LSM A;  5L3B A;  1YS6 A;  2HPI A;  3F8F A;  4E7L A;  3GTK J;  2QF7 A;  3QYB A;  2IGO A;  1HST A;  2E71 A;  2MLG A;  2QEN A;  4JX4 A;  2ZFU A;  2ZBK A;  3C2H A;  2DBB A;  3HOS A;  4G6D A;  5BNG A;  4G7Z F;  3E5U A;  5JHF A;  4KIS A;  3BG9 A;  1TTY A;  2QLZ A;  4L9T A;  1SFU A;  5FD6 A;  2R7V A;  3JRF A;  2EPF A;  2R7R A;  4CYC B;  4BDY A;  1D5V A;  2RKH A;  1U0J A;  2Z16 A;  1P7J A;  2F5V A;  4S04 A;  3TOB A;  5FLX K;  1E0E A;  4IL6 C;  1A6Q A;  2VAS A;  1ON1 A;  1LVA A;  3MKL A;  4LB5 A;  3LST A;  1IN4 A;  3V4G A;  2FF4 A;  3OSG A;  1QZE A;  4DGW B;  4ESJ A;  4UY8 I;  3J7A Y;  3PNV A;  3CC2 I;  2QKM B;  2HVS A;  1R5I D;  2DLL A;  1L3L A;  3WG7 H;  4RAY A;  2IVM A;  1OYY A;  1XMK A;  3HHG A;  1BI3 A;  1X3U A;  1YI2 I;  1FNN A;  1FX7 A;  4BBS J;  5L3D A;  3JCU C;  3GVA A;  4LLL A;  1QVU A;  3H1C A;  2XDV A;  2FRH A;  4HX4 A;  4RGR A;  3GX4 X;  3P7N A;  2JA6 J;  2ELH A;  2WB1 N;  1BW5 A;  2DT7 B;  1GXQ A;  4CCJ A;  1N78 A;  3E3V A;  1FBS A;  3HUG B;  4NBQ A;  3EQL F;  1X1C A;  5ILU A;  1OIS A;  5ICE A;  1WSU A;  1NK3 P;  2TCT A;  3AG1 H;  1V54 H;  3HM5 A;  1FYL A;  2O5R A;  4PGG A;  1MBE A;  5K1Y A;  4UXN A;  2ZXI A;  1R4N B;  3WTU C;  2K3F A;  5K7H A;  2E5Z A;  5LGU A;  2PJR A;  4A0Z A;  4GYI A;  4ZZL A;  2Q2E B;  2WAD A;  4KA4 A;  2H27 A;  2IS2 A;  2KIU A;  2EB7 A;  5HNH A;  2D5V A;  3VFZ A;  3Q3S A;  5DTD A;  5JFR A;  1FSH A;  4HX8 A;  2E7X A;  4FTH A;  3DLL F;  3BG3 A;  2Y0S A;  5EG0 B;  4CCN A;  3S17 J;  5F0C A;  1Y1V J;  1ZRC A;  3IH4 A;  2WWY A;  3HIF A;  3F23 A;  2L7Z A;  4XRS A;  3ABU A;  1MDM B;  2PMH A;  3OYA A;  2WAQ A;  2IRF G;  3GFJ A;  3HSR A;  3QOP A;  4HNU A;  1TQM A;  3H36 A;  3MD2 A;  1SFX A;  4G8X A;  1PUF A;  2IGM A;  2EV5 A;  4A0Y A;  3QYE A;  4FX0 A;  2EH3 A;  3M8J A;  3FWE A;  4PJN A;  4A5M A;  2NS8 A;  2JJ7 A;  3BTI A;  2VT2 A;  4UV9 A;  5F1J A;  4CA0 A;  4IHW A;  3ABK H;  4IRI A;  4BQO A;  4P1W A;  2E19 A;  2VB6 A;  3ML6 A;  1MJA A;  2LTP A;  3KYC B;  3BJO A;  1JJ8 C;  5J8F A;  3HGY A;  3WTS C;  2XAG A;  1W7P B;  3JRD A;  3CJN A;  1GVJ A;  3H92 A;  4D7M A;  5B1A H;  1ULY A;  5E3O A;  3FXU A;  2CWE A;  3DEE A;  1IF1 A;  4J19 A;  4UHT A;  3ZMU A;  2H8R A;  4GDF A;  3IV5 A;  1ETK A;  1MMS A;  2HQA A;  1MH3 A;  2DJN A;  3ZXS A;  2YUS A;  4AID A;  2R7Q A;  1J75 A;  2LP0 A;  3DTE A;  4CXF A;  2IS4 A;  1X1B A;  3TBI A;  3NEU A;  2CSO A;  4RGU A;  3WTV C;  1N25 A;  4RBO A;  4BJ5 C;  4XM3 A;  2DMU A;  5EDN A;  3QOE A;  1QGP A;  5EEG A;  4QIW N;  4IRG A;  1MH4 A;  3KLN A;  2ZXH A;  3FXQ A;  4UV8 A;  1GLN A;  5K5R A;  5FRM A;  3DU6 A;  2W25 A;  3V7R A;  3DP7 A;  3WTX C;  3HOZ J;  3CCQ I;  2DI3 A;  4G12 A;  5CQG A;  2BE5 F;  1MND A;  4R79 A;  1R5H A;  4LIT A;  3G1M A;  3AG3 H;  1UG2 A;  1P4X A;  3FZV A;  3WGI A;  2F4M B;  1ZG1 A;  1Z21 A;  2HWV A;  2R3S A;  5AIP A;  1Z05 A;  1V55 H;  1VQL I;  1ZQ3 P;  1I6H J;  3AG2 H;  1YE9 A;  2R5Z A;  1Z91 A;  3MZ8 A;  5DCM B;  2AQF A;  3DBH B;  4EM2 A;  5GTH C;  3C2B A;  4B47 A;  3QPT A;  2XAJ A;  4A5N A;  4ITV A;  1UG0 A;  2HQN A;  2XIG A;  4OMY A;  2VL8 A;  3DWL E;  3DF8 A;  3W6V A;  4OAY A;  1SVL A;  1BR4 A;  4J00 A;  2K4J A;  4R8H A;  3BR1 A;  2HI3 A;  3OIO A;  1RR7 A;  1M1E B;  4CUG A;  4ZYE A;  1JJ6 C;  2BZT A;  3S2H J;  2QQB A;  4P5O A;  3JRH A;  4Y52 J;  2RNG A;  2IS6 A;  5DUK A;  1ODD A;  3K2A A;  1ZR2 A;  2FX0 A;  2LBF A;  3HDD A;  1BM9 A;  4QPQ A;  4YG2 F;  3IAS 2;  1BI1 A;  2L0K A;  2YPR A;  3HKZ A;  2NVY J;  4HYE A;  2DOF A;  2QVO A;  1CF7 A;  3FIS A;  2PG4 A;  2QBY B;  2LC2 A;  2B7E A;  1IDZ A;  2VKE A;  4AU7 A;  1MMA A;  1RKT A;  2P4W A;  1BA5 A;  4BHC A;  1ETV A;  1DP7 P;  1KU3 A;  2QSH X;  2VBX A;  4QPO A;  4G6Q A;  5J4Y A;  4LFU A;  1PVE A;  2BOL A;  4XKW A;  2HXO A;  2FMY A;  3ZR8 X;  1A6I A;  3F9K A;  2K27 A;  1NTC A;  3IP4 B;  2KIF A;  1WVR A;  3OYI A;  3ZQF A;  1GXP A;  3Q0W A;  1A31 A;  4I0A A;  5CQE A;  1SFK A;  3GXO A;  2M8E A;  3H0G J;  4CCM A;  2XB5 A;  3HOW J;  4RAF A;  4D1Q A;  1PUF B;  1KZH A;  1W5S A;  3H9Q A;  1G8X A;  2MFZ A;  4ESF A;  4J01 A;  2GM4 A;  4C2M J;  3L1P A;  1J9I A;  3LL7 A;  5FRO A;  3PQK A;  1YW8 A;  1ZTR A;  2XV4 S;  1FZP B;  2X6W A;  2PJP A;  5H6Q A;  2TRT A;  3GZN B;  3F8B A;  1R58 A;  1V4R A;  2E1M B;  3Q0V A;  4PFP A;  1E17 A;  4G6T B;  1SFO J;  3TW7 A;  2EIJ H;  1PYV A;  4BUP A;  2HOA A;  2W85 A;  3NAR A;  3EUA A;  1Z0X A;  2Y0S N;  1XB4 A;  3Q9S A;  1I3Q J;  1HW1 A;  3OR1 C;  1QZY A;  2HS5 A;  3CCS I;  3G6E I;  1W36 C;  1XSD A;  1W1W E;  2JT1 A;  2W84 A;  3DEW A;  3LWF A;  2FBI A;  2IBD A;  5DDG A;  3FMS A;  1R22 A;  2RQP A;  5LGN A;  1X1A A;  4W97 A;  2P7V B;  2WAQ N;  3HRM A;  5HDK A;  1IXC A;  1HOM A;  3QU6 A;  4U7B A;  4AIH A;  2DJI A;  2EA4 A;  1Z3Y A;  3CDH A;  3SFZ A;  3LNQ A;  2XF6 A;  3S1Q J;  1UAA A;  3S15 J;  3GEZ A;  1BIB A;  4MHG A;  2Z9O A;  1GHC A;  2QGU A;  1BIA A;  3GFL A;  1D8K A;  4XSX F;  3B02 A;  3G71 I;  1SC7 A;  2M4K A;  4HQE A;  2WV0 A;  5IYD J;  5J1Y A;  3AG4 H;  1T98 A;  1FOX A;  2ZSH B;  2A3S A;  2QKL B;  3HYI A;  1LFU P;  1P4A A;  2ZFW A;  1YJW I;  2BVL A;  2DK8 A;  3F21 A;  3DCF A;  3KZI C;  1TWF J;  4PJL A;  2A05 A;  1U78 A;  2BGC A;  2G9W A;  3OYN A;  2ID6 A;  1CQT A;  2PBI A;  3BC8 A;  4L9V A;  4OIP F;  1VZ0 A;  3ZN0 A;  5LHG A;  5D5W B;  4E7S A;  3L2R A;  3EPZ A;  4O6J A;  2F48 A;  4LLG F;  1FIP A;  5JR3 A;  3ONQ A;  1R7J A;  3IRQ A;  3S93 A;  1W5C C;  2IW5 A;  2P0W A;  3QU3 A;  2BY2 A;  2K9S A;  2E2J J;  4M71 A;  4PUS A;  1W0T A;  2JUC A;  2OAZ A;  5HLI A;  2DTZ A;  4YFK F;  4KIB A;  1DQU A;  2EFO A;  4D9J A;  5IP7 J;  2IAI A;  2JTV A;  3HXL A;  5GTI C;  1FBU A;  1G6N A;  1VQO I;  2K9N A;  2AXL A;  2V26 A;  3QYF A;  1K61 A;  1FTZ A;  3EUH C;  3CF5 F;  2X6Y A;  1I39 A;  3UNG C;  1AKH A;  1G2H A;  4LIV A;  4ZJZ A;  4S05 A;  1EA3 A;  2NVU B;  2BYV E;  5BPD A;  3MFK A;  2KIM A;  2J5P A;  2A6E F;  2EFW A;  2DYS H;  1PDN C;  4A3K J;  1WJ5 A;  1KYZ A;  3JR9 A;  2VQL A;  1CF7 B;  1ORK A;  3OV8 A;  2BW3 A;  4Y4R A;  1H88 C;  3LSJ A;  3R6S A;  2LDU A;  3F8N A;  2DO7 A;  1JUS A;  2CUZ A;  2M0C A;  5JHU A;  2DTR A;  3KYL A;  3PNT A;  5GAG J;  1D1C A;  4BDZ A;  4ZYH A;  5CVV A;  2VE8 A;  4BE2 A;  4BAY A;  2KHM A;  4V2F A;  3ZOB A;  4Y13 A;  4AVP A;  1T38 A;  4LG0 A;  4ZDP A;  2EV0 A;  2DAO A;  3C2G A;  1QNT A;  3L2C A;  2YX4 A;  2M1B A;  3H9G A;  4LD5 A;  4BJ6 C;  4WX9 A;  3PIO F;  4DNC A;  2MLK A;  4YII A;  3ZQH A;  2DPU A;  1N77 A;  1T0F C;  4H4K C;  4UVA A;  4WF2 A;  1A36 A;  2XAS A;  2WTE A;  3E97 A;  3IC7 A;  4EJU A;  2QSF X;  3CTA A;  3VEP A;  3UKG A;  4M3F A;  4BHP A;  1RI7 A;  4L5J A;  3HKZ N;  4KIT B;  4JX5 A;  1TQP A;  2ICW G;  1R00 A;  1DP3 A;  1UFM A;  2R7O A;  3CP8 A;  1DU6 A;  3RPQ A;  3I56 I;  4E7J A;  4BQQ A;  3BZC A;  1G4D A;  2ECC A;  5D8L B;  2MAB A;  3VSK A;  2XSD C;  2P5L C;  2VXZ A;  1T6S A;  4MFE A;  3OR2 C;  2EJR A;  2QUF A;  4M3B A;  3LQR A;  3K1P A;  4XN3 A;  5F0H A;  2FQ4 A;  3LFU A;  3K7A J;  1GV5 A;  4CCL A;  1TBX A;  4IX7 A;  1LNW A;  3H3Z A;  1DGW Y;  4LK1 F;  3FK7 A;  3TOA A;  4XKV A;  1BI0 A;  3KEY A;  4B48 A;  1O3R A;  2AHQ A;  2EIM H;  3KET A;  3T8T A;  2ME6 A;  1E3H A;  3IH3 A;  5FLM J;  1U5T C;  3GWZ A;  1RR8 C;  1NHA A;  1G3T A;  2FD5 A;  1YIT I;  2O7O A;  2R7S A;  4IOC F;  1K4S A;  4MO7 A;  2HR3 A;  1NH3 A;  5DM7 F;  4C9Y A;  2Q1Z B;  4C2T A;  1WH5 A;  4UNO A;  2M45 A;  2CQQ A;  3GF2 A;  3M4O J;  4CYC A;  2STT A;  1MBF A;  3GZ5 A;  2L7K A;  3MZH A;  5IY5 H;  2H6B A;  4L0Z B;  2O9L A;  2V1X A;  1Y8Q B;  1MMG A;  2CV2 A;  1K6O A;  2E1N A;  3BWG A;  2XAF A;  4JX6 A;  3TMO A;  2QWW A;  4AC0 A;  3I4P A;  3DEU A;  1IO2 A;  2IS1 A;  2R7D A;  3HG9 A;  1T39 A;  1TP4 A;  1Y0N A;  5D5V B;  3JTH A;  3BJA A;  1IXR C;  3Q9V A;  4A2U A;  1AKH B;  4CSW A;  1GUU A;  4FCY A;  1BW6 A;  1P92 A;  2LKP A;  4UVB A;  3GO5 A;  3WHB A;  2VLA A;  1MNM C;  2A07 F;  5IOY A;  2YSR A;  4RMN A;  1HW5 A;  2PN6 A;  4HPQ A;  4BXF A;  2ESN A;  4XLA A;  4EMS A;  4M74 A;  1QZZ A;  4YIR X;  2XF5 A;  2Z1D A;  3LFK A;  2KZG A;  3CLO A;  3DKX A;  1S3J A;  4IHV A;  1KQ0 A;  1HSJ A;  4V19 K;  5FLV A;  1R9T J;  2VC0 A;  3H35 A;  2LOO A;  1VND A;  1Y0U A;  1ITY A;  2A69 F;  3CJR B;  4RAG A;  3OYC A;  2X6X A;  1JT0 A;  1ZRF A;  1SMT A;  1EV7 A;  2H1L A;  5E17 F;  1EH7 A;  1A5J A;  2L01 A;  1FEX A;  2Q2E A;  3KYD B;  3EET A;  3RKQ A;  5D5X B;  3BR2 A;  5HLT A;  1SVM A;  1BN5 A;  3GBG A;  4OIR F;  2K85 A;  3L2W A;  4PZJ A;  3A02 A;  1X19 A;  4A3E J;  1W5T A;  4HLX A;  1N75 A;  1QQI A;  5EG0 A;  4I09 A;  3T8R A;  2FOK A;  1TNS A;  5L3F A;  1YX5 A;  2R7T A;  2CYY A;  2HFH A;  2IPQ X;  1FOW A;  2DXI A;  2HZD A;  1MDM A;  3SFI A;  2OC6 A;  1Z67 A;  3TED A;  1QU3 A;  4KDP A;  2LF8 A;  3FKI J;  5F27 A;  4A3J J;  2ZME B;  4IXA A;  2CUJ A;  1OR7 C;  1R4M B;  3ABM H;  3OSF A;  2DOD A;  2ZSI B;  4A69 C;  5E1W A;  1LDK B;  4JYK A;  2VUM J;  3KPH A;  3D5L A;  3HBL A;  2XKO A;  3GTM J;  1DDN A;  5DV5 A;  1IN8 A;  4CCO A;  1XD7 A;  4XKB A;  3IH2 A;  5C4J J;  5E20 A;  4CDG A;  3VYT B;  1EF4 A;  2M7A A;  1R23 A;  2Z3Y A;  3H5N A;  3PFY A;  3ZMS A;  5H2F C;  2BY1 A;  4QTR A;  1HLV A;  4P9F A;  2EIK H;  2R93 J;  2BV6 A;  3QOD A;  3I0T A;  2OQG A;  2K86 A;  4OU0 A;  2R0Q C;  3QWL A;  3W2W A;  1Z77 A;  3S2D J;  4HBL A;  4BHB A;  2ZO4 A;  4DYR A;  4PK4 A;  1T08 B; 
#chains in the Genus database with same CATH homology
 2B7E A;  2DOE A;  2E71 A;  1UZC A;  2JUC A;  2LKS A;  4FQG A;  2KIQ A;  2DOF A;  2L9V A;  2KFD A;  2KIS A;  2CQN A;  2K85 A;  2DOD A;  2KZG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...