1XD7A

Crystal structure of a putative dna binding protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
116
Chain Sequence
SRLAVAIHILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGASLKKDPADISLLEVYRAVQKNPKCPVGKKIQNALDETFESVQRAMENELASKSLKDVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ywnA
publication title Crystal structure of a putative DNA binding protein
rcsb
source organism Bacillus subtilis subsp. subtilis
total genus 36
structure length 116
sequence length 127
ec nomenclature
pdb deposition date 2004-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xd7A00
1IN5A 3WTZA 5HOOA 3WU1B 4WXCA 5HS8A 4KICA 1UB9A 2VBXA 2DPDA 1DPRA 1CGPA 4ENNA 3ROUA 4MNUA 2G7HA 2JRTA 3DQVC 4YIIA 1X3UA 3P9CA 4UVAA 4HAMA 1ZGAA 4A0XA 2XAFA 3JTGA 5L3CA 3FXRA 1IZ1A 4L9JA 2MLGA 2OBPA 2PLYA 1U5TC 3R61A 2V79A 1R7JA 4M73A 1P4XA 3ULQB 3VFZA 3CUQC 1V4RA 2CSOA 3V7CA 4WXHA 2HOEA 4L9VA 4Y17A 4NB5A 1K78A 1A04A 5E1WA 2OAZA 2Q8KA 5CVIA 4GXOA 3GO5A 2FE3A 3ERED 1VTNC 2MBFA 3DFGA 2FBIA 1D8KA 4IVNA 1UCRA 5HVQC 2VOPA 2CO5A 4Q4ZF 2ESNA 5H20A 2M8EA 1R1UA 1U2WA 5ILUA 2XAGA 4IPAA 2RQPA 3MAJA 4XBFA 2M30A 1STZA 4HQEA 3I5UA 4A2UA 4HV6A 2QYOA 4WX9A 1D3YA 3S2WA 3LAPA 2PBIA 3HRMA 4YFKF 1BC7C 1ZRFA 2NRAC 2EV0A 4MTEA 5BPIA 2P7CB 1USSA 3ECOA 4U88A 4ENKA 2FQ3A 1ZRDA 4OOIA 5TRDA 2L4AA 4G7ZF 3BROA 1EV7A 3BJOA 2H94A 3WTUC 3W6JB 2V9VA 3HSEA 5KK1A 1O3SA 2F2EA 4AIKA 1FY7A 3CDHA 2K27A 1ON1A 3FM5A 1S3JA 3TO7A 4EJWA 2ZXJA 4HDUA 5DCFA 3RIRA 2OD5A 3E3VA 3MZHA 2DFIA 4EMSA 5KVRA 3KETA 5LLQA 3C1DA 3F72A 1GXQA 4WK8F 5E8GA 3LQQA 2VONA 2DPUA 1PDNC 3E5UA 2EV6A 1FOKA 2AS5F 2WC2A 2DW4A 1B9MA 1KU7A 1FZPB 3EDPA 4M72A 3EYIA 2A5YB 2RNJA 1WWXA 1Z6RA 1LQ1A 2LNBA 1HSJA 1I1SA 1SMYF 1YTYA 3BPXA 2PMHA 1TW2A 4B09A 1SAXA 1K6OA 3GFIA 1K7AA 5FD5A 5EEGA 5AIPA 1Z05A 5FGMA 3QP6A 3LWFA 5ILSA 3CUOA 2EFWA 1G3SA 2NNNA 3E97A 2OZUA 4M6YA 3P9KA 3GUDA 3J81K 2WTEA 1P2FA 2XGXA 4UV9A 1TQPA 3F8NA 3ZP5A 3ML6A 2STWA 4BAYA 3GVAA 3K1NA 1XD7A 4P55A 3E6MA 4BQAA 3KCCA 4BNCA 3TOAA 1QZZA 4FX4A 1TNTA 5BOXA 3WGHA 1H9TA 3IKTA 2O61A 4HZFA 2FU4A 3BP8A 1YYVA 1FBUA 3BY6A 2CW0F 3J80Z 5DD8A 2HKOA 2EK5A 1JE8A 1IUYA 3ZMTA 2W25A 4PGHA 3LA3A 1YLFA 2NAZA 2B0LA 4M6XA 4UNOA 2P4WA 4TV7A 1FX7A 3WG9A 5F1RA 2ZBKA 3T5XA 3K1PA 1RUNA 5LEJA 1LEBA 4MQVA 4IF4A 1Z9CA 2VN2A 3WTTC 3SFZA 2EFPA 1XCBA 3JTHA 4P5OA 4F7ZA 4JQFA 1XMKA 1EH6A 3V8JA 5K5QA 2BEOA 1HW5A 3WTVC 3HIFA 4QWQA 4HLXA 2HQNA 3HRTA 4MHGA 1LJ9A 1EH8A 4JK1X 1S7AA 1CF7B 1HQCA 2XVCA 4BHPA 4I2OA 3VOEA 5FFXA 1TBXA 3J7AO 4A6DA 1PP7U 3RYPA 2J5OA 1JGSA 2LF8A 1ODDA 4KUMA 5HLHA 1FYKA 2PEXA 3T8RA 1T6SA 4ZYHA 3M1EA 3FX3A 1TLHB 2YU3A 3VEPA 3V8LA 2L01A 5L3EA 4U0WA 3HSRA 4AVPA 2PI0A 3B02A 1LDJA 2PMUA 1BI2A 5IT9K 2E7XA 2A07F 4HLYA 4HOBA 1SD6A 2Z5UA 1I5ZA 1O3RA 2XUBA 2GZWA 3ZMUA 3RYRA 4WF2A 4FHTA 2LKPA 1LNWA 1Z7UA 3E5QA 2VBZA 1T0FA 4LB5A 2RGVA 4UUVA 5ICGA 4YG2F 5ILVA 2ZMEA 3BPVA 3ABUA 4OMYA 1MKMA 3HTUA 1IN8A 2HKXA 2R7DA 1IXCA 2L3DA 5L3GA 1U5TB 3OOPA 3V8KA 2QWWA 1P6RA 4CHUA 3M9AA 4LLLA 2QVOA 2HYGD 2HZTA 4U0VA 4ESJA 2LSOA 4I0BA 1B59A 3GWZA 4LFUA 2F5CA 3N97A 3DP7A 2DAOA 3KP3A 2GIVA 5D6EA 1MJBA 2G7UA 2RKHA 3FZVA 1KA8A 4A6EA 4S05A 1XGNA 3K1MA 3GFLA 1QPMA 2FEZA 3K9TA 1BC8C 2ZFWA 2ZKZA 1YW8A 2YX7A 1MDMB 5L3FA 3ZN1A 1KGSA 4CO8A 5E1ZB 5EEHA 2ELHA 2UXXA 3ABTA 1IXSB 3F6OA 3I58A 5DCMB 1SFXA 1W5SA 4HQMA 3TO6A 4FX0A 2CYYA 1R1VA 1V3FA 3TOBA 2IRFG 3I71A 5D8LB 3TDZC 5CVUA 4YFNF 4RB2C 3C7JA 3J81Z 4EJUA 4IXAA 4E70A 1YW9A 3DKWA 3JSOA 3HRUA 3KLNA 1WQ2A 1YIOA 2KIUA 1B1BA 2P6SA 1W7PB 2ADUA 1OR7A 1Y0UA 4R1HA 1O3QA 2IP2A 4L9TA 3L2CA 2EA2A 3I59B 2JSCA 4ON0A 1FYMA 1IF1A 5DUKA 3I64A 4LB6B 3H92A 3QU6A 1BM9A 2X4HA 3BWGA 3TQNA 1KYZA 2RDPA 3U9GA 2QQBA 2ZJ2A 2DT5A 3FHZA 4O5VA 3VB2A 3PQKA 3GEZA 1SFEA 1ZLJA 3DV8A 4L9NA 1H9GA 4KIGA 2FOKA 1JXSA 2PJPA 3KP4A 4XLNF 3DF8A 1E2XA 5LGTA 2GAUA 2IT0A 4R8HA 4LD5A 1J9IA 3QAHA 2KRFA 2FA5A 1UFMA 1FLIA 4EM0B 3C3WA 4M71A 1IW7F 1KQ8A 4L18B 4WCGA 4P9UA 3TGNA 4OIRF 4CXFA 2OU2A 3DPTA 1QBJA 1E17A 2XASA 2K7LA 2P5LC 4IRHA 3R60A 5F64A 5DV5A 3ECHA 5LEKA 1ZHFA 1S6LA 2PFBA 3SXYA 1TW3A 1MJAA 1J5YA 3IWZA 3HUGA 1XSVA 2VT3A 1U3EM 3DXJF 3MZYA 2DQLA 2VC1A 3H3ZA 5IT9Z 2VE8A 4I7HA 2Z33A 1HBXG 3LQRA 1C0WA 3KZZA 5E1XA 4GCVA 2DK8A 1G3WA 2M45A 2P5VA 3QRFF 5LRSA 2A68F 4BYYA 4G94A 2F5DA 3GZ5A 1J75A 3GLXA 2A69F 1SFUA 1FBQA 1SMTA 2EFNA 1D5VA 2QQ9A 1ULYA 2QENA 2XAJA 4NHJA 5ERIA 3WU0A 2GWRA 1U6GA 2EV5A 2F5FA 4AIJA 4G6QA 4WXDA 1IXRC 1ZARA 1J0RA 1ZGJA 1XMAA 1MDMA 4AWXB 2MH2A 4G8XA 3ZQ7A 1P92A 4HBLA 4UVBA 3IC7A 4N9IA 4LLNA 1XGSA 3EUHA 3CJNA 4FT8A 3LSTA 3MFKA 3HYIA 2G9WA 4LK1F 2YSRA 5E8IA 3ELKA 2ZNYA 1R36A 1OYWA 5DCMA 4ZYEA 4HX8A 3RPQA 1G3TA 4U0YA 1SD5A 1W7PD 3WTYC 1BBYA 3OV8A 3ZN0A 2Z9OA 3KP7A 1GHCA 4BH9A 4XRFA 2QBYB 2ESHA 2D45A 4RAYA 3CLOA 2VODA 1G4DA 1JHFA 2TDXA 4XLPF 1D8JA 3I53A 1HSTA 2ISYA 3T1BA 5LGUA 1XN7A 2FSWA 4LG0B 2YX4A 2Z99A 3SZPA 4ZH4F 1B9NA 3SHFA 1DUXC 4IRGA 1ZREA 2CGPA 5HDNA 1QO0D 1TQMA 3LFKA 1FBSA 1FP2A 5FFZA 5FD6A 5ICEA 4A5MA 1BI3A 2HQRA 4IJAA 1J59A 2CQKA 3F22A 1DP7P 3WODF 2O03A 1F5TA 2D2WA 1REPC 4OIPF 5CVJA 3CO7C 3Q9SA 1ZN2A 2BE5F 4OIQF 3EYYA 4MQ9F 2HS5A 2QUFA 4CICA 1L3LA 2IW5A 4Q47A 1HKSA 3AAFA 4KMFA 2V1UA 4IHTA 3IHUA 2GXBA 2EJRA 4KN7X 5JFRA 4ESBA 4Y15A 3E6DA 2MH9A 2NS0A 2L54A 2HGCA 5E20A 3F21A 1MGTA 2H09A 2WWYA 1FYLA 2E7WA 1G6NA 4KIBA 1QQIA 1KQ0A 3RKXA 3H3UA 3L9FA 1IRGA 4G6DA 3JSPA 5L3BA 3O2PE 5LBQA 3T8TA 1DDNA 3KP5A 1XDSA 4G9YA 4U7DA 2OA4A 1I6XA 5ICFA 3BJAA 1R5HA 2IPQX 1QGPA 2P8TA 1RIOH 4RGUA 3T0YA 2XROA 2Q2EA 1YG2A 4PZJA 1I1GA 1B6AA 4P96A 1FSEA 3FMSA 5HLGA 5K5OA 2NYXA 2NNYA 4ZYGA 2ETHA 3QU3A 5D5XB 2YPRA 1Z1DA 3RPUA 4GGGA 3O3KA 1RNLA 2L02A 4KFCA 3WTSC 4CGZA 5DUIA 4EV0A 3FMQA 3V7SA 1BJAA 4CZZA 4ZYDA 3L7WA 2KJBA 2KKOA 1HW2A 2VE9A 4CYDA 4DQ2A 2GA2A 2BYVE 3P7NA 3Q5FA 1JHHA 1K78B 3GF2A 4MEXF 5K5RA 5AIQA 1TNSA 1F9NA 4HF0A 2EWNA 2X0LA 5ICCA 5BQTA 2JT1A 1KYWA 3EQLF 1F1ZA 3IKVA 3W6KB 3QPHA 2KIMA 1YO5C 4EGYA 1PUEE 1RUOA 3CUQB 2R7FA 3CO6C 2XKPA 4KDPA 1MD0A 4BHCA 3L09A 4UHTA 3GX4X 3HRSA 3ISPA 2P5KA 1KU9A 4EM2A 2VXZA 2XAQA 3KLOA 1LVAA 1USTA 2DLLA 4EM1A 1Q1HA 3F3XA 5TJJA 1R5GA 2FNPA 3LA2A 5D4SA 2EB7A 2PQ8A 4U7BA 1W5TA 1FPQA 1EH7A 4P9FA 2WV0A 3D0SA 2M1BA 2RVCA 4N0BA 1O3TA 1ZRCA 5DYMA 1ZAOA 1T38A 2FRHA 3B73A 1W4MA 2W24A 4UV8A 2DI3A 4OINF 4ASNA 2HYFA 2L4MA 3FMRA 3RKWA 1XGMA 1YFHA 3Q9VA 1KU3A 2Q0OA 4D0PA 3RJPA 4L0YB 4BXUA 1GXPA 5D4RA 4G7HF 5D5UB 4RB0A 3LA7A 2A6EF 2DTRA 2CFXA 2Y0MA 3G73A 5HS9A 3M8EA 2JPBA 4ENJA 1ZH5A 3JAMK 4I09A 1ZG3A 2V1DA 1SD7A 4A0YA 4LLGF 3FF5A 3TKYA 2H6BA 2QQAA 1B4AA 4OMZA 2UXNA 4HF2A 1CF7A 2XRNA 2IA0A 4LGWA 2DO7A 4PGGA 4OIOF 1LDKB 3J80K 2XAHA 3D5LA 3K69A 5CYVA 4O6JA 2R3SA 2HDCA 4GYIA 4RGSA 1WI9A 4I98B 1ZG1A 3MCZA 3F8FA 5A2QK 3U2RA 3EETA 1OYIA 4M9ZA 1R58A 1R1TA 2LDUA 2CG4A 4HA8A 2W85A 4KMUX 4LMYA 4O3MA 4HW0A 3WTWC 2COMA 3F8CA 4RGRA 3V4GA 3C18A 4G7OF 5FLXK 2MC3A 3BOQA 1AOYA 1OPCA 3GW2A 4DNCA 3WE3A 2EFQA 5DDGA 3ZPLA 4R79A 4RAZA 1T98A 2Y75A 3G3ZA 2OQGA 4EGZA 2VBYA 3I4PA 2K4BA 1G3YA 2IVMA 1O7LA 2K86A 5JHUA 1NHAA 1IN7A 1XCVA 5CVRA 2HWVA 4L5JA 1U5TA 4XSZF 4KIFA 3ZMZA 1IN6A 4IRIA 3PQJA 1L0OC 1J2XA 1YS6A 4HV5A 1XSDA 3HSFA 5BPDA 3CUQA 4UVCA 4YIFA 4HF1A 5L3DA 1BN5A 2XHKA 4H0EA 2O8XA 1FT9A 5D5WB 2QLZA 2HFHA 1WKMA 4KT5C 1FNNA 3HHGA 2VT2A 2W84A 4EJTA 2O6GE 3IRRA 3R0JA 3P9IA 1Z6TA 3GFMA 4I0AA 1BIBA 2H27A 1UHMA 5ED4A 4AD9A 4ESFA 1PP8F 4RS8A 1R23A 2K4JA 3N4MA 4QLCU 2GA1A 3RI4A 1P4WA 5CJ9A 1RI7A 3I0TA 4A12A 4RGXA 5CVVA 3FXQA 4YFXF 3WGIA 2BGCA 1QNTA 1IN4A 2MLKA 3REOA 1LEAA 5LRRA 2CWEA 3NEUA 3R6SA 3QP5A 3NRVA 3KE2A 2A6HF 2E1NA 1FC3A 1BIAA 2ZMEB 2VC0A 1WSUA 1P4AA 3COAC 4I01A 5DD4A 3NQOA 4S04A 2E1CA 4M9SA 2FBHA 4EJVA 1W7PA 4K2EA 2FNAA 2MA3A 3HOTA 1FSHA 3MQ0A 4RB1A 5D5VB 2DBBA 1TQIA 4NQWA 5FO5A 3V7RA 2D1VA 3O6BB 1RZ4A 3I59A 3F23A 5D8KB 4Y13A 1BI0A 3GXOA 2MD5A 5AONA 1Z91A 2ACJA 1H0MA 3KP6A 4LK0F 1MJ9A 3WTXC 1T2KA 3E5XA 4GO1A 3BZ6A 1KU2A 1O57A 2KIFA 1OYYA 3JAMZ 5FB2A 5CLSA 4I02A 2FF4A 2DK5A 2A61A 2Y48A 3DPLC 3I54A 2XKOA 1ONVA 2HEOA 3HTSB 1WRJA 1ZLKA 4A0ZA 1TTYA 1FWZA 2IA2A 2C6YA 3KZYA 2PG4A 3BJ6A 2K02A 1XSXA 3IL2A 3GYHX 2UZKA 4M9XA 3GFJA 4XSXF 2JTVA 1FP1D 4PCQA 5LHIA 4KNYA 5A2QZ 2F5EA 5H6QA 2W57A 2D1HA 2YR2A 4EVIA 3BDDA 1K79A 5HS7A 4ENMA 5E17F 2DQRA 2FXAA 2BBYA 2QM3A 2EA4A 2IJLA 1UHWA 4Q5SF 1I27A 1YW7A 4OU0A 5FLXZ 3E6BA 3ZMVA 2JPCA 4KA4A 3RKYA 1S8NA 2BV6A 4KN4X 3SZTA 1ON2A 3KEOA 1DPUA 5JVTA 1U78A 3HHHA 4Z2YA 1SD4A 1HKQA 2EFOA 2RV8A 2Z3YA 5HLIA 4B8XA 5LHGA 3DEUA 2FMLA 3E6CC 5BS6A 1KQ9A 5BMZA 4L5IA 3R4KA 3RDIA 2O3FA 3F6VA 4AIHA 2M87A 2GQQA 4GYGA 3ZMSA 5LGNA 5HDKA 4M74A 1HKTA 1YQAA 3TO9A 2QZ8A 4UXNA 2LF7A 2J5PA 5H6RA 4IHSA 2P6TA 1U8RA 1LDDA 5E18F 1R22A 2GXGA 2O0YA 3K0LA 4PDKA 4HYEA 1OKRA 2V1XA 4CDGA 1MZBA 4EQQA 1IRFA 4A5NA 5F6FA 4WWCA 4MEYF 3M8FA 1ZYRF 3IWFA 2ZCWA 4KYWA 2JZYA 2PN6A 4HDVA 2HTJA 4RB3C 3KEQA 1XGOA 2QBYA 5LHHA 2HTSA 4MGRA 5D6FA 3VODA 1T39A 5K1YA 4JBAA 3ZMDA 2XIGA 5J8CA 2AXLA 4N9HA 2M5WA 1IAWA 1XB4A 2VBWA 3HOSA 1XDUA 2IA1A 2ZNZA 4LG0A 2STTA 3MEXA 5J6XA 5JI6A 2XV4S 1GVJA 1YS7A 1R00A 5DEQA 1AWCA 4EJOA 4MTDA 1LB2A 3FWEA 3M7GA 4ZZLA 4ETSA 1BOAA 2HR3A 2OZ6A 2ISZA 2FBKA 3WE2A 5J8FA 3QOPA 3R0AA 3WGGA 4ZZDA 2ZO4A 2RN7A 3TDUC 3F8BA 3MWMA 1ZG5A 1F4KA 3QPTA 2P7VB 1HXDA 3U1DA 4HX4A 3PFIA 3KFWX 4LJZF 4Q48A 4L0ZB 1S29A 2VOOA 3IRQA 2A3SA 2H6CA 2UWMA 2DU9A 2RC4A 2KJCA 3LAJA 5IT3A 3CTAA 3SQNA 4BHBA 3F8MA 3KP2A 5JR3A 1QZYA 3K2ZA 1O7FA 6PAXA 1J7KA 1OMIA 5HDGA 3FM3A 3RTRA 3GZ6A 2V6CA 3JW4A 1S7OA 3FXUA 4HX7A 3L00A 2FMYA 1BI1A 2OQRA 1HW1A
chains in the Genus database with same CATH superfamily
2XF7A 3SZGA 3VSKA 1IN5A 3WTZA 5HOOA 3WU1B 2BVLA 4WXCA 2LD5A 3OYNA 1ERDA 1R9TJ 5HS8A 4KICA 1UB9A 1FOXA 2DMUA 2VBXA 2E35A 3AG4H 2DPDA 1DPRA 2VB6A 1Y0NA 1CGPA 1ETXA 2LC2A 2QSHX 4ENNA 3ROUA 4MNUA 2E5ZA 2VQHA 2G7HA 2OTJI 2JRTA 4QSHA 3DQVC 2HVSA 4YIIA 1MMAA 1X3UA 2MC4A 2WV1A 2KZGA 4JP0A 3P9CA 4UVAA 3HEFA 4HAMA 3CC4I 4F55A 2WA0A 4IHYA 2X1DA 4B48A 1ZGAA 1W1WE 4A0XA 4E7ZA 1N77A 2XAFA 4E7JA 3JTGA 2ECBA 3NWTA 3B6AA 5L3CA 1RR8C 3JRAA 3FXRA 3FK7A 3G1MA 1IZ1A 5M5WJ 4L9JA 2MLGA 4DOZA 5CQEA 2OBPA 2PLYA 1LE8B 1U5TC 3R61A 2H1LA 2V79A 1R7JA 5IYCJ 4M73A 5EG0A 1MBGA 1OLTA 4PFOA 1P4XA 3AL0C 1VNDA 3ULQB 4HRIA 3VFZA 3RZOJ 3SEQA 3CUQC 1V4RA 2CSOA 3ZQCA 3V7CA 2Z1DA 3SFIA 4WXHA 2HOEA 1YHQI 4C2TA 4BXXJ 2IEKA 2MGQA 2RREA 4L9VA 2MSYA 4Y17A 2JK3A 4NB5A 1E0EA 1K78A 3HKZN 1A04A 5E1WA 1AKHA 2OAZA 2Q8KA 5CVIA 4CCOA 3K4CA 3W2AA 1UHSA 2EZKA 3W2WA 4GXOA 3GO5A 2FE3A 3ERED 4GDFA 1VTNC 2QEXI 1S72I 2MBFA 1BW5A 3DFGA 5EZGA 4M3EA 2FBIA 4XNFA 1ACIA 3CCEI 1D8KA 1BL0A 4IVNA 3IP4B 1PUFA 1UCRA 3J7ZI 5HVQC 2VOPA 5M3MJ 4E4HA 2CO5A 2ELKA 4CCKA 4Q4ZF 4AU7A 2DFHA 2ESNA 5H20A 2M8EA 1BJZA 1R1UA 1U2WA 5ILUA 2XAGA 1Z67A 2OUMA 3CDIA 4FTHA 3A2KA 4IPAA 2RQPA 3OYMA 3A0BC 3MAJA 3OIQA 4XBFA 1BR1A 4C2UA 3CF5F 2M30A 2E5NA 1STZA 4HG2A 4HQEA 3UKGA 4XRSA 3I5UA 4A2UA 4HV6A 1R4NB 3E1SA 2QYOA 4WX9A 2BY2A 1D3YA 4RA2A 2ME6A 1GUUA 3S2WA 4DYQA 1EJ9A 3LAPA 2PBIA 3HRMA 4YFKF 1BC7C 1ZRFA 2NRAC 1E3OC 2EV0A 2NS8A 4MTEA 3DBRB 5BPIA 4BE1A 4EEFG 1YX3A 2P7CB 1DGRM 1LFBA 1USSA 1SVOA 3PIOF 3FBIB 3ECOA 3KYDB 4U88A 3RCOA 4ENKA 2W1OA 2FQ3A 2AO9A 4OOIA 1ZRDA 4XKCA 4XL9A 4XICA 4BE2A 5TRDA 2L4AA 5LFAA 4G7ZF 3IH4A 2VKHA 3CCRI 2OCEA 3BROA 1OJLA 1EV7A 1NTCA 4J00A 1VZ0A 3BJOA 2H94A 3WTUC 3W6JB 3CCLI 4B43A 3ZGKA 1K6YA 2V9VA 3HSEA 5KK1A 5KNLA 1O3SA 2F2EA 2Y9ZA 3ASOH 4AIKA 4MLOA 1FY7A 2QKMB 1TWFJ 3CDHA 2K27A 3H5AA 1MBFA 2IGOA 3K4JA 1JUMA 1ZR4A 1ON1A 3FM5A 3FXMA 1S3JA 3TO7A 4EJWA 3CD6I 2ZXJA 5DCFA 4HSTA 3VDXA 4HDUA 3RIRA 2H8WA 2OD5A 1MH4A 3E3VA 3G1OA 5E3LA 3MZHA 2DFIA 4UB6C 4EMSA 5FJ8J 4BACA 5KVRA 3H9GA 3KETA 2EZIA 5LLQA 2A5WA 3M3YJ 1JUPA 1B72B 3TL4X 3C1DA 3F72A 1GXQA 4WK8F 5E8GA 3LQQA 3HPGA 1QPIA 2VONA 2DPUA 3BG7A 1HLVA 4XONA 1PDNC 2CQQA 3E5UA 3A01B 2EV6A 1FOKA 3QYBA 2CW7A 1R5ID 2AS5F 4D7NA 4BEHA 2WC2A 4RMNA 3I56I 2DW4A 1B9MA 3VSLA 2R7OA 1KU7A 1ZKGA 1FZPB 3BTIA 3EDPA 1T33A 2ZSHB 4M72A 1X3ZB 1OCZH 3EYIA 2A5YB 4A3GJ 2RNJA 3L2QA 1WWXA 5DS9A 4QPQA 2RAEA 2PJRB 1Z6RA 3Q3SA 1Z0XA 1LQ1A 2I5UA 2LNBA 1HSJA 1I1SA 1MH3A 1SMYF 3ZXSA 1YTYA 3BPXA 2R7XA 2PMHA 1TW2A 2GOMA 4B09A 1SAXA 1K6OA 3GFIA 1K7AA 1N75A 5FD5A 1HF0A 2XDVA 4XMYA 5JLWA 2XGEA 2M0CA 5AIPA 1Z05A 5EEGA 1MBJA 5FGMA 2W4SA 3QP6A 3GZNB 5M5XJ 3LWFA 2GXAA 1UZCA 5ILSA 3CUOA 2FX0A 3N05A 2EFWA 1G3SA 2NNNA 2KP6A 2LY1A 3H0DA 3E97A 5HLTA 2IGNA 2OZUA 4M6YA 3P9KA 5IP7J 3GUDA 5EGOB 3CMAI 4ZTFA 3J81K 2WTEA 1P2FA 1X58A 2O7OA 2IGKA 2XGXA 1XS9A 4UV9A 1SVLA 1TQPA 3F8NA 5F08A 3ZP5A 3S16J 3ML6A 2STWA 3F0CA 3L1PA 3QYFA 3KZIC 1U0JA 4BAYA 1GVDA 3GVAA 3K1NA 2R7UA 1XD7A 4ABZA 3U1KA 5GTHC 4P55A 2XF6A 2R4GA 3FHNA 1I50J 3E6MA 4BQAA 2OPTA 3CCYA 3KCCA 3B6CA 4BNCA 3TOAA 1QZZA 3PO2J 4FX4A 1TNTA 5BOXA 3WGHA 1WJ5A 3CESA 1H9TA 1WGXA 3IKTA 2O61A 4HZFA 4ZJZA 2FU4A 3BP8A 1YYVA 1FBUA 3BY6A 2Z16A 1VFCA 2CW0F 2E1MC 3J80Z 2QF7A 2XRLA 5DD8A 4C3IJ 2DYRH 2HKOA 2EK5A 1TZLA 3OR1C 5HODA 1JE8A 1IUYA 3ZMTA 1OISA 2W25A 1YIJI 1D5YA 4PGHA 3OYJA 3LA3A 1YLFA 2NAZA 2B0LA 4M6XA 4UNOA 3O8HA 1X19A 2P4WA 4TV7A 1FX7A 1MMDA 3WG9A 4CSWA 2ZBKA 5F1RA 3T5XA 3K1PA 3SDGA 2E1OA 3G4SI 1RUNA 3S2HJ 5LEJA 2DDAA 2M34A 1MSFC 1LEBA 4MQVA 4IF4A 1Z9CA 3H3VK 3KYCB 2VN2A 3WTTC 4RLFA 2OC6A 2LFBA 3SFZA 1HDDC 2EFPA 1XCBA 4JOMA 2VKVA 3JTHA 4P5OA 1Y6IA 3E0JB 4NUBA 4F7ZA 2DTZA 2VJ5A 4ANJA 4BBSJ 4JQFA 1XMKA 4RAFA 1EH6A 4Y4RA 3V8JA 3DU6A 5K5QA 4B47A 2KT0A 1WCMJ 2DYSH 2BEOA 4D7MA 1YJNI 1VQOI 2DOFA 1HW5A 1IO2A 2KHMA 3WTVC 3HIFA 4QTRA 2L9NA 4HLXA 4QWQA 2HQNA 3HRTA 4MHGA 4BJ6C 2IS1A 1I3AA 4IOCF 3OWTA 1FJLA 2W7NA 1LJ9A 2BHYA 1EH8A 4JK1X 2JRMA 3M07A 1S7AA 1CF7B 1HQCA 2XVCA 4BHPA 2E60A 2M2EA 1T56A 3BR2A 4I2OA 3VOEA 1KONA 1V5FA 2CU7A 2ZJRF 5FFXA 2K3PA 1TBXA 3J7AO 4A6DA 2BXYA 3ABKH 1PP7U 2Y31A 2J5OA 3RYPA 1A36A 3OYCA 1R4MB 1JGSA 2LF8A 1SANA 1ODDA 4KUMA 5HLHA 1T0FC 1FYKA 2PEXA 3T8RA 1T6SA 4ZYHA 3M1EA 3FX3A 1TLHB 2YU3A 1GDTA 3VEPA 3V8LA 2L01A 5L3EA 4U0WA 4BY1J 2VJ4A 3PJRA 3HSRA 4AVPA 1PJRA 2PI0A 1FOYA 3B02A 1LDJA 2PMUA 1BI2A 5IT9K 2FJ1A 2E7XA 5IP6A 3BTJA 4RBOA 4LOCA 2A07F 4Y52J 1W36D 3VPRA 2JJ7A 4OWRB 4HLYA 4HOBA 3H9JA 1SD6A 2Z5UA 4RM3A 1I5ZA 1O3RA 2XUBA 4AYBA 2GZWA 1H89C 5FRNA 3ZMUA 3RYRA 4WF2A 4FHTA 2LKPA 1LNWA 2R7RA 1Z7UA 4AUXA 3E5QA 4BXFA 2VBZA 1T0FA 4LB5A 2RGVA 4B1RA 4UUVA 2VQGA 5ICGA 4YG2F 5ILVA 1A5JA 3ZQHA 2ZMEA 3BPVA 3ABUA 2JSPA 1ETKA 3WG7H 4OMYA 1MKMA 3HTUA 3FXKA 1IN8A 2E2JJ 2HKXA 2R7DA 1IXCA 2L3DA 3DPUA 2LK2A 5L3GA 3MKLA 1U5TB 3LSMA 3OOPA 3V8KA 2QWWA 1D1CA 1P6RA 4JX5A 3M9AA 4LLLA 4CHUA 2V7FA 3BG5A 2QVOA 5HNFA 3BR5A 2HYGD 2HZTA 4NBQA 4U0VA 3OYBA 4ESJA 3AL0B 3IAS2 2LSOA 3C2BA 1XMXA 1B59A 4I0BA 5M5YJ 3GWZA 2PJRA 4LFUA 5CPRB 2HDWA 2F5CA 4E7IA 3N97A 1Z3XA 4U87A 3TMOA 2IXSA 2DA7A 3WHCA 3DP7A 4C30A 2DAOA 4X6AJ 3KP3A 1PYVA 2GIVA 5D6EA 1MJBA 4CCNA 2G7UA 2RKHA 3FZVA 3UR3C 1KA8A 4A6EA 2JVGA 4S05A 1HDPA 1XGNA 4F52A 2NVXJ 3K1MA 1VQ4I 3GFLA 1QPMA 2FEZA 3OR2C 4E7HA 3ZQGA 3RQ4A 2GOXB 2XC7A 3K9TA 1BC8C 1YJWI 1EF4A 2ZFWA 1TWAJ 2ZKZA 3ASNH 1YW8A 3L2VA 2YX7A 5J4YA 1MDMB 3DCFA 5L3FA 3GMEA 2F5VA 4IQ4A 3ZN1A 5IOZA 3LNQA 1KGSA 4CO8A 1WI3A 5E1ZB 5EEHA 1SVMA 1XG1A 2ELHA 2UXXA 5EYRA 1VQNI 3ABTA 3QPSA 5J40A 1IXSB 2HYJA 2COBA 3F6OA 2DCEA 3I58A 3KPHA 5DCMB 1SFXA 1W5SA 4HQMA 3TO6A 1IG7A 4FX0A 2CYYA 2W48A 2MG4A 2OCCH 1R1VA 1V3FA 1B8IB 1ETYA 3L2UA 2XB5A 3TOBA 4PJJA 2Y0SA 4RLQA 2IRFG 3I71A 5D8LB 3TDZC 5CVUA 1OFCX 2EIMH 4Y33A 4YFNF 4RB2C 3C7JA 3J81Z 5K7HA 4EJUA 3LSKA 4IXAA 4E70A 1YW9A 1UG0A 2B63J 2NVYJ 3PNVA 4HNTA 3DKWA 1APLC 3A0HC 1A6QA 3LSJA 1AU7A 3JSOA 2D5VA 2BY0A 3HRUA 3KLNA 3HG9A 1D1BA 1WQ2A 1YIOA 1YJ9I 2KIUA 2QKLB 1JKQC 3UNGC 2QQ8A 4FASD 2GIZA 1B1BA 2P6SA 3DKXA 1LVKA 1W7PB 2ADUA 1OR7A 3HGYA 2DA3A 1Y0UA 4R1HA 1O3QA 1V5EA 1UAAA 1XX5A 3ABMH 1ZR2A 2IP2A 4L9TA 3L2CA 3VWBA 4ZYAA 2EA2A 3I59B 2JSCA 1V55H 2CRGA 2V26A 4ON0A 1FYMA 1IF1A 5DUKA 3I64A 3AG1H 4LB6B 5BNGA 4CYCA 3H92A 1YRNB 2XSJC 3QU6A 3W3CA 2FUG2 3DEEA 1BM9A 5FKOA 2X4HA 3BWGA 3H35A 3TQNA 1KYZA 2RDPA 3U9GA 3GTMJ 1DGWY 2QQBA 2ZJ2A 1FMVA 2DT5A 3FHZA 4O5VA 4JYKA 3VB2A 3PQKA 3FDYA 4PJ0C 3GEZA 1SFEA 1ZLJA 3ZQQA 3DV8A 4L9NA 4V2FA 2K9QA 2KMUA 3S1MJ 1H9GA 4KIGA 2FOKA 1JXSA 1K61A 2PJPA 4BQOA 5F0CA 3MN2A 3BTCA 3KP4A 4XLNF 3DF8A 1E2XA 5LGTA 2MFZA 1Y1VJ 1ZTRA 2GAUA 4R8HA 2IT0A 1WJAA 1IV8A 4LD5A 5GAHJ 5F0HA 2R5YB 2EINH 1TC3C 1J9IA 3AFHA 1WJEA 3QAHA 2JA6J 2KRFA 2NOGA 2FA5A 5JHFA 1UFMA 1FLIA 4KJZA 4EM0B 2KQRA 1H88C 3C3WA 4M71A 1MNEA 3LFUA 4JX4A 1IW7F 1KQ8A 1X1DA 4L18B 4WCGA 4XOTA 3TGNA 4P9UA 2HPMA 4OIRF 4CXFA 2OU2A 3DPTA 1YITI 4A3IJ 1QBJA 4YRVA 4XLCA 1LFPA 4GFBA 2JA5J 1E17A 5IY5H 2R0QC 2XASA 1IRXA 2K7LA 2P5LC 4IRHA 2Y2ZA 4CCJA 3BR6A 3R60A 5KAFC 5F64A 3GTLJ 2AHQA 2IAIA 4NDLA 5DV5A 3ECHA 1OCOH 5LEKA 1ZHFA 1S6LA 2K3FA 2VJJA 2V6EA 1QA6A 2PFBA 3RSNA 3SXYA 3BQZA 1S5LC 1TW3A 2HZDA 1MJAA 3SJMA 1J5YA 3IWZA 3HUGA 1XSVA 2VT3A 1U3EM 4MO7A 5IYDJ 3DXJF 2GBYA 3MZYA 3GBGA 3S14J 2DQLA 2VC1A 5J1RA 4W1UA 4AM3A 1ITYA 3H3ZA 3OYHA 5IT9Z 3G71I 2VE8A 2CW8A 4W97A 1HOMA 4I7HA 2E1MB 2Z33A 4I6ZA 1WJCA 1HBXG 5KHDA 2KPMA 3LQRA 3K7AJ 1C0WA 3KZZA 5E1XA 4G6TB 4GCVA 2KRCA 3QODA 2R7WA 2DK8A 4XLHA 1Z3YA 1JKRC 2BXZA 3PL8A 1G3WA 2M45A 2LOOA 3CCVI 2P5VA 2Q2EB 3CJTB 3QRFF 5LRSA 2A68F 3DBHB 4BYYA 4G94A 2NXNB 2F5DA 3GZ5A 1FTTA 3BR0A 1J75A 3GLXA 2A69F 2LY9A 2R7QA 4BY7J 2BW3B 3JRHA 1SFUA 1FBQA 1SMTA 2EFNA 3PFYA 1D5VA 2QQ9A 1ULYA 1AA7A 2QENA 2R7VA 1DP3A 2XAJA 2WAQN 5ERIA 2W00A 3WU0A 4NHJA 2GWRA 1U6GA 2EV5A 2IBDA 2F5FA 4NNJA 4AIJA 4G6QA 4WXDA 1IXRC 1ZARA 1U9NA 1J0RA 1TT0A 1ZGJA 4FE7A 1XMAA 5B1BH 3RZDJ 3HOZJ 1MDMA 2KZVA 4AWXB 2MH2A 4G8XA 1IJWC 1R71A 3ZQ7A 1P92A 4XLFA 1UMQA 4HBLA 4UVBA 3IC7A 4B3XA 2K9MA 2IS4A 4N9IA 4LLNA 1XGSA 3VYUB 3EUHA 3CJNA 3BG3A 3LSTA 4FT8A 2HXOA 3MFKA 1S7EA 3HYIA 5GP9A 5B5EC 2WAFA 3I3LA 2G9WA 4LK1F 2YSRA 5E8IA 1IC8A 3ELKA 2NOJB 2ZNYA 1DU6A 1R36A 2VL8A 5E3NA 1RETA 1OYWA 2LH9A 2TRTA 3BTLA 5DCMA 3ONQA 3OYAA 4ZYEA 4HX8A 3RPQA 1G3TA 4U0YA 4A3KJ 1W5CC 2X51A 1SD5A 2UV1A 3CF2A 1W7PD 3WTYC 1K4SA 1OCCH 1BBYA 3OV8A 3CCJI 3ZN0A 2V9KA 4MFDA 5FKNA 2Z9OA 3KP7A 4B3AA 4C3HJ 3DLLF 4BH9A 4DYRA 1GHCA 4XRFA 2QBYB 2ESHA 5GTIC 2CQNA 4RAYA 4A3EJ 2D45A 3HC7A 3CLOA 3IH3A 2P0WA 3EPZA 3P5JA 2VODA 1G4DA 1JHFA 2TDXA 3NARA 2WB1N 4XLPF 1O4XA 4CCLA 1D8JA 3I53A 1LFUP 1HSTA 1Q1VA 3NWSA 1BOBA 2ISYA 3LSHA 1X3WB 3T1BA 5LGUA 3LOCA 2DOAA 1XN7A 2PX9A 1ZK8A 4DBRA 1HA8A 2FSWA 4LG0B 3CCSI 1ORKA 2YX4A 2Z99A 3SZPA 4ZH4F 1B9NA 2TCTA 3SHFA 1DUXC 4IRGA 1ZREA 4XKWA 2DDBA 2CGPA 5HDNA 1POGA 2F4OB 1QO0D 1WZ2A 3PM1A 3LSRA 3D5SC 1TQMA 3E7LA 3LFKA 1FBSA 2VASA 2M4KA 2XGDA 1FP2A 1WJDA 3K10A 5E3MA 1YRNA 1IDYA 1IDZA 5FFZA 5F1JA 1FIPA 5FD6A 5ICEA 2ZJQF 4A5MA 1BI3A 3BG9A 3JRCA 4BL0B 3K70C 2HQRA 3MMYB 4IJAA 1J59A 2BZTA 3JRBA 2CQKA 3F22A 3RKQA 1RRJA 1DP7P 1ZQ3P 3WODF 3M1CA 1N25A 2O03A 1F5TA 2XPUA 2D2WA 1REPC 4OIPF 2VJIA 5CVJA 3Q9SA 1K83J 1ZN2A 3CO7C 2BE5F 2YU9J 4OIQF 2KFDA 3EYYA 1LE8A 2ZSIB 4MQ9F 3HKZA 4BS9A 4CH7A 2HS5A 2QUFA 4CICA 2HVRA 2DOEA 1L3LA 1BW6A 4BKXA 2IW5A 3HZJA 3ZQIA 5GPCA 4RM2A 4Q47A 4BE0A 4DYCA 4NC8A 1HKSA 4J19A 3AAFA 4KMFA 1W0UA 2V1UA 3PUFA 2R5ZB 4IHTA 1YE9A 3IHUA 4YIRX 2FOWA 4FCYA 2QGUA 2GXBA 2R93J 2EJRA 4KN7X 2JVHA 5DTDA 5IPAA 5JFRA 4ESBA 4XORA 4Y15A 2YUSA 3E6DA 2MH9A 4F93B 2NS0A 1N78A 2L54A 2Q1ZB 9ANTA 2HGCA 5E20A 3F21A 1MGTA 2H09A 5JLXA 4GRIA 2WWYA 4E7SA 1VQ5I 3GTJJ 2XB0X 1NK2P 1FYLA 2E7WA 1UJ8A 1G6NA 3BZCA 4KIBA 5J47A 1NK3P 1JKOC 1MW7A 2V1NA 4AIDA 1QQIA 1QVUA 1KQ0A 3BCAA 4UUSB 3RKXA 3H3UA 3JRDA 1MNDA 3L9FA 1IRGA 4G6DA 3TW7A 3CMMA 2HQ5A 1F36A 4DJAA 4XOPA 3TEDA 3JSPA 4HNUA 1DU0A 4NC7A 4ZC3A 5L3BA 3O2PE 1SAUA 5LBQA 1TWHJ 1VI0A 2L7FP 3HM5A 1D0XA 3T8TA 4A3FJ 1DDNA 4OAZA 3LSPA 1QVTA 2HDDA 3KP5A 1XDSA 4G9YA 4U7DA 2QCOA 1ZGWA 1QHGA 2OA4A 4RAGA 1JTXA 4L5EA 1I6XA 2JUCA 5ICFA 3BJAA 1R5HA 2IPQX 3K4BA 2FD5A 3RPUD 5IP9J 2JMWA 1JUSA 1QGPA 2QSFX 2P8TA 1TWGJ 2F4MB 1RIOH 4RGUA 4ZTJA 3BZKA 3GTKJ 3T0YA 2XROA 2Q2EA 3OS0A 2CUEA 4NC6A 1YG2A 1QRYA 4PZJA 1I1GA 1B6AA 3BLYA 3EUAA 4P96A 1FSEA 3FMSA 5HLGA 2ZXIA 2WAEA 5K5OA 1MNMC 2NYXA 4D9JA 2NNYA 1W0TA 5LD2C 4ZYGA 2ETHA 5TGTA 3QU3A 3ZCOA 3AG2H 2ZMEC 3HDDA 4EATA 1YI2I 4A69C 5D5XB 3FBNB 1Z21A 1Z1DA 2YPRA 3RPUA 3BG6A 1D1AA 1FEXA 2AQFA 4GGGA 5FLVA 3O3KA 3OYEA 1RNLA 2L02A 2ZXHA 4KFCA 4BJTA 2M8GX 2JA2A 3WTSC 1G8XA 4CGZA 4LIUA 2P81A 4M3DA 5DUIA 3LL7A 2F4IA 2HXIA 4EV0A 5M3FJ 3FMQA 2DT7B 3V7SA 1BJAA 4CZZA 4ZYDA 3L7WA 2KJBA 2KKOA 1RKTA 1G59A 3HOVJ 2LG4A 1HW2A 2VE9A 2H1KA 4CYDA 4DQ2A 2GA2A 3HOYJ 2BYVE 3P7NA 3I9V2 4IHVA 3Q5FA 5K7ZA 1JHHA 1K78B 3GF2A 4MEXF 1UG2A 3DWLE 5K5RA 1M1EB 3S1RJ 1AKHB 3C2GA 2K9NA 5AIQA 1B72A 2DMPA 1TNSA 3MZ8A 1IUFA 2PMZA 1F9NA 2XAUA 4HF0A 2EWNA 2X0LA 4XK4A 5ICCA 5BQTA 3A01A 4FE4A 2ICWG 3JREA 1PUFB 2JT1A 2DFFA 1KYWA 3CP2A 5FLMJ 4XLEA 2IS6A 3EQLF 1F1ZA 2CQXA 2LKSA 3HPHA 3IKVA 2EZLA 3W6KB 3QPHA 2KIMA 2Y30A 1YO5C 4EGYA 1PUEE 1RUOA 3O8GA 3W6VA 3CUQB 2R7FA 4ZDOA 2VI6A 2L7KA 3CO6C 3H36A 2OTLI 2XKPA 4KDPA 1MD0A 4BHCA 3L09A 4UHTA 3GX4X 3HRSA 3ISPA 3QYEA 1A6IA 2P5KA 2HOTA 1KU9A 4EM2A 2O8KA 4D5CA 2VXZA 3U21A 2E19A 1Y56A 2XAQA 5E3OA 1OQYA 3KLOA 1U8BA 2XF5A 1LVAA 1USTA 2DMNA 4IL6C 2DLLA 2EIJH 1FTZA 4EM1A 1Q1HA 3FKJA 3BT9A 1GV5A 3EUKL 3F3XA 2V9PA 5TJJA 1VQKI 2AQEA 3ZRGA 4F3QA 1R5GA 4BDZA 3CLQA 2FNPA 3LA2A 5D4SA 4C2MJ 2EB7A 1X1PA 1QZEA 2L9RA 2PQ8A 5EDNA 1W5TA 5EGOA 4U7BA 1FPQA 3CMYA 1EH7A 4P9FA 4UY8I 4IO9F 2WV0A 2JWTA 2LKXA 3D0SA 2HU9A 2M1BA 2RVCA 1T08B 4N0BA 1O3TA 3DKYA 1ZRCA 3I4NJ 2LTPA 2AXTC 5DYMA 1RPWA 1ZAOA 1T38A 2FRHA 3B73A 1W4MA 2M9HA 1HCRA 2W24A 2CUFA 4UV8A 2DI3A 4OINF 4ASNA 2HYFA 1OR7C 3BC8A 4BBRJ 2ID3A 2L4MA 3FMRA 3RKWA 1XGMA 3G1LA 1ETOA 1A35A 4II3A 2HQAA 1Y1WJ 3IUOA 3Q0UA 1MMNA 1YFHA 3Q9VA 2M7AA 1KU3A 1ETQA 1RR7A 3CCMI 1P7JA 2Q0OA 4CUGA 4D0PA 3RJPA 1MSEC 1RC9A 1YOVB 3TW6A 2R5ZA 4L0YB 3GTQJ 1V54H 4BXUA 3HGGA 4FISA 1GXPA 5D4RA 2LVSA 3I4MJ 3CJRB 4HEA2 4G7HF 1FIAA 5FKMA 2EBIA 5D5UB 3A03A 4RB0A 4II2A 3LA7A 2A6EF 3H5RA 2DTRA 2CFXA 3V42A 2Y0MA 5B66C 5F0FA 3G73A 4LG3A 2O5RA 5HS9A 1UELB 4A3LJ 4BEHB 2N8GA 3K4NA 3BR3A 3M8EA 1P7IA 4PK4A 2JPBA 1F43A 1MIJA 4ENJA 1U9OA 1ZH5A 1BA5A 3JAMK 3JRFA 4I09A 1ZG3A 3J7YJ 2V1DA 1TWCJ 1Y8RB 4NQWB 1SD7A 2ZXWH 4IKFA 1IRZA 2KDOA 4A0YA 4PUSA 4LLGF 3FF5A 3CZ6A 1I3QJ 3CCUI 3TKYA 1H8AC 4ITVA 4E6KG 3PNYA 4HPQA 1VF9A 2H6BA 2QQAA 5EEAA 1B4AA 3MKZA 3JRIA 4OMZA 4KISA 3VYTB 3CC2I 1RESA 2UXNA 5C3EJ 4HF2A 1CF7A 2XRNA 2IA0A 4LGWA 2DO7A 4PGGA 2HVQA 1I39A 4OIOF 3I55I 1KZHA 3OMYA 1LDKB 3J80K 5FROA 3S1QJ 2XAHA 3K4LA 3M4OJ 3D5LA 1WPKA 1Z7LA 2DJIA 4UB8C 3K69A 2DA1A 3PIPF 3HOUJ 5C4XJ 4UUTA 3K6GA 3FISA 4O6JA 5CYVA 2G0EA 1WVRA 2R3SA 3OYKA 2HDCA 2CS3A 4GYIA 4RGSA 1WI9A 1XTAA 4I98B 1G2HA 2DA5A 1ZG1A 4XRSG 3MCZA 3BQYA 1VQPI 2VLAA 1SC7A 3F8FA 3FXJA 5A2QK 1LPQA 1HC8A 2ECCA 3OL3A 5C44J 3U2RA 1MMGA 4YEJA 3EETA 3OYDA 3DTIA 1OYIA 1PVEA 4A3JJ 4M9ZA 1R58A 3CMEI 3DEWA 1X1AA 1R1TA 4KITB 1A31A 2NS7A 3QPLA 2LDUA 2CG4A 3IV5A 4HA8A 3H9QA 2W85A 4V19K 4KMUX 4PJLA 1TP4A 4LMYA 4O3MA 3OYFA 4KT6A 1IGNA 4HW0A 3WTWC 2E2IJ 2L9VA 3BR1A 2COMA 3F8CA 4RGRA 3V4GA 3C18A 4BQNA 4G7OF 3VYRB 5FLXK 2MC3A 2X85A 3BOQA 1AOYA 1OPCA 2L7ZA 3GW2A 2QA4I 1JT6A 3GLLA 5KAIC 1OCRH 3K4MA 4DNCA 2X48A 2Z2SB 4A3MJ 3IAM2 4ZDLA 5F04A 3WE3A 3OSFA 1OCTC 2ZJPF 4Z6YA 4BU2A 2EFQA 4XM3A 1QHHD 1R6RA 5DDGA 1BR2A 3ZPLA 5EJCA 4R79A 4RAZA 1T98A 2Y75A 3G3ZA 2OQGA 5J4VA 2A6TA 4EGZA 1R49A 2VBYA 3I4PA 2K4BA 1G3YA 2HPIA 2IVMA 5K7FA 3ZQLA 1X2MA 1TT5B 1O7LA 2K86A 3H0GJ 5JHUA 4XLAA 2X1CA 1NHAA 2MABA 3AKZA 1IN7A 1XCVA 5CVRA 3PSFA 3S3MA 2HWVA 3C2HA 4N4OB 4L5JA 1U5TA 4XSZF 4KIFA 3ZMZA 4IHWA 1IN6A 4IRIA 3PQJA 1L0OC 3PSIA 1J2XA 2KRHA 5IOYA 1YS6A 4HV5A 5CKTA 1XSDA 4A3DJ 5GADJ 3SDBA 3HSFA 3SYTA 2VPRA 3M8JA 2VIXA 2CFOA 4XN0A 2RQQA 3CP8A 4XQFA 5BPDA 4LITA 4RDUA 3EUHC 1WH7A 3CUQA 5DM6F 1I6HJ 3CQZJ 4UVCA 3HJEA 4YIFA 4HF1A 1MBHA 3DBLB 5L3DA 1BN5A 5JVGF 2XHKA 2O8XA 4H0EA 1FT9A 5D5WB 2EQRA 2QLZA 2HFHA 3KEYA 1WKMA 4MIMA 4KT5C 3HBLA 1FNNA 2Y9YA 2ZC2A 3HHGA 2VT2A 4XN3A 2W84A 4X0GA 4EJTA 2O6GE 4DZJA 3IRRA 3HB9A 2M0MA 1IV6A 3R0JA 1Z6TA 3P9IA 1JKPC 3GFMA 4I0AA 1BIBA 2WY7Q 2H27A 1UHMA 3OIOA 4AD9A 4ESFA 4QIWN 5ED4A 4CA0A 1PP8F 4RS8A 1R23A 2K4JA 3N4MA 4QLCU 2GA1A 4CZCA 3LMMA 4E7KA 4D5FA 3RI4A 1P4WA 5E79C 3D1NI 3OS2A 5TISC 2K85A 4IZZA 1X1CA 3KX2A 2R92J 2LRDA 5CJ9A 3H5NA 1RI7A 3ERMA 4QPOA 4I76A 3I0TA 4BUPA 4DIQA 4A12A 4RGXA 4YELA 1JI8A 5CVVA 3FXQA 1FMWA 3FIWA 2F6CA 4YFXF 3WGIA 4PFPA 2BGCA 1B8IA 1QNTA 1IN4A 1D0YA 2MLKA 3REOA 2DN0A 2MYSA 1LEAA 2YS9A 2OJED 3VYSB 5KCMA 2CMPA 4BGDA 5LRRA 2CWEA 3NEUA 2CQ7A 2WADA 4FETA 3TBIA 2LREA 3R6SA 3Q0VA 3QP5A 3LSGA 1ENHA 1CQTA 3NRVA 2XGCA 3KE2A 2A6HF 2E1NA 1FC3A 2X6XA 4J01A 3ABLH 1BIAA 2ZMEB 2ZFUA 1YX5A 2VC0A 4V2GA 1WSUA 1P4AA 3COAC 4I01A 3LSIA 2I8DA 1BR4A 5DD4A 1NG6A 4B4CA 3NQOA 4C3JJ 5C4JJ 4AYBN 3PNTA 2WY8Q 3CDLA 5B1AH 4S04A 2LY2A 2E1CA 4LIVA 2BOLA 4M9SA 2FBHA 4EJVA 1W7PA 2LMDA 2Y69H 3JCUC 4K2EA 2FNAA 2VQCA 2LBFB 5GAEJ 2MA3A 3HOTA 1FSHA 2ZB9A 3MQ0A 3W2VA 3DTEA 5D5VB 4RB1A 3S17J 2DBBA 1WJFA 1TQIA 4NQWA 1EA3A 2KL4A 5FO5A 3TP3A 3V7RA 2D1VA 3O6BB 1VQ8I 1RZ4A 3S15J 2PMZN 1XC5A 3QOEA 3BCBA 3I59A 4DGWB 1MMSA 2DXIA 3F23A 5D8KB 4Y13A 3OSGA 1BI0A 3GXOA 3ZOBA 2JQ7A 3S3OA 3S93A 2A05A 2MD5A 2L5QA 5AONA 1Z91A 4DZPA 1GLNA 2ACJA 1H0MA 1WJBA 3KP6A 4D1QA 4LK0F 1EKEA 3WHBA 3MKWB 1MBKA 3IH2A 2B7EA 2HI3A 4A3CJ 4X1EA 1JJ6C 2K9SA 1MJ9A 3WTXC 1T2KA 3E5XA 2FQ4A 3FK6A 4GO1A 3BZ6A 1KU2A 1O57A 2KIFA 2EZHA 4G12A 3GTOJ 1OYYA 3GCMA 3JAMZ 3KIOA 1JJ8C 4XRMA 5FB2A 5CLSA 4I02A 2FF4A 2R5YA 2DK5A 2A61A 3D5RC 2Y48A 1X4PA 3DPLC 2X9DA 3I54A 2XKOA 1ONVA 4DBQA 3ZR8X 2HEOA 3HTSB 3MVPA 1WRJA 3RQIA 2KIQA 2XPWA 1ZLKA 4A0ZA 1TTYA 1ZELA 3K70D 1FWZA 1Z77A 2IA2A 2C6YA 3KZYA 3PUBA 2M4GA 2NVUB 4PJMA 2PG4A 2CJJA 3BJ6A 3HOXJ 2RNGA 2K02A 1XSXA 2R7TA 3IL2A 3GYHX 2UZKA 4M9XA 2B9SA 3OS1A 3GFJA 4XSXF 2JTVA 4IX7A 2BVMA 2DJNA 4F91B 1FP1D 1D0ZA 4PCQA 5LHIA 4AC0A 1X2NA 4KNYA 2KDZA 5A2QZ 2MW8A 2F5EA 1QU3A 5H6QA 3QQAA 3QWLA 2W57A 2D1HA 1NG7A 2YR2A 4BDYA 1E3PA 1VQ7I 2Y0SN 4EVIA 3BDDA 1K79A 2XPVA 5HS7A 4ENMA 5E17F 1LUJB 2DQRA 1VQ6I 3AG3H 4DW6A 2FXAA 4CCMA 2KLOA 2QSGX 2BBYA 1ETWA 2EIKH 2QM3A 3OYIA 2EA4A 2IJLA 1UHWA 3DTKA 4Q5SF 1I27A 1YW7A 4OU0A 5EF6A 3F9KA 5FLXZ 1TL8A 3E6BA 3ZMVA 2JPCA 4KA4A 2V4JC 3RKYA 2W82A 2WAQA 5HNHA 4F92B 2E36A 2E71A 3Q0WA 1S8NA 2BV6A 2CUJA 2ELJA 4CYCB 4KN4X 3SZTA 1ON2A 3KEOA 1T95A 4IEJA 1DPUA 5JVTA 2EILH 3A1YA 3HHHA 1U78A 2CV0A 4Z2YA 1SD4A 4FQGA 2F48A 1HKQA 4PSWA 2EFOA 3X2QH 1ETVA 2GLOA 4A93J 2M3AA 2RV8A 2BW3A 5J3LA 2X6WA 2Z3YA 5HLIA 4B8XA 5LHGA 3DEUA 2FMLA 1SEUA 3E6CC 5BS6A 1KQ9A 5BMZA 4L5IA 1W36C 1AHDP 3ESWB 3R4KA 3RDIA 2O9LA 1FOWA 2O3FA 3F6VA 5FRMA 4AIHA 2M87A 3FXLA 2GQQA 4GYGA 1NH3A 3ZMSA 5LGNA 5HDKA 4M74A 1HKTA 2BHZA 5EG0B 1YQAA 4XKVA 2CV2A 2BY1A 3TO9A 2E2HJ 2QZ8A 1K4TA 3A02A 4UXNA 3FKIJ 2LF7A 2J5PA 3S8PA 3J7AY 5H6RA 4IHSA 5FKLA 2P6TA 1U8RA 1LDDA 5E18F 3WU2C 3OY9A 1R22A 2VXDA 3CJQB 2GXGA 2O0YA 4H4KC 2UUZA 3K0LA 4PDKA 4HYEA 1OKRA 2JA8J 1J09A 2VKDA 2IGMA 2L0KA 2V1XA 3L2WA 2L2OA 4OAYA 4CDGA 1VQ9I 1MZBA 4EQQA 3HL2A 1IRFA 2DODA 4A5NA 2WB1A 5F6FA 4WWCA 1GV2A 4MEYF 3M8FA 4BJ5C 2DA4A 1ZYRF 2EH3A 4N4NB 5IYBJ 3IWFA 2DA6A 2ZCWA 4KYWA 1SFKA 1LKXA 2DT6A 3FXOA 2JZYA 2PN6A 4HDVA 1Y8QB 2HTJA 2MD0A 3HUGB 4RB3C 3KEQA 1XGOA 2CV1A 2HOAA 2QBYA 3PO3J 5LHHA 2HTSA 5FKKA 3GTPJ 4MGRA 5D6FA 2HOSA 2DFEA 2JA7J 3OOUA 2X1EA 3VODA 1T39A 4PSXA 4IOAF 5K1YA 2LLKA 4JBAA 3ZMDA 4HSRA 3OIPA 4IQJA 2XIGA 2K40A 5CQGA 5J8CA 2AXLA 4N9HA 1SFOJ 2K5CA 2M5WA 1IAWA 1P9QC 3HOWJ 3OYGA 1X1BA 1XB4A 5J1UA 2VBWA 3HOSA 1XDUA 2LBFA 4Y3OA 2IA1A 2ZNZA 4LG0A 2CUZA 2STTA 3MEXA 5J6XA 3HXLA 5JI6A 2XV4S 1GVJA 1YS7A 1R00A 2JUGA 4HNVA 5DEQA 3CCQI 2DMTA 2EPFA 2JN6A 3JRGA 1AWCA 4EJOA 4PJNA 5J1YA 4MTDA 3FWEA 1LB2A 3G2BA 1E3HA 1MBEA 2ME0A 2BY3A 2I10A 3M7GA 4B44A 4XIDA 4M3GA 4ZZLA 4IHXA 4ETSA 1WHUA 1BOAA 2HR3A 2L7MP 2XSDC 2H8RA 2OZ6A 3ZQFA 2ID6A 2ISZA 4A3BJ 3A4CA 3S3NA 4E7LA 1DQUA 2FBKA 3WE2A 1WH5A 2LP0A 2X6OA 5J8FA 3QOPA 1OCPA 2NVQJ 5DM7F 4XR6A 4ZDPA 3R0AA 3OL4A 2M7BA 2R7SA 2VQLA 4JX6A 1WFXA 2LYCA 3WGGA 4ZZDA 3MD2A 5GPAA 2ZO4A 3S1NJ 2RN7A 3H1CA 2WBMA 3TDUC 2DMQA 3F8BA 3MWMA 1ZG5A 1XPXA 1F4KA 1JGGA 1V5GA 3K2AA 3S32A 1JTYA 3NAUA 4M3BA 3QPTA 3OYLA 2P7VB 5GAGJ 5B3SH 3L2RA 1HXDA 1S9HA 2OV7A 3CC7I 2LR8A 3U1DA 4HX4A 3PFIA 3KFWX 4LJZF 4Q48A 4L0ZB 1X4OA 1JT0A 4I99C 1RKWA 4C9YA 1S29A 4S0HB 3SEZA 2VOOA 5F27A 2IS2A 4M3FA 3MKYB 1Y39A 2A3SA 3IRQA 2H6CA 1GT0C 4BQQA 3K4KA 2X6YA 2UWMA 2DU9A 1VQMI 2VPLA 2R7ZJ 2RC4A 2KJCA 3G6EI 2L9SA 3LAJA 1VQLI 2K9LA 4AVZA 5IT3A 4P1WA 4Y7NJ 3CTAA 3SQNA 2DA2A 4BHBA 5H2FC 3F8MA 2NVTJ 2E34A 3KP2A 5JR3A 4M6VA 2KISA 3DLAA 4UUSA 1QZYA 3K2ZA 2GM4A 1O7FA 6PAXA 2OF7A 1J7KA 1OMIA 2VUMJ 2VKEA 5HDGA 3S2DJ 3DU5A 4MFEA 1T8IA 2HNHA 3FM3A 3RTRA 3JR9A 3GZ6A 2V6CA 3JW4A 1S7OA 3TP0A 2CH0A 3FXUA 3KYLA 4HX7A 3L00A 5EZHA 4XKBA 2FMYA 1BI1A 2OQRA 1HW1A 3GTGJ
chains in the Genus database with same CATH topology
1IN5A 3WTZA 5HOOA 3WU1B 4WXCA 5HS8A 4KICA 1UB9A 2VBXA 2DPDA 1DPRA 1CGPA 4ENNA 3ROUA 4MNUA 2G7HA 2JRTA 3DQVC 4YIIA 1X3UA 3P9CA 4UVAA 4HAMA 1ZGAA 4A0XA 2XAFA 3JTGA 5L3CA 3FXRA 1IZ1A 4L9JA 2MLGA 2OBPA 2PLYA 1U5TC 3R61A 2V79A 1R7JA 4M73A 1P4XA 3ULQB 3VFZA 3CUQC 1V4RA 2CSOA 3V7CA 4WXHA 2HOEA 4L9VA 4Y17A 4NB5A 1K78A 1A04A 5E1WA 2OAZA 2Q8KA 5CVIA 4GXOA 3GO5A 2FE3A 3ERED 1VTNC 2MBFA 3DFGA 2FBIA 1D8KA 4IVNA 1UCRA 5HVQC 2VOPA 2CO5A 4Q4ZF 2ESNA 5H20A 2M8EA 1R1UA 1U2WA 5ILUA 2XAGA 4IPAA 2RQPA 3MAJA 4XBFA 2M30A 1STZA 4HQEA 3I5UA 4A2UA 4HV6A 2QYOA 4WX9A 1D3YA 3S2WA 3LAPA 2PBIA 3HRMA 4YFKF 1BC7C 1ZRFA 2NRAC 2EV0A 4MTEA 5BPIA 2P7CB 1USSA 3ECOA 4U88A 4ENKA 2FQ3A 1ZRDA 4OOIA 5TRDA 2L4AA 4G7ZF 3BROA 1EV7A 3BJOA 2H94A 3WTUC 3W6JB 2V9VA 3HSEA 5KK1A 1O3SA 2F2EA 4AIKA 1FY7A 3CDHA 2K27A 1ON1A 3FM5A 1S3JA 3TO7A 4EJWA 2ZXJA 4HDUA 5DCFA 3RIRA 2OD5A 3E3VA 3MZHA 2DFIA 4EMSA 5KVRA 3KETA 5LLQA 3C1DA 3F72A 1GXQA 4WK8F 5E8GA 3LQQA 2VONA 2DPUA 1PDNC 3E5UA 2EV6A 1FOKA 2AS5F 2WC2A 2DW4A 1B9MA 1KU7A 1FZPB 3EDPA 4M72A 3EYIA 2A5YB 2RNJA 1WWXA 1Z6RA 1LQ1A 2LNBA 1HSJA 1I1SA 1SMYF 1YTYA 3BPXA 2PMHA 1TW2A 4B09A 1SAXA 1K6OA 3GFIA 1K7AA 5FD5A 5EEGA 5AIPA 1Z05A 5FGMA 3QP6A 3LWFA 5ILSA 3CUOA 2EFWA 1G3SA 2NNNA 3E97A 2OZUA 4M6YA 3P9KA 3GUDA 3J81K 2WTEA 1P2FA 2XGXA 4UV9A 1TQPA 3F8NA 3ZP5A 3ML6A 2STWA 4BAYA 3GVAA 3K1NA 1XD7A 4P55A 3E6MA 4BQAA 3KCCA 4BNCA 3TOAA 1QZZA 4FX4A 1TNTA 5BOXA 3WGHA 1H9TA 3IKTA 2O61A 4HZFA 2FU4A 3BP8A 1YYVA 1FBUA 3BY6A 2CW0F 3J80Z 5DD8A 2HKOA 2EK5A 1JE8A 1IUYA 3ZMTA 2W25A 4PGHA 3LA3A 1YLFA 2NAZA 2B0LA 4M6XA 4UNOA 2P4WA 4TV7A 1FX7A 3WG9A 5F1RA 2ZBKA 3T5XA 3K1PA 1RUNA 5LEJA 1LEBA 4MQVA 4IF4A 1Z9CA 2VN2A 3WTTC 3SFZA 2EFPA 1XCBA 3JTHA 4P5OA 4F7ZA 4JQFA 1XMKA 1EH6A 3V8JA 5K5QA 2BEOA 1HW5A 3WTVC 3HIFA 4QWQA 4HLXA 2HQNA 3HRTA 4MHGA 1LJ9A 1EH8A 4JK1X 1S7AA 1CF7B 1HQCA 2XVCA 4BHPA 4I2OA 3VOEA 5FFXA 1TBXA 3J7AO 4A6DA 1PP7U 3RYPA 2J5OA 1JGSA 2LF8A 1ODDA 4KUMA 5HLHA 1FYKA 2PEXA 3T8RA 1T6SA 4ZYHA 3M1EA 3FX3A 1TLHB 2YU3A 3VEPA 3V8LA 2L01A 5L3EA 4U0WA 3HSRA 4AVPA 2PI0A 3B02A 1LDJA 2PMUA 1BI2A 5IT9K 2E7XA 2A07F 4HLYA 4HOBA 1SD6A 2Z5UA 1I5ZA 1O3RA 2XUBA 2GZWA 3ZMUA 3RYRA 4WF2A 4FHTA 2LKPA 1LNWA 1Z7UA 3E5QA 2VBZA 1T0FA 4LB5A 2RGVA 4UUVA 5ICGA 4YG2F 5ILVA 2ZMEA 3BPVA 3ABUA 4OMYA 1MKMA 3HTUA 1IN8A 2HKXA 2R7DA 1IXCA 2L3DA 5L3GA 1U5TB 3OOPA 3V8KA 2QWWA 1P6RA 4CHUA 3M9AA 4LLLA 2QVOA 2HYGD 2HZTA 4U0VA 4ESJA 2LSOA 4I0BA 1B59A 3GWZA 4LFUA 2F5CA 3N97A 3DP7A 2DAOA 3KP3A 2GIVA 5D6EA 1MJBA 2G7UA 2RKHA 3FZVA 1KA8A 4A6EA 4S05A 1XGNA 3K1MA 3GFLA 1QPMA 2FEZA 3K9TA 1BC8C 2ZFWA 2ZKZA 1YW8A 2YX7A 1MDMB 5L3FA 3ZN1A 1KGSA 4CO8A 5E1ZB 5EEHA 2ELHA 2UXXA 3ABTA 1IXSB 3F6OA 3I58A 5DCMB 1SFXA 1W5SA 4HQMA 3TO6A 4FX0A 2CYYA 1R1VA 1V3FA 3TOBA 2IRFG 3I71A 5D8LB 3TDZC 5CVUA 4YFNF 4RB2C 3C7JA 3J81Z 4EJUA 4IXAA 4E70A 1YW9A 3DKWA 3JSOA 3HRUA 3KLNA 1WQ2A 1YIOA 2KIUA 1B1BA 2P6SA 1W7PB 2ADUA 1OR7A 1Y0UA 4R1HA 1O3QA 2IP2A 4L9TA 3L2CA 2EA2A 3I59B 2JSCA 4ON0A 1FYMA 1IF1A 5DUKA 3I64A 4LB6B 3H92A 3QU6A 1BM9A 2X4HA 3BWGA 3TQNA 1KYZA 2RDPA 3U9GA 2QQBA 2ZJ2A 2DT5A 3FHZA 4O5VA 3VB2A 3PQKA 3GEZA 1SFEA 1ZLJA 3DV8A 4L9NA 1H9GA 4KIGA 2FOKA 1JXSA 2PJPA 3KP4A 4XLNF 3DF8A 1E2XA 5LGTA 2GAUA 2IT0A 4R8HA 4LD5A 1J9IA 3QAHA 2KRFA 2FA5A 1UFMA 1FLIA 4EM0B 3C3WA 4M71A 1IW7F 1KQ8A 4L18B 4WCGA 4P9UA 3TGNA 4OIRF 4CXFA 2OU2A 3DPTA 1QBJA 1E17A 2XASA 2K7LA 2P5LC 4IRHA 3R60A 5F64A 5DV5A 3ECHA 5LEKA 1ZHFA 1S6LA 2PFBA 3SXYA 1TW3A 1MJAA 1J5YA 3IWZA 3HUGA 1XSVA 2VT3A 1U3EM 3DXJF 3MZYA 2DQLA 2VC1A 3H3ZA 5IT9Z 2VE8A 4I7HA 2Z33A 1HBXG 3LQRA 1C0WA 3KZZA 5E1XA 4GCVA 2DK8A 1G3WA 2M45A 2P5VA 3QRFF 5LRSA 2A68F 4BYYA 4G94A 2F5DA 3GZ5A 1J75A 3GLXA 2A69F 1SFUA 1FBQA 1SMTA 2EFNA 1D5VA 2QQ9A 1ULYA 2QENA 2XAJA 4NHJA 5ERIA 3WU0A 2GWRA 1U6GA 2EV5A 2F5FA 4AIJA 4G6QA 4WXDA 1IXRC 1ZARA 1J0RA 1ZGJA 1XMAA 1MDMA 4AWXB 2MH2A 4G8XA 3ZQ7A 1P92A 4HBLA 4UVBA 3IC7A 4N9IA 4LLNA 1XGSA 3EUHA 3CJNA 4FT8A 3LSTA 3MFKA 3HYIA 2G9WA 4LK1F 2YSRA 5E8IA 3ELKA 2ZNYA 1R36A 1OYWA 5DCMA 4ZYEA 4HX8A 3RPQA 1G3TA 4U0YA 1SD5A 1W7PD 3WTYC 1BBYA 3OV8A 3ZN0A 2Z9OA 3KP7A 1GHCA 4BH9A 4XRFA 2QBYB 2ESHA 2D45A 4RAYA 3CLOA 2VODA 1G4DA 1JHFA 2TDXA 4XLPF 1D8JA 3I53A 1HSTA 2ISYA 3T1BA 5LGUA 1XN7A 2FSWA 4LG0B 2YX4A 2Z99A 3SZPA 4ZH4F 1B9NA 3SHFA 1DUXC 4IRGA 1ZREA 2CGPA 5HDNA 1QO0D 1TQMA 3LFKA 1FBSA 1FP2A 5FFZA 5FD6A 5ICEA 4A5MA 1BI3A 2HQRA 4IJAA 1J59A 2CQKA 3F22A 1DP7P 3WODF 2O03A 1F5TA 2D2WA 1REPC 4OIPF 5CVJA 3CO7C 3Q9SA 1ZN2A 2BE5F 4OIQF 3EYYA 4MQ9F 2HS5A 2QUFA 4CICA 1L3LA 2IW5A 4Q47A 1HKSA 3AAFA 4KMFA 2V1UA 4IHTA 3IHUA 2GXBA 2EJRA 4KN7X 5JFRA 4ESBA 4Y15A 3E6DA 2MH9A 2NS0A 2L54A 2HGCA 5E20A 3F21A 1MGTA 2H09A 2WWYA 1FYLA 2E7WA 1G6NA 4KIBA 1QQIA 1KQ0A 3RKXA 3H3UA 3L9FA 1IRGA 4G6DA 3JSPA 5L3BA 3O2PE 5LBQA 3T8TA 1DDNA 3KP5A 1XDSA 4G9YA 4U7DA 2OA4A 1I6XA 5ICFA 3BJAA 1R5HA 2IPQX 1QGPA 2P8TA 1RIOH 4RGUA 3T0YA 2XROA 2Q2EA 1YG2A 4PZJA 1I1GA 1B6AA 4P96A 1FSEA 3FMSA 5HLGA 5K5OA 2NYXA 2NNYA 4ZYGA 2ETHA 3QU3A 5D5XB 2YPRA 1Z1DA 3RPUA 4GGGA 3O3KA 1RNLA 2L02A 4KFCA 3WTSC 4CGZA 5DUIA 4EV0A 3FMQA 3V7SA 1BJAA 4CZZA 4ZYDA 3L7WA 2KJBA 2KKOA 1HW2A 2VE9A 4CYDA 4DQ2A 2GA2A 2BYVE 3P7NA 3Q5FA 1JHHA 1K78B 3GF2A 4MEXF 5K5RA 5AIQA 1TNSA 1F9NA 4HF0A 2EWNA 2X0LA 5ICCA 5BQTA 2JT1A 1KYWA 3EQLF 1F1ZA 3IKVA 3W6KB 3QPHA 2KIMA 1YO5C 4EGYA 1PUEE 1RUOA 3CUQB 2R7FA 3CO6C 2XKPA 4KDPA 1MD0A 4BHCA 3L09A 4UHTA 3GX4X 3HRSA 3ISPA 2P5KA 1KU9A 4EM2A 2VXZA 2XAQA 3KLOA 1LVAA 1USTA 2DLLA 4EM1A 1Q1HA 3F3XA 5TJJA 1R5GA 2FNPA 3LA2A 5D4SA 2EB7A 2PQ8A 4U7BA 1W5TA 1FPQA 1EH7A 4P9FA 2WV0A 3D0SA 2M1BA 2RVCA 4N0BA 1O3TA 1ZRCA 5DYMA 1ZAOA 1T38A 2FRHA 3B73A 1W4MA 2W24A 4UV8A 2DI3A 4OINF 4ASNA 2HYFA 2L4MA 3FMRA 3RKWA 1XGMA 1YFHA 3Q9VA 1KU3A 2Q0OA 4D0PA 3RJPA 4L0YB 4BXUA 1GXPA 5D4RA 4G7HF 5D5UB 4RB0A 3LA7A 2A6EF 2DTRA 2CFXA 2Y0MA 3G73A 5HS9A 3M8EA 2JPBA 4ENJA 1ZH5A 3JAMK 4I09A 1ZG3A 2V1DA 1SD7A 4A0YA 4LLGF 3FF5A 3TKYA 2H6BA 2QQAA 1B4AA 4OMZA 2UXNA 4HF2A 1CF7A 2XRNA 2IA0A 4LGWA 2DO7A 4PGGA 4OIOF 1LDKB 3J80K 2XAHA 3D5LA 3K69A 5CYVA 4O6JA 2R3SA 2HDCA 4GYIA 4RGSA 1WI9A 4I98B 1ZG1A 3MCZA 3F8FA 5A2QK 3U2RA 3EETA 1OYIA 4M9ZA 1R58A 1R1TA 2LDUA 2CG4A 4HA8A 2W85A 4KMUX 4LMYA 4O3MA 4HW0A 3WTWC 2COMA 3F8CA 4RGRA 3V4GA 3C18A 4G7OF 5FLXK 2MC3A 3BOQA 1AOYA 1OPCA 3GW2A 4DNCA 3WE3A 2EFQA 5DDGA 3ZPLA 4R79A 4RAZA 1T98A 2Y75A 3G3ZA 2OQGA 4EGZA 2VBYA 3I4PA 2K4BA 1G3YA 2IVMA 1O7LA 2K86A 5JHUA 1NHAA 1IN7A 1XCVA 5CVRA 2HWVA 4L5JA 1U5TA 4XSZF 4KIFA 3ZMZA 1IN6A 4IRIA 3PQJA 1L0OC 1J2XA 1YS6A 4HV5A 1XSDA 3HSFA 5BPDA 3CUQA 4UVCA 4YIFA 4HF1A 5L3DA 1BN5A 2XHKA 4H0EA 2O8XA 1FT9A 5D5WB 2QLZA 2HFHA 1WKMA 4KT5C 1FNNA 3HHGA 2VT2A 2W84A 4EJTA 2O6GE 3IRRA 3R0JA 3P9IA 1Z6TA 3GFMA 4I0AA 1BIBA 2H27A 1UHMA 5ED4A 4AD9A 4ESFA 1PP8F 4RS8A 1R23A 2K4JA 3N4MA 4QLCU 2GA1A 3RI4A 1P4WA 5CJ9A 1RI7A 3I0TA 4A12A 4RGXA 5CVVA 3FXQA 4YFXF 3WGIA 2BGCA 1QNTA 1IN4A 2MLKA 3REOA 1LEAA 5LRRA 2CWEA 3NEUA 3R6SA 3QP5A 3NRVA 3KE2A 2A6HF 2E1NA 1FC3A 1BIAA 2ZMEB 2VC0A 1WSUA 1P4AA 3COAC 4I01A 5DD4A 3NQOA 4S04A 2E1CA 4M9SA 2FBHA 4EJVA 1W7PA 4K2EA 2FNAA 2MA3A 3HOTA 1FSHA 3MQ0A 4RB1A 5D5VB 2DBBA 1TQIA 4NQWA 5FO5A 3V7RA 2D1VA 3O6BB 1RZ4A 3I59A 3F23A 5D8KB 4Y13A 1BI0A 3GXOA 2MD5A 5AONA 1Z91A 2ACJA 1H0MA 3KP6A 4LK0F 1MJ9A 3WTXC 1T2KA 3E5XA 4GO1A 3BZ6A 1KU2A 1O57A 2KIFA 1OYYA 3JAMZ 5FB2A 5CLSA 4I02A 2FF4A 2DK5A 2A61A 2Y48A 3DPLC 3I54A 2XKOA 1ONVA 2HEOA 3HTSB 1WRJA 1ZLKA 4A0ZA 1TTYA 1FWZA 2IA2A 2C6YA 3KZYA 2PG4A 3BJ6A 2K02A 1XSXA 3IL2A 3GYHX 2UZKA 4M9XA 3GFJA 4XSXF 2JTVA 1FP1D 4PCQA 5LHIA 4KNYA 5A2QZ 2F5EA 5H6QA 2W57A 2D1HA 2YR2A 4EVIA 3BDDA 1K79A 5HS7A 4ENMA 5E17F 2DQRA 2FXAA 2BBYA 2QM3A 2EA4A 2IJLA 1UHWA 4Q5SF 1I27A 1YW7A 4OU0A 5FLXZ 3E6BA 3ZMVA 2JPCA 4KA4A 3RKYA 1S8NA 2BV6A 4KN4X 3SZTA 1ON2A 3KEOA 1DPUA 5JVTA 1U78A 3HHHA 4Z2YA 1SD4A 1HKQA 2EFOA 2RV8A 2Z3YA 5HLIA 4B8XA 5LHGA 3DEUA 2FMLA 3E6CC 5BS6A 1KQ9A 5BMZA 4L5IA 3R4KA 3RDIA 2O3FA 3F6VA 4AIHA 2M87A 2GQQA 4GYGA 3ZMSA 5LGNA 5HDKA 4M74A 1HKTA 1YQAA 3TO9A 2QZ8A 4UXNA 2LF7A 2J5PA 5H6RA 4IHSA 2P6TA 1U8RA 1LDDA 5E18F 1R22A 2GXGA 2O0YA 3K0LA 4PDKA 4HYEA 1OKRA 2V1XA 4CDGA 1MZBA 4EQQA 1IRFA 4A5NA 5F6FA 4WWCA 4MEYF 3M8FA 1ZYRF 3IWFA 2ZCWA 4KYWA 2JZYA 2PN6A 4HDVA 2HTJA 4RB3C 3KEQA 1XGOA 2QBYA 5LHHA 2HTSA 4MGRA 5D6FA 3VODA 1T39A 5K1YA 4JBAA 3ZMDA 2XIGA 5J8CA 2AXLA 4N9HA 2M5WA 1IAWA 1XB4A 2VBWA 3HOSA 1XDUA 2IA1A 2ZNZA 4LG0A 2STTA 3MEXA 5J6XA 5JI6A 2XV4S 1GVJA 1YS7A 1R00A 5DEQA 1AWCA 4EJOA 4MTDA 1LB2A 3FWEA 3M7GA 4ZZLA 4ETSA 1BOAA 2HR3A 2OZ6A 2ISZA 2FBKA 3WE2A 5J8FA 3QOPA 3R0AA 3WGGA 4ZZDA 2ZO4A 2RN7A 3TDUC 3F8BA 3MWMA 1ZG5A 1F4KA 3QPTA 2P7VB 1HXDA 3U1DA 4HX4A 3PFIA 3KFWX 4LJZF 4Q48A 4L0ZB 1S29A 2VOOA 3IRQA 2A3SA 2H6CA 2UWMA 2DU9A 2RC4A 2KJCA 3LAJA 5IT3A 3CTAA 3SQNA 4BHBA 3F8MA 3KP2A 5JR3A 1QZYA 3K2ZA 1O7FA 6PAXA 1J7KA 1OMIA 5HDGA 3FM3A 3RTRA 3GZ6A 2V6CA 3JW4A 1S7OA 3FXUA 4HX7A 3L00A 2FMYA 1BI1A 2OQRA 1HW1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1IN5 A;  3WTZ A;  5HOO A;  3WU1 B;  4WXC A;  5HS8 A;  4KIC A;  1UB9 A;  2VBX A;  2DPD A;  1DPR A;  1CGP A;  4ENN A;  3ROU A;  4MNU A;  2G7H A;  2JRT A;  3DQV C;  4YII A;  1X3U A;  3P9C A;  4UVA A;  4HAM A;  1ZGA A;  4A0X A;  2XAF A;  3JTG A;  5L3C A;  3FXR A;  1IZ1 A;  4L9J A;  2MLG A;  2OBP A;  2PLY A;  1U5T C;  3R61 A;  2V79 A;  1R7J A;  4M73 A;  1P4X A;  3ULQ B;  3VFZ A;  3CUQ C;  1V4R A;  2CSO A;  3V7C A;  4WXH A;  2HOE A;  4L9V A;  4Y17 A;  4NB5 A;  1K78 A;  1A04 A;  5E1W A;  2OAZ A;  2Q8K A;  5CVI A;  4GXO A;  3GO5 A;  2FE3 A;  3ERE D;  1VTN C;  2MBF A;  3DFG A;  2FBI A;  1D8K A;  4IVN A;  1UCR A;  5HVQ C;  2VOP A;  2CO5 A;  4Q4Z F;  2ESN A;  5H20 A;  2M8E A;  1R1U A;  1U2W A;  5ILU A;  2XAG A;  4IPA A;  2RQP A;  3MAJ A;  4XBF A;  2M30 A;  1STZ A;  4HQE A;  3I5U A;  4A2U A;  4HV6 A;  2QYO A;  4WX9 A;  1D3Y A;  3S2W A;  3LAP A;  2PBI A;  3HRM A;  4YFK F;  1BC7 C;  1ZRF A;  2NRA C;  2EV0 A;  4MTE A;  5BPI A;  2P7C B;  1USS A;  3ECO A;  4U88 A;  4ENK A;  2FQ3 A;  1ZRD A;  4OOI A;  5TRD A;  2L4A A;  4G7Z F;  3BRO A;  1EV7 A;  3BJO A;  2H94 A;  3WTU C;  3W6J B;  2V9V A;  3HSE A;  5KK1 A;  1O3S A;  2F2E A;  4AIK A;  1FY7 A;  3CDH A;  2K27 A;  1ON1 A;  3FM5 A;  1S3J A;  3TO7 A;  4EJW A;  2ZXJ A;  4HDU A;  5DCF A;  3RIR A;  2OD5 A;  3E3V A;  3MZH A;  2DFI A;  4EMS A;  5KVR A;  3KET A;  5LLQ A;  3C1D A;  3F72 A;  1GXQ A;  4WK8 F;  5E8G A;  3LQQ A;  2VON A;  2DPU A;  1PDN C;  3E5U A;  2EV6 A;  1FOK A;  2AS5 F;  2WC2 A;  2DW4 A;  1B9M A;  1KU7 A;  1FZP B;  3EDP A;  4M72 A;  3EYI A;  2A5Y B;  2RNJ A;  1WWX A;  1Z6R A;  1LQ1 A;  2LNB A;  1HSJ A;  1I1S A;  1SMY F;  1YTY A;  3BPX A;  2PMH A;  1TW2 A;  4B09 A;  1SAX A;  1K6O A;  3GFI A;  1K7A A;  5FD5 A;  5EEG A;  5AIP A;  1Z05 A;  5FGM A;  3QP6 A;  3LWF A;  5ILS A;  3CUO A;  2EFW A;  1G3S A;  2NNN A;  3E97 A;  2OZU A;  4M6Y A;  3P9K A;  3GUD A;  3J81 K;  2WTE A;  1P2F A;  2XGX A;  4UV9 A;  1TQP A;  3F8N A;  3ZP5 A;  3ML6 A;  2STW A;  4BAY A;  3GVA A;  3K1N A;  1XD7 A;  4P55 A;  3E6M A;  4BQA A;  3KCC A;  4BNC A;  3TOA A;  1QZZ A;  4FX4 A;  1TNT A;  5BOX A;  3WGH A;  1H9T A;  3IKT A;  2O61 A;  4HZF A;  2FU4 A;  3BP8 A;  1YYV A;  1FBU A;  3BY6 A;  2CW0 F;  3J80 Z;  5DD8 A;  2HKO A;  2EK5 A;  1JE8 A;  1IUY A;  3ZMT A;  2W25 A;  4PGH A;  3LA3 A;  1YLF A;  2NAZ A;  2B0L A;  4M6X A;  4UNO A;  2P4W A;  4TV7 A;  1FX7 A;  3WG9 A;  5F1R A;  2ZBK A;  3T5X A;  3K1P A;  1RUN A;  5LEJ A;  1LEB A;  4MQV A;  4IF4 A;  1Z9C A;  2VN2 A;  3WTT C;  3SFZ A;  2EFP A;  1XCB A;  3JTH A;  4P5O A;  4F7Z A;  4JQF A;  1XMK A;  1EH6 A;  3V8J A;  5K5Q A;  2BEO A;  1HW5 A;  3WTV C;  3HIF A;  4QWQ A;  4HLX A;  2HQN A;  3HRT A;  4MHG A;  1LJ9 A;  1EH8 A;  4JK1 X;  1S7A A;  1CF7 B;  1HQC A;  2XVC A;  4BHP A;  4I2O A;  3VOE A;  5FFX A;  1TBX A;  3J7A O;  4A6D A;  1PP7 U;  3RYP A;  2J5O A;  1JGS A;  2LF8 A;  1ODD A;  4KUM A;  5HLH A;  1FYK A;  2PEX A;  3T8R A;  1T6S A;  4ZYH A;  3M1E A;  3FX3 A;  1TLH B;  2YU3 A;  3VEP A;  3V8L A;  2L01 A;  5L3E A;  4U0W A;  3HSR A;  4AVP A;  2PI0 A;  3B02 A;  1LDJ A;  2PMU A;  1BI2 A;  5IT9 K;  2E7X A;  2A07 F;  4HLY A;  4HOB A;  1SD6 A;  2Z5U A;  1I5Z A;  1O3R A;  2XUB A;  2GZW A;  3ZMU A;  3RYR A;  4WF2 A;  4FHT A;  2LKP A;  1LNW A;  1Z7U A;  3E5Q A;  2VBZ A;  1T0F A;  4LB5 A;  2RGV A;  4UUV A;  5ICG A;  4YG2 F;  5ILV A;  2ZME A;  3BPV A;  3ABU A;  4OMY A;  1MKM A;  3HTU A;  1IN8 A;  2HKX A;  2R7D A;  1IXC A;  2L3D A;  5L3G A;  1U5T B;  3OOP A;  3V8K A;  2QWW A;  1P6R A;  4CHU A;  3M9A A;  4LLL A;  2QVO A;  2HYG D;  2HZT A;  4U0V A;  4ESJ A;  2LSO A;  4I0B A;  1B59 A;  3GWZ A;  4LFU A;  2F5C A;  3N97 A;  3DP7 A;  2DAO A;  3KP3 A;  2GIV A;  5D6E A;  1MJB A;  2G7U A;  2RKH A;  3FZV A;  1KA8 A;  4A6E A;  4S05 A;  1XGN A;  3K1M A;  3GFL A;  1QPM A;  2FEZ A;  3K9T A;  1BC8 C;  2ZFW A;  2ZKZ A;  1YW8 A;  2YX7 A;  1MDM B;  5L3F A;  3ZN1 A;  1KGS A;  4CO8 A;  5E1Z B;  5EEH A;  2ELH A;  2UXX A;  3ABT A;  1IXS B;  3F6O A;  3I58 A;  5DCM B;  1SFX A;  1W5S A;  4HQM A;  3TO6 A;  4FX0 A;  2CYY A;  1R1V A;  1V3F A;  3TOB A;  2IRF G;  3I71 A;  5D8L B;  3TDZ C;  5CVU A;  4YFN F;  4RB2 C;  3C7J A;  3J81 Z;  4EJU A;  4IXA A;  4E70 A;  1YW9 A;  3DKW A;  3JSO A;  3HRU A;  3KLN A;  1WQ2 A;  1YIO A;  2KIU A;  1B1B A;  2P6S A;  1W7P B;  2ADU A;  1OR7 A;  1Y0U A;  4R1H A;  1O3Q A;  2IP2 A;  4L9T A;  3L2C A;  2EA2 A;  3I59 B;  2JSC A;  4ON0 A;  1FYM A;  1IF1 A;  5DUK A;  3I64 A;  4LB6 B;  3H92 A;  3QU6 A;  1BM9 A;  2X4H A;  3BWG A;  3TQN A;  1KYZ A;  2RDP A;  3U9G A;  2QQB A;  2ZJ2 A;  2DT5 A;  3FHZ A;  4O5V A;  3VB2 A;  3PQK A;  3GEZ A;  1SFE A;  1ZLJ A;  3DV8 A;  4L9N A;  1H9G A;  4KIG A;  2FOK A;  1JXS A;  2PJP A;  3KP4 A;  4XLN F;  3DF8 A;  1E2X A;  5LGT A;  2GAU A;  2IT0 A;  4R8H A;  4LD5 A;  1J9I A;  3QAH A;  2KRF A;  2FA5 A;  1UFM A;  1FLI A;  4EM0 B;  3C3W A;  4M71 A;  1IW7 F;  1KQ8 A;  4L18 B;  4WCG A;  4P9U A;  3TGN A;  4OIR F;  4CXF A;  2OU2 A;  3DPT A;  1QBJ A;  1E17 A;  2XAS A;  2K7L A;  2P5L C;  4IRH A;  3R60 A;  5F64 A;  5DV5 A;  3ECH A;  5LEK A;  1ZHF A;  1S6L A;  2PFB A;  3SXY A;  1TW3 A;  1MJA A;  1J5Y A;  3IWZ A;  3HUG A;  1XSV A;  2VT3 A;  1U3E M;  3DXJ F;  3MZY A;  2DQL A;  2VC1 A;  3H3Z A;  5IT9 Z;  2VE8 A;  4I7H A;  2Z33 A;  1HBX G;  3LQR A;  1C0W A;  3KZZ A;  5E1X A;  4GCV A;  2DK8 A;  1G3W A;  2M45 A;  2P5V A;  3QRF F;  5LRS A;  2A68 F;  4BYY A;  4G94 A;  2F5D A;  3GZ5 A;  1J75 A;  3GLX A;  2A69 F;  1SFU A;  1FBQ A;  1SMT A;  2EFN A;  1D5V A;  2QQ9 A;  1ULY A;  2QEN A;  2XAJ A;  4NHJ A;  5ERI A;  3WU0 A;  2GWR A;  1U6G A;  2EV5 A;  2F5F A;  4AIJ A;  4G6Q A;  4WXD A;  1IXR C;  1ZAR A;  1J0R A;  1ZGJ A;  1XMA A;  1MDM A;  4AWX B;  2MH2 A;  4G8X A;  3ZQ7 A;  1P92 A;  4HBL A;  4UVB A;  3IC7 A;  4N9I A;  4LLN A;  1XGS A;  3EUH A;  3CJN A;  4FT8 A;  3LST A;  3MFK A;  3HYI A;  2G9W A;  4LK1 F;  2YSR A;  5E8I A;  3ELK A;  2ZNY A;  1R36 A;  1OYW A;  5DCM A;  4ZYE A;  4HX8 A;  3RPQ A;  1G3T A;  4U0Y A;  1SD5 A;  1W7P D;  3WTY C;  1BBY A;  3OV8 A;  3ZN0 A;  2Z9O A;  3KP7 A;  1GHC A;  4BH9 A;  4XRF A;  2QBY B;  2ESH A;  2D45 A;  4RAY A;  3CLO A;  2VOD A;  1G4D A;  1JHF A;  2TDX A;  4XLP F;  1D8J A;  3I53 A;  1HST A;  2ISY A;  3T1B A;  5LGU A;  1XN7 A;  2FSW A;  4LG0 B;  2YX4 A;  2Z99 A;  3SZP A;  4ZH4 F;  1B9N A;  3SHF A;  1DUX C;  4IRG A;  1ZRE A;  2CGP A;  5HDN A;  1QO0 D;  1TQM A;  3LFK A;  1FBS A;  1FP2 A;  5FFZ A;  5FD6 A;  5ICE A;  4A5M A;  1BI3 A;  2HQR A;  4IJA A;  1J59 A;  2CQK A;  3F22 A;  1DP7 P;  3WOD F;  2O03 A;  1F5T A;  2D2W A;  1REP C;  4OIP F;  5CVJ A;  3CO7 C;  3Q9S A;  1ZN2 A;  2BE5 F;  4OIQ F;  3EYY A;  4MQ9 F;  2HS5 A;  2QUF A;  4CIC A;  1L3L A;  2IW5 A;  4Q47 A;  1HKS A;  3AAF A;  4KMF A;  2V1U A;  4IHT A;  3IHU A;  2GXB A;  2EJR A;  4KN7 X;  5JFR A;  4ESB A;  4Y15 A;  3E6D A;  2MH9 A;  2NS0 A;  2L54 A;  2HGC A;  5E20 A;  3F21 A;  1MGT A;  2H09 A;  2WWY A;  1FYL A;  2E7W A;  1G6N A;  4KIB A;  1QQI A;  1KQ0 A;  3RKX A;  3H3U A;  3L9F A;  1IRG A;  4G6D A;  3JSP A;  5L3B A;  3O2P E;  5LBQ A;  3T8T A;  1DDN A;  3KP5 A;  1XDS A;  4G9Y A;  4U7D A;  2OA4 A;  1I6X A;  5ICF A;  3BJA A;  1R5H A;  2IPQ X;  1QGP A;  2P8T A;  1RIO H;  4RGU A;  3T0Y A;  2XRO A;  2Q2E A;  1YG2 A;  4PZJ A;  1I1G A;  1B6A A;  4P96 A;  1FSE A;  3FMS A;  5HLG A;  5K5O A;  2NYX A;  2NNY A;  4ZYG A;  2ETH A;  3QU3 A;  5D5X B;  2YPR A;  1Z1D A;  3RPU A;  4GGG A;  3O3K A;  1RNL A;  2L02 A;  4KFC A;  3WTS C;  4CGZ A;  5DUI A;  4EV0 A;  3FMQ A;  3V7S A;  1BJA A;  4CZZ A;  4ZYD A;  3L7W A;  2KJB A;  2KKO A;  1HW2 A;  2VE9 A;  4CYD A;  4DQ2 A;  2GA2 A;  2BYV E;  3P7N A;  3Q5F A;  1JHH A;  1K78 B;  3GF2 A;  4MEX F;  5K5R A;  5AIQ A;  1TNS A;  1F9N A;  4HF0 A;  2EWN A;  2X0L A;  5ICC A;  5BQT A;  2JT1 A;  1KYW A;  3EQL F;  1F1Z A;  3IKV A;  3W6K B;  3QPH A;  2KIM A;  1YO5 C;  4EGY A;  1PUE E;  1RUO A;  3CUQ B;  2R7F A;  3CO6 C;  2XKP A;  4KDP A;  1MD0 A;  4BHC A;  3L09 A;  4UHT A;  3GX4 X;  3HRS A;  3ISP A;  2P5K A;  1KU9 A;  4EM2 A;  2VXZ A;  2XAQ A;  3KLO A;  1LVA A;  1UST A;  2DLL A;  4EM1 A;  1Q1H A;  3F3X A;  5TJJ A;  1R5G A;  2FNP A;  3LA2 A;  5D4S A;  2EB7 A;  2PQ8 A;  4U7B A;  1W5T A;  1FPQ A;  1EH7 A;  4P9F A;  2WV0 A;  3D0S A;  2M1B A;  2RVC A;  4N0B A;  1O3T A;  1ZRC A;  5DYM A;  1ZAO A;  1T38 A;  2FRH A;  3B73 A;  1W4M A;  2W24 A;  4UV8 A;  2DI3 A;  4OIN F;  4ASN A;  2HYF A;  2L4M A;  3FMR A;  3RKW A;  1XGM A;  1YFH A;  3Q9V A;  1KU3 A;  2Q0O A;  4D0P A;  3RJP A;  4L0Y B;  4BXU A;  1GXP A;  5D4R A;  4G7H F;  5D5U B;  4RB0 A;  3LA7 A;  2A6E F;  2DTR A;  2CFX A;  2Y0M A;  3G73 A;  5HS9 A;  3M8E A;  2JPB A;  4ENJ A;  1ZH5 A;  3JAM K;  4I09 A;  1ZG3 A;  2V1D A;  1SD7 A;  4A0Y A;  4LLG F;  3FF5 A;  3TKY A;  2H6B A;  2QQA A;  1B4A A;  4OMZ A;  2UXN A;  4HF2 A;  1CF7 A;  2XRN A;  2IA0 A;  4LGW A;  2DO7 A;  4PGG A;  4OIO F;  1LDK B;  3J80 K;  2XAH A;  3D5L A;  3K69 A;  5CYV A;  4O6J A;  2R3S A;  2HDC A;  4GYI A;  4RGS A;  1WI9 A;  4I98 B;  1ZG1 A;  3MCZ A;  3F8F A;  5A2Q K;  3U2R A;  3EET A;  1OYI A;  4M9Z A;  1R58 A;  1R1T A;  2LDU A;  2CG4 A;  4HA8 A;  2W85 A;  4KMU X;  4LMY A;  4O3M A;  4HW0 A;  3WTW C;  2COM A;  3F8C A;  4RGR A;  3V4G A;  3C18 A;  4G7O F;  5FLX K;  2MC3 A;  3BOQ A;  1AOY A;  1OPC A;  3GW2 A;  4DNC A;  3WE3 A;  2EFQ A;  5DDG A;  3ZPL A;  4R79 A;  4RAZ A;  1T98 A;  2Y75 A;  3G3Z A;  2OQG A;  4EGZ A;  2VBY A;  3I4P A;  2K4B A;  1G3Y A;  2IVM A;  1O7L A;  2K86 A;  5JHU A;  1NHA A;  1IN7 A;  1XCV A;  5CVR A;  2HWV A;  4L5J A;  1U5T A;  4XSZ F;  4KIF A;  3ZMZ A;  1IN6 A;  4IRI A;  3PQJ A;  1L0O C;  1J2X A;  1YS6 A;  4HV5 A;  1XSD A;  3HSF A;  5BPD A;  3CUQ A;  4UVC A;  4YIF A;  4HF1 A;  5L3D A;  1BN5 A;  2XHK A;  4H0E A;  2O8X A;  1FT9 A;  5D5W B;  2QLZ A;  2HFH A;  1WKM A;  4KT5 C;  1FNN A;  3HHG A;  2VT2 A;  2W84 A;  4EJT A;  2O6G E;  3IRR A;  3R0J A;  3P9I A;  1Z6T A;  3GFM A;  4I0A A;  1BIB A;  2H27 A;  1UHM A;  5ED4 A;  4AD9 A;  4ESF A;  1PP8 F;  4RS8 A;  1R23 A;  2K4J A;  3N4M A;  4QLC U;  2GA1 A;  3RI4 A;  1P4W A;  5CJ9 A;  1RI7 A;  3I0T A;  4A12 A;  4RGX A;  5CVV A;  3FXQ A;  4YFX F;  3WGI A;  2BGC A;  1QNT A;  1IN4 A;  2MLK A;  3REO A;  1LEA A;  5LRR A;  2CWE A;  3NEU A;  3R6S A;  3QP5 A;  3NRV A;  3KE2 A;  2A6H F;  2E1N A;  1FC3 A;  1BIA A;  2ZME B;  2VC0 A;  1WSU A;  1P4A A;  3COA C;  4I01 A;  5DD4 A;  3NQO A;  4S04 A;  2E1C A;  4M9S A;  2FBH A;  4EJV A;  1W7P A;  4K2E A;  2FNA A;  2MA3 A;  3HOT A;  1FSH A;  3MQ0 A;  4RB1 A;  5D5V B;  2DBB A;  1TQI A;  4NQW A;  5FO5 A;  3V7R A;  2D1V A;  3O6B B;  1RZ4 A;  3I59 A;  3F23 A;  5D8K B;  4Y13 A;  1BI0 A;  3GXO A;  2MD5 A;  5AON A;  1Z91 A;  2ACJ A;  1H0M A;  3KP6 A;  4LK0 F;  1MJ9 A;  3WTX C;  1T2K A;  3E5X A;  4GO1 A;  3BZ6 A;  1KU2 A;  1O57 A;  2KIF A;  1OYY A;  3JAM Z;  5FB2 A;  5CLS A;  4I02 A;  2FF4 A;  2DK5 A;  2A61 A;  2Y48 A;  3DPL C;  3I54 A;  2XKO A;  1ONV A;  2HEO A;  3HTS B;  1WRJ A;  1ZLK A;  4A0Z A;  1TTY A;  1FWZ A;  2IA2 A;  2C6Y A;  3KZY A;  2PG4 A;  3BJ6 A;  2K02 A;  1XSX A;  3IL2 A;  3GYH X;  2UZK A;  4M9X A;  3GFJ A;  4XSX F;  2JTV A;  1FP1 D;  4PCQ A;  5LHI A;  4KNY A;  5A2Q Z;  2F5E A;  5H6Q A;  2W57 A;  2D1H A;  2YR2 A;  4EVI A;  3BDD A;  1K79 A;  5HS7 A;  4ENM A;  5E17 F;  2DQR A;  2FXA A;  2BBY A;  2QM3 A;  2EA4 A;  2IJL A;  1UHW A;  4Q5S F;  1I27 A;  1YW7 A;  4OU0 A;  5FLX Z;  3E6B A;  3ZMV A;  2JPC A;  4KA4 A;  3RKY A;  1S8N A;  2BV6 A;  4KN4 X;  3SZT A;  1ON2 A;  3KEO A;  1DPU A;  5JVT A;  1U78 A;  3HHH A;  4Z2Y A;  1SD4 A;  1HKQ A;  2EFO A;  2RV8 A;  2Z3Y A;  5HLI A;  4B8X A;  5LHG A;  3DEU A;  2FML A;  3E6C C;  5BS6 A;  1KQ9 A;  5BMZ A;  4L5I A;  3R4K A;  3RDI A;  2O3F A;  3F6V A;  4AIH A;  2M87 A;  2GQQ A;  4GYG A;  3ZMS A;  5LGN A;  5HDK A;  4M74 A;  1HKT A;  1YQA A;  3TO9 A;  2QZ8 A;  4UXN A;  2LF7 A;  2J5P A;  5H6R A;  4IHS A;  2P6T A;  1U8R A;  1LDD A;  5E18 F;  1R22 A;  2GXG A;  2O0Y A;  3K0L A;  4PDK A;  4HYE A;  1OKR A;  2V1X A;  4CDG A;  1MZB A;  4EQQ A;  1IRF A;  4A5N A;  5F6F A;  4WWC A;  4MEY F;  3M8F A;  1ZYR F;  3IWF A;  2ZCW A;  4KYW A;  2JZY A;  2PN6 A;  4HDV A;  2HTJ A;  4RB3 C;  3KEQ A;  1XGO A;  2QBY A;  5LHH A;  2HTS A;  4MGR A;  5D6F A;  3VOD A;  1T39 A;  5K1Y A;  4JBA A;  3ZMD A;  2XIG A;  5J8C A;  2AXL A;  4N9H A;  2M5W A;  1IAW A;  1XB4 A;  2VBW A;  3HOS A;  1XDU A;  2IA1 A;  2ZNZ A;  4LG0 A;  2STT A;  3MEX A;  5J6X A;  5JI6 A;  2XV4 S;  1GVJ A;  1YS7 A;  1R00 A;  5DEQ A;  1AWC A;  4EJO A;  4MTD A;  1LB2 A;  3FWE A;  3M7G A;  4ZZL A;  4ETS A;  1BOA A;  2HR3 A;  2OZ6 A;  2ISZ A;  2FBK A;  3WE2 A;  5J8F A;  3QOP A;  3R0A A;  3WGG A;  4ZZD A;  2ZO4 A;  2RN7 A;  3TDU C;  3F8B A;  3MWM A;  1ZG5 A;  1F4K A;  3QPT A;  2P7V B;  1HXD A;  3U1D A;  4HX4 A;  3PFI A;  3KFW X;  4LJZ F;  4Q48 A;  4L0Z B;  1S29 A;  2VOO A;  3IRQ A;  2A3S A;  2H6C A;  2UWM A;  2DU9 A;  2RC4 A;  2KJC A;  3LAJ A;  5IT3 A;  3CTA A;  3SQN A;  4BHB A;  3F8M A;  3KP2 A;  5JR3 A;  1QZY A;  3K2Z A;  1O7F A;  6PAX A;  1J7K A;  1OMI A;  5HDG A;  3FM3 A;  3RTR A;  3GZ6 A;  2V6C A;  3JW4 A;  1S7O A;  3FXU A;  4HX7 A;  3L00 A;  2FMY A;  1BI1 A;  2OQR A;  1HW1 A; 
#chains in the Genus database with same CATH topology
 2XF7 A;  3SZG A;  3VSK A;  1IN5 A;  3WTZ A;  5HOO A;  3WU1 B;  2BVL A;  4WXC A;  2LD5 A;  3OYN A;  1ERD A;  1R9T J;  5HS8 A;  4KIC A;  1UB9 A;  1FOX A;  2DMU A;  2VBX A;  2E35 A;  3AG4 H;  2DPD A;  1DPR A;  2VB6 A;  1Y0N A;  1CGP A;  1ETX A;  2LC2 A;  2QSH X;  4ENN A;  3ROU A;  4MNU A;  2E5Z A;  2VQH A;  2G7H A;  2OTJ I;  2JRT A;  4QSH A;  3DQV C;  2HVS A;  4YII A;  1MMA A;  1X3U A;  2MC4 A;  2WV1 A;  2KZG A;  4JP0 A;  3P9C A;  4UVA A;  3HEF A;  4HAM A;  3CC4 I;  4F55 A;  2WA0 A;  4IHY A;  2X1D A;  4B48 A;  1ZGA A;  1W1W E;  4A0X A;  4E7Z A;  1N77 A;  2XAF A;  4E7J A;  3JTG A;  2ECB A;  3NWT A;  3B6A A;  5L3C A;  1RR8 C;  3JRA A;  3FXR A;  3FK7 A;  3G1M A;  1IZ1 A;  5M5W J;  4L9J A;  2MLG A;  4DOZ A;  5CQE A;  2OBP A;  2PLY A;  1LE8 B;  1U5T C;  3R61 A;  2H1L A;  2V79 A;  1R7J A;  5IYC J;  4M73 A;  5EG0 A;  1MBG A;  1OLT A;  4PFO A;  1P4X A;  3AL0 C;  1VND A;  3ULQ B;  4HRI A;  3VFZ A;  3RZO J;  3SEQ A;  3CUQ C;  1V4R A;  2CSO A;  3ZQC A;  3V7C A;  2Z1D A;  3SFI A;  4WXH A;  2HOE A;  1YHQ I;  4C2T A;  4BXX J;  2IEK A;  2MGQ A;  2RRE A;  4L9V A;  2MSY A;  4Y17 A;  2JK3 A;  4NB5 A;  1E0E A;  1K78 A;  3HKZ N;  1A04 A;  5E1W A;  1AKH A;  2OAZ A;  2Q8K A;  5CVI A;  4CCO A;  3K4C A;  3W2A A;  1UHS A;  2EZK A;  3W2W A;  4GXO A;  3GO5 A;  2FE3 A;  3ERE D;  4GDF A;  1VTN C;  2QEX I;  1S72 I;  2MBF A;  1BW5 A;  3DFG A;  5EZG A;  4M3E A;  2FBI A;  4XNF A;  1ACI A;  3CCE I;  1D8K A;  1BL0 A;  4IVN A;  3IP4 B;  1PUF A;  1UCR A;  3J7Z I;  5HVQ C;  2VOP A;  5M3M J;  4E4H A;  2CO5 A;  2ELK A;  4CCK A;  4Q4Z F;  4AU7 A;  2DFH A;  2ESN A;  5H20 A;  2M8E A;  1BJZ A;  1R1U A;  1U2W A;  5ILU A;  2XAG A;  1Z67 A;  2OUM A;  3CDI A;  4FTH A;  3A2K A;  4IPA A;  2RQP A;  3OYM A;  3A0B C;  3MAJ A;  3OIQ A;  4XBF A;  1BR1 A;  4C2U A;  3CF5 F;  2M30 A;  2E5N A;  1STZ A;  4HG2 A;  4HQE A;  3UKG A;  4XRS A;  3I5U A;  4A2U A;  4HV6 A;  1R4N B;  3E1S A;  2QYO A;  4WX9 A;  2BY2 A;  1D3Y A;  4RA2 A;  2ME6 A;  1GUU A;  3S2W A;  4DYQ A;  1EJ9 A;  3LAP A;  2PBI A;  3HRM A;  4YFK F;  1BC7 C;  1ZRF A;  2NRA C;  1E3O C;  2EV0 A;  2NS8 A;  4MTE A;  3DBR B;  5BPI A;  4BE1 A;  4EEF G;  1YX3 A;  2P7C B;  1DGR M;  1LFB A;  1USS A;  1SVO A;  3PIO F;  3FBI B;  3ECO A;  3KYD B;  4U88 A;  3RCO A;  4ENK A;  2W1O A;  2FQ3 A;  2AO9 A;  4OOI A;  1ZRD A;  4XKC A;  4XL9 A;  4XIC A;  4BE2 A;  5TRD A;  2L4A A;  5LFA A;  4G7Z F;  3IH4 A;  2VKH A;  3CCR I;  2OCE A;  3BRO A;  1OJL A;  1EV7 A;  1NTC A;  4J00 A;  1VZ0 A;  3BJO A;  2H94 A;  3WTU C;  3W6J B;  3CCL I;  4B43 A;  3ZGK A;  1K6Y A;  2V9V A;  3HSE A;  5KK1 A;  5KNL A;  1O3S A;  2F2E A;  2Y9Z A;  3ASO H;  4AIK A;  4MLO A;  1FY7 A;  2QKM B;  1TWF J;  3CDH A;  2K27 A;  3H5A A;  1MBF A;  2IGO A;  3K4J A;  1JUM A;  1ZR4 A;  1ON1 A;  3FM5 A;  3FXM A;  1S3J A;  3TO7 A;  4EJW A;  3CD6 I;  2ZXJ A;  5DCF A;  4HST A;  3VDX A;  4HDU A;  3RIR A;  2H8W A;  2OD5 A;  1MH4 A;  3E3V A;  3G1O A;  5E3L A;  3MZH A;  2DFI A;  4UB6 C;  4EMS A;  5FJ8 J;  4BAC A;  5KVR A;  3H9G A;  3KET A;  2EZI A;  5LLQ A;  2A5W A;  3M3Y J;  1JUP A;  1B72 B;  3TL4 X;  3C1D A;  3F72 A;  1GXQ A;  4WK8 F;  5E8G A;  3LQQ A;  3HPG A;  1QPI A;  2VON A;  2DPU A;  3BG7 A;  1HLV A;  4XON A;  1PDN C;  2CQQ A;  3E5U A;  3A01 B;  2EV6 A;  1FOK A;  3QYB A;  2CW7 A;  1R5I D;  2AS5 F;  4D7N A;  4BEH A;  2WC2 A;  4RMN A;  3I56 I;  2DW4 A;  1B9M A;  3VSL A;  2R7O A;  1KU7 A;  1ZKG A;  1FZP B;  3BTI A;  3EDP A;  1T33 A;  2ZSH B;  4M72 A;  1X3Z B;  1OCZ H;  3EYI A;  2A5Y B;  4A3G J;  2RNJ A;  3L2Q A;  1WWX A;  5DS9 A;  4QPQ A;  2RAE A;  2PJR B;  1Z6R A;  3Q3S A;  1Z0X A;  1LQ1 A;  2I5U A;  2LNB A;  1HSJ A;  1I1S A;  1MH3 A;  1SMY F;  3ZXS A;  1YTY A;  3BPX A;  2R7X A;  2PMH A;  1TW2 A;  2GOM A;  4B09 A;  1SAX A;  1K6O A;  3GFI A;  1K7A A;  1N75 A;  5FD5 A;  1HF0 A;  2XDV A;  4XMY A;  5JLW A;  2XGE A;  2M0C A;  5AIP A;  1Z05 A;  5EEG A;  1MBJ A;  5FGM A;  2W4S A;  3QP6 A;  3GZN B;  5M5X J;  3LWF A;  2GXA A;  1UZC A;  5ILS A;  3CUO A;  2FX0 A;  3N05 A;  2EFW A;  1G3S A;  2NNN A;  2KP6 A;  2LY1 A;  3H0D A;  3E97 A;  5HLT A;  2IGN A;  2OZU A;  4M6Y A;  3P9K A;  5IP7 J;  3GUD A;  5EGO B;  3CMA I;  4ZTF A;  3J81 K;  2WTE A;  1P2F A;  1X58 A;  2O7O A;  2IGK A;  2XGX A;  1XS9 A;  4UV9 A;  1SVL A;  1TQP A;  3F8N A;  5F08 A;  3ZP5 A;  3S16 J;  3ML6 A;  2STW A;  3F0C A;  3L1P A;  3QYF A;  3KZI C;  1U0J A;  4BAY A;  1GVD A;  3GVA A;  3K1N A;  2R7U A;  1XD7 A;  4ABZ A;  3U1K A;  5GTH C;  4P55 A;  2XF6 A;  2R4G A;  3FHN A;  1I50 J;  3E6M A;  4BQA A;  2OPT A;  3CCY A;  3KCC A;  3B6C A;  4BNC A;  3TOA A;  1QZZ A;  3PO2 J;  4FX4 A;  1TNT A;  5BOX A;  3WGH A;  1WJ5 A;  3CES A;  1H9T A;  1WGX A;  3IKT A;  2O61 A;  4HZF A;  4ZJZ A;  2FU4 A;  3BP8 A;  1YYV A;  1FBU A;  3BY6 A;  2Z16 A;  1VFC A;  2CW0 F;  2E1M C;  3J80 Z;  2QF7 A;  2XRL A;  5DD8 A;  4C3I J;  2DYR H;  2HKO A;  2EK5 A;  1TZL A;  3OR1 C;  5HOD A;  1JE8 A;  1IUY A;  3ZMT A;  1OIS A;  2W25 A;  1YIJ I;  1D5Y A;  4PGH A;  3OYJ A;  3LA3 A;  1YLF A;  2NAZ A;  2B0L A;  4M6X A;  4UNO A;  3O8H A;  1X19 A;  2P4W A;  4TV7 A;  1FX7 A;  1MMD A;  3WG9 A;  4CSW A;  2ZBK A;  5F1R A;  3T5X A;  3K1P A;  3SDG A;  2E1O A;  3G4S I;  1RUN A;  3S2H J;  5LEJ A;  2DDA A;  2M34 A;  1MSF C;  1LEB A;  4MQV A;  4IF4 A;  1Z9C A;  3H3V K;  3KYC B;  2VN2 A;  3WTT C;  4RLF A;  2OC6 A;  2LFB A;  3SFZ A;  1HDD C;  2EFP A;  1XCB A;  4JOM A;  2VKV A;  3JTH A;  4P5O A;  1Y6I A;  3E0J B;  4NUB A;  4F7Z A;  2DTZ A;  2VJ5 A;  4ANJ A;  4BBS J;  4JQF A;  1XMK A;  4RAF A;  1EH6 A;  4Y4R A;  3V8J A;  3DU6 A;  5K5Q A;  4B47 A;  2KT0 A;  1WCM J;  2DYS H;  2BEO A;  4D7M A;  1YJN I;  1VQO I;  2DOF A;  1HW5 A;  1IO2 A;  2KHM A;  3WTV C;  3HIF A;  4QTR A;  2L9N A;  4HLX A;  4QWQ A;  2HQN A;  3HRT A;  4MHG A;  4BJ6 C;  2IS1 A;  1I3A A;  4IOC F;  3OWT A;  1FJL A;  2W7N A;  1LJ9 A;  2BHY A;  1EH8 A;  4JK1 X;  2JRM A;  3M07 A;  1S7A A;  1CF7 B;  1HQC A;  2XVC A;  4BHP A;  2E60 A;  2M2E A;  1T56 A;  3BR2 A;  4I2O A;  3VOE A;  1KON A;  1V5F A;  2CU7 A;  2ZJR F;  5FFX A;  2K3P A;  1TBX A;  3J7A O;  4A6D A;  2BXY A;  3ABK H;  1PP7 U;  2Y31 A;  2J5O A;  3RYP A;  1A36 A;  3OYC A;  1R4M B;  1JGS A;  2LF8 A;  1SAN A;  1ODD A;  4KUM A;  5HLH A;  1T0F C;  1FYK A;  2PEX A;  3T8R A;  1T6S A;  4ZYH A;  3M1E A;  3FX3 A;  1TLH B;  2YU3 A;  1GDT A;  3VEP A;  3V8L A;  2L01 A;  5L3E A;  4U0W A;  4BY1 J;  2VJ4 A;  3PJR A;  3HSR A;  4AVP A;  1PJR A;  2PI0 A;  1FOY A;  3B02 A;  1LDJ A;  2PMU A;  1BI2 A;  5IT9 K;  2FJ1 A;  2E7X A;  5IP6 A;  3BTJ A;  4RBO A;  4LOC A;  2A07 F;  4Y52 J;  1W36 D;  3VPR A;  2JJ7 A;  4OWR B;  4HLY A;  4HOB A;  3H9J A;  1SD6 A;  2Z5U A;  4RM3 A;  1I5Z A;  1O3R A;  2XUB A;  4AYB A;  2GZW A;  1H89 C;  5FRN A;  3ZMU A;  3RYR A;  4WF2 A;  4FHT A;  2LKP A;  1LNW A;  2R7R A;  1Z7U A;  4AUX A;  3E5Q A;  4BXF A;  2VBZ A;  1T0F A;  4LB5 A;  2RGV A;  4B1R A;  4UUV A;  2VQG A;  5ICG A;  4YG2 F;  5ILV A;  1A5J A;  3ZQH A;  2ZME A;  3BPV A;  3ABU A;  2JSP A;  1ETK A;  3WG7 H;  4OMY A;  1MKM A;  3HTU A;  3FXK A;  1IN8 A;  2E2J J;  2HKX A;  2R7D A;  1IXC A;  2L3D A;  3DPU A;  2LK2 A;  5L3G A;  3MKL A;  1U5T B;  3LSM A;  3OOP A;  3V8K A;  2QWW A;  1D1C A;  1P6R A;  4JX5 A;  3M9A A;  4LLL A;  4CHU A;  2V7F A;  3BG5 A;  2QVO A;  5HNF A;  3BR5 A;  2HYG D;  2HZT A;  4NBQ A;  4U0V A;  3OYB A;  4ESJ A;  3AL0 B;  3IAS 2;  2LSO A;  3C2B A;  1XMX A;  1B59 A;  4I0B A;  5M5Y J;  3GWZ A;  2PJR A;  4LFU A;  5CPR B;  2HDW A;  2F5C A;  4E7I A;  3N97 A;  1Z3X A;  4U87 A;  3TMO A;  2IXS A;  2DA7 A;  3WHC A;  3DP7 A;  4C30 A;  2DAO A;  4X6A J;  3KP3 A;  1PYV A;  2GIV A;  5D6E A;  1MJB A;  4CCN A;  2G7U A;  2RKH A;  3FZV A;  3UR3 C;  1KA8 A;  4A6E A;  2JVG A;  4S05 A;  1HDP A;  1XGN A;  4F52 A;  2NVX J;  3K1M A;  1VQ4 I;  3GFL A;  1QPM A;  2FEZ A;  3OR2 C;  4E7H A;  3ZQG A;  3RQ4 A;  2GOX B;  2XC7 A;  3K9T A;  1BC8 C;  1YJW I;  1EF4 A;  2ZFW A;  1TWA J;  2ZKZ A;  3ASN H;  1YW8 A;  3L2V A;  2YX7 A;  5J4Y A;  1MDM B;  3DCF A;  5L3F A;  3GME A;  2F5V A;  4IQ4 A;  3ZN1 A;  5IOZ A;  3LNQ A;  1KGS A;  4CO8 A;  1WI3 A;  5E1Z B;  5EEH A;  1SVM A;  1XG1 A;  2ELH A;  2UXX A;  5EYR A;  1VQN I;  3ABT A;  3QPS A;  5J40 A;  1IXS B;  2HYJ A;  2COB A;  3F6O A;  2DCE A;  3I58 A;  3KPH A;  5DCM B;  1SFX A;  1W5S A;  4HQM A;  3TO6 A;  1IG7 A;  4FX0 A;  2CYY A;  2W48 A;  2MG4 A;  2OCC H;  1R1V A;  1V3F A;  1B8I B;  1ETY A;  3L2U A;  2XB5 A;  3TOB A;  4PJJ A;  2Y0S A;  4RLQ A;  2IRF G;  3I71 A;  5D8L B;  3TDZ C;  5CVU A;  1OFC X;  2EIM H;  4Y33 A;  4YFN F;  4RB2 C;  3C7J A;  3J81 Z;  5K7H A;  4EJU A;  3LSK A;  4IXA A;  4E70 A;  1YW9 A;  1UG0 A;  2B63 J;  2NVY J;  3PNV A;  4HNT A;  3DKW A;  1APL C;  3A0H C;  1A6Q A;  3LSJ A;  1AU7 A;  3JSO A;  2D5V A;  2BY0 A;  3HRU A;  3KLN A;  3HG9 A;  1D1B A;  1WQ2 A;  1YIO A;  1YJ9 I;  2KIU A;  2QKL B;  1JKQ C;  3UNG C;  2QQ8 A;  4FAS D;  2GIZ A;  1B1B A;  2P6S A;  3DKX A;  1LVK A;  1W7P B;  2ADU A;  1OR7 A;  3HGY A;  2DA3 A;  1Y0U A;  4R1H A;  1O3Q A;  1V5E A;  1UAA A;  1XX5 A;  3ABM H;  1ZR2 A;  2IP2 A;  4L9T A;  3L2C A;  3VWB A;  4ZYA A;  2EA2 A;  3I59 B;  2JSC A;  1V55 H;  2CRG A;  2V26 A;  4ON0 A;  1FYM A;  1IF1 A;  5DUK A;  3I64 A;  3AG1 H;  4LB6 B;  5BNG A;  4CYC A;  3H92 A;  1YRN B;  2XSJ C;  3QU6 A;  3W3C A;  2FUG 2;  3DEE A;  1BM9 A;  5FKO A;  2X4H A;  3BWG A;  3H35 A;  3TQN A;  1KYZ A;  2RDP A;  3U9G A;  3GTM J;  1DGW Y;  2QQB A;  2ZJ2 A;  1FMV A;  2DT5 A;  3FHZ A;  4O5V A;  4JYK A;  3VB2 A;  3PQK A;  3FDY A;  4PJ0 C;  3GEZ A;  1SFE A;  1ZLJ A;  3ZQQ A;  3DV8 A;  4L9N A;  4V2F A;  2K9Q A;  2KMU A;  3S1M J;  1H9G A;  4KIG A;  2FOK A;  1JXS A;  1K61 A;  2PJP A;  4BQO A;  5F0C A;  3MN2 A;  3BTC A;  3KP4 A;  4XLN F;  3DF8 A;  1E2X A;  5LGT A;  2MFZ A;  1Y1V J;  1ZTR A;  2GAU A;  4R8H A;  2IT0 A;  1WJA A;  1IV8 A;  4LD5 A;  5GAH J;  5F0H A;  2R5Y B;  2EIN H;  1TC3 C;  1J9I A;  3AFH A;  1WJE A;  3QAH A;  2JA6 J;  2KRF A;  2NOG A;  2FA5 A;  5JHF A;  1UFM A;  1FLI A;  4KJZ A;  4EM0 B;  2KQR A;  1H88 C;  3C3W A;  4M71 A;  1MNE A;  3LFU A;  4JX4 A;  1IW7 F;  1KQ8 A;  1X1D A;  4L18 B;  4WCG A;  4XOT A;  3TGN A;  4P9U A;  2HPM A;  4OIR F;  4CXF A;  2OU2 A;  3DPT A;  1YIT I;  4A3I J;  1QBJ A;  4YRV A;  4XLC A;  1LFP A;  4GFB A;  2JA5 J;  1E17 A;  5IY5 H;  2R0Q C;  2XAS A;  1IRX A;  2K7L A;  2P5L C;  4IRH A;  2Y2Z A;  4CCJ A;  3BR6 A;  3R60 A;  5KAF C;  5F64 A;  3GTL J;  2AHQ A;  2IAI A;  4NDL A;  5DV5 A;  3ECH A;  1OCO H;  5LEK A;  1ZHF A;  1S6L A;  2K3F A;  2VJJ A;  2V6E A;  1QA6 A;  2PFB A;  3RSN A;  3SXY A;  3BQZ A;  1S5L C;  1TW3 A;  2HZD A;  1MJA A;  3SJM A;  1J5Y A;  3IWZ A;  3HUG A;  1XSV A;  2VT3 A;  1U3E M;  4MO7 A;  5IYD J;  3DXJ F;  2GBY A;  3MZY A;  3GBG A;  3S14 J;  2DQL A;  2VC1 A;  5J1R A;  4W1U A;  4AM3 A;  1ITY A;  3H3Z A;  3OYH A;  5IT9 Z;  3G71 I;  2VE8 A;  2CW8 A;  4W97 A;  1HOM A;  4I7H A;  2E1M B;  2Z33 A;  4I6Z A;  1WJC A;  1HBX G;  5KHD A;  2KPM A;  3LQR A;  3K7A J;  1C0W A;  3KZZ A;  5E1X A;  4G6T B;  4GCV A;  2KRC A;  3QOD A;  2R7W A;  2DK8 A;  4XLH A;  1Z3Y A;  1JKR C;  2BXZ A;  3PL8 A;  1G3W A;  2M45 A;  2LOO A;  3CCV I;  2P5V A;  2Q2E B;  3CJT B;  3QRF F;  5LRS A;  2A68 F;  3DBH B;  4BYY A;  4G94 A;  2NXN B;  2F5D A;  3GZ5 A;  1FTT A;  3BR0 A;  1J75 A;  3GLX A;  2A69 F;  2LY9 A;  2R7Q A;  4BY7 J;  2BW3 B;  3JRH A;  1SFU A;  1FBQ A;  1SMT A;  2EFN A;  3PFY A;  1D5V A;  2QQ9 A;  1ULY A;  1AA7 A;  2QEN A;  2R7V A;  1DP3 A;  2XAJ A;  2WAQ N;  5ERI A;  2W00 A;  3WU0 A;  4NHJ A;  2GWR A;  1U6G A;  2EV5 A;  2IBD A;  2F5F A;  4NNJ A;  4AIJ A;  4G6Q A;  4WXD A;  1IXR C;  1ZAR A;  1U9N A;  1J0R A;  1TT0 A;  1ZGJ A;  4FE7 A;  1XMA A;  5B1B H;  3RZD J;  3HOZ J;  1MDM A;  2KZV A;  4AWX B;  2MH2 A;  4G8X A;  1IJW C;  1R71 A;  3ZQ7 A;  1P92 A;  4XLF A;  1UMQ A;  4HBL A;  4UVB A;  3IC7 A;  4B3X A;  2K9M A;  2IS4 A;  4N9I A;  4LLN A;  1XGS A;  3VYU B;  3EUH A;  3CJN A;  3BG3 A;  3LST A;  4FT8 A;  2HXO A;  3MFK A;  1S7E A;  3HYI A;  5GP9 A;  5B5E C;  2WAF A;  3I3L A;  2G9W A;  4LK1 F;  2YSR A;  5E8I A;  1IC8 A;  3ELK A;  2NOJ B;  2ZNY A;  1DU6 A;  1R36 A;  2VL8 A;  5E3N A;  1RET A;  1OYW A;  2LH9 A;  2TRT A;  3BTL A;  5DCM A;  3ONQ A;  3OYA A;  4ZYE A;  4HX8 A;  3RPQ A;  1G3T A;  4U0Y A;  4A3K J;  1W5C C;  2X51 A;  1SD5 A;  2UV1 A;  3CF2 A;  1W7P D;  3WTY C;  1K4S A;  1OCC H;  1BBY A;  3OV8 A;  3CCJ I;  3ZN0 A;  2V9K A;  4MFD A;  5FKN A;  2Z9O A;  3KP7 A;  4B3A A;  4C3H J;  3DLL F;  4BH9 A;  4DYR A;  1GHC A;  4XRF A;  2QBY B;  2ESH A;  5GTI C;  2CQN A;  4RAY A;  4A3E J;  2D45 A;  3HC7 A;  3CLO A;  3IH3 A;  2P0W A;  3EPZ A;  3P5J A;  2VOD A;  1G4D A;  1JHF A;  2TDX A;  3NAR A;  2WB1 N;  4XLP F;  1O4X A;  4CCL A;  1D8J A;  3I53 A;  1LFU P;  1HST A;  1Q1V A;  3NWS A;  1BOB A;  2ISY A;  3LSH A;  1X3W B;  3T1B A;  5LGU A;  3LOC A;  2DOA A;  1XN7 A;  2PX9 A;  1ZK8 A;  4DBR A;  1HA8 A;  2FSW A;  4LG0 B;  3CCS I;  1ORK A;  2YX4 A;  2Z99 A;  3SZP A;  4ZH4 F;  1B9N A;  2TCT A;  3SHF A;  1DUX C;  4IRG A;  1ZRE A;  4XKW A;  2DDB A;  2CGP A;  5HDN A;  1POG A;  2F4O B;  1QO0 D;  1WZ2 A;  3PM1 A;  3LSR A;  3D5S C;  1TQM A;  3E7L A;  3LFK A;  1FBS A;  2VAS A;  2M4K A;  2XGD A;  1FP2 A;  1WJD A;  3K10 A;  5E3M A;  1YRN A;  1IDY A;  1IDZ A;  5FFZ A;  5F1J A;  1FIP A;  5FD6 A;  5ICE A;  2ZJQ F;  4A5M A;  1BI3 A;  3BG9 A;  3JRC A;  4BL0 B;  3K70 C;  2HQR A;  3MMY B;  4IJA A;  1J59 A;  2BZT A;  3JRB A;  2CQK A;  3F22 A;  3RKQ A;  1RRJ A;  1DP7 P;  1ZQ3 P;  3WOD F;  3M1C A;  1N25 A;  2O03 A;  1F5T A;  2XPU A;  2D2W A;  1REP C;  4OIP F;  2VJI A;  5CVJ A;  3Q9S A;  1K83 J;  1ZN2 A;  3CO7 C;  2BE5 F;  2YU9 J;  4OIQ F;  2KFD A;  3EYY A;  1LE8 A;  2ZSI B;  4MQ9 F;  3HKZ A;  4BS9 A;  4CH7 A;  2HS5 A;  2QUF A;  4CIC A;  2HVR A;  2DOE A;  1L3L A;  1BW6 A;  4BKX A;  2IW5 A;  3HZJ A;  3ZQI A;  5GPC A;  4RM2 A;  4Q47 A;  4BE0 A;  4DYC A;  4NC8 A;  1HKS A;  4J19 A;  3AAF A;  4KMF A;  1W0U A;  2V1U A;  3PUF A;  2R5Z B;  4IHT A;  1YE9 A;  3IHU A;  4YIR X;  2FOW A;  4FCY A;  2QGU A;  2GXB A;  2R93 J;  2EJR A;  4KN7 X;  2JVH A;  5DTD A;  5IPA A;  5JFR A;  4ESB A;  4XOR A;  4Y15 A;  2YUS A;  3E6D A;  2MH9 A;  4F93 B;  2NS0 A;  1N78 A;  2L54 A;  2Q1Z B;  9ANT A;  2HGC A;  5E20 A;  3F21 A;  1MGT A;  2H09 A;  5JLX A;  4GRI A;  2WWY A;  4E7S A;  1VQ5 I;  3GTJ J;  2XB0 X;  1NK2 P;  1FYL A;  2E7W A;  1UJ8 A;  1G6N A;  3BZC A;  4KIB A;  5J47 A;  1NK3 P;  1JKO C;  1MW7 A;  2V1N A;  4AID A;  1QQI A;  1QVU A;  1KQ0 A;  3BCA A;  4UUS B;  3RKX A;  3H3U A;  3JRD A;  1MND A;  3L9F A;  1IRG A;  4G6D A;  3TW7 A;  3CMM A;  2HQ5 A;  1F36 A;  4DJA A;  4XOP A;  3TED A;  3JSP A;  4HNU A;  1DU0 A;  4NC7 A;  4ZC3 A;  5L3B A;  3O2P E;  1SAU A;  5LBQ A;  1TWH J;  1VI0 A;  2L7F P;  3HM5 A;  1D0X A;  3T8T A;  4A3F J;  1DDN A;  4OAZ A;  3LSP A;  1QVT A;  2HDD A;  3KP5 A;  1XDS A;  4G9Y A;  4U7D A;  2QCO A;  1ZGW A;  1QHG A;  2OA4 A;  4RAG A;  1JTX A;  4L5E A;  1I6X A;  2JUC A;  5ICF A;  3BJA A;  1R5H A;  2IPQ X;  3K4B A;  2FD5 A;  3RPU D;  5IP9 J;  2JMW A;  1JUS A;  1QGP A;  2QSF X;  2P8T A;  1TWG J;  2F4M B;  1RIO H;  4RGU A;  4ZTJ A;  3BZK A;  3GTK J;  3T0Y A;  2XRO A;  2Q2E A;  3OS0 A;  2CUE A;  4NC6 A;  1YG2 A;  1QRY A;  4PZJ A;  1I1G A;  1B6A A;  3BLY A;  3EUA A;  4P96 A;  1FSE A;  3FMS A;  5HLG A;  2ZXI A;  2WAE A;  5K5O A;  1MNM C;  2NYX A;  4D9J A;  2NNY A;  1W0T A;  5LD2 C;  4ZYG A;  2ETH A;  5TGT A;  3QU3 A;  3ZCO A;  3AG2 H;  2ZME C;  3HDD A;  4EAT A;  1YI2 I;  4A69 C;  5D5X B;  3FBN B;  1Z21 A;  1Z1D A;  2YPR A;  3RPU A;  3BG6 A;  1D1A A;  1FEX A;  2AQF A;  4GGG A;  5FLV A;  3O3K A;  3OYE A;  1RNL A;  2L02 A;  2ZXH A;  4KFC A;  4BJT A;  2M8G X;  2JA2 A;  3WTS C;  1G8X A;  4CGZ A;  4LIU A;  2P81 A;  4M3D A;  5DUI A;  3LL7 A;  2F4I A;  2HXI A;  4EV0 A;  5M3F J;  3FMQ A;  2DT7 B;  3V7S A;  1BJA A;  4CZZ A;  4ZYD A;  3L7W A;  2KJB A;  2KKO A;  1RKT A;  1G59 A;  3HOV J;  2LG4 A;  1HW2 A;  2VE9 A;  2H1K A;  4CYD A;  4DQ2 A;  2GA2 A;  3HOY J;  2BYV E;  3P7N A;  3I9V 2;  4IHV A;  3Q5F A;  5K7Z A;  1JHH A;  1K78 B;  3GF2 A;  4MEX F;  1UG2 A;  3DWL E;  5K5R A;  1M1E B;  3S1R J;  1AKH B;  3C2G A;  2K9N A;  5AIQ A;  1B72 A;  2DMP A;  1TNS A;  3MZ8 A;  1IUF A;  2PMZ A;  1F9N A;  2XAU A;  4HF0 A;  2EWN A;  2X0L A;  4XK4 A;  5ICC A;  5BQT A;  3A01 A;  4FE4 A;  2ICW G;  3JRE A;  1PUF B;  2JT1 A;  2DFF A;  1KYW A;  3CP2 A;  5FLM J;  4XLE A;  2IS6 A;  3EQL F;  1F1Z A;  2CQX A;  2LKS A;  3HPH A;  3IKV A;  2EZL A;  3W6K B;  3QPH A;  2KIM A;  2Y30 A;  1YO5 C;  4EGY A;  1PUE E;  1RUO A;  3O8G A;  3W6V A;  3CUQ B;  2R7F A;  4ZDO A;  2VI6 A;  2L7K A;  3CO6 C;  3H36 A;  2OTL I;  2XKP A;  4KDP A;  1MD0 A;  4BHC A;  3L09 A;  4UHT A;  3GX4 X;  3HRS A;  3ISP A;  3QYE A;  1A6I A;  2P5K A;  2HOT A;  1KU9 A;  4EM2 A;  2O8K A;  4D5C A;  2VXZ A;  3U21 A;  2E19 A;  1Y56 A;  2XAQ A;  5E3O A;  1OQY A;  3KLO A;  1U8B A;  2XF5 A;  1LVA A;  1UST A;  2DMN A;  4IL6 C;  2DLL A;  2EIJ H;  1FTZ A;  4EM1 A;  1Q1H A;  3FKJ A;  3BT9 A;  1GV5 A;  3EUK L;  3F3X A;  2V9P A;  5TJJ A;  1VQK I;  2AQE A;  3ZRG A;  4F3Q A;  1R5G A;  4BDZ A;  3CLQ A;  2FNP A;  3LA2 A;  5D4S A;  4C2M J;  2EB7 A;  1X1P A;  1QZE A;  2L9R A;  2PQ8 A;  5EDN A;  1W5T A;  5EGO A;  4U7B A;  1FPQ A;  3CMY A;  1EH7 A;  4P9F A;  4UY8 I;  4IO9 F;  2WV0 A;  2JWT A;  2LKX A;  3D0S A;  2HU9 A;  2M1B A;  2RVC A;  1T08 B;  4N0B A;  1O3T A;  3DKY A;  1ZRC A;  3I4N J;  2LTP A;  2AXT C;  5DYM A;  1RPW A;  1ZAO A;  1T38 A;  2FRH A;  3B73 A;  1W4M A;  2M9H A;  1HCR A;  2W24 A;  2CUF A;  4UV8 A;  2DI3 A;  4OIN F;  4ASN A;  2HYF A;  1OR7 C;  3BC8 A;  4BBR J;  2ID3 A;  2L4M A;  3FMR A;  3RKW A;  1XGM A;  3G1L A;  1ETO A;  1A35 A;  4II3 A;  2HQA A;  1Y1W J;  3IUO A;  3Q0U A;  1MMN A;  1YFH A;  3Q9V A;  2M7A A;  1KU3 A;  1ETQ A;  1RR7 A;  3CCM I;  1P7J A;  2Q0O A;  4CUG A;  4D0P A;  3RJP A;  1MSE C;  1RC9 A;  1YOV B;  3TW6 A;  2R5Z A;  4L0Y B;  3GTQ J;  1V54 H;  4BXU A;  3HGG A;  4FIS A;  1GXP A;  5D4R A;  2LVS A;  3I4M J;  3CJR B;  4HEA 2;  4G7H F;  1FIA A;  5FKM A;  2EBI A;  5D5U B;  3A03 A;  4RB0 A;  4II2 A;  3LA7 A;  2A6E F;  3H5R A;  2DTR A;  2CFX A;  3V42 A;  2Y0M A;  5B66 C;  5F0F A;  3G73 A;  4LG3 A;  2O5R A;  5HS9 A;  1UEL B;  4A3L J;  4BEH B;  2N8G A;  3K4N A;  3BR3 A;  3M8E A;  1P7I A;  4PK4 A;  2JPB A;  1F43 A;  1MIJ A;  4ENJ A;  1U9O A;  1ZH5 A;  1BA5 A;  3JAM K;  3JRF A;  4I09 A;  1ZG3 A;  3J7Y J;  2V1D A;  1TWC J;  1Y8R B;  4NQW B;  1SD7 A;  2ZXW H;  4IKF A;  1IRZ A;  2KDO A;  4A0Y A;  4PUS A;  4LLG F;  3FF5 A;  3CZ6 A;  1I3Q J;  3CCU I;  3TKY A;  1H8A C;  4ITV A;  4E6K G;  3PNY A;  4HPQ A;  1VF9 A;  2H6B A;  2QQA A;  5EEA A;  1B4A A;  3MKZ A;  3JRI A;  4OMZ A;  4KIS A;  3VYT B;  3CC2 I;  1RES A;  2UXN A;  5C3E J;  4HF2 A;  1CF7 A;  2XRN A;  2IA0 A;  4LGW A;  2DO7 A;  4PGG A;  2HVQ A;  1I39 A;  4OIO F;  3I55 I;  1KZH A;  3OMY A;  1LDK B;  3J80 K;  5FRO A;  3S1Q J;  2XAH A;  3K4L A;  3M4O J;  3D5L A;  1WPK A;  1Z7L A;  2DJI A;  4UB8 C;  3K69 A;  2DA1 A;  3PIP F;  3HOU J;  5C4X J;  4UUT A;  3K6G A;  3FIS A;  4O6J A;  5CYV A;  2G0E A;  1WVR A;  2R3S A;  3OYK A;  2HDC A;  2CS3 A;  4GYI A;  4RGS A;  1WI9 A;  1XTA A;  4I98 B;  1G2H A;  2DA5 A;  1ZG1 A;  4XRS G;  3MCZ A;  3BQY A;  1VQP I;  2VLA A;  1SC7 A;  3F8F A;  3FXJ A;  5A2Q K;  1LPQ A;  1HC8 A;  2ECC A;  3OL3 A;  5C44 J;  3U2R A;  1MMG A;  4YEJ A;  3EET A;  3OYD A;  3DTI A;  1OYI A;  1PVE A;  4A3J J;  4M9Z A;  1R58 A;  3CME I;  3DEW A;  1X1A A;  1R1T A;  4KIT B;  1A31 A;  2NS7 A;  3QPL A;  2LDU A;  2CG4 A;  3IV5 A;  4HA8 A;  3H9Q A;  2W85 A;  4V19 K;  4KMU X;  4PJL A;  1TP4 A;  4LMY A;  4O3M A;  3OYF A;  4KT6 A;  1IGN A;  4HW0 A;  3WTW C;  2E2I J;  2L9V A;  3BR1 A;  2COM A;  3F8C A;  4RGR A;  3V4G A;  3C18 A;  4BQN A;  4G7O F;  3VYR B;  5FLX K;  2MC3 A;  2X85 A;  3BOQ A;  1AOY A;  1OPC A;  2L7Z A;  3GW2 A;  2QA4 I;  1JT6 A;  3GLL A;  5KAI C;  1OCR H;  3K4M A;  4DNC A;  2X48 A;  2Z2S B;  4A3M J;  3IAM 2;  4ZDL A;  5F04 A;  3WE3 A;  3OSF A;  1OCT C;  2ZJP F;  4Z6Y A;  4BU2 A;  2EFQ A;  4XM3 A;  1QHH D;  1R6R A;  5DDG A;  1BR2 A;  3ZPL A;  5EJC A;  4R79 A;  4RAZ A;  1T98 A;  2Y75 A;  3G3Z A;  2OQG A;  5J4V A;  2A6T A;  4EGZ A;  1R49 A;  2VBY A;  3I4P A;  2K4B A;  1G3Y A;  2HPI A;  2IVM A;  5K7F A;  3ZQL A;  1X2M A;  1TT5 B;  1O7L A;  2K86 A;  3H0G J;  5JHU A;  4XLA A;  2X1C A;  1NHA A;  2MAB A;  3AKZ A;  1IN7 A;  1XCV A;  5CVR A;  3PSF A;  3S3M A;  2HWV A;  3C2H A;  4N4O B;  4L5J A;  1U5T A;  4XSZ F;  4KIF A;  3ZMZ A;  4IHW A;  1IN6 A;  4IRI A;  3PQJ A;  1L0O C;  3PSI A;  1J2X A;  2KRH A;  5IOY A;  1YS6 A;  4HV5 A;  5CKT A;  1XSD A;  4A3D J;  5GAD J;  3SDB A;  3HSF A;  3SYT A;  2VPR A;  3M8J A;  2VIX A;  2CFO A;  4XN0 A;  2RQQ A;  3CP8 A;  4XQF A;  5BPD A;  4LIT A;  4RDU A;  3EUH C;  1WH7 A;  3CUQ A;  5DM6 F;  1I6H J;  3CQZ J;  4UVC A;  3HJE A;  4YIF A;  4HF1 A;  1MBH A;  3DBL B;  5L3D A;  1BN5 A;  5JVG F;  2XHK A;  2O8X A;  4H0E A;  1FT9 A;  5D5W B;  2EQR A;  2QLZ A;  2HFH A;  3KEY A;  1WKM A;  4MIM A;  4KT5 C;  3HBL A;  1FNN A;  2Y9Y A;  2ZC2 A;  3HHG A;  2VT2 A;  4XN3 A;  2W84 A;  4X0G A;  4EJT A;  2O6G E;  4DZJ A;  3IRR A;  3HB9 A;  2M0M A;  1IV6 A;  3R0J A;  1Z6T A;  3P9I A;  1JKP C;  3GFM A;  4I0A A;  1BIB A;  2WY7 Q;  2H27 A;  1UHM A;  3OIO A;  4AD9 A;  4ESF A;  4QIW N;  5ED4 A;  4CA0 A;  1PP8 F;  4RS8 A;  1R23 A;  2K4J A;  3N4M A;  4QLC U;  2GA1 A;  4CZC A;  3LMM A;  4E7K A;  4D5F A;  3RI4 A;  1P4W A;  5E79 C;  3D1N I;  3OS2 A;  5TIS C;  2K85 A;  4IZZ A;  1X1C A;  3KX2 A;  2R92 J;  2LRD A;  5CJ9 A;  3H5N A;  1RI7 A;  3ERM A;  4QPO A;  4I76 A;  3I0T A;  4BUP A;  4DIQ A;  4A12 A;  4RGX A;  4YEL A;  1JI8 A;  5CVV A;  3FXQ A;  1FMW A;  3FIW A;  2F6C A;  4YFX F;  3WGI A;  4PFP A;  2BGC A;  1B8I A;  1QNT A;  1IN4 A;  1D0Y A;  2MLK A;  3REO A;  2DN0 A;  2MYS A;  1LEA A;  2YS9 A;  2OJE D;  3VYS B;  5KCM A;  2CMP A;  4BGD A;  5LRR A;  2CWE A;  3NEU A;  2CQ7 A;  2WAD A;  4FET A;  3TBI A;  2LRE A;  3R6S A;  3Q0V A;  3QP5 A;  3LSG A;  1ENH A;  1CQT A;  3NRV A;  2XGC A;  3KE2 A;  2A6H F;  2E1N A;  1FC3 A;  2X6X A;  4J01 A;  3ABL H;  1BIA A;  2ZME B;  2ZFU A;  1YX5 A;  2VC0 A;  4V2G A;  1WSU A;  1P4A A;  3COA C;  4I01 A;  3LSI A;  2I8D A;  1BR4 A;  5DD4 A;  1NG6 A;  4B4C A;  3NQO A;  4C3J J;  5C4J J;  4AYB N;  3PNT A;  2WY8 Q;  3CDL A;  5B1A H;  4S04 A;  2LY2 A;  2E1C A;  4LIV A;  2BOL A;  4M9S A;  2FBH A;  4EJV A;  1W7P A;  2LMD A;  2Y69 H;  3JCU C;  4K2E A;  2FNA A;  2VQC A;  2LBF B;  5GAE J;  2MA3 A;  3HOT A;  1FSH A;  2ZB9 A;  3MQ0 A;  3W2V A;  3DTE A;  5D5V B;  4RB1 A;  3S17 J;  2DBB A;  1WJF A;  1TQI A;  4NQW A;  1EA3 A;  2KL4 A;  5FO5 A;  3TP3 A;  3V7R A;  2D1V A;  3O6B B;  1VQ8 I;  1RZ4 A;  3S15 J;  2PMZ N;  1XC5 A;  3QOE A;  3BCB A;  3I59 A;  4DGW B;  1MMS A;  2DXI A;  3F23 A;  5D8K B;  4Y13 A;  3OSG A;  1BI0 A;  3GXO A;  3ZOB A;  2JQ7 A;  3S3O A;  3S93 A;  2A05 A;  2MD5 A;  2L5Q A;  5AON A;  1Z91 A;  4DZP A;  1GLN A;  2ACJ A;  1H0M A;  1WJB A;  3KP6 A;  4D1Q A;  4LK0 F;  1EKE A;  3WHB A;  3MKW B;  1MBK A;  3IH2 A;  2B7E A;  2HI3 A;  4A3C J;  4X1E A;  1JJ6 C;  2K9S A;  1MJ9 A;  3WTX C;  1T2K A;  3E5X A;  2FQ4 A;  3FK6 A;  4GO1 A;  3BZ6 A;  1KU2 A;  1O57 A;  2KIF A;  2EZH A;  4G12 A;  3GTO J;  1OYY A;  3GCM A;  3JAM Z;  3KIO A;  1JJ8 C;  4XRM A;  5FB2 A;  5CLS A;  4I02 A;  2FF4 A;  2R5Y A;  2DK5 A;  2A61 A;  3D5R C;  2Y48 A;  1X4P A;  3DPL C;  2X9D A;  3I54 A;  2XKO A;  1ONV A;  4DBQ A;  3ZR8 X;  2HEO A;  3HTS B;  3MVP A;  1WRJ A;  3RQI A;  2KIQ A;  2XPW A;  1ZLK A;  4A0Z A;  1TTY A;  1ZEL A;  3K70 D;  1FWZ A;  1Z77 A;  2IA2 A;  2C6Y A;  3KZY A;  3PUB A;  2M4G A;  2NVU B;  4PJM A;  2PG4 A;  2CJJ A;  3BJ6 A;  3HOX J;  2RNG A;  2K02 A;  1XSX A;  2R7T A;  3IL2 A;  3GYH X;  2UZK A;  4M9X A;  2B9S A;  3OS1 A;  3GFJ A;  4XSX F;  2JTV A;  4IX7 A;  2BVM A;  2DJN A;  4F91 B;  1FP1 D;  1D0Z A;  4PCQ A;  5LHI A;  4AC0 A;  1X2N A;  4KNY A;  2KDZ A;  5A2Q Z;  2MW8 A;  2F5E A;  1QU3 A;  5H6Q A;  3QQA A;  3QWL A;  2W57 A;  2D1H A;  1NG7 A;  2YR2 A;  4BDY A;  1E3P A;  1VQ7 I;  2Y0S N;  4EVI A;  3BDD A;  1K79 A;  2XPV A;  5HS7 A;  4ENM A;  5E17 F;  1LUJ B;  2DQR A;  1VQ6 I;  3AG3 H;  4DW6 A;  2FXA A;  4CCM A;  2KLO A;  2QSG X;  2BBY A;  1ETW A;  2EIK H;  2QM3 A;  3OYI A;  2EA4 A;  2IJL A;  1UHW A;  3DTK A;  4Q5S F;  1I27 A;  1YW7 A;  4OU0 A;  5EF6 A;  3F9K A;  5FLX Z;  1TL8 A;  3E6B A;  3ZMV A;  2JPC A;  4KA4 A;  2V4J C;  3RKY A;  2W82 A;  2WAQ A;  5HNH A;  4F92 B;  2E36 A;  2E71 A;  3Q0W A;  1S8N A;  2BV6 A;  2CUJ A;  2ELJ A;  4CYC B;  4KN4 X;  3SZT A;  1ON2 A;  3KEO A;  1T95 A;  4IEJ A;  1DPU A;  5JVT A;  2EIL H;  3A1Y A;  3HHH A;  1U78 A;  2CV0 A;  4Z2Y A;  1SD4 A;  4FQG A;  2F48 A;  1HKQ A;  4PSW A;  2EFO A;  3X2Q H;  1ETV A;  2GLO A;  4A93 J;  2M3A A;  2RV8 A;  2BW3 A;  5J3L A;  2X6W A;  2Z3Y A;  5HLI A;  4B8X A;  5LHG A;  3DEU A;  2FML A;  1SEU A;  3E6C C;  5BS6 A;  1KQ9 A;  5BMZ A;  4L5I A;  1W36 C;  1AHD P;  3ESW B;  3R4K A;  3RDI A;  2O9L A;  1FOW A;  2O3F A;  3F6V A;  5FRM A;  4AIH A;  2M87 A;  3FXL A;  2GQQ A;  4GYG A;  1NH3 A;  3ZMS A;  5LGN A;  5HDK A;  4M74 A;  1HKT A;  2BHZ A;  5EG0 B;  1YQA A;  4XKV A;  2CV2 A;  2BY1 A;  3TO9 A;  2E2H J;  2QZ8 A;  1K4T A;  3A02 A;  4UXN A;  3FKI J;  2LF7 A;  2J5P A;  3S8P A;  3J7A Y;  5H6R A;  4IHS A;  5FKL A;  2P6T A;  1U8R A;  1LDD A;  5E18 F;  3WU2 C;  3OY9 A;  1R22 A;  2VXD A;  3CJQ B;  2GXG A;  2O0Y A;  4H4K C;  2UUZ A;  3K0L A;  4PDK A;  4HYE A;  1OKR A;  2JA8 J;  1J09 A;  2VKD A;  2IGM A;  2L0K A;  2V1X A;  3L2W A;  2L2O A;  4OAY A;  4CDG A;  1VQ9 I;  1MZB A;  4EQQ A;  3HL2 A;  1IRF A;  2DOD A;  4A5N A;  2WB1 A;  5F6F A;  4WWC A;  1GV2 A;  4MEY F;  3M8F A;  4BJ5 C;  2DA4 A;  1ZYR F;  2EH3 A;  4N4N B;  5IYB J;  3IWF A;  2DA6 A;  2ZCW A;  4KYW A;  1SFK A;  1LKX A;  2DT6 A;  3FXO A;  2JZY A;  2PN6 A;  4HDV A;  1Y8Q B;  2HTJ A;  2MD0 A;  3HUG B;  4RB3 C;  3KEQ A;  1XGO A;  2CV1 A;  2HOA A;  2QBY A;  3PO3 J;  5LHH A;  2HTS A;  5FKK A;  3GTP J;  4MGR A;  5D6F A;  2HOS A;  2DFE A;  2JA7 J;  3OOU A;  2X1E A;  3VOD A;  1T39 A;  4PSX A;  4IOA F;  5K1Y A;  2LLK A;  4JBA A;  3ZMD A;  4HSR A;  3OIP A;  4IQJ A;  2XIG A;  2K40 A;  5CQG A;  5J8C A;  2AXL A;  4N9H A;  1SFO J;  2K5C A;  2M5W A;  1IAW A;  1P9Q C;  3HOW J;  3OYG A;  1X1B A;  1XB4 A;  5J1U A;  2VBW A;  3HOS A;  1XDU A;  2LBF A;  4Y3O A;  2IA1 A;  2ZNZ A;  4LG0 A;  2CUZ A;  2STT A;  3MEX A;  5J6X A;  3HXL A;  5JI6 A;  2XV4 S;  1GVJ A;  1YS7 A;  1R00 A;  2JUG A;  4HNV A;  5DEQ A;  3CCQ I;  2DMT A;  2EPF A;  2JN6 A;  3JRG A;  1AWC A;  4EJO A;  4PJN A;  5J1Y A;  4MTD A;  3FWE A;  1LB2 A;  3G2B A;  1E3H A;  1MBE A;  2ME0 A;  2BY3 A;  2I10 A;  3M7G A;  4B44 A;  4XID A;  4M3G A;  4ZZL A;  4IHX A;  4ETS A;  1WHU A;  1BOA A;  2HR3 A;  2L7M P;  2XSD C;  2H8R A;  2OZ6 A;  3ZQF A;  2ID6 A;  2ISZ A;  4A3B J;  3A4C A;  3S3N A;  4E7L A;  1DQU A;  2FBK A;  3WE2 A;  1WH5 A;  2LP0 A;  2X6O A;  5J8F A;  3QOP A;  1OCP A;  2NVQ J;  5DM7 F;  4XR6 A;  4ZDP A;  3R0A A;  3OL4 A;  2M7B A;  2R7S A;  2VQL A;  4JX6 A;  1WFX A;  2LYC A;  3WGG A;  4ZZD A;  3MD2 A;  5GPA A;  2ZO4 A;  3S1N J;  2RN7 A;  3H1C A;  2WBM A;  3TDU C;  2DMQ A;  3F8B A;  3MWM A;  1ZG5 A;  1XPX A;  1F4K A;  1JGG A;  1V5G A;  3K2A A;  3S32 A;  1JTY A;  3NAU A;  4M3B A;  3QPT A;  3OYL A;  2P7V B;  5GAG J;  5B3S H;  3L2R A;  1HXD A;  1S9H A;  2OV7 A;  3CC7 I;  2LR8 A;  3U1D A;  4HX4 A;  3PFI A;  3KFW X;  4LJZ F;  4Q48 A;  4L0Z B;  1X4O A;  1JT0 A;  4I99 C;  1RKW A;  4C9Y A;  1S29 A;  4S0H B;  3SEZ A;  2VOO A;  5F27 A;  2IS2 A;  4M3F A;  3MKY B;  1Y39 A;  2A3S A;  3IRQ A;  2H6C A;  1GT0 C;  4BQQ A;  3K4K A;  2X6Y A;  2UWM A;  2DU9 A;  1VQM I;  2VPL A;  2R7Z J;  2RC4 A;  2KJC A;  3G6E I;  2L9S A;  3LAJ A;  1VQL I;  2K9L A;  4AVZ A;  5IT3 A;  4P1W A;  4Y7N J;  3CTA A;  3SQN A;  2DA2 A;  4BHB A;  5H2F C;  3F8M A;  2NVT J;  2E34 A;  3KP2 A;  5JR3 A;  4M6V A;  2KIS A;  3DLA A;  4UUS A;  1QZY A;  3K2Z A;  2GM4 A;  1O7F A;  6PAX A;  2OF7 A;  1J7K A;  1OMI A;  2VUM J;  2VKE A;  5HDG A;  3S2D J;  3DU5 A;  4MFE A;  1T8I A;  2HNH A;  3FM3 A;  3RTR A;  3JR9 A;  3GZ6 A;  2V6C A;  3JW4 A;  1S7O A;  3TP0 A;  2CH0 A;  3FXU A;  3KYL A;  4HX7 A;  3L00 A;  5EZH A;  4XKB A;  2FMY A;  1BI1 A;  2OQR A;  1HW1 A;  3GTG J; 
#chains in the Genus database with same CATH homology
 1IN5 A;  3WTZ A;  5HOO A;  3WU1 B;  4WXC A;  5HS8 A;  4KIC A;  1UB9 A;  2VBX A;  2DPD A;  1DPR A;  1CGP A;  4ENN A;  3ROU A;  4MNU A;  2G7H A;  2JRT A;  3DQV C;  4YII A;  1X3U A;  3P9C A;  4UVA A;  4HAM A;  1ZGA A;  4A0X A;  2XAF A;  3JTG A;  5L3C A;  3FXR A;  1IZ1 A;  4L9J A;  2MLG A;  2OBP A;  2PLY A;  1U5T C;  3R61 A;  2V79 A;  1R7J A;  4M73 A;  1P4X A;  3ULQ B;  3VFZ A;  3CUQ C;  1V4R A;  2CSO A;  3V7C A;  4WXH A;  2HOE A;  4L9V A;  4Y17 A;  4NB5 A;  1K78 A;  1A04 A;  5E1W A;  2OAZ A;  2Q8K A;  5CVI A;  4GXO A;  3GO5 A;  2FE3 A;  3ERE D;  1VTN C;  2MBF A;  3DFG A;  2FBI A;  1D8K A;  4IVN A;  1UCR A;  5HVQ C;  2VOP A;  2CO5 A;  4Q4Z F;  2ESN A;  5H20 A;  2M8E A;  1R1U A;  1U2W A;  5ILU A;  2XAG A;  4IPA A;  2RQP A;  3MAJ A;  4XBF A;  2M30 A;  1STZ A;  4HQE A;  3I5U A;  4A2U A;  4HV6 A;  2QYO A;  4WX9 A;  1D3Y A;  3S2W A;  3LAP A;  2PBI A;  3HRM A;  4YFK F;  1BC7 C;  1ZRF A;  2NRA C;  2EV0 A;  4MTE A;  5BPI A;  2P7C B;  1USS A;  3ECO A;  4U88 A;  4ENK A;  2FQ3 A;  1ZRD A;  4OOI A;  5TRD A;  2L4A A;  4G7Z F;  3BRO A;  1EV7 A;  3BJO A;  2H94 A;  3WTU C;  3W6J B;  2V9V A;  3HSE A;  5KK1 A;  1O3S A;  2F2E A;  4AIK A;  1FY7 A;  3CDH A;  2K27 A;  1ON1 A;  3FM5 A;  1S3J A;  3TO7 A;  4EJW A;  2ZXJ A;  4HDU A;  5DCF A;  3RIR A;  2OD5 A;  3E3V A;  3MZH A;  2DFI A;  4EMS A;  5KVR A;  3KET A;  5LLQ A;  3C1D A;  3F72 A;  1GXQ A;  4WK8 F;  5E8G A;  3LQQ A;  2VON A;  2DPU A;  1PDN C;  3E5U A;  2EV6 A;  1FOK A;  2AS5 F;  2WC2 A;  2DW4 A;  1B9M A;  1KU7 A;  1FZP B;  3EDP A;  4M72 A;  3EYI A;  2A5Y B;  2RNJ A;  1WWX A;  1Z6R A;  1LQ1 A;  2LNB A;  1HSJ A;  1I1S A;  1SMY F;  1YTY A;  3BPX A;  2PMH A;  1TW2 A;  4B09 A;  1SAX A;  1K6O A;  3GFI A;  1K7A A;  5FD5 A;  5EEG A;  5AIP A;  1Z05 A;  5FGM A;  3QP6 A;  3LWF A;  5ILS A;  3CUO A;  2EFW A;  1G3S A;  2NNN A;  3E97 A;  2OZU A;  4M6Y A;  3P9K A;  3GUD A;  3J81 K;  2WTE A;  1P2F A;  2XGX A;  4UV9 A;  1TQP A;  3F8N A;  3ZP5 A;  3ML6 A;  2STW A;  4BAY A;  3GVA A;  3K1N A;  1XD7 A;  4P55 A;  3E6M A;  4BQA A;  3KCC A;  4BNC A;  3TOA A;  1QZZ A;  4FX4 A;  1TNT A;  5BOX A;  3WGH A;  1H9T A;  3IKT A;  2O61 A;  4HZF A;  2FU4 A;  3BP8 A;  1YYV A;  1FBU A;  3BY6 A;  2CW0 F;  3J80 Z;  5DD8 A;  2HKO A;  2EK5 A;  1JE8 A;  1IUY A;  3ZMT A;  2W25 A;  4PGH A;  3LA3 A;  1YLF A;  2NAZ A;  2B0L A;  4M6X A;  4UNO A;  2P4W A;  4TV7 A;  1FX7 A;  3WG9 A;  5F1R A;  2ZBK A;  3T5X A;  3K1P A;  1RUN A;  5LEJ A;  1LEB A;  4MQV A;  4IF4 A;  1Z9C A;  2VN2 A;  3WTT C;  3SFZ A;  2EFP A;  1XCB A;  3JTH A;  4P5O A;  4F7Z A;  4JQF A;  1XMK A;  1EH6 A;  3V8J A;  5K5Q A;  2BEO A;  1HW5 A;  3WTV C;  3HIF A;  4QWQ A;  4HLX A;  2HQN A;  3HRT A;  4MHG A;  1LJ9 A;  1EH8 A;  4JK1 X;  1S7A A;  1CF7 B;  1HQC A;  2XVC A;  4BHP A;  4I2O A;  3VOE A;  5FFX A;  1TBX A;  3J7A O;  4A6D A;  1PP7 U;  3RYP A;  2J5O A;  1JGS A;  2LF8 A;  1ODD A;  4KUM A;  5HLH A;  1FYK A;  2PEX A;  3T8R A;  1T6S A;  4ZYH A;  3M1E A;  3FX3 A;  1TLH B;  2YU3 A;  3VEP A;  3V8L A;  2L01 A;  5L3E A;  4U0W A;  3HSR A;  4AVP A;  2PI0 A;  3B02 A;  1LDJ A;  2PMU A;  1BI2 A;  5IT9 K;  2E7X A;  2A07 F;  4HLY A;  4HOB A;  1SD6 A;  2Z5U A;  1I5Z A;  1O3R A;  2XUB A;  2GZW A;  3ZMU A;  3RYR A;  4WF2 A;  4FHT A;  2LKP A;  1LNW A;  1Z7U A;  3E5Q A;  2VBZ A;  1T0F A;  4LB5 A;  2RGV A;  4UUV A;  5ICG A;  4YG2 F;  5ILV A;  2ZME A;  3BPV A;  3ABU A;  4OMY A;  1MKM A;  3HTU A;  1IN8 A;  2HKX A;  2R7D A;  1IXC A;  2L3D A;  5L3G A;  1U5T B;  3OOP A;  3V8K A;  2QWW A;  1P6R A;  4CHU A;  3M9A A;  4LLL A;  2QVO A;  2HYG D;  2HZT A;  4U0V A;  4ESJ A;  2LSO A;  4I0B A;  1B59 A;  3GWZ A;  4LFU A;  2F5C A;  3N97 A;  3DP7 A;  2DAO A;  3KP3 A;  2GIV A;  5D6E A;  1MJB A;  2G7U A;  2RKH A;  3FZV A;  1KA8 A;  4A6E A;  4S05 A;  1XGN A;  3K1M A;  3GFL A;  1QPM A;  2FEZ A;  3K9T A;  1BC8 C;  2ZFW A;  2ZKZ A;  1YW8 A;  2YX7 A;  1MDM B;  5L3F A;  3ZN1 A;  1KGS A;  4CO8 A;  5E1Z B;  5EEH A;  2ELH A;  2UXX A;  3ABT A;  1IXS B;  3F6O A;  3I58 A;  5DCM B;  1SFX A;  1W5S A;  4HQM A;  3TO6 A;  4FX0 A;  2CYY A;  1R1V A;  1V3F A;  3TOB A;  2IRF G;  3I71 A;  5D8L B;  3TDZ C;  5CVU A;  4YFN F;  4RB2 C;  3C7J A;  3J81 Z;  4EJU A;  4IXA A;  4E70 A;  1YW9 A;  3DKW A;  3JSO A;  3HRU A;  3KLN A;  1WQ2 A;  1YIO A;  2KIU A;  1B1B A;  2P6S A;  1W7P B;  2ADU A;  1OR7 A;  1Y0U A;  4R1H A;  1O3Q A;  2IP2 A;  4L9T A;  3L2C A;  2EA2 A;  3I59 B;  2JSC A;  4ON0 A;  1FYM A;  1IF1 A;  5DUK A;  3I64 A;  4LB6 B;  3H92 A;  3QU6 A;  1BM9 A;  2X4H A;  3BWG A;  3TQN A;  1KYZ A;  2RDP A;  3U9G A;  2QQB A;  2ZJ2 A;  2DT5 A;  3FHZ A;  4O5V A;  3VB2 A;  3PQK A;  3GEZ A;  1SFE A;  1ZLJ A;  3DV8 A;  4L9N A;  1H9G A;  4KIG A;  2FOK A;  1JXS A;  2PJP A;  3KP4 A;  4XLN F;  3DF8 A;  1E2X A;  5LGT A;  2GAU A;  2IT0 A;  4R8H A;  4LD5 A;  1J9I A;  3QAH A;  2KRF A;  2FA5 A;  1UFM A;  1FLI A;  4EM0 B;  3C3W A;  4M71 A;  1IW7 F;  1KQ8 A;  4L18 B;  4WCG A;  4P9U A;  3TGN A;  4OIR F;  4CXF A;  2OU2 A;  3DPT A;  1QBJ A;  1E17 A;  2XAS A;  2K7L A;  2P5L C;  4IRH A;  3R60 A;  5F64 A;  5DV5 A;  3ECH A;  5LEK A;  1ZHF A;  1S6L A;  2PFB A;  3SXY A;  1TW3 A;  1MJA A;  1J5Y A;  3IWZ A;  3HUG A;  1XSV A;  2VT3 A;  1U3E M;  3DXJ F;  3MZY A;  2DQL A;  2VC1 A;  3H3Z A;  5IT9 Z;  2VE8 A;  4I7H A;  2Z33 A;  1HBX G;  3LQR A;  1C0W A;  3KZZ A;  5E1X A;  4GCV A;  2DK8 A;  1G3W A;  2M45 A;  2P5V A;  3QRF F;  5LRS A;  2A68 F;  4BYY A;  4G94 A;  2F5D A;  3GZ5 A;  1J75 A;  3GLX A;  2A69 F;  1SFU A;  1FBQ A;  1SMT A;  2EFN A;  1D5V A;  2QQ9 A;  1ULY A;  2QEN A;  2XAJ A;  4NHJ A;  5ERI A;  3WU0 A;  2GWR A;  1U6G A;  2EV5 A;  2F5F A;  4AIJ A;  4G6Q A;  4WXD A;  1IXR C;  1ZAR A;  1J0R A;  1ZGJ A;  1XMA A;  1MDM A;  4AWX B;  2MH2 A;  4G8X A;  3ZQ7 A;  1P92 A;  4HBL A;  4UVB A;  3IC7 A;  4N9I A;  4LLN A;  1XGS A;  3EUH A;  3CJN A;  4FT8 A;  3LST A;  3MFK A;  3HYI A;  2G9W A;  4LK1 F;  2YSR A;  5E8I A;  3ELK A;  2ZNY A;  1R36 A;  1OYW A;  5DCM A;  4ZYE A;  4HX8 A;  3RPQ A;  1G3T A;  4U0Y A;  1SD5 A;  1W7P D;  3WTY C;  1BBY A;  3OV8 A;  3ZN0 A;  2Z9O A;  3KP7 A;  1GHC A;  4BH9 A;  4XRF A;  2QBY B;  2ESH A;  2D45 A;  4RAY A;  3CLO A;  2VOD A;  1G4D A;  1JHF A;  2TDX A;  4XLP F;  1D8J A;  3I53 A;  1HST A;  2ISY A;  3T1B A;  5LGU A;  1XN7 A;  2FSW A;  4LG0 B;  2YX4 A;  2Z99 A;  3SZP A;  4ZH4 F;  1B9N A;  3SHF A;  1DUX C;  4IRG A;  1ZRE A;  2CGP A;  5HDN A;  1QO0 D;  1TQM A;  3LFK A;  1FBS A;  1FP2 A;  5FFZ A;  5FD6 A;  5ICE A;  4A5M A;  1BI3 A;  2HQR A;  4IJA A;  1J59 A;  2CQK A;  3F22 A;  1DP7 P;  3WOD F;  2O03 A;  1F5T A;  2D2W A;  1REP C;  4OIP F;  5CVJ A;  3CO7 C;  3Q9S A;  1ZN2 A;  2BE5 F;  4OIQ F;  3EYY A;  4MQ9 F;  2HS5 A;  2QUF A;  4CIC A;  1L3L A;  2IW5 A;  4Q47 A;  1HKS A;  3AAF A;  4KMF A;  2V1U A;  4IHT A;  3IHU A;  2GXB A;  2EJR A;  4KN7 X;  5JFR A;  4ESB A;  4Y15 A;  3E6D A;  2MH9 A;  2NS0 A;  2L54 A;  2HGC A;  5E20 A;  3F21 A;  1MGT A;  2H09 A;  2WWY A;  1FYL A;  2E7W A;  1G6N A;  4KIB A;  1QQI A;  1KQ0 A;  3RKX A;  3H3U A;  3L9F A;  1IRG A;  4G6D A;  3JSP A;  5L3B A;  3O2P E;  5LBQ A;  3T8T A;  1DDN A;  3KP5 A;  1XDS A;  4G9Y A;  4U7D A;  2OA4 A;  1I6X A;  5ICF A;  3BJA A;  1R5H A;  2IPQ X;  1QGP A;  2P8T A;  1RIO H;  4RGU A;  3T0Y A;  2XRO A;  2Q2E A;  1YG2 A;  4PZJ A;  1I1G A;  1B6A A;  4P96 A;  1FSE A;  3FMS A;  5HLG A;  5K5O A;  2NYX A;  2NNY A;  4ZYG A;  2ETH A;  3QU3 A;  5D5X B;  2YPR A;  1Z1D A;  3RPU A;  4GGG A;  3O3K A;  1RNL A;  2L02 A;  4KFC A;  3WTS C;  4CGZ A;  5DUI A;  4EV0 A;  3FMQ A;  3V7S A;  1BJA A;  4CZZ A;  4ZYD A;  3L7W A;  2KJB A;  2KKO A;  1HW2 A;  2VE9 A;  4CYD A;  4DQ2 A;  2GA2 A;  2BYV E;  3P7N A;  3Q5F A;  1JHH A;  1K78 B;  3GF2 A;  4MEX F;  5K5R A;  5AIQ A;  1TNS A;  1F9N A;  4HF0 A;  2EWN A;  2X0L A;  5ICC A;  5BQT A;  2JT1 A;  1KYW A;  3EQL F;  1F1Z A;  3IKV A;  3W6K B;  3QPH A;  2KIM A;  1YO5 C;  4EGY A;  1PUE E;  1RUO A;  3CUQ B;  2R7F A;  3CO6 C;  2XKP A;  4KDP A;  1MD0 A;  4BHC A;  3L09 A;  4UHT A;  3GX4 X;  3HRS A;  3ISP A;  2P5K A;  1KU9 A;  4EM2 A;  2VXZ A;  2XAQ A;  3KLO A;  1LVA A;  1UST A;  2DLL A;  4EM1 A;  1Q1H A;  3F3X A;  5TJJ A;  1R5G A;  2FNP A;  3LA2 A;  5D4S A;  2EB7 A;  2PQ8 A;  4U7B A;  1W5T A;  1FPQ A;  1EH7 A;  4P9F A;  2WV0 A;  3D0S A;  2M1B A;  2RVC A;  4N0B A;  1O3T A;  1ZRC A;  5DYM A;  1ZAO A;  1T38 A;  2FRH A;  3B73 A;  1W4M A;  2W24 A;  4UV8 A;  2DI3 A;  4OIN F;  4ASN A;  2HYF A;  2L4M A;  3FMR A;  3RKW A;  1XGM A;  1YFH A;  3Q9V A;  1KU3 A;  2Q0O A;  4D0P A;  3RJP A;  4L0Y B;  4BXU A;  1GXP A;  5D4R A;  4G7H F;  5D5U B;  4RB0 A;  3LA7 A;  2A6E F;  2DTR A;  2CFX A;  2Y0M A;  3G73 A;  5HS9 A;  3M8E A;  2JPB A;  4ENJ A;  1ZH5 A;  3JAM K;  4I09 A;  1ZG3 A;  2V1D A;  1SD7 A;  4A0Y A;  4LLG F;  3FF5 A;  3TKY A;  2H6B A;  2QQA A;  1B4A A;  4OMZ A;  2UXN A;  4HF2 A;  1CF7 A;  2XRN A;  2IA0 A;  4LGW A;  2DO7 A;  4PGG A;  4OIO F;  1LDK B;  3J80 K;  2XAH A;  3D5L A;  3K69 A;  5CYV A;  4O6J A;  2R3S A;  2HDC A;  4GYI A;  4RGS A;  1WI9 A;  4I98 B;  1ZG1 A;  3MCZ A;  3F8F A;  5A2Q K;  3U2R A;  3EET A;  1OYI A;  4M9Z A;  1R58 A;  1R1T A;  2LDU A;  2CG4 A;  4HA8 A;  2W85 A;  4KMU X;  4LMY A;  4O3M A;  4HW0 A;  3WTW C;  2COM A;  3F8C A;  4RGR A;  3V4G A;  3C18 A;  4G7O F;  5FLX K;  2MC3 A;  3BOQ A;  1AOY A;  1OPC A;  3GW2 A;  4DNC A;  3WE3 A;  2EFQ A;  5DDG A;  3ZPL A;  4R79 A;  4RAZ A;  1T98 A;  2Y75 A;  3G3Z A;  2OQG A;  4EGZ A;  2VBY A;  3I4P A;  2K4B A;  1G3Y A;  2IVM A;  1O7L A;  2K86 A;  5JHU A;  1NHA A;  1IN7 A;  1XCV A;  5CVR A;  2HWV A;  4L5J A;  1U5T A;  4XSZ F;  4KIF A;  3ZMZ A;  1IN6 A;  4IRI A;  3PQJ A;  1L0O C;  1J2X A;  1YS6 A;  4HV5 A;  1XSD A;  3HSF A;  5BPD A;  3CUQ A;  4UVC A;  4YIF A;  4HF1 A;  5L3D A;  1BN5 A;  2XHK A;  4H0E A;  2O8X A;  1FT9 A;  5D5W B;  2QLZ A;  2HFH A;  1WKM A;  4KT5 C;  1FNN A;  3HHG A;  2VT2 A;  2W84 A;  4EJT A;  2O6G E;  3IRR A;  3R0J A;  3P9I A;  1Z6T A;  3GFM A;  4I0A A;  1BIB A;  2H27 A;  1UHM A;  5ED4 A;  4AD9 A;  4ESF A;  1PP8 F;  4RS8 A;  1R23 A;  2K4J A;  3N4M A;  4QLC U;  2GA1 A;  3RI4 A;  1P4W A;  5CJ9 A;  1RI7 A;  3I0T A;  4A12 A;  4RGX A;  5CVV A;  3FXQ A;  4YFX F;  3WGI A;  2BGC A;  1QNT A;  1IN4 A;  2MLK A;  3REO A;  1LEA A;  5LRR A;  2CWE A;  3NEU A;  3R6S A;  3QP5 A;  3NRV A;  3KE2 A;  2A6H F;  2E1N A;  1FC3 A;  1BIA A;  2ZME B;  2VC0 A;  1WSU A;  1P4A A;  3COA C;  4I01 A;  5DD4 A;  3NQO A;  4S04 A;  2E1C A;  4M9S A;  2FBH A;  4EJV A;  1W7P A;  4K2E A;  2FNA A;  2MA3 A;  3HOT A;  1FSH A;  3MQ0 A;  4RB1 A;  5D5V B;  2DBB A;  1TQI A;  4NQW A;  5FO5 A;  3V7R A;  2D1V A;  3O6B B;  1RZ4 A;  3I59 A;  3F23 A;  5D8K B;  4Y13 A;  1BI0 A;  3GXO A;  2MD5 A;  5AON A;  1Z91 A;  2ACJ A;  1H0M A;  3KP6 A;  4LK0 F;  1MJ9 A;  3WTX C;  1T2K A;  3E5X A;  4GO1 A;  3BZ6 A;  1KU2 A;  1O57 A;  2KIF A;  1OYY A;  3JAM Z;  5FB2 A;  5CLS A;  4I02 A;  2FF4 A;  2DK5 A;  2A61 A;  2Y48 A;  3DPL C;  3I54 A;  2XKO A;  1ONV A;  2HEO A;  3HTS B;  1WRJ A;  1ZLK A;  4A0Z A;  1TTY A;  1FWZ A;  2IA2 A;  2C6Y A;  3KZY A;  2PG4 A;  3BJ6 A;  2K02 A;  1XSX A;  3IL2 A;  3GYH X;  2UZK A;  4M9X A;  3GFJ A;  4XSX F;  2JTV A;  1FP1 D;  4PCQ A;  5LHI A;  4KNY A;  5A2Q Z;  2F5E A;  5H6Q A;  2W57 A;  2D1H A;  2YR2 A;  4EVI A;  3BDD A;  1K79 A;  5HS7 A;  4ENM A;  5E17 F;  2DQR A;  2FXA A;  2BBY A;  2QM3 A;  2EA4 A;  2IJL A;  1UHW A;  4Q5S F;  1I27 A;  1YW7 A;  4OU0 A;  5FLX Z;  3E6B A;  3ZMV A;  2JPC A;  4KA4 A;  3RKY A;  1S8N A;  2BV6 A;  4KN4 X;  3SZT A;  1ON2 A;  3KEO A;  1DPU A;  5JVT A;  1U78 A;  3HHH A;  4Z2Y A;  1SD4 A;  1HKQ A;  2EFO A;  2RV8 A;  2Z3Y A;  5HLI A;  4B8X A;  5LHG A;  3DEU A;  2FML A;  3E6C C;  5BS6 A;  1KQ9 A;  5BMZ A;  4L5I A;  3R4K A;  3RDI A;  2O3F A;  3F6V A;  4AIH A;  2M87 A;  2GQQ A;  4GYG A;  3ZMS A;  5LGN A;  5HDK A;  4M74 A;  1HKT A;  1YQA A;  3TO9 A;  2QZ8 A;  4UXN A;  2LF7 A;  2J5P A;  5H6R A;  4IHS A;  2P6T A;  1U8R A;  1LDD A;  5E18 F;  1R22 A;  2GXG A;  2O0Y A;  3K0L A;  4PDK A;  4HYE A;  1OKR A;  2V1X A;  4CDG A;  1MZB A;  4EQQ A;  1IRF A;  4A5N A;  5F6F A;  4WWC A;  4MEY F;  3M8F A;  1ZYR F;  3IWF A;  2ZCW A;  4KYW A;  2JZY A;  2PN6 A;  4HDV A;  2HTJ A;  4RB3 C;  3KEQ A;  1XGO A;  2QBY A;  5LHH A;  2HTS A;  4MGR A;  5D6F A;  3VOD A;  1T39 A;  5K1Y A;  4JBA A;  3ZMD A;  2XIG A;  5J8C A;  2AXL A;  4N9H A;  2M5W A;  1IAW A;  1XB4 A;  2VBW A;  3HOS A;  1XDU A;  2IA1 A;  2ZNZ A;  4LG0 A;  2STT A;  3MEX A;  5J6X A;  5JI6 A;  2XV4 S;  1GVJ A;  1YS7 A;  1R00 A;  5DEQ A;  1AWC A;  4EJO A;  4MTD A;  1LB2 A;  3FWE A;  3M7G A;  4ZZL A;  4ETS A;  1BOA A;  2HR3 A;  2OZ6 A;  2ISZ A;  2FBK A;  3WE2 A;  5J8F A;  3QOP A;  3R0A A;  3WGG A;  4ZZD A;  2ZO4 A;  2RN7 A;  3TDU C;  3F8B A;  3MWM A;  1ZG5 A;  1F4K A;  3QPT A;  2P7V B;  1HXD A;  3U1D A;  4HX4 A;  3PFI A;  3KFW X;  4LJZ F;  4Q48 A;  4L0Z B;  1S29 A;  2VOO A;  3IRQ A;  2A3S A;  2H6C A;  2UWM A;  2DU9 A;  2RC4 A;  2KJC A;  3LAJ A;  5IT3 A;  3CTA A;  3SQN A;  4BHB A;  3F8M A;  3KP2 A;  5JR3 A;  1QZY A;  3K2Z A;  1O7F A;  6PAX A;  1J7K A;  1OMI A;  5HDG A;  3FM3 A;  3RTR A;  3GZ6 A;  2V6C A;  3JW4 A;  1S7O A;  3FXU A;  4HX7 A;  3L00 A;  2FMY A;  1BI1 A;  2OQR A;  1HW1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...