1XD7A

Crystal structure of a putative dna binding protein
Total Genus 36
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
36
sequence length
127
structure length
116
Chain Sequence
SRLAVAIHILSLISMDEKTSSEIIADSVNTNPVVVRRMISLLKKADILTSRAGVPGASLKKDPADISLLEVYRAVQKNPKCPVGKKIQNALDETFESVQRAMENELASKSLKDVMN
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ywnA
publication title Crystal structure of a putative DNA binding protein
rcsb
source organism Bacillus subtilis subsp. subtilis
molecule tags Dna binding protein
total genus 36
structure length 116
sequence length 127
ec nomenclature
pdb deposition date 2004-09-04
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 1xd7A00
5F64A 3ROUA 1USTA 2VN2A 3GVAA 3BP8A 3Q9SA 1O7FA 2OAZA 3TOAA 4EQQA 1FYLA 2BYVE 3KP5A 1J2XA 1FP1D 1H9TA 1U8RA 5E18F 1B4AA 2IVMA 2FOKA 1HKQA 2ZMEA 2ETHA 2R7DA 4EGYA 3SZPA 2FU4A 2HTSA 3KEOA 1Z9CA 2A68F 1YW9A 2L01A 2IW5A 1IRGA 1S7AA 2QM3A 1HXDA 1IRFA 3H3ZA 2DPDA 5HLHA 2QVOA 1H0MA 3KE2A 1QZYA 2PJPA 4Q47A 5E1WA 1IAWA 5LEKA 1ZH5A 4LK0F 4HLXA 2VC0A 3FX3A 1HW5A 4M6YA 4CXFA 1G3YA 3DXJF 3WTSC 4L18B 2HKOA 3DV8A 4Z2YA 2JPCA 3F8MA 4LG0B 3LA7A 2KIMA 3HIFA 3R0AA 2HQNA 2XAQA 2V9VA 4I0BA 2XKOA 2RQPA 4WCGA 2Z3YA 5HDKA 1BBYA 2DPUA 5L3DA 2A61A 4UV9A 5ICCA 2ZNYA 2O3FA 3GFIA 3C3WA 4ESFA 2KJCA 2HEOA 1BI1A 2H27A 3N97A 1EH7A 3IRQA 2LNBA 1ZLJA 3PQJA 5DYMA 3WGHA 5F6FA 2CQKA 4XSXF 3VOEA 4Q5SF 3WTVC 4IRIA 3R61A 3ML6A 2A69F 5D5WB 4GCVA 2ISYA 1XSVA 1WI9A 3V7CA 1ZN2A 1MDMB 3FM5A 1QPMA 1YLFA 4OU0A 5DDGA 2VBWA 4I02A 2Z9OA 3C1DA 4L9JA 1B9NA 1JHFA 5D8KB 3GF2A 3ZMZA 4Y15A 3T1BA 3K9TA 2A6HF 1ZGAA 2V1XA 1SD4A 2MC3A 3N4MA 4M9SA 2CG4A 1Z05A 1HQCA 2C6YA 3J80K 4KA4A 2ZO4A 3SXYA 3TQNA 2K27A 2P7CB 1OYYA 5EEHA 3F22A 4AIKA 1FPQA 5LEJA 2E1NA 2HR3A 4L5IA 3GUDA 4U0VA 5ERIA 1IN7A 5K1YA 3KP2A 1IXSB 3LQQA 1R5GA 2OQRA 3FM3A 3ELKA 5HS8A 1OYWA 4UXNA 2JRTA 1R5HA 3P7NA 3CUQA 3WE2A 4RB0A 3E97A 4ENKA 1FOKA 1U3EM 4OIRF 3ABUA 3QP6A 2F5DA 4HF2A 1XGMA 3J80Z 3MZYA 3U9GA 3WTZA 4HA8A 3WU1B 2OZ6A 4PZJA 5J8CA 4U0WA 3HHGA 3IC7A 5FD5A 2CFXA 5TRDA 2LKPA 2DU9A 1TW2A 1IF1A 5LBQA 3WG9A 2MLGA 1DDNA 3RYPA 1T98A 2ESNA 2VOPA 1WKMA 5FGMA 3MCZA 2O8XA 2B0LA 3IL2A 5J6XA 3O2PE 3B02A 2M8EA 1I5ZA 3SQNA 2GZWA 1I27A 4AD9A 2XKPA 3QU6A 5CVVA 4LFUA 2FRHA 2RC4A 4ZYEA 1YW7A 1R36A 2XROA 1S7OA 1W5SA 1ZHFA 1ZG3A 1R23A 5L3FA 4HDVA 2GWRA 3FXRA 1AWCA 3TO7A 1LDJA 1EH8A 1O3QA 2JPBA 2O6GE 3TGNA 2QBYA 2HTJA 4JBAA 2IP2A 4HF0A 2XRNA 3DPTA 2H6BA 5L3GA 1GHCA 3GFLA 1TLHB 1D8JA 2AXLA 2D1VA 2JTVA 2IRFG 4KMFA 5JHUA 2KIUA 4WXCA 4H0EA 2DW4A 4M71A 2F2EA 2F5CA 3LQRA 3L09A 1R00A 5DCMB 3ZQ7A 4DQ2A 3QPHA 4HV5A 4N0BA 4TV7A 4M72A 2PG4A 2MA3A 4D0PA 3E3VA 1A04A 5FFZA 1I1SA 3H92A 4I7HA 3HRSA 4M9XA 4UV8A 4R8HA 3E6CC 1RZ4A 2FNAA 2FEZA 1X3UA 1XD7A 3LA2A 1XSXA 4NHJA 4KIGA 4IPAA 4ZZDA 3ERED 4WWCA 1R1VA 3J81K 1XMAA 1F1ZA 3CO6C 3V4GA 4MHGA 2PFBA 4FX4A 1REPC 4L9TA 4E70A 2ZFWA 4RB1A 2L54A 3REOA 1IN5A 2PQ8A 1LVAA 3MWMA 4KNYA 3BOQA 3R0JA 2EV6A 2QLZA 4EJOA 3KP3A 4ESJA 3JTGA 2E1CA 3E6DA 5FFXA 1S29A 3TOBA 4BXUA 2HYGD 2IA2A 2D1HA 3KETA 2EFQA 3PFIA 2OZUA 3J81Z 4AWXB 2K86A 3C18A 2D45A 3RKYA 4HQMA 1ON2A 3GX4X 2NAZA 4U88A 2UWMA 2HQRA 1IN4A 3H3UA 4A0ZA 1CF7B 3T8RA 3COAC 2PBIA 1KQ9A 4CO8A 1XCBA 1V4RA 1WSUA 1ZRDA 5KVRA 2EA4A 5D4RA 3E5UA 2WV0A 2CYYA 3PQKA 5HOOA 3K1NA 5LRSA 1BI0A 5HS7A 1MJAA 4WXDA 1TBXA 4LJZF 3FXQA 1RUNA 4L0YB 2ELHA 5JVTA 5LGUA 3CUQC 2GXBA 1G3SA 4KN4X 3GWZA 2ACJA 1TW3A 4L9VA 4LLNA 3BDDA 2NNNA 3WE3A 1OR7A 3DFGA 2XIGA 4O6JA 2OA4A 4L9NA 1XDUA 2RGVA 3WGIA 3EYYA 1ZRFA 1TQIA 2XV4S 3LAJA 3I0TA 4BYYA 2ZBKA 1J59A 5JI6A 2KIFA 3BPVA 1U2WA 3ECOA 5JR3A 4P9FA 1FSHA 1J5YA 1KQ8A 5HLGA 4WF2A 2MD5A 1I6XA 4I98B 4ZH4F 2MH2A 3I54A 1HW1A 3IKVA 3ZMUA 1K78A 5DUKA 1JXSA 2GQQA 2RV8A 2W25A 1QZZA 1SD5A 2UZKA 1FT9A 2XAJA 4KN7X 4KMUX 1W5TA 5LLQA 1DPRA 2HWVA 3ECHA 3QOPA 2XHKA 4HQEA 1R7JA 2HFHA 5JFRA 2EB7A 5TJJA 1IZ1A 3IKTA 3ZMSA 4GO1A 1IN8A 3ZP5A 2HYFA 4PGGA 2IJLA 4MGRA 4MTEA 3FMSA 3D0SA 3F21A 3HHHA 4IRGA 2UXNA 2X0LA 3CO7C 3JSOA 1IXCA 2DFIA 3GEZA 2QZ8A 1STZA 2YU3A 5DUIA 1T38A 2RN7A 1J0RA 2ZNZA 2P4WA 2W85A 2H09A 1QO0D 5AIQA 1TNTA 1QBJA 4A0XA 2Y0MA 4G7ZF 3EYIA 4O3MA 2VODA 1U78A 1J7KA 1O3TA 4HV6A 2V1UA 2VC1A 1ZARA 4K2EA 2VE8A 4HZFA 2EV0A 4YIIA 4G6DA 3F8BA 4LGWA 3BY6A 1LQ1A 1U6GA 3P9KA 1FX7A 1D8KA 1KU7A 2R3SA 1XGSA 2YX7A 3M8FA 4IHSA 3RTRA 4UNOA 2P5LC 2UXXA 2GAUA 5DD8A 2L4AA 3ZPLA 1XGNA 1L3LA 4WXHA 2FBKA 1KU3A 3GLXA 3GZ5A 4ENJA 3G73A 2DT5A 5J8FA 3CJNA 1OKRA 5IT9K 4ZZLA 1YS7A 1RIOH 1FY7A 2MH9A 4UUVA 3DP7A 2PEXA 3RDIA 1W7PA 1R58A 4L0ZB 4O5VA 2ZMEB 4LD5A 2XVCA 3LFKA 1ZAOA 2RKHA 5ILVA 1ZLKA 5ICEA 2OD5A 4XSZF 5L3EA 2VXZA 3NRVA 1TTYA 2WC2A 4XLNF 3TDUC 2VBXA 4A2UA 1LJ9A 1BC8C 4G8XA 3SFZA 3ISPA 2DI3A 2H94A 5LRRA 5D5VB 3HTUA 3I58A 1O3SA 4A0YA 3CUOA 4NB5A 1S6LA 4HOBA 1ZREA 5IT9Z 3QRFF 3RIRA 2FE3A 1YIOA 5AONA 3JTHA 1T6SA 2QENA 5HVQC 3DQVC 3DF8A 3RKWA 1R1UA 2FBIA 4M9ZA 1YTYA 3M1EA 5EEGA 3IWFA 3CTAA 2GXGA 1SAXA 1Y0UA 1GXQA 1GVJA 1KYWA 2QQ9A 3ABTA 3I53A 1YW8A 2FBHA 2BGCA 4Q48A 1U5TA 1FBQA 1H9GA 3EQLF 4CDGA 3WODF 2ADUA 5D4SA 5HDNA 4KIFA 3KFWX 2ZJ2A 4G7HF 4EJVA 1FBSA 4LMYA 2X4HA 3FF5A 3FHZA 4WX9A 1E17A 1TQMA 1P92A 1W4MA 3M9AA 1J75A 3ZMTA 1SFXA 3F6OA 1D5VA 4KUMA 3Q5FA 1RNLA 3QPTA 2Z33A 4CGZA 2EWNA 2EJRA 3NEUA 2IA0A 1UCRA 3I71A 4P5OA 4ZYHA 1KA8A 2EFWA 3OOPA 2Y75A 1YG2A 1GXPA 4CYDA 5K5OA 2DQRA 4EGZA 5FLXK 1P4WA 4UHTA 4A6EA 3I59A 3V8LA 3V7RA 3ZN0A 1JGSA 4KFCA 5D5XB 2XUBA 1DUXC 3WTYC 4FHTA 1WQ2A 2VBZA 2VONA 4S04A 4XLPF 1RI7A 4IRHA 2O03A 1F5TA 3KP7A 2VOOA 1FSEA 4RB2C 2QUFA 1ZGJA 2CSOA 2HGCA 2MBFA 4G94A 4YFXF 2G7UA 1KQ0A 1XB4A 4WK8F 5CJ9A 1PUEE 3ZN1A 4ESBA 2FMYA 3L2CA 1O57A 2EFOA 1XGOA 2YX4A 1K6OA 3F8FA 2DAOA 1ZG1A 3HSFA 3K2ZA 1RUOA 3R60A 3WTTC 2LF8A 2HZTA 1IXRC 1OMIA 3CUQB 4CHUA 4IJAA 5FLXZ 2NNYA 2L02A 2OQGA 5BS6A 3SZTA 1JHHA 5BOXA 3P9CA 3AAFA 4MEXF 4HYEA 4N9HA 2EA2A 4RGUA 3VODA 4HDUA 2STTA 3HRTA 2Q2EA 1XDSA 1T0FA 2Q8KA 2GA1A 3EDPA 4LLLA 2W84A 4IF4A 2F5FA 2PMHA 5HDGA 2DQLA 1QGPA 3LA3A 2HKXA 2V1DA 3KP6A 1Z7UA 1YQAA 1ON1A 2CW0F 2P7VB 3HOSA 4G7OF 5ILUA 2O0YA 3T0YA 4PDKA 5DCFA 3CLOA 4I01A 4FX0A 4LLGF 2DTRA 5ICFA 3FZVA 1F9NA 3ULQB 4U7DA 2MLKA 3LAPA 1LB2A 1MD0A 5BPDA 4YIFA 2LDUA 3DEUA 2EFNA 1YO5C 2IPQX 2G9WA 1LEBA 2QBYB 1SMTA 4R79A 4MQVA 4HW0A 5E1ZB 3KZZA 4LG0A 1XCVA 3MQ0A 1PP8F 2P6TA 1FC3A 3O6BB 3ZMDA 1C0WA 1O7LA 1HBXG 3WGGA 1F4KA 4OIOF 3LSTA 2A6EF 2EFPA 3I4PA 2XGXA 3BPXA 3RYRA 2KKOA 5E8IA 4LB5A 2P5KA 3M8EA 2JT1A 4GYGA 4HBLA 1IUYA 4JK1X 3LWFA 3GW2A 3GFMA 1FYMA 3WTXC 4RAYA 3HUGA 2RNJA 3V8JA 5LGTA 4GGGA 1LDDA 4I0AA 2WTEA 4UVCA 4PGHA 1Z1DA 5FB2A 1MDMA 4I2OA 5HLIA 3M7GA 3E6MA 1HKTA 4BHBA 1EV7A 2L3DA 2A5YB 3F23A 3R6SA 4OMZA 3HSEA 4CZZA 1B6AA 5CLSA 4HX8A 2M87A 4KICA 1Z6TA 4B09A 3C7JA 5CVIA 5FO5A 2XAHA 3CDHA 4A5MA 3KZYA 1G3WA 3K1MA 2KRFA 4EMSA 4MEYF 1EH6A 1MKMA 3BROA 2OBPA 4U0YA 2CGPA 2V79A 1S3JA 1MJBA 3W6JB 2DO7A 2KJBA 1MJ9A 2BEOA 3ZMVA 5ICGA 3TO6A 3E5XA 1FZPB 2ISZA 3F72A 3F8CA 3HTSB 4G6QA 1AOYA 3GFJA 3V8KA 1HKSA 1IW7F 1ULYA 3E5QA 1SFEA 4M6XA 3TO9A 2Q0OA 3MAJA 6PAXA 1W7PD 1P6RA 1FYKA 3DKWA 5LHHA 4EM0B 2E7WA 2K02A 3WTWC 4IXAA 3W6KB 4JQFA 3U2RA 5LGNA 4BH9A 1BC7C 5L3BA 1BI2A 2TDXA 4A5NA 2W57A 4ASNA 4U7BA 2FMLA 1YS6A 1JE8A 5BQTA 4RGXA 4EV0A 5E8GA 3KEQA 2BBYA 1T39A 3EETA 2ZXJA 4XRFA 4GXOA 1LNWA 2HS5A 3KLOA 4FT8A 4ZYGA 5D8LB 1XSDA 5E17F 3GYHX 2VE9A 3GZ6A 1G4DA 4EJTA 1BI3A 3Q9VA 2PN6A 5IT3A 3BJ6A 4RS8A 5A2QK 1Z6RA 4KT5C 1O3RA 2FF4A 2STWA 1B9MA 3GXOA 1K78B 4XBFA 1I1GA 1P4XA 5D6EA 1BN5A 4AIHA 3O3KA 2COMA 2W24A 2YPRA 3IRRA 1CGPA 3WU0A 5ED4A 1P4AA 3F3XA 1ODDA 1G3TA 4S05A 3OV8A 2K7LA 1HW2A 1ONVA 5LHGA 1KGSA 5DCMA 3T5XA 5ILSA 2EV5A 2Z99A 4Q4ZF 4ON0A 3GO5A 4MNUA 4EVIA 2ZKZA 3HOTA 4RGSA 2NRAC 2ZCWA 4YG2F 5K5RA 1L0OC 5A2QZ 1Z91A 4NQWA 2QQBA 1T2KA 5E20A 2D2WA 5BPIA 3I64A 1P2FA 4RAZA 2O61A 1G6NA 3HRUA 3K69A 1TQPA 2QQAA 2HDCA 5DD4A 4LK1F 4EJWA 2VT2A 2P8TA 2ESHA 3VEPA 1SD7A 3MFKA 3BJOA 1QNTA 4PCQA 2A07F 1BIBA 5HS9A 2M1BA 2M30A 1S8NA 1UHMA 4HF1A 3EUHA 4B8XA 2PLYA 2K4BA 2YR2A 4EM1A 2CWEA 4BNCA 1B1BA 2FNPA 2LSOA 4P55A 3K0LA 3R4KA 3TKYA 4BHCA 4AIJA 4DNCA 2LF7A 1SD6A 1DPUA 1TNSA 1NHAA 3FMRA 4N9IA 5LHIA 2FXAA 3HRMA 3B73A 2E7XA 4L5JA 1E2XA 3BJAA 2DLLA 4GYIA 3RKXA 4EJUA 3WTUC 1LDKB 3RPUA 4R1HA 1CF7A 2DK8A 2M45A 2P5VA 4G9YA 1BM9A 3F6VA 1KU9A 3F8NA 1UFMA 1W7PB 4ETSA 3BZ6A 2P6SA 4OOIA 3RPQA 2L4MA 5H20A 4OINF 2IT0A 1QQIA 1FP2A 4OIQF 2PMUA 1K7AA 5H6RA 4RB3C 2F5EA 4YFNF 4ENNA 4IVNA 1PDNC 3T8TA 5BMZA 3FWEA 5H6QA 4HAMA 3JSPA 3VFZA 3DPLC 1WWXA 4BAYA 4HX7A 3L9FA 2XAFA 5D6FA 2NS0A 2V6CA 4M73A 4MTDA 4KYWA 2DK5A 1OPCA 1SMYF 1PP7U 3SHFA 4QLCU 2AS5F 1KYZA 2FQ3A 3MEXA 4KIBA 1Q1HA 3QAHA 3VB2A 1ZRCA 1FNNA 3RJPA 2YSRA 5CVJA 2QWWA 3FMQA 4IHTA 2WWYA 3FXUA 3BWGA 1YYVA 5D5UB 4I09A 4CICA 3IWZA 3HSRA 2HOEA 2J5OA 4Y17A 4YFKF 1K79A 3QP5A 5CYVA 3U1DA 2PI0A 4F7ZA 1UHWA 1J9IA 1U5TB 3RI4A 2H6CA 1YFHA 3L00A 1VTNC 4UVAA 2J5PA 3TDZC 3IHUA 2BV6A 1XN7A 4ZYDA 3P9IA 2CO5A 4OMYA 5AIPA 1KU2A 2GA2A 2IA1A 4BHPA 2K4JA 1IN6A 1ZYRF 4MQ9F 3V7SA 3J7AO 4P9UA 1HSJA 3S2WA 4KDPA 2JZYA 5K5QA 4HLYA 1BJAA 3NQOA 4UVBA 3KP4A 5CVUA 3L7WA 1LEAA 2VBYA 1FLIA 1B59A 5DEQA 3JAMK 4P96A 5F1RA 2A3SA 5E1XA 2M5WA 1FWZA 2Z5UA 1FBUA 2EK5A 5DV5A 4EM2A 3D5LA 1WRJA 4QWQA 5CVRA 3KCCA 1DP7P 3I5UA 5L3CA 4A12A 2FSWA 4HX4A 1UB9A 2RDPA 1V3FA 3I59B 5KK1A 1SFUA 2RVCA 4LB6B 4Y13A 1ZG5A 2VT3A 4BQAA 1MGTA 3E6BA 1R1TA 3HYIA 3JW4A 4A6DA 3K1PA 4M74A 2DBBA 1OYIA 2JSCA 1USSA 4RGRA 4OIPF 2QYOA 1R22A 2XASA 2NYXA 2XAGA 1BIAA 1HSTA 2FA5A 2GIVA 3JAMZ 4ENMA 3MZHA 1D3YA 1BOAA 1U5TC 2R7FA 4AVPA 2OU2A 3QU3A 3KLNA 5FD6A 2G7HA 1XMKA 2Y48A 2BE5F 3G3ZA 1MZBA
chains in the Genus database with same CATH superfamily
2ME6A 5F64A 4BJ6C 2RNGA 3ROUA 2R5YA 1M1EB 4C2UA 1USTA 1QU3A 2VN2A 2KFDA 3GVAA 3WHCA 3BP8A 3Q9SA 1O7FA 3K4LA 2OAZA 3TOAA 4EQQA 1S9HA 1FYLA 2BYVE 3KP5A 1J2XA 1FP1D 1T33A 1SEUA 1WJAA 1H9TA 2WA0A 3A03A 3SEZA 2EINH 2Q2EB 1U8RA 5E18F 1B4AA 5KHDA 2X85A 4FCYA 2IVMA 2FOKA 2VL8A 2LY2A 4C2TA 1HKQA 3CC4I 2QQ8A 2ZMEA 2ETHA 2R7DA 4EGYA 3SZPA 2HNHA 2FU4A 2HTSA 3KEOA 1WH7A 3FXOA 1Z9CA 3BG6A 1X58A 3W3CA 2A68F 1YW9A 2L01A 1JKOC 2IW5A 1IRGA 1S7AA 2O7OA 2QM3A 1HXDA 4S0HB 1IRFA 3K10A 4H4KC 4DOZA 3HL2A 3H3ZA 2DPDA 1W36C 2MSYA 2IS2A 5HLHA 2G0EA 4IOAF 2QVOA 2ID6A 3JRGA 3KE2A 1QZYA 5FKOA 1H0MA 2PJPA 4Q47A 1NK2P 2XPUA 1ORKA 5FRNA 5E1WA 4JX5A 3UKGA 1IAWA 1ACIA 2KL4A 4KT6A 4RDUA 3JR9A 4B43A 1SVOA 1W0UA 3S1RJ 3RQIA 1ZR2A 1AU7A 2CQNA 4XRSG 5LEKA 3OSGA 4LK0F 1ZH5A 1JUMA 3CF2A 2CUFA 4HLXA 2VC0A 4XOTA 3FX3A 2HPMA 3RZOJ 1HW5A 3EUKL 4M6YA 4CXFA 3S1MJ 1Z3XA 1G3YA 1U0JA 2E5ZA 4II3A 3K6GA 1HDPA 2JVGA 3DXJF 2MABA 3WTSC 2JUGA 4L18B 2HKOA 1VQ6I 3MKLA 4PFPA 3DV8A 4Z2YA 2JPCA 3F8MA 3CCJI 3G6EI 3BG3A 2Q1ZB 4LG0B 3LA7A 2DDBA 3C2HA 2CQXA 3A0HC 2KIMA 3HIFA 1RRJA 2L7KA 2IS1A 3R0AA 2HQNA 2XAQA 3X2QH 3MD2A 5CKTA 4BEHA 1NK3P 1YRNB 2V9VA 4I0BA 1P7IA 3GTQJ 2XKOA 2RQPA 4WCGA 2DA6A 4UUSA 2Z3YA 3PSIA 1BOBA 2FD5A 3A01B 4XR6A 5HDKA 5LD2C 3ASNH 2M4GA 1BBYA 1T95A 2DPUA 5L3DA 2A61A 4UV9A 3BC8A 2BOLA 5ICCA 2ZNYA 2O3FA 3GFIA 3C3WA 4ESFA 2KJCA 2HEOA 5IP9J 3ZCOA 1ZR4A 1BI1A 4BE1A 5DM7F 2H27A 3N97A 1EH7A 3E7LA 3IRQA 2LNBA 3D5RC 1XS9A 1ZLJA 4NC8A 2LH9A 3PQJA 2X51A 4A69C 5DYMA 1ZK8A 3HXLA 2QCOA 2R7TA 3WGHA 1T0FC 2HXOA 3HUGB 2NVUB 3ZRGA 5F6FA 2DA7A 3UNGC 2LLKA 3OYLA 1YJWI 5E3NA 2AQEA 4M3BA 2CQKA 4XSXF 3VOEA 2FJ1A 1AKHB 4Q5SF 3WTVC 4IRIA 4XLCA 3R61A 4BQNA 2R7SA 2COBA 1H8AC 3ML6A 3CCQI 2A69F 5D5WB 5E3LA 4GCVA 1YI2I 2ISYA 1XSVA 1FTTA 1WI9A 3V7CA 3QPLA 1ZN2A 1MDMB 1PJRA 3FM5A 1QPMA 1YLFA 4OU0A 2K9MA 2XF6A 5DDGA 3L2UA 4PUSA 2VBWA 3GTPJ 1G2HA 4I02A 4Y52J 1TWCJ 2Z9OA 3C1DA 4L9JA 2KQRA 2L9NA 3GZNB 1OLTA 1W0TA 2M2EA 1B9NA 3WHBA 3BR2A 1JHFA 5D8KB 1NH3A 3GF2A 3H9JA 2BW3B 1YIJI 2BY0A 4BE0A 3ZMZA 4Y15A 3T1BA 1ETXA 3K4NA 3K9TA 2A6HF 3CP2A 1ZGAA 2V1XA 3C2BA 1SD4A 3LOCA 2MC3A 3N4MA 3CJRB 4M9SA 2CG4A 2E2IJ 1Z05A 1HQCA 2C6YA 3J80K 3CCVI 1Y56A 4KA4A 2ZO4A 3SXYA 1Z0XA 3TQNA 2K27A 2P7CB 1OYYA 5EEHA 3HBLA 3F22A 4AIKA 1FPQA 3DWLE 5B1BH 4YIRX 3OWTA 5LEJA 2E1NA 2NS7A 2HR3A 4L5IA 3HOZJ 3GUDA 4U0VA 5ERIA 4F55A 4GDFA 4DBRA 1IN7A 3JRFA 5K1YA 3KP2A 2AHQA 2DMQA 4DZPA 5FRMA 1IXSB 2VQHA 3AL0B 3LQQA 1DQUA 2CQ7A 1ERDA 3LNQA 2AXTC 4RLFA 2QA4I 4DIQA 1R5GA 5E79C 4LIUA 3I4NJ 2OQRA 4BBRJ 1VFCA 3FM3A 2DODA 3ELKA 5HS8A 3CC2I 1OYWA 3K70C 2MG4A 4UXNA 4CSWA 3MVPA 3DTIA 2JRTA 1R5HA 3P7NA 2HQAA 3CUQA 3BG7A 3WE2A 4RB0A 1JKRC 3E97A 4ENKA 3SEQA 1XG1A 2M3AA 3CJQB 1FOKA 3RPUD 4CZCA 1U3EM 4OIRF 3OYBA 3ABUA 3QP6A 2F5DA 3DEWA 4OAZA 2IEKA 3ZGKA 2JJ7A 3G1OA 4HF2A 1XGMA 3J80Z 3S1QJ 3MZYA 1X1AA 4IHVA 3U9GA 4CCJA 2DFHA 5C4XJ 3WTZA 4HA8A 4DYCA 3WU1B 4FQGA 2OZ6A 4PZJA 2K3PA 3Q0VA 1A5JA 5J8CA 4U0WA 1VQ7I 3HHGA 1I50J 3IC7A 5FD5A 3ZQFA 2CFXA 5TRDA 1X1DA 2LKPA 4F52A 2GM4A 2DU9A 3L2WA 1TW2A 3TP0A 2CJJA 2L7MP 2NVQJ 1IF1A 5LBQA 3WG9A 3HOWJ 3CCLI 2GOMA 2MLGA 5BNGA 1DDNA 4A3KJ 4U87A 1JJ6C 3RYPA 2R93J 1T98A 3DTKA 2ESNA 2VOPA 1WKMA 5FKMA 2RQQA 4OWRB 5FGMA 1E3OC 3MCZA 2O8XA 2K85A 2B0LA 3SFIA 3IL2A 3B02A 3O2PE 5J6XA 2DA5A 2M8EA 1I5ZA 3SQNA 2GZWA 2XF7A 5JHFA 2ZXIA 3CCYA 4HEA2 1I27A 3KYLA 3VPRA 1E0EA 4AD9A 2XKPA 3QU6A 3PNVA 5CVVA 3NWTA 2WAQA 4LFUA 1PUFA 5EG0A 2FRHA 1MZBA 1A6IA 2RC4A 3IH3A 4E7ZA 4ZYEA 3PO3J 1YW7A 3BT9A 3EUAA 1R36A 2XROA 2LBFB 3RZDJ 1S7OA 1W5SA 1ZHFA 1ZG3A 1R23A 2JWTA 5L3FA 4HDVA 2GWRA 3KPHA 3FXRA 1TWFJ 3TO7A 1AWCA 1LDJA 4MIMA 2LC2A 4UUTA 3WU2C 1EH8A 1GT0C 1O3QA 2JPBA 2O6GE 3TGNA 2DFFA 4BE2A 4CCOA 4QIWN 2VB6A 4BGDA 2R5ZA 2QBYA 2HTJA 3AL0C 4II2A 2R7UA 1UG0A 2F4MB 4D7MA 4JBAA 2IP2A 3H35A 4NNJA 5J4VA 3JRDA 4HF0A 1MBKA 2XRNA 1F36A 3H5RA 3DPTA 2H6BA 3HKZA 5L3GA 1GHCA 4X0GA 3GFLA 1TLHB 1D8JA 4Z6YA 2QSHX 2AXLA 2D1VA 2JTVA 4ITVA 1LKXA 3OYKA 2IRFG 3CQZJ 1ETQA 2VQCA 2K9NA 2VKEA 4KMFA 5JHUA 2KIUA 4WXCA 4H0EA 2ZSIB 3ZXSA 2DW4A 4M71A 5IOYA 1VNDA 2DMTA 2F2EA 5LFAA 2F5CA 3LQRA 3L09A 1R00A 1D0ZA 2LR8A 1ETVA 5DCMB 3ZQ7A 2L2OA 3HB9A 4DQ2A 3BQYA 3QPHA 4HV5A 4N0BA 4TV7A 4M72A 5KNLA 2PG4A 3BR5A 1GDTA 2MA3A 4D0PA 3JREA 2CV1A 2L5QA 2V9KA 2M0MA 3E3VA 3SYTA 2LVSA 1A04A 5FFZA 1I1SA 1WJEA 2EZHA 2LP0A 3H92A 4I7HA 3HRSA 4M9XA 4XNFA 4UV8A 4R8HA 3E6CC 1RZ4A 2FNAA 5GPAA 3U1KA 2FEZA 4A3FJ 3HOYJ 1X3UA 1XD7A 3LA2A 1XSXA 4NHJA 4NQWB 4KIGA 3VSKA 4IPAA 1WVRA 5M3FJ 4ZZDA 2CU7A 3ERED 4WWCA 1R1VA 3A0BC 2BY3A 3J81K 1JTYA 1XMAA 1F1ZA 2CUJA 1SC7A 2H1KA 3MMYB 3V4GA 1WJCA 3CO6C 2RAEA 4MHGA 3A2KA 1XPXA 2BVMA 1X3ZB 1ZELA 1XC5A 2PFBA 4FX4A 1REPC 2PJRB 4ZDPA 4L9TA 2VQLA 4E70A 2ZFWA 3NARA 5B5EC 1RPWA 1S7EA 4RB1A 3DLAA 2FUG2 3E1SA 2L54A 3REOA 5GTIC 1N75A 1IN5A 2PQ8A 1SANA 1LVAA 3MWMA 4KNYA 4XN3A 1AA7A 3MN2A 3BOQA 2A6TA 3R0JA 2EV6A 2DTZA 1JJ8C 5K7FA 2QLZA 4XK4A 2E34A 4EJOA 1T56A 1XTAA 1JTXA 3KP3A 1POGA 4ESJA 3JTGA 2E1CA 3E6DA 3I3LA 3AG1H 2X6XA 1BL0A 4A93J 5FFXA 1IG7A 1I6HJ 1S29A 3Q0WA 3TOBA 3JRHA 4BXUA 2HYGD 2IA2A 2D1HA 3IAS2 1BR2A 2F6CA 1RKTA 3KETA 3K7AJ 2K5CA 1R4MB 2EFQA 2ELJA 4AYBA 3PFIA 1I39A 5EZHA 4AM3A 3I9V2 3RQ4A 1Z3YA 3LSGA 4BBSJ 2OZUA 3J81Z 4AWXB 4E7IA 2K86A 3C18A 2IGOA 2KT0A 4DW6A 2D45A 3RKYA 4HQMA 4DGWB 2VKDA 1ON2A 3GX4X 2NAZA 4U88A 1X4PA 4A3GJ 2UWMA 2HQRA 4DYRA 3L2RA 2E71A 1IN4A 2JA7J 2DT7B 3H3UA 4A0ZA 3OYEA 1CF7B 2KPMA 3T8RA 3CESA 2OUMA 1DGRM 3COAC 2PBIA 1KQ9A 4CO8A 4XRSA 1XCBA 1V4RA 4XMYA 1WSUA 1ZRDA 5KVRA 2EA4A 5D4RA 3E5UA 5HNFA 5M5YJ 2WV0A 2DA3A 4E6KG 2CYYA 3GTLJ 3PQKA 5HOOA 3K1NA 4KJZA 5LRSA 1ENHA 3D1NI 3PSFA 4XOPA 3HOUJ 1BI0A 5HS7A 1MJAA 4WXDA 1TP4A 4MFDA 3LSPA 2IS4A 1TBXA 4FTHA 1I3AA 3BR0A 4IOCF 4LJZF 3FXQA 1RUNA 4KITB 3KX2A 2Z16A 4HPQA 4L0YB 4BY1J 2NVYJ 2ELHA 3TL4X 5JVTA 5LGUA 3CUQC 3GTJJ 2EILH 1G3SA 4KN4X 3GWZA 2Y0SN 2ACJA 2GXBA 3QYBA 1TW3A 2L7ZA 4L9VA 1N25A 1UAAA 4LLNA 5HODA 3BDDA 2NNNA 1NG6A 3CD6I 3WE3A 4XKCA 1OR7A 3TW6A 2BHYA 3DFGA 2XIGA 4O6JA 1B8IB 2XF5A 1VQMI 3U21A 2OA4A 1MMNA 3HGGA 4CYCA 3SDGA 4L9NA 2KLOA 1XDUA 2RGVA 3WGIA 3FXJA 3EYYA 1ZRFA 3FKJA 1TQIA 2XV4S 3LAJA 3I0TA 4BYYA 3I56I 2ZBKA 4MLOA 1X4OA 2ELKA 5H2FC 2DMNA 2LRDA 1J59A 3H9QA 5JI6A 2KIFA 3BPVA 1U2WA 3EUHC 3ECOA 5JR3A 3L1PA 4P9FA 1FSHA 1J5YA 1LVKA 5J1RA 1S72I 5EEAA 3PUBA 4E7JA 1YJ9I 1JKPC 1KQ8A 4V2GA 3CDIA 4PK4A 4WF2A 3ZOBA 5HLGA 1LE8A 2MD5A 1I6XA 1EKEA 2HOSA 4I98B 4ZDLA 4ZH4F 3JRCA 2MH2A 1SVLA 4PJNA 2R7RA 3CMEI 3I54A 1HW1A 3M8JA 2M7BA 3IKVA 3ZMUA 1K78A 3CCRI 2EQRA 2KIQA 5DUKA 4A3DJ 1JXSA 1Z67A 3BG5A 2GQQA 3A1YA 2RV8A 1MH3A 2DOAA 1MMDA 4GRIA 4IKFA 2W25A 5EF6A 1QZZA 2M0CA 1D5YA 1SD5A 2DYSH 1FT9A 2TCTA 2UZKA 3IAM2 5HLTA 2XAJA 3H1CA 3C2GA 4KN7X 4KMUX 1UZCA 3J7ZI 4AU7A 3QYEA 1W5TA 5LLQA 1DPRA 2I8DA 3OS0A 2HWVA 3ECHA 3QOPA 2XHKA 3HOVJ 1Z7LA 1KZHA 3D5SC 4HQEA 1R7JA 2HFHA 5JFRA 2EB7A 5TJJA 1IZ1A 2JUCA 2W82A 3FXLA 4JX4A 2E60A 1U9OA 2XSJC 2CUZA 2YS9A 3ZMSA 3IKTA 4F91B 4XL9A 4GO1A 5EJCA 5KAFC 1GVDA 1IN8A 3ZP5A 2K9LA 2HYFA 4PGGA 2IJLA 4MGRA 2VI6A 1FOWA 4MTEA 3FMSA 3OIQA 3D0SA 3F21A 3HHHA 4IRGA 2UXNA 4XRMA 3AKZA 2X0LA 4NC7A 1X1CA 3CO7C 3JSOA 1IXCA 3OR1C 2GXAA 1MSEC 3GMEA 2DFIA 3FK6A 3GEZA 1MMAA 2QZ8A 5J47A 5CQGA 2CFOA 3VSLA 2JVHA 3W2AA 1STZA 1Y1VJ 2YU3A 5DS9A 4I76A 5DUIA 3G4SI 1JUPA 1T38A 1J09A 2RN7A 1J0RA 3LSJA 5FLMJ 1XMXA 2CMPA 3CC7I 5J1UA 1WJ5A 2HDWA 2P4WA 2ZNZA 2W85A 2H09A 3CMMA 3JRIA 1DP3A 1ETYA 1QO0D 5AIQA 1TNTA 1QBJA 1RKWA 4A0XA 2Y0MA 4G7ZF 2Y9YA 3EYIA 4O3MA 5IP6A 5M5XJ 1IRZA 2VODA 2EIMH 2NOJB 1U78A 2L9RA 1J7KA 1O3TA 2DA1A 4HV6A 4IHYA 2V1UA 2VC1A 1VQLI 1ZARA 4K2EA 2VE8A 3PIPF 4HZFA 3IP4B 1MNEA 2EV0A 4YIIA 4G6DA 1F43A 2E2JJ 3F8BA 3Q3SA 3FBNB 4LGWA 3BY6A 1LQ1A 2EZLA 1U6GA 1ZTRA 2KZVA 3P9KA 1FX7A 2M34A 1D8KA 3K4JA 1Y39A 1KU7A 2R3SA 1XGSA 2YX7A 2JA5J 3P5JA 3M8FA 2IGNA 1OCRH 2VKHA 4IHSA 3RTRA 4UNOA 2P5LC 1EF4A 2UXXA 3AG3H 2XGDA 1FOXA 4HG2A 2GAUA 2W1OA 3MKYB 2M7AA 5DD8A 1A36A 2L4AA 1R4NB 3ZPLA 2E2HJ 1XGNA 2NS8A 4WXHA 1L3LA 2XGEA 1X1PA 4B3AA 2FBKA 4J01A 1KU3A 3ABMH 3GLXA 2R4GA 3GZ5A 3AG2H 3G73A 4ENJA 2R5YB 2DT5A 2XGCA 2F4IA 1YX5A 3LSIA 5J8FA 3G2BA 3CJNA 1OKRA 1QHHD 5IT9K 2H8RA 4ZZLA 1MSFC 1YS7A 1RIOH 1FY7A 3ONQA 1MBHA 2MH9A 4PJLA 2R7XA 1IGNA 4UUVA 3DP7A 1PVEA 1R9TJ 2PEXA 2JMWA 4HSTA 3RDIA 4IEJA 2HDDA 1W7PA 5TISC 1R58A 4L0ZB 4B1RA 3L2QA 4O5VA 1H89C 2LKSA 5IYBJ 2ZMEB 4LD5A 2XVCA 2X6YA 3LFKA 4C30A 2F5VA 1ZAOA 2RKHA 1RR7A 2XSDC 3S15J 5ILVA 1ZLKA 5FLVA 3JCUC 2HU9A 5ICEA 2A05A 2OD5A 3A4CA 4XSZF 4B47A 5L3EA 4HSRA 2VXZA 2KP6A 4F3QA 2OJED 4XORA 3NRVA 1TTYA 3G1MA 2WC2A 2WAFA 4XLNF 4AIDA 3TDUC 2VBXA 3BQZA 2NVXJ 3OS2A 4A2UA 1LJ9A 1IO2A 4PJJA 3H5AA 1BC8C 1T08B 4G8XA 2YUSA 3SFZA 1SFKA 2NVTJ 3DEEA 2DI3A 2H94A 3ISPA 5LRRA 2LKXA 1HOMA 5D5VB 3HTUA 3I58A 3CCSI 1O3SA 3JRBA 4A0YA 3CUOA 1W1WE 4NB5A 3HOXJ 1S6LA 2IXSA 4HOBA 1QRYA 1ZREA 5FKLA 1B72A 5IT9Z 1QPIA 2BXYA 4XIDA 3QRFF 3CCUI 3GBGA 3DBRB 3RIRA 1K6YA 2DOFA 4CCKA 2FE3A 4D7NA 4A3IJ 1YIOA 5AONA 3JTHA 4BXXJ 1T6SA 3BCBA 2QENA 5HVQC 2Y2ZA 3DF8A 3DQVC 3RKWA 1R1UA 2FBIA 4PJ0C 4M9ZA 1YTYA 3M1EA 5EEGA 1GUUA 3IWFA 2W00A 1OR7C 3CTAA 1APLC 4BEHB 1FJLA 1WJBA 1YX3A 2GXGA 1K83J 1SAXA 3AFHA 1Y0UA 1GXQA 1GVJA 2CV2A 1KYWA 2QQ9A 3KZIC 1V54H 4ANJA 2PJRA 3ABTA 3I53A 1YW8A 2FBHA 3ZQHA 4BKXA 2D5VA 2BGCA 2L9VA 4C2MJ 4Q48A 3CMYA 5FROA 2HPIA 1MMSA 3CDLA 2IBDA 1U5TA 1FBQA 2QGUA 4M3GA 4G12A 2N8GA 1H9GA 4NUBA 1EA3A 3EQLF 4CDGA 4A3BJ 4BJ5C 2MC4A 2KISA 3WODF 2ADUA 1BR1A 5D4SA 5HDNA 2VLAA 2ZSHB 1K4TA 3LSMA 4KIFA 3LFUA 3RSNA 3TW7A 3KFWX 2ZJ2A 1DGWY 1ZGWA 4G7HF 3OOUA 4EATA 4EJVA 2ZMEC 4YEJA 3H9GA 5B1AH 1FBSA 3HG9A 4LMYA 3Q0UA 5CQEA 2X4HA 3FF5A 3FHZA 5B3SH 3M07A 4XM3A 4WX9A 1E17A 1TQMA 1P92A 1W4MA 3M9AA 1J75A 2MGQA 2O9LA 3ZMTA 3OYHA 4HRIA 4Y4RA 1SFXA 2CW7A 3F6OA 4LG3A 3VDXA 3GCMA 2BY2A 1D5VA 4KUMA 3Q5FA 3FXKA 1OISA 3OIPA 1RNLA 3QPTA 2Z33A 4CGZA 3GTOJ 2EWNA 5GAEJ 4QTRA 2EJRA 3NEUA 4AUXA 4BQQA 2EBIA 2IA0A 2OV7A 4MO7A 2ECBA 1XX5A 3OYCA 1MBEA 2K40A 2Y69H 1O4XA 1UCRA 3I71A 4P5OA 2X9DA 4ZYHA 1Y1WJ 1KA8A 2EFWA 1MBGA 3OOPA 2Y75A 1PYVA 1YG2A 5J4YA 1GXPA 3VWBA 4CYDA 5K5OA 3PL8A 2DQRA 2OCCH 4EGZA 5FLXK 1P4WA 4UHTA 4A6EA 2QSFX 1JUSA 2XAUA 3I59A 5EGOA 3V8LA 1MBJA 3V7RA 3ZN0A 1JGSA 5C3EJ 4KFCA 3PJRA 4V2FA 4FISA 4EEFG 5D5XB 1WFXA 2XUBA 3BR1A 1DUXC 4DZJA 3WTYC 4FHTA 1WQ2A 1MBFA 2VBZA 2VONA 1YOVB 4S04A 4XLPF 1V5FA 1RI7A 4IRHA 2O03A 4FE4A 5F0CA 1F5TA 3KP7A 3G1LA 3PNYA 4RMNA 1X3WB 3HZJA 2VOOA 2K3FA 9ANTA 4LITA 1FMVA 1FSEA 3OYAA 2W48A 2P81A 3MKZA 4RB2C 2QUFA 1X19A 4IHXA 2E1MB 1ZGJA 2CSOA 2HGCA 2MBFA 4G94A 1W5CC 2KHMA 2G7UA 5DTDA 4YFXF 1A31A 1KQ0A 1XB4A 4WK8F 5CJ9A 1PUEE 1FIPA 2AO9A 2M9HA 1TT5B 1VQKI 3ZN1A 3OYMA 4XICA 4ESBA 3KYDB 4P1WA 2FMYA 3L2CA 3FHNA 2B7EA 2F48A 4N4NB 3NWSA 5GADJ 1O57A 2EFOA 1XGOA 2YX4A 3TEDA 3F8FA 4YRVA 1K6OA 2DAOA 1VQ8I 4X6AJ 2H1LA 3ZQCA 5EDNA 1ZG1A 3HSFA 3K2ZA 3M1CA 2R7OA 1RUOA 3R60A 3WTTC 2LF8A 2XC7A 4B3XA 3DU6A 2HZTA 1IXRC 5CPRB 1OMIA 3CUQB 2OPTA 3K2AA 4CHUA 4IJAA 5FLXZ 2NNYA 1HC8A 2L02A 3S2HJ 2OQGA 1OCPA 5BS6A 3CCMI 3SZTA 1IDZA 1JHHA 1LFPA 4CH7A 2L0KA 5BOXA 3P9CA 3AAFA 1N78A 4MEXF 4HYEA 4N9HA 2EA2A 3S16J 4N4OB 1ITYA 2HZDA 4RGUA 3VODA 4HDUA 3BLYA 2STTA 3HRTA 2DJIA 2Q2EA 2ZJPF 4BUPA 1XDSA 1T0FA 2Q8KA 4QSHA 2BHZA 5EYRA 3H5NA 2GA1A 3EDPA 4LLLA 2W84A 3CF5F 4IF4A 2F5FA 5J1YA 2GIZA 2PMHA 1DU0A 5HDGA 2DQLA 1QGPA 3QYFA 3LA3A 2HKXA 2V1DA 3KP6A 1Z7UA 1YQAA 4IX7A 2VJ5A 1ON1A 3ESWB 2CW0F 2P7VB 3HOSA 4G7OF 5ILUA 2JSPA 4Y7NJ 2O0YA 3T0YA 2IAIA 2WB1A 2KRHA 1Q1VA 1JT6A 4PDKA 5DCFA 3CLOA 2P0WA 4I01A 4FX0A 4LLGF 2DTRA 3BR3A 2DXIA 2ZXWH 2HOAA 1ZQ3P 4AYBN 5ICFA 2LOOA 2MD0A 2IS6A 3FZVA 1F9NA 3ULQB 4U7DA 2MLKA 4UY8I 1MNMC 4JYKA 3LAPA 1PUFB 2HOTA 1G59A 5EG0B 1N77A 1LB2A 2BVLA 2JA8J 1MD0A 4BY7J 2JA2A 4ZTJA 4OAYA 5BPDA 1MW7A 1TZLA 4YIFA 2LDUA 3DEUA 2EFNA 1YO5C 2IPQX 4KISA 2E1MC 2R5ZB 2G9WA 1LEBA 4Y3OA 2QBYB 1SMTA 4R79A 1YE9A 4AC0A 4MQVA 1V5EA 2DCEA 4HW0A 5E1ZB 3KZZA 3FKIJ 4IL6C 4LG0A 2ME0A 4RBOA 2BZTA 1XCVA 3K4KA 3MQ0A 3S14J 3S3NA 2HVQA 1PP8F 2P6TA 4M3FA 1D0XA 1FC3A 1UHSA 1YRNA 3O6BB 1QA6A 3ZMDA 1C0WA 1O7LA 3HGYA 1HBXG 3WGGA 4ZC3A 3A01A 1F4KA 4OIOF 2HYJA 3LSTA 2A6EF 2EFPA 3I4PA 4CCLA 2XGXA 3HEFA 3BPXA 2PX9A 4RA2A 2DYRH 5TGTA 3RYRA 2KKOA 5E8IA 4LB5A 2E1OA 2P5KA 2LFBA 3M8EA 2JT1A 4GYGA 4HBLA 1IUYA 1X2NA 2VUMJ 4JK1X 3NAUA 4PSXA 4XKWA 3S3MA 2VQGA 3LWFA 4Y33A 3GW2A 3GFMA 4RM3A 4JX6A 5IYDJ 1FYMA 3WTXC 4RAYA 1Y8QB 4XQFA 1TWGJ 3HUGA 2V6EA 1IJWC 2RNJA 3V8JA 4GFBA 3V42A 2BXZA 5F04A 1T8IA 2LG4A 5LGTA 3FXMA 1AKHA 2X6OA 1VQPI 5F27A 4GGGA 1LDDA 3HJEA 3N05A 3CMAI 3M4OJ 2DDAA 5JLWA 4E7SA 1D1AA 2CH0A 4I0AA 2CUEA 2PMZN 2WTEA 3OL4A 4CCNA 4UVCA 2HVSA 3OSFA 4PGHA 2JRMA 1Z1DA 3FK7A 5FB2A 1MDMA 4I2OA 4J00A 5HLIA 3DKXA 3M7GA 3E6MA 1HKTA 4BHBA 2VPRA 4HNUA 1EV7A 2L3DA 2A5YB 3F23A 3R6SA 2CS3A 1I3QJ 4OMZA 3JRAA 1VZ0A 5F08A 1OCTC 3HSEA 3S8PA 4CZZA 1TC3C 2DJNA 2VJJA 3OIOA 3OR2C 1RR8C 1B6AA 5CLSA 2O5RA 3W2WA 2BW3A 1WJFA 3ZQGA 1WGXA 1X1BA 2M4KA 4HX8A 1WPKA 2M87A 3SDBA 4IQJA 2WBMA 4KICA 1Z6TA 2KRCA 4B09A 2ZB9A 3C7JA 4UB6C 5CVIA 5FO5A 2XAHA 3CDHA 4A5MA 1LFUP 3KZYA 1OCZH 3CCEI 1A6QA 2X48A 1G3WA 1TT0A 2F4OB 1A35A 1CQTA 4BJTA 2Y30A 2DA4A 3K1MA 2KRFA 4EMSA 4MEYF 3S17J 3OMYA 1U8BA 2JK3A 1EH6A 1MKMA 4IO9F 3BTIA 3BROA 2OBPA 2R0QC 2LY1A 4U0YA 1ETKA 2CGPA 1BA5A 2V79A 1S3JA 1GV5A 1MJBA 4C3JJ 3W6JB 3HPHA 3G71I 1ETOA 2DO7A 2KJBA 5IP7J 2I5UA 2QEXI 1MJ9A 2BEOA 3ZMVA 2VXDA 2VPLA 1QVTA 5ICGA 3TO6A 1RETA 2QKMB 3E5XA 1FZPB 4PJMA 1VQ4I 4W97A 2ISZA 2DA2A 5E3MA 1Y8RB 4FETA 3F72A 1R71A 3F8CA 2GLOA 3HTSB 4G6QA 1AOYA 2LTPA 3GFJA 2EIKH 3V8KA 3IUOA 1HCRA 1HKSA 1E3PA 2RREA 2HVRA 1IW7F 4QPOA 1ULYA 3F0CA 5FKNA 1OCCH 3E5QA 1AHDP 1SFEA 2I10A 4M6XA 3TO9A 2Q0OA 3MAJA 3O8HA 6PAXA 3MKWB 5JLXA 1W7PD 1P6RA 1FYKA 4YELA 3TBIA 2LY9A 1NTCA 3DKWA 2K9SA 2DN0A 4E7LA 3WG7H 3MZ8A 5LHHA 1D0YA 4EM0B 1HF0A 1HA8A 5JVGF 3PNTA 1IUFA 3DBLB 2E7WA 2K02A 1BR4A 3WTWC 4IXAA 3W6KB 1KONA 4JQFA 3U2RA 5LGNA 3DKYA 4BH9A 3QPSA 1D1BA 2ICWG 5GTHC 1BC7C 5L3BA 4A3MJ 3LSKA 1BI2A 3RCOA 2TDXA 4A5NA 3AG4H 5HNHA 5E3OA 4DBQA 2W57A 4ASNA 2ZJQF 1VQOI 4U7BA 4CYCB 1UJ8A 2FMLA 1YS6A 2WY8Q 1JE8A 2MW8A 5BQTA 4RGXA 2VJIA 4JP0A 4EV0A 2HI3A 5E8GA 3KEQA 2BBYA 1YHQI 3EETA 1T39A 2Z1DA 2ZXJA 3QOEA 4XRFA 4GXOA 1LNWA 2V26A 1BW5A 2HS5A 3KLOA 1R6RA 2E5NA 4FT8A 4ZYGA 4A3JJ 1IC8A 5D8LB 1XSDA 3PM1A 5E17F 1HDDC 1MH4A 4D5CA 3GYHX 2MFZA 2VE9A 3GZ6A 1G4DA 4EJTA 1SAUA 1BI3A 4BXFA 2LBFA 3Q9VA 1P9QC 2XPWA 2PN6A 3EPZA 1FMWA 5IT3A 3BJ6A 5F0FA 1LE8B 4RS8A 2DT6A 3DBHB 4ZYAA 5A2QK 1Z6RA 4KT5C 5IOZA 1O3RA 2FF4A 2STWA 1FOYA 2QKLB 4NBQA 1B9MA 3K4CA 2JA6J 2M8GX 4ZDOA 2DOEA 3GXOA 2A5WA 1K78B 4XBFA 2LMDA 4ZJZA 1YITI 1I1GA 1P4XA 2DFEA 3BTLA 2LYCA 5D6EA 1BN5A 1RESA 1LPQA 4D5FA 4AIHA 3TP3A 2Z2SB 3O3KA 4HNTA 3S93A 2JN6A 1DU6A 2V7FA 2COMA 2W24A 2YPRA 3LSHA 3IRRA 1CGPA 3M3YJ 3WU0A 5ED4A 1P4AA 3F3XA 3GTMJ 3FIWA 1ODDA 1G3TA 4S05A 3OV8A 2K7LA 2R7ZJ 1HW2A 1GV2A 1ONVA 5LHGA 1OQYA 1KGSA 2VASA 5DCMA 2TRTA 4G6TB 3T5XA 3DCFA 1WI3A 2XDVA 1JKQC 5ILSA 2DMUA 2EV5A 2Z99A 3KYCB 3ZR8X 4NDLA 4BU2A 4L5EA 4Q4ZF 4RAGA 3S32A 4ON0A 3GO5A 4MNUA 2OTJI 3DU5A 4EVIA 3BTCA 5M3MJ 3QWLA 1Z21A 2ZKZA 3CP8A 3HOTA 4RGSA 3OS1A 4IZZA 2NRAC 2ZCWA 3FBIB 4YG2F 5K5RA 1L0OC 5A2QZ 1Z91A 1K4SA 4NQWA 1V55H 4XLFA 2EH3A 1QVUA 2QQBA 4BS9A 3OYDA 1T2KA 5E20A 2WV1A 4XLAA 1IV6A 2D2WA 4C9YA 5IY5H 1P7JA 2V1NA 4A3CJ 5BPIA 3I64A 3I4MJ 1P2FA 5B66C 1R49A 2CRGA 4RAZA 2O61A 4ZTFA 3E0JB 4BL0B 1G6NA 2ECCA 3HRUA 3K69A 1TQPA 4C3IJ 3H0GJ 1HLVA 2OF7A 2QQAA 1FTZA 4UUSB 3H36A 2GOXB 1W36D 2HDCA 5DD4A 1FIAA 4LK1F 4EJWA 2VT2A 1Y6IA 3HDDA 5KAIC 2P8TA 2X1DA 4PSWA 5M5WJ 2VJ4A 5F0HA 2ESHA 2R7QA 1VF9A 1WH5A 3VEPA 1SD7A 1JT0A 4RLQA 4CUGA 3MFKA 2FQ4A 1QZEA 2KDOA 3FDYA 3VYRB 3BJOA 1QNTA 1BW6A 3PFYA 3J7YJ 1WHUA 2ZJRF 2IGMA 2GBYA 4I99C 4PCQA 4AVZA 2A07F 1BIBA 5HS9A 1OCOH 2VKVA 1ETWA 2M1BA 2M30A 1S8NA 1UHMA 4HF1A 3EUHA 4B8XA 1RC9A 3HPGA 2PLYA 3BTJA 2VIXA 2K4BA 1SFOJ 5C44J 2YR2A 4PFOA 4EM1A 1VQ5I 1V5GA 2CWEA 3OYFA 4BNCA 1B1BA 2FNPA 3ABLH 3RKQA 2LSOA 4P55A 3K0LA 3R4KA 3L2VA 1QHGA 3W6VA 3TKYA 5C4JJ 4BHCA 4AIJA 4DNCA 5K7ZA 2LF7A 1VQ9I 1R5ID 1SD6A 4M3EA 2X1EA 1DPUA 4XKVA 1TNSA 1NHAA 2L7FP 3FMRA 4N9IA 5LHIA 3ERMA 2Y31A 4B44A 2FXAA 2XB5A 3HRMA 3B73A 2WAQN 3H3VK 1X2MA 2R7VA 2E7XA 4L5JA 3VYUB 1E2XA 3VYSB 1G8XA 3BJAA 2DLLA 1WZ2A 4GYIA 1VQNI 2B63J 3RKXA 4EJUA 3WTUC 1LDKB 3PUFA 4XLHA 3RPUA 4R1HA 1CF7A 2DK8A 2M45A 1U9NA 4CA0A 2P5VA 3GLLA 4G9YA 4FE7A 1BM9A 3IH2A 4LIVA 1WCMJ 1KU9A 3F6VA 3F8NA 1UFMA 1W7PB 2OC6A 1ZKGA 4ETSA 3BZ6A 1IDYA 2P6SA 3OYIA 4OOIA 3HKZN 2L4MA 5H20A 3RPQA 4OINF 2IT0A 1QQIA 1FP2A 4OIQF 2LD5A 3S1NJ 2PMUA 3S2DJ 1LFBA 3BZKA 2KMUA 5H6RA 1MNDA 1K7AA 1E3HA 3OYNA 4RB3C 2F5EA 4YFNF 2FOWA 4ENNA 5GP9A 5F1JA 4IVNA 1PDNC 3T8TA 2QF7A 3J7AY 2W7NA 5BMZA 3FWEA 4HNVA 5H6QA 4HAMA 3JSPA 3VFZA 3OYGA 3DPLC 1SVMA 2CW8A 2ZFUA 1WWXA 5IYCJ 4BAYA 4HX7A 1UELB 3L9FA 4C3HJ 2XAFA 3ASOH 1FEXA 5D6FA 5DM6F 1Y0NA 4V19K 2WADA 2NS0A 2V6CA 3KIOA 2L9SA 4XONA 4M73A 4MTDA 4KYWA 2NOGA 3BCAA 3BG9A 2DK5A 1B8IA 1OPCA 2E35A 2ZXHA 1SMYF 1PP7U 3SHFA 3K4MA 1B72B 2R92J 1BJZA 2B9SA 3GTGJ 4QLCU 2AS5F 1KYZA 3B6CA 2V9PA 2WY7Q 2DMPA 2FQ3A 3MEXA 1YJNI 4KIBA 4A3EJ 1Q1HA 3FISA 2XRLA 4BACA 4XKBA 3QQAA 3QAHA 3CZ6A 5GAGJ 5J3LA 1IV8A 3IV5A 3VB2A 4ABZA 1ZRCA 3OL3A 4DJAA 3B6AA 1FNNA 3RJPA 2YSRA 5CVJA 2OTLI 5FKKA 2HXIA 2QWWA 3FMQA 4IHTA 3S3OA 3W2VA 2WWYA 3FXUA 3OY9A 3BWGA 1YYVA 3F9KA 5D5UB 2FX0A 2LREA 4I09A 4CICA 1IRXA 3IWZA 3HSRA 2HOEA 4XLEA 2QSGX 2J5OA 4Y17A 4YFKF 1K79A 3QP5A 5CYVA 3U1DA 4IQ4A 2PI0A 1GLNA 4F7ZA 1UHWA 3DPUA 1J9IA 1U5TB 1MMGA 3RI4A 2H6CA 3K4BA 3LSRA 4BQOA 1YFHA 3HM5A 3L00A 1VTNC 4UVAA 3VYTB 1EJ9A 2J5PA 2WAEA 3TDZC 3QODA 3IHUA 2BV6A 1XN7A 4ZYDA 4CCMA 1TL8A 3P9IA 2CO5A 2H8WA 4OMYA 5AIPA 2KDZA 1KU2A 2EIJH 2GA2A 2O8KA 2IA1A 4BHPA 4M3DA 1TWHJ 2K4JA 2NXNB 4RM2A 1IN6A 3O8GA 1ZYRF 2BY1A 4MQ9F 3K70D 3DLLF 2MYSA 3V7SA 3J7AO 5IPAA 4P9UA 3KEYA 4RAFA 1HSJA 2WB1N 3S2WA 4KDPA 2JZYA 5K5QA 4HLYA 3LMMA 1BJAA 3NQOA 4UVBA 3KP4A 4B48A 5CVUA 4NC6A 3L7WA 1S5LC 4X1EA 3ABKH 4UB8C 2UV1A 1UG2A 1TWAJ 2E19A 1LEAA 2VBYA 1FLIA 2UUZA 1B59A 2E36A 5DEQA 3JAMK 2X1CA 4P96A 5F1RA 1OFCX 2EZKA 2HQ5A 2A3SA 5E1XA 2EZIA 4I6ZA 4BDYA 2M5WA 4E7HA 3BZCA 1FWZA 2Z5UA 5EZGA 1FBUA 3UR3C 5FJ8J 2AQFA 2EK5A 5K7HA 5DV5A 1D1CA 3CLQA 4EM2A 4BDZA 3D5LA 3ZQQA 1WRJA 4QWQA 5CVRA 3KCCA 2EPFA 1DP7P 3I5UA 5L3CA 4A12A 2FSWA 4F93B 2YU9J 5KCMA 4HX4A 1MIJA 3BR6A 1UB9A 2RDPA 1V3FA 3I59B 1OJLA 2R7WA 5EGOB 5KK1A 1SFUA 1H88C 2K9QA 3GTKJ 4W1UA 2RVCA 4JOMA 2Y9ZA 1K61A 2JQ7A 2XPVA 4LB6B 4D9JA 4Y13A 1ZG5A 2CV0A 2VT3A 1Z77A 1JGGA 4BQAA 1MGTA 3E6BA 4LOCA 1R1TA 3HYIA 3JW4A 2Y0SA 3CJTB 2X6WA 4A6DA 4F92B 4E7KA 3DTEA 3PIOF 2LK2A 3K1PA 4M74A 3SZGA 4FASD 3A02A 2DBBA 1OYIA 3TMOA 4B4CA 1WJDA 4E4HA 3ZQLA 2IGKA 2JSCA 1USSA 4RGRA 4OIPF 4IHWA 2QYOA 1R22A 2V4JC 3HC7A 2XASA 2XB0X 4QPQA 2ZC2A 1JI8A 2NYXA 5GAHJ 5GPCA 2XAGA 4J19A 2ID3A 1BIAA 3I55I 1HSTA 2CQQA 2FA5A 2GIVA 3JAMZ 3IH4A 4ENMA 4D1QA 3MZHA 1VI0A 1D3YA 1BOAA 1U5TC 2R7FA 4AVPA 2KZGA 2OU2A 3QU3A 5J40A 2W4SA 4XN0A 3ZQIA 3SJMA 4A3LJ 1LUJB 3KLNA 4MFEA 3PO2J 5FD6A 2G7HA 4M6VA 1XMKA 2OCEA 3LL7A 4DYQA 3OYJA 3H0DA 2PMZA 2Y48A 1NG7A 2BE5F 3G3ZA 1UMQA
chains in the Genus database with same CATH topology
5F64A 3ROUA 1USTA 2VN2A 3GVAA 3BP8A 3Q9SA 1O7FA 2OAZA 3TOAA 4EQQA 1FYLA 2BYVE 3KP5A 1J2XA 1FP1D 1H9TA 1U8RA 5E18F 1B4AA 2IVMA 2FOKA 1HKQA 2ZMEA 2ETHA 2R7DA 4EGYA 3SZPA 2FU4A 2HTSA 3KEOA 1Z9CA 2A68F 1YW9A 2L01A 2IW5A 1IRGA 1S7AA 2QM3A 1HXDA 1IRFA 3H3ZA 2DPDA 5HLHA 2QVOA 1H0MA 3KE2A 1QZYA 2PJPA 4Q47A 5E1WA 1IAWA 5LEKA 1ZH5A 4LK0F 4HLXA 2VC0A 3FX3A 1HW5A 4M6YA 4CXFA 1G3YA 3DXJF 3WTSC 4L18B 2HKOA 3DV8A 4Z2YA 2JPCA 3F8MA 4LG0B 3LA7A 2KIMA 3HIFA 3R0AA 2HQNA 2XAQA 2V9VA 4I0BA 2XKOA 2RQPA 4WCGA 2Z3YA 5HDKA 1BBYA 2DPUA 5L3DA 2A61A 4UV9A 5ICCA 2ZNYA 2O3FA 3GFIA 3C3WA 4ESFA 2KJCA 2HEOA 1BI1A 2H27A 3N97A 1EH7A 3IRQA 2LNBA 1ZLJA 3PQJA 5DYMA 3WGHA 5F6FA 2CQKA 4XSXF 3VOEA 4Q5SF 3WTVC 4IRIA 3R61A 3ML6A 2A69F 5D5WB 4GCVA 2ISYA 1XSVA 1WI9A 3V7CA 1ZN2A 1MDMB 3FM5A 1QPMA 1YLFA 4OU0A 5DDGA 2VBWA 4I02A 2Z9OA 3C1DA 4L9JA 1B9NA 1JHFA 5D8KB 3GF2A 3ZMZA 4Y15A 3T1BA 3K9TA 2A6HF 1ZGAA 2V1XA 1SD4A 2MC3A 3N4MA 4M9SA 2CG4A 1Z05A 1HQCA 2C6YA 3J80K 4KA4A 2ZO4A 3SXYA 3TQNA 2K27A 2P7CB 1OYYA 5EEHA 3F22A 4AIKA 1FPQA 5LEJA 2E1NA 2HR3A 4L5IA 3GUDA 4U0VA 5ERIA 1IN7A 5K1YA 3KP2A 1IXSB 3LQQA 1R5GA 2OQRA 3FM3A 3ELKA 5HS8A 1OYWA 4UXNA 2JRTA 1R5HA 3P7NA 3CUQA 3WE2A 4RB0A 3E97A 4ENKA 1FOKA 1U3EM 4OIRF 3ABUA 3QP6A 2F5DA 4HF2A 1XGMA 3J80Z 3MZYA 3U9GA 3WTZA 4HA8A 3WU1B 2OZ6A 4PZJA 5J8CA 4U0WA 3HHGA 3IC7A 5FD5A 2CFXA 5TRDA 2LKPA 2DU9A 1TW2A 1IF1A 5LBQA 3WG9A 2MLGA 1DDNA 3RYPA 1T98A 2ESNA 2VOPA 1WKMA 5FGMA 3MCZA 2O8XA 2B0LA 3IL2A 5J6XA 3O2PE 3B02A 2M8EA 1I5ZA 3SQNA 2GZWA 1I27A 4AD9A 2XKPA 3QU6A 5CVVA 4LFUA 2FRHA 2RC4A 4ZYEA 1YW7A 1R36A 2XROA 1S7OA 1W5SA 1ZHFA 1ZG3A 1R23A 5L3FA 4HDVA 2GWRA 3FXRA 1AWCA 3TO7A 1LDJA 1EH8A 1O3QA 2JPBA 2O6GE 3TGNA 2QBYA 2HTJA 4JBAA 2IP2A 4HF0A 2XRNA 3DPTA 2H6BA 5L3GA 1GHCA 3GFLA 1TLHB 1D8JA 2AXLA 2D1VA 2JTVA 2IRFG 4KMFA 5JHUA 2KIUA 4WXCA 4H0EA 2DW4A 4M71A 2F2EA 2F5CA 3LQRA 3L09A 1R00A 5DCMB 3ZQ7A 4DQ2A 3QPHA 4HV5A 4N0BA 4TV7A 4M72A 2PG4A 2MA3A 4D0PA 3E3VA 1A04A 5FFZA 1I1SA 3H92A 4I7HA 3HRSA 4M9XA 4UV8A 4R8HA 3E6CC 1RZ4A 2FNAA 2FEZA 1X3UA 1XD7A 3LA2A 1XSXA 4NHJA 4KIGA 4IPAA 4ZZDA 3ERED 4WWCA 1R1VA 3J81K 1XMAA 1F1ZA 3CO6C 3V4GA 4MHGA 2PFBA 4FX4A 1REPC 4L9TA 4E70A 2ZFWA 4RB1A 2L54A 3REOA 1IN5A 2PQ8A 1LVAA 3MWMA 4KNYA 3BOQA 3R0JA 2EV6A 2QLZA 4EJOA 3KP3A 4ESJA 3JTGA 2E1CA 3E6DA 5FFXA 1S29A 3TOBA 4BXUA 2HYGD 2IA2A 2D1HA 3KETA 2EFQA 3PFIA 2OZUA 3J81Z 4AWXB 2K86A 3C18A 2D45A 3RKYA 4HQMA 1ON2A 3GX4X 2NAZA 4U88A 2UWMA 2HQRA 1IN4A 3H3UA 4A0ZA 1CF7B 3T8RA 3COAC 2PBIA 1KQ9A 4CO8A 1XCBA 1V4RA 1WSUA 1ZRDA 5KVRA 2EA4A 5D4RA 3E5UA 2WV0A 2CYYA 3PQKA 5HOOA 3K1NA 5LRSA 1BI0A 5HS7A 1MJAA 4WXDA 1TBXA 4LJZF 3FXQA 1RUNA 4L0YB 2ELHA 5JVTA 5LGUA 3CUQC 2GXBA 1G3SA 4KN4X 3GWZA 2ACJA 1TW3A 4L9VA 4LLNA 3BDDA 2NNNA 3WE3A 1OR7A 3DFGA 2XIGA 4O6JA 2OA4A 4L9NA 1XDUA 2RGVA 3WGIA 3EYYA 1ZRFA 1TQIA 2XV4S 3LAJA 3I0TA 4BYYA 2ZBKA 1J59A 5JI6A 2KIFA 3BPVA 1U2WA 3ECOA 5JR3A 4P9FA 1FSHA 1J5YA 1KQ8A 5HLGA 4WF2A 2MD5A 1I6XA 4I98B 4ZH4F 2MH2A 3I54A 1HW1A 3IKVA 3ZMUA 1K78A 5DUKA 1JXSA 2GQQA 2RV8A 2W25A 1QZZA 1SD5A 2UZKA 1FT9A 2XAJA 4KN7X 4KMUX 1W5TA 5LLQA 1DPRA 2HWVA 3ECHA 3QOPA 2XHKA 4HQEA 1R7JA 2HFHA 5JFRA 2EB7A 5TJJA 1IZ1A 3IKTA 3ZMSA 4GO1A 1IN8A 3ZP5A 2HYFA 4PGGA 2IJLA 4MGRA 4MTEA 3FMSA 3D0SA 3F21A 3HHHA 4IRGA 2UXNA 2X0LA 3CO7C 3JSOA 1IXCA 2DFIA 3GEZA 2QZ8A 1STZA 2YU3A 5DUIA 1T38A 2RN7A 1J0RA 2ZNZA 2P4WA 2W85A 2H09A 1QO0D 5AIQA 1TNTA 1QBJA 4A0XA 2Y0MA 4G7ZF 3EYIA 4O3MA 2VODA 1U78A 1J7KA 1O3TA 4HV6A 2V1UA 2VC1A 1ZARA 4K2EA 2VE8A 4HZFA 2EV0A 4YIIA 4G6DA 3F8BA 4LGWA 3BY6A 1LQ1A 1U6GA 3P9KA 1FX7A 1D8KA 1KU7A 2R3SA 1XGSA 2YX7A 3M8FA 4IHSA 3RTRA 4UNOA 2P5LC 2UXXA 2GAUA 5DD8A 2L4AA 3ZPLA 1XGNA 1L3LA 4WXHA 2FBKA 1KU3A 3GLXA 3GZ5A 4ENJA 3G73A 2DT5A 5J8FA 3CJNA 1OKRA 5IT9K 4ZZLA 1YS7A 1RIOH 1FY7A 2MH9A 4UUVA 3DP7A 2PEXA 3RDIA 1W7PA 1R58A 4L0ZB 4O5VA 2ZMEB 4LD5A 2XVCA 3LFKA 1ZAOA 2RKHA 5ILVA 1ZLKA 5ICEA 2OD5A 4XSZF 5L3EA 2VXZA 3NRVA 1TTYA 2WC2A 4XLNF 3TDUC 2VBXA 4A2UA 1LJ9A 1BC8C 4G8XA 3SFZA 3ISPA 2DI3A 2H94A 5LRRA 5D5VB 3HTUA 3I58A 1O3SA 4A0YA 3CUOA 4NB5A 1S6LA 4HOBA 1ZREA 5IT9Z 3QRFF 3RIRA 2FE3A 1YIOA 5AONA 3JTHA 1T6SA 2QENA 5HVQC 3DQVC 3DF8A 3RKWA 1R1UA 2FBIA 4M9ZA 1YTYA 3M1EA 5EEGA 3IWFA 3CTAA 2GXGA 1SAXA 1Y0UA 1GXQA 1GVJA 1KYWA 2QQ9A 3ABTA 3I53A 1YW8A 2FBHA 2BGCA 4Q48A 1U5TA 1FBQA 1H9GA 3EQLF 4CDGA 3WODF 2ADUA 5D4SA 5HDNA 4KIFA 3KFWX 2ZJ2A 4G7HF 4EJVA 1FBSA 4LMYA 2X4HA 3FF5A 3FHZA 4WX9A 1E17A 1TQMA 1P92A 1W4MA 3M9AA 1J75A 3ZMTA 1SFXA 3F6OA 1D5VA 4KUMA 3Q5FA 1RNLA 3QPTA 2Z33A 4CGZA 2EWNA 2EJRA 3NEUA 2IA0A 1UCRA 3I71A 4P5OA 4ZYHA 1KA8A 2EFWA 3OOPA 2Y75A 1YG2A 1GXPA 4CYDA 5K5OA 2DQRA 4EGZA 5FLXK 1P4WA 4UHTA 4A6EA 3I59A 3V8LA 3V7RA 3ZN0A 1JGSA 4KFCA 5D5XB 2XUBA 1DUXC 3WTYC 4FHTA 1WQ2A 2VBZA 2VONA 4S04A 4XLPF 1RI7A 4IRHA 2O03A 1F5TA 3KP7A 2VOOA 1FSEA 4RB2C 2QUFA 1ZGJA 2CSOA 2HGCA 2MBFA 4G94A 4YFXF 2G7UA 1KQ0A 1XB4A 4WK8F 5CJ9A 1PUEE 3ZN1A 4ESBA 2FMYA 3L2CA 1O57A 2EFOA 1XGOA 2YX4A 1K6OA 3F8FA 2DAOA 1ZG1A 3HSFA 3K2ZA 1RUOA 3R60A 3WTTC 2LF8A 2HZTA 1IXRC 1OMIA 3CUQB 4CHUA 4IJAA 5FLXZ 2NNYA 2L02A 2OQGA 5BS6A 3SZTA 1JHHA 5BOXA 3P9CA 3AAFA 4MEXF 4HYEA 4N9HA 2EA2A 4RGUA 3VODA 4HDUA 2STTA 3HRTA 2Q2EA 1XDSA 1T0FA 2Q8KA 2GA1A 3EDPA 4LLLA 2W84A 4IF4A 2F5FA 2PMHA 5HDGA 2DQLA 1QGPA 3LA3A 2HKXA 2V1DA 3KP6A 1Z7UA 1YQAA 1ON1A 2CW0F 2P7VB 3HOSA 4G7OF 5ILUA 2O0YA 3T0YA 4PDKA 5DCFA 3CLOA 4I01A 4FX0A 4LLGF 2DTRA 5ICFA 3FZVA 1F9NA 3ULQB 4U7DA 2MLKA 3LAPA 1LB2A 1MD0A 5BPDA 4YIFA 2LDUA 3DEUA 2EFNA 1YO5C 2IPQX 2G9WA 1LEBA 2QBYB 1SMTA 4R79A 4MQVA 4HW0A 5E1ZB 3KZZA 4LG0A 1XCVA 3MQ0A 1PP8F 2P6TA 1FC3A 3O6BB 3ZMDA 1C0WA 1O7LA 1HBXG 3WGGA 1F4KA 4OIOF 3LSTA 2A6EF 2EFPA 3I4PA 2XGXA 3BPXA 3RYRA 2KKOA 5E8IA 4LB5A 2P5KA 3M8EA 2JT1A 4GYGA 4HBLA 1IUYA 4JK1X 3LWFA 3GW2A 3GFMA 1FYMA 3WTXC 4RAYA 3HUGA 2RNJA 3V8JA 5LGTA 4GGGA 1LDDA 4I0AA 2WTEA 4UVCA 4PGHA 1Z1DA 5FB2A 1MDMA 4I2OA 5HLIA 3M7GA 3E6MA 1HKTA 4BHBA 1EV7A 2L3DA 2A5YB 3F23A 3R6SA 4OMZA 3HSEA 4CZZA 1B6AA 5CLSA 4HX8A 2M87A 4KICA 1Z6TA 4B09A 3C7JA 5CVIA 5FO5A 2XAHA 3CDHA 4A5MA 3KZYA 1G3WA 3K1MA 2KRFA 4EMSA 4MEYF 1EH6A 1MKMA 3BROA 2OBPA 4U0YA 2CGPA 2V79A 1S3JA 1MJBA 3W6JB 2DO7A 2KJBA 1MJ9A 2BEOA 3ZMVA 5ICGA 3TO6A 3E5XA 1FZPB 2ISZA 3F72A 3F8CA 3HTSB 4G6QA 1AOYA 3GFJA 3V8KA 1HKSA 1IW7F 1ULYA 3E5QA 1SFEA 4M6XA 3TO9A 2Q0OA 3MAJA 6PAXA 1W7PD 1P6RA 1FYKA 3DKWA 5LHHA 4EM0B 2E7WA 2K02A 3WTWC 4IXAA 3W6KB 4JQFA 3U2RA 5LGNA 4BH9A 1BC7C 5L3BA 1BI2A 2TDXA 4A5NA 2W57A 4ASNA 4U7BA 2FMLA 1YS6A 1JE8A 5BQTA 4RGXA 4EV0A 5E8GA 3KEQA 2BBYA 1T39A 3EETA 2ZXJA 4XRFA 4GXOA 1LNWA 2HS5A 3KLOA 4FT8A 4ZYGA 5D8LB 1XSDA 5E17F 3GYHX 2VE9A 3GZ6A 1G4DA 4EJTA 1BI3A 3Q9VA 2PN6A 5IT3A 3BJ6A 4RS8A 5A2QK 1Z6RA 4KT5C 1O3RA 2FF4A 2STWA 1B9MA 3GXOA 1K78B 4XBFA 1I1GA 1P4XA 5D6EA 1BN5A 4AIHA 3O3KA 2COMA 2W24A 2YPRA 3IRRA 1CGPA 3WU0A 5ED4A 1P4AA 3F3XA 1ODDA 1G3TA 4S05A 3OV8A 2K7LA 1HW2A 1ONVA 5LHGA 1KGSA 5DCMA 3T5XA 5ILSA 2EV5A 2Z99A 4Q4ZF 4ON0A 3GO5A 4MNUA 4EVIA 2ZKZA 3HOTA 4RGSA 2NRAC 2ZCWA 4YG2F 5K5RA 1L0OC 5A2QZ 1Z91A 4NQWA 2QQBA 1T2KA 5E20A 2D2WA 5BPIA 3I64A 1P2FA 4RAZA 2O61A 1G6NA 3HRUA 3K69A 1TQPA 2QQAA 2HDCA 5DD4A 4LK1F 4EJWA 2VT2A 2P8TA 2ESHA 3VEPA 1SD7A 3MFKA 3BJOA 1QNTA 4PCQA 2A07F 1BIBA 5HS9A 2M1BA 2M30A 1S8NA 1UHMA 4HF1A 3EUHA 4B8XA 2PLYA 2K4BA 2YR2A 4EM1A 2CWEA 4BNCA 1B1BA 2FNPA 2LSOA 4P55A 3K0LA 3R4KA 3TKYA 4BHCA 4AIJA 4DNCA 2LF7A 1SD6A 1DPUA 1TNSA 1NHAA 3FMRA 4N9IA 5LHIA 2FXAA 3HRMA 3B73A 2E7XA 4L5JA 1E2XA 3BJAA 2DLLA 4GYIA 3RKXA 4EJUA 3WTUC 1LDKB 3RPUA 4R1HA 1CF7A 2DK8A 2M45A 2P5VA 4G9YA 1BM9A 3F6VA 1KU9A 3F8NA 1UFMA 1W7PB 4ETSA 3BZ6A 2P6SA 4OOIA 3RPQA 2L4MA 5H20A 4OINF 2IT0A 1QQIA 1FP2A 4OIQF 2PMUA 1K7AA 5H6RA 4RB3C 2F5EA 4YFNF 4ENNA 4IVNA 1PDNC 3T8TA 5BMZA 3FWEA 5H6QA 4HAMA 3JSPA 3VFZA 3DPLC 1WWXA 4BAYA 4HX7A 3L9FA 2XAFA 5D6FA 2NS0A 2V6CA 4M73A 4MTDA 4KYWA 2DK5A 1OPCA 1SMYF 1PP7U 3SHFA 4QLCU 2AS5F 1KYZA 2FQ3A 3MEXA 4KIBA 1Q1HA 3QAHA 3VB2A 1ZRCA 1FNNA 3RJPA 2YSRA 5CVJA 2QWWA 3FMQA 4IHTA 2WWYA 3FXUA 3BWGA 1YYVA 5D5UB 4I09A 4CICA 3IWZA 3HSRA 2HOEA 2J5OA 4Y17A 4YFKF 1K79A 3QP5A 5CYVA 3U1DA 2PI0A 4F7ZA 1UHWA 1J9IA 1U5TB 3RI4A 2H6CA 1YFHA 3L00A 1VTNC 4UVAA 2J5PA 3TDZC 3IHUA 2BV6A 1XN7A 4ZYDA 3P9IA 2CO5A 4OMYA 5AIPA 1KU2A 2GA2A 2IA1A 4BHPA 2K4JA 1IN6A 1ZYRF 4MQ9F 3V7SA 3J7AO 4P9UA 1HSJA 3S2WA 4KDPA 2JZYA 5K5QA 4HLYA 1BJAA 3NQOA 4UVBA 3KP4A 5CVUA 3L7WA 1LEAA 2VBYA 1FLIA 1B59A 5DEQA 3JAMK 4P96A 5F1RA 2A3SA 5E1XA 2M5WA 1FWZA 2Z5UA 1FBUA 2EK5A 5DV5A 4EM2A 3D5LA 1WRJA 4QWQA 5CVRA 3KCCA 1DP7P 3I5UA 5L3CA 4A12A 2FSWA 4HX4A 1UB9A 2RDPA 1V3FA 3I59B 5KK1A 1SFUA 2RVCA 4LB6B 4Y13A 1ZG5A 2VT3A 4BQAA 1MGTA 3E6BA 1R1TA 3HYIA 3JW4A 4A6DA 3K1PA 4M74A 2DBBA 1OYIA 2JSCA 1USSA 4RGRA 4OIPF 2QYOA 1R22A 2XASA 2NYXA 2XAGA 1BIAA 1HSTA 2FA5A 2GIVA 3JAMZ 4ENMA 3MZHA 1D3YA 1BOAA 1U5TC 2R7FA 4AVPA 2OU2A 3QU3A 3KLNA 5FD6A 2G7HA 1XMKA 2Y48A 2BE5F 3G3ZA 1MZBA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F64 A;  3ROU A;  1UST A;  2VN2 A;  3GVA A;  3BP8 A;  3Q9S A;  1O7F A;  2OAZ A;  3TOA A;  4EQQ A;  1FYL A;  2BYV E;  3KP5 A;  1J2X A;  1FP1 D;  1H9T A;  1U8R A;  5E18 F;  1B4A A;  2IVM A;  2FOK A;  1HKQ A;  2ZME A;  2ETH A;  2R7D A;  4EGY A;  3SZP A;  2FU4 A;  2HTS A;  3KEO A;  1Z9C A;  2A68 F;  1YW9 A;  2L01 A;  2IW5 A;  1IRG A;  1S7A A;  2QM3 A;  1HXD A;  1IRF A;  3H3Z A;  2DPD A;  5HLH A;  2QVO A;  1H0M A;  3KE2 A;  1QZY A;  2PJP A;  4Q47 A;  5E1W A;  1IAW A;  5LEK A;  1ZH5 A;  4LK0 F;  4HLX A;  2VC0 A;  3FX3 A;  1HW5 A;  4M6Y A;  4CXF A;  1G3Y A;  3DXJ F;  3WTS C;  4L18 B;  2HKO A;  3DV8 A;  4Z2Y A;  2JPC A;  3F8M A;  4LG0 B;  3LA7 A;  2KIM A;  3HIF A;  3R0A A;  2HQN A;  2XAQ A;  2V9V A;  4I0B A;  2XKO A;  2RQP A;  4WCG A;  2Z3Y A;  5HDK A;  1BBY A;  2DPU A;  5L3D A;  2A61 A;  4UV9 A;  5ICC A;  2ZNY A;  2O3F A;  3GFI A;  3C3W A;  4ESF A;  2KJC A;  2HEO A;  1BI1 A;  2H27 A;  3N97 A;  1EH7 A;  3IRQ A;  2LNB A;  1ZLJ A;  3PQJ A;  5DYM A;  3WGH A;  5F6F A;  2CQK A;  4XSX F;  3VOE A;  4Q5S F;  3WTV C;  4IRI A;  3R61 A;  3ML6 A;  2A69 F;  5D5W B;  4GCV A;  2ISY A;  1XSV A;  1WI9 A;  3V7C A;  1ZN2 A;  1MDM B;  3FM5 A;  1QPM A;  1YLF A;  4OU0 A;  5DDG A;  2VBW A;  4I02 A;  2Z9O A;  3C1D A;  4L9J A;  1B9N A;  1JHF A;  5D8K B;  3GF2 A;  3ZMZ A;  4Y15 A;  3T1B A;  3K9T A;  2A6H F;  1ZGA A;  2V1X A;  1SD4 A;  2MC3 A;  3N4M A;  4M9S A;  2CG4 A;  1Z05 A;  1HQC A;  2C6Y A;  3J80 K;  4KA4 A;  2ZO4 A;  3SXY A;  3TQN A;  2K27 A;  2P7C B;  1OYY A;  5EEH A;  3F22 A;  4AIK A;  1FPQ A;  5LEJ A;  2E1N A;  2HR3 A;  4L5I A;  3GUD A;  4U0V A;  5ERI A;  1IN7 A;  5K1Y A;  3KP2 A;  1IXS B;  3LQQ A;  1R5G A;  2OQR A;  3FM3 A;  3ELK A;  5HS8 A;  1OYW A;  4UXN A;  2JRT A;  1R5H A;  3P7N A;  3CUQ A;  3WE2 A;  4RB0 A;  3E97 A;  4ENK A;  1FOK A;  1U3E M;  4OIR F;  3ABU A;  3QP6 A;  2F5D A;  4HF2 A;  1XGM A;  3J80 Z;  3MZY A;  3U9G A;  3WTZ A;  4HA8 A;  3WU1 B;  2OZ6 A;  4PZJ A;  5J8C A;  4U0W A;  3HHG A;  3IC7 A;  5FD5 A;  2CFX A;  5TRD A;  2LKP A;  2DU9 A;  1TW2 A;  1IF1 A;  5LBQ A;  3WG9 A;  2MLG A;  1DDN A;  3RYP A;  1T98 A;  2ESN A;  2VOP A;  1WKM A;  5FGM A;  3MCZ A;  2O8X A;  2B0L A;  3IL2 A;  5J6X A;  3O2P E;  3B02 A;  2M8E A;  1I5Z A;  3SQN A;  2GZW A;  1I27 A;  4AD9 A;  2XKP A;  3QU6 A;  5CVV A;  4LFU A;  2FRH A;  2RC4 A;  4ZYE A;  1YW7 A;  1R36 A;  2XRO A;  1S7O A;  1W5S A;  1ZHF A;  1ZG3 A;  1R23 A;  5L3F A;  4HDV A;  2GWR A;  3FXR A;  1AWC A;  3TO7 A;  1LDJ A;  1EH8 A;  1O3Q A;  2JPB A;  2O6G E;  3TGN A;  2QBY A;  2HTJ A;  4JBA A;  2IP2 A;  4HF0 A;  2XRN A;  3DPT A;  2H6B A;  5L3G A;  1GHC A;  3GFL A;  1TLH B;  1D8J A;  2AXL A;  2D1V A;  2JTV A;  2IRF G;  4KMF A;  5JHU A;  2KIU A;  4WXC A;  4H0E A;  2DW4 A;  4M71 A;  2F2E A;  2F5C A;  3LQR A;  3L09 A;  1R00 A;  5DCM B;  3ZQ7 A;  4DQ2 A;  3QPH A;  4HV5 A;  4N0B A;  4TV7 A;  4M72 A;  2PG4 A;  2MA3 A;  4D0P A;  3E3V A;  1A04 A;  5FFZ A;  1I1S A;  3H92 A;  4I7H A;  3HRS A;  4M9X A;  4UV8 A;  4R8H A;  3E6C C;  1RZ4 A;  2FNA A;  2FEZ A;  1X3U A;  1XD7 A;  3LA2 A;  1XSX A;  4NHJ A;  4KIG A;  4IPA A;  4ZZD A;  3ERE D;  4WWC A;  1R1V A;  3J81 K;  1XMA A;  1F1Z A;  3CO6 C;  3V4G A;  4MHG A;  2PFB A;  4FX4 A;  1REP C;  4L9T A;  4E70 A;  2ZFW A;  4RB1 A;  2L54 A;  3REO A;  1IN5 A;  2PQ8 A;  1LVA A;  3MWM A;  4KNY A;  3BOQ A;  3R0J A;  2EV6 A;  2QLZ A;  4EJO A;  3KP3 A;  4ESJ A;  3JTG A;  2E1C A;  3E6D A;  5FFX A;  1S29 A;  3TOB A;  4BXU A;  2HYG D;  2IA2 A;  2D1H A;  3KET A;  2EFQ A;  3PFI A;  2OZU A;  3J81 Z;  4AWX B;  2K86 A;  3C18 A;  2D45 A;  3RKY A;  4HQM A;  1ON2 A;  3GX4 X;  2NAZ A;  4U88 A;  2UWM A;  2HQR A;  1IN4 A;  3H3U A;  4A0Z A;  1CF7 B;  3T8R A;  3COA C;  2PBI A;  1KQ9 A;  4CO8 A;  1XCB A;  1V4R A;  1WSU A;  1ZRD A;  5KVR A;  2EA4 A;  5D4R A;  3E5U A;  2WV0 A;  2CYY A;  3PQK A;  5HOO A;  3K1N A;  5LRS A;  1BI0 A;  5HS7 A;  1MJA A;  4WXD A;  1TBX A;  4LJZ F;  3FXQ A;  1RUN A;  4L0Y B;  2ELH A;  5JVT A;  5LGU A;  3CUQ C;  2GXB A;  1G3S A;  4KN4 X;  3GWZ A;  2ACJ A;  1TW3 A;  4L9V A;  4LLN A;  3BDD A;  2NNN A;  3WE3 A;  1OR7 A;  3DFG A;  2XIG A;  4O6J A;  2OA4 A;  4L9N A;  1XDU A;  2RGV A;  3WGI A;  3EYY A;  1ZRF A;  1TQI A;  2XV4 S;  3LAJ A;  3I0T A;  4BYY A;  2ZBK A;  1J59 A;  5JI6 A;  2KIF A;  3BPV A;  1U2W A;  3ECO A;  5JR3 A;  4P9F A;  1FSH A;  1J5Y A;  1KQ8 A;  5HLG A;  4WF2 A;  2MD5 A;  1I6X A;  4I98 B;  4ZH4 F;  2MH2 A;  3I54 A;  1HW1 A;  3IKV A;  3ZMU A;  1K78 A;  5DUK A;  1JXS A;  2GQQ A;  2RV8 A;  2W25 A;  1QZZ A;  1SD5 A;  2UZK A;  1FT9 A;  2XAJ A;  4KN7 X;  4KMU X;  1W5T A;  5LLQ A;  1DPR A;  2HWV A;  3ECH A;  3QOP A;  2XHK A;  4HQE A;  1R7J A;  2HFH A;  5JFR A;  2EB7 A;  5TJJ A;  1IZ1 A;  3IKT A;  3ZMS A;  4GO1 A;  1IN8 A;  3ZP5 A;  2HYF A;  4PGG A;  2IJL A;  4MGR A;  4MTE A;  3FMS A;  3D0S A;  3F21 A;  3HHH A;  4IRG A;  2UXN A;  2X0L A;  3CO7 C;  3JSO A;  1IXC A;  2DFI A;  3GEZ A;  2QZ8 A;  1STZ A;  2YU3 A;  5DUI A;  1T38 A;  2RN7 A;  1J0R A;  2ZNZ A;  2P4W A;  2W85 A;  2H09 A;  1QO0 D;  5AIQ A;  1TNT A;  1QBJ A;  4A0X A;  2Y0M A;  4G7Z F;  3EYI A;  4O3M A;  2VOD A;  1U78 A;  1J7K A;  1O3T A;  4HV6 A;  2V1U A;  2VC1 A;  1ZAR A;  4K2E A;  2VE8 A;  4HZF A;  2EV0 A;  4YII A;  4G6D A;  3F8B A;  4LGW A;  3BY6 A;  1LQ1 A;  1U6G A;  3P9K A;  1FX7 A;  1D8K A;  1KU7 A;  2R3S A;  1XGS A;  2YX7 A;  3M8F A;  4IHS A;  3RTR A;  4UNO A;  2P5L C;  2UXX A;  2GAU A;  5DD8 A;  2L4A A;  3ZPL A;  1XGN A;  1L3L A;  4WXH A;  2FBK A;  1KU3 A;  3GLX A;  3GZ5 A;  4ENJ A;  3G73 A;  2DT5 A;  5J8F A;  3CJN A;  1OKR A;  5IT9 K;  4ZZL A;  1YS7 A;  1RIO H;  1FY7 A;  2MH9 A;  4UUV A;  3DP7 A;  2PEX A;  3RDI A;  1W7P A;  1R58 A;  4L0Z B;  4O5V A;  2ZME B;  4LD5 A;  2XVC A;  3LFK A;  1ZAO A;  2RKH A;  5ILV A;  1ZLK A;  5ICE A;  2OD5 A;  4XSZ F;  5L3E A;  2VXZ A;  3NRV A;  1TTY A;  2WC2 A;  4XLN F;  3TDU C;  2VBX A;  4A2U A;  1LJ9 A;  1BC8 C;  4G8X A;  3SFZ A;  3ISP A;  2DI3 A;  2H94 A;  5LRR A;  5D5V B;  3HTU A;  3I58 A;  1O3S A;  4A0Y A;  3CUO A;  4NB5 A;  1S6L A;  4HOB A;  1ZRE A;  5IT9 Z;  3QRF F;  3RIR A;  2FE3 A;  1YIO A;  5AON A;  3JTH A;  1T6S A;  2QEN A;  5HVQ C;  3DQV C;  3DF8 A;  3RKW A;  1R1U A;  2FBI A;  4M9Z A;  1YTY A;  3M1E A;  5EEG A;  3IWF A;  3CTA A;  2GXG A;  1SAX A;  1Y0U A;  1GXQ A;  1GVJ A;  1KYW A;  2QQ9 A;  3ABT A;  3I53 A;  1YW8 A;  2FBH A;  2BGC A;  4Q48 A;  1U5T A;  1FBQ A;  1H9G A;  3EQL F;  4CDG A;  3WOD F;  2ADU A;  5D4S A;  5HDN A;  4KIF A;  3KFW X;  2ZJ2 A;  4G7H F;  4EJV A;  1FBS A;  4LMY A;  2X4H A;  3FF5 A;  3FHZ A;  4WX9 A;  1E17 A;  1TQM A;  1P92 A;  1W4M A;  3M9A A;  1J75 A;  3ZMT A;  1SFX A;  3F6O A;  1D5V A;  4KUM A;  3Q5F A;  1RNL A;  3QPT A;  2Z33 A;  4CGZ A;  2EWN A;  2EJR A;  3NEU A;  2IA0 A;  1UCR A;  3I71 A;  4P5O A;  4ZYH A;  1KA8 A;  2EFW A;  3OOP A;  2Y75 A;  1YG2 A;  1GXP A;  4CYD A;  5K5O A;  2DQR A;  4EGZ A;  5FLX K;  1P4W A;  4UHT A;  4A6E A;  3I59 A;  3V8L A;  3V7R A;  3ZN0 A;  1JGS A;  4KFC A;  5D5X B;  2XUB A;  1DUX C;  3WTY C;  4FHT A;  1WQ2 A;  2VBZ A;  2VON A;  4S04 A;  4XLP F;  1RI7 A;  4IRH A;  2O03 A;  1F5T A;  3KP7 A;  2VOO A;  1FSE A;  4RB2 C;  2QUF A;  1ZGJ A;  2CSO A;  2HGC A;  2MBF A;  4G94 A;  4YFX F;  2G7U A;  1KQ0 A;  1XB4 A;  4WK8 F;  5CJ9 A;  1PUE E;  3ZN1 A;  4ESB A;  2FMY A;  3L2C A;  1O57 A;  2EFO A;  1XGO A;  2YX4 A;  1K6O A;  3F8F A;  2DAO A;  1ZG1 A;  3HSF A;  3K2Z A;  1RUO A;  3R60 A;  3WTT C;  2LF8 A;  2HZT A;  1IXR C;  1OMI A;  3CUQ B;  4CHU A;  4IJA A;  5FLX Z;  2NNY A;  2L02 A;  2OQG A;  5BS6 A;  3SZT A;  1JHH A;  5BOX A;  3P9C A;  3AAF A;  4MEX F;  4HYE A;  4N9H A;  2EA2 A;  4RGU A;  3VOD A;  4HDU A;  2STT A;  3HRT A;  2Q2E A;  1XDS A;  1T0F A;  2Q8K A;  2GA1 A;  3EDP A;  4LLL A;  2W84 A;  4IF4 A;  2F5F A;  2PMH A;  5HDG A;  2DQL A;  1QGP A;  3LA3 A;  2HKX A;  2V1D A;  3KP6 A;  1Z7U A;  1YQA A;  1ON1 A;  2CW0 F;  2P7V B;  3HOS A;  4G7O F;  5ILU A;  2O0Y A;  3T0Y A;  4PDK A;  5DCF A;  3CLO A;  4I01 A;  4FX0 A;  4LLG F;  2DTR A;  5ICF A;  3FZV A;  1F9N A;  3ULQ B;  4U7D A;  2MLK A;  3LAP A;  1LB2 A;  1MD0 A;  5BPD A;  4YIF A;  2LDU A;  3DEU A;  2EFN A;  1YO5 C;  2IPQ X;  2G9W A;  1LEB A;  2QBY B;  1SMT A;  4R79 A;  4MQV A;  4HW0 A;  5E1Z B;  3KZZ A;  4LG0 A;  1XCV A;  3MQ0 A;  1PP8 F;  2P6T A;  1FC3 A;  3O6B B;  3ZMD A;  1C0W A;  1O7L A;  1HBX G;  3WGG A;  1F4K A;  4OIO F;  3LST A;  2A6E F;  2EFP A;  3I4P A;  2XGX A;  3BPX A;  3RYR A;  2KKO A;  5E8I A;  4LB5 A;  2P5K A;  3M8E A;  2JT1 A;  4GYG A;  4HBL A;  1IUY A;  4JK1 X;  3LWF A;  3GW2 A;  3GFM A;  1FYM A;  3WTX C;  4RAY A;  3HUG A;  2RNJ A;  3V8J A;  5LGT A;  4GGG A;  1LDD A;  4I0A A;  2WTE A;  4UVC A;  4PGH A;  1Z1D A;  5FB2 A;  1MDM A;  4I2O A;  5HLI A;  3M7G A;  3E6M A;  1HKT A;  4BHB A;  1EV7 A;  2L3D A;  2A5Y B;  3F23 A;  3R6S A;  4OMZ A;  3HSE A;  4CZZ A;  1B6A A;  5CLS A;  4HX8 A;  2M87 A;  4KIC A;  1Z6T A;  4B09 A;  3C7J A;  5CVI A;  5FO5 A;  2XAH A;  3CDH A;  4A5M A;  3KZY A;  1G3W A;  3K1M A;  2KRF A;  4EMS A;  4MEY F;  1EH6 A;  1MKM A;  3BRO A;  2OBP A;  4U0Y A;  2CGP A;  2V79 A;  1S3J A;  1MJB A;  3W6J B;  2DO7 A;  2KJB A;  1MJ9 A;  2BEO A;  3ZMV A;  5ICG A;  3TO6 A;  3E5X A;  1FZP B;  2ISZ A;  3F72 A;  3F8C A;  3HTS B;  4G6Q A;  1AOY A;  3GFJ A;  3V8K A;  1HKS A;  1IW7 F;  1ULY A;  3E5Q A;  1SFE A;  4M6X A;  3TO9 A;  2Q0O A;  3MAJ A;  6PAX A;  1W7P D;  1P6R A;  1FYK A;  3DKW A;  5LHH A;  4EM0 B;  2E7W A;  2K02 A;  3WTW C;  4IXA A;  3W6K B;  4JQF A;  3U2R A;  5LGN A;  4BH9 A;  1BC7 C;  5L3B A;  1BI2 A;  2TDX A;  4A5N A;  2W57 A;  4ASN A;  4U7B A;  2FML A;  1YS6 A;  1JE8 A;  5BQT A;  4RGX A;  4EV0 A;  5E8G A;  3KEQ A;  2BBY A;  1T39 A;  3EET A;  2ZXJ A;  4XRF A;  4GXO A;  1LNW A;  2HS5 A;  3KLO A;  4FT8 A;  4ZYG A;  5D8L B;  1XSD A;  5E17 F;  3GYH X;  2VE9 A;  3GZ6 A;  1G4D A;  4EJT A;  1BI3 A;  3Q9V A;  2PN6 A;  5IT3 A;  3BJ6 A;  4RS8 A;  5A2Q K;  1Z6R A;  4KT5 C;  1O3R A;  2FF4 A;  2STW A;  1B9M A;  3GXO A;  1K78 B;  4XBF A;  1I1G A;  1P4X A;  5D6E A;  1BN5 A;  4AIH A;  3O3K A;  2COM A;  2W24 A;  2YPR A;  3IRR A;  1CGP A;  3WU0 A;  5ED4 A;  1P4A A;  3F3X A;  1ODD A;  1G3T A;  4S05 A;  3OV8 A;  2K7L A;  1HW2 A;  1ONV A;  5LHG A;  1KGS A;  5DCM A;  3T5X A;  5ILS A;  2EV5 A;  2Z99 A;  4Q4Z F;  4ON0 A;  3GO5 A;  4MNU A;  4EVI A;  2ZKZ A;  3HOT A;  4RGS A;  2NRA C;  2ZCW A;  4YG2 F;  5K5R A;  1L0O C;  5A2Q Z;  1Z91 A;  4NQW A;  2QQB A;  1T2K A;  5E20 A;  2D2W A;  5BPI A;  3I64 A;  1P2F A;  4RAZ A;  2O61 A;  1G6N A;  3HRU A;  3K69 A;  1TQP A;  2QQA A;  2HDC A;  5DD4 A;  4LK1 F;  4EJW A;  2VT2 A;  2P8T A;  2ESH A;  3VEP A;  1SD7 A;  3MFK A;  3BJO A;  1QNT A;  4PCQ A;  2A07 F;  1BIB A;  5HS9 A;  2M1B A;  2M30 A;  1S8N A;  1UHM A;  4HF1 A;  3EUH A;  4B8X A;  2PLY A;  2K4B A;  2YR2 A;  4EM1 A;  2CWE A;  4BNC A;  1B1B A;  2FNP A;  2LSO A;  4P55 A;  3K0L A;  3R4K A;  3TKY A;  4BHC A;  4AIJ A;  4DNC A;  2LF7 A;  1SD6 A;  1DPU A;  1TNS A;  1NHA A;  3FMR A;  4N9I A;  5LHI A;  2FXA A;  3HRM A;  3B73 A;  2E7X A;  4L5J A;  1E2X A;  3BJA A;  2DLL A;  4GYI A;  3RKX A;  4EJU A;  3WTU C;  1LDK B;  3RPU A;  4R1H A;  1CF7 A;  2DK8 A;  2M45 A;  2P5V A;  4G9Y A;  1BM9 A;  3F6V A;  1KU9 A;  3F8N A;  1UFM A;  1W7P B;  4ETS A;  3BZ6 A;  2P6S A;  4OOI A;  3RPQ A;  2L4M A;  5H20 A;  4OIN F;  2IT0 A;  1QQI A;  1FP2 A;  4OIQ F;  2PMU A;  1K7A A;  5H6R A;  4RB3 C;  2F5E A;  4YFN F;  4ENN A;  4IVN A;  1PDN C;  3T8T A;  5BMZ A;  3FWE A;  5H6Q A;  4HAM A;  3JSP A;  3VFZ A;  3DPL C;  1WWX A;  4BAY A;  4HX7 A;  3L9F A;  2XAF A;  5D6F A;  2NS0 A;  2V6C A;  4M73 A;  4MTD A;  4KYW A;  2DK5 A;  1OPC A;  1SMY F;  1PP7 U;  3SHF A;  4QLC U;  2AS5 F;  1KYZ A;  2FQ3 A;  3MEX A;  4KIB A;  1Q1H A;  3QAH A;  3VB2 A;  1ZRC A;  1FNN A;  3RJP A;  2YSR A;  5CVJ A;  2QWW A;  3FMQ A;  4IHT A;  2WWY A;  3FXU A;  3BWG A;  1YYV A;  5D5U B;  4I09 A;  4CIC A;  3IWZ A;  3HSR A;  2HOE A;  2J5O A;  4Y17 A;  4YFK F;  1K79 A;  3QP5 A;  5CYV A;  3U1D A;  2PI0 A;  4F7Z A;  1UHW A;  1J9I A;  1U5T B;  3RI4 A;  2H6C A;  1YFH A;  3L00 A;  1VTN C;  4UVA A;  2J5P A;  3TDZ C;  3IHU A;  2BV6 A;  1XN7 A;  4ZYD A;  3P9I A;  2CO5 A;  4OMY A;  5AIP A;  1KU2 A;  2GA2 A;  2IA1 A;  4BHP A;  2K4J A;  1IN6 A;  1ZYR F;  4MQ9 F;  3V7S A;  3J7A O;  4P9U A;  1HSJ A;  3S2W A;  4KDP A;  2JZY A;  5K5Q A;  4HLY A;  1BJA A;  3NQO A;  4UVB A;  3KP4 A;  5CVU A;  3L7W A;  1LEA A;  2VBY A;  1FLI A;  1B59 A;  5DEQ A;  3JAM K;  4P96 A;  5F1R A;  2A3S A;  5E1X A;  2M5W A;  1FWZ A;  2Z5U A;  1FBU A;  2EK5 A;  5DV5 A;  4EM2 A;  3D5L A;  1WRJ A;  4QWQ A;  5CVR A;  3KCC A;  1DP7 P;  3I5U A;  5L3C A;  4A12 A;  2FSW A;  4HX4 A;  1UB9 A;  2RDP A;  1V3F A;  3I59 B;  5KK1 A;  1SFU A;  2RVC A;  4LB6 B;  4Y13 A;  1ZG5 A;  2VT3 A;  4BQA A;  1MGT A;  3E6B A;  1R1T A;  3HYI A;  3JW4 A;  4A6D A;  3K1P A;  4M74 A;  2DBB A;  1OYI A;  2JSC A;  1USS A;  4RGR A;  4OIP F;  2QYO A;  1R22 A;  2XAS A;  2NYX A;  2XAG A;  1BIA A;  1HST A;  2FA5 A;  2GIV A;  3JAM Z;  4ENM A;  3MZH A;  1D3Y A;  1BOA A;  1U5T C;  2R7F A;  4AVP A;  2OU2 A;  3QU3 A;  3KLN A;  5FD6 A;  2G7H A;  1XMK A;  2Y48 A;  2BE5 F;  3G3Z A;  1MZB A; 
#chains in the Genus database with same CATH topology
 2ME6 A;  5F64 A;  4BJ6 C;  2RNG A;  3ROU A;  2R5Y A;  1M1E B;  4C2U A;  1UST A;  1QU3 A;  2VN2 A;  2KFD A;  3GVA A;  3WHC A;  3BP8 A;  3Q9S A;  1O7F A;  3K4L A;  2OAZ A;  3TOA A;  4EQQ A;  1S9H A;  1FYL A;  2BYV E;  3KP5 A;  1J2X A;  1FP1 D;  1T33 A;  1SEU A;  1WJA A;  1H9T A;  2WA0 A;  3A03 A;  3SEZ A;  2EIN H;  2Q2E B;  1U8R A;  5E18 F;  1B4A A;  5KHD A;  2X85 A;  4FCY A;  2IVM A;  2FOK A;  2VL8 A;  2LY2 A;  4C2T A;  1HKQ A;  3CC4 I;  2QQ8 A;  2ZME A;  2ETH A;  2R7D A;  4EGY A;  3SZP A;  2HNH A;  2FU4 A;  2HTS A;  3KEO A;  1WH7 A;  3FXO A;  1Z9C A;  3BG6 A;  1X58 A;  3W3C A;  2A68 F;  1YW9 A;  2L01 A;  1JKO C;  2IW5 A;  1IRG A;  1S7A A;  2O7O A;  2QM3 A;  1HXD A;  4S0H B;  1IRF A;  3K10 A;  4H4K C;  4DOZ A;  3HL2 A;  3H3Z A;  2DPD A;  1W36 C;  2MSY A;  2IS2 A;  5HLH A;  2G0E A;  4IOA F;  2QVO A;  2ID6 A;  3JRG A;  3KE2 A;  1QZY A;  5FKO A;  1H0M A;  2PJP A;  4Q47 A;  1NK2 P;  2XPU A;  1ORK A;  5FRN A;  5E1W A;  4JX5 A;  3UKG A;  1IAW A;  1ACI A;  2KL4 A;  4KT6 A;  4RDU A;  3JR9 A;  4B43 A;  1SVO A;  1W0U A;  3S1R J;  3RQI A;  1ZR2 A;  1AU7 A;  2CQN A;  4XRS G;  5LEK A;  3OSG A;  4LK0 F;  1ZH5 A;  1JUM A;  3CF2 A;  2CUF A;  4HLX A;  2VC0 A;  4XOT A;  3FX3 A;  2HPM A;  3RZO J;  1HW5 A;  3EUK L;  4M6Y A;  4CXF A;  3S1M J;  1Z3X A;  1G3Y A;  1U0J A;  2E5Z A;  4II3 A;  3K6G A;  1HDP A;  2JVG A;  3DXJ F;  2MAB A;  3WTS C;  2JUG A;  4L18 B;  2HKO A;  1VQ6 I;  3MKL A;  4PFP A;  3DV8 A;  4Z2Y A;  2JPC A;  3F8M A;  3CCJ I;  3G6E I;  3BG3 A;  2Q1Z B;  4LG0 B;  3LA7 A;  2DDB A;  3C2H A;  2CQX A;  3A0H C;  2KIM A;  3HIF A;  1RRJ A;  2L7K A;  2IS1 A;  3R0A A;  2HQN A;  2XAQ A;  3X2Q H;  3MD2 A;  5CKT A;  4BEH A;  1NK3 P;  1YRN B;  2V9V A;  4I0B A;  1P7I A;  3GTQ J;  2XKO A;  2RQP A;  4WCG A;  2DA6 A;  4UUS A;  2Z3Y A;  3PSI A;  1BOB A;  2FD5 A;  3A01 B;  4XR6 A;  5HDK A;  5LD2 C;  3ASN H;  2M4G A;  1BBY A;  1T95 A;  2DPU A;  5L3D A;  2A61 A;  4UV9 A;  3BC8 A;  2BOL A;  5ICC A;  2ZNY A;  2O3F A;  3GFI A;  3C3W A;  4ESF A;  2KJC A;  2HEO A;  5IP9 J;  3ZCO A;  1ZR4 A;  1BI1 A;  4BE1 A;  5DM7 F;  2H27 A;  3N97 A;  1EH7 A;  3E7L A;  3IRQ A;  2LNB A;  3D5R C;  1XS9 A;  1ZLJ A;  4NC8 A;  2LH9 A;  3PQJ A;  2X51 A;  4A69 C;  5DYM A;  1ZK8 A;  3HXL A;  2QCO A;  2R7T A;  3WGH A;  1T0F C;  2HXO A;  3HUG B;  2NVU B;  3ZRG A;  5F6F A;  2DA7 A;  3UNG C;  2LLK A;  3OYL A;  1YJW I;  5E3N A;  2AQE A;  4M3B A;  2CQK A;  4XSX F;  3VOE A;  2FJ1 A;  1AKH B;  4Q5S F;  3WTV C;  4IRI A;  4XLC A;  3R61 A;  4BQN A;  2R7S A;  2COB A;  1H8A C;  3ML6 A;  3CCQ I;  2A69 F;  5D5W B;  5E3L A;  4GCV A;  1YI2 I;  2ISY A;  1XSV A;  1FTT A;  1WI9 A;  3V7C A;  3QPL A;  1ZN2 A;  1MDM B;  1PJR A;  3FM5 A;  1QPM A;  1YLF A;  4OU0 A;  2K9M A;  2XF6 A;  5DDG A;  3L2U A;  4PUS A;  2VBW A;  3GTP J;  1G2H A;  4I02 A;  4Y52 J;  1TWC J;  2Z9O A;  3C1D A;  4L9J A;  2KQR A;  2L9N A;  3GZN B;  1OLT A;  1W0T A;  2M2E A;  1B9N A;  3WHB A;  3BR2 A;  1JHF A;  5D8K B;  1NH3 A;  3GF2 A;  3H9J A;  2BW3 B;  1YIJ I;  2BY0 A;  4BE0 A;  3ZMZ A;  4Y15 A;  3T1B A;  1ETX A;  3K4N A;  3K9T A;  2A6H F;  3CP2 A;  1ZGA A;  2V1X A;  3C2B A;  1SD4 A;  3LOC A;  2MC3 A;  3N4M A;  3CJR B;  4M9S A;  2CG4 A;  2E2I J;  1Z05 A;  1HQC A;  2C6Y A;  3J80 K;  3CCV I;  1Y56 A;  4KA4 A;  2ZO4 A;  3SXY A;  1Z0X A;  3TQN A;  2K27 A;  2P7C B;  1OYY A;  5EEH A;  3HBL A;  3F22 A;  4AIK A;  1FPQ A;  3DWL E;  5B1B H;  4YIR X;  3OWT A;  5LEJ A;  2E1N A;  2NS7 A;  2HR3 A;  4L5I A;  3HOZ J;  3GUD A;  4U0V A;  5ERI A;  4F55 A;  4GDF A;  4DBR A;  1IN7 A;  3JRF A;  5K1Y A;  3KP2 A;  2AHQ A;  2DMQ A;  4DZP A;  5FRM A;  1IXS B;  2VQH A;  3AL0 B;  3LQQ A;  1DQU A;  2CQ7 A;  1ERD A;  3LNQ A;  2AXT C;  4RLF A;  2QA4 I;  4DIQ A;  1R5G A;  5E79 C;  4LIU A;  3I4N J;  2OQR A;  4BBR J;  1VFC A;  3FM3 A;  2DOD A;  3ELK A;  5HS8 A;  3CC2 I;  1OYW A;  3K70 C;  2MG4 A;  4UXN A;  4CSW A;  3MVP A;  3DTI A;  2JRT A;  1R5H A;  3P7N A;  2HQA A;  3CUQ A;  3BG7 A;  3WE2 A;  4RB0 A;  1JKR C;  3E97 A;  4ENK A;  3SEQ A;  1XG1 A;  2M3A A;  3CJQ B;  1FOK A;  3RPU D;  4CZC A;  1U3E M;  4OIR F;  3OYB A;  3ABU A;  3QP6 A;  2F5D A;  3DEW A;  4OAZ A;  2IEK A;  3ZGK A;  2JJ7 A;  3G1O A;  4HF2 A;  1XGM A;  3J80 Z;  3S1Q J;  3MZY A;  1X1A A;  4IHV A;  3U9G A;  4CCJ A;  2DFH A;  5C4X J;  3WTZ A;  4HA8 A;  4DYC A;  3WU1 B;  4FQG A;  2OZ6 A;  4PZJ A;  2K3P A;  3Q0V A;  1A5J A;  5J8C A;  4U0W A;  1VQ7 I;  3HHG A;  1I50 J;  3IC7 A;  5FD5 A;  3ZQF A;  2CFX A;  5TRD A;  1X1D A;  2LKP A;  4F52 A;  2GM4 A;  2DU9 A;  3L2W A;  1TW2 A;  3TP0 A;  2CJJ A;  2L7M P;  2NVQ J;  1IF1 A;  5LBQ A;  3WG9 A;  3HOW J;  3CCL I;  2GOM A;  2MLG A;  5BNG A;  1DDN A;  4A3K J;  4U87 A;  1JJ6 C;  3RYP A;  2R93 J;  1T98 A;  3DTK A;  2ESN A;  2VOP A;  1WKM A;  5FKM A;  2RQQ A;  4OWR B;  5FGM A;  1E3O C;  3MCZ A;  2O8X A;  2K85 A;  2B0L A;  3SFI A;  3IL2 A;  3B02 A;  3O2P E;  5J6X A;  2DA5 A;  2M8E A;  1I5Z A;  3SQN A;  2GZW A;  2XF7 A;  5JHF A;  2ZXI A;  3CCY A;  4HEA 2;  1I27 A;  3KYL A;  3VPR A;  1E0E A;  4AD9 A;  2XKP A;  3QU6 A;  3PNV A;  5CVV A;  3NWT A;  2WAQ A;  4LFU A;  1PUF A;  5EG0 A;  2FRH A;  1MZB A;  1A6I A;  2RC4 A;  3IH3 A;  4E7Z A;  4ZYE A;  3PO3 J;  1YW7 A;  3BT9 A;  3EUA A;  1R36 A;  2XRO A;  2LBF B;  3RZD J;  1S7O A;  1W5S A;  1ZHF A;  1ZG3 A;  1R23 A;  2JWT A;  5L3F A;  4HDV A;  2GWR A;  3KPH A;  3FXR A;  1TWF J;  3TO7 A;  1AWC A;  1LDJ A;  4MIM A;  2LC2 A;  4UUT A;  3WU2 C;  1EH8 A;  1GT0 C;  1O3Q A;  2JPB A;  2O6G E;  3TGN A;  2DFF A;  4BE2 A;  4CCO A;  4QIW N;  2VB6 A;  4BGD A;  2R5Z A;  2QBY A;  2HTJ A;  3AL0 C;  4II2 A;  2R7U A;  1UG0 A;  2F4M B;  4D7M A;  4JBA A;  2IP2 A;  3H35 A;  4NNJ A;  5J4V A;  3JRD A;  4HF0 A;  1MBK A;  2XRN A;  1F36 A;  3H5R A;  3DPT A;  2H6B A;  3HKZ A;  5L3G A;  1GHC A;  4X0G A;  3GFL A;  1TLH B;  1D8J A;  4Z6Y A;  2QSH X;  2AXL A;  2D1V A;  2JTV A;  4ITV A;  1LKX A;  3OYK A;  2IRF G;  3CQZ J;  1ETQ A;  2VQC A;  2K9N A;  2VKE A;  4KMF A;  5JHU A;  2KIU A;  4WXC A;  4H0E A;  2ZSI B;  3ZXS A;  2DW4 A;  4M71 A;  5IOY A;  1VND A;  2DMT A;  2F2E A;  5LFA A;  2F5C A;  3LQR A;  3L09 A;  1R00 A;  1D0Z A;  2LR8 A;  1ETV A;  5DCM B;  3ZQ7 A;  2L2O A;  3HB9 A;  4DQ2 A;  3BQY A;  3QPH A;  4HV5 A;  4N0B A;  4TV7 A;  4M72 A;  5KNL A;  2PG4 A;  3BR5 A;  1GDT A;  2MA3 A;  4D0P A;  3JRE A;  2CV1 A;  2L5Q A;  2V9K A;  2M0M A;  3E3V A;  3SYT A;  2LVS A;  1A04 A;  5FFZ A;  1I1S A;  1WJE A;  2EZH A;  2LP0 A;  3H92 A;  4I7H A;  3HRS A;  4M9X A;  4XNF A;  4UV8 A;  4R8H A;  3E6C C;  1RZ4 A;  2FNA A;  5GPA A;  3U1K A;  2FEZ A;  4A3F J;  3HOY J;  1X3U A;  1XD7 A;  3LA2 A;  1XSX A;  4NHJ A;  4NQW B;  4KIG A;  3VSK A;  4IPA A;  1WVR A;  5M3F J;  4ZZD A;  2CU7 A;  3ERE D;  4WWC A;  1R1V A;  3A0B C;  2BY3 A;  3J81 K;  1JTY A;  1XMA A;  1F1Z A;  2CUJ A;  1SC7 A;  2H1K A;  3MMY B;  3V4G A;  1WJC A;  3CO6 C;  2RAE A;  4MHG A;  3A2K A;  1XPX A;  2BVM A;  1X3Z B;  1ZEL A;  1XC5 A;  2PFB A;  4FX4 A;  1REP C;  2PJR B;  4ZDP A;  4L9T A;  2VQL A;  4E70 A;  2ZFW A;  3NAR A;  5B5E C;  1RPW A;  1S7E A;  4RB1 A;  3DLA A;  2FUG 2;  3E1S A;  2L54 A;  3REO A;  5GTI C;  1N75 A;  1IN5 A;  2PQ8 A;  1SAN A;  1LVA A;  3MWM A;  4KNY A;  4XN3 A;  1AA7 A;  3MN2 A;  3BOQ A;  2A6T A;  3R0J A;  2EV6 A;  2DTZ A;  1JJ8 C;  5K7F A;  2QLZ A;  4XK4 A;  2E34 A;  4EJO A;  1T56 A;  1XTA A;  1JTX A;  3KP3 A;  1POG A;  4ESJ A;  3JTG A;  2E1C A;  3E6D A;  3I3L A;  3AG1 H;  2X6X A;  1BL0 A;  4A93 J;  5FFX A;  1IG7 A;  1I6H J;  1S29 A;  3Q0W A;  3TOB A;  3JRH A;  4BXU A;  2HYG D;  2IA2 A;  2D1H A;  3IAS 2;  1BR2 A;  2F6C A;  1RKT A;  3KET A;  3K7A J;  2K5C A;  1R4M B;  2EFQ A;  2ELJ A;  4AYB A;  3PFI A;  1I39 A;  5EZH A;  4AM3 A;  3I9V 2;  3RQ4 A;  1Z3Y A;  3LSG A;  4BBS J;  2OZU A;  3J81 Z;  4AWX B;  4E7I A;  2K86 A;  3C18 A;  2IGO A;  2KT0 A;  4DW6 A;  2D45 A;  3RKY A;  4HQM A;  4DGW B;  2VKD A;  1ON2 A;  3GX4 X;  2NAZ A;  4U88 A;  1X4P A;  4A3G J;  2UWM A;  2HQR A;  4DYR A;  3L2R A;  2E71 A;  1IN4 A;  2JA7 J;  2DT7 B;  3H3U A;  4A0Z A;  3OYE A;  1CF7 B;  2KPM A;  3T8R A;  3CES A;  2OUM A;  1DGR M;  3COA C;  2PBI A;  1KQ9 A;  4CO8 A;  4XRS A;  1XCB A;  1V4R A;  4XMY A;  1WSU A;  1ZRD A;  5KVR A;  2EA4 A;  5D4R A;  3E5U A;  5HNF A;  5M5Y J;  2WV0 A;  2DA3 A;  4E6K G;  2CYY A;  3GTL J;  3PQK A;  5HOO A;  3K1N A;  4KJZ A;  5LRS A;  1ENH A;  3D1N I;  3PSF A;  4XOP A;  3HOU J;  1BI0 A;  5HS7 A;  1MJA A;  4WXD A;  1TP4 A;  4MFD A;  3LSP A;  2IS4 A;  1TBX A;  4FTH A;  1I3A A;  3BR0 A;  4IOC F;  4LJZ F;  3FXQ A;  1RUN A;  4KIT B;  3KX2 A;  2Z16 A;  4HPQ A;  4L0Y B;  4BY1 J;  2NVY J;  2ELH A;  3TL4 X;  5JVT A;  5LGU A;  3CUQ C;  3GTJ J;  2EIL H;  1G3S A;  4KN4 X;  3GWZ A;  2Y0S N;  2ACJ A;  2GXB A;  3QYB A;  1TW3 A;  2L7Z A;  4L9V A;  1N25 A;  1UAA A;  4LLN A;  5HOD A;  3BDD A;  2NNN A;  1NG6 A;  3CD6 I;  3WE3 A;  4XKC A;  1OR7 A;  3TW6 A;  2BHY A;  3DFG A;  2XIG A;  4O6J A;  1B8I B;  2XF5 A;  1VQM I;  3U21 A;  2OA4 A;  1MMN A;  3HGG A;  4CYC A;  3SDG A;  4L9N A;  2KLO A;  1XDU A;  2RGV A;  3WGI A;  3FXJ A;  3EYY A;  1ZRF A;  3FKJ A;  1TQI A;  2XV4 S;  3LAJ A;  3I0T A;  4BYY A;  3I56 I;  2ZBK A;  4MLO A;  1X4O A;  2ELK A;  5H2F C;  2DMN A;  2LRD A;  1J59 A;  3H9Q A;  5JI6 A;  2KIF A;  3BPV A;  1U2W A;  3EUH C;  3ECO A;  5JR3 A;  3L1P A;  4P9F A;  1FSH A;  1J5Y A;  1LVK A;  5J1R A;  1S72 I;  5EEA A;  3PUB A;  4E7J A;  1YJ9 I;  1JKP C;  1KQ8 A;  4V2G A;  3CDI A;  4PK4 A;  4WF2 A;  3ZOB A;  5HLG A;  1LE8 A;  2MD5 A;  1I6X A;  1EKE A;  2HOS A;  4I98 B;  4ZDL A;  4ZH4 F;  3JRC A;  2MH2 A;  1SVL A;  4PJN A;  2R7R A;  3CME I;  3I54 A;  1HW1 A;  3M8J A;  2M7B A;  3IKV A;  3ZMU A;  1K78 A;  3CCR I;  2EQR A;  2KIQ A;  5DUK A;  4A3D J;  1JXS A;  1Z67 A;  3BG5 A;  2GQQ A;  3A1Y A;  2RV8 A;  1MH3 A;  2DOA A;  1MMD A;  4GRI A;  4IKF A;  2W25 A;  5EF6 A;  1QZZ A;  2M0C A;  1D5Y A;  1SD5 A;  2DYS H;  1FT9 A;  2TCT A;  2UZK A;  3IAM 2;  5HLT A;  2XAJ A;  3H1C A;  3C2G A;  4KN7 X;  4KMU X;  1UZC A;  3J7Z I;  4AU7 A;  3QYE A;  1W5T A;  5LLQ A;  1DPR A;  2I8D A;  3OS0 A;  2HWV A;  3ECH A;  3QOP A;  2XHK A;  3HOV J;  1Z7L A;  1KZH A;  3D5S C;  4HQE A;  1R7J A;  2HFH A;  5JFR A;  2EB7 A;  5TJJ A;  1IZ1 A;  2JUC A;  2W82 A;  3FXL A;  4JX4 A;  2E60 A;  1U9O A;  2XSJ C;  2CUZ A;  2YS9 A;  3ZMS A;  3IKT A;  4F91 B;  4XL9 A;  4GO1 A;  5EJC A;  5KAF C;  1GVD A;  1IN8 A;  3ZP5 A;  2K9L A;  2HYF A;  4PGG A;  2IJL A;  4MGR A;  2VI6 A;  1FOW A;  4MTE A;  3FMS A;  3OIQ A;  3D0S A;  3F21 A;  3HHH A;  4IRG A;  2UXN A;  4XRM A;  3AKZ A;  2X0L A;  4NC7 A;  1X1C A;  3CO7 C;  3JSO A;  1IXC A;  3OR1 C;  2GXA A;  1MSE C;  3GME A;  2DFI A;  3FK6 A;  3GEZ A;  1MMA A;  2QZ8 A;  5J47 A;  5CQG A;  2CFO A;  3VSL A;  2JVH A;  3W2A A;  1STZ A;  1Y1V J;  2YU3 A;  5DS9 A;  4I76 A;  5DUI A;  3G4S I;  1JUP A;  1T38 A;  1J09 A;  2RN7 A;  1J0R A;  3LSJ A;  5FLM J;  1XMX A;  2CMP A;  3CC7 I;  5J1U A;  1WJ5 A;  2HDW A;  2P4W A;  2ZNZ A;  2W85 A;  2H09 A;  3CMM A;  3JRI A;  1DP3 A;  1ETY A;  1QO0 D;  5AIQ A;  1TNT A;  1QBJ A;  1RKW A;  4A0X A;  2Y0M A;  4G7Z F;  2Y9Y A;  3EYI A;  4O3M A;  5IP6 A;  5M5X J;  1IRZ A;  2VOD A;  2EIM H;  2NOJ B;  1U78 A;  2L9R A;  1J7K A;  1O3T A;  2DA1 A;  4HV6 A;  4IHY A;  2V1U A;  2VC1 A;  1VQL I;  1ZAR A;  4K2E A;  2VE8 A;  3PIP F;  4HZF A;  3IP4 B;  1MNE A;  2EV0 A;  4YII A;  4G6D A;  1F43 A;  2E2J J;  3F8B A;  3Q3S A;  3FBN B;  4LGW A;  3BY6 A;  1LQ1 A;  2EZL A;  1U6G A;  1ZTR A;  2KZV A;  3P9K A;  1FX7 A;  2M34 A;  1D8K A;  3K4J A;  1Y39 A;  1KU7 A;  2R3S A;  1XGS A;  2YX7 A;  2JA5 J;  3P5J A;  3M8F A;  2IGN A;  1OCR H;  2VKH A;  4IHS A;  3RTR A;  4UNO A;  2P5L C;  1EF4 A;  2UXX A;  3AG3 H;  2XGD A;  1FOX A;  4HG2 A;  2GAU A;  2W1O A;  3MKY B;  2M7A A;  5DD8 A;  1A36 A;  2L4A A;  1R4N B;  3ZPL A;  2E2H J;  1XGN A;  2NS8 A;  4WXH A;  1L3L A;  2XGE A;  1X1P A;  4B3A A;  2FBK A;  4J01 A;  1KU3 A;  3ABM H;  3GLX A;  2R4G A;  3GZ5 A;  3AG2 H;  3G73 A;  4ENJ A;  2R5Y B;  2DT5 A;  2XGC A;  2F4I A;  1YX5 A;  3LSI A;  5J8F A;  3G2B A;  3CJN A;  1OKR A;  1QHH D;  5IT9 K;  2H8R A;  4ZZL A;  1MSF C;  1YS7 A;  1RIO H;  1FY7 A;  3ONQ A;  1MBH A;  2MH9 A;  4PJL A;  2R7X A;  1IGN A;  4UUV A;  3DP7 A;  1PVE A;  1R9T J;  2PEX A;  2JMW A;  4HST A;  3RDI A;  4IEJ A;  2HDD A;  1W7P A;  5TIS C;  1R58 A;  4L0Z B;  4B1R A;  3L2Q A;  4O5V A;  1H89 C;  2LKS A;  5IYB J;  2ZME B;  4LD5 A;  2XVC A;  2X6Y A;  3LFK A;  4C30 A;  2F5V A;  1ZAO A;  2RKH A;  1RR7 A;  2XSD C;  3S15 J;  5ILV A;  1ZLK A;  5FLV A;  3JCU C;  2HU9 A;  5ICE A;  2A05 A;  2OD5 A;  3A4C A;  4XSZ F;  4B47 A;  5L3E A;  4HSR A;  2VXZ A;  2KP6 A;  4F3Q A;  2OJE D;  4XOR A;  3NRV A;  1TTY A;  3G1M A;  2WC2 A;  2WAF A;  4XLN F;  4AID A;  3TDU C;  2VBX A;  3BQZ A;  2NVX J;  3OS2 A;  4A2U A;  1LJ9 A;  1IO2 A;  4PJJ A;  3H5A A;  1BC8 C;  1T08 B;  4G8X A;  2YUS A;  3SFZ A;  1SFK A;  2NVT J;  3DEE A;  2DI3 A;  2H94 A;  3ISP A;  5LRR A;  2LKX A;  1HOM A;  5D5V B;  3HTU A;  3I58 A;  3CCS I;  1O3S A;  3JRB A;  4A0Y A;  3CUO A;  1W1W E;  4NB5 A;  3HOX J;  1S6L A;  2IXS A;  4HOB A;  1QRY A;  1ZRE A;  5FKL A;  1B72 A;  5IT9 Z;  1QPI A;  2BXY A;  4XID A;  3QRF F;  3CCU I;  3GBG A;  3DBR B;  3RIR A;  1K6Y A;  2DOF A;  4CCK A;  2FE3 A;  4D7N A;  4A3I J;  1YIO A;  5AON A;  3JTH A;  4BXX J;  1T6S A;  3BCB A;  2QEN A;  5HVQ C;  2Y2Z A;  3DF8 A;  3DQV C;  3RKW A;  1R1U A;  2FBI A;  4PJ0 C;  4M9Z A;  1YTY A;  3M1E A;  5EEG A;  1GUU A;  3IWF A;  2W00 A;  1OR7 C;  3CTA A;  1APL C;  4BEH B;  1FJL A;  1WJB A;  1YX3 A;  2GXG A;  1K83 J;  1SAX A;  3AFH A;  1Y0U A;  1GXQ A;  1GVJ A;  2CV2 A;  1KYW A;  2QQ9 A;  3KZI C;  1V54 H;  4ANJ A;  2PJR A;  3ABT A;  3I53 A;  1YW8 A;  2FBH A;  3ZQH A;  4BKX A;  2D5V A;  2BGC A;  2L9V A;  4C2M J;  4Q48 A;  3CMY A;  5FRO A;  2HPI A;  1MMS A;  3CDL A;  2IBD A;  1U5T A;  1FBQ A;  2QGU A;  4M3G A;  4G12 A;  2N8G A;  1H9G A;  4NUB A;  1EA3 A;  3EQL F;  4CDG A;  4A3B J;  4BJ5 C;  2MC4 A;  2KIS A;  3WOD F;  2ADU A;  1BR1 A;  5D4S A;  5HDN A;  2VLA A;  2ZSH B;  1K4T A;  3LSM A;  4KIF A;  3LFU A;  3RSN A;  3TW7 A;  3KFW X;  2ZJ2 A;  1DGW Y;  1ZGW A;  4G7H F;  3OOU A;  4EAT A;  4EJV A;  2ZME C;  4YEJ A;  3H9G A;  5B1A H;  1FBS A;  3HG9 A;  4LMY A;  3Q0U A;  5CQE A;  2X4H A;  3FF5 A;  3FHZ A;  5B3S H;  3M07 A;  4XM3 A;  4WX9 A;  1E17 A;  1TQM A;  1P92 A;  1W4M A;  3M9A A;  1J75 A;  2MGQ A;  2O9L A;  3ZMT A;  3OYH A;  4HRI A;  4Y4R A;  1SFX A;  2CW7 A;  3F6O A;  4LG3 A;  3VDX A;  3GCM A;  2BY2 A;  1D5V A;  4KUM A;  3Q5F A;  3FXK A;  1OIS A;  3OIP A;  1RNL A;  3QPT A;  2Z33 A;  4CGZ A;  3GTO J;  2EWN A;  5GAE J;  4QTR A;  2EJR A;  3NEU A;  4AUX A;  4BQQ A;  2EBI A;  2IA0 A;  2OV7 A;  4MO7 A;  2ECB A;  1XX5 A;  3OYC A;  1MBE A;  2K40 A;  2Y69 H;  1O4X A;  1UCR A;  3I71 A;  4P5O A;  2X9D A;  4ZYH A;  1Y1W J;  1KA8 A;  2EFW A;  1MBG A;  3OOP A;  2Y75 A;  1PYV A;  1YG2 A;  5J4Y A;  1GXP A;  3VWB A;  4CYD A;  5K5O A;  3PL8 A;  2DQR A;  2OCC H;  4EGZ A;  5FLX K;  1P4W A;  4UHT A;  4A6E A;  2QSF X;  1JUS A;  2XAU A;  3I59 A;  5EGO A;  3V8L A;  1MBJ A;  3V7R A;  3ZN0 A;  1JGS A;  5C3E J;  4KFC A;  3PJR A;  4V2F A;  4FIS A;  4EEF G;  5D5X B;  1WFX A;  2XUB A;  3BR1 A;  1DUX C;  4DZJ A;  3WTY C;  4FHT A;  1WQ2 A;  1MBF A;  2VBZ A;  2VON A;  1YOV B;  4S04 A;  4XLP F;  1V5F A;  1RI7 A;  4IRH A;  2O03 A;  4FE4 A;  5F0C A;  1F5T A;  3KP7 A;  3G1L A;  3PNY A;  4RMN A;  1X3W B;  3HZJ A;  2VOO A;  2K3F A;  9ANT A;  4LIT A;  1FMV A;  1FSE A;  3OYA A;  2W48 A;  2P81 A;  3MKZ A;  4RB2 C;  2QUF A;  1X19 A;  4IHX A;  2E1M B;  1ZGJ A;  2CSO A;  2HGC A;  2MBF A;  4G94 A;  1W5C C;  2KHM A;  2G7U A;  5DTD A;  4YFX F;  1A31 A;  1KQ0 A;  1XB4 A;  4WK8 F;  5CJ9 A;  1PUE E;  1FIP A;  2AO9 A;  2M9H A;  1TT5 B;  1VQK I;  3ZN1 A;  3OYM A;  4XIC A;  4ESB A;  3KYD B;  4P1W A;  2FMY A;  3L2C A;  3FHN A;  2B7E A;  2F48 A;  4N4N B;  3NWS A;  5GAD J;  1O57 A;  2EFO A;  1XGO A;  2YX4 A;  3TED A;  3F8F A;  4YRV A;  1K6O A;  2DAO A;  1VQ8 I;  4X6A J;  2H1L A;  3ZQC A;  5EDN A;  1ZG1 A;  3HSF A;  3K2Z A;  3M1C A;  2R7O A;  1RUO A;  3R60 A;  3WTT C;  2LF8 A;  2XC7 A;  4B3X A;  3DU6 A;  2HZT A;  1IXR C;  5CPR B;  1OMI A;  3CUQ B;  2OPT A;  3K2A A;  4CHU A;  4IJA A;  5FLX Z;  2NNY A;  1HC8 A;  2L02 A;  3S2H J;  2OQG A;  1OCP A;  5BS6 A;  3CCM I;  3SZT A;  1IDZ A;  1JHH A;  1LFP A;  4CH7 A;  2L0K A;  5BOX A;  3P9C A;  3AAF A;  1N78 A;  4MEX F;  4HYE A;  4N9H A;  2EA2 A;  3S16 J;  4N4O B;  1ITY A;  2HZD A;  4RGU A;  3VOD A;  4HDU A;  3BLY A;  2STT A;  3HRT A;  2DJI A;  2Q2E A;  2ZJP F;  4BUP A;  1XDS A;  1T0F A;  2Q8K A;  4QSH A;  2BHZ A;  5EYR A;  3H5N A;  2GA1 A;  3EDP A;  4LLL A;  2W84 A;  3CF5 F;  4IF4 A;  2F5F A;  5J1Y A;  2GIZ A;  2PMH A;  1DU0 A;  5HDG A;  2DQL A;  1QGP A;  3QYF A;  3LA3 A;  2HKX A;  2V1D A;  3KP6 A;  1Z7U A;  1YQA A;  4IX7 A;  2VJ5 A;  1ON1 A;  3ESW B;  2CW0 F;  2P7V B;  3HOS A;  4G7O F;  5ILU A;  2JSP A;  4Y7N J;  2O0Y A;  3T0Y A;  2IAI A;  2WB1 A;  2KRH A;  1Q1V A;  1JT6 A;  4PDK A;  5DCF A;  3CLO A;  2P0W A;  4I01 A;  4FX0 A;  4LLG F;  2DTR A;  3BR3 A;  2DXI A;  2ZXW H;  2HOA A;  1ZQ3 P;  4AYB N;  5ICF A;  2LOO A;  2MD0 A;  2IS6 A;  3FZV A;  1F9N A;  3ULQ B;  4U7D A;  2MLK A;  4UY8 I;  1MNM C;  4JYK A;  3LAP A;  1PUF B;  2HOT A;  1G59 A;  5EG0 B;  1N77 A;  1LB2 A;  2BVL A;  2JA8 J;  1MD0 A;  4BY7 J;  2JA2 A;  4ZTJ A;  4OAY A;  5BPD A;  1MW7 A;  1TZL A;  4YIF A;  2LDU A;  3DEU A;  2EFN A;  1YO5 C;  2IPQ X;  4KIS A;  2E1M C;  2R5Z B;  2G9W A;  1LEB A;  4Y3O A;  2QBY B;  1SMT A;  4R79 A;  1YE9 A;  4AC0 A;  4MQV A;  1V5E A;  2DCE A;  4HW0 A;  5E1Z B;  3KZZ A;  3FKI J;  4IL6 C;  4LG0 A;  2ME0 A;  4RBO A;  2BZT A;  1XCV A;  3K4K A;  3MQ0 A;  3S14 J;  3S3N A;  2HVQ A;  1PP8 F;  2P6T A;  4M3F A;  1D0X A;  1FC3 A;  1UHS A;  1YRN A;  3O6B B;  1QA6 A;  3ZMD A;  1C0W A;  1O7L A;  3HGY A;  1HBX G;  3WGG A;  4ZC3 A;  3A01 A;  1F4K A;  4OIO F;  2HYJ A;  3LST A;  2A6E F;  2EFP A;  3I4P A;  4CCL A;  2XGX A;  3HEF A;  3BPX A;  2PX9 A;  4RA2 A;  2DYR H;  5TGT A;  3RYR A;  2KKO A;  5E8I A;  4LB5 A;  2E1O A;  2P5K A;  2LFB A;  3M8E A;  2JT1 A;  4GYG A;  4HBL A;  1IUY A;  1X2N A;  2VUM J;  4JK1 X;  3NAU A;  4PSX A;  4XKW A;  3S3M A;  2VQG A;  3LWF A;  4Y33 A;  3GW2 A;  3GFM A;  4RM3 A;  4JX6 A;  5IYD J;  1FYM A;  3WTX C;  4RAY A;  1Y8Q B;  4XQF A;  1TWG J;  3HUG A;  2V6E A;  1IJW C;  2RNJ A;  3V8J A;  4GFB A;  3V42 A;  2BXZ A;  5F04 A;  1T8I A;  2LG4 A;  5LGT A;  3FXM A;  1AKH A;  2X6O A;  1VQP I;  5F27 A;  4GGG A;  1LDD A;  3HJE A;  3N05 A;  3CMA I;  3M4O J;  2DDA A;  5JLW A;  4E7S A;  1D1A A;  2CH0 A;  4I0A A;  2CUE A;  2PMZ N;  2WTE A;  3OL4 A;  4CCN A;  4UVC A;  2HVS A;  3OSF A;  4PGH A;  2JRM A;  1Z1D A;  3FK7 A;  5FB2 A;  1MDM A;  4I2O A;  4J00 A;  5HLI A;  3DKX A;  3M7G A;  3E6M A;  1HKT A;  4BHB A;  2VPR A;  4HNU A;  1EV7 A;  2L3D A;  2A5Y B;  3F23 A;  3R6S A;  2CS3 A;  1I3Q J;  4OMZ A;  3JRA A;  1VZ0 A;  5F08 A;  1OCT C;  3HSE A;  3S8P A;  4CZZ A;  1TC3 C;  2DJN A;  2VJJ A;  3OIO A;  3OR2 C;  1RR8 C;  1B6A A;  5CLS A;  2O5R A;  3W2W A;  2BW3 A;  1WJF A;  3ZQG A;  1WGX A;  1X1B A;  2M4K A;  4HX8 A;  1WPK A;  2M87 A;  3SDB A;  4IQJ A;  2WBM A;  4KIC A;  1Z6T A;  2KRC A;  4B09 A;  2ZB9 A;  3C7J A;  4UB6 C;  5CVI A;  5FO5 A;  2XAH A;  3CDH A;  4A5M A;  1LFU P;  3KZY A;  1OCZ H;  3CCE I;  1A6Q A;  2X48 A;  1G3W A;  1TT0 A;  2F4O B;  1A35 A;  1CQT A;  4BJT A;  2Y30 A;  2DA4 A;  3K1M A;  2KRF A;  4EMS A;  4MEY F;  3S17 J;  3OMY A;  1U8B A;  2JK3 A;  1EH6 A;  1MKM A;  4IO9 F;  3BTI A;  3BRO A;  2OBP A;  2R0Q C;  2LY1 A;  4U0Y A;  1ETK A;  2CGP A;  1BA5 A;  2V79 A;  1S3J A;  1GV5 A;  1MJB A;  4C3J J;  3W6J B;  3HPH A;  3G71 I;  1ETO A;  2DO7 A;  2KJB A;  5IP7 J;  2I5U A;  2QEX I;  1MJ9 A;  2BEO A;  3ZMV A;  2VXD A;  2VPL A;  1QVT A;  5ICG A;  3TO6 A;  1RET A;  2QKM B;  3E5X A;  1FZP B;  4PJM A;  1VQ4 I;  4W97 A;  2ISZ A;  2DA2 A;  5E3M A;  1Y8R B;  4FET A;  3F72 A;  1R71 A;  3F8C A;  2GLO A;  3HTS B;  4G6Q A;  1AOY A;  2LTP A;  3GFJ A;  2EIK H;  3V8K A;  3IUO A;  1HCR A;  1HKS A;  1E3P A;  2RRE A;  2HVR A;  1IW7 F;  4QPO A;  1ULY A;  3F0C A;  5FKN A;  1OCC H;  3E5Q A;  1AHD P;  1SFE A;  2I10 A;  4M6X A;  3TO9 A;  2Q0O A;  3MAJ A;  3O8H A;  6PAX A;  3MKW B;  5JLX A;  1W7P D;  1P6R A;  1FYK A;  4YEL A;  3TBI A;  2LY9 A;  1NTC A;  3DKW A;  2K9S A;  2DN0 A;  4E7L A;  3WG7 H;  3MZ8 A;  5LHH A;  1D0Y A;  4EM0 B;  1HF0 A;  1HA8 A;  5JVG F;  3PNT A;  1IUF A;  3DBL B;  2E7W A;  2K02 A;  1BR4 A;  3WTW C;  4IXA A;  3W6K B;  1KON A;  4JQF A;  3U2R A;  5LGN A;  3DKY A;  4BH9 A;  3QPS A;  1D1B A;  2ICW G;  5GTH C;  1BC7 C;  5L3B A;  4A3M J;  3LSK A;  1BI2 A;  3RCO A;  2TDX A;  4A5N A;  3AG4 H;  5HNH A;  5E3O A;  4DBQ A;  2W57 A;  4ASN A;  2ZJQ F;  1VQO I;  4U7B A;  4CYC B;  1UJ8 A;  2FML A;  1YS6 A;  2WY8 Q;  1JE8 A;  2MW8 A;  5BQT A;  4RGX A;  2VJI A;  4JP0 A;  4EV0 A;  2HI3 A;  5E8G A;  3KEQ A;  2BBY A;  1YHQ I;  3EET A;  1T39 A;  2Z1D A;  2ZXJ A;  3QOE A;  4XRF A;  4GXO A;  1LNW A;  2V26 A;  1BW5 A;  2HS5 A;  3KLO A;  1R6R A;  2E5N A;  4FT8 A;  4ZYG A;  4A3J J;  1IC8 A;  5D8L B;  1XSD A;  3PM1 A;  5E17 F;  1HDD C;  1MH4 A;  4D5C A;  3GYH X;  2MFZ A;  2VE9 A;  3GZ6 A;  1G4D A;  4EJT A;  1SAU A;  1BI3 A;  4BXF A;  2LBF A;  3Q9V A;  1P9Q C;  2XPW A;  2PN6 A;  3EPZ A;  1FMW A;  5IT3 A;  3BJ6 A;  5F0F A;  1LE8 B;  4RS8 A;  2DT6 A;  3DBH B;  4ZYA A;  5A2Q K;  1Z6R A;  4KT5 C;  5IOZ A;  1O3R A;  2FF4 A;  2STW A;  1FOY A;  2QKL B;  4NBQ A;  1B9M A;  3K4C A;  2JA6 J;  2M8G X;  4ZDO A;  2DOE A;  3GXO A;  2A5W A;  1K78 B;  4XBF A;  2LMD A;  4ZJZ A;  1YIT I;  1I1G A;  1P4X A;  2DFE A;  3BTL A;  2LYC A;  5D6E A;  1BN5 A;  1RES A;  1LPQ A;  4D5F A;  4AIH A;  3TP3 A;  2Z2S B;  3O3K A;  4HNT A;  3S93 A;  2JN6 A;  1DU6 A;  2V7F A;  2COM A;  2W24 A;  2YPR A;  3LSH A;  3IRR A;  1CGP A;  3M3Y J;  3WU0 A;  5ED4 A;  1P4A A;  3F3X A;  3GTM J;  3FIW A;  1ODD A;  1G3T A;  4S05 A;  3OV8 A;  2K7L A;  2R7Z J;  1HW2 A;  1GV2 A;  1ONV A;  5LHG A;  1OQY A;  1KGS A;  2VAS A;  5DCM A;  2TRT A;  4G6T B;  3T5X A;  3DCF A;  1WI3 A;  2XDV A;  1JKQ C;  5ILS A;  2DMU A;  2EV5 A;  2Z99 A;  3KYC B;  3ZR8 X;  4NDL A;  4BU2 A;  4L5E A;  4Q4Z F;  4RAG A;  3S32 A;  4ON0 A;  3GO5 A;  4MNU A;  2OTJ I;  3DU5 A;  4EVI A;  3BTC A;  5M3M J;  3QWL A;  1Z21 A;  2ZKZ A;  3CP8 A;  3HOT A;  4RGS A;  3OS1 A;  4IZZ A;  2NRA C;  2ZCW A;  3FBI B;  4YG2 F;  5K5R A;  1L0O C;  5A2Q Z;  1Z91 A;  1K4S A;  4NQW A;  1V55 H;  4XLF A;  2EH3 A;  1QVU A;  2QQB A;  4BS9 A;  3OYD A;  1T2K A;  5E20 A;  2WV1 A;  4XLA A;  1IV6 A;  2D2W A;  4C9Y A;  5IY5 H;  1P7J A;  2V1N A;  4A3C J;  5BPI A;  3I64 A;  3I4M J;  1P2F A;  5B66 C;  1R49 A;  2CRG A;  4RAZ A;  2O61 A;  4ZTF A;  3E0J B;  4BL0 B;  1G6N A;  2ECC A;  3HRU A;  3K69 A;  1TQP A;  4C3I J;  3H0G J;  1HLV A;  2OF7 A;  2QQA A;  1FTZ A;  4UUS B;  3H36 A;  2GOX B;  1W36 D;  2HDC A;  5DD4 A;  1FIA A;  4LK1 F;  4EJW A;  2VT2 A;  1Y6I A;  3HDD A;  5KAI C;  2P8T A;  2X1D A;  4PSW A;  5M5W J;  2VJ4 A;  5F0H A;  2ESH A;  2R7Q A;  1VF9 A;  1WH5 A;  3VEP A;  1SD7 A;  1JT0 A;  4RLQ A;  4CUG A;  3MFK A;  2FQ4 A;  1QZE A;  2KDO A;  3FDY A;  3VYR B;  3BJO A;  1QNT A;  1BW6 A;  3PFY A;  3J7Y J;  1WHU A;  2ZJR F;  2IGM A;  2GBY A;  4I99 C;  4PCQ A;  4AVZ A;  2A07 F;  1BIB A;  5HS9 A;  1OCO H;  2VKV A;  1ETW A;  2M1B A;  2M30 A;  1S8N A;  1UHM A;  4HF1 A;  3EUH A;  4B8X A;  1RC9 A;  3HPG A;  2PLY A;  3BTJ A;  2VIX A;  2K4B A;  1SFO J;  5C44 J;  2YR2 A;  4PFO A;  4EM1 A;  1VQ5 I;  1V5G A;  2CWE A;  3OYF A;  4BNC A;  1B1B A;  2FNP A;  3ABL H;  3RKQ A;  2LSO A;  4P55 A;  3K0L A;  3R4K A;  3L2V A;  1QHG A;  3W6V A;  3TKY A;  5C4J J;  4BHC A;  4AIJ A;  4DNC A;  5K7Z A;  2LF7 A;  1VQ9 I;  1R5I D;  1SD6 A;  4M3E A;  2X1E A;  1DPU A;  4XKV A;  1TNS A;  1NHA A;  2L7F P;  3FMR A;  4N9I A;  5LHI A;  3ERM A;  2Y31 A;  4B44 A;  2FXA A;  2XB5 A;  3HRM A;  3B73 A;  2WAQ N;  3H3V K;  1X2M A;  2R7V A;  2E7X A;  4L5J A;  3VYU B;  1E2X A;  3VYS B;  1G8X A;  3BJA A;  2DLL A;  1WZ2 A;  4GYI A;  1VQN I;  2B63 J;  3RKX A;  4EJU A;  3WTU C;  1LDK B;  3PUF A;  4XLH A;  3RPU A;  4R1H A;  1CF7 A;  2DK8 A;  2M45 A;  1U9N A;  4CA0 A;  2P5V A;  3GLL A;  4G9Y A;  4FE7 A;  1BM9 A;  3IH2 A;  4LIV A;  1WCM J;  1KU9 A;  3F6V A;  3F8N A;  1UFM A;  1W7P B;  2OC6 A;  1ZKG A;  4ETS A;  3BZ6 A;  1IDY A;  2P6S A;  3OYI A;  4OOI A;  3HKZ N;  2L4M A;  5H20 A;  3RPQ A;  4OIN F;  2IT0 A;  1QQI A;  1FP2 A;  4OIQ F;  2LD5 A;  3S1N J;  2PMU A;  3S2D J;  1LFB A;  3BZK A;  2KMU A;  5H6R A;  1MND A;  1K7A A;  1E3H A;  3OYN A;  4RB3 C;  2F5E A;  4YFN F;  2FOW A;  4ENN A;  5GP9 A;  5F1J A;  4IVN A;  1PDN C;  3T8T A;  2QF7 A;  3J7A Y;  2W7N A;  5BMZ A;  3FWE A;  4HNV A;  5H6Q A;  4HAM A;  3JSP A;  3VFZ A;  3OYG A;  3DPL C;  1SVM A;  2CW8 A;  2ZFU A;  1WWX A;  5IYC J;  4BAY A;  4HX7 A;  1UEL B;  3L9F A;  4C3H J;  2XAF A;  3ASO H;  1FEX A;  5D6F A;  5DM6 F;  1Y0N A;  4V19 K;  2WAD A;  2NS0 A;  2V6C A;  3KIO A;  2L9S A;  4XON A;  4M73 A;  4MTD A;  4KYW A;  2NOG A;  3BCA A;  3BG9 A;  2DK5 A;  1B8I A;  1OPC A;  2E35 A;  2ZXH A;  1SMY F;  1PP7 U;  3SHF A;  3K4M A;  1B72 B;  2R92 J;  1BJZ A;  2B9S A;  3GTG J;  4QLC U;  2AS5 F;  1KYZ A;  3B6C A;  2V9P A;  2WY7 Q;  2DMP A;  2FQ3 A;  3MEX A;  1YJN I;  4KIB A;  4A3E J;  1Q1H A;  3FIS A;  2XRL A;  4BAC A;  4XKB A;  3QQA A;  3QAH A;  3CZ6 A;  5GAG J;  5J3L A;  1IV8 A;  3IV5 A;  3VB2 A;  4ABZ A;  1ZRC A;  3OL3 A;  4DJA A;  3B6A A;  1FNN A;  3RJP A;  2YSR A;  5CVJ A;  2OTL I;  5FKK A;  2HXI A;  2QWW A;  3FMQ A;  4IHT A;  3S3O A;  3W2V A;  2WWY A;  3FXU A;  3OY9 A;  3BWG A;  1YYV A;  3F9K A;  5D5U B;  2FX0 A;  2LRE A;  4I09 A;  4CIC A;  1IRX A;  3IWZ A;  3HSR A;  2HOE A;  4XLE A;  2QSG X;  2J5O A;  4Y17 A;  4YFK F;  1K79 A;  3QP5 A;  5CYV A;  3U1D A;  4IQ4 A;  2PI0 A;  1GLN A;  4F7Z A;  1UHW A;  3DPU A;  1J9I A;  1U5T B;  1MMG A;  3RI4 A;  2H6C A;  3K4B A;  3LSR A;  4BQO A;  1YFH A;  3HM5 A;  3L00 A;  1VTN C;  4UVA A;  3VYT B;  1EJ9 A;  2J5P A;  2WAE A;  3TDZ C;  3QOD A;  3IHU A;  2BV6 A;  1XN7 A;  4ZYD A;  4CCM A;  1TL8 A;  3P9I A;  2CO5 A;  2H8W A;  4OMY A;  5AIP A;  2KDZ A;  1KU2 A;  2EIJ H;  2GA2 A;  2O8K A;  2IA1 A;  4BHP A;  4M3D A;  1TWH J;  2K4J A;  2NXN B;  4RM2 A;  1IN6 A;  3O8G A;  1ZYR F;  2BY1 A;  4MQ9 F;  3K70 D;  3DLL F;  2MYS A;  3V7S A;  3J7A O;  5IPA A;  4P9U A;  3KEY A;  4RAF A;  1HSJ A;  2WB1 N;  3S2W A;  4KDP A;  2JZY A;  5K5Q A;  4HLY A;  3LMM A;  1BJA A;  3NQO A;  4UVB A;  3KP4 A;  4B48 A;  5CVU A;  4NC6 A;  3L7W A;  1S5L C;  4X1E A;  3ABK H;  4UB8 C;  2UV1 A;  1UG2 A;  1TWA J;  2E19 A;  1LEA A;  2VBY A;  1FLI A;  2UUZ A;  1B59 A;  2E36 A;  5DEQ A;  3JAM K;  2X1C A;  4P96 A;  5F1R A;  1OFC X;  2EZK A;  2HQ5 A;  2A3S A;  5E1X A;  2EZI A;  4I6Z A;  4BDY A;  2M5W A;  4E7H A;  3BZC A;  1FWZ A;  2Z5U A;  5EZG A;  1FBU A;  3UR3 C;  5FJ8 J;  2AQF A;  2EK5 A;  5K7H A;  5DV5 A;  1D1C A;  3CLQ A;  4EM2 A;  4BDZ A;  3D5L A;  3ZQQ A;  1WRJ A;  4QWQ A;  5CVR A;  3KCC A;  2EPF A;  1DP7 P;  3I5U A;  5L3C A;  4A12 A;  2FSW A;  4F93 B;  2YU9 J;  5KCM A;  4HX4 A;  1MIJ A;  3BR6 A;  1UB9 A;  2RDP A;  1V3F A;  3I59 B;  1OJL A;  2R7W A;  5EGO B;  5KK1 A;  1SFU A;  1H88 C;  2K9Q A;  3GTK J;  4W1U A;  2RVC A;  4JOM A;  2Y9Z A;  1K61 A;  2JQ7 A;  2XPV A;  4LB6 B;  4D9J A;  4Y13 A;  1ZG5 A;  2CV0 A;  2VT3 A;  1Z77 A;  1JGG A;  4BQA A;  1MGT A;  3E6B A;  4LOC A;  1R1T A;  3HYI A;  3JW4 A;  2Y0S A;  3CJT B;  2X6W A;  4A6D A;  4F92 B;  4E7K A;  3DTE A;  3PIO F;  2LK2 A;  3K1P A;  4M74 A;  3SZG A;  4FAS D;  3A02 A;  2DBB A;  1OYI A;  3TMO A;  4B4C A;  1WJD A;  4E4H A;  3ZQL A;  2IGK A;  2JSC A;  1USS A;  4RGR A;  4OIP F;  4IHW A;  2QYO A;  1R22 A;  2V4J C;  3HC7 A;  2XAS A;  2XB0 X;  4QPQ A;  2ZC2 A;  1JI8 A;  2NYX A;  5GAH J;  5GPC A;  2XAG A;  4J19 A;  2ID3 A;  1BIA A;  3I55 I;  1HST A;  2CQQ A;  2FA5 A;  2GIV A;  3JAM Z;  3IH4 A;  4ENM A;  4D1Q A;  3MZH A;  1VI0 A;  1D3Y A;  1BOA A;  1U5T C;  2R7F A;  4AVP A;  2KZG A;  2OU2 A;  3QU3 A;  5J40 A;  2W4S A;  4XN0 A;  3ZQI A;  3SJM A;  4A3L J;  1LUJ B;  3KLN A;  4MFE A;  3PO2 J;  5FD6 A;  2G7H A;  4M6V A;  1XMK A;  2OCE A;  3LL7 A;  4DYQ A;  3OYJ A;  3H0D A;  2PMZ A;  2Y48 A;  1NG7 A;  2BE5 F;  3G3Z A;  1UMQ A; 
#chains in the Genus database with same CATH homology
 5F64 A;  3ROU A;  1UST A;  2VN2 A;  3GVA A;  3BP8 A;  3Q9S A;  1O7F A;  2OAZ A;  3TOA A;  4EQQ A;  1FYL A;  2BYV E;  3KP5 A;  1J2X A;  1FP1 D;  1H9T A;  1U8R A;  5E18 F;  1B4A A;  2IVM A;  2FOK A;  1HKQ A;  2ZME A;  2ETH A;  2R7D A;  4EGY A;  3SZP A;  2FU4 A;  2HTS A;  3KEO A;  1Z9C A;  2A68 F;  1YW9 A;  2L01 A;  2IW5 A;  1IRG A;  1S7A A;  2QM3 A;  1HXD A;  1IRF A;  3H3Z A;  2DPD A;  5HLH A;  2QVO A;  1H0M A;  3KE2 A;  1QZY A;  2PJP A;  4Q47 A;  5E1W A;  1IAW A;  5LEK A;  1ZH5 A;  4LK0 F;  4HLX A;  2VC0 A;  3FX3 A;  1HW5 A;  4M6Y A;  4CXF A;  1G3Y A;  3DXJ F;  3WTS C;  4L18 B;  2HKO A;  3DV8 A;  4Z2Y A;  2JPC A;  3F8M A;  4LG0 B;  3LA7 A;  2KIM A;  3HIF A;  3R0A A;  2HQN A;  2XAQ A;  2V9V A;  4I0B A;  2XKO A;  2RQP A;  4WCG A;  2Z3Y A;  5HDK A;  1BBY A;  2DPU A;  5L3D A;  2A61 A;  4UV9 A;  5ICC A;  2ZNY A;  2O3F A;  3GFI A;  3C3W A;  4ESF A;  2KJC A;  2HEO A;  1BI1 A;  2H27 A;  3N97 A;  1EH7 A;  3IRQ A;  2LNB A;  1ZLJ A;  3PQJ A;  5DYM A;  3WGH A;  5F6F A;  2CQK A;  4XSX F;  3VOE A;  4Q5S F;  3WTV C;  4IRI A;  3R61 A;  3ML6 A;  2A69 F;  5D5W B;  4GCV A;  2ISY A;  1XSV A;  1WI9 A;  3V7C A;  1ZN2 A;  1MDM B;  3FM5 A;  1QPM A;  1YLF A;  4OU0 A;  5DDG A;  2VBW A;  4I02 A;  2Z9O A;  3C1D A;  4L9J A;  1B9N A;  1JHF A;  5D8K B;  3GF2 A;  3ZMZ A;  4Y15 A;  3T1B A;  3K9T A;  2A6H F;  1ZGA A;  2V1X A;  1SD4 A;  2MC3 A;  3N4M A;  4M9S A;  2CG4 A;  1Z05 A;  1HQC A;  2C6Y A;  3J80 K;  4KA4 A;  2ZO4 A;  3SXY A;  3TQN A;  2K27 A;  2P7C B;  1OYY A;  5EEH A;  3F22 A;  4AIK A;  1FPQ A;  5LEJ A;  2E1N A;  2HR3 A;  4L5I A;  3GUD A;  4U0V A;  5ERI A;  1IN7 A;  5K1Y A;  3KP2 A;  1IXS B;  3LQQ A;  1R5G A;  2OQR A;  3FM3 A;  3ELK A;  5HS8 A;  1OYW A;  4UXN A;  2JRT A;  1R5H A;  3P7N A;  3CUQ A;  3WE2 A;  4RB0 A;  3E97 A;  4ENK A;  1FOK A;  1U3E M;  4OIR F;  3ABU A;  3QP6 A;  2F5D A;  4HF2 A;  1XGM A;  3J80 Z;  3MZY A;  3U9G A;  3WTZ A;  4HA8 A;  3WU1 B;  2OZ6 A;  4PZJ A;  5J8C A;  4U0W A;  3HHG A;  3IC7 A;  5FD5 A;  2CFX A;  5TRD A;  2LKP A;  2DU9 A;  1TW2 A;  1IF1 A;  5LBQ A;  3WG9 A;  2MLG A;  1DDN A;  3RYP A;  1T98 A;  2ESN A;  2VOP A;  1WKM A;  5FGM A;  3MCZ A;  2O8X A;  2B0L A;  3IL2 A;  5J6X A;  3O2P E;  3B02 A;  2M8E A;  1I5Z A;  3SQN A;  2GZW A;  1I27 A;  4AD9 A;  2XKP A;  3QU6 A;  5CVV A;  4LFU A;  2FRH A;  2RC4 A;  4ZYE A;  1YW7 A;  1R36 A;  2XRO A;  1S7O A;  1W5S A;  1ZHF A;  1ZG3 A;  1R23 A;  5L3F A;  4HDV A;  2GWR A;  3FXR A;  1AWC A;  3TO7 A;  1LDJ A;  1EH8 A;  1O3Q A;  2JPB A;  2O6G E;  3TGN A;  2QBY A;  2HTJ A;  4JBA A;  2IP2 A;  4HF0 A;  2XRN A;  3DPT A;  2H6B A;  5L3G A;  1GHC A;  3GFL A;  1TLH B;  1D8J A;  2AXL A;  2D1V A;  2JTV A;  2IRF G;  4KMF A;  5JHU A;  2KIU A;  4WXC A;  4H0E A;  2DW4 A;  4M71 A;  2F2E A;  2F5C A;  3LQR A;  3L09 A;  1R00 A;  5DCM B;  3ZQ7 A;  4DQ2 A;  3QPH A;  4HV5 A;  4N0B A;  4TV7 A;  4M72 A;  2PG4 A;  2MA3 A;  4D0P A;  3E3V A;  1A04 A;  5FFZ A;  1I1S A;  3H92 A;  4I7H A;  3HRS A;  4M9X A;  4UV8 A;  4R8H A;  3E6C C;  1RZ4 A;  2FNA A;  2FEZ A;  1X3U A;  1XD7 A;  3LA2 A;  1XSX A;  4NHJ A;  4KIG A;  4IPA A;  4ZZD A;  3ERE D;  4WWC A;  1R1V A;  3J81 K;  1XMA A;  1F1Z A;  3CO6 C;  3V4G A;  4MHG A;  2PFB A;  4FX4 A;  1REP C;  4L9T A;  4E70 A;  2ZFW A;  4RB1 A;  2L54 A;  3REO A;  1IN5 A;  2PQ8 A;  1LVA A;  3MWM A;  4KNY A;  3BOQ A;  3R0J A;  2EV6 A;  2QLZ A;  4EJO A;  3KP3 A;  4ESJ A;  3JTG A;  2E1C A;  3E6D A;  5FFX A;  1S29 A;  3TOB A;  4BXU A;  2HYG D;  2IA2 A;  2D1H A;  3KET A;  2EFQ A;  3PFI A;  2OZU A;  3J81 Z;  4AWX B;  2K86 A;  3C18 A;  2D45 A;  3RKY A;  4HQM A;  1ON2 A;  3GX4 X;  2NAZ A;  4U88 A;  2UWM A;  2HQR A;  1IN4 A;  3H3U A;  4A0Z A;  1CF7 B;  3T8R A;  3COA C;  2PBI A;  1KQ9 A;  4CO8 A;  1XCB A;  1V4R A;  1WSU A;  1ZRD A;  5KVR A;  2EA4 A;  5D4R A;  3E5U A;  2WV0 A;  2CYY A;  3PQK A;  5HOO A;  3K1N A;  5LRS A;  1BI0 A;  5HS7 A;  1MJA A;  4WXD A;  1TBX A;  4LJZ F;  3FXQ A;  1RUN A;  4L0Y B;  2ELH A;  5JVT A;  5LGU A;  3CUQ C;  2GXB A;  1G3S A;  4KN4 X;  3GWZ A;  2ACJ A;  1TW3 A;  4L9V A;  4LLN A;  3BDD A;  2NNN A;  3WE3 A;  1OR7 A;  3DFG A;  2XIG A;  4O6J A;  2OA4 A;  4L9N A;  1XDU A;  2RGV A;  3WGI A;  3EYY A;  1ZRF A;  1TQI A;  2XV4 S;  3LAJ A;  3I0T A;  4BYY A;  2ZBK A;  1J59 A;  5JI6 A;  2KIF A;  3BPV A;  1U2W A;  3ECO A;  5JR3 A;  4P9F A;  1FSH A;  1J5Y A;  1KQ8 A;  5HLG A;  4WF2 A;  2MD5 A;  1I6X A;  4I98 B;  4ZH4 F;  2MH2 A;  3I54 A;  1HW1 A;  3IKV A;  3ZMU A;  1K78 A;  5DUK A;  1JXS A;  2GQQ A;  2RV8 A;  2W25 A;  1QZZ A;  1SD5 A;  2UZK A;  1FT9 A;  2XAJ A;  4KN7 X;  4KMU X;  1W5T A;  5LLQ A;  1DPR A;  2HWV A;  3ECH A;  3QOP A;  2XHK A;  4HQE A;  1R7J A;  2HFH A;  5JFR A;  2EB7 A;  5TJJ A;  1IZ1 A;  3IKT A;  3ZMS A;  4GO1 A;  1IN8 A;  3ZP5 A;  2HYF A;  4PGG A;  2IJL A;  4MGR A;  4MTE A;  3FMS A;  3D0S A;  3F21 A;  3HHH A;  4IRG A;  2UXN A;  2X0L A;  3CO7 C;  3JSO A;  1IXC A;  2DFI A;  3GEZ A;  2QZ8 A;  1STZ A;  2YU3 A;  5DUI A;  1T38 A;  2RN7 A;  1J0R A;  2ZNZ A;  2P4W A;  2W85 A;  2H09 A;  1QO0 D;  5AIQ A;  1TNT A;  1QBJ A;  4A0X A;  2Y0M A;  4G7Z F;  3EYI A;  4O3M A;  2VOD A;  1U78 A;  1J7K A;  1O3T A;  4HV6 A;  2V1U A;  2VC1 A;  1ZAR A;  4K2E A;  2VE8 A;  4HZF A;  2EV0 A;  4YII A;  4G6D A;  3F8B A;  4LGW A;  3BY6 A;  1LQ1 A;  1U6G A;  3P9K A;  1FX7 A;  1D8K A;  1KU7 A;  2R3S A;  1XGS A;  2YX7 A;  3M8F A;  4IHS A;  3RTR A;  4UNO A;  2P5L C;  2UXX A;  2GAU A;  5DD8 A;  2L4A A;  3ZPL A;  1XGN A;  1L3L A;  4WXH A;  2FBK A;  1KU3 A;  3GLX A;  3GZ5 A;  4ENJ A;  3G73 A;  2DT5 A;  5J8F A;  3CJN A;  1OKR A;  5IT9 K;  4ZZL A;  1YS7 A;  1RIO H;  1FY7 A;  2MH9 A;  4UUV A;  3DP7 A;  2PEX A;  3RDI A;  1W7P A;  1R58 A;  4L0Z B;  4O5V A;  2ZME B;  4LD5 A;  2XVC A;  3LFK A;  1ZAO A;  2RKH A;  5ILV A;  1ZLK A;  5ICE A;  2OD5 A;  4XSZ F;  5L3E A;  2VXZ A;  3NRV A;  1TTY A;  2WC2 A;  4XLN F;  3TDU C;  2VBX A;  4A2U A;  1LJ9 A;  1BC8 C;  4G8X A;  3SFZ A;  3ISP A;  2DI3 A;  2H94 A;  5LRR A;  5D5V B;  3HTU A;  3I58 A;  1O3S A;  4A0Y A;  3CUO A;  4NB5 A;  1S6L A;  4HOB A;  1ZRE A;  5IT9 Z;  3QRF F;  3RIR A;  2FE3 A;  1YIO A;  5AON A;  3JTH A;  1T6S A;  2QEN A;  5HVQ C;  3DQV C;  3DF8 A;  3RKW A;  1R1U A;  2FBI A;  4M9Z A;  1YTY A;  3M1E A;  5EEG A;  3IWF A;  3CTA A;  2GXG A;  1SAX A;  1Y0U A;  1GXQ A;  1GVJ A;  1KYW A;  2QQ9 A;  3ABT A;  3I53 A;  1YW8 A;  2FBH A;  2BGC A;  4Q48 A;  1U5T A;  1FBQ A;  1H9G A;  3EQL F;  4CDG A;  3WOD F;  2ADU A;  5D4S A;  5HDN A;  4KIF A;  3KFW X;  2ZJ2 A;  4G7H F;  4EJV A;  1FBS A;  4LMY A;  2X4H A;  3FF5 A;  3FHZ A;  4WX9 A;  1E17 A;  1TQM A;  1P92 A;  1W4M A;  3M9A A;  1J75 A;  3ZMT A;  1SFX A;  3F6O A;  1D5V A;  4KUM A;  3Q5F A;  1RNL A;  3QPT A;  2Z33 A;  4CGZ A;  2EWN A;  2EJR A;  3NEU A;  2IA0 A;  1UCR A;  3I71 A;  4P5O A;  4ZYH A;  1KA8 A;  2EFW A;  3OOP A;  2Y75 A;  1YG2 A;  1GXP A;  4CYD A;  5K5O A;  2DQR A;  4EGZ A;  5FLX K;  1P4W A;  4UHT A;  4A6E A;  3I59 A;  3V8L A;  3V7R A;  3ZN0 A;  1JGS A;  4KFC A;  5D5X B;  2XUB A;  1DUX C;  3WTY C;  4FHT A;  1WQ2 A;  2VBZ A;  2VON A;  4S04 A;  4XLP F;  1RI7 A;  4IRH A;  2O03 A;  1F5T A;  3KP7 A;  2VOO A;  1FSE A;  4RB2 C;  2QUF A;  1ZGJ A;  2CSO A;  2HGC A;  2MBF A;  4G94 A;  4YFX F;  2G7U A;  1KQ0 A;  1XB4 A;  4WK8 F;  5CJ9 A;  1PUE E;  3ZN1 A;  4ESB A;  2FMY A;  3L2C A;  1O57 A;  2EFO A;  1XGO A;  2YX4 A;  1K6O A;  3F8F A;  2DAO A;  1ZG1 A;  3HSF A;  3K2Z A;  1RUO A;  3R60 A;  3WTT C;  2LF8 A;  2HZT A;  1IXR C;  1OMI A;  3CUQ B;  4CHU A;  4IJA A;  5FLX Z;  2NNY A;  2L02 A;  2OQG A;  5BS6 A;  3SZT A;  1JHH A;  5BOX A;  3P9C A;  3AAF A;  4MEX F;  4HYE A;  4N9H A;  2EA2 A;  4RGU A;  3VOD A;  4HDU A;  2STT A;  3HRT A;  2Q2E A;  1XDS A;  1T0F A;  2Q8K A;  2GA1 A;  3EDP A;  4LLL A;  2W84 A;  4IF4 A;  2F5F A;  2PMH A;  5HDG A;  2DQL A;  1QGP A;  3LA3 A;  2HKX A;  2V1D A;  3KP6 A;  1Z7U A;  1YQA A;  1ON1 A;  2CW0 F;  2P7V B;  3HOS A;  4G7O F;  5ILU A;  2O0Y A;  3T0Y A;  4PDK A;  5DCF A;  3CLO A;  4I01 A;  4FX0 A;  4LLG F;  2DTR A;  5ICF A;  3FZV A;  1F9N A;  3ULQ B;  4U7D A;  2MLK A;  3LAP A;  1LB2 A;  1MD0 A;  5BPD A;  4YIF A;  2LDU A;  3DEU A;  2EFN A;  1YO5 C;  2IPQ X;  2G9W A;  1LEB A;  2QBY B;  1SMT A;  4R79 A;  4MQV A;  4HW0 A;  5E1Z B;  3KZZ A;  4LG0 A;  1XCV A;  3MQ0 A;  1PP8 F;  2P6T A;  1FC3 A;  3O6B B;  3ZMD A;  1C0W A;  1O7L A;  1HBX G;  3WGG A;  1F4K A;  4OIO F;  3LST A;  2A6E F;  2EFP A;  3I4P A;  2XGX A;  3BPX A;  3RYR A;  2KKO A;  5E8I A;  4LB5 A;  2P5K A;  3M8E A;  2JT1 A;  4GYG A;  4HBL A;  1IUY A;  4JK1 X;  3LWF A;  3GW2 A;  3GFM A;  1FYM A;  3WTX C;  4RAY A;  3HUG A;  2RNJ A;  3V8J A;  5LGT A;  4GGG A;  1LDD A;  4I0A A;  2WTE A;  4UVC A;  4PGH A;  1Z1D A;  5FB2 A;  1MDM A;  4I2O A;  5HLI A;  3M7G A;  3E6M A;  1HKT A;  4BHB A;  1EV7 A;  2L3D A;  2A5Y B;  3F23 A;  3R6S A;  4OMZ A;  3HSE A;  4CZZ A;  1B6A A;  5CLS A;  4HX8 A;  2M87 A;  4KIC A;  1Z6T A;  4B09 A;  3C7J A;  5CVI A;  5FO5 A;  2XAH A;  3CDH A;  4A5M A;  3KZY A;  1G3W A;  3K1M A;  2KRF A;  4EMS A;  4MEY F;  1EH6 A;  1MKM A;  3BRO A;  2OBP A;  4U0Y A;  2CGP A;  2V79 A;  1S3J A;  1MJB A;  3W6J B;  2DO7 A;  2KJB A;  1MJ9 A;  2BEO A;  3ZMV A;  5ICG A;  3TO6 A;  3E5X A;  1FZP B;  2ISZ A;  3F72 A;  3F8C A;  3HTS B;  4G6Q A;  1AOY A;  3GFJ A;  3V8K A;  1HKS A;  1IW7 F;  1ULY A;  3E5Q A;  1SFE A;  4M6X A;  3TO9 A;  2Q0O A;  3MAJ A;  6PAX A;  1W7P D;  1P6R A;  1FYK A;  3DKW A;  5LHH A;  4EM0 B;  2E7W A;  2K02 A;  3WTW C;  4IXA A;  3W6K B;  4JQF A;  3U2R A;  5LGN A;  4BH9 A;  1BC7 C;  5L3B A;  1BI2 A;  2TDX A;  4A5N A;  2W57 A;  4ASN A;  4U7B A;  2FML A;  1YS6 A;  1JE8 A;  5BQT A;  4RGX A;  4EV0 A;  5E8G A;  3KEQ A;  2BBY A;  1T39 A;  3EET A;  2ZXJ A;  4XRF A;  4GXO A;  1LNW A;  2HS5 A;  3KLO A;  4FT8 A;  4ZYG A;  5D8L B;  1XSD A;  5E17 F;  3GYH X;  2VE9 A;  3GZ6 A;  1G4D A;  4EJT A;  1BI3 A;  3Q9V A;  2PN6 A;  5IT3 A;  3BJ6 A;  4RS8 A;  5A2Q K;  1Z6R A;  4KT5 C;  1O3R A;  2FF4 A;  2STW A;  1B9M A;  3GXO A;  1K78 B;  4XBF A;  1I1G A;  1P4X A;  5D6E A;  1BN5 A;  4AIH A;  3O3K A;  2COM A;  2W24 A;  2YPR A;  3IRR A;  1CGP A;  3WU0 A;  5ED4 A;  1P4A A;  3F3X A;  1ODD A;  1G3T A;  4S05 A;  3OV8 A;  2K7L A;  1HW2 A;  1ONV A;  5LHG A;  1KGS A;  5DCM A;  3T5X A;  5ILS A;  2EV5 A;  2Z99 A;  4Q4Z F;  4ON0 A;  3GO5 A;  4MNU A;  4EVI A;  2ZKZ A;  3HOT A;  4RGS A;  2NRA C;  2ZCW A;  4YG2 F;  5K5R A;  1L0O C;  5A2Q Z;  1Z91 A;  4NQW A;  2QQB A;  1T2K A;  5E20 A;  2D2W A;  5BPI A;  3I64 A;  1P2F A;  4RAZ A;  2O61 A;  1G6N A;  3HRU A;  3K69 A;  1TQP A;  2QQA A;  2HDC A;  5DD4 A;  4LK1 F;  4EJW A;  2VT2 A;  2P8T A;  2ESH A;  3VEP A;  1SD7 A;  3MFK A;  3BJO A;  1QNT A;  4PCQ A;  2A07 F;  1BIB A;  5HS9 A;  2M1B A;  2M30 A;  1S8N A;  1UHM A;  4HF1 A;  3EUH A;  4B8X A;  2PLY A;  2K4B A;  2YR2 A;  4EM1 A;  2CWE A;  4BNC A;  1B1B A;  2FNP A;  2LSO A;  4P55 A;  3K0L A;  3R4K A;  3TKY A;  4BHC A;  4AIJ A;  4DNC A;  2LF7 A;  1SD6 A;  1DPU A;  1TNS A;  1NHA A;  3FMR A;  4N9I A;  5LHI A;  2FXA A;  3HRM A;  3B73 A;  2E7X A;  4L5J A;  1E2X A;  3BJA A;  2DLL A;  4GYI A;  3RKX A;  4EJU A;  3WTU C;  1LDK B;  3RPU A;  4R1H A;  1CF7 A;  2DK8 A;  2M45 A;  2P5V A;  4G9Y A;  1BM9 A;  3F6V A;  1KU9 A;  3F8N A;  1UFM A;  1W7P B;  4ETS A;  3BZ6 A;  2P6S A;  4OOI A;  3RPQ A;  2L4M A;  5H20 A;  4OIN F;  2IT0 A;  1QQI A;  1FP2 A;  4OIQ F;  2PMU A;  1K7A A;  5H6R A;  4RB3 C;  2F5E A;  4YFN F;  4ENN A;  4IVN A;  1PDN C;  3T8T A;  5BMZ A;  3FWE A;  5H6Q A;  4HAM A;  3JSP A;  3VFZ A;  3DPL C;  1WWX A;  4BAY A;  4HX7 A;  3L9F A;  2XAF A;  5D6F A;  2NS0 A;  2V6C A;  4M73 A;  4MTD A;  4KYW A;  2DK5 A;  1OPC A;  1SMY F;  1PP7 U;  3SHF A;  4QLC U;  2AS5 F;  1KYZ A;  2FQ3 A;  3MEX A;  4KIB A;  1Q1H A;  3QAH A;  3VB2 A;  1ZRC A;  1FNN A;  3RJP A;  2YSR A;  5CVJ A;  2QWW A;  3FMQ A;  4IHT A;  2WWY A;  3FXU A;  3BWG A;  1YYV A;  5D5U B;  4I09 A;  4CIC A;  3IWZ A;  3HSR A;  2HOE A;  2J5O A;  4Y17 A;  4YFK F;  1K79 A;  3QP5 A;  5CYV A;  3U1D A;  2PI0 A;  4F7Z A;  1UHW A;  1J9I A;  1U5T B;  3RI4 A;  2H6C A;  1YFH A;  3L00 A;  1VTN C;  4UVA A;  2J5P A;  3TDZ C;  3IHU A;  2BV6 A;  1XN7 A;  4ZYD A;  3P9I A;  2CO5 A;  4OMY A;  5AIP A;  1KU2 A;  2GA2 A;  2IA1 A;  4BHP A;  2K4J A;  1IN6 A;  1ZYR F;  4MQ9 F;  3V7S A;  3J7A O;  4P9U A;  1HSJ A;  3S2W A;  4KDP A;  2JZY A;  5K5Q A;  4HLY A;  1BJA A;  3NQO A;  4UVB A;  3KP4 A;  5CVU A;  3L7W A;  1LEA A;  2VBY A;  1FLI A;  1B59 A;  5DEQ A;  3JAM K;  4P96 A;  5F1R A;  2A3S A;  5E1X A;  2M5W A;  1FWZ A;  2Z5U A;  1FBU A;  2EK5 A;  5DV5 A;  4EM2 A;  3D5L A;  1WRJ A;  4QWQ A;  5CVR A;  3KCC A;  1DP7 P;  3I5U A;  5L3C A;  4A12 A;  2FSW A;  4HX4 A;  1UB9 A;  2RDP A;  1V3F A;  3I59 B;  5KK1 A;  1SFU A;  2RVC A;  4LB6 B;  4Y13 A;  1ZG5 A;  2VT3 A;  4BQA A;  1MGT A;  3E6B A;  1R1T A;  3HYI A;  3JW4 A;  4A6D A;  3K1P A;  4M74 A;  2DBB A;  1OYI A;  2JSC A;  1USS A;  4RGR A;  4OIP F;  2QYO A;  1R22 A;  2XAS A;  2NYX A;  2XAG A;  1BIA A;  1HST A;  2FA5 A;  2GIV A;  3JAM Z;  4ENM A;  3MZH A;  1D3Y A;  1BOA A;  1U5T C;  2R7F A;  4AVP A;  2OU2 A;  3QU3 A;  3KLN A;  5FD6 A;  2G7H A;  1XMK A;  2Y48 A;  2BE5 F;  3G3Z A;  1MZB A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...