1PVEA

Solution structure of xpc binding domain of hhr23b
Total Genus 22
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
22
sequence length
72
structure length
72
Chain Sequence
GSHMPLEFLRNQPQFQQMRQIIQQNPSLLPALLQQIGRENPQLLQQISQHQEHFIQMLNEPVQEAGGQGGGG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords UV excision repair protein RAD23 homolog B
publication title Solution structure and backbone dynamics of the XPC-binding domain of the human DNA repair protein hHR23B.
pubmed doi rcsb
source organism Homo sapiens
total genus 22
structure length 72
sequence length 72
ec nomenclature
pdb deposition date 2003-06-27

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF09280 XPC-binding XPC-binding domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.540 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A XPC-binding domain 1pveA00
1X3ZB 1OQYA 1QZEA 4YIRX 3ESWB 2QSHX 2F4OB 1X3WB 2QSGX 2QSFX 2F4MB 1PVEA 1TP4A
chains in the Genus database with same CATH superfamily
3CCYA 4U0WA 1ZK8A 2ELJA 1PYVA 4HG2A 4DQ2A 2ZMEA 3G71I 1OPCA 1K79A 1SD7A 1HKQA 1O7FA 3S2HJ 1I3QJ 1LDJA 4UUSA 2Q8KA 1TWCJ 3IH4A 2JA8J 4XONA 4C30A 1GXPA 1S7AA 4EJUA 2DTRA 3U2RA 1NK2P 5JFRA 4EM2A 4HAMA 2GA1A 3GTKJ 2IXSA 1F1ZA 1REPC 2DQRA 3HDDA 1GDTA 2RQQA 4UNOA 5E8GA 2EFOA 2EIJH 3OL3A 4N9HA 4A12A 3T8RA 2B63J 1X1BA 3OY9A 1N25A 2V6EA 1C0WA 4DZPA 2A69F 1T98A 4KFCA 4XQFA 4U7BA 1SFEA 3PFYA 3HRTA 3TOBA 2I5UA 5DM6F 5L3FA 3CCLI 5ICEA 3RKWA 1R7JA 3L09A 1B59A 2M4KA 3KCCA 3HKZA 2CFOA 4AYBN 2DTZA 3S2DJ 3GWZA 2OJED 5LLQA 1DGWY 2VN2A 2M8GX 1XCBA 2KPMA 2LREA 3B02A 3WE3A 2RREA 2UWMA 2ZJPF 2W4SA 3KYLA 3HSRA 3R0JA 2CFXA 1TWAJ 5JLWA 1FZPB 1OFCX 2LP0A 1MKMA 4JBAA 1AKHA 4M3EA 2HTSA 1DP7P 5BNGA 2DJIA 2UV1A 2O8XA 1D8JA 2L9SA 3I4MJ 4BE2A 4JX6A 2X1CA 4OMZA 2GBYA 3OYNA 4XKWA 3F9KA 2PN6A 2RGVA 3K1NA 1RNLA 1ETWA 3CCEI 3HEFA 4UV9A 4WXCA 2VOOA 3D5LA 3AG2H 4RA2A 3K69A 2BY0A 3FK7A 4EEFG 3J7YJ 2L0KA 3K4MA 3QYBA 1GUUA 1WHUA 1MDMA 3GTOJ 2OQRA 1HLVA 3EDPA 4ASNA 4A3IJ 1P4XA 4C2MJ 3QPSA 1SFXA 2VC1A 2R5YA 1FMVA 2VC0A 3L1PA 3CCUI 1K61A 3W6KB 4HNVA 1STZA 2KZVA 1YIOA 2W57A 3T8TA 2JVGA 2IGNA 2XASA 1HSJA 2E2HJ 2M45A 2Z33A 4CYCB 4ZYEA 4G7OF 4M6VA 1YITI 1SVOA 5J3LA 2ZJRF 3PSIA 2JUGA 1SVMA 4Q4ZF 4Y4RA 5A2QZ 4FCYA 3S3MA 2B9SA 4BQQA 2MSYA 3JRBA 2DA7A 2EWNA 2DK5A 2IP2A 3LSMA 2JVHA 3G3ZA 1U2WA 2FRHA 5B5EC 2LY2A 2GZWA 4HF1A 1HKTA 2E1CA 2M0CA 4XLCA 2ESHA 3GW2A 2RNJA 5DD8A 2ZSHB 3HIFA 3P9KA 2N8GA 4MNUA 1QVTA 3DP7A 3RKQA 2WB1N 2X51A 1VQ5I 2LYCA 1GXQA 2BHZA 3SHFA 3V8LA 3G1OA 4LLLA 3ROUA 2O6GE 4NHJA 2QKMB 1TZLA 2DN0A 1Z3YA 2BY3A 2EH3A 1APLC 3DKXA 2F4IA 1YS6A 1IZ1A 4QWQA 1JHHA 1W7PD 2DFIA 3EUKL 1HA8A 1IN4A 2HOEA 4MEXF 2KL4A 1E17A 1OYYA 3FMRA 3CCRI 2K7LA 2DFFA 2E2JJ 4AC0A 5GPCA 2O61A 2F5DA 2RV8A 1YW8A 4ZZLA 2E1OA 3S93A 4RMNA 1X1CA 1YYVA 1WWXA 1RR8C 5GPAA 5KHDA 1ETXA 4OIQF 2GLOA 3JAMZ 1ZLJA 3MCZA 2JUCA 4XRSA 3KZIC 2WY8Q 1VTNC 3DPLC 1ETYA 1G3WA 5K5RA 5FROA 1RPWA 2LDUA 1FSHA 3MD2A 1W5SA 3TOAA 4XKCA 2DODA 2KZGA 3ABUA 3CTAA 2OA4A 1GLNA 3KEOA 5FD5A 1IN8A 2KLOA 2QQ9A 4BJTA 4IRHA 3QYEA 5H2FC 2STWA 3S14J 4BYYA 3OIPA 4E7SA 1MMAA 3H3VK 2P4WA 1ZGWA 4BXFA 3SXYA 1U5TC 4GO1A 4ENKA 4PSXA 3ZRGA 4OWRB 5DTDA 1POGA 1Y1VJ 2IAIA 1K6OA 2JK3A 4CGZA 1DU6A 3OYDA 4WXDA 3GXOA 5LBQA 1WJBA 2BXZA 3OYMA 3CJTB 5J1YA 3ERMA 2VXZA 3HUGA 3M1CA 4XOPA 2NOJB 4C2TA 1R49A 3LL7A 2R92J 1Z05A 2HS5A 4OOIA 3HC7A 3LAPA 1J7KA 4GRIA 3SDGA 4A0YA 1T08B 3B6CA 4EJWA 4AIJA 4BDZA 2X0LA 4MFEA 1YX5A 3DPTA 3GZ5A 4IRIA 1UHWA 3F23A 4MHGA 1ZKGA 3IP4B 1WCMJ 4DOZA 3IWZA 2O8KA 3BJAA 5EG0A 5E79C 2HOSA 3EPZA 3FHZA 1HDPA 2TRTA 2XF7A 3F3XA 1FT9A 2XAGA 4Z2YA 5HDGA 3CDLA 5JVTA 2ELHA 1TNTA 2PX9A 1G8XA 2L7FP 2Q1ZB 4RGSA 1ENHA 3L2QA 4C3HJ 1JTXA 1F5TA 5K7HA 4U87A 1J59A 5FKLA 2PJRB 1MBEA 2GM4A 2HFHA 4IX7A 4UUSB 3V7SA 3JRHA 2CV0A 2HQNA 2NNYA 5HOOA 3GBGA 1G59A 5E1ZB 2QQBA 4A0XA 1MBHA 3WTYC 2ZMEC 3J80K 4ON0A 2VKEA 2EIKH 2W24A 2XKPA 3G2BA 3ZQLA 2VJ4A 1T38A 1UFMA 3CUQA 3ZPLA 3V7RA 1LFPA 1O3RA 3L9FA 1D3YA 1VQOI 4XN0A 3ZQIA 2KJCA 3W3CA 3K0LA 2J5OA 1MJBA 3G6EI 1UHMA 3HHHA 2JT1A 2HYJA 3ECHA 3DBRB 3VSLA 3I5UA 2VUMJ 2DA1A 1MNEA 3ZMDA 3JRDA 3CUOA 2MG4A 4X6AJ 2DPDA 1R1VA 1FTZA 1F36A 1VQ4I 1FBQA 5D4SA 3W2AA 5D6EA 3FBNB 1OCZH 3FXKA 5L3CA 3HOUJ 5EZGA 4NC7A 1MH4A 2NAZA 3JRIA 4M3GA 2XIGA 4NBQA 2QSFX 3CZ6A 1MH3A 4EATA 4BDYA 4M9ZA 3VDXA 2AS5F 2LKPA 4A3GJ 1JUMA 3MQ0A 2H1KA 1WJAA 3BR5A 2LKSA 2ETHA 5D8LB 4I76A 3G4SI 1D0XA 4G12A 3KP4A 3AG1H 4HBLA 2OAZA 2PBIA 4CXFA 2Z16A 3E7LA 4D5CA 2Y0SA 4NQWB 1NHAA 4B44A 5DD4A 5FRMA 2ISZA 4I0AA 3RZOJ 2LY1A 2MW8A 2FUG2 1XMAA 3AKZA 2ICWG 2HVRA 2R7SA 1QZEA 1XB4A 5LRRA 2XPUA 5DCMB 2K9QA 2EK5A 4A3JJ 2R7XA 1LDKB 2L5QA 3VYRB 1P6RA 1Q1VA 3Q3SA 2QQ8A 2K27A 1JKPC 4LG0A 2O3FA 1MJ9A 3HYIA 3I58A 2OZUA 3TW6A 2OTJI 2AQEA 2G7HA 1IN6A 4UUVA 2KIFA 5EGOA 5EZHA 3F6VA 1SFOJ 4D0PA 1MDMB 1QU3A 1LFUP 2RVCA 2ID6A 5J6XA 2ZJQF 1D1BA 2R5YB 1SD6A 5H20A 4N4NB 4RDUA 1VQ8I 3Q9SA 5CVJA 2LBFB 3K4KA 3A0BC 3V8KA 5K1YA 4YFNF 2VL8A 3T5XA 4KT6A 4L0ZB 4ZYGA 1O3SA 3KEYA 1BIBA 1L3LA 1KU2A 2DOEA 1YW9A 4B3AA 2O03A 2X1DA 1EF4A 2YU3A 2K40A 2E2IJ 3NARA 3TO9A 4MO7A 2MFZA 2R7TA 2QLZA 1UELB 2PMHA 1S6LA 5F64A 1ORKA 5AIQA 1FSEA 2VJIA 1XGMA 4F3QA 3ZXSA 2F5FA 2ADUA 3DEUA 2VB6A 2WTEA 3L2UA 1MMSA 3OSGA 3TEDA 2QKLB 3CMMA 1SAUA 2WY7Q 2JQ7A 3C18A 3DTKA 4CZZA 2R5ZB 3GFIA 2XAQA 2LNBA 1VQ9I 4RB3C 3K1MA 3TKYA 1MNDA 2A6HF 5C4XJ 3H5AA 5EJCA 1Z7LA 4RLQA 2V1UA 3JRFA 4BXXJ 2P81A 2G9WA 1QA6A 3C2HA 2Z9OA 3NEUA 1SMTA 5HNHA 3IKTA 1JGSA 4M9XA 4KJZA 2XDVA 3TGNA 1YRNB 1JKOC 3HHGA 3LSTA 1YO5C 4IOCF 2YPRA 2K3PA 4A3DJ 1ZG5A 3HOZJ 4XN3A 4WX9A 3J81K 1T33A 4L0YB 3OYLA 1SD4A 3ML6A 1IN5A 1RZ4A 3GX4X 3RSNA 4KT5C 1YTYA 2D5VA 5FLVA 5H6RA 1R4MB 5D6FA 2BY1A 4HX7A 3SFIA 3OIQA 2FF4A 2BW3A 1HW5A 4UV8A 3K4NA 4BHPA 2R7RA 2HDWA 4IO9F 2Y9YA 1UG0A 3PUBA 3V8JA 1T6SA 3D5SC 4YIRX 4O6JA 1MSFC 4II2A 2WV1A 2VKDA 2V4JC 4C3JJ 2DMQA 4ZYHA 1P9QC 4HZFA 2ZSIB 1W36C 1CQTA 2NVXJ 4N4OB 3K6GA 2IT0A 2DMUA 4L5IA 2VQHA 3ZN1A 3ZCOA 3L2CA 5HS8A 2DLLA 1UB9A 2L4AA 5JR3A 1MBGA 1P92A 5IY5H 3ABTA 2L7MP 2L9VA 4OAZA 1E3HA 3LSKA 1TWFJ 2XAHA 4LIUA 2HWVA 1QBJA 3A03A 2E71A 4EJTA 3DEWA 5HDKA 5E3OA 2VASA 5IP9J 5TRDA 3R4KA 2KDZA 4DBQA 3HM5A 2IGMA 4UVAA 3TO7A 2XGEA 2P5VA 4XM3A 4ZTFA 1FYLA 1P2FA 2CWEA 4AWXB 3AL0B 2RAEA 2OD5A 4WF2A 3RQ4A 1ZGAA 2AXLA 5KAFC 1RESA 2ZKZA 3I4PA 3H0GJ 4BY7J 3BY6A 3DF8A 3V7CA 1IUYA 1TW2A 3PQJA 5J1UA 1JI8A 1HKSA 1RETA 3HOVJ 2LLKA 1LEBA 1XCVA 1Y8QB 4P96A 5DM7F 3H9QA 1IGNA 1JJ6C 1ZG3A 2NS0A 5E20A 2DDAA 4LD5A 2X48A 2VE9A 3M8EA 2AO9A 2EFPA 1U5TA 4PGHA 2CG4A 2EA4A 4EV0A 3BPXA 3P9CA 4DIQA 5HS9A 1I1SA 4CHUA 1JKRC 1O3QA 1YQAA 4BAYA 3DWLE 5CYVA 2EB7A 3H3UA 1U3EM 2I8DA 3M8JA 5TISC 1KQ8A 3BWGA 2F6CA 2PLYA 2VPLA 1YE9A 1TT5B 3CUQC 3Q5FA 4ZDLA 2MYSA 4FX0A 2CMPA 1OQYA 3TMOA 1SMYF 3FXUA 3OL4A 5F1JA 2LRDA 3S17J 3LSPA 1RRJA 1SD5A 2IPQX 4UHTA 1JE8A 5FFXA 3H0DA 5IOYA 2VQCA 3FXLA 4IVNA 4QPOA 2LY9A 3LA3A 4F92B 1U9NA 4NC8A 1ZH5A 3CJRB 3CQZJ 1CGPA 1OCPA 4DZJA 1VQMI 3CCJI 1TL8A 2XPVA 2HVSA 4JOMA 1KU9A 3CO7C 4GYIA 5KNLA 3OYKA 1PUFA 1Z6TA 2HOAA 1Z77A 2W84A 4QTRA 2ZC2A 1XMXA 3FX3A 1FJLA 1GT0C 1YLFA 2HGCA 2VODA 1SANA 5J4YA 2OCEA 3FXRA 4L5EA 1S9HA 4EM1A 1GV5A 2LK2A 2VT3A 2QBYB 5FKNA 5FRNA 3M9AA 2FBKA 2L9NA 2DCEA 3U21A 1WI3A 3JRGA 2IA1A 5FKKA 4D7NA 3WG9A 2E5NA 2X6YA 1KGSA 1PJRA 3A1YA 5J8FA 3DBHB 4RGXA 2K4JA 3WE2A 3F8NA 2OU2A 1VQPI 1H9GA 3GZ6A 2Y75A 2BBYA 3CP2A 2JA5J 2JJ7A 1B8IA 4IOAF 1P7JA 2KMUA 1MGTA 4A6DA 5LHIA 3A02A 2Y2ZA 3VYUB 1MBFA 3GLXA 4IQJA 4IZZA 3PJRA 5D4RA 3FBIB 1TWHJ 3QQAA 1DQUA 3KP7A 5LFAA 4ENJA 4MLOA 3KPHA 3M07A 4DBRA 3C7JA 4L18B 4L5JA 1QHGA 3WGIA 3HXLA 5DDGA 1V4RA 2JSCA 1R5ID 1ZREA 4CICA 3BP8A 3HSFA 1JT6A 2W00A 3KLNA 3QODA 3WTTC 1V55H 2P7VB 2FMYA 3HSEA 5KK1A 3I59B 2DU9A 2Y30A 3CO6C 3KP2A 1B9NA 3T0YA 4A6EA 3G73A 4YG2F 2WAQA 2DPUA 3LSHA 3SDBA 1TP4A 3PQKA 2EFWA 4F93B 4PGGA 5CVVA 4LOCA 3S1QJ 3QP6A 2EFQA 2BHYA 1GVJA 2FE3A 5GADJ 3CF5F 4XMYA 2E60A 4BEHA 1R4NB 3K70D 2QENA 3NWTA 3ONQA 4HOBA 2M0MA 1MMGA 2K85A 4BHBA 3OR1C 2FBHA 2DA3A 3FKIJ 3BT9A 4PJNA 3I55I 3QPHA 5FGMA 3A01A 1U8RA 2FA5A 1S29A 1CF7B 2COMA 1YHQI 3HRMA 1B4AA 4NDLA 2V9KA 5HDNA 3KEQA 5L3EA 5E8IA 4AD9A 2Z2SB 1TBXA 1WFXA 1MMNA 3DEEA 3F6OA 2XGXA 5IPAA 1Q1HA 5F04A 4DJAA 4G7HF 4QSHA 4B4CA 4HLYA 1A6QA 1Z7UA 4FE7A 2QYOA 3K4JA 2L4MA 2ZBKA 2GA2A 5DV5A 2DJNA 1K78A 2FOWA 3K70C 1E3PA 2WWYA 4IRGA 4MTDA 3PL8A 5GAHJ 3OMYA 1YIJI 2E7WA 3LMMA 1ZRCA 3UNGC 2A07F 5FLMJ 1S5LC 3FMSA 1ETOA 2ECBA 5E17F 4RB1A 3KLOA 3J81Z 4ZTJA 5F0CA 4NUBA 5L3BA 3E0JB 3S3OA 3JREA 5DUIA 4HA8A 1D5YA 4KN7X 2G7UA 1FX7A 4JX5A 3PO2J 3Q0UA 1R23A 2KRCA 3W6VA 1W5TA 3GFMA 2TDXA 5F1RA 3D1NI 5CQEA 3W2WA 2PMZN 4G94A 2DQLA 5AONA 3OYGA 4JP0A 4L9VA 1SFUA 2JSPA 2MGQA 5M3MJ 4QLCU 2BY2A 1I5ZA 1V3FA 2TCTA 3E5UA 3ZP5A 1IF1A 4RAFA 2CUZA 3X2QH 4BBSJ 1WI9A 4O5VA 5LGNA 4S0HB 3M7GA 4I09A 2CUFA 5F27A 1SAXA 1YX3A 2VXDA 3TL4X 4BXUA 3K2ZA 3MKLA 1X58A 3O2PE 3HB9A 4A5NA 1QZZA 3JSPA 3AAFA 1GHCA 1B1BA 1QGPA 1Z1DA 1M1EB 5GTHC 4A3FJ 2KRHA 3JR9A 4PFOA 5C4JJ 4A3MJ 4FE4A 3F0CA 4U0VA 2CGPA 1ON2A 3IUOA 3WTVC 1USSA 2VQLA 5D8KB 3HOTA 2M5WA 3N97A 5GTIC 1X3WB 1J9IA 2CSOA 2Y31A 2FJ1A 3CP8A 1OJLA 1X1AA 1BBYA 4CZCA 5C3EJ 1EKEA 3HTUA 4B47A 1IAWA 1MMDA 2E1MC 3VODA 4CCKA 1FOXA 1IDZA 1WRJA 3FXJA 2V1XA 4M71A 2KQRA 4AIHA 2GIVA 3H9GA 1HDDC 2WAEA 3L2RA 3A2KA 1LE8B 1ZYRF 1W7PB 4U0YA 1U9OA 2RNGA 4HQEA 1O3TA 2X6WA 1XN7A 3KP3A 1I1GA 4E7ZA 2Y0MA 1L0OC 1NG6A 2ELKA 4DNCA 5D5VB 2HEOA 4E4HA 1B72A 1J2XA 4EMSA 1ETKA 2A61A 3SFZA 1LVKA 3NQOA 1G6NA 2IS2A 5CVRA 5TJJA 4WWCA 1X4OA 2DO7A 2VBWA 5FB2A 4XKVA 4A3BJ 1XC5A 3ZQ7A 3BG9A 1K4TA 2NRAC 3K1PA 3CCVI 4DYCA 5M3FJ 3ZQFA 5ICCA 1RKTA 1G2HA 5K5OA 2QWWA 2K9SA 2VIXA 2NNNA 4S04A 4BQOA 3BDDA 1TQMA 2RDPA 3S32A 1G3SA 1LEAA 2YUSA 3OS2A 3RKYA 3BQZA 3K2AA 1IDYA 2ZXJA 3EUHC 3MZHA 4KYWA 2FNAA 3ESWB 3E6MA 5IT3A 3KZYA 2VOPA 2FMLA 3AFHA 4W1UA 3S3NA 1YJ9I 4Y33A 4DYRA 3VWBA 1FPQA 4HF0A 5J47A 1XSXA 1ZR2A 4BBRJ 2WV0A 3C3WA 1SC7A 2LSOA 1OMIA 4RBOA 1D1CA 2M9HA 1ZGJA 1QPIA 4M72A 2IVMA 4ENNA 2OCCH 1FC3A 2EIMH 4LMYA 3CCSI 4UVCA 2PEXA 4GXOA 4KIFA 2Z5UA 3F8MA 2O0YA 3I56I 1PP8F 1HCRA 3BC8A 4XSZF 2HOTA 2ESNA 2V1DA 3V42A 2HYFA 1P4WA 1Z9CA 2ZMEB 1QHHD 2DA2A 2XF5A 3H36A 2CW0F 1XPXA 2CW8A 1E2XA 5EDNA 2DMTA 3SEZA 1F4KA 1B8IB 1D5VA 1UZCA 4I0BA 2BVLA 1WPKA 2JPBA 5ERIA 5JVGF 1T0FA 4D9JA 1EA3A 2NVYJ 3CMEI 1BR4A 3RI4A 3ERED 3W6JB 2VPRA 1IO2A 4RLFA 1W0TA 4KMFA 4LG3A 3DFGA 4CYDA 3QOPA 2P7CB 1R6RA 3IL2A 1LJ9A 2EV6A 4RM2A 4AYBA 4IJAA 2EV5A 4BU2A 1RUNA 1G3YA 3RCOA 2WC2A 3J7AO 3CDHA 3DU6A 3AG4H 5IYBJ 1QRYA 2HR3A 4MQ9F 1QPMA 1TWGJ 5IT9K 1TNSA 1FWZA 1MIJA 2NS8A 2UZKA 2MA3A 1D8KA 1BOBA 3I4NJ 2JN6A 4X0GA 1Y0UA 2CQKA 1NG7A 3PIPF 1EJ9A 4I6ZA 4DW6A 2F48A 1DPUA 1J0RA 1JUSA 3IH3A 3K7AJ 4YEJA 2Q2EA 3ZQHA 1HW1A 2XGDA 2ZNYA 4UUTA 3KP5A 1O57A 1LB2A 1O7LA 2JPCA 3OYJA 3DTIA 1AKHB 2VKHA 2K4BA 3E5QA 2M3AA 3RJPA 2Z1DA 2IA2A 5HLHA 2V26A 1FY7A 2K5CA 2XKOA 3I3LA 4AIDA 3WG7H 5B1AH 5JHFA 4HEA2 4HV6A 2W25A 5CVIA 9ANTA 4IQ4A 3GTQJ 2XV4S 2QEXI 2Y69H 2LF8A 2F4MB 2M87A 4BNCA 2H8WA 2MD0A 3LOCA 2A6TA 4EM0B 3MFKA 3BR3A 5ILVA 2ME0A 3ZQCA 1MZBA 2WB1A 2E35A 1TQPA 3WHBA 2P6TA 3E3VA 1UMQA 2QQAA 3EETA 4P55A 3HRUA 2NVQJ 3IKVA 4ETSA 1OLTA 2H8RA 2LH9A 1V5GA 4RAGA 3TDZC 4U88A 4ZDPA 3PIOF 5BPDA 1U0JA 1RR7A 3SZGA 4BE1A 1R58A 2ZFWA 1PDNC 3E5XA 5HLTA 1BC7C 1Z91A 1DPRA 1G4DA 1W5CC 3PO3J 3OYEA 1KZHA 3OYAA 1H9TA 4CCMA 3WTZA 5DYMA 1E3OC 1K7AA 3F8CA 2H1LA 1MSEC 4K2EA 2K86A 3E6DA 1UG2A 1IN7A 2QCOA 4E7HA 5EEGA 4YIFA 3RQIA 4F52A 2CV1A 3FHNA 3OV8A 3BPVA 2HQRA 4HSTA 1ON1A 4EGYA 3BG3A 3BR1A 4KISA 2XB0X 1BI3A 1X4PA 5D5XB 5FFZA 3Q0WA 2F5CA 3FIWA 1I39A 5K7ZA 5L3DA 4A3LJ 4BH9A 2BEOA 3LSJA 1FTTA 1D0ZA 1XS9A 2KP6A 2GWRA 3H1CA 3KFWX 4BUPA 3ABKH 3RPQA 4MGRA 1I50J 1WJFA 4W97A 4E7JA 4B43A 5EEAA 2Z3YA 3C1DA 4HX4A 2XGCA 3DBLB 2E36A 3BROA 2HVQA 4M9SA 2P5LC 2GXBA 2C6YA 2P5KA 2VBYA 1VQLI 1XD7A 2GXAA 1BA5A 4CA0A 3B73A 2FEZA 3GVAA 2A3SA 4S05A 2IW5A 4HF2A 2GAUA 4Y7NJ 3M4OJ 4PJ0C 3HKZN 2ZCWA 4ESJA 2YX7A 2ZXWH 4XIDA 5FD6A 1KONA 3J7AY 2KRFA 2G0EA 5ICFA 4H4KC 5A2QK 2YX4A 3DTEA 1R5GA 4RS8A 3BZCA 1ULYA 3JW4A 5E18F 4CYCA 1A31A 3MKWB 2ZJ2A 1IV8A 3HUGB 3NAUA 1XG1A 4OU0A 2JA6J 2XRLA 1KQ0A 1ZELA 4ANJA 3OOPA 4AIKA 2D2WA 1G3TA 1LKXA 3HL2A 3G1MA 4A69C 3QU3A 2DI3A 4CCJA 5M5WJ 4RB0A 2ZNZA 1FNNA 2M2EA 3TBIA 1AU7A 3RYPA 3HG9A 1IC8A 2F2EA 4J00A 1Y56A 4Z6YA 3S1MJ 3H9JA 4IPAA 5JLXA 1BJAA 2VKVA 5EG0B 3FXQA 1H89C 1LNWA 4FT8A 1E0EA 2A5YB 3WU1B 2DBBA 4CCLA 2O5RA 1X3ZB 3OWTA 4XRSG 1ZR4A 1H88C 1ZQ3P 3K4LA 2M34A 3CDIA 1VQNI 1KYWA 1XGOA 3ELKA 1FYMA 2IRFG 3JTGA 1FP1D 2RN7A 1TTYA 5F6FA 3TP0A 3LNQA 2DA5A 1T2KA 1DP3A 1FBSA 4U7DA 1K4SA 4NC6A 3K10A 1Y39A 3ECOA 4M3DA 4WXHA 3P9IA 1MJAA 5J4VA 3P7NA 4M6XA 1HSTA 2P6SA 1Z21A 4R79A 1XTAA 2BV6A 3IAS2 2PG4A 1JUPA 3JAMK 3LA7A 3CMYA 3PNVA 4F7ZA 5LGUA 5IYDJ 3HZJA 1X19A 4PK4A 3TDUC 2VQGA 2ZFUA 4E7KA 2CUEA 3B6AA 3CUQB 2PMUA 4QIWN 1T95A 2NVUB 1UAAA 2EQRA 1S7EA 3FWEA 3OS1A 2FSWA 1UCRA 4KICA 1T0FC 4HYEA 2A68F 2COBA 1JT0A 4ITVA 3GEZA 3CESA 4UY8I 1IXCA 4XLEA 5F0HA 1BL0A 4II3A 3J80Z 1FLIA 3OYFA 3FM3A 2V7FA 2E19A 4A93J 2HZTA 4RGRA 2B7EA 2JTVA 1VFCA 1IXRC 5LGTA 3HOWJ 1B6AA 1QQIA 3GO5A 4M74A 3EUHA 2CYYA 4BE0A 2P8TA 3C2GA 1ONVA 2XROA 4I99C 1QZYA 3MEXA 3CLQA 5IT9Z 2ME6A 2BXYA 3OR2C 4PJMA 4M3FA 2MC3A 2JA2A 4IHVA 1JTYA 2LKXA 2Q0OA 3S16J 1O4XA 5BQTA 1R00A 2OV7A 1WJCA 2F5EA 4I01A 2CV2A 3O3KA 3GZNB 2IEKA 4GCVA 1WGXA 3KYDB 2DMNA 2NVTJ 2HQ5A 5EYRA 2EBIA 5D5UB 1WQ2A 5E1WA 3L7WA 2X85A 3DV8A 3RTRA 1S72I 5DUKA 3FDYA 4R1HA 4RM3A 2XC7A 4LB6B 2E34A 1BIAA 4LGWA 2XRNA 5FLXK 2XPWA 3ZMZA 1OCCH 4LG0B 1VQKI 1UHSA 3LA2A 4JYKA 2VLAA 3CC4I 1OKRA 3PUFA 2WBMA 1R1UA 5EGOB 1T39A 4G6QA 3BJOA 2H94A 1MNMC 3WTSC 3BG5A 2KKOA 2JRTA 3PNYA 1S7OA 1W0UA 2V79A 3DXJF 3H5NA 3VYTB 2NXNB 3WGHA 2CQ7A 3CLOA 2YU9J 3S8PA 1MW7A 1WJ5A 4YRVA 2PJRA 3BTLA 1BR2A 2P0WA 3KZZA 3VFZA 2HKXA 4MEYF 5J1RA 3BR0A 1KU7A 2DK8A 3BCBA 2DFHA 1RUOA 2IJLA 5M5YJ 1D1AA 3ZN0A 2RQPA 2H6BA 3R61A 1WJEA 5EF6A 1NTCA 4CCOA 1J5YA 3FXMA 2BOLA 4C3IJ 2R7VA 4Y17A 2EZIA 2GQQA 3VYSB 4IXAA 4AVZA 2OBPA 3IV5A 2CU7A 3H3ZA 3K9TA 2XSDC 5ICGA 1V5FA 4PUSA 5E3LA 2ZXHA 5HLIA 3BCAA 3T1BA 4H0EA 3RDIA 4JQFA 5HODA 4FTHA 3MZYA 2F4OB 4GYGA 2M8EA 4RAZA 4XK4A 1P4AA 5H6QA 2NS7A 3ZMVA 1DU0A 3M1EA 1RC9A 2L3DA 3GUDA 3CC2I 1BOAA 3DU5A 3JSOA 2QA4I 2L7ZA 2EZLA 3EUAA 3FM5A 2CJJA 3RYRA 2LMDA 4Y13A 5HNFA 1HW2A 2K9NA 1ITYA 2DMPA 3SQNA 1SFKA 4MQVA 2EPFA 3RKXA 2HPMA 3NRVA 4A0ZA 3MZ8A 1OR7A 2M7AA 3M3YJ 4IF4A 2XVCA 5CPRB 3S1RJ 2D1HA 1K6YA 3BG6A 4XKBA 3QAHA 3BTIA 3E6CC 1IUFA 4NQWA 3GF2A 3JTHA 2EFNA 1Y0NA 1OCRH 5LEKA 3PNTA 2V1NA 5DEQA 1T56A 4FX4A 5LHGA 2STTA 2Y48A 5DCMA 4PFPA 3WGGA 3GCMA 3ZR8X 2ACJA 2OUMA 4MIMA 5B66C 2GXGA 3J7ZI 3BR2A 5IP7J 2HYGD 1YOVB 4J19A 1VI0A 2R0QC 2BW3B 2DT7B 1IRFA 4BQNA 4PJLA 1BR1A 3MVPA 2PQ8A 4RAYA 4HV5A 5B1BH 2ECCA 2R7QA 4LLNA 1ETQA 2L01A 4G8XA 1Z6RA 4IHTA 1H8AC 2JMWA 5IP6A 2CH0A 2LBFA 4V19K 2Y0SN 3DLLF 3E1SA 3I64A 3SEQA 3I53A 3CD6I 3BZ6A 2FQ4A 4P5OA 4F55A 3I0TA 2L02A 1EV7A 2D45A 2EV0A 2ZO4A 4IHXA 2CQNA 1DGRM 1X2MA 6PAXA 2CW7A 4XLFA 4EGZA 5GAGJ 1HBXG 3FKJA 2I10A 4YIIA 1QO0D 5DCFA 4KITB 4ZYDA 1R22A 2GOMA 3L2VA 1AWCA 4OINF 2IBDA 2MC4A 1K83J 5L3GA 2L54A 1YJWI 2EILH 1OCTC 2O9LA 2Z99A 5F0FA 2X6OA 3MKZA 2FNPA 4HSRA 1A36A 1LUJB 3OS0A 1H0MA 4BL0B 4B8XA 2E1MB 2BE5F 2IA0A 3KX2A 4G9YA 1WVRA 4EJOA 4FETA 1A6IA 1BM9A 2HZDA 1J75A 1F9NA 1Z67A 1BI0A 3OIOA 3KETA 1DUXC 4O3MA 1QNTA 3CCMI 1MBKA 4XORA 2ISYA 4PCQA 2R5ZA 4YFXF 4A3EJ 3ZQGA 3CF2A 3E97A 3EQLF 1P7IA 5B3SH 1XMKA 4N9IA 1FP2A 2XSJC 2VBXA 4BJ6C 4Y52J 1X1PA 1NH3A 2UXNA 3ABMH 4NB5A 4XBFA 2K02A 3IAM2 4BKXA 5FJ8J 1BW5A 1BJZA 1U5TB 4E70A 2R7WA 1S3JA 1SEUA 1YRNA 2ID3A 3I71A 2J5PA 5ILSA 3DQVC 2O7OA 1ZTRA 3QPLA 1BW6A 3LQRA 1HOMA 2AQFA 3UKGA 4LJZF 2QGUA 2M1BA 2KIQA 2CS3A 4YELA 2CO5A 1JJ8C 2HU9A 3D0SA 4R8HA 3GYHX 2KIMA 1A5JA 1ZG1A 1KA8A 4RGUA 4HNTA 3Q9VA 1IXSB 2MLKA 3MN2A 2QM3A 4ESFA 3HTSB 1TW3A 3CCQI 3QPTA 2A6EF 4XR6A 1HXDA 1XSVA 2L9RA 3SJMA 1B9MA 2FBIA 2M4GA 3ASNH 4ABZA 1X2NA 3R60A 4ENMA 2R7ZJ 1EH8A 4PDKA 5GAEJ 3BG7A 4LITA 2FOKA 2AHQA 1R71A 2JWTA 2PFBA 2UXXA 2H6CA 1Z0XA 3CC7I 1FOYA 4WCGA 1ACIA 3C2BA 1D0YA 1PUFB 1XGSA 2JZYA 1SVLA 2GIZA 1DDNA 3FF5A 1JHFA 2KISA 3TP3A 3KIOA 3FZVA 3A4CA 5BMZA 3BOQA 3RPUA 1FIAA 2RKHA 3L2WA 2K3FA 3SZPA 5FO5A 5F08A 1ZRFA 4BQAA 1N75A 4HX8A 2XHKA 2FD5A 2WA0A 2K9LA 2IS1A 5CLSA 4BACA 1MBJA 1RI7A 5LEJA 1F43A 4CH7A 3NWSA 1R1TA 2YR2A 3CJNA 4C2UA 3KYCB 2IS4A 5FLXZ 4IL6C 3OYIA 1USTA 4BS9A 1FOKA 2HKOA 5CKTA 2VJ5A 3OSFA 4FQGA 4HRIA 4IEJA 2BGCA 4HLXA 4Q5SF 2XB5A 3VPRA 3O6BB 4G6DA 3SZTA 4EVIA 4HDVA 1XGNA 3DPUA 5BPIA 1Y6IA 4HQMA 1WSUA 4UXNA 3QP5A 2MH2A 4DYQA 2DXIA 1XDUA 2XUBA 2B0LA 1IRZA 2K9MA 2DA4A 4OMYA 3Q0VA 2LVSA 2BYVE 4B09A 3H5RA 5K5QA 2FU4A 3N05A 5C44J 3A0HC 4OAYA 1YW7A 2XAFA 2PJPA 4HNUA 3HPHA 1FIPA 3BTCA 4BEHB 1UJ8A 3RZDJ 4RB2C 2F5VA 3VOEA 2D1VA 4HDUA 3UR3C 3LFKA 1V54H 4P9FA 4E7IA 2LC2A 1XSDA 3DKWA 3HGYA 2OPTA 3IH2A 4XLHA 3W2VA 4Y3OA 3JRCA 1AOYA 3A01B 3JRAA 2V9VA 3JCUC 1LPQA 3S2WA 4V2GA 3WTXC 4GDFA 4YFKF 4BHCA 4CDGA 1ZHFA 2X1EA 1LQ1A 2X6XA 2W7NA 1OCOH 2FXAA 3DKYA 2XAJA 1JXSA 5GP9A 2MLGA 1VNDA 4CCNA 4EJVA 1GV2A 2DYRH 2IGOA 3LSRA 1OYIA 4ZDOA 2LOOA 3GFLA 4XL9A 3LQQA 1YFHA 2PMZA 1VZ0A 2LFBA 3MKYB 1K78B 2V9PA 2E5ZA 2BZTA 2QBYA 2EA2A 3QYFA 2WADA 3QU6A 4NNJA 1OR7C 1BI2A 2MABA 4MFDA 3EYIA 2MH9A 3S1NJ 3VEPA 4P9UA 5JI6A 2MD5A 5BOXA 2DT6A 2YSRA 5TGTA 1I6XA 1T8IA 1LFBA 1EH6A 1GVDA 2VE8A 4UB8C 3G1LA 1YS7A 4F91B 5J40A 4AU7A 1RIOH 2NYXA 1Z3XA 5LD2C 2VI6A 4L9NA 5J8CA 4I2OA 4CO8A 3COAC 3OOUA 3QOEA 3OYCA 3N4MA 4C9YA 4E7LA 1PUEE 3LSIA 1U6GA 3VSKA 2DOFA 4XOTA 1YJNI 2E1NA 3IC7A 3WU0A 4GFBA 1VQ6I 3ASOH 1LDDA 4KN4X 2HTJA 3F8FA 4V2FA 4I98B 3V4GA 1ZN2A 4KMUX 3H92A 2QUFA 3U1KA 3ZMSA 3E6BA 3F72A 4KUMA 1WH5A 2W1OA 3CJQB 3I59A 2OZ6A 4AM3A 4J01A 2KHMA 3EYYA 2KJBA 2EZHA 2LG4A 1JGGA 2L2OA 5HLGA 1PP7U 2HDCA 5HS7A 3GTGJ 2OF7A 1BC8C 5KVRA 4XLAA 2JA7J 2DYSH 2H27A 4ESBA 1BI1A 2R7FA 5DS9A 1ZAOA 3CMAI 1I3AA 3BQYA 1A04A 3RIRA 2EJRA 2QZ8A 1KYZA 5E1XA 2QVOA 4EQQA 4MTEA 2PI0A 1KU3A 1YI2I 1KQ9A 2QF7A 2CRGA 1TLHB 4HW0A 2ZXIA 2RC4A 3IWFA 5ED4A 3ULQB 4KA4A 2KFDA 2X4HA 4D1QA 1CF7A 1Y8RB 2WAQN 5CQGA 5ILUA 4LFUA 4UVBA 3FK6A 3K4CA 4ZC3A 4LLGF 3HOYJ 1WKMA 2DOAA 1ZLKA 2CQXA 3FMQA 4X1EA 2E7XA 4DGWB 3GTPJ 3GTMJ 4ZJZA 5IYCJ 4G6TB 4B3XA 1JKQC 1B72B 4KDPA 2KT0A 2YS9A 1S8NA 3FXOA 2VJJA 2W82A 5AIPA 4E6KG 4PZJA 4M3BA 5LRSA 3BJ6A 5K7FA 3M8FA 5LHHA 3OYBA 1W36D 3HGGA 1X1DA 3MWMA 3PSFA 1V5EA 1BN5A 2CUJA 3DCFA 2XAUA 1A35A 4IHYA 4IKFA 2IS6A 4PSWA 4XRMA 2DA6A 3HOSA 3WHCA 3HJEA 3O8GA 2LD5A 1QVUA 2BVMA 4FHTA 4B1RA 4M6YA 4D7MA 3F22A 2QSGX 4G7ZF 5CJ9A 2R93J 4AVPA 4A2UA 2H09A 4ZYAA 4BJ5C 1IV6A 3KP6A 4HPQA 4XRFA 1TT0A 3HOXJ 1EH7A 3BLYA 3VB2A 1I27A 3RPUD 2GOXB 1R36A 4TV7A 4A3KJ 4L9TA 4XSXF 3REOA 4BGDA 3I54A 1U8BA 3GFJA 3K4BA 2NOGA 4KNYA 1OYWA 3GLLA 2DT5A 3F8BA 1NK3P 4D5FA 3IHUA 3LFUA 3P5JA 3D5RC 3I9V2 4Q48A 2R7OA 2HPIA 3HPGA 4B48A 3ZMUA 3AG3H 2L7KA 1VQ7I 2OC6A 2R7UA 5BS6A 3ABLH 3HBLA 4ZZDA 4OIRF 3ZQQA 2OTLI 2M7BA 1IW7F 2FX0A 1WH7A 2LTPA 2V6CA 3WU2C 3WODF 1ZRDA 4GGGA 2IGKA 5M5XJ 2DDBA 2R3SA 5HVQC 1U78A 1Y1WJ 2KIUA 1FYKA 4LB5A 2W48A 2AXTC 4KIGA 2HNHA 2UUZA 3BTJA 1ETVA 1HQCA 4AUXA 3BR6A 1PVEA 5D5WB 2OQGA 3R0AA 1MD0A 5E3MA 3DLAA 3O8HA 4OIPF 1WZ2A 3WTWC 2XF6A 3KE2A 4N0BA 1W1WE 2CQQA 3GTJJ 4XICA 3PFIA 1HC8A 2ZB9A 4WK8F 4XNFA 1I6HJ 2LR8A 2MBFA 1FBUA 4M73A 2R7DA 5EEHA 4KIBA 2WAFA 1FEXA 3AL0C 3ZMTA 4L9JA 1LE8A 4JK1X 1W7PA 3WTUC 3IRRA 4UB6C 1RKWA 4XLPF 1OISA 2VONA 1ERDA 3LAJA 3TO6A 1VF9A 4P1WA 1IRXA 3MMYB 4JX4A 1XX5A 5FKMA 2DW4A 1AHDP 1N78A 4OIOF 4CSWA 3GTLJ 3H35A 1ODDA 2Y9ZA 3R6SA 1R5HA 4LK1F 3OYHA 1R9TJ 1IJWC 4BY1J 3QWLA 2A5WA 4XLNF 3F21A 2HQAA 4I02A 3SYTA 1HF0A 5CVUA 2HI3A 3TW7A 3ZGKA 1X3UA 4I7HA 4IHWA 4FISA 4A5MA 5JHUA 2HXOA 3ZOBA 1FMWA 2JRMA 4LK0F 4QPQA 2Q2EB 5KAIC 3LWFA 2M30A 3GMEA 2A05A 3L00A 2EINH 1AA7A 1WJDA 2R4GA 5KCMA 3HRSA 2W85A 2EZKA 1IRGA 4IHSA 1W4MA 3U9GA 4CUGA 3BZKA 2KDOA 1J09A 1FOWA 2FQ3A 5IOZA 2HXIA 4FASD 4Q47A 3FISA 2VT2A 1ZARA 1LVAA 3LSGA 5FKOA 2QSHX 3ISPA 1TC3C 3IRQA 1YG2A 1TQIA 2HDDA 2X9DA 2LF7A 5E3NA 3QRFF 3MAJA 4ZH4F 4LIVA 2DAOA 3PM1A 2DFEA 2VBZA 4PJJA 3S15J 4Y15A 3TQNA 3U1DA 1XDSA 1IG7A 1N77A 4A3CJ
chains in the Genus database with same CATH topology
1X3ZB 1OQYA 1QZEA 4YIRX 3ESWB 2QSHX 2F4OB 1X3WB 2QSGX 2QSFX 2F4MB 1PVEA 1TP4A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X3Z B;  1OQY A;  1QZE A;  4YIR X;  3ESW B;  2QSH X;  2F4O B;  1X3W B;  2QSG X;  2QSF X;  2F4M B;  1PVE A;  1TP4 A; 
#chains in the Genus database with same CATH topology
 3CCY A;  4U0W A;  1ZK8 A;  2ELJ A;  1PYV A;  4HG2 A;  4DQ2 A;  2ZME A;  3G71 I;  1OPC A;  1K79 A;  1SD7 A;  1HKQ A;  1O7F A;  3S2H J;  1I3Q J;  1LDJ A;  4UUS A;  2Q8K A;  1TWC J;  3IH4 A;  2JA8 J;  4XON A;  4C30 A;  1GXP A;  1S7A A;  4EJU A;  2DTR A;  3U2R A;  1NK2 P;  5JFR A;  4EM2 A;  4HAM A;  2GA1 A;  3GTK J;  2IXS A;  1F1Z A;  1REP C;  2DQR A;  3HDD A;  1GDT A;  2RQQ A;  4UNO A;  5E8G A;  2EFO A;  2EIJ H;  3OL3 A;  4N9H A;  4A12 A;  3T8R A;  2B63 J;  1X1B A;  3OY9 A;  1N25 A;  2V6E A;  1C0W A;  4DZP A;  2A69 F;  1T98 A;  4KFC A;  4XQF A;  4U7B A;  1SFE A;  3PFY A;  3HRT A;  3TOB A;  2I5U A;  5DM6 F;  5L3F A;  3CCL I;  5ICE A;  3RKW A;  1R7J A;  3L09 A;  1B59 A;  2M4K A;  3KCC A;  3HKZ A;  2CFO A;  4AYB N;  2DTZ A;  3S2D J;  3GWZ A;  2OJE D;  5LLQ A;  1DGW Y;  2VN2 A;  2M8G X;  1XCB A;  2KPM A;  2LRE A;  3B02 A;  3WE3 A;  2RRE A;  2UWM A;  2ZJP F;  2W4S A;  3KYL A;  3HSR A;  3R0J A;  2CFX A;  1TWA J;  5JLW A;  1FZP B;  1OFC X;  2LP0 A;  1MKM A;  4JBA A;  1AKH A;  4M3E A;  2HTS A;  1DP7 P;  5BNG A;  2DJI A;  2UV1 A;  2O8X A;  1D8J A;  2L9S A;  3I4M J;  4BE2 A;  4JX6 A;  2X1C A;  4OMZ A;  2GBY A;  3OYN A;  4XKW A;  3F9K A;  2PN6 A;  2RGV A;  3K1N A;  1RNL A;  1ETW A;  3CCE I;  3HEF A;  4UV9 A;  4WXC A;  2VOO A;  3D5L A;  3AG2 H;  4RA2 A;  3K69 A;  2BY0 A;  3FK7 A;  4EEF G;  3J7Y J;  2L0K A;  3K4M A;  3QYB A;  1GUU A;  1WHU A;  1MDM A;  3GTO J;  2OQR A;  1HLV A;  3EDP A;  4ASN A;  4A3I J;  1P4X A;  4C2M J;  3QPS A;  1SFX A;  2VC1 A;  2R5Y A;  1FMV A;  2VC0 A;  3L1P A;  3CCU I;  1K61 A;  3W6K B;  4HNV A;  1STZ A;  2KZV A;  1YIO A;  2W57 A;  3T8T A;  2JVG A;  2IGN A;  2XAS A;  1HSJ A;  2E2H J;  2M45 A;  2Z33 A;  4CYC B;  4ZYE A;  4G7O F;  4M6V A;  1YIT I;  1SVO A;  5J3L A;  2ZJR F;  3PSI A;  2JUG A;  1SVM A;  4Q4Z F;  4Y4R A;  5A2Q Z;  4FCY A;  3S3M A;  2B9S A;  4BQQ A;  2MSY A;  3JRB A;  2DA7 A;  2EWN A;  2DK5 A;  2IP2 A;  3LSM A;  2JVH A;  3G3Z A;  1U2W A;  2FRH A;  5B5E C;  2LY2 A;  2GZW A;  4HF1 A;  1HKT A;  2E1C A;  2M0C A;  4XLC A;  2ESH A;  3GW2 A;  2RNJ A;  5DD8 A;  2ZSH B;  3HIF A;  3P9K A;  2N8G A;  4MNU A;  1QVT A;  3DP7 A;  3RKQ A;  2WB1 N;  2X51 A;  1VQ5 I;  2LYC A;  1GXQ A;  2BHZ A;  3SHF A;  3V8L A;  3G1O A;  4LLL A;  3ROU A;  2O6G E;  4NHJ A;  2QKM B;  1TZL A;  2DN0 A;  1Z3Y A;  2BY3 A;  2EH3 A;  1APL C;  3DKX A;  2F4I A;  1YS6 A;  1IZ1 A;  4QWQ A;  1JHH A;  1W7P D;  2DFI A;  3EUK L;  1HA8 A;  1IN4 A;  2HOE A;  4MEX F;  2KL4 A;  1E17 A;  1OYY A;  3FMR A;  3CCR I;  2K7L A;  2DFF A;  2E2J J;  4AC0 A;  5GPC A;  2O61 A;  2F5D A;  2RV8 A;  1YW8 A;  4ZZL A;  2E1O A;  3S93 A;  4RMN A;  1X1C A;  1YYV A;  1WWX A;  1RR8 C;  5GPA A;  5KHD A;  1ETX A;  4OIQ F;  2GLO A;  3JAM Z;  1ZLJ A;  3MCZ A;  2JUC A;  4XRS A;  3KZI C;  2WY8 Q;  1VTN C;  3DPL C;  1ETY A;  1G3W A;  5K5R A;  5FRO A;  1RPW A;  2LDU A;  1FSH A;  3MD2 A;  1W5S A;  3TOA A;  4XKC A;  2DOD A;  2KZG A;  3ABU A;  3CTA A;  2OA4 A;  1GLN A;  3KEO A;  5FD5 A;  1IN8 A;  2KLO A;  2QQ9 A;  4BJT A;  4IRH A;  3QYE A;  5H2F C;  2STW A;  3S14 J;  4BYY A;  3OIP A;  4E7S A;  1MMA A;  3H3V K;  2P4W A;  1ZGW A;  4BXF A;  3SXY A;  1U5T C;  4GO1 A;  4ENK A;  4PSX A;  3ZRG A;  4OWR B;  5DTD A;  1POG A;  1Y1V J;  2IAI A;  1K6O A;  2JK3 A;  4CGZ A;  1DU6 A;  3OYD A;  4WXD A;  3GXO A;  5LBQ A;  1WJB A;  2BXZ A;  3OYM A;  3CJT B;  5J1Y A;  3ERM A;  2VXZ A;  3HUG A;  3M1C A;  4XOP A;  2NOJ B;  4C2T A;  1R49 A;  3LL7 A;  2R92 J;  1Z05 A;  2HS5 A;  4OOI A;  3HC7 A;  3LAP A;  1J7K A;  4GRI A;  3SDG A;  4A0Y A;  1T08 B;  3B6C A;  4EJW A;  4AIJ A;  4BDZ A;  2X0L A;  4MFE A;  1YX5 A;  3DPT A;  3GZ5 A;  4IRI A;  1UHW A;  3F23 A;  4MHG A;  1ZKG A;  3IP4 B;  1WCM J;  4DOZ A;  3IWZ A;  2O8K A;  3BJA A;  5EG0 A;  5E79 C;  2HOS A;  3EPZ A;  3FHZ A;  1HDP A;  2TRT A;  2XF7 A;  3F3X A;  1FT9 A;  2XAG A;  4Z2Y A;  5HDG A;  3CDL A;  5JVT A;  2ELH A;  1TNT A;  2PX9 A;  1G8X A;  2L7F P;  2Q1Z B;  4RGS A;  1ENH A;  3L2Q A;  4C3H J;  1JTX A;  1F5T A;  5K7H A;  4U87 A;  1J59 A;  5FKL A;  2PJR B;  1MBE A;  2GM4 A;  2HFH A;  4IX7 A;  4UUS B;  3V7S A;  3JRH A;  2CV0 A;  2HQN A;  2NNY A;  5HOO A;  3GBG A;  1G59 A;  5E1Z B;  2QQB A;  4A0X A;  1MBH A;  3WTY C;  2ZME C;  3J80 K;  4ON0 A;  2VKE A;  2EIK H;  2W24 A;  2XKP A;  3G2B A;  3ZQL A;  2VJ4 A;  1T38 A;  1UFM A;  3CUQ A;  3ZPL A;  3V7R A;  1LFP A;  1O3R A;  3L9F A;  1D3Y A;  1VQO I;  4XN0 A;  3ZQI A;  2KJC A;  3W3C A;  3K0L A;  2J5O A;  1MJB A;  3G6E I;  1UHM A;  3HHH A;  2JT1 A;  2HYJ A;  3ECH A;  3DBR B;  3VSL A;  3I5U A;  2VUM J;  2DA1 A;  1MNE A;  3ZMD A;  3JRD A;  3CUO A;  2MG4 A;  4X6A J;  2DPD A;  1R1V A;  1FTZ A;  1F36 A;  1VQ4 I;  1FBQ A;  5D4S A;  3W2A A;  5D6E A;  3FBN B;  1OCZ H;  3FXK A;  5L3C A;  3HOU J;  5EZG A;  4NC7 A;  1MH4 A;  2NAZ A;  3JRI A;  4M3G A;  2XIG A;  4NBQ A;  2QSF X;  3CZ6 A;  1MH3 A;  4EAT A;  4BDY A;  4M9Z A;  3VDX A;  2AS5 F;  2LKP A;  4A3G J;  1JUM A;  3MQ0 A;  2H1K A;  1WJA A;  3BR5 A;  2LKS A;  2ETH A;  5D8L B;  4I76 A;  3G4S I;  1D0X A;  4G12 A;  3KP4 A;  3AG1 H;  4HBL A;  2OAZ A;  2PBI A;  4CXF A;  2Z16 A;  3E7L A;  4D5C A;  2Y0S A;  4NQW B;  1NHA A;  4B44 A;  5DD4 A;  5FRM A;  2ISZ A;  4I0A A;  3RZO J;  2LY1 A;  2MW8 A;  2FUG 2;  1XMA A;  3AKZ A;  2ICW G;  2HVR A;  2R7S A;  1QZE A;  1XB4 A;  5LRR A;  2XPU A;  5DCM B;  2K9Q A;  2EK5 A;  4A3J J;  2R7X A;  1LDK B;  2L5Q A;  3VYR B;  1P6R A;  1Q1V A;  3Q3S A;  2QQ8 A;  2K27 A;  1JKP C;  4LG0 A;  2O3F A;  1MJ9 A;  3HYI A;  3I58 A;  2OZU A;  3TW6 A;  2OTJ I;  2AQE A;  2G7H A;  1IN6 A;  4UUV A;  2KIF A;  5EGO A;  5EZH A;  3F6V A;  1SFO J;  4D0P A;  1MDM B;  1QU3 A;  1LFU P;  2RVC A;  2ID6 A;  5J6X A;  2ZJQ F;  1D1B A;  2R5Y B;  1SD6 A;  5H20 A;  4N4N B;  4RDU A;  1VQ8 I;  3Q9S A;  5CVJ A;  2LBF B;  3K4K A;  3A0B C;  3V8K A;  5K1Y A;  4YFN F;  2VL8 A;  3T5X A;  4KT6 A;  4L0Z B;  4ZYG A;  1O3S A;  3KEY A;  1BIB A;  1L3L A;  1KU2 A;  2DOE A;  1YW9 A;  4B3A A;  2O03 A;  2X1D A;  1EF4 A;  2YU3 A;  2K40 A;  2E2I J;  3NAR A;  3TO9 A;  4MO7 A;  2MFZ A;  2R7T A;  2QLZ A;  1UEL B;  2PMH A;  1S6L A;  5F64 A;  1ORK A;  5AIQ A;  1FSE A;  2VJI A;  1XGM A;  4F3Q A;  3ZXS A;  2F5F A;  2ADU A;  3DEU A;  2VB6 A;  2WTE A;  3L2U A;  1MMS A;  3OSG A;  3TED A;  2QKL B;  3CMM A;  1SAU A;  2WY7 Q;  2JQ7 A;  3C18 A;  3DTK A;  4CZZ A;  2R5Z B;  3GFI A;  2XAQ A;  2LNB A;  1VQ9 I;  4RB3 C;  3K1M A;  3TKY A;  1MND A;  2A6H F;  5C4X J;  3H5A A;  5EJC A;  1Z7L A;  4RLQ A;  2V1U A;  3JRF A;  4BXX J;  2P81 A;  2G9W A;  1QA6 A;  3C2H A;  2Z9O A;  3NEU A;  1SMT A;  5HNH A;  3IKT A;  1JGS A;  4M9X A;  4KJZ A;  2XDV A;  3TGN A;  1YRN B;  1JKO C;  3HHG A;  3LST A;  1YO5 C;  4IOC F;  2YPR A;  2K3P A;  4A3D J;  1ZG5 A;  3HOZ J;  4XN3 A;  4WX9 A;  3J81 K;  1T33 A;  4L0Y B;  3OYL A;  1SD4 A;  3ML6 A;  1IN5 A;  1RZ4 A;  3GX4 X;  3RSN A;  4KT5 C;  1YTY A;  2D5V A;  5FLV A;  5H6R A;  1R4M B;  5D6F A;  2BY1 A;  4HX7 A;  3SFI A;  3OIQ A;  2FF4 A;  2BW3 A;  1HW5 A;  4UV8 A;  3K4N A;  4BHP A;  2R7R A;  2HDW A;  4IO9 F;  2Y9Y A;  1UG0 A;  3PUB A;  3V8J A;  1T6S A;  3D5S C;  4YIR X;  4O6J A;  1MSF C;  4II2 A;  2WV1 A;  2VKD A;  2V4J C;  4C3J J;  2DMQ A;  4ZYH A;  1P9Q C;  4HZF A;  2ZSI B;  1W36 C;  1CQT A;  2NVX J;  4N4O B;  3K6G A;  2IT0 A;  2DMU A;  4L5I A;  2VQH A;  3ZN1 A;  3ZCO A;  3L2C A;  5HS8 A;  2DLL A;  1UB9 A;  2L4A A;  5JR3 A;  1MBG A;  1P92 A;  5IY5 H;  3ABT A;  2L7M P;  2L9V A;  4OAZ A;  1E3H A;  3LSK A;  1TWF J;  2XAH A;  4LIU A;  2HWV A;  1QBJ A;  3A03 A;  2E71 A;  4EJT A;  3DEW A;  5HDK A;  5E3O A;  2VAS A;  5IP9 J;  5TRD A;  3R4K A;  2KDZ A;  4DBQ A;  3HM5 A;  2IGM A;  4UVA A;  3TO7 A;  2XGE A;  2P5V A;  4XM3 A;  4ZTF A;  1FYL A;  1P2F A;  2CWE A;  4AWX B;  3AL0 B;  2RAE A;  2OD5 A;  4WF2 A;  3RQ4 A;  1ZGA A;  2AXL A;  5KAF C;  1RES A;  2ZKZ A;  3I4P A;  3H0G J;  4BY7 J;  3BY6 A;  3DF8 A;  3V7C A;  1IUY A;  1TW2 A;  3PQJ A;  5J1U A;  1JI8 A;  1HKS A;  1RET A;  3HOV J;  2LLK A;  1LEB A;  1XCV A;  1Y8Q B;  4P96 A;  5DM7 F;  3H9Q A;  1IGN A;  1JJ6 C;  1ZG3 A;  2NS0 A;  5E20 A;  2DDA A;  4LD5 A;  2X48 A;  2VE9 A;  3M8E A;  2AO9 A;  2EFP A;  1U5T A;  4PGH A;  2CG4 A;  2EA4 A;  4EV0 A;  3BPX A;  3P9C A;  4DIQ A;  5HS9 A;  1I1S A;  4CHU A;  1JKR C;  1O3Q A;  1YQA A;  4BAY A;  3DWL E;  5CYV A;  2EB7 A;  3H3U A;  1U3E M;  2I8D A;  3M8J A;  5TIS C;  1KQ8 A;  3BWG A;  2F6C A;  2PLY A;  2VPL A;  1YE9 A;  1TT5 B;  3CUQ C;  3Q5F A;  4ZDL A;  2MYS A;  4FX0 A;  2CMP A;  1OQY A;  3TMO A;  1SMY F;  3FXU A;  3OL4 A;  5F1J A;  2LRD A;  3S17 J;  3LSP A;  1RRJ A;  1SD5 A;  2IPQ X;  4UHT A;  1JE8 A;  5FFX A;  3H0D A;  5IOY A;  2VQC A;  3FXL A;  4IVN A;  4QPO A;  2LY9 A;  3LA3 A;  4F92 B;  1U9N A;  4NC8 A;  1ZH5 A;  3CJR B;  3CQZ J;  1CGP A;  1OCP A;  4DZJ A;  1VQM I;  3CCJ I;  1TL8 A;  2XPV A;  2HVS A;  4JOM A;  1KU9 A;  3CO7 C;  4GYI A;  5KNL A;  3OYK A;  1PUF A;  1Z6T A;  2HOA A;  1Z77 A;  2W84 A;  4QTR A;  2ZC2 A;  1XMX A;  3FX3 A;  1FJL A;  1GT0 C;  1YLF A;  2HGC A;  2VOD A;  1SAN A;  5J4Y A;  2OCE A;  3FXR A;  4L5E A;  1S9H A;  4EM1 A;  1GV5 A;  2LK2 A;  2VT3 A;  2QBY B;  5FKN A;  5FRN A;  3M9A A;  2FBK A;  2L9N A;  2DCE A;  3U21 A;  1WI3 A;  3JRG A;  2IA1 A;  5FKK A;  4D7N A;  3WG9 A;  2E5N A;  2X6Y A;  1KGS A;  1PJR A;  3A1Y A;  5J8F A;  3DBH B;  4RGX A;  2K4J A;  3WE2 A;  3F8N A;  2OU2 A;  1VQP I;  1H9G A;  3GZ6 A;  2Y75 A;  2BBY A;  3CP2 A;  2JA5 J;  2JJ7 A;  1B8I A;  4IOA F;  1P7J A;  2KMU A;  1MGT A;  4A6D A;  5LHI A;  3A02 A;  2Y2Z A;  3VYU B;  1MBF A;  3GLX A;  4IQJ A;  4IZZ A;  3PJR A;  5D4R A;  3FBI B;  1TWH J;  3QQA A;  1DQU A;  3KP7 A;  5LFA A;  4ENJ A;  4MLO A;  3KPH A;  3M07 A;  4DBR A;  3C7J A;  4L18 B;  4L5J A;  1QHG A;  3WGI A;  3HXL A;  5DDG A;  1V4R A;  2JSC A;  1R5I D;  1ZRE A;  4CIC A;  3BP8 A;  3HSF A;  1JT6 A;  2W00 A;  3KLN A;  3QOD A;  3WTT C;  1V55 H;  2P7V B;  2FMY A;  3HSE A;  5KK1 A;  3I59 B;  2DU9 A;  2Y30 A;  3CO6 C;  3KP2 A;  1B9N A;  3T0Y A;  4A6E A;  3G73 A;  4YG2 F;  2WAQ A;  2DPU A;  3LSH A;  3SDB A;  1TP4 A;  3PQK A;  2EFW A;  4F93 B;  4PGG A;  5CVV A;  4LOC A;  3S1Q J;  3QP6 A;  2EFQ A;  2BHY A;  1GVJ A;  2FE3 A;  5GAD J;  3CF5 F;  4XMY A;  2E60 A;  4BEH A;  1R4N B;  3K70 D;  2QEN A;  3NWT A;  3ONQ A;  4HOB A;  2M0M A;  1MMG A;  2K85 A;  4BHB A;  3OR1 C;  2FBH A;  2DA3 A;  3FKI J;  3BT9 A;  4PJN A;  3I55 I;  3QPH A;  5FGM A;  3A01 A;  1U8R A;  2FA5 A;  1S29 A;  1CF7 B;  2COM A;  1YHQ I;  3HRM A;  1B4A A;  4NDL A;  2V9K A;  5HDN A;  3KEQ A;  5L3E A;  5E8I A;  4AD9 A;  2Z2S B;  1TBX A;  1WFX A;  1MMN A;  3DEE A;  3F6O A;  2XGX A;  5IPA A;  1Q1H A;  5F04 A;  4DJA A;  4G7H F;  4QSH A;  4B4C A;  4HLY A;  1A6Q A;  1Z7U A;  4FE7 A;  2QYO A;  3K4J A;  2L4M A;  2ZBK A;  2GA2 A;  5DV5 A;  2DJN A;  1K78 A;  2FOW A;  3K70 C;  1E3P A;  2WWY A;  4IRG A;  4MTD A;  3PL8 A;  5GAH J;  3OMY A;  1YIJ I;  2E7W A;  3LMM A;  1ZRC A;  3UNG C;  2A07 F;  5FLM J;  1S5L C;  3FMS A;  1ETO A;  2ECB A;  5E17 F;  4RB1 A;  3KLO A;  3J81 Z;  4ZTJ A;  5F0C A;  4NUB A;  5L3B A;  3E0J B;  3S3O A;  3JRE A;  5DUI A;  4HA8 A;  1D5Y A;  4KN7 X;  2G7U A;  1FX7 A;  4JX5 A;  3PO2 J;  3Q0U A;  1R23 A;  2KRC A;  3W6V A;  1W5T A;  3GFM A;  2TDX A;  5F1R A;  3D1N I;  5CQE A;  3W2W A;  2PMZ N;  4G94 A;  2DQL A;  5AON A;  3OYG A;  4JP0 A;  4L9V A;  1SFU A;  2JSP A;  2MGQ A;  5M3M J;  4QLC U;  2BY2 A;  1I5Z A;  1V3F A;  2TCT A;  3E5U A;  3ZP5 A;  1IF1 A;  4RAF A;  2CUZ A;  3X2Q H;  4BBS J;  1WI9 A;  4O5V A;  5LGN A;  4S0H B;  3M7G A;  4I09 A;  2CUF A;  5F27 A;  1SAX A;  1YX3 A;  2VXD A;  3TL4 X;  4BXU A;  3K2Z A;  3MKL A;  1X58 A;  3O2P E;  3HB9 A;  4A5N A;  1QZZ A;  3JSP A;  3AAF A;  1GHC A;  1B1B A;  1QGP A;  1Z1D A;  1M1E B;  5GTH C;  4A3F J;  2KRH A;  3JR9 A;  4PFO A;  5C4J J;  4A3M J;  4FE4 A;  3F0C A;  4U0V A;  2CGP A;  1ON2 A;  3IUO A;  3WTV C;  1USS A;  2VQL A;  5D8K B;  3HOT A;  2M5W A;  3N97 A;  5GTI C;  1X3W B;  1J9I A;  2CSO A;  2Y31 A;  2FJ1 A;  3CP8 A;  1OJL A;  1X1A A;  1BBY A;  4CZC A;  5C3E J;  1EKE A;  3HTU A;  4B47 A;  1IAW A;  1MMD A;  2E1M C;  3VOD A;  4CCK A;  1FOX A;  1IDZ A;  1WRJ A;  3FXJ A;  2V1X A;  4M71 A;  2KQR A;  4AIH A;  2GIV A;  3H9G A;  1HDD C;  2WAE A;  3L2R A;  3A2K A;  1LE8 B;  1ZYR F;  1W7P B;  4U0Y A;  1U9O A;  2RNG A;  4HQE A;  1O3T A;  2X6W A;  1XN7 A;  3KP3 A;  1I1G A;  4E7Z A;  2Y0M A;  1L0O C;  1NG6 A;  2ELK A;  4DNC A;  5D5V B;  2HEO A;  4E4H A;  1B72 A;  1J2X A;  4EMS A;  1ETK A;  2A61 A;  3SFZ A;  1LVK A;  3NQO A;  1G6N A;  2IS2 A;  5CVR A;  5TJJ A;  4WWC A;  1X4O A;  2DO7 A;  2VBW A;  5FB2 A;  4XKV A;  4A3B J;  1XC5 A;  3ZQ7 A;  3BG9 A;  1K4T A;  2NRA C;  3K1P A;  3CCV I;  4DYC A;  5M3F J;  3ZQF A;  5ICC A;  1RKT A;  1G2H A;  5K5O A;  2QWW A;  2K9S A;  2VIX A;  2NNN A;  4S04 A;  4BQO A;  3BDD A;  1TQM A;  2RDP A;  3S32 A;  1G3S A;  1LEA A;  2YUS A;  3OS2 A;  3RKY A;  3BQZ A;  3K2A A;  1IDY A;  2ZXJ A;  3EUH C;  3MZH A;  4KYW A;  2FNA A;  3ESW B;  3E6M A;  5IT3 A;  3KZY A;  2VOP A;  2FML A;  3AFH A;  4W1U A;  3S3N A;  1YJ9 I;  4Y33 A;  4DYR A;  3VWB A;  1FPQ A;  4HF0 A;  5J47 A;  1XSX A;  1ZR2 A;  4BBR J;  2WV0 A;  3C3W A;  1SC7 A;  2LSO A;  1OMI A;  4RBO A;  1D1C A;  2M9H A;  1ZGJ A;  1QPI A;  4M72 A;  2IVM A;  4ENN A;  2OCC H;  1FC3 A;  2EIM H;  4LMY A;  3CCS I;  4UVC A;  2PEX A;  4GXO A;  4KIF A;  2Z5U A;  3F8M A;  2O0Y A;  3I56 I;  1PP8 F;  1HCR A;  3BC8 A;  4XSZ F;  2HOT A;  2ESN A;  2V1D A;  3V42 A;  2HYF A;  1P4W A;  1Z9C A;  2ZME B;  1QHH D;  2DA2 A;  2XF5 A;  3H36 A;  2CW0 F;  1XPX A;  2CW8 A;  1E2X A;  5EDN A;  2DMT A;  3SEZ A;  1F4K A;  1B8I B;  1D5V A;  1UZC A;  4I0B A;  2BVL A;  1WPK A;  2JPB A;  5ERI A;  5JVG F;  1T0F A;  4D9J A;  1EA3 A;  2NVY J;  3CME I;  1BR4 A;  3RI4 A;  3ERE D;  3W6J B;  2VPR A;  1IO2 A;  4RLF A;  1W0T A;  4KMF A;  4LG3 A;  3DFG A;  4CYD A;  3QOP A;  2P7C B;  1R6R A;  3IL2 A;  1LJ9 A;  2EV6 A;  4RM2 A;  4AYB A;  4IJA A;  2EV5 A;  4BU2 A;  1RUN A;  1G3Y A;  3RCO A;  2WC2 A;  3J7A O;  3CDH A;  3DU6 A;  3AG4 H;  5IYB J;  1QRY A;  2HR3 A;  4MQ9 F;  1QPM A;  1TWG J;  5IT9 K;  1TNS A;  1FWZ A;  1MIJ A;  2NS8 A;  2UZK A;  2MA3 A;  1D8K A;  1BOB A;  3I4N J;  2JN6 A;  4X0G A;  1Y0U A;  2CQK A;  1NG7 A;  3PIP F;  1EJ9 A;  4I6Z A;  4DW6 A;  2F48 A;  1DPU A;  1J0R A;  1JUS A;  3IH3 A;  3K7A J;  4YEJ A;  2Q2E A;  3ZQH A;  1HW1 A;  2XGD A;  2ZNY A;  4UUT A;  3KP5 A;  1O57 A;  1LB2 A;  1O7L A;  2JPC A;  3OYJ A;  3DTI A;  1AKH B;  2VKH A;  2K4B A;  3E5Q A;  2M3A A;  3RJP A;  2Z1D A;  2IA2 A;  5HLH A;  2V26 A;  1FY7 A;  2K5C A;  2XKO A;  3I3L A;  4AID A;  3WG7 H;  5B1A H;  5JHF A;  4HEA 2;  4HV6 A;  2W25 A;  5CVI A;  9ANT A;  4IQ4 A;  3GTQ J;  2XV4 S;  2QEX I;  2Y69 H;  2LF8 A;  2F4M B;  2M87 A;  4BNC A;  2H8W A;  2MD0 A;  3LOC A;  2A6T A;  4EM0 B;  3MFK A;  3BR3 A;  5ILV A;  2ME0 A;  3ZQC A;  1MZB A;  2WB1 A;  2E35 A;  1TQP A;  3WHB A;  2P6T A;  3E3V A;  1UMQ A;  2QQA A;  3EET A;  4P55 A;  3HRU A;  2NVQ J;  3IKV A;  4ETS A;  1OLT A;  2H8R A;  2LH9 A;  1V5G A;  4RAG A;  3TDZ C;  4U88 A;  4ZDP A;  3PIO F;  5BPD A;  1U0J A;  1RR7 A;  3SZG A;  4BE1 A;  1R58 A;  2ZFW A;  1PDN C;  3E5X A;  5HLT A;  1BC7 C;  1Z91 A;  1DPR A;  1G4D A;  1W5C C;  3PO3 J;  3OYE A;  1KZH A;  3OYA A;  1H9T A;  4CCM A;  3WTZ A;  5DYM A;  1E3O C;  1K7A A;  3F8C A;  2H1L A;  1MSE C;  4K2E A;  2K86 A;  3E6D A;  1UG2 A;  1IN7 A;  2QCO A;  4E7H A;  5EEG A;  4YIF A;  3RQI A;  4F52 A;  2CV1 A;  3FHN A;  3OV8 A;  3BPV A;  2HQR A;  4HST A;  1ON1 A;  4EGY A;  3BG3 A;  3BR1 A;  4KIS A;  2XB0 X;  1BI3 A;  1X4P A;  5D5X B;  5FFZ A;  3Q0W A;  2F5C A;  3FIW A;  1I39 A;  5K7Z A;  5L3D A;  4A3L J;  4BH9 A;  2BEO A;  3LSJ A;  1FTT A;  1D0Z A;  1XS9 A;  2KP6 A;  2GWR A;  3H1C A;  3KFW X;  4BUP A;  3ABK H;  3RPQ A;  4MGR A;  1I50 J;  1WJF A;  4W97 A;  4E7J A;  4B43 A;  5EEA A;  2Z3Y A;  3C1D A;  4HX4 A;  2XGC A;  3DBL B;  2E36 A;  3BRO A;  2HVQ A;  4M9S A;  2P5L C;  2GXB A;  2C6Y A;  2P5K A;  2VBY A;  1VQL I;  1XD7 A;  2GXA A;  1BA5 A;  4CA0 A;  3B73 A;  2FEZ A;  3GVA A;  2A3S A;  4S05 A;  2IW5 A;  4HF2 A;  2GAU A;  4Y7N J;  3M4O J;  4PJ0 C;  3HKZ N;  2ZCW A;  4ESJ A;  2YX7 A;  2ZXW H;  4XID A;  5FD6 A;  1KON A;  3J7A Y;  2KRF A;  2G0E A;  5ICF A;  4H4K C;  5A2Q K;  2YX4 A;  3DTE A;  1R5G A;  4RS8 A;  3BZC A;  1ULY A;  3JW4 A;  5E18 F;  4CYC A;  1A31 A;  3MKW B;  2ZJ2 A;  1IV8 A;  3HUG B;  3NAU A;  1XG1 A;  4OU0 A;  2JA6 J;  2XRL A;  1KQ0 A;  1ZEL A;  4ANJ A;  3OOP A;  4AIK A;  2D2W A;  1G3T A;  1LKX A;  3HL2 A;  3G1M A;  4A69 C;  3QU3 A;  2DI3 A;  4CCJ A;  5M5W J;  4RB0 A;  2ZNZ A;  1FNN A;  2M2E A;  3TBI A;  1AU7 A;  3RYP A;  3HG9 A;  1IC8 A;  2F2E A;  4J00 A;  1Y56 A;  4Z6Y A;  3S1M J;  3H9J A;  4IPA A;  5JLX A;  1BJA A;  2VKV A;  5EG0 B;  3FXQ A;  1H89 C;  1LNW A;  4FT8 A;  1E0E A;  2A5Y B;  3WU1 B;  2DBB A;  4CCL A;  2O5R A;  1X3Z B;  3OWT A;  4XRS G;  1ZR4 A;  1H88 C;  1ZQ3 P;  3K4L A;  2M34 A;  3CDI A;  1VQN I;  1KYW A;  1XGO A;  3ELK A;  1FYM A;  2IRF G;  3JTG A;  1FP1 D;  2RN7 A;  1TTY A;  5F6F A;  3TP0 A;  3LNQ A;  2DA5 A;  1T2K A;  1DP3 A;  1FBS A;  4U7D A;  1K4S A;  4NC6 A;  3K10 A;  1Y39 A;  3ECO A;  4M3D A;  4WXH A;  3P9I A;  1MJA A;  5J4V A;  3P7N A;  4M6X A;  1HST A;  2P6S A;  1Z21 A;  4R79 A;  1XTA A;  2BV6 A;  3IAS 2;  2PG4 A;  1JUP A;  3JAM K;  3LA7 A;  3CMY A;  3PNV A;  4F7Z A;  5LGU A;  5IYD J;  3HZJ A;  1X19 A;  4PK4 A;  3TDU C;  2VQG A;  2ZFU A;  4E7K A;  2CUE A;  3B6A A;  3CUQ B;  2PMU A;  4QIW N;  1T95 A;  2NVU B;  1UAA A;  2EQR A;  1S7E A;  3FWE A;  3OS1 A;  2FSW A;  1UCR A;  4KIC A;  1T0F C;  4HYE A;  2A68 F;  2COB A;  1JT0 A;  4ITV A;  3GEZ A;  3CES A;  4UY8 I;  1IXC A;  4XLE A;  5F0H A;  1BL0 A;  4II3 A;  3J80 Z;  1FLI A;  3OYF A;  3FM3 A;  2V7F A;  2E19 A;  4A93 J;  2HZT A;  4RGR A;  2B7E A;  2JTV A;  1VFC A;  1IXR C;  5LGT A;  3HOW J;  1B6A A;  1QQI A;  3GO5 A;  4M74 A;  3EUH A;  2CYY A;  4BE0 A;  2P8T A;  3C2G A;  1ONV A;  2XRO A;  4I99 C;  1QZY A;  3MEX A;  3CLQ A;  5IT9 Z;  2ME6 A;  2BXY A;  3OR2 C;  4PJM A;  4M3F A;  2MC3 A;  2JA2 A;  4IHV A;  1JTY A;  2LKX A;  2Q0O A;  3S16 J;  1O4X A;  5BQT A;  1R00 A;  2OV7 A;  1WJC A;  2F5E A;  4I01 A;  2CV2 A;  3O3K A;  3GZN B;  2IEK A;  4GCV A;  1WGX A;  3KYD B;  2DMN A;  2NVT J;  2HQ5 A;  5EYR A;  2EBI A;  5D5U B;  1WQ2 A;  5E1W A;  3L7W A;  2X85 A;  3DV8 A;  3RTR A;  1S72 I;  5DUK A;  3FDY A;  4R1H A;  4RM3 A;  2XC7 A;  4LB6 B;  2E34 A;  1BIA A;  4LGW A;  2XRN A;  5FLX K;  2XPW A;  3ZMZ A;  1OCC H;  4LG0 B;  1VQK I;  1UHS A;  3LA2 A;  4JYK A;  2VLA A;  3CC4 I;  1OKR A;  3PUF A;  2WBM A;  1R1U A;  5EGO B;  1T39 A;  4G6Q A;  3BJO A;  2H94 A;  1MNM C;  3WTS C;  3BG5 A;  2KKO A;  2JRT A;  3PNY A;  1S7O A;  1W0U A;  2V79 A;  3DXJ F;  3H5N A;  3VYT B;  2NXN B;  3WGH A;  2CQ7 A;  3CLO A;  2YU9 J;  3S8P A;  1MW7 A;  1WJ5 A;  4YRV A;  2PJR A;  3BTL A;  1BR2 A;  2P0W A;  3KZZ A;  3VFZ A;  2HKX A;  4MEY F;  5J1R A;  3BR0 A;  1KU7 A;  2DK8 A;  3BCB A;  2DFH A;  1RUO A;  2IJL A;  5M5Y J;  1D1A A;  3ZN0 A;  2RQP A;  2H6B A;  3R61 A;  1WJE A;  5EF6 A;  1NTC A;  4CCO A;  1J5Y A;  3FXM A;  2BOL A;  4C3I J;  2R7V A;  4Y17 A;  2EZI A;  2GQQ A;  3VYS B;  4IXA A;  4AVZ A;  2OBP A;  3IV5 A;  2CU7 A;  3H3Z A;  3K9T A;  2XSD C;  5ICG A;  1V5F A;  4PUS A;  5E3L A;  2ZXH A;  5HLI A;  3BCA A;  3T1B A;  4H0E A;  3RDI A;  4JQF A;  5HOD A;  4FTH A;  3MZY A;  2F4O B;  4GYG A;  2M8E A;  4RAZ A;  4XK4 A;  1P4A A;  5H6Q A;  2NS7 A;  3ZMV A;  1DU0 A;  3M1E A;  1RC9 A;  2L3D A;  3GUD A;  3CC2 I;  1BOA A;  3DU5 A;  3JSO A;  2QA4 I;  2L7Z A;  2EZL A;  3EUA A;  3FM5 A;  2CJJ A;  3RYR A;  2LMD A;  4Y13 A;  5HNF A;  1HW2 A;  2K9N A;  1ITY A;  2DMP A;  3SQN A;  1SFK A;  4MQV A;  2EPF A;  3RKX A;  2HPM A;  3NRV A;  4A0Z A;  3MZ8 A;  1OR7 A;  2M7A A;  3M3Y J;  4IF4 A;  2XVC A;  5CPR B;  3S1R J;  2D1H A;  1K6Y A;  3BG6 A;  4XKB A;  3QAH A;  3BTI A;  3E6C C;  1IUF A;  4NQW A;  3GF2 A;  3JTH A;  2EFN A;  1Y0N A;  1OCR H;  5LEK A;  3PNT A;  2V1N A;  5DEQ A;  1T56 A;  4FX4 A;  5LHG A;  2STT A;  2Y48 A;  5DCM A;  4PFP A;  3WGG A;  3GCM A;  3ZR8 X;  2ACJ A;  2OUM A;  4MIM A;  5B66 C;  2GXG A;  3J7Z I;  3BR2 A;  5IP7 J;  2HYG D;  1YOV B;  4J19 A;  1VI0 A;  2R0Q C;  2BW3 B;  2DT7 B;  1IRF A;  4BQN A;  4PJL A;  1BR1 A;  3MVP A;  2PQ8 A;  4RAY A;  4HV5 A;  5B1B H;  2ECC A;  2R7Q A;  4LLN A;  1ETQ A;  2L01 A;  4G8X A;  1Z6R A;  4IHT A;  1H8A C;  2JMW A;  5IP6 A;  2CH0 A;  2LBF A;  4V19 K;  2Y0S N;  3DLL F;  3E1S A;  3I64 A;  3SEQ A;  3I53 A;  3CD6 I;  3BZ6 A;  2FQ4 A;  4P5O A;  4F55 A;  3I0T A;  2L02 A;  1EV7 A;  2D45 A;  2EV0 A;  2ZO4 A;  4IHX A;  2CQN A;  1DGR M;  1X2M A;  6PAX A;  2CW7 A;  4XLF A;  4EGZ A;  5GAG J;  1HBX G;  3FKJ A;  2I10 A;  4YII A;  1QO0 D;  5DCF A;  4KIT B;  4ZYD A;  1R22 A;  2GOM A;  3L2V A;  1AWC A;  4OIN F;  2IBD A;  2MC4 A;  1K83 J;  5L3G A;  2L54 A;  1YJW I;  2EIL H;  1OCT C;  2O9L A;  2Z99 A;  5F0F A;  2X6O A;  3MKZ A;  2FNP A;  4HSR A;  1A36 A;  1LUJ B;  3OS0 A;  1H0M A;  4BL0 B;  4B8X A;  2E1M B;  2BE5 F;  2IA0 A;  3KX2 A;  4G9Y A;  1WVR A;  4EJO A;  4FET A;  1A6I A;  1BM9 A;  2HZD A;  1J75 A;  1F9N A;  1Z67 A;  1BI0 A;  3OIO A;  3KET A;  1DUX C;  4O3M A;  1QNT A;  3CCM I;  1MBK A;  4XOR A;  2ISY A;  4PCQ A;  2R5Z A;  4YFX F;  4A3E J;  3ZQG A;  3CF2 A;  3E97 A;  3EQL F;  1P7I A;  5B3S H;  1XMK A;  4N9I A;  1FP2 A;  2XSJ C;  2VBX A;  4BJ6 C;  4Y52 J;  1X1P A;  1NH3 A;  2UXN A;  3ABM H;  4NB5 A;  4XBF A;  2K02 A;  3IAM 2;  4BKX A;  5FJ8 J;  1BW5 A;  1BJZ A;  1U5T B;  4E70 A;  2R7W A;  1S3J A;  1SEU A;  1YRN A;  2ID3 A;  3I71 A;  2J5P A;  5ILS A;  3DQV C;  2O7O A;  1ZTR A;  3QPL A;  1BW6 A;  3LQR A;  1HOM A;  2AQF A;  3UKG A;  4LJZ F;  2QGU A;  2M1B A;  2KIQ A;  2CS3 A;  4YEL A;  2CO5 A;  1JJ8 C;  2HU9 A;  3D0S A;  4R8H A;  3GYH X;  2KIM A;  1A5J A;  1ZG1 A;  1KA8 A;  4RGU A;  4HNT A;  3Q9V A;  1IXS B;  2MLK A;  3MN2 A;  2QM3 A;  4ESF A;  3HTS B;  1TW3 A;  3CCQ I;  3QPT A;  2A6E F;  4XR6 A;  1HXD A;  1XSV A;  2L9R A;  3SJM A;  1B9M A;  2FBI A;  2M4G A;  3ASN H;  4ABZ A;  1X2N A;  3R60 A;  4ENM A;  2R7Z J;  1EH8 A;  4PDK A;  5GAE J;  3BG7 A;  4LIT A;  2FOK A;  2AHQ A;  1R71 A;  2JWT A;  2PFB A;  2UXX A;  2H6C A;  1Z0X A;  3CC7 I;  1FOY A;  4WCG A;  1ACI A;  3C2B A;  1D0Y A;  1PUF B;  1XGS A;  2JZY A;  1SVL A;  2GIZ A;  1DDN A;  3FF5 A;  1JHF A;  2KIS A;  3TP3 A;  3KIO A;  3FZV A;  3A4C A;  5BMZ A;  3BOQ A;  3RPU A;  1FIA A;  2RKH A;  3L2W A;  2K3F A;  3SZP A;  5FO5 A;  5F08 A;  1ZRF A;  4BQA A;  1N75 A;  4HX8 A;  2XHK A;  2FD5 A;  2WA0 A;  2K9L A;  2IS1 A;  5CLS A;  4BAC A;  1MBJ A;  1RI7 A;  5LEJ A;  1F43 A;  4CH7 A;  3NWS A;  1R1T A;  2YR2 A;  3CJN A;  4C2U A;  3KYC B;  2IS4 A;  5FLX Z;  4IL6 C;  3OYI A;  1UST A;  4BS9 A;  1FOK A;  2HKO A;  5CKT A;  2VJ5 A;  3OSF A;  4FQG A;  4HRI A;  4IEJ A;  2BGC A;  4HLX A;  4Q5S F;  2XB5 A;  3VPR A;  3O6B B;  4G6D A;  3SZT A;  4EVI A;  4HDV A;  1XGN A;  3DPU A;  5BPI A;  1Y6I A;  4HQM A;  1WSU A;  4UXN A;  3QP5 A;  2MH2 A;  4DYQ A;  2DXI A;  1XDU A;  2XUB A;  2B0L A;  1IRZ A;  2K9M A;  2DA4 A;  4OMY A;  3Q0V A;  2LVS A;  2BYV E;  4B09 A;  3H5R A;  5K5Q A;  2FU4 A;  3N05 A;  5C44 J;  3A0H C;  4OAY A;  1YW7 A;  2XAF A;  2PJP A;  4HNU A;  3HPH A;  1FIP A;  3BTC A;  4BEH B;  1UJ8 A;  3RZD J;  4RB2 C;  2F5V A;  3VOE A;  2D1V A;  4HDU A;  3UR3 C;  3LFK A;  1V54 H;  4P9F A;  4E7I A;  2LC2 A;  1XSD A;  3DKW A;  3HGY A;  2OPT A;  3IH2 A;  4XLH A;  3W2V A;  4Y3O A;  3JRC A;  1AOY A;  3A01 B;  3JRA A;  2V9V A;  3JCU C;  1LPQ A;  3S2W A;  4V2G A;  3WTX C;  4GDF A;  4YFK F;  4BHC A;  4CDG A;  1ZHF A;  2X1E A;  1LQ1 A;  2X6X A;  2W7N A;  1OCO H;  2FXA A;  3DKY A;  2XAJ A;  1JXS A;  5GP9 A;  2MLG A;  1VND A;  4CCN A;  4EJV A;  1GV2 A;  2DYR H;  2IGO A;  3LSR A;  1OYI A;  4ZDO A;  2LOO A;  3GFL A;  4XL9 A;  3LQQ A;  1YFH A;  2PMZ A;  1VZ0 A;  2LFB A;  3MKY B;  1K78 B;  2V9P A;  2E5Z A;  2BZT A;  2QBY A;  2EA2 A;  3QYF A;  2WAD A;  3QU6 A;  4NNJ A;  1OR7 C;  1BI2 A;  2MAB A;  4MFD A;  3EYI A;  2MH9 A;  3S1N J;  3VEP A;  4P9U A;  5JI6 A;  2MD5 A;  5BOX A;  2DT6 A;  2YSR A;  5TGT A;  1I6X A;  1T8I A;  1LFB A;  1EH6 A;  1GVD A;  2VE8 A;  4UB8 C;  3G1L A;  1YS7 A;  4F91 B;  5J40 A;  4AU7 A;  1RIO H;  2NYX A;  1Z3X A;  5LD2 C;  2VI6 A;  4L9N A;  5J8C A;  4I2O A;  4CO8 A;  3COA C;  3OOU A;  3QOE A;  3OYC A;  3N4M A;  4C9Y A;  4E7L A;  1PUE E;  3LSI A;  1U6G A;  3VSK A;  2DOF A;  4XOT A;  1YJN I;  2E1N A;  3IC7 A;  3WU0 A;  4GFB A;  1VQ6 I;  3ASO H;  1LDD A;  4KN4 X;  2HTJ A;  3F8F A;  4V2F A;  4I98 B;  3V4G A;  1ZN2 A;  4KMU X;  3H92 A;  2QUF A;  3U1K A;  3ZMS A;  3E6B A;  3F72 A;  4KUM A;  1WH5 A;  2W1O A;  3CJQ B;  3I59 A;  2OZ6 A;  4AM3 A;  4J01 A;  2KHM A;  3EYY A;  2KJB A;  2EZH A;  2LG4 A;  1JGG A;  2L2O A;  5HLG A;  1PP7 U;  2HDC A;  5HS7 A;  3GTG J;  2OF7 A;  1BC8 C;  5KVR A;  4XLA A;  2JA7 J;  2DYS H;  2H27 A;  4ESB A;  1BI1 A;  2R7F A;  5DS9 A;  1ZAO A;  3CMA I;  1I3A A;  3BQY A;  1A04 A;  3RIR A;  2EJR A;  2QZ8 A;  1KYZ A;  5E1X A;  2QVO A;  4EQQ A;  4MTE A;  2PI0 A;  1KU3 A;  1YI2 I;  1KQ9 A;  2QF7 A;  2CRG A;  1TLH B;  4HW0 A;  2ZXI A;  2RC4 A;  3IWF A;  5ED4 A;  3ULQ B;  4KA4 A;  2KFD A;  2X4H A;  4D1Q A;  1CF7 A;  1Y8R B;  2WAQ N;  5CQG A;  5ILU A;  4LFU A;  4UVB A;  3FK6 A;  3K4C A;  4ZC3 A;  4LLG F;  3HOY J;  1WKM A;  2DOA A;  1ZLK A;  2CQX A;  3FMQ A;  4X1E A;  2E7X A;  4DGW B;  3GTP J;  3GTM J;  4ZJZ A;  5IYC J;  4G6T B;  4B3X A;  1JKQ C;  1B72 B;  4KDP A;  2KT0 A;  2YS9 A;  1S8N A;  3FXO A;  2VJJ A;  2W82 A;  5AIP A;  4E6K G;  4PZJ A;  4M3B A;  5LRS A;  3BJ6 A;  5K7F A;  3M8F A;  5LHH A;  3OYB A;  1W36 D;  3HGG A;  1X1D A;  3MWM A;  3PSF A;  1V5E A;  1BN5 A;  2CUJ A;  3DCF A;  2XAU A;  1A35 A;  4IHY A;  4IKF A;  2IS6 A;  4PSW A;  4XRM A;  2DA6 A;  3HOS A;  3WHC A;  3HJE A;  3O8G A;  2LD5 A;  1QVU A;  2BVM A;  4FHT A;  4B1R A;  4M6Y A;  4D7M A;  3F22 A;  2QSG X;  4G7Z F;  5CJ9 A;  2R93 J;  4AVP A;  4A2U A;  2H09 A;  4ZYA A;  4BJ5 C;  1IV6 A;  3KP6 A;  4HPQ A;  4XRF A;  1TT0 A;  3HOX J;  1EH7 A;  3BLY A;  3VB2 A;  1I27 A;  3RPU D;  2GOX B;  1R36 A;  4TV7 A;  4A3K J;  4L9T A;  4XSX F;  3REO A;  4BGD A;  3I54 A;  1U8B A;  3GFJ A;  3K4B A;  2NOG A;  4KNY A;  1OYW A;  3GLL A;  2DT5 A;  3F8B A;  1NK3 P;  4D5F A;  3IHU A;  3LFU A;  3P5J A;  3D5R C;  3I9V 2;  4Q48 A;  2R7O A;  2HPI A;  3HPG A;  4B48 A;  3ZMU A;  3AG3 H;  2L7K A;  1VQ7 I;  2OC6 A;  2R7U A;  5BS6 A;  3ABL H;  3HBL A;  4ZZD A;  4OIR F;  3ZQQ A;  2OTL I;  2M7B A;  1IW7 F;  2FX0 A;  1WH7 A;  2LTP A;  2V6C A;  3WU2 C;  3WOD F;  1ZRD A;  4GGG A;  2IGK A;  5M5X J;  2DDB A;  2R3S A;  5HVQ C;  1U78 A;  1Y1W J;  2KIU A;  1FYK A;  4LB5 A;  2W48 A;  2AXT C;  4KIG A;  2HNH A;  2UUZ A;  3BTJ A;  1ETV A;  1HQC A;  4AUX A;  3BR6 A;  1PVE A;  5D5W B;  2OQG A;  3R0A A;  1MD0 A;  5E3M A;  3DLA A;  3O8H A;  4OIP F;  1WZ2 A;  3WTW C;  2XF6 A;  3KE2 A;  4N0B A;  1W1W E;  2CQQ A;  3GTJ J;  4XIC A;  3PFI A;  1HC8 A;  2ZB9 A;  4WK8 F;  4XNF A;  1I6H J;  2LR8 A;  2MBF A;  1FBU A;  4M73 A;  2R7D A;  5EEH A;  4KIB A;  2WAF A;  1FEX A;  3AL0 C;  3ZMT A;  4L9J A;  1LE8 A;  4JK1 X;  1W7P A;  3WTU C;  3IRR A;  4UB6 C;  1RKW A;  4XLP F;  1OIS A;  2VON A;  1ERD A;  3LAJ A;  3TO6 A;  1VF9 A;  4P1W A;  1IRX A;  3MMY B;  4JX4 A;  1XX5 A;  5FKM A;  2DW4 A;  1AHD P;  1N78 A;  4OIO F;  4CSW A;  3GTL J;  3H35 A;  1ODD A;  2Y9Z A;  3R6S A;  1R5H A;  4LK1 F;  3OYH A;  1R9T J;  1IJW C;  4BY1 J;  3QWL A;  2A5W A;  4XLN F;  3F21 A;  2HQA A;  4I02 A;  3SYT A;  1HF0 A;  5CVU A;  2HI3 A;  3TW7 A;  3ZGK A;  1X3U A;  4I7H A;  4IHW A;  4FIS A;  4A5M A;  5JHU A;  2HXO A;  3ZOB A;  1FMW A;  2JRM A;  4LK0 F;  4QPQ A;  2Q2E B;  5KAI C;  3LWF A;  2M30 A;  3GME A;  2A05 A;  3L00 A;  2EIN H;  1AA7 A;  1WJD A;  2R4G A;  5KCM A;  3HRS A;  2W85 A;  2EZK A;  1IRG A;  4IHS A;  1W4M A;  3U9G A;  4CUG A;  3BZK A;  2KDO A;  1J09 A;  1FOW A;  2FQ3 A;  5IOZ A;  2HXI A;  4FAS D;  4Q47 A;  3FIS A;  2VT2 A;  1ZAR A;  1LVA A;  3LSG A;  5FKO A;  2QSH X;  3ISP A;  1TC3 C;  3IRQ A;  1YG2 A;  1TQI A;  2HDD A;  2X9D A;  2LF7 A;  5E3N A;  3QRF F;  3MAJ A;  4ZH4 F;  4LIV A;  2DAO A;  3PM1 A;  2DFE A;  2VBZ A;  4PJJ A;  3S15 J;  4Y15 A;  3TQN A;  3U1D A;  1XDS A;  1IG7 A;  1N77 A;  4A3C J; 
#chains in the Genus database with same CATH homology
 1X3Z B;  1OQY A;  1QZE A;  4YIR X;  3ESW B;  2QSH X;  2F4O B;  1X3W B;  2QSG X;  2QSF X;  2F4M B;  1PVE A;  1TP4 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...