4IRIA

Auto-inhibited erg ets domain-dna complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Dna binding protein/dna
molecule keywords Transcriptional regulator ERG
publication title Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
pubmed doi rcsb
source organism Homo sapiens
total genus 32
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4iriA00
3WGIA 4IHSA 2X0LA 2EFPA 3TOBA 3F6OA 4XRFA 2OBPA 5E1ZB 3ZMVA 1KA8A 2MH2A 2CSOA 1F5TA 1Y0UA 3WTSC 1G3WA 3U2RA 4MNUA 4KICA 5E1WA 4XLNF 5EEHA 5DCMA 1B6AA 4HQMA 5CLSA 4YG2F 1YQAA 2CG4A 4EJOA 5BOXA 5DDGA 1OYYA 3WTXC 2ESHA 3FX3A 2QM3A 4ZYEA 1O7FA 4RB2C 2ZKZA 1QBJA 5H6QA 4KN4X 3TO6A 4AIHA 5J6XA 4U0VA 3JAMK 5H6RA 3F23A 2UXXA 2AXLA 3J81Z 4L5JA 1U78A 1ZARA 5JFRA 4HBLA 2L54A 5DD4A 2H09A 3BY6A 2JPBA 2MBFA 3E5UA 2OZUA 2DAOA 2EJRA 1XMAA 3V7CA 5FFXA 2M30A 3D5LA 4WWCA 3GVAA 1LDJA 5DCFA 4ESBA 1PUEE 1G3SA 4A6DA 2LDUA 2RKHA 1Z05A 2A61A 5DD8A 1J2XA 4HLXA 1S8NA 3BDDA 2H6CA 3EDPA 2E7XA 1LB2A 1IN7A 4IVNA 2LF8A 4P96A 3TOAA 1AWCA 2KJBA 2HYFA 5ED4A 3WGHA 2KIUA 4ENJA 4OINF 4KIFA 2K27A 2WC2A 1B1BA 3T5XA 2VN2A 3MAJA 4M9XA 1ZYRF 3O6BB 2XIGA 3F6VA 3HUGA 2D1VA 4BAYA 1PDNC 1OPCA 2IVMA 1IN5A 2ZMEB 3K1MA 2GIVA 2GXGA 3NEUA 4Q47A 2FBKA 4NHJA 3CUOA 3LQQA 2NS0A 3L09A 5D4SA 1RNLA 1A04A 1TW3A 5FFZA 1T2KA 2OU2A 3TO7A 2LNBA 4G94A 3FZVA 1G6NA 2XASA 5FO5A 2BV6A 3FXQA 3EYIA 2CFXA 1WSUA 3WE2A 1SD5A 1P92A 4HDUA 3GFJA 4H0EA 3BJOA 3ZN0A 3KE2A 3RDIA 3ERED 4PZJA 2RV8A 1FP1D 2IRFG 2YX4A 4CO8A 3TO9A 2MH9A 3SQNA 4KFCA 5E8GA 3IRRA 4B8XA 4ZH4F 1IW7F 1CF7B 1ZG5A 1V3FA 1F1ZA 3FMSA 3BOQA 5JVTA 2F5FA 5DUIA 4HA8A 4HLYA 4WK8F 3KP5A 5D6FA 4XBFA 3LAJA 2STWA 1ZG1A 1TNTA 2P4WA 5LGUA 1P4AA 3HOTA 2W24A 4U0YA 3V7SA 3SZTA 3E6BA 1LDDA 1BIAA 4M72A 1BI3A 3OV8A 2P7CB 1H0MA 4ZZLA 3R60A 4TV7A 4HF1A 3NRVA 2CYYA 2H94A 3GW2A 4OIPF 4LLLA 3FHZA 4RAZA 1SMYF 1DP7P 3P9CA 4Y15A 5F1RA 4L9TA 3F8FA 2FRHA 4OIQF 3I58A 3L7WA 1LJ9A 1YS6A 2ZNYA 5L3BA 4WXHA 4YFXF 1T39A 4UXNA 3KEOA 1RZ4A 1J5YA 1HW2A 4MGRA 4UVBA 3E5XA 5CVJA 3TQNA 3PFIA 2GA1A 4ENMA 2EFWA 4BHBA 2ELHA 3FMRA 1D8KA 4CYDA 5LHGA 4LD5A 3SXYA 2M1BA 3CTAA 1UB9A 1XDUA 2ZBKA 3DPLC 1YIOA 4YFKF 2Z33A 2JSCA 1TW2A 2EV6A 2PN6A 3F8CA 2NAZA 4OOIA 1FLIA 2W25A 3MWMA 5K1YA 4O5VA 1ZRCA 2V6CA 2Q2EA 3L00A 4EMSA 3J80Z 5E18F 2D2WA 1BI2A 4YIFA 2P7VB 3ZMTA 5TJJA 3O2PE 2P5VA 4AWXB 3QU6A 4EVIA 2O6GE 1BI0A 3LFKA 1MDMA 2HZTA 2ETHA 2FE3A 4M9ZA 1OYWA 1YO5C 2HOEA 4MQVA 4L0YB 1I5ZA 2K86A 4FHTA 5L3DA 4BH9A 3F8NA 2OA4A 4M9SA 4RS8A 5LHHA 4XSXF 1KU2A 1LDKB 4I7HA 4NQWA 5ICCA 3AAFA 1T6SA 4RAYA 5LEKA 4IRGA 1USSA 1W7PA 3JTHA 4LB6B 1B9MA 3WG9A 2VOPA 2F5DA 3F22A 2D45A 2FEZA 2HKXA 1MD0A 1XSDA 3RPUA 4HX7A 3C3WA 2HR3A 3GZ5A 4IRIA 2DQRA 4WX9A 4KA4A 4F7ZA 5AONA 5ILSA 4HDVA 4ENNA 2K7LA 2Q8KA 5DEQA 3M7GA 1BIBA 4I98B 4PGGA 4A5MA 3DP7A 1BBYA 2CWEA 2J5PA 1R5GA 2M45A 4P5OA 4OU0A 4IRHA 1OR7A 4Z2YA 4Q48A 1ZLKA 1J75A 2K4BA 2QENA 4OIOF 2ADUA 2ESNA 2IPQX 3ZMUA 1HKQA 4EGZA 4FT8A 2RGVA 4I0BA 1IXCA 3V8LA 1QO0D 2L4MA 3LAPA 4HX4A 1Z1DA 4ESFA 3CO7C 3I54A 2E1CA 4LG0A 1BN5A 2ISZA 4L0ZB 1HSTA 1FPQA 3Q9VA 4AD9A 2R7DA 4I0AA 2AS5F 2MLKA 4R79A 2QQAA 2R7FA 4XLPF 2BE5F 3EQLF 3RTRA 1SAXA 2DPDA 4KUMA 2PQ8A 4RGRA 3ELKA 2V1UA 3HSFA 5HLHA 4BHPA 2O03A 3Q9SA 3E5QA 1WKMA 2LSOA 4WXDA 5FGMA 1TTYA 1TQMA 1OMIA 2A3SA 2XHKA 3QOPA 2UWMA 2VBYA 1D5VA 3HRTA 2ZO4A 2HQRA 1XGSA 3BP8A 4CXFA 3CDHA 3M9AA 3HHHA 2QBYB 4UUVA 5FLXK 1I27A 2IA0A 3TDUC 4HF0A 4KIBA 3B02A 3K9TA 1QZZA 1QZYA 3ABUA 1U5TB 1R5HA 3K69A 4I09A 1BM9A 2VXZA 2ZMEA 4GCVA 4P55A 1U2WA 2P5KA 4RB1A 4QLCU 5BMZA 5ILUA 1DUXC 1B9NA 4A0YA 5D5VB 4ZYGA 1ODDA 3COAC 2VODA 2O61A 3HIFA 5TRDA 3QRFF 5HDKA 4Q4ZF 3KLOA 3QAHA 1K78B 2W84A 3ISPA 2MD5A 1OYIA 1ZAOA 3BROA 3RKXA 3ABTA 3VFZA 4WF2A 4LG0B 1F9NA 5DV5A 1S7AA 1J59A 2A68F 3RYRA 4M74A 3V4GA 3JSOA 3I4PA 2JT1A 1B59A 3SHFA 1CF7A 1ZRDA 1O3QA 3JW4A 3W6KB 2DPUA 2VE8A 4LMYA 1P6RA 3FWEA 4O3MA 4YIIA 1AOYA 4EJVA 2V1XA 3RPQA 2Z5UA 1XMKA 2W85A 3WTYC 2VC1A 4LK0F 2QZ8A 2OZ6A 1R7JA 1TQPA 2C6YA 1DPUA 3WTZA 3ML6A 4XSZF 2VE9A 4HV6A 3I59B 2Y48A 3KP2A 2GQQA 1L0OC 3KEQA 4MTEA 2HEOA 3CUQB 5IT9K 4GXOA 4EM1A 1FWZA 4N0BA 2DK8A 3QPTA 1XB4A 2COMA 1FYKA 2IW5A 5D5UB 3KZZA 2RDPA 4UV8A 3R61A 3F8MA 3VOEA 1JHFA 2P8TA 5D4RA 4AIKA 1E2XA 2BEOA 2EK5A 4S04A 3I5UA 4LGWA 4O6JA 3K2ZA 5FD6A 2F5CA 2YPRA 3FF5A 2FSWA 4MTDA 2QVOA 2YR2A 3IWZA 1GXQA 1ZHFA 2A07F 5D5WB 3J7AO 1IAWA 4AVPA 2M5WA 3N4MA 1S6LA 2HQNA 4NB5A 1ZREA 4K2EA 1S7OA 1KGSA 3VB2A 2PLYA 2EV5A 4R1HA 4QWQA 3I71A 3T8TA 4U0WA 2F5EA 3KCCA 1ZG3A 5LBQA 1W5SA 1Z9CA 1W4MA 3EYYA 3E97A 2EFQA 2L4AA 2DQLA 3FM5A 3WE3A 3K1NA 1XD7A 4HZFA 1ZGJA 2WV0A 3BZ6A 1RUNA 2FNPA 1I1GA 2PMUA 5A2QK 3NQOA 2ISYA 1MGTA 4JBAA 2EB7A 1ON1A 3WTWC 2EA4A 2W57A 4ON0A 5JI6A 2KKOA 2E1NA 1SFUA 5E20A 1IXRC 5D8KB 1R22A 1IN4A 4HV5A 1U3EM 2HYGD 3WU1B 1WRJA 1PP7U 3H92A 2ZJ2A 1G3TA 5CVIA 5K5QA 2FQ3A 1HSJA 2KRFA 2FOKA 1BI1A 3TDZC 1EH8A 2Z9OA 3QP5A 1IUYA 2CQKA 1UHWA 1P4XA 1FNNA 3ECOA 3IRQA 2DT5A 2MA3A 5ICFA 4G8XA 2J5OA 1O3RA 1OKRA 2PG4A 4I01A 2ACJA 2OD5A 3K0LA 3MQ0A 4G9YA 1LQ1A 4G7ZF 3GFIA 3WTUC 2E7WA 4DQ2A 5E8IA 2QYOA 2H27A 3C1DA 4I2OA 1XGNA 1ON2A 1FYLA 1IXSB 4KYWA 2DK5A 1O57A 5IT3A 2V1DA 4HYEA 2P5LC 2XKPA 2D1HA 1YW9A 1DDNA 2VT3A 5ICEA 1R1VA 5F64A 4PCQA 3HSRA 4KDPA 3RJPA 1QNTA 3RIRA 2RNJA 2BBYA 3GFLA 2XAQA 5ILVA 3IC7A 4L9NA 1G3YA 4M6YA 3ZMZA 4A0ZA 1S29A 4AIJA 2XAGA 2YSRA 1KU3A 1LEAA 2FBHA 1BC7C 2K4JA 3FXRA 4BYYA 1JHHA 3B73A 1EH6A 3G3ZA 2YU3A 2F2EA 3KETA 3K1PA 3PQKA 3T0YA 3U9GA 1MJBA 5BQTA 3GFMA 2XROA 2XVCA 3HSEA 2G7UA 5HLIA 5DUKA 1R58A 2B0LA 2QBYA 3GXOA 3KFWX 3HRUA 4M73A 2UXNA 2QQBA 3U1DA 5E1XA 2VBXA 5L3CA 2NRAC 1JGSA 3R0AA 1IRGA 3OOPA 4P9UA 1YFHA 1U5TA 3VEPA 5HS8A 4L9JA 4EQQA 3GO5A 3T1BA 5LGTA 3M1EA 1XSXA 5AIQA 1R23A 4UHTA 3JAMZ 5LHIA 3EUHA 2RVCA 2VBZA 1KU7A 2HDCA 2G9WA 4HAMA 5LGNA 4GYIA 2A6HF 3GF2A 1KU9A 1FP2A 3MFKA 1T38A 1STZA 5LLQA 3GX4X 3DQVC 2WWYA 1KYWA 1K78A 5ICGA 1HW5A 2BGCA 3G73A 1VTNC 4EJWA 1T98A 2GZWA 1QGPA 2DU9A 3BPVA 4N9IA 1ZRFA 2R3SA 3O3KA 4D0PA 2HKOA 4FX4A 3J80K 3WTTC 4IF4A 4LFUA 4EJTA 3LSTA 1YG2A 1PP8F 2IA2A 4M6XA 4I02A 4BHCA 4GGGA 2STTA 1O3TA 3ROUA 4FX0A 1YYVA 1LEBA 4OMYA 1XN7A 4KNYA 3R0JA 1BC8C 3KP4A 1WWXA 1GVJA 4U7BA 1X3UA 1J0RA 5JHUA 3M8EA 3H3ZA 5D8LB 3I59A 3I0TA 1U6GA 3V7RA 2MLGA 3KZYA 4CICA 5CJ9A 3CUQA 1WQ2A 4BNCA 2FMYA 4U88A 4IJAA 3LQRA 3WU0A 2CGPA 2PJPA 2M87A 3DKWA 2WTEA 2O3FA 2VBWA 2A69F 1UHMA 1T0FA 2PI0A 5KK1A 1LVAA 1J9IA 4LB5A 4IHTA 3CLOA 2V9VA 2P6TA 3E6DA 2H6BA 3D0SA 3QPHA 2XV4S 1TLHB 1XGOA 4M71A 1WI9A 5J8FA 2IA1A 3ZMSA 2ZNZA 3IKTA 1S3JA 1XDSA 4JQFA 2FNAA 4U7DA 5EEGA 4OIRF 4EGYA 1Z6TA 4IPAA 3GEZA 4CZZA 4GO1A 1D3YA 5D6EA 4BXUA 1UCRA 1YW7A 2DTRA 4MEXF 2X4HA 3IL2A 4MQ9F 2MC3A 3DFGA 1P2FA 5A2QZ 4KMFA 2LKPA 1HKSA 2IP2A 1MJ9A 1CGPA 1W5TA 2DW4A 1FC3A 1DPRA 2O0YA 1I6XA 4G6DA 4ZYDA 2FA5A 1ONVA 4Q5SF 1O7LA 2K02A 3GYHX 3L9FA 4RGSA 2FXAA 3L2CA 1L3LA 1Q1HA 1R1UA 3GWZA 3ZQ7A 3V8JA 2O8XA 3BJAA 1FBUA 2EA2A 4G6QA 4P9FA 3DF8A 3I64A 4EM2A 4CHUA 2HGCA 1KQ9A 1U8RA 1RUOA 2CO5A 3LA7A 3IKVA 4EV0A 3DPTA 1XCBA 4ETSA 4L9VA 3ULQB 4HOBA 2BYVE 1H9GA 2A5YB 5CVUA 1TBXA 3F8BA 3P9IA 3F21A 3KP6A 4CGZA 5JR3A 1FT9A 5BPDA 2GWRA 4RB0A 1ZN2A 5DCMB 5HOOA 4LLNA 3ZPLA 2DI3A 4UVCA 3WODF 4RGUA 1RIOH 3KP7A 4E70A 4UVAA 2Z99A 2JRTA 3REOA 1IN8A 4ENKA 5LRRA 3PQJA 3DXJF 3FM3A 4KIGA 2XKOA 5K5OA 3DEUA 1K7AA 1YS7A 4ZYHA 4A0XA 4N9HA 3JSPA 2Z3YA 1HXDA 3ZP5A 1I1SA 2EWNA 5HS9A 1ZH5A 2IT0A 2ZXJA 1B4AA 2UZKA 2QQ9A 3C18A 4EJUA 4L5IA 2RQPA 1HQCA 3HHGA 4G7HF 4UNOA 4PDKA 4BQAA 3LWFA 3J81K 5E17F 4S05A 1FSHA 5J8CA 2NYXA 2LF7A 4A6EA 2HWVA 3BPXA 4HX8A 2OAZA 1J7KA 2PFBA 3I53A 2VONA 2XUBA 3TKYA 1KQ0A 3BJ6A 1U5TC 1UFMA 5FD5A 4ESJA 1SD4A 4R8HA 3RI4A 4PGHA 2KIMA 2RN7A 3RYPA 2VOOA 5LEJA 1YTYA 3MZYA 4LK1F 3P7NA 4A2UA 1ULYA 5H20A 3R6SA 1Z6RA 3MZHA 4HF2A 3T8RA 3QU3A 5CVRA 1SFEA 1K6OA 2EFNA 4MHGA 2EFOA 3FMQA 3N97A 1QPMA 3M8FA 2IJLA 2OQGA 2XGXA 3ZN1A 2FMLA 5CVVA 5BPIA 3F3XA 4A12A 3HYIA 3LA3A 4A5NA 3WTVC 1D8JA 4KMUX 4GYGA 1H9TA 1GXPA 5K5RA 3Q5FA 3CO6C 3R4KA 2GAUA 2VC0A 1FYMA 4KN7X 1IZ1A 2M8EA 4WCGA 3V8KA 3E3VA 4RB3C 2XAHA 4CDGA 3WGGA 4EM0B 1SFXA 1F4KA 3TGNA 2HFHA 1FSEA 5DYMA 5AIPA 1TNSA 1E17A 2TDXA 1FBQA 5L3FA 2DBBA 1KYZA 2Q0OA 2KIFA 2HTSA 3CUQC 4WXCA 1ZGAA 1QQIA 1IRFA 5HDNA 2RC4A 3C7JA 2L01A 2JTVA 2G7HA 4B09A 1JXSA 3FXUA 1R36A 1GHCA 2A6EF 4Y17A 3MEXA 3KLNA 2XAJA 5CYVA 1Z7UA 1ZLJA 2DO7A 3GUDA 2FF4A 2GA2A 2CW0F 2KJCA 1FBSA 5HLGA 1SD7A 2Y75A 5HVQC 5D5XB 4YFNF 1XGMA 1XSVA 1MJAA 5L3GA 1SMTA 1RI7A 2OQRA 1FZPB 1BJAA 3LA2A 3SZPA 1FY7A 2PEXA 3HOSA 3BWGA 4ZZDA 1V4RA 3HTUA 2NNNA 3H3UA 1FOKA 2VT2A 5FLXZ 1YW8A 3F72A 1USTA 2JPCA 1HW1A 4MEYF 4KT5C 2L02A 4ASNA 1BOAA 3E6CC 5F6FA 1IN6A 1R1TA 2JZYA 2ZFWA 2XRNA 3KP3A 3RKWA 2YX7A 1EV7A 2QUFA 2FU4A 4OMZA 5ERIA 3HRSA 4L18B 1C0WA 2DFIA 5L3EA 3EETA 2DLLA 3SFZA 4RGXA 2Y0MA 5HDGA 2NNYA 1NHAA 1O3SA 3S2WA 2ZCWA 1P4WA 1Z91A 1HKTA 1R00A 5BS6A 3IHUA 2PMHA 2FBIA 1IF1A 4G7OF 3CJNA 1HBXG 3E6MA 5LRSA 1G4DA 1TQIA 3P9KA 2XAFA 3QP6A 2HS5A 3GZ6A 2EV0A 4UV9A 1EH7A 3GLXA 3JTGA 3ECHA 1KQ8A 5HS7A 3MCZA 3DV8A 3IWFA 1MZBA 1W7PD 4JK1X 3RKYA 3VODA 2GXBA 1MDMB 2PBIA 2QWWA 1SD6A 6PAXA 4HW0A 3W6JB 4LLGF 2V79A 2HTJA 3HTSB 3HRMA 1YLFA 4DNCA 5IT9Z 1JE8A 2QLZA 1FX7A 1REPC 4LJZF 1K79A 2L3DA 5FB2A 1MKMA 2P6SA 5KVRA 3ZMDA 4HQEA 1LNWA 1XCVA 4Y13A 1W7PB 4IXAA
chains in the Genus database with same CATH superfamily
1SVMA 2VXDA 3WGIA 2FOWA 2R7RA 4IHSA 5IP9J 1TWHJ 2X0LA 2EFPA 3TOBA 5LD2C 3F6OA 3K2AA 3KX2A 2VJ4A 4XRFA 2OBPA 5E1ZB 3ZMVA 3HG9A 1KA8A 3JREA 5JLXA 2KMUA 2MH2A 2CSOA 3Q0VA 1F5TA 3LSPA 3K4MA 2L9RA 1Y0UA 3WTSC 3CESA 3V42A 1XC5A 3DTEA 1G3WA 2M8GX 2B7EA 3U2RA 1QPIA 4MNUA 4KICA 5E1WA 4XLNF 2ICWG 5EEHA 5DCMA 2DA4A 1Y8QB 1B6AA 4HQMA 5CLSA 2VJIA 3OYBA 2ZXWH 1X4OA 4YG2F 1YQAA 3UR3C 4BE2A 2CG4A 3PNVA 1MSFC 2R5ZA 4HEA2 4EJOA 5BOXA 5DDGA 2XPWA 1OYYA 3WTXC 2IAIA 2QA4I 2H8RA 3HZJA 2ESHA 3FX3A 3RSNA 2VIXA 4IHVA 5KCMA 1SC7A 1VQ8I 1H89C 2QM3A 4ZYEA 2BXYA 1HOMA 1W36D 1O7FA 3K4BA 4M6VA 4RB2C 3GMEA 4CCOA 4FCYA 1D1BA 2ZKZA 1QBJA 4XIDA 2YS9A 4KN4X 2V26A 5H6QA 3TO6A 2DMUA 4AIHA 4A3FJ 5J6XA 1VFCA 4JP0A 3CC4I 3TEDA 4U0VA 3JAMK 2O8KA 5H6RA 3F23A 1SEUA 3G1LA 2UXXA 2AXLA 3J81Z 4L5JA 1U78A 1ZARA 5IYBJ 3CC7I 1TWFJ 2CJJA 4A3DJ 5JFRA 3BC8A 1JKPC 1VI0A 4HBLA 2L54A 5DD4A 2M3AA 2H09A 3BY6A 2JPBA 2MBFA 3DCFA 3E5UA 4PSXA 2OZUA 4B47A 2DAOA 2EJRA 4BE1A 1X3ZB 1SAUA 1XMAA 3V7CA 5FFXA 3M1CA 2B9SA 2M30A 3D5LA 2Y9ZA 4WWCA 3GVAA 1LDJA 1S5LC 4L5EA 2XDVA 3A1YA 1D0YA 5DCFA 4ESBA 3VYRB 1PUEE 2O5RA 3ZRGA 4X1EA 1G3SA 1NG6A 2V9PA 4A6DA 2XGCA 3IV5A 2LDUA 2RKHA 2V4JC 2COBA 3H9JA 1TT0A 2BHYA 1Z05A 2A61A 5DD8A 2GOXB 1J2XA 4HLXA 1S8NA 3BDDA 3OYHA 1AU7A 2H6CA 2OJED 3CF5F 1DP3A 3EDPA 3PO3J 2E7XA 5DTDA 5EGOA 3LNQA 1RKWA 2ZJQF 4ZDPA 4XL9A 1LB2A 1BR4A 3HOWJ 3EPZA 1IN7A 3OSFA 2IBDA 1LUJB 4IVNA 3HL2A 3L2QA 5M5WJ 2LF8A 2F4OB 4P96A 3TOAA 1A6QA 1AWCA 2KJBA 2HYFA 2R7XA 5ED4A 3WGHA 5H2FC 1YOVB 2WADA 1LE8A 3OYCA 2PJRB 2KIUA 4ENJA 2ZB9A 4OINF 2DXIA 4KIFA 3RKQA 3F9KA 2K27A 2WC2A 4NBQA 1B1BA 1Z3XA 5GP9A 3T5XA 2VN2A 3MAJA 5FKOA 4BJ6C 4M9XA 1ETQA 1ZYRF 3O6BB 1IV8A 2XIGA 3F6VA 3FKIJ 3HUGA 3LOCA 2D1VA 3FDYA 4BACA 2DA7A 4BAYA 1OPCA 1PDNC 3BQYA 3LL7A 2BY3A 2IVMA 1IN5A 1IUFA 2ME0A 2JUCA 3LSHA 1SVLA 2BXZA 2BW3A 2ZMEB 4PJMA 3K1MA 2GIVA 2GXGA 3NEUA 5K7HA 1MMNA 4Q47A 3ZQHA 2FBKA 2IGOA 3NAUA 4NHJA 1MW7A 2ID3A 3CUOA 4OAZA 2LREA 3LQQA 2R92J 2NS0A 3L09A 5D4SA 1F43A 1RNLA 1A04A 4Y33A 4ABZA 2YU9J 1TW3A 4BQQA 5FFZA 1T2KA 2OU2A 3TO7A 2LNBA 1QU3A 4G94A 3FZVA 4HSRA 2KDOA 3U1KA 2EILH 3MN2A 3IP4B 1G6NA 2XASA 3PUBA 3SYTA 5FO5A 1ZR2A 5C4JJ 2BV6A 3FXQA 1YRNA 3EYIA 2CFXA 4V2GA 2E1MB 1WSUA 3WE2A 5FKMA 3CCUI 1SD5A 1P92A 4HDUA 3GFJA 4H0EA 2G0EA 3BJOA 3ZN0A 3KE2A 3RDIA 2E36A 2X6WA 4EATA 1YJWI 1QVTA 3ERED 4PZJA 5B1BH 3CMMA 2RV8A 4CCKA 1P7IA 1FP1D 2IRFG 2YX4A 3HJEA 2MD0A 3TO9A 2QGUA 4CO8A 2W82A 1BA5A 2MH9A 3SQNA 1EJ9A 4KFCA 4UUTA 3OYKA 4C3JJ 5E8GA 3IRRA 3I55I 4B8XA 4ZH4F 3MVPA 4IQ4A 2W4SA 1IW7F 1VQ7I 1CF7B 1ZG5A 1VZ0A 1V3FA 1ZELA 1H8AC 3KZIC 1F1ZA 2KT0A 3FMSA 3BOQA 5JVTA 3I4NJ 2F5FA 2K9SA 3DKXA 5DUIA 4HA8A 4HLYA 2A5WA 4AIDA 3Q0UA 4WK8F 1Z7LA 3KP5A 5D6FA 3ZQGA 4XBFA 2LY9A 4CYCA 3LAJA 2STWA 1ZG1A 1TNTA 2P4WA 4C3HJ 1P4AA 5LGUA 3HOTA 2W24A 3DWLE 1S9HA 2JA8J 3JRFA 2LD5A 4U0YA 3CDIA 3V7SA 2MABA 3SZTA 1K6YA 3E6BA 3CF2A 2XGEA 2DDBA 2JA7J 1LDDA 1BIAA 4M72A 3ZCOA 1BI3A 1MMAA 3OV8A 4MO7A 4F52A 1VQ9I 2P7CB 1OJLA 1H0MA 3HM5A 4ZZLA 3R60A 4TV7A 4HF1A 3NRVA 2CYYA 2H94A 3GW2A 3OYAA 4OIPF 4LLLA 3WU2C 3FHZA 4RAZA 1YI2I 2OCEA 2BZTA 3CCYA 4IL6C 2MYSA 1I3QJ 1IRXA 1SMYF 1DP7P 2DA1A 3HOVJ 3P9CA 5IYCJ 4Y15A 5F1RA 5CKTA 3JRAA 4L9TA 3F8FA 2FRHA 4DZJA 3FXOA 3PIPF 5FLMJ 3I58A 3L7WA 2HVRA 1LJ9A 4OIQF 1YS6A 2ZNYA 5CQEA 4WXHA 5L3BA 3GTMJ 2LC2A 1VQNI 4YFXF 1T39A 4UXNA 3KEOA 1RZ4A 1FIAA 3ZR8X 1J5YA 1HW2A 3TL4X 4MGRA 4UVBA 1RPWA 5M3FJ 1SANA 3E5XA 5CVJA 2IS6A 3TQNA 2ZXHA 3PFIA 4KJZA 4NDLA 2GA1A 1W36C 3BG7A 4ENMA 2EFWA 1R4NB 4AUXA 5M3MJ 4BHBA 2ELHA 4E7JA 5B5EC 3FMRA 1D8KA 4CYDA 5LHGA 4LD5A 2LBFA 3SXYA 2M1BA 3VPRA 3IAM2 3CTAA 1UB9A 2VQCA 1XDUA 1UG0A 2BOLA 1YIOA 2ZBKA 3DPLC 3HB9A 1YX5A 4XQFA 3MKWB 1OCTC 2R7ZJ 2XPUA 2HVQA 1U9NA 4YFKF 3OYFA 2Z33A 4RMNA 1JGGA 2JSCA 1TW2A 2EV6A 2PN6A 3FIWA 1XS9A 5GADJ 3MKLA 3F8CA 2CV0A 4UUSA 2NAZA 4OOIA 1GDTA 4V19K 1FLIA 1T0FC 4PJNA 2H1KA 2W25A 3MWMA 3OS1A 5K1YA 1PUFB 4O5VA 1W5CC 2NS8A 1ZRCA 2V6CA 1T33A 2Q2EA 3L00A 4EMSA 3J80Z 2P0WA 1ZK8A 1JI8A 3G6EI 3K10A 5E18F 1KZHA 2WB1A 1QHHD 2D2WA 1JUPA 1BI2A 4YIFA 1TWGJ 2P7VB 3ZMTA 5TJJA 5EYRA 3VSLA 3O2PE 1TT5B 3OYLA 3GLLA 2F48A 2P5VA 4AWXB 3QU6A 2JWTA 3A03A 1M1EB 4EVIA 4AYBN 1X1DA 9ANTA 4IOCF 2L7MP 2O6GE 1BI0A 3LFKA 1MDMA 2HZTA 3C2BA 4M3FA 2ETHA 3PUFA 1P7JA 1FOYA 2FE3A 4M9ZA 3D5SC 1OYWA 1LFPA 1ERDA 1YO5C 2HOEA 5FROA 5HNFA 4MQVA 2XPVA 4L0YB 2ECCA 1I5ZA 2K86A 1R9TJ 4FHTA 5L3DA 1NK2P 1BL0A 4BH9A 3PL8A 4YRVA 3F8NA 2OA4A 1ACIA 4OWRB 2M9HA 4M9SA 4RS8A 3OOUA 4M3EA 5LHHA 2WAQA 3DPUA 4YIRX 4XSXF 1OQYA 1KU2A 1LDKB 4I7HA 4NQWA 4BL0B 5ICCA 3AAFA 1T6SA 3I4MJ 5EDNA 3CCLI 1RESA 4B3XA 2DA5A 2HU9A 4RAYA 3TP3A 3GTLJ 2AQEA 5LEKA 1YJNI 1OCRH 1MBGA 4IRGA 1USSA 4BU2A 2AQFA 1GV2A 1RR8C 5DM6F 1W7PA 3JTHA 2VKHA 4LB6B 1B9MA 3WG9A 2VOPA 2F5DA 3F22A 2D45A 4W97A 3HPHA 1MBEA 3W6VA 2FEZA 2HKXA 1MD0A 4JOMA 4RA2A 1XSDA 2E60A 3RPUA 4HX7A 3MKZA 3C3WA 2MG4A 2HR3A 3GZ5A 3M4OJ 1R49A 4B44A 2L5QA 3LFUA 1Y1WJ 4IRIA 2DQRA 2WAFA 4WX9A 4KA4A 2VKVA 1Z3YA 3UNGC 2FD5A 4F7ZA 5AONA 5F0FA 2E71A 1IDYA 1N75A 1U0JA 2DDAA 5ILSA 2LKXA 4ZTJA 4HDVA 4C2UA 3S15J 3AG3H 2R7TA 3NARA 2R7WA 2GXAA 3K4LA 2VQHA 4FE7A 4ENNA 3C2GA 3O8HA 3JRDA 1X2NA 2LK2A 2K7LA 2K5CA 2Q8KA 5DEQA 3M7GA 4IHYA 4BXFA 3DU6A 4F91B 4I6ZA 1G59A 1PJRA 3FBNB 2NVYJ 1A36A 1E3OC 2L9SA 1BIBA 1BOBA 4I98B 3FXKA 4PGGA 2DFEA 4A5MA 3DP7A 4ZJZA 4DYCA 2AXTC 1BBYA 2CWEA 2J5PA 2L9VA 1A5JA 1R5GA 3S3OA 1WJFA 2AHQA 2M45A 4P5OA 4OU0A 2JK3A 1E3PA 2L9NA 4IRHA 4DOZA 1OR7A 4Z2YA 3B6AA 3AG4H 1LFBA 2HI3A 4Q48A 1ZLKA 1J75A 4X0GA 2K4BA 2QENA 2JQ7A 4LIUA 4OIOF 2ADUA 2ESNA 3ONQA 4M3GA 1RKTA 2HQAA 2IPQX 3ZMUA 1WJCA 1HKQA 3JRBA 4EGZA 4FT8A 4CH7A 2RGVA 4I0BA 1IXCA 2LVSA 3ERMA 3V8LA 1F36A 3I3LA 4FE4A 3S17J 1QO0D 2FUG2 1D1AA 2L4MA 3RPUD 3LAPA 4HX4A 2XGDA 3CP2A 1Z1DA 3KIOA 4ESFA 3CO7C 1HC8A 4F92B 3I54A 2VI6A 2E1CA 1MSEC 2FQ4A 2KRHA 3BCAA 5JVGF 4LG0A 1JT6A 1B72A 1BN5A 2ISZA 4L0ZB 1HSTA 5FLVA 1FPQA 3CQZJ 2BY0A 3Q9VA 4AD9A 3H9GA 3CC2I 2R7DA 4I0AA 2AS5F 2MLKA 2EPFA 4R79A 2QQAA 4F3QA 2R7FA 4XLPF 3DLLF 5FKKA 3BZCA 2Y2ZA 4NC7A 3GZNB 2BE5F 3EQLF 5B1AH 5FRNA 4MIMA 3NWSA 3RTRA 1SAXA 2XC7A 1X1CA 5E3LA 3NWTA 2DPDA 4KUMA 2PQ8A 4RGRA 3OL4A 2X9DA 2XRLA 2EZHA 3ELKA 3LSMA 2V1UA 3RZOJ 2K85A 3HSFA 4A3GJ 1NH3A 5HLHA 2ZSIB 2BVLA 1WH7A 4BHPA 3H3VK 2O03A 1MBJA 3Q9SA 3E5QA 1WKMA 2LSOA 3F0CA 4WXDA 5FGMA 2PJRA 1TTYA 2F6CA 1TQMA 1OMIA 2A3SA 2XHKA 3QOPA 5EF6A 2UWMA 2VBYA 4UY8I 4BBSJ 2CQ7A 1D5VA 2VUMJ 3HRTA 2ZO4A 2HQRA 1XGSA 3BP8A 4CXFA 3SFIA 3CDHA 3M9AA 3HHHA 2OF7A 2QBYB 4UUVA 5FLXK 1I27A 2E2IJ 3SZGA 2IA0A 3TDUC 4HNTA 1WZ2A 4HF0A 4KIBA 2PX9A 3B02A 3K9TA 4BE0A 1QZZA 3KEYA 3L1PA 1QZYA 3ABUA 1JTYA 1U5TB 2DTZA 3KYDB 1R5HA 4QPOA 5K7ZA 3K69A 4I09A 1BM9A 2VXZA 2ZMEA 4GCVA 1W1WE 1U2WA 4P55A 4Y4RA 4RDUA 5C4XJ 2IGNA 4IEJA 5J3LA 5GAHJ 1DGWY 2P5KA 4RB1A 4QLCU 5BMZA 3AFHA 4XR6A 2IXSA 4YEJA 5ILUA 1DUXC 3FXJA 1B9NA 2R4GA 3JRHA 4A0YA 5D5VB 4ZYGA 1ODDA 3CZ6A 3COAC 2VODA 3KYCB 3A01B 1QZEA 2VLAA 3H5AA 2X1EA 2O61A 3HIFA 5TRDA 5EJCA 3QRFF 1LFUP 5HDKA 4Q4ZF 3KLOA 3QAHA 2DOEA 1K78B 1DU0A 2W84A 3ISPA 2MD5A 2W7NA 3BR0A 1OYIA 3BQZA 1MH3A 1ZAOA 3BROA 3HPGA 3ZQIA 3RKXA 2CUEA 3DTIA 3HXLA 2QQ8A 3ABTA 3OYEA 3VFZA 3HDDA 4WF2A 3MZ8A 4LG0B 1F9NA 3RQIA 5B66C 5DV5A 1B72B 1S7AA 4NC8A 5GTIC 1J59A 2A68F 3RYRA 4M74A 3V4GA 3EUKL 3JSOA 3IH4A 3I4PA 1MMDA 2JT1A 1B59A 5JHFA 3PSFA 5C44J 2UV1A 4IZZA 2DMPA 3IH3A 3SHFA 1YITI 1CF7A 1ZRDA 1O3QA 3W3CA 3JW4A 1X2MA 3W6KB 2VE8A 4A69C 2DPUA 4LMYA 1P6RA 3FWEA 4O3MA 3CJQB 4YIIA 1AOYA 1WGXA 2LH9A 4EJVA 2V1XA 3RPQA 1TZLA 2Z5UA 4J01A 1XMKA 2GBYA 2W85A 3WTYC 4II2A 2VC1A 4LK0F 2QZ8A 2OZ6A 1R7JA 1TQPA 3CMAI 2C6YA 1DPUA 3WTZA 4J00A 3ML6A 3QOEA 4XOTA 2LFBA 5F1JA 4XSZF 3G71I 1WI3A 3AG1H 3TBIA 2VE9A 4HV6A 3I59B 4DYRA 2Y48A 4N4NB 2LLKA 3KP2A 3OR2C 4C30A 2GQQA 1L0OC 3KEQA 4MTEA 4E7LA 3OYDA 4G6TB 2HEOA 3CUQB 4YELA 5IT9K 4GXOA 4EM1A 3L2UA 2V7FA 1FWZA 4N0BA 2DK8A 3QPTA 1XB4A 2COMA 3S2HJ 1FYKA 2IW5A 2Z1DA 2ME6A 5D5UB 1UAAA 3S3MA 1WHUA 3KZZA 4E7SA 4BGDA 2V1NA 2DYRH 2RDPA 1WPKA 2CW8A 1UZCA 4UV8A 3OY9A 4GDFA 3R61A 3F8MA 3VOEA 1JHFA 4B43A 3OIPA 2P8TA 2HDWA 5D4RA 2XSDC 1I39A 4AIKA 1K61A 1E2XA 1WFXA 4HSTA 4RAGA 2BEOA 2EK5A 1XTAA 4S04A 1V5EA 3I5UA 4LGWA 4BJ5C 1IG7A 4O6JA 3K2ZA 5FD6A 2F5CA 4B48A 2LRDA 4RM2A 5DM7F 2N8GA 1X1AA 2YPRA 3FF5A 2FSWA 1WJ5A 4MTDA 3L2VA 2A05A 2QVOA 2YR2A 3IWZA 1IV6A 1GXQA 1ZHFA 1AKHB 2A07F 1V5FA 5D5WB 3J7AO 3E1SA 1IAWA 4AVPA 2M5WA 1NK3P 3N4MA 4BS9A 1S6LA 2HQNA 4NB5A 4C9YA 3ASOH 3LSGA 3AL0B 3PJRA 1ZREA 3JRGA 4K2EA 1S7OA 1KGSA 3SDGA 2JSPA 3VB2A 2PLYA 1KONA 2EV5A 4R1HA 4QWQA 2V6EA 3I71A 3T8TA 4U0WA 2R7SA 2F5EA 3KCCA 2QKLB 5F0CA 1ZG3A 3BR6A 5LBQA 1W5SA 1Z9CA 3ZXSA 2EH3A 1IO2A 3D1NI 1EA3A 3LSJA 4OAYA 5DS9A 1W4MA 3EYYA 3P5JA 3TW6A 3E97A 1MH4A 1ITYA 3QYFA 1WCMJ 2Y0SA 4M3BA 2EFQA 4BKXA 1JUSA 2L4AA 2DQLA 3IUOA 3FM5A 3BR2A 3K1NA 3WE3A 1PUFA 3ABMH 1XD7A 4HZFA 1ZGJA 1BR2A 2WV0A 3BZ6A 2VL8A 5EEAA 1Y0NA 1RUNA 3PNTA 3H1CA 2Y30A 2WB1N 2FNPA 1I1GA 2CUJA 2PMUA 5A2QK 3ABLH 3NQOA 4RM3A 4ZYAA 2ISYA 1MGTA 2K3FA 4JBAA 2HYJA 5KAIC 2CUZA 4JX4A 3OYJA 1S72I 1XX5A 2EB7A 1ON1A 3WTWC 2EA4A 1JJ8C 2OPTA 2W57A 4ON0A 3HOYJ 5JI6A 2KKOA 2E1NA 4ITVA 4MFDA 1IJWC 3OYGA 1SFUA 2HDDA 1N78A 1G2HA 4CZCA 2HPMA 2H8WA 1VF9A 2DT6A 5E20A 1OR7C 4KITB 4H4KC 1IXRC 3ESWB 4A3JJ 5D8KB 3L2RA 1R22A 1IN4A 1YE9A 3GTKJ 2X48A 4HV5A 4XLFA 1U3EM 2EZKA 3BCBA 2HYGD 4DIQA 2E35A 4D1QA 3IAS2 2WAQN 1WRJA 3WU1B 1PP7U 3H92A 4FTHA 2UUZA 3S2DJ 2LOOA 2ZJ2A 3BTIA 1G3TA 3QQAA 4I99C 5CVIA 2FQ3A 5K5QA 1QVUA 1HSJA 2KRFA 2QSHX 3OYNA 3JRCA 4FQGA 2FOKA 3Q0WA 1BI1A 3TDZC 1EH8A 2JJ7A 3S8PA 2Z9OA 3QP5A 1IUYA 2CQKA 4AU7A 3DBRB 1UHWA 1P4XA 2NVQJ 1FNNA 3ECOA 3IRQA 2DT5A 3G4SI 1J09A 2MA3A 3BLYA 1LVKA 5ICFA 4G8XA 2CUFA 2J5OA 2HNHA 1BJZA 1O3RA 1OKRA 5JLWA 4PJJA 1YJ9I 1Z21A 2PG4A 4NUBA 5LFAA 2F5VA 2VKEA 4I01A 1YHQI 5IP7J 2ACJA 1MNEA 2OD5A 3K0LA 3MQ0A 4G9YA 3FXMA 5B3SH 4G7ZF 1LQ1A 3I9V2 3GFIA 3GTJJ 3WTUC 2QSGX 5F08A 2E7WA 4DQ2A 2CH0A 5E8IA 5KAFC 1VQ4I 2QYOA 2L7FP 2H27A 4QPQA 4DW6A 3C1DA 2ELJA 3B6CA 4ZDLA 4I2OA 1XGNA 1ON2A 4IO9F 1FYLA 3TMOA 1IXSB 1PVEA 4KYWA 1A31A 1D0ZA 2DK5A 3OYMA 3RQ4A 1O57A 4BQNA 5IT3A 1ETXA 2VJJA 5BNGA 2DA6A 4EEFG 2V1DA 1HF0A 4HYEA 2P5LC 1UHSA 2E5ZA 1ETOA 4B4CA 1RR7A 2JVHA 2XKPA 1VQOI 2D1HA 1YW9A 2EZLA 1DDNA 1X58A 3OYIA 2VT3A 5ICEA 2ZMEC 1R1VA 2DT7B 1FMVA 5F64A 4PCQA 3HSRA 1MNMC 1JKRC 2Q1ZB 4KDPA 3RJPA 3HOXJ 1QNTA 3SEZA 3RIRA 2L0KA 2RNJA 4CCJA 2KPMA 3OMYA 2BBYA 2RREA 3GFLA 2XAQA 5ILVA 3IC7A 2GIZA 4L9NA 2ECBA 3A0HC 1G3YA 4PSWA 1TL8A 4M6YA 3ZMZA 2DFHA 4A0ZA 4Y52J 1S29A 4P1WA 1AHDP 4AIJA 2XAGA 5J1UA 1H88C 3KPHA 4ZDOA 2E1MC 2E34A 2YSRA 3A02A 3CCRI 1KU3A 1LEAA 2FBHA 3BG6A 4CSWA 1DU6A 2X85A 1BC7C 1E0EA 2NS7A 2K4JA 3FXRA 2LY1A 1O4XA 4BYYA 1JHHA 2HXOA 3B73A 1T8IA 3S16J 1EH6A 3G3ZA 4CCNA 2YU3A 3BTCA 2F2EA 4E4HA 3KETA 4XLCA 2GM4A 2TRTA 1X4PA 3K1PA 4X6AJ 4XN3A 3W2VA 1A35A 1Y39A 2I5UA 3PQKA 2MGQA 3T0YA 3U9GA 3S1RJ 1QA6A 1I3AA 1MJBA 3H9QA 5BQTA 3GFMA 2XROA 2XVCA 3HC7A 1FMWA 2CW7A 1XG1A 1V5GA 4I76A 3HSEA 4LOCA 5EZGA 2O7OA 4IOAF 4UB8C 4Z6YA 2G7UA 5HLIA 5DUKA 1R58A 1OCOH 2B0LA 2QBYA 3GXOA 3KFWX 1Z67A 3HRUA 4JX6A 4PK4A 4M73A 2UXNA 2QQBA 3U1DA 5GPCA 5E1XA 1RRJA 1Y8RB 4IHXA 1X1BA 2JRMA 3GTGJ 2VBXA 5L3CA 2JVGA 2WBMA 2NRAC 1JGSA 1MMGA 1ZR4A 3R0AA 4HNVA 4GFBA 1IRGA 2K9NA 3OOPA 3BG9A 4A3MJ 4P9UA 1YFHA 1GVDA 1U5TA 2CQQA 1A6IA 3VEPA 4NNJA 5HS8A 2JA6J 4L9JA 4EQQA 3GCMA 3GO5A 3T1BA 1R5ID 3M1EA 1XSXA 5AIQA 5LGTA 3HOUJ 1R23A 3FHNA 1FTTA 4UHTA 3JAMZ 2DJIA 5LHIA 4RLQA 1POGA 3EUHA 4HPQA 2RVCA 2EIJH 2VBZA 1KU7A 2HDCA 2Y9YA 2G9WA 3H5RA 4HAMA 5LGNA 1YX3A 1W0TA 3A01A 4GYIA 2A6HF 3GF2A 1KU9A 1FP2A 3MFKA 2M4KA 1T38A 1STZA 5LLQA 5FKLA 3GX4X 1OCCH 2QEXI 3DQVC 2WWYA 1KYWA 5EG0B 2ZC2A 1K78A 5ICGA 5IPAA 1HW5A 3BG3A 2VKDA 2BGCA 3G73A 1VTNC 3HKZA 1T98A 3MD2A 4EJWA 5E79C 4BJTA 2GZWA 2DOAA 3DTKA 1QGPA 2DU9A 3BPVA 4N9IA 2KZVA 1ZRFA 3ZOBA 3H35A 4PJ0C 3VWBA 2R3SA 4FISA 3VSKA 3O3KA 4D0PA 2HKOA 2CQXA 4FX4A 3BT9A 3J80K 3WTTC 4DGWB 5IY5H 3OS2A 4IF4A 4LFUA 4EJTA 5E3MA 2VPLA 3LSTA 1HLVA 1YG2A 1PP8F 2IA2A 2GOMA 2X51A 4M6XA 4I02A 2IGKA 2VQLA 3BR1A 4BHCA 4GGGA 3QYBA 2STTA 4N4OB 1BW5A 1HDPA 4B3AA 3DBHB 3SJMA 1O3TA 3K4JA 3ROUA 4FX0A 2BVMA 5HLTA 5HNHA 1JT0A 1DQUA 1YYVA 3CD6I 1LEBA 4PJLA 4OMYA 1XN7A 2OV7A 2Y31A 1RETA 4KNYA 3R0JA 1BC8C 3KP4A 3DBLB 1WWXA 3W2WA 1GVJA 2BY2A 1ETWA 4U7BA 1X3UA 3HGYA 1J0RA 5JHUA 3M8EA 1SFOJ 2TCTA 3OWTA 3H3ZA 5D8LB 1RC9A 4BDYA 1MMSA 3I59A 3I0TA 1U6GA 3V7RA 1SFKA 4DJAA 2MLGA 1Y1VJ 2W1OA 3KZYA 4CICA 5CJ9A 3CUQA 3QPSA 1WQ2A 4B1RA 2WY7Q 4BNCA 2HOTA 1MBKA 2FMYA 4U88A 3CLQA 3LQRA 4IJAA 3CP8A 1BW6A 4XLAA 3GTPJ 3WU0A 1B8IB 2CGPA 2PJPA 3FXLA 3O8GA 5GAGJ 2M87A 3DKWA 2K9MA 2O3FA 2R7QA 2WTEA 3S32A 2E2JJ 2VBWA 1UMQA 1K4TA 2PMZA 3HEFA 2A69F 1UHMA 2OCCH 1T0FA 2AO9A 2QSFX 4GRIA 5F04A 2PI0A 5TISC 3I56I 2QF7A 5KK1A 1DGRM 1UG2A 1LVAA 1X1PA 4HG2A 1J9IA 5CQGA 2R5YB 4CA0A 2Z16A 4LB5A 3OSGA 4IHTA 2VQGA 3CLOA 5CPRB 1ZGWA 4C2TA 2EINH 1U8BA 2V9VA 3K70D 3WHCA 2P6TA 2Y69H 3E6DA 2DA2A 2H6BA 3D0SA 4XNFA 5GAEJ 3QPHA 2XV4S 1TLHB 3H36A 1XGOA 4XLHA 2ZXIA 4M71A 1WI9A 4A93J 2IS2A 5J8FA 3LSKA 1AKHA 2IA1A 3ZMSA 2ZNZA 3IKTA 1S3JA 1XDSA 4JQFA 4D7NA 2FNAA 4U7DA 5EEGA 4F93B 4OIRF 3BR3A 3QYEA 4EGYA 1Z6TA 4IPAA 3CCJI 3GEZA 2M34A 2WA0A 4CZZA 1N25A 4GO1A 1D3YA 2JUGA 5D6EA 4W1UA 4BXUA 2ELKA 1VQLI 2CV1A 1UCRA 1YW7A 1X3WB 2DTRA 4MEXF 2HQ5A 4XLEA 2DJNA 2X4HA 3S14J 1R6RA 1WH5A 3IL2A 3MMYB 4MQ9F 4IQJA 5FJ8J 2MC3A 1OLTA 2M0CA 3DFGA 1P2FA 2OUMA 1Q1VA 5A2QZ 4KMFA 3S1NJ 2LKPA 1HKSA 4BY7J 2IP2A 2WV1A 1MJ9A 2X6XA 1CGPA 2Y0SN 4AM3A 1W5TA 1Y56A 2DW4A 4II3A 1FC3A 2QCOA 1U9OA 1DPRA 1VQPI 2O0YA 2X1DA 3CMEI 2DFFA 2V9KA 1I6XA 3E0JB 4G6DA 3U21A 1G8XA 4ZYDA 3J7ZI 3ZQCA 2FA5A 2I8DA 5FRMA 3RZDJ 1ONVA 4Q5SF 1EKEA 1XPXA 1O7LA 3LMMA 2K02A 1HDDC 4HNUA 3K4KA 3GYHX 3L9FA 3TW7A 2WAEA 4RGSA 4ZTFA 2DMNA 5J4VA 2FXAA 2KHMA 3L2CA 1FOWA 4BUPA 4RBOA 1L3LA 3JRIA 1Q1HA 4ZC3A 1FOXA 2EZIA 4E7ZA 1VQ6I 2KZGA 1R1UA 3GWZA 3ZQ7A 3V8JA 2HOSA 2O8XA 2QKMB 3BJAA 1FBUA 2EA2A 4G6QA 4P9FA 4G12A 2GLOA 3DF8A 1GUUA 3I64A 1ZTRA 4EM2A 4CHUA 2HGCA 1KQ9A 4A3LJ 3A4CA 1U8RA 1RUOA 3E7LA 3QODA 2CO5A 3LA7A 5FKNA 3PIOF 1K83J 3IKVA 4CUGA 3OS0A 2K3PA 1ZKGA 2HOAA 3DPTA 4EV0A 2CMPA 1XCBA 4ETSA 3K6GA 4L9VA 3ULQB 2DOFA 1ZQ3P 1TWCJ 1CQTA 4HOBA 3J7YJ 2BYVE 2X1CA 1H9GA 2A5YB 2RNGA 2XB5A 5CVUA 1TBXA 3F8BA 4BEHA 3P9IA 3F21A 3KP6A 4CGZA 2YUSA 4F55A 2K40A 1ETYA 4BDZA 3H5NA 1JUMA 4PUSA 5JR3A 4IX7A 2A6TA 1FT9A 3PFYA 5BPDA 1AA7A 2GWRA 4RB0A 3SDBA 1ZN2A 2VB6A 4U87A 5DCMB 5HOOA 4LLNA 3ZPLA 2DI3A 4UVCA 3WODF 4RGUA 4JYKA 3PO2J 4DZPA 1RIOH 3KP7A 1PYVA 2OC6A 4E70A 1UJ8A 2DN0A 4UVAA 3FKJA 2IS4A 2Z99A 2JRTA 1TP4A 2R5ZB 3REOA 1IN8A 4ENKA 4XRMA 5LRRA 3PQJA 2M4GA 4XK4A 4E7HA 3DXJF 3FM3A 4KIGA 2WY8Q 2VJ5A 2XKOA 5K5OA 3DEWA 1FEXA 3DEUA 1K7AA 1YS7A 2DMTA 1X19A 4XKCA 4ZYHA 2LTPA 5M5YJ 1YIJI 3M8JA 3OIOA 4A0XA 4N9HA 3VYUB 3JSPA 2Z3YA 3TP0A 1HXDA 3ZP5A 1I1SA 3VYSB 1WJDA 2JN6A 2XAUA 2EWNA 5HS9A 1JKQC 2D5VA 2ZXJA 4CCLA 2IT0A 1ZH5A 1B4AA 3CCEI 1Y6IA 4A3IJ 2CU7A 2FJ1A 2UZKA 2QQ9A 3C18A 1OCPA 2HVSA 3A2KA 4EJUA 4L5IA 1GT0C 2ZSHB 2DODA 2RQPA 1HQCA 3HHGA 4G7HF 4UNOA 1MBHA 1T08B 4PDKA 3A0BC 3FISA 3PNYA 1R4MB 1FIPA 1Z77A 3ZQQA 1Z0XA 4BQAA 2LYCA 3LWFA 3S1QJ 3J81K 1BR1A 5E17F 5HODA 4S05A 1FSHA 5J8CA 2LY2A 4MFEA 2NYXA 2IGMA 3ZGKA 1ETKA 2LF7A 1VQ5I 2LR8A 4A6EA 1GV5A 2NXNB 1NG7A 4QTRA 2E19A 2XF6A 2HWVA 3BPXA 3HBLA 4HX8A 1LPQA 4DBQA 2KP6A 1J7KA 2OAZA 2PFBA 3I53A 2VONA 2XUBA 2XF5A 3TKYA 1D1CA 1KQ0A 3KYLA 2RAEA 3BJ6A 1U5TC 4Y3OA 2IEKA 2NVTJ 2R93J 1UFMA 5FD5A 4RAFA 1JTXA 3C2HA 5EGOB 2RQQA 3CJTB 4ESJA 1SD4A 2ZJPF 4R8HA 3RI4A 1WJBA 1VNDA 4PGHA 3CJRB 4M3DA 3VYTB 3EUHC 2HXIA 2KIMA 2RN7A 3RYPA 2VOOA 2KFDA 5LEJA 3K7AJ 1YTYA 4C3IJ 3PM1A 3JCUC 2R0QC 2LMDA 3MZYA 5KHDA 1LE8B 4LK1F 4J19A 3P7NA 4A2UA 1R71A 1ULYA 2DYSH 5H20A 4QIWN 1MNDA 3R6SA 1Z6RA 4AC0A 2MC4A 2M7AA 4E7KA 2B63J 3MZHA 4HF2A 3T8RA 3QU3A 5CVRA 4BEHB 1SFEA 1K6OA 2EFNA 4MLOA 4NC6A 4MHGA 2EFOA 3FMQA 1S7EA 1JKOC 3GBGA 1LKXA 3N97A 1QPMA 3M8FA 2L7KA 2DCEA 5GPAA 2NVXJ 3DEEA 3HUGB 3K4NA 1HCRA 1VQMI 2CV2A 3GTQJ 2K9QA 4C2MJ 2E2HJ 5IP6A 2IJLA 2OQGA 2XGXA 1VQKI 3ZN1A 3K70C 2KIQA 3CCMI 2FMLA 5CVVA 5J1YA 5BPIA 2ID6A 3F3XA 4A12A 3CMYA 2IS1A 2JA2A 4PFOA 3HOZJ 3HYIA 4A3KJ 3LA3A 4A5NA 3BR5A 3WTVC 1D8JA 4KMUX 4GYGA 1H9TA 3OIQA 2BW3B 1GXPA 5K5RA 3Q5FA 3LSRA 4Y7NJ 4D9JA 3CO6C 3R4KA 3FK7A 2EBIA 1K4SA 2GAUA 2VC0A 3FBIB 1MIJA 1FYMA 4RLFA 2HPIA 4KN7X 4XRSG 1IZ1A 2M8EA 4XM3A 4WCGA 5KNLA 3QWLA 3DLAA 3E3VA 4V2FA 3V8KA 2P81A 2E1OA 2L2OA 1D0XA 4RB3C 2XAHA 4CDGA 3WGGA 2KLOA 4EM0B 1FTZA 4IKFA 1SFXA 1F4KA 3LSIA 4E7IA 3TGNA 2HFHA 2XSJC 1FSEA 1YRNB 5DYMA 5AIPA 1TNSA 4XN0A 4A3BJ 4QSHA 1OFCX 2TDXA 1E17A 1FBQA 1GLNA 2JMWA 2ZJRF 5L3FA 2DBBA 1KYZA 2Q0OA 2OTLI 2BY1A 4BXXJ 2KIFA 2Z2SB 2MSYA 4CCMA 2HTSA 3CUQC 4WXCA 4D5CA 1ZGAA 1QQIA 2L7ZA 1IRFA 5HDNA 2RC4A 2VPRA 2KL4A 2L01A 3C7JA 2EQRA 2JTVA 2G7HA 4XKVA 4B09A 3AKZA 1D5YA 4D7MA 1JXSA 3FXUA 2ZFUA 1R36A 1GHCA 2A6EF 4Y17A 4ANJA 2NOJB 2M2EA 3G1OA 1ENHA 4D5FA 3MEXA 3KLNA 1APLC 5J47A 5EG0A 2XAJA 5CYVA 2I10A 1Z7UA 1ZLJA 3J7AY 3PSIA 4A3EJ 2DO7A 4XKBA 5C3EJ 4BBRJ 2E5NA 3X2QH 3GUDA 3MKYB 4LG3A 3HKZN 3AG2H 2FF4A 3CDLA 2GA2A 1QHGA 2CW0F 4XONA 1V55H 3N05A 1SVOA 4CYCB 2CRGA 1I6HJ 2KJCA 1IGNA 1FBSA 2K9LA 5K7FA 5E3NA 1QRYA 5HLGA 2EIMH 1SD7A 4XICA 2Y75A 5HVQC 5J1RA 5D5XB 4YFNF 5EZHA 2M7BA 1XGMA 1XSVA 1MJAA 3L2WA 3AL0C 3M3YJ 5L3GA 1SMTA 1RI7A 2OQRA 2HZDA 2KQRA 3OL3A 1FZPB 1BJAA 3LA2A 3M07A 3SZPA 1FY7A 2PEXA 3HOSA 1ETVA 3BWGA 4ZZDA 4A3CJ 3DU5A 1V4RA 4BY1J 3HTUA 4XOPA 1N77A 3Q3SA 1I50J 2R7VA 2NNNA 4IHWA 2CS3A 3H0GJ 4AVZA 2MW8A 3H3UA 3VDXA 3CCQI 2VT2A 1FOKA 1V54H 3RCOA 2XB0X 5FLXZ 1YW8A 3F72A 1USTA 4UB6C 2JPCA 1HW1A 4S0HB 1OISA 1TWAJ 4MEYF 4KT5C 3WG7H 2L02A 4ASNA 5J4YA 1BOAA 2DMQA 4DBRA 3E6CC 1IC8A 2O9LA 5F27A 5F6FA 1IN6A 4FASD 1WJAA 1R1TA 1B8IA 2JZYA 2DA3A 3W2AA 2ZFWA 2XRNA 3KP3A 2W48A 4E6KG 3RKWA 2YX7A 1EV7A 2QUFA 2FU4A 4OMZA 5ERIA 1OCZH 3HRSA 4L18B 1C0WA 2DFIA 3IH2A 2PMZN 3WHBA 5L3EA 3EETA 2DLLA 3SFZA 3CCVI 4RGXA 2Y0MA 5TGTA 2NVUB 5HDGA 2NNYA 1NHAA 2F4MB 2M0MA 3G2BA 3ZQLA 2R5YA 4XRSA 1O3SA 5F0HA 3S2WA 4LITA 2ZCWA 4XORA 3D5RC 2LBFB 1P4WA 3FK6A 3S93A 1Z91A 1HKTA 1WJEA 2VASA 1R00A 5BS6A 3S3NA 2X6YA 3IHUA 2PMHA 2W00A 3EUAA 1EF4A 2FBIA 1IF1A 3H0DA 2FX0A 3BTLA 2KRCA 1NTCA 4G7OF 1IRZA 3K4CA 1TC3C 4UUSB 2LKSA 3CJNA 2JA5J 3OR1C 2CQNA 1JJ6C 1UELB 1IDZA 3CCSI 2LG4A 4KT6A 1HBXG 3E6MA 4JX5A 5LRSA 1G4DA 2KDZA 2Q2EB 5E3OA 4XMYA 1W0UA 1TQIA 3P9KA 2XAFA 3QP6A 2HS5A 3GZ6A 3SEQA 2EV0A 4UV9A 3ABKH 1EH7A 3GLXA 3HGGA 2F4IA 3JTGA 5M5XJ 2XF7A 3ECHA 3DKYA 1KQ8A 2BHZA 5HS7A 3MCZA 4PFPA 4AYBA 3DV8A 3IWFA 2R7OA 1MZBA 2OTJI 3GTOJ 5GTHC 1W7PD 4BQOA 4JK1X 3RKYA 3VODA 1HA8A 2GXBA 1MDMB 2PBIA 2QWWA 2R7UA 4XKWA 1FJLA 1SD6A 2MFZA 3JR9A 6PAXA 4HW0A 3UKGA 3W6JB 2H1LA 3BTJA 1P9QC 4LLGF 2NOGA 2V79A 5IOYA 2HTJA 4KISA 3HTSB 3HRMA 1ORKA 1YLFA 1MBFA 2X6OA 4DNCA 1T95A 1WVRA 1T56A 5IT9Z 1JE8A 3BG5A 2QLZA 5IOZA 1FX7A 2EIKH 3QPLA 4LJZF 1REPC 3ASNH 3ZQFA 3S1MJ 5IYDJ 1K79A 4NQWB 5J40A 2L3DA 4FETA 4LIVA 5FB2A 3BZKA 4HRIA 1MKMA 2P6SA 5KVRA 3ZMDA 2CFOA 4HQEA 1LNWA 1XMXA 1XCVA 3G1MA 4Y13A 2KISA 1E3HA 1W7PB 4DYQA 2LP0A 4IXAA
chains in the Genus database with same CATH topology
3WGIA 4IHSA 2X0LA 2EFPA 3TOBA 3F6OA 4XRFA 2OBPA 5E1ZB 3ZMVA 1KA8A 2MH2A 2CSOA 1F5TA 1Y0UA 3WTSC 1G3WA 3U2RA 4MNUA 4KICA 5E1WA 4XLNF 5EEHA 5DCMA 1B6AA 4HQMA 5CLSA 4YG2F 1YQAA 2CG4A 4EJOA 5BOXA 5DDGA 1OYYA 3WTXC 2ESHA 3FX3A 2QM3A 4ZYEA 1O7FA 4RB2C 2ZKZA 1QBJA 5H6QA 4KN4X 3TO6A 4AIHA 5J6XA 4U0VA 3JAMK 5H6RA 3F23A 2UXXA 2AXLA 3J81Z 4L5JA 1U78A 1ZARA 5JFRA 4HBLA 2L54A 5DD4A 2H09A 3BY6A 2JPBA 2MBFA 3E5UA 2OZUA 2DAOA 2EJRA 1XMAA 3V7CA 5FFXA 2M30A 3D5LA 4WWCA 3GVAA 1LDJA 5DCFA 4ESBA 1PUEE 1G3SA 4A6DA 2LDUA 2RKHA 1Z05A 2A61A 5DD8A 1J2XA 4HLXA 1S8NA 3BDDA 2H6CA 3EDPA 2E7XA 1LB2A 1IN7A 4IVNA 2LF8A 4P96A 3TOAA 1AWCA 2KJBA 2HYFA 5ED4A 3WGHA 2KIUA 4ENJA 4OINF 4KIFA 2K27A 2WC2A 1B1BA 3T5XA 2VN2A 3MAJA 4M9XA 1ZYRF 3O6BB 2XIGA 3F6VA 3HUGA 2D1VA 4BAYA 1PDNC 1OPCA 2IVMA 1IN5A 2ZMEB 3K1MA 2GIVA 2GXGA 3NEUA 4Q47A 2FBKA 4NHJA 3CUOA 3LQQA 2NS0A 3L09A 5D4SA 1RNLA 1A04A 1TW3A 5FFZA 1T2KA 2OU2A 3TO7A 2LNBA 4G94A 3FZVA 1G6NA 2XASA 5FO5A 2BV6A 3FXQA 3EYIA 2CFXA 1WSUA 3WE2A 1SD5A 1P92A 4HDUA 3GFJA 4H0EA 3BJOA 3ZN0A 3KE2A 3RDIA 3ERED 4PZJA 2RV8A 1FP1D 2IRFG 2YX4A 4CO8A 3TO9A 2MH9A 3SQNA 4KFCA 5E8GA 3IRRA 4B8XA 4ZH4F 1IW7F 1CF7B 1ZG5A 1V3FA 1F1ZA 3FMSA 3BOQA 5JVTA 2F5FA 5DUIA 4HA8A 4HLYA 4WK8F 3KP5A 5D6FA 4XBFA 3LAJA 2STWA 1ZG1A 1TNTA 2P4WA 5LGUA 1P4AA 3HOTA 2W24A 4U0YA 3V7SA 3SZTA 3E6BA 1LDDA 1BIAA 4M72A 1BI3A 3OV8A 2P7CB 1H0MA 4ZZLA 3R60A 4TV7A 4HF1A 3NRVA 2CYYA 2H94A 3GW2A 4OIPF 4LLLA 3FHZA 4RAZA 1SMYF 1DP7P 3P9CA 4Y15A 5F1RA 4L9TA 3F8FA 2FRHA 4OIQF 3I58A 3L7WA 1LJ9A 1YS6A 2ZNYA 5L3BA 4WXHA 4YFXF 1T39A 4UXNA 3KEOA 1RZ4A 1J5YA 1HW2A 4MGRA 4UVBA 3E5XA 5CVJA 3TQNA 3PFIA 2GA1A 4ENMA 2EFWA 4BHBA 2ELHA 3FMRA 1D8KA 4CYDA 5LHGA 4LD5A 3SXYA 2M1BA 3CTAA 1UB9A 1XDUA 2ZBKA 3DPLC 1YIOA 4YFKF 2Z33A 2JSCA 1TW2A 2EV6A 2PN6A 3F8CA 2NAZA 4OOIA 1FLIA 2W25A 3MWMA 5K1YA 4O5VA 1ZRCA 2V6CA 2Q2EA 3L00A 4EMSA 3J80Z 5E18F 2D2WA 1BI2A 4YIFA 2P7VB 3ZMTA 5TJJA 3O2PE 2P5VA 4AWXB 3QU6A 4EVIA 2O6GE 1BI0A 3LFKA 1MDMA 2HZTA 2ETHA 2FE3A 4M9ZA 1OYWA 1YO5C 2HOEA 4MQVA 4L0YB 1I5ZA 2K86A 4FHTA 5L3DA 4BH9A 3F8NA 2OA4A 4M9SA 4RS8A 5LHHA 4XSXF 1KU2A 1LDKB 4I7HA 4NQWA 5ICCA 3AAFA 1T6SA 4RAYA 5LEKA 4IRGA 1USSA 1W7PA 3JTHA 4LB6B 1B9MA 3WG9A 2VOPA 2F5DA 3F22A 2D45A 2FEZA 2HKXA 1MD0A 1XSDA 3RPUA 4HX7A 3C3WA 2HR3A 3GZ5A 4IRIA 2DQRA 4WX9A 4KA4A 4F7ZA 5AONA 5ILSA 4HDVA 4ENNA 2K7LA 2Q8KA 5DEQA 3M7GA 1BIBA 4I98B 4PGGA 4A5MA 3DP7A 1BBYA 2CWEA 2J5PA 1R5GA 2M45A 4P5OA 4OU0A 4IRHA 1OR7A 4Z2YA 4Q48A 1ZLKA 1J75A 2K4BA 2QENA 4OIOF 2ADUA 2ESNA 2IPQX 3ZMUA 1HKQA 4EGZA 4FT8A 2RGVA 4I0BA 1IXCA 3V8LA 1QO0D 2L4MA 3LAPA 4HX4A 1Z1DA 4ESFA 3CO7C 3I54A 2E1CA 4LG0A 1BN5A 2ISZA 4L0ZB 1HSTA 1FPQA 3Q9VA 4AD9A 2R7DA 4I0AA 2AS5F 2MLKA 4R79A 2QQAA 2R7FA 4XLPF 2BE5F 3EQLF 3RTRA 1SAXA 2DPDA 4KUMA 2PQ8A 4RGRA 3ELKA 2V1UA 3HSFA 5HLHA 4BHPA 2O03A 3Q9SA 3E5QA 1WKMA 2LSOA 4WXDA 5FGMA 1TTYA 1TQMA 1OMIA 2A3SA 2XHKA 3QOPA 2UWMA 2VBYA 1D5VA 3HRTA 2ZO4A 2HQRA 1XGSA 3BP8A 4CXFA 3CDHA 3M9AA 3HHHA 2QBYB 4UUVA 5FLXK 1I27A 2IA0A 3TDUC 4HF0A 4KIBA 3B02A 3K9TA 1QZZA 1QZYA 3ABUA 1U5TB 1R5HA 3K69A 4I09A 1BM9A 2VXZA 2ZMEA 4GCVA 4P55A 1U2WA 2P5KA 4RB1A 4QLCU 5BMZA 5ILUA 1DUXC 1B9NA 4A0YA 5D5VB 4ZYGA 1ODDA 3COAC 2VODA 2O61A 3HIFA 5TRDA 3QRFF 5HDKA 4Q4ZF 3KLOA 3QAHA 1K78B 2W84A 3ISPA 2MD5A 1OYIA 1ZAOA 3BROA 3RKXA 3ABTA 3VFZA 4WF2A 4LG0B 1F9NA 5DV5A 1S7AA 1J59A 2A68F 3RYRA 4M74A 3V4GA 3JSOA 3I4PA 2JT1A 1B59A 3SHFA 1CF7A 1ZRDA 1O3QA 3JW4A 3W6KB 2DPUA 2VE8A 4LMYA 1P6RA 3FWEA 4O3MA 4YIIA 1AOYA 4EJVA 2V1XA 3RPQA 2Z5UA 1XMKA 2W85A 3WTYC 2VC1A 4LK0F 2QZ8A 2OZ6A 1R7JA 1TQPA 2C6YA 1DPUA 3WTZA 3ML6A 4XSZF 2VE9A 4HV6A 3I59B 2Y48A 3KP2A 2GQQA 1L0OC 3KEQA 4MTEA 2HEOA 3CUQB 5IT9K 4GXOA 4EM1A 1FWZA 4N0BA 2DK8A 3QPTA 1XB4A 2COMA 1FYKA 2IW5A 5D5UB 3KZZA 2RDPA 4UV8A 3R61A 3F8MA 3VOEA 1JHFA 2P8TA 5D4RA 4AIKA 1E2XA 2BEOA 2EK5A 4S04A 3I5UA 4LGWA 4O6JA 3K2ZA 5FD6A 2F5CA 2YPRA 3FF5A 2FSWA 4MTDA 2QVOA 2YR2A 3IWZA 1GXQA 1ZHFA 2A07F 5D5WB 3J7AO 1IAWA 4AVPA 2M5WA 3N4MA 1S6LA 2HQNA 4NB5A 1ZREA 4K2EA 1S7OA 1KGSA 3VB2A 2PLYA 2EV5A 4R1HA 4QWQA 3I71A 3T8TA 4U0WA 2F5EA 3KCCA 1ZG3A 5LBQA 1W5SA 1Z9CA 1W4MA 3EYYA 3E97A 2EFQA 2L4AA 2DQLA 3FM5A 3WE3A 3K1NA 1XD7A 4HZFA 1ZGJA 2WV0A 3BZ6A 1RUNA 2FNPA 1I1GA 2PMUA 5A2QK 3NQOA 2ISYA 1MGTA 4JBAA 2EB7A 1ON1A 3WTWC 2EA4A 2W57A 4ON0A 5JI6A 2KKOA 2E1NA 1SFUA 5E20A 1IXRC 5D8KB 1R22A 1IN4A 4HV5A 1U3EM 2HYGD 3WU1B 1WRJA 1PP7U 3H92A 2ZJ2A 1G3TA 5CVIA 5K5QA 2FQ3A 1HSJA 2KRFA 2FOKA 1BI1A 3TDZC 1EH8A 2Z9OA 3QP5A 1IUYA 2CQKA 1UHWA 1P4XA 1FNNA 3ECOA 3IRQA 2DT5A 2MA3A 5ICFA 4G8XA 2J5OA 1O3RA 1OKRA 2PG4A 4I01A 2ACJA 2OD5A 3K0LA 3MQ0A 4G9YA 1LQ1A 4G7ZF 3GFIA 3WTUC 2E7WA 4DQ2A 5E8IA 2QYOA 2H27A 3C1DA 4I2OA 1XGNA 1ON2A 1FYLA 1IXSB 4KYWA 2DK5A 1O57A 5IT3A 2V1DA 4HYEA 2P5LC 2XKPA 2D1HA 1YW9A 1DDNA 2VT3A 5ICEA 1R1VA 5F64A 4PCQA 3HSRA 4KDPA 3RJPA 1QNTA 3RIRA 2RNJA 2BBYA 3GFLA 2XAQA 5ILVA 3IC7A 4L9NA 1G3YA 4M6YA 3ZMZA 4A0ZA 1S29A 4AIJA 2XAGA 2YSRA 1KU3A 1LEAA 2FBHA 1BC7C 2K4JA 3FXRA 4BYYA 1JHHA 3B73A 1EH6A 3G3ZA 2YU3A 2F2EA 3KETA 3K1PA 3PQKA 3T0YA 3U9GA 1MJBA 5BQTA 3GFMA 2XROA 2XVCA 3HSEA 2G7UA 5HLIA 5DUKA 1R58A 2B0LA 2QBYA 3GXOA 3KFWX 3HRUA 4M73A 2UXNA 2QQBA 3U1DA 5E1XA 2VBXA 5L3CA 2NRAC 1JGSA 3R0AA 1IRGA 3OOPA 4P9UA 1YFHA 1U5TA 3VEPA 5HS8A 4L9JA 4EQQA 3GO5A 3T1BA 5LGTA 3M1EA 1XSXA 5AIQA 1R23A 4UHTA 3JAMZ 5LHIA 3EUHA 2RVCA 2VBZA 1KU7A 2HDCA 2G9WA 4HAMA 5LGNA 4GYIA 2A6HF 3GF2A 1KU9A 1FP2A 3MFKA 1T38A 1STZA 5LLQA 3GX4X 3DQVC 2WWYA 1KYWA 1K78A 5ICGA 1HW5A 2BGCA 3G73A 1VTNC 4EJWA 1T98A 2GZWA 1QGPA 2DU9A 3BPVA 4N9IA 1ZRFA 2R3SA 3O3KA 4D0PA 2HKOA 4FX4A 3J80K 3WTTC 4IF4A 4LFUA 4EJTA 3LSTA 1YG2A 1PP8F 2IA2A 4M6XA 4I02A 4BHCA 4GGGA 2STTA 1O3TA 3ROUA 4FX0A 1YYVA 1LEBA 4OMYA 1XN7A 4KNYA 3R0JA 1BC8C 3KP4A 1WWXA 1GVJA 4U7BA 1X3UA 1J0RA 5JHUA 3M8EA 3H3ZA 5D8LB 3I59A 3I0TA 1U6GA 3V7RA 2MLGA 3KZYA 4CICA 5CJ9A 3CUQA 1WQ2A 4BNCA 2FMYA 4U88A 4IJAA 3LQRA 3WU0A 2CGPA 2PJPA 2M87A 3DKWA 2WTEA 2O3FA 2VBWA 2A69F 1UHMA 1T0FA 2PI0A 5KK1A 1LVAA 1J9IA 4LB5A 4IHTA 3CLOA 2V9VA 2P6TA 3E6DA 2H6BA 3D0SA 3QPHA 2XV4S 1TLHB 1XGOA 4M71A 1WI9A 5J8FA 2IA1A 3ZMSA 2ZNZA 3IKTA 1S3JA 1XDSA 4JQFA 2FNAA 4U7DA 5EEGA 4OIRF 4EGYA 1Z6TA 4IPAA 3GEZA 4CZZA 4GO1A 1D3YA 5D6EA 4BXUA 1UCRA 1YW7A 2DTRA 4MEXF 2X4HA 3IL2A 4MQ9F 2MC3A 3DFGA 1P2FA 5A2QZ 4KMFA 2LKPA 1HKSA 2IP2A 1MJ9A 1CGPA 1W5TA 2DW4A 1FC3A 1DPRA 2O0YA 1I6XA 4G6DA 4ZYDA 2FA5A 1ONVA 4Q5SF 1O7LA 2K02A 3GYHX 3L9FA 4RGSA 2FXAA 3L2CA 1L3LA 1Q1HA 1R1UA 3GWZA 3ZQ7A 3V8JA 2O8XA 3BJAA 1FBUA 2EA2A 4G6QA 4P9FA 3DF8A 3I64A 4EM2A 4CHUA 2HGCA 1KQ9A 1U8RA 1RUOA 2CO5A 3LA7A 3IKVA 4EV0A 3DPTA 1XCBA 4ETSA 4L9VA 3ULQB 4HOBA 2BYVE 1H9GA 2A5YB 5CVUA 1TBXA 3F8BA 3P9IA 3F21A 3KP6A 4CGZA 5JR3A 1FT9A 5BPDA 2GWRA 4RB0A 1ZN2A 5DCMB 5HOOA 4LLNA 3ZPLA 2DI3A 4UVCA 3WODF 4RGUA 1RIOH 3KP7A 4E70A 4UVAA 2Z99A 2JRTA 3REOA 1IN8A 4ENKA 5LRRA 3PQJA 3DXJF 3FM3A 4KIGA 2XKOA 5K5OA 3DEUA 1K7AA 1YS7A 4ZYHA 4A0XA 4N9HA 3JSPA 2Z3YA 1HXDA 3ZP5A 1I1SA 2EWNA 5HS9A 1ZH5A 2IT0A 2ZXJA 1B4AA 2UZKA 2QQ9A 3C18A 4EJUA 4L5IA 2RQPA 1HQCA 3HHGA 4G7HF 4UNOA 4PDKA 4BQAA 3LWFA 3J81K 5E17F 4S05A 1FSHA 5J8CA 2NYXA 2LF7A 4A6EA 2HWVA 3BPXA 4HX8A 2OAZA 1J7KA 2PFBA 3I53A 2VONA 2XUBA 3TKYA 1KQ0A 3BJ6A 1U5TC 1UFMA 5FD5A 4ESJA 1SD4A 4R8HA 3RI4A 4PGHA 2KIMA 2RN7A 3RYPA 2VOOA 5LEJA 1YTYA 3MZYA 4LK1F 3P7NA 4A2UA 1ULYA 5H20A 3R6SA 1Z6RA 3MZHA 4HF2A 3T8RA 3QU3A 5CVRA 1SFEA 1K6OA 2EFNA 4MHGA 2EFOA 3FMQA 3N97A 1QPMA 3M8FA 2IJLA 2OQGA 2XGXA 3ZN1A 2FMLA 5CVVA 5BPIA 3F3XA 4A12A 3HYIA 3LA3A 4A5NA 3WTVC 1D8JA 4KMUX 4GYGA 1H9TA 1GXPA 5K5RA 3Q5FA 3CO6C 3R4KA 2GAUA 2VC0A 1FYMA 4KN7X 1IZ1A 2M8EA 4WCGA 3V8KA 3E3VA 4RB3C 2XAHA 4CDGA 3WGGA 4EM0B 1SFXA 1F4KA 3TGNA 2HFHA 1FSEA 5DYMA 5AIPA 1TNSA 1E17A 2TDXA 1FBQA 5L3FA 2DBBA 1KYZA 2Q0OA 2KIFA 2HTSA 3CUQC 4WXCA 1ZGAA 1QQIA 1IRFA 5HDNA 2RC4A 3C7JA 2L01A 2JTVA 2G7HA 4B09A 1JXSA 3FXUA 1R36A 1GHCA 2A6EF 4Y17A 3MEXA 3KLNA 2XAJA 5CYVA 1Z7UA 1ZLJA 2DO7A 3GUDA 2FF4A 2GA2A 2CW0F 2KJCA 1FBSA 5HLGA 1SD7A 2Y75A 5HVQC 5D5XB 4YFNF 1XGMA 1XSVA 1MJAA 5L3GA 1SMTA 1RI7A 2OQRA 1FZPB 1BJAA 3LA2A 3SZPA 1FY7A 2PEXA 3HOSA 3BWGA 4ZZDA 1V4RA 3HTUA 2NNNA 3H3UA 1FOKA 2VT2A 5FLXZ 1YW8A 3F72A 1USTA 2JPCA 1HW1A 4MEYF 4KT5C 2L02A 4ASNA 1BOAA 3E6CC 5F6FA 1IN6A 1R1TA 2JZYA 2ZFWA 2XRNA 3KP3A 3RKWA 2YX7A 1EV7A 2QUFA 2FU4A 4OMZA 5ERIA 3HRSA 4L18B 1C0WA 2DFIA 5L3EA 3EETA 2DLLA 3SFZA 4RGXA 2Y0MA 5HDGA 2NNYA 1NHAA 1O3SA 3S2WA 2ZCWA 1P4WA 1Z91A 1HKTA 1R00A 5BS6A 3IHUA 2PMHA 2FBIA 1IF1A 4G7OF 3CJNA 1HBXG 3E6MA 5LRSA 1G4DA 1TQIA 3P9KA 2XAFA 3QP6A 2HS5A 3GZ6A 2EV0A 4UV9A 1EH7A 3GLXA 3JTGA 3ECHA 1KQ8A 5HS7A 3MCZA 3DV8A 3IWFA 1MZBA 1W7PD 4JK1X 3RKYA 3VODA 2GXBA 1MDMB 2PBIA 2QWWA 1SD6A 6PAXA 4HW0A 3W6JB 4LLGF 2V79A 2HTJA 3HTSB 3HRMA 1YLFA 4DNCA 5IT9Z 1JE8A 2QLZA 1FX7A 1REPC 4LJZF 1K79A 2L3DA 5FB2A 1MKMA 2P6SA 5KVRA 3ZMDA 4HQEA 1LNWA 1XCVA 4Y13A 1W7PB 4IXAA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3WGI A;  4IHS A;  2X0L A;  2EFP A;  3TOB A;  3F6O A;  4XRF A;  2OBP A;  5E1Z B;  3ZMV A;  1KA8 A;  2MH2 A;  2CSO A;  1F5T A;  1Y0U A;  3WTS C;  1G3W A;  3U2R A;  4MNU A;  4KIC A;  5E1W A;  4XLN F;  5EEH A;  5DCM A;  1B6A A;  4HQM A;  5CLS A;  4YG2 F;  1YQA A;  2CG4 A;  4EJO A;  5BOX A;  5DDG A;  1OYY A;  3WTX C;  2ESH A;  3FX3 A;  2QM3 A;  4ZYE A;  1O7F A;  4RB2 C;  2ZKZ A;  1QBJ A;  5H6Q A;  4KN4 X;  3TO6 A;  4AIH A;  5J6X A;  4U0V A;  3JAM K;  5H6R A;  3F23 A;  2UXX A;  2AXL A;  3J81 Z;  4L5J A;  1U78 A;  1ZAR A;  5JFR A;  4HBL A;  2L54 A;  5DD4 A;  2H09 A;  3BY6 A;  2JPB A;  2MBF A;  3E5U A;  2OZU A;  2DAO A;  2EJR A;  1XMA A;  3V7C A;  5FFX A;  2M30 A;  3D5L A;  4WWC A;  3GVA A;  1LDJ A;  5DCF A;  4ESB A;  1PUE E;  1G3S A;  4A6D A;  2LDU A;  2RKH A;  1Z05 A;  2A61 A;  5DD8 A;  1J2X A;  4HLX A;  1S8N A;  3BDD A;  2H6C A;  3EDP A;  2E7X A;  1LB2 A;  1IN7 A;  4IVN A;  2LF8 A;  4P96 A;  3TOA A;  1AWC A;  2KJB A;  2HYF A;  5ED4 A;  3WGH A;  2KIU A;  4ENJ A;  4OIN F;  4KIF A;  2K27 A;  2WC2 A;  1B1B A;  3T5X A;  2VN2 A;  3MAJ A;  4M9X A;  1ZYR F;  3O6B B;  2XIG A;  3F6V A;  3HUG A;  2D1V A;  4BAY A;  1PDN C;  1OPC A;  2IVM A;  1IN5 A;  2ZME B;  3K1M A;  2GIV A;  2GXG A;  3NEU A;  4Q47 A;  2FBK A;  4NHJ A;  3CUO A;  3LQQ A;  2NS0 A;  3L09 A;  5D4S A;  1RNL A;  1A04 A;  1TW3 A;  5FFZ A;  1T2K A;  2OU2 A;  3TO7 A;  2LNB A;  4G94 A;  3FZV A;  1G6N A;  2XAS A;  5FO5 A;  2BV6 A;  3FXQ A;  3EYI A;  2CFX A;  1WSU A;  3WE2 A;  1SD5 A;  1P92 A;  4HDU A;  3GFJ A;  4H0E A;  3BJO A;  3ZN0 A;  3KE2 A;  3RDI A;  3ERE D;  4PZJ A;  2RV8 A;  1FP1 D;  2IRF G;  2YX4 A;  4CO8 A;  3TO9 A;  2MH9 A;  3SQN A;  4KFC A;  5E8G A;  3IRR A;  4B8X A;  4ZH4 F;  1IW7 F;  1CF7 B;  1ZG5 A;  1V3F A;  1F1Z A;  3FMS A;  3BOQ A;  5JVT A;  2F5F A;  5DUI A;  4HA8 A;  4HLY A;  4WK8 F;  3KP5 A;  5D6F A;  4XBF A;  3LAJ A;  2STW A;  1ZG1 A;  1TNT A;  2P4W A;  5LGU A;  1P4A A;  3HOT A;  2W24 A;  4U0Y A;  3V7S A;  3SZT A;  3E6B A;  1LDD A;  1BIA A;  4M72 A;  1BI3 A;  3OV8 A;  2P7C B;  1H0M A;  4ZZL A;  3R60 A;  4TV7 A;  4HF1 A;  3NRV A;  2CYY A;  2H94 A;  3GW2 A;  4OIP F;  4LLL A;  3FHZ A;  4RAZ A;  1SMY F;  1DP7 P;  3P9C A;  4Y15 A;  5F1R A;  4L9T A;  3F8F A;  2FRH A;  4OIQ F;  3I58 A;  3L7W A;  1LJ9 A;  1YS6 A;  2ZNY A;  5L3B A;  4WXH A;  4YFX F;  1T39 A;  4UXN A;  3KEO A;  1RZ4 A;  1J5Y A;  1HW2 A;  4MGR A;  4UVB A;  3E5X A;  5CVJ A;  3TQN A;  3PFI A;  2GA1 A;  4ENM A;  2EFW A;  4BHB A;  2ELH A;  3FMR A;  1D8K A;  4CYD A;  5LHG A;  4LD5 A;  3SXY A;  2M1B A;  3CTA A;  1UB9 A;  1XDU A;  2ZBK A;  3DPL C;  1YIO A;  4YFK F;  2Z33 A;  2JSC A;  1TW2 A;  2EV6 A;  2PN6 A;  3F8C A;  2NAZ A;  4OOI A;  1FLI A;  2W25 A;  3MWM A;  5K1Y A;  4O5V A;  1ZRC A;  2V6C A;  2Q2E A;  3L00 A;  4EMS A;  3J80 Z;  5E18 F;  2D2W A;  1BI2 A;  4YIF A;  2P7V B;  3ZMT A;  5TJJ A;  3O2P E;  2P5V A;  4AWX B;  3QU6 A;  4EVI A;  2O6G E;  1BI0 A;  3LFK A;  1MDM A;  2HZT A;  2ETH A;  2FE3 A;  4M9Z A;  1OYW A;  1YO5 C;  2HOE A;  4MQV A;  4L0Y B;  1I5Z A;  2K86 A;  4FHT A;  5L3D A;  4BH9 A;  3F8N A;  2OA4 A;  4M9S A;  4RS8 A;  5LHH A;  4XSX F;  1KU2 A;  1LDK B;  4I7H A;  4NQW A;  5ICC A;  3AAF A;  1T6S A;  4RAY A;  5LEK A;  4IRG A;  1USS A;  1W7P A;  3JTH A;  4LB6 B;  1B9M A;  3WG9 A;  2VOP A;  2F5D A;  3F22 A;  2D45 A;  2FEZ A;  2HKX A;  1MD0 A;  1XSD A;  3RPU A;  4HX7 A;  3C3W A;  2HR3 A;  3GZ5 A;  4IRI A;  2DQR A;  4WX9 A;  4KA4 A;  4F7Z A;  5AON A;  5ILS A;  4HDV A;  4ENN A;  2K7L A;  2Q8K A;  5DEQ A;  3M7G A;  1BIB A;  4I98 B;  4PGG A;  4A5M A;  3DP7 A;  1BBY A;  2CWE A;  2J5P A;  1R5G A;  2M45 A;  4P5O A;  4OU0 A;  4IRH A;  1OR7 A;  4Z2Y A;  4Q48 A;  1ZLK A;  1J75 A;  2K4B A;  2QEN A;  4OIO F;  2ADU A;  2ESN A;  2IPQ X;  3ZMU A;  1HKQ A;  4EGZ A;  4FT8 A;  2RGV A;  4I0B A;  1IXC A;  3V8L A;  1QO0 D;  2L4M A;  3LAP A;  4HX4 A;  1Z1D A;  4ESF A;  3CO7 C;  3I54 A;  2E1C A;  4LG0 A;  1BN5 A;  2ISZ A;  4L0Z B;  1HST A;  1FPQ A;  3Q9V A;  4AD9 A;  2R7D A;  4I0A A;  2AS5 F;  2MLK A;  4R79 A;  2QQA A;  2R7F A;  4XLP F;  2BE5 F;  3EQL F;  3RTR A;  1SAX A;  2DPD A;  4KUM A;  2PQ8 A;  4RGR A;  3ELK A;  2V1U A;  3HSF A;  5HLH A;  4BHP A;  2O03 A;  3Q9S A;  3E5Q A;  1WKM A;  2LSO A;  4WXD A;  5FGM A;  1TTY A;  1TQM A;  1OMI A;  2A3S A;  2XHK A;  3QOP A;  2UWM A;  2VBY A;  1D5V A;  3HRT A;  2ZO4 A;  2HQR A;  1XGS A;  3BP8 A;  4CXF A;  3CDH A;  3M9A A;  3HHH A;  2QBY B;  4UUV A;  5FLX K;  1I27 A;  2IA0 A;  3TDU C;  4HF0 A;  4KIB A;  3B02 A;  3K9T A;  1QZZ A;  1QZY A;  3ABU A;  1U5T B;  1R5H A;  3K69 A;  4I09 A;  1BM9 A;  2VXZ A;  2ZME A;  4GCV A;  4P55 A;  1U2W A;  2P5K A;  4RB1 A;  4QLC U;  5BMZ A;  5ILU A;  1DUX C;  1B9N A;  4A0Y A;  5D5V B;  4ZYG A;  1ODD A;  3COA C;  2VOD A;  2O61 A;  3HIF A;  5TRD A;  3QRF F;  5HDK A;  4Q4Z F;  3KLO A;  3QAH A;  1K78 B;  2W84 A;  3ISP A;  2MD5 A;  1OYI A;  1ZAO A;  3BRO A;  3RKX A;  3ABT A;  3VFZ A;  4WF2 A;  4LG0 B;  1F9N A;  5DV5 A;  1S7A A;  1J59 A;  2A68 F;  3RYR A;  4M74 A;  3V4G A;  3JSO A;  3I4P A;  2JT1 A;  1B59 A;  3SHF A;  1CF7 A;  1ZRD A;  1O3Q A;  3JW4 A;  3W6K B;  2DPU A;  2VE8 A;  4LMY A;  1P6R A;  3FWE A;  4O3M A;  4YII A;  1AOY A;  4EJV A;  2V1X A;  3RPQ A;  2Z5U A;  1XMK A;  2W85 A;  3WTY C;  2VC1 A;  4LK0 F;  2QZ8 A;  2OZ6 A;  1R7J A;  1TQP A;  2C6Y A;  1DPU A;  3WTZ A;  3ML6 A;  4XSZ F;  2VE9 A;  4HV6 A;  3I59 B;  2Y48 A;  3KP2 A;  2GQQ A;  1L0O C;  3KEQ A;  4MTE A;  2HEO A;  3CUQ B;  5IT9 K;  4GXO A;  4EM1 A;  1FWZ A;  4N0B A;  2DK8 A;  3QPT A;  1XB4 A;  2COM A;  1FYK A;  2IW5 A;  5D5U B;  3KZZ A;  2RDP A;  4UV8 A;  3R61 A;  3F8M A;  3VOE A;  1JHF A;  2P8T A;  5D4R A;  4AIK A;  1E2X A;  2BEO A;  2EK5 A;  4S04 A;  3I5U A;  4LGW A;  4O6J A;  3K2Z A;  5FD6 A;  2F5C A;  2YPR A;  3FF5 A;  2FSW A;  4MTD A;  2QVO A;  2YR2 A;  3IWZ A;  1GXQ A;  1ZHF A;  2A07 F;  5D5W B;  3J7A O;  1IAW A;  4AVP A;  2M5W A;  3N4M A;  1S6L A;  2HQN A;  4NB5 A;  1ZRE A;  4K2E A;  1S7O A;  1KGS A;  3VB2 A;  2PLY A;  2EV5 A;  4R1H A;  4QWQ A;  3I71 A;  3T8T A;  4U0W A;  2F5E A;  3KCC A;  1ZG3 A;  5LBQ A;  1W5S A;  1Z9C A;  1W4M A;  3EYY A;  3E97 A;  2EFQ A;  2L4A A;  2DQL A;  3FM5 A;  3WE3 A;  3K1N A;  1XD7 A;  4HZF A;  1ZGJ A;  2WV0 A;  3BZ6 A;  1RUN A;  2FNP A;  1I1G A;  2PMU A;  5A2Q K;  3NQO A;  2ISY A;  1MGT A;  4JBA A;  2EB7 A;  1ON1 A;  3WTW C;  2EA4 A;  2W57 A;  4ON0 A;  5JI6 A;  2KKO A;  2E1N A;  1SFU A;  5E20 A;  1IXR C;  5D8K B;  1R22 A;  1IN4 A;  4HV5 A;  1U3E M;  2HYG D;  3WU1 B;  1WRJ A;  1PP7 U;  3H92 A;  2ZJ2 A;  1G3T A;  5CVI A;  5K5Q A;  2FQ3 A;  1HSJ A;  2KRF A;  2FOK A;  1BI1 A;  3TDZ C;  1EH8 A;  2Z9O A;  3QP5 A;  1IUY A;  2CQK A;  1UHW A;  1P4X A;  1FNN A;  3ECO A;  3IRQ A;  2DT5 A;  2MA3 A;  5ICF A;  4G8X A;  2J5O A;  1O3R A;  1OKR A;  2PG4 A;  4I01 A;  2ACJ A;  2OD5 A;  3K0L A;  3MQ0 A;  4G9Y A;  1LQ1 A;  4G7Z F;  3GFI A;  3WTU C;  2E7W A;  4DQ2 A;  5E8I A;  2QYO A;  2H27 A;  3C1D A;  4I2O A;  1XGN A;  1ON2 A;  1FYL A;  1IXS B;  4KYW A;  2DK5 A;  1O57 A;  5IT3 A;  2V1D A;  4HYE A;  2P5L C;  2XKP A;  2D1H A;  1YW9 A;  1DDN A;  2VT3 A;  5ICE A;  1R1V A;  5F64 A;  4PCQ A;  3HSR A;  4KDP A;  3RJP A;  1QNT A;  3RIR A;  2RNJ A;  2BBY A;  3GFL A;  2XAQ A;  5ILV A;  3IC7 A;  4L9N A;  1G3Y A;  4M6Y A;  3ZMZ A;  4A0Z A;  1S29 A;  4AIJ A;  2XAG A;  2YSR A;  1KU3 A;  1LEA A;  2FBH A;  1BC7 C;  2K4J A;  3FXR A;  4BYY A;  1JHH A;  3B73 A;  1EH6 A;  3G3Z A;  2YU3 A;  2F2E A;  3KET A;  3K1P A;  3PQK A;  3T0Y A;  3U9G A;  1MJB A;  5BQT A;  3GFM A;  2XRO A;  2XVC A;  3HSE A;  2G7U A;  5HLI A;  5DUK A;  1R58 A;  2B0L A;  2QBY A;  3GXO A;  3KFW X;  3HRU A;  4M73 A;  2UXN A;  2QQB A;  3U1D A;  5E1X A;  2VBX A;  5L3C A;  2NRA C;  1JGS A;  3R0A A;  1IRG A;  3OOP A;  4P9U A;  1YFH A;  1U5T A;  3VEP A;  5HS8 A;  4L9J A;  4EQQ A;  3GO5 A;  3T1B A;  5LGT A;  3M1E A;  1XSX A;  5AIQ A;  1R23 A;  4UHT A;  3JAM Z;  5LHI A;  3EUH A;  2RVC A;  2VBZ A;  1KU7 A;  2HDC A;  2G9W A;  4HAM A;  5LGN A;  4GYI A;  2A6H F;  3GF2 A;  1KU9 A;  1FP2 A;  3MFK A;  1T38 A;  1STZ A;  5LLQ A;  3GX4 X;  3DQV C;  2WWY A;  1KYW A;  1K78 A;  5ICG A;  1HW5 A;  2BGC A;  3G73 A;  1VTN C;  4EJW A;  1T98 A;  2GZW A;  1QGP A;  2DU9 A;  3BPV A;  4N9I A;  1ZRF A;  2R3S A;  3O3K A;  4D0P A;  2HKO A;  4FX4 A;  3J80 K;  3WTT C;  4IF4 A;  4LFU A;  4EJT A;  3LST A;  1YG2 A;  1PP8 F;  2IA2 A;  4M6X A;  4I02 A;  4BHC A;  4GGG A;  2STT A;  1O3T A;  3ROU A;  4FX0 A;  1YYV A;  1LEB A;  4OMY A;  1XN7 A;  4KNY A;  3R0J A;  1BC8 C;  3KP4 A;  1WWX A;  1GVJ A;  4U7B A;  1X3U A;  1J0R A;  5JHU A;  3M8E A;  3H3Z A;  5D8L B;  3I59 A;  3I0T A;  1U6G A;  3V7R A;  2MLG A;  3KZY A;  4CIC A;  5CJ9 A;  3CUQ A;  1WQ2 A;  4BNC A;  2FMY A;  4U88 A;  4IJA A;  3LQR A;  3WU0 A;  2CGP A;  2PJP A;  2M87 A;  3DKW A;  2WTE A;  2O3F A;  2VBW A;  2A69 F;  1UHM A;  1T0F A;  2PI0 A;  5KK1 A;  1LVA A;  1J9I A;  4LB5 A;  4IHT A;  3CLO A;  2V9V A;  2P6T A;  3E6D A;  2H6B A;  3D0S A;  3QPH A;  2XV4 S;  1TLH B;  1XGO A;  4M71 A;  1WI9 A;  5J8F A;  2IA1 A;  3ZMS A;  2ZNZ A;  3IKT A;  1S3J A;  1XDS A;  4JQF A;  2FNA A;  4U7D A;  5EEG A;  4OIR F;  4EGY A;  1Z6T A;  4IPA A;  3GEZ A;  4CZZ A;  4GO1 A;  1D3Y A;  5D6E A;  4BXU A;  1UCR A;  1YW7 A;  2DTR A;  4MEX F;  2X4H A;  3IL2 A;  4MQ9 F;  2MC3 A;  3DFG A;  1P2F A;  5A2Q Z;  4KMF A;  2LKP A;  1HKS A;  2IP2 A;  1MJ9 A;  1CGP A;  1W5T A;  2DW4 A;  1FC3 A;  1DPR A;  2O0Y A;  1I6X A;  4G6D A;  4ZYD A;  2FA5 A;  1ONV A;  4Q5S F;  1O7L A;  2K02 A;  3GYH X;  3L9F A;  4RGS A;  2FXA A;  3L2C A;  1L3L A;  1Q1H A;  1R1U A;  3GWZ A;  3ZQ7 A;  3V8J A;  2O8X A;  3BJA A;  1FBU A;  2EA2 A;  4G6Q A;  4P9F A;  3DF8 A;  3I64 A;  4EM2 A;  4CHU A;  2HGC A;  1KQ9 A;  1U8R A;  1RUO A;  2CO5 A;  3LA7 A;  3IKV A;  4EV0 A;  3DPT A;  1XCB A;  4ETS A;  4L9V A;  3ULQ B;  4HOB A;  2BYV E;  1H9G A;  2A5Y B;  5CVU A;  1TBX A;  3F8B A;  3P9I A;  3F21 A;  3KP6 A;  4CGZ A;  5JR3 A;  1FT9 A;  5BPD A;  2GWR A;  4RB0 A;  1ZN2 A;  5DCM B;  5HOO A;  4LLN A;  3ZPL A;  2DI3 A;  4UVC A;  3WOD F;  4RGU A;  1RIO H;  3KP7 A;  4E70 A;  4UVA A;  2Z99 A;  2JRT A;  3REO A;  1IN8 A;  4ENK A;  5LRR A;  3PQJ A;  3DXJ F;  3FM3 A;  4KIG A;  2XKO A;  5K5O A;  3DEU A;  1K7A A;  1YS7 A;  4ZYH A;  4A0X A;  4N9H A;  3JSP A;  2Z3Y A;  1HXD A;  3ZP5 A;  1I1S A;  2EWN A;  5HS9 A;  1ZH5 A;  2IT0 A;  2ZXJ A;  1B4A A;  2UZK A;  2QQ9 A;  3C18 A;  4EJU A;  4L5I A;  2RQP A;  1HQC A;  3HHG A;  4G7H F;  4UNO A;  4PDK A;  4BQA A;  3LWF A;  3J81 K;  5E17 F;  4S05 A;  1FSH A;  5J8C A;  2NYX A;  2LF7 A;  4A6E A;  2HWV A;  3BPX A;  4HX8 A;  2OAZ A;  1J7K A;  2PFB A;  3I53 A;  2VON A;  2XUB A;  3TKY A;  1KQ0 A;  3BJ6 A;  1U5T C;  1UFM A;  5FD5 A;  4ESJ A;  1SD4 A;  4R8H A;  3RI4 A;  4PGH A;  2KIM A;  2RN7 A;  3RYP A;  2VOO A;  5LEJ A;  1YTY A;  3MZY A;  4LK1 F;  3P7N A;  4A2U A;  1ULY A;  5H20 A;  3R6S A;  1Z6R A;  3MZH A;  4HF2 A;  3T8R A;  3QU3 A;  5CVR A;  1SFE A;  1K6O A;  2EFN A;  4MHG A;  2EFO A;  3FMQ A;  3N97 A;  1QPM A;  3M8F A;  2IJL A;  2OQG A;  2XGX A;  3ZN1 A;  2FML A;  5CVV A;  5BPI A;  3F3X A;  4A12 A;  3HYI A;  3LA3 A;  4A5N A;  3WTV C;  1D8J A;  4KMU X;  4GYG A;  1H9T A;  1GXP A;  5K5R A;  3Q5F A;  3CO6 C;  3R4K A;  2GAU A;  2VC0 A;  1FYM A;  4KN7 X;  1IZ1 A;  2M8E A;  4WCG A;  3V8K A;  3E3V A;  4RB3 C;  2XAH A;  4CDG A;  3WGG A;  4EM0 B;  1SFX A;  1F4K A;  3TGN A;  2HFH A;  1FSE A;  5DYM A;  5AIP A;  1TNS A;  1E17 A;  2TDX A;  1FBQ A;  5L3F A;  2DBB A;  1KYZ A;  2Q0O A;  2KIF A;  2HTS A;  3CUQ C;  4WXC A;  1ZGA A;  1QQI A;  1IRF A;  5HDN A;  2RC4 A;  3C7J A;  2L01 A;  2JTV A;  2G7H A;  4B09 A;  1JXS A;  3FXU A;  1R36 A;  1GHC A;  2A6E F;  4Y17 A;  3MEX A;  3KLN A;  2XAJ A;  5CYV A;  1Z7U A;  1ZLJ A;  2DO7 A;  3GUD A;  2FF4 A;  2GA2 A;  2CW0 F;  2KJC A;  1FBS A;  5HLG A;  1SD7 A;  2Y75 A;  5HVQ C;  5D5X B;  4YFN F;  1XGM A;  1XSV A;  1MJA A;  5L3G A;  1SMT A;  1RI7 A;  2OQR A;  1FZP B;  1BJA A;  3LA2 A;  3SZP A;  1FY7 A;  2PEX A;  3HOS A;  3BWG A;  4ZZD A;  1V4R A;  3HTU A;  2NNN A;  3H3U A;  1FOK A;  2VT2 A;  5FLX Z;  1YW8 A;  3F72 A;  1UST A;  2JPC A;  1HW1 A;  4MEY F;  4KT5 C;  2L02 A;  4ASN A;  1BOA A;  3E6C C;  5F6F A;  1IN6 A;  1R1T A;  2JZY A;  2ZFW A;  2XRN A;  3KP3 A;  3RKW A;  2YX7 A;  1EV7 A;  2QUF A;  2FU4 A;  4OMZ A;  5ERI A;  3HRS A;  4L18 B;  1C0W A;  2DFI A;  5L3E A;  3EET A;  2DLL A;  3SFZ A;  4RGX A;  2Y0M A;  5HDG A;  2NNY A;  1NHA A;  1O3S A;  3S2W A;  2ZCW A;  1P4W A;  1Z91 A;  1HKT A;  1R00 A;  5BS6 A;  3IHU A;  2PMH A;  2FBI A;  1IF1 A;  4G7O F;  3CJN A;  1HBX G;  3E6M A;  5LRS A;  1G4D A;  1TQI A;  3P9K A;  2XAF A;  3QP6 A;  2HS5 A;  3GZ6 A;  2EV0 A;  4UV9 A;  1EH7 A;  3GLX A;  3JTG A;  3ECH A;  1KQ8 A;  5HS7 A;  3MCZ A;  3DV8 A;  3IWF A;  1MZB A;  1W7P D;  4JK1 X;  3RKY A;  3VOD A;  2GXB A;  1MDM B;  2PBI A;  2QWW A;  1SD6 A;  6PAX A;  4HW0 A;  3W6J B;  4LLG F;  2V79 A;  2HTJ A;  3HTS B;  3HRM A;  1YLF A;  4DNC A;  5IT9 Z;  1JE8 A;  2QLZ A;  1FX7 A;  1REP C;  4LJZ F;  1K79 A;  2L3D A;  5FB2 A;  1MKM A;  2P6S A;  5KVR A;  3ZMD A;  4HQE A;  1LNW A;  1XCV A;  4Y13 A;  1W7P B;  4IXA A; 
#chains in the Genus database with same CATH topology
 1SVM A;  2VXD A;  3WGI A;  2FOW A;  2R7R A;  4IHS A;  5IP9 J;  1TWH J;  2X0L A;  2EFP A;  3TOB A;  5LD2 C;  3F6O A;  3K2A A;  3KX2 A;  2VJ4 A;  4XRF A;  2OBP A;  5E1Z B;  3ZMV A;  3HG9 A;  1KA8 A;  3JRE A;  5JLX A;  2KMU A;  2MH2 A;  2CSO A;  3Q0V A;  1F5T A;  3LSP A;  3K4M A;  2L9R A;  1Y0U A;  3WTS C;  3CES A;  3V42 A;  1XC5 A;  3DTE A;  1G3W A;  2M8G X;  2B7E A;  3U2R A;  1QPI A;  4MNU A;  4KIC A;  5E1W A;  4XLN F;  2ICW G;  5EEH A;  5DCM A;  2DA4 A;  1Y8Q B;  1B6A A;  4HQM A;  5CLS A;  2VJI A;  3OYB A;  2ZXW H;  1X4O A;  4YG2 F;  1YQA A;  3UR3 C;  4BE2 A;  2CG4 A;  3PNV A;  1MSF C;  2R5Z A;  4HEA 2;  4EJO A;  5BOX A;  5DDG A;  2XPW A;  1OYY A;  3WTX C;  2IAI A;  2QA4 I;  2H8R A;  3HZJ A;  2ESH A;  3FX3 A;  3RSN A;  2VIX A;  4IHV A;  5KCM A;  1SC7 A;  1VQ8 I;  1H89 C;  2QM3 A;  4ZYE A;  2BXY A;  1HOM A;  1W36 D;  1O7F A;  3K4B A;  4M6V A;  4RB2 C;  3GME A;  4CCO A;  4FCY A;  1D1B A;  2ZKZ A;  1QBJ A;  4XID A;  2YS9 A;  4KN4 X;  2V26 A;  5H6Q A;  3TO6 A;  2DMU A;  4AIH A;  4A3F J;  5J6X A;  1VFC A;  4JP0 A;  3CC4 I;  3TED A;  4U0V A;  3JAM K;  2O8K A;  5H6R A;  3F23 A;  1SEU A;  3G1L A;  2UXX A;  2AXL A;  3J81 Z;  4L5J A;  1U78 A;  1ZAR A;  5IYB J;  3CC7 I;  1TWF J;  2CJJ A;  4A3D J;  5JFR A;  3BC8 A;  1JKP C;  1VI0 A;  4HBL A;  2L54 A;  5DD4 A;  2M3A A;  2H09 A;  3BY6 A;  2JPB A;  2MBF A;  3DCF A;  3E5U A;  4PSX A;  2OZU A;  4B47 A;  2DAO A;  2EJR A;  4BE1 A;  1X3Z B;  1SAU A;  1XMA A;  3V7C A;  5FFX A;  3M1C A;  2B9S A;  2M30 A;  3D5L A;  2Y9Z A;  4WWC A;  3GVA A;  1LDJ A;  1S5L C;  4L5E A;  2XDV A;  3A1Y A;  1D0Y A;  5DCF A;  4ESB A;  3VYR B;  1PUE E;  2O5R A;  3ZRG A;  4X1E A;  1G3S A;  1NG6 A;  2V9P A;  4A6D A;  2XGC A;  3IV5 A;  2LDU A;  2RKH A;  2V4J C;  2COB A;  3H9J A;  1TT0 A;  2BHY A;  1Z05 A;  2A61 A;  5DD8 A;  2GOX B;  1J2X A;  4HLX A;  1S8N A;  3BDD A;  3OYH A;  1AU7 A;  2H6C A;  2OJE D;  3CF5 F;  1DP3 A;  3EDP A;  3PO3 J;  2E7X A;  5DTD A;  5EGO A;  3LNQ A;  1RKW A;  2ZJQ F;  4ZDP A;  4XL9 A;  1LB2 A;  1BR4 A;  3HOW J;  3EPZ A;  1IN7 A;  3OSF A;  2IBD A;  1LUJ B;  4IVN A;  3HL2 A;  3L2Q A;  5M5W J;  2LF8 A;  2F4O B;  4P96 A;  3TOA A;  1A6Q A;  1AWC A;  2KJB A;  2HYF A;  2R7X A;  5ED4 A;  3WGH A;  5H2F C;  1YOV B;  2WAD A;  1LE8 A;  3OYC A;  2PJR B;  2KIU A;  4ENJ A;  2ZB9 A;  4OIN F;  2DXI A;  4KIF A;  3RKQ A;  3F9K A;  2K27 A;  2WC2 A;  4NBQ A;  1B1B A;  1Z3X A;  5GP9 A;  3T5X A;  2VN2 A;  3MAJ A;  5FKO A;  4BJ6 C;  4M9X A;  1ETQ A;  1ZYR F;  3O6B B;  1IV8 A;  2XIG A;  3F6V A;  3FKI J;  3HUG A;  3LOC A;  2D1V A;  3FDY A;  4BAC A;  2DA7 A;  4BAY A;  1OPC A;  1PDN C;  3BQY A;  3LL7 A;  2BY3 A;  2IVM A;  1IN5 A;  1IUF A;  2ME0 A;  2JUC A;  3LSH A;  1SVL A;  2BXZ A;  2BW3 A;  2ZME B;  4PJM A;  3K1M A;  2GIV A;  2GXG A;  3NEU A;  5K7H A;  1MMN A;  4Q47 A;  3ZQH A;  2FBK A;  2IGO A;  3NAU A;  4NHJ A;  1MW7 A;  2ID3 A;  3CUO A;  4OAZ A;  2LRE A;  3LQQ A;  2R92 J;  2NS0 A;  3L09 A;  5D4S A;  1F43 A;  1RNL A;  1A04 A;  4Y33 A;  4ABZ A;  2YU9 J;  1TW3 A;  4BQQ A;  5FFZ A;  1T2K A;  2OU2 A;  3TO7 A;  2LNB A;  1QU3 A;  4G94 A;  3FZV A;  4HSR A;  2KDO A;  3U1K A;  2EIL H;  3MN2 A;  3IP4 B;  1G6N A;  2XAS A;  3PUB A;  3SYT A;  5FO5 A;  1ZR2 A;  5C4J J;  2BV6 A;  3FXQ A;  1YRN A;  3EYI A;  2CFX A;  4V2G A;  2E1M B;  1WSU A;  3WE2 A;  5FKM A;  3CCU I;  1SD5 A;  1P92 A;  4HDU A;  3GFJ A;  4H0E A;  2G0E A;  3BJO A;  3ZN0 A;  3KE2 A;  3RDI A;  2E36 A;  2X6W A;  4EAT A;  1YJW I;  1QVT A;  3ERE D;  4PZJ A;  5B1B H;  3CMM A;  2RV8 A;  4CCK A;  1P7I A;  1FP1 D;  2IRF G;  2YX4 A;  3HJE A;  2MD0 A;  3TO9 A;  2QGU A;  4CO8 A;  2W82 A;  1BA5 A;  2MH9 A;  3SQN A;  1EJ9 A;  4KFC A;  4UUT A;  3OYK A;  4C3J J;  5E8G A;  3IRR A;  3I55 I;  4B8X A;  4ZH4 F;  3MVP A;  4IQ4 A;  2W4S A;  1IW7 F;  1VQ7 I;  1CF7 B;  1ZG5 A;  1VZ0 A;  1V3F A;  1ZEL A;  1H8A C;  3KZI C;  1F1Z A;  2KT0 A;  3FMS A;  3BOQ A;  5JVT A;  3I4N J;  2F5F A;  2K9S A;  3DKX A;  5DUI A;  4HA8 A;  4HLY A;  2A5W A;  4AID A;  3Q0U A;  4WK8 F;  1Z7L A;  3KP5 A;  5D6F A;  3ZQG A;  4XBF A;  2LY9 A;  4CYC A;  3LAJ A;  2STW A;  1ZG1 A;  1TNT A;  2P4W A;  4C3H J;  1P4A A;  5LGU A;  3HOT A;  2W24 A;  3DWL E;  1S9H A;  2JA8 J;  3JRF A;  2LD5 A;  4U0Y A;  3CDI A;  3V7S A;  2MAB A;  3SZT A;  1K6Y A;  3E6B A;  3CF2 A;  2XGE A;  2DDB A;  2JA7 J;  1LDD A;  1BIA A;  4M72 A;  3ZCO A;  1BI3 A;  1MMA A;  3OV8 A;  4MO7 A;  4F52 A;  1VQ9 I;  2P7C B;  1OJL A;  1H0M A;  3HM5 A;  4ZZL A;  3R60 A;  4TV7 A;  4HF1 A;  3NRV A;  2CYY A;  2H94 A;  3GW2 A;  3OYA A;  4OIP F;  4LLL A;  3WU2 C;  3FHZ A;  4RAZ A;  1YI2 I;  2OCE A;  2BZT A;  3CCY A;  4IL6 C;  2MYS A;  1I3Q J;  1IRX A;  1SMY F;  1DP7 P;  2DA1 A;  3HOV J;  3P9C A;  5IYC J;  4Y15 A;  5F1R A;  5CKT A;  3JRA A;  4L9T A;  3F8F A;  2FRH A;  4DZJ A;  3FXO A;  3PIP F;  5FLM J;  3I58 A;  3L7W A;  2HVR A;  1LJ9 A;  4OIQ F;  1YS6 A;  2ZNY A;  5CQE A;  4WXH A;  5L3B A;  3GTM J;  2LC2 A;  1VQN I;  4YFX F;  1T39 A;  4UXN A;  3KEO A;  1RZ4 A;  1FIA A;  3ZR8 X;  1J5Y A;  1HW2 A;  3TL4 X;  4MGR A;  4UVB A;  1RPW A;  5M3F J;  1SAN A;  3E5X A;  5CVJ A;  2IS6 A;  3TQN A;  2ZXH A;  3PFI A;  4KJZ A;  4NDL A;  2GA1 A;  1W36 C;  3BG7 A;  4ENM A;  2EFW A;  1R4N B;  4AUX A;  5M3M J;  4BHB A;  2ELH A;  4E7J A;  5B5E C;  3FMR A;  1D8K A;  4CYD A;  5LHG A;  4LD5 A;  2LBF A;  3SXY A;  2M1B A;  3VPR A;  3IAM 2;  3CTA A;  1UB9 A;  2VQC A;  1XDU A;  1UG0 A;  2BOL A;  1YIO A;  2ZBK A;  3DPL C;  3HB9 A;  1YX5 A;  4XQF A;  3MKW B;  1OCT C;  2R7Z J;  2XPU A;  2HVQ A;  1U9N A;  4YFK F;  3OYF A;  2Z33 A;  4RMN A;  1JGG A;  2JSC A;  1TW2 A;  2EV6 A;  2PN6 A;  3FIW A;  1XS9 A;  5GAD J;  3MKL A;  3F8C A;  2CV0 A;  4UUS A;  2NAZ A;  4OOI A;  1GDT A;  4V19 K;  1FLI A;  1T0F C;  4PJN A;  2H1K A;  2W25 A;  3MWM A;  3OS1 A;  5K1Y A;  1PUF B;  4O5V A;  1W5C C;  2NS8 A;  1ZRC A;  2V6C A;  1T33 A;  2Q2E A;  3L00 A;  4EMS A;  3J80 Z;  2P0W A;  1ZK8 A;  1JI8 A;  3G6E I;  3K10 A;  5E18 F;  1KZH A;  2WB1 A;  1QHH D;  2D2W A;  1JUP A;  1BI2 A;  4YIF A;  1TWG J;  2P7V B;  3ZMT A;  5TJJ A;  5EYR A;  3VSL A;  3O2P E;  1TT5 B;  3OYL A;  3GLL A;  2F48 A;  2P5V A;  4AWX B;  3QU6 A;  2JWT A;  3A03 A;  1M1E B;  4EVI A;  4AYB N;  1X1D A;  9ANT A;  4IOC F;  2L7M P;  2O6G E;  1BI0 A;  3LFK A;  1MDM A;  2HZT A;  3C2B A;  4M3F A;  2ETH A;  3PUF A;  1P7J A;  1FOY A;  2FE3 A;  4M9Z A;  3D5S C;  1OYW A;  1LFP A;  1ERD A;  1YO5 C;  2HOE A;  5FRO A;  5HNF A;  4MQV A;  2XPV A;  4L0Y B;  2ECC A;  1I5Z A;  2K86 A;  1R9T J;  4FHT A;  5L3D A;  1NK2 P;  1BL0 A;  4BH9 A;  3PL8 A;  4YRV A;  3F8N A;  2OA4 A;  1ACI A;  4OWR B;  2M9H A;  4M9S A;  4RS8 A;  3OOU A;  4M3E A;  5LHH A;  2WAQ A;  3DPU A;  4YIR X;  4XSX F;  1OQY A;  1KU2 A;  1LDK B;  4I7H A;  4NQW A;  4BL0 B;  5ICC A;  3AAF A;  1T6S A;  3I4M J;  5EDN A;  3CCL I;  1RES A;  4B3X A;  2DA5 A;  2HU9 A;  4RAY A;  3TP3 A;  3GTL J;  2AQE A;  5LEK A;  1YJN I;  1OCR H;  1MBG A;  4IRG A;  1USS A;  4BU2 A;  2AQF A;  1GV2 A;  1RR8 C;  5DM6 F;  1W7P A;  3JTH A;  2VKH A;  4LB6 B;  1B9M A;  3WG9 A;  2VOP A;  2F5D A;  3F22 A;  2D45 A;  4W97 A;  3HPH A;  1MBE A;  3W6V A;  2FEZ A;  2HKX A;  1MD0 A;  4JOM A;  4RA2 A;  1XSD A;  2E60 A;  3RPU A;  4HX7 A;  3MKZ A;  3C3W A;  2MG4 A;  2HR3 A;  3GZ5 A;  3M4O J;  1R49 A;  4B44 A;  2L5Q A;  3LFU A;  1Y1W J;  4IRI A;  2DQR A;  2WAF A;  4WX9 A;  4KA4 A;  2VKV A;  1Z3Y A;  3UNG C;  2FD5 A;  4F7Z A;  5AON A;  5F0F A;  2E71 A;  1IDY A;  1N75 A;  1U0J A;  2DDA A;  5ILS A;  2LKX A;  4ZTJ A;  4HDV A;  4C2U A;  3S15 J;  3AG3 H;  2R7T A;  3NAR A;  2R7W A;  2GXA A;  3K4L A;  2VQH A;  4FE7 A;  4ENN A;  3C2G A;  3O8H A;  3JRD A;  1X2N A;  2LK2 A;  2K7L A;  2K5C A;  2Q8K A;  5DEQ A;  3M7G A;  4IHY A;  4BXF A;  3DU6 A;  4F91 B;  4I6Z A;  1G59 A;  1PJR A;  3FBN B;  2NVY J;  1A36 A;  1E3O C;  2L9S A;  1BIB A;  1BOB A;  4I98 B;  3FXK A;  4PGG A;  2DFE A;  4A5M A;  3DP7 A;  4ZJZ A;  4DYC A;  2AXT C;  1BBY A;  2CWE A;  2J5P A;  2L9V A;  1A5J A;  1R5G A;  3S3O A;  1WJF A;  2AHQ A;  2M45 A;  4P5O A;  4OU0 A;  2JK3 A;  1E3P A;  2L9N A;  4IRH A;  4DOZ A;  1OR7 A;  4Z2Y A;  3B6A A;  3AG4 H;  1LFB A;  2HI3 A;  4Q48 A;  1ZLK A;  1J75 A;  4X0G A;  2K4B A;  2QEN A;  2JQ7 A;  4LIU A;  4OIO F;  2ADU A;  2ESN A;  3ONQ A;  4M3G A;  1RKT A;  2HQA A;  2IPQ X;  3ZMU A;  1WJC A;  1HKQ A;  3JRB A;  4EGZ A;  4FT8 A;  4CH7 A;  2RGV A;  4I0B A;  1IXC A;  2LVS A;  3ERM A;  3V8L A;  1F36 A;  3I3L A;  4FE4 A;  3S17 J;  1QO0 D;  2FUG 2;  1D1A A;  2L4M A;  3RPU D;  3LAP A;  4HX4 A;  2XGD A;  3CP2 A;  1Z1D A;  3KIO A;  4ESF A;  3CO7 C;  1HC8 A;  4F92 B;  3I54 A;  2VI6 A;  2E1C A;  1MSE C;  2FQ4 A;  2KRH A;  3BCA A;  5JVG F;  4LG0 A;  1JT6 A;  1B72 A;  1BN5 A;  2ISZ A;  4L0Z B;  1HST A;  5FLV A;  1FPQ A;  3CQZ J;  2BY0 A;  3Q9V A;  4AD9 A;  3H9G A;  3CC2 I;  2R7D A;  4I0A A;  2AS5 F;  2MLK A;  2EPF A;  4R79 A;  2QQA A;  4F3Q A;  2R7F A;  4XLP F;  3DLL F;  5FKK A;  3BZC A;  2Y2Z A;  4NC7 A;  3GZN B;  2BE5 F;  3EQL F;  5B1A H;  5FRN A;  4MIM A;  3NWS A;  3RTR A;  1SAX A;  2XC7 A;  1X1C A;  5E3L A;  3NWT A;  2DPD A;  4KUM A;  2PQ8 A;  4RGR A;  3OL4 A;  2X9D A;  2XRL A;  2EZH A;  3ELK A;  3LSM A;  2V1U A;  3RZO J;  2K85 A;  3HSF A;  4A3G J;  1NH3 A;  5HLH A;  2ZSI B;  2BVL A;  1WH7 A;  4BHP A;  3H3V K;  2O03 A;  1MBJ A;  3Q9S A;  3E5Q A;  1WKM A;  2LSO A;  3F0C A;  4WXD A;  5FGM A;  2PJR A;  1TTY A;  2F6C A;  1TQM A;  1OMI A;  2A3S A;  2XHK A;  3QOP A;  5EF6 A;  2UWM A;  2VBY A;  4UY8 I;  4BBS J;  2CQ7 A;  1D5V A;  2VUM J;  3HRT A;  2ZO4 A;  2HQR A;  1XGS A;  3BP8 A;  4CXF A;  3SFI A;  3CDH A;  3M9A A;  3HHH A;  2OF7 A;  2QBY B;  4UUV A;  5FLX K;  1I27 A;  2E2I J;  3SZG A;  2IA0 A;  3TDU C;  4HNT A;  1WZ2 A;  4HF0 A;  4KIB A;  2PX9 A;  3B02 A;  3K9T A;  4BE0 A;  1QZZ A;  3KEY A;  3L1P A;  1QZY A;  3ABU A;  1JTY A;  1U5T B;  2DTZ A;  3KYD B;  1R5H A;  4QPO A;  5K7Z A;  3K69 A;  4I09 A;  1BM9 A;  2VXZ A;  2ZME A;  4GCV A;  1W1W E;  1U2W A;  4P55 A;  4Y4R A;  4RDU A;  5C4X J;  2IGN A;  4IEJ A;  5J3L A;  5GAH J;  1DGW Y;  2P5K A;  4RB1 A;  4QLC U;  5BMZ A;  3AFH A;  4XR6 A;  2IXS A;  4YEJ A;  5ILU A;  1DUX C;  3FXJ A;  1B9N A;  2R4G A;  3JRH A;  4A0Y A;  5D5V B;  4ZYG A;  1ODD A;  3CZ6 A;  3COA C;  2VOD A;  3KYC B;  3A01 B;  1QZE A;  2VLA A;  3H5A A;  2X1E A;  2O61 A;  3HIF A;  5TRD A;  5EJC A;  3QRF F;  1LFU P;  5HDK A;  4Q4Z F;  3KLO A;  3QAH A;  2DOE A;  1K78 B;  1DU0 A;  2W84 A;  3ISP A;  2MD5 A;  2W7N A;  3BR0 A;  1OYI A;  3BQZ A;  1MH3 A;  1ZAO A;  3BRO A;  3HPG A;  3ZQI A;  3RKX A;  2CUE A;  3DTI A;  3HXL A;  2QQ8 A;  3ABT A;  3OYE A;  3VFZ A;  3HDD A;  4WF2 A;  3MZ8 A;  4LG0 B;  1F9N A;  3RQI A;  5B66 C;  5DV5 A;  1B72 B;  1S7A A;  4NC8 A;  5GTI C;  1J59 A;  2A68 F;  3RYR A;  4M74 A;  3V4G A;  3EUK L;  3JSO A;  3IH4 A;  3I4P A;  1MMD A;  2JT1 A;  1B59 A;  5JHF A;  3PSF A;  5C44 J;  2UV1 A;  4IZZ A;  2DMP A;  3IH3 A;  3SHF A;  1YIT I;  1CF7 A;  1ZRD A;  1O3Q A;  3W3C A;  3JW4 A;  1X2M A;  3W6K B;  2VE8 A;  4A69 C;  2DPU A;  4LMY A;  1P6R A;  3FWE A;  4O3M A;  3CJQ B;  4YII A;  1AOY A;  1WGX A;  2LH9 A;  4EJV A;  2V1X A;  3RPQ A;  1TZL A;  2Z5U A;  4J01 A;  1XMK A;  2GBY A;  2W85 A;  3WTY C;  4II2 A;  2VC1 A;  4LK0 F;  2QZ8 A;  2OZ6 A;  1R7J A;  1TQP A;  3CMA I;  2C6Y A;  1DPU A;  3WTZ A;  4J00 A;  3ML6 A;  3QOE A;  4XOT A;  2LFB A;  5F1J A;  4XSZ F;  3G71 I;  1WI3 A;  3AG1 H;  3TBI A;  2VE9 A;  4HV6 A;  3I59 B;  4DYR A;  2Y48 A;  4N4N B;  2LLK A;  3KP2 A;  3OR2 C;  4C30 A;  2GQQ A;  1L0O C;  3KEQ A;  4MTE A;  4E7L A;  3OYD A;  4G6T B;  2HEO A;  3CUQ B;  4YEL A;  5IT9 K;  4GXO A;  4EM1 A;  3L2U A;  2V7F A;  1FWZ A;  4N0B A;  2DK8 A;  3QPT A;  1XB4 A;  2COM A;  3S2H J;  1FYK A;  2IW5 A;  2Z1D A;  2ME6 A;  5D5U B;  1UAA A;  3S3M A;  1WHU A;  3KZZ A;  4E7S A;  4BGD A;  2V1N A;  2DYR H;  2RDP A;  1WPK A;  2CW8 A;  1UZC A;  4UV8 A;  3OY9 A;  4GDF A;  3R61 A;  3F8M A;  3VOE A;  1JHF A;  4B43 A;  3OIP A;  2P8T A;  2HDW A;  5D4R A;  2XSD C;  1I39 A;  4AIK A;  1K61 A;  1E2X A;  1WFX A;  4HST A;  4RAG A;  2BEO A;  2EK5 A;  1XTA A;  4S04 A;  1V5E A;  3I5U A;  4LGW A;  4BJ5 C;  1IG7 A;  4O6J A;  3K2Z A;  5FD6 A;  2F5C A;  4B48 A;  2LRD A;  4RM2 A;  5DM7 F;  2N8G A;  1X1A A;  2YPR A;  3FF5 A;  2FSW A;  1WJ5 A;  4MTD A;  3L2V A;  2A05 A;  2QVO A;  2YR2 A;  3IWZ A;  1IV6 A;  1GXQ A;  1ZHF A;  1AKH B;  2A07 F;  1V5F A;  5D5W B;  3J7A O;  3E1S A;  1IAW A;  4AVP A;  2M5W A;  1NK3 P;  3N4M A;  4BS9 A;  1S6L A;  2HQN A;  4NB5 A;  4C9Y A;  3ASO H;  3LSG A;  3AL0 B;  3PJR A;  1ZRE A;  3JRG A;  4K2E A;  1S7O A;  1KGS A;  3SDG A;  2JSP A;  3VB2 A;  2PLY A;  1KON A;  2EV5 A;  4R1H A;  4QWQ A;  2V6E A;  3I71 A;  3T8T A;  4U0W A;  2R7S A;  2F5E A;  3KCC A;  2QKL B;  5F0C A;  1ZG3 A;  3BR6 A;  5LBQ A;  1W5S A;  1Z9C A;  3ZXS A;  2EH3 A;  1IO2 A;  3D1N I;  1EA3 A;  3LSJ A;  4OAY A;  5DS9 A;  1W4M A;  3EYY A;  3P5J A;  3TW6 A;  3E97 A;  1MH4 A;  1ITY A;  3QYF A;  1WCM J;  2Y0S A;  4M3B A;  2EFQ A;  4BKX A;  1JUS A;  2L4A A;  2DQL A;  3IUO A;  3FM5 A;  3BR2 A;  3K1N A;  3WE3 A;  1PUF A;  3ABM H;  1XD7 A;  4HZF A;  1ZGJ A;  1BR2 A;  2WV0 A;  3BZ6 A;  2VL8 A;  5EEA A;  1Y0N A;  1RUN A;  3PNT A;  3H1C A;  2Y30 A;  2WB1 N;  2FNP A;  1I1G A;  2CUJ A;  2PMU A;  5A2Q K;  3ABL H;  3NQO A;  4RM3 A;  4ZYA A;  2ISY A;  1MGT A;  2K3F A;  4JBA A;  2HYJ A;  5KAI C;  2CUZ A;  4JX4 A;  3OYJ A;  1S72 I;  1XX5 A;  2EB7 A;  1ON1 A;  3WTW C;  2EA4 A;  1JJ8 C;  2OPT A;  2W57 A;  4ON0 A;  3HOY J;  5JI6 A;  2KKO A;  2E1N A;  4ITV A;  4MFD A;  1IJW C;  3OYG A;  1SFU A;  2HDD A;  1N78 A;  1G2H A;  4CZC A;  2HPM A;  2H8W A;  1VF9 A;  2DT6 A;  5E20 A;  1OR7 C;  4KIT B;  4H4K C;  1IXR C;  3ESW B;  4A3J J;  5D8K B;  3L2R A;  1R22 A;  1IN4 A;  1YE9 A;  3GTK J;  2X48 A;  4HV5 A;  4XLF A;  1U3E M;  2EZK A;  3BCB A;  2HYG D;  4DIQ A;  2E35 A;  4D1Q A;  3IAS 2;  2WAQ N;  1WRJ A;  3WU1 B;  1PP7 U;  3H92 A;  4FTH A;  2UUZ A;  3S2D J;  2LOO A;  2ZJ2 A;  3BTI A;  1G3T A;  3QQA A;  4I99 C;  5CVI A;  2FQ3 A;  5K5Q A;  1QVU A;  1HSJ A;  2KRF A;  2QSH X;  3OYN A;  3JRC A;  4FQG A;  2FOK A;  3Q0W A;  1BI1 A;  3TDZ C;  1EH8 A;  2JJ7 A;  3S8P A;  2Z9O A;  3QP5 A;  1IUY A;  2CQK A;  4AU7 A;  3DBR B;  1UHW A;  1P4X A;  2NVQ J;  1FNN A;  3ECO A;  3IRQ A;  2DT5 A;  3G4S I;  1J09 A;  2MA3 A;  3BLY A;  1LVK A;  5ICF A;  4G8X A;  2CUF A;  2J5O A;  2HNH A;  1BJZ A;  1O3R A;  1OKR A;  5JLW A;  4PJJ A;  1YJ9 I;  1Z21 A;  2PG4 A;  4NUB A;  5LFA A;  2F5V A;  2VKE A;  4I01 A;  1YHQ I;  5IP7 J;  2ACJ A;  1MNE A;  2OD5 A;  3K0L A;  3MQ0 A;  4G9Y A;  3FXM A;  5B3S H;  4G7Z F;  1LQ1 A;  3I9V 2;  3GFI A;  3GTJ J;  3WTU C;  2QSG X;  5F08 A;  2E7W A;  4DQ2 A;  2CH0 A;  5E8I A;  5KAF C;  1VQ4 I;  2QYO A;  2L7F P;  2H27 A;  4QPQ A;  4DW6 A;  3C1D A;  2ELJ A;  3B6C A;  4ZDL A;  4I2O A;  1XGN A;  1ON2 A;  4IO9 F;  1FYL A;  3TMO A;  1IXS B;  1PVE A;  4KYW A;  1A31 A;  1D0Z A;  2DK5 A;  3OYM A;  3RQ4 A;  1O57 A;  4BQN A;  5IT3 A;  1ETX A;  2VJJ A;  5BNG A;  2DA6 A;  4EEF G;  2V1D A;  1HF0 A;  4HYE A;  2P5L C;  1UHS A;  2E5Z A;  1ETO A;  4B4C A;  1RR7 A;  2JVH A;  2XKP A;  1VQO I;  2D1H A;  1YW9 A;  2EZL A;  1DDN A;  1X58 A;  3OYI A;  2VT3 A;  5ICE A;  2ZME C;  1R1V A;  2DT7 B;  1FMV A;  5F64 A;  4PCQ A;  3HSR A;  1MNM C;  1JKR C;  2Q1Z B;  4KDP A;  3RJP A;  3HOX J;  1QNT A;  3SEZ A;  3RIR A;  2L0K A;  2RNJ A;  4CCJ A;  2KPM A;  3OMY A;  2BBY A;  2RRE A;  3GFL A;  2XAQ A;  5ILV A;  3IC7 A;  2GIZ A;  4L9N A;  2ECB A;  3A0H C;  1G3Y A;  4PSW A;  1TL8 A;  4M6Y A;  3ZMZ A;  2DFH A;  4A0Z A;  4Y52 J;  1S29 A;  4P1W A;  1AHD P;  4AIJ A;  2XAG A;  5J1U A;  1H88 C;  3KPH A;  4ZDO A;  2E1M C;  2E34 A;  2YSR A;  3A02 A;  3CCR I;  1KU3 A;  1LEA A;  2FBH A;  3BG6 A;  4CSW A;  1DU6 A;  2X85 A;  1BC7 C;  1E0E A;  2NS7 A;  2K4J A;  3FXR A;  2LY1 A;  1O4X A;  4BYY A;  1JHH A;  2HXO A;  3B73 A;  1T8I A;  3S16 J;  1EH6 A;  3G3Z A;  4CCN A;  2YU3 A;  3BTC A;  2F2E A;  4E4H A;  3KET A;  4XLC A;  2GM4 A;  2TRT A;  1X4P A;  3K1P A;  4X6A J;  4XN3 A;  3W2V A;  1A35 A;  1Y39 A;  2I5U A;  3PQK A;  2MGQ A;  3T0Y A;  3U9G A;  3S1R J;  1QA6 A;  1I3A A;  1MJB A;  3H9Q A;  5BQT A;  3GFM A;  2XRO A;  2XVC A;  3HC7 A;  1FMW A;  2CW7 A;  1XG1 A;  1V5G A;  4I76 A;  3HSE A;  4LOC A;  5EZG A;  2O7O A;  4IOA F;  4UB8 C;  4Z6Y A;  2G7U A;  5HLI A;  5DUK A;  1R58 A;  1OCO H;  2B0L A;  2QBY A;  3GXO A;  3KFW X;  1Z67 A;  3HRU A;  4JX6 A;  4PK4 A;  4M73 A;  2UXN A;  2QQB A;  3U1D A;  5GPC A;  5E1X A;  1RRJ A;  1Y8R B;  4IHX A;  1X1B A;  2JRM A;  3GTG J;  2VBX A;  5L3C A;  2JVG A;  2WBM A;  2NRA C;  1JGS A;  1MMG A;  1ZR4 A;  3R0A A;  4HNV A;  4GFB A;  1IRG A;  2K9N A;  3OOP A;  3BG9 A;  4A3M J;  4P9U A;  1YFH A;  1GVD A;  1U5T A;  2CQQ A;  1A6I A;  3VEP A;  4NNJ A;  5HS8 A;  2JA6 J;  4L9J A;  4EQQ A;  3GCM A;  3GO5 A;  3T1B A;  1R5I D;  3M1E A;  1XSX A;  5AIQ A;  5LGT A;  3HOU J;  1R23 A;  3FHN A;  1FTT A;  4UHT A;  3JAM Z;  2DJI A;  5LHI A;  4RLQ A;  1POG A;  3EUH A;  4HPQ A;  2RVC A;  2EIJ H;  2VBZ A;  1KU7 A;  2HDC A;  2Y9Y A;  2G9W A;  3H5R A;  4HAM A;  5LGN A;  1YX3 A;  1W0T A;  3A01 A;  4GYI A;  2A6H F;  3GF2 A;  1KU9 A;  1FP2 A;  3MFK A;  2M4K A;  1T38 A;  1STZ A;  5LLQ A;  5FKL A;  3GX4 X;  1OCC H;  2QEX I;  3DQV C;  2WWY A;  1KYW A;  5EG0 B;  2ZC2 A;  1K78 A;  5ICG A;  5IPA A;  1HW5 A;  3BG3 A;  2VKD A;  2BGC A;  3G73 A;  1VTN C;  3HKZ A;  1T98 A;  3MD2 A;  4EJW A;  5E79 C;  4BJT A;  2GZW A;  2DOA A;  3DTK A;  1QGP A;  2DU9 A;  3BPV A;  4N9I A;  2KZV A;  1ZRF A;  3ZOB A;  3H35 A;  4PJ0 C;  3VWB A;  2R3S A;  4FIS A;  3VSK A;  3O3K A;  4D0P A;  2HKO A;  2CQX A;  4FX4 A;  3BT9 A;  3J80 K;  3WTT C;  4DGW B;  5IY5 H;  3OS2 A;  4IF4 A;  4LFU A;  4EJT A;  5E3M A;  2VPL A;  3LST A;  1HLV A;  1YG2 A;  1PP8 F;  2IA2 A;  2GOM A;  2X51 A;  4M6X A;  4I02 A;  2IGK A;  2VQL A;  3BR1 A;  4BHC A;  4GGG A;  3QYB A;  2STT A;  4N4O B;  1BW5 A;  1HDP A;  4B3A A;  3DBH B;  3SJM A;  1O3T A;  3K4J A;  3ROU A;  4FX0 A;  2BVM A;  5HLT A;  5HNH A;  1JT0 A;  1DQU A;  1YYV A;  3CD6 I;  1LEB A;  4PJL A;  4OMY A;  1XN7 A;  2OV7 A;  2Y31 A;  1RET A;  4KNY A;  3R0J A;  1BC8 C;  3KP4 A;  3DBL B;  1WWX A;  3W2W A;  1GVJ A;  2BY2 A;  1ETW A;  4U7B A;  1X3U A;  3HGY A;  1J0R A;  5JHU A;  3M8E A;  1SFO J;  2TCT A;  3OWT A;  3H3Z A;  5D8L B;  1RC9 A;  4BDY A;  1MMS A;  3I59 A;  3I0T A;  1U6G A;  3V7R A;  1SFK A;  4DJA A;  2MLG A;  1Y1V J;  2W1O A;  3KZY A;  4CIC A;  5CJ9 A;  3CUQ A;  3QPS A;  1WQ2 A;  4B1R A;  2WY7 Q;  4BNC A;  2HOT A;  1MBK A;  2FMY A;  4U88 A;  3CLQ A;  3LQR A;  4IJA A;  3CP8 A;  1BW6 A;  4XLA A;  3GTP J;  3WU0 A;  1B8I B;  2CGP A;  2PJP A;  3FXL A;  3O8G A;  5GAG J;  2M87 A;  3DKW A;  2K9M A;  2O3F A;  2R7Q A;  2WTE A;  3S32 A;  2E2J J;  2VBW A;  1UMQ A;  1K4T A;  2PMZ A;  3HEF A;  2A69 F;  1UHM A;  2OCC H;  1T0F A;  2AO9 A;  2QSF X;  4GRI A;  5F04 A;  2PI0 A;  5TIS C;  3I56 I;  2QF7 A;  5KK1 A;  1DGR M;  1UG2 A;  1LVA A;  1X1P A;  4HG2 A;  1J9I A;  5CQG A;  2R5Y B;  4CA0 A;  2Z16 A;  4LB5 A;  3OSG A;  4IHT A;  2VQG A;  3CLO A;  5CPR B;  1ZGW A;  4C2T A;  2EIN H;  1U8B A;  2V9V A;  3K70 D;  3WHC A;  2P6T A;  2Y69 H;  3E6D A;  2DA2 A;  2H6B A;  3D0S A;  4XNF A;  5GAE J;  3QPH A;  2XV4 S;  1TLH B;  3H36 A;  1XGO A;  4XLH A;  2ZXI A;  4M71 A;  1WI9 A;  4A93 J;  2IS2 A;  5J8F A;  3LSK A;  1AKH A;  2IA1 A;  3ZMS A;  2ZNZ A;  3IKT A;  1S3J A;  1XDS A;  4JQF A;  4D7N A;  2FNA A;  4U7D A;  5EEG A;  4F93 B;  4OIR F;  3BR3 A;  3QYE A;  4EGY A;  1Z6T A;  4IPA A;  3CCJ I;  3GEZ A;  2M34 A;  2WA0 A;  4CZZ A;  1N25 A;  4GO1 A;  1D3Y A;  2JUG A;  5D6E A;  4W1U A;  4BXU A;  2ELK A;  1VQL I;  2CV1 A;  1UCR A;  1YW7 A;  1X3W B;  2DTR A;  4MEX F;  2HQ5 A;  4XLE A;  2DJN A;  2X4H A;  3S14 J;  1R6R A;  1WH5 A;  3IL2 A;  3MMY B;  4MQ9 F;  4IQJ A;  5FJ8 J;  2MC3 A;  1OLT A;  2M0C A;  3DFG A;  1P2F A;  2OUM A;  1Q1V A;  5A2Q Z;  4KMF A;  3S1N J;  2LKP A;  1HKS A;  4BY7 J;  2IP2 A;  2WV1 A;  1MJ9 A;  2X6X A;  1CGP A;  2Y0S N;  4AM3 A;  1W5T A;  1Y56 A;  2DW4 A;  4II3 A;  1FC3 A;  2QCO A;  1U9O A;  1DPR A;  1VQP I;  2O0Y A;  2X1D A;  3CME I;  2DFF A;  2V9K A;  1I6X A;  3E0J B;  4G6D A;  3U21 A;  1G8X A;  4ZYD A;  3J7Z I;  3ZQC A;  2FA5 A;  2I8D A;  5FRM A;  3RZD J;  1ONV A;  4Q5S F;  1EKE A;  1XPX A;  1O7L A;  3LMM A;  2K02 A;  1HDD C;  4HNU A;  3K4K A;  3GYH X;  3L9F A;  3TW7 A;  2WAE A;  4RGS A;  4ZTF A;  2DMN A;  5J4V A;  2FXA A;  2KHM A;  3L2C A;  1FOW A;  4BUP A;  4RBO A;  1L3L A;  3JRI A;  1Q1H A;  4ZC3 A;  1FOX A;  2EZI A;  4E7Z A;  1VQ6 I;  2KZG A;  1R1U A;  3GWZ A;  3ZQ7 A;  3V8J A;  2HOS A;  2O8X A;  2QKM B;  3BJA A;  1FBU A;  2EA2 A;  4G6Q A;  4P9F A;  4G12 A;  2GLO A;  3DF8 A;  1GUU A;  3I64 A;  1ZTR A;  4EM2 A;  4CHU A;  2HGC A;  1KQ9 A;  4A3L J;  3A4C A;  1U8R A;  1RUO A;  3E7L A;  3QOD A;  2CO5 A;  3LA7 A;  5FKN A;  3PIO F;  1K83 J;  3IKV A;  4CUG A;  3OS0 A;  2K3P A;  1ZKG A;  2HOA A;  3DPT A;  4EV0 A;  2CMP A;  1XCB A;  4ETS A;  3K6G A;  4L9V A;  3ULQ B;  2DOF A;  1ZQ3 P;  1TWC J;  1CQT A;  4HOB A;  3J7Y J;  2BYV E;  2X1C A;  1H9G A;  2A5Y B;  2RNG A;  2XB5 A;  5CVU A;  1TBX A;  3F8B A;  4BEH A;  3P9I A;  3F21 A;  3KP6 A;  4CGZ A;  2YUS A;  4F55 A;  2K40 A;  1ETY A;  4BDZ A;  3H5N A;  1JUM A;  4PUS A;  5JR3 A;  4IX7 A;  2A6T A;  1FT9 A;  3PFY A;  5BPD A;  1AA7 A;  2GWR A;  4RB0 A;  3SDB A;  1ZN2 A;  2VB6 A;  4U87 A;  5DCM B;  5HOO A;  4LLN A;  3ZPL A;  2DI3 A;  4UVC A;  3WOD F;  4RGU A;  4JYK A;  3PO2 J;  4DZP A;  1RIO H;  3KP7 A;  1PYV A;  2OC6 A;  4E70 A;  1UJ8 A;  2DN0 A;  4UVA A;  3FKJ A;  2IS4 A;  2Z99 A;  2JRT A;  1TP4 A;  2R5Z B;  3REO A;  1IN8 A;  4ENK A;  4XRM A;  5LRR A;  3PQJ A;  2M4G A;  4XK4 A;  4E7H A;  3DXJ F;  3FM3 A;  4KIG A;  2WY8 Q;  2VJ5 A;  2XKO A;  5K5O A;  3DEW A;  1FEX A;  3DEU A;  1K7A A;  1YS7 A;  2DMT A;  1X19 A;  4XKC A;  4ZYH A;  2LTP A;  5M5Y J;  1YIJ I;  3M8J A;  3OIO A;  4A0X A;  4N9H A;  3VYU B;  3JSP A;  2Z3Y A;  3TP0 A;  1HXD A;  3ZP5 A;  1I1S A;  3VYS B;  1WJD A;  2JN6 A;  2XAU A;  2EWN A;  5HS9 A;  1JKQ C;  2D5V A;  2ZXJ A;  4CCL A;  2IT0 A;  1ZH5 A;  1B4A A;  3CCE I;  1Y6I A;  4A3I J;  2CU7 A;  2FJ1 A;  2UZK A;  2QQ9 A;  3C18 A;  1OCP A;  2HVS A;  3A2K A;  4EJU A;  4L5I A;  1GT0 C;  2ZSH B;  2DOD A;  2RQP A;  1HQC A;  3HHG A;  4G7H F;  4UNO A;  1MBH A;  1T08 B;  4PDK A;  3A0B C;  3FIS A;  3PNY A;  1R4M B;  1FIP A;  1Z77 A;  3ZQQ A;  1Z0X A;  4BQA A;  2LYC A;  3LWF A;  3S1Q J;  3J81 K;  1BR1 A;  5E17 F;  5HOD A;  4S05 A;  1FSH A;  5J8C A;  2LY2 A;  4MFE A;  2NYX A;  2IGM A;  3ZGK A;  1ETK A;  2LF7 A;  1VQ5 I;  2LR8 A;  4A6E A;  1GV5 A;  2NXN B;  1NG7 A;  4QTR A;  2E19 A;  2XF6 A;  2HWV A;  3BPX A;  3HBL A;  4HX8 A;  1LPQ A;  4DBQ A;  2KP6 A;  1J7K A;  2OAZ A;  2PFB A;  3I53 A;  2VON A;  2XUB A;  2XF5 A;  3TKY A;  1D1C A;  1KQ0 A;  3KYL A;  2RAE A;  3BJ6 A;  1U5T C;  4Y3O A;  2IEK A;  2NVT J;  2R93 J;  1UFM A;  5FD5 A;  4RAF A;  1JTX A;  3C2H A;  5EGO B;  2RQQ A;  3CJT B;  4ESJ A;  1SD4 A;  2ZJP F;  4R8H A;  3RI4 A;  1WJB A;  1VND A;  4PGH A;  3CJR B;  4M3D A;  3VYT B;  3EUH C;  2HXI A;  2KIM A;  2RN7 A;  3RYP A;  2VOO A;  2KFD A;  5LEJ A;  3K7A J;  1YTY A;  4C3I J;  3PM1 A;  3JCU C;  2R0Q C;  2LMD A;  3MZY A;  5KHD A;  1LE8 B;  4LK1 F;  4J19 A;  3P7N A;  4A2U A;  1R71 A;  1ULY A;  2DYS H;  5H20 A;  4QIW N;  1MND A;  3R6S A;  1Z6R A;  4AC0 A;  2MC4 A;  2M7A A;  4E7K A;  2B63 J;  3MZH A;  4HF2 A;  3T8R A;  3QU3 A;  5CVR A;  4BEH B;  1SFE A;  1K6O A;  2EFN A;  4MLO A;  4NC6 A;  4MHG A;  2EFO A;  3FMQ A;  1S7E A;  1JKO C;  3GBG A;  1LKX A;  3N97 A;  1QPM A;  3M8F A;  2L7K A;  2DCE A;  5GPA A;  2NVX J;  3DEE A;  3HUG B;  3K4N A;  1HCR A;  1VQM I;  2CV2 A;  3GTQ J;  2K9Q A;  4C2M J;  2E2H J;  5IP6 A;  2IJL A;  2OQG A;  2XGX A;  1VQK I;  3ZN1 A;  3K70 C;  2KIQ A;  3CCM I;  2FML A;  5CVV A;  5J1Y A;  5BPI A;  2ID6 A;  3F3X A;  4A12 A;  3CMY A;  2IS1 A;  2JA2 A;  4PFO A;  3HOZ J;  3HYI A;  4A3K J;  3LA3 A;  4A5N A;  3BR5 A;  3WTV C;  1D8J A;  4KMU X;  4GYG A;  1H9T A;  3OIQ A;  2BW3 B;  1GXP A;  5K5R A;  3Q5F A;  3LSR A;  4Y7N J;  4D9J A;  3CO6 C;  3R4K A;  3FK7 A;  2EBI A;  1K4S A;  2GAU A;  2VC0 A;  3FBI B;  1MIJ A;  1FYM A;  4RLF A;  2HPI A;  4KN7 X;  4XRS G;  1IZ1 A;  2M8E A;  4XM3 A;  4WCG A;  5KNL A;  3QWL A;  3DLA A;  3E3V A;  4V2F A;  3V8K A;  2P81 A;  2E1O A;  2L2O A;  1D0X A;  4RB3 C;  2XAH A;  4CDG A;  3WGG A;  2KLO A;  4EM0 B;  1FTZ A;  4IKF A;  1SFX A;  1F4K A;  3LSI A;  4E7I A;  3TGN A;  2HFH A;  2XSJ C;  1FSE A;  1YRN B;  5DYM A;  5AIP A;  1TNS A;  4XN0 A;  4A3B J;  4QSH A;  1OFC X;  2TDX A;  1E17 A;  1FBQ A;  1GLN A;  2JMW A;  2ZJR F;  5L3F A;  2DBB A;  1KYZ A;  2Q0O A;  2OTL I;  2BY1 A;  4BXX J;  2KIF A;  2Z2S B;  2MSY A;  4CCM A;  2HTS A;  3CUQ C;  4WXC A;  4D5C A;  1ZGA A;  1QQI A;  2L7Z A;  1IRF A;  5HDN A;  2RC4 A;  2VPR A;  2KL4 A;  2L01 A;  3C7J A;  2EQR A;  2JTV A;  2G7H A;  4XKV A;  4B09 A;  3AKZ A;  1D5Y A;  4D7M A;  1JXS A;  3FXU A;  2ZFU A;  1R36 A;  1GHC A;  2A6E F;  4Y17 A;  4ANJ A;  2NOJ B;  2M2E A;  3G1O A;  1ENH A;  4D5F A;  3MEX A;  3KLN A;  1APL C;  5J47 A;  5EG0 A;  2XAJ A;  5CYV A;  2I10 A;  1Z7U A;  1ZLJ A;  3J7A Y;  3PSI A;  4A3E J;  2DO7 A;  4XKB A;  5C3E J;  4BBR J;  2E5N A;  3X2Q H;  3GUD A;  3MKY B;  4LG3 A;  3HKZ N;  3AG2 H;  2FF4 A;  3CDL A;  2GA2 A;  1QHG A;  2CW0 F;  4XON A;  1V55 H;  3N05 A;  1SVO A;  4CYC B;  2CRG A;  1I6H J;  2KJC A;  1IGN A;  1FBS A;  2K9L A;  5K7F A;  5E3N A;  1QRY A;  5HLG A;  2EIM H;  1SD7 A;  4XIC A;  2Y75 A;  5HVQ C;  5J1R A;  5D5X B;  4YFN F;  5EZH A;  2M7B A;  1XGM A;  1XSV A;  1MJA A;  3L2W A;  3AL0 C;  3M3Y J;  5L3G A;  1SMT A;  1RI7 A;  2OQR A;  2HZD A;  2KQR A;  3OL3 A;  1FZP B;  1BJA A;  3LA2 A;  3M07 A;  3SZP A;  1FY7 A;  2PEX A;  3HOS A;  1ETV A;  3BWG A;  4ZZD A;  4A3C J;  3DU5 A;  1V4R A;  4BY1 J;  3HTU A;  4XOP A;  1N77 A;  3Q3S A;  1I50 J;  2R7V A;  2NNN A;  4IHW A;  2CS3 A;  3H0G J;  4AVZ A;  2MW8 A;  3H3U A;  3VDX A;  3CCQ I;  2VT2 A;  1FOK A;  1V54 H;  3RCO A;  2XB0 X;  5FLX Z;  1YW8 A;  3F72 A;  1UST A;  4UB6 C;  2JPC A;  1HW1 A;  4S0H B;  1OIS A;  1TWA J;  4MEY F;  4KT5 C;  3WG7 H;  2L02 A;  4ASN A;  5J4Y A;  1BOA A;  2DMQ A;  4DBR A;  3E6C C;  1IC8 A;  2O9L A;  5F27 A;  5F6F A;  1IN6 A;  4FAS D;  1WJA A;  1R1T A;  1B8I A;  2JZY A;  2DA3 A;  3W2A A;  2ZFW A;  2XRN A;  3KP3 A;  2W48 A;  4E6K G;  3RKW A;  2YX7 A;  1EV7 A;  2QUF A;  2FU4 A;  4OMZ A;  5ERI A;  1OCZ H;  3HRS A;  4L18 B;  1C0W A;  2DFI A;  3IH2 A;  2PMZ N;  3WHB A;  5L3E A;  3EET A;  2DLL A;  3SFZ A;  3CCV I;  4RGX A;  2Y0M A;  5TGT A;  2NVU B;  5HDG A;  2NNY A;  1NHA A;  2F4M B;  2M0M A;  3G2B A;  3ZQL A;  2R5Y A;  4XRS A;  1O3S A;  5F0H A;  3S2W A;  4LIT A;  2ZCW A;  4XOR A;  3D5R C;  2LBF B;  1P4W A;  3FK6 A;  3S93 A;  1Z91 A;  1HKT A;  1WJE A;  2VAS A;  1R00 A;  5BS6 A;  3S3N A;  2X6Y A;  3IHU A;  2PMH A;  2W00 A;  3EUA A;  1EF4 A;  2FBI A;  1IF1 A;  3H0D A;  2FX0 A;  3BTL A;  2KRC A;  1NTC A;  4G7O F;  1IRZ A;  3K4C A;  1TC3 C;  4UUS B;  2LKS A;  3CJN A;  2JA5 J;  3OR1 C;  2CQN A;  1JJ6 C;  1UEL B;  1IDZ A;  3CCS I;  2LG4 A;  4KT6 A;  1HBX G;  3E6M A;  4JX5 A;  5LRS A;  1G4D A;  2KDZ A;  2Q2E B;  5E3O A;  4XMY A;  1W0U A;  1TQI A;  3P9K A;  2XAF A;  3QP6 A;  2HS5 A;  3GZ6 A;  3SEQ A;  2EV0 A;  4UV9 A;  3ABK H;  1EH7 A;  3GLX A;  3HGG A;  2F4I A;  3JTG A;  5M5X J;  2XF7 A;  3ECH A;  3DKY A;  1KQ8 A;  2BHZ A;  5HS7 A;  3MCZ A;  4PFP A;  4AYB A;  3DV8 A;  3IWF A;  2R7O A;  1MZB A;  2OTJ I;  3GTO J;  5GTH C;  1W7P D;  4BQO A;  4JK1 X;  3RKY A;  3VOD A;  1HA8 A;  2GXB A;  1MDM B;  2PBI A;  2QWW A;  2R7U A;  4XKW A;  1FJL A;  1SD6 A;  2MFZ A;  3JR9 A;  6PAX A;  4HW0 A;  3UKG A;  3W6J B;  2H1L A;  3BTJ A;  1P9Q C;  4LLG F;  2NOG A;  2V79 A;  5IOY A;  2HTJ A;  4KIS A;  3HTS B;  3HRM A;  1ORK A;  1YLF A;  1MBF A;  2X6O A;  4DNC A;  1T95 A;  1WVR A;  1T56 A;  5IT9 Z;  1JE8 A;  3BG5 A;  2QLZ A;  5IOZ A;  1FX7 A;  2EIK H;  3QPL A;  4LJZ F;  1REP C;  3ASN H;  3ZQF A;  3S1M J;  5IYD J;  1K79 A;  4NQW B;  5J40 A;  2L3D A;  4FET A;  4LIV A;  5FB2 A;  3BZK A;  4HRI A;  1MKM A;  2P6S A;  5KVR A;  3ZMD A;  2CFO A;  4HQE A;  1LNW A;  1XMX A;  1XCV A;  3G1M A;  4Y13 A;  2KIS A;  1E3H A;  1W7P B;  4DYQ A;  2LP0 A;  4IXA A; 
#chains in the Genus database with same CATH homology
 3WGI A;  4IHS A;  2X0L A;  2EFP A;  3TOB A;  3F6O A;  4XRF A;  2OBP A;  5E1Z B;  3ZMV A;  1KA8 A;  2MH2 A;  2CSO A;  1F5T A;  1Y0U A;  3WTS C;  1G3W A;  3U2R A;  4MNU A;  4KIC A;  5E1W A;  4XLN F;  5EEH A;  5DCM A;  1B6A A;  4HQM A;  5CLS A;  4YG2 F;  1YQA A;  2CG4 A;  4EJO A;  5BOX A;  5DDG A;  1OYY A;  3WTX C;  2ESH A;  3FX3 A;  2QM3 A;  4ZYE A;  1O7F A;  4RB2 C;  2ZKZ A;  1QBJ A;  5H6Q A;  4KN4 X;  3TO6 A;  4AIH A;  5J6X A;  4U0V A;  3JAM K;  5H6R A;  3F23 A;  2UXX A;  2AXL A;  3J81 Z;  4L5J A;  1U78 A;  1ZAR A;  5JFR A;  4HBL A;  2L54 A;  5DD4 A;  2H09 A;  3BY6 A;  2JPB A;  2MBF A;  3E5U A;  2OZU A;  2DAO A;  2EJR A;  1XMA A;  3V7C A;  5FFX A;  2M30 A;  3D5L A;  4WWC A;  3GVA A;  1LDJ A;  5DCF A;  4ESB A;  1PUE E;  1G3S A;  4A6D A;  2LDU A;  2RKH A;  1Z05 A;  2A61 A;  5DD8 A;  1J2X A;  4HLX A;  1S8N A;  3BDD A;  2H6C A;  3EDP A;  2E7X A;  1LB2 A;  1IN7 A;  4IVN A;  2LF8 A;  4P96 A;  3TOA A;  1AWC A;  2KJB A;  2HYF A;  5ED4 A;  3WGH A;  2KIU A;  4ENJ A;  4OIN F;  4KIF A;  2K27 A;  2WC2 A;  1B1B A;  3T5X A;  2VN2 A;  3MAJ A;  4M9X A;  1ZYR F;  3O6B B;  2XIG A;  3F6V A;  3HUG A;  2D1V A;  4BAY A;  1PDN C;  1OPC A;  2IVM A;  1IN5 A;  2ZME B;  3K1M A;  2GIV A;  2GXG A;  3NEU A;  4Q47 A;  2FBK A;  4NHJ A;  3CUO A;  3LQQ A;  2NS0 A;  3L09 A;  5D4S A;  1RNL A;  1A04 A;  1TW3 A;  5FFZ A;  1T2K A;  2OU2 A;  3TO7 A;  2LNB A;  4G94 A;  3FZV A;  1G6N A;  2XAS A;  5FO5 A;  2BV6 A;  3FXQ A;  3EYI A;  2CFX A;  1WSU A;  3WE2 A;  1SD5 A;  1P92 A;  4HDU A;  3GFJ A;  4H0E A;  3BJO A;  3ZN0 A;  3KE2 A;  3RDI A;  3ERE D;  4PZJ A;  2RV8 A;  1FP1 D;  2IRF G;  2YX4 A;  4CO8 A;  3TO9 A;  2MH9 A;  3SQN A;  4KFC A;  5E8G A;  3IRR A;  4B8X A;  4ZH4 F;  1IW7 F;  1CF7 B;  1ZG5 A;  1V3F A;  1F1Z A;  3FMS A;  3BOQ A;  5JVT A;  2F5F A;  5DUI A;  4HA8 A;  4HLY A;  4WK8 F;  3KP5 A;  5D6F A;  4XBF A;  3LAJ A;  2STW A;  1ZG1 A;  1TNT A;  2P4W A;  5LGU A;  1P4A A;  3HOT A;  2W24 A;  4U0Y A;  3V7S A;  3SZT A;  3E6B A;  1LDD A;  1BIA A;  4M72 A;  1BI3 A;  3OV8 A;  2P7C B;  1H0M A;  4ZZL A;  3R60 A;  4TV7 A;  4HF1 A;  3NRV A;  2CYY A;  2H94 A;  3GW2 A;  4OIP F;  4LLL A;  3FHZ A;  4RAZ A;  1SMY F;  1DP7 P;  3P9C A;  4Y15 A;  5F1R A;  4L9T A;  3F8F A;  2FRH A;  4OIQ F;  3I58 A;  3L7W A;  1LJ9 A;  1YS6 A;  2ZNY A;  5L3B A;  4WXH A;  4YFX F;  1T39 A;  4UXN A;  3KEO A;  1RZ4 A;  1J5Y A;  1HW2 A;  4MGR A;  4UVB A;  3E5X A;  5CVJ A;  3TQN A;  3PFI A;  2GA1 A;  4ENM A;  2EFW A;  4BHB A;  2ELH A;  3FMR A;  1D8K A;  4CYD A;  5LHG A;  4LD5 A;  3SXY A;  2M1B A;  3CTA A;  1UB9 A;  1XDU A;  2ZBK A;  3DPL C;  1YIO A;  4YFK F;  2Z33 A;  2JSC A;  1TW2 A;  2EV6 A;  2PN6 A;  3F8C A;  2NAZ A;  4OOI A;  1FLI A;  2W25 A;  3MWM A;  5K1Y A;  4O5V A;  1ZRC A;  2V6C A;  2Q2E A;  3L00 A;  4EMS A;  3J80 Z;  5E18 F;  2D2W A;  1BI2 A;  4YIF A;  2P7V B;  3ZMT A;  5TJJ A;  3O2P E;  2P5V A;  4AWX B;  3QU6 A;  4EVI A;  2O6G E;  1BI0 A;  3LFK A;  1MDM A;  2HZT A;  2ETH A;  2FE3 A;  4M9Z A;  1OYW A;  1YO5 C;  2HOE A;  4MQV A;  4L0Y B;  1I5Z A;  2K86 A;  4FHT A;  5L3D A;  4BH9 A;  3F8N A;  2OA4 A;  4M9S A;  4RS8 A;  5LHH A;  4XSX F;  1KU2 A;  1LDK B;  4I7H A;  4NQW A;  5ICC A;  3AAF A;  1T6S A;  4RAY A;  5LEK A;  4IRG A;  1USS A;  1W7P A;  3JTH A;  4LB6 B;  1B9M A;  3WG9 A;  2VOP A;  2F5D A;  3F22 A;  2D45 A;  2FEZ A;  2HKX A;  1MD0 A;  1XSD A;  3RPU A;  4HX7 A;  3C3W A;  2HR3 A;  3GZ5 A;  4IRI A;  2DQR A;  4WX9 A;  4KA4 A;  4F7Z A;  5AON A;  5ILS A;  4HDV A;  4ENN A;  2K7L A;  2Q8K A;  5DEQ A;  3M7G A;  1BIB A;  4I98 B;  4PGG A;  4A5M A;  3DP7 A;  1BBY A;  2CWE A;  2J5P A;  1R5G A;  2M45 A;  4P5O A;  4OU0 A;  4IRH A;  1OR7 A;  4Z2Y A;  4Q48 A;  1ZLK A;  1J75 A;  2K4B A;  2QEN A;  4OIO F;  2ADU A;  2ESN A;  2IPQ X;  3ZMU A;  1HKQ A;  4EGZ A;  4FT8 A;  2RGV A;  4I0B A;  1IXC A;  3V8L A;  1QO0 D;  2L4M A;  3LAP A;  4HX4 A;  1Z1D A;  4ESF A;  3CO7 C;  3I54 A;  2E1C A;  4LG0 A;  1BN5 A;  2ISZ A;  4L0Z B;  1HST A;  1FPQ A;  3Q9V A;  4AD9 A;  2R7D A;  4I0A A;  2AS5 F;  2MLK A;  4R79 A;  2QQA A;  2R7F A;  4XLP F;  2BE5 F;  3EQL F;  3RTR A;  1SAX A;  2DPD A;  4KUM A;  2PQ8 A;  4RGR A;  3ELK A;  2V1U A;  3HSF A;  5HLH A;  4BHP A;  2O03 A;  3Q9S A;  3E5Q A;  1WKM A;  2LSO A;  4WXD A;  5FGM A;  1TTY A;  1TQM A;  1OMI A;  2A3S A;  2XHK A;  3QOP A;  2UWM A;  2VBY A;  1D5V A;  3HRT A;  2ZO4 A;  2HQR A;  1XGS A;  3BP8 A;  4CXF A;  3CDH A;  3M9A A;  3HHH A;  2QBY B;  4UUV A;  5FLX K;  1I27 A;  2IA0 A;  3TDU C;  4HF0 A;  4KIB A;  3B02 A;  3K9T A;  1QZZ A;  1QZY A;  3ABU A;  1U5T B;  1R5H A;  3K69 A;  4I09 A;  1BM9 A;  2VXZ A;  2ZME A;  4GCV A;  4P55 A;  1U2W A;  2P5K A;  4RB1 A;  4QLC U;  5BMZ A;  5ILU A;  1DUX C;  1B9N A;  4A0Y A;  5D5V B;  4ZYG A;  1ODD A;  3COA C;  2VOD A;  2O61 A;  3HIF A;  5TRD A;  3QRF F;  5HDK A;  4Q4Z F;  3KLO A;  3QAH A;  1K78 B;  2W84 A;  3ISP A;  2MD5 A;  1OYI A;  1ZAO A;  3BRO A;  3RKX A;  3ABT A;  3VFZ A;  4WF2 A;  4LG0 B;  1F9N A;  5DV5 A;  1S7A A;  1J59 A;  2A68 F;  3RYR A;  4M74 A;  3V4G A;  3JSO A;  3I4P A;  2JT1 A;  1B59 A;  3SHF A;  1CF7 A;  1ZRD A;  1O3Q A;  3JW4 A;  3W6K B;  2DPU A;  2VE8 A;  4LMY A;  1P6R A;  3FWE A;  4O3M A;  4YII A;  1AOY A;  4EJV A;  2V1X A;  3RPQ A;  2Z5U A;  1XMK A;  2W85 A;  3WTY C;  2VC1 A;  4LK0 F;  2QZ8 A;  2OZ6 A;  1R7J A;  1TQP A;  2C6Y A;  1DPU A;  3WTZ A;  3ML6 A;  4XSZ F;  2VE9 A;  4HV6 A;  3I59 B;  2Y48 A;  3KP2 A;  2GQQ A;  1L0O C;  3KEQ A;  4MTE A;  2HEO A;  3CUQ B;  5IT9 K;  4GXO A;  4EM1 A;  1FWZ A;  4N0B A;  2DK8 A;  3QPT A;  1XB4 A;  2COM A;  1FYK A;  2IW5 A;  5D5U B;  3KZZ A;  2RDP A;  4UV8 A;  3R61 A;  3F8M A;  3VOE A;  1JHF A;  2P8T A;  5D4R A;  4AIK A;  1E2X A;  2BEO A;  2EK5 A;  4S04 A;  3I5U A;  4LGW A;  4O6J A;  3K2Z A;  5FD6 A;  2F5C A;  2YPR A;  3FF5 A;  2FSW A;  4MTD A;  2QVO A;  2YR2 A;  3IWZ A;  1GXQ A;  1ZHF A;  2A07 F;  5D5W B;  3J7A O;  1IAW A;  4AVP A;  2M5W A;  3N4M A;  1S6L A;  2HQN A;  4NB5 A;  1ZRE A;  4K2E A;  1S7O A;  1KGS A;  3VB2 A;  2PLY A;  2EV5 A;  4R1H A;  4QWQ A;  3I71 A;  3T8T A;  4U0W A;  2F5E A;  3KCC A;  1ZG3 A;  5LBQ A;  1W5S A;  1Z9C A;  1W4M A;  3EYY A;  3E97 A;  2EFQ A;  2L4A A;  2DQL A;  3FM5 A;  3WE3 A;  3K1N A;  1XD7 A;  4HZF A;  1ZGJ A;  2WV0 A;  3BZ6 A;  1RUN A;  2FNP A;  1I1G A;  2PMU A;  5A2Q K;  3NQO A;  2ISY A;  1MGT A;  4JBA A;  2EB7 A;  1ON1 A;  3WTW C;  2EA4 A;  2W57 A;  4ON0 A;  5JI6 A;  2KKO A;  2E1N A;  1SFU A;  5E20 A;  1IXR C;  5D8K B;  1R22 A;  1IN4 A;  4HV5 A;  1U3E M;  2HYG D;  3WU1 B;  1WRJ A;  1PP7 U;  3H92 A;  2ZJ2 A;  1G3T A;  5CVI A;  5K5Q A;  2FQ3 A;  1HSJ A;  2KRF A;  2FOK A;  1BI1 A;  3TDZ C;  1EH8 A;  2Z9O A;  3QP5 A;  1IUY A;  2CQK A;  1UHW A;  1P4X A;  1FNN A;  3ECO A;  3IRQ A;  2DT5 A;  2MA3 A;  5ICF A;  4G8X A;  2J5O A;  1O3R A;  1OKR A;  2PG4 A;  4I01 A;  2ACJ A;  2OD5 A;  3K0L A;  3MQ0 A;  4G9Y A;  1LQ1 A;  4G7Z F;  3GFI A;  3WTU C;  2E7W A;  4DQ2 A;  5E8I A;  2QYO A;  2H27 A;  3C1D A;  4I2O A;  1XGN A;  1ON2 A;  1FYL A;  1IXS B;  4KYW A;  2DK5 A;  1O57 A;  5IT3 A;  2V1D A;  4HYE A;  2P5L C;  2XKP A;  2D1H A;  1YW9 A;  1DDN A;  2VT3 A;  5ICE A;  1R1V A;  5F64 A;  4PCQ A;  3HSR A;  4KDP A;  3RJP A;  1QNT A;  3RIR A;  2RNJ A;  2BBY A;  3GFL A;  2XAQ A;  5ILV A;  3IC7 A;  4L9N A;  1G3Y A;  4M6Y A;  3ZMZ A;  4A0Z A;  1S29 A;  4AIJ A;  2XAG A;  2YSR A;  1KU3 A;  1LEA A;  2FBH A;  1BC7 C;  2K4J A;  3FXR A;  4BYY A;  1JHH A;  3B73 A;  1EH6 A;  3G3Z A;  2YU3 A;  2F2E A;  3KET A;  3K1P A;  3PQK A;  3T0Y A;  3U9G A;  1MJB A;  5BQT A;  3GFM A;  2XRO A;  2XVC A;  3HSE A;  2G7U A;  5HLI A;  5DUK A;  1R58 A;  2B0L A;  2QBY A;  3GXO A;  3KFW X;  3HRU A;  4M73 A;  2UXN A;  2QQB A;  3U1D A;  5E1X A;  2VBX A;  5L3C A;  2NRA C;  1JGS A;  3R0A A;  1IRG A;  3OOP A;  4P9U A;  1YFH A;  1U5T A;  3VEP A;  5HS8 A;  4L9J A;  4EQQ A;  3GO5 A;  3T1B A;  5LGT A;  3M1E A;  1XSX A;  5AIQ A;  1R23 A;  4UHT A;  3JAM Z;  5LHI A;  3EUH A;  2RVC A;  2VBZ A;  1KU7 A;  2HDC A;  2G9W A;  4HAM A;  5LGN A;  4GYI A;  2A6H F;  3GF2 A;  1KU9 A;  1FP2 A;  3MFK A;  1T38 A;  1STZ A;  5LLQ A;  3GX4 X;  3DQV C;  2WWY A;  1KYW A;  1K78 A;  5ICG A;  1HW5 A;  2BGC A;  3G73 A;  1VTN C;  4EJW A;  1T98 A;  2GZW A;  1QGP A;  2DU9 A;  3BPV A;  4N9I A;  1ZRF A;  2R3S A;  3O3K A;  4D0P A;  2HKO A;  4FX4 A;  3J80 K;  3WTT C;  4IF4 A;  4LFU A;  4EJT A;  3LST A;  1YG2 A;  1PP8 F;  2IA2 A;  4M6X A;  4I02 A;  4BHC A;  4GGG A;  2STT A;  1O3T A;  3ROU A;  4FX0 A;  1YYV A;  1LEB A;  4OMY A;  1XN7 A;  4KNY A;  3R0J A;  1BC8 C;  3KP4 A;  1WWX A;  1GVJ A;  4U7B A;  1X3U A;  1J0R A;  5JHU A;  3M8E A;  3H3Z A;  5D8L B;  3I59 A;  3I0T A;  1U6G A;  3V7R A;  2MLG A;  3KZY A;  4CIC A;  5CJ9 A;  3CUQ A;  1WQ2 A;  4BNC A;  2FMY A;  4U88 A;  4IJA A;  3LQR A;  3WU0 A;  2CGP A;  2PJP A;  2M87 A;  3DKW A;  2WTE A;  2O3F A;  2VBW A;  2A69 F;  1UHM A;  1T0F A;  2PI0 A;  5KK1 A;  1LVA A;  1J9I A;  4LB5 A;  4IHT A;  3CLO A;  2V9V A;  2P6T A;  3E6D A;  2H6B A;  3D0S A;  3QPH A;  2XV4 S;  1TLH B;  1XGO A;  4M71 A;  1WI9 A;  5J8F A;  2IA1 A;  3ZMS A;  2ZNZ A;  3IKT A;  1S3J A;  1XDS A;  4JQF A;  2FNA A;  4U7D A;  5EEG A;  4OIR F;  4EGY A;  1Z6T A;  4IPA A;  3GEZ A;  4CZZ A;  4GO1 A;  1D3Y A;  5D6E A;  4BXU A;  1UCR A;  1YW7 A;  2DTR A;  4MEX F;  2X4H A;  3IL2 A;  4MQ9 F;  2MC3 A;  3DFG A;  1P2F A;  5A2Q Z;  4KMF A;  2LKP A;  1HKS A;  2IP2 A;  1MJ9 A;  1CGP A;  1W5T A;  2DW4 A;  1FC3 A;  1DPR A;  2O0Y A;  1I6X A;  4G6D A;  4ZYD A;  2FA5 A;  1ONV A;  4Q5S F;  1O7L A;  2K02 A;  3GYH X;  3L9F A;  4RGS A;  2FXA A;  3L2C A;  1L3L A;  1Q1H A;  1R1U A;  3GWZ A;  3ZQ7 A;  3V8J A;  2O8X A;  3BJA A;  1FBU A;  2EA2 A;  4G6Q A;  4P9F A;  3DF8 A;  3I64 A;  4EM2 A;  4CHU A;  2HGC A;  1KQ9 A;  1U8R A;  1RUO A;  2CO5 A;  3LA7 A;  3IKV A;  4EV0 A;  3DPT A;  1XCB A;  4ETS A;  4L9V A;  3ULQ B;  4HOB A;  2BYV E;  1H9G A;  2A5Y B;  5CVU A;  1TBX A;  3F8B A;  3P9I A;  3F21 A;  3KP6 A;  4CGZ A;  5JR3 A;  1FT9 A;  5BPD A;  2GWR A;  4RB0 A;  1ZN2 A;  5DCM B;  5HOO A;  4LLN A;  3ZPL A;  2DI3 A;  4UVC A;  3WOD F;  4RGU A;  1RIO H;  3KP7 A;  4E70 A;  4UVA A;  2Z99 A;  2JRT A;  3REO A;  1IN8 A;  4ENK A;  5LRR A;  3PQJ A;  3DXJ F;  3FM3 A;  4KIG A;  2XKO A;  5K5O A;  3DEU A;  1K7A A;  1YS7 A;  4ZYH A;  4A0X A;  4N9H A;  3JSP A;  2Z3Y A;  1HXD A;  3ZP5 A;  1I1S A;  2EWN A;  5HS9 A;  1ZH5 A;  2IT0 A;  2ZXJ A;  1B4A A;  2UZK A;  2QQ9 A;  3C18 A;  4EJU A;  4L5I A;  2RQP A;  1HQC A;  3HHG A;  4G7H F;  4UNO A;  4PDK A;  4BQA A;  3LWF A;  3J81 K;  5E17 F;  4S05 A;  1FSH A;  5J8C A;  2NYX A;  2LF7 A;  4A6E A;  2HWV A;  3BPX A;  4HX8 A;  2OAZ A;  1J7K A;  2PFB A;  3I53 A;  2VON A;  2XUB A;  3TKY A;  1KQ0 A;  3BJ6 A;  1U5T C;  1UFM A;  5FD5 A;  4ESJ A;  1SD4 A;  4R8H A;  3RI4 A;  4PGH A;  2KIM A;  2RN7 A;  3RYP A;  2VOO A;  5LEJ A;  1YTY A;  3MZY A;  4LK1 F;  3P7N A;  4A2U A;  1ULY A;  5H20 A;  3R6S A;  1Z6R A;  3MZH A;  4HF2 A;  3T8R A;  3QU3 A;  5CVR A;  1SFE A;  1K6O A;  2EFN A;  4MHG A;  2EFO A;  3FMQ A;  3N97 A;  1QPM A;  3M8F A;  2IJL A;  2OQG A;  2XGX A;  3ZN1 A;  2FML A;  5CVV A;  5BPI A;  3F3X A;  4A12 A;  3HYI A;  3LA3 A;  4A5N A;  3WTV C;  1D8J A;  4KMU X;  4GYG A;  1H9T A;  1GXP A;  5K5R A;  3Q5F A;  3CO6 C;  3R4K A;  2GAU A;  2VC0 A;  1FYM A;  4KN7 X;  1IZ1 A;  2M8E A;  4WCG A;  3V8K A;  3E3V A;  4RB3 C;  2XAH A;  4CDG A;  3WGG A;  4EM0 B;  1SFX A;  1F4K A;  3TGN A;  2HFH A;  1FSE A;  5DYM A;  5AIP A;  1TNS A;  1E17 A;  2TDX A;  1FBQ A;  5L3F A;  2DBB A;  1KYZ A;  2Q0O A;  2KIF A;  2HTS A;  3CUQ C;  4WXC A;  1ZGA A;  1QQI A;  1IRF A;  5HDN A;  2RC4 A;  3C7J A;  2L01 A;  2JTV A;  2G7H A;  4B09 A;  1JXS A;  3FXU A;  1R36 A;  1GHC A;  2A6E F;  4Y17 A;  3MEX A;  3KLN A;  2XAJ A;  5CYV A;  1Z7U A;  1ZLJ A;  2DO7 A;  3GUD A;  2FF4 A;  2GA2 A;  2CW0 F;  2KJC A;  1FBS A;  5HLG A;  1SD7 A;  2Y75 A;  5HVQ C;  5D5X B;  4YFN F;  1XGM A;  1XSV A;  1MJA A;  5L3G A;  1SMT A;  1RI7 A;  2OQR A;  1FZP B;  1BJA A;  3LA2 A;  3SZP A;  1FY7 A;  2PEX A;  3HOS A;  3BWG A;  4ZZD A;  1V4R A;  3HTU A;  2NNN A;  3H3U A;  1FOK A;  2VT2 A;  5FLX Z;  1YW8 A;  3F72 A;  1UST A;  2JPC A;  1HW1 A;  4MEY F;  4KT5 C;  2L02 A;  4ASN A;  1BOA A;  3E6C C;  5F6F A;  1IN6 A;  1R1T A;  2JZY A;  2ZFW A;  2XRN A;  3KP3 A;  3RKW A;  2YX7 A;  1EV7 A;  2QUF A;  2FU4 A;  4OMZ A;  5ERI A;  3HRS A;  4L18 B;  1C0W A;  2DFI A;  5L3E A;  3EET A;  2DLL A;  3SFZ A;  4RGX A;  2Y0M A;  5HDG A;  2NNY A;  1NHA A;  1O3S A;  3S2W A;  2ZCW A;  1P4W A;  1Z91 A;  1HKT A;  1R00 A;  5BS6 A;  3IHU A;  2PMH A;  2FBI A;  1IF1 A;  4G7O F;  3CJN A;  1HBX G;  3E6M A;  5LRS A;  1G4D A;  1TQI A;  3P9K A;  2XAF A;  3QP6 A;  2HS5 A;  3GZ6 A;  2EV0 A;  4UV9 A;  1EH7 A;  3GLX A;  3JTG A;  3ECH A;  1KQ8 A;  5HS7 A;  3MCZ A;  3DV8 A;  3IWF A;  1MZB A;  1W7P D;  4JK1 X;  3RKY A;  3VOD A;  2GXB A;  1MDM B;  2PBI A;  2QWW A;  1SD6 A;  6PAX A;  4HW0 A;  3W6J B;  4LLG F;  2V79 A;  2HTJ A;  3HTS B;  3HRM A;  1YLF A;  4DNC A;  5IT9 Z;  1JE8 A;  2QLZ A;  1FX7 A;  1REP C;  4LJZ F;  1K79 A;  2L3D A;  5FB2 A;  1MKM A;  2P6S A;  5KVR A;  3ZMD A;  4HQE A;  1LNW A;  1XCV A;  4Y13 A;  1W7P B;  4IXA A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...