4IRIA

Auto-inhibited erg ets domain-dna complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
molecule keywords Transcriptional regulator ERG
total genus 32
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4iriA00
1R22A 4M73A 1WRJA 1PUEE 1KQ8A 3KZYA 2MH9A 3IKTA 5D8LB 1SAXA 3OOPA 3HRUA 3COAC 4I2OA 1I1GA 5ICGA 4LB5A 3F8MA 1K6OA 2EFWA 2Q0OA 2CFXA 4RB2C 2L3DA 3N4MA 1UHWA 1O3TA 2ZJ2A 2WTEA 2CQKA 4UUVA 4HOBA 5DD8A 3WE2A 1KU2A 3R0JA 3M1EA 2FF4A 3VFZA 2W24A 1TW3A 1U5TC 1IN8A 1W7PA 3F21A 3VEPA 3ZP5A 2DU9A 4KUMA 4KNYA 3K69A 4UHTA 1S29A 1ZGAA 5DD4A 3SFZA 1B1BA 4XLPF 1ULYA 5E18F 4GXOA 1R00A 4NHJA 2EK5A 4WCGA 2Q8KA 2BGCA 1UHMA 5KVRA 3FF5A 2B0LA 3JAMK 4LB6B 4EV0A 2MA3A 3SHFA 3HYIA 2FMYA 5LBQA 2NNYA 5A2QZ 4BXUA 4HF0A 4GO1A 4AVPA 2HQNA 2IVMA 3DFGA 2W57A 1J5YA 2LF8A 5ERIA 1TNSA 1STZA 1ON1A 4O5VA 4BYYA 2F5DA 3TQNA 4H0EA 2D1HA 3JTHA 1FC3A 1XDUA 3LSTA 3L00A 3ZMZA 2P5LC 3HSEA 5HS9A 1LDJA 1WSUA 4N9IA 3F8BA 4ENMA 3SQNA 1P4XA 1HXDA 2XUBA 2XAQA 3KP5A 5JHUA 2AXLA 4IRIA 3Q9VA 2ISYA 2XIGA 1DPUA 5FB2A 3EETA 4DNCA 4F7ZA 4ASNA 4ETSA 5CLSA 5DYMA 3I0TA 2D2WA 4M72A 1FSEA 2FEZA 3J80Z 2GA1A 5F1RA 4Q5SF 1SD5A 3GFLA 1CF7B 5FO5A 4AIHA 1U5TA 4IHTA 4I01A 4I7HA 3D5LA 4OIRF 4OIPF 5ILUA 2GQQA 2Z99A 3G73A 5L3BA 3MWMA 2HZTA 2JZYA 3E3VA 3FHZA 3QU6A 1U8RA 2IJLA 1TQPA 2O8XA 2YR2A 2EB7A 4G9YA 3DEUA 1BC8C 2QBYA 2DI3A 2K27A 4LGWA 3JTGA 5J6XA 3TDZC 1FLIA 1ZRFA 3NQOA 1JE8A 3K1MA 2E1CA 5TJJA 3W6JB 1XGMA 3Q9SA 4L9NA 4U88A 2ZCWA 1I1SA 4I02A 2NRAC 3GEZA 2P6SA 4FT8A 3HRMA 4FHTA 5BOXA 1ZLJA 2DBBA 4LK1F 2HYGD 1BM9A 2MBFA 2DQLA 4I0AA 5JVTA 4ESJA 4IVNA 1HKSA 3WGGA 4A5NA 1MJAA 2XRNA 4JK1X 2JRTA 2P8TA 4EJOA 4PZJA 2COMA 2H09A 3FM5A 1FT9A 1EV7A 4U0VA 4UV9A 4R8HA 3IRQA 4YFXF 1T98A 5HOOA 1U2WA 1OYWA 3MEXA 3BWGA 1I6XA 5IT3A 1YW7A 2DPUA 3ECOA 1Z6TA 4YFNF 5D6EA 5E1WA 4CZZA 2Q2EA 1MDMA 1SMTA 5LGTA 4I0BA 2GWRA 4L9JA 2DK8A 2VOPA 5E17F 4UVAA 3LA7A 5FLXZ 3V8JA 3CTAA 3HOTA 1C0WA 3T0YA 2GXBA 3V8LA 3WODF 3MFKA 4NQWA 4IJAA 3IC7A 4PCQA 4WK8F 2XKOA 2F5CA 2A3SA 2CO5A 4ESBA 4HV5A 1KYZA 1P92A 1MJ9A 1DP7P 1MJBA 4I98B 4E70A 2M87A 4HDUA 3C7JA 4LFUA 4R1HA 3ROUA 2QQ9A 3I54A 1TQMA 4BAYA 1ZYRF 3KEOA 3I5UA 1FPQA 1H0MA 1CGPA 3FXQA 3CJNA 5ILVA 4Q4ZF 4M9SA 1QO0D 2STWA 2VOOA 3ECHA 2OZ6A 5L3FA 3HRSA 5HDNA 2GIVA 2EA2A 2IPQX 1VTNC 2J5OA 1B9NA 1QGPA 4Q48A 1LEAA 2V1UA 2FMLA 3FMRA 4WXHA 2PFBA 2RN7A 3GO5A 4PDKA 3P9IA 1FBQA 5E8IA 3GUDA 1ZRCA 1E2XA 2DFIA 1J2XA 5H6RA 4OINF 3GFJA 5LHHA 4KA4A 5HDGA 3RYRA 2OD5A 1K78B 1U3EM 4OMZA 2XAGA 3KP7A 2HOEA 3HSRA 1Z7UA 2V6CA 1IXCA 3TO9A 1FBSA 1HKTA 4KN7X 4BHPA 5L3GA 3ELKA 3BOQA 3SZTA 5CVIA 4EQQA 2YSRA 1FBUA 4BHCA 4HF1A 2KIFA 1ZH5A 3H3ZA 2XHKA 3MZYA 5L3EA 1RIOH 2JPBA 3ZMDA 1MGTA 2O6GE 4HLXA 5DCMA 4XBFA 4OU0A 3WTXC 2NNNA 2JT1A 4RS8A 3IWZA 1V3FA 4S05A 4WXCA 2UXXA 1BI0A 1Z6RA 1O3SA 3EQLF 3DXJF 5K5OA 4NB5A 1USSA 1QQIA 3I71A 1G4DA 4L18B 4UXNA 5DDGA 3JSOA 2EFPA 2ZMEB 1R23A 4LG0A 4WF2A 1R58A 4CDGA 2RQPA 1BBYA 1YQAA 3FWEA 2VE8A 1G3WA 1U6GA 4EJVA 3HOSA 5EEGA 5LHGA 2OZUA 1P6RA 2VBZA 5LEJA 2XGXA 1UCRA 2ETHA 3R6SA 5CVUA 3KP2A 2HEOA 2IRFG 3QRFF 4EM0B 2HS5A 4RGXA 1YFHA 4AIJA 4A12A 4YG2F 5JR3A 1J9IA 2ESHA 2RC4A 1BI1A 1B4AA 1MDMB 1HW5A 1OKRA 4ENNA 3GWZA 2K86A 5D6FA 5ED4A 4Q47A 2V1DA 1DUXC 4JBAA 1F5TA 2XROA 1FP2A 1CF7A 2ZMEA 2D1VA 2MLKA 1G3TA 3E6CC 1LDDA 3FZVA 4KYWA 2M30A 3GZ6A 5BQTA 1O3QA 4BH9A 1FX7A 2BE5F 3ZMUA 1YIOA 4RGUA 2DPDA 4LMYA 2EV0A 4M6YA 4M9XA 5D5XB 3GFIA 3Q5FA 3K9TA 4RAZA 3F6OA 2OQGA 3DQVC 4EGZA 4P9UA 4BHBA 4OOIA 5LGNA 3TDUC 2Z9OA 3MAJA 1J7KA 3GLXA 2X4HA 1J75A 4KDPA 1QNTA 4RGSA 3E5UA 3HIFA 1OMIA 3GYHX 4U7DA 2CW0F 2C6YA 3ULQB 3KE2A 1IRFA 1I27A 5D5WB 1OPCA 2UXNA 3TGNA 1HW2A 3RKWA 4GGGA 2JPCA 3U9GA 4L0YB 3VOEA 2PJPA 4HQEA 4IRGA 1IN7A 2DO7A 2V1XA 4D0PA 2HFHA 1K78A 2H94A 4MEXF 1REPC 4OIQF 5D5VB 4G7ZF 1B6AA 2IA2A 2ZXJA 3M7GA 5K5RA 2A07F 1XGSA 5K1YA 1R1VA 1I5ZA 1FSHA 4P55A 2ZFWA 2R7FA 2BBYA 4HA8A 4AIKA 4G7HF 1JXSA 2VONA 1EH6A 3U2RA 2CWEA 5HLGA 2FBKA 4GCVA 4PGGA 4G7OF 2BV6A 2PMHA 4HAMA 4IHSA 2O03A 3DKWA 3GZ5A 5H6QA 1V4RA 3CUOA 2ZO4A 1GXQA 5CVRA 3F8NA 4MQ9F 4HLYA 2E1NA 1XSDA 3IL2A 4LG0B 4YIIA 2VODA 3LA3A 3R61A 4LLGF 3L9FA 2KKOA 2RV8A 3MCZA 1SD4A 1K79A 1HKQA 2UZKA 4HW0A 1XMKA 2QUFA 1YO5C 1B9MA 3WE3A 3EDPA 3WTSC 2W85A 4Y13A 1XCBA 2NYXA 4L9VA 5HS7A 5E20A 1IF1A 4A0ZA 3HTSB 1OYYA 5FD6A 3TKYA 2P5VA 4XRFA 1XCVA 1ZG5A 3NRVA 3ZQ7A 2VE9A 2BEOA 1R7JA 4QWQA 3E6MA 4O6JA 2Y48A 5DCFA 2QWWA 1G6NA 2L4MA 5F6FA 1SFUA 3DV8A 4O3MA 1Z91A 2DW4A 5J8CA 1USTA 4L9TA 1WQ2A 2YU3A 2DT5A 2E7WA 4XSZF 4MEYF 1DPRA 1R1TA 1PP7U 1T38A 1QZYA 3ML6A 5DV5A 1WWXA 1FY7A 3GW2A 3VB2A 4TV7A 2HGCA 4OMYA 1RUOA 1U78A 4N0BA 3WTYC 2HKOA 3KLOA 1HW1A 4ZYHA 1XMAA 1XB4A 1G3SA 4HZFA 5ICFA 3M8FA 2FA5A 2FRHA 2OU2A 1W4MA 3WGIA 5HVQC 1EH7A 3ABUA 3CLOA 4BNCA 3RDIA 4ZZLA 2XASA 3G3ZA 4IF4A 2EFQA 2RGVA 1ON2A 2HYFA 1S3JA 1Y0UA 3JSPA 3WTUC 4I09A 2QQBA 1IW7F 1MKMA 2VT3A 4IPAA 1ONVA 2A6EF 1XN7A 2OBPA 2M45A 1AWCA 3O2PE 2HKXA 3NEUA 2VT2A 2JSCA 1XGNA 3JW4A 1BIBA 3HHHA 2XAHA 4ZYDA 2KJCA 4GYGA 5CVVA 3I64A 2A5YB 3QP5A 2J5PA 2FBIA 4HYEA 1SMYF 4UVBA 4MNUA 2XAJA 5LRRA 4XSXF 2Z3YA 2ISZA 1ZHFA 3BY6A 1XSXA 3SXYA 5L3CA 3QAHA 1PP8F 1R1UA 4AD9A 1XSVA 3RJPA 3T8TA 1HBXG 4MTEA 2W84A 3MQ0A 4UVCA 3HHGA 1IXRC 3FXRA 4K2EA 3I59B 2MD5A 2VBXA 4EM1A 2OAZA 4M9ZA 1BC7C 4M71A 1TTYA 4CGZA 4KIBA 2LF7A 3RYPA 3RKYA 4YIFA 2M1BA 3J80K 1FYKA 3LWFA 3JAMZ 4RB1A 3J81Z 2L54A 4KIGA 5BS6A 3BJAA 3GVAA 1YLFA 5LGUA 1IN6A 3E5XA 1FYMA 2LDUA 1GHCA 4G6QA 5AONA 4ON0A 1ZLKA 2GAUA 1SFXA 4ENKA 4LLNA 1NHAA 3LA2A 3KP6A 2IW5A 1ZREA 6PAXA 1IRGA 1GVJA 5TRDA 3V8KA 2FNPA 2PQ8A 4G8XA 3FX3A 2G7HA 3F23A 1DDNA 4LLLA 2VN2A 4B09A 5CYVA 4S04A 2F5EA 2FXAA 4OIOF 4CYDA 1D3YA 1KQ0A 3KCCA 3ZMSA 3SZPA 4ZYGA 1UFMA 4N9HA 3WU1B 2PI0A 3GF2A 2EV6A 2P4WA 4RB0A 1S8NA 2A6HF 1WKMA 4LD5A 2H27A 2ZKZA 3T8RA 2D45A 3EUHA 1FYLA 1Z05A 5HLIA 3F72A 2FSWA 2VBYA 3EYIA 1IN4A 2H6BA 2ADUA 4U0YA 4DQ2A 4P9FA 1ZRDA 1D8JA 3LAJA 3B02A 3HTUA 5E1ZB 2R7DA 4M74A 1LDKB 2Y0MA 2VXZA 2HTSA 4HDVA 4FX4A 2V79A 5ICEA 2KIUA 3GXOA 3V4GA 2EWNA 3H3UA 4EJTA 4EJUA 2KJBA 2OQRA 3KEQA 5FD5A 2FU4A 2YX4A 1D8KA 4MQVA 2JTVA 3R60A 2QZ8A 3F8FA 3F8CA 3DPTA 1YW8A 2VC1A 1E17A 3RI4A 1PDNC 2P5KA 2CG4A 2XVCA 1KU9A 1F4KA 3M9AA 3HUGA 2MC3A 3KZZA 3K1PA 1TQIA 2WWYA 1ZG1A 1TBXA 3KFWX 3DPLC 3I53A 3B73A 3E6BA 4R79A 3N97A 4RB3C 5BMZA 3FM3A 2MLGA 1BOAA 2O3FA 5ILSA 3QPTA 3R0AA 3BZ6A 4A0XA 5A2QK 1T6SA 4Z2YA 4LJZF 1BI2A 2NS0A 3TOBA 3QPHA 3QOPA 5E1XA 3WTTC 4ZYEA 2YX7A 4EGYA 4P5OA 3I59A 4CHUA 1UB9A 3CUQA 4KMFA 3WTZA 3ZMVA 4CO8A 2XAFA 4HX8A 1R5HA 3ISPA 3I4PA 4A0YA 2ZBKA 3CO6C 3H92A 5E8GA 4JQFA 4Y17A 4KIFA 2AS5F 4CXFA 3TO6A 1LVAA 1KYWA 1YW9A 4MGRA 4YFKF 3O3KA 1EH8A 5D4RA 1ZGJA 5KK1A 1JHFA 3EYYA 4WXDA 5D4SA 1W5SA 2CYYA 2HR3A 2IA1A 1U5TB 4G94A 5IT9K 2EFOA 2VC0A 2LNBA 2HQRA 3LQQA 3O6BB 3J81K 2A61A 1FNNA 2PMUA 1LB2A 4B8XA 2OA4A 3VODA 1JHHA 2FOKA 2CGPA 4KMUX 1YS7A 2FE3A 4HF2A 1RI7A 1LEBA 3BPXA 5CJ9A 1J0RA 5J8FA 3BJOA 4XLNF 3FMQA 2Z5UA 1W5TA 3P9KA 2QBYB 1L3LA 3KP4A 4WWCA 5JFRA 1B59A 3HSFA 1BJAA 1D5VA 5BPDA 1KU7A 1YTYA 2P6TA 4KN4X 3RIRA 2TDXA 2W25A 2G7UA 1FP1D 3U1DA 1XGOA 1Q1HA 3KETA 5AIPA 1YYVA 1ZARA 3BDDA 5LRSA 2RKHA 4MTDA 1QPMA 1SFEA 5K5QA 2H6CA 1H9GA 4AWXB 5DUKA 2IT0A 1JGSA 1RUNA 3ZMTA 3QU3A 1BN5A 4PGHA 1SD7A 2QLZA 3L09A 4UV8A 1QZZA 3V7RA 3GX4X 1P4AA 1LNWA 3W6KB 1O7LA 1LJ9A 2DAOA 1IN5A 2M5WA 1R5GA 2VBWA 3ZPLA 2DK5A 4L0ZB 1TW2A 3PQKA 4KT5C 5LHIA 5BPIA 3REOA 5LLQA 1WI9A 1ZG3A 5L3DA 4ESFA 3ZN0A 1L0OC 2LKPA 3T1BA 3HRTA 1TNTA 4EMSA 1FZPB 1KU3A 2L4AA 1P2FA 2EA4A 1G3YA 4HX4A 3WG9A 1O57A 2PN6A 1S7OA 2XV4S 3FXUA 2EFNA 5JI6A 1IAWA 3RKXA 4KICA 5D8KB 3BP8A 2M8EA 2PG4A 1YS6A 3ABTA 4MHGA 1OR7A 2O61A 2L01A 2K4BA 1YG2A 3K1NA 3F22A 2CSOA 1HQCA 1W7PB 3GFMA 4P96A 1OYIA 1KQ9A 2BYVE 4CICA 2FQ3A 4QLCU 1IZ1A 2R3SA 3PFIA 3DP7A 1KA8A 4RGRA 3P9CA 2FBHA 1W7PD 1Z9CA 1S6LA 2K02A 4L5JA 2G9WA 5CVJA 1XD7A 3IHUA 3RPUA 2WC2A 4A5MA 2LSOA 1FWZA 2STTA 4M6XA 5FGMA 4U0WA 3IKVA 3F3XA 1LQ1A 2GXGA 3BJ6A 1AOYA 3TOAA 3C18A 1T2KA 1IUYA 2L02A 3QP6A 5DCMB 2ESNA 3D0SA 3LAPA 2ACJA 2Z33A 3L2CA 5ICCA 3V7SA 5EEHA 1IXSB 3P7NA 3DF8A 4FX0A 2QM3A 4EM2A 4L5IA 3LQRA 4RAYA 4ZH4F 3V7CA 2HTJA 2PBIA 2E7XA 5FLXK 2QYOA 2F5FA 2EV5A 1J59A 2ELHA 3PQJA 3RPQA 3MZHA 2P7CB 4G6DA 1QBJA 3L7WA 1F9NA 2F2EA 2O0YA 1ODDA 4Y15A 2DLLA 4A6EA 2GZWA 4HBLA 3KP3A 2P7VB 3CDHA 3AAFA 5DEQA 1SD6A 1BI3A 3IRRA 1RZ4A 3WTVC 2ZNZA 1S7AA 3I58A 4KFCA 4HV6A 1FOKA 2QVOA 1H9TA 4HX7A 5LEKA 3WGHA 5FFZA 1HSTA 3BROA 2KRFA 3CUQB 3M8EA 5H20A 2EJRA 3R4KA 3T5XA 1GXPA 3WTWC 1MZBA 3IWFA 4A2UA 1ZAOA 3CUQC 1RNLA 3BPVA 4UNOA 1O7FA 1F1ZA 2HWVA 4IXAA 3S2WA 2X0LA 2QENA 4HQMA 2RNJA 4LK0F 1T0FA 2YPRA 2KIMA 3ERED 3K2ZA 3E97A 2QQAA 1T39A 1TLHB 4BQAA 4GYIA 3TO7A 2RDPA 4WX9A 2XKPA 3RTRA 2A68F 3KLNA 2RVCA 5DUIA 3WU0A 1KGSA 4EVIA 2Y75A 2IP2A 2ZNYA 1P4WA 4IRHA 4U7BA 1O3RA 2A69F 2IA0A 1BIAA 2WV0A 3FMSA 5HDKA 1X3UA 3J7AO 1A04A 2K7LA 1Z1DA 2MH2A 3E6DA 3C3WA 4ZZDA 2NAZA 5F64A 2DQRA 3E5QA 2PEXA 2UWMA 5HLHA 3K0LA 5D5UB 2DTRA 1HSJA 1ZN2A 4A6DA 2FNAA 3ZN1A 2K4JA 5FFXA 2GA2A 3CO7C 3OV8A 3C1DA 2V9VA 5HS8A 5AIQA 3F6VA 4ENJA 2HDCA 4EJWA 5IT9Z 1R36A 3LFKA 2PLYA 1K7AA 1MD0A 1XDSA
chains in the Genus database with same CATH superfamily
2W4SA 2R4GA 1HLVA 1WI3A 3D5SC 1R22A 4M73A 4UB8C 1WRJA 1PUEE 1KQ8A 2JUCA 3KZYA 2MH9A 2R93J 3IKTA 3OSGA 5D8LB 3C2GA 1SAXA 4A69C 1R6RA 3OOPA 1R49A 1RESA 1JJ8C 2JUGA 3HRUA 3COAC 3CP8A 4I2OA 4XOPA 1I1GA 2I8DA 9ANTA 1BJZA 5ICGA 4LB5A 3F8MA 1KONA 1K6OA 1VQKI 2OV7A 3J7YJ 2EFWA 1ERDA 1MBKA 2Q0OA 2CFXA 4RB2C 2KFDA 2L3DA 3N4MA 3NWTA 4LOCA 1UHWA 1WVRA 1SFOJ 2LR8A 1O3TA 2ZJ2A 4BJ5C 2XSDC 2M0CA 4CCLA 1WPKA 2VQCA 2WTEA 2VB6A 3K2AA 1VQ8I 2CQKA 3CDLA 4HOBA 5DD8A 3W2VA 1D0XA 1BR2A 1KU2A 3WE2A 4UUVA 3QOEA 1P7JA 3M1EA 2FF4A 3R0JA 2W24A 4PFOA 5EYRA 3AG2H 3VFZA 1TW3A 1U5TC 2DDAA 5IYDJ 1IN8A 1W7PA 3F21A 3VEPA 1RPWA 4AYBN 3ZP5A 2DU9A 4N4OB 4KUMA 3B6CA 4KNYA 3K69A 3PNYA 2KHMA 2ELKA 4UHTA 1S29A 1ZGAA 2DMUA 5DD4A 3SFZA 2CQNA 1B1BA 1VQ7I 4XLPF 1ULYA 5E18F 3CCQI 4GXOA 3GTKJ 4IX7A 1R00A 1QVTA 1WH7A 3TW7A 4NHJA 1OR7C 1ZTRA 2EK5A 4WCGA 1P9QC 2Q8KA 2BGCA 1UHMA 5KVRA 1U0JA 3M3YJ 2CS3A 3FF5A 2B0LA 1VF9A 5FKMA 3OL4A 3JAMK 4LB6B 4EV0A 2MA3A 3DTEA 3SHFA 3HYIA 3PO3J 2NOGA 2FMYA 5LBQA 4RLQA 2BY0A 2NNYA 2Y9ZA 5A2QZ 4BXUA 4HF0A 4GO1A 2XF6A 2KQRA 4AVPA 3GZNB 3I3LA 3ZRGA 2HQNA 2K85A 2DMPA 2IVMA 3DFGA 2W57A 1J5YA 4XOTA 2KL4A 5HNHA 1SFKA 4L5EA 2LF8A 4IHVA 5ERIA 1AA7A 5J40A 1TNSA 2NXNB 1STZA 1ON1A 4O5VA 3BG6A 3FBNB 4BYYA 2DFHA 2F5DA 3TQNA 4H0EA 2D1HA 3JTHA 2ZB9A 4M3FA 1FC3A 1XDUA 3J7ZI 3LSTA 3L00A 3ZMZA 2P5LC 3HSEA 4XRSA 4DYRA 5HS9A 1LDJA 1WSUA 4N9IA 3F8BA 3CCVI 2O7OA 4ENMA 3SQNA 1ZR2A 2K40A 1P4XA 4A3MJ 1HXDA 2XUBA 2EZHA 2XAQA 3KP5A 5JHUA 3LSGA 2AXLA 4B1RA 1YJNI 4IRIA 3Q9VA 2ISYA 2XIGA 1DPUA 5FB2A 4ABZA 3EETA 4DNCA 1YHQI 4HG2A 4F7ZA 3E7LA 1D0ZA 3QPSA 3LSHA 4ASNA 4C9YA 4ETSA 5CLSA 1VQLI 1SANA 5DYMA 1T8IA 3I0TA 2D2WA 4M72A 1FSEA 2FEZA 2HOSA 5EGOB 2DA2A 2LFBA 3J80Z 2BHYA 2GA1A 1QVUA 2Y69H 5F1RA 4Q5SF 1SD5A 3PFYA 1OCOH 1HC8A 3GFLA 5J1RA 1H8AC 1D0YA 1CF7B 5FO5A 4AIHA 2HQAA 5EG0A 3I9V2 2R5ZA 1U5TA 4PSWA 4NNJA 4IHTA 3CCMI 2JA2A 4I01A 4I7HA 3HOWJ 3D5LA 4OIRF 2W48A 4PJJA 5ILUA 1LE8A 4OIPF 3TEDA 2GQQA 2Z99A 3G73A 1Z67A 2E35A 5L3BA 3JRAA 3OYGA 1YX3A 4BS9A 3MWMA 1MSEC 3CCJI 2V9KA 2HZTA 1MH3A 2JZYA 3E3VA 3FKIJ 2K9LA 3FHZA 4DYQA 4NUBA 2OTLI 3QU6A 1U8RA 3NWSA 2IJLA 2X6WA 2FUG2 4RDUA 1TQPA 2O8XA 3HM5A 2YR2A 2R0QC 1T95A 2VQLA 2EB7A 4P1WA 4G9YA 3DEUA 1BC8C 2IAIA 4FE4A 2QBYA 2HZDA 2DI3A 2K27A 2EH3A 4DJAA 2GLOA 1ETVA 4LGWA 3JTGA 2FJ1A 5J6XA 3TDZC 1FLIA 2R7XA 1ZRFA 1TP4A 3NQOA 1JE8A 3KX2A 3J7AY 3K1MA 2E1CA 5TJJA 1VNDA 2MD0A 1RKTA 3W6JB 1XGMA 3Q9SA 2Y30A 4L9NA 4U88A 3OYCA 1XC5A 3CJQB 2ZCWA 4XORA 1I1SA 3G2BA 1YE9A 4A3FJ 4F55A 4I02A 2NRAC 3GEZA 1N75A 2P6SA 2XF5A 3DTKA 3ZR8X 2HPMA 4FT8A 2LYCA 3HRMA 2VJIA 4FHTA 5BOXA 4NC8A 1ZLJA 1G2HA 2XF7A 3OYLA 1MBFA 1VQ4I 3BTCA 2DBBA 1TWCJ 2AHQA 3F0CA 2DOAA 2HYGD 1BM9A 1FMVA 4LK1F 2CV1A 2HOTA 3LOCA 3OOUA 2MBFA 4BY7J 3FISA 1IJWC 3HOYJ 2LY9A 3ASOH 2NVQJ 2JA7J 2DA6A 2DQLA 4I0AA 5JVTA 4C2TA 5CPRB 4J19A 4IVNA 4ESJA 1HKSA 2L9NA 2W00A 3BTLA 3WGGA 4A5NA 1W0UA 5M3MJ 1UZCA 3NARA 3GTLJ 1MJAA 2XRNA 4JK1X 2JRTA 2P8TA 2QCOA 4PJMA 2ECBA 4EJOA 1OCCH 4CCMA 4PZJA 1I3QJ 2COMA 2CMPA 1IGNA 2H09A 3FM5A 2JVGA 1FT9A 1EV7A 4U0VA 2OTJI 4UV9A 4R8HA 3IRQA 4YFXF 1T98A 1A36A 5HOOA 1U2WA 1JTXA 1OYWA 2JJ7A 2Y31A 2K3PA 1D1AA 3MEXA 2QSFX 3OS2A 3BWGA 5KNLA 2WAQN 1E0EA 2DMNA 3FXJA 1I6XA 1XPXA 1TZLA 4M3DA 3VYSB 3IUOA 2H1KA 5IT3A 2V9PA 2F48A 1U9NA 2X51A 1YW7A 5GTIC 2DPUA 3ECOA 1Z6TA 3ABKH 1W1WE 4B44A 4YFNF 4ZTFA 4RAFA 5D6EA 1G59A 4BJ6C 5E1WA 4CZZA 2Q2EA 1MDMA 2AQFA 1SMTA 5LGTA 4I0BA 2GWRA 4B48A 3BCBA 1VZ0A 4A93J 1B8IB 4L9JA 2DK8A 2VOPA 3MN2A 4FTHA 5E17F 1I6HJ 3G1LA 4UVAA 3LA7A 3H1CA 1NTCA 4NC6A 1GT0C 5FLXZ 3V8JA 3CTAA 3HOTA 1C0WA 2O5RA 3W2WA 3T0YA 5B1BH 4XR6A 1UAAA 1N25A 2GOMA 2GXBA 3V8LA 3WODF 3MFKA 4NQWA 4IJAA 2WY8Q 4BY1J 3IC7A 3OYJA 3S2HJ 4PCQA 2V6EA 4WK8F 4E7JA 3ERMA 2XKOA 2F5CA 2A3SA 2CO5A 2X48A 3E1SA 3PNTA 3RZOJ 2LTPA 3CF2A 4ESBA 4HV5A 1KYZA 1P92A 1MJ9A 4XNFA 2XDVA 1DP7P 4IKFA 1MJBA 3CC7I 3CF5F 2E5NA 2GBYA 4I98B 2M87A 4QPQA 3C7JA 1X58A 4E70A 1R4MB 4HDUA 4LFUA 4R1HA 3AG1H 3DLAA 1FMWA 3D5RC 3ROUA 1YOVB 2QQ9A 3I54A 1TQMA 1WJFA 1ZYRF 4BAYA 3KEOA 3I5UA 2IGKA 1FPQA 1OJLA 3DBHB 1TL8A 2L9VA 1H0MA 3M1CA 1CGPA 3FXQA 1JTYA 4MFEA 3CJNA 4D9JA 5ILVA 3VPRA 4Q4ZF 4M9SA 1QO0D 2STWA 2VOOA 2LK2A 1JI8A 2XGDA 3ECHA 2OZ6A 5L3FA 3HRSA 5IP6A 1G8XA 1Y8QB 3FKJA 2K9QA 4PJ0C 5HDNA 2GIVA 1D1BA 2EA2A 5F08A 1LFUP 2IPQX 1VTNC 4RBOA 2J5OA 2OC6A 1B9NA 5EG0B 1PUFA 3EUAA 2E1MB 1QGPA 4Q48A 1LEAA 2V1UA 1UJ8A 2FMLA 3FMRA 1WJCA 4WXHA 2PFBA 2RN7A 2PMZN 3GO5A 4PDKA 3P9IA 1FBQA 1WZ2A 5E8IA 3GUDA 1Q1VA 1ZRCA 3OYNA 1I3AA 2IGNA 1E2XA 2DFIA 3A01B 3HC7A 2WB1A 1J2XA 3C2HA 2KZVA 5H6RA 4OINF 3GFJA 1X2NA 5LHHA 4KA4A 5HDGA 2R92J 2DTZA 3BG5A 3RYRA 1A35A 4GDFA 2OD5A 3O8HA 1U3EM 4OMZA 1K78B 2WB1N 2XAGA 2BVMA 2EZKA 3KP7A 2HOEA 2V7FA 3HSRA 3PNVA 1Z7UA 4DIQA 2V6CA 2XPWA 1IXCA 2XGCA 3TO9A 2E71A 3SJMA 1VQ6I 3HB9A 1EKEA 1FBSA 1HKTA 4KN7X 5C4XJ 4BHPA 3IH2A 5L3GA 3ELKA 3BOQA 3SZTA 5CVIA 4EQQA 4UUSA 2YSRA 3GTMJ 1FBUA 1IO2A 2JSPA 3VDXA 3OYHA 4BHCA 4HF1A 2FOWA 4BXFA 2KIFA 3HKZN 1ZH5A 2H8RA 4V2GA 3H3ZA 1IRXA 2XHKA 3MZYA 5L3EA 4A3EJ 1RIOH 1X2MA 1BW6A 2MSYA 3CZ6A 1ETWA 2JPBA 1GV5A 2WAQA 3ZMDA 1MGTA 2O6GE 2WAEA 2MW8A 3UR3C 2R7WA 4HLXA 5DCMA 4XBFA 2QA4I 4IOCF 3H36A 3FK7A 4OU0A 3WTXC 2NNNA 4CCOA 2JT1A 1OFCX 2E2JJ 4RS8A 1BR4A 3IWZA 1V3FA 3Q3SA 4WXCA 4S05A 2UXXA 1BI0A 1Z6RA 5C3EJ 2QSGX 1O3SA 3EQLF 3DXJF 1VQ9I 5K5OA 2DA4A 4NB5A 1YITI 1USSA 4ZYAA 3HL2A 2DA5A 1QQIA 3I71A 3K4MA 3OS0A 1G4DA 4L18B 4UXNA 4PK4A 2KISA 5DDGA 3JRCA 1OCZH 2EFPA 2ZMEB 3OL3A 3JSOA 5E3OA 5LD2C 1K4TA 4JX4A 3HDDA 3HGGA 4M3BA 1U8BA 1R23A 3X2QH 2JVHA 4LG0A 4WF2A 3FHNA 1R58A 4CDGA 2RQPA 1S5LC 3PIOF 2XB0X 1BBYA 1YQAA 2K9SA 3IH3A 3FWEA 4XK4A 2VE8A 2R7OA 3H35A 1B72A 3MD2A 1G3WA 2Q1ZB 1U6GA 2HPIA 2MGQA 2B9SA 4EJVA 1WH5A 3HOSA 5EEGA 5LHGA 2OZUA 1P6RA 2VBZA 2LREA 2KLOA 3BR3A 5LEJA 2XGXA 1UCRA 2ETHA 1DQUA 3R6SA 3FK6A 3S8PA 5CVUA 3KP2A 4BUPA 2HEOA 1TWFJ 2XSJC 2IRFG 3QRFF 1MBGA 4YEJA 4EM0B 1MNDA 2HS5A 5C4JJ 4RGXA 1RETA 2CV0A 3TP3A 3S3MA 1YFHA 2M3AA 4AIJA 4A12A 4YG2F 5JR3A 1J9IA 2ESHA 5FLMJ 2RC4A 1BI1A 2L2OA 1B4AA 1MDMB 4AC0A 2VQGA 2M7AA 1HW5A 2MG4A 1MNEA 3DKYA 1OKRA 4ENNA 4Y3OA 1POGA 4DBQA 3GWZA 2K86A 5D6FA 1UELB 3KPHA 1IDYA 4HNVA 4Y7NJ 4QPOA 2EZLA 3PSFA 4DBRA 5ED4A 4Q47A 2V1DA 1DUXC 4JBAA 1F5TA 5GPCA 1FP2A 2XROA 1CF7A 1GDTA 4E7ZA 2ZMEA 2D1VA 2MLKA 1G3TA 3E6CC 2LC2A 1LDDA 3KEYA 5K7ZA 3BCAA 2JK3A 3FZVA 2IS6A 4KYWA 1AHDP 2M30A 3GZ6A 3BTIA 5BQTA 1YX5A 4AIDA 1O3QA 4BH9A 2X1CA 1B72B 4DOZA 5B1AH 1FX7A 3Q0UA 1N77A 4GFBA 2BE5F 1JUPA 3ZMUA 5FKNA 3S16J 1YIOA 2IGMA 2EQRA 3QWLA 4OWRB 4RGUA 2DPDA 4FASD 4LMYA 2KP6A 3CC2I 1JT6A 2DA3A 2EV0A 4M6YA 4M9XA 5D5XB 4IHXA 1JT0A 3ZQHA 3GFIA 3H9JA 5HODA 1UHSA 3Q5FA 3K9TA 4RAZA 4DZJA 3F6OA 1IV6A 2OQGA 3DQVC 4EGZA 4P9UA 4BHBA 4OOIA 2Z2SB 4JOMA 5LGNA 3TDUC 2EINH 2CFOA 2IS4A 2DODA 2Z9OA 2LKXA 1ITYA 2V1NA 1DGRM 1X3WB 3S1MJ 3MAJA 1J7KA 3GLXA 2X4HA 1BW5A 4BEHB 1J75A 1ETYA 1K6YA 1YRNA 3A4CA 4KDPA 2CUEA 4H4KC 1QNTA 2BXYA 3FXKA 2LBFB 4RGSA 2VJ5A 3E5UA 3HIFA 3LFUA 2NS7A 1OMIA 3GYHX 4J00A 2O9LA 4B3AA 1S7EA 3FXLA 4U7DA 1MMAA 2TRTA 4IHWA 2CW0F 2C6YA 3ULQB 2ID3A 3KE2A 1AKHB 1IRFA 1I27A 1X1CA 5D5WB 2JA5J 1OPCA 2UXNA 1P7IA 3TGNA 1HW2A 3RKWA 4GGGA 5IOZA 3BQYA 2JPCA 3U9GA 5FJ8J 1ETOA 4L0YB 3VOEA 2PJPA 2VXDA 4OAYA 4HQEA 4IRGA 1IN7A 2DO7A 2V1XA 4D0PA 2B7EA 2HFHA 2BY1A 1K78A 5IP7J 4OAZA 2H94A 1FOWA 2QF7A 1VQMI 3LL7A 3W2AA 4FCYA 2HVSA 3S17J 4MEXF 3CJRB 2BXZA 1REPC 5E3NA 3BQZA 1SC7A 4OIQF 1MSFC 2K3FA 5D5VB 2D5VA 4G7ZF 2K9NA 1B6AA 2IA2A 2ZXJA 4DW6A 2JWTA 2JA8J 4UUSB 3M7GA 1O4XA 2ZC2A 5K5RA 2A07F 4HSRA 1XGSA 1DU6A 5K1YA 1R1VA 1I5ZA 2H1LA 3OS1A 3OYBA 3H3VK 1FSHA 3QPLA 3BR6A 4P55A 4C3JJ 3AL0B 2ZFWA 1X1PA 1OCRH 2R7FA 4BQNA 2BVLA 2V4JC 2BBYA 2LBFA 4HA8A 5HNFA 4AIKA 2BW3B 2LY2A 4G7HF 1EH6A 3U2RA 2VONA 1JXSA 2CWEA 2HYJA 2FBKA 5HLGA 1DU0A 3S32A 1NG7A 4GCVA 4PGGA 4HRIA 4G7OF 5B66C 3L2QA 2BV6A 5K7FA 2PMHA 3SYTA 5J47A 1V5FA 1ORKA 3S1QJ 1JUSA 4HAMA 4XQFA 1AKHA 4DYCA 4F3QA 4IHSA 1B8IA 2F4IA 3TBIA 3GLLA 2FQ4A 2O03A 3DKWA 3GZ5A 5H6QA 4BE2A 1V4RA 3CUOA 4FQGA 3EPZA 2ZO4A 2OCCH 3M4OJ 2E1OA 5EZHA 3LSMA 1GXQA 5CVRA 4A3KJ 3F8NA 2R5ZB 4MQ9F 4HLYA 2E1NA 4E7HA 2M4KA 2LMDA 1XSDA 4QIWN 1MW7A 3IL2A 2ZJRF 4LG0B 4YIIA 2DCEA 2VODA 2LKSA 3S3OA 3LA3A 3R61A 4LLGF 4UY8I 3L9FA 2CW8A 2HNHA 2KKOA 4JX6A 4B4CA 2RV8A 4IHYA 1QPIA 3MCZA 3OR2C 5J4YA 1SD4A 1K79A 1HKQA 2UZKA 4M3GA 1MMNA 2MFZA 4B47A 4HW0A 1XMKA 2QUFA 1R71A 1YO5C 5J1UA 1B9MA 3BR5A 4X6AJ 3WE3A 4GRIA 3EDPA 3WTSC 3PUBA 2W85A 4Y13A 3JRDA 2LH9A 2JRMA 2RREA 1XCBA 2NYXA 4L9VA 5HS7A 5E20A 3K4JA 3U1KA 4PJNA 1IF1A 4A0ZA 2K5CA 3HTSB 5GAGJ 1OYYA 2VKVA 3RQIA 5FD6A 3TKYA 2P5VA 4XRFA 4JX5A 1V5EA 5J1YA 1QZEA 1XCVA 5DM6F 1ZG5A 2OJED 3IAM2 3BZCA 3NRVA 3ZQ7A 2VE9A 2BEOA 2M8GX 4JP0A 1R7JA 4QWQA 3E6MA 1NK3P 4O6JA 2DYSH 2Y48A 5DCFA 1NH3A 2DT6A 2QWWA 1G6NA 2L4MA 2QKLB 2N8GA 5F6FA 2X6OA 5JLWA 3OYFA 4J01A 1SFUA 2ZSIB 3DV8A 5E3MA 2ICWG 4O3MA 3S15J 5K7HA 1Z91A 3OYEA 2DW4A 5J8CA 1USTA 4L9TA 4D1QA 2VQHA 1WQ2A 3GMEA 2YU3A 2DT5A 4G6TB 2DFFA 5HLTA 2X1DA 1H89C 3S93A 2E7WA 2ELJA 4XSZF 5DTDA 4MEYF 3NAUA 1DPRA 1R1TA 3S2DJ 2DOFA 1PP7U 5E3LA 1T38A 1SVLA 1QZYA 3ML6A 2L0KA 4I99C 5DV5A 1WWXA 1VQ5I 4XKVA 1FY7A 3GW2A 3VB2A 3EUKL 3CESA 4TV7A 2HGCA 4FISA 1EJ9A 4OMYA 1LUJB 1LPQA 1RUOA 1U78A 4N0BA 3WTYC 1Y1WJ 3A03A 2HKOA 3KLOA 3WU2C 1SVMA 2AQEA 1T56A 1E3PA 4FETA 1HW1A 4ZYHA 2LG4A 2HU9A 1FIAA 5CKTA 3LSPA 1XMAA 1XB4A 1WGXA 4D5FA 1G3SA 1D1CA 4HZFA 4XRSG 5ICFA 3M8FA 2FA5A 2FRHA 2GOXB 1VQNI 3OIPA 4Y33A 5C44J 4ZTJA 2OU2A 1W4MA 4CH7A 3WGIA 2I5UA 5HVQC 1EH7A 3ABUA 3CLOA 1XS9A 4BNCA 3CQZJ 3RDIA 1FJLA 1IV8A 4ZZLA 2XASA 2Y9YA 3G3ZA 4IF4A 2EFQA 2RGVA 1ON2A 2HYFA 1S3JA 3DEWA 3QYBA 1Y0UA 3JSPA 3WTUC 3CJTB 4I09A 2QQBA 3GTJJ 1DP3A 1IW7F 1MKMA 1I50J 2VT3A 2GIZA 2KPMA 4IPAA 1H88C 1N78A 1T0FC 4ZDLA 1ONVA 3U21A 4II2A 2A6EF 2CQQA 4EATA 3K4CA 4HPQA 5EGOA 3OIOA 3CMMA 3IP4B 1VQPI 3WHCA 1XN7A 1QRYA 3JREA 4BGDA 2OBPA 2M45A 1AWCA 3O2PE 2DYRH 2HKXA 3NEUA 2VT2A 1KZHA 1K4SA 4CZCA 4XN3A 3SEZA 2JSCA 4A3DJ 4AYBA 1XGNA 3CCYA 1ENHA 1W5CC 3JW4A 3CMAI 1BIBA 2F4OB 3HHHA 2XAHA 1F36A 1Z3YA 1ETKA 4ZYDA 2KJCA 4GYGA 4DGWB 5CVVA 2V26A 1UG0A 3I64A 1S9HA 3LNQA 1A6IA 3OYDA 2A5YB 2QQ8A 3QP5A 3L2WA 2J5PA 1W36C 2FBIA 4HYEA 1SMYF 4UVBA 4F52A 4MNUA 2CV2A 1TWHJ 2XAJA 3MVPA 1CQTA 1A31A 5LRRA 4XSXF 1WJDA 3AG3H 1YJWI 2Z3YA 2ISZA 4XONA 1XG1A 1ZHFA 5EDNA 3BY6A 3QQAA 2UUZA 1XSXA 4NDLA 3SXYA 1DGWY 5L3CA 3QAHA 1SVOA 1MIJA 1PP8F 4I6ZA 1R1UA 4AD9A 1S72I 1XSVA 2JQ7A 3RJPA 1FEXA 2AO9A 3T8TA 1WJEA 4MTEA 1HBXG 4HNUA 2NVUB 2W84A 3LSRA 5FRNA 1R4NB 3MQ0A 1MBJA 4UVCA 1ACIA 4CA0A 2HI3A 5FROA 3HHGA 2IS2A 2ZMEC 1IXRC 3FXRA 4K2EA 3ZQCA 4MO7A 4C2MJ 1J09A 2MD5A 2VBXA 3I59B 4EM1A 3DPUA 5BNGA 2OAZA 5TISC 2HXOA 1ZQ3P 2E60A 3H5AA 3GTOJ 3HGYA 2DMTA 2YUSA 4M9ZA 1BC7C 4M71A 1TTYA 1Z0XA 4KIBA 4CGZA 1ZELA 1BOBA 2OUMA 2LF7A 3RYPA 2NOJB 1FOXA 2IEKA 3RKYA 3E0JB 4YIFA 2M1BA 3J80K 1IUFA 3OYAA 3LWFA 1FYKA 3SDGA 3JAMZ 4RB1A 3CP2A 3J81Z 4XLEA 2L54A 2LVSA 3KYDB 4KIGA 1JKOC 5BS6A 2PX9A 3BJAA 3GVAA 4F91B 1VI0A 1YLFA 4PFPA 5LGUA 2W1OA 1IN6A 2M34A 3ASNH 2R7VA 4YELA 5J4VA 4BXXJ 3E5XA 2L7ZA 1FYMA 2LDUA 3MKLA 1GHCA 3BG9A 4G6QA 5AONA 2LRDA 3I4MJ 4ON0A 1ZLKA 2E36A 5J3LA 2MABA 2GAUA 3MKYB 4A3LJ 2YU9J 1SFXA 1MH4A 4ENKA 4LLNA 1NHAA 5FKOA 3AL0C 3LA2A 4QSHA 3KP6A 3A2KA 2IW5A 1ZREA 4G12A 4NC7A 6PAXA 4XLFA 1IRGA 1GVJA 3PIPF 5TRDA 4U87A 3V8KA 2R7TA 3HG9A 2FNPA 2PQ8A 4G8XA 3FX3A 3SFIA 2G7HA 3F23A 2XPUA 1DDNA 4LLLA 1RR8C 1Y0NA 4BQQA 2VN2A 4B09A 3HUGB 5CYVA 2P0WA 4S04A 2F5EA 1LFBA 2FXAA 4OIOF 4CYDA 2HVRA 2Y0SA 2JMWA 1D3YA 1KQ0A 3KCCA 3ZMSA 3H9QA 3SZPA 4ZYGA 2X9DA 3VWBA 1UFMA 4N9HA 3WU1B 2PI0A 3GF2A 5B3SH 2EV6A 2P4WA 4RB0A 4PJLA 1S8NA 2A6HF 1WKMA 2BHZA 4LD5A 2ZSHB 2H27A 2QKMB 3QODA 2ZKZA 1V55H 3T8RA 2D45A 2DA1A 2RQQA 3EUHA 4KJZA 4KITB 3VYTB 2VJJA 1XMXA 1Z05A 3A0HC 5HLIA 1FYLA 2KZGA 3F72A 2ZXIA 4XLCA 2FSWA 2VBYA 3EYIA 4ZJZA 2KMUA 1GLNA 1IN4A 3A0BC 2H6BA 3DCFA 2IGOA 2ADUA 5CQEA 4U0YA 4DQ2A 4IO9F 4P9FA 1ZRDA 2L7KA 1D8JA 3LAJA 3B02A 3HTUA 5E1ZB 2R7DA 1BL0A 4BJTA 4M74A 1Y56A 1LDKB 2VKHA 2Y0MA 1TT0A 2HTSA 2VXZA 4D7MA 4HDVA 2DT7B 1PUFB 4FX4A 2BW3A 2V79A 5ICEA 2KIUA 3GXOA 4XM3A 1PYVA 5EZGA 3H3UA 2EWNA 3V4GA 4EJTA 3TW6A 4BE0A 3HPGA 4EJUA 2KJBA 3MKZA 2OQRA 3KEQA 4A3IJ 5M3FJ 2IBDA 2R7ZJ 3AG4H 5FD5A 2FU4A 2XB5A 2YX4A 4XIDA 3CCEI 4AM3A 1D8KA 4MQVA 4XL9A 2ZJQF 4Y4RA 2VL8A 1RC9A 2JTVA 3R60A 2QZ8A 3F8FA 4XMYA 5KCMA 1JJ6C 3F8CA 3BR1A 3DPTA 3WG7H 4E4HA 4RMNA 1YW8A 4CSWA 4M6VA 2UV1A 2VC1A 1E17A 2R7SA 1BA5A 1IG7A 3KYCB 3TL4X 3RI4A 1PDNC 2P5KA 2CG4A 2XVCA 2L7FP 1KU9A 2JA6J 1F4KA 1ETXA 3M9AA 3HUGA 2RNGA 3L2UA 2MC3A 4ZDOA 3KZZA 3K1PA 1TQIA 2X6YA 2ME0A 4XLHA 2WWYA 1ZG1A 1TBXA 1YIJI 3KFWX 4I76A 2HVQA 4AUXA 2QEXI 3DPLC 2PJRB 3I53A 3B73A 2KIQA 3E6BA 4R79A 3IH4A 2KDZA 4BACA 3N97A 1ZR4A 4RB3C 5BMZA 2CQ7A 3CMYA 1ZKGA 3FM3A 2X1EA 2Y2ZA 1VQOI 2MLGA 4UUTA 5KAIC 1BOAA 2O3FA 5ILSA 3QPTA 3R0AA 3KIOA 3BZ6A 4A0XA 4KT6A 5A2QK 2HDWA 2EZIA 4EEFG 1YJ9I 1T6SA 4Z2YA 2E19A 3SZGA 4V19K 4LJZF 1BI2A 2NS0A 3TOBA 2EILH 3QPHA 4BU2A 4ANJA 3QOPA 2CQXA 5E1XA 2P81A 3WTTC 4ZYEA 3IV5A 1W0TA 2ID6A 2YX7A 4EGYA 4P5OA 3I59A 1FOYA 4CHUA 3P5JA 1UB9A 3CUQA 3FIWA 4KMFA 3WTZA 2QSHX 3ZMVA 3PL8A 4CO8A 2XAFA 3OYMA 1X19A 4HX8A 5E79C 1R5HA 3ISPA 3I4PA 3PUFA 4A0YA 1EF4A 2ZBKA 3CO6C 3ONQA 3H92A 5E8GA 4BL0B 4JQFA 1R5ID 4Y17A 2Z16A 2BY3A 3Q0WA 5CQGA 1WJBA 4KIFA 2AS5F 2F5VA 2VUMJ 4CXFA 3TO6A 3L2VA 2LOOA 1LVAA 1KYWA 1YW9A 3GCMA 4MGRA 4YFKF 5IP9J 3O3KA 1EH8A 5D4RA 1ZGJA 5KK1A 2HDDA 1JHFA 3EYYA 4WXDA 5D4SA 3DWLE 3ZQFA 1W5SA 3BZKA 2CYYA 2BY2A 3CMEI 2HR3A 2IA1A 1U5TB 4G94A 4M3EA 5IT9K 1VFCA 2EFOA 1MMDA 1QHGA 2LD5A 2VC0A 3OY9A 2LNBA 2HQRA 3LQQA 3O6BB 3J81K 1OCPA 1OISA 1FNNA 2A61A 2PMUA 1LB2A 4II3A 2VI6A 4B8XA 2OA4A 3VODA 1YI2I 4F93B 1JHHA 2FOKA 4XICA 2A5WA 2L7MP 3DKXA 4KMUX 2CGPA 5GAHJ 1YS7A 3RKQA 2FE3A 3HXLA 1HDPA 5JLXA 4HF2A 3IAS2 5F0CA 4LITA 5GADJ 1LKXA 3BLYA 3G6EI 1RI7A 1LEBA 1HOMA 3BPXA 5CJ9A 1J0RA 5J8FA 1V54H 3BJOA 4XLNF 4BDZA 3FMQA 3HOVJ 1X3ZB 3VSKA 2Z5UA 3ZQLA 3W6VA 1W5TA 1TWGJ 2VKEA 4CCJA 2NVYJ 2X85A 3H5NA 3P9KA 3SDBA 3QYFA 1MBEA 3AKZA 2QBYB 4HNTA 5IYBJ 1Y6IA 4KISA 3LSJA 4PSXA 3K10A 4BE1A 1L3LA 3KP4A 4UB6C 2TCTA 4RM3A 4X1EA 2WY7Q 3TP0A 3G1MA 4WWCA 5JFRA 1FIPA 1B59A 3HSFA 1WJ5A 1BJAA 2WAFA 4IEJA 1MNMC 4IZZA 1D5VA 5BPDA 1KU7A 4A3BJ 1YTYA 4MFDA 3F9KA 1Y1VJ 2QGUA 4BBSJ 1NK2P 2P6TA 4KN4X 5F0HA 3RIRA 3PO2J 2TDXA 2W25A 2G7UA 1FP1D 3M8JA 3U1DA 1XGOA 1Q1HA 1D5YA 5EEAA 4CYCA 3OIQA 3KETA 5AIPA 1YYVA 1ZARA 3BDDA 1Z3XA 5LRSA 3ZOBA 3KZIC 2RKHA 4MTDA 1QPMA 4HSTA 3I56I 1JUMA 2ZJPF 1SFEA 3K4LA 5K5QA 1LFPA 3A01A 2H6CA 4D7NA 4AU7A 1H9GA 3S1NJ 4AWXB 2WADA 5DUKA 4QTRA 2IT0A 1F43A 4D5CA 2X6XA 3DU5A 3FDYA 5IYCJ 4E7LA 1JGSA 4BQOA 1WJAA 1RUNA 3K7AJ 4ZDPA 2G0EA 3ZMTA 1MMSA 2XC7A 4BKXA 3QU3A 1JGGA 1BN5A 4PGHA 3JRBA 1GUUA 2LLKA 1SD7A 1QA6A 1T33A 2QLZA 3L09A 4UV8A 2R7UA 1QZZA 3V7RA 3ZQGA 3OSFA 2H8WA 2WBMA 1P4AA 3GX4X 3RQ4A 3DU6A 1LNWA 2ME6A 5H2FC 3W6KB 1O7LA 1LJ9A 2DAOA 1IN5A 2COBA 2M5WA 1R5GA 2CU7A 2VBWA 1X1BA 3ZPLA 2CUJA 2DK5A 3FXMA 4L0ZB 4BDYA 5F04A 1TW2A 3PQKA 4KT5C 5LHIA 5BPIA 2B63J 5F27A 1TWAJ 3REOA 5LLQA 1WI9A 1ZG3A 5L3DA 3WHBA 4B3XA 4ESFA 5DM7F 2A05A 1QU3A 5KHDA 3G1OA 1HA8A 3ZN0A 1L0OC 2GM4A 1AU7A 4B43A 3H0DA 2I10A 2LKPA 1V5GA 3T1BA 3HRTA 1TNTA 4Y52J 2A6TA 3HKZA 4FE7A 3H0GJ 4RA2A 4EMSA 1FZPB 1KU3A 2DMQA 2L4AA 1P2FA 4IOAF 2EA4A 1G3YA 4HX4A 3WG9A 1O57A 2OF7A 1Z77A 2PN6A 4XKCA 1K61A 1S7OA 2XV4S 3FXUA 2EFNA 5JI6A 3C2BA 3RKXA 1IAWA 2Y0SN 3HZJA 4KICA 4NQWB 5D8KB 1X4PA 3RSNA 4E7IA 3BP8A 1TT5B 2M8EA 4LIVA 3RPUD 3D1NI 2PG4A 1YS6A 3ABTA 4MHGA 3ZGKA 1R9TJ 2XAUA 1OR7A 2VASA 2DN0A 2O61A 2L01A 2KRHA 2K4BA 2MYSA 2KRCA 1YG2A 2CH0A 3K1NA 5KAFC 3F22A 2CSOA 1E3OC 1HQCA 3K6GA 1W7PB 3BG3A 3JRHA 1LVKA 3CD6I 3GFMA 2ZFUA 4XKBA 5EF6A 1W36D 3VSLA 4P96A 4ITVA 1OYIA 1KQ9A 1SEUA 2L5QA 3ZCOA 2JN6A 5IOYA 1TC3C 3CCSI 1XTAA 2BYVE 4CICA 4A3CJ 3LSIA 2FQ3A 3BC8A 4S0HB 2CUZA 2W7NA 3V42A 4QLCU 4DZPA 1IZ1A 2R3SA 4W97A 3PFIA 3G71I 3DP7A 1KA8A 1X1AA 4RGRA 2E34A 4E6KG 3P9CA 3OR1C 2EPFA 4YIRX 2VPLA 2FBHA 4NBQA 3OYIA 4N4NB 1W7PD 3LMMA 3VYRB 2ECCA 1Z9CA 3A02A 3GTPJ 3ESWB 1S6LA 4LG3A 2DJNA 1OQYA 2K02A 3EUHC 3MMYB 2G9WA 2M0MA 4L5JA 5CVJA 2R5YB 3K70D 1XD7A 3BR0A 2LP0A 3IHUA 3RPUA 1JKRC 4F92B 2ZXWH 1RRJA 3K70C 2WC2A 2KT0A 3W3CA 2GXAA 5GP9A 3FXOA 4A5MA 1ETQA 3DEEA 2M9HA 2MC4A 3JCUC 3JR9A 2OCEA 2LSOA 1APLC 2E2IJ 2M7BA 1FTTA 1FWZA 1X1DA 2STTA 3ZXSA 4M6XA 1WFXA 4RM2A 1GV2A 5FGMA 3I55I 4U0WA 4AVZA 3CDIA 4BBRJ 3IKVA 2VIXA 5M5XJ 3F3XA 1I39A 1LQ1A 4RAGA 4BEHA 1Z7LA 2GXGA 3BJ6A 1QHHD 1RR7A 2BOLA 3TOAA 4Z6YA 1AOYA 2DJIA 2NVXJ 3C18A 5EJCA 1T2KA 5FLVA 4CUGA 1Z21A 3VYUB 3CCLI 1IUYA 2LY1A 3K4NA 2L02A 3CCUI 1PVEA 3QP6A 3CC4I 5DCMB 2ESNA 3D0SA 3LAPA 2ACJA 1MMGA 2DDBA 2Z33A 4YRVA 5M5WJ 3L2CA 4RLFA 5FKLA 5ICCA 3V7SA 5EEHA 1IXSB 3OWTA 3P7NA 3DF8A 4FX0A 2QM3A 3RCOA 4EM2A 1WHUA 4L5IA 3CLQA 3LQRA 2CJJA 2RAEA 4RAYA 5GAEJ 3BG7A 1RKWA 4ZH4F 3V7CA 2HTJA 2PBIA 1FTZA 5M5YJ 2E7XA 5FLXK 1E3HA 2YS9A 2QYOA 2F5FA 2EV5A 1J59A 2R7RA 2W82A 4XLAA 2ELHA 2DXIA 3PQJA 3RPQA 3MZHA 3UNGC 2P7CB 4MIMA 3KYLA 4G6DA 4A3GJ 1U9OA 1QBJA 5TGTA 3L7WA 1F9NA 2F2EA 2M4GA 2O0YA 3G4SI 2PJRA 1A5JA 4X0GA 2EIKH 1ODDA 4Y15A 2DLLA 4A6EA 2GZWA 4HBLA 1UG2A 2O8KA 1JKQC 3KP3A 2P7VB 5FRMA 3TMOA 3K4KA 2HXIA 2L9RA 4XN0A 3CDHA 2R5YA 3AAFA 1WCMJ 5DEQA 1SD6A 1BI3A 3IRRA 2EIJH 2VJ4A 1EA3A 1RZ4A 2XRLA 4E7SA 3WTVC 2ZNZA 1S7AA 3BTJA 3I58A 3DBLB 4KFCA 1UMQA 4C3HJ 4HV6A 2AXTC 1FOKA 2QVOA 4CCNA 1H9TA 3PJRA 4HX7A 2L9SA 1IC8A 2ZXHA 3ABLH 5LEKA 1IRZA 2K9MA 3WGHA 5JVGF 3H9GA 1IDZA 2HQ5A 5FFZA 1HSTA 3HPHA 3BROA 2KRFA 3A1YA 3CUQB 3M8EA 2EJRA 2NS8A 3QYEA 5H20A 4IL6C 3OYKA 5FKKA 2HOAA 3DBRB 3R4KA 2M2EA 3T5XA 1X4OA 4E7KA 2CW7A 1GXPA 2E2HJ 3WTWC 1MZBA 3IWFA 2DOEA 2NVTJ 3GBGA 4PUSA 4A2UA 2EBIA 3CCRI 1ZAOA 4V2FA 3JRIA 2OPTA 2F6CA 3CUQC 1ZK8A 2VKDA 1HDDC 2F4MB 1RNLA 3GTGJ 3BPVA 4UNOA 1O7FA 1F1ZA 3HOXJ 2KDOA 3PSIA 2HWVA 4IXAA 3S2WA 2X0LA 3HJEA 2VLAA 2QENA 4HQMA 2RNJA 3S3NA 2XGEA 4LK0F 5B5EC 3HOZJ 1T0FA 2YPRA 2KIMA 4MLOA 1MBHA 4W1UA 3ERED 3K2ZA 3E97A 2QQAA 3RZDJ 1T39A 5F1JA 1TLHB 4LIUA 4A3JJ 4BQAA 3BT9A 3Q0VA 1Y39A 4HEA2 4GYIA 3TO7A 4JYKA 3DTIA 2RDPA 4WX9A 3DLLF 2XKPA 2R7QA 3JRFA 3L1PA 3GTQJ 1JKPC 2XPVA 4IQ4A 5IPAA 3RTRA 2A68F 2BZTA 3KLNA 5JHFA 1ZGWA 2RVCA 5DUIA 3WU0A 2DFEA 4IQJA 2IS1A 2Q2EB 2PMZA 1KGSA 4XRMA 4EVIA 2E5ZA 2Y75A 2IP2A 3S14J 1K83J 2ZNYA 1P4WA 4IRHA 4U7BA 3M07A 3ZQIA 5F0FA 2A69F 1O3RA 3HOUJ 3I4NJ 1YRNB 4ZC3A 2IA0A 2FX0A 2VPRA 1BR1A 2WA0A 1BIAA 5DS9A 1M1EB 2WV0A 1OLTA 3FMSA 5HDKA 3FBIB 4CYCB 1X3UA 3J7AO 2WV1A 2DA7A 3ABMH 3UKGA 1A04A 1LE8B 2K7LA 1HF0A 4C30A 5GTHC 1Z1DA 2FD5A 2MH2A 3E6DA 3C3WA 3MKWB 4ZZDA 3JRGA 2NAZA 3B6AA 3PM1A 5F64A 1XX5A 4CCKA 2DQRA 3E5QA 2PEXA 2UWMA 5HLHA 1T08B 3HEFA 1Y8RB 5GPAA 5IY5H 3K0LA 2Z1DA 1OCTC 5D5UB 2DTRA 1HSJA 1ZN2A 3OMYA 4A6DA 2FNAA 3ZN1A 2K4JA 4C3IJ 2E1MC 3H5RA 3L2RA 1PJRA 5FFXA 3ZQQA 2GA2A 3CO7C 1GVDA 3O8GA 3OV8A 3C1DA 2EIMH 2V9VA 5HS8A 1A6QA 1NG6A 3S1RJ 2IXSA 5AIQA 2CUFA 3K4BA 3N05A 3MZ8A 3F6VA 5LFAA 4C2UA 4ENJA 1HCRA 2HDCA 3HBLA 4EJWA 3SEQA 5IT9Z 1R36A 3LFKA 3BR2A 2CRGA 2PLYA 3LSKA 1K7AA 1SAUA 1MD0A 3AFHA 4XKWA 1XDSA
chains in the Genus database with same CATH topology
1R22A 4M73A 1WRJA 1PUEE 1KQ8A 3KZYA 2MH9A 3IKTA 5D8LB 1SAXA 3OOPA 3HRUA 3COAC 4I2OA 1I1GA 5ICGA 4LB5A 3F8MA 1K6OA 2EFWA 2Q0OA 2CFXA 4RB2C 2L3DA 3N4MA 1UHWA 1O3TA 2ZJ2A 2WTEA 2CQKA 4UUVA 4HOBA 5DD8A 3WE2A 1KU2A 3R0JA 3M1EA 2FF4A 3VFZA 2W24A 1TW3A 1U5TC 1IN8A 1W7PA 3F21A 3VEPA 3ZP5A 2DU9A 4KUMA 4KNYA 3K69A 4UHTA 1S29A 1ZGAA 5DD4A 3SFZA 1B1BA 4XLPF 1ULYA 5E18F 4GXOA 1R00A 4NHJA 2EK5A 4WCGA 2Q8KA 2BGCA 1UHMA 5KVRA 3FF5A 2B0LA 3JAMK 4LB6B 4EV0A 2MA3A 3SHFA 3HYIA 2FMYA 5LBQA 2NNYA 5A2QZ 4BXUA 4HF0A 4GO1A 4AVPA 2HQNA 2IVMA 3DFGA 2W57A 1J5YA 2LF8A 5ERIA 1TNSA 1STZA 1ON1A 4O5VA 4BYYA 2F5DA 3TQNA 4H0EA 2D1HA 3JTHA 1FC3A 1XDUA 3LSTA 3L00A 3ZMZA 2P5LC 3HSEA 5HS9A 1LDJA 1WSUA 4N9IA 3F8BA 4ENMA 3SQNA 1P4XA 1HXDA 2XUBA 2XAQA 3KP5A 5JHUA 2AXLA 4IRIA 3Q9VA 2ISYA 2XIGA 1DPUA 5FB2A 3EETA 4DNCA 4F7ZA 4ASNA 4ETSA 5CLSA 5DYMA 3I0TA 2D2WA 4M72A 1FSEA 2FEZA 3J80Z 2GA1A 5F1RA 4Q5SF 1SD5A 3GFLA 1CF7B 5FO5A 4AIHA 1U5TA 4IHTA 4I01A 4I7HA 3D5LA 4OIRF 4OIPF 5ILUA 2GQQA 2Z99A 3G73A 5L3BA 3MWMA 2HZTA 2JZYA 3E3VA 3FHZA 3QU6A 1U8RA 2IJLA 1TQPA 2O8XA 2YR2A 2EB7A 4G9YA 3DEUA 1BC8C 2QBYA 2DI3A 2K27A 4LGWA 3JTGA 5J6XA 3TDZC 1FLIA 1ZRFA 3NQOA 1JE8A 3K1MA 2E1CA 5TJJA 3W6JB 1XGMA 3Q9SA 4L9NA 4U88A 2ZCWA 1I1SA 4I02A 2NRAC 3GEZA 2P6SA 4FT8A 3HRMA 4FHTA 5BOXA 1ZLJA 2DBBA 4LK1F 2HYGD 1BM9A 2MBFA 2DQLA 4I0AA 5JVTA 4ESJA 4IVNA 1HKSA 3WGGA 4A5NA 1MJAA 2XRNA 4JK1X 2JRTA 2P8TA 4EJOA 4PZJA 2COMA 2H09A 3FM5A 1FT9A 1EV7A 4U0VA 4UV9A 4R8HA 3IRQA 4YFXF 1T98A 5HOOA 1U2WA 1OYWA 3MEXA 3BWGA 1I6XA 5IT3A 1YW7A 2DPUA 3ECOA 1Z6TA 4YFNF 5D6EA 5E1WA 4CZZA 2Q2EA 1MDMA 1SMTA 5LGTA 4I0BA 2GWRA 4L9JA 2DK8A 2VOPA 5E17F 4UVAA 3LA7A 5FLXZ 3V8JA 3CTAA 3HOTA 1C0WA 3T0YA 2GXBA 3V8LA 3WODF 3MFKA 4NQWA 4IJAA 3IC7A 4PCQA 4WK8F 2XKOA 2F5CA 2A3SA 2CO5A 4ESBA 4HV5A 1KYZA 1P92A 1MJ9A 1DP7P 1MJBA 4I98B 4E70A 2M87A 4HDUA 3C7JA 4LFUA 4R1HA 3ROUA 2QQ9A 3I54A 1TQMA 4BAYA 1ZYRF 3KEOA 3I5UA 1FPQA 1H0MA 1CGPA 3FXQA 3CJNA 5ILVA 4Q4ZF 4M9SA 1QO0D 2STWA 2VOOA 3ECHA 2OZ6A 5L3FA 3HRSA 5HDNA 2GIVA 2EA2A 2IPQX 1VTNC 2J5OA 1B9NA 1QGPA 4Q48A 1LEAA 2V1UA 2FMLA 3FMRA 4WXHA 2PFBA 2RN7A 3GO5A 4PDKA 3P9IA 1FBQA 5E8IA 3GUDA 1ZRCA 1E2XA 2DFIA 1J2XA 5H6RA 4OINF 3GFJA 5LHHA 4KA4A 5HDGA 3RYRA 2OD5A 1K78B 1U3EM 4OMZA 2XAGA 3KP7A 2HOEA 3HSRA 1Z7UA 2V6CA 1IXCA 3TO9A 1FBSA 1HKTA 4KN7X 4BHPA 5L3GA 3ELKA 3BOQA 3SZTA 5CVIA 4EQQA 2YSRA 1FBUA 4BHCA 4HF1A 2KIFA 1ZH5A 3H3ZA 2XHKA 3MZYA 5L3EA 1RIOH 2JPBA 3ZMDA 1MGTA 2O6GE 4HLXA 5DCMA 4XBFA 4OU0A 3WTXC 2NNNA 2JT1A 4RS8A 3IWZA 1V3FA 4S05A 4WXCA 2UXXA 1BI0A 1Z6RA 1O3SA 3EQLF 3DXJF 5K5OA 4NB5A 1USSA 1QQIA 3I71A 1G4DA 4L18B 4UXNA 5DDGA 3JSOA 2EFPA 2ZMEB 1R23A 4LG0A 4WF2A 1R58A 4CDGA 2RQPA 1BBYA 1YQAA 3FWEA 2VE8A 1G3WA 1U6GA 4EJVA 3HOSA 5EEGA 5LHGA 2OZUA 1P6RA 2VBZA 5LEJA 2XGXA 1UCRA 2ETHA 3R6SA 5CVUA 3KP2A 2HEOA 2IRFG 3QRFF 4EM0B 2HS5A 4RGXA 1YFHA 4AIJA 4A12A 4YG2F 5JR3A 1J9IA 2ESHA 2RC4A 1BI1A 1B4AA 1MDMB 1HW5A 1OKRA 4ENNA 3GWZA 2K86A 5D6FA 5ED4A 4Q47A 2V1DA 1DUXC 4JBAA 1F5TA 2XROA 1FP2A 1CF7A 2ZMEA 2D1VA 2MLKA 1G3TA 3E6CC 1LDDA 3FZVA 4KYWA 2M30A 3GZ6A 5BQTA 1O3QA 4BH9A 1FX7A 2BE5F 3ZMUA 1YIOA 4RGUA 2DPDA 4LMYA 2EV0A 4M6YA 4M9XA 5D5XB 3GFIA 3Q5FA 3K9TA 4RAZA 3F6OA 2OQGA 3DQVC 4EGZA 4P9UA 4BHBA 4OOIA 5LGNA 3TDUC 2Z9OA 3MAJA 1J7KA 3GLXA 2X4HA 1J75A 4KDPA 1QNTA 4RGSA 3E5UA 3HIFA 1OMIA 3GYHX 4U7DA 2CW0F 2C6YA 3ULQB 3KE2A 1IRFA 1I27A 5D5WB 1OPCA 2UXNA 3TGNA 1HW2A 3RKWA 4GGGA 2JPCA 3U9GA 4L0YB 3VOEA 2PJPA 4HQEA 4IRGA 1IN7A 2DO7A 2V1XA 4D0PA 2HFHA 1K78A 2H94A 4MEXF 1REPC 4OIQF 5D5VB 4G7ZF 1B6AA 2IA2A 2ZXJA 3M7GA 5K5RA 2A07F 1XGSA 5K1YA 1R1VA 1I5ZA 1FSHA 4P55A 2ZFWA 2R7FA 2BBYA 4HA8A 4AIKA 4G7HF 1JXSA 2VONA 1EH6A 3U2RA 2CWEA 5HLGA 2FBKA 4GCVA 4PGGA 4G7OF 2BV6A 2PMHA 4HAMA 4IHSA 2O03A 3DKWA 3GZ5A 5H6QA 1V4RA 3CUOA 2ZO4A 1GXQA 5CVRA 3F8NA 4MQ9F 4HLYA 2E1NA 1XSDA 3IL2A 4LG0B 4YIIA 2VODA 3LA3A 3R61A 4LLGF 3L9FA 2KKOA 2RV8A 3MCZA 1SD4A 1K79A 1HKQA 2UZKA 4HW0A 1XMKA 2QUFA 1YO5C 1B9MA 3WE3A 3EDPA 3WTSC 2W85A 4Y13A 1XCBA 2NYXA 4L9VA 5HS7A 5E20A 1IF1A 4A0ZA 3HTSB 1OYYA 5FD6A 3TKYA 2P5VA 4XRFA 1XCVA 1ZG5A 3NRVA 3ZQ7A 2VE9A 2BEOA 1R7JA 4QWQA 3E6MA 4O6JA 2Y48A 5DCFA 2QWWA 1G6NA 2L4MA 5F6FA 1SFUA 3DV8A 4O3MA 1Z91A 2DW4A 5J8CA 1USTA 4L9TA 1WQ2A 2YU3A 2DT5A 2E7WA 4XSZF 4MEYF 1DPRA 1R1TA 1PP7U 1T38A 1QZYA 3ML6A 5DV5A 1WWXA 1FY7A 3GW2A 3VB2A 4TV7A 2HGCA 4OMYA 1RUOA 1U78A 4N0BA 3WTYC 2HKOA 3KLOA 1HW1A 4ZYHA 1XMAA 1XB4A 1G3SA 4HZFA 5ICFA 3M8FA 2FA5A 2FRHA 2OU2A 1W4MA 3WGIA 5HVQC 1EH7A 3ABUA 3CLOA 4BNCA 3RDIA 4ZZLA 2XASA 3G3ZA 4IF4A 2EFQA 2RGVA 1ON2A 2HYFA 1S3JA 1Y0UA 3JSPA 3WTUC 4I09A 2QQBA 1IW7F 1MKMA 2VT3A 4IPAA 1ONVA 2A6EF 1XN7A 2OBPA 2M45A 1AWCA 3O2PE 2HKXA 3NEUA 2VT2A 2JSCA 1XGNA 3JW4A 1BIBA 3HHHA 2XAHA 4ZYDA 2KJCA 4GYGA 5CVVA 3I64A 2A5YB 3QP5A 2J5PA 2FBIA 4HYEA 1SMYF 4UVBA 4MNUA 2XAJA 5LRRA 4XSXF 2Z3YA 2ISZA 1ZHFA 3BY6A 1XSXA 3SXYA 5L3CA 3QAHA 1PP8F 1R1UA 4AD9A 1XSVA 3RJPA 3T8TA 1HBXG 4MTEA 2W84A 3MQ0A 4UVCA 3HHGA 1IXRC 3FXRA 4K2EA 3I59B 2MD5A 2VBXA 4EM1A 2OAZA 4M9ZA 1BC7C 4M71A 1TTYA 4CGZA 4KIBA 2LF7A 3RYPA 3RKYA 4YIFA 2M1BA 3J80K 1FYKA 3LWFA 3JAMZ 4RB1A 3J81Z 2L54A 4KIGA 5BS6A 3BJAA 3GVAA 1YLFA 5LGUA 1IN6A 3E5XA 1FYMA 2LDUA 1GHCA 4G6QA 5AONA 4ON0A 1ZLKA 2GAUA 1SFXA 4ENKA 4LLNA 1NHAA 3LA2A 3KP6A 2IW5A 1ZREA 6PAXA 1IRGA 1GVJA 5TRDA 3V8KA 2FNPA 2PQ8A 4G8XA 3FX3A 2G7HA 3F23A 1DDNA 4LLLA 2VN2A 4B09A 5CYVA 4S04A 2F5EA 2FXAA 4OIOF 4CYDA 1D3YA 1KQ0A 3KCCA 3ZMSA 3SZPA 4ZYGA 1UFMA 4N9HA 3WU1B 2PI0A 3GF2A 2EV6A 2P4WA 4RB0A 1S8NA 2A6HF 1WKMA 4LD5A 2H27A 2ZKZA 3T8RA 2D45A 3EUHA 1FYLA 1Z05A 5HLIA 3F72A 2FSWA 2VBYA 3EYIA 1IN4A 2H6BA 2ADUA 4U0YA 4DQ2A 4P9FA 1ZRDA 1D8JA 3LAJA 3B02A 3HTUA 5E1ZB 2R7DA 4M74A 1LDKB 2Y0MA 2VXZA 2HTSA 4HDVA 4FX4A 2V79A 5ICEA 2KIUA 3GXOA 3V4GA 2EWNA 3H3UA 4EJTA 4EJUA 2KJBA 2OQRA 3KEQA 5FD5A 2FU4A 2YX4A 1D8KA 4MQVA 2JTVA 3R60A 2QZ8A 3F8FA 3F8CA 3DPTA 1YW8A 2VC1A 1E17A 3RI4A 1PDNC 2P5KA 2CG4A 2XVCA 1KU9A 1F4KA 3M9AA 3HUGA 2MC3A 3KZZA 3K1PA 1TQIA 2WWYA 1ZG1A 1TBXA 3KFWX 3DPLC 3I53A 3B73A 3E6BA 4R79A 3N97A 4RB3C 5BMZA 3FM3A 2MLGA 1BOAA 2O3FA 5ILSA 3QPTA 3R0AA 3BZ6A 4A0XA 5A2QK 1T6SA 4Z2YA 4LJZF 1BI2A 2NS0A 3TOBA 3QPHA 3QOPA 5E1XA 3WTTC 4ZYEA 2YX7A 4EGYA 4P5OA 3I59A 4CHUA 1UB9A 3CUQA 4KMFA 3WTZA 3ZMVA 4CO8A 2XAFA 4HX8A 1R5HA 3ISPA 3I4PA 4A0YA 2ZBKA 3CO6C 3H92A 5E8GA 4JQFA 4Y17A 4KIFA 2AS5F 4CXFA 3TO6A 1LVAA 1KYWA 1YW9A 4MGRA 4YFKF 3O3KA 1EH8A 5D4RA 1ZGJA 5KK1A 1JHFA 3EYYA 4WXDA 5D4SA 1W5SA 2CYYA 2HR3A 2IA1A 1U5TB 4G94A 5IT9K 2EFOA 2VC0A 2LNBA 2HQRA 3LQQA 3O6BB 3J81K 2A61A 1FNNA 2PMUA 1LB2A 4B8XA 2OA4A 3VODA 1JHHA 2FOKA 2CGPA 4KMUX 1YS7A 2FE3A 4HF2A 1RI7A 1LEBA 3BPXA 5CJ9A 1J0RA 5J8FA 3BJOA 4XLNF 3FMQA 2Z5UA 1W5TA 3P9KA 2QBYB 1L3LA 3KP4A 4WWCA 5JFRA 1B59A 3HSFA 1BJAA 1D5VA 5BPDA 1KU7A 1YTYA 2P6TA 4KN4X 3RIRA 2TDXA 2W25A 2G7UA 1FP1D 3U1DA 1XGOA 1Q1HA 3KETA 5AIPA 1YYVA 1ZARA 3BDDA 5LRSA 2RKHA 4MTDA 1QPMA 1SFEA 5K5QA 2H6CA 1H9GA 4AWXB 5DUKA 2IT0A 1JGSA 1RUNA 3ZMTA 3QU3A 1BN5A 4PGHA 1SD7A 2QLZA 3L09A 4UV8A 1QZZA 3V7RA 3GX4X 1P4AA 1LNWA 3W6KB 1O7LA 1LJ9A 2DAOA 1IN5A 2M5WA 1R5GA 2VBWA 3ZPLA 2DK5A 4L0ZB 1TW2A 3PQKA 4KT5C 5LHIA 5BPIA 3REOA 5LLQA 1WI9A 1ZG3A 5L3DA 4ESFA 3ZN0A 1L0OC 2LKPA 3T1BA 3HRTA 1TNTA 4EMSA 1FZPB 1KU3A 2L4AA 1P2FA 2EA4A 1G3YA 4HX4A 3WG9A 1O57A 2PN6A 1S7OA 2XV4S 3FXUA 2EFNA 5JI6A 1IAWA 3RKXA 4KICA 5D8KB 3BP8A 2M8EA 2PG4A 1YS6A 3ABTA 4MHGA 1OR7A 2O61A 2L01A 2K4BA 1YG2A 3K1NA 3F22A 2CSOA 1HQCA 1W7PB 3GFMA 4P96A 1OYIA 1KQ9A 2BYVE 4CICA 2FQ3A 4QLCU 1IZ1A 2R3SA 3PFIA 3DP7A 1KA8A 4RGRA 3P9CA 2FBHA 1W7PD 1Z9CA 1S6LA 2K02A 4L5JA 2G9WA 5CVJA 1XD7A 3IHUA 3RPUA 2WC2A 4A5MA 2LSOA 1FWZA 2STTA 4M6XA 5FGMA 4U0WA 3IKVA 3F3XA 1LQ1A 2GXGA 3BJ6A 1AOYA 3TOAA 3C18A 1T2KA 1IUYA 2L02A 3QP6A 5DCMB 2ESNA 3D0SA 3LAPA 2ACJA 2Z33A 3L2CA 5ICCA 3V7SA 5EEHA 1IXSB 3P7NA 3DF8A 4FX0A 2QM3A 4EM2A 4L5IA 3LQRA 4RAYA 4ZH4F 3V7CA 2HTJA 2PBIA 2E7XA 5FLXK 2QYOA 2F5FA 2EV5A 1J59A 2ELHA 3PQJA 3RPQA 3MZHA 2P7CB 4G6DA 1QBJA 3L7WA 1F9NA 2F2EA 2O0YA 1ODDA 4Y15A 2DLLA 4A6EA 2GZWA 4HBLA 3KP3A 2P7VB 3CDHA 3AAFA 5DEQA 1SD6A 1BI3A 3IRRA 1RZ4A 3WTVC 2ZNZA 1S7AA 3I58A 4KFCA 4HV6A 1FOKA 2QVOA 1H9TA 4HX7A 5LEKA 3WGHA 5FFZA 1HSTA 3BROA 2KRFA 3CUQB 3M8EA 5H20A 2EJRA 3R4KA 3T5XA 1GXPA 3WTWC 1MZBA 3IWFA 4A2UA 1ZAOA 3CUQC 1RNLA 3BPVA 4UNOA 1O7FA 1F1ZA 2HWVA 4IXAA 3S2WA 2X0LA 2QENA 4HQMA 2RNJA 4LK0F 1T0FA 2YPRA 2KIMA 3ERED 3K2ZA 3E97A 2QQAA 1T39A 1TLHB 4BQAA 4GYIA 3TO7A 2RDPA 4WX9A 2XKPA 3RTRA 2A68F 3KLNA 2RVCA 5DUIA 3WU0A 1KGSA 4EVIA 2Y75A 2IP2A 2ZNYA 1P4WA 4IRHA 4U7BA 1O3RA 2A69F 2IA0A 1BIAA 2WV0A 3FMSA 5HDKA 1X3UA 3J7AO 1A04A 2K7LA 1Z1DA 2MH2A 3E6DA 3C3WA 4ZZDA 2NAZA 5F64A 2DQRA 3E5QA 2PEXA 2UWMA 5HLHA 3K0LA 5D5UB 2DTRA 1HSJA 1ZN2A 4A6DA 2FNAA 3ZN1A 2K4JA 5FFXA 2GA2A 3CO7C 3OV8A 3C1DA 2V9VA 5HS8A 5AIQA 3F6VA 4ENJA 2HDCA 4EJWA 5IT9Z 1R36A 3LFKA 2PLYA 1K7AA 1MD0A 1XDSA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1R22 A;  4M73 A;  1WRJ A;  1PUE E;  1KQ8 A;  3KZY A;  2MH9 A;  3IKT A;  5D8L B;  1SAX A;  3OOP A;  3HRU A;  3COA C;  4I2O A;  1I1G A;  5ICG A;  4LB5 A;  3F8M A;  1K6O A;  2EFW A;  2Q0O A;  2CFX A;  4RB2 C;  2L3D A;  3N4M A;  1UHW A;  1O3T A;  2ZJ2 A;  2WTE A;  2CQK A;  4UUV A;  4HOB A;  5DD8 A;  3WE2 A;  1KU2 A;  3R0J A;  3M1E A;  2FF4 A;  3VFZ A;  2W24 A;  1TW3 A;  1U5T C;  1IN8 A;  1W7P A;  3F21 A;  3VEP A;  3ZP5 A;  2DU9 A;  4KUM A;  4KNY A;  3K69 A;  4UHT A;  1S29 A;  1ZGA A;  5DD4 A;  3SFZ A;  1B1B A;  4XLP F;  1ULY A;  5E18 F;  4GXO A;  1R00 A;  4NHJ A;  2EK5 A;  4WCG A;  2Q8K A;  2BGC A;  1UHM A;  5KVR A;  3FF5 A;  2B0L A;  3JAM K;  4LB6 B;  4EV0 A;  2MA3 A;  3SHF A;  3HYI A;  2FMY A;  5LBQ A;  2NNY A;  5A2Q Z;  4BXU A;  4HF0 A;  4GO1 A;  4AVP A;  2HQN A;  2IVM A;  3DFG A;  2W57 A;  1J5Y A;  2LF8 A;  5ERI A;  1TNS A;  1STZ A;  1ON1 A;  4O5V A;  4BYY A;  2F5D A;  3TQN A;  4H0E A;  2D1H A;  3JTH A;  1FC3 A;  1XDU A;  3LST A;  3L00 A;  3ZMZ A;  2P5L C;  3HSE A;  5HS9 A;  1LDJ A;  1WSU A;  4N9I A;  3F8B A;  4ENM A;  3SQN A;  1P4X A;  1HXD A;  2XUB A;  2XAQ A;  3KP5 A;  5JHU A;  2AXL A;  4IRI A;  3Q9V A;  2ISY A;  2XIG A;  1DPU A;  5FB2 A;  3EET A;  4DNC A;  4F7Z A;  4ASN A;  4ETS A;  5CLS A;  5DYM A;  3I0T A;  2D2W A;  4M72 A;  1FSE A;  2FEZ A;  3J80 Z;  2GA1 A;  5F1R A;  4Q5S F;  1SD5 A;  3GFL A;  1CF7 B;  5FO5 A;  4AIH A;  1U5T A;  4IHT A;  4I01 A;  4I7H A;  3D5L A;  4OIR F;  4OIP F;  5ILU A;  2GQQ A;  2Z99 A;  3G73 A;  5L3B A;  3MWM A;  2HZT A;  2JZY A;  3E3V A;  3FHZ A;  3QU6 A;  1U8R A;  2IJL A;  1TQP A;  2O8X A;  2YR2 A;  2EB7 A;  4G9Y A;  3DEU A;  1BC8 C;  2QBY A;  2DI3 A;  2K27 A;  4LGW A;  3JTG A;  5J6X A;  3TDZ C;  1FLI A;  1ZRF A;  3NQO A;  1JE8 A;  3K1M A;  2E1C A;  5TJJ A;  3W6J B;  1XGM A;  3Q9S A;  4L9N A;  4U88 A;  2ZCW A;  1I1S A;  4I02 A;  2NRA C;  3GEZ A;  2P6S A;  4FT8 A;  3HRM A;  4FHT A;  5BOX A;  1ZLJ A;  2DBB A;  4LK1 F;  2HYG D;  1BM9 A;  2MBF A;  2DQL A;  4I0A A;  5JVT A;  4ESJ A;  4IVN A;  1HKS A;  3WGG A;  4A5N A;  1MJA A;  2XRN A;  4JK1 X;  2JRT A;  2P8T A;  4EJO A;  4PZJ A;  2COM A;  2H09 A;  3FM5 A;  1FT9 A;  1EV7 A;  4U0V A;  4UV9 A;  4R8H A;  3IRQ A;  4YFX F;  1T98 A;  5HOO A;  1U2W A;  1OYW A;  3MEX A;  3BWG A;  1I6X A;  5IT3 A;  1YW7 A;  2DPU A;  3ECO A;  1Z6T A;  4YFN F;  5D6E A;  5E1W A;  4CZZ A;  2Q2E A;  1MDM A;  1SMT A;  5LGT A;  4I0B A;  2GWR A;  4L9J A;  2DK8 A;  2VOP A;  5E17 F;  4UVA A;  3LA7 A;  5FLX Z;  3V8J A;  3CTA A;  3HOT A;  1C0W A;  3T0Y A;  2GXB A;  3V8L A;  3WOD F;  3MFK A;  4NQW A;  4IJA A;  3IC7 A;  4PCQ A;  4WK8 F;  2XKO A;  2F5C A;  2A3S A;  2CO5 A;  4ESB A;  4HV5 A;  1KYZ A;  1P92 A;  1MJ9 A;  1DP7 P;  1MJB A;  4I98 B;  4E70 A;  2M87 A;  4HDU A;  3C7J A;  4LFU A;  4R1H A;  3ROU A;  2QQ9 A;  3I54 A;  1TQM A;  4BAY A;  1ZYR F;  3KEO A;  3I5U A;  1FPQ A;  1H0M A;  1CGP A;  3FXQ A;  3CJN A;  5ILV A;  4Q4Z F;  4M9S A;  1QO0 D;  2STW A;  2VOO A;  3ECH A;  2OZ6 A;  5L3F A;  3HRS A;  5HDN A;  2GIV A;  2EA2 A;  2IPQ X;  1VTN C;  2J5O A;  1B9N A;  1QGP A;  4Q48 A;  1LEA A;  2V1U A;  2FML A;  3FMR A;  4WXH A;  2PFB A;  2RN7 A;  3GO5 A;  4PDK A;  3P9I A;  1FBQ A;  5E8I A;  3GUD A;  1ZRC A;  1E2X A;  2DFI A;  1J2X A;  5H6R A;  4OIN F;  3GFJ A;  5LHH A;  4KA4 A;  5HDG A;  3RYR A;  2OD5 A;  1K78 B;  1U3E M;  4OMZ A;  2XAG A;  3KP7 A;  2HOE A;  3HSR A;  1Z7U A;  2V6C A;  1IXC A;  3TO9 A;  1FBS A;  1HKT A;  4KN7 X;  4BHP A;  5L3G A;  3ELK A;  3BOQ A;  3SZT A;  5CVI A;  4EQQ A;  2YSR A;  1FBU A;  4BHC A;  4HF1 A;  2KIF A;  1ZH5 A;  3H3Z A;  2XHK A;  3MZY A;  5L3E A;  1RIO H;  2JPB A;  3ZMD A;  1MGT A;  2O6G E;  4HLX A;  5DCM A;  4XBF A;  4OU0 A;  3WTX C;  2NNN A;  2JT1 A;  4RS8 A;  3IWZ A;  1V3F A;  4S05 A;  4WXC A;  2UXX A;  1BI0 A;  1Z6R A;  1O3S A;  3EQL F;  3DXJ F;  5K5O A;  4NB5 A;  1USS A;  1QQI A;  3I71 A;  1G4D A;  4L18 B;  4UXN A;  5DDG A;  3JSO A;  2EFP A;  2ZME B;  1R23 A;  4LG0 A;  4WF2 A;  1R58 A;  4CDG A;  2RQP A;  1BBY A;  1YQA A;  3FWE A;  2VE8 A;  1G3W A;  1U6G A;  4EJV A;  3HOS A;  5EEG A;  5LHG A;  2OZU A;  1P6R A;  2VBZ A;  5LEJ A;  2XGX A;  1UCR A;  2ETH A;  3R6S A;  5CVU A;  3KP2 A;  2HEO A;  2IRF G;  3QRF F;  4EM0 B;  2HS5 A;  4RGX A;  1YFH A;  4AIJ A;  4A12 A;  4YG2 F;  5JR3 A;  1J9I A;  2ESH A;  2RC4 A;  1BI1 A;  1B4A A;  1MDM B;  1HW5 A;  1OKR A;  4ENN A;  3GWZ A;  2K86 A;  5D6F A;  5ED4 A;  4Q47 A;  2V1D A;  1DUX C;  4JBA A;  1F5T A;  2XRO A;  1FP2 A;  1CF7 A;  2ZME A;  2D1V A;  2MLK A;  1G3T A;  3E6C C;  1LDD A;  3FZV A;  4KYW A;  2M30 A;  3GZ6 A;  5BQT A;  1O3Q A;  4BH9 A;  1FX7 A;  2BE5 F;  3ZMU A;  1YIO A;  4RGU A;  2DPD A;  4LMY A;  2EV0 A;  4M6Y A;  4M9X A;  5D5X B;  3GFI A;  3Q5F A;  3K9T A;  4RAZ A;  3F6O A;  2OQG A;  3DQV C;  4EGZ A;  4P9U A;  4BHB A;  4OOI A;  5LGN A;  3TDU C;  2Z9O A;  3MAJ A;  1J7K A;  3GLX A;  2X4H A;  1J75 A;  4KDP A;  1QNT A;  4RGS A;  3E5U A;  3HIF A;  1OMI A;  3GYH X;  4U7D A;  2CW0 F;  2C6Y A;  3ULQ B;  3KE2 A;  1IRF A;  1I27 A;  5D5W B;  1OPC A;  2UXN A;  3TGN A;  1HW2 A;  3RKW A;  4GGG A;  2JPC A;  3U9G A;  4L0Y B;  3VOE A;  2PJP A;  4HQE A;  4IRG A;  1IN7 A;  2DO7 A;  2V1X A;  4D0P A;  2HFH A;  1K78 A;  2H94 A;  4MEX F;  1REP C;  4OIQ F;  5D5V B;  4G7Z F;  1B6A A;  2IA2 A;  2ZXJ A;  3M7G A;  5K5R A;  2A07 F;  1XGS A;  5K1Y A;  1R1V A;  1I5Z A;  1FSH A;  4P55 A;  2ZFW A;  2R7F A;  2BBY A;  4HA8 A;  4AIK A;  4G7H F;  1JXS A;  2VON A;  1EH6 A;  3U2R A;  2CWE A;  5HLG A;  2FBK A;  4GCV A;  4PGG A;  4G7O F;  2BV6 A;  2PMH A;  4HAM A;  4IHS A;  2O03 A;  3DKW A;  3GZ5 A;  5H6Q A;  1V4R A;  3CUO A;  2ZO4 A;  1GXQ A;  5CVR A;  3F8N A;  4MQ9 F;  4HLY A;  2E1N A;  1XSD A;  3IL2 A;  4LG0 B;  4YII A;  2VOD A;  3LA3 A;  3R61 A;  4LLG F;  3L9F A;  2KKO A;  2RV8 A;  3MCZ A;  1SD4 A;  1K79 A;  1HKQ A;  2UZK A;  4HW0 A;  1XMK A;  2QUF A;  1YO5 C;  1B9M A;  3WE3 A;  3EDP A;  3WTS C;  2W85 A;  4Y13 A;  1XCB A;  2NYX A;  4L9V A;  5HS7 A;  5E20 A;  1IF1 A;  4A0Z A;  3HTS B;  1OYY A;  5FD6 A;  3TKY A;  2P5V A;  4XRF A;  1XCV A;  1ZG5 A;  3NRV A;  3ZQ7 A;  2VE9 A;  2BEO A;  1R7J A;  4QWQ A;  3E6M A;  4O6J A;  2Y48 A;  5DCF A;  2QWW A;  1G6N A;  2L4M A;  5F6F A;  1SFU A;  3DV8 A;  4O3M A;  1Z91 A;  2DW4 A;  5J8C A;  1UST A;  4L9T A;  1WQ2 A;  2YU3 A;  2DT5 A;  2E7W A;  4XSZ F;  4MEY F;  1DPR A;  1R1T A;  1PP7 U;  1T38 A;  1QZY A;  3ML6 A;  5DV5 A;  1WWX A;  1FY7 A;  3GW2 A;  3VB2 A;  4TV7 A;  2HGC A;  4OMY A;  1RUO A;  1U78 A;  4N0B A;  3WTY C;  2HKO A;  3KLO A;  1HW1 A;  4ZYH A;  1XMA A;  1XB4 A;  1G3S A;  4HZF A;  5ICF A;  3M8F A;  2FA5 A;  2FRH A;  2OU2 A;  1W4M A;  3WGI A;  5HVQ C;  1EH7 A;  3ABU A;  3CLO A;  4BNC A;  3RDI A;  4ZZL A;  2XAS A;  3G3Z A;  4IF4 A;  2EFQ A;  2RGV A;  1ON2 A;  2HYF A;  1S3J A;  1Y0U A;  3JSP A;  3WTU C;  4I09 A;  2QQB A;  1IW7 F;  1MKM A;  2VT3 A;  4IPA A;  1ONV A;  2A6E F;  1XN7 A;  2OBP A;  2M45 A;  1AWC A;  3O2P E;  2HKX A;  3NEU A;  2VT2 A;  2JSC A;  1XGN A;  3JW4 A;  1BIB A;  3HHH A;  2XAH A;  4ZYD A;  2KJC A;  4GYG A;  5CVV A;  3I64 A;  2A5Y B;  3QP5 A;  2J5P A;  2FBI A;  4HYE A;  1SMY F;  4UVB A;  4MNU A;  2XAJ A;  5LRR A;  4XSX F;  2Z3Y A;  2ISZ A;  1ZHF A;  3BY6 A;  1XSX A;  3SXY A;  5L3C A;  3QAH A;  1PP8 F;  1R1U A;  4AD9 A;  1XSV A;  3RJP A;  3T8T A;  1HBX G;  4MTE A;  2W84 A;  3MQ0 A;  4UVC A;  3HHG A;  1IXR C;  3FXR A;  4K2E A;  3I59 B;  2MD5 A;  2VBX A;  4EM1 A;  2OAZ A;  4M9Z A;  1BC7 C;  4M71 A;  1TTY A;  4CGZ A;  4KIB A;  2LF7 A;  3RYP A;  3RKY A;  4YIF A;  2M1B A;  3J80 K;  1FYK A;  3LWF A;  3JAM Z;  4RB1 A;  3J81 Z;  2L54 A;  4KIG A;  5BS6 A;  3BJA A;  3GVA A;  1YLF A;  5LGU A;  1IN6 A;  3E5X A;  1FYM A;  2LDU A;  1GHC A;  4G6Q A;  5AON A;  4ON0 A;  1ZLK A;  2GAU A;  1SFX A;  4ENK A;  4LLN A;  1NHA A;  3LA2 A;  3KP6 A;  2IW5 A;  1ZRE A;  6PAX A;  1IRG A;  1GVJ A;  5TRD A;  3V8K A;  2FNP A;  2PQ8 A;  4G8X A;  3FX3 A;  2G7H A;  3F23 A;  1DDN A;  4LLL A;  2VN2 A;  4B09 A;  5CYV A;  4S04 A;  2F5E A;  2FXA A;  4OIO F;  4CYD A;  1D3Y A;  1KQ0 A;  3KCC A;  3ZMS A;  3SZP A;  4ZYG A;  1UFM A;  4N9H A;  3WU1 B;  2PI0 A;  3GF2 A;  2EV6 A;  2P4W A;  4RB0 A;  1S8N A;  2A6H F;  1WKM A;  4LD5 A;  2H27 A;  2ZKZ A;  3T8R A;  2D45 A;  3EUH A;  1FYL A;  1Z05 A;  5HLI A;  3F72 A;  2FSW A;  2VBY A;  3EYI A;  1IN4 A;  2H6B A;  2ADU A;  4U0Y A;  4DQ2 A;  4P9F A;  1ZRD A;  1D8J A;  3LAJ A;  3B02 A;  3HTU A;  5E1Z B;  2R7D A;  4M74 A;  1LDK B;  2Y0M A;  2VXZ A;  2HTS A;  4HDV A;  4FX4 A;  2V79 A;  5ICE A;  2KIU A;  3GXO A;  3V4G A;  2EWN A;  3H3U A;  4EJT A;  4EJU A;  2KJB A;  2OQR A;  3KEQ A;  5FD5 A;  2FU4 A;  2YX4 A;  1D8K A;  4MQV A;  2JTV A;  3R60 A;  2QZ8 A;  3F8F A;  3F8C A;  3DPT A;  1YW8 A;  2VC1 A;  1E17 A;  3RI4 A;  1PDN C;  2P5K A;  2CG4 A;  2XVC A;  1KU9 A;  1F4K A;  3M9A A;  3HUG A;  2MC3 A;  3KZZ A;  3K1P A;  1TQI A;  2WWY A;  1ZG1 A;  1TBX A;  3KFW X;  3DPL C;  3I53 A;  3B73 A;  3E6B A;  4R79 A;  3N97 A;  4RB3 C;  5BMZ A;  3FM3 A;  2MLG A;  1BOA A;  2O3F A;  5ILS A;  3QPT A;  3R0A A;  3BZ6 A;  4A0X A;  5A2Q K;  1T6S A;  4Z2Y A;  4LJZ F;  1BI2 A;  2NS0 A;  3TOB A;  3QPH A;  3QOP A;  5E1X A;  3WTT C;  4ZYE A;  2YX7 A;  4EGY A;  4P5O A;  3I59 A;  4CHU A;  1UB9 A;  3CUQ A;  4KMF A;  3WTZ A;  3ZMV A;  4CO8 A;  2XAF A;  4HX8 A;  1R5H A;  3ISP A;  3I4P A;  4A0Y A;  2ZBK A;  3CO6 C;  3H92 A;  5E8G A;  4JQF A;  4Y17 A;  4KIF A;  2AS5 F;  4CXF A;  3TO6 A;  1LVA A;  1KYW A;  1YW9 A;  4MGR A;  4YFK F;  3O3K A;  1EH8 A;  5D4R A;  1ZGJ A;  5KK1 A;  1JHF A;  3EYY A;  4WXD A;  5D4S A;  1W5S A;  2CYY A;  2HR3 A;  2IA1 A;  1U5T B;  4G94 A;  5IT9 K;  2EFO A;  2VC0 A;  2LNB A;  2HQR A;  3LQQ A;  3O6B B;  3J81 K;  2A61 A;  1FNN A;  2PMU A;  1LB2 A;  4B8X A;  2OA4 A;  3VOD A;  1JHH A;  2FOK A;  2CGP A;  4KMU X;  1YS7 A;  2FE3 A;  4HF2 A;  1RI7 A;  1LEB A;  3BPX A;  5CJ9 A;  1J0R A;  5J8F A;  3BJO A;  4XLN F;  3FMQ A;  2Z5U A;  1W5T A;  3P9K A;  2QBY B;  1L3L A;  3KP4 A;  4WWC A;  5JFR A;  1B59 A;  3HSF A;  1BJA A;  1D5V A;  5BPD A;  1KU7 A;  1YTY A;  2P6T A;  4KN4 X;  3RIR A;  2TDX A;  2W25 A;  2G7U A;  1FP1 D;  3U1D A;  1XGO A;  1Q1H A;  3KET A;  5AIP A;  1YYV A;  1ZAR A;  3BDD A;  5LRS A;  2RKH A;  4MTD A;  1QPM A;  1SFE A;  5K5Q A;  2H6C A;  1H9G A;  4AWX B;  5DUK A;  2IT0 A;  1JGS A;  1RUN A;  3ZMT A;  3QU3 A;  1BN5 A;  4PGH A;  1SD7 A;  2QLZ A;  3L09 A;  4UV8 A;  1QZZ A;  3V7R A;  3GX4 X;  1P4A A;  1LNW A;  3W6K B;  1O7L A;  1LJ9 A;  2DAO A;  1IN5 A;  2M5W A;  1R5G A;  2VBW A;  3ZPL A;  2DK5 A;  4L0Z B;  1TW2 A;  3PQK A;  4KT5 C;  5LHI A;  5BPI A;  3REO A;  5LLQ A;  1WI9 A;  1ZG3 A;  5L3D A;  4ESF A;  3ZN0 A;  1L0O C;  2LKP A;  3T1B A;  3HRT A;  1TNT A;  4EMS A;  1FZP B;  1KU3 A;  2L4A A;  1P2F A;  2EA4 A;  1G3Y A;  4HX4 A;  3WG9 A;  1O57 A;  2PN6 A;  1S7O A;  2XV4 S;  3FXU A;  2EFN A;  5JI6 A;  1IAW A;  3RKX A;  4KIC A;  5D8K B;  3BP8 A;  2M8E A;  2PG4 A;  1YS6 A;  3ABT A;  4MHG A;  1OR7 A;  2O61 A;  2L01 A;  2K4B A;  1YG2 A;  3K1N A;  3F22 A;  2CSO A;  1HQC A;  1W7P B;  3GFM A;  4P96 A;  1OYI A;  1KQ9 A;  2BYV E;  4CIC A;  2FQ3 A;  4QLC U;  1IZ1 A;  2R3S A;  3PFI A;  3DP7 A;  1KA8 A;  4RGR A;  3P9C A;  2FBH A;  1W7P D;  1Z9C A;  1S6L A;  2K02 A;  4L5J A;  2G9W A;  5CVJ A;  1XD7 A;  3IHU A;  3RPU A;  2WC2 A;  4A5M A;  2LSO A;  1FWZ A;  2STT A;  4M6X A;  5FGM A;  4U0W A;  3IKV A;  3F3X A;  1LQ1 A;  2GXG A;  3BJ6 A;  1AOY A;  3TOA A;  3C18 A;  1T2K A;  1IUY A;  2L02 A;  3QP6 A;  5DCM B;  2ESN A;  3D0S A;  3LAP A;  2ACJ A;  2Z33 A;  3L2C A;  5ICC A;  3V7S A;  5EEH A;  1IXS B;  3P7N A;  3DF8 A;  4FX0 A;  2QM3 A;  4EM2 A;  4L5I A;  3LQR A;  4RAY A;  4ZH4 F;  3V7C A;  2HTJ A;  2PBI A;  2E7X A;  5FLX K;  2QYO A;  2F5F A;  2EV5 A;  1J59 A;  2ELH A;  3PQJ A;  3RPQ A;  3MZH A;  2P7C B;  4G6D A;  1QBJ A;  3L7W A;  1F9N A;  2F2E A;  2O0Y A;  1ODD A;  4Y15 A;  2DLL A;  4A6E A;  2GZW A;  4HBL A;  3KP3 A;  2P7V B;  3CDH A;  3AAF A;  5DEQ A;  1SD6 A;  1BI3 A;  3IRR A;  1RZ4 A;  3WTV C;  2ZNZ A;  1S7A A;  3I58 A;  4KFC A;  4HV6 A;  1FOK A;  2QVO A;  1H9T A;  4HX7 A;  5LEK A;  3WGH A;  5FFZ A;  1HST A;  3BRO A;  2KRF A;  3CUQ B;  3M8E A;  5H20 A;  2EJR A;  3R4K A;  3T5X A;  1GXP A;  3WTW C;  1MZB A;  3IWF A;  4A2U A;  1ZAO A;  3CUQ C;  1RNL A;  3BPV A;  4UNO A;  1O7F A;  1F1Z A;  2HWV A;  4IXA A;  3S2W A;  2X0L A;  2QEN A;  4HQM A;  2RNJ A;  4LK0 F;  1T0F A;  2YPR A;  2KIM A;  3ERE D;  3K2Z A;  3E97 A;  2QQA A;  1T39 A;  1TLH B;  4BQA A;  4GYI A;  3TO7 A;  2RDP A;  4WX9 A;  2XKP A;  3RTR A;  2A68 F;  3KLN A;  2RVC A;  5DUI A;  3WU0 A;  1KGS A;  4EVI A;  2Y75 A;  2IP2 A;  2ZNY A;  1P4W A;  4IRH A;  4U7B A;  1O3R A;  2A69 F;  2IA0 A;  1BIA A;  2WV0 A;  3FMS A;  5HDK A;  1X3U A;  3J7A O;  1A04 A;  2K7L A;  1Z1D A;  2MH2 A;  3E6D A;  3C3W A;  4ZZD A;  2NAZ A;  5F64 A;  2DQR A;  3E5Q A;  2PEX A;  2UWM A;  5HLH A;  3K0L A;  5D5U B;  2DTR A;  1HSJ A;  1ZN2 A;  4A6D A;  2FNA A;  3ZN1 A;  2K4J A;  5FFX A;  2GA2 A;  3CO7 C;  3OV8 A;  3C1D A;  2V9V A;  5HS8 A;  5AIQ A;  3F6V A;  4ENJ A;  2HDC A;  4EJW A;  5IT9 Z;  1R36 A;  3LFK A;  2PLY A;  1K7A A;  1MD0 A;  1XDS A; 
#chains in the Genus database with same CATH topology
 2W4S A;  2R4G A;  1HLV A;  1WI3 A;  3D5S C;  1R22 A;  4M73 A;  4UB8 C;  1WRJ A;  1PUE E;  1KQ8 A;  2JUC A;  3KZY A;  2MH9 A;  2R93 J;  3IKT A;  3OSG A;  5D8L B;  3C2G A;  1SAX A;  4A69 C;  1R6R A;  3OOP A;  1R49 A;  1RES A;  1JJ8 C;  2JUG A;  3HRU A;  3COA C;  3CP8 A;  4I2O A;  4XOP A;  1I1G A;  2I8D A;  9ANT A;  1BJZ A;  5ICG A;  4LB5 A;  3F8M A;  1KON A;  1K6O A;  1VQK I;  2OV7 A;  3J7Y J;  2EFW A;  1ERD A;  1MBK A;  2Q0O A;  2CFX A;  4RB2 C;  2KFD A;  2L3D A;  3N4M A;  3NWT A;  4LOC A;  1UHW A;  1WVR A;  1SFO J;  2LR8 A;  1O3T A;  2ZJ2 A;  4BJ5 C;  2XSD C;  2M0C A;  4CCL A;  1WPK A;  2VQC A;  2WTE A;  2VB6 A;  3K2A A;  1VQ8 I;  2CQK A;  3CDL A;  4HOB A;  5DD8 A;  3W2V A;  1D0X A;  1BR2 A;  1KU2 A;  3WE2 A;  4UUV A;  3QOE A;  1P7J A;  3M1E A;  2FF4 A;  3R0J A;  2W24 A;  4PFO A;  5EYR A;  3AG2 H;  3VFZ A;  1TW3 A;  1U5T C;  2DDA A;  5IYD J;  1IN8 A;  1W7P A;  3F21 A;  3VEP A;  1RPW A;  4AYB N;  3ZP5 A;  2DU9 A;  4N4O B;  4KUM A;  3B6C A;  4KNY A;  3K69 A;  3PNY A;  2KHM A;  2ELK A;  4UHT A;  1S29 A;  1ZGA A;  2DMU A;  5DD4 A;  3SFZ A;  2CQN A;  1B1B A;  1VQ7 I;  4XLP F;  1ULY A;  5E18 F;  3CCQ I;  4GXO A;  3GTK J;  4IX7 A;  1R00 A;  1QVT A;  1WH7 A;  3TW7 A;  4NHJ A;  1OR7 C;  1ZTR A;  2EK5 A;  4WCG A;  1P9Q C;  2Q8K A;  2BGC A;  1UHM A;  5KVR A;  1U0J A;  3M3Y J;  2CS3 A;  3FF5 A;  2B0L A;  1VF9 A;  5FKM A;  3OL4 A;  3JAM K;  4LB6 B;  4EV0 A;  2MA3 A;  3DTE A;  3SHF A;  3HYI A;  3PO3 J;  2NOG A;  2FMY A;  5LBQ A;  4RLQ A;  2BY0 A;  2NNY A;  2Y9Z A;  5A2Q Z;  4BXU A;  4HF0 A;  4GO1 A;  2XF6 A;  2KQR A;  4AVP A;  3GZN B;  3I3L A;  3ZRG A;  2HQN A;  2K85 A;  2DMP A;  2IVM A;  3DFG A;  2W57 A;  1J5Y A;  4XOT A;  2KL4 A;  5HNH A;  1SFK A;  4L5E A;  2LF8 A;  4IHV A;  5ERI A;  1AA7 A;  5J40 A;  1TNS A;  2NXN B;  1STZ A;  1ON1 A;  4O5V A;  3BG6 A;  3FBN B;  4BYY A;  2DFH A;  2F5D A;  3TQN A;  4H0E A;  2D1H A;  3JTH A;  2ZB9 A;  4M3F A;  1FC3 A;  1XDU A;  3J7Z I;  3LST A;  3L00 A;  3ZMZ A;  2P5L C;  3HSE A;  4XRS A;  4DYR A;  5HS9 A;  1LDJ A;  1WSU A;  4N9I A;  3F8B A;  3CCV I;  2O7O A;  4ENM A;  3SQN A;  1ZR2 A;  2K40 A;  1P4X A;  4A3M J;  1HXD A;  2XUB A;  2EZH A;  2XAQ A;  3KP5 A;  5JHU A;  3LSG A;  2AXL A;  4B1R A;  1YJN I;  4IRI A;  3Q9V A;  2ISY A;  2XIG A;  1DPU A;  5FB2 A;  4ABZ A;  3EET A;  4DNC A;  1YHQ I;  4HG2 A;  4F7Z A;  3E7L A;  1D0Z A;  3QPS A;  3LSH A;  4ASN A;  4C9Y A;  4ETS A;  5CLS A;  1VQL I;  1SAN A;  5DYM A;  1T8I A;  3I0T A;  2D2W A;  4M72 A;  1FSE A;  2FEZ A;  2HOS A;  5EGO B;  2DA2 A;  2LFB A;  3J80 Z;  2BHY A;  2GA1 A;  1QVU A;  2Y69 H;  5F1R A;  4Q5S F;  1SD5 A;  3PFY A;  1OCO H;  1HC8 A;  3GFL A;  5J1R A;  1H8A C;  1D0Y A;  1CF7 B;  5FO5 A;  4AIH A;  2HQA A;  5EG0 A;  3I9V 2;  2R5Z A;  1U5T A;  4PSW A;  4NNJ A;  4IHT A;  3CCM I;  2JA2 A;  4I01 A;  4I7H A;  3HOW J;  3D5L A;  4OIR F;  2W48 A;  4PJJ A;  5ILU A;  1LE8 A;  4OIP F;  3TED A;  2GQQ A;  2Z99 A;  3G73 A;  1Z67 A;  2E35 A;  5L3B A;  3JRA A;  3OYG A;  1YX3 A;  4BS9 A;  3MWM A;  1MSE C;  3CCJ I;  2V9K A;  2HZT A;  1MH3 A;  2JZY A;  3E3V A;  3FKI J;  2K9L A;  3FHZ A;  4DYQ A;  4NUB A;  2OTL I;  3QU6 A;  1U8R A;  3NWS A;  2IJL A;  2X6W A;  2FUG 2;  4RDU A;  1TQP A;  2O8X A;  3HM5 A;  2YR2 A;  2R0Q C;  1T95 A;  2VQL A;  2EB7 A;  4P1W A;  4G9Y A;  3DEU A;  1BC8 C;  2IAI A;  4FE4 A;  2QBY A;  2HZD A;  2DI3 A;  2K27 A;  2EH3 A;  4DJA A;  2GLO A;  1ETV A;  4LGW A;  3JTG A;  2FJ1 A;  5J6X A;  3TDZ C;  1FLI A;  2R7X A;  1ZRF A;  1TP4 A;  3NQO A;  1JE8 A;  3KX2 A;  3J7A Y;  3K1M A;  2E1C A;  5TJJ A;  1VND A;  2MD0 A;  1RKT A;  3W6J B;  1XGM A;  3Q9S A;  2Y30 A;  4L9N A;  4U88 A;  3OYC A;  1XC5 A;  3CJQ B;  2ZCW A;  4XOR A;  1I1S A;  3G2B A;  1YE9 A;  4A3F J;  4F55 A;  4I02 A;  2NRA C;  3GEZ A;  1N75 A;  2P6S A;  2XF5 A;  3DTK A;  3ZR8 X;  2HPM A;  4FT8 A;  2LYC A;  3HRM A;  2VJI A;  4FHT A;  5BOX A;  4NC8 A;  1ZLJ A;  1G2H A;  2XF7 A;  3OYL A;  1MBF A;  1VQ4 I;  3BTC A;  2DBB A;  1TWC J;  2AHQ A;  3F0C A;  2DOA A;  2HYG D;  1BM9 A;  1FMV A;  4LK1 F;  2CV1 A;  2HOT A;  3LOC A;  3OOU A;  2MBF A;  4BY7 J;  3FIS A;  1IJW C;  3HOY J;  2LY9 A;  3ASO H;  2NVQ J;  2JA7 J;  2DA6 A;  2DQL A;  4I0A A;  5JVT A;  4C2T A;  5CPR B;  4J19 A;  4IVN A;  4ESJ A;  1HKS A;  2L9N A;  2W00 A;  3BTL A;  3WGG A;  4A5N A;  1W0U A;  5M3M J;  1UZC A;  3NAR A;  3GTL J;  1MJA A;  2XRN A;  4JK1 X;  2JRT A;  2P8T A;  2QCO A;  4PJM A;  2ECB A;  4EJO A;  1OCC H;  4CCM A;  4PZJ A;  1I3Q J;  2COM A;  2CMP A;  1IGN A;  2H09 A;  3FM5 A;  2JVG A;  1FT9 A;  1EV7 A;  4U0V A;  2OTJ I;  4UV9 A;  4R8H A;  3IRQ A;  4YFX F;  1T98 A;  1A36 A;  5HOO A;  1U2W A;  1JTX A;  1OYW A;  2JJ7 A;  2Y31 A;  2K3P A;  1D1A A;  3MEX A;  2QSF X;  3OS2 A;  3BWG A;  5KNL A;  2WAQ N;  1E0E A;  2DMN A;  3FXJ A;  1I6X A;  1XPX A;  1TZL A;  4M3D A;  3VYS B;  3IUO A;  2H1K A;  5IT3 A;  2V9P A;  2F48 A;  1U9N A;  2X51 A;  1YW7 A;  5GTI C;  2DPU A;  3ECO A;  1Z6T A;  3ABK H;  1W1W E;  4B44 A;  4YFN F;  4ZTF A;  4RAF A;  5D6E A;  1G59 A;  4BJ6 C;  5E1W A;  4CZZ A;  2Q2E A;  1MDM A;  2AQF A;  1SMT A;  5LGT A;  4I0B A;  2GWR A;  4B48 A;  3BCB A;  1VZ0 A;  4A93 J;  1B8I B;  4L9J A;  2DK8 A;  2VOP A;  3MN2 A;  4FTH A;  5E17 F;  1I6H J;  3G1L A;  4UVA A;  3LA7 A;  3H1C A;  1NTC A;  4NC6 A;  1GT0 C;  5FLX Z;  3V8J A;  3CTA A;  3HOT A;  1C0W A;  2O5R A;  3W2W A;  3T0Y A;  5B1B H;  4XR6 A;  1UAA A;  1N25 A;  2GOM A;  2GXB A;  3V8L A;  3WOD F;  3MFK A;  4NQW A;  4IJA A;  2WY8 Q;  4BY1 J;  3IC7 A;  3OYJ A;  3S2H J;  4PCQ A;  2V6E A;  4WK8 F;  4E7J A;  3ERM A;  2XKO A;  2F5C A;  2A3S A;  2CO5 A;  2X48 A;  3E1S A;  3PNT A;  3RZO J;  2LTP A;  3CF2 A;  4ESB A;  4HV5 A;  1KYZ A;  1P92 A;  1MJ9 A;  4XNF A;  2XDV A;  1DP7 P;  4IKF A;  1MJB A;  3CC7 I;  3CF5 F;  2E5N A;  2GBY A;  4I98 B;  2M87 A;  4QPQ A;  3C7J A;  1X58 A;  4E70 A;  1R4M B;  4HDU A;  4LFU A;  4R1H A;  3AG1 H;  3DLA A;  1FMW A;  3D5R C;  3ROU A;  1YOV B;  2QQ9 A;  3I54 A;  1TQM A;  1WJF A;  1ZYR F;  4BAY A;  3KEO A;  3I5U A;  2IGK A;  1FPQ A;  1OJL A;  3DBH B;  1TL8 A;  2L9V A;  1H0M A;  3M1C A;  1CGP A;  3FXQ A;  1JTY A;  4MFE A;  3CJN A;  4D9J A;  5ILV A;  3VPR A;  4Q4Z F;  4M9S A;  1QO0 D;  2STW A;  2VOO A;  2LK2 A;  1JI8 A;  2XGD A;  3ECH A;  2OZ6 A;  5L3F A;  3HRS A;  5IP6 A;  1G8X A;  1Y8Q B;  3FKJ A;  2K9Q A;  4PJ0 C;  5HDN A;  2GIV A;  1D1B A;  2EA2 A;  5F08 A;  1LFU P;  2IPQ X;  1VTN C;  4RBO A;  2J5O A;  2OC6 A;  1B9N A;  5EG0 B;  1PUF A;  3EUA A;  2E1M B;  1QGP A;  4Q48 A;  1LEA A;  2V1U A;  1UJ8 A;  2FML A;  3FMR A;  1WJC A;  4WXH A;  2PFB A;  2RN7 A;  2PMZ N;  3GO5 A;  4PDK A;  3P9I A;  1FBQ A;  1WZ2 A;  5E8I A;  3GUD A;  1Q1V A;  1ZRC A;  3OYN A;  1I3A A;  2IGN A;  1E2X A;  2DFI A;  3A01 B;  3HC7 A;  2WB1 A;  1J2X A;  3C2H A;  2KZV A;  5H6R A;  4OIN F;  3GFJ A;  1X2N A;  5LHH A;  4KA4 A;  5HDG A;  2R92 J;  2DTZ A;  3BG5 A;  3RYR A;  1A35 A;  4GDF A;  2OD5 A;  3O8H A;  1U3E M;  4OMZ A;  1K78 B;  2WB1 N;  2XAG A;  2BVM A;  2EZK A;  3KP7 A;  2HOE A;  2V7F A;  3HSR A;  3PNV A;  1Z7U A;  4DIQ A;  2V6C A;  2XPW A;  1IXC A;  2XGC A;  3TO9 A;  2E71 A;  3SJM A;  1VQ6 I;  3HB9 A;  1EKE A;  1FBS A;  1HKT A;  4KN7 X;  5C4X J;  4BHP A;  3IH2 A;  5L3G A;  3ELK A;  3BOQ A;  3SZT A;  5CVI A;  4EQQ A;  4UUS A;  2YSR A;  3GTM J;  1FBU A;  1IO2 A;  2JSP A;  3VDX A;  3OYH A;  4BHC A;  4HF1 A;  2FOW A;  4BXF A;  2KIF A;  3HKZ N;  1ZH5 A;  2H8R A;  4V2G A;  3H3Z A;  1IRX A;  2XHK A;  3MZY A;  5L3E A;  4A3E J;  1RIO H;  1X2M A;  1BW6 A;  2MSY A;  3CZ6 A;  1ETW A;  2JPB A;  1GV5 A;  2WAQ A;  3ZMD A;  1MGT A;  2O6G E;  2WAE A;  2MW8 A;  3UR3 C;  2R7W A;  4HLX A;  5DCM A;  4XBF A;  2QA4 I;  4IOC F;  3H36 A;  3FK7 A;  4OU0 A;  3WTX C;  2NNN A;  4CCO A;  2JT1 A;  1OFC X;  2E2J J;  4RS8 A;  1BR4 A;  3IWZ A;  1V3F A;  3Q3S A;  4WXC A;  4S05 A;  2UXX A;  1BI0 A;  1Z6R A;  5C3E J;  2QSG X;  1O3S A;  3EQL F;  3DXJ F;  1VQ9 I;  5K5O A;  2DA4 A;  4NB5 A;  1YIT I;  1USS A;  4ZYA A;  3HL2 A;  2DA5 A;  1QQI A;  3I71 A;  3K4M A;  3OS0 A;  1G4D A;  4L18 B;  4UXN A;  4PK4 A;  2KIS A;  5DDG A;  3JRC A;  1OCZ H;  2EFP A;  2ZME B;  3OL3 A;  3JSO A;  5E3O A;  5LD2 C;  1K4T A;  4JX4 A;  3HDD A;  3HGG A;  4M3B A;  1U8B A;  1R23 A;  3X2Q H;  2JVH A;  4LG0 A;  4WF2 A;  3FHN A;  1R58 A;  4CDG A;  2RQP A;  1S5L C;  3PIO F;  2XB0 X;  1BBY A;  1YQA A;  2K9S A;  3IH3 A;  3FWE A;  4XK4 A;  2VE8 A;  2R7O A;  3H35 A;  1B72 A;  3MD2 A;  1G3W A;  2Q1Z B;  1U6G A;  2HPI A;  2MGQ A;  2B9S A;  4EJV A;  1WH5 A;  3HOS A;  5EEG A;  5LHG A;  2OZU A;  1P6R A;  2VBZ A;  2LRE A;  2KLO A;  3BR3 A;  5LEJ A;  2XGX A;  1UCR A;  2ETH A;  1DQU A;  3R6S A;  3FK6 A;  3S8P A;  5CVU A;  3KP2 A;  4BUP A;  2HEO A;  1TWF J;  2XSJ C;  2IRF G;  3QRF F;  1MBG A;  4YEJ A;  4EM0 B;  1MND A;  2HS5 A;  5C4J J;  4RGX A;  1RET A;  2CV0 A;  3TP3 A;  3S3M A;  1YFH A;  2M3A A;  4AIJ A;  4A12 A;  4YG2 F;  5JR3 A;  1J9I A;  2ESH A;  5FLM J;  2RC4 A;  1BI1 A;  2L2O A;  1B4A A;  1MDM B;  4AC0 A;  2VQG A;  2M7A A;  1HW5 A;  2MG4 A;  1MNE A;  3DKY A;  1OKR A;  4ENN A;  4Y3O A;  1POG A;  4DBQ A;  3GWZ A;  2K86 A;  5D6F A;  1UEL B;  3KPH A;  1IDY A;  4HNV A;  4Y7N J;  4QPO A;  2EZL A;  3PSF A;  4DBR A;  5ED4 A;  4Q47 A;  2V1D A;  1DUX C;  4JBA A;  1F5T A;  5GPC A;  1FP2 A;  2XRO A;  1CF7 A;  1GDT A;  4E7Z A;  2ZME A;  2D1V A;  2MLK A;  1G3T A;  3E6C C;  2LC2 A;  1LDD A;  3KEY A;  5K7Z A;  3BCA A;  2JK3 A;  3FZV A;  2IS6 A;  4KYW A;  1AHD P;  2M30 A;  3GZ6 A;  3BTI A;  5BQT A;  1YX5 A;  4AID A;  1O3Q A;  4BH9 A;  2X1C A;  1B72 B;  4DOZ A;  5B1A H;  1FX7 A;  3Q0U A;  1N77 A;  4GFB A;  2BE5 F;  1JUP A;  3ZMU A;  5FKN A;  3S16 J;  1YIO A;  2IGM A;  2EQR A;  3QWL A;  4OWR B;  4RGU A;  2DPD A;  4FAS D;  4LMY A;  2KP6 A;  3CC2 I;  1JT6 A;  2DA3 A;  2EV0 A;  4M6Y A;  4M9X A;  5D5X B;  4IHX A;  1JT0 A;  3ZQH A;  3GFI A;  3H9J A;  5HOD A;  1UHS A;  3Q5F A;  3K9T A;  4RAZ A;  4DZJ A;  3F6O A;  1IV6 A;  2OQG A;  3DQV C;  4EGZ A;  4P9U A;  4BHB A;  4OOI A;  2Z2S B;  4JOM A;  5LGN A;  3TDU C;  2EIN H;  2CFO A;  2IS4 A;  2DOD A;  2Z9O A;  2LKX A;  1ITY A;  2V1N A;  1DGR M;  1X3W B;  3S1M J;  3MAJ A;  1J7K A;  3GLX A;  2X4H A;  1BW5 A;  4BEH B;  1J75 A;  1ETY A;  1K6Y A;  1YRN A;  3A4C A;  4KDP A;  2CUE A;  4H4K C;  1QNT A;  2BXY A;  3FXK A;  2LBF B;  4RGS A;  2VJ5 A;  3E5U A;  3HIF A;  3LFU A;  2NS7 A;  1OMI A;  3GYH X;  4J00 A;  2O9L A;  4B3A A;  1S7E A;  3FXL A;  4U7D A;  1MMA A;  2TRT A;  4IHW A;  2CW0 F;  2C6Y A;  3ULQ B;  2ID3 A;  3KE2 A;  1AKH B;  1IRF A;  1I27 A;  1X1C A;  5D5W B;  2JA5 J;  1OPC A;  2UXN A;  1P7I A;  3TGN A;  1HW2 A;  3RKW A;  4GGG A;  5IOZ A;  3BQY A;  2JPC A;  3U9G A;  5FJ8 J;  1ETO A;  4L0Y B;  3VOE A;  2PJP A;  2VXD A;  4OAY A;  4HQE A;  4IRG A;  1IN7 A;  2DO7 A;  2V1X A;  4D0P A;  2B7E A;  2HFH A;  2BY1 A;  1K78 A;  5IP7 J;  4OAZ A;  2H94 A;  1FOW A;  2QF7 A;  1VQM I;  3LL7 A;  3W2A A;  4FCY A;  2HVS A;  3S17 J;  4MEX F;  3CJR B;  2BXZ A;  1REP C;  5E3N A;  3BQZ A;  1SC7 A;  4OIQ F;  1MSF C;  2K3F A;  5D5V B;  2D5V A;  4G7Z F;  2K9N A;  1B6A A;  2IA2 A;  2ZXJ A;  4DW6 A;  2JWT A;  2JA8 J;  4UUS B;  3M7G A;  1O4X A;  2ZC2 A;  5K5R A;  2A07 F;  4HSR A;  1XGS A;  1DU6 A;  5K1Y A;  1R1V A;  1I5Z A;  2H1L A;  3OS1 A;  3OYB A;  3H3V K;  1FSH A;  3QPL A;  3BR6 A;  4P55 A;  4C3J J;  3AL0 B;  2ZFW A;  1X1P A;  1OCR H;  2R7F A;  4BQN A;  2BVL A;  2V4J C;  2BBY A;  2LBF A;  4HA8 A;  5HNF A;  4AIK A;  2BW3 B;  2LY2 A;  4G7H F;  1EH6 A;  3U2R A;  2VON A;  1JXS A;  2CWE A;  2HYJ A;  2FBK A;  5HLG A;  1DU0 A;  3S32 A;  1NG7 A;  4GCV A;  4PGG A;  4HRI A;  4G7O F;  5B66 C;  3L2Q A;  2BV6 A;  5K7F A;  2PMH A;  3SYT A;  5J47 A;  1V5F A;  1ORK A;  3S1Q J;  1JUS A;  4HAM A;  4XQF A;  1AKH A;  4DYC A;  4F3Q A;  4IHS A;  1B8I A;  2F4I A;  3TBI A;  3GLL A;  2FQ4 A;  2O03 A;  3DKW A;  3GZ5 A;  5H6Q A;  4BE2 A;  1V4R A;  3CUO A;  4FQG A;  3EPZ A;  2ZO4 A;  2OCC H;  3M4O J;  2E1O A;  5EZH A;  3LSM A;  1GXQ A;  5CVR A;  4A3K J;  3F8N A;  2R5Z B;  4MQ9 F;  4HLY A;  2E1N A;  4E7H A;  2M4K A;  2LMD A;  1XSD A;  4QIW N;  1MW7 A;  3IL2 A;  2ZJR F;  4LG0 B;  4YII A;  2DCE A;  2VOD A;  2LKS A;  3S3O A;  3LA3 A;  3R61 A;  4LLG F;  4UY8 I;  3L9F A;  2CW8 A;  2HNH A;  2KKO A;  4JX6 A;  4B4C A;  2RV8 A;  4IHY A;  1QPI A;  3MCZ A;  3OR2 C;  5J4Y A;  1SD4 A;  1K79 A;  1HKQ A;  2UZK A;  4M3G A;  1MMN A;  2MFZ A;  4B47 A;  4HW0 A;  1XMK A;  2QUF A;  1R71 A;  1YO5 C;  5J1U A;  1B9M A;  3BR5 A;  4X6A J;  3WE3 A;  4GRI A;  3EDP A;  3WTS C;  3PUB A;  2W85 A;  4Y13 A;  3JRD A;  2LH9 A;  2JRM A;  2RRE A;  1XCB A;  2NYX A;  4L9V A;  5HS7 A;  5E20 A;  3K4J A;  3U1K A;  4PJN A;  1IF1 A;  4A0Z A;  2K5C A;  3HTS B;  5GAG J;  1OYY A;  2VKV A;  3RQI A;  5FD6 A;  3TKY A;  2P5V A;  4XRF A;  4JX5 A;  1V5E A;  5J1Y A;  1QZE A;  1XCV A;  5DM6 F;  1ZG5 A;  2OJE D;  3IAM 2;  3BZC A;  3NRV A;  3ZQ7 A;  2VE9 A;  2BEO A;  2M8G X;  4JP0 A;  1R7J A;  4QWQ A;  3E6M A;  1NK3 P;  4O6J A;  2DYS H;  2Y48 A;  5DCF A;  1NH3 A;  2DT6 A;  2QWW A;  1G6N A;  2L4M A;  2QKL B;  2N8G A;  5F6F A;  2X6O A;  5JLW A;  3OYF A;  4J01 A;  1SFU A;  2ZSI B;  3DV8 A;  5E3M A;  2ICW G;  4O3M A;  3S15 J;  5K7H A;  1Z91 A;  3OYE A;  2DW4 A;  5J8C A;  1UST A;  4L9T A;  4D1Q A;  2VQH A;  1WQ2 A;  3GME A;  2YU3 A;  2DT5 A;  4G6T B;  2DFF A;  5HLT A;  2X1D A;  1H89 C;  3S93 A;  2E7W A;  2ELJ A;  4XSZ F;  5DTD A;  4MEY F;  3NAU A;  1DPR A;  1R1T A;  3S2D J;  2DOF A;  1PP7 U;  5E3L A;  1T38 A;  1SVL A;  1QZY A;  3ML6 A;  2L0K A;  4I99 C;  5DV5 A;  1WWX A;  1VQ5 I;  4XKV A;  1FY7 A;  3GW2 A;  3VB2 A;  3EUK L;  3CES A;  4TV7 A;  2HGC A;  4FIS A;  1EJ9 A;  4OMY A;  1LUJ B;  1LPQ A;  1RUO A;  1U78 A;  4N0B A;  3WTY C;  1Y1W J;  3A03 A;  2HKO A;  3KLO A;  3WU2 C;  1SVM A;  2AQE A;  1T56 A;  1E3P A;  4FET A;  1HW1 A;  4ZYH A;  2LG4 A;  2HU9 A;  1FIA A;  5CKT A;  3LSP A;  1XMA A;  1XB4 A;  1WGX A;  4D5F A;  1G3S A;  1D1C A;  4HZF A;  4XRS G;  5ICF A;  3M8F A;  2FA5 A;  2FRH A;  2GOX B;  1VQN I;  3OIP A;  4Y33 A;  5C44 J;  4ZTJ A;  2OU2 A;  1W4M A;  4CH7 A;  3WGI A;  2I5U A;  5HVQ C;  1EH7 A;  3ABU A;  3CLO A;  1XS9 A;  4BNC A;  3CQZ J;  3RDI A;  1FJL A;  1IV8 A;  4ZZL A;  2XAS A;  2Y9Y A;  3G3Z A;  4IF4 A;  2EFQ A;  2RGV A;  1ON2 A;  2HYF A;  1S3J A;  3DEW A;  3QYB A;  1Y0U A;  3JSP A;  3WTU C;  3CJT B;  4I09 A;  2QQB A;  3GTJ J;  1DP3 A;  1IW7 F;  1MKM A;  1I50 J;  2VT3 A;  2GIZ A;  2KPM A;  4IPA A;  1H88 C;  1N78 A;  1T0F C;  4ZDL A;  1ONV A;  3U21 A;  4II2 A;  2A6E F;  2CQQ A;  4EAT A;  3K4C A;  4HPQ A;  5EGO A;  3OIO A;  3CMM A;  3IP4 B;  1VQP I;  3WHC A;  1XN7 A;  1QRY A;  3JRE A;  4BGD A;  2OBP A;  2M45 A;  1AWC A;  3O2P E;  2DYR H;  2HKX A;  3NEU A;  2VT2 A;  1KZH A;  1K4S A;  4CZC A;  4XN3 A;  3SEZ A;  2JSC A;  4A3D J;  4AYB A;  1XGN A;  3CCY A;  1ENH A;  1W5C C;  3JW4 A;  3CMA I;  1BIB A;  2F4O B;  3HHH A;  2XAH A;  1F36 A;  1Z3Y A;  1ETK A;  4ZYD A;  2KJC A;  4GYG A;  4DGW B;  5CVV A;  2V26 A;  1UG0 A;  3I64 A;  1S9H A;  3LNQ A;  1A6I A;  3OYD A;  2A5Y B;  2QQ8 A;  3QP5 A;  3L2W A;  2J5P A;  1W36 C;  2FBI A;  4HYE A;  1SMY F;  4UVB A;  4F52 A;  4MNU A;  2CV2 A;  1TWH J;  2XAJ A;  3MVP A;  1CQT A;  1A31 A;  5LRR A;  4XSX F;  1WJD A;  3AG3 H;  1YJW I;  2Z3Y A;  2ISZ A;  4XON A;  1XG1 A;  1ZHF A;  5EDN A;  3BY6 A;  3QQA A;  2UUZ A;  1XSX A;  4NDL A;  3SXY A;  1DGW Y;  5L3C A;  3QAH A;  1SVO A;  1MIJ A;  1PP8 F;  4I6Z A;  1R1U A;  4AD9 A;  1S72 I;  1XSV A;  2JQ7 A;  3RJP A;  1FEX A;  2AO9 A;  3T8T A;  1WJE A;  4MTE A;  1HBX G;  4HNU A;  2NVU B;  2W84 A;  3LSR A;  5FRN A;  1R4N B;  3MQ0 A;  1MBJ A;  4UVC A;  1ACI A;  4CA0 A;  2HI3 A;  5FRO A;  3HHG A;  2IS2 A;  2ZME C;  1IXR C;  3FXR A;  4K2E A;  3ZQC A;  4MO7 A;  4C2M J;  1J09 A;  2MD5 A;  2VBX A;  3I59 B;  4EM1 A;  3DPU A;  5BNG A;  2OAZ A;  5TIS C;  2HXO A;  1ZQ3 P;  2E60 A;  3H5A A;  3GTO J;  3HGY A;  2DMT A;  2YUS A;  4M9Z A;  1BC7 C;  4M71 A;  1TTY A;  1Z0X A;  4KIB A;  4CGZ A;  1ZEL A;  1BOB A;  2OUM A;  2LF7 A;  3RYP A;  2NOJ B;  1FOX A;  2IEK A;  3RKY A;  3E0J B;  4YIF A;  2M1B A;  3J80 K;  1IUF A;  3OYA A;  3LWF A;  1FYK A;  3SDG A;  3JAM Z;  4RB1 A;  3CP2 A;  3J81 Z;  4XLE A;  2L54 A;  2LVS A;  3KYD B;  4KIG A;  1JKO C;  5BS6 A;  2PX9 A;  3BJA A;  3GVA A;  4F91 B;  1VI0 A;  1YLF A;  4PFP A;  5LGU A;  2W1O A;  1IN6 A;  2M34 A;  3ASN H;  2R7V A;  4YEL A;  5J4V A;  4BXX J;  3E5X A;  2L7Z A;  1FYM A;  2LDU A;  3MKL A;  1GHC A;  3BG9 A;  4G6Q A;  5AON A;  2LRD A;  3I4M J;  4ON0 A;  1ZLK A;  2E36 A;  5J3L A;  2MAB A;  2GAU A;  3MKY B;  4A3L J;  2YU9 J;  1SFX A;  1MH4 A;  4ENK A;  4LLN A;  1NHA A;  5FKO A;  3AL0 C;  3LA2 A;  4QSH A;  3KP6 A;  3A2K A;  2IW5 A;  1ZRE A;  4G12 A;  4NC7 A;  6PAX A;  4XLF A;  1IRG A;  1GVJ A;  3PIP F;  5TRD A;  4U87 A;  3V8K A;  2R7T A;  3HG9 A;  2FNP A;  2PQ8 A;  4G8X A;  3FX3 A;  3SFI A;  2G7H A;  3F23 A;  2XPU A;  1DDN A;  4LLL A;  1RR8 C;  1Y0N A;  4BQQ A;  2VN2 A;  4B09 A;  3HUG B;  5CYV A;  2P0W A;  4S04 A;  2F5E A;  1LFB A;  2FXA A;  4OIO F;  4CYD A;  2HVR A;  2Y0S A;  2JMW A;  1D3Y A;  1KQ0 A;  3KCC A;  3ZMS A;  3H9Q A;  3SZP A;  4ZYG A;  2X9D A;  3VWB A;  1UFM A;  4N9H A;  3WU1 B;  2PI0 A;  3GF2 A;  5B3S H;  2EV6 A;  2P4W A;  4RB0 A;  4PJL A;  1S8N A;  2A6H F;  1WKM A;  2BHZ A;  4LD5 A;  2ZSH B;  2H27 A;  2QKM B;  3QOD A;  2ZKZ A;  1V55 H;  3T8R A;  2D45 A;  2DA1 A;  2RQQ A;  3EUH A;  4KJZ A;  4KIT B;  3VYT B;  2VJJ A;  1XMX A;  1Z05 A;  3A0H C;  5HLI A;  1FYL A;  2KZG A;  3F72 A;  2ZXI A;  4XLC A;  2FSW A;  2VBY A;  3EYI A;  4ZJZ A;  2KMU A;  1GLN A;  1IN4 A;  3A0B C;  2H6B A;  3DCF A;  2IGO A;  2ADU A;  5CQE A;  4U0Y A;  4DQ2 A;  4IO9 F;  4P9F A;  1ZRD A;  2L7K A;  1D8J A;  3LAJ A;  3B02 A;  3HTU A;  5E1Z B;  2R7D A;  1BL0 A;  4BJT A;  4M74 A;  1Y56 A;  1LDK B;  2VKH A;  2Y0M A;  1TT0 A;  2HTS A;  2VXZ A;  4D7M A;  4HDV A;  2DT7 B;  1PUF B;  4FX4 A;  2BW3 A;  2V79 A;  5ICE A;  2KIU A;  3GXO A;  4XM3 A;  1PYV A;  5EZG A;  3H3U A;  2EWN A;  3V4G A;  4EJT A;  3TW6 A;  4BE0 A;  3HPG A;  4EJU A;  2KJB A;  3MKZ A;  2OQR A;  3KEQ A;  4A3I J;  5M3F J;  2IBD A;  2R7Z J;  3AG4 H;  5FD5 A;  2FU4 A;  2XB5 A;  2YX4 A;  4XID A;  3CCE I;  4AM3 A;  1D8K A;  4MQV A;  4XL9 A;  2ZJQ F;  4Y4R A;  2VL8 A;  1RC9 A;  2JTV A;  3R60 A;  2QZ8 A;  3F8F A;  4XMY A;  5KCM A;  1JJ6 C;  3F8C A;  3BR1 A;  3DPT A;  3WG7 H;  4E4H A;  4RMN A;  1YW8 A;  4CSW A;  4M6V A;  2UV1 A;  2VC1 A;  1E17 A;  2R7S A;  1BA5 A;  1IG7 A;  3KYC B;  3TL4 X;  3RI4 A;  1PDN C;  2P5K A;  2CG4 A;  2XVC A;  2L7F P;  1KU9 A;  2JA6 J;  1F4K A;  1ETX A;  3M9A A;  3HUG A;  2RNG A;  3L2U A;  2MC3 A;  4ZDO A;  3KZZ A;  3K1P A;  1TQI A;  2X6Y A;  2ME0 A;  4XLH A;  2WWY A;  1ZG1 A;  1TBX A;  1YIJ I;  3KFW X;  4I76 A;  2HVQ A;  4AUX A;  2QEX I;  3DPL C;  2PJR B;  3I53 A;  3B73 A;  2KIQ A;  3E6B A;  4R79 A;  3IH4 A;  2KDZ A;  4BAC A;  3N97 A;  1ZR4 A;  4RB3 C;  5BMZ A;  2CQ7 A;  3CMY A;  1ZKG A;  3FM3 A;  2X1E A;  2Y2Z A;  1VQO I;  2MLG A;  4UUT A;  5KAI C;  1BOA A;  2O3F A;  5ILS A;  3QPT A;  3R0A A;  3KIO A;  3BZ6 A;  4A0X A;  4KT6 A;  5A2Q K;  2HDW A;  2EZI A;  4EEF G;  1YJ9 I;  1T6S A;  4Z2Y A;  2E19 A;  3SZG A;  4V19 K;  4LJZ F;  1BI2 A;  2NS0 A;  3TOB A;  2EIL H;  3QPH A;  4BU2 A;  4ANJ A;  3QOP A;  2CQX A;  5E1X A;  2P81 A;  3WTT C;  4ZYE A;  3IV5 A;  1W0T A;  2ID6 A;  2YX7 A;  4EGY A;  4P5O A;  3I59 A;  1FOY A;  4CHU A;  3P5J A;  1UB9 A;  3CUQ A;  3FIW A;  4KMF A;  3WTZ A;  2QSH X;  3ZMV A;  3PL8 A;  4CO8 A;  2XAF A;  3OYM A;  1X19 A;  4HX8 A;  5E79 C;  1R5H A;  3ISP A;  3I4P A;  3PUF A;  4A0Y A;  1EF4 A;  2ZBK A;  3CO6 C;  3ONQ A;  3H92 A;  5E8G A;  4BL0 B;  4JQF A;  1R5I D;  4Y17 A;  2Z16 A;  2BY3 A;  3Q0W A;  5CQG A;  1WJB A;  4KIF A;  2AS5 F;  2F5V A;  2VUM J;  4CXF A;  3TO6 A;  3L2V A;  2LOO A;  1LVA A;  1KYW A;  1YW9 A;  3GCM A;  4MGR A;  4YFK F;  5IP9 J;  3O3K A;  1EH8 A;  5D4R A;  1ZGJ A;  5KK1 A;  2HDD A;  1JHF A;  3EYY A;  4WXD A;  5D4S A;  3DWL E;  3ZQF A;  1W5S A;  3BZK A;  2CYY A;  2BY2 A;  3CME I;  2HR3 A;  2IA1 A;  1U5T B;  4G94 A;  4M3E A;  5IT9 K;  1VFC A;  2EFO A;  1MMD A;  1QHG A;  2LD5 A;  2VC0 A;  3OY9 A;  2LNB A;  2HQR A;  3LQQ A;  3O6B B;  3J81 K;  1OCP A;  1OIS A;  1FNN A;  2A61 A;  2PMU A;  1LB2 A;  4II3 A;  2VI6 A;  4B8X A;  2OA4 A;  3VOD A;  1YI2 I;  4F93 B;  1JHH A;  2FOK A;  4XIC A;  2A5W A;  2L7M P;  3DKX A;  4KMU X;  2CGP A;  5GAH J;  1YS7 A;  3RKQ A;  2FE3 A;  3HXL A;  1HDP A;  5JLX A;  4HF2 A;  3IAS 2;  5F0C A;  4LIT A;  5GAD J;  1LKX A;  3BLY A;  3G6E I;  1RI7 A;  1LEB A;  1HOM A;  3BPX A;  5CJ9 A;  1J0R A;  5J8F A;  1V54 H;  3BJO A;  4XLN F;  4BDZ A;  3FMQ A;  3HOV J;  1X3Z B;  3VSK A;  2Z5U A;  3ZQL A;  3W6V A;  1W5T A;  1TWG J;  2VKE A;  4CCJ A;  2NVY J;  2X85 A;  3H5N A;  3P9K A;  3SDB A;  3QYF A;  1MBE A;  3AKZ A;  2QBY B;  4HNT A;  5IYB J;  1Y6I A;  4KIS A;  3LSJ A;  4PSX A;  3K10 A;  4BE1 A;  1L3L A;  3KP4 A;  4UB6 C;  2TCT A;  4RM3 A;  4X1E A;  2WY7 Q;  3TP0 A;  3G1M A;  4WWC A;  5JFR A;  1FIP A;  1B59 A;  3HSF A;  1WJ5 A;  1BJA A;  2WAF A;  4IEJ A;  1MNM C;  4IZZ A;  1D5V A;  5BPD A;  1KU7 A;  4A3B J;  1YTY A;  4MFD A;  3F9K A;  1Y1V J;  2QGU A;  4BBS J;  1NK2 P;  2P6T A;  4KN4 X;  5F0H A;  3RIR A;  3PO2 J;  2TDX A;  2W25 A;  2G7U A;  1FP1 D;  3M8J A;  3U1D A;  1XGO A;  1Q1H A;  1D5Y A;  5EEA A;  4CYC A;  3OIQ A;  3KET A;  5AIP A;  1YYV A;  1ZAR A;  3BDD A;  1Z3X A;  5LRS A;  3ZOB A;  3KZI C;  2RKH A;  4MTD A;  1QPM A;  4HST A;  3I56 I;  1JUM A;  2ZJP F;  1SFE A;  3K4L A;  5K5Q A;  1LFP A;  3A01 A;  2H6C A;  4D7N A;  4AU7 A;  1H9G A;  3S1N J;  4AWX B;  2WAD A;  5DUK A;  4QTR A;  2IT0 A;  1F43 A;  4D5C A;  2X6X A;  3DU5 A;  3FDY A;  5IYC J;  4E7L A;  1JGS A;  4BQO A;  1WJA A;  1RUN A;  3K7A J;  4ZDP A;  2G0E A;  3ZMT A;  1MMS A;  2XC7 A;  4BKX A;  3QU3 A;  1JGG A;  1BN5 A;  4PGH A;  3JRB A;  1GUU A;  2LLK A;  1SD7 A;  1QA6 A;  1T33 A;  2QLZ A;  3L09 A;  4UV8 A;  2R7U A;  1QZZ A;  3V7R A;  3ZQG A;  3OSF A;  2H8W A;  2WBM A;  1P4A A;  3GX4 X;  3RQ4 A;  3DU6 A;  1LNW A;  2ME6 A;  5H2F C;  3W6K B;  1O7L A;  1LJ9 A;  2DAO A;  1IN5 A;  2COB A;  2M5W A;  1R5G A;  2CU7 A;  2VBW A;  1X1B A;  3ZPL A;  2CUJ A;  2DK5 A;  3FXM A;  4L0Z B;  4BDY A;  5F04 A;  1TW2 A;  3PQK A;  4KT5 C;  5LHI A;  5BPI A;  2B63 J;  5F27 A;  1TWA J;  3REO A;  5LLQ A;  1WI9 A;  1ZG3 A;  5L3D A;  3WHB A;  4B3X A;  4ESF A;  5DM7 F;  2A05 A;  1QU3 A;  5KHD A;  3G1O A;  1HA8 A;  3ZN0 A;  1L0O C;  2GM4 A;  1AU7 A;  4B43 A;  3H0D A;  2I10 A;  2LKP A;  1V5G A;  3T1B A;  3HRT A;  1TNT A;  4Y52 J;  2A6T A;  3HKZ A;  4FE7 A;  3H0G J;  4RA2 A;  4EMS A;  1FZP B;  1KU3 A;  2DMQ A;  2L4A A;  1P2F A;  4IOA F;  2EA4 A;  1G3Y A;  4HX4 A;  3WG9 A;  1O57 A;  2OF7 A;  1Z77 A;  2PN6 A;  4XKC A;  1K61 A;  1S7O A;  2XV4 S;  3FXU A;  2EFN A;  5JI6 A;  3C2B A;  3RKX A;  1IAW A;  2Y0S N;  3HZJ A;  4KIC A;  4NQW B;  5D8K B;  1X4P A;  3RSN A;  4E7I A;  3BP8 A;  1TT5 B;  2M8E A;  4LIV A;  3RPU D;  3D1N I;  2PG4 A;  1YS6 A;  3ABT A;  4MHG A;  3ZGK A;  1R9T J;  2XAU A;  1OR7 A;  2VAS A;  2DN0 A;  2O61 A;  2L01 A;  2KRH A;  2K4B A;  2MYS A;  2KRC A;  1YG2 A;  2CH0 A;  3K1N A;  5KAF C;  3F22 A;  2CSO A;  1E3O C;  1HQC A;  3K6G A;  1W7P B;  3BG3 A;  3JRH A;  1LVK A;  3CD6 I;  3GFM A;  2ZFU A;  4XKB A;  5EF6 A;  1W36 D;  3VSL A;  4P96 A;  4ITV A;  1OYI A;  1KQ9 A;  1SEU A;  2L5Q A;  3ZCO A;  2JN6 A;  5IOY A;  1TC3 C;  3CCS I;  1XTA A;  2BYV E;  4CIC A;  4A3C J;  3LSI A;  2FQ3 A;  3BC8 A;  4S0H B;  2CUZ A;  2W7N A;  3V42 A;  4QLC U;  4DZP A;  1IZ1 A;  2R3S A;  4W97 A;  3PFI A;  3G71 I;  3DP7 A;  1KA8 A;  1X1A A;  4RGR A;  2E34 A;  4E6K G;  3P9C A;  3OR1 C;  2EPF A;  4YIR X;  2VPL A;  2FBH A;  4NBQ A;  3OYI A;  4N4N B;  1W7P D;  3LMM A;  3VYR B;  2ECC A;  1Z9C A;  3A02 A;  3GTP J;  3ESW B;  1S6L A;  4LG3 A;  2DJN A;  1OQY A;  2K02 A;  3EUH C;  3MMY B;  2G9W A;  2M0M A;  4L5J A;  5CVJ A;  2R5Y B;  3K70 D;  1XD7 A;  3BR0 A;  2LP0 A;  3IHU A;  3RPU A;  1JKR C;  4F92 B;  2ZXW H;  1RRJ A;  3K70 C;  2WC2 A;  2KT0 A;  3W3C A;  2GXA A;  5GP9 A;  3FXO A;  4A5M A;  1ETQ A;  3DEE A;  2M9H A;  2MC4 A;  3JCU C;  3JR9 A;  2OCE A;  2LSO A;  1APL C;  2E2I J;  2M7B A;  1FTT A;  1FWZ A;  1X1D A;  2STT A;  3ZXS A;  4M6X A;  1WFX A;  4RM2 A;  1GV2 A;  5FGM A;  3I55 I;  4U0W A;  4AVZ A;  3CDI A;  4BBR J;  3IKV A;  2VIX A;  5M5X J;  3F3X A;  1I39 A;  1LQ1 A;  4RAG A;  4BEH A;  1Z7L A;  2GXG A;  3BJ6 A;  1QHH D;  1RR7 A;  2BOL A;  3TOA A;  4Z6Y A;  1AOY A;  2DJI A;  2NVX J;  3C18 A;  5EJC A;  1T2K A;  5FLV A;  4CUG A;  1Z21 A;  3VYU B;  3CCL I;  1IUY A;  2LY1 A;  3K4N A;  2L02 A;  3CCU I;  1PVE A;  3QP6 A;  3CC4 I;  5DCM B;  2ESN A;  3D0S A;  3LAP A;  2ACJ A;  1MMG A;  2DDB A;  2Z33 A;  4YRV A;  5M5W J;  3L2C A;  4RLF A;  5FKL A;  5ICC A;  3V7S A;  5EEH A;  1IXS B;  3OWT A;  3P7N A;  3DF8 A;  4FX0 A;  2QM3 A;  3RCO A;  4EM2 A;  1WHU A;  4L5I A;  3CLQ A;  3LQR A;  2CJJ A;  2RAE A;  4RAY A;  5GAE J;  3BG7 A;  1RKW A;  4ZH4 F;  3V7C A;  2HTJ A;  2PBI A;  1FTZ A;  5M5Y J;  2E7X A;  5FLX K;  1E3H A;  2YS9 A;  2QYO A;  2F5F A;  2EV5 A;  1J59 A;  2R7R A;  2W82 A;  4XLA A;  2ELH A;  2DXI A;  3PQJ A;  3RPQ A;  3MZH A;  3UNG C;  2P7C B;  4MIM A;  3KYL A;  4G6D A;  4A3G J;  1U9O A;  1QBJ A;  5TGT A;  3L7W A;  1F9N A;  2F2E A;  2M4G A;  2O0Y A;  3G4S I;  2PJR A;  1A5J A;  4X0G A;  2EIK H;  1ODD A;  4Y15 A;  2DLL A;  4A6E A;  2GZW A;  4HBL A;  1UG2 A;  2O8K A;  1JKQ C;  3KP3 A;  2P7V B;  5FRM A;  3TMO A;  3K4K A;  2HXI A;  2L9R A;  4XN0 A;  3CDH A;  2R5Y A;  3AAF A;  1WCM J;  5DEQ A;  1SD6 A;  1BI3 A;  3IRR A;  2EIJ H;  2VJ4 A;  1EA3 A;  1RZ4 A;  2XRL A;  4E7S A;  3WTV C;  2ZNZ A;  1S7A A;  3BTJ A;  3I58 A;  3DBL B;  4KFC A;  1UMQ A;  4C3H J;  4HV6 A;  2AXT C;  1FOK A;  2QVO A;  4CCN A;  1H9T A;  3PJR A;  4HX7 A;  2L9S A;  1IC8 A;  2ZXH A;  3ABL H;  5LEK A;  1IRZ A;  2K9M A;  3WGH A;  5JVG F;  3H9G A;  1IDZ A;  2HQ5 A;  5FFZ A;  1HST A;  3HPH A;  3BRO A;  2KRF A;  3A1Y A;  3CUQ B;  3M8E A;  2EJR A;  2NS8 A;  3QYE A;  5H20 A;  4IL6 C;  3OYK A;  5FKK A;  2HOA A;  3DBR B;  3R4K A;  2M2E A;  3T5X A;  1X4O A;  4E7K A;  2CW7 A;  1GXP A;  2E2H J;  3WTW C;  1MZB A;  3IWF A;  2DOE A;  2NVT J;  3GBG A;  4PUS A;  4A2U A;  2EBI A;  3CCR I;  1ZAO A;  4V2F A;  3JRI A;  2OPT A;  2F6C A;  3CUQ C;  1ZK8 A;  2VKD A;  1HDD C;  2F4M B;  1RNL A;  3GTG J;  3BPV A;  4UNO A;  1O7F A;  1F1Z A;  3HOX J;  2KDO A;  3PSI A;  2HWV A;  4IXA A;  3S2W A;  2X0L A;  3HJE A;  2VLA A;  2QEN A;  4HQM A;  2RNJ A;  3S3N A;  2XGE A;  4LK0 F;  5B5E C;  3HOZ J;  1T0F A;  2YPR A;  2KIM A;  4MLO A;  1MBH A;  4W1U A;  3ERE D;  3K2Z A;  3E97 A;  2QQA A;  3RZD J;  1T39 A;  5F1J A;  1TLH B;  4LIU A;  4A3J J;  4BQA A;  3BT9 A;  3Q0V A;  1Y39 A;  4HEA 2;  4GYI A;  3TO7 A;  4JYK A;  3DTI A;  2RDP A;  4WX9 A;  3DLL F;  2XKP A;  2R7Q A;  3JRF A;  3L1P A;  3GTQ J;  1JKP C;  2XPV A;  4IQ4 A;  5IPA A;  3RTR A;  2A68 F;  2BZT A;  3KLN A;  5JHF A;  1ZGW A;  2RVC A;  5DUI A;  3WU0 A;  2DFE A;  4IQJ A;  2IS1 A;  2Q2E B;  2PMZ A;  1KGS A;  4XRM A;  4EVI A;  2E5Z A;  2Y75 A;  2IP2 A;  3S14 J;  1K83 J;  2ZNY A;  1P4W A;  4IRH A;  4U7B A;  3M07 A;  3ZQI A;  5F0F A;  2A69 F;  1O3R A;  3HOU J;  3I4N J;  1YRN B;  4ZC3 A;  2IA0 A;  2FX0 A;  2VPR A;  1BR1 A;  2WA0 A;  1BIA A;  5DS9 A;  1M1E B;  2WV0 A;  1OLT A;  3FMS A;  5HDK A;  3FBI B;  4CYC B;  1X3U A;  3J7A O;  2WV1 A;  2DA7 A;  3ABM H;  3UKG A;  1A04 A;  1LE8 B;  2K7L A;  1HF0 A;  4C30 A;  5GTH C;  1Z1D A;  2FD5 A;  2MH2 A;  3E6D A;  3C3W A;  3MKW B;  4ZZD A;  3JRG A;  2NAZ A;  3B6A A;  3PM1 A;  5F64 A;  1XX5 A;  4CCK A;  2DQR A;  3E5Q A;  2PEX A;  2UWM A;  5HLH A;  1T08 B;  3HEF A;  1Y8R B;  5GPA A;  5IY5 H;  3K0L A;  2Z1D A;  1OCT C;  5D5U B;  2DTR A;  1HSJ A;  1ZN2 A;  3OMY A;  4A6D A;  2FNA A;  3ZN1 A;  2K4J A;  4C3I J;  2E1M C;  3H5R A;  3L2R A;  1PJR A;  5FFX A;  3ZQQ A;  2GA2 A;  3CO7 C;  1GVD A;  3O8G A;  3OV8 A;  3C1D A;  2EIM H;  2V9V A;  5HS8 A;  1A6Q A;  1NG6 A;  3S1R J;  2IXS A;  5AIQ A;  2CUF A;  3K4B A;  3N05 A;  3MZ8 A;  3F6V A;  5LFA A;  4C2U A;  4ENJ A;  1HCR A;  2HDC A;  3HBL A;  4EJW A;  3SEQ A;  5IT9 Z;  1R36 A;  3LFK A;  3BR2 A;  2CRG A;  2PLY A;  3LSK A;  1K7A A;  1SAU A;  1MD0 A;  3AFH A;  4XKW A;  1XDS A; 
#chains in the Genus database with same CATH homology
 1R22 A;  4M73 A;  1WRJ A;  1PUE E;  1KQ8 A;  3KZY A;  2MH9 A;  3IKT A;  5D8L B;  1SAX A;  3OOP A;  3HRU A;  3COA C;  4I2O A;  1I1G A;  5ICG A;  4LB5 A;  3F8M A;  1K6O A;  2EFW A;  2Q0O A;  2CFX A;  4RB2 C;  2L3D A;  3N4M A;  1UHW A;  1O3T A;  2ZJ2 A;  2WTE A;  2CQK A;  4UUV A;  4HOB A;  5DD8 A;  3WE2 A;  1KU2 A;  3R0J A;  3M1E A;  2FF4 A;  3VFZ A;  2W24 A;  1TW3 A;  1U5T C;  1IN8 A;  1W7P A;  3F21 A;  3VEP A;  3ZP5 A;  2DU9 A;  4KUM A;  4KNY A;  3K69 A;  4UHT A;  1S29 A;  1ZGA A;  5DD4 A;  3SFZ A;  1B1B A;  4XLP F;  1ULY A;  5E18 F;  4GXO A;  1R00 A;  4NHJ A;  2EK5 A;  4WCG A;  2Q8K A;  2BGC A;  1UHM A;  5KVR A;  3FF5 A;  2B0L A;  3JAM K;  4LB6 B;  4EV0 A;  2MA3 A;  3SHF A;  3HYI A;  2FMY A;  5LBQ A;  2NNY A;  5A2Q Z;  4BXU A;  4HF0 A;  4GO1 A;  4AVP A;  2HQN A;  2IVM A;  3DFG A;  2W57 A;  1J5Y A;  2LF8 A;  5ERI A;  1TNS A;  1STZ A;  1ON1 A;  4O5V A;  4BYY A;  2F5D A;  3TQN A;  4H0E A;  2D1H A;  3JTH A;  1FC3 A;  1XDU A;  3LST A;  3L00 A;  3ZMZ A;  2P5L C;  3HSE A;  5HS9 A;  1LDJ A;  1WSU A;  4N9I A;  3F8B A;  4ENM A;  3SQN A;  1P4X A;  1HXD A;  2XUB A;  2XAQ A;  3KP5 A;  5JHU A;  2AXL A;  4IRI A;  3Q9V A;  2ISY A;  2XIG A;  1DPU A;  5FB2 A;  3EET A;  4DNC A;  4F7Z A;  4ASN A;  4ETS A;  5CLS A;  5DYM A;  3I0T A;  2D2W A;  4M72 A;  1FSE A;  2FEZ A;  3J80 Z;  2GA1 A;  5F1R A;  4Q5S F;  1SD5 A;  3GFL A;  1CF7 B;  5FO5 A;  4AIH A;  1U5T A;  4IHT A;  4I01 A;  4I7H A;  3D5L A;  4OIR F;  4OIP F;  5ILU A;  2GQQ A;  2Z99 A;  3G73 A;  5L3B A;  3MWM A;  2HZT A;  2JZY A;  3E3V A;  3FHZ A;  3QU6 A;  1U8R A;  2IJL A;  1TQP A;  2O8X A;  2YR2 A;  2EB7 A;  4G9Y A;  3DEU A;  1BC8 C;  2QBY A;  2DI3 A;  2K27 A;  4LGW A;  3JTG A;  5J6X A;  3TDZ C;  1FLI A;  1ZRF A;  3NQO A;  1JE8 A;  3K1M A;  2E1C A;  5TJJ A;  3W6J B;  1XGM A;  3Q9S A;  4L9N A;  4U88 A;  2ZCW A;  1I1S A;  4I02 A;  2NRA C;  3GEZ A;  2P6S A;  4FT8 A;  3HRM A;  4FHT A;  5BOX A;  1ZLJ A;  2DBB A;  4LK1 F;  2HYG D;  1BM9 A;  2MBF A;  2DQL A;  4I0A A;  5JVT A;  4ESJ A;  4IVN A;  1HKS A;  3WGG A;  4A5N A;  1MJA A;  2XRN A;  4JK1 X;  2JRT A;  2P8T A;  4EJO A;  4PZJ A;  2COM A;  2H09 A;  3FM5 A;  1FT9 A;  1EV7 A;  4U0V A;  4UV9 A;  4R8H A;  3IRQ A;  4YFX F;  1T98 A;  5HOO A;  1U2W A;  1OYW A;  3MEX A;  3BWG A;  1I6X A;  5IT3 A;  1YW7 A;  2DPU A;  3ECO A;  1Z6T A;  4YFN F;  5D6E A;  5E1W A;  4CZZ A;  2Q2E A;  1MDM A;  1SMT A;  5LGT A;  4I0B A;  2GWR A;  4L9J A;  2DK8 A;  2VOP A;  5E17 F;  4UVA A;  3LA7 A;  5FLX Z;  3V8J A;  3CTA A;  3HOT A;  1C0W A;  3T0Y A;  2GXB A;  3V8L A;  3WOD F;  3MFK A;  4NQW A;  4IJA A;  3IC7 A;  4PCQ A;  4WK8 F;  2XKO A;  2F5C A;  2A3S A;  2CO5 A;  4ESB A;  4HV5 A;  1KYZ A;  1P92 A;  1MJ9 A;  1DP7 P;  1MJB A;  4I98 B;  4E70 A;  2M87 A;  4HDU A;  3C7J A;  4LFU A;  4R1H A;  3ROU A;  2QQ9 A;  3I54 A;  1TQM A;  4BAY A;  1ZYR F;  3KEO A;  3I5U A;  1FPQ A;  1H0M A;  1CGP A;  3FXQ A;  3CJN A;  5ILV A;  4Q4Z F;  4M9S A;  1QO0 D;  2STW A;  2VOO A;  3ECH A;  2OZ6 A;  5L3F A;  3HRS A;  5HDN A;  2GIV A;  2EA2 A;  2IPQ X;  1VTN C;  2J5O A;  1B9N A;  1QGP A;  4Q48 A;  1LEA A;  2V1U A;  2FML A;  3FMR A;  4WXH A;  2PFB A;  2RN7 A;  3GO5 A;  4PDK A;  3P9I A;  1FBQ A;  5E8I A;  3GUD A;  1ZRC A;  1E2X A;  2DFI A;  1J2X A;  5H6R A;  4OIN F;  3GFJ A;  5LHH A;  4KA4 A;  5HDG A;  3RYR A;  2OD5 A;  1K78 B;  1U3E M;  4OMZ A;  2XAG A;  3KP7 A;  2HOE A;  3HSR A;  1Z7U A;  2V6C A;  1IXC A;  3TO9 A;  1FBS A;  1HKT A;  4KN7 X;  4BHP A;  5L3G A;  3ELK A;  3BOQ A;  3SZT A;  5CVI A;  4EQQ A;  2YSR A;  1FBU A;  4BHC A;  4HF1 A;  2KIF A;  1ZH5 A;  3H3Z A;  2XHK A;  3MZY A;  5L3E A;  1RIO H;  2JPB A;  3ZMD A;  1MGT A;  2O6G E;  4HLX A;  5DCM A;  4XBF A;  4OU0 A;  3WTX C;  2NNN A;  2JT1 A;  4RS8 A;  3IWZ A;  1V3F A;  4S05 A;  4WXC A;  2UXX A;  1BI0 A;  1Z6R A;  1O3S A;  3EQL F;  3DXJ F;  5K5O A;  4NB5 A;  1USS A;  1QQI A;  3I71 A;  1G4D A;  4L18 B;  4UXN A;  5DDG A;  3JSO A;  2EFP A;  2ZME B;  1R23 A;  4LG0 A;  4WF2 A;  1R58 A;  4CDG A;  2RQP A;  1BBY A;  1YQA A;  3FWE A;  2VE8 A;  1G3W A;  1U6G A;  4EJV A;  3HOS A;  5EEG A;  5LHG A;  2OZU A;  1P6R A;  2VBZ A;  5LEJ A;  2XGX A;  1UCR A;  2ETH A;  3R6S A;  5CVU A;  3KP2 A;  2HEO A;  2IRF G;  3QRF F;  4EM0 B;  2HS5 A;  4RGX A;  1YFH A;  4AIJ A;  4A12 A;  4YG2 F;  5JR3 A;  1J9I A;  2ESH A;  2RC4 A;  1BI1 A;  1B4A A;  1MDM B;  1HW5 A;  1OKR A;  4ENN A;  3GWZ A;  2K86 A;  5D6F A;  5ED4 A;  4Q47 A;  2V1D A;  1DUX C;  4JBA A;  1F5T A;  2XRO A;  1FP2 A;  1CF7 A;  2ZME A;  2D1V A;  2MLK A;  1G3T A;  3E6C C;  1LDD A;  3FZV A;  4KYW A;  2M30 A;  3GZ6 A;  5BQT A;  1O3Q A;  4BH9 A;  1FX7 A;  2BE5 F;  3ZMU A;  1YIO A;  4RGU A;  2DPD A;  4LMY A;  2EV0 A;  4M6Y A;  4M9X A;  5D5X B;  3GFI A;  3Q5F A;  3K9T A;  4RAZ A;  3F6O A;  2OQG A;  3DQV C;  4EGZ A;  4P9U A;  4BHB A;  4OOI A;  5LGN A;  3TDU C;  2Z9O A;  3MAJ A;  1J7K A;  3GLX A;  2X4H A;  1J75 A;  4KDP A;  1QNT A;  4RGS A;  3E5U A;  3HIF A;  1OMI A;  3GYH X;  4U7D A;  2CW0 F;  2C6Y A;  3ULQ B;  3KE2 A;  1IRF A;  1I27 A;  5D5W B;  1OPC A;  2UXN A;  3TGN A;  1HW2 A;  3RKW A;  4GGG A;  2JPC A;  3U9G A;  4L0Y B;  3VOE A;  2PJP A;  4HQE A;  4IRG A;  1IN7 A;  2DO7 A;  2V1X A;  4D0P A;  2HFH A;  1K78 A;  2H94 A;  4MEX F;  1REP C;  4OIQ F;  5D5V B;  4G7Z F;  1B6A A;  2IA2 A;  2ZXJ A;  3M7G A;  5K5R A;  2A07 F;  1XGS A;  5K1Y A;  1R1V A;  1I5Z A;  1FSH A;  4P55 A;  2ZFW A;  2R7F A;  2BBY A;  4HA8 A;  4AIK A;  4G7H F;  1JXS A;  2VON A;  1EH6 A;  3U2R A;  2CWE A;  5HLG A;  2FBK A;  4GCV A;  4PGG A;  4G7O F;  2BV6 A;  2PMH A;  4HAM A;  4IHS A;  2O03 A;  3DKW A;  3GZ5 A;  5H6Q A;  1V4R A;  3CUO A;  2ZO4 A;  1GXQ A;  5CVR A;  3F8N A;  4MQ9 F;  4HLY A;  2E1N A;  1XSD A;  3IL2 A;  4LG0 B;  4YII A;  2VOD A;  3LA3 A;  3R61 A;  4LLG F;  3L9F A;  2KKO A;  2RV8 A;  3MCZ A;  1SD4 A;  1K79 A;  1HKQ A;  2UZK A;  4HW0 A;  1XMK A;  2QUF A;  1YO5 C;  1B9M A;  3WE3 A;  3EDP A;  3WTS C;  2W85 A;  4Y13 A;  1XCB A;  2NYX A;  4L9V A;  5HS7 A;  5E20 A;  1IF1 A;  4A0Z A;  3HTS B;  1OYY A;  5FD6 A;  3TKY A;  2P5V A;  4XRF A;  1XCV A;  1ZG5 A;  3NRV A;  3ZQ7 A;  2VE9 A;  2BEO A;  1R7J A;  4QWQ A;  3E6M A;  4O6J A;  2Y48 A;  5DCF A;  2QWW A;  1G6N A;  2L4M A;  5F6F A;  1SFU A;  3DV8 A;  4O3M A;  1Z91 A;  2DW4 A;  5J8C A;  1UST A;  4L9T A;  1WQ2 A;  2YU3 A;  2DT5 A;  2E7W A;  4XSZ F;  4MEY F;  1DPR A;  1R1T A;  1PP7 U;  1T38 A;  1QZY A;  3ML6 A;  5DV5 A;  1WWX A;  1FY7 A;  3GW2 A;  3VB2 A;  4TV7 A;  2HGC A;  4OMY A;  1RUO A;  1U78 A;  4N0B A;  3WTY C;  2HKO A;  3KLO A;  1HW1 A;  4ZYH A;  1XMA A;  1XB4 A;  1G3S A;  4HZF A;  5ICF A;  3M8F A;  2FA5 A;  2FRH A;  2OU2 A;  1W4M A;  3WGI A;  5HVQ C;  1EH7 A;  3ABU A;  3CLO A;  4BNC A;  3RDI A;  4ZZL A;  2XAS A;  3G3Z A;  4IF4 A;  2EFQ A;  2RGV A;  1ON2 A;  2HYF A;  1S3J A;  1Y0U A;  3JSP A;  3WTU C;  4I09 A;  2QQB A;  1IW7 F;  1MKM A;  2VT3 A;  4IPA A;  1ONV A;  2A6E F;  1XN7 A;  2OBP A;  2M45 A;  1AWC A;  3O2P E;  2HKX A;  3NEU A;  2VT2 A;  2JSC A;  1XGN A;  3JW4 A;  1BIB A;  3HHH A;  2XAH A;  4ZYD A;  2KJC A;  4GYG A;  5CVV A;  3I64 A;  2A5Y B;  3QP5 A;  2J5P A;  2FBI A;  4HYE A;  1SMY F;  4UVB A;  4MNU A;  2XAJ A;  5LRR A;  4XSX F;  2Z3Y A;  2ISZ A;  1ZHF A;  3BY6 A;  1XSX A;  3SXY A;  5L3C A;  3QAH A;  1PP8 F;  1R1U A;  4AD9 A;  1XSV A;  3RJP A;  3T8T A;  1HBX G;  4MTE A;  2W84 A;  3MQ0 A;  4UVC A;  3HHG A;  1IXR C;  3FXR A;  4K2E A;  3I59 B;  2MD5 A;  2VBX A;  4EM1 A;  2OAZ A;  4M9Z A;  1BC7 C;  4M71 A;  1TTY A;  4CGZ A;  4KIB A;  2LF7 A;  3RYP A;  3RKY A;  4YIF A;  2M1B A;  3J80 K;  1FYK A;  3LWF A;  3JAM Z;  4RB1 A;  3J81 Z;  2L54 A;  4KIG A;  5BS6 A;  3BJA A;  3GVA A;  1YLF A;  5LGU A;  1IN6 A;  3E5X A;  1FYM A;  2LDU A;  1GHC A;  4G6Q A;  5AON A;  4ON0 A;  1ZLK A;  2GAU A;  1SFX A;  4ENK A;  4LLN A;  1NHA A;  3LA2 A;  3KP6 A;  2IW5 A;  1ZRE A;  6PAX A;  1IRG A;  1GVJ A;  5TRD A;  3V8K A;  2FNP A;  2PQ8 A;  4G8X A;  3FX3 A;  2G7H A;  3F23 A;  1DDN A;  4LLL A;  2VN2 A;  4B09 A;  5CYV A;  4S04 A;  2F5E A;  2FXA A;  4OIO F;  4CYD A;  1D3Y A;  1KQ0 A;  3KCC A;  3ZMS A;  3SZP A;  4ZYG A;  1UFM A;  4N9H A;  3WU1 B;  2PI0 A;  3GF2 A;  2EV6 A;  2P4W A;  4RB0 A;  1S8N A;  2A6H F;  1WKM A;  4LD5 A;  2H27 A;  2ZKZ A;  3T8R A;  2D45 A;  3EUH A;  1FYL A;  1Z05 A;  5HLI A;  3F72 A;  2FSW A;  2VBY A;  3EYI A;  1IN4 A;  2H6B A;  2ADU A;  4U0Y A;  4DQ2 A;  4P9F A;  1ZRD A;  1D8J A;  3LAJ A;  3B02 A;  3HTU A;  5E1Z B;  2R7D A;  4M74 A;  1LDK B;  2Y0M A;  2VXZ A;  2HTS A;  4HDV A;  4FX4 A;  2V79 A;  5ICE A;  2KIU A;  3GXO A;  3V4G A;  2EWN A;  3H3U A;  4EJT A;  4EJU A;  2KJB A;  2OQR A;  3KEQ A;  5FD5 A;  2FU4 A;  2YX4 A;  1D8K A;  4MQV A;  2JTV A;  3R60 A;  2QZ8 A;  3F8F A;  3F8C A;  3DPT A;  1YW8 A;  2VC1 A;  1E17 A;  3RI4 A;  1PDN C;  2P5K A;  2CG4 A;  2XVC A;  1KU9 A;  1F4K A;  3M9A A;  3HUG A;  2MC3 A;  3KZZ A;  3K1P A;  1TQI A;  2WWY A;  1ZG1 A;  1TBX A;  3KFW X;  3DPL C;  3I53 A;  3B73 A;  3E6B A;  4R79 A;  3N97 A;  4RB3 C;  5BMZ A;  3FM3 A;  2MLG A;  1BOA A;  2O3F A;  5ILS A;  3QPT A;  3R0A A;  3BZ6 A;  4A0X A;  5A2Q K;  1T6S A;  4Z2Y A;  4LJZ F;  1BI2 A;  2NS0 A;  3TOB A;  3QPH A;  3QOP A;  5E1X A;  3WTT C;  4ZYE A;  2YX7 A;  4EGY A;  4P5O A;  3I59 A;  4CHU A;  1UB9 A;  3CUQ A;  4KMF A;  3WTZ A;  3ZMV A;  4CO8 A;  2XAF A;  4HX8 A;  1R5H A;  3ISP A;  3I4P A;  4A0Y A;  2ZBK A;  3CO6 C;  3H92 A;  5E8G A;  4JQF A;  4Y17 A;  4KIF A;  2AS5 F;  4CXF A;  3TO6 A;  1LVA A;  1KYW A;  1YW9 A;  4MGR A;  4YFK F;  3O3K A;  1EH8 A;  5D4R A;  1ZGJ A;  5KK1 A;  1JHF A;  3EYY A;  4WXD A;  5D4S A;  1W5S A;  2CYY A;  2HR3 A;  2IA1 A;  1U5T B;  4G94 A;  5IT9 K;  2EFO A;  2VC0 A;  2LNB A;  2HQR A;  3LQQ A;  3O6B B;  3J81 K;  2A61 A;  1FNN A;  2PMU A;  1LB2 A;  4B8X A;  2OA4 A;  3VOD A;  1JHH A;  2FOK A;  2CGP A;  4KMU X;  1YS7 A;  2FE3 A;  4HF2 A;  1RI7 A;  1LEB A;  3BPX A;  5CJ9 A;  1J0R A;  5J8F A;  3BJO A;  4XLN F;  3FMQ A;  2Z5U A;  1W5T A;  3P9K A;  2QBY B;  1L3L A;  3KP4 A;  4WWC A;  5JFR A;  1B59 A;  3HSF A;  1BJA A;  1D5V A;  5BPD A;  1KU7 A;  1YTY A;  2P6T A;  4KN4 X;  3RIR A;  2TDX A;  2W25 A;  2G7U A;  1FP1 D;  3U1D A;  1XGO A;  1Q1H A;  3KET A;  5AIP A;  1YYV A;  1ZAR A;  3BDD A;  5LRS A;  2RKH A;  4MTD A;  1QPM A;  1SFE A;  5K5Q A;  2H6C A;  1H9G A;  4AWX B;  5DUK A;  2IT0 A;  1JGS A;  1RUN A;  3ZMT A;  3QU3 A;  1BN5 A;  4PGH A;  1SD7 A;  2QLZ A;  3L09 A;  4UV8 A;  1QZZ A;  3V7R A;  3GX4 X;  1P4A A;  1LNW A;  3W6K B;  1O7L A;  1LJ9 A;  2DAO A;  1IN5 A;  2M5W A;  1R5G A;  2VBW A;  3ZPL A;  2DK5 A;  4L0Z B;  1TW2 A;  3PQK A;  4KT5 C;  5LHI A;  5BPI A;  3REO A;  5LLQ A;  1WI9 A;  1ZG3 A;  5L3D A;  4ESF A;  3ZN0 A;  1L0O C;  2LKP A;  3T1B A;  3HRT A;  1TNT A;  4EMS A;  1FZP B;  1KU3 A;  2L4A A;  1P2F A;  2EA4 A;  1G3Y A;  4HX4 A;  3WG9 A;  1O57 A;  2PN6 A;  1S7O A;  2XV4 S;  3FXU A;  2EFN A;  5JI6 A;  1IAW A;  3RKX A;  4KIC A;  5D8K B;  3BP8 A;  2M8E A;  2PG4 A;  1YS6 A;  3ABT A;  4MHG A;  1OR7 A;  2O61 A;  2L01 A;  2K4B A;  1YG2 A;  3K1N A;  3F22 A;  2CSO A;  1HQC A;  1W7P B;  3GFM A;  4P96 A;  1OYI A;  1KQ9 A;  2BYV E;  4CIC A;  2FQ3 A;  4QLC U;  1IZ1 A;  2R3S A;  3PFI A;  3DP7 A;  1KA8 A;  4RGR A;  3P9C A;  2FBH A;  1W7P D;  1Z9C A;  1S6L A;  2K02 A;  4L5J A;  2G9W A;  5CVJ A;  1XD7 A;  3IHU A;  3RPU A;  2WC2 A;  4A5M A;  2LSO A;  1FWZ A;  2STT A;  4M6X A;  5FGM A;  4U0W A;  3IKV A;  3F3X A;  1LQ1 A;  2GXG A;  3BJ6 A;  1AOY A;  3TOA A;  3C18 A;  1T2K A;  1IUY A;  2L02 A;  3QP6 A;  5DCM B;  2ESN A;  3D0S A;  3LAP A;  2ACJ A;  2Z33 A;  3L2C A;  5ICC A;  3V7S A;  5EEH A;  1IXS B;  3P7N A;  3DF8 A;  4FX0 A;  2QM3 A;  4EM2 A;  4L5I A;  3LQR A;  4RAY A;  4ZH4 F;  3V7C A;  2HTJ A;  2PBI A;  2E7X A;  5FLX K;  2QYO A;  2F5F A;  2EV5 A;  1J59 A;  2ELH A;  3PQJ A;  3RPQ A;  3MZH A;  2P7C B;  4G6D A;  1QBJ A;  3L7W A;  1F9N A;  2F2E A;  2O0Y A;  1ODD A;  4Y15 A;  2DLL A;  4A6E A;  2GZW A;  4HBL A;  3KP3 A;  2P7V B;  3CDH A;  3AAF A;  5DEQ A;  1SD6 A;  1BI3 A;  3IRR A;  1RZ4 A;  3WTV C;  2ZNZ A;  1S7A A;  3I58 A;  4KFC A;  4HV6 A;  1FOK A;  2QVO A;  1H9T A;  4HX7 A;  5LEK A;  3WGH A;  5FFZ A;  1HST A;  3BRO A;  2KRF A;  3CUQ B;  3M8E A;  5H20 A;  2EJR A;  3R4K A;  3T5X A;  1GXP A;  3WTW C;  1MZB A;  3IWF A;  4A2U A;  1ZAO A;  3CUQ C;  1RNL A;  3BPV A;  4UNO A;  1O7F A;  1F1Z A;  2HWV A;  4IXA A;  3S2W A;  2X0L A;  2QEN A;  4HQM A;  2RNJ A;  4LK0 F;  1T0F A;  2YPR A;  2KIM A;  3ERE D;  3K2Z A;  3E97 A;  2QQA A;  1T39 A;  1TLH B;  4BQA A;  4GYI A;  3TO7 A;  2RDP A;  4WX9 A;  2XKP A;  3RTR A;  2A68 F;  3KLN A;  2RVC A;  5DUI A;  3WU0 A;  1KGS A;  4EVI A;  2Y75 A;  2IP2 A;  2ZNY A;  1P4W A;  4IRH A;  4U7B A;  1O3R A;  2A69 F;  2IA0 A;  1BIA A;  2WV0 A;  3FMS A;  5HDK A;  1X3U A;  3J7A O;  1A04 A;  2K7L A;  1Z1D A;  2MH2 A;  3E6D A;  3C3W A;  4ZZD A;  2NAZ A;  5F64 A;  2DQR A;  3E5Q A;  2PEX A;  2UWM A;  5HLH A;  3K0L A;  5D5U B;  2DTR A;  1HSJ A;  1ZN2 A;  4A6D A;  2FNA A;  3ZN1 A;  2K4J A;  5FFX A;  2GA2 A;  3CO7 C;  3OV8 A;  3C1D A;  2V9V A;  5HS8 A;  5AIQ A;  3F6V A;  4ENJ A;  2HDC A;  4EJW A;  5IT9 Z;  1R36 A;  3LFK A;  2PLY A;  1K7A A;  1MD0 A;  1XDS A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...