4IRIA

Auto-inhibited erg ets domain-dna complex
Total Genus 32
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
32
sequence length
94
structure length
94
Chain Sequence
GQIQLWQFLLELLSDSSNSSCITWEGTNGEFKMTDPDEVARRWGERKSKPNMNYDKLSRALRYYYDKNIMTKVHGKRYAYKFDFHGIAQALQPH
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords Transcriptional regulator ERG
publication title Structural and dynamic studies of the transcription factor ERG reveal DNA binding is allosterically autoinhibited.
pubmed doi rcsb
source organism Homo sapiens
molecule tags Dna binding protein/dna
total genus 32
structure length 94
sequence length 94
ec nomenclature
pdb deposition date 2013-01-14

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00178 Ets Ets-domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 4iriA00
2L02A 4G9YA 1T6SA 1AOYA 1R1TA 1QBJA 1D3YA 3ECHA 3FMRA 1B4AA 3I59B 4YIIA 4M6XA 5ICFA 1XCBA 4OINF 1J59A 4YG2F 2D1VA 3MWMA 3Q9SA 3ZP5A 5LGTA 1FYKA 4ZYEA 2P5VA 1B59A 2EJRA 3N4MA 2PI0A 1FPQA 4WX9A 2ZFWA 2O3FA 2VOOA 2BGCA 5ICEA 1WI9A 3WTZA 4WF2A 1YS6A 4CO8A 1ZYRF 4LB6B 5TRDA 3ABUA 1KGSA 1FWZA 3T0YA 3F72A 5FD5A 2L3DA 2GXBA 1OYYA 1ODDA 3LWFA 1WRJA 1DDNA 4UVBA 2OU2A 1TQIA 1TNSA 1S6LA 1RNLA 1V4RA 1QGPA 2UXNA 2V9VA 5HOOA 3LA7A 5CJ9A 4KMUX 4JK1X 1R00A 2XAGA 1IW7F 4EJWA 1Z6RA 2EFOA 4MTDA 1K7AA 3BP8A 4K2EA 3F8CA 2QUFA 3H92A 1E2XA 4G7OF 1XB4A 5ILVA 2W57A 2YR2A 3M7GA 1ZRCA 2VBZA 4L9TA 1R1UA 2K86A 4ENKA 3HTUA 2O6GE 1BIAA 2W85A 2O61A 1JHFA 1Z05A 2O0YA 2OQRA 2PJPA 3I0TA 3QAHA 1HQCA 2H09A 3TO9A 4R79A 3MQ0A 2QVOA 1IN5A 1HSTA 3RKXA 3V8JA 5D5WB 2EB7A 3O3KA 1ON2A 2CG4A 1I27A 5L3CA 2EV6A 3BJAA 3ULQB 1W5TA 3KEOA 2FA5A 4M72A 1PP7U 2Q8KA 1LVAA 3KE2A 3QPHA 3JTHA 2COMA 3K69A 1KQ8A 2HQRA 4BXUA 1XCVA 4LK0F 1F4KA 2FOKA 2GXGA 1W5SA 1FLIA 4GYGA 2P6SA 3EDPA 1BBYA 3WGIA 1YW7A 1K79A 1LNWA 3ML6A 5E1ZB 4WCGA 1MZBA 3L7WA 1HW2A 4U7DA 2FEZA 4KIGA 2FBHA 1P4AA 3BY6A 3WG9A 4EJTA 3DXJF 3DV8A 1P2FA 1FZPB 2GA1A 3MZHA 1IRFA 3I71A 1MJBA 2GZWA 2XGXA 2D2WA 3TO7A 4XLPF 3LQRA 2HGCA 4XSZF 4EM2A 5D4SA 4IRGA 4MGRA 4BAYA 3E6DA 3K0LA 2RN7A 2ZNZA 2V6CA 1B1BA 3V7RA 1FYLA 3F8MA 5DDGA 1TQMA 5DCFA 2H6BA 2CO5A 4HQEA 4M73A 1F9NA 1KA8A 5FB2A 5DV5A 2DQRA 3V7CA 2HQNA 2HYFA 3BDDA 2FSWA 1CGPA 5LBQA 4A0ZA 5H20A 2QM3A 1XSVA 3HOTA 2NS0A 4UV9A 1Z9CA 2WWYA 2K02A 2A68F 4I02A 4UV8A 2PQ8A 5D8LB 1LEBA 1QZZA 5D5VB 1X3UA 4NHJA 4L9VA 2HTJA 5LGNA 5FD6A 5F64A 2H27A 5HLIA 1ZG5A 4P9UA 2NNYA 3RYRA 3DQVC 1FOKA 5LEKA 5JR3A 3GO5A 1H0MA 1YIOA 2DAOA 2BBYA 1YW9A 3LA2A 3OV8A 4G8XA 4EQQA 5A2QK 3GF2A 3IKVA 3GVAA 3GLXA 4DNCA 3HIFA 3CO6C 4HX7A 4RGUA 2K7LA 3SZPA 1Y0UA 4G7ZF 5LRSA 1AWCA 3KZYA 1F5TA 1FY7A 1T39A 3D0SA 4Y17A 2P7CB 3NRVA 4I2OA 1JGSA 2CGPA 2F5FA 4ENNA 2UZKA 4HDUA 2FU4A 2KIFA 2NAZA 1ZRFA 3P7NA 1HXDA 3SFZA 5E8IA 1J0RA 2F5CA 2PEXA 1HSJA 3IL2A 3QU3A 1FYMA 1S3JA 1T98A 4I01A 3RIRA 2HZTA 5IT9Z 1YFHA 3K1MA 2EK5A 5K5QA 3M1EA 2M30A 3JTGA 2RKHA 4P96A 3I58A 3BWGA 1T0FA 4LJZF 5FO5A 2ESNA 2W84A 2PMUA 1OYWA 2WC2A 4HX8A 4WXHA 1KU7A 2BYVE 1SFUA 1WWXA 3WODF 2RV8A 2M8EA 3RKYA 5BPDA 2R7FA 3I64A 2G7HA 3JAMZ 4DQ2A 1JHHA 2CSOA 5DUKA 2AXLA 5HDGA 3ZN0A 2DU9A 4U0YA 4KT5C 2VBWA 4RB1A 3WE2A 2E7WA 4OIOF 1WKMA 2XAHA 5J6XA 2LNBA 3KP7A 3EUHA 2PBIA 2QQAA 4BNCA 1SD6A 3W6JB 5ED4A 1DPRA 5CVVA 1XMKA 3BROA 3J81K 3AAFA 3IRRA 3J80Z 2CQKA 3KP3A 4HA8A 4HDVA 5JVTA 3D5LA 3SZTA 4UVAA 2XKPA 4LD5A 3HRTA 1LQ1A 5L3FA 4RS8A 2R7DA 3V8KA 1C0WA 3WGHA 1QQIA 1U3EM 4I98B 2GAUA 1STZA 2EV5A 4EV0A 1HKQA 3Q5FA 4XBFA 4WWCA 4M74A 3LAJA 2STWA 2CYYA 1ZHFA 2K27A 4S05A 4LGWA 4PCQA 1IRGA 4MNUA 4UVCA 4OU0A 1R36A 2FNAA 1TBXA 4PDKA 3HRUA 2A6EF 1W7PD 4U88A 2A6HF 2FMLA 2RC4A 4MEXF 4HX4A 5D8KB 5E17F 3L2CA 4HBLA 1XGOA 1Z6TA 5E1XA 4L5IA 2H6CA 4LB5A 1TW3A 1LJ9A 3K1NA 4MQVA 4A6EA 3K1PA 3RKWA 5HS8A 1IF1A 1S7AA 3BJOA 3MCZA 2UXXA 2TDXA 3F23A 3TDZC 2DLLA 2UWMA 1XMAA 1O3TA 1FNNA 3DPLC 2BV6A 5K1YA 2FNPA 1EV7A 2ZNYA 4XRFA 3QP6A 1R22A 5HS9A 4OIQF 1SFEA 5E1WA 2G7UA 4OMZA 1U8RA 4AIJA 1S29A 4ESFA 4N0BA 5K5RA 2EA4A 4E70A 1LB2A 2RVCA 1CF7A 3WE3A 5HLGA 3H3UA 1I1SA 4BHBA 3FF5A 1ZG3A 5IT3A 1RIOH 2XAQA 3LA3A 3P9CA 3LQQA 5DEQA 1R23A 3I53A 1ZRDA 2NNNA 4YIFA 1VTNC 1QNTA 4U7BA 3DP7A 3M8EA 3P9KA 5EEHA 4ZYDA 4KA4A 1IXSB 2YPRA 4Q5SF 4GGGA 1O7FA 4HF2A 2FRHA 2EFWA 1I1GA 4IPAA 2IVMA 2YX4A 2K4BA 1PUEE 5L3GA 2LKPA 3IWFA 4CICA 2JPCA 3J7AO 2IRFG 3KP5A 4KN7X 4KMFA 4IXAA 4U0VA 1ZARA 3M9AA 2OZUA 1MDMA 1ON1A 2JRTA 2V79A 4Q47A 1MD0A 3HRSA 4IHSA 4KICA 5DUIA 1PP8F 3V7SA 4RB3C 1QO0D 2MLKA 4O5VA 4EM0B 2V1UA 3L00A 2MA3A 4PZJA 5FLXZ 4N9HA 2M45A 2ZBKA 2LF7A 4WK8F 2BEOA 3ISPA 4KDPA 2K4JA 1R1VA 3JSOA 3C18A 4H0EA 3KZZA 2DPUA 1SMYF 5LEJA 2G9WA 2LSOA 4ENJA 4LLNA 2DK5A 4O3MA 3HTSB 5LHGA 1HBXG 1XGNA 3I59A 4RGRA 1OMIA 3GWZA 3FZVA 4LFUA 3ERED 1U78A 4L18B 2DTRA 4L0ZB 3JSPA 3ZMDA 3H3ZA 2MBFA 2KIUA 2NYXA 3MZYA 3WTXC 3L9FA 3BJ6A 4KIFA 2IA0A 1RUNA 2A07F 1SD7A 2NRAC 3FMSA 3KP4A 2VC1A 3PQJA 4YFKF 2FQ3A 4HW0A 1XSDA 2C6YA 1KU2A 1UCRA 1IN8A 5L3BA 2PMHA 1TNTA 1KU3A 1TQPA 3BPVA 5CVUA 3IKTA 3ABTA 5LLQA 1I6XA 2Z5UA 4IVNA 1ZAOA 1LEAA 1J9IA 3LAPA 2IP2A 2W25A 3B02A 3R60A 4IRIA 4EM1A 2XROA 2XHKA 2HDCA 1Q1HA 1K78B 4GYIA 2A5YB 3E6BA 5HDKA 2VE9A 2XASA 4I0AA 4EVIA 5DCMA 4BQAA 4M6YA 2DFIA 4EMSA 3ELKA 1IAWA 2QBYB 3R6SA 3CJNA 4JQFA 3EYYA 4KUMA 3S2WA 4RB0A 1ZLKA 2XUBA 4D0PA 4A0YA 5L3EA 4HLXA 1P4WA 2ZJ2A 1BN5A 2EA2A 1U2WA 4ZYGA 1FSEA 3SHFA 1R5GA 1FBUA 1FX7A 4HF0A 5DD4A 2WV0A 5ERIA 2P5KA 3U2RA 3K9TA 5H6QA 1E17A 2P6TA 4M71A 2VE8A 4L0YB 1FC3A 2FE3A 3GEZA 1L0OC 1FBSA 1GXQA 2ISZA 1GHCA 1SFXA 2Z9OA 1IUYA 3GX4X 2ADUA 4XLNF 4IF4A 4ESBA 3P9IA 3KP2A 2DQLA 5JFRA 3KCCA 4ZYHA 4NQWA 4KNYA 2DI3A 3JAMK 6PAXA 2ZMEB 4EJVA 2B0LA 5LGUA 5E18F 1QZYA 5L3DA 2DPDA 3F8BA 1RI7A 1B9MA 3T8RA 3GYHX 4MTEA 1J2XA 3OOPA 4G6QA 3KLNA 2XVCA 3QRFF 3GFLA 4MEYF 2ISYA 1XN7A 2IA1A 2VC0A 1T2KA 2JZYA 1WQ2A 2OZ6A 5ILSA 3ZPLA 2O8XA 4AVPA 1S8NA 3TO6A 3E5XA 4FX0A 5D6FA 4ETSA 1OKRA 4PGGA 4ASNA 2GIVA 2P4WA 5BS6A 4M9XA 1JXSA 1XDUA 1OPCA 2XAFA 3JW4A 4OIRF 2GA2A 3QOPA 2J5OA 2XKOA 3VB2A 1ZH5A 3E3VA 4MQ9F 3L09A 1S7OA 1KYZA 4B8XA 3REOA 1P4XA 2VT2A 1KQ0A 2F5DA 2IJLA 3RPQA 1U6GA 1UB9A 2L4AA 1SAXA 4YFXF 4BH9A 1YQAA 3F21A 2EWNA 2VODA 4IHTA 4UUVA 2VN2A 3R61A 3EETA 3B73A 4L9NA 2IPQX 3SQNA 2FMYA 3MFKA 2GWRA 1O3RA 3F3XA 1FT9A 3WU1B 1IZ1A 1I5ZA 4UHTA 5JI6A 2XV4S 2RDPA 4AD9A 1D5VA 2RNJA 3GUDA 4OOIA 4G6DA 2STTA 2AS5F 2ZCWA 2JPBA 2HKOA 4NB5A 3HSFA 5CYVA 1BM9A 2R3SA 5A2QZ 3DF8A 3O2PE 1UFMA 1USSA 2MH9A 3VOEA 3ZMSA 2MLGA 3DPTA 2HKXA 2XRNA 4WXCA 3CUQA 4RAYA 2OA4A 3FXUA 1ONVA 2DW4A 1XSXA 2L54A 4AWXB 3C7JA 1Z91A 1ZN2A 1YG2A 3PFIA 1R58A 3V4GA 3O6BB 1XGSA 3N97A 3TKYA 1ULYA 1IXRC 3CUOA 1RUOA 2F2EA 3HHGA 4WXDA 2H94A 1H9GA 4B09A 2HS5A 4ENMA 2O03A 1YLFA 2A69F 1G4DA 2HYGD 1R5HA 4LG0A 2P8TA 1V3FA 1O7LA 2LDUA 1NHAA 4HQMA 3TDUC 4ON0A 5D6EA 2KRFA 4FHTA 1FBQA 4BHPA 2PN6A 4I7HA 1D8JA 2OD5A 3WU0A 5BOXA 2VBXA 2Y48A 1HW1A 2E1CA 4A2UA 4RAZA 5H6RA 4G94A 3BZ6A 1OYIA 3CUQC 2HFHA 3TQNA 4RGXA 2HR3A 1B9NA 5AONA 1EH7A 3MEXA 3ZQ7A 2A61A 2DT5A 4Q48A 3HOSA 2BE5F 1D8KA 3J81Z 3C1DA 1KQ9A 5EEGA 1SMTA 4A12A 1GVJA 2GQQA 1SD4A 2M1BA 4P9FA 1ZREA 4O6JA 3T1BA 3WTSC 4CZZA 1O3QA 1YS7A 2XIGA 4IJAA 3VEPA 5ICGA 3G73A 4I0BA 3BOQA 1U5TA 2J5PA 1ZGJA 4P5OA 1REPC 5F1RA 4RB2C 1K6OA 1FP2A 4HAMA 3WTUC 1BC7C 3RYPA 2FXAA 2M5WA 3ZN1A 2X4HA 1XGMA 3RDIA 1ZLJA 2PLYA 3CO7C 4M9SA 5KK1A 2HTSA 4G7HF 2A3SA 4CHUA 3LSTA 3SXYA 1A04A 4LLLA 5DCMB 1H9TA 3ZMTA 4HLYA 3R0AA 5ICCA 1W7PA 3GFMA 3IHUA 1KU9A 4FT8A 3EQLF 2ACJA 2KKOA 1WSUA 3CLOA 5BQTA 4UNOA 4BYYA 3HHHA 1TLHB 1MJAA 2V1DA 2OQGA 2RQPA 4KYWA 1MKMA 5ILUA 2F5EA 3CDHA 4LLGF 3GFJA 1ZG1A 1EH8A 4YFNF 3I5UA 4I09A 3FM3A 1R7JA 1HKSA 3HUGA 1U5TC 1MJ9A 3FWEA 3WGGA 4EJOA 2OAZA 3FM5A 3PQKA 3M8FA 3ECOA 3F22A 5LHIA 3BPXA 1HW5A 4EGZA 1G3WA 3TGNA 1G3SA 3K2ZA 2D45A 2D1HA 3TOBA 4ZZDA 4GO1A 2W24A 2X0LA 3WTTC 2FF4A 2CWEA 5E8GA 2LF8A 2RGVA 3F6VA 3RJPA 4ZH4F 3T5XA 3IRQA 3KETA 2DO7A 3GFIA 4GXOA 2VT3A 1DPUA 3WTYC 1DP7P 1F1ZA 1BI3A 2VOPA 3E6MA 4L5JA 4A6DA 5JHUA 1KYWA 3MAJA 3NQOA 1FSHA 4R8HA 5J8CA 2Z3YA 4KIBA 3E5QA 4HYEA 3NEUA 5LRRA 3I4PA 2JT1A 4A5MA 3QPTA 2IT0A 1QPMA 2QENA 3V8LA 1EH6A 5CVJA 5IT9K 4L9JA 1IN6A 3KEQA 1O3SA 2FBKA 1T38A 2KJCA 2V1XA 2ZKZA 1B6AA 5BPIA 1JE8A 1P92A 1IXCA 4HOBA 2QZ8A 2FBIA 2E1NA 4Y15A 4LMYA 3GZ6A 1G3YA 5KVRA 2Y0MA 2Z99A 2EFNA 3DKWA 4A0XA 5D5UB 3T8TA 2P5LC 3E5UA 4MHGA 5AIPA 5FFXA 4HZFA 1ZGAA 1P6RA 3RI4A 2VBYA 3VODA 2ELHA 3FMQA 4UXNA 5HVQC 4EGYA 1BOAA 1FP1D 2MC3A 4JBAA 2Z33A 1YTYA 1Z7UA 4IRHA 3W6KB 1UHWA 2CFXA 3HYIA 5F6FA 3WTVC 3J80K 1K78A 3QU6A 3HSEA 4HF1A 1O57A 3FHZA 1UHMA 4TV7A 4HV6A 1J75A 3CUQB 4AIHA 5CVRA 2OBPA 5HS7A 4CXFA 5DYMA 4AIKA 1OR7A 3VFZA 2QBYA 1IN7A 2ZO4A 3HRMA 4CGZA 1BI0A 1BI2A 2IA2A 4Z2YA 5D4RA 3KFWX 2JSCA 1LDKB 5DD8A 3DFGA 1LDJA 4QWQA 2HWVA 1RZ4A 3EYIA 3CTAA 3QP5A 2QWWA 2VONA 3E6CC 3KP6A 3KLOA 1TTYA 2EV0A 2QQBA 3IWZA 3DEUA 4OIPF 2DBBA 4CYDA 4LG0B 1BI1A 2QYOA 3COAC 4XSXF 2CW0F 1XDSA 3R0JA 5LHHA 1W4MA 5BMZA 4LK1F 1G3TA 2EFQA 2L4MA 1BC8C 4BHCA 3LFKA 2PFBA 3GXOA 2IW5A 3FXRA 3ZMUA 4P55A 2DK8A 1TW2A 2ZMEA 3U1DA 4A5NA 1GXPA 3ZMVA 4KFCA 2JTVA 1BJAA 2MD5A 3WTWC 3G3ZA 1CF7B 2ZXJA 3HSRA 2ETHA 1Z1DA 2MH2A 4R1HA 1USTA 5K5OA 4U0WA 2YX7A 3RPUA 3F8FA 4HV5A 4Y13A 2EFPA 3IC7A 3F8NA 4Q4ZF 1HKTA 4RGSA 2E7XA 1BIBA 4ESJA 3Q9VA 4GCVA 1J5YA 5FFZA 2HEOA 2L01A 5D5XB 1U5TB 3FX3A 1XD7A 2ESHA 3ZMZA 3R4KA 5HDNA 3TOAA 3U9GA 5CLSA 5J8FA 1L3LA 3F6OA 1PDNC 5E20A 1IN4A 3GZ5A 1DUXC 2KIMA 4S04A 1MDMB 1J7KA 3GW2A 3RTRA 1LDDA 4CDGA 2M87A 2XAJA 1SD5A 1YO5C 1MGTA 4EJUA 4F7ZA 1YYVA 2PG4A 2WTEA 1YW8A 2KJBA 4N9IA 2Q0OA 2YSRA 3E97A 4KN4X 2VXZA 5CVIA 4PGHA 4QLCU 1G6NA 2QQ9A 2P7VB 2Y75A 5AIQA 4OMYA 1W7PB 2Q2EA 5FLXK 3I54A 3ROUA 4ZZLA 4M9ZA 2HOEA 5FGMA 2YU3A 5HLHA 3C3WA 4FX4A 5TJJA 2QLZA 3FXQA
chains in the Genus database with same CATH superfamily
2L02A 3CCUI 4XKCA 2W1OA 1A31A 4G9YA 1T6SA 1AOYA 1R1TA 3CF5F 5B5EC 1QBJA 1EF4A 4C2TA 3CCVI 1D3YA 2JN6A 3ECHA 3FMRA 1B4AA 2BHZA 2FUG2 3I59B 4JP0A 2R7VA 2NXNB 2HOAA 2IEKA 4M6XA 4YIIA 5ICFA 1XCBA 4OINF 2JRMA 1J59A 4YG2F 2D1VA 1IDZA 3MWMA 2DDAA 5FLVA 4CCMA 4BBSJ 2JUGA 3Q9SA 2F48A 2JA8J 5JLXA 3ZP5A 2MC4A 5LGTA 4DJAA 3AG3H 5FROA 1FYKA 4ZYEA 2P5VA 3A02A 1ERDA 1B59A 4A3CJ 2EJRA 3OOUA 3PNVA 1YOVB 3N4MA 2PI0A 4KITB 2B7EA 2BY2A 2CRGA 3OR1C 1FPQA 3DBHB 5EGOB 2DA5A 1SC7A 3S1NJ 4WX9A 3WHCA 2R7XA 3JRGA 2ZFWA 1XC5A 2O3FA 2JA2A 4DIQA 2X9DA 2R7RA 2VOOA 2BGCA 1JI8A 3W2VA 2DODA 5ICEA 3TEDA 1D0YA 1WI9A 3WTZA 4WF2A 1YS6A 1M1EB 4CO8A 1ZYRF 3I3LA 4LB6B 4HSRA 5TRDA 1AU7A 3ABUA 1KGSA 4RDUA 5C44J 1FWZA 1QU3A 3T0YA 3F72A 5C4JJ 5FD5A 1ETWA 1OFCX 2L3DA 2GXBA 3CCJI 1OYYA 1K83J 1ODDA 4EATA 1BA5A 3CJTB 1WRJA 3LWFA 1DDNA 3Q0WA 4C3IJ 4UVBA 2OU2A 2L7ZA 2X85A 5KAIC 1TQIA 3Q0UA 2KP6A 2O7OA 1TNSA 3X2QH 5F04A 3DPUA 1S6LA 1RNLA 1V4RA 1X1PA 3OSFA 1QGPA 2UXNA 3FKJA 1ZQ3P 1BW6A 1JGGA 2V9VA 1FJLA 2LK2A 5HOOA 3HOWJ 1WCMJ 3LA7A 3MKYB 4M3DA 2O9LA 5CJ9A 4KMUX 4JK1X 1PUFA 4C2UA 2LY1A 1YI2I 1R00A 3JCUC 2HVQA 2CQ7A 1I3QJ 4PSXA 2XAGA 1IW7F 2Y0SA 2W48A 2VJJA 1VQ5I 1E3HA 4ZYAA 4EJWA 1VZ0A 1Z6RA 3FBNB 3S3NA 2KZGA 2EFOA 4MTDA 1K7AA 3BP8A 1UHSA 2JSPA 4I76A 4K2EA 3F8CA 1X3WB 2QUFA 3H92A 1E2XA 1ACIA 4G7OF 2BW3A 1QVUA 1XB4A 5ILVA 4IQ4A 2W57A 2YR2A 2JWTA 3M7GA 3OL3A 2QCOA 1VQPI 1VQ8I 3CMAI 1ZRCA 2VBZA 2Y9YA 4L9TA 2L9VA 1XS9A 1Y8RB 5F08A 1R1UA 2K86A 4ENKA 1XX5A 3HTUA 2O6GE 1BIAA 1P9QC 2W85A 1TWCJ 2O61A 1NH3A 3PUFA 1JHFA 2E1OA 4B1RA 1ETXA 1Z05A 2O0YA 3PIOF 5EDNA 2VUMJ 2GIZA 1EKEA 2OQRA 2YS9A 2PJPA 1OCRH 3I0TA 3QAHA 2JUCA 3GTKJ 2YUSA 1HQCA 2VJ4A 4XKBA 3OIOA 4B4CA 2V6EA 2H09A 1Z21A 4RA2A 1TWGJ 3TO9A 1ETVA 1W1WE 4R79A 3MQ0A 2QVOA 1AKHB 1IN5A 1HSTA 3RKXA 3V8JA 5D5WB 3HEFA 2EB7A 2R7QA 3O3KA 3O8GA 3CLQA 2ECCA 1ON2A 2CG4A 3DTKA 1I27A 5L3CA 1H88C 1A6QA 2EV6A 3BJAA 3ULQB 1W5TA 1E3PA 2FA5A 3KEOA 4X6AJ 4M72A 1PP7U 2Q8KA 1OCPA 1LVAA 2I5UA 3KE2A 5GTHC 3W3CA 3QPHA 2CJJA 3U21A 2DYSH 3JTHA 4NQWB 2ZC2A 1KONA 2COMA 2CQQA 2LG4A 3K69A 1KQ8A 2E1MB 2HQRA 3AL0B 4FASD 2R7WA 4BXUA 1XCVA 3HB9A 1Y39A 4A3BJ 1R5ID 4LK0F 1F4KA 1W0TA 2FOKA 2M8GX 1VQ9I 2GXGA 2LLKA 4XM3A 1W5SA 1Y6IA 4E7JA 1OCTC 5IPAA 1FLIA 4GYGA 2P6SA 3EDPA 1PVEA 2XRLA 2M0MA 4BACA 4BXXJ 1MSEC 3OYBA 1BBYA 1S5LC 3LMMA 4IHWA 3QQAA 3WGIA 1YW7A 3OL4A 1K79A 1ZGWA 3UNGC 1YJNI 3OYFA 1WJEA 2RQQA 2LBFB 3SFIA 1LNWA 3ML6A 3S16J 5E1ZB 4WCGA 2VPLA 2HXIA 1IJWC 1MZBA 3L7WA 3VYTB 2DXIA 1HW2A 1FOWA 4U7DA 2FEZA 2DMUA 1S7EA 3CF2A 4NDLA 3RQ4A 3G4SI 2E19A 4KIGA 2FBHA 1P4AA 3BY6A 3MZ8A 4RLFA 3WG9A 3BR5A 4EJTA 3S1QJ 4IHXA 3DXJF 3DV8A 1P2FA 4OAZA 1FZPB 3LSGA 2GA1A 2F4IA 2IGKA 4KJZA 3MZHA 1IRFA 3I71A 1MBJA 1TWFJ 3DU5A 5GPAA 4D7NA 1MJBA 2GZWA 2WY8Q 2D2WA 2XGXA 5IYCJ 2BY1A 2KRCA 3TO7A 4XLPF 3LQRA 2HGCA 3JRDA 2F6CA 4XSZF 4EM2A 2IGMA 4IRGA 5D4SA 4A3IJ 4MGRA 4BAYA 3E6DA 3K0LA 1JT6A 1RRJA 2RN7A 2ZNZA 2V6CA 2VIXA 1B1BA 3V7RA 1O4XA 2X51A 1FYLA 3F8MA 5DDGA 1TQMA 5DCFA 1LKXA 2H6BA 1LVKA 2CO5A 2VPRA 4HQEA 4M73A 1WJBA 1F9NA 1KA8A 4DYQA 2LOOA 5FB2A 1XPXA 5DV5A 2DQRA 2JJ7A 3V7CA 4IX7A 2HQNA 2CFOA 2HYFA 3BDDA 3RZDJ 2FSWA 5HODA 1CGPA 5LBQA 4UB6C 4A0ZA 5H20A 3OIQA 2QM3A 4QPQA 2HQ5A 1XSVA 1WH7A 3HOTA 1LFBA 3OMYA 2NS0A 4UV9A 2X6WA 3AKZA 1SVOA 4XN0A 1Z9CA 3PNTA 2WWYA 2K02A 2A68F 4I02A 4UV8A 5K7FA 4M3GA 2NOGA 2PQ8A 2E5NA 5D8LB 3HKZN 1LEBA 1QZZA 2E71A 5D5VB 1X3UA 4A3MJ 3CCRI 4NHJA 4L9VA 2R7ZJ 3BR2A 2HTJA 5LGNA 1BL0A 5FD6A 2DT6A 3WG7H 5C3EJ 1DQUA 5F64A 2H27A 5HLIA 1ZG5A 4P9UA 1JKOC 2NNYA 3IH4A 2CUJA 3RYRA 3DQVC 3OYDA 1FOKA 1JJ8C 5LEKA 5JR3A 3MD2A 3H0GJ 4DYCA 1MW7A 5F0FA 3GO5A 4F55A 2CV1A 3FKIJ 1H0MA 1YIOA 3GTMJ 1Y1VJ 2DAOA 2BBYA 1YW9A 4PSWA 2R93J 2HDDA 3ZQLA 2M34A 3LA2A 3OV8A 4G8XA 4EQQA 4F93B 5A2QK 3GF2A 3W2AA 3LSJA 2Y31A 3IKVA 2E34A 3D5SC 3PO3J 2L2OA 3GVAA 2HVRA 3GLXA 4DNCA 3D5RC 2E2IJ 3CCQI 1VQLI 3HIFA 1F43A 3AG4H 3CO6C 2QSFX 4HX7A 4RGUA 2CW7A 1MH4A 2K7LA 2K5CA 3SZPA 1Y0UA 1A36A 2AQEA 2BVMA 4G7ZF 5LRSA 3TBIA 1AWCA 2WY7Q 3S14J 1OQYA 1U0JA 3KZYA 2OJED 2Y69H 1F5TA 1FY7A 2KIQA 4AUXA 1T39A 2EZLA 3D0SA 5J4VA 4Y17A 1ETYA 2P7CB 3NRVA 4OAYA 3K10A 4I2OA 1JGSA 2CGPA 1W5CC 2F5FA 4ENNA 2EZHA 2QGUA 2UZKA 2FU4A 2KIFA 4HDUA 2NAZA 1ZRFA 3BG9A 3P7NA 1IO2A 4Y33A 1HXDA 3SFZA 5E8IA 1G2HA 1J0RA 2F5CA 4QSHA 1TWAJ 1UZCA 2PEXA 4B48A 5F27A 1ORKA 2WBMA 1HSJA 3IL2A 1K6YA 3QU3A 3ZOBA 3L1PA 1FYMA 5J4YA 1S3JA 1T98A 2R5ZB 4I01A 3RIRA 2CV2A 2HZTA 5IT9Z 2X1EA 1YFHA 3K1MA 5EG0B 3BR1A 3S15J 2EK5A 5K5QA 2KPMA 3M1EA 3HG9A 2M30A 3JTGA 4J00A 2RKHA 4P96A 1R6RA 3I58A 5FKMA 3BWGA 1T0FA 3H3VK 4LJZF 1JUSA 5FO5A 5GTIC 4E7SA 2ESNA 3N05A 2ZB9A 2W84A 2PMUA 1OYWA 4CCOA 1DGWY 2WC2A 4HX8A 1WPKA 4WXHA 1KU7A 2BYVE 1SFUA 2L9SA 1WWXA 3BT9A 3WODF 1B72B 2RV8A 2M8EA 2K3FA 3AFHA 3RKYA 2R7FA 3F9KA 5BPDA 4XN3A 2GM4A 3I64A 2XGEA 1HC8A 2G7HA 3JAMZ 4DQ2A 1JHHA 3KYCB 2CSOA 5DUKA 3I4NJ 1MBHA 2AXLA 2K3PA 5HDGA 3ZN0A 2DU9A 2EINH 4U0YA 4KT5C 3FHNA 2VBWA 3CCLI 3G1OA 2JQ7A 3A0BC 4ZDOA 3IUOA 4RB1A 1WI3A 3WE2A 2E7WA 5DS9A 3IV5A 1OR7C 3HKZA 1IC8A 2Y9ZA 1IDYA 5FKOA 4OIOF 1WKMA 2XAHA 5J6XA 2LNBA 3KP7A 3EUHA 4HNUA 2PBIA 2QQAA 4NC8A 1SD6A 3W6JB 4BNCA 1RETA 5ED4A 1DPRA 5CVVA 3H9GA 4LOCA 3HGYA 3DLLF 2L5QA 1XMKA 4UY8I 3BROA 3J81K 3AAFA 3IRRA 3J80Z 1NTCA 2JMWA 2CQKA 3KP3A 1UG0A 1VQ4I 2LYCA 2LKSA 3BR3A 3CP2A 4HA8A 4XLAA 4HDVA 3ZQQA 5JVTA 3D5LA 3SZTA 4UVAA 3C2HA 2KL4A 2XKPA 4BQNA 3OYGA 3ABKH 4LD5A 3HRTA 2VLAA 1LQ1A 3HOZJ 2AXTC 5L3FA 4RS8A 4BQQA 4XOPA 2R7DA 3V8KA 1WJDA 1GV2A 3FK7A 5IP6A 1C0WA 4XLHA 3WGHA 1X2MA 3PO2J 1QQIA 1U3EM 4I98B 4HG2A 4F52A 2M4GA 2KT0A 2GAUA 1STZA 2EV5A 3DEWA 1TL8A 1WJFA 4EV0A 4BY7J 1HKQA 3Q5FA 1D1BA 3CD6I 4XBFA 4WWCA 2MW8A 1RR8C 2LY9A 2A6TA 2K9MA 4M74A 3LAJA 1GLNA 1FTTA 5B1AH 2STWA 2CYYA 4MFDA 1YX5A 1ZHFA 2K27A 4S05A 4LGWA 4PCQA 1IRGA 1V55H 4ZDPA 4MNUA 4UVCA 4RBOA 3MVPA 1JJ6C 2H1KA 4OU0A 2DMNA 3BTCA 2LRDA 1R36A 2OCCH 2WAFA 1X1AA 2FNAA 4B3XA 1TBXA 4PDKA 3HRUA 3K70C 4J01A 5FJ8J 2A6EF 2DTZA 3RKQA 4YRVA 1W7PD 2EZKA 4U88A 3DKYA 3ZGKA 2A6HF 2FMLA 2RC4A 5CQGA 4MEXF 3LSKA 4HX4A 5D8KB 5GAHJ 1SVMA 2CV0A 2YU9J 3L2CA 4HBLA 5E17F 1UAAA 2ZMEC 1XGOA 1Z6TA 3QYFA 4NNJA 5E1XA 1YJ9I 4L5IA 2JA7J 2H6CA 4LB5A 1E0EA 1TW3A 1W0UA 1LJ9A 3K1NA 4MQVA 4A6EA 3K1PA 3S1RJ 3RKWA 5HS8A 1IF1A 4BJ5C 1S7AA 3BJOA 3MCZA 1TT0A 4JYKA 4LG3A 4C2MJ 3EUHC 2UXXA 2TDXA 4UUSA 5FLMJ 3CDLA 3O8HA 3PL8A 3QYBA 1P7JA 2B9SA 4H4KC 4XK4A 3F23A 2ZJQF 2KQRA 3TDZC 3JRHA 2JA5J 2DMQA 2DLLA 2WAQN 1F36A 1T95A 2UWMA 2BW3B 1XMAA 1O3TA 1FNNA 3DPLC 5IP9J 2BV6A 3GTQJ 5K1YA 2FNPA 5EJCA 1EV7A 2ZNYA 4AYBN 4XRFA 1TWHJ 2VQCA 3QP6A 4C3HJ 1R22A 3H5NA 5HS9A 4OIQF 1SFEA 2VKVA 3HUGB 5E1WA 1R71A 2G7UA 4OMZA 1U8RA 1HDDC 2K9NA 4AIJA 1S29A 4ESFA 4N0BA 5K5RA 2EA4A 4E70A 1B8IA 2W82A 1LB2A 2RVCA 1W36C 1CF7A 3TW7A 3WE3A 5HLGA 3H3UA 4BS9A 2FX0A 4BHBA 1I1SA 5M5XJ 3A01A 1JUPA 3FF5A 1ZG3A 5IT3A 1RIOH 2XAQA 3LA3A 3P9CA 3LQQA 3ZQCA 5DEQA 1R23A 3I53A 1IV6A 1ZRDA 1ETQA 2NNNA 1KZHA 4YIFA 4V19K 2XGDA 3SZGA 1D0ZA 9ANTA 3AG1H 1VTNC 1QNTA 3UR3C 1GUUA 3DP7A 4U7BA 3M8EA 1TC3C 3OS1A 3P9KA 1MH3A 5EEHA 2QSGX 2CQXA 4DBRA 1WJAA 4ZYDA 4B44A 4KA4A 1IXSB 4GFBA 2KZVA 2YPRA 5K7ZA 4E7HA 3OYCA 2L7MP 2Z1DA 4DBQA 1T08B 2W4SA 4F3QA 4E7KA 2LD5A 4Q5SF 4GGGA 1O7FA 4HF2A 2FRHA 2EFWA 1I1GA 4IPAA 2IVMA 4DW6A 4B47A 2YX4A 1X2NA 2K4BA 4BKXA 3M4OJ 1PUEE 4GDFA 5L3GA 3L2QA 5E3MA 2LKPA 1OCZH 3IWFA 2JPCA 4CICA 3CC2I 3J7AO 2IRFG 3KP5A 4KN7X 3EUAA 4KMFA 1I39A 4IXAA 2V9KA 4U0VA 4C9YA 1ZARA 3ABMH 3M07A 3M9AA 4BBRJ 2OZUA 2E36A 4OWRB 1MDMA 2WV1A 2IS2A 5IYBJ 1ON1A 3J7ZI 2JRTA 1ZELA 2V79A 4Q47A 4ZDLA 1MD0A 1UG2A 2R5YA 3HRSA 4CZCA 4YIRX 4IHSA 1GVDA 3K4CA 4KICA 5DUIA 1PP8F 3V7SA 3DTEA 4RB3C 4E7IA 1QO0D 2MLKA 1WGXA 4O5VA 4BU2A 2EH3A 4W1UA 2KISA 4EM0B 2V1UA 3L00A 2MA3A 4BE2A 5TGTA 3H36A 4BEHB 4MLOA 2LMDA 4PZJA 5FLXZ 4N9HA 2M45A 2EIKH 2ZBKA 2IAIA 2LF7A 3PFYA 4WK8F 4A93J 2BEOA 4PJMA 2VKHA 2LTPA 3ISPA 1SEUA 4KDPA 2K4JA 4PJLA 1R1VA 3M8JA 4BJTA 3OS2A 3JSOA 3C18A 4B3AA 4H0EA 2ECBA 3KZZA 2QA4I 2DOEA 2DPUA 1SMYF 3A4CA 5CKTA 5LEJA 2G9WA 2LSOA 4ENJA 1LFUP 3LNQA 1YIJI 4LLNA 2DK5A 3OR2C 1VQ7I 4O3MA 3HTSB 3LSIA 2HDWA 5LHGA 4Y4RA 1HBXG 4RAFA 1XGNA 3I59A 4RGRA 1OMIA 2ZSIB 3FZVA 3GWZA 4LFUA 3ERED 5M3FJ 3ZQFA 1U78A 4L18B 4II2A 4Y3OA 2DTRA 2WAQA 3LSPA 3K6GA 4L0ZB 3JSPA 1D1CA 1FEXA 1JKPC 5J1UA 2VKDA 3E0JB 3ZMDA 2LC2A 4AYBA 2WA0A 3H3ZA 1FMVA 4XL9A 5F0CA 2MBFA 3KYLA 1G59A 3FDYA 2KIUA 4A3LJ 4ITVA 2NYXA 3MZYA 3WTXC 3K4LA 3BJ6A 3L9FA 2CW8A 1N75A 2LREA 1A35A 1RR7A 2HYJA 4KIFA 2IA0A 1RUNA 2A07F 4CCLA 1SD7A 3L2RA 2NRAC 3FMSA 3A03A 3KP4A 4HNVA 2VC1A 1IRXA 3PQJA 2FQ3A 4HW0A 4YFKF 1XSDA 2C6YA 1KU2A 1FOXA 1UCRA 1IN8A 3GZNB 5L3BA 2PMHA 3RQIA 5GP9A 5IOZA 1TNTA 4XLCA 1KU3A 5GAGJ 1TQPA 3HXLA 3BPVA 2GLOA 2IS1A 1X3ZB 3DU6A 3KYDB 5CVUA 3IKTA 2DDBA 3ABTA 4CH7A 4II3A 5LLQA 3ONQA 3S2HJ 1I6XA 2QEXI 1DP3A 2Z5UA 4IVNA 4BL0B 3MKLA 1ZAOA 3BR0A 1YX3A 3IH2A 1LEAA 2AHQA 3CP8A 1J9IA 3LAPA 1RC9A 2IP2A 3G6EI 2W25A 3B02A 3R60A 4PJNA 4IRIA 4EM1A 2XROA 2BY3A 2XHKA 4IZZA 2M4KA 4BDZA 2HDCA 1Q1HA 1NG6A 1YRNB 1WH5A 1K78B 4GYIA 5FKKA 2BY0A 2A5YB 3E6BA 1OISA 5HDKA 2XASA 2VE9A 4I0AA 4EVIA 2XC7A 4E6KG 1N77A 5DCMA 4BQAA 2UUZA 3OIPA 5H2FC 4M6YA 2DFIA 1T33A 1OLTA 2M0CA 2O8KA 1WFXA 3FK6A 1RPWA 4EMSA 3ELKA 1IAWA 3K2AA 2QBYB 2EIJH 3R6SA 2DFEA 1ZR2A 3HOXJ 3CJNA 4JQFA 3EYYA 2DYRH 2LH9A 4KUMA 1RKTA 3M1CA 4ZTJA 3DCFA 3I4MJ 3S2WA 1J09A 4RB0A 5F0HA 1ZLKA 3TW6A 2XUBA 1ZR4A 4S0HB 4D0PA 4A0YA 5L3EA 2IXSA 2BVLA 2M2EA 5B66C 1SAUA 1VNDA 4HLXA 1H8AC 3FXLA 1P4WA 2OC6A 3BZKA 2E60A 2ZJ2A 4UUTA 3CMMA 4HSTA 1BN5A 3ESWB 3K4MA 2EA2A 4BXFA 1K61A 1U2WA 1ZTRA 3IAS2 5DM7F 4ZYGA 1FSEA 3SHFA 1R5GA 2ICWG 1FBUA 2XPVA 1E3OC 1G8XA 4A3DJ 1FX7A 1Z3YA 4HF0A 1X4PA 5DD4A 2ZXWH 2VXDA 4IHYA 1X1CA 2WV0A 5ERIA 2P5KA 3U2RA 3W6VA 4E7LA 3ERMA 3K9TA 1BJZA 1U9NA 1HOMA 5H6QA 3HPHA 1E17A 2P6TA 4M71A 2QSHX 3FBIB 1GDTA 3H0DA 1MBGA 3K70D 3NARA 1AKHA 1TT5B 1QVTA 2VE8A 4L0YB 1FC3A 1P7IA 2FE3A 3CQZJ 3GEZA 4JX6A 1L0OC 4D7MA 1FBSA 4XORA 3GTGJ 1GXQA 2ISZA 1GHCA 3PIPF 3VYUB 3VSLA 1SFXA 4BGDA 2Z9OA 1IUYA 3NWTA 3GX4X 2ADUA 2ZJPF 4XLNF 4IF4A 4CYCB 4ESBA 4D1QA 3P9IA 3KP2A 4RM2A 2DQLA 4FCYA 2NOJB 5JFRA 2DMTA 4J19A 3GTPJ 4CA0A 3KCCA 4ZYHA 4NQWA 4KNYA 2DI3A 3JAMK 1DU0A 2W00A 6PAXA 1UJ8A 1D1AA 5EEAA 4HEA2 2ZMEB 1IG7A 4EJVA 4ZTFA 1ZKGA 2OV7A 4FQGA 2E35A 4CCNA 2B0LA 1SANA 5LGUA 2DCEA 4JX4A 5E18F 1QZYA 5L3DA 4RAGA 3RPUD 2DPDA 3F8BA 4PUSA 1RI7A 2TCTA 3G2BA 1B9MA 4LITA 3T8RA 3A2KA 2CH0A 2R92J 1RKWA 3GYHX 4MTEA 1J2XA 1LE8B 4FETA 1VF9A 1N78A 3OOPA 3FISA 2KFDA 4G6QA 5EF6A 1HLVA 3KLNA 4CUGA 2LBFA 2XVCA 4V2FA 3VYRB 3QRFF 3GFLA 3B6CA 3IP4B 2ISYA 4MEYF 3BQZA 1CQTA 5FRMA 1XN7A 1FMWA 2IA1A 5IYDJ 2VC0A 1T2KA 2JZYA 1WQ2A 2OZ6A 5ILSA 2DA2A 3A0HC 3ZPLA 3PSFA 2R7UA 2O8XA 3E7LA 4AVPA 1S8NA 3TO6A 1W36D 3E5XA 4FX0A 4GRIA 2MABA 5D6FA 4X1EA 4ETSA 1V54H 2EILH 1OKRA 4PGGA 4ASNA 3CCMI 2GIVA 3BCAA 4XIDA 1VQNI 4JOMA 2P4WA 5BS6A 2CUZA 4M9XA 3S32A 2PJRB 2BXYA 1JXSA 5FKNA 1XDUA 3C2BA 1OPCA 2A05A 2XAFA 4HPQA 1MSFC 3JW4A 4OIRF 2GA2A 3QOPA 2J5OA 2XKOA 3VB2A 1ZH5A 3E3VA 5J40A 4CSWA 4MQ9F 3L09A 4G12A 2LFBA 1S7OA 4AVZA 1KYZA 2DA3A 1H89C 3FIWA 2Z2SB 4B8XA 2NS7A 3K4BA 3REOA 5HNHA 1P4XA 2VT2A 3GBGA 1KQ0A 2F5DA 3Q3SA 4YELA 1MNEA 5KAFC 2IJLA 3RPQA 1U6GA 1UB9A 2L4AA 2MD0A 5IY5H 1SAXA 4RM3A 4YFXF 4BH9A 1YQAA 3F21A 2VL8A 3G71I 2EWNA 2VODA 4IHVA 4IHTA 2IGNA 2R4GA 4UUVA 2LR8A 1SVLA 2DN0A 3OYAA 2VN2A 3R61A 3EETA 3B73A 4L9NA 2IPQX 3SQNA 2FMYA 2Q2EB 5KCMA 4C30A 3MFKA 2GWRA 2ID6A 1O3RA 4UUSB 3F3XA 1JTXA 4CCJA 3QWLA 1JTYA 2H8RA 3B6AA 1FT9A 3WU1B 3TMOA 1IZ1A 1I5ZA 1BW5A 3HDDA 1VFCA 2I8DA 1TZLA 1D5YA 4Z6YA 2L9RA 2HOSA 2GXAA 3KZIC 4UHTA 1QHHD 5JI6A 2PMZN 5JHFA 1S72I 1WJCA 3E1SA 1VQ6I 2WADA 5KNLA 2XV4S 2RDPA 1MMNA 4AD9A 1D5VA 2RNJA 1AHDP 2DFFA 3GUDA 4OOIA 4G6DA 2STTA 4XLEA 2AS5F 3DEEA 3S93A 2BHYA 4MIMA 2ZCWA 3LSHA 1MMAA 2JPBA 1MMGA 2HKOA 4NB5A 3HSFA 5CYVA 4BDYA 2XAUA 1BM9A 2ELKA 2R3SA 3PNYA 3F0CA 5A2QZ 3DF8A 3K4NA 2CS3A 3O2PE 4ANJA 1UFMA 3GTLJ 2JVHA 4DYRA 1USSA 1QA6A 5FKLA 2MH9A 3BTIA 3LL7A 3VOEA 3ZMSA 1R4MB 2MLGA 3DPTA 4XLFA 2HKXA 2XRNA 4WXCA 2KDZA 3FXOA 3CUQA 4HNTA 3BR6A 2EZIA 4XMYA 3KX2A 2DA6A 4RAYA 5B1BH 2OA4A 1ETOA 2L0KA 3FXUA 3L2UA 1ONVA 2DW4A 2VASA 3BQYA 1XSXA 2GBYA 2L54A 1T0FC 4AWXB 1X19A 3C7JA 3VPRA 4LIVA 3NAUA 1Z91A 1ZN2A 5TISC 1YG2A 3OYMA 2NS8A 2OCEA 3PFIA 3S1MJ 1R58A 3TP3A 5CPRB 3V4GA 3O6BB 2HQAA 3ZR8X 1XGSA 3ZCOA 3N97A 3LOCA 3TKYA 1ULYA 2K40A 1IXRC 3JRBA 2IS6A 3KPHA 3JRFA 2F5VA 5EZGA 5B3SH 3CUOA 3OS0A 1RUOA 2F2EA 2K85A 3HHGA 4WXDA 2H94A 2HXOA 4M3BA 1HF0A 1H9GA 3SJMA 4B09A 2VJ5A 2HS5A 2XPUA 4QPOA 4A3JJ 2V9PA 3OWTA 4ENMA 5EG0A 4X0GA 3QPLA 2O03A 1YLFA 1VI0A 2A69F 2M7AA 3BLYA 4XICA 2HYGD 1R5HA 1G4DA 4LG0A 1OCCH 2P8TA 2LVSA 1QRYA 1O7LA 1V3FA 2LDUA 2MGQA 4DGWB 5JLWA 1NHAA 4V2GA 4HQMA 2H1LA 3PSIA 1X1BA 4ON0A 3TDUC 1PUFB 1QPIA 1XMXA 1V5GA 4G6TB 2KRFA 5D6EA 4FHTA 2PX9A 1FBQA 4BHPA 2PN6A 4I7HA 1D8JA 2G0EA 2OD5A 4XKWA 3WU0A 1SFKA 2X48A 5BOXA 2VBXA 2Y48A 1IGNA 2X6OA 1HW1A 1Z77A 4Y7NJ 2E1CA 1FOYA 4DOZA 2KDOA 3CCSI 4IKFA 4A2UA 3BG7A 4PK4A 4RAZA 5M5WJ 5H6RA 3KEYA 4G94A 3BZ6A 3ZQGA 2TRTA 1OYIA 3CUQC 2XSDC 2F4MB 2HFHA 4QIWN 4XRMA 2R7SA 3TQNA 4RGXA 2HR3A 1B9NA 5AONA 4A3FJ 1EH7A 5GPCA 3K7AJ 3MEXA 2A61A 3ZQ7A 2DT5A 1YJWI 4IOAF 2X6XA 4Q48A 3HOSA 1MIJA 2BE5F 2DA1A 3BC8A 1D8KA 2OUMA 2PMZA 3J81Z 3C1DA 3VYSB 1JUMA 1KQ9A 1JT0A 5EEGA 1SMTA 2ME6A 4A12A 2COBA 1GVJA 3M3YJ 1OCOH 2X1CA 2GQQA 1SD4A 2M1BA 4P9FA 1ZREA 4O6JA 3T1BA 3WTSC 4CZZA 1O3QA 1YS7A 2K9LA 2HZDA 1UMQA 4E4HA 2XIGA 2HI3A 4IJAA 3VEPA 5ICGA 3G73A 4I0BA 2L7FP 1YE9A 2DFHA 2GOXB 3BOQA 1U5TA 5HNFA 2J5PA 1ZGJA 3UKGA 2ELJA 4P5OA 1REPC 4PFPA 5F1RA 4RB2C 1K6OA 4PJ0C 1V5EA 3SDGA 1FP2A 4HAMA 3RSNA 3WTUC 4I99C 1BC7C 3RYPA 4XR6A 2FXAA 4N4OB 3HGGA 2M5WA 5GAEJ 2B63J 3ZN1A 2EBIA 2X4HA 2QKLB 2E2HJ 1XGMA 5BNGA 3SDBA 3BG3A 3IH3A 3RDIA 2GOMA 4M3FA 1ZLJA 2PLYA 3CO7C 4M9SA 2DJIA 5KK1A 2HTSA 4G7HF 1S9HA 2A3SA 4CHUA 3RCOA 2NVQJ 3VWBA 3LSTA 3OY9A 2P81A 4CCKA 2KRHA 2KMUA 4D9JA 3OYHA 2XPWA 2E2JJ 5CQEA 1N25A 1ETKA 3ASOH 2V7FA 2IBDA 3CZ6A 1Y1WJ 3SXYA 1A04A 2OPTA 4LLLA 5J1YA 2O5RA 1QHGA 5DCMB 1H9TA 3ZMTA 3JRAA 4HLYA 2AQFA 2DOAA 1Z0XA 2BZTA 3R0AA 5ICCA 3OYNA 1W7PA 1DU6A 3GFMA 5E3OA 3IHUA 1KU9A 1VQMI 4FT8A 3EQLF 2ACJA 1IUFA 1X58A 2KKOA 1Z67A 2OTJI 1RESA 1WSUA 3CLOA 1Z3XA 2K9QA 5BQTA 1HCRA 4UNOA 1HA8A 3NWSA 4BYYA 3HHHA 1TLHB 2EIMH 4AU7A 1MJAA 3MN2A 2V1DA 2OQGA 2RQPA 4KYWA 1MKMA 3HOYJ 2Q1ZB 3OYLA 5ILUA 2F5EA 3DBLB 3CDHA 1JKRC 4LLGF 3GFJA 1MNDA 3WHBA 3DKXA 5J47A 1ZG1A 3HPGA 1EH8A 4YFNF 3I5UA 4I09A 4A3GJ 4EEFG 1K4SA 3FM3A 1VQKI 1R7JA 1HKSA 3HUGA 1U5TC 1MJ9A 3FWEA 5LD2C 3WGGA 3G1LA 3CMEI 1LUJB 2M7BA 4EJOA 2OAZA 3FM5A 3PQKA 3M8FA 4XONA 3ECOA 5EGOA 2DA7A 1NK2P 3MMYB 4XKVA 5E79C 5C4XJ 1MBEA 3F22A 5LHIA 1X4OA 2NVTJ 3BPXA 1HW5A 4EGZA 1G3WA 2ZXHA 1U8BA 1DGRM 3TGNA 3GTOJ 1OJLA 1G3SA 4Y52J 3K2ZA 2D45A 2D1HA 5M5YJ 3TOBA 4ZZDA 3ABLH 4GO1A 5E3NA 2MSYA 2ZSHB 1ZK8A 2W24A 2HPMA 1MMDA 5IP7J 2ZJRF 2DMPA 2X0LA 3WTTC 2VJIA 2VKEA 2FF4A 1R49A 5JVGF 1A6IA 1NG7A 2V1NA 3QODA 2CWEA 2QF7A 5E8GA 2LF8A 2RGVA 3F6VA 2R7OA 3PM1A 3RJPA 4ZH4F 3T5XA 3IRQA 4I6ZA 5LFAA 1I6HJ 2M9HA 3DLAA 3BZCA 3QYEA 3KETA 1MBFA 1BR1A 1WVRA 2BOLA 2HVSA 5M3MJ 2DO7A 3GFIA 2AO9A 3A1YA 4MO7A 1LFPA 4GXOA 2VT3A 3AG2H 2CU7A 1VQOI 2DOFA 3OYEA 1DPUA 1Z7LA 2N8GA 2MYSA 2H8WA 4ZC3A 3WTYC 1YHQI 1DP7P 2D5VA 4A3EJ 1F1ZA 3G1MA 3IAM2 1BI3A 2WB1N 2WAEA 5J3LA 2VOPA 2BXZA 3E6MA 4L5JA 1BOBA 2Y2ZA 2EPFA 3DWLE 4C3JJ 1POGA 4BEHA 3S3MA 3HJEA 4A6DA 3C2GA 3HOVJ 4F91B 3WU2C 5JHUA 3CCYA 3KIOA 3VDXA 1KYWA 3MAJA 1R9TJ 3HM5A 3NQOA 3D1NI 4BJ6C 3H5AA 1FSHA 4R8HA 1Y56A 5J8CA 3LSRA 3HL2A 2Z3YA 5F1JA 3P5JA 4KIBA 3E5QA 4HYEA 3NEUA 5LRRA 3I4PA 4U87A 2M3AA 3DBRB 2KHMA 2JT1A 4A5MA 2V26A 3QPTA 3JRCA 2IT0A 2V4JC 1QPMA 2QENA 3BG6A 4BY1J 3V42A 3V8LA 1EH6A 3RZOJ 3GMEA 3CC4I 2VQGA 5CVJA 5IT9K 2HU9A 4L9JA 1IN6A 3KEQA 3BG5A 1ITYA 3JR9A 1O3SA 2FBKA 1T38A 1U9OA 2KJCA 2V1XA 2ZKZA 3JRIA 1B6AA 1FIPA 5BPIA 1JE8A 1P92A 1IXCA 4HOBA 2QZ8A 2FBIA 1FTZA 3H5RA 4BQOA 1R4NB 2E1NA 1YITI 5K7HA 2X6YA 4RLQA 4LMYA 4Y15A 3HBLA 3GZ6A 1G3YA 3JREA 5KVRA 2Y0MA 2Z99A 1Y0NA 1Y8QB 3SEZA 2EFNA 4D5CA 3DKWA 4A0XA 5D5UB 3T8TA 2P5LC 4JX5A 2UV1A 3E5UA 3FXMA 4MHGA 4XRSG 5AIPA 3CMYA 3CESA 3K4JA 5FFXA 4HZFA 4IOCF 3J7AY 1ZGAA 4F92B 1P6RA 2XGCA 1AA7A 2IGOA 3RI4A 2VBYA 3VODA 4B43A 2ELHA 2QKMB 3FMQA 2R7TA 4UXNA 3OYKA 1GV5A 2JVGA 2LKXA 4N4NB 5HVQC 4EGYA 3CJQB 3CC7I 2ZFUA 2ID3A 1BOAA 1FP1D 4AM3A 2I10A 4NC7A 1V5FA 1LPQA 2MC3A 1XTAA 4JBAA 2Z33A 2NVXJ 3L2VA 1YTYA 2FOWA 1Z7UA 1A5JA 4IRHA 3W6KB 2HOTA 1UHWA 2CFXA 3HYIA 5F6FA 5GADJ 3J80K 3WTVC 4LIUA 4BE1A 1YRNA 1K78A 3QU6A 3HSEA 4HF1A 2HNHA 1O57A 4NUBA 3EUKL 3FHZA 2OTLI 1UHMA 2MFZA 4TV7A 4E7ZA 4HV6A 1TP4A 1J75A 4FE7A 2R0QC 3CUQB 4AIHA 2NVYJ 2FQ4A 3ZXSA 5CVRA 2OBPA 1SFOJ 5HS7A 1FIAA 4CXFA 3MKWB 5DYMA 5HLTA 4AIKA 1OR7A 3BTLA 3VFZA 2QBYA 1IN7A 3L2WA 4IQJA 3EPZA 2ZO4A 3HRMA 4PFOA 4CGZA 3CJRB 4PJJA 1BI0A 1BI2A 3K4KA 4M6VA 2IA2A 4Z2YA 5D4RA 2WB1A 3KFWX 4QTRA 2CUFA 2JSCA 1LDKB 2XDVA 3H9JA 2FJ1A 2OF7A 5DD8A 2XSJC 2X1DA 5FRNA 3DFGA 1LDJA 4QWQA 4DZPA 1ENHA 4ABZA 2HWVA 1RZ4A 1NK3P 3EYIA 3CTAA 3QP5A 3PJRA 2QWWA 3ZRGA 4RMNA 2VONA 3LSMA 2P0WA 3BTJA 2DJNA 3KP6A 5EYRA 3E6CC 3KLOA 1TTYA 2E1MC 2EV0A 4ZJZA 2QQBA 3AL0C 3IWZA 3DEUA 1MNMC 4OIPF 3VSKA 2HPIA 1D0XA 2W7NA 2DBBA 5E3LA 4CYDA 5KHDA 4LG0B 1BI1A 2Z16A 3S17J 2QYOA 4NC6A 4BE0A 1EA3A 2XF7A 3I9V2 3COAC 4HRIA 4XSXF 3J7YJ 1T56A 2CW0F 1XDSA 3R0JA 2L7KA 4XNFA 2VB6A 4KISA 3OSGA 5LHHA 1I50J 1W4MA 3MKZA 4LK1F 5BMZA 1G3TA 2CMPA 2F4OB 3SEQA 1UELB 2EFQA 2L4MA 1BC8C 3W2WA 5J1RA 3HOUJ 3FXJA 4BHCA 4IO9F 3LFKA 4M3EA 2CUEA 5EZHA 2PFBA 3GXOA 2IW5A 1K4TA 4CYCA 2ME0A 2RREA 2E5ZA 3FXRA 3GCMA 3ZMUA 1PJRA 4P55A 2DK8A 3BCBA 1XG1A 1TW2A 4IL6C 2DA4A 2ZMEA 3U1DA 4A5NA 1GXPA 1BR2A 3ZMVA 4KFCA 3I55I 2XF5A 3S8PA 1WZ2A 2JTVA 1BJAA 2MD5A 3WTWC 1HDPA 1QZEA 3G3ZA 1B8IB 2JK3A 1CF7B 2FD5A 2ZXJA 1MMSA 3HC7A 1Q1VA 3CDIA 3HSRA 1LE8A 3A01B 2ETHA 1Z1DA 2A5WA 2MH2A 4R1HA 1USTA 5K5OA 3S2DJ 4U0WA 1EJ9A 3U1KA 2IS4A 2YX7A 4YEJA 3RPUA 3F8FA 4HV5A 4Y13A 3H9QA 2EFPA 4XOTA 3IC7A 3F8NA 2NVUB 4Q4ZF 1HKTA 4RGSA 2E7XA 3HZJA 1BIBA 3GTJJ 4ESJA 3QPSA 3Q9VA 3H1CA 4GCVA 3OYJA 1J5YA 2XB0X 5FFZA 3ZQIA 2HEOA 2EQRA 2L01A 4BUPA 2VQHA 5D5XB 1U5TB 5IOYA 3FX3A 1XD7A 1MBKA 2ESHA 3ZMZA 3R4KA 2LP0A 4FE4A 5HDNA 1IV8A 4AC0A 3TOAA 2PJRA 3U9GA 5CLSA 5DTDA 3GLLA 3TP0A 5J8FA 1L3LA 3F6OA 1PDNC 5E20A 1IN4A 2ZXIA 3ASNH 2CQNA 3I56I 3GZ5A 1DUXC 3S3OA 2R5ZA 2RAEA 1GT0C 1BR4A 4XRSA 2Y30A 4D5FA 2KIMA 4P1WA 4FISA 3FXKA 4S04A 1MDMB 4L5EA 1J7KA 3GW2A 2XB5A 3RTRA 3SYTA 2Y0SN 1WJ5A 2RNGA 2R5YB 1LDDA 4CDGA 2M87A 2XAJA 1SD5A 1YO5C 1MGTA 4EJUA 4F7ZA 3CCEI 2L9NA 1YYVA 2PG4A 2WTEA 1T8IA 3QOEA 4A69C 1I3AA 1YW8A 2KJBA 4DZJA 4N9IA 3OYIA 2Q0OA 5DM6F 3Q0VA 2YSRA 4UB8C 3LFUA 3E97A 2JA6J 1WHUA 4KN4X 2VXZA 4MFEA 5CVIA 4FTHA 4PGHA 4QLCU 1G6NA 2KLOA 3PUBA 2VI6A 2QQ9A 4IEJA 1B72A 4NBQA 2P7VB 2Y75A 4KT6A 5AIQA 4AIDA 4OMYA 3H35A 1W7PB 2Q2EA 5FLXK 3I54A 2MG4A 1APLC 2LY2A 3DTIA 3ROUA 4W97A 1X1DA 4ZZLA 3TL4X 4XQFA 4M9ZA 2DT7B 2HOEA 2XF6A 5FGMA 2YU3A 2QQ8A 4A3KJ 1JKQC 5HLHA 1PYVA 3C3WA 1IRZA 2VQLA 2K9SA 4FX4A 5TJJA 2QLZA 3ZQHA 3FXQA
chains in the Genus database with same CATH topology
2L02A 4G9YA 1T6SA 1AOYA 1R1TA 1QBJA 1D3YA 3ECHA 3FMRA 1B4AA 3I59B 4YIIA 4M6XA 5ICFA 1XCBA 4OINF 1J59A 4YG2F 2D1VA 3MWMA 3Q9SA 3ZP5A 5LGTA 1FYKA 4ZYEA 2P5VA 1B59A 2EJRA 3N4MA 2PI0A 1FPQA 4WX9A 2ZFWA 2O3FA 2VOOA 2BGCA 5ICEA 1WI9A 3WTZA 4WF2A 1YS6A 4CO8A 1ZYRF 4LB6B 5TRDA 3ABUA 1KGSA 1FWZA 3T0YA 3F72A 5FD5A 2L3DA 2GXBA 1OYYA 1ODDA 3LWFA 1WRJA 1DDNA 4UVBA 2OU2A 1TQIA 1TNSA 1S6LA 1RNLA 1V4RA 1QGPA 2UXNA 2V9VA 5HOOA 3LA7A 5CJ9A 4KMUX 4JK1X 1R00A 2XAGA 1IW7F 4EJWA 1Z6RA 2EFOA 4MTDA 1K7AA 3BP8A 4K2EA 3F8CA 2QUFA 3H92A 1E2XA 4G7OF 1XB4A 5ILVA 2W57A 2YR2A 3M7GA 1ZRCA 2VBZA 4L9TA 1R1UA 2K86A 4ENKA 3HTUA 2O6GE 1BIAA 2W85A 2O61A 1JHFA 1Z05A 2O0YA 2OQRA 2PJPA 3I0TA 3QAHA 1HQCA 2H09A 3TO9A 4R79A 3MQ0A 2QVOA 1IN5A 1HSTA 3RKXA 3V8JA 5D5WB 2EB7A 3O3KA 1ON2A 2CG4A 1I27A 5L3CA 2EV6A 3BJAA 3ULQB 1W5TA 3KEOA 2FA5A 4M72A 1PP7U 2Q8KA 1LVAA 3KE2A 3QPHA 3JTHA 2COMA 3K69A 1KQ8A 2HQRA 4BXUA 1XCVA 4LK0F 1F4KA 2FOKA 2GXGA 1W5SA 1FLIA 4GYGA 2P6SA 3EDPA 1BBYA 3WGIA 1YW7A 1K79A 1LNWA 3ML6A 5E1ZB 4WCGA 1MZBA 3L7WA 1HW2A 4U7DA 2FEZA 4KIGA 2FBHA 1P4AA 3BY6A 3WG9A 4EJTA 3DXJF 3DV8A 1P2FA 1FZPB 2GA1A 3MZHA 1IRFA 3I71A 1MJBA 2GZWA 2XGXA 2D2WA 3TO7A 4XLPF 3LQRA 2HGCA 4XSZF 4EM2A 5D4SA 4IRGA 4MGRA 4BAYA 3E6DA 3K0LA 2RN7A 2ZNZA 2V6CA 1B1BA 3V7RA 1FYLA 3F8MA 5DDGA 1TQMA 5DCFA 2H6BA 2CO5A 4HQEA 4M73A 1F9NA 1KA8A 5FB2A 5DV5A 2DQRA 3V7CA 2HQNA 2HYFA 3BDDA 2FSWA 1CGPA 5LBQA 4A0ZA 5H20A 2QM3A 1XSVA 3HOTA 2NS0A 4UV9A 1Z9CA 2WWYA 2K02A 2A68F 4I02A 4UV8A 2PQ8A 5D8LB 1LEBA 1QZZA 5D5VB 1X3UA 4NHJA 4L9VA 2HTJA 5LGNA 5FD6A 5F64A 2H27A 5HLIA 1ZG5A 4P9UA 2NNYA 3RYRA 3DQVC 1FOKA 5LEKA 5JR3A 3GO5A 1H0MA 1YIOA 2DAOA 2BBYA 1YW9A 3LA2A 3OV8A 4G8XA 4EQQA 5A2QK 3GF2A 3IKVA 3GVAA 3GLXA 4DNCA 3HIFA 3CO6C 4HX7A 4RGUA 2K7LA 3SZPA 1Y0UA 4G7ZF 5LRSA 1AWCA 3KZYA 1F5TA 1FY7A 1T39A 3D0SA 4Y17A 2P7CB 3NRVA 4I2OA 1JGSA 2CGPA 2F5FA 4ENNA 2UZKA 4HDUA 2FU4A 2KIFA 2NAZA 1ZRFA 3P7NA 1HXDA 3SFZA 5E8IA 1J0RA 2F5CA 2PEXA 1HSJA 3IL2A 3QU3A 1FYMA 1S3JA 1T98A 4I01A 3RIRA 2HZTA 5IT9Z 1YFHA 3K1MA 2EK5A 5K5QA 3M1EA 2M30A 3JTGA 2RKHA 4P96A 3I58A 3BWGA 1T0FA 4LJZF 5FO5A 2ESNA 2W84A 2PMUA 1OYWA 2WC2A 4HX8A 4WXHA 1KU7A 2BYVE 1SFUA 1WWXA 3WODF 2RV8A 2M8EA 3RKYA 5BPDA 2R7FA 3I64A 2G7HA 3JAMZ 4DQ2A 1JHHA 2CSOA 5DUKA 2AXLA 5HDGA 3ZN0A 2DU9A 4U0YA 4KT5C 2VBWA 4RB1A 3WE2A 2E7WA 4OIOF 1WKMA 2XAHA 5J6XA 2LNBA 3KP7A 3EUHA 2PBIA 2QQAA 4BNCA 1SD6A 3W6JB 5ED4A 1DPRA 5CVVA 1XMKA 3BROA 3J81K 3AAFA 3IRRA 3J80Z 2CQKA 3KP3A 4HA8A 4HDVA 5JVTA 3D5LA 3SZTA 4UVAA 2XKPA 4LD5A 3HRTA 1LQ1A 5L3FA 4RS8A 2R7DA 3V8KA 1C0WA 3WGHA 1QQIA 1U3EM 4I98B 2GAUA 1STZA 2EV5A 4EV0A 1HKQA 3Q5FA 4XBFA 4WWCA 4M74A 3LAJA 2STWA 2CYYA 1ZHFA 2K27A 4S05A 4LGWA 4PCQA 1IRGA 4MNUA 4UVCA 4OU0A 1R36A 2FNAA 1TBXA 4PDKA 3HRUA 2A6EF 1W7PD 4U88A 2A6HF 2FMLA 2RC4A 4MEXF 4HX4A 5D8KB 5E17F 3L2CA 4HBLA 1XGOA 1Z6TA 5E1XA 4L5IA 2H6CA 4LB5A 1TW3A 1LJ9A 3K1NA 4MQVA 4A6EA 3K1PA 3RKWA 5HS8A 1IF1A 1S7AA 3BJOA 3MCZA 2UXXA 2TDXA 3F23A 3TDZC 2DLLA 2UWMA 1XMAA 1O3TA 1FNNA 3DPLC 2BV6A 5K1YA 2FNPA 1EV7A 2ZNYA 4XRFA 3QP6A 1R22A 5HS9A 4OIQF 1SFEA 5E1WA 2G7UA 4OMZA 1U8RA 4AIJA 1S29A 4ESFA 4N0BA 5K5RA 2EA4A 4E70A 1LB2A 2RVCA 1CF7A 3WE3A 5HLGA 3H3UA 1I1SA 4BHBA 3FF5A 1ZG3A 5IT3A 1RIOH 2XAQA 3LA3A 3P9CA 3LQQA 5DEQA 1R23A 3I53A 1ZRDA 2NNNA 4YIFA 1VTNC 1QNTA 4U7BA 3DP7A 3M8EA 3P9KA 5EEHA 4ZYDA 4KA4A 1IXSB 2YPRA 4Q5SF 4GGGA 1O7FA 4HF2A 2FRHA 2EFWA 1I1GA 4IPAA 2IVMA 2YX4A 2K4BA 1PUEE 5L3GA 2LKPA 3IWFA 4CICA 2JPCA 3J7AO 2IRFG 3KP5A 4KN7X 4KMFA 4IXAA 4U0VA 1ZARA 3M9AA 2OZUA 1MDMA 1ON1A 2JRTA 2V79A 4Q47A 1MD0A 3HRSA 4IHSA 4KICA 5DUIA 1PP8F 3V7SA 4RB3C 1QO0D 2MLKA 4O5VA 4EM0B 2V1UA 3L00A 2MA3A 4PZJA 5FLXZ 4N9HA 2M45A 2ZBKA 2LF7A 4WK8F 2BEOA 3ISPA 4KDPA 2K4JA 1R1VA 3JSOA 3C18A 4H0EA 3KZZA 2DPUA 1SMYF 5LEJA 2G9WA 2LSOA 4ENJA 4LLNA 2DK5A 4O3MA 3HTSB 5LHGA 1HBXG 1XGNA 3I59A 4RGRA 1OMIA 3GWZA 3FZVA 4LFUA 3ERED 1U78A 4L18B 2DTRA 4L0ZB 3JSPA 3ZMDA 3H3ZA 2MBFA 2KIUA 2NYXA 3MZYA 3WTXC 3L9FA 3BJ6A 4KIFA 2IA0A 1RUNA 2A07F 1SD7A 2NRAC 3FMSA 3KP4A 2VC1A 3PQJA 4YFKF 2FQ3A 4HW0A 1XSDA 2C6YA 1KU2A 1UCRA 1IN8A 5L3BA 2PMHA 1TNTA 1KU3A 1TQPA 3BPVA 5CVUA 3IKTA 3ABTA 5LLQA 1I6XA 2Z5UA 4IVNA 1ZAOA 1LEAA 1J9IA 3LAPA 2IP2A 2W25A 3B02A 3R60A 4IRIA 4EM1A 2XROA 2XHKA 2HDCA 1Q1HA 1K78B 4GYIA 2A5YB 3E6BA 5HDKA 2VE9A 2XASA 4I0AA 4EVIA 5DCMA 4BQAA 4M6YA 2DFIA 4EMSA 3ELKA 1IAWA 2QBYB 3R6SA 3CJNA 4JQFA 3EYYA 4KUMA 3S2WA 4RB0A 1ZLKA 2XUBA 4D0PA 4A0YA 5L3EA 4HLXA 1P4WA 2ZJ2A 1BN5A 2EA2A 1U2WA 4ZYGA 1FSEA 3SHFA 1R5GA 1FBUA 1FX7A 4HF0A 5DD4A 2WV0A 5ERIA 2P5KA 3U2RA 3K9TA 5H6QA 1E17A 2P6TA 4M71A 2VE8A 4L0YB 1FC3A 2FE3A 3GEZA 1L0OC 1FBSA 1GXQA 2ISZA 1GHCA 1SFXA 2Z9OA 1IUYA 3GX4X 2ADUA 4XLNF 4IF4A 4ESBA 3P9IA 3KP2A 2DQLA 5JFRA 3KCCA 4ZYHA 4NQWA 4KNYA 2DI3A 3JAMK 6PAXA 2ZMEB 4EJVA 2B0LA 5LGUA 5E18F 1QZYA 5L3DA 2DPDA 3F8BA 1RI7A 1B9MA 3T8RA 3GYHX 4MTEA 1J2XA 3OOPA 4G6QA 3KLNA 2XVCA 3QRFF 3GFLA 4MEYF 2ISYA 1XN7A 2IA1A 2VC0A 1T2KA 2JZYA 1WQ2A 2OZ6A 5ILSA 3ZPLA 2O8XA 4AVPA 1S8NA 3TO6A 3E5XA 4FX0A 5D6FA 4ETSA 1OKRA 4PGGA 4ASNA 2GIVA 2P4WA 5BS6A 4M9XA 1JXSA 1XDUA 1OPCA 2XAFA 3JW4A 4OIRF 2GA2A 3QOPA 2J5OA 2XKOA 3VB2A 1ZH5A 3E3VA 4MQ9F 3L09A 1S7OA 1KYZA 4B8XA 3REOA 1P4XA 2VT2A 1KQ0A 2F5DA 2IJLA 3RPQA 1U6GA 1UB9A 2L4AA 1SAXA 4YFXF 4BH9A 1YQAA 3F21A 2EWNA 2VODA 4IHTA 4UUVA 2VN2A 3R61A 3EETA 3B73A 4L9NA 2IPQX 3SQNA 2FMYA 3MFKA 2GWRA 1O3RA 3F3XA 1FT9A 3WU1B 1IZ1A 1I5ZA 4UHTA 5JI6A 2XV4S 2RDPA 4AD9A 1D5VA 2RNJA 3GUDA 4OOIA 4G6DA 2STTA 2AS5F 2ZCWA 2JPBA 2HKOA 4NB5A 3HSFA 5CYVA 1BM9A 2R3SA 5A2QZ 3DF8A 3O2PE 1UFMA 1USSA 2MH9A 3VOEA 3ZMSA 2MLGA 3DPTA 2HKXA 2XRNA 4WXCA 3CUQA 4RAYA 2OA4A 3FXUA 1ONVA 2DW4A 1XSXA 2L54A 4AWXB 3C7JA 1Z91A 1ZN2A 1YG2A 3PFIA 1R58A 3V4GA 3O6BB 1XGSA 3N97A 3TKYA 1ULYA 1IXRC 3CUOA 1RUOA 2F2EA 3HHGA 4WXDA 2H94A 1H9GA 4B09A 2HS5A 4ENMA 2O03A 1YLFA 2A69F 1G4DA 2HYGD 1R5HA 4LG0A 2P8TA 1V3FA 1O7LA 2LDUA 1NHAA 4HQMA 3TDUC 4ON0A 5D6EA 2KRFA 4FHTA 1FBQA 4BHPA 2PN6A 4I7HA 1D8JA 2OD5A 3WU0A 5BOXA 2VBXA 2Y48A 1HW1A 2E1CA 4A2UA 4RAZA 5H6RA 4G94A 3BZ6A 1OYIA 3CUQC 2HFHA 3TQNA 4RGXA 2HR3A 1B9NA 5AONA 1EH7A 3MEXA 3ZQ7A 2A61A 2DT5A 4Q48A 3HOSA 2BE5F 1D8KA 3J81Z 3C1DA 1KQ9A 5EEGA 1SMTA 4A12A 1GVJA 2GQQA 1SD4A 2M1BA 4P9FA 1ZREA 4O6JA 3T1BA 3WTSC 4CZZA 1O3QA 1YS7A 2XIGA 4IJAA 3VEPA 5ICGA 3G73A 4I0BA 3BOQA 1U5TA 2J5PA 1ZGJA 4P5OA 1REPC 5F1RA 4RB2C 1K6OA 1FP2A 4HAMA 3WTUC 1BC7C 3RYPA 2FXAA 2M5WA 3ZN1A 2X4HA 1XGMA 3RDIA 1ZLJA 2PLYA 3CO7C 4M9SA 5KK1A 2HTSA 4G7HF 2A3SA 4CHUA 3LSTA 3SXYA 1A04A 4LLLA 5DCMB 1H9TA 3ZMTA 4HLYA 3R0AA 5ICCA 1W7PA 3GFMA 3IHUA 1KU9A 4FT8A 3EQLF 2ACJA 2KKOA 1WSUA 3CLOA 5BQTA 4UNOA 4BYYA 3HHHA 1TLHB 1MJAA 2V1DA 2OQGA 2RQPA 4KYWA 1MKMA 5ILUA 2F5EA 3CDHA 4LLGF 3GFJA 1ZG1A 1EH8A 4YFNF 3I5UA 4I09A 3FM3A 1R7JA 1HKSA 3HUGA 1U5TC 1MJ9A 3FWEA 3WGGA 4EJOA 2OAZA 3FM5A 3PQKA 3M8FA 3ECOA 3F22A 5LHIA 3BPXA 1HW5A 4EGZA 1G3WA 3TGNA 1G3SA 3K2ZA 2D45A 2D1HA 3TOBA 4ZZDA 4GO1A 2W24A 2X0LA 3WTTC 2FF4A 2CWEA 5E8GA 2LF8A 2RGVA 3F6VA 3RJPA 4ZH4F 3T5XA 3IRQA 3KETA 2DO7A 3GFIA 4GXOA 2VT3A 1DPUA 3WTYC 1DP7P 1F1ZA 1BI3A 2VOPA 3E6MA 4L5JA 4A6DA 5JHUA 1KYWA 3MAJA 3NQOA 1FSHA 4R8HA 5J8CA 2Z3YA 4KIBA 3E5QA 4HYEA 3NEUA 5LRRA 3I4PA 2JT1A 4A5MA 3QPTA 2IT0A 1QPMA 2QENA 3V8LA 1EH6A 5CVJA 5IT9K 4L9JA 1IN6A 3KEQA 1O3SA 2FBKA 1T38A 2KJCA 2V1XA 2ZKZA 1B6AA 5BPIA 1JE8A 1P92A 1IXCA 4HOBA 2QZ8A 2FBIA 2E1NA 4Y15A 4LMYA 3GZ6A 1G3YA 5KVRA 2Y0MA 2Z99A 2EFNA 3DKWA 4A0XA 5D5UB 3T8TA 2P5LC 3E5UA 4MHGA 5AIPA 5FFXA 4HZFA 1ZGAA 1P6RA 3RI4A 2VBYA 3VODA 2ELHA 3FMQA 4UXNA 5HVQC 4EGYA 1BOAA 1FP1D 2MC3A 4JBAA 2Z33A 1YTYA 1Z7UA 4IRHA 3W6KB 1UHWA 2CFXA 3HYIA 5F6FA 3WTVC 3J80K 1K78A 3QU6A 3HSEA 4HF1A 1O57A 3FHZA 1UHMA 4TV7A 4HV6A 1J75A 3CUQB 4AIHA 5CVRA 2OBPA 5HS7A 4CXFA 5DYMA 4AIKA 1OR7A 3VFZA 2QBYA 1IN7A 2ZO4A 3HRMA 4CGZA 1BI0A 1BI2A 2IA2A 4Z2YA 5D4RA 3KFWX 2JSCA 1LDKB 5DD8A 3DFGA 1LDJA 4QWQA 2HWVA 1RZ4A 3EYIA 3CTAA 3QP5A 2QWWA 2VONA 3E6CC 3KP6A 3KLOA 1TTYA 2EV0A 2QQBA 3IWZA 3DEUA 4OIPF 2DBBA 4CYDA 4LG0B 1BI1A 2QYOA 3COAC 4XSXF 2CW0F 1XDSA 3R0JA 5LHHA 1W4MA 5BMZA 4LK1F 1G3TA 2EFQA 2L4MA 1BC8C 4BHCA 3LFKA 2PFBA 3GXOA 2IW5A 3FXRA 3ZMUA 4P55A 2DK8A 1TW2A 2ZMEA 3U1DA 4A5NA 1GXPA 3ZMVA 4KFCA 2JTVA 1BJAA 2MD5A 3WTWC 3G3ZA 1CF7B 2ZXJA 3HSRA 2ETHA 1Z1DA 2MH2A 4R1HA 1USTA 5K5OA 4U0WA 2YX7A 3RPUA 3F8FA 4HV5A 4Y13A 2EFPA 3IC7A 3F8NA 4Q4ZF 1HKTA 4RGSA 2E7XA 1BIBA 4ESJA 3Q9VA 4GCVA 1J5YA 5FFZA 2HEOA 2L01A 5D5XB 1U5TB 3FX3A 1XD7A 2ESHA 3ZMZA 3R4KA 5HDNA 3TOAA 3U9GA 5CLSA 5J8FA 1L3LA 3F6OA 1PDNC 5E20A 1IN4A 3GZ5A 1DUXC 2KIMA 4S04A 1MDMB 1J7KA 3GW2A 3RTRA 1LDDA 4CDGA 2M87A 2XAJA 1SD5A 1YO5C 1MGTA 4EJUA 4F7ZA 1YYVA 2PG4A 2WTEA 1YW8A 2KJBA 4N9IA 2Q0OA 2YSRA 3E97A 4KN4X 2VXZA 5CVIA 4PGHA 4QLCU 1G6NA 2QQ9A 2P7VB 2Y75A 5AIQA 4OMYA 1W7PB 2Q2EA 5FLXK 3I54A 3ROUA 4ZZLA 4M9ZA 2HOEA 5FGMA 2YU3A 5HLHA 3C3WA 4FX4A 5TJJA 2QLZA 3FXQA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2L02 A;  4G9Y A;  1T6S A;  1AOY A;  1R1T A;  1QBJ A;  1D3Y A;  3ECH A;  3FMR A;  1B4A A;  3I59 B;  4YII A;  4M6X A;  5ICF A;  1XCB A;  4OIN F;  1J59 A;  4YG2 F;  2D1V A;  3MWM A;  3Q9S A;  3ZP5 A;  5LGT A;  1FYK A;  4ZYE A;  2P5V A;  1B59 A;  2EJR A;  3N4M A;  2PI0 A;  1FPQ A;  4WX9 A;  2ZFW A;  2O3F A;  2VOO A;  2BGC A;  5ICE A;  1WI9 A;  3WTZ A;  4WF2 A;  1YS6 A;  4CO8 A;  1ZYR F;  4LB6 B;  5TRD A;  3ABU A;  1KGS A;  1FWZ A;  3T0Y A;  3F72 A;  5FD5 A;  2L3D A;  2GXB A;  1OYY A;  1ODD A;  3LWF A;  1WRJ A;  1DDN A;  4UVB A;  2OU2 A;  1TQI A;  1TNS A;  1S6L A;  1RNL A;  1V4R A;  1QGP A;  2UXN A;  2V9V A;  5HOO A;  3LA7 A;  5CJ9 A;  4KMU X;  4JK1 X;  1R00 A;  2XAG A;  1IW7 F;  4EJW A;  1Z6R A;  2EFO A;  4MTD A;  1K7A A;  3BP8 A;  4K2E A;  3F8C A;  2QUF A;  3H92 A;  1E2X A;  4G7O F;  1XB4 A;  5ILV A;  2W57 A;  2YR2 A;  3M7G A;  1ZRC A;  2VBZ A;  4L9T A;  1R1U A;  2K86 A;  4ENK A;  3HTU A;  2O6G E;  1BIA A;  2W85 A;  2O61 A;  1JHF A;  1Z05 A;  2O0Y A;  2OQR A;  2PJP A;  3I0T A;  3QAH A;  1HQC A;  2H09 A;  3TO9 A;  4R79 A;  3MQ0 A;  2QVO A;  1IN5 A;  1HST A;  3RKX A;  3V8J A;  5D5W B;  2EB7 A;  3O3K A;  1ON2 A;  2CG4 A;  1I27 A;  5L3C A;  2EV6 A;  3BJA A;  3ULQ B;  1W5T A;  3KEO A;  2FA5 A;  4M72 A;  1PP7 U;  2Q8K A;  1LVA A;  3KE2 A;  3QPH A;  3JTH A;  2COM A;  3K69 A;  1KQ8 A;  2HQR A;  4BXU A;  1XCV A;  4LK0 F;  1F4K A;  2FOK A;  2GXG A;  1W5S A;  1FLI A;  4GYG A;  2P6S A;  3EDP A;  1BBY A;  3WGI A;  1YW7 A;  1K79 A;  1LNW A;  3ML6 A;  5E1Z B;  4WCG A;  1MZB A;  3L7W A;  1HW2 A;  4U7D A;  2FEZ A;  4KIG A;  2FBH A;  1P4A A;  3BY6 A;  3WG9 A;  4EJT A;  3DXJ F;  3DV8 A;  1P2F A;  1FZP B;  2GA1 A;  3MZH A;  1IRF A;  3I71 A;  1MJB A;  2GZW A;  2XGX A;  2D2W A;  3TO7 A;  4XLP F;  3LQR A;  2HGC A;  4XSZ F;  4EM2 A;  5D4S A;  4IRG A;  4MGR A;  4BAY A;  3E6D A;  3K0L A;  2RN7 A;  2ZNZ A;  2V6C A;  1B1B A;  3V7R A;  1FYL A;  3F8M A;  5DDG A;  1TQM A;  5DCF A;  2H6B A;  2CO5 A;  4HQE A;  4M73 A;  1F9N A;  1KA8 A;  5FB2 A;  5DV5 A;  2DQR A;  3V7C A;  2HQN A;  2HYF A;  3BDD A;  2FSW A;  1CGP A;  5LBQ A;  4A0Z A;  5H20 A;  2QM3 A;  1XSV A;  3HOT A;  2NS0 A;  4UV9 A;  1Z9C A;  2WWY A;  2K02 A;  2A68 F;  4I02 A;  4UV8 A;  2PQ8 A;  5D8L B;  1LEB A;  1QZZ A;  5D5V B;  1X3U A;  4NHJ A;  4L9V A;  2HTJ A;  5LGN A;  5FD6 A;  5F64 A;  2H27 A;  5HLI A;  1ZG5 A;  4P9U A;  2NNY A;  3RYR A;  3DQV C;  1FOK A;  5LEK A;  5JR3 A;  3GO5 A;  1H0M A;  1YIO A;  2DAO A;  2BBY A;  1YW9 A;  3LA2 A;  3OV8 A;  4G8X A;  4EQQ A;  5A2Q K;  3GF2 A;  3IKV A;  3GVA A;  3GLX A;  4DNC A;  3HIF A;  3CO6 C;  4HX7 A;  4RGU A;  2K7L A;  3SZP A;  1Y0U A;  4G7Z F;  5LRS A;  1AWC A;  3KZY A;  1F5T A;  1FY7 A;  1T39 A;  3D0S A;  4Y17 A;  2P7C B;  3NRV A;  4I2O A;  1JGS A;  2CGP A;  2F5F A;  4ENN A;  2UZK A;  4HDU A;  2FU4 A;  2KIF A;  2NAZ A;  1ZRF A;  3P7N A;  1HXD A;  3SFZ A;  5E8I A;  1J0R A;  2F5C A;  2PEX A;  1HSJ A;  3IL2 A;  3QU3 A;  1FYM A;  1S3J A;  1T98 A;  4I01 A;  3RIR A;  2HZT A;  5IT9 Z;  1YFH A;  3K1M A;  2EK5 A;  5K5Q A;  3M1E A;  2M30 A;  3JTG A;  2RKH A;  4P96 A;  3I58 A;  3BWG A;  1T0F A;  4LJZ F;  5FO5 A;  2ESN A;  2W84 A;  2PMU A;  1OYW A;  2WC2 A;  4HX8 A;  4WXH A;  1KU7 A;  2BYV E;  1SFU A;  1WWX A;  3WOD F;  2RV8 A;  2M8E A;  3RKY A;  5BPD A;  2R7F A;  3I64 A;  2G7H A;  3JAM Z;  4DQ2 A;  1JHH A;  2CSO A;  5DUK A;  2AXL A;  5HDG A;  3ZN0 A;  2DU9 A;  4U0Y A;  4KT5 C;  2VBW A;  4RB1 A;  3WE2 A;  2E7W A;  4OIO F;  1WKM A;  2XAH A;  5J6X A;  2LNB A;  3KP7 A;  3EUH A;  2PBI A;  2QQA A;  4BNC A;  1SD6 A;  3W6J B;  5ED4 A;  1DPR A;  5CVV A;  1XMK A;  3BRO A;  3J81 K;  3AAF A;  3IRR A;  3J80 Z;  2CQK A;  3KP3 A;  4HA8 A;  4HDV A;  5JVT A;  3D5L A;  3SZT A;  4UVA A;  2XKP A;  4LD5 A;  3HRT A;  1LQ1 A;  5L3F A;  4RS8 A;  2R7D A;  3V8K A;  1C0W A;  3WGH A;  1QQI A;  1U3E M;  4I98 B;  2GAU A;  1STZ A;  2EV5 A;  4EV0 A;  1HKQ A;  3Q5F A;  4XBF A;  4WWC A;  4M74 A;  3LAJ A;  2STW A;  2CYY A;  1ZHF A;  2K27 A;  4S05 A;  4LGW A;  4PCQ A;  1IRG A;  4MNU A;  4UVC A;  4OU0 A;  1R36 A;  2FNA A;  1TBX A;  4PDK A;  3HRU A;  2A6E F;  1W7P D;  4U88 A;  2A6H F;  2FML A;  2RC4 A;  4MEX F;  4HX4 A;  5D8K B;  5E17 F;  3L2C A;  4HBL A;  1XGO A;  1Z6T A;  5E1X A;  4L5I A;  2H6C A;  4LB5 A;  1TW3 A;  1LJ9 A;  3K1N A;  4MQV A;  4A6E A;  3K1P A;  3RKW A;  5HS8 A;  1IF1 A;  1S7A A;  3BJO A;  3MCZ A;  2UXX A;  2TDX A;  3F23 A;  3TDZ C;  2DLL A;  2UWM A;  1XMA A;  1O3T A;  1FNN A;  3DPL C;  2BV6 A;  5K1Y A;  2FNP A;  1EV7 A;  2ZNY A;  4XRF A;  3QP6 A;  1R22 A;  5HS9 A;  4OIQ F;  1SFE A;  5E1W A;  2G7U A;  4OMZ A;  1U8R A;  4AIJ A;  1S29 A;  4ESF A;  4N0B A;  5K5R A;  2EA4 A;  4E70 A;  1LB2 A;  2RVC A;  1CF7 A;  3WE3 A;  5HLG A;  3H3U A;  1I1S A;  4BHB A;  3FF5 A;  1ZG3 A;  5IT3 A;  1RIO H;  2XAQ A;  3LA3 A;  3P9C A;  3LQQ A;  5DEQ A;  1R23 A;  3I53 A;  1ZRD A;  2NNN A;  4YIF A;  1VTN C;  1QNT A;  4U7B A;  3DP7 A;  3M8E A;  3P9K A;  5EEH A;  4ZYD A;  4KA4 A;  1IXS B;  2YPR A;  4Q5S F;  4GGG A;  1O7F A;  4HF2 A;  2FRH A;  2EFW A;  1I1G A;  4IPA A;  2IVM A;  2YX4 A;  2K4B A;  1PUE E;  5L3G A;  2LKP A;  3IWF A;  4CIC A;  2JPC A;  3J7A O;  2IRF G;  3KP5 A;  4KN7 X;  4KMF A;  4IXA A;  4U0V A;  1ZAR A;  3M9A A;  2OZU A;  1MDM A;  1ON1 A;  2JRT A;  2V79 A;  4Q47 A;  1MD0 A;  3HRS A;  4IHS A;  4KIC A;  5DUI A;  1PP8 F;  3V7S A;  4RB3 C;  1QO0 D;  2MLK A;  4O5V A;  4EM0 B;  2V1U A;  3L00 A;  2MA3 A;  4PZJ A;  5FLX Z;  4N9H A;  2M45 A;  2ZBK A;  2LF7 A;  4WK8 F;  2BEO A;  3ISP A;  4KDP A;  2K4J A;  1R1V A;  3JSO A;  3C18 A;  4H0E A;  3KZZ A;  2DPU A;  1SMY F;  5LEJ A;  2G9W A;  2LSO A;  4ENJ A;  4LLN A;  2DK5 A;  4O3M A;  3HTS B;  5LHG A;  1HBX G;  1XGN A;  3I59 A;  4RGR A;  1OMI A;  3GWZ A;  3FZV A;  4LFU A;  3ERE D;  1U78 A;  4L18 B;  2DTR A;  4L0Z B;  3JSP A;  3ZMD A;  3H3Z A;  2MBF A;  2KIU A;  2NYX A;  3MZY A;  3WTX C;  3L9F A;  3BJ6 A;  4KIF A;  2IA0 A;  1RUN A;  2A07 F;  1SD7 A;  2NRA C;  3FMS A;  3KP4 A;  2VC1 A;  3PQJ A;  4YFK F;  2FQ3 A;  4HW0 A;  1XSD A;  2C6Y A;  1KU2 A;  1UCR A;  1IN8 A;  5L3B A;  2PMH A;  1TNT A;  1KU3 A;  1TQP A;  3BPV A;  5CVU A;  3IKT A;  3ABT A;  5LLQ A;  1I6X A;  2Z5U A;  4IVN A;  1ZAO A;  1LEA A;  1J9I A;  3LAP A;  2IP2 A;  2W25 A;  3B02 A;  3R60 A;  4IRI A;  4EM1 A;  2XRO A;  2XHK A;  2HDC A;  1Q1H A;  1K78 B;  4GYI A;  2A5Y B;  3E6B A;  5HDK A;  2VE9 A;  2XAS A;  4I0A A;  4EVI A;  5DCM A;  4BQA A;  4M6Y A;  2DFI A;  4EMS A;  3ELK A;  1IAW A;  2QBY B;  3R6S A;  3CJN A;  4JQF A;  3EYY A;  4KUM A;  3S2W A;  4RB0 A;  1ZLK A;  2XUB A;  4D0P A;  4A0Y A;  5L3E A;  4HLX A;  1P4W A;  2ZJ2 A;  1BN5 A;  2EA2 A;  1U2W A;  4ZYG A;  1FSE A;  3SHF A;  1R5G A;  1FBU A;  1FX7 A;  4HF0 A;  5DD4 A;  2WV0 A;  5ERI A;  2P5K A;  3U2R A;  3K9T A;  5H6Q A;  1E17 A;  2P6T A;  4M71 A;  2VE8 A;  4L0Y B;  1FC3 A;  2FE3 A;  3GEZ A;  1L0O C;  1FBS A;  1GXQ A;  2ISZ A;  1GHC A;  1SFX A;  2Z9O A;  1IUY A;  3GX4 X;  2ADU A;  4XLN F;  4IF4 A;  4ESB A;  3P9I A;  3KP2 A;  2DQL A;  5JFR A;  3KCC A;  4ZYH A;  4NQW A;  4KNY A;  2DI3 A;  3JAM K;  6PAX A;  2ZME B;  4EJV A;  2B0L A;  5LGU A;  5E18 F;  1QZY A;  5L3D A;  2DPD A;  3F8B A;  1RI7 A;  1B9M A;  3T8R A;  3GYH X;  4MTE A;  1J2X A;  3OOP A;  4G6Q A;  3KLN A;  2XVC A;  3QRF F;  3GFL A;  4MEY F;  2ISY A;  1XN7 A;  2IA1 A;  2VC0 A;  1T2K A;  2JZY A;  1WQ2 A;  2OZ6 A;  5ILS A;  3ZPL A;  2O8X A;  4AVP A;  1S8N A;  3TO6 A;  3E5X A;  4FX0 A;  5D6F A;  4ETS A;  1OKR A;  4PGG A;  4ASN A;  2GIV A;  2P4W A;  5BS6 A;  4M9X A;  1JXS A;  1XDU A;  1OPC A;  2XAF A;  3JW4 A;  4OIR F;  2GA2 A;  3QOP A;  2J5O A;  2XKO A;  3VB2 A;  1ZH5 A;  3E3V A;  4MQ9 F;  3L09 A;  1S7O A;  1KYZ A;  4B8X A;  3REO A;  1P4X A;  2VT2 A;  1KQ0 A;  2F5D A;  2IJL A;  3RPQ A;  1U6G A;  1UB9 A;  2L4A A;  1SAX A;  4YFX F;  4BH9 A;  1YQA A;  3F21 A;  2EWN A;  2VOD A;  4IHT A;  4UUV A;  2VN2 A;  3R61 A;  3EET A;  3B73 A;  4L9N A;  2IPQ X;  3SQN A;  2FMY A;  3MFK A;  2GWR A;  1O3R A;  3F3X A;  1FT9 A;  3WU1 B;  1IZ1 A;  1I5Z A;  4UHT A;  5JI6 A;  2XV4 S;  2RDP A;  4AD9 A;  1D5V A;  2RNJ A;  3GUD A;  4OOI A;  4G6D A;  2STT A;  2AS5 F;  2ZCW A;  2JPB A;  2HKO A;  4NB5 A;  3HSF A;  5CYV A;  1BM9 A;  2R3S A;  5A2Q Z;  3DF8 A;  3O2P E;  1UFM A;  1USS A;  2MH9 A;  3VOE A;  3ZMS A;  2MLG A;  3DPT A;  2HKX A;  2XRN A;  4WXC A;  3CUQ A;  4RAY A;  2OA4 A;  3FXU A;  1ONV A;  2DW4 A;  1XSX A;  2L54 A;  4AWX B;  3C7J A;  1Z91 A;  1ZN2 A;  1YG2 A;  3PFI A;  1R58 A;  3V4G A;  3O6B B;  1XGS A;  3N97 A;  3TKY A;  1ULY A;  1IXR C;  3CUO A;  1RUO A;  2F2E A;  3HHG A;  4WXD A;  2H94 A;  1H9G A;  4B09 A;  2HS5 A;  4ENM A;  2O03 A;  1YLF A;  2A69 F;  1G4D A;  2HYG D;  1R5H A;  4LG0 A;  2P8T A;  1V3F A;  1O7L A;  2LDU A;  1NHA A;  4HQM A;  3TDU C;  4ON0 A;  5D6E A;  2KRF A;  4FHT A;  1FBQ A;  4BHP A;  2PN6 A;  4I7H A;  1D8J A;  2OD5 A;  3WU0 A;  5BOX A;  2VBX A;  2Y48 A;  1HW1 A;  2E1C A;  4A2U A;  4RAZ A;  5H6R A;  4G94 A;  3BZ6 A;  1OYI A;  3CUQ C;  2HFH A;  3TQN A;  4RGX A;  2HR3 A;  1B9N A;  5AON A;  1EH7 A;  3MEX A;  3ZQ7 A;  2A61 A;  2DT5 A;  4Q48 A;  3HOS A;  2BE5 F;  1D8K A;  3J81 Z;  3C1D A;  1KQ9 A;  5EEG A;  1SMT A;  4A12 A;  1GVJ A;  2GQQ A;  1SD4 A;  2M1B A;  4P9F A;  1ZRE A;  4O6J A;  3T1B A;  3WTS C;  4CZZ A;  1O3Q A;  1YS7 A;  2XIG A;  4IJA A;  3VEP A;  5ICG A;  3G73 A;  4I0B A;  3BOQ A;  1U5T A;  2J5P A;  1ZGJ A;  4P5O A;  1REP C;  5F1R A;  4RB2 C;  1K6O A;  1FP2 A;  4HAM A;  3WTU C;  1BC7 C;  3RYP A;  2FXA A;  2M5W A;  3ZN1 A;  2X4H A;  1XGM A;  3RDI A;  1ZLJ A;  2PLY A;  3CO7 C;  4M9S A;  5KK1 A;  2HTS A;  4G7H F;  2A3S A;  4CHU A;  3LST A;  3SXY A;  1A04 A;  4LLL A;  5DCM B;  1H9T A;  3ZMT A;  4HLY A;  3R0A A;  5ICC A;  1W7P A;  3GFM A;  3IHU A;  1KU9 A;  4FT8 A;  3EQL F;  2ACJ A;  2KKO A;  1WSU A;  3CLO A;  5BQT A;  4UNO A;  4BYY A;  3HHH A;  1TLH B;  1MJA A;  2V1D A;  2OQG A;  2RQP A;  4KYW A;  1MKM A;  5ILU A;  2F5E A;  3CDH A;  4LLG F;  3GFJ A;  1ZG1 A;  1EH8 A;  4YFN F;  3I5U A;  4I09 A;  3FM3 A;  1R7J A;  1HKS A;  3HUG A;  1U5T C;  1MJ9 A;  3FWE A;  3WGG A;  4EJO A;  2OAZ A;  3FM5 A;  3PQK A;  3M8F A;  3ECO A;  3F22 A;  5LHI A;  3BPX A;  1HW5 A;  4EGZ A;  1G3W A;  3TGN A;  1G3S A;  3K2Z A;  2D45 A;  2D1H A;  3TOB A;  4ZZD A;  4GO1 A;  2W24 A;  2X0L A;  3WTT C;  2FF4 A;  2CWE A;  5E8G A;  2LF8 A;  2RGV A;  3F6V A;  3RJP A;  4ZH4 F;  3T5X A;  3IRQ A;  3KET A;  2DO7 A;  3GFI A;  4GXO A;  2VT3 A;  1DPU A;  3WTY C;  1DP7 P;  1F1Z A;  1BI3 A;  2VOP A;  3E6M A;  4L5J A;  4A6D A;  5JHU A;  1KYW A;  3MAJ A;  3NQO A;  1FSH A;  4R8H A;  5J8C A;  2Z3Y A;  4KIB A;  3E5Q A;  4HYE A;  3NEU A;  5LRR A;  3I4P A;  2JT1 A;  4A5M A;  3QPT A;  2IT0 A;  1QPM A;  2QEN A;  3V8L A;  1EH6 A;  5CVJ A;  5IT9 K;  4L9J A;  1IN6 A;  3KEQ A;  1O3S A;  2FBK A;  1T38 A;  2KJC A;  2V1X A;  2ZKZ A;  1B6A A;  5BPI A;  1JE8 A;  1P92 A;  1IXC A;  4HOB A;  2QZ8 A;  2FBI A;  2E1N A;  4Y15 A;  4LMY A;  3GZ6 A;  1G3Y A;  5KVR A;  2Y0M A;  2Z99 A;  2EFN A;  3DKW A;  4A0X A;  5D5U B;  3T8T A;  2P5L C;  3E5U A;  4MHG A;  5AIP A;  5FFX A;  4HZF A;  1ZGA A;  1P6R A;  3RI4 A;  2VBY A;  3VOD A;  2ELH A;  3FMQ A;  4UXN A;  5HVQ C;  4EGY A;  1BOA A;  1FP1 D;  2MC3 A;  4JBA A;  2Z33 A;  1YTY A;  1Z7U A;  4IRH A;  3W6K B;  1UHW A;  2CFX A;  3HYI A;  5F6F A;  3WTV C;  3J80 K;  1K78 A;  3QU6 A;  3HSE A;  4HF1 A;  1O57 A;  3FHZ A;  1UHM A;  4TV7 A;  4HV6 A;  1J75 A;  3CUQ B;  4AIH A;  5CVR A;  2OBP A;  5HS7 A;  4CXF A;  5DYM A;  4AIK A;  1OR7 A;  3VFZ A;  2QBY A;  1IN7 A;  2ZO4 A;  3HRM A;  4CGZ A;  1BI0 A;  1BI2 A;  2IA2 A;  4Z2Y A;  5D4R A;  3KFW X;  2JSC A;  1LDK B;  5DD8 A;  3DFG A;  1LDJ A;  4QWQ A;  2HWV A;  1RZ4 A;  3EYI A;  3CTA A;  3QP5 A;  2QWW A;  2VON A;  3E6C C;  3KP6 A;  3KLO A;  1TTY A;  2EV0 A;  2QQB A;  3IWZ A;  3DEU A;  4OIP F;  2DBB A;  4CYD A;  4LG0 B;  1BI1 A;  2QYO A;  3COA C;  4XSX F;  2CW0 F;  1XDS A;  3R0J A;  5LHH A;  1W4M A;  5BMZ A;  4LK1 F;  1G3T A;  2EFQ A;  2L4M A;  1BC8 C;  4BHC A;  3LFK A;  2PFB A;  3GXO A;  2IW5 A;  3FXR A;  3ZMU A;  4P55 A;  2DK8 A;  1TW2 A;  2ZME A;  3U1D A;  4A5N A;  1GXP A;  3ZMV A;  4KFC A;  2JTV A;  1BJA A;  2MD5 A;  3WTW C;  3G3Z A;  1CF7 B;  2ZXJ A;  3HSR A;  2ETH A;  1Z1D A;  2MH2 A;  4R1H A;  1UST A;  5K5O A;  4U0W A;  2YX7 A;  3RPU A;  3F8F A;  4HV5 A;  4Y13 A;  2EFP A;  3IC7 A;  3F8N A;  4Q4Z F;  1HKT A;  4RGS A;  2E7X A;  1BIB A;  4ESJ A;  3Q9V A;  4GCV A;  1J5Y A;  5FFZ A;  2HEO A;  2L01 A;  5D5X B;  1U5T B;  3FX3 A;  1XD7 A;  2ESH A;  3ZMZ A;  3R4K A;  5HDN A;  3TOA A;  3U9G A;  5CLS A;  5J8F A;  1L3L A;  3F6O A;  1PDN C;  5E20 A;  1IN4 A;  3GZ5 A;  1DUX C;  2KIM A;  4S04 A;  1MDM B;  1J7K A;  3GW2 A;  3RTR A;  1LDD A;  4CDG A;  2M87 A;  2XAJ A;  1SD5 A;  1YO5 C;  1MGT A;  4EJU A;  4F7Z A;  1YYV A;  2PG4 A;  2WTE A;  1YW8 A;  2KJB A;  4N9I A;  2Q0O A;  2YSR A;  3E97 A;  4KN4 X;  2VXZ A;  5CVI A;  4PGH A;  4QLC U;  1G6N A;  2QQ9 A;  2P7V B;  2Y75 A;  5AIQ A;  4OMY A;  1W7P B;  2Q2E A;  5FLX K;  3I54 A;  3ROU A;  4ZZL A;  4M9Z A;  2HOE A;  5FGM A;  2YU3 A;  5HLH A;  3C3W A;  4FX4 A;  5TJJ A;  2QLZ A;  3FXQ A; 
#chains in the Genus database with same CATH topology
 2L02 A;  3CCU I;  4XKC A;  2W1O A;  1A31 A;  4G9Y A;  1T6S A;  1AOY A;  1R1T A;  3CF5 F;  5B5E C;  1QBJ A;  1EF4 A;  4C2T A;  3CCV I;  1D3Y A;  2JN6 A;  3ECH A;  3FMR A;  1B4A A;  2BHZ A;  2FUG 2;  3I59 B;  4JP0 A;  2R7V A;  2NXN B;  2HOA A;  2IEK A;  4M6X A;  4YII A;  5ICF A;  1XCB A;  4OIN F;  2JRM A;  1J59 A;  4YG2 F;  2D1V A;  1IDZ A;  3MWM A;  2DDA A;  5FLV A;  4CCM A;  4BBS J;  2JUG A;  3Q9S A;  2F48 A;  2JA8 J;  5JLX A;  3ZP5 A;  2MC4 A;  5LGT A;  4DJA A;  3AG3 H;  5FRO A;  1FYK A;  4ZYE A;  2P5V A;  3A02 A;  1ERD A;  1B59 A;  4A3C J;  2EJR A;  3OOU A;  3PNV A;  1YOV B;  3N4M A;  2PI0 A;  4KIT B;  2B7E A;  2BY2 A;  2CRG A;  3OR1 C;  1FPQ A;  3DBH B;  5EGO B;  2DA5 A;  1SC7 A;  3S1N J;  4WX9 A;  3WHC A;  2R7X A;  3JRG A;  2ZFW A;  1XC5 A;  2O3F A;  2JA2 A;  4DIQ A;  2X9D A;  2R7R A;  2VOO A;  2BGC A;  1JI8 A;  3W2V A;  2DOD A;  5ICE A;  3TED A;  1D0Y A;  1WI9 A;  3WTZ A;  4WF2 A;  1YS6 A;  1M1E B;  4CO8 A;  1ZYR F;  3I3L A;  4LB6 B;  4HSR A;  5TRD A;  1AU7 A;  3ABU A;  1KGS A;  4RDU A;  5C44 J;  1FWZ A;  1QU3 A;  3T0Y A;  3F72 A;  5C4J J;  5FD5 A;  1ETW A;  1OFC X;  2L3D A;  2GXB A;  3CCJ I;  1OYY A;  1K83 J;  1ODD A;  4EAT A;  1BA5 A;  3CJT B;  1WRJ A;  3LWF A;  1DDN A;  3Q0W A;  4C3I J;  4UVB A;  2OU2 A;  2L7Z A;  2X85 A;  5KAI C;  1TQI A;  3Q0U A;  2KP6 A;  2O7O A;  1TNS A;  3X2Q H;  5F04 A;  3DPU A;  1S6L A;  1RNL A;  1V4R A;  1X1P A;  3OSF A;  1QGP A;  2UXN A;  3FKJ A;  1ZQ3 P;  1BW6 A;  1JGG A;  2V9V A;  1FJL A;  2LK2 A;  5HOO A;  3HOW J;  1WCM J;  3LA7 A;  3MKY B;  4M3D A;  2O9L A;  5CJ9 A;  4KMU X;  4JK1 X;  1PUF A;  4C2U A;  2LY1 A;  1YI2 I;  1R00 A;  3JCU C;  2HVQ A;  2CQ7 A;  1I3Q J;  4PSX A;  2XAG A;  1IW7 F;  2Y0S A;  2W48 A;  2VJJ A;  1VQ5 I;  1E3H A;  4ZYA A;  4EJW A;  1VZ0 A;  1Z6R A;  3FBN B;  3S3N A;  2KZG A;  2EFO A;  4MTD A;  1K7A A;  3BP8 A;  1UHS A;  2JSP A;  4I76 A;  4K2E A;  3F8C A;  1X3W B;  2QUF A;  3H92 A;  1E2X A;  1ACI A;  4G7O F;  2BW3 A;  1QVU A;  1XB4 A;  5ILV A;  4IQ4 A;  2W57 A;  2YR2 A;  2JWT A;  3M7G A;  3OL3 A;  2QCO A;  1VQP I;  1VQ8 I;  3CMA I;  1ZRC A;  2VBZ A;  2Y9Y A;  4L9T A;  2L9V A;  1XS9 A;  1Y8R B;  5F08 A;  1R1U A;  2K86 A;  4ENK A;  1XX5 A;  3HTU A;  2O6G E;  1BIA A;  1P9Q C;  2W85 A;  1TWC J;  2O61 A;  1NH3 A;  3PUF A;  1JHF A;  2E1O A;  4B1R A;  1ETX A;  1Z05 A;  2O0Y A;  3PIO F;  5EDN A;  2VUM J;  2GIZ A;  1EKE A;  2OQR A;  2YS9 A;  2PJP A;  1OCR H;  3I0T A;  3QAH A;  2JUC A;  3GTK J;  2YUS A;  1HQC A;  2VJ4 A;  4XKB A;  3OIO A;  4B4C A;  2V6E A;  2H09 A;  1Z21 A;  4RA2 A;  1TWG J;  3TO9 A;  1ETV A;  1W1W E;  4R79 A;  3MQ0 A;  2QVO A;  1AKH B;  1IN5 A;  1HST A;  3RKX A;  3V8J A;  5D5W B;  3HEF A;  2EB7 A;  2R7Q A;  3O3K A;  3O8G A;  3CLQ A;  2ECC A;  1ON2 A;  2CG4 A;  3DTK A;  1I27 A;  5L3C A;  1H88 C;  1A6Q A;  2EV6 A;  3BJA A;  3ULQ B;  1W5T A;  1E3P A;  2FA5 A;  3KEO A;  4X6A J;  4M72 A;  1PP7 U;  2Q8K A;  1OCP A;  1LVA A;  2I5U A;  3KE2 A;  5GTH C;  3W3C A;  3QPH A;  2CJJ A;  3U21 A;  2DYS H;  3JTH A;  4NQW B;  2ZC2 A;  1KON A;  2COM A;  2CQQ A;  2LG4 A;  3K69 A;  1KQ8 A;  2E1M B;  2HQR A;  3AL0 B;  4FAS D;  2R7W A;  4BXU A;  1XCV A;  3HB9 A;  1Y39 A;  4A3B J;  1R5I D;  4LK0 F;  1F4K A;  1W0T A;  2FOK A;  2M8G X;  1VQ9 I;  2GXG A;  2LLK A;  4XM3 A;  1W5S A;  1Y6I A;  4E7J A;  1OCT C;  5IPA A;  1FLI A;  4GYG A;  2P6S A;  3EDP A;  1PVE A;  2XRL A;  2M0M A;  4BAC A;  4BXX J;  1MSE C;  3OYB A;  1BBY A;  1S5L C;  3LMM A;  4IHW A;  3QQA A;  3WGI A;  1YW7 A;  3OL4 A;  1K79 A;  1ZGW A;  3UNG C;  1YJN I;  3OYF A;  1WJE A;  2RQQ A;  2LBF B;  3SFI A;  1LNW A;  3ML6 A;  3S16 J;  5E1Z B;  4WCG A;  2VPL A;  2HXI A;  1IJW C;  1MZB A;  3L7W A;  3VYT B;  2DXI A;  1HW2 A;  1FOW A;  4U7D A;  2FEZ A;  2DMU A;  1S7E A;  3CF2 A;  4NDL A;  3RQ4 A;  3G4S I;  2E19 A;  4KIG A;  2FBH A;  1P4A A;  3BY6 A;  3MZ8 A;  4RLF A;  3WG9 A;  3BR5 A;  4EJT A;  3S1Q J;  4IHX A;  3DXJ F;  3DV8 A;  1P2F A;  4OAZ A;  1FZP B;  3LSG A;  2GA1 A;  2F4I A;  2IGK A;  4KJZ A;  3MZH A;  1IRF A;  3I71 A;  1MBJ A;  1TWF J;  3DU5 A;  5GPA A;  4D7N A;  1MJB A;  2GZW A;  2WY8 Q;  2D2W A;  2XGX A;  5IYC J;  2BY1 A;  2KRC A;  3TO7 A;  4XLP F;  3LQR A;  2HGC A;  3JRD A;  2F6C A;  4XSZ F;  4EM2 A;  2IGM A;  4IRG A;  5D4S A;  4A3I J;  4MGR A;  4BAY A;  3E6D A;  3K0L A;  1JT6 A;  1RRJ A;  2RN7 A;  2ZNZ A;  2V6C A;  2VIX A;  1B1B A;  3V7R A;  1O4X A;  2X51 A;  1FYL A;  3F8M A;  5DDG A;  1TQM A;  5DCF A;  1LKX A;  2H6B A;  1LVK A;  2CO5 A;  2VPR A;  4HQE A;  4M73 A;  1WJB A;  1F9N A;  1KA8 A;  4DYQ A;  2LOO A;  5FB2 A;  1XPX A;  5DV5 A;  2DQR A;  2JJ7 A;  3V7C A;  4IX7 A;  2HQN A;  2CFO A;  2HYF A;  3BDD A;  3RZD J;  2FSW A;  5HOD A;  1CGP A;  5LBQ A;  4UB6 C;  4A0Z A;  5H20 A;  3OIQ A;  2QM3 A;  4QPQ A;  2HQ5 A;  1XSV A;  1WH7 A;  3HOT A;  1LFB A;  3OMY A;  2NS0 A;  4UV9 A;  2X6W A;  3AKZ A;  1SVO A;  4XN0 A;  1Z9C A;  3PNT A;  2WWY A;  2K02 A;  2A68 F;  4I02 A;  4UV8 A;  5K7F A;  4M3G A;  2NOG A;  2PQ8 A;  2E5N A;  5D8L B;  3HKZ N;  1LEB A;  1QZZ A;  2E71 A;  5D5V B;  1X3U A;  4A3M J;  3CCR I;  4NHJ A;  4L9V A;  2R7Z J;  3BR2 A;  2HTJ A;  5LGN A;  1BL0 A;  5FD6 A;  2DT6 A;  3WG7 H;  5C3E J;  1DQU A;  5F64 A;  2H27 A;  5HLI A;  1ZG5 A;  4P9U A;  1JKO C;  2NNY A;  3IH4 A;  2CUJ A;  3RYR A;  3DQV C;  3OYD A;  1FOK A;  1JJ8 C;  5LEK A;  5JR3 A;  3MD2 A;  3H0G J;  4DYC A;  1MW7 A;  5F0F A;  3GO5 A;  4F55 A;  2CV1 A;  3FKI J;  1H0M A;  1YIO A;  3GTM J;  1Y1V J;  2DAO A;  2BBY A;  1YW9 A;  4PSW A;  2R93 J;  2HDD A;  3ZQL A;  2M34 A;  3LA2 A;  3OV8 A;  4G8X A;  4EQQ A;  4F93 B;  5A2Q K;  3GF2 A;  3W2A A;  3LSJ A;  2Y31 A;  3IKV A;  2E34 A;  3D5S C;  3PO3 J;  2L2O A;  3GVA A;  2HVR A;  3GLX A;  4DNC A;  3D5R C;  2E2I J;  3CCQ I;  1VQL I;  3HIF A;  1F43 A;  3AG4 H;  3CO6 C;  2QSF X;  4HX7 A;  4RGU A;  2CW7 A;  1MH4 A;  2K7L A;  2K5C A;  3SZP A;  1Y0U A;  1A36 A;  2AQE A;  2BVM A;  4G7Z F;  5LRS A;  3TBI A;  1AWC A;  2WY7 Q;  3S14 J;  1OQY A;  1U0J A;  3KZY A;  2OJE D;  2Y69 H;  1F5T A;  1FY7 A;  2KIQ A;  4AUX A;  1T39 A;  2EZL A;  3D0S A;  5J4V A;  4Y17 A;  1ETY A;  2P7C B;  3NRV A;  4OAY A;  3K10 A;  4I2O A;  1JGS A;  2CGP A;  1W5C C;  2F5F A;  4ENN A;  2EZH A;  2QGU A;  2UZK A;  2FU4 A;  2KIF A;  4HDU A;  2NAZ A;  1ZRF A;  3BG9 A;  3P7N A;  1IO2 A;  4Y33 A;  1HXD A;  3SFZ A;  5E8I A;  1G2H A;  1J0R A;  2F5C A;  4QSH A;  1TWA J;  1UZC A;  2PEX A;  4B48 A;  5F27 A;  1ORK A;  2WBM A;  1HSJ A;  3IL2 A;  1K6Y A;  3QU3 A;  3ZOB A;  3L1P A;  1FYM A;  5J4Y A;  1S3J A;  1T98 A;  2R5Z B;  4I01 A;  3RIR A;  2CV2 A;  2HZT A;  5IT9 Z;  2X1E A;  1YFH A;  3K1M A;  5EG0 B;  3BR1 A;  3S15 J;  2EK5 A;  5K5Q A;  2KPM A;  3M1E A;  3HG9 A;  2M30 A;  3JTG A;  4J00 A;  2RKH A;  4P96 A;  1R6R A;  3I58 A;  5FKM A;  3BWG A;  1T0F A;  3H3V K;  4LJZ F;  1JUS A;  5FO5 A;  5GTI C;  4E7S A;  2ESN A;  3N05 A;  2ZB9 A;  2W84 A;  2PMU A;  1OYW A;  4CCO A;  1DGW Y;  2WC2 A;  4HX8 A;  1WPK A;  4WXH A;  1KU7 A;  2BYV E;  1SFU A;  2L9S A;  1WWX A;  3BT9 A;  3WOD F;  1B72 B;  2RV8 A;  2M8E A;  2K3F A;  3AFH A;  3RKY A;  2R7F A;  3F9K A;  5BPD A;  4XN3 A;  2GM4 A;  3I64 A;  2XGE A;  1HC8 A;  2G7H A;  3JAM Z;  4DQ2 A;  1JHH A;  3KYC B;  2CSO A;  5DUK A;  3I4N J;  1MBH A;  2AXL A;  2K3P A;  5HDG A;  3ZN0 A;  2DU9 A;  2EIN H;  4U0Y A;  4KT5 C;  3FHN A;  2VBW A;  3CCL I;  3G1O A;  2JQ7 A;  3A0B C;  4ZDO A;  3IUO A;  4RB1 A;  1WI3 A;  3WE2 A;  2E7W A;  5DS9 A;  3IV5 A;  1OR7 C;  3HKZ A;  1IC8 A;  2Y9Z A;  1IDY A;  5FKO A;  4OIO F;  1WKM A;  2XAH A;  5J6X A;  2LNB A;  3KP7 A;  3EUH A;  4HNU A;  2PBI A;  2QQA A;  4NC8 A;  1SD6 A;  3W6J B;  4BNC A;  1RET A;  5ED4 A;  1DPR A;  5CVV A;  3H9G A;  4LOC A;  3HGY A;  3DLL F;  2L5Q A;  1XMK A;  4UY8 I;  3BRO A;  3J81 K;  3AAF A;  3IRR A;  3J80 Z;  1NTC A;  2JMW A;  2CQK A;  3KP3 A;  1UG0 A;  1VQ4 I;  2LYC A;  2LKS A;  3BR3 A;  3CP2 A;  4HA8 A;  4XLA A;  4HDV A;  3ZQQ A;  5JVT A;  3D5L A;  3SZT A;  4UVA A;  3C2H A;  2KL4 A;  2XKP A;  4BQN A;  3OYG A;  3ABK H;  4LD5 A;  3HRT A;  2VLA A;  1LQ1 A;  3HOZ J;  2AXT C;  5L3F A;  4RS8 A;  4BQQ A;  4XOP A;  2R7D A;  3V8K A;  1WJD A;  1GV2 A;  3FK7 A;  5IP6 A;  1C0W A;  4XLH A;  3WGH A;  1X2M A;  3PO2 J;  1QQI A;  1U3E M;  4I98 B;  4HG2 A;  4F52 A;  2M4G A;  2KT0 A;  2GAU A;  1STZ A;  2EV5 A;  3DEW A;  1TL8 A;  1WJF A;  4EV0 A;  4BY7 J;  1HKQ A;  3Q5F A;  1D1B A;  3CD6 I;  4XBF A;  4WWC A;  2MW8 A;  1RR8 C;  2LY9 A;  2A6T A;  2K9M A;  4M74 A;  3LAJ A;  1GLN A;  1FTT A;  5B1A H;  2STW A;  2CYY A;  4MFD A;  1YX5 A;  1ZHF A;  2K27 A;  4S05 A;  4LGW A;  4PCQ A;  1IRG A;  1V55 H;  4ZDP A;  4MNU A;  4UVC A;  4RBO A;  3MVP A;  1JJ6 C;  2H1K A;  4OU0 A;  2DMN A;  3BTC A;  2LRD A;  1R36 A;  2OCC H;  2WAF A;  1X1A A;  2FNA A;  4B3X A;  1TBX A;  4PDK A;  3HRU A;  3K70 C;  4J01 A;  5FJ8 J;  2A6E F;  2DTZ A;  3RKQ A;  4YRV A;  1W7P D;  2EZK A;  4U88 A;  3DKY A;  3ZGK A;  2A6H F;  2FML A;  2RC4 A;  5CQG A;  4MEX F;  3LSK A;  4HX4 A;  5D8K B;  5GAH J;  1SVM A;  2CV0 A;  2YU9 J;  3L2C A;  4HBL A;  5E17 F;  1UAA A;  2ZME C;  1XGO A;  1Z6T A;  3QYF A;  4NNJ A;  5E1X A;  1YJ9 I;  4L5I A;  2JA7 J;  2H6C A;  4LB5 A;  1E0E A;  1TW3 A;  1W0U A;  1LJ9 A;  3K1N A;  4MQV A;  4A6E A;  3K1P A;  3S1R J;  3RKW A;  5HS8 A;  1IF1 A;  4BJ5 C;  1S7A A;  3BJO A;  3MCZ A;  1TT0 A;  4JYK A;  4LG3 A;  4C2M J;  3EUH C;  2UXX A;  2TDX A;  4UUS A;  5FLM J;  3CDL A;  3O8H A;  3PL8 A;  3QYB A;  1P7J A;  2B9S A;  4H4K C;  4XK4 A;  3F23 A;  2ZJQ F;  2KQR A;  3TDZ C;  3JRH A;  2JA5 J;  2DMQ A;  2DLL A;  2WAQ N;  1F36 A;  1T95 A;  2UWM A;  2BW3 B;  1XMA A;  1O3T A;  1FNN A;  3DPL C;  5IP9 J;  2BV6 A;  3GTQ J;  5K1Y A;  2FNP A;  5EJC A;  1EV7 A;  2ZNY A;  4AYB N;  4XRF A;  1TWH J;  2VQC A;  3QP6 A;  4C3H J;  1R22 A;  3H5N A;  5HS9 A;  4OIQ F;  1SFE A;  2VKV A;  3HUG B;  5E1W A;  1R71 A;  2G7U A;  4OMZ A;  1U8R A;  1HDD C;  2K9N A;  4AIJ A;  1S29 A;  4ESF A;  4N0B A;  5K5R A;  2EA4 A;  4E70 A;  1B8I A;  2W82 A;  1LB2 A;  2RVC A;  1W36 C;  1CF7 A;  3TW7 A;  3WE3 A;  5HLG A;  3H3U A;  4BS9 A;  2FX0 A;  4BHB A;  1I1S A;  5M5X J;  3A01 A;  1JUP A;  3FF5 A;  1ZG3 A;  5IT3 A;  1RIO H;  2XAQ A;  3LA3 A;  3P9C A;  3LQQ A;  3ZQC A;  5DEQ A;  1R23 A;  3I53 A;  1IV6 A;  1ZRD A;  1ETQ A;  2NNN A;  1KZH A;  4YIF A;  4V19 K;  2XGD A;  3SZG A;  1D0Z A;  9ANT A;  3AG1 H;  1VTN C;  1QNT A;  3UR3 C;  1GUU A;  3DP7 A;  4U7B A;  3M8E A;  1TC3 C;  3OS1 A;  3P9K A;  1MH3 A;  5EEH A;  2QSG X;  2CQX A;  4DBR A;  1WJA A;  4ZYD A;  4B44 A;  4KA4 A;  1IXS B;  4GFB A;  2KZV A;  2YPR A;  5K7Z A;  4E7H A;  3OYC A;  2L7M P;  2Z1D A;  4DBQ A;  1T08 B;  2W4S A;  4F3Q A;  4E7K A;  2LD5 A;  4Q5S F;  4GGG A;  1O7F A;  4HF2 A;  2FRH A;  2EFW A;  1I1G A;  4IPA A;  2IVM A;  4DW6 A;  4B47 A;  2YX4 A;  1X2N A;  2K4B A;  4BKX A;  3M4O J;  1PUE E;  4GDF A;  5L3G A;  3L2Q A;  5E3M A;  2LKP A;  1OCZ H;  3IWF A;  2JPC A;  4CIC A;  3CC2 I;  3J7A O;  2IRF G;  3KP5 A;  4KN7 X;  3EUA A;  4KMF A;  1I39 A;  4IXA A;  2V9K A;  4U0V A;  4C9Y A;  1ZAR A;  3ABM H;  3M07 A;  3M9A A;  4BBR J;  2OZU A;  2E36 A;  4OWR B;  1MDM A;  2WV1 A;  2IS2 A;  5IYB J;  1ON1 A;  3J7Z I;  2JRT A;  1ZEL A;  2V79 A;  4Q47 A;  4ZDL A;  1MD0 A;  1UG2 A;  2R5Y A;  3HRS A;  4CZC A;  4YIR X;  4IHS A;  1GVD A;  3K4C A;  4KIC A;  5DUI A;  1PP8 F;  3V7S A;  3DTE A;  4RB3 C;  4E7I A;  1QO0 D;  2MLK A;  1WGX A;  4O5V A;  4BU2 A;  2EH3 A;  4W1U A;  2KIS A;  4EM0 B;  2V1U A;  3L00 A;  2MA3 A;  4BE2 A;  5TGT A;  3H36 A;  4BEH B;  4MLO A;  2LMD A;  4PZJ A;  5FLX Z;  4N9H A;  2M45 A;  2EIK H;  2ZBK A;  2IAI A;  2LF7 A;  3PFY A;  4WK8 F;  4A93 J;  2BEO A;  4PJM A;  2VKH A;  2LTP A;  3ISP A;  1SEU A;  4KDP A;  2K4J A;  4PJL A;  1R1V A;  3M8J A;  4BJT A;  3OS2 A;  3JSO A;  3C18 A;  4B3A A;  4H0E A;  2ECB A;  3KZZ A;  2QA4 I;  2DOE A;  2DPU A;  1SMY F;  3A4C A;  5CKT A;  5LEJ A;  2G9W A;  2LSO A;  4ENJ A;  1LFU P;  3LNQ A;  1YIJ I;  4LLN A;  2DK5 A;  3OR2 C;  1VQ7 I;  4O3M A;  3HTS B;  3LSI A;  2HDW A;  5LHG A;  4Y4R A;  1HBX G;  4RAF A;  1XGN A;  3I59 A;  4RGR A;  1OMI A;  2ZSI B;  3FZV A;  3GWZ A;  4LFU A;  3ERE D;  5M3F J;  3ZQF A;  1U78 A;  4L18 B;  4II2 A;  4Y3O A;  2DTR A;  2WAQ A;  3LSP A;  3K6G A;  4L0Z B;  3JSP A;  1D1C A;  1FEX A;  1JKP C;  5J1U A;  2VKD A;  3E0J B;  3ZMD A;  2LC2 A;  4AYB A;  2WA0 A;  3H3Z A;  1FMV A;  4XL9 A;  5F0C A;  2MBF A;  3KYL A;  1G59 A;  3FDY A;  2KIU A;  4A3L J;  4ITV A;  2NYX A;  3MZY A;  3WTX C;  3K4L A;  3BJ6 A;  3L9F A;  2CW8 A;  1N75 A;  2LRE A;  1A35 A;  1RR7 A;  2HYJ A;  4KIF A;  2IA0 A;  1RUN A;  2A07 F;  4CCL A;  1SD7 A;  3L2R A;  2NRA C;  3FMS A;  3A03 A;  3KP4 A;  4HNV A;  2VC1 A;  1IRX A;  3PQJ A;  2FQ3 A;  4HW0 A;  4YFK F;  1XSD A;  2C6Y A;  1KU2 A;  1FOX A;  1UCR A;  1IN8 A;  3GZN B;  5L3B A;  2PMH A;  3RQI A;  5GP9 A;  5IOZ A;  1TNT A;  4XLC A;  1KU3 A;  5GAG J;  1TQP A;  3HXL A;  3BPV A;  2GLO A;  2IS1 A;  1X3Z B;  3DU6 A;  3KYD B;  5CVU A;  3IKT A;  2DDB A;  3ABT A;  4CH7 A;  4II3 A;  5LLQ A;  3ONQ A;  3S2H J;  1I6X A;  2QEX I;  1DP3 A;  2Z5U A;  4IVN A;  4BL0 B;  3MKL A;  1ZAO A;  3BR0 A;  1YX3 A;  3IH2 A;  1LEA A;  2AHQ A;  3CP8 A;  1J9I A;  3LAP A;  1RC9 A;  2IP2 A;  3G6E I;  2W25 A;  3B02 A;  3R60 A;  4PJN A;  4IRI A;  4EM1 A;  2XRO A;  2BY3 A;  2XHK A;  4IZZ A;  2M4K A;  4BDZ A;  2HDC A;  1Q1H A;  1NG6 A;  1YRN B;  1WH5 A;  1K78 B;  4GYI A;  5FKK A;  2BY0 A;  2A5Y B;  3E6B A;  1OIS A;  5HDK A;  2XAS A;  2VE9 A;  4I0A A;  4EVI A;  2XC7 A;  4E6K G;  1N77 A;  5DCM A;  4BQA A;  2UUZ A;  3OIP A;  5H2F C;  4M6Y A;  2DFI A;  1T33 A;  1OLT A;  2M0C A;  2O8K A;  1WFX A;  3FK6 A;  1RPW A;  4EMS A;  3ELK A;  1IAW A;  3K2A A;  2QBY B;  2EIJ H;  3R6S A;  2DFE A;  1ZR2 A;  3HOX J;  3CJN A;  4JQF A;  3EYY A;  2DYR H;  2LH9 A;  4KUM A;  1RKT A;  3M1C A;  4ZTJ A;  3DCF A;  3I4M J;  3S2W A;  1J09 A;  4RB0 A;  5F0H A;  1ZLK A;  3TW6 A;  2XUB A;  1ZR4 A;  4S0H B;  4D0P A;  4A0Y A;  5L3E A;  2IXS A;  2BVL A;  2M2E A;  5B66 C;  1SAU A;  1VND A;  4HLX A;  1H8A C;  3FXL A;  1P4W A;  2OC6 A;  3BZK A;  2E60 A;  2ZJ2 A;  4UUT A;  3CMM A;  4HST A;  1BN5 A;  3ESW B;  3K4M A;  2EA2 A;  4BXF A;  1K61 A;  1U2W A;  1ZTR A;  3IAS 2;  5DM7 F;  4ZYG A;  1FSE A;  3SHF A;  1R5G A;  2ICW G;  1FBU A;  2XPV A;  1E3O C;  1G8X A;  4A3D J;  1FX7 A;  1Z3Y A;  4HF0 A;  1X4P A;  5DD4 A;  2ZXW H;  2VXD A;  4IHY A;  1X1C A;  2WV0 A;  5ERI A;  2P5K A;  3U2R A;  3W6V A;  4E7L A;  3ERM A;  3K9T A;  1BJZ A;  1U9N A;  1HOM A;  5H6Q A;  3HPH A;  1E17 A;  2P6T A;  4M71 A;  2QSH X;  3FBI B;  1GDT A;  3H0D A;  1MBG A;  3K70 D;  3NAR A;  1AKH A;  1TT5 B;  1QVT A;  2VE8 A;  4L0Y B;  1FC3 A;  1P7I A;  2FE3 A;  3CQZ J;  3GEZ A;  4JX6 A;  1L0O C;  4D7M A;  1FBS A;  4XOR A;  3GTG J;  1GXQ A;  2ISZ A;  1GHC A;  3PIP F;  3VYU B;  3VSL A;  1SFX A;  4BGD A;  2Z9O A;  1IUY A;  3NWT A;  3GX4 X;  2ADU A;  2ZJP F;  4XLN F;  4IF4 A;  4CYC B;  4ESB A;  4D1Q A;  3P9I A;  3KP2 A;  4RM2 A;  2DQL A;  4FCY A;  2NOJ B;  5JFR A;  2DMT A;  4J19 A;  3GTP J;  4CA0 A;  3KCC A;  4ZYH A;  4NQW A;  4KNY A;  2DI3 A;  3JAM K;  1DU0 A;  2W00 A;  6PAX A;  1UJ8 A;  1D1A A;  5EEA A;  4HEA 2;  2ZME B;  1IG7 A;  4EJV A;  4ZTF A;  1ZKG A;  2OV7 A;  4FQG A;  2E35 A;  4CCN A;  2B0L A;  1SAN A;  5LGU A;  2DCE A;  4JX4 A;  5E18 F;  1QZY A;  5L3D A;  4RAG A;  3RPU D;  2DPD A;  3F8B A;  4PUS A;  1RI7 A;  2TCT A;  3G2B A;  1B9M A;  4LIT A;  3T8R A;  3A2K A;  2CH0 A;  2R92 J;  1RKW A;  3GYH X;  4MTE A;  1J2X A;  1LE8 B;  4FET A;  1VF9 A;  1N78 A;  3OOP A;  3FIS A;  2KFD A;  4G6Q A;  5EF6 A;  1HLV A;  3KLN A;  4CUG A;  2LBF A;  2XVC A;  4V2F A;  3VYR B;  3QRF F;  3GFL A;  3B6C A;  3IP4 B;  2ISY A;  4MEY F;  3BQZ A;  1CQT A;  5FRM A;  1XN7 A;  1FMW A;  2IA1 A;  5IYD J;  2VC0 A;  1T2K A;  2JZY A;  1WQ2 A;  2OZ6 A;  5ILS A;  2DA2 A;  3A0H C;  3ZPL A;  3PSF A;  2R7U A;  2O8X A;  3E7L A;  4AVP A;  1S8N A;  3TO6 A;  1W36 D;  3E5X A;  4FX0 A;  4GRI A;  2MAB A;  5D6F A;  4X1E A;  4ETS A;  1V54 H;  2EIL H;  1OKR A;  4PGG A;  4ASN A;  3CCM I;  2GIV A;  3BCA A;  4XID A;  1VQN I;  4JOM A;  2P4W A;  5BS6 A;  2CUZ A;  4M9X A;  3S32 A;  2PJR B;  2BXY A;  1JXS A;  5FKN A;  1XDU A;  3C2B A;  1OPC A;  2A05 A;  2XAF A;  4HPQ A;  1MSF C;  3JW4 A;  4OIR F;  2GA2 A;  3QOP A;  2J5O A;  2XKO A;  3VB2 A;  1ZH5 A;  3E3V A;  5J40 A;  4CSW A;  4MQ9 F;  3L09 A;  4G12 A;  2LFB A;  1S7O A;  4AVZ A;  1KYZ A;  2DA3 A;  1H89 C;  3FIW A;  2Z2S B;  4B8X A;  2NS7 A;  3K4B A;  3REO A;  5HNH A;  1P4X A;  2VT2 A;  3GBG A;  1KQ0 A;  2F5D A;  3Q3S A;  4YEL A;  1MNE A;  5KAF C;  2IJL A;  3RPQ A;  1U6G A;  1UB9 A;  2L4A A;  2MD0 A;  5IY5 H;  1SAX A;  4RM3 A;  4YFX F;  4BH9 A;  1YQA A;  3F21 A;  2VL8 A;  3G71 I;  2EWN A;  2VOD A;  4IHV A;  4IHT A;  2IGN A;  2R4G A;  4UUV A;  2LR8 A;  1SVL A;  2DN0 A;  3OYA A;  2VN2 A;  3R61 A;  3EET A;  3B73 A;  4L9N A;  2IPQ X;  3SQN A;  2FMY A;  2Q2E B;  5KCM A;  4C30 A;  3MFK A;  2GWR A;  2ID6 A;  1O3R A;  4UUS B;  3F3X A;  1JTX A;  4CCJ A;  3QWL A;  1JTY A;  2H8R A;  3B6A A;  1FT9 A;  3WU1 B;  3TMO A;  1IZ1 A;  1I5Z A;  1BW5 A;  3HDD A;  1VFC A;  2I8D A;  1TZL A;  1D5Y A;  4Z6Y A;  2L9R A;  2HOS A;  2GXA A;  3KZI C;  4UHT A;  1QHH D;  5JI6 A;  2PMZ N;  5JHF A;  1S72 I;  1WJC A;  3E1S A;  1VQ6 I;  2WAD A;  5KNL A;  2XV4 S;  2RDP A;  1MMN A;  4AD9 A;  1D5V A;  2RNJ A;  1AHD P;  2DFF A;  3GUD A;  4OOI A;  4G6D A;  2STT A;  4XLE A;  2AS5 F;  3DEE A;  3S93 A;  2BHY A;  4MIM A;  2ZCW A;  3LSH A;  1MMA A;  2JPB A;  1MMG A;  2HKO A;  4NB5 A;  3HSF A;  5CYV A;  4BDY A;  2XAU A;  1BM9 A;  2ELK A;  2R3S A;  3PNY A;  3F0C A;  5A2Q Z;  3DF8 A;  3K4N A;  2CS3 A;  3O2P E;  4ANJ A;  1UFM A;  3GTL J;  2JVH A;  4DYR A;  1USS A;  1QA6 A;  5FKL A;  2MH9 A;  3BTI A;  3LL7 A;  3VOE A;  3ZMS A;  1R4M B;  2MLG A;  3DPT A;  4XLF A;  2HKX A;  2XRN A;  4WXC A;  2KDZ A;  3FXO A;  3CUQ A;  4HNT A;  3BR6 A;  2EZI A;  4XMY A;  3KX2 A;  2DA6 A;  4RAY A;  5B1B H;  2OA4 A;  1ETO A;  2L0K A;  3FXU A;  3L2U A;  1ONV A;  2DW4 A;  2VAS A;  3BQY A;  1XSX A;  2GBY A;  2L54 A;  1T0F C;  4AWX B;  1X19 A;  3C7J A;  3VPR A;  4LIV A;  3NAU A;  1Z91 A;  1ZN2 A;  5TIS C;  1YG2 A;  3OYM A;  2NS8 A;  2OCE A;  3PFI A;  3S1M J;  1R58 A;  3TP3 A;  5CPR B;  3V4G A;  3O6B B;  2HQA A;  3ZR8 X;  1XGS A;  3ZCO A;  3N97 A;  3LOC A;  3TKY A;  1ULY A;  2K40 A;  1IXR C;  3JRB A;  2IS6 A;  3KPH A;  3JRF A;  2F5V A;  5EZG A;  5B3S H;  3CUO A;  3OS0 A;  1RUO A;  2F2E A;  2K85 A;  3HHG A;  4WXD A;  2H94 A;  2HXO A;  4M3B A;  1HF0 A;  1H9G A;  3SJM A;  4B09 A;  2VJ5 A;  2HS5 A;  2XPU A;  4QPO A;  4A3J J;  2V9P A;  3OWT A;  4ENM A;  5EG0 A;  4X0G A;  3QPL A;  2O03 A;  1YLF A;  1VI0 A;  2A69 F;  2M7A A;  3BLY A;  4XIC A;  2HYG D;  1R5H A;  1G4D A;  4LG0 A;  1OCC H;  2P8T A;  2LVS A;  1QRY A;  1O7L A;  1V3F A;  2LDU A;  2MGQ A;  4DGW B;  5JLW A;  1NHA A;  4V2G A;  4HQM A;  2H1L A;  3PSI A;  1X1B A;  4ON0 A;  3TDU C;  1PUF B;  1QPI A;  1XMX A;  1V5G A;  4G6T B;  2KRF A;  5D6E A;  4FHT A;  2PX9 A;  1FBQ A;  4BHP A;  2PN6 A;  4I7H A;  1D8J A;  2G0E A;  2OD5 A;  4XKW A;  3WU0 A;  1SFK A;  2X48 A;  5BOX A;  2VBX A;  2Y48 A;  1IGN A;  2X6O A;  1HW1 A;  1Z77 A;  4Y7N J;  2E1C A;  1FOY A;  4DOZ A;  2KDO A;  3CCS I;  4IKF A;  4A2U A;  3BG7 A;  4PK4 A;  4RAZ A;  5M5W J;  5H6R A;  3KEY A;  4G94 A;  3BZ6 A;  3ZQG A;  2TRT A;  1OYI A;  3CUQ C;  2XSD C;  2F4M B;  2HFH A;  4QIW N;  4XRM A;  2R7S A;  3TQN A;  4RGX A;  2HR3 A;  1B9N A;  5AON A;  4A3F J;  1EH7 A;  5GPC A;  3K7A J;  3MEX A;  2A61 A;  3ZQ7 A;  2DT5 A;  1YJW I;  4IOA F;  2X6X A;  4Q48 A;  3HOS A;  1MIJ A;  2BE5 F;  2DA1 A;  3BC8 A;  1D8K A;  2OUM A;  2PMZ A;  3J81 Z;  3C1D A;  3VYS B;  1JUM A;  1KQ9 A;  1JT0 A;  5EEG A;  1SMT A;  2ME6 A;  4A12 A;  2COB A;  1GVJ A;  3M3Y J;  1OCO H;  2X1C A;  2GQQ A;  1SD4 A;  2M1B A;  4P9F A;  1ZRE A;  4O6J A;  3T1B A;  3WTS C;  4CZZ A;  1O3Q A;  1YS7 A;  2K9L A;  2HZD A;  1UMQ A;  4E4H A;  2XIG A;  2HI3 A;  4IJA A;  3VEP A;  5ICG A;  3G73 A;  4I0B A;  2L7F P;  1YE9 A;  2DFH A;  2GOX B;  3BOQ A;  1U5T A;  5HNF A;  2J5P A;  1ZGJ A;  3UKG A;  2ELJ A;  4P5O A;  1REP C;  4PFP A;  5F1R A;  4RB2 C;  1K6O A;  4PJ0 C;  1V5E A;  3SDG A;  1FP2 A;  4HAM A;  3RSN A;  3WTU C;  4I99 C;  1BC7 C;  3RYP A;  4XR6 A;  2FXA A;  4N4O B;  3HGG A;  2M5W A;  5GAE J;  2B63 J;  3ZN1 A;  2EBI A;  2X4H A;  2QKL B;  2E2H J;  1XGM A;  5BNG A;  3SDB A;  3BG3 A;  3IH3 A;  3RDI A;  2GOM A;  4M3F A;  1ZLJ A;  2PLY A;  3CO7 C;  4M9S A;  2DJI A;  5KK1 A;  2HTS A;  4G7H F;  1S9H A;  2A3S A;  4CHU A;  3RCO A;  2NVQ J;  3VWB A;  3LST A;  3OY9 A;  2P81 A;  4CCK A;  2KRH A;  2KMU A;  4D9J A;  3OYH A;  2XPW A;  2E2J J;  5CQE A;  1N25 A;  1ETK A;  3ASO H;  2V7F A;  2IBD A;  3CZ6 A;  1Y1W J;  3SXY A;  1A04 A;  2OPT A;  4LLL A;  5J1Y A;  2O5R A;  1QHG A;  5DCM B;  1H9T A;  3ZMT A;  3JRA A;  4HLY A;  2AQF A;  2DOA A;  1Z0X A;  2BZT A;  3R0A A;  5ICC A;  3OYN A;  1W7P A;  1DU6 A;  3GFM A;  5E3O A;  3IHU A;  1KU9 A;  1VQM I;  4FT8 A;  3EQL F;  2ACJ A;  1IUF A;  1X58 A;  2KKO A;  1Z67 A;  2OTJ I;  1RES A;  1WSU A;  3CLO A;  1Z3X A;  2K9Q A;  5BQT A;  1HCR A;  4UNO A;  1HA8 A;  3NWS A;  4BYY A;  3HHH A;  1TLH B;  2EIM H;  4AU7 A;  1MJA A;  3MN2 A;  2V1D A;  2OQG A;  2RQP A;  4KYW A;  1MKM A;  3HOY J;  2Q1Z B;  3OYL A;  5ILU A;  2F5E A;  3DBL B;  3CDH A;  1JKR C;  4LLG F;  3GFJ A;  1MND A;  3WHB A;  3DKX A;  5J47 A;  1ZG1 A;  3HPG A;  1EH8 A;  4YFN F;  3I5U A;  4I09 A;  4A3G J;  4EEF G;  1K4S A;  3FM3 A;  1VQK I;  1R7J A;  1HKS A;  3HUG A;  1U5T C;  1MJ9 A;  3FWE A;  5LD2 C;  3WGG A;  3G1L A;  3CME I;  1LUJ B;  2M7B A;  4EJO A;  2OAZ A;  3FM5 A;  3PQK A;  3M8F A;  4XON A;  3ECO A;  5EGO A;  2DA7 A;  1NK2 P;  3MMY B;  4XKV A;  5E79 C;  5C4X J;  1MBE A;  3F22 A;  5LHI A;  1X4O A;  2NVT J;  3BPX A;  1HW5 A;  4EGZ A;  1G3W A;  2ZXH A;  1U8B A;  1DGR M;  3TGN A;  3GTO J;  1OJL A;  1G3S A;  4Y52 J;  3K2Z A;  2D45 A;  2D1H A;  5M5Y J;  3TOB A;  4ZZD A;  3ABL H;  4GO1 A;  5E3N A;  2MSY A;  2ZSH B;  1ZK8 A;  2W24 A;  2HPM A;  1MMD A;  5IP7 J;  2ZJR F;  2DMP A;  2X0L A;  3WTT C;  2VJI A;  2VKE A;  2FF4 A;  1R49 A;  5JVG F;  1A6I A;  1NG7 A;  2V1N A;  3QOD A;  2CWE A;  2QF7 A;  5E8G A;  2LF8 A;  2RGV A;  3F6V A;  2R7O A;  3PM1 A;  3RJP A;  4ZH4 F;  3T5X A;  3IRQ A;  4I6Z A;  5LFA A;  1I6H J;  2M9H A;  3DLA A;  3BZC A;  3QYE A;  3KET A;  1MBF A;  1BR1 A;  1WVR A;  2BOL A;  2HVS A;  5M3M J;  2DO7 A;  3GFI A;  2AO9 A;  3A1Y A;  4MO7 A;  1LFP A;  4GXO A;  2VT3 A;  3AG2 H;  2CU7 A;  1VQO I;  2DOF A;  3OYE A;  1DPU A;  1Z7L A;  2N8G A;  2MYS A;  2H8W A;  4ZC3 A;  3WTY C;  1YHQ I;  1DP7 P;  2D5V A;  4A3E J;  1F1Z A;  3G1M A;  3IAM 2;  1BI3 A;  2WB1 N;  2WAE A;  5J3L A;  2VOP A;  2BXZ A;  3E6M A;  4L5J A;  1BOB A;  2Y2Z A;  2EPF A;  3DWL E;  4C3J J;  1POG A;  4BEH A;  3S3M A;  3HJE A;  4A6D A;  3C2G A;  3HOV J;  4F91 B;  3WU2 C;  5JHU A;  3CCY A;  3KIO A;  3VDX A;  1KYW A;  3MAJ A;  1R9T J;  3HM5 A;  3NQO A;  3D1N I;  4BJ6 C;  3H5A A;  1FSH A;  4R8H A;  1Y56 A;  5J8C A;  3LSR A;  3HL2 A;  2Z3Y A;  5F1J A;  3P5J A;  4KIB A;  3E5Q A;  4HYE A;  3NEU A;  5LRR A;  3I4P A;  4U87 A;  2M3A A;  3DBR B;  2KHM A;  2JT1 A;  4A5M A;  2V26 A;  3QPT A;  3JRC A;  2IT0 A;  2V4J C;  1QPM A;  2QEN A;  3BG6 A;  4BY1 J;  3V42 A;  3V8L A;  1EH6 A;  3RZO J;  3GME A;  3CC4 I;  2VQG A;  5CVJ A;  5IT9 K;  2HU9 A;  4L9J A;  1IN6 A;  3KEQ A;  3BG5 A;  1ITY A;  3JR9 A;  1O3S A;  2FBK A;  1T38 A;  1U9O A;  2KJC A;  2V1X A;  2ZKZ A;  3JRI A;  1B6A A;  1FIP A;  5BPI A;  1JE8 A;  1P92 A;  1IXC A;  4HOB A;  2QZ8 A;  2FBI A;  1FTZ A;  3H5R A;  4BQO A;  1R4N B;  2E1N A;  1YIT I;  5K7H A;  2X6Y A;  4RLQ A;  4LMY A;  4Y15 A;  3HBL A;  3GZ6 A;  1G3Y A;  3JRE A;  5KVR A;  2Y0M A;  2Z99 A;  1Y0N A;  1Y8Q B;  3SEZ A;  2EFN A;  4D5C A;  3DKW A;  4A0X A;  5D5U B;  3T8T A;  2P5L C;  4JX5 A;  2UV1 A;  3E5U A;  3FXM A;  4MHG A;  4XRS G;  5AIP A;  3CMY A;  3CES A;  3K4J A;  5FFX A;  4HZF A;  4IOC F;  3J7A Y;  1ZGA A;  4F92 B;  1P6R A;  2XGC A;  1AA7 A;  2IGO A;  3RI4 A;  2VBY A;  3VOD A;  4B43 A;  2ELH A;  2QKM B;  3FMQ A;  2R7T A;  4UXN A;  3OYK A;  1GV5 A;  2JVG A;  2LKX A;  4N4N B;  5HVQ C;  4EGY A;  3CJQ B;  3CC7 I;  2ZFU A;  2ID3 A;  1BOA A;  1FP1 D;  4AM3 A;  2I10 A;  4NC7 A;  1V5F A;  1LPQ A;  2MC3 A;  1XTA A;  4JBA A;  2Z33 A;  2NVX J;  3L2V A;  1YTY A;  2FOW A;  1Z7U A;  1A5J A;  4IRH A;  3W6K B;  2HOT A;  1UHW A;  2CFX A;  3HYI A;  5F6F A;  5GAD J;  3J80 K;  3WTV C;  4LIU A;  4BE1 A;  1YRN A;  1K78 A;  3QU6 A;  3HSE A;  4HF1 A;  2HNH A;  1O57 A;  4NUB A;  3EUK L;  3FHZ A;  2OTL I;  1UHM A;  2MFZ A;  4TV7 A;  4E7Z A;  4HV6 A;  1TP4 A;  1J75 A;  4FE7 A;  2R0Q C;  3CUQ B;  4AIH A;  2NVY J;  2FQ4 A;  3ZXS A;  5CVR A;  2OBP A;  1SFO J;  5HS7 A;  1FIA A;  4CXF A;  3MKW B;  5DYM A;  5HLT A;  4AIK A;  1OR7 A;  3BTL A;  3VFZ A;  2QBY A;  1IN7 A;  3L2W A;  4IQJ A;  3EPZ A;  2ZO4 A;  3HRM A;  4PFO A;  4CGZ A;  3CJR B;  4PJJ A;  1BI0 A;  1BI2 A;  3K4K A;  4M6V A;  2IA2 A;  4Z2Y A;  5D4R A;  2WB1 A;  3KFW X;  4QTR A;  2CUF A;  2JSC A;  1LDK B;  2XDV A;  3H9J A;  2FJ1 A;  2OF7 A;  5DD8 A;  2XSJ C;  2X1D A;  5FRN A;  3DFG A;  1LDJ A;  4QWQ A;  4DZP A;  1ENH A;  4ABZ A;  2HWV A;  1RZ4 A;  1NK3 P;  3EYI A;  3CTA A;  3QP5 A;  3PJR A;  2QWW A;  3ZRG A;  4RMN A;  2VON A;  3LSM A;  2P0W A;  3BTJ A;  2DJN A;  3KP6 A;  5EYR A;  3E6C C;  3KLO A;  1TTY A;  2E1M C;  2EV0 A;  4ZJZ A;  2QQB A;  3AL0 C;  3IWZ A;  3DEU A;  1MNM C;  4OIP F;  3VSK A;  2HPI A;  1D0X A;  2W7N A;  2DBB A;  5E3L A;  4CYD A;  5KHD A;  4LG0 B;  1BI1 A;  2Z16 A;  3S17 J;  2QYO A;  4NC6 A;  4BE0 A;  1EA3 A;  2XF7 A;  3I9V 2;  3COA C;  4HRI A;  4XSX F;  3J7Y J;  1T56 A;  2CW0 F;  1XDS A;  3R0J A;  2L7K A;  4XNF A;  2VB6 A;  4KIS A;  3OSG A;  5LHH A;  1I50 J;  1W4M A;  3MKZ A;  4LK1 F;  5BMZ A;  1G3T A;  2CMP A;  2F4O B;  3SEQ A;  1UEL B;  2EFQ A;  2L4M A;  1BC8 C;  3W2W A;  5J1R A;  3HOU J;  3FXJ A;  4BHC A;  4IO9 F;  3LFK A;  4M3E A;  2CUE A;  5EZH A;  2PFB A;  3GXO A;  2IW5 A;  1K4T A;  4CYC A;  2ME0 A;  2RRE A;  2E5Z A;  3FXR A;  3GCM A;  3ZMU A;  1PJR A;  4P55 A;  2DK8 A;  3BCB A;  1XG1 A;  1TW2 A;  4IL6 C;  2DA4 A;  2ZME A;  3U1D A;  4A5N A;  1GXP A;  1BR2 A;  3ZMV A;  4KFC A;  3I55 I;  2XF5 A;  3S8P A;  1WZ2 A;  2JTV A;  1BJA A;  2MD5 A;  3WTW C;  1HDP A;  1QZE A;  3G3Z A;  1B8I B;  2JK3 A;  1CF7 B;  2FD5 A;  2ZXJ A;  1MMS A;  3HC7 A;  1Q1V A;  3CDI A;  3HSR A;  1LE8 A;  3A01 B;  2ETH A;  1Z1D A;  2A5W A;  2MH2 A;  4R1H A;  1UST A;  5K5O A;  3S2D J;  4U0W A;  1EJ9 A;  3U1K A;  2IS4 A;  2YX7 A;  4YEJ A;  3RPU A;  3F8F A;  4HV5 A;  4Y13 A;  3H9Q A;  2EFP A;  4XOT A;  3IC7 A;  3F8N A;  2NVU B;  4Q4Z F;  1HKT A;  4RGS A;  2E7X A;  3HZJ A;  1BIB A;  3GTJ J;  4ESJ A;  3QPS A;  3Q9V A;  3H1C A;  4GCV A;  3OYJ A;  1J5Y A;  2XB0 X;  5FFZ A;  3ZQI A;  2HEO A;  2EQR A;  2L01 A;  4BUP A;  2VQH A;  5D5X B;  1U5T B;  5IOY A;  3FX3 A;  1XD7 A;  1MBK A;  2ESH A;  3ZMZ A;  3R4K A;  2LP0 A;  4FE4 A;  5HDN A;  1IV8 A;  4AC0 A;  3TOA A;  2PJR A;  3U9G A;  5CLS A;  5DTD A;  3GLL A;  3TP0 A;  5J8F A;  1L3L A;  3F6O A;  1PDN C;  5E20 A;  1IN4 A;  2ZXI A;  3ASN H;  2CQN A;  3I56 I;  3GZ5 A;  1DUX C;  3S3O A;  2R5Z A;  2RAE A;  1GT0 C;  1BR4 A;  4XRS A;  2Y30 A;  4D5F A;  2KIM A;  4P1W A;  4FIS A;  3FXK A;  4S04 A;  1MDM B;  4L5E A;  1J7K A;  3GW2 A;  2XB5 A;  3RTR A;  3SYT A;  2Y0S N;  1WJ5 A;  2RNG A;  2R5Y B;  1LDD A;  4CDG A;  2M87 A;  2XAJ A;  1SD5 A;  1YO5 C;  1MGT A;  4EJU A;  4F7Z A;  3CCE I;  2L9N A;  1YYV A;  2PG4 A;  2WTE A;  1T8I A;  3QOE A;  4A69 C;  1I3A A;  1YW8 A;  2KJB A;  4DZJ A;  4N9I A;  3OYI A;  2Q0O A;  5DM6 F;  3Q0V A;  2YSR A;  4UB8 C;  3LFU A;  3E97 A;  2JA6 J;  1WHU A;  4KN4 X;  2VXZ A;  4MFE A;  5CVI A;  4FTH A;  4PGH A;  4QLC U;  1G6N A;  2KLO A;  3PUB A;  2VI6 A;  2QQ9 A;  4IEJ A;  1B72 A;  4NBQ A;  2P7V B;  2Y75 A;  4KT6 A;  5AIQ A;  4AID A;  4OMY A;  3H35 A;  1W7P B;  2Q2E A;  5FLX K;  3I54 A;  2MG4 A;  1APL C;  2LY2 A;  3DTI A;  3ROU A;  4W97 A;  1X1D A;  4ZZL A;  3TL4 X;  4XQF A;  4M9Z A;  2DT7 B;  2HOE A;  2XF6 A;  5FGM A;  2YU3 A;  2QQ8 A;  4A3K J;  1JKQ C;  5HLH A;  1PYV A;  3C3W A;  1IRZ A;  2VQL A;  2K9S A;  4FX4 A;  5TJJ A;  2QLZ A;  3ZQH A;  3FXQ A; 
#chains in the Genus database with same CATH homology
 2L02 A;  4G9Y A;  1T6S A;  1AOY A;  1R1T A;  1QBJ A;  1D3Y A;  3ECH A;  3FMR A;  1B4A A;  3I59 B;  4YII A;  4M6X A;  5ICF A;  1XCB A;  4OIN F;  1J59 A;  4YG2 F;  2D1V A;  3MWM A;  3Q9S A;  3ZP5 A;  5LGT A;  1FYK A;  4ZYE A;  2P5V A;  1B59 A;  2EJR A;  3N4M A;  2PI0 A;  1FPQ A;  4WX9 A;  2ZFW A;  2O3F A;  2VOO A;  2BGC A;  5ICE A;  1WI9 A;  3WTZ A;  4WF2 A;  1YS6 A;  4CO8 A;  1ZYR F;  4LB6 B;  5TRD A;  3ABU A;  1KGS A;  1FWZ A;  3T0Y A;  3F72 A;  5FD5 A;  2L3D A;  2GXB A;  1OYY A;  1ODD A;  3LWF A;  1WRJ A;  1DDN A;  4UVB A;  2OU2 A;  1TQI A;  1TNS A;  1S6L A;  1RNL A;  1V4R A;  1QGP A;  2UXN A;  2V9V A;  5HOO A;  3LA7 A;  5CJ9 A;  4KMU X;  4JK1 X;  1R00 A;  2XAG A;  1IW7 F;  4EJW A;  1Z6R A;  2EFO A;  4MTD A;  1K7A A;  3BP8 A;  4K2E A;  3F8C A;  2QUF A;  3H92 A;  1E2X A;  4G7O F;  1XB4 A;  5ILV A;  2W57 A;  2YR2 A;  3M7G A;  1ZRC A;  2VBZ A;  4L9T A;  1R1U A;  2K86 A;  4ENK A;  3HTU A;  2O6G E;  1BIA A;  2W85 A;  2O61 A;  1JHF A;  1Z05 A;  2O0Y A;  2OQR A;  2PJP A;  3I0T A;  3QAH A;  1HQC A;  2H09 A;  3TO9 A;  4R79 A;  3MQ0 A;  2QVO A;  1IN5 A;  1HST A;  3RKX A;  3V8J A;  5D5W B;  2EB7 A;  3O3K A;  1ON2 A;  2CG4 A;  1I27 A;  5L3C A;  2EV6 A;  3BJA A;  3ULQ B;  1W5T A;  3KEO A;  2FA5 A;  4M72 A;  1PP7 U;  2Q8K A;  1LVA A;  3KE2 A;  3QPH A;  3JTH A;  2COM A;  3K69 A;  1KQ8 A;  2HQR A;  4BXU A;  1XCV A;  4LK0 F;  1F4K A;  2FOK A;  2GXG A;  1W5S A;  1FLI A;  4GYG A;  2P6S A;  3EDP A;  1BBY A;  3WGI A;  1YW7 A;  1K79 A;  1LNW A;  3ML6 A;  5E1Z B;  4WCG A;  1MZB A;  3L7W A;  1HW2 A;  4U7D A;  2FEZ A;  4KIG A;  2FBH A;  1P4A A;  3BY6 A;  3WG9 A;  4EJT A;  3DXJ F;  3DV8 A;  1P2F A;  1FZP B;  2GA1 A;  3MZH A;  1IRF A;  3I71 A;  1MJB A;  2GZW A;  2XGX A;  2D2W A;  3TO7 A;  4XLP F;  3LQR A;  2HGC A;  4XSZ F;  4EM2 A;  5D4S A;  4IRG A;  4MGR A;  4BAY A;  3E6D A;  3K0L A;  2RN7 A;  2ZNZ A;  2V6C A;  1B1B A;  3V7R A;  1FYL A;  3F8M A;  5DDG A;  1TQM A;  5DCF A;  2H6B A;  2CO5 A;  4HQE A;  4M73 A;  1F9N A;  1KA8 A;  5FB2 A;  5DV5 A;  2DQR A;  3V7C A;  2HQN A;  2HYF A;  3BDD A;  2FSW A;  1CGP A;  5LBQ A;  4A0Z A;  5H20 A;  2QM3 A;  1XSV A;  3HOT A;  2NS0 A;  4UV9 A;  1Z9C A;  2WWY A;  2K02 A;  2A68 F;  4I02 A;  4UV8 A;  2PQ8 A;  5D8L B;  1LEB A;  1QZZ A;  5D5V B;  1X3U A;  4NHJ A;  4L9V A;  2HTJ A;  5LGN A;  5FD6 A;  5F64 A;  2H27 A;  5HLI A;  1ZG5 A;  4P9U A;  2NNY A;  3RYR A;  3DQV C;  1FOK A;  5LEK A;  5JR3 A;  3GO5 A;  1H0M A;  1YIO A;  2DAO A;  2BBY A;  1YW9 A;  3LA2 A;  3OV8 A;  4G8X A;  4EQQ A;  5A2Q K;  3GF2 A;  3IKV A;  3GVA A;  3GLX A;  4DNC A;  3HIF A;  3CO6 C;  4HX7 A;  4RGU A;  2K7L A;  3SZP A;  1Y0U A;  4G7Z F;  5LRS A;  1AWC A;  3KZY A;  1F5T A;  1FY7 A;  1T39 A;  3D0S A;  4Y17 A;  2P7C B;  3NRV A;  4I2O A;  1JGS A;  2CGP A;  2F5F A;  4ENN A;  2UZK A;  4HDU A;  2FU4 A;  2KIF A;  2NAZ A;  1ZRF A;  3P7N A;  1HXD A;  3SFZ A;  5E8I A;  1J0R A;  2F5C A;  2PEX A;  1HSJ A;  3IL2 A;  3QU3 A;  1FYM A;  1S3J A;  1T98 A;  4I01 A;  3RIR A;  2HZT A;  5IT9 Z;  1YFH A;  3K1M A;  2EK5 A;  5K5Q A;  3M1E A;  2M30 A;  3JTG A;  2RKH A;  4P96 A;  3I58 A;  3BWG A;  1T0F A;  4LJZ F;  5FO5 A;  2ESN A;  2W84 A;  2PMU A;  1OYW A;  2WC2 A;  4HX8 A;  4WXH A;  1KU7 A;  2BYV E;  1SFU A;  1WWX A;  3WOD F;  2RV8 A;  2M8E A;  3RKY A;  5BPD A;  2R7F A;  3I64 A;  2G7H A;  3JAM Z;  4DQ2 A;  1JHH A;  2CSO A;  5DUK A;  2AXL A;  5HDG A;  3ZN0 A;  2DU9 A;  4U0Y A;  4KT5 C;  2VBW A;  4RB1 A;  3WE2 A;  2E7W A;  4OIO F;  1WKM A;  2XAH A;  5J6X A;  2LNB A;  3KP7 A;  3EUH A;  2PBI A;  2QQA A;  4BNC A;  1SD6 A;  3W6J B;  5ED4 A;  1DPR A;  5CVV A;  1XMK A;  3BRO A;  3J81 K;  3AAF A;  3IRR A;  3J80 Z;  2CQK A;  3KP3 A;  4HA8 A;  4HDV A;  5JVT A;  3D5L A;  3SZT A;  4UVA A;  2XKP A;  4LD5 A;  3HRT A;  1LQ1 A;  5L3F A;  4RS8 A;  2R7D A;  3V8K A;  1C0W A;  3WGH A;  1QQI A;  1U3E M;  4I98 B;  2GAU A;  1STZ A;  2EV5 A;  4EV0 A;  1HKQ A;  3Q5F A;  4XBF A;  4WWC A;  4M74 A;  3LAJ A;  2STW A;  2CYY A;  1ZHF A;  2K27 A;  4S05 A;  4LGW A;  4PCQ A;  1IRG A;  4MNU A;  4UVC A;  4OU0 A;  1R36 A;  2FNA A;  1TBX A;  4PDK A;  3HRU A;  2A6E F;  1W7P D;  4U88 A;  2A6H F;  2FML A;  2RC4 A;  4MEX F;  4HX4 A;  5D8K B;  5E17 F;  3L2C A;  4HBL A;  1XGO A;  1Z6T A;  5E1X A;  4L5I A;  2H6C A;  4LB5 A;  1TW3 A;  1LJ9 A;  3K1N A;  4MQV A;  4A6E A;  3K1P A;  3RKW A;  5HS8 A;  1IF1 A;  1S7A A;  3BJO A;  3MCZ A;  2UXX A;  2TDX A;  3F23 A;  3TDZ C;  2DLL A;  2UWM A;  1XMA A;  1O3T A;  1FNN A;  3DPL C;  2BV6 A;  5K1Y A;  2FNP A;  1EV7 A;  2ZNY A;  4XRF A;  3QP6 A;  1R22 A;  5HS9 A;  4OIQ F;  1SFE A;  5E1W A;  2G7U A;  4OMZ A;  1U8R A;  4AIJ A;  1S29 A;  4ESF A;  4N0B A;  5K5R A;  2EA4 A;  4E70 A;  1LB2 A;  2RVC A;  1CF7 A;  3WE3 A;  5HLG A;  3H3U A;  1I1S A;  4BHB A;  3FF5 A;  1ZG3 A;  5IT3 A;  1RIO H;  2XAQ A;  3LA3 A;  3P9C A;  3LQQ A;  5DEQ A;  1R23 A;  3I53 A;  1ZRD A;  2NNN A;  4YIF A;  1VTN C;  1QNT A;  4U7B A;  3DP7 A;  3M8E A;  3P9K A;  5EEH A;  4ZYD A;  4KA4 A;  1IXS B;  2YPR A;  4Q5S F;  4GGG A;  1O7F A;  4HF2 A;  2FRH A;  2EFW A;  1I1G A;  4IPA A;  2IVM A;  2YX4 A;  2K4B A;  1PUE E;  5L3G A;  2LKP A;  3IWF A;  4CIC A;  2JPC A;  3J7A O;  2IRF G;  3KP5 A;  4KN7 X;  4KMF A;  4IXA A;  4U0V A;  1ZAR A;  3M9A A;  2OZU A;  1MDM A;  1ON1 A;  2JRT A;  2V79 A;  4Q47 A;  1MD0 A;  3HRS A;  4IHS A;  4KIC A;  5DUI A;  1PP8 F;  3V7S A;  4RB3 C;  1QO0 D;  2MLK A;  4O5V A;  4EM0 B;  2V1U A;  3L00 A;  2MA3 A;  4PZJ A;  5FLX Z;  4N9H A;  2M45 A;  2ZBK A;  2LF7 A;  4WK8 F;  2BEO A;  3ISP A;  4KDP A;  2K4J A;  1R1V A;  3JSO A;  3C18 A;  4H0E A;  3KZZ A;  2DPU A;  1SMY F;  5LEJ A;  2G9W A;  2LSO A;  4ENJ A;  4LLN A;  2DK5 A;  4O3M A;  3HTS B;  5LHG A;  1HBX G;  1XGN A;  3I59 A;  4RGR A;  1OMI A;  3GWZ A;  3FZV A;  4LFU A;  3ERE D;  1U78 A;  4L18 B;  2DTR A;  4L0Z B;  3JSP A;  3ZMD A;  3H3Z A;  2MBF A;  2KIU A;  2NYX A;  3MZY A;  3WTX C;  3L9F A;  3BJ6 A;  4KIF A;  2IA0 A;  1RUN A;  2A07 F;  1SD7 A;  2NRA C;  3FMS A;  3KP4 A;  2VC1 A;  3PQJ A;  4YFK F;  2FQ3 A;  4HW0 A;  1XSD A;  2C6Y A;  1KU2 A;  1UCR A;  1IN8 A;  5L3B A;  2PMH A;  1TNT A;  1KU3 A;  1TQP A;  3BPV A;  5CVU A;  3IKT A;  3ABT A;  5LLQ A;  1I6X A;  2Z5U A;  4IVN A;  1ZAO A;  1LEA A;  1J9I A;  3LAP A;  2IP2 A;  2W25 A;  3B02 A;  3R60 A;  4IRI A;  4EM1 A;  2XRO A;  2XHK A;  2HDC A;  1Q1H A;  1K78 B;  4GYI A;  2A5Y B;  3E6B A;  5HDK A;  2VE9 A;  2XAS A;  4I0A A;  4EVI A;  5DCM A;  4BQA A;  4M6Y A;  2DFI A;  4EMS A;  3ELK A;  1IAW A;  2QBY B;  3R6S A;  3CJN A;  4JQF A;  3EYY A;  4KUM A;  3S2W A;  4RB0 A;  1ZLK A;  2XUB A;  4D0P A;  4A0Y A;  5L3E A;  4HLX A;  1P4W A;  2ZJ2 A;  1BN5 A;  2EA2 A;  1U2W A;  4ZYG A;  1FSE A;  3SHF A;  1R5G A;  1FBU A;  1FX7 A;  4HF0 A;  5DD4 A;  2WV0 A;  5ERI A;  2P5K A;  3U2R A;  3K9T A;  5H6Q A;  1E17 A;  2P6T A;  4M71 A;  2VE8 A;  4L0Y B;  1FC3 A;  2FE3 A;  3GEZ A;  1L0O C;  1FBS A;  1GXQ A;  2ISZ A;  1GHC A;  1SFX A;  2Z9O A;  1IUY A;  3GX4 X;  2ADU A;  4XLN F;  4IF4 A;  4ESB A;  3P9I A;  3KP2 A;  2DQL A;  5JFR A;  3KCC A;  4ZYH A;  4NQW A;  4KNY A;  2DI3 A;  3JAM K;  6PAX A;  2ZME B;  4EJV A;  2B0L A;  5LGU A;  5E18 F;  1QZY A;  5L3D A;  2DPD A;  3F8B A;  1RI7 A;  1B9M A;  3T8R A;  3GYH X;  4MTE A;  1J2X A;  3OOP A;  4G6Q A;  3KLN A;  2XVC A;  3QRF F;  3GFL A;  4MEY F;  2ISY A;  1XN7 A;  2IA1 A;  2VC0 A;  1T2K A;  2JZY A;  1WQ2 A;  2OZ6 A;  5ILS A;  3ZPL A;  2O8X A;  4AVP A;  1S8N A;  3TO6 A;  3E5X A;  4FX0 A;  5D6F A;  4ETS A;  1OKR A;  4PGG A;  4ASN A;  2GIV A;  2P4W A;  5BS6 A;  4M9X A;  1JXS A;  1XDU A;  1OPC A;  2XAF A;  3JW4 A;  4OIR F;  2GA2 A;  3QOP A;  2J5O A;  2XKO A;  3VB2 A;  1ZH5 A;  3E3V A;  4MQ9 F;  3L09 A;  1S7O A;  1KYZ A;  4B8X A;  3REO A;  1P4X A;  2VT2 A;  1KQ0 A;  2F5D A;  2IJL A;  3RPQ A;  1U6G A;  1UB9 A;  2L4A A;  1SAX A;  4YFX F;  4BH9 A;  1YQA A;  3F21 A;  2EWN A;  2VOD A;  4IHT A;  4UUV A;  2VN2 A;  3R61 A;  3EET A;  3B73 A;  4L9N A;  2IPQ X;  3SQN A;  2FMY A;  3MFK A;  2GWR A;  1O3R A;  3F3X A;  1FT9 A;  3WU1 B;  1IZ1 A;  1I5Z A;  4UHT A;  5JI6 A;  2XV4 S;  2RDP A;  4AD9 A;  1D5V A;  2RNJ A;  3GUD A;  4OOI A;  4G6D A;  2STT A;  2AS5 F;  2ZCW A;  2JPB A;  2HKO A;  4NB5 A;  3HSF A;  5CYV A;  1BM9 A;  2R3S A;  5A2Q Z;  3DF8 A;  3O2P E;  1UFM A;  1USS A;  2MH9 A;  3VOE A;  3ZMS A;  2MLG A;  3DPT A;  2HKX A;  2XRN A;  4WXC A;  3CUQ A;  4RAY A;  2OA4 A;  3FXU A;  1ONV A;  2DW4 A;  1XSX A;  2L54 A;  4AWX B;  3C7J A;  1Z91 A;  1ZN2 A;  1YG2 A;  3PFI A;  1R58 A;  3V4G A;  3O6B B;  1XGS A;  3N97 A;  3TKY A;  1ULY A;  1IXR C;  3CUO A;  1RUO A;  2F2E A;  3HHG A;  4WXD A;  2H94 A;  1H9G A;  4B09 A;  2HS5 A;  4ENM A;  2O03 A;  1YLF A;  2A69 F;  1G4D A;  2HYG D;  1R5H A;  4LG0 A;  2P8T A;  1V3F A;  1O7L A;  2LDU A;  1NHA A;  4HQM A;  3TDU C;  4ON0 A;  5D6E A;  2KRF A;  4FHT A;  1FBQ A;  4BHP A;  2PN6 A;  4I7H A;  1D8J A;  2OD5 A;  3WU0 A;  5BOX A;  2VBX A;  2Y48 A;  1HW1 A;  2E1C A;  4A2U A;  4RAZ A;  5H6R A;  4G94 A;  3BZ6 A;  1OYI A;  3CUQ C;  2HFH A;  3TQN A;  4RGX A;  2HR3 A;  1B9N A;  5AON A;  1EH7 A;  3MEX A;  3ZQ7 A;  2A61 A;  2DT5 A;  4Q48 A;  3HOS A;  2BE5 F;  1D8K A;  3J81 Z;  3C1D A;  1KQ9 A;  5EEG A;  1SMT A;  4A12 A;  1GVJ A;  2GQQ A;  1SD4 A;  2M1B A;  4P9F A;  1ZRE A;  4O6J A;  3T1B A;  3WTS C;  4CZZ A;  1O3Q A;  1YS7 A;  2XIG A;  4IJA A;  3VEP A;  5ICG A;  3G73 A;  4I0B A;  3BOQ A;  1U5T A;  2J5P A;  1ZGJ A;  4P5O A;  1REP C;  5F1R A;  4RB2 C;  1K6O A;  1FP2 A;  4HAM A;  3WTU C;  1BC7 C;  3RYP A;  2FXA A;  2M5W A;  3ZN1 A;  2X4H A;  1XGM A;  3RDI A;  1ZLJ A;  2PLY A;  3CO7 C;  4M9S A;  5KK1 A;  2HTS A;  4G7H F;  2A3S A;  4CHU A;  3LST A;  3SXY A;  1A04 A;  4LLL A;  5DCM B;  1H9T A;  3ZMT A;  4HLY A;  3R0A A;  5ICC A;  1W7P A;  3GFM A;  3IHU A;  1KU9 A;  4FT8 A;  3EQL F;  2ACJ A;  2KKO A;  1WSU A;  3CLO A;  5BQT A;  4UNO A;  4BYY A;  3HHH A;  1TLH B;  1MJA A;  2V1D A;  2OQG A;  2RQP A;  4KYW A;  1MKM A;  5ILU A;  2F5E A;  3CDH A;  4LLG F;  3GFJ A;  1ZG1 A;  1EH8 A;  4YFN F;  3I5U A;  4I09 A;  3FM3 A;  1R7J A;  1HKS A;  3HUG A;  1U5T C;  1MJ9 A;  3FWE A;  3WGG A;  4EJO A;  2OAZ A;  3FM5 A;  3PQK A;  3M8F A;  3ECO A;  3F22 A;  5LHI A;  3BPX A;  1HW5 A;  4EGZ A;  1G3W A;  3TGN A;  1G3S A;  3K2Z A;  2D45 A;  2D1H A;  3TOB A;  4ZZD A;  4GO1 A;  2W24 A;  2X0L A;  3WTT C;  2FF4 A;  2CWE A;  5E8G A;  2LF8 A;  2RGV A;  3F6V A;  3RJP A;  4ZH4 F;  3T5X A;  3IRQ A;  3KET A;  2DO7 A;  3GFI A;  4GXO A;  2VT3 A;  1DPU A;  3WTY C;  1DP7 P;  1F1Z A;  1BI3 A;  2VOP A;  3E6M A;  4L5J A;  4A6D A;  5JHU A;  1KYW A;  3MAJ A;  3NQO A;  1FSH A;  4R8H A;  5J8C A;  2Z3Y A;  4KIB A;  3E5Q A;  4HYE A;  3NEU A;  5LRR A;  3I4P A;  2JT1 A;  4A5M A;  3QPT A;  2IT0 A;  1QPM A;  2QEN A;  3V8L A;  1EH6 A;  5CVJ A;  5IT9 K;  4L9J A;  1IN6 A;  3KEQ A;  1O3S A;  2FBK A;  1T38 A;  2KJC A;  2V1X A;  2ZKZ A;  1B6A A;  5BPI A;  1JE8 A;  1P92 A;  1IXC A;  4HOB A;  2QZ8 A;  2FBI A;  2E1N A;  4Y15 A;  4LMY A;  3GZ6 A;  1G3Y A;  5KVR A;  2Y0M A;  2Z99 A;  2EFN A;  3DKW A;  4A0X A;  5D5U B;  3T8T A;  2P5L C;  3E5U A;  4MHG A;  5AIP A;  5FFX A;  4HZF A;  1ZGA A;  1P6R A;  3RI4 A;  2VBY A;  3VOD A;  2ELH A;  3FMQ A;  4UXN A;  5HVQ C;  4EGY A;  1BOA A;  1FP1 D;  2MC3 A;  4JBA A;  2Z33 A;  1YTY A;  1Z7U A;  4IRH A;  3W6K B;  1UHW A;  2CFX A;  3HYI A;  5F6F A;  3WTV C;  3J80 K;  1K78 A;  3QU6 A;  3HSE A;  4HF1 A;  1O57 A;  3FHZ A;  1UHM A;  4TV7 A;  4HV6 A;  1J75 A;  3CUQ B;  4AIH A;  5CVR A;  2OBP A;  5HS7 A;  4CXF A;  5DYM A;  4AIK A;  1OR7 A;  3VFZ A;  2QBY A;  1IN7 A;  2ZO4 A;  3HRM A;  4CGZ A;  1BI0 A;  1BI2 A;  2IA2 A;  4Z2Y A;  5D4R A;  3KFW X;  2JSC A;  1LDK B;  5DD8 A;  3DFG A;  1LDJ A;  4QWQ A;  2HWV A;  1RZ4 A;  3EYI A;  3CTA A;  3QP5 A;  2QWW A;  2VON A;  3E6C C;  3KP6 A;  3KLO A;  1TTY A;  2EV0 A;  2QQB A;  3IWZ A;  3DEU A;  4OIP F;  2DBB A;  4CYD A;  4LG0 B;  1BI1 A;  2QYO A;  3COA C;  4XSX F;  2CW0 F;  1XDS A;  3R0J A;  5LHH A;  1W4M A;  5BMZ A;  4LK1 F;  1G3T A;  2EFQ A;  2L4M A;  1BC8 C;  4BHC A;  3LFK A;  2PFB A;  3GXO A;  2IW5 A;  3FXR A;  3ZMU A;  4P55 A;  2DK8 A;  1TW2 A;  2ZME A;  3U1D A;  4A5N A;  1GXP A;  3ZMV A;  4KFC A;  2JTV A;  1BJA A;  2MD5 A;  3WTW C;  3G3Z A;  1CF7 B;  2ZXJ A;  3HSR A;  2ETH A;  1Z1D A;  2MH2 A;  4R1H A;  1UST A;  5K5O A;  4U0W A;  2YX7 A;  3RPU A;  3F8F A;  4HV5 A;  4Y13 A;  2EFP A;  3IC7 A;  3F8N A;  4Q4Z F;  1HKT A;  4RGS A;  2E7X A;  1BIB A;  4ESJ A;  3Q9V A;  4GCV A;  1J5Y A;  5FFZ A;  2HEO A;  2L01 A;  5D5X B;  1U5T B;  3FX3 A;  1XD7 A;  2ESH A;  3ZMZ A;  3R4K A;  5HDN A;  3TOA A;  3U9G A;  5CLS A;  5J8F A;  1L3L A;  3F6O A;  1PDN C;  5E20 A;  1IN4 A;  3GZ5 A;  1DUX C;  2KIM A;  4S04 A;  1MDM B;  1J7K A;  3GW2 A;  3RTR A;  1LDD A;  4CDG A;  2M87 A;  2XAJ A;  1SD5 A;  1YO5 C;  1MGT A;  4EJU A;  4F7Z A;  1YYV A;  2PG4 A;  2WTE A;  1YW8 A;  2KJB A;  4N9I A;  2Q0O A;  2YSR A;  3E97 A;  4KN4 X;  2VXZ A;  5CVI A;  4PGH A;  4QLC U;  1G6N A;  2QQ9 A;  2P7V B;  2Y75 A;  5AIQ A;  4OMY A;  1W7P B;  2Q2E A;  5FLX K;  3I54 A;  3ROU A;  4ZZL A;  4M9Z A;  2HOE A;  5FGM A;  2YU3 A;  5HLH A;  3C3W A;  4FX4 A;  5TJJ A;  2QLZ A;  3FXQ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...