1XPXA

Structural basis of prospero-dna interaction; implications for transcription regulation in developing cells
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
144
Chain Sequence
SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Prospero-DNA Interaction: Implications for Transcription Regulationin Developing Cells.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation/dna
molecule keywords 5'-D(*AP*GP*CP*AP*TP*GP*CP*CP*TP*G)-3'
total genus 54
structure length 144
sequence length 157
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1xpxA00
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH superfamily
4L9NA 3M1CA 4X6AJ 3D5RC 3F8BA 4F3QA 4CH7A 3F21A 4H4KC 1D8JA 4AIKA 2HYFA 3MMYB 1YQAA 4RA2A 1OYWA 2LD5A 1B6AA 1O3RA 3ABKH 2VXZA 1J0RA 1XTAA 4NBQA 2DPDA 4ESFA 2DOFA 1PUFA 4XSXF 2PMZA 3R0AA 2R5YB 3VOEA 5J3LA 5LLQA 1QHGA 2FX0A 4UY8I 1UHSA 1EH8A 3WTTC 3KFWX 4FASD 4BEHB 3GFMA 1FMVA 2KIQA 2JA7J 2KP6A 4A2UA 2LOOA 1Y0UA 2DJIA 4N9IA 1U9NA 1IV6A 1B8IB 3H36A 2IGNA 1GXQA 2XGCA 3ABTA 3NEUA 3BC8A 1ZN2A 5JVTA 1W36D 1TQPA 3K4KA 1TNSA 1YOVB 3OS0A 1TQIA 4PFOA 1W7PB 4EQQA 2K9LA 5FKNA 2D2WA 4K2EA 1A6IA 3E5XA 5IYCJ 1L3LA 3GTMJ 2NS7A 3HOXJ 2Z3YA 4O5VA 2ZKZA 3D1NI 5IP7J 2Q2EB 3WTWC 2MLGA 4PGHA 4RAGA 2KIUA 4CGZA 1OQYA 3F8FA 5TGTA 2ZCWA 1OYYA 1X1PA 1LNWA 3SEQA 1TC3C 3JAMK 1UZCA 2BBYA 3MAJA 1U0JA 2X6YA 3CMEI 2XC7A 1EJ9A 2COBA 4IHWA 3MKLA 1IJWC 2JA8J 2W1OA 2M0MA 3RPUD 3L2UA 3B6CA 3WG7H 2CJJA 3PQJA 1YG2A 1BR2A 3CCVI 3M8EA 3OYDA 1LE8B 1TWFJ 2EZIA 2R5ZA 2PJPA 3E6MA 3HRUA 3G2BA 3IC7A 2HOAA 2IS1A 1SMYF 4J00A 1TT0A 3CMMA 3AKZA 4A0YA 2YX7A 2F4IA 3W6KB 3OYJA 4KIFA 1V5EA 2MA3A 2PMZN 4PJNA 2PJRB 4QLCU 4PJLA 3V8JA 3HTSB 4EJWA 1A04A 1WQ2A 2X48A 3GF2A 4FT8A 2BV6A 1S5LC 2XPUA 3FMQA 4XORA 3TW6A 2CFOA 1TW2A 2NNYA 3HOSA 1ZR4A 2R93J 3CC2I 1TL8A 2F4OB 3H9JA 1FP2A 4F92B 5ILVA 5KNLA 1CGPA 1PP8F 2JUGA 3WE2A 3BP8A 2WB1N 5J40A 4A3IJ 1O57A 3OR1C 4PGGA 5IT9Z 2Y9YA 3OOUA 3WGHA 4NC6A 1ZG3A 2RGVA 3CC4I 3HIFA 3WTZA 3K0LA 3L2QA 5M3FJ 4CCNA 5F04A 1R1VA 1JTXA 3KZIC 3RKQA 1OCRH 3HJEA 4HV5A 1IC8A 4EJOA 3HPGA 4BY1J 2DPUA 1R00A 1I50J 2GZWA 1VFCA 2IT0A 3GCMA 3TOAA 2CUFA 5KK1A 1QGPA 3SFIA 5DM7F 5E3OA 1VNDA 4L18B 4BQNA 3T1BA 2Y9ZA 3LSTA 2E1CA 1BR4A 2CUJA 2JPCA 5K5RA 4R79A 4A3EJ 4OU0A 1ZRCA 1AKHA 1HF0A 3P9CA 4HQMA 1S7OA 4HOBA 1P4XA 4I0AA 2XF5A 2MD0A 3LSGA 4NC7A 4UVAA 4BBRJ 3J80Z 3LSRA 3JRIA 1GXPA 2A5YB 2LVSA 1W0TA 4OOIA 3IRRA 2Z33A 4MTEA 1KU2A 2E5ZA 1YRNA 3FK6A 2IGMA 3HOTA 3WU1B 1Y39A 2VBZA 3I55I 3WTYC 3HOWJ 2RV8A 5FROA 4WCGA 2DTRA 2L9SA 4IZZA 3COAC 4I76A 3I59A 3KZYA 3L2CA 4XONA 5K7FA 4IQ4A 3ZN1A 4AVZA 1MMAA 2R7SA 2GQQA 2HXOA 4P9FA 1S72I 1DGRM 1K6OA 5J1RA 2BVLA 1UJ8A 2VJIA 3LSHA 3Q9VA 5ICCA 3CD6I 1BIBA 1BA5A 2QSFX 3KP6A 2EIJH 3HBLA 3SJMA 2GIZA 2QKMB 4YFXF 1LVKA 2LF7A 3CUQA 4II2A 3ZP5A 5L3DA 2K4JA 3L09A 5D4SA 3P7NA 4L5EA 2VB6A 3CF2A 4I6ZA 2ZMEC 2ZMEA 3A2KA 4EGZA 3I4NJ 2X6XA 3BY6A 3PO2J 2PG4A 5B3SH 2XF7A 2QUFA 5EZHA 2Z16A 5FKKA 1IXCA 4WF2A 2Z5UA 3VYTB 4ABZA 5CPRB 4B43A 2RNJA 3D0SA 5FFZA 1H88C 5CLSA 4BU2A 4XKWA 4IX7A 2OF7A 2RC4A 1LUJB 4RS8A 3IUOA 1Z05A 4ZDPA 1LEBA 2P81A 2M87A 4HF0A 3CMYA 2FQ3A 2HQ5A 3FXKA 3V8LA 1HQCA 5IT9K 4WWCA 2M30A 1WVRA 2WV0A 1Z91A 3LSJA 1B59A 1TTYA 1YW7A 2M1BA 4LOCA 4F55A 3CQZJ 1T8IA 4AD9A 2DMNA 4ZZLA 1U5TA 1X3WB 2GXAA 3I9V2 4XLPF 3RJPA 2PBIA 5BS6A 4CDGA 4KIGA 5CQGA 4OMYA 2UZKA 2D45A 5ICFA 4A0XA 3HDDA 1S9HA 2HYJA 2STTA 3QRFF 4JP0A 4HX8A 1HA8A 3DBLB 1SFOJ 2KDOA 5A2QZ 1MBFA 3RQIA 4MGRA 1FTZA 2DJNA 1RETA 3E1SA 3DWLE 3HTUA 1BBYA 4P5OA 1U78A 1R58A 2CQQA 4I7HA 4A3JJ 4RB0A 1ZLKA 1Z6RA 2IW5A 4ZYHA 1WJBA 2DA5A 3QOEA 4ZYEA 3ZMDA 1ULYA 3WGGA 2WY8Q 1W7PA 3CCRI 1S3JA 5L3FA 1H89C 3D5SC 3CUQB 4EM2A 4KNYA 1A6QA 3K4NA 1V4RA 1FBUA 4DOZA 3T0YA 5FLXK 1GVDA 4R8HA 3V8KA 1R1UA 1PJRA 3JW4A 3PFYA 1P4AA 3KEOA 4HNVA 1Z3YA 2XIGA 3E6DA 1X2MA 3PUBA 2BYVE 2BE5F 2VKVA 1Z9CA 4EGYA 3I59B 2JRMA 2GA1A 5AIPA 5DDGA 1T38A 4AUXA 4CXFA 1FSHA 1OCPA 2LG4A 2X4HA 4B8XA 2F5CA 3DEWA 2R5YA 3PQKA 2DT7B 4DIQA 3MD2A 3HOUJ 4XN3A 1WJCA 3ZMTA 2CS3A 3LQRA 1I3QJ 3J7ZI 2EV6A 4XKVA 3RTRA 2PI0A 3L9FA 4JX5A 5C4XJ 1SFEA 4BEHA 2CW7A 1SC7A 2IA2A 4I09A 5L3BA 5LD2C 1U9OA 4CCJA 3BPXA 4BJTA 4YG2F 2WAFA 5LGNA 3ZXSA 1EA3A 1JT6A 3K10A 4QIWN 1FBSA 2IS2A 1NK2P 4U7DA 3S3NA 3A01A 1HBXG 5AONA 4CZZA 2FBHA 4G12A 1V5FA 3BG7A 3AL0B 1XC5A 2LC2A 4UXNA 1P2FA 4S04A 4Y15A 2ELHA 1ZKGA 5D6FA 3HGGA 2B0LA 2DMQA 2EPFA 2PQ8A 2FXAA 1R36A 1PVEA 2UWMA 5E8GA 5DUKA 3J7YJ 4NNJA 1YX3A 3A01B 2DMUA 1L0OC 3K2AA 5LEJA 1R7JA 4Z2YA 5DUIA 3LA3A 4AIJA 2XAJA 1SD6A 4N0BA 3U1KA 3H35A 2VQHA 4ETSA 2LYCA 2DA6A 3KYCB 1IXRC 3X2QH 3SYTA 4FX4A 1MMNA 1ZK8A 3CCUI 1EF4A 2VT3A 3L2RA 5CVJA 1NK3P 2V1XA 4IJAA 3VDXA 3JTHA 5F0FA 5K5OA 3KE2A 4ZYDA 3IAM2 2L2OA 2XRNA 1WJDA 2F5VA 1ETOA 3DKYA 2JSPA 2E2JJ 2QM3A 1JE8A 5GAGJ 1N25A 1ETWA 2OC6A 3F0CA 1IV8A 2LBFA 2WA0A 3BZCA 2ZJPF 3LA7A 3E5UA 1W36C 3ECOA 2M7BA 4EEFG 4B47A 4BHCA 3IH3A 2HS5A 2OBPA 3L00A 1UFMA 2ADUA 2L9VA 4FE7A 3ZMUA 1YO5C 1GVJA 1K4SA 1XCBA 2MD5A 3FXRA 2H09A 3CJRB 1JJ8C 3H9GA 4CYCB 4G6TB 3QYEA 1UG0A 2JJ7A 5TISC 4XBFA 1YX5A 2E1MC 4UUSA 3E6CC 4L0YB 3HGYA 4RB1A 1YYVA 4V19K 1J5YA 4AYBA 4DBQA 1JHFA 5J4VA 1AWCA 2E5NA 1RKWA 4XSZF 2LBFB 1A35A 1A36A 2QBYA 2UUZA 4WXHA 2GOMA 3CUOA 2UV1A 3TP0A 2CV2A 4CHUA 2XASA 3MN2A 3I54A 1EH7A 4BY7J 2X6OA 3HB9A 4BYYA 3WTXC 4HX4A 1XSVA 4MTDA 2TRTA 2KZGA 3S93A 1BOBA 1HDDC 5D4RA 4P55A 1ZR2A 3M07A 1H9TA 4NUBA 4ENMA 3F8MA 5FD6A 2YS9A 1IZ1A 1X2NA 2KDZA 5HLTA 4LD5A 2V6CA 2HPIA 1X1CA 2K7LA 1IN4A 2ECCA 1YJNI 3W6VA 4N9HA 3PUFA 4UVCA 1ON2A 1P4WA 3PIPF 3SEZA 4E7SA 4KA4A 1N77A 2A5WA 2CQ7A 5IT3A 4DW6A 4ASNA 3TP3A 3CLQA 2HKXA 2OD5A 2P7CB 2NYXA 4EMSA 3MQ0A 2HFHA 2EB7A 4DYRA 3OSGA 2DXIA 1TT5B 2M8GX 2E19A 2A6EF 5CVRA 2CQNA 2ACJA 1MBEA 2M4GA 2W00A 2XGXA 5M5YJ 2QQBA 4Q5SF 3L7WA 4KUMA 4G94A 1JJ6C 4CCKA 1OJLA 1WJEA 1E3PA 3OIOA 2M8EA 2VUMJ 3LSMA 1R4NB 2D1HA 5FB2A 3ZOBA 3KCCA 3NWSA 2HQAA 2OA4A 2LKSA 4HG2A 4E7IA 5LBQA 2D5VA 2J5OA 3UNGC 2WC2A 5KAFC 3BR0A 4EJTA 4V2FA 2L7FP 1E3HA 2H94A 2DQLA 3GW2A 2DODA 4IEJA 3ERMA 4UUTA 4ZYAA 1ZYRF 3DU5A 1PP7U 2LF8A 5J8FA 2MH9A 4A12A 4IF4A 1FOYA 1QVTA 2DI3A 3S1QJ 1Z0XA 2ELJA 3OR2C 1O7FA 3OYLA 3A0BC 1T2KA 3W3CA 1JGGA 5M5WJ 2B9SA 2XRLA 2JRTA 4RGXA 2CW0F 1LEAA 2W24A 2EFQA 3AG4H 5DCMA 1G4DA 5EGOA 2EZLA 3G1MA 1YJ9I 1E17A 3JRBA 3S8PA 5BNGA 3MZHA 3KLOA 3BCBA 5LGUA 1IN6A 1FOWA 2ZJRF 3V42A 3ASNH 4BQQA 2JA6J 1JKRC 3U9GA 2AQFA 4M3DA 3KP4A 1MBGA 1IXSB 3SDGA 2DDBA 1ITYA 4KMUX 3AL0C 1XMKA 2XKPA 2DA4A 1J75A 1SANA 3EUHA 4A3MJ 4ITVA 3VSLA 4C3JJ 2WAQA 2OU2A 5JI6A 2I10A 4DJAA 3LMMA 4G7HF 1S7AA 4RGUA 2QCOA 1MNEA 2DO7A 3DTIA 3E7LA 4J01A 2X0LA 4BDZA 2PFBA 1W1WE 2CRGA 3G3ZA 3W6JB 2K3FA 4KJZA 3BOQA 1DP7P 2E7WA 2LP0A 2MW8A 4KT6A 1XMXA 3O2PE 2ME6A 2Y48A 5E1ZB 3EQLF 5B1BH 2Q1ZB 4MQVA 5J4YA 1MBHA 1JTYA 1I6XA 3LNQA 1NHAA 3MKWB 5KCMA 4GRIA 3JTGA 1X3UA 4PJ0C 5CYVA 3LAPA 2DOAA 4RBOA 3FKJA 4L5JA 1IF1A 3F8CA 2CSOA 2KJBA 5JVGF 5K7ZA 1X1AA 2HU9A 2DK5A 3CJTB 3B6AA 4MQ9F 3RKYA 4BH9A 3PL8A 4A3LJ 3EETA 4KN4X 4MFEA 3SQNA 5FLVA 3CO7C 1JKQC 3ASOH 4NQWB 4BE1A 1KQ9A 3BTCA 2IXSA 1ETQA 3BG5A 2WTEA 2COMA 4L9TA 4A3KJ 2MC4A 2DOEA 1ZELA 4ESJA 3E97A 1BM9A 3JREA 1TWAJ 2DW4A 1T33A 5GTIC 3MKZA 2EWNA 2JA2A 2NOGA 2BY1A 2HWVA 3F22A 4ZDLA 3ERED 3TKYA 1M1EB 1FNNA 4OAYA 2VBWA 2R7ZJ 2XAFA 1FYMA 4UUVA 3VYRB 4CSWA 2A61A 4JYKA 3TBIA 2IS6A 3RYPA 1YFHA 4C3IJ 5FJ8J 2KZVA 5E1WA 4NQWA 1K4TA 3IL2A 3FM5A 1USTA 2FNPA 4BNCA 1DPRA 1HW2A 4NC8A 2O5RA 2OCCH 3CZ6A 4JQFA 2KKOA 4HDUA 3BPVA 2BVMA 4U88A 4HQEA 2VBXA 2K02A 1R23A 3E6BA 2MLKA 4FQGA 3V7RA 3FXMA 3W2WA 5E3MA 5F0HA 2FSWA 2XAQA 2Z9OA 4MO7A 3OYGA 1B9MA 4GCVA 1SEUA 2NVUB 2PLYA 1Y8QB 1WJ5A 1MW7A 1U6GA 4RLQA 1AOYA 5LFAA 4YELA 3S2WA 4HW0A 2DA2A 5AIQA 2LSOA 1IRZA 1IUFA 1K6YA 1UHMA 3KYDB 3WHCA 4FCYA 4BJ5C 1SD5A 2DAOA 2W85A 2Y0SN 4I01A 3JRGA 2N8GA 3FBIB 1LVAA 2A69F 3AAFA 3CESA 3W2VA 3HUGB 2ZMEB 2JPBA 3HKZN 2JSCA 5E17F 1IDZA 1U8RA 1MZBA 1U2WA 1GHCA 1FSEA 1MJ9A 3WU0A 1CQTA 4XR6A 3F8NA 3GVAA 3C1DA 1QPIA 1B1BA 2O8KA 1W5TA 2VI6A 3H0GJ 1OFCX 4CCLA 4C2TA 5D8LB 4AC0A 2VKDA 2ZFUA 5HS8A 1QBJA 1QZYA 2F5FA 3CP2A 1TBXA 4Y13A 5IOZA 2HTJA 1BI1A 2CH0A 1VQ9I 1IO2A 4E7ZA 2Q8KA 3M4OJ 4L5IA 2P4WA 5HLIA 2L9NA 2C6YA 2GXBA 2A6TA 4WXDA 1E3OC 2BOLA 3ULQB 5JHFA 1YTYA 2K4BA 4MNUA 3FX3A 5GPAA 1ETXA 4G7ZF 2Z2SB 1JKOC 3A4CA 1B72A 2E71A 4A3DJ 2WB1A 2L7MP 4WXCA 2CQKA 2E1MB 1D3YA 2QSGX 2ZO4A 1WWXA 2EFNA 2MG4A 1XPXA 1X19A 1FPQA 1RR8C 3B02A 3UR3C 4XLCA 3BG3A 2HVRA 3IWFA 3HL2A 1T0FC 1G3SA 3A1YA 2CGPA 4YIFA 3QPTA 4IL6C 2BEOA 4X0GA 3FXUA 4D5CA 1ORKA 3PSFA 1KZHA 3S14J 4QWQA 3DP7A 1VQKI 2CFXA 3F3XA 3ABUA 3LSIA 1YJWI 2E35A 3H5AA 4M3FA 1BI3A 1KU9A 4M9ZA 5GAHJ 4XKCA 3FHZA 1ENHA 1YE9A 3DQVC 4A6DA 2V79A 2QLZA 4GDFA 2CMPA 1TLHB 4MEXF 2XSJC 2O6GE 2ZJ2A 2O7OA 4C9YA 3OL4A 2HDWA 2GBYA 1P7IA 2Y75A 2DFIA 3U1DA 2IP2A 5D5VB 4NB5A 1F4KA 2FJ1A 5IY5H 1IRGA 4IKFA 3QYBA 2HPMA 1DU6A 2R7VA 2K9SA 4IHXA 2L02A 2VODA 2K5CA 3CMAI 3HSFA 3IAS2 4XLNF 4LB5A 2DYRH 4I2OA 2ZXJA 1O7LA 4CO8A 1D0ZA 3BROA 1X4OA 3IHUA 4RLFA 2W57A 3ZQHA 2KFDA 5F1JA 1HKQA 4LITA 5LRSA 5FGMA 3QPLA 4M3GA 3T8RA 3GFIA 1XGOA 4DYCA 2L4AA 1IN5A 4ON0A 1FIPA 2KJCA 3A0HC 3LWFA 4LMYA 4U0WA 2DCEA 4RB3C 4IHVA 2V1UA 2F6CA 2QA4I 1YI2I 2JN6A 2X1EA 3KX2A 1XX5A 1G6NA 1WFXA 3ABMH 4R1HA 2J5PA 5IYBJ 2M9HA 1ZRDA 3TO7A 2H1KA 5BPDA 1VQ4I 1I1SA 3GWZA 2HXIA 3H5NA 2X6WA 4HPQA 5C4JJ 4OINF 1LQ1A 1X3ZB 1Z77A 4BBSJ 3N4MA 4BAYA 4OIOF 4XRSA 3K4BA 1V5GA 2LKPA 1B8IA 2ZC2A 5CKTA 3K1NA 4XNFA 3F6VA 3MFKA 3GLXA 5F27A 2R7FA 1MSFC 2KIMA 5KVRA 3QPSA 3I53A 3OV8A 5TJJA 4IRHA 1ZQ3P 2A3SA 3F72A 3J81Z 2DK8A 3BR3A 3S32A 3PM1A 4F91B 2EV5A 2DDAA 1FY7A 4U87A 4Q4ZF 2RQQA 4A6EA 3KP5A 3J7AY 4YEJA 2HR3A 4B3XA 3U21A 3PNTA 2E36A 3HOYJ 3TO9A 4A5MA 3RYRA 1EKEA 2F5EA 3ZQLA 1J9IA 2RQPA 2QSHX 3TO6A 3IRQA 2YUSA 1FTTA 2F5DA 2M3AA 5DD4A 2JT1A 2E60A 4BS9A 1QZEA 3CTAA 3WHBA 4B48A 4EVIA 1OR7A 1IG7A 3LSPA 3WG9A 2YSRA 3VEPA 2MYSA 2Y69H 4ZZDA 3V7CA 2VOPA 1V3FA 3GTPJ 1QU3A 3GMEA 2QEXI 4M3BA 2XKOA 2H8RA 1RZ4A 2RREA 1ZH5A 4AWXB 1JXSA 3DTEA 3H0DA 3CCSI 3R0JA 3AFHA 2HEOA 2LKXA 2LY2A 1RIOH 1I6HJ 3HG9A 5DTDA 3T5XA 4FISA 4I02A 3JRAA 3EUAA 2H1LA 2K3PA 1ZRFA 2EIMH 5D8KB 4IXAA 3DPLC 3HSEA 1WI9A 4ZH4F 2PX9A 3HRTA 2E1NA 1S29A 1TP4A 2TCTA 3H9QA 3IWZA 3ECHA 4FHTA 4II3A 2EILH 3KYLA 1UAAA 4LG0A 3CCLI 4HF1A 3GZ5A 2I5UA 1FOXA 3CDHA 1ETYA 4OIRF 2L3DA 3S3OA 2OQGA 1TZLA 1V54H 1GV5A 1T0FA 3VPRA 2R4GA 5LRRA 2RKHA 4HNTA 2UXNA 1LDDA 4RDUA 3OYEA 4XOPA 4BKXA 1XN7A 1K78A 2STWA 2IEKA 1HW1A 3RDIA 4CA0A 3UKGA 3CO6C 1D1CA 4KN7X 2DMPA 4PDKA 4IRGA 4XLAA 2M2EA 1U5TB 4JBAA 1IW7F 3FWEA 3R4KA 3IKTA 1GV2A 4EM0B 2WV1A 5CVIA 2L7KA 1ONVA 1IAWA 2MFZA 5JR3A 1ETVA 3Q3SA 2ISZA 3L2VA 1KU3A 2JA5J 1VQ8I 3FF5A 1RNLA 1R49A 1ACIA 2MC3A 2V1NA 1AHDP 2ID6A 1WKMA 2AQEA 5F6FA 3VB2A 2R7UA 2EA2A 2L5QA 3B73A 2PMHA 2HNHA 3M1EA 2ME0A 3S1RJ 4HEA2 1D8KA 3OYNA 1FYLA 2ECBA 2ICWG 5C3EJ 3S1NJ 2VE9A 2IRFG 1G8XA 1MNDA 1HOMA 1HW5A 2P7VB 4A5NA 1N75A 5J8CA 1SMTA 3O8HA 3CJNA 2P6SA 1YRNB 2VL8A 3GFJA 5IPAA 2VC0A 4N4NB 3M8FA 1NTCA 2XPVA 4Y7NJ 2KHMA 1O3SA 2EBIA 1DUXC 4ZJZA 1SAXA 2FF4A 4CICA 2L01A 4KISA 4PK4A 1K7AA 1B4AA 2EJRA 2R7RA 1MH4A 2FOKA 4QSHA 1FX7A 4XICA 3FMRA 4CCOA 3L2WA 3SXYA 2HQNA 3OYAA 4C30A 2BY3A 2CO5A 2ZSHB 1POGA 1LFUP 2GM4A 2X51A 3I3LA 3RI4A 4ENKA 2CQXA 1SD4A 1Y8RB 2YPRA 3KEQA 2FU4A 3PNVA 3Q0UA 5M3MJ 3CCMI 1N78A 3CJQB 3Q0WA 2DLLA 1UHWA 4M73A 2DMTA 2QQAA 2XGDA 5C44J 2DBBA 2XGEA 2IA0A 2L54A 2FRHA 3RZOJ 3RCOA 2WAEA 3FISA 1T39A 3HSRA 3VYSB 4ZTFA 2ETHA 4BACA 3FM3A 2JZYA 3TGNA 3WODF 2H6CA 3Q9SA 2KT0A 2Y31A 4IHYA 1SFKA 2EIKH 3OYFA 1IN7A 1RR7A 4PUSA 3RPUA 1MJAA 1QQIA 1OR7C 4MLOA 4AIHA 2H6BA 5FO5A 1DPUA 4NDLA 4HF2A 4Y3OA 1LKXA 3H1CA 2K85A 3K7AJ 4OWRB 1WSUA 5KHDA 2GOXB 3AG1H 1ZGWA 4G7OF 2PEXA 4D1QA 2HOSA 1VQNI 5J47A 3NWTA 3JAMZ 2K9QA 4IHTA 3R60A 1QVUA 3VODA 1E0EA 4D5FA 3LAJA 1SD7A 1HC8A 4DQ2A 3OYHA 3PSIA 2EFWA 3IV5A 1HXDA 1MD0A 2D1VA 2X9DA 3WTVC 2HDDA 1TWCJ 2E7XA 4AU7A 3FXLA 3OS2A 2QBYB 2W48A 4YFNF 1P6RA 5J6XA 3NAUA 3BT9A 3S17J 2VPRA 1MIJA 3KIOA 1Z7LA 1LB2A 4IRIA 2HTSA 3HEFA 1B9NA 4D9JA 2IVMA 3J81K 2K27A 3OS1A 2BHZA 2Y30A 1BW5A 2LTPA 2DN0A 3EYYA 1DDNA 3HOVJ 4M71A 2HGCA 1RESA 3LQQA 2VQLA 3FXQA 3K69A 2AXLA 4DYQA 3GTKJ 3W2AA 4L9VA 4JOMA 1XDUA 1O4XA 2R7TA 3O8GA 5FFXA 2OCEA 2IJLA 3JSOA 1ZHFA 4BDYA 2CV0A 2XDVA 4GXOA 1YIOA 3N05A 2EA4A 2YU9J 3QODA 2VLAA 1FLIA 3LOCA 4UNOA 2E1OA 3ML6A 2ZBKA 3EUKL 2GXGA 4D0PA 1WH7A 4RAZA 1W0UA 1F43A 3CCJI 4XIDA 2F4MB 2K9NA 2V9KA 4JX4A 3TL4X 3BLYA 3IP4B 3RPQA 5HOOA 2MGQA 4P1WA 4XKBA 3LFKA 4Y52J 3DPUA 3DV8A 2ELKA 5H6RA 4G9YA 2PJRA 4F93B 2DFFA 2QKLB 1FJLA 1YW9A 5DCFA 3HOZJ 2UXXA 3JR9A 1QPMA 3DKXA 2BY2A 3J80K 1SFXA 4HSRA 1QZZA 3K4JA 3RIRA 5IOYA 1X1DA 2W4SA 3TOBA 2JWTA 3M7GA 4O6JA 1KYWA 2QZ8A 4U0YA 4AM3A 1MMGA 2VJ5A 3R6SA 4UV8A 5E8IA 4J19A 1R5HA 2ID3A 1F36A 3C7JA 3WTUC 3FBNB 2IAIA 1USSA 5F1RA 1KQ0A 2VOOA 5DCMB 1C0WA 3IKVA 3QWLA 2DTZA 5L3CA 2DA3A 1GUUA 2VN2A 4P96A 2P5LC 1R71A 1WPKA 4FE4A 3NQOA 5HLHA 4UHTA 5HVQC 1D5YA 3BJOA 2WBMA 1ERDA 4Y4RA 3ESWB 3P5JA 4RM3A 1LDKB 2M0CA 2KRFA 5FD5A 5EJCA 2R5ZB 2LNBA 1REPC 3OL3A 1GT0C 1RRJA 1QNTA 2VC1A 1IDYA 3GLLA 4XN0A 3KEYA 2CWEA 4LK1F 4EM1A 5IYDJ 2RAEA 1ZTRA 4KDPA 4D7NA 3SFZA 3ZQFA 4E4HA 1H8AC 5DD8A 1MKMA 2EQRA 3GTLJ 2BXZA 3GTGJ 1Y0NA 2M5WA 5EG0A 1P92A 3OWTA 5ICGA 3FDYA 2KIFA 3J7AO 3SZGA 4PFPA 1U3EM 4BJ6C 3DXJF 4HA8A 4DGWB 1B72B 4ZTJA 3ROUA 4M74A 1MSEC 4LG0B 1X58A 3RQ4A 1XSXA 3ZRGA 5DV5A 3NRVA 5E20A 1RI7A 5DS9A 3DPTA 1VI0A 3Q0VA 2IBDA 3I4PA 4ENJA 1YHQI 3FXJA 2DFEA 4BL0B 2LLKA 1JUPA 3D5LA 4RAYA 1OCZH 3EYIA 2QVOA 1VQ5I 2AO9A 2PMUA 1TNTA 3K1PA 5L3EA 5EDNA 1W4MA 1WI3A 1KYZA 2ZXHA 3DBRB 2IGOA 3G1LA 4I99C 3RKXA 1OLTA 3BTIA 4BUPA 2OZUA 2JTVA 4QTRA 4BXFA 3GYHX 4MEYF 5H20A 3OSFA 1U8BA 3CP8A 4HX7A 5HS9A 4A93J 1XD7A 2HYGD 2EV0A 4XLFA 2JUCA 2NS0A 2R0QC 4BHBA 3K1MA 3WTSC 5D5WB 1G2HA 4HV6A 3K2ZA 3HUGA 3LA2A 3HC7A 2QYOA 4KICA 4PZJA 4H0EA 2O61A 4ANJA 2XHKA 1EH6A 5D5UB 2Q0OA 1UELB 4XRMA 4JX6A 2P8TA 1BI2A 3JRFA 1Y1WJ 2AS5F 1FZPB 4FX0A 4LIUA 1MH3A 3ZCOA 4BQAA 1AU7A 3HZJA 3TEDA 1BL0A 2O0YA 5LEKA 3S1MJ 4BE0A 2A6HF 3MWMA 3PNYA 3QOPA 1HKSA 3MKYB 4EJUA 4MHGA 4E7KA 1OMIA 3HM5A 1WGXA 4YIIA 3GZNB 2OZ6A 2VE8A 2VQGA 1FIAA 3WGIA 3FZVA 3TQNA 4UV9A 4B44A 3M3YJ 3OIQA 1WJFA 1D0XA 2IA1A 3O3KA 3DLAA 4IHSA 3JRHA 4D7MA 1YIJI 1VZ0A 1R5GA 1PYVA 1KA8A 2FBIA 3QYFA 2HOEA 1T6SA 5LHGA 1O3QA 2FNAA 3M9AA 2GA2A 4PSWA 3TDUC 1S8NA 4WK8F 1T08B 2FA5A 2OAZA 4Q48A 1J09A 2Y2ZA 5CVVA 4LLLA 3WE3A 3FKIJ 2NVYJ 3K70D 2LMDA 4M6VA 2H27A 3HYIA 3K4MA 3ZMSA 4Q47A 2WY7Q 2KPMA 4HDVA 1XG1A 3BG6A 3DBHB 4I0BA 4XL9A 3FK7A 3DTKA 2AHQA 2Y0SA 2HVQA 4OIQF 3HRSA 4E7HA 4IVNA 4RB2C 2VXDA 2LR8A 4TV7A 2ZSIB 5JLXA 2BHYA 1WZ2A 2WWYA 2HDCA 4HSTA 3GTJJ 1I39A 1FOKA 4CYDA 3DLLF 1RKTA 1W5CC 3F9KA 2KMUA 1XCVA 4KT5C 1VQOI 3P9IA 4GGGA 3QP6A 1F9NA 3T8TA 3RKWA 3I0TA 1KONA 4B3AA 3QU6A 5H2FC 3S3MA 2KQRA 3CCYA 1F1ZA 2O03A 1KU7A 1F5TA 4I98B 3K4CA 3A02A 3ISPA 1YS7A 1HDPA 2XB0X 2I8DA 1VQPI 2DT6A 3RZDJ 3OMYA 1KGSA 2RN7A 3KLNA 1FWZA 1LFBA 1Z1DA 5BQTA 1ZGAA 2L7ZA 2PN6A 5K5QA 3CLOA 4FETA 3LFUA 5BPIA 4CZCA 4HNUA 4LK0F 4ESBA 2WAQN 4UB6C 2HVSA 3GTQJ 2JVGA 1Z21A 2NAZA 1H0MA 1TW3A 2XVCA 2FQ4A 1XGSA 3LL7A 4XLEA 3KP2A 3GZ6A 3GO5A 5GAEJ 3ZR8X 5HDKA 4V2GA 1OYIA 2A68F 1IRFA 3VSKA 3EDPA 4HBLA 1FP1D 4PJMA 1TWHJ 2DYSH 1I27A 2M34A 2LY9A 5EEGA 1A5JA 5DM6F 1I5ZA 1XGMA 5HLGA 5BMZA 2NXNB 5JLWA 1BJAA 3ZMZA 1K83J 5GP9A 1AKHB 3MZ8A 2XV4S 2VKEA 2FUG2 3DFGA 5LGTA 4WX9A 3I4MJ 4B09A 1OCTC 5E1XA 3BG9A 3GFLA 4GYIA 2ZNYA 5FLXZ 2BY0A 5H6QA 2GIVA 1CF7A 3BR1A 5J1UA 1J7KA 4ZDOA 5LHHA 2QF7A 1O3TA 1QO0D 2HKOA 2VQCA 2BXYA 4RAFA 2O3FA 2NVXJ 1K79A 3U2RA 3GTOJ 2XUBA 4MIMA 5HS7A 2RNGA 2IS4A 3S15J 4M72A 3ZQCA 1FC3A 2MH2A 2VT2A 1VQMI 2W84A 3TMOA 3OYKA 5LHIA 1DP3A 2LFBA 2KRCA 3OY9A 1VF9A 3ZQGA 3OYBA 1IUYA 2ZFWA 2QWWA 2V9VA 2VJ4A 3EPZA 4PCQA 2GLOA 4QPOA 1VQ7I 3V7SA 1K61A 1D5VA 1IRXA 3G6EI 3H92A 2CG4A 3ZQIA 4G6DA 3MCZA 4BXUA 5FLMJ 5F08A 2XROA 5JFRA 2BW3B 2P0WA 2K40A 2X1DA 1ZLJA 2OUMA 3DEUA 1X1BA 2P5VA 3DKWA 2L9RA 4EJVA 2VONA 1SVOA 3O6BB 2FMLA 3OIPA 4UB8C 4GFBA 4Z6YA 3C18A 3G71I 2LDUA 1ODDA 1TWGJ 1S7EA 1NG7A 2OTJI 1BIAA 4E70A 2QENA 3GEZA 4C3HJ 3VFZA 1D1AA 4XLHA 5M5XJ 3KPHA 4HYEA 3RSNA 1MBJA 2X85A 1MJBA 1BC7C 2VASA 1P7JA 3S2DJ 3ONQA 2F48A 2G0EA 3JRDA 1HKTA 3L1PA 2CW8A 3BZ6A 1PUFB 5HDNA 2R92J 1XGNA 1RPWA 4LGWA 3JRCA 2VJJA 4JK1X 1EV7A 3H3UA 2CV1A 1KQ8A 4QPQA 4XRFA 5ILUA 1HSJA 2FD5A 3BR2A 4FTHA 5B66C 6PAXA 4B4CA 5BOXA 3BCAA 3OOPA 2A07F 1IN8A 3QAHA 5ED4A 1S6LA 5K7HA 5B1AH 2KLOA 3DU6A 4DNCA 2ESHA 2EZHA 2TDXA 4L0ZB 4RM2A 3OYIA 3JSPA 5FRNA 1APLC 3IH2A 3BR6A 2W7NA 4KITB 3K6GA 3KP3A 4GYGA 1RUOA 1MDMB 2LRDA 3ZN0A 2EINH 1RUNA 3BQZA 2LY1A 1V55H 3QPHA 1Q1HA 4PJJA 4IPAA 2B63J 4RGRA 2NRAC 3I58A 4Y33A 1DQUA 2M7AA 4A3CJ 3HXLA 4B1RA 5E3LA 1ZARA 3CC7I 1DU0A 4O3MA 5HDGA 3MVPA 4X1EA 4HAMA 3SHFA 3FHNA 2QQ9A 2HOTA 2LREA 1R22A 3PO3J 2EFPA 1DGWY 1OISA 2FEZA 2R7OA 4XRSG 1MDMA 2R3SA 4AYBN 3QU3A 3H3ZA 3SDBA 5EEHA 1QA6A 1HLVA 3PIOF 3IH4A 1J2XA 5A2QK 1FMWA 4KYWA 2HI3A 3GX4X 1IGNA 2R7XA 4YIRX 5CJ9A 2NOJB 2XF6A 4A69C 1YLFA 2DFHA 1W5SA 1Y1VJ 3GXOA 1Q1VA 4MFDA 5EZGA 1R5ID 1UG2A 1XB4A 2CYYA 2DU9A 2P5KA 3JCUC 1BJZA 3I5UA 5EEAA 1J59A 2CU7A 1BR1A 1G3TA 1ZG1A 3BDDA 1UCRA 1G3YA 1XDSA 1XMAA 2BW3A 4LJZF 5ICEA 5KAIC 1MBKA 5JHUA 3OYCA 2XAGA 3BTJA 4DZJA 2V6EA 2Z1DA 1Y56A 3CDIA 4G6QA 4C2MJ 5CQEA 1MMSA 4KMFA 4NHJA 3S2HJ 3HKZA 4S05A 2VBYA 4PSXA 5IP9J 1H9GA 4N4OB 5CVUA 4HLXA 2VKHA 4EATA 3ZMVA 3WU2C 4OAZA 4YFKF 5FKOA 3K70C 4W1UA 3DCFA 4M9XA 4XMYA 4BE2A 2E2HJ 3VWBA 2FBKA 3FXOA 5FKMA 2M45A 2JQ7A 4OMZA 1XSDA 1BW6A 2EFOA 2AXTC 4AIDA 3HHHA 3KZZA 3BWGA 5L3GA 1Z3XA 2XAUA 2QQ8A 1I3AA 3ABLH 5HNFA 3PJRA 4E7LA 1SVLA 1YITI 2K9MA 1WRJA 4M9SA 3VYUB 1MGTA 5IP6A 3KP7A 2M4KA 3QQAA 2IGKA 1WJAA 2P6TA 4XK4A 1STZA 2VIXA 3R61A 3KETA 3BR5A 1X4PA 3MZYA 1QHHD 1MNMC 4IQJA 1JI8A 1LDJA 4L9JA 2GAUA 2MABA 4A3BJ 1I1GA 3GUDA 3TW7A 5FRMA 1Z6TA 3CDLA 1RC9A 1LE8A 1LJ9A 4DZPA 2LK2A 3I64A 1XS9A 1Z67A 2G9WA 5B5EC 2ZJQF 4F7ZA 4LLNA 5DEQA 1OCCH 2DT5A 1PUEE 2OJED 3AG3H 1ZG5A 2R7DA 5F0CA 2EK5A 3F6OA 4IO9F 1P9QC 5K1YA 2JMWA 2V26A 2E34A 1W7PD 3AG2H 3I71A 1D1BA 1HSTA 2K86A 1FT9A 1K78B 1BOAA 1VQ6I 2CUZA 5GADJ 2CUEA 3I56I 4BGDA 2BZTA 1D0YA 4CYCA 1SFUA 5FKLA 3TDZC 2NVTJ 2YR2A 1JUSA 4LB6B 4P9UA 2MBFA 5ILSA 2OQRA 2KISA 3HRMA 4W97A 4CUGA 4BQOA 3FIWA 2L4MA 2Q2EA 3C2HA 3E3VA 1A31A 2KL4A 3C2BA 4U7BA 4ENNA 5F64A 5E3NA 2XAHA 2ESNA 2W25A 2OTLI 1UMQA 1TQMA 1SVMA 5D5XB 5E18F 1BN5A 4IOCF 2O9LA 3ZPLA 3C2GA 2B7EA 2O8XA 4XQFA 3NARA 1YS6A 1E2XA 2XSDC 1FYKA 4GO1A 3V4GA 1G3WA 5EF6A 5EG0B 4KFCA 1PDNC 2Y0MA 4XM3A 2L0KA 3DF8A 3SZPA 2LH9A 5GTHC 1BI0A 2FOWA 3REOA 3G73A 4OIPF 4E6KG 3CCQI 1FBQA 1T56A 2DA7A 1FEXA 1AA7A 5DYMA 3F23A 1JT0A 1LPQA 1VQLI 2V1DA 5TRDA 1R9TJ 2RDPA 2YU3A 3CF5F 3BQYA 3A03A 3ZQ7A 2ZXIA 4LLGF 3G4SI 2WADA 5EYRA 3S16J 2Z99A 2RVCA 2G7UA 3H3VK 3G1OA 2ZB9A 3FMSA 3SZTA 1OKRA 3MEXA 2YX4A 2BGCA 1JGSA 5HODA 2EH3A 4ZC3A 1R6RA 2NNNA 1G59A 3HHGA 5HNHA 1JKPC 2ZNZA 1U5TC 1MMDA 4YRVA 3C3WA 1BC8C 1SAUA 3K9TA 1ZAOA 4HZFA 4UUSB 1OPCA 1GLNA 1T95A 3K4LA 1WH5A 3LSKA 5J1YA 4AVPA 4XOTA 1YW8A 4M6YA 3QP5A 2R7WA 2KRHA 1T98A 5D6EA 4RMNA 2GWRA 3BJAA 3CCEI 2ISYA 3Q5FA 3DEEA 5EGOB 1JUMA 3E5QA 4S0HB 2FMYA 4G8XA 2HQRA 4U0VA 4Y17A 4IOAF 1R4MB 4UVBA 4RGSA 4M3EA 1JHHA 1Z7UA 1UB9A 4LIVA 1WCMJ 1Y6IA 3P9KA 3H5RA 3M8JA 5ERIA 4LFUA 2X1CA 1CF7B 1ZGJA 1ON1A 1WHUA 3BZKA 3OYMA 3HPHA 2QGUA 1HCRA 4KIBA 4EV0A 1R1TA 2NVQJ 2V7FA 2F2EA 4BXXJ 2JVHA 9ANTA 4DBRA 2ZXWH 3CUQC 1VTNC 3ELKA 1NH3A 3BJ6A 2IPQX 2FE3A 4CCMA 4A0ZA 2MSYA 2VPLA 2EZKA 4LG3A 4C2UA 4M6XA 2W82A 3BTLA 2HZTA 2DA1A 2JK3A 3N97A 3PFIA 2A05A 4BHPA 4A3GJ 1OCOH 2H8WA 2OPTA 2DQRA 2E2IJ 2XPWA 2R7QA 1ZREA 4F52A 2XB5A 5E79C 3ZQQA 4E7JA 3GBGA 3ZGKA 2G7HA 2V9PA 2NS8A 3E0JB 1QRYA 2V4JC 4HRIA 5GPCA 3EUHC 1GDTA 4A3FJ 4ZYGA 2OV7A 4HLYA 1LFPA 2HZDA 1ETKA 1NG6A
chains in the Genus database with same CATH topology
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMD A;  1MIJ A;  1XPX A; 
#chains in the Genus database with same CATH topology
 4L9N A;  3M1C A;  4X6A J;  3D5R C;  3F8B A;  4F3Q A;  4CH7 A;  3F21 A;  4H4K C;  1D8J A;  4AIK A;  2HYF A;  3MMY B;  1YQA A;  4RA2 A;  1OYW A;  2LD5 A;  1B6A A;  1O3R A;  3ABK H;  2VXZ A;  1J0R A;  1XTA A;  4NBQ A;  2DPD A;  4ESF A;  2DOF A;  1PUF A;  4XSX F;  2PMZ A;  3R0A A;  2R5Y B;  3VOE A;  5J3L A;  5LLQ A;  1QHG A;  2FX0 A;  4UY8 I;  1UHS A;  1EH8 A;  3WTT C;  3KFW X;  4FAS D;  4BEH B;  3GFM A;  1FMV A;  2KIQ A;  2JA7 J;  2KP6 A;  4A2U A;  2LOO A;  1Y0U A;  2DJI A;  4N9I A;  1U9N A;  1IV6 A;  1B8I B;  3H36 A;  2IGN A;  1GXQ A;  2XGC A;  3ABT A;  3NEU A;  3BC8 A;  1ZN2 A;  5JVT A;  1W36 D;  1TQP A;  3K4K A;  1TNS A;  1YOV B;  3OS0 A;  1TQI A;  4PFO A;  1W7P B;  4EQQ A;  2K9L A;  5FKN A;  2D2W A;  4K2E A;  1A6I A;  3E5X A;  5IYC J;  1L3L A;  3GTM J;  2NS7 A;  3HOX J;  2Z3Y A;  4O5V A;  2ZKZ A;  3D1N I;  5IP7 J;  2Q2E B;  3WTW C;  2MLG A;  4PGH A;  4RAG A;  2KIU A;  4CGZ A;  1OQY A;  3F8F A;  5TGT A;  2ZCW A;  1OYY A;  1X1P A;  1LNW A;  3SEQ A;  1TC3 C;  3JAM K;  1UZC A;  2BBY A;  3MAJ A;  1U0J A;  2X6Y A;  3CME I;  2XC7 A;  1EJ9 A;  2COB A;  4IHW A;  3MKL A;  1IJW C;  2JA8 J;  2W1O A;  2M0M A;  3RPU D;  3L2U A;  3B6C A;  3WG7 H;  2CJJ A;  3PQJ A;  1YG2 A;  1BR2 A;  3CCV I;  3M8E A;  3OYD A;  1LE8 B;  1TWF J;  2EZI A;  2R5Z A;  2PJP A;  3E6M A;  3HRU A;  3G2B A;  3IC7 A;  2HOA A;  2IS1 A;  1SMY F;  4J00 A;  1TT0 A;  3CMM A;  3AKZ A;  4A0Y A;  2YX7 A;  2F4I A;  3W6K B;  3OYJ A;  4KIF A;  1V5E A;  2MA3 A;  2PMZ N;  4PJN A;  2PJR B;  4QLC U;  4PJL A;  3V8J A;  3HTS B;  4EJW A;  1A04 A;  1WQ2 A;  2X48 A;  3GF2 A;  4FT8 A;  2BV6 A;  1S5L C;  2XPU A;  3FMQ A;  4XOR A;  3TW6 A;  2CFO A;  1TW2 A;  2NNY A;  3HOS A;  1ZR4 A;  2R93 J;  3CC2 I;  1TL8 A;  2F4O B;  3H9J A;  1FP2 A;  4F92 B;  5ILV A;  5KNL A;  1CGP A;  1PP8 F;  2JUG A;  3WE2 A;  3BP8 A;  2WB1 N;  5J40 A;  4A3I J;  1O57 A;  3OR1 C;  4PGG A;  5IT9 Z;  2Y9Y A;  3OOU A;  3WGH A;  4NC6 A;  1ZG3 A;  2RGV A;  3CC4 I;  3HIF A;  3WTZ A;  3K0L A;  3L2Q A;  5M3F J;  4CCN A;  5F04 A;  1R1V A;  1JTX A;  3KZI C;  3RKQ A;  1OCR H;  3HJE A;  4HV5 A;  1IC8 A;  4EJO A;  3HPG A;  4BY1 J;  2DPU A;  1R00 A;  1I50 J;  2GZW A;  1VFC A;  2IT0 A;  3GCM A;  3TOA A;  2CUF A;  5KK1 A;  1QGP A;  3SFI A;  5DM7 F;  5E3O A;  1VND A;  4L18 B;  4BQN A;  3T1B A;  2Y9Z A;  3LST A;  2E1C A;  1BR4 A;  2CUJ A;  2JPC A;  5K5R A;  4R79 A;  4A3E J;  4OU0 A;  1ZRC A;  1AKH A;  1HF0 A;  3P9C A;  4HQM A;  1S7O A;  4HOB A;  1P4X A;  4I0A A;  2XF5 A;  2MD0 A;  3LSG A;  4NC7 A;  4UVA A;  4BBR J;  3J80 Z;  3LSR A;  3JRI A;  1GXP A;  2A5Y B;  2LVS A;  1W0T A;  4OOI A;  3IRR A;  2Z33 A;  4MTE A;  1KU2 A;  2E5Z A;  1YRN A;  3FK6 A;  2IGM A;  3HOT A;  3WU1 B;  1Y39 A;  2VBZ A;  3I55 I;  3WTY C;  3HOW J;  2RV8 A;  5FRO A;  4WCG A;  2DTR A;  2L9S A;  4IZZ A;  3COA C;  4I76 A;  3I59 A;  3KZY A;  3L2C A;  4XON A;  5K7F A;  4IQ4 A;  3ZN1 A;  4AVZ A;  1MMA A;  2R7S A;  2GQQ A;  2HXO A;  4P9F A;  1S72 I;  1DGR M;  1K6O A;  5J1R A;  2BVL A;  1UJ8 A;  2VJI A;  3LSH A;  3Q9V A;  5ICC A;  3CD6 I;  1BIB A;  1BA5 A;  2QSF X;  3KP6 A;  2EIJ H;  3HBL A;  3SJM A;  2GIZ A;  2QKM B;  4YFX F;  1LVK A;  2LF7 A;  3CUQ A;  4II2 A;  3ZP5 A;  5L3D A;  2K4J A;  3L09 A;  5D4S A;  3P7N A;  4L5E A;  2VB6 A;  3CF2 A;  4I6Z A;  2ZME C;  2ZME A;  3A2K A;  4EGZ A;  3I4N J;  2X6X A;  3BY6 A;  3PO2 J;  2PG4 A;  5B3S H;  2XF7 A;  2QUF A;  5EZH A;  2Z16 A;  5FKK A;  1IXC A;  4WF2 A;  2Z5U A;  3VYT B;  4ABZ A;  5CPR B;  4B43 A;  2RNJ A;  3D0S A;  5FFZ A;  1H88 C;  5CLS A;  4BU2 A;  4XKW A;  4IX7 A;  2OF7 A;  2RC4 A;  1LUJ B;  4RS8 A;  3IUO A;  1Z05 A;  4ZDP A;  1LEB A;  2P81 A;  2M87 A;  4HF0 A;  3CMY A;  2FQ3 A;  2HQ5 A;  3FXK A;  3V8L A;  1HQC A;  5IT9 K;  4WWC A;  2M30 A;  1WVR A;  2WV0 A;  1Z91 A;  3LSJ A;  1B59 A;  1TTY A;  1YW7 A;  2M1B A;  4LOC A;  4F55 A;  3CQZ J;  1T8I A;  4AD9 A;  2DMN A;  4ZZL A;  1U5T A;  1X3W B;  2GXA A;  3I9V 2;  4XLP F;  3RJP A;  2PBI A;  5BS6 A;  4CDG A;  4KIG A;  5CQG A;  4OMY A;  2UZK A;  2D45 A;  5ICF A;  4A0X A;  3HDD A;  1S9H A;  2HYJ A;  2STT A;  3QRF F;  4JP0 A;  4HX8 A;  1HA8 A;  3DBL B;  1SFO J;  2KDO A;  5A2Q Z;  1MBF A;  3RQI A;  4MGR A;  1FTZ A;  2DJN A;  1RET A;  3E1S A;  3DWL E;  3HTU A;  1BBY A;  4P5O A;  1U78 A;  1R58 A;  2CQQ A;  4I7H A;  4A3J J;  4RB0 A;  1ZLK A;  1Z6R A;  2IW5 A;  4ZYH A;  1WJB A;  2DA5 A;  3QOE A;  4ZYE A;  3ZMD A;  1ULY A;  3WGG A;  2WY8 Q;  1W7P A;  3CCR I;  1S3J A;  5L3F A;  1H89 C;  3D5S C;  3CUQ B;  4EM2 A;  4KNY A;  1A6Q A;  3K4N A;  1V4R A;  1FBU A;  4DOZ A;  3T0Y A;  5FLX K;  1GVD A;  4R8H A;  3V8K A;  1R1U A;  1PJR A;  3JW4 A;  3PFY A;  1P4A A;  3KEO A;  4HNV A;  1Z3Y A;  2XIG A;  3E6D A;  1X2M A;  3PUB A;  2BYV E;  2BE5 F;  2VKV A;  1Z9C A;  4EGY A;  3I59 B;  2JRM A;  2GA1 A;  5AIP A;  5DDG A;  1T38 A;  4AUX A;  4CXF A;  1FSH A;  1OCP A;  2LG4 A;  2X4H A;  4B8X A;  2F5C A;  3DEW A;  2R5Y A;  3PQK A;  2DT7 B;  4DIQ A;  3MD2 A;  3HOU J;  4XN3 A;  1WJC A;  3ZMT A;  2CS3 A;  3LQR A;  1I3Q J;  3J7Z I;  2EV6 A;  4XKV A;  3RTR A;  2PI0 A;  3L9F A;  4JX5 A;  5C4X J;  1SFE A;  4BEH A;  2CW7 A;  1SC7 A;  2IA2 A;  4I09 A;  5L3B A;  5LD2 C;  1U9O A;  4CCJ A;  3BPX A;  4BJT A;  4YG2 F;  2WAF A;  5LGN A;  3ZXS A;  1EA3 A;  1JT6 A;  3K10 A;  4QIW N;  1FBS A;  2IS2 A;  1NK2 P;  4U7D A;  3S3N A;  3A01 A;  1HBX G;  5AON A;  4CZZ A;  2FBH A;  4G12 A;  1V5F A;  3BG7 A;  3AL0 B;  1XC5 A;  2LC2 A;  4UXN A;  1P2F A;  4S04 A;  4Y15 A;  2ELH A;  1ZKG A;  5D6F A;  3HGG A;  2B0L A;  2DMQ A;  2EPF A;  2PQ8 A;  2FXA A;  1R36 A;  1PVE A;  2UWM A;  5E8G A;  5DUK A;  3J7Y J;  4NNJ A;  1YX3 A;  3A01 B;  2DMU A;  1L0O C;  3K2A A;  5LEJ A;  1R7J A;  4Z2Y A;  5DUI A;  3LA3 A;  4AIJ A;  2XAJ A;  1SD6 A;  4N0B A;  3U1K A;  3H35 A;  2VQH A;  4ETS A;  2LYC A;  2DA6 A;  3KYC B;  1IXR C;  3X2Q H;  3SYT A;  4FX4 A;  1MMN A;  1ZK8 A;  3CCU I;  1EF4 A;  2VT3 A;  3L2R A;  5CVJ A;  1NK3 P;  2V1X A;  4IJA A;  3VDX A;  3JTH A;  5F0F A;  5K5O A;  3KE2 A;  4ZYD A;  3IAM 2;  2L2O A;  2XRN A;  1WJD A;  2F5V A;  1ETO A;  3DKY A;  2JSP A;  2E2J J;  2QM3 A;  1JE8 A;  5GAG J;  1N25 A;  1ETW A;  2OC6 A;  3F0C A;  1IV8 A;  2LBF A;  2WA0 A;  3BZC A;  2ZJP F;  3LA7 A;  3E5U A;  1W36 C;  3ECO A;  2M7B A;  4EEF G;  4B47 A;  4BHC A;  3IH3 A;  2HS5 A;  2OBP A;  3L00 A;  1UFM A;  2ADU A;  2L9V A;  4FE7 A;  3ZMU A;  1YO5 C;  1GVJ A;  1K4S A;  1XCB A;  2MD5 A;  3FXR A;  2H09 A;  3CJR B;  1JJ8 C;  3H9G A;  4CYC B;  4G6T B;  3QYE A;  1UG0 A;  2JJ7 A;  5TIS C;  4XBF A;  1YX5 A;  2E1M C;  4UUS A;  3E6C C;  4L0Y B;  3HGY A;  4RB1 A;  1YYV A;  4V19 K;  1J5Y A;  4AYB A;  4DBQ A;  1JHF A;  5J4V A;  1AWC A;  2E5N A;  1RKW A;  4XSZ F;  2LBF B;  1A35 A;  1A36 A;  2QBY A;  2UUZ A;  4WXH A;  2GOM A;  3CUO A;  2UV1 A;  3TP0 A;  2CV2 A;  4CHU A;  2XAS A;  3MN2 A;  3I54 A;  1EH7 A;  4BY7 J;  2X6O A;  3HB9 A;  4BYY A;  3WTX C;  4HX4 A;  1XSV A;  4MTD A;  2TRT A;  2KZG A;  3S93 A;  1BOB A;  1HDD C;  5D4R A;  4P55 A;  1ZR2 A;  3M07 A;  1H9T A;  4NUB A;  4ENM A;  3F8M A;  5FD6 A;  2YS9 A;  1IZ1 A;  1X2N A;  2KDZ A;  5HLT A;  4LD5 A;  2V6C A;  2HPI A;  1X1C A;  2K7L A;  1IN4 A;  2ECC A;  1YJN I;  3W6V A;  4N9H A;  3PUF A;  4UVC A;  1ON2 A;  1P4W A;  3PIP F;  3SEZ A;  4E7S A;  4KA4 A;  1N77 A;  2A5W A;  2CQ7 A;  5IT3 A;  4DW6 A;  4ASN A;  3TP3 A;  3CLQ A;  2HKX A;  2OD5 A;  2P7C B;  2NYX A;  4EMS A;  3MQ0 A;  2HFH A;  2EB7 A;  4DYR A;  3OSG A;  2DXI A;  1TT5 B;  2M8G X;  2E19 A;  2A6E F;  5CVR A;  2CQN A;  2ACJ A;  1MBE A;  2M4G A;  2W00 A;  2XGX A;  5M5Y J;  2QQB A;  4Q5S F;  3L7W A;  4KUM A;  4G94 A;  1JJ6 C;  4CCK A;  1OJL A;  1WJE A;  1E3P A;  3OIO A;  2M8E A;  2VUM J;  3LSM A;  1R4N B;  2D1H A;  5FB2 A;  3ZOB A;  3KCC A;  3NWS A;  2HQA A;  2OA4 A;  2LKS A;  4HG2 A;  4E7I A;  5LBQ A;  2D5V A;  2J5O A;  3UNG C;  2WC2 A;  5KAF C;  3BR0 A;  4EJT A;  4V2F A;  2L7F P;  1E3H A;  2H94 A;  2DQL A;  3GW2 A;  2DOD A;  4IEJ A;  3ERM A;  4UUT A;  4ZYA A;  1ZYR F;  3DU5 A;  1PP7 U;  2LF8 A;  5J8F A;  2MH9 A;  4A12 A;  4IF4 A;  1FOY A;  1QVT A;  2DI3 A;  3S1Q J;  1Z0X A;  2ELJ A;  3OR2 C;  1O7F A;  3OYL A;  3A0B C;  1T2K A;  3W3C A;  1JGG A;  5M5W J;  2B9S A;  2XRL A;  2JRT A;  4RGX A;  2CW0 F;  1LEA A;  2W24 A;  2EFQ A;  3AG4 H;  5DCM A;  1G4D A;  5EGO A;  2EZL A;  3G1M A;  1YJ9 I;  1E17 A;  3JRB A;  3S8P A;  5BNG A;  3MZH A;  3KLO A;  3BCB A;  5LGU A;  1IN6 A;  1FOW A;  2ZJR F;  3V42 A;  3ASN H;  4BQQ A;  2JA6 J;  1JKR C;  3U9G A;  2AQF A;  4M3D A;  3KP4 A;  1MBG A;  1IXS B;  3SDG A;  2DDB A;  1ITY A;  4KMU X;  3AL0 C;  1XMK A;  2XKP A;  2DA4 A;  1J75 A;  1SAN A;  3EUH A;  4A3M J;  4ITV A;  3VSL A;  4C3J J;  2WAQ A;  2OU2 A;  5JI6 A;  2I10 A;  4DJA A;  3LMM A;  4G7H F;  1S7A A;  4RGU A;  2QCO A;  1MNE A;  2DO7 A;  3DTI A;  3E7L A;  4J01 A;  2X0L A;  4BDZ A;  2PFB A;  1W1W E;  2CRG A;  3G3Z A;  3W6J B;  2K3F A;  4KJZ A;  3BOQ A;  1DP7 P;  2E7W A;  2LP0 A;  2MW8 A;  4KT6 A;  1XMX A;  3O2P E;  2ME6 A;  2Y48 A;  5E1Z B;  3EQL F;  5B1B H;  2Q1Z B;  4MQV A;  5J4Y A;  1MBH A;  1JTY A;  1I6X A;  3LNQ A;  1NHA A;  3MKW B;  5KCM A;  4GRI A;  3JTG A;  1X3U A;  4PJ0 C;  5CYV A;  3LAP A;  2DOA A;  4RBO A;  3FKJ A;  4L5J A;  1IF1 A;  3F8C A;  2CSO A;  2KJB A;  5JVG F;  5K7Z A;  1X1A A;  2HU9 A;  2DK5 A;  3CJT B;  3B6A A;  4MQ9 F;  3RKY A;  4BH9 A;  3PL8 A;  4A3L J;  3EET A;  4KN4 X;  4MFE A;  3SQN A;  5FLV A;  3CO7 C;  1JKQ C;  3ASO H;  4NQW B;  4BE1 A;  1KQ9 A;  3BTC A;  2IXS A;  1ETQ A;  3BG5 A;  2WTE A;  2COM A;  4L9T A;  4A3K J;  2MC4 A;  2DOE A;  1ZEL A;  4ESJ A;  3E97 A;  1BM9 A;  3JRE A;  1TWA J;  2DW4 A;  1T33 A;  5GTI C;  3MKZ A;  2EWN A;  2JA2 A;  2NOG A;  2BY1 A;  2HWV A;  3F22 A;  4ZDL A;  3ERE D;  3TKY A;  1M1E B;  1FNN A;  4OAY A;  2VBW A;  2R7Z J;  2XAF A;  1FYM A;  4UUV A;  3VYR B;  4CSW A;  2A61 A;  4JYK A;  3TBI A;  2IS6 A;  3RYP A;  1YFH A;  4C3I J;  5FJ8 J;  2KZV A;  5E1W A;  4NQW A;  1K4T A;  3IL2 A;  3FM5 A;  1UST A;  2FNP A;  4BNC A;  1DPR A;  1HW2 A;  4NC8 A;  2O5R A;  2OCC H;  3CZ6 A;  4JQF A;  2KKO A;  4HDU A;  3BPV A;  2BVM A;  4U88 A;  4HQE A;  2VBX A;  2K02 A;  1R23 A;  3E6B A;  2MLK A;  4FQG A;  3V7R A;  3FXM A;  3W2W A;  5E3M A;  5F0H A;  2FSW A;  2XAQ A;  2Z9O A;  4MO7 A;  3OYG A;  1B9M A;  4GCV A;  1SEU A;  2NVU B;  2PLY A;  1Y8Q B;  1WJ5 A;  1MW7 A;  1U6G A;  4RLQ A;  1AOY A;  5LFA A;  4YEL A;  3S2W A;  4HW0 A;  2DA2 A;  5AIQ A;  2LSO A;  1IRZ A;  1IUF A;  1K6Y A;  1UHM A;  3KYD B;  3WHC A;  4FCY A;  4BJ5 C;  1SD5 A;  2DAO A;  2W85 A;  2Y0S N;  4I01 A;  3JRG A;  2N8G A;  3FBI B;  1LVA A;  2A69 F;  3AAF A;  3CES A;  3W2V A;  3HUG B;  2ZME B;  2JPB A;  3HKZ N;  2JSC A;  5E17 F;  1IDZ A;  1U8R A;  1MZB A;  1U2W A;  1GHC A;  1FSE A;  1MJ9 A;  3WU0 A;  1CQT A;  4XR6 A;  3F8N A;  3GVA A;  3C1D A;  1QPI A;  1B1B A;  2O8K A;  1W5T A;  2VI6 A;  3H0G J;  1OFC X;  4CCL A;  4C2T A;  5D8L B;  4AC0 A;  2VKD A;  2ZFU A;  5HS8 A;  1QBJ A;  1QZY A;  2F5F A;  3CP2 A;  1TBX A;  4Y13 A;  5IOZ A;  2HTJ A;  1BI1 A;  2CH0 A;  1VQ9 I;  1IO2 A;  4E7Z A;  2Q8K A;  3M4O J;  4L5I A;  2P4W A;  5HLI A;  2L9N A;  2C6Y A;  2GXB A;  2A6T A;  4WXD A;  1E3O C;  2BOL A;  3ULQ B;  5JHF A;  1YTY A;  2K4B A;  4MNU A;  3FX3 A;  5GPA A;  1ETX A;  4G7Z F;  2Z2S B;  1JKO C;  3A4C A;  1B72 A;  2E71 A;  4A3D J;  2WB1 A;  2L7M P;  4WXC A;  2CQK A;  2E1M B;  1D3Y A;  2QSG X;  2ZO4 A;  1WWX A;  2EFN A;  2MG4 A;  1XPX A;  1X19 A;  1FPQ A;  1RR8 C;  3B02 A;  3UR3 C;  4XLC A;  3BG3 A;  2HVR A;  3IWF A;  3HL2 A;  1T0F C;  1G3S A;  3A1Y A;  2CGP A;  4YIF A;  3QPT A;  4IL6 C;  2BEO A;  4X0G A;  3FXU A;  4D5C A;  1ORK A;  3PSF A;  1KZH A;  3S14 J;  4QWQ A;  3DP7 A;  1VQK I;  2CFX A;  3F3X A;  3ABU A;  3LSI A;  1YJW I;  2E35 A;  3H5A A;  4M3F A;  1BI3 A;  1KU9 A;  4M9Z A;  5GAH J;  4XKC A;  3FHZ A;  1ENH A;  1YE9 A;  3DQV C;  4A6D A;  2V79 A;  2QLZ A;  4GDF A;  2CMP A;  1TLH B;  4MEX F;  2XSJ C;  2O6G E;  2ZJ2 A;  2O7O A;  4C9Y A;  3OL4 A;  2HDW A;  2GBY A;  1P7I A;  2Y75 A;  2DFI A;  3U1D A;  2IP2 A;  5D5V B;  4NB5 A;  1F4K A;  2FJ1 A;  5IY5 H;  1IRG A;  4IKF A;  3QYB A;  2HPM A;  1DU6 A;  2R7V A;  2K9S A;  4IHX A;  2L02 A;  2VOD A;  2K5C A;  3CMA I;  3HSF A;  3IAS 2;  4XLN F;  4LB5 A;  2DYR H;  4I2O A;  2ZXJ A;  1O7L A;  4CO8 A;  1D0Z A;  3BRO A;  1X4O A;  3IHU A;  4RLF A;  2W57 A;  3ZQH A;  2KFD A;  5F1J A;  1HKQ A;  4LIT A;  5LRS A;  5FGM A;  3QPL A;  4M3G A;  3T8R A;  3GFI A;  1XGO A;  4DYC A;  2L4A A;  1IN5 A;  4ON0 A;  1FIP A;  2KJC A;  3A0H C;  3LWF A;  4LMY A;  4U0W A;  2DCE A;  4RB3 C;  4IHV A;  2V1U A;  2F6C A;  2QA4 I;  1YI2 I;  2JN6 A;  2X1E A;  3KX2 A;  1XX5 A;  1G6N A;  1WFX A;  3ABM H;  4R1H A;  2J5P A;  5IYB J;  2M9H A;  1ZRD A;  3TO7 A;  2H1K A;  5BPD A;  1VQ4 I;  1I1S A;  3GWZ A;  2HXI A;  3H5N A;  2X6W A;  4HPQ A;  5C4J J;  4OIN F;  1LQ1 A;  1X3Z B;  1Z77 A;  4BBS J;  3N4M A;  4BAY A;  4OIO F;  4XRS A;  3K4B A;  1V5G A;  2LKP A;  1B8I A;  2ZC2 A;  5CKT A;  3K1N A;  4XNF A;  3F6V A;  3MFK A;  3GLX A;  5F27 A;  2R7F A;  1MSF C;  2KIM A;  5KVR A;  3QPS A;  3I53 A;  3OV8 A;  5TJJ A;  4IRH A;  1ZQ3 P;  2A3S A;  3F72 A;  3J81 Z;  2DK8 A;  3BR3 A;  3S32 A;  3PM1 A;  4F91 B;  2EV5 A;  2DDA A;  1FY7 A;  4U87 A;  4Q4Z F;  2RQQ A;  4A6E A;  3KP5 A;  3J7A Y;  4YEJ A;  2HR3 A;  4B3X A;  3U21 A;  3PNT A;  2E36 A;  3HOY J;  3TO9 A;  4A5M A;  3RYR A;  1EKE A;  2F5E A;  3ZQL A;  1J9I A;  2RQP A;  2QSH X;  3TO6 A;  3IRQ A;  2YUS A;  1FTT A;  2F5D A;  2M3A A;  5DD4 A;  2JT1 A;  2E60 A;  4BS9 A;  1QZE A;  3CTA A;  3WHB A;  4B48 A;  4EVI A;  1OR7 A;  1IG7 A;  3LSP A;  3WG9 A;  2YSR A;  3VEP A;  2MYS A;  2Y69 H;  4ZZD A;  3V7C A;  2VOP A;  1V3F A;  3GTP J;  1QU3 A;  3GME A;  2QEX I;  4M3B A;  2XKO A;  2H8R A;  1RZ4 A;  2RRE A;  1ZH5 A;  4AWX B;  1JXS A;  3DTE A;  3H0D A;  3CCS I;  3R0J A;  3AFH A;  2HEO A;  2LKX A;  2LY2 A;  1RIO H;  1I6H J;  3HG9 A;  5DTD A;  3T5X A;  4FIS A;  4I02 A;  3JRA A;  3EUA A;  2H1L A;  2K3P A;  1ZRF A;  2EIM H;  5D8K B;  4IXA A;  3DPL C;  3HSE A;  1WI9 A;  4ZH4 F;  2PX9 A;  3HRT A;  2E1N A;  1S29 A;  1TP4 A;  2TCT A;  3H9Q A;  3IWZ A;  3ECH A;  4FHT A;  4II3 A;  2EIL H;  3KYL A;  1UAA A;  4LG0 A;  3CCL I;  4HF1 A;  3GZ5 A;  2I5U A;  1FOX A;  3CDH A;  1ETY A;  4OIR F;  2L3D A;  3S3O A;  2OQG A;  1TZL A;  1V54 H;  1GV5 A;  1T0F A;  3VPR A;  2R4G A;  5LRR A;  2RKH A;  4HNT A;  2UXN A;  1LDD A;  4RDU A;  3OYE A;  4XOP A;  4BKX A;  1XN7 A;  1K78 A;  2STW A;  2IEK A;  1HW1 A;  3RDI A;  4CA0 A;  3UKG A;  3CO6 C;  1D1C A;  4KN7 X;  2DMP A;  4PDK A;  4IRG A;  4XLA A;  2M2E A;  1U5T B;  4JBA A;  1IW7 F;  3FWE A;  3R4K A;  3IKT A;  1GV2 A;  4EM0 B;  2WV1 A;  5CVI A;  2L7K A;  1ONV A;  1IAW A;  2MFZ A;  5JR3 A;  1ETV A;  3Q3S A;  2ISZ A;  3L2V A;  1KU3 A;  2JA5 J;  1VQ8 I;  3FF5 A;  1RNL A;  1R49 A;  1ACI A;  2MC3 A;  2V1N A;  1AHD P;  2ID6 A;  1WKM A;  2AQE A;  5F6F A;  3VB2 A;  2R7U A;  2EA2 A;  2L5Q A;  3B73 A;  2PMH A;  2HNH A;  3M1E A;  2ME0 A;  3S1R J;  4HEA 2;  1D8K A;  3OYN A;  1FYL A;  2ECB A;  2ICW G;  5C3E J;  3S1N J;  2VE9 A;  2IRF G;  1G8X A;  1MND A;  1HOM A;  1HW5 A;  2P7V B;  4A5N A;  1N75 A;  5J8C A;  1SMT A;  3O8H A;  3CJN A;  2P6S A;  1YRN B;  2VL8 A;  3GFJ A;  5IPA A;  2VC0 A;  4N4N B;  3M8F A;  1NTC A;  2XPV A;  4Y7N J;  2KHM A;  1O3S A;  2EBI A;  1DUX C;  4ZJZ A;  1SAX A;  2FF4 A;  4CIC A;  2L01 A;  4KIS A;  4PK4 A;  1K7A A;  1B4A A;  2EJR A;  2R7R A;  1MH4 A;  2FOK A;  4QSH A;  1FX7 A;  4XIC A;  3FMR A;  4CCO A;  3L2W A;  3SXY A;  2HQN A;  3OYA A;  4C30 A;  2BY3 A;  2CO5 A;  2ZSH B;  1POG A;  1LFU P;  2GM4 A;  2X51 A;  3I3L A;  3RI4 A;  4ENK A;  2CQX A;  1SD4 A;  1Y8R B;  2YPR A;  3KEQ A;  2FU4 A;  3PNV A;  3Q0U A;  5M3M J;  3CCM I;  1N78 A;  3CJQ B;  3Q0W A;  2DLL A;  1UHW A;  4M73 A;  2DMT A;  2QQA A;  2XGD A;  5C44 J;  2DBB A;  2XGE A;  2IA0 A;  2L54 A;  2FRH A;  3RZO J;  3RCO A;  2WAE A;  3FIS A;  1T39 A;  3HSR A;  3VYS B;  4ZTF A;  2ETH A;  4BAC A;  3FM3 A;  2JZY A;  3TGN A;  3WOD F;  2H6C A;  3Q9S A;  2KT0 A;  2Y31 A;  4IHY A;  1SFK A;  2EIK H;  3OYF A;  1IN7 A;  1RR7 A;  4PUS A;  3RPU A;  1MJA A;  1QQI A;  1OR7 C;  4MLO A;  4AIH A;  2H6B A;  5FO5 A;  1DPU A;  4NDL A;  4HF2 A;  4Y3O A;  1LKX A;  3H1C A;  2K85 A;  3K7A J;  4OWR B;  1WSU A;  5KHD A;  2GOX B;  3AG1 H;  1ZGW A;  4G7O F;  2PEX A;  4D1Q A;  2HOS A;  1VQN I;  5J47 A;  3NWT A;  3JAM Z;  2K9Q A;  4IHT A;  3R60 A;  1QVU A;  3VOD A;  1E0E A;  4D5F A;  3LAJ A;  1SD7 A;  1HC8 A;  4DQ2 A;  3OYH A;  3PSI A;  2EFW A;  3IV5 A;  1HXD A;  1MD0 A;  2D1V A;  2X9D A;  3WTV C;  2HDD A;  1TWC J;  2E7X A;  4AU7 A;  3FXL A;  3OS2 A;  2QBY B;  2W48 A;  4YFN F;  1P6R A;  5J6X A;  3NAU A;  3BT9 A;  3S17 J;  2VPR A;  1MIJ A;  3KIO A;  1Z7L A;  1LB2 A;  4IRI A;  2HTS A;  3HEF A;  1B9N A;  4D9J A;  2IVM A;  3J81 K;  2K27 A;  3OS1 A;  2BHZ A;  2Y30 A;  1BW5 A;  2LTP A;  2DN0 A;  3EYY A;  1DDN A;  3HOV J;  4M71 A;  2HGC A;  1RES A;  3LQQ A;  2VQL A;  3FXQ A;  3K69 A;  2AXL A;  4DYQ A;  3GTK J;  3W2A A;  4L9V A;  4JOM A;  1XDU A;  1O4X A;  2R7T A;  3O8G A;  5FFX A;  2OCE A;  2IJL A;  3JSO A;  1ZHF A;  4BDY A;  2CV0 A;  2XDV A;  4GXO A;  1YIO A;  3N05 A;  2EA4 A;  2YU9 J;  3QOD A;  2VLA A;  1FLI A;  3LOC A;  4UNO A;  2E1O A;  3ML6 A;  2ZBK A;  3EUK L;  2GXG A;  4D0P A;  1WH7 A;  4RAZ A;  1W0U A;  1F43 A;  3CCJ I;  4XID A;  2F4M B;  2K9N A;  2V9K A;  4JX4 A;  3TL4 X;  3BLY A;  3IP4 B;  3RPQ A;  5HOO A;  2MGQ A;  4P1W A;  4XKB A;  3LFK A;  4Y52 J;  3DPU A;  3DV8 A;  2ELK A;  5H6R A;  4G9Y A;  2PJR A;  4F93 B;  2DFF A;  2QKL B;  1FJL A;  1YW9 A;  5DCF A;  3HOZ J;  2UXX A;  3JR9 A;  1QPM A;  3DKX A;  2BY2 A;  3J80 K;  1SFX A;  4HSR A;  1QZZ A;  3K4J A;  3RIR A;  5IOY A;  1X1D A;  2W4S A;  3TOB A;  2JWT A;  3M7G A;  4O6J A;  1KYW A;  2QZ8 A;  4U0Y A;  4AM3 A;  1MMG A;  2VJ5 A;  3R6S A;  4UV8 A;  5E8I A;  4J19 A;  1R5H A;  2ID3 A;  1F36 A;  3C7J A;  3WTU C;  3FBN B;  2IAI A;  1USS A;  5F1R A;  1KQ0 A;  2VOO A;  5DCM B;  1C0W A;  3IKV A;  3QWL A;  2DTZ A;  5L3C A;  2DA3 A;  1GUU A;  2VN2 A;  4P96 A;  2P5L C;  1R71 A;  1WPK A;  4FE4 A;  3NQO A;  5HLH A;  4UHT A;  5HVQ C;  1D5Y A;  3BJO A;  2WBM A;  1ERD A;  4Y4R A;  3ESW B;  3P5J A;  4RM3 A;  1LDK B;  2M0C A;  2KRF A;  5FD5 A;  5EJC A;  2R5Z B;  2LNB A;  1REP C;  3OL3 A;  1GT0 C;  1RRJ A;  1QNT A;  2VC1 A;  1IDY A;  3GLL A;  4XN0 A;  3KEY A;  2CWE A;  4LK1 F;  4EM1 A;  5IYD J;  2RAE A;  1ZTR A;  4KDP A;  4D7N A;  3SFZ A;  3ZQF A;  4E4H A;  1H8A C;  5DD8 A;  1MKM A;  2EQR A;  3GTL J;  2BXZ A;  3GTG J;  1Y0N A;  2M5W A;  5EG0 A;  1P92 A;  3OWT A;  5ICG A;  3FDY A;  2KIF A;  3J7A O;  3SZG A;  4PFP A;  1U3E M;  4BJ6 C;  3DXJ F;  4HA8 A;  4DGW B;  1B72 B;  4ZTJ A;  3ROU A;  4M74 A;  1MSE C;  4LG0 B;  1X58 A;  3RQ4 A;  1XSX A;  3ZRG A;  5DV5 A;  3NRV A;  5E20 A;  1RI7 A;  5DS9 A;  3DPT A;  1VI0 A;  3Q0V A;  2IBD A;  3I4P A;  4ENJ A;  1YHQ I;  3FXJ A;  2DFE A;  4BL0 B;  2LLK A;  1JUP A;  3D5L A;  4RAY A;  1OCZ H;  3EYI A;  2QVO A;  1VQ5 I;  2AO9 A;  2PMU A;  1TNT A;  3K1P A;  5L3E A;  5EDN A;  1W4M A;  1WI3 A;  1KYZ A;  2ZXH A;  3DBR B;  2IGO A;  3G1L A;  4I99 C;  3RKX A;  1OLT A;  3BTI A;  4BUP A;  2OZU A;  2JTV A;  4QTR A;  4BXF A;  3GYH X;  4MEY F;  5H20 A;  3OSF A;  1U8B A;  3CP8 A;  4HX7 A;  5HS9 A;  4A93 J;  1XD7 A;  2HYG D;  2EV0 A;  4XLF A;  2JUC A;  2NS0 A;  2R0Q C;  4BHB A;  3K1M A;  3WTS C;  5D5W B;  1G2H A;  4HV6 A;  3K2Z A;  3HUG A;  3LA2 A;  3HC7 A;  2QYO A;  4KIC A;  4PZJ A;  4H0E A;  2O61 A;  4ANJ A;  2XHK A;  1EH6 A;  5D5U B;  2Q0O A;  1UEL B;  4XRM A;  4JX6 A;  2P8T A;  1BI2 A;  3JRF A;  1Y1W J;  2AS5 F;  1FZP B;  4FX0 A;  4LIU A;  1MH3 A;  3ZCO A;  4BQA A;  1AU7 A;  3HZJ A;  3TED A;  1BL0 A;  2O0Y A;  5LEK A;  3S1M J;  4BE0 A;  2A6H F;  3MWM A;  3PNY A;  3QOP A;  1HKS A;  3MKY B;  4EJU A;  4MHG A;  4E7K A;  1OMI A;  3HM5 A;  1WGX A;  4YII A;  3GZN B;  2OZ6 A;  2VE8 A;  2VQG A;  1FIA A;  3WGI A;  3FZV A;  3TQN A;  4UV9 A;  4B44 A;  3M3Y J;  3OIQ A;  1WJF A;  1D0X A;  2IA1 A;  3O3K A;  3DLA A;  4IHS A;  3JRH A;  4D7M A;  1YIJ I;  1VZ0 A;  1R5G A;  1PYV A;  1KA8 A;  2FBI A;  3QYF A;  2HOE A;  1T6S A;  5LHG A;  1O3Q A;  2FNA A;  3M9A A;  2GA2 A;  4PSW A;  3TDU C;  1S8N A;  4WK8 F;  1T08 B;  2FA5 A;  2OAZ A;  4Q48 A;  1J09 A;  2Y2Z A;  5CVV A;  4LLL A;  3WE3 A;  3FKI J;  2NVY J;  3K70 D;  2LMD A;  4M6V A;  2H27 A;  3HYI A;  3K4M A;  3ZMS A;  4Q47 A;  2WY7 Q;  2KPM A;  4HDV A;  1XG1 A;  3BG6 A;  3DBH B;  4I0B A;  4XL9 A;  3FK7 A;  3DTK A;  2AHQ A;  2Y0S A;  2HVQ A;  4OIQ F;  3HRS A;  4E7H A;  4IVN A;  4RB2 C;  2VXD A;  2LR8 A;  4TV7 A;  2ZSI B;  5JLX A;  2BHY A;  1WZ2 A;  2WWY A;  2HDC A;  4HST A;  3GTJ J;  1I39 A;  1FOK A;  4CYD A;  3DLL F;  1RKT A;  1W5C C;  3F9K A;  2KMU A;  1XCV A;  4KT5 C;  1VQO I;  3P9I A;  4GGG A;  3QP6 A;  1F9N A;  3T8T A;  3RKW A;  3I0T A;  1KON A;  4B3A A;  3QU6 A;  5H2F C;  3S3M A;  2KQR A;  3CCY A;  1F1Z A;  2O03 A;  1KU7 A;  1F5T A;  4I98 B;  3K4C A;  3A02 A;  3ISP A;  1YS7 A;  1HDP A;  2XB0 X;  2I8D A;  1VQP I;  2DT6 A;  3RZD J;  3OMY A;  1KGS A;  2RN7 A;  3KLN A;  1FWZ A;  1LFB A;  1Z1D A;  5BQT A;  1ZGA A;  2L7Z A;  2PN6 A;  5K5Q A;  3CLO A;  4FET A;  3LFU A;  5BPI A;  4CZC A;  4HNU A;  4LK0 F;  4ESB A;  2WAQ N;  4UB6 C;  2HVS A;  3GTQ J;  2JVG A;  1Z21 A;  2NAZ A;  1H0M A;  1TW3 A;  2XVC A;  2FQ4 A;  1XGS A;  3LL7 A;  4XLE A;  3KP2 A;  3GZ6 A;  3GO5 A;  5GAE J;  3ZR8 X;  5HDK A;  4V2G A;  1OYI A;  2A68 F;  1IRF A;  3VSK A;  3EDP A;  4HBL A;  1FP1 D;  4PJM A;  1TWH J;  2DYS H;  1I27 A;  2M34 A;  2LY9 A;  5EEG A;  1A5J A;  5DM6 F;  1I5Z A;  1XGM A;  5HLG A;  5BMZ A;  2NXN B;  5JLW A;  1BJA A;  3ZMZ A;  1K83 J;  5GP9 A;  1AKH B;  3MZ8 A;  2XV4 S;  2VKE A;  2FUG 2;  3DFG A;  5LGT A;  4WX9 A;  3I4M J;  4B09 A;  1OCT C;  5E1X A;  3BG9 A;  3GFL A;  4GYI A;  2ZNY A;  5FLX Z;  2BY0 A;  5H6Q A;  2GIV A;  1CF7 A;  3BR1 A;  5J1U A;  1J7K A;  4ZDO A;  5LHH A;  2QF7 A;  1O3T A;  1QO0 D;  2HKO A;  2VQC A;  2BXY A;  4RAF A;  2O3F A;  2NVX J;  1K79 A;  3U2R A;  3GTO J;  2XUB A;  4MIM A;  5HS7 A;  2RNG A;  2IS4 A;  3S15 J;  4M72 A;  3ZQC A;  1FC3 A;  2MH2 A;  2VT2 A;  1VQM I;  2W84 A;  3TMO A;  3OYK A;  5LHI A;  1DP3 A;  2LFB A;  2KRC A;  3OY9 A;  1VF9 A;  3ZQG A;  3OYB A;  1IUY A;  2ZFW A;  2QWW A;  2V9V A;  2VJ4 A;  3EPZ A;  4PCQ A;  2GLO A;  4QPO A;  1VQ7 I;  3V7S A;  1K61 A;  1D5V A;  1IRX A;  3G6E I;  3H92 A;  2CG4 A;  3ZQI A;  4G6D A;  3MCZ A;  4BXU A;  5FLM J;  5F08 A;  2XRO A;  5JFR A;  2BW3 B;  2P0W A;  2K40 A;  2X1D A;  1ZLJ A;  2OUM A;  3DEU A;  1X1B A;  2P5V A;  3DKW A;  2L9R A;  4EJV A;  2VON A;  1SVO A;  3O6B B;  2FML A;  3OIP A;  4UB8 C;  4GFB A;  4Z6Y A;  3C18 A;  3G71 I;  2LDU A;  1ODD A;  1TWG J;  1S7E A;  1NG7 A;  2OTJ I;  1BIA A;  4E70 A;  2QEN A;  3GEZ A;  4C3H J;  3VFZ A;  1D1A A;  4XLH A;  5M5X J;  3KPH A;  4HYE A;  3RSN A;  1MBJ A;  2X85 A;  1MJB A;  1BC7 C;  2VAS A;  1P7J A;  3S2D J;  3ONQ A;  2F48 A;  2G0E A;  3JRD A;  1HKT A;  3L1P A;  2CW8 A;  3BZ6 A;  1PUF B;  5HDN A;  2R92 J;  1XGN A;  1RPW A;  4LGW A;  3JRC A;  2VJJ A;  4JK1 X;  1EV7 A;  3H3U A;  2CV1 A;  1KQ8 A;  4QPQ A;  4XRF A;  5ILU A;  1HSJ A;  2FD5 A;  3BR2 A;  4FTH A;  5B66 C;  6PAX A;  4B4C A;  5BOX A;  3BCA A;  3OOP A;  2A07 F;  1IN8 A;  3QAH A;  5ED4 A;  1S6L A;  5K7H A;  5B1A H;  2KLO A;  3DU6 A;  4DNC A;  2ESH A;  2EZH A;  2TDX A;  4L0Z B;  4RM2 A;  3OYI A;  3JSP A;  5FRN A;  1APL C;  3IH2 A;  3BR6 A;  2W7N A;  4KIT B;  3K6G A;  3KP3 A;  4GYG A;  1RUO A;  1MDM B;  2LRD A;  3ZN0 A;  2EIN H;  1RUN A;  3BQZ A;  2LY1 A;  1V55 H;  3QPH A;  1Q1H A;  4PJJ A;  4IPA A;  2B63 J;  4RGR A;  2NRA C;  3I58 A;  4Y33 A;  1DQU A;  2M7A A;  4A3C J;  3HXL A;  4B1R A;  5E3L A;  1ZAR A;  3CC7 I;  1DU0 A;  4O3M A;  5HDG A;  3MVP A;  4X1E A;  4HAM A;  3SHF A;  3FHN A;  2QQ9 A;  2HOT A;  2LRE A;  1R22 A;  3PO3 J;  2EFP A;  1DGW Y;  1OIS A;  2FEZ A;  2R7O A;  4XRS G;  1MDM A;  2R3S A;  4AYB N;  3QU3 A;  3H3Z A;  3SDB A;  5EEH A;  1QA6 A;  1HLV A;  3PIO F;  3IH4 A;  1J2X A;  5A2Q K;  1FMW A;  4KYW A;  2HI3 A;  3GX4 X;  1IGN A;  2R7X A;  4YIR X;  5CJ9 A;  2NOJ B;  2XF6 A;  4A69 C;  1YLF A;  2DFH A;  1W5S A;  1Y1V J;  3GXO A;  1Q1V A;  4MFD A;  5EZG A;  1R5I D;  1UG2 A;  1XB4 A;  2CYY A;  2DU9 A;  2P5K A;  3JCU C;  1BJZ A;  3I5U A;  5EEA A;  1J59 A;  2CU7 A;  1BR1 A;  1G3T A;  1ZG1 A;  3BDD A;  1UCR A;  1G3Y A;  1XDS A;  1XMA A;  2BW3 A;  4LJZ F;  5ICE A;  5KAI C;  1MBK A;  5JHU A;  3OYC A;  2XAG A;  3BTJ A;  4DZJ A;  2V6E A;  2Z1D A;  1Y56 A;  3CDI A;  4G6Q A;  4C2M J;  5CQE A;  1MMS A;  4KMF A;  4NHJ A;  3S2H J;  3HKZ A;  4S05 A;  2VBY A;  4PSX A;  5IP9 J;  1H9G A;  4N4O B;  5CVU A;  4HLX A;  2VKH A;  4EAT A;  3ZMV A;  3WU2 C;  4OAZ A;  4YFK F;  5FKO A;  3K70 C;  4W1U A;  3DCF A;  4M9X A;  4XMY A;  4BE2 A;  2E2H J;  3VWB A;  2FBK A;  3FXO A;  5FKM A;  2M45 A;  2JQ7 A;  4OMZ A;  1XSD A;  1BW6 A;  2EFO A;  2AXT C;  4AID A;  3HHH A;  3KZZ A;  3BWG A;  5L3G A;  1Z3X A;  2XAU A;  2QQ8 A;  1I3A A;  3ABL H;  5HNF A;  3PJR A;  4E7L A;  1SVL A;  1YIT I;  2K9M A;  1WRJ A;  4M9S A;  3VYU B;  1MGT A;  5IP6 A;  3KP7 A;  2M4K A;  3QQA A;  2IGK A;  1WJA A;  2P6T A;  4XK4 A;  1STZ A;  2VIX A;  3R61 A;  3KET A;  3BR5 A;  1X4P A;  3MZY A;  1QHH D;  1MNM C;  4IQJ A;  1JI8 A;  1LDJ A;  4L9J A;  2GAU A;  2MAB A;  4A3B J;  1I1G A;  3GUD A;  3TW7 A;  5FRM A;  1Z6T A;  3CDL A;  1RC9 A;  1LE8 A;  1LJ9 A;  4DZP A;  2LK2 A;  3I64 A;  1XS9 A;  1Z67 A;  2G9W A;  5B5E C;  2ZJQ F;  4F7Z A;  4LLN A;  5DEQ A;  1OCC H;  2DT5 A;  1PUE E;  2OJE D;  3AG3 H;  1ZG5 A;  2R7D A;  5F0C A;  2EK5 A;  3F6O A;  4IO9 F;  1P9Q C;  5K1Y A;  2JMW A;  2V26 A;  2E34 A;  1W7P D;  3AG2 H;  3I71 A;  1D1B A;  1HST A;  2K86 A;  1FT9 A;  1K78 B;  1BOA A;  1VQ6 I;  2CUZ A;  5GAD J;  2CUE A;  3I56 I;  4BGD A;  2BZT A;  1D0Y A;  4CYC A;  1SFU A;  5FKL A;  3TDZ C;  2NVT J;  2YR2 A;  1JUS A;  4LB6 B;  4P9U A;  2MBF A;  5ILS A;  2OQR A;  2KIS A;  3HRM A;  4W97 A;  4CUG A;  4BQO A;  3FIW A;  2L4M A;  2Q2E A;  3C2H A;  3E3V A;  1A31 A;  2KL4 A;  3C2B A;  4U7B A;  4ENN A;  5F64 A;  5E3N A;  2XAH A;  2ESN A;  2W25 A;  2OTL I;  1UMQ A;  1TQM A;  1SVM A;  5D5X B;  5E18 F;  1BN5 A;  4IOC F;  2O9L A;  3ZPL A;  3C2G A;  2B7E A;  2O8X A;  4XQF A;  3NAR A;  1YS6 A;  1E2X A;  2XSD C;  1FYK A;  4GO1 A;  3V4G A;  1G3W A;  5EF6 A;  5EG0 B;  4KFC A;  1PDN C;  2Y0M A;  4XM3 A;  2L0K A;  3DF8 A;  3SZP A;  2LH9 A;  5GTH C;  1BI0 A;  2FOW A;  3REO A;  3G73 A;  4OIP F;  4E6K G;  3CCQ I;  1FBQ A;  1T56 A;  2DA7 A;  1FEX A;  1AA7 A;  5DYM A;  3F23 A;  1JT0 A;  1LPQ A;  1VQL I;  2V1D A;  5TRD A;  1R9T J;  2RDP A;  2YU3 A;  3CF5 F;  3BQY A;  3A03 A;  3ZQ7 A;  2ZXI A;  4LLG F;  3G4S I;  2WAD A;  5EYR A;  3S16 J;  2Z99 A;  2RVC A;  2G7U A;  3H3V K;  3G1O A;  2ZB9 A;  3FMS A;  3SZT A;  1OKR A;  3MEX A;  2YX4 A;  2BGC A;  1JGS A;  5HOD A;  2EH3 A;  4ZC3 A;  1R6R A;  2NNN A;  1G59 A;  3HHG A;  5HNH A;  1JKP C;  2ZNZ A;  1U5T C;  1MMD A;  4YRV A;  3C3W A;  1BC8 C;  1SAU A;  3K9T A;  1ZAO A;  4HZF A;  4UUS B;  1OPC A;  1GLN A;  1T95 A;  3K4L A;  1WH5 A;  3LSK A;  5J1Y A;  4AVP A;  4XOT A;  1YW8 A;  4M6Y A;  3QP5 A;  2R7W A;  2KRH A;  1T98 A;  5D6E A;  4RMN A;  2GWR A;  3BJA A;  3CCE I;  2ISY A;  3Q5F A;  3DEE A;  5EGO B;  1JUM A;  3E5Q A;  4S0H B;  2FMY A;  4G8X A;  2HQR A;  4U0V A;  4Y17 A;  4IOA F;  1R4M B;  4UVB A;  4RGS A;  4M3E A;  1JHH A;  1Z7U A;  1UB9 A;  4LIV A;  1WCM J;  1Y6I A;  3P9K A;  3H5R A;  3M8J A;  5ERI A;  4LFU A;  2X1C A;  1CF7 B;  1ZGJ A;  1ON1 A;  1WHU A;  3BZK A;  3OYM A;  3HPH A;  2QGU A;  1HCR A;  4KIB A;  4EV0 A;  1R1T A;  2NVQ J;  2V7F A;  2F2E A;  4BXX J;  2JVH A;  9ANT A;  4DBR A;  2ZXW H;  3CUQ C;  1VTN C;  3ELK A;  1NH3 A;  3BJ6 A;  2IPQ X;  2FE3 A;  4CCM A;  4A0Z A;  2MSY A;  2VPL A;  2EZK A;  4LG3 A;  4C2U A;  4M6X A;  2W82 A;  3BTL A;  2HZT A;  2DA1 A;  2JK3 A;  3N97 A;  3PFI A;  2A05 A;  4BHP A;  4A3G J;  1OCO H;  2H8W A;  2OPT A;  2DQR A;  2E2I J;  2XPW A;  2R7Q A;  1ZRE A;  4F52 A;  2XB5 A;  5E79 C;  3ZQQ A;  4E7J A;  3GBG A;  3ZGK A;  2G7H A;  2V9P A;  2NS8 A;  3E0J B;  1QRY A;  2V4J C;  4HRI A;  5GPC A;  3EUH C;  1GDT A;  4A3F J;  4ZYG A;  2OV7 A;  4HLY A;  1LFP A;  2HZD A;  1ETK A;  1NG6 A; 
#chains in the Genus database with same CATH homology
 2LMD A;  1MIJ A;  1XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...