1XPXA

Structural basis of prospero-dna interaction; implications for transcription regulation in developing cells
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
144
Chain Sequence
SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*GP*CP*AP*TP*GP*CP*CP*TP*G)-3'
publication title Structural Basis of Prospero-DNA Interaction: Implications for Transcription Regulationin Developing Cells.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation/dna
total genus 54
structure length 144
sequence length 157
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1xpxA00
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH superfamily
2JA7J 2STWA 1QNTA 4QPQA 3ZMVA 4ENJA 5DCMA 4GO1A 2ESHA 2Y75A 3E7LA 2IGOA 4LG3A 2VOPA 1J59A 1N75A 2K4JA 3CZ6A 2H6CA 2TCTA 2BGCA 1HKTA 3ONQA 3JTHA 2YR2A 1MMNA 5F04A 1Z1DA 2B9SA 1WJAA 1Z77A 2XIGA 2VL8A 3ZRGA 2BY0A 1ZH5A 4RLQA 2KFDA 5EEGA 4UVCA 4ZC3A 1TT0A 3MKZA 4RM2A 1FSEA 2CW7A 2VQHA 1SD5A 3DKWA 1BM9A 4FT8A 2VE9A 5J3LA 3JTGA 3CMEI 1OCOH 2XF5A 4GCVA 3FXOA 4ESFA 1SMYF 1HKSA 3VPRA 5M3MJ 3KZYA 3C18A 4D0PA 2BHYA 3RKXA 4ITVA 2DI3A 2W1OA 2M9HA 3HBLA 4UB6C 2LC2A 2WA0A 1WKMA 3QQAA 2CV0A 2FQ3A 1ETVA 3CF5F 2L5QA 3LL7A 3BT9A 4EEFG 1YW8A 2HDWA 3E5UA 4ENKA 4KIBA 3GW2A 2H8RA 1Y0UA 2R7OA 2CWEA 3G1LA 1H0MA 4FASD 2DPUA 3GTLJ 1SFKA 3M7GA 2K9LA 4IQJA 3OS2A 4C3IJ 4OMYA 1W5CC 2KIFA 1OJLA 4CICA 2HQ5A 1XB4A 2DK8A 1JUMA 1KA8A 2ZSIB 4J00A 3ZMSA 4H4KC 5GAEJ 4NDLA 3HUGA 4EMSA 4F7ZA 5HLGA 1ETYA 3K70D 3BDDA 1UZCA 3KPHA 1LQ1A 3ZCOA 3FXUA 2PG4A 3BZ6A 5FGMA 3HZJA 2MYSA 5F1RA 2QENA 4BBSJ 1FLIA 2DK5A 1MMDA 3D5RC 3NWTA 4MNUA 4XRMA 3L09A 4CO8A 3H1CA 1FMWA 1W7PB 1WJFA 3G4SI 2L7MP 3GZ6A 1PYVA 2E2IJ 2ICWG 2MGQA 4G6TB 2XSJC 3F21A 1BJZA 4PZJA 3H5AA 1Z0XA 1IN5A 2ZXHA 1X3WB 2R5ZB 1GLNA 3PQJA 1IDZA 2P5KA 3HOTA 5DV5A 3F3XA 2X6YA 3HEFA 2LVSA 5F27A 2NOJB 2HPIA 3DLAA 4U0YA 4CHUA 3K7AJ 4AVZA 2M34A 3BPVA 1IN7A 1JI8A 3ROUA 3OIQA 2R92J 2Q0OA 1DGRM 3EDPA 3BG3A 3W2WA 1DPRA 1TQIA 4IHWA 2D5VA 1UMQA 1XTAA 2JSPA 3CJRB 1YQAA 5BOXA 3F6OA 1KQ8A 3JCUC 1K83J 3CJNA 3TP3A 1SD7A 4YFXF 2DFEA 3F0CA 3G2BA 3DTKA 2PMZA 1GUUA 3TP0A 5FKLA 1T95A 1U8RA 1EV7A 1YJNI 1S5LC 3S17J 1A6IA 1R00A 3H5RA 4CCJA 1FX7A 4KT5C 2X48A 1GV2A 4XKBA 4AD9A 4RAYA 1LDKB 3DBRB 2OZ6A 5JHFA 2V1DA 3WE3A 2H6BA 1LNWA 2XAHA 5DD4A 5L3CA 3REOA 2WY8Q 3H36A 3RQ4A 2W82A 3BLYA 4HF2A 2VKHA 3E6CC 1BW5A 2UUZA 3T0YA 3IRQA 3DTEA 1W5TA 2KQRA 5KHDA 4FE4A 3PNTA 5IPAA 1ENHA 3L2RA 2M0MA 3UKGA 2F4OB 5DTDA 4EJWA 4BXFA 3DEEA 4S05A 4H0EA 5BPIA 4DW6A 3E6MA 3KZIC 5DCFA 1XPXA 3BP8A 1DU6A 3C7JA 3L00A 2IEKA 3HOUJ 1S7AA 4XNFA 1LEBA 2AHQA 2QQAA 4IL6C 4D5FA 4OIPF 5F0CA 3F8FA 1OISA 1YX3A 1YG2A 3IKTA 2DFHA 3S15J 2BYVE 1IN8A 1WQ2A 1USTA 3K1NA 1HDDC 3CC4I 2DMNA 2GIZA 3FK7A 4GYIA 3VOEA 1H88C 2R7SA 2QBYA 2OCEA 1HW2A 2NVQJ 3FM3A 3J81Z 3X2QH 1E2XA 3EETA 4IF4A 2BVLA 1QRYA 2DLLA 2CUEA 2LOOA 2F6CA 4IEJA 2NRAC 1U78A 2HOTA 3BCAA 4HYEA 4XL9A 4E7KA 5IP9J 4KNYA 3GMEA 3EUAA 3QPHA 3BG9A 5LHHA 3IH2A 3S93A 1OCPA 2K3FA 3IAM2 1VNDA 3CCLI 1MW7A 3KX2A 1ZN2A 5B3SH 3OMYA 1USSA 1B72B 1BC7C 3SXYA 3QYEA 2XASA 4C3JJ 4FTHA 4KUMA 3PUBA 1B72A 4EM1A 2KJBA 2V6CA 3F72A 5L3GA 4G7HF 1BBYA 1QPIA 3AL0B 3S16J 2Y9YA 1Z91A 1ZARA 3OV8A 3D0SA 2Y0SA 1B59A 4F92B 2Y2ZA 1VQ8I 2I5UA 2XAGA 3JRDA 5LBQA 1A36A 1J2XA 1G3TA 2O6GE 1BIAA 1U5TB 3I3LA 3WGGA 1XGOA 2ACJA 4M6VA 1OYIA 1ZK8A 2TRTA 4UV8A 3A4CA 3Q0UA 2IW5A 1ETQA 2K4BA 3IAS2 4Q5SF 1YYVA 3CJQB 4RB1A 3EUHC 3ZPLA 2WTEA 4HLXA 4JQFA 2BVMA 1T6SA 3CCYA 1K4SA 5HS9A 5JLWA 4XM3A 3FHZA 3PQKA 3BPXA 3O8GA 2K40A 1LKXA 2DYRH 1R71A 3M3YJ 2VBYA 3IWZA 5EG0B 2QF7A 5EGOA 3AG1H 4CYCB 4HEA2 3GTQJ 2X1EA 3I5UA 3B6AA 2IJLA 1YTYA 1BI2A 3SYTA 3ELKA 1X4PA 1PP7U 3OYJA 2NXNB 2CUFA 2YPRA 1ZELA 5ICFA 1P92A 5KNLA 4LMYA 5F1JA 2E60A 5FKNA 4UXNA 2F5CA 3ZQQA 1NK2P 1HSJA 2KRCA 4FX4A 3M8FA 5C4XJ 3W6VA 3DPTA 3V7CA 2XRLA 2E71A 2R5YB 4M9XA 3RQIA 2QVOA 1J75A 3BR0A 1FPQA 3ZMTA 4HDUA 4HF0A 5JHUA 1POGA 2HVSA 3CD6I 3FKJA 2FOWA 3D5SC 3DPLC 4BEHA 3CCRI 2X6XA 3TOAA 3JAMZ 2BE5F 3RKWA 3ZQHA 1YX5A 2M3AA 3CDIA 3S3MA 5LGUA 5LRSA 4NC7A 2E1OA 1I27A 1W0UA 1MSFC 4A5MA 3OYHA 5TRDA 2Q8KA 4B47A 4EV0A 2LBFB 2XB5A 5E3LA 5ICCA 1CGPA 2DJNA 5E17F 3RI4A 1K78A 1PVEA 2JWTA 4LB6B 4OIQF 4Z2YA 2R7XA 1R5HA 2X9DA 2JPBA 4CA0A 1BL0A 1JUSA 2LTPA 4MTEA 2PBIA 1OCRH 1TC3C 1N77A 3HTSB 1RRJA 1KONA 5A2QZ 4LK0F 3A01B 2DFIA 2ZJQF 1A31A 2GM4A 1P9QC 3MKYB 5FFXA 3SQNA 1YITI 2MG4A 2FEZA 3TW6A 3V7SA 3P9IA 4NBQA 1RKWA 2XB0X 2NNYA 1IDYA 5J47A 4LJZF 3OS1A 4HLYA 1VZ0A 1N25A 2VIXA 2DA1A 1FY7A 2IVMA 2HZTA 4YEJA 3RIRA 2D1VA 3RPUD 2HI3A 3LQQA 3RSNA 4LG0B 1QGPA 3K1PA 2IS4A 3TL4X 2A6HF 4I0AA 3S32A 1OCTC 2XKPA 2EIKH 2DPDA 4CDGA 2VQGA 2YS9A 1JUPA 3GO5A 4UVAA 2K9SA 4IO9F 4E7LA 3E3VA 2AQEA 1PUEE 4II3A 5J8CA 2R7DA 2CYYA 5D5WB 4XR6A 2ZXIA 3OYCA 3QOPA 5F0FA 5F0HA 9ANTA 2H09A 5EYRA 5FLMJ 4OAYA 2BHZA 5EEAA 3LAPA 3DXJF 3CO7C 1ZKGA 2P7VB 1TWGJ 1VQMI 4XLNF 1NG7A 2VJIA 2K86A 1EH7A 1WH7A 1IRFA 2V1NA 3OIOA 4KMUX 3W3CA 2IP2A 4A12A 4KITB 2JSCA 2XGXA 5EEHA 2DAOA 1HBXG 3DLLF 5DYMA 3MVPA 1HOMA 1VQKI 1I5ZA 2IGMA 2VJJA 3OYBA 1WJBA 1G6NA 3L2QA 1KZHA 2K27A 4XMYA 2EH3A 4A0XA 5FFZA 1IRXA 3Q3SA 1FJLA 1BR1A 1QHHD 5J1RA 3OYIA 4YIIA 2KDOA 4C2MJ 1RNLA 3ZMUA 2G0EA 2PMZN 3ABKH 1XMKA 1QHGA 2DOEA 1KYWA 2L3DA 3DTIA 1Y1VJ 2QZ8A 3JRCA 1D8JA 1KU3A 4IX7A 1R4NB 3SZPA 4N9IA 3EYIA 4JK1X 4AUXA 4BU2A 1FZPB 4XKWA 4K2EA 4JX6A 5FO5A 1ZR2A 2L2OA 4M9SA 1FYKA 4D7MA 1QQIA 2HOSA 2ZCWA 5KVRA 2K9NA 3TKYA 2HQRA 2EA4A 2RN7A 1UHMA 1YIOA 1S29A 1LE8B 3PFYA 4ANJA 4MEXF 4E6KG 1I6HJ 4BH9A 5LGNA 4KICA 4Q47A 2K02A 2A3SA 1R1UA 2VJ4A 1ZRDA 2QQ8A 1U3EM 1I50J 4PSXA 5HS7A 1BI1A 3OYEA 1UHSA 2GAUA 5DD8A 5FD6A 3ABMH 1BR2A 2ZJPF 4JBAA 4LIVA 3JR9A 2X1CA 3FM5A 4Y33A 1PUFA 1MJBA 5E20A 4EVIA 2HOEA 3BJAA 1OR7A 3LSGA 1YHQI 4ZTJA 2KZVA 4IOCF 1B8IB 4BQNA 1MKMA 1SFEA 3KE2A 1VQNI 5FLXK 1Z6TA 5KAFC 4BE2A 3I64A 3JREA 2EFPA 1MNDA 5ILUA 5DUKA 2LF7A 3TDUC 3LSKA 2CO5A 4HX4A 2ELKA 2WB1N 1JTXA 2VPLA 2XAJA 4XICA 3M1CA 1MMSA 6PAXA 2JUCA 3CMYA 3FISA 1Z05A 3T5XA 1Q1HA 3KFWX 4G6QA 4L9JA 1X1AA 5CVIA 1IN4A 3D5LA 1ZR4A 2L9VA 3RPUA 5D6EA 1GVDA 1TWHJ 2FMLA 4I2OA 3LNQA 3I71A 3M8EA 5CVJA 5E1ZB 2UXNA 4U7BA 2K3PA 2MLKA 2O61A 3BQYA 3HKZN 3FXMA 1J5YA 1MJ9A 1P7JA 2ISYA 5HOOA 4B43A 1X1DA 3ABUA 3FBNB 2V9KA 2L4AA 4I09A 2GQQA 3CUQC 4DYQA 4UUSA 3A2KA 3GF2A 4KFCA 2XRNA 5C44J 2ZC2A 4A3JJ 2Y0SN 2CFOA 2E34A 1XC5A 4YG2F 3COAC 4EQQA 2M7BA 1YJ9I 3E5QA 1FP1D 1WJCA 3I4PA 2EWNA 4Y13A 3CCVI 3QPTA 3C2HA 1ZGWA 2ZB9A 1QVUA 1XGSA 5L3EA 4LOCA 2ZMEA 2WAQA 3PNVA 4HRIA 3O6BB 1R23A 2BY2A 2ME6A 1K7AA 3VWBA 2ZKZA 2P6SA 4PFPA 4AWXB 4Q48A 2VOOA 4KMFA 2A6TA 2CH0A 1Z7UA 5FKOA 2DJIA 3E97A 3FX3A 3ECOA 3HIFA 1AU7A 2QA4I 4Y17A 1BOAA 5LFAA 2ETHA 2HYFA 2XGCA 2R7WA 2IAIA 1FC3A 2XF7A 1IXCA 5HNFA 4ZDOA 1RUOA 3IWFA 2K9MA 1RR7A 2QSHX 2NS0A 2R7QA 2M2EA 4GGGA 3DPUA 1IJWC 3WODF 2H1LA 3CUQB 2KKOA 1MDMA 4MQVA 2BW3B 1ZRFA 4AIHA 2E7XA 1TQMA 5HDKA 1SD6A 2JRMA 2DO7A 2P6TA 1X1PA 5IP6A 2X0LA 2ELJA 1KGSA 1IAWA 3I58A 1X1BA 4J19A 4AVPA 4BJ5C 4BUPA 2NVYJ 3ZMDA 1U2WA 2FQ4A 4DNCA 2Y48A 1WCMJ 3TW7A 2VPRA 1Z21A 4XORA 4ZZDA 5K5QA 3RKQA 5HNHA 5F6FA 2LLKA 5DCMB 4RBOA 4JX4A 2R0QC 1EH6A 2CRGA 3OYDA 2FNPA 1GV5A 4A3FJ 2Q2EA 1HF0A 5FRNA 1K79A 1IRGA 1R1VA 4A3IJ 3HC7A 2ZXWH 5C3EJ 4D9JA 3KETA 4U88A 3C3WA 1R1TA 2YSRA 3M4OJ 2PN6A 1W36D 4DYCA 2DMPA 5EDNA 2YU3A 2HTSA 3H9GA 1VFCA 2XF6A 4ENMA 2B0LA 1HXDA 1QU3A 1B4AA 3ISPA 5CVRA 3GCMA 4P5OA 5GAGJ 2HGCA 1BC8C 2VXZA 3F8CA 2MD0A 1F43A 2H94A 2DA3A 3OOUA 4DYRA 3DU6A 2CQKA 4KT6A 2OZUA 2V6EA 2HKXA 2HTJA 5E8IA 4ESBA 5KAIC 5M3FJ 4P9FA 4G8XA 2HYJA 2HXIA 3S1RJ 1TTYA 3BR3A 4OMZA 3HXLA 4PGGA 2RAEA 2F5DA 1Y1WJ 1D1CA 1FIPA 2R7FA 2W57A 2DU9A 5FB2A 4A5NA 5JVTA 3L2VA 3HL2A 4G94A 1SAUA 2OF7A 1DUXC 2GZWA 3D1NI 3JSPA 4RLFA 4IHVA 3ASOH 3U2RA 1AOYA 4RGUA 2IGKA 4BHPA 3MZHA 1KQ0A 3I0TA 1Z3XA 2OQRA 4YFNF 3S3NA 3WU0A 5F64A 1O57A 4B3AA 4YIRX 4M3BA 1YLFA 5B1BH 5FRMA 2W4SA 3HUGB 2JTVA 4LD5A 4XN0A 4E7JA 2DA6A 2FBIA 3T8RA 4BQOA 1APLC 1D5YA 4N0BA 3WG9A 1DU0A 2EFNA 2FBKA 4ZDPA 2DN0A 2J5OA 3CCJI 2PI0A 3V42A 2LF8A 4DGWB 4CZCA 3ZQ7A 2ZBKA 4PJNA 4X1EA 4AM3A 2BXYA 3S1QJ 1T39A 1XSVA 1W4MA 1BOBA 4IVNA 5J1UA 5B1AH 4GFBA 5IYBJ 1G59A 3JRIA 2GXAA 3BTCA 3EQLF 4WXHA 3K4JA 3GTOJ 1E17A 4BYYA 5L3BA 3BC8A 3GTGJ 3HPHA 1FTTA 1I3QJ 2CGPA 2G9WA 4A6DA 3I56I 2GXBA 2PJRA 2CQXA 3PIOF 2JA2A 1GT0C 2AXTC 2HKOA 2IBDA 2NYXA 1I1SA 3ULQB 4O6JA 5IP7J 3V8KA 4HOBA 1MZBA 2Q1ZB 3FXJA 1FOXA 3TO7A 3R0JA 3Q0VA 2C6YA 4DJAA 3FMRA 1ETOA 1FNNA 3GXOA 3HRTA 2CV2A 2Y31A 3TBIA 3U1KA 3G73A 2VKEA 3HHGA 3WGHA 1DP3A 2P8TA 4XLEA 1IGNA 2E2JJ 4E70A 3OSGA 3R60A 3C2BA 3H3ZA 5HDNA 3K70C 3LSRA 3LOCA 1IXSB 3CC7I 4MFDA 5E8GA 5GADJ 2YUSA 4XSXF 2EA2A 5FD5A 3U9GA 1IG7A 4CCKA 4KJZA 1Y39A 3FDYA 3ZN0A 1ERDA 2A68F 2OUMA 3I4MJ 3I4NJ 5JFRA 1WPKA 5KK1A 1N78A 1I39A 2FXAA 2KIUA 1WI9A 5JI6A 1OKRA 1WVRA 1FOWA 1KU9A 5J1YA 1R49A 1TNSA 3HYIA 1HKQA 3MQ0A 3MZ8A 3SDGA 4MGRA 4AU7A 4RB3C 1AKHA 3W2VA 5D4RA 2DTZA 2IPQX 2QQ9A 2LH9A 2OA4A 3CCQI 3HOSA 4BNCA 2DOFA 1QPMA 4X0GA 5AIPA 2UXXA 3CDLA 5H20A 3U21A 2CW8A 1K6OA 1OYYA 1H9TA 3AL0C 3SHFA 3JAMK 3OSFA 4UNOA 2UWMA 1YW9A 3NRVA 3F9KA 3I59A 1YO5C 2O7OA 3HRMA 3OL4A 2GOXB 3ESWB 4XLFA 1U5TC 2XGDA 3F8BA 4UVBA 2LMDA 4Q4ZF 2DQRA 3HRUA 5GPCA 5E3NA 1I6XA 4HNUA 1W1WE 3EYYA 2EB7A 5D8KB 1XN7A 2QYOA 4NNJA 1YI2I 3MD2A 3KCCA 2WB1A 1KQ9A 1VQPI 1IUFA 2QBYB 1IC8A 2M1BA 4ZZLA 1S3JA 3LFUA 3WG7H 3HHHA 3HRSA 4L9VA 2R7RA 1OCZH 3OL3A 3WTZA 3FMSA 2WAQN 4QIWN 1QVTA 4F3QA 1MIJA 1O4XA 4B4CA 1R6RA 2PQ8A 4I0BA 2LY2A 3KP7A 3L2CA 1SFOJ 1ONVA 1QZEA 2G7UA 5LRRA 1KU7A 3NAUA 3F22A 2FUG2 2E19A 3N05A 1G3YA 2E35A 3KLNA 3HKZA 3S2HJ 1Y8QB 3HGGA 4DBRA 1JJ8C 2XC7A 1I1GA 1BA5A 2L9SA 3K4MA 1S7OA 4AIDA 1T8IA 1KU2A 1B9MA 4AIKA 2DFFA 5EZHA 4Z6YA 4BY7J 3V8LA 4V2FA 5M5YJ 3G71I 4HZFA 2I10A 2KIQA 2MC4A 4EJOA 1YOVB 2P4WA 1IN6A 5KCMA 1SANA 1YRNA 4QSHA 1E3HA 5E1WA 3MN2A 3ERED 2ZSHB 4A69C 3VSLA 5JLXA 1P4XA 4F52A 2Y30A 4D5CA 4W97A 4II2A 4CCLA 1ZLJA 3FF5A 4JP0A 1QZZA 4OOIA 3BG5A 1RESA 2JMWA 2X85A 3KP3A 5J4YA 1FBSA 3HOXJ 5EGOB 5DS9A 2E5ZA 2EZHA 2EFQA 2XV4S 2ID3A 3WGIA 1A6QA 1WWXA 5IT3A 5EZGA 2A07F 1JGGA 2DDAA 3K0LA 4A3LJ 3AG2H 4BHBA 3SEQA 4LLNA 3CP8A 4IJAA 3A02A 2L9NA 2DW4A 2ISZA 1T0FC 2MABA 4RA2A 2EINH 2NVXJ 3UR3C 3U1DA 1VQ7I 4EGZA 1I3AA 2YX7A 1O3RA 2ZO4A 4RMNA 4KIFA 5K7ZA 1OMIA 2LK2A 4I98B 3S2WA 1TL8A 5CYVA 3DP7A 2FMYA 3MZYA 2VI6A 4XLHA 1XGNA 3P7NA 2Y69H 1MH4A 4Y4RA 1VTNC 1AHDP 3BQZA 2A69F 4BEHB 3Q9SA 4M9ZA 3AKZA 1IV8A 5E1XA 3MKWB 3H0GJ 3K4NA 4XIDA 3TO9A 4UUTA 1O7LA 3KEYA 2QLZA 1S8NA 4F93B 1YW7A 4MQ9F 3WTVC 3H5NA 2L54A 3H92A 3CQZJ 3DKXA 2EPFA 1JKQC 1TP4A 3ZQCA 3IH4A 2LSOA 2RREA 3CTAA 4I02A 1K78B 3J80Z 3I54A 2OTJI 3BROA 2R7UA 2OAZA 3CESA 4XOTA 4BL0B 3WHBA 1TWCJ 3NARA 1U8BA 4HG2A 4E7IA 2D1HA 4OIOF 4A0ZA 4C3HJ 1RKTA 3GTMJ 2VLAA 1D0ZA 1RI7A 3B02A 1JGSA 3KP6A 2WAEA 1T2KA 3V7RA 1EA3A 1X3UA 2F5EA 2L02A 1WFXA 3F23A 1U9OA 3L9FA 3L1PA 2ADUA 2GLOA 1FBQA 3QWLA 4IHYA 4L0ZB 3ZGKA 4M3DA 4CUGA 1FOYA 1GVJA 4IXAA 1Y0NA 2TDXA 2VE8A 2Y9ZA 2VT3A 2PJPA 5FKKA 2JVHA 3FXLA 2QEXI 2JUGA 2NNNA 4KN4X 2HQNA 1DGWY 2CQNA 1XDUA 1T98A 4FISA 3F8MA 3K1MA 2STTA 3K4BA 4NQWA 2VKDA 3L2WA 5TGTA 3GTPJ 4ZYGA 2XSDC 2HXOA 3ERMA 2IA2A 5HVQC 3SZTA 5HLHA 4MLOA 3P5JA 3VYTB 2IS2A 3M8JA 1WRJA 2MSYA 1J7KA 2OBPA 2P5LC 1P7IA 1A04A 4M73A 2DMTA 2XAFA 2V4JC 4AYBA 1TWAJ 4U0WA 3GWZA 3S14J 2MD5A 1P4WA 2XPWA 3HJEA 2JVGA 2LP0A 4JYKA 4XBFA 4B44A 3CCSI 1IO2A 3OIPA 2E36A 4ZYEA 3L2UA 2P0WA 4IRIA 1ULYA 5FJ8J 2EFOA 4R79A 2WWYA 3GUDA 1PJRA 4IHSA 1JTYA 3CCUI 3J7AY 1DQUA 4EJTA 3RJPA 2LREA 3IP4B 3QPSA 3OS0A 2DDBA 2ME0A 4A3CJ 1F1ZA 2A6EF 3K69A 4ZTFA 1LEAA 3P9KA 3T8TA 3S1MJ 2GIVA 4XOPA 4L9TA 2VQCA 3LSMA 1RZ4A 2EK5A 2R3SA 2W7NA 3RCOA 4LIUA 1XDSA 3OYMA 2Z9OA 3K2ZA 2F5VA 4XONA 3EPZA 3ZMZA 4FX0A 1PUFB 3HOVJ 5GPAA 1U6GA 2UZKA 5FKMA 5HS8A 2XGEA 2I8DA 1T56A 3WE2A 4QLCU 4Y52J 2RNJA 4FE7A 4AC0A 2K5CA 4E4HA 2ZXJA 1JKOC 2P7CB 2IT0A 2XKOA 4P55A 4ENNA 2QGUA 3DEUA 3GEZA 4WXDA 3H9JA 4KISA 1VQ6I 4XLPF 3I53A 3KEOA 4ASNA 1LUJB 1R4MB 3BJ6A 5DDGA 4DZPA 2EZKA 2MLGA 3WTUC 3GFJA 4A2UA 2KPMA 5H2FC 1TT5B 1YS6A 2EIJH 2OQGA 4UHTA 5K5RA 2BBYA 4NC8A 3CP2A 4L5IA 3VB2A 4BS9A 4ZJZA 2M45A 4C30A 4JOMA 4E7ZA 3HOWJ 1ZHFA 2NAZA 2KHMA 4RGXA 1LPQA 1C0WA 2ZFWA 1Z6RA 5J6XA 2ECBA 3G1MA 2V26A 2R93J 4RDUA 2XAQA 1CF7A 3ECHA 2F4IA 3ABLH 4YIFA 1FTZA 2FD5A 2WY7Q 4KDPA 5LHGA 4PK4A 3JRAA 1OPCA 2M8EA 4UUSB 2IS1A 2O3FA 2VC1A 2HVQA 3PO3J 5IYDJ 1X3ZB 1S7EA 4DBQA 1JJ6C 2VBWA 1Z9CA 1X2NA 3FBIB 3LA7A 3GTJJ 4A3MJ 3ZOBA 1SC7A 3PO2J 1IV6A 2JA5J 4HA8A 1HA8A 1A5JA 2B7EA 1OCCH 1MMGA 2ZMEB 2WV0A 2XROA 4CCNA 1JT0A 1P2FA 5IOZA 4QWQA 5FROA 1O3TA 1G2HA 2EBIA 2DYSH 3VYSB 4XRSA 1LFPA 2GA1A 2AQFA 2JN6A 5K7HA 3QU3A 1TW3A 2G7HA 2GWRA 3GZ5A 3KYCB 2R7TA 3ZQIA 2ZFUA 1L3LA 3SFZA 4BDZA 2EQRA 3CO6C 2O8KA 2HPMA 3VODA 1H89C 5LGTA 3C2GA 2E1MB 1SFXA 1FP2A 4HAMA 4PJJA 3PFIA 4RAGA 4FQGA 4HNVA 3K9TA 3R0AA 4M6YA 2JA6J 5J4VA 3QYBA 3RTRA 4C2UA 2CUJA 3GFIA 3CC2I 3ZN1A 2VQLA 1WHUA 1MGTA 2W24A 1REPC 2O9LA 3NEUA 1JKRC 1S72I 2KT0A 2CFXA 1XGMA 1LFUP 3H3UA 2X6WA 2JK3A 3DQVC 3FIWA 2X6OA 5JR3A 1V4RA 4IZZA 3T1BA 1U9NA 3BR2A 1X2MA 5HLIA 4B09A 4N4NB 4MEYF 5HODA 3J7ZI 1W7PD 1W0TA 3FXQA 4WX9A 3DWLE 5L3DA 2VXDA 2HNHA 5D5XB 2Q2EB 1YS7A 2EV5A 3QPLA 2HDCA 2LD5A 4BDYA 1X58A 1R9TJ 1P6RA 1QZYA 3IL2A 2PLYA 2NS8A 2CMPA 4HPQA 2YU9J 4UV9A 2N8GA 3BG7A 5IYCJ 2R7VA 3HG9A 5AONA 1IW7F 5FLXZ 2LDUA 4R1HA 5B5EC 3F6VA 1IUYA 1DDNA 2QCOA 3KLOA 1ZYRF 3OYFA 3IKVA 3FKIJ 5BS6A 3TEDA 1FEXA 1ETWA 1Q1VA 1MMAA 1TNTA 5LEKA 4BACA 2DTRA 2LR8A 4HBLA 4NUBA 2W48A 2XPUA 4C9YA 2ELHA 2W85A 2BOLA 2BY1A 1D8KA 1MH3A 2DQLA 3A1YA 3BTIA 4M3EA 4A3KJ 4A6EA 1HW1A 4A3GJ 3AFHA 4LLLA 2LY1A 3QP5A 2O03A 4IQ4A 2KLOA 3KYLA 3KP4A 3H0DA 3W6KB 1FYLA 4A3BJ 2R4GA 2PEXA 3HSEA 2DT7B 3WTSC 1BI3A 2CU7A 4I99C 4EM0B 2Z33A 4UUVA 3EUKL 3S3OA 4RB2C 2KZGA 1HC8A 3MWMA 4RS8A 2W25A 3K6GA 3FHNA 4PCQA 1FBUA 2H8WA 2CSOA 3GBGA 4MIMA 2AO9A 2CG4A 2ZNYA 3DCFA 4UB8C 4Y7NJ 4BHCA 4G7ZF 3DF8A 1YJWI 1O3QA 3J7AO 4FCYA 2K85A 1K4TA 1OYWA 2K7LA 1Y6IA 3ZXSA 1XCVA 4A3DJ 1OFCX 3FZVA 5C4JJ 3J81K 3R6SA 5ED4A 2EJRA 4DIQA 5AIQA 3HSFA 1W36C 1HSTA 4HQMA 2L7ZA 3JSOA 4CCMA 2QSGX 1M1EB 5ILSA 4AYBN 4CZZA 3HPGA 5K1YA 3NWSA 2B63J 1IRZA 3RZDJ 3LSPA 3PUFA 1VQOI 4LLGF 2PMHA 4MHGA 5GTIC 3GTKJ 1PP8F 1EKEA 5HLTA 1JHFA 2V1UA 1XMAA 1HLVA 5IT9Z 2V1XA 2FBHA 1MD0A 3M1EA 3C1DA 2PJRB 1R7JA 2GXGA 2WC2A 5D5VB 2DA5A 3Q0WA 1RPWA 2FF4A 1UG0A 3ZQGA 4PGHA 3LSIA 1HW5A 2IS6A 1LJ9A 4BE0A 1LDDA 1EJ9A 3BY6A 2A5WA 2BEOA 4U0VA 3JRBA 2DA7A 3K10A 1W7PA 1D1AA 3K4KA 1S6LA 4PUSA 4B3XA 2KP6A 4HV5A 4MFEA 2R5ZA 2O0YA 4JX5A 3OYAA 4J01A 1ZTRA 3GFMA 4QPOA 3LSHA 4EJVA 2EILH 2WADA 4N4OB 1BN5A 2L9RA 4V2GA 3A0HC 2L7KA 2HQAA 1BI0A 1OQYA 1WH5A 2ID6A 3K4CA 3W2AA 3E5XA 4OAZA 2FJ1A 2XPVA 3V8JA 2OTLI 2CW0F 4U7DA 2E5NA 3ZQLA 1NH3A 4PFOA 2HDDA 3FXRA 4XLAA 2JPCA 1V5GA 4A0YA 5EF6A 2ZJRF 1L0OC 1LVAA 3MEXA 5CVUA 3RYPA 1NK3P 4RAFA 4HX8A 4S0HB 3KYDB 4M3GA 3PL8A 4I7HA 4RAZA 1AA7A 5CLSA 4B1RA 1XX5A 3RKYA 5F08A 1ZG3A 1X1CA 3AG3H 1AKHB 2FX0A 2LYCA 5BMZA 1ON1A 4XSZF 4XN3A 3JRHA 3R61A 4ESJA 2HVRA 4GXOA 1JE8A 3PSIA 1MNMC 2BY3A 1NTCA 3DV8A 4EATA 2PFBA 3WU1B 1G4DA 3KIOA 5LD2C 3TOBA 3AAFA 1UCRA 3MAJA 4PJ0C 4O5VA 3H3VK 2DBBA 3MFKA 2DCEA 5E18F 5DEQA 1EF4A 2BXZA 3S2DJ 3VYUB 3HDDA 3I59B 3LMMA 2O8XA 2MH9A 2HFHA 2VT2A 3MKLA 2VONA 4KA4A 1V55H 3FMQA 2KISA 4OWRB 5BQTA 4NHJA 3E1SA 4PSWA 5CQEA 3WTYC 3J80K 2X1DA 2DMUA 4WWCA 1VQ5I 4HW0A 1JXSA 3BTJA 3PIPF 1G3WA 4DQ2A 5B66C 4LFUA 2HR3A 1BJAA 4IPAA 4M71A 3RPQA 3PNYA 4I01A 3WU2C 3OYGA 5K7FA 1ZREA 3A0BC 1EH8A 1MDMB 1WJ5A 2KIMA 2EV0A 2RV8A 3KP5A 4QTRA 5A2QK 4IOAF 3LQRA 4HSRA 1TW2A 4PJMA 2WAFA 4OINF 1FWZA 2CQQA 2OJED 3W6JB 3N4MA 4EGYA 2GA2A 1ZAOA 5CQGA 4ABZA 2JA8J 2KRFA 2XUBA 2Z5UA 3IH3A 4BAYA 1HDPA 2IXSA 3IUOA 1FOKA 1RUNA 3N97A 3S8PA 2RDPA 3ASNH 3CDHA 2COMA 3BZCA 2HYGD 3PM1A 1FIAA 2NOGA 4BXXJ 2HEOA 2F5FA 1F36A 4WCGA 4GDFA 3GZNB 4CGZA 5BNGA 3CJTB 1WJEA 2A5YB 2M0CA 2VC0A 1YRNB 4EJUA 2CQ7A 5H6RA 1D1BA 1MJAA 3BCBA 2FU4A 3OR1C 2F4MB 2Y0MA 2Z2SB 2ZJ2A 2CS3A 2FOKA 2IGNA 3HB9A 2EFWA 4PDKA 1QBJA 2D45A 4N9HA 4E7SA 4ZYHA 1VQLI 1T33A 3TQNA 4ZH4F 4HX7A 4LGWA 4D1QA 3R4KA 4W1UA 2JRTA 4BKXA 2EIMH 2OC6A 2GBYA 3PSFA 3B73A 2DODA 3SZGA 1RC9A 3QAHA 2V9PA 2J5PA 4CH7A 1UELB 4KIGA 4AIJA 3CF2A 3KZZA 4L18B 1XCBA 4KN7X 5GAHJ 1U5TA 2L01A 3H9QA 2MBFA 1TQPA 3JRFA 2FNAA 1ZG1A 4I6ZA 4LK1F 1VF9A 2FSWA 2QQBA 2L7FP 1UJ8A 4UY8I 2E1CA 3CLOA 3FXKA 2BZTA 4DZJA 3BZKA 3S1NJ 2AS5F 2D2WA 1MBFA 3ABTA 2W00A 2XAUA 3DU5A 1SD4A 3TGNA 3J7YJ 3BJOA 2HZDA 1MBJA 3BR5A 4HQEA 1SVMA 2HWVA 1SAXA 3WHCA 1Z67A 1RETA 1ZGJA 2A61A 2M5WA 5EG0A 1R5ID 1WGXA 4TV7A 3H35A 4CYCA 4WXCA 5TISC 1TZLA 3M07A 3QOEA 2VJ5A 1MSEC 2ZNZA 1LFBA 1T08B 2M87A 2FE3A 2X4HA 4P1WA 2E1NA 3HTUA 2RKHA 1UB9A 1K6YA 5HDGA 3HSRA 4HNTA 2MW8A 5ERIA 1YIJI 1DPUA 2MA3A 2NVTJ 3WTWC 1BR4A 3OYNA 4XRFA 3CUOA 3M9AA 2DA2A 1JT6A 2DMQA 5TJJA 1K61A 3ML6A 5GTHC 1H9GA 4FETA 1D3YA 4ZDLA 2R5YA 3BR6A 4XLCA 5GP9A 4GYGA 1VQ4I 2RVCA 3MMYB 1D0YA 2WV1A 1MBHA 4Y3OA 2MFZA 4G9YA 1QO0D 2PX9A 2VN2A 5D5UB 4C2TA 4DOZA 2KJCA 3EUHA 4NB5A 4PJLA 1GHCA 3GX4X 1SFUA 1B1BA 1MBEA 2M7AA 1Y8RB 5E3MA 2LFBA 1X19A 4E7HA 1R5GA 3CMMA 4ETSA 2YX4A 3GFLA 3CCMI 4BXUA 2BV6A 3QODA 3E6BA 2LBFA 3DBHB 4BGDA 3DFGA 3QYFA 3GLLA 4L5EA 3A03A 4MTDA 3OY9A 1TLHB 3WTXC 1NG6A 2DA4A 4U87A 2M4KA 1ETKA 4F91B 1T0FA 2XDVA 1VI0A 4WK8F 2HS5A 2VASA 4CCOA 4P9UA 2KMUA 3A01A 1VQ9I 1B6AA 4XKVA 3IV5A 4NQWB 1ODDA 4S04A 1PDNC 1D5VA 4D7NA 2L4MA 2RNGA 2IA0A 2JQ7A 4HDVA 2NS7A 3SDBA 4L5JA 1ITYA 2L0KA 3CLQA 2V9VA 1J0RA 3HM5A 1V5EA 2V7FA 1G3SA 3BOQA 5DM6F 4A93J 3E6DA 3CCEI 3LWFA 4LG0A 3VSKA 4WF2A 3OYKA 1OR7C 2Z16A 2W84A 5LEJA 2UV1A 1OLTA 2MC3A 3OR2C 4B8XA 1FSHA 3JRGA 3LA2A 1F9NA 1YE9A 2O5RA 3GVAA 4XK4A 1HQCA 3KP2A 2KL4A 3MCZA 3NQOA 4YELA 3HGYA 5CJ9A 1HCRA 2WBMA 1SVOA 3B6CA 5IY5H 1V5FA 1STZA 4OU0A 2X51A 2CV1A 5H6QA 1TWFJ 5K5OA 2LRDA 1RR8C 4NC6A 3Q5FA 1QA6A 1R58A 2RQQA 1DP7P 4G7OF 1SEUA 4IHXA 1FYMA 4IKFA 2FRHA 1GXQA 2V79A 2LKPA 1UAAA 2E7WA 1FT9A 4O3MA 4LITA 3BR1A 2JT1A 5D8LB 5E3OA 5J40A 5ILVA 1Z7LA 2E2HJ 3FK6A 4ZYDA 4EM2A 1GDTA 3LAJA 1Z3YA 1ON2A 3QP6A 2LKXA 5FLVA 4HV6A 4CYDA 3QU6A 3RDIA 5CKTA 4ON0A 3AG4H 4BQAA 1H8AC 1W5SA 2EV6A 1IZ1A 3HOZJ 3TO6A 1WJDA 1BW6A 1X4OA 4RGSA 5CVVA 2QSFX 4ZYAA 1LE8A 1LVKA 3G3ZA 3RYRA 3BWGA 1XSXA 4MO7A 4M6XA 1WZ2A 1U0JA 4FHTA 2GOMA 2ZMEC 2M4GA 2IRFG 4IRHA 3DEWA 1XMXA 4IHTA 4XKCA 3DBLB 4RB0A 1R22A 3SEZA 4XRSG 1ACIA 3BG6A 3VEPA 1ETXA 2QWWA 3JW4A 3RZOJ 4BJ6C 4G12A 3HOYJ 4OIRF 1CQTA 4M3FA 1Y56A 3PJRA 1B8IA 4L9NA 2KDZA 4IRGA 2H1KA 1UG2A 1CF7B 3IRRA 1RIOH 5IOYA 1UFMA 2LKSA 3O3KA 1TBXA 1LDJA 2M8GX 4XQFA 3LSTA 2EZIA 2R7ZJ 1UHWA 2OPTA 2MH2A 2XHKA 1SMTA 2FA5A 2E1MC 2LNBA 4BE1A 1ZGAA 1ZRCA 3CMAI 1T38A 2QKMB 5DM7F 2ECCA 1IXRC 2IA1A 3I9V2 2HU9A 5JVGF 1R36A 1E3OC 1ZQ3P 3TMOA 2KRHA 4B48A 2JJ7A 4GRIA 2XVCA 5D6FA 2RGVA 2DOAA 2HOAA 3IHUA 3K4LA 4G6DA 3WTTC 3I55I 4Y15A 3SJMA 5DUIA 4LB5A 2VUMJ 4HSTA 1ZLKA 2EZLA 1B9NA 1D0XA 2JZYA 1V3FA 5J8FA 3G1OA 3LSJA 4I76A 2QUFA 5LLQA 1XS9A 3VFZA 1MBKA 1IF1A 5EJCA 2F48A 3K2AA 3L7WA 3GLXA 3IC7A 5E79C 3VDXA 4BY1J 5L3FA 2RC4A 4P96A 1A35A 3BTLA 3GYHX 2DT6A 4M74A 1O7FA 1E3PA 4BBRJ 4F55A 2DT5A 1F5TA 3ZR8X 1XD7A 2Z1DA 1LB2A 3TDZC 3F8NA 4BQQA 1SVLA 3O2PE 1V54H 4CSWA 5M5XJ 4KYWA 1MNEA 2VB6A 1P4AA 4L0YB 1J09A 2PMUA 3O8HA 3G6EI 5IT9K 1G8XA 1J9IA 3KEQA 2OD5A 3E0JB 1KYZA 3V4GA 2RQPA 1AWCA 3LA3A 5LHIA 2QKLB 2CJJA 3OYLA 2OV7A 3SFIA 4X6AJ 5D4SA 3ZP5A 1ORKA 5ICGA 2AXLA 2ESNA 1ZG5A 1FMVA 4HF1A 2LG4A 4RM3A 2H27A 2QM3A 3QRFF 2Z3YA 1XSDA 2P5VA 3VYRB 2VKVA 2F2EA 2LY9A 2OCCH 1O3SA 4A3EJ 5M5WJ 2VODA 5CPRB 1MBGA 2K9QA 1E0EA 2VBXA 2COBA 3DKYA 2NVUB 3LFKA 3FWEA 4M72A 2P81A 1NHAA 4CXFA 2VBZA 3CUQA 3OWTA 2BW3A 3Q9VA 1S9HA 3ZQFA 4V19K 1JKPC 3OOPA 5ICEA 3UNGC 1XG1A 4YFKF 1GXPA 5BPDA 1WI3A 3P9CA 2Z99A 2DXIA 1JHHA 2A05A 4RGRA 1YFHA 4YRVA 2CUZA 4R8HA 2OU2A 4BJTA 1F4KA 1WSUA 1BIBA 2M30A
chains in the Genus database with same CATH topology
2LMDA 1MIJA 1XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LMD A;  1MIJ A;  1XPX A; 
#chains in the Genus database with same CATH topology
 2JA7 J;  2STW A;  1QNT A;  4QPQ A;  3ZMV A;  4ENJ A;  5DCM A;  4GO1 A;  2ESH A;  2Y75 A;  3E7L A;  2IGO A;  4LG3 A;  2VOP A;  1J59 A;  1N75 A;  2K4J A;  3CZ6 A;  2H6C A;  2TCT A;  2BGC A;  1HKT A;  3ONQ A;  3JTH A;  2YR2 A;  1MMN A;  5F04 A;  1Z1D A;  2B9S A;  1WJA A;  1Z77 A;  2XIG A;  2VL8 A;  3ZRG A;  2BY0 A;  1ZH5 A;  4RLQ A;  2KFD A;  5EEG A;  4UVC A;  4ZC3 A;  1TT0 A;  3MKZ A;  4RM2 A;  1FSE A;  2CW7 A;  2VQH A;  1SD5 A;  3DKW A;  1BM9 A;  4FT8 A;  2VE9 A;  5J3L A;  3JTG A;  3CME I;  1OCO H;  2XF5 A;  4GCV A;  3FXO A;  4ESF A;  1SMY F;  1HKS A;  3VPR A;  5M3M J;  3KZY A;  3C18 A;  4D0P A;  2BHY A;  3RKX A;  4ITV A;  2DI3 A;  2W1O A;  2M9H A;  3HBL A;  4UB6 C;  2LC2 A;  2WA0 A;  1WKM A;  3QQA A;  2CV0 A;  2FQ3 A;  1ETV A;  3CF5 F;  2L5Q A;  3LL7 A;  3BT9 A;  4EEF G;  1YW8 A;  2HDW A;  3E5U A;  4ENK A;  4KIB A;  3GW2 A;  2H8R A;  1Y0U A;  2R7O A;  2CWE A;  3G1L A;  1H0M A;  4FAS D;  2DPU A;  3GTL J;  1SFK A;  3M7G A;  2K9L A;  4IQJ A;  3OS2 A;  4C3I J;  4OMY A;  1W5C C;  2KIF A;  1OJL A;  4CIC A;  2HQ5 A;  1XB4 A;  2DK8 A;  1JUM A;  1KA8 A;  2ZSI B;  4J00 A;  3ZMS A;  4H4K C;  5GAE J;  4NDL A;  3HUG A;  4EMS A;  4F7Z A;  5HLG A;  1ETY A;  3K70 D;  3BDD A;  1UZC A;  3KPH A;  1LQ1 A;  3ZCO A;  3FXU A;  2PG4 A;  3BZ6 A;  5FGM A;  3HZJ A;  2MYS A;  5F1R A;  2QEN A;  4BBS J;  1FLI A;  2DK5 A;  1MMD A;  3D5R C;  3NWT A;  4MNU A;  4XRM A;  3L09 A;  4CO8 A;  3H1C A;  1FMW A;  1W7P B;  1WJF A;  3G4S I;  2L7M P;  3GZ6 A;  1PYV A;  2E2I J;  2ICW G;  2MGQ A;  4G6T B;  2XSJ C;  3F21 A;  1BJZ A;  4PZJ A;  3H5A A;  1Z0X A;  1IN5 A;  2ZXH A;  1X3W B;  2R5Z B;  1GLN A;  3PQJ A;  1IDZ A;  2P5K A;  3HOT A;  5DV5 A;  3F3X A;  2X6Y A;  3HEF A;  2LVS A;  5F27 A;  2NOJ B;  2HPI A;  3DLA A;  4U0Y A;  4CHU A;  3K7A J;  4AVZ A;  2M34 A;  3BPV A;  1IN7 A;  1JI8 A;  3ROU A;  3OIQ A;  2R92 J;  2Q0O A;  1DGR M;  3EDP A;  3BG3 A;  3W2W A;  1DPR A;  1TQI A;  4IHW A;  2D5V A;  1UMQ A;  1XTA A;  2JSP A;  3CJR B;  1YQA A;  5BOX A;  3F6O A;  1KQ8 A;  3JCU C;  1K83 J;  3CJN A;  3TP3 A;  1SD7 A;  4YFX F;  2DFE A;  3F0C A;  3G2B A;  3DTK A;  2PMZ A;  1GUU A;  3TP0 A;  5FKL A;  1T95 A;  1U8R A;  1EV7 A;  1YJN I;  1S5L C;  3S17 J;  1A6I A;  1R00 A;  3H5R A;  4CCJ A;  1FX7 A;  4KT5 C;  2X48 A;  1GV2 A;  4XKB A;  4AD9 A;  4RAY A;  1LDK B;  3DBR B;  2OZ6 A;  5JHF A;  2V1D A;  3WE3 A;  2H6B A;  1LNW A;  2XAH A;  5DD4 A;  5L3C A;  3REO A;  2WY8 Q;  3H36 A;  3RQ4 A;  2W82 A;  3BLY A;  4HF2 A;  2VKH A;  3E6C C;  1BW5 A;  2UUZ A;  3T0Y A;  3IRQ A;  3DTE A;  1W5T A;  2KQR A;  5KHD A;  4FE4 A;  3PNT A;  5IPA A;  1ENH A;  3L2R A;  2M0M A;  3UKG A;  2F4O B;  5DTD A;  4EJW A;  4BXF A;  3DEE A;  4S05 A;  4H0E A;  5BPI A;  4DW6 A;  3E6M A;  3KZI C;  5DCF A;  1XPX A;  3BP8 A;  1DU6 A;  3C7J A;  3L00 A;  2IEK A;  3HOU J;  1S7A A;  4XNF A;  1LEB A;  2AHQ A;  2QQA A;  4IL6 C;  4D5F A;  4OIP F;  5F0C A;  3F8F A;  1OIS A;  1YX3 A;  1YG2 A;  3IKT A;  2DFH A;  3S15 J;  2BYV E;  1IN8 A;  1WQ2 A;  1UST A;  3K1N A;  1HDD C;  3CC4 I;  2DMN A;  2GIZ A;  3FK7 A;  4GYI A;  3VOE A;  1H88 C;  2R7S A;  2QBY A;  2OCE A;  1HW2 A;  2NVQ J;  3FM3 A;  3J81 Z;  3X2Q H;  1E2X A;  3EET A;  4IF4 A;  2BVL A;  1QRY A;  2DLL A;  2CUE A;  2LOO A;  2F6C A;  4IEJ A;  2NRA C;  1U78 A;  2HOT A;  3BCA A;  4HYE A;  4XL9 A;  4E7K A;  5IP9 J;  4KNY A;  3GME A;  3EUA A;  3QPH A;  3BG9 A;  5LHH A;  3IH2 A;  3S93 A;  1OCP A;  2K3F A;  3IAM 2;  1VND A;  3CCL I;  1MW7 A;  3KX2 A;  1ZN2 A;  5B3S H;  3OMY A;  1USS A;  1B72 B;  1BC7 C;  3SXY A;  3QYE A;  2XAS A;  4C3J J;  4FTH A;  4KUM A;  3PUB A;  1B72 A;  4EM1 A;  2KJB A;  2V6C A;  3F72 A;  5L3G A;  4G7H F;  1BBY A;  1QPI A;  3AL0 B;  3S16 J;  2Y9Y A;  1Z91 A;  1ZAR A;  3OV8 A;  3D0S A;  2Y0S A;  1B59 A;  4F92 B;  2Y2Z A;  1VQ8 I;  2I5U A;  2XAG A;  3JRD A;  5LBQ A;  1A36 A;  1J2X A;  1G3T A;  2O6G E;  1BIA A;  1U5T B;  3I3L A;  3WGG A;  1XGO A;  2ACJ A;  4M6V A;  1OYI A;  1ZK8 A;  2TRT A;  4UV8 A;  3A4C A;  3Q0U A;  2IW5 A;  1ETQ A;  2K4B A;  3IAS 2;  4Q5S F;  1YYV A;  3CJQ B;  4RB1 A;  3EUH C;  3ZPL A;  2WTE A;  4HLX A;  4JQF A;  2BVM A;  1T6S A;  3CCY A;  1K4S A;  5HS9 A;  5JLW A;  4XM3 A;  3FHZ A;  3PQK A;  3BPX A;  3O8G A;  2K40 A;  1LKX A;  2DYR H;  1R71 A;  3M3Y J;  2VBY A;  3IWZ A;  5EG0 B;  2QF7 A;  5EGO A;  3AG1 H;  4CYC B;  4HEA 2;  3GTQ J;  2X1E A;  3I5U A;  3B6A A;  2IJL A;  1YTY A;  1BI2 A;  3SYT A;  3ELK A;  1X4P A;  1PP7 U;  3OYJ A;  2NXN B;  2CUF A;  2YPR A;  1ZEL A;  5ICF A;  1P92 A;  5KNL A;  4LMY A;  5F1J A;  2E60 A;  5FKN A;  4UXN A;  2F5C A;  3ZQQ A;  1NK2 P;  1HSJ A;  2KRC A;  4FX4 A;  3M8F A;  5C4X J;  3W6V A;  3DPT A;  3V7C A;  2XRL A;  2E71 A;  2R5Y B;  4M9X A;  3RQI A;  2QVO A;  1J75 A;  3BR0 A;  1FPQ A;  3ZMT A;  4HDU A;  4HF0 A;  5JHU A;  1POG A;  2HVS A;  3CD6 I;  3FKJ A;  2FOW A;  3D5S C;  3DPL C;  4BEH A;  3CCR I;  2X6X A;  3TOA A;  3JAM Z;  2BE5 F;  3RKW A;  3ZQH A;  1YX5 A;  2M3A A;  3CDI A;  3S3M A;  5LGU A;  5LRS A;  4NC7 A;  2E1O A;  1I27 A;  1W0U A;  1MSF C;  4A5M A;  3OYH A;  5TRD A;  2Q8K A;  4B47 A;  4EV0 A;  2LBF B;  2XB5 A;  5E3L A;  5ICC A;  1CGP A;  2DJN A;  5E17 F;  3RI4 A;  1K78 A;  1PVE A;  2JWT A;  4LB6 B;  4OIQ F;  4Z2Y A;  2R7X A;  1R5H A;  2X9D A;  2JPB A;  4CA0 A;  1BL0 A;  1JUS A;  2LTP A;  4MTE A;  2PBI A;  1OCR H;  1TC3 C;  1N77 A;  3HTS B;  1RRJ A;  1KON A;  5A2Q Z;  4LK0 F;  3A01 B;  2DFI A;  2ZJQ F;  1A31 A;  2GM4 A;  1P9Q C;  3MKY B;  5FFX A;  3SQN A;  1YIT I;  2MG4 A;  2FEZ A;  3TW6 A;  3V7S A;  3P9I A;  4NBQ A;  1RKW A;  2XB0 X;  2NNY A;  1IDY A;  5J47 A;  4LJZ F;  3OS1 A;  4HLY A;  1VZ0 A;  1N25 A;  2VIX A;  2DA1 A;  1FY7 A;  2IVM A;  2HZT A;  4YEJ A;  3RIR A;  2D1V A;  3RPU D;  2HI3 A;  3LQQ A;  3RSN A;  4LG0 B;  1QGP A;  3K1P A;  2IS4 A;  3TL4 X;  2A6H F;  4I0A A;  3S32 A;  1OCT C;  2XKP A;  2EIK H;  2DPD A;  4CDG A;  2VQG A;  2YS9 A;  1JUP A;  3GO5 A;  4UVA A;  2K9S A;  4IO9 F;  4E7L A;  3E3V A;  2AQE A;  1PUE E;  4II3 A;  5J8C A;  2R7D A;  2CYY A;  5D5W B;  4XR6 A;  2ZXI A;  3OYC A;  3QOP A;  5F0F A;  5F0H A;  9ANT A;  2H09 A;  5EYR A;  5FLM J;  4OAY A;  2BHZ A;  5EEA A;  3LAP A;  3DXJ F;  3CO7 C;  1ZKG A;  2P7V B;  1TWG J;  1VQM I;  4XLN F;  1NG7 A;  2VJI A;  2K86 A;  1EH7 A;  1WH7 A;  1IRF A;  2V1N A;  3OIO A;  4KMU X;  3W3C A;  2IP2 A;  4A12 A;  4KIT B;  2JSC A;  2XGX A;  5EEH A;  2DAO A;  1HBX G;  3DLL F;  5DYM A;  3MVP A;  1HOM A;  1VQK I;  1I5Z A;  2IGM A;  2VJJ A;  3OYB A;  1WJB A;  1G6N A;  3L2Q A;  1KZH A;  2K27 A;  4XMY A;  2EH3 A;  4A0X A;  5FFZ A;  1IRX A;  3Q3S A;  1FJL A;  1BR1 A;  1QHH D;  5J1R A;  3OYI A;  4YII A;  2KDO A;  4C2M J;  1RNL A;  3ZMU A;  2G0E A;  2PMZ N;  3ABK H;  1XMK A;  1QHG A;  2DOE A;  1KYW A;  2L3D A;  3DTI A;  1Y1V J;  2QZ8 A;  3JRC A;  1D8J A;  1KU3 A;  4IX7 A;  1R4N B;  3SZP A;  4N9I A;  3EYI A;  4JK1 X;  4AUX A;  4BU2 A;  1FZP B;  4XKW A;  4K2E A;  4JX6 A;  5FO5 A;  1ZR2 A;  2L2O A;  4M9S A;  1FYK A;  4D7M A;  1QQI A;  2HOS A;  2ZCW A;  5KVR A;  2K9N A;  3TKY A;  2HQR A;  2EA4 A;  2RN7 A;  1UHM A;  1YIO A;  1S29 A;  1LE8 B;  3PFY A;  4ANJ A;  4MEX F;  4E6K G;  1I6H J;  4BH9 A;  5LGN A;  4KIC A;  4Q47 A;  2K02 A;  2A3S A;  1R1U A;  2VJ4 A;  1ZRD A;  2QQ8 A;  1U3E M;  1I50 J;  4PSX A;  5HS7 A;  1BI1 A;  3OYE A;  1UHS A;  2GAU A;  5DD8 A;  5FD6 A;  3ABM H;  1BR2 A;  2ZJP F;  4JBA A;  4LIV A;  3JR9 A;  2X1C A;  3FM5 A;  4Y33 A;  1PUF A;  1MJB A;  5E20 A;  4EVI A;  2HOE A;  3BJA A;  1OR7 A;  3LSG A;  1YHQ I;  4ZTJ A;  2KZV A;  4IOC F;  1B8I B;  4BQN A;  1MKM A;  1SFE A;  3KE2 A;  1VQN I;  5FLX K;  1Z6T A;  5KAF C;  4BE2 A;  3I64 A;  3JRE A;  2EFP A;  1MND A;  5ILU A;  5DUK A;  2LF7 A;  3TDU C;  3LSK A;  2CO5 A;  4HX4 A;  2ELK A;  2WB1 N;  1JTX A;  2VPL A;  2XAJ A;  4XIC A;  3M1C A;  1MMS A;  6PAX A;  2JUC A;  3CMY A;  3FIS A;  1Z05 A;  3T5X A;  1Q1H A;  3KFW X;  4G6Q A;  4L9J A;  1X1A A;  5CVI A;  1IN4 A;  3D5L A;  1ZR4 A;  2L9V A;  3RPU A;  5D6E A;  1GVD A;  1TWH J;  2FML A;  4I2O A;  3LNQ A;  3I71 A;  3M8E A;  5CVJ A;  5E1Z B;  2UXN A;  4U7B A;  2K3P A;  2MLK A;  2O61 A;  3BQY A;  3HKZ N;  3FXM A;  1J5Y A;  1MJ9 A;  1P7J A;  2ISY A;  5HOO A;  4B43 A;  1X1D A;  3ABU A;  3FBN B;  2V9K A;  2L4A A;  4I09 A;  2GQQ A;  3CUQ C;  4DYQ A;  4UUS A;  3A2K A;  3GF2 A;  4KFC A;  2XRN A;  5C44 J;  2ZC2 A;  4A3J J;  2Y0S N;  2CFO A;  2E34 A;  1XC5 A;  4YG2 F;  3COA C;  4EQQ A;  2M7B A;  1YJ9 I;  3E5Q A;  1FP1 D;  1WJC A;  3I4P A;  2EWN A;  4Y13 A;  3CCV I;  3QPT A;  3C2H A;  1ZGW A;  2ZB9 A;  1QVU A;  1XGS A;  5L3E A;  4LOC A;  2ZME A;  2WAQ A;  3PNV A;  4HRI A;  3O6B B;  1R23 A;  2BY2 A;  2ME6 A;  1K7A A;  3VWB A;  2ZKZ A;  2P6S A;  4PFP A;  4AWX B;  4Q48 A;  2VOO A;  4KMF A;  2A6T A;  2CH0 A;  1Z7U A;  5FKO A;  2DJI A;  3E97 A;  3FX3 A;  3ECO A;  3HIF A;  1AU7 A;  2QA4 I;  4Y17 A;  1BOA A;  5LFA A;  2ETH A;  2HYF A;  2XGC A;  2R7W A;  2IAI A;  1FC3 A;  2XF7 A;  1IXC A;  5HNF A;  4ZDO A;  1RUO A;  3IWF A;  2K9M A;  1RR7 A;  2QSH X;  2NS0 A;  2R7Q A;  2M2E A;  4GGG A;  3DPU A;  1IJW C;  3WOD F;  2H1L A;  3CUQ B;  2KKO A;  1MDM A;  4MQV A;  2BW3 B;  1ZRF A;  4AIH A;  2E7X A;  1TQM A;  5HDK A;  1SD6 A;  2JRM A;  2DO7 A;  2P6T A;  1X1P A;  5IP6 A;  2X0L A;  2ELJ A;  1KGS A;  1IAW A;  3I58 A;  1X1B A;  4J19 A;  4AVP A;  4BJ5 C;  4BUP A;  2NVY J;  3ZMD A;  1U2W A;  2FQ4 A;  4DNC A;  2Y48 A;  1WCM J;  3TW7 A;  2VPR A;  1Z21 A;  4XOR A;  4ZZD A;  5K5Q A;  3RKQ A;  5HNH A;  5F6F A;  2LLK A;  5DCM B;  4RBO A;  4JX4 A;  2R0Q C;  1EH6 A;  2CRG A;  3OYD A;  2FNP A;  1GV5 A;  4A3F J;  2Q2E A;  1HF0 A;  5FRN A;  1K79 A;  1IRG A;  1R1V A;  4A3I J;  3HC7 A;  2ZXW H;  5C3E J;  4D9J A;  3KET A;  4U88 A;  3C3W A;  1R1T A;  2YSR A;  3M4O J;  2PN6 A;  1W36 D;  4DYC A;  2DMP A;  5EDN A;  2YU3 A;  2HTS A;  3H9G A;  1VFC A;  2XF6 A;  4ENM A;  2B0L A;  1HXD A;  1QU3 A;  1B4A A;  3ISP A;  5CVR A;  3GCM A;  4P5O A;  5GAG J;  2HGC A;  1BC8 C;  2VXZ A;  3F8C A;  2MD0 A;  1F43 A;  2H94 A;  2DA3 A;  3OOU A;  4DYR A;  3DU6 A;  2CQK A;  4KT6 A;  2OZU A;  2V6E A;  2HKX A;  2HTJ A;  5E8I A;  4ESB A;  5KAI C;  5M3F J;  4P9F A;  4G8X A;  2HYJ A;  2HXI A;  3S1R J;  1TTY A;  3BR3 A;  4OMZ A;  3HXL A;  4PGG A;  2RAE A;  2F5D A;  1Y1W J;  1D1C A;  1FIP A;  2R7F A;  2W57 A;  2DU9 A;  5FB2 A;  4A5N A;  5JVT A;  3L2V A;  3HL2 A;  4G94 A;  1SAU A;  2OF7 A;  1DUX C;  2GZW A;  3D1N I;  3JSP A;  4RLF A;  4IHV A;  3ASO H;  3U2R A;  1AOY A;  4RGU A;  2IGK A;  4BHP A;  3MZH A;  1KQ0 A;  3I0T A;  1Z3X A;  2OQR A;  4YFN F;  3S3N A;  3WU0 A;  5F64 A;  1O57 A;  4B3A A;  4YIR X;  4M3B A;  1YLF A;  5B1B H;  5FRM A;  2W4S A;  3HUG B;  2JTV A;  4LD5 A;  4XN0 A;  4E7J A;  2DA6 A;  2FBI A;  3T8R A;  4BQO A;  1APL C;  1D5Y A;  4N0B A;  3WG9 A;  1DU0 A;  2EFN A;  2FBK A;  4ZDP A;  2DN0 A;  2J5O A;  3CCJ I;  2PI0 A;  3V42 A;  2LF8 A;  4DGW B;  4CZC A;  3ZQ7 A;  2ZBK A;  4PJN A;  4X1E A;  4AM3 A;  2BXY A;  3S1Q J;  1T39 A;  1XSV A;  1W4M A;  1BOB A;  4IVN A;  5J1U A;  5B1A H;  4GFB A;  5IYB J;  1G59 A;  3JRI A;  2GXA A;  3BTC A;  3EQL F;  4WXH A;  3K4J A;  3GTO J;  1E17 A;  4BYY A;  5L3B A;  3BC8 A;  3GTG J;  3HPH A;  1FTT A;  1I3Q J;  2CGP A;  2G9W A;  4A6D A;  3I56 I;  2GXB A;  2PJR A;  2CQX A;  3PIO F;  2JA2 A;  1GT0 C;  2AXT C;  2HKO A;  2IBD A;  2NYX A;  1I1S A;  3ULQ B;  4O6J A;  5IP7 J;  3V8K A;  4HOB A;  1MZB A;  2Q1Z B;  3FXJ A;  1FOX A;  3TO7 A;  3R0J A;  3Q0V A;  2C6Y A;  4DJA A;  3FMR A;  1ETO A;  1FNN A;  3GXO A;  3HRT A;  2CV2 A;  2Y31 A;  3TBI A;  3U1K A;  3G73 A;  2VKE A;  3HHG A;  3WGH A;  1DP3 A;  2P8T A;  4XLE A;  1IGN A;  2E2J J;  4E70 A;  3OSG A;  3R60 A;  3C2B A;  3H3Z A;  5HDN A;  3K70 C;  3LSR A;  3LOC A;  1IXS B;  3CC7 I;  4MFD A;  5E8G A;  5GAD J;  2YUS A;  4XSX F;  2EA2 A;  5FD5 A;  3U9G A;  1IG7 A;  4CCK A;  4KJZ A;  1Y39 A;  3FDY A;  3ZN0 A;  1ERD A;  2A68 F;  2OUM A;  3I4M J;  3I4N J;  5JFR A;  1WPK A;  5KK1 A;  1N78 A;  1I39 A;  2FXA A;  2KIU A;  1WI9 A;  5JI6 A;  1OKR A;  1WVR A;  1FOW A;  1KU9 A;  5J1Y A;  1R49 A;  1TNS A;  3HYI A;  1HKQ A;  3MQ0 A;  3MZ8 A;  3SDG A;  4MGR A;  4AU7 A;  4RB3 C;  1AKH A;  3W2V A;  5D4R A;  2DTZ A;  2IPQ X;  2QQ9 A;  2LH9 A;  2OA4 A;  3CCQ I;  3HOS A;  4BNC A;  2DOF A;  1QPM A;  4X0G A;  5AIP A;  2UXX A;  3CDL A;  5H20 A;  3U21 A;  2CW8 A;  1K6O A;  1OYY A;  1H9T A;  3AL0 C;  3SHF A;  3JAM K;  3OSF A;  4UNO A;  2UWM A;  1YW9 A;  3NRV A;  3F9K A;  3I59 A;  1YO5 C;  2O7O A;  3HRM A;  3OL4 A;  2GOX B;  3ESW B;  4XLF A;  1U5T C;  2XGD A;  3F8B A;  4UVB A;  2LMD A;  4Q4Z F;  2DQR A;  3HRU A;  5GPC A;  5E3N A;  1I6X A;  4HNU A;  1W1W E;  3EYY A;  2EB7 A;  5D8K B;  1XN7 A;  2QYO A;  4NNJ A;  1YI2 I;  3MD2 A;  3KCC A;  2WB1 A;  1KQ9 A;  1VQP I;  1IUF A;  2QBY B;  1IC8 A;  2M1B A;  4ZZL A;  1S3J A;  3LFU A;  3WG7 H;  3HHH A;  3HRS A;  4L9V A;  2R7R A;  1OCZ H;  3OL3 A;  3WTZ A;  3FMS A;  2WAQ N;  4QIW N;  1QVT A;  4F3Q A;  1MIJ A;  1O4X A;  4B4C A;  1R6R A;  2PQ8 A;  4I0B A;  2LY2 A;  3KP7 A;  3L2C A;  1SFO J;  1ONV A;  1QZE A;  2G7U A;  5LRR A;  1KU7 A;  3NAU A;  3F22 A;  2FUG 2;  2E19 A;  3N05 A;  1G3Y A;  2E35 A;  3KLN A;  3HKZ A;  3S2H J;  1Y8Q B;  3HGG A;  4DBR A;  1JJ8 C;  2XC7 A;  1I1G A;  1BA5 A;  2L9S A;  3K4M A;  1S7O A;  4AID A;  1T8I A;  1KU2 A;  1B9M A;  4AIK A;  2DFF A;  5EZH A;  4Z6Y A;  4BY7 J;  3V8L A;  4V2F A;  5M5Y J;  3G71 I;  4HZF A;  2I10 A;  2KIQ A;  2MC4 A;  4EJO A;  1YOV B;  2P4W A;  1IN6 A;  5KCM A;  1SAN A;  1YRN A;  4QSH A;  1E3H A;  5E1W A;  3MN2 A;  3ERE D;  2ZSH B;  4A69 C;  3VSL A;  5JLX A;  1P4X A;  4F52 A;  2Y30 A;  4D5C A;  4W97 A;  4II2 A;  4CCL A;  1ZLJ A;  3FF5 A;  4JP0 A;  1QZZ A;  4OOI A;  3BG5 A;  1RES A;  2JMW A;  2X85 A;  3KP3 A;  5J4Y A;  1FBS A;  3HOX J;  5EGO B;  5DS9 A;  2E5Z A;  2EZH A;  2EFQ A;  2XV4 S;  2ID3 A;  3WGI A;  1A6Q A;  1WWX A;  5IT3 A;  5EZG A;  2A07 F;  1JGG A;  2DDA A;  3K0L A;  4A3L J;  3AG2 H;  4BHB A;  3SEQ A;  4LLN A;  3CP8 A;  4IJA A;  3A02 A;  2L9N A;  2DW4 A;  2ISZ A;  1T0F C;  2MAB A;  4RA2 A;  2EIN H;  2NVX J;  3UR3 C;  3U1D A;  1VQ7 I;  4EGZ A;  1I3A A;  2YX7 A;  1O3R A;  2ZO4 A;  4RMN A;  4KIF A;  5K7Z A;  1OMI A;  2LK2 A;  4I98 B;  3S2W A;  1TL8 A;  5CYV A;  3DP7 A;  2FMY A;  3MZY A;  2VI6 A;  4XLH A;  1XGN A;  3P7N A;  2Y69 H;  1MH4 A;  4Y4R A;  1VTN C;  1AHD P;  3BQZ A;  2A69 F;  4BEH B;  3Q9S A;  4M9Z A;  3AKZ A;  1IV8 A;  5E1X A;  3MKW B;  3H0G J;  3K4N A;  4XID A;  3TO9 A;  4UUT A;  1O7L A;  3KEY A;  2QLZ A;  1S8N A;  4F93 B;  1YW7 A;  4MQ9 F;  3WTV C;  3H5N A;  2L54 A;  3H92 A;  3CQZ J;  3DKX A;  2EPF A;  1JKQ C;  1TP4 A;  3ZQC A;  3IH4 A;  2LSO A;  2RRE A;  3CTA A;  4I02 A;  1K78 B;  3J80 Z;  3I54 A;  2OTJ I;  3BRO A;  2R7U A;  2OAZ A;  3CES A;  4XOT A;  4BL0 B;  3WHB A;  1TWC J;  3NAR A;  1U8B A;  4HG2 A;  4E7I A;  2D1H A;  4OIO F;  4A0Z A;  4C3H J;  1RKT A;  3GTM J;  2VLA A;  1D0Z A;  1RI7 A;  3B02 A;  1JGS A;  3KP6 A;  2WAE A;  1T2K A;  3V7R A;  1EA3 A;  1X3U A;  2F5E A;  2L02 A;  1WFX A;  3F23 A;  1U9O A;  3L9F A;  3L1P A;  2ADU A;  2GLO A;  1FBQ A;  3QWL A;  4IHY A;  4L0Z B;  3ZGK A;  4M3D A;  4CUG A;  1FOY A;  1GVJ A;  4IXA A;  1Y0N A;  2TDX A;  2VE8 A;  2Y9Z A;  2VT3 A;  2PJP A;  5FKK A;  2JVH A;  3FXL A;  2QEX I;  2JUG A;  2NNN A;  4KN4 X;  2HQN A;  1DGW Y;  2CQN A;  1XDU A;  1T98 A;  4FIS A;  3F8M A;  3K1M A;  2STT A;  3K4B A;  4NQW A;  2VKD A;  3L2W A;  5TGT A;  3GTP J;  4ZYG A;  2XSD C;  2HXO A;  3ERM A;  2IA2 A;  5HVQ C;  3SZT A;  5HLH A;  4MLO A;  3P5J A;  3VYT B;  2IS2 A;  3M8J A;  1WRJ A;  2MSY A;  1J7K A;  2OBP A;  2P5L C;  1P7I A;  1A04 A;  4M73 A;  2DMT A;  2XAF A;  2V4J C;  4AYB A;  1TWA J;  4U0W A;  3GWZ A;  3S14 J;  2MD5 A;  1P4W A;  2XPW A;  3HJE A;  2JVG A;  2LP0 A;  4JYK A;  4XBF A;  4B44 A;  3CCS I;  1IO2 A;  3OIP A;  2E36 A;  4ZYE A;  3L2U A;  2P0W A;  4IRI A;  1ULY A;  5FJ8 J;  2EFO A;  4R79 A;  2WWY A;  3GUD A;  1PJR A;  4IHS A;  1JTY A;  3CCU I;  3J7A Y;  1DQU A;  4EJT A;  3RJP A;  2LRE A;  3IP4 B;  3QPS A;  3OS0 A;  2DDB A;  2ME0 A;  4A3C J;  1F1Z A;  2A6E F;  3K69 A;  4ZTF A;  1LEA A;  3P9K A;  3T8T A;  3S1M J;  2GIV A;  4XOP A;  4L9T A;  2VQC A;  3LSM A;  1RZ4 A;  2EK5 A;  2R3S A;  2W7N A;  3RCO A;  4LIU A;  1XDS A;  3OYM A;  2Z9O A;  3K2Z A;  2F5V A;  4XON A;  3EPZ A;  3ZMZ A;  4FX0 A;  1PUF B;  3HOV J;  5GPA A;  1U6G A;  2UZK A;  5FKM A;  5HS8 A;  2XGE A;  2I8D A;  1T56 A;  3WE2 A;  4QLC U;  4Y52 J;  2RNJ A;  4FE7 A;  4AC0 A;  2K5C A;  4E4H A;  2ZXJ A;  1JKO C;  2P7C B;  2IT0 A;  2XKO A;  4P55 A;  4ENN A;  2QGU A;  3DEU A;  3GEZ A;  4WXD A;  3H9J A;  4KIS A;  1VQ6 I;  4XLP F;  3I53 A;  3KEO A;  4ASN A;  1LUJ B;  1R4M B;  3BJ6 A;  5DDG A;  4DZP A;  2EZK A;  2MLG A;  3WTU C;  3GFJ A;  4A2U A;  2KPM A;  5H2F C;  1TT5 B;  1YS6 A;  2EIJ H;  2OQG A;  4UHT A;  5K5R A;  2BBY A;  4NC8 A;  3CP2 A;  4L5I A;  3VB2 A;  4BS9 A;  4ZJZ A;  2M45 A;  4C30 A;  4JOM A;  4E7Z A;  3HOW J;  1ZHF A;  2NAZ A;  2KHM A;  4RGX A;  1LPQ A;  1C0W A;  2ZFW A;  1Z6R A;  5J6X A;  2ECB A;  3G1M A;  2V26 A;  2R93 J;  4RDU A;  2XAQ A;  1CF7 A;  3ECH A;  2F4I A;  3ABL H;  4YIF A;  1FTZ A;  2FD5 A;  2WY7 Q;  4KDP A;  5LHG A;  4PK4 A;  3JRA A;  1OPC A;  2M8E A;  4UUS B;  2IS1 A;  2O3F A;  2VC1 A;  2HVQ A;  3PO3 J;  5IYD J;  1X3Z B;  1S7E A;  4DBQ A;  1JJ6 C;  2VBW A;  1Z9C A;  1X2N A;  3FBI B;  3LA7 A;  3GTJ J;  4A3M J;  3ZOB A;  1SC7 A;  3PO2 J;  1IV6 A;  2JA5 J;  4HA8 A;  1HA8 A;  1A5J A;  2B7E A;  1OCC H;  1MMG A;  2ZME B;  2WV0 A;  2XRO A;  4CCN A;  1JT0 A;  1P2F A;  5IOZ A;  4QWQ A;  5FRO A;  1O3T A;  1G2H A;  2EBI A;  2DYS H;  3VYS B;  4XRS A;  1LFP A;  2GA1 A;  2AQF A;  2JN6 A;  5K7H A;  3QU3 A;  1TW3 A;  2G7H A;  2GWR A;  3GZ5 A;  3KYC B;  2R7T A;  3ZQI A;  2ZFU A;  1L3L A;  3SFZ A;  4BDZ A;  2EQR A;  3CO6 C;  2O8K A;  2HPM A;  3VOD A;  1H89 C;  5LGT A;  3C2G A;  2E1M B;  1SFX A;  1FP2 A;  4HAM A;  4PJJ A;  3PFI A;  4RAG A;  4FQG A;  4HNV A;  3K9T A;  3R0A A;  4M6Y A;  2JA6 J;  5J4V A;  3QYB A;  3RTR A;  4C2U A;  2CUJ A;  3GFI A;  3CC2 I;  3ZN1 A;  2VQL A;  1WHU A;  1MGT A;  2W24 A;  1REP C;  2O9L A;  3NEU A;  1JKR C;  1S72 I;  2KT0 A;  2CFX A;  1XGM A;  1LFU P;  3H3U A;  2X6W A;  2JK3 A;  3DQV C;  3FIW A;  2X6O A;  5JR3 A;  1V4R A;  4IZZ A;  3T1B A;  1U9N A;  3BR2 A;  1X2M A;  5HLI A;  4B09 A;  4N4N B;  4MEY F;  5HOD A;  3J7Z I;  1W7P D;  1W0T A;  3FXQ A;  4WX9 A;  3DWL E;  5L3D A;  2VXD A;  2HNH A;  5D5X B;  2Q2E B;  1YS7 A;  2EV5 A;  3QPL A;  2HDC A;  2LD5 A;  4BDY A;  1X58 A;  1R9T J;  1P6R A;  1QZY A;  3IL2 A;  2PLY A;  2NS8 A;  2CMP A;  4HPQ A;  2YU9 J;  4UV9 A;  2N8G A;  3BG7 A;  5IYC J;  2R7V A;  3HG9 A;  5AON A;  1IW7 F;  5FLX Z;  2LDU A;  4R1H A;  5B5E C;  3F6V A;  1IUY A;  1DDN A;  2QCO A;  3KLO A;  1ZYR F;  3OYF A;  3IKV A;  3FKI J;  5BS6 A;  3TED A;  1FEX A;  1ETW A;  1Q1V A;  1MMA A;  1TNT A;  5LEK A;  4BAC A;  2DTR A;  2LR8 A;  4HBL A;  4NUB A;  2W48 A;  2XPU A;  4C9Y A;  2ELH A;  2W85 A;  2BOL A;  2BY1 A;  1D8K A;  1MH3 A;  2DQL A;  3A1Y A;  3BTI A;  4M3E A;  4A3K J;  4A6E A;  1HW1 A;  4A3G J;  3AFH A;  4LLL A;  2LY1 A;  3QP5 A;  2O03 A;  4IQ4 A;  2KLO A;  3KYL A;  3KP4 A;  3H0D A;  3W6K B;  1FYL A;  4A3B J;  2R4G A;  2PEX A;  3HSE A;  2DT7 B;  3WTS C;  1BI3 A;  2CU7 A;  4I99 C;  4EM0 B;  2Z33 A;  4UUV A;  3EUK L;  3S3O A;  4RB2 C;  2KZG A;  1HC8 A;  3MWM A;  4RS8 A;  2W25 A;  3K6G A;  3FHN A;  4PCQ A;  1FBU A;  2H8W A;  2CSO A;  3GBG A;  4MIM A;  2AO9 A;  2CG4 A;  2ZNY A;  3DCF A;  4UB8 C;  4Y7N J;  4BHC A;  4G7Z F;  3DF8 A;  1YJW I;  1O3Q A;  3J7A O;  4FCY A;  2K85 A;  1K4T A;  1OYW A;  2K7L A;  1Y6I A;  3ZXS A;  1XCV A;  4A3D J;  1OFC X;  3FZV A;  5C4J J;  3J81 K;  3R6S A;  5ED4 A;  2EJR A;  4DIQ A;  5AIQ A;  3HSF A;  1W36 C;  1HST A;  4HQM A;  2L7Z A;  3JSO A;  4CCM A;  2QSG X;  1M1E B;  5ILS A;  4AYB N;  4CZZ A;  3HPG A;  5K1Y A;  3NWS A;  2B63 J;  1IRZ A;  3RZD J;  3LSP A;  3PUF A;  1VQO I;  4LLG F;  2PMH A;  4MHG A;  5GTI C;  3GTK J;  1PP8 F;  1EKE A;  5HLT A;  1JHF A;  2V1U A;  1XMA A;  1HLV A;  5IT9 Z;  2V1X A;  2FBH A;  1MD0 A;  3M1E A;  3C1D A;  2PJR B;  1R7J A;  2GXG A;  2WC2 A;  5D5V B;  2DA5 A;  3Q0W A;  1RPW A;  2FF4 A;  1UG0 A;  3ZQG A;  4PGH A;  3LSI A;  1HW5 A;  2IS6 A;  1LJ9 A;  4BE0 A;  1LDD A;  1EJ9 A;  3BY6 A;  2A5W A;  2BEO A;  4U0V A;  3JRB A;  2DA7 A;  3K10 A;  1W7P A;  1D1A A;  3K4K A;  1S6L A;  4PUS A;  4B3X A;  2KP6 A;  4HV5 A;  4MFE A;  2R5Z A;  2O0Y A;  4JX5 A;  3OYA A;  4J01 A;  1ZTR A;  3GFM A;  4QPO A;  3LSH A;  4EJV A;  2EIL H;  2WAD A;  4N4O B;  1BN5 A;  2L9R A;  4V2G A;  3A0H C;  2L7K A;  2HQA A;  1BI0 A;  1OQY A;  1WH5 A;  2ID6 A;  3K4C A;  3W2A A;  3E5X A;  4OAZ A;  2FJ1 A;  2XPV A;  3V8J A;  2OTL I;  2CW0 F;  4U7D A;  2E5N A;  3ZQL A;  1NH3 A;  4PFO A;  2HDD A;  3FXR A;  4XLA A;  2JPC A;  1V5G A;  4A0Y A;  5EF6 A;  2ZJR F;  1L0O C;  1LVA A;  3MEX A;  5CVU A;  3RYP A;  1NK3 P;  4RAF A;  4HX8 A;  4S0H B;  3KYD B;  4M3G A;  3PL8 A;  4I7H A;  4RAZ A;  1AA7 A;  5CLS A;  4B1R A;  1XX5 A;  3RKY A;  5F08 A;  1ZG3 A;  1X1C A;  3AG3 H;  1AKH B;  2FX0 A;  2LYC A;  5BMZ A;  1ON1 A;  4XSZ F;  4XN3 A;  3JRH A;  3R61 A;  4ESJ A;  2HVR A;  4GXO A;  1JE8 A;  3PSI A;  1MNM C;  2BY3 A;  1NTC A;  3DV8 A;  4EAT A;  2PFB A;  3WU1 B;  1G4D A;  3KIO A;  5LD2 C;  3TOB A;  3AAF A;  1UCR A;  3MAJ A;  4PJ0 C;  4O5V A;  3H3V K;  2DBB A;  3MFK A;  2DCE A;  5E18 F;  5DEQ A;  1EF4 A;  2BXZ A;  3S2D J;  3VYU B;  3HDD A;  3I59 B;  3LMM A;  2O8X A;  2MH9 A;  2HFH A;  2VT2 A;  3MKL A;  2VON A;  4KA4 A;  1V55 H;  3FMQ A;  2KIS A;  4OWR B;  5BQT A;  4NHJ A;  3E1S A;  4PSW A;  5CQE A;  3WTY C;  3J80 K;  2X1D A;  2DMU A;  4WWC A;  1VQ5 I;  4HW0 A;  1JXS A;  3BTJ A;  3PIP F;  1G3W A;  4DQ2 A;  5B66 C;  4LFU A;  2HR3 A;  1BJA A;  4IPA A;  4M71 A;  3RPQ A;  3PNY A;  4I01 A;  3WU2 C;  3OYG A;  5K7F A;  1ZRE A;  3A0B C;  1EH8 A;  1MDM B;  1WJ5 A;  2KIM A;  2EV0 A;  2RV8 A;  3KP5 A;  4QTR A;  5A2Q K;  4IOA F;  3LQR A;  4HSR A;  1TW2 A;  4PJM A;  2WAF A;  4OIN F;  1FWZ A;  2CQQ A;  2OJE D;  3W6J B;  3N4M A;  4EGY A;  2GA2 A;  1ZAO A;  5CQG A;  4ABZ A;  2JA8 J;  2KRF A;  2XUB A;  2Z5U A;  3IH3 A;  4BAY A;  1HDP A;  2IXS A;  3IUO A;  1FOK A;  1RUN A;  3N97 A;  3S8P A;  2RDP A;  3ASN H;  3CDH A;  2COM A;  3BZC A;  2HYG D;  3PM1 A;  1FIA A;  2NOG A;  4BXX J;  2HEO A;  2F5F A;  1F36 A;  4WCG A;  4GDF A;  3GZN B;  4CGZ A;  5BNG A;  3CJT B;  1WJE A;  2A5Y B;  2M0C A;  2VC0 A;  1YRN B;  4EJU A;  2CQ7 A;  5H6R A;  1D1B A;  1MJA A;  3BCB A;  2FU4 A;  3OR1 C;  2F4M B;  2Y0M A;  2Z2S B;  2ZJ2 A;  2CS3 A;  2FOK A;  2IGN A;  3HB9 A;  2EFW A;  4PDK A;  1QBJ A;  2D45 A;  4N9H A;  4E7S A;  4ZYH A;  1VQL I;  1T33 A;  3TQN A;  4ZH4 F;  4HX7 A;  4LGW A;  4D1Q A;  3R4K A;  4W1U A;  2JRT A;  4BKX A;  2EIM H;  2OC6 A;  2GBY A;  3PSF A;  3B73 A;  2DOD A;  3SZG A;  1RC9 A;  3QAH A;  2V9P A;  2J5P A;  4CH7 A;  1UEL B;  4KIG A;  4AIJ A;  3CF2 A;  3KZZ A;  4L18 B;  1XCB A;  4KN7 X;  5GAH J;  1U5T A;  2L01 A;  3H9Q A;  2MBF A;  1TQP A;  3JRF A;  2FNA A;  1ZG1 A;  4I6Z A;  4LK1 F;  1VF9 A;  2FSW A;  2QQB A;  2L7F P;  1UJ8 A;  4UY8 I;  2E1C A;  3CLO A;  3FXK A;  2BZT A;  4DZJ A;  3BZK A;  3S1N J;  2AS5 F;  2D2W A;  1MBF A;  3ABT A;  2W00 A;  2XAU A;  3DU5 A;  1SD4 A;  3TGN A;  3J7Y J;  3BJO A;  2HZD A;  1MBJ A;  3BR5 A;  4HQE A;  1SVM A;  2HWV A;  1SAX A;  3WHC A;  1Z67 A;  1RET A;  1ZGJ A;  2A61 A;  2M5W A;  5EG0 A;  1R5I D;  1WGX A;  4TV7 A;  3H35 A;  4CYC A;  4WXC A;  5TIS C;  1TZL A;  3M07 A;  3QOE A;  2VJ5 A;  1MSE C;  2ZNZ A;  1LFB A;  1T08 B;  2M87 A;  2FE3 A;  2X4H A;  4P1W A;  2E1N A;  3HTU A;  2RKH A;  1UB9 A;  1K6Y A;  5HDG A;  3HSR A;  4HNT A;  2MW8 A;  5ERI A;  1YIJ I;  1DPU A;  2MA3 A;  2NVT J;  3WTW C;  1BR4 A;  3OYN A;  4XRF A;  3CUO A;  3M9A A;  2DA2 A;  1JT6 A;  2DMQ A;  5TJJ A;  1K61 A;  3ML6 A;  5GTH C;  1H9G A;  4FET A;  1D3Y A;  4ZDL A;  2R5Y A;  3BR6 A;  4XLC A;  5GP9 A;  4GYG A;  1VQ4 I;  2RVC A;  3MMY B;  1D0Y A;  2WV1 A;  1MBH A;  4Y3O A;  2MFZ A;  4G9Y A;  1QO0 D;  2PX9 A;  2VN2 A;  5D5U B;  4C2T A;  4DOZ A;  2KJC A;  3EUH A;  4NB5 A;  4PJL A;  1GHC A;  3GX4 X;  1SFU A;  1B1B A;  1MBE A;  2M7A A;  1Y8R B;  5E3M A;  2LFB A;  1X19 A;  4E7H A;  1R5G A;  3CMM A;  4ETS A;  2YX4 A;  3GFL A;  3CCM I;  4BXU A;  2BV6 A;  3QOD A;  3E6B A;  2LBF A;  3DBH B;  4BGD A;  3DFG A;  3QYF A;  3GLL A;  4L5E A;  3A03 A;  4MTD A;  3OY9 A;  1TLH B;  3WTX C;  1NG6 A;  2DA4 A;  4U87 A;  2M4K A;  1ETK A;  4F91 B;  1T0F A;  2XDV A;  1VI0 A;  4WK8 F;  2HS5 A;  2VAS A;  4CCO A;  4P9U A;  2KMU A;  3A01 A;  1VQ9 I;  1B6A A;  4XKV A;  3IV5 A;  4NQW B;  1ODD A;  4S04 A;  1PDN C;  1D5V A;  4D7N A;  2L4M A;  2RNG A;  2IA0 A;  2JQ7 A;  4HDV A;  2NS7 A;  3SDB A;  4L5J A;  1ITY A;  2L0K A;  3CLQ A;  2V9V A;  1J0R A;  3HM5 A;  1V5E A;  2V7F A;  1G3S A;  3BOQ A;  5DM6 F;  4A93 J;  3E6D A;  3CCE I;  3LWF A;  4LG0 A;  3VSK A;  4WF2 A;  3OYK A;  1OR7 C;  2Z16 A;  2W84 A;  5LEJ A;  2UV1 A;  1OLT A;  2MC3 A;  3OR2 C;  4B8X A;  1FSH A;  3JRG A;  3LA2 A;  1F9N A;  1YE9 A;  2O5R A;  3GVA A;  4XK4 A;  1HQC A;  3KP2 A;  2KL4 A;  3MCZ A;  3NQO A;  4YEL A;  3HGY A;  5CJ9 A;  1HCR A;  2WBM A;  1SVO A;  3B6C A;  5IY5 H;  1V5F A;  1STZ A;  4OU0 A;  2X51 A;  2CV1 A;  5H6Q A;  1TWF J;  5K5O A;  2LRD A;  1RR8 C;  4NC6 A;  3Q5F A;  1QA6 A;  1R58 A;  2RQQ A;  1DP7 P;  4G7O F;  1SEU A;  4IHX A;  1FYM A;  4IKF A;  2FRH A;  1GXQ A;  2V79 A;  2LKP A;  1UAA A;  2E7W A;  1FT9 A;  4O3M A;  4LIT A;  3BR1 A;  2JT1 A;  5D8L B;  5E3O A;  5J40 A;  5ILV A;  1Z7L A;  2E2H J;  3FK6 A;  4ZYD A;  4EM2 A;  1GDT A;  3LAJ A;  1Z3Y A;  1ON2 A;  3QP6 A;  2LKX A;  5FLV A;  4HV6 A;  4CYD A;  3QU6 A;  3RDI A;  5CKT A;  4ON0 A;  3AG4 H;  4BQA A;  1H8A C;  1W5S A;  2EV6 A;  1IZ1 A;  3HOZ J;  3TO6 A;  1WJD A;  1BW6 A;  1X4O A;  4RGS A;  5CVV A;  2QSF X;  4ZYA A;  1LE8 A;  1LVK A;  3G3Z A;  3RYR A;  3BWG A;  1XSX A;  4MO7 A;  4M6X A;  1WZ2 A;  1U0J A;  4FHT A;  2GOM A;  2ZME C;  2M4G A;  2IRF G;  4IRH A;  3DEW A;  1XMX A;  4IHT A;  4XKC A;  3DBL B;  4RB0 A;  1R22 A;  3SEZ A;  4XRS G;  1ACI A;  3BG6 A;  3VEP A;  1ETX A;  2QWW A;  3JW4 A;  3RZO J;  4BJ6 C;  4G12 A;  3HOY J;  4OIR F;  1CQT A;  4M3F A;  1Y56 A;  3PJR A;  1B8I A;  4L9N A;  2KDZ A;  4IRG A;  2H1K A;  1UG2 A;  1CF7 B;  3IRR A;  1RIO H;  5IOY A;  1UFM A;  2LKS A;  3O3K A;  1TBX A;  1LDJ A;  2M8G X;  4XQF A;  3LST A;  2EZI A;  2R7Z J;  1UHW A;  2OPT A;  2MH2 A;  2XHK A;  1SMT A;  2FA5 A;  2E1M C;  2LNB A;  4BE1 A;  1ZGA A;  1ZRC A;  3CMA I;  1T38 A;  2QKM B;  5DM7 F;  2ECC A;  1IXR C;  2IA1 A;  3I9V 2;  2HU9 A;  5JVG F;  1R36 A;  1E3O C;  1ZQ3 P;  3TMO A;  2KRH A;  4B48 A;  2JJ7 A;  4GRI A;  2XVC A;  5D6F A;  2RGV A;  2DOA A;  2HOA A;  3IHU A;  3K4L A;  4G6D A;  3WTT C;  3I55 I;  4Y15 A;  3SJM A;  5DUI A;  4LB5 A;  2VUM J;  4HST A;  1ZLK A;  2EZL A;  1B9N A;  1D0X A;  2JZY A;  1V3F A;  5J8F A;  3G1O A;  3LSJ A;  4I76 A;  2QUF A;  5LLQ A;  1XS9 A;  3VFZ A;  1MBK A;  1IF1 A;  5EJC A;  2F48 A;  3K2A A;  3L7W A;  3GLX A;  3IC7 A;  5E79 C;  3VDX A;  4BY1 J;  5L3F A;  2RC4 A;  4P96 A;  1A35 A;  3BTL A;  3GYH X;  2DT6 A;  4M74 A;  1O7F A;  1E3P A;  4BBR J;  4F55 A;  2DT5 A;  1F5T A;  3ZR8 X;  1XD7 A;  2Z1D A;  1LB2 A;  3TDZ C;  3F8N A;  4BQQ A;  1SVL A;  3O2P E;  1V54 H;  4CSW A;  5M5X J;  4KYW A;  1MNE A;  2VB6 A;  1P4A A;  4L0Y B;  1J09 A;  2PMU A;  3O8H A;  3G6E I;  5IT9 K;  1G8X A;  1J9I A;  3KEQ A;  2OD5 A;  3E0J B;  1KYZ A;  3V4G A;  2RQP A;  1AWC A;  3LA3 A;  5LHI A;  2QKL B;  2CJJ A;  3OYL A;  2OV7 A;  3SFI A;  4X6A J;  5D4S A;  3ZP5 A;  1ORK A;  5ICG A;  2AXL A;  2ESN A;  1ZG5 A;  1FMV A;  4HF1 A;  2LG4 A;  4RM3 A;  2H27 A;  2QM3 A;  3QRF F;  2Z3Y A;  1XSD A;  2P5V A;  3VYR B;  2VKV A;  2F2E A;  2LY9 A;  2OCC H;  1O3S A;  4A3E J;  5M5W J;  2VOD A;  5CPR B;  1MBG A;  2K9Q A;  1E0E A;  2VBX A;  2COB A;  3DKY A;  2NVU B;  3LFK A;  3FWE A;  4M72 A;  2P81 A;  1NHA A;  4CXF A;  2VBZ A;  3CUQ A;  3OWT A;  2BW3 A;  3Q9V A;  1S9H A;  3ZQF A;  4V19 K;  1JKP C;  3OOP A;  5ICE A;  3UNG C;  1XG1 A;  4YFK F;  1GXP A;  5BPD A;  1WI3 A;  3P9C A;  2Z99 A;  2DXI A;  1JHH A;  2A05 A;  4RGR A;  1YFH A;  4YRV A;  2CUZ A;  4R8H A;  2OU2 A;  4BJT A;  1F4K A;  1WSU A;  1BIB A;  2M30 A; 
#chains in the Genus database with same CATH homology
 2LMD A;  1MIJ A;  1XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...