1XPXA

Structural basis of prospero-dna interaction; implications for transcription regulation in developing cells
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
144
Chain Sequence
b'SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*GP*CP*AP*TP*GP*CP*CP*TP*G)-3'
publication title Structural Basis of Prospero-DNA Interaction: Implications for Transcription Regulationin Developing Cells.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation/dna
total genus 54
structure length 144
sequence length 157
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1xpxA00
1MIJA 1XPXA 2LMDA
chains in the Genus database with same CATH superfamily
2VJ5A 1TBXA 1BR1A 2LR8A 4Q5SF 4JX6A 3WTZA 1RESA 1FYKA 1HKSA 5EGOA 1FPQA 1QNTA 3GFMA 5HOOA 1JKRC 3ISPA 4BDYA 1BI0A 1HBXG 2CQNA 4A0YA 2D5VA 2LOOA 2XGCA 2ZXJA 3KYDB 2VASA 3PNVA 5D6FA 2F48A 4E7SA 4BGDA 5F1RA 2Y2ZA 2Y75A 4OU0A 3IH4A 2JUCA 5DCMA 3FK7A 1SFEA 4QTRA 3BTCA 3HKZA 2HTSA 4HQEA 2QUFA 2O8XA 5HDGA 4A3BJ 4G6TB 4D7MA 4IHTA 3CCMI 3BTJA 4TV7A 3RDIA 4A5MA 2JSPA 2DMTA 3J80Z 3ZGKA 1Y56A 5H20A 1KU7A 3H5AA 3HXLA 2JPCA 4IQ4A 1EKEA 1J5YA 2UUZA 3DF8A 3TO7A 3RIRA 4L9NA 2BV6A 2VKHA 5IYCJ 2HNHA 2QQ9A 1JKOC 3SZPA 2NVUB 1XMKA 3FM5A 1BM9A 2M2EA 1W36D 2L02A 1O3RA 2XB0X 2QBYA 2JA7J 1JGSA 3KLNA 1T8IA 3F8BA 1DQUA 2VIXA 2HS5A 4MNUA 2XVCA 3CC2I 1JTYA 4GYGA 3SDBA 2JN6A 1BN5A 1O57A 3DTKA 5HNHA 4Y3OA 2GIVA 4A3JJ 2WB1N 3F0CA 1S9HA 1DDNA 4LITA 1H88C 2KIFA 1VQ6I 2K85A 2L4MA 4RDUA 1SANA 3HTSB 1NG6A 3E5UA 2HYGD 4AYBN 3GMEA 4CDGA 1STZA 2XPVA 3HOWJ 3PIPF 1SD4A 2DBBA 2X1CA 2FUG2 4XK4A 4EM2A 2XROA 1EF4A 4BHCA 1WQ2A 3VB2A 1VQ7I 4CA0A 1UZCA 3FKJA 3GFJA 4GO1A 4AM3A 4IPAA 3HHHA 2E1OA 2XF6A 3K4BA 3QRFF 4Y7NJ 1ETWA 1K61A 4HZFA 2L5QA 3ZQQA 3QWLA 2ZC2A 2W84A 2P81A 4XLFA 3FF5A 2VL8A 5F04A 2R92J 4A5NA 1BC8C 2RNGA 4IQJA 1BIBA 1MH4A 4HRIA 2FQ4A 1K4TA 4KN4X 2DQRA 4L5EA 4HV6A 1TLHB 1S8NA 3D0SA 4IO9F 3WE3A 1I3AA 3EETA 2F5EA 4I99C 1WJ5A 2PG4A 1BJZA 2EB7A 3KLOA 1K6OA 2R7XA 3HOTA 3A0BC 5KCMA 2F5CA 2TDXA 4R8HA 3GTPJ 4N4NB 4BE2A 1KQ8A 2P5KA 2LDUA 3KX2A 4M3DA 2VJ4A 1A6QA 1X1AA 3H3UA 4XR6A 5D8KB 3PJRA 1USSA 2BVLA 2X0LA 1OMIA 2ZNZA 1JUPA 4I0AA 1KA8A 2IRFG 4AU7A 2EZLA 4RLQA 2GWRA 1FX7A 5BPIA 2WADA 1OPCA 1R6RA 2EZHA 2W7NA 3UKGA 1OQYA 4OOIA 2VPRA 1MZBA 2JA6J 1V5GA 1SD7A 2XIGA 3N05A 3IRQA 1XGOA 2V1XA 4N9HA 5D5WB 1W1WE 2CG4A 5EEGA 1KGSA 3S2WA 1YQAA 2J5PA 5CYVA 2B63J 1QU3A 3ZN0A 3O8GA 1ZREA 1H9GA 1DGWY 5DV5A 1U6GA 5EEAA 2O8KA 3S1MJ 1XGNA 1ZELA 1UHSA 3EYYA 5L3GA 2PBIA 1CF7A 3NWSA 5B1AH 3VWBA 1WJCA 2EA4A 2XASA 2K4BA 2VKDA 3ABUA 3IV5A 1EV7A 4A0ZA 3CCJI 1TQIA 5EDNA 2JJ7A 4L5IA 4XMYA 2WAQN 4XONA 1U9NA 1S7OA 1IF1A 2VE9A 2CWEA 1GT0C 1HLVA 2KJCA 2E5NA 3IC7A 1NK3P 2LNBA 1WH5A 5CQGA 2QSFX 4U87A 4F3QA 3TP3A 4A6EA 1J59A 4E7KA 3GYHX 2WBMA 1C0WA 4X6AJ 4XBFA 5CVVA 1YRNA 2VC0A 3W6JB 2CV1A 5BS6A 4BY7J 3KYCB 4C3IJ 1F4KA 4F91B 1YIOA 1OCRH 3B73A 2JTVA 5BPDA 1OCCH 2PEXA 1T33A 1KYZA 3QPSA 2HQAA 3CDIA 3I54A 3GTKJ 1ZGAA 1DPUA 2E19A 2HOEA 3D5RC 1K7AA 3I4NJ 3CZ6A 3KEQA 5E1WA 3NEUA 3E7LA 5D6EA 1NG7A 2X85A 2L7ZA 2W48A 2BOLA 3TW6A 5LHHA 2XAHA 4FX0A 5CQEA 3S1NJ 1D8KA 2YX7A 1Z77A 3SDGA 4NHJA 1W7PB 2ZXHA 3L2QA 5E8GA 4KMFA 2R7VA 3H1CA 5CJ9A 2W00A 4IJAA 4PDKA 4UV9A 3S32A 2R7ZJ 5HDKA 2XC7A 2EILH 4RAGA 2O3FA 1FP2A 1W4MA 2YPRA 3HSRA 3P9KA 5H6QA 5DDGA 5IT3A 1HF0A 2GXGA 3H5NA 4QIWN 2O0YA 4XOPA 3MKYB 3O2PE 1D1AA 4HNTA 1VQ5I 2DFIA 2HXIA 1J7KA 2W25A 3PSFA 3G73A 5EYRA 1VQMI 2HOTA 2GA2A 3GEZA 3HUGA 4FT8A 4II2A 2GOMA 3DXJF 1VI0A 2OQGA 1YW9A 4OMYA 4HX4A 5EZGA 4ZTFA 4NDLA 2EWNA 4M3BA 4RM2A 2K3PA 3BY6A 3OMYA 1OYWA 5IYBJ 1QPMA 1LDDA 1UB9A 2FX0A 2Y69H 3H9QA 5H2FC 3HG9A 1DPRA 5HODA 3JAMK 1I1SA 1LFBA 2DFEA 1F9NA 1H9TA 3REOA 3TO6A 4CHUA 4PFPA 4MIMA 2H1LA 4F93B 3L2VA 4J19A 2H6CA 2OBPA 4U88A 4OIRF 5CPRB 2AXLA 2V79A 1JE8A 2HVRA 2IT0A 4OIQF 2FE3A 2NXNB 1Z7LA 1B1BA 2XB5A 2FU4A 2LF7A 1XG1A 3LNQA 2QEXI 3K0LA 2VPLA 2ETHA 4C3JJ 3S93A 4IXAA 3CC4I 2PJPA 1X58A 3DFGA 5IP7J 1TT0A 1QPIA 1RNLA 3OYKA 5LD2C 2ZMEC 2BW3A 3HRMA 4JYKA 2R5ZA 2IGKA 3S2HJ 2JVGA 2P8TA 5DM7F 2EH3A 3T5XA 2FNPA 2V7FA 1D5VA 1IO2A 2IA1A 2HYJA 5FKLA 2ZMEA 3GZ5A 4B3AA 5E18F 1UAAA 3H35A 4JX4A 2GOXB 4KICA 4A3GJ 5D8LB 3JRFA 3U9GA 4FISA 5LRSA 3MFKA 4RS8A 2V6EA 3L7WA 5KVRA 2VN2A 3CCSI 3DBLB 2IEKA 4DBQA 2ISZA 2R4GA 2DN0A 2L4AA 1IDYA 1TTYA 3R60A 5FLXZ 3VODA 2OD5A 1SAXA 4CSWA 5JLXA 2JRMA 2M0CA 2FXAA 1W0TA 2DFHA 4NC7A 4NC6A 1EH8A 3QPLA 4DQ2A 1MIJA 4RGSA 2CFOA 1VQ4I 3SQNA 1POGA 3NRVA 2BXYA 2MABA 1PUFA 2ELKA 1BR2A 3KZZA 1Y6IA 3OS0A 1WH7A 1X19A 4V2FA 3I53A 2DFFA 4NNJA 1IXRC 4YIIA 3RQ4A 4ASNA 5C44J 2OZUA 3GW2A 2D2WA 1R23A 2DMQA 4BHPA 5HLGA 2ELJA 3GF2A 4XLHA 4X0GA 4XKCA 5ILVA 2QYOA 1YJ9I 1TWGJ 4W1UA 1QHGA 4FHTA 3V8KA 4MFEA 3F8MA 1BL0A 3H3VK 3FMRA 1VQOI 1TWHJ 2E7XA 3H36A 3HEFA 3RQIA 3OIQA 3OYIA 1IN6A 3S1RJ 3PIOF 1Z67A 2DQLA 5E1ZB 3PQJA 3I56I 4N9IA 5F6FA 2B9SA 5HS9A 1B72B 1W5CC 1APLC 1QBJA 2RN7A 5GAGJ 3I58A 2ZJQF 4EQQA 5IOYA 3LSJA 2M3AA 3C1DA 5J1UA 2CQ7A 2FMLA 5A2QZ 1JHHA 3VDXA 2KRHA 3ZMTA 2EFWA 3PNYA 1FC3A 1P2FA 3OIPA 3V8LA 2NRAC 2X6YA 2HTJA 4I76A 1O7LA 3NARA 3ESWB 2K9NA 2COBA 3PSIA 4HLXA 1MBGA 2KJBA 4FASD 3ERMA 2X48A 3IP4B 2KLOA 4ZDPA 3E6MA 1HQCA 5M5YJ 2EFNA 3VSLA 2VI6A 1YITI 4I01A 1TWFJ 2AQFA 1GDTA 4U7BA 2KIMA 3WG7H 1FOXA 3WHCA 2BYVE 2JUGA 4BE0A 3OS1A 2HFHA 4HAMA 5ICGA 4RB3C 2DT7B 1BW6A 3JCUC 3HRSA 3KP2A 4FE7A 2P7CB 2XSDC 3QPHA 3O3KA 3M7GA 3NAUA 2HGCA 5E79C 3FBIB 1ZR4A 2FRHA 2WB1A 5DCMB 3LWFA 3CMAI 1WJFA 3E6BA 4XLPF 4HSRA 4AYBA 3A02A 2HOAA 3HPHA 3OV8A 4MGRA 3F22A 3V8JA 2WC2A 5M5XJ 1K83J 2ZXWH 4ON0A 3OYEA 2LLKA 5J6XA 4YEJA 1IN7A 4B8XA 4C2MJ 1P4WA 3OYLA 2L7FP 5DM6F 2WAFA 3CUOA 5K5OA 3CMMA 3V7RA 1D0ZA 2XF5A 4K2EA 3G4SI 3JTGA 2JMWA 3M4OJ 3F8CA 5JVTA 2XKPA 4IOAF 4RGRA 3KIOA 5HDNA 2NVQJ 1ZTRA 1OLTA 4UXNA 4P96A 4CICA 2QBYB 1LEBA 2F5DA 4ZDLA 1OYYA 3CDHA 1X3UA 3ZQCA 4UUSA 3N97A 3I4MJ 2FJ1A 1UMQA 4E7IA 4B4CA 3FWEA 3ABMH 1BC7C 4PFOA 1T0FC 2LY2A 2LYCA 3OYNA 2MLKA 2TRTA 1BI1A 1XDSA 2DO7A 2PMHA 2VQGA 1PYVA 2DK8A 1G3WA 2ZFUA 3CC7I 3E0JB 1VNDA 1TP4A 3BJOA 4RMNA 2KMUA 4W97A 2QQ8A 2GBYA 1T0FA 5B1BH 1R1UA 3QQAA 1Y0NA 2QWWA 1WWXA 2FMYA 1ENHA 4FX4A 5F1JA 2DJNA 1YHQI 4HF2A 2W1OA 1IRFA 2LD5A 2E1CA 2KIUA 2RGVA 2ZJPF 3A0HC 3OYGA 2GAUA 2R3SA 3DBHB 5DS9A 1B4AA 1FTTA 1HSTA 5KAIC 4L0ZB 1ZG3A 2NS0A 3SZGA 3PL8A 1AHDP 3M07A 2QSHX 1EH7A 4II3A 2NVTJ 1BA5A 4I02A 1FIPA 4GXOA 4JX5A 3OL4A 3WTWC 2D45A 3TGNA 2VKVA 4EJOA 1ETXA 1MBKA 1XS9A 1T39A 3U1KA 5FJ8J 5DEQA 4RB0A 1YX5A 4DW6A 3O6BB 4EJWA 4BL0B 4BQQA 3KCCA 3KP5A 5AIQA 2V9KA 3K4NA 4IX7A 3HDDA 5IT9Z 4ZZDA 2I10A 2L7KA 3KE2A 1RUNA 1Z05A 3G1LA 3S16J 4LFUA 1P7JA 1GVJA 4IRHA 1XCBA 1GV2A 4L9TA 1V54H 3LSMA 2WAQA 3CF2A 1MJAA 2FSWA 2BY0A 2E5ZA 1XSXA 3W3CA 3WU1B 4XLCA 1HOMA 2R7QA 2VBXA 1S72I 4EGYA 4E7JA 4M73A 2A05A 2BEOA 4KYWA 1USTA 1S6LA 2FQ3A 3LOCA 5FFXA 1D0XA 5K5RA 1O3TA 2DMPA 5AIPA 2CUZA 3JRCA 2F4MB 4CCOA 1W36C 1A35A 3WGGA 2ELHA 1G2HA 3FISA 1OFCX 3WTVC 3LAPA 3F72A 1L0OC 4UV8A 4UY8I 4RB1A 3JRBA 4CUGA 3CUQC 4LJZF 2IVMA 3TW7A 1T38A 1ACIA 2E36A 4WK8F 2CW8A 1AWCA 1CF7B 2IGOA 5FO5A 3Q0VA 3FZVA 4LOCA 3W6KB 4B44A 1LFPA 2CFXA 3CUQA 1U9OA 2VBZA 4HG2A 4OIPF 4N4OB 2RC4A 2XPUA 5LFAA 5D5VB 3WGHA 2HOSA 3GTQJ 2A6EF 3I4PA 1LNWA 3KYLA 2QKMB 2O5RA 1G8XA 4EJUA 2W82A 2O7OA 1YFHA 2Z9OA 1P7IA 1T56A 2UV1A 3DPUA 2DXIA 1YRNB 1EH6A 2HQRA 3K2AA 3QOPA 3VYUB 4ENJA 1VQ8I 2MG4A 1IXCA 4UVBA 4DBRA 4M71A 3FDYA 5J1YA 3BTLA 3GXOA 4C30A 3R0AA 1NHAA 1SMTA 1YS6A 2EBIA 4AIHA 1EJ9A 3I3LA 4GGGA 2IS6A 3F6OA 4HEA2 2P4WA 1G3SA 3PNTA 3IUOA 3CLOA 4BQOA 2UWMA 3OY9A 2EIJH 1SFKA 3SFIA 4AVZA 4HOBA 1ZH5A 1YIJI 1HDPA 3VYRB 1A6IA 4OWRB 5C3EJ 2RV8A 1ZG5A 2V1UA 2E71A 1YW7A 3JRDA 4AUXA 2BHYA 2K3FA 4KIBA 4Y13A 1UFMA 4EEFG 3T1BA 3ZQFA 2RNJA 1KQ0A 1ZK8A 2UZKA 1TT5B 2R7DA 1V55H 2MA3A 4UB8C 2VXDA 4E7ZA 3VEPA 2J5OA 2MD0A 5TISC 2P5VA 2R5YB 1J2XA 3GZ6A 2X1DA 3HGGA 1HA8A 2OF7A 1X1BA 2B7EA 3K69A 3FXOA 2HZTA 3MWMA 2PQ8A 5ICCA 1AKHB 4H0EA 4I0BA 1SVMA 4KDPA 4XRSG 1A04A 5C4JJ 2DTRA 4A3KJ 1Y0UA 2E1MC 3HUGB 4G12A 3DP7A 3L9FA 3M8EA 2H09A 4E6KG 2CW7A 2ZB9A 4D7NA 3AL0C 2Z2SB 4HF1A 2VQLA 2LH9A 3FKIJ 3TDUC 2LVSA 3JR9A 4A12A 1RC9A 2MGQA 4CO8A 3K9TA 1KU3A 2NNNA 2HEOA 4Q47A 1ITYA 3F21A 2MYSA 1PP8F 4XORA 3AG1H 4IKFA 4F52A 2HPMA 5GTIC 2HQ5A 4RGXA 2WV1A 1XSDA 5GPCA 3RKQA 3DKXA 3OSGA 3K70C 3BTIA 3E1SA 3Q9SA 1TL8A 1HW5A 1ZRDA 3H0GJ 3K1NA 3ZMUA 5GTHC 3FXRA 2EZKA 3CJTB 3TOAA 2RQPA 2JVHA 3V42A 2QCOA 2TCTA 2CUEA 3OYMA 1IXSB 3DV8A 2VONA 4BACA 4D9JA 1PP7U 1KYWA 4IHXA 1GV5A 1XGMA 4KJZA 1R22A 2ADUA 3BR0A 2BW3B 2EJRA 2R5ZB 4B48A 1K78A 3HOVJ 4NC8A 1YW8A 3GUDA 5FKMA 2L9NA 1R1VA 3HSFA 1B8IA 2IJLA 3SYTA 1LE8A 4Y52J 2Z16A 4XNFA 4EVIA 2CV0A 2ZMEB 2FBIA 2M8EA 4WWCA 2DYSH 3ZQGA 1MJ9A 2XSJC 1IAWA 1R5GA 3PM1A 1ZRFA 2MBFA 1NH3A 1GHCA 2V4JC 3ZPLA 2ZCWA 5LLQA 4CXFA 3DCFA 4HSTA 4UB6C 4Z6YA 2JPBA 2IS4A 1ZYRF 2A69F 3I5UA 5LGTA 4HPQA 4L18B 2MC4A 1GVDA 3ABTA 3DPLC 5BNGA 2P5LC 5K7ZA 3GVAA 2MW8A 2DW4A 4OAYA 3FXKA 4CCJA 2ACJA 4BAYA 1B9NA 3QAHA 4AIKA 3GWZA 1WHUA 3Q0UA 3QP5A 5LGUA 3D5SC 1ON2A 1PUFB 2QGUA 4WXHA 4XRSA 2X51A 3ULQB 5CVRA 3S3OA 4ANJA 1V5FA 4M72A 2P6TA 3WE2A 2KRCA 2Y0MA 3S8PA 2PN6A 3OYBA 1YJWI 3K70D 2QSGX 1E0EA 4M6XA 2AQEA 1MMDA 1JKQC 2DK5A 3S3NA 3FX3A 1IRZA 2V26A 2P7VB 1S7EA 4OIOF 2IGNA 1XPXA 2KDOA 2R7FA 2ID3A 1WI9A 2DA6A 1J09A 2HYFA 5K1YA 1RIOH 3IH3A 1SMYF 4B09A 3TDZC 2FBHA 3L1PA 4HX8A 1I6XA 2F6CA 4WX9A 2PJRA 1SVLA 3HPGA 2ZJ2A 1X2MA 5GAHJ 1IRGA 1UHWA 4S04A 2A07F 2H6BA 2OC6A 1JT6A 3OYJA 4IOCF 4LK0F 4P5OA 5ERIA 1R9TJ 2GIZA 4KUMA 3M1CA 2EFOA 1XCVA 5DUIA 4A3CJ 1O3QA 2IS2A 3LFUA 5F0CA 2QQAA 2OJED 1XX5A 1M1EB 4KIFA 1LKXA 1LB2A 3MZ8A 3BG5A 2V6CA 4IF4A 3WTSC 4C9YA 2WY8Q 2A3SA 2IS1A 3ZR8X 1BI3A 1F1ZA 3JTHA 2R5YA 3OOUA 1SEUA 1D5YA 1REPC 5JR3A 1VF9A 5HNFA 4PGHA 4BJ6C 2F2EA 3CCRI 1NTCA 2PMZN 5IOZA 2X6WA 4IEJA 3U21A 2X4HA 3GX4X 2XAFA 1MNEA 1AKHA 4C2TA 3HJEA 3TBIA 4WXCA 2Z3YA 3U1DA 1HKTA 4FTHA 1BIAA 2WV0A 4BXUA 2VXZA 2ICWG 4ENMA 1MW7A 2K9LA 3HBLA 4QPQA 4MHGA 2CSOA 3K1MA 4NUBA 3KFWX 4LIVA 4ZTJA 5HLHA 1VZ0A 2OUMA 2JA2A 5LEKA 3C18A 3KP7A 3BJ6A 4IZZA 4RAZA 1MD0A 3HOXJ 4A3LJ 1ETOA 2ISYA 4Q4ZF 1IDZA 3BZCA 3G1MA 3FHZA 4XL9A 1N75A 2JA8J 1BJAA 1CGPA 2KP6A 4A3FJ 3ERED 2M7AA 2XGDA 3CCQI 1XB4A 3FM3A 2R7UA 2VC1A 2M30A 3OR1C 2HWVA 3KP6A 4UUSB 2R93J 3G3ZA 2LY1A 1ZARA 1XGSA 1W5SA 3HRTA 1Z6TA 3ML6A 2DOFA 2HR3A 4EJTA 2CUFA 3FXLA 5TGTA 2KT0A 4QSHA 2Y0SN 2C6YA 3FXMA 3OYCA 3LA3A 1SC7A 4UHTA 4LG3A 3BR6A 3JRAA 3AFHA 1T08B 3E5XA 2HU9A 1OYIA 3G2BA 5ICFA 2A68F 3EUKL 1D0YA 4EM1A 1TQPA 1SFOJ 2PMUA 1V4RA 3UR3C 1AU7A 2X1EA 4S0HB 1E17A 2LG4A 1B6AA 2EZIA 3AKZA 2CQQA 2UXXA 1HXDA 1U8BA 4HYEA 5J1RA 4IHWA 2L2OA 3FBNB 2LP0A 4A69C 2RQQA 2HI3A 4LG0A 2WWYA 1F5TA 2GXAA 2ECCA 3T8RA 3GLLA 2DTZA 5J4YA 4RBOA 5JHUA 1MBJA 3AG2H 5FKKA 4EV0A 3RCOA 1P6RA 4I98B 3CMYA 2K02A 2LREA 2CQKA 3HSEA 1R71A 3CD6I 1YOVB 4A0XA 2EFPA 1WCMJ 3RI4A 2VQCA 2LTPA 2V9VA 5FRNA 3FXUA 1Y39A 1U5TC 4AIJA 4ABZA 2M8GX 2IW5A 4OMZA 4IRGA 2DPUA 3BP8A 1MMSA 2CUJA 3Q0WA 4BQNA 1ETVA 2O6GE 2IBDA 4WXDA 3BG3A 3P9CA 1PDNC 3FMQA 1U5TA 3CLQA 5D5XB 3SZTA 1A5JA 2EFQA 5E20A 4IHYA 2BY1A 2QM3A 4C3HJ 3ZXSA 3DKWA 2KHMA 3PO3J 4CYDA 4ENNA 4J00A 1RZ4A 2BXZA 1DU6A 1UG0A 1TW3A 5F08A 3JSOA 2R7TA 2FNAA 2Y30A 3CCEI 5DD8A 4KN7X 4HDVA 2OAZA 4JK1X 1HW1A 5LRRA 2DMUA 2CYYA 2IA2A 1AOYA 5GPAA 2ZSHB 1KONA 4CZCA 1H0MA 1I6HJ 3CUQB 3M3YJ 4E4HA 4ZC3A 4GDFA 2M0MA 2LBFA 1I50J 2EPFA 1Z6RA 2QLZA 1MKMA 4U0VA 3BPVA 5HS8A 1HSJA 1FOWA 4OAZA 5DUKA 3BT9A 4ZJZA 3JAMZ 4JOMA 2KKOA 4LB6B 1J9IA 2Q8KA 4Z2YA 3J81K 4QPOA 1FSHA 4PSXA 3S3MA 5J4VA 3GTOJ 4CCMA 3E3VA 1VQNI 5GP9A 2A61A 2BGCA 5ILUA 3MAJA 2OZ6A 3HIFA 4YFXF 1D3YA 1LPQA 3OWTA 2WY7Q 1XMAA 5FGMA 1R58A 1WFXA 1G59A 1GXPA 2CW0F 3AG4H 5M5WJ 2L9SA 1J75A 2IXSA 2CS3A 1MSFC 4PJ0C 2DPDA 2COMA 3FK6A 3DBRB 3QODA 3KETA 3EPZA 3GTMJ 2IPQX 5F27A 4GCVA 4O5VA 1VQLI 4DJAA 2KISA 3A1YA 3W2AA 5M3MJ 1BBYA 1FMWA 2XHKA 4XN3A 1ORKA 1VTNC 4N0BA 1ZR2A 4CH7A 3JSPA 1F36A 2M4GA 4LB5A 3C3WA 1LDJA 2GA1A 1J0RA 4HNVA 1Y1WJ 1GUUA 1TQMA 1U78A 3K4MA 1DUXC 3GFLA 2LK2A 3BCAA 2FF4A 3RKWA 1X3WB 4XOTA 2NOGA 1Z3YA 3LSHA 5CKTA 4BQAA 5B5EC 4PJLA 1R49A 2CJJA 3TOBA 4OINF 3C7JA 3LQQA 3G1OA 2NNYA 1A31A 1HCRA 1IV8A 1MDMA 5AONA 1LVKA 1KU9A 3GBGA 4HNUA 4WCGA 4YFKF 2AO9A 4CYCA 4D5FA 1MBFA 2CGPA 1D8JA 2CH0A 1G6NA 2DT5A 4EGZA 3LA2A 2B0LA 1U2WA 5J47A 2RREA 4FE4A 4DZPA 5L3CA 1MNDA 1IUYA 2XAQA 1UCRA 4U0WA 3WU2C 3K7AJ 1OCOH 4L9VA 2M34A 1S29A 4DYRA 2X6XA 2VKEA 2MFZA 1TC3C 2DDAA 4AVPA 1WJEA 3HB9A 3WODF 2E1MB 3BWGA 4EJVA 3CESA 3ABKH 3AL0B 3VOEA 5FRMA 3BR1A 4BH9A 3WTXC 2E34A 2DMNA 2E60A 1Q1HA 1WPKA 4BUPA 1W7PD 1XDUA 3RPUD 3J80K 3A01A 2E2HJ 1QZZA 2A6TA 2MC3A 1MSEC 3TMOA 5IYDJ 2DA3A 4PSWA 3J7YJ 3BQZA 1O7FA 3OS2A 4BKXA 1YO5C 3FXQA 2OV7A 4MQVA 4YELA 1SFXA 2KPMA 4YIRX 3F9KA 1YLFA 4G9YA 2K7LA 4G7ZF 3HGYA 3U2RA 4BHBA 3HOZJ 4P1WA 4B3XA 3KPHA 4BDZA 2Z33A 2BHZA 1RUOA 2M4KA 2L54A 1K78B 4BJ5C 3LFKA 4FQGA 2YX4A 1IW7F 3AG3H 4HBLA 3BG6A 1IN4A 1FIAA 2DOAA 5HLIA 1B8IB 1LE8B 2BE5F 3HHGA 3QU6A 5LEJA 1FYLA 3PFYA 3L2UA 1WI3A 3BG9A 4I09A 4YIFA 2V1NA 3V7SA 1VQPI 5B66C 4JQFA 3EYIA 3CP2A 5JFRA 1H89C 1Z0XA 1QQIA 1ZRCA 5H6RA 3QYFA 1I3QJ 2CMPA 2CV2A 3GTGJ 5DCFA 4XQFA 1A36A 2X6OA 5E8IA 3W2VA 4BEHA 3BZKA 4L5JA 3WGIA 2PLYA 1LFUP 2Y31A 1DU0A 4XKBA 3R6SA 1E3OC 3NWTA 3PFIA 3H3ZA 4I7HA 3GTJJ 2GM4A 2GZWA 3WHBA 2LKXA 1B9MA 3ZMSA 3GZNB 1JHFA 5F0FA 1RRJA 3R4KA 2XRNA 2Y9ZA 1U8RA 1IZ1A 1ETYA 1L3LA 2OTJI 2LKSA 2F4IA 2Z1DA 4ETSA 5B3SH 5FLVA 2EK5A 2K40A 3BLYA 5J3LA 1P4AA 2W4SA 5EG0A 1ULYA 2PX9A 5HS7A 3JRIA 2I5UA 2VJIA 1MBEA 1S3JA 2EIMH 2XUBA 4HLYA 2XAGA 4IVNA 3EDPA 1NK2P 4G6DA 4E70A 4JP0A 5D4RA 3VFZA 1EA3A 1K6YA 3CP8A 4O6JA 1X4OA 3PQKA 1IN8A 4LK1F 1YX3A 1T95A 2O03A 3IWFA 4Y4RA 2V1DA 5CVJA 4CCKA 1GLNA 1IGNA 2ESNA 5EEHA 3RSNA 1MMNA 2PMZA 2WA0A 3ZQ7A 4RAFA 1X2NA 2M45A 3HRUA 3VPRA 2DA2A 3E6DA 3CO6C 1LEAA 2PJRB 2NAZA 4ZYAA 2O9LA 2ZBKA 3H92A 4XRMA 4ZDOA 1QA6A 5J40A 3M8FA 3S1QJ 1Y8RB 4YG2F 4D1QA 2E35A 1FBQA 3COAC 1JT0A 5FLMJ 1X1CA 1Y8QB 1Z9CA 4HX7A 1FYMA 4IHVA 2QF7A 4BU2A 3RPQA 4UVAA 3MD2A 1ERDA 1FP1D 2VODA 3S14J 2NVXJ 3F8NA 4QLCU 3B6CA 2ZJRF 4RM3A 2XF7A 3ZP5A 1R4NB 3ZCOA 2ZKZA 1KQ9A 1SVOA 4HDUA 2WTEA 1I39A 3Q3SA 3FIWA 1FEXA 4LIUA 1ON1A 4P9FA 1OCTC 2JA5J 2HDDA 1W0UA 4BNCA 3P5JA 2DA1A 4M9SA 2F5FA 2ME0A 2UXNA 3H0DA 1FY7A 2ESHA 2EINH 1UHMA 3QPTA 3L2RA 3F3XA 1W5TA 1G4DA 1MNMC 2Y0SA 1YS7A 3LSKA 1X4PA 3BPXA 4HQMA 1HDDC 1P9QC 5F64A 1OKRA 1BR4A 4AIDA 3JW4A 3I71A 3IAM2 2LC2A 4HW0A 2D1VA 1E3PA 2P6SA 1XMXA 3WTYC 3MKWB 5E3LA 3RKXA 4RAYA 4I6ZA 3OR2C 5FFZA 2QVOA 2H1KA 5J8CA 3B6AA 4A3MJ 3I0TA 4M3GA 1LDKB 3PUFA 2JZYA 2QQBA 3R0JA 3CCLI 2DLLA 5JHFA 5D4SA 3ECHA 2DI3A 3V7CA 1QHHD 1TZLA 3WTTC 3C2HA 2VBWA 3ONQA 2IAIA 2NS8A 2NOJB 1YYVA 4GFBA 4MFDA 1TNSA 2ZXIA 3D5LA 2XDVA 2HVQA 5DTDA 4DOZA 3BCBA 4XKVA 2M1BA 3K4JA 4DYCA 2A6HF 3LSPA 4M3FA 5LGNA 2VB6A 1V3FA 2DJIA 1RR8C 3B02A 3KP4A 3BG7A 3MMYB 5FKOA 2Q2EA 1JTXA 2NVYJ 3OYAA 3HOSA 3CCVI 5LHGA 2JK3A 3E6CC 1FWZA 1RPWA 4PUSA 5DD4A 4UUTA 2K9SA 2VOOA 3I59A 3ROUA 3RYRA 1JXSA 3O8HA 4KT5C 3IL2A 5E3OA 1KU2A 1IG7A 4ZH4F 3IHUA 2MLGA 3SEZA 1SFUA 4XKWA 4G7HF 4LG0B 1XSVA 1U3EM 2XGXA 4EM0B 1KZHA 4EMSA 4YFNF 1O4XA 2STTA 1OCZH 4B1RA 1OR7C 2VT2A 2IA0A 3BROA 2XGEA 4IRIA 3F8FA 1N25A 3HZJA 1JUMA 1OISA 1K79A 2ZO4A 5ICEA 4ESBA 2E2IJ 2ECBA 2K4JA 3L09A 4U0YA 1IV6A 4NB5A 3IRRA 1TWCJ 1OR7A 3DPTA 4DNCA 4LLLA 1IC8A 1JUSA 2E1NA 3CMEI 2YS9A 3DTEA 1P92A 1E3HA 1T6SA 2RDPA 1JJ6C 2M87A 4PCQA 1QVUA 1ODDA 4CZZA 1UELB 3CJNA 3LMMA 4CCNA 1ZG1A 1T98A 3CDLA 2FA5A 4CCLA 2R0QC 2CU7A 3QYEA 5JLWA 4V19K 4MTDA 1U5TB 1WRJA 1FZPB 5E3NA 3MVPA 2VQHA 3DTIA 3F23A 4GRIA 3CO7C 3MN2A 2VLAA 4LMYA 1YE9A 3M1EA 1YTYA 2KDZA 2GQQA 3K4KA 4PGGA 3N4MA 2O61A 3A4CA 1Q1VA 1UG2A 2LRDA 2CO5A 4NQWA 4XLAA 5BMZA 2XKOA 3T8TA 3TKYA 3LAJA 3K2ZA 3RZDJ 2E2JJ 2VT3A 1H8AC 3QOEA 4BBRJ 1TW2A 4RGUA 5L3DA 3H9GA 3GCMA 2CQXA 5K7FA 4HA8A 2OU2A 4ZYHA 3LQRA 4E7LA 2VOPA 4E7HA 3FMSA 2DA4A 1Z1DA 5FD6A 5FLXK 1R5ID 2FBKA 2IGMA 1P4XA 3CJRB 4PJMA 4XSZF 2LBFB 1WJAA 4M6YA 2G7HA 4XLNF 2LSOA 2FEZA 4R79A 1Y1VJ 1GXQA 2LMDA 3J7AO 4G6QA 1R7JA 2DOEA 1MJBA 5E3MA 3RZOJ 2KZVA 2Y48A 2BBYA 5D5UB 1WKMA 4IL6C 2QA4I 2MH9A 5ED4A 4HF0A 3SHFA 3ZMDA 1TNTA 2K5CA 3DLLF 1VQ9I 3E5QA 1G3YA 2OTLI 3EUAA 5E1XA 3L00A 2VE8A 1Z7UA 4JBAA 3HL2A 2XRLA 3K10A 2K27A 5IP9J 5C4XJ 2H94A 3TP0A 2XAUA 2VJJA 1YI2I 4KMUX 2L01A 5CVUA 1RETA 4MQ9F 4I2OA 4C2UA 3DKYA 3ECOA 5CVIA 4Y15A 4D0PA 1WZ2A 1X3ZB 2W57A 5KAFC 1QRYA 3IKVA 4ZYEA 1BI2A 2LFBA 1LJ9A 1SD6A 3BZ6A 3HKZN 2KIQA 3JREA 1JJ8C 3X2QH 2FD5A 1HC8A 5LBQA 2FOKA 2QZ8A 4WF2A 5A2QK 3H9JA 4BYYA 5JI6A 3J7AY 1RKTA 4XIDA 2N8GA 2GXBA 2G0EA 3ASNH 5L3FA 1MDMB 3BC8A 1UJ8A 2DA7A 2ID6A 3MEXA 4M6VA 2I8DA 4CYCB 4UVCA 1JI8A 3GLXA 1Z91A 4BS9A 5FD5A 3K1PA 4A6DA 3OYHA 2KFDA 3Q5FA 1D1BA 4AD9A 4BBSJ 5K5QA 1IRXA 2VBYA 2AXTC 3MKLA 2E7WA 3ELKA 3DEEA 5LHIA 2WAEA 3QYBA 1WGXA 4V2GA 4MTEA 1ZGWA 4XM3A 1ONVA 2DU9A 3DQVC 3ZOBA 2LF8A 2DYRH 3QU3A 3CJQB 2YU3A 2IP2A 2JSCA 4M9ZA 4B43A 1F43A 2XAJA 3DU5A 4DGWB 4F92B 2Z99A 3M8JA 4A93J 4KNYA 2A5WA 1PJRA 3GO5A 1BOBA 1FTZA 2HDWA 1FT9A 1JGGA 1N77A 1WSUA 1SD5A 5EF6A 3A01B 4L9JA 3WG9A 5TRDA 2DDBA 2OA4A 4EATA 1U0JA 3BDDA 1ZLKA 3GTLJ 2XPWA 2HZDA 2K9QA 2VUMJ 4A3EJ 2LY9A 1OCPA 1FBSA 5BQTA 1LUJB 1PUEE 2K9MA 5F0HA 1RKWA 1WJDA 3HTUA 2EV6A 1ETQA 3AAFA 4BE1A 1FJLA 3CQZJ 2NS7A 2BZTA 1FSEA 2OPTA 4GYIA 3FHNA 4XLEA 4D5CA 3GFIA 3F6VA 1R00A 3L2CA 1XTAA 4QWQA 3IKTA 3PO2J 1FMVA 1QZYA 3JRHA 3LSTA 1ZGJA 2BVMA 2DT6A 5FB2A 5IP6A 1LVAA 5GADJ 2R7SA 1TWAJ 2HKXA 4PJJA 5ILSA 3CF5F 1BW5A 4LD5A 3G71I 2V9PA 2X9DA 2R7OA 1HW2A 4BEHB 1WJBA 4Q48A 2H27A 1X1PA 3KEOA 3BJAA 2LKPA 5KNLA 2L7MP 5TJJA 2DA5A 5CLSA 3LSIA 1IJWC 2OCEA 1E2XA 1RI7A 3R61A 4XRFA 3MZYA 4L0YB 1N78A 2AHQA 4BJTA 2YUSA 2EV5A 3WTUC 1MH3A 3BR2A 3MQ0A 4A3DJ 1X1DA 5EG0B 4ZZLA 3OOPA 4KT6A 4ESFA 3C2BA 1PVEA 4HV5A 5L3BA 2AS5F 2HKOA 3OSFA 1ZAOA 3ASOH 4XSXF 2YU9J 3E97A 1I1GA 4LGWA 4LLNA 2EV0A 5IT9K 3K4LA 4BXXJ 2ZNYA 3G6EI 3OYDA 1IUFA 3FXJA 4MEYF 5KK1A 1MMAA 3LA7A 3RJPA 3CCUI 2JQ7A 5EJCA 2F4OB 3TQNA 2A5YB 2DODA 3VSKA 3ZN1A 1AA7A 3MCZA 3P9IA 2L0KA 3ZQIA 1ETKA 2H8RA 5KHDA 3KZIC 1MMGA 1W7PA 3RPUA 1B59A 3S17J 3K6GA 1XC5A 2YR2A 3OYFA 5EGOB 4J01A 2W85A 3TO9A 9ANTA 1S5LC 1ZHFA 3RKYA 3EQLF 4Y33A 4G94A 4BY1J 4RLFA 4KA4A 4MEXF 2W24A 3DWLE 4PJNA 3I9V2 1R36A 2R7WA 4ESJA 1S7AA 1FOYA 1HKQA 3BR3A 3I55I 2ZSIB 1WVRA 3OIOA 3WU0A 4P55A 4XICA 6PAXA 2EIKH 4AWXB 3DEWA 3BR5A 1YJNI 4NBQA 1G3TA 3V4GA 1QVTA 4CGZA 1I27A 3DU6A 4LLGF 4H4KC 1BOAA 3SXYA 1SAUA 3P7NA 4M3EA 1D1CA 4FCYA 2FOWA 1QGPA 4DYQA 1O3SA 2RAEA 2G7UA 2HDCA 4RB2C 2KQRA 2L9VA 1ZQ3P 4R1HA 2EA2A 4A2UA 3Q9VA 2XV4S 5FKNA 1JKPC 2K86A 1ZLJA 2KRFA 1XD7A 2QKLB 4U7DA 5BOXA 1OJLA 3L2WA 5HVQC 5HLTA 2BY2A 4XN0A 4KIGA 3KZYA 2Z5UA 3C2GA 2PI0A 1FLIA 1FNNA 2M9HA 3ZQLA 2STWA 5E17F 2BY3A 2OQRA 1MGTA 4RA2A 5M3FJ 2MSYA 5DYMA 4UUVA 3QP6A 3KP3A 3SJMA 5EZHA 3MZHA 3EUHC 3A2KA 3RTRA 3ABLH 3CCYA 3RYPA 2NYXA 2HVSA 1T2KA 3OL3A 1VFCA 2Y9YA 3I64A 3DEUA 3EUHA 2G9WA 3LSGA 4P9UA 3VYSB 1FOKA 3HYIA 4F55A 1FBUA 2KZGA 1RR7A 3IH2A 3PUBA 1DP7P 4G7OF 2P0WA 1VQKI 3D1NI 3UNGC 5J8FA 1I5ZA 4O3MA 1YG2A 3H5RA 4MLOA 2Q2EB 4AC0A 2GLOA 1ZN2A 4ZYGA 3S2DJ 1Z3XA 3I59B 4DIQA 2F5VA 4F7ZA 3W2WA 4S05A 3ZMZA 3ZQHA 1QZEA 4KITB 3J81Z 4M74A 1XN7A 2JWTA 4UNOA 4A3IJ 2PFBA 3NQOA 3HOUJ 4DZJA 4PK4A 2KL4A 3SFZA 5FROA 3HC7A 3LL7A 2HPIA 1Z21A 4FETA 4Y17A 2ME6A 4B47A 4KISA 3T0YA 3IWZA 2QENA 2JRTA 3CTAA 3K4CA 1V5EA 3A03A 4BXFA 2DCEA 1ZKGA 3W6VA 3HOYJ 5K7HA 4KFCA 2L9RA 1DGRM 3HM5A 4ZYDA 1K4SA 2MH2A 5IY5H 2CRGA 2Q0OA 3LSRA 2M5WA 1LQ1A 1DP3A 2YSRA 3MKZA 5GAEJ 4MO7A 3VYTB 3IAS2 2L3DA 4PZJA 4YRVA 4X1EA 1B72A 2ZFWA 2H8WA 3J7ZI 4ENKA 1QO0D 2RKHA 1MBHA 3BOQA 2EQRA 3TEDA 2R7RA 3SEQA 3TL4X 1R1TA 2HQNA 5JVGF 3DLAA 3M9AA 5IPAA 2HXOA 1CQTA 1R5HA 3JRGA 4IHSA 4NQWB 2MD5A 2M7BA 1IN5A 2RVCA 4ITVA 3BQYA 4G8XA 2D1HA 2DAOA 2OCCH 2JT1A 3S15J 3ZMVA 1R4MB 2Q1ZB 5L3EA 3ZRGA 4M9XA 3KEYA
chains in the Genus database with same CATH topology
1MIJA 1XPXA 2LMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIJ A;  1XPX A;  2LMD A; 
#chains in the Genus database with same CATH topology
 2VJ5 A;  1TBX A;  1BR1 A;  2LR8 A;  4Q5S F;  4JX6 A;  3WTZ A;  1RES A;  1FYK A;  1HKS A;  5EGO A;  1FPQ A;  1QNT A;  3GFM A;  5HOO A;  1JKR C;  3ISP A;  4BDY A;  1BI0 A;  1HBX G;  2CQN A;  4A0Y A;  2D5V A;  2LOO A;  2XGC A;  2ZXJ A;  3KYD B;  2VAS A;  3PNV A;  5D6F A;  2F48 A;  4E7S A;  4BGD A;  5F1R A;  2Y2Z A;  2Y75 A;  4OU0 A;  3IH4 A;  2JUC A;  5DCM A;  3FK7 A;  1SFE A;  4QTR A;  3BTC A;  3HKZ A;  2HTS A;  4HQE A;  2QUF A;  2O8X A;  5HDG A;  4A3B J;  4G6T B;  4D7M A;  4IHT A;  3CCM I;  3BTJ A;  4TV7 A;  3RDI A;  4A5M A;  2JSP A;  2DMT A;  3J80 Z;  3ZGK A;  1Y56 A;  5H20 A;  1KU7 A;  3H5A A;  3HXL A;  2JPC A;  4IQ4 A;  1EKE A;  1J5Y A;  2UUZ A;  3DF8 A;  3TO7 A;  3RIR A;  4L9N A;  2BV6 A;  2VKH A;  5IYC J;  2HNH A;  2QQ9 A;  1JKO C;  3SZP A;  2NVU B;  1XMK A;  3FM5 A;  1BM9 A;  2M2E A;  1W36 D;  2L02 A;  1O3R A;  2XB0 X;  2QBY A;  2JA7 J;  1JGS A;  3KLN A;  1T8I A;  3F8B A;  1DQU A;  2VIX A;  2HS5 A;  4MNU A;  2XVC A;  3CC2 I;  1JTY A;  4GYG A;  3SDB A;  2JN6 A;  1BN5 A;  1O57 A;  3DTK A;  5HNH A;  4Y3O A;  2GIV A;  4A3J J;  2WB1 N;  3F0C A;  1S9H A;  1DDN A;  4LIT A;  1H88 C;  2KIF A;  1VQ6 I;  2K85 A;  2L4M A;  4RDU A;  1SAN A;  3HTS B;  1NG6 A;  3E5U A;  2HYG D;  4AYB N;  3GME A;  4CDG A;  1STZ A;  2XPV A;  3HOW J;  3PIP F;  1SD4 A;  2DBB A;  2X1C A;  2FUG 2;  4XK4 A;  4EM2 A;  2XRO A;  1EF4 A;  4BHC A;  1WQ2 A;  3VB2 A;  1VQ7 I;  4CA0 A;  1UZC A;  3FKJ A;  3GFJ A;  4GO1 A;  4AM3 A;  4IPA A;  3HHH A;  2E1O A;  2XF6 A;  3K4B A;  3QRF F;  4Y7N J;  1ETW A;  1K61 A;  4HZF A;  2L5Q A;  3ZQQ A;  3QWL A;  2ZC2 A;  2W84 A;  2P81 A;  4XLF A;  3FF5 A;  2VL8 A;  5F04 A;  2R92 J;  4A5N A;  1BC8 C;  2RNG A;  4IQJ A;  1BIB A;  1MH4 A;  4HRI A;  2FQ4 A;  1K4T A;  4KN4 X;  2DQR A;  4L5E A;  4HV6 A;  1TLH B;  1S8N A;  3D0S A;  4IO9 F;  3WE3 A;  1I3A A;  3EET A;  2F5E A;  4I99 C;  1WJ5 A;  2PG4 A;  1BJZ A;  2EB7 A;  3KLO A;  1K6O A;  2R7X A;  3HOT A;  3A0B C;  5KCM A;  2F5C A;  2TDX A;  4R8H A;  3GTP J;  4N4N B;  4BE2 A;  1KQ8 A;  2P5K A;  2LDU A;  3KX2 A;  4M3D A;  2VJ4 A;  1A6Q A;  1X1A A;  3H3U A;  4XR6 A;  5D8K B;  3PJR A;  1USS A;  2BVL A;  2X0L A;  1OMI A;  2ZNZ A;  1JUP A;  4I0A A;  1KA8 A;  2IRF G;  4AU7 A;  2EZL A;  4RLQ A;  2GWR A;  1FX7 A;  5BPI A;  2WAD A;  1OPC A;  1R6R A;  2EZH A;  2W7N A;  3UKG A;  1OQY A;  4OOI A;  2VPR A;  1MZB A;  2JA6 J;  1V5G A;  1SD7 A;  2XIG A;  3N05 A;  3IRQ A;  1XGO A;  2V1X A;  4N9H A;  5D5W B;  1W1W E;  2CG4 A;  5EEG A;  1KGS A;  3S2W A;  1YQA A;  2J5P A;  5CYV A;  2B63 J;  1QU3 A;  3ZN0 A;  3O8G A;  1ZRE A;  1H9G A;  1DGW Y;  5DV5 A;  1U6G A;  5EEA A;  2O8K A;  3S1M J;  1XGN A;  1ZEL A;  1UHS A;  3EYY A;  5L3G A;  2PBI A;  1CF7 A;  3NWS A;  5B1A H;  3VWB A;  1WJC A;  2EA4 A;  2XAS A;  2K4B A;  2VKD A;  3ABU A;  3IV5 A;  1EV7 A;  4A0Z A;  3CCJ I;  1TQI A;  5EDN A;  2JJ7 A;  4L5I A;  4XMY A;  2WAQ N;  4XON A;  1U9N A;  1S7O A;  1IF1 A;  2VE9 A;  2CWE A;  1GT0 C;  1HLV A;  2KJC A;  2E5N A;  3IC7 A;  1NK3 P;  2LNB A;  1WH5 A;  5CQG A;  2QSF X;  4U87 A;  4F3Q A;  3TP3 A;  4A6E A;  1J59 A;  4E7K A;  3GYH X;  2WBM A;  1C0W A;  4X6A J;  4XBF A;  5CVV A;  1YRN A;  2VC0 A;  3W6J B;  2CV1 A;  5BS6 A;  4BY7 J;  3KYC B;  4C3I J;  1F4K A;  4F91 B;  1YIO A;  1OCR H;  3B73 A;  2JTV A;  5BPD A;  1OCC H;  2PEX A;  1T33 A;  1KYZ A;  3QPS A;  2HQA A;  3CDI A;  3I54 A;  3GTK J;  1ZGA A;  1DPU A;  2E19 A;  2HOE A;  3D5R C;  1K7A A;  3I4N J;  3CZ6 A;  3KEQ A;  5E1W A;  3NEU A;  3E7L A;  5D6E A;  1NG7 A;  2X85 A;  2L7Z A;  2W48 A;  2BOL A;  3TW6 A;  5LHH A;  2XAH A;  4FX0 A;  5CQE A;  3S1N J;  1D8K A;  2YX7 A;  1Z77 A;  3SDG A;  4NHJ A;  1W7P B;  2ZXH A;  3L2Q A;  5E8G A;  4KMF A;  2R7V A;  3H1C A;  5CJ9 A;  2W00 A;  4IJA A;  4PDK A;  4UV9 A;  3S32 A;  2R7Z J;  5HDK A;  2XC7 A;  2EIL H;  4RAG A;  2O3F A;  1FP2 A;  1W4M A;  2YPR A;  3HSR A;  3P9K A;  5H6Q A;  5DDG A;  5IT3 A;  1HF0 A;  2GXG A;  3H5N A;  4QIW N;  2O0Y A;  4XOP A;  3MKY B;  3O2P E;  1D1A A;  4HNT A;  1VQ5 I;  2DFI A;  2HXI A;  1J7K A;  2W25 A;  3PSF A;  3G73 A;  5EYR A;  1VQM I;  2HOT A;  2GA2 A;  3GEZ A;  3HUG A;  4FT8 A;  4II2 A;  2GOM A;  3DXJ F;  1VI0 A;  2OQG A;  1YW9 A;  4OMY A;  4HX4 A;  5EZG A;  4ZTF A;  4NDL A;  2EWN A;  4M3B A;  4RM2 A;  2K3P A;  3BY6 A;  3OMY A;  1OYW A;  5IYB J;  1QPM A;  1LDD A;  1UB9 A;  2FX0 A;  2Y69 H;  3H9Q A;  5H2F C;  3HG9 A;  1DPR A;  5HOD A;  3JAM K;  1I1S A;  1LFB A;  2DFE A;  1F9N A;  1H9T A;  3REO A;  3TO6 A;  4CHU A;  4PFP A;  4MIM A;  2H1L A;  4F93 B;  3L2V A;  4J19 A;  2H6C A;  2OBP A;  4U88 A;  4OIR F;  5CPR B;  2AXL A;  2V79 A;  1JE8 A;  2HVR A;  2IT0 A;  4OIQ F;  2FE3 A;  2NXN B;  1Z7L A;  1B1B A;  2XB5 A;  2FU4 A;  2LF7 A;  1XG1 A;  3LNQ A;  2QEX I;  3K0L A;  2VPL A;  2ETH A;  4C3J J;  3S93 A;  4IXA A;  3CC4 I;  2PJP A;  1X58 A;  3DFG A;  5IP7 J;  1TT0 A;  1QPI A;  1RNL A;  3OYK A;  5LD2 C;  2ZME C;  2BW3 A;  3HRM A;  4JYK A;  2R5Z A;  2IGK A;  3S2H J;  2JVG A;  2P8T A;  5DM7 F;  2EH3 A;  3T5X A;  2FNP A;  2V7F A;  1D5V A;  1IO2 A;  2IA1 A;  2HYJ A;  5FKL A;  2ZME A;  3GZ5 A;  4B3A A;  5E18 F;  1UAA A;  3H35 A;  4JX4 A;  2GOX B;  4KIC A;  4A3G J;  5D8L B;  3JRF A;  3U9G A;  4FIS A;  5LRS A;  3MFK A;  4RS8 A;  2V6E A;  3L7W A;  5KVR A;  2VN2 A;  3CCS I;  3DBL B;  2IEK A;  4DBQ A;  2ISZ A;  2R4G A;  2DN0 A;  2L4A A;  1IDY A;  1TTY A;  3R60 A;  5FLX Z;  3VOD A;  2OD5 A;  1SAX A;  4CSW A;  5JLX A;  2JRM A;  2M0C A;  2FXA A;  1W0T A;  2DFH A;  4NC7 A;  4NC6 A;  1EH8 A;  3QPL A;  4DQ2 A;  1MIJ A;  4RGS A;  2CFO A;  1VQ4 I;  3SQN A;  1POG A;  3NRV A;  2BXY A;  2MAB A;  1PUF A;  2ELK A;  1BR2 A;  3KZZ A;  1Y6I A;  3OS0 A;  1WH7 A;  1X19 A;  4V2F A;  3I53 A;  2DFF A;  4NNJ A;  1IXR C;  4YII A;  3RQ4 A;  4ASN A;  5C44 J;  2OZU A;  3GW2 A;  2D2W A;  1R23 A;  2DMQ A;  4BHP A;  5HLG A;  2ELJ A;  3GF2 A;  4XLH A;  4X0G A;  4XKC A;  5ILV A;  2QYO A;  1YJ9 I;  1TWG J;  4W1U A;  1QHG A;  4FHT A;  3V8K A;  4MFE A;  3F8M A;  1BL0 A;  3H3V K;  3FMR A;  1VQO I;  1TWH J;  2E7X A;  3H36 A;  3HEF A;  3RQI A;  3OIQ A;  3OYI A;  1IN6 A;  3S1R J;  3PIO F;  1Z67 A;  2DQL A;  5E1Z B;  3PQJ A;  3I56 I;  4N9I A;  5F6F A;  2B9S A;  5HS9 A;  1B72 B;  1W5C C;  1APL C;  1QBJ A;  2RN7 A;  5GAG J;  3I58 A;  2ZJQ F;  4EQQ A;  5IOY A;  3LSJ A;  2M3A A;  3C1D A;  5J1U A;  2CQ7 A;  2FML A;  5A2Q Z;  1JHH A;  3VDX A;  2KRH A;  3ZMT A;  2EFW A;  3PNY A;  1FC3 A;  1P2F A;  3OIP A;  3V8L A;  2NRA C;  2X6Y A;  2HTJ A;  4I76 A;  1O7L A;  3NAR A;  3ESW B;  2K9N A;  2COB A;  3PSI A;  4HLX A;  1MBG A;  2KJB A;  4FAS D;  3ERM A;  2X48 A;  3IP4 B;  2KLO A;  4ZDP A;  3E6M A;  1HQC A;  5M5Y J;  2EFN A;  3VSL A;  2VI6 A;  1YIT I;  4I01 A;  1TWF J;  2AQF A;  1GDT A;  4U7B A;  2KIM A;  3WG7 H;  1FOX A;  3WHC A;  2BYV E;  2JUG A;  4BE0 A;  3OS1 A;  2HFH A;  4HAM A;  5ICG A;  4RB3 C;  2DT7 B;  1BW6 A;  3JCU C;  3HRS A;  3KP2 A;  4FE7 A;  2P7C B;  2XSD C;  3QPH A;  3O3K A;  3M7G A;  3NAU A;  2HGC A;  5E79 C;  3FBI B;  1ZR4 A;  2FRH A;  2WB1 A;  5DCM B;  3LWF A;  3CMA I;  1WJF A;  3E6B A;  4XLP F;  4HSR A;  4AYB A;  3A02 A;  2HOA A;  3HPH A;  3OV8 A;  4MGR A;  3F22 A;  3V8J A;  2WC2 A;  5M5X J;  1K83 J;  2ZXW H;  4ON0 A;  3OYE A;  2LLK A;  5J6X A;  4YEJ A;  1IN7 A;  4B8X A;  4C2M J;  1P4W A;  3OYL A;  2L7F P;  5DM6 F;  2WAF A;  3CUO A;  5K5O A;  3CMM A;  3V7R A;  1D0Z A;  2XF5 A;  4K2E A;  3G4S I;  3JTG A;  2JMW A;  3M4O J;  3F8C A;  5JVT A;  2XKP A;  4IOA F;  4RGR A;  3KIO A;  5HDN A;  2NVQ J;  1ZTR A;  1OLT A;  4UXN A;  4P96 A;  4CIC A;  2QBY B;  1LEB A;  2F5D A;  4ZDL A;  1OYY A;  3CDH A;  1X3U A;  3ZQC A;  4UUS A;  3N97 A;  3I4M J;  2FJ1 A;  1UMQ A;  4E7I A;  4B4C A;  3FWE A;  3ABM H;  1BC7 C;  4PFO A;  1T0F C;  2LY2 A;  2LYC A;  3OYN A;  2MLK A;  2TRT A;  1BI1 A;  1XDS A;  2DO7 A;  2PMH A;  2VQG A;  1PYV A;  2DK8 A;  1G3W A;  2ZFU A;  3CC7 I;  3E0J B;  1VND A;  1TP4 A;  3BJO A;  4RMN A;  2KMU A;  4W97 A;  2QQ8 A;  2GBY A;  1T0F A;  5B1B H;  1R1U A;  3QQA A;  1Y0N A;  2QWW A;  1WWX A;  2FMY A;  1ENH A;  4FX4 A;  5F1J A;  2DJN A;  1YHQ I;  4HF2 A;  2W1O A;  1IRF A;  2LD5 A;  2E1C A;  2KIU A;  2RGV A;  2ZJP F;  3A0H C;  3OYG A;  2GAU A;  2R3S A;  3DBH B;  5DS9 A;  1B4A A;  1FTT A;  1HST A;  5KAI C;  4L0Z B;  1ZG3 A;  2NS0 A;  3SZG A;  3PL8 A;  1AHD P;  3M07 A;  2QSH X;  1EH7 A;  4II3 A;  2NVT J;  1BA5 A;  4I02 A;  1FIP A;  4GXO A;  4JX5 A;  3OL4 A;  3WTW C;  2D45 A;  3TGN A;  2VKV A;  4EJO A;  1ETX A;  1MBK A;  1XS9 A;  1T39 A;  3U1K A;  5FJ8 J;  5DEQ A;  4RB0 A;  1YX5 A;  4DW6 A;  3O6B B;  4EJW A;  4BL0 B;  4BQQ A;  3KCC A;  3KP5 A;  5AIQ A;  2V9K A;  3K4N A;  4IX7 A;  3HDD A;  5IT9 Z;  4ZZD A;  2I10 A;  2L7K A;  3KE2 A;  1RUN A;  1Z05 A;  3G1L A;  3S16 J;  4LFU A;  1P7J A;  1GVJ A;  4IRH A;  1XCB A;  1GV2 A;  4L9T A;  1V54 H;  3LSM A;  2WAQ A;  3CF2 A;  1MJA A;  2FSW A;  2BY0 A;  2E5Z A;  1XSX A;  3W3C A;  3WU1 B;  4XLC A;  1HOM A;  2R7Q A;  2VBX A;  1S72 I;  4EGY A;  4E7J A;  4M73 A;  2A05 A;  2BEO A;  4KYW A;  1UST A;  1S6L A;  2FQ3 A;  3LOC A;  5FFX A;  1D0X A;  5K5R A;  1O3T A;  2DMP A;  5AIP A;  2CUZ A;  3JRC A;  2F4M B;  4CCO A;  1W36 C;  1A35 A;  3WGG A;  2ELH A;  1G2H A;  3FIS A;  1OFC X;  3WTV C;  3LAP A;  3F72 A;  1L0O C;  4UV8 A;  4UY8 I;  4RB1 A;  3JRB A;  4CUG A;  3CUQ C;  4LJZ F;  2IVM A;  3TW7 A;  1T38 A;  1ACI A;  2E36 A;  4WK8 F;  2CW8 A;  1AWC A;  1CF7 B;  2IGO A;  5FO5 A;  3Q0V A;  3FZV A;  4LOC A;  3W6K B;  4B44 A;  1LFP A;  2CFX A;  3CUQ A;  1U9O A;  2VBZ A;  4HG2 A;  4OIP F;  4N4O B;  2RC4 A;  2XPU A;  5LFA A;  5D5V B;  3WGH A;  2HOS A;  3GTQ J;  2A6E F;  3I4P A;  1LNW A;  3KYL A;  2QKM B;  2O5R A;  1G8X A;  4EJU A;  2W82 A;  2O7O A;  1YFH A;  2Z9O A;  1P7I A;  1T56 A;  2UV1 A;  3DPU A;  2DXI A;  1YRN B;  1EH6 A;  2HQR A;  3K2A A;  3QOP A;  3VYU B;  4ENJ A;  1VQ8 I;  2MG4 A;  1IXC A;  4UVB A;  4DBR A;  4M71 A;  3FDY A;  5J1Y A;  3BTL A;  3GXO A;  4C30 A;  3R0A A;  1NHA A;  1SMT A;  1YS6 A;  2EBI A;  4AIH A;  1EJ9 A;  3I3L A;  4GGG A;  2IS6 A;  3F6O A;  4HEA 2;  2P4W A;  1G3S A;  3PNT A;  3IUO A;  3CLO A;  4BQO A;  2UWM A;  3OY9 A;  2EIJ H;  1SFK A;  3SFI A;  4AVZ A;  4HOB A;  1ZH5 A;  1YIJ I;  1HDP A;  3VYR B;  1A6I A;  4OWR B;  5C3E J;  2RV8 A;  1ZG5 A;  2V1U A;  2E71 A;  1YW7 A;  3JRD A;  4AUX A;  2BHY A;  2K3F A;  4KIB A;  4Y13 A;  1UFM A;  4EEF G;  3T1B A;  3ZQF A;  2RNJ A;  1KQ0 A;  1ZK8 A;  2UZK A;  1TT5 B;  2R7D A;  1V55 H;  2MA3 A;  4UB8 C;  2VXD A;  4E7Z A;  3VEP A;  2J5O A;  2MD0 A;  5TIS C;  2P5V A;  2R5Y B;  1J2X A;  3GZ6 A;  2X1D A;  3HGG A;  1HA8 A;  2OF7 A;  1X1B A;  2B7E A;  3K69 A;  3FXO A;  2HZT A;  3MWM A;  2PQ8 A;  5ICC A;  1AKH B;  4H0E A;  4I0B A;  1SVM A;  4KDP A;  4XRS G;  1A04 A;  5C4J J;  2DTR A;  4A3K J;  1Y0U A;  2E1M C;  3HUG B;  4G12 A;  3DP7 A;  3L9F A;  3M8E A;  2H09 A;  4E6K G;  2CW7 A;  2ZB9 A;  4D7N A;  3AL0 C;  2Z2S B;  4HF1 A;  2VQL A;  2LH9 A;  3FKI J;  3TDU C;  2LVS A;  3JR9 A;  4A12 A;  1RC9 A;  2MGQ A;  4CO8 A;  3K9T A;  1KU3 A;  2NNN A;  2HEO A;  4Q47 A;  1ITY A;  3F21 A;  2MYS A;  1PP8 F;  4XOR A;  3AG1 H;  4IKF A;  4F52 A;  2HPM A;  5GTI C;  2HQ5 A;  4RGX A;  2WV1 A;  1XSD A;  5GPC A;  3RKQ A;  3DKX A;  3OSG A;  3K70 C;  3BTI A;  3E1S A;  3Q9S A;  1TL8 A;  1HW5 A;  1ZRD A;  3H0G J;  3K1N A;  3ZMU A;  5GTH C;  3FXR A;  2EZK A;  3CJT B;  3TOA A;  2RQP A;  2JVH A;  3V42 A;  2QCO A;  2TCT A;  2CUE A;  3OYM A;  1IXS B;  3DV8 A;  2VON A;  4BAC A;  4D9J A;  1PP7 U;  1KYW A;  4IHX A;  1GV5 A;  1XGM A;  4KJZ A;  1R22 A;  2ADU A;  3BR0 A;  2BW3 B;  2EJR A;  2R5Z B;  4B48 A;  1K78 A;  3HOV J;  4NC8 A;  1YW8 A;  3GUD A;  5FKM A;  2L9N A;  1R1V A;  3HSF A;  1B8I A;  2IJL A;  3SYT A;  1LE8 A;  4Y52 J;  2Z16 A;  4XNF A;  4EVI A;  2CV0 A;  2ZME B;  2FBI A;  2M8E A;  4WWC A;  2DYS H;  3ZQG A;  1MJ9 A;  2XSJ C;  1IAW A;  1R5G A;  3PM1 A;  1ZRF A;  2MBF A;  1NH3 A;  1GHC A;  2V4J C;  3ZPL A;  2ZCW A;  5LLQ A;  4CXF A;  3DCF A;  4HST A;  4UB6 C;  4Z6Y A;  2JPB A;  2IS4 A;  1ZYR F;  2A69 F;  3I5U A;  5LGT A;  4HPQ A;  4L18 B;  2MC4 A;  1GVD A;  3ABT A;  3DPL C;  5BNG A;  2P5L C;  5K7Z A;  3GVA A;  2MW8 A;  2DW4 A;  4OAY A;  3FXK A;  4CCJ A;  2ACJ A;  4BAY A;  1B9N A;  3QAH A;  4AIK A;  3GWZ A;  1WHU A;  3Q0U A;  3QP5 A;  5LGU A;  3D5S C;  1ON2 A;  1PUF B;  2QGU A;  4WXH A;  4XRS A;  2X51 A;  3ULQ B;  5CVR A;  3S3O A;  4ANJ A;  1V5F A;  4M72 A;  2P6T A;  3WE2 A;  2KRC A;  2Y0M A;  3S8P A;  2PN6 A;  3OYB A;  1YJW I;  3K70 D;  2QSG X;  1E0E A;  4M6X A;  2AQE A;  1MMD A;  1JKQ C;  2DK5 A;  3S3N A;  3FX3 A;  1IRZ A;  2V26 A;  2P7V B;  1S7E A;  4OIO F;  2IGN A;  1XPX A;  2KDO A;  2R7F A;  2ID3 A;  1WI9 A;  2DA6 A;  1J09 A;  2HYF A;  5K1Y A;  1RIO H;  3IH3 A;  1SMY F;  4B09 A;  3TDZ C;  2FBH A;  3L1P A;  4HX8 A;  1I6X A;  2F6C A;  4WX9 A;  2PJR A;  1SVL A;  3HPG A;  2ZJ2 A;  1X2M A;  5GAH J;  1IRG A;  1UHW A;  4S04 A;  2A07 F;  2H6B A;  2OC6 A;  1JT6 A;  3OYJ A;  4IOC F;  4LK0 F;  4P5O A;  5ERI A;  1R9T J;  2GIZ A;  4KUM A;  3M1C A;  2EFO A;  1XCV A;  5DUI A;  4A3C J;  1O3Q A;  2IS2 A;  3LFU A;  5F0C A;  2QQA A;  2OJE D;  1XX5 A;  1M1E B;  4KIF A;  1LKX A;  1LB2 A;  3MZ8 A;  3BG5 A;  2V6C A;  4IF4 A;  3WTS C;  4C9Y A;  2WY8 Q;  2A3S A;  2IS1 A;  3ZR8 X;  1BI3 A;  1F1Z A;  3JTH A;  2R5Y A;  3OOU A;  1SEU A;  1D5Y A;  1REP C;  5JR3 A;  1VF9 A;  5HNF A;  4PGH A;  4BJ6 C;  2F2E A;  3CCR I;  1NTC A;  2PMZ N;  5IOZ A;  2X6W A;  4IEJ A;  3U21 A;  2X4H A;  3GX4 X;  2XAF A;  1MNE A;  1AKH A;  4C2T A;  3HJE A;  3TBI A;  4WXC A;  2Z3Y A;  3U1D A;  1HKT A;  4FTH A;  1BIA A;  2WV0 A;  4BXU A;  2VXZ A;  2ICW G;  4ENM A;  1MW7 A;  2K9L A;  3HBL A;  4QPQ A;  4MHG A;  2CSO A;  3K1M A;  4NUB A;  3KFW X;  4LIV A;  4ZTJ A;  5HLH A;  1VZ0 A;  2OUM A;  2JA2 A;  5LEK A;  3C18 A;  3KP7 A;  3BJ6 A;  4IZZ A;  4RAZ A;  1MD0 A;  3HOX J;  4A3L J;  1ETO A;  2ISY A;  4Q4Z F;  1IDZ A;  3BZC A;  3G1M A;  3FHZ A;  4XL9 A;  1N75 A;  2JA8 J;  1BJA A;  1CGP A;  2KP6 A;  4A3F J;  3ERE D;  2M7A A;  2XGD A;  3CCQ I;  1XB4 A;  3FM3 A;  2R7U A;  2VC1 A;  2M30 A;  3OR1 C;  2HWV A;  3KP6 A;  4UUS B;  2R93 J;  3G3Z A;  2LY1 A;  1ZAR A;  1XGS A;  1W5S A;  3HRT A;  1Z6T A;  3ML6 A;  2DOF A;  2HR3 A;  4EJT A;  2CUF A;  3FXL A;  5TGT A;  2KT0 A;  4QSH A;  2Y0S N;  2C6Y A;  3FXM A;  3OYC A;  3LA3 A;  1SC7 A;  4UHT A;  4LG3 A;  3BR6 A;  3JRA A;  3AFH A;  1T08 B;  3E5X A;  2HU9 A;  1OYI A;  3G2B A;  5ICF A;  2A68 F;  3EUK L;  1D0Y A;  4EM1 A;  1TQP A;  1SFO J;  2PMU A;  1V4R A;  3UR3 C;  1AU7 A;  2X1E A;  4S0H B;  1E17 A;  2LG4 A;  1B6A A;  2EZI A;  3AKZ A;  2CQQ A;  2UXX A;  1HXD A;  1U8B A;  4HYE A;  5J1R A;  4IHW A;  2L2O A;  3FBN B;  2LP0 A;  4A69 C;  2RQQ A;  2HI3 A;  4LG0 A;  2WWY A;  1F5T A;  2GXA A;  2ECC A;  3T8R A;  3GLL A;  2DTZ A;  5J4Y A;  4RBO A;  5JHU A;  1MBJ A;  3AG2 H;  5FKK A;  4EV0 A;  3RCO A;  1P6R A;  4I98 B;  3CMY A;  2K02 A;  2LRE A;  2CQK A;  3HSE A;  1R71 A;  3CD6 I;  1YOV B;  4A0X A;  2EFP A;  1WCM J;  3RI4 A;  2VQC A;  2LTP A;  2V9V A;  5FRN A;  3FXU A;  1Y39 A;  1U5T C;  4AIJ A;  4ABZ A;  2M8G X;  2IW5 A;  4OMZ A;  4IRG A;  2DPU A;  3BP8 A;  1MMS A;  2CUJ A;  3Q0W A;  4BQN A;  1ETV A;  2O6G E;  2IBD A;  4WXD A;  3BG3 A;  3P9C A;  1PDN C;  3FMQ A;  1U5T A;  3CLQ A;  5D5X B;  3SZT A;  1A5J A;  2EFQ A;  5E20 A;  4IHY A;  2BY1 A;  2QM3 A;  4C3H J;  3ZXS A;  3DKW A;  2KHM A;  3PO3 J;  4CYD A;  4ENN A;  4J00 A;  1RZ4 A;  2BXZ A;  1DU6 A;  1UG0 A;  1TW3 A;  5F08 A;  3JSO A;  2R7T A;  2FNA A;  2Y30 A;  3CCE I;  5DD8 A;  4KN7 X;  4HDV A;  2OAZ A;  4JK1 X;  1HW1 A;  5LRR A;  2DMU A;  2CYY A;  2IA2 A;  1AOY A;  5GPA A;  2ZSH B;  1KON A;  4CZC A;  1H0M A;  1I6H J;  3CUQ B;  3M3Y J;  4E4H A;  4ZC3 A;  4GDF A;  2M0M A;  2LBF A;  1I50 J;  2EPF A;  1Z6R A;  2QLZ A;  1MKM A;  4U0V A;  3BPV A;  5HS8 A;  1HSJ A;  1FOW A;  4OAZ A;  5DUK A;  3BT9 A;  4ZJZ A;  3JAM Z;  4JOM A;  2KKO A;  4LB6 B;  1J9I A;  2Q8K A;  4Z2Y A;  3J81 K;  4QPO A;  1FSH A;  4PSX A;  3S3M A;  5J4V A;  3GTO J;  4CCM A;  3E3V A;  1VQN I;  5GP9 A;  2A61 A;  2BGC A;  5ILU A;  3MAJ A;  2OZ6 A;  3HIF A;  4YFX F;  1D3Y A;  1LPQ A;  3OWT A;  2WY7 Q;  1XMA A;  5FGM A;  1R58 A;  1WFX A;  1G59 A;  1GXP A;  2CW0 F;  3AG4 H;  5M5W J;  2L9S A;  1J75 A;  2IXS A;  2CS3 A;  1MSF C;  4PJ0 C;  2DPD A;  2COM A;  3FK6 A;  3DBR B;  3QOD A;  3KET A;  3EPZ A;  3GTM J;  2IPQ X;  5F27 A;  4GCV A;  4O5V A;  1VQL I;  4DJA A;  2KIS A;  3A1Y A;  3W2A A;  5M3M J;  1BBY A;  1FMW A;  2XHK A;  4XN3 A;  1ORK A;  1VTN C;  4N0B A;  1ZR2 A;  4CH7 A;  3JSP A;  1F36 A;  2M4G A;  4LB5 A;  3C3W A;  1LDJ A;  2GA1 A;  1J0R A;  4HNV A;  1Y1W J;  1GUU A;  1TQM A;  1U78 A;  3K4M A;  1DUX C;  3GFL A;  2LK2 A;  3BCA A;  2FF4 A;  3RKW A;  1X3W B;  4XOT A;  2NOG A;  1Z3Y A;  3LSH A;  5CKT A;  4BQA A;  5B5E C;  4PJL A;  1R49 A;  2CJJ A;  3TOB A;  4OIN F;  3C7J A;  3LQQ A;  3G1O A;  2NNY A;  1A31 A;  1HCR A;  1IV8 A;  1MDM A;  5AON A;  1LVK A;  1KU9 A;  3GBG A;  4HNU A;  4WCG A;  4YFK F;  2AO9 A;  4CYC A;  4D5F A;  1MBF A;  2CGP A;  1D8J A;  2CH0 A;  1G6N A;  2DT5 A;  4EGZ A;  3LA2 A;  2B0L A;  1U2W A;  5J47 A;  2RRE A;  4FE4 A;  4DZP A;  5L3C A;  1MND A;  1IUY A;  2XAQ A;  1UCR A;  4U0W A;  3WU2 C;  3K7A J;  1OCO H;  4L9V A;  2M34 A;  1S29 A;  4DYR A;  2X6X A;  2VKE A;  2MFZ A;  1TC3 C;  2DDA A;  4AVP A;  1WJE A;  3HB9 A;  3WOD F;  2E1M B;  3BWG A;  4EJV A;  3CES A;  3ABK H;  3AL0 B;  3VOE A;  5FRM A;  3BR1 A;  4BH9 A;  3WTX C;  2E34 A;  2DMN A;  2E60 A;  1Q1H A;  1WPK A;  4BUP A;  1W7P D;  1XDU A;  3RPU D;  3J80 K;  3A01 A;  2E2H J;  1QZZ A;  2A6T A;  2MC3 A;  1MSE C;  3TMO A;  5IYD J;  2DA3 A;  4PSW A;  3J7Y J;  3BQZ A;  1O7F A;  3OS2 A;  4BKX A;  1YO5 C;  3FXQ A;  2OV7 A;  4MQV A;  4YEL A;  1SFX A;  2KPM A;  4YIR X;  3F9K A;  1YLF A;  4G9Y A;  2K7L A;  4G7Z F;  3HGY A;  3U2R A;  4BHB A;  3HOZ J;  4P1W A;  4B3X A;  3KPH A;  4BDZ A;  2Z33 A;  2BHZ A;  1RUO A;  2M4K A;  2L54 A;  1K78 B;  4BJ5 C;  3LFK A;  4FQG A;  2YX4 A;  1IW7 F;  3AG3 H;  4HBL A;  3BG6 A;  1IN4 A;  1FIA A;  2DOA A;  5HLI A;  1B8I B;  1LE8 B;  2BE5 F;  3HHG A;  3QU6 A;  5LEJ A;  1FYL A;  3PFY A;  3L2U A;  1WI3 A;  3BG9 A;  4I09 A;  4YIF A;  2V1N A;  3V7S A;  1VQP I;  5B66 C;  4JQF A;  3EYI A;  3CP2 A;  5JFR A;  1H89 C;  1Z0X A;  1QQI A;  1ZRC A;  5H6R A;  3QYF A;  1I3Q J;  2CMP A;  2CV2 A;  3GTG J;  5DCF A;  4XQF A;  1A36 A;  2X6O A;  5E8I A;  3W2V A;  4BEH A;  3BZK A;  4L5J A;  3WGI A;  2PLY A;  1LFU P;  2Y31 A;  1DU0 A;  4XKB A;  3R6S A;  1E3O C;  3NWT A;  3PFI A;  3H3Z A;  4I7H A;  3GTJ J;  2GM4 A;  2GZW A;  3WHB A;  2LKX A;  1B9M A;  3ZMS A;  3GZN B;  1JHF A;  5F0F A;  1RRJ A;  3R4K A;  2XRN A;  2Y9Z A;  1U8R A;  1IZ1 A;  1ETY A;  1L3L A;  2OTJ I;  2LKS A;  2F4I A;  2Z1D A;  4ETS A;  5B3S H;  5FLV A;  2EK5 A;  2K40 A;  3BLY A;  5J3L A;  1P4A A;  2W4S A;  5EG0 A;  1ULY A;  2PX9 A;  5HS7 A;  3JRI A;  2I5U A;  2VJI A;  1MBE A;  1S3J A;  2EIM H;  2XUB A;  4HLY A;  2XAG A;  4IVN A;  3EDP A;  1NK2 P;  4G6D A;  4E70 A;  4JP0 A;  5D4R A;  3VFZ A;  1EA3 A;  1K6Y A;  3CP8 A;  4O6J A;  1X4O A;  3PQK A;  1IN8 A;  4LK1 F;  1YX3 A;  1T95 A;  2O03 A;  3IWF A;  4Y4R A;  2V1D A;  5CVJ A;  4CCK A;  1GLN A;  1IGN A;  2ESN A;  5EEH A;  3RSN A;  1MMN A;  2PMZ A;  2WA0 A;  3ZQ7 A;  4RAF A;  1X2N A;  2M45 A;  3HRU A;  3VPR A;  2DA2 A;  3E6D A;  3CO6 C;  1LEA A;  2PJR B;  2NAZ A;  4ZYA A;  2O9L A;  2ZBK A;  3H92 A;  4XRM A;  4ZDO A;  1QA6 A;  5J40 A;  3M8F A;  3S1Q J;  1Y8R B;  4YG2 F;  4D1Q A;  2E35 A;  1FBQ A;  3COA C;  1JT0 A;  5FLM J;  1X1C A;  1Y8Q B;  1Z9C A;  4HX7 A;  1FYM A;  4IHV A;  2QF7 A;  4BU2 A;  3RPQ A;  4UVA A;  3MD2 A;  1ERD A;  1FP1 D;  2VOD A;  3S14 J;  2NVX J;  3F8N A;  4QLC U;  3B6C A;  2ZJR F;  4RM3 A;  2XF7 A;  3ZP5 A;  1R4N B;  3ZCO A;  2ZKZ A;  1KQ9 A;  1SVO A;  4HDU A;  2WTE A;  1I39 A;  3Q3S A;  3FIW A;  1FEX A;  4LIU A;  1ON1 A;  4P9F A;  1OCT C;  2JA5 J;  2HDD A;  1W0U A;  4BNC A;  3P5J A;  2DA1 A;  4M9S A;  2F5F A;  2ME0 A;  2UXN A;  3H0D A;  1FY7 A;  2ESH A;  2EIN H;  1UHM A;  3QPT A;  3L2R A;  3F3X A;  1W5T A;  1G4D A;  1MNM C;  2Y0S A;  1YS7 A;  3LSK A;  1X4P A;  3BPX A;  4HQM A;  1HDD C;  1P9Q C;  5F64 A;  1OKR A;  1BR4 A;  4AID A;  3JW4 A;  3I71 A;  3IAM 2;  2LC2 A;  4HW0 A;  2D1V A;  1E3P A;  2P6S A;  1XMX A;  3WTY C;  3MKW B;  5E3L A;  3RKX A;  4RAY A;  4I6Z A;  3OR2 C;  5FFZ A;  2QVO A;  2H1K A;  5J8C A;  3B6A A;  4A3M J;  3I0T A;  4M3G A;  1LDK B;  3PUF A;  2JZY A;  2QQB A;  3R0J A;  3CCL I;  2DLL A;  5JHF A;  5D4S A;  3ECH A;  2DI3 A;  3V7C A;  1QHH D;  1TZL A;  3WTT C;  3C2H A;  2VBW A;  3ONQ A;  2IAI A;  2NS8 A;  2NOJ B;  1YYV A;  4GFB A;  4MFD A;  1TNS A;  2ZXI A;  3D5L A;  2XDV A;  2HVQ A;  5DTD A;  4DOZ A;  3BCB A;  4XKV A;  2M1B A;  3K4J A;  4DYC A;  2A6H F;  3LSP A;  4M3F A;  5LGN A;  2VB6 A;  1V3F A;  2DJI A;  1RR8 C;  3B02 A;  3KP4 A;  3BG7 A;  3MMY B;  5FKO A;  2Q2E A;  1JTX A;  2NVY J;  3OYA A;  3HOS A;  3CCV I;  5LHG A;  2JK3 A;  3E6C C;  1FWZ A;  1RPW A;  4PUS A;  5DD4 A;  4UUT A;  2K9S A;  2VOO A;  3I59 A;  3ROU A;  3RYR A;  1JXS A;  3O8H A;  4KT5 C;  3IL2 A;  5E3O A;  1KU2 A;  1IG7 A;  4ZH4 F;  3IHU A;  2MLG A;  3SEZ A;  1SFU A;  4XKW A;  4G7H F;  4LG0 B;  1XSV A;  1U3E M;  2XGX A;  4EM0 B;  1KZH A;  4EMS A;  4YFN F;  1O4X A;  2STT A;  1OCZ H;  4B1R A;  1OR7 C;  2VT2 A;  2IA0 A;  3BRO A;  2XGE A;  4IRI A;  3F8F A;  1N25 A;  3HZJ A;  1JUM A;  1OIS A;  1K79 A;  2ZO4 A;  5ICE A;  4ESB A;  2E2I J;  2ECB A;  2K4J A;  3L09 A;  4U0Y A;  1IV6 A;  4NB5 A;  3IRR A;  1TWC J;  1OR7 A;  3DPT A;  4DNC A;  4LLL A;  1IC8 A;  1JUS A;  2E1N A;  3CME I;  2YS9 A;  3DTE A;  1P92 A;  1E3H A;  1T6S A;  2RDP A;  1JJ6 C;  2M87 A;  4PCQ A;  1QVU A;  1ODD A;  4CZZ A;  1UEL B;  3CJN A;  3LMM A;  4CCN A;  1ZG1 A;  1T98 A;  3CDL A;  2FA5 A;  4CCL A;  2R0Q C;  2CU7 A;  3QYE A;  5JLW A;  4V19 K;  4MTD A;  1U5T B;  1WRJ A;  1FZP B;  5E3N A;  3MVP A;  2VQH A;  3DTI A;  3F23 A;  4GRI A;  3CO7 C;  3MN2 A;  2VLA A;  4LMY A;  1YE9 A;  3M1E A;  1YTY A;  2KDZ A;  2GQQ A;  3K4K A;  4PGG A;  3N4M A;  2O61 A;  3A4C A;  1Q1V A;  1UG2 A;  2LRD A;  2CO5 A;  4NQW A;  4XLA A;  5BMZ A;  2XKO A;  3T8T A;  3TKY A;  3LAJ A;  3K2Z A;  3RZD J;  2E2J J;  2VT3 A;  1H8A C;  3QOE A;  4BBR J;  1TW2 A;  4RGU A;  5L3D A;  3H9G A;  3GCM A;  2CQX A;  5K7F A;  4HA8 A;  2OU2 A;  4ZYH A;  3LQR A;  4E7L A;  2VOP A;  4E7H A;  3FMS A;  2DA4 A;  1Z1D A;  5FD6 A;  5FLX K;  1R5I D;  2FBK A;  2IGM A;  1P4X A;  3CJR B;  4PJM A;  4XSZ F;  2LBF B;  1WJA A;  4M6Y A;  2G7H A;  4XLN F;  2LSO A;  2FEZ A;  4R79 A;  1Y1V J;  1GXQ A;  2LMD A;  3J7A O;  4G6Q A;  1R7J A;  2DOE A;  1MJB A;  5E3M A;  3RZO J;  2KZV A;  2Y48 A;  2BBY A;  5D5U B;  1WKM A;  4IL6 C;  2QA4 I;  2MH9 A;  5ED4 A;  4HF0 A;  3SHF A;  3ZMD A;  1TNT A;  2K5C A;  3DLL F;  1VQ9 I;  3E5Q A;  1G3Y A;  2OTL I;  3EUA A;  5E1X A;  3L00 A;  2VE8 A;  1Z7U A;  4JBA A;  3HL2 A;  2XRL A;  3K10 A;  2K27 A;  5IP9 J;  5C4X J;  2H94 A;  3TP0 A;  2XAU A;  2VJJ A;  1YI2 I;  4KMU X;  2L01 A;  5CVU A;  1RET A;  4MQ9 F;  4I2O A;  4C2U A;  3DKY A;  3ECO A;  5CVI A;  4Y15 A;  4D0P A;  1WZ2 A;  1X3Z B;  2W57 A;  5KAF C;  1QRY A;  3IKV A;  4ZYE A;  1BI2 A;  2LFB A;  1LJ9 A;  1SD6 A;  3BZ6 A;  3HKZ N;  2KIQ A;  3JRE A;  1JJ8 C;  3X2Q H;  2FD5 A;  1HC8 A;  5LBQ A;  2FOK A;  2QZ8 A;  4WF2 A;  5A2Q K;  3H9J A;  4BYY A;  5JI6 A;  3J7A Y;  1RKT A;  4XID A;  2N8G A;  2GXB A;  2G0E A;  3ASN H;  5L3F A;  1MDM B;  3BC8 A;  1UJ8 A;  2DA7 A;  2ID6 A;  3MEX A;  4M6V A;  2I8D A;  4CYC B;  4UVC A;  1JI8 A;  3GLX A;  1Z91 A;  4BS9 A;  5FD5 A;  3K1P A;  4A6D A;  3OYH A;  2KFD A;  3Q5F A;  1D1B A;  4AD9 A;  4BBS J;  5K5Q A;  1IRX A;  2VBY A;  2AXT C;  3MKL A;  2E7W A;  3ELK A;  3DEE A;  5LHI A;  2WAE A;  3QYB A;  1WGX A;  4V2G A;  4MTE A;  1ZGW A;  4XM3 A;  1ONV A;  2DU9 A;  3DQV C;  3ZOB A;  2LF8 A;  2DYR H;  3QU3 A;  3CJQ B;  2YU3 A;  2IP2 A;  2JSC A;  4M9Z A;  4B43 A;  1F43 A;  2XAJ A;  3DU5 A;  4DGW B;  4F92 B;  2Z99 A;  3M8J A;  4A93 J;  4KNY A;  2A5W A;  1PJR A;  3GO5 A;  1BOB A;  1FTZ A;  2HDW A;  1FT9 A;  1JGG A;  1N77 A;  1WSU A;  1SD5 A;  5EF6 A;  3A01 B;  4L9J A;  3WG9 A;  5TRD A;  2DDB A;  2OA4 A;  4EAT A;  1U0J A;  3BDD A;  1ZLK A;  3GTL J;  2XPW A;  2HZD A;  2K9Q A;  2VUM J;  4A3E J;  2LY9 A;  1OCP A;  1FBS A;  5BQT A;  1LUJ B;  1PUE E;  2K9M A;  5F0H A;  1RKW A;  1WJD A;  3HTU A;  2EV6 A;  1ETQ A;  3AAF A;  4BE1 A;  1FJL A;  3CQZ J;  2NS7 A;  2BZT A;  1FSE A;  2OPT A;  4GYI A;  3FHN A;  4XLE A;  4D5C A;  3GFI A;  3F6V A;  1R00 A;  3L2C A;  1XTA A;  4QWQ A;  3IKT A;  3PO2 J;  1FMV A;  1QZY A;  3JRH A;  3LST A;  1ZGJ A;  2BVM A;  2DT6 A;  5FB2 A;  5IP6 A;  1LVA A;  5GAD J;  2R7S A;  1TWA J;  2HKX A;  4PJJ A;  5ILS A;  3CF5 F;  1BW5 A;  4LD5 A;  3G71 I;  2V9P A;  2X9D A;  2R7O A;  1HW2 A;  4BEH B;  1WJB A;  4Q48 A;  2H27 A;  1X1P A;  3KEO A;  3BJA A;  2LKP A;  5KNL A;  2L7M P;  5TJJ A;  2DA5 A;  5CLS A;  3LSI A;  1IJW C;  2OCE A;  1E2X A;  1RI7 A;  3R61 A;  4XRF A;  3MZY A;  4L0Y B;  1N78 A;  2AHQ A;  4BJT A;  2YUS A;  2EV5 A;  3WTU C;  1MH3 A;  3BR2 A;  3MQ0 A;  4A3D J;  1X1D A;  5EG0 B;  4ZZL A;  3OOP A;  4KT6 A;  4ESF A;  3C2B A;  1PVE A;  4HV5 A;  5L3B A;  2AS5 F;  2HKO A;  3OSF A;  1ZAO A;  3ASO H;  4XSX F;  2YU9 J;  3E97 A;  1I1G A;  4LGW A;  4LLN A;  2EV0 A;  5IT9 K;  3K4L A;  4BXX J;  2ZNY A;  3G6E I;  3OYD A;  1IUF A;  3FXJ A;  4MEY F;  5KK1 A;  1MMA A;  3LA7 A;  3RJP A;  3CCU I;  2JQ7 A;  5EJC A;  2F4O B;  3TQN A;  2A5Y B;  2DOD A;  3VSK A;  3ZN1 A;  1AA7 A;  3MCZ A;  3P9I A;  2L0K A;  3ZQI A;  1ETK A;  2H8R A;  5KHD A;  3KZI C;  1MMG A;  1W7P A;  3RPU A;  1B59 A;  3S17 J;  3K6G A;  1XC5 A;  2YR2 A;  3OYF A;  5EGO B;  4J01 A;  2W85 A;  3TO9 A;  9ANT A;  1S5L C;  1ZHF A;  3RKY A;  3EQL F;  4Y33 A;  4G94 A;  4BY1 J;  4RLF A;  4KA4 A;  4MEX F;  2W24 A;  3DWL E;  4PJN A;  3I9V 2;  1R36 A;  2R7W A;  4ESJ A;  1S7A A;  1FOY A;  1HKQ A;  3BR3 A;  3I55 I;  2ZSI B;  1WVR A;  3OIO A;  3WU0 A;  4P55 A;  4XIC A;  6PAX A;  2EIK H;  4AWX B;  3DEW A;  3BR5 A;  1YJN I;  4NBQ A;  1G3T A;  3V4G A;  1QVT A;  4CGZ A;  1I27 A;  3DU6 A;  4LLG F;  4H4K C;  1BOA A;  3SXY A;  1SAU A;  3P7N A;  4M3E A;  1D1C A;  4FCY A;  2FOW A;  1QGP A;  4DYQ A;  1O3S A;  2RAE A;  2G7U A;  2HDC A;  4RB2 C;  2KQR A;  2L9V A;  1ZQ3 P;  4R1H A;  2EA2 A;  4A2U A;  3Q9V A;  2XV4 S;  5FKN A;  1JKP C;  2K86 A;  1ZLJ A;  2KRF A;  1XD7 A;  2QKL B;  4U7D A;  5BOX A;  1OJL A;  3L2W A;  5HVQ C;  5HLT A;  2BY2 A;  4XN0 A;  4KIG A;  3KZY A;  2Z5U A;  3C2G A;  2PI0 A;  1FLI A;  1FNN A;  2M9H A;  3ZQL A;  2STW A;  5E17 F;  2BY3 A;  2OQR A;  1MGT A;  4RA2 A;  5M3F J;  2MSY A;  5DYM A;  4UUV A;  3QP6 A;  3KP3 A;  3SJM A;  5EZH A;  3MZH A;  3EUH C;  3A2K A;  3RTR A;  3ABL H;  3CCY A;  3RYP A;  2NYX A;  2HVS A;  1T2K A;  3OL3 A;  1VFC A;  2Y9Y A;  3I64 A;  3DEU A;  3EUH A;  2G9W A;  3LSG A;  4P9U A;  3VYS B;  1FOK A;  3HYI A;  4F55 A;  1FBU A;  2KZG A;  1RR7 A;  3IH2 A;  3PUB A;  1DP7 P;  4G7O F;  2P0W A;  1VQK I;  3D1N I;  3UNG C;  5J8F A;  1I5Z A;  4O3M A;  1YG2 A;  3H5R A;  4MLO A;  2Q2E B;  4AC0 A;  2GLO A;  1ZN2 A;  4ZYG A;  3S2D J;  1Z3X A;  3I59 B;  4DIQ A;  2F5V A;  4F7Z A;  3W2W A;  4S05 A;  3ZMZ A;  3ZQH A;  1QZE A;  4KIT B;  3J81 Z;  4M74 A;  1XN7 A;  2JWT A;  4UNO A;  4A3I J;  2PFB A;  3NQO A;  3HOU J;  4DZJ A;  4PK4 A;  2KL4 A;  3SFZ A;  5FRO A;  3HC7 A;  3LL7 A;  2HPI A;  1Z21 A;  4FET A;  4Y17 A;  2ME6 A;  4B47 A;  4KIS A;  3T0Y A;  3IWZ A;  2QEN A;  2JRT A;  3CTA A;  3K4C A;  1V5E A;  3A03 A;  4BXF A;  2DCE A;  1ZKG A;  3W6V A;  3HOY J;  5K7H A;  4KFC A;  2L9R A;  1DGR M;  3HM5 A;  4ZYD A;  1K4S A;  2MH2 A;  5IY5 H;  2CRG A;  2Q0O A;  3LSR A;  2M5W A;  1LQ1 A;  1DP3 A;  2YSR A;  3MKZ A;  5GAE J;  4MO7 A;  3VYT B;  3IAS 2;  2L3D A;  4PZJ A;  4YRV A;  4X1E A;  1B72 A;  2ZFW A;  2H8W A;  3J7Z I;  4ENK A;  1QO0 D;  2RKH A;  1MBH A;  3BOQ A;  2EQR A;  3TED A;  2R7R A;  3SEQ A;  3TL4 X;  1R1T A;  2HQN A;  5JVG F;  3DLA A;  3M9A A;  5IPA A;  2HXO A;  1CQT A;  1R5H A;  3JRG A;  4IHS A;  4NQW B;  2MD5 A;  2M7B A;  1IN5 A;  2RVC A;  4ITV A;  3BQY A;  4G8X A;  2D1H A;  2DAO A;  2OCC H;  2JT1 A;  3S15 J;  3ZMV A;  1R4M B;  2Q1Z B;  5L3E A;  3ZRG A;  4M9X A;  3KEY A; 
#chains in the Genus database with same CATH homology
 1MIJ A;  1XPX A;  2LMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...