1XPXA

Structural basis of prospero-dna interaction; implications for transcription regulation in developing cells
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
144
Chain Sequence
SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule tags Transcription regulation/dna
molecule keywords 5'-D(*AP*GP*CP*AP*TP*GP*CP*CP*TP*G)-3'
publication title Structural Basis of Prospero-DNA Interaction: Implications for Transcription Regulationin Developing Cells.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 54
structure length 144
sequence length 157
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1xpxA00
1MIJA 2LMDA 1XPXA
chains in the Genus database with same CATH superfamily
1S29A 4XRSG 2XROA 3K10A 1K7AA 3WTUC 1ETXA 1S7AA 1XMKA 2KRFA 1D0XA 3E5QA 4CYDA 2G0EA 2EQRA 1L0OC 5D5UB 1LB2A 1OCOH 1I3QJ 3PFYA 3CJRB 1R7JA 4Y33A 5FO5A 1XDSA 5K7FA 2EZKA 3I4NJ 4EJUA 3QPLA 1MJBA 2E36A 2IGOA 3AG3H 3M8JA 3RYRA 1U5TC 2DI3A 1FY7A 1S72I 5F27A 3JRHA 2DFHA 1GVJA 1MBEA 2WV1A 1WJAA 1MNMC 2KZGA 1A5JA 2W84A 3VODA 4IOCF 4C9YA 5D4RA 2EA2A 3WGHA 4CUGA 3OYKA 4BXUA 3ZCOA 5FKNA 4ASNA 4BBSJ 2F5CA 5EZHA 3HG9A 3J81K 3ECOA 1QBJA 4PZJA 2WADA 1D1AA 4ZH4F 3O6BB 2K86A 1B1BA 2H6CA 4A3FJ 3QPHA 1PVEA 4IF4A 4BQOA 1JT0A 1YE9A 4RMNA 4WXDA 5E3LA 1MMNA 4I02A 5E3MA 2DFEA 3J80K 1JGGA 4E7ZA 4JQFA 2BZTA 3E6BA 4RAYA 3LA2A 5HS9A 1PDNC 1RESA 2JRTA 3K4BA 3OWTA 5KAIC 1Y1WJ 3TW6A 4PJLA 4P55A 1FT9A 1IG7A 3K7AJ 3QAHA 2TDXA 5CVUA 3H5AA 4BAYA 3CF5F 2WY8Q 2RN7A 4M3GA 1RUOA 2N8GA 2BV6A 1QNTA 1WVRA 4M6YA 1MH3A 3R6SA 3VYTB 1LVAA 2R92J 3CMEI 2FSWA 3PFIA 4E7SA 1XB4A 4UVCA 3MKYB 3Q9SA 2IVMA 3H9GA 1SAXA 4AWXB 2NS8A 1FZPB 2K40A 3KLNA 4L18B 4I0AA 2HS5A 3HRTA 4ON0A 1MBKA 1UHSA 3LL7A 1ZARA 3BG9A 1GXPA 3KP3A 3LWFA 5EF6A 1FP1D 2CUFA 2LY2A 3O8GA 3NARA 4NC8A 4ANJA 2X4HA 5J1YA 3V8KA 1ETOA 4LIUA 2I8DA 1BR4A 5J40A 4FASD 2R5YB 2PMHA 1ZHFA 2DU9A 3HOSA 2EJRA 3S32A 4CYCB 2DK8A 1XPXA 4G94A 2M45A 2M0CA 4YIIA 1Z91A 1REPC 4FT8A 2LRDA 3I59B 5JLWA 3ABUA 3OOPA 1IV6A 2JVHA 2CUZA 5FRMA 1P92A 5FB2A 3P5JA 2V6CA 3J7YJ 3RIRA 3Q0VA 3D5RC 2XVCA 1Z9CA 2QQ9A 1TP4A 2STTA 4CCLA 4FE4A 4HDUA 1MH4A 4CA0A 2PI0A 1NK3P 5E8IA 2P5VA 4HYEA 2A07F 2XAUA 2DFFA 1XC5A 3GW2A 4GFBA 1ETVA 3GXOA 1A35A 1V55H 2LG4A 2E2IJ 2EINH 3HYIA 4DQ2A 1K78B 2LR8A 2DPUA 1RKTA 1BC8C 1ETWA 2YS9A 2DAOA 3HRSA 2LLKA 3LSGA 1XDUA 2ZXWH 3TOAA 2L7ZA 3ZGKA 2Y30A 3OS2A 1HDPA 2XF6A 2VBXA 3MN2A 4Q4ZF 2Q0OA 3ZMSA 4EMSA 1B9NA 1JJ8C 4UY8I 1EV7A 3R4KA 2ZFUA 3LSRA 1FPQA 1WJ5A 2IS2A 1ZGAA 3OYCA 3QRFF 2LMDA 2W25A 4DW6A 2HOEA 3IV5A 1A6QA 1U78A 4II3A 2VQCA 4XLCA 1BM9A 4X6AJ 3JRBA 1CF7A 2XF7A 1ZR2A 5F64A 2OTLI 2K7LA 3PJRA 3HOWJ 3FXQA 3I9V2 4LJZF 2AQEA 1LNWA 4L5EA 4HG2A 2NOGA 1D0ZA 2CWEA 2XPVA 5IT3A 3I0TA 4HQMA 4F3QA 2UZKA 3ELKA 1LJ9A 3DKXA 3BPVA 4H0EA 4EJTA 2PMZA 4BNCA 3IHUA 4I99C 3TKYA 2CMPA 5BQTA 1H0MA 5IT9K 1V5GA 3HRUA 2VB6A 2QYOA 1MW7A 5C4JJ 1N77A 3F72A 4RLFA 2CV0A 3GEZA 1YITI 4LLNA 2A6EF 2V1NA 1TT0A 2FBKA 5FKKA 2HYFA 4UHTA 3M8EA 2VI6A 3W6VA 3KP7A 1P2FA 3REOA 4OMYA 3PNVA 1P4WA 3GCMA 1J59A 1Z67A 4XKCA 2EWNA 1V5EA 2VJ4A 3VYSB 6PAXA 2I5UA 1JKQC 5L3CA 1Y0UA 4B47A 3HSEA 2MH2A 4II2A 3SEZA 4ZYGA 2COBA 3FBNB 4Y15A 5HDKA 2FQ3A 3BCAA 1ZG5A 3SDGA 3M07A 4PJJA 5A2QK 2E1OA 1XN7A 1Z77A 2GZWA 1OJLA 2WTEA 3MQ0A 4ZDPA 3PUBA 2AXTC 2CU7A 2VIXA 3CCMI 4KIBA 4ENJA 2ESHA 1JJ6C 3EYYA 5ED4A 2X51A 3RKQA 2DDBA 2X6OA 1QZYA 3HSRA 1YI2I 1I6HJ 1FSEA 3VB2A 1IN5A 3HKZA 2Y0SN 5J47A 3J81Z 1WJCA 1YYVA 3CQZJ 5HS8A 2QSGX 1UCRA 1TT5B 1YX3A 5TISC 2GBYA 3QYBA 3TBIA 3RJPA 3ZRGA 5J8FA 1D8KA 3CJQB 3E6MA 1HLVA 3TDZC 3RDIA 4TV7A 4KFCA 2K3PA 3CMYA 4G8XA 1STZA 3ZMUA 3WTYC 3ERMA 3G6EI 4DBQA 2EV6A 2X6XA 1P4XA 4U0VA 2NVTJ 1O3TA 5EEGA 4IRIA 2PLYA 3EUKL 2WY7Q 1BR1A 2Y9ZA 3FMSA 1DPRA 3ECHA 3HTUA 2Z2SB 3EUHA 4IO9F 1TQMA 5D5XB 1V54H 3AL0B 2HZTA 4AYBA 3JSPA 3ABMH 3B6AA 2A6HF 3BC8A 2ZMEB 5M3MJ 3WTVC 3FXUA 3V7RA 2X48A 2P81A 1LDKB 5IY5H 5CYVA 4UUTA 1MJAA 4ZC3A 2LC2A 1MMDA 1W36D 3QPTA 3WTTC 2YX4A 1NTCA 2CV2A 2R7UA 1BN5A 3DLLF 1WGXA 3CP8A 3F8FA 3CUQA 3MKWB 1YS7A 3HBLA 3NWSA 4YFNF 1QA6A 2DDAA 2V1UA 4LLLA 2EILH 2PBIA 2NOJB 5GAGJ 1HQCA 1Y0NA 3JTGA 3DEWA 2KP6A 3RTRA 2WAQN 2CSOA 2GM4A 3OR1C 3WGIA 5B5EC 3BTIA 2EFWA 1OFCX 3BDDA 3TP0A 2BY0A 4LIVA 4X0GA 4G12A 1IRFA 5ERIA 4BHCA 3IH2A 3PQKA 3DBHB 1X3UA 4RAZA 4R8HA 2GXBA 1J7KA 2BOLA 1OLTA 1G3YA 1TC3C 4M71A 2YPRA 5K1YA 2WB1N 3LSPA 2BY1A 2VC1A 3PQJA 5BNGA 3HL2A 2H27A 1Y8RB 4IHTA 1X1AA 1PUEE 2CV1A 3CCQI 2YX7A 1W4MA 3PO3J 2GXGA 2XGXA 3TQNA 3P7NA 5LHGA 1MZBA 4QIWN 4L9TA 2OAZA 1BI2A 1DQUA 3CDLA 1WJEA 2NNNA 1T38A 2DA1A 4GYIA 1G3TA 2V26A 2XV4S 1MSFC 2VPRA 5D6FA 5LBQA 4RB1A 1WJBA 1WSUA 3E1SA 3KPHA 4B43A 1NK2P 3NAUA 1HW2A 2ZJRF 3QP6A 2OZ6A 5CQEA 1XS9A 1TNTA 3BQYA 4A5MA 4HOBA 3ZPLA 2X85A 3OV8A 4A3JJ 3ZP5A 4CDGA 4XQFA 4UXNA 3LMMA 4PGHA 3SEQA 1TTYA 2QQBA 1FOYA 3J7ZI 1EH6A 2VJJA 3JW4A 4YG2F 1ZAOA 4ZYEA 5GP9A 4UB6C 3IAM2 3GX4X 3KLOA 2GLOA 3KIOA 2VE9A 2ZXIA 3FDYA 5DYMA 4G7ZF 3S1MJ 2JSCA 2Y75A 1MD0A 1R36A 2DODA 2XRNA 2CJJA 2GAUA 2JPBA 1KU9A 1ZGJA 1X1CA 4LOCA 2HOAA 4KIGA 1LPQA 4V19K 3UKGA 2KMUA 1VZ0A 1YIJI 1PP8F 5M5YJ 3DEEA 2L02A 5HDNA 2FRHA 1EH8A 3OL3A 1VQ8I 1BA5A 4FISA 1TNSA 1VQ6I 3OYMA 3DTIA 1BI1A 2FA5A 2VXZA 3FZVA 4OIQF 1NHAA 3SDBA 3HPGA 3RKXA 2LK2A 4NC7A 2FOWA 1VQLI 4MNUA 2VUMJ 3GFMA 3OIOA 4I0BA 3WG9A 3L1PA 2M4KA 3K9TA 3BT9A 4PSWA 4YEJA 1BW5A 4HPQA 1JT6A 3I55I 3KP2A 3WGGA 3BQZA 2M2EA 1ZQ3P 3PM1A 5F08A 3HC7A 4C30A 2DJNA 5LLQA 2R5YA 1FP2A 4OAYA 1A36A 4N9HA 4FE7A 1FX7A 4AIKA 2OCCH 1BJZA 1HSTA 1R6RA 4KMUX 2NVUB 5C3EJ 1SEUA 1W5TA 3RKYA 4CYCA 1FNNA 4GO1A 3T0YA 3V42A 4DBRA 2KL4A 4BL0B 1Y56A 4I7HA 4BDYA 1YIOA 1PYVA 2UXXA 3LSTA 2GWRA 3CMMA 5E1WA 3M7GA 3K4MA 3KZZA 2PN6A 3F9KA 1QZEA 1WJDA 1Z21A 3PIOF 5DD4A 4BJ6C 2AHQA 2CFXA 5BS6A 1BI3A 2LSOA 3ZN1A 1F1ZA 2Z3YA 2D5VA 2MYSA 3CO6C 3K4NA 3CDHA 3OYEA 5FRNA 2HYJA 2NRAC 4WCGA 2EFQA 4EGYA 4M3EA 2XPUA 5GPAA 1EKEA 1K78A 4YIFA 3MCZA 3T8RA 1APLC 4B1RA 2FF4A 4MEXF 3SQNA 2ICWG 3ABKH 4EQQA 3A2KA 3EUHC 2W57A 1LEBA 1EH7A 2OCEA 1RPWA 4E4HA 2E2JJ 1GV2A 4UV8A 2FXAA 2WBMA 2DT5A 4O6JA 3IP4B 2M30A 3D5SC 2JJ7A 3VYRB 3ZQIA 5LGUA 1BBYA 3H36A 4V2FA 1FYLA 2FU4A 2L2OA 4A2UA 4RGRA 5FKOA 5HNHA 2CW0F 3K4JA 3TOBA 2EIMH 5B1AH 1OQYA 1FWZA 2PQ8A 1SAUA 4ESBA 2JUGA 3BTLA 3CUQC 4BY7J 3HOZJ 4YRVA 4RB2C 4BU2A 4EJWA 4HV6A 2HOTA 4XSXF 5J3LA 3FF5A 3ZXSA 1W36C 1EF4A 2E5ZA 2GOXB 1YRNA 2XAQA 2CS3A 3G3ZA 3VSKA 4BH9A 1BW6A 2M4GA 1BIAA 2CUJA 2IJLA 4XOTA 1Z3YA 3JRDA 1SMYF 2KZVA 2CO5A 4BEHA 5IOZA 5EG0A 5JLXA 5GTHC 4NQWB 4F55A 5CQGA 3SZPA 1R5GA 4XOPA 1LKXA 1Z3XA 3OYDA 3MZ8A 4YFKF 1MBGA 1P4AA 2Q8KA 4HF1A 1YG2A 2R7SA 4E7KA 2YUSA 2KDZA 2M34A 2JN6A 3ZMDA 2DOEA 2LBFA 1UHWA 3M1CA 1W0UA 5FJ8J 2GOMA 4A3MJ 2R5ZB 1IZ1A 2NYXA 2PX9A 4B4CA 2WAEA 4BE0A 3KYDB 1MGTA 3AG4H 5J1RA 5E1ZB 1T33A 4M9XA 4M3FA 3GTMJ 1S8NA 1XMAA 2J5PA 2R7FA 3BCBA 2VQLA 3NWTA 5D6EA 2QEXI 5TRDA 3ZMZA 4LG3A 4NHJA 3F0CA 4ENNA 4IHSA 1BC7C 3TDUC 2CGPA 1PP7U 4ZDOA 5JHUA 5CVJA 2DTZA 2RDPA 4BQAA 1SD7A 1XD7A 1TBXA 2LVSA 4ESFA 1FEXA 2IGNA 3DPTA 1W1WE 1D0YA 4B8XA 4A0ZA 3WE2A 5IYBJ 3BPXA 3C18A 4C3JJ 1OPCA 4XLAA 1G3WA 3MEXA 3FXLA 1E3OC 4P1WA 2IS6A 2HVQA 3RSNA 2EZIA 1SANA 4RGXA 3H9QA 4QTRA 3OYLA 4FHTA 4ITVA 4PSXA 2O8XA 1UG0A 1LFPA 2HTJA 1QGPA 5KHDA 2BVMA 4BS9A 2DMPA 2V1XA 3QOPA 4DZJA 5EEAA 2HQRA 2X1DA 4MHGA 2M8GX 3DBLB 1I6XA 1OMIA 4JP0A 3L2VA 5FLXZ 2BXYA 3TP3A 2H8RA 4L9VA 4U88A 4XSZF 4DZPA 5TGTA 4XKBA 4BJ5C 2RVCA 5D8KB 3QWLA 4CH7A 3E0JB 2ZMEA 5JHFA 2BHZA 5GADJ 1O3QA 4HNUA 1ONVA 2DQRA 3Q3SA 4G7HF 3MKLA 2JA7J 2XGDA 3X2QH 4AIHA 2VJIA 4HRIA 2MC4A 1YO5C 1K6YA 5KCMA 4M74A 3CC7I 4FETA 3H35A 1IUFA 5EEHA 1DUXC 4CO8A 1S7OA 3BP8A 3FXRA 4CZZA 2L7FP 3OS1A 2IGMA 2LH9A 4BKXA 3K4KA 3ZQHA 1UG2A 4UVAA 4IRGA 3S14J 4PJNA 4G6DA 1T98A 3BZKA 2W24A 3IC7A 3A1YA 2R7RA 1WJFA 1UJ8A 5LGNA 2KLOA 2LKPA 1ZKGA 3K6GA 2HZDA 1BI0A 3GFJA 1VQKI 1I1SA 3FXMA 4L9NA 4G6QA 5D5VB 3G71I 1G59A 4CCKA 1YW8A 2GA1A 1RIOH 4AUXA 3P9KA 1SFOJ 3D5LA 1XGMA 2QENA 2PFBA 2ECBA 2LF8A 4HBLA 2W7NA 2NVXJ 4PGGA 1ZELA 1YJNI 1LQ1A 1VTNC 4CCMA 3GO5A 2O9LA 1OYIA 2Z33A 1H9GA 4MQ9F 1U0JA 4R79A 3C3WA 1S9HA 1TWCJ 3K69A 3S2HJ 2ZB9A 4Y7NJ 3S1NJ 2VKHA 3LSKA 1YFHA 1KGSA 4IHXA 3DWLE 1D5VA 3ABTA 1ZG3A 1IXRC 2EFOA 1OYYA 2KIQA 4IQJA 1G4DA 5H6RA 4G6TB 4I98B 3K70C 1BL0A 1VNDA 2DA2A 3M8FA 4KN4X 4G7OF 4XLEA 3CJTB 3UR3C 4YELA 4KIFA 3CMAI 3I71A 2MLKA 3GTKJ 1J0RA 3WU2C 1N78A 1BIBA 2HFHA 4A3IJ 2R93J 2VT3A 2HQ5A 3F8CA 3IKVA 5DEQA 3C1DA 1IW7F 3S1RJ 2CUEA 2HWVA 4CCOA 2OD5A 3MVPA 3WU0A 4S04A 3GF2A 4NNJA 1FTTA 1QPMA 2J5OA 1UHMA 2KFDA 4EM1A 1PUFB 3UNGC 3C2HA 4ZYAA 1LDDA 2L4MA 2HDDA 2VQGA 4MIMA 3I3LA 2F4IA 2K5CA 1U6GA 5KAFC 5JI6A 2FUG2 3EUAA 3PSFA 2LY9A 4HA8A 2VLAA 4A6DA 5LD2C 2BEOA 1F36A 3HSFA 5FFZA 2M9HA 1ORKA 4U0YA 3RPUD 3TO6A 1P7JA 1FMVA 1FC3A 1ZRDA 5HLTA 2HTSA 3Q5FA 2XGEA 1IV8A 4PJMA 1I50J 4OU0A 2JTVA 1ACIA 2ME6A 3F3XA 3H0GJ 2M1BA 3L00A 3RPUA 4LFUA 5EDNA 4A3LJ 3KYCB 2E7WA 2OTJI 1K61A 3ASNH 3OYAA 1B72B 1MDMB 4MGRA 3CF2A 4UVBA 2FJ1A 4WXCA 4S0HB 5DDGA 1X2NA 4XLHA 4QPOA 2VT2A 5IOYA 4UUSB 5KK1A 2L9SA 3MFKA 1MNEA 2W48A 3GTOJ 2DA4A 3KEYA 3FHNA 3K4LA 1SC7A 1ZGWA 2RNJA 1U9OA 3U1DA 1QU3A 1YRNB 4HEA2 2KISA 1KQ9A 2V6EA 3HOTA 3OYJA 2R7WA 4BEHB 4ZZLA 3CESA 5EG0B 1SVLA 4KITB 3S3MA 1QZZA 3FKJA 4NC6A 1CGPA 3RZOJ 3DF8A 5FFXA 4LB6B 1Z7LA 2PMZN 4NBQA 2COMA 1SD5A 2Y2ZA 1MSEC 3IWFA 3OYFA 2W00A 2RV8A 2ZJPF 3WU1B 4OIOF 1ON2A 3QPSA 1JE8A 3ZQ7A 3B02A 2XC7A 3U9GA 2ZNYA 3WTSC 5L3GA 2LBFB 3GTLJ 3AL0C 1IO2A 5AIQA 1D8JA 3GTPJ 4FQGA 2ZMEC 2QQAA 1R71A 4BHBA 2DFIA 2LDUA 3CLOA 1VQ5I 3EQLF 4C2TA 1IN4A 1OYWA 2Y69H 2Y48A 2ZJ2A 2YSRA 2VBWA 4HNVA 4GRIA 1FBQA 1FSHA 1K4SA 1FBSA 1Y1VJ 4HLYA 1K79A 5K5RA 1D1BA 2FD5A 3TMOA 4FTHA 4PFOA 3FK7A 3LNQA 1S7EA 2W85A 1TWHJ 4K2EA 4MLOA 2F4MB 2BY3A 2MGQA 4F93B 4RM2A 2IW5A 3EETA 4HQEA 3I64A 2W82A 1JGSA 4D7MA 1QPIA 3DEUA 3CCUI 3FXOA 1RR7A 5IYDJ 3ESWB 5HS7A 2XSJC 1OCPA 1LDJA 3ERED 2JWTA 3E5UA 3J80Z 4XRFA 2F5DA 2XKOA 3HKZN 3KP4A 5D4SA 4NQWA 4ENMA 2ZFWA 2O7OA 3OYGA 4BGDA 4BDZA 4XNFA 4HDVA 2E2HJ 2K9MA 2R0QC 1X58A 1X3WB 2JK3A 3BR6A 4GXOA 1DP7P 2K3FA 2X6YA 1JI8A 2L7KA 3F8NA 2BHYA 4Y52J 4DYRA 3Q9VA 3L09A 5LFAA 4MQVA 2IEKA 2VBYA 1N75A 4WF2A 4N4OB 3OS0A 1OKRA 3L2CA 3TO7A 2HU9A 3ZN0A 2STWA 2R5ZA 3CCEI 2QKMB 2NXNB 3E6DA 3MMYB 5E79C 4Z2YA 3GTQJ 3GZ6A 2VC0A 3VWBA 4KDPA 5KVRA 2DBBA 3W2WA 3CCJI 1JTXA 1TWFJ 2DTRA 3EPZA 2QA4I 5K7ZA 5JVGF 4E7JA 2Z1DA 2O03A 5BPDA 1YW7A 4A3GJ 5LEKA 3V8JA 2OQGA 2ETHA 5ILVA 2Q2EB 1R4NB 4CZCA 2KPMA 4GDFA 2KKOA 2HNHA 5IPAA 5E3OA 1SD4A 3D1NI 5C44J 1K6OA 1OCTC 1VQPI 2WAQA 3DBRB 1ON1A 4W97A 1K83J 1VQ9I 1ZK8A 4IKFA 1ZRFA 3SHFA 2EA4A 1FTZA 4C2UA 1X4PA 1ZH5A 1MBFA 2H09A 1WI3A 2DJIA 4A0YA 4BYYA 1E2XA 3E3VA 4WX9A 3HOVJ 4E70A 2MW8A 2UV1A 3F6OA 5L3DA 4EVIA 2E60A 3HEFA 4F91B 1AKHB 4I6ZA 1J09A 1W5SA 4BQNA 1Y39A 2E19A 1ENHA 5JR3A 2QVOA 2DA5A 5ICEA 1FOKA 2VODA 3FBIB 2DOAA 4FCYA 3BR0A 4RGSA 1XMXA 3MKZA 3CLQA 2IP2A 1H88C 4OAZA 2EV0A 2F4OB 3BR1A 1WHUA 1O3RA 2ISYA 1RI7A 4DGWB 3PO2J 4A3BJ 3G2BA 1XCVA 4ETSA 1G2HA 4HV5A 3EYIA 3WHCA 4XMYA 5HDGA 2JRMA 4I2OA 2EFNA 2OF7A 1U8BA 1N25A 2E35A 5DTDA 2FE3A 3FIWA 2CQKA 3SZTA 4A0XA 4LB5A 3HGGA 1PJRA 2E34A 4MO7A 4UV9A 2NVQJ 2QKLB 4JX5A 4ZYHA 1ERDA 3PSIA 2VPLA 1J75A 2LNBA 4M3BA 2ELHA 1T6SA 4MTDA 4XR6A 2A5YB 4MTEA 5IP9J 2JA8J 1JKOC 1QO0D 2XAJA 4XICA 1Z6RA 5DUIA 1JUSA 5FKMA 1IF1A 5ICGA 3GMEA 3MZYA 5EGOB 1IJWC 4XKWA 1OR7A 2NNYA 2H1KA 4UNOA 2HXOA 1DP3A 4EGZA 1X1DA 3Q0UA 2DYRH 1QQIA 4F52A 2CFOA 3IH4A 2K9LA 4RLQA 2LTPA 5IT9Z 2OU2A 1W5CC 3LSHA 1BOAA 5GAHJ 1ZN2A 3CP2A 2QBYB 4MFEA 4M73A 3S1QJ 4D0PA 3ONQA 4N0BA 2AQFA 2DMNA 1SVMA 2L01A 4XKVA 1HW5A 3HPHA 1VQOI 5M5WJ 2MABA 2BGCA 4M72A 4AIJA 2HKXA 3GBGA 5HLHA 1DU0A 3ZOBA 3QYEA 5DCMB 1QVTA 4CSWA 1R5ID 3MWMA 2Z16A 1NG6A 2IA2A 3QOEA 3PIPF 1QHHD 2HDWA 2LOOA 1IUYA 2CQNA 4XL9A 4YIRX 2Y0MA 3SZGA 1ZLKA 3S17J 3D0SA 3M9AA 1IN7A 2BVLA 2IA0A 1V3FA 4E6KG 5A2QZ 1LVKA 3S16J 4DYCA 5HLGA 3TW7A 5CPRB 2EBIA 1KU3A 2M7BA 4M6XA 1ODDA 5BPIA 1ETKA 2CW7A 2E1NA 5JVTA 4FX4A 3MAJA 5F0FA 3K4CA 4BY1J 3VOEA 2ZCWA 3FM3A 5HLIA 3I54A 2GQQA 1I39A 1MBHA 2DCEA 9ANTA 1O57A 1JHHA 1MJ9A 2XB5A 1PUFA 3DV8A 3ZMVA 5HODA 3J7AO 2L4AA 3BG5A 1GT0C 2XB0X 3LSMA 4X1EA 2RREA 4B3XA 3Q0WA 5ILSA 1CQTA 3IH3A 3BY6A 2CQQA 4HF0A 4L9JA 3GTJJ 2XHKA 4C3IJ 3GYHX 1JXSA 2IA1A 1AA7A 1O7LA 2KDOA 3VDXA 1FOXA 3K70D 1HA8A 1ZYRF 3A02A 1OCRH 1WZ2A 1JTYA 3R0JA 2OUMA 1IXCA 1D3YA 1B4AA 2LY1A 2PJRB 2XASA 4MFDA 3SYTA 4OIPF 1SFXA 2PG4A 3DU5A 1HXDA 4HNTA 1UAAA 4Q48A 2M3AA 5IYCJ 1YLFA 1R58A 4KN7X 3W6JB 2FQ4A 2P0WA 4RM3A 2E71A 2F2EA 2K9SA 2X1EA 3GWZA 1B72A 1MDMA 5J4YA 4IX7A 1XSVA 2P8TA 2Q1ZB 2D1HA 1ZR4A 3CCRI 1JKRC 4ABZA 3R60A 3LOCA 4OWRB 4UUSA 3HUGB 4GGGA 1TQIA 3CTAA 1R00A 3OL4A 5E8GA 1GVDA 2DA6A 3WTXC 1MMGA 1KYZA 3ZQQA 5GTIC 4BHPA 5F0CA 2ID3A 3MZHA 2G7UA 2ELJA 4A3EJ 3QYFA 1BOBA 3BROA 4LD5A 2P5LC 3CO7C 3HHGA 4HLXA 4M9ZA 2ZKZA 1A6IA 1V4RA 2VOPA 1BR2A 4XLPF 3PNTA 3S8PA 4AVZA 1WRJA 3IL2A 1VQNI 2O6GE 2BYVE 4LK0F 2MC3A 2QSFX 3H9JA 3CCVI 3K2ZA 3OR2C 4KISA 1ULYA 1KA8A 1YS6A 3H5RA 4A5NA 1VFCA 1A31A 1G3SA 2IS1A 3LFKA 5DM6F 2M0MA 2ZXJA 2LP0A 2ELKA 1B9MA 1JKPC 1AU7A 3O2PE 4N4NB 1D1CA 3C2GA 3B73A 3BWGA 3A4CA 3QODA 1F43A 3QU3A 2DLLA 5KNLA 2F5EA 2L5QA 1LE8B 4D9JA 1DDNA 2G7HA 1KYWA 2G9WA 1IAWA 1FLIA 3WODF 3KFWX 3NQOA 2DYSH 1TQPA 2OC6A 2JUCA 3BG3A 2L9NA 5M3FJ 5H2FC 3L2WA 2ADUA 4A12A 2V7FA 1Y6IA 1IGNA 4QWQA 4BXFA 2HOSA 3LQRA 1HKQA 1UFMA 3BR2A 2VASA 1RNLA 2CH0A 4IXAA 1ZLJA 2D1VA 2ZJQF 2HI3A 2UUZA 1E3PA 2IBDA 3DKYA 2FEZA 4OOIA 5AONA 1Z6TA 3F6VA 1P6RA 1OR7C 4I01A 3L9FA 2Y31A 3OY9A 2HQNA 2L9VA 3H0DA 1ITYA 2MD0A 2VKVA 5HNFA 2BXZA 4Y3OA 4D1QA 1WH5A 3T1BA 1ZTRA 5LRRA 4M6VA 2CYYA 4CCNA 3OYBA 3HOXJ 1B6AA 2KHMA 2R7DA 2V9PA 3RKWA 2R7TA 2QSHX 1FMWA 2A69F 1UELB 4HX7A 4LMYA 3WHBA 1GUUA 2P6TA 1NH3A 2K02A 2ZO4A 3LAPA 2E1CA 4IHYA 4CCJA 1R1UA 3FISA 2OV7A 4HX4A 1OCZH 2KIUA 2OA4A 2A3SA 3IKTA 2L7MP 1VF9A 1I27A 5B3SH 3BTCA 5K5QA 1H8AC 5L3EA 2BBYA 4V2GA 5LRSA 5HOOA 3G73A 1MIJA 3DU6A 2ZSIB 2O61A 1F9NA 3ROUA 1OCCH 3DCFA 4NUBA 2WC2A 3WG7H 2WAFA 4AM3A 4JYKA 2Q2EA 3RYPA 3A01B 2K9QA 1BJAA 2XIGA 2KJBA 3JR9A 1DPUA 3GLLA 3VYUB 4C3HJ 2R7XA 2QWWA 1B8IB 2DT6A 3BOQA 1FJLA 3FMQA 2ZBKA 4PFPA 1J2XA 3I56I 1RRJA 4IHVA 3HM5A 3BJAA 4HW0A 4F7ZA 5CLSA 1AOYA 3G1MA 2GIVA 2V79A 2KIMA 2WWYA 2A05A 4ESJA 4I76A 1HOMA 5H20A 4U0WA 5LHIA 2QCOA 3OSFA 1UMQA 2IGKA 1KQ8A 3ZMTA 1AKHA 1SFKA 4L5IA 4AU7A 1E17A 2MD5A 3CC2I 2R7VA 2EV5A 3H3VK 4JBAA 4YFXF 3GZNB 2O0YA 3I58A 3E6CC 1IRZA 4HX8A 2MA3A 1R4MB 3PNYA 4ZTJA 1Q1VA 1YTYA 2X0LA 2YU3A 3DTKA 3G1OA 5ILUA 4JOMA 3FMRA 1O4XA 2ID6A 3LSIA 3FHZA 1QRYA 3PUFA 1ZRCA 2P6SA 2D45A 3IUOA 2XRLA 3C7JA 2KQRA 1E0EA 3I4PA 4W1UA 2CG4A 1P9QC 3F23A 3JTHA 1U5TB 1USSA 2LREA 2IS4A 3JRGA 3S93A 2B0LA 3DPUA 3CC4I 1HKSA 5J8CA 1R1TA 4D5FA 1IC8A 1GHCA 1IN8A 3LSJA 3P9CA 4HF2A 3O3KA 1T0FA 3LAJA 3H3UA 1EA3A 5EGOA 1C0WA 2FNPA 2XAFA 4MEYF 4U87A 2B7EA 2BW3B 4J00A 3IAS2 1X4OA 1Z1DA 4P5OA 2CRGA 3JAMK 3KEQA 1K4TA 3ZQGA 3ZQCA 3M3YJ 5K5OA 3LA7A 3JCUC 2PEXA 2ESNA 2M7AA 4N9IA 5C4XJ 4JK1X 3KP5A 3QU6A 2QBYA 2YU9J 2L3DA 2JT1A 2HKOA 4LK1F 2DMQA 3HTSB 2QLZA 5LEJA 4CICA 1U3EM 4XRMA 2NS0A 3GVAA 5EYRA 3W6KB 5DCMA 3FWEA 4EM2A 4HAMA 4BBRJ 3ASOH 4J01A 4RA2A 3RQ4A 5CKTA 3ULQB 4IZZA 1WKMA 1SD6A 1TL8A 3OOUA 4B09A 3H92A 2JVGA 3HOYJ 4Z6YA 4M9SA 2V9VA 3L2UA 2ACJA 3W3CA 2QUFA 1TW3A 1QHGA 4BE2A 4B44A 1RUNA 4Q47A 2KIFA 1RR8C 1KQ0A 3T5XA 2BE5F 1OISA 2GA2A 2H94A 3FM5A 5J1UA 2F5FA 2C6YA 2K85A 5F6FA 3U21A 5BMZA 2K27A 1H89C 2TCTA 1Z7UA 5DUKA 2LFBA 4RAFA 1Y8QB 3FK6A 5LGTA 4BJTA 2XAHA 4NDLA 4NB5A 4QSHA 3WTZA 3TO9A 1DGWY 5AIPA 2EIKH 3F21A 4PK4A 2RC4A 3O8HA 2E1MC 5FKLA 1R5HA 1LUJB 1LEAA 3W2VA 2LD5A 3BZ6A 1G8XA 4D7NA 2XSDC 2MBFA 3CZ6A 3JRAA 2XPWA 3OMYA 2F48A 1XGSA 4XBFA 4BUPA 5HVQC 5J4VA 1TLHB 4XRSA 1WWXA 3K2AA 4EJVA 5D5WB 1KONA 2NAZA 5LHHA 1YHQI 2DT7B 1T95A 3S2WA 1YJWI 2OZUA 4XM3A 2L9RA 1EJ9A 2PJRA 2BY2A 4KYWA 2QQ8A 3V8LA 2I10A 3LQQA 4LG0B 3DPLC 3ML6A 3ZQLA 5EJCA 2A5WA 3V7SA 5L3FA 1SVOA 3SFZA 4WK8F 2JA6J 5E20A 2HVSA 1Z0XA 1RKWA 3WTWC 4BE1A 4ZJZA 3GTGJ 1R1VA 5GPCA 4J19A 2E5NA 2GIZA 2IXSA 1RZ4A 1W7PB 2R7QA 4G9YA 4LITA 4LLGF 3JRCA 3HUGA 4L5JA 2Y0SA 3W2AA 2F5VA 5E1XA 3IRRA 2QZ8A 4D5CA 1S3JA 3DP7A 3AKZA 1YJ9I 1MMSA 3HJEA 4WXHA 3J7AY 3FXKA 5B1BH 3SXYA 1HBXG 1ZREA 1MKMA 2LKXA 2QF7A 3AFHA 2Z5UA 3LFUA 4XIDA 1POGA 2RKHA 4CXFA 4XLNF 2WV0A 5CVIA 1X3ZB 2E1MB 4IQ4A 2JZYA 1XX5A 4ZZDA 2VXDA 1XCBA 4PCQA 5CJ9A 5F1RA 5M5XJ 3CCLI 3H5NA 4AC0A 1DGRM 3N4MA 2IT0A 2X9DA 2FBIA 5D8LB 3RZDJ 2RGVA 2V4JC 3RCOA 2HQAA 1HW1A 1GDTA 4DNCA 4L0YB 3CCSI 3S2DJ 3T8TA 3F8MA 1LE8A 1X1PA 4JX4A 2A68F 5DD8A 2O8KA 3ZQFA 4DJAA 5TJJA 4XK4A 4A3CJ 5DS9A 2GXAA 2PJPA 3AAFA 1E3HA 2XUBA 4AYBN 2K4JA 3V7CA 2UXNA 5E3NA 1F5TA 2L54A 4Y17A 4PUSA 1R9TJ 4IPAA 1G6NA 4IEJA 3JSOA 3ZR8X 4KNYA 5IP7J 2HPMA 1T0FC 2RNGA 5DM7F 2DMTA 2QGUA 4XONA 2JA2A 3B6CA 1LFUP 4Y13A 3S15J 2ECCA 3QP5A 3DQVC 4ZTFA 3DFGA 4QLCU 1X19A 4AVPA 1J5YA 2CQXA 2Y9YA 5FROA 4RAGA 5FLMJ 1X2MA 1MMAA 3L2RA 1FYKA 3I4MJ 2R7ZJ 4UB8C 2A61A 4A3DJ 3I53A 2WB1A 3GFLA 1O7FA 3HGYA 3JREA 1XTAA 3SFIA 2LYCA 2HVRA 4OIRF 2ZC2A 5E18F 2VKEA 5F0HA 1F4KA 3BR3A 1M1EB 1UZCA 2JMWA 2VQHA 4RB0A 3JAMZ 4O5VA 5ICCA 4AD9A 2XDVA 5H6QA 3E97A 1YX5A 1JUMA 1WPKA 4Q5SF 3AG1H 2OJED 3KZYA 1Z05A 1IRXA 2F6CA 1I3AA 3S3OA 2AO9A 2YR2A 5BOXA 1RC9A 2H8WA 2P7VB 3LA3A 1SFEA 1ZG1A 3VSLA 1P7IA 1SMTA 4P9UA 2P5KA 2WA0A 2Z9OA 3ISPA 2Z99A 4QPQA 4HSRA 1U9NA 2MH9A 3R61A 4EEFG 4KMFA 3A0HC 2VONA 2KRCA 2FMLA 1XSDA 2FMYA 1SFUA 2P4WA 2NVYJ 2W4SA 4Y4RA 4IVNA 3A01A 3GZ5A 2EIJH 1Q1HA 1DU6A 4EJOA 1HCRA 2DQLA 1B8IA 2VKDA 3HOUJ 2K9NA 4E7HA 4PJ0C 2AS5F 5GAEJ 1XGNA 3OIPA 2DK5A 3FKIJ 2EZHA 2M8EA 2B63J 4CHUA 1WCMJ 1YW9A 3DKWA 2KRHA 1XSXA 2ZXHA 2UWMA 2JPCA 2VL8A 4H4KC 4U7DA 4RB3C 3OYIA 2KJCA 3G4SI 3K1MA 4FX0A 1MNDA 1FBUA 1IDZA 4GYGA 3OSGA 2V9KA 1VQ7I 3TGNA 3A03A 4PDKA 4IOAF 3HZJA 3OIQA 4XLFA 4XORA 1HC8A 3CJNA 2R4GA 3KE2A 3QQAA 1VQ4I 2FX0A 4R1HA 2XGCA 3SJMA 5DV5A 5FLXK 2EZLA 2OBPA 5B66C 2VE8A 1HDDC 3HB9A 4KT6A 1TZLA 2DW4A 4S05A 1B59A 5FLVA 4P96A 2LKSA 3TEDA 2MG4A 4HSTA 1R23A 2ME0A 1KU7A 2EB7A 3VPRA 1R49A 2DN0A 3GFIA 4KA4A 4HZFA 1U5TA 2XKPA 2DOFA 3H3ZA 4UUVA 1TW2A 4RS8A 3GLXA 1S6LA 2HDCA 4ZYDA 2DA7A 3N05A 4O3MA 2LF7A 2HXIA 2EK5A 4LGWA 1T39A 3ABLH 4XN0A 2JA5J 1L3LA 3L2QA 3K1PA 2IRFG 5FD6A 3FX3A 4GCVA 4F92B 1WH7A 1WQ2A 3RPQA 1T56A 3BG6A 2RQPA 4E7LA 5JFRA 2XF5A 2M87A 1XGOA 1CF7B 5IP6A 2BW3A 4A69C 3CCYA 2HPIA 3HXLA 4RBOA 2IPQX 4WWCA 4CGZA 4EV0A 1AWCA 2PMUA 3I59A 3U1KA 4DIQA 2OQRA 3FXJA 3V4GA 3KETA 1GV5A 1YQAA 3PL8A 1HKTA 1O3SA 5FGMA 2HYGD 5EZGA 2NS7A 2IAIA 3CUOA 2VN2A 3BG7A 2O5RA 4E7IA 2VBZA 3CDIA 3OYNA 4P9FA 1X1BA 3M4OJ 1NG7A 1GXQA 3KYLA 1MBJA 1I5ZA 2VOOA 1UB9A 4C2MJ 4B3AA 1JUPA 2O3FA 2R3SA 1A04A 4RGUA 1AHDP 1KU2A 4OMZA 3COAC 3KZIC 4L0ZB 3VEPA 1J9IA 1R22A 4IL6C 2MFZA 3K0LA 5F1JA 4ZDLA 3HRMA 2FOKA 4BXXJ 3AG2H 2W1OA 2V1DA 2HEOA 2CQ7A 3S3NA 3L7WA 4JX6A 2X1CA 2QM3A 3HIFA 2E7XA 4KJZA 4U7BA 3RQIA 1FIPA 3RI4A 2AXLA 1V5FA 2ZNZA 2XAGA 3EDPA 3JRIA 4XN3A 3IRQA 3NEUA 4A93J 2H1LA 3JRFA 4A3KJ 2VJ5A 3I5UA 2P7CB 5E17F 3R0AA 1IDYA 1VI0A 2MLGA 2H6BA 4DYQA 1KZHA 3DTEA 3MD2A 4EATA 3E7LA 3DXJF 3KCCA 4KICA 2CW8A 1ETQA 3HHHA 3DLAA 1IN6A 3G1LA 2RQQA 4M3DA 4KUMA 1HF0A 1FOWA 3NRVA 3BLYA 3BJOA 3TL4X 5J6XA 1U2WA 1YOVB 4EM0B 2HR3A 5FD5A 1S5LC 3P9IA 1W7PD 3H1CA 1T2KA 1IXSB 3C2BA 4RDUA 3N97A 3KP6A 4LG0A 1VQMI 4I09A 2EPFA 4IJAA 5K7HA 3BR5A 1HSJA 4AIDA 2JSPA 3F8BA 1ETYA 1FYMA 1TWGJ 1W7PA 1WI9A 2M5WA 3M1EA 5F04A 3OYHA 3BJ6A 3HDDA 1W0TA 3A0BC 4ENKA 1T8IA 2D2WA 2FBHA 1H9TA 3GUDA 2DA3A 2ZSHB 1U8RA 2DPDA 3IWZA 2DMUA 4BACA 2X6WA 2FNAA 2RAEA 4A6EA 3E5XA 5CVRA 1JHFA 3KEOA 2DXIA 1T08B 2EH3A 1WFXA 2R7OA 4KT5C 3CD6I 1QVUA 1RETA 2ISZA 2JQ7A 2B9SA 2MSYA 3CUQB 2L0KA 3F22A 1D5YA 3K1NA 1I1GA 5DCFA 4BQQA 2TRTA 3U2RA 5ICFA 2OPTA 4OINF 1IRGA 3BZCA 1FIAA 1LFBA 2EFPA 3WE3A 5CVVA 2A6TA 2HGCA 4IRHA 4IHWA 2DO7A 2K4BA 3VFZA 5L3BA 1TWAJ 1GLNA 2KT0A 3BTJA 1XG1A 1USTA 4DOZA 4B48A 3KX2A
chains in the Genus database with same CATH topology
1MIJA 2LMDA 1XPXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MIJ A;  2LMD A;  1XPX A; 
#chains in the Genus database with same CATH topology
 1S29 A;  4XRS G;  2XRO A;  3K10 A;  1K7A A;  3WTU C;  1ETX A;  1S7A A;  1XMK A;  2KRF A;  1D0X A;  3E5Q A;  4CYD A;  2G0E A;  2EQR A;  1L0O C;  5D5U B;  1LB2 A;  1OCO H;  1I3Q J;  3PFY A;  3CJR B;  1R7J A;  4Y33 A;  5FO5 A;  1XDS A;  5K7F A;  2EZK A;  3I4N J;  4EJU A;  3QPL A;  1MJB A;  2E36 A;  2IGO A;  3AG3 H;  3M8J A;  3RYR A;  1U5T C;  2DI3 A;  1FY7 A;  1S72 I;  5F27 A;  3JRH A;  2DFH A;  1GVJ A;  1MBE A;  2WV1 A;  1WJA A;  1MNM C;  2KZG A;  1A5J A;  2W84 A;  3VOD A;  4IOC F;  4C9Y A;  5D4R A;  2EA2 A;  3WGH A;  4CUG A;  3OYK A;  4BXU A;  3ZCO A;  5FKN A;  4ASN A;  4BBS J;  2F5C A;  5EZH A;  3HG9 A;  3J81 K;  3ECO A;  1QBJ A;  4PZJ A;  2WAD A;  1D1A A;  4ZH4 F;  3O6B B;  2K86 A;  1B1B A;  2H6C A;  4A3F J;  3QPH A;  1PVE A;  4IF4 A;  4BQO A;  1JT0 A;  1YE9 A;  4RMN A;  4WXD A;  5E3L A;  1MMN A;  4I02 A;  5E3M A;  2DFE A;  3J80 K;  1JGG A;  4E7Z A;  4JQF A;  2BZT A;  3E6B A;  4RAY A;  3LA2 A;  5HS9 A;  1PDN C;  1RES A;  2JRT A;  3K4B A;  3OWT A;  5KAI C;  1Y1W J;  3TW6 A;  4PJL A;  4P55 A;  1FT9 A;  1IG7 A;  3K7A J;  3QAH A;  2TDX A;  5CVU A;  3H5A A;  4BAY A;  3CF5 F;  2WY8 Q;  2RN7 A;  4M3G A;  1RUO A;  2N8G A;  2BV6 A;  1QNT A;  1WVR A;  4M6Y A;  1MH3 A;  3R6S A;  3VYT B;  1LVA A;  2R92 J;  3CME I;  2FSW A;  3PFI A;  4E7S A;  1XB4 A;  4UVC A;  3MKY B;  3Q9S A;  2IVM A;  3H9G A;  1SAX A;  4AWX B;  2NS8 A;  1FZP B;  2K40 A;  3KLN A;  4L18 B;  4I0A A;  2HS5 A;  3HRT A;  4ON0 A;  1MBK A;  1UHS A;  3LL7 A;  1ZAR A;  3BG9 A;  1GXP A;  3KP3 A;  3LWF A;  5EF6 A;  1FP1 D;  2CUF A;  2LY2 A;  3O8G A;  3NAR A;  4NC8 A;  4ANJ A;  2X4H A;  5J1Y A;  3V8K A;  1ETO A;  4LIU A;  2I8D A;  1BR4 A;  5J40 A;  4FAS D;  2R5Y B;  2PMH A;  1ZHF A;  2DU9 A;  3HOS A;  2EJR A;  3S32 A;  4CYC B;  2DK8 A;  1XPX A;  4G94 A;  2M45 A;  2M0C A;  4YII A;  1Z91 A;  1REP C;  4FT8 A;  2LRD A;  3I59 B;  5JLW A;  3ABU A;  3OOP A;  1IV6 A;  2JVH A;  2CUZ A;  5FRM A;  1P92 A;  5FB2 A;  3P5J A;  2V6C A;  3J7Y J;  3RIR A;  3Q0V A;  3D5R C;  2XVC A;  1Z9C A;  2QQ9 A;  1TP4 A;  2STT A;  4CCL A;  4FE4 A;  4HDU A;  1MH4 A;  4CA0 A;  2PI0 A;  1NK3 P;  5E8I A;  2P5V A;  4HYE A;  2A07 F;  2XAU A;  2DFF A;  1XC5 A;  3GW2 A;  4GFB A;  1ETV A;  3GXO A;  1A35 A;  1V55 H;  2LG4 A;  2E2I J;  2EIN H;  3HYI A;  4DQ2 A;  1K78 B;  2LR8 A;  2DPU A;  1RKT A;  1BC8 C;  1ETW A;  2YS9 A;  2DAO A;  3HRS A;  2LLK A;  3LSG A;  1XDU A;  2ZXW H;  3TOA A;  2L7Z A;  3ZGK A;  2Y30 A;  3OS2 A;  1HDP A;  2XF6 A;  2VBX A;  3MN2 A;  4Q4Z F;  2Q0O A;  3ZMS A;  4EMS A;  1B9N A;  1JJ8 C;  4UY8 I;  1EV7 A;  3R4K A;  2ZFU A;  3LSR A;  1FPQ A;  1WJ5 A;  2IS2 A;  1ZGA A;  3OYC A;  3QRF F;  2LMD A;  2W25 A;  4DW6 A;  2HOE A;  3IV5 A;  1A6Q A;  1U78 A;  4II3 A;  2VQC A;  4XLC A;  1BM9 A;  4X6A J;  3JRB A;  1CF7 A;  2XF7 A;  1ZR2 A;  5F64 A;  2OTL I;  2K7L A;  3PJR A;  3HOW J;  3FXQ A;  3I9V 2;  4LJZ F;  2AQE A;  1LNW A;  4L5E A;  4HG2 A;  2NOG A;  1D0Z A;  2CWE A;  2XPV A;  5IT3 A;  3I0T A;  4HQM A;  4F3Q A;  2UZK A;  3ELK A;  1LJ9 A;  3DKX A;  3BPV A;  4H0E A;  4EJT A;  2PMZ A;  4BNC A;  3IHU A;  4I99 C;  3TKY A;  2CMP A;  5BQT A;  1H0M A;  5IT9 K;  1V5G A;  3HRU A;  2VB6 A;  2QYO A;  1MW7 A;  5C4J J;  1N77 A;  3F72 A;  4RLF A;  2CV0 A;  3GEZ A;  1YIT I;  4LLN A;  2A6E F;  2V1N A;  1TT0 A;  2FBK A;  5FKK A;  2HYF A;  4UHT A;  3M8E A;  2VI6 A;  3W6V A;  3KP7 A;  1P2F A;  3REO A;  4OMY A;  3PNV A;  1P4W A;  3GCM A;  1J59 A;  1Z67 A;  4XKC A;  2EWN A;  1V5E A;  2VJ4 A;  3VYS B;  6PAX A;  2I5U A;  1JKQ C;  5L3C A;  1Y0U A;  4B47 A;  3HSE A;  2MH2 A;  4II2 A;  3SEZ A;  4ZYG A;  2COB A;  3FBN B;  4Y15 A;  5HDK A;  2FQ3 A;  3BCA A;  1ZG5 A;  3SDG A;  3M07 A;  4PJJ A;  5A2Q K;  2E1O A;  1XN7 A;  1Z77 A;  2GZW A;  1OJL A;  2WTE A;  3MQ0 A;  4ZDP A;  3PUB A;  2AXT C;  2CU7 A;  2VIX A;  3CCM I;  4KIB A;  4ENJ A;  2ESH A;  1JJ6 C;  3EYY A;  5ED4 A;  2X51 A;  3RKQ A;  2DDB A;  2X6O A;  1QZY A;  3HSR A;  1YI2 I;  1I6H J;  1FSE A;  3VB2 A;  1IN5 A;  3HKZ A;  2Y0S N;  5J47 A;  3J81 Z;  1WJC A;  1YYV A;  3CQZ J;  5HS8 A;  2QSG X;  1UCR A;  1TT5 B;  1YX3 A;  5TIS C;  2GBY A;  3QYB A;  3TBI A;  3RJP A;  3ZRG A;  5J8F A;  1D8K A;  3CJQ B;  3E6M A;  1HLV A;  3TDZ C;  3RDI A;  4TV7 A;  4KFC A;  2K3P A;  3CMY A;  4G8X A;  1STZ A;  3ZMU A;  3WTY C;  3ERM A;  3G6E I;  4DBQ A;  2EV6 A;  2X6X A;  1P4X A;  4U0V A;  2NVT J;  1O3T A;  5EEG A;  4IRI A;  2PLY A;  3EUK L;  2WY7 Q;  1BR1 A;  2Y9Z A;  3FMS A;  1DPR A;  3ECH A;  3HTU A;  2Z2S B;  3EUH A;  4IO9 F;  1TQM A;  5D5X B;  1V54 H;  3AL0 B;  2HZT A;  4AYB A;  3JSP A;  3ABM H;  3B6A A;  2A6H F;  3BC8 A;  2ZME B;  5M3M J;  3WTV C;  3FXU A;  3V7R A;  2X48 A;  2P81 A;  1LDK B;  5IY5 H;  5CYV A;  4UUT A;  1MJA A;  4ZC3 A;  2LC2 A;  1MMD A;  1W36 D;  3QPT A;  3WTT C;  2YX4 A;  1NTC A;  2CV2 A;  2R7U A;  1BN5 A;  3DLL F;  1WGX A;  3CP8 A;  3F8F A;  3CUQ A;  3MKW B;  1YS7 A;  3HBL A;  3NWS A;  4YFN F;  1QA6 A;  2DDA A;  2V1U A;  4LLL A;  2EIL H;  2PBI A;  2NOJ B;  5GAG J;  1HQC A;  1Y0N A;  3JTG A;  3DEW A;  2KP6 A;  3RTR A;  2WAQ N;  2CSO A;  2GM4 A;  3OR1 C;  3WGI A;  5B5E C;  3BTI A;  2EFW A;  1OFC X;  3BDD A;  3TP0 A;  2BY0 A;  4LIV A;  4X0G A;  4G12 A;  1IRF A;  5ERI A;  4BHC A;  3IH2 A;  3PQK A;  3DBH B;  1X3U A;  4RAZ A;  4R8H A;  2GXB A;  1J7K A;  2BOL A;  1OLT A;  1G3Y A;  1TC3 C;  4M71 A;  2YPR A;  5K1Y A;  2WB1 N;  3LSP A;  2BY1 A;  2VC1 A;  3PQJ A;  5BNG A;  3HL2 A;  2H27 A;  1Y8R B;  4IHT A;  1X1A A;  1PUE E;  2CV1 A;  3CCQ I;  2YX7 A;  1W4M A;  3PO3 J;  2GXG A;  2XGX A;  3TQN A;  3P7N A;  5LHG A;  1MZB A;  4QIW N;  4L9T A;  2OAZ A;  1BI2 A;  1DQU A;  3CDL A;  1WJE A;  2NNN A;  1T38 A;  2DA1 A;  4GYI A;  1G3T A;  2V26 A;  2XV4 S;  1MSF C;  2VPR A;  5D6F A;  5LBQ A;  4RB1 A;  1WJB A;  1WSU A;  3E1S A;  3KPH A;  4B43 A;  1NK2 P;  3NAU A;  1HW2 A;  2ZJR F;  3QP6 A;  2OZ6 A;  5CQE A;  1XS9 A;  1TNT A;  3BQY A;  4A5M A;  4HOB A;  3ZPL A;  2X85 A;  3OV8 A;  4A3J J;  3ZP5 A;  4CDG A;  4XQF A;  4UXN A;  3LMM A;  4PGH A;  3SEQ A;  1TTY A;  2QQB A;  1FOY A;  3J7Z I;  1EH6 A;  2VJJ A;  3JW4 A;  4YG2 F;  1ZAO A;  4ZYE A;  5GP9 A;  4UB6 C;  3IAM 2;  3GX4 X;  3KLO A;  2GLO A;  3KIO A;  2VE9 A;  2ZXI A;  3FDY A;  5DYM A;  4G7Z F;  3S1M J;  2JSC A;  2Y75 A;  1MD0 A;  1R36 A;  2DOD A;  2XRN A;  2CJJ A;  2GAU A;  2JPB A;  1KU9 A;  1ZGJ A;  1X1C A;  4LOC A;  2HOA A;  4KIG A;  1LPQ A;  4V19 K;  3UKG A;  2KMU A;  1VZ0 A;  1YIJ I;  1PP8 F;  5M5Y J;  3DEE A;  2L02 A;  5HDN A;  2FRH A;  1EH8 A;  3OL3 A;  1VQ8 I;  1BA5 A;  4FIS A;  1TNS A;  1VQ6 I;  3OYM A;  3DTI A;  1BI1 A;  2FA5 A;  2VXZ A;  3FZV A;  4OIQ F;  1NHA A;  3SDB A;  3HPG A;  3RKX A;  2LK2 A;  4NC7 A;  2FOW A;  1VQL I;  4MNU A;  2VUM J;  3GFM A;  3OIO A;  4I0B A;  3WG9 A;  3L1P A;  2M4K A;  3K9T A;  3BT9 A;  4PSW A;  4YEJ A;  1BW5 A;  4HPQ A;  1JT6 A;  3I55 I;  3KP2 A;  3WGG A;  3BQZ A;  2M2E A;  1ZQ3 P;  3PM1 A;  5F08 A;  3HC7 A;  4C30 A;  2DJN A;  5LLQ A;  2R5Y A;  1FP2 A;  4OAY A;  1A36 A;  4N9H A;  4FE7 A;  1FX7 A;  4AIK A;  2OCC H;  1BJZ A;  1HST A;  1R6R A;  4KMU X;  2NVU B;  5C3E J;  1SEU A;  1W5T A;  3RKY A;  4CYC A;  1FNN A;  4GO1 A;  3T0Y A;  3V42 A;  4DBR A;  2KL4 A;  4BL0 B;  1Y56 A;  4I7H A;  4BDY A;  1YIO A;  1PYV A;  2UXX A;  3LST A;  2GWR A;  3CMM A;  5E1W A;  3M7G A;  3K4M A;  3KZZ A;  2PN6 A;  3F9K A;  1QZE A;  1WJD A;  1Z21 A;  3PIO F;  5DD4 A;  4BJ6 C;  2AHQ A;  2CFX A;  5BS6 A;  1BI3 A;  2LSO A;  3ZN1 A;  1F1Z A;  2Z3Y A;  2D5V A;  2MYS A;  3CO6 C;  3K4N A;  3CDH A;  3OYE A;  5FRN A;  2HYJ A;  2NRA C;  4WCG A;  2EFQ A;  4EGY A;  4M3E A;  2XPU A;  5GPA A;  1EKE A;  1K78 A;  4YIF A;  3MCZ A;  3T8R A;  1APL C;  4B1R A;  2FF4 A;  4MEX F;  3SQN A;  2ICW G;  3ABK H;  4EQQ A;  3A2K A;  3EUH C;  2W57 A;  1LEB A;  1EH7 A;  2OCE A;  1RPW A;  4E4H A;  2E2J J;  1GV2 A;  4UV8 A;  2FXA A;  2WBM A;  2DT5 A;  4O6J A;  3IP4 B;  2M30 A;  3D5S C;  2JJ7 A;  3VYR B;  3ZQI A;  5LGU A;  1BBY A;  3H36 A;  4V2F A;  1FYL A;  2FU4 A;  2L2O A;  4A2U A;  4RGR A;  5FKO A;  5HNH A;  2CW0 F;  3K4J A;  3TOB A;  2EIM H;  5B1A H;  1OQY A;  1FWZ A;  2PQ8 A;  1SAU A;  4ESB A;  2JUG A;  3BTL A;  3CUQ C;  4BY7 J;  3HOZ J;  4YRV A;  4RB2 C;  4BU2 A;  4EJW A;  4HV6 A;  2HOT A;  4XSX F;  5J3L A;  3FF5 A;  3ZXS A;  1W36 C;  1EF4 A;  2E5Z A;  2GOX B;  1YRN A;  2XAQ A;  2CS3 A;  3G3Z A;  3VSK A;  4BH9 A;  1BW6 A;  2M4G A;  1BIA A;  2CUJ A;  2IJL A;  4XOT A;  1Z3Y A;  3JRD A;  1SMY F;  2KZV A;  2CO5 A;  4BEH A;  5IOZ A;  5EG0 A;  5JLX A;  5GTH C;  4NQW B;  4F55 A;  5CQG A;  3SZP A;  1R5G A;  4XOP A;  1LKX A;  1Z3X A;  3OYD A;  3MZ8 A;  4YFK F;  1MBG A;  1P4A A;  2Q8K A;  4HF1 A;  1YG2 A;  2R7S A;  4E7K A;  2YUS A;  2KDZ A;  2M34 A;  2JN6 A;  3ZMD A;  2DOE A;  2LBF A;  1UHW A;  3M1C A;  1W0U A;  5FJ8 J;  2GOM A;  4A3M J;  2R5Z B;  1IZ1 A;  2NYX A;  2PX9 A;  4B4C A;  2WAE A;  4BE0 A;  3KYD B;  1MGT A;  3AG4 H;  5J1R A;  5E1Z B;  1T33 A;  4M9X A;  4M3F A;  3GTM J;  1S8N A;  1XMA A;  2J5P A;  2R7F A;  3BCB A;  2VQL A;  3NWT A;  5D6E A;  2QEX I;  5TRD A;  3ZMZ A;  4LG3 A;  4NHJ A;  3F0C A;  4ENN A;  4IHS A;  1BC7 C;  3TDU C;  2CGP A;  1PP7 U;  4ZDO A;  5JHU A;  5CVJ A;  2DTZ A;  2RDP A;  4BQA A;  1SD7 A;  1XD7 A;  1TBX A;  2LVS A;  4ESF A;  1FEX A;  2IGN A;  3DPT A;  1W1W E;  1D0Y A;  4B8X A;  4A0Z A;  3WE2 A;  5IYB J;  3BPX A;  3C18 A;  4C3J J;  1OPC A;  4XLA A;  1G3W A;  3MEX A;  3FXL A;  1E3O C;  4P1W A;  2IS6 A;  2HVQ A;  3RSN A;  2EZI A;  1SAN A;  4RGX A;  3H9Q A;  4QTR A;  3OYL A;  4FHT A;  4ITV A;  4PSX A;  2O8X A;  1UG0 A;  1LFP A;  2HTJ A;  1QGP A;  5KHD A;  2BVM A;  4BS9 A;  2DMP A;  2V1X A;  3QOP A;  4DZJ A;  5EEA A;  2HQR A;  2X1D A;  4MHG A;  2M8G X;  3DBL B;  1I6X A;  1OMI A;  4JP0 A;  3L2V A;  5FLX Z;  2BXY A;  3TP3 A;  2H8R A;  4L9V A;  4U88 A;  4XSZ F;  4DZP A;  5TGT A;  4XKB A;  4BJ5 C;  2RVC A;  5D8K B;  3QWL A;  4CH7 A;  3E0J B;  2ZME A;  5JHF A;  2BHZ A;  5GAD J;  1O3Q A;  4HNU A;  1ONV A;  2DQR A;  3Q3S A;  4G7H F;  3MKL A;  2JA7 J;  2XGD A;  3X2Q H;  4AIH A;  2VJI A;  4HRI A;  2MC4 A;  1YO5 C;  1K6Y A;  5KCM A;  4M74 A;  3CC7 I;  4FET A;  3H35 A;  1IUF A;  5EEH A;  1DUX C;  4CO8 A;  1S7O A;  3BP8 A;  3FXR A;  4CZZ A;  2L7F P;  3OS1 A;  2IGM A;  2LH9 A;  4BKX A;  3K4K A;  3ZQH A;  1UG2 A;  4UVA A;  4IRG A;  3S14 J;  4PJN A;  4G6D A;  1T98 A;  3BZK A;  2W24 A;  3IC7 A;  3A1Y A;  2R7R A;  1WJF A;  1UJ8 A;  5LGN A;  2KLO A;  2LKP A;  1ZKG A;  3K6G A;  2HZD A;  1BI0 A;  3GFJ A;  1VQK I;  1I1S A;  3FXM A;  4L9N A;  4G6Q A;  5D5V B;  3G71 I;  1G59 A;  4CCK A;  1YW8 A;  2GA1 A;  1RIO H;  4AUX A;  3P9K A;  1SFO J;  3D5L A;  1XGM A;  2QEN A;  2PFB A;  2ECB A;  2LF8 A;  4HBL A;  2W7N A;  2NVX J;  4PGG A;  1ZEL A;  1YJN I;  1LQ1 A;  1VTN C;  4CCM A;  3GO5 A;  2O9L A;  1OYI A;  2Z33 A;  1H9G A;  4MQ9 F;  1U0J A;  4R79 A;  3C3W A;  1S9H A;  1TWC J;  3K69 A;  3S2H J;  2ZB9 A;  4Y7N J;  3S1N J;  2VKH A;  3LSK A;  1YFH A;  1KGS A;  4IHX A;  3DWL E;  1D5V A;  3ABT A;  1ZG3 A;  1IXR C;  2EFO A;  1OYY A;  2KIQ A;  4IQJ A;  1G4D A;  5H6R A;  4G6T B;  4I98 B;  3K70 C;  1BL0 A;  1VND A;  2DA2 A;  3M8F A;  4KN4 X;  4G7O F;  4XLE A;  3CJT B;  3UR3 C;  4YEL A;  4KIF A;  3CMA I;  3I71 A;  2MLK A;  3GTK J;  1J0R A;  3WU2 C;  1N78 A;  1BIB A;  2HFH A;  4A3I J;  2R93 J;  2VT3 A;  2HQ5 A;  3F8C A;  3IKV A;  5DEQ A;  3C1D A;  1IW7 F;  3S1R J;  2CUE A;  2HWV A;  4CCO A;  2OD5 A;  3MVP A;  3WU0 A;  4S04 A;  3GF2 A;  4NNJ A;  1FTT A;  1QPM A;  2J5O A;  1UHM A;  2KFD A;  4EM1 A;  1PUF B;  3UNG C;  3C2H A;  4ZYA A;  1LDD A;  2L4M A;  2HDD A;  2VQG A;  4MIM A;  3I3L A;  2F4I A;  2K5C A;  1U6G A;  5KAF C;  5JI6 A;  2FUG 2;  3EUA A;  3PSF A;  2LY9 A;  4HA8 A;  2VLA A;  4A6D A;  5LD2 C;  2BEO A;  1F36 A;  3HSF A;  5FFZ A;  2M9H A;  1ORK A;  4U0Y A;  3RPU D;  3TO6 A;  1P7J A;  1FMV A;  1FC3 A;  1ZRD A;  5HLT A;  2HTS A;  3Q5F A;  2XGE A;  1IV8 A;  4PJM A;  1I50 J;  4OU0 A;  2JTV A;  1ACI A;  2ME6 A;  3F3X A;  3H0G J;  2M1B A;  3L00 A;  3RPU A;  4LFU A;  5EDN A;  4A3L J;  3KYC B;  2E7W A;  2OTJ I;  1K61 A;  3ASN H;  3OYA A;  1B72 B;  1MDM B;  4MGR A;  3CF2 A;  4UVB A;  2FJ1 A;  4WXC A;  4S0H B;  5DDG A;  1X2N A;  4XLH A;  4QPO A;  2VT2 A;  5IOY A;  4UUS B;  5KK1 A;  2L9S A;  3MFK A;  1MNE A;  2W48 A;  3GTO J;  2DA4 A;  3KEY A;  3FHN A;  3K4L A;  1SC7 A;  1ZGW A;  2RNJ A;  1U9O A;  3U1D A;  1QU3 A;  1YRN B;  4HEA 2;  2KIS A;  1KQ9 A;  2V6E A;  3HOT A;  3OYJ A;  2R7W A;  4BEH B;  4ZZL A;  3CES A;  5EG0 B;  1SVL A;  4KIT B;  3S3M A;  1QZZ A;  3FKJ A;  4NC6 A;  1CGP A;  3RZO J;  3DF8 A;  5FFX A;  4LB6 B;  1Z7L A;  2PMZ N;  4NBQ A;  2COM A;  1SD5 A;  2Y2Z A;  1MSE C;  3IWF A;  3OYF A;  2W00 A;  2RV8 A;  2ZJP F;  3WU1 B;  4OIO F;  1ON2 A;  3QPS A;  1JE8 A;  3ZQ7 A;  3B02 A;  2XC7 A;  3U9G A;  2ZNY A;  3WTS C;  5L3G A;  2LBF B;  3GTL J;  3AL0 C;  1IO2 A;  5AIQ A;  1D8J A;  3GTP J;  4FQG A;  2ZME C;  2QQA A;  1R71 A;  4BHB A;  2DFI A;  2LDU A;  3CLO A;  1VQ5 I;  3EQL F;  4C2T A;  1IN4 A;  1OYW A;  2Y69 H;  2Y48 A;  2ZJ2 A;  2YSR A;  2VBW A;  4HNV A;  4GRI A;  1FBQ A;  1FSH A;  1K4S A;  1FBS A;  1Y1V J;  4HLY A;  1K79 A;  5K5R A;  1D1B A;  2FD5 A;  3TMO A;  4FTH A;  4PFO A;  3FK7 A;  3LNQ A;  1S7E A;  2W85 A;  1TWH J;  4K2E A;  4MLO A;  2F4M B;  2BY3 A;  2MGQ A;  4F93 B;  4RM2 A;  2IW5 A;  3EET A;  4HQE A;  3I64 A;  2W82 A;  1JGS A;  4D7M A;  1QPI A;  3DEU A;  3CCU I;  3FXO A;  1RR7 A;  5IYD J;  3ESW B;  5HS7 A;  2XSJ C;  1OCP A;  1LDJ A;  3ERE D;  2JWT A;  3E5U A;  3J80 Z;  4XRF A;  2F5D A;  2XKO A;  3HKZ N;  3KP4 A;  5D4S A;  4NQW A;  4ENM A;  2ZFW A;  2O7O A;  3OYG A;  4BGD A;  4BDZ A;  4XNF A;  4HDV A;  2E2H J;  2K9M A;  2R0Q C;  1X58 A;  1X3W B;  2JK3 A;  3BR6 A;  4GXO A;  1DP7 P;  2K3F A;  2X6Y A;  1JI8 A;  2L7K A;  3F8N A;  2BHY A;  4Y52 J;  4DYR A;  3Q9V A;  3L09 A;  5LFA A;  4MQV A;  2IEK A;  2VBY A;  1N75 A;  4WF2 A;  4N4O B;  3OS0 A;  1OKR A;  3L2C A;  3TO7 A;  2HU9 A;  3ZN0 A;  2STW A;  2R5Z A;  3CCE I;  2QKM B;  2NXN B;  3E6D A;  3MMY B;  5E79 C;  4Z2Y A;  3GTQ J;  3GZ6 A;  2VC0 A;  3VWB A;  4KDP A;  5KVR A;  2DBB A;  3W2W A;  3CCJ I;  1JTX A;  1TWF J;  2DTR A;  3EPZ A;  2QA4 I;  5K7Z A;  5JVG F;  4E7J A;  2Z1D A;  2O03 A;  5BPD A;  1YW7 A;  4A3G J;  5LEK A;  3V8J A;  2OQG A;  2ETH A;  5ILV A;  2Q2E B;  1R4N B;  4CZC A;  2KPM A;  4GDF A;  2KKO A;  2HNH A;  5IPA A;  5E3O A;  1SD4 A;  3D1N I;  5C44 J;  1K6O A;  1OCT C;  1VQP I;  2WAQ A;  3DBR B;  1ON1 A;  4W97 A;  1K83 J;  1VQ9 I;  1ZK8 A;  4IKF A;  1ZRF A;  3SHF A;  2EA4 A;  1FTZ A;  4C2U A;  1X4P A;  1ZH5 A;  1MBF A;  2H09 A;  1WI3 A;  2DJI A;  4A0Y A;  4BYY A;  1E2X A;  3E3V A;  4WX9 A;  3HOV J;  4E70 A;  2MW8 A;  2UV1 A;  3F6O A;  5L3D A;  4EVI A;  2E60 A;  3HEF A;  4F91 B;  1AKH B;  4I6Z A;  1J09 A;  1W5S A;  4BQN A;  1Y39 A;  2E19 A;  1ENH A;  5JR3 A;  2QVO A;  2DA5 A;  5ICE A;  1FOK A;  2VOD A;  3FBI B;  2DOA A;  4FCY A;  3BR0 A;  4RGS A;  1XMX A;  3MKZ A;  3CLQ A;  2IP2 A;  1H88 C;  4OAZ A;  2EV0 A;  2F4O B;  3BR1 A;  1WHU A;  1O3R A;  2ISY A;  1RI7 A;  4DGW B;  3PO2 J;  4A3B J;  3G2B A;  1XCV A;  4ETS A;  1G2H A;  4HV5 A;  3EYI A;  3WHC A;  4XMY A;  5HDG A;  2JRM A;  4I2O A;  2EFN A;  2OF7 A;  1U8B A;  1N25 A;  2E35 A;  5DTD A;  2FE3 A;  3FIW A;  2CQK A;  3SZT A;  4A0X A;  4LB5 A;  3HGG A;  1PJR A;  2E34 A;  4MO7 A;  4UV9 A;  2NVQ J;  2QKL B;  4JX5 A;  4ZYH A;  1ERD A;  3PSI A;  2VPL A;  1J75 A;  2LNB A;  4M3B A;  2ELH A;  1T6S A;  4MTD A;  4XR6 A;  2A5Y B;  4MTE A;  5IP9 J;  2JA8 J;  1JKO C;  1QO0 D;  2XAJ A;  4XIC A;  1Z6R A;  5DUI A;  1JUS A;  5FKM A;  1IF1 A;  5ICG A;  3GME A;  3MZY A;  5EGO B;  1IJW C;  4XKW A;  1OR7 A;  2NNY A;  2H1K A;  4UNO A;  2HXO A;  1DP3 A;  4EGZ A;  1X1D A;  3Q0U A;  2DYR H;  1QQI A;  4F52 A;  2CFO A;  3IH4 A;  2K9L A;  4RLQ A;  2LTP A;  5IT9 Z;  2OU2 A;  1W5C C;  3LSH A;  1BOA A;  5GAH J;  1ZN2 A;  3CP2 A;  2QBY B;  4MFE A;  4M73 A;  3S1Q J;  4D0P A;  3ONQ A;  4N0B A;  2AQF A;  2DMN A;  1SVM A;  2L01 A;  4XKV A;  1HW5 A;  3HPH A;  1VQO I;  5M5W J;  2MAB A;  2BGC A;  4M72 A;  4AIJ A;  2HKX A;  3GBG A;  5HLH A;  1DU0 A;  3ZOB A;  3QYE A;  5DCM B;  1QVT A;  4CSW A;  1R5I D;  3MWM A;  2Z16 A;  1NG6 A;  2IA2 A;  3QOE A;  3PIP F;  1QHH D;  2HDW A;  2LOO A;  1IUY A;  2CQN A;  4XL9 A;  4YIR X;  2Y0M A;  3SZG A;  1ZLK A;  3S17 J;  3D0S A;  3M9A A;  1IN7 A;  2BVL A;  2IA0 A;  1V3F A;  4E6K G;  5A2Q Z;  1LVK A;  3S16 J;  4DYC A;  5HLG A;  3TW7 A;  5CPR B;  2EBI A;  1KU3 A;  2M7B A;  4M6X A;  1ODD A;  5BPI A;  1ETK A;  2CW7 A;  2E1N A;  5JVT A;  4FX4 A;  3MAJ A;  5F0F A;  3K4C A;  4BY1 J;  3VOE A;  2ZCW A;  3FM3 A;  5HLI A;  3I54 A;  2GQQ A;  1I39 A;  1MBH A;  2DCE A;  9ANT A;  1O57 A;  1JHH A;  1MJ9 A;  2XB5 A;  1PUF A;  3DV8 A;  3ZMV A;  5HOD A;  3J7A O;  2L4A A;  3BG5 A;  1GT0 C;  2XB0 X;  3LSM A;  4X1E A;  2RRE A;  4B3X A;  3Q0W A;  5ILS A;  1CQT A;  3IH3 A;  3BY6 A;  2CQQ A;  4HF0 A;  4L9J A;  3GTJ J;  2XHK A;  4C3I J;  3GYH X;  1JXS A;  2IA1 A;  1AA7 A;  1O7L A;  2KDO A;  3VDX A;  1FOX A;  3K70 D;  1HA8 A;  1ZYR F;  3A02 A;  1OCR H;  1WZ2 A;  1JTY A;  3R0J A;  2OUM A;  1IXC A;  1D3Y A;  1B4A A;  2LY1 A;  2PJR B;  2XAS A;  4MFD A;  3SYT A;  4OIP F;  1SFX A;  2PG4 A;  3DU5 A;  1HXD A;  4HNT A;  1UAA A;  4Q48 A;  2M3A A;  5IYC J;  1YLF A;  1R58 A;  4KN7 X;  3W6J B;  2FQ4 A;  2P0W A;  4RM3 A;  2E71 A;  2F2E A;  2K9S A;  2X1E A;  3GWZ A;  1B72 A;  1MDM A;  5J4Y A;  4IX7 A;  1XSV A;  2P8T A;  2Q1Z B;  2D1H A;  1ZR4 A;  3CCR I;  1JKR C;  4ABZ A;  3R60 A;  3LOC A;  4OWR B;  4UUS A;  3HUG B;  4GGG A;  1TQI A;  3CTA A;  1R00 A;  3OL4 A;  5E8G A;  1GVD A;  2DA6 A;  3WTX C;  1MMG A;  1KYZ A;  3ZQQ A;  5GTI C;  4BHP A;  5F0C A;  2ID3 A;  3MZH A;  2G7U A;  2ELJ A;  4A3E J;  3QYF A;  1BOB A;  3BRO A;  4LD5 A;  2P5L C;  3CO7 C;  3HHG A;  4HLX A;  4M9Z A;  2ZKZ A;  1A6I A;  1V4R A;  2VOP A;  1BR2 A;  4XLP F;  3PNT A;  3S8P A;  4AVZ A;  1WRJ A;  3IL2 A;  1VQN I;  2O6G E;  2BYV E;  4LK0 F;  2MC3 A;  2QSF X;  3H9J A;  3CCV I;  3K2Z A;  3OR2 C;  4KIS A;  1ULY A;  1KA8 A;  1YS6 A;  3H5R A;  4A5N A;  1VFC A;  1A31 A;  1G3S A;  2IS1 A;  3LFK A;  5DM6 F;  2M0M A;  2ZXJ A;  2LP0 A;  2ELK A;  1B9M A;  1JKP C;  1AU7 A;  3O2P E;  4N4N B;  1D1C A;  3C2G A;  3B73 A;  3BWG A;  3A4C A;  3QOD A;  1F43 A;  3QU3 A;  2DLL A;  5KNL A;  2F5E A;  2L5Q A;  1LE8 B;  4D9J A;  1DDN A;  2G7H A;  1KYW A;  2G9W A;  1IAW A;  1FLI A;  3WOD F;  3KFW X;  3NQO A;  2DYS H;  1TQP A;  2OC6 A;  2JUC A;  3BG3 A;  2L9N A;  5M3F J;  5H2F C;  3L2W A;  2ADU A;  4A12 A;  2V7F A;  1Y6I A;  1IGN A;  4QWQ A;  4BXF A;  2HOS A;  3LQR A;  1HKQ A;  1UFM A;  3BR2 A;  2VAS A;  1RNL A;  2CH0 A;  4IXA A;  1ZLJ A;  2D1V A;  2ZJQ F;  2HI3 A;  2UUZ A;  1E3P A;  2IBD A;  3DKY A;  2FEZ A;  4OOI A;  5AON A;  1Z6T A;  3F6V A;  1P6R A;  1OR7 C;  4I01 A;  3L9F A;  2Y31 A;  3OY9 A;  2HQN A;  2L9V A;  3H0D A;  1ITY A;  2MD0 A;  2VKV A;  5HNF A;  2BXZ A;  4Y3O A;  4D1Q A;  1WH5 A;  3T1B A;  1ZTR A;  5LRR A;  4M6V A;  2CYY A;  4CCN A;  3OYB A;  3HOX J;  1B6A A;  2KHM A;  2R7D A;  2V9P A;  3RKW A;  2R7T A;  2QSH X;  1FMW A;  2A69 F;  1UEL B;  4HX7 A;  4LMY A;  3WHB A;  1GUU A;  2P6T A;  1NH3 A;  2K02 A;  2ZO4 A;  3LAP A;  2E1C A;  4IHY A;  4CCJ A;  1R1U A;  3FIS A;  2OV7 A;  4HX4 A;  1OCZ H;  2KIU A;  2OA4 A;  2A3S A;  3IKT A;  2L7M P;  1VF9 A;  1I27 A;  5B3S H;  3BTC A;  5K5Q A;  1H8A C;  5L3E A;  2BBY A;  4V2G A;  5LRS A;  5HOO A;  3G73 A;  1MIJ A;  3DU6 A;  2ZSI B;  2O61 A;  1F9N A;  3ROU A;  1OCC H;  3DCF A;  4NUB A;  2WC2 A;  3WG7 H;  2WAF A;  4AM3 A;  4JYK A;  2Q2E A;  3RYP A;  3A01 B;  2K9Q A;  1BJA A;  2XIG A;  2KJB A;  3JR9 A;  1DPU A;  3GLL A;  3VYU B;  4C3H J;  2R7X A;  2QWW A;  1B8I B;  2DT6 A;  3BOQ A;  1FJL A;  3FMQ A;  2ZBK A;  4PFP A;  1J2X A;  3I56 I;  1RRJ A;  4IHV A;  3HM5 A;  3BJA A;  4HW0 A;  4F7Z A;  5CLS A;  1AOY A;  3G1M A;  2GIV A;  2V79 A;  2KIM A;  2WWY A;  2A05 A;  4ESJ A;  4I76 A;  1HOM A;  5H20 A;  4U0W A;  5LHI A;  2QCO A;  3OSF A;  1UMQ A;  2IGK A;  1KQ8 A;  3ZMT A;  1AKH A;  1SFK A;  4L5I A;  4AU7 A;  1E17 A;  2MD5 A;  3CC2 I;  2R7V A;  2EV5 A;  3H3V K;  4JBA A;  4YFX F;  3GZN B;  2O0Y A;  3I58 A;  3E6C C;  1IRZ A;  4HX8 A;  2MA3 A;  1R4M B;  3PNY A;  4ZTJ A;  1Q1V A;  1YTY A;  2X0L A;  2YU3 A;  3DTK A;  3G1O A;  5ILU A;  4JOM A;  3FMR A;  1O4X A;  2ID6 A;  3LSI A;  3FHZ A;  1QRY A;  3PUF A;  1ZRC A;  2P6S A;  2D45 A;  3IUO A;  2XRL A;  3C7J A;  2KQR A;  1E0E A;  3I4P A;  4W1U A;  2CG4 A;  1P9Q C;  3F23 A;  3JTH A;  1U5T B;  1USS A;  2LRE A;  2IS4 A;  3JRG A;  3S93 A;  2B0L A;  3DPU A;  3CC4 I;  1HKS A;  5J8C A;  1R1T A;  4D5F A;  1IC8 A;  1GHC A;  1IN8 A;  3LSJ A;  3P9C A;  4HF2 A;  3O3K A;  1T0F A;  3LAJ A;  3H3U A;  1EA3 A;  5EGO A;  1C0W A;  2FNP A;  2XAF A;  4MEY F;  4U87 A;  2B7E A;  2BW3 B;  4J00 A;  3IAS 2;  1X4O A;  1Z1D A;  4P5O A;  2CRG A;  3JAM K;  3KEQ A;  1K4T A;  3ZQG A;  3ZQC A;  3M3Y J;  5K5O A;  3LA7 A;  3JCU C;  2PEX A;  2ESN A;  2M7A A;  4N9I A;  5C4X J;  4JK1 X;  3KP5 A;  3QU6 A;  2QBY A;  2YU9 J;  2L3D A;  2JT1 A;  2HKO A;  4LK1 F;  2DMQ A;  3HTS B;  2QLZ A;  5LEJ A;  4CIC A;  1U3E M;  4XRM A;  2NS0 A;  3GVA A;  5EYR A;  3W6K B;  5DCM A;  3FWE A;  4EM2 A;  4HAM A;  4BBR J;  3ASO H;  4J01 A;  4RA2 A;  3RQ4 A;  5CKT A;  3ULQ B;  4IZZ A;  1WKM A;  1SD6 A;  1TL8 A;  3OOU A;  4B09 A;  3H92 A;  2JVG A;  3HOY J;  4Z6Y A;  4M9S A;  2V9V A;  3L2U A;  2ACJ A;  3W3C A;  2QUF A;  1TW3 A;  1QHG A;  4BE2 A;  4B44 A;  1RUN A;  4Q47 A;  2KIF A;  1RR8 C;  1KQ0 A;  3T5X A;  2BE5 F;  1OIS A;  2GA2 A;  2H94 A;  3FM5 A;  5J1U A;  2F5F A;  2C6Y A;  2K85 A;  5F6F A;  3U21 A;  5BMZ A;  2K27 A;  1H89 C;  2TCT A;  1Z7U A;  5DUK A;  2LFB A;  4RAF A;  1Y8Q B;  3FK6 A;  5LGT A;  4BJT A;  2XAH A;  4NDL A;  4NB5 A;  4QSH A;  3WTZ A;  3TO9 A;  1DGW Y;  5AIP A;  2EIK H;  3F21 A;  4PK4 A;  2RC4 A;  3O8H A;  2E1M C;  5FKL A;  1R5H A;  1LUJ B;  1LEA A;  3W2V A;  2LD5 A;  3BZ6 A;  1G8X A;  4D7N A;  2XSD C;  2MBF A;  3CZ6 A;  3JRA A;  2XPW A;  3OMY A;  2F48 A;  1XGS A;  4XBF A;  4BUP A;  5HVQ C;  5J4V A;  1TLH B;  4XRS A;  1WWX A;  3K2A A;  4EJV A;  5D5W B;  1KON A;  2NAZ A;  5LHH A;  1YHQ I;  2DT7 B;  1T95 A;  3S2W A;  1YJW I;  2OZU A;  4XM3 A;  2L9R A;  1EJ9 A;  2PJR A;  2BY2 A;  4KYW A;  2QQ8 A;  3V8L A;  2I10 A;  3LQQ A;  4LG0 B;  3DPL C;  3ML6 A;  3ZQL A;  5EJC A;  2A5W A;  3V7S A;  5L3F A;  1SVO A;  3SFZ A;  4WK8 F;  2JA6 J;  5E20 A;  2HVS A;  1Z0X A;  1RKW A;  3WTW C;  4BE1 A;  4ZJZ A;  3GTG J;  1R1V A;  5GPC A;  4J19 A;  2E5N A;  2GIZ A;  2IXS A;  1RZ4 A;  1W7P B;  2R7Q A;  4G9Y A;  4LIT A;  4LLG F;  3JRC A;  3HUG A;  4L5J A;  2Y0S A;  3W2A A;  2F5V A;  5E1X A;  3IRR A;  2QZ8 A;  4D5C A;  1S3J A;  3DP7 A;  3AKZ A;  1YJ9 I;  1MMS A;  3HJE A;  4WXH A;  3J7A Y;  3FXK A;  5B1B H;  3SXY A;  1HBX G;  1ZRE A;  1MKM A;  2LKX A;  2QF7 A;  3AFH A;  2Z5U A;  3LFU A;  4XID A;  1POG A;  2RKH A;  4CXF A;  4XLN F;  2WV0 A;  5CVI A;  1X3Z B;  2E1M B;  4IQ4 A;  2JZY A;  1XX5 A;  4ZZD A;  2VXD A;  1XCB A;  4PCQ A;  5CJ9 A;  5F1R A;  5M5X J;  3CCL I;  3H5N A;  4AC0 A;  1DGR M;  3N4M A;  2IT0 A;  2X9D A;  2FBI A;  5D8L B;  3RZD J;  2RGV A;  2V4J C;  3RCO A;  2HQA A;  1HW1 A;  1GDT A;  4DNC A;  4L0Y B;  3CCS I;  3S2D J;  3T8T A;  3F8M A;  1LE8 A;  1X1P A;  4JX4 A;  2A68 F;  5DD8 A;  2O8K A;  3ZQF A;  4DJA A;  5TJJ A;  4XK4 A;  4A3C J;  5DS9 A;  2GXA A;  2PJP A;  3AAF A;  1E3H A;  2XUB A;  4AYB N;  2K4J A;  3V7C A;  2UXN A;  5E3N A;  1F5T A;  2L54 A;  4Y17 A;  4PUS A;  1R9T J;  4IPA A;  1G6N A;  4IEJ A;  3JSO A;  3ZR8 X;  4KNY A;  5IP7 J;  2HPM A;  1T0F C;  2RNG A;  5DM7 F;  2DMT A;  2QGU A;  4XON A;  2JA2 A;  3B6C A;  1LFU P;  4Y13 A;  3S15 J;  2ECC A;  3QP5 A;  3DQV C;  4ZTF A;  3DFG A;  4QLC U;  1X19 A;  4AVP A;  1J5Y A;  2CQX A;  2Y9Y A;  5FRO A;  4RAG A;  5FLM J;  1X2M A;  1MMA A;  3L2R A;  1FYK A;  3I4M J;  2R7Z J;  4UB8 C;  2A61 A;  4A3D J;  3I53 A;  2WB1 A;  3GFL A;  1O7F A;  3HGY A;  3JRE A;  1XTA A;  3SFI A;  2LYC A;  2HVR A;  4OIR F;  2ZC2 A;  5E18 F;  2VKE A;  5F0H A;  1F4K A;  3BR3 A;  1M1E B;  1UZC A;  2JMW A;  2VQH A;  4RB0 A;  3JAM Z;  4O5V A;  5ICC A;  4AD9 A;  2XDV A;  5H6Q A;  3E97 A;  1YX5 A;  1JUM A;  1WPK A;  4Q5S F;  3AG1 H;  2OJE D;  3KZY A;  1Z05 A;  1IRX A;  2F6C A;  1I3A A;  3S3O A;  2AO9 A;  2YR2 A;  5BOX A;  1RC9 A;  2H8W A;  2P7V B;  3LA3 A;  1SFE A;  1ZG1 A;  3VSL A;  1P7I A;  1SMT A;  4P9U A;  2P5K A;  2WA0 A;  2Z9O A;  3ISP A;  2Z99 A;  4QPQ A;  4HSR A;  1U9N A;  2MH9 A;  3R61 A;  4EEF G;  4KMF A;  3A0H C;  2VON A;  2KRC A;  2FML A;  1XSD A;  2FMY A;  1SFU A;  2P4W A;  2NVY J;  2W4S A;  4Y4R A;  4IVN A;  3A01 A;  3GZ5 A;  2EIJ H;  1Q1H A;  1DU6 A;  4EJO A;  1HCR A;  2DQL A;  1B8I A;  2VKD A;  3HOU J;  2K9N A;  4E7H A;  4PJ0 C;  2AS5 F;  5GAE J;  1XGN A;  3OIP A;  2DK5 A;  3FKI J;  2EZH A;  2M8E A;  2B63 J;  4CHU A;  1WCM J;  1YW9 A;  3DKW A;  2KRH A;  1XSX A;  2ZXH A;  2UWM A;  2JPC A;  2VL8 A;  4H4K C;  4U7D A;  4RB3 C;  3OYI A;  2KJC A;  3G4S I;  3K1M A;  4FX0 A;  1MND A;  1FBU A;  1IDZ A;  4GYG A;  3OSG A;  2V9K A;  1VQ7 I;  3TGN A;  3A03 A;  4PDK A;  4IOA F;  3HZJ A;  3OIQ A;  4XLF A;  4XOR A;  1HC8 A;  3CJN A;  2R4G A;  3KE2 A;  3QQA A;  1VQ4 I;  2FX0 A;  4R1H A;  2XGC A;  3SJM A;  5DV5 A;  5FLX K;  2EZL A;  2OBP A;  5B66 C;  2VE8 A;  1HDD C;  3HB9 A;  4KT6 A;  1TZL A;  2DW4 A;  4S05 A;  1B59 A;  5FLV A;  4P96 A;  2LKS A;  3TED A;  2MG4 A;  4HST A;  1R23 A;  2ME0 A;  1KU7 A;  2EB7 A;  3VPR A;  1R49 A;  2DN0 A;  3GFI A;  4KA4 A;  4HZF A;  1U5T A;  2XKP A;  2DOF A;  3H3Z A;  4UUV A;  1TW2 A;  4RS8 A;  3GLX A;  1S6L A;  2HDC A;  4ZYD A;  2DA7 A;  3N05 A;  4O3M A;  2LF7 A;  2HXI A;  2EK5 A;  4LGW A;  1T39 A;  3ABL H;  4XN0 A;  2JA5 J;  1L3L A;  3L2Q A;  3K1P A;  2IRF G;  5FD6 A;  3FX3 A;  4GCV A;  4F92 B;  1WH7 A;  1WQ2 A;  3RPQ A;  1T56 A;  3BG6 A;  2RQP A;  4E7L A;  5JFR A;  2XF5 A;  2M87 A;  1XGO A;  1CF7 B;  5IP6 A;  2BW3 A;  4A69 C;  3CCY A;  2HPI A;  3HXL A;  4RBO A;  2IPQ X;  4WWC A;  4CGZ A;  4EV0 A;  1AWC A;  2PMU A;  3I59 A;  3U1K A;  4DIQ A;  2OQR A;  3FXJ A;  3V4G A;  3KET A;  1GV5 A;  1YQA A;  3PL8 A;  1HKT A;  1O3S A;  5FGM A;  2HYG D;  5EZG A;  2NS7 A;  2IAI A;  3CUO A;  2VN2 A;  3BG7 A;  2O5R A;  4E7I A;  2VBZ A;  3CDI A;  3OYN A;  4P9F A;  1X1B A;  3M4O J;  1NG7 A;  1GXQ A;  3KYL A;  1MBJ A;  1I5Z A;  2VOO A;  1UB9 A;  4C2M J;  4B3A A;  1JUP A;  2O3F A;  2R3S A;  1A04 A;  4RGU A;  1AHD P;  1KU2 A;  4OMZ A;  3COA C;  3KZI C;  4L0Z B;  3VEP A;  1J9I A;  1R22 A;  4IL6 C;  2MFZ A;  3K0L A;  5F1J A;  4ZDL A;  3HRM A;  2FOK A;  4BXX J;  3AG2 H;  2W1O A;  2V1D A;  2HEO A;  2CQ7 A;  3S3N A;  3L7W A;  4JX6 A;  2X1C A;  2QM3 A;  3HIF A;  2E7X A;  4KJZ A;  4U7B A;  3RQI A;  1FIP A;  3RI4 A;  2AXL A;  1V5F A;  2ZNZ A;  2XAG A;  3EDP A;  3JRI A;  4XN3 A;  3IRQ A;  3NEU A;  4A93 J;  2H1L A;  3JRF A;  4A3K J;  2VJ5 A;  3I5U A;  2P7C B;  5E17 F;  3R0A A;  1IDY A;  1VI0 A;  2MLG A;  2H6B A;  4DYQ A;  1KZH A;  3DTE A;  3MD2 A;  4EAT A;  3E7L A;  3DXJ F;  3KCC A;  4KIC A;  2CW8 A;  1ETQ A;  3HHH A;  3DLA A;  1IN6 A;  3G1L A;  2RQQ A;  4M3D A;  4KUM A;  1HF0 A;  1FOW A;  3NRV A;  3BLY A;  3BJO A;  3TL4 X;  5J6X A;  1U2W A;  1YOV B;  4EM0 B;  2HR3 A;  5FD5 A;  1S5L C;  3P9I A;  1W7P D;  3H1C A;  1T2K A;  1IXS B;  3C2B A;  4RDU A;  3N97 A;  3KP6 A;  4LG0 A;  1VQM I;  4I09 A;  2EPF A;  4IJA A;  5K7H A;  3BR5 A;  1HSJ A;  4AID A;  2JSP A;  3F8B A;  1ETY A;  1FYM A;  1TWG J;  1W7P A;  1WI9 A;  2M5W A;  3M1E A;  5F04 A;  3OYH A;  3BJ6 A;  3HDD A;  1W0T A;  3A0B C;  4ENK A;  1T8I A;  2D2W A;  2FBH A;  1H9T A;  3GUD A;  2DA3 A;  2ZSH B;  1U8R A;  2DPD A;  3IWZ A;  2DMU A;  4BAC A;  2X6W A;  2FNA A;  2RAE A;  4A6E A;  3E5X A;  5CVR A;  1JHF A;  3KEO A;  2DXI A;  1T08 B;  2EH3 A;  1WFX A;  2R7O A;  4KT5 C;  3CD6 I;  1QVU A;  1RET A;  2ISZ A;  2JQ7 A;  2B9S A;  2MSY A;  3CUQ B;  2L0K A;  3F22 A;  1D5Y A;  3K1N A;  1I1G A;  5DCF A;  4BQQ A;  2TRT A;  3U2R A;  5ICF A;  2OPT A;  4OIN F;  1IRG A;  3BZC A;  1FIA A;  1LFB A;  2EFP A;  3WE3 A;  5CVV A;  2A6T A;  2HGC A;  4IRH A;  4IHW A;  2DO7 A;  2K4B A;  3VFZ A;  5L3B A;  1TWA J;  1GLN A;  2KT0 A;  3BTJ A;  1XG1 A;  1UST A;  4DOZ A;  4B48 A;  3KX2 A; 
#chains in the Genus database with same CATH homology
 1MIJ A;  2LMD A;  1XPX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...