1XPXA

Structural basis of prospero-dna interaction; implications for transcription regulation in developing cells
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
144
Chain Sequence
SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

publication title Structural Basis of Prospero-DNA Interaction: Implications for Transcription Regulationin Developing Cells.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation/dna
molecule keywords 5'-D(*AP*GP*CP*AP*TP*GP*CP*CP*TP*G)-3'
total genus 54
structure length 144
sequence length 157
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1xpxA00
1XPXA 1MIJA 2LMDA
chains in the Genus database with same CATH superfamily
3DTKA 4UUSA 1X4PA 3FM5A 1G6NA 2DA3A 2DMUA 4OMZA 5EF6A 2H27A 1M1EB 1U5TC 4UHTA 2V1XA 2DT6A 2F4OB 3L2RA 4G7OF 2G9WA 2LY9A 2CFXA 2VPLA 2LC2A 1OISA 4RAGA 4IO9F 1Z21A 3OYDA 3ZQQA 1QGPA 2HI3A 2ESHA 2HYGD 3K1MA 5J47A 1U5TB 3RI4A 1SFUA 4CCLA 2CH0A 1XTAA 5KHDA 4BY1J 4F91B 4WXHA 2F5DA 3LA3A 1T2KA 2L4MA 4DZJA 5JI6A 1YOVB 3CC4I 4L18B 3L2UA 2L4AA 2DAOA 3HTUA 2QQAA 2B7EA 3E5UA 2GZWA 3GFLA 2EZIA 2OC6A 3PO3J 3WE3A 2XV4S 4JOMA 4YFXF 2K85A 4PK4A 2MLKA 2R4GA 5EEHA 5L3CA 4C2MJ 4J00A 2E1NA 2PJRA 4UNOA 4HNTA 2NS0A 4EVIA 3PFIA 3DV8A 3E6DA 3OR2C 3DLAA 3DKYA 4FHTA 3M7GA 4QPQA 2DK8A 4RB1A 5L3FA 1ZN2A 2XVCA 1V4RA 5F0FA 4GYGA 1AKHA 3I56I 1OCZH 3I3LA 4C3JJ 4G7ZF 4HV6A 2Y75A 4UVAA 2R7ZJ 1VQ5I 2D1VA 4A12A 5E3NA 3HSRA 3RYPA 2EJRA 3LA7A 2DXIA 1SC7A 1JGSA 3JTGA 1QRYA 3I59B 5JHFA 5IPAA 1YX5A 5LHGA 2R7SA 2DODA 3Q9VA 2NYXA 4R79A 1IV6A 3D5LA 2R5ZA 3M1EA 3GZNB 1RPWA 5IOZA 3LSHA 5K5OA 1TC3C 2KIUA 1SVLA 4KDPA 1WWXA 2HZDA 2F6CA 3C18A 2Q8KA 3BPXA 4ZZDA 1VQ6I 1ITYA 1HLVA 3ABLH 4E70A 4QPOA 2PFBA 3S3NA 5FD6A 2DYRH 2GQQA 3E5QA 4A3KJ 2GM4A 4EJUA 4A3GJ 2VQHA 5C44J 2H6CA 3QYEA 4KMUX 4K2EA 5FKKA 1FOWA 5GPCA 2OJED 2VC1A 4PJNA 5EJCA 2LBFA 1WI3A 1MMSA 2D2WA 5EZHA 2FJ1A 1UHMA 4CYCB 1R1VA 2R7DA 4MHGA 2HKOA 3L2VA 4RM3A 1SVMA 2ME0A 1JHHA 1K79A 2Z1DA 1ZRDA 1FY7A 4FX0A 4PGGA 3BR5A 2VBZA 2XAQA 3CO6C 2LKPA 2ECCA 2JK3A 3RPUD 1ZR2A 4N9HA 1OFCX 1IGNA 5E18F 2WC2A 4IXAA 4M74A 4N4OB 1S72I 2V1NA 2XUBA 5FKLA 4P9UA 1STZA 4P1WA 3PFYA 4EMSA 2VASA 2LRDA 3A01B 1NK2P 1ONVA 3BP8A 3JCUC 3U1DA 1G3SA 2L3DA 5ILVA 1YJNI 2VIXA 4BQAA 3A4CA 4RGRA 2W84A 2EWNA 4CGZA 2QA4I 1XSDA 4MNUA 3GX4X 3NWTA 1LEBA 4IL6C 4UVCA 2KIMA 3DKWA 1JUPA 1WI9A 2QM3A 1TWGJ 1FSEA 3QU6A 4MLOA 3JREA 2DI3A 2V79A 1F5TA 2M5WA 1I3AA 3FXOA 1RZ4A 3QQAA 2KIQA 3J80K 2V1UA 1K78B 3FMSA 4JBAA 3C3WA 2A69F 2NVQJ 1XS9A 4MQ9F 3PQKA 1TZLA 4IRGA 4L0ZB 3KEOA 4XN0A 1A04A 3IWFA 1K6YA 2DT7B 4LG3A 3K70C 4M3DA 2XKOA 1E0EA 2OCEA 2BVMA 2LH9A 3FHNA 3CUOA 1PYVA 1YHQI 2HOEA 2E7XA 2VT3A 5GTIC 1R9TJ 3OYKA 2LK2A 1U5TA 3K4NA 4AIJA 1IC8A 2LKXA 2FSWA 1U0JA 2CUZA 1WJFA 4UVBA 1SVOA 3AG4H 4V2FA 4YIFA 3ZMZA 3RKXA 1PDNC 2MC3A 2IGKA 2GWRA 1IDYA 1D5YA 4JYKA 4A0YA 3CLQA 3RJPA 3HOUJ 2E1MC 1QNTA 2HQ5A 4PSWA 4UUSB 2VN2A 3J7YJ 2MGQA 4D5CA 2MLGA 3V4GA 2QBYA 1KU9A 1D8JA 4KIBA 3ZMSA 3VPRA 2JVHA 4M73A 2WB1A 1BC7C 1R58A 1Z7LA 2CGPA 2KT0A 2W48A 5E20A 4PDKA 5AIPA 4BUPA 2E2JJ 2HQAA 1HW1A 1UMQA 2DA2A 3OYIA 4J01A 3PUBA 3FISA 1RESA 1MBHA 2IGOA 2QZ8A 2ZCWA 3GTMJ 1WSUA 4ASNA 2L7FP 2RGVA 1K7AA 3KIOA 2CRGA 4IQ4A 1BOAA 3KP7A 4XLNF 2EV5A 5EEAA 5F27A 4ABZA 1T39A 3ECOA 3A01A 1IZ1A 4BKXA 1N75A 2A6EF 1RUOA 3GTGJ 3P9CA 1UG0A 2HPMA 2K5CA 2IVMA 5K5QA 4DZPA 5D5UB 3W6VA 1NK3P 1VQ8I 1JKPC 5BPDA 4XQFA 1XMXA 3KLOA 4M9XA 3OYLA 1YW9A 2OCCH 2XGEA 3ISPA 3CJRB 3H9QA 1OCRH 4A3JJ 2LBFB 1Y1VJ 2ZKZA 3JAMZ 3HIFA 5FLXK 3SZGA 2QF7A 2XB0X 3M1CA 3A2KA 3SDBA 5AONA 1VQKI 4PSXA 1KQ0A 2ISZA 3NAUA 1DP3A 2M3AA 1LVAA 3HB9A 3PM1A 3CDHA 3V8LA 2EPFA 4LD5A 5GP9A 2K9LA 1MMAA 3BTLA 5GADJ 5HS8A 1X1DA 3FXQA 2K02A 4RAZA 3UKGA 1IG7A 2IP2A 2GOXB 3U9GA 3SZPA 2NAZA 3PSFA 3TDZC 2IPQX 2P8TA 1TW2A 2EILH 3RCOA 4XM3A 4YRVA 3HTSB 2L02A 2DLLA 3IH3A 2XPVA 3Q0WA 4AVZA 2FMLA 2PMZA 1SANA 3I4MJ 5DCFA 1MIJA 5FGMA 5GAHJ 2RAEA 1JGGA 4UB8C 5C4XJ 2DMQA 3HSEA 3I59A 4LLGF 5IT3A 2XAJA 4Z6YA 3RZOJ 4ENJA 1ETXA 3E6BA 3GTOJ 4Y15A 1XB4A 2F48A 3FDYA 1XD7A 3LQRA 1S8NA 2LYCA 1MSFC 5LHHA 3L7WA 3F9KA 5GTHC 2LF8A 4S05A 2ACJA 3ZGKA 1R71A 1XX5A 3S1RJ 1GV5A 1AKHB 3BR1A 3JAMK 2FD5A 4E7ZA 1SFKA 1Y0UA 5DCMA 2B9SA 4AYBA 2JJ7A 4U7DA 4CUGA 2VT2A 4M71A 5M5WJ 2ZNYA 1PUEE 3JW4A 4D7NA 1W7PD 3VDXA 4HAMA 5DM6F 1XCBA 4PJJA 2Z3YA 4XBFA 4BE0A 1XGMA 2AHQA 1V5FA 2IA0A 3BWGA 1E3PA 1FOYA 1FOXA 1QPIA 1KYWA 2NRAC 3BCAA 1V5EA 3CUQC 1KU2A 4BJ6C 1Z9CA 3PJRA 2XASA 2JVGA 1DGRM 1FBQA 3TL4X 5HDGA 4E4HA 1RR8C 2HQRA 3NQOA 1X1PA 3EUHA 2MABA 4YG2F 5KAIC 2KIFA 4L5EA 2OU2A 4CYDA 4E7JA 3CUQB 4L5JA 3D1NI 3PNTA 2XF5A 4JX4A 3FXRA 4CCMA 3HC7A 5H20A 2VONA 4XKVA 1P92A 4PJMA 3GO5A 1NHAA 2ZXIA 3TOAA 2M45A 2LF7A 2VJ5A 5FRMA 4BXXJ 3F8MA 2DMPA 2DA6A 3RQIA 3EYIA 3CCMI 3HZJA 3S3OA 1B59A 1IDZA 5IYDJ 2NVYJ 2PX9A 5IP6A 2IRFG 4RGSA 1TWHJ 2HDWA 4OIPF 4ENMA 1YJ9I 2X1CA 3RKWA 4AD9A 1J09A 2I8DA 2WAEA 2DT5A 1FWZA 3GEZA 3I64A 2NXNB 5JHUA 2MH9A 3SFZA 2XGDA 1UZCA 2O03A 2PBIA 1EH8A 4JX6A 1NTCA 2GA2A 3V42A 4E6KG 4HNVA 1KA8A 2ELJA 3TP0A 3L2WA 2IA2A 3BZ6A 1T95A 4JP0A 3JRGA 3M4OJ 1LE8A 5HODA 1D3YA 2DJIA 2W25A 1GVJA 3TO9A 1HKQA 4XLHA 1TNTA 2JSPA 2KLOA 2R5YA 2HDDA 2RQQA 4B47A 3HOWJ 4NBQA 4U88A 3W2WA 3WTZA 4EJVA 2H1LA 1P2FA 4U87A 3FKJA 3C2HA 2IEKA 2LFBA 3WU2C 1FNNA 4E7LA 3ZPLA 1LDJA 3CF5F 3KFWX 4MTEA 3RSNA 1BIBA 3G71I 5F0CA 4F52A 3KP5A 2OTLI 3R60A 3QPSA 1NG7A 2F4MB 4EQQA 2FBHA 3TKYA 2H09A 1UCRA 5KNLA 1SFOJ 1FZPB 2JRMA 2HOTA 1MMNA 1UJ8A 4BHPA 3GLXA 3OS0A 1J0RA 1EA3A 5IT9Z 4PFOA 3CDIA 2WTEA 4BAYA 3HJEA 3FM3A 3H92A 1ULYA 2E71A 2JT1A 1Y56A 5CQGA 4HF0A 4E7IA 3S15J 2Y9YA 3QODA 4FQGA 3ROUA 3JRIA 4ZDLA 2JA8J 3VSKA 3BR3A 1KZHA 4M6VA 5L3EA 2GXGA 4OINF 4M9ZA 5DS9A 3K4CA 2I5UA 4ZDOA 3LSIA 5EGOA 4M3GA 3Q0UA 2P7VB 3CDLA 4QTRA 1HCRA 2HKXA 4A3BJ 2OZUA 1U78A 2M87A 2FNAA 4XL9A 2CG4A 2H94A 2Y69H 1A6IA 3ABMH 4XKBA 3LSRA 2YUSA 2V6EA 4X1EA 1UB9A 1WJDA 4QIWN 4XOTA 4Y7NJ 2X6XA 2ZMEA 3E6CC 3D0SA 2R5YB 4BNCA 1MMGA 3BT9A 3WTYC 2ZXJA 1VQOI 2L7ZA 5HNFA 4BXFA 3CCUI 3KEQA 2BW3B 1R5GA 3IWZA 5J3LA 5EYRA 2Y0SN 2WB1N 3BR2A 1UHSA 1Z67A 2KZGA 2W4SA 3ZQHA 1DPUA 2RVCA 3OYJA 4FT8A 1AA7A 2XAUA 1B9MA 2YR2A 1LJ9A 4CA0A 4E7KA 2R7XA 3ABTA 1JT6A 2HZTA 2ZO4A 3WGGA 2DOEA 2V9VA 3DTIA 2M30A 1DGWY 3T1BA 2EIKH 3OIPA 3TBIA 1BIAA 5LD2C 2K4JA 1BOBA 3EDPA 2KDOA 4CCJA 3VYRB 4AWXB 3OYEA 5M3FJ 1XC5A 2UXNA 3WODF 2FXAA 4C2TA 4LG0B 3HUGB 1MGTA 2XRLA 3Q9SA 1ZGJA 4ZZLA 3BCBA 3HM5A 2YS9A 4KIGA 5LGNA 1G3WA 4WXCA 4YEJA 3OSFA 3F6VA 3QRFF 1IRGA 3FX3A 2P81A 3MFKA 4W1UA 3IRQA 2C6YA 3B6CA 4F7ZA 3W2AA 1B1BA 1BC8C 1R6RA 1D8KA 4GXOA 1FMVA 4S04A 4DYQA 2PEXA 1SD4A 4LB6B 3P7NA 2O9LA 2JRTA 2OUMA 4DOZA 3FK7A 3K4JA 3WE2A 1ZAOA 4OOIA 4OWRB 3SHFA 3LMMA 4N0BA 3CCVI 4DBRA 2JZYA 3WG7H 1ZREA 3L9FA 1IN4A 1W5SA 2MH2A 4BACA 4R1HA 1CQTA 4EV0A 3WGHA 2JWTA 4B48A 4GCVA 3RPUA 1PJRA 4KYWA 3ZMDA 2BY1A 2IXSA 3IH4A 1N77A 2OQRA 5LRSA 3RZDJ 3L09A 1FOKA 4BJTA 1UFMA 2DQRA 4U0VA 3LNQA 3CMYA 1JHFA 4HW0A 2A68F 2QYOA 3W6JB 4ZYGA 3W6KB 3AG3H 1O3RA 4CSWA 2Y2ZA 3AAFA 1R5HA 2RQPA 5DCMB 1E2XA 3C7JA 2BV6A 3I55I 1HXDA 2J5PA 3PIOF 2DA5A 2FRHA 4UUTA 4HZFA 2FE3A 4BEHA 2L7KA 1ZLJA 3ASOH 2VBWA 3PNVA 1FPQA 1S7EA 2GBYA 4EM0B 2X1DA 3M8JA 5LBQA 2FMYA 4LLNA 3H35A 3MZYA 5LRRA 1FYLA 3VYSB 1R22A 4DQ2A 4BBSJ 1UELB 4A2UA 4Y17A 3WU1B 2VOPA 2XAGA 3BZKA 5FROA 3OSGA 2M4GA 2VOOA 3OL3A 1ZG5A 4AVPA 3H9GA 2P0WA 3OWTA 3HGYA 4AIKA 3QWLA 4A5MA 3CCRI 2FU4A 3CQZJ 3HKZA 3O2PE 4PZJA 1ZK8A 2CV0A 2A07F 3MVPA 1GV2A 1YIOA 1WJEA 4KITB 4RB0A 1YFHA 3A0BC 2VQGA 1LKXA 2BHYA 3MKLA 2M8GX 1QVUA 4KISA 2LLKA 3DBRB 2M8EA 1VTNC 5ED4A 2CW7A 3IKTA 2QQ8A 2NNYA 4XLCA 2M9HA 1B8IB 1OCTC 1W4MA 1LDDA 2Q2EB 2YX7A 3DPLC 2A61A 1JJ6C 3D5RC 2OZ6A 1LFPA 4NDLA 3G6EI 3G1MA 2DFHA 2HXIA 2L54A 5GPAA 2XGCA 3JTHA 4JQFA 1O3TA 2VE9A 4LK1F 4HX4A 2WAFA 3TMOA 3DTEA 2ID3A 2R92J 1XSVA 4EEFG 1QO0D 3JRDA 3ZMUA 3BROA 3GCMA 4IF4A 4B3AA 2LOOA 2W00A 3J81Z 5DV5A 1MJ9A 2BBYA 4XLAA 3LFKA 1F4KA 2L9NA 1MNMC 1GXQA 2K27A 1USSA 1VI0A 3BY6A 3O8GA 2L9VA 2MBFA 2R7OA 5J1RA 1P9QC 2KKOA 2V26A 4LOCA 5TGTA 1YS7A 5DYMA 2ZJ2A 1JJ8C 1D0ZA 5E8IA 2P7CB 4ITVA 2VUMJ 3F8FA 1ZQ3P 2D45A 3ZP5A 3HDDA 2OA4A 4PJLA 4KFCA 2IS2A 2HNHA 2NVUB 4MTDA 5IY5H 3HRUA 1JE8A 2PN6A 2OD5A 2BXZA 4L9VA 2EH3A 3QPTA 2EIJH 3OS2A 1JUSA 1I6HJ 2CV1A 1SFEA 2EB7A 3OYFA 1BN5A 4XICA 2MG4A 3ECHA 3TEDA 2EBIA 1I5ZA 1MBGA 3LSKA 1O57A 2HPIA 2B0LA 1YS6A 4M72A 1WCMJ 5DM7F 2WWYA 2CQKA 1EF4A 1J5YA 3SEZA 2QCOA 4GYIA 2Z16A 3ZN0A 3ZN1A 3WTUC 3F23A 3LA2A 4BJ5C 1BJZA 1D0YA 1IXCA 1W36C 1I39A 3F6OA 2H8RA 2IS6A 4DYRA 4ZDPA 2E1OA 1QQIA 2DW4A 5DD4A 1ZYRF 3BJOA 3GZ5A 1T56A 2LKSA 1MBFA 1D1CA 5M5YJ 3CESA 2DDAA 2JQ7A 2L01A 3RYRA 2IW5A 1ORKA 3PNYA 1FYKA 2HVQA 1K78A 3K4KA 3TO7A 1OCOH 4XRSG 2COMA 1NH3A 5GAEJ 5BMZA 2K9SA 3ASNH 1OKRA 5L3DA 1ZRFA 4HX8A 3H5AA 5ICFA 4XRSA 3LOCA 3EUKL 2VBYA 2R7TA 5L3BA 2ZMEC 2VI6A 4BYYA 5CPRB 2L7MP 1ZTRA 3H9JA 3DPTA 1WJAA 2AO9A 1YI2I 2VQCA 3BG7A 3G4SI 2PMZN 4A3MJ 2JPCA 3K4BA 2JSCA 3HOVJ 4B44A 2ZC2A 2EZKA 1SEUA 1UAAA 1YO5C 2WV0A 3ZQ7A 1LEAA 5H2FC 1X3UA 3EPZA 5CVRA 3GXOA 3MQ0A 1TT5B 2JN6A 3PQJA 1HDDC 4F55A 2STTA 2VC0A 1MJBA 2GXBA 1MH3A 5CVUA 9ANTA 4RA2A 3VSLA 1IUFA 3MWMA 2GAUA 1DU0A 1T0FA 4A3DJ 3FMRA 2Y0MA 1LB2A 1KU7A 4NHJA 3S1QJ 5IYCJ 4W97A 4XLEA 1ETQA 4D0PA 4ZTJA 1R49A 1IN8A 3ZCOA 3FXUA 1BM9A 2Y30A 4XORA 2R7VA 2OF7A 3N4MA 2W7NA 1XG1A 1Z1DA 2TRTA 1YTYA 2W85A 4C9YA 1HC8A 4YFNF 4B43A 2EA4A 2RNGA 2AQFA 2MW8A 2KISA 2LVSA 4QLCU 3FXMA 3QOPA 1LPQA 2DFEA 2DTRA 3MKZA 1F36A 2FQ3A 1QU3A 5FFXA 2CW0F 4IRHA 1HOMA 1HQCA 2DK5A 3I53A 2VLAA 1F9NA 4UXNA 2WAQA 4I02A 1N25A 1XMAA 3IAM2 4A6EA 1BA5A 5E1WA 1LQ1A 2CSOA 1YLFA 1T98A 1RI7A 1B4AA 4I76A 2LY2A 3CJNA 5F08A 2RDPA 3F0CA 1Y39A 3MKWB 5FLVA 5E3LA 3OYCA 2EFOA 4OIQF 1P4XA 3L1PA 4YFKF 1IRZA 2RREA 2KL4A 1X2NA 1OR7A 2VPRA 3LSGA 1IRXA 1S5LC 5E1ZB 1H89C 3TDUC 1X19A 3FMQA 4PFPA 4A3EJ 1VQ4I 1FIAA 4M9SA 2CQXA 2CU7A 2O0YA 5M5XJ 4YIIA 1HKSA 3EUAA 5LEJA 2VKVA 4MIMA 3CTAA 4G94A 1V3FA 3DFGA 2RC4A 5JR3A 3HL2A 2QQ9A 1KGSA 3QOEA 1U6GA 1ZGAA 2G7UA 1WJBA 3SEQA 3QP5A 3U1KA 1XMKA 1B72B 4ZYHA 4N4NB 2LP0A 4IPAA 3O8HA 1ZH5A 2M1BA 3UNGC 2EV0A 2XF7A 1W0TA 2KJBA 4II3A 1BW5A 3IC7A 3A02A 2H8WA 3BC8A 3HHGA 3WGIA 2ZJRF 3LAJA 3Q0VA 2CQQA 2XIGA 5A2QZ 4KA4A 3OYMA 1FLIA 5DUKA 1E3HA 4KNYA 2KQRA 3LSMA 1JTXA 1MMDA 1Z3YA 3HKZN 3S8PA 4CCOA 2ELHA 4XKWA 4FE4A 2DA4A 5F64A 1TQMA 2E34A 2EA2A 3PSIA 3RDIA 3RPQA 1OLTA 1VQ7I 2DOAA 3OMYA 3VYUB 3FBIB 5CKTA 4B09A 3NEUA 1X3ZB 2YU9J 1ZR4A 2DPUA 2HVSA 2K7LA 3DPUA 1N78A 1BL0A 1I27A 4ZYAA 1O7FA 4BS9A 1MNEA 5B66C 5C4JJ 5IT9K 3NWSA 3H1CA 2G0EA 4HQMA 5M3MJ 4LGWA 1IF1A 5HLIA 1Z6RA 4LIVA 4BQNA 3G1LA 1T08B 1I1GA 1YJWI 1APLC 1IW7F 1KYZA 4WX9A 1SD7A 3KE2A 2E5NA 4P96A 4F3QA 2VE8A 1DUXC 2ZBKA 5KVRA 1RKTA 4C2UA 1Z7UA 3HPGA 2BXYA 2XPUA 1XN7A 3CMMA 3LFUA 3GBGA 2FOKA 3RKYA 3PL8A 1IUYA 2E35A 3C2BA 4LB5A 1WKMA 2HTSA 5ICEA 4NC8A 1HSTA 2FBKA 2KRHA 2GIVA 1V54H 4KT5C 3I71A 1VNDA 4NC7A 3BR6A 5EG0A 3S16J 4AUXA 4JX5A 1TL8A 2CS3A 1VZ0A 1Z91A 5FFZA 3KP4A 2A3SA 2K9QA 4I01A 4FX4A 2ICWG 2P5LC 2O61A 1ZHFA 2QVOA 3U2RA 2V7FA 3NARA 5IOYA 4HQEA 3F22A 2KFDA 3HUGA 4LG0A 3A03A 3HPHA 1GDTA 4IOAF 3OY9A 3IAS2 3E97A 2EQRA 1IRFA 2BY2A 3SFIA 1KQ8A 2R93J 4GFBA 1WPKA 3I9V2 1W0UA 1GXPA 1TWCJ 3P9IA 3GLLA 2A6TA 1R4MB 3GTLJ 1WVRA 4HSTA 3GUDA 3CF2A 4HF1A 4OIRF 1E17A 4ENNA 4D9JA 1POGA 4L9TA 1OYIA 4NNJA 1YRNA 3KLNA 3C1DA 2Z99A 4M3BA 1YE9A 5K7ZA 2CJJA 4U7BA 2X6OA 2TDXA 4QWQA 3HOZJ 3JSPA 1J2XA 4I09A 4MGRA 5EZGA 1W7PB 3TOBA 1B9NA 1DQUA 4XK4A 4KMFA 2OTJI 1J9IA 2BW3A 4U0WA 4I2OA 5FKNA 3N97A 3VWBA 3MMYB 1FJLA 3TP3A 4A6DA 1HF0A 4BQOA 1E3OC 4I7HA 1EH6A 4BDYA 1WH5A 2MA3A 2W1OA 5HNHA 4AM3A 5D8KB 2L2OA 2HXOA 5E1XA 4KUMA 2EINH 4NUBA 2PJPA 2X48A 2QKMB 1JUMA 3AL0C 1MBKA 5ICCA 4BHCA 3GTPJ 1QHGA 3JRCA 2DMTA 1F1ZA 1P7IA 3B73A 3VFZA 4A3CJ 5K7HA 1D5VA 5LEKA 2CUEA 4EJTA 1RIOH 2GA1A 4PUSA 1Z3XA 2BE5F 2EIMH 5D4RA 2K3PA 3AL0B 3H0GJ 3CZ6A 2E36A 2J5OA 3DBLB 2W57A 3R0JA 3BG5A 1JKQC 1LVKA 5E3MA 2ZNZA 4KN7X 1F43A 1D0XA 4PCQA 3KP6A 4OIOF 2LSOA 4WK8F 2FF4A 4OMYA 5D5XB 2LMDA 3KZZA 4ANJA 3QAHA 2X6YA 4KN4X 5J8CA 3BJAA 1BI3A 1ETOA 1MBJA 2WAQN 4L5IA 3CCEI 2ME6A 1X4OA 2DU9A 4IVNA 4DJAA 2HU9A 4HSRA 1OCPA 2WADA 5J40A 4B3XA 2JTVA 1T38A 3CP8A 2KRFA 2JUGA 3S17J 3BQYA 4CXFA 2Z9OA 3CCQI 2CMPA 5CJ9A 2XAFA 5FB2A 4Y13A 1MDMB 2RV8A 5BNGA 4ETSA 4NQWA 1EH7A 5HLHA 2O6GE 3BTJA 1BR1A 2QGUA 2K40A 1FIPA 2EV6A 2GLOA 3CCLI 1AU7A 2ETHA 2DYSH 3MZHA 1H88C 2K9NA 1TNSA 3DEUA 1Z6TA 3O3KA 1RC9A 4D7MA 3DBHB 3LSPA 3CJTB 1ETVA 2B63J 4XNFA 1FMWA 4CZCA 3Q3SA 4FTHA 4C3IJ 4BDZA 2DDBA 4J19A 2ISYA 3GMEA 4G12A 1X1BA 4M6YA 2Z5UA 2JPBA 3RQ4A 3GW2A 1R5ID 5KK1A 3M9AA 3FF5A 4I99C 1FC3A 3OS1A 1X1CA 4BXUA 1FP2A 3HYIA 4RM2A 5CLSA 4C3HJ 1SAUA 3DWLE 2GOMA 2L0KA 3G1OA 1RUNA 5ICGA 4F92B 3DLLF 3IKVA 1RRJA 4A93J 1HW5A 2HR3A 2UV1A 2H1KA 4XRMA 1ETYA 2V9PA 1A36A 3GTQJ 3IRRA 1MZBA 1GHCA 3SDGA 1WZ2A 1MDMA 2JA5J 4II2A 4CH7A 3J81K 1LFBA 4G9YA 3LSTA 4PJ0C 3MD2A 3CCJI 2LNBA 4JK1X 2EFQA 2BOLA 2KMUA 1YITI 3AG1H 2V9KA 4CICA 1REPC 5BQTA 1T33A 2D1HA 4IKFA 2X51A 3GYHX 2DBBA 2XF6A 4RGXA 3WHCA 2AS5F 1QZEA 1YYVA 2XKPA 3MEXA 4S0HB 1B72A 5TISC 3J7ZI 3COAC 3OYHA 1YW7A 4HF2A 1HBXG 4L9JA 2E5ZA 3CC7I 3GFMA 4BE2A 2FX0A 4MQVA 3KPHA 2QEXI 5C3EJ 2Y9ZA 3WHBA 1PP8F 2JA2A 1LUJB 3UR3C 3GTJJ 2M7BA 4BH9A 1OMIA 2VKEA 2HWVA 4A0XA 1ZRCA 4IHSA 3K1NA 2WA0A 1Q1HA 2VKDA 2DFIA 4XSZF 5D5VB 5D5WB 3L2CA 3V7CA 3FZVA 2W82A 4A5NA 3M8EA 3REOA 1TWAJ 4DGWB 1H9TA 1FBSA 4EATA 4WCGA 3KYCB 2CQ7A 4KJZA 2R3SA 3CLOA 1TW3A 5J1YA 3OYBA 1HW2A 2M34A 2O3FA 2OBPA 3R6SA 3MAJA 4O3MA 2HVRA 3GTKJ 2F5FA 2G7HA 3R4KA 1FTZA 5JLWA 4A3FJ 4X0GA 3DEWA 2EZHA 3SXYA 2P6TA 1IV8A 3TW7A 2O5RA 3AFHA 1PP7U 1B6AA 3IH2A 4Q4ZF 4XN3A 1ZGWA 3S1MJ 4EM1A 4YIRX 2KZVA 5L3GA 2D5VA 2LDUA 4R8HA 1UHWA 2X1EA 1A5JA 3DEEA 1W5TA 4RLQA 2TCTA 3KYDB 2R7QA 3K7AJ 1YRNB 4OU0A 4FCYA 1WQ2A 2PLYA 1I3QJ 4BBRJ 1R36A 3KP2A 5FKMA 3ZR8X 3L2QA 5FKOA 4ZYEA 4HEA2 2STWA 1MKMA 2VB6A 2HDCA 5DEQA 5B1BH 4EGZA 3KETA 2DJNA 2RN7A 3DP7A 1GVDA 4KT6A 3S93A 1BBYA 4MFDA 5BS6A 2X0LA 1I50J 3HXLA 2E1MB 3ML6A 1ENHA 4HNUA 4IHTA 3K0LA 2VL8A 3FK6A 1OCCH 2DOFA 2CQNA 5F1JA 4D1QA 2ESNA 2QQBA 4YELA 1G59A 2GIZA 4AIHA 3BLYA 4CCNA 4BGDA 5F1RA 5IYBJ 1FTTA 3DXJF 3G2BA 1D1AA 1XDSA 3F3XA 5K5RA 5BOXA 3ZQGA 1AWCA 4M3FA 3BDDA 1ZARA 1YG2A 4A3LJ 2IT0A 2P6SA 2ZFWA 3GFJA 1W5CC 1JXSA 3CP2A 3Q5FA 2I10A 4ZTFA 4IZZA 2XGXA 2Z2SB 3SQNA 3IV5A 3WG9A 1CGPA 3OIQA 1ODDA 1T6SA 5EEGA 5FLMJ 3B6AA 3T8TA 4E7SA 3AG2H 5HLGA 1S7AA 3ZMTA 1KU3A 1G8XA 2VXZA 3H36A 2FEZA 4WXDA 3E3VA 1D1BA 2M4KA 3VB2A 1X2MA 3W2VA 2JA6J 1A6QA 2KHMA 5J8FA 1BW6A 2XAHA 1QVTA 3FXJA 4XKCA 2VODA 4HBLA 3HHHA 4IHXA 4HOBA 2FNPA 4Y52J 4EJWA 1YQAA 4CZZA 1P7JA 3V7SA 4IEJA 3BTCA 2AQEA 5D8LB 1QBJA 3X2QH 1U8BA 3ABKH 4MFEA 3ZRGA 4A0ZA 4ZYDA 1VFCA 2ZB9A 3QP6A 2ZJQF 1FBUA 1EKEA 4RDUA 2BVLA 2DMNA 2RNJA 3K2AA 1BI2A 5ERIA 1VF9A 1TQPA 5HLTA 3P5JA 5H6QA 3FIWA 1R7JA 1K6OA 3KZYA 1J75A 1YIJI 4N9IA 3PO2J 4DIQA 1YX3A 3HOYJ 2R0QC 1OJLA 2R7RA 1WJ5A 3H5NA 2KDZA 4G7HF 4ZH4F 2HOAA 5DUIA 4XSXF 4H4KC 4UUVA 1EV7A 2VJ4A 3E1SA 4RLFA 3CCSI 2GXAA 3KX2A 1S3JA 4FETA 2KP6A 1Y6IA 1P6RA 3ERED 2LY1A 4U0YA 3B02A 3E6MA 2DA1A 1R00A 2Y31A 4HX7A 3K10A 4WF2A 5CVIA 1S7OA 2OV7A 4BY7J 4RB3C 4EJOA 3M8FA 2P5VA 3BTIA 5D6EA 1K83J 1JI8A 3JR9A 1CF7B 2H6BA 2OQGA 5LGTA 3IL2A 3MN2A 2CW8A 4HG2A 1X3WB 5FD5A 1CF7A 2DN0A 5J1UA 1TP4A 4AC0A 2HYJA 3ONQA 5EDNA 2VQLA 1TT0A 1SMYF 3ELKA 2DTZA 4XOPA 1V5GA 2A6HF 4CYCA 1A31A 4Y3OA 3DF8A 2K3FA 1HA8A 3CO7C 3U21A 2CWEA 2Q2EA 3I0TA 2A5WA 3IUOA 1B8IA 3G3ZA 4ZJZA 1OR7C 2F4IA 3CC2I 2QKLB 3CD6I 2K86A 1YW8A 1RETA 1IO2A 2YPRA 3I5UA 2WY7Q 3MZ8A 2VBXA 3HRTA 3E0JB 3OYGA 3OYNA 1JT0A 3K1PA 2QSGX 3CMEI 1FYMA 2LD5A 1IN5A 3OR1C 1QZZA 2QENA 2EFWA 4LK0F 2UUZA 5DDGA 1XGNA 4LFUA 5IP9J 4KIFA 4GGGA 3HBLA 2RKHA 4H0EA 1Z0XA 4C30A 3E5XA 1MBEA 2XPWA 2E60A 4IHVA 3WU0A 2NOJB 2HTJA 3ZQIA 4CCKA 5J6XA 2R7FA 4BE1A 1ZLKA 2VJIA 2M7AA 2R5ZB 5B1AH 1GLNA 2COBA 4B1RA 4B8XA 1LNWA 3SJMA 2NNNA 3I54A 1LDKB 2XDVA 2Y48A 4Q48A 3S14J 2K9MA 3F8BA 4LITA 5E3OA 4HV5A 4D5FA 3FBNB 4XONA 3M07A 3K4LA 1IXSB 2YSRA 4GRIA 4P5OA 4TV7A 5CQEA 2DPDA 2O8KA 3SZTA 3ULQB 3K6GA 1TWFJ 1OQYA 3BQZA 4HLYA 2Q0OA 3S2WA 2CUFA 4HRIA 2MC4A 5LHIA 3ZOBA 2JA7J 1FSHA 4CO8A 1G3YA 2O8XA 1BI0A 3OOPA 2YX4A 4MEYF 4E7HA 2R7UA 5E8GA 1MH4A 3RIRA 2CYYA 2LR8A 1DU6A 1O3SA 1HSJA 4XIDA 2AXLA 3QYFA 2PJRB 4G6TB 2ELKA 2JUCA 3E7LA 4MO7A 2CO5A 4G6DA 3LAPA 1O3QA 2HOSA 3BR0A 2JMWA 4G8XA 2UWMA 1V55H 1H0MA 5LFAA 3F8NA 1TQIA 1TTYA 2BGCA 3WTSC 4AIDA 5IP7J 4OAZA 1IAWA 2O7OA 3HEFA 1RNLA 5HS7A 3C2GA 2AXTC 3J80Z 2XB5A 2Y0SA 4I0BA 1JKRC 2XROA 3HOXJ 1XCVA 3A1YA 1J7KA 3FXLA 1W36D 3V7RA 2X4HA 2NS7A 1Z77A 4UB6C 4HDVA 2EFPA 2V6CA 5F04A 4RGUA 1X1AA 4FE7A 2IS1A 2FA5A 3EETA 1AOYA 2IJLA 3V8JA 3M3YJ 3DU6A 2M2EA 2ZXHA 1G4DA 3P9KA 4HPQA 1SAXA 4EM2A 2NVXJ 3FXKA 3DQVC 4ZC3A 1LFUP 1VQPI 1T0FC 1FP1D 1U8RA 1HDPA 2ECBA 1IXRC 3WTWC 5FO5A 3BJ6A 4GO1A 2F2EA 4NB5A 4Q47A 4LLLA 1L0OC 2CUJA 3BG6A 5E17F 3TQNA 3H3ZA 5DD8A 5D4SA 1OPCA 1HKTA 4O6JA 4IQJA 1BR4A 1A35A 2EK5A 3JRAA 5BPIA 1KQ9A 3S1NJ 5D6FA 2PQ8A 5J4VA 2IAIA 4RB2C 1VQMI 4P9FA 4I0AA 3J7AY 3TGNA 3HGGA 5HDNA 2HGCA 1IJWC 1RR7A 3AKZA 2QUFA 3MCZA 4IRIA 2KJCA 2QSHX 4LIUA 3V8KA 1WJCA 1ZG1A 1GUUA 1W1WE 2KRCA 1ON1A 2ZMEB 3K9TA 4HYEA 3JRHA 3W3CA 2N8GA 3HOTA 4F93B 3I4NJ 1PVEA 4RAYA 5CVVA 1QA6A 4B4CA 5LGUA 2XSDC 4NC6A 2PMHA 4L0YB 2OPTA 3HRMA 1QZYA 5HOOA 5EGOB 2BZTA 3LSJA 3N05A 2PI0A 2FBIA 5KAFC 4ON0A 4IX7A 1QPMA 4IHWA 4Y33A 3H3VK 3QPLA 1R1TA 2MD0A 1O7LA 2VXDA 3S2DJ 1IN6A 3F21A 2BHZA 2UZKA 1U9NA 5J4YA 4O5VA 3ZXSA 2X6WA 4DNCA 1ACIA 5FLXZ 1Q1VA 3EUHC 1H9GA 2Z33A 2IS4A 1BJAA 3K4MA 3T5XA 4RS8A 2VJJA 2L9SA 3CJQB 4BHBA 2DQLA 2MFZA 3BG9A 1U3EM 4FASD 5K1YA 1SMTA 5H6RA 4QSHA 4KICA 1K61A 2E2HJ 2XSJC 3LQQA 1MD0A 5K7FA 4CHUA 2HYFA 3JRFA 1XSXA 4IJAA 1S6LA 2CV2A 1X58A 2VKHA 3ERMA 1DP7P 3CCYA 3WTVC 3DKXA 5FJ8J 1PUFB 3ZQCA 1WFXA 2DFFA 2ADUA 2QSFX 3H0DA 1KONA 4FISA 4M6XA 1LE8B 1VQ9I 3J7AO 1ZG3A 4UV8A 1EJ9A 1G3TA 1I1SA 3PIPF 3DU5A 3T8RA 1AHDP 1R23A 4BEHB 1ETKA 2FQ4A 3SYTA 2R7WA 2X85A 2Q1ZB 4WWCA 1SD6A 2L5QA 3BOQA 4LJZF 2UXXA 1S29A 3KP3A 4L9NA 4XR6A 4MEXF 3IP4B 1H8AC 1XGOA 4UV9A 2ZFUA 3R0AA 3QU3A 3OL4A 5HS9A 3OV8A 2NVTJ 3I58A 4RBOA 2HEOA 5B5EC 3S2HJ 3KYLA 1ERDA 1Z05A 1WGXA 1VQNI 1R4NB 2IA1A 1FEXA 1ZELA 3A0HC 3LL7A 5TJJA 3MKYB 1K4SA 2ZJPF 4V2GA 2CFOA 1ETWA 1BI1A 2P4WA 3CUQA 3GVAA 4GDFA 1SD5A 4NQWB 1R1UA 2HS5A 1Y1WJ 2EFNA 3KCCA 2PMUA 4M3EA 4A3IJ 3DCFA 5KCMA 2E7WA 3RKQA 1WHUA 3FHZA 2L9RA 5GAGJ 2XHKA 3EYYA 2PG4A 2DA7A 4V19K 1OYWA 1J59A 5DTDA 1ON2A 3NRVA 4AU7A 2ZXWH 5CVJA 3ESWB 3K70D 4CDGA 5HDKA 5JVGF 5HVQC 3HSFA 2WV1A 3JSOA 3OOUA 4HA8A 4Y4RA 3K2ZA 4ESJA 2IGMA 6PAXA 1P4AA 4RMNA 2FUG2 2LG4A 3FWEA 1L3LA 2W24A 1TBXA 3D5SC 3LWFA 2NS8A 1P4WA 3BZCA 3VEPA 1NG6A 3FKIJ 2XC7A 4UY8I 4ESBA 2F5VA 2MD5A 1FT9A 2HFHA 2KPMA 4DBQA 2DO7A 2ID6A 2BY3A 3HOSA 1K4TA 1JKOC 4XMYA 2V1DA 1GT0C 3S32A 3RTRA 1I6XA 3VODA 3IHUA 1WH7A 1C0WA 4P55A 4LMYA 4BL0B 5JLXA 3L00A 4Q5SF 2BY0A 4OAYA 3BPVA 3F8CA 4ENKA 5JVTA 1XGSA 2YU3A 3ZQFA 1ZKGA 2A05A 2ZSHB 2WY8Q 3KEYA 3QPHA 2QLZA 5ILSA 5F0HA 1PUFA 3ZQLA 3HRSA 2M0CA 3H3UA 4I6ZA 4XLPF 1UG2A 3HG9A 2X9DA 3BG3A 1SFXA 2HQNA 4RAFA 2M0MA 1U2WA 1W7PA 3S3MA 3I4PA 5ILUA 3WTTC 2MYSA 3TW6A 4X6AJ 3PUFA 1G2HA 5FRNA 2V4JC 5B3SH 5E79C 2QWWA 3WTXC 2ZSIB 3G73A 1WRJA 4AYBN 2F5CA 2IGNA 1Y0NA 3GF2A 4PGHA 1TLHB 2E19A 1RKWA 4I98B 5CYVA 1MJAA 1DPRA 5F6FA 3TO6A 1XPXA 1MW7A 2E1CA 3K69A 2DCEA 4EGYA 2OAZA 1IN7A 1O4XA 3QYBA 3H5RA 4Z2YA 3KZIC 4HLXA 4ESFA 1FX7A 5EG0B 3O6BB 3T0YA 3CMAI 1DDNA 5AIQA 2IBDA 2P5KA 1MNDA 1Y8RB 3GWZA 5JFRA 3JRBA 1OYYA 2MSYA 2K4BA 5A2QK 1QHHD 4BU2A 5TRDA 2NOGA 3R61A 2BEOA 4XLFA 1U9OA 4XRFA 5LLQA 3VYTB 2LREA 3F72A 3OIOA 3VOEA 4A69C 4BQQA 1T8IA 3GFIA 2E2IJ 3GZ6A 2F5EA 3EQLF 3ZMVA 4DW6A 1USTA 1MSEC 1JTYA 1BR2A 4HDUA 4DYCA 4G6QA 1XDUA 2XRNA 4IOCF 1VQLI 2EZLA 3OYAA 2LTPA 2QBYB 2BYVE 4IHYA 3ABUA 1Y8QB 2WBMA 2A5YB 1S9HA 2FOWA
chains in the Genus database with same CATH topology
1XPXA 1MIJA 2LMDA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPX A;  1MIJ A;  2LMD A; 
#chains in the Genus database with same CATH topology
 3DTK A;  4UUS A;  1X4P A;  3FM5 A;  1G6N A;  2DA3 A;  2DMU A;  4OMZ A;  5EF6 A;  2H27 A;  1M1E B;  1U5T C;  4UHT A;  2V1X A;  2DT6 A;  2F4O B;  3L2R A;  4G7O F;  2G9W A;  2LY9 A;  2CFX A;  2VPL A;  2LC2 A;  1OIS A;  4RAG A;  4IO9 F;  1Z21 A;  3OYD A;  3ZQQ A;  1QGP A;  2HI3 A;  2ESH A;  2HYG D;  3K1M A;  5J47 A;  1U5T B;  3RI4 A;  1SFU A;  4CCL A;  2CH0 A;  1XTA A;  5KHD A;  4BY1 J;  4F91 B;  4WXH A;  2F5D A;  3LA3 A;  1T2K A;  2L4M A;  4DZJ A;  5JI6 A;  1YOV B;  3CC4 I;  4L18 B;  3L2U A;  2L4A A;  2DAO A;  3HTU A;  2QQA A;  2B7E A;  3E5U A;  2GZW A;  3GFL A;  2EZI A;  2OC6 A;  3PO3 J;  3WE3 A;  2XV4 S;  4JOM A;  4YFX F;  2K85 A;  4PK4 A;  2MLK A;  2R4G A;  5EEH A;  5L3C A;  4C2M J;  4J00 A;  2E1N A;  2PJR A;  4UNO A;  4HNT A;  2NS0 A;  4EVI A;  3PFI A;  3DV8 A;  3E6D A;  3OR2 C;  3DLA A;  3DKY A;  4FHT A;  3M7G A;  4QPQ A;  2DK8 A;  4RB1 A;  5L3F A;  1ZN2 A;  2XVC A;  1V4R A;  5F0F A;  4GYG A;  1AKH A;  3I56 I;  1OCZ H;  3I3L A;  4C3J J;  4G7Z F;  4HV6 A;  2Y75 A;  4UVA A;  2R7Z J;  1VQ5 I;  2D1V A;  4A12 A;  5E3N A;  3HSR A;  3RYP A;  2EJR A;  3LA7 A;  2DXI A;  1SC7 A;  1JGS A;  3JTG A;  1QRY A;  3I59 B;  5JHF A;  5IPA A;  1YX5 A;  5LHG A;  2R7S A;  2DOD A;  3Q9V A;  2NYX A;  4R79 A;  1IV6 A;  3D5L A;  2R5Z A;  3M1E A;  3GZN B;  1RPW A;  5IOZ A;  3LSH A;  5K5O A;  1TC3 C;  2KIU A;  1SVL A;  4KDP A;  1WWX A;  2HZD A;  2F6C A;  3C18 A;  2Q8K A;  3BPX A;  4ZZD A;  1VQ6 I;  1ITY A;  1HLV A;  3ABL H;  4E70 A;  4QPO A;  2PFB A;  3S3N A;  5FD6 A;  2DYR H;  2GQQ A;  3E5Q A;  4A3K J;  2GM4 A;  4EJU A;  4A3G J;  2VQH A;  5C44 J;  2H6C A;  3QYE A;  4KMU X;  4K2E A;  5FKK A;  1FOW A;  5GPC A;  2OJE D;  2VC1 A;  4PJN A;  5EJC A;  2LBF A;  1WI3 A;  1MMS A;  2D2W A;  5EZH A;  2FJ1 A;  1UHM A;  4CYC B;  1R1V A;  2R7D A;  4MHG A;  2HKO A;  3L2V A;  4RM3 A;  1SVM A;  2ME0 A;  1JHH A;  1K79 A;  2Z1D A;  1ZRD A;  1FY7 A;  4FX0 A;  4PGG A;  3BR5 A;  2VBZ A;  2XAQ A;  3CO6 C;  2LKP A;  2ECC A;  2JK3 A;  3RPU D;  1ZR2 A;  4N9H A;  1OFC X;  1IGN A;  5E18 F;  2WC2 A;  4IXA A;  4M74 A;  4N4O B;  1S72 I;  2V1N A;  2XUB A;  5FKL A;  4P9U A;  1STZ A;  4P1W A;  3PFY A;  4EMS A;  2VAS A;  2LRD A;  3A01 B;  1NK2 P;  1ONV A;  3BP8 A;  3JCU C;  3U1D A;  1G3S A;  2L3D A;  5ILV A;  1YJN I;  2VIX A;  4BQA A;  3A4C A;  4RGR A;  2W84 A;  2EWN A;  4CGZ A;  2QA4 I;  1XSD A;  4MNU A;  3GX4 X;  3NWT A;  1LEB A;  4IL6 C;  4UVC A;  2KIM A;  3DKW A;  1JUP A;  1WI9 A;  2QM3 A;  1TWG J;  1FSE A;  3QU6 A;  4MLO A;  3JRE A;  2DI3 A;  2V79 A;  1F5T A;  2M5W A;  1I3A A;  3FXO A;  1RZ4 A;  3QQA A;  2KIQ A;  3J80 K;  2V1U A;  1K78 B;  3FMS A;  4JBA A;  3C3W A;  2A69 F;  2NVQ J;  1XS9 A;  4MQ9 F;  3PQK A;  1TZL A;  4IRG A;  4L0Z B;  3KEO A;  4XN0 A;  1A04 A;  3IWF A;  1K6Y A;  2DT7 B;  4LG3 A;  3K70 C;  4M3D A;  2XKO A;  1E0E A;  2OCE A;  2BVM A;  2LH9 A;  3FHN A;  3CUO A;  1PYV A;  1YHQ I;  2HOE A;  2E7X A;  2VT3 A;  5GTI C;  1R9T J;  3OYK A;  2LK2 A;  1U5T A;  3K4N A;  4AIJ A;  1IC8 A;  2LKX A;  2FSW A;  1U0J A;  2CUZ A;  1WJF A;  4UVB A;  1SVO A;  3AG4 H;  4V2F A;  4YIF A;  3ZMZ A;  3RKX A;  1PDN C;  2MC3 A;  2IGK A;  2GWR A;  1IDY A;  1D5Y A;  4JYK A;  4A0Y A;  3CLQ A;  3RJP A;  3HOU J;  2E1M C;  1QNT A;  2HQ5 A;  4PSW A;  4UUS B;  2VN2 A;  3J7Y J;  2MGQ A;  4D5C A;  2MLG A;  3V4G A;  2QBY A;  1KU9 A;  1D8J A;  4KIB A;  3ZMS A;  3VPR A;  2JVH A;  4M73 A;  2WB1 A;  1BC7 C;  1R58 A;  1Z7L A;  2CGP A;  2KT0 A;  2W48 A;  5E20 A;  4PDK A;  5AIP A;  4BUP A;  2E2J J;  2HQA A;  1HW1 A;  1UMQ A;  2DA2 A;  3OYI A;  4J01 A;  3PUB A;  3FIS A;  1RES A;  1MBH A;  2IGO A;  2QZ8 A;  2ZCW A;  3GTM J;  1WSU A;  4ASN A;  2L7F P;  2RGV A;  1K7A A;  3KIO A;  2CRG A;  4IQ4 A;  1BOA A;  3KP7 A;  4XLN F;  2EV5 A;  5EEA A;  5F27 A;  4ABZ A;  1T39 A;  3ECO A;  3A01 A;  1IZ1 A;  4BKX A;  1N75 A;  2A6E F;  1RUO A;  3GTG J;  3P9C A;  1UG0 A;  2HPM A;  2K5C A;  2IVM A;  5K5Q A;  4DZP A;  5D5U B;  3W6V A;  1NK3 P;  1VQ8 I;  1JKP C;  5BPD A;  4XQF A;  1XMX A;  3KLO A;  4M9X A;  3OYL A;  1YW9 A;  2OCC H;  2XGE A;  3ISP A;  3CJR B;  3H9Q A;  1OCR H;  4A3J J;  2LBF B;  1Y1V J;  2ZKZ A;  3JAM Z;  3HIF A;  5FLX K;  3SZG A;  2QF7 A;  2XB0 X;  3M1C A;  3A2K A;  3SDB A;  5AON A;  1VQK I;  4PSX A;  1KQ0 A;  2ISZ A;  3NAU A;  1DP3 A;  2M3A A;  1LVA A;  3HB9 A;  3PM1 A;  3CDH A;  3V8L A;  2EPF A;  4LD5 A;  5GP9 A;  2K9L A;  1MMA A;  3BTL A;  5GAD J;  5HS8 A;  1X1D A;  3FXQ A;  2K02 A;  4RAZ A;  3UKG A;  1IG7 A;  2IP2 A;  2GOX B;  3U9G A;  3SZP A;  2NAZ A;  3PSF A;  3TDZ C;  2IPQ X;  2P8T A;  1TW2 A;  2EIL H;  3RCO A;  4XM3 A;  4YRV A;  3HTS B;  2L02 A;  2DLL A;  3IH3 A;  2XPV A;  3Q0W A;  4AVZ A;  2FML A;  2PMZ A;  1SAN A;  3I4M J;  5DCF A;  1MIJ A;  5FGM A;  5GAH J;  2RAE A;  1JGG A;  4UB8 C;  5C4X J;  2DMQ A;  3HSE A;  3I59 A;  4LLG F;  5IT3 A;  2XAJ A;  4Z6Y A;  3RZO J;  4ENJ A;  1ETX A;  3E6B A;  3GTO J;  4Y15 A;  1XB4 A;  2F48 A;  3FDY A;  1XD7 A;  3LQR A;  1S8N A;  2LYC A;  1MSF C;  5LHH A;  3L7W A;  3F9K A;  5GTH C;  2LF8 A;  4S05 A;  2ACJ A;  3ZGK A;  1R71 A;  1XX5 A;  3S1R J;  1GV5 A;  1AKH B;  3BR1 A;  3JAM K;  2FD5 A;  4E7Z A;  1SFK A;  1Y0U A;  5DCM A;  2B9S A;  4AYB A;  2JJ7 A;  4U7D A;  4CUG A;  2VT2 A;  4M71 A;  5M5W J;  2ZNY A;  1PUE E;  3JW4 A;  4D7N A;  1W7P D;  3VDX A;  4HAM A;  5DM6 F;  1XCB A;  4PJJ A;  2Z3Y A;  4XBF A;  4BE0 A;  1XGM A;  2AHQ A;  1V5F A;  2IA0 A;  3BWG A;  1E3P A;  1FOY A;  1FOX A;  1QPI A;  1KYW A;  2NRA C;  3BCA A;  1V5E A;  3CUQ C;  1KU2 A;  4BJ6 C;  1Z9C A;  3PJR A;  2XAS A;  2JVG A;  1DGR M;  1FBQ A;  3TL4 X;  5HDG A;  4E4H A;  1RR8 C;  2HQR A;  3NQO A;  1X1P A;  3EUH A;  2MAB A;  4YG2 F;  5KAI C;  2KIF A;  4L5E A;  2OU2 A;  4CYD A;  4E7J A;  3CUQ B;  4L5J A;  3D1N I;  3PNT A;  2XF5 A;  4JX4 A;  3FXR A;  4CCM A;  3HC7 A;  5H20 A;  2VON A;  4XKV A;  1P92 A;  4PJM A;  3GO5 A;  1NHA A;  2ZXI A;  3TOA A;  2M45 A;  2LF7 A;  2VJ5 A;  5FRM A;  4BXX J;  3F8M A;  2DMP A;  2DA6 A;  3RQI A;  3EYI A;  3CCM I;  3HZJ A;  3S3O A;  1B59 A;  1IDZ A;  5IYD J;  2NVY J;  2PX9 A;  5IP6 A;  2IRF G;  4RGS A;  1TWH J;  2HDW A;  4OIP F;  4ENM A;  1YJ9 I;  2X1C A;  3RKW A;  4AD9 A;  1J09 A;  2I8D A;  2WAE A;  2DT5 A;  1FWZ A;  3GEZ A;  3I64 A;  2NXN B;  5JHU A;  2MH9 A;  3SFZ A;  2XGD A;  1UZC A;  2O03 A;  2PBI A;  1EH8 A;  4JX6 A;  1NTC A;  2GA2 A;  3V42 A;  4E6K G;  4HNV A;  1KA8 A;  2ELJ A;  3TP0 A;  3L2W A;  2IA2 A;  3BZ6 A;  1T95 A;  4JP0 A;  3JRG A;  3M4O J;  1LE8 A;  5HOD A;  1D3Y A;  2DJI A;  2W25 A;  1GVJ A;  3TO9 A;  1HKQ A;  4XLH A;  1TNT A;  2JSP A;  2KLO A;  2R5Y A;  2HDD A;  2RQQ A;  4B47 A;  3HOW J;  4NBQ A;  4U88 A;  3W2W A;  3WTZ A;  4EJV A;  2H1L A;  1P2F A;  4U87 A;  3FKJ A;  3C2H A;  2IEK A;  2LFB A;  3WU2 C;  1FNN A;  4E7L A;  3ZPL A;  1LDJ A;  3CF5 F;  3KFW X;  4MTE A;  3RSN A;  1BIB A;  3G71 I;  5F0C A;  4F52 A;  3KP5 A;  2OTL I;  3R60 A;  3QPS A;  1NG7 A;  2F4M B;  4EQQ A;  2FBH A;  3TKY A;  2H09 A;  1UCR A;  5KNL A;  1SFO J;  1FZP B;  2JRM A;  2HOT A;  1MMN A;  1UJ8 A;  4BHP A;  3GLX A;  3OS0 A;  1J0R A;  1EA3 A;  5IT9 Z;  4PFO A;  3CDI A;  2WTE A;  4BAY A;  3HJE A;  3FM3 A;  3H92 A;  1ULY A;  2E71 A;  2JT1 A;  1Y56 A;  5CQG A;  4HF0 A;  4E7I A;  3S15 J;  2Y9Y A;  3QOD A;  4FQG A;  3ROU A;  3JRI A;  4ZDL A;  2JA8 J;  3VSK A;  3BR3 A;  1KZH A;  4M6V A;  5L3E A;  2GXG A;  4OIN F;  4M9Z A;  5DS9 A;  3K4C A;  2I5U A;  4ZDO A;  3LSI A;  5EGO A;  4M3G A;  3Q0U A;  2P7V B;  3CDL A;  4QTR A;  1HCR A;  2HKX A;  4A3B J;  2OZU A;  1U78 A;  2M87 A;  2FNA A;  4XL9 A;  2CG4 A;  2H94 A;  2Y69 H;  1A6I A;  3ABM H;  4XKB A;  3LSR A;  2YUS A;  2V6E A;  4X1E A;  1UB9 A;  1WJD A;  4QIW N;  4XOT A;  4Y7N J;  2X6X A;  2ZME A;  3E6C C;  3D0S A;  2R5Y B;  4BNC A;  1MMG A;  3BT9 A;  3WTY C;  2ZXJ A;  1VQO I;  2L7Z A;  5HNF A;  4BXF A;  3CCU I;  3KEQ A;  2BW3 B;  1R5G A;  3IWZ A;  5J3L A;  5EYR A;  2Y0S N;  2WB1 N;  3BR2 A;  1UHS A;  1Z67 A;  2KZG A;  2W4S A;  3ZQH A;  1DPU A;  2RVC A;  3OYJ A;  4FT8 A;  1AA7 A;  2XAU A;  1B9M A;  2YR2 A;  1LJ9 A;  4CA0 A;  4E7K A;  2R7X A;  3ABT A;  1JT6 A;  2HZT A;  2ZO4 A;  3WGG A;  2DOE A;  2V9V A;  3DTI A;  2M30 A;  1DGW Y;  3T1B A;  2EIK H;  3OIP A;  3TBI A;  1BIA A;  5LD2 C;  2K4J A;  1BOB A;  3EDP A;  2KDO A;  4CCJ A;  3VYR B;  4AWX B;  3OYE A;  5M3F J;  1XC5 A;  2UXN A;  3WOD F;  2FXA A;  4C2T A;  4LG0 B;  3HUG B;  1MGT A;  2XRL A;  3Q9S A;  1ZGJ A;  4ZZL A;  3BCB A;  3HM5 A;  2YS9 A;  4KIG A;  5LGN A;  1G3W A;  4WXC A;  4YEJ A;  3OSF A;  3F6V A;  3QRF F;  1IRG A;  3FX3 A;  2P81 A;  3MFK A;  4W1U A;  3IRQ A;  2C6Y A;  3B6C A;  4F7Z A;  3W2A A;  1B1B A;  1BC8 C;  1R6R A;  1D8K A;  4GXO A;  1FMV A;  4S04 A;  4DYQ A;  2PEX A;  1SD4 A;  4LB6 B;  3P7N A;  2O9L A;  2JRT A;  2OUM A;  4DOZ A;  3FK7 A;  3K4J A;  3WE2 A;  1ZAO A;  4OOI A;  4OWR B;  3SHF A;  3LMM A;  4N0B A;  3CCV I;  4DBR A;  2JZY A;  3WG7 H;  1ZRE A;  3L9F A;  1IN4 A;  1W5S A;  2MH2 A;  4BAC A;  4R1H A;  1CQT A;  4EV0 A;  3WGH A;  2JWT A;  4B48 A;  4GCV A;  3RPU A;  1PJR A;  4KYW A;  3ZMD A;  2BY1 A;  2IXS A;  3IH4 A;  1N77 A;  2OQR A;  5LRS A;  3RZD J;  3L09 A;  1FOK A;  4BJT A;  1UFM A;  2DQR A;  4U0V A;  3LNQ A;  3CMY A;  1JHF A;  4HW0 A;  2A68 F;  2QYO A;  3W6J B;  4ZYG A;  3W6K B;  3AG3 H;  1O3R A;  4CSW A;  2Y2Z A;  3AAF A;  1R5H A;  2RQP A;  5DCM B;  1E2X A;  3C7J A;  2BV6 A;  3I55 I;  1HXD A;  2J5P A;  3PIO F;  2DA5 A;  2FRH A;  4UUT A;  4HZF A;  2FE3 A;  4BEH A;  2L7K A;  1ZLJ A;  3ASO H;  2VBW A;  3PNV A;  1FPQ A;  1S7E A;  2GBY A;  4EM0 B;  2X1D A;  3M8J A;  5LBQ A;  2FMY A;  4LLN A;  3H35 A;  3MZY A;  5LRR A;  1FYL A;  3VYS B;  1R22 A;  4DQ2 A;  4BBS J;  1UEL B;  4A2U A;  4Y17 A;  3WU1 B;  2VOP A;  2XAG A;  3BZK A;  5FRO A;  3OSG A;  2M4G A;  2VOO A;  3OL3 A;  1ZG5 A;  4AVP A;  3H9G A;  2P0W A;  3OWT A;  3HGY A;  4AIK A;  3QWL A;  4A5M A;  3CCR I;  2FU4 A;  3CQZ J;  3HKZ A;  3O2P E;  4PZJ A;  1ZK8 A;  2CV0 A;  2A07 F;  3MVP A;  1GV2 A;  1YIO A;  1WJE A;  4KIT B;  4RB0 A;  1YFH A;  3A0B C;  2VQG A;  1LKX A;  2BHY A;  3MKL A;  2M8G X;  1QVU A;  4KIS A;  2LLK A;  3DBR B;  2M8E A;  1VTN C;  5ED4 A;  2CW7 A;  3IKT A;  2QQ8 A;  2NNY A;  4XLC A;  2M9H A;  1B8I B;  1OCT C;  1W4M A;  1LDD A;  2Q2E B;  2YX7 A;  3DPL C;  2A61 A;  1JJ6 C;  3D5R C;  2OZ6 A;  1LFP A;  4NDL A;  3G6E I;  3G1M A;  2DFH A;  2HXI A;  2L54 A;  5GPA A;  2XGC A;  3JTH A;  4JQF A;  1O3T A;  2VE9 A;  4LK1 F;  4HX4 A;  2WAF A;  3TMO A;  3DTE A;  2ID3 A;  2R92 J;  1XSV A;  4EEF G;  1QO0 D;  3JRD A;  3ZMU A;  3BRO A;  3GCM A;  4IF4 A;  4B3A A;  2LOO A;  2W00 A;  3J81 Z;  5DV5 A;  1MJ9 A;  2BBY A;  4XLA A;  3LFK A;  1F4K A;  2L9N A;  1MNM C;  1GXQ A;  2K27 A;  1USS A;  1VI0 A;  3BY6 A;  3O8G A;  2L9V A;  2MBF A;  2R7O A;  5J1R A;  1P9Q C;  2KKO A;  2V26 A;  4LOC A;  5TGT A;  1YS7 A;  5DYM A;  2ZJ2 A;  1JJ8 C;  1D0Z A;  5E8I A;  2P7C B;  4ITV A;  2VUM J;  3F8F A;  1ZQ3 P;  2D45 A;  3ZP5 A;  3HDD A;  2OA4 A;  4PJL A;  4KFC A;  2IS2 A;  2HNH A;  2NVU B;  4MTD A;  5IY5 H;  3HRU A;  1JE8 A;  2PN6 A;  2OD5 A;  2BXZ A;  4L9V A;  2EH3 A;  3QPT A;  2EIJ H;  3OS2 A;  1JUS A;  1I6H J;  2CV1 A;  1SFE A;  2EB7 A;  3OYF A;  1BN5 A;  4XIC A;  2MG4 A;  3ECH A;  3TED A;  2EBI A;  1I5Z A;  1MBG A;  3LSK A;  1O57 A;  2HPI A;  2B0L A;  1YS6 A;  4M72 A;  1WCM J;  5DM7 F;  2WWY A;  2CQK A;  1EF4 A;  1J5Y A;  3SEZ A;  2QCO A;  4GYI A;  2Z16 A;  3ZN0 A;  3ZN1 A;  3WTU C;  3F23 A;  3LA2 A;  4BJ5 C;  1BJZ A;  1D0Y A;  1IXC A;  1W36 C;  1I39 A;  3F6O A;  2H8R A;  2IS6 A;  4DYR A;  4ZDP A;  2E1O A;  1QQI A;  2DW4 A;  5DD4 A;  1ZYR F;  3BJO A;  3GZ5 A;  1T56 A;  2LKS A;  1MBF A;  1D1C A;  5M5Y J;  3CES A;  2DDA A;  2JQ7 A;  2L01 A;  3RYR A;  2IW5 A;  1ORK A;  3PNY A;  1FYK A;  2HVQ A;  1K78 A;  3K4K A;  3TO7 A;  1OCO H;  4XRS G;  2COM A;  1NH3 A;  5GAE J;  5BMZ A;  2K9S A;  3ASN H;  1OKR A;  5L3D A;  1ZRF A;  4HX8 A;  3H5A A;  5ICF A;  4XRS A;  3LOC A;  3EUK L;  2VBY A;  2R7T A;  5L3B A;  2ZME C;  2VI6 A;  4BYY A;  5CPR B;  2L7M P;  1ZTR A;  3H9J A;  3DPT A;  1WJA A;  2AO9 A;  1YI2 I;  2VQC A;  3BG7 A;  3G4S I;  2PMZ N;  4A3M J;  2JPC A;  3K4B A;  2JSC A;  3HOV J;  4B44 A;  2ZC2 A;  2EZK A;  1SEU A;  1UAA A;  1YO5 C;  2WV0 A;  3ZQ7 A;  1LEA A;  5H2F C;  1X3U A;  3EPZ A;  5CVR A;  3GXO A;  3MQ0 A;  1TT5 B;  2JN6 A;  3PQJ A;  1HDD C;  4F55 A;  2STT A;  2VC0 A;  1MJB A;  2GXB A;  1MH3 A;  5CVU A;  9ANT A;  4RA2 A;  3VSL A;  1IUF A;  3MWM A;  2GAU A;  1DU0 A;  1T0F A;  4A3D J;  3FMR A;  2Y0M A;  1LB2 A;  1KU7 A;  4NHJ A;  3S1Q J;  5IYC J;  4W97 A;  4XLE A;  1ETQ A;  4D0P A;  4ZTJ A;  1R49 A;  1IN8 A;  3ZCO A;  3FXU A;  1BM9 A;  2Y30 A;  4XOR A;  2R7V A;  2OF7 A;  3N4M A;  2W7N A;  1XG1 A;  1Z1D A;  2TRT A;  1YTY A;  2W85 A;  4C9Y A;  1HC8 A;  4YFN F;  4B43 A;  2EA4 A;  2RNG A;  2AQF A;  2MW8 A;  2KIS A;  2LVS A;  4QLC U;  3FXM A;  3QOP A;  1LPQ A;  2DFE A;  2DTR A;  3MKZ A;  1F36 A;  2FQ3 A;  1QU3 A;  5FFX A;  2CW0 F;  4IRH A;  1HOM A;  1HQC A;  2DK5 A;  3I53 A;  2VLA A;  1F9N A;  4UXN A;  2WAQ A;  4I02 A;  1N25 A;  1XMA A;  3IAM 2;  4A6E A;  1BA5 A;  5E1W A;  1LQ1 A;  2CSO A;  1YLF A;  1T98 A;  1RI7 A;  1B4A A;  4I76 A;  2LY2 A;  3CJN A;  5F08 A;  2RDP A;  3F0C A;  1Y39 A;  3MKW B;  5FLV A;  5E3L A;  3OYC A;  2EFO A;  4OIQ F;  1P4X A;  3L1P A;  4YFK F;  1IRZ A;  2RRE A;  2KL4 A;  1X2N A;  1OR7 A;  2VPR A;  3LSG A;  1IRX A;  1S5L C;  5E1Z B;  1H89 C;  3TDU C;  1X19 A;  3FMQ A;  4PFP A;  4A3E J;  1VQ4 I;  1FIA A;  4M9S A;  2CQX A;  2CU7 A;  2O0Y A;  5M5X J;  4YII A;  1HKS A;  3EUA A;  5LEJ A;  2VKV A;  4MIM A;  3CTA A;  4G94 A;  1V3F A;  3DFG A;  2RC4 A;  5JR3 A;  3HL2 A;  2QQ9 A;  1KGS A;  3QOE A;  1U6G A;  1ZGA A;  2G7U A;  1WJB A;  3SEQ A;  3QP5 A;  3U1K A;  1XMK A;  1B72 B;  4ZYH A;  4N4N B;  2LP0 A;  4IPA A;  3O8H A;  1ZH5 A;  2M1B A;  3UNG C;  2EV0 A;  2XF7 A;  1W0T A;  2KJB A;  4II3 A;  1BW5 A;  3IC7 A;  3A02 A;  2H8W A;  3BC8 A;  3HHG A;  3WGI A;  2ZJR F;  3LAJ A;  3Q0V A;  2CQQ A;  2XIG A;  5A2Q Z;  4KA4 A;  3OYM A;  1FLI A;  5DUK A;  1E3H A;  4KNY A;  2KQR A;  3LSM A;  1JTX A;  1MMD A;  1Z3Y A;  3HKZ N;  3S8P A;  4CCO A;  2ELH A;  4XKW A;  4FE4 A;  2DA4 A;  5F64 A;  1TQM A;  2E34 A;  2EA2 A;  3PSI A;  3RDI A;  3RPQ A;  1OLT A;  1VQ7 I;  2DOA A;  3OMY A;  3VYU B;  3FBI B;  5CKT A;  4B09 A;  3NEU A;  1X3Z B;  2YU9 J;  1ZR4 A;  2DPU A;  2HVS A;  2K7L A;  3DPU A;  1N78 A;  1BL0 A;  1I27 A;  4ZYA A;  1O7F A;  4BS9 A;  1MNE A;  5B66 C;  5C4J J;  5IT9 K;  3NWS A;  3H1C A;  2G0E A;  4HQM A;  5M3M J;  4LGW A;  1IF1 A;  5HLI A;  1Z6R A;  4LIV A;  4BQN A;  3G1L A;  1T08 B;  1I1G A;  1YJW I;  1APL C;  1IW7 F;  1KYZ A;  4WX9 A;  1SD7 A;  3KE2 A;  2E5N A;  4P96 A;  4F3Q A;  2VE8 A;  1DUX C;  2ZBK A;  5KVR A;  1RKT A;  4C2U A;  1Z7U A;  3HPG A;  2BXY A;  2XPU A;  1XN7 A;  3CMM A;  3LFU A;  3GBG A;  2FOK A;  3RKY A;  3PL8 A;  1IUY A;  2E35 A;  3C2B A;  4LB5 A;  1WKM A;  2HTS A;  5ICE A;  4NC8 A;  1HST A;  2FBK A;  2KRH A;  2GIV A;  1V54 H;  4KT5 C;  3I71 A;  1VND A;  4NC7 A;  3BR6 A;  5EG0 A;  3S16 J;  4AUX A;  4JX5 A;  1TL8 A;  2CS3 A;  1VZ0 A;  1Z91 A;  5FFZ A;  3KP4 A;  2A3S A;  2K9Q A;  4I01 A;  4FX4 A;  2ICW G;  2P5L C;  2O61 A;  1ZHF A;  2QVO A;  3U2R A;  2V7F A;  3NAR A;  5IOY A;  4HQE A;  3F22 A;  2KFD A;  3HUG A;  4LG0 A;  3A03 A;  3HPH A;  1GDT A;  4IOA F;  3OY9 A;  3IAS 2;  3E97 A;  2EQR A;  1IRF A;  2BY2 A;  3SFI A;  1KQ8 A;  2R93 J;  4GFB A;  1WPK A;  3I9V 2;  1W0U A;  1GXP A;  1TWC J;  3P9I A;  3GLL A;  2A6T A;  1R4M B;  3GTL J;  1WVR A;  4HST A;  3GUD A;  3CF2 A;  4HF1 A;  4OIR F;  1E17 A;  4ENN A;  4D9J A;  1POG A;  4L9T A;  1OYI A;  4NNJ A;  1YRN A;  3KLN A;  3C1D A;  2Z99 A;  4M3B A;  1YE9 A;  5K7Z A;  2CJJ A;  4U7B A;  2X6O A;  2TDX A;  4QWQ A;  3HOZ J;  3JSP A;  1J2X A;  4I09 A;  4MGR A;  5EZG A;  1W7P B;  3TOB A;  1B9N A;  1DQU A;  4XK4 A;  4KMF A;  2OTJ I;  1J9I A;  2BW3 A;  4U0W A;  4I2O A;  5FKN A;  3N97 A;  3VWB A;  3MMY B;  1FJL A;  3TP3 A;  4A6D A;  1HF0 A;  4BQO A;  1E3O C;  4I7H A;  1EH6 A;  4BDY A;  1WH5 A;  2MA3 A;  2W1O A;  5HNH A;  4AM3 A;  5D8K B;  2L2O A;  2HXO A;  5E1X A;  4KUM A;  2EIN H;  4NUB A;  2PJP A;  2X48 A;  2QKM B;  1JUM A;  3AL0 C;  1MBK A;  5ICC A;  4BHC A;  3GTP J;  1QHG A;  3JRC A;  2DMT A;  1F1Z A;  1P7I A;  3B73 A;  3VFZ A;  4A3C J;  5K7H A;  1D5V A;  5LEK A;  2CUE A;  4EJT A;  1RIO H;  2GA1 A;  4PUS A;  1Z3X A;  2BE5 F;  2EIM H;  5D4R A;  2K3P A;  3AL0 B;  3H0G J;  3CZ6 A;  2E36 A;  2J5O A;  3DBL B;  2W57 A;  3R0J A;  3BG5 A;  1JKQ C;  1LVK A;  5E3M A;  2ZNZ A;  4KN7 X;  1F43 A;  1D0X A;  4PCQ A;  3KP6 A;  4OIO F;  2LSO A;  4WK8 F;  2FF4 A;  4OMY A;  5D5X B;  2LMD A;  3KZZ A;  4ANJ A;  3QAH A;  2X6Y A;  4KN4 X;  5J8C A;  3BJA A;  1BI3 A;  1ETO A;  1MBJ A;  2WAQ N;  4L5I A;  3CCE I;  2ME6 A;  1X4O A;  2DU9 A;  4IVN A;  4DJA A;  2HU9 A;  4HSR A;  1OCP A;  2WAD A;  5J40 A;  4B3X A;  2JTV A;  1T38 A;  3CP8 A;  2KRF A;  2JUG A;  3S17 J;  3BQY A;  4CXF A;  2Z9O A;  3CCQ I;  2CMP A;  5CJ9 A;  2XAF A;  5FB2 A;  4Y13 A;  1MDM B;  2RV8 A;  5BNG A;  4ETS A;  4NQW A;  1EH7 A;  5HLH A;  2O6G E;  3BTJ A;  1BR1 A;  2QGU A;  2K40 A;  1FIP A;  2EV6 A;  2GLO A;  3CCL I;  1AU7 A;  2ETH A;  2DYS H;  3MZH A;  1H88 C;  2K9N A;  1TNS A;  3DEU A;  1Z6T A;  3O3K A;  1RC9 A;  4D7M A;  3DBH B;  3LSP A;  3CJT B;  1ETV A;  2B63 J;  4XNF A;  1FMW A;  4CZC A;  3Q3S A;  4FTH A;  4C3I J;  4BDZ A;  2DDB A;  4J19 A;  2ISY A;  3GME A;  4G12 A;  1X1B A;  4M6Y A;  2Z5U A;  2JPB A;  3RQ4 A;  3GW2 A;  1R5I D;  5KK1 A;  3M9A A;  3FF5 A;  4I99 C;  1FC3 A;  3OS1 A;  1X1C A;  4BXU A;  1FP2 A;  3HYI A;  4RM2 A;  5CLS A;  4C3H J;  1SAU A;  3DWL E;  2GOM A;  2L0K A;  3G1O A;  1RUN A;  5ICG A;  4F92 B;  3DLL F;  3IKV A;  1RRJ A;  4A93 J;  1HW5 A;  2HR3 A;  2UV1 A;  2H1K A;  4XRM A;  1ETY A;  2V9P A;  1A36 A;  3GTQ J;  3IRR A;  1MZB A;  1GHC A;  3SDG A;  1WZ2 A;  1MDM A;  2JA5 J;  4II2 A;  4CH7 A;  3J81 K;  1LFB A;  4G9Y A;  3LST A;  4PJ0 C;  3MD2 A;  3CCJ I;  2LNB A;  4JK1 X;  2EFQ A;  2BOL A;  2KMU A;  1YIT I;  3AG1 H;  2V9K A;  4CIC A;  1REP C;  5BQT A;  1T33 A;  2D1H A;  4IKF A;  2X51 A;  3GYH X;  2DBB A;  2XF6 A;  4RGX A;  3WHC A;  2AS5 F;  1QZE A;  1YYV A;  2XKP A;  3MEX A;  4S0H B;  1B72 A;  5TIS C;  3J7Z I;  3COA C;  3OYH A;  1YW7 A;  4HF2 A;  1HBX G;  4L9J A;  2E5Z A;  3CC7 I;  3GFM A;  4BE2 A;  2FX0 A;  4MQV A;  3KPH A;  2QEX I;  5C3E J;  2Y9Z A;  3WHB A;  1PP8 F;  2JA2 A;  1LUJ B;  3UR3 C;  3GTJ J;  2M7B A;  4BH9 A;  1OMI A;  2VKE A;  2HWV A;  4A0X A;  1ZRC A;  4IHS A;  3K1N A;  2WA0 A;  1Q1H A;  2VKD A;  2DFI A;  4XSZ F;  5D5V B;  5D5W B;  3L2C A;  3V7C A;  3FZV A;  2W82 A;  4A5N A;  3M8E A;  3REO A;  1TWA J;  4DGW B;  1H9T A;  1FBS A;  4EAT A;  4WCG A;  3KYC B;  2CQ7 A;  4KJZ A;  2R3S A;  3CLO A;  1TW3 A;  5J1Y A;  3OYB A;  1HW2 A;  2M34 A;  2O3F A;  2OBP A;  3R6S A;  3MAJ A;  4O3M A;  2HVR A;  3GTK J;  2F5F A;  2G7H A;  3R4K A;  1FTZ A;  5JLW A;  4A3F J;  4X0G A;  3DEW A;  2EZH A;  3SXY A;  2P6T A;  1IV8 A;  3TW7 A;  2O5R A;  3AFH A;  1PP7 U;  1B6A A;  3IH2 A;  4Q4Z F;  4XN3 A;  1ZGW A;  3S1M J;  4EM1 A;  4YIR X;  2KZV A;  5L3G A;  2D5V A;  2LDU A;  4R8H A;  1UHW A;  2X1E A;  1A5J A;  3DEE A;  1W5T A;  4RLQ A;  2TCT A;  3KYD B;  2R7Q A;  3K7A J;  1YRN B;  4OU0 A;  4FCY A;  1WQ2 A;  2PLY A;  1I3Q J;  4BBR J;  1R36 A;  3KP2 A;  5FKM A;  3ZR8 X;  3L2Q A;  5FKO A;  4ZYE A;  4HEA 2;  2STW A;  1MKM A;  2VB6 A;  2HDC A;  5DEQ A;  5B1B H;  4EGZ A;  3KET A;  2DJN A;  2RN7 A;  3DP7 A;  1GVD A;  4KT6 A;  3S93 A;  1BBY A;  4MFD A;  5BS6 A;  2X0L A;  1I50 J;  3HXL A;  2E1M B;  3ML6 A;  1ENH A;  4HNU A;  4IHT A;  3K0L A;  2VL8 A;  3FK6 A;  1OCC H;  2DOF A;  2CQN A;  5F1J A;  4D1Q A;  2ESN A;  2QQB A;  4YEL A;  1G59 A;  2GIZ A;  4AIH A;  3BLY A;  4CCN A;  4BGD A;  5F1R A;  5IYB J;  1FTT A;  3DXJ F;  3G2B A;  1D1A A;  1XDS A;  3F3X A;  5K5R A;  5BOX A;  3ZQG A;  1AWC A;  4M3F A;  3BDD A;  1ZAR A;  1YG2 A;  4A3L J;  2IT0 A;  2P6S A;  2ZFW A;  3GFJ A;  1W5C C;  1JXS A;  3CP2 A;  3Q5F A;  2I10 A;  4ZTF A;  4IZZ A;  2XGX A;  2Z2S B;  3SQN A;  3IV5 A;  3WG9 A;  1CGP A;  3OIQ A;  1ODD A;  1T6S A;  5EEG A;  5FLM J;  3B6A A;  3T8T A;  4E7S A;  3AG2 H;  5HLG A;  1S7A A;  3ZMT A;  1KU3 A;  1G8X A;  2VXZ A;  3H36 A;  2FEZ A;  4WXD A;  3E3V A;  1D1B A;  2M4K A;  3VB2 A;  1X2M A;  3W2V A;  2JA6 J;  1A6Q A;  2KHM A;  5J8F A;  1BW6 A;  2XAH A;  1QVT A;  3FXJ A;  4XKC A;  2VOD A;  4HBL A;  3HHH A;  4IHX A;  4HOB A;  2FNP A;  4Y52 J;  4EJW A;  1YQA A;  4CZZ A;  1P7J A;  3V7S A;  4IEJ A;  3BTC A;  2AQE A;  5D8L B;  1QBJ A;  3X2Q H;  1U8B A;  3ABK H;  4MFE A;  3ZRG A;  4A0Z A;  4ZYD A;  1VFC A;  2ZB9 A;  3QP6 A;  2ZJQ F;  1FBU A;  1EKE A;  4RDU A;  2BVL A;  2DMN A;  2RNJ A;  3K2A A;  1BI2 A;  5ERI A;  1VF9 A;  1TQP A;  5HLT A;  3P5J A;  5H6Q A;  3FIW A;  1R7J A;  1K6O A;  3KZY A;  1J75 A;  1YIJ I;  4N9I A;  3PO2 J;  4DIQ A;  1YX3 A;  3HOY J;  2R0Q C;  1OJL A;  2R7R A;  1WJ5 A;  3H5N A;  2KDZ A;  4G7H F;  4ZH4 F;  2HOA A;  5DUI A;  4XSX F;  4H4K C;  4UUV A;  1EV7 A;  2VJ4 A;  3E1S A;  4RLF A;  3CCS I;  2GXA A;  3KX2 A;  1S3J A;  4FET A;  2KP6 A;  1Y6I A;  1P6R A;  3ERE D;  2LY1 A;  4U0Y A;  3B02 A;  3E6M A;  2DA1 A;  1R00 A;  2Y31 A;  4HX7 A;  3K10 A;  4WF2 A;  5CVI A;  1S7O A;  2OV7 A;  4BY7 J;  4RB3 C;  4EJO A;  3M8F A;  2P5V A;  3BTI A;  5D6E A;  1K83 J;  1JI8 A;  3JR9 A;  1CF7 B;  2H6B A;  2OQG A;  5LGT A;  3IL2 A;  3MN2 A;  2CW8 A;  4HG2 A;  1X3W B;  5FD5 A;  1CF7 A;  2DN0 A;  5J1U A;  1TP4 A;  4AC0 A;  2HYJ A;  3ONQ A;  5EDN A;  2VQL A;  1TT0 A;  1SMY F;  3ELK A;  2DTZ A;  4XOP A;  1V5G A;  2A6H F;  4CYC A;  1A31 A;  4Y3O A;  3DF8 A;  2K3F A;  1HA8 A;  3CO7 C;  3U21 A;  2CWE A;  2Q2E A;  3I0T A;  2A5W A;  3IUO A;  1B8I A;  3G3Z A;  4ZJZ A;  1OR7 C;  2F4I A;  3CC2 I;  2QKL B;  3CD6 I;  2K86 A;  1YW8 A;  1RET A;  1IO2 A;  2YPR A;  3I5U A;  2WY7 Q;  3MZ8 A;  2VBX A;  3HRT A;  3E0J B;  3OYG A;  3OYN A;  1JT0 A;  3K1P A;  2QSG X;  3CME I;  1FYM A;  2LD5 A;  1IN5 A;  3OR1 C;  1QZZ A;  2QEN A;  2EFW A;  4LK0 F;  2UUZ A;  5DDG A;  1XGN A;  4LFU A;  5IP9 J;  4KIF A;  4GGG A;  3HBL A;  2RKH A;  4H0E A;  1Z0X A;  4C30 A;  3E5X A;  1MBE A;  2XPW A;  2E60 A;  4IHV A;  3WU0 A;  2NOJ B;  2HTJ A;  3ZQI A;  4CCK A;  5J6X A;  2R7F A;  4BE1 A;  1ZLK A;  2VJI A;  2M7A A;  2R5Z B;  5B1A H;  1GLN A;  2COB A;  4B1R A;  4B8X A;  1LNW A;  3SJM A;  2NNN A;  3I54 A;  1LDK B;  2XDV A;  2Y48 A;  4Q48 A;  3S14 J;  2K9M A;  3F8B A;  4LIT A;  5E3O A;  4HV5 A;  4D5F A;  3FBN B;  4XON A;  3M07 A;  3K4L A;  1IXS B;  2YSR A;  4GRI A;  4P5O A;  4TV7 A;  5CQE A;  2DPD A;  2O8K A;  3SZT A;  3ULQ B;  3K6G A;  1TWF J;  1OQY A;  3BQZ A;  4HLY A;  2Q0O A;  3S2W A;  2CUF A;  4HRI A;  2MC4 A;  5LHI A;  3ZOB A;  2JA7 J;  1FSH A;  4CO8 A;  1G3Y A;  2O8X A;  1BI0 A;  3OOP A;  2YX4 A;  4MEY F;  4E7H A;  2R7U A;  5E8G A;  1MH4 A;  3RIR A;  2CYY A;  2LR8 A;  1DU6 A;  1O3S A;  1HSJ A;  4XID A;  2AXL A;  3QYF A;  2PJR B;  4G6T B;  2ELK A;  2JUC A;  3E7L A;  4MO7 A;  2CO5 A;  4G6D A;  3LAP A;  1O3Q A;  2HOS A;  3BR0 A;  2JMW A;  4G8X A;  2UWM A;  1V55 H;  1H0M A;  5LFA A;  3F8N A;  1TQI A;  1TTY A;  2BGC A;  3WTS C;  4AID A;  5IP7 J;  4OAZ A;  1IAW A;  2O7O A;  3HEF A;  1RNL A;  5HS7 A;  3C2G A;  2AXT C;  3J80 Z;  2XB5 A;  2Y0S A;  4I0B A;  1JKR C;  2XRO A;  3HOX J;  1XCV A;  3A1Y A;  1J7K A;  3FXL A;  1W36 D;  3V7R A;  2X4H A;  2NS7 A;  1Z77 A;  4UB6 C;  4HDV A;  2EFP A;  2V6C A;  5F04 A;  4RGU A;  1X1A A;  4FE7 A;  2IS1 A;  2FA5 A;  3EET A;  1AOY A;  2IJL A;  3V8J A;  3M3Y J;  3DU6 A;  2M2E A;  2ZXH A;  1G4D A;  3P9K A;  4HPQ A;  1SAX A;  4EM2 A;  2NVX J;  3FXK A;  3DQV C;  4ZC3 A;  1LFU P;  1VQP I;  1T0F C;  1FP1 D;  1U8R A;  1HDP A;  2ECB A;  1IXR C;  3WTW C;  5FO5 A;  3BJ6 A;  4GO1 A;  2F2E A;  4NB5 A;  4Q47 A;  4LLL A;  1L0O C;  2CUJ A;  3BG6 A;  5E17 F;  3TQN A;  3H3Z A;  5DD8 A;  5D4S A;  1OPC A;  1HKT A;  4O6J A;  4IQJ A;  1BR4 A;  1A35 A;  2EK5 A;  3JRA A;  5BPI A;  1KQ9 A;  3S1N J;  5D6F A;  2PQ8 A;  5J4V A;  2IAI A;  4RB2 C;  1VQM I;  4P9F A;  4I0A A;  3J7A Y;  3TGN A;  3HGG A;  5HDN A;  2HGC A;  1IJW C;  1RR7 A;  3AKZ A;  2QUF A;  3MCZ A;  4IRI A;  2KJC A;  2QSH X;  4LIU A;  3V8K A;  1WJC A;  1ZG1 A;  1GUU A;  1W1W E;  2KRC A;  1ON1 A;  2ZME B;  3K9T A;  4HYE A;  3JRH A;  3W3C A;  2N8G A;  3HOT A;  4F93 B;  3I4N J;  1PVE A;  4RAY A;  5CVV A;  1QA6 A;  4B4C A;  5LGU A;  2XSD C;  4NC6 A;  2PMH A;  4L0Y B;  2OPT A;  3HRM A;  1QZY A;  5HOO A;  5EGO B;  2BZT A;  3LSJ A;  3N05 A;  2PI0 A;  2FBI A;  5KAF C;  4ON0 A;  4IX7 A;  1QPM A;  4IHW A;  4Y33 A;  3H3V K;  3QPL A;  1R1T A;  2MD0 A;  1O7L A;  2VXD A;  3S2D J;  1IN6 A;  3F21 A;  2BHZ A;  2UZK A;  1U9N A;  5J4Y A;  4O5V A;  3ZXS A;  2X6W A;  4DNC A;  1ACI A;  5FLX Z;  1Q1V A;  3EUH C;  1H9G A;  2Z33 A;  2IS4 A;  1BJA A;  3K4M A;  3T5X A;  4RS8 A;  2VJJ A;  2L9S A;  3CJQ B;  4BHB A;  2DQL A;  2MFZ A;  3BG9 A;  1U3E M;  4FAS D;  5K1Y A;  1SMT A;  5H6R A;  4QSH A;  4KIC A;  1K61 A;  2E2H J;  2XSJ C;  3LQQ A;  1MD0 A;  5K7F A;  4CHU A;  2HYF A;  3JRF A;  1XSX A;  4IJA A;  1S6L A;  2CV2 A;  1X58 A;  2VKH A;  3ERM A;  1DP7 P;  3CCY A;  3WTV C;  3DKX A;  5FJ8 J;  1PUF B;  3ZQC A;  1WFX A;  2DFF A;  2ADU A;  2QSF X;  3H0D A;  1KON A;  4FIS A;  4M6X A;  1LE8 B;  1VQ9 I;  3J7A O;  1ZG3 A;  4UV8 A;  1EJ9 A;  1G3T A;  1I1S A;  3PIP F;  3DU5 A;  3T8R A;  1AHD P;  1R23 A;  4BEH B;  1ETK A;  2FQ4 A;  3SYT A;  2R7W A;  2X85 A;  2Q1Z B;  4WWC A;  1SD6 A;  2L5Q A;  3BOQ A;  4LJZ F;  2UXX A;  1S29 A;  3KP3 A;  4L9N A;  4XR6 A;  4MEX F;  3IP4 B;  1H8A C;  1XGO A;  4UV9 A;  2ZFU A;  3R0A A;  3QU3 A;  3OL4 A;  5HS9 A;  3OV8 A;  2NVT J;  3I58 A;  4RBO A;  2HEO A;  5B5E C;  3S2H J;  3KYL A;  1ERD A;  1Z05 A;  1WGX A;  1VQN I;  1R4N B;  2IA1 A;  1FEX A;  1ZEL A;  3A0H C;  3LL7 A;  5TJJ A;  3MKY B;  1K4S A;  2ZJP F;  4V2G A;  2CFO A;  1ETW A;  1BI1 A;  2P4W A;  3CUQ A;  3GVA A;  4GDF A;  1SD5 A;  4NQW B;  1R1U A;  2HS5 A;  1Y1W J;  2EFN A;  3KCC A;  2PMU A;  4M3E A;  4A3I J;  3DCF A;  5KCM A;  2E7W A;  3RKQ A;  1WHU A;  3FHZ A;  2L9R A;  5GAG J;  2XHK A;  3EYY A;  2PG4 A;  2DA7 A;  4V19 K;  1OYW A;  1J59 A;  5DTD A;  1ON2 A;  3NRV A;  4AU7 A;  2ZXW H;  5CVJ A;  3ESW B;  3K70 D;  4CDG A;  5HDK A;  5JVG F;  5HVQ C;  3HSF A;  2WV1 A;  3JSO A;  3OOU A;  4HA8 A;  4Y4R A;  3K2Z A;  4ESJ A;  2IGM A;  6PAX A;  1P4A A;  4RMN A;  2FUG 2;  2LG4 A;  3FWE A;  1L3L A;  2W24 A;  1TBX A;  3D5S C;  3LWF A;  2NS8 A;  1P4W A;  3BZC A;  3VEP A;  1NG6 A;  3FKI J;  2XC7 A;  4UY8 I;  4ESB A;  2F5V A;  2MD5 A;  1FT9 A;  2HFH A;  2KPM A;  4DBQ A;  2DO7 A;  2ID6 A;  2BY3 A;  3HOS A;  1K4T A;  1JKO C;  4XMY A;  2V1D A;  1GT0 C;  3S32 A;  3RTR A;  1I6X A;  3VOD A;  3IHU A;  1WH7 A;  1C0W A;  4P55 A;  4LMY A;  4BL0 B;  5JLX A;  3L00 A;  4Q5S F;  2BY0 A;  4OAY A;  3BPV A;  3F8C A;  4ENK A;  5JVT A;  1XGS A;  2YU3 A;  3ZQF A;  1ZKG A;  2A05 A;  2ZSH B;  2WY8 Q;  3KEY A;  3QPH A;  2QLZ A;  5ILS A;  5F0H A;  1PUF A;  3ZQL A;  3HRS A;  2M0C A;  3H3U A;  4I6Z A;  4XLP F;  1UG2 A;  3HG9 A;  2X9D A;  3BG3 A;  1SFX A;  2HQN A;  4RAF A;  2M0M A;  1U2W A;  1W7P A;  3S3M A;  3I4P A;  5ILU A;  3WTT C;  2MYS A;  3TW6 A;  4X6A J;  3PUF A;  1G2H A;  5FRN A;  2V4J C;  5B3S H;  5E79 C;  2QWW A;  3WTX C;  2ZSI B;  3G73 A;  1WRJ A;  4AYB N;  2F5C A;  2IGN A;  1Y0N A;  3GF2 A;  4PGH A;  1TLH B;  2E19 A;  1RKW A;  4I98 B;  5CYV A;  1MJA A;  1DPR A;  5F6F A;  3TO6 A;  1XPX A;  1MW7 A;  2E1C A;  3K69 A;  2DCE A;  4EGY A;  2OAZ A;  1IN7 A;  1O4X A;  3QYB A;  3H5R A;  4Z2Y A;  3KZI C;  4HLX A;  4ESF A;  1FX7 A;  5EG0 B;  3O6B B;  3T0Y A;  3CMA I;  1DDN A;  5AIQ A;  2IBD A;  2P5K A;  1MND A;  1Y8R B;  3GWZ A;  5JFR A;  3JRB A;  1OYY A;  2MSY A;  2K4B A;  5A2Q K;  1QHH D;  4BU2 A;  5TRD A;  2NOG A;  3R61 A;  2BEO A;  4XLF A;  1U9O A;  4XRF A;  5LLQ A;  3VYT B;  2LRE A;  3F72 A;  3OIO A;  3VOE A;  4A69 C;  4BQQ A;  1T8I A;  3GFI A;  2E2I J;  3GZ6 A;  2F5E A;  3EQL F;  3ZMV A;  4DW6 A;  1UST A;  1MSE C;  1JTY A;  1BR2 A;  4HDU A;  4DYC A;  4G6Q A;  1XDU A;  2XRN A;  4IOC F;  1VQL I;  2EZL A;  3OYA A;  2LTP A;  2QBY B;  2BYV E;  4IHY A;  3ABU A;  1Y8Q B;  2WBM A;  2A5Y B;  1S9H A;  2FOW A; 
#chains in the Genus database with same CATH homology
 1XPX A;  1MIJ A;  2LMD A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...