1XPXA

Structural basis of prospero-dna interaction; implications for transcription regulation in developing cells
Total Genus 54
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
54
sequence length
157
structure length
144
Chain Sequence
SSTLTPMHLRKAKLMFFWVRYPSSAVLKMYFPDIKFNKNNTAQLVKWFSNFREFYYIQMEKYARQAVTESELYRVLNLHYNRNNHIEVPQNFRFVVESTLREFFRAIQGGKDTEQSWKKSIYKIISRMDDPVPEYFKSPNFLEQ
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

molecule keywords 5'-D(*AP*GP*CP*AP*TP*GP*CP*CP*TP*G)-3'
publication title Structural Basis of Prospero-DNA Interaction: Implications for Transcription Regulationin Developing Cells.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Transcription regulation/dna
total genus 54
structure length 144
sequence length 157
ec nomenclature
pdb deposition date 2004-10-09

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF05044 HPD Homeo-prospero domain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.500 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeo-prospero domain 1xpxA00
1XPXA 2LMDA 1MIJA
chains in the Genus database with same CATH superfamily
4U87A 3TW6A 3J81K 2HVQA 3BR3A 3IH4A 1LDKB 1D8JA 5CKTA 4FX4A 1YI2I 4ZDLA 1A04A 3E6MA 3TEDA 3WTWC 4QPQA 2JA6J 2L7ZA 1ORKA 1QZEA 2XB0X 3IAM2 4I7HA 5FGMA 3CP2A 2V9PA 4H0EA 2IS1A 3HKZN 4PFOA 4LFUA 3OYNA 4O5VA 4D1QA 2P6TA 1MGTA 3CCSI 3G6EI 1BA5A 1B1BA 1YX3A 5EZGA 1XTAA 2P5KA 4ZYHA 2PQ8A 1K83J 3IV5A 2BYVE 3JW4A 3GEZA 4EV0A 4ESFA 1UFMA 2L3DA 4WCGA 1J59A 2QQ8A 2HS5A 1WJCA 3M1EA 2GQQA 2UWMA 1V54H 2F5FA 3DLLF 4CUGA 2RQPA 2Z9OA 1K6YA 1JUPA 1KQ0A 2COMA 4C2TA 2H6CA 1I3AA 3PO2J 1MBHA 5LBQA 4RAZA 4XKWA 3TDZC 2JMWA 1VZ0A 2Q0OA 1VQ8I 3BG6A 1X1CA 3BJ6A 2DDAA 5LLQA 2VE9A 1XCBA 1H9TA 2MABA 4Q47A 5EYRA 3ZQCA 2ZNYA 3V7SA 2EILH 2XB5A 1MBGA 2OZ6A 3KYCB 1U6GA 1ZAOA 5F27A 3FKJA 4RB2C 1OYYA 1RUNA 1D1BA 1G6NA 2HKXA 3V42A 1XC5A 1GT0C 4BDZA 1UHWA 2DT6A 4HX4A 4DYCA 1IJWC 3BROA 3NARA 3P5JA 1Z6TA 2FNAA 3OV8A 5J47A 3OYLA 1T0FA 1VQLI 2LKXA 2RQQA 3FXMA 4A5NA 2F5DA 3AG2H 4UB6C 2E35A 3Q9SA 4IL6C 4ABZA 2R7OA 1B9MA 2A5WA 2P4WA 4CCNA 2X6XA 3BG5A 3HOVJ 4A5MA 5ERIA 3A01A 2P0WA 2BE5F 2FRHA 2K86A 2EIJH 3M8FA 3WE3A 1PDNC 1GVDA 1L0OC 2R3SA 4GXOA 4XLHA 5DCFA 3V4GA 3MZ8A 2EZKA 2VONA 3OYJA 1K4TA 2XAHA 4P9UA 4AUXA 1UG0A 1AHDP 1BOBA 4EJOA 1YITI 2WAQA 1D0ZA 3KZIC 5HDNA 1OR7A 4JK1X 2BVLA 4X0GA 1T8IA 3WGGA 2DFIA 1VQ9I 3F72A 3O8GA 3FBIB 2M0CA 2KFDA 4WXDA 2HDDA 2XGXA 1JT6A 4M72A 5FKKA 1FIAA 1ZR2A 3NEUA 2O9LA 1GXQA 2DFHA 3HOZJ 4NQWA 2MLGA 2K4BA 2MYSA 2OQRA 4Q48A 1TWGJ 2DQRA 4IX7A 1IN6A 3CLOA 3EQLF 4NC7A 3E6DA 5HNHA 1OYIA 3BOQA 2VOPA 2FU4A 5HOOA 4BJTA 4BH9A 2Q8KA 5ILVA 1HDDC 4CCMA 2QA4I 4IKFA 1GHCA 4C2UA 3S14J 1TP4A 3MKYB 1BBYA 4BE0A 4X1EA 1UMQA 3G4SI 2XPWA 2NYXA 1BIAA 3PIPF 1KQ8A 1WI9A 4GGGA 2V1XA 5L3CA 3CD6I 1TT0A 3JRAA 1B8IB 2NAZA 1WPKA 3JRHA 1OFCX 1MDMA 1MH3A 1OYWA 4MTDA 3W6VA 3FKIJ 9ANTA 2CQ7A 4B3XA 2JJ7A 1IRZA 3K6GA 4LG0B 2H09A 2OQGA 2FOWA 2BY3A 3VSLA 4Y15A 2DFFA 4CXFA 1U9NA 2X85A 3N97A 3M4OJ 1IN4A 1K6OA 3BT9A 2ID6A 4ZC3A 3DWLE 2B7EA 1R1UA 3L2UA 1TW2A 3LSKA 5D5VB 3KETA 2NVTJ 4F91B 3U1DA 3ERED 2CFXA 3WTXC 1BW6A 3TGNA 1BIBA 1AA7A 2P7CB 1AOYA 1LKXA 3LSGA 1VQMI 1KA8A 2F4OB 2L02A 1WWXA 2E2HJ 3EPZA 4U0VA 2UZKA 4M3FA 1A6QA 5M3MJ 1HW1A 3ERMA 3I5UA 3DLAA 5E1XA 3T8RA 3SDBA 3K70C 3FHNA 5JVTA 5J1RA 4HQMA 3BR1A 1N25A 2A68F 4B8XA 3OYBA 2BOLA 4B3AA 1MZBA 3F9KA 5K5RA 4LMYA 2UUZA 1OISA 1T56A 3LOCA 2V26A 2A61A 5H6QA 2HQNA 2PLYA 5FO5A 4UUSB 3TMOA 2A6EF 1WJAA 4ENMA 2COBA 5M3FJ 4V19K 3QAHA 2JUCA 1G3YA 2DW4A 3GTLJ 1Y1VJ 2DYSH 4EGZA 2K4JA 3U1KA 3R0JA 1BI3A 3JRCA 3MMYB 4G7ZF 1RRJA 1IGNA 2R5ZB 1SD4A 2KDOA 4I76A 5A2QK 5FRMA 5F1RA 2JVHA 3ONQA 3BP8A 4LOCA 4XSXF 1YO5C 1YJ9I 4IRIA 3SZPA 4KNYA 1QPMA 2CV2A 3UNGC 2WTEA 3GFLA 3C7JA 2L9NA 3CF5F 4KICA 4OAYA 1J75A 1Z77A 2YX7A 4ZDOA 1NTCA 4RGSA 1O3SA 3DPUA 2GOMA 3VPRA 4G7OF 1KYWA 2MC4A 3A02A 1IZ1A 2LP0A 4WXHA 4RLQA 4KDPA 3GTKJ 5FKMA 4F7ZA 1PP7U 3BC8A 1S29A 2RV8A 3K10A 4DGWB 4IHYA 1OCZH 3HRSA 1MNDA 1XCVA 3NAUA 4LIVA 1Q1HA 1TBXA 3H5RA 2CUEA 3R6SA 4CYCA 3BDDA 2JZYA 4NNJA 4FETA 1YIJI 2VJIA 2NVUB 3FM5A 2IJLA 5E79C 1GLNA 2CSOA 4EATA 1X3UA 3KCCA 1V5GA 1Q1VA 2DBBA 1WJDA 3TL4X 5E3NA 4RLFA 3IP4B 4LB6B 4HX7A 3IWFA 2A6HF 3VDXA 4C3IJ 3ABKH 4ZJZA 3JAMK 1A6IA 2WY7Q 2W25A 5JLXA 2FA5A 3KP4A 3D1NI 1IO2A 3RTRA 2TCTA 3DV8A 4DOZA 2ME0A 5AIQA 2QYOA 1Y39A 1QPIA 3WTVC 1W7PA 4MQ9F 1JKOC 2V1UA 3J7AY 2M8GX 4CH7A 2H1KA 2OTJI 3K4LA 2A07F 2BW3B 2VL8A 1JUMA 2M34A 3HJEA 4A3JJ 2LSOA 2WY8Q 2KT0A 4E7ZA 4S04A 1IUYA 3O6BB 2A69F 2VOOA 2R5ZA 3W6JB 3ESWB 1T2KA 2OAZA 2ZSIB 1JTXA 5ILUA 2A3SA 4FASD 3WE2A 2IXSA 2QZ8A 1R5HA 4S0HB 3LFKA 3RIRA 1F5TA 3HPGA 1YLFA 1H89C 4IPAA 2IA2A 4KUMA 2E1CA 1P7JA 3CUQC 3MFKA 2OCEA 2IA1A 3P9KA 1U8RA 3WODF 2F4IA 4YG2F 2W7NA 1JJ8C 3RPQA 4DNCA 3PM1A 1FYKA 3IUOA 3CCVI 4IHXA 2IP2A 4Q4ZF 2L7MP 2IPQX 1R9TJ 2DJIA 1FMWA 2NNNA 1D1CA 3VWBA 3K4JA 1XMKA 4KISA 1Y6IA 5FKLA 5ICGA 2V7FA 5EEAA 2G9WA 3CTAA 2JA5J 3MKLA 1QRYA 4DYRA 1CF7B 1HCRA 1IN8A 1C0WA 3DTKA 3ABLH 1ERDA 2QF7A 4QIWN 2XDVA 3LNQA 2CQKA 3K2AA 3PUFA 2V6CA 2FBKA 5CVRA 4A0ZA 4B4CA 2VBXA 4U0YA 3CLQA 4GRIA 2FX0A 1TWAJ 4YRVA 1XMAA 3SFZA 5IOYA 1HKTA 4AYBN 5DTDA 3CUQB 2VB6A 2D1VA 4BJ5C 2JVGA 2K9MA 3TBIA 1XB4A 1E3OC 3D0SA 3I55I 2K85A 3K2ZA 3LQRA 3K70D 1FZPB 1TWCJ 5BOXA 2DA1A 2LRDA 1H0MA 1ACIA 2K3PA 3QYEA 4EJTA 4DIQA 4ZTFA 1XD7A 3F8CA 3OL4A 2F48A 3BR5A 2P6SA 3F21A 1B72A 2PJRB 1UG2A 4M3EA 4UUTA 4N9HA 2HPMA 1U5TB 2E71A 2OZUA 1MMNA 3GYHX 5HLGA 4HG2A 4A3DJ 2LD5A 2Z1DA 2KRCA 2M45A 3F6VA 4UV9A 3S2HJ 3AFHA 2KRFA 4A6EA 3COAC 1R4NB 5D5WB 1IG7A 1KZHA 1FWZA 2R7TA 2JRTA 2O3FA 3HRMA 1VQOI 2CJJA 3K7AJ 4M3BA 4LLNA 2L9RA 3ZCOA 1NHAA 3OSFA 2VJ4A 3DU6A 4IOAF 4P5OA 2FJ1A 3DQVC 3QP6A 2DO7A 2JN6A 1LFUP 2NRAC 4HNTA 1S7OA 3S93A 5JLWA 1YOVB 4EM1A 3Q3SA 1IRGA 3CUOA 1LJ9A 2CW0F 4RB0A 1O7FA 5J6XA 2M7AA 1GXPA 3PNYA 4I0BA 3CDIA 4HNUA 4LB5A 4PJ0C 1I27A 2KIFA 5C3EJ 2STWA 1KU9A 1T33A 2GLOA 2QGUA 1JGSA 5GADJ 5JVGF 2G7HA 2F5VA 3HBLA 1X1BA 2EA4A 1QHHD 1G4DA 2B63J 1BR4A 2QEXI 4IHWA 4NC8A 3F3XA 1T39A 2DT5A 1ZGAA 1MJ9A 2VC1A 2VXZA 3CJNA 5HS7A 3C2GA 2W48A 4BUPA 2JT1A 3VOEA 2CQNA 3L2VA 1X1PA 3GTJJ 4HBLA 2Y48A 4DJAA 3ECOA 4A2UA 4AU7A 2VASA 2KKOA 3DXJF 3O8HA 1ZK8A 2MG4A 3TP0A 2HVRA 2DOEA 4E7LA 1R7JA 4RGUA 1SFEA 2HYJA 5AONA 1D0YA 3M8JA 3RZDJ 3QOEA 2D2WA 3CF2A 5F08A 3FISA 5FLXK 3PNVA 4KFCA 2VQCA 5F1JA 3H35A 2X4HA 3U9GA 4XM3A 1PUFB 1STZA 2KIMA 4G6DA 3J7AO 1L3LA 5HNFA 1A5JA 2NS0A 2DA6A 4PJLA 2GIZA 3CMEI 5CVVA 3OS1A 4BACA 1IXSB 2CYYA 4MO7A 1HW2A 4BGDA 3AG1H 5FLVA 3WTTC 3GTPJ 1X4OA 2HTJA 4A6DA 1BR1A 2V1NA 3ZQGA 2O8XA 3HKZA 5E20A 2HQAA 3F8BA 3KP5A 4HRIA 2CWEA 1BOAA 2EA2A 3LQQA 2M30A 4A3IJ 4Z6YA 1FJLA 1TZLA 2LY2A 3QOPA 5ICEA 1LDDA 3SXYA 1YYVA 2EBIA 4MIMA 5L3GA 1MNMC 3CC2I 1QVUA 4L18B 1D5VA 2EB7A 1U9OA 1JT0A 4RM2A 1TWFJ 2EIMH 5ICFA 3H9QA 3ZMUA 1FEXA 4RGRA 3RKWA 2BY0A 3FMQA 3LSHA 1G3TA 3FXOA 1T0FC 4JQFA 1VQ6I 5J1UA 4BQOA 4FTHA 4W97A 4C2MJ 1VQ5I 2IRFG 2PMHA 4H4KC 3V8KA 5J40A 3F23A 2DK8A 5IP7J 3RSNA 2VN2A 2W24A 4M73A 3S3MA 2KP6A 1RR7A 3L1PA 3H0DA 2EZIA 2PMUA 3HHGA 1FTTA 3HUGA 3RQ4A 4XLPF 2IGOA 1Y8RB 1XGSA 1WJBA 2LF7A 2OC6A 3FK6A 4QTRA 3K4MA 3BTLA 3HGGA 1RKTA 5KAIC 4M74A 4BQNA 1N77A 2LY1A 2RC4A 4E7IA 1Z67A 3CC7I 4C9YA 4CGZA 2BHYA 1WRJA 4M6VA 3KE2A 1OR7C 5B1BH 2HI3A 2VJ5A 1VI0A 2NXNB 3ZN0A 3ML6A 4BY1J 1N75A 1VQKI 1UCRA 1E2XA 1ETQA 2LOOA 3L7WA 2ZFWA 2XC7A 2DQLA 3RCOA 1CGPA 3K4CA 3OOPA 3FIWA 4I6ZA 2DPDA 2R93J 2BHZA 1PUFA 1O4XA 4A12A 4QPOA 1FC3A 3PFYA 3GX4X 3EDPA 3LFUA 3KZYA 2VXDA 5J1YA 1YJNI 2QM3A 5K7HA 3A01B 5D8LB 4CDGA 2TDXA 3HC7A 3I71A 1YQAA 3RKYA 1GV5A 2E5NA 3S15J 3TW7A 5JFRA 2MW8A 1RETA 2F5CA 5BMZA 2CV0A 2E19A 3E5UA 2FNPA 1FLIA 2HZDA 1ZYRF 3GTGJ 3K0LA 2DMUA 4GCVA 4E7SA 2VQGA 3V7RA 2W57A 4A3EJ 4GFBA 3WG7H 3PL8A 1TT5B 1ODDA 3JTHA 3BG9A 3R61A 2Y75A 4F93B 4IQJA 3LL7A 4ZZDA 5B3SH 3DF8A 2FXAA 3K4KA 4F92B 2V79A 5E18F 3ABUA 1PUEE 2JRMA 3MKWB 1OKRA 3DTEA 4MEYF 4BQAA 1MBFA 3HTSB 1I5ZA 2W84A 2Z16A 4WF2A 5CVJA 1IRXA 2E1OA 4Y3OA 2O03A 5DYMA 4NQWB 4RB3C 2QLZA 3EUAA 2MSYA 2CFOA 3OR2C 3EYYA 4IZZA 1TQMA 4AVZA 4M9SA 2D45A 5KAFC 1IDZA 4EM2A 1SC7A 2ETHA 5CQEA 2X0LA 3CO6C 1W5SA 1VQPI 2K02A 2DI3A 2WC2A 1U3EM 3LA3A 1ZQ3P 3M8EA 3JREA 3BR0A 2BEOA 3U2RA 3S2DJ 5FJ8J 3U21A 2P7VB 2C6YA 2KMUA 1RNLA 4PSXA 4HW0A 4KIBA 3RYRA 1T6SA 4AWXB 2O0YA 4L5IA 3ULQB 2H8RA 1OJLA 3F8MA 1SFXA 5JHUA 1F43A 1REPC 1I1SA 3DPTA 2ZXWH 3KEYA 5E8GA 4IF4A 1MDMB 1ONVA 3J80Z 3FXQA 1WVRA 2LYCA 2PMZN 4OIRF 4EJWA 4XONA 2E7WA 3R60A 3LSMA 3UR3C 3HRTA 2MD0A 3AAFA 3CQZJ 1VQ7I 2HYFA 5L3FA 1Z91A 4YIRX 4S05A 1ZREA 5E17F 5C4JJ 4BEHA 1FYLA 1DU0A 2HEOA 4HX8A 2B0LA 3CDLA 3PFIA 2GZWA 1ETYA 3QU6A 2CGPA 3HOXJ 5H6RA 4IRHA 2E34A 4PGGA 3BTCA 3JSPA 1RIOH 3OYHA 4RS8A 2MH9A 4N9IA 1RUOA 1YX5A 4BY7J 2WBMA 1OLTA 3OYMA 4WWCA 4BBSJ 4UVBA 2FQ4A 3MCZA 3B6CA 4YFXF 2WV0A 4IQ4A 4PGHA 5TRDA 2LMDA 1FNNA 4E4HA 3WTYC 5LD2C 2MFZA 4N4NB 1X1AA 5F0HA 3WTUC 2M87A 3OS0A 4P55A 2QQ9A 2K27A 3FXLA 2PFBA 3LMMA 4HF2A 1ZR4A 1FMVA 1FOKA 2HDWA 3HOUJ 1OCCH 5ILSA 2HPIA 1IV6A 4Q5SF 3E6CC 4RAGA 3GZ6A 2CV1A 2RAEA 2KZVA 1XGNA 2QSHX 2DOFA 3L9FA 4L5JA 2Y0SN 4ENJA 1P9QC 3WHBA 2NOGA 2K9QA 2VJJA 5GAHJ 1IN7A 3P9IA 2OPTA 1T08B 4HF1A 1TNSA 3BTIA 4RA2A 1UELB 3IWZA 3GLXA 1F9NA 1R1TA 3WU0A 1LE8A 1BJZA 4LITA 2QSGX 3O3KA 3P7NA 1EJ9A 4HSTA 3IAS2 3ZP5A 5K1YA 3EETA 3M9AA 4HDVA 3I0TA 3ZQLA 3FZVA 4PDKA 3E1SA 4PJMA 4HF0A 1JKRC 2KRHA 3RYPA 1XN7A 1ON1A 4LGWA 4CCKA 4G7HF 2OTLI 1N78A 2VQLA 3AL0B 4A3CJ 4CYCB 5IY5H 1HBXG 2MBFA 5EEHA 5E3LA 5H20A 2A5YB 2VBYA 2R4GA 1I39A 3S3NA 2K9SA 4XKVA 5JHFA 2H94A 5DS9A 1USTA 1MH4A 5J4VA 1PP8F 2XAGA 2OF7A 2HNHA 4BXXJ 3MN2A 3BTJA 1SFOJ 1MMSA 4M9ZA 1LEBA 1WJFA 2W4SA 3M07A 4XKCA 1QBJA 3S16J 2WAFA 3QYBA 4BE1A 3ASOH 4B1RA 5IP6A 2ZMEB 1SD5A 2ZO4A 1V55H 2HTSA 1SAXA 1UHSA 2ME6A 3OIOA 2VT2A 1WKMA 5B66C 2E5ZA 4GYIA 3BPVA 1W7PB 3BZ6A 4RDUA 3ZRGA 2VQHA 4ON0A 3KX2A 3ZMDA 3A0HC 3F6OA 1EH6A 2DU9A 1X3ZB 1FP2A 3OYEA 1O3QA 3EUKL 4E70A 1YE9A 1OQYA 5EF6A 1G2HA 4AIDA 4YIIA 2FSWA 1BC7C 1YW8A 2QBYB 3OYGA 1ZG1A 3GFMA 1JKQC 4A69C 2HVSA 3GTMJ 1TW3A 4B47A 3PSFA 3A2KA 3I4NJ 5GAGJ 3KYLA 1RZ4A 3VODA 3LSIA 3MVPA 2DA4A 3B02A 3N4MA 3ZPLA 2LLKA 3M7GA 5LGNA 1S9HA 2HXOA 4I01A 1HC8A 5IT9Z 3OMYA 1SVLA 3NQOA 4BXUA 1YG2A 3GCMA 5HLTA 5GPCA 3FM3A 5DV5A 3OYIA 1VQNI 1RI7A 1HW5A 3S3OA 2O7OA 2M9HA 3M1CA 2L0KA 2DN0A 1TLHB 1SAUA 2PG4A 1P6RA 3HG9A 1EH8A 1JE8A 4HNVA 1OCPA 4D7MA 3CCMI 2W00A 2DA5A 2F5EA 1A35A 3LWFA 4E7HA 4OMZA 4YEJA 2BBYA 3IH3A 1HSJA 3OR1C 4Y13A 4PK4A 1W1WE 3HXLA 2DXIA 3KZZA 4QSHA 3HHHA 1DGRM 4CCJA 1SMYF 3FDYA 2X48A 1F36A 1Z0XA 4KN7X 2P8TA 1LEAA 2ELJA 4AYBA 5H2FC 2MC3A 3LSTA 1JHFA 2ZMEA 5J8CA 2IGMA 1AU7A 1CQTA 2R7UA 4LK1F 1ZGJA 4M71A 1R49A 1ZLKA 2VODA 2VKVA 3HYIA 1DGWY 3MEXA 3DEEA 5BS6A 2LR8A 1W0UA 5D8KB 4A0YA 2ZXIA 2ELKA 1B72B 1QVTA 2MD5A 2ZXJA 5F04A 5LHIA 1SMTA 3GUDA 3JRBA 3F8FA 5FFXA 2M0MA 3HGYA 3BY6A 5L3BA 1DDNA 2XGEA 1T95A 2H1LA 2UV1A 2EFOA 5IOZA 2DLLA 2QBYA 4UY8I 3QU3A 1NG6A 2A6TA 2M4KA 4XOPA 2W1OA 2L5QA 4G6TB 3G2BA 3BCBA 3QPLA 3JTGA 1YTYA 4RM3A 1RR8C 2GXBA 1FSEA 1ETKA 5D4RA 2XF5A 2IEKA 2EZHA 2E1MB 1IXRC 1JTYA 4DZJA 1MBEA 3IHUA 4XSZF 1ZRCA 3HSRA 2IS6A 5K5OA 2ECBA 1D3YA 2X6OA 1X1DA 4B48A 2DMQA 3C1DA 4XQFA 1EH7A 4WXCA 1LPQA 5D5XB 3JR9A 5B1AH 2R5YA 2QWWA 2YU3A 4F52A 2K9NA 1XSXA 4NUBA 1IF1A 5CVUA 3PIOF 3ZOBA 2BXYA 2DAOA 1W7PD 2XIGA 1KYZA 1X2NA 1U2WA 2LY9A 2V1DA 4XNFA 5TISC 2EV0A 3KEOA 3ZR8X 1XSDA 1LB2A 1IV8A 1W5TA 4GO1A 1U78A 1U5TC 2HOTA 5EG0A 2IS2A 1XSVA 5L3EA 2QKMB 4BHCA 3ASNH 3CZ6A 4L9VA 1R23A 3QP5A 3GTOJ 2ZKZA 2OA4A 5FD5A 4U7DA 3OS2A 4A3BJ 2O6GE 3BZCA 3L00A 4FCYA 3S1RJ 1S72I 1QA6A 2QQAA 2IGKA 4FHTA 2N8GA 2J5PA 2VBWA 3KIOA 3OYDA 4BBRJ 3IRRA 3D5LA 2PN6A 1WCMJ 3VFZA 4A3GJ 5ICCA 3GFJA 2NVQJ 3EYIA 4BHPA 1MD0A 1KU2A 3J81Z 4D7NA 2H8WA 2XAJA 4OAZA 1IXCA 2LK2A 2X6WA 3S1QJ 1POGA 1TTYA 3DPLC 1O7LA 2DCEA 3HIFA 4RGXA 5E8IA 4CO8A 3ZQ7A 1Z6RA 4IO9F 3H5AA 4I2OA 1MNEA 3EUHA 4BHBA 3QQAA 1UJ8A 4LK0F 1S3JA 2AS5F 1YS6A 2FMYA 4ASNA 3JSOA 1XG1A 2Y31A 2DA3A 3CJRB 3JCUC 1ETVA 5IYCJ 2DMTA 2BY1A 4LJZF 3TQNA 2PBIA 4HZFA 5JI6A 1S5LC 2CG4A 2KPMA 4UVAA 2L2OA 1ZTRA 1H9GA 2ICWG 1SFUA 1X58A 2KHMA 3KP7A 1WGXA 1ZARA 4IHVA 1IW7F 3WU2C 4HLYA 1QQIA 3M3YJ 2IAIA 3PQKA 2ZBKA 1WH5A 5F0CA 4ESBA 2IA0A 1HXDA 2EFQA 1MBJA 3VYSB 4UUVA 2ZNZA 3DBLB 4MTEA 1J0RA 1OMIA 3F0CA 3BQZA 3TOBA 4AVPA 2JUGA 2NOJB 3FXJA 2ISZA 2LVSA 2DPUA 1J9IA 3HUGB 4UNOA 3BWGA 3CDHA 4HV6A 5EGOA 3I9V2 1X4PA 2Y9YA 1VFCA 3S8PA 1OPCA 2ZCWA 3PQJA 4MFEA 4DW6A 4LIUA 4ZYAA 2VBZA 4DQ2A 4AC0A 1FPQA 1JGGA 3WTZA 4BE2A 3K4BA 3CESA 3E7LA 1V4RA 3GW2A 3RPUA 1EA3A 3ZQHA 2XROA 1T38A 3BR2A 2PI0A 2EZLA 4B44A 4RBOA 2YU9J 2LKPA 1P2FA 3C2BA 2ZJRF 3CCRI 2E1NA 1MMAA 4I09A 2PJPA 2M2EA 5LGTA 1NG7A 1R22A 1MKMA 4X6AJ 4BAYA 3KEQA 2XKPA 4RB1A 1IUFA 3QYFA 4II3A 2VT3A 2QVOA 5GTIC 4N0BA 1Z9CA 2Z3YA 2RNJA 2HOSA 3MWMA 4D5CA 4HOBA 5DDGA 5IP9J 4HQEA 4CCOA 2YX4A 2HWVA 2GA2A 4KT6A 2ACJA 4HEA2 5AIPA 2X9DA 4KJZA 1S7AA 3ZMZA 1LVKA 4XRSA 2KLOA 1H8AC 3KYDB 2NS8A 3L2QA 3HL2A 2R7DA 3DKXA 3CJTB 2CQXA 4HSRA 1LNWA 3OIPA 1B59A 5D6EA 2YR2A 1DP7P 4CCLA 2BGCA 1JJ6C 4LLGF 4AM3A 4FISA 5HLHA 2RKHA 4WK8F 3G1MA 2JPCA 4ZYGA 2K3FA 3SZTA 5BNGA 4NDLA 4BL0B 4UVCA 3K9TA 2AO9A 4G94A 4L0YB 3FHZA 2I5UA 4BKXA 1JHHA 4YFNF 5CQGA 3IKTA 3GWZA 1GUUA 2ZJQF 3CCEI 3GXOA 3DBRB 4O3MA 2OV7A 3QPHA 3KLNA 2M4GA 2K7LA 2W85A 3VYRB 3E0JB 3BR6A 5KCMA 2L4MA 4MNUA 4BYYA 1ETWA 4V2FA 5KHDA 1XPXA 3QODA 4JBAA 1R6RA 2Q2EA 2PMZA 2GBYA 3QWLA 1K61A 3SEZA 1BN5A 5HDKA 2Z33A 1O3TA 1VNDA 1R36A 4PJJA 2HYGD 2CW7A 1QHGA 1DPUA 1EKEA 2XSDC 1S8NA 1ETOA 1FY7A 1RC9A 3BQYA 2KDZA 3CO7C 1UAAA 3BJAA 1U8BA 1FP1D 4PSWA 1PJRA 4G8XA 4IVNA 4BXFA 2UXNA 1FYMA 3LA7A 4N4OB 1WFXA 2VI6A 1J09A 2JSCA 5LGUA 2O5RA 5FKNA 4U0WA 4BEHB 1QU3A 1GV2A 3AG4H 5E1WA 3KP6A 3L2WA 3HOTA 5LFAA 2Z5UA 1FX7A 5M5WJ 3HSFA 5EJCA 4YELA 2EV5A 1W36C 2JA7J 4II2A 4IHTA 1B6AA 1ZKGA 2XAQA 3HB9A 4XKBA 1FIPA 4KA4A 1HQCA 2VPRA 2R0QC 1WZ2A 2LDUA 2XAUA 2R7SA 3D5SC 1MSFC 1I3QJ 1D5YA 1S6LA 4MQVA 3LSPA 3SQNA 2LF8A 2LNBA 4L9TA 5CLSA 1R5ID 5L3DA 2ESHA 3S1NJ 3ECHA 3W3CA 3S1MJ 3H9GA 1YRNA 4MLOA 4U88A 2DODA 1VQ4I 3RKXA 1MMDA 4AIJA 3A03A 5E3OA 3RZOJ 2FOKA 2LBFA 3TP3A 2GA1A 5A2QZ 1Y8QB 3WU1B 1QZZA 3H36A 3HZJA 1D0XA 2CUFA 3KPHA 5LHGA 3WGHA 2Y0SA 2WA0A 4BS9A 3W2WA 4ZYDA 3H92A 4O6JA 5LEJA 1R58A 4I98B 4I99C 4WX9A 1R71A 3K1PA 4RAFA 3GBGA 1D8KA 2BZTA 2QQBA 2EJRA 2KZGA 4D5FA 3IRQA 1WSUA 3VB2A 1NK2P 4F3QA 2M7BA 1Y0UA 3PUBA 4G9YA 2F2EA 4HPQA 5CPRB 1K78A 3P9CA 1XMXA 2ESNA 5EDNA 2R92J 4KT5C 1JXSA 2XUBA 3Q9VA 1LE8B 3R0AA 3B6AA 1E3HA 2R7ZJ 2L4AA 4MFDA 1ZHFA 1LDJA 2XVCA 2JSPA 4M6XA 3JRGA 1ZLJA 2QSFX 3ABMH 4JP0A 4XLEA 3CCLI 2Y30A 1ZN2A 3PJRA 2V6EA 3WGIA 2DTRA 3MZHA 3I4MJ 3I58A 4KMUX 5E3MA 1K4SA 2FMLA 4B43A 3CMMA 1ON2A 1AKHA 2Z2SB 2EINH 3C18A 2CMPA 2IBDA 1ETXA 3TO9A 4ENNA 4E7JA 1DQUA 3CCJI 2GM4A 1KU7A 3HOWJ 2L7FP 3RKQA 4IRGA 2WV1A 3VYUB 4QLCU 3JAMZ 4FT8A 4KMFA 2H27A 3GTQJ 2QKLB 2HFHA 2JQ7A 3ZQIA 1X2MA 3HOSA 3OSGA 3FMRA 4EJVA 3OYCA 2YS9A 3S2WA 2G7UA 2IT0A 3ZN1A 1KU3A 3E97A 1D1AA 4E7KA 1B4AA 1RESA 2LH9A 3LSJA 4ITVA 3TO6A 1P92A 4ZH4F 2EWNA 4J01A 2CU7A 4PJNA 4UXNA 3L09A 1O3RA 4Y52J 4KITB 4DBRA 3FBNB 3G71I 4W1UA 3J7YJ 3JRDA 4C3JJ 4YFKF 1Y1WJ 3SYTA 3AL0C 3I54A 3RDIA 1APLC 1HSTA 2XGDA 1AWCA 2GAUA 3GO5A 4ANJA 1GDTA 4A3FJ 5D4SA 4BJ6C 4UB8C 2FE3A 3X2QH 4PCQA 4GYGA 4D0PA 1BR2A 3C2HA 3ZMTA 4CICA 1BL0A 3SZGA 2WB1A 2F6CA 2XPUA 2KQRA 4HA8A 1B9NA 3TDUC 4XBFA 3MQ0A 3VYTB 4DBQA 2X51A 3GF2A 3OWTA 3RQIA 3DKWA 4AIKA 4DYQA 1YW9A 2ZMEC 3Q5FA 3FWEA 3K1NA 2CW8A 2D5VA 1J5YA 1FSHA 3SDGA 3QPTA 1VTNC 3HEFA 4NB5A 3ABTA 1WJ5A 2I8DA 1MBKA 3N05A 1GVJA 1XGOA 5K7ZA 5DM6F 2AXLA 5C44J 5J8FA 1I50J 4ZZLA 4Y7NJ 1BI1A 1F1ZA 2KJCA 3BJOA 2X1CA 4NC6A 5HS9A 5TJJA 2FEZA 2R7QA 1OCOH 1P7IA 2QUFA 3DBHB 2E7XA 3B73A 5FRNA 3WHCA 4XLFA 2BVMA 2HXIA 2I10A 3IKVA 3CCUI 4XOTA 2IW5A 3ZGKA 4ETSA 3IL2A 2YSRA 5FB2A 4Y17A 2R7RA 4YIFA 1W36D 5ED4A 3L2CA 2GXAA 1EF4A 1QZYA 2J5OA 3MKZA 2VUMJ 5M5YJ 4MHGA 3VSKA 2KISA 1JUSA 1SVMA 5HDGA 4R8HA 1FOWA 4JX6A 5GP9A 4XIDA 2WAEA 2EH3A 1J7KA 3FXRA 1XS9A 2HOAA 5F0FA 2HKOA 1HLVA 2ZJ2A 4DZPA 2DTZA 4CSWA 1ULYA 3GZNB 1SVOA 2ADUA 2WAQN 2XHKA 2E60A 2DYRH 3K4NA 1UHMA 2HR3A 2VC0A 2XGCA 1QO0D 1UB9A 3Q0VA 4LG3A 1RPWA 4ZDPA 1BC8C 2FBIA 4M3DA 2DDBA 4Y33A 3CCQI 4XRSG 5BPIA 2KL4A 1KGSA 2VIXA 1V3FA 3DTIA 1P4XA 2RN7A 4J19A 3JRIA 1ENHA 3I3LA 4BDYA 3S17J 2WB1N 3W2VA 1X3WB 1BJAA 5CJ9A 2WWYA 1SFKA 4KIFA 4AIHA 1WH7A 1Y56A 5C4XJ 4K2EA 1WI3A 2HU9A 1Z21A 3I53A 4P96A 5LRRA 1MJAA 4M6YA 2A05A 1SANA 2Q1ZB 1BW5A 4TV7A 1FOYA 1V5EA 2ZFUA 2R5YB 2XRNA 1S7EA 3T8TA 4E6KG 4PFPA 4LD5A 1X19A 2CQQA 4G6QA 2D1HA 1B8IA 5DD8A 1R1VA 2ECCA 4Y4RA 4OIQF 2JWTA 1XX5A 1F4KA 2XRLA 5GAEJ 4OMYA 2XSJC 1WJEA 1IAWA 5BQTA 3BPXA 4XORA 5EG0B 3FX3A 3F22A 3V7CA 2O61A 4LG0A 3EUHC 4I02A 2JTVA 3DFGA 3ELKA 1BM9A 1G3WA 5HVQC 3J80K 3SEQA 1JI8A 1YHQI 2DK5A 5E1ZB 1IRFA 2K5CA 4HAMA 2HZTA 2F4MB 2E1MC 2ID3A 1G59A 1E0EA 5FLXZ 2OJED 3H1CA 3T0YA 3LAJA 2FBHA 4V2GA 2AHQA 2L01A 1MW7A 3ISPA 2QCOA 1HKQA 3OYFA 6PAXA 5LRSA 1DP3A 1P4WA 2YUSA 1LQ1A 5FROA 4HDUA 5KNLA 2JA8J 4EQQA 2DJNA 2X1DA 5FKOA 3LA2A 5GPAA 4XICA 1XGMA 3PSIA 3HTUA 4I0AA 4XN0A 3TO7A 1TC3C 3IC7A 3KP2A 3BCAA 5JR3A 5J3LA 2ELHA 3FF5A 4OOIA 4XRMA 2OU2A 1Y0NA 2R7XA 3W6KB 5F6FA 2BV6A 2PX9A 3I59B 2K9LA 3ZQQA 1J2XA 3G73A 3A1YA 3OY9A 4XLCA 1ZH5A 4OWRB 3BG3A 2V4JC 2WADA 4UHTA 4UUSA 1HOMA 2FD5A 2OD5A 4RMNA 4EGYA 2DOAA 1E17A 2BXZA 1WQ2A 5IYDJ 2YPRA 3FK7A 3WG9A 1ZRFA 1H88C 4OINF 3GZ5A 3OYAA 3OL3A 4IJAA 1MMGA 5FD6A 3O2PE 2X1EA 2DFEA 1TWHJ 3BG7A 3C3WA 2BY2A 1YW7A 3FXUA 1FOXA 3V8JA 3ZMVA 2OBPA 4KN4X 2DMPA 4IEJA 5DUIA 4QWQA 4R1HA 3CMAI 1FT9A 2RREA 4G12A 1XDSA 2KIUA 1TNTA 2R7FA 2Y2ZA 3TOAA 3G3ZA 4CZCA 2EFPA 2HGCA 2KJBA 5BPDA 5DD4A 1V5FA 2EFWA 4OU0A 2G0EA 3VEPA 3FXKA 2FUG2 1W5CC 2L7KA 4L5EA 2XAFA 2XV4S 4HLXA 4A0XA 2VLAA 2P5VA 1TL8A 5EGOB 1ZRDA 1Z7LA 3E5QA 2DT7B 3LSRA 5F64A 1IC8A 3OYKA 1DUXC 4CHUA 1WHUA 1FBUA 1JKPC 3CMYA 3H0GJ 2HQRA 2AQEA 1UZCA 1G8XA 1ZGWA 2W82A 1OCTC 2OUMA 3CCYA 2Y0MA 3PO3J 4CZZA 5FFZA 4P1WA 4ENKA 2E36A 4BU2A 4R79A 4XMYA 4A3MJ 5B5EC 3MZYA 2EQRA 4LLLA 4PUSA 3Q0WA 2ZJPF 1MIJA 3V8LA 1PVEA 3UKGA 2V9KA 2R7VA 1MSEC 4XRFA 1FBSA 3I59A 1PYVA 3A0BC 5IPAA 1HA8A 2LKSA 2IS4A 2L9SA 1I6HJ 3GVAA 3QPSA 5DM7F 4XK4A 4P9FA 3RI4A 2EIKH 4D9JA 2EV6A 3GFIA 2R7WA 1TQPA 2BW3A 3DEWA 2P81A 1R5GA 4ZTJA 1G3SA 1LFPA 2EK5A 2V9VA 2LG4A 3NRVA 2E2JJ 2VPLA 4JX4A 1KONA 3ZMSA 3H5NA 4RAYA 2ISYA 1TQIA 5CVIA 5DCMB 3QRFF 4FX0A 4FE7A 1NH3A 4ESJA 4L0ZB 2X6YA 2VE8A 3J7ZI 4EEFG 1M1EB 1EV7A 1YFHA 3SFIA 1YIOA 3ROUA 1IDYA 2OCCH 1DPRA 4XR6A 5EZHA 3S32A 5FLMJ 2MLKA 5J4YA 2E2IJ 1FBQA 1SEUA 2LFBA 1NK3P 1U0JA 3GMEA 5IT3A 1Z1DA 3I56I 3W2AA 3BZKA 2P5LC 3JRFA 2L9VA 5IT9K 3H3UA 2IGNA 3DP7A 2XKOA 1IN5A 3CJQB 3D5RC 1LUJB 3E3VA 3L2RA 4IOCF 4EM0B 1R00A 2NVXJ 3PNTA 2FF4A 2Q2EB 2M3AA 5HLIA 1I6XA 1CF7A 1HKSA 4L9NA 4EVIA 2NS7A 2CS3A 4M3GA 4JX5A 3NWSA 5D6FA 3FMSA 2IVMA 4F55A 4FQGA 2MH2A 3T1BA 1ITYA 2XASA 3I4PA 1Z05A 4U7BA 4HYEA 4EJUA 5LEKA 1K79A 3HRUA 2RVCA 4CA0A 4FE4A 1HDPA 2ZSHB 4IHSA 3CUQA 2L54A 2LREA 2DA7A 4L9JA 5HODA 3R4KA 4ZYEA 2STTA 2M5WA 3RJPA 1K7AA 2MGQA 2JPBA 2DMNA 2XF7A 4MGRA 5GTHC 4C30A 2UXXA 1MJBA 4CYDA 1Z7UA 1YJWI 2GXGA 3LAPA 3CC4I 2HQ5A 2PJRA 4MEXF 3CP8A 2PEXA 3AKZA 2Z99A 4Z2YA 2RDPA 4XN3A 3DCFA 1USSA 1W4MA 1U5TA 3KFWX 3G1OA 4JYKA 1LFBA 1Z3XA 5DCMA 1BI0A 4OIOF 2KIQA 2B9SA 3HPHA 3G1LA 5HS8A 4XLAA 1FTZA 5K7FA 2HOEA 2XPVA 1QGPA 3I64A 3HDDA 1E3PA 2GOXB 2K40A 4PZJA 4EMSA 1YRNB 5K5QA 2GIVA 2H6BA 1VF9A 2RNGA 3RPUD 1DU6A 1SD7A 2ZXHA 5M5XJ 3NWTA 3F8NA 4BQQA 4NHJA 2TRTA 1ZELA 3OOUA 5EEGA 2LBFB 3IH2A 4AD9A 2VKDA 2LTPA 1BI2A 3E6BA 5TGTA 3TKYA 4OIPF 5DUKA 3H9JA 2CRGA 3HOYJ 1LVAA 3BLYA 1OCRH 3WTSC 4KYWA 3ZQFA 2NNYA 2JK3A 4UV8A 4XL9A 2AXTC 1SD6A 2M8EA 2QENA 1O57A 1I1GA 3GLLA 4M9XA 3H3VK 2CUZA 2AQFA 4NBQA 1W0TA 3SHFA 3ZXSA 2VKEA 4C3HJ 1R4MB 4HV5A 5DEQA 3T5XA 2NVYJ 2FQ3A 2XF6A 1P4AA 4JOMA 2HDCA 1K78B 2JA2A 2ZC2A 3K1MA 5KVRA 3DEUA 1A31A 5CYVA 4J00A 4A3LJ 2LC2A 4KIGA 4B09A 3MAJA 2MA3A 3HM5A 2EPFA 1ZG5A 1Z3YA 2O8KA 1QNTA 3AG3H 3MD2A 2Y69H 3Q0UA 4IXAA 2Y9ZA 1HF0A 1ZG3A 1AKHB 3H3ZA 4BNCA 2EFNA 5IYBJ 1YS7A 2GWRA 3DKYA 2VKHA 3A4CA 2ZB9A 2DA2A 3DU5A 3SJMA 3K69A 1T98A 2CH0A 1XDUA 2RGVA 3HSEA 4XLNF 1KQ9A 5D5UB 4GDFA 5KK1A 4A3KJ 2CO5A 3KP3A 3KLOA 2CUJA 5LHHA 4A93J 1A36A 2M1BA 3E5XA 3REOA 3OIQA 1RKWA
chains in the Genus database with same CATH topology
1XPXA 2LMDA 1MIJA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1XPX A;  2LMD A;  1MIJ A; 
#chains in the Genus database with same CATH topology
 4U87 A;  3TW6 A;  3J81 K;  2HVQ A;  3BR3 A;  3IH4 A;  1LDK B;  1D8J A;  5CKT A;  4FX4 A;  1YI2 I;  4ZDL A;  1A04 A;  3E6M A;  3TED A;  3WTW C;  4QPQ A;  2JA6 J;  2L7Z A;  1ORK A;  1QZE A;  2XB0 X;  3IAM 2;  4I7H A;  5FGM A;  3CP2 A;  2V9P A;  4H0E A;  2IS1 A;  3HKZ N;  4PFO A;  4LFU A;  3OYN A;  4O5V A;  4D1Q A;  2P6T A;  1MGT A;  3CCS I;  3G6E I;  1BA5 A;  1B1B A;  1YX3 A;  5EZG A;  1XTA A;  2P5K A;  4ZYH A;  2PQ8 A;  1K83 J;  3IV5 A;  2BYV E;  3JW4 A;  3GEZ A;  4EV0 A;  4ESF A;  1UFM A;  2L3D A;  4WCG A;  1J59 A;  2QQ8 A;  2HS5 A;  1WJC A;  3M1E A;  2GQQ A;  2UWM A;  1V54 H;  2F5F A;  3DLL F;  4CUG A;  2RQP A;  2Z9O A;  1K6Y A;  1JUP A;  1KQ0 A;  2COM A;  4C2T A;  2H6C A;  1I3A A;  3PO2 J;  1MBH A;  5LBQ A;  4RAZ A;  4XKW A;  3TDZ C;  2JMW A;  1VZ0 A;  2Q0O A;  1VQ8 I;  3BG6 A;  1X1C A;  3BJ6 A;  2DDA A;  5LLQ A;  2VE9 A;  1XCB A;  1H9T A;  2MAB A;  4Q47 A;  5EYR A;  3ZQC A;  2ZNY A;  3V7S A;  2EIL H;  2XB5 A;  1MBG A;  2OZ6 A;  3KYC B;  1U6G A;  1ZAO A;  5F27 A;  3FKJ A;  4RB2 C;  1OYY A;  1RUN A;  1D1B A;  1G6N A;  2HKX A;  3V42 A;  1XC5 A;  1GT0 C;  4BDZ A;  1UHW A;  2DT6 A;  4HX4 A;  4DYC A;  1IJW C;  3BRO A;  3NAR A;  3P5J A;  1Z6T A;  2FNA A;  3OV8 A;  5J47 A;  3OYL A;  1T0F A;  1VQL I;  2LKX A;  2RQQ A;  3FXM A;  4A5N A;  2F5D A;  3AG2 H;  4UB6 C;  2E35 A;  3Q9S A;  4IL6 C;  4ABZ A;  2R7O A;  1B9M A;  2A5W A;  2P4W A;  4CCN A;  2X6X A;  3BG5 A;  3HOV J;  4A5M A;  5ERI A;  3A01 A;  2P0W A;  2BE5 F;  2FRH A;  2K86 A;  2EIJ H;  3M8F A;  3WE3 A;  1PDN C;  1GVD A;  1L0O C;  2R3S A;  4GXO A;  4XLH A;  5DCF A;  3V4G A;  3MZ8 A;  2EZK A;  2VON A;  3OYJ A;  1K4T A;  2XAH A;  4P9U A;  4AUX A;  1UG0 A;  1AHD P;  1BOB A;  4EJO A;  1YIT I;  2WAQ A;  1D0Z A;  3KZI C;  5HDN A;  1OR7 A;  4JK1 X;  2BVL A;  4X0G A;  1T8I A;  3WGG A;  2DFI A;  1VQ9 I;  3F72 A;  3O8G A;  3FBI B;  2M0C A;  2KFD A;  4WXD A;  2HDD A;  2XGX A;  1JT6 A;  4M72 A;  5FKK A;  1FIA A;  1ZR2 A;  3NEU A;  2O9L A;  1GXQ A;  2DFH A;  3HOZ J;  4NQW A;  2MLG A;  2K4B A;  2MYS A;  2OQR A;  4Q48 A;  1TWG J;  2DQR A;  4IX7 A;  1IN6 A;  3CLO A;  3EQL F;  4NC7 A;  3E6D A;  5HNH A;  1OYI A;  3BOQ A;  2VOP A;  2FU4 A;  5HOO A;  4BJT A;  4BH9 A;  2Q8K A;  5ILV A;  1HDD C;  4CCM A;  2QA4 I;  4IKF A;  1GHC A;  4C2U A;  3S14 J;  1TP4 A;  3MKY B;  1BBY A;  4BE0 A;  4X1E A;  1UMQ A;  3G4S I;  2XPW A;  2NYX A;  1BIA A;  3PIP F;  1KQ8 A;  1WI9 A;  4GGG A;  2V1X A;  5L3C A;  3CD6 I;  1TT0 A;  3JRA A;  1B8I B;  2NAZ A;  1WPK A;  3JRH A;  1OFC X;  1MDM A;  1MH3 A;  1OYW A;  4MTD A;  3W6V A;  3FKI J;  9ANT A;  2CQ7 A;  4B3X A;  2JJ7 A;  1IRZ A;  3K6G A;  4LG0 B;  2H09 A;  2OQG A;  2FOW A;  2BY3 A;  3VSL A;  4Y15 A;  2DFF A;  4CXF A;  1U9N A;  2X85 A;  3N97 A;  3M4O J;  1IN4 A;  1K6O A;  3BT9 A;  2ID6 A;  4ZC3 A;  3DWL E;  2B7E A;  1R1U A;  3L2U A;  1TW2 A;  3LSK A;  5D5V B;  3KET A;  2NVT J;  4F91 B;  3U1D A;  3ERE D;  2CFX A;  3WTX C;  1BW6 A;  3TGN A;  1BIB A;  1AA7 A;  2P7C B;  1AOY A;  1LKX A;  3LSG A;  1VQM I;  1KA8 A;  2F4O B;  2L02 A;  1WWX A;  2E2H J;  3EPZ A;  4U0V A;  2UZK A;  4M3F A;  1A6Q A;  5M3M J;  1HW1 A;  3ERM A;  3I5U A;  3DLA A;  5E1X A;  3T8R A;  3SDB A;  3K70 C;  3FHN A;  5JVT A;  5J1R A;  4HQM A;  3BR1 A;  1N25 A;  2A68 F;  4B8X A;  3OYB A;  2BOL A;  4B3A A;  1MZB A;  3F9K A;  5K5R A;  4LMY A;  2UUZ A;  1OIS A;  1T56 A;  3LOC A;  2V26 A;  2A61 A;  5H6Q A;  2HQN A;  2PLY A;  5FO5 A;  4UUS B;  3TMO A;  2A6E F;  1WJA A;  4ENM A;  2COB A;  5M3F J;  4V19 K;  3QAH A;  2JUC A;  1G3Y A;  2DW4 A;  3GTL J;  1Y1V J;  2DYS H;  4EGZ A;  2K4J A;  3U1K A;  3R0J A;  1BI3 A;  3JRC A;  3MMY B;  4G7Z F;  1RRJ A;  1IGN A;  2R5Z B;  1SD4 A;  2KDO A;  4I76 A;  5A2Q K;  5FRM A;  5F1R A;  2JVH A;  3ONQ A;  3BP8 A;  4LOC A;  4XSX F;  1YO5 C;  1YJ9 I;  4IRI A;  3SZP A;  4KNY A;  1QPM A;  2CV2 A;  3UNG C;  2WTE A;  3GFL A;  3C7J A;  2L9N A;  3CF5 F;  4KIC A;  4OAY A;  1J75 A;  1Z77 A;  2YX7 A;  4ZDO A;  1NTC A;  4RGS A;  1O3S A;  3DPU A;  2GOM A;  3VPR A;  4G7O F;  1KYW A;  2MC4 A;  3A02 A;  1IZ1 A;  2LP0 A;  4WXH A;  4RLQ A;  4KDP A;  3GTK J;  5FKM A;  4F7Z A;  1PP7 U;  3BC8 A;  1S29 A;  2RV8 A;  3K10 A;  4DGW B;  4IHY A;  1OCZ H;  3HRS A;  1MND A;  1XCV A;  3NAU A;  4LIV A;  1Q1H A;  1TBX A;  3H5R A;  2CUE A;  3R6S A;  4CYC A;  3BDD A;  2JZY A;  4NNJ A;  4FET A;  1YIJ I;  2VJI A;  2NVU B;  3FM5 A;  2IJL A;  5E79 C;  1GLN A;  2CSO A;  4EAT A;  1X3U A;  3KCC A;  1V5G A;  1Q1V A;  2DBB A;  1WJD A;  3TL4 X;  5E3N A;  4RLF A;  3IP4 B;  4LB6 B;  4HX7 A;  3IWF A;  2A6H F;  3VDX A;  4C3I J;  3ABK H;  4ZJZ A;  3JAM K;  1A6I A;  2WY7 Q;  2W25 A;  5JLX A;  2FA5 A;  3KP4 A;  3D1N I;  1IO2 A;  3RTR A;  2TCT A;  3DV8 A;  4DOZ A;  2ME0 A;  5AIQ A;  2QYO A;  1Y39 A;  1QPI A;  3WTV C;  1W7P A;  4MQ9 F;  1JKO C;  2V1U A;  3J7A Y;  2M8G X;  4CH7 A;  2H1K A;  2OTJ I;  3K4L A;  2A07 F;  2BW3 B;  2VL8 A;  1JUM A;  2M34 A;  3HJE A;  4A3J J;  2LSO A;  2WY8 Q;  2KT0 A;  4E7Z A;  4S04 A;  1IUY A;  3O6B B;  2A69 F;  2VOO A;  2R5Z A;  3W6J B;  3ESW B;  1T2K A;  2OAZ A;  2ZSI B;  1JTX A;  5ILU A;  2A3S A;  4FAS D;  3WE2 A;  2IXS A;  2QZ8 A;  1R5H A;  4S0H B;  3LFK A;  3RIR A;  1F5T A;  3HPG A;  1YLF A;  1H89 C;  4IPA A;  2IA2 A;  4KUM A;  2E1C A;  1P7J A;  3CUQ C;  3MFK A;  2OCE A;  2IA1 A;  3P9K A;  1U8R A;  3WOD F;  2F4I A;  4YG2 F;  2W7N A;  1JJ8 C;  3RPQ A;  4DNC A;  3PM1 A;  1FYK A;  3IUO A;  3CCV I;  4IHX A;  2IP2 A;  4Q4Z F;  2L7M P;  2IPQ X;  1R9T J;  2DJI A;  1FMW A;  2NNN A;  1D1C A;  3VWB A;  3K4J A;  1XMK A;  4KIS A;  1Y6I A;  5FKL A;  5ICG A;  2V7F A;  5EEA A;  2G9W A;  3CTA A;  2JA5 J;  3MKL A;  1QRY A;  4DYR A;  1CF7 B;  1HCR A;  1IN8 A;  1C0W A;  3DTK A;  3ABL H;  1ERD A;  2QF7 A;  4QIW N;  2XDV A;  3LNQ A;  2CQK A;  3K2A A;  3PUF A;  2V6C A;  2FBK A;  5CVR A;  4A0Z A;  4B4C A;  2VBX A;  4U0Y A;  3CLQ A;  4GRI A;  2FX0 A;  1TWA J;  4YRV A;  1XMA A;  3SFZ A;  5IOY A;  1HKT A;  4AYB N;  5DTD A;  3CUQ B;  2VB6 A;  2D1V A;  4BJ5 C;  2JVG A;  2K9M A;  3TBI A;  1XB4 A;  1E3O C;  3D0S A;  3I55 I;  2K85 A;  3K2Z A;  3LQR A;  3K70 D;  1FZP B;  1TWC J;  5BOX A;  2DA1 A;  2LRD A;  1H0M A;  1ACI A;  2K3P A;  3QYE A;  4EJT A;  4DIQ A;  4ZTF A;  1XD7 A;  3F8C A;  3OL4 A;  2F48 A;  3BR5 A;  2P6S A;  3F21 A;  1B72 A;  2PJR B;  1UG2 A;  4M3E A;  4UUT A;  4N9H A;  2HPM A;  1U5T B;  2E71 A;  2OZU A;  1MMN A;  3GYH X;  5HLG A;  4HG2 A;  4A3D J;  2LD5 A;  2Z1D A;  2KRC A;  2M45 A;  3F6V A;  4UV9 A;  3S2H J;  3AFH A;  2KRF A;  4A6E A;  3COA C;  1R4N B;  5D5W B;  1IG7 A;  1KZH A;  1FWZ A;  2R7T A;  2JRT A;  2O3F A;  3HRM A;  1VQO I;  2CJJ A;  3K7A J;  4M3B A;  4LLN A;  2L9R A;  3ZCO A;  1NHA A;  3OSF A;  2VJ4 A;  3DU6 A;  4IOA F;  4P5O A;  2FJ1 A;  3DQV C;  3QP6 A;  2DO7 A;  2JN6 A;  1LFU P;  2NRA C;  4HNT A;  1S7O A;  3S93 A;  5JLW A;  1YOV B;  4EM1 A;  3Q3S A;  1IRG A;  3CUO A;  1LJ9 A;  2CW0 F;  4RB0 A;  1O7F A;  5J6X A;  2M7A A;  1GXP A;  3PNY A;  4I0B A;  3CDI A;  4HNU A;  4LB5 A;  4PJ0 C;  1I27 A;  2KIF A;  5C3E J;  2STW A;  1KU9 A;  1T33 A;  2GLO A;  2QGU A;  1JGS A;  5GAD J;  5JVG F;  2G7H A;  2F5V A;  3HBL A;  1X1B A;  2EA4 A;  1QHH D;  1G4D A;  2B63 J;  1BR4 A;  2QEX I;  4IHW A;  4NC8 A;  3F3X A;  1T39 A;  2DT5 A;  1ZGA A;  1MJ9 A;  2VC1 A;  2VXZ A;  3CJN A;  5HS7 A;  3C2G A;  2W48 A;  4BUP A;  2JT1 A;  3VOE A;  2CQN A;  3L2V A;  1X1P A;  3GTJ J;  4HBL A;  2Y48 A;  4DJA A;  3ECO A;  4A2U A;  4AU7 A;  2VAS A;  2KKO A;  3DXJ F;  3O8H A;  1ZK8 A;  2MG4 A;  3TP0 A;  2HVR A;  2DOE A;  4E7L A;  1R7J A;  4RGU A;  1SFE A;  2HYJ A;  5AON A;  1D0Y A;  3M8J A;  3RZD J;  3QOE A;  2D2W A;  3CF2 A;  5F08 A;  3FIS A;  5FLX K;  3PNV A;  4KFC A;  2VQC A;  5F1J A;  3H35 A;  2X4H A;  3U9G A;  4XM3 A;  1PUF B;  1STZ A;  2KIM A;  4G6D A;  3J7A O;  1L3L A;  5HNF A;  1A5J A;  2NS0 A;  2DA6 A;  4PJL A;  2GIZ A;  3CME I;  5CVV A;  3OS1 A;  4BAC A;  1IXS B;  2CYY A;  4MO7 A;  1HW2 A;  4BGD A;  3AG1 H;  5FLV A;  3WTT C;  3GTP J;  1X4O A;  2HTJ A;  4A6D A;  1BR1 A;  2V1N A;  3ZQG A;  2O8X A;  3HKZ A;  5E20 A;  2HQA A;  3F8B A;  3KP5 A;  4HRI A;  2CWE A;  1BOA A;  2EA2 A;  3LQQ A;  2M30 A;  4A3I J;  4Z6Y A;  1FJL A;  1TZL A;  2LY2 A;  3QOP A;  5ICE A;  1LDD A;  3SXY A;  1YYV A;  2EBI A;  4MIM A;  5L3G A;  1MNM C;  3CC2 I;  1QVU A;  4L18 B;  1D5V A;  2EB7 A;  1U9O A;  1JT0 A;  4RM2 A;  1TWF J;  2EIM H;  5ICF A;  3H9Q A;  3ZMU A;  1FEX A;  4RGR A;  3RKW A;  2BY0 A;  3FMQ A;  3LSH A;  1G3T A;  3FXO A;  1T0F C;  4JQF A;  1VQ6 I;  5J1U A;  4BQO A;  4FTH A;  4W97 A;  4C2M J;  1VQ5 I;  2IRF G;  2PMH A;  4H4K C;  3V8K A;  5J40 A;  3F23 A;  2DK8 A;  5IP7 J;  3RSN A;  2VN2 A;  2W24 A;  4M73 A;  3S3M A;  2KP6 A;  1RR7 A;  3L1P A;  3H0D A;  2EZI A;  2PMU A;  3HHG A;  1FTT A;  3HUG A;  3RQ4 A;  4XLP F;  2IGO A;  1Y8R B;  1XGS A;  1WJB A;  2LF7 A;  2OC6 A;  3FK6 A;  4QTR A;  3K4M A;  3BTL A;  3HGG A;  1RKT A;  5KAI C;  4M74 A;  4BQN A;  1N77 A;  2LY1 A;  2RC4 A;  4E7I A;  1Z67 A;  3CC7 I;  4C9Y A;  4CGZ A;  2BHY A;  1WRJ A;  4M6V A;  3KE2 A;  1OR7 C;  5B1B H;  2HI3 A;  2VJ5 A;  1VI0 A;  2NXN B;  3ZN0 A;  3ML6 A;  4BY1 J;  1N75 A;  1VQK I;  1UCR A;  1E2X A;  1ETQ A;  2LOO A;  3L7W A;  2ZFW A;  2XC7 A;  2DQL A;  3RCO A;  1CGP A;  3K4C A;  3OOP A;  3FIW A;  4I6Z A;  2DPD A;  2R93 J;  2BHZ A;  1PUF A;  1O4X A;  4A12 A;  4QPO A;  1FC3 A;  3PFY A;  3GX4 X;  3EDP A;  3LFU A;  3KZY A;  2VXD A;  5J1Y A;  1YJN I;  2QM3 A;  5K7H A;  3A01 B;  5D8L B;  4CDG A;  2TDX A;  3HC7 A;  3I71 A;  1YQA A;  3RKY A;  1GV5 A;  2E5N A;  3S15 J;  3TW7 A;  5JFR A;  2MW8 A;  1RET A;  2F5C A;  5BMZ A;  2CV0 A;  2E19 A;  3E5U A;  2FNP A;  1FLI A;  2HZD A;  1ZYR F;  3GTG J;  3K0L A;  2DMU A;  4GCV A;  4E7S A;  2VQG A;  3V7R A;  2W57 A;  4A3E J;  4GFB A;  3WG7 H;  3PL8 A;  1TT5 B;  1ODD A;  3JTH A;  3BG9 A;  3R61 A;  2Y75 A;  4F93 B;  4IQJ A;  3LL7 A;  4ZZD A;  5B3S H;  3DF8 A;  2FXA A;  3K4K A;  4F92 B;  2V79 A;  5E18 F;  3ABU A;  1PUE E;  2JRM A;  3MKW B;  1OKR A;  3DTE A;  4MEY F;  4BQA A;  1MBF A;  3HTS B;  1I5Z A;  2W84 A;  2Z16 A;  4WF2 A;  5CVJ A;  1IRX A;  2E1O A;  4Y3O A;  2O03 A;  5DYM A;  4NQW B;  4RB3 C;  2QLZ A;  3EUA A;  2MSY A;  2CFO A;  3OR2 C;  3EYY A;  4IZZ A;  1TQM A;  4AVZ A;  4M9S A;  2D45 A;  5KAF C;  1IDZ A;  4EM2 A;  1SC7 A;  2ETH A;  5CQE A;  2X0L A;  3CO6 C;  1W5S A;  1VQP I;  2K02 A;  2DI3 A;  2WC2 A;  1U3E M;  3LA3 A;  1ZQ3 P;  3M8E A;  3JRE A;  3BR0 A;  2BEO A;  3U2R A;  3S2D J;  5FJ8 J;  3U21 A;  2P7V B;  2C6Y A;  2KMU A;  1RNL A;  4PSX A;  4HW0 A;  4KIB A;  3RYR A;  1T6S A;  4AWX B;  2O0Y A;  4L5I A;  3ULQ B;  2H8R A;  1OJL A;  3F8M A;  1SFX A;  5JHU A;  1F43 A;  1REP C;  1I1S A;  3DPT A;  2ZXW H;  3KEY A;  5E8G A;  4IF4 A;  1MDM B;  1ONV A;  3J80 Z;  3FXQ A;  1WVR A;  2LYC A;  2PMZ N;  4OIR F;  4EJW A;  4XON A;  2E7W A;  3R60 A;  3LSM A;  3UR3 C;  3HRT A;  2MD0 A;  3AAF A;  3CQZ J;  1VQ7 I;  2HYF A;  5L3F A;  1Z91 A;  4YIR X;  4S05 A;  1ZRE A;  5E17 F;  5C4J J;  4BEH A;  1FYL A;  1DU0 A;  2HEO A;  4HX8 A;  2B0L A;  3CDL A;  3PFI A;  2GZW A;  1ETY A;  3QU6 A;  2CGP A;  3HOX J;  5H6R A;  4IRH A;  2E34 A;  4PGG A;  3BTC A;  3JSP A;  1RIO H;  3OYH A;  4RS8 A;  2MH9 A;  4N9I A;  1RUO A;  1YX5 A;  4BY7 J;  2WBM A;  1OLT A;  3OYM A;  4WWC A;  4BBS J;  4UVB A;  2FQ4 A;  3MCZ A;  3B6C A;  4YFX F;  2WV0 A;  4IQ4 A;  4PGH A;  5TRD A;  2LMD A;  1FNN A;  4E4H A;  3WTY C;  5LD2 C;  2MFZ A;  4N4N B;  1X1A A;  5F0H A;  3WTU C;  2M87 A;  3OS0 A;  4P55 A;  2QQ9 A;  2K27 A;  3FXL A;  2PFB A;  3LMM A;  4HF2 A;  1ZR4 A;  1FMV A;  1FOK A;  2HDW A;  3HOU J;  1OCC H;  5ILS A;  2HPI A;  1IV6 A;  4Q5S F;  3E6C C;  4RAG A;  3GZ6 A;  2CV1 A;  2RAE A;  2KZV A;  1XGN A;  2QSH X;  2DOF A;  3L9F A;  4L5J A;  2Y0S N;  4ENJ A;  1P9Q C;  3WHB A;  2NOG A;  2K9Q A;  2VJJ A;  5GAH J;  1IN7 A;  3P9I A;  2OPT A;  1T08 B;  4HF1 A;  1TNS A;  3BTI A;  4RA2 A;  1UEL B;  3IWZ A;  3GLX A;  1F9N A;  1R1T A;  3WU0 A;  1LE8 A;  1BJZ A;  4LIT A;  2QSG X;  3O3K A;  3P7N A;  1EJ9 A;  4HST A;  3IAS 2;  3ZP5 A;  5K1Y A;  3EET A;  3M9A A;  4HDV A;  3I0T A;  3ZQL A;  3FZV A;  4PDK A;  3E1S A;  4PJM A;  4HF0 A;  1JKR C;  2KRH A;  3RYP A;  1XN7 A;  1ON1 A;  4LGW A;  4CCK A;  4G7H F;  2OTL I;  1N78 A;  2VQL A;  3AL0 B;  4A3C J;  4CYC B;  5IY5 H;  1HBX G;  2MBF A;  5EEH A;  5E3L A;  5H20 A;  2A5Y B;  2VBY A;  2R4G A;  1I39 A;  3S3N A;  2K9S A;  4XKV A;  5JHF A;  2H94 A;  5DS9 A;  1UST A;  1MH4 A;  5J4V A;  1PP8 F;  2XAG A;  2OF7 A;  2HNH A;  4BXX J;  3MN2 A;  3BTJ A;  1SFO J;  1MMS A;  4M9Z A;  1LEB A;  1WJF A;  2W4S A;  3M07 A;  4XKC A;  1QBJ A;  3S16 J;  2WAF A;  3QYB A;  4BE1 A;  3ASO H;  4B1R A;  5IP6 A;  2ZME B;  1SD5 A;  2ZO4 A;  1V55 H;  2HTS A;  1SAX A;  1UHS A;  2ME6 A;  3OIO A;  2VT2 A;  1WKM A;  5B66 C;  2E5Z A;  4GYI A;  3BPV A;  1W7P B;  3BZ6 A;  4RDU A;  3ZRG A;  2VQH A;  4ON0 A;  3KX2 A;  3ZMD A;  3A0H C;  3F6O A;  1EH6 A;  2DU9 A;  1X3Z B;  1FP2 A;  3OYE A;  1O3Q A;  3EUK L;  4E70 A;  1YE9 A;  1OQY A;  5EF6 A;  1G2H A;  4AID A;  4YII A;  2FSW A;  1BC7 C;  1YW8 A;  2QBY B;  3OYG A;  1ZG1 A;  3GFM A;  1JKQ C;  4A69 C;  2HVS A;  3GTM J;  1TW3 A;  4B47 A;  3PSF A;  3A2K A;  3I4N J;  5GAG J;  3KYL A;  1RZ4 A;  3VOD A;  3LSI A;  3MVP A;  2DA4 A;  3B02 A;  3N4M A;  3ZPL A;  2LLK A;  3M7G A;  5LGN A;  1S9H A;  2HXO A;  4I01 A;  1HC8 A;  5IT9 Z;  3OMY A;  1SVL A;  3NQO A;  4BXU A;  1YG2 A;  3GCM A;  5HLT A;  5GPC A;  3FM3 A;  5DV5 A;  3OYI A;  1VQN I;  1RI7 A;  1HW5 A;  3S3O A;  2O7O A;  2M9H A;  3M1C A;  2L0K A;  2DN0 A;  1TLH B;  1SAU A;  2PG4 A;  1P6R A;  3HG9 A;  1EH8 A;  1JE8 A;  4HNV A;  1OCP A;  4D7M A;  3CCM I;  2W00 A;  2DA5 A;  2F5E A;  1A35 A;  3LWF A;  4E7H A;  4OMZ A;  4YEJ A;  2BBY A;  3IH3 A;  1HSJ A;  3OR1 C;  4Y13 A;  4PK4 A;  1W1W E;  3HXL A;  2DXI A;  3KZZ A;  4QSH A;  3HHH A;  1DGR M;  4CCJ A;  1SMY F;  3FDY A;  2X48 A;  1F36 A;  1Z0X A;  4KN7 X;  2P8T A;  1LEA A;  2ELJ A;  4AYB A;  5H2F C;  2MC3 A;  3LST A;  1JHF A;  2ZME A;  5J8C A;  2IGM A;  1AU7 A;  1CQT A;  2R7U A;  4LK1 F;  1ZGJ A;  4M71 A;  1R49 A;  1ZLK A;  2VOD A;  2VKV A;  3HYI A;  1DGW Y;  3MEX A;  3DEE A;  5BS6 A;  2LR8 A;  1W0U A;  5D8K B;  4A0Y A;  2ZXI A;  2ELK A;  1B72 B;  1QVT A;  2MD5 A;  2ZXJ A;  5F04 A;  5LHI A;  1SMT A;  3GUD A;  3JRB A;  3F8F A;  5FFX A;  2M0M A;  3HGY A;  3BY6 A;  5L3B A;  1DDN A;  2XGE A;  1T95 A;  2H1L A;  2UV1 A;  2EFO A;  5IOZ A;  2DLL A;  2QBY A;  4UY8 I;  3QU3 A;  1NG6 A;  2A6T A;  2M4K A;  4XOP A;  2W1O A;  2L5Q A;  4G6T B;  3G2B A;  3BCB A;  3QPL A;  3JTG A;  1YTY A;  4RM3 A;  1RR8 C;  2GXB A;  1FSE A;  1ETK A;  5D4R A;  2XF5 A;  2IEK A;  2EZH A;  2E1M B;  1IXR C;  1JTY A;  4DZJ A;  1MBE A;  3IHU A;  4XSZ F;  1ZRC A;  3HSR A;  2IS6 A;  5K5O A;  2ECB A;  1D3Y A;  2X6O A;  1X1D A;  4B48 A;  2DMQ A;  3C1D A;  4XQF A;  1EH7 A;  4WXC A;  1LPQ A;  5D5X B;  3JR9 A;  5B1A H;  2R5Y A;  2QWW A;  2YU3 A;  4F52 A;  2K9N A;  1XSX A;  4NUB A;  1IF1 A;  5CVU A;  3PIO F;  3ZOB A;  2BXY A;  2DAO A;  1W7P D;  2XIG A;  1KYZ A;  1X2N A;  1U2W A;  2LY9 A;  2V1D A;  4XNF A;  5TIS C;  2EV0 A;  3KEO A;  3ZR8 X;  1XSD A;  1LB2 A;  1IV8 A;  1W5T A;  4GO1 A;  1U78 A;  1U5T C;  2HOT A;  5EG0 A;  2IS2 A;  1XSV A;  5L3E A;  2QKM B;  4BHC A;  3ASN H;  3CZ6 A;  4L9V A;  1R23 A;  3QP5 A;  3GTO J;  2ZKZ A;  2OA4 A;  5FD5 A;  4U7D A;  3OS2 A;  4A3B J;  2O6G E;  3BZC A;  3L00 A;  4FCY A;  3S1R J;  1S72 I;  1QA6 A;  2QQA A;  2IGK A;  4FHT A;  2N8G A;  2J5P A;  2VBW A;  3KIO A;  3OYD A;  4BBR J;  3IRR A;  3D5L A;  2PN6 A;  1WCM J;  3VFZ A;  4A3G J;  5ICC A;  3GFJ A;  2NVQ J;  3EYI A;  4BHP A;  1MD0 A;  1KU2 A;  3J81 Z;  4D7N A;  2H8W A;  2XAJ A;  4OAZ A;  1IXC A;  2LK2 A;  2X6W A;  3S1Q J;  1POG A;  1TTY A;  3DPL C;  1O7L A;  2DCE A;  3HIF A;  4RGX A;  5E8I A;  4CO8 A;  3ZQ7 A;  1Z6R A;  4IO9 F;  3H5A A;  4I2O A;  1MNE A;  3EUH A;  4BHB A;  3QQA A;  1UJ8 A;  4LK0 F;  1S3J A;  2AS5 F;  1YS6 A;  2FMY A;  4ASN A;  3JSO A;  1XG1 A;  2Y31 A;  2DA3 A;  3CJR B;  3JCU C;  1ETV A;  5IYC J;  2DMT A;  2BY1 A;  4LJZ F;  3TQN A;  2PBI A;  4HZF A;  5JI6 A;  1S5L C;  2CG4 A;  2KPM A;  4UVA A;  2L2O A;  1ZTR A;  1H9G A;  2ICW G;  1SFU A;  1X58 A;  2KHM A;  3KP7 A;  1WGX A;  1ZAR A;  4IHV A;  1IW7 F;  3WU2 C;  4HLY A;  1QQI A;  3M3Y J;  2IAI A;  3PQK A;  2ZBK A;  1WH5 A;  5F0C A;  4ESB A;  2IA0 A;  1HXD A;  2EFQ A;  1MBJ A;  3VYS B;  4UUV A;  2ZNZ A;  3DBL B;  4MTE A;  1J0R A;  1OMI A;  3F0C A;  3BQZ A;  3TOB A;  4AVP A;  2JUG A;  2NOJ B;  3FXJ A;  2ISZ A;  2LVS A;  2DPU A;  1J9I A;  3HUG B;  4UNO A;  3BWG A;  3CDH A;  4HV6 A;  5EGO A;  3I9V 2;  1X4P A;  2Y9Y A;  1VFC A;  3S8P A;  1OPC A;  2ZCW A;  3PQJ A;  4MFE A;  4DW6 A;  4LIU A;  4ZYA A;  2VBZ A;  4DQ2 A;  4AC0 A;  1FPQ A;  1JGG A;  3WTZ A;  4BE2 A;  3K4B A;  3CES A;  3E7L A;  1V4R A;  3GW2 A;  3RPU A;  1EA3 A;  3ZQH A;  2XRO A;  1T38 A;  3BR2 A;  2PI0 A;  2EZL A;  4B44 A;  4RBO A;  2YU9 J;  2LKP A;  1P2F A;  3C2B A;  2ZJR F;  3CCR I;  2E1N A;  1MMA A;  4I09 A;  2PJP A;  2M2E A;  5LGT A;  1NG7 A;  1R22 A;  1MKM A;  4X6A J;  4BAY A;  3KEQ A;  2XKP A;  4RB1 A;  1IUF A;  3QYF A;  4II3 A;  2VT3 A;  2QVO A;  5GTI C;  4N0B A;  1Z9C A;  2Z3Y A;  2RNJ A;  2HOS A;  3MWM A;  4D5C A;  4HOB A;  5DDG A;  5IP9 J;  4HQE A;  4CCO A;  2YX4 A;  2HWV A;  2GA2 A;  4KT6 A;  2ACJ A;  4HEA 2;  5AIP A;  2X9D A;  4KJZ A;  1S7A A;  3ZMZ A;  1LVK A;  4XRS A;  2KLO A;  1H8A C;  3KYD B;  2NS8 A;  3L2Q A;  3HL2 A;  2R7D A;  3DKX A;  3CJT B;  2CQX A;  4HSR A;  1LNW A;  3OIP A;  1B59 A;  5D6E A;  2YR2 A;  1DP7 P;  4CCL A;  2BGC A;  1JJ6 C;  4LLG F;  4AM3 A;  4FIS A;  5HLH A;  2RKH A;  4WK8 F;  3G1M A;  2JPC A;  4ZYG A;  2K3F A;  3SZT A;  5BNG A;  4NDL A;  4BL0 B;  4UVC A;  3K9T A;  2AO9 A;  4G94 A;  4L0Y B;  3FHZ A;  2I5U A;  4BKX A;  1JHH A;  4YFN F;  5CQG A;  3IKT A;  3GWZ A;  1GUU A;  2ZJQ F;  3CCE I;  3GXO A;  3DBR B;  4O3M A;  2OV7 A;  3QPH A;  3KLN A;  2M4G A;  2K7L A;  2W85 A;  3VYR B;  3E0J B;  3BR6 A;  5KCM A;  2L4M A;  4MNU A;  4BYY A;  1ETW A;  4V2F A;  5KHD A;  1XPX A;  3QOD A;  4JBA A;  1R6R A;  2Q2E A;  2PMZ A;  2GBY A;  3QWL A;  1K61 A;  3SEZ A;  1BN5 A;  5HDK A;  2Z33 A;  1O3T A;  1VND A;  1R36 A;  4PJJ A;  2HYG D;  2CW7 A;  1QHG A;  1DPU A;  1EKE A;  2XSD C;  1S8N A;  1ETO A;  1FY7 A;  1RC9 A;  3BQY A;  2KDZ A;  3CO7 C;  1UAA A;  3BJA A;  1U8B A;  1FP1 D;  4PSW A;  1PJR A;  4G8X A;  4IVN A;  4BXF A;  2UXN A;  1FYM A;  3LA7 A;  4N4O B;  1WFX A;  2VI6 A;  1J09 A;  2JSC A;  5LGU A;  2O5R A;  5FKN A;  4U0W A;  4BEH B;  1QU3 A;  1GV2 A;  3AG4 H;  5E1W A;  3KP6 A;  3L2W A;  3HOT A;  5LFA A;  2Z5U A;  1FX7 A;  5M5W J;  3HSF A;  5EJC A;  4YEL A;  2EV5 A;  1W36 C;  2JA7 J;  4II2 A;  4IHT A;  1B6A A;  1ZKG A;  2XAQ A;  3HB9 A;  4XKB A;  1FIP A;  4KA4 A;  1HQC A;  2VPR A;  2R0Q C;  1WZ2 A;  2LDU A;  2XAU A;  2R7S A;  3D5S C;  1MSF C;  1I3Q J;  1D5Y A;  1S6L A;  4MQV A;  3LSP A;  3SQN A;  2LF8 A;  2LNB A;  4L9T A;  5CLS A;  1R5I D;  5L3D A;  2ESH A;  3S1N J;  3ECH A;  3W3C A;  3S1M J;  3H9G A;  1YRN A;  4MLO A;  4U88 A;  2DOD A;  1VQ4 I;  3RKX A;  1MMD A;  4AIJ A;  3A03 A;  5E3O A;  3RZO J;  2FOK A;  2LBF A;  3TP3 A;  2GA1 A;  5A2Q Z;  1Y8Q B;  3WU1 B;  1QZZ A;  3H36 A;  3HZJ A;  1D0X A;  2CUF A;  3KPH A;  5LHG A;  3WGH A;  2Y0S A;  2WA0 A;  4BS9 A;  3W2W A;  4ZYD A;  3H92 A;  4O6J A;  5LEJ A;  1R58 A;  4I98 B;  4I99 C;  4WX9 A;  1R71 A;  3K1P A;  4RAF A;  3GBG A;  1D8K A;  2BZT A;  2QQB A;  2EJR A;  2KZG A;  4D5F A;  3IRQ A;  1WSU A;  3VB2 A;  1NK2 P;  4F3Q A;  2M7B A;  1Y0U A;  3PUB A;  4G9Y A;  2F2E A;  4HPQ A;  5CPR B;  1K78 A;  3P9C A;  1XMX A;  2ESN A;  5EDN A;  2R92 J;  4KT5 C;  1JXS A;  2XUB A;  3Q9V A;  1LE8 B;  3R0A A;  3B6A A;  1E3H A;  2R7Z J;  2L4A A;  4MFD A;  1ZHF A;  1LDJ A;  2XVC A;  2JSP A;  4M6X A;  3JRG A;  1ZLJ A;  2QSF X;  3ABM H;  4JP0 A;  4XLE A;  3CCL I;  2Y30 A;  1ZN2 A;  3PJR A;  2V6E A;  3WGI A;  2DTR A;  3MZH A;  3I4M J;  3I58 A;  4KMU X;  5E3M A;  1K4S A;  2FML A;  4B43 A;  3CMM A;  1ON2 A;  1AKH A;  2Z2S B;  2EIN H;  3C18 A;  2CMP A;  2IBD A;  1ETX A;  3TO9 A;  4ENN A;  4E7J A;  1DQU A;  3CCJ I;  2GM4 A;  1KU7 A;  3HOW J;  2L7F P;  3RKQ A;  4IRG A;  2WV1 A;  3VYU B;  4QLC U;  3JAM Z;  4FT8 A;  4KMF A;  2H27 A;  3GTQ J;  2QKL B;  2HFH A;  2JQ7 A;  3ZQI A;  1X2M A;  3HOS A;  3OSG A;  3FMR A;  4EJV A;  3OYC A;  2YS9 A;  3S2W A;  2G7U A;  2IT0 A;  3ZN1 A;  1KU3 A;  3E97 A;  1D1A A;  4E7K A;  1B4A A;  1RES A;  2LH9 A;  3LSJ A;  4ITV A;  3TO6 A;  1P92 A;  4ZH4 F;  2EWN A;  4J01 A;  2CU7 A;  4PJN A;  4UXN A;  3L09 A;  1O3R A;  4Y52 J;  4KIT B;  4DBR A;  3FBN B;  3G71 I;  4W1U A;  3J7Y J;  3JRD A;  4C3J J;  4YFK F;  1Y1W J;  3SYT A;  3AL0 C;  3I54 A;  3RDI A;  1APL C;  1HST A;  2XGD A;  1AWC A;  2GAU A;  3GO5 A;  4ANJ A;  1GDT A;  4A3F J;  5D4S A;  4BJ6 C;  4UB8 C;  2FE3 A;  3X2Q H;  4PCQ A;  4GYG A;  4D0P A;  1BR2 A;  3C2H A;  3ZMT A;  4CIC A;  1BL0 A;  3SZG A;  2WB1 A;  2F6C A;  2XPU A;  2KQR A;  4HA8 A;  1B9N A;  3TDU C;  4XBF A;  3MQ0 A;  3VYT B;  4DBQ A;  2X51 A;  3GF2 A;  3OWT A;  3RQI A;  3DKW A;  4AIK A;  4DYQ A;  1YW9 A;  2ZME C;  3Q5F A;  3FWE A;  3K1N A;  2CW8 A;  2D5V A;  1J5Y A;  1FSH A;  3SDG A;  3QPT A;  1VTN C;  3HEF A;  4NB5 A;  3ABT A;  1WJ5 A;  2I8D A;  1MBK A;  3N05 A;  1GVJ A;  1XGO A;  5K7Z A;  5DM6 F;  2AXL A;  5C44 J;  5J8F A;  1I50 J;  4ZZL A;  4Y7N J;  1BI1 A;  1F1Z A;  2KJC A;  3BJO A;  2X1C A;  4NC6 A;  5HS9 A;  5TJJ A;  2FEZ A;  2R7Q A;  1OCO H;  1P7I A;  2QUF A;  3DBH B;  2E7X A;  3B73 A;  5FRN A;  3WHC A;  4XLF A;  2BVM A;  2HXI A;  2I10 A;  3IKV A;  3CCU I;  4XOT A;  2IW5 A;  3ZGK A;  4ETS A;  3IL2 A;  2YSR A;  5FB2 A;  4Y17 A;  2R7R A;  4YIF A;  1W36 D;  5ED4 A;  3L2C A;  2GXA A;  1EF4 A;  1QZY A;  2J5O A;  3MKZ A;  2VUM J;  5M5Y J;  4MHG A;  3VSK A;  2KIS A;  1JUS A;  1SVM A;  5HDG A;  4R8H A;  1FOW A;  4JX6 A;  5GP9 A;  4XID A;  2WAE A;  2EH3 A;  1J7K A;  3FXR A;  1XS9 A;  2HOA A;  5F0F A;  2HKO A;  1HLV A;  2ZJ2 A;  4DZP A;  2DTZ A;  4CSW A;  1ULY A;  3GZN B;  1SVO A;  2ADU A;  2WAQ N;  2XHK A;  2E60 A;  2DYR H;  3K4N A;  1UHM A;  2HR3 A;  2VC0 A;  2XGC A;  1QO0 D;  1UB9 A;  3Q0V A;  4LG3 A;  1RPW A;  4ZDP A;  1BC8 C;  2FBI A;  4M3D A;  2DDB A;  4Y33 A;  3CCQ I;  4XRS G;  5BPI A;  2KL4 A;  1KGS A;  2VIX A;  1V3F A;  3DTI A;  1P4X A;  2RN7 A;  4J19 A;  3JRI A;  1ENH A;  3I3L A;  4BDY A;  3S17 J;  2WB1 N;  3W2V A;  1X3W B;  1BJA A;  5CJ9 A;  2WWY A;  1SFK A;  4KIF A;  4AIH A;  1WH7 A;  1Y56 A;  5C4X J;  4K2E A;  1WI3 A;  2HU9 A;  1Z21 A;  3I53 A;  4P96 A;  5LRR A;  1MJA A;  4M6Y A;  2A05 A;  1SAN A;  2Q1Z B;  1BW5 A;  4TV7 A;  1FOY A;  1V5E A;  2ZFU A;  2R5Y B;  2XRN A;  1S7E A;  3T8T A;  4E6K G;  4PFP A;  4LD5 A;  1X19 A;  2CQQ A;  4G6Q A;  2D1H A;  1B8I A;  5DD8 A;  1R1V A;  2ECC A;  4Y4R A;  4OIQ F;  2JWT A;  1XX5 A;  1F4K A;  2XRL A;  5GAE J;  4OMY A;  2XSJ C;  1WJE A;  1IAW A;  5BQT A;  3BPX A;  4XOR A;  5EG0 B;  3FX3 A;  3F22 A;  3V7C A;  2O61 A;  4LG0 A;  3EUH C;  4I02 A;  2JTV A;  3DFG A;  3ELK A;  1BM9 A;  1G3W A;  5HVQ C;  3J80 K;  3SEQ A;  1JI8 A;  1YHQ I;  2DK5 A;  5E1Z B;  1IRF A;  2K5C A;  4HAM A;  2HZT A;  2F4M B;  2E1M C;  2ID3 A;  1G59 A;  1E0E A;  5FLX Z;  2OJE D;  3H1C A;  3T0Y A;  3LAJ A;  2FBH A;  4V2G A;  2AHQ A;  2L01 A;  1MW7 A;  3ISP A;  2QCO A;  1HKQ A;  3OYF A;  6PAX A;  5LRS A;  1DP3 A;  1P4W A;  2YUS A;  1LQ1 A;  5FRO A;  4HDU A;  5KNL A;  2JA8 J;  4EQQ A;  2DJN A;  2X1D A;  5FKO A;  3LA2 A;  5GPA A;  4XIC A;  1XGM A;  3PSI A;  3HTU A;  4I0A A;  4XN0 A;  3TO7 A;  1TC3 C;  3IC7 A;  3KP2 A;  3BCA A;  5JR3 A;  5J3L A;  2ELH A;  3FF5 A;  4OOI A;  4XRM A;  2OU2 A;  1Y0N A;  2R7X A;  3W6K B;  5F6F A;  2BV6 A;  2PX9 A;  3I59 B;  2K9L A;  3ZQQ A;  1J2X A;  3G73 A;  3A1Y A;  3OY9 A;  4XLC A;  1ZH5 A;  4OWR B;  3BG3 A;  2V4J C;  2WAD A;  4UHT A;  4UUS A;  1HOM A;  2FD5 A;  2OD5 A;  4RMN A;  4EGY A;  2DOA A;  1E17 A;  2BXZ A;  1WQ2 A;  5IYD J;  2YPR A;  3FK7 A;  3WG9 A;  1ZRF A;  1H88 C;  4OIN F;  3GZ5 A;  3OYA A;  3OL3 A;  4IJA A;  1MMG A;  5FD6 A;  3O2P E;  2X1E A;  2DFE A;  1TWH J;  3BG7 A;  3C3W A;  2BY2 A;  1YW7 A;  3FXU A;  1FOX A;  3V8J A;  3ZMV A;  2OBP A;  4KN4 X;  2DMP A;  4IEJ A;  5DUI A;  4QWQ A;  4R1H A;  3CMA I;  1FT9 A;  2RRE A;  4G12 A;  1XDS A;  2KIU A;  1TNT A;  2R7F A;  2Y2Z A;  3TOA A;  3G3Z A;  4CZC A;  2EFP A;  2HGC A;  2KJB A;  5BPD A;  5DD4 A;  1V5F A;  2EFW A;  4OU0 A;  2G0E A;  3VEP A;  3FXK A;  2FUG 2;  1W5C C;  2L7K A;  4L5E A;  2XAF A;  2XV4 S;  4HLX A;  4A0X A;  2VLA A;  2P5V A;  1TL8 A;  5EGO B;  1ZRD A;  1Z7L A;  3E5Q A;  2DT7 B;  3LSR A;  5F64 A;  1IC8 A;  3OYK A;  1DUX C;  4CHU A;  1WHU A;  1FBU A;  1JKP C;  3CMY A;  3H0G J;  2HQR A;  2AQE A;  1UZC A;  1G8X A;  1ZGW A;  2W82 A;  1OCT C;  2OUM A;  3CCY A;  2Y0M A;  3PO3 J;  4CZZ A;  5FFZ A;  4P1W A;  4ENK A;  2E36 A;  4BU2 A;  4R79 A;  4XMY A;  4A3M J;  5B5E C;  3MZY A;  2EQR A;  4LLL A;  4PUS A;  3Q0W A;  2ZJP F;  1MIJ A;  3V8L A;  1PVE A;  3UKG A;  2V9K A;  2R7V A;  1MSE C;  4XRF A;  1FBS A;  3I59 A;  1PYV A;  3A0B C;  5IPA A;  1HA8 A;  2LKS A;  2IS4 A;  2L9S A;  1I6H J;  3GVA A;  3QPS A;  5DM7 F;  4XK4 A;  4P9F A;  3RI4 A;  2EIK H;  4D9J A;  2EV6 A;  3GFI A;  2R7W A;  1TQP A;  2BW3 A;  3DEW A;  2P81 A;  1R5G A;  4ZTJ A;  1G3S A;  1LFP A;  2EK5 A;  2V9V A;  2LG4 A;  3NRV A;  2E2J J;  2VPL A;  4JX4 A;  1KON A;  3ZMS A;  3H5N A;  4RAY A;  2ISY A;  1TQI A;  5CVI A;  5DCM B;  3QRF F;  4FX0 A;  4FE7 A;  1NH3 A;  4ESJ A;  4L0Z B;  2X6Y A;  2VE8 A;  3J7Z I;  4EEF G;  1M1E B;  1EV7 A;  1YFH A;  3SFI A;  1YIO A;  3ROU A;  1IDY A;  2OCC H;  1DPR A;  4XR6 A;  5EZH A;  3S32 A;  5FLM J;  2MLK A;  5J4Y A;  2E2I J;  1FBQ A;  1SEU A;  2LFB A;  1NK3 P;  1U0J A;  3GME A;  5IT3 A;  1Z1D A;  3I56 I;  3W2A A;  3BZK A;  2P5L C;  3JRF A;  2L9V A;  5IT9 K;  3H3U A;  2IGN A;  3DP7 A;  2XKO A;  1IN5 A;  3CJQ B;  3D5R C;  1LUJ B;  3E3V A;  3L2R A;  4IOC F;  4EM0 B;  1R00 A;  2NVX J;  3PNT A;  2FF4 A;  2Q2E B;  2M3A A;  5HLI A;  1I6X A;  1CF7 A;  1HKS A;  4L9N A;  4EVI A;  2NS7 A;  2CS3 A;  4M3G A;  4JX5 A;  3NWS A;  5D6F A;  3FMS A;  2IVM A;  4F55 A;  4FQG A;  2MH2 A;  3T1B A;  1ITY A;  2XAS A;  3I4P A;  1Z05 A;  4U7B A;  4HYE A;  4EJU A;  5LEK A;  1K79 A;  3HRU A;  2RVC A;  4CA0 A;  4FE4 A;  1HDP A;  2ZSH B;  4IHS A;  3CUQ A;  2L54 A;  2LRE A;  2DA7 A;  4L9J A;  5HOD A;  3R4K A;  4ZYE A;  2STT A;  2M5W A;  3RJP A;  1K7A A;  2MGQ A;  2JPB A;  2DMN A;  2XF7 A;  4MGR A;  5GTH C;  4C30 A;  2UXX A;  1MJB A;  4CYD A;  1Z7U A;  1YJW I;  2GXG A;  3LAP A;  3CC4 I;  2HQ5 A;  2PJR A;  4MEX F;  3CP8 A;  2PEX A;  3AKZ A;  2Z99 A;  4Z2Y A;  2RDP A;  4XN3 A;  3DCF A;  1USS A;  1W4M A;  1U5T A;  3KFW X;  3G1O A;  4JYK A;  1LFB A;  1Z3X A;  5DCM A;  1BI0 A;  4OIO F;  2KIQ A;  2B9S A;  3HPH A;  3G1L A;  5HS8 A;  4XLA A;  1FTZ A;  5K7F A;  2HOE A;  2XPV A;  1QGP A;  3I64 A;  3HDD A;  1E3P A;  2GOX B;  2K40 A;  4PZJ A;  4EMS A;  1YRN B;  5K5Q A;  2GIV A;  2H6B A;  1VF9 A;  2RNG A;  3RPU D;  1DU6 A;  1SD7 A;  2ZXH A;  5M5X J;  3NWT A;  3F8N A;  4BQQ A;  4NHJ A;  2TRT A;  1ZEL A;  3OOU A;  5EEG A;  2LBF B;  3IH2 A;  4AD9 A;  2VKD A;  2LTP A;  1BI2 A;  3E6B A;  5TGT A;  3TKY A;  4OIP F;  5DUK A;  3H9J A;  2CRG A;  3HOY J;  1LVA A;  3BLY A;  1OCR H;  3WTS C;  4KYW A;  3ZQF A;  2NNY A;  2JK3 A;  4UV8 A;  4XL9 A;  2AXT C;  1SD6 A;  2M8E A;  2QEN A;  1O57 A;  1I1G A;  3GLL A;  4M9X A;  3H3V K;  2CUZ A;  2AQF A;  4NBQ A;  1W0T A;  3SHF A;  3ZXS A;  2VKE A;  4C3H J;  1R4M B;  4HV5 A;  5DEQ A;  3T5X A;  2NVY J;  2FQ3 A;  2XF6 A;  1P4A A;  4JOM A;  2HDC A;  1K78 B;  2JA2 A;  2ZC2 A;  3K1M A;  5KVR A;  3DEU A;  1A31 A;  5CYV A;  4J00 A;  4A3L J;  2LC2 A;  4KIG A;  4B09 A;  3MAJ A;  2MA3 A;  3HM5 A;  2EPF A;  1ZG5 A;  1Z3Y A;  2O8K A;  1QNT A;  3AG3 H;  3MD2 A;  2Y69 H;  3Q0U A;  4IXA A;  2Y9Z A;  1HF0 A;  1ZG3 A;  1AKH B;  3H3Z A;  4BNC A;  2EFN A;  5IYB J;  1YS7 A;  2GWR A;  3DKY A;  2VKH A;  3A4C A;  2ZB9 A;  2DA2 A;  3DU5 A;  3SJM A;  3K69 A;  1T98 A;  2CH0 A;  1XDU A;  2RGV A;  3HSE A;  4XLN F;  1KQ9 A;  5D5U B;  4GDF A;  5KK1 A;  4A3K J;  2CO5 A;  3KP3 A;  3KLO A;  2CUJ A;  5LHH A;  4A93 J;  1A36 A;  2M1B A;  3E5X A;  3REO A;  3OIQ A;  1RKW A; 
#chains in the Genus database with same CATH homology
 1XPX A;  2LMD A;  1MIJ A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...