2HOAA

Structure determination of the antp(c39->s) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs diana, caliba, habas and glomsa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKENKTKGEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTENNAPEDIA PROTEIN
publication title Structure determination of the Antp (C39----S) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs DIANA, CALIBA, HABAS and GLOMSA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1992-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hoaA00
2NS8A 4A3GJ 4GFBA 1Z77A 1DU6A 3JR9A 5E3MA 5K7FA 2D5VA 3HOYJ 1MBEA 1TC3C 5DTDA 4JP0A 1XS9A 1X58A 3W6VA 2ME6A 2HXIA 2XRLA 2TCTA 3FIWA 4DZJA 5GPCA 1RESA 3FKIJ 3GTQJ 1Y1VJ 1ZR4A 1IGNA 4UUSB 2HDDA 1JTYA 1HLVA 2DN0A 2CRGA 1XG1A 2JA7J 3ZQCA 4Y52J 1POGA 5C44J 1VF9A 4UUTA 5FLVA 4L5EA 2E2HJ 4A93J 1MNMC 3S15J 2R93J 1JUSA 4NDLA 3HEFA 1FTTA 1AKHA 3FISA 2ID3A 3K7AJ 3SDGA 2K9NA 2XPUA 3QQAA 2Y30A 4FTHA 1B72A 4QTRA 2DMUA 5EG0B 1ETOA 2LFBA 3OIOA 3JRIA 5GP9A 3E7LA 4G12A 3G1OA 1S7EA 3F0CA 3I4NJ 3BQZA 2R7ZJ 4XRMA 1D5YA 5FJ8J 2OPTA 4XICA 1ETYA 4M3BA 4QSHA 1HDDC 5FKNA 1QVTA 3A03A 3HGGA 3JRGA 3HM5A 1OJLA 1PUFA 3HOZJ 3B6AA 1YRNA 3ZQIA 2Y9ZA 1GUUA 1BW5A 3H3VK 4M6VA 3M3YJ 4DYCA 3JRHA 3Q0WA 1FTZA 3ZQFA 2COBA 1FIAA 1ETVA 2R5YB 2NS7A 3GTMJ 5F04A 2XB5A 5EEAA 3BTCA 1JT0A 2VKVA 4MO7A 2M9HA 1I6HJ 3MN2A 1ZGWA 2MW8A 5EGOB 3GTLJ 3HGYA 1GVDA 1JGGA 1K61A 4MLOA 1ETKA 1Q1VA 1H89C 4C3JJ 5C4XJ 1WCMJ 2ECBA 2VPRA 2KT0A 1JKQC 2M8GX 3JRDA 2JA5J 4BXXJ 1TWGJ 2DTZA 4EEFG 5JLWA 3QPSA 1BL0A 1B8IA 1VNDA 1NTCA 3LSJA 2EBIA 3S1NJ 1IDZA 5F0CA 4D7MA 1RKWA 3CMYA 4A3LJ 1AHDP 5BNGA 1SANA 3WHBA 4A69C 3BR6A 4Y7NJ 3JRFA 1OCTC 1XC5A 4A3IJ 4FE4A 2L7FP 1MBFA 1T56A 4FISA 2LVSA 1I50J 2MG4A 2HYJA 1MSFC 1TWAJ 2R5ZA 4C3IJ 1FEXA 2HOSA 5K7ZA 3HOXJ 1ZK8A 3SJMA 2M2EA 2HXOA 1FIPA 1IJWC 4C3HJ 1HCRA 1RETA 1O4XA 1PUFB 2AHQA 1JJ6C 1U9NA 2JWTA 1UMQA 2JJ7A 1JKOC 1BW6A 2DMNA 2KDZA 2E1OA 4D5CA 5M3FJ 1WGXA 5F0HA 2R0QC 5M5YJ 5F0FA 1VFCA 3DCFA 4JX6A 4DZPA 2PMZN 4J19A 5F1JA 5C4JJ 3A01A 4DYRA 2FX0A 4JYKA 2H8RA 2G0EA 1APLC 3S1RJ 2NOGA 3OSGA 1DU0A 1HDPA 4QIWN 1BJZA 1GV2A 1OFCX 2DA4A 2O7OA 2E19A 1Y1WJ 2GM4A 1VI0A 3BR0A 3BTIA 3PM1A 3G1MA 2O9LA 2VI6A 3S1MJ 4S0HB 9ANTA 5EYRA 1Z0XA 1MH4A 2EZLA 4B1RA 1IRZA 1WH7A 2JN6A 1IDYA 2K40A 1TWFJ 4AYBN 3GTPJ 1WI3A 2DMQA 2FQ4A 4LOCA 2CU7A 4A3BJ 5JLXA 4CYCA 2EZIA 3C2BA 4BBRJ 2XGCA 2LP0A 3FK7A 5EDNA 2L7ZA 3B6CA 1IG7A 2XB0X 2VKEA 5HODA 4A3CJ 3BTJA 3HDDA 2K9SA 1TWHJ 2N8GA 1LFUP 3FK6A 2EZKA 2LLKA 4BBSJ 5IYBJ 5IYCJ 2XPVA 2Y2ZA 4MFDA 3CDLA 4D5FA 3TEDA 5EF6A 3ZQLA 1T33A 3TW7A 1W0UA 4X6AJ 3O8HA 1JJ8C 2M0CA 5DS9A 1LFBA 1ITYA 1U78A 3BG5A 4JX4A 4XRSA 1X2MA 1AU7A 5IP7J 3BQYA 2GLOA 3RZDJ 5K7HA 1JUPA 4A3DJ 1H8AC 1X2NA 3L1PA 4UUSA 4C2MJ 1UG2A 1UHSA 2FJ1A 3BTLA 2JMWA 4XIDA 3HOUJ 3BR5A 3D1NI 2EZHA 2LD5A 3BG3A 1WPKA 3ZOBA 4A3JJ 1IC8A 4M3FA 2DA3A 3HB9A 5M5XJ 1MH3A 3MKLA 5M3MJ 4V2FA 4IHVA 5GPAA 3IH3A 3LNQA 2ELKA 2EH3A 1AKHB 5J1YA 2X48A 1U9OA 2JA8J 1K83J 4FE7A 2WB1N 2E2JJ 1OCPA 1B72B 3BG9A 5IYDJ 1NK2P 2H1KA 2QCOA 1WH5A 1H88C 3GTKJ 3O8GA 2FD5A 3TW6A 4JX5A 5F08A 1ETWA 1U8BA 2LY9A 3DEWA 3HOVJ 4B3AA 4IEJA 3BT9A 1RKTA 2DA7A 2Y9YA 3CCYA 2NVXJ 1G2HA 5FLMJ 1A6IA 2R92J 2XPWA 3S2DJ 3VPRA 3G1LA 2DA2A 2DA5A 2B63J 2ME0A 5IOZA 4BY1J 4A3MJ 2E2IJ 1F36A 3JRBA 1YRNB 2XSDC 3LOCA 4A3FJ 4MFEA 2CQQA 3GBGA 2RAEA 1ZKGA 3I4MJ 2OF7A 2O8KA 2XGEA 5EGOA 4I6ZA 5J1UA 5FKMA 2QF7A 3JRAA 2TRTA 3JRCA 2Y0SN 4X1EA 2ECCA 2IEKA 3RQIA 5IP6A 1R9TJ 2L9RA 3NARA 1TWCJ 4ABZA 3HBLA 5J1RA 3S14J 1ZR2A 1MBHA 1ZTRA 3GTOJ 5E3OA 1HF0A 2IBDA 1A5JA 4IHYA 2YU9J 1RR7A 2L0KA 4RDUA 3GTGJ 1B8IB 1MBGA 4IHXA 1JT6A 1RPWA 4W97A 4A3EJ 4RBOA 2HI3A 4M3DA 4AUXA 2CJJA 2M34A 3TP3A 3LSRA 2WAQN 4D7NA 4FCYA 2LKXA 1ENHA 1E3OC 4IHWA 3ZQGA 1EF4A 5EZHA 1LE8A 1HOMA 3UKGA 5FKOA 2I10A 1ZQ3P 1NK3P 2LK2A 2EQRA 4DW6A 4A3KJ 4V2GA 2NVQJ 1IUFA 2X9DA 5FKKA 1BA5A 2R5ZB 2JK3A 2LR8A 1F43A 2W48A 1P7JA 2XGDA 3WHCA 1JKRC 3LSGA 4M3GA 2X6OA 2HQ5A 3A02A 3NAUA 3SFIA 2AO9A 4MIMA 1I3QJ 2NVYJ 5IPAA 3QPLA 1QPIA 3H0GJ 2CUEA 3Q0UA 3Q0VA 2P81A 2CUFA 2HOTA 2ID6A 1ETQA 3CQZJ 1JTXA 3LSPA 5EZGA 3HKZN 4W1UA 1MSEC 3BR1A 5FKLA 1MBJA 5C3EJ 2GBYA 3JREA 2JA6J 4BKXA 5F27A 3A01B 3OOUA 2HOAA 1P7IA 2YS9A 1CQTA 3S16J 4B4CA 3MVPA 2L7MP 1W0TA 4BY7J 3RKQA 2DJNA 4M3EA 5EG0A 3BR2A 5IP9J 2DA6A 2Y31A 1ORKA 2YUSA 3PO3J 5E3LA 3S2HJ 1SFOJ 3S17J 3ZQHA 2IAIA 3IH2A 2DA1A 3M4OJ 3TP0A 3BR3A 4DYQA 5E3NA 3IH4A 2DMPA 5M5WJ 1GV5A 4XRSG 4XK4A 2MGQA 1ETXA 4CYCB 1FJLA 1GT0C 4AC0A 4I76A 2MSYA 2VUMJ 2NVTJ 2K9QA 1JUMA 3GTJJ 5IOYA 2R5YA 3PO2J 2DMTA 1LE8B 3Q3SA 2ZB9A 5J3LA 3K2AA 3IV5A 1MBKA 4HNVA 3HOWJ 2LTPA 3S1QJ 1QVUA 3RZOJ 1QRYA 3OSFA 2CQXA 1JKPC 1IV6A 1GDTA 2WV1A
chains in the Genus database with same CATH superfamily
2NS8A 2EA4A 3DWLE 3IAM2 1G3TA 3PNVA 4GFBA 4BJTA 4BHPA 4HX4A 1B59A 5DTDA 3WTWC 1BC8C 2EFQA 4O5VA 4C2UA 3J7AY 1X58A 1IUYA 5J4VA 3DBRB 3CLOA 3A1YA 4HZFA 5HLHA 4N4NB 3PSFA 3T1BA 1Y1VJ 2HDDA 4UUSB 2CRGA 1XG1A 4WXDA 1LDJA 1IN5A 1EJ9A 5CJ9A 3HJEA 1R58A 3FXQA 3ASNH 4PJLA 5J4YA 3BPXA 3Q9VA 3HTSB 5LRSA 1FYKA 4M74A 5JHFA 1FOWA 1VQ8I 5EG0B 3OY9A 4XLEA 4RB2C 3OIOA 4KIFA 3E7LA 4KFCA 2OAZA 1WJBA 4MNUA 1R36A 1Y0NA 1V4RA 4PJNA 1D5YA 3HRSA 3VFZA 3IRQA 4PFOA 1D0ZA 5FKNA 2KJBA 3RKXA 4G7ZF 2JA2A 2VQHA 1OJLA 5LHHA 2ZNYA 3HOZJ 1B1BA 1YRNA 4Y3OA 1GUUA 1S72I 3H3VK 4DYCA 4ZYHA 4OINF 4LB6B 2LKPA 1GXQA 2NS7A 4CICA 3MZHA 5F04A 5L3GA 5ILVA 1WSUA 1IRXA 2DPUA 1LNWA 1IXSB 2VKVA 3LQQA 4MO7A 5LFAA 2KIQA 3LA7A 5H20A 3CP8A 4DNCA 1D5VA 3MN2A 4KIGA 2MW8A 4IPAA 1YLFA 2QA4I 3GTLJ 2M3AA 3LA3A 3HGYA 4H0EA 1K61A 4MLOA 1H89C 1W7PB 5H6QA 3H5RA 5C4XJ 3GFJA 3CUOA 2LSOA 3I55I 1VQNI 3E6BA 2E1CA 2F2EA 4I0AA 2ECBA 4A6DA 2F4OB 4AVPA 4BYYA 3PUBA 1ZLJA 2DTZA 2KRCA 1ZREA 5JLWA 3QPSA 1U5TC 2CFOA 2E36A 1G3WA 3L2QA 2LF7A 2K7LA 3LSJA 2LDUA 1WQ2A 2BVMA 1N25A 5F0CA 1UAAA 1IN8A 1QU3A 4G94A 2GIVA 4KYWA 1IN6A 1OYIA 1ZELA 3WHBA 2ZSHB 4RS8A 2CH0A 3OYDA 3J80K 1MNEA 3LAJA 4Y7NJ 2EV6A 2CG4A 3IWFA 4QPQA 3FMQA 4GYGA 2L7FP 1MBFA 1YS7A 2L7KA 2BBYA 3MZ8A 3E6DA 4NC7A 4NNJA 3RTRA 1J09A 4ZDLA 4I99C 1MSFC 1SVMA 3Q5FA 5HLIA 1TP4A 2IS4A 1TZLA 2P7CB 5K7ZA 1DP7P 1XDSA 2W82A 2R7FA 4GRIA 3PFIA 3SJMA 1H0MA 1AOYA 5EJCA 4KITB 1IJWC 3P7NA 1MJBA 2OA4A 1XCBA 2STWA 3J7YJ 2AHQA 2KFDA 1IN4A 1U9NA 2JWTA 1KGSA 2EV5A 1UMQA 1ZRCA 1BW6A 2DMNA 3GFLA 4KNYA 1XSDA 2W4SA 4MTDA 5FLXK 5J8FA 2CW0F 2MYSA 3G6EI 4ZJZA 5HNFA 1VFCA 1MJ9A 4JX6A 3H9GA 1RRJA 4KIBA 5H2FC 2HQNA 3A01A 3BJ6A 4Q47A 3ZRGA 1O3TA 3C18A 3W2WA 3P9KA 4D0PA 4ITVA 1DQUA 2NOGA 3OSGA 1JGSA 1HDPA 4QIWN 1DU0A 3PNYA 5HS7A 1OFCX 2VJIA 3R0AA 2DA4A 2O7OA 1VI0A 3UNGC 3KP5A 2H94A 2DXIA 4LIVA 4V19K 2H27A 2DT6A 2VI6A 3S1MJ 2FE3A 1Z0XA 1MH4A 3RKWA 3HIFA 4KA4A 2DU9A 1WJAA 1WH7A 2K40A 3JTGA 3G4SI 2BZTA 2DMQA 2FQ4A 3MZYA 4LOCA 4PK4A 1OKRA 4A3BJ 5JLXA 1IZ1A 3K0LA 1OCRH 4CYCA 2P4WA 1Z7UA 5H6RA 3LAPA 3FK7A 5EDNA 3HOSA 5K5QA 1BI0A 1JE8A 3PQKA 4ZTJA 2VKEA 5HODA 4O6JA 2IS1A 3K9TA 2JZYA 3FK6A 2LLKA 3I64A 5IYCJ 2XPVA 3CCJI 2ETHA 3TEDA 2FBIA 3VYTB 2WV0A 4LLLA 3MEXA 5D8KB 2XROA 1SFUA 3TO7A 3RQ4A 3TW7A 4X6AJ 3O8HA 1FYLA 4IQ4A 1LFBA 3MWMA 4LJZF 1XGMA 4XRSA 2FBHA 2GLOA 3CCSI 1R1VA 3LSKA 5K7HA 3KE2A 4A3DJ 1J75A 3KETA 1X2NA 3F21A 1BN5A 4HQEA 1J9IA 3NRVA 3DPTA 4UUSA 1UG2A 3DKWA 4PJJA 2QZ8A 3DFGA 1IO2A 4XIDA 1DPUA 2MC4A 3D1NI 3S2WA 5HNHA 1IC8A 1FC3A 2QKMB 4P96A 1R1TA 1T6SA 1UHWA 1BR2A 3BZCA 2ISZA 2HWVA 1O3QA 1AWCA 3IH3A 2RN7A 3PQJA 3LNQA 3ZMVA 1K83J 2QSHX 1SC7A 3CCRI 3BZ6A 3CC2I 1M1EB 3VEPA 1OCPA 4HNUA 1B72B 1WWXA 3VWBA 1S8NA 1WH5A 3GTKJ 3O8GA 2FD5A 4CCNA 3TW6A 2CUZA 2XKOA 1FYMA 4HPQA 1HKTA 3TBIA 4ZZDA 3BT9A 3KIOA 4GYIA 4F91B 1TQIA 2DA7A 3CCYA 4RGRA 2NVXJ 5FLMJ 2VASA 1U5TB 4XLHA 1QNTA 2XPWA 3G1LA 4G7HF 1PJRA 2DA2A 3OMYA 3FZVA 2KISA 4CA0A 2B63J 1XGOA 2ME0A 5IOZA 3JRBA 2I8DA 5E79C 2OZ6A 3EQLF 2F48A 2HZTA 3LOCA 2PFBA 4HLXA 4II2A 3GBGA 1J7KA 2XVCA 3CC7I 3H3ZA 2F5DA 2J5PA 1YJWI 2OQRA 3D5RC 4I6ZA 1V5GA 1SD5A 3U9GA 5J1UA 1ZHFA 2QF7A 2RQQA 4BXFA 1QHGA 5GAEJ 4X1EA 3TDUC 4LITA 3GW2A 2AQEA 3SQNA 5IP6A 2Q8KA 5F1RA 3NARA 3HUGB 5CQEA 1IF1A 1TWCJ 1ZH5A 5ICFA 3S14J 1E3HA 1YG2A 2QEXI 1MGTA 3QOPA 5E3OA 4OIOF 2E60A 1HF0A 3P9CA 1R5GA 1JHHA 3A2KA 2K4JA 4RDUA 1WHUA 4OIQF 1NHAA 2VXZA 3M7GA 2EFNA 3A4CA 4A12A 3LQRA 1MZBA 3BWGA 3S8PA 4RBOA 4AUXA 3K4KA 3RCOA 5L3FA 4E7IA 5FO5A 2RQPA 2M1BA 1W4MA 5TJJA 4FCYA 3ASOH 1A31A 3K4LA 3E3VA 3ZQGA 5E17F 5EZHA 1EF4A 2L4MA 2XHKA 4KN7X 2F5VA 1R6RA 2OCEA 2PMUA 1YW9A 2DODA 2IGKA 2LREA 2LK2A 2MH9A 2MC3A 5A2QZ 3R60A 4GO1A 4A3KJ 1J2XA 4K2EA 2NVQJ 4ON0A 1ODDA 2O3FA 1BA5A 2JK3A 2LR8A 2IJLA 2AQFA 2W48A 2VBYA 3WHCA 4LG0B 2QGUA 4KMUX 3LSGA 2RVCA 2NYXA 4A0XA 3A02A 3HPGA 2E35A 4MIMA 1WJDA 4RLQA 3TO6A 4XOTA 5K1YA 1MDMA 2K9LA 3Q0UA 4I2OA 4H4KC 2XAHA 2VT3A 4ZH4F 2VLAA 1QZYA 2CV2A 4AIHA 4XN3A 2P81A 2HOTA 2PI0A 4R1HA 3LSPA 4W1UA 3WTZA 1A6QA 3VSLA 1MSEC 3IKTA 1QBJA 1MBJA 3DPLC 2GBYA 4PJMA 2BHYA 3OOUA 1P7IA 3S16J 2O8XA 3GZ6A 2RNGA 2M7BA 3RKQA 3GUDA 2DFIA 2PEXA 1YITI 3EUHC 1HKSA 4BHBA 5B5EC 3BR2A 3ABKH 4RGSA 3BROA 5K5RA 1STZA 3PO3J 3HC7A 2IGNA 2L2OA 2JUCA 2IT0A 3LL7A 2H1LA 3QU3A 2IAIA 3IH2A 1R5HA 4YIIA 5HDKA 4DIQA 2VN2A 4DYQA 2CW7A 1CGPA 3DTEA 3ZGKA 4U87A 1LQ1A 5DDGA 1J59A 4XRSG 4Y13A 2W24A 3TL4X 4XBFA 1FJLA 1Q1HA 3K70D 2VONA 1IW7F 3TQNA 2K3FA 2F4MB 1X3WB 2RNJA 1JUMA 1S7AA 2W25A 2ZFUA 3O2PE 4EJUA 2IP2A 5IOYA 4PFPA 2ZB9A 2I5UA 2ZFWA 1Z6RA 3K4MA 2LOOA 3GMEA 3DEEA 4ESBA 4EM1A 3P5JA 3REOA 2Q0OA 2WV1A 2V1DA 2EJRA 3A0BC 4A3GJ 2X51A 4E7HA 1E17A 2CV0A 1DU6A 2KZGA 2YU3A 5CVUA 4XMYA 5K7FA 2HQRA 2ZXJA 1TT0A 4JP0A 1Z3YA 3SEZA 4RA2A 1DPRA 5LGTA 3W6VA 4F3QA 3H9JA 1MMGA 4L5JA 4J01A 4RB3C 3ZXSA 1KU7A 3FKIJ 4U7BA 2GA1A 2MFZA 1HLVA 2BY1A 2JA7J 1LUJB 4Y52J 1OR7C 2CO5A 3FX3A 4Q4ZF 3CCUI 5FLVA 2R7OA 2DI3A 2E2HJ 1U6GA 3PL8A 3MCZA 3S15J 3I3LA 4A5MA 2R93J 4CH7A 3JW4A 4G6DA 4NDLA 3HEFA 3GLLA 3FISA 2ID3A 1QGPA 4UVCA 1YO5C 3H35A 2XPUA 3FXJA 3OS0A 2PJPA 1E0EA 5IY5H 1B72A 2QSGX 2DMUA 1T8IA 1IAWA 1QHHD 5JI6A 5GP9A 1DUXC 3G1OA 3CDIA 2R7ZJ 2KKOA 5B3SH 5D5WB 2OPTA 5JFRA 3V8KA 4XICA 1ETYA 2OZUA 3F8CA 1V5FA 3G3ZA 4M3BA 3RKYA 4CCOA 4B48A 3HGGA 2P6SA 1ZG1A 2EIJH 1FWZA 2LRDA 1KQ9A 5CQGA 3IWZA 2E71A 3HM5A 3PIOF 1PUFA 2V1UA 1WJFA 3I0TA 1DDNA 2Y9ZA 3WTYC 2VOOA 4M9XA 3M3YJ 3KP4A 3JRHA 1FZPB 2COBA 1FIAA 2DPDA 1ZRDA 2BXZA 2XF7A 3GTMJ 2B7EA 3G2BA 2BXYA 3QPTA 4BEHB 1S7OA 4KT5C 1JT0A 5GTIC 2GXBA 4BAYA 3FHZA 1BC7C 1T98A 1X1CA 3OIPA 4N9IA 3K4CA 5EGOB 1VQMI 1B6AA 3ZMSA 1LVAA 3U21A 2QYOA 4EATA 2WA0A 3ECHA 3T8TA 2XUBA 3AFHA 5L3EA 4R8HA 5E18F 4ENNA 1USTA 1WCMJ 2FQ3A 3QYEA 1OYYA 2D1HA 1JKQC 1X3ZB 2VPLA 1VQ7I 4EEFG 3QWLA 1O3RA 1ON1A 1ZAOA 3FMSA 1ONVA 3KYLA 5AONA 3GFMA 1I6XA 4OIRF 1GHCA 1B9MA 2JPBA 1H9GA 4G6TB 3D0SA 5BNGA 4M9SA 4A69C 2XIGA 5BOXA 1LEAA 4LIUA 4B47A 4EQQA 3HL2A 1BI1A 4A3IJ 1W5CC 2RDPA 4FE4A 1T56A 1WVRA 1EKEA 1ACIA 2EINH 2LVSA 3V4GA 4F55A 4L9JA 2FUG2 1Y0UA 4HV6A 1K78A 2HYJA 3FBIB 3M07A 3S3MA 2X0LA 1F5TA 3HXLA 2VC1A 2L4AA 4RAYA 1SFKA 4LK0F 3U1DA 5B1BH 4BH9A 4LG0A 3HOXJ 3BCBA 1BOBA 4EV0A 1N77A 2KJCA 4PGHA 2M4KA 3AG2H 1SAUA 2E1MC 1RETA 1O4XA 4AM3A 3TOAA 2HKOA 2EIMH 1Z91A 2DLLA 3FWEA 5HDGA 1G3SA 2YX4A 4HF0A 2KDZA 3R4KA 2DFHA 3H92A 2V1XA 4NUBA 1BJAA 2NNNA 3DLAA 2BVLA 2A5WA 3LWFA 4BGDA 2R0QC 3MAJA 1FY7A 2GQQA 5C4JJ 1I1GA 3BLYA 4GCVA 1SFXA 5FFZA 4I0BA 2DK8A 2ZXIA 2QM3A 2FX0A 3IKVA 2OU2A 4C9YA 4JYKA 5GADJ 2G0EA 2IW5A 3S1RJ 1GV2A 4Y17A 4HX8A 1XMKA 4KN4X 5L3BA 3K1MA 1D8KA 2E19A 1Y1WJ 2GM4A 1UJ8A 3F8FA 1VQOI 3PM1A 4LGWA 2Z2SB 1A04A 2O9LA 2WBMA 1Z21A 4S0HB 9ANTA 2BGCA 2FMLA 5J47A 2O03A 3JSPA 3WG9A 4N4OB 2HR3A 2XASA 3WTUC 3CUQB 2LY2A 3IRRA 1S6LA 4U88A 3ABLH 1G3YA 3H5NA 4HA8A 3MKWB 2ESNA 1HW1A 2WAEA 1VZ0A 3B6CA 4XQFA 5FLXZ 1IG7A 3EUKL 2ACJA 2ZMEC 3BTJA 1TWHJ 3FXUA 3QOEA 2KDOA 4RAFA 3KP6A 2VT2A 4EM2A 3W6JB 5IYBJ 3F22A 1P9QC 2OCCH 2VQLA 1DGRM 2Y2ZA 4MFDA 2VJ4A 4D5FA 5EF6A 1CF7A 4KJZA 2WB1A 1BIAA 1Y39A 2PG4A 5D5UB 4KMFA 2X1EA 1P4AA 1T0FC 3SHFA 5LLQA 1ITYA 4ZYEA 1W36D 3ZMTA 3BG5A 1FOXA 2IS6A 3CDHA 4WXHA 5DYMA 5CKTA 3OS2A 2V7FA 3BQYA 3WU2C 5HS8A 4G8XA 4QLCU 1H8AC 3L1PA 4PJ0C 4C2MJ 3BTLA 1Z67A 3HOUJ 2KRFA 4L5IA 3K1PA 4FHTA 3ZMZA 4A3JJ 2HYGD 4ZYDA 5M5XJ 3CCQI 4I09A 1JXSA 3OS1A 3KFWX 4IHVA 4HDVA 5GPAA 1OLTA 4MTEA 2FOWA 4CCLA 2JA8J 3ZQQA 1OMIA 1OYWA 1LEBA 2WB1N 3V42A 2ESHA 3LSHA 5IYDJ 2BW3B 2H1KA 3RSNA 2VJJA 4LLNA 2K3PA 4DOZA 3PJRA 4P55A 3HOVJ 4B3AA 4IEJA 2R7RA 2HTSA 4CZZA 5LHGA 2Z3YA 4FX0A 5KHDA 2HDCA 3VPRA 2A07F 2ADUA 2LBFB 2DA5A 4IQJA 4KT6A 4DBQA 1R4MB 2WAFA 3RIRA 3EDPA 3KEOA 1XN7A 3GF2A 4HLYA 1ZGJA 5KCMA 1SAXA 4OOIA 1X1PA 1G6NA 4MFEA 2CQQA 1A36A 5FD6A 1U3EM 2XAGA 2RAEA 3X2QH 2WAQA 1JI8A 4FQGA 2K4BA 4CXFA 2R7QA 3LSMA 1IRGA 2XGEA 5EGOA 1R1UA 3TO9A 1Y6IA 2TRTA 4RMNA 1N78A 3P9IA 3FM5A 3OYMA 2Y0SN 2ECCA 3J81K 1WJCA 1O7FA 1R9TJ 4U0VA 3CD6I 3CLQA 2A6EF 1RC9A 2OV7A 2HOEA 3HBLA 4AD9A 5J1RA 1ZR2A 3FM3A 4L18B 1ZTRA 3GTOJ 2K85A 4QWQA 1YE9A 2E1MB 2L9SA 2GOMA 2CW8A 3BC8A 2YU9J 3F23A 4EGYA 1RR7A 2L0KA 4E7ZA 2STTA 4YIFA 3KP7A 3QYBA 2P0WA 1H9TA 1REPC 2KRHA 3DBHB 3KP3A 4Z2YA 4A3EJ 4ENJA 1K79A 2HI3A 2PQ8A 3ZN0A 2Y69H 1X4PA 3TP3A 2B9SA 1N75A 1ZGAA 4BQAA 2WAQN 2VOPA 2LKXA 1BI2A 3F72A 4IHWA 1HOMA 3CMMA 3EUHA 1I39A 3WE3A 2BOLA 3RPQA 4WF2A 2DW4A 2EQRA 4DW6A 5BS6A 1IUFA 1JHFA 2PX9A 4QPOA 5JVGF 3ZPLA 5FRNA 4KDPA 2XGDA 1WJEA 3EETA 4WK8F 1JKRC 4HF2A 4LFUA 4RAZA 1ZRFA 1WI9A 3I4PA 2VKHA 3SFIA 5JHUA 4ZDOA 1I3QJ 2NVYJ 2QKLB 3GZNB 1MJAA 2EFOA 2H8WA 5D6EA 4EJVA 2M87A 2R4GA 2CUEA 2E34A 4HOBA 2HEOA 3Q0VA 2BHZA 4IOCF 2AXLA 2XDVA 2ID6A 2M0MA 2V9KA 1JTXA 4LMYA 2ZMEB 2EIKH 2RGVA 3HKZN 5E8IA 2P8TA 4JK1X 2ZC2A 3CP2A 3OYAA 1SEUA 3OYGA 4YIRX 1L3LA 1RIOH 3HZJA 4NC6A 4IO9F 4II3A 2JA6J 5F27A 4IF4A 5FD5A 4M71A 1NH3A 4XR6A 3I59B 1W0TA 5HVQC 5LGNA 3GEZA 2OBPA 4XLNF 4BY7J 2KPMA 1YHQI 3DPUA 1QPMA 4M3EA 5LGUA 5EG0A 2IS2A 2YSRA 4AVZA 1ERDA 1ORKA 2JT1A 3CO7C 5E3LA 3S2HJ 3OWTA 2DA1A 1MW7A 3TP0A 3CUQA 5E3NA 4L9NA 4S04A 1ZLKA 2VKDA 2CS3A 2L5QA 1R00A 2MGQA 2E5ZA 2V1NA 3GXOA 1W5SA 1RUNA 1W7PD 1SD6A 4AC0A 4R79A 2OQGA 2ZBKA 4XKWA 5ICEA 3S3OA 4OMYA 1ZG5A 2VQCA 2FSWA 3I9V2 1YJ9I 4MGRA 3HSEA 4AIJA 1TTYA 2VE8A 4L9TA 4L9VA 5GAHJ 5DM6F 3VYRB 3OYKA 1LE8B 3LSTA 3K6GA 3E1SA 1MBKA 5FGMA 3VOEA 2XF6A 4HW0A 1TW3A 2V4JC 2LTPA 1T95A 4WWCA 3DU6A 2IGMA 4BE1A 1EH8A 2NRAC 2XRNA 3H36A 5B66C 3JR9A 5E3MA 1SFEA 2D5VA 1BBYA 2QENA 2LC2A 1MBEA 1WZ2A 1W7PA 2DO7A 2JRMA 1VQ9I 4Y15A 3C2HA 3W2AA 4M73A 3T0YA 2HVRA 2ME6A 4C30A 3V8LA 3ABTA 5DD8A 1KQ0A 3OYLA 2VC0A 1UELB 2XRLA 3ERMA 2TCTA 3FIWA 4DZJA 5GPCA 1RESA 3AL0C 3GTQJ 4DQ2A 1ZR4A 1IGNA 2F5EA 2Y0MA 3GWZA 2B0LA 4IOAF 1POGA 5C44J 2A69F 2L9VA 2BY0A 2HDWA 1K4TA 3R6SA 4A93J 3RYRA 3ROUA 4M6XA 1D0YA 2DOEA 1JUSA 3ZMDA 3CJRB 1FTTA 2QWWA 1KONA 2K27A 4WXCA 4BUPA 4CCJA 3SDGA 2K9NA 3PUFA 4MQVA 2Y30A 4Q5SF 2O5RA 2FNAA 5DM7F 2IA2A 2XAFA 1ETOA 2LFBA 2DT7B 3JRIA 2F5CA 3CF5F 3RJPA 4M9ZA 5HOOA 4L0YB 2E7XA 3F0CA 3L7WA 1Z9CA 3BQZA 3N4MA 4XRMA 3TKYA 2HVSA 2M5WA 2MA3A 2DOAA 5FJ8J 1F1ZA 1TT5B 4QSHA 1IXRC 2KIFA 3GLXA 3HSRA 3F6OA 3A03A 1C0WA 1XMAA 2IPQX 2LBFA 1W5TA 1IRFA 1FNNA 1HW5A 1S5LC 2Y48A 4EM0B 3M8FA 2ZXWH 3ZQIA 4WX9A 1BW5A 3NWTA 3DV8A 1FTZA 3ZQFA 4PSWA 1SMTA 3R61A 2R5YB 1FT9A 3B73A 1YI2I 3M1EA 1YJNI 2KL4A 5EEAA 2X6YA 2J5OA 3OV8A 3FF5A 5EEGA 1OCZH 1T08B 2M9HA 3KLNA 1I6HJ 4PCQA 3CCMI 3KX2A 1VQ5I 1GVDA 3ISPA 3WE2A 3BG7A 1ETKA 1Q1VA 1VQLI 4C3JJ 1O57A 1RNLA 3WGHA 2BY2A 5FB2A 5J40A 5CVVA 2HQAA 3JRDA 2DTRA 4XLPF 1P4XA 1TWGJ 4NC8A 2EFPA 2HU9A 2DYSH 3Q9SA 1VNDA 2CQKA 4I01A 1KYWA 2EBIA 2O0YA 5D8LB 1VQ4I 2AXTC 4F92B 1RKWA 1XCVA 2G9WA 3GX4X 1AHDP 3SZPA 3HSFA 1SANA 5CVRA 1QZZA 3BR6A 3AG3H 3NWSA 4Z6YA 3BJAA 3JRFA 1YQAA 2HYFA 2ZJRF 2Z16A 3F8MA 2X1DA 3ECOA 2FA5A 3S32A 4E7JA 1I50J 1XDUA 3V8JA 2CV1A 3E97A 3OYEA 1EV7A 1TWAJ 2A6TA 4BJ5C 1R7JA 3TMOA 2R7SA 4B09A 1FPQA 1R5ID 2R7VA 5KK1A 2XKPA 2ZCWA 3VODA 2UWMA 3ULQB 2EB7A 2XV4S 1FIPA 1HCRA 2D1VA 4P9FA 2A5YB 2DK5A 4AYBA 1JJ6C 2C6YA 4ESFA 1XX5A 1Z3XA 1PYVA 1YIOA 2DDAA 4HX7A 3PIPF 1JKOC 2ZJQF 2FEZA 2P6TA 4XLAA 2E1OA 2VB6A 2M30A 2DBBA 3BDDA 2Q1ZB 5M3FJ 2ZMEA 1T39A 5IT9Z 1WGXA 5F0HA 3LMMA 5M5YJ 1MD0A 3DCFA 3CO6C 2WY8Q 1HXDA 2L01A 4DZPA 2PMZN 3A0HC 4J19A 4IRGA 1SVLA 5F1JA 2JSPA 1YIJI 4U0WA 5A2QK 2P5LC 3VYUB 1FP2A 3HYIA 1I1SA 1XD7A 3ZN1A 2H8RA 1APLC 4BL0B 2A61A 1VQ6I 2A05A 1BJZA 4UHTA 4FASD 5LBQA 2V9PA 4Q48A 4A2UA 3JAMZ 2Z33A 4ZYGA 3K10A 2FU4A 3BR0A 4XL9A 3G1MA 3EUAA 1AA7A 4ANJA 2P5KA 3BJOA 2TDXA 4XN0A 5EYRA 2EZLA 4XM3A 2MLGA 1IRZA 1IDYA 4AYBN 1TWFJ 1WI3A 2R7WA 3RI4A 1FBQA 3AL0B 2CU7A 1U5TA 3MMYB 5ILUA 3CCLI 1X1DA 4UB8C 4HF1A 2EZIA 5DUKA 4RGXA 3WGIA 3C2BA 4BBRJ 2V9VA 2XGCA 4OMZA 4I98B 2IA0A 1XMXA 3HTUA 5TGTA 4Y4RA 3VB2A 2GAUA 1XPXA 2K9SA 3HDDA 3RPUD 2EWNA 3T5XA 4BBSJ 2QLZA 2KIUA 2Z5UA 4D1QA 3ML6A 3CDLA 1TQMA 4JBAA 1ZN2A 2H09A 2MBFA 4B44A 1S3JA 2G7HA 4XLFA 2ELHA 1T33A 2CUJA 5CVJA 4YFXF 5K5OA 1JJ8C 2M0CA 1OCCH 3EYIA 5DS9A 3UR3C 1D1BA 3HUGA 1X3UA 1U78A 4JX4A 1BR4A 3L09A 4UNOA 1X2MA 2JRTA 5IP7J 4NB5A 1JUPA 4HBLA 3QAHA 3RPUA 4OAZA 4A6EA 1UZCA 4IXAA 1UHSA 2FJ1A 1V54H 3BR5A 3C1DA 2CYYA 3COAC 2LD5A 3ERED 3BG3A 4ESJA 1WPKA 4PGGA 2DA3A 1PDNC 1MKMA 3NQOA 3WTTC 1WKMA 4L0ZB 3DP7A 2KZVA 2ELKA 1KYZA 5ILSA 1AKHB 2X48A 1ZG3A 1HSTA 1F4KA 3VYSB 2XSJC 3J7ZI 2AS5F 4GXOA 4PUSA 2E2JJ 5LHIA 4EMSA 2MH2A 1I3AA 2VXDA 3ZCOA 3MQ0A 1O7LA 2OC6A 2QCOA 1SD4A 1TBXA 3DQVC 3FXMA 2LYCA 4HYEA 2FXAA 5F08A 3WU1B 1U8BA 2F4IA 5B1AH 4LB5A 3AKZA 1HSJA 2OJED 4C2TA 2CQNA 2R92J 1HQCA 3ABUA 1YTYA 2QQ9A 3SZTA 5D4RA 1R22A 1OISA 1R49A 3H9QA 2HNHA 2X1CA 4BY1J 4A3MJ 2E2IJ 2FF4A 2NOJB 4FX4A 4MHGA 5FROA 4RM3A 1P4WA 1EA3A 2GA2A 3CZ6A 4A3FJ 1KU9A 3KZZA 3FBNB 4YEJA 2X85A 3I4MJ 5JR3A 2KLOA 4Y33A 2A6HF 4FETA 2ZKZA 1P6RA 3NEUA 1FSHA 3ZQ7A 3JRCA 3B02A 3J80Z 1K4SA 3L2CA 2L9RA 3GZ5A 3S93A 3V7SA 2YR2A 2GXGA 4XKBA 1XB4A 3FMRA 1TQPA 4JQFA 4BDZA 1MBHA 3H3UA 5BPIA 3W3CA 1OPCA 4YFNF 1A5JA 2ZNZA 3VDXA 1QQIA 4IHYA 3IL2A 3OL3A 5LD2C 2MABA 3GTGJ 5DEQA 1B8IB 1MMNA 5LEJA 4IHXA 1EH6A 1JT6A 2XAQA 1XGSA 4XKVA 2VQGA 5KVRA 1QA6A 1FBUA 1D1CA 2CJJA 2M34A 3L2UA 4BACA 2IA1A 1ULYA 5IT3A 4EJTA 5TISC 3DF8A 1FBSA 4EJOA 3CMAI 2XGXA 3DKYA 1E3OC 2CMPA 3IAS2 3HHGA 1GXPA 2Q2EB 3LSIA 4XSXF 5HLGA 2I10A 1YW8A 4U0YA 3O3KA 3J81Z 2W7NA 4X0GA 4V2GA 5FKKA 2CSOA 2R5ZB 5DCMB 3K70C 4OU0A 1IXCA 3IC7A 1YS6A 1QZEA 2O6GE 2VIXA 3RYPA 2ZJPF 3DTIA 4IHSA 2LMDA 3NAUA 4BS9A 2HVQA 1OCOH 4E70A 1Y56A 2VODA 1LVKA 3N05A 5IPAA 3QPLA 3I71A 5KAFC 4MEYF 4ASNA 3OYNA 1TW2A 2CUFA 1R4NB 5EEHA 1ETQA 1LPQA 1XSXA 4M6YA 3PFYA 5EZGA 5AIQA 5KAIC 3IHUA 1J0RA 4RGUA 1G4DA 3BR1A 4MEXF 4IKFA 5C3EJ 5ICGA 4UXNA 5HLTA 2HOAA 2KMUA 4E6KG 4OIPF 1W1WE 3FXRA 4B4CA 1XTAA 1G59A 2PJRB 4MQ9F 4BQOA 2GWRA 4XORA 3WGGA 3ZR8X 3HOTA 2CQ7A 2PN6A 2Y0SA 3BY6A 2Y31A 2YUSA 2GIZA 1SFOJ 2ZJ2A 1TNTA 1Z7LA 3ZQHA 3TOBA 3M4OJ 2O61A 2R7TA 3BR3A 1KU3A 3DEUA 1USSA 5J8CA 3CESA 5E1ZB 2WTEA 2Y75A 1GV5A 4XK4A 2XC7A 3BPVA 3MKZA 3KYDB 1FMVA 2MSYA 1Z05A 1D3YA 3FXOA 3QPHA 2FMYA 2K9QA 2NVTJ 5F64A 2IRFG 3TGNA 3HRMA 2DMTA 3M1CA 1L0OC 3Q3SA 5J3LA 4BEHA 3K2AA 3IV5A 2HS5A 1RZ4A 3MD2A 1EH7A 3V7CA 1KA8A 1QVUA 3OSFA 2CQXA 4I02A 1IV6A 1GDTA 2QQAA 2JJ7A 1T2KA 2KQRA 2HPMA 1XGNA 1Z77A 2Z9OA 2JTVA 2JVHA 2UUZA 3HOYJ 2X6XA 4PZJA 3JSOA 3DBLB 1TC3C 2LKSA 1UFMA 2BV6A 1XS9A 3ABMH 1S29A 2Z1DA 4IZZA 1HBXG 1MDMB 3DLLF 5E1XA 1T38A 3M8EA 2D2WA 2HXIA 2LNBA 5D5XB 1Y8RB 2RV8A 5DV5A 4HG2A 3WU0A 3QP6A 1JTYA 1TNSA 2DN0A 4E7KA 5D5VB 4YRVA 3ZQCA 3GCMA 5TRDA 1VF9A 4UUTA 2UXXA 4L5EA 2BYVE 2LH9A 2EA2A 1WRJA 3BZKA 4AWXB 1RR8C 2VL8A 3E6MA 4ZYAA 4YFKF 1MNMC 1WFXA 1ZYRF 2G7UA 3K4JA 3H0DA 1AKHA 3T8RA 3M8JA 3K7AJ 1OQYA 3HKZA 3EYYA 2COMA 3QQAA 5F6FA 4B3XA 4FTHA 2F5FA 4CYDA 4QTRA 2CWEA 2PLYA 2L9NA 1YOVB 4G12A 1S7EA 2BY3A 3I4NJ 3LFKA 3TDZC 5BPDA 2LG4A 2R7UA 1HDDC 2HFHA 1QVTA 1LJ9A 4TV7A 4B43A 1Z6TA 2NS0A 3G71I 4BQQA 2DJIA 5D4SA 3OIQA 2VJ5A 3JRGA 4NQWB 4HV5A 5ERIA 1UG0A 3B6AA 4IRHA 1FLIA 3L9FA 4M6VA 1Y8QB 3Q0WA 1UCRA 4P5OA 2XF5A 1ETVA 1SMYF 2IXSA 3SDBA 4O3MA 4CZCA 1F9NA 2DQLA 2W1OA 2XB5A 2FRHA 3BTCA 4HAMA 1KZHA 4XRFA 4CO8A 4IRIA 1P92A 2UZKA 3CCEI 1ZGWA 3OYHA 3VSKA 3M9AA 1JGGA 4G9YA 2VBZA 2UV1A 2EFWA 1RUOA 5AIPA 2NNYA 2KIMA 4UVAA 4JOMA 2VPRA 2KT0A 2M8GX 2BEOA 1O3SA 2JA5J 4BXXJ 3DXJF 3CJQB 3FHNA 2M4GA 3KP2A 4IVNA 1A35A 1GVJA 1XSVA 1BL0A 1B8IA 1NTCA 2A68F 4RM2A 4XSZF 3S1NJ 1IDZA 3FXLA 4OWRB 4YELA 4D7MA 2A3SA 3I58A 3CMYA 4A3LJ 3DTKA 4KICA 1OR7A 3GFIA 3L2RA 1PP8F 1G8XA 5CPRB 1OCTC 3KLOA 1XC5A 4FISA 3OR2C 1FP1D 1K6YA 2Q2EA 3LA2A 3PNTA 3CTAA 4ENKA 4ZTFA 3OYCA 4A5NA 2E5NA 2MG4A 5KNLA 4UUVA 4CHUA 4AU7A 2R5ZA 4C3IJ 4EVIA 1FEXA 2HOSA 4HEA2 5DCMA 5J6XA 3K2ZA 3H5AA 3E0JB 2HKXA 2LF8A 3S3NA 1ZK8A 2VBWA 2M2EA 2HXOA 3BG6A 3RDIA 5GTHC 1MNDA 4C3HJ 4G7OF 2WWYA 1E3PA 4HDUA 3C3WA 3ZP5A 3FDYA 4AIKA 1PUFB 5FFXA 2KP6A 1YX3A 2RKHA 1V5EA 1E2XA 4XKCA 4KUMA 4D9JA 2EK5A 1VQPI 2VBXA 4HQMA 4D5CA 2XAUA 3F9KA 1VTNC 2OTJI 3KYCB 5F0FA 1IV8A 4J00A 4BJ6C 4IHTA 1W36C 4UY8I 3F8BA 1X19A 3HHHA 4DYRA 4HNTA 3D5SC 2PJRA 3I5UA 4BXUA 3JCUC 3HRTA 2IVMA 1GLNA 5FRMA 4LG3A 4M72A 3C7JA 3BTIA 2BW3A 5BQTA 2JVGA 3I56I 2MLKA 3F3XA 3PSIA 4B1RA 2K02A 3OYFA 2JN6A 3L2WA 1FX7A 1YYVA 4RAGA 3GTPJ 2QVOA 3FXKA 4ZC3A 1DGWY 2R3SA 5LEKA 3OOPA 1RI7A 3ONQA 5JVTA 4EGZA 4I7HA 1YW7A 1K6OA 1LFPA 3BCAA 3DU5A 4CGZA 4HSRA 2V26A 3AG4H 1R71A 2LP0A 4BE0A 3FKJA 2ZO4A 3O6BB 1X1BA 2GXAA 2L7ZA 3BP8A 3HRUA 2XB0X 2V6CA 4A3CJ 4E4HA 4IX7A 4ZZLA 2N8GA 1BOAA 1QO0D 2P5VA 1LFUP 2EZKA 3K4NA 2IGOA 2DYRH 3WTXC 1K78B 3KCCA 4WCGA 3K69A 3ZQLA 3V7RA 4F52A 2E7WA 4B8XA 2QBYB 1NG6A 1W0UA 3C2GA 1PP7U 2WY7Q 2F6CA 3CJNA 3KZIC 2NXNB 4OAYA 4XNFA 4BU2A 3QRFF 1AU7A 3IP4B 3RZDJ 3I53A 4NBQA 1U2WA 2WC2A 5E1WA 2K5CA 4N9HA 2FNPA 3J7AO 4EJWA 2JMWA 3K4BA 3HG9A 2EZHA 2NVUB 1MMSA 2RREA 3ZOBA 3DKXA 5L3DA 3N97A 3WTVC 2BE5F 3HB9A 2ZXHA 4M3FA 1FSEA 2ZSIB 5HS9A 5LRRA 1MH3A 5BMZA 5CLSA 3MKLA 4BDYA 5M3MJ 4V2FA 2DFFA 2H6CA 3AAFA 4CCMA 3KEQA 2RC4A 2ICWG 3ESWB 2DAOA 2EH3A 5J1YA 2PMZA 1HW2A 1U9OA 1DP3A 2CGPA 2JPCA 2QSFX 4CCKA 4FE7A 2QUFA 2HGCA 3BG9A 2OTLI 1ON2A 1LDDA 1MMAA 3E6CC 1NK2P 2EPFA 1H88C 1ZARA 2XAJA 1KQ8A 4JX5A 1ETWA 2VE9A 2LY9A 3DEWA 1I5ZA 1BM9A 3K1NA 1RKTA 3BOQA 2Y9YA 3IUOA 1G2HA 1A6IA 3ZMUA 2FBKA 4E7LA 3CC4I 4NQWA 3S2DJ 4BQNA 2ELJA 5GAGJ 1F36A 2JUGA 1YRNB 1HA8A 3MKYB 4YG2F 2XSDC 1V55H 1NG7A 1KU2A 4GDFA 5ED4A 1V3FA 1U0JA 5E8GA 1R23A 1ZKGA 4LK1F 1D0XA 2OF7A 2L02A 2O8KA 3CCVI 4LLGF 3SXYA 1CF7B 3GVAA 2UXNA 1UB9A 2YX7A 4XOPA 5FKMA 3JRAA 1LDKB 2Z99A 2W85A 4XLCA 4UVBA 1UHMA 2DFEA 2IEKA 3OYBA 3RQIA 3EPZA 4GGGA 3HPHA 4P1WA 2NAZA 3I59A 4A0ZA 1MIJA 2WADA 2W57A 4ABZA 3E5UA 3JTHA 5DD4A 1T0FA 1BIBA 1B4AA 4ETSA 2CFXA 3OL4A 4ENMA 3CUQC 2IBDA 5D6FA 3WG7H 4DGWB 2E1NA 2MD5A 1J5YA 1K7AA 1SD7A 2YPRA 1I27A 2QQ8A 1TL8A 3CF2A 4DBRA 3G73A 1MBGA 2QQBA 1RPWA 2DQRA 3ELKA 4S05A 2EILH 4W97A 5CVIA 4M3DA 2M7AA 1PUEE 4KISA 3KPHA 4UV8A 4XONA 3QODA 2L54A 3LSRA 4D7NA 2DDBA 3LFUA 4CUGA 2HZDA 2GZWA 6PAXA 1ENHA 2LY1A 2K9MA 2ISYA 1PVEA 1D1AA 1U8RA 1LB2A 1FOYA 1LE8A 3UKGA 1WJ5A 1HC8A 1IN7A 5FKOA 1ZQ3P 4BE2A 4RB1A 1NK3P 2HPIA 3OR1C 4F93B 1TLHB 4HRIA 2X9DA 3L00A 3SYTA 4CSWA 4NHJA 1BI3A 1F43A 1VQKI 1P7JA 2P7VB 5DCFA 2GOXB 5L3CA 4M3GA 1YX5A 3KZYA 2X6OA 3OYIA 2HQ5A 4UB6C 3D5LA 3R0JA 2AO9A 3H1CA 1QPIA 3H0GJ 2X6WA 3WTSC 3QU6A 2W84A 5HDNA 3SZGA 4HSTA 3MFKA 3CQZJ 3CMEI 2OUMA 1FMWA 4BHCA 3SEQA 2OD5A 4UV9A 3OYJA 4FT8A 5FKLA 2H6BA 3E5QA 1X1AA 2DCEA 5CYVA 3JREA 4BKXA 1MMDA 3A01B 1Z1DA 2YS9A 1CQTA 4BNCA 2M8EA 3U1KA 3W6KB 1LKXA 3MVPA 2L7MP 2K86A 4PSXA 5E20A 2DJNA 2L3DA 3I54A 3U2RA 2DOFA 2DT5A 5IP9J 2DA6A 3QP5A 1HKQA 2HTJA 4DJAA 2R7DA 2JSCA 4E7SA 3S17J 3AG1H 2JQ7A 5ICCA 2R7XA 2X4HA 2V6EA 1YFHA 3L2VA 4U7DA 4G6QA 5IT9K 3IH4A 4LD5A 4IJAA 2DMPA 3W2VA 1S9HA 1D8JA 3GO5A 3WODF 5M5WJ 1BR1A 3CJTB 4N0BA 3SFZA 4ZDPA 2D45A 1ETXA 4CYCB 5DUIA 1GT0C 4RB0A 3F8NA 2KHMA 1FOKA 4I76A 2PBIA 2VUMJ 2MD0A 2PMHA 1SVOA 4PDKA 3GTJJ 2R5YA 4A0YA 3KEYA 3PO2J 3JAMK 4IL6C 4F7ZA 1B9NA 1X4OA 4AIDA 3QYFA 2M45A 1P2FA 2FOKA 3E5XA 4HNVA 3F6VA 3HOWJ 2W00A 2QBYA 3GYHX 1QRYA 4P9UA 4CDGA 3S1QJ 4RLFA 3RZOJ 1JKPC 2EV0A 2V79A
chains in the Genus database with same CATH topology
2NS8A 4A3GJ 4GFBA 1Z77A 1DU6A 3JR9A 5E3MA 5K7FA 2D5VA 3HOYJ 1MBEA 1TC3C 5DTDA 4JP0A 1XS9A 1X58A 3W6VA 2ME6A 2HXIA 2XRLA 2TCTA 3FIWA 4DZJA 5GPCA 1RESA 3FKIJ 3GTQJ 1Y1VJ 1ZR4A 1IGNA 4UUSB 2HDDA 1JTYA 1HLVA 2DN0A 2CRGA 1XG1A 2JA7J 3ZQCA 4Y52J 1POGA 5C44J 1VF9A 4UUTA 5FLVA 4L5EA 2E2HJ 4A93J 1MNMC 3S15J 2R93J 1JUSA 4NDLA 3HEFA 1FTTA 1AKHA 3FISA 2ID3A 3K7AJ 3SDGA 2K9NA 2XPUA 3QQAA 2Y30A 4FTHA 1B72A 4QTRA 2DMUA 5EG0B 1ETOA 2LFBA 3OIOA 3JRIA 5GP9A 3E7LA 4G12A 3G1OA 1S7EA 3F0CA 3I4NJ 3BQZA 2R7ZJ 4XRMA 1D5YA 5FJ8J 2OPTA 4XICA 1ETYA 4M3BA 4QSHA 1HDDC 5FKNA 1QVTA 3A03A 3HGGA 3JRGA 3HM5A 1OJLA 1PUFA 3HOZJ 3B6AA 1YRNA 3ZQIA 2Y9ZA 1GUUA 1BW5A 3H3VK 4M6VA 3M3YJ 4DYCA 3JRHA 3Q0WA 1FTZA 3ZQFA 2COBA 1FIAA 1ETVA 2R5YB 2NS7A 3GTMJ 5F04A 2XB5A 5EEAA 3BTCA 1JT0A 2VKVA 4MO7A 2M9HA 1I6HJ 3MN2A 1ZGWA 2MW8A 5EGOB 3GTLJ 3HGYA 1GVDA 1JGGA 1K61A 4MLOA 1ETKA 1Q1VA 1H89C 4C3JJ 5C4XJ 1WCMJ 2ECBA 2VPRA 2KT0A 1JKQC 2M8GX 3JRDA 2JA5J 4BXXJ 1TWGJ 2DTZA 4EEFG 5JLWA 3QPSA 1BL0A 1B8IA 1VNDA 1NTCA 3LSJA 2EBIA 3S1NJ 1IDZA 5F0CA 4D7MA 1RKWA 3CMYA 4A3LJ 1AHDP 5BNGA 1SANA 3WHBA 4A69C 3BR6A 4Y7NJ 3JRFA 1OCTC 1XC5A 4A3IJ 4FE4A 2L7FP 1MBFA 1T56A 4FISA 2LVSA 1I50J 2MG4A 2HYJA 1MSFC 1TWAJ 2R5ZA 4C3IJ 1FEXA 2HOSA 5K7ZA 3HOXJ 1ZK8A 3SJMA 2M2EA 2HXOA 1FIPA 1IJWC 4C3HJ 1HCRA 1RETA 1O4XA 1PUFB 2AHQA 1JJ6C 1U9NA 2JWTA 1UMQA 2JJ7A 1JKOC 1BW6A 2DMNA 2KDZA 2E1OA 4D5CA 5M3FJ 1WGXA 5F0HA 2R0QC 5M5YJ 5F0FA 1VFCA 3DCFA 4JX6A 4DZPA 2PMZN 4J19A 5F1JA 5C4JJ 3A01A 4DYRA 2FX0A 4JYKA 2H8RA 2G0EA 1APLC 3S1RJ 2NOGA 3OSGA 1DU0A 1HDPA 4QIWN 1BJZA 1GV2A 1OFCX 2DA4A 2O7OA 2E19A 1Y1WJ 2GM4A 1VI0A 3BR0A 3BTIA 3PM1A 3G1MA 2O9LA 2VI6A 3S1MJ 4S0HB 9ANTA 5EYRA 1Z0XA 1MH4A 2EZLA 4B1RA 1IRZA 1WH7A 2JN6A 1IDYA 2K40A 1TWFJ 4AYBN 3GTPJ 1WI3A 2DMQA 2FQ4A 4LOCA 2CU7A 4A3BJ 5JLXA 4CYCA 2EZIA 3C2BA 4BBRJ 2XGCA 2LP0A 3FK7A 5EDNA 2L7ZA 3B6CA 1IG7A 2XB0X 2VKEA 5HODA 4A3CJ 3BTJA 3HDDA 2K9SA 1TWHJ 2N8GA 1LFUP 3FK6A 2EZKA 2LLKA 4BBSJ 5IYBJ 5IYCJ 2XPVA 2Y2ZA 4MFDA 3CDLA 4D5FA 3TEDA 5EF6A 3ZQLA 1T33A 3TW7A 1W0UA 4X6AJ 3O8HA 1JJ8C 2M0CA 5DS9A 1LFBA 1ITYA 1U78A 3BG5A 4JX4A 4XRSA 1X2MA 1AU7A 5IP7J 3BQYA 2GLOA 3RZDJ 5K7HA 1JUPA 4A3DJ 1H8AC 1X2NA 3L1PA 4UUSA 4C2MJ 1UG2A 1UHSA 2FJ1A 3BTLA 2JMWA 4XIDA 3HOUJ 3BR5A 3D1NI 2EZHA 2LD5A 3BG3A 1WPKA 3ZOBA 4A3JJ 1IC8A 4M3FA 2DA3A 3HB9A 5M5XJ 1MH3A 3MKLA 5M3MJ 4V2FA 4IHVA 5GPAA 3IH3A 3LNQA 2ELKA 2EH3A 1AKHB 5J1YA 2X48A 1U9OA 2JA8J 1K83J 4FE7A 2WB1N 2E2JJ 1OCPA 1B72B 3BG9A 5IYDJ 1NK2P 2H1KA 2QCOA 1WH5A 1H88C 3GTKJ 3O8GA 2FD5A 3TW6A 4JX5A 5F08A 1ETWA 1U8BA 2LY9A 3DEWA 3HOVJ 4B3AA 4IEJA 3BT9A 1RKTA 2DA7A 2Y9YA 3CCYA 2NVXJ 1G2HA 5FLMJ 1A6IA 2R92J 2XPWA 3S2DJ 3VPRA 3G1LA 2DA2A 2DA5A 2B63J 2ME0A 5IOZA 4BY1J 4A3MJ 2E2IJ 1F36A 3JRBA 1YRNB 2XSDC 3LOCA 4A3FJ 4MFEA 2CQQA 3GBGA 2RAEA 1ZKGA 3I4MJ 2OF7A 2O8KA 2XGEA 5EGOA 4I6ZA 5J1UA 5FKMA 2QF7A 3JRAA 2TRTA 3JRCA 2Y0SN 4X1EA 2ECCA 2IEKA 3RQIA 5IP6A 1R9TJ 2L9RA 3NARA 1TWCJ 4ABZA 3HBLA 5J1RA 3S14J 1ZR2A 1MBHA 1ZTRA 3GTOJ 5E3OA 1HF0A 2IBDA 1A5JA 4IHYA 2YU9J 1RR7A 2L0KA 4RDUA 3GTGJ 1B8IB 1MBGA 4IHXA 1JT6A 1RPWA 4W97A 4A3EJ 4RBOA 2HI3A 4M3DA 4AUXA 2CJJA 2M34A 3TP3A 3LSRA 2WAQN 4D7NA 4FCYA 2LKXA 1ENHA 1E3OC 4IHWA 3ZQGA 1EF4A 5EZHA 1LE8A 1HOMA 3UKGA 5FKOA 2I10A 1ZQ3P 1NK3P 2LK2A 2EQRA 4DW6A 4A3KJ 4V2GA 2NVQJ 1IUFA 2X9DA 5FKKA 1BA5A 2R5ZB 2JK3A 2LR8A 1F43A 2W48A 1P7JA 2XGDA 3WHCA 1JKRC 3LSGA 4M3GA 2X6OA 2HQ5A 3A02A 3NAUA 3SFIA 2AO9A 4MIMA 1I3QJ 2NVYJ 5IPAA 3QPLA 1QPIA 3H0GJ 2CUEA 3Q0UA 3Q0VA 2P81A 2CUFA 2HOTA 2ID6A 1ETQA 3CQZJ 1JTXA 3LSPA 5EZGA 3HKZN 4W1UA 1MSEC 3BR1A 5FKLA 1MBJA 5C3EJ 2GBYA 3JREA 2JA6J 4BKXA 5F27A 3A01B 3OOUA 2HOAA 1P7IA 2YS9A 1CQTA 3S16J 4B4CA 3MVPA 2L7MP 1W0TA 4BY7J 3RKQA 2DJNA 4M3EA 5EG0A 3BR2A 5IP9J 2DA6A 2Y31A 1ORKA 2YUSA 3PO3J 5E3LA 3S2HJ 1SFOJ 3S17J 3ZQHA 2IAIA 3IH2A 2DA1A 3M4OJ 3TP0A 3BR3A 4DYQA 5E3NA 3IH4A 2DMPA 5M5WJ 1GV5A 4XRSG 4XK4A 2MGQA 1ETXA 4CYCB 1FJLA 1GT0C 4AC0A 4I76A 2MSYA 2VUMJ 2NVTJ 2K9QA 1JUMA 3GTJJ 5IOYA 2R5YA 3PO2J 2DMTA 1LE8B 3Q3SA 2ZB9A 5J3LA 3K2AA 3IV5A 1MBKA 4HNVA 3HOWJ 2LTPA 3S1QJ 1QVUA 3RZOJ 1QRYA 3OSFA 2CQXA 1JKPC 1IV6A 1GDTA 2WV1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2NS8 A;  4A3G J;  4GFB A;  1Z77 A;  1DU6 A;  3JR9 A;  5E3M A;  5K7F A;  2D5V A;  3HOY J;  1MBE A;  1TC3 C;  5DTD A;  4JP0 A;  1XS9 A;  1X58 A;  3W6V A;  2ME6 A;  2HXI A;  2XRL A;  2TCT A;  3FIW A;  4DZJ A;  5GPC A;  1RES A;  3FKI J;  3GTQ J;  1Y1V J;  1ZR4 A;  1IGN A;  4UUS B;  2HDD A;  1JTY A;  1HLV A;  2DN0 A;  2CRG A;  1XG1 A;  2JA7 J;  3ZQC A;  4Y52 J;  1POG A;  5C44 J;  1VF9 A;  4UUT A;  5FLV A;  4L5E A;  2E2H J;  4A93 J;  1MNM C;  3S15 J;  2R93 J;  1JUS A;  4NDL A;  3HEF A;  1FTT A;  1AKH A;  3FIS A;  2ID3 A;  3K7A J;  3SDG A;  2K9N A;  2XPU A;  3QQA A;  2Y30 A;  4FTH A;  1B72 A;  4QTR A;  2DMU A;  5EG0 B;  1ETO A;  2LFB A;  3OIO A;  3JRI A;  5GP9 A;  3E7L A;  4G12 A;  3G1O A;  1S7E A;  3F0C A;  3I4N J;  3BQZ A;  2R7Z J;  4XRM A;  1D5Y A;  5FJ8 J;  2OPT A;  4XIC A;  1ETY A;  4M3B A;  4QSH A;  1HDD C;  5FKN A;  1QVT A;  3A03 A;  3HGG A;  3JRG A;  3HM5 A;  1OJL A;  1PUF A;  3HOZ J;  3B6A A;  1YRN A;  3ZQI A;  2Y9Z A;  1GUU A;  1BW5 A;  3H3V K;  4M6V A;  3M3Y J;  4DYC A;  3JRH A;  3Q0W A;  1FTZ A;  3ZQF A;  2COB A;  1FIA A;  1ETV A;  2R5Y B;  2NS7 A;  3GTM J;  5F04 A;  2XB5 A;  5EEA A;  3BTC A;  1JT0 A;  2VKV A;  4MO7 A;  2M9H A;  1I6H J;  3MN2 A;  1ZGW A;  2MW8 A;  5EGO B;  3GTL J;  3HGY A;  1GVD A;  1JGG A;  1K61 A;  4MLO A;  1ETK A;  1Q1V A;  1H89 C;  4C3J J;  5C4X J;  1WCM J;  2ECB A;  2VPR A;  2KT0 A;  1JKQ C;  2M8G X;  3JRD A;  2JA5 J;  4BXX J;  1TWG J;  2DTZ A;  4EEF G;  5JLW A;  3QPS A;  1BL0 A;  1B8I A;  1VND A;  1NTC A;  3LSJ A;  2EBI A;  3S1N J;  1IDZ A;  5F0C A;  4D7M A;  1RKW A;  3CMY A;  4A3L J;  1AHD P;  5BNG A;  1SAN A;  3WHB A;  4A69 C;  3BR6 A;  4Y7N J;  3JRF A;  1OCT C;  1XC5 A;  4A3I J;  4FE4 A;  2L7F P;  1MBF A;  1T56 A;  4FIS A;  2LVS A;  1I50 J;  2MG4 A;  2HYJ A;  1MSF C;  1TWA J;  2R5Z A;  4C3I J;  1FEX A;  2HOS A;  5K7Z A;  3HOX J;  1ZK8 A;  3SJM A;  2M2E A;  2HXO A;  1FIP A;  1IJW C;  4C3H J;  1HCR A;  1RET A;  1O4X A;  1PUF B;  2AHQ A;  1JJ6 C;  1U9N A;  2JWT A;  1UMQ A;  2JJ7 A;  1JKO C;  1BW6 A;  2DMN A;  2KDZ A;  2E1O A;  4D5C A;  5M3F J;  1WGX A;  5F0H A;  2R0Q C;  5M5Y J;  5F0F A;  1VFC A;  3DCF A;  4JX6 A;  4DZP A;  2PMZ N;  4J19 A;  5F1J A;  5C4J J;  3A01 A;  4DYR A;  2FX0 A;  4JYK A;  2H8R A;  2G0E A;  1APL C;  3S1R J;  2NOG A;  3OSG A;  1DU0 A;  1HDP A;  4QIW N;  1BJZ A;  1GV2 A;  1OFC X;  2DA4 A;  2O7O A;  2E19 A;  1Y1W J;  2GM4 A;  1VI0 A;  3BR0 A;  3BTI A;  3PM1 A;  3G1M A;  2O9L A;  2VI6 A;  3S1M J;  4S0H B;  9ANT A;  5EYR A;  1Z0X A;  1MH4 A;  2EZL A;  4B1R A;  1IRZ A;  1WH7 A;  2JN6 A;  1IDY A;  2K40 A;  1TWF J;  4AYB N;  3GTP J;  1WI3 A;  2DMQ A;  2FQ4 A;  4LOC A;  2CU7 A;  4A3B J;  5JLX A;  4CYC A;  2EZI A;  3C2B A;  4BBR J;  2XGC A;  2LP0 A;  3FK7 A;  5EDN A;  2L7Z A;  3B6C A;  1IG7 A;  2XB0 X;  2VKE A;  5HOD A;  4A3C J;  3BTJ A;  3HDD A;  2K9S A;  1TWH J;  2N8G A;  1LFU P;  3FK6 A;  2EZK A;  2LLK A;  4BBS J;  5IYB J;  5IYC J;  2XPV A;  2Y2Z A;  4MFD A;  3CDL A;  4D5F A;  3TED A;  5EF6 A;  3ZQL A;  1T33 A;  3TW7 A;  1W0U A;  4X6A J;  3O8H A;  1JJ8 C;  2M0C A;  5DS9 A;  1LFB A;  1ITY A;  1U78 A;  3BG5 A;  4JX4 A;  4XRS A;  1X2M A;  1AU7 A;  5IP7 J;  3BQY A;  2GLO A;  3RZD J;  5K7H A;  1JUP A;  4A3D J;  1H8A C;  1X2N A;  3L1P A;  4UUS A;  4C2M J;  1UG2 A;  1UHS A;  2FJ1 A;  3BTL A;  2JMW A;  4XID A;  3HOU J;  3BR5 A;  3D1N I;  2EZH A;  2LD5 A;  3BG3 A;  1WPK A;  3ZOB A;  4A3J J;  1IC8 A;  4M3F A;  2DA3 A;  3HB9 A;  5M5X J;  1MH3 A;  3MKL A;  5M3M J;  4V2F A;  4IHV A;  5GPA A;  3IH3 A;  3LNQ A;  2ELK A;  2EH3 A;  1AKH B;  5J1Y A;  2X48 A;  1U9O A;  2JA8 J;  1K83 J;  4FE7 A;  2WB1 N;  2E2J J;  1OCP A;  1B72 B;  3BG9 A;  5IYD J;  1NK2 P;  2H1K A;  2QCO A;  1WH5 A;  1H88 C;  3GTK J;  3O8G A;  2FD5 A;  3TW6 A;  4JX5 A;  5F08 A;  1ETW A;  1U8B A;  2LY9 A;  3DEW A;  3HOV J;  4B3A A;  4IEJ A;  3BT9 A;  1RKT A;  2DA7 A;  2Y9Y A;  3CCY A;  2NVX J;  1G2H A;  5FLM J;  1A6I A;  2R92 J;  2XPW A;  3S2D J;  3VPR A;  3G1L A;  2DA2 A;  2DA5 A;  2B63 J;  2ME0 A;  5IOZ A;  4BY1 J;  4A3M J;  2E2I J;  1F36 A;  3JRB A;  1YRN B;  2XSD C;  3LOC A;  4A3F J;  4MFE A;  2CQQ A;  3GBG A;  2RAE A;  1ZKG A;  3I4M J;  2OF7 A;  2O8K A;  2XGE A;  5EGO A;  4I6Z A;  5J1U A;  5FKM A;  2QF7 A;  3JRA A;  2TRT A;  3JRC A;  2Y0S N;  4X1E A;  2ECC A;  2IEK A;  3RQI A;  5IP6 A;  1R9T J;  2L9R A;  3NAR A;  1TWC J;  4ABZ A;  3HBL A;  5J1R A;  3S14 J;  1ZR2 A;  1MBH A;  1ZTR A;  3GTO J;  5E3O A;  1HF0 A;  2IBD A;  1A5J A;  4IHY A;  2YU9 J;  1RR7 A;  2L0K A;  4RDU A;  3GTG J;  1B8I B;  1MBG A;  4IHX A;  1JT6 A;  1RPW A;  4W97 A;  4A3E J;  4RBO A;  2HI3 A;  4M3D A;  4AUX A;  2CJJ A;  2M34 A;  3TP3 A;  3LSR A;  2WAQ N;  4D7N A;  4FCY A;  2LKX A;  1ENH A;  1E3O C;  4IHW A;  3ZQG A;  1EF4 A;  5EZH A;  1LE8 A;  1HOM A;  3UKG A;  5FKO A;  2I10 A;  1ZQ3 P;  1NK3 P;  2LK2 A;  2EQR A;  4DW6 A;  4A3K J;  4V2G A;  2NVQ J;  1IUF A;  2X9D A;  5FKK A;  1BA5 A;  2R5Z B;  2JK3 A;  2LR8 A;  1F43 A;  2W48 A;  1P7J A;  2XGD A;  3WHC A;  1JKR C;  3LSG A;  4M3G A;  2X6O A;  2HQ5 A;  3A02 A;  3NAU A;  3SFI A;  2AO9 A;  4MIM A;  1I3Q J;  2NVY J;  5IPA A;  3QPL A;  1QPI A;  3H0G J;  2CUE A;  3Q0U A;  3Q0V A;  2P81 A;  2CUF A;  2HOT A;  2ID6 A;  1ETQ A;  3CQZ J;  1JTX A;  3LSP A;  5EZG A;  3HKZ N;  4W1U A;  1MSE C;  3BR1 A;  5FKL A;  1MBJ A;  5C3E J;  2GBY A;  3JRE A;  2JA6 J;  4BKX A;  5F27 A;  3A01 B;  3OOU A;  2HOA A;  1P7I A;  2YS9 A;  1CQT A;  3S16 J;  4B4C A;  3MVP A;  2L7M P;  1W0T A;  4BY7 J;  3RKQ A;  2DJN A;  4M3E A;  5EG0 A;  3BR2 A;  5IP9 J;  2DA6 A;  2Y31 A;  1ORK A;  2YUS A;  3PO3 J;  5E3L A;  3S2H J;  1SFO J;  3S17 J;  3ZQH A;  2IAI A;  3IH2 A;  2DA1 A;  3M4O J;  3TP0 A;  3BR3 A;  4DYQ A;  5E3N A;  3IH4 A;  2DMP A;  5M5W J;  1GV5 A;  4XRS G;  4XK4 A;  2MGQ A;  1ETX A;  4CYC B;  1FJL A;  1GT0 C;  4AC0 A;  4I76 A;  2MSY A;  2VUM J;  2NVT J;  2K9Q A;  1JUM A;  3GTJ J;  5IOY A;  2R5Y A;  3PO2 J;  2DMT A;  1LE8 B;  3Q3S A;  2ZB9 A;  5J3L A;  3K2A A;  3IV5 A;  1MBK A;  4HNV A;  3HOW J;  2LTP A;  3S1Q J;  1QVU A;  3RZO J;  1QRY A;  3OSF A;  2CQX A;  1JKP C;  1IV6 A;  1GDT A;  2WV1 A; 
#chains in the Genus database with same CATH topology
 2NS8 A;  2EA4 A;  3DWL E;  3IAM 2;  1G3T A;  3PNV A;  4GFB A;  4BJT A;  4BHP A;  4HX4 A;  1B59 A;  5DTD A;  3WTW C;  1BC8 C;  2EFQ A;  4O5V A;  4C2U A;  3J7A Y;  1X58 A;  1IUY A;  5J4V A;  3DBR B;  3CLO A;  3A1Y A;  4HZF A;  5HLH A;  4N4N B;  3PSF A;  3T1B A;  1Y1V J;  2HDD A;  4UUS B;  2CRG A;  1XG1 A;  4WXD A;  1LDJ A;  1IN5 A;  1EJ9 A;  5CJ9 A;  3HJE A;  1R58 A;  3FXQ A;  3ASN H;  4PJL A;  5J4Y A;  3BPX A;  3Q9V A;  3HTS B;  5LRS A;  1FYK A;  4M74 A;  5JHF A;  1FOW A;  1VQ8 I;  5EG0 B;  3OY9 A;  4XLE A;  4RB2 C;  3OIO A;  4KIF A;  3E7L A;  4KFC A;  2OAZ A;  1WJB A;  4MNU A;  1R36 A;  1Y0N A;  1V4R A;  4PJN A;  1D5Y A;  3HRS A;  3VFZ A;  3IRQ A;  4PFO A;  1D0Z A;  5FKN A;  2KJB A;  3RKX A;  4G7Z F;  2JA2 A;  2VQH A;  1OJL A;  5LHH A;  2ZNY A;  3HOZ J;  1B1B A;  1YRN A;  4Y3O A;  1GUU A;  1S72 I;  3H3V K;  4DYC A;  4ZYH A;  4OIN F;  4LB6 B;  2LKP A;  1GXQ A;  2NS7 A;  4CIC A;  3MZH A;  5F04 A;  5L3G A;  5ILV A;  1WSU A;  1IRX A;  2DPU A;  1LNW A;  1IXS B;  2VKV A;  3LQQ A;  4MO7 A;  5LFA A;  2KIQ A;  3LA7 A;  5H20 A;  3CP8 A;  4DNC A;  1D5V A;  3MN2 A;  4KIG A;  2MW8 A;  4IPA A;  1YLF A;  2QA4 I;  3GTL J;  2M3A A;  3LA3 A;  3HGY A;  4H0E A;  1K61 A;  4MLO A;  1H89 C;  1W7P B;  5H6Q A;  3H5R A;  5C4X J;  3GFJ A;  3CUO A;  2LSO A;  3I55 I;  1VQN I;  3E6B A;  2E1C A;  2F2E A;  4I0A A;  2ECB A;  4A6D A;  2F4O B;  4AVP A;  4BYY A;  3PUB A;  1ZLJ A;  2DTZ A;  2KRC A;  1ZRE A;  5JLW A;  3QPS A;  1U5T C;  2CFO A;  2E36 A;  1G3W A;  3L2Q A;  2LF7 A;  2K7L A;  3LSJ A;  2LDU A;  1WQ2 A;  2BVM A;  1N25 A;  5F0C A;  1UAA A;  1IN8 A;  1QU3 A;  4G94 A;  2GIV A;  4KYW A;  1IN6 A;  1OYI A;  1ZEL A;  3WHB A;  2ZSH B;  4RS8 A;  2CH0 A;  3OYD A;  3J80 K;  1MNE A;  3LAJ A;  4Y7N J;  2EV6 A;  2CG4 A;  3IWF A;  4QPQ A;  3FMQ A;  4GYG A;  2L7F P;  1MBF A;  1YS7 A;  2L7K A;  2BBY A;  3MZ8 A;  3E6D A;  4NC7 A;  4NNJ A;  3RTR A;  1J09 A;  4ZDL A;  4I99 C;  1MSF C;  1SVM A;  3Q5F A;  5HLI A;  1TP4 A;  2IS4 A;  1TZL A;  2P7C B;  5K7Z A;  1DP7 P;  1XDS A;  2W82 A;  2R7F A;  4GRI A;  3PFI A;  3SJM A;  1H0M A;  1AOY A;  5EJC A;  4KIT B;  1IJW C;  3P7N A;  1MJB A;  2OA4 A;  1XCB A;  2STW A;  3J7Y J;  2AHQ A;  2KFD A;  1IN4 A;  1U9N A;  2JWT A;  1KGS A;  2EV5 A;  1UMQ A;  1ZRC A;  1BW6 A;  2DMN A;  3GFL A;  4KNY A;  1XSD A;  2W4S A;  4MTD A;  5FLX K;  5J8F A;  2CW0 F;  2MYS A;  3G6E I;  4ZJZ A;  5HNF A;  1VFC A;  1MJ9 A;  4JX6 A;  3H9G A;  1RRJ A;  4KIB A;  5H2F C;  2HQN A;  3A01 A;  3BJ6 A;  4Q47 A;  3ZRG A;  1O3T A;  3C18 A;  3W2W A;  3P9K A;  4D0P A;  4ITV A;  1DQU A;  2NOG A;  3OSG A;  1JGS A;  1HDP A;  4QIW N;  1DU0 A;  3PNY A;  5HS7 A;  1OFC X;  2VJI A;  3R0A A;  2DA4 A;  2O7O A;  1VI0 A;  3UNG C;  3KP5 A;  2H94 A;  2DXI A;  4LIV A;  4V19 K;  2H27 A;  2DT6 A;  2VI6 A;  3S1M J;  2FE3 A;  1Z0X A;  1MH4 A;  3RKW A;  3HIF A;  4KA4 A;  2DU9 A;  1WJA A;  1WH7 A;  2K40 A;  3JTG A;  3G4S I;  2BZT A;  2DMQ A;  2FQ4 A;  3MZY A;  4LOC A;  4PK4 A;  1OKR A;  4A3B J;  5JLX A;  1IZ1 A;  3K0L A;  1OCR H;  4CYC A;  2P4W A;  1Z7U A;  5H6R A;  3LAP A;  3FK7 A;  5EDN A;  3HOS A;  5K5Q A;  1BI0 A;  1JE8 A;  3PQK A;  4ZTJ A;  2VKE A;  5HOD A;  4O6J A;  2IS1 A;  3K9T A;  2JZY A;  3FK6 A;  2LLK A;  3I64 A;  5IYC J;  2XPV A;  3CCJ I;  2ETH A;  3TED A;  2FBI A;  3VYT B;  2WV0 A;  4LLL A;  3MEX A;  5D8K B;  2XRO A;  1SFU A;  3TO7 A;  3RQ4 A;  3TW7 A;  4X6A J;  3O8H A;  1FYL A;  4IQ4 A;  1LFB A;  3MWM A;  4LJZ F;  1XGM A;  4XRS A;  2FBH A;  2GLO A;  3CCS I;  1R1V A;  3LSK A;  5K7H A;  3KE2 A;  4A3D J;  1J75 A;  3KET A;  1X2N A;  3F21 A;  1BN5 A;  4HQE A;  1J9I A;  3NRV A;  3DPT A;  4UUS A;  1UG2 A;  3DKW A;  4PJJ A;  2QZ8 A;  3DFG A;  1IO2 A;  4XID A;  1DPU A;  2MC4 A;  3D1N I;  3S2W A;  5HNH A;  1IC8 A;  1FC3 A;  2QKM B;  4P96 A;  1R1T A;  1T6S A;  1UHW A;  1BR2 A;  3BZC A;  2ISZ A;  2HWV A;  1O3Q A;  1AWC A;  3IH3 A;  2RN7 A;  3PQJ A;  3LNQ A;  3ZMV A;  1K83 J;  2QSH X;  1SC7 A;  3CCR I;  3BZ6 A;  3CC2 I;  1M1E B;  3VEP A;  1OCP A;  4HNU A;  1B72 B;  1WWX A;  3VWB A;  1S8N A;  1WH5 A;  3GTK J;  3O8G A;  2FD5 A;  4CCN A;  3TW6 A;  2CUZ A;  2XKO A;  1FYM A;  4HPQ A;  1HKT A;  3TBI A;  4ZZD A;  3BT9 A;  3KIO A;  4GYI A;  4F91 B;  1TQI A;  2DA7 A;  3CCY A;  4RGR A;  2NVX J;  5FLM J;  2VAS A;  1U5T B;  4XLH A;  1QNT A;  2XPW A;  3G1L A;  4G7H F;  1PJR A;  2DA2 A;  3OMY A;  3FZV A;  2KIS A;  4CA0 A;  2B63 J;  1XGO A;  2ME0 A;  5IOZ A;  3JRB A;  2I8D A;  5E79 C;  2OZ6 A;  3EQL F;  2F48 A;  2HZT A;  3LOC A;  2PFB A;  4HLX A;  4II2 A;  3GBG A;  1J7K A;  2XVC A;  3CC7 I;  3H3Z A;  2F5D A;  2J5P A;  1YJW I;  2OQR A;  3D5R C;  4I6Z A;  1V5G A;  1SD5 A;  3U9G A;  5J1U A;  1ZHF A;  2QF7 A;  2RQQ A;  4BXF A;  1QHG A;  5GAE J;  4X1E A;  3TDU C;  4LIT A;  3GW2 A;  2AQE A;  3SQN A;  5IP6 A;  2Q8K A;  5F1R A;  3NAR A;  3HUG B;  5CQE A;  1IF1 A;  1TWC J;  1ZH5 A;  5ICF A;  3S14 J;  1E3H A;  1YG2 A;  2QEX I;  1MGT A;  3QOP A;  5E3O A;  4OIO F;  2E60 A;  1HF0 A;  3P9C A;  1R5G A;  1JHH A;  3A2K A;  2K4J A;  4RDU A;  1WHU A;  4OIQ F;  1NHA A;  2VXZ A;  3M7G A;  2EFN A;  3A4C A;  4A12 A;  3LQR A;  1MZB A;  3BWG A;  3S8P A;  4RBO A;  4AUX A;  3K4K A;  3RCO A;  5L3F A;  4E7I A;  5FO5 A;  2RQP A;  2M1B A;  1W4M A;  5TJJ A;  4FCY A;  3ASO H;  1A31 A;  3K4L A;  3E3V A;  3ZQG A;  5E17 F;  5EZH A;  1EF4 A;  2L4M A;  2XHK A;  4KN7 X;  2F5V A;  1R6R A;  2OCE A;  2PMU A;  1YW9 A;  2DOD A;  2IGK A;  2LRE A;  2LK2 A;  2MH9 A;  2MC3 A;  5A2Q Z;  3R60 A;  4GO1 A;  4A3K J;  1J2X A;  4K2E A;  2NVQ J;  4ON0 A;  1ODD A;  2O3F A;  1BA5 A;  2JK3 A;  2LR8 A;  2IJL A;  2AQF A;  2W48 A;  2VBY A;  3WHC A;  4LG0 B;  2QGU A;  4KMU X;  3LSG A;  2RVC A;  2NYX A;  4A0X A;  3A02 A;  3HPG A;  2E35 A;  4MIM A;  1WJD A;  4RLQ A;  3TO6 A;  4XOT A;  5K1Y A;  1MDM A;  2K9L A;  3Q0U A;  4I2O A;  4H4K C;  2XAH A;  2VT3 A;  4ZH4 F;  2VLA A;  1QZY A;  2CV2 A;  4AIH A;  4XN3 A;  2P81 A;  2HOT A;  2PI0 A;  4R1H A;  3LSP A;  4W1U A;  3WTZ A;  1A6Q A;  3VSL A;  1MSE C;  3IKT A;  1QBJ A;  1MBJ A;  3DPL C;  2GBY A;  4PJM A;  2BHY A;  3OOU A;  1P7I A;  3S16 J;  2O8X A;  3GZ6 A;  2RNG A;  2M7B A;  3RKQ A;  3GUD A;  2DFI A;  2PEX A;  1YIT I;  3EUH C;  1HKS A;  4BHB A;  5B5E C;  3BR2 A;  3ABK H;  4RGS A;  3BRO A;  5K5R A;  1STZ A;  3PO3 J;  3HC7 A;  2IGN A;  2L2O A;  2JUC A;  2IT0 A;  3LL7 A;  2H1L A;  3QU3 A;  2IAI A;  3IH2 A;  1R5H A;  4YII A;  5HDK A;  4DIQ A;  2VN2 A;  4DYQ A;  2CW7 A;  1CGP A;  3DTE A;  3ZGK A;  4U87 A;  1LQ1 A;  5DDG A;  1J59 A;  4XRS G;  4Y13 A;  2W24 A;  3TL4 X;  4XBF A;  1FJL A;  1Q1H A;  3K70 D;  2VON A;  1IW7 F;  3TQN A;  2K3F A;  2F4M B;  1X3W B;  2RNJ A;  1JUM A;  1S7A A;  2W25 A;  2ZFU A;  3O2P E;  4EJU A;  2IP2 A;  5IOY A;  4PFP A;  2ZB9 A;  2I5U A;  2ZFW A;  1Z6R A;  3K4M A;  2LOO A;  3GME A;  3DEE A;  4ESB A;  4EM1 A;  3P5J A;  3REO A;  2Q0O A;  2WV1 A;  2V1D A;  2EJR A;  3A0B C;  4A3G J;  2X51 A;  4E7H A;  1E17 A;  2CV0 A;  1DU6 A;  2KZG A;  2YU3 A;  5CVU A;  4XMY A;  5K7F A;  2HQR A;  2ZXJ A;  1TT0 A;  4JP0 A;  1Z3Y A;  3SEZ A;  4RA2 A;  1DPR A;  5LGT A;  3W6V A;  4F3Q A;  3H9J A;  1MMG A;  4L5J A;  4J01 A;  4RB3 C;  3ZXS A;  1KU7 A;  3FKI J;  4U7B A;  2GA1 A;  2MFZ A;  1HLV A;  2BY1 A;  2JA7 J;  1LUJ B;  4Y52 J;  1OR7 C;  2CO5 A;  3FX3 A;  4Q4Z F;  3CCU I;  5FLV A;  2R7O A;  2DI3 A;  2E2H J;  1U6G A;  3PL8 A;  3MCZ A;  3S15 J;  3I3L A;  4A5M A;  2R93 J;  4CH7 A;  3JW4 A;  4G6D A;  4NDL A;  3HEF A;  3GLL A;  3FIS A;  2ID3 A;  1QGP A;  4UVC A;  1YO5 C;  3H35 A;  2XPU A;  3FXJ A;  3OS0 A;  2PJP A;  1E0E A;  5IY5 H;  1B72 A;  2QSG X;  2DMU A;  1T8I A;  1IAW A;  1QHH D;  5JI6 A;  5GP9 A;  1DUX C;  3G1O A;  3CDI A;  2R7Z J;  2KKO A;  5B3S H;  5D5W B;  2OPT A;  5JFR A;  3V8K A;  4XIC A;  1ETY A;  2OZU A;  3F8C A;  1V5F A;  3G3Z A;  4M3B A;  3RKY A;  4CCO A;  4B48 A;  3HGG A;  2P6S A;  1ZG1 A;  2EIJ H;  1FWZ A;  2LRD A;  1KQ9 A;  5CQG A;  3IWZ A;  2E71 A;  3HM5 A;  3PIO F;  1PUF A;  2V1U A;  1WJF A;  3I0T A;  1DDN A;  2Y9Z A;  3WTY C;  2VOO A;  4M9X A;  3M3Y J;  3KP4 A;  3JRH A;  1FZP B;  2COB A;  1FIA A;  2DPD A;  1ZRD A;  2BXZ A;  2XF7 A;  3GTM J;  2B7E A;  3G2B A;  2BXY A;  3QPT A;  4BEH B;  1S7O A;  4KT5 C;  1JT0 A;  5GTI C;  2GXB A;  4BAY A;  3FHZ A;  1BC7 C;  1T98 A;  1X1C A;  3OIP A;  4N9I A;  3K4C A;  5EGO B;  1VQM I;  1B6A A;  3ZMS A;  1LVA A;  3U21 A;  2QYO A;  4EAT A;  2WA0 A;  3ECH A;  3T8T A;  2XUB A;  3AFH A;  5L3E A;  4R8H A;  5E18 F;  4ENN A;  1UST A;  1WCM J;  2FQ3 A;  3QYE A;  1OYY A;  2D1H A;  1JKQ C;  1X3Z B;  2VPL A;  1VQ7 I;  4EEF G;  3QWL A;  1O3R A;  1ON1 A;  1ZAO A;  3FMS A;  1ONV A;  3KYL A;  5AON A;  3GFM A;  1I6X A;  4OIR F;  1GHC A;  1B9M A;  2JPB A;  1H9G A;  4G6T B;  3D0S A;  5BNG A;  4M9S A;  4A69 C;  2XIG A;  5BOX A;  1LEA A;  4LIU A;  4B47 A;  4EQQ A;  3HL2 A;  1BI1 A;  4A3I J;  1W5C C;  2RDP A;  4FE4 A;  1T56 A;  1WVR A;  1EKE A;  1ACI A;  2EIN H;  2LVS A;  3V4G A;  4F55 A;  4L9J A;  2FUG 2;  1Y0U A;  4HV6 A;  1K78 A;  2HYJ A;  3FBI B;  3M07 A;  3S3M A;  2X0L A;  1F5T A;  3HXL A;  2VC1 A;  2L4A A;  4RAY A;  1SFK A;  4LK0 F;  3U1D A;  5B1B H;  4BH9 A;  4LG0 A;  3HOX J;  3BCB A;  1BOB A;  4EV0 A;  1N77 A;  2KJC A;  4PGH A;  2M4K A;  3AG2 H;  1SAU A;  2E1M C;  1RET A;  1O4X A;  4AM3 A;  3TOA A;  2HKO A;  2EIM H;  1Z91 A;  2DLL A;  3FWE A;  5HDG A;  1G3S A;  2YX4 A;  4HF0 A;  2KDZ A;  3R4K A;  2DFH A;  3H92 A;  2V1X A;  4NUB A;  1BJA A;  2NNN A;  3DLA A;  2BVL A;  2A5W A;  3LWF A;  4BGD A;  2R0Q C;  3MAJ A;  1FY7 A;  2GQQ A;  5C4J J;  1I1G A;  3BLY A;  4GCV A;  1SFX A;  5FFZ A;  4I0B A;  2DK8 A;  2ZXI A;  2QM3 A;  2FX0 A;  3IKV A;  2OU2 A;  4C9Y A;  4JYK A;  5GAD J;  2G0E A;  2IW5 A;  3S1R J;  1GV2 A;  4Y17 A;  4HX8 A;  1XMK A;  4KN4 X;  5L3B A;  3K1M A;  1D8K A;  2E19 A;  1Y1W J;  2GM4 A;  1UJ8 A;  3F8F A;  1VQO I;  3PM1 A;  4LGW A;  2Z2S B;  1A04 A;  2O9L A;  2WBM A;  1Z21 A;  4S0H B;  9ANT A;  2BGC A;  2FML A;  5J47 A;  2O03 A;  3JSP A;  3WG9 A;  4N4O B;  2HR3 A;  2XAS A;  3WTU C;  3CUQ B;  2LY2 A;  3IRR A;  1S6L A;  4U88 A;  3ABL H;  1G3Y A;  3H5N A;  4HA8 A;  3MKW B;  2ESN A;  1HW1 A;  2WAE A;  1VZ0 A;  3B6C A;  4XQF A;  5FLX Z;  1IG7 A;  3EUK L;  2ACJ A;  2ZME C;  3BTJ A;  1TWH J;  3FXU A;  3QOE A;  2KDO A;  4RAF A;  3KP6 A;  2VT2 A;  4EM2 A;  3W6J B;  5IYB J;  3F22 A;  1P9Q C;  2OCC H;  2VQL A;  1DGR M;  2Y2Z A;  4MFD A;  2VJ4 A;  4D5F A;  5EF6 A;  1CF7 A;  4KJZ A;  2WB1 A;  1BIA A;  1Y39 A;  2PG4 A;  5D5U B;  4KMF A;  2X1E A;  1P4A A;  1T0F C;  3SHF A;  5LLQ A;  1ITY A;  4ZYE A;  1W36 D;  3ZMT A;  3BG5 A;  1FOX A;  2IS6 A;  3CDH A;  4WXH A;  5DYM A;  5CKT A;  3OS2 A;  2V7F A;  3BQY A;  3WU2 C;  5HS8 A;  4G8X A;  4QLC U;  1H8A C;  3L1P A;  4PJ0 C;  4C2M J;  3BTL A;  1Z67 A;  3HOU J;  2KRF A;  4L5I A;  3K1P A;  4FHT A;  3ZMZ A;  4A3J J;  2HYG D;  4ZYD A;  5M5X J;  3CCQ I;  4I09 A;  1JXS A;  3OS1 A;  3KFW X;  4IHV A;  4HDV A;  5GPA A;  1OLT A;  4MTE A;  2FOW A;  4CCL A;  2JA8 J;  3ZQQ A;  1OMI A;  1OYW A;  1LEB A;  2WB1 N;  3V42 A;  2ESH A;  3LSH A;  5IYD J;  2BW3 B;  2H1K A;  3RSN A;  2VJJ A;  4LLN A;  2K3P A;  4DOZ A;  3PJR A;  4P55 A;  3HOV J;  4B3A A;  4IEJ A;  2R7R A;  2HTS A;  4CZZ A;  5LHG A;  2Z3Y A;  4FX0 A;  5KHD A;  2HDC A;  3VPR A;  2A07 F;  2ADU A;  2LBF B;  2DA5 A;  4IQJ A;  4KT6 A;  4DBQ A;  1R4M B;  2WAF A;  3RIR A;  3EDP A;  3KEO A;  1XN7 A;  3GF2 A;  4HLY A;  1ZGJ A;  5KCM A;  1SAX A;  4OOI A;  1X1P A;  1G6N A;  4MFE A;  2CQQ A;  1A36 A;  5FD6 A;  1U3E M;  2XAG A;  2RAE A;  3X2Q H;  2WAQ A;  1JI8 A;  4FQG A;  2K4B A;  4CXF A;  2R7Q A;  3LSM A;  1IRG A;  2XGE A;  5EGO A;  1R1U A;  3TO9 A;  1Y6I A;  2TRT A;  4RMN A;  1N78 A;  3P9I A;  3FM5 A;  3OYM A;  2Y0S N;  2ECC A;  3J81 K;  1WJC A;  1O7F A;  1R9T J;  4U0V A;  3CD6 I;  3CLQ A;  2A6E F;  1RC9 A;  2OV7 A;  2HOE A;  3HBL A;  4AD9 A;  5J1R A;  1ZR2 A;  3FM3 A;  4L18 B;  1ZTR A;  3GTO J;  2K85 A;  4QWQ A;  1YE9 A;  2E1M B;  2L9S A;  2GOM A;  2CW8 A;  3BC8 A;  2YU9 J;  3F23 A;  4EGY A;  1RR7 A;  2L0K A;  4E7Z A;  2STT A;  4YIF A;  3KP7 A;  3QYB A;  2P0W A;  1H9T A;  1REP C;  2KRH A;  3DBH B;  3KP3 A;  4Z2Y A;  4A3E J;  4ENJ A;  1K79 A;  2HI3 A;  2PQ8 A;  3ZN0 A;  2Y69 H;  1X4P A;  3TP3 A;  2B9S A;  1N75 A;  1ZGA A;  4BQA A;  2WAQ N;  2VOP A;  2LKX A;  1BI2 A;  3F72 A;  4IHW A;  1HOM A;  3CMM A;  3EUH A;  1I39 A;  3WE3 A;  2BOL A;  3RPQ A;  4WF2 A;  2DW4 A;  2EQR A;  4DW6 A;  5BS6 A;  1IUF A;  1JHF A;  2PX9 A;  4QPO A;  5JVG F;  3ZPL A;  5FRN A;  4KDP A;  2XGD A;  1WJE A;  3EET A;  4WK8 F;  1JKR C;  4HF2 A;  4LFU A;  4RAZ A;  1ZRF A;  1WI9 A;  3I4P A;  2VKH A;  3SFI A;  5JHU A;  4ZDO A;  1I3Q J;  2NVY J;  2QKL B;  3GZN B;  1MJA A;  2EFO A;  2H8W A;  5D6E A;  4EJV A;  2M87 A;  2R4G A;  2CUE A;  2E34 A;  4HOB A;  2HEO A;  3Q0V A;  2BHZ A;  4IOC F;  2AXL A;  2XDV A;  2ID6 A;  2M0M A;  2V9K A;  1JTX A;  4LMY A;  2ZME B;  2EIK H;  2RGV A;  3HKZ N;  5E8I A;  2P8T A;  4JK1 X;  2ZC2 A;  3CP2 A;  3OYA A;  1SEU A;  3OYG A;  4YIR X;  1L3L A;  1RIO H;  3HZJ A;  4NC6 A;  4IO9 F;  4II3 A;  2JA6 J;  5F27 A;  4IF4 A;  5FD5 A;  4M71 A;  1NH3 A;  4XR6 A;  3I59 B;  1W0T A;  5HVQ C;  5LGN A;  3GEZ A;  2OBP A;  4XLN F;  4BY7 J;  2KPM A;  1YHQ I;  3DPU A;  1QPM A;  4M3E A;  5LGU A;  5EG0 A;  2IS2 A;  2YSR A;  4AVZ A;  1ERD A;  1ORK A;  2JT1 A;  3CO7 C;  5E3L A;  3S2H J;  3OWT A;  2DA1 A;  1MW7 A;  3TP0 A;  3CUQ A;  5E3N A;  4L9N A;  4S04 A;  1ZLK A;  2VKD A;  2CS3 A;  2L5Q A;  1R00 A;  2MGQ A;  2E5Z A;  2V1N A;  3GXO A;  1W5S A;  1RUN A;  1W7P D;  1SD6 A;  4AC0 A;  4R79 A;  2OQG A;  2ZBK A;  4XKW A;  5ICE A;  3S3O A;  4OMY A;  1ZG5 A;  2VQC A;  2FSW A;  3I9V 2;  1YJ9 I;  4MGR A;  3HSE A;  4AIJ A;  1TTY A;  2VE8 A;  4L9T A;  4L9V A;  5GAH J;  5DM6 F;  3VYR B;  3OYK A;  1LE8 B;  3LST A;  3K6G A;  3E1S A;  1MBK A;  5FGM A;  3VOE A;  2XF6 A;  4HW0 A;  1TW3 A;  2V4J C;  2LTP A;  1T95 A;  4WWC A;  3DU6 A;  2IGM A;  4BE1 A;  1EH8 A;  2NRA C;  2XRN A;  3H36 A;  5B66 C;  3JR9 A;  5E3M A;  1SFE A;  2D5V A;  1BBY A;  2QEN A;  2LC2 A;  1MBE A;  1WZ2 A;  1W7P A;  2DO7 A;  2JRM A;  1VQ9 I;  4Y15 A;  3C2H A;  3W2A A;  4M73 A;  3T0Y A;  2HVR A;  2ME6 A;  4C30 A;  3V8L A;  3ABT A;  5DD8 A;  1KQ0 A;  3OYL A;  2VC0 A;  1UEL B;  2XRL A;  3ERM A;  2TCT A;  3FIW A;  4DZJ A;  5GPC A;  1RES A;  3AL0 C;  3GTQ J;  4DQ2 A;  1ZR4 A;  1IGN A;  2F5E A;  2Y0M A;  3GWZ A;  2B0L A;  4IOA F;  1POG A;  5C44 J;  2A69 F;  2L9V A;  2BY0 A;  2HDW A;  1K4T A;  3R6S A;  4A93 J;  3RYR A;  3ROU A;  4M6X A;  1D0Y A;  2DOE A;  1JUS A;  3ZMD A;  3CJR B;  1FTT A;  2QWW A;  1KON A;  2K27 A;  4WXC A;  4BUP A;  4CCJ A;  3SDG A;  2K9N A;  3PUF A;  4MQV A;  2Y30 A;  4Q5S F;  2O5R A;  2FNA A;  5DM7 F;  2IA2 A;  2XAF A;  1ETO A;  2LFB A;  2DT7 B;  3JRI A;  2F5C A;  3CF5 F;  3RJP A;  4M9Z A;  5HOO A;  4L0Y B;  2E7X A;  3F0C A;  3L7W A;  1Z9C A;  3BQZ A;  3N4M A;  4XRM A;  3TKY A;  2HVS A;  2M5W A;  2MA3 A;  2DOA A;  5FJ8 J;  1F1Z A;  1TT5 B;  4QSH A;  1IXR C;  2KIF A;  3GLX A;  3HSR A;  3F6O A;  3A03 A;  1C0W A;  1XMA A;  2IPQ X;  2LBF A;  1W5T A;  1IRF A;  1FNN A;  1HW5 A;  1S5L C;  2Y48 A;  4EM0 B;  3M8F A;  2ZXW H;  3ZQI A;  4WX9 A;  1BW5 A;  3NWT A;  3DV8 A;  1FTZ A;  3ZQF A;  4PSW A;  1SMT A;  3R61 A;  2R5Y B;  1FT9 A;  3B73 A;  1YI2 I;  3M1E A;  1YJN I;  2KL4 A;  5EEA A;  2X6Y A;  2J5O A;  3OV8 A;  3FF5 A;  5EEG A;  1OCZ H;  1T08 B;  2M9H A;  3KLN A;  1I6H J;  4PCQ A;  3CCM I;  3KX2 A;  1VQ5 I;  1GVD A;  3ISP A;  3WE2 A;  3BG7 A;  1ETK A;  1Q1V A;  1VQL I;  4C3J J;  1O57 A;  1RNL A;  3WGH A;  2BY2 A;  5FB2 A;  5J40 A;  5CVV A;  2HQA A;  3JRD A;  2DTR A;  4XLP F;  1P4X A;  1TWG J;  4NC8 A;  2EFP A;  2HU9 A;  2DYS H;  3Q9S A;  1VND A;  2CQK A;  4I01 A;  1KYW A;  2EBI A;  2O0Y A;  5D8L B;  1VQ4 I;  2AXT C;  4F92 B;  1RKW A;  1XCV A;  2G9W A;  3GX4 X;  1AHD P;  3SZP A;  3HSF A;  1SAN A;  5CVR A;  1QZZ A;  3BR6 A;  3AG3 H;  3NWS A;  4Z6Y A;  3BJA A;  3JRF A;  1YQA A;  2HYF A;  2ZJR F;  2Z16 A;  3F8M A;  2X1D A;  3ECO A;  2FA5 A;  3S32 A;  4E7J A;  1I50 J;  1XDU A;  3V8J A;  2CV1 A;  3E97 A;  3OYE A;  1EV7 A;  1TWA J;  2A6T A;  4BJ5 C;  1R7J A;  3TMO A;  2R7S A;  4B09 A;  1FPQ A;  1R5I D;  2R7V A;  5KK1 A;  2XKP A;  2ZCW A;  3VOD A;  2UWM A;  3ULQ B;  2EB7 A;  2XV4 S;  1FIP A;  1HCR A;  2D1V A;  4P9F A;  2A5Y B;  2DK5 A;  4AYB A;  1JJ6 C;  2C6Y A;  4ESF A;  1XX5 A;  1Z3X A;  1PYV A;  1YIO A;  2DDA A;  4HX7 A;  3PIP F;  1JKO C;  2ZJQ F;  2FEZ A;  2P6T A;  4XLA A;  2E1O A;  2VB6 A;  2M30 A;  2DBB A;  3BDD A;  2Q1Z B;  5M3F J;  2ZME A;  1T39 A;  5IT9 Z;  1WGX A;  5F0H A;  3LMM A;  5M5Y J;  1MD0 A;  3DCF A;  3CO6 C;  2WY8 Q;  1HXD A;  2L01 A;  4DZP A;  2PMZ N;  3A0H C;  4J19 A;  4IRG A;  1SVL A;  5F1J A;  2JSP A;  1YIJ I;  4U0W A;  5A2Q K;  2P5L C;  3VYU B;  1FP2 A;  3HYI A;  1I1S A;  1XD7 A;  3ZN1 A;  2H8R A;  1APL C;  4BL0 B;  2A61 A;  1VQ6 I;  2A05 A;  1BJZ A;  4UHT A;  4FAS D;  5LBQ A;  2V9P A;  4Q48 A;  4A2U A;  3JAM Z;  2Z33 A;  4ZYG A;  3K10 A;  2FU4 A;  3BR0 A;  4XL9 A;  3G1M A;  3EUA A;  1AA7 A;  4ANJ A;  2P5K A;  3BJO A;  2TDX A;  4XN0 A;  5EYR A;  2EZL A;  4XM3 A;  2MLG A;  1IRZ A;  1IDY A;  4AYB N;  1TWF J;  1WI3 A;  2R7W A;  3RI4 A;  1FBQ A;  3AL0 B;  2CU7 A;  1U5T A;  3MMY B;  5ILU A;  3CCL I;  1X1D A;  4UB8 C;  4HF1 A;  2EZI A;  5DUK A;  4RGX A;  3WGI A;  3C2B A;  4BBR J;  2V9V A;  2XGC A;  4OMZ A;  4I98 B;  2IA0 A;  1XMX A;  3HTU A;  5TGT A;  4Y4R A;  3VB2 A;  2GAU A;  1XPX A;  2K9S A;  3HDD A;  3RPU D;  2EWN A;  3T5X A;  4BBS J;  2QLZ A;  2KIU A;  2Z5U A;  4D1Q A;  3ML6 A;  3CDL A;  1TQM A;  4JBA A;  1ZN2 A;  2H09 A;  2MBF A;  4B44 A;  1S3J A;  2G7H A;  4XLF A;  2ELH A;  1T33 A;  2CUJ A;  5CVJ A;  4YFX F;  5K5O A;  1JJ8 C;  2M0C A;  1OCC H;  3EYI A;  5DS9 A;  3UR3 C;  1D1B A;  3HUG A;  1X3U A;  1U78 A;  4JX4 A;  1BR4 A;  3L09 A;  4UNO A;  1X2M A;  2JRT A;  5IP7 J;  4NB5 A;  1JUP A;  4HBL A;  3QAH A;  3RPU A;  4OAZ A;  4A6E A;  1UZC A;  4IXA A;  1UHS A;  2FJ1 A;  1V54 H;  3BR5 A;  3C1D A;  2CYY A;  3COA C;  2LD5 A;  3ERE D;  3BG3 A;  4ESJ A;  1WPK A;  4PGG A;  2DA3 A;  1PDN C;  1MKM A;  3NQO A;  3WTT C;  1WKM A;  4L0Z B;  3DP7 A;  2KZV A;  2ELK A;  1KYZ A;  5ILS A;  1AKH B;  2X48 A;  1ZG3 A;  1HST A;  1F4K A;  3VYS B;  2XSJ C;  3J7Z I;  2AS5 F;  4GXO A;  4PUS A;  2E2J J;  5LHI A;  4EMS A;  2MH2 A;  1I3A A;  2VXD A;  3ZCO A;  3MQ0 A;  1O7L A;  2OC6 A;  2QCO A;  1SD4 A;  1TBX A;  3DQV C;  3FXM A;  2LYC A;  4HYE A;  2FXA A;  5F08 A;  3WU1 B;  1U8B A;  2F4I A;  5B1A H;  4LB5 A;  3AKZ A;  1HSJ A;  2OJE D;  4C2T A;  2CQN A;  2R92 J;  1HQC A;  3ABU A;  1YTY A;  2QQ9 A;  3SZT A;  5D4R A;  1R22 A;  1OIS A;  1R49 A;  3H9Q A;  2HNH A;  2X1C A;  4BY1 J;  4A3M J;  2E2I J;  2FF4 A;  2NOJ B;  4FX4 A;  4MHG A;  5FRO A;  4RM3 A;  1P4W A;  1EA3 A;  2GA2 A;  3CZ6 A;  4A3F J;  1KU9 A;  3KZZ A;  3FBN B;  4YEJ A;  2X85 A;  3I4M J;  5JR3 A;  2KLO A;  4Y33 A;  2A6H F;  4FET A;  2ZKZ A;  1P6R A;  3NEU A;  1FSH A;  3ZQ7 A;  3JRC A;  3B02 A;  3J80 Z;  1K4S A;  3L2C A;  2L9R A;  3GZ5 A;  3S93 A;  3V7S A;  2YR2 A;  2GXG A;  4XKB A;  1XB4 A;  3FMR A;  1TQP A;  4JQF A;  4BDZ A;  1MBH A;  3H3U A;  5BPI A;  3W3C A;  1OPC A;  4YFN F;  1A5J A;  2ZNZ A;  3VDX A;  1QQI A;  4IHY A;  3IL2 A;  3OL3 A;  5LD2 C;  2MAB A;  3GTG J;  5DEQ A;  1B8I B;  1MMN A;  5LEJ A;  4IHX A;  1EH6 A;  1JT6 A;  2XAQ A;  1XGS A;  4XKV A;  2VQG A;  5KVR A;  1QA6 A;  1FBU A;  1D1C A;  2CJJ A;  2M34 A;  3L2U A;  4BAC A;  2IA1 A;  1ULY A;  5IT3 A;  4EJT A;  5TIS C;  3DF8 A;  1FBS A;  4EJO A;  3CMA I;  2XGX A;  3DKY A;  1E3O C;  2CMP A;  3IAS 2;  3HHG A;  1GXP A;  2Q2E B;  3LSI A;  4XSX F;  5HLG A;  2I10 A;  1YW8 A;  4U0Y A;  3O3K A;  3J81 Z;  2W7N A;  4X0G A;  4V2G A;  5FKK A;  2CSO A;  2R5Z B;  5DCM B;  3K70 C;  4OU0 A;  1IXC A;  3IC7 A;  1YS6 A;  1QZE A;  2O6G E;  2VIX A;  3RYP A;  2ZJP F;  3DTI A;  4IHS A;  2LMD A;  3NAU A;  4BS9 A;  2HVQ A;  1OCO H;  4E70 A;  1Y56 A;  2VOD A;  1LVK A;  3N05 A;  5IPA A;  3QPL A;  3I71 A;  5KAF C;  4MEY F;  4ASN A;  3OYN A;  1TW2 A;  2CUF A;  1R4N B;  5EEH A;  1ETQ A;  1LPQ A;  1XSX A;  4M6Y A;  3PFY A;  5EZG A;  5AIQ A;  5KAI C;  3IHU A;  1J0R A;  4RGU A;  1G4D A;  3BR1 A;  4MEX F;  4IKF A;  5C3E J;  5ICG A;  4UXN A;  5HLT A;  2HOA A;  2KMU A;  4E6K G;  4OIP F;  1W1W E;  3FXR A;  4B4C A;  1XTA A;  1G59 A;  2PJR B;  4MQ9 F;  4BQO A;  2GWR A;  4XOR A;  3WGG A;  3ZR8 X;  3HOT A;  2CQ7 A;  2PN6 A;  2Y0S A;  3BY6 A;  2Y31 A;  2YUS A;  2GIZ A;  1SFO J;  2ZJ2 A;  1TNT A;  1Z7L A;  3ZQH A;  3TOB A;  3M4O J;  2O61 A;  2R7T A;  3BR3 A;  1KU3 A;  3DEU A;  1USS A;  5J8C A;  3CES A;  5E1Z B;  2WTE A;  2Y75 A;  1GV5 A;  4XK4 A;  2XC7 A;  3BPV A;  3MKZ A;  3KYD B;  1FMV A;  2MSY A;  1Z05 A;  1D3Y A;  3FXO A;  3QPH A;  2FMY A;  2K9Q A;  2NVT J;  5F64 A;  2IRF G;  3TGN A;  3HRM A;  2DMT A;  3M1C A;  1L0O C;  3Q3S A;  5J3L A;  4BEH A;  3K2A A;  3IV5 A;  2HS5 A;  1RZ4 A;  3MD2 A;  1EH7 A;  3V7C A;  1KA8 A;  1QVU A;  3OSF A;  2CQX A;  4I02 A;  1IV6 A;  1GDT A;  2QQA A;  2JJ7 A;  1T2K A;  2KQR A;  2HPM A;  1XGN A;  1Z77 A;  2Z9O A;  2JTV A;  2JVH A;  2UUZ A;  3HOY J;  2X6X A;  4PZJ A;  3JSO A;  3DBL B;  1TC3 C;  2LKS A;  1UFM A;  2BV6 A;  1XS9 A;  3ABM H;  1S29 A;  2Z1D A;  4IZZ A;  1HBX G;  1MDM B;  3DLL F;  5E1X A;  1T38 A;  3M8E A;  2D2W A;  2HXI A;  2LNB A;  5D5X B;  1Y8R B;  2RV8 A;  5DV5 A;  4HG2 A;  3WU0 A;  3QP6 A;  1JTY A;  1TNS A;  2DN0 A;  4E7K A;  5D5V B;  4YRV A;  3ZQC A;  3GCM A;  5TRD A;  1VF9 A;  4UUT A;  2UXX A;  4L5E A;  2BYV E;  2LH9 A;  2EA2 A;  1WRJ A;  3BZK A;  4AWX B;  1RR8 C;  2VL8 A;  3E6M A;  4ZYA A;  4YFK F;  1MNM C;  1WFX A;  1ZYR F;  2G7U A;  3K4J A;  3H0D A;  1AKH A;  3T8R A;  3M8J A;  3K7A J;  1OQY A;  3HKZ A;  3EYY A;  2COM A;  3QQA A;  5F6F A;  4B3X A;  4FTH A;  2F5F A;  4CYD A;  4QTR A;  2CWE A;  2PLY A;  2L9N A;  1YOV B;  4G12 A;  1S7E A;  2BY3 A;  3I4N J;  3LFK A;  3TDZ C;  5BPD A;  2LG4 A;  2R7U A;  1HDD C;  2HFH A;  1QVT A;  1LJ9 A;  4TV7 A;  4B43 A;  1Z6T A;  2NS0 A;  3G71 I;  4BQQ A;  2DJI A;  5D4S A;  3OIQ A;  2VJ5 A;  3JRG A;  4NQW B;  4HV5 A;  5ERI A;  1UG0 A;  3B6A A;  4IRH A;  1FLI A;  3L9F A;  4M6V A;  1Y8Q B;  3Q0W A;  1UCR A;  4P5O A;  2XF5 A;  1ETV A;  1SMY F;  2IXS A;  3SDB A;  4O3M A;  4CZC A;  1F9N A;  2DQL A;  2W1O A;  2XB5 A;  2FRH A;  3BTC A;  4HAM A;  1KZH A;  4XRF A;  4CO8 A;  4IRI A;  1P92 A;  2UZK A;  3CCE I;  1ZGW A;  3OYH A;  3VSK A;  3M9A A;  1JGG A;  4G9Y A;  2VBZ A;  2UV1 A;  2EFW A;  1RUO A;  5AIP A;  2NNY A;  2KIM A;  4UVA A;  4JOM A;  2VPR A;  2KT0 A;  2M8G X;  2BEO A;  1O3S A;  2JA5 J;  4BXX J;  3DXJ F;  3CJQ B;  3FHN A;  2M4G A;  3KP2 A;  4IVN A;  1A35 A;  1GVJ A;  1XSV A;  1BL0 A;  1B8I A;  1NTC A;  2A68 F;  4RM2 A;  4XSZ F;  3S1N J;  1IDZ A;  3FXL A;  4OWR B;  4YEL A;  4D7M A;  2A3S A;  3I58 A;  3CMY A;  4A3L J;  3DTK A;  4KIC A;  1OR7 A;  3GFI A;  3L2R A;  1PP8 F;  1G8X A;  5CPR B;  1OCT C;  3KLO A;  1XC5 A;  4FIS A;  3OR2 C;  1FP1 D;  1K6Y A;  2Q2E A;  3LA2 A;  3PNT A;  3CTA A;  4ENK A;  4ZTF A;  3OYC A;  4A5N A;  2E5N A;  2MG4 A;  5KNL A;  4UUV A;  4CHU A;  4AU7 A;  2R5Z A;  4C3I J;  4EVI A;  1FEX A;  2HOS A;  4HEA 2;  5DCM A;  5J6X A;  3K2Z A;  3H5A A;  3E0J B;  2HKX A;  2LF8 A;  3S3N A;  1ZK8 A;  2VBW A;  2M2E A;  2HXO A;  3BG6 A;  3RDI A;  5GTH C;  1MND A;  4C3H J;  4G7O F;  2WWY A;  1E3P A;  4HDU A;  3C3W A;  3ZP5 A;  3FDY A;  4AIK A;  1PUF B;  5FFX A;  2KP6 A;  1YX3 A;  2RKH A;  1V5E A;  1E2X A;  4XKC A;  4KUM A;  4D9J A;  2EK5 A;  1VQP I;  2VBX A;  4HQM A;  4D5C A;  2XAU A;  3F9K A;  1VTN C;  2OTJ I;  3KYC B;  5F0F A;  1IV8 A;  4J00 A;  4BJ6 C;  4IHT A;  1W36 C;  4UY8 I;  3F8B A;  1X19 A;  3HHH A;  4DYR A;  4HNT A;  3D5S C;  2PJR A;  3I5U A;  4BXU A;  3JCU C;  3HRT A;  2IVM A;  1GLN A;  5FRM A;  4LG3 A;  4M72 A;  3C7J A;  3BTI A;  2BW3 A;  5BQT A;  2JVG A;  3I56 I;  2MLK A;  3F3X A;  3PSI A;  4B1R A;  2K02 A;  3OYF A;  2JN6 A;  3L2W A;  1FX7 A;  1YYV A;  4RAG A;  3GTP J;  2QVO A;  3FXK A;  4ZC3 A;  1DGW Y;  2R3S A;  5LEK A;  3OOP A;  1RI7 A;  3ONQ A;  5JVT A;  4EGZ A;  4I7H A;  1YW7 A;  1K6O A;  1LFP A;  3BCA A;  3DU5 A;  4CGZ A;  4HSR A;  2V26 A;  3AG4 H;  1R71 A;  2LP0 A;  4BE0 A;  3FKJ A;  2ZO4 A;  3O6B B;  1X1B A;  2GXA A;  2L7Z A;  3BP8 A;  3HRU A;  2XB0 X;  2V6C A;  4A3C J;  4E4H A;  4IX7 A;  4ZZL A;  2N8G A;  1BOA A;  1QO0 D;  2P5V A;  1LFU P;  2EZK A;  3K4N A;  2IGO A;  2DYR H;  3WTX C;  1K78 B;  3KCC A;  4WCG A;  3K69 A;  3ZQL A;  3V7R A;  4F52 A;  2E7W A;  4B8X A;  2QBY B;  1NG6 A;  1W0U A;  3C2G A;  1PP7 U;  2WY7 Q;  2F6C A;  3CJN A;  3KZI C;  2NXN B;  4OAY A;  4XNF A;  4BU2 A;  3QRF F;  1AU7 A;  3IP4 B;  3RZD J;  3I53 A;  4NBQ A;  1U2W A;  2WC2 A;  5E1W A;  2K5C A;  4N9H A;  2FNP A;  3J7A O;  4EJW A;  2JMW A;  3K4B A;  3HG9 A;  2EZH A;  2NVU B;  1MMS A;  2RRE A;  3ZOB A;  3DKX A;  5L3D A;  3N97 A;  3WTV C;  2BE5 F;  3HB9 A;  2ZXH A;  4M3F A;  1FSE A;  2ZSI B;  5HS9 A;  5LRR A;  1MH3 A;  5BMZ A;  5CLS A;  3MKL A;  4BDY A;  5M3M J;  4V2F A;  2DFF A;  2H6C A;  3AAF A;  4CCM A;  3KEQ A;  2RC4 A;  2ICW G;  3ESW B;  2DAO A;  2EH3 A;  5J1Y A;  2PMZ A;  1HW2 A;  1U9O A;  1DP3 A;  2CGP A;  2JPC A;  2QSF X;  4CCK A;  4FE7 A;  2QUF A;  2HGC A;  3BG9 A;  2OTL I;  1ON2 A;  1LDD A;  1MMA A;  3E6C C;  1NK2 P;  2EPF A;  1H88 C;  1ZAR A;  2XAJ A;  1KQ8 A;  4JX5 A;  1ETW A;  2VE9 A;  2LY9 A;  3DEW A;  1I5Z A;  1BM9 A;  3K1N A;  1RKT A;  3BOQ A;  2Y9Y A;  3IUO A;  1G2H A;  1A6I A;  3ZMU A;  2FBK A;  4E7L A;  3CC4 I;  4NQW A;  3S2D J;  4BQN A;  2ELJ A;  5GAG J;  1F36 A;  2JUG A;  1YRN B;  1HA8 A;  3MKY B;  4YG2 F;  2XSD C;  1V55 H;  1NG7 A;  1KU2 A;  4GDF A;  5ED4 A;  1V3F A;  1U0J A;  5E8G A;  1R23 A;  1ZKG A;  4LK1 F;  1D0X A;  2OF7 A;  2L02 A;  2O8K A;  3CCV I;  4LLG F;  3SXY A;  1CF7 B;  3GVA A;  2UXN A;  1UB9 A;  2YX7 A;  4XOP A;  5FKM A;  3JRA A;  1LDK B;  2Z99 A;  2W85 A;  4XLC A;  4UVB A;  1UHM A;  2DFE A;  2IEK A;  3OYB A;  3RQI A;  3EPZ A;  4GGG A;  3HPH A;  4P1W A;  2NAZ A;  3I59 A;  4A0Z A;  1MIJ A;  2WAD A;  2W57 A;  4ABZ A;  3E5U A;  3JTH A;  5DD4 A;  1T0F A;  1BIB A;  1B4A A;  4ETS A;  2CFX A;  3OL4 A;  4ENM A;  3CUQ C;  2IBD A;  5D6F A;  3WG7 H;  4DGW B;  2E1N A;  2MD5 A;  1J5Y A;  1K7A A;  1SD7 A;  2YPR A;  1I27 A;  2QQ8 A;  1TL8 A;  3CF2 A;  4DBR A;  3G73 A;  1MBG A;  2QQB A;  1RPW A;  2DQR A;  3ELK A;  4S05 A;  2EIL H;  4W97 A;  5CVI A;  4M3D A;  2M7A A;  1PUE E;  4KIS A;  3KPH A;  4UV8 A;  4XON A;  3QOD A;  2L54 A;  3LSR A;  4D7N A;  2DDB A;  3LFU A;  4CUG A;  2HZD A;  2GZW A;  6PAX A;  1ENH A;  2LY1 A;  2K9M A;  2ISY A;  1PVE A;  1D1A A;  1U8R A;  1LB2 A;  1FOY A;  1LE8 A;  3UKG A;  1WJ5 A;  1HC8 A;  1IN7 A;  5FKO A;  1ZQ3 P;  4BE2 A;  4RB1 A;  1NK3 P;  2HPI A;  3OR1 C;  4F93 B;  1TLH B;  4HRI A;  2X9D A;  3L00 A;  3SYT A;  4CSW A;  4NHJ A;  1BI3 A;  1F43 A;  1VQK I;  1P7J A;  2P7V B;  5DCF A;  2GOX B;  5L3C A;  4M3G A;  1YX5 A;  3KZY A;  2X6O A;  3OYI A;  2HQ5 A;  4UB6 C;  3D5L A;  3R0J A;  2AO9 A;  3H1C A;  1QPI A;  3H0G J;  2X6W A;  3WTS C;  3QU6 A;  2W84 A;  5HDN A;  3SZG A;  4HST A;  3MFK A;  3CQZ J;  3CME I;  2OUM A;  1FMW A;  4BHC A;  3SEQ A;  2OD5 A;  4UV9 A;  3OYJ A;  4FT8 A;  5FKL A;  2H6B A;  3E5Q A;  1X1A A;  2DCE A;  5CYV A;  3JRE A;  4BKX A;  1MMD A;  3A01 B;  1Z1D A;  2YS9 A;  1CQT A;  4BNC A;  2M8E A;  3U1K A;  3W6K B;  1LKX A;  3MVP A;  2L7M P;  2K86 A;  4PSX A;  5E20 A;  2DJN A;  2L3D A;  3I54 A;  3U2R A;  2DOF A;  2DT5 A;  5IP9 J;  2DA6 A;  3QP5 A;  1HKQ A;  2HTJ A;  4DJA A;  2R7D A;  2JSC A;  4E7S A;  3S17 J;  3AG1 H;  2JQ7 A;  5ICC A;  2R7X A;  2X4H A;  2V6E A;  1YFH A;  3L2V A;  4U7D A;  4G6Q A;  5IT9 K;  3IH4 A;  4LD5 A;  4IJA A;  2DMP A;  3W2V A;  1S9H A;  1D8J A;  3GO5 A;  3WOD F;  5M5W J;  1BR1 A;  3CJT B;  4N0B A;  3SFZ A;  4ZDP A;  2D45 A;  1ETX A;  4CYC B;  5DUI A;  1GT0 C;  4RB0 A;  3F8N A;  2KHM A;  1FOK A;  4I76 A;  2PBI A;  2VUM J;  2MD0 A;  2PMH A;  1SVO A;  4PDK A;  3GTJ J;  2R5Y A;  4A0Y A;  3KEY A;  3PO2 J;  3JAM K;  4IL6 C;  4F7Z A;  1B9N A;  1X4O A;  4AID A;  3QYF A;  2M45 A;  1P2F A;  2FOK A;  3E5X A;  4HNV A;  3F6V A;  3HOW J;  2W00 A;  2QBY A;  3GYH X;  1QRY A;  4P9U A;  4CDG A;  3S1Q J;  4RLF A;  3RZO J;  1JKP C;  2EV0 A;  2V79 A; 
#chains in the Genus database with same CATH homology
 2NS8 A;  4A3G J;  4GFB A;  1Z77 A;  1DU6 A;  3JR9 A;  5E3M A;  5K7F A;  2D5V A;  3HOY J;  1MBE A;  1TC3 C;  5DTD A;  4JP0 A;  1XS9 A;  1X58 A;  3W6V A;  2ME6 A;  2HXI A;  2XRL A;  2TCT A;  3FIW A;  4DZJ A;  5GPC A;  1RES A;  3FKI J;  3GTQ J;  1Y1V J;  1ZR4 A;  1IGN A;  4UUS B;  2HDD A;  1JTY A;  1HLV A;  2DN0 A;  2CRG A;  1XG1 A;  2JA7 J;  3ZQC A;  4Y52 J;  1POG A;  5C44 J;  1VF9 A;  4UUT A;  5FLV A;  4L5E A;  2E2H J;  4A93 J;  1MNM C;  3S15 J;  2R93 J;  1JUS A;  4NDL A;  3HEF A;  1FTT A;  1AKH A;  3FIS A;  2ID3 A;  3K7A J;  3SDG A;  2K9N A;  2XPU A;  3QQA A;  2Y30 A;  4FTH A;  1B72 A;  4QTR A;  2DMU A;  5EG0 B;  1ETO A;  2LFB A;  3OIO A;  3JRI A;  5GP9 A;  3E7L A;  4G12 A;  3G1O A;  1S7E A;  3F0C A;  3I4N J;  3BQZ A;  2R7Z J;  4XRM A;  1D5Y A;  5FJ8 J;  2OPT A;  4XIC A;  1ETY A;  4M3B A;  4QSH A;  1HDD C;  5FKN A;  1QVT A;  3A03 A;  3HGG A;  3JRG A;  3HM5 A;  1OJL A;  1PUF A;  3HOZ J;  3B6A A;  1YRN A;  3ZQI A;  2Y9Z A;  1GUU A;  1BW5 A;  3H3V K;  4M6V A;  3M3Y J;  4DYC A;  3JRH A;  3Q0W A;  1FTZ A;  3ZQF A;  2COB A;  1FIA A;  1ETV A;  2R5Y B;  2NS7 A;  3GTM J;  5F04 A;  2XB5 A;  5EEA A;  3BTC A;  1JT0 A;  2VKV A;  4MO7 A;  2M9H A;  1I6H J;  3MN2 A;  1ZGW A;  2MW8 A;  5EGO B;  3GTL J;  3HGY A;  1GVD A;  1JGG A;  1K61 A;  4MLO A;  1ETK A;  1Q1V A;  1H89 C;  4C3J J;  5C4X J;  1WCM J;  2ECB A;  2VPR A;  2KT0 A;  1JKQ C;  2M8G X;  3JRD A;  2JA5 J;  4BXX J;  1TWG J;  2DTZ A;  4EEF G;  5JLW A;  3QPS A;  1BL0 A;  1B8I A;  1VND A;  1NTC A;  3LSJ A;  2EBI A;  3S1N J;  1IDZ A;  5F0C A;  4D7M A;  1RKW A;  3CMY A;  4A3L J;  1AHD P;  5BNG A;  1SAN A;  3WHB A;  4A69 C;  3BR6 A;  4Y7N J;  3JRF A;  1OCT C;  1XC5 A;  4A3I J;  4FE4 A;  2L7F P;  1MBF A;  1T56 A;  4FIS A;  2LVS A;  1I50 J;  2MG4 A;  2HYJ A;  1MSF C;  1TWA J;  2R5Z A;  4C3I J;  1FEX A;  2HOS A;  5K7Z A;  3HOX J;  1ZK8 A;  3SJM A;  2M2E A;  2HXO A;  1FIP A;  1IJW C;  4C3H J;  1HCR A;  1RET A;  1O4X A;  1PUF B;  2AHQ A;  1JJ6 C;  1U9N A;  2JWT A;  1UMQ A;  2JJ7 A;  1JKO C;  1BW6 A;  2DMN A;  2KDZ A;  2E1O A;  4D5C A;  5M3F J;  1WGX A;  5F0H A;  2R0Q C;  5M5Y J;  5F0F A;  1VFC A;  3DCF A;  4JX6 A;  4DZP A;  2PMZ N;  4J19 A;  5F1J A;  5C4J J;  3A01 A;  4DYR A;  2FX0 A;  4JYK A;  2H8R A;  2G0E A;  1APL C;  3S1R J;  2NOG A;  3OSG A;  1DU0 A;  1HDP A;  4QIW N;  1BJZ A;  1GV2 A;  1OFC X;  2DA4 A;  2O7O A;  2E19 A;  1Y1W J;  2GM4 A;  1VI0 A;  3BR0 A;  3BTI A;  3PM1 A;  3G1M A;  2O9L A;  2VI6 A;  3S1M J;  4S0H B;  9ANT A;  5EYR A;  1Z0X A;  1MH4 A;  2EZL A;  4B1R A;  1IRZ A;  1WH7 A;  2JN6 A;  1IDY A;  2K40 A;  1TWF J;  4AYB N;  3GTP J;  1WI3 A;  2DMQ A;  2FQ4 A;  4LOC A;  2CU7 A;  4A3B J;  5JLX A;  4CYC A;  2EZI A;  3C2B A;  4BBR J;  2XGC A;  2LP0 A;  3FK7 A;  5EDN A;  2L7Z A;  3B6C A;  1IG7 A;  2XB0 X;  2VKE A;  5HOD A;  4A3C J;  3BTJ A;  3HDD A;  2K9S A;  1TWH J;  2N8G A;  1LFU P;  3FK6 A;  2EZK A;  2LLK A;  4BBS J;  5IYB J;  5IYC J;  2XPV A;  2Y2Z A;  4MFD A;  3CDL A;  4D5F A;  3TED A;  5EF6 A;  3ZQL A;  1T33 A;  3TW7 A;  1W0U A;  4X6A J;  3O8H A;  1JJ8 C;  2M0C A;  5DS9 A;  1LFB A;  1ITY A;  1U78 A;  3BG5 A;  4JX4 A;  4XRS A;  1X2M A;  1AU7 A;  5IP7 J;  3BQY A;  2GLO A;  3RZD J;  5K7H A;  1JUP A;  4A3D J;  1H8A C;  1X2N A;  3L1P A;  4UUS A;  4C2M J;  1UG2 A;  1UHS A;  2FJ1 A;  3BTL A;  2JMW A;  4XID A;  3HOU J;  3BR5 A;  3D1N I;  2EZH A;  2LD5 A;  3BG3 A;  1WPK A;  3ZOB A;  4A3J J;  1IC8 A;  4M3F A;  2DA3 A;  3HB9 A;  5M5X J;  1MH3 A;  3MKL A;  5M3M J;  4V2F A;  4IHV A;  5GPA A;  3IH3 A;  3LNQ A;  2ELK A;  2EH3 A;  1AKH B;  5J1Y A;  2X48 A;  1U9O A;  2JA8 J;  1K83 J;  4FE7 A;  2WB1 N;  2E2J J;  1OCP A;  1B72 B;  3BG9 A;  5IYD J;  1NK2 P;  2H1K A;  2QCO A;  1WH5 A;  1H88 C;  3GTK J;  3O8G A;  2FD5 A;  3TW6 A;  4JX5 A;  5F08 A;  1ETW A;  1U8B A;  2LY9 A;  3DEW A;  3HOV J;  4B3A A;  4IEJ A;  3BT9 A;  1RKT A;  2DA7 A;  2Y9Y A;  3CCY A;  2NVX J;  1G2H A;  5FLM J;  1A6I A;  2R92 J;  2XPW A;  3S2D J;  3VPR A;  3G1L A;  2DA2 A;  2DA5 A;  2B63 J;  2ME0 A;  5IOZ A;  4BY1 J;  4A3M J;  2E2I J;  1F36 A;  3JRB A;  1YRN B;  2XSD C;  3LOC A;  4A3F J;  4MFE A;  2CQQ A;  3GBG A;  2RAE A;  1ZKG A;  3I4M J;  2OF7 A;  2O8K A;  2XGE A;  5EGO A;  4I6Z A;  5J1U A;  5FKM A;  2QF7 A;  3JRA A;  2TRT A;  3JRC A;  2Y0S N;  4X1E A;  2ECC A;  2IEK A;  3RQI A;  5IP6 A;  1R9T J;  2L9R A;  3NAR A;  1TWC J;  4ABZ A;  3HBL A;  5J1R A;  3S14 J;  1ZR2 A;  1MBH A;  1ZTR A;  3GTO J;  5E3O A;  1HF0 A;  2IBD A;  1A5J A;  4IHY A;  2YU9 J;  1RR7 A;  2L0K A;  4RDU A;  3GTG J;  1B8I B;  1MBG A;  4IHX A;  1JT6 A;  1RPW A;  4W97 A;  4A3E J;  4RBO A;  2HI3 A;  4M3D A;  4AUX A;  2CJJ A;  2M34 A;  3TP3 A;  3LSR A;  2WAQ N;  4D7N A;  4FCY A;  2LKX A;  1ENH A;  1E3O C;  4IHW A;  3ZQG A;  1EF4 A;  5EZH A;  1LE8 A;  1HOM A;  3UKG A;  5FKO A;  2I10 A;  1ZQ3 P;  1NK3 P;  2LK2 A;  2EQR A;  4DW6 A;  4A3K J;  4V2G A;  2NVQ J;  1IUF A;  2X9D A;  5FKK A;  1BA5 A;  2R5Z B;  2JK3 A;  2LR8 A;  1F43 A;  2W48 A;  1P7J A;  2XGD A;  3WHC A;  1JKR C;  3LSG A;  4M3G A;  2X6O A;  2HQ5 A;  3A02 A;  3NAU A;  3SFI A;  2AO9 A;  4MIM A;  1I3Q J;  2NVY J;  5IPA A;  3QPL A;  1QPI A;  3H0G J;  2CUE A;  3Q0U A;  3Q0V A;  2P81 A;  2CUF A;  2HOT A;  2ID6 A;  1ETQ A;  3CQZ J;  1JTX A;  3LSP A;  5EZG A;  3HKZ N;  4W1U A;  1MSE C;  3BR1 A;  5FKL A;  1MBJ A;  5C3E J;  2GBY A;  3JRE A;  2JA6 J;  4BKX A;  5F27 A;  3A01 B;  3OOU A;  2HOA A;  1P7I A;  2YS9 A;  1CQT A;  3S16 J;  4B4C A;  3MVP A;  2L7M P;  1W0T A;  4BY7 J;  3RKQ A;  2DJN A;  4M3E A;  5EG0 A;  3BR2 A;  5IP9 J;  2DA6 A;  2Y31 A;  1ORK A;  2YUS A;  3PO3 J;  5E3L A;  3S2H J;  1SFO J;  3S17 J;  3ZQH A;  2IAI A;  3IH2 A;  2DA1 A;  3M4O J;  3TP0 A;  3BR3 A;  4DYQ A;  5E3N A;  3IH4 A;  2DMP A;  5M5W J;  1GV5 A;  4XRS G;  4XK4 A;  2MGQ A;  1ETX A;  4CYC B;  1FJL A;  1GT0 C;  4AC0 A;  4I76 A;  2MSY A;  2VUM J;  2NVT J;  2K9Q A;  1JUM A;  3GTJ J;  5IOY A;  2R5Y A;  3PO2 J;  2DMT A;  1LE8 B;  3Q3S A;  2ZB9 A;  5J3L A;  3K2A A;  3IV5 A;  1MBK A;  4HNV A;  3HOW J;  2LTP A;  3S1Q J;  1QVU A;  3RZO J;  1QRY A;  3OSF A;  2CQX A;  1JKP C;  1IV6 A;  1GDT A;  2WV1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...