2HOAA

Structure determination of the antp(c39->s) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs diana, caliba, habas and glomsa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKENKTKGEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords ANTENNAPEDIA PROTEIN
publication title Structure determination of the Antp (C39----S) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs DIANA, CALIBA, HABAS and GLOMSA.
pubmed doi rcsb
source organism Drosophila melanogaster
molecule tags Dna binding protein
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1992-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hoaA00
1MBFA 5IP7J 2LFBA 3IH2A 1ZR2A 1WPKA 1PUFA 2MGQA 1T56A 4QTRA 3BR0A 1AKHB 3JRBA 4B3AA 1GT0C 1VNDA 5K7HA 5F0HA 4V2FA 1JUPA 3S17J 5EG0B 1HLVA 5GP9A 3WHBA 3IH4A 5BNGA 1IGNA 5EF6A 1U8BA 2CUFA 2M0CA 5E3LA 1ETWA 2R93J 1MSFC 3S1MJ 3G1LA 1JTYA 2JK3A 5J1UA 3K7AJ 5EG0A 3JRGA 4UUTA 3MN2A 4XRMA 5F1JA 1QPIA 5IOYA 3TW7A 2CQXA 1TC3C 2EZHA 2M8GX 4IHXA 2MSYA 1BL0A 2XB5A 3E7LA 2M34A 3HGGA 4CYCA 4FTHA 1JKOC 1POGA 2E2IJ 4M3DA 1UMQA 1SFOJ 1MH4A 2ME6A 1VI0A 1X2MA 4QSHA 1MBHA 3BR1A 1BW5A 3GTJJ 3S15J 3S16J 1NTCA 2XGEA 1QRYA 3VPRA 2Y9YA 1MNMC 2DN0A 1ETQA 2JA6J 2JJ7A 3PM1A 3MVPA 2HI3A 3LSGA 1RPWA 4W1UA 1WI3A 1RETA 1JJ6C 4M3BA 1DU0A 3BTJA 1W0TA 4AUXA 1F43A 1FTZA 2JMWA 2LVSA 3SDGA 2XPWA 2QF7A 4D7NA 2O7OA 4A3JJ 2DTZA 3JREA 4X1EA 1U9NA 4RBOA 4C3JJ 2R5YB 1VFCA 3LOCA 3JRDA 2TCTA 2FX0A 4B1RA 4D7MA 1Z77A 4A3FJ 1UHSA 2GM4A 1GV2A 4XRSA 3Q0VA 2NS7A 1IV6A 4HNVA 2RAEA 4I76A 1S7EA 1WH7A 1LFBA 1K61A 1ITYA 3JRCA 1XC5A 1ETKA 3GTPJ 4AYBN 2DA5A 1CQTA 2Y9ZA 1NK3P 3A01B 2E2JJ 4A69C 3BTIA 3GTLJ 2JA7J 1ZKGA 5J1RA 2LD5A 4A3LJ 2NS8A 2HXIA 3Q0WA 1SANA 1ETOA 2R7ZJ 5IP6A 2CRGA 3HOVJ 3HM5A 1AHDP 4IHVA 1QVUA 3M3YJ 3L1PA 2DJNA 3TP0A 3RZDJ 2NVTJ 4MFEA 2HXOA 4IHYA 1H88C 1JKPC 3HB9A 2CQQA 2LLKA 2R5ZA 4FE4A 4FE7A 5FKLA 3JRFA 1YRNA 4M3EA 1BW6A 2X9DA 4BBSJ 3D1NI 1IJWC 3RQIA 5IYDJ 3TW6A 2DA4A 4FISA 2NVYJ 5EEAA 2W48A 2MG4A 1LE8B 5GPAA 1JT6A 5J3LA 5IYBJ 1ORKA 1RR7A 2B63J 1X58A 3DCFA 5F08A 2K9NA 2CUEA 2M2EA 5EGOB 3SJMA 1UG2A 1ZQ3P 2EH3A 5F0CA 3S2HJ 1OFCX 1GVDA 3BTLA 3JRIA 1HDPA 3A03A 3HOZJ 1IC8A 1R9TJ 2EBIA 4AC0A 1ENHA 5E3MA 2XPUA 4JX6A 3S1NJ 3QPLA 2EZKA 1AKHA 1E3OC 4JYKA 4V2GA 1IDYA 4BY7J 1VF9A 2VUMJ 3S2DJ 4IHWA 5EGOA 2PMZN 2ECBA 2HYJA 9ANTA 4BY1J 2ME0A 3Q0UA 2XPVA 4A3GJ 5F27A 4DZJA 1HOMA 5EYRA 2NVXJ 3H0GJ 5C4JJ 4JX5A 4Y7NJ 2DMNA 3ZQGA 5IPAA 3RKQA 1FTTA 1Z0XA 3LSRA 1U78A 2WV1A 2Y2ZA 3HDDA 1EF4A 1OJLA 1TWCJ 2VI6A 4M3GA 3RZOJ 5F0FA 1K83J 3TEDA 2NOGA 2DA7A 2M9HA 2TRTA 1B8IB 1JUMA 1H89C 2XB0X 3JR9A 2R0QC 1GUUA 5F04A 1XS9A 1O4XA 5FKMA 1W0UA 1T33A 2VPRA 4A3CJ 2DA3A 1F36A 2DMTA 3BR6A 1IDZA 1IG7A 3GTKJ 5M5WJ 2L0KA 5EZHA 1ZK8A 3HBLA 4JP0A 3CCYA 3WHCA 3S1QJ 1B8IA 3ZOBA 3B6AA 2O8KA 1JKQC 1NK2P 2LY9A 5IYCJ 2N8GA 5GPCA 2AHQA 3OIOA 3C2BA 1LFUP 2ELKA 2Y31A 5K7ZA 2R5YA 2FJ1A 3M4OJ 2DMPA 4NDLA 5M3FJ 1HF0A 1ETXA 2GBYA 3IH3A 5FLMJ 1MSEC 2EZIA 5E3OA 2O9LA 2IEKA 1BA5A 3SFIA 2CU7A 5IP9J 1JGGA 2DMUA 2FD5A 4IEJA 3ZQFA 2MW8A 4DZPA 2HDDA 1WH5A 3JRAA 2AO9A 3W6VA 5C44J 4JX4A 2P81A 5EDNA 1JTXA 4UUSB 3A01A 3JRHA 1ETYA 3QQAA 1B72B 3BR3A 4L5EA 5DTDA 1I6HJ 2LK2A 1FIAA 2DA6A 3F0CA 1TWHJ 2E2HJ 4MIMA 3BQZA 2GLOA 2H8RA 3CMYA 2COBA 3GTQJ 2EQRA 1U9OA 4DYRA 2K9QA 1TWAJ 4DYCA 5JLXA 2WB1N 3ZQLA 4ABZA 1RKTA 5FKNA 1B72A 5FKKA 1RKWA 2Y30A 4DYQA 1G2HA 2WAQN 1TWFJ 1PUFB 1OCPA 3I4MJ 1Q1VA 4A3IJ 5E3NA 1ZTRA 3ZQHA 3GBGA 4DW6A 2Y0SN 4D5CA 3ZQCA 1FEXA 2L7MP 1LE8A 2JWTA 3ZQIA 4RDUA 3GTGJ 2FQ4A 3S1RJ 3FISA 1ZGWA 1QVTA 2XRLA 4BXXJ 3BR5A 5J1YA 3HKZN 1I50J 5EZGA 2YU9J 3PO2J 2QCOA 4J19A 3TP3A 3B6CA 2LR8A 4FCYA 1JJ8C 1IUFA 4GFBA 4A3BJ 1BJZA 3DEWA 3FKIJ 1OCTC 2L7ZA 1WGXA 1X2NA 2L9RA 3BTCA 3HEFA 2X48A 5HODA 2G0EA 5M3MJ 2NVQJ 1DU6A 3FK6A 3HGYA 3H3VK 1MBEA 3PO3J 3G1OA 2R92J 4CYCB 4BKXA 2HQ5A 5M5YJ 4C3HJ 2XSDC 5DS9A 3K2AA 2LKXA 4G12A 3BR2A 5IOZA 1D5YA 3G1MA 5C4XJ 1JKRC 3HOYJ 2HOSA 1MH3A 5FLVA 2OPTA 4I6ZA 1WCMJ 4M6VA 3I4NJ 4S0HB 3UKGA 4M3FA 2X6OA 3O8HA 4MO7A 3BG9A 5C3EJ 1GDTA 2IAIA 2EZLA 2HOAA 4LOCA 1JT0A 1A6IA 1H8AC 1XG1A 2VKVA 1A5JA 2K40A 3OOUA 4C3IJ 5FJ8J 2JN6A 1APLC 2ID3A 1JUSA 4A3KJ 1TWGJ 2CJJA 2VKEA 1P7JA 3Q3SA 2LTPA 3HOXJ 5M5XJ 4C2MJ 2K9SA 4W97A 1MBKA 4EEFG 4D5FA 3O8GA 4A3MJ 2XGCA 2I10A 1FJLA 3HOWJ 2LP0A 2JA8J 2H1KA 3A02A 4B4CA 1RESA 1P7IA 2YUSA 3OSFA 2L7FP 2KT0A 3IV5A 2KDZA 3CQZJ 3GTMJ 3BQYA 2E1OA 4XICA 3CDLA 4A93J 2JA5J 3NAUA 3FIWA 4MFDA 2OF7A 1HDDC 2ZB9A 2DA1A 3FK7A 3NARA 3GTOJ 1GV5A 3LSJA 2E19A 2R5ZB 1HCRA 1ETVA 1YRNB 4UUSA 2HOTA 4A3DJ 4QIWN 4XK4A 1Y1VJ 2ID6A 3LNQA 4XIDA 1FIPA 4A3EJ 2ECCA 1Y1WJ 2XGDA 4X6AJ 2D5VA 2IBDA 1ZR4A 3OSGA 3S14J 1MBJA 3BG5A 2DMQA 4XRSG 4BBRJ 4Y52J 2DA2A 5K7FA 3QPSA 3MKLA 5JLWA 3LSPA 1I3QJ 1AU7A 5FKOA 1IRZA 3HOUJ 2YS9A 3BG3A 3BT9A 4MLOA 1MBGA
chains in the Genus database with same CATH superfamily
1MBFA 2LF8A 1WPKA 4I99C 1FY7A 1FYKA 2JA2A 2MGQA 1T56A 2E35A 1Y0NA 2LYCA 4G6DA 2KHMA 3LA2A 4TV7A 3TOBA 1VNDA 3CJQB 1SEUA 2RQPA 2LY1A 3FHNA 1N75A 1BOAA 4OAYA 5GP9A 1FBQA 3W2WA 1WJBA 1KQ8A 2A07F 3MZ8A 2RDPA 2WWYA 1U8BA 2CUFA 2B0LA 3GFIA 4LD5A 2J5OA 1X4OA 3E3VA 1EKEA 2LC2A 2L01A 4XQFA 3PFYA 3K7AJ 2IGNA 5EG0A 1QZZA 2KKOA 4UUTA 4E7LA 1DGRM 4XRMA 3MD2A 1MMDA 1FNNA 5IOYA 1WWXA 1KONA 2EZHA 1V5FA 2A3SA 2KPMA 1V4RA 1G6NA 2EFQA 2MSYA 1T39A 5LHHA 2HPIA 3BP8A 2DDBA 4I0AA 3H5NA 3JCUC 1POGA 2E2IJ 4M3DA 2OC6A 1SFOJ 3FMQA 5DYMA 2F2EA 2ZJRF 3I58A 3BR1A 3OV8A 1BW5A 3GTJJ 3K4KA 3FMRA 3S15J 3L00A 1NTCA 2Z5UA 2XROA 3HRTA 2XGEA 1QRYA 3HSEA 3VPRA 4FETA 3BG7A 3S3NA 1V3FA 2JA6J 4CCLA 5HDGA 4IPAA 1RPWA 3CF2A 5CVUA 3DU5A 4GDFA 2O8XA 1JJ6C 3ZPLA 2MD0A 3DLAA 2M30A 2VC1A 2JMWA 4D7NA 4EM0B 5FFXA 2O7OA 1R4MB 1ZN2A 2LH9A 2EFOA 2DTZA 1ZGAA 2V1XA 4X1EA 3JREA 2G9WA 3FXMA 4UVBA 1U9NA 4C3JJ 3W2AA 3LOCA 4G8XA 5KAFC 4D7MA 1VQLI 4IRIA 2V1UA 4BUPA 1Z77A 1PYVA 1UHSA 2HKOA 2GM4A 2R7XA 2V6CA 1ON1A 4XRSA 2XHKA 1W7PD 4B43A 3QOPA 5CVJA 5AIPA 2RAEA 3H5RA 1W7PB 3RQ4A 1WH7A 3H9GA 1LFBA 3GYHX 3C2GA 3SFZA 1Z7UA 4AYBA 1RRJA 4AYBN 3GMEA 2DA5A 3R60A 4C30A 1U5TA 1CQTA 1I27A 2K27A 3SZGA 3A01B 1VQNI 3GTLJ 4KN4X 1ZKGA 3DKXA 3T5XA 5J4VA 2VODA 4LB5A 2V1DA 3Q0WA 3A4CA 4YIIA 4RB2C 5IP6A 2F4OB 2P4WA 3HOVJ 1O7FA 1AHDP 1DGWY 2Q2EA 2E7XA 3G71I 4RM3A 2R7VA 3TP0A 1TW2A 2P0WA 2VN2A 4MFEA 4IHYA 2KIUA 4L5IA 3E5UA 3HB9A 1MNEA 5H2FC 3F8CA 1LVKA 3IWFA 1YITI 4HOBA 4RB0A 3JRFA 1YRNA 3LQQA 3X2QH 2DYSH 4RA2A 4BHCA 4BBSJ 5IY5H 1IJWC 5BOXA 1T0FA 2QSHX 2DA4A 4G6TB 2NVYJ 2VB6A 5EEAA 4Z6YA 1W5SA 1T2KA 3K2ZA 5J3LA 4WF2A 5IYBJ 4ZDPA 1RR7A 1X58A 3BCBA 4HSTA 3S93A 1Q1HA 4KA4A 3DCFA 4CZZA 3HRMA 2HQAA 3FBNB 1T38A 4DGWB 1D0XA 2NAZA 1BN5A 5FFZA 4O3MA 4N9HA 3DV8A 1UG2A 1ZQ3P 5HOOA 2EH3A 5F0CA 4RS8A 3CDIA 3S2HJ 3FDYA 3JRIA 1HDPA 4XLAA 1IC8A 1R9TJ 3TO6A 2K5CA 3MEXA 4AC0A 4B09A 1KU3A 1AA7A 3HC7A 3QPLA 3ZN1A 2W25A 1IDYA 4WXHA 5D8KB 2PMZA 1H0MA 3MZHA 3F6VA 5H6QA 2PMZN 2HYJA 3RI4A 3JTGA 2V9VA 3E5QA 3HTUA 2ME0A 2ZJPF 2EFPA 2VQCA 5HNFA 5DCMB 5F27A 4DZJA 5LGTA 3SYTA 3OYLA 2STWA 3CC2I 4HRIA 4DIQA 1BM9A 1Y39A 2OBPA 2XIGA 4PSXA 1K4TA 3AG3H 3U9GA 3I53A 3DTEA 3AKZA 1EF4A 5FRNA 3OYEA 4F7ZA 2VI6A 3CO6C 3TL4X 1NG7A 4M3GA 4UB6C 2V79A 5LEKA 2IS4A 3CCEI 4CXFA 2NOJB 1SVLA 2XB0X 4RB3C 5LHGA 5A2QZ 3JR9A 1X1DA 1VQ4I 2XSJC 1XS9A 1DP3A 1W0UA 2OUMA 2VPRA 4A3CJ 1F36A 5IT3A 2DT6A 3BR6A 4AIDA 1IDZA 3C2HA 1IG7A 3R4KA 5EZHA 4HW0A 1XCBA 1IN5A 3FXLA 1D1AA 3CCYA 2IA2A 3WHCA 4IOCF 1VQ9I 1X1AA 1XSDA 1I1SA 5K5RA 1B8IA 4IKFA 3B6AA 2YX7A 3S8PA 3QWLA 3WTSC 5ICEA 1XDSA 2M8EA 3E97A 3GZ5A 4NQWB 1MDMA 2AHQA 4A12A 1B9MA 4A2UA 1YTYA 1LFUP 1IXSB 3FX3A 3C18A 2XF5A 3KP6A 5CYVA 3DPTA 4N4OB 4V19K 4CHUA 2IEKA 5ICGA 3ISPA 1W7PA 3K4NA 1NHAA 4IEJA 4ZYGA 5D4RA 1Y0UA 2VOOA 5HLTA 3I5UA 3ZQFA 2O3FA 2R7FA 2HDDA 3JRAA 2AO9A 4U7BA 4JX4A 1Z1DA 1T8IA 2LKSA 3A01A 1N78A 4F52A 2BYVE 3HZJA 2Q8KA 2F5DA 4OMZA 4BEHA 1I6HJ 1XGOA 1D3YA 1UHWA 1TWHJ 2E5ZA 3ELKA 3GTQJ 3L7WA 2LNBA 3D5LA 4BXUA 3QOEA 1RI7A 2F4MB 2JT1A 1MBGA 5JLXA 1LNWA 4L9NA 2VOPA 2R3SA 4GCVA 1O7LA 1XN7A 3OR1C 3GEZA 5FKKA 1RKWA 2Y30A 2KRCA 2DBBA 5A2QK 4E6KG 2X1EA 2BEOA 1N25A 3I4PA 1VZ0A 1OQYA 2RNGA 3GBGA 5JVTA 2VBXA 4JBAA 4LITA 3I3LA 3ZQIA 2PN6A 2ZJ2A 1FOXA 3BOQA 3BR5A 4ZYHA 1FSHA 4UB8C 2BW3B 4RAYA 4J19A 1WSUA 5FROA 3WTUC 4BACA 4CA0A 2WV0A 4A3BJ 2XAHA 3FKIJ 3DXJF 3CUQA 5E8GA 2ISZA 2D45A 2VQHA 2L9RA 3TGNA 3KP3A 1MMGA 1XX5A 4M71A 5M3MJ 2OV7A 3WE2A 4KITB 3DLLF 3ROUA 1MBEA 2RC4A 2YX4A 3OYDA 1K7AA 1UZCA 3LL7A 5M5YJ 2XAGA 1M1EB 2HFHA 4XM3A 3F23A 2F5EA 3PSFA 2XSDC 2HEOA 2KMUA 4BQNA 1S7OA 5L3EA 4BL0B 3SDBA 4F3QA 3QYBA 2M7BA 4Q48A 1EJ9A 1R36A 1TP4A 1MH3A 4I02A 4P1WA 5FLVA 3OYHA 4I6ZA 4Q47A 5LGNA 3KYDB 1K6OA 4ZDLA 1EH8A 2X6OA 1JHFA 4I7HA 4AM3A 3BG9A 5C3EJ 3OYCA 1GDTA 2IAIA 3M7GA 2EZLA 2HOAA 3GFLA 1ZELA 2JVGA 3HPGA 1K4SA 3R6SA 5KVRA 3KEYA 2P8TA 3FM3A 3RKWA 3Q5FA 3G3ZA 1ZG3A 2P5VA 3GCMA 2VKEA 3HOXJ 2VIXA 5BMZA 4A0XA 1HSTA 1QGPA 4LG0B 3GZ6A 2K9SA 2UXXA 2XGCA 3PSIA 3HOWJ 1BR2A 2WC2A 1S3JA 1F9NA 4CDGA 2P7VB 3SZPA 1FMVA 2V7FA 2ELHA 3EYIA 4I98B 2M4KA 2O6GE 1E3PA 3DU6A 1IRXA 1VQ5I 4RLFA 3PNYA 4NQWA 4RGSA 2HGCA 1O3TA 3F9KA 5E1WA 2E7WA 2BVMA 3CCSI 5GAGJ 3E6MA 3ZGKA 4NC6A 3VFZA 5D5WB 4A93J 3KP4A 2Z99A 3V8JA 2CGPA 1IXCA 1ZLJA 1UCRA 3BPXA 5LBQA 1R1TA 1YIJI 3HHGA 3I56I 5DM7F 2VBYA 3OY9A 3NARA 5H6RA 3GTOJ 2HOEA 3KZIC 2HDWA 3LSJA 1R71A 2CW7A 2LDUA 3PUFA 2DT5A 1QPMA 1HCRA 3CO7C 4WCGA 1IXRC 2R7TA 2DK5A 1TW3A 2WA0A 3BWGA 3A0BC 2KIQA 3LSIA 2V9KA 4A0YA 1ODDA 4QIWN 4PFOA 2IT0A 1ACIA 1Y1VJ 1P92A 1FYLA 2F5VA 2ID6A 4XIDA 1Y1WJ 2A69F 2D5VA 4PJNA 3S14J 3SQNA 1IN4A 2VE8A 3FWEA 4XRSG 4PK4A 3CCUI 4XNFA 2NNYA 1FSEA 1OCOH 3CD6I 4A6EA 5J6XA 2GIZA 3VODA 2L9VA 2HWVA 2RV8A 3D5SC 3KLOA 4EM2A 4C2UA 1AU7A 4PJJA 2EIMH 2YS9A 4MLOA 3JSPA 2LFBA 1ZR2A 1KYZA 2XV4S 5ED4A 4YIRX 1X3ZB 4XLHA 1ZAOA 4CCJA 4QTRA 3CDHA 4ZZLA 3JRBA 5D5VB 3OL3A 5K7HA 3T8RA 4LLLA 4MGRA 4WXCA 4XLPF 3S17J 1FYMA 2EJRA 2YPRA 5EG0B 4I0BA 2K02A 2HYGD 3B02A 4PDKA 5DUKA 4BJTA 2F4IA 1D1BA 4XMYA 4YG2F 1IGNA 3LA7A 4RGUA 4BQAA 1ETWA 5EEHA 3LSTA 4RGXA 5ICFA 1MSFC 2MFZA 1S29A 2GOMA 1VQPI 3BY6A 4AIHA 1GLNA 1HW2A 1TT5B 2BV6A 1X1CA 5DM6F 3QPHA 5F1JA 1ZYRF 4IHSA 1QPIA 2CQXA 1TC3C 2M8GX 1LQ1A 4IHXA 3CC4I 1VQMI 5K5QA 3KIOA 1BL0A 3E7LA 4UUVA 3HPHA 4FTHA 5L3FA 2KQRA 1JKOC 1UMQA 2K3FA 2HU9A 1EH6A 2ME6A 3FMSA 4BE0A 1MBHA 4AVZA 3OWTA 3W2VA 2R7QA 2JUCA 3ABLH 1KZHA 4NUBA 1F4KA 2PJRB 2HS5A 5EEGA 4UY8I 1Z9CA 2DN0A 2PBIA 4P9UA 1Z3XA 1YYVA 2FNPA 4G7HF 5L3GA 2HI3A 3S3MA 2Z2SB 1WI3A 1ZGJA 2D1VA 3NWTA 4G7ZF 2CV1A 3BTJA 2FU4A 5IT9Z 1P9QC 4LMYA 4XORA 1BR4A 2FQ3A 2QF7A 2ZFUA 3SDGA 3N4MA 2K7LA 4WX9A 2DPUA 3CESA 2QEXI 4BH9A 1VFCA 1TQPA 1HKSA 1U5TB 2H8WA 4K2EA 2TCTA 3JAMZ 2CSOA 2ZFWA 4B47A 1GV2A 3IP4B 4PJLA 2NS7A 4U87A 4HF2A 3ERMA 4LG0A 4I76A 2EFNA 3U1DA 2O03A 1X1BA 2BY0A 2V6EA 2BXZA 4XLNF 3I54A 1K61A 4D9JA 1WJAA 1TQIA 2DOFA 3K1MA 1Y6IA 1I6XA 1NK3P 4A69C 2JA7J 4L0YB 4CUGA 3MMYB 3KCCA 3E6DA 3LAPA 4HX7A 4MNUA 3I0TA 3VDXA 4A3LJ 2HXIA 1SANA 1WHUA 1ETOA 4NBQA 3CP8A 1Z21A 2XC7A 2CRGA 2WADA 2WY8Q 3HM5A 1U0JA 3QU6A 4EJVA 3K70C 2MH2A 2DTRA 1MIJA 3CZ6A 3L1PA 1D5VA 3RZDJ 4CYDA 1X19A 1R6RA 2DCEA 2VXDA 3NRVA 2EPFA 3HJEA 5GTHC 3IL2A 2XF6A 3EUHA 4ZYEA 5FKLA 3FXUA 4M3EA 3OOPA 1S8NA 2Y0MA 1J5YA 2WB1A 4OINF 3H36A 3D1NI 1U6GA 4MTDA 4L18B 1L0OC 5CPRB 4EQQA 4N0BA 4UVAA 4PGGA 3MCZA 4ZJZA 3E5XA 5IT9K 2D2WA 4R8HA 2B63J 2GAUA 2K9NA 2AXLA 1J09A 4E7KA 4CCMA 5JHFA 2ZC2A 5ILVA 2QWWA 2ZXWH 4BQOA 1KYWA 3C3WA 3HRUA 3JAMK 2W7NA 2K4JA 4LGWA 1I1GA 1IUYA 5FD6A 4XOPA 5E3MA 2NNNA 3BDDA 3CTAA 3R0JA 4BU2A 2OD5A 2OTJI 2ZSIB 1R1UA 1GVJA 4E4HA 4BY7J 3PIOF 3S2DJ 2VUMJ 4AU7A 1LPQA 4IHWA 2PJPA 2ISYA 3BPVA 5TISC 2XAQA 3EUHC 1X4PA 3CJRB 5ICCA 2VJ4A 4UNOA 3Q0UA 2XPVA 4JK1X 1HXDA 2LG4A 2IS6A 3WU0A 5AONA 1XSXA 3BROA 4JX5A 3FXRA 2FBIA 4DJAA 2R7UA 3RKQA 3W6JB 2RKHA 1MMSA 2L4AA 1XGNA 3RYPA 2J5PA 1BBYA 2Y2ZA 3CCQI 2EA2A 1DP7P 3PNVA 2CV0A 2RREA 1W36D 3HDDA 2KZGA 2XKOA 2OQRA 3IHUA 2CUZA 2BY1A 4EJUA 1OCCH 4ZDOA 4N9IA 2M9HA 4XKVA 4P55A 1B8IB 1IN8A 1JUMA 2CH0A 3GFJA 2PJRA 4Y4RA 5F04A 5HNHA 1O4XA 1MDMB 1T33A 1LDJA 1P4WA 1FC3A 1FP1D 2DA3A 2DMTA 1EV7A 3EYYA 1WJDA 3H5AA 2L0KA 5M5WJ 1ZK8A 2KFDA 5TRDA 1QO0D 1QBJA 1BI3A 4LLGF 2XRNA 2ESNA 4DQ2A 3HRSA 2PI0A 4JOMA 2FMLA 3GFMA 2KLOA 4HNTA 3ZOBA 1W4MA 1JKQC 3PIPF 2LY9A 1B59A 3F8MA 3WTTC 2M3AA 2MLGA 2AXTC 1WJCA 2CWEA 2ELKA 4XKCA 1A35A 3J81Z 4DBQA 2FXAA 3K4BA 2QQAA 3ECOA 3L2VA 4LJZF 1ETXA 4Y13A 3CJNA 1V5EA 4QPOA 1MSEC 1J9IA 3WTZA 4BEHB 1LJ9A 3DPLC 1MD0A 4E7JA 1JGGA 4AD9A 1PJRA 1TBXA 5CKTA 1PP7U 3LA3A 2P6SA 4S05A 1WH5A 4ENNA 4BDZA 2L54A 3PNTA 2P81A 1JTXA 3QP6A 3JRHA 1ULYA 1ETYA 2FBHA 2CQ7A 1ZH5A 4IQ4A 3KYCB 1OPCA 1QHHD 1FIAA 2GLOA 3F0CA 2E2HJ 3CMYA 2DAOA 4KMFA 5F1RA 1U9OA 3FKJA 4DYRA 4A6DA 4DYCA 3G6EI 2VT2A 2RGVA 3IUOA 1MNDA 4HDVA 4HYEA 3ZQLA 3LFUA 2UV1A 3F8BA 1GHCA 3ASNH 1G3TA 3VYSB 2G7HA 1DPRA 3U2RA 3MKZA 5F6FA 3OYKA 2HQNA 1I5ZA 1RZ4A 1UHMA 3BC8A 3H3UA 4NNJA 2R7RA 1OCPA 3I4MJ 3L2CA 1Q1VA 2FBKA 3J80Z 2QQBA 5E3NA 4IX7A 3ZQHA 1IRGA 2Y0SA 2JVHA 1AOYA 2BZTA 2Y0SN 4D5CA 4KT5C 3CUQB 1S9HA 1FEXA 4KICA 4QLCU 1MW7A 3WTVC 4B3XA 2JWTA 2FQ4A 3FISA 1V5GA 2I5UA 2EV0A 3KLNA 2YU9J 3QAHA 3L2WA 1IW7F 3KEQA 3J81K 1JJ8C 1PP8F 4GFBA 3I59A 1XCVA 3K0LA 3DEWA 1OCTC 2XGXA 2L7ZA 2DFFA 4ASNA 3HEFA 1FPQA 2CUJA 5E1XA 5HODA 2G0EA 5DD4A 3QP5A 2JTVA 3DBHB 1DU6A 3FK6A 3HGYA 2K85A 2FRHA 3SEZA 4PSWA 2QBYB 1B9NA 2VASA 2HQ5A 3CF5F 4C3HJ 4HG2A 4XR6A 5KAIC 5DS9A 2MH9A 2X1CA 3CCLI 1H9GA 3KFWX 3M07A 3OL4A 4G12A 4B44A 3BR2A 4G9YA 5IOZA 2VT3A 3G1MA 5BS6A 3F72A 2A68F 1JKRC 1QHGA 1TT0A 2XKPA 2Y75A 2OPTA 1TQMA 2BVLA 2KIFA 1WCMJ 3TO9A 4BE2A 4L0ZB 4S0HB 1FOKA 3LSHA 3UKGA 1WJEA 4M3FA 1YFHA 3O8HA 3V8LA 4AVPA 5B1BH 2ELJA 2ZJQF 5TGTA 3HHHA 1Y8QB 3HSRA 2VKVA 2QM3A 3J80K 1FMWA 4C3IJ 1G3SA 4R79A 5FJ8J 1Z05A 2JN6A 3ABMH 1APLC 1QA6A 2M5WA 3F8FA 1JUSA 1TWGJ 2V1NA 3RTRA 3RJPA 1L3LA 3SZTA 3WU1B 4FX4A 3WTYC 3M1EA 3DWLE 2CJJA 3AG2H 3CMAI 1A36A 4PJMA 1MBKA 4EEFG 2IP2A 4BGDA 2RQQA 4D5FA 3O8GA 3RSNA 5CQGA 1FJLA 3QRFF 3J7ZI 4KIGA 5HDNA 2ZCWA 3CLQA 3A02A 3GUDA 2WBMA 4CCNA 2ZNZA 3OSFA 3P7NA 3IV5A 1HKTA 3CQZJ 2K9MA 3GTMJ 3OYGA 4GYGA 1WKMA 3CLOA 2OF7A 1U2WA 2E71A 3F6OA 5J40A 2CQKA 4O6JA 4XBFA 1VQOI 4ENJA 3K4JA 1ETVA 2EIJH 2LOOA 3QODA 1R00A 3HUGB 4KIFA 2HOTA 4ZYAA 3HOSA 3C1DA 4YFKF 1BC7C 2C6YA 4XK4A 4A3DJ 2GOXB 3VOEA 4A3EJ 2ECCA 2AQEA 4M6XA 2W84A 2ZO4A 3EDPA 2WTEA 2OQGA 4I2OA 2DMQA 2ZXHA 2IA1A 4HEA2 2VXZA 2KP6A 2Z1DA 2W82A 2HYFA 5F64A 2H1LA 2OZUA 3ZMUA 1FBSA 1YIOA 2KISA 3ZMDA 2QKLB 2VJIA 3LSPA 5CQEA 5LD2C 1I3QJ 3LQRA 3ZXSA 1F43A 3BT9A 1R5GA 5IP7J 3IH2A 4HF0A 4DOZA 4OWRB 1IN7A 5CJ9A 3WGGA 5HDKA 2PX9A 3MZYA 2EA4A 1W5CC 3ZCOA 4CCOA 1AKHB 1S5LC 1IF1A 4UV8A 1D0ZA 1V54H 4KISA 1JUPA 2JSCA 3O6BB 1USSA 5ERIA 5HVQC 2OCEA 4E7SA 1DDNA 3MFKA 3G4SI 1VQ8I 3WHBA 1FWZA 4KUMA 3IH4A 5BNGA 1MJBA 3KETA 2M0CA 3UNGC 2R93J 2ADUA 1T98A 2FSWA 3G1LA 1MZBA 2JK3A 1WRJA 2X51A 1MMAA 4OU0A 5LGUA 5FRMA 1J59A 2L5QA 5JI6A 3JRGA 4UVCA 4HLYA 2P7CB 2GXAA 2QQ8A 1J0RA 3I55I 1E0EA 2XB5A 2M34A 2QBYA 1OR7C 1IZ1A 1Y8RB 4UV9A 4LIVA 4Y33A 1MH4A 2PEXA 4H0EA 1S6LA 1BIBA 1X2MA 3DF8A 4KJZA 1P2FA 3WE3A 2IJLA 1A6QA 3S16J 1DUXC 1WVRA 4Y17A 3CCRI 2MC3A 2Y9YA 1MNMC 3Q9SA 3C7JA 3TKYA 1ETQA 1OYIA 3DTIA 2JJ7A 2QSFX 3PM1A 3E1SA 4W1UA 4M72A 4M3BA 4IRHA 5L3BA 1W0TA 4L9TA 4YEJA 4E70A 2R7SA 2LVSA 1FTZA 2XPWA 3AL0C 4U7DA 4XSZF 1VQKI 1R23A 1UJ8A 2R5YB 4RBOA 2ZMEC 3F8NA 3JRDA 2B9SA 4J00A 2FX0A 4R1HA 2H6CA 3KPHA 2XAJA 1Z7LA 3Q0VA 2Z33A 3V7RA 1J7KA 2HTSA 1IV6A 2W1OA 1S7EA 1YE9A 2HZDA 1JE8A 1IO2A 4DBRA 1MKMA 1ETKA 2JRTA 3GTPJ 2WY7Q 4M6YA 2Y9ZA 3R61A 4BQQA 2GQQA 1R5ID 2LD5A 5DD8A 2VLAA 2WAFA 1E17A 4ITVA 3OYFA 3DP7A 1GXPA 4OIQF 1TLHB 1QVUA 3M3YJ 2H09A 1Y56A 1SAXA 2DJNA 4CGZA 3JSOA 3HL2A 4E7ZA 2HXOA 4F55A 1H88C 1JKPC 4H4KC 2CFXA 2CQQA 2OZ6A 2QSGX 4FQGA 4FE7A 3OYBA 3V42A 3SEQA 3HUGA 5B1AH 3KEOA 3V4GA 2X0LA 3DKYA 3RQIA 4IQJA 5IYDJ 1YJWI 1Z91A 2YU3A 3TW6A 3TO7A 2OU2A 2BBYA 2IGMA 1V55H 3FBIB 4HBLA 5FLXZ 2XVCA 2DXIA 2MG4A 2K4BA 1JT6A 1ZRCA 2R7DA 3FM5A 3DBRB 5F08A 2EB7A 5E18F 3V8KA 3D0SA 2M2EA 3BLYA 4RGRA 3WG7H 2H94A 1OFCX 3GWZA 4BNCA 3BTLA 2IGOA 3A03A 1U8RA 2FOKA 2EBIA 4OIOF 3DPUA 1PVEA 4JX6A 3S1NJ 1AKHA 4M74A 1E3OC 4NC7A 2DOEA 4V2GA 2Z16A 2M45A 3IC7A 5EGOA 3RCOA 2IXSA 3PUBA 3RIRA 1FP2A 3COAC 1H9TA 4C2TA 9ANTA 2KJBA 1YI2I 3GW2A 5ILUA 2TDXA 3HYIA 4Q5SF 3LAJA 3ZRGA 5B3SH 1SFXA 4A3GJ 2HQRA 3JW4A 4HLXA 4P9FA 3VEPA 2DK8A 2L9NA 1HOMA 5EYRA 4YIFA 1P6RA 3H0GJ 4Y7NJ 4B8XA 4XLFA 2D1HA 2DMNA 3ZQGA 1T95A 2CS3A 2XDVA 1J75A 2OTLI 2IVMA 1FTTA 2M87A 1Z0XA 1E3HA 5DEQA 4OIRF 1U78A 3KZYA 1JI8A 4DNCA 2OA4A 3W3CA 3J7AO 1OJLA 4ZTJA 2EV5A 1P4AA 4NHJA 3AG1H 5H20A 3RZOJ 2ZNYA 5F0FA 1K83J 3TEDA 2NOGA 4EGZA 4HAMA 5FLXK 2LBFA 1BOBA 1DQUA 1K78B 5FGMA 4BHPA 3K6GA 1R49A 1YS7A 1RUOA 1H89C 2R0QC 1GUUA 3AFHA 5FKMA 2ZBKA 4PGHA 3HG9A 4U0VA 3HXLA 5HLGA 3GTKJ 4ZH4F 3A2KA 2DOAA 2VQGA 3GVAA 4M9XA 3GZNB 4XOTA 2BXYA 1UFMA 3HBLA 4JP0A 4IZZA 4RLQA 2DDAA 3VWBA 5L3DA 1R58A 3OYAA 1OYWA 2ZKZA 2N8GA 3K9TA 4UHTA 5JHUA 4LK0F 5GPCA 1VTNC 3OIOA 5GAEJ 4CCKA 2VONA 2R5YA 2FJ1A 2KDOA 3K4MA 4NDLA 5M3FJ 1HF0A 2CYYA 3IH3A 5FLMJ 4LIUA 2DJIA 2EZIA 4CH7A 1BA5A 2LREA 4QWQA 2MABA 1BIAA 2CU7A 4U88A 5FD5A 5IP9J 3SHFA 2FD5A 4BHBA 3WGIA 3MKWB 2IW5A 2VBZA 3S2WA 4MQ9F 3ZQ7A 3CUOA 3W6VA 4GRIA 2OAZA 4L9JA 2A6EF 2AQFA 4A5NA 4GXOA 2GIVA 4UUSB 3OIPA 2DU9A 5BPDA 3CCVI 4IL6C 3QQAA 1IAWA 3FHZA 2V9PA 1QZEA 2RVCA 4ENKA 4AIKA 5DTDA 2MC4A 2LK2A 2DA6A 4IF4A 4ZYDA 2LKPA 4ZTFA 3K10A 3BQZA 2H8RA 1ZLKA 3H3ZA 2JRMA 4OMYA 3IWZA 2EQRA 2LY2A 5CVVA 2WB1N 3LFKA 4UXNA 4ABZA 3T1BA 1RKTA 2KIMA 1EA3A 2JUGA 5FKNA 2GA2A 1B72A 3EETA 4HF1A 4RMNA 1R1VA 1G2HA 2M0MA 2KRFA 1TWFJ 5D6FA 1PUFB 2I8DA 2ZXIA 2HPMA 4Y15A 4A3IJ 2UWMA 1ZTRA 3CMMA 3MKYB 1OLTA 4YFXF 4II2A 1QQIA 2HTJA 3I59B 3M9AA 2W00A 4WK8F 3ZQCA 1XSVA 4PJ0C 2DFHA 3E6CC 2UXNA 2PMHA 2L7MP 3FXKA 2W57A 1BC8C 3IRQA 3Q9VA 4HSRA 1QVTA 2XRLA 5J4YA 3LSMA 1I50J 4YELA 2QCOA 3B73A 2Q1ZB 5K1YA 1A04A 3TP3A 2FEZA 4FCYA 1HBXG 1O3QA 3PQJA 1BJZA 1XMXA 1G3WA 4XL9A 1WGXA 2F6CA 1TL8A 3REOA 3BTCA 2X48A 1HKQA 5GADJ 2DLLA 1Z3YA 3PO3J 2FE3A 3CCJI 4CYCB 4BKXA 2BHZA 2E1NA 2Z3YA 4OOIA 2XF7A 2P6TA 3K2AA 3RPQA 3H9JA 2LKXA 3OYIA 4CSWA 1KQ9A 4G94A 4FX0A 1D5YA 1A31A 2O61A 1TZLA 1G59A 2B7EA 2HOSA 1GXQA 1BI1A 3TBIA 2HZTA 3I4NJ 3CMEI 3KZZA 2FUG2 1RR8C 1BI2A 2HR3A 2FOWA 4MEYF 1A6IA 1XG1A 1YX5A 1A5JA 3OYNA 3K4CA 3S3OA 4C9YA 3BCAA 1PUEE 3P5JA 3F21A 1XB4A 4U0WA 1RC9A 1K78A 3GO5A 5E8IA 4A3KJ 4P5OA 4RB1A 2VPLA 1TTYA 4OAZA 3BJOA 2QUFA 3DFGA 2LTPA 5M5XJ 1LFPA 2F5CA 3CP2A 3FXQA 4MTEA 3H1CA 5JVGF 3I64A 4W97A 5KK1A 1PDNC 4FT8A 4A3MJ 4RM2A 2I10A 3ASOH 2LSOA 4EGYA 1S7AA 2PMUA 4GGGA 2JA8J 1OKRA 2CV2A 2H1KA 3ZQQA 4IO9F 4M73A 3V7SA 1P7IA 2IGKA 3HOTA 2GXBA 1OYYA 5E79C 2A6TA 2L7FP 2V26A 1ZREA 2KDZA 2DI3A 4U0YA 2E1OA 4EMSA 4HPQA 4O5VA 3NAUA 3L2UA 3FIWA 3IKVA 4MFDA 2DW4A 4FHTA 4F92B 1SC7A 1HDDC 4EJWA 3NQOA 2ZB9A 2DA1A 4XKWA 4Y3OA 1Z67A 3W6KB 4A0ZA 3FK7A 4LB6B 1GV5A 2E19A 2MYSA 2Q0OA 2X1DA 4EJOA 3KP2A 2R5ZB 3ML6A 3HIFA 2A5WA 4UUSA 2K86A 3IAM2 2E1MC 4IJAA 4ESFA 3LNQA 5HS9A 1FIPA 1D0YA 1SD7A 5CVIA 2XGDA 4XN0A 2IBDA 2W85A 2GXGA 3K1NA 3QU3A 3OSGA 3O2PE 3MQ0A 1MJAA 2DPDA 4L5JA 3RPUD 4Y52J 5E1ZB 4BYYA 5LRSA 4J01A 2DA2A 3QPSA 2JQ7A 2GWRA 5JLWA 2EINH 2VJJA 2CFOA 3FXOA 2ZXJA 3SXYA 2HNHA 1IRZA 5FKOA 2E60A 3HOUJ 1KU7A 1ERDA 3BG3A 3BZKA 4XLCA 3OMYA 1PUFA 2K3PA 4EM1A 3H35A 2YR2A 2M7AA 4GO1A 4KMUX 1U5TC 3BR0A 1YJ9I 2COMA 4B3AA 5K5OA 1R5HA 3ZN0A 5DV5A 1GT0C 3AL0B 1LKXA 3BZCA 2L02A 5F0HA 4V2FA 4ZC3A 1HC8A 3L9FA 2PQ8A 3NWSA 1YOVB 1HLVA 3UR3C 2ZMEB 3J7YJ 2RNJA 1T6SA 3OS2A 1HA8A 2QVOA 3GLXA 5EF6A 4II3A 2W24A 1F1ZA 5E3LA 2BE5F 1XD7A 3S1MJ 1JTYA 1ZG1A 5J1UA 3S32A 4CO8A 3WODF 2EILH 2CG4A 3V7CA 1LB2A 1P4XA 2QZ8A 3MN2A 1BJAA 2R7WA 4FASD 3D5RC 2MBFA 2NRAC 2DT7B 2QA4I 2JSPA 3TW7A 3ECHA 1T0FC 3N05A 4CYCA 3HGGA 1CGPA 3A1YA 3K69A 2DQRA 3TDUC 1W5TA 2EV6A 3DQVC 4AWXB 4ANJA 5DUIA 3L09A 3AG4H 1VI0A 4QSHA 3WGHA 3CJTB 3KX2A 3DEEA 4G6QA 5LHIA 4ON0A 2DQLA 5B5EC 2DFEA 4QPQA 5E17F 1OMIA 2QENA 3EUAA 4B48A 4OIPF 1MMNA 2LF7A 3FZVA 3QYEA 1XDUA 1QNTA 3J7AY 1RIOH 4IRGA 1XTAA 2VE9A 3MVPA 3LSGA 4RAGA 5J47A 2F5FA 1RETA 2JZYA 1DU0A 3LSKA 4AUXA 4RAFA 4GYIA 1AWCA 1SMTA 1SVMA 2LRDA 2KRHA 4I01A 1SMYF 2PLYA 4A3JJ 3G73A 1YO5C 2NS0A 2DO7A 3F22A 2OCCH 2JPCA 4B1RA 5L3CA 4A3FJ 3R0AA 4HNVA 3NEUA 2CMPA 5LFAA 4E7HA 3WTXC 2ESHA 2WAEA 1ITYA 3JRCA 4HQEA 1XC5A 3K4LA 2UZKA 1SD6A 2E2JJ 3BTIA 3DEUA 1XMKA 2BY3A 2UUZA 3KP7A 4PUSA 5J1RA 1ZARA 1G3YA 2NS8A 3VSLA 2E34A 4KT6A 1NG6A 3K1PA 2R7ZJ 1OCZH 4IHVA 3AAFA 2BGCA 2JPBA 1KQ0A 1K79A 1UG0A 2NVTJ 1NH3A 1IRFA 1C0WA 2P5KA 4ESJA 5D4SA 4HV5A 3PFIA 1JXSA 5D8LB 3VYUB 2LLKA 2R5ZA 4FE4A 4S04A 2G7UA 1W36C 4EJTA 4D1QA 2Y48A 1IN6A 1BW6A 4LG3A 5B66C 4KIBA 3BJ6A 1B4AA 2X9DA 2EWNA 5D5UB 2ETHA 3A0HC 4PZJA 3EQLF 4FISA 1OR7A 3HTSB 4BJ5C 3QYFA 3ZMZA 1F5TA 2W48A 2NYXA 1LE8B 1YX3A 5GPAA 1LVAA 1CF7B 1ORKA 4I09A 2BY2A 1YG2A 3RPUA 4XONA 2CUEA 3WU2C 1FX7A 1FZPB 4F93B 2VJ5A 3ABKH 5JFRA 5EGOB 5LRRA 3SJMA 2EK5A 2L9SA 1MJ9A 3L2QA 4A5MA 2XAUA 5D6EA 4Z2YA 2RN7A 1GVDA 3IRRA 1REPC 3HOZJ 3OR2C 1N77A 3O3KA 1ENHA 2XPUA 3E6BA 4BJ6C 3ERED 2EZKA 1VQ7I 4JYKA 1YW7A 3RDIA 3GXOA 1VF9A 5ILSA 2CW8A 2L3DA 4IXAA 2Z9OA 2ECBA 2ZMEA 4BY1J 4X0GA 2STTA 2ZSHB 3M1CA 3L2RA 2EIKH 4PCQA 4E7IA 1LEBA 3U1KA 4KFCA 1B1BA 1O3RA 3VYTB 1LEAA 3E0JB 5HS8A 4BE1A 3K70D 1STZA 4LK1F 2NVXJ 4XRFA 5C4JJ 3OYJA 1R4NB 1J2XA 2W4SA 1BR1A 5E20A 5IPAA 5J8CA 2LBFB 1G4DA 2F48A 1R7JA 4AIJA 3LSRA 4HA8A 5FO5A 4BS9A 3RKXA 2WV1A 3RKYA 4WWCA 3ZMSA 3ULQB 1R22A 2QGUA 1OCRH 3PL8A 4MQVA 5DCMA 2P5LC 2PG4A 2VBWA 1TWCJ 3MAJA 3U21A 4KNYA 2E5NA 2K9LA 2VKDA 1UELB 3ABUA 2DA7A 1I3AA 4XN3A 2TRTA 1U3EM 2YSRA 4BAYA 2A61A 4KDPA 4CICA 5KHDA 2XUBA 2CQNA 3N97A 3CUQC 5HLHA 1QU3A 1SVOA 4L9VA 2O0YA 5CVRA 3IKTA 3S1QJ 1ZRDA 3WTWC 3F3XA 2O8KA 2FA5A 2X85A 1NK2P 5IYCJ 1BI0A 1WQ2A 3QPTA 2E36A 3H9QA 2ACJA 1D8JA 2GA1A 3C2BA 4XLEA 2Y31A 5K7ZA 4HX8A 3M4OJ 2DMPA 2VL8A 2O5RA 4HDUA 4MEXF 4EVIA 1DPUA 1HW5A 2GBYA 3GX4X 1S72I 5E3OA 4ESBA 2O9LA 3SFIA 3VB2A 4N4NB 4MHGA 2DMUA 2MW8A 4XSXF 4DZPA 1YW8A 1KU2A 1ON2A 1RNLA 5C44J 3LMMA 5EDNA 1XGMA 2GZWA 2ICWG 3M8EA 2MLKA 1K6YA 4HZFA 2FMYA 2PFBA 2Y69H 5KNLA 1B72B 3BR3A 2L7KA 4L5EA 3VYRB 5LLQA 1UAAA 1KU9A 2H6BA 2M1BA 1EH7A 1SAUA 2QYOA 3WG9A 1X1PA 4MIMA 3KP5A 2COBA 3PQKA 1USTA 2K9QA 1TWAJ 1WJFA 2X6YA 3VSKA 3LWFA 3G2BA 1TNTA 4LLNA 5HLIA 3FF5A 2QKMB 3RYRA 1Z6RA 4HNUA 2BOLA 2DFIA 4DYQA 1LDKB 2QQ9A 4HX4A 2WAQA 2WAQN 4CZCA 2NVUB 3BG6A 4D0PA 4BDYA 5BQTA 1KA8A 1LUJB 5GTIC 1SFKA 3DTKA 3DKWA 3ESWB 3OS1A 4DW6A 3TMOA 1I39A 3H0DA 2EFWA 2L2OA 2L4MA 4Q4ZF 2HVSA 5J8FA 1LE8A 2X4HA 3JTHA 4RDUA 1CF7A 3HKZA 4LFUA 1T08B 4YRVA 3ZR8X 3S1RJ 1ZGWA 3GTGJ 4BXXJ 1D1CA 3H92A 2IS2A 5J1YA 3HKZN 5CLSA 5EZGA 3PO2J 5EJCA 1X3WB 3KYLA 1VQ6I 1HW1A 1FLIA 3B6CA 1G8XA 2LR8A 3T8TA 1IUFA 2MA3A 3ZMTA 1YJNI 1YS6A 3OS0A 1X2NA 3I71A 2MD5A 2X6XA 1W1WE 4PFPA 3CC7I 2AS5F 4EATA 2BW3A 2NVQJ 1WFXA 1ONVA 5JR3A 3H3VK 4IVNA 1D8KA 3G1OA 1KGSA 1B6AA 2R92J 1O57A 3FXJA 1XGSA 2FF4A 4M9SA 3CCMI 2HVQA 4IHTA 1WI9A 4HQMA 4M9ZA 2NXNB 2DODA 1RUNA 2A05A 2XASA 3ZMVA 1YLFA 2R7OA 3BJAA 1ZRFA 1SD4A 1X3UA 5D5XB 3HOYJ 5C4XJ 1E2XA 1WJ5A 5GAHJ 4M6VA 1ZHFA 3MWMA 2M4GA 1ZG5A 4ENMA 2E1MB 3HSFA 2HKXA 4MO7A 1FT9A 4NC8A 1XPXA 1UB9A 3GLLA 3P9CA 1SFEA 1SFUA 1JHHA 4LOCA 5AIQA 3P9KA 2FNAA 1JT0A 1H8AC 3I9V2 4XKBA 1OISA 2KL4A 2K40A 2VKHA 3OOUA 4BXFA 3OYMA 2HVRA 5HS7A 2XAFA 2ID3A 1Z6TA 1FOWA 1YQAA 2IA0A 5DCFA 4IOAF 5FB2A 2VQLA 1P7JA 3Q3SA 4C2MJ 2IS1A 4ZZDA 2E1CA 3EUKL 2LP0A 1SD5A 4EV0A 2A6HF 4B4CA 4KN7X 4RAZA 1RESA 4F91B 2YUSA 3IAS2 3TOAA 4YFNF 2R4GA 2KT0A 4ETSA 6PAXA 2BHYA 1FOYA 3BQYA 4JQFA 2IPQX 3ZP5A 3ABTA 4XICA 3ONQA 1IV8A 3CDLA 1JGSA 1LDDA 2JA5J 2QLZA 2Q2EB 3EPZA 3TQNA 2OJED 4HV6A 3KE2A 1O3SA 2KZVA 3TDZC 5BPIA 2V4JC 2A5YB 1FBUA 1MGTA 3BZ6A 1XMAA 4G7OF 5KCMA 1YW9A 2IRFG 2X6WA 4KYWA 1HQCA 2CW0F 1QZYA 5DDGA 1YRNB 3P9IA 1YHQI 4WXDA 3T0YA 3PJRA 5LEJA 4X6AJ 2H27A 1TNSA 5TJJA 1WZ2A 1ZR4A 1MBJA 3BG5A 1HSJA 4P96A 3DBLB 4BBRJ 2HDCA 3OIQA 2LMDA 5K7FA 3MKLA 4NB5A 2CO5A 2KJCA 2DYRH 3M8JA 3GF2A 3M8FA 2VC0A
chains in the Genus database with same CATH topology
1MBFA 5IP7J 2LFBA 3IH2A 1ZR2A 1WPKA 1PUFA 2MGQA 1T56A 4QTRA 3BR0A 1AKHB 3JRBA 4B3AA 1GT0C 1VNDA 5K7HA 5F0HA 4V2FA 1JUPA 3S17J 5EG0B 1HLVA 5GP9A 3WHBA 3IH4A 5BNGA 1IGNA 5EF6A 1U8BA 2CUFA 2M0CA 5E3LA 1ETWA 2R93J 1MSFC 3S1MJ 3G1LA 1JTYA 2JK3A 5J1UA 3K7AJ 5EG0A 3JRGA 4UUTA 3MN2A 4XRMA 5F1JA 1QPIA 5IOYA 3TW7A 2CQXA 1TC3C 2EZHA 2M8GX 4IHXA 2MSYA 1BL0A 2XB5A 3E7LA 2M34A 3HGGA 4CYCA 4FTHA 1JKOC 1POGA 2E2IJ 4M3DA 1UMQA 1SFOJ 1MH4A 2ME6A 1VI0A 1X2MA 4QSHA 1MBHA 3BR1A 1BW5A 3GTJJ 3S15J 3S16J 1NTCA 2XGEA 1QRYA 3VPRA 2Y9YA 1MNMC 2DN0A 1ETQA 2JA6J 2JJ7A 3PM1A 3MVPA 2HI3A 3LSGA 1RPWA 4W1UA 1WI3A 1RETA 1JJ6C 4M3BA 1DU0A 3BTJA 1W0TA 4AUXA 1F43A 1FTZA 2JMWA 2LVSA 3SDGA 2XPWA 2QF7A 4D7NA 2O7OA 4A3JJ 2DTZA 3JREA 4X1EA 1U9NA 4RBOA 4C3JJ 2R5YB 1VFCA 3LOCA 3JRDA 2TCTA 2FX0A 4B1RA 4D7MA 1Z77A 4A3FJ 1UHSA 2GM4A 1GV2A 4XRSA 3Q0VA 2NS7A 1IV6A 4HNVA 2RAEA 4I76A 1S7EA 1WH7A 1LFBA 1K61A 1ITYA 3JRCA 1XC5A 1ETKA 3GTPJ 4AYBN 2DA5A 1CQTA 2Y9ZA 1NK3P 3A01B 2E2JJ 4A69C 3BTIA 3GTLJ 2JA7J 1ZKGA 5J1RA 2LD5A 4A3LJ 2NS8A 2HXIA 3Q0WA 1SANA 1ETOA 2R7ZJ 5IP6A 2CRGA 3HOVJ 3HM5A 1AHDP 4IHVA 1QVUA 3M3YJ 3L1PA 2DJNA 3TP0A 3RZDJ 2NVTJ 4MFEA 2HXOA 4IHYA 1H88C 1JKPC 3HB9A 2CQQA 2LLKA 2R5ZA 4FE4A 4FE7A 5FKLA 3JRFA 1YRNA 4M3EA 1BW6A 2X9DA 4BBSJ 3D1NI 1IJWC 3RQIA 5IYDJ 3TW6A 2DA4A 4FISA 2NVYJ 5EEAA 2W48A 2MG4A 1LE8B 5GPAA 1JT6A 5J3LA 5IYBJ 1ORKA 1RR7A 2B63J 1X58A 3DCFA 5F08A 2K9NA 2CUEA 2M2EA 5EGOB 3SJMA 1UG2A 1ZQ3P 2EH3A 5F0CA 3S2HJ 1OFCX 1GVDA 3BTLA 3JRIA 1HDPA 3A03A 3HOZJ 1IC8A 1R9TJ 2EBIA 4AC0A 1ENHA 5E3MA 2XPUA 4JX6A 3S1NJ 3QPLA 2EZKA 1AKHA 1E3OC 4JYKA 4V2GA 1IDYA 4BY7J 1VF9A 2VUMJ 3S2DJ 4IHWA 5EGOA 2PMZN 2ECBA 2HYJA 9ANTA 4BY1J 2ME0A 3Q0UA 2XPVA 4A3GJ 5F27A 4DZJA 1HOMA 5EYRA 2NVXJ 3H0GJ 5C4JJ 4JX5A 4Y7NJ 2DMNA 3ZQGA 5IPAA 3RKQA 1FTTA 1Z0XA 3LSRA 1U78A 2WV1A 2Y2ZA 3HDDA 1EF4A 1OJLA 1TWCJ 2VI6A 4M3GA 3RZOJ 5F0FA 1K83J 3TEDA 2NOGA 2DA7A 2M9HA 2TRTA 1B8IB 1JUMA 1H89C 2XB0X 3JR9A 2R0QC 1GUUA 5F04A 1XS9A 1O4XA 5FKMA 1W0UA 1T33A 2VPRA 4A3CJ 2DA3A 1F36A 2DMTA 3BR6A 1IDZA 1IG7A 3GTKJ 5M5WJ 2L0KA 5EZHA 1ZK8A 3HBLA 4JP0A 3CCYA 3WHCA 3S1QJ 1B8IA 3ZOBA 3B6AA 2O8KA 1JKQC 1NK2P 2LY9A 5IYCJ 2N8GA 5GPCA 2AHQA 3OIOA 3C2BA 1LFUP 2ELKA 2Y31A 5K7ZA 2R5YA 2FJ1A 3M4OJ 2DMPA 4NDLA 5M3FJ 1HF0A 1ETXA 2GBYA 3IH3A 5FLMJ 1MSEC 2EZIA 5E3OA 2O9LA 2IEKA 1BA5A 3SFIA 2CU7A 5IP9J 1JGGA 2DMUA 2FD5A 4IEJA 3ZQFA 2MW8A 4DZPA 2HDDA 1WH5A 3JRAA 2AO9A 3W6VA 5C44J 4JX4A 2P81A 5EDNA 1JTXA 4UUSB 3A01A 3JRHA 1ETYA 3QQAA 1B72B 3BR3A 4L5EA 5DTDA 1I6HJ 2LK2A 1FIAA 2DA6A 3F0CA 1TWHJ 2E2HJ 4MIMA 3BQZA 2GLOA 2H8RA 3CMYA 2COBA 3GTQJ 2EQRA 1U9OA 4DYRA 2K9QA 1TWAJ 4DYCA 5JLXA 2WB1N 3ZQLA 4ABZA 1RKTA 5FKNA 1B72A 5FKKA 1RKWA 2Y30A 4DYQA 1G2HA 2WAQN 1TWFJ 1PUFB 1OCPA 3I4MJ 1Q1VA 4A3IJ 5E3NA 1ZTRA 3ZQHA 3GBGA 4DW6A 2Y0SN 4D5CA 3ZQCA 1FEXA 2L7MP 1LE8A 2JWTA 3ZQIA 4RDUA 3GTGJ 2FQ4A 3S1RJ 3FISA 1ZGWA 1QVTA 2XRLA 4BXXJ 3BR5A 5J1YA 3HKZN 1I50J 5EZGA 2YU9J 3PO2J 2QCOA 4J19A 3TP3A 3B6CA 2LR8A 4FCYA 1JJ8C 1IUFA 4GFBA 4A3BJ 1BJZA 3DEWA 3FKIJ 1OCTC 2L7ZA 1WGXA 1X2NA 2L9RA 3BTCA 3HEFA 2X48A 5HODA 2G0EA 5M3MJ 2NVQJ 1DU6A 3FK6A 3HGYA 3H3VK 1MBEA 3PO3J 3G1OA 2R92J 4CYCB 4BKXA 2HQ5A 5M5YJ 4C3HJ 2XSDC 5DS9A 3K2AA 2LKXA 4G12A 3BR2A 5IOZA 1D5YA 3G1MA 5C4XJ 1JKRC 3HOYJ 2HOSA 1MH3A 5FLVA 2OPTA 4I6ZA 1WCMJ 4M6VA 3I4NJ 4S0HB 3UKGA 4M3FA 2X6OA 3O8HA 4MO7A 3BG9A 5C3EJ 1GDTA 2IAIA 2EZLA 2HOAA 4LOCA 1JT0A 1A6IA 1H8AC 1XG1A 2VKVA 1A5JA 2K40A 3OOUA 4C3IJ 5FJ8J 2JN6A 1APLC 2ID3A 1JUSA 4A3KJ 1TWGJ 2CJJA 2VKEA 1P7JA 3Q3SA 2LTPA 3HOXJ 5M5XJ 4C2MJ 2K9SA 4W97A 1MBKA 4EEFG 4D5FA 3O8GA 4A3MJ 2XGCA 2I10A 1FJLA 3HOWJ 2LP0A 2JA8J 2H1KA 3A02A 4B4CA 1RESA 1P7IA 2YUSA 3OSFA 2L7FP 2KT0A 3IV5A 2KDZA 3CQZJ 3GTMJ 3BQYA 2E1OA 4XICA 3CDLA 4A93J 2JA5J 3NAUA 3FIWA 4MFDA 2OF7A 1HDDC 2ZB9A 2DA1A 3FK7A 3NARA 3GTOJ 1GV5A 3LSJA 2E19A 2R5ZB 1HCRA 1ETVA 1YRNB 4UUSA 2HOTA 4A3DJ 4QIWN 4XK4A 1Y1VJ 2ID6A 3LNQA 4XIDA 1FIPA 4A3EJ 2ECCA 1Y1WJ 2XGDA 4X6AJ 2D5VA 2IBDA 1ZR4A 3OSGA 3S14J 1MBJA 3BG5A 2DMQA 4XRSG 4BBRJ 4Y52J 2DA2A 5K7FA 3QPSA 3MKLA 5JLWA 3LSPA 1I3QJ 1AU7A 5FKOA 1IRZA 3HOUJ 2YS9A 3BG3A 3BT9A 4MLOA 1MBGA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1MBF A;  5IP7 J;  2LFB A;  3IH2 A;  1ZR2 A;  1WPK A;  1PUF A;  2MGQ A;  1T56 A;  4QTR A;  3BR0 A;  1AKH B;  3JRB A;  4B3A A;  1GT0 C;  1VND A;  5K7H A;  5F0H A;  4V2F A;  1JUP A;  3S17 J;  5EG0 B;  1HLV A;  5GP9 A;  3WHB A;  3IH4 A;  5BNG A;  1IGN A;  5EF6 A;  1U8B A;  2CUF A;  2M0C A;  5E3L A;  1ETW A;  2R93 J;  1MSF C;  3S1M J;  3G1L A;  1JTY A;  2JK3 A;  5J1U A;  3K7A J;  5EG0 A;  3JRG A;  4UUT A;  3MN2 A;  4XRM A;  5F1J A;  1QPI A;  5IOY A;  3TW7 A;  2CQX A;  1TC3 C;  2EZH A;  2M8G X;  4IHX A;  2MSY A;  1BL0 A;  2XB5 A;  3E7L A;  2M34 A;  3HGG A;  4CYC A;  4FTH A;  1JKO C;  1POG A;  2E2I J;  4M3D A;  1UMQ A;  1SFO J;  1MH4 A;  2ME6 A;  1VI0 A;  1X2M A;  4QSH A;  1MBH A;  3BR1 A;  1BW5 A;  3GTJ J;  3S15 J;  3S16 J;  1NTC A;  2XGE A;  1QRY A;  3VPR A;  2Y9Y A;  1MNM C;  2DN0 A;  1ETQ A;  2JA6 J;  2JJ7 A;  3PM1 A;  3MVP A;  2HI3 A;  3LSG A;  1RPW A;  4W1U A;  1WI3 A;  1RET A;  1JJ6 C;  4M3B A;  1DU0 A;  3BTJ A;  1W0T A;  4AUX A;  1F43 A;  1FTZ A;  2JMW A;  2LVS A;  3SDG A;  2XPW A;  2QF7 A;  4D7N A;  2O7O A;  4A3J J;  2DTZ A;  3JRE A;  4X1E A;  1U9N A;  4RBO A;  4C3J J;  2R5Y B;  1VFC A;  3LOC A;  3JRD A;  2TCT A;  2FX0 A;  4B1R A;  4D7M A;  1Z77 A;  4A3F J;  1UHS A;  2GM4 A;  1GV2 A;  4XRS A;  3Q0V A;  2NS7 A;  1IV6 A;  4HNV A;  2RAE A;  4I76 A;  1S7E A;  1WH7 A;  1LFB A;  1K61 A;  1ITY A;  3JRC A;  1XC5 A;  1ETK A;  3GTP J;  4AYB N;  2DA5 A;  1CQT A;  2Y9Z A;  1NK3 P;  3A01 B;  2E2J J;  4A69 C;  3BTI A;  3GTL J;  2JA7 J;  1ZKG A;  5J1R A;  2LD5 A;  4A3L J;  2NS8 A;  2HXI A;  3Q0W A;  1SAN A;  1ETO A;  2R7Z J;  5IP6 A;  2CRG A;  3HOV J;  3HM5 A;  1AHD P;  4IHV A;  1QVU A;  3M3Y J;  3L1P A;  2DJN A;  3TP0 A;  3RZD J;  2NVT J;  4MFE A;  2HXO A;  4IHY A;  1H88 C;  1JKP C;  3HB9 A;  2CQQ A;  2LLK A;  2R5Z A;  4FE4 A;  4FE7 A;  5FKL A;  3JRF A;  1YRN A;  4M3E A;  1BW6 A;  2X9D A;  4BBS J;  3D1N I;  1IJW C;  3RQI A;  5IYD J;  3TW6 A;  2DA4 A;  4FIS A;  2NVY J;  5EEA A;  2W48 A;  2MG4 A;  1LE8 B;  5GPA A;  1JT6 A;  5J3L A;  5IYB J;  1ORK A;  1RR7 A;  2B63 J;  1X58 A;  3DCF A;  5F08 A;  2K9N A;  2CUE A;  2M2E A;  5EGO B;  3SJM A;  1UG2 A;  1ZQ3 P;  2EH3 A;  5F0C A;  3S2H J;  1OFC X;  1GVD A;  3BTL A;  3JRI A;  1HDP A;  3A03 A;  3HOZ J;  1IC8 A;  1R9T J;  2EBI A;  4AC0 A;  1ENH A;  5E3M A;  2XPU A;  4JX6 A;  3S1N J;  3QPL A;  2EZK A;  1AKH A;  1E3O C;  4JYK A;  4V2G A;  1IDY A;  4BY7 J;  1VF9 A;  2VUM J;  3S2D J;  4IHW A;  5EGO A;  2PMZ N;  2ECB A;  2HYJ A;  9ANT A;  4BY1 J;  2ME0 A;  3Q0U A;  2XPV A;  4A3G J;  5F27 A;  4DZJ A;  1HOM A;  5EYR A;  2NVX J;  3H0G J;  5C4J J;  4JX5 A;  4Y7N J;  2DMN A;  3ZQG A;  5IPA A;  3RKQ A;  1FTT A;  1Z0X A;  3LSR A;  1U78 A;  2WV1 A;  2Y2Z A;  3HDD A;  1EF4 A;  1OJL A;  1TWC J;  2VI6 A;  4M3G A;  3RZO J;  5F0F A;  1K83 J;  3TED A;  2NOG A;  2DA7 A;  2M9H A;  2TRT A;  1B8I B;  1JUM A;  1H89 C;  2XB0 X;  3JR9 A;  2R0Q C;  1GUU A;  5F04 A;  1XS9 A;  1O4X A;  5FKM A;  1W0U A;  1T33 A;  2VPR A;  4A3C J;  2DA3 A;  1F36 A;  2DMT A;  3BR6 A;  1IDZ A;  1IG7 A;  3GTK J;  5M5W J;  2L0K A;  5EZH A;  1ZK8 A;  3HBL A;  4JP0 A;  3CCY A;  3WHC A;  3S1Q J;  1B8I A;  3ZOB A;  3B6A A;  2O8K A;  1JKQ C;  1NK2 P;  2LY9 A;  5IYC J;  2N8G A;  5GPC A;  2AHQ A;  3OIO A;  3C2B A;  1LFU P;  2ELK A;  2Y31 A;  5K7Z A;  2R5Y A;  2FJ1 A;  3M4O J;  2DMP A;  4NDL A;  5M3F J;  1HF0 A;  1ETX A;  2GBY A;  3IH3 A;  5FLM J;  1MSE C;  2EZI A;  5E3O A;  2O9L A;  2IEK A;  1BA5 A;  3SFI A;  2CU7 A;  5IP9 J;  1JGG A;  2DMU A;  2FD5 A;  4IEJ A;  3ZQF A;  2MW8 A;  4DZP A;  2HDD A;  1WH5 A;  3JRA A;  2AO9 A;  3W6V A;  5C44 J;  4JX4 A;  2P81 A;  5EDN A;  1JTX A;  4UUS B;  3A01 A;  3JRH A;  1ETY A;  3QQA A;  1B72 B;  3BR3 A;  4L5E A;  5DTD A;  1I6H J;  2LK2 A;  1FIA A;  2DA6 A;  3F0C A;  1TWH J;  2E2H J;  4MIM A;  3BQZ A;  2GLO A;  2H8R A;  3CMY A;  2COB A;  3GTQ J;  2EQR A;  1U9O A;  4DYR A;  2K9Q A;  1TWA J;  4DYC A;  5JLX A;  2WB1 N;  3ZQL A;  4ABZ A;  1RKT A;  5FKN A;  1B72 A;  5FKK A;  1RKW A;  2Y30 A;  4DYQ A;  1G2H A;  2WAQ N;  1TWF J;  1PUF B;  1OCP A;  3I4M J;  1Q1V A;  4A3I J;  5E3N A;  1ZTR A;  3ZQH A;  3GBG A;  4DW6 A;  2Y0S N;  4D5C A;  3ZQC A;  1FEX A;  2L7M P;  1LE8 A;  2JWT A;  3ZQI A;  4RDU A;  3GTG J;  2FQ4 A;  3S1R J;  3FIS A;  1ZGW A;  1QVT A;  2XRL A;  4BXX J;  3BR5 A;  5J1Y A;  3HKZ N;  1I50 J;  5EZG A;  2YU9 J;  3PO2 J;  2QCO A;  4J19 A;  3TP3 A;  3B6C A;  2LR8 A;  4FCY A;  1JJ8 C;  1IUF A;  4GFB A;  4A3B J;  1BJZ A;  3DEW A;  3FKI J;  1OCT C;  2L7Z A;  1WGX A;  1X2N A;  2L9R A;  3BTC A;  3HEF A;  2X48 A;  5HOD A;  2G0E A;  5M3M J;  2NVQ J;  1DU6 A;  3FK6 A;  3HGY A;  3H3V K;  1MBE A;  3PO3 J;  3G1O A;  2R92 J;  4CYC B;  4BKX A;  2HQ5 A;  5M5Y J;  4C3H J;  2XSD C;  5DS9 A;  3K2A A;  2LKX A;  4G12 A;  3BR2 A;  5IOZ A;  1D5Y A;  3G1M A;  5C4X J;  1JKR C;  3HOY J;  2HOS A;  1MH3 A;  5FLV A;  2OPT A;  4I6Z A;  1WCM J;  4M6V A;  3I4N J;  4S0H B;  3UKG A;  4M3F A;  2X6O A;  3O8H A;  4MO7 A;  3BG9 A;  5C3E J;  1GDT A;  2IAI A;  2EZL A;  2HOA A;  4LOC A;  1JT0 A;  1A6I A;  1H8A C;  1XG1 A;  2VKV A;  1A5J A;  2K40 A;  3OOU A;  4C3I J;  5FJ8 J;  2JN6 A;  1APL C;  2ID3 A;  1JUS A;  4A3K J;  1TWG J;  2CJJ A;  2VKE A;  1P7J A;  3Q3S A;  2LTP A;  3HOX J;  5M5X J;  4C2M J;  2K9S A;  4W97 A;  1MBK A;  4EEF G;  4D5F A;  3O8G A;  4A3M J;  2XGC A;  2I10 A;  1FJL A;  3HOW J;  2LP0 A;  2JA8 J;  2H1K A;  3A02 A;  4B4C A;  1RES A;  1P7I A;  2YUS A;  3OSF A;  2L7F P;  2KT0 A;  3IV5 A;  2KDZ A;  3CQZ J;  3GTM J;  3BQY A;  2E1O A;  4XIC A;  3CDL A;  4A93 J;  2JA5 J;  3NAU A;  3FIW A;  4MFD A;  2OF7 A;  1HDD C;  2ZB9 A;  2DA1 A;  3FK7 A;  3NAR A;  3GTO J;  1GV5 A;  3LSJ A;  2E19 A;  2R5Z B;  1HCR A;  1ETV A;  1YRN B;  4UUS A;  2HOT A;  4A3D J;  4QIW N;  4XK4 A;  1Y1V J;  2ID6 A;  3LNQ A;  4XID A;  1FIP A;  4A3E J;  2ECC A;  1Y1W J;  2XGD A;  4X6A J;  2D5V A;  2IBD A;  1ZR4 A;  3OSG A;  3S14 J;  1MBJ A;  3BG5 A;  2DMQ A;  4XRS G;  4BBR J;  4Y52 J;  2DA2 A;  5K7F A;  3QPS A;  3MKL A;  5JLW A;  3LSP A;  1I3Q J;  1AU7 A;  5FKO A;  1IRZ A;  3HOU J;  2YS9 A;  3BG3 A;  3BT9 A;  4MLO A;  1MBG A; 
#chains in the Genus database with same CATH topology
 1MBF A;  2LF8 A;  1WPK A;  4I99 C;  1FY7 A;  1FYK A;  2JA2 A;  2MGQ A;  1T56 A;  2E35 A;  1Y0N A;  2LYC A;  4G6D A;  2KHM A;  3LA2 A;  4TV7 A;  3TOB A;  1VND A;  3CJQ B;  1SEU A;  2RQP A;  2LY1 A;  3FHN A;  1N75 A;  1BOA A;  4OAY A;  5GP9 A;  1FBQ A;  3W2W A;  1WJB A;  1KQ8 A;  2A07 F;  3MZ8 A;  2RDP A;  2WWY A;  1U8B A;  2CUF A;  2B0L A;  3GFI A;  4LD5 A;  2J5O A;  1X4O A;  3E3V A;  1EKE A;  2LC2 A;  2L01 A;  4XQF A;  3PFY A;  3K7A J;  2IGN A;  5EG0 A;  1QZZ A;  2KKO A;  4UUT A;  4E7L A;  1DGR M;  4XRM A;  3MD2 A;  1MMD A;  1FNN A;  5IOY A;  1WWX A;  1KON A;  2EZH A;  1V5F A;  2A3S A;  2KPM A;  1V4R A;  1G6N A;  2EFQ A;  2MSY A;  1T39 A;  5LHH A;  2HPI A;  3BP8 A;  2DDB A;  4I0A A;  3H5N A;  3JCU C;  1POG A;  2E2I J;  4M3D A;  2OC6 A;  1SFO J;  3FMQ A;  5DYM A;  2F2E A;  2ZJR F;  3I58 A;  3BR1 A;  3OV8 A;  1BW5 A;  3GTJ J;  3K4K A;  3FMR A;  3S15 J;  3L00 A;  1NTC A;  2Z5U A;  2XRO A;  3HRT A;  2XGE A;  1QRY A;  3HSE A;  3VPR A;  4FET A;  3BG7 A;  3S3N A;  1V3F A;  2JA6 J;  4CCL A;  5HDG A;  4IPA A;  1RPW A;  3CF2 A;  5CVU A;  3DU5 A;  4GDF A;  2O8X A;  1JJ6 C;  3ZPL A;  2MD0 A;  3DLA A;  2M30 A;  2VC1 A;  2JMW A;  4D7N A;  4EM0 B;  5FFX A;  2O7O A;  1R4M B;  1ZN2 A;  2LH9 A;  2EFO A;  2DTZ A;  1ZGA A;  2V1X A;  4X1E A;  3JRE A;  2G9W A;  3FXM A;  4UVB A;  1U9N A;  4C3J J;  3W2A A;  3LOC A;  4G8X A;  5KAF C;  4D7M A;  1VQL I;  4IRI A;  2V1U A;  4BUP A;  1Z77 A;  1PYV A;  1UHS A;  2HKO A;  2GM4 A;  2R7X A;  2V6C A;  1ON1 A;  4XRS A;  2XHK A;  1W7P D;  4B43 A;  3QOP A;  5CVJ A;  5AIP A;  2RAE A;  3H5R A;  1W7P B;  3RQ4 A;  1WH7 A;  3H9G A;  1LFB A;  3GYH X;  3C2G A;  3SFZ A;  1Z7U A;  4AYB A;  1RRJ A;  4AYB N;  3GME A;  2DA5 A;  3R60 A;  4C30 A;  1U5T A;  1CQT A;  1I27 A;  2K27 A;  3SZG A;  3A01 B;  1VQN I;  3GTL J;  4KN4 X;  1ZKG A;  3DKX A;  3T5X A;  5J4V A;  2VOD A;  4LB5 A;  2V1D A;  3Q0W A;  3A4C A;  4YII A;  4RB2 C;  5IP6 A;  2F4O B;  2P4W A;  3HOV J;  1O7F A;  1AHD P;  1DGW Y;  2Q2E A;  2E7X A;  3G71 I;  4RM3 A;  2R7V A;  3TP0 A;  1TW2 A;  2P0W A;  2VN2 A;  4MFE A;  4IHY A;  2KIU A;  4L5I A;  3E5U A;  3HB9 A;  1MNE A;  5H2F C;  3F8C A;  1LVK A;  3IWF A;  1YIT I;  4HOB A;  4RB0 A;  3JRF A;  1YRN A;  3LQQ A;  3X2Q H;  2DYS H;  4RA2 A;  4BHC A;  4BBS J;  5IY5 H;  1IJW C;  5BOX A;  1T0F A;  2QSH X;  2DA4 A;  4G6T B;  2NVY J;  2VB6 A;  5EEA A;  4Z6Y A;  1W5S A;  1T2K A;  3K2Z A;  5J3L A;  4WF2 A;  5IYB J;  4ZDP A;  1RR7 A;  1X58 A;  3BCB A;  4HST A;  3S93 A;  1Q1H A;  4KA4 A;  3DCF A;  4CZZ A;  3HRM A;  2HQA A;  3FBN B;  1T38 A;  4DGW B;  1D0X A;  2NAZ A;  1BN5 A;  5FFZ A;  4O3M A;  4N9H A;  3DV8 A;  1UG2 A;  1ZQ3 P;  5HOO A;  2EH3 A;  5F0C A;  4RS8 A;  3CDI A;  3S2H J;  3FDY A;  3JRI A;  1HDP A;  4XLA A;  1IC8 A;  1R9T J;  3TO6 A;  2K5C A;  3MEX A;  4AC0 A;  4B09 A;  1KU3 A;  1AA7 A;  3HC7 A;  3QPL A;  3ZN1 A;  2W25 A;  1IDY A;  4WXH A;  5D8K B;  2PMZ A;  1H0M A;  3MZH A;  3F6V A;  5H6Q A;  2PMZ N;  2HYJ A;  3RI4 A;  3JTG A;  2V9V A;  3E5Q A;  3HTU A;  2ME0 A;  2ZJP F;  2EFP A;  2VQC A;  5HNF A;  5DCM B;  5F27 A;  4DZJ A;  5LGT A;  3SYT A;  3OYL A;  2STW A;  3CC2 I;  4HRI A;  4DIQ A;  1BM9 A;  1Y39 A;  2OBP A;  2XIG A;  4PSX A;  1K4T A;  3AG3 H;  3U9G A;  3I53 A;  3DTE A;  3AKZ A;  1EF4 A;  5FRN A;  3OYE A;  4F7Z A;  2VI6 A;  3CO6 C;  3TL4 X;  1NG7 A;  4M3G A;  4UB6 C;  2V79 A;  5LEK A;  2IS4 A;  3CCE I;  4CXF A;  2NOJ B;  1SVL A;  2XB0 X;  4RB3 C;  5LHG A;  5A2Q Z;  3JR9 A;  1X1D A;  1VQ4 I;  2XSJ C;  1XS9 A;  1DP3 A;  1W0U A;  2OUM A;  2VPR A;  4A3C J;  1F36 A;  5IT3 A;  2DT6 A;  3BR6 A;  4AID A;  1IDZ A;  3C2H A;  1IG7 A;  3R4K A;  5EZH A;  4HW0 A;  1XCB A;  1IN5 A;  3FXL A;  1D1A A;  3CCY A;  2IA2 A;  3WHC A;  4IOC F;  1VQ9 I;  1X1A A;  1XSD A;  1I1S A;  5K5R A;  1B8I A;  4IKF A;  3B6A A;  2YX7 A;  3S8P A;  3QWL A;  3WTS C;  5ICE A;  1XDS A;  2M8E A;  3E97 A;  3GZ5 A;  4NQW B;  1MDM A;  2AHQ A;  4A12 A;  1B9M A;  4A2U A;  1YTY A;  1LFU P;  1IXS B;  3FX3 A;  3C18 A;  2XF5 A;  3KP6 A;  5CYV A;  3DPT A;  4N4O B;  4V19 K;  4CHU A;  2IEK A;  5ICG A;  3ISP A;  1W7P A;  3K4N A;  1NHA A;  4IEJ A;  4ZYG A;  5D4R A;  1Y0U A;  2VOO A;  5HLT A;  3I5U A;  3ZQF A;  2O3F A;  2R7F A;  2HDD A;  3JRA A;  2AO9 A;  4U7B A;  4JX4 A;  1Z1D A;  1T8I A;  2LKS A;  3A01 A;  1N78 A;  4F52 A;  2BYV E;  3HZJ A;  2Q8K A;  2F5D A;  4OMZ A;  4BEH A;  1I6H J;  1XGO A;  1D3Y A;  1UHW A;  1TWH J;  2E5Z A;  3ELK A;  3GTQ J;  3L7W A;  2LNB A;  3D5L A;  4BXU A;  3QOE A;  1RI7 A;  2F4M B;  2JT1 A;  1MBG A;  5JLX A;  1LNW A;  4L9N A;  2VOP A;  2R3S A;  4GCV A;  1O7L A;  1XN7 A;  3OR1 C;  3GEZ A;  5FKK A;  1RKW A;  2Y30 A;  2KRC A;  2DBB A;  5A2Q K;  4E6K G;  2X1E A;  2BEO A;  1N25 A;  3I4P A;  1VZ0 A;  1OQY A;  2RNG A;  3GBG A;  5JVT A;  2VBX A;  4JBA A;  4LIT A;  3I3L A;  3ZQI A;  2PN6 A;  2ZJ2 A;  1FOX A;  3BOQ A;  3BR5 A;  4ZYH A;  1FSH A;  4UB8 C;  2BW3 B;  4RAY A;  4J19 A;  1WSU A;  5FRO A;  3WTU C;  4BAC A;  4CA0 A;  2WV0 A;  4A3B J;  2XAH A;  3FKI J;  3DXJ F;  3CUQ A;  5E8G A;  2ISZ A;  2D45 A;  2VQH A;  2L9R A;  3TGN A;  3KP3 A;  1MMG A;  1XX5 A;  4M71 A;  5M3M J;  2OV7 A;  3WE2 A;  4KIT B;  3DLL F;  3ROU A;  1MBE A;  2RC4 A;  2YX4 A;  3OYD A;  1K7A A;  1UZC A;  3LL7 A;  5M5Y J;  2XAG A;  1M1E B;  2HFH A;  4XM3 A;  3F23 A;  2F5E A;  3PSF A;  2XSD C;  2HEO A;  2KMU A;  4BQN A;  1S7O A;  5L3E A;  4BL0 B;  3SDB A;  4F3Q A;  3QYB A;  2M7B A;  4Q48 A;  1EJ9 A;  1R36 A;  1TP4 A;  1MH3 A;  4I02 A;  4P1W A;  5FLV A;  3OYH A;  4I6Z A;  4Q47 A;  5LGN A;  3KYD B;  1K6O A;  4ZDL A;  1EH8 A;  2X6O A;  1JHF A;  4I7H A;  4AM3 A;  3BG9 A;  5C3E J;  3OYC A;  1GDT A;  2IAI A;  3M7G A;  2EZL A;  2HOA A;  3GFL A;  1ZEL A;  2JVG A;  3HPG A;  1K4S A;  3R6S A;  5KVR A;  3KEY A;  2P8T A;  3FM3 A;  3RKW A;  3Q5F A;  3G3Z A;  1ZG3 A;  2P5V A;  3GCM A;  2VKE A;  3HOX J;  2VIX A;  5BMZ A;  4A0X A;  1HST A;  1QGP A;  4LG0 B;  3GZ6 A;  2K9S A;  2UXX A;  2XGC A;  3PSI A;  3HOW J;  1BR2 A;  2WC2 A;  1S3J A;  1F9N A;  4CDG A;  2P7V B;  3SZP A;  1FMV A;  2V7F A;  2ELH A;  3EYI A;  4I98 B;  2M4K A;  2O6G E;  1E3P A;  3DU6 A;  1IRX A;  1VQ5 I;  4RLF A;  3PNY A;  4NQW A;  4RGS A;  2HGC A;  1O3T A;  3F9K A;  5E1W A;  2E7W A;  2BVM A;  3CCS I;  5GAG J;  3E6M A;  3ZGK A;  4NC6 A;  3VFZ A;  5D5W B;  4A93 J;  3KP4 A;  2Z99 A;  3V8J A;  2CGP A;  1IXC A;  1ZLJ A;  1UCR A;  3BPX A;  5LBQ A;  1R1T A;  1YIJ I;  3HHG A;  3I56 I;  5DM7 F;  2VBY A;  3OY9 A;  3NAR A;  5H6R A;  3GTO J;  2HOE A;  3KZI C;  2HDW A;  3LSJ A;  1R71 A;  2CW7 A;  2LDU A;  3PUF A;  2DT5 A;  1QPM A;  1HCR A;  3CO7 C;  4WCG A;  1IXR C;  2R7T A;  2DK5 A;  1TW3 A;  2WA0 A;  3BWG A;  3A0B C;  2KIQ A;  3LSI A;  2V9K A;  4A0Y A;  1ODD A;  4QIW N;  4PFO A;  2IT0 A;  1ACI A;  1Y1V J;  1P92 A;  1FYL A;  2F5V A;  2ID6 A;  4XID A;  1Y1W J;  2A69 F;  2D5V A;  4PJN A;  3S14 J;  3SQN A;  1IN4 A;  2VE8 A;  3FWE A;  4XRS G;  4PK4 A;  3CCU I;  4XNF A;  2NNY A;  1FSE A;  1OCO H;  3CD6 I;  4A6E A;  5J6X A;  2GIZ A;  3VOD A;  2L9V A;  2HWV A;  2RV8 A;  3D5S C;  3KLO A;  4EM2 A;  4C2U A;  1AU7 A;  4PJJ A;  2EIM H;  2YS9 A;  4MLO A;  3JSP A;  2LFB A;  1ZR2 A;  1KYZ A;  2XV4 S;  5ED4 A;  4YIR X;  1X3Z B;  4XLH A;  1ZAO A;  4CCJ A;  4QTR A;  3CDH A;  4ZZL A;  3JRB A;  5D5V B;  3OL3 A;  5K7H A;  3T8R A;  4LLL A;  4MGR A;  4WXC A;  4XLP F;  3S17 J;  1FYM A;  2EJR A;  2YPR A;  5EG0 B;  4I0B A;  2K02 A;  2HYG D;  3B02 A;  4PDK A;  5DUK A;  4BJT A;  2F4I A;  1D1B A;  4XMY A;  4YG2 F;  1IGN A;  3LA7 A;  4RGU A;  4BQA A;  1ETW A;  5EEH A;  3LST A;  4RGX A;  5ICF A;  1MSF C;  2MFZ A;  1S29 A;  2GOM A;  1VQP I;  3BY6 A;  4AIH A;  1GLN A;  1HW2 A;  1TT5 B;  2BV6 A;  1X1C A;  5DM6 F;  3QPH A;  5F1J A;  1ZYR F;  4IHS A;  1QPI A;  2CQX A;  1TC3 C;  2M8G X;  1LQ1 A;  4IHX A;  3CC4 I;  1VQM I;  5K5Q A;  3KIO A;  1BL0 A;  3E7L A;  4UUV A;  3HPH A;  4FTH A;  5L3F A;  2KQR A;  1JKO C;  1UMQ A;  2K3F A;  2HU9 A;  1EH6 A;  2ME6 A;  3FMS A;  4BE0 A;  1MBH A;  4AVZ A;  3OWT A;  3W2V A;  2R7Q A;  2JUC A;  3ABL H;  1KZH A;  4NUB A;  1F4K A;  2PJR B;  2HS5 A;  5EEG A;  4UY8 I;  1Z9C A;  2DN0 A;  2PBI A;  4P9U A;  1Z3X A;  1YYV A;  2FNP A;  4G7H F;  5L3G A;  2HI3 A;  3S3M A;  2Z2S B;  1WI3 A;  1ZGJ A;  2D1V A;  3NWT A;  4G7Z F;  2CV1 A;  3BTJ A;  2FU4 A;  5IT9 Z;  1P9Q C;  4LMY A;  4XOR A;  1BR4 A;  2FQ3 A;  2QF7 A;  2ZFU A;  3SDG A;  3N4M A;  2K7L A;  4WX9 A;  2DPU A;  3CES A;  2QEX I;  4BH9 A;  1VFC A;  1TQP A;  1HKS A;  1U5T B;  2H8W A;  4K2E A;  2TCT A;  3JAM Z;  2CSO A;  2ZFW A;  4B47 A;  1GV2 A;  3IP4 B;  4PJL A;  2NS7 A;  4U87 A;  4HF2 A;  3ERM A;  4LG0 A;  4I76 A;  2EFN A;  3U1D A;  2O03 A;  1X1B A;  2BY0 A;  2V6E A;  2BXZ A;  4XLN F;  3I54 A;  1K61 A;  4D9J A;  1WJA A;  1TQI A;  2DOF A;  3K1M A;  1Y6I A;  1I6X A;  1NK3 P;  4A69 C;  2JA7 J;  4L0Y B;  4CUG A;  3MMY B;  3KCC A;  3E6D A;  3LAP A;  4HX7 A;  4MNU A;  3I0T A;  3VDX A;  4A3L J;  2HXI A;  1SAN A;  1WHU A;  1ETO A;  4NBQ A;  3CP8 A;  1Z21 A;  2XC7 A;  2CRG A;  2WAD A;  2WY8 Q;  3HM5 A;  1U0J A;  3QU6 A;  4EJV A;  3K70 C;  2MH2 A;  2DTR A;  1MIJ A;  3CZ6 A;  3L1P A;  1D5V A;  3RZD J;  4CYD A;  1X19 A;  1R6R A;  2DCE A;  2VXD A;  3NRV A;  2EPF A;  3HJE A;  5GTH C;  3IL2 A;  2XF6 A;  3EUH A;  4ZYE A;  5FKL A;  3FXU A;  4M3E A;  3OOP A;  1S8N A;  2Y0M A;  1J5Y A;  2WB1 A;  4OIN F;  3H36 A;  3D1N I;  1U6G A;  4MTD A;  4L18 B;  1L0O C;  5CPR B;  4EQQ A;  4N0B A;  4UVA A;  4PGG A;  3MCZ A;  4ZJZ A;  3E5X A;  5IT9 K;  2D2W A;  4R8H A;  2B63 J;  2GAU A;  2K9N A;  2AXL A;  1J09 A;  4E7K A;  4CCM A;  5JHF A;  2ZC2 A;  5ILV A;  2QWW A;  2ZXW H;  4BQO A;  1KYW A;  3C3W A;  3HRU A;  3JAM K;  2W7N A;  2K4J A;  4LGW A;  1I1G A;  1IUY A;  5FD6 A;  4XOP A;  5E3M A;  2NNN A;  3BDD A;  3CTA A;  3R0J A;  4BU2 A;  2OD5 A;  2OTJ I;  2ZSI B;  1R1U A;  1GVJ A;  4E4H A;  4BY7 J;  3PIO F;  3S2D J;  2VUM J;  4AU7 A;  1LPQ A;  4IHW A;  2PJP A;  2ISY A;  3BPV A;  5TIS C;  2XAQ A;  3EUH C;  1X4P A;  3CJR B;  5ICC A;  2VJ4 A;  4UNO A;  3Q0U A;  2XPV A;  4JK1 X;  1HXD A;  2LG4 A;  2IS6 A;  3WU0 A;  5AON A;  1XSX A;  3BRO A;  4JX5 A;  3FXR A;  2FBI A;  4DJA A;  2R7U A;  3RKQ A;  3W6J B;  2RKH A;  1MMS A;  2L4A A;  1XGN A;  3RYP A;  2J5P A;  1BBY A;  2Y2Z A;  3CCQ I;  2EA2 A;  1DP7 P;  3PNV A;  2CV0 A;  2RRE A;  1W36 D;  3HDD A;  2KZG A;  2XKO A;  2OQR A;  3IHU A;  2CUZ A;  2BY1 A;  4EJU A;  1OCC H;  4ZDO A;  4N9I A;  2M9H A;  4XKV A;  4P55 A;  1B8I B;  1IN8 A;  1JUM A;  2CH0 A;  3GFJ A;  2PJR A;  4Y4R A;  5F04 A;  5HNH A;  1O4X A;  1MDM B;  1T33 A;  1LDJ A;  1P4W A;  1FC3 A;  1FP1 D;  2DA3 A;  2DMT A;  1EV7 A;  3EYY A;  1WJD A;  3H5A A;  2L0K A;  5M5W J;  1ZK8 A;  2KFD A;  5TRD A;  1QO0 D;  1QBJ A;  1BI3 A;  4LLG F;  2XRN A;  2ESN A;  4DQ2 A;  3HRS A;  2PI0 A;  4JOM A;  2FML A;  3GFM A;  2KLO A;  4HNT A;  3ZOB A;  1W4M A;  1JKQ C;  3PIP F;  2LY9 A;  1B59 A;  3F8M A;  3WTT C;  2M3A A;  2MLG A;  2AXT C;  1WJC A;  2CWE A;  2ELK A;  4XKC A;  1A35 A;  3J81 Z;  4DBQ A;  2FXA A;  3K4B A;  2QQA A;  3ECO A;  3L2V A;  4LJZ F;  1ETX A;  4Y13 A;  3CJN A;  1V5E A;  4QPO A;  1MSE C;  1J9I A;  3WTZ A;  4BEH B;  1LJ9 A;  3DPL C;  1MD0 A;  4E7J A;  1JGG A;  4AD9 A;  1PJR A;  1TBX A;  5CKT A;  1PP7 U;  3LA3 A;  2P6S A;  4S05 A;  1WH5 A;  4ENN A;  4BDZ A;  2L54 A;  3PNT A;  2P81 A;  1JTX A;  3QP6 A;  3JRH A;  1ULY A;  1ETY A;  2FBH A;  2CQ7 A;  1ZH5 A;  4IQ4 A;  3KYC B;  1OPC A;  1QHH D;  1FIA A;  2GLO A;  3F0C A;  2E2H J;  3CMY A;  2DAO A;  4KMF A;  5F1R A;  1U9O A;  3FKJ A;  4DYR A;  4A6D A;  4DYC A;  3G6E I;  2VT2 A;  2RGV A;  3IUO A;  1MND A;  4HDV A;  4HYE A;  3ZQL A;  3LFU A;  2UV1 A;  3F8B A;  1GHC A;  3ASN H;  1G3T A;  3VYS B;  2G7H A;  1DPR A;  3U2R A;  3MKZ A;  5F6F A;  3OYK A;  2HQN A;  1I5Z A;  1RZ4 A;  1UHM A;  3BC8 A;  3H3U A;  4NNJ A;  2R7R A;  1OCP A;  3I4M J;  3L2C A;  1Q1V A;  2FBK A;  3J80 Z;  2QQB A;  5E3N A;  4IX7 A;  3ZQH A;  1IRG A;  2Y0S A;  2JVH A;  1AOY A;  2BZT A;  2Y0S N;  4D5C A;  4KT5 C;  3CUQ B;  1S9H A;  1FEX A;  4KIC A;  4QLC U;  1MW7 A;  3WTV C;  4B3X A;  2JWT A;  2FQ4 A;  3FIS A;  1V5G A;  2I5U A;  2EV0 A;  3KLN A;  2YU9 J;  3QAH A;  3L2W A;  1IW7 F;  3KEQ A;  3J81 K;  1JJ8 C;  1PP8 F;  4GFB A;  3I59 A;  1XCV A;  3K0L A;  3DEW A;  1OCT C;  2XGX A;  2L7Z A;  2DFF A;  4ASN A;  3HEF A;  1FPQ A;  2CUJ A;  5E1X A;  5HOD A;  2G0E A;  5DD4 A;  3QP5 A;  2JTV A;  3DBH B;  1DU6 A;  3FK6 A;  3HGY A;  2K85 A;  2FRH A;  3SEZ A;  4PSW A;  2QBY B;  1B9N A;  2VAS A;  2HQ5 A;  3CF5 F;  4C3H J;  4HG2 A;  4XR6 A;  5KAI C;  5DS9 A;  2MH9 A;  2X1C A;  3CCL I;  1H9G A;  3KFW X;  3M07 A;  3OL4 A;  4G12 A;  4B44 A;  3BR2 A;  4G9Y A;  5IOZ A;  2VT3 A;  3G1M A;  5BS6 A;  3F72 A;  2A68 F;  1JKR C;  1QHG A;  1TT0 A;  2XKP A;  2Y75 A;  2OPT A;  1TQM A;  2BVL A;  2KIF A;  1WCM J;  3TO9 A;  4BE2 A;  4L0Z B;  4S0H B;  1FOK A;  3LSH A;  3UKG A;  1WJE A;  4M3F A;  1YFH A;  3O8H A;  3V8L A;  4AVP A;  5B1B H;  2ELJ A;  2ZJQ F;  5TGT A;  3HHH A;  1Y8Q B;  3HSR A;  2VKV A;  2QM3 A;  3J80 K;  1FMW A;  4C3I J;  1G3S A;  4R79 A;  5FJ8 J;  1Z05 A;  2JN6 A;  3ABM H;  1APL C;  1QA6 A;  2M5W A;  3F8F A;  1JUS A;  1TWG J;  2V1N A;  3RTR A;  3RJP A;  1L3L A;  3SZT A;  3WU1 B;  4FX4 A;  3WTY C;  3M1E A;  3DWL E;  2CJJ A;  3AG2 H;  3CMA I;  1A36 A;  4PJM A;  1MBK A;  4EEF G;  2IP2 A;  4BGD A;  2RQQ A;  4D5F A;  3O8G A;  3RSN A;  5CQG A;  1FJL A;  3QRF F;  3J7Z I;  4KIG A;  5HDN A;  2ZCW A;  3CLQ A;  3A02 A;  3GUD A;  2WBM A;  4CCN A;  2ZNZ A;  3OSF A;  3P7N A;  3IV5 A;  1HKT A;  3CQZ J;  2K9M A;  3GTM J;  3OYG A;  4GYG A;  1WKM A;  3CLO A;  2OF7 A;  1U2W A;  2E71 A;  3F6O A;  5J40 A;  2CQK A;  4O6J A;  4XBF A;  1VQO I;  4ENJ A;  3K4J A;  1ETV A;  2EIJ H;  2LOO A;  3QOD A;  1R00 A;  3HUG B;  4KIF A;  2HOT A;  4ZYA A;  3HOS A;  3C1D A;  4YFK F;  1BC7 C;  2C6Y A;  4XK4 A;  4A3D J;  2GOX B;  3VOE A;  4A3E J;  2ECC A;  2AQE A;  4M6X A;  2W84 A;  2ZO4 A;  3EDP A;  2WTE A;  2OQG A;  4I2O A;  2DMQ A;  2ZXH A;  2IA1 A;  4HEA 2;  2VXZ A;  2KP6 A;  2Z1D A;  2W82 A;  2HYF A;  5F64 A;  2H1L A;  2OZU A;  3ZMU A;  1FBS A;  1YIO A;  2KIS A;  3ZMD A;  2QKL B;  2VJI A;  3LSP A;  5CQE A;  5LD2 C;  1I3Q J;  3LQR A;  3ZXS A;  1F43 A;  3BT9 A;  1R5G A;  5IP7 J;  3IH2 A;  4HF0 A;  4DOZ A;  4OWR B;  1IN7 A;  5CJ9 A;  3WGG A;  5HDK A;  2PX9 A;  3MZY A;  2EA4 A;  1W5C C;  3ZCO A;  4CCO A;  1AKH B;  1S5L C;  1IF1 A;  4UV8 A;  1D0Z A;  1V54 H;  4KIS A;  1JUP A;  2JSC A;  3O6B B;  1USS A;  5ERI A;  5HVQ C;  2OCE A;  4E7S A;  1DDN A;  3MFK A;  3G4S I;  1VQ8 I;  3WHB A;  1FWZ A;  4KUM A;  3IH4 A;  5BNG A;  1MJB A;  3KET A;  2M0C A;  3UNG C;  2R93 J;  2ADU A;  1T98 A;  2FSW A;  3G1L A;  1MZB A;  2JK3 A;  1WRJ A;  2X51 A;  1MMA A;  4OU0 A;  5LGU A;  5FRM A;  1J59 A;  2L5Q A;  5JI6 A;  3JRG A;  4UVC A;  4HLY A;  2P7C B;  2GXA A;  2QQ8 A;  1J0R A;  3I55 I;  1E0E A;  2XB5 A;  2M34 A;  2QBY A;  1OR7 C;  1IZ1 A;  1Y8R B;  4UV9 A;  4LIV A;  4Y33 A;  1MH4 A;  2PEX A;  4H0E A;  1S6L A;  1BIB A;  1X2M A;  3DF8 A;  4KJZ A;  1P2F A;  3WE3 A;  2IJL A;  1A6Q A;  3S16 J;  1DUX C;  1WVR A;  4Y17 A;  3CCR I;  2MC3 A;  2Y9Y A;  1MNM C;  3Q9S A;  3C7J A;  3TKY A;  1ETQ A;  1OYI A;  3DTI A;  2JJ7 A;  2QSF X;  3PM1 A;  3E1S A;  4W1U A;  4M72 A;  4M3B A;  4IRH A;  5L3B A;  1W0T A;  4L9T A;  4YEJ A;  4E70 A;  2R7S A;  2LVS A;  1FTZ A;  2XPW A;  3AL0 C;  4U7D A;  4XSZ F;  1VQK I;  1R23 A;  1UJ8 A;  2R5Y B;  4RBO A;  2ZME C;  3F8N A;  3JRD A;  2B9S A;  4J00 A;  2FX0 A;  4R1H A;  2H6C A;  3KPH A;  2XAJ A;  1Z7L A;  3Q0V A;  2Z33 A;  3V7R A;  1J7K A;  2HTS A;  1IV6 A;  2W1O A;  1S7E A;  1YE9 A;  2HZD A;  1JE8 A;  1IO2 A;  4DBR A;  1MKM A;  1ETK A;  2JRT A;  3GTP J;  2WY7 Q;  4M6Y A;  2Y9Z A;  3R61 A;  4BQQ A;  2GQQ A;  1R5I D;  2LD5 A;  5DD8 A;  2VLA A;  2WAF A;  1E17 A;  4ITV A;  3OYF A;  3DP7 A;  1GXP A;  4OIQ F;  1TLH B;  1QVU A;  3M3Y J;  2H09 A;  1Y56 A;  1SAX A;  2DJN A;  4CGZ A;  3JSO A;  3HL2 A;  4E7Z A;  2HXO A;  4F55 A;  1H88 C;  1JKP C;  4H4K C;  2CFX A;  2CQQ A;  2OZ6 A;  2QSG X;  4FQG A;  4FE7 A;  3OYB A;  3V42 A;  3SEQ A;  3HUG A;  5B1A H;  3KEO A;  3V4G A;  2X0L A;  3DKY A;  3RQI A;  4IQJ A;  5IYD J;  1YJW I;  1Z91 A;  2YU3 A;  3TW6 A;  3TO7 A;  2OU2 A;  2BBY A;  2IGM A;  1V55 H;  3FBI B;  4HBL A;  5FLX Z;  2XVC A;  2DXI A;  2MG4 A;  2K4B A;  1JT6 A;  1ZRC A;  2R7D A;  3FM5 A;  3DBR B;  5F08 A;  2EB7 A;  5E18 F;  3V8K A;  3D0S A;  2M2E A;  3BLY A;  4RGR A;  3WG7 H;  2H94 A;  1OFC X;  3GWZ A;  4BNC A;  3BTL A;  2IGO A;  3A03 A;  1U8R A;  2FOK A;  2EBI A;  4OIO F;  3DPU A;  1PVE A;  4JX6 A;  3S1N J;  1AKH A;  4M74 A;  1E3O C;  4NC7 A;  2DOE A;  4V2G A;  2Z16 A;  2M45 A;  3IC7 A;  5EGO A;  3RCO A;  2IXS A;  3PUB A;  3RIR A;  1FP2 A;  3COA C;  1H9T A;  4C2T A;  9ANT A;  2KJB A;  1YI2 I;  3GW2 A;  5ILU A;  2TDX A;  3HYI A;  4Q5S F;  3LAJ A;  3ZRG A;  5B3S H;  1SFX A;  4A3G J;  2HQR A;  3JW4 A;  4HLX A;  4P9F A;  3VEP A;  2DK8 A;  2L9N A;  1HOM A;  5EYR A;  4YIF A;  1P6R A;  3H0G J;  4Y7N J;  4B8X A;  4XLF A;  2D1H A;  2DMN A;  3ZQG A;  1T95 A;  2CS3 A;  2XDV A;  1J75 A;  2OTL I;  2IVM A;  1FTT A;  2M87 A;  1Z0X A;  1E3H A;  5DEQ A;  4OIR F;  1U78 A;  3KZY A;  1JI8 A;  4DNC A;  2OA4 A;  3W3C A;  3J7A O;  1OJL A;  4ZTJ A;  2EV5 A;  1P4A A;  4NHJ A;  3AG1 H;  5H20 A;  3RZO J;  2ZNY A;  5F0F A;  1K83 J;  3TED A;  2NOG A;  4EGZ A;  4HAM A;  5FLX K;  2LBF A;  1BOB A;  1DQU A;  1K78 B;  5FGM A;  4BHP A;  3K6G A;  1R49 A;  1YS7 A;  1RUO A;  1H89 C;  2R0Q C;  1GUU A;  3AFH A;  5FKM A;  2ZBK A;  4PGH A;  3HG9 A;  4U0V A;  3HXL A;  5HLG A;  3GTK J;  4ZH4 F;  3A2K A;  2DOA A;  2VQG A;  3GVA A;  4M9X A;  3GZN B;  4XOT A;  2BXY A;  1UFM A;  3HBL A;  4JP0 A;  4IZZ A;  4RLQ A;  2DDA A;  3VWB A;  5L3D A;  1R58 A;  3OYA A;  1OYW A;  2ZKZ A;  2N8G A;  3K9T A;  4UHT A;  5JHU A;  4LK0 F;  5GPC A;  1VTN C;  3OIO A;  5GAE J;  4CCK A;  2VON A;  2R5Y A;  2FJ1 A;  2KDO A;  3K4M A;  4NDL A;  5M3F J;  1HF0 A;  2CYY A;  3IH3 A;  5FLM J;  4LIU A;  2DJI A;  2EZI A;  4CH7 A;  1BA5 A;  2LRE A;  4QWQ A;  2MAB A;  1BIA A;  2CU7 A;  4U88 A;  5FD5 A;  5IP9 J;  3SHF A;  2FD5 A;  4BHB A;  3WGI A;  3MKW B;  2IW5 A;  2VBZ A;  3S2W A;  4MQ9 F;  3ZQ7 A;  3CUO A;  3W6V A;  4GRI A;  2OAZ A;  4L9J A;  2A6E F;  2AQF A;  4A5N A;  4GXO A;  2GIV A;  4UUS B;  3OIP A;  2DU9 A;  5BPD A;  3CCV I;  4IL6 C;  3QQA A;  1IAW A;  3FHZ A;  2V9P A;  1QZE A;  2RVC A;  4ENK A;  4AIK A;  5DTD A;  2MC4 A;  2LK2 A;  2DA6 A;  4IF4 A;  4ZYD A;  2LKP A;  4ZTF A;  3K10 A;  3BQZ A;  2H8R A;  1ZLK A;  3H3Z A;  2JRM A;  4OMY A;  3IWZ A;  2EQR A;  2LY2 A;  5CVV A;  2WB1 N;  3LFK A;  4UXN A;  4ABZ A;  3T1B A;  1RKT A;  2KIM A;  1EA3 A;  2JUG A;  5FKN A;  2GA2 A;  1B72 A;  3EET A;  4HF1 A;  4RMN A;  1R1V A;  1G2H A;  2M0M A;  2KRF A;  1TWF J;  5D6F A;  1PUF B;  2I8D A;  2ZXI A;  2HPM A;  4Y15 A;  4A3I J;  2UWM A;  1ZTR A;  3CMM A;  3MKY B;  1OLT A;  4YFX F;  4II2 A;  1QQI A;  2HTJ A;  3I59 B;  3M9A A;  2W00 A;  4WK8 F;  3ZQC A;  1XSV A;  4PJ0 C;  2DFH A;  3E6C C;  2UXN A;  2PMH A;  2L7M P;  3FXK A;  2W57 A;  1BC8 C;  3IRQ A;  3Q9V A;  4HSR A;  1QVT A;  2XRL A;  5J4Y A;  3LSM A;  1I50 J;  4YEL A;  2QCO A;  3B73 A;  2Q1Z B;  5K1Y A;  1A04 A;  3TP3 A;  2FEZ A;  4FCY A;  1HBX G;  1O3Q A;  3PQJ A;  1BJZ A;  1XMX A;  1G3W A;  4XL9 A;  1WGX A;  2F6C A;  1TL8 A;  3REO A;  3BTC A;  2X48 A;  1HKQ A;  5GAD J;  2DLL A;  1Z3Y A;  3PO3 J;  2FE3 A;  3CCJ I;  4CYC B;  4BKX A;  2BHZ A;  2E1N A;  2Z3Y A;  4OOI A;  2XF7 A;  2P6T A;  3K2A A;  3RPQ A;  3H9J A;  2LKX A;  3OYI A;  4CSW A;  1KQ9 A;  4G94 A;  4FX0 A;  1D5Y A;  1A31 A;  2O61 A;  1TZL A;  1G59 A;  2B7E A;  2HOS A;  1GXQ A;  1BI1 A;  3TBI A;  2HZT A;  3I4N J;  3CME I;  3KZZ A;  2FUG 2;  1RR8 C;  1BI2 A;  2HR3 A;  2FOW A;  4MEY F;  1A6I A;  1XG1 A;  1YX5 A;  1A5J A;  3OYN A;  3K4C A;  3S3O A;  4C9Y A;  3BCA A;  1PUE E;  3P5J A;  3F21 A;  1XB4 A;  4U0W A;  1RC9 A;  1K78 A;  3GO5 A;  5E8I A;  4A3K J;  4P5O A;  4RB1 A;  2VPL A;  1TTY A;  4OAZ A;  3BJO A;  2QUF A;  3DFG A;  2LTP A;  5M5X J;  1LFP A;  2F5C A;  3CP2 A;  3FXQ A;  4MTE A;  3H1C A;  5JVG F;  3I64 A;  4W97 A;  5KK1 A;  1PDN C;  4FT8 A;  4A3M J;  4RM2 A;  2I10 A;  3ASO H;  2LSO A;  4EGY A;  1S7A A;  2PMU A;  4GGG A;  2JA8 J;  1OKR A;  2CV2 A;  2H1K A;  3ZQQ A;  4IO9 F;  4M73 A;  3V7S A;  1P7I A;  2IGK A;  3HOT A;  2GXB A;  1OYY A;  5E79 C;  2A6T A;  2L7F P;  2V26 A;  1ZRE A;  2KDZ A;  2DI3 A;  4U0Y A;  2E1O A;  4EMS A;  4HPQ A;  4O5V A;  3NAU A;  3L2U A;  3FIW A;  3IKV A;  4MFD A;  2DW4 A;  4FHT A;  4F92 B;  1SC7 A;  1HDD C;  4EJW A;  3NQO A;  2ZB9 A;  2DA1 A;  4XKW A;  4Y3O A;  1Z67 A;  3W6K B;  4A0Z A;  3FK7 A;  4LB6 B;  1GV5 A;  2E19 A;  2MYS A;  2Q0O A;  2X1D A;  4EJO A;  3KP2 A;  2R5Z B;  3ML6 A;  3HIF A;  2A5W A;  4UUS A;  2K86 A;  3IAM 2;  2E1M C;  4IJA A;  4ESF A;  3LNQ A;  5HS9 A;  1FIP A;  1D0Y A;  1SD7 A;  5CVI A;  2XGD A;  4XN0 A;  2IBD A;  2W85 A;  2GXG A;  3K1N A;  3QU3 A;  3OSG A;  3O2P E;  3MQ0 A;  1MJA A;  2DPD A;  4L5J A;  3RPU D;  4Y52 J;  5E1Z B;  4BYY A;  5LRS A;  4J01 A;  2DA2 A;  3QPS A;  2JQ7 A;  2GWR A;  5JLW A;  2EIN H;  2VJJ A;  2CFO A;  3FXO A;  2ZXJ A;  3SXY A;  2HNH A;  1IRZ A;  5FKO A;  2E60 A;  3HOU J;  1KU7 A;  1ERD A;  3BG3 A;  3BZK A;  4XLC A;  3OMY A;  1PUF A;  2K3P A;  4EM1 A;  3H35 A;  2YR2 A;  2M7A A;  4GO1 A;  4KMU X;  1U5T C;  3BR0 A;  1YJ9 I;  2COM A;  4B3A A;  5K5O A;  1R5H A;  3ZN0 A;  5DV5 A;  1GT0 C;  3AL0 B;  1LKX A;  3BZC A;  2L02 A;  5F0H A;  4V2F A;  4ZC3 A;  1HC8 A;  3L9F A;  2PQ8 A;  3NWS A;  1YOV B;  1HLV A;  3UR3 C;  2ZME B;  3J7Y J;  2RNJ A;  1T6S A;  3OS2 A;  1HA8 A;  2QVO A;  3GLX A;  5EF6 A;  4II3 A;  2W24 A;  1F1Z A;  5E3L A;  2BE5 F;  1XD7 A;  3S1M J;  1JTY A;  1ZG1 A;  5J1U A;  3S32 A;  4CO8 A;  3WOD F;  2EIL H;  2CG4 A;  3V7C A;  1LB2 A;  1P4X A;  2QZ8 A;  3MN2 A;  1BJA A;  2R7W A;  4FAS D;  3D5R C;  2MBF A;  2NRA C;  2DT7 B;  2QA4 I;  2JSP A;  3TW7 A;  3ECH A;  1T0F C;  3N05 A;  4CYC A;  3HGG A;  1CGP A;  3A1Y A;  3K69 A;  2DQR A;  3TDU C;  1W5T A;  2EV6 A;  3DQV C;  4AWX B;  4ANJ A;  5DUI A;  3L09 A;  3AG4 H;  1VI0 A;  4QSH A;  3WGH A;  3CJT B;  3KX2 A;  3DEE A;  4G6Q A;  5LHI A;  4ON0 A;  2DQL A;  5B5E C;  2DFE A;  4QPQ A;  5E17 F;  1OMI A;  2QEN A;  3EUA A;  4B48 A;  4OIP F;  1MMN A;  2LF7 A;  3FZV A;  3QYE A;  1XDU A;  1QNT A;  3J7A Y;  1RIO H;  4IRG A;  1XTA A;  2VE9 A;  3MVP A;  3LSG A;  4RAG A;  5J47 A;  2F5F A;  1RET A;  2JZY A;  1DU0 A;  3LSK A;  4AUX A;  4RAF A;  4GYI A;  1AWC A;  1SMT A;  1SVM A;  2LRD A;  2KRH A;  4I01 A;  1SMY F;  2PLY A;  4A3J J;  3G73 A;  1YO5 C;  2NS0 A;  2DO7 A;  3F22 A;  2OCC H;  2JPC A;  4B1R A;  5L3C A;  4A3F J;  3R0A A;  4HNV A;  3NEU A;  2CMP A;  5LFA A;  4E7H A;  3WTX C;  2ESH A;  2WAE A;  1ITY A;  3JRC A;  4HQE A;  1XC5 A;  3K4L A;  2UZK A;  1SD6 A;  2E2J J;  3BTI A;  3DEU A;  1XMK A;  2BY3 A;  2UUZ A;  3KP7 A;  4PUS A;  5J1R A;  1ZAR A;  1G3Y A;  2NS8 A;  3VSL A;  2E34 A;  4KT6 A;  1NG6 A;  3K1P A;  2R7Z J;  1OCZ H;  4IHV A;  3AAF A;  2BGC A;  2JPB A;  1KQ0 A;  1K79 A;  1UG0 A;  2NVT J;  1NH3 A;  1IRF A;  1C0W A;  2P5K A;  4ESJ A;  5D4S A;  4HV5 A;  3PFI A;  1JXS A;  5D8L B;  3VYU B;  2LLK A;  2R5Z A;  4FE4 A;  4S04 A;  2G7U A;  1W36 C;  4EJT A;  4D1Q A;  2Y48 A;  1IN6 A;  1BW6 A;  4LG3 A;  5B66 C;  4KIB A;  3BJ6 A;  1B4A A;  2X9D A;  2EWN A;  5D5U B;  2ETH A;  3A0H C;  4PZJ A;  3EQL F;  4FIS A;  1OR7 A;  3HTS B;  4BJ5 C;  3QYF A;  3ZMZ A;  1F5T A;  2W48 A;  2NYX A;  1LE8 B;  1YX3 A;  5GPA A;  1LVA A;  1CF7 B;  1ORK A;  4I09 A;  2BY2 A;  1YG2 A;  3RPU A;  4XON A;  2CUE A;  3WU2 C;  1FX7 A;  1FZP B;  4F93 B;  2VJ5 A;  3ABK H;  5JFR A;  5EGO B;  5LRR A;  3SJM A;  2EK5 A;  2L9S A;  1MJ9 A;  3L2Q A;  4A5M A;  2XAU A;  5D6E A;  4Z2Y A;  2RN7 A;  1GVD A;  3IRR A;  1REP C;  3HOZ J;  3OR2 C;  1N77 A;  3O3K A;  1ENH A;  2XPU A;  3E6B A;  4BJ6 C;  3ERE D;  2EZK A;  1VQ7 I;  4JYK A;  1YW7 A;  3RDI A;  3GXO A;  1VF9 A;  5ILS A;  2CW8 A;  2L3D A;  4IXA A;  2Z9O A;  2ECB A;  2ZME A;  4BY1 J;  4X0G A;  2STT A;  2ZSH B;  3M1C A;  3L2R A;  2EIK H;  4PCQ A;  4E7I A;  1LEB A;  3U1K A;  4KFC A;  1B1B A;  1O3R A;  3VYT B;  1LEA A;  3E0J B;  5HS8 A;  4BE1 A;  3K70 D;  1STZ A;  4LK1 F;  2NVX J;  4XRF A;  5C4J J;  3OYJ A;  1R4N B;  1J2X A;  2W4S A;  1BR1 A;  5E20 A;  5IPA A;  5J8C A;  2LBF B;  1G4D A;  2F48 A;  1R7J A;  4AIJ A;  3LSR A;  4HA8 A;  5FO5 A;  4BS9 A;  3RKX A;  2WV1 A;  3RKY A;  4WWC A;  3ZMS A;  3ULQ B;  1R22 A;  2QGU A;  1OCR H;  3PL8 A;  4MQV A;  5DCM A;  2P5L C;  2PG4 A;  2VBW A;  1TWC J;  3MAJ A;  3U21 A;  4KNY A;  2E5N A;  2K9L A;  2VKD A;  1UEL B;  3ABU A;  2DA7 A;  1I3A A;  4XN3 A;  2TRT A;  1U3E M;  2YSR A;  4BAY A;  2A61 A;  4KDP A;  4CIC A;  5KHD A;  2XUB A;  2CQN A;  3N97 A;  3CUQ C;  5HLH A;  1QU3 A;  1SVO A;  4L9V A;  2O0Y A;  5CVR A;  3IKT A;  3S1Q J;  1ZRD A;  3WTW C;  3F3X A;  2O8K A;  2FA5 A;  2X85 A;  1NK2 P;  5IYC J;  1BI0 A;  1WQ2 A;  3QPT A;  2E36 A;  3H9Q A;  2ACJ A;  1D8J A;  2GA1 A;  3C2B A;  4XLE A;  2Y31 A;  5K7Z A;  4HX8 A;  3M4O J;  2DMP A;  2VL8 A;  2O5R A;  4HDU A;  4MEX F;  4EVI A;  1DPU A;  1HW5 A;  2GBY A;  3GX4 X;  1S72 I;  5E3O A;  4ESB A;  2O9L A;  3SFI A;  3VB2 A;  4N4N B;  4MHG A;  2DMU A;  2MW8 A;  4XSX F;  4DZP A;  1YW8 A;  1KU2 A;  1ON2 A;  1RNL A;  5C44 J;  3LMM A;  5EDN A;  1XGM A;  2GZW A;  2ICW G;  3M8E A;  2MLK A;  1K6Y A;  4HZF A;  2FMY A;  2PFB A;  2Y69 H;  5KNL A;  1B72 B;  3BR3 A;  2L7K A;  4L5E A;  3VYR B;  5LLQ A;  1UAA A;  1KU9 A;  2H6B A;  2M1B A;  1EH7 A;  1SAU A;  2QYO A;  3WG9 A;  1X1P A;  4MIM A;  3KP5 A;  2COB A;  3PQK A;  1UST A;  2K9Q A;  1TWA J;  1WJF A;  2X6Y A;  3VSK A;  3LWF A;  3G2B A;  1TNT A;  4LLN A;  5HLI A;  3FF5 A;  2QKM B;  3RYR A;  1Z6R A;  4HNU A;  2BOL A;  2DFI A;  4DYQ A;  1LDK B;  2QQ9 A;  4HX4 A;  2WAQ A;  2WAQ N;  4CZC A;  2NVU B;  3BG6 A;  4D0P A;  4BDY A;  5BQT A;  1KA8 A;  1LUJ B;  5GTI C;  1SFK A;  3DTK A;  3DKW A;  3ESW B;  3OS1 A;  4DW6 A;  3TMO A;  1I39 A;  3H0D A;  2EFW A;  2L2O A;  2L4M A;  4Q4Z F;  2HVS A;  5J8F A;  1LE8 A;  2X4H A;  3JTH A;  4RDU A;  1CF7 A;  3HKZ A;  4LFU A;  1T08 B;  4YRV A;  3ZR8 X;  3S1R J;  1ZGW A;  3GTG J;  4BXX J;  1D1C A;  3H92 A;  2IS2 A;  5J1Y A;  3HKZ N;  5CLS A;  5EZG A;  3PO2 J;  5EJC A;  1X3W B;  3KYL A;  1VQ6 I;  1HW1 A;  1FLI A;  3B6C A;  1G8X A;  2LR8 A;  3T8T A;  1IUF A;  2MA3 A;  3ZMT A;  1YJN I;  1YS6 A;  3OS0 A;  1X2N A;  3I71 A;  2MD5 A;  2X6X A;  1W1W E;  4PFP A;  3CC7 I;  2AS5 F;  4EAT A;  2BW3 A;  2NVQ J;  1WFX A;  1ONV A;  5JR3 A;  3H3V K;  4IVN A;  1D8K A;  3G1O A;  1KGS A;  1B6A A;  2R92 J;  1O57 A;  3FXJ A;  1XGS A;  2FF4 A;  4M9S A;  3CCM I;  2HVQ A;  4IHT A;  1WI9 A;  4HQM A;  4M9Z A;  2NXN B;  2DOD A;  1RUN A;  2A05 A;  2XAS A;  3ZMV A;  1YLF A;  2R7O A;  3BJA A;  1ZRF A;  1SD4 A;  1X3U A;  5D5X B;  3HOY J;  5C4X J;  1E2X A;  1WJ5 A;  5GAH J;  4M6V A;  1ZHF A;  3MWM A;  2M4G A;  1ZG5 A;  4ENM A;  2E1M B;  3HSF A;  2HKX A;  4MO7 A;  1FT9 A;  4NC8 A;  1XPX A;  1UB9 A;  3GLL A;  3P9C A;  1SFE A;  1SFU A;  1JHH A;  4LOC A;  5AIQ A;  3P9K A;  2FNA A;  1JT0 A;  1H8A C;  3I9V 2;  4XKB A;  1OIS A;  2KL4 A;  2K40 A;  2VKH A;  3OOU A;  4BXF A;  3OYM A;  2HVR A;  5HS7 A;  2XAF A;  2ID3 A;  1Z6T A;  1FOW A;  1YQA A;  2IA0 A;  5DCF A;  4IOA F;  5FB2 A;  2VQL A;  1P7J A;  3Q3S A;  4C2M J;  2IS1 A;  4ZZD A;  2E1C A;  3EUK L;  2LP0 A;  1SD5 A;  4EV0 A;  2A6H F;  4B4C A;  4KN7 X;  4RAZ A;  1RES A;  4F91 B;  2YUS A;  3IAS 2;  3TOA A;  4YFN F;  2R4G A;  2KT0 A;  4ETS A;  6PAX A;  2BHY A;  1FOY A;  3BQY A;  4JQF A;  2IPQ X;  3ZP5 A;  3ABT A;  4XIC A;  3ONQ A;  1IV8 A;  3CDL A;  1JGS A;  1LDD A;  2JA5 J;  2QLZ A;  2Q2E B;  3EPZ A;  3TQN A;  2OJE D;  4HV6 A;  3KE2 A;  1O3S A;  2KZV A;  3TDZ C;  5BPI A;  2V4J C;  2A5Y B;  1FBU A;  1MGT A;  3BZ6 A;  1XMA A;  4G7O F;  5KCM A;  1YW9 A;  2IRF G;  2X6W A;  4KYW A;  1HQC A;  2CW0 F;  1QZY A;  5DDG A;  1YRN B;  3P9I A;  1YHQ I;  4WXD A;  3T0Y A;  3PJR A;  5LEJ A;  4X6A J;  2H27 A;  1TNS A;  5TJJ A;  1WZ2 A;  1ZR4 A;  1MBJ A;  3BG5 A;  1HSJ A;  4P96 A;  3DBL B;  4BBR J;  2HDC A;  3OIQ A;  2LMD A;  5K7F A;  3MKL A;  4NB5 A;  2CO5 A;  2KJC A;  2DYR H;  3M8J A;  3GF2 A;  3M8F A;  2VC0 A; 
#chains in the Genus database with same CATH homology
 1MBF A;  5IP7 J;  2LFB A;  3IH2 A;  1ZR2 A;  1WPK A;  1PUF A;  2MGQ A;  1T56 A;  4QTR A;  3BR0 A;  1AKH B;  3JRB A;  4B3A A;  1GT0 C;  1VND A;  5K7H A;  5F0H A;  4V2F A;  1JUP A;  3S17 J;  5EG0 B;  1HLV A;  5GP9 A;  3WHB A;  3IH4 A;  5BNG A;  1IGN A;  5EF6 A;  1U8B A;  2CUF A;  2M0C A;  5E3L A;  1ETW A;  2R93 J;  1MSF C;  3S1M J;  3G1L A;  1JTY A;  2JK3 A;  5J1U A;  3K7A J;  5EG0 A;  3JRG A;  4UUT A;  3MN2 A;  4XRM A;  5F1J A;  1QPI A;  5IOY A;  3TW7 A;  2CQX A;  1TC3 C;  2EZH A;  2M8G X;  4IHX A;  2MSY A;  1BL0 A;  2XB5 A;  3E7L A;  2M34 A;  3HGG A;  4CYC A;  4FTH A;  1JKO C;  1POG A;  2E2I J;  4M3D A;  1UMQ A;  1SFO J;  1MH4 A;  2ME6 A;  1VI0 A;  1X2M A;  4QSH A;  1MBH A;  3BR1 A;  1BW5 A;  3GTJ J;  3S15 J;  3S16 J;  1NTC A;  2XGE A;  1QRY A;  3VPR A;  2Y9Y A;  1MNM C;  2DN0 A;  1ETQ A;  2JA6 J;  2JJ7 A;  3PM1 A;  3MVP A;  2HI3 A;  3LSG A;  1RPW A;  4W1U A;  1WI3 A;  1RET A;  1JJ6 C;  4M3B A;  1DU0 A;  3BTJ A;  1W0T A;  4AUX A;  1F43 A;  1FTZ A;  2JMW A;  2LVS A;  3SDG A;  2XPW A;  2QF7 A;  4D7N A;  2O7O A;  4A3J J;  2DTZ A;  3JRE A;  4X1E A;  1U9N A;  4RBO A;  4C3J J;  2R5Y B;  1VFC A;  3LOC A;  3JRD A;  2TCT A;  2FX0 A;  4B1R A;  4D7M A;  1Z77 A;  4A3F J;  1UHS A;  2GM4 A;  1GV2 A;  4XRS A;  3Q0V A;  2NS7 A;  1IV6 A;  4HNV A;  2RAE A;  4I76 A;  1S7E A;  1WH7 A;  1LFB A;  1K61 A;  1ITY A;  3JRC A;  1XC5 A;  1ETK A;  3GTP J;  4AYB N;  2DA5 A;  1CQT A;  2Y9Z A;  1NK3 P;  3A01 B;  2E2J J;  4A69 C;  3BTI A;  3GTL J;  2JA7 J;  1ZKG A;  5J1R A;  2LD5 A;  4A3L J;  2NS8 A;  2HXI A;  3Q0W A;  1SAN A;  1ETO A;  2R7Z J;  5IP6 A;  2CRG A;  3HOV J;  3HM5 A;  1AHD P;  4IHV A;  1QVU A;  3M3Y J;  3L1P A;  2DJN A;  3TP0 A;  3RZD J;  2NVT J;  4MFE A;  2HXO A;  4IHY A;  1H88 C;  1JKP C;  3HB9 A;  2CQQ A;  2LLK A;  2R5Z A;  4FE4 A;  4FE7 A;  5FKL A;  3JRF A;  1YRN A;  4M3E A;  1BW6 A;  2X9D A;  4BBS J;  3D1N I;  1IJW C;  3RQI A;  5IYD J;  3TW6 A;  2DA4 A;  4FIS A;  2NVY J;  5EEA A;  2W48 A;  2MG4 A;  1LE8 B;  5GPA A;  1JT6 A;  5J3L A;  5IYB J;  1ORK A;  1RR7 A;  2B63 J;  1X58 A;  3DCF A;  5F08 A;  2K9N A;  2CUE A;  2M2E A;  5EGO B;  3SJM A;  1UG2 A;  1ZQ3 P;  2EH3 A;  5F0C A;  3S2H J;  1OFC X;  1GVD A;  3BTL A;  3JRI A;  1HDP A;  3A03 A;  3HOZ J;  1IC8 A;  1R9T J;  2EBI A;  4AC0 A;  1ENH A;  5E3M A;  2XPU A;  4JX6 A;  3S1N J;  3QPL A;  2EZK A;  1AKH A;  1E3O C;  4JYK A;  4V2G A;  1IDY A;  4BY7 J;  1VF9 A;  2VUM J;  3S2D J;  4IHW A;  5EGO A;  2PMZ N;  2ECB A;  2HYJ A;  9ANT A;  4BY1 J;  2ME0 A;  3Q0U A;  2XPV A;  4A3G J;  5F27 A;  4DZJ A;  1HOM A;  5EYR A;  2NVX J;  3H0G J;  5C4J J;  4JX5 A;  4Y7N J;  2DMN A;  3ZQG A;  5IPA A;  3RKQ A;  1FTT A;  1Z0X A;  3LSR A;  1U78 A;  2WV1 A;  2Y2Z A;  3HDD A;  1EF4 A;  1OJL A;  1TWC J;  2VI6 A;  4M3G A;  3RZO J;  5F0F A;  1K83 J;  3TED A;  2NOG A;  2DA7 A;  2M9H A;  2TRT A;  1B8I B;  1JUM A;  1H89 C;  2XB0 X;  3JR9 A;  2R0Q C;  1GUU A;  5F04 A;  1XS9 A;  1O4X A;  5FKM A;  1W0U A;  1T33 A;  2VPR A;  4A3C J;  2DA3 A;  1F36 A;  2DMT A;  3BR6 A;  1IDZ A;  1IG7 A;  3GTK J;  5M5W J;  2L0K A;  5EZH A;  1ZK8 A;  3HBL A;  4JP0 A;  3CCY A;  3WHC A;  3S1Q J;  1B8I A;  3ZOB A;  3B6A A;  2O8K A;  1JKQ C;  1NK2 P;  2LY9 A;  5IYC J;  2N8G A;  5GPC A;  2AHQ A;  3OIO A;  3C2B A;  1LFU P;  2ELK A;  2Y31 A;  5K7Z A;  2R5Y A;  2FJ1 A;  3M4O J;  2DMP A;  4NDL A;  5M3F J;  1HF0 A;  1ETX A;  2GBY A;  3IH3 A;  5FLM J;  1MSE C;  2EZI A;  5E3O A;  2O9L A;  2IEK A;  1BA5 A;  3SFI A;  2CU7 A;  5IP9 J;  1JGG A;  2DMU A;  2FD5 A;  4IEJ A;  3ZQF A;  2MW8 A;  4DZP A;  2HDD A;  1WH5 A;  3JRA A;  2AO9 A;  3W6V A;  5C44 J;  4JX4 A;  2P81 A;  5EDN A;  1JTX A;  4UUS B;  3A01 A;  3JRH A;  1ETY A;  3QQA A;  1B72 B;  3BR3 A;  4L5E A;  5DTD A;  1I6H J;  2LK2 A;  1FIA A;  2DA6 A;  3F0C A;  1TWH J;  2E2H J;  4MIM A;  3BQZ A;  2GLO A;  2H8R A;  3CMY A;  2COB A;  3GTQ J;  2EQR A;  1U9O A;  4DYR A;  2K9Q A;  1TWA J;  4DYC A;  5JLX A;  2WB1 N;  3ZQL A;  4ABZ A;  1RKT A;  5FKN A;  1B72 A;  5FKK A;  1RKW A;  2Y30 A;  4DYQ A;  1G2H A;  2WAQ N;  1TWF J;  1PUF B;  1OCP A;  3I4M J;  1Q1V A;  4A3I J;  5E3N A;  1ZTR A;  3ZQH A;  3GBG A;  4DW6 A;  2Y0S N;  4D5C A;  3ZQC A;  1FEX A;  2L7M P;  1LE8 A;  2JWT A;  3ZQI A;  4RDU A;  3GTG J;  2FQ4 A;  3S1R J;  3FIS A;  1ZGW A;  1QVT A;  2XRL A;  4BXX J;  3BR5 A;  5J1Y A;  3HKZ N;  1I50 J;  5EZG A;  2YU9 J;  3PO2 J;  2QCO A;  4J19 A;  3TP3 A;  3B6C A;  2LR8 A;  4FCY A;  1JJ8 C;  1IUF A;  4GFB A;  4A3B J;  1BJZ A;  3DEW A;  3FKI J;  1OCT C;  2L7Z A;  1WGX A;  1X2N A;  2L9R A;  3BTC A;  3HEF A;  2X48 A;  5HOD A;  2G0E A;  5M3M J;  2NVQ J;  1DU6 A;  3FK6 A;  3HGY A;  3H3V K;  1MBE A;  3PO3 J;  3G1O A;  2R92 J;  4CYC B;  4BKX A;  2HQ5 A;  5M5Y J;  4C3H J;  2XSD C;  5DS9 A;  3K2A A;  2LKX A;  4G12 A;  3BR2 A;  5IOZ A;  1D5Y A;  3G1M A;  5C4X J;  1JKR C;  3HOY J;  2HOS A;  1MH3 A;  5FLV A;  2OPT A;  4I6Z A;  1WCM J;  4M6V A;  3I4N J;  4S0H B;  3UKG A;  4M3F A;  2X6O A;  3O8H A;  4MO7 A;  3BG9 A;  5C3E J;  1GDT A;  2IAI A;  2EZL A;  2HOA A;  4LOC A;  1JT0 A;  1A6I A;  1H8A C;  1XG1 A;  2VKV A;  1A5J A;  2K40 A;  3OOU A;  4C3I J;  5FJ8 J;  2JN6 A;  1APL C;  2ID3 A;  1JUS A;  4A3K J;  1TWG J;  2CJJ A;  2VKE A;  1P7J A;  3Q3S A;  2LTP A;  3HOX J;  5M5X J;  4C2M J;  2K9S A;  4W97 A;  1MBK A;  4EEF G;  4D5F A;  3O8G A;  4A3M J;  2XGC A;  2I10 A;  1FJL A;  3HOW J;  2LP0 A;  2JA8 J;  2H1K A;  3A02 A;  4B4C A;  1RES A;  1P7I A;  2YUS A;  3OSF A;  2L7F P;  2KT0 A;  3IV5 A;  2KDZ A;  3CQZ J;  3GTM J;  3BQY A;  2E1O A;  4XIC A;  3CDL A;  4A93 J;  2JA5 J;  3NAU A;  3FIW A;  4MFD A;  2OF7 A;  1HDD C;  2ZB9 A;  2DA1 A;  3FK7 A;  3NAR A;  3GTO J;  1GV5 A;  3LSJ A;  2E19 A;  2R5Z B;  1HCR A;  1ETV A;  1YRN B;  4UUS A;  2HOT A;  4A3D J;  4QIW N;  4XK4 A;  1Y1V J;  2ID6 A;  3LNQ A;  4XID A;  1FIP A;  4A3E J;  2ECC A;  1Y1W J;  2XGD A;  4X6A J;  2D5V A;  2IBD A;  1ZR4 A;  3OSG A;  3S14 J;  1MBJ A;  3BG5 A;  2DMQ A;  4XRS G;  4BBR J;  4Y52 J;  2DA2 A;  5K7F A;  3QPS A;  3MKL A;  5JLW A;  3LSP A;  1I3Q J;  1AU7 A;  5FKO A;  1IRZ A;  3HOU J;  2YS9 A;  3BG3 A;  3BT9 A;  4MLO A;  1MBG A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...