2HOAA

Structure determination of the antp(c39->s) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs diana, caliba, habas and glomsa
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
68
structure length
68
Chain Sequence
MRKRGRQTYTRYQTLELEKEFHFNRYLTRRRRIEIAHALSLTERQIKIWFQNRRMKWKKENKTKGEPG
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords ANTENNAPEDIA PROTEIN
publication title Structure determination of the Antp (C39----S) homeodomain from nuclear magnetic resonance data in solution using a novel strategy for the structure calculation with the programs DIANA, CALIBA, HABAS and GLOMSA.
pubmed doi rcsb
source organism Drosophila melanogaster
total genus 19
structure length 68
sequence length 68
ec nomenclature
pdb deposition date 1992-04-04

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00046 Homeodomain Homeodomain
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 2hoaA00
1X2MA 4ABZA 2LKXA 3JRIA 3GTLJ 4BKXA 2FJ1A 5JLWA 2DMNA 2L7MP 5FLMJ 3HDDA 4MFDA 3TEDA 2NVYJ 5K7ZA 1IC8A 1FTTA 1QPIA 4A3KJ 1BL0A 1FTZA 5IP7J 1JKPC 5GPAA 2G0EA 2EBIA 1U9NA 4A3BJ 3RZOJ 4XRSG 1ETYA 1AKHB 4A93J 2OPTA 2M0CA 3SDGA 3JREA 3HOWJ 3PO3J 3RKQA 4A3JJ 2YUSA 5F1JA 5JLXA 2E2HJ 5K7HA 5EG0A 3B6AA 5FKLA 2HOTA 1JUPA 5HODA 3HOVJ 2M9HA 1P7JA 1JKRC 3S15J 4M3BA 5IYBJ 2X6OA 1S7EA 3D1NI 5FLVA 1JT6A 3BQYA 5F04A 3WHBA 4C3HJ 2MG4A 2YU9J 5GPCA 5IYCJ 1X2NA 3S1QJ 1H88C 4DYRA 4C3JJ 1ETOA 2XPWA 3GTOJ 2PMZN 2NVTJ 2JA5J 1QVTA 1P7IA 3CDLA 1GDTA 2Y30A 2HOSA 3BR2A 3HB9A 1VNDA 2K9SA 4JYKA 1FEXA 3BR6A 3S14J 3MVPA 1RKWA 2R0QC 5IOZA 1QRYA 3K7AJ 4B3AA 3TW6A 3TP3A 2H8RA 1UG2A 1FJLA 2D5VA 1IDYA 4CYCA 5FKNA 4QIWN 2WV1A 3BT9A 1ZK8A 1HDPA 3DEWA 4W1UA 4XRMA 5J1UA 1ETQA 4L5EA 3LSJA 4MO7A 1MBJA 2CQXA 4G12A 2CUFA 3ZQHA 4DW6A 3BG5A 2X9DA 4X1EA 4A3CJ 3GBGA 1HOMA 4V2GA 2FQ4A 2O9LA 1I50J 3S1NJ 4HNVA 5E3NA 2AHQA 3HKZN 2MSYA 1OFCX 2LY9A 2KDZA 1XS9A 3S16J 5J1RA 2E1OA 3GTPJ 5EGOA 3C2BA 3ZQIA 5F27A 3LSGA 5K7FA 2OF7A 2ECBA 2XSDC 3HOXJ 1TWHJ 2E19A 2Y2ZA 2HDDA 2M2EA 1IUFA 5C44J 2JA6J 4QTRA 3DCFA 1MBGA 1HDDC 5DTDA 3G1MA 4C2MJ 3JR9A 1WI3A 3FK7A 5FKOA 4XRSA 3OSGA 5EYRA 1BJZA 1WH5A 1NK2P 4UUSB 4AUXA 1R9TJ 3FKIJ 2EZHA 1U9OA 1TWGJ 2YS9A 4W97A 5IPAA 2LLKA 3A01B 5M3MJ 5FKKA 1APLC 1A5JA 3WHCA 3QQAA 2XRLA 1LE8B 3HBLA 1CQTA 1WH7A 2R5YA 2I10A 1ZQ3P 1RESA 1XC5A 1T33A 3LSRA 1IG7A 2H1KA 5C4XJ 2MW8A 1W0UA 2ELKA 4LOCA 1MSEC 2LTPA 2NVXJ 2QCOA 3Q0VA 2L0KA 3CMYA 3M4OJ 4FTHA 3QPLA 1OCTC 2LK2A 2HXIA 4NDLA 2R5YB 5FKMA 3ZQGA 3I4NJ 5E3LA 1ETXA 5EEAA 1B8IA 4DZPA 3S1MJ 4DZJA 3G1LA 3Q0UA 1RR7A 2VKVA 3BG9A 1NK3P 2DA7A 3Q3SA 2GBYA 3JRBA 4IHYA 2R7ZJ 1H89C 2DA5A 2WAQN 1HCRA 1JKOC 2K9QA 2CU7A 3RZDJ 1FIAA 1MBKA 4D5FA 3JRCA 1BW5A 4V2FA 2W48A 3NAUA 2AO9A 3LOCA 4AYBN 2X48A 5EG0B 3O8GA 1OCPA 1I6HJ 3OIOA 1U78A 2O7OA 3GTJJ 3GTMJ 4EEFG 2TCTA 4A3IJ 3HOZJ 1JTYA 1Z77A 1IV6A 1JGGA 4Y7NJ 2QF7A 2L7ZA 2ECCA 3TW7A 4D5CA 1MH3A 4D7MA 1ENHA 5F0FA 3S1RJ 2HYJA 1JT0A 2HOAA 4FISA 1MBEA 2IAIA 3TP0A 4BXXJ 3S2HJ 2COBA 3Q0WA 2VI6A 1AHDP 1JTXA 3IH2A 3GTQJ 4JP0A 2IBDA 2TRTA 2DN0A 1MBHA 3M3YJ 2ME6A 1JKQC 2JA8J 2VUMJ 4CYCB 2DJNA 1LFBA 4FE4A 1TWCJ 2EZKA 3ZQCA 1YRNA 2ZB9A 5F08A 4C3IJ 3FK6A 1SFOJ 5J1YA 4XK4A 5BNGA 1IDZA 4MFEA 2R5ZA 1MNMC 3BR5A 2NS8A 3FIWA 5E3MA 5M5YJ 2E2JJ 4A3GJ 2Y0SN 4MIMA 4QSHA 3FISA 3IH4A 2K40A 4IHWA 4MLOA 3CQZJ 4M3DA 3HOYJ 5EZHA 1ZKGA 2M8GX 2Y9ZA 1WPKA 3H3VK 2ME0A 2LP0A 1ZTRA 5EGOB 1LFUP 1VFCA 1RKTA 2DA1A 2R93J 2JMWA 3JRHA 2L7FP 1VI0A 2O8KA 1HLVA 3UKGA 2XGEA 5F0CA 1Y1WJ 2VKEA 4I6ZA 1NTCA 4RBOA 1B72A 1BW6A 1ZR4A 1U8BA 4DYQA 2NVQJ 2EQRA 5C4JJ 1Z0XA 3GTKJ 1X58A 4BY7J 3SFIA 1PUFA 4D7NA 1E3OC 1POGA 2LVSA 2CUEA 4RDUA 1W0TA 1D5YA 2DMPA 3A02A 1MSFC 1MBFA 2DA2A 2DA4A 3L1PA 1F43A 1G2HA 3BR1A 1RPWA 2JWTA 4IHXA 2JN6A 4A3FJ 3ZQFA 3K2AA 1GT0C 3HM5A 3BTIA 1A6IA 2GLOA 1JJ6C 2CQQA 1ETKA 5M3FJ 1T56A 1EF4A 3PO2J 1Q1VA 3NARA 3LSPA 3HGYA 1DU6A 2IEKA 3OSFA 1JUSA 1AKHA 1VF9A 1SANA 4GFBA 3E7LA 3MN2A 2EH3A 1B8IB 3MKLA 1ETVA 4M6VA 1XG1A 4A69C 2HI3A 2Y31A 4X6AJ 1TWFJ 1BA5A 1UHSA 1I3QJ 5GP9A 2DTZA 4JX4A 1HF0A 4BBSJ 2B63J 2XGCA 1GV2A 4IHVA 1JJ8C 4A3EJ 1WCMJ 3BTCA 1H8AC 1TC3C 2MGQA 2FD5A 4FE7A 1ZR2A 3PM1A 4BBRJ 2ID3A 3IH3A 5IOYA 1FIPA 3BR3A 2LFBA 3RQIA 4XIDA 1ZGWA 1UMQA 4J19A 2JJ7A 2M34A 3F0CA 5EZGA 2EZLA 1ORKA 3A03A 1Y1VJ 4IEJA 1MH4A 3W6VA 3BQZA 2NS7A 5M5WJ 4JX6A 9ANTA 4FCYA 5IYDJ 1K61A 1GUUA 2FX0A 4B1RA 4B4CA 4A3MJ 2WB1N 2DMTA 2K9NA 5IP9J 2NOGA 2XB0X 3JRGA 5M5XJ 5FJ8J 4Y52J 3GTGJ 4JX5A 1IGNA 3I4MJ 2DMQA 1ETWA 5J3LA 4A3LJ 2XGDA 3BTLA 4UUTA 3JRFA 1K83J 1DU0A 1YRNB 4XICA 2CJJA 2LD5A 2JA7J 2P81A 4BY1J 3ZOBA 1GVDA 2N8GA 2LR8A 3JRAA 2XPUA 5EF6A 2R5ZB 3S17J 5EDNA 4A3DJ 4M3EA 2HXOA 5E3OA 3LNQA 2EZIA 2HQ5A 3OOUA 3HGGA 3VPRA 3S2DJ 2R92J 3H0GJ 3BG3A 3QPSA 2Y9YA 2L9RA 1O4XA 1GV5A 1JUMA 5DS9A 3B6CA 2KT0A 5IP6A 3BTJA 1ITYA 4UUSA 1TWAJ 4DYCA 3IV5A 2GM4A 2DMUA 2RAEA 1AU7A 4AC0A 3O8HA 3BR0A 3HOUJ 3A01A 4I76A 1B72B 1RETA 3SJMA 1QVUA 3CCYA 3G1OA 1OJLA 4S0HB 2JK3A 1IJWC 2CRGA 2DA3A 2DA6A 3HEFA 2E2IJ 2ID6A 2VPRA 1IRZA 1LE8A 1PUFB 1F36A 3JRDA 5C3EJ 4M3GA 3ZQLA 4M3FA 2XPVA 5F0HA 1WGXA 2XB5A
chains in the Genus database with same CATH superfamily
4ABZA 3JRIA 2X0LA 1USSA 4HV5A 2E1MC 3MZ8A 3HOSA 3E6DA 2DMNA 1SMTA 3WU1B 3FMQA 4MFDA 2E5NA 4B09A 2A68F 1K78A 1MIJA 4A3KJ 1FTZA 2GAUA 2WC2A 2X6YA 1JKPC 3RZOJ 4XRSG 1ETYA 5K5QA 3WG9A 4IKFA 4KYWA 5D8LB 1B6AA 3W2VA 3HOWJ 3QU3A 3GVAA 2LKPA 3GCMA 5F1JA 1I1SA 2E2HJ 3E1SA 1PDNC 2P6SA 5DCFA 2M87A 3MKYB 4LK0F 4HNUA 3S3MA 3EQLF 2WAQA 1JKRC 1C0WA 3CJQB 3LA7A 4G9YA 1EV7A 2Z16A 1E3HA 4PCQA 5LHIA 4CHUA 5F04A 4FETA 3QRFF 2BZTA 3RPUD 4M73A 3WTXC 2W25A 4F3QA 5ICFA 2BXZA 5GPCA 3BJOA 1X2NA 1YO5C 3GZ5A 2GXBA 2R7QA 2A5WA 4DYRA 1FP2A 4LLLA 2COMA 6PAXA 1VNDA 4XQFA 2CV0A 2K9SA 4PZJA 4PJMA 3U1KA 3J7AY 3S14J 3U1DA 1H9TA 1WRJA 1Y56A 3KP3A 3SEZA 4MEXF 2KIFA 3TO7A 3TW6A 3OYEA 2L9SA 2MD5A 1FJLA 4FASD 3ZMVA 3KP7A 3ZPLA 1ZRFA 1YIJI 3ERMA 3WODF 4E4HA 1REPC 3RYPA 4MEYF 5HLHA 1LUJB 3BC8A 2UZKA 5E8GA 4UVAA 4L9VA 2HDWA 1B4AA 1J7KA 5IY5H 4XRMA 1UCRA 5J1UA 1OCOH 2M45A 2V1NA 2FE3A 3I4PA 2K02A 2CUFA 2O3FA 3GLXA 4X1EA 2XRNA 4LIVA 4BJTA 4IRHA 3GMEA 4V2GA 2FQ4A 4YFXF 3CDIA 3E5XA 5LEJA 1QO0D 2H1LA 1DP7P 2K3PA 4HNVA 2NVUB 4CZZA 4B8XA 1T0FC 4ZYDA 3GTPJ 2E36A 3C2BA 2XAJA 2QBYA 3ZN0A 3I55I 4BEHA 1U8RA 3N97A 3OYCA 2BHZA 3HOXJ 2HDDA 4RM2A 3KX2A 2XC7A 2JA6J 3ZN1A 1VTNC 1BI3A 3BP8A 1HDDC 5DTDA 3F3XA 4HYEA 4I02A 4YELA 2RQQA 3MQ0A 1WI3A 3MZYA 4XRSA 2VB6A 3ABMH 3VEPA 4XSXF 2DU9A 3H5NA 3DXJF 4AUXA 2DOEA 1BM9A 3OWTA 1TWGJ 2VE8A 2ZNZA 3A01B 1G3WA 4OINF 1SFUA 2C6YA 4OU0A 2HQAA 2Z33A 2JPCA 3WHCA 1J0RA 2OZ6A 2Q8KA 2XRLA 2HU9A 3ECOA 4RAYA 5CYVA 2FU4A 1LE8B 5J6XA 3OYAA 4UUVA 2QENA 2I10A 4RB3C 5KK1A 4CUGA 5A2QZ 3R0JA 2VXZA 2KPMA 3HUGB 3MEXA 4I09A 3SYTA 3FHZA 4JBAA 2XAQA 3CTAA 1CF7A 2L0KA 4UVBA 2GOMA 1OCTC 1FBUA 3K4LA 3OYGA 2LK2A 1T39A 3BWGA 2R5YB 2LY2A 2B7EA 4ZH4F 1XMAA 4G8XA 3COAC 4AIJA 3DU6A 2EILH 4DZPA 3Q0UA 3IKTA 2DA7A 2E5ZA 3Q3SA 4IHYA 1XMXA 1WJFA 4IHSA 3IRQA 3ABLH 2L4MA 4CGZA 4BL0B 1R49A 2X51A 5L3CA 2D45A 4AM3A 4D5FA 2E1MB 3DEUA 1BW5A 2Q2EA 1FSHA 2BY2A 2WA0A 2W48A 2KL4A 3HJEA 3NAUA 2MH9A 2OC6A 1VQPI 2ZBKA 4RA2A 2X1CA 4EGZA 1A31A 1UB9A 4C2UA 4HSTA 3ONQA 3GTMJ 2XIGA 4A3IJ 2FNPA 2LC2A 5E18F 3C7JA 3BY6A 2P0WA 2L7ZA 2IA1A 2VJ5A 3IC7A 4PSWA 4IQ4A 2FOWA 3CUOA 4PUSA 3S1RJ 2VOOA 2GXAA 3FBIB 1QQIA 3E5QA 5FFZA 1ZHFA 4IO9F 4BXXJ 2GZWA 2PQ8A 1TTYA 2RREA 3Q0WA 1P6RA 2F48A 3KZIC 4II2A 3GZ6A 2ZC2A 2KLOA 1QNTA 2L9VA 4L5IA 2DCEA 4C9YA 3TKYA 2OUMA 4I2OA 4B3XA 5DDGA 1Z9CA 3M3YJ 3BJAA 3DU5A 3S93A 4ZJZA 4KMUX 3GWZA 1ZGAA 2WADA 2W24A 2YPRA 2MLGA 5ILUA 2QKLB 3AFHA 3SFZA 2R7WA 4B47A 1YRNA 3OR2C 1SVLA 4CXFA 4OIPF 1W7PA 1X1AA 4CCLA 2VQCA 4Y15A 1N25A 2OU2A 4IPAA 4JOMA 1SD6A 1SVOA 4EGYA 4XLHA 4YIRX 1FOKA 4OIQF 3EUHA 3IWZA 2KIQA 4P1WA 2DPUA 2JQ7A 4MLOA 1HC8A 2V79A 4Y3OA 3HOYJ 1XGMA 1ZKGA 2OAZA 1WPKA 1RRJA 4AIHA 2QLZA 1R1TA 1F4KA 2LP0A 5EGOB 4M9ZA 5DYMA 3H92A 1J5YA 1K4SA 2J5PA 3V8KA 4HEA2 1MJ9A 1G3SA 5IT9Z 1DP3A 3KEQA 4N9HA 3DP7A 5JI6A 1Y1WJ 4O6JA 4XLEA 2BYVE 5JHFA 1KYZA 1U8BA 2BXYA 3I58A 3DPLC 3CC4I 4MHGA 3ASNH 4EJVA 4HLYA 1MJAA 4RGUA 1Z0XA 5E1WA 1I1GA 3SFIA 4ENJA 1KU3A 1Y0UA 4FQGA 4EQQA 3J80Z 1UFMA 2AQEA 2CH0A 3K6GA 3KP4A 1PUFA 1OCRH 1RR8C 1BI0A 5J8CA 4BYYA 1KU2A 1I39A 2CUEA 2DMPA 3A02A 5B5EC 5DCMB 2OTJI 3OYIA 1WJEA 3KPHA 4MQVA 4PSXA 4Y4RA 3TO6A 4L5JA 2X4HA 1G2HA 3BR1A 5D5VB 2JWTA 4IHXA 3AG1H 2M4KA 3K2AA 4ANJA 2CQ7A 4XKCA 4PGHA 1X1CA 4M6XA 4KN4X 4N0BA 1Q1VA 3OIPA 4ZYGA 2KIMA 2DI3A 3LSPA 3IP4B 1VZ0A 2QSFX 5KHDA 5LHHA 1SANA 5FFXA 5EEGA 3MN2A 4PJLA 2EH3A 1JHHA 1B8IB 4XKVA 3S3NA 1F5TA 3AG4H 2HI3A 3LQRA 2ISZA 3BPXA 2VXDA 4PDKA 5D8KB 5KCMA 4OOIA 1JI8A 3ELKA 2ESHA 4JX4A 5CVIA 1HF0A 3I54A 2IS2A 2XGCA 1V55H 3DBRB 3KYCB 5LRSA 1ZYRF 1TNTA 2DOAA 3HHHA 2LNBA 3TBIA 2XAHA 3K1PA 4RLQA 2ID3A 3G73A 2VE9A 3CLOA 3BR3A 3PFIA 4KN7X 2LFBA 3RQIA 3CUQB 1E0EA 1QZYA 3JTGA 1Z67A 4A5NA 1I3AA 1W5TA 5FRNA 1MH4A 4EM1A 4YRVA 3BQZA 2CUZA 2X1EA 1Y6IA 3H36A 1UJ8A 1MNDA 1EH7A 2F5EA 3K4BA 4HG2A 2H09A 3GEZA 3M1EA 4XKWA 9ANTA 1XGNA 2QZ8A 4A3MJ 3OMYA 1OCZH 5LGNA 2DMTA 1KYWA 5F6FA 4BQOA 3I3LA 2VBXA 3MAJA 5M5XJ 1IO2A 4Y52J 3GTGJ 5JFRA 1IGNA 2O8XA 5DUKA 2QWWA 2FMYA 2E60A 1YYVA 3SEQA 2G7UA 2XF7A 2H6BA 1MD0A 3CJNA 3RTRA 3M8EA 3JRFA 3PL8A 2R7UA 2MD0A 5DV5A 4XICA 1D0YA 1KZHA 2JA7J 4BY1J 4PJNA 1LJ9A 4P55A 3ZOBA 1E3PA 1FSEA 2LR8A 3S17J 5EDNA 3PIOF 4M3EA 5CQEA 2XDVA 1WWXA 4BXUA 2HQ5A 3OOUA 4F93B 3S2DJ 1BC7C 1K7AA 1K6OA 3BG3A 2A05A 3SZTA 2L9RA 1JUMA 4O5VA 1GLNA 1GVJA 3CO7C 3AG2H 2RV8A 1S5LC 5J40A 2RAEA 1YW8A 4ENNA 1TQMA 4AC0A 3BR0A 1T0FA 3OYJA 1VQ4I 5JVTA 4XOPA 4QPQA 4S0HB 1LEBA 1O7FA 3FXQA 3HEFA 4A5MA 1IRXA 2ID6A 2NAZA 2VPRA 4CCMA 4EJWA 4BE2A 1MMSA 1ZAOA 4QWQA 4LB6B 1OMIA 3FXMA 4I0BA 3G3ZA 3V7SA 3DKXA 1IN4A 2MYSA 1XD7A 2VLAA 1W36D 1RUNA 2QSHX 5F0HA 4EM2A 2W4SA 2BW3A 4EM0B 1X2MA 1UZCA 3PSIA 4XLNF 3GTLJ 1B1BA 2ZJPF 3REOA 4J01A 1W7PD 2IT0A 5JLWA 1OR7C 5GAEJ 3HDDA 1SVMA 5H2FC 4BE0A 2Y0MA 3OL3A 3W2WA 1XX5A 4ZYHA 5IP7J 3GZNB 5GPAA 2EBIA 3RKYA 1U9NA 3F6VA 4EMSA 4A3BJ 1Z7LA 3WU2C 4A93J 3P9KA 2OPTA 3JREA 5LRRA 1FT9A 5JLXA 3GW2A 5K7HA 3K4JA 5DEQA 3CDHA 3B6AA 1YE9A 2KJBA 3ZRGA 1QA6A 2HOTA 5HODA 4QLCU 3HOVJ 4ENKA 3GXOA 3BZ6A 2FA5A 5IYBJ 4PK4A 1SAUA 2M0MA 1L0OC 1S7EA 3KZYA 1W5SA 2VL8A 2ZKZA 3O2PE 5CPRB 3WHBA 2IPQX 4LD5A 4F55A 3I59A 2MG4A 1USTA 4AYBA 5IYCJ 1DGWY 2CUJA 1HSJA 3S1QJ 2ZJ2A 2Z9OA 3GTOJ 2XPWA 2PMZN 5E8IA 2R7TA 2OTLI 2HOSA 3CDLA 3L2CA 2Y30A 5B1BH 3UNGC 3G6EI 1GDTA 5KNLA 3M1CA 3K70D 1YW7A 3CESA 3F8MA 2RNJA 3A0BC 1RKWA 1V5FA 3K7AJ 4G6TB 2QSGX 1LKXA 1W5CC 2OV7A 2WV0A 2MLKA 3DTIA 1U5TC 3NEUA 1QHHD 4HQMA 5FKNA 4CYCA 2WV1A 1SFEA 4WCGA 4M9SA 2HVRA 1AOYA 1P4XA 4KIGA 3OYNA 1N77A 1YRNB 4E70A 4F52A 4BHCA 3HXLA 2FSWA 5H6RA 4L5EA 4BE1A 3LWFA 3OOPA 2DPDA 4A3CJ 3DBHB 1HKTA 3VFZA 4ENMA 1FMVA 4FT8A 2FXAA 2HS5A 2BVLA 3CC2I 4UV9A 3V8LA 5E3NA 1OYIA 2MSYA 3S16J 1LDJA 3H1CA 2ISYA 5J1RA 2V1DA 1QGPA 2E1OA 2KQRA 5JVGF 3HRUA 3G2BA 2V7FA 2OF7A 2ECBA 3FXLA 2CWEA 2XSDC 3HPHA 1QZZA 1TWHJ 4GO1A 2E19A 5DUIA 2B9SA 3VYRB 2XVCA 5KVRA 3EDPA 2GA2A 3DCFA 1HW2A 2L02A 3FM3A 5HLGA 3G1MA 4C2MJ 5FKOA 3CD6I 4IOAF 4ZZLA 2VT2A 4L9NA 2BBYA 4X0GA 4ZZDA 4UUSB 3HRSA 3R61A 5E1ZB 5D6EA 3G71I 1XGOA 4NNJA 5D5XB 5HVQC 4W97A 1Z7UA 5LLQA 2LDUA 4C30A 1A5JA 1G59A 1B9NA 2DLLA 2IRFG 2VBYA 4YFKF 4DOZA 5JHUA 1P4AA 1IN7A 1WH7A 3CC7I 4FX0A 5HDKA 1ZQ3P 1XC5A 4XRFA 1R5ID 2HYFA 2Z3YA 2K9LA 4LOCA 2KJCA 2NVXJ 2FBHA 4HAMA 4Y33A 3F23A 3CMYA 3M4OJ 2P8TA 4RGRA 2CQNA 3N05A 5CLSA 3V7CA 4NDLA 1FOXA 4RAGA 2ZJQF 1S6LA 4J00A 2VOPA 2Q0OA 3R4KA 4DZJA 3MMYB 3BG9A 1NK3P 2GBYA 3JRBA 2MBFA 3MFKA 1FNNA 4NQWA 3RZDJ 1OYYA 2I5UA 1FIAA 1KU9A 3E97A 3BOQA 1OISA 3JRCA 1V54H 2Y48A 4P5OA 1VQKI 2AO9A 2RC4A 3LOCA 3ZQQA 3TO9A 5EG0B 4IVNA 3O8GA 1FLIA 2K27A 1YOVB 4HA8A 1D1BA 3IHUA 2VKHA 2FUG2 4LG0B 2IW5A 3GTJJ 1NG7A 1ON2A 3MZHA 4EEFG 2P5VA 1U0JA 4I99C 1YHQI 4RM3A 4Y7NJ 1Z05A 3TW7A 1WKMA 4D7MA 2Z5UA 3RDIA 1JT0A 4BNCA 2HOAA 2HPMA 2L01A 1SD7A 2OCEA 4KIBA 1IRGA 3JSPA 1YG2A 1K6YA 3S2HJ 4AIKA 1EH8A 3U9GA 1LQ1A 4BU2A 1STZA 1IXRC 3DLLF 1JTXA 4V19K 2ZFWA 1I5ZA 5ILVA 2NS0A 2I8DA 3FMRA 4HBLA 2E7WA 4XM3A 3O3KA 3GTQJ 2IBDA 1O3QA 4CZCA 2ZFUA 2NYXA 2QQAA 2F5FA 4FE4A 2DK8A 1MMGA 2D1HA 2G9WA 5GAHJ 2EZKA 2W85A 5D4RA 1IRFA 3DEEA 2VJIA 2ZB9A 5F08A 3CCVI 3L2QA 3KE2A 3B02A 2VKDA 4LJZF 1MDMA 2P6TA 4DQ2A 5ICEA 2XROA 1IDZA 4Q47A 4CCKA 2R5ZA 3FIWA 4IJAA 3VSLA 1IXSB 2IGNA 2R4GA 2ZO4A 1U5TB 2XGXA 5M5YJ 2E2JJ 2Y0SN 3K4KA 3R6SA 4IHWA 3OYKA 4ZDOA 1IF1A 3WTSC 2FBKA 1OLTA 1EKEA 4N4OB 1TT0A 5EJCA 1ZTRA 2LMDA 3C18A 3N4MA 4EJTA 1HW1A 5F1RA 4Q48A 3H5RA 1UHMA 2DDAA 2VC0A 4WF2A 5A2QK 2DO7A 2EFPA 2R93J 2K7LA 4GYGA 5FROA 4CH7A 2L7FP 1VI0A 3JRHA 2XGEA 4HDVA 3PQJA 5J4VA 4I6ZA 2LOOA 1NTCA 5CQGA 3F22A 1QU3A 4IXAA 1ZR4A 4DYQA 2K86A 1WJCA 3JAMZ 3OY9A 4BY7J 4RLFA 4YFNF 4XL9A 2NOJB 2M7AA 3AL0B 2VASA 3KIOA 1YI2I 4YIFA 5FD6A 1LPQA 3PJRA 2VQHA 2Z99A 1E3OC 1VQ9I 2LVSA 3BCBA 4I7HA 2XASA 1Z6TA 1MSFC 3L1PA 1FOYA 2A3SA 3EPZA 1XB4A 2X1DA 4II3A 2JN6A 2BY0A 4A3FJ 3UR3C 1GT0C 2UWMA 2VBWA 4ZTFA 1A6IA 4LMYA 4R79A 1JJ6C 2CQQA 2ICWG 4U0WA 4RMNA 3HTSB 2LYCA 5M3FJ 1UAAA 3I56I 3FWEA 3RCOA 4KUMA 5AIPA 3NARA 1DU6A 2IEKA 1LEAA 2A61A 2NNYA 3GUDA 4BQNA 2HTJA 1D0ZA 3CUQC 1VQ8I 4BHBA 4EATA 3LQQA 3H5AA 3MKLA 1ETVA 3ZP5A 1XG1A 1PYVA 1XCBA 1O7LA 5HNFA 1W1WE 1BA5A 4UB8C 1VQ5I 3JW4A 2VQGA 3CMEI 2DTZA 2IA2A 2PEXA 1TZLA 4A3EJ 1H8AC 3WE2A 2BY3A 1S29A 2MGQA 4A0XA 2JRTA 2FD5A 3H3UA 5L3FA 2E7XA 3MKWB 4BBRJ 1VQNI 4MTDA 2W00A 1G4DA 1ON1A 3FXOA 3FDYA 4F7ZA 3PUBA 3C2HA 2JJ7A 3F0CA 1A36A 3E3VA 1EJ9A 3A03A 3PSFA 3F21A 4IEJA 1R6RA 2BV6A 2IGKA 4RB1A 3WGIA 2ADUA 5M5WJ 3TL4X 1WJBA 4WXDA 4IRGA 3SQNA 4AVZA 4ESBA 2V1XA 1GUUA 4B1RA 1FYMA 2WB1N 2ZMEB 5GAGJ 1DDNA 3GX4X 3GF2A 4XLPF 2JT1A 3JRGA 2WY8Q 4BJ6C 1XSXA 3MD2A 1BR4A 3DQVC 4Z2YA 4JX5A 4U7DA 2DMQA 4KFCA 2HEOA 1BR1A 5J3LA 5IT9K 2GOXB 4QPOA 2X6WA 2WTEA 5HS7A 2KRCA 2O03A 4LLNA 1DU0A 2CW8A 3SZPA 2CJJA 5TRDA 2P81A 3R0AA 3P9CA 2XPUA 5EF6A 3J80K 3V7RA 2YSRA 1DGRM 5K5RA 2L4AA 5E3OA 2H27A 5BS6A 5AIQA 3EUKL 2XAUA 4LG3A 3QPSA 5LD2C 2Y9YA 1BC8C 1J9IA 3KCCA 3HOTA 4A0YA 2KZVA 3KYDB 1GV5A 1YQAA 2FNAA 2KT0A 5IP6A 3SHFA 1ITYA 3HIFA 2GM4A 3IV5A 1VQ7I 1MMAA 4R1HA 4F92B 3A01A 4I76A 1B72B 3J81Z 1RETA 2HTSA 1WQ2A 3SJMA 2BGCA 4XOTA 3E5UA 2E71A 1R36A 2DYSH 2JK3A 2K4JA 3LSKA 1ZLJA 2GWRA 2DA6A 3OL4A 2RQPA 2F2EA 1LE8A 4IF4A 3JRDA 5D4SA 4MNUA 5C3EJ 3M8FA 2HVQA 2HFHA 3KZZA 1JE8A 1VQLI 3HUGA 1TBXA 4M3FA 3FF5A 2DK5A 1J09A 5L3DA 3IKVA 1Y8RB 5E79C 3F9KA 2CW7A 2AS5F 1AA7A 5K7ZA 1IC8A 4D9JA 4UV8A 4YEJA 4A0ZA 2WAFA 3DTKA 3K0LA 1OPCA 1OCCH 5L3GA 1AKHB 4E7LA 4UXNA 2M0CA 3SDGA 3PNVA 3OYMA 4JQFA 3PO3J 4XONA 2DW4A 4A3JJ 4ASNA 4M9XA 2CMPA 5FKLA 1JUPA 4NC7A 3SZGA 1ZG5A 3QPHA 3CJRB 3PIPF 1R4MB 4AVPA 2Q1ZB 2R3SA 3D1NI 5FLVA 3K4MA 4XN3A 2JVHA 4ZTJA 4IHTA 1JT6A 1QHGA 3BQYA 1XN7A 4C3HJ 2EFQA 2LBFB 3GFMA 4JK1X 1H88C 2XUBA 4C3JJ 2ACJA 2NVTJ 2JA5J 2W1OA 1P7IA 3ABUA 2IS4A 3BR2A 3PNTA 3HB9A 1YJNI 2HVSA 2OQRA 2STWA 2M4GA 4JYKA 5TGTA 2RKHA 3L00A 4XNFA 3OS0A 4KISA 2EIKH 1FY7A 2JUCA 3GFLA 2VJJA 4B3AA 4HF1A 2H8RA 1RZ4A 4BAYA 1UG2A 3CP8A 1YX3A 1KQ8A 3WTZA 2D5VA 3CLQA 3PUFA 1GXPA 1G3TA 1HDPA 1OQYA 1PVEA 3CF5F 1WVRA 3DEWA 4HF2A 2VONA 2DTRA 2M5WA 2M30A 1IZ1A 3WTUC 4E7SA 4XBFA 2PMHA 2R7RA 3W2AA 1UHWA 3P7NA 1ETQA 5FO5A 4GDFA 3T8TA 3VODA 3LSJA 4MO7A 2CQXA 2PFBA 2DYRH 3O6BB 4KIFA 3ZQHA 2O6GE 2X9DA 1YS7A 2WY7Q 2L54A 1MZBA 2ZJRF 3CCEI 1XPXA 1PP7U 1KGSA 2XAFA 1A04A 2O9LA 1IN6A 3GLLA 4I0AA 2AHQA 3HKZN 4BDZA 1OFCX 2KDZA 1XS9A 4WX9A 4G6QA 5EGOA 5F27A 3LSGA 1XSVA 3RQ4A 3ZCOA 1U3EM 1Z1DA 3IL2A 3FXJA 2EA2A 2M3AA 3QYBA 4RGSA 4CO8A 2M2EA 2B0LA 1IUFA 1UG0A 5C44J 2DQRA 4QTRA 4KICA 1S72I 2P4WA 1UELB 5TISC 3JR9A 3OSGA 5EYRA 2PJRB 1BJZA 1WH5A 3BDDA 3F6OA 2E34A 3MKZA 2ELJA 3ABTA 3S32A 1NK2P 1R9TJ 4OAYA 4BACA 3FKIJ 2EZHA 4AD9A 2KIUA 2E1NA 2BE5F 4HW0A 4WXCA 2YS9A 1QPMA 5IPAA 2LLKA 4AIDA 3X2QH 1ZRDA 2EFOA 5FKKA 5J8FA 3PQKA 3WGGA 3F8NA 1M1EB 5DCMA 1TL8A 1EH6A 4BGDA 3HBLA 1CQTA 3QAHA 4HV6A 3G4SI 3LSIA 3OS2A 1RESA 2EIMH 3LSRA 1IG7A 1R5HA 4B44A 5C4XJ 3FHNA 3RI4A 3F8BA 1MSEC 3T0YA 3Q0VA 4EJUA 3I0TA 3DKWA 4FTHA 3QPLA 5HOOA 1PP8F 2AQFA 2IVMA 5AONA 3LSHA 5FKMA 3I4NJ 5FD5A 5E3LA 1ETXA 2MA3A 5EEAA 1B8IA 3S1MJ 1K79A 1RR7A 5L3EA 1K78B 5K1YA 1H89C 4OIOF 2DA5A 1KONA 2WAQN 1L3LA 1HCRA 3QP6A 2CU7A 1MGTA 2K9MA 2LY1A 4GYIA 3WE3A 5B1AH 3VWBA 1BI2A 1I6XA 1Z21A 3E6MA 3TDZC 3ECHA 3BZCA 4V2FA 2VODA 3NRVA 1FMWA 1T08B 3PNYA 2ELHA 2KMUA 2X48A 3GFIA 1TLHB 1LVKA 4CCOA 2MC4A 1I6HJ 3L2UA 2JTVA 2O7OA 1BIBA 4GCVA 4ESJA 4IL6C 2TCTA 3CUQA 3KYLA 3HOZJ 1V3FA 2EINH 2RGVA 3GYHX 3J7YJ 3TDUC 5KAIC 2QF7A 3VDXA 2HDCA 1O3TA 2ECCA 2L2OA 4OMZA 2PN6A 1ENHA 5F0FA 3H0DA 2HYJA 4U87A 1Y8QB 1MBEA 3LSMA 3TP0A 4LK1F 4IZZA 2O5RA 5DM6F 1IAWA 2CGPA 5BMZA 2COBA 2M1BA 2A07F 2DXIA 1AHDP 3LL7A 3OYDA 2DFFA 3DPUA 4L9JA 4LITA 5E17F 1D1AA 4PFOA 4A6EA 4KITB 3OR1C 2P7VB 4XLFA 2TRTA 2DN0A 1MBHA 2ME6A 4UNOA 4UY8I 4Q5SF 3W6JB 1G6NA 3EUHC 2X85A 2VUMJ 2DJNA 1LFBA 3ZMUA 3KEYA 1TWCJ 1YJWI 2F4IA 4BJ5C 3ZQCA 1X4OA 5HS8A 1Z3YA 2NNNA 2E1CA 2EB7A 4XLCA 3BZKA 4XK4A 2HQRA 5BNGA 2BY1A 4MFEA 1MNMC 5E3MA 2NS8A 2YX7A 3VYSB 5LFAA 4DIQA 3BROA 2VQLA 5BPIA 4QSHA 1ZELA 4BHPA 1R4NB 2BOLA 3F8CA 3FISA 2K40A 1VQOI 2R7SA 3AL0C 3JCUC 5EZHA 2M8GX 3DFGA 3CCUI 4P96A 1YTYA 4D0PA 4S04A 3H3VK 1KQ0A 3H9JA 2QBYB 1N78A 3BG7A 3L9FA 4BEHB 3T5XA 1VFCA 1RKTA 4D1QA 2JMWA 2H6CA 2OA4A 2WAEA 1R1VA 2VKEA 4RGXA 1IUYA 1TNSA 2F5CA 5GTHC 4L9TA 2GXGA 4ZDPA 2LSOA 2EQRA 4CCNA 3M8JA 4XKBA 2QA4I 4XMYA 3IRRA 1VQ6I 3A2KA 2FOKA 1X58A 1HBXG 1H9GA 3CO6C 3L2VA 2IS1A 1FBQA 4H4KC 2QUFA 4IQJA 2XKOA 1W4MA 1ZARA 4RDUA 3RSNA 1D5YA 4BDYA 2DA4A 1B59A 4G7HF 1RIOH 2VT3A 1F43A 2VC1A 3D5RC 2XHKA 1ZN2A 1ZGJA 1RPWA 4HNTA 3HM5A 1QZEA 3BTIA 3T8RA 1R71A 3JTHA 4CDGA 2GLOA 2HKXA 1HKQA 3KLOA 3NWTA 1ETKA 1R7JA 1EF4A 1CF7B 3ZXSA 2L3DA 3HGYA 3PFYA 3OSFA 1FX7A 4GFBA 2NRAC 5B3SH 1JXSA 2L7KA 4G94A 4CCJA 1QBJA 5FLXZ 1J2XA 3ROUA 2IGMA 1YX5A 1ZREA 1R1UA 3S3OA 4M6VA 3WG7H 4A69C 4KDPA 1BOAA 2GQQA 2HYGD 2E35A 3OYFA 2WWYA 2M7BA 4BBSJ 2B63J 2Q2EB 4IHVA 1X4PA 2FRHA 4OAZA 4NBQA 1JJ8C 1X1BA 3BTCA 2ZMEC 4AWXB 5LBQA 1HKSA 1TC3C 1D8KA 3I9V2 3E6BA 2HR3A 4EV0A 1V5GA 4FE7A 1IN8A 2IA0A 1ZR2A 1MMNA 2LKSA 3PM1A 5IOYA 1S3JA 4OMYA 1O57A 3BCAA 3ZR8X 4M74A 3W6KB 1MKMA 4J19A 2BHYA 2M34A 5EZGA 1ORKA 1Y1VJ 4LFUA 4IRIA 3J7ZI 2DQLA 2LG4A 4HZFA 3W6VA 2GIZA 2NS7A 3BG6A 3IAM2 2Z2SB 1T6SA 4K2EA 3AKZA 2R7OA 1SC7A 1SFKA 5H6QA 1A6QA 3M07A 2PMZA 4FCYA 5IYDJ 2OCCH 2DBBA 4B4CA 2FX0A 3HL2A 4HOBA 1ZG3A 2KKOA 2QQ9A 2K9NA 1LVAA 5IP9J 2NOGA 4Y13A 2D2WA 2VPLA 3I5UA 2A6EF 1BJAA 2R7DA 4NC8A 1XDSA 3I4MJ 4MTEA 1LDDA 5BOXA 2PMUA 5HNHA 4LLGF 2HKOA 2QYOA 2JVGA 5DD4A 1ERDA 5ILSA 3A1YA 2QGUA 3EYYA 1X3WB 3ESWB 3AG3H 3FBNB 4RAFA 2LD5A 1SAXA 1Y39A 1W7PB 4G7OF 3JAMK 2DFIA 4I98B 1GVDA 3DKYA 2N8GA 2Y69H 2DAOA 3M9AA 1R5GA 4A3DJ 3QYFA 3LNQA 2EZIA 4LGWA 3VPRA 2DFHA 2R92J 2PX9A 4XSZF 3H0GJ 1BBYA 1P2FA 3CMAI 1TQPA 5D5UB 2KRHA 2QQ8A 5JR3A 3HTUA 5CKTA 4UUSA 1TWAJ 4DYCA 1Z6RA 3KLNA 2PI0A 2DMUA 2DT7B 1LB2A 4EJOA 3FXKA 3O8HA 4YIIA 5GTIC 3B73A 1SD4A 1XDUA 2RN7A 1OJLA 1S7AA 1K4TA 1IJWC 4XLAA 5J47A 5CVJA 2DA3A 4Z6YA 4HX4A 2E2IJ 4C2TA 1IRZA 3T1BA 3ZMZA 3ABKH 1PUFB 3VOEA 3WTYC 1ZRCA 3CF2A 4M3GA 4U7BA 1TP4A 2KFDA 2PG4A 3WU0A 2BVMA 2XPVA 4A2UA 2X6XA 5BPDA 2QEXI 4BXFA 4RB0A 2LKXA 3H9GA 1DQUA 4IOCF 2V1UA 5H20A 4BKXA 2O0YA 2K5CA 2UUZA 4XR6A 2FJ1A 5DD8A 4S05A 3EYIA 2L7MP 1KA8A 5FLMJ 5HLIA 3TEDA 2NVYJ 1FTTA 2CS3A 5D6FA 3U2RA 1QPIA 4HRIA 1FYKA 1BL0A 3S8PA 1R23A 2G0EA 1G3YA 2A69F 4ZYAA 4WXHA 3K1NA 3RKQA 3L09A 3QOEA 2YUSA 4M71A 1OR7A 5EG0A 2V6EA 5CVVA 2M9HA 5CJ9A 1P7JA 3S15J 2UV1A 4M3BA 3RPQA 4LG0A 2HWVA 1S9HA 3D5LA 2X6OA 5D5WB 5FB2A 4MQ9F 3HC7A 2EIJH 2G7HA 2JZYA 1SD5A 4HLXA 1WJ5A 2YU9J 2XAGA 1HA8A 4KMFA 2QQBA 2LH9A 1S7OA 2R7FA 2HGCA 3QOPA 2CFXA 1O3RA 4DJAA 2VJ4A 1ETOA 1QVTA 3I53A 3KFWX 1WSUA 3KETA 2L9NA 1D1CA 1SMYF 3LMMA 2QVOA 4NB5A 1HXDA 2FEZA 5K5OA 2DJIA 2P5KA 1HSTA 1FEXA 3BR6A 3ZQ7A 3MVPA 3HRMA 2R0QC 1WJDA 1QRYA 5IOZA 1GXQA 2EV6A 2VN2A 3LFKA 3HSFA 1Y0NA 3TP3A 2H8WA 2HPIA 3V4GA 1CGPA 3IAS2 4CA0A 2CSOA 4A6DA 1IXCA 1BI1A 4PGGA 1IDYA 1FP1D 4ZDLA 2OD5A 4QIWN 1RC9A 4L18B 1ZG1A 3BT9A 4NUBA 1ZK8A 5CVRA 5LGTA 1FBSA 3CZ6A 1T38A 2CYYA 3F72A 2F6CA 1B9MA 4W1UA 1Q1HA 4P9UA 2OQGA 2JSPA 4CSWA 1BN5A 3TOBA 1AWCA 1MBJA 4G12A 4DW6A 1DPRA 1FOWA 3BG5A 2EFNA 3ZMDA 1U5TA 3Q9VA 3OIQA 1D3YA 1N75A 3GBGA 3J81K 1HOMA 1A35A 3AAFA 5BQTA 3W3CA 2V4JC 3CMMA 1I50J 1JHFA 2EWNA 3S1NJ 2EFWA 2LY9A 3DLAA 4B43A 4E7KA 1R00A 5HDNA 1X3UA 3ZQIA 2IGOA 1MNEA 2PLYA 5K7FA 1OKRA 4ITVA 1TW3A 5E20A 2MC3A 1XSDA 2HOEA 2Y0SA 3BPVA 1WHUA 3FXRA 2Y2ZA 2XF5A 4FX4A 5ICCA 4M6YA 1T98A 3ZGKA 1D5VA 1MBGA 3WTVC 4LB5A 4P9FA 1V4RA 3FK7A 2RDPA 4A12A 4MGRA 3K9TA 1MJBA 4R8HA 1DPUA 3C3WA 1VQMI 1TW2A 2K4BA 2V9VA 1U9OA 3E6CC 1F1ZA 1R58A 3HHGA 4WK8F 5M3MJ 1APLC 2HZTA 5CVUA 3QQAA 3QWLA 4PJ0C 3C2GA 3H9QA 4DNCA 3EUAA 2P5LC 2QKMB 1YS6A 4E7ZA 2CG4A 2FF4A 3EETA 3C1DA 1R22A 2V9PA 3BLYA 3ML6A 5EEHA 2LREA 3LAPA 3CCLI 3D0SA 2R5YA 3CCJI 1T33A 2H1KA 2HZDA 2K3FA 5ICGA 2CFOA 2MW8A 1W0UA 2ELKA 1BR2A 2LTPA 3WTWC 2QCOA 1YW9A 2BW3B 2ESNA 3Q9SA 2CV2A 2HXIA 4NHJA 1P92A 4ZYEA 2FQ3A 1T2KA 3ZQGA 3GO5A 1YFHA 1G8XA 4KNYA 3VYTB 2A6HF 3G1LA 3R60A 2VKVA 3K4NA 4AU7A 2R7ZJ 1DUXC 4HX8A 4BQAA 5FGMA 1JKOC 2K9QA 3A0HC 1MBKA 4UHTA 4U88A 1NH3A 3MCZA 1YIOA 2IP2A 4E7JA 1T8IA 1TT5B 2JSCA 4U0VA 1IN5A 1YLFA 2XSJC 4AYBN 2WBMA 1BOBA 1NG6A 5ED4A 1OCPA 1ODDA 3OIOA 3CJTB 1U78A 3HSEA 5HS9A 4EVIA 1HW5A 2ZCWA 1RUOA 1JTYA 1Z77A 1IV6A 1JGGA 2W7NA 1ZH5A 1IV8A 3I59B 4G6DA 4NC6A 4D5CA 1MH3A 3RJPA 4FISA 1H0MA 2TDXA 2IAIA 3K4CA 1S8NA 3H35A 3K10A 3U21A 2XKPA 3M7GA 2VI6A 2ZMEA 3LA2A 3IH2A 4DGWB 2V9KA 4GGGA 1HQCA 4HX7A 4JP0A 3NQOA 1X19A 1JKQC 2CO5A 2JA8J 4CYCB 3ULQB 4HSRA 2ZXIA 2RNGA 1X1DA 2WB1A 1X3ZB 1WJAA 1IW7F 2F5VA 4C3IJ 2KHMA 4CYDA 3I64A 3VYUB 2FBIA 3FK6A 1SFOJ 2CW0F 5J1YA 4I01A 1O3SA 3BR5A 1WI9A 2ZSIB 1JGSA 2EV0A 3ASOH 4A3GJ 2L5QA 1XTAA 3E0JB 4MIMA 3D5SC 2YR2A 3IH4A 4DBQA 4PJJA 1D0XA 3CQZJ 1SFXA 3K1MA 4M3DA 4ESFA 2AXTC 2M8EA 3OYLA 2Y9ZA 1YITI 2DFEA 5J4YA 2ME0A 1LFUP 4L0YB 1X1PA 4KA4A 3CCRI 1WZ2A 2A6TA 2ZXWH 4U0YA 2DA1A 5IT3A 2O8KA 1HLVA 1U2WA 4E7HA 3UKGA 1LNWA 5F0CA 3FXUA 1E17A 3TMOA 4O3MA 4RBOA 1B72A 3OYHA 1BW6A 4G7ZF 3RPUA 3WGHA 2NVQJ 2EPFA 2GIVA 1YJ9I 2F5DA 4ON0A 3RIRA 2W84A 5C4JJ 1ONVA 2A5YB 3GTKJ 2H94A 3RYRA 3Q5FA 2UXXA 4BUPA 1F9NA 3FMSA 4RS8A 4HQEA 4D7NA 4ETSA 2RVCA 3WTTC 1POGA 3P9IA 4HPQA 3QODA 1W0TA 3BJ6A 2IJLA 2MABA 1MBFA 2DA2A 2PBIA 1TQIA 2JPBA 2YU3A 5E1XA 1SEUA 1WFXA 2V26A 3QP5A 3ZQFA 2DODA 4Y17A 2EA4A 3OV8A 2MH2A 4HF0A 1FWZA 3SDBA 1RI7A 1T56A 1U6GA 2XV4S 3PO2J 1ULYA 1BIAA 4RAZA 3L7WA 4XN0A 5HLTA 1JUSA 4KJZA 4H0EA 3LSTA 1AKHA 1VF9A 2AXLA 3E7LA 2R7XA 2VIXA 2EJRA 5F64A 4PFPA 3DV8A 3VB2A 2OJED 2ZXJA 3L2RA 2PJPA 2IS6A 5KAFC 3KP2A 4OIRF 2Y31A 2ZSHB 4X6AJ 1TWFJ 2J5OA 3FM5A 1UHSA 1I3QJ 2CQKA 2V6CA 4NQWB 3RKXA 3DWLE 3QPTA 5GP9A 2OZUA 2Y75A 3IWFA 4KT6A 1GV2A 4L0ZB 2W57A 2UXNA 2NXNB 2KZGA 5B66C 2ETHA 2GA1A 2KDOA 4N4NB 4UVCA 3RKWA 2LBFA 1MW7A 1WCMJ 2LF8A 2OBPA 5HDGA 4HDUA 2CV1A 3HZJA 3HPGA 3A4CA 3LAJA 2STTA 2F4OB 3TOAA 4B48A 3DF8A 3IH3A 2ZXHA 1W36C 1FIPA 2HQNA 1ZGWA 4XIDA 1E2XA 1UMQA 2JA2A 4FHTA 2LRDA 3ZMSA 1KQ9A 1P4WA 3DPTA 2EZLA 3CCQI 1PJRA 1LFPA 1XGSA 3KEOA 3ZMTA 5TJJA 3DTEA 2P7CB 3LFUA 2D1VA 2HNHA 4JX6A 2QM3A 2KP6A 2F4MB 3CP2A 4XORA 3HSRA 3OS1A 3JSOA 1K61A 3GFJA 2O61A 1GHCA 4M72A 4BH9A 1ACIA 1LDKB 1OYWA 3FX3A 2XB0X 5DM7F 1FZPB 2K85A 5FJ8J 2KRFA 4OWRB 3V8JA 3FZVA 3HG9A 4RB2C 1ETWA 4KT5C 4N9IA 3TGNA 1RNLA 2XF6A 4A3LJ 5FRMA 4F91B 1FC3A 2XGDA 3BTLA 4UUTA 1K83J 4IX7A 1Z3XA 3S2WA 1EA3A 1MDMB 2EV5A 3CCSI 1PUEE 1V5EA 2EK5A 4Q4ZF 3IUOA 3JRAA 3MWMA 4YG2F 2R5ZB 2ZNYA 3FKJA 5LGUA 1J75A 2HXOA 2JRMA 3LA3A 5ERIA 3HGGA 1Z91A 1FPQA 4LIUA 3V42A 1MMDA 2MFZA 3HRTA 1J59A 2W82A 2BEOA 3TQNA 3SXYA 3HKZA 2KISA 3I71A 3K70C 5L3BA 1O4XA 2DT6A 2YX4A 4ZC3A 3KP6A 3KP5A 3B6CA 5DS9A 4GRIA 2PJRA 3H3ZA 3BTJA 3P5JA 1D8JA 3CCMI 4E6KG 2DT5A 2Z1DA 1I27A 1XMKA 2LF7A 1AU7A 3NWSA 3OYBA 5GADJ 2IXSA 4WWCA 1XCVA 3HOUJ 3K69A 1T95A 4GXOA 1QVUA 3CCYA 3G1OA 1P9QC 4DBRA 3DBLB 3F8FA 2FMLA 2CRGA 3ISPA 5FLXK 4TV7A 3L2WA 2VBZA 1ZLKA 2R7VA 4UB6C 2DDBA 3VSKA 1KU7A 1F36A 4BQQA 3QYEA 5LEKA 4E7IA 3ERED 3J7AO 4CICA 3QU6A 5LHGA 3ZQLA 1NHAA 3HYIA 2JUGA 2DOFA 1FYLA 1WGXA 2XB5A 4BS9A 3K2ZA
chains in the Genus database with same CATH topology
1X2MA 4ABZA 2LKXA 3JRIA 3GTLJ 4BKXA 2FJ1A 5JLWA 2DMNA 2L7MP 5FLMJ 3HDDA 4MFDA 3TEDA 2NVYJ 5K7ZA 1IC8A 1FTTA 1QPIA 4A3KJ 1BL0A 1FTZA 5IP7J 1JKPC 5GPAA 2G0EA 2EBIA 1U9NA 4A3BJ 3RZOJ 4XRSG 1ETYA 1AKHB 4A93J 2OPTA 2M0CA 3SDGA 3JREA 3HOWJ 3PO3J 3RKQA 4A3JJ 2YUSA 5F1JA 5JLXA 2E2HJ 5K7HA 5EG0A 3B6AA 5FKLA 2HOTA 1JUPA 5HODA 3HOVJ 2M9HA 1P7JA 1JKRC 3S15J 4M3BA 5IYBJ 2X6OA 1S7EA 3D1NI 5FLVA 1JT6A 3BQYA 5F04A 3WHBA 4C3HJ 2MG4A 2YU9J 5GPCA 5IYCJ 1X2NA 3S1QJ 1H88C 4DYRA 4C3JJ 1ETOA 2XPWA 3GTOJ 2PMZN 2NVTJ 2JA5J 1QVTA 1P7IA 3CDLA 1GDTA 2Y30A 2HOSA 3BR2A 3HB9A 1VNDA 2K9SA 4JYKA 1FEXA 3BR6A 3S14J 3MVPA 1RKWA 2R0QC 5IOZA 1QRYA 3K7AJ 4B3AA 3TW6A 3TP3A 2H8RA 1UG2A 1FJLA 2D5VA 1IDYA 4CYCA 5FKNA 4QIWN 2WV1A 3BT9A 1ZK8A 1HDPA 3DEWA 4W1UA 4XRMA 5J1UA 1ETQA 4L5EA 3LSJA 4MO7A 1MBJA 2CQXA 4G12A 2CUFA 3ZQHA 4DW6A 3BG5A 2X9DA 4X1EA 4A3CJ 3GBGA 1HOMA 4V2GA 2FQ4A 2O9LA 1I50J 3S1NJ 4HNVA 5E3NA 2AHQA 3HKZN 2MSYA 1OFCX 2LY9A 2KDZA 1XS9A 3S16J 5J1RA 2E1OA 3GTPJ 5EGOA 3C2BA 3ZQIA 5F27A 3LSGA 5K7FA 2OF7A 2ECBA 2XSDC 3HOXJ 1TWHJ 2E19A 2Y2ZA 2HDDA 2M2EA 1IUFA 5C44J 2JA6J 4QTRA 3DCFA 1MBGA 1HDDC 5DTDA 3G1MA 4C2MJ 3JR9A 1WI3A 3FK7A 5FKOA 4XRSA 3OSGA 5EYRA 1BJZA 1WH5A 1NK2P 4UUSB 4AUXA 1R9TJ 3FKIJ 2EZHA 1U9OA 1TWGJ 2YS9A 4W97A 5IPAA 2LLKA 3A01B 5M3MJ 5FKKA 1APLC 1A5JA 3WHCA 3QQAA 2XRLA 1LE8B 3HBLA 1CQTA 1WH7A 2R5YA 2I10A 1ZQ3P 1RESA 1XC5A 1T33A 3LSRA 1IG7A 2H1KA 5C4XJ 2MW8A 1W0UA 2ELKA 4LOCA 1MSEC 2LTPA 2NVXJ 2QCOA 3Q0VA 2L0KA 3CMYA 3M4OJ 4FTHA 3QPLA 1OCTC 2LK2A 2HXIA 4NDLA 2R5YB 5FKMA 3ZQGA 3I4NJ 5E3LA 1ETXA 5EEAA 1B8IA 4DZPA 3S1MJ 4DZJA 3G1LA 3Q0UA 1RR7A 2VKVA 3BG9A 1NK3P 2DA7A 3Q3SA 2GBYA 3JRBA 4IHYA 2R7ZJ 1H89C 2DA5A 2WAQN 1HCRA 1JKOC 2K9QA 2CU7A 3RZDJ 1FIAA 1MBKA 4D5FA 3JRCA 1BW5A 4V2FA 2W48A 3NAUA 2AO9A 3LOCA 4AYBN 2X48A 5EG0B 3O8GA 1OCPA 1I6HJ 3OIOA 1U78A 2O7OA 3GTJJ 3GTMJ 4EEFG 2TCTA 4A3IJ 3HOZJ 1JTYA 1Z77A 1IV6A 1JGGA 4Y7NJ 2QF7A 2L7ZA 2ECCA 3TW7A 4D5CA 1MH3A 4D7MA 1ENHA 5F0FA 3S1RJ 2HYJA 1JT0A 2HOAA 4FISA 1MBEA 2IAIA 3TP0A 4BXXJ 3S2HJ 2COBA 3Q0WA 2VI6A 1AHDP 1JTXA 3IH2A 3GTQJ 4JP0A 2IBDA 2TRTA 2DN0A 1MBHA 3M3YJ 2ME6A 1JKQC 2JA8J 2VUMJ 4CYCB 2DJNA 1LFBA 4FE4A 1TWCJ 2EZKA 3ZQCA 1YRNA 2ZB9A 5F08A 4C3IJ 3FK6A 1SFOJ 5J1YA 4XK4A 5BNGA 1IDZA 4MFEA 2R5ZA 1MNMC 3BR5A 2NS8A 3FIWA 5E3MA 5M5YJ 2E2JJ 4A3GJ 2Y0SN 4MIMA 4QSHA 3FISA 3IH4A 2K40A 4IHWA 4MLOA 3CQZJ 4M3DA 3HOYJ 5EZHA 1ZKGA 2M8GX 2Y9ZA 1WPKA 3H3VK 2ME0A 2LP0A 1ZTRA 5EGOB 1LFUP 1VFCA 1RKTA 2DA1A 2R93J 2JMWA 3JRHA 2L7FP 1VI0A 2O8KA 1HLVA 3UKGA 2XGEA 5F0CA 1Y1WJ 2VKEA 4I6ZA 1NTCA 4RBOA 1B72A 1BW6A 1ZR4A 1U8BA 4DYQA 2NVQJ 2EQRA 5C4JJ 1Z0XA 3GTKJ 1X58A 4BY7J 3SFIA 1PUFA 4D7NA 1E3OC 1POGA 2LVSA 2CUEA 4RDUA 1W0TA 1D5YA 2DMPA 3A02A 1MSFC 1MBFA 2DA2A 2DA4A 3L1PA 1F43A 1G2HA 3BR1A 1RPWA 2JWTA 4IHXA 2JN6A 4A3FJ 3ZQFA 3K2AA 1GT0C 3HM5A 3BTIA 1A6IA 2GLOA 1JJ6C 2CQQA 1ETKA 5M3FJ 1T56A 1EF4A 3PO2J 1Q1VA 3NARA 3LSPA 3HGYA 1DU6A 2IEKA 3OSFA 1JUSA 1AKHA 1VF9A 1SANA 4GFBA 3E7LA 3MN2A 2EH3A 1B8IB 3MKLA 1ETVA 4M6VA 1XG1A 4A69C 2HI3A 2Y31A 4X6AJ 1TWFJ 1BA5A 1UHSA 1I3QJ 5GP9A 2DTZA 4JX4A 1HF0A 4BBSJ 2B63J 2XGCA 1GV2A 4IHVA 1JJ8C 4A3EJ 1WCMJ 3BTCA 1H8AC 1TC3C 2MGQA 2FD5A 4FE7A 1ZR2A 3PM1A 4BBRJ 2ID3A 3IH3A 5IOYA 1FIPA 3BR3A 2LFBA 3RQIA 4XIDA 1ZGWA 1UMQA 4J19A 2JJ7A 2M34A 3F0CA 5EZGA 2EZLA 1ORKA 3A03A 1Y1VJ 4IEJA 1MH4A 3W6VA 3BQZA 2NS7A 5M5WJ 4JX6A 9ANTA 4FCYA 5IYDJ 1K61A 1GUUA 2FX0A 4B1RA 4B4CA 4A3MJ 2WB1N 2DMTA 2K9NA 5IP9J 2NOGA 2XB0X 3JRGA 5M5XJ 5FJ8J 4Y52J 3GTGJ 4JX5A 1IGNA 3I4MJ 2DMQA 1ETWA 5J3LA 4A3LJ 2XGDA 3BTLA 4UUTA 3JRFA 1K83J 1DU0A 1YRNB 4XICA 2CJJA 2LD5A 2JA7J 2P81A 4BY1J 3ZOBA 1GVDA 2N8GA 2LR8A 3JRAA 2XPUA 5EF6A 2R5ZB 3S17J 5EDNA 4A3DJ 4M3EA 2HXOA 5E3OA 3LNQA 2EZIA 2HQ5A 3OOUA 3HGGA 3VPRA 3S2DJ 2R92J 3H0GJ 3BG3A 3QPSA 2Y9YA 2L9RA 1O4XA 1GV5A 1JUMA 5DS9A 3B6CA 2KT0A 5IP6A 3BTJA 1ITYA 4UUSA 1TWAJ 4DYCA 3IV5A 2GM4A 2DMUA 2RAEA 1AU7A 4AC0A 3O8HA 3BR0A 3HOUJ 3A01A 4I76A 1B72B 1RETA 3SJMA 1QVUA 3CCYA 3G1OA 1OJLA 4S0HB 2JK3A 1IJWC 2CRGA 2DA3A 2DA6A 3HEFA 2E2IJ 2ID6A 2VPRA 1IRZA 1LE8A 1PUFB 1F36A 3JRDA 5C3EJ 4M3GA 3ZQLA 4M3FA 2XPVA 5F0HA 1WGXA 2XB5A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1X2M A;  4ABZ A;  2LKX A;  3JRI A;  3GTL J;  4BKX A;  2FJ1 A;  5JLW A;  2DMN A;  2L7M P;  5FLM J;  3HDD A;  4MFD A;  3TED A;  2NVY J;  5K7Z A;  1IC8 A;  1FTT A;  1QPI A;  4A3K J;  1BL0 A;  1FTZ A;  5IP7 J;  1JKP C;  5GPA A;  2G0E A;  2EBI A;  1U9N A;  4A3B J;  3RZO J;  4XRS G;  1ETY A;  1AKH B;  4A93 J;  2OPT A;  2M0C A;  3SDG A;  3JRE A;  3HOW J;  3PO3 J;  3RKQ A;  4A3J J;  2YUS A;  5F1J A;  5JLX A;  2E2H J;  5K7H A;  5EG0 A;  3B6A A;  5FKL A;  2HOT A;  1JUP A;  5HOD A;  3HOV J;  2M9H A;  1P7J A;  1JKR C;  3S15 J;  4M3B A;  5IYB J;  2X6O A;  1S7E A;  3D1N I;  5FLV A;  1JT6 A;  3BQY A;  5F04 A;  3WHB A;  4C3H J;  2MG4 A;  2YU9 J;  5GPC A;  5IYC J;  1X2N A;  3S1Q J;  1H88 C;  4DYR A;  4C3J J;  1ETO A;  2XPW A;  3GTO J;  2PMZ N;  2NVT J;  2JA5 J;  1QVT A;  1P7I A;  3CDL A;  1GDT A;  2Y30 A;  2HOS A;  3BR2 A;  3HB9 A;  1VND A;  2K9S A;  4JYK A;  1FEX A;  3BR6 A;  3S14 J;  3MVP A;  1RKW A;  2R0Q C;  5IOZ A;  1QRY A;  3K7A J;  4B3A A;  3TW6 A;  3TP3 A;  2H8R A;  1UG2 A;  1FJL A;  2D5V A;  1IDY A;  4CYC A;  5FKN A;  4QIW N;  2WV1 A;  3BT9 A;  1ZK8 A;  1HDP A;  3DEW A;  4W1U A;  4XRM A;  5J1U A;  1ETQ A;  4L5E A;  3LSJ A;  4MO7 A;  1MBJ A;  2CQX A;  4G12 A;  2CUF A;  3ZQH A;  4DW6 A;  3BG5 A;  2X9D A;  4X1E A;  4A3C J;  3GBG A;  1HOM A;  4V2G A;  2FQ4 A;  2O9L A;  1I50 J;  3S1N J;  4HNV A;  5E3N A;  2AHQ A;  3HKZ N;  2MSY A;  1OFC X;  2LY9 A;  2KDZ A;  1XS9 A;  3S16 J;  5J1R A;  2E1O A;  3GTP J;  5EGO A;  3C2B A;  3ZQI A;  5F27 A;  3LSG A;  5K7F A;  2OF7 A;  2ECB A;  2XSD C;  3HOX J;  1TWH J;  2E19 A;  2Y2Z A;  2HDD A;  2M2E A;  1IUF A;  5C44 J;  2JA6 J;  4QTR A;  3DCF A;  1MBG A;  1HDD C;  5DTD A;  3G1M A;  4C2M J;  3JR9 A;  1WI3 A;  3FK7 A;  5FKO A;  4XRS A;  3OSG A;  5EYR A;  1BJZ A;  1WH5 A;  1NK2 P;  4UUS B;  4AUX A;  1R9T J;  3FKI J;  2EZH A;  1U9O A;  1TWG J;  2YS9 A;  4W97 A;  5IPA A;  2LLK A;  3A01 B;  5M3M J;  5FKK A;  1APL C;  1A5J A;  3WHC A;  3QQA A;  2XRL A;  1LE8 B;  3HBL A;  1CQT A;  1WH7 A;  2R5Y A;  2I10 A;  1ZQ3 P;  1RES A;  1XC5 A;  1T33 A;  3LSR A;  1IG7 A;  2H1K A;  5C4X J;  2MW8 A;  1W0U A;  2ELK A;  4LOC A;  1MSE C;  2LTP A;  2NVX J;  2QCO A;  3Q0V A;  2L0K A;  3CMY A;  3M4O J;  4FTH A;  3QPL A;  1OCT C;  2LK2 A;  2HXI A;  4NDL A;  2R5Y B;  5FKM A;  3ZQG A;  3I4N J;  5E3L A;  1ETX A;  5EEA A;  1B8I A;  4DZP A;  3S1M J;  4DZJ A;  3G1L A;  3Q0U A;  1RR7 A;  2VKV A;  3BG9 A;  1NK3 P;  2DA7 A;  3Q3S A;  2GBY A;  3JRB A;  4IHY A;  2R7Z J;  1H89 C;  2DA5 A;  2WAQ N;  1HCR A;  1JKO C;  2K9Q A;  2CU7 A;  3RZD J;  1FIA A;  1MBK A;  4D5F A;  3JRC A;  1BW5 A;  4V2F A;  2W48 A;  3NAU A;  2AO9 A;  3LOC A;  4AYB N;  2X48 A;  5EG0 B;  3O8G A;  1OCP A;  1I6H J;  3OIO A;  1U78 A;  2O7O A;  3GTJ J;  3GTM J;  4EEF G;  2TCT A;  4A3I J;  3HOZ J;  1JTY A;  1Z77 A;  1IV6 A;  1JGG A;  4Y7N J;  2QF7 A;  2L7Z A;  2ECC A;  3TW7 A;  4D5C A;  1MH3 A;  4D7M A;  1ENH A;  5F0F A;  3S1R J;  2HYJ A;  1JT0 A;  2HOA A;  4FIS A;  1MBE A;  2IAI A;  3TP0 A;  4BXX J;  3S2H J;  2COB A;  3Q0W A;  2VI6 A;  1AHD P;  1JTX A;  3IH2 A;  3GTQ J;  4JP0 A;  2IBD A;  2TRT A;  2DN0 A;  1MBH A;  3M3Y J;  2ME6 A;  1JKQ C;  2JA8 J;  2VUM J;  4CYC B;  2DJN A;  1LFB A;  4FE4 A;  1TWC J;  2EZK A;  3ZQC A;  1YRN A;  2ZB9 A;  5F08 A;  4C3I J;  3FK6 A;  1SFO J;  5J1Y A;  4XK4 A;  5BNG A;  1IDZ A;  4MFE A;  2R5Z A;  1MNM C;  3BR5 A;  2NS8 A;  3FIW A;  5E3M A;  5M5Y J;  2E2J J;  4A3G J;  2Y0S N;  4MIM A;  4QSH A;  3FIS A;  3IH4 A;  2K40 A;  4IHW A;  4MLO A;  3CQZ J;  4M3D A;  3HOY J;  5EZH A;  1ZKG A;  2M8G X;  2Y9Z A;  1WPK A;  3H3V K;  2ME0 A;  2LP0 A;  1ZTR A;  5EGO B;  1LFU P;  1VFC A;  1RKT A;  2DA1 A;  2R93 J;  2JMW A;  3JRH A;  2L7F P;  1VI0 A;  2O8K A;  1HLV A;  3UKG A;  2XGE A;  5F0C A;  1Y1W J;  2VKE A;  4I6Z A;  1NTC A;  4RBO A;  1B72 A;  1BW6 A;  1ZR4 A;  1U8B A;  4DYQ A;  2NVQ J;  2EQR A;  5C4J J;  1Z0X A;  3GTK J;  1X58 A;  4BY7 J;  3SFI A;  1PUF A;  4D7N A;  1E3O C;  1POG A;  2LVS A;  2CUE A;  4RDU A;  1W0T A;  1D5Y A;  2DMP A;  3A02 A;  1MSF C;  1MBF A;  2DA2 A;  2DA4 A;  3L1P A;  1F43 A;  1G2H A;  3BR1 A;  1RPW A;  2JWT A;  4IHX A;  2JN6 A;  4A3F J;  3ZQF A;  3K2A A;  1GT0 C;  3HM5 A;  3BTI A;  1A6I A;  2GLO A;  1JJ6 C;  2CQQ A;  1ETK A;  5M3F J;  1T56 A;  1EF4 A;  3PO2 J;  1Q1V A;  3NAR A;  3LSP A;  3HGY A;  1DU6 A;  2IEK A;  3OSF A;  1JUS A;  1AKH A;  1VF9 A;  1SAN A;  4GFB A;  3E7L A;  3MN2 A;  2EH3 A;  1B8I B;  3MKL A;  1ETV A;  4M6V A;  1XG1 A;  4A69 C;  2HI3 A;  2Y31 A;  4X6A J;  1TWF J;  1BA5 A;  1UHS A;  1I3Q J;  5GP9 A;  2DTZ A;  4JX4 A;  1HF0 A;  4BBS J;  2B63 J;  2XGC A;  1GV2 A;  4IHV A;  1JJ8 C;  4A3E J;  1WCM J;  3BTC A;  1H8A C;  1TC3 C;  2MGQ A;  2FD5 A;  4FE7 A;  1ZR2 A;  3PM1 A;  4BBR J;  2ID3 A;  3IH3 A;  5IOY A;  1FIP A;  3BR3 A;  2LFB A;  3RQI A;  4XID A;  1ZGW A;  1UMQ A;  4J19 A;  2JJ7 A;  2M34 A;  3F0C A;  5EZG A;  2EZL A;  1ORK A;  3A03 A;  1Y1V J;  4IEJ A;  1MH4 A;  3W6V A;  3BQZ A;  2NS7 A;  5M5W J;  4JX6 A;  9ANT A;  4FCY A;  5IYD J;  1K61 A;  1GUU A;  2FX0 A;  4B1R A;  4B4C A;  4A3M J;  2WB1 N;  2DMT A;  2K9N A;  5IP9 J;  2NOG A;  2XB0 X;  3JRG A;  5M5X J;  5FJ8 J;  4Y52 J;  3GTG J;  4JX5 A;  1IGN A;  3I4M J;  2DMQ A;  1ETW A;  5J3L A;  4A3L J;  2XGD A;  3BTL A;  4UUT A;  3JRF A;  1K83 J;  1DU0 A;  1YRN B;  4XIC A;  2CJJ A;  2LD5 A;  2JA7 J;  2P81 A;  4BY1 J;  3ZOB A;  1GVD A;  2N8G A;  2LR8 A;  3JRA A;  2XPU A;  5EF6 A;  2R5Z B;  3S17 J;  5EDN A;  4A3D J;  4M3E A;  2HXO A;  5E3O A;  3LNQ A;  2EZI A;  2HQ5 A;  3OOU A;  3HGG A;  3VPR A;  3S2D J;  2R92 J;  3H0G J;  3BG3 A;  3QPS A;  2Y9Y A;  2L9R A;  1O4X A;  1GV5 A;  1JUM A;  5DS9 A;  3B6C A;  2KT0 A;  5IP6 A;  3BTJ A;  1ITY A;  4UUS A;  1TWA J;  4DYC A;  3IV5 A;  2GM4 A;  2DMU A;  2RAE A;  1AU7 A;  4AC0 A;  3O8H A;  3BR0 A;  3HOU J;  3A01 A;  4I76 A;  1B72 B;  1RET A;  3SJM A;  1QVU A;  3CCY A;  3G1O A;  1OJL A;  4S0H B;  2JK3 A;  1IJW C;  2CRG A;  2DA3 A;  2DA6 A;  3HEF A;  2E2I J;  2ID6 A;  2VPR A;  1IRZ A;  1LE8 A;  1PUF B;  1F36 A;  3JRD A;  5C3E J;  4M3G A;  3ZQL A;  4M3F A;  2XPV A;  5F0H A;  1WGX A;  2XB5 A; 
#chains in the Genus database with same CATH topology
 4ABZ A;  3JRI A;  2X0L A;  1USS A;  4HV5 A;  2E1M C;  3MZ8 A;  3HOS A;  3E6D A;  2DMN A;  1SMT A;  3WU1 B;  3FMQ A;  4MFD A;  2E5N A;  4B09 A;  2A68 F;  1K78 A;  1MIJ A;  4A3K J;  1FTZ A;  2GAU A;  2WC2 A;  2X6Y A;  1JKP C;  3RZO J;  4XRS G;  1ETY A;  5K5Q A;  3WG9 A;  4IKF A;  4KYW A;  5D8L B;  1B6A A;  3W2V A;  3HOW J;  3QU3 A;  3GVA A;  2LKP A;  3GCM A;  5F1J A;  1I1S A;  2E2H J;  3E1S A;  1PDN C;  2P6S A;  5DCF A;  2M87 A;  3MKY B;  4LK0 F;  4HNU A;  3S3M A;  3EQL F;  2WAQ A;  1JKR C;  1C0W A;  3CJQ B;  3LA7 A;  4G9Y A;  1EV7 A;  2Z16 A;  1E3H A;  4PCQ A;  5LHI A;  4CHU A;  5F04 A;  4FET A;  3QRF F;  2BZT A;  3RPU D;  4M73 A;  3WTX C;  2W25 A;  4F3Q A;  5ICF A;  2BXZ A;  5GPC A;  3BJO A;  1X2N A;  1YO5 C;  3GZ5 A;  2GXB A;  2R7Q A;  2A5W A;  4DYR A;  1FP2 A;  4LLL A;  2COM A;  6PAX A;  1VND A;  4XQF A;  2CV0 A;  2K9S A;  4PZJ A;  4PJM A;  3U1K A;  3J7A Y;  3S14 J;  3U1D A;  1H9T A;  1WRJ A;  1Y56 A;  3KP3 A;  3SEZ A;  4MEX F;  2KIF A;  3TO7 A;  3TW6 A;  3OYE A;  2L9S A;  2MD5 A;  1FJL A;  4FAS D;  3ZMV A;  3KP7 A;  3ZPL A;  1ZRF A;  1YIJ I;  3ERM A;  3WOD F;  4E4H A;  1REP C;  3RYP A;  4MEY F;  5HLH A;  1LUJ B;  3BC8 A;  2UZK A;  5E8G A;  4UVA A;  4L9V A;  2HDW A;  1B4A A;  1J7K A;  5IY5 H;  4XRM A;  1UCR A;  5J1U A;  1OCO H;  2M45 A;  2V1N A;  2FE3 A;  3I4P A;  2K02 A;  2CUF A;  2O3F A;  3GLX A;  4X1E A;  2XRN A;  4LIV A;  4BJT A;  4IRH A;  3GME A;  4V2G A;  2FQ4 A;  4YFX F;  3CDI A;  3E5X A;  5LEJ A;  1QO0 D;  2H1L A;  1DP7 P;  2K3P A;  4HNV A;  2NVU B;  4CZZ A;  4B8X A;  1T0F C;  4ZYD A;  3GTP J;  2E36 A;  3C2B A;  2XAJ A;  2QBY A;  3ZN0 A;  3I55 I;  4BEH A;  1U8R A;  3N97 A;  3OYC A;  2BHZ A;  3HOX J;  2HDD A;  4RM2 A;  3KX2 A;  2XC7 A;  2JA6 J;  3ZN1 A;  1VTN C;  1BI3 A;  3BP8 A;  1HDD C;  5DTD A;  3F3X A;  4HYE A;  4I02 A;  4YEL A;  2RQQ A;  3MQ0 A;  1WI3 A;  3MZY A;  4XRS A;  2VB6 A;  3ABM H;  3VEP A;  4XSX F;  2DU9 A;  3H5N A;  3DXJ F;  4AUX A;  2DOE A;  1BM9 A;  3OWT A;  1TWG J;  2VE8 A;  2ZNZ A;  3A01 B;  1G3W A;  4OIN F;  1SFU A;  2C6Y A;  4OU0 A;  2HQA A;  2Z33 A;  2JPC A;  3WHC A;  1J0R A;  2OZ6 A;  2Q8K A;  2XRL A;  2HU9 A;  3ECO A;  4RAY A;  5CYV A;  2FU4 A;  1LE8 B;  5J6X A;  3OYA A;  4UUV A;  2QEN A;  2I10 A;  4RB3 C;  5KK1 A;  4CUG A;  5A2Q Z;  3R0J A;  2VXZ A;  2KPM A;  3HUG B;  3MEX A;  4I09 A;  3SYT A;  3FHZ A;  4JBA A;  2XAQ A;  3CTA A;  1CF7 A;  2L0K A;  4UVB A;  2GOM A;  1OCT C;  1FBU A;  3K4L A;  3OYG A;  2LK2 A;  1T39 A;  3BWG A;  2R5Y B;  2LY2 A;  2B7E A;  4ZH4 F;  1XMA A;  4G8X A;  3COA C;  4AIJ A;  3DU6 A;  2EIL H;  4DZP A;  3Q0U A;  3IKT A;  2DA7 A;  2E5Z A;  3Q3S A;  4IHY A;  1XMX A;  1WJF A;  4IHS A;  3IRQ A;  3ABL H;  2L4M A;  4CGZ A;  4BL0 B;  1R49 A;  2X51 A;  5L3C A;  2D45 A;  4AM3 A;  4D5F A;  2E1M B;  3DEU A;  1BW5 A;  2Q2E A;  1FSH A;  2BY2 A;  2WA0 A;  2W48 A;  2KL4 A;  3HJE A;  3NAU A;  2MH9 A;  2OC6 A;  1VQP I;  2ZBK A;  4RA2 A;  2X1C A;  4EGZ A;  1A31 A;  1UB9 A;  4C2U A;  4HST A;  3ONQ A;  3GTM J;  2XIG A;  4A3I J;  2FNP A;  2LC2 A;  5E18 F;  3C7J A;  3BY6 A;  2P0W A;  2L7Z A;  2IA1 A;  2VJ5 A;  3IC7 A;  4PSW A;  4IQ4 A;  2FOW A;  3CUO A;  4PUS A;  3S1R J;  2VOO A;  2GXA A;  3FBI B;  1QQI A;  3E5Q A;  5FFZ A;  1ZHF A;  4IO9 F;  4BXX J;  2GZW A;  2PQ8 A;  1TTY A;  2RRE A;  3Q0W A;  1P6R A;  2F48 A;  3KZI C;  4II2 A;  3GZ6 A;  2ZC2 A;  2KLO A;  1QNT A;  2L9V A;  4L5I A;  2DCE A;  4C9Y A;  3TKY A;  2OUM A;  4I2O A;  4B3X A;  5DDG A;  1Z9C A;  3M3Y J;  3BJA A;  3DU5 A;  3S93 A;  4ZJZ A;  4KMU X;  3GWZ A;  1ZGA A;  2WAD A;  2W24 A;  2YPR A;  2MLG A;  5ILU A;  2QKL B;  3AFH A;  3SFZ A;  2R7W A;  4B47 A;  1YRN A;  3OR2 C;  1SVL A;  4CXF A;  4OIP F;  1W7P A;  1X1A A;  4CCL A;  2VQC A;  4Y15 A;  1N25 A;  2OU2 A;  4IPA A;  4JOM A;  1SD6 A;  1SVO A;  4EGY A;  4XLH A;  4YIR X;  1FOK A;  4OIQ F;  3EUH A;  3IWZ A;  2KIQ A;  4P1W A;  2DPU A;  2JQ7 A;  4MLO A;  1HC8 A;  2V79 A;  4Y3O A;  3HOY J;  1XGM A;  1ZKG A;  2OAZ A;  1WPK A;  1RRJ A;  4AIH A;  2QLZ A;  1R1T A;  1F4K A;  2LP0 A;  5EGO B;  4M9Z A;  5DYM A;  3H92 A;  1J5Y A;  1K4S A;  2J5P A;  3V8K A;  4HEA 2;  1MJ9 A;  1G3S A;  5IT9 Z;  1DP3 A;  3KEQ A;  4N9H A;  3DP7 A;  5JI6 A;  1Y1W J;  4O6J A;  4XLE A;  2BYV E;  5JHF A;  1KYZ A;  1U8B A;  2BXY A;  3I58 A;  3DPL C;  3CC4 I;  4MHG A;  3ASN H;  4EJV A;  4HLY A;  1MJA A;  4RGU A;  1Z0X A;  5E1W A;  1I1G A;  3SFI A;  4ENJ A;  1KU3 A;  1Y0U A;  4FQG A;  4EQQ A;  3J80 Z;  1UFM A;  2AQE A;  2CH0 A;  3K6G A;  3KP4 A;  1PUF A;  1OCR H;  1RR8 C;  1BI0 A;  5J8C A;  4BYY A;  1KU2 A;  1I39 A;  2CUE A;  2DMP A;  3A02 A;  5B5E C;  5DCM B;  2OTJ I;  3OYI A;  1WJE A;  3KPH A;  4MQV A;  4PSX A;  4Y4R A;  3TO6 A;  4L5J A;  2X4H A;  1G2H A;  3BR1 A;  5D5V B;  2JWT A;  4IHX A;  3AG1 H;  2M4K A;  3K2A A;  4ANJ A;  2CQ7 A;  4XKC A;  4PGH A;  1X1C A;  4M6X A;  4KN4 X;  4N0B A;  1Q1V A;  3OIP A;  4ZYG A;  2KIM A;  2DI3 A;  3LSP A;  3IP4 B;  1VZ0 A;  2QSF X;  5KHD A;  5LHH A;  1SAN A;  5FFX A;  5EEG A;  3MN2 A;  4PJL A;  2EH3 A;  1JHH A;  1B8I B;  4XKV A;  3S3N A;  1F5T A;  3AG4 H;  2HI3 A;  3LQR A;  2ISZ A;  3BPX A;  2VXD A;  4PDK A;  5D8K B;  5KCM A;  4OOI A;  1JI8 A;  3ELK A;  2ESH A;  4JX4 A;  5CVI A;  1HF0 A;  3I54 A;  2IS2 A;  2XGC A;  1V55 H;  3DBR B;  3KYC B;  5LRS A;  1ZYR F;  1TNT A;  2DOA A;  3HHH A;  2LNB A;  3TBI A;  2XAH A;  3K1P A;  4RLQ A;  2ID3 A;  3G73 A;  2VE9 A;  3CLO A;  3BR3 A;  3PFI A;  4KN7 X;  2LFB A;  3RQI A;  3CUQ B;  1E0E A;  1QZY A;  3JTG A;  1Z67 A;  4A5N A;  1I3A A;  1W5T A;  5FRN A;  1MH4 A;  4EM1 A;  4YRV A;  3BQZ A;  2CUZ A;  2X1E A;  1Y6I A;  3H36 A;  1UJ8 A;  1MND A;  1EH7 A;  2F5E A;  3K4B A;  4HG2 A;  2H09 A;  3GEZ A;  3M1E A;  4XKW A;  9ANT A;  1XGN A;  2QZ8 A;  4A3M J;  3OMY A;  1OCZ H;  5LGN A;  2DMT A;  1KYW A;  5F6F A;  4BQO A;  3I3L A;  2VBX A;  3MAJ A;  5M5X J;  1IO2 A;  4Y52 J;  3GTG J;  5JFR A;  1IGN A;  2O8X A;  5DUK A;  2QWW A;  2FMY A;  2E60 A;  1YYV A;  3SEQ A;  2G7U A;  2XF7 A;  2H6B A;  1MD0 A;  3CJN A;  3RTR A;  3M8E A;  3JRF A;  3PL8 A;  2R7U A;  2MD0 A;  5DV5 A;  4XIC A;  1D0Y A;  1KZH A;  2JA7 J;  4BY1 J;  4PJN A;  1LJ9 A;  4P55 A;  3ZOB A;  1E3P A;  1FSE A;  2LR8 A;  3S17 J;  5EDN A;  3PIO F;  4M3E A;  5CQE A;  2XDV A;  1WWX A;  4BXU A;  2HQ5 A;  3OOU A;  4F93 B;  3S2D J;  1BC7 C;  1K7A A;  1K6O A;  3BG3 A;  2A05 A;  3SZT A;  2L9R A;  1JUM A;  4O5V A;  1GLN A;  1GVJ A;  3CO7 C;  3AG2 H;  2RV8 A;  1S5L C;  5J40 A;  2RAE A;  1YW8 A;  4ENN A;  1TQM A;  4AC0 A;  3BR0 A;  1T0F A;  3OYJ A;  1VQ4 I;  5JVT A;  4XOP A;  4QPQ A;  4S0H B;  1LEB A;  1O7F A;  3FXQ A;  3HEF A;  4A5M A;  1IRX A;  2ID6 A;  2NAZ A;  2VPR A;  4CCM A;  4EJW A;  4BE2 A;  1MMS A;  1ZAO A;  4QWQ A;  4LB6 B;  1OMI A;  3FXM A;  4I0B A;  3G3Z A;  3V7S A;  3DKX A;  1IN4 A;  2MYS A;  1XD7 A;  2VLA A;  1W36 D;  1RUN A;  2QSH X;  5F0H A;  4EM2 A;  2W4S A;  2BW3 A;  4EM0 B;  1X2M A;  1UZC A;  3PSI A;  4XLN F;  3GTL J;  1B1B A;  2ZJP F;  3REO A;  4J01 A;  1W7P D;  2IT0 A;  5JLW A;  1OR7 C;  5GAE J;  3HDD A;  1SVM A;  5H2F C;  4BE0 A;  2Y0M A;  3OL3 A;  3W2W A;  1XX5 A;  4ZYH A;  5IP7 J;  3GZN B;  5GPA A;  2EBI A;  3RKY A;  1U9N A;  3F6V A;  4EMS A;  4A3B J;  1Z7L A;  3WU2 C;  4A93 J;  3P9K A;  2OPT A;  3JRE A;  5LRR A;  1FT9 A;  5JLX A;  3GW2 A;  5K7H A;  3K4J A;  5DEQ A;  3CDH A;  3B6A A;  1YE9 A;  2KJB A;  3ZRG A;  1QA6 A;  2HOT A;  5HOD A;  4QLC U;  3HOV J;  4ENK A;  3GXO A;  3BZ6 A;  2FA5 A;  5IYB J;  4PK4 A;  1SAU A;  2M0M A;  1L0O C;  1S7E A;  3KZY A;  1W5S A;  2VL8 A;  2ZKZ A;  3O2P E;  5CPR B;  3WHB A;  2IPQ X;  4LD5 A;  4F55 A;  3I59 A;  2MG4 A;  1UST A;  4AYB A;  5IYC J;  1DGW Y;  2CUJ A;  1HSJ A;  3S1Q J;  2ZJ2 A;  2Z9O A;  3GTO J;  2XPW A;  2PMZ N;  5E8I A;  2R7T A;  2OTL I;  2HOS A;  3CDL A;  3L2C A;  2Y30 A;  5B1B H;  3UNG C;  3G6E I;  1GDT A;  5KNL A;  3M1C A;  3K70 D;  1YW7 A;  3CES A;  3F8M A;  2RNJ A;  3A0B C;  1RKW A;  1V5F A;  3K7A J;  4G6T B;  2QSG X;  1LKX A;  1W5C C;  2OV7 A;  2WV0 A;  2MLK A;  3DTI A;  1U5T C;  3NEU A;  1QHH D;  4HQM A;  5FKN A;  4CYC A;  2WV1 A;  1SFE A;  4WCG A;  4M9S A;  2HVR A;  1AOY A;  1P4X A;  4KIG A;  3OYN A;  1N77 A;  1YRN B;  4E70 A;  4F52 A;  4BHC A;  3HXL A;  2FSW A;  5H6R A;  4L5E A;  4BE1 A;  3LWF A;  3OOP A;  2DPD A;  4A3C J;  3DBH B;  1HKT A;  3VFZ A;  4ENM A;  1FMV A;  4FT8 A;  2FXA A;  2HS5 A;  2BVL A;  3CC2 I;  4UV9 A;  3V8L A;  5E3N A;  1OYI A;  2MSY A;  3S16 J;  1LDJ A;  3H1C A;  2ISY A;  5J1R A;  2V1D A;  1QGP A;  2E1O A;  2KQR A;  5JVG F;  3HRU A;  3G2B A;  2V7F A;  2OF7 A;  2ECB A;  3FXL A;  2CWE A;  2XSD C;  3HPH A;  1QZZ A;  1TWH J;  4GO1 A;  2E19 A;  5DUI A;  2B9S A;  3VYR B;  2XVC A;  5KVR A;  3EDP A;  2GA2 A;  3DCF A;  1HW2 A;  2L02 A;  3FM3 A;  5HLG A;  3G1M A;  4C2M J;  5FKO A;  3CD6 I;  4IOA F;  4ZZL A;  2VT2 A;  4L9N A;  2BBY A;  4X0G A;  4ZZD A;  4UUS B;  3HRS A;  3R61 A;  5E1Z B;  5D6E A;  3G71 I;  1XGO A;  4NNJ A;  5D5X B;  5HVQ C;  4W97 A;  1Z7U A;  5LLQ A;  2LDU A;  4C30 A;  1A5J A;  1G59 A;  1B9N A;  2DLL A;  2IRF G;  2VBY A;  4YFK F;  4DOZ A;  5JHU A;  1P4A A;  1IN7 A;  1WH7 A;  3CC7 I;  4FX0 A;  5HDK A;  1ZQ3 P;  1XC5 A;  4XRF A;  1R5I D;  2HYF A;  2Z3Y A;  2K9L A;  4LOC A;  2KJC A;  2NVX J;  2FBH A;  4HAM A;  4Y33 A;  3F23 A;  3CMY A;  3M4O J;  2P8T A;  4RGR A;  2CQN A;  3N05 A;  5CLS A;  3V7C A;  4NDL A;  1FOX A;  4RAG A;  2ZJQ F;  1S6L A;  4J00 A;  2VOP A;  2Q0O A;  3R4K A;  4DZJ A;  3MMY B;  3BG9 A;  1NK3 P;  2GBY A;  3JRB A;  2MBF A;  3MFK A;  1FNN A;  4NQW A;  3RZD J;  1OYY A;  2I5U A;  1FIA A;  1KU9 A;  3E97 A;  3BOQ A;  1OIS A;  3JRC A;  1V54 H;  2Y48 A;  4P5O A;  1VQK I;  2AO9 A;  2RC4 A;  3LOC A;  3ZQQ A;  3TO9 A;  5EG0 B;  4IVN A;  3O8G A;  1FLI A;  2K27 A;  1YOV B;  4HA8 A;  1D1B A;  3IHU A;  2VKH A;  2FUG 2;  4LG0 B;  2IW5 A;  3GTJ J;  1NG7 A;  1ON2 A;  3MZH A;  4EEF G;  2P5V A;  1U0J A;  4I99 C;  1YHQ I;  4RM3 A;  4Y7N J;  1Z05 A;  3TW7 A;  1WKM A;  4D7M A;  2Z5U A;  3RDI A;  1JT0 A;  4BNC A;  2HOA A;  2HPM A;  2L01 A;  1SD7 A;  2OCE A;  4KIB A;  1IRG A;  3JSP A;  1YG2 A;  1K6Y A;  3S2H J;  4AIK A;  1EH8 A;  3U9G A;  1LQ1 A;  4BU2 A;  1STZ A;  1IXR C;  3DLL F;  1JTX A;  4V19 K;  2ZFW A;  1I5Z A;  5ILV A;  2NS0 A;  2I8D A;  3FMR A;  4HBL A;  2E7W A;  4XM3 A;  3O3K A;  3GTQ J;  2IBD A;  1O3Q A;  4CZC A;  2ZFU A;  2NYX A;  2QQA A;  2F5F A;  4FE4 A;  2DK8 A;  1MMG A;  2D1H A;  2G9W A;  5GAH J;  2EZK A;  2W85 A;  5D4R A;  1IRF A;  3DEE A;  2VJI A;  2ZB9 A;  5F08 A;  3CCV I;  3L2Q A;  3KE2 A;  3B02 A;  2VKD A;  4LJZ F;  1MDM A;  2P6T A;  4DQ2 A;  5ICE A;  2XRO A;  1IDZ A;  4Q47 A;  4CCK A;  2R5Z A;  3FIW A;  4IJA A;  3VSL A;  1IXS B;  2IGN A;  2R4G A;  2ZO4 A;  1U5T B;  2XGX A;  5M5Y J;  2E2J J;  2Y0S N;  3K4K A;  3R6S A;  4IHW A;  3OYK A;  4ZDO A;  1IF1 A;  3WTS C;  2FBK A;  1OLT A;  1EKE A;  4N4O B;  1TT0 A;  5EJC A;  1ZTR A;  2LMD A;  3C18 A;  3N4M A;  4EJT A;  1HW1 A;  5F1R A;  4Q48 A;  3H5R A;  1UHM A;  2DDA A;  2VC0 A;  4WF2 A;  5A2Q K;  2DO7 A;  2EFP A;  2R93 J;  2K7L A;  4GYG A;  5FRO A;  4CH7 A;  2L7F P;  1VI0 A;  3JRH A;  2XGE A;  4HDV A;  3PQJ A;  5J4V A;  4I6Z A;  2LOO A;  1NTC A;  5CQG A;  3F22 A;  1QU3 A;  4IXA A;  1ZR4 A;  4DYQ A;  2K86 A;  1WJC A;  3JAM Z;  3OY9 A;  4BY7 J;  4RLF A;  4YFN F;  4XL9 A;  2NOJ B;  2M7A A;  3AL0 B;  2VAS A;  3KIO A;  1YI2 I;  4YIF A;  5FD6 A;  1LPQ A;  3PJR A;  2VQH A;  2Z99 A;  1E3O C;  1VQ9 I;  2LVS A;  3BCB A;  4I7H A;  2XAS A;  1Z6T A;  1MSF C;  3L1P A;  1FOY A;  2A3S A;  3EPZ A;  1XB4 A;  2X1D A;  4II3 A;  2JN6 A;  2BY0 A;  4A3F J;  3UR3 C;  1GT0 C;  2UWM A;  2VBW A;  4ZTF A;  1A6I A;  4LMY A;  4R79 A;  1JJ6 C;  2CQQ A;  2ICW G;  4U0W A;  4RMN A;  3HTS B;  2LYC A;  5M3F J;  1UAA A;  3I56 I;  3FWE A;  3RCO A;  4KUM A;  5AIP A;  3NAR A;  1DU6 A;  2IEK A;  1LEA A;  2A61 A;  2NNY A;  3GUD A;  4BQN A;  2HTJ A;  1D0Z A;  3CUQ C;  1VQ8 I;  4BHB A;  4EAT A;  3LQQ A;  3H5A A;  3MKL A;  1ETV A;  3ZP5 A;  1XG1 A;  1PYV A;  1XCB A;  1O7L A;  5HNF A;  1W1W E;  1BA5 A;  4UB8 C;  1VQ5 I;  3JW4 A;  2VQG A;  3CME I;  2DTZ A;  2IA2 A;  2PEX A;  1TZL A;  4A3E J;  1H8A C;  3WE2 A;  2BY3 A;  1S29 A;  2MGQ A;  4A0X A;  2JRT A;  2FD5 A;  3H3U A;  5L3F A;  2E7X A;  3MKW B;  4BBR J;  1VQN I;  4MTD A;  2W00 A;  1G4D A;  1ON1 A;  3FXO A;  3FDY A;  4F7Z A;  3PUB A;  3C2H A;  2JJ7 A;  3F0C A;  1A36 A;  3E3V A;  1EJ9 A;  3A03 A;  3PSF A;  3F21 A;  4IEJ A;  1R6R A;  2BV6 A;  2IGK A;  4RB1 A;  3WGI A;  2ADU A;  5M5W J;  3TL4 X;  1WJB A;  4WXD A;  4IRG A;  3SQN A;  4AVZ A;  4ESB A;  2V1X A;  1GUU A;  4B1R A;  1FYM A;  2WB1 N;  2ZME B;  5GAG J;  1DDN A;  3GX4 X;  3GF2 A;  4XLP F;  2JT1 A;  3JRG A;  2WY8 Q;  4BJ6 C;  1XSX A;  3MD2 A;  1BR4 A;  3DQV C;  4Z2Y A;  4JX5 A;  4U7D A;  2DMQ A;  4KFC A;  2HEO A;  1BR1 A;  5J3L A;  5IT9 K;  2GOX B;  4QPO A;  2X6W A;  2WTE A;  5HS7 A;  2KRC A;  2O03 A;  4LLN A;  1DU0 A;  2CW8 A;  3SZP A;  2CJJ A;  5TRD A;  2P81 A;  3R0A A;  3P9C A;  2XPU A;  5EF6 A;  3J80 K;  3V7R A;  2YSR A;  1DGR M;  5K5R A;  2L4A A;  5E3O A;  2H27 A;  5BS6 A;  5AIQ A;  3EUK L;  2XAU A;  4LG3 A;  3QPS A;  5LD2 C;  2Y9Y A;  1BC8 C;  1J9I A;  3KCC A;  3HOT A;  4A0Y A;  2KZV A;  3KYD B;  1GV5 A;  1YQA A;  2FNA A;  2KT0 A;  5IP6 A;  3SHF A;  1ITY A;  3HIF A;  2GM4 A;  3IV5 A;  1VQ7 I;  1MMA A;  4R1H A;  4F92 B;  3A01 A;  4I76 A;  1B72 B;  3J81 Z;  1RET A;  2HTS A;  1WQ2 A;  3SJM A;  2BGC A;  4XOT A;  3E5U A;  2E71 A;  1R36 A;  2DYS H;  2JK3 A;  2K4J A;  3LSK A;  1ZLJ A;  2GWR A;  2DA6 A;  3OL4 A;  2RQP A;  2F2E A;  1LE8 A;  4IF4 A;  3JRD A;  5D4S A;  4MNU A;  5C3E J;  3M8F A;  2HVQ A;  2HFH A;  3KZZ A;  1JE8 A;  1VQL I;  3HUG A;  1TBX A;  4M3F A;  3FF5 A;  2DK5 A;  1J09 A;  5L3D A;  3IKV A;  1Y8R B;  5E79 C;  3F9K A;  2CW7 A;  2AS5 F;  1AA7 A;  5K7Z A;  1IC8 A;  4D9J A;  4UV8 A;  4YEJ A;  4A0Z A;  2WAF A;  3DTK A;  3K0L A;  1OPC A;  1OCC H;  5L3G A;  1AKH B;  4E7L A;  4UXN A;  2M0C A;  3SDG A;  3PNV A;  3OYM A;  4JQF A;  3PO3 J;  4XON A;  2DW4 A;  4A3J J;  4ASN A;  4M9X A;  2CMP A;  5FKL A;  1JUP A;  4NC7 A;  3SZG A;  1ZG5 A;  3QPH A;  3CJR B;  3PIP F;  1R4M B;  4AVP A;  2Q1Z B;  2R3S A;  3D1N I;  5FLV A;  3K4M A;  4XN3 A;  2JVH A;  4ZTJ A;  4IHT A;  1JT6 A;  1QHG A;  3BQY A;  1XN7 A;  4C3H J;  2EFQ A;  2LBF B;  3GFM A;  4JK1 X;  1H88 C;  2XUB A;  4C3J J;  2ACJ A;  2NVT J;  2JA5 J;  2W1O A;  1P7I A;  3ABU A;  2IS4 A;  3BR2 A;  3PNT A;  3HB9 A;  1YJN I;  2HVS A;  2OQR A;  2STW A;  2M4G A;  4JYK A;  5TGT A;  2RKH A;  3L00 A;  4XNF A;  3OS0 A;  4KIS A;  2EIK H;  1FY7 A;  2JUC A;  3GFL A;  2VJJ A;  4B3A A;  4HF1 A;  2H8R A;  1RZ4 A;  4BAY A;  1UG2 A;  3CP8 A;  1YX3 A;  1KQ8 A;  3WTZ A;  2D5V A;  3CLQ A;  3PUF A;  1GXP A;  1G3T A;  1HDP A;  1OQY A;  1PVE A;  3CF5 F;  1WVR A;  3DEW A;  4HF2 A;  2VON A;  2DTR A;  2M5W A;  2M30 A;  1IZ1 A;  3WTU C;  4E7S A;  4XBF A;  2PMH A;  2R7R A;  3W2A A;  1UHW A;  3P7N A;  1ETQ A;  5FO5 A;  4GDF A;  3T8T A;  3VOD A;  3LSJ A;  4MO7 A;  2CQX A;  2PFB A;  2DYR H;  3O6B B;  4KIF A;  3ZQH A;  2O6G E;  2X9D A;  1YS7 A;  2WY7 Q;  2L54 A;  1MZB A;  2ZJR F;  3CCE I;  1XPX A;  1PP7 U;  1KGS A;  2XAF A;  1A04 A;  2O9L A;  1IN6 A;  3GLL A;  4I0A A;  2AHQ A;  3HKZ N;  4BDZ A;  1OFC X;  2KDZ A;  1XS9 A;  4WX9 A;  4G6Q A;  5EGO A;  5F27 A;  3LSG A;  1XSV A;  3RQ4 A;  3ZCO A;  1U3E M;  1Z1D A;  3IL2 A;  3FXJ A;  2EA2 A;  2M3A A;  3QYB A;  4RGS A;  4CO8 A;  2M2E A;  2B0L A;  1IUF A;  1UG0 A;  5C44 J;  2DQR A;  4QTR A;  4KIC A;  1S72 I;  2P4W A;  1UEL B;  5TIS C;  3JR9 A;  3OSG A;  5EYR A;  2PJR B;  1BJZ A;  1WH5 A;  3BDD A;  3F6O A;  2E34 A;  3MKZ A;  2ELJ A;  3ABT A;  3S32 A;  1NK2 P;  1R9T J;  4OAY A;  4BAC A;  3FKI J;  2EZH A;  4AD9 A;  2KIU A;  2E1N A;  2BE5 F;  4HW0 A;  4WXC A;  2YS9 A;  1QPM A;  5IPA A;  2LLK A;  4AID A;  3X2Q H;  1ZRD A;  2EFO A;  5FKK A;  5J8F A;  3PQK A;  3WGG A;  3F8N A;  1M1E B;  5DCM A;  1TL8 A;  1EH6 A;  4BGD A;  3HBL A;  1CQT A;  3QAH A;  4HV6 A;  3G4S I;  3LSI A;  3OS2 A;  1RES A;  2EIM H;  3LSR A;  1IG7 A;  1R5H A;  4B44 A;  5C4X J;  3FHN A;  3RI4 A;  3F8B A;  1MSE C;  3T0Y A;  3Q0V A;  4EJU A;  3I0T A;  3DKW A;  4FTH A;  3QPL A;  5HOO A;  1PP8 F;  2AQF A;  2IVM A;  5AON A;  3LSH A;  5FKM A;  3I4N J;  5FD5 A;  5E3L A;  1ETX A;  2MA3 A;  5EEA A;  1B8I A;  3S1M J;  1K79 A;  1RR7 A;  5L3E A;  1K78 B;  5K1Y A;  1H89 C;  4OIO F;  2DA5 A;  1KON A;  2WAQ N;  1L3L A;  1HCR A;  3QP6 A;  2CU7 A;  1MGT A;  2K9M A;  2LY1 A;  4GYI A;  3WE3 A;  5B1A H;  3VWB A;  1BI2 A;  1I6X A;  1Z21 A;  3E6M A;  3TDZ C;  3ECH A;  3BZC A;  4V2F A;  2VOD A;  3NRV A;  1FMW A;  1T08 B;  3PNY A;  2ELH A;  2KMU A;  2X48 A;  3GFI A;  1TLH B;  1LVK A;  4CCO A;  2MC4 A;  1I6H J;  3L2U A;  2JTV A;  2O7O A;  1BIB A;  4GCV A;  4ESJ A;  4IL6 C;  2TCT A;  3CUQ A;  3KYL A;  3HOZ J;  1V3F A;  2EIN H;  2RGV A;  3GYH X;  3J7Y J;  3TDU C;  5KAI C;  2QF7 A;  3VDX A;  2HDC A;  1O3T A;  2ECC A;  2L2O A;  4OMZ A;  2PN6 A;  1ENH A;  5F0F A;  3H0D A;  2HYJ A;  4U87 A;  1Y8Q B;  1MBE A;  3LSM A;  3TP0 A;  4LK1 F;  4IZZ A;  2O5R A;  5DM6 F;  1IAW A;  2CGP A;  5BMZ A;  2COB A;  2M1B A;  2A07 F;  2DXI A;  1AHD P;  3LL7 A;  3OYD A;  2DFF A;  3DPU A;  4L9J A;  4LIT A;  5E17 F;  1D1A A;  4PFO A;  4A6E A;  4KIT B;  3OR1 C;  2P7V B;  4XLF A;  2TRT A;  2DN0 A;  1MBH A;  2ME6 A;  4UNO A;  4UY8 I;  4Q5S F;  3W6J B;  1G6N A;  3EUH C;  2X85 A;  2VUM J;  2DJN A;  1LFB A;  3ZMU A;  3KEY A;  1TWC J;  1YJW I;  2F4I A;  4BJ5 C;  3ZQC A;  1X4O A;  5HS8 A;  1Z3Y A;  2NNN A;  2E1C A;  2EB7 A;  4XLC A;  3BZK A;  4XK4 A;  2HQR A;  5BNG A;  2BY1 A;  4MFE A;  1MNM C;  5E3M A;  2NS8 A;  2YX7 A;  3VYS B;  5LFA A;  4DIQ A;  3BRO A;  2VQL A;  5BPI A;  4QSH A;  1ZEL A;  4BHP A;  1R4N B;  2BOL A;  3F8C A;  3FIS A;  2K40 A;  1VQO I;  2R7S A;  3AL0 C;  3JCU C;  5EZH A;  2M8G X;  3DFG A;  3CCU I;  4P96 A;  1YTY A;  4D0P A;  4S04 A;  3H3V K;  1KQ0 A;  3H9J A;  2QBY B;  1N78 A;  3BG7 A;  3L9F A;  4BEH B;  3T5X A;  1VFC A;  1RKT A;  4D1Q A;  2JMW A;  2H6C A;  2OA4 A;  2WAE A;  1R1V A;  2VKE A;  4RGX A;  1IUY A;  1TNS A;  2F5C A;  5GTH C;  4L9T A;  2GXG A;  4ZDP A;  2LSO A;  2EQR A;  4CCN A;  3M8J A;  4XKB A;  2QA4 I;  4XMY A;  3IRR A;  1VQ6 I;  3A2K A;  2FOK A;  1X58 A;  1HBX G;  1H9G A;  3CO6 C;  3L2V A;  2IS1 A;  1FBQ A;  4H4K C;  2QUF A;  4IQJ A;  2XKO A;  1W4M A;  1ZAR A;  4RDU A;  3RSN A;  1D5Y A;  4BDY A;  2DA4 A;  1B59 A;  4G7H F;  1RIO H;  2VT3 A;  1F43 A;  2VC1 A;  3D5R C;  2XHK A;  1ZN2 A;  1ZGJ A;  1RPW A;  4HNT A;  3HM5 A;  1QZE A;  3BTI A;  3T8R A;  1R71 A;  3JTH A;  4CDG A;  2GLO A;  2HKX A;  1HKQ A;  3KLO A;  3NWT A;  1ETK A;  1R7J A;  1EF4 A;  1CF7 B;  3ZXS A;  2L3D A;  3HGY A;  3PFY A;  3OSF A;  1FX7 A;  4GFB A;  2NRA C;  5B3S H;  1JXS A;  2L7K A;  4G94 A;  4CCJ A;  1QBJ A;  5FLX Z;  1J2X A;  3ROU A;  2IGM A;  1YX5 A;  1ZRE A;  1R1U A;  3S3O A;  4M6V A;  3WG7 H;  4A69 C;  4KDP A;  1BOA A;  2GQQ A;  2HYG D;  2E35 A;  3OYF A;  2WWY A;  2M7B A;  4BBS J;  2B63 J;  2Q2E B;  4IHV A;  1X4P A;  2FRH A;  4OAZ A;  4NBQ A;  1JJ8 C;  1X1B A;  3BTC A;  2ZME C;  4AWX B;  5LBQ A;  1HKS A;  1TC3 C;  1D8K A;  3I9V 2;  3E6B A;  2HR3 A;  4EV0 A;  1V5G A;  4FE7 A;  1IN8 A;  2IA0 A;  1ZR2 A;  1MMN A;  2LKS A;  3PM1 A;  5IOY A;  1S3J A;  4OMY A;  1O57 A;  3BCA A;  3ZR8 X;  4M74 A;  3W6K B;  1MKM A;  4J19 A;  2BHY A;  2M34 A;  5EZG A;  1ORK A;  1Y1V J;  4LFU A;  4IRI A;  3J7Z I;  2DQL A;  2LG4 A;  4HZF A;  3W6V A;  2GIZ A;  2NS7 A;  3BG6 A;  3IAM 2;  2Z2S B;  1T6S A;  4K2E A;  3AKZ A;  2R7O A;  1SC7 A;  1SFK A;  5H6Q A;  1A6Q A;  3M07 A;  2PMZ A;  4FCY A;  5IYD J;  2OCC H;  2DBB A;  4B4C A;  2FX0 A;  3HL2 A;  4HOB A;  1ZG3 A;  2KKO A;  2QQ9 A;  2K9N A;  1LVA A;  5IP9 J;  2NOG A;  4Y13 A;  2D2W A;  2VPL A;  3I5U A;  2A6E F;  1BJA A;  2R7D A;  4NC8 A;  1XDS A;  3I4M J;  4MTE A;  1LDD A;  5BOX A;  2PMU A;  5HNH A;  4LLG F;  2HKO A;  2QYO A;  2JVG A;  5DD4 A;  1ERD A;  5ILS A;  3A1Y A;  2QGU A;  3EYY A;  1X3W B;  3ESW B;  3AG3 H;  3FBN B;  4RAF A;  2LD5 A;  1SAX A;  1Y39 A;  1W7P B;  4G7O F;  3JAM K;  2DFI A;  4I98 B;  1GVD A;  3DKY A;  2N8G A;  2Y69 H;  2DAO A;  3M9A A;  1R5G A;  4A3D J;  3QYF A;  3LNQ A;  2EZI A;  4LGW A;  3VPR A;  2DFH A;  2R92 J;  2PX9 A;  4XSZ F;  3H0G J;  1BBY A;  1P2F A;  3CMA I;  1TQP A;  5D5U B;  2KRH A;  2QQ8 A;  5JR3 A;  3HTU A;  5CKT A;  4UUS A;  1TWA J;  4DYC A;  1Z6R A;  3KLN A;  2PI0 A;  2DMU A;  2DT7 B;  1LB2 A;  4EJO A;  3FXK A;  3O8H A;  4YII A;  5GTI C;  3B73 A;  1SD4 A;  1XDU A;  2RN7 A;  1OJL A;  1S7A A;  1K4T A;  1IJW C;  4XLA A;  5J47 A;  5CVJ A;  2DA3 A;  4Z6Y A;  4HX4 A;  2E2I J;  4C2T A;  1IRZ A;  3T1B A;  3ZMZ A;  3ABK H;  1PUF B;  3VOE A;  3WTY C;  1ZRC A;  3CF2 A;  4M3G A;  4U7B A;  1TP4 A;  2KFD A;  2PG4 A;  3WU0 A;  2BVM A;  2XPV A;  4A2U A;  2X6X A;  5BPD A;  2QEX I;  4BXF A;  4RB0 A;  2LKX A;  3H9G A;  1DQU A;  4IOC F;  2V1U A;  5H20 A;  4BKX A;  2O0Y A;  2K5C A;  2UUZ A;  4XR6 A;  2FJ1 A;  5DD8 A;  4S05 A;  3EYI A;  2L7M P;  1KA8 A;  5FLM J;  5HLI A;  3TED A;  2NVY J;  1FTT A;  2CS3 A;  5D6F A;  3U2R A;  1QPI A;  4HRI A;  1FYK A;  1BL0 A;  3S8P A;  1R23 A;  2G0E A;  1G3Y A;  2A69 F;  4ZYA A;  4WXH A;  3K1N A;  3RKQ A;  3L09 A;  3QOE A;  2YUS A;  4M71 A;  1OR7 A;  5EG0 A;  2V6E A;  5CVV A;  2M9H A;  5CJ9 A;  1P7J A;  3S15 J;  2UV1 A;  4M3B A;  3RPQ A;  4LG0 A;  2HWV A;  1S9H A;  3D5L A;  2X6O A;  5D5W B;  5FB2 A;  4MQ9 F;  3HC7 A;  2EIJ H;  2G7H A;  2JZY A;  1SD5 A;  4HLX A;  1WJ5 A;  2YU9 J;  2XAG A;  1HA8 A;  4KMF A;  2QQB A;  2LH9 A;  1S7O A;  2R7F A;  2HGC A;  3QOP A;  2CFX A;  1O3R A;  4DJA A;  2VJ4 A;  1ETO A;  1QVT A;  3I53 A;  3KFW X;  1WSU A;  3KET A;  2L9N A;  1D1C A;  1SMY F;  3LMM A;  2QVO A;  4NB5 A;  1HXD A;  2FEZ A;  5K5O A;  2DJI A;  2P5K A;  1HST A;  1FEX A;  3BR6 A;  3ZQ7 A;  3MVP A;  3HRM A;  2R0Q C;  1WJD A;  1QRY A;  5IOZ A;  1GXQ A;  2EV6 A;  2VN2 A;  3LFK A;  3HSF A;  1Y0N A;  3TP3 A;  2H8W A;  2HPI A;  3V4G A;  1CGP A;  3IAS 2;  4CA0 A;  2CSO A;  4A6D A;  1IXC A;  1BI1 A;  4PGG A;  1IDY A;  1FP1 D;  4ZDL A;  2OD5 A;  4QIW N;  1RC9 A;  4L18 B;  1ZG1 A;  3BT9 A;  4NUB A;  1ZK8 A;  5CVR A;  5LGT A;  1FBS A;  3CZ6 A;  1T38 A;  2CYY A;  3F72 A;  2F6C A;  1B9M A;  4W1U A;  1Q1H A;  4P9U A;  2OQG A;  2JSP A;  4CSW A;  1BN5 A;  3TOB A;  1AWC A;  1MBJ A;  4G12 A;  4DW6 A;  1DPR A;  1FOW A;  3BG5 A;  2EFN A;  3ZMD A;  1U5T A;  3Q9V A;  3OIQ A;  1D3Y A;  1N75 A;  3GBG A;  3J81 K;  1HOM A;  1A35 A;  3AAF A;  5BQT A;  3W3C A;  2V4J C;  3CMM A;  1I50 J;  1JHF A;  2EWN A;  3S1N J;  2EFW A;  2LY9 A;  3DLA A;  4B43 A;  4E7K A;  1R00 A;  5HDN A;  1X3U A;  3ZQI A;  2IGO A;  1MNE A;  2PLY A;  5K7F A;  1OKR A;  4ITV A;  1TW3 A;  5E20 A;  2MC3 A;  1XSD A;  2HOE A;  2Y0S A;  3BPV A;  1WHU A;  3FXR A;  2Y2Z A;  2XF5 A;  4FX4 A;  5ICC A;  4M6Y A;  1T98 A;  3ZGK A;  1D5V A;  1MBG A;  3WTV C;  4LB5 A;  4P9F A;  1V4R A;  3FK7 A;  2RDP A;  4A12 A;  4MGR A;  3K9T A;  1MJB A;  4R8H A;  1DPU A;  3C3W A;  1VQM I;  1TW2 A;  2K4B A;  2V9V A;  1U9O A;  3E6C C;  1F1Z A;  1R58 A;  3HHG A;  4WK8 F;  5M3M J;  1APL C;  2HZT A;  5CVU A;  3QQA A;  3QWL A;  4PJ0 C;  3C2G A;  3H9Q A;  4DNC A;  3EUA A;  2P5L C;  2QKM B;  1YS6 A;  4E7Z A;  2CG4 A;  2FF4 A;  3EET A;  3C1D A;  1R22 A;  2V9P A;  3BLY A;  3ML6 A;  5EEH A;  2LRE A;  3LAP A;  3CCL I;  3D0S A;  2R5Y A;  3CCJ I;  1T33 A;  2H1K A;  2HZD A;  2K3F A;  5ICG A;  2CFO A;  2MW8 A;  1W0U A;  2ELK A;  1BR2 A;  2LTP A;  3WTW C;  2QCO A;  1YW9 A;  2BW3 B;  2ESN A;  3Q9S A;  2CV2 A;  2HXI A;  4NHJ A;  1P92 A;  4ZYE A;  2FQ3 A;  1T2K A;  3ZQG A;  3GO5 A;  1YFH A;  1G8X A;  4KNY A;  3VYT B;  2A6H F;  3G1L A;  3R60 A;  2VKV A;  3K4N A;  4AU7 A;  2R7Z J;  1DUX C;  4HX8 A;  4BQA A;  5FGM A;  1JKO C;  2K9Q A;  3A0H C;  1MBK A;  4UHT A;  4U88 A;  1NH3 A;  3MCZ A;  1YIO A;  2IP2 A;  4E7J A;  1T8I A;  1TT5 B;  2JSC A;  4U0V A;  1IN5 A;  1YLF A;  2XSJ C;  4AYB N;  2WBM A;  1BOB A;  1NG6 A;  5ED4 A;  1OCP A;  1ODD A;  3OIO A;  3CJT B;  1U78 A;  3HSE A;  5HS9 A;  4EVI A;  1HW5 A;  2ZCW A;  1RUO A;  1JTY A;  1Z77 A;  1IV6 A;  1JGG A;  2W7N A;  1ZH5 A;  1IV8 A;  3I59 B;  4G6D A;  4NC6 A;  4D5C A;  1MH3 A;  3RJP A;  4FIS A;  1H0M A;  2TDX A;  2IAI A;  3K4C A;  1S8N A;  3H35 A;  3K10 A;  3U21 A;  2XKP A;  3M7G A;  2VI6 A;  2ZME A;  3LA2 A;  3IH2 A;  4DGW B;  2V9K A;  4GGG A;  1HQC A;  4HX7 A;  4JP0 A;  3NQO A;  1X19 A;  1JKQ C;  2CO5 A;  2JA8 J;  4CYC B;  3ULQ B;  4HSR A;  2ZXI A;  2RNG A;  1X1D A;  2WB1 A;  1X3Z B;  1WJA A;  1IW7 F;  2F5V A;  4C3I J;  2KHM A;  4CYD A;  3I64 A;  3VYU B;  2FBI A;  3FK6 A;  1SFO J;  2CW0 F;  5J1Y A;  4I01 A;  1O3S A;  3BR5 A;  1WI9 A;  2ZSI B;  1JGS A;  2EV0 A;  3ASO H;  4A3G J;  2L5Q A;  1XTA A;  3E0J B;  4MIM A;  3D5S C;  2YR2 A;  3IH4 A;  4DBQ A;  4PJJ A;  1D0X A;  3CQZ J;  1SFX A;  3K1M A;  4M3D A;  4ESF A;  2AXT C;  2M8E A;  3OYL A;  2Y9Z A;  1YIT I;  2DFE A;  5J4Y A;  2ME0 A;  1LFU P;  4L0Y B;  1X1P A;  4KA4 A;  3CCR I;  1WZ2 A;  2A6T A;  2ZXW H;  4U0Y A;  2DA1 A;  5IT3 A;  2O8K A;  1HLV A;  1U2W A;  4E7H A;  3UKG A;  1LNW A;  5F0C A;  3FXU A;  1E17 A;  3TMO A;  4O3M A;  4RBO A;  1B72 A;  3OYH A;  1BW6 A;  4G7Z F;  3RPU A;  3WGH A;  2NVQ J;  2EPF A;  2GIV A;  1YJ9 I;  2F5D A;  4ON0 A;  3RIR A;  2W84 A;  5C4J J;  1ONV A;  2A5Y B;  3GTK J;  2H94 A;  3RYR A;  3Q5F A;  2UXX A;  4BUP A;  1F9N A;  3FMS A;  4RS8 A;  4HQE A;  4D7N A;  4ETS A;  2RVC A;  3WTT C;  1POG A;  3P9I A;  4HPQ A;  3QOD A;  1W0T A;  3BJ6 A;  2IJL A;  2MAB A;  1MBF A;  2DA2 A;  2PBI A;  1TQI A;  2JPB A;  2YU3 A;  5E1X A;  1SEU A;  1WFX A;  2V26 A;  3QP5 A;  3ZQF A;  2DOD A;  4Y17 A;  2EA4 A;  3OV8 A;  2MH2 A;  4HF0 A;  1FWZ A;  3SDB A;  1RI7 A;  1T56 A;  1U6G A;  2XV4 S;  3PO2 J;  1ULY A;  1BIA A;  4RAZ A;  3L7W A;  4XN0 A;  5HLT A;  1JUS A;  4KJZ A;  4H0E A;  3LST A;  1AKH A;  1VF9 A;  2AXL A;  3E7L A;  2R7X A;  2VIX A;  2EJR A;  5F64 A;  4PFP A;  3DV8 A;  3VB2 A;  2OJE D;  2ZXJ A;  3L2R A;  2PJP A;  2IS6 A;  5KAF C;  3KP2 A;  4OIR F;  2Y31 A;  2ZSH B;  4X6A J;  1TWF J;  2J5O A;  3FM5 A;  1UHS A;  1I3Q J;  2CQK A;  2V6C A;  4NQW B;  3RKX A;  3DWL E;  3QPT A;  5GP9 A;  2OZU A;  2Y75 A;  3IWF A;  4KT6 A;  1GV2 A;  4L0Z B;  2W57 A;  2UXN A;  2NXN B;  2KZG A;  5B66 C;  2ETH A;  2GA1 A;  2KDO A;  4N4N B;  4UVC A;  3RKW A;  2LBF A;  1MW7 A;  1WCM J;  2LF8 A;  2OBP A;  5HDG A;  4HDU A;  2CV1 A;  3HZJ A;  3HPG A;  3A4C A;  3LAJ A;  2STT A;  2F4O B;  3TOA A;  4B48 A;  3DF8 A;  3IH3 A;  2ZXH A;  1W36 C;  1FIP A;  2HQN A;  1ZGW A;  4XID A;  1E2X A;  1UMQ A;  2JA2 A;  4FHT A;  2LRD A;  3ZMS A;  1KQ9 A;  1P4W A;  3DPT A;  2EZL A;  3CCQ I;  1PJR A;  1LFP A;  1XGS A;  3KEO A;  3ZMT A;  5TJJ A;  3DTE A;  2P7C B;  3LFU A;  2D1V A;  2HNH A;  4JX6 A;  2QM3 A;  2KP6 A;  2F4M B;  3CP2 A;  4XOR A;  3HSR A;  3OS1 A;  3JSO A;  1K61 A;  3GFJ A;  2O61 A;  1GHC A;  4M72 A;  4BH9 A;  1ACI A;  1LDK B;  1OYW A;  3FX3 A;  2XB0 X;  5DM7 F;  1FZP B;  2K85 A;  5FJ8 J;  2KRF A;  4OWR B;  3V8J A;  3FZV A;  3HG9 A;  4RB2 C;  1ETW A;  4KT5 C;  4N9I A;  3TGN A;  1RNL A;  2XF6 A;  4A3L J;  5FRM A;  4F91 B;  1FC3 A;  2XGD A;  3BTL A;  4UUT A;  1K83 J;  4IX7 A;  1Z3X A;  3S2W A;  1EA3 A;  1MDM B;  2EV5 A;  3CCS I;  1PUE E;  1V5E A;  2EK5 A;  4Q4Z F;  3IUO A;  3JRA A;  3MWM A;  4YG2 F;  2R5Z B;  2ZNY A;  3FKJ A;  5LGU A;  1J75 A;  2HXO A;  2JRM A;  3LA3 A;  5ERI A;  3HGG A;  1Z91 A;  1FPQ A;  4LIU A;  3V42 A;  1MMD A;  2MFZ A;  3HRT A;  1J59 A;  2W82 A;  2BEO A;  3TQN A;  3SXY A;  3HKZ A;  2KIS A;  3I71 A;  3K70 C;  5L3B A;  1O4X A;  2DT6 A;  2YX4 A;  4ZC3 A;  3KP6 A;  3KP5 A;  3B6C A;  5DS9 A;  4GRI A;  2PJR A;  3H3Z A;  3BTJ A;  3P5J A;  1D8J A;  3CCM I;  4E6K G;  2DT5 A;  2Z1D A;  1I27 A;  1XMK A;  2LF7 A;  1AU7 A;  3NWS A;  3OYB A;  5GAD J;  2IXS A;  4WWC A;  1XCV A;  3HOU J;  3K69 A;  1T95 A;  4GXO A;  1QVU A;  3CCY A;  3G1O A;  1P9Q C;  4DBR A;  3DBL B;  3F8F A;  2FML A;  2CRG A;  3ISP A;  5FLX K;  4TV7 A;  3L2W A;  2VBZ A;  1ZLK A;  2R7V A;  4UB6 C;  2DDB A;  3VSK A;  1KU7 A;  1F36 A;  4BQQ A;  3QYE A;  5LEK A;  4E7I A;  3ERE D;  3J7A O;  4CIC A;  3QU6 A;  5LHG A;  3ZQL A;  1NHA A;  3HYI A;  2JUG A;  2DOF A;  1FYL A;  1WGX A;  2XB5 A;  4BS9 A;  3K2Z A; 
#chains in the Genus database with same CATH homology
 1X2M A;  4ABZ A;  2LKX A;  3JRI A;  3GTL J;  4BKX A;  2FJ1 A;  5JLW A;  2DMN A;  2L7M P;  5FLM J;  3HDD A;  4MFD A;  3TED A;  2NVY J;  5K7Z A;  1IC8 A;  1FTT A;  1QPI A;  4A3K J;  1BL0 A;  1FTZ A;  5IP7 J;  1JKP C;  5GPA A;  2G0E A;  2EBI A;  1U9N A;  4A3B J;  3RZO J;  4XRS G;  1ETY A;  1AKH B;  4A93 J;  2OPT A;  2M0C A;  3SDG A;  3JRE A;  3HOW J;  3PO3 J;  3RKQ A;  4A3J J;  2YUS A;  5F1J A;  5JLX A;  2E2H J;  5K7H A;  5EG0 A;  3B6A A;  5FKL A;  2HOT A;  1JUP A;  5HOD A;  3HOV J;  2M9H A;  1P7J A;  1JKR C;  3S15 J;  4M3B A;  5IYB J;  2X6O A;  1S7E A;  3D1N I;  5FLV A;  1JT6 A;  3BQY A;  5F04 A;  3WHB A;  4C3H J;  2MG4 A;  2YU9 J;  5GPC A;  5IYC J;  1X2N A;  3S1Q J;  1H88 C;  4DYR A;  4C3J J;  1ETO A;  2XPW A;  3GTO J;  2PMZ N;  2NVT J;  2JA5 J;  1QVT A;  1P7I A;  3CDL A;  1GDT A;  2Y30 A;  2HOS A;  3BR2 A;  3HB9 A;  1VND A;  2K9S A;  4JYK A;  1FEX A;  3BR6 A;  3S14 J;  3MVP A;  1RKW A;  2R0Q C;  5IOZ A;  1QRY A;  3K7A J;  4B3A A;  3TW6 A;  3TP3 A;  2H8R A;  1UG2 A;  1FJL A;  2D5V A;  1IDY A;  4CYC A;  5FKN A;  4QIW N;  2WV1 A;  3BT9 A;  1ZK8 A;  1HDP A;  3DEW A;  4W1U A;  4XRM A;  5J1U A;  1ETQ A;  4L5E A;  3LSJ A;  4MO7 A;  1MBJ A;  2CQX A;  4G12 A;  2CUF A;  3ZQH A;  4DW6 A;  3BG5 A;  2X9D A;  4X1E A;  4A3C J;  3GBG A;  1HOM A;  4V2G A;  2FQ4 A;  2O9L A;  1I50 J;  3S1N J;  4HNV A;  5E3N A;  2AHQ A;  3HKZ N;  2MSY A;  1OFC X;  2LY9 A;  2KDZ A;  1XS9 A;  3S16 J;  5J1R A;  2E1O A;  3GTP J;  5EGO A;  3C2B A;  3ZQI A;  5F27 A;  3LSG A;  5K7F A;  2OF7 A;  2ECB A;  2XSD C;  3HOX J;  1TWH J;  2E19 A;  2Y2Z A;  2HDD A;  2M2E A;  1IUF A;  5C44 J;  2JA6 J;  4QTR A;  3DCF A;  1MBG A;  1HDD C;  5DTD A;  3G1M A;  4C2M J;  3JR9 A;  1WI3 A;  3FK7 A;  5FKO A;  4XRS A;  3OSG A;  5EYR A;  1BJZ A;  1WH5 A;  1NK2 P;  4UUS B;  4AUX A;  1R9T J;  3FKI J;  2EZH A;  1U9O A;  1TWG J;  2YS9 A;  4W97 A;  5IPA A;  2LLK A;  3A01 B;  5M3M J;  5FKK A;  1APL C;  1A5J A;  3WHC A;  3QQA A;  2XRL A;  1LE8 B;  3HBL A;  1CQT A;  1WH7 A;  2R5Y A;  2I10 A;  1ZQ3 P;  1RES A;  1XC5 A;  1T33 A;  3LSR A;  1IG7 A;  2H1K A;  5C4X J;  2MW8 A;  1W0U A;  2ELK A;  4LOC A;  1MSE C;  2LTP A;  2NVX J;  2QCO A;  3Q0V A;  2L0K A;  3CMY A;  3M4O J;  4FTH A;  3QPL A;  1OCT C;  2LK2 A;  2HXI A;  4NDL A;  2R5Y B;  5FKM A;  3ZQG A;  3I4N J;  5E3L A;  1ETX A;  5EEA A;  1B8I A;  4DZP A;  3S1M J;  4DZJ A;  3G1L A;  3Q0U A;  1RR7 A;  2VKV A;  3BG9 A;  1NK3 P;  2DA7 A;  3Q3S A;  2GBY A;  3JRB A;  4IHY A;  2R7Z J;  1H89 C;  2DA5 A;  2WAQ N;  1HCR A;  1JKO C;  2K9Q A;  2CU7 A;  3RZD J;  1FIA A;  1MBK A;  4D5F A;  3JRC A;  1BW5 A;  4V2F A;  2W48 A;  3NAU A;  2AO9 A;  3LOC A;  4AYB N;  2X48 A;  5EG0 B;  3O8G A;  1OCP A;  1I6H J;  3OIO A;  1U78 A;  2O7O A;  3GTJ J;  3GTM J;  4EEF G;  2TCT A;  4A3I J;  3HOZ J;  1JTY A;  1Z77 A;  1IV6 A;  1JGG A;  4Y7N J;  2QF7 A;  2L7Z A;  2ECC A;  3TW7 A;  4D5C A;  1MH3 A;  4D7M A;  1ENH A;  5F0F A;  3S1R J;  2HYJ A;  1JT0 A;  2HOA A;  4FIS A;  1MBE A;  2IAI A;  3TP0 A;  4BXX J;  3S2H J;  2COB A;  3Q0W A;  2VI6 A;  1AHD P;  1JTX A;  3IH2 A;  3GTQ J;  4JP0 A;  2IBD A;  2TRT A;  2DN0 A;  1MBH A;  3M3Y J;  2ME6 A;  1JKQ C;  2JA8 J;  2VUM J;  4CYC B;  2DJN A;  1LFB A;  4FE4 A;  1TWC J;  2EZK A;  3ZQC A;  1YRN A;  2ZB9 A;  5F08 A;  4C3I J;  3FK6 A;  1SFO J;  5J1Y A;  4XK4 A;  5BNG A;  1IDZ A;  4MFE A;  2R5Z A;  1MNM C;  3BR5 A;  2NS8 A;  3FIW A;  5E3M A;  5M5Y J;  2E2J J;  4A3G J;  2Y0S N;  4MIM A;  4QSH A;  3FIS A;  3IH4 A;  2K40 A;  4IHW A;  4MLO A;  3CQZ J;  4M3D A;  3HOY J;  5EZH A;  1ZKG A;  2M8G X;  2Y9Z A;  1WPK A;  3H3V K;  2ME0 A;  2LP0 A;  1ZTR A;  5EGO B;  1LFU P;  1VFC A;  1RKT A;  2DA1 A;  2R93 J;  2JMW A;  3JRH A;  2L7F P;  1VI0 A;  2O8K A;  1HLV A;  3UKG A;  2XGE A;  5F0C A;  1Y1W J;  2VKE A;  4I6Z A;  1NTC A;  4RBO A;  1B72 A;  1BW6 A;  1ZR4 A;  1U8B A;  4DYQ A;  2NVQ J;  2EQR A;  5C4J J;  1Z0X A;  3GTK J;  1X58 A;  4BY7 J;  3SFI A;  1PUF A;  4D7N A;  1E3O C;  1POG A;  2LVS A;  2CUE A;  4RDU A;  1W0T A;  1D5Y A;  2DMP A;  3A02 A;  1MSF C;  1MBF A;  2DA2 A;  2DA4 A;  3L1P A;  1F43 A;  1G2H A;  3BR1 A;  1RPW A;  2JWT A;  4IHX A;  2JN6 A;  4A3F J;  3ZQF A;  3K2A A;  1GT0 C;  3HM5 A;  3BTI A;  1A6I A;  2GLO A;  1JJ6 C;  2CQQ A;  1ETK A;  5M3F J;  1T56 A;  1EF4 A;  3PO2 J;  1Q1V A;  3NAR A;  3LSP A;  3HGY A;  1DU6 A;  2IEK A;  3OSF A;  1JUS A;  1AKH A;  1VF9 A;  1SAN A;  4GFB A;  3E7L A;  3MN2 A;  2EH3 A;  1B8I B;  3MKL A;  1ETV A;  4M6V A;  1XG1 A;  4A69 C;  2HI3 A;  2Y31 A;  4X6A J;  1TWF J;  1BA5 A;  1UHS A;  1I3Q J;  5GP9 A;  2DTZ A;  4JX4 A;  1HF0 A;  4BBS J;  2B63 J;  2XGC A;  1GV2 A;  4IHV A;  1JJ8 C;  4A3E J;  1WCM J;  3BTC A;  1H8A C;  1TC3 C;  2MGQ A;  2FD5 A;  4FE7 A;  1ZR2 A;  3PM1 A;  4BBR J;  2ID3 A;  3IH3 A;  5IOY A;  1FIP A;  3BR3 A;  2LFB A;  3RQI A;  4XID A;  1ZGW A;  1UMQ A;  4J19 A;  2JJ7 A;  2M34 A;  3F0C A;  5EZG A;  2EZL A;  1ORK A;  3A03 A;  1Y1V J;  4IEJ A;  1MH4 A;  3W6V A;  3BQZ A;  2NS7 A;  5M5W J;  4JX6 A;  9ANT A;  4FCY A;  5IYD J;  1K61 A;  1GUU A;  2FX0 A;  4B1R A;  4B4C A;  4A3M J;  2WB1 N;  2DMT A;  2K9N A;  5IP9 J;  2NOG A;  2XB0 X;  3JRG A;  5M5X J;  5FJ8 J;  4Y52 J;  3GTG J;  4JX5 A;  1IGN A;  3I4M J;  2DMQ A;  1ETW A;  5J3L A;  4A3L J;  2XGD A;  3BTL A;  4UUT A;  3JRF A;  1K83 J;  1DU0 A;  1YRN B;  4XIC A;  2CJJ A;  2LD5 A;  2JA7 J;  2P81 A;  4BY1 J;  3ZOB A;  1GVD A;  2N8G A;  2LR8 A;  3JRA A;  2XPU A;  5EF6 A;  2R5Z B;  3S17 J;  5EDN A;  4A3D J;  4M3E A;  2HXO A;  5E3O A;  3LNQ A;  2EZI A;  2HQ5 A;  3OOU A;  3HGG A;  3VPR A;  3S2D J;  2R92 J;  3H0G J;  3BG3 A;  3QPS A;  2Y9Y A;  2L9R A;  1O4X A;  1GV5 A;  1JUM A;  5DS9 A;  3B6C A;  2KT0 A;  5IP6 A;  3BTJ A;  1ITY A;  4UUS A;  1TWA J;  4DYC A;  3IV5 A;  2GM4 A;  2DMU A;  2RAE A;  1AU7 A;  4AC0 A;  3O8H A;  3BR0 A;  3HOU J;  3A01 A;  4I76 A;  1B72 B;  1RET A;  3SJM A;  1QVU A;  3CCY A;  3G1O A;  1OJL A;  4S0H B;  2JK3 A;  1IJW C;  2CRG A;  2DA3 A;  2DA6 A;  3HEF A;  2E2I J;  2ID6 A;  2VPR A;  1IRZ A;  1LE8 A;  1PUF B;  1F36 A;  3JRD A;  5C3E J;  4M3G A;  3ZQL A;  4M3F A;  2XPV A;  5F0H A;  1WGX A;  2XB5 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...