4A3BJ

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3bJ00
5F04A 1PUFB 4M6VA 4XK4A 3A02A 2JMWA 1R9TJ 2DA6A 1IV6A 1Z77A 3CDLA 2DA1A 2ID6A 5FJ8J 2Y9ZA 4FISA 5IOZA 1UMQA 1MBFA 1P7IA 4M3GA 3BTCA 4Y52J 4BKXA 3JREA 3A01B 2N8GA 3MKLA 3E7LA 3TW6A 1ZQ3P 4M3BA 1IDZA 1ZGWA 2TRTA 3S16J 1JUMA 3RQIA 2R5ZA 1ETQA 3FISA 2JJ7A 4FTHA 2CUFA 3OIOA 1ZTRA 1IDYA 2CUEA 2GLOA 3GBGA 2IBDA 4BBRJ 3S1QJ 5IOYA 2MSYA 3HEFA 2LY9A 3JRIA 2E19A 3ZQLA 3NARA 3IH3A 1A5JA 1NTCA 2DMTA 2B63J 2M0CA 3Q3SA 5EZHA 2K9QA 2LTPA 1MBJA 2JA5J 1MNMC 3B6AA 2R5YA 5J1YA 4XRSG 1ETKA 2DA2A 1ENHA 1YRNB 3H0GJ 1MSFC 3Q0VA 1U9NA 1D5YA 4JX5A 1OFCX 2XRLA 4MLOA 1ORKA 1E3OC 5FKMA 3K7AJ 3RZDJ 3TEDA 3Q0UA 1FIAA 3O8HA 5E3NA 2JK3A 1ZR2A 2DA4A 1F36A 2X9DA 1OCTC 4DYRA 1WI3A 4DW6A 1T33A 1VF9A 3A03A 5FLMJ 5J1RA 2VPRA 1TWAJ 2L0KA 3QQAA 3JRCA 1QPIA 1WH7A 4D7NA 1MBHA 1APLC 3S15J 1HDPA 5M5XJ 5E3MA 1S7EA 3TW7A 4DZPA 4A3MJ 3G1LA 1IUFA 3GTJJ 4BXXJ 5IYBJ 4B4CA 2R0QC 5EEAA 1MBKA 1XC5A 5M3FJ 1H89C 1I3QJ 5EDNA 4IHWA 2HDDA 1FTZA 3BR1A 2JN6A 2H1KA 4M3EA 1P7JA 3GTLJ 2NS8A 2VUMJ 3GTMJ 1IG7A 1MBEA 1RETA 2E2HJ 4AC0A 3FK7A 2OF7A 3LSJA 2LP0A 1O4XA 1HDDC 1UG2A 4XRSA 3F0CA 2KDZA 2R5ZB 4D5FA 1IC8A 4C3IJ 2L7ZA 2GBYA 3JRDA 1BW5A 3HOUJ 3BR2A 4GFBA 4UUTA 3JRHA 2D5VA 5EF6A 2JWTA 5EG0A 1JGGA 3PM1A 1WH5A 4MFEA 5GP9A 3TP0A 2EQRA 2HQ5A 5K7ZA 2TCTA 2E2IJ 3I4MJ 1VI0A 1GVDA 3MN2A 3G1OA 2HOTA 1Z0XA 1MH3A 3GTQJ 3ZQIA 4RDUA 4AYBN 2R5YB 4HNVA 3BTJA 4A3FJ 5JLWA 4A3DJ 1TC3C 1GV5A 4FCYA 4IEJA 3S2HJ 1JJ6C 1BJZA 3BG9A 4C2MJ 3QPLA 4B1RA 2CU7A 2CQQA 4NDLA 1OJLA 4C3HJ 3HM5A 3PO2J 1W0UA 4IHVA 9ANTA 2DJNA 3OSGA 1RR7A 3BG3A 5EGOA 2FJ1A 4FE4A 4I76A 2M34A 4DYCA 1B8IB 1AKHA 3IH2A 1K61A 4MFDA 1JT6A 1JKOC 3HGYA 2LFBA 5BNGA 3G1MA 5F0FA 3LSRA 1TWCJ 4A3GJ 2X48A 1VFCA 3BR3A 1ETVA 1LFUP 1NK2P 2DMQA 1IJWC 1JKRC 1GUUA 3S14J 4BY7J 4MIMA 1ETOA 2QF7A 4DZJA 1MBGA 3BTLA 5M5WJ 1JJ8C 1ITYA 1EF4A 2ME0A 2DN0A 3DEWA 3SDGA 1DU6A 3C2BA 1A6IA 3FK6A 1QRYA 2XSDC 1JTXA 4J19A 2WAQN 3NAUA 3HOXJ 1POGA 4C3JJ 2XGCA 2K40A 2LVSA 3PO3J 4M3DA 3ZOBA 5DS9A 2FX0A 1W0TA 2LKXA 5E3LA 4A3KJ 5C4JJ 2ZB9A 3BQYA 2Y9YA 1HCRA 3UKGA 3S2DJ 4I6ZA 3HGGA 2HOAA 1LFBA 3S17J 1HOMA 3GTGJ 2COBA 2IAIA 2ID3A 3LSGA 2R7ZJ 2AO9A 3I4NJ 5F27A 1BA5A 2NVQJ 1ETWA 2JA7J 1JTYA 1DU0A 2E2JJ 3GTPJ 3LOCA 4X1EA 5EG0B 1GDTA 3RZOJ 2AHQA 4X6AJ 4A3IJ 2Y30A 2XPUA 2MGQA 1K83J 3JR9A 4B3AA 2LD5A 3ZQCA 2VI6A 4A3EJ 2O9LA 1F43A 2WB1N 3BG5A 2FQ4A 1IGNA 1AU7A 3JRGA 1RKWA 1GT0C 2LR8A 3L1PA 4XIDA 2VKEA 2XB5A 4W97A 1HLVA 1FIPA 1X2NA 4JX6A 4V2FA 5EZGA 3Q0WA 3W6VA 1XS9A 3BR0A 2EH3A 5EGOB 2YUSA 1U9OA 3O8GA 2HXOA 2VKVA 3HOVJ 4CYCA 1JKPC 1SANA 5M3MJ 1AKHB 4FE7A 5F0HA 2GM4A 3D1NI 3H3VK 2DA5A 4JP0A 4QSHA 2YS9A 3WHBA 2FD5A 1SFOJ 2JA6J 3GTKJ 4A3LJ 4AUXA 1FJLA 3HOYJ 4ABZA 5C44J 1WGXA 2EZKA 3QPSA 2EBIA 1I50J 3ZQFA 3ZQGA 1JT0A 2R93J 2M9HA 2K9NA 3LSPA 2L7MP 2Y0SN 1TWHJ 2LK2A 3K2AA 2YU9J 3BT9A 2CRGA 1RKTA 1G2HA 1VNDA 5FLVA 3TP3A 2HXIA 3SJMA 1ZKGA 4W1UA 2K9SA 3M4OJ 5EYRA 5GPCA 3BR6A 2IEKA 1TWGJ 5E3OA 1UHSA 1LE8A 1BL0A 2L7FP 4DYQA 1I6HJ 2LLKA 1B72A 2NOGA 3IV5A 1QVTA 2NVXJ 2O8KA 1JKQC 1WPKA 5F1JA 3BQZA 1Y1WJ 5IYDJ 3ZQHA 4XICA 2W48A 2XGDA 1H88C 5GPAA 1X2MA 1ETYA 2KT0A 2DMPA 1U8BA 2HOSA 2HI3A 2NVTJ 2M8GX 4MO7A 3HBLA 5K7HA 4A3CJ 2L9RA 2ELKA 3LNQA 2DMUA 4JYKA 4G12A 1RESA 1ZK8A 1CQTA 3CQZJ 1JUSA 3CCYA 5IYCJ 4UUSA 3CMYA 5C4XJ 3JRBA 2WV1A 5FKLA 1JUPA 2MG4A 4BY1J 4BBSJ 2P81A 3FIWA 4CYCB 1NK3P 4RBOA 3MVPA 2JA8J 2EZHA 5DTDA 2HYJA 3HOZJ 1PUFA 2M2EA 1U78A 3GTOJ 3IH4A 2CQXA 1FTTA 4V2GA 1X58A 4A3BJ 4A69C 2ECCA 5J1UA 5JLXA 4IHYA 2XGEA 4M3FA 3A01A 3HDDA 3S1NJ 1OCPA 2MW8A 2E1OA 4EEFG 3BR5A 1B8IA 2R92J 5F08A 3DCFA 5FKKA 3OOUA 1ZR4A 1AHDP 2NVYJ 4A93J 2XB0X 1TWFJ 5HODA 2OPTA 2NS7A 2XPVA 3M3YJ 2X6OA 3HB9A 1MH4A 4QTRA 2DMNA 3OSFA 2ECBA 4D7MA 3S1RJ 4IHXA 1Q1VA 5FKNA 4QIWN 2ME6A 1LE8B 3VPRA 3JRAA 2XPWA 3BTIA 1YRNA 1H8AC 1RPWA 2EZLA 1HF0A 1B72B 3JRFA 2CJJA 1BW6A 1ETXA 1MSEC 5FKOA 2RAEA 3HOWJ 5IPAA 5IP7J 3HKZN 4Y7NJ 1Y1VJ 2DA7A 4S0HB 3B6CA 2I10A 2Y2ZA 4JX4A 3S1MJ 4D5CA 3WHCA 5J3LA 4LOCA 2DA3A 3FKIJ 2O7OA 5IP6A 4XRMA 1GV2A 1QVUA 3RKQA 2H8RA 1IRZA 2PMZN 1FEXA 1T56A 2EZIA 4A3JJ 5IP9J 5M5YJ 2QCOA 2Y31A 4UUSB 2G0EA 5C3EJ 5F0CA 2DTZA 5K7FA 1XG1A 1WCMJ 3SFIA 4L5EA
chains in the Genus database with same CATH superfamily
4ESBA 3FXQA 1T0FC 3BZ6A 1RIOH 1PUFB 3A02A 2JMWA 4XLPF 2VC0A 4ZZDA 3L2RA 5BPIA 2M30A 1LVKA 3CDHA 4EJWA 3BTCA 4Y52J 5ERIA 2OU2A 4BKXA 4MQVA 2MBFA 2EWNA 1Y0UA 2OZ6A 1EH6A 2HZDA 1ZQ3P 3DPUA 3K69A 1IDZA 1DGRM 1G8XA 4AYBA 3RQIA 2R5ZA 5CVVA 4BDZA 3VDXA 4CO8A 4CCLA 1P6RA 3IUOA 1FYMA 1V5FA 2GLOA 1G59A 4HOBA 1I3AA 2AXLA 3HEFA 2LY9A 3ZQQA 2E19A 2OCEA 4YFXF 2HNHA 4HDVA 4XSXF 3ZQLA 1NTCA 3CF2A 2GQQA 4YIFA 2XAQA 1RI7A 4A5MA 1AOYA 3B6AA 2Q1ZB 3ECOA 3AL0C 3Q5FA 4XRSG 1ETKA 2ZO4A 3RKYA 2RC4A 3ZMSA 1UHWA 4XL9A 4N4OB 4XLFA 5E79C 4RGSA 2D45A 4YFNF 3ONQA 3QOEA 1IUYA 2KFDA 3TEDA 2CG4A 3Q0UA 1TZLA 4O6JA 5D4SA 3OYDA 4I09A 4PCQA 2FRHA 2PJPA 1V3FA 5BOXA 2CUJA 4GXOA 4DW6A 1T33A 1VF9A 5E8IA 5J1RA 2P7VB 2HDWA 2GXAA 1TWAJ 3QQAA 2HZTA 1ULYA 4BACA 4XNFA 4A5NA 4V19K 3R4KA 3OYBA 4D7NA 3UNGC 2CH0A 1RC9A 2PBIA 3FMRA 1S29A 3E6MA 4CICA 2V4JC 3PIPF 3CLQA 3PNTA 1IUFA 2LOOA 2KIMA 2WAEA 2AQEA 3C7JA 3TQNA 4Z6YA 3DWLE 2XDVA 2LNBA 2TDXA 5E17F 5TGTA 5M3FJ 1H89C 1USSA 1FX7A 5EDNA 2X6WA 2W82A 3MD2A 3WTSC 2HDDA 1FTZA 2JN6A 4J00A 4YIIA 4XKVA 5ILSA 1T39A 2OQGA 2UUZA 1LB2A 2A5WA 3WTYC 1MMDA 2R7FA 2BEOA 1R1VA 2YSRA 4AC0A 3SZGA 4RAZA 2OF7A 4UVBA 2LP0A 3G3ZA 1OQYA 3HOSA 3QODA 1LEBA 1UG2A 4XRSA 3WTVC 3RKWA 1DPUA 2R5ZB 4D5FA 4C3IJ 2EA4A 1G3WA 4M73A 2DPUA 4IRGA 1YHQI 1BW5A 3BR2A 1X1AA 5LBQA 1YYVA 4L0YB 1YLFA 3RIRA 2I8DA 5EF6A 4YG2F 2VJ4A 3ISPA 1JGGA 4MFEA 3J81K 4FT8A 2HQ5A 2A6TA 2CMPA 2COMA 2TCTA 3PUFA 4UUVA 1E0EA 4G94A 2KRCA 3FXJA 4I01A 1GHCA 3KYCB 3GTQJ 3ZQIA 4AYBN 2MLKA 2DOAA 1IXCA 3M7GA 3MMYB 2CW0F 4HNVA 1VQ5I 1MMAA 2WV0A 4HEA2 2QVOA 4CCNA 2GA1A 3DTEA 4A3DJ 3CTAA 4IEJA 2KL4A 2MD0A 3L2UA 2BXZA 2P5KA 3QPLA 3U1KA 2A5YB 3CESA 3CP2A 3HM5A 2B7EA 5TISC 1W0UA 3DBLB 1MGTA 2LSOA 5FO5A 2KPMA 9ANTA 2QQ8A 2EB7A 3BG3A 5EGOA 5B66C 4FE4A 1F9NA 2M34A 4FX4A 2DFEA 2IVMA 1YS6A 1IXRC 4G6QA 3D5SC 3VYRB 3JAMK 5BNGA 3G1MA 2F6CA 2K3FA 1NG6A 2LH9A 3OWTA 3WTXC 1RUNA 2WTEA 4A3GJ 5HDNA 2X48A 3BR3A 1ETVA 3EUHC 2FOWA 2BGCA 2DMQA 4DOZA 2KIUA 4JK1X 3PUBA 2BVLA 3NEUA 4KT6A 1EF4A 1XDUA 2ME0A 4AIHA 1USTA 2Z1DA 5AIPA 4ENNA 2DFHA 2G7UA 4BU2A 3IRRA 2R7XA 1JXSA 3WODF 2XGCA 2CS3A 1DP3A 3ZOBA 3LA3A 2LKXA 2E7XA 1RRJA 1MZBA 4G6TB 3SHFA 3MKWB 2P0WA 5C4JJ 1MMSA 2ZB9A 4ASNA 3UKGA 4KIGA 2FU4A 1FMVA 3HGGA 3CF5F 4PJJA 1W5CC 5HS9A 1NH3A 3KLNA 1LFBA 1U6GA 3OOPA 3DTIA 4KN4X 2ID3A 3I4NJ 2A05A 2AO9A 5L3DA 3ZMDA 4H0EA 2JA7J 2MFZA 1H0MA 2IXSA 2DDBA 4OMZA 3HSEA 3LOCA 3F21A 2FQ3A 3K1MA 2AHQA 2VC1A 4U7BA 1UFMA 4XOTA 5CYVA 3S2WA 1T8IA 4X0GA 5CVJA 3RDIA 4P1WA 4RB2C 1D8KA 2NRAC 3OYFA 3WGIA 4OMYA 2VI6A 3BZCA 3DEEA 3HL2A 2O9LA 3K4BA 4BQOA 3TO9A 2FQ4A 5E20A 4BE0A 3JRGA 1P2FA 2W4SA 2E60A 1WSUA 2QWWA 3SXYA 2JZYA 3E3VA 2H09A 3R60A 3Q0WA 3MZHA 1Z1DA 5FRMA 3DU5A 1WZ2A 5EGOB 1XMAA 2Z16A 2FNPA 2V9PA 3R0AA 4UVCA 2ZJ2A 1HC8A 4CYCA 3SFZA 1SANA 3WTZA 5M3MJ 2JSCA 4FE7A 5F0HA 1D0ZA 2VBXA 3D1NI 3H3VK 5D8LB 1G3TA 3HHHA 1KU2A 1R5ID 4F55A 1FJLA 1S9HA 4BAYA 1PDNC 1IV8A 5C44J 1ON1A 2E1CA 3DF8A 4WWCA 1D1CA 1I50J 3ZQFA 3IC7A 2XAFA 1U5TA 5EJCA 2KRHA 4CHUA 4LGWA 1EV7A 1KYZA 5J8CA 4WCGA 1FZPB 3H92A 4LITA 3NQOA 2Y0SN 1R00A 3M1EA 1BC7C 2YU3A 1TWHJ 3I58A 2CRGA 1RKTA 2EFOA 2FXAA 4RGRA 2X1CA 4DBRA 3FM3A 5H6RA 2UXNA 1UG0A 1VNDA 2X1EA 2ADUA 4HRIA 3TP3A 3M8EA 2KZVA 5LGTA 3VFZA 2K9SA 4E7ZA 5HLTA 2EJRA 4I0AA 2EFQA 1D3YA 3BR6A 2IEKA 2DT6A 3ASNH 1LE8A 1LDKB 2JVHA 4B3XA 2STWA 3OYEA 3OYKA 4BDYA 5CKTA 3IAM2 5DDGA 2NOGA 3NWSA 4C9YA 1QZYA 2O8KA 5DD8A 2CQNA 3PNVA 3WTTC 5EEHA 3ZQHA 1J7KA 2OAZA 1XCBA 1W4MA 2BBYA 1TQMA 4EQQA 1XGSA 5D4RA 2DMPA 1SFKA 2HI3A 2NVTJ 1B9MA 2IA2A 4MO7A 5K7HA 1ACIA 4KUMA 3GLLA 1UJ8A 4UV8A 5CVIA 2L4MA 4D9JA 4ZYEA 3DPTA 1S3JA 2GXGA 2M87A 1J59A 1CQTA 2JUGA 5LLQA 1VQ6I 3H35A 5IYCJ 4GO1A 5C4XJ 3JRBA 2MG4A 2A3SA 4CYCB 1OYYA 4RBOA 1WRJA 2PQ8A 5CVRA 5GADJ 5HS8A 1S72I 1U78A 3IH4A 2CQXA 5CJ9A 4N9IA 4A69C 5JLXA 1QHHD 4DGWB 5L3GA 1RUOA 4M3FA 2DAOA 3GFJA 3HDDA 1U5TB 2O61A 4EEFG 3BR5A 4PGHA 1JGSA 4Z2YA 4ETSA 2QQBA 2CW8A 5KNLA 5K1YA 1IN4A 2WAQA 4BE1A 2X1DA 2ZNYA 3K0LA 3C3WA 3VYSB 2FBKA 3C18A 4WF2A 4B44A 4DNCA 3M3YJ 2OTJI 2UXXA 1HA8A 3QYBA 3LFKA 4EMSA 1ZREA 1LDJA 4UB6C 2K4BA 1MH4A 4QTRA 1ODDA 4ZYGA 2Z33A 2P5VA 2W84A 3PQKA 3QWLA 2ZJQF 4IHXA 4OAYA 2ZMEA 5JVTA 3CUQA 1LE8B 3VPRA 1TT5B 4LLGF 4RMNA 3JRAA 2OA4A 3H5RA 1S8NA 2EZLA 1M1EB 1BW6A 4HLYA 3WG9A 3DU6A 3HOWJ 2R7RA 1N25A 2VQHA 4BH9A 1I39A 3K2ZA 3KYDB 4LLLA 1Y1VJ 4PUSA 3EYIA 3ZGKA 2R7TA 3B6CA 2OD5A 2Y2ZA 5DUIA 3S1MJ 2E7WA 4L5IA 1SD7A 3E6DA 4YFKF 3D0SA 4LOCA 3VWBA 4NUBA 5HDGA 4JBAA 2CGPA 1R4NB 1IRZA 2PMZN 4OWRB 4I0BA 3ZN1A 1DPRA 4MEXF 2HTSA 2FMLA 3CUOA 2Y31A 3DLLF 3LWFA 2E5ZA 5F1RA 3GFMA 5C3EJ 3LAPA 1YITI 1ZHFA 3HPGA 5LHHA 4PJNA 1K7AA 3OYLA 1IN6A 4M6VA 2LBFA 1W7PD 3RKXA 2KP6A 3W2AA 3CDLA 2DA1A 4NNJA 3GZ5A 2BHZA 4WK8F 1MMGA 4FISA 5IOZA 3BPVA 1QPMA 1R6RA 3AG4H 4ZH4F 3KETA 3E7LA 3ZPLA 1D1BA 3HZJA 1W5TA 4F52A 1P9QC 3ZXSA 1N75A 2NOJB 2TRTA 3ZQ7A 2P6TA 1WKMA 4CH7A 1BR1A 2LREA 3FHNA 3OIOA 5CVUA 2VIXA 3KIOA 4GDFA 2KIQA 3ERED 2Q0OA 3J7AO 2IBDA 1XSXA 3S1QJ 5IOYA 2MSYA 2XVCA 4NBQA 2DMTA 1YFHA 3EPZA 1OMIA 1P4AA 2LTPA 1MNMC 2R5YA 4YRVA 4HV6A 1UHMA 3GXOA 3CUQB 2DA2A 2CW7A 3CO6C 3NRVA 5JHFA 3MAJA 5CQEA 1D5YA 2D1HA 1OCRH 2HWVA 1ORKA 1E3OC 3EDPA 4L9VA 3CCVI 4ENKA 2EIMH 1ZAOA 3OS1A 2OCCH 4II2A 1BIAA 1O7FA 2V7FA 2K02A 1VQMI 2DA4A 1F36A 3J7ZI 3H1CA 3CCLI 2X9DA 4CYDA 1OCTC 4DYRA 1WI3A 4Q4ZF 4CA0A 2EPFA 2QSHX 2L0KA 2XAGA 2IS2A 1MBHA 2V9VA 3BC8A 2WY8Q 5A2QK 2P6SA 3SYTA 2Q2EA 4PFPA 2L02A 4DZPA 4BXXJ 3G1LA 5IYBJ 4CDGA 3E1SA 3KLOA 1D1AA 4JOMA 5EEAA 3E0JB 2FUG2 3GLXA 1BI0A 4HW0A 1MBKA 4D0PA 1FWZA 1XC5A 2PX9A 2DODA 3J80Z 4IZZA 1X1DA 1BI2A 1SD6A 1R71A 5B1AH 2ZXJA 4IHWA 2XC7A 2CFXA 2LBFB 3BR1A 2R7QA 1S6LA 2ZXHA 1XCVA 1XSDA 1PJRA 3ZMVA 3F6VA 2LY1A 2NS8A 4QLCU 1FYLA 1PYVA 3EYYA 4UXNA 3GTMJ 4H4KC 2E2HJ 3HSFA 2UWMA 3QYEA 3GMEA 1O4XA 1HDDC 3F8BA 1T95A 4O3MA 3K6GA 4HBLA 1F5TA 4UY8I 1R23A 3JRDA 4RB0A 2WB1A 1R22A 4FX0A 4UUTA 3BWGA 2ACJA 1IN5A 3JRHA 4XORA 1QA6A 2D5VA 2EILH 2JWTA 5GP9A 1WH5A 2E71A 4XSZF 4NQWA 3I4MJ 2OZUA 1U3EM 2JRMA 4LD5A 4S05A 1LPQA 1GVDA 3G1OA 4XLNF 1Z0XA 1MH3A 3K4MA 3PFIA 4EATA 4HX4A 5J6XA 2M4GA 4HG2A 2R5YB 4LB5A 5JLWA 3CMAI 1TC3C 4R1HA 2GWRA 3S2HJ 1BJZA 1WJFA 1R4MB 2RQPA 3SDBA 3V8LA 4C2MJ 5JFRA 5K5OA 5H20A 1OJLA 4P9UA 5J4VA 2ZC2A 4LK0F 3IKTA 2ZFUA 1KQ0A 4B47A 2O03A 3OSGA 1RR7A 3PQJA 2FJ1A 2A07F 4DYCA 1B8IB 4ZYAA 3WE2A 4U0VA 3ZMUA 2LFBA 1LVAA 2HYGD 5F0FA 3BROA 5K5RA 1YJNI 3BJAA 4ZDPA 2KKOA 3H9GA 1EJ9A 1BN5A 1IJWC 1Z3XA 2FOKA 3HIFA 4MIMA 2Q2EB 4QPQA 1YJWI 2X85A 2RDPA 1ITYA 1TT0A 3KEQA 2BE5F 2DN0A 3DEWA 3OIQA 1DU6A 1TBXA 3TBIA 2XSDC 3EUKL 2HPIA 3HOXJ 4A2UA 2P8TA 3BCBA 4HSTA 4A0ZA 2FX0A 5DS9A 3AG2H 3K70D 3FBNB 5E3LA 3U9GA 4Y13A 2RKHA 1ZRDA 3ABMH 3W6KB 3BQYA 3LSTA 3W6JB 3N05A 4I6ZA 2DK5A 2G7HA 1I27A 4XM3A 2LC2A 3OS0A 1ZG5A 1VQ4I 3GUDA 3GTGJ 4IOAF 2IAIA 3LSGA 2R7ZJ 2CV1A 3DXJF 1A36A 3GFLA 3GTPJ 2EK5A 5LEKA 1U5TC 1Y6IA 1BOBA 2DI3A 1GDTA 3RZOJ 2BZTA 3IKVA 4A3IJ 2Y30A 4NQWB 1ZGJA 4BQQA 2ELHA 3H9QA 4A12A 3OIPA 4XLCA 3JR9A 3ZMZA 1O57A 3BPXA 5E18F 5ED4A 3ZQCA 1REPC 1IN7A 2MC4A 3RCOA 4AVZA 2EV5A 3EUAA 2A6EF 2WB1N 4HNUA 3KP3A 2MH2A 3HOTA 4KNYA 1B4AA 3CCSI 2LG4A 3HTSB 2VXZA 1CGPA 3LQQA 3P7NA 3LSIA 3KYLA 1R58A 2V1DA 4CZCA 3CJTB 2W25A 2XB5A 5B1BH 3OL4A 2RQQA 1TP4A 5F6FA 1X2NA 1HQCA 3KP4A 1XS9A 3KX2A 3BR0A 2W1OA 3CJRB 3KP5A 1BC8C 2R7VA 2IJLA 2BW3A 1U9OA 2VKVA 4RGXA 4CGZA 4PGGA 3WG7H 2DFFA 2GAUA 4P96A 5FFZA 5KAIC 3KP7A 1TW3A 3ZCOA 1G6NA 3GFIA 2YS9A 2DK8A 2FMYA 4IJAA 3GVAA 2MA3A 3WHBA 4CCKA 3R61A 2HVRA 4A3LJ 2JA2A 4AUXA 1Z05A 4ABZA 2BY1A 3QPSA 5ICCA 2W7NA 2ETHA 3ZQGA 5JR3A 1JT0A 3L2QA 4I02A 2M9HA 5DCMA 3QU6A 3E6BA 4GYIA 1UCRA 3ELKA 3K1PA 2YU9J 1YI2I 1FOWA 4KICA 2STTA 5KVRA 1TNTA 1HW1A 2EV6A 4GGGA 1MJBA 4M9SA 1Z9CA 1SFXA 3K9TA 1D8JA 3G71I 2W85A 4W1UA 1W1WE 1FLIA 1K78A 3KZZA 5GPCA 2PFBA 3CLOA 1PVEA 3LSKA 4YIRX 3B02A 4BS9A 4Y4RA 2X4HA 1X19A 5BQTA 1KGSA 5HLIA 1S7OA 1OCOH 4AVPA 1S7AA 5GAGJ 1KA8A 1ON2A 2M0MA 5H2FC 2O3FA 4PK4A 1FMWA 3DKWA 1T38A 1FBSA 1H88C 1FSHA 1WJDA 3OYIA 2KT0A 3LMMA 5DV5A 4RLFA 2M5WA 3WGGA 1STZA 4HZFA 4O5VA 1X1BA 1SMTA 2GA2A 4L5JA 1ZH5A 4JYKA 1YIJI 4G12A 4BHBA 3LFUA 1TTYA 3TO6A 1F1ZA 3CUQC 2Y75A 2KISA 4EGZA 4KFCA 1WWXA 3HRSA 3PSIA 1KU7A 3FIWA 4MQ9F 2O6GE 2DT7B 2JA8J 2EZHA 1K4SA 4U0YA 1QU3A 2ZSIB 4ZYHA 5A2QZ 2IT0A 2DT5A 4V2GA 1RR8C 1EH7A 3FF5A 2ECCA 5F64A 2IW5A 3VOEA 3DFGA 1R49A 1HBXG 5E1XA 5HOOA 3CJNA 1WVRA 4F3QA 1XSVA 2R7WA 1J2XA 3AAFA 2L01A 2MW8A 1EKEA 2O8XA 3OMYA 2HKXA 3QPTA 2M7AA 5FLXZ 3IHUA 1EH8A 3OOUA 1ZR4A 2XIGA 1QGPA 1QZZA 2HDCA 2NVYJ 2XB0X 1MD0A 1OYIA 5LEJA 1W5SA 5TRDA 2QSGX 2XPVA 2VOPA 2Y48A 1Z21A 2PEXA 3GCMA 4IHTA 4LG0A 4RB1A 3N4MA 2FEZA 4L9TA 2KJCA 2XAUA 4RGUA 1Q1VA 2BHYA 4NB5A 5ICEA 2K4JA 4RLQA 2VKDA 4HQMA 4C2TA 2RREA 2F4MB 3CCEI 2RN7A 3T5XA 3W2WA 1YRNA 5BMZA 3WU1B 1IN8A 5HLHA 1H9TA 2CJJA 4I2OA 3RPUA 5IT9K 3FXKA 5HS7A 2XF5A 3CCJI 1MSEC 1IZ1A 5IPAA 3M9AA 2VQLA 4B48A 1FP2A 3DBRB 3JW4A 2O0YA 4JX4A 4F7ZA 3WHCA 3PFYA 5LRRA 3TMOA 5D5XB 2M4KA 5ILUA 2V9KA 3I3LA 3W2VA 1VQNI 5D5WB 3CD6I 2O7OA 3K4LA 5IP6A 1GV2A 4Q48A 3RKQA 2CSOA 1YW7A 2DYSH 1OR7C 4DBQA 2P5LC 2EZIA 4ZDLA 3I4PA 3ECHA 5M5YJ 2ZJRF 4R79A 3K70C 3OR2C 1L0OC 5LHIA 5F0CA 4AWXB 1B6AA 2DTZA 1TQPA 5FGMA 5K7FA 1WCMJ 4PSWA 2BY2A 1KYWA 2M8EA 1Z6TA 4XK4A 4IRHA 3BJOA 3I54A 1R9TJ 2DA6A 3DQVC 1Z77A 1P4XA 2VN2A 4IX7A 2ID6A 3MQ0A 2E36A 2CV2A 1P7IA 3ZRGA 4M3GA 1SMYF 2A68F 4MEYF 3G73A 2OTLI 2N8GA 1PUEE 1I6XA 2V1NA 4OU0A 4KYWA 1ZLKA 4M3BA 2H1LA 1O7LA 2GIVA 1SAUA 2KHMA 1ZGWA 1J09A 1JUMA 3GZNB 3KEOA 2ESNA 3QPHA 2EV0A 4XLEA 2JJ7A 3BY6A 4ESJA 1T98A 1HW5A 5DCFA 1JE8A 2Z5UA 3L2WA 2FE3A 3FMSA 4PJMA 2F5DA 3JRIA 3LL7A 1A5JA 2KMUA 3BZKA 3IH3A 1JI8A 3EQLF 4GCVA 4LG0B 3ZMTA 1ZELA 3I9V2 2HQNA 1Z7UA 3GO5A 3Q3SA 2K5CA 2FBHA 2F48A 1XB4A 4FASD 2VL8A 4K2EA 1YRNB 3H0GJ 1SFEA 4XLAA 1FPQA 2NS0A 1ZLJA 1MSFC 4KN7X 1FY7A 2E1MB 5E1WA 1OISA 4XMYA 4NC7A 4PFOA 2F5EA 3K7AJ 5DEQA 5FKMA 3RZDJ 3AL0B 1FOYA 4HF2A 2Z3YA 3A2KA 1FIAA 2FF4A 1UZCA 2MC3A 3UR3C 1BR4A 2JK3A 4ZZLA 2UV1A 3I59A 1MDMA 3A03A 5FLMJ 2VPRA 3H3ZA 3OR1C 4BHCA 5GTHC 1Z7LA 5D6FA 1XD7A 3S15J 1YOVB 3B73A 1HDPA 5M5XJ 5E3MA 2LF8A 4Y3OA 4RM3A 1S7EA 3TW7A 3GX4X 4A3MJ 3FXRA 3WGHA 2W24A 4BYYA 5J4YA 2ZSHB 2DTRA 2BVMA 3OL3A 2WWYA 3IP4B 1R1TA 4F93B 2IGNA 2KLOA 3RPQA 1I3QJ 1GXPA 3DKXA 2VODA 3FKJA 2BY3A 2ZKZA 5LGNA 3J81Z 2H1KA 4M3EA 4M72A 4KISA 3GTLJ 3MZYA 4E7KA 4EJTA 3S32A 2BXYA 2VUMJ 3N97A 1GXQA 1GVJA 1MBEA 1RETA 2VJ5A 1MNDA 3LSJA 1K79A 3HRTA 2IPQX 3F0CA 1OCZH 2KDZA 2J5OA 1IC8A 1FBUA 2L9NA 2GBYA 1X3WB 4TV7A 4GFBA 1G3YA 5LFAA 3QP6A 3L09A 5E8GA 3L7WA 3DLAA 1R5GA 2K85A 4P9FA 3JTGA 2E2IJ 3HRUA 2VB6A 2DOFA 1Y39A 2XV4S 1J9IA 3MN2A 2HOTA 5KCMA 3JSOA 4RDUA 2EFWA 1KQ8A 2ISYA 3JAMZ 3H5NA 2XF6A 4KJZA 4E7JA 3ULQB 1VQOI 3BTJA 3S8PA 2B9SA 2HVQA 1GV5A 4E4HA 4FCYA 2VT3A 1VQLI 3BG9A 4HF0A 2VQCA 4B1RA 3P9CA 1T6SA 2CQQA 3D5LA 4NDLA 5JI6A 3JSPA 4BEHA 2DJNA 5CPRB 4WXHA 2NNYA 3HKZA 1N78A 5FROA 4I76A 3I53A 4KIFA 1AKHA 4KT5C 3I59B 3IH2A 1TW2A 4MFDA 5DM7F 4IO9F 1K61A 1MDMB 1JKOC 2DDAA 2FBIA 3F8NA 1FNNA 4HAMA 4XQFA 3OYCA 2YPRA 1VFCA 2O5RA 1LFUP 5HVQC 1V4RA 1BOAA 3JTHA 1GUUA 4E7LA 4BY7J 1SEUA 1HKTA 3FXLA 2ZNZA 1ETOA 3X2QH 4YELA 1MBGA 3BTLA 4FHTA 5M5WJ 1JJ8C 4NC8A 1LDDA 1BJAA 1PP8F 1A35A 1UELB 3C2BA 2ZMEB 3V7RA 1A6IA 3OS2A 1VQ7I 2HQAA 1IXSB 3KZYA 1N77A 2HS5A 2WAQN 4RB3C 3MKYB 4KMFA 3F23A 2YX7A 3OYHA 2VASA 2IGKA 4EGYA 1POGA 4C3JJ 3I56I 2LVSA 2CUZA 3P9KA 4M3DA 1BI3A 2OV7A 4A3KJ 3M8FA 3Q9VA 2D2WA 3M07A 3DV8A 1TL8A 3GF2A 2QYOA 2Y9YA 3HXLA 4G6DA 4FQGA 1HCRA 2L2OA 3OYMA 4CCOA 5KK1A 2F5FA 3S17J 1BI1A 1MMNA 3BDDA 2COBA 2MD5A 1O3SA 4BNCA 1XMKA 1G4DA 3T8TA 2VQGA 2NVQJ 3K4CA 1HW2A 1JTYA 4A6DA 1ZARA 1FYKA 1YS7A 2XSJC 3ML6A 3TL4X 5ILVA 1L3LA 4X6AJ 2EFPA 3CC2I 2BOLA 1SD4A 1BM9A 2OJED 1XTAA 2NXNB 2MGQA 2CWEA 4L9NA 2QGUA 1PP7U 1BBYA 1R5HA 1ZGAA 5L3EA 2XGXA 4Y33A 4B3AA 2LD5A 3COAC 1GLNA 1FOXA 2HR3A 4N0BA 3S3OA 2IA0A 1XMXA 2K9LA 2GXBA 5IT9Z 3LSHA 3BG5A 3FHZA 1FSEA 1IGNA 4A6EA 2XHKA 3P5JA 3T8RA 2EIKH 1YW8A 3E6CC 1RKWA 1GT0C 2LR8A 3WU0A 4AM3A 2VKEA 4W97A 3VEPA 4KA4A 2P4WA 5LD2C 4JX6A 4V2FA 4RS8A 4EM0B 4F91B 1X4PA 4RM2A 2IS4A 4M9ZA 1AWCA 1IRXA 2YUSA 1ZRCA 1VZ0A 3O8GA 1R7JA 2HXOA 1JKPC 3FXMA 1AKHB 3V7SA 1C0WA 3DTKA 2CYYA 4BQAA 3SEZA 4JP0A 2LMDA 5L3CA 1T2KA 2AQFA 2FD5A 1Y8QB 1ZN2A 2XASA 3BCAA 3O6BB 1SFOJ 2JA6J 3GTKJ 3AFHA 3HOYJ 2IRFG 4IVNA 3FBIB 4HQEA 2IP2A 1QHGA 4FETA 5HLGA 4EJUA 3PIOF 1Z67A 2RNJA 3V7CA 1SFUA 2OC6A 2LK2A 2VBWA 4I98B 4ITVA 2HQRA 1YW9A 4QWQA 2JPBA 3CC7I 2QENA 4M9XA 1YTYA 1G2HA 2DQLA 3CMEI 4ENJA 5FLVA 3RYPA 2E35A 2RGVA 3A1YA 1FT9A 3KFWX 4HDUA 1MJ9A 2GOMA 4PZJA 2HXIA 1Q1HA 1ERDA 1ZKGA 1I5ZA 1B1BA 1V5EA 3F22A 4IXAA 3M4OJ 2XKOA 5EYRA 3CO7C 4MTEA 1UHSA 4Y17A 3S3MA 4PJLA 3HC7A 4DYQA 3OYNA 5FFXA 1O3QA 3H0DA 4NC6A 3IV5A 3GYHX 2B0LA 1QVTA 2UZKA 4DIQA 4E7IA 1SVOA 2NVUB 3REOA 5F1JA 4CXFA 1K6OA 2PJRA 2NNNA 5IYDJ 3DP7A 1QNTA 2XGDA 3PSFA 3LQRA 1X2MA 5DUKA 2M8GX 2L5QA 3C1DA 2EFNA 2JUCA 2F5CA 3ERMA 2DMUA 2V1UA 3HPHA 1OLTA 1CF7A 3HYIA 3WE3A 2R7SA 2IGOA 4Y15A 4CZZA 2HGCA 3PL8A 1X1PA 3VODA 5D5UB 2L54A 3CQZJ 4XKCA 1JUSA 1QBJA 2YR2A 4UUSA 3CMYA 1IF1A 2K27A 1HXDA 2LY2A 3I55I 1JUPA 3MKZA 2E1MC 4BBSJ 2P81A 2BY0A 1NK3P 3S93A 3MVPA 3E5QA 5DTDA 2EINH 2HYJA 3HOZJ 1NG7A 1K6YA 3MZ8A 4AIJA 4A3BJ 1X58A 1FTTA 5J1UA 5BPDA 3GW2A 2ZJPF 3ZR8X 3G6EI 1TNSA 3A01A 3W3CA 3FX3A 1Z3YA 3BLYA 3VYTB 2E1OA 2K3PA 3LAJA 3ABKH 3F6OA 1LJ9A 1WJAA 5L3BA 2R92J 4GYGA 2V79A 3BJ6A 3NWTA 2XF7A 4LIVA 1KU3A 3DCFA 1HKSA 2XRNA 3I5UA 2KQRA 3MWMA 3CCRI 1XGMA 3I71A 1YO5C 1TWFJ 2AXTC 3GZ6A 4E6KG 4BJ6C 4CCJA 1IRFA 2P7CB 2X6OA 1QZEA 4LG3A 4LK1F 4AIDA 3KP2A 5EEGA 3G4SI 4XBFA 2CFOA 1LEAA 2DMNA 3E97A 1ZYRF 4MHGA 3BP8A 4DJAA 4UVAA 2VLAA 5FKNA 4QIWN 4BXUA 2GOXB 3R0JA 4IPAA 3WU2C 3H36A 2XPWA 3BTIA 1RPWA 3K4JA 2JSPA 3U1DA 1HF0A 3JRFA 2PLYA 1KQ9A 2WADA 1ETXA 3SEQA 4HX7A 5FKOA 2HKOA 1RNLA 3VYUB 2PJRB 5IP7J 4F92B 2G9WA 2QLZA 2DA7A 1VQKI 4AIKA 3I64A 3R6SA 3RI4A 4PSXA 2I5UA 4M6YA 5J3LA 5JHUA 3CCQI 1FP1D 2DA3A 3F9KA 4NHJA 2V6CA 3ESWB 4XRMA 1CF7B 4G7ZF 1QVUA 6PAXA 5B5EC 4XONA 3K10A 2XAHA 4LB6B 1T56A 5IP9J 2W00A 4DQ2A 1BIBA 4N4NB 2QCOA 2K9MA 4XLHA 1A04A 2KJBA 4UUSB 2H6CA 2LF7A 3ROUA 1B59A 2EA2A 1VQ8I 1XG1A 4Q47A 5F04A 1ZG1A 1XPXA 2QKLB 4LMYA 2QKMB 3CCUI 4IQJA 1HSTA 3IAS2 3IWFA 2VT2A 4RAYA 1IV6A 3FMQA 2ICWG 5FJ8J 2Y9ZA 3TKYA 1UMQA 1MBFA 3TDUC 4I7HA 3JREA 4IHSA 2F4IA 3A01B 4XKBA 3MKLA 2L9SA 1SC7A 4WXCA 3TW6A 4IOCF 4I99C 4ANJA 1KONA 2KDOA 2X51A 1P4WA 3DBHB 4YEJA 3S16J 5D8KB 2RNGA 1OPCA 1ETQA 3FISA 4FTHA 1D0XA 3QRFF 2CUFA 3P9IA 2Y0SA 3CCMI 1ZTRA 1IDYA 2A6HF 2CUEA 2E1NA 3GBGA 2BV6A 2OBPA 4OOIA 3RYRA 3ZN0A 4BBRJ 2ZMEC 1XN7A 5DM6F 3F8FA 1LUJB 2IA1A 3NARA 2VE9A 4C30A 2JTVA 2B63J 1SD5A 2ELJA 3E5XA 2M0CA 4P5OA 3U2RA 4EM2A 1IW7F 2BW3B 5EZHA 2DO7A 3ZP5A 2K9QA 4KDPA 3PJRA 1MBJA 2JA5J 3HG9A 2X6YA 1G3SA 1Y0NA 2QM3A 5J1YA 2WAFA 1A31A 2FNAA 4XR6A 5CQGA 3TDZC 1ENHA 3E5UA 4PDKA 5HNHA 2IS1A 1MJAA 3Q0VA 1U9NA 2VBYA 4JX5A 4ZTFA 1OFCX 2XRLA 3H5AA 4MLOA 1X3ZB 3V8KA 2DXIA 2JVGA 4HF1A 4BE2A 1T0FA 4BGDA 3G2BA 1FBQA 3O8HA 4LIUA 5E3NA 2VE8A 2L9VA 4RAGA 1ZR2A 3KE2A 3KZIC 5DCMB 5IY5H 1TLHB 4L18B 1W36D 2E34A 1QO0D 2WA0A 1T08B 4G8XA 3JRCA 1QPIA 1WH7A 4UV9A 2VONA 2XAJA 3FDYA 1RZ4A 1APLC 4OAZA 2WBMA 4WXDA 2DYRH 4OIOF 3CP8A 2C6YA 2LYCA 5E1ZB 3SZPA 1AA7A 3GTJJ 4XN3A 4B4CA 2X0LA 2R0QC 1DDNA 1X3UA 3DPLC 3CC4I 3I0TA 1K78B 2EIJH 4E7HA 1UB9A 2PMUA 3QYFA 2PI0A 1R36A 5FD5A 1WQ2A 3QAHA 2DFIA 3QOPA 1P7JA 1E3PA 2HTJA 3IL2A 2QA4I 2KRFA 4WX9A 2ZXIA 1I1GA 5AIQA 1BR2A 1WFXA 3M8JA 3RTRA 1IG7A 4M6XA 3BOQA 3F8CA 5ICGA 2MLGA 3FK7A 1HKQA 2GZWA 3FM5A 2XKPA 3RQ4A 2NYXA 5K5QA 3OYAA 2QBYA 2L7ZA 3HOUJ 2VOOA 2OUMA 3A0BC 3J80K 4P55A 1P92A 1X4OA 1XGOA 3AG1H 5EG0A 3H3UA 4G7HF 3PM1A 3TP0A 4XKWA 2EQRA 5GAEJ 1HSJA 5K7ZA 1E17A 3J7AY 2VPLA 1VI0A 1LQ1A 3ABUA 4IQ4A 5LGUA 4OIPF 2QEXI 3FZVA 3T1BA 2RVCA 5LHGA 4HV5A 2R7OA 1FOKA 4A3FJ 1XDSA 3LSMA 3VSKA 3LA7A 4ZDOA 1X1CA 4MGRA 3WTWC 4JQFA 1O3RA 1JJ6C 2J5PA 2KZGA 2JPCA 1YJ9I 1E2XA 4L9JA 2CU7A 4C3HJ 3PO2J 1DQUA 4IHVA 1MNEA 3OV8A 2XUBA 4E7SA 2X6XA 4M74A 5KHDA 1W7PA 1VQ9I 1OYWA 3HHGA 3J7YJ 1MIJA 1JT6A 2MH9A 3HGYA 5LRSA 4ON0A 1IRGA 2QUFA 4KIBA 3LSRA 1TWCJ 2NAZA 3HUGA 4B43A 3F8MA 2CV0A 1J5YA 4RAFA 2R7DA 1NK2P 2A69F 1DUXC 3S14J 1JKRC 2PMZA 2JQ7A 4HA8A 3IRQA 4ZJZA 2QF7A 4DZJA 3U21A 2M3AA 2M7BA 4LJZF 2DJIA 4HX8A 3SDGA 4U7DA 5J8FA 5D5VB 3FK6A 1QRYA 1JTXA 4J19A 2IS6A 3QP5A 2Z99A 3AKZA 3A0HC 3NAUA 2K40A 2V6EA 2QZ8A 3PO3J 2H6BA 4ESFA 2HPMA 3CJQB 3V8JA 1S5LC 1W0TA 2XROA 4L0ZB 1QQIA 3KP6A 5DD4A 2R3SA 5FD6A 1XGNA 2E5NA 4ENMA 3S2DJ 2Y0MA 2CQKA 2V1XA 1H9GA 4EV0A 2A61A 2H94A 2HOAA 3HSRA 3FXUA 1HOMA 5FRNA 1WHUA 1U2WA 1VTNC 2DLLA 2QBYB 1BA5A 5F27A 1D5VA 3A4CA 1ETWA 3H9JA 1DU0A 2E2JJ 4QPOA 2FSWA 4X1EA 5EG0B 1LNWA 2HFHA 5H6QA 4XRFA 2XPUA 3IWZA 4BHPA 1K83J 2QQAA 4A0YA 1SAXA 2WY7Q 2HVSA 2W57A 1KZHA 1F4KA 1LKXA 4UNOA 4C2UA 1JHHA 3EUHA 1WJ5A 2R7UA 3MCZA 4A3EJ 1F43A 4HNTA 5J40A 4D1QA 2K7LA 1AU7A 3LA2A 2PN6A 3L1PA 2PG4A 1WJBA 4XIDA 2CO5A 1HLVA 1UAAA 3M1CA 1FIPA 2Z9OA 5EZGA 3W6VA 1WI9A 3RPUD 4CUGA 2EH3A 3TOAA 2F5VA 4PJ0C 3RSNA 2L7KA 3VB2A 5TJJA 3HOVJ 4IL6C 2DPDA 1W7PB 2F2EA 4IF4A 1YG2A 3HRMA 2GM4A 3L9FA 3QU3A 2DA5A 4QSHA 4MTDA 3HUGB 4CCMA 4IRIA 3KPHA 2HOEA 2AS5F 2IGMA 2H8WA 1WGXA 2EZKA 2V26A 2JT1A 1OKRA 1DP7P 4EJVA 2EBIA 3PNYA 2CQ7A 3L2VA 1U0JA 2R93J 1U8RA 2ESHA 4IKFA 2K9NA 4R8HA 1FC3A 2DW4A 1OCCH 3S3NA 3V42A 3LSPA 2L7MP 3K1NA 4BJTA 3KCCA 4XOPA 4OIRF 1MW7A 3K2AA 2M1BA 4U88A 2Q8KA 5B3SH 3OY9A 3BT9A 1ZRFA 2RV8A 5HNFA 2DOEA 3FWEA 5AONA 2DU9A 3CMMA 1I1SA 1K4TA 4HLXA 2L4AA 1SVLA 3SJMA 2VBZA 3ABTA 3TGNA 3TO7A 4ZTJA 2HEOA 2LKPA 1TWGJ 5D6EA 5E3OA 3ABLH 4KITB 1BL0A 2L7FP 4HSRA 4G7OF 4CSWA 2KIFA 5GTIC 1W36C 1I6HJ 1YE9A 2LLKA 1B72A 2OQRA 2VXDA 2NVXJ 4U0WA 1JKQC 1WPKA 3BQZA 2GIZA 3JCUC 1IO2A 4EM1A 1Y1WJ 2JRTA 5FB2A 5BS6A 4XICA 2W48A 4HYEA 1ZG3A 2DQRA 4ZC3A 3MEXA 2VJJA 5GPAA 3DKYA 1ETYA 1U8BA 1VQPI 2HOSA 5DYMA 3HBLA 4BJ5C 2ZBKA 3K4KA 3TOBA 4A3CJ 2L9RA 2ELKA 3CDIA 4S04A 3LNQA 4LFUA 3BG7A 4M71A 2HU9A 1E3HA 1RESA 1ZK8A 1XX5A 3GWZA 5JVGF 3L2CA 4II3A 4UHTA 1MKMA 1ONVA 4BL0B 2ZXWH 3CZ6A 4BQNA 5GAHJ 5KAFC 2ZFWA 1A6QA 3CCYA 3VSLA 4LLNA 2WV1A 2R4GA 5FKLA 4BUPA 4BY1J 2LRDA 3AG3H 2HYFA 3SZTA 1OR7A 3MFKA 3ASOH 2DBBA 3HJEA 1Z91A 2BYVE 3GEZA 3KEYA 5CLSA 1PUFA 3C2GA 3C2HA 2M2EA 3GTOJ 2LKSA 4OINF 3OYGA 4EJOA 4OIQF 4IHYA 2XGEA 4GRIA 4BXFA 3D5RC 2H27A 3F72A 4U87A 4A0XA 3S1NJ 1B9NA 1YX3A 1OCPA 3WTUC 1WJCA 2MABA 1IAWA 2YX4A 1B8IA 3FXOA 5F08A 1NHAA 5FKKA 2LDUA 4XN0A 1AHDP 1DGWY 4A93J 5HODA 1Y56A 2NS7A 2OPTA 2PMHA 2ZCWA 3HB9A 2Y69H 4G9YA 4BEHB 2D1VA 3L00A 4RA2A 3OSFA 2ECBA 4MNUA 4D7MA 3S1RJ 2Z2SB 1SVMA 1V55H 2FA5A 2QQ9A 3DEUA 5L3FA 2ME6A 1D0YA 3OYJA 2ISZA 4Q5SF 4B8XA 3SQNA 1O3TA 4N9HA 4E70A 1H8AC 1JHFA 1Z6RA 1B72B 2K86A 5IT3A 4ZYDA 1YIOA 3F3XA 3RJPA 5FLXK 2WC2A 2F4OB 2RAEA 1WJEA 1V54H 2MYSA 3BG6A 3HKZN 4Y7NJ 3EETA 4S0HB 5HDKA 2I10A 2M45A 1EA3A 3O2PE 4EVIA 1J75A 4D5CA 2L3DA 4HPQA 1J0RA 3O3KA 2VKHA 1LFPA 3HTUA 5ICFA 4AD9A 4AU7A 4B09A 3FKIJ 1TQIA 2QSFX 4UB8C 3V4GA 1R1UA 2H8RA 1KU9A 1FEXA 4J01A 3K4NA 4A3JJ 1YX5A 1Y8RB 3Q9SA 2G0EA 2VJIA 5J47A 2DCEA 1YQAA 4KMUX 3T0YA 1V5GA 3SFIA 4L5EA
chains in the Genus database with same CATH topology
5F04A 1PUFB 4M6VA 4XK4A 3A02A 2JMWA 1R9TJ 2DA6A 1IV6A 1Z77A 3CDLA 2DA1A 2ID6A 5FJ8J 2Y9ZA 4FISA 5IOZA 1UMQA 1MBFA 1P7IA 4M3GA 3BTCA 4Y52J 4BKXA 3JREA 3A01B 2N8GA 3MKLA 3E7LA 3TW6A 1ZQ3P 4M3BA 1IDZA 1ZGWA 2TRTA 3S16J 1JUMA 3RQIA 2R5ZA 1ETQA 3FISA 2JJ7A 4FTHA 2CUFA 3OIOA 1ZTRA 1IDYA 2CUEA 2GLOA 3GBGA 2IBDA 4BBRJ 3S1QJ 5IOYA 2MSYA 3HEFA 2LY9A 3JRIA 2E19A 3ZQLA 3NARA 3IH3A 1A5JA 1NTCA 2DMTA 2B63J 2M0CA 3Q3SA 5EZHA 2K9QA 2LTPA 1MBJA 2JA5J 1MNMC 3B6AA 2R5YA 5J1YA 4XRSG 1ETKA 2DA2A 1ENHA 1YRNB 3H0GJ 1MSFC 3Q0VA 1U9NA 1D5YA 4JX5A 1OFCX 2XRLA 4MLOA 1ORKA 1E3OC 5FKMA 3K7AJ 3RZDJ 3TEDA 3Q0UA 1FIAA 3O8HA 5E3NA 2JK3A 1ZR2A 2DA4A 1F36A 2X9DA 1OCTC 4DYRA 1WI3A 4DW6A 1T33A 1VF9A 3A03A 5FLMJ 5J1RA 2VPRA 1TWAJ 2L0KA 3QQAA 3JRCA 1QPIA 1WH7A 4D7NA 1MBHA 1APLC 3S15J 1HDPA 5M5XJ 5E3MA 1S7EA 3TW7A 4DZPA 4A3MJ 3G1LA 1IUFA 3GTJJ 4BXXJ 5IYBJ 4B4CA 2R0QC 5EEAA 1MBKA 1XC5A 5M3FJ 1H89C 1I3QJ 5EDNA 4IHWA 2HDDA 1FTZA 3BR1A 2JN6A 2H1KA 4M3EA 1P7JA 3GTLJ 2NS8A 2VUMJ 3GTMJ 1IG7A 1MBEA 1RETA 2E2HJ 4AC0A 3FK7A 2OF7A 3LSJA 2LP0A 1O4XA 1HDDC 1UG2A 4XRSA 3F0CA 2KDZA 2R5ZB 4D5FA 1IC8A 4C3IJ 2L7ZA 2GBYA 3JRDA 1BW5A 3HOUJ 3BR2A 4GFBA 4UUTA 3JRHA 2D5VA 5EF6A 2JWTA 5EG0A 1JGGA 3PM1A 1WH5A 4MFEA 5GP9A 3TP0A 2EQRA 2HQ5A 5K7ZA 2TCTA 2E2IJ 3I4MJ 1VI0A 1GVDA 3MN2A 3G1OA 2HOTA 1Z0XA 1MH3A 3GTQJ 3ZQIA 4RDUA 4AYBN 2R5YB 4HNVA 3BTJA 4A3FJ 5JLWA 4A3DJ 1TC3C 1GV5A 4FCYA 4IEJA 3S2HJ 1JJ6C 1BJZA 3BG9A 4C2MJ 3QPLA 4B1RA 2CU7A 2CQQA 4NDLA 1OJLA 4C3HJ 3HM5A 3PO2J 1W0UA 4IHVA 9ANTA 2DJNA 3OSGA 1RR7A 3BG3A 5EGOA 2FJ1A 4FE4A 4I76A 2M34A 4DYCA 1B8IB 1AKHA 3IH2A 1K61A 4MFDA 1JT6A 1JKOC 3HGYA 2LFBA 5BNGA 3G1MA 5F0FA 3LSRA 1TWCJ 4A3GJ 2X48A 1VFCA 3BR3A 1ETVA 1LFUP 1NK2P 2DMQA 1IJWC 1JKRC 1GUUA 3S14J 4BY7J 4MIMA 1ETOA 2QF7A 4DZJA 1MBGA 3BTLA 5M5WJ 1JJ8C 1ITYA 1EF4A 2ME0A 2DN0A 3DEWA 3SDGA 1DU6A 3C2BA 1A6IA 3FK6A 1QRYA 2XSDC 1JTXA 4J19A 2WAQN 3NAUA 3HOXJ 1POGA 4C3JJ 2XGCA 2K40A 2LVSA 3PO3J 4M3DA 3ZOBA 5DS9A 2FX0A 1W0TA 2LKXA 5E3LA 4A3KJ 5C4JJ 2ZB9A 3BQYA 2Y9YA 1HCRA 3UKGA 3S2DJ 4I6ZA 3HGGA 2HOAA 1LFBA 3S17J 1HOMA 3GTGJ 2COBA 2IAIA 2ID3A 3LSGA 2R7ZJ 2AO9A 3I4NJ 5F27A 1BA5A 2NVQJ 1ETWA 2JA7J 1JTYA 1DU0A 2E2JJ 3GTPJ 3LOCA 4X1EA 5EG0B 1GDTA 3RZOJ 2AHQA 4X6AJ 4A3IJ 2Y30A 2XPUA 2MGQA 1K83J 3JR9A 4B3AA 2LD5A 3ZQCA 2VI6A 4A3EJ 2O9LA 1F43A 2WB1N 3BG5A 2FQ4A 1IGNA 1AU7A 3JRGA 1RKWA 1GT0C 2LR8A 3L1PA 4XIDA 2VKEA 2XB5A 4W97A 1HLVA 1FIPA 1X2NA 4JX6A 4V2FA 5EZGA 3Q0WA 3W6VA 1XS9A 3BR0A 2EH3A 5EGOB 2YUSA 1U9OA 3O8GA 2HXOA 2VKVA 3HOVJ 4CYCA 1JKPC 1SANA 5M3MJ 1AKHB 4FE7A 5F0HA 2GM4A 3D1NI 3H3VK 2DA5A 4JP0A 4QSHA 2YS9A 3WHBA 2FD5A 1SFOJ 2JA6J 3GTKJ 4A3LJ 4AUXA 1FJLA 3HOYJ 4ABZA 5C44J 1WGXA 2EZKA 3QPSA 2EBIA 1I50J 3ZQFA 3ZQGA 1JT0A 2R93J 2M9HA 2K9NA 3LSPA 2L7MP 2Y0SN 1TWHJ 2LK2A 3K2AA 2YU9J 3BT9A 2CRGA 1RKTA 1G2HA 1VNDA 5FLVA 3TP3A 2HXIA 3SJMA 1ZKGA 4W1UA 2K9SA 3M4OJ 5EYRA 5GPCA 3BR6A 2IEKA 1TWGJ 5E3OA 1UHSA 1LE8A 1BL0A 2L7FP 4DYQA 1I6HJ 2LLKA 1B72A 2NOGA 3IV5A 1QVTA 2NVXJ 2O8KA 1JKQC 1WPKA 5F1JA 3BQZA 1Y1WJ 5IYDJ 3ZQHA 4XICA 2W48A 2XGDA 1H88C 5GPAA 1X2MA 1ETYA 2KT0A 2DMPA 1U8BA 2HOSA 2HI3A 2NVTJ 2M8GX 4MO7A 3HBLA 5K7HA 4A3CJ 2L9RA 2ELKA 3LNQA 2DMUA 4JYKA 4G12A 1RESA 1ZK8A 1CQTA 3CQZJ 1JUSA 3CCYA 5IYCJ 4UUSA 3CMYA 5C4XJ 3JRBA 2WV1A 5FKLA 1JUPA 2MG4A 4BY1J 4BBSJ 2P81A 3FIWA 4CYCB 1NK3P 4RBOA 3MVPA 2JA8J 2EZHA 5DTDA 2HYJA 3HOZJ 1PUFA 2M2EA 1U78A 3GTOJ 3IH4A 2CQXA 1FTTA 4V2GA 1X58A 4A3BJ 4A69C 2ECCA 5J1UA 5JLXA 4IHYA 2XGEA 4M3FA 3A01A 3HDDA 3S1NJ 1OCPA 2MW8A 2E1OA 4EEFG 3BR5A 1B8IA 2R92J 5F08A 3DCFA 5FKKA 3OOUA 1ZR4A 1AHDP 2NVYJ 4A93J 2XB0X 1TWFJ 5HODA 2OPTA 2NS7A 2XPVA 3M3YJ 2X6OA 3HB9A 1MH4A 4QTRA 2DMNA 3OSFA 2ECBA 4D7MA 3S1RJ 4IHXA 1Q1VA 5FKNA 4QIWN 2ME6A 1LE8B 3VPRA 3JRAA 2XPWA 3BTIA 1YRNA 1H8AC 1RPWA 2EZLA 1HF0A 1B72B 3JRFA 2CJJA 1BW6A 1ETXA 1MSEC 5FKOA 2RAEA 3HOWJ 5IPAA 5IP7J 3HKZN 4Y7NJ 1Y1VJ 2DA7A 4S0HB 3B6CA 2I10A 2Y2ZA 4JX4A 3S1MJ 4D5CA 3WHCA 5J3LA 4LOCA 2DA3A 3FKIJ 2O7OA 5IP6A 4XRMA 1GV2A 1QVUA 3RKQA 2H8RA 1IRZA 2PMZN 1FEXA 1T56A 2EZIA 4A3JJ 5IP9J 5M5YJ 2QCOA 2Y31A 4UUSB 2G0EA 5C3EJ 5F0CA 2DTZA 5K7FA 1XG1A 1WCMJ 3SFIA 4L5EA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 5F04 A;  1PUF B;  4M6V A;  4XK4 A;  3A02 A;  2JMW A;  1R9T J;  2DA6 A;  1IV6 A;  1Z77 A;  3CDL A;  2DA1 A;  2ID6 A;  5FJ8 J;  2Y9Z A;  4FIS A;  5IOZ A;  1UMQ A;  1MBF A;  1P7I A;  4M3G A;  3BTC A;  4Y52 J;  4BKX A;  3JRE A;  3A01 B;  2N8G A;  3MKL A;  3E7L A;  3TW6 A;  1ZQ3 P;  4M3B A;  1IDZ A;  1ZGW A;  2TRT A;  3S16 J;  1JUM A;  3RQI A;  2R5Z A;  1ETQ A;  3FIS A;  2JJ7 A;  4FTH A;  2CUF A;  3OIO A;  1ZTR A;  1IDY A;  2CUE A;  2GLO A;  3GBG A;  2IBD A;  4BBR J;  3S1Q J;  5IOY A;  2MSY A;  3HEF A;  2LY9 A;  3JRI A;  2E19 A;  3ZQL A;  3NAR A;  3IH3 A;  1A5J A;  1NTC A;  2DMT A;  2B63 J;  2M0C A;  3Q3S A;  5EZH A;  2K9Q A;  2LTP A;  1MBJ A;  2JA5 J;  1MNM C;  3B6A A;  2R5Y A;  5J1Y A;  4XRS G;  1ETK A;  2DA2 A;  1ENH A;  1YRN B;  3H0G J;  1MSF C;  3Q0V A;  1U9N A;  1D5Y A;  4JX5 A;  1OFC X;  2XRL A;  4MLO A;  1ORK A;  1E3O C;  5FKM A;  3K7A J;  3RZD J;  3TED A;  3Q0U A;  1FIA A;  3O8H A;  5E3N A;  2JK3 A;  1ZR2 A;  2DA4 A;  1F36 A;  2X9D A;  1OCT C;  4DYR A;  1WI3 A;  4DW6 A;  1T33 A;  1VF9 A;  3A03 A;  5FLM J;  5J1R A;  2VPR A;  1TWA J;  2L0K A;  3QQA A;  3JRC A;  1QPI A;  1WH7 A;  4D7N A;  1MBH A;  1APL C;  3S15 J;  1HDP A;  5M5X J;  5E3M A;  1S7E A;  3TW7 A;  4DZP A;  4A3M J;  3G1L A;  1IUF A;  3GTJ J;  4BXX J;  5IYB J;  4B4C A;  2R0Q C;  5EEA A;  1MBK A;  1XC5 A;  5M3F J;  1H89 C;  1I3Q J;  5EDN A;  4IHW A;  2HDD A;  1FTZ A;  3BR1 A;  2JN6 A;  2H1K A;  4M3E A;  1P7J A;  3GTL J;  2NS8 A;  2VUM J;  3GTM J;  1IG7 A;  1MBE A;  1RET A;  2E2H J;  4AC0 A;  3FK7 A;  2OF7 A;  3LSJ A;  2LP0 A;  1O4X A;  1HDD C;  1UG2 A;  4XRS A;  3F0C A;  2KDZ A;  2R5Z B;  4D5F A;  1IC8 A;  4C3I J;  2L7Z A;  2GBY A;  3JRD A;  1BW5 A;  3HOU J;  3BR2 A;  4GFB A;  4UUT A;  3JRH A;  2D5V A;  5EF6 A;  2JWT A;  5EG0 A;  1JGG A;  3PM1 A;  1WH5 A;  4MFE A;  5GP9 A;  3TP0 A;  2EQR A;  2HQ5 A;  5K7Z A;  2TCT A;  2E2I J;  3I4M J;  1VI0 A;  1GVD A;  3MN2 A;  3G1O A;  2HOT A;  1Z0X A;  1MH3 A;  3GTQ J;  3ZQI A;  4RDU A;  4AYB N;  2R5Y B;  4HNV A;  3BTJ A;  4A3F J;  5JLW A;  4A3D J;  1TC3 C;  1GV5 A;  4FCY A;  4IEJ A;  3S2H J;  1JJ6 C;  1BJZ A;  3BG9 A;  4C2M J;  3QPL A;  4B1R A;  2CU7 A;  2CQQ A;  4NDL A;  1OJL A;  4C3H J;  3HM5 A;  3PO2 J;  1W0U A;  4IHV A;  9ANT A;  2DJN A;  3OSG A;  1RR7 A;  3BG3 A;  5EGO A;  2FJ1 A;  4FE4 A;  4I76 A;  2M34 A;  4DYC A;  1B8I B;  1AKH A;  3IH2 A;  1K61 A;  4MFD A;  1JT6 A;  1JKO C;  3HGY A;  2LFB A;  5BNG A;  3G1M A;  5F0F A;  3LSR A;  1TWC J;  4A3G J;  2X48 A;  1VFC A;  3BR3 A;  1ETV A;  1LFU P;  1NK2 P;  2DMQ A;  1IJW C;  1JKR C;  1GUU A;  3S14 J;  4BY7 J;  4MIM A;  1ETO A;  2QF7 A;  4DZJ A;  1MBG A;  3BTL A;  5M5W J;  1JJ8 C;  1ITY A;  1EF4 A;  2ME0 A;  2DN0 A;  3DEW A;  3SDG A;  1DU6 A;  3C2B A;  1A6I A;  3FK6 A;  1QRY A;  2XSD C;  1JTX A;  4J19 A;  2WAQ N;  3NAU A;  3HOX J;  1POG A;  4C3J J;  2XGC A;  2K40 A;  2LVS A;  3PO3 J;  4M3D A;  3ZOB A;  5DS9 A;  2FX0 A;  1W0T A;  2LKX A;  5E3L A;  4A3K J;  5C4J J;  2ZB9 A;  3BQY A;  2Y9Y A;  1HCR A;  3UKG A;  3S2D J;  4I6Z A;  3HGG A;  2HOA A;  1LFB A;  3S17 J;  1HOM A;  3GTG J;  2COB A;  2IAI A;  2ID3 A;  3LSG A;  2R7Z J;  2AO9 A;  3I4N J;  5F27 A;  1BA5 A;  2NVQ J;  1ETW A;  2JA7 J;  1JTY A;  1DU0 A;  2E2J J;  3GTP J;  3LOC A;  4X1E A;  5EG0 B;  1GDT A;  3RZO J;  2AHQ A;  4X6A J;  4A3I J;  2Y30 A;  2XPU A;  2MGQ A;  1K83 J;  3JR9 A;  4B3A A;  2LD5 A;  3ZQC A;  2VI6 A;  4A3E J;  2O9L A;  1F43 A;  2WB1 N;  3BG5 A;  2FQ4 A;  1IGN A;  1AU7 A;  3JRG A;  1RKW A;  1GT0 C;  2LR8 A;  3L1P A;  4XID A;  2VKE A;  2XB5 A;  4W97 A;  1HLV A;  1FIP A;  1X2N A;  4JX6 A;  4V2F A;  5EZG A;  3Q0W A;  3W6V A;  1XS9 A;  3BR0 A;  2EH3 A;  5EGO B;  2YUS A;  1U9O A;  3O8G A;  2HXO A;  2VKV A;  3HOV J;  4CYC A;  1JKP C;  1SAN A;  5M3M J;  1AKH B;  4FE7 A;  5F0H A;  2GM4 A;  3D1N I;  3H3V K;  2DA5 A;  4JP0 A;  4QSH A;  2YS9 A;  3WHB A;  2FD5 A;  1SFO J;  2JA6 J;  3GTK J;  4A3L J;  4AUX A;  1FJL A;  3HOY J;  4ABZ A;  5C44 J;  1WGX A;  2EZK A;  3QPS A;  2EBI A;  1I50 J;  3ZQF A;  3ZQG A;  1JT0 A;  2R93 J;  2M9H A;  2K9N A;  3LSP A;  2L7M P;  2Y0S N;  1TWH J;  2LK2 A;  3K2A A;  2YU9 J;  3BT9 A;  2CRG A;  1RKT A;  1G2H A;  1VND A;  5FLV A;  3TP3 A;  2HXI A;  3SJM A;  1ZKG A;  4W1U A;  2K9S A;  3M4O J;  5EYR A;  5GPC A;  3BR6 A;  2IEK A;  1TWG J;  5E3O A;  1UHS A;  1LE8 A;  1BL0 A;  2L7F P;  4DYQ A;  1I6H J;  2LLK A;  1B72 A;  2NOG A;  3IV5 A;  1QVT A;  2NVX J;  2O8K A;  1JKQ C;  1WPK A;  5F1J A;  3BQZ A;  1Y1W J;  5IYD J;  3ZQH A;  4XIC A;  2W48 A;  2XGD A;  1H88 C;  5GPA A;  1X2M A;  1ETY A;  2KT0 A;  2DMP A;  1U8B A;  2HOS A;  2HI3 A;  2NVT J;  2M8G X;  4MO7 A;  3HBL A;  5K7H A;  4A3C J;  2L9R A;  2ELK A;  3LNQ A;  2DMU A;  4JYK A;  4G12 A;  1RES A;  1ZK8 A;  1CQT A;  3CQZ J;  1JUS A;  3CCY A;  5IYC J;  4UUS A;  3CMY A;  5C4X J;  3JRB A;  2WV1 A;  5FKL A;  1JUP A;  2MG4 A;  4BY1 J;  4BBS J;  2P81 A;  3FIW A;  4CYC B;  1NK3 P;  4RBO A;  3MVP A;  2JA8 J;  2EZH A;  5DTD A;  2HYJ A;  3HOZ J;  1PUF A;  2M2E A;  1U78 A;  3GTO J;  3IH4 A;  2CQX A;  1FTT A;  4V2G A;  1X58 A;  4A3B J;  4A69 C;  2ECC A;  5J1U A;  5JLX A;  4IHY A;  2XGE A;  4M3F A;  3A01 A;  3HDD A;  3S1N J;  1OCP A;  2MW8 A;  2E1O A;  4EEF G;  3BR5 A;  1B8I A;  2R92 J;  5F08 A;  3DCF A;  5FKK A;  3OOU A;  1ZR4 A;  1AHD P;  2NVY J;  4A93 J;  2XB0 X;  1TWF J;  5HOD A;  2OPT A;  2NS7 A;  2XPV A;  3M3Y J;  2X6O A;  3HB9 A;  1MH4 A;  4QTR A;  2DMN A;  3OSF A;  2ECB A;  4D7M A;  3S1R J;  4IHX A;  1Q1V A;  5FKN A;  4QIW N;  2ME6 A;  1LE8 B;  3VPR A;  3JRA A;  2XPW A;  3BTI A;  1YRN A;  1H8A C;  1RPW A;  2EZL A;  1HF0 A;  1B72 B;  3JRF A;  2CJJ A;  1BW6 A;  1ETX A;  1MSE C;  5FKO A;  2RAE A;  3HOW J;  5IPA A;  5IP7 J;  3HKZ N;  4Y7N J;  1Y1V J;  2DA7 A;  4S0H B;  3B6C A;  2I10 A;  2Y2Z A;  4JX4 A;  3S1M J;  4D5C A;  3WHC A;  5J3L A;  4LOC A;  2DA3 A;  3FKI J;  2O7O A;  5IP6 A;  4XRM A;  1GV2 A;  1QVU A;  3RKQ A;  2H8R A;  1IRZ A;  2PMZ N;  1FEX A;  1T56 A;  2EZI A;  4A3J J;  5IP9 J;  5M5Y J;  2QCO A;  2Y31 A;  4UUS B;  2G0E A;  5C3E J;  5F0C A;  2DTZ A;  5K7F A;  1XG1 A;  1WCM J;  3SFI A;  4L5E A; 
#chains in the Genus database with same CATH topology
 4ESB A;  3FXQ A;  1T0F C;  3BZ6 A;  1RIO H;  1PUF B;  3A02 A;  2JMW A;  4XLP F;  2VC0 A;  4ZZD A;  3L2R A;  5BPI A;  2M30 A;  1LVK A;  3CDH A;  4EJW A;  3BTC A;  4Y52 J;  5ERI A;  2OU2 A;  4BKX A;  4MQV A;  2MBF A;  2EWN A;  1Y0U A;  2OZ6 A;  1EH6 A;  2HZD A;  1ZQ3 P;  3DPU A;  3K69 A;  1IDZ A;  1DGR M;  1G8X A;  4AYB A;  3RQI A;  2R5Z A;  5CVV A;  4BDZ A;  3VDX A;  4CO8 A;  4CCL A;  1P6R A;  3IUO A;  1FYM A;  1V5F A;  2GLO A;  1G59 A;  4HOB A;  1I3A A;  2AXL A;  3HEF A;  2LY9 A;  3ZQQ A;  2E19 A;  2OCE A;  4YFX F;  2HNH A;  4HDV A;  4XSX F;  3ZQL A;  1NTC A;  3CF2 A;  2GQQ A;  4YIF A;  2XAQ A;  1RI7 A;  4A5M A;  1AOY A;  3B6A A;  2Q1Z B;  3ECO A;  3AL0 C;  3Q5F A;  4XRS G;  1ETK A;  2ZO4 A;  3RKY A;  2RC4 A;  3ZMS A;  1UHW A;  4XL9 A;  4N4O B;  4XLF A;  5E79 C;  4RGS A;  2D45 A;  4YFN F;  3ONQ A;  3QOE A;  1IUY A;  2KFD A;  3TED A;  2CG4 A;  3Q0U A;  1TZL A;  4O6J A;  5D4S A;  3OYD A;  4I09 A;  4PCQ A;  2FRH A;  2PJP A;  1V3F A;  5BOX A;  2CUJ A;  4GXO A;  4DW6 A;  1T33 A;  1VF9 A;  5E8I A;  5J1R A;  2P7V B;  2HDW A;  2GXA A;  1TWA J;  3QQA A;  2HZT A;  1ULY A;  4BAC A;  4XNF A;  4A5N A;  4V19 K;  3R4K A;  3OYB A;  4D7N A;  3UNG C;  2CH0 A;  1RC9 A;  2PBI A;  3FMR A;  1S29 A;  3E6M A;  4CIC A;  2V4J C;  3PIP F;  3CLQ A;  3PNT A;  1IUF A;  2LOO A;  2KIM A;  2WAE A;  2AQE A;  3C7J A;  3TQN A;  4Z6Y A;  3DWL E;  2XDV A;  2LNB A;  2TDX A;  5E17 F;  5TGT A;  5M3F J;  1H89 C;  1USS A;  1FX7 A;  5EDN A;  2X6W A;  2W82 A;  3MD2 A;  3WTS C;  2HDD A;  1FTZ A;  2JN6 A;  4J00 A;  4YII A;  4XKV A;  5ILS A;  1T39 A;  2OQG A;  2UUZ A;  1LB2 A;  2A5W A;  3WTY C;  1MMD A;  2R7F A;  2BEO A;  1R1V A;  2YSR A;  4AC0 A;  3SZG A;  4RAZ A;  2OF7 A;  4UVB A;  2LP0 A;  3G3Z A;  1OQY A;  3HOS A;  3QOD A;  1LEB A;  1UG2 A;  4XRS A;  3WTV C;  3RKW A;  1DPU A;  2R5Z B;  4D5F A;  4C3I J;  2EA4 A;  1G3W A;  4M73 A;  2DPU A;  4IRG A;  1YHQ I;  1BW5 A;  3BR2 A;  1X1A A;  5LBQ A;  1YYV A;  4L0Y B;  1YLF A;  3RIR A;  2I8D A;  5EF6 A;  4YG2 F;  2VJ4 A;  3ISP A;  1JGG A;  4MFE A;  3J81 K;  4FT8 A;  2HQ5 A;  2A6T A;  2CMP A;  2COM A;  2TCT A;  3PUF A;  4UUV A;  1E0E A;  4G94 A;  2KRC A;  3FXJ A;  4I01 A;  1GHC A;  3KYC B;  3GTQ J;  3ZQI A;  4AYB N;  2MLK A;  2DOA A;  1IXC A;  3M7G A;  3MMY B;  2CW0 F;  4HNV A;  1VQ5 I;  1MMA A;  2WV0 A;  4HEA 2;  2QVO A;  4CCN A;  2GA1 A;  3DTE A;  4A3D J;  3CTA A;  4IEJ A;  2KL4 A;  2MD0 A;  3L2U A;  2BXZ A;  2P5K A;  3QPL A;  3U1K A;  2A5Y B;  3CES A;  3CP2 A;  3HM5 A;  2B7E A;  5TIS C;  1W0U A;  3DBL B;  1MGT A;  2LSO A;  5FO5 A;  2KPM A;  9ANT A;  2QQ8 A;  2EB7 A;  3BG3 A;  5EGO A;  5B66 C;  4FE4 A;  1F9N A;  2M34 A;  4FX4 A;  2DFE A;  2IVM A;  1YS6 A;  1IXR C;  4G6Q A;  3D5S C;  3VYR B;  3JAM K;  5BNG A;  3G1M A;  2F6C A;  2K3F A;  1NG6 A;  2LH9 A;  3OWT A;  3WTX C;  1RUN A;  2WTE A;  4A3G J;  5HDN A;  2X48 A;  3BR3 A;  1ETV A;  3EUH C;  2FOW A;  2BGC A;  2DMQ A;  4DOZ A;  2KIU A;  4JK1 X;  3PUB A;  2BVL A;  3NEU A;  4KT6 A;  1EF4 A;  1XDU A;  2ME0 A;  4AIH A;  1UST A;  2Z1D A;  5AIP A;  4ENN A;  2DFH A;  2G7U A;  4BU2 A;  3IRR A;  2R7X A;  1JXS A;  3WOD F;  2XGC A;  2CS3 A;  1DP3 A;  3ZOB A;  3LA3 A;  2LKX A;  2E7X A;  1RRJ A;  1MZB A;  4G6T B;  3SHF A;  3MKW B;  2P0W A;  5C4J J;  1MMS A;  2ZB9 A;  4ASN A;  3UKG A;  4KIG A;  2FU4 A;  1FMV A;  3HGG A;  3CF5 F;  4PJJ A;  1W5C C;  5HS9 A;  1NH3 A;  3KLN A;  1LFB A;  1U6G A;  3OOP A;  3DTI A;  4KN4 X;  2ID3 A;  3I4N J;  2A05 A;  2AO9 A;  5L3D A;  3ZMD A;  4H0E A;  2JA7 J;  2MFZ A;  1H0M A;  2IXS A;  2DDB A;  4OMZ A;  3HSE A;  3LOC A;  3F21 A;  2FQ3 A;  3K1M A;  2AHQ A;  2VC1 A;  4U7B A;  1UFM A;  4XOT A;  5CYV A;  3S2W A;  1T8I A;  4X0G A;  5CVJ A;  3RDI A;  4P1W A;  4RB2 C;  1D8K A;  2NRA C;  3OYF A;  3WGI A;  4OMY A;  2VI6 A;  3BZC A;  3DEE A;  3HL2 A;  2O9L A;  3K4B A;  4BQO A;  3TO9 A;  2FQ4 A;  5E20 A;  4BE0 A;  3JRG A;  1P2F A;  2W4S A;  2E60 A;  1WSU A;  2QWW A;  3SXY A;  2JZY A;  3E3V A;  2H09 A;  3R60 A;  3Q0W A;  3MZH A;  1Z1D A;  5FRM A;  3DU5 A;  1WZ2 A;  5EGO B;  1XMA A;  2Z16 A;  2FNP A;  2V9P A;  3R0A A;  4UVC A;  2ZJ2 A;  1HC8 A;  4CYC A;  3SFZ A;  1SAN A;  3WTZ A;  5M3M J;  2JSC A;  4FE7 A;  5F0H A;  1D0Z A;  2VBX A;  3D1N I;  3H3V K;  5D8L B;  1G3T A;  3HHH A;  1KU2 A;  1R5I D;  4F55 A;  1FJL A;  1S9H A;  4BAY A;  1PDN C;  1IV8 A;  5C44 J;  1ON1 A;  2E1C A;  3DF8 A;  4WWC A;  1D1C A;  1I50 J;  3ZQF A;  3IC7 A;  2XAF A;  1U5T A;  5EJC A;  2KRH A;  4CHU A;  4LGW A;  1EV7 A;  1KYZ A;  5J8C A;  4WCG A;  1FZP B;  3H92 A;  4LIT A;  3NQO A;  2Y0S N;  1R00 A;  3M1E A;  1BC7 C;  2YU3 A;  1TWH J;  3I58 A;  2CRG A;  1RKT A;  2EFO A;  2FXA A;  4RGR A;  2X1C A;  4DBR A;  3FM3 A;  5H6R A;  2UXN A;  1UG0 A;  1VND A;  2X1E A;  2ADU A;  4HRI A;  3TP3 A;  3M8E A;  2KZV A;  5LGT A;  3VFZ A;  2K9S A;  4E7Z A;  5HLT A;  2EJR A;  4I0A A;  2EFQ A;  1D3Y A;  3BR6 A;  2IEK A;  2DT6 A;  3ASN H;  1LE8 A;  1LDK B;  2JVH A;  4B3X A;  2STW A;  3OYE A;  3OYK A;  4BDY A;  5CKT A;  3IAM 2;  5DDG A;  2NOG A;  3NWS A;  4C9Y A;  1QZY A;  2O8K A;  5DD8 A;  2CQN A;  3PNV A;  3WTT C;  5EEH A;  3ZQH A;  1J7K A;  2OAZ A;  1XCB A;  1W4M A;  2BBY A;  1TQM A;  4EQQ A;  1XGS A;  5D4R A;  2DMP A;  1SFK A;  2HI3 A;  2NVT J;  1B9M A;  2IA2 A;  4MO7 A;  5K7H A;  1ACI A;  4KUM A;  3GLL A;  1UJ8 A;  4UV8 A;  5CVI A;  2L4M A;  4D9J A;  4ZYE A;  3DPT A;  1S3J A;  2GXG A;  2M87 A;  1J59 A;  1CQT A;  2JUG A;  5LLQ A;  1VQ6 I;  3H35 A;  5IYC J;  4GO1 A;  5C4X J;  3JRB A;  2MG4 A;  2A3S A;  4CYC B;  1OYY A;  4RBO A;  1WRJ A;  2PQ8 A;  5CVR A;  5GAD J;  5HS8 A;  1S72 I;  1U78 A;  3IH4 A;  2CQX A;  5CJ9 A;  4N9I A;  4A69 C;  5JLX A;  1QHH D;  4DGW B;  5L3G A;  1RUO A;  4M3F A;  2DAO A;  3GFJ A;  3HDD A;  1U5T B;  2O61 A;  4EEF G;  3BR5 A;  4PGH A;  1JGS A;  4Z2Y A;  4ETS A;  2QQB A;  2CW8 A;  5KNL A;  5K1Y A;  1IN4 A;  2WAQ A;  4BE1 A;  2X1D A;  2ZNY A;  3K0L A;  3C3W A;  3VYS B;  2FBK A;  3C18 A;  4WF2 A;  4B44 A;  4DNC A;  3M3Y J;  2OTJ I;  2UXX A;  1HA8 A;  3QYB A;  3LFK A;  4EMS A;  1ZRE A;  1LDJ A;  4UB6 C;  2K4B A;  1MH4 A;  4QTR A;  1ODD A;  4ZYG A;  2Z33 A;  2P5V A;  2W84 A;  3PQK A;  3QWL A;  2ZJQ F;  4IHX A;  4OAY A;  2ZME A;  5JVT A;  3CUQ A;  1LE8 B;  3VPR A;  1TT5 B;  4LLG F;  4RMN A;  3JRA A;  2OA4 A;  3H5R A;  1S8N A;  2EZL A;  1M1E B;  1BW6 A;  4HLY A;  3WG9 A;  3DU6 A;  3HOW J;  2R7R A;  1N25 A;  2VQH A;  4BH9 A;  1I39 A;  3K2Z A;  3KYD B;  4LLL A;  1Y1V J;  4PUS A;  3EYI A;  3ZGK A;  2R7T A;  3B6C A;  2OD5 A;  2Y2Z A;  5DUI A;  3S1M J;  2E7W A;  4L5I A;  1SD7 A;  3E6D A;  4YFK F;  3D0S A;  4LOC A;  3VWB A;  4NUB A;  5HDG A;  4JBA A;  2CGP A;  1R4N B;  1IRZ A;  2PMZ N;  4OWR B;  4I0B A;  3ZN1 A;  1DPR A;  4MEX F;  2HTS A;  2FML A;  3CUO A;  2Y31 A;  3DLL F;  3LWF A;  2E5Z A;  5F1R A;  3GFM A;  5C3E J;  3LAP A;  1YIT I;  1ZHF A;  3HPG A;  5LHH A;  4PJN A;  1K7A A;  3OYL A;  1IN6 A;  4M6V A;  2LBF A;  1W7P D;  3RKX A;  2KP6 A;  3W2A A;  3CDL A;  2DA1 A;  4NNJ A;  3GZ5 A;  2BHZ A;  4WK8 F;  1MMG A;  4FIS A;  5IOZ A;  3BPV A;  1QPM A;  1R6R A;  3AG4 H;  4ZH4 F;  3KET A;  3E7L A;  3ZPL A;  1D1B A;  3HZJ A;  1W5T A;  4F52 A;  1P9Q C;  3ZXS A;  1N75 A;  2NOJ B;  2TRT A;  3ZQ7 A;  2P6T A;  1WKM A;  4CH7 A;  1BR1 A;  2LRE A;  3FHN A;  3OIO A;  5CVU A;  2VIX A;  3KIO A;  4GDF A;  2KIQ A;  3ERE D;  2Q0O A;  3J7A O;  2IBD A;  1XSX A;  3S1Q J;  5IOY A;  2MSY A;  2XVC A;  4NBQ A;  2DMT A;  1YFH A;  3EPZ A;  1OMI A;  1P4A A;  2LTP A;  1MNM C;  2R5Y A;  4YRV A;  4HV6 A;  1UHM A;  3GXO A;  3CUQ B;  2DA2 A;  2CW7 A;  3CO6 C;  3NRV A;  5JHF A;  3MAJ A;  5CQE A;  1D5Y A;  2D1H A;  1OCR H;  2HWV A;  1ORK A;  1E3O C;  3EDP A;  4L9V A;  3CCV I;  4ENK A;  2EIM H;  1ZAO A;  3OS1 A;  2OCC H;  4II2 A;  1BIA A;  1O7F A;  2V7F A;  2K02 A;  1VQM I;  2DA4 A;  1F36 A;  3J7Z I;  3H1C A;  3CCL I;  2X9D A;  4CYD A;  1OCT C;  4DYR A;  1WI3 A;  4Q4Z F;  4CA0 A;  2EPF A;  2QSH X;  2L0K A;  2XAG A;  2IS2 A;  1MBH A;  2V9V A;  3BC8 A;  2WY8 Q;  5A2Q K;  2P6S A;  3SYT A;  2Q2E A;  4PFP A;  2L02 A;  4DZP A;  4BXX J;  3G1L A;  5IYB J;  4CDG A;  3E1S A;  3KLO A;  1D1A A;  4JOM A;  5EEA A;  3E0J B;  2FUG 2;  3GLX A;  1BI0 A;  4HW0 A;  1MBK A;  4D0P A;  1FWZ A;  1XC5 A;  2PX9 A;  2DOD A;  3J80 Z;  4IZZ A;  1X1D A;  1BI2 A;  1SD6 A;  1R71 A;  5B1A H;  2ZXJ A;  4IHW A;  2XC7 A;  2CFX A;  2LBF B;  3BR1 A;  2R7Q A;  1S6L A;  2ZXH A;  1XCV A;  1XSD A;  1PJR A;  3ZMV A;  3F6V A;  2LY1 A;  2NS8 A;  4QLC U;  1FYL A;  1PYV A;  3EYY A;  4UXN A;  3GTM J;  4H4K C;  2E2H J;  3HSF A;  2UWM A;  3QYE A;  3GME A;  1O4X A;  1HDD C;  3F8B A;  1T95 A;  4O3M A;  3K6G A;  4HBL A;  1F5T A;  4UY8 I;  1R23 A;  3JRD A;  4RB0 A;  2WB1 A;  1R22 A;  4FX0 A;  4UUT A;  3BWG A;  2ACJ A;  1IN5 A;  3JRH A;  4XOR A;  1QA6 A;  2D5V A;  2EIL H;  2JWT A;  5GP9 A;  1WH5 A;  2E71 A;  4XSZ F;  4NQW A;  3I4M J;  2OZU A;  1U3E M;  2JRM A;  4LD5 A;  4S05 A;  1LPQ A;  1GVD A;  3G1O A;  4XLN F;  1Z0X A;  1MH3 A;  3K4M A;  3PFI A;  4EAT A;  4HX4 A;  5J6X A;  2M4G A;  4HG2 A;  2R5Y B;  4LB5 A;  5JLW A;  3CMA I;  1TC3 C;  4R1H A;  2GWR A;  3S2H J;  1BJZ A;  1WJF A;  1R4M B;  2RQP A;  3SDB A;  3V8L A;  4C2M J;  5JFR A;  5K5O A;  5H20 A;  1OJL A;  4P9U A;  5J4V A;  2ZC2 A;  4LK0 F;  3IKT A;  2ZFU A;  1KQ0 A;  4B47 A;  2O03 A;  3OSG A;  1RR7 A;  3PQJ A;  2FJ1 A;  2A07 F;  4DYC A;  1B8I B;  4ZYA A;  3WE2 A;  4U0V A;  3ZMU A;  2LFB A;  1LVA A;  2HYG D;  5F0F A;  3BRO A;  5K5R A;  1YJN I;  3BJA A;  4ZDP A;  2KKO A;  3H9G A;  1EJ9 A;  1BN5 A;  1IJW C;  1Z3X A;  2FOK A;  3HIF A;  4MIM A;  2Q2E B;  4QPQ A;  1YJW I;  2X85 A;  2RDP A;  1ITY A;  1TT0 A;  3KEQ A;  2BE5 F;  2DN0 A;  3DEW A;  3OIQ A;  1DU6 A;  1TBX A;  3TBI A;  2XSD C;  3EUK L;  2HPI A;  3HOX J;  4A2U A;  2P8T A;  3BCB A;  4HST A;  4A0Z A;  2FX0 A;  5DS9 A;  3AG2 H;  3K70 D;  3FBN B;  5E3L A;  3U9G A;  4Y13 A;  2RKH A;  1ZRD A;  3ABM H;  3W6K B;  3BQY A;  3LST A;  3W6J B;  3N05 A;  4I6Z A;  2DK5 A;  2G7H A;  1I27 A;  4XM3 A;  2LC2 A;  3OS0 A;  1ZG5 A;  1VQ4 I;  3GUD A;  3GTG J;  4IOA F;  2IAI A;  3LSG A;  2R7Z J;  2CV1 A;  3DXJ F;  1A36 A;  3GFL A;  3GTP J;  2EK5 A;  5LEK A;  1U5T C;  1Y6I A;  1BOB A;  2DI3 A;  1GDT A;  3RZO J;  2BZT A;  3IKV A;  4A3I J;  2Y30 A;  4NQW B;  1ZGJ A;  4BQQ A;  2ELH A;  3H9Q A;  4A12 A;  3OIP A;  4XLC A;  3JR9 A;  3ZMZ A;  1O57 A;  3BPX A;  5E18 F;  5ED4 A;  3ZQC A;  1REP C;  1IN7 A;  2MC4 A;  3RCO A;  4AVZ A;  2EV5 A;  3EUA A;  2A6E F;  2WB1 N;  4HNU A;  3KP3 A;  2MH2 A;  3HOT A;  4KNY A;  1B4A A;  3CCS I;  2LG4 A;  3HTS B;  2VXZ A;  1CGP A;  3LQQ A;  3P7N A;  3LSI A;  3KYL A;  1R58 A;  2V1D A;  4CZC A;  3CJT B;  2W25 A;  2XB5 A;  5B1B H;  3OL4 A;  2RQQ A;  1TP4 A;  5F6F A;  1X2N A;  1HQC A;  3KP4 A;  1XS9 A;  3KX2 A;  3BR0 A;  2W1O A;  3CJR B;  3KP5 A;  1BC8 C;  2R7V A;  2IJL A;  2BW3 A;  1U9O A;  2VKV A;  4RGX A;  4CGZ A;  4PGG A;  3WG7 H;  2DFF A;  2GAU A;  4P96 A;  5FFZ A;  5KAI C;  3KP7 A;  1TW3 A;  3ZCO A;  1G6N A;  3GFI A;  2YS9 A;  2DK8 A;  2FMY A;  4IJA A;  3GVA A;  2MA3 A;  3WHB A;  4CCK A;  3R61 A;  2HVR A;  4A3L J;  2JA2 A;  4AUX A;  1Z05 A;  4ABZ A;  2BY1 A;  3QPS A;  5ICC A;  2W7N A;  2ETH A;  3ZQG A;  5JR3 A;  1JT0 A;  3L2Q A;  4I02 A;  2M9H A;  5DCM A;  3QU6 A;  3E6B A;  4GYI A;  1UCR A;  3ELK A;  3K1P A;  2YU9 J;  1YI2 I;  1FOW A;  4KIC A;  2STT A;  5KVR A;  1TNT A;  1HW1 A;  2EV6 A;  4GGG A;  1MJB A;  4M9S A;  1Z9C A;  1SFX A;  3K9T A;  1D8J A;  3G71 I;  2W85 A;  4W1U A;  1W1W E;  1FLI A;  1K78 A;  3KZZ A;  5GPC A;  2PFB A;  3CLO A;  1PVE A;  3LSK A;  4YIR X;  3B02 A;  4BS9 A;  4Y4R A;  2X4H A;  1X19 A;  5BQT A;  1KGS A;  5HLI A;  1S7O A;  1OCO H;  4AVP A;  1S7A A;  5GAG J;  1KA8 A;  1ON2 A;  2M0M A;  5H2F C;  2O3F A;  4PK4 A;  1FMW A;  3DKW A;  1T38 A;  1FBS A;  1H88 C;  1FSH A;  1WJD A;  3OYI A;  2KT0 A;  3LMM A;  5DV5 A;  4RLF A;  2M5W A;  3WGG A;  1STZ A;  4HZF A;  4O5V A;  1X1B A;  1SMT A;  2GA2 A;  4L5J A;  1ZH5 A;  4JYK A;  1YIJ I;  4G12 A;  4BHB A;  3LFU A;  1TTY A;  3TO6 A;  1F1Z A;  3CUQ C;  2Y75 A;  2KIS A;  4EGZ A;  4KFC A;  1WWX A;  3HRS A;  3PSI A;  1KU7 A;  3FIW A;  4MQ9 F;  2O6G E;  2DT7 B;  2JA8 J;  2EZH A;  1K4S A;  4U0Y A;  1QU3 A;  2ZSI B;  4ZYH A;  5A2Q Z;  2IT0 A;  2DT5 A;  4V2G A;  1RR8 C;  1EH7 A;  3FF5 A;  2ECC A;  5F64 A;  2IW5 A;  3VOE A;  3DFG A;  1R49 A;  1HBX G;  5E1X A;  5HOO A;  3CJN A;  1WVR A;  4F3Q A;  1XSV A;  2R7W A;  1J2X A;  3AAF A;  2L01 A;  2MW8 A;  1EKE A;  2O8X A;  3OMY A;  2HKX A;  3QPT A;  2M7A A;  5FLX Z;  3IHU A;  1EH8 A;  3OOU A;  1ZR4 A;  2XIG A;  1QGP A;  1QZZ A;  2HDC A;  2NVY J;  2XB0 X;  1MD0 A;  1OYI A;  5LEJ A;  1W5S A;  5TRD A;  2QSG X;  2XPV A;  2VOP A;  2Y48 A;  1Z21 A;  2PEX A;  3GCM A;  4IHT A;  4LG0 A;  4RB1 A;  3N4M A;  2FEZ A;  4L9T A;  2KJC A;  2XAU A;  4RGU A;  1Q1V A;  2BHY A;  4NB5 A;  5ICE A;  2K4J A;  4RLQ A;  2VKD A;  4HQM A;  4C2T A;  2RRE A;  2F4M B;  3CCE I;  2RN7 A;  3T5X A;  3W2W A;  1YRN A;  5BMZ A;  3WU1 B;  1IN8 A;  5HLH A;  1H9T A;  2CJJ A;  4I2O A;  3RPU A;  5IT9 K;  3FXK A;  5HS7 A;  2XF5 A;  3CCJ I;  1MSE C;  1IZ1 A;  5IPA A;  3M9A A;  2VQL A;  4B48 A;  1FP2 A;  3DBR B;  3JW4 A;  2O0Y A;  4JX4 A;  4F7Z A;  3WHC A;  3PFY A;  5LRR A;  3TMO A;  5D5X B;  2M4K A;  5ILU A;  2V9K A;  3I3L A;  3W2V A;  1VQN I;  5D5W B;  3CD6 I;  2O7O A;  3K4L A;  5IP6 A;  1GV2 A;  4Q48 A;  3RKQ A;  2CSO A;  1YW7 A;  2DYS H;  1OR7 C;  4DBQ A;  2P5L C;  2EZI A;  4ZDL A;  3I4P A;  3ECH A;  5M5Y J;  2ZJR F;  4R79 A;  3K70 C;  3OR2 C;  1L0O C;  5LHI A;  5F0C A;  4AWX B;  1B6A A;  2DTZ A;  1TQP A;  5FGM A;  5K7F A;  1WCM J;  4PSW A;  2BY2 A;  1KYW A;  2M8E A;  1Z6T A;  4XK4 A;  4IRH A;  3BJO A;  3I54 A;  1R9T J;  2DA6 A;  3DQV C;  1Z77 A;  1P4X A;  2VN2 A;  4IX7 A;  2ID6 A;  3MQ0 A;  2E36 A;  2CV2 A;  1P7I A;  3ZRG A;  4M3G A;  1SMY F;  2A68 F;  4MEY F;  3G73 A;  2OTL I;  2N8G A;  1PUE E;  1I6X A;  2V1N A;  4OU0 A;  4KYW A;  1ZLK A;  4M3B A;  2H1L A;  1O7L A;  2GIV A;  1SAU A;  2KHM A;  1ZGW A;  1J09 A;  1JUM A;  3GZN B;  3KEO A;  2ESN A;  3QPH A;  2EV0 A;  4XLE A;  2JJ7 A;  3BY6 A;  4ESJ A;  1T98 A;  1HW5 A;  5DCF A;  1JE8 A;  2Z5U A;  3L2W A;  2FE3 A;  3FMS A;  4PJM A;  2F5D A;  3JRI A;  3LL7 A;  1A5J A;  2KMU A;  3BZK A;  3IH3 A;  1JI8 A;  3EQL F;  4GCV A;  4LG0 B;  3ZMT A;  1ZEL A;  3I9V 2;  2HQN A;  1Z7U A;  3GO5 A;  3Q3S A;  2K5C A;  2FBH A;  2F48 A;  1XB4 A;  4FAS D;  2VL8 A;  4K2E A;  1YRN B;  3H0G J;  1SFE A;  4XLA A;  1FPQ A;  2NS0 A;  1ZLJ A;  1MSF C;  4KN7 X;  1FY7 A;  2E1M B;  5E1W A;  1OIS A;  4XMY A;  4NC7 A;  4PFO A;  2F5E A;  3K7A J;  5DEQ A;  5FKM A;  3RZD J;  3AL0 B;  1FOY A;  4HF2 A;  2Z3Y A;  3A2K A;  1FIA A;  2FF4 A;  1UZC A;  2MC3 A;  3UR3 C;  1BR4 A;  2JK3 A;  4ZZL A;  2UV1 A;  3I59 A;  1MDM A;  3A03 A;  5FLM J;  2VPR A;  3H3Z A;  3OR1 C;  4BHC A;  5GTH C;  1Z7L A;  5D6F A;  1XD7 A;  3S15 J;  1YOV B;  3B73 A;  1HDP A;  5M5X J;  5E3M A;  2LF8 A;  4Y3O A;  4RM3 A;  1S7E A;  3TW7 A;  3GX4 X;  4A3M J;  3FXR A;  3WGH A;  2W24 A;  4BYY A;  5J4Y A;  2ZSH B;  2DTR A;  2BVM A;  3OL3 A;  2WWY A;  3IP4 B;  1R1T A;  4F93 B;  2IGN A;  2KLO A;  3RPQ A;  1I3Q J;  1GXP A;  3DKX A;  2VOD A;  3FKJ A;  2BY3 A;  2ZKZ A;  5LGN A;  3J81 Z;  2H1K A;  4M3E A;  4M72 A;  4KIS A;  3GTL J;  3MZY A;  4E7K A;  4EJT A;  3S32 A;  2BXY A;  2VUM J;  3N97 A;  1GXQ A;  1GVJ A;  1MBE A;  1RET A;  2VJ5 A;  1MND A;  3LSJ A;  1K79 A;  3HRT A;  2IPQ X;  3F0C A;  1OCZ H;  2KDZ A;  2J5O A;  1IC8 A;  1FBU A;  2L9N A;  2GBY A;  1X3W B;  4TV7 A;  4GFB A;  1G3Y A;  5LFA A;  3QP6 A;  3L09 A;  5E8G A;  3L7W A;  3DLA A;  1R5G A;  2K85 A;  4P9F A;  3JTG A;  2E2I J;  3HRU A;  2VB6 A;  2DOF A;  1Y39 A;  2XV4 S;  1J9I A;  3MN2 A;  2HOT A;  5KCM A;  3JSO A;  4RDU A;  2EFW A;  1KQ8 A;  2ISY A;  3JAM Z;  3H5N A;  2XF6 A;  4KJZ A;  4E7J A;  3ULQ B;  1VQO I;  3BTJ A;  3S8P A;  2B9S A;  2HVQ A;  1GV5 A;  4E4H A;  4FCY A;  2VT3 A;  1VQL I;  3BG9 A;  4HF0 A;  2VQC A;  4B1R A;  3P9C A;  1T6S A;  2CQQ A;  3D5L A;  4NDL A;  5JI6 A;  3JSP A;  4BEH A;  2DJN A;  5CPR B;  4WXH A;  2NNY A;  3HKZ A;  1N78 A;  5FRO A;  4I76 A;  3I53 A;  4KIF A;  1AKH A;  4KT5 C;  3I59 B;  3IH2 A;  1TW2 A;  4MFD A;  5DM7 F;  4IO9 F;  1K61 A;  1MDM B;  1JKO C;  2DDA A;  2FBI A;  3F8N A;  1FNN A;  4HAM A;  4XQF A;  3OYC A;  2YPR A;  1VFC A;  2O5R A;  1LFU P;  5HVQ C;  1V4R A;  1BOA A;  3JTH A;  1GUU A;  4E7L A;  4BY7 J;  1SEU A;  1HKT A;  3FXL A;  2ZNZ A;  1ETO A;  3X2Q H;  4YEL A;  1MBG A;  3BTL A;  4FHT A;  5M5W J;  1JJ8 C;  4NC8 A;  1LDD A;  1BJA A;  1PP8 F;  1A35 A;  1UEL B;  3C2B A;  2ZME B;  3V7R A;  1A6I A;  3OS2 A;  1VQ7 I;  2HQA A;  1IXS B;  3KZY A;  1N77 A;  2HS5 A;  2WAQ N;  4RB3 C;  3MKY B;  4KMF A;  3F23 A;  2YX7 A;  3OYH A;  2VAS A;  2IGK A;  4EGY A;  1POG A;  4C3J J;  3I56 I;  2LVS A;  2CUZ A;  3P9K A;  4M3D A;  1BI3 A;  2OV7 A;  4A3K J;  3M8F A;  3Q9V A;  2D2W A;  3M07 A;  3DV8 A;  1TL8 A;  3GF2 A;  2QYO A;  2Y9Y A;  3HXL A;  4G6D A;  4FQG A;  1HCR A;  2L2O A;  3OYM A;  4CCO A;  5KK1 A;  2F5F A;  3S17 J;  1BI1 A;  1MMN A;  3BDD A;  2COB A;  2MD5 A;  1O3S A;  4BNC A;  1XMK A;  1G4D A;  3T8T A;  2VQG A;  2NVQ J;  3K4C A;  1HW2 A;  1JTY A;  4A6D A;  1ZAR A;  1FYK A;  1YS7 A;  2XSJ C;  3ML6 A;  3TL4 X;  5ILV A;  1L3L A;  4X6A J;  2EFP A;  3CC2 I;  2BOL A;  1SD4 A;  1BM9 A;  2OJE D;  1XTA A;  2NXN B;  2MGQ A;  2CWE A;  4L9N A;  2QGU A;  1PP7 U;  1BBY A;  1R5H A;  1ZGA A;  5L3E A;  2XGX A;  4Y33 A;  4B3A A;  2LD5 A;  3COA C;  1GLN A;  1FOX A;  2HR3 A;  4N0B A;  3S3O A;  2IA0 A;  1XMX A;  2K9L A;  2GXB A;  5IT9 Z;  3LSH A;  3BG5 A;  3FHZ A;  1FSE A;  1IGN A;  4A6E A;  2XHK A;  3P5J A;  3T8R A;  2EIK H;  1YW8 A;  3E6C C;  1RKW A;  1GT0 C;  2LR8 A;  3WU0 A;  4AM3 A;  2VKE A;  4W97 A;  3VEP A;  4KA4 A;  2P4W A;  5LD2 C;  4JX6 A;  4V2F A;  4RS8 A;  4EM0 B;  4F91 B;  1X4P A;  4RM2 A;  2IS4 A;  4M9Z A;  1AWC A;  1IRX A;  2YUS A;  1ZRC A;  1VZ0 A;  3O8G A;  1R7J A;  2HXO A;  1JKP C;  3FXM A;  1AKH B;  3V7S A;  1C0W A;  3DTK A;  2CYY A;  4BQA A;  3SEZ A;  4JP0 A;  2LMD A;  5L3C A;  1T2K A;  2AQF A;  2FD5 A;  1Y8Q B;  1ZN2 A;  2XAS A;  3BCA A;  3O6B B;  1SFO J;  2JA6 J;  3GTK J;  3AFH A;  3HOY J;  2IRF G;  4IVN A;  3FBI B;  4HQE A;  2IP2 A;  1QHG A;  4FET A;  5HLG A;  4EJU A;  3PIO F;  1Z67 A;  2RNJ A;  3V7C A;  1SFU A;  2OC6 A;  2LK2 A;  2VBW A;  4I98 B;  4ITV A;  2HQR A;  1YW9 A;  4QWQ A;  2JPB A;  3CC7 I;  2QEN A;  4M9X A;  1YTY A;  1G2H A;  2DQL A;  3CME I;  4ENJ A;  5FLV A;  3RYP A;  2E35 A;  2RGV A;  3A1Y A;  1FT9 A;  3KFW X;  4HDU A;  1MJ9 A;  2GOM A;  4PZJ A;  2HXI A;  1Q1H A;  1ERD A;  1ZKG A;  1I5Z A;  1B1B A;  1V5E A;  3F22 A;  4IXA A;  3M4O J;  2XKO A;  5EYR A;  3CO7 C;  4MTE A;  1UHS A;  4Y17 A;  3S3M A;  4PJL A;  3HC7 A;  4DYQ A;  3OYN A;  5FFX A;  1O3Q A;  3H0D A;  4NC6 A;  3IV5 A;  3GYH X;  2B0L A;  1QVT A;  2UZK A;  4DIQ A;  4E7I A;  1SVO A;  2NVU B;  3REO A;  5F1J A;  4CXF A;  1K6O A;  2PJR A;  2NNN A;  5IYD J;  3DP7 A;  1QNT A;  2XGD A;  3PSF A;  3LQR A;  1X2M A;  5DUK A;  2M8G X;  2L5Q A;  3C1D A;  2EFN A;  2JUC A;  2F5C A;  3ERM A;  2DMU A;  2V1U A;  3HPH A;  1OLT A;  1CF7 A;  3HYI A;  3WE3 A;  2R7S A;  2IGO A;  4Y15 A;  4CZZ A;  2HGC A;  3PL8 A;  1X1P A;  3VOD A;  5D5U B;  2L54 A;  3CQZ J;  4XKC A;  1JUS A;  1QBJ A;  2YR2 A;  4UUS A;  3CMY A;  1IF1 A;  2K27 A;  1HXD A;  2LY2 A;  3I55 I;  1JUP A;  3MKZ A;  2E1M C;  4BBS J;  2P81 A;  2BY0 A;  1NK3 P;  3S93 A;  3MVP A;  3E5Q A;  5DTD A;  2EIN H;  2HYJ A;  3HOZ J;  1NG7 A;  1K6Y A;  3MZ8 A;  4AIJ A;  4A3B J;  1X58 A;  1FTT A;  5J1U A;  5BPD A;  3GW2 A;  2ZJP F;  3ZR8 X;  3G6E I;  1TNS A;  3A01 A;  3W3C A;  3FX3 A;  1Z3Y A;  3BLY A;  3VYT B;  2E1O A;  2K3P A;  3LAJ A;  3ABK H;  3F6O A;  1LJ9 A;  1WJA A;  5L3B A;  2R92 J;  4GYG A;  2V79 A;  3BJ6 A;  3NWT A;  2XF7 A;  4LIV A;  1KU3 A;  3DCF A;  1HKS A;  2XRN A;  3I5U A;  2KQR A;  3MWM A;  3CCR I;  1XGM A;  3I71 A;  1YO5 C;  1TWF J;  2AXT C;  3GZ6 A;  4E6K G;  4BJ6 C;  4CCJ A;  1IRF A;  2P7C B;  2X6O A;  1QZE A;  4LG3 A;  4LK1 F;  4AID A;  3KP2 A;  5EEG A;  3G4S I;  4XBF A;  2CFO A;  1LEA A;  2DMN A;  3E97 A;  1ZYR F;  4MHG A;  3BP8 A;  4DJA A;  4UVA A;  2VLA A;  5FKN A;  4QIW N;  4BXU A;  2GOX B;  3R0J A;  4IPA A;  3WU2 C;  3H36 A;  2XPW A;  3BTI A;  1RPW A;  3K4J A;  2JSP A;  3U1D A;  1HF0 A;  3JRF A;  2PLY A;  1KQ9 A;  2WAD A;  1ETX A;  3SEQ A;  4HX7 A;  5FKO A;  2HKO A;  1RNL A;  3VYU B;  2PJR B;  5IP7 J;  4F92 B;  2G9W A;  2QLZ A;  2DA7 A;  1VQK I;  4AIK A;  3I64 A;  3R6S A;  3RI4 A;  4PSX A;  2I5U A;  4M6Y A;  5J3L A;  5JHU A;  3CCQ I;  1FP1 D;  2DA3 A;  3F9K A;  4NHJ A;  2V6C A;  3ESW B;  4XRM A;  1CF7 B;  4G7Z F;  1QVU A;  6PAX A;  5B5E C;  4XON A;  3K10 A;  2XAH A;  4LB6 B;  1T56 A;  5IP9 J;  2W00 A;  4DQ2 A;  1BIB A;  4N4N B;  2QCO A;  2K9M A;  4XLH A;  1A04 A;  2KJB A;  4UUS B;  2H6C A;  2LF7 A;  3ROU A;  1B59 A;  2EA2 A;  1VQ8 I;  1XG1 A;  4Q47 A;  5F04 A;  1ZG1 A;  1XPX A;  2QKL B;  4LMY A;  2QKM B;  3CCU I;  4IQJ A;  1HST A;  3IAS 2;  3IWF A;  2VT2 A;  4RAY A;  1IV6 A;  3FMQ A;  2ICW G;  5FJ8 J;  2Y9Z A;  3TKY A;  1UMQ A;  1MBF A;  3TDU C;  4I7H A;  3JRE A;  4IHS A;  2F4I A;  3A01 B;  4XKB A;  3MKL A;  2L9S A;  1SC7 A;  4WXC A;  3TW6 A;  4IOC F;  4I99 C;  4ANJ A;  1KON A;  2KDO A;  2X51 A;  1P4W A;  3DBH B;  4YEJ A;  3S16 J;  5D8K B;  2RNG A;  1OPC A;  1ETQ A;  3FIS A;  4FTH A;  1D0X A;  3QRF F;  2CUF A;  3P9I A;  2Y0S A;  3CCM I;  1ZTR A;  1IDY A;  2A6H F;  2CUE A;  2E1N A;  3GBG A;  2BV6 A;  2OBP A;  4OOI A;  3RYR A;  3ZN0 A;  4BBR J;  2ZME C;  1XN7 A;  5DM6 F;  3F8F A;  1LUJ B;  2IA1 A;  3NAR A;  2VE9 A;  4C30 A;  2JTV A;  2B63 J;  1SD5 A;  2ELJ A;  3E5X A;  2M0C A;  4P5O A;  3U2R A;  4EM2 A;  1IW7 F;  2BW3 B;  5EZH A;  2DO7 A;  3ZP5 A;  2K9Q A;  4KDP A;  3PJR A;  1MBJ A;  2JA5 J;  3HG9 A;  2X6Y A;  1G3S A;  1Y0N A;  2QM3 A;  5J1Y A;  2WAF A;  1A31 A;  2FNA A;  4XR6 A;  5CQG A;  3TDZ C;  1ENH A;  3E5U A;  4PDK A;  5HNH A;  2IS1 A;  1MJA A;  3Q0V A;  1U9N A;  2VBY A;  4JX5 A;  4ZTF A;  1OFC X;  2XRL A;  3H5A A;  4MLO A;  1X3Z B;  3V8K A;  2DXI A;  2JVG A;  4HF1 A;  4BE2 A;  1T0F A;  4BGD A;  3G2B A;  1FBQ A;  3O8H A;  4LIU A;  5E3N A;  2VE8 A;  2L9V A;  4RAG A;  1ZR2 A;  3KE2 A;  3KZI C;  5DCM B;  5IY5 H;  1TLH B;  4L18 B;  1W36 D;  2E34 A;  1QO0 D;  2WA0 A;  1T08 B;  4G8X A;  3JRC A;  1QPI A;  1WH7 A;  4UV9 A;  2VON A;  2XAJ A;  3FDY A;  1RZ4 A;  1APL C;  4OAZ A;  2WBM A;  4WXD A;  2DYR H;  4OIO F;  3CP8 A;  2C6Y A;  2LYC A;  5E1Z B;  3SZP A;  1AA7 A;  3GTJ J;  4XN3 A;  4B4C A;  2X0L A;  2R0Q C;  1DDN A;  1X3U A;  3DPL C;  3CC4 I;  3I0T A;  1K78 B;  2EIJ H;  4E7H A;  1UB9 A;  2PMU A;  3QYF A;  2PI0 A;  1R36 A;  5FD5 A;  1WQ2 A;  3QAH A;  2DFI A;  3QOP A;  1P7J A;  1E3P A;  2HTJ A;  3IL2 A;  2QA4 I;  2KRF A;  4WX9 A;  2ZXI A;  1I1G A;  5AIQ A;  1BR2 A;  1WFX A;  3M8J A;  3RTR A;  1IG7 A;  4M6X A;  3BOQ A;  3F8C A;  5ICG A;  2MLG A;  3FK7 A;  1HKQ A;  2GZW A;  3FM5 A;  2XKP A;  3RQ4 A;  2NYX A;  5K5Q A;  3OYA A;  2QBY A;  2L7Z A;  3HOU J;  2VOO A;  2OUM A;  3A0B C;  3J80 K;  4P55 A;  1P92 A;  1X4O A;  1XGO A;  3AG1 H;  5EG0 A;  3H3U A;  4G7H F;  3PM1 A;  3TP0 A;  4XKW A;  2EQR A;  5GAE J;  1HSJ A;  5K7Z A;  1E17 A;  3J7A Y;  2VPL A;  1VI0 A;  1LQ1 A;  3ABU A;  4IQ4 A;  5LGU A;  4OIP F;  2QEX I;  3FZV A;  3T1B A;  2RVC A;  5LHG A;  4HV5 A;  2R7O A;  1FOK A;  4A3F J;  1XDS A;  3LSM A;  3VSK A;  3LA7 A;  4ZDO A;  1X1C A;  4MGR A;  3WTW C;  4JQF A;  1O3R A;  1JJ6 C;  2J5P A;  2KZG A;  2JPC A;  1YJ9 I;  1E2X A;  4L9J A;  2CU7 A;  4C3H J;  3PO2 J;  1DQU A;  4IHV A;  1MNE A;  3OV8 A;  2XUB A;  4E7S A;  2X6X A;  4M74 A;  5KHD A;  1W7P A;  1VQ9 I;  1OYW A;  3HHG A;  3J7Y J;  1MIJ A;  1JT6 A;  2MH9 A;  3HGY A;  5LRS A;  4ON0 A;  1IRG A;  2QUF A;  4KIB A;  3LSR A;  1TWC J;  2NAZ A;  3HUG A;  4B43 A;  3F8M A;  2CV0 A;  1J5Y A;  4RAF A;  2R7D A;  1NK2 P;  2A69 F;  1DUX C;  3S14 J;  1JKR C;  2PMZ A;  2JQ7 A;  4HA8 A;  3IRQ A;  4ZJZ A;  2QF7 A;  4DZJ A;  3U21 A;  2M3A A;  2M7B A;  4LJZ F;  2DJI A;  4HX8 A;  3SDG A;  4U7D A;  5J8F A;  5D5V B;  3FK6 A;  1QRY A;  1JTX A;  4J19 A;  2IS6 A;  3QP5 A;  2Z99 A;  3AKZ A;  3A0H C;  3NAU A;  2K40 A;  2V6E A;  2QZ8 A;  3PO3 J;  2H6B A;  4ESF A;  2HPM A;  3CJQ B;  3V8J A;  1S5L C;  1W0T A;  2XRO A;  4L0Z B;  1QQI A;  3KP6 A;  5DD4 A;  2R3S A;  5FD6 A;  1XGN A;  2E5N A;  4ENM A;  3S2D J;  2Y0M A;  2CQK A;  2V1X A;  1H9G A;  4EV0 A;  2A61 A;  2H94 A;  2HOA A;  3HSR A;  3FXU A;  1HOM A;  5FRN A;  1WHU A;  1U2W A;  1VTN C;  2DLL A;  2QBY B;  1BA5 A;  5F27 A;  1D5V A;  3A4C A;  1ETW A;  3H9J A;  1DU0 A;  2E2J J;  4QPO A;  2FSW A;  4X1E A;  5EG0 B;  1LNW A;  2HFH A;  5H6Q A;  4XRF A;  2XPU A;  3IWZ A;  4BHP A;  1K83 J;  2QQA A;  4A0Y A;  1SAX A;  2WY7 Q;  2HVS A;  2W57 A;  1KZH A;  1F4K A;  1LKX A;  4UNO A;  4C2U A;  1JHH A;  3EUH A;  1WJ5 A;  2R7U A;  3MCZ A;  4A3E J;  1F43 A;  4HNT A;  5J40 A;  4D1Q A;  2K7L A;  1AU7 A;  3LA2 A;  2PN6 A;  3L1P A;  2PG4 A;  1WJB A;  4XID A;  2CO5 A;  1HLV A;  1UAA A;  3M1C A;  1FIP A;  2Z9O A;  5EZG A;  3W6V A;  1WI9 A;  3RPU D;  4CUG A;  2EH3 A;  3TOA A;  2F5V A;  4PJ0 C;  3RSN A;  2L7K A;  3VB2 A;  5TJJ A;  3HOV J;  4IL6 C;  2DPD A;  1W7P B;  2F2E A;  4IF4 A;  1YG2 A;  3HRM A;  2GM4 A;  3L9F A;  3QU3 A;  2DA5 A;  4QSH A;  4MTD A;  3HUG B;  4CCM A;  4IRI A;  3KPH A;  2HOE A;  2AS5 F;  2IGM A;  2H8W A;  1WGX A;  2EZK A;  2V26 A;  2JT1 A;  1OKR A;  1DP7 P;  4EJV A;  2EBI A;  3PNY A;  2CQ7 A;  3L2V A;  1U0J A;  2R93 J;  1U8R A;  2ESH A;  4IKF A;  2K9N A;  4R8H A;  1FC3 A;  2DW4 A;  1OCC H;  3S3N A;  3V42 A;  3LSP A;  2L7M P;  3K1N A;  4BJT A;  3KCC A;  4XOP A;  4OIR F;  1MW7 A;  3K2A A;  2M1B A;  4U88 A;  2Q8K A;  5B3S H;  3OY9 A;  3BT9 A;  1ZRF A;  2RV8 A;  5HNF A;  2DOE A;  3FWE A;  5AON A;  2DU9 A;  3CMM A;  1I1S A;  1K4T A;  4HLX A;  2L4A A;  1SVL A;  3SJM A;  2VBZ A;  3ABT A;  3TGN A;  3TO7 A;  4ZTJ A;  2HEO A;  2LKP A;  1TWG J;  5D6E A;  5E3O A;  3ABL H;  4KIT B;  1BL0 A;  2L7F P;  4HSR A;  4G7O F;  4CSW A;  2KIF A;  5GTI C;  1W36 C;  1I6H J;  1YE9 A;  2LLK A;  1B72 A;  2OQR A;  2VXD A;  2NVX J;  4U0W A;  1JKQ C;  1WPK A;  3BQZ A;  2GIZ A;  3JCU C;  1IO2 A;  4EM1 A;  1Y1W J;  2JRT A;  5FB2 A;  5BS6 A;  4XIC A;  2W48 A;  4HYE A;  1ZG3 A;  2DQR A;  4ZC3 A;  3MEX A;  2VJJ A;  5GPA A;  3DKY A;  1ETY A;  1U8B A;  1VQP I;  2HOS A;  5DYM A;  3HBL A;  4BJ5 C;  2ZBK A;  3K4K A;  3TOB A;  4A3C J;  2L9R A;  2ELK A;  3CDI A;  4S04 A;  3LNQ A;  4LFU A;  3BG7 A;  4M71 A;  2HU9 A;  1E3H A;  1RES A;  1ZK8 A;  1XX5 A;  3GWZ A;  5JVG F;  3L2C A;  4II3 A;  4UHT A;  1MKM A;  1ONV A;  4BL0 B;  2ZXW H;  3CZ6 A;  4BQN A;  5GAH J;  5KAF C;  2ZFW A;  1A6Q A;  3CCY A;  3VSL A;  4LLN A;  2WV1 A;  2R4G A;  5FKL A;  4BUP A;  4BY1 J;  2LRD A;  3AG3 H;  2HYF A;  3SZT A;  1OR7 A;  3MFK A;  3ASO H;  2DBB A;  3HJE A;  1Z91 A;  2BYV E;  3GEZ A;  3KEY A;  5CLS A;  1PUF A;  3C2G A;  3C2H A;  2M2E A;  3GTO J;  2LKS A;  4OIN F;  3OYG A;  4EJO A;  4OIQ F;  4IHY A;  2XGE A;  4GRI A;  4BXF A;  3D5R C;  2H27 A;  3F72 A;  4U87 A;  4A0X A;  3S1N J;  1B9N A;  1YX3 A;  1OCP A;  3WTU C;  1WJC A;  2MAB A;  1IAW A;  2YX4 A;  1B8I A;  3FXO A;  5F08 A;  1NHA A;  5FKK A;  2LDU A;  4XN0 A;  1AHD P;  1DGW Y;  4A93 J;  5HOD A;  1Y56 A;  2NS7 A;  2OPT A;  2PMH A;  2ZCW A;  3HB9 A;  2Y69 H;  4G9Y A;  4BEH B;  2D1V A;  3L00 A;  4RA2 A;  3OSF A;  2ECB A;  4MNU A;  4D7M A;  3S1R J;  2Z2S B;  1SVM A;  1V55 H;  2FA5 A;  2QQ9 A;  3DEU A;  5L3F A;  2ME6 A;  1D0Y A;  3OYJ A;  2ISZ A;  4Q5S F;  4B8X A;  3SQN A;  1O3T A;  4N9H A;  4E70 A;  1H8A C;  1JHF A;  1Z6R A;  1B72 B;  2K86 A;  5IT3 A;  4ZYD A;  1YIO A;  3F3X A;  3RJP A;  5FLX K;  2WC2 A;  2F4O B;  2RAE A;  1WJE A;  1V54 H;  2MYS A;  3BG6 A;  3HKZ N;  4Y7N J;  3EET A;  4S0H B;  5HDK A;  2I10 A;  2M45 A;  1EA3 A;  3O2P E;  4EVI A;  1J75 A;  4D5C A;  2L3D A;  4HPQ A;  1J0R A;  3O3K A;  2VKH A;  1LFP A;  3HTU A;  5ICF A;  4AD9 A;  4AU7 A;  4B09 A;  3FKI J;  1TQI A;  2QSF X;  4UB8 C;  3V4G A;  1R1U A;  2H8R A;  1KU9 A;  1FEX A;  4J01 A;  3K4N A;  4A3J J;  1YX5 A;  1Y8R B;  3Q9S A;  2G0E A;  2VJI A;  5J47 A;  2DCE A;  1YQA A;  4KMU X;  3T0Y A;  1V5G A;  3SFI A;  4L5E A; 
#chains in the Genus database with same CATH homology
 5F04 A;  1PUF B;  4M6V A;  4XK4 A;  3A02 A;  2JMW A;  1R9T J;  2DA6 A;  1IV6 A;  1Z77 A;  3CDL A;  2DA1 A;  2ID6 A;  5FJ8 J;  2Y9Z A;  4FIS A;  5IOZ A;  1UMQ A;  1MBF A;  1P7I A;  4M3G A;  3BTC A;  4Y52 J;  4BKX A;  3JRE A;  3A01 B;  2N8G A;  3MKL A;  3E7L A;  3TW6 A;  1ZQ3 P;  4M3B A;  1IDZ A;  1ZGW A;  2TRT A;  3S16 J;  1JUM A;  3RQI A;  2R5Z A;  1ETQ A;  3FIS A;  2JJ7 A;  4FTH A;  2CUF A;  3OIO A;  1ZTR A;  1IDY A;  2CUE A;  2GLO A;  3GBG A;  2IBD A;  4BBR J;  3S1Q J;  5IOY A;  2MSY A;  3HEF A;  2LY9 A;  3JRI A;  2E19 A;  3ZQL A;  3NAR A;  3IH3 A;  1A5J A;  1NTC A;  2DMT A;  2B63 J;  2M0C A;  3Q3S A;  5EZH A;  2K9Q A;  2LTP A;  1MBJ A;  2JA5 J;  1MNM C;  3B6A A;  2R5Y A;  5J1Y A;  4XRS G;  1ETK A;  2DA2 A;  1ENH A;  1YRN B;  3H0G J;  1MSF C;  3Q0V A;  1U9N A;  1D5Y A;  4JX5 A;  1OFC X;  2XRL A;  4MLO A;  1ORK A;  1E3O C;  5FKM A;  3K7A J;  3RZD J;  3TED A;  3Q0U A;  1FIA A;  3O8H A;  5E3N A;  2JK3 A;  1ZR2 A;  2DA4 A;  1F36 A;  2X9D A;  1OCT C;  4DYR A;  1WI3 A;  4DW6 A;  1T33 A;  1VF9 A;  3A03 A;  5FLM J;  5J1R A;  2VPR A;  1TWA J;  2L0K A;  3QQA A;  3JRC A;  1QPI A;  1WH7 A;  4D7N A;  1MBH A;  1APL C;  3S15 J;  1HDP A;  5M5X J;  5E3M A;  1S7E A;  3TW7 A;  4DZP A;  4A3M J;  3G1L A;  1IUF A;  3GTJ J;  4BXX J;  5IYB J;  4B4C A;  2R0Q C;  5EEA A;  1MBK A;  1XC5 A;  5M3F J;  1H89 C;  1I3Q J;  5EDN A;  4IHW A;  2HDD A;  1FTZ A;  3BR1 A;  2JN6 A;  2H1K A;  4M3E A;  1P7J A;  3GTL J;  2NS8 A;  2VUM J;  3GTM J;  1IG7 A;  1MBE A;  1RET A;  2E2H J;  4AC0 A;  3FK7 A;  2OF7 A;  3LSJ A;  2LP0 A;  1O4X A;  1HDD C;  1UG2 A;  4XRS A;  3F0C A;  2KDZ A;  2R5Z B;  4D5F A;  1IC8 A;  4C3I J;  2L7Z A;  2GBY A;  3JRD A;  1BW5 A;  3HOU J;  3BR2 A;  4GFB A;  4UUT A;  3JRH A;  2D5V A;  5EF6 A;  2JWT A;  5EG0 A;  1JGG A;  3PM1 A;  1WH5 A;  4MFE A;  5GP9 A;  3TP0 A;  2EQR A;  2HQ5 A;  5K7Z A;  2TCT A;  2E2I J;  3I4M J;  1VI0 A;  1GVD A;  3MN2 A;  3G1O A;  2HOT A;  1Z0X A;  1MH3 A;  3GTQ J;  3ZQI A;  4RDU A;  4AYB N;  2R5Y B;  4HNV A;  3BTJ A;  4A3F J;  5JLW A;  4A3D J;  1TC3 C;  1GV5 A;  4FCY A;  4IEJ A;  3S2H J;  1JJ6 C;  1BJZ A;  3BG9 A;  4C2M J;  3QPL A;  4B1R A;  2CU7 A;  2CQQ A;  4NDL A;  1OJL A;  4C3H J;  3HM5 A;  3PO2 J;  1W0U A;  4IHV A;  9ANT A;  2DJN A;  3OSG A;  1RR7 A;  3BG3 A;  5EGO A;  2FJ1 A;  4FE4 A;  4I76 A;  2M34 A;  4DYC A;  1B8I B;  1AKH A;  3IH2 A;  1K61 A;  4MFD A;  1JT6 A;  1JKO C;  3HGY A;  2LFB A;  5BNG A;  3G1M A;  5F0F A;  3LSR A;  1TWC J;  4A3G J;  2X48 A;  1VFC A;  3BR3 A;  1ETV A;  1LFU P;  1NK2 P;  2DMQ A;  1IJW C;  1JKR C;  1GUU A;  3S14 J;  4BY7 J;  4MIM A;  1ETO A;  2QF7 A;  4DZJ A;  1MBG A;  3BTL A;  5M5W J;  1JJ8 C;  1ITY A;  1EF4 A;  2ME0 A;  2DN0 A;  3DEW A;  3SDG A;  1DU6 A;  3C2B A;  1A6I A;  3FK6 A;  1QRY A;  2XSD C;  1JTX A;  4J19 A;  2WAQ N;  3NAU A;  3HOX J;  1POG A;  4C3J J;  2XGC A;  2K40 A;  2LVS A;  3PO3 J;  4M3D A;  3ZOB A;  5DS9 A;  2FX0 A;  1W0T A;  2LKX A;  5E3L A;  4A3K J;  5C4J J;  2ZB9 A;  3BQY A;  2Y9Y A;  1HCR A;  3UKG A;  3S2D J;  4I6Z A;  3HGG A;  2HOA A;  1LFB A;  3S17 J;  1HOM A;  3GTG J;  2COB A;  2IAI A;  2ID3 A;  3LSG A;  2R7Z J;  2AO9 A;  3I4N J;  5F27 A;  1BA5 A;  2NVQ J;  1ETW A;  2JA7 J;  1JTY A;  1DU0 A;  2E2J J;  3GTP J;  3LOC A;  4X1E A;  5EG0 B;  1GDT A;  3RZO J;  2AHQ A;  4X6A J;  4A3I J;  2Y30 A;  2XPU A;  2MGQ A;  1K83 J;  3JR9 A;  4B3A A;  2LD5 A;  3ZQC A;  2VI6 A;  4A3E J;  2O9L A;  1F43 A;  2WB1 N;  3BG5 A;  2FQ4 A;  1IGN A;  1AU7 A;  3JRG A;  1RKW A;  1GT0 C;  2LR8 A;  3L1P A;  4XID A;  2VKE A;  2XB5 A;  4W97 A;  1HLV A;  1FIP A;  1X2N A;  4JX6 A;  4V2F A;  5EZG A;  3Q0W A;  3W6V A;  1XS9 A;  3BR0 A;  2EH3 A;  5EGO B;  2YUS A;  1U9O A;  3O8G A;  2HXO A;  2VKV A;  3HOV J;  4CYC A;  1JKP C;  1SAN A;  5M3M J;  1AKH B;  4FE7 A;  5F0H A;  2GM4 A;  3D1N I;  3H3V K;  2DA5 A;  4JP0 A;  4QSH A;  2YS9 A;  3WHB A;  2FD5 A;  1SFO J;  2JA6 J;  3GTK J;  4A3L J;  4AUX A;  1FJL A;  3HOY J;  4ABZ A;  5C44 J;  1WGX A;  2EZK A;  3QPS A;  2EBI A;  1I50 J;  3ZQF A;  3ZQG A;  1JT0 A;  2R93 J;  2M9H A;  2K9N A;  3LSP A;  2L7M P;  2Y0S N;  1TWH J;  2LK2 A;  3K2A A;  2YU9 J;  3BT9 A;  2CRG A;  1RKT A;  1G2H A;  1VND A;  5FLV A;  3TP3 A;  2HXI A;  3SJM A;  1ZKG A;  4W1U A;  2K9S A;  3M4O J;  5EYR A;  5GPC A;  3BR6 A;  2IEK A;  1TWG J;  5E3O A;  1UHS A;  1LE8 A;  1BL0 A;  2L7F P;  4DYQ A;  1I6H J;  2LLK A;  1B72 A;  2NOG A;  3IV5 A;  1QVT A;  2NVX J;  2O8K A;  1JKQ C;  1WPK A;  5F1J A;  3BQZ A;  1Y1W J;  5IYD J;  3ZQH A;  4XIC A;  2W48 A;  2XGD A;  1H88 C;  5GPA A;  1X2M A;  1ETY A;  2KT0 A;  2DMP A;  1U8B A;  2HOS A;  2HI3 A;  2NVT J;  2M8G X;  4MO7 A;  3HBL A;  5K7H A;  4A3C J;  2L9R A;  2ELK A;  3LNQ A;  2DMU A;  4JYK A;  4G12 A;  1RES A;  1ZK8 A;  1CQT A;  3CQZ J;  1JUS A;  3CCY A;  5IYC J;  4UUS A;  3CMY A;  5C4X J;  3JRB A;  2WV1 A;  5FKL A;  1JUP A;  2MG4 A;  4BY1 J;  4BBS J;  2P81 A;  3FIW A;  4CYC B;  1NK3 P;  4RBO A;  3MVP A;  2JA8 J;  2EZH A;  5DTD A;  2HYJ A;  3HOZ J;  1PUF A;  2M2E A;  1U78 A;  3GTO J;  3IH4 A;  2CQX A;  1FTT A;  4V2G A;  1X58 A;  4A3B J;  4A69 C;  2ECC A;  5J1U A;  5JLX A;  4IHY A;  2XGE A;  4M3F A;  3A01 A;  3HDD A;  3S1N J;  1OCP A;  2MW8 A;  2E1O A;  4EEF G;  3BR5 A;  1B8I A;  2R92 J;  5F08 A;  3DCF A;  5FKK A;  3OOU A;  1ZR4 A;  1AHD P;  2NVY J;  4A93 J;  2XB0 X;  1TWF J;  5HOD A;  2OPT A;  2NS7 A;  2XPV A;  3M3Y J;  2X6O A;  3HB9 A;  1MH4 A;  4QTR A;  2DMN A;  3OSF A;  2ECB A;  4D7M A;  3S1R J;  4IHX A;  1Q1V A;  5FKN A;  4QIW N;  2ME6 A;  1LE8 B;  3VPR A;  3JRA A;  2XPW A;  3BTI A;  1YRN A;  1H8A C;  1RPW A;  2EZL A;  1HF0 A;  1B72 B;  3JRF A;  2CJJ A;  1BW6 A;  1ETX A;  1MSE C;  5FKO A;  2RAE A;  3HOW J;  5IPA A;  5IP7 J;  3HKZ N;  4Y7N J;  1Y1V J;  2DA7 A;  4S0H B;  3B6C A;  2I10 A;  2Y2Z A;  4JX4 A;  3S1M J;  4D5C A;  3WHC A;  5J3L A;  4LOC A;  2DA3 A;  3FKI J;  2O7O A;  5IP6 A;  4XRM A;  1GV2 A;  1QVU A;  3RKQ A;  2H8R A;  1IRZ A;  2PMZ N;  1FEX A;  1T56 A;  2EZI A;  4A3J J;  5IP9 J;  5M5Y J;  2QCO A;  2Y31 A;  4UUS B;  2G0E A;  5C3E J;  5F0C A;  2DTZ A;  5K7F A;  1XG1 A;  1WCM J;  3SFI A;  4L5E A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...