4A3BJ

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3bJ00
2XB5A 3BR5A 3E7LA 1TWHJ 5EG0A 1NK3P 4A3LJ 1OCPA 2NVXJ 3S15J 4CYCA 1IDYA 5FLMJ 1TWFJ 4FISA 4JX4A 2DA7A 1VFCA 3S1MJ 1VF9A 2DMNA 3HGGA 2JJ7A 2LR8A 4D5FA 5J3LA 2JN6A 2IAIA 5E3LA 3W6VA 2DJNA 4HNVA 1JT6A 1MSFC 4IHWA 4IHYA 1BW6A 1WH5A 4DW6A 5M5YJ 1YRNA 3PO2J 2E2IJ 3M4OJ 3S14J 3GTGJ 1U9NA 5EGOB 1TWGJ 2EZIA 1MH3A 2XSDC 3S1QJ 4DZJA 4M3GA 3Q0UA 5EDNA 4UUSB 1RPWA 5C44J 1B72A 3VPRA 3L1PA 4I6ZA 3GTOJ 1MBKA 1E3OC 2QCOA 3LSPA 1LFBA 1ZR2A 3JRHA 2M9HA 3JRAA 2M0CA 4I76A 3RZOJ 3CMYA 1IRZA 1EF4A 5FJ8J 2DMTA 2TRTA 2B63J 1HOMA 2DMPA 1GVDA 5FKKA 2DTZA 2R0QC 4MFDA 1U9OA 2MSYA 1GDTA 2R5YB 2DN0A 5JLXA 4JP0A 3Q0WA 1IG7A 3GTMJ 4AYBN 1P7IA 3IH4A 4L5EA 1U78A 3BR0A 1HLVA 4A3BJ 3M3YJ 1UMQA 3MVPA 1QPIA 2EQRA 3OOUA 2K40A 2NS8A 1ETQA 3Q3SA 3HEFA 1WI3A 2NS7A 3TW7A 3LSRA 5J1RA 3OIOA 4LOCA 1ETXA 2YUSA 5DTDA 5IP7J 4M3BA 2XB0X 1LE8A 4D5CA 3JRIA 3S2HJ 1JKRC 4IHXA 3A03A 2AHQA 1SFOJ 1MBFA 2O9LA 1T33A 2Y9YA 3FK7A 2JWTA 2PMZN 2DA3A 5IYCJ 3HKZN 3HM5A 1X2MA 2ECBA 3Q0VA 2E2JJ 3DEWA 1ETYA 2EZLA 5IYBJ 3LNQA 1BA5A 1ETKA 1HDPA 3GTPJ 2WB1N 3ZQFA 1JUPA 2Y9ZA 3BQYA 3ZQIA 4S0HB 2IEKA 2LP0A 1MBHA 5E3OA 5DS9A 3CDLA 4J19A 4DZPA 1VI0A 2O7OA 2AO9A 3O8GA 4M6VA 4DYQA 1IUFA 5M5XJ 4QSHA 2QF7A 3JRDA 2EZHA 1CQTA 5JLWA 5GPCA 5M3FJ 2JA8J 3GTJJ 3OSGA 5F27A 2M34A 1JUSA 1S7EA 3BTIA 2ZB9A 2DA2A 5EYRA 2YU9J 3BQZA 4B1RA 4FE7A 4A3CJ 4MO7A 3GTQJ 2EBIA 4UUTA 3K2AA 5J1YA 2L7MP 1QVUA 1ETVA 3G1MA 2OPTA 4EEFG 3OSFA 2JK3A 3NARA 1ZTRA 2CUFA 1VNDA 1X2NA 3B6CA 5F1JA 1JKQC 3TEDA 1G2HA 3BR1A 3IH2A 2M8GX 3H3VK 1GV5A 2JA5J 2N8GA 4FTHA 1A6IA 3K7AJ 2HOTA 2JA7J 2HQ5A 2LKXA 4W1UA 1IDZA 1BL0A 1AKHA 3LOCA 3HOZJ 2NVYJ 4A3EJ 2IBDA 2YS9A 3FISA 3A01B 1B8IB 2HOSA 1UG2A 3G1LA 3WHCA 5C4JJ 4RBOA 4M3DA 1ZGWA 1GT0C 1ETOA 2LY9A 1DU0A 2HDDA 3SDGA 2X6OA 1BW5A 2CUEA 1A5JA 5IP6A 2XPUA 3NAUA 5IOZA 1OJLA 5F0CA 1PUFB 5BNGA 2K9SA 1XS9A 3IH3A 1RESA 2GBYA 4QTRA 3ZQHA 5FKOA 2ID3A 1JKOC 2LFBA 5IPAA 1POGA 3TP3A 2R5ZA 5FLVA 1K61A 5F0HA 2VKVA 3WHBA 1SANA 3I4NJ 1I6HJ 2WV1A 3HB9A 4C2MJ 5M3MJ 3HDDA 2M2EA 4JYKA 4V2GA 5EEAA 3TW6A 5EG0B 3JRBA 1W0TA 3LSJA 3BTCA 2DA6A 3FKIJ 1H89C 2WAQN 4Y7NJ 4FCYA 5J1UA 2CQQA 4CYCB 1WCMJ 2E2HJ 1HF0A 3JRGA 4G12A 1ZQ3P 3S16J 4XICA 2JMWA 2H1KA 4JX6A 1ITYA 2MW8A 4A3GJ 2LTPA 3JRCA 4JX5A 2LVSA 1OFCX 3S1NJ 2L9RA 2HXIA 2XGEA 1NK2P 2GLOA 2XGCA 1APLC 3S17J 2L0KA 5FKNA 1YRNB 2COBA 2DA1A 2NVTJ 4RDUA 3JREA 2VKEA 3RKQA 4ABZA 1MBGA 3ZQGA 1ZR4A 2LD5A 1JGGA 2MG4A 5EGOA 2E1OA 1RETA 2ECCA 2ME0A 2G0EA 2X48A 1MBEA 1B72B 3HOWJ 3G1OA 4A3DJ 2FQ4A 4A3MJ 1F43A 4UUSA 2Y2ZA 5GP9A 2NVQJ 2ELKA 3BG3A 4BKXA 3MN2A 5C3EJ 4D7NA 1RR7A 1O4XA 3GTLJ 3TP0A 3HBLA 2HOAA 4BXXJ 3CCYA 4XRSA 1Y1VJ 5F0FA 5GPAA 3SJMA 3D1NI 4GFBA 1Z0XA 1JT0A 3GTKJ 4QIWN 1H8AC 5K7ZA 1MH4A 3BR3A 3B6AA 4A3JJ 4MFEA 1JTXA 5K7HA 5FKMA 4IEJA 4A93J 2R5YA 3HOXJ 4A3KJ 3FK6A 2XRLA 4W97A 4A69C 1IGNA 3JR9A 1GV2A 5EZGA 1T56A 1XG1A 2CRGA 1JKPC 4XK4A 1WH7A 4BY1J 2DMUA 2NOGA 3BR6A 4BBRJ 1U8BA 2K9QA 3DCFA 2O8KA 3HGYA 3C2BA 2E19A 2ME6A 2XPVA 1TC3C 3HOVJ 4BBSJ 4IHVA 1FIPA 2CU7A 1D5YA 4Y52J 3RZDJ 1TWAJ 3CQZJ 1LE8B 2DMQA 2L7ZA 2VUMJ 4MIMA 2W48A 2D5VA 4B3AA 2X9DA 1R9TJ 3S2DJ 4BY7J 2FX0A 4MLOA 1X58A 1FTZA 2Y0SN 4V2FA 1IV6A 4X1EA 5EF6A 4DYCA 1F36A 3QPLA 1NTCA 2Y30A 4C3HJ 5E3MA 4FE4A 5IYDJ 4AC0A 1ETWA 1BJZA 1TWCJ 2I10A 4NDLA 3ZQLA 1AU7A 3QQAA 3LSGA 2GM4A 3BT9A 3BG9A 1DU6A 1I50J 1HDDC 2LLKA 1OCTC 1K83J 2KDZA 1HCRA 4XRMA 1FIAA 1RKTA 4DYRA 3BTLA 3HOUJ 3MKLA 1WGXA 1JTYA 5M5WJ 4M3EA 5EZHA 2H8RA 5IP9J 1MSEC 2JA6J 1P7JA 2K9NA 2OF7A 4A3FJ 1MBJA 1ORKA 1FJLA 1W0UA 2FD5A 4B4CA 2R92J 2ID6A 2DA5A 2HI3A 5E3NA 3JRFA 1UHSA 1Z77A 1MNMC 1AHDP 2FJ1A 1I3QJ 2DA4A 2XPWA 3RQIA 5HODA 2XGDA 1H88C 4M3FA 3BTJA 3F0CA 3O8HA 5F08A 3BG5A 4XIDA 5K7FA 2LK2A 3GBGA 2EH3A 2R7ZJ 1IC8A 1AKHB 3QPSA 1GUUA 3UKGA 3ZOBA 1QVTA 4A3IJ 2Y31A 3I4MJ 4C3IJ 3A01A 3ZQCA 1B8IA 3S1RJ 1IJWC 1RKWA 3BR2A 2CQXA 1Y1WJ 1ZK8A 1ZKGA 3FIWA 3IV5A 3SFIA 9ANTA 1LFUP 2VPRA 3PO3J 1QRYA 3H0GJ 2MGQA 3HOYJ 1WPKA 2CJJA 4D7MA 4C3JJ 1FEXA 1XC5A 3PM1A 2HXOA 4XRSG 5F04A 1PUFA 5IOYA 3A02A 2R93J 5FKLA 2P81A 4X6AJ 2KT0A 2TCTA 2VI6A 2EZKA 1FTTA 2R5ZB 1JJ6C 1JJ8C 4AUXA 1Q1VA 2L7FP 1ENHA 5C4XJ 2HYJA 1JUMA 2RAEA
chains in the Genus database with same CATH superfamily
5LFAA 1M1EB 3E6MA 2ICWG 2PBIA 1W36C 1VQKI 2EV6A 1TWHJ 1ZREA 4B43A 1OCPA 2V1UA 2OCEA 3M07A 1EA3A 3IAS2 2CW0F 4HSTA 5B1AH 4CYCA 1F4KA 1IDYA 4P96A 1F9NA 4FISA 1E3PA 3FXQA 3S3OA 1IAWA 3JSOA 1T0FA 3S1MJ 4UUVA 2DMNA 3ZMZA 1U6GA 5CVRA 4QPQA 4RB3C 2X6WA 1BOAA 4BJTA 5E3LA 4HNVA 2WV0A 1JT6A 4IHWA 3OYIA 1T6SA 1MW7A 2BXYA 5CQEA 1TTYA 3PFYA 1TWGJ 2EZIA 1MH3A 2XSDC 2W7NA 4IHSA 2R7VA 3CF2A 1BIAA 2VQGA 3Q0UA 3VODA 3BJOA 2OCCH 2MLKA 2J5PA 4I6ZA 1E3OC 2K86A 3R61A 3A1YA 3LSPA 1TQIA 1I3AA 5DD8A 3WU1B 1FLIA 4AIDA 2RDPA 3NQOA 2PLYA 3CDIA 2P5VA 3CMYA 3WGGA 1HOMA 3IKTA 4BEHA 2DTZA 2QM3A 2UXNA 2EWNA 2KJCA 2ZKZA 2E60A 4EJWA 2DN0A 3KETA 1MDMA 3IH4A 3BJ6A 3VFZA 3DF8A 1U78A 1HLVA 3I9V2 1ZHFA 5EEHA 3OOUA 2ZFWA 5TISC 5D5VB 2KRFA 3IKVA 4WK8F 3TW7A 3LSRA 3ML6A 1OLTA 1RC9A 4LOCA 1X1CA 1B6AA 4YFXF 3UNGC 5IP7J 3CJTB 1T98A 3S3MA 1HKQA 1XB4A 4HDUA 1X4OA 2FA5A 5D8KB 3CDHA 1D3YA 3BDDA 4KUMA 2XB0X 4M3BA 4BXFA 1I27A 4PSXA 2LOOA 5H20A 1JKRC 3BWGA 2IGOA 2I5UA 1YFHA 3UR3C 2K9MA 1FWZA 3LSKA 2O9LA 3N97A 2PMZN 2CGPA 1G4DA 1CGPA 2VXDA 3ROUA 4CCLA 3HM5A 3ZN0A 1X2MA 1YOVB 2E2JJ 3LNQA 1HDPA 2VL8A 4XSXF 3MWMA 2Z33A 4XM3A 3OYAA 1VQ4I 2ZMEB 5B1BH 2IGNA 4UB8C 5IY5H 4BXUA 2VXZA 4S0HB 3AFHA 2IEKA 4CA0A 3AG4H 2LNBA 2KISA 4DZPA 3CLQA 2A68F 2BBYA 2IS4A 2O7OA 2AO9A 2F5DA 4DYQA 1IUFA 2ZXIA 3ASNH 2QF7A 3JRDA 2K5CA 2XDVA 2EZHA 2JA8J 5GPCA 3WTWC 4U7DA 5F27A 3CD6I 1MJBA 1TP4A 4F52A 2FF4A 1G3SA 1JUSA 2B7EA 2KDOA 3LFUA 1BI2A 2YU9J 4B1RA 1SD5A 3RYPA 2CQNA 2BZTA 3RPQA 5HVQC 4U0YA 4UXNA 4XLNF 4LD5A 5J1YA 2ZJRF 4OMZA 1O57A 3A0BC 4HX4A 3ERED 2HDWA 4HEA2 3W2VA 2DDBA 2IXSA 3DTKA 3HZJA 1I1SA 1TZLA 4KIBA 2F5FA 2HKXA 3OSFA 2OC6A 3RPUA 1YIOA 4I09A 4JBAA 1ZTRA 3GUDA 2E1MC 5HS8A 1B9MA 4EGZA 2F4OB 1VNDA 1X2NA 3R6SA 1N25A 2JRTA 5FROA 3TEDA 4B44A 3IH2A 4L0YB 1STZA 2M8GX 3F8FA 2L9SA 1SVMA 1XGSA 3KX2A 4FTHA 3K7AJ 4UNOA 2HQ5A 4ANJA 4W1UA 5ICGA 1MZBA 1IDZA 1Z7UA 4CO8A 3LOCA 5H6QA 3TKYA 4DBRA 4BQAA 5H2FC 3DFGA 3FISA 3L2VA 5FD6A 1B8IB 1UG2A 3I5UA 4R1HA 2X51A 3FXUA 1PP8F 5CJ9A 4Q47A 1ZGWA 4KNYA 1GT0C 2ADUA 3LSHA 2HDDA 3SDGA 3H0DA 4AIHA 1BW5A 2XAJA 3T8TA 1W7PB 4IVNA 2XPUA 2K3PA 4GXOA 2OD5A 5ICCA 4LIUA 1ZG1A 2E7WA 2V79A 3PSFA 3I59A 1SFEA 3IH3A 1RESA 4UV9A 2L54A 4PUSA 4QTRA 2LKSA 3OIPA 3T5XA 4ZDPA 4IQ4A 2VONA 3OMYA 1KZHA 3JW4A 3OS1A 4PZJA 4IO9F 1VQ7I 2G9WA 3WHBA 2KPMA 2IW5A 2TDXA 1MMAA 1MKMA 3HB9A 5BPIA 4IRGA 3VEPA 5GTIC 2UUZA 5M3MJ 4F7ZA 1UZCA 3K4KA 4IRHA 4BYYA 3CCMI 1SFUA 4V2GA 4JYKA 5EEAA 1GXQA 3C2GA 2F5VA 4CCJA 3LSJA 3BTCA 1XX5A 2RREA 2V1DA 4RLQA 1H89C 4RB0A 3ZPLA 4RB2C 2L4AA 1R58A 2IJLA 1WCMJ 4CYCB 2YU3A 1L0OC 3ZMSA 3JRGA 1HF0A 1N75A 2E2HJ 2R7OA 4Z6YA 1D5VA 3S16J 2EFQA 3DPTA 4A3GJ 1HKTA 2XAQA 5E79C 1MD0A 1WVRA 2LF8A 2OBPA 4RAFA 4MTEA 3G6EI 2VKDA 1APLC 2YX4A 4CZZA 3WTVC 3M8FA 4O3MA 2VKEA 2GA1A 3PUBA 2DYSH 2CG4A 4OIQF 1JGGA 3R60A 5EGOA 2E1OA 2Y69H 1KU7A 3TDZC 5HLHA 4GCVA 4A3MJ 4UUSA 5GP9A 2VBXA 1LVAA 4P9UA 5C3EJ 4XN0A 2IT0A 1X1DA 2D45A 4D7NA 2BHYA 1K4SA 1U0JA 2WBMA 2HQNA 3OYMA 3TP0A 3GTLJ 3GXOA 2GXAA 3V8JA 1Y1VJ 3ERMA 1AWCA 2VJIA 3I55I 4BEHB 3D1NI 1Z0XA 4JK1X 1JT0A 5E1ZB 4Q5SF 4M74A 4EV0A 3CCEI 1MDMB 4A93J 4DJAA 4LB5A 3ZR8X 2RGVA 3CO6C 4ZH4F 2XRLA 1N78A 1X3UA 3GWZA 2P6TA 2WAQA 1IGNA 1WWXA 1GV2A 2ZSIB 4L0ZB 1WH7A 4CCMA 3SQNA 4BY1J 5JI6A 4I0BA 3O2PE 4DIQA 3P7NA 5J6XA 1ZRDA 3C2BA 2P8TA 2E7XA 1SEUA 1TC3C 4IHVA 2AQEA 3CQZJ 1HW1A 2D5VA 2ESNA 3SFZA 3Q9VA 1WRJA 2VC0A 2ZJPF 1LEBA 2QZ8A 4J00A 4M9SA 4EJOA 2EILH 3CESA 1MNDA 1VQNI 1OQYA 1B9NA 4KA4A 4XNFA 4X1EA 4RGUA 1F36A 2EFOA 1BI0A 3HHGA 3QPLA 2Y30A 1LDDA 4B09A 5E3MA 3FHNA 3PNTA 1BJZA 2EV5A 2I10A 4NDLA 5DDGA 4PJJA 1QQIA 4EMSA 4BJ6C 5HDNA 1RZ4A 4ON0A 2IRFG 4GGGA 5D5WB 3K70D 1XDUA 1P4AA 2EJRA 1K83J 2LLKA 3LWFA 4Y17A 3TQNA 4XRMA 1HCRA 1S9HA 3HOUJ 1GXPA 2KIMA 1JTYA 2HZDA 4IHTA 2H8RA 2M3AA 5IP9J 3BC8A 3V7CA 2LG4A 1V5EA 2JA6J 1P7JA 1XCVA 5TGTA 3IC7A 1F5TA 3QU3A 2GIVA 4I2OA 2V4JC 4LK1F 2BY0A 3L2QA 4OAZA 4LLGF 3WTZA 4B4CA 1TW2A 4KIFA 2GOXB 5BOXA 2ID6A 2XHKA 5D4SA 4JQFA 2QQBA 1UHSA 2J5OA 1Z3XA 5J8CA 5K5OA 1H9TA 1AHDP 4V19K 2DA4A 2QUFA 2JUGA 2NRAC 4UVAA 2MLGA 3CCVI 3S93A 3ZRGA 2DBBA 1IZ1A 1YJNI 4S05A 2XF5A 2JSPA 2PFBA 4PCQA 3CCJI 2F48A 2HFHA 2W84A 4B48A 3UKGA 3O6BB 1Z9CA 1Y39A 1QVTA 3HJEA 1ZYRF 1ZRCA 4E7KA 5L3CA 2UWMA 1LUJB 1G8XA 4HOBA 2VASA 2FBHA 3QYEA 3ZQCA 4AIJA 2V1XA 3CCSI 1KONA 1RKWA 1RRJA 2CQXA 4BE2A 1MJ9A 5CKTA 3IV5A 4HDVA 2JVHA 2VJJA 2AQFA 3PO3J 2M4GA 3HPGA 3G2BA 3ZQ7A 2Z9OA 2LREA 2KP6A 4L9JA 2DYRH 3K2ZA 4CCNA 4M9ZA 3I56I 2XSJC 5F64A 3QAHA 1DP3A 2WADA 1PUFA 3DPLC 3A02A 3OYLA 3FM5A 3JTGA 2AXLA 4X6AJ 2MBFA 2TCTA 2VI6A 2EZKA 3K9TA 1FOKA 1O7FA 3VSLA 1A04A 2IP2A 2QBYA 3CJQB 5K5QA 3ULQB 1ENHA 1J0RA 1E17A 3CUOA 5FGMA 1LDJA 1JXSA 3E6CC 2XB5A 2G7HA 4ZYHA 3GZNB 5EG0A 2BY1A 2FRHA 2K02A 2GZWA 3VSKA 3L2RA 3I64A 2ZNZA 3WU2C 2NVXJ 2RQPA 4IJAA 3S15J 1OPCA 2QQ9A 5GAHJ 1T39A 1TWFJ 4JX4A 1V5GA 2V26A 5E1WA 5JHFA 1YITI 2ZXJA 3QYBA 1ONVA 5HS7A 3OY9A 1XDSA 1L3LA 2LR8A 2VC1A 3AL0C 1NG6A 1IV8A 2JN6A 1IO2A 1ZG3A 2EB7A 4MEYF 3W6VA 2DJNA 1R5GA 4KIGA 2JPBA 5B5EC 1MSFC 4DW6A 1WH5A 2JQ7A 2O5RA 3BPVA 1X1BA 5M5YJ 4L5IA 1BN5A 2KJBA 1XMKA 2A6TA 3C3WA 2P5LC 3HRSA 5EGOB 3MKWB 3F8MA 4G7ZF 3J81Z 2CFXA 4DZJA 4M3GA 4PDKA 3MKZA 5EDNA 2LRDA 4UUSB 1RPWA 3GFJA 5LHHA 1Q1HA 3FMSA 1FNNA 3L1PA 1X4PA 5DCFA 5ERIA 1MMGA 1LFBA 4U87A 1YS6A 2G7UA 2W24A 4ZDLA 3VYUB 3JRHA 2ZO4A 1XTAA 3JCUC 3JRAA 2VQHA 3ZMTA 2L9NA 1N77A 3DLAA 3FXRA 1IRZA 2H1LA 2P4WA 4LMYA 4EVIA 3TO9A 3G73A 2TRTA 3E97A 3OYGA 2L9VA 1GVDA 4MFDA 4XKCA 1X3ZB 5TJJA 5IT9K 3CZ6A 4CYDA 3E5UA 1GDTA 3FM3A 3F21A 1A35A 3Q0WA 4MQVA 4FETA 4XL9A 3CUQC 4L5EA 4A3BJ 2WAEA 3PIOF 2VT2A 1GVJA 3M3YJ 3MVPA 4OAYA 5B3SH 3CP8A 3ELKA 3OWTA 1ETQA 5DYMA 5LD2C 2NS7A 3RKWA 1SC7A 3KEOA 2PI0A 2VOPA 1ETXA 3OIQA 2P7CB 1ZAOA 1PJRA 1W7PD 5BQTA 2QQAA 1D0ZA 2K85A 4FQGA 1S5LC 5KK1A 1D8KA 4K2EA 4BGDA 1WI9A 4MQ9F 1BBYA 4XONA 4H0EA 4IHXA 2KKOA 1JE8A 5DV5A 3DKYA 2Y0MA 4HBLA 2H94A 1O3TA 2DA3A 2HEOA 4J01A 3HKZN 5DM7F 2B9SA 3TDUC 3DEWA 1TNTA 1ETYA 1ETKA 3F6OA 1UHMA 4LG0A 3RI4A 2WB1N 1HW2A 3ZQFA 2CH0A 3IAM2 4M6XA 1JUPA 4BHCA 3FMRA 5HS9A 1R49A 1R4MB 1JHHA 5E3OA 1Z05A 2W1OA 1UCRA 4CDGA 5JLWA 1K7AA 2BV6A 4O5VA 2HU9A 1LB2A 4HNUA 4CCKA 1MMDA 1V55H 2ZB9A 5EYRA 3BQZA 5CVVA 1SFXA 1IF1A 4MO7A 4KN7X 4C2UA 3K2AA 3IWZA 5D5UB 3IHUA 1QVUA 1BM9A 3QPHA 1ETVA 5E18F 2K7LA 1YG2A 2CV2A 1A6QA 3L2UA 4HA8A 3GO5A 3NARA 3OYEA 4ESJA 3MCZA 2H09A 3CTAA 2KIQA 2X1EA 3B6CA 4IRIA 2OU2A 2PEXA 3K1PA 3T8RA 3MMYB 2OJED 3AKZA 4A12A 4MTDA 2R7WA 2PMZA 2JA5J 4R8HA 4GRIA 3F72A 2H6BA 2F4MB 2CFOA 2HOTA 2MABA 1JGSA 2PX9A 3GF2A 2VB6A 4ZZLA 2MD5A 2NVYJ 2PJRA 1P4WA 4N4NB 1TW3A 2YS9A 1J7KA 3CCUI 2OUMA 2E5ZA 1K79A 3WHCA 4HNTA 3QOEA 4M3DA 4BQNA 2WY7Q 3D5LA 4ESFA 5JVTA 3KEYA 1J75A 2V9PA 4HAMA 2JVGA 4ITVA 4A5MA 4DBQA 3H1CA 1DDNA 4C2TA 2KHMA 1UELB 5IP6A 1DPUA 2BVMA 2QLZA 3KZIC 3VDXA 2L7KA 3DKXA 1PUFB 2HWVA 2BW3A 4HQMA 1IUYA 3C18A 3U21A 5FKOA 5FFXA 3FWEA 1R22A 2QBYB 3GX4X 2QWWA 5HNHA 1XD7A 5FLVA 2W4SA 1K61A 2VKVA 3HG9A 4AWXB 1VQOI 1IN8A 3C1DA 3EUHA 1VQMI 4AU7A 5FLXK 2M7AA 4YG2F 5EG0B 1WQ2A 1W0TA 2L2OA 4BHPA 3ABUA 3FKIJ 4CHUA 3EUHC 3LSTA 4YRVA 5J1UA 5L3BA 2GQQA 2CQQA 4AIKA 3V7RA 2CYYA 5HNFA 3BROA 2BEOA 4XICA 1P92A 4NC6A 3AAFA 2EINH 4PGGA 4JX5A 1FYMA 2LVSA 1OFCX 4Y3OA 2EFWA 2B0LA 4U0VA 3HOTA 2L9RA 2X6YA 3E5QA 4L9VA 5ILVA 1LJ9A 3KLNA 3S17J 1R1UA 3CC7I 4ZYGA 1VQ6I 2NVTJ 4RDUA 1XGOA 2RNGA 3RKQA 2FOWA 1J5YA 1ZR4A 1QPMA 1ZGAA 3EUAA 1RETA 3BCAA 3KLOA 2ME0A 2X48A 1WJ5A 3RPUD 1K78B 3G1OA 3H9QA 4I7HA 4A3DJ 2FQ4A 1F43A 1SFKA 4F55A 2M8EA 2NVQJ 2ELKA 4BKXA 3VYTB 3ABMH 3QRFF 2VJ5A 3HSFA 1HA8A 5E17F 2HOAA 4DNCA 3CCYA 5E20A 4XRSA 3M1EA 1OCOH 3GMEA 1KQ8A 1OMIA 4XLPF 1MMSA 4CGZA 4GFBA 3CO7C 2DPDA 4HQEA 2LBFA 5K7ZA 3BR3A 5FRNA 2DXIA 1A36A 2DFHA 2NVUB 2WA0A 5K7HA 4PK4A 3DBLB 1Z6TA 2NNYA 2XGXA 1FYKA 2O61A 2X1DA 5EZGA 1T56A 5CYVA 2HVQA 2DOEA 4L9NA 3BR6A 4BBRJ 1SAXA 4KMFA 3DCFA 2O8KA 4A5NA 1V5FA 2DW4A 3KIOA 2E19A 1KQ0A 2KZGA 4BBSJ 4LG3A 3DEEA 1MJAA 2CU7A 2W85A 1RR8C 5KNLA 1VQPI 2ESHA 2VUMJ 1TNSA 5KAIC 4QLCU 1R9TJ 2M0MA 3ZMUA 5FRMA 3S2DJ 3WTYC 3HXLA 4FX0A 4NC8A 1ULYA 4MLOA 1Z21A 1W1WE 2BVLA 2A61A 1YW7A 4XKWA 1J09A 2FQ3A 2Y0SN 4E7ZA 1RI7A 1G3YA 2V6CA 3H3UA 1WJDA 1IV6A 5EF6A 1X19A 3SEQA 2CV1A 1R71A 1NTCA 2DJIA 4C3HJ 4FE4A 1ZELA 1BOBA 3ONQA 4ZYAA 4MEXF 2M45A 3CC4I 4BAYA 4NB5A 3JAMZ 3V8KA 2AS5F 1AU7A 4A0ZA 2HTJA 1BI3A 4HF2A 4IQJA 2GM4A 1F1ZA 3EETA 1KU3A 3DTIA 3H92A 1DU6A 2DODA 3FMQA 2PG4A 1HDDC 1OCTC 2LC2A 4QWQA 4BNCA 4WXDA 3W3CA 1YLFA 1VQ5I 1PYVA 2E5NA 4ENKA 4M3EA 1ZARA 1MSEC 2FMLA 4A3FJ 1W4MA 4XRFA 2FBIA 1IRFA 3GLLA 2P0WA 1FX7A 3DU5A 2RN7A 1ORKA 3A0HC 4M73A 4CCOA 5ILSA 1LNWA 3WTTC 1DUXC 4IXAA 1QZYA 3B73A 2XROA 1D8JA 4ZYDA 3JRFA 2HQRA 4ENJA 1NG7A 3R0AA 1MNMC 5A2QZ 3QOPA 2LH9A 4CICA 3HYIA 4RB1A 3ABLH 2BYVE 1XPXA 1YO5C 4G7HF 2ZSHB 3F23A 2XAGA 3O8HA 1USTA 2HPMA 1FT9A 4XIDA 4U7BA 2CMPA 3MZHA 3X2QH 3BJAA 2LK2A 2LYCA 3GBGA 3S32A 4F91B 1IC8A 5AONA 1GUUA 3WTXC 4KDPA 2UV1A 2VE9A 4ZDOA 2A6EF 2PJRB 3H9GA 1D1AA 4A6DA 3QYFA 2DQLA 3AG2H 4A3IJ 3J7ZI 5DCMA 3TGNA 4C3IJ 1QO0D 1FMWA 3DQVC 4EM2A 3N4MA 1Y1WJ 3O3KA 2UZKA 1ZKGA 4UHTA 1IXRC 2L3DA 2NNNA 3LQQA 3SFIA 1H9GA 9ANTA 4KICA 2CW7A 2BY3A 1OCZH 3TOBA 2DFFA 2OAZA 3OYFA 1S6LA 2HPIA 1QRYA 1O3QA 2MGQA 3HOYJ 4C3JJ 1EH6A 4YEJA 1XC5A 2BW3B 1XSDA 1FBSA 4IPAA 4XOTA 4XRSG 5F04A 5IOYA 1ACIA 1S3JA 2KLOA 3PJRA 2DOAA 5LBQA 1KYWA 4IL6C 4AUXA 4YIIA 4XQFA 2KQRA 2QGUA 1FYLA 5C4XJ 4C30A 3N05A 1GHCA 3SHFA 1JUMA 3W2WA 2RAEA 3KP7A 3BR5A 1SD4A 1NK3P 4B8XA 5E8GA 5CPRB 3KP5A 3QWLA 2PN6A 3WTSC 4OU0A 3I3LA 4PJMA 2DA7A 5HLIA 1VFCA 3PFIA 4B3XA 2GAUA 3HGGA 4XKBA 2JJ7A 3SDBA 4OIOF 2Z2SB 5J3LA 4L18B 2DO7A 4TV7A 2IAIA 5L3GA 2F5CA 3ABKH 5L3DA 3K1NA 3HIFA 3RKXA 3PO2J 2E2IJ 3GTGJ 3D0SA 1U9NA 5D6FA 2F5EA 3K4LA 1UAAA 3RQ4A 1WJCA 1ZGJA 2XVCA 1B72A 3ISPA 1WJEA 3VPRA 3KYLA 1KU2A 2DCEA 4LB6B 4EGYA 1KQ9A 1YQAA 1SD7A 2CQ7A 2M0CA 4F93B 2KMUA 1Z6RA 2GA2A 1P4XA 4KN4X 2O6GE 5FJ8J 2DFEA 2DMTA 2DMPA 2LBFB 1WSUA 2R0QC 1SAUA 3J80Z 4BE0A 2E1MB 3FXMA 4P5OA 2GXGA 3KZZA 5JLXA 4XKVA 1T8IA 4AYBN 1P7IA 6PAXA 2V9VA 3BR0A 5HLGA 3PQJA 4HSRA 1UMQA 3WG9A 1QPIA 2IS1A 3COAC 2K40A 2QYOA 1R36A 2XV4S 3DV8A 3HEFA 1WI3A 3E6BA 5BS6A 4KT6A 2L4MA 2VE8A 5J1RA 2M1BA 5LEJA 3H5RA 1D0YA 4OMYA 3BZKA 3OIOA 2YUSA 5HOOA 5K5RA 4A2UA 3Q9SA 3F8BA 3L2WA 1V4RA 3H3ZA 3REOA 3GYHX 2V1NA 4XORA 3S2HJ 2VQCA 3G3ZA 2DLLA 2XAHA 3DWLE 1MBFA 2Y9YA 2JWTA 4N4OB 4RM2A 3C7JA 3ABTA 5J47A 2IPQX 4EJUA 1Z91A 2ETHA 1FY7A 4E7IA 1BJAA 1B1BA 2HTSA 2R7UA 2ELHA 3BQYA 3K10A 3ZQIA 2BGCA 2Y9ZA 3CCLI 2LP0A 4ENMA 4PFPA 3QP6A 1PP7U 3PL8A 1VQ9I 2Q8KA 2DK5A 4Y15A 4U0WA 5DS9A 4J19A 3I59B 5F1RA 4HF1A 1VI0A 1BI1A 1C0WA 4PJLA 3E3VA 3ZP5A 3BY6A 4QSHA 5CVUA 4G94A 1QZEA 4YELA 4X0GA 1IRXA 4BDZA 3OR2C 3T1BA 3GTJJ 3WE2A 3OSGA 4ZTFA 3F8NA 2MFZA 1G6NA 1R6RA 2DDAA 2M34A 4H4KC 2DT7B 3H9JA 4ENNA 3BTIA 4NC7A 2DT5A 4FE7A 3G4SI 3TMOA 3GTQJ 2EBIA 3OV8A 4UUTA 1RNLA 2L7MP 3LA3A 3CJRB 3MZYA 3RSNA 3BPXA 4BQOA 3FZVA 1ODDA 4Q48A 5D4RA 4EEFG 4G6TB 3CCRI 2X85A 4LLLA 2ACJA 4KITB 2JK3A 4EM0B 4UB6C 1ZRFA 4D9JA 1JI8A 1JKQC 1TBXA 3BR1A 1XSVA 4EM1A 3F22A 3H3VK 2PMUA 1W5TA 3K0LA 5LRRA 2DFIA 2N8GA 3RYRA 3L00A 3FF5A 1A6IA 3HKZA 2LKXA 2K9LA 1BL0A 4BACA 1AKHA 2WB1A 3HOZJ 1YS7A 3EDPA 3MEXA 2JZYA 4WXHA 2DOFA 5DCMB 4A3EJ 2IBDA 4KT5C 1FZPB 2HQAA 3VYRB 3I53A 2XF6A 2VBZA 5C4JJ 2NXNB 3LQRA 2HNHA 3MAJA 4MNUA 4EJVA 2F2EA 1ON1A 2CUEA 3I54A 1LFPA 4NNJA 4D0PA 5E1XA 3WGHA 2GIZA 2VLAA 4NHJA 1A5JA 3NAUA 2YR2A 1OJLA 5CVIA 2CO5A 2FNPA 3RKYA 4BS9A 4PJNA 3CUQA 1NH3A 2JA2A 1XS9A 4WCGA 1R00A 3ZQHA 4PGHA 3WE3A 1TT5B 1RIOH 3OOPA 5JR3A 1JKOC 5IPAA 3I0TA 2LSOA 4FHTA 3TP3A 2R5ZA 1P2FA 4BE1A 1O3SA 4LJZF 1SANA 1IN7A 3I4NJ 2L5QA 2WV1A 4HRIA 3P5JA 2QSGX 1BR1A 2ZXHA 3JRBA 4P1WA 3TW6A 3EQLF 2MC3A 3BLYA 2Z99A 2ISZA 3VYSB 3NRVA 4FCYA 1QZZA 1YYVA 1UB9A 1Y8QB 2JMWA 2LY2A 2MA3A 2WWYA 1K4TA 4JX6A 2CW8A 2HVSA 2MW8A 3DBHB 2BXZA 1XGMA 2DK8A 2W82A 1W36D 1DGWY 2EK5A 2ZC2A 3IUOA 1H0MA 2HXIA 1NK2P 3BZCA 2XGCA 1ZG5A 4ZZDA 2L0KA 5FKNA 2DA1A 2R3SA 1A31A 4XBFA 2R7DA 3JREA 3E0JB 1KA8A 1G59A 2K3FA 1Y56A 4G9YA 3TBIA 3ZQGA 2LD5A 3H35A 2MG4A 3OYBA 2ISYA 1B72B 1QBJA 1B59A 4DOZA 1VQLI 2H6CA 1E0EA 2BOLA 3BG3A 3M7GA 3MN2A 3LAPA 3DPUA 1O4XA 4G6QA 1MMNA 1LDKB 2GWRA 3NEUA 4I99C 4G7OF 2STWA 3HBLA 3Q5FA 1WJAA 2OTLI 4WXCA 2WY8Q 3SJMA 2X6XA 3GTKJ 1S7AA 2K27A 3WODF 4QIWN 1H8AC 2IS6A 1MH4A 5F6FA 3OYHA 3A4CA 2VODA 2R5YA 3OYKA 2W00A 1U8RA 3K4NA 3HOXJ 4A3KJ 3FK6A 4E6KG 3U2RA 2DTRA 4A69C 5BMZA 2PMHA 3F9KA 3ZMVA 2OQGA 3NWSA 1R4NB 2CRGA 2W25A 2XKPA 4P9FA 3KP4A 1JKPC 4XLCA 2IGKA 2NOGA 5JFRA 1U8BA 1AA7A 4ZJZA 2K9QA 3PNYA 3K4BA 4IOCF 1LQ1A 2IS2A 3SXYA 3HOVJ 3CMEI 1G3TA 2E1CA 2V7FA 4EQQA 5LHGA 4Y52J 1TWAJ 2DMQA 3HRTA 2L7ZA 4MIMA 2LDUA 2JTVA 3V8LA 4B3AA 2EFNA 3ECHA 3LL7A 1R1VA 4HPQA 2M30A 5FO5A 3VOEA 1X58A 4ASNA 1OYIA 1SMTA 3F3XA 1FTZA 3GFMA 4CUGA 2MYSA 1J2XA 3SZPA 2EFPA 4ZTJA 3HRUA 2IGMA 1T0FC 5AIQA 1QHHD 4AC0A 1I5ZA 1FP2A 3RJPA 4R79A 1ETWA 1VQ8I 4LGWA 4M72A 1TWCJ 3RTRA 4OIPF 3ZQLA 3HUGA 1WKMA 3AG3H 3QQAA 3LSGA 5LGTA 4RGXA 1Z3YA 3R0JA 2Z16A 3BT9A 4RAGA 3V4GA 1YX5A 3DEUA 2HR3A 3L09A 4XLAA 4I98B 3SYTA 1FIAA 2OZUA 4DYRA 4A0XA 3BTLA 3U9GA 3MKLA 1XMAA 2QKMB 1WGXA 4BUPA 4OOIA 4XOPA 1R23A 3I58A 1WJBA 3E5XA 3WU0A 2BE5F 3CLOA 3FBIB 1NHAA 5JVGF 1MBJA 2OQRA 2QSHX 2Y75A 3IP4B 3H5AA 1FJLA 3DBRB 1W0UA 2R7SA 2KFDA 3T0YA 2CS3A 3J81K 4XLEA 2FUG2 2HI3A 4OWRB 4BQQA 1OKRA 1Z67A 2E35A 4E7JA 4E7SA 3AL0B 2M87A 5FB2A 1Z77A 2K4JA 5DUKA 3BG7A 3RQIA 3ZCOA 3DU6A 5ICEA 4PJ0C 1T08B 1H88C 2JUCA 4HV5A 4M3FA 2LKPA 3F0CA 3BG5A 4BDYA 3R4KA 5B66C 5DM6F 2X4HA 1XCBA 3VB2A 4BH9A 1QGPA 2Y0SA 2PJPA 1AKHB 3LSMA 4NBQA 3P9KA 3ZOBA 4F3QA 2XF7A 1EH8A 2V9KA 2Y31A 2ZJ2A 3PIPF 3A01A 3S1RJ 4A6EA 1IJWC 2HDCA 1B4AA 1SMYF 2A5WA 3GEZA 1BC7C 1ZK8A 5J40A 3KYDB 2Z3YA 3OR1C 2ZBKA 2FU4A 1LFUP 2VPRA 4IOAF 1O3RA 3KPHA 2I8DA 1TQPA 1UHWA 5LGUA 1CF7A 1REPC 4UV8A 3GCMA 1WPKA 5KHDA 2CJJA 4D7MA 4XN3A 1YI2I 4ZC3A 1FEXA 2Y48A 3CUQB 4HLXA 4KFCA 5CVJA 4CSWA 5KVRA 2HXOA 1YHQI 2A69F 2NOJB 2Q2EA 5DUIA 2D1HA 2DI3A 4JOMA 5FKLA 2P81A 3I71A 3P9CA 3ZN1A 2KT0A 4E70A 3OS0A 1FTTA 2R5ZB 1QA6A 2P6SA 2IA2A 3FXKA 1JJ8C 2BHZA 3GW2A 4P55A 4IZZA 1Q1VA 3JTHA 2HVRA 2VOOA 1RUOA 2L7FP 5DD4A 5AIPA 2EIJH 1OYYA 4E7LA 5LHIA 4I01A 5H6RA 1Y8RB 2DT6A 4E4HA 2XRNA 1PDNC 3AG1H 3E7LA 4XLFA 2E1NA 3WG7H 4M6YA 4AD9A 3HTSB 2KL4A 3S2WA 4KISA 4A3LJ 2VPLA 3W6JB 1J59A 2Q0OA 5HDKA 1EV7A 1XGNA 5FLMJ 2EIMH 3ZXSA 2A6HF 3M9AA 3OL3A 2FEZA 2Z5UA 3K6GA 3GFLA 1VF9A 2L02A 4D5FA 4LG0B 3EPZA 1FBQA 4XLHA 4QPOA 2UXXA 3BCBA 4F92B 2HS5A 4IF4A 4GO1A 1BW6A 4II2A 4IHYA 4IKFA 3RDIA 1RUNA 1YRNA 2HGCA 2FE3A 3M4OJ 3KP3A 3S14J 2COMA 3I4PA 2CWEA 2R7QA 5D5XB 3MD2A 1HC8A 1U5TA 3HHHA 4LLNA 3S1QJ 3KE2A 1IXSB 2H8WA 3CC2I 1S7OA 5C44J 2D1VA 1U5TC 4RGRA 5GTHC 1VZ0A 1MBKA 1UFMA 4U88A 3GTOJ 2DU9A 4XR6A 2QCOA 2QENA 1Y0NA 1ZR2A 5J4YA 2M9HA 3DKWA 4NQWA 1WZ2A 4I76A 3MFKA 3RZOJ 2WAFA 2ZJQF 4RAYA 1EF4A 1U3EM 2B63J 4CXFA 5CQGA 4RLFA 5FKKA 1P6RA 4FX4A 1OYWA 1ZLKA 1U9OA 3VWBA 2MSYA 2R5YB 1XSXA 4ZYEA 2QEXI 3KEQA 4JP0A 2IA0A 1IG7A 3GZ6A 3GTMJ 3HC7A 3HPHA 4HX7A 4A0YA 3HDDA 5DEQA 2CUZA 1FOYA 3S3NA 2CSOA 2BY2A 2EQRA 2JT1A 1YIJI 2NS8A 3Q3SA 1WJFA 3V7SA 1TL8A 2GOMA 3FX3A 1R5HA 2RQQA 3GLXA 3HSEA 5DTDA 1X1AA 5J8FA 1X1PA 1K6YA 3P9IA 1LE8A 1QHGA 4BHBA 4D5CA 3JRIA 4GYGA 3EYYA 3A03A 2AHQA 2HZTA 4S04A 1SFOJ 2L01A 1T33A 3FK7A 2DQRA 5GAGJ 1EJ9A 2IA1A 4HW0A 2EPFA 3ECOA 3SZGA 5IYCJ 1ZH5A 3F8CA 1HQCA 2ECBA 3Q0VA 2WTEA 1BA5A 2AXTC 2EZLA 5IYBJ 1OCRH 2KIFA 3IRQA 3GTPJ 2R7FA 3IWFA 2R7TA 2P5KA 1UG0A 4AM3A 3HUGB 4EATA 3PUFA 4YFKF 1FMVA 3CMAI 3LAJA 1S72I 1MBHA 2F4IA 2GXBA 3CDLA 3WGIA 3ASOH 3JSPA 2VKHA 3C2HA 5E8IA 3O8GA 4M6VA 4Y33A 1IRGA 2E34A 5M5XJ 3DP7A 1CQTA 3QU6A 5M3FJ 2YPRA 1ON2A 3D5SC 1ZLJA 1HBXG 3K4CA 5FFZA 2ZNYA 3KCCA 1S7EA 2X1CA 2O0YA 2DA2A 4YIFA 4AYBA 1J9IA 4KJZA 4A3CJ 4DQ2A 3NWTA 2MD0A 3LMMA 2EA2A 5EEGA 2VJ4A 3FKJA 4RA2A 1YW9A 3ESWB 1YW8A 3WTUC 5CLSA 3L9FA 1Z7LA 3OL4A 4RS8A 2VQLA 2EV0A 3G1MA 1Z1DA 2EIKH 2OPTA 2XIGA 4HX8A 3M8EA 1BR4A 1EH7A 2OZ6A 4HLYA 3HSRA 5GAEJ 3BOQA 2CUFA 2X0LA 1HW5A 5F1JA 1P9QC 1LVKA 1G2HA 3FXLA 4MHGA 5LLQA 1D0XA 4XMYA 2OA4A 4AVZA 2O03A 1GV5A 2O3FA 2E36A 4I02A 1R1TA 1VTNC 2PQ8A 2JA7J 3DLLF 3E1SA 2D2WA 3H36A 1I1GA 4Z2YA 3W2AA 3H5NA 2RC4A 1XMXA 3DXJF 3PNVA 1TQMA 2KIUA 3MKYB 3M1CA 4UVCA 1SVLA 2KRHA 4OIRF 5J4VA 3A01B 2HOSA 5D8LB 1LEAA 5IT9Z 3G1LA 3U1KA 3OYJA 3CJNA 1S29A 3OYCA 3LSIA 2E71A 4RMNA 4RBOA 4BU2A 1SD6A 4PFOA 1HSJA 4LFUA 1Y6IA 2ELJA 1ETOA 2YX7A 3PQKA 2LY9A 2DPUA 1DU0A 4LITA 3L2CA 3KFWX 2X6OA 3EUKL 4N9HA 4BL0B 1CF7B 3S8PA 3OS2A 4LK0F 3B02A 3FHZA 3DTEA 1DPRA 4NUBA 5IOZA 2CUJA 5GADJ 5F0CA 2Q2EB 5BNGA 2K9SA 1GLNA 2GBYA 1HKSA 3HOSA 5KAFC 2FBKA 4N0BA 2ID3A 2A07F 4AVPA 2LFBA 3QPTA 1POGA 1YTYA 2R7XA 2MC4A 5F0HA 1I6HJ 2QQ8A 3JAMK 3K4JA 3IRRA 4EJTA 1XN7A 4C2MJ 1G3WA 1DQUA 4KYWA 2MH2A 1YE9A 2VIXA 2M2EA 1ERDA 1R5ID 4B47A 2DA6A 2WAQN 4Y7NJ 4Y4RA 4ETSA 3TOAA 1LKXA 2JSCA 2XASA 4G12A 1ZQ3P 1D1BA 4N9IA 4Q4ZF 2VBWA 1YJWI 2H1KA 5FD5A 1ITYA 1BC8C 2HOEA 2ZFUA 3MQ0A 3LFKA 2LTPA 2F6CA 2STTA 3JRCA 1S8NA 3K70C 3F6VA 5D6EA 3GZ5A 2WC2A 3S1NJ 5TRDA 5LGNA 1O7LA 2XGEA 2GLOA 1QNTA 1DP7P 1HXDA 1WFXA 1SVOA 5EJCA 3CMMA 3M8JA 3KZYA 1YRNB 2COBA 1X3WB 1MGTA 2KZVA 3K69A 4ABZA 1FSHA 1U5TB 2FOKA 1MBGA 3BG6A 4CH7A 2ECCA 1V54H 2G0EA 5A2QK 1MBEA 1TT0A 3BP8A 3HOWJ 2A05A 2NYXA 2Y2ZA 5IT3A 1D1CA 2RVCA 3D5RC 2OTJI 2CQKA 1DGRM 4NQWB 1RR7A 5BPDA 1TLHB 4D1QA 3HRMA 4BXXJ 1I6XA 5F0FA 1FOWA 4MGRA 5GPAA 2FNAA 4FASD 4YFNF 4UY8I 3GFIA 4Y13A 4KMUX 3OYNA 2ZXWH 3K4MA 1QU3A 1Y0UA 2QSFX 3B6AA 2A5YB 4I0AA 4MFEA 4A3JJ 1JTXA 2M4KA 4G8XA 5FKMA 4IEJA 4RM3A 1I39A 2P7VB 2R7RA 4HF0A 2QVOA 2RKHA 1BR2A 2HYGD 4W97A 3RIRA 1T95A 4FT8A 3JR9A 2HKOA 2XC7A 1XG1A 5HLTA 2NS0A 3ZQQA 4XK4A 4O6JA 3HTUA 3TO7A 2DMUA 3FXOA 3QP5A 3J7AY 2RNJA 1YJ9I 2RV8A 3HGYA 4M9XA 3TO6A 2JPCA 2ME6A 4M71A 2XPVA 2FXAA 3FXJA 1FIPA 1EKEA 1E3HA 1FSEA 2EA4A 1D5YA 3EYIA 3RZDJ 1LE8B 1OR7A 2W48A 2X9DA 2XUBA 4BY7J 3SZTA 2FX0A 2H27A 1WHUA 5LEKA 1OR7C 5ICFA 5ED4A 1IW7F 3KP2A 4HZFA 4C9YA 3U1DA 4E7HA 4V2FA 2CV0A 4DYCA 4HV6A 1KU9A 1PVEA 2K4BA 1FOXA 2A3SA 3J7YJ 2KRCA 5IYDJ 3J7AO 1IN4A 2ZMEA 5FLXZ 3SEZA 3BG9A 3GVAA 2DAOA 4RAZA 2ZMEC 2OV7A 1I50J 1T38A 1K78A 2KDZA 1YX3A 2R4GA 5KCMA 1W5CC 1RKTA 2VT3A 3QODA 5M5WJ 2LMDA 4G6DA 4LIVA 5EZHA 2XAFA 4RGSA 1W5SA 3E6DA 1IXCA 2MH9A 4WWCA 2K9NA 2OF7A 5JHUA 2Z1DA 1E2XA 3MZ8A 2ZCWA 2LY1A 2FMYA 2FD5A 1BIBA 2QA4I 2R92J 1UJ8A 4IX7A 2DA5A 5E3NA 3K1MA 3V42A 3IL2A 4CZCA 5ILUA 1USSA 1IN6A 3A2KA 2FJ1A 3FBNB 1I3QJ 2XPWA 5L3FA 3LA7A 4DGWB 5HODA 1HSTA 4HG2A 2XGDA 2VBYA 2W57A 4ESBA 3BTJA 3LA2A 5HDGA 5F08A 1PUEE 1FC3A 5K7FA 2EH3A 1R7JA 1KYZA 1MIJA 4UVBA 2R7ZJ 3J80K 4OINF 2NAZA 3QPSA 4YIRX 3CF5F 2XAUA 4HYEA 5LRSA 4L9TA 1MNEA 1JHFA 3ZMDA 1FBUA 3I4MJ 3BZ6A 5K1YA 1B8IA 2LF7A 3OYDA 4PSWA 2V6EA 3TL4X 3CCQI 3ZGKA 2FSWA 3BR2A 1LPQA 2Q1ZB 2XKOA 1FP1D 2VN2A 3FIWA 3KYCB 3L7WA 1AOYA 2QKLB 3CP2A 1V3FA 3HL2A 3PSIA 2IVMA 2HYFA 1W7PA 2M5WA 4BJ5C 3H0GJ 3G71I 1FPQA 4II3A 5L3EA 2JRMA 2YSRA 4GYIA 3FDYA 3PM1A 4XSZF 1K6OA 3W6KB 3KP6A 2R93J 1OISA 2M7BA 4GDFA 4WX9A 2O8XA 1JJ6C 1ZN2A 1OCCH 3RCOA 1IN5A 4WF2A 1KGSA 2HYJA 4L5JA 2C6YA 1T2KA 1U2WA
chains in the Genus database with same CATH topology
2XB5A 3BR5A 3E7LA 1TWHJ 5EG0A 1NK3P 4A3LJ 1OCPA 2NVXJ 3S15J 4CYCA 1IDYA 5FLMJ 1TWFJ 4FISA 4JX4A 2DA7A 1VFCA 3S1MJ 1VF9A 2DMNA 3HGGA 2JJ7A 2LR8A 4D5FA 5J3LA 2JN6A 2IAIA 5E3LA 3W6VA 2DJNA 4HNVA 1JT6A 1MSFC 4IHWA 4IHYA 1BW6A 1WH5A 4DW6A 5M5YJ 1YRNA 3PO2J 2E2IJ 3M4OJ 3S14J 3GTGJ 1U9NA 5EGOB 1TWGJ 2EZIA 1MH3A 2XSDC 3S1QJ 4DZJA 4M3GA 3Q0UA 5EDNA 4UUSB 1RPWA 5C44J 1B72A 3VPRA 3L1PA 4I6ZA 3GTOJ 1MBKA 1E3OC 2QCOA 3LSPA 1LFBA 1ZR2A 3JRHA 2M9HA 3JRAA 2M0CA 4I76A 3RZOJ 3CMYA 1IRZA 1EF4A 5FJ8J 2DMTA 2TRTA 2B63J 1HOMA 2DMPA 1GVDA 5FKKA 2DTZA 2R0QC 4MFDA 1U9OA 2MSYA 1GDTA 2R5YB 2DN0A 5JLXA 4JP0A 3Q0WA 1IG7A 3GTMJ 4AYBN 1P7IA 3IH4A 4L5EA 1U78A 3BR0A 1HLVA 4A3BJ 3M3YJ 1UMQA 3MVPA 1QPIA 2EQRA 3OOUA 2K40A 2NS8A 1ETQA 3Q3SA 3HEFA 1WI3A 2NS7A 3TW7A 3LSRA 5J1RA 3OIOA 4LOCA 1ETXA 2YUSA 5DTDA 5IP7J 4M3BA 2XB0X 1LE8A 4D5CA 3JRIA 3S2HJ 1JKRC 4IHXA 3A03A 2AHQA 1SFOJ 1MBFA 2O9LA 1T33A 2Y9YA 3FK7A 2JWTA 2PMZN 2DA3A 5IYCJ 3HKZN 3HM5A 1X2MA 2ECBA 3Q0VA 2E2JJ 3DEWA 1ETYA 2EZLA 5IYBJ 3LNQA 1BA5A 1ETKA 1HDPA 3GTPJ 2WB1N 3ZQFA 1JUPA 2Y9ZA 3BQYA 3ZQIA 4S0HB 2IEKA 2LP0A 1MBHA 5E3OA 5DS9A 3CDLA 4J19A 4DZPA 1VI0A 2O7OA 2AO9A 3O8GA 4M6VA 4DYQA 1IUFA 5M5XJ 4QSHA 2QF7A 3JRDA 2EZHA 1CQTA 5JLWA 5GPCA 5M3FJ 2JA8J 3GTJJ 3OSGA 5F27A 2M34A 1JUSA 1S7EA 3BTIA 2ZB9A 2DA2A 5EYRA 2YU9J 3BQZA 4B1RA 4FE7A 4A3CJ 4MO7A 3GTQJ 2EBIA 4UUTA 3K2AA 5J1YA 2L7MP 1QVUA 1ETVA 3G1MA 2OPTA 4EEFG 3OSFA 2JK3A 3NARA 1ZTRA 2CUFA 1VNDA 1X2NA 3B6CA 5F1JA 1JKQC 3TEDA 1G2HA 3BR1A 3IH2A 2M8GX 3H3VK 1GV5A 2JA5J 2N8GA 4FTHA 1A6IA 3K7AJ 2HOTA 2JA7J 2HQ5A 2LKXA 4W1UA 1IDZA 1BL0A 1AKHA 3LOCA 3HOZJ 2NVYJ 4A3EJ 2IBDA 2YS9A 3FISA 3A01B 1B8IB 2HOSA 1UG2A 3G1LA 3WHCA 5C4JJ 4RBOA 4M3DA 1ZGWA 1GT0C 1ETOA 2LY9A 1DU0A 2HDDA 3SDGA 2X6OA 1BW5A 2CUEA 1A5JA 5IP6A 2XPUA 3NAUA 5IOZA 1OJLA 5F0CA 1PUFB 5BNGA 2K9SA 1XS9A 3IH3A 1RESA 2GBYA 4QTRA 3ZQHA 5FKOA 2ID3A 1JKOC 2LFBA 5IPAA 1POGA 3TP3A 2R5ZA 5FLVA 1K61A 5F0HA 2VKVA 3WHBA 1SANA 3I4NJ 1I6HJ 2WV1A 3HB9A 4C2MJ 5M3MJ 3HDDA 2M2EA 4JYKA 4V2GA 5EEAA 3TW6A 5EG0B 3JRBA 1W0TA 3LSJA 3BTCA 2DA6A 3FKIJ 1H89C 2WAQN 4Y7NJ 4FCYA 5J1UA 2CQQA 4CYCB 1WCMJ 2E2HJ 1HF0A 3JRGA 4G12A 1ZQ3P 3S16J 4XICA 2JMWA 2H1KA 4JX6A 1ITYA 2MW8A 4A3GJ 2LTPA 3JRCA 4JX5A 2LVSA 1OFCX 3S1NJ 2L9RA 2HXIA 2XGEA 1NK2P 2GLOA 2XGCA 1APLC 3S17J 2L0KA 5FKNA 1YRNB 2COBA 2DA1A 2NVTJ 4RDUA 3JREA 2VKEA 3RKQA 4ABZA 1MBGA 3ZQGA 1ZR4A 2LD5A 1JGGA 2MG4A 5EGOA 2E1OA 1RETA 2ECCA 2ME0A 2G0EA 2X48A 1MBEA 1B72B 3HOWJ 3G1OA 4A3DJ 2FQ4A 4A3MJ 1F43A 4UUSA 2Y2ZA 5GP9A 2NVQJ 2ELKA 3BG3A 4BKXA 3MN2A 5C3EJ 4D7NA 1RR7A 1O4XA 3GTLJ 3TP0A 3HBLA 2HOAA 4BXXJ 3CCYA 4XRSA 1Y1VJ 5F0FA 5GPAA 3SJMA 3D1NI 4GFBA 1Z0XA 1JT0A 3GTKJ 4QIWN 1H8AC 5K7ZA 1MH4A 3BR3A 3B6AA 4A3JJ 4MFEA 1JTXA 5K7HA 5FKMA 4IEJA 4A93J 2R5YA 3HOXJ 4A3KJ 3FK6A 2XRLA 4W97A 4A69C 1IGNA 3JR9A 1GV2A 5EZGA 1T56A 1XG1A 2CRGA 1JKPC 4XK4A 1WH7A 4BY1J 2DMUA 2NOGA 3BR6A 4BBRJ 1U8BA 2K9QA 3DCFA 2O8KA 3HGYA 3C2BA 2E19A 2ME6A 2XPVA 1TC3C 3HOVJ 4BBSJ 4IHVA 1FIPA 2CU7A 1D5YA 4Y52J 3RZDJ 1TWAJ 3CQZJ 1LE8B 2DMQA 2L7ZA 2VUMJ 4MIMA 2W48A 2D5VA 4B3AA 2X9DA 1R9TJ 3S2DJ 4BY7J 2FX0A 4MLOA 1X58A 1FTZA 2Y0SN 4V2FA 1IV6A 4X1EA 5EF6A 4DYCA 1F36A 3QPLA 1NTCA 2Y30A 4C3HJ 5E3MA 4FE4A 5IYDJ 4AC0A 1ETWA 1BJZA 1TWCJ 2I10A 4NDLA 3ZQLA 1AU7A 3QQAA 3LSGA 2GM4A 3BT9A 3BG9A 1DU6A 1I50J 1HDDC 2LLKA 1OCTC 1K83J 2KDZA 1HCRA 4XRMA 1FIAA 1RKTA 4DYRA 3BTLA 3HOUJ 3MKLA 1WGXA 1JTYA 5M5WJ 4M3EA 5EZHA 2H8RA 5IP9J 1MSEC 2JA6J 1P7JA 2K9NA 2OF7A 4A3FJ 1MBJA 1ORKA 1FJLA 1W0UA 2FD5A 4B4CA 2R92J 2ID6A 2DA5A 2HI3A 5E3NA 3JRFA 1UHSA 1Z77A 1MNMC 1AHDP 2FJ1A 1I3QJ 2DA4A 2XPWA 3RQIA 5HODA 2XGDA 1H88C 4M3FA 3BTJA 3F0CA 3O8HA 5F08A 3BG5A 4XIDA 5K7FA 2LK2A 3GBGA 2EH3A 2R7ZJ 1IC8A 1AKHB 3QPSA 1GUUA 3UKGA 3ZOBA 1QVTA 4A3IJ 2Y31A 3I4MJ 4C3IJ 3A01A 3ZQCA 1B8IA 3S1RJ 1IJWC 1RKWA 3BR2A 2CQXA 1Y1WJ 1ZK8A 1ZKGA 3FIWA 3IV5A 3SFIA 9ANTA 1LFUP 2VPRA 3PO3J 1QRYA 3H0GJ 2MGQA 3HOYJ 1WPKA 2CJJA 4D7MA 4C3JJ 1FEXA 1XC5A 3PM1A 2HXOA 4XRSG 5F04A 1PUFA 5IOYA 3A02A 2R93J 5FKLA 2P81A 4X6AJ 2KT0A 2TCTA 2VI6A 2EZKA 1FTTA 2R5ZB 1JJ6C 1JJ8C 4AUXA 1Q1VA 2L7FP 1ENHA 5C4XJ 2HYJA 1JUMA 2RAEA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2XB5 A;  3BR5 A;  3E7L A;  1TWH J;  5EG0 A;  1NK3 P;  4A3L J;  1OCP A;  2NVX J;  3S15 J;  4CYC A;  1IDY A;  5FLM J;  1TWF J;  4FIS A;  4JX4 A;  2DA7 A;  1VFC A;  3S1M J;  1VF9 A;  2DMN A;  3HGG A;  2JJ7 A;  2LR8 A;  4D5F A;  5J3L A;  2JN6 A;  2IAI A;  5E3L A;  3W6V A;  2DJN A;  4HNV A;  1JT6 A;  1MSF C;  4IHW A;  4IHY A;  1BW6 A;  1WH5 A;  4DW6 A;  5M5Y J;  1YRN A;  3PO2 J;  2E2I J;  3M4O J;  3S14 J;  3GTG J;  1U9N A;  5EGO B;  1TWG J;  2EZI A;  1MH3 A;  2XSD C;  3S1Q J;  4DZJ A;  4M3G A;  3Q0U A;  5EDN A;  4UUS B;  1RPW A;  5C44 J;  1B72 A;  3VPR A;  3L1P A;  4I6Z A;  3GTO J;  1MBK A;  1E3O C;  2QCO A;  3LSP A;  1LFB A;  1ZR2 A;  3JRH A;  2M9H A;  3JRA A;  2M0C A;  4I76 A;  3RZO J;  3CMY A;  1IRZ A;  1EF4 A;  5FJ8 J;  2DMT A;  2TRT A;  2B63 J;  1HOM A;  2DMP A;  1GVD A;  5FKK A;  2DTZ A;  2R0Q C;  4MFD A;  1U9O A;  2MSY A;  1GDT A;  2R5Y B;  2DN0 A;  5JLX A;  4JP0 A;  3Q0W A;  1IG7 A;  3GTM J;  4AYB N;  1P7I A;  3IH4 A;  4L5E A;  1U78 A;  3BR0 A;  1HLV A;  4A3B J;  3M3Y J;  1UMQ A;  3MVP A;  1QPI A;  2EQR A;  3OOU A;  2K40 A;  2NS8 A;  1ETQ A;  3Q3S A;  3HEF A;  1WI3 A;  2NS7 A;  3TW7 A;  3LSR A;  5J1R A;  3OIO A;  4LOC A;  1ETX A;  2YUS A;  5DTD A;  5IP7 J;  4M3B A;  2XB0 X;  1LE8 A;  4D5C A;  3JRI A;  3S2H J;  1JKR C;  4IHX A;  3A03 A;  2AHQ A;  1SFO J;  1MBF A;  2O9L A;  1T33 A;  2Y9Y A;  3FK7 A;  2JWT A;  2PMZ N;  2DA3 A;  5IYC J;  3HKZ N;  3HM5 A;  1X2M A;  2ECB A;  3Q0V A;  2E2J J;  3DEW A;  1ETY A;  2EZL A;  5IYB J;  3LNQ A;  1BA5 A;  1ETK A;  1HDP A;  3GTP J;  2WB1 N;  3ZQF A;  1JUP A;  2Y9Z A;  3BQY A;  3ZQI A;  4S0H B;  2IEK A;  2LP0 A;  1MBH A;  5E3O A;  5DS9 A;  3CDL A;  4J19 A;  4DZP A;  1VI0 A;  2O7O A;  2AO9 A;  3O8G A;  4M6V A;  4DYQ A;  1IUF A;  5M5X J;  4QSH A;  2QF7 A;  3JRD A;  2EZH A;  1CQT A;  5JLW A;  5GPC A;  5M3F J;  2JA8 J;  3GTJ J;  3OSG A;  5F27 A;  2M34 A;  1JUS A;  1S7E A;  3BTI A;  2ZB9 A;  2DA2 A;  5EYR A;  2YU9 J;  3BQZ A;  4B1R A;  4FE7 A;  4A3C J;  4MO7 A;  3GTQ J;  2EBI A;  4UUT A;  3K2A A;  5J1Y A;  2L7M P;  1QVU A;  1ETV A;  3G1M A;  2OPT A;  4EEF G;  3OSF A;  2JK3 A;  3NAR A;  1ZTR A;  2CUF A;  1VND A;  1X2N A;  3B6C A;  5F1J A;  1JKQ C;  3TED A;  1G2H A;  3BR1 A;  3IH2 A;  2M8G X;  3H3V K;  1GV5 A;  2JA5 J;  2N8G A;  4FTH A;  1A6I A;  3K7A J;  2HOT A;  2JA7 J;  2HQ5 A;  2LKX A;  4W1U A;  1IDZ A;  1BL0 A;  1AKH A;  3LOC A;  3HOZ J;  2NVY J;  4A3E J;  2IBD A;  2YS9 A;  3FIS A;  3A01 B;  1B8I B;  2HOS A;  1UG2 A;  3G1L A;  3WHC A;  5C4J J;  4RBO A;  4M3D A;  1ZGW A;  1GT0 C;  1ETO A;  2LY9 A;  1DU0 A;  2HDD A;  3SDG A;  2X6O A;  1BW5 A;  2CUE A;  1A5J A;  5IP6 A;  2XPU A;  3NAU A;  5IOZ A;  1OJL A;  5F0C A;  1PUF B;  5BNG A;  2K9S A;  1XS9 A;  3IH3 A;  1RES A;  2GBY A;  4QTR A;  3ZQH A;  5FKO A;  2ID3 A;  1JKO C;  2LFB A;  5IPA A;  1POG A;  3TP3 A;  2R5Z A;  5FLV A;  1K61 A;  5F0H A;  2VKV A;  3WHB A;  1SAN A;  3I4N J;  1I6H J;  2WV1 A;  3HB9 A;  4C2M J;  5M3M J;  3HDD A;  2M2E A;  4JYK A;  4V2G A;  5EEA A;  3TW6 A;  5EG0 B;  3JRB A;  1W0T A;  3LSJ A;  3BTC A;  2DA6 A;  3FKI J;  1H89 C;  2WAQ N;  4Y7N J;  4FCY A;  5J1U A;  2CQQ A;  4CYC B;  1WCM J;  2E2H J;  1HF0 A;  3JRG A;  4G12 A;  1ZQ3 P;  3S16 J;  4XIC A;  2JMW A;  2H1K A;  4JX6 A;  1ITY A;  2MW8 A;  4A3G J;  2LTP A;  3JRC A;  4JX5 A;  2LVS A;  1OFC X;  3S1N J;  2L9R A;  2HXI A;  2XGE A;  1NK2 P;  2GLO A;  2XGC A;  1APL C;  3S17 J;  2L0K A;  5FKN A;  1YRN B;  2COB A;  2DA1 A;  2NVT J;  4RDU A;  3JRE A;  2VKE A;  3RKQ A;  4ABZ A;  1MBG A;  3ZQG A;  1ZR4 A;  2LD5 A;  1JGG A;  2MG4 A;  5EGO A;  2E1O A;  1RET A;  2ECC A;  2ME0 A;  2G0E A;  2X48 A;  1MBE A;  1B72 B;  3HOW J;  3G1O A;  4A3D J;  2FQ4 A;  4A3M J;  1F43 A;  4UUS A;  2Y2Z A;  5GP9 A;  2NVQ J;  2ELK A;  3BG3 A;  4BKX A;  3MN2 A;  5C3E J;  4D7N A;  1RR7 A;  1O4X A;  3GTL J;  3TP0 A;  3HBL A;  2HOA A;  4BXX J;  3CCY A;  4XRS A;  1Y1V J;  5F0F A;  5GPA A;  3SJM A;  3D1N I;  4GFB A;  1Z0X A;  1JT0 A;  3GTK J;  4QIW N;  1H8A C;  5K7Z A;  1MH4 A;  3BR3 A;  3B6A A;  4A3J J;  4MFE A;  1JTX A;  5K7H A;  5FKM A;  4IEJ A;  4A93 J;  2R5Y A;  3HOX J;  4A3K J;  3FK6 A;  2XRL A;  4W97 A;  4A69 C;  1IGN A;  3JR9 A;  1GV2 A;  5EZG A;  1T56 A;  1XG1 A;  2CRG A;  1JKP C;  4XK4 A;  1WH7 A;  4BY1 J;  2DMU A;  2NOG A;  3BR6 A;  4BBR J;  1U8B A;  2K9Q A;  3DCF A;  2O8K A;  3HGY A;  3C2B A;  2E19 A;  2ME6 A;  2XPV A;  1TC3 C;  3HOV J;  4BBS J;  4IHV A;  1FIP A;  2CU7 A;  1D5Y A;  4Y52 J;  3RZD J;  1TWA J;  3CQZ J;  1LE8 B;  2DMQ A;  2L7Z A;  2VUM J;  4MIM A;  2W48 A;  2D5V A;  4B3A A;  2X9D A;  1R9T J;  3S2D J;  4BY7 J;  2FX0 A;  4MLO A;  1X58 A;  1FTZ A;  2Y0S N;  4V2F A;  1IV6 A;  4X1E A;  5EF6 A;  4DYC A;  1F36 A;  3QPL A;  1NTC A;  2Y30 A;  4C3H J;  5E3M A;  4FE4 A;  5IYD J;  4AC0 A;  1ETW A;  1BJZ A;  1TWC J;  2I10 A;  4NDL A;  3ZQL A;  1AU7 A;  3QQA A;  3LSG A;  2GM4 A;  3BT9 A;  3BG9 A;  1DU6 A;  1I50 J;  1HDD C;  2LLK A;  1OCT C;  1K83 J;  2KDZ A;  1HCR A;  4XRM A;  1FIA A;  1RKT A;  4DYR A;  3BTL A;  3HOU J;  3MKL A;  1WGX A;  1JTY A;  5M5W J;  4M3E A;  5EZH A;  2H8R A;  5IP9 J;  1MSE C;  2JA6 J;  1P7J A;  2K9N A;  2OF7 A;  4A3F J;  1MBJ A;  1ORK A;  1FJL A;  1W0U A;  2FD5 A;  4B4C A;  2R92 J;  2ID6 A;  2DA5 A;  2HI3 A;  5E3N A;  3JRF A;  1UHS A;  1Z77 A;  1MNM C;  1AHD P;  2FJ1 A;  1I3Q J;  2DA4 A;  2XPW A;  3RQI A;  5HOD A;  2XGD A;  1H88 C;  4M3F A;  3BTJ A;  3F0C A;  3O8H A;  5F08 A;  3BG5 A;  4XID A;  5K7F A;  2LK2 A;  3GBG A;  2EH3 A;  2R7Z J;  1IC8 A;  1AKH B;  3QPS A;  1GUU A;  3UKG A;  3ZOB A;  1QVT A;  4A3I J;  2Y31 A;  3I4M J;  4C3I J;  3A01 A;  3ZQC A;  1B8I A;  3S1R J;  1IJW C;  1RKW A;  3BR2 A;  2CQX A;  1Y1W J;  1ZK8 A;  1ZKG A;  3FIW A;  3IV5 A;  3SFI A;  9ANT A;  1LFU P;  2VPR A;  3PO3 J;  1QRY A;  3H0G J;  2MGQ A;  3HOY J;  1WPK A;  2CJJ A;  4D7M A;  4C3J J;  1FEX A;  1XC5 A;  3PM1 A;  2HXO A;  4XRS G;  5F04 A;  1PUF A;  5IOY A;  3A02 A;  2R93 J;  5FKL A;  2P81 A;  4X6A J;  2KT0 A;  2TCT A;  2VI6 A;  2EZK A;  1FTT A;  2R5Z B;  1JJ6 C;  1JJ8 C;  4AUX A;  1Q1V A;  2L7F P;  1ENH A;  5C4X J;  2HYJ A;  1JUM A;  2RAE A; 
#chains in the Genus database with same CATH topology
 5LFA A;  1M1E B;  3E6M A;  2ICW G;  2PBI A;  1W36 C;  1VQK I;  2EV6 A;  1TWH J;  1ZRE A;  4B43 A;  1OCP A;  2V1U A;  2OCE A;  3M07 A;  1EA3 A;  3IAS 2;  2CW0 F;  4HST A;  5B1A H;  4CYC A;  1F4K A;  1IDY A;  4P96 A;  1F9N A;  4FIS A;  1E3P A;  3FXQ A;  3S3O A;  1IAW A;  3JSO A;  1T0F A;  3S1M J;  4UUV A;  2DMN A;  3ZMZ A;  1U6G A;  5CVR A;  4QPQ A;  4RB3 C;  2X6W A;  1BOA A;  4BJT A;  5E3L A;  4HNV A;  2WV0 A;  1JT6 A;  4IHW A;  3OYI A;  1T6S A;  1MW7 A;  2BXY A;  5CQE A;  1TTY A;  3PFY A;  1TWG J;  2EZI A;  1MH3 A;  2XSD C;  2W7N A;  4IHS A;  2R7V A;  3CF2 A;  1BIA A;  2VQG A;  3Q0U A;  3VOD A;  3BJO A;  2OCC H;  2MLK A;  2J5P A;  4I6Z A;  1E3O C;  2K86 A;  3R61 A;  3A1Y A;  3LSP A;  1TQI A;  1I3A A;  5DD8 A;  3WU1 B;  1FLI A;  4AID A;  2RDP A;  3NQO A;  2PLY A;  3CDI A;  2P5V A;  3CMY A;  3WGG A;  1HOM A;  3IKT A;  4BEH A;  2DTZ A;  2QM3 A;  2UXN A;  2EWN A;  2KJC A;  2ZKZ A;  2E60 A;  4EJW A;  2DN0 A;  3KET A;  1MDM A;  3IH4 A;  3BJ6 A;  3VFZ A;  3DF8 A;  1U78 A;  1HLV A;  3I9V 2;  1ZHF A;  5EEH A;  3OOU A;  2ZFW A;  5TIS C;  5D5V B;  2KRF A;  3IKV A;  4WK8 F;  3TW7 A;  3LSR A;  3ML6 A;  1OLT A;  1RC9 A;  4LOC A;  1X1C A;  1B6A A;  4YFX F;  3UNG C;  5IP7 J;  3CJT B;  1T98 A;  3S3M A;  1HKQ A;  1XB4 A;  4HDU A;  1X4O A;  2FA5 A;  5D8K B;  3CDH A;  1D3Y A;  3BDD A;  4KUM A;  2XB0 X;  4M3B A;  4BXF A;  1I27 A;  4PSX A;  2LOO A;  5H20 A;  1JKR C;  3BWG A;  2IGO A;  2I5U A;  1YFH A;  3UR3 C;  2K9M A;  1FWZ A;  3LSK A;  2O9L A;  3N97 A;  2PMZ N;  2CGP A;  1G4D A;  1CGP A;  2VXD A;  3ROU A;  4CCL A;  3HM5 A;  3ZN0 A;  1X2M A;  1YOV B;  2E2J J;  3LNQ A;  1HDP A;  2VL8 A;  4XSX F;  3MWM A;  2Z33 A;  4XM3 A;  3OYA A;  1VQ4 I;  2ZME B;  5B1B H;  2IGN A;  4UB8 C;  5IY5 H;  4BXU A;  2VXZ A;  4S0H B;  3AFH A;  2IEK A;  4CA0 A;  3AG4 H;  2LNB A;  2KIS A;  4DZP A;  3CLQ A;  2A68 F;  2BBY A;  2IS4 A;  2O7O A;  2AO9 A;  2F5D A;  4DYQ A;  1IUF A;  2ZXI A;  3ASN H;  2QF7 A;  3JRD A;  2K5C A;  2XDV A;  2EZH A;  2JA8 J;  5GPC A;  3WTW C;  4U7D A;  5F27 A;  3CD6 I;  1MJB A;  1TP4 A;  4F52 A;  2FF4 A;  1G3S A;  1JUS A;  2B7E A;  2KDO A;  3LFU A;  1BI2 A;  2YU9 J;  4B1R A;  1SD5 A;  3RYP A;  2CQN A;  2BZT A;  3RPQ A;  5HVQ C;  4U0Y A;  4UXN A;  4XLN F;  4LD5 A;  5J1Y A;  2ZJR F;  4OMZ A;  1O57 A;  3A0B C;  4HX4 A;  3ERE D;  2HDW A;  4HEA 2;  3W2V A;  2DDB A;  2IXS A;  3DTK A;  3HZJ A;  1I1S A;  1TZL A;  4KIB A;  2F5F A;  2HKX A;  3OSF A;  2OC6 A;  3RPU A;  1YIO A;  4I09 A;  4JBA A;  1ZTR A;  3GUD A;  2E1M C;  5HS8 A;  1B9M A;  4EGZ A;  2F4O B;  1VND A;  1X2N A;  3R6S A;  1N25 A;  2JRT A;  5FRO A;  3TED A;  4B44 A;  3IH2 A;  4L0Y B;  1STZ A;  2M8G X;  3F8F A;  2L9S A;  1SVM A;  1XGS A;  3KX2 A;  4FTH A;  3K7A J;  4UNO A;  2HQ5 A;  4ANJ A;  4W1U A;  5ICG A;  1MZB A;  1IDZ A;  1Z7U A;  4CO8 A;  3LOC A;  5H6Q A;  3TKY A;  4DBR A;  4BQA A;  5H2F C;  3DFG A;  3FIS A;  3L2V A;  5FD6 A;  1B8I B;  1UG2 A;  3I5U A;  4R1H A;  2X51 A;  3FXU A;  1PP8 F;  5CJ9 A;  4Q47 A;  1ZGW A;  4KNY A;  1GT0 C;  2ADU A;  3LSH A;  2HDD A;  3SDG A;  3H0D A;  4AIH A;  1BW5 A;  2XAJ A;  3T8T A;  1W7P B;  4IVN A;  2XPU A;  2K3P A;  4GXO A;  2OD5 A;  5ICC A;  4LIU A;  1ZG1 A;  2E7W A;  2V79 A;  3PSF A;  3I59 A;  1SFE A;  3IH3 A;  1RES A;  4UV9 A;  2L54 A;  4PUS A;  4QTR A;  2LKS A;  3OIP A;  3T5X A;  4ZDP A;  4IQ4 A;  2VON A;  3OMY A;  1KZH A;  3JW4 A;  3OS1 A;  4PZJ A;  4IO9 F;  1VQ7 I;  2G9W A;  3WHB A;  2KPM A;  2IW5 A;  2TDX A;  1MMA A;  1MKM A;  3HB9 A;  5BPI A;  4IRG A;  3VEP A;  5GTI C;  2UUZ A;  5M3M J;  4F7Z A;  1UZC A;  3K4K A;  4IRH A;  4BYY A;  3CCM I;  1SFU A;  4V2G A;  4JYK A;  5EEA A;  1GXQ A;  3C2G A;  2F5V A;  4CCJ A;  3LSJ A;  3BTC A;  1XX5 A;  2RRE A;  2V1D A;  4RLQ A;  1H89 C;  4RB0 A;  3ZPL A;  4RB2 C;  2L4A A;  1R58 A;  2IJL A;  1WCM J;  4CYC B;  2YU3 A;  1L0O C;  3ZMS A;  3JRG A;  1HF0 A;  1N75 A;  2E2H J;  2R7O A;  4Z6Y A;  1D5V A;  3S16 J;  2EFQ A;  3DPT A;  4A3G J;  1HKT A;  2XAQ A;  5E79 C;  1MD0 A;  1WVR A;  2LF8 A;  2OBP A;  4RAF A;  4MTE A;  3G6E I;  2VKD A;  1APL C;  2YX4 A;  4CZZ A;  3WTV C;  3M8F A;  4O3M A;  2VKE A;  2GA1 A;  3PUB A;  2DYS H;  2CG4 A;  4OIQ F;  1JGG A;  3R60 A;  5EGO A;  2E1O A;  2Y69 H;  1KU7 A;  3TDZ C;  5HLH A;  4GCV A;  4A3M J;  4UUS A;  5GP9 A;  2VBX A;  1LVA A;  4P9U A;  5C3E J;  4XN0 A;  2IT0 A;  1X1D A;  2D45 A;  4D7N A;  2BHY A;  1K4S A;  1U0J A;  2WBM A;  2HQN A;  3OYM A;  3TP0 A;  3GTL J;  3GXO A;  2GXA A;  3V8J A;  1Y1V J;  3ERM A;  1AWC A;  2VJI A;  3I55 I;  4BEH B;  3D1N I;  1Z0X A;  4JK1 X;  1JT0 A;  5E1Z B;  4Q5S F;  4M74 A;  4EV0 A;  3CCE I;  1MDM B;  4A93 J;  4DJA A;  4LB5 A;  3ZR8 X;  2RGV A;  3CO6 C;  4ZH4 F;  2XRL A;  1N78 A;  1X3U A;  3GWZ A;  2P6T A;  2WAQ A;  1IGN A;  1WWX A;  1GV2 A;  2ZSI B;  4L0Z B;  1WH7 A;  4CCM A;  3SQN A;  4BY1 J;  5JI6 A;  4I0B A;  3O2P E;  4DIQ A;  3P7N A;  5J6X A;  1ZRD A;  3C2B A;  2P8T A;  2E7X A;  1SEU A;  1TC3 C;  4IHV A;  2AQE A;  3CQZ J;  1HW1 A;  2D5V A;  2ESN A;  3SFZ A;  3Q9V A;  1WRJ A;  2VC0 A;  2ZJP F;  1LEB A;  2QZ8 A;  4J00 A;  4M9S A;  4EJO A;  2EIL H;  3CES A;  1MND A;  1VQN I;  1OQY A;  1B9N A;  4KA4 A;  4XNF A;  4X1E A;  4RGU A;  1F36 A;  2EFO A;  1BI0 A;  3HHG A;  3QPL A;  2Y30 A;  1LDD A;  4B09 A;  5E3M A;  3FHN A;  3PNT A;  1BJZ A;  2EV5 A;  2I10 A;  4NDL A;  5DDG A;  4PJJ A;  1QQI A;  4EMS A;  4BJ6 C;  5HDN A;  1RZ4 A;  4ON0 A;  2IRF G;  4GGG A;  5D5W B;  3K70 D;  1XDU A;  1P4A A;  2EJR A;  1K83 J;  2LLK A;  3LWF A;  4Y17 A;  3TQN A;  4XRM A;  1HCR A;  1S9H A;  3HOU J;  1GXP A;  2KIM A;  1JTY A;  2HZD A;  4IHT A;  2H8R A;  2M3A A;  5IP9 J;  3BC8 A;  3V7C A;  2LG4 A;  1V5E A;  2JA6 J;  1P7J A;  1XCV A;  5TGT A;  3IC7 A;  1F5T A;  3QU3 A;  2GIV A;  4I2O A;  2V4J C;  4LK1 F;  2BY0 A;  3L2Q A;  4OAZ A;  4LLG F;  3WTZ A;  4B4C A;  1TW2 A;  4KIF A;  2GOX B;  5BOX A;  2ID6 A;  2XHK A;  5D4S A;  4JQF A;  2QQB A;  1UHS A;  2J5O A;  1Z3X A;  5J8C A;  5K5O A;  1H9T A;  1AHD P;  4V19 K;  2DA4 A;  2QUF A;  2JUG A;  2NRA C;  4UVA A;  2MLG A;  3CCV I;  3S93 A;  3ZRG A;  2DBB A;  1IZ1 A;  1YJN I;  4S05 A;  2XF5 A;  2JSP A;  2PFB A;  4PCQ A;  3CCJ I;  2F48 A;  2HFH A;  2W84 A;  4B48 A;  3UKG A;  3O6B B;  1Z9C A;  1Y39 A;  1QVT A;  3HJE A;  1ZYR F;  1ZRC A;  4E7K A;  5L3C A;  2UWM A;  1LUJ B;  1G8X A;  4HOB A;  2VAS A;  2FBH A;  3QYE A;  3ZQC A;  4AIJ A;  2V1X A;  3CCS I;  1KON A;  1RKW A;  1RRJ A;  2CQX A;  4BE2 A;  1MJ9 A;  5CKT A;  3IV5 A;  4HDV A;  2JVH A;  2VJJ A;  2AQF A;  3PO3 J;  2M4G A;  3HPG A;  3G2B A;  3ZQ7 A;  2Z9O A;  2LRE A;  2KP6 A;  4L9J A;  2DYR H;  3K2Z A;  4CCN A;  4M9Z A;  3I56 I;  2XSJ C;  5F64 A;  3QAH A;  1DP3 A;  2WAD A;  1PUF A;  3DPL C;  3A02 A;  3OYL A;  3FM5 A;  3JTG A;  2AXL A;  4X6A J;  2MBF A;  2TCT A;  2VI6 A;  2EZK A;  3K9T A;  1FOK A;  1O7F A;  3VSL A;  1A04 A;  2IP2 A;  2QBY A;  3CJQ B;  5K5Q A;  3ULQ B;  1ENH A;  1J0R A;  1E17 A;  3CUO A;  5FGM A;  1LDJ A;  1JXS A;  3E6C C;  2XB5 A;  2G7H A;  4ZYH A;  3GZN B;  5EG0 A;  2BY1 A;  2FRH A;  2K02 A;  2GZW A;  3VSK A;  3L2R A;  3I64 A;  2ZNZ A;  3WU2 C;  2NVX J;  2RQP A;  4IJA A;  3S15 J;  1OPC A;  2QQ9 A;  5GAH J;  1T39 A;  1TWF J;  4JX4 A;  1V5G A;  2V26 A;  5E1W A;  5JHF A;  1YIT I;  2ZXJ A;  3QYB A;  1ONV A;  5HS7 A;  3OY9 A;  1XDS A;  1L3L A;  2LR8 A;  2VC1 A;  3AL0 C;  1NG6 A;  1IV8 A;  2JN6 A;  1IO2 A;  1ZG3 A;  2EB7 A;  4MEY F;  3W6V A;  2DJN A;  1R5G A;  4KIG A;  2JPB A;  5B5E C;  1MSF C;  4DW6 A;  1WH5 A;  2JQ7 A;  2O5R A;  3BPV A;  1X1B A;  5M5Y J;  4L5I A;  1BN5 A;  2KJB A;  1XMK A;  2A6T A;  3C3W A;  2P5L C;  3HRS A;  5EGO B;  3MKW B;  3F8M A;  4G7Z F;  3J81 Z;  2CFX A;  4DZJ A;  4M3G A;  4PDK A;  3MKZ A;  5EDN A;  2LRD A;  4UUS B;  1RPW A;  3GFJ A;  5LHH A;  1Q1H A;  3FMS A;  1FNN A;  3L1P A;  1X4P A;  5DCF A;  5ERI A;  1MMG A;  1LFB A;  4U87 A;  1YS6 A;  2G7U A;  2W24 A;  4ZDL A;  3VYU B;  3JRH A;  2ZO4 A;  1XTA A;  3JCU C;  3JRA A;  2VQH A;  3ZMT A;  2L9N A;  1N77 A;  3DLA A;  3FXR A;  1IRZ A;  2H1L A;  2P4W A;  4LMY A;  4EVI A;  3TO9 A;  3G73 A;  2TRT A;  3E97 A;  3OYG A;  2L9V A;  1GVD A;  4MFD A;  4XKC A;  1X3Z B;  5TJJ A;  5IT9 K;  3CZ6 A;  4CYD A;  3E5U A;  1GDT A;  3FM3 A;  3F21 A;  1A35 A;  3Q0W A;  4MQV A;  4FET A;  4XL9 A;  3CUQ C;  4L5E A;  4A3B J;  2WAE A;  3PIO F;  2VT2 A;  1GVJ A;  3M3Y J;  3MVP A;  4OAY A;  5B3S H;  3CP8 A;  3ELK A;  3OWT A;  1ETQ A;  5DYM A;  5LD2 C;  2NS7 A;  3RKW A;  1SC7 A;  3KEO A;  2PI0 A;  2VOP A;  1ETX A;  3OIQ A;  2P7C B;  1ZAO A;  1PJR A;  1W7P D;  5BQT A;  2QQA A;  1D0Z A;  2K85 A;  4FQG A;  1S5L C;  5KK1 A;  1D8K A;  4K2E A;  4BGD A;  1WI9 A;  4MQ9 F;  1BBY A;  4XON A;  4H0E A;  4IHX A;  2KKO A;  1JE8 A;  5DV5 A;  3DKY A;  2Y0M A;  4HBL A;  2H94 A;  1O3T A;  2DA3 A;  2HEO A;  4J01 A;  3HKZ N;  5DM7 F;  2B9S A;  3TDU C;  3DEW A;  1TNT A;  1ETY A;  1ETK A;  3F6O A;  1UHM A;  4LG0 A;  3RI4 A;  2WB1 N;  1HW2 A;  3ZQF A;  2CH0 A;  3IAM 2;  4M6X A;  1JUP A;  4BHC A;  3FMR A;  5HS9 A;  1R49 A;  1R4M B;  1JHH A;  5E3O A;  1Z05 A;  2W1O A;  1UCR A;  4CDG A;  5JLW A;  1K7A A;  2BV6 A;  4O5V A;  2HU9 A;  1LB2 A;  4HNU A;  4CCK A;  1MMD A;  1V55 H;  2ZB9 A;  5EYR A;  3BQZ A;  5CVV A;  1SFX A;  1IF1 A;  4MO7 A;  4KN7 X;  4C2U A;  3K2A A;  3IWZ A;  5D5U B;  3IHU A;  1QVU A;  1BM9 A;  3QPH A;  1ETV A;  5E18 F;  2K7L A;  1YG2 A;  2CV2 A;  1A6Q A;  3L2U A;  4HA8 A;  3GO5 A;  3NAR A;  3OYE A;  4ESJ A;  3MCZ A;  2H09 A;  3CTA A;  2KIQ A;  2X1E A;  3B6C A;  4IRI A;  2OU2 A;  2PEX A;  3K1P A;  3T8R A;  3MMY B;  2OJE D;  3AKZ A;  4A12 A;  4MTD A;  2R7W A;  2PMZ A;  2JA5 J;  4R8H A;  4GRI A;  3F72 A;  2H6B A;  2F4M B;  2CFO A;  2HOT A;  2MAB A;  1JGS A;  2PX9 A;  3GF2 A;  2VB6 A;  4ZZL A;  2MD5 A;  2NVY J;  2PJR A;  1P4W A;  4N4N B;  1TW3 A;  2YS9 A;  1J7K A;  3CCU I;  2OUM A;  2E5Z A;  1K79 A;  3WHC A;  4HNT A;  3QOE A;  4M3D A;  4BQN A;  2WY7 Q;  3D5L A;  4ESF A;  5JVT A;  3KEY A;  1J75 A;  2V9P A;  4HAM A;  2JVG A;  4ITV A;  4A5M A;  4DBQ A;  3H1C A;  1DDN A;  4C2T A;  2KHM A;  1UEL B;  5IP6 A;  1DPU A;  2BVM A;  2QLZ A;  3KZI C;  3VDX A;  2L7K A;  3DKX A;  1PUF B;  2HWV A;  2BW3 A;  4HQM A;  1IUY A;  3C18 A;  3U21 A;  5FKO A;  5FFX A;  3FWE A;  1R22 A;  2QBY B;  3GX4 X;  2QWW A;  5HNH A;  1XD7 A;  5FLV A;  2W4S A;  1K61 A;  2VKV A;  3HG9 A;  4AWX B;  1VQO I;  1IN8 A;  3C1D A;  3EUH A;  1VQM I;  4AU7 A;  5FLX K;  2M7A A;  4YG2 F;  5EG0 B;  1WQ2 A;  1W0T A;  2L2O A;  4BHP A;  3ABU A;  3FKI J;  4CHU A;  3EUH C;  3LST A;  4YRV A;  5J1U A;  5L3B A;  2GQQ A;  2CQQ A;  4AIK A;  3V7R A;  2CYY A;  5HNF A;  3BRO A;  2BEO A;  4XIC A;  1P92 A;  4NC6 A;  3AAF A;  2EIN H;  4PGG A;  4JX5 A;  1FYM A;  2LVS A;  1OFC X;  4Y3O A;  2EFW A;  2B0L A;  4U0V A;  3HOT A;  2L9R A;  2X6Y A;  3E5Q A;  4L9V A;  5ILV A;  1LJ9 A;  3KLN A;  3S17 J;  1R1U A;  3CC7 I;  4ZYG A;  1VQ6 I;  2NVT J;  4RDU A;  1XGO A;  2RNG A;  3RKQ A;  2FOW A;  1J5Y A;  1ZR4 A;  1QPM A;  1ZGA A;  3EUA A;  1RET A;  3BCA A;  3KLO A;  2ME0 A;  2X48 A;  1WJ5 A;  3RPU D;  1K78 B;  3G1O A;  3H9Q A;  4I7H A;  4A3D J;  2FQ4 A;  1F43 A;  1SFK A;  4F55 A;  2M8E A;  2NVQ J;  2ELK A;  4BKX A;  3VYT B;  3ABM H;  3QRF F;  2VJ5 A;  3HSF A;  1HA8 A;  5E17 F;  2HOA A;  4DNC A;  3CCY A;  5E20 A;  4XRS A;  3M1E A;  1OCO H;  3GME A;  1KQ8 A;  1OMI A;  4XLP F;  1MMS A;  4CGZ A;  4GFB A;  3CO7 C;  2DPD A;  4HQE A;  2LBF A;  5K7Z A;  3BR3 A;  5FRN A;  2DXI A;  1A36 A;  2DFH A;  2NVU B;  2WA0 A;  5K7H A;  4PK4 A;  3DBL B;  1Z6T A;  2NNY A;  2XGX A;  1FYK A;  2O61 A;  2X1D A;  5EZG A;  1T56 A;  5CYV A;  2HVQ A;  2DOE A;  4L9N A;  3BR6 A;  4BBR J;  1SAX A;  4KMF A;  3DCF A;  2O8K A;  4A5N A;  1V5F A;  2DW4 A;  3KIO A;  2E19 A;  1KQ0 A;  2KZG A;  4BBS J;  4LG3 A;  3DEE A;  1MJA A;  2CU7 A;  2W85 A;  1RR8 C;  5KNL A;  1VQP I;  2ESH A;  2VUM J;  1TNS A;  5KAI C;  4QLC U;  1R9T J;  2M0M A;  3ZMU A;  5FRM A;  3S2D J;  3WTY C;  3HXL A;  4FX0 A;  4NC8 A;  1ULY A;  4MLO A;  1Z21 A;  1W1W E;  2BVL A;  2A61 A;  1YW7 A;  4XKW A;  1J09 A;  2FQ3 A;  2Y0S N;  4E7Z A;  1RI7 A;  1G3Y A;  2V6C A;  3H3U A;  1WJD A;  1IV6 A;  5EF6 A;  1X19 A;  3SEQ A;  2CV1 A;  1R71 A;  1NTC A;  2DJI A;  4C3H J;  4FE4 A;  1ZEL A;  1BOB A;  3ONQ A;  4ZYA A;  4MEX F;  2M45 A;  3CC4 I;  4BAY A;  4NB5 A;  3JAM Z;  3V8K A;  2AS5 F;  1AU7 A;  4A0Z A;  2HTJ A;  1BI3 A;  4HF2 A;  4IQJ A;  2GM4 A;  1F1Z A;  3EET A;  1KU3 A;  3DTI A;  3H92 A;  1DU6 A;  2DOD A;  3FMQ A;  2PG4 A;  1HDD C;  1OCT C;  2LC2 A;  4QWQ A;  4BNC A;  4WXD A;  3W3C A;  1YLF A;  1VQ5 I;  1PYV A;  2E5N A;  4ENK A;  4M3E A;  1ZAR A;  1MSE C;  2FML A;  4A3F J;  1W4M A;  4XRF A;  2FBI A;  1IRF A;  3GLL A;  2P0W A;  1FX7 A;  3DU5 A;  2RN7 A;  1ORK A;  3A0H C;  4M73 A;  4CCO A;  5ILS A;  1LNW A;  3WTT C;  1DUX C;  4IXA A;  1QZY A;  3B73 A;  2XRO A;  1D8J A;  4ZYD A;  3JRF A;  2HQR A;  4ENJ A;  1NG7 A;  3R0A A;  1MNM C;  5A2Q Z;  3QOP A;  2LH9 A;  4CIC A;  3HYI A;  4RB1 A;  3ABL H;  2BYV E;  1XPX A;  1YO5 C;  4G7H F;  2ZSH B;  3F23 A;  2XAG A;  3O8H A;  1UST A;  2HPM A;  1FT9 A;  4XID A;  4U7B A;  2CMP A;  3MZH A;  3X2Q H;  3BJA A;  2LK2 A;  2LYC A;  3GBG A;  3S32 A;  4F91 B;  1IC8 A;  5AON A;  1GUU A;  3WTX C;  4KDP A;  2UV1 A;  2VE9 A;  4ZDO A;  2A6E F;  2PJR B;  3H9G A;  1D1A A;  4A6D A;  3QYF A;  2DQL A;  3AG2 H;  4A3I J;  3J7Z I;  5DCM A;  3TGN A;  4C3I J;  1QO0 D;  1FMW A;  3DQV C;  4EM2 A;  3N4M A;  1Y1W J;  3O3K A;  2UZK A;  1ZKG A;  4UHT A;  1IXR C;  2L3D A;  2NNN A;  3LQQ A;  3SFI A;  1H9G A;  9ANT A;  4KIC A;  2CW7 A;  2BY3 A;  1OCZ H;  3TOB A;  2DFF A;  2OAZ A;  3OYF A;  1S6L A;  2HPI A;  1QRY A;  1O3Q A;  2MGQ A;  3HOY J;  4C3J J;  1EH6 A;  4YEJ A;  1XC5 A;  2BW3 B;  1XSD A;  1FBS A;  4IPA A;  4XOT A;  4XRS G;  5F04 A;  5IOY A;  1ACI A;  1S3J A;  2KLO A;  3PJR A;  2DOA A;  5LBQ A;  1KYW A;  4IL6 C;  4AUX A;  4YII A;  4XQF A;  2KQR A;  2QGU A;  1FYL A;  5C4X J;  4C30 A;  3N05 A;  1GHC A;  3SHF A;  1JUM A;  3W2W A;  2RAE A;  3KP7 A;  3BR5 A;  1SD4 A;  1NK3 P;  4B8X A;  5E8G A;  5CPR B;  3KP5 A;  3QWL A;  2PN6 A;  3WTS C;  4OU0 A;  3I3L A;  4PJM A;  2DA7 A;  5HLI A;  1VFC A;  3PFI A;  4B3X A;  2GAU A;  3HGG A;  4XKB A;  2JJ7 A;  3SDB A;  4OIO F;  2Z2S B;  5J3L A;  4L18 B;  2DO7 A;  4TV7 A;  2IAI A;  5L3G A;  2F5C A;  3ABK H;  5L3D A;  3K1N A;  3HIF A;  3RKX A;  3PO2 J;  2E2I J;  3GTG J;  3D0S A;  1U9N A;  5D6F A;  2F5E A;  3K4L A;  1UAA A;  3RQ4 A;  1WJC A;  1ZGJ A;  2XVC A;  1B72 A;  3ISP A;  1WJE A;  3VPR A;  3KYL A;  1KU2 A;  2DCE A;  4LB6 B;  4EGY A;  1KQ9 A;  1YQA A;  1SD7 A;  2CQ7 A;  2M0C A;  4F93 B;  2KMU A;  1Z6R A;  2GA2 A;  1P4X A;  4KN4 X;  2O6G E;  5FJ8 J;  2DFE A;  2DMT A;  2DMP A;  2LBF B;  1WSU A;  2R0Q C;  1SAU A;  3J80 Z;  4BE0 A;  2E1M B;  3FXM A;  4P5O A;  2GXG A;  3KZZ A;  5JLX A;  4XKV A;  1T8I A;  4AYB N;  1P7I A;  6PAX A;  2V9V A;  3BR0 A;  5HLG A;  3PQJ A;  4HSR A;  1UMQ A;  3WG9 A;  1QPI A;  2IS1 A;  3COA C;  2K40 A;  2QYO A;  1R36 A;  2XV4 S;  3DV8 A;  3HEF A;  1WI3 A;  3E6B A;  5BS6 A;  4KT6 A;  2L4M A;  2VE8 A;  5J1R A;  2M1B A;  5LEJ A;  3H5R A;  1D0Y A;  4OMY A;  3BZK A;  3OIO A;  2YUS A;  5HOO A;  5K5R A;  4A2U A;  3Q9S A;  3F8B A;  3L2W A;  1V4R A;  3H3Z A;  3REO A;  3GYH X;  2V1N A;  4XOR A;  3S2H J;  2VQC A;  3G3Z A;  2DLL A;  2XAH A;  3DWL E;  1MBF A;  2Y9Y A;  2JWT A;  4N4O B;  4RM2 A;  3C7J A;  3ABT A;  5J47 A;  2IPQ X;  4EJU A;  1Z91 A;  2ETH A;  1FY7 A;  4E7I A;  1BJA A;  1B1B A;  2HTS A;  2R7U A;  2ELH A;  3BQY A;  3K10 A;  3ZQI A;  2BGC A;  2Y9Z A;  3CCL I;  2LP0 A;  4ENM A;  4PFP A;  3QP6 A;  1PP7 U;  3PL8 A;  1VQ9 I;  2Q8K A;  2DK5 A;  4Y15 A;  4U0W A;  5DS9 A;  4J19 A;  3I59 B;  5F1R A;  4HF1 A;  1VI0 A;  1BI1 A;  1C0W A;  4PJL A;  3E3V A;  3ZP5 A;  3BY6 A;  4QSH A;  5CVU A;  4G94 A;  1QZE A;  4YEL A;  4X0G A;  1IRX A;  4BDZ A;  3OR2 C;  3T1B A;  3GTJ J;  3WE2 A;  3OSG A;  4ZTF A;  3F8N A;  2MFZ A;  1G6N A;  1R6R A;  2DDA A;  2M34 A;  4H4K C;  2DT7 B;  3H9J A;  4ENN A;  3BTI A;  4NC7 A;  2DT5 A;  4FE7 A;  3G4S I;  3TMO A;  3GTQ J;  2EBI A;  3OV8 A;  4UUT A;  1RNL A;  2L7M P;  3LA3 A;  3CJR B;  3MZY A;  3RSN A;  3BPX A;  4BQO A;  3FZV A;  1ODD A;  4Q48 A;  5D4R A;  4EEF G;  4G6T B;  3CCR I;  2X85 A;  4LLL A;  2ACJ A;  4KIT B;  2JK3 A;  4EM0 B;  4UB6 C;  1ZRF A;  4D9J A;  1JI8 A;  1JKQ C;  1TBX A;  3BR1 A;  1XSV A;  4EM1 A;  3F22 A;  3H3V K;  2PMU A;  1W5T A;  3K0L A;  5LRR A;  2DFI A;  2N8G A;  3RYR A;  3L00 A;  3FF5 A;  1A6I A;  3HKZ A;  2LKX A;  2K9L A;  1BL0 A;  4BAC A;  1AKH A;  2WB1 A;  3HOZ J;  1YS7 A;  3EDP A;  3MEX A;  2JZY A;  4WXH A;  2DOF A;  5DCM B;  4A3E J;  2IBD A;  4KT5 C;  1FZP B;  2HQA A;  3VYR B;  3I53 A;  2XF6 A;  2VBZ A;  5C4J J;  2NXN B;  3LQR A;  2HNH A;  3MAJ A;  4MNU A;  4EJV A;  2F2E A;  1ON1 A;  2CUE A;  3I54 A;  1LFP A;  4NNJ A;  4D0P A;  5E1X A;  3WGH A;  2GIZ A;  2VLA A;  4NHJ A;  1A5J A;  3NAU A;  2YR2 A;  1OJL A;  5CVI A;  2CO5 A;  2FNP A;  3RKY A;  4BS9 A;  4PJN A;  3CUQ A;  1NH3 A;  2JA2 A;  1XS9 A;  4WCG A;  1R00 A;  3ZQH A;  4PGH A;  3WE3 A;  1TT5 B;  1RIO H;  3OOP A;  5JR3 A;  1JKO C;  5IPA A;  3I0T A;  2LSO A;  4FHT A;  3TP3 A;  2R5Z A;  1P2F A;  4BE1 A;  1O3S A;  4LJZ F;  1SAN A;  1IN7 A;  3I4N J;  2L5Q A;  2WV1 A;  4HRI A;  3P5J A;  2QSG X;  1BR1 A;  2ZXH A;  3JRB A;  4P1W A;  3TW6 A;  3EQL F;  2MC3 A;  3BLY A;  2Z99 A;  2ISZ A;  3VYS B;  3NRV A;  4FCY A;  1QZZ A;  1YYV A;  1UB9 A;  1Y8Q B;  2JMW A;  2LY2 A;  2MA3 A;  2WWY A;  1K4T A;  4JX6 A;  2CW8 A;  2HVS A;  2MW8 A;  3DBH B;  2BXZ A;  1XGM A;  2DK8 A;  2W82 A;  1W36 D;  1DGW Y;  2EK5 A;  2ZC2 A;  3IUO A;  1H0M A;  2HXI A;  1NK2 P;  3BZC A;  2XGC A;  1ZG5 A;  4ZZD A;  2L0K A;  5FKN A;  2DA1 A;  2R3S A;  1A31 A;  4XBF A;  2R7D A;  3JRE A;  3E0J B;  1KA8 A;  1G59 A;  2K3F A;  1Y56 A;  4G9Y A;  3TBI A;  3ZQG A;  2LD5 A;  3H35 A;  2MG4 A;  3OYB A;  2ISY A;  1B72 B;  1QBJ A;  1B59 A;  4DOZ A;  1VQL I;  2H6C A;  1E0E A;  2BOL A;  3BG3 A;  3M7G A;  3MN2 A;  3LAP A;  3DPU A;  1O4X A;  4G6Q A;  1MMN A;  1LDK B;  2GWR A;  3NEU A;  4I99 C;  4G7O F;  2STW A;  3HBL A;  3Q5F A;  1WJA A;  2OTL I;  4WXC A;  2WY8 Q;  3SJM A;  2X6X A;  3GTK J;  1S7A A;  2K27 A;  3WOD F;  4QIW N;  1H8A C;  2IS6 A;  1MH4 A;  5F6F A;  3OYH A;  3A4C A;  2VOD A;  2R5Y A;  3OYK A;  2W00 A;  1U8R A;  3K4N A;  3HOX J;  4A3K J;  3FK6 A;  4E6K G;  3U2R A;  2DTR A;  4A69 C;  5BMZ A;  2PMH A;  3F9K A;  3ZMV A;  2OQG A;  3NWS A;  1R4N B;  2CRG A;  2W25 A;  2XKP A;  4P9F A;  3KP4 A;  1JKP C;  4XLC A;  2IGK A;  2NOG A;  5JFR A;  1U8B A;  1AA7 A;  4ZJZ A;  2K9Q A;  3PNY A;  3K4B A;  4IOC F;  1LQ1 A;  2IS2 A;  3SXY A;  3HOV J;  3CME I;  1G3T A;  2E1C A;  2V7F A;  4EQQ A;  5LHG A;  4Y52 J;  1TWA J;  2DMQ A;  3HRT A;  2L7Z A;  4MIM A;  2LDU A;  2JTV A;  3V8L A;  4B3A A;  2EFN A;  3ECH A;  3LL7 A;  1R1V A;  4HPQ A;  2M30 A;  5FO5 A;  3VOE A;  1X58 A;  4ASN A;  1OYI A;  1SMT A;  3F3X A;  1FTZ A;  3GFM A;  4CUG A;  2MYS A;  1J2X A;  3SZP A;  2EFP A;  4ZTJ A;  3HRU A;  2IGM A;  1T0F C;  5AIQ A;  1QHH D;  4AC0 A;  1I5Z A;  1FP2 A;  3RJP A;  4R79 A;  1ETW A;  1VQ8 I;  4LGW A;  4M72 A;  1TWC J;  3RTR A;  4OIP F;  3ZQL A;  3HUG A;  1WKM A;  3AG3 H;  3QQA A;  3LSG A;  5LGT A;  4RGX A;  1Z3Y A;  3R0J A;  2Z16 A;  3BT9 A;  4RAG A;  3V4G A;  1YX5 A;  3DEU A;  2HR3 A;  3L09 A;  4XLA A;  4I98 B;  3SYT A;  1FIA A;  2OZU A;  4DYR A;  4A0X A;  3BTL A;  3U9G A;  3MKL A;  1XMA A;  2QKM B;  1WGX A;  4BUP A;  4OOI A;  4XOP A;  1R23 A;  3I58 A;  1WJB A;  3E5X A;  3WU0 A;  2BE5 F;  3CLO A;  3FBI B;  1NHA A;  5JVG F;  1MBJ A;  2OQR A;  2QSH X;  2Y75 A;  3IP4 B;  3H5A A;  1FJL A;  3DBR B;  1W0U A;  2R7S A;  2KFD A;  3T0Y A;  2CS3 A;  3J81 K;  4XLE A;  2FUG 2;  2HI3 A;  4OWR B;  4BQQ A;  1OKR A;  1Z67 A;  2E35 A;  4E7J A;  4E7S A;  3AL0 B;  2M87 A;  5FB2 A;  1Z77 A;  2K4J A;  5DUK A;  3BG7 A;  3RQI A;  3ZCO A;  3DU6 A;  5ICE A;  4PJ0 C;  1T08 B;  1H88 C;  2JUC A;  4HV5 A;  4M3F A;  2LKP A;  3F0C A;  3BG5 A;  4BDY A;  3R4K A;  5B66 C;  5DM6 F;  2X4H A;  1XCB A;  3VB2 A;  4BH9 A;  1QGP A;  2Y0S A;  2PJP A;  1AKH B;  3LSM A;  4NBQ A;  3P9K A;  3ZOB A;  4F3Q A;  2XF7 A;  1EH8 A;  2V9K A;  2Y31 A;  2ZJ2 A;  3PIP F;  3A01 A;  3S1R J;  4A6E A;  1IJW C;  2HDC A;  1B4A A;  1SMY F;  2A5W A;  3GEZ A;  1BC7 C;  1ZK8 A;  5J40 A;  3KYD B;  2Z3Y A;  3OR1 C;  2ZBK A;  2FU4 A;  1LFU P;  2VPR A;  4IOA F;  1O3R A;  3KPH A;  2I8D A;  1TQP A;  1UHW A;  5LGU A;  1CF7 A;  1REP C;  4UV8 A;  3GCM A;  1WPK A;  5KHD A;  2CJJ A;  4D7M A;  4XN3 A;  1YI2 I;  4ZC3 A;  1FEX A;  2Y48 A;  3CUQ B;  4HLX A;  4KFC A;  5CVJ A;  4CSW A;  5KVR A;  2HXO A;  1YHQ I;  2A69 F;  2NOJ B;  2Q2E A;  5DUI A;  2D1H A;  2DI3 A;  4JOM A;  5FKL A;  2P81 A;  3I71 A;  3P9C A;  3ZN1 A;  2KT0 A;  4E70 A;  3OS0 A;  1FTT A;  2R5Z B;  1QA6 A;  2P6S A;  2IA2 A;  3FXK A;  1JJ8 C;  2BHZ A;  3GW2 A;  4P55 A;  4IZZ A;  1Q1V A;  3JTH A;  2HVR A;  2VOO A;  1RUO A;  2L7F P;  5DD4 A;  5AIP A;  2EIJ H;  1OYY A;  4E7L A;  5LHI A;  4I01 A;  5H6R A;  1Y8R B;  2DT6 A;  4E4H A;  2XRN A;  1PDN C;  3AG1 H;  3E7L A;  4XLF A;  2E1N A;  3WG7 H;  4M6Y A;  4AD9 A;  3HTS B;  2KL4 A;  3S2W A;  4KIS A;  4A3L J;  2VPL A;  3W6J B;  1J59 A;  2Q0O A;  5HDK A;  1EV7 A;  1XGN A;  5FLM J;  2EIM H;  3ZXS A;  2A6H F;  3M9A A;  3OL3 A;  2FEZ A;  2Z5U A;  3K6G A;  3GFL A;  1VF9 A;  2L02 A;  4D5F A;  4LG0 B;  3EPZ A;  1FBQ A;  4XLH A;  4QPO A;  2UXX A;  3BCB A;  4F92 B;  2HS5 A;  4IF4 A;  4GO1 A;  1BW6 A;  4II2 A;  4IHY A;  4IKF A;  3RDI A;  1RUN A;  1YRN A;  2HGC A;  2FE3 A;  3M4O J;  3KP3 A;  3S14 J;  2COM A;  3I4P A;  2CWE A;  2R7Q A;  5D5X B;  3MD2 A;  1HC8 A;  1U5T A;  3HHH A;  4LLN A;  3S1Q J;  3KE2 A;  1IXS B;  2H8W A;  3CC2 I;  1S7O A;  5C44 J;  2D1V A;  1U5T C;  4RGR A;  5GTH C;  1VZ0 A;  1MBK A;  1UFM A;  4U88 A;  3GTO J;  2DU9 A;  4XR6 A;  2QCO A;  2QEN A;  1Y0N A;  1ZR2 A;  5J4Y A;  2M9H A;  3DKW A;  4NQW A;  1WZ2 A;  4I76 A;  3MFK A;  3RZO J;  2WAF A;  2ZJQ F;  4RAY A;  1EF4 A;  1U3E M;  2B63 J;  4CXF A;  5CQG A;  4RLF A;  5FKK A;  1P6R A;  4FX4 A;  1OYW A;  1ZLK A;  1U9O A;  3VWB A;  2MSY A;  2R5Y B;  1XSX A;  4ZYE A;  2QEX I;  3KEQ A;  4JP0 A;  2IA0 A;  1IG7 A;  3GZ6 A;  3GTM J;  3HC7 A;  3HPH A;  4HX7 A;  4A0Y A;  3HDD A;  5DEQ A;  2CUZ A;  1FOY A;  3S3N A;  2CSO A;  2BY2 A;  2EQR A;  2JT1 A;  1YIJ I;  2NS8 A;  3Q3S A;  1WJF A;  3V7S A;  1TL8 A;  2GOM A;  3FX3 A;  1R5H A;  2RQQ A;  3GLX A;  3HSE A;  5DTD A;  1X1A A;  5J8F A;  1X1P A;  1K6Y A;  3P9I A;  1LE8 A;  1QHG A;  4BHB A;  4D5C A;  3JRI A;  4GYG A;  3EYY A;  3A03 A;  2AHQ A;  2HZT A;  4S04 A;  1SFO J;  2L01 A;  1T33 A;  3FK7 A;  2DQR A;  5GAG J;  1EJ9 A;  2IA1 A;  4HW0 A;  2EPF A;  3ECO A;  3SZG A;  5IYC J;  1ZH5 A;  3F8C A;  1HQC A;  2ECB A;  3Q0V A;  2WTE A;  1BA5 A;  2AXT C;  2EZL A;  5IYB J;  1OCR H;  2KIF A;  3IRQ A;  3GTP J;  2R7F A;  3IWF A;  2R7T A;  2P5K A;  1UG0 A;  4AM3 A;  3HUG B;  4EAT A;  3PUF A;  4YFK F;  1FMV A;  3CMA I;  3LAJ A;  1S72 I;  1MBH A;  2F4I A;  2GXB A;  3CDL A;  3WGI A;  3ASO H;  3JSP A;  2VKH A;  3C2H A;  5E8I A;  3O8G A;  4M6V A;  4Y33 A;  1IRG A;  2E34 A;  5M5X J;  3DP7 A;  1CQT A;  3QU6 A;  5M3F J;  2YPR A;  1ON2 A;  3D5S C;  1ZLJ A;  1HBX G;  3K4C A;  5FFZ A;  2ZNY A;  3KCC A;  1S7E A;  2X1C A;  2O0Y A;  2DA2 A;  4YIF A;  4AYB A;  1J9I A;  4KJZ A;  4A3C J;  4DQ2 A;  3NWT A;  2MD0 A;  3LMM A;  2EA2 A;  5EEG A;  2VJ4 A;  3FKJ A;  4RA2 A;  1YW9 A;  3ESW B;  1YW8 A;  3WTU C;  5CLS A;  3L9F A;  1Z7L A;  3OL4 A;  4RS8 A;  2VQL A;  2EV0 A;  3G1M A;  1Z1D A;  2EIK H;  2OPT A;  2XIG A;  4HX8 A;  3M8E A;  1BR4 A;  1EH7 A;  2OZ6 A;  4HLY A;  3HSR A;  5GAE J;  3BOQ A;  2CUF A;  2X0L A;  1HW5 A;  5F1J A;  1P9Q C;  1LVK A;  1G2H A;  3FXL A;  4MHG A;  5LLQ A;  1D0X A;  4XMY A;  2OA4 A;  4AVZ A;  2O03 A;  1GV5 A;  2O3F A;  2E36 A;  4I02 A;  1R1T A;  1VTN C;  2PQ8 A;  2JA7 J;  3DLL F;  3E1S A;  2D2W A;  3H36 A;  1I1G A;  4Z2Y A;  3W2A A;  3H5N A;  2RC4 A;  1XMX A;  3DXJ F;  3PNV A;  1TQM A;  2KIU A;  3MKY B;  3M1C A;  4UVC A;  1SVL A;  2KRH A;  4OIR F;  5J4V A;  3A01 B;  2HOS A;  5D8L B;  1LEA A;  5IT9 Z;  3G1L A;  3U1K A;  3OYJ A;  3CJN A;  1S29 A;  3OYC A;  3LSI A;  2E71 A;  4RMN A;  4RBO A;  4BU2 A;  1SD6 A;  4PFO A;  1HSJ A;  4LFU A;  1Y6I A;  2ELJ A;  1ETO A;  2YX7 A;  3PQK A;  2LY9 A;  2DPU A;  1DU0 A;  4LIT A;  3L2C A;  3KFW X;  2X6O A;  3EUK L;  4N9H A;  4BL0 B;  1CF7 B;  3S8P A;  3OS2 A;  4LK0 F;  3B02 A;  3FHZ A;  3DTE A;  1DPR A;  4NUB A;  5IOZ A;  2CUJ A;  5GAD J;  5F0C A;  2Q2E B;  5BNG A;  2K9S A;  1GLN A;  2GBY A;  1HKS A;  3HOS A;  5KAF C;  2FBK A;  4N0B A;  2ID3 A;  2A07 F;  4AVP A;  2LFB A;  3QPT A;  1POG A;  1YTY A;  2R7X A;  2MC4 A;  5F0H A;  1I6H J;  2QQ8 A;  3JAM K;  3K4J A;  3IRR A;  4EJT A;  1XN7 A;  4C2M J;  1G3W A;  1DQU A;  4KYW A;  2MH2 A;  1YE9 A;  2VIX A;  2M2E A;  1ERD A;  1R5I D;  4B47 A;  2DA6 A;  2WAQ N;  4Y7N J;  4Y4R A;  4ETS A;  3TOA A;  1LKX A;  2JSC A;  2XAS A;  4G12 A;  1ZQ3 P;  1D1B A;  4N9I A;  4Q4Z F;  2VBW A;  1YJW I;  2H1K A;  5FD5 A;  1ITY A;  1BC8 C;  2HOE A;  2ZFU A;  3MQ0 A;  3LFK A;  2LTP A;  2F6C A;  2STT A;  3JRC A;  1S8N A;  3K70 C;  3F6V A;  5D6E A;  3GZ5 A;  2WC2 A;  3S1N J;  5TRD A;  5LGN A;  1O7L A;  2XGE A;  2GLO A;  1QNT A;  1DP7 P;  1HXD A;  1WFX A;  1SVO A;  5EJC A;  3CMM A;  3M8J A;  3KZY A;  1YRN B;  2COB A;  1X3W B;  1MGT A;  2KZV A;  3K69 A;  4ABZ A;  1FSH A;  1U5T B;  2FOK A;  1MBG A;  3BG6 A;  4CH7 A;  2ECC A;  1V54 H;  2G0E A;  5A2Q K;  1MBE A;  1TT0 A;  3BP8 A;  3HOW J;  2A05 A;  2NYX A;  2Y2Z A;  5IT3 A;  1D1C A;  2RVC A;  3D5R C;  2OTJ I;  2CQK A;  1DGR M;  4NQW B;  1RR7 A;  5BPD A;  1TLH B;  4D1Q A;  3HRM A;  4BXX J;  1I6X A;  5F0F A;  1FOW A;  4MGR A;  5GPA A;  2FNA A;  4FAS D;  4YFN F;  4UY8 I;  3GFI A;  4Y13 A;  4KMU X;  3OYN A;  2ZXW H;  3K4M A;  1QU3 A;  1Y0U A;  2QSF X;  3B6A A;  2A5Y B;  4I0A A;  4MFE A;  4A3J J;  1JTX A;  2M4K A;  4G8X A;  5FKM A;  4IEJ A;  4RM3 A;  1I39 A;  2P7V B;  2R7R A;  4HF0 A;  2QVO A;  2RKH A;  1BR2 A;  2HYG D;  4W97 A;  3RIR A;  1T95 A;  4FT8 A;  3JR9 A;  2HKO A;  2XC7 A;  1XG1 A;  5HLT A;  2NS0 A;  3ZQQ A;  4XK4 A;  4O6J A;  3HTU A;  3TO7 A;  2DMU A;  3FXO A;  3QP5 A;  3J7A Y;  2RNJ A;  1YJ9 I;  2RV8 A;  3HGY A;  4M9X A;  3TO6 A;  2JPC A;  2ME6 A;  4M71 A;  2XPV A;  2FXA A;  3FXJ A;  1FIP A;  1EKE A;  1E3H A;  1FSE A;  2EA4 A;  1D5Y A;  3EYI A;  3RZD J;  1LE8 B;  1OR7 A;  2W48 A;  2X9D A;  2XUB A;  4BY7 J;  3SZT A;  2FX0 A;  2H27 A;  1WHU A;  5LEK A;  1OR7 C;  5ICF A;  5ED4 A;  1IW7 F;  3KP2 A;  4HZF A;  4C9Y A;  3U1D A;  4E7H A;  4V2F A;  2CV0 A;  4DYC A;  4HV6 A;  1KU9 A;  1PVE A;  2K4B A;  1FOX A;  2A3S A;  3J7Y J;  2KRC A;  5IYD J;  3J7A O;  1IN4 A;  2ZME A;  5FLX Z;  3SEZ A;  3BG9 A;  3GVA A;  2DAO A;  4RAZ A;  2ZME C;  2OV7 A;  1I50 J;  1T38 A;  1K78 A;  2KDZ A;  1YX3 A;  2R4G A;  5KCM A;  1W5C C;  1RKT A;  2VT3 A;  3QOD A;  5M5W J;  2LMD A;  4G6D A;  4LIV A;  5EZH A;  2XAF A;  4RGS A;  1W5S A;  3E6D A;  1IXC A;  2MH9 A;  4WWC A;  2K9N A;  2OF7 A;  5JHU A;  2Z1D A;  1E2X A;  3MZ8 A;  2ZCW A;  2LY1 A;  2FMY A;  2FD5 A;  1BIB A;  2QA4 I;  2R92 J;  1UJ8 A;  4IX7 A;  2DA5 A;  5E3N A;  3K1M A;  3V42 A;  3IL2 A;  4CZC A;  5ILU A;  1USS A;  1IN6 A;  3A2K A;  2FJ1 A;  3FBN B;  1I3Q J;  2XPW A;  5L3F A;  3LA7 A;  4DGW B;  5HOD A;  1HST A;  4HG2 A;  2XGD A;  2VBY A;  2W57 A;  4ESB A;  3BTJ A;  3LA2 A;  5HDG A;  5F08 A;  1PUE E;  1FC3 A;  5K7F A;  2EH3 A;  1R7J A;  1KYZ A;  1MIJ A;  4UVB A;  2R7Z J;  3J80 K;  4OIN F;  2NAZ A;  3QPS A;  4YIR X;  3CF5 F;  2XAU A;  4HYE A;  5LRS A;  4L9T A;  1MNE A;  1JHF A;  3ZMD A;  1FBU A;  3I4M J;  3BZ6 A;  5K1Y A;  1B8I A;  2LF7 A;  3OYD A;  4PSW A;  2V6E A;  3TL4 X;  3CCQ I;  3ZGK A;  2FSW A;  3BR2 A;  1LPQ A;  2Q1Z B;  2XKO A;  1FP1 D;  2VN2 A;  3FIW A;  3KYC B;  3L7W A;  1AOY A;  2QKL B;  3CP2 A;  1V3F A;  3HL2 A;  3PSI A;  2IVM A;  2HYF A;  1W7P A;  2M5W A;  4BJ5 C;  3H0G J;  3G71 I;  1FPQ A;  4II3 A;  5L3E A;  2JRM A;  2YSR A;  4GYI A;  3FDY A;  3PM1 A;  4XSZ F;  1K6O A;  3W6K B;  3KP6 A;  2R93 J;  1OIS A;  2M7B A;  4GDF A;  4WX9 A;  2O8X A;  1JJ6 C;  1ZN2 A;  1OCC H;  3RCO A;  1IN5 A;  4WF2 A;  1KGS A;  2HYJ A;  4L5J A;  2C6Y A;  1T2K A;  1U2W A; 
#chains in the Genus database with same CATH homology
 2XB5 A;  3BR5 A;  3E7L A;  1TWH J;  5EG0 A;  1NK3 P;  4A3L J;  1OCP A;  2NVX J;  3S15 J;  4CYC A;  1IDY A;  5FLM J;  1TWF J;  4FIS A;  4JX4 A;  2DA7 A;  1VFC A;  3S1M J;  1VF9 A;  2DMN A;  3HGG A;  2JJ7 A;  2LR8 A;  4D5F A;  5J3L A;  2JN6 A;  2IAI A;  5E3L A;  3W6V A;  2DJN A;  4HNV A;  1JT6 A;  1MSF C;  4IHW A;  4IHY A;  1BW6 A;  1WH5 A;  4DW6 A;  5M5Y J;  1YRN A;  3PO2 J;  2E2I J;  3M4O J;  3S14 J;  3GTG J;  1U9N A;  5EGO B;  1TWG J;  2EZI A;  1MH3 A;  2XSD C;  3S1Q J;  4DZJ A;  4M3G A;  3Q0U A;  5EDN A;  4UUS B;  1RPW A;  5C44 J;  1B72 A;  3VPR A;  3L1P A;  4I6Z A;  3GTO J;  1MBK A;  1E3O C;  2QCO A;  3LSP A;  1LFB A;  1ZR2 A;  3JRH A;  2M9H A;  3JRA A;  2M0C A;  4I76 A;  3RZO J;  3CMY A;  1IRZ A;  1EF4 A;  5FJ8 J;  2DMT A;  2TRT A;  2B63 J;  1HOM A;  2DMP A;  1GVD A;  5FKK A;  2DTZ A;  2R0Q C;  4MFD A;  1U9O A;  2MSY A;  1GDT A;  2R5Y B;  2DN0 A;  5JLX A;  4JP0 A;  3Q0W A;  1IG7 A;  3GTM J;  4AYB N;  1P7I A;  3IH4 A;  4L5E A;  1U78 A;  3BR0 A;  1HLV A;  4A3B J;  3M3Y J;  1UMQ A;  3MVP A;  1QPI A;  2EQR A;  3OOU A;  2K40 A;  2NS8 A;  1ETQ A;  3Q3S A;  3HEF A;  1WI3 A;  2NS7 A;  3TW7 A;  3LSR A;  5J1R A;  3OIO A;  4LOC A;  1ETX A;  2YUS A;  5DTD A;  5IP7 J;  4M3B A;  2XB0 X;  1LE8 A;  4D5C A;  3JRI A;  3S2H J;  1JKR C;  4IHX A;  3A03 A;  2AHQ A;  1SFO J;  1MBF A;  2O9L A;  1T33 A;  2Y9Y A;  3FK7 A;  2JWT A;  2PMZ N;  2DA3 A;  5IYC J;  3HKZ N;  3HM5 A;  1X2M A;  2ECB A;  3Q0V A;  2E2J J;  3DEW A;  1ETY A;  2EZL A;  5IYB J;  3LNQ A;  1BA5 A;  1ETK A;  1HDP A;  3GTP J;  2WB1 N;  3ZQF A;  1JUP A;  2Y9Z A;  3BQY A;  3ZQI A;  4S0H B;  2IEK A;  2LP0 A;  1MBH A;  5E3O A;  5DS9 A;  3CDL A;  4J19 A;  4DZP A;  1VI0 A;  2O7O A;  2AO9 A;  3O8G A;  4M6V A;  4DYQ A;  1IUF A;  5M5X J;  4QSH A;  2QF7 A;  3JRD A;  2EZH A;  1CQT A;  5JLW A;  5GPC A;  5M3F J;  2JA8 J;  3GTJ J;  3OSG A;  5F27 A;  2M34 A;  1JUS A;  1S7E A;  3BTI A;  2ZB9 A;  2DA2 A;  5EYR A;  2YU9 J;  3BQZ A;  4B1R A;  4FE7 A;  4A3C J;  4MO7 A;  3GTQ J;  2EBI A;  4UUT A;  3K2A A;  5J1Y A;  2L7M P;  1QVU A;  1ETV A;  3G1M A;  2OPT A;  4EEF G;  3OSF A;  2JK3 A;  3NAR A;  1ZTR A;  2CUF A;  1VND A;  1X2N A;  3B6C A;  5F1J A;  1JKQ C;  3TED A;  1G2H A;  3BR1 A;  3IH2 A;  2M8G X;  3H3V K;  1GV5 A;  2JA5 J;  2N8G A;  4FTH A;  1A6I A;  3K7A J;  2HOT A;  2JA7 J;  2HQ5 A;  2LKX A;  4W1U A;  1IDZ A;  1BL0 A;  1AKH A;  3LOC A;  3HOZ J;  2NVY J;  4A3E J;  2IBD A;  2YS9 A;  3FIS A;  3A01 B;  1B8I B;  2HOS A;  1UG2 A;  3G1L A;  3WHC A;  5C4J J;  4RBO A;  4M3D A;  1ZGW A;  1GT0 C;  1ETO A;  2LY9 A;  1DU0 A;  2HDD A;  3SDG A;  2X6O A;  1BW5 A;  2CUE A;  1A5J A;  5IP6 A;  2XPU A;  3NAU A;  5IOZ A;  1OJL A;  5F0C A;  1PUF B;  5BNG A;  2K9S A;  1XS9 A;  3IH3 A;  1RES A;  2GBY A;  4QTR A;  3ZQH A;  5FKO A;  2ID3 A;  1JKO C;  2LFB A;  5IPA A;  1POG A;  3TP3 A;  2R5Z A;  5FLV A;  1K61 A;  5F0H A;  2VKV A;  3WHB A;  1SAN A;  3I4N J;  1I6H J;  2WV1 A;  3HB9 A;  4C2M J;  5M3M J;  3HDD A;  2M2E A;  4JYK A;  4V2G A;  5EEA A;  3TW6 A;  5EG0 B;  3JRB A;  1W0T A;  3LSJ A;  3BTC A;  2DA6 A;  3FKI J;  1H89 C;  2WAQ N;  4Y7N J;  4FCY A;  5J1U A;  2CQQ A;  4CYC B;  1WCM J;  2E2H J;  1HF0 A;  3JRG A;  4G12 A;  1ZQ3 P;  3S16 J;  4XIC A;  2JMW A;  2H1K A;  4JX6 A;  1ITY A;  2MW8 A;  4A3G J;  2LTP A;  3JRC A;  4JX5 A;  2LVS A;  1OFC X;  3S1N J;  2L9R A;  2HXI A;  2XGE A;  1NK2 P;  2GLO A;  2XGC A;  1APL C;  3S17 J;  2L0K A;  5FKN A;  1YRN B;  2COB A;  2DA1 A;  2NVT J;  4RDU A;  3JRE A;  2VKE A;  3RKQ A;  4ABZ A;  1MBG A;  3ZQG A;  1ZR4 A;  2LD5 A;  1JGG A;  2MG4 A;  5EGO A;  2E1O A;  1RET A;  2ECC A;  2ME0 A;  2G0E A;  2X48 A;  1MBE A;  1B72 B;  3HOW J;  3G1O A;  4A3D J;  2FQ4 A;  4A3M J;  1F43 A;  4UUS A;  2Y2Z A;  5GP9 A;  2NVQ J;  2ELK A;  3BG3 A;  4BKX A;  3MN2 A;  5C3E J;  4D7N A;  1RR7 A;  1O4X A;  3GTL J;  3TP0 A;  3HBL A;  2HOA A;  4BXX J;  3CCY A;  4XRS A;  1Y1V J;  5F0F A;  5GPA A;  3SJM A;  3D1N I;  4GFB A;  1Z0X A;  1JT0 A;  3GTK J;  4QIW N;  1H8A C;  5K7Z A;  1MH4 A;  3BR3 A;  3B6A A;  4A3J J;  4MFE A;  1JTX A;  5K7H A;  5FKM A;  4IEJ A;  4A93 J;  2R5Y A;  3HOX J;  4A3K J;  3FK6 A;  2XRL A;  4W97 A;  4A69 C;  1IGN A;  3JR9 A;  1GV2 A;  5EZG A;  1T56 A;  1XG1 A;  2CRG A;  1JKP C;  4XK4 A;  1WH7 A;  4BY1 J;  2DMU A;  2NOG A;  3BR6 A;  4BBR J;  1U8B A;  2K9Q A;  3DCF A;  2O8K A;  3HGY A;  3C2B A;  2E19 A;  2ME6 A;  2XPV A;  1TC3 C;  3HOV J;  4BBS J;  4IHV A;  1FIP A;  2CU7 A;  1D5Y A;  4Y52 J;  3RZD J;  1TWA J;  3CQZ J;  1LE8 B;  2DMQ A;  2L7Z A;  2VUM J;  4MIM A;  2W48 A;  2D5V A;  4B3A A;  2X9D A;  1R9T J;  3S2D J;  4BY7 J;  2FX0 A;  4MLO A;  1X58 A;  1FTZ A;  2Y0S N;  4V2F A;  1IV6 A;  4X1E A;  5EF6 A;  4DYC A;  1F36 A;  3QPL A;  1NTC A;  2Y30 A;  4C3H J;  5E3M A;  4FE4 A;  5IYD J;  4AC0 A;  1ETW A;  1BJZ A;  1TWC J;  2I10 A;  4NDL A;  3ZQL A;  1AU7 A;  3QQA A;  3LSG A;  2GM4 A;  3BT9 A;  3BG9 A;  1DU6 A;  1I50 J;  1HDD C;  2LLK A;  1OCT C;  1K83 J;  2KDZ A;  1HCR A;  4XRM A;  1FIA A;  1RKT A;  4DYR A;  3BTL A;  3HOU J;  3MKL A;  1WGX A;  1JTY A;  5M5W J;  4M3E A;  5EZH A;  2H8R A;  5IP9 J;  1MSE C;  2JA6 J;  1P7J A;  2K9N A;  2OF7 A;  4A3F J;  1MBJ A;  1ORK A;  1FJL A;  1W0U A;  2FD5 A;  4B4C A;  2R92 J;  2ID6 A;  2DA5 A;  2HI3 A;  5E3N A;  3JRF A;  1UHS A;  1Z77 A;  1MNM C;  1AHD P;  2FJ1 A;  1I3Q J;  2DA4 A;  2XPW A;  3RQI A;  5HOD A;  2XGD A;  1H88 C;  4M3F A;  3BTJ A;  3F0C A;  3O8H A;  5F08 A;  3BG5 A;  4XID A;  5K7F A;  2LK2 A;  3GBG A;  2EH3 A;  2R7Z J;  1IC8 A;  1AKH B;  3QPS A;  1GUU A;  3UKG A;  3ZOB A;  1QVT A;  4A3I J;  2Y31 A;  3I4M J;  4C3I J;  3A01 A;  3ZQC A;  1B8I A;  3S1R J;  1IJW C;  1RKW A;  3BR2 A;  2CQX A;  1Y1W J;  1ZK8 A;  1ZKG A;  3FIW A;  3IV5 A;  3SFI A;  9ANT A;  1LFU P;  2VPR A;  3PO3 J;  1QRY A;  3H0G J;  2MGQ A;  3HOY J;  1WPK A;  2CJJ A;  4D7M A;  4C3J J;  1FEX A;  1XC5 A;  3PM1 A;  2HXO A;  4XRS G;  5F04 A;  1PUF A;  5IOY A;  3A02 A;  2R93 J;  5FKL A;  2P81 A;  4X6A J;  2KT0 A;  2TCT A;  2VI6 A;  2EZK A;  1FTT A;  2R5Z B;  1JJ6 C;  1JJ8 C;  4AUX A;  1Q1V A;  2L7F P;  1ENH A;  5C4X J;  2HYJ A;  1JUM A;  2RAE A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...