4A3BJ

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3bJ00
3B6CA 3E7LA 5GP9A 2XB5A 2ECBA 3W6VA 3DEWA 1RKWA 4M6VA 5F1JA 1U9NA 1QVTA 3S16J 2TRTA 1MH3A 2W48A 4C3HJ 4XK4A 3RZOJ 1WI3A 1MBJA 3L1PA 1TC3C 2Y9ZA 3BR3A 4UUSB 1E3OC 2LK2A 2VKEA 2XB0X 4A3EJ 1OJLA 1ITYA 1RKTA 1MSFC 3PO3J 1VNDA 1FEXA 2Y2ZA 3WHBA 3GTGJ 2GLOA 2ZB9A 3MKLA 1QPIA 4LOCA 5EDNA 1D5YA 2DA1A 5F0FA 1P7JA 3GBGA 4FTHA 4M3EA 2MG4A 2R5YB 3Q0UA 1BW6A 1H8AC 1G2HA 1IGNA 2E19A 4BBSJ 4V2FA 3A03A 4L5EA 4BY7J 3ZQHA 2HOAA 2DJNA 2WAQN 1Z77A 2LP0A 2JJ7A 5GPAA 1A5JA 1Q1VA 2NOGA 2DA3A 3I4MJ 4Y7NJ 1ETVA 1NK2P 5EGOB 3GTMJ 5K7ZA 2HXOA 3JRCA 2E2JJ 2XPWA 2VPRA 3ZQIA 1BJZA 2FJ1A 2XGDA 3IH4A 1AHDP 3M4OJ 3CMYA 1W0UA 4XICA 3CCYA 3BTIA 1GV5A 3ZQLA 4A93J 3MVPA 3WHCA 1P7IA 1JT6A 3BQYA 1ETQA 1FTTA 1QRYA 5BNGA 1UMQA 5F0CA 2VKVA 3SJMA 3BR0A 4HNVA 2CRGA 4IEJA 2L7FP 4XRSA 1GUUA 3B6AA 1T33A 2KDZA 4JX5A 1DU0A 3A02A 1ZQ3P 2DA7A 5IOZA 1GDTA 3HKZN 1IRZA 2YS9A 2COBA 4BBRJ 1PUFA 2VI6A 2L7ZA 4IHYA 1XC5A 3HDDA 4D7NA 4QSHA 3S17J 3O8GA 1FIPA 3F0CA 3G1MA 5C3EJ 4IHVA 2MW8A 3Q0WA 1AKHB 5EF6A 4BXXJ 4CYCB 3C2BA 1I50J 2R5ZA 2YUSA 4FCYA 2EZLA 3GTOJ 2Y0SN 4X1EA 5J1YA 2DA6A 2IEKA 2DMNA 2K9NA 4V2GA 1U9OA 2RAEA 4FE4A 1JT0A 2TCTA 2JA5J 4W97A 1RR7A 3S15J 3I4NJ 4M3FA 3JRGA 1HCRA 2DMUA 1FJLA 1Z0XA 1WH5A 2O8KA 4M3BA 4RDUA 3HOWJ 4JX6A 1JUMA 5M5XJ 3BG9A 9ANTA 1H88C 1LE8A 1OCTC 2LVSA 3GTJJ 4A3FJ 3PM1A 5IP6A 2Y31A 1F43A 3OOUA 4A3CJ 5FKKA 3IH2A 1YRNA 2DMPA 3S2DJ 2R93J 5M5WJ 4A3IJ 2ELKA 3S1MJ 1HDPA 4DZJA 4B3AA 2CUFA 2X48A 1B72A 1FIAA 5E3LA 3LSRA 1IV6A 2LKXA 2NS8A 3JRHA 2NVQJ 2QF7A 2FQ4A 5EZGA 4RBOA 2FX0A 5M3MJ 1OCPA 3HBLA 5IYBJ 4QIWN 1IG7A 2LR8A 1ZK8A 5F04A 5EEAA 1BL0A 4G12A 4C2MJ 3LSPA 3S14J 3JRBA 3FK6A 5FKOA 2JN6A 2PMZN 4IHXA 3LSJA 3FK7A 2NVTJ 4JX4A 3RQIA 1Y1VJ 3OSFA 1R9TJ 2OF7A 2DA5A 4M3GA 2IBDA 1W0TA 3JREA 5J1RA 3LNQA 2HXIA 1RETA 3GTKJ 2R7ZJ 2AHQA 2G0EA 2WB1N 5J3LA 2EBIA 3BTLA 5C44J 5IP9J 3IV5A 5EZHA 1ENHA 4A3DJ 1CQTA 2CQXA 1MBGA 4AC0A 2LFBA 2VUMJ 5FKLA 2LTPA 3JRFA 1U78A 1JTXA 1TWFJ 4UUTA 1RPWA 1JKRC 1IDYA 5F0HA 1QVUA 2L9RA 3BQZA 1VI0A 2N8GA 3BR2A 4MIMA 2K9SA 1MH4A 5FLMJ 1MSEC 1F36A 4DW6A 3A01A 1ORKA 3UKGA 3HOYJ 1LFUP 4BY1J 4AYBN 3FISA 3S1NJ 3RZDJ 3QPSA 1K61A 2K40A 2MGQA 2ID6A 2OPTA 3IH3A 4C3IJ 1O4XA 2M0CA 1S7EA 2QCOA 3SFIA 2O9LA 2ME6A 1NTCA 4MO7A 3HGYA 1B8IA 5IYDJ 5HODA 5IPAA 2EH3A 4JP0A 1X58A 1JUPA 4FISA 2I10A 1PUFB 2ECCA 2M2EA 3CQZJ 2E1OA 2EZHA 4XRSG 1ETOA 1WPKA 5IOYA 1BW5A 4A3LJ 3CDLA 4A3GJ 5K7FA 4XRMA 2FD5A 3PO2J 2R5ZB 2LD5A 2DA4A 4AUXA 4D5FA 3JRIA 1TWCJ 1NK3P 4JYKA 5EG0A 4FE7A 1GT0C 3BG5A 2JA7J 3S1QJ 3LSGA 1JKOC 2X9DA 5IP7J 4EEFG 2AO9A 2KT0A 2LY9A 4A3JJ 3HGGA 1VF9A 1WCMJ 1TWAJ 4A3MJ 1X2MA 3BR5A 4B1RA 2XSDC 2EZIA 2XRLA 4A3BJ 3G1OA 1ETWA 2EQRA 3Q0VA 5FKMA 1ZR4A 3OIOA 1LE8B 2LLKA 4MFDA 1MNMC 1MBFA 5M5YJ 1X2NA 5C4XJ 5F08A 4C3JJ 3G1LA 2E2IJ 5E3MA 3TW7A 4GFBA 3JRAA 1YRNB 5M3FJ 4QTRA 1ZKGA 2XPUA 1FTZA 5J1UA 3HEFA 3S2HJ 1ETYA 1WH7A 1ETKA 4DYQA 4UUSA 3O8HA 3HOVJ 2JA8J 1MBHA 4I76A 2R0QC 1B72B 1ETXA 1XG1A 4DZPA 3ZOBA 2HOSA 2MSYA 1LFBA 4DYCA 3BTJA 1DU6A 4W1UA 2ME0A 2CU7A 1POGA 3FKIJ 5GPCA 3LOCA 2DMTA 3Q3SA 1XS9A 1MBKA 2O7OA 4DYRA 1RESA 2NVYJ 2M9HA 1UG2A 5DS9A 1JJ8C 1HOMA 1JKPC 2ID3A 3BTCA 4I6ZA 5FJ8J 4A3KJ 2D5VA 2CJJA 2HDDA 2R5YA 1JTYA 2HI3A 1ZR2A 2GM4A 2Y9YA 3VPRA 3TEDA 5JLWA 1IC8A 3TW6A 2B63J 2Y30A 1ZGWA 1BA5A 2HQ5A 2WV1A 4MLOA 2L0KA 1K83J 2CUEA 2CQQA 2XPVA 3MN2A 1JJ6C 5EGOA 3NARA 2L7MP 3GTQJ 1SFOJ 2XGEA 3BR6A 1ZTRA 5F27A 4B4CA 1U8BA 4NDLA 5FLVA 4X6AJ 4IHWA 4ABZA 3M3YJ 3BT9A 4D7MA 3OSGA 3DCFA 1UHSA 3FIWA 4S0HB 1JKQC 2DN0A 3RKQA 1JGGA 1IUFA 1IJWC 3A01B 4Y52J 2M8GX 1APLC 3BG3A 1EF4A 3TP0A 1VFCA 1WGXA 3GTPJ 3JRDA 5DTDA 3K7AJ 5E3NA 4D5CA 2YU9J 2E2HJ 4XIDA 2IAIA 3K2AA 4BKXA 3HOZJ 1MBEA 5JLXA 5E3OA 1A6IA 1HLVA 3ZQCA 3HM5A 1B8IB 4MFEA 2K9QA 1IDZA 3H3VK 3QQAA 3JR9A 1AU7A 2JMWA 1AKHA 3H0GJ 3HOUJ 3NAUA 2JK3A 3QPLA 4CYCA 2X6OA 2P81A 3SDGA 2R92J 1TWGJ 4A69C 1OFCX 2DA2A 2DTZA 2NS7A 3S1RJ 3GTLJ 2GBYA 3D1NI 1Y1WJ 4J19A 1GV2A 2H1KA 3HB9A 1GVDA 1HF0A 5EG0B 2XGCA 1I6HJ 2DMQA 2HYJA 5IYCJ 2NVXJ 5C4JJ 1HDDC 1JUSA 3TP3A 1H89C 2H8RA 2EZKA 3HOXJ 3ZQGA 2JWTA 2JA6J 1T56A 3ZQFA 1I3QJ 2M34A 5FKNA 2HOTA 3BR1A 1TWHJ 1SANA 5EYRA 5K7HA 4M3DA
chains in the Genus database with same CATH superfamily
3E6DA 3EDPA 4HV6A 5GP9A 3W6VA 3DKWA 1RKWA 2XAGA 3FMQA 4M6VA 3TMOA 3CD6I 3CJRB 4CUGA 2MYSA 4UY8I 3HSFA 2V6EA 2W48A 3RIRA 5LHGA 1HKTA 4I98B 4C3HJ 1LB2A 2KQRA 1MBJA 1AA7A 2HU9A 3V42A 4PJJA 2Y9ZA 2ZJRF 1E3OC 2JPBA 4NQWA 3WU0A 2PN6A 1ITYA 1F9NA 3D5SC 2A05A 1IRGA 1XN7A 1VNDA 1FEXA 1R58A 1YS7A 3BZCA 2CQ7A 1G6NA 2XV4S 1XDUA 1TNTA 2KKOA 3O3KA 5CVRA 4I0BA 3NWTA 3QPHA 4A6EA 4NC6A 2Z1DA 5D6EA 4MEYF 1W7PD 2ZB9A 4XLPF 4RS8A 1XGSA 3MKLA 1SAXA 1YFHA 2HWVA 4P55A 3CJNA 1PDNC 4IX7A 3CC2I 1A31A 3HSEA 2EFWA 2OC6A 3MAJA 3M9AA 2MG4A 4M3EA 1WJAA 2OQGA 4LLLA 1YG2A 1BW6A 2HYGD 1FWZA 2OUMA 3AG4H 1G2HA 2LY1A 4V2FA 1MJAA 1LPQA 3ZQHA 3LAPA 5CVUA 2HOAA 2DJNA 2JJ7A 1UB9A 1SD7A 4RAGA 1Q1VA 4WF2A 3HRUA 4IRHA 2VL8A 1EH8A 1SD4A 1ETVA 3GTMJ 3JSPA 3JRCA 2F5VA 4H0EA 2ZCWA 2EIJH 3LWFA 1SMTA 2KPMA 3DBRB 3G73A 1TW3A 4C2UA 2ZJ2A 3LA7A 4I09A 4IRGA 3CLQA 2K02A 4WWCA 2Y75A 4XNFA 1R4NB 2IPQX 4OIRF 1W0UA 4XICA 2QQAA 3CCYA 3ZQLA 4A93J 3ABTA 3M1EA 1U5TA 2M0MA 3TO7A 2LYCA 3GVAA 1TTYA 4U0YA 5BNGA 1UMQA 1R36A 3SJMA 3QRFF 2L7FP 1G3SA 4QPOA 4KA4A 1GUUA 2ZO4A 1R1VA 4XKWA 3U1DA 2DFIA 2A68F 2G7HA 5LLQA 1ZQ3P 4L9NA 2VKDA 3TL4X 3WTSC 4M6YA 2KHMA 3F21A 5KAIC 3RYRA 4QSHA 1ZG5A 3O8GA 1D8KA 2BXZA 2CG4A 2M7BA 5C3EJ 1A35A 3AL0B 3COAC 1STZA 3MMYB 1AKHB 2V7FA 3QU3A 2IA1A 5B5EC 2FBIA 4KJZA 1I50J 3GTOJ 4JK1X 3DPTA 4KYWA 5ERIA 2Y0SN 2HDWA 2FQ3A 2DMNA 1YIOA 4V2GA 1U9OA 1BOBA 4UVBA 4HPQA 1JT0A 2EA2A 4BEHA 1RR7A 2W7NA 1D1AA 4XR6A 4EVIA 3CC4I 4UV9A 3SEZA 1R5GA 1S9HA 2XUBA 1IN6A 1Z0XA 4ITVA 2COMA 4M3BA 2L2OA 3VOEA 2QKLB 2EFNA 4RDUA 1TZLA 2KIUA 5M5XJ 3TOAA 3QYFA 3BG9A 3TKYA 2NOJB 3WG9A 3OYKA 2A6TA 2ZMEA 5IT3A 3FBIB 4BJ5C 4A3FJ 2O6GE 2Y31A 3GO5A 2EIKH 2TDXA 3VSLA 4MNUA 4F55A 1K78B 2FF4A 2JA2A 3U2RA 1YJNI 3P9CA 1YRNA 3M7GA 3S2DJ 1OCRH 4IOAF 3VYUB 2MC3A 1I5ZA 5HLTA 4DZJA 2BGCA 6PAXA 4L9VA 3X2QH 5GAGJ 2CUFA 1B72A 5E3LA 3LSRA 2NVQJ 2LKXA 2AXLA 4FQGA 3J7AO 1E3HA 3R4KA 2F5FA 5TJJA 4RBOA 3J7ZI 5D4RA 1ON1A 3RCOA 1ZYRF 2HFHA 1IG7A 2R7XA 2LR8A 2YX4A 4ZYAA 4HLYA 1BIAA 1RUOA 3LSPA 2V4JC 4BQQA 2H6BA 3S14J 5D5VB 3TDUC 4IZZA 4IQJA 4P9FA 3KE2A 2FRHA 3FK6A 3BCAA 2EV6A 2Q2EB 1R5ID 3DTKA 3CF2A 3VYSB 1G3WA 3K1NA 4XLCA 4EM2A 1P9QC 1GXPA 1ACIA 1FBSA 3CCMI 2A6HF 2IBDA 4BE0A 3JREA 4E7JA 2MA3A 5LEKA 3GTKJ 2R7ZJ 4S05A 4CCJA 2HZTA 2M1BA 3K0LA 3PNYA 2FNPA 5J3LA 3BTLA 1ENHA 2STWA 3W3CA 2ELJA 2CQXA 4RB1A 3WTVC 3V8LA 2KL4A 2VUMJ 2K86A 2RQQA 3JRFA 4UUTA 1MKMA 5GADJ 3PUBA 5J4VA 5F0HA 1EJ9A 1IAWA 1QVUA 5FFXA 4E7KA 2WAFA 3BQZA 2GIZA 2M30A 2DT7B 3ZPLA 4A6DA 2OZ6A 3LSTA 1F36A 4DW6A 5FLMJ 1J0RA 1HA8A 1W5CC 3DEEA 4LIVA 4BY1J 1J59A 4AYBN 2LC2A 3RZDJ 4II2A 1QA6A 2K5CA 2X1EA 4N4NB 2OPTA 2RQPA 2V1DA 2GOXB 4JOMA 2HPMA 3HPGA 2O9LA 2EINH 4XOTA 2R7OA 2WADA 3I55I 3OWTA 1WJFA 3QP6A 5D5WB 2EH3A 3GFMA 1X58A 1WJCA 4CXFA 2I10A 1NH3A 3DPUA 4YIFA 2ECCA 3T1BA 2M2EA 3CQZJ 3H9JA 2EZHA 1UHWA 3L7WA 2X4HA 4KN4X 1BW5A 3M1CA 4BNCA 4I7HA 3O6BB 4A3GJ 2D2WA 3DQVC 3VYRB 2AS5F 1VTNC 2H09A 4IJAA 2FD5A 2JTVA 3WTTC 3OYMA 2CUJA 3HPHA 2R5ZB 2Z99A 2OCCH 3WE2A 1U2WA 1MD0A 3JRIA 4A12A 1VQ7I 5EG0A 3R6SA 1GT0C 4G6TB 2JA7J 4B47A 1GHCA 3M8EA 2VJ4A 1R49A 3S8PA 5EEGA 1IO2A 3P5JA 1BR1A 3BP8A 2EFPA 4EEFG 2VPLA 3KPHA 2XF6A 1OMIA 1KQ8A 2I5UA 1G3YA 2E5NA 4KIGA 1SFXA 1FMWA 1X2MA 3JCUC 2ETHA 1LNWA 3FMRA 5D5UB 4B1RA 2M4GA 2XSDC 1R6RA 2EZIA 2OV7A 4XM3A 2EQRA 4WXCA 1ZR4A 4XOPA 2ADUA 5JI6A 1LE8B 2M5WA 2LLKA 5H20A 1MNMC 2CV0A 1TNSA 1MBFA 5M5YJ 2NRAC 1X2NA 2MLKA 3VYTB 1ZN2A 2E2IJ 2DFHA 2M3AA 3JRAA 3DLLF 4QLCU 3AG2H 1ZKGA 3KP7A 3S2HJ 3HEFA 3W6KB 1ETYA 3FBNB 1XCVA 3PJRA 4S04A 5D4SA 3CCJI 3HOVJ 1LEBA 4LB6B 2YPRA 1LFBA 2DU9A 3MEXA 3BTJA 2HEOA 1MMDA 2ME0A 2DMTA 3SZGA 3GEZA 3R60A 1RESA 4DBRA 4L9TA 2M9HA 2ID3A 3W6JB 2HOEA 5L3EA 3CO7C 1N75A 2D5VA 2EJRA 4RLFA 1KU3A 1Z3XA 2HDDA 1USSA 2C6YA 2JVGA 2QQ8A 5IT9K 3WTXC 2O3FA 1X1BA 3ASNH 2X0LA 2R4GA 1TT5B 2Y9YA 2VC0A 4U0VA 3TW6A 2B63J 2Y30A 2CFXA 4Z2YA 5F1RA 1K83J 2K9MA 4UB6C 4Q4ZF 3KP6A 1J75A 3J80K 2IS1A 2LF7A 3OYCA 3KZZA 3BZKA 2Q8KA 4E4HA 3TGNA 3BR6A 3H36A 2PI0A 1ZTRA 3HL2A 5F27A 3LFKA 4ZH4F 3QOPA 1J7KA 4M9XA 4NDLA 3ONQA 4X6AJ 2HTSA 4WX9A 3RDIA 1K7AA 2MABA 3M3YJ 5LGTA 1U5TB 1X1DA 3DCFA 3IHUA 1UHSA 3FXRA 2DN0A 1JGGA 2QBYB 2H27A 2DO7A 4Y52J 2RNGA 2GXGA 2CH0A 2X6YA 1APLC 1H0MA 2DOEA 2KP6A 2VT3A 5LRSA 2RDPA 1ZHFA 3L2QA 2M7AA 2P4WA 4LD5A 3HTSB 4HDUA 1A6IA 3ZMTA 2MLGA 1XGMA 3HM5A 3ZCOA 1B8IB 3CCSI 3KLOA 3H5RA 4HX4A 3QQAA 2ACJA 2GZWA 1WI9A 1AKHA 3H0GJ 1XSXA 3H0DA 4ZZDA 3EUHC 3NAUA 3QPLA 4OOIA 3PNVA 2XSJC 4A69C 5HOOA 3GTLJ 2KRFA 2GBYA 5D5XB 2WY7Q 4L9JA 1GV2A 1UG0A 4BQAA 4ZDLA 4GYGA 1SFKA 1HF0A 3V7CA 4MQ9F 1J5YA 3CDIA 3OL3A 1I6HJ 4RGXA 2ELHA 5C4JJ 5LGNA 2MH9A 5CQGA 4DQ2A 3A1YA 4NHJA 1LDDA 3ZQGA 1TP4A 3J81K 2JWTA 3SFZA 2LRDA 3BCBA 1T56A 3OL4A 4HQMA 1A04A 2Y0MA 2KIMA 1J9IA 3FXLA 1K78A 1F4KA 2ZFWA 1FT9A 3B6CA 3L09A 1P4WA 3U9GA 5GTIC 3TDZC 4PZJA 3K4CA 5F1JA 1LVKA 1BBYA 1U9NA 4B8XA 1S29A 3IAM2 4XK4A 1Z21A 1LKXA 3L1PA 4MEXF 4M72A 3BR3A 4XRFA 2LK2A 3BJAA 1XDSA 3F6VA 4R8HA 1MMNA 3ZMUA 1O3TA 4C30A 3PO3J 3MZHA 2L02A 2Y2ZA 4AD9A 3V8JA 3CC7I 4NB5A 2HVSA 1W5SA 4EMSA 1IF1A 4ESFA 3GTGJ 2FUG2 1Z6TA 3GXOA 4G7ZF 1YJ9I 3NQOA 2Q2EA 3E5UA 1EH7A 4OAYA 1QPIA 2O61A 3IRQA 3S32A 4DBQA 3KEQA 4CGZA 3Q0UA 4G94A 1FC3A 4HZFA 3T8RA 1O3RA 4BBSJ 2E19A 2OAZA 5LHHA 4L5EA 2L9VA 4F91B 5BOXA 3F3XA 5GPAA 2LP0A 3VSKA 3ZXSA 2IGOA 4XL9A 2DI3A 4CCOA 1UELB 3DTIA 2DA3A 4IOCF 4AIJA 2A69F 5E8GA 4DGWB 5K7ZA 2HXOA 2E2JJ 3HRSA 3KP3A 2VPRA 4CICA 2VOOA 3CMAI 2BY2A 1Z91A 2NS0A 3HRTA 3QODA 1RZ4A 2W1OA 1W5TA 5KK1A 4BHCA 3O2PE 2XAHA 3F8NA 2XGDA 3IH4A 2X1DA 1AHDP 3HC7A 3H1CA 3M4OJ 1Y56A 2HQRA 3BTIA 1S3JA 1NHAA 2XASA 4XLNF 2QQ9A 3MVPA 3WHCA 3BQYA 5E1XA 4EJWA 1ETQA 1FTTA 1QRYA 3FXJA 2VKHA 3E1SA 3KCCA 3ELKA 5F0CA 4IEJA 2AQFA 1J09A 3B6AA 4UB8C 4XKCA 1T33A 4KT5C 5B1BH 1MJ9A 4JX5A 1R22A 2KDZA 4IHTA 2ZXHA 1Y0UA 2W57A 1KGSA 2NXNB 5IOZA 2O8XA 3I59B 1V55H 2YS9A 2LMDA 5E79C 4BBRJ 2L54A 4ENNA 5IT9Z 2LG4A 1IW7F 3K4NA 1ZREA 2HZDA 1D5VA 3OYNA 1USTA 1FP2A 2M4KA 4Y33A 2R5ZA 2E1MC 2YUSA 3IKTA 4KUMA 3H92A 4PFOA 4FCYA 3ML6A 5J1YA 2BY1A 3N4MA 2DA6A 2XF7A 2H8WA 1X3UA 2Z33A 4HOBA 1T38A 2YU3A 2Z5UA 3CP8A 5HLHA 4WXHA 1UZCA 2CQNA 4FE4A 2FSWA 5JFRA 3ZN0A 2JA5J 5KNLA 1B4AA 4W97A 3IRRA 3S15J 2VQLA 4B48A 4RM2A 2F4OB 2FBKA 3I0TA 1FJLA 1WH5A 2CFOA 2QSFX 2B9SA 4JX6A 1JUMA 3TO6A 1S72I 5B1AH 1H9TA 1LE8A 1OCTC 3GFLA 5IP6A 1F43A 3I58A 1Y8QB 1YX3A 4HW0A 4RB2C 3SZTA 3VEPA 1ULYA 1P4AA 4A3IJ 5JVGF 3RPUA 1HDPA 4YIIA 2PMHA 1LJ9A 2FNAA 3RJPA 1E2XA 5HNHA 2QF7A 1KZHA 2P7CB 3R0AA 4I02A 3MKZA 1WFXA 2JVHA 3I5UA 2PJRB 2L7KA 4CHUA 5F04A 3OYIA 2JUGA 4C2MJ 1K6YA 2IXSA 2J5PA 2K85A 4GO1A 4IHSA 2IS2A 4F7ZA 4KISA 2UWMA 3JRBA 2CYYA 5CJ9A 2PMZN 3FK7A 4XN0A 2NVTJ 3LA3A 4E7SA 2MFZA 5HNFA 1WHUA 3G6EI 1WVRA 1HXDA 3OSFA 1R9TJ 3E5XA 4GDFA 4RB0A 2A5WA 1VQ9I 5FGMA 5E18F 2G9WA 1B9MA 3KLNA 3OV8A 3U1KA 4AVZA 4A0XA 5J1RA 3LNQA 2R7UA 2HXIA 4EJUA 4BDYA 2H1LA 2WB1N 2QYOA 2EBIA 5EEHA 4EGYA 1W36C 1N77A 2NNNA 5J4YA 3IP4B 4OIQF 2LFBA 4U87A 1SVMA 5FKLA 1X1CA 4P5OA 1U78A 3ZMDA 1RPWA 4PFPA 2BBYA 2QEXI 4KIBA 1R00A 2XAJA 4X0GA 1VI0A 2GQQA 2N8GA 4CZCA 3W2AA 3J7YJ 1LEAA 3IWZA 2A3SA 4JQFA 1MSEC 1MNEA 2LKPA 2QBYA 4IRIA 5GTHC 3UKGA 2GWRA 2L4MA 1E3PA 2D1HA 3CCQI 3CO6C 3FISA 1MMAA 3S1NJ 2F6CA 3PNTA 3QPSA 1K61A 2K40A 2VQHA 4A0ZA 1IZ1A 2MGQA 2ID6A 3IH3A 4A5NA 4C3IJ 2IW5A 2M0CA 4ZTJA 1S7EA 3F8BA 2ME6A 1B8IA 3KEOA 2RREA 3F72A 4FISA 1JHHA 4I01A 1PUFB 3OYAA 4UUVA 1WRJA 3GLLA 4HNTA 3GYHX 2V1NA 1YHQI 4U88A 3K4JA 5ICGA 3IC7A 4LG0B 2GAUA 3QU6A 4CCNA 4XRMA 3HHGA 5K5OA 1V5FA 4AUXA 4A0YA 1NK3P 4CZZA 2LREA 1SD5A 1ODDA 2DDAA 2X51A 3CCRI 1T0FC 3DP7A 5K5QA 1OKRA 1I27A 1L3LA 4M6XA 2LH9A 1T8IA 3SXYA 3GF2A 2AO9A 2LY9A 4A3JJ 2G7UA 2CW0F 1VF9A 4A3MJ 4L0YB 4EJTA 1G4DA 2MD5A 4RB3C 1VQMI 1JE8A 4A3BJ 3T8TA 1ETWA 2E1NA 1T2KA 4EM1A 2JRTA 1O7FA 1KYZA 3RPUD 2BY3A 4BL0B 3CUOA 1IXRC 2E71A 5HDGA 1VQ4I 3L2RA 4C3JJ 2OQRA 3E97A 5CQEA 3CF5F 3P9IA 4GFBA 4NC7A 3KP4A 1DQUA 4O3MA 4HDVA 5M3FJ 3DBHB 4QTRA 3ERMA 4G7HF 2A61A 1VZ0A 2K3PA 4DYQA 2UXXA 4BJ6C 4J00A 3OYGA 1IN4A 3IWFA 4I76A 1XG1A 4DZPA 3ZOBA 3W2VA 4FASD 2MSYA 1SD6A 5GAEJ 1TT0A 4ZYEA 3K4MA 1RUNA 2CW7A 3FKIJ 5JR3A 4LLGF 1ZG1A 3Q3SA 3AG3H 3JTGA 4B09A 1PP8F 4Y13A 1HOMA 2ZC2A 4I6ZA 3CCVI 2CJJA 2KRHA 1F5TA 1MJBA 2E60A 2VB6A 5HS8A 4MQVA 1XD7A 2EA4A 3D5LA 4HEA2 1S6LA 3WTYC 5GAHJ 2CO5A 2LBFB 2GM4A 3BY6A 3VPRA 3ZRGA 3TEDA 4LJZF 4EJOA 1DUXC 2V9VA 2HQ5A 1BA5A 2P0WA 4K2EA 4MLOA 2NNYA 2CUEA 2XPVA 1JJ6C 3A0HC 3RKXA 4E6KG 3GTQJ 3JTHA 1XMKA 4XKVA 2PLYA 2GOMA 2CSOA 2JSPA 4XKBA 1CF7A 1N78A 3HHHA 2V9PA 2VJ5A 4NUBA 1YQAA 1DDNA 2ZSIB 4Q48A 4UVAA 3M8FA 4BAYA 3VB2A 3GX4X 3DKYA 4ESJA 3FIWA 3CUQC 1Z6RA 1IUFA 2XIGA 3BG7A 1TQMA 3A01B 4H4KC 2M45A 1R71A 1ONVA 3BG3A 3AL0C 3N97A 3GTPJ 4XQFA 2KJBA 4D5CA 2PG4A 1BI3A 4XIDA 1XMXA 2KDOA 2IAIA 2W82A 5JLXA 2KRCA 3HIFA 3I59A 2HTJA 4V19K 1DP7P 4NBQA 3ZQCA 4G6QA 1BM9A 2BVMA 1OYIA 2R7VA 3JR9A 5E8IA 1A6QA 5FB2A 1AOYA 4RA2A 3CJTB 2RC4A 4IQ4A 3GLXA 4ZDPA 1D1BA 5CPRB 2X6OA 3SDGA 2DA2A 2NS7A 2EPFA 3MKYB 4YFKF 4QPQA 1ERDA 3D1NI 3CCLI 2DOAA 2O5RA 4ZZLA 3ZMSA 3HB9A 3K70C 2JUCA 2AQEA 4PJ0C 2Y0SA 5H6RA 2VE8A 3GUDA 4D0PA 1OISA 3L2VA 1TLHB 2XGCA 4O5VA 1XX5A 4HSRA 2NVXJ 2E1CA 3EPZA 1I39A 2IVMA 1H89C 2H8RA 2EZKA 3ZGKA 5A2QK 4U7DA 2WA0A 1R7JA 2HNHA 2MC4A 3FZVA 3PUFA 4HF1A 3REOA 2P7VB 3RQ4A 5CVVA 2JQ7A 2L4AA 3R0JA 1TWHJ 1BI2A 1FSEA 1SANA 1TQIA 2BEOA 3HTUA 3HYIA 3MZ8A 4XBFA 3MQ0A 2L7MP 3KIOA 1QQIA 3E7LA 2XB5A 2ECBA 5EJCA 3RYPA 5ILVA 2DK5A 1B1BA 3JAMK 2XKOA 2CGPA 3S16J 1MIJA 2TRTA 2VXDA 2PX9A 2ISZA 3EETA 4HX8A 5BPDA 3DLAA 1Y39A 4MTEA 1SMYF 1TL8A 1X1AA 4DNCA 4UUSB 4BU2A 3HXLA 3OR2C 3OMYA 2PJRA 2DYRH 5HDKA 1RKTA 4G8XA 2XROA 5HLGA 2W24A 5LBQA 2FMYA 3F6OA 3WHBA 2ZKZA 4ZJZA 3EUAA 5TGTA 1QZZA 2ZXJA 1O3SA 1U0JA 2VBXA 3ZMVA 4Y17A 4LOCA 2E36A 5EDNA 1D5YA 2DA1A 3DBLB 5F0FA 4F92B 1QO0D 3FXMA 1PUEE 4C2TA 1G59A 1FOWA 1H8AC 1WZ2A 4ZYDA 3HOTA 1HQCA 2VBYA 4IO9F 3A03A 3Q9VA 1Z9CA 2OJED 3F8MA 3BLYA 3W2WA 2WAQN 1Z77A 4EATA 1A5JA 1E17A 5FROA 3F23A 1O7LA 2DLLA 3ECHA 1OR7C 1KQ9A 2NOGA 2QM3A 2V6CA 3HUGB 2WAEA 1PVEA 4Y7NJ 1NK2P 2XC7A 5IY5H 5JHUA 4ENKA 4CCKA 1XB4A 1YYVA 2XPWA 3ZQIA 1IUYA 2RN7A 4HYEA 3C2GA 2QQBA 1QZEA 1QHGA 1U6GA 2K7LA 1IXSB 3K1MA 1XGOA 2FJ1A 2W85A 1FPQA 4G9YA 3CMYA 2VQCA 1GV5A 3T5XA 1VQ6I 2MH2A 1JT6A 2WTEA 2CQKA 4AYBA 2E7XA 4ZDOA 2VKVA 3BR0A 3E6CC 3K10A 2CRGA 1RC9A 2DFEA 1OLTA 3KYDB 1DU0A 3EYIA 3PQKA 3A02A 3KZYA 1OYWA 1YOVB 1GDTA 3C7JA 3HKZN 4Y3OA 1BOAA 1PUFA 2B7EA 2VOPA 1Z7LA 1XC5A 3LSHA 3A2KA 3Q5FA 3HDDA 1FIPA 3F0CA 3G1MA 1X4OA 4LG0A 3GZ5A 3Q0WA 2DBBA 5EF6A 4BXXJ 5KAFC 4CDGA 5DCFA 5LFAA 4CYCB 1RI7A 3C2BA 1W4MA 5DD4A 1ZAOA 2EZLA 4ENJA 2VBWA 2K9LA 5E1WA 3D0SA 3KX2A 4X1EA 2EIMH 3MCZA 3QPTA 2IEKA 2VONA 3S3OA 1L0OC 2K9NA 5CLSA 3L2CA 1O3QA 1ZG3A 4XLAA 3QYEA 3KYCB 3WTZA 4OWRB 2RAEA 1EV7A 4CCLA 3BG6A 3K4LA 3QP5A 3PL8A 3KFWX 3SZPA 1Y0NA 2ZNYA 1Y6IA 4M3FA 3JRGA 1HCRA 2VBZA 4NC8A 3BOQA 3ABLH 1KYWA 1V5GA 2DMUA 4AIKA 4M9SA 3TBIA 1ZH5A 1MZBA 1ZGAA 3MKWB 5L3CA 4FHTA 1UHMA 3HOWJ 1ZARA 2VJIA 4C9YA 2BW3B 2J5OA 3HG9A 4L5JA 1D8JA 2E1MB 9ANTA 1O57A 2DW4A 2LVSA 4BDZA 3GTJJ 2DQRA 3C2HA 3PM1A 4WXDA 3OOUA 2LNBA 3KEYA 1Y8RB 4P1WA 4LIUA 3ZN1A 1I6XA 2R93J 3PIOF 2DFFA 2P8TA 3S1MJ 3VWBA 4WCGA 5AIPA 2ZNZA 3MFKA 2OBPA 2BY0A 4M3DA 3KYLA 2X48A 2XGXA 1T39A 2PQ8A 1Z1DA 5KCMA 2FQ4A 1MMGA 3FDYA 2FX0A 5M3MJ 4XONA 1D0YA 3HBLA 5KVRA 5IYBJ 5DV5A 1ZK8A 5EEAA 1BL0A 2F5CA 3V8KA 1Z7UA 2OCEA 5FKOA 1NG7A 5KHDA 2JN6A 1X3WB 1FOKA 3WGHA 3LSJA 2X6WA 2GXBA 4JX4A 2GXAA 3CZ6A 1SVOA 2ESNA 3DPLC 4RM3A 5D8LB 1BN5A 2WY8Q 2LKSA 1Y1VJ 3RPQA 2Y48A 1IN8A 2RKHA 2I8DA 2LBFA 3G3ZA 1JGSA 5ICCA 3DV8A 1J2XA 1UJ8A 3FX3A 4M3GA 4UVCA 4YG2F 4HRIA 5DM6F 3ZMZA 3OYJA 1X1PA 2FU4A 4GYIA 1RETA 2PBIA 1U5TC 2QKMB 1PJRA 5BS6A 2G0EA 1FOYA 5CKTA 4LMYA 3K4BA 2EV5A 5EZHA 4A3DJ 4BQOA 1CQTA 4AM3A 1NG6A 2NAZA 1CF7B 4AC0A 4BE2A 1UCRA 2DODA 2MBFA 3JAMZ 1BC8C 4EJVA 1IDYA 5E17F 2L9RA 2QWWA 2R3SA 4YELA 4YFNF 2XKPA 2X6XA 5K1YA 3H9QA 3AAFA 4HQEA 1ZLKA 2HDCA 1FMVA 4MIMA 2ZXIA 3VFZA 4WK8F 3WODF 4LK0F 1YJWI 1RIOH 2DCEA 3A01A 1D0ZA 1ORKA 3WGIA 3HOYJ 1LFUP 3J7AY 1G8XA 4UV8A 4AIDA 4B3XA 1GVJA 1YLFA 4BH9A 2DPDA 3GFJA 2QCOA 4RAFA 3SFIA 3RSNA 1VQNI 4N0BA 2VT2A 5IYDJ 4LITA 3AFHA 5HODA 4XLEA 3RTRA 1YITI 5FFZA 4IPAA 3H3UA 2Z16A 5HLIA 3JW4A 2XAUA 2Q1ZB 3G4SI 1ETOA 1WPKA 2IRFG 5FO5A 3J80Z 4KNYA 4A3LJ 5K7FA 1LFPA 2YX7A 3M8JA 2FMLA 3GFIA 4PUSA 4XSZF 2ZMEC 4D5FA 3OYFA 1TWCJ 4PCQA 1T95A 3BPVA 3P9KA 3S1QJ 2R7RA 1YW9A 3GWZA 4UXNA 3LSGA 3S93A 1JKOC 3WTWC 1K4TA 2X9DA 3WG7H 3LSKA 3LL7A 5IP7J 4CA0A 3MZYA 2H94A 2FE3A 1F1ZA 1VQLI 3HGGA 1IRFA 1WCMJ 4FT8A 1TWAJ 3GMEA 5JVTA 1BIBA 3BR5A 3TQNA 2XRLA 3G1OA 3LA2A 1E0EA 1YIJI 2WV0A 1DGRM 4LFUA 2E7WA 4MFDA 5LD2C 2EILH 2PJPA 2HGCA 4ETSA 4Q47A 2R7WA 5E3MA 3TW7A 3FKJA 1XPXA 1BI1A 1VQ8I 4ASNA 1DP3A 5L3DA 2R7SA 3K6GA 1SEUA 2XPUA 5DUKA 1FTZA 1WH7A 1ETKA 2GIVA 4UUSA 1KU7A 1OCOH 2R0QC 2V9KA 1ETXA 2A6EF 4KIFA 3EQLF 4JBAA 2P5LC 5HS7A 4DYCA 1FNNA 1POGA 4RGUA 2PMUA 2W84A 3LSIA 4XN3A 1XS9A 1MBKA 1IXCA 2O7OA 4U0WA 2AXTC 4AVPA 4CYDA 3E0JB 5DS9A 4F93B 1WQ2A 1JKPC 4AIHA 1R4MB 5FJ8J 2R7TA 4G7OF 2HVQA 2Y69H 3J81Z 2O0YA 4LGWA 3JSOA 1OPCA 1ZLJA 1P6RA 2VQGA 2DYSH 2F5EA 1JTYA 2BHZA 2QVOA 2JPCA 4FETA 1OCZH 2EFQA 2QSGX 1YS6A 3E3VA 3CCEI 3CJQB 1ZGWA 2DXIA 4PSWA 3HZJA 3HUGA 2FXAA 2EWNA 3OIQA 1QNTA 3MN2A 3NARA 3C18A 1ON2A 2LDUA 3U21A 3OYDA 4FX4A 1SFOJ 1B9NA 4BQNA 4HA8A 2P5VA 4XLHA 3ERED 1CGPA 1Q1HA 3LQRA 3VODA 5FLVA 2HKXA 1KQ0A 2F4MB 1VQKI 2EK5A 3B73A 4YRVA 1YI2I 3KP2A 2ICWG 1IN7A 5FD6A 2OA4A 3BT9A 1Z67A 4CO8A 4D7MA 3I4PA 3HRMA 5J6XA 3OSGA 4S0HB 1T6SA 3LQQA 4N9IA 3WE3A 1JKQC 3RKQA 1FX7A 1N25A 3UNGC 3FHNA 4UNOA 2M8GX 1EF4A 2HKOA 2WWYA 4E7HA 2Z2SB 1PYVA 2HYFA 1VFCA 1YO5C 1WGXA 4PGGA 5DTDA 3K7AJ 5E3NA 2YU9J 2E2HJ 4PJMA 1HW1A 3K2AA 4BKXA 1MBEA 1HLVA 5L3BA 1K4SA 1SFEA 2IS4A 1I1SA 4MFEA 2K9QA 1IDZA 5ICEA 1TW2A 2PFBA 5DUIA 3BJOA 5HDNA 1AU7A 1YX5A 3CLOA 3OYLA 2JK3A 3CUQB 1WWXA 2FA5A 4M9ZA 3ZQQA 5DD8A 3RKWA 1M1EB 2JT1A 3MD2A 4CYCA 2M8EA 2P81A 1QU3A 3HOSA 1TWGJ 2R92J 1OFCX 2M87A 3ESWB 2OD5A 4KICA 4J19A 2E5ZA 2H1KA 2EV0A 4F52A 1HBXG 1GVDA 1OYYA 2LOOA 2ZFUA 4RGRA 4GGGA 3S3MA 3LMMA 3QAHA 3EYYA 4B43A 1ZELA 2X1CA 2W25A 5IYCJ 2BXYA 1HDDC 2P5KA 1JUSA 3FXKA 4YEJA 5DYMA 1FP1D 3CDHA 4ENMA 1EKEA 1QGPA 1R1TA 2LY2A 2WBMA 4BXFA 1SC7A 1H9GA 2BW3A 2HR3A 1WJDA 2IA2A 3GW2A 1XGNA 3AG1H 2IGKA 4EV0A 2VODA 3DTEA 2NYXA 5K7HA 5B3SH 1YTYA 1VQPI 2BYVE 2K4BA 3DEWA 2P6SA 1V5EA 4Q5SF 1FYKA 3GCMA 3UR3C 4IF4A 1WSUA 4GRIA 1QVTA 1I3AA 3IL2A 1MH3A 4ZYHA 4IVNA 4LK1F 3H5NA 3KP5A 2HVRA 3RZOJ 1JXSA 1WI3A 2K4JA 1TC3C 2FBHA 4PK4A 4XSXF 1HW5A 3K2ZA 3WGGA 3SHFA 2VKEA 2XB0X 3OS0A 1OJLA 4A3EJ 3ECOA 4GCVA 1MSFC 2Q0OA 2DOFA 5DCMB 3OR1C 2DTRA 3K9TA 3KETA 2GLOA 2KZGA 3M07A 4Z6YA 1VQOI 2PMZA 3HSRA 4E7LA 4I99C 3WU1B 1MDMB 3H3ZA 1A36A 4OMYA 1T08B 5L3FA 1P7JA 3L9FA 2GA2A 3GBGA 4KT6A 4FTHA 3WTUC 2Z9OA 2ZSHB 3BROA 2F4IA 2R5YB 1W7PB 1IGNA 2WC2A 1ZRDA 1EA3A 3PSIA 4BY7J 1KU2A 4MHGA 2IJLA 2MD0A 5D8KB 4BGDA 2K3FA 1FSHA 2WB1A 3PQJA 1QBJA 3I4MJ 2F5DA 5EGOB 4BS9A 2CS3A 2A07F 2UUZA 1FYLA 1XSVA 4MTDA 1BJZA 3F8FA 3K1PA 2O03A 4ON0A 1MMSA 1IN5A 5BPIA 4CSWA 3LAJA 1TBXA 3ABKH 1KU9A 5HS9A 2A5YB 3KZIC 3OOPA 4DIQA 4KN7X 3SQNA 1P7IA 3CMMA 3CCUI 1LVAA 4DOZA 3D5RC 4LB5A 2BV6A 4ANJA 1D0XA 4HNVA 4PDKA 2F48A 2CWEA 2OTJI 4XRSA 3DWLE 4IXAA 5AIQA 3F22A 4CH7A 2DA7A 1GXQA 1X3ZB 1IRZA 2L9SA 2COBA 2VI6A 2L7ZA 4PSXA 4IHYA 4OIPF 1MGTA 5L3GA 4KMFA 4D7NA 1OCCH 1XCBA 3S17J 1LUJB 4CCMA 4IHVA 2MW8A 2VN2A 3GZNB 1T98A 4BACA 2QSHX 4HV5A 3ABMH 1HW2A 3CMEI 2V26A 1DPRA 5LRRA 5J47A 2IGNA 3BDDA 4HG2A 3CP2A 1V3FA 2B0LA 2XRNA 2UXNA 1P92A 2D1VA 4RAYA 4EQQA 1ZRCA 3FHZA 1B59A 1ZGJA 3LSMA 2L3DA 1FYMA 1K79A 1LQ1A 4YIRX 1JI8A 1IV8A 2E35A 2TCTA 4HLXA 3P7NA 4M74A 3I4NJ 4RGSA 4XLFA 1FZPB 3RKYA 4KMUX 2ISYA 2O8KA 3ASOH 4HNUA 1VQ5I 1S7AA 2RVCA 2RNJA 3FM5A 1BR2A 1H88C 4L0ZB 1K6OA 5CYVA 2VASA 2KFDA 3L2WA 5FKKA 3IH2A 5J8FA 4U7BA 3NEUA 1XSDA 3MWMA 4N9HA 4A3CJ 4MGRA 1T0FA 3BC8A 2DMPA 2W4SA 5M5WJ 1P4XA 5BMZA 2ELKA 1QZYA 2KIQA 2ZXWH 1D1CA 4PJNA 3I56I 1U8RA 5E1ZB 4TV7A 4B3AA 1QHHD 1RNLA 1FIAA 2R7FA 1IV6A 1AWCA 2NS8A 3JRHA 4M73A 5EZGA 4L18B 1IRXA 1OCPA 4NQWB 1LDJA 4D9JA 5ILSA 2VLAA 4R1HA 4QIWN 5TISC 3OYEA 4ZC3A 2JSCA 2IT0A 2D45A 4G12A 3AKZA 3E5QA 3RI4A 4LG3A 1X4PA 3EUKL 3R61A 4IHXA 2X85A 1S5LC 1KA8A 3V4GA 3DEUA 3G2BA 3F8CA 4AWXB 2ZJQF 1HSJA 3RQIA 1TQPA 1REPC 2R7DA 2OU2A 2BHYA 5LEJA 2OF7A 2DA5A 2KZVA 3OYHA 1W0TA 1S7OA 1FBUA 3E6BA 3DKXA 5DEQA 2AHQA 1BC7C 1R5HA 3A4CA 1FOXA 5C44J 1UFMA 2CV2A 5IP9J 3IV5A 2IA0A 2QA4I 3BJ6A 3FXUA 1ZRFA 1MBGA 4IKFA 4O6JA 4E7IA 4XORA 2LTPA 1JTXA 1TWFJ 2ESHA 1JKRC 2KISA 2DT5A 4RMNA 5K5RA 4ESBA 1FLIA 2V1UA 1Z05A 3PSFA 3BR2A 1W36D 2K9SA 1MH4A 4Y4RA 3DU6A 2CW8A 2LF8A 4HBLA 4UHTA 3ISPA 1WJEA 5FLXK 2L5QA 4HAMA 4BE1A 3I3LA 2QUFA 3I64A 4P9UA 5D6FA 5LGUA 1OQYA 1O4XA 1HKSA 2XAQA 2OTLI 2PEXA 3DU5A 4D1QA 2QLZA 2L9NA 2LSOA 1NTCA 4MO7A 3HGYA 5FRNA 4YFXF 5IPAA 4JP0A 4KFCA 1JUPA 2KMUA 1JHFA 2BZTA 2RV8A 4BJTA 3OS1A 3ROUA 5F64A 2DJIA 3CUQA 2E1OA 2R7QA 3K4KA 1V4RA 4XRSG 3FF5A 5ILUA 5IOYA 4HF0A 3NWSA 3CDLA 3FXQA 1D3YA 3K69A 3L00A 2IGMA 1GLNA 4F3QA 1R23A 1YW8A 4I2OA 3PO2J 2LD5A 2DA4A 4HF2A 3BZ6A 4JYKA 5CVIA 4FE7A 5DDGA 3BG5A 3OYBA 5FD5A 1FY7A 2HS5A 2KLOA 3OIPA 2VIXA 3F9KA 3ZQ7A 4J01A 2DQLA 1BR4A 3G71I 4BEHB 2KT0A 3ZP5A 2DK8A 4ZYGA 1P2FA 2DT6A 1WJ5A 1WJBA 4LLNA 3S2WA 5JHFA 2YR2A 2DDBA 5B66C 1S8NA 4EM0B 1XTAA 3Q0VA 5FKMA 4OMZA 4E7ZA 2IP2A 3OIOA 3N05A 2FEZA 2ZMEB 1SVLA 4N4OB 5C4XJ 1C0WA 3H35A 3QOEA 5F08A 3G1LA 2UZKA 5TRDA 1EH6A 3I54A 4G6DA 1RRJA 4EGZA 1YRNB 4I0AA 5FRMA 2XHKA 5J1UA 1X19A 3O8HA 4BXUA 2JA8J 1MBHA 4RLQA 5AONA 4II3A 2ZJPF 5LHIA 1B72B 1WKMA 2HOSA 1MNDA 3FM3A 3BPXA 3LFUA 4PGHA 2H6CA 5H6QA 5ED4A 2OZUA 4W1UA 2QENA 2VC1A 4XMYA 5DCMA 1UAAA 1DU6A 2CU7A 1BI0A 1MW7A 2EFOA 4A5MA 3LOCA 5GPCA 4A2UA 4DYRA 4Y15A 2NVYJ 3I9V2 1UG2A 3ULQB 1JJ8C 1PP7U 1MDMA 2V1XA 2E34A 3BTCA 5J8CA 3I53A 3ZR8X 3OS2A 5H2FC 3HJEA 4A3KJ 1HSTA 5A2QZ 2DAOA 2EB7A 4ZTFA 1U3EM 1KONA 2R5YA 2VJJA 1W7PA 4RAZA 3CTAA 1DPUA 4QWQA 3C3WA 2K27A 2HPIA 2XVCA 2HI3A 4GXOA 3C1DA 5F6FA 3V7SA 4L5IA 1XMAA 1ZR2A 4BHPA 4HSTA 5JLWA 1IC8A 3GZ6A 3WU2C 3SDBA 4R79A 2WV1A 2RGVA 4P96A 4E70A 2L0KA 2WAQA 2CQQA 1RR8C 3H9GA 5EGOA 2YSRA 2F2EA 2XGEA 2GA1A 2XAFA 3BWGA 3DF8A 3SYTA 4B4CA 1U8BA 4BUPA 2BE5F 2JZYA 3H5AA 3FXOA 4IL6C 2KIFA 2VE9A 3FMSA 3IUOA 4BHBA 1V54H 4ABZA 4IHWA 4OAZA 1YE9A 1B6AA 2NVUB 2CUZA 4BYYA 2KJCA 1IJWC 1OR7A 2UV1A 4HX7A 5J40A 3T0YA 3TP0A 2DPUA 1BJAA 3B02A 2VXZA 3JRDA 2CV1A 1FBQA 3A0BC 4OINF 4OIOF 1G3TA 1R1UA 3CESA 3HOZJ 4AU7A 5E3OA 3IAS2 4OU0A 3DFGA 3FWEA 4FX0A 2STTA 5DM7F 2JRMA 1LDKB 3TOBA 3PIPF 3HKZA 5ICFA 1SAUA 3H3VK 2W00A 4KITB 2JMWA 5E20A 2XF5A 4B44A 3HOUJ 2IS6A 2QGUA 3PFYA 5BQTA 3S3NA 2BOLA 1DGWY 3QYBA 2CMPA 3S1RJ 2DTZA 1HKQA 4PJLA 5CVJA 1Y1WJ 2V79A 3OY9A 1Z3YA 1QPMA 3TO9A 1W1WE 3NRVA 2FOWA 4M71A 4NNJA 1SFUA 3L2UA 1I1GA 5EG0B 2HQNA 3EUHA 3VDXA 2DMQA 3E6MA 2HYJA 2P6TA 4DJAA 3ABUA 3IKVA 4KDPA 1HC8A 1YW7A 2HQAA 3TP3A 3I71A 3HOXJ 3K70D 2JA6J 2FOKA 3SEQA 3QWLA 2QZ8A 2XDVA 3PFIA 3ZQFA 5HVQC 1I3QJ 2M34A 3Q9SA 5FKNA 5FLXZ 2HOTA 3BR1A 2L01A 3DXJF 2BVLA 3V7RA 5EYRA 2ZBKA 2Z3YA
chains in the Genus database with same CATH topology
3B6CA 3E7LA 5GP9A 2XB5A 2ECBA 3W6VA 3DEWA 1RKWA 4M6VA 5F1JA 1U9NA 1QVTA 3S16J 2TRTA 1MH3A 2W48A 4C3HJ 4XK4A 3RZOJ 1WI3A 1MBJA 3L1PA 1TC3C 2Y9ZA 3BR3A 4UUSB 1E3OC 2LK2A 2VKEA 2XB0X 4A3EJ 1OJLA 1ITYA 1RKTA 1MSFC 3PO3J 1VNDA 1FEXA 2Y2ZA 3WHBA 3GTGJ 2GLOA 2ZB9A 3MKLA 1QPIA 4LOCA 5EDNA 1D5YA 2DA1A 5F0FA 1P7JA 3GBGA 4FTHA 4M3EA 2MG4A 2R5YB 3Q0UA 1BW6A 1H8AC 1G2HA 1IGNA 2E19A 4BBSJ 4V2FA 3A03A 4L5EA 4BY7J 3ZQHA 2HOAA 2DJNA 2WAQN 1Z77A 2LP0A 2JJ7A 5GPAA 1A5JA 1Q1VA 2NOGA 2DA3A 3I4MJ 4Y7NJ 1ETVA 1NK2P 5EGOB 3GTMJ 5K7ZA 2HXOA 3JRCA 2E2JJ 2XPWA 2VPRA 3ZQIA 1BJZA 2FJ1A 2XGDA 3IH4A 1AHDP 3M4OJ 3CMYA 1W0UA 4XICA 3CCYA 3BTIA 1GV5A 3ZQLA 4A93J 3MVPA 3WHCA 1P7IA 1JT6A 3BQYA 1ETQA 1FTTA 1QRYA 5BNGA 1UMQA 5F0CA 2VKVA 3SJMA 3BR0A 4HNVA 2CRGA 4IEJA 2L7FP 4XRSA 1GUUA 3B6AA 1T33A 2KDZA 4JX5A 1DU0A 3A02A 1ZQ3P 2DA7A 5IOZA 1GDTA 3HKZN 1IRZA 2YS9A 2COBA 4BBRJ 1PUFA 2VI6A 2L7ZA 4IHYA 1XC5A 3HDDA 4D7NA 4QSHA 3S17J 3O8GA 1FIPA 3F0CA 3G1MA 5C3EJ 4IHVA 2MW8A 3Q0WA 1AKHB 5EF6A 4BXXJ 4CYCB 3C2BA 1I50J 2R5ZA 2YUSA 4FCYA 2EZLA 3GTOJ 2Y0SN 4X1EA 5J1YA 2DA6A 2IEKA 2DMNA 2K9NA 4V2GA 1U9OA 2RAEA 4FE4A 1JT0A 2TCTA 2JA5J 4W97A 1RR7A 3S15J 3I4NJ 4M3FA 3JRGA 1HCRA 2DMUA 1FJLA 1Z0XA 1WH5A 2O8KA 4M3BA 4RDUA 3HOWJ 4JX6A 1JUMA 5M5XJ 3BG9A 9ANTA 1H88C 1LE8A 1OCTC 2LVSA 3GTJJ 4A3FJ 3PM1A 5IP6A 2Y31A 1F43A 3OOUA 4A3CJ 5FKKA 3IH2A 1YRNA 2DMPA 3S2DJ 2R93J 5M5WJ 4A3IJ 2ELKA 3S1MJ 1HDPA 4DZJA 4B3AA 2CUFA 2X48A 1B72A 1FIAA 5E3LA 3LSRA 1IV6A 2LKXA 2NS8A 3JRHA 2NVQJ 2QF7A 2FQ4A 5EZGA 4RBOA 2FX0A 5M3MJ 1OCPA 3HBLA 5IYBJ 4QIWN 1IG7A 2LR8A 1ZK8A 5F04A 5EEAA 1BL0A 4G12A 4C2MJ 3LSPA 3S14J 3JRBA 3FK6A 5FKOA 2JN6A 2PMZN 4IHXA 3LSJA 3FK7A 2NVTJ 4JX4A 3RQIA 1Y1VJ 3OSFA 1R9TJ 2OF7A 2DA5A 4M3GA 2IBDA 1W0TA 3JREA 5J1RA 3LNQA 2HXIA 1RETA 3GTKJ 2R7ZJ 2AHQA 2G0EA 2WB1N 5J3LA 2EBIA 3BTLA 5C44J 5IP9J 3IV5A 5EZHA 1ENHA 4A3DJ 1CQTA 2CQXA 1MBGA 4AC0A 2LFBA 2VUMJ 5FKLA 2LTPA 3JRFA 1U78A 1JTXA 1TWFJ 4UUTA 1RPWA 1JKRC 1IDYA 5F0HA 1QVUA 2L9RA 3BQZA 1VI0A 2N8GA 3BR2A 4MIMA 2K9SA 1MH4A 5FLMJ 1MSEC 1F36A 4DW6A 3A01A 1ORKA 3UKGA 3HOYJ 1LFUP 4BY1J 4AYBN 3FISA 3S1NJ 3RZDJ 3QPSA 1K61A 2K40A 2MGQA 2ID6A 2OPTA 3IH3A 4C3IJ 1O4XA 2M0CA 1S7EA 2QCOA 3SFIA 2O9LA 2ME6A 1NTCA 4MO7A 3HGYA 1B8IA 5IYDJ 5HODA 5IPAA 2EH3A 4JP0A 1X58A 1JUPA 4FISA 2I10A 1PUFB 2ECCA 2M2EA 3CQZJ 2E1OA 2EZHA 4XRSG 1ETOA 1WPKA 5IOYA 1BW5A 4A3LJ 3CDLA 4A3GJ 5K7FA 4XRMA 2FD5A 3PO2J 2R5ZB 2LD5A 2DA4A 4AUXA 4D5FA 3JRIA 1TWCJ 1NK3P 4JYKA 5EG0A 4FE7A 1GT0C 3BG5A 2JA7J 3S1QJ 3LSGA 1JKOC 2X9DA 5IP7J 4EEFG 2AO9A 2KT0A 2LY9A 4A3JJ 3HGGA 1VF9A 1WCMJ 1TWAJ 4A3MJ 1X2MA 3BR5A 4B1RA 2XSDC 2EZIA 2XRLA 4A3BJ 3G1OA 1ETWA 2EQRA 3Q0VA 5FKMA 1ZR4A 3OIOA 1LE8B 2LLKA 4MFDA 1MNMC 1MBFA 5M5YJ 1X2NA 5C4XJ 5F08A 4C3JJ 3G1LA 2E2IJ 5E3MA 3TW7A 4GFBA 3JRAA 1YRNB 5M3FJ 4QTRA 1ZKGA 2XPUA 1FTZA 5J1UA 3HEFA 3S2HJ 1ETYA 1WH7A 1ETKA 4DYQA 4UUSA 3O8HA 3HOVJ 2JA8J 1MBHA 4I76A 2R0QC 1B72B 1ETXA 1XG1A 4DZPA 3ZOBA 2HOSA 2MSYA 1LFBA 4DYCA 3BTJA 1DU6A 4W1UA 2ME0A 2CU7A 1POGA 3FKIJ 5GPCA 3LOCA 2DMTA 3Q3SA 1XS9A 1MBKA 2O7OA 4DYRA 1RESA 2NVYJ 2M9HA 1UG2A 5DS9A 1JJ8C 1HOMA 1JKPC 2ID3A 3BTCA 4I6ZA 5FJ8J 4A3KJ 2D5VA 2CJJA 2HDDA 2R5YA 1JTYA 2HI3A 1ZR2A 2GM4A 2Y9YA 3VPRA 3TEDA 5JLWA 1IC8A 3TW6A 2B63J 2Y30A 1ZGWA 1BA5A 2HQ5A 2WV1A 4MLOA 2L0KA 1K83J 2CUEA 2CQQA 2XPVA 3MN2A 1JJ6C 5EGOA 3NARA 2L7MP 3GTQJ 1SFOJ 2XGEA 3BR6A 1ZTRA 5F27A 4B4CA 1U8BA 4NDLA 5FLVA 4X6AJ 4IHWA 4ABZA 3M3YJ 3BT9A 4D7MA 3OSGA 3DCFA 1UHSA 3FIWA 4S0HB 1JKQC 2DN0A 3RKQA 1JGGA 1IUFA 1IJWC 3A01B 4Y52J 2M8GX 1APLC 3BG3A 1EF4A 3TP0A 1VFCA 1WGXA 3GTPJ 3JRDA 5DTDA 3K7AJ 5E3NA 4D5CA 2YU9J 2E2HJ 4XIDA 2IAIA 3K2AA 4BKXA 3HOZJ 1MBEA 5JLXA 5E3OA 1A6IA 1HLVA 3ZQCA 3HM5A 1B8IB 4MFEA 2K9QA 1IDZA 3H3VK 3QQAA 3JR9A 1AU7A 2JMWA 1AKHA 3H0GJ 3HOUJ 3NAUA 2JK3A 3QPLA 4CYCA 2X6OA 2P81A 3SDGA 2R92J 1TWGJ 4A69C 1OFCX 2DA2A 2DTZA 2NS7A 3S1RJ 3GTLJ 2GBYA 3D1NI 1Y1WJ 4J19A 1GV2A 2H1KA 3HB9A 1GVDA 1HF0A 5EG0B 2XGCA 1I6HJ 2DMQA 2HYJA 5IYCJ 2NVXJ 5C4JJ 1HDDC 1JUSA 3TP3A 1H89C 2H8RA 2EZKA 3HOXJ 3ZQGA 2JWTA 2JA6J 1T56A 3ZQFA 1I3QJ 2M34A 5FKNA 2HOTA 3BR1A 1TWHJ 1SANA 5EYRA 5K7HA 4M3DA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3B6C A;  3E7L A;  5GP9 A;  2XB5 A;  2ECB A;  3W6V A;  3DEW A;  1RKW A;  4M6V A;  5F1J A;  1U9N A;  1QVT A;  3S16 J;  2TRT A;  1MH3 A;  2W48 A;  4C3H J;  4XK4 A;  3RZO J;  1WI3 A;  1MBJ A;  3L1P A;  1TC3 C;  2Y9Z A;  3BR3 A;  4UUS B;  1E3O C;  2LK2 A;  2VKE A;  2XB0 X;  4A3E J;  1OJL A;  1ITY A;  1RKT A;  1MSF C;  3PO3 J;  1VND A;  1FEX A;  2Y2Z A;  3WHB A;  3GTG J;  2GLO A;  2ZB9 A;  3MKL A;  1QPI A;  4LOC A;  5EDN A;  1D5Y A;  2DA1 A;  5F0F A;  1P7J A;  3GBG A;  4FTH A;  4M3E A;  2MG4 A;  2R5Y B;  3Q0U A;  1BW6 A;  1H8A C;  1G2H A;  1IGN A;  2E19 A;  4BBS J;  4V2F A;  3A03 A;  4L5E A;  4BY7 J;  3ZQH A;  2HOA A;  2DJN A;  2WAQ N;  1Z77 A;  2LP0 A;  2JJ7 A;  5GPA A;  1A5J A;  1Q1V A;  2NOG A;  2DA3 A;  3I4M J;  4Y7N J;  1ETV A;  1NK2 P;  5EGO B;  3GTM J;  5K7Z A;  2HXO A;  3JRC A;  2E2J J;  2XPW A;  2VPR A;  3ZQI A;  1BJZ A;  2FJ1 A;  2XGD A;  3IH4 A;  1AHD P;  3M4O J;  3CMY A;  1W0U A;  4XIC A;  3CCY A;  3BTI A;  1GV5 A;  3ZQL A;  4A93 J;  3MVP A;  3WHC A;  1P7I A;  1JT6 A;  3BQY A;  1ETQ A;  1FTT A;  1QRY A;  5BNG A;  1UMQ A;  5F0C A;  2VKV A;  3SJM A;  3BR0 A;  4HNV A;  2CRG A;  4IEJ A;  2L7F P;  4XRS A;  1GUU A;  3B6A A;  1T33 A;  2KDZ A;  4JX5 A;  1DU0 A;  3A02 A;  1ZQ3 P;  2DA7 A;  5IOZ A;  1GDT A;  3HKZ N;  1IRZ A;  2YS9 A;  2COB A;  4BBR J;  1PUF A;  2VI6 A;  2L7Z A;  4IHY A;  1XC5 A;  3HDD A;  4D7N A;  4QSH A;  3S17 J;  3O8G A;  1FIP A;  3F0C A;  3G1M A;  5C3E J;  4IHV A;  2MW8 A;  3Q0W A;  1AKH B;  5EF6 A;  4BXX J;  4CYC B;  3C2B A;  1I50 J;  2R5Z A;  2YUS A;  4FCY A;  2EZL A;  3GTO J;  2Y0S N;  4X1E A;  5J1Y A;  2DA6 A;  2IEK A;  2DMN A;  2K9N A;  4V2G A;  1U9O A;  2RAE A;  4FE4 A;  1JT0 A;  2TCT A;  2JA5 J;  4W97 A;  1RR7 A;  3S15 J;  3I4N J;  4M3F A;  3JRG A;  1HCR A;  2DMU A;  1FJL A;  1Z0X A;  1WH5 A;  2O8K A;  4M3B A;  4RDU A;  3HOW J;  4JX6 A;  1JUM A;  5M5X J;  3BG9 A;  9ANT A;  1H88 C;  1LE8 A;  1OCT C;  2LVS A;  3GTJ J;  4A3F J;  3PM1 A;  5IP6 A;  2Y31 A;  1F43 A;  3OOU A;  4A3C J;  5FKK A;  3IH2 A;  1YRN A;  2DMP A;  3S2D J;  2R93 J;  5M5W J;  4A3I J;  2ELK A;  3S1M J;  1HDP A;  4DZJ A;  4B3A A;  2CUF A;  2X48 A;  1B72 A;  1FIA A;  5E3L A;  3LSR A;  1IV6 A;  2LKX A;  2NS8 A;  3JRH A;  2NVQ J;  2QF7 A;  2FQ4 A;  5EZG A;  4RBO A;  2FX0 A;  5M3M J;  1OCP A;  3HBL A;  5IYB J;  4QIW N;  1IG7 A;  2LR8 A;  1ZK8 A;  5F04 A;  5EEA A;  1BL0 A;  4G12 A;  4C2M J;  3LSP A;  3S14 J;  3JRB A;  3FK6 A;  5FKO A;  2JN6 A;  2PMZ N;  4IHX A;  3LSJ A;  3FK7 A;  2NVT J;  4JX4 A;  3RQI A;  1Y1V J;  3OSF A;  1R9T J;  2OF7 A;  2DA5 A;  4M3G A;  2IBD A;  1W0T A;  3JRE A;  5J1R A;  3LNQ A;  2HXI A;  1RET A;  3GTK J;  2R7Z J;  2AHQ A;  2G0E A;  2WB1 N;  5J3L A;  2EBI A;  3BTL A;  5C44 J;  5IP9 J;  3IV5 A;  5EZH A;  1ENH A;  4A3D J;  1CQT A;  2CQX A;  1MBG A;  4AC0 A;  2LFB A;  2VUM J;  5FKL A;  2LTP A;  3JRF A;  1U78 A;  1JTX A;  1TWF J;  4UUT A;  1RPW A;  1JKR C;  1IDY A;  5F0H A;  1QVU A;  2L9R A;  3BQZ A;  1VI0 A;  2N8G A;  3BR2 A;  4MIM A;  2K9S A;  1MH4 A;  5FLM J;  1MSE C;  1F36 A;  4DW6 A;  3A01 A;  1ORK A;  3UKG A;  3HOY J;  1LFU P;  4BY1 J;  4AYB N;  3FIS A;  3S1N J;  3RZD J;  3QPS A;  1K61 A;  2K40 A;  2MGQ A;  2ID6 A;  2OPT A;  3IH3 A;  4C3I J;  1O4X A;  2M0C A;  1S7E A;  2QCO A;  3SFI A;  2O9L A;  2ME6 A;  1NTC A;  4MO7 A;  3HGY A;  1B8I A;  5IYD J;  5HOD A;  5IPA A;  2EH3 A;  4JP0 A;  1X58 A;  1JUP A;  4FIS A;  2I10 A;  1PUF B;  2ECC A;  2M2E A;  3CQZ J;  2E1O A;  2EZH A;  4XRS G;  1ETO A;  1WPK A;  5IOY A;  1BW5 A;  4A3L J;  3CDL A;  4A3G J;  5K7F A;  4XRM A;  2FD5 A;  3PO2 J;  2R5Z B;  2LD5 A;  2DA4 A;  4AUX A;  4D5F A;  3JRI A;  1TWC J;  1NK3 P;  4JYK A;  5EG0 A;  4FE7 A;  1GT0 C;  3BG5 A;  2JA7 J;  3S1Q J;  3LSG A;  1JKO C;  2X9D A;  5IP7 J;  4EEF G;  2AO9 A;  2KT0 A;  2LY9 A;  4A3J J;  3HGG A;  1VF9 A;  1WCM J;  1TWA J;  4A3M J;  1X2M A;  3BR5 A;  4B1R A;  2XSD C;  2EZI A;  2XRL A;  4A3B J;  3G1O A;  1ETW A;  2EQR A;  3Q0V A;  5FKM A;  1ZR4 A;  3OIO A;  1LE8 B;  2LLK A;  4MFD A;  1MNM C;  1MBF A;  5M5Y J;  1X2N A;  5C4X J;  5F08 A;  4C3J J;  3G1L A;  2E2I J;  5E3M A;  3TW7 A;  4GFB A;  3JRA A;  1YRN B;  5M3F J;  4QTR A;  1ZKG A;  2XPU A;  1FTZ A;  5J1U A;  3HEF A;  3S2H J;  1ETY A;  1WH7 A;  1ETK A;  4DYQ A;  4UUS A;  3O8H A;  3HOV J;  2JA8 J;  1MBH A;  4I76 A;  2R0Q C;  1B72 B;  1ETX A;  1XG1 A;  4DZP A;  3ZOB A;  2HOS A;  2MSY A;  1LFB A;  4DYC A;  3BTJ A;  1DU6 A;  4W1U A;  2ME0 A;  2CU7 A;  1POG A;  3FKI J;  5GPC A;  3LOC A;  2DMT A;  3Q3S A;  1XS9 A;  1MBK A;  2O7O A;  4DYR A;  1RES A;  2NVY J;  2M9H A;  1UG2 A;  5DS9 A;  1JJ8 C;  1HOM A;  1JKP C;  2ID3 A;  3BTC A;  4I6Z A;  5FJ8 J;  4A3K J;  2D5V A;  2CJJ A;  2HDD A;  2R5Y A;  1JTY A;  2HI3 A;  1ZR2 A;  2GM4 A;  2Y9Y A;  3VPR A;  3TED A;  5JLW A;  1IC8 A;  3TW6 A;  2B63 J;  2Y30 A;  1ZGW A;  1BA5 A;  2HQ5 A;  2WV1 A;  4MLO A;  2L0K A;  1K83 J;  2CUE A;  2CQQ A;  2XPV A;  3MN2 A;  1JJ6 C;  5EGO A;  3NAR A;  2L7M P;  3GTQ J;  1SFO J;  2XGE A;  3BR6 A;  1ZTR A;  5F27 A;  4B4C A;  1U8B A;  4NDL A;  5FLV A;  4X6A J;  4IHW A;  4ABZ A;  3M3Y J;  3BT9 A;  4D7M A;  3OSG A;  3DCF A;  1UHS A;  3FIW A;  4S0H B;  1JKQ C;  2DN0 A;  3RKQ A;  1JGG A;  1IUF A;  1IJW C;  3A01 B;  4Y52 J;  2M8G X;  1APL C;  3BG3 A;  1EF4 A;  3TP0 A;  1VFC A;  1WGX A;  3GTP J;  3JRD A;  5DTD A;  3K7A J;  5E3N A;  4D5C A;  2YU9 J;  2E2H J;  4XID A;  2IAI A;  3K2A A;  4BKX A;  3HOZ J;  1MBE A;  5JLX A;  5E3O A;  1A6I A;  1HLV A;  3ZQC A;  3HM5 A;  1B8I B;  4MFE A;  2K9Q A;  1IDZ A;  3H3V K;  3QQA A;  3JR9 A;  1AU7 A;  2JMW A;  1AKH A;  3H0G J;  3HOU J;  3NAU A;  2JK3 A;  3QPL A;  4CYC A;  2X6O A;  2P81 A;  3SDG A;  2R92 J;  1TWG J;  4A69 C;  1OFC X;  2DA2 A;  2DTZ A;  2NS7 A;  3S1R J;  3GTL J;  2GBY A;  3D1N I;  1Y1W J;  4J19 A;  1GV2 A;  2H1K A;  3HB9 A;  1GVD A;  1HF0 A;  5EG0 B;  2XGC A;  1I6H J;  2DMQ A;  2HYJ A;  5IYC J;  2NVX J;  5C4J J;  1HDD C;  1JUS A;  3TP3 A;  1H89 C;  2H8R A;  2EZK A;  3HOX J;  3ZQG A;  2JWT A;  2JA6 J;  1T56 A;  3ZQF A;  1I3Q J;  2M34 A;  5FKN A;  2HOT A;  3BR1 A;  1TWH J;  1SAN A;  5EYR A;  5K7H A;  4M3D A; 
#chains in the Genus database with same CATH topology
 3E6D A;  3EDP A;  4HV6 A;  5GP9 A;  3W6V A;  3DKW A;  1RKW A;  2XAG A;  3FMQ A;  4M6V A;  3TMO A;  3CD6 I;  3CJR B;  4CUG A;  2MYS A;  4UY8 I;  3HSF A;  2V6E A;  2W48 A;  3RIR A;  5LHG A;  1HKT A;  4I98 B;  4C3H J;  1LB2 A;  2KQR A;  1MBJ A;  1AA7 A;  2HU9 A;  3V42 A;  4PJJ A;  2Y9Z A;  2ZJR F;  1E3O C;  2JPB A;  4NQW A;  3WU0 A;  2PN6 A;  1ITY A;  1F9N A;  3D5S C;  2A05 A;  1IRG A;  1XN7 A;  1VND A;  1FEX A;  1R58 A;  1YS7 A;  3BZC A;  2CQ7 A;  1G6N A;  2XV4 S;  1XDU A;  1TNT A;  2KKO A;  3O3K A;  5CVR A;  4I0B A;  3NWT A;  3QPH A;  4A6E A;  4NC6 A;  2Z1D A;  5D6E A;  4MEY F;  1W7P D;  2ZB9 A;  4XLP F;  4RS8 A;  1XGS A;  3MKL A;  1SAX A;  1YFH A;  2HWV A;  4P55 A;  3CJN A;  1PDN C;  4IX7 A;  3CC2 I;  1A31 A;  3HSE A;  2EFW A;  2OC6 A;  3MAJ A;  3M9A A;  2MG4 A;  4M3E A;  1WJA A;  2OQG A;  4LLL A;  1YG2 A;  1BW6 A;  2HYG D;  1FWZ A;  2OUM A;  3AG4 H;  1G2H A;  2LY1 A;  4V2F A;  1MJA A;  1LPQ A;  3ZQH A;  3LAP A;  5CVU A;  2HOA A;  2DJN A;  2JJ7 A;  1UB9 A;  1SD7 A;  4RAG A;  1Q1V A;  4WF2 A;  3HRU A;  4IRH A;  2VL8 A;  1EH8 A;  1SD4 A;  1ETV A;  3GTM J;  3JSP A;  3JRC A;  2F5V A;  4H0E A;  2ZCW A;  2EIJ H;  3LWF A;  1SMT A;  2KPM A;  3DBR B;  3G73 A;  1TW3 A;  4C2U A;  2ZJ2 A;  3LA7 A;  4I09 A;  4IRG A;  3CLQ A;  2K02 A;  4WWC A;  2Y75 A;  4XNF A;  1R4N B;  2IPQ X;  4OIR F;  1W0U A;  4XIC A;  2QQA A;  3CCY A;  3ZQL A;  4A93 J;  3ABT A;  3M1E A;  1U5T A;  2M0M A;  3TO7 A;  2LYC A;  3GVA A;  1TTY A;  4U0Y A;  5BNG A;  1UMQ A;  1R36 A;  3SJM A;  3QRF F;  2L7F P;  1G3S A;  4QPO A;  4KA4 A;  1GUU A;  2ZO4 A;  1R1V A;  4XKW A;  3U1D A;  2DFI A;  2A68 F;  2G7H A;  5LLQ A;  1ZQ3 P;  4L9N A;  2VKD A;  3TL4 X;  3WTS C;  4M6Y A;  2KHM A;  3F21 A;  5KAI C;  3RYR A;  4QSH A;  1ZG5 A;  3O8G A;  1D8K A;  2BXZ A;  2CG4 A;  2M7B A;  5C3E J;  1A35 A;  3AL0 B;  3COA C;  1STZ A;  3MMY B;  1AKH B;  2V7F A;  3QU3 A;  2IA1 A;  5B5E C;  2FBI A;  4KJZ A;  1I50 J;  3GTO J;  4JK1 X;  3DPT A;  4KYW A;  5ERI A;  2Y0S N;  2HDW A;  2FQ3 A;  2DMN A;  1YIO A;  4V2G A;  1U9O A;  1BOB A;  4UVB A;  4HPQ A;  1JT0 A;  2EA2 A;  4BEH A;  1RR7 A;  2W7N A;  1D1A A;  4XR6 A;  4EVI A;  3CC4 I;  4UV9 A;  3SEZ A;  1R5G A;  1S9H A;  2XUB A;  1IN6 A;  1Z0X A;  4ITV A;  2COM A;  4M3B A;  2L2O A;  3VOE A;  2QKL B;  2EFN A;  4RDU A;  1TZL A;  2KIU A;  5M5X J;  3TOA A;  3QYF A;  3BG9 A;  3TKY A;  2NOJ B;  3WG9 A;  3OYK A;  2A6T A;  2ZME A;  5IT3 A;  3FBI B;  4BJ5 C;  4A3F J;  2O6G E;  2Y31 A;  3GO5 A;  2EIK H;  2TDX A;  3VSL A;  4MNU A;  4F55 A;  1K78 B;  2FF4 A;  2JA2 A;  3U2R A;  1YJN I;  3P9C A;  1YRN A;  3M7G A;  3S2D J;  1OCR H;  4IOA F;  3VYU B;  2MC3 A;  1I5Z A;  5HLT A;  4DZJ A;  2BGC A;  6PAX A;  4L9V A;  3X2Q H;  5GAG J;  2CUF A;  1B72 A;  5E3L A;  3LSR A;  2NVQ J;  2LKX A;  2AXL A;  4FQG A;  3J7A O;  1E3H A;  3R4K A;  2F5F A;  5TJJ A;  4RBO A;  3J7Z I;  5D4R A;  1ON1 A;  3RCO A;  1ZYR F;  2HFH A;  1IG7 A;  2R7X A;  2LR8 A;  2YX4 A;  4ZYA A;  4HLY A;  1BIA A;  1RUO A;  3LSP A;  2V4J C;  4BQQ A;  2H6B A;  3S14 J;  5D5V B;  3TDU C;  4IZZ A;  4IQJ A;  4P9F A;  3KE2 A;  2FRH A;  3FK6 A;  3BCA A;  2EV6 A;  2Q2E B;  1R5I D;  3DTK A;  3CF2 A;  3VYS B;  1G3W A;  3K1N A;  4XLC A;  4EM2 A;  1P9Q C;  1GXP A;  1ACI A;  1FBS A;  3CCM I;  2A6H F;  2IBD A;  4BE0 A;  3JRE A;  4E7J A;  2MA3 A;  5LEK A;  3GTK J;  2R7Z J;  4S05 A;  4CCJ A;  2HZT A;  2M1B A;  3K0L A;  3PNY A;  2FNP A;  5J3L A;  3BTL A;  1ENH A;  2STW A;  3W3C A;  2ELJ A;  2CQX A;  4RB1 A;  3WTV C;  3V8L A;  2KL4 A;  2VUM J;  2K86 A;  2RQQ A;  3JRF A;  4UUT A;  1MKM A;  5GAD J;  3PUB A;  5J4V A;  5F0H A;  1EJ9 A;  1IAW A;  1QVU A;  5FFX A;  4E7K A;  2WAF A;  3BQZ A;  2GIZ A;  2M30 A;  2DT7 B;  3ZPL A;  4A6D A;  2OZ6 A;  3LST A;  1F36 A;  4DW6 A;  5FLM J;  1J0R A;  1HA8 A;  1W5C C;  3DEE A;  4LIV A;  4BY1 J;  1J59 A;  4AYB N;  2LC2 A;  3RZD J;  4II2 A;  1QA6 A;  2K5C A;  2X1E A;  4N4N B;  2OPT A;  2RQP A;  2V1D A;  2GOX B;  4JOM A;  2HPM A;  3HPG A;  2O9L A;  2EIN H;  4XOT A;  2R7O A;  2WAD A;  3I55 I;  3OWT A;  1WJF A;  3QP6 A;  5D5W B;  2EH3 A;  3GFM A;  1X58 A;  1WJC A;  4CXF A;  2I10 A;  1NH3 A;  3DPU A;  4YIF A;  2ECC A;  3T1B A;  2M2E A;  3CQZ J;  3H9J A;  2EZH A;  1UHW A;  3L7W A;  2X4H A;  4KN4 X;  1BW5 A;  3M1C A;  4BNC A;  4I7H A;  3O6B B;  4A3G J;  2D2W A;  3DQV C;  3VYR B;  2AS5 F;  1VTN C;  2H09 A;  4IJA A;  2FD5 A;  2JTV A;  3WTT C;  3OYM A;  2CUJ A;  3HPH A;  2R5Z B;  2Z99 A;  2OCC H;  3WE2 A;  1U2W A;  1MD0 A;  3JRI A;  4A12 A;  1VQ7 I;  5EG0 A;  3R6S A;  1GT0 C;  4G6T B;  2JA7 J;  4B47 A;  1GHC A;  3M8E A;  2VJ4 A;  1R49 A;  3S8P A;  5EEG A;  1IO2 A;  3P5J A;  1BR1 A;  3BP8 A;  2EFP A;  4EEF G;  2VPL A;  3KPH A;  2XF6 A;  1OMI A;  1KQ8 A;  2I5U A;  1G3Y A;  2E5N A;  4KIG A;  1SFX A;  1FMW A;  1X2M A;  3JCU C;  2ETH A;  1LNW A;  3FMR A;  5D5U B;  4B1R A;  2M4G A;  2XSD C;  1R6R A;  2EZI A;  2OV7 A;  4XM3 A;  2EQR A;  4WXC A;  1ZR4 A;  4XOP A;  2ADU A;  5JI6 A;  1LE8 B;  2M5W A;  2LLK A;  5H20 A;  1MNM C;  2CV0 A;  1TNS A;  1MBF A;  5M5Y J;  2NRA C;  1X2N A;  2MLK A;  3VYT B;  1ZN2 A;  2E2I J;  2DFH A;  2M3A A;  3JRA A;  3DLL F;  4QLC U;  3AG2 H;  1ZKG A;  3KP7 A;  3S2H J;  3HEF A;  3W6K B;  1ETY A;  3FBN B;  1XCV A;  3PJR A;  4S04 A;  5D4S A;  3CCJ I;  3HOV J;  1LEB A;  4LB6 B;  2YPR A;  1LFB A;  2DU9 A;  3MEX A;  3BTJ A;  2HEO A;  1MMD A;  2ME0 A;  2DMT A;  3SZG A;  3GEZ A;  3R60 A;  1RES A;  4DBR A;  4L9T A;  2M9H A;  2ID3 A;  3W6J B;  2HOE A;  5L3E A;  3CO7 C;  1N75 A;  2D5V A;  2EJR A;  4RLF A;  1KU3 A;  1Z3X A;  2HDD A;  1USS A;  2C6Y A;  2JVG A;  2QQ8 A;  5IT9 K;  3WTX C;  2O3F A;  1X1B A;  3ASN H;  2X0L A;  2R4G A;  1TT5 B;  2Y9Y A;  2VC0 A;  4U0V A;  3TW6 A;  2B63 J;  2Y30 A;  2CFX A;  4Z2Y A;  5F1R A;  1K83 J;  2K9M A;  4UB6 C;  4Q4Z F;  3KP6 A;  1J75 A;  3J80 K;  2IS1 A;  2LF7 A;  3OYC A;  3KZZ A;  3BZK A;  2Q8K A;  4E4H A;  3TGN A;  3BR6 A;  3H36 A;  2PI0 A;  1ZTR A;  3HL2 A;  5F27 A;  3LFK A;  4ZH4 F;  3QOP A;  1J7K A;  4M9X A;  4NDL A;  3ONQ A;  4X6A J;  2HTS A;  4WX9 A;  3RDI A;  1K7A A;  2MAB A;  3M3Y J;  5LGT A;  1U5T B;  1X1D A;  3DCF A;  3IHU A;  1UHS A;  3FXR A;  2DN0 A;  1JGG A;  2QBY B;  2H27 A;  2DO7 A;  4Y52 J;  2RNG A;  2GXG A;  2CH0 A;  2X6Y A;  1APL C;  1H0M A;  2DOE A;  2KP6 A;  2VT3 A;  5LRS A;  2RDP A;  1ZHF A;  3L2Q A;  2M7A A;  2P4W A;  4LD5 A;  3HTS B;  4HDU A;  1A6I A;  3ZMT A;  2MLG A;  1XGM A;  3HM5 A;  3ZCO A;  1B8I B;  3CCS I;  3KLO A;  3H5R A;  4HX4 A;  3QQA A;  2ACJ A;  2GZW A;  1WI9 A;  1AKH A;  3H0G J;  1XSX A;  3H0D A;  4ZZD A;  3EUH C;  3NAU A;  3QPL A;  4OOI A;  3PNV A;  2XSJ C;  4A69 C;  5HOO A;  3GTL J;  2KRF A;  2GBY A;  5D5X B;  2WY7 Q;  4L9J A;  1GV2 A;  1UG0 A;  4BQA A;  4ZDL A;  4GYG A;  1SFK A;  1HF0 A;  3V7C A;  4MQ9 F;  1J5Y A;  3CDI A;  3OL3 A;  1I6H J;  4RGX A;  2ELH A;  5C4J J;  5LGN A;  2MH9 A;  5CQG A;  4DQ2 A;  3A1Y A;  4NHJ A;  1LDD A;  3ZQG A;  1TP4 A;  3J81 K;  2JWT A;  3SFZ A;  2LRD A;  3BCB A;  1T56 A;  3OL4 A;  4HQM A;  1A04 A;  2Y0M A;  2KIM A;  1J9I A;  3FXL A;  1K78 A;  1F4K A;  2ZFW A;  1FT9 A;  3B6C A;  3L09 A;  1P4W A;  3U9G A;  5GTI C;  3TDZ C;  4PZJ A;  3K4C A;  5F1J A;  1LVK A;  1BBY A;  1U9N A;  4B8X A;  1S29 A;  3IAM 2;  4XK4 A;  1Z21 A;  1LKX A;  3L1P A;  4MEX F;  4M72 A;  3BR3 A;  4XRF A;  2LK2 A;  3BJA A;  1XDS A;  3F6V A;  4R8H A;  1MMN A;  3ZMU A;  1O3T A;  4C30 A;  3PO3 J;  3MZH A;  2L02 A;  2Y2Z A;  4AD9 A;  3V8J A;  3CC7 I;  4NB5 A;  2HVS A;  1W5S A;  4EMS A;  1IF1 A;  4ESF A;  3GTG J;  2FUG 2;  1Z6T A;  3GXO A;  4G7Z F;  1YJ9 I;  3NQO A;  2Q2E A;  3E5U A;  1EH7 A;  4OAY A;  1QPI A;  2O61 A;  3IRQ A;  3S32 A;  4DBQ A;  3KEQ A;  4CGZ A;  3Q0U A;  4G94 A;  1FC3 A;  4HZF A;  3T8R A;  1O3R A;  4BBS J;  2E19 A;  2OAZ A;  5LHH A;  4L5E A;  2L9V A;  4F91 B;  5BOX A;  3F3X A;  5GPA A;  2LP0 A;  3VSK A;  3ZXS A;  2IGO A;  4XL9 A;  2DI3 A;  4CCO A;  1UEL B;  3DTI A;  2DA3 A;  4IOC F;  4AIJ A;  2A69 F;  5E8G A;  4DGW B;  5K7Z A;  2HXO A;  2E2J J;  3HRS A;  3KP3 A;  2VPR A;  4CIC A;  2VOO A;  3CMA I;  2BY2 A;  1Z91 A;  2NS0 A;  3HRT A;  3QOD A;  1RZ4 A;  2W1O A;  1W5T A;  5KK1 A;  4BHC A;  3O2P E;  2XAH A;  3F8N A;  2XGD A;  3IH4 A;  2X1D A;  1AHD P;  3HC7 A;  3H1C A;  3M4O J;  1Y56 A;  2HQR A;  3BTI A;  1S3J A;  1NHA A;  2XAS A;  4XLN F;  2QQ9 A;  3MVP A;  3WHC A;  3BQY A;  5E1X A;  4EJW A;  1ETQ A;  1FTT A;  1QRY A;  3FXJ A;  2VKH A;  3E1S A;  3KCC A;  3ELK A;  5F0C A;  4IEJ A;  2AQF A;  1J09 A;  3B6A A;  4UB8 C;  4XKC A;  1T33 A;  4KT5 C;  5B1B H;  1MJ9 A;  4JX5 A;  1R22 A;  2KDZ A;  4IHT A;  2ZXH A;  1Y0U A;  2W57 A;  1KGS A;  2NXN B;  5IOZ A;  2O8X A;  3I59 B;  1V55 H;  2YS9 A;  2LMD A;  5E79 C;  4BBR J;  2L54 A;  4ENN A;  5IT9 Z;  2LG4 A;  1IW7 F;  3K4N A;  1ZRE A;  2HZD A;  1D5V A;  3OYN A;  1UST A;  1FP2 A;  2M4K A;  4Y33 A;  2R5Z A;  2E1M C;  2YUS A;  3IKT A;  4KUM A;  3H92 A;  4PFO A;  4FCY A;  3ML6 A;  5J1Y A;  2BY1 A;  3N4M A;  2DA6 A;  2XF7 A;  2H8W A;  1X3U A;  2Z33 A;  4HOB A;  1T38 A;  2YU3 A;  2Z5U A;  3CP8 A;  5HLH A;  4WXH A;  1UZC A;  2CQN A;  4FE4 A;  2FSW A;  5JFR A;  3ZN0 A;  2JA5 J;  5KNL A;  1B4A A;  4W97 A;  3IRR A;  3S15 J;  2VQL A;  4B48 A;  4RM2 A;  2F4O B;  2FBK A;  3I0T A;  1FJL A;  1WH5 A;  2CFO A;  2QSF X;  2B9S A;  4JX6 A;  1JUM A;  3TO6 A;  1S72 I;  5B1A H;  1H9T A;  1LE8 A;  1OCT C;  3GFL A;  5IP6 A;  1F43 A;  3I58 A;  1Y8Q B;  1YX3 A;  4HW0 A;  4RB2 C;  3SZT A;  3VEP A;  1ULY A;  1P4A A;  4A3I J;  5JVG F;  3RPU A;  1HDP A;  4YII A;  2PMH A;  1LJ9 A;  2FNA A;  3RJP A;  1E2X A;  5HNH A;  2QF7 A;  1KZH A;  2P7C B;  3R0A A;  4I02 A;  3MKZ A;  1WFX A;  2JVH A;  3I5U A;  2PJR B;  2L7K A;  4CHU A;  5F04 A;  3OYI A;  2JUG A;  4C2M J;  1K6Y A;  2IXS A;  2J5P A;  2K85 A;  4GO1 A;  4IHS A;  2IS2 A;  4F7Z A;  4KIS A;  2UWM A;  3JRB A;  2CYY A;  5CJ9 A;  2PMZ N;  3FK7 A;  4XN0 A;  2NVT J;  3LA3 A;  4E7S A;  2MFZ A;  5HNF A;  1WHU A;  3G6E I;  1WVR A;  1HXD A;  3OSF A;  1R9T J;  3E5X A;  4GDF A;  4RB0 A;  2A5W A;  1VQ9 I;  5FGM A;  5E18 F;  2G9W A;  1B9M A;  3KLN A;  3OV8 A;  3U1K A;  4AVZ A;  4A0X A;  5J1R A;  3LNQ A;  2R7U A;  2HXI A;  4EJU A;  4BDY A;  2H1L A;  2WB1 N;  2QYO A;  2EBI A;  5EEH A;  4EGY A;  1W36 C;  1N77 A;  2NNN A;  5J4Y A;  3IP4 B;  4OIQ F;  2LFB A;  4U87 A;  1SVM A;  5FKL A;  1X1C A;  4P5O A;  1U78 A;  3ZMD A;  1RPW A;  4PFP A;  2BBY A;  2QEX I;  4KIB A;  1R00 A;  2XAJ A;  4X0G A;  1VI0 A;  2GQQ A;  2N8G A;  4CZC A;  3W2A A;  3J7Y J;  1LEA A;  3IWZ A;  2A3S A;  4JQF A;  1MSE C;  1MNE A;  2LKP A;  2QBY A;  4IRI A;  5GTH C;  3UKG A;  2GWR A;  2L4M A;  1E3P A;  2D1H A;  3CCQ I;  3CO6 C;  3FIS A;  1MMA A;  3S1N J;  2F6C A;  3PNT A;  3QPS A;  1K61 A;  2K40 A;  2VQH A;  4A0Z A;  1IZ1 A;  2MGQ A;  2ID6 A;  3IH3 A;  4A5N A;  4C3I J;  2IW5 A;  2M0C A;  4ZTJ A;  1S7E A;  3F8B A;  2ME6 A;  1B8I A;  3KEO A;  2RRE A;  3F72 A;  4FIS A;  1JHH A;  4I01 A;  1PUF B;  3OYA A;  4UUV A;  1WRJ A;  3GLL A;  4HNT A;  3GYH X;  2V1N A;  1YHQ I;  4U88 A;  3K4J A;  5ICG A;  3IC7 A;  4LG0 B;  2GAU A;  3QU6 A;  4CCN A;  4XRM A;  3HHG A;  5K5O A;  1V5F A;  4AUX A;  4A0Y A;  1NK3 P;  4CZZ A;  2LRE A;  1SD5 A;  1ODD A;  2DDA A;  2X51 A;  3CCR I;  1T0F C;  3DP7 A;  5K5Q A;  1OKR A;  1I27 A;  1L3L A;  4M6X A;  2LH9 A;  1T8I A;  3SXY A;  3GF2 A;  2AO9 A;  2LY9 A;  4A3J J;  2G7U A;  2CW0 F;  1VF9 A;  4A3M J;  4L0Y B;  4EJT A;  1G4D A;  2MD5 A;  4RB3 C;  1VQM I;  1JE8 A;  4A3B J;  3T8T A;  1ETW A;  2E1N A;  1T2K A;  4EM1 A;  2JRT A;  1O7F A;  1KYZ A;  3RPU D;  2BY3 A;  4BL0 B;  3CUO A;  1IXR C;  2E71 A;  5HDG A;  1VQ4 I;  3L2R A;  4C3J J;  2OQR A;  3E97 A;  5CQE A;  3CF5 F;  3P9I A;  4GFB A;  4NC7 A;  3KP4 A;  1DQU A;  4O3M A;  4HDV A;  5M3F J;  3DBH B;  4QTR A;  3ERM A;  4G7H F;  2A61 A;  1VZ0 A;  2K3P A;  4DYQ A;  2UXX A;  4BJ6 C;  4J00 A;  3OYG A;  1IN4 A;  3IWF A;  4I76 A;  1XG1 A;  4DZP A;  3ZOB A;  3W2V A;  4FAS D;  2MSY A;  1SD6 A;  5GAE J;  1TT0 A;  4ZYE A;  3K4M A;  1RUN A;  2CW7 A;  3FKI J;  5JR3 A;  4LLG F;  1ZG1 A;  3Q3S A;  3AG3 H;  3JTG A;  4B09 A;  1PP8 F;  4Y13 A;  1HOM A;  2ZC2 A;  4I6Z A;  3CCV I;  2CJJ A;  2KRH A;  1F5T A;  1MJB A;  2E60 A;  2VB6 A;  5HS8 A;  4MQV A;  1XD7 A;  2EA4 A;  3D5L A;  4HEA 2;  1S6L A;  3WTY C;  5GAH J;  2CO5 A;  2LBF B;  2GM4 A;  3BY6 A;  3VPR A;  3ZRG A;  3TED A;  4LJZ F;  4EJO A;  1DUX C;  2V9V A;  2HQ5 A;  1BA5 A;  2P0W A;  4K2E A;  4MLO A;  2NNY A;  2CUE A;  2XPV A;  1JJ6 C;  3A0H C;  3RKX A;  4E6K G;  3GTQ J;  3JTH A;  1XMK A;  4XKV A;  2PLY A;  2GOM A;  2CSO A;  2JSP A;  4XKB A;  1CF7 A;  1N78 A;  3HHH A;  2V9P A;  2VJ5 A;  4NUB A;  1YQA A;  1DDN A;  2ZSI B;  4Q48 A;  4UVA A;  3M8F A;  4BAY A;  3VB2 A;  3GX4 X;  3DKY A;  4ESJ A;  3FIW A;  3CUQ C;  1Z6R A;  1IUF A;  2XIG A;  3BG7 A;  1TQM A;  3A01 B;  4H4K C;  2M45 A;  1R71 A;  1ONV A;  3BG3 A;  3AL0 C;  3N97 A;  3GTP J;  4XQF A;  2KJB A;  4D5C A;  2PG4 A;  1BI3 A;  4XID A;  1XMX A;  2KDO A;  2IAI A;  2W82 A;  5JLX A;  2KRC A;  3HIF A;  3I59 A;  2HTJ A;  4V19 K;  1DP7 P;  4NBQ A;  3ZQC A;  4G6Q A;  1BM9 A;  2BVM A;  1OYI A;  2R7V A;  3JR9 A;  5E8I A;  1A6Q A;  5FB2 A;  1AOY A;  4RA2 A;  3CJT B;  2RC4 A;  4IQ4 A;  3GLX A;  4ZDP A;  1D1B A;  5CPR B;  2X6O A;  3SDG A;  2DA2 A;  2NS7 A;  2EPF A;  3MKY B;  4YFK F;  4QPQ A;  1ERD A;  3D1N I;  3CCL I;  2DOA A;  2O5R A;  4ZZL A;  3ZMS A;  3HB9 A;  3K70 C;  2JUC A;  2AQE A;  4PJ0 C;  2Y0S A;  5H6R A;  2VE8 A;  3GUD A;  4D0P A;  1OIS A;  3L2V A;  1TLH B;  2XGC A;  4O5V A;  1XX5 A;  4HSR A;  2NVX J;  2E1C A;  3EPZ A;  1I39 A;  2IVM A;  1H89 C;  2H8R A;  2EZK A;  3ZGK A;  5A2Q K;  4U7D A;  2WA0 A;  1R7J A;  2HNH A;  2MC4 A;  3FZV A;  3PUF A;  4HF1 A;  3REO A;  2P7V B;  3RQ4 A;  5CVV A;  2JQ7 A;  2L4A A;  3R0J A;  1TWH J;  1BI2 A;  1FSE A;  1SAN A;  1TQI A;  2BEO A;  3HTU A;  3HYI A;  3MZ8 A;  4XBF A;  3MQ0 A;  2L7M P;  3KIO A;  1QQI A;  3E7L A;  2XB5 A;  2ECB A;  5EJC A;  3RYP A;  5ILV A;  2DK5 A;  1B1B A;  3JAM K;  2XKO A;  2CGP A;  3S16 J;  1MIJ A;  2TRT A;  2VXD A;  2PX9 A;  2ISZ A;  3EET A;  4HX8 A;  5BPD A;  3DLA A;  1Y39 A;  4MTE A;  1SMY F;  1TL8 A;  1X1A A;  4DNC A;  4UUS B;  4BU2 A;  3HXL A;  3OR2 C;  3OMY A;  2PJR A;  2DYR H;  5HDK A;  1RKT A;  4G8X A;  2XRO A;  5HLG A;  2W24 A;  5LBQ A;  2FMY A;  3F6O A;  3WHB A;  2ZKZ A;  4ZJZ A;  3EUA A;  5TGT A;  1QZZ A;  2ZXJ A;  1O3S A;  1U0J A;  2VBX A;  3ZMV A;  4Y17 A;  4LOC A;  2E36 A;  5EDN A;  1D5Y A;  2DA1 A;  3DBL B;  5F0F A;  4F92 B;  1QO0 D;  3FXM A;  1PUE E;  4C2T A;  1G59 A;  1FOW A;  1H8A C;  1WZ2 A;  4ZYD A;  3HOT A;  1HQC A;  2VBY A;  4IO9 F;  3A03 A;  3Q9V A;  1Z9C A;  2OJE D;  3F8M A;  3BLY A;  3W2W A;  2WAQ N;  1Z77 A;  4EAT A;  1A5J A;  1E17 A;  5FRO A;  3F23 A;  1O7L A;  2DLL A;  3ECH A;  1OR7 C;  1KQ9 A;  2NOG A;  2QM3 A;  2V6C A;  3HUG B;  2WAE A;  1PVE A;  4Y7N J;  1NK2 P;  2XC7 A;  5IY5 H;  5JHU A;  4ENK A;  4CCK A;  1XB4 A;  1YYV A;  2XPW A;  3ZQI A;  1IUY A;  2RN7 A;  4HYE A;  3C2G A;  2QQB A;  1QZE A;  1QHG A;  1U6G A;  2K7L A;  1IXS B;  3K1M A;  1XGO A;  2FJ1 A;  2W85 A;  1FPQ A;  4G9Y A;  3CMY A;  2VQC A;  1GV5 A;  3T5X A;  1VQ6 I;  2MH2 A;  1JT6 A;  2WTE A;  2CQK A;  4AYB A;  2E7X A;  4ZDO A;  2VKV A;  3BR0 A;  3E6C C;  3K10 A;  2CRG A;  1RC9 A;  2DFE A;  1OLT A;  3KYD B;  1DU0 A;  3EYI A;  3PQK A;  3A02 A;  3KZY A;  1OYW A;  1YOV B;  1GDT A;  3C7J A;  3HKZ N;  4Y3O A;  1BOA A;  1PUF A;  2B7E A;  2VOP A;  1Z7L A;  1XC5 A;  3LSH A;  3A2K A;  3Q5F A;  3HDD A;  1FIP A;  3F0C A;  3G1M A;  1X4O A;  4LG0 A;  3GZ5 A;  3Q0W A;  2DBB A;  5EF6 A;  4BXX J;  5KAF C;  4CDG A;  5DCF A;  5LFA A;  4CYC B;  1RI7 A;  3C2B A;  1W4M A;  5DD4 A;  1ZAO A;  2EZL A;  4ENJ A;  2VBW A;  2K9L A;  5E1W A;  3D0S A;  3KX2 A;  4X1E A;  2EIM H;  3MCZ A;  3QPT A;  2IEK A;  2VON A;  3S3O A;  1L0O C;  2K9N A;  5CLS A;  3L2C A;  1O3Q A;  1ZG3 A;  4XLA A;  3QYE A;  3KYC B;  3WTZ A;  4OWR B;  2RAE A;  1EV7 A;  4CCL A;  3BG6 A;  3K4L A;  3QP5 A;  3PL8 A;  3KFW X;  3SZP A;  1Y0N A;  2ZNY A;  1Y6I A;  4M3F A;  3JRG A;  1HCR A;  2VBZ A;  4NC8 A;  3BOQ A;  3ABL H;  1KYW A;  1V5G A;  2DMU A;  4AIK A;  4M9S A;  3TBI A;  1ZH5 A;  1MZB A;  1ZGA A;  3MKW B;  5L3C A;  4FHT A;  1UHM A;  3HOW J;  1ZAR A;  2VJI A;  4C9Y A;  2BW3 B;  2J5O A;  3HG9 A;  4L5J A;  1D8J A;  2E1M B;  9ANT A;  1O57 A;  2DW4 A;  2LVS A;  4BDZ A;  3GTJ J;  2DQR A;  3C2H A;  3PM1 A;  4WXD A;  3OOU A;  2LNB A;  3KEY A;  1Y8R B;  4P1W A;  4LIU A;  3ZN1 A;  1I6X A;  2R93 J;  3PIO F;  2DFF A;  2P8T A;  3S1M J;  3VWB A;  4WCG A;  5AIP A;  2ZNZ A;  3MFK A;  2OBP A;  2BY0 A;  4M3D A;  3KYL A;  2X48 A;  2XGX A;  1T39 A;  2PQ8 A;  1Z1D A;  5KCM A;  2FQ4 A;  1MMG A;  3FDY A;  2FX0 A;  5M3M J;  4XON A;  1D0Y A;  3HBL A;  5KVR A;  5IYB J;  5DV5 A;  1ZK8 A;  5EEA A;  1BL0 A;  2F5C A;  3V8K A;  1Z7U A;  2OCE A;  5FKO A;  1NG7 A;  5KHD A;  2JN6 A;  1X3W B;  1FOK A;  3WGH A;  3LSJ A;  2X6W A;  2GXB A;  4JX4 A;  2GXA A;  3CZ6 A;  1SVO A;  2ESN A;  3DPL C;  4RM3 A;  5D8L B;  1BN5 A;  2WY8 Q;  2LKS A;  1Y1V J;  3RPQ A;  2Y48 A;  1IN8 A;  2RKH A;  2I8D A;  2LBF A;  3G3Z A;  1JGS A;  5ICC A;  3DV8 A;  1J2X A;  1UJ8 A;  3FX3 A;  4M3G A;  4UVC A;  4YG2 F;  4HRI A;  5DM6 F;  3ZMZ A;  3OYJ A;  1X1P A;  2FU4 A;  4GYI A;  1RET A;  2PBI A;  1U5T C;  2QKM B;  1PJR A;  5BS6 A;  2G0E A;  1FOY A;  5CKT A;  4LMY A;  3K4B A;  2EV5 A;  5EZH A;  4A3D J;  4BQO A;  1CQT A;  4AM3 A;  1NG6 A;  2NAZ A;  1CF7 B;  4AC0 A;  4BE2 A;  1UCR A;  2DOD A;  2MBF A;  3JAM Z;  1BC8 C;  4EJV A;  1IDY A;  5E17 F;  2L9R A;  2QWW A;  2R3S A;  4YEL A;  4YFN F;  2XKP A;  2X6X A;  5K1Y A;  3H9Q A;  3AAF A;  4HQE A;  1ZLK A;  2HDC A;  1FMV A;  4MIM A;  2ZXI A;  3VFZ A;  4WK8 F;  3WOD F;  4LK0 F;  1YJW I;  1RIO H;  2DCE A;  3A01 A;  1D0Z A;  1ORK A;  3WGI A;  3HOY J;  1LFU P;  3J7A Y;  1G8X A;  4UV8 A;  4AID A;  4B3X A;  1GVJ A;  1YLF A;  4BH9 A;  2DPD A;  3GFJ A;  2QCO A;  4RAF A;  3SFI A;  3RSN A;  1VQN I;  4N0B A;  2VT2 A;  5IYD J;  4LIT A;  3AFH A;  5HOD A;  4XLE A;  3RTR A;  1YIT I;  5FFZ A;  4IPA A;  3H3U A;  2Z16 A;  5HLI A;  3JW4 A;  2XAU A;  2Q1Z B;  3G4S I;  1ETO A;  1WPK A;  2IRF G;  5FO5 A;  3J80 Z;  4KNY A;  4A3L J;  5K7F A;  1LFP A;  2YX7 A;  3M8J A;  2FML A;  3GFI A;  4PUS A;  4XSZ F;  2ZME C;  4D5F A;  3OYF A;  1TWC J;  4PCQ A;  1T95 A;  3BPV A;  3P9K A;  3S1Q J;  2R7R A;  1YW9 A;  3GWZ A;  4UXN A;  3LSG A;  3S93 A;  1JKO C;  3WTW C;  1K4T A;  2X9D A;  3WG7 H;  3LSK A;  3LL7 A;  5IP7 J;  4CA0 A;  3MZY A;  2H94 A;  2FE3 A;  1F1Z A;  1VQL I;  3HGG A;  1IRF A;  1WCM J;  4FT8 A;  1TWA J;  3GME A;  5JVT A;  1BIB A;  3BR5 A;  3TQN A;  2XRL A;  3G1O A;  3LA2 A;  1E0E A;  1YIJ I;  2WV0 A;  1DGR M;  4LFU A;  2E7W A;  4MFD A;  5LD2 C;  2EIL H;  2PJP A;  2HGC A;  4ETS A;  4Q47 A;  2R7W A;  5E3M A;  3TW7 A;  3FKJ A;  1XPX A;  1BI1 A;  1VQ8 I;  4ASN A;  1DP3 A;  5L3D A;  2R7S A;  3K6G A;  1SEU A;  2XPU A;  5DUK A;  1FTZ A;  1WH7 A;  1ETK A;  2GIV A;  4UUS A;  1KU7 A;  1OCO H;  2R0Q C;  2V9K A;  1ETX A;  2A6E F;  4KIF A;  3EQL F;  4JBA A;  2P5L C;  5HS7 A;  4DYC A;  1FNN A;  1POG A;  4RGU A;  2PMU A;  2W84 A;  3LSI A;  4XN3 A;  1XS9 A;  1MBK A;  1IXC A;  2O7O A;  4U0W A;  2AXT C;  4AVP A;  4CYD A;  3E0J B;  5DS9 A;  4F93 B;  1WQ2 A;  1JKP C;  4AIH A;  1R4M B;  5FJ8 J;  2R7T A;  4G7O F;  2HVQ A;  2Y69 H;  3J81 Z;  2O0Y A;  4LGW A;  3JSO A;  1OPC A;  1ZLJ A;  1P6R A;  2VQG A;  2DYS H;  2F5E A;  1JTY A;  2BHZ A;  2QVO A;  2JPC A;  4FET A;  1OCZ H;  2EFQ A;  2QSG X;  1YS6 A;  3E3V A;  3CCE I;  3CJQ B;  1ZGW A;  2DXI A;  4PSW A;  3HZJ A;  3HUG A;  2FXA A;  2EWN A;  3OIQ A;  1QNT A;  3MN2 A;  3NAR A;  3C18 A;  1ON2 A;  2LDU A;  3U21 A;  3OYD A;  4FX4 A;  1SFO J;  1B9N A;  4BQN A;  4HA8 A;  2P5V A;  4XLH A;  3ERE D;  1CGP A;  1Q1H A;  3LQR A;  3VOD A;  5FLV A;  2HKX A;  1KQ0 A;  2F4M B;  1VQK I;  2EK5 A;  3B73 A;  4YRV A;  1YI2 I;  3KP2 A;  2ICW G;  1IN7 A;  5FD6 A;  2OA4 A;  3BT9 A;  1Z67 A;  4CO8 A;  4D7M A;  3I4P A;  3HRM A;  5J6X A;  3OSG A;  4S0H B;  1T6S A;  3LQQ A;  4N9I A;  3WE3 A;  1JKQ C;  3RKQ A;  1FX7 A;  1N25 A;  3UNG C;  3FHN A;  4UNO A;  2M8G X;  1EF4 A;  2HKO A;  2WWY A;  4E7H A;  2Z2S B;  1PYV A;  2HYF A;  1VFC A;  1YO5 C;  1WGX A;  4PGG A;  5DTD A;  3K7A J;  5E3N A;  2YU9 J;  2E2H J;  4PJM A;  1HW1 A;  3K2A A;  4BKX A;  1MBE A;  1HLV A;  5L3B A;  1K4S A;  1SFE A;  2IS4 A;  1I1S A;  4MFE A;  2K9Q A;  1IDZ A;  5ICE A;  1TW2 A;  2PFB A;  5DUI A;  3BJO A;  5HDN A;  1AU7 A;  1YX5 A;  3CLO A;  3OYL A;  2JK3 A;  3CUQ B;  1WWX A;  2FA5 A;  4M9Z A;  3ZQQ A;  5DD8 A;  3RKW A;  1M1E B;  2JT1 A;  3MD2 A;  4CYC A;  2M8E A;  2P81 A;  1QU3 A;  3HOS A;  1TWG J;  2R92 J;  1OFC X;  2M87 A;  3ESW B;  2OD5 A;  4KIC A;  4J19 A;  2E5Z A;  2H1K A;  2EV0 A;  4F52 A;  1HBX G;  1GVD A;  1OYY A;  2LOO A;  2ZFU A;  4RGR A;  4GGG A;  3S3M A;  3LMM A;  3QAH A;  3EYY A;  4B43 A;  1ZEL A;  2X1C A;  2W25 A;  5IYC J;  2BXY A;  1HDD C;  2P5K A;  1JUS A;  3FXK A;  4YEJ A;  5DYM A;  1FP1 D;  3CDH A;  4ENM A;  1EKE A;  1QGP A;  1R1T A;  2LY2 A;  2WBM A;  4BXF A;  1SC7 A;  1H9G A;  2BW3 A;  2HR3 A;  1WJD A;  2IA2 A;  3GW2 A;  1XGN A;  3AG1 H;  2IGK A;  4EV0 A;  2VOD A;  3DTE A;  2NYX A;  5K7H A;  5B3S H;  1YTY A;  1VQP I;  2BYV E;  2K4B A;  3DEW A;  2P6S A;  1V5E A;  4Q5S F;  1FYK A;  3GCM A;  3UR3 C;  4IF4 A;  1WSU A;  4GRI A;  1QVT A;  1I3A A;  3IL2 A;  1MH3 A;  4ZYH A;  4IVN A;  4LK1 F;  3H5N A;  3KP5 A;  2HVR A;  3RZO J;  1JXS A;  1WI3 A;  2K4J A;  1TC3 C;  2FBH A;  4PK4 A;  4XSX F;  1HW5 A;  3K2Z A;  3WGG A;  3SHF A;  2VKE A;  2XB0 X;  3OS0 A;  1OJL A;  4A3E J;  3ECO A;  4GCV A;  1MSF C;  2Q0O A;  2DOF A;  5DCM B;  3OR1 C;  2DTR A;  3K9T A;  3KET A;  2GLO A;  2KZG A;  3M07 A;  4Z6Y A;  1VQO I;  2PMZ A;  3HSR A;  4E7L A;  4I99 C;  3WU1 B;  1MDM B;  3H3Z A;  1A36 A;  4OMY A;  1T08 B;  5L3F A;  1P7J A;  3L9F A;  2GA2 A;  3GBG A;  4KT6 A;  4FTH A;  3WTU C;  2Z9O A;  2ZSH B;  3BRO A;  2F4I A;  2R5Y B;  1W7P B;  1IGN A;  2WC2 A;  1ZRD A;  1EA3 A;  3PSI A;  4BY7 J;  1KU2 A;  4MHG A;  2IJL A;  2MD0 A;  5D8K B;  4BGD A;  2K3F A;  1FSH A;  2WB1 A;  3PQJ A;  1QBJ A;  3I4M J;  2F5D A;  5EGO B;  4BS9 A;  2CS3 A;  2A07 F;  2UUZ A;  1FYL A;  1XSV A;  4MTD A;  1BJZ A;  3F8F A;  3K1P A;  2O03 A;  4ON0 A;  1MMS A;  1IN5 A;  5BPI A;  4CSW A;  3LAJ A;  1TBX A;  3ABK H;  1KU9 A;  5HS9 A;  2A5Y B;  3KZI C;  3OOP A;  4DIQ A;  4KN7 X;  3SQN A;  1P7I A;  3CMM A;  3CCU I;  1LVA A;  4DOZ A;  3D5R C;  4LB5 A;  2BV6 A;  4ANJ A;  1D0X A;  4HNV A;  4PDK A;  2F48 A;  2CWE A;  2OTJ I;  4XRS A;  3DWL E;  4IXA A;  5AIQ A;  3F22 A;  4CH7 A;  2DA7 A;  1GXQ A;  1X3Z B;  1IRZ A;  2L9S A;  2COB A;  2VI6 A;  2L7Z A;  4PSX A;  4IHY A;  4OIP F;  1MGT A;  5L3G A;  4KMF A;  4D7N A;  1OCC H;  1XCB A;  3S17 J;  1LUJ B;  4CCM A;  4IHV A;  2MW8 A;  2VN2 A;  3GZN B;  1T98 A;  4BAC A;  2QSH X;  4HV5 A;  3ABM H;  1HW2 A;  3CME I;  2V26 A;  1DPR A;  5LRR A;  5J47 A;  2IGN A;  3BDD A;  4HG2 A;  3CP2 A;  1V3F A;  2B0L A;  2XRN A;  2UXN A;  1P92 A;  2D1V A;  4RAY A;  4EQQ A;  1ZRC A;  3FHZ A;  1B59 A;  1ZGJ A;  3LSM A;  2L3D A;  1FYM A;  1K79 A;  1LQ1 A;  4YIR X;  1JI8 A;  1IV8 A;  2E35 A;  2TCT A;  4HLX A;  3P7N A;  4M74 A;  3I4N J;  4RGS A;  4XLF A;  1FZP B;  3RKY A;  4KMU X;  2ISY A;  2O8K A;  3ASO H;  4HNU A;  1VQ5 I;  1S7A A;  2RVC A;  2RNJ A;  3FM5 A;  1BR2 A;  1H88 C;  4L0Z B;  1K6O A;  5CYV A;  2VAS A;  2KFD A;  3L2W A;  5FKK A;  3IH2 A;  5J8F A;  4U7B A;  3NEU A;  1XSD A;  3MWM A;  4N9H A;  4A3C J;  4MGR A;  1T0F A;  3BC8 A;  2DMP A;  2W4S A;  5M5W J;  1P4X A;  5BMZ A;  2ELK A;  1QZY A;  2KIQ A;  2ZXW H;  1D1C A;  4PJN A;  3I56 I;  1U8R A;  5E1Z B;  4TV7 A;  4B3A A;  1QHH D;  1RNL A;  1FIA A;  2R7F A;  1IV6 A;  1AWC A;  2NS8 A;  3JRH A;  4M73 A;  5EZG A;  4L18 B;  1IRX A;  1OCP A;  4NQW B;  1LDJ A;  4D9J A;  5ILS A;  2VLA A;  4R1H A;  4QIW N;  5TIS C;  3OYE A;  4ZC3 A;  2JSC A;  2IT0 A;  2D45 A;  4G12 A;  3AKZ A;  3E5Q A;  3RI4 A;  4LG3 A;  1X4P A;  3EUK L;  3R61 A;  4IHX A;  2X85 A;  1S5L C;  1KA8 A;  3V4G A;  3DEU A;  3G2B A;  3F8C A;  4AWX B;  2ZJQ F;  1HSJ A;  3RQI A;  1TQP A;  1REP C;  2R7D A;  2OU2 A;  2BHY A;  5LEJ A;  2OF7 A;  2DA5 A;  2KZV A;  3OYH A;  1W0T A;  1S7O A;  1FBU A;  3E6B A;  3DKX A;  5DEQ A;  2AHQ A;  1BC7 C;  1R5H A;  3A4C A;  1FOX A;  5C44 J;  1UFM A;  2CV2 A;  5IP9 J;  3IV5 A;  2IA0 A;  2QA4 I;  3BJ6 A;  3FXU A;  1ZRF A;  1MBG A;  4IKF A;  4O6J A;  4E7I A;  4XOR A;  2LTP A;  1JTX A;  1TWF J;  2ESH A;  1JKR C;  2KIS A;  2DT5 A;  4RMN A;  5K5R A;  4ESB A;  1FLI A;  2V1U A;  1Z05 A;  3PSF A;  3BR2 A;  1W36 D;  2K9S A;  1MH4 A;  4Y4R A;  3DU6 A;  2CW8 A;  2LF8 A;  4HBL A;  4UHT A;  3ISP A;  1WJE A;  5FLX K;  2L5Q A;  4HAM A;  4BE1 A;  3I3L A;  2QUF A;  3I64 A;  4P9U A;  5D6F A;  5LGU A;  1OQY A;  1O4X A;  1HKS A;  2XAQ A;  2OTL I;  2PEX A;  3DU5 A;  4D1Q A;  2QLZ A;  2L9N A;  2LSO A;  1NTC A;  4MO7 A;  3HGY A;  5FRN A;  4YFX F;  5IPA A;  4JP0 A;  4KFC A;  1JUP A;  2KMU A;  1JHF A;  2BZT A;  2RV8 A;  4BJT A;  3OS1 A;  3ROU A;  5F64 A;  2DJI A;  3CUQ A;  2E1O A;  2R7Q A;  3K4K A;  1V4R A;  4XRS G;  3FF5 A;  5ILU A;  5IOY A;  4HF0 A;  3NWS A;  3CDL A;  3FXQ A;  1D3Y A;  3K69 A;  3L00 A;  2IGM A;  1GLN A;  4F3Q A;  1R23 A;  1YW8 A;  4I2O A;  3PO2 J;  2LD5 A;  2DA4 A;  4HF2 A;  3BZ6 A;  4JYK A;  5CVI A;  4FE7 A;  5DDG A;  3BG5 A;  3OYB A;  5FD5 A;  1FY7 A;  2HS5 A;  2KLO A;  3OIP A;  2VIX A;  3F9K A;  3ZQ7 A;  4J01 A;  2DQL A;  1BR4 A;  3G71 I;  4BEH B;  2KT0 A;  3ZP5 A;  2DK8 A;  4ZYG A;  1P2F A;  2DT6 A;  1WJ5 A;  1WJB A;  4LLN A;  3S2W A;  5JHF A;  2YR2 A;  2DDB A;  5B66 C;  1S8N A;  4EM0 B;  1XTA A;  3Q0V A;  5FKM A;  4OMZ A;  4E7Z A;  2IP2 A;  3OIO A;  3N05 A;  2FEZ A;  2ZME B;  1SVL A;  4N4O B;  5C4X J;  1C0W A;  3H35 A;  3QOE A;  5F08 A;  3G1L A;  2UZK A;  5TRD A;  1EH6 A;  3I54 A;  4G6D A;  1RRJ A;  4EGZ A;  1YRN B;  4I0A A;  5FRM A;  2XHK A;  5J1U A;  1X19 A;  3O8H A;  4BXU A;  2JA8 J;  1MBH A;  4RLQ A;  5AON A;  4II3 A;  2ZJP F;  5LHI A;  1B72 B;  1WKM A;  2HOS A;  1MND A;  3FM3 A;  3BPX A;  3LFU A;  4PGH A;  2H6C A;  5H6Q A;  5ED4 A;  2OZU A;  4W1U A;  2QEN A;  2VC1 A;  4XMY A;  5DCM A;  1UAA A;  1DU6 A;  2CU7 A;  1BI0 A;  1MW7 A;  2EFO A;  4A5M A;  3LOC A;  5GPC A;  4A2U A;  4DYR A;  4Y15 A;  2NVY J;  3I9V 2;  1UG2 A;  3ULQ B;  1JJ8 C;  1PP7 U;  1MDM A;  2V1X A;  2E34 A;  3BTC A;  5J8C A;  3I53 A;  3ZR8 X;  3OS2 A;  5H2F C;  3HJE A;  4A3K J;  1HST A;  5A2Q Z;  2DAO A;  2EB7 A;  4ZTF A;  1U3E M;  1KON A;  2R5Y A;  2VJJ A;  1W7P A;  4RAZ A;  3CTA A;  1DPU A;  4QWQ A;  3C3W A;  2K27 A;  2HPI A;  2XVC A;  2HI3 A;  4GXO A;  3C1D A;  5F6F A;  3V7S A;  4L5I A;  1XMA A;  1ZR2 A;  4BHP A;  4HST A;  5JLW A;  1IC8 A;  3GZ6 A;  3WU2 C;  3SDB A;  4R79 A;  2WV1 A;  2RGV A;  4P96 A;  4E70 A;  2L0K A;  2WAQ A;  2CQQ A;  1RR8 C;  3H9G A;  5EGO A;  2YSR A;  2F2E A;  2XGE A;  2GA1 A;  2XAF A;  3BWG A;  3DF8 A;  3SYT A;  4B4C A;  1U8B A;  4BUP A;  2BE5 F;  2JZY A;  3H5A A;  3FXO A;  4IL6 C;  2KIF A;  2VE9 A;  3FMS A;  3IUO A;  4BHB A;  1V54 H;  4ABZ A;  4IHW A;  4OAZ A;  1YE9 A;  1B6A A;  2NVU B;  2CUZ A;  4BYY A;  2KJC A;  1IJW C;  1OR7 A;  2UV1 A;  4HX7 A;  5J40 A;  3T0Y A;  3TP0 A;  2DPU A;  1BJA A;  3B02 A;  2VXZ A;  3JRD A;  2CV1 A;  1FBQ A;  3A0B C;  4OIN F;  4OIO F;  1G3T A;  1R1U A;  3CES A;  3HOZ J;  4AU7 A;  5E3O A;  3IAS 2;  4OU0 A;  3DFG A;  3FWE A;  4FX0 A;  2STT A;  5DM7 F;  2JRM A;  1LDK B;  3TOB A;  3PIP F;  3HKZ A;  5ICF A;  1SAU A;  3H3V K;  2W00 A;  4KIT B;  2JMW A;  5E20 A;  2XF5 A;  4B44 A;  3HOU J;  2IS6 A;  2QGU A;  3PFY A;  5BQT A;  3S3N A;  2BOL A;  1DGW Y;  3QYB A;  2CMP A;  3S1R J;  2DTZ A;  1HKQ A;  4PJL A;  5CVJ A;  1Y1W J;  2V79 A;  3OY9 A;  1Z3Y A;  1QPM A;  3TO9 A;  1W1W E;  3NRV A;  2FOW A;  4M71 A;  4NNJ A;  1SFU A;  3L2U A;  1I1G A;  5EG0 B;  2HQN A;  3EUH A;  3VDX A;  2DMQ A;  3E6M A;  2HYJ A;  2P6T A;  4DJA A;  3ABU A;  3IKV A;  4KDP A;  1HC8 A;  1YW7 A;  2HQA A;  3TP3 A;  3I71 A;  3HOX J;  3K70 D;  2JA6 J;  2FOK A;  3SEQ A;  3QWL A;  2QZ8 A;  2XDV A;  3PFI A;  3ZQF A;  5HVQ C;  1I3Q J;  2M34 A;  3Q9S A;  5FKN A;  5FLX Z;  2HOT A;  3BR1 A;  2L01 A;  3DXJ F;  2BVL A;  3V7R A;  5EYR A;  2ZBK A;  2Z3Y A; 
#chains in the Genus database with same CATH homology
 3B6C A;  3E7L A;  5GP9 A;  2XB5 A;  2ECB A;  3W6V A;  3DEW A;  1RKW A;  4M6V A;  5F1J A;  1U9N A;  1QVT A;  3S16 J;  2TRT A;  1MH3 A;  2W48 A;  4C3H J;  4XK4 A;  3RZO J;  1WI3 A;  1MBJ A;  3L1P A;  1TC3 C;  2Y9Z A;  3BR3 A;  4UUS B;  1E3O C;  2LK2 A;  2VKE A;  2XB0 X;  4A3E J;  1OJL A;  1ITY A;  1RKT A;  1MSF C;  3PO3 J;  1VND A;  1FEX A;  2Y2Z A;  3WHB A;  3GTG J;  2GLO A;  2ZB9 A;  3MKL A;  1QPI A;  4LOC A;  5EDN A;  1D5Y A;  2DA1 A;  5F0F A;  1P7J A;  3GBG A;  4FTH A;  4M3E A;  2MG4 A;  2R5Y B;  3Q0U A;  1BW6 A;  1H8A C;  1G2H A;  1IGN A;  2E19 A;  4BBS J;  4V2F A;  3A03 A;  4L5E A;  4BY7 J;  3ZQH A;  2HOA A;  2DJN A;  2WAQ N;  1Z77 A;  2LP0 A;  2JJ7 A;  5GPA A;  1A5J A;  1Q1V A;  2NOG A;  2DA3 A;  3I4M J;  4Y7N J;  1ETV A;  1NK2 P;  5EGO B;  3GTM J;  5K7Z A;  2HXO A;  3JRC A;  2E2J J;  2XPW A;  2VPR A;  3ZQI A;  1BJZ A;  2FJ1 A;  2XGD A;  3IH4 A;  1AHD P;  3M4O J;  3CMY A;  1W0U A;  4XIC A;  3CCY A;  3BTI A;  1GV5 A;  3ZQL A;  4A93 J;  3MVP A;  3WHC A;  1P7I A;  1JT6 A;  3BQY A;  1ETQ A;  1FTT A;  1QRY A;  5BNG A;  1UMQ A;  5F0C A;  2VKV A;  3SJM A;  3BR0 A;  4HNV A;  2CRG A;  4IEJ A;  2L7F P;  4XRS A;  1GUU A;  3B6A A;  1T33 A;  2KDZ A;  4JX5 A;  1DU0 A;  3A02 A;  1ZQ3 P;  2DA7 A;  5IOZ A;  1GDT A;  3HKZ N;  1IRZ A;  2YS9 A;  2COB A;  4BBR J;  1PUF A;  2VI6 A;  2L7Z A;  4IHY A;  1XC5 A;  3HDD A;  4D7N A;  4QSH A;  3S17 J;  3O8G A;  1FIP A;  3F0C A;  3G1M A;  5C3E J;  4IHV A;  2MW8 A;  3Q0W A;  1AKH B;  5EF6 A;  4BXX J;  4CYC B;  3C2B A;  1I50 J;  2R5Z A;  2YUS A;  4FCY A;  2EZL A;  3GTO J;  2Y0S N;  4X1E A;  5J1Y A;  2DA6 A;  2IEK A;  2DMN A;  2K9N A;  4V2G A;  1U9O A;  2RAE A;  4FE4 A;  1JT0 A;  2TCT A;  2JA5 J;  4W97 A;  1RR7 A;  3S15 J;  3I4N J;  4M3F A;  3JRG A;  1HCR A;  2DMU A;  1FJL A;  1Z0X A;  1WH5 A;  2O8K A;  4M3B A;  4RDU A;  3HOW J;  4JX6 A;  1JUM A;  5M5X J;  3BG9 A;  9ANT A;  1H88 C;  1LE8 A;  1OCT C;  2LVS A;  3GTJ J;  4A3F J;  3PM1 A;  5IP6 A;  2Y31 A;  1F43 A;  3OOU A;  4A3C J;  5FKK A;  3IH2 A;  1YRN A;  2DMP A;  3S2D J;  2R93 J;  5M5W J;  4A3I J;  2ELK A;  3S1M J;  1HDP A;  4DZJ A;  4B3A A;  2CUF A;  2X48 A;  1B72 A;  1FIA A;  5E3L A;  3LSR A;  1IV6 A;  2LKX A;  2NS8 A;  3JRH A;  2NVQ J;  2QF7 A;  2FQ4 A;  5EZG A;  4RBO A;  2FX0 A;  5M3M J;  1OCP A;  3HBL A;  5IYB J;  4QIW N;  1IG7 A;  2LR8 A;  1ZK8 A;  5F04 A;  5EEA A;  1BL0 A;  4G12 A;  4C2M J;  3LSP A;  3S14 J;  3JRB A;  3FK6 A;  5FKO A;  2JN6 A;  2PMZ N;  4IHX A;  3LSJ A;  3FK7 A;  2NVT J;  4JX4 A;  3RQI A;  1Y1V J;  3OSF A;  1R9T J;  2OF7 A;  2DA5 A;  4M3G A;  2IBD A;  1W0T A;  3JRE A;  5J1R A;  3LNQ A;  2HXI A;  1RET A;  3GTK J;  2R7Z J;  2AHQ A;  2G0E A;  2WB1 N;  5J3L A;  2EBI A;  3BTL A;  5C44 J;  5IP9 J;  3IV5 A;  5EZH A;  1ENH A;  4A3D J;  1CQT A;  2CQX A;  1MBG A;  4AC0 A;  2LFB A;  2VUM J;  5FKL A;  2LTP A;  3JRF A;  1U78 A;  1JTX A;  1TWF J;  4UUT A;  1RPW A;  1JKR C;  1IDY A;  5F0H A;  1QVU A;  2L9R A;  3BQZ A;  1VI0 A;  2N8G A;  3BR2 A;  4MIM A;  2K9S A;  1MH4 A;  5FLM J;  1MSE C;  1F36 A;  4DW6 A;  3A01 A;  1ORK A;  3UKG A;  3HOY J;  1LFU P;  4BY1 J;  4AYB N;  3FIS A;  3S1N J;  3RZD J;  3QPS A;  1K61 A;  2K40 A;  2MGQ A;  2ID6 A;  2OPT A;  3IH3 A;  4C3I J;  1O4X A;  2M0C A;  1S7E A;  2QCO A;  3SFI A;  2O9L A;  2ME6 A;  1NTC A;  4MO7 A;  3HGY A;  1B8I A;  5IYD J;  5HOD A;  5IPA A;  2EH3 A;  4JP0 A;  1X58 A;  1JUP A;  4FIS A;  2I10 A;  1PUF B;  2ECC A;  2M2E A;  3CQZ J;  2E1O A;  2EZH A;  4XRS G;  1ETO A;  1WPK A;  5IOY A;  1BW5 A;  4A3L J;  3CDL A;  4A3G J;  5K7F A;  4XRM A;  2FD5 A;  3PO2 J;  2R5Z B;  2LD5 A;  2DA4 A;  4AUX A;  4D5F A;  3JRI A;  1TWC J;  1NK3 P;  4JYK A;  5EG0 A;  4FE7 A;  1GT0 C;  3BG5 A;  2JA7 J;  3S1Q J;  3LSG A;  1JKO C;  2X9D A;  5IP7 J;  4EEF G;  2AO9 A;  2KT0 A;  2LY9 A;  4A3J J;  3HGG A;  1VF9 A;  1WCM J;  1TWA J;  4A3M J;  1X2M A;  3BR5 A;  4B1R A;  2XSD C;  2EZI A;  2XRL A;  4A3B J;  3G1O A;  1ETW A;  2EQR A;  3Q0V A;  5FKM A;  1ZR4 A;  3OIO A;  1LE8 B;  2LLK A;  4MFD A;  1MNM C;  1MBF A;  5M5Y J;  1X2N A;  5C4X J;  5F08 A;  4C3J J;  3G1L A;  2E2I J;  5E3M A;  3TW7 A;  4GFB A;  3JRA A;  1YRN B;  5M3F J;  4QTR A;  1ZKG A;  2XPU A;  1FTZ A;  5J1U A;  3HEF A;  3S2H J;  1ETY A;  1WH7 A;  1ETK A;  4DYQ A;  4UUS A;  3O8H A;  3HOV J;  2JA8 J;  1MBH A;  4I76 A;  2R0Q C;  1B72 B;  1ETX A;  1XG1 A;  4DZP A;  3ZOB A;  2HOS A;  2MSY A;  1LFB A;  4DYC A;  3BTJ A;  1DU6 A;  4W1U A;  2ME0 A;  2CU7 A;  1POG A;  3FKI J;  5GPC A;  3LOC A;  2DMT A;  3Q3S A;  1XS9 A;  1MBK A;  2O7O A;  4DYR A;  1RES A;  2NVY J;  2M9H A;  1UG2 A;  5DS9 A;  1JJ8 C;  1HOM A;  1JKP C;  2ID3 A;  3BTC A;  4I6Z A;  5FJ8 J;  4A3K J;  2D5V A;  2CJJ A;  2HDD A;  2R5Y A;  1JTY A;  2HI3 A;  1ZR2 A;  2GM4 A;  2Y9Y A;  3VPR A;  3TED A;  5JLW A;  1IC8 A;  3TW6 A;  2B63 J;  2Y30 A;  1ZGW A;  1BA5 A;  2HQ5 A;  2WV1 A;  4MLO A;  2L0K A;  1K83 J;  2CUE A;  2CQQ A;  2XPV A;  3MN2 A;  1JJ6 C;  5EGO A;  3NAR A;  2L7M P;  3GTQ J;  1SFO J;  2XGE A;  3BR6 A;  1ZTR A;  5F27 A;  4B4C A;  1U8B A;  4NDL A;  5FLV A;  4X6A J;  4IHW A;  4ABZ A;  3M3Y J;  3BT9 A;  4D7M A;  3OSG A;  3DCF A;  1UHS A;  3FIW A;  4S0H B;  1JKQ C;  2DN0 A;  3RKQ A;  1JGG A;  1IUF A;  1IJW C;  3A01 B;  4Y52 J;  2M8G X;  1APL C;  3BG3 A;  1EF4 A;  3TP0 A;  1VFC A;  1WGX A;  3GTP J;  3JRD A;  5DTD A;  3K7A J;  5E3N A;  4D5C A;  2YU9 J;  2E2H J;  4XID A;  2IAI A;  3K2A A;  4BKX A;  3HOZ J;  1MBE A;  5JLX A;  5E3O A;  1A6I A;  1HLV A;  3ZQC A;  3HM5 A;  1B8I B;  4MFE A;  2K9Q A;  1IDZ A;  3H3V K;  3QQA A;  3JR9 A;  1AU7 A;  2JMW A;  1AKH A;  3H0G J;  3HOU J;  3NAU A;  2JK3 A;  3QPL A;  4CYC A;  2X6O A;  2P81 A;  3SDG A;  2R92 J;  1TWG J;  4A69 C;  1OFC X;  2DA2 A;  2DTZ A;  2NS7 A;  3S1R J;  3GTL J;  2GBY A;  3D1N I;  1Y1W J;  4J19 A;  1GV2 A;  2H1K A;  3HB9 A;  1GVD A;  1HF0 A;  5EG0 B;  2XGC A;  1I6H J;  2DMQ A;  2HYJ A;  5IYC J;  2NVX J;  5C4J J;  1HDD C;  1JUS A;  3TP3 A;  1H89 C;  2H8R A;  2EZK A;  3HOX J;  3ZQG A;  2JWT A;  2JA6 J;  1T56 A;  3ZQF A;  1I3Q J;  2M34 A;  5FKN A;  2HOT A;  3BR1 A;  1TWH J;  1SAN A;  5EYR A;  5K7H A;  4M3D A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...