4A3BJ

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3bJ00
3GTJJ 2CJJA 1U9NA 1JKRC 5IP6A 3GBGA 2VPRA 4MFDA 2O7OA 4CYCB 2HOTA 5IP7J 4FE4A 1ZR4A 3S1QJ 2DA1A 2DA2A 1QPIA 2DMPA 5C3EJ 3FKIJ 2ECBA 4BKXA 4IHYA 4NDLA 3RZOJ 1B72A 2HXIA 2WAQN 3LSJA 2DMTA 2L7MP 2DA3A 4FCYA 4IHXA 1IDZA 2JMWA 1S7EA 1HF0A 1TWHJ 4D7MA 1SANA 1ETVA 4AYBN 5K7HA 3B6AA 2B63J 4A3EJ 3TP0A 2E1OA 2ME6A 3BT9A 5J1RA 5E3NA 2AHQA 3OOUA 4M3EA 3PO3J 3HOZJ 3ZQLA 2XB5A 3A03A 2HQ5A 1E3OC 5IOYA 2ME0A 2L7ZA 2DA7A 1ZK8A 3Q0VA 5DTDA 3LNQA 5GPAA 5JLXA 5FLMJ 1TC3C 3S2HJ 5F1JA 4C3IJ 1WH7A 5EG0B 4A3MJ 3GTGJ 3BR5A 3BR1A 5C4JJ 1GVDA 2DA4A 3I4MJ 3HDDA 2Y31A 3CQZJ 4M3FA 4W97A 3GTMJ 3IH2A 4LOCA 3ZQGA 4M6VA 3IH3A 1JT6A 3OIOA 2JK3A 1X58A 4UUTA 4A3DJ 2XPVA 4D5CA 5M3MJ 2EZLA 1RKTA 1FTTA 4JX6A 3JRBA 3FIWA 1VFCA 2DMNA 3HEFA 3BTJA 4JX4A 4HNVA 3Q0UA 1PUFB 2WV1A 3HKZN 1GT0C 3UKGA 2ELKA 1TWFJ 3DCFA 4W1UA 1IGNA 1NK2P 1IG7A 3BTIA 3I4NJ 2XSDC 1UMQA 1U9OA 5M5YJ 1LE8B 1WPKA 1Y1WJ 5J3LA 1WCMJ 5C44J 2OF7A 5GP9A 2G0EA 3ZQHA 2K40A 4L5EA 5M5WJ 4FTHA 2M0CA 1HLVA 1QVTA 3ZQFA 4DYCA 1T56A 2DA6A 2NVTJ 3NARA 3MVPA 2LP0A 5FLVA 2LK2A 2CU7A 3HOUJ 1MH3A 3CCYA 9ANTA 2M34A 1H89C 2JA5J 3VPRA 3F0CA 3JRCA 3PM1A 4XRSA 4A3LJ 1MBGA 1VI0A 5EGOA 4S0HB 2IEKA 1IV6A 2XGEA 4I76A 1IRZA 5F08A 1FIAA 3QPLA 3TEDA 1XC5A 1MBHA 4BBRJ 3E7LA 2CQQA 2MG4A 2E19A 5EEAA 2XGCA 5J1YA 3JRDA 2R93J 5EF6A 1OCTC 4XRSG 1I6HJ 1Z0XA 2DMQA 3FK6A 1JTYA 3IH4A 4M3GA 5IP9J 1ZGWA 1MBFA 3LSGA 2MGQA 4DYRA 1MBKA 1Z77A 4UUSA 1F36A 2ID3A 2W48A 5BNGA 2LVSA 4ABZA 1IDYA 3S1RJ 3H0GJ 1EF4A 4EEFG 3BR6A 3RQIA 3LSRA 3GTLJ 2JWTA 1ETOA 1LE8A 1R9TJ 1I50J 1P7JA 2YS9A 2K9NA 3HB9A 5K7ZA 5EZGA 1FIPA 1G2HA 2VI6A 4V2FA 3GTKJ 1ITYA 2LY9A 3TW6A 3G1OA 1JUSA 5M5XJ 1JGGA 3M4OJ 2Y9ZA 4B4CA 3DEWA 2KT0A 5IYBJ 1RPWA 1TWGJ 1ZKGA 5C4XJ 1WI3A 2Y30A 3S16J 1P7IA 1Q1VA 3BG5A 5JLWA 3RZDJ 1LFUP 3JRAA 3IV5A 1FJLA 4DW6A 2FJ1A 4MIMA 3HM5A 2HI3A 2I10A 1JJ8C 3S1NJ 1ETWA 4XIDA 4AC0A 5M3FJ 3ZQCA 5HODA 1GV5A 3QQAA 3BG3A 5FKNA 4BBSJ 3JRFA 4MO7A 5FKOA 3QPSA 1MNMC 1HDDC 3JR9A 2H8RA 1ZTRA 2LD5A 3H3VK 4M3BA 4XICA 1B8IB 1X2NA 5J1UA 3HOXJ 3HGYA 4G12A 4JX5A 2R5ZA 4DZJA 1AU7A 1MSFC 4Y7NJ 4UUSB 1ORKA 1QRYA 1ETKA 2OPTA 1CQTA 4C2MJ 1POGA 2WB1N 3JREA 2LKXA 4A3FJ 3WHBA 1ZR2A 4JP0A 5FKMA 1JKPC 3BG9A 4FISA 1BA5A 1RETA 1ETXA 1B72B 5F27A 2JJ7A 3WHCA 2FD5A 3PO2J 2R5ZB 1YRNA 3FK7A 4D7NA 3Q3SA 1W0TA 1ETYA 1LFBA 2CUFA 2QCOA 1RESA 2X6OA 3BR2A 1I3QJ 2EBIA 2N8GA 3O8HA 4M3DA 4V2GA 3W6VA 5GPCA 1H8AC 2CQXA 3BQZA 4A3CJ 1SFOJ 2MW8A 1XS9A 3K7AJ 1OCPA 1UHSA 5F04A 1BW6A 4BXXJ 1K83J 2MSYA 1JKQC 2FQ4A 2YUSA 3S1MJ 2DMUA 2R7ZJ 3HOYJ 2HOAA 1AHDP 2Y2ZA 4IHVA 2XB0X 3SDGA 4X1EA 5EDNA 2GBYA 1D5YA 2ECCA 2L9RA 1RR7A 2E2IJ 2R5YB 1MBJA 2DA5A 2HOSA 1HDPA 2YU9J 3RKQA 2EZHA 2HYJA 3LSPA 1X2MA 2VKEA 1MSEC 2M8GX 3GTPJ 2X48A 2R0QC 2NS8A 3O8GA 1B8IA 3B6CA 3MN2A 4QIWN 1BW5A 4DZPA 2K9QA 2M9HA 2X9DA 1ETQA 5IPAA 4RBOA 5IYCJ 2AO9A 2HDDA 1QVUA 3GTQJ 3FISA 3OSFA 4A3IJ 4MLOA 3BR3A 2CUEA 5FKLA 2NS7A 3TP3A 4QSHA 5E3LA 1F43A 3HOWJ 1A5JA 2KDZA 4XK4A 5DS9A 5F0HA 2D5VA 2NVQJ 2HXOA 1YRNB 2XGDA 4IHWA 1O4XA 4D5FA 3D1NI 1IUFA 5IOZA 1APLC 2L7FP 5K7FA 1GDTA 3NAUA 4IEJA 3SJMA 3BQYA 1H88C 4X6AJ 2DN0A 5FKKA 3BTLA 2P81A 1HCRA 1U8BA 1RKWA 4A69C 1GV2A 1WH5A 3GTOJ 1JTXA 4B1RA 4A3JJ 2COBA 5F0FA 2NVYJ 3CMYA 1IC8A 2FX0A 1DU6A 2XRLA 4AUXA 2EH3A 2XPWA 2IAIA 1UG2A 1ENHA 3HBLA 1BL0A 3HOVJ 5F0CA 4MFEA 2JN6A 2TRTA 3CDLA 3ZOBA 1AKHA 3S17J 2QF7A 2DJNA 1JUMA 2EQRA 2ID6A 2GM4A 3K2AA 2H1KA 2M2EA 4CYCA 4A3BJ 2RAEA 3BTCA 2E2HJ 2GLOA 1GUUA 2K9SA 4B3AA 2VKVA 2XPUA 3A02A 1T33A 2NOGA 4XRMA 1IJWC 2EZKA 1JUPA 2Y9YA 1PUFA 1ZQ3P 5E3MA 5EGOB 2L0KA 2CRGA 3SFIA 3JRIA 3S14J 1W0UA 3HGGA 1MBEA 3G1LA 4QTRA 3JRHA 4FE7A 3OSGA 1OJLA 2IBDA 2PMZN 4DYQA 4JYKA 5EZHA 1DU0A 1NK3P 1TWAJ 1WGXA 1VNDA 3G1MA 1JT0A 4A3GJ 4C3HJ 3A01B 2VUMJ 3S15J 2O8KA 2LTPA 2E2JJ 2O9LA 1FTZA 2Y0SN 3L1PA 2EZIA 1JJ6C 4Y52J 4A3KJ 1TWCJ 5EG0A 3LOCA 3A01A 1NTCA 1AKHB 3ZQIA 5E3OA 1BJZA 4C3JJ 1A6IA 4RDUA 2NVXJ 4I6ZA 4GFBA 2JA6J 2TCTA 1VF9A 1JKOC 2LR8A 3JRGA 3S2DJ 3M3YJ 1OFCX 2ZB9A 4J19A 4BY7J 2JA7J 1Y1VJ 3C2BA 1MH4A 4A93J 2LFBA 2LLKA 2DTZA 3BR0A 2JA8J 1U78A 2R5YA 2R92J 1HOMA 5EYRA 3TW7A 3Q0WA 1K61A 3MKLA 1XG1A 4BY1J 5FJ8J 5IYDJ 1FEXA
chains in the Genus database with same CATH superfamily
1G6NA 2DLLA 3GFIA 3GTJJ 2CJJA 4S04A 1ZGAA 4G94A 4MFDA 1PP7U 2IS2A 1J9IA 3ZR8X 2HU9A 3P9KA 4II3A 1B6AA 2EPFA 2VASA 1K4SA 3S1QJ 1MW7A 2DA2A 2P6SA 5TGTA 2YX4A 4XSXF 3I4PA 4N9HA 4XKWA 1VQ8I 5JVGF 4L9JA 3QU6A 4IHYA 4Y3OA 1W1WE 1EJ9A 2NAZA 3ECHA 2V26A 3LSJA 1FYLA 2HQRA 4FCYA 3SFZA 3DKYA 2JMWA 4QWQA 5JVTA 4AWXB 1YW7A 2RC4A 4XN0A 1VZ0A 2GQQA 3G2BA 1T95A 2KLOA 2L5QA 3OYMA 4M9SA 2ETHA 4CHUA 3OIPA 3BT9A 1OPCA 5E3NA 3SZTA 1XCBA 2AHQA 3OOUA 2KMUA 1X19A 2MABA 3PO3J 1I6XA 3ZQLA 2XRNA 1FX7A 3M7GA 1K78A 4HF2A 3HOZJ 2HQ5A 2OCEA 3M1EA 3ABMH 2L7ZA 2DA7A 2B0LA 4QLCU 2LRDA 1X4PA 1WWXA 1J0RA 4E7JA 5FLMJ 3FHZA 2WAEA 2PFBA 4ZYDA 4C3IJ 3RPUA 5EG0B 4A3MJ 3ZMVA 4A6EA 3GTGJ 3HYIA 5D8LB 3BR1A 1GVDA 4KIGA 2ELHA 3I4MJ 2Z2SB 4XORA 1V3FA 5K5QA 4W97A 4BS9A 1U2WA 2K4BA 4M6VA 3OS0A 2R3SA 4NB5A 2BHYA 1X58A 5IT9K 2XPVA 2PJPA 3LSTA 3L09A 5M3MJ 1ULYA 5LLQA 2E1MC 3GVAA 1OCRH 3ELKA 1JE8A 2P8TA 4U0WA 2VB6A 3M9AA 4HV6A 1S8NA 3K1PA 2A61A 4CGZA 3NEUA 3R4KA 1VQ4I 1TBXA 2H1LA 1QZYA 1S7AA 4A5NA 4LMYA 1SD6A 2V4JC 3LSHA 1U9OA 2LG4A 4RB1A 3DPTA 5H6QA 2ADUA 1R36A 2QGUA 1Y1WJ 5J3LA 3GX4X 1OR7A 2G0EA 3DKXA 1YW8A 3T8TA 1J7KA 3BROA 3D5RC 3FXLA 3WTXC 1XCVA 1BR4A 1XDUA 2E5NA 5CPRB 1SVOA 2DA6A 3PFYA 1D0ZA 2V1DA 4HNTA 4CSWA 4M6YA 1HKSA 2LP0A 1MH3A 3CCYA 3HPGA 4UV8A 2CYYA 2M34A 4ZYHA 2JA5J 2PMHA 1W36D 3VPRA 1R00A 4F92B 3PM1A 4A3LJ 4GCVA 1MBGA 3EQLF 4S0HB 5LD2C 3CCUI 1ZGJA 1IV6A 2DQLA 1FWZA 1FIAA 3QOEA 3G3ZA 3QPLA 1Y6IA 1T39A 1T6SA 3K10A 4ZYAA 3MAJA 3A0BC 2IS6A 2OD5A 3SEQA 4BGDA 2O0YA 2XGCA 3JRDA 2BVMA 1RZ4A 1YHQI 1FSEA 2NXNB 1Z0XA 2IGMA 3CDHA 4P1WA 4UVBA 1GHCA 1OCZH 1OYYA 5KAIC 5IP9J 3LSGA 1O3TA 1FOKA 2MGQA 4ZH4F 3K9TA 2M5WA 2VKHA 3F3XA 4RAZA 1YE9A 3C1DA 1KU2A 2F4OB 3HIFA 4ABZA 2M3AA 2W85A 3S1RJ 3QYFA 3HL2A 2BEOA 4IZZA 2M0MA 1LEAA 3G71I 1SAUA 1ETOA 1T2KA 1IW7F 1LE8A 3E97A 1I50J 5DM6F 3AG1H 1A04A 2HKXA 2LY2A 2OTJI 1UG0A 2GWRA 4RB2C 3HB9A 1FNNA 1HKQA 2GIZA 5K7ZA 2OZ6A 3IL2A 1G2HA 2VI6A 3CCQI 3GTKJ 1ITYA 3DLAA 4LITA 2Z33A 4A2UA 2QWWA 3JW4A 2Y9ZA 4YIFA 5JHFA 1D1CA 2CQ7A 3M8JA 1WI3A 2Y30A 4G9YA 2H6CA 3Q9SA 4KT6A 1P7IA 4B48A 3KPHA 1FJLA 4EM2A 2CUZA 3PNYA 2D1VA 1O3QA 1F9NA 4XBFA 1KU3A 3GZNB 2VJ5A 1KONA 1TNTA 3MQ0A 2I10A 3HRUA 3S1NJ 3OR2C 3BZKA 3EDPA 3ZQCA 3QQAA 2EA4A 4FHTA 4MO7A 1RC9A 2A05A 5FKOA 1BN5A 3JR9A 3KP6A 1YTYA 2KRCA 3H3VK 1W5CC 3PNVA 3DTEA 4HZFA 5J1UA 2BBYA 3ML6A 3CF5F 3M1CA 4DZJA 4I01A 4Y13A 3ZMZA 2MH9A 1ORKA 2EK5A 4UNOA 1ETKA 2OPTA 5HS8A 1CQTA 5DUIA 3OMYA 4C2TA 3GLLA 1LVAA 3P5JA 1P4AA 3JREA 1LFPA 4XLAA 4EVIA 2LKXA 4A3FJ 3J81K 3OYDA 5L3GA 3GFMA 3FXMA 4X0GA 3FWEA 3VYTB 5DUKA 2OC6A 1J2XA 1FT9A 2CQNA 1E0EA 1SD4A 2JPCA 3E5QA 2F5CA 4BEHB 4IOCF 3WHCA 2IT0A 4DGWB 3VODA 3R61A 3CUQB 5GADJ 2FD5A 2XF6A 1X1DA 4II2A 1YRNA 2VXDA 3Q3SA 1ETYA 3ERED 1W0TA 3V7CA 4LIVA 5BMZA 5HLGA 2XAFA 2LMDA 2CUFA 2QCOA 3OIQA 3TL4X 3ZXSA 4KJZA 1YG2A 1R49A 1W7PD 4KIFA 4M3DA 4V19K 2VE9A 5F04A 1BW6A 3IRRA 2ZMEA 2ZMEB 3PQKA 3S3NA 3FM5A 3MKZA 3HOYJ 4XLPF 5CQGA 1YX5A 2Y2ZA 3SDGA 2EA2A 3J80K 2HTJA 2YPRA 3CO6C 3I56I 1D5YA 2E2IJ 1RR7A 3ASNH 5ILVA 2DA5A 2WA0A 4KYWA 1HDPA 1K79A 4MQVA 3GYHX 5CVVA 3CC7I 4ITVA 3LA2A 4E7SA 2P5KA 2VONA 2DT6A 1MMAA 1OYWA 3GCMA 3VB2A 2R0QC 2NS8A 3D0SA 1B8IA 2E5ZA 4E7KA 3FBNB 2OAZA 5B1BH 2BY3A 2D1HA 5FROA 3MD2A 3OYHA 1MDMA 2CS3A 2DI3A 4I7HA 2R7WA 1XMXA 1QVUA 2GOXB 4NHJA 5FD5A 2PBIA 3DXJF 5HLIA 1KU7A 3MKWB 2C6YA 4L5IA 3CMEI 4KISA 5CVJA 3VOEA 5E3LA 4BE0A 1F43A 2KDZA 2HTSA 2LNBA 5LGTA 2CH0A 3CDIA 3OR1C 5DS9A 5KCMA 2D5VA 3Q9VA 4FX4A 4ESBA 3AFHA 1Z67A 2ISYA 1KQ8A 2VN2A 2H94A 3HUGB 1ZREA 1Y8RB 5ICFA 4B3XA 1QQIA 1F4KA 2JTVA 3HC7A 4RA2A 1IUFA 1WVRA 1APLC 1MJ9A 2RQPA 2EFPA 4Q5SF 1T0FA 4GRIA 4X6AJ 3BTLA 1RKWA 4A69C 4B1RA 2W7NA 2COBA 3CMYA 4HF0A 2FX0A 4DOZA 1D0YA 2CW0F 4XONA 5LHGA 2XPWA 1ENHA 4I99C 2ZBKA 1BL0A 1ZRDA 2FU4A 1QPMA 2TRTA 2MC3A 4XKCA 2DJNA 1KYZA 2EQRA 1FBUA 3K4NA 2A69F 3K2AA 1P9QC 2RN7A 3JAMK 1LPQA 1FY7A 4PCQA 3HKZA 2K9SA 2DT5A 3I5UA 2XPUA 4ON0A 4ZDOA 2EFOA 4GXOA 4MQ9F 4ENJA 3IP4B 2DW4A 2EZKA 1QO0D 2O6GE 3I3LA 1TTYA 2H8WA 4DBRA 5EGOB 1RUOA 4YFXF 3BP8A 3VFZA 4KFCA 5D5XB 3F21A 5FFXA 3VEPA 3JRHA 3J7AY 3BPXA 3IWFA 1OJLA 5HDNA 2V9KA 3PL8A 4UY8I 4PSXA 3ONQA 1NK3P 1Z7UA 1ZG3A 3G1MA 3QWLA 4CCJA 5FD6A 4Q4ZF 2VL8A 1IN4A 1R4MB 3A01B 1XGMA 3S15J 3H36A 4M74A 1S72I 1FYMA 2K9LA 2O8KA 2LTPA 2X51A 1TLHB 1LDJA 2O9LA 2VPLA 4F55A 2EZIA 1OYIA 2Q8KA 4Y52J 1P4XA 5EG0A 4L0ZB 4B8XA 4ANJA 3MMYB 3A01A 1NTCA 2BY0A 1YOVB 1BJZA 3ZMDA 2DYSH 1Z6TA 3TGNA 4I6ZA 4GFBA 4F93B 2TCTA 4EJTA 2P5VA 1QGPA 3JRGA 1JGSA 3CC4I 4P9UA 2CGPA 2JA7J 1ACIA 1Y1VJ 4UUVA 1MH4A 3B02A 2LFBA 2NVUB 3V8JA 1YJWI 4AM3A 2NOJB 3WTTC 5D5VB 3TW7A 3QRFF 3Q0WA 1IZ1A 1J5YA 3IKVA 3IHUA 4PUSA 2GAUA 1WHUA 2KIMA 2JA2A 1CF7B 4BDYA 3WTVC 3O3KA 2M4KA 1ZARA 1J59A 1TQPA 1ZR4A 3M07A 2STTA 4RM2A 6PAXA 3MZYA 2ZCWA 2DMPA 2VBXA 3FKIJ 5C3EJ 1HSJA 1G59A 4CYDA 2MA3A 3HZJA 4PDKA 4OIQF 4NDLA 3WODF 2DPUA 3QYBA 2M7AA 3RZOJ 1B72A 4HBLA 2HXIA 3H35A 5DCMB 3WE3A 4IHXA 3W6KB 3WTUC 3OYIA 3L00A 1ETVA 4AYBN 5K7HA 3I53A 3W2WA 4EM0B 5H6RA 3OYNA 2JSPA 4YELA 2EV5A 4EJVA 2QEXI 4RMNA 2VXZA 1BM9A 2A6EF 3A03A 1E3OC 4HLXA 4Y15A 1R23A 1XB4A 2YR2A 5DTDA 3LNQA 5GPAA 4XLNF 2J5OA 1NH3A 4L18B 1WH7A 1W5SA 2DA4A 3HDDA 4CCOA 4J01A 1LNWA 1E17A 3LAPA 4M3FA 2KHMA 3ABUA 3IH2A 1TNSA 4QPQA 3U1KA 3ZQGA 1MMDA 2V6CA 1JT6A 2ZXWH 2JK3A 4U88A 3ZMTA 4UUTA 3TOAA 4A3DJ 1MDMB 1Z3YA 4UB8C 2DCEA 2EZLA 3J7ZI 3NWTA 4JX6A 3JRBA 1WZ2A 1TZLA 3D5SC 1U8RA 4G6DA 1K4TA 1DP7P 2EFQA 3Q0UA 3ZCOA 2P7CB 3HKZN 2G7HA 2ELKA 1TWFJ 3NWSA 4W1UA 3KP2A 2L2OA 4DIQA 4XR6A 3BY6A 2RVCA 2KP6A 3BTIA 5AIQA 2FXAA 3A2KA 3I4NJ 1UMQA 4NQWB 5HDGA 2HQNA 5HLHA 1YIOA 1VQNI 3UR3C 1WPKA 1F5TA 4OAYA 1I5ZA 1V54H 1KA8A 2E1CA 3TO6A 2OF7A 5GP9A 1O3RA 1VQLI 3MZHA 4FTHA 4TV7A 4PJNA 3C3WA 3ZQFA 2UWMA 1ODDA 4DYCA 1T56A 4KIBA 3NARA 1HW2A 1QA6A 3MVPA 2GOMA 2V7FA 5HLTA 2HYFA 2OU2A 5FLVA 4C2UA 3WG9A 1H89C 4JQFA 3F0CA 3JRCA 3F8BA 3K1MA 1PP8F 2K3PA 2F6CA 2IEKA 2V6EA 1TW2A 4I76A 4LJZF 1R71A 4BEHA 3TEDA 5FGMA 1UZCA 3NRVA 1TT0A 1K7AA 3E3VA 4BBRJ 2XSJC 3CESA 3E7LA 5HNHA 2E19A 2R93J 3I64A 2WB1A 2XDVA 1OKRA 3OYEA 1VQPI 3FK6A 1JTYA 3IH4A 3CO7C 2X1DA 2D2WA 4XLHA 3V4GA 4ETSA 1SFUA 4DYRA 3R0AA 1H9TA 2ID3A 3HSEA 2W48A 4CCLA 4CZZA 3OS2A 1S29A 4EGYA 4YRVA 2H27A 3H0GJ 1W7PA 1EF4A 2XAHA 4EMSA 1VQMI 2RDPA 3RQIA 3LSRA 1SFXA 3I59B 2A5YB 3GTLJ 3A0HC 2KZVA 4LK0F 1ZAOA 2M4GA 1Z3XA 2WY8Q 2ZKZA 3MFKA 1G3WA 4OAZA 3G6EI 1QHHD 4BQAA 1JI8A 4V2FA 1MJAA 2F48A 3G1OA 1FMVA 2OQGA 2JUGA 3E5XA 2PJRA 4FQGA 5HS7A 1HQCA 1BI0A 5J40A 3ULQB 1RPWA 1QNTA 1ZKGA 3N05A 4HSTA 4BNCA 5K5RA 1Q1VA 1N75A 3IWZA 4BJ5C 2J5PA 5DV5A 2EFNA 1LFUP 3JRAA 2UXXA 3BG6A 4L9VA 4GYGA 3DV8A 2EIJH 3M8FA 1USTA 3HTSB 3V7SA 2OTLI 1FOWA 1S9HA 3R6SA 2HI3A 4HYEA 5ILUA 1ETWA 2E1MB 4N4OB 5M3FJ 2HZTA 1RRJA 3F6VA 3JCUC 5KK1A 3DU6A 3KEYA 4DBQA 3JRFA 2ZSIB 3ROUA 1VQ6I 3QPSA 3TOBA 1XD7A 1D8KA 2H8RA 1ZTRA 2XAQA 3WU1B 3TMOA 3BZ6A 2EV6A 1I39A 2EWNA 3H9GA 3HOXJ 1UCRA 1FSHA 4H4KC 1GXPA 3LFUA 3HGYA 3MZ8A 2FBIA 1RUNA 4JX5A 3GXOA 5B1AH 1TP4A 4N9IA 1AU7A 4Y7NJ 3DLLF 4RLQA 2BHZA 3GFJA 2QSFX 3ISPA 3LA3A 4HQMA 5HOOA 4Q48A 3ZGKA 3GLXA 2W82A 4NQWA 1A31A 3O6BB 3DP7A 3WHBA 2QQAA 3L2UA 2HEOA 5FKMA 1K6YA 3BG9A 2BZTA 3DF8A 1BR1A 1U5TC 4RB0A 1ETXA 1B72B 2EILH 2KJCA 2V79A 2XV4S 2L9SA 3E1SA 4AIDA 4G6TB 1YLFA 2KZGA 3PO2J 2R5ZB 3FK7A 1T38A 2QQ8A 4JK1X 3VDXA 4BL0B 4HDVA 4LIUA 4MGRA 3W2AA 3EUAA 3OYAA 5AONA 2N8GA 5FB2A 3W6VA 3CCMI 1H8AC 3BQZA 1SFOJ 2MW8A 3IRQA 2FMLA 1OCPA 1UHSA 4LGWA 2QKLB 2CQKA 2MSYA 1X1PA 3H5AA 3DEUA 3HPHA 3LQQA 2VC1A 2HOAA 1AHDP 1VQKI 2QZ8A 2NNNA 4X1EA 1YS6A 2ECCA 2LBFB 2LDUA 2QKMB 4IJAA 1MBJA 5DDGA 3QPTA 1LEBA 5DYMA 2RREA 2H09A 3SYTA 1GLNA 2M45A 4AU7A 1MMSA 3K70C 2HYJA 4XNFA 1X2MA 4Q47A 1BOAA 2HVQA 4LG0B 2FOKA 4G6QA 3RPQA 2AQFA 2M8GX 3RKWA 4GGGA 4E7ZA 3WTWC 3O8GA 3B6CA 2A68F 4EM1A 3FMQA 3HHGA 4LLLA 4DZPA 2Y69H 1WQ2A 3KFWX 4ZYGA 4XKVA 4A6DA 1Y56A 2X9DA 2Y0MA 2R7FA 4IQ4A 4PSWA 5DEQA 1L0OC 2RV8A 2FNAA 2LC2A 3DWLE 2HYGD 3BDDA 4OMZA 5IYCJ 2YSRA 2HDDA 2LSOA 3GTQJ 4EJOA 3OSFA 2CUJA 1XPXA 2P6TA 2G9WA 2GXGA 5FKLA 2ICWG 3E0JB 3MCZA 2IVMA 1S3JA 3T1BA 1E3PA 1OLTA 4M71A 2QENA 2RNGA 2K5CA 3U1DA 1Z21A 1ZN2A 2YU3A 4I09A 5J8FA 3C2GA 2KQRA 2VT3A 4UXNA 3L2CA 3H9JA 3DBRB 2EB7A 1Q1HA 2V1XA 4RB3C 3FHNA 4CCMA 1B1BA 4G7OF 4E7LA 3D1NI 4WXHA 3PNTA 4PJ0C 3BWGA 3ZN0A 5D4SA 3NAUA 3TKYA 2CV1A 2XUBA 2VJ4A 4ZYEA 3VYRB 1JHHA 3AG3H 5FKKA 1HCRA 2P81A 1U8BA 4YFKF 5TJJA 4HG2A 1S6LA 5F0FA 1IC8A 2BYVE 2PQ8A 3RYRA 4WK8F 2QUFA 2PI0A 2XRLA 1XGNA 2G7UA 1IF1A 2GXBA 4AUXA 3K4KA 4A0ZA 4RS8A 2IAIA 1UG2A 3OYLA 2UXNA 3DPUA 2LF8A 5ED4A 3CJTB 2XGXA 2LKPA 2R7UA 3P7NA 3RI4A 5F0CA 4HLYA 4MFEA 1HA8A 2JN6A 1JHFA 2K3FA 4M6XA 5TISC 3ZOBA 3S17J 5F64A 2QSHX 3L2QA 4F52A 2ID6A 1R1VA 3HRSA 1PUEE 2H1KA 3QP5A 1U3EM 2RAEA 3BTCA 1EA3A 2CSOA 2GLOA 2KJBA 2R7VA 1GUUA 4B3AA 3A02A 1NG6A 2DT7B 3U9GA 2ZO4A 4XRMA 1QZZA 1IJWC 2B9SA 1Y8QB 2F5VA 2JVGA 4A0YA 4XLEA 3F22A 3GZ5A 4B47A 4LG0A 1W36C 1ZQ3P 1SMTA 1OCOH 3OYCA 2VQLA 1DQUA 2W00A 2ZSHB 3ZP5A 3FXOA 3VSLA 3S14J 1W0UA 2R7OA 1VQ9I 3SZGA 1MBEA 1P4WA 2ZXIA 3CJNA 5J47A 1SMYF 2VBWA 3ZMSA 2PMZN 1UAAA 3I9V2 1FMWA 5K1YA 1WI9A 4ASNA 4A3GJ 2BY2A 3K4MA 4UHTA 4ZDPA 2E2JJ 1FTZA 1AOYA 2HQAA 2MC4A 1JJ6C 1X4OA 2CFXA 2JT1A 3CLOA 2QQ9A 1X1BA 3CUOA 2K27A 2ZMEC 3H3ZA 3H92A 3S8PA 3ZQIA 3DU5A 2X0LA 3F72A 3VYSB 2FF4A 4P5OA 4EQQA 1VF9A 3CTAA 4BJTA 3OL4A 1LQ1A 4CCKA 1HC8A 2VQCA 2WC2A 4ENKA 2BXZA 2LY1A 3C2BA 4A93J 5KAFC 1U0JA 5J6XA 3IKTA 4B09A 4BY1J 3HXLA 3G73A 3CJQB 1JKRC 1U9NA 2F5FA 1XDSA 3RTRA 3Q5FA 3GBGA 2VPRA 1MJBA 2ZJ2A 1EH6A 4PJLA 1V5GA 3ZPLA 3ESWB 2VBZA 2QSGX 5E1XA 2R7RA 2DA1A 1LVKA 1TQMA 5B66C 2X6WA 5E17F 2ZJRF 4BKXA 2VQHA 1D1BA 3KZIC 2GA1A 1NHAA 3DEEA 4UB6C 1SFKA 3H5NA 2MH2A 4KDPA 2DMTA 3PJRA 1WJBA 4ENMA 1IDZA 3KCCA 4CA0A 4HF1A 4IOAF 1S7EA 1HF0A 3CCEI 1TWHJ 4D7MA 1SANA 4A3EJ 3TP0A 2ME6A 3CCLI 1G8XA 5JI6A 1DUXC 2R7SA 2LF7A 2CV0A 3T0YA 1IRGA 2QM3A 5HS9A 4PK4A 2XB5A 5L3DA 4LK1F 3RCOA 4GDFA 2IXSA 2ME0A 1ZK8A 2DK5A 1Z7LA 3GW2A 4L5JA 1SVMA 3Q0VA 5HVQC 5JLXA 5F1JA 5BS6A 3L2VA 1LJ9A 1D5VA 4A0XA 4L9NA 5LEJA 1ON2A 2DOAA 3ZQQA 5A2QZ 3GFLA 2A6HF 1J09A 1S5LC 1U6GA 2VIXA 1W7PB 3K70D 5FO5A 2VQGA 4GYIA 2HVSA 3IH3A 4I02A 3RIRA 4HW0A 1R22A 4D5CA 4B43A 1RKTA 1FTTA 1D3YA 2PMZA 3I71A 4XQFA 3OYJA 3HEFA 1X3ZB 3CUQA 3QYEA 1I1GA 1PUFB 2WV1A 3T8RA 2Z16A 3UKGA 3KZZA 2CW8A 3DCFA 3PSFA 4WWCA 2JRMA 2RQQA 3WU2C 3H3UA 5KHDA 2JPBA 3QAHA 2DOEA 3FXKA 2W84A 1UHMA 2OZUA 5M5YJ 1BI2A 1LE8B 3BOQA 3PIPF 4FT8A 2V9VA 3CP2A 1OQYA 3GMEA 3ZQHA 2K40A 4PFOA 3OYBA 2QVOA 5CJ9A 2M0CA 3E6MA 1HLVA 2CMPA 2JZYA 3FMRA 1QHGA 2EIMH 2LREA 4HX7A 1IRFA 2NVTJ 3CZ6A 3COAC 4IF4A 2KL4A 2KRFA 2NYXA 1R5GA 4YFNF 3L2WA 2UV1A 3KP3A 3H9QA 1VI0A 1FC3A 4BE2A 3CMAI 2ZFWA 5H2FC 4MEYF 4LFUA 1S7OA 3LMMA 1XC5A 3DTIA 2CQQA 2MG4A 4EJUA 5EF6A 1Z1DA 5AIPA 4F7ZA 4XRSG 2HWVA 4BJ6C 1MMNA 2WWYA 1EV7A 1TT5B 4R1HA 3U2RA 4M3GA 3H5RA 3GF2A 3BG7A 3F8NA 3SHFA 2DK8A 2ZJPF 2ISZA 4E7HA 2F4MB 4JOMA 1MBKA 1F36A 2Y48A 4Y33A 2LVSA 3HOSA 1C0WA 1IDYA 3RJPA 3C7JA 1XSVA 1LUJB 4RAFA 2DO7A 3MEXA 4OIPF 4EATA 1HKTA 1XMAA 3V8KA 2OBPA 3K4JA 5J8CA 2YS9A 2K9NA 2K85A 4XLFA 5EZGA 4YG2F 3OYKA 2YX7A 2LY9A 3E6BA 3TW6A 1QBJA 1KQ0A 3T5XA 3BJAA 2L4AA 4B4CA 3DEWA 1IN8A 3F23A 2KT0A 5IYBJ 1TWGJ 5C4XJ 2L01A 1BJAA 1XSXA 1WRJA 3OV8A 2PMUA 4CXFA 3FM3A 4KNYA 3J7YJ 4BHPA 2E1NA 2WAQA 2VODA 2O5RA 3DTKA 2ZC2A 4MIMA 5GAEJ 3HM5A 2DTRA 4LLNA 1G4DA 1D8JA 4XIDA 4AC0A 1R1TA 2DDAA 3NQOA 2HDCA 1VTNC 1SAXA 4YEJA 4OMYA 4A12A 1ONVA 2LD5A 1LDKB 2V1UA 2DBBA 2W1OA 1CGPA 2A3SA 4M9ZA 4MTEA 4G8XA 1N25A 1MSFC 1KYWA 3VYUB 4UUSB 1QRYA 1YO5C 1K78B 1ZELA 1RR8C 4HRIA 1HBXG 2KRHA 2MD5A 4HSRA 4XL9A 4BACA 2EIKH 5IT9Z 4KICA 4NUBA 2LBFA 2HPIA 3P9IA 2W4SA 2JSCA 3LWFA 2FBHA 1R4NB 2ZXJA 4PJJA 3G4SI 2D45A 1ZR2A 1UHWA 4JP0A 3JTHA 3CCSI 5FRNA 1JXSA 2XKPA 3W6JB 1RETA 1R5ID 1T98A 2VOOA 3B73A 2XROA 2Z9OA 4BHCA 2W24A 1Y0UA 1DPRA 1BIBA 2DAOA 2HDWA 1LFBA 2MFZA 4ENNA 1RESA 2B7EA 2X6OA 3BZCA 1XGOA 5GPCA 4A3CJ 2CQXA 4PJMA 5GTIC 4O3MA 3S2WA 2DQRA 2FRHA 5LRSA 4BYYA 2YUSA 4U0VA 5TRDA 5D5UB 5HDKA 2XB0X 5E1WA 2GBYA 2IA0A 2IA1A 3PSIA 4M9XA 4EGZA 2L9VA 1NG7A 5BPDA 4F91B 5ILSA 2NS0A 3DBHB 3WG7H 1DDNA 1IN5A 4S05A 2F4IA 1OCCH 1WJCA 4HPQA 2CV2A 3KIOA 3BCAA 4IQJA 1X1CA 1W4MA 2VKEA 4CDGA 3ABLH 2Q1ZB 3CMMA 1MSEC 3P9CA 5CVIA 2FBKA 3PUFA 1IN6A 1XMKA 3RSNA 4M72A 4BU2A 2E7XA 1YS7A 3KLNA 1ZG5A 3MN2A 1GXQA 3CP8A 2K9QA 2M9HA 4IVNA 3DQVC 1I27A 1YI2I 4Y4RA 4RBOA 1D1AA 2FEZA 3SXYA 2ZFUA 2NRAC 1L3LA 2M8EA 2AO9A 1B9NA 4A3IJ 5HNFA 1IRXA 4MLOA 2CUEA 1K6OA 2NS7A 4WX9A 3VWBA 2ZJQF 3TP3A 2L4MA 3HOWJ 3FXUA 1A5JA 1IXRC 2O03A 3JTGA 1WFXA 4IHTA 5EEHA 1MIJA 5F0HA 2NVQJ 1BR2A 2HXOA 3M8EA 1B9MA 3F8FA 1HSTA 1E2XA 3EETA 1DGRM 2ESHA 2PJRB 4D5FA 2P4WA 3GO5A 5JFRA 1PVEA 4GO1A 4BQQA 2OUMA 1DP3A 4OU0A 2HOEA 5D8KB 2EV0A 3EUHA 1YFHA 1GDTA 4K2EA 4IPAA 5DD4A 2Q2EB 3SJMA 1WJEA 1ZLJA 3HTUA 2R7QA 5BOXA 1GV2A 3O2PE 2M30A 1JTXA 4A3JJ 3K6GA 2NVYJ 4CZCA 5KNLA 1RIOH 4OIRF 2KIFA 2VOPA 4E70A 3F6OA 3V7RA 3OS1A 1QU3A 2HVRA 3HBLA 4IRHA 3HOVJ 2M7BA 4LB6B 1IO2A 2MLGA 3R60A 5CVRA 5D4RA 3HHHA 2P7VB 3PQJA 4EJWA 2NNYA 3FF5A 3KYDB 4ZTJA 1G3TA 3CLQA 4P96A 1MNDA 4CYCA 3SDBA 3CD6I 4BUPA 3QU3A 4DJAA 3L9FA 1UFMA 4HNUA 3AKZA 2VKVA 3S3MA 4KMFA 4I0BA 1MNEA 3OY9A 1N77A 1T33A 3I58A 3QP6A 5CKTA 2R7DA 5LGNA 1JUPA 3LSMA 4O5VA 2Y9YA 1PUFA 1T8IA 3RKXA 5E3MA 3HG9A 2DU9A 3FX3A 1RNLA 2L0KA 2CRGA 3SFIA 2XIGA 5KVRA 2X4HA 2OJED 3HGGA 3X2QH 2AXTC 4D1QA 1OMIA 4QTRA 3K2ZA 1LDDA 2MYSA 2Z1DA 3W3CA 2IBDA 4ZDLA 3KP4A 2UZKA 3LL7A 3U21A 2VBYA 4DYQA 1HW1A 2BVLA 5EZHA 4NNJA 3C18A 1DU0A 4BXFA 1WGXA 3C2HA 4XLCA 3FXRA 3IUOA 2DJIA 5D6FA 1EKEA 1JT0A 1Z91A 4C3HJ 4OWRB 3LA7A 4UVAA 1BC7C 1BI1A 4ZTFA 2VKDA 2HKOA 2Y0SN 3H1CA 4KN7X 3DPLC 4A3KJ 4RM3A 2AXLA 1TWCJ 4AIJA 3LOCA 4HQEA 3EUKL 1AKHB 4FX0A 3RDIA 3MKYB 1A6IA 1P2FA 2XHKA 1WJFA 1ZHFA 3LSKA 3WTYC 2QYOA 2JA6J 2PN6A 5CQEA 2PLYA 2XC7A 1JKOC 5IY5H 3M3YJ 1OFCX 2ZB9A 1T08B 2OCCH 2UUZA 5ICCA 2DTZA 2L02A 5ICGA 2VJIA 2R5YA 4AIKA 2R92J 2FNPA 2F2EA 1MZBA 2IGOA 2R7XA 2OV7A 4L0YB 2HZDA 1MD0A 4PZJA 2X1CA 3MKLA 2WY7Q 1Z9CA 2WAFA 5LHIA 5FJ8J 3TO7A 3PIOF 4R8HA 4MEXF 5IYDJ 1FEXA 3J7AO 1SVLA 4BHBA 1FP2A 5LGUA 5IP6A 4BQNA 5DM7F 1R7JA 2O7OA 4LLGF 4CYCB 3KLOA 1OISA 2HOTA 3K0LA 5IP7J 3JSOA 1WJAA 3OWTA 4FE4A 2K9MA 3V8LA 1SD7A 1AWCA 1QPIA 4ZC3A 1PYVA 4N4NB 2DXIA 2XASA 4BQOA 2ECBA 3AL0C 2ELJA 4XSZF 4AIHA 3E6CC 5FLXK 3BJ6A 3K4LA 1FPQA 3L7WA 2Z5UA 3VSKA 3CCJI 2O8XA 3SEZA 3KE2A 1WJ5A 4IRGA 5H20A 2IS4A 3HRMA 2WAQN 2L7MP 2M87A 2DA3A 4BH9A 1X3WB 2WV0A 3E6DA 3WGHA 4O6JA 1D0XA 2K7LA 1KGSA 5BQTA 1B4AA 4ESJA 4IHSA 2B63J 3B6AA 5LBQA 2E1OA 5E8GA 3RQ4A 2WADA 1FOYA 4WF2A 4DNCA 1ZG1A 5J1RA 4J00A 1YQAA 1Z6RA 4MTDA 4M3EA 1FBQA 1V4RA 2IRFG 3WGGA 2HGCA 5IOYA 3CJRB 2I8DA 1UJ8A 1SD5A 4CUGA 4RGXA 2JRTA 4ZJZA 5F6FA 5ICEA 1TC3C 3S2HJ 2K4JA 1MKMA 2ZNYA 2Y75A 3BR5A 4P55A 4WXDA 5C4JJ 2Z3YA 1YX3A 2Y31A 3CQZJ 1U5TB 5E8IA 4U0YA 3GTMJ 3AL0B 1Y0NA 4XOPA 4LOCA 5D6EA 3RKYA 3RPUD 5FLXZ 2BGCA 1CF7A 3OOPA 4UVCA 5JR3A 3LAJA 3OIOA 3DKWA 4YIRX 2HNHA 2QA4I 4AVPA 5LEKA 1H9GA 3UNGC 1VQ5I 4OINF 2FOWA 3FIWA 3SZPA 1VFCA 2W57A 3K4CA 3CC2I 2DMNA 3BTJA 3D5LA 1IN7A 3FDYA 3ZRGA 4FASD 4JX4A 4HNVA 1B59A 1TQIA 3TO9A 1SEUA 4BXUA 1GT0C 5B5EC 2O3FA 4HAMA 2IP2A 4RAYA 3TDZC 4HX8A 4YIIA 1IGNA 1NK2P 1IG7A 2JQ7A 2P5LC 2AS5F 2EINH 2XSDC 2OA4A 4L9TA 1REPC 2BOLA 4CH7A 2GIVA 2V1NA 1R6RA 1WCMJ 2E71A 5C44J 1DPUA 5DCMA 3EYYA 4HX4A 4L5EA 4E6KG 5M5WJ 2A6TA 1IUYA 1QVTA 3KP7A 1O3SA 3A4CA 1ZRCA 4NC8A 3HOTA 5IT3A 3AG4H 1UB9A 2DFHA 4IKFA 2DFIA 2MBFA 2LK2A 3HRTA 2CU7A 3HOUJ 9ANTA 3DBLB 4PGGA 2KPMA 2X85A 4C30A 2IA2A 4XRSA 5L3EA 4U7DA 4RGRA 2VJJA 3K69A 1TL8A 1R1UA 4XN3A 5CLSA 3QPHA 5EGOA 4XMYA 2Y0SA 2XGEA 1IRZA 5F08A 1FYKA 4F3QA 5DD8A 4KMUX 3J81Z 4RGUA 1MBHA 5J4VA 3K1NA 4NC7A 2GA2A 4XM3A 5EJCA 3I54A 5J1YA 5EEAA 1OCTC 1BIAA 3LSIA 1YW9A 1I6HJ 1ON1A 1A6QA 4NC6A 2VLAA 2DMQA 1FOXA 3ZMUA 1ZGWA 3SQNA 4OOIA 3GWZA 1MBFA 4P9FA 2KIQA 1FBSA 2VC0A 3BC8A 3LQRA 1Z77A 4UUSA 5F1RA 1Y39A 2L54A 4CICA 5BNGA 3LFKA 5ERIA 2CO5A 1P92A 3WGIA 2PX9A 1GVJA 4EEFG 3BR6A 5L3FA 5L3BA 2RKHA 2FMYA 2FE3A 2JWTA 3KYCB 1E3HA 1R9TJ 3J80Z 3ERMA 2L3DA 2K86A 3CCRI 1P7JA 1W5TA 2X1EA 1FIPA 5DCFA 1G3YA 3QOPA 1JUSA 5M5XJ 2XAJA 1YJNI 3HUGA 4RAGA 1JGGA 3M4OJ 1ZYRF 2IW5A 3ZN1A 2EJRA 1R58A 3S16J 3BG5A 5JLWA 3RZDJ 3S32A 3IAM2 3IV5A 2FA5A 4WXCA 4DW6A 1STZA 4I98B 4BDZA 4NBQA 4KA4A 2DODA 1VQOI 3QODA 2Q0OA 2DPDA 1IV8A 2COMA 2FJ1A 2L7KA 1JJ8C 2H6BA 1U5TA 2HS5A 3FKJA 5HODA 1GV5A 4C9YA 2A5WA 3BG3A 1LB2A 5FKNA 4BBSJ 1F1ZA 1DGWY 3ZQ7A 3EUHC 3PUBA 1YIJI 4I0AA 1MNMC 2MD0A 1HDDC 1J75A 1I3AA 1TW3A 2AQEA 1YITI 3ABKH 3WU0A 4M3BA 4XICA 1B8IB 1X2NA 4KT5C 2IJLA 4D9JA 1R5HA 4G12A 3F9KA 4BAYA 5JHUA 2R5ZA 1LKXA 5E20A 2HPMA 2DFEA 4B44A 4C2MJ 1WKMA 2JVHA 1POGA 3R0JA 2WB1N 4HOBA 2E35A 4Z2YA 2XKOA 4IO9F 4ZZLA 4E7IA 1BBYA 1ZLKA 3W2VA 1V55H 5LFAA 3L2RA 2IGNA 3WE2A 3OYGA 5BPIA 2F5DA 3TBIA 1JKPC 4FISA 4ESFA 3ECOA 1BA5A 1XGSA 4UV9A 5GTHC 2BW3A 5F27A 2P0WA 2IS1A 1WJDA 3CF2A 2JJ7A 4JBAA 3KETA 5EEGA 4ZZDA 4D7NA 2O61A 1A35A 2X6XA 2ESNA 2XAUA 2EFWA 1SC7A 3BR2A 1P6RA 2BXYA 1I3QJ 5CYVA 2EBIA 3O8HA 4XKBA 1H0MA 1BC8C 2A07F 4V2GA 2GXAA 2WBMA 3H0DA 1O7FA 1YJ9I 1XS9A 2JUCA 1MGTA 3K7AJ 2E60A 4BXXJ 1PDNC 5D5WB 2FQ3A 2QQBA 1K83J 2QBYA 4CCNA 2HR3A 1JKQC 2FQ4A 3MWMA 4BE1A 3S1MJ 5LRRA 2DMUA 2R7ZJ 2MLKA 1ZH5A 1RI7A 1X3UA 4WCGA 4IHVA 1XX5A 5GAGJ 5EDNA 2XF5A 2XVCA 4M73A 4U7BA 4IL6C 2KKOA 2L9RA 2R5YB 3FBIB 3N97A 2HOSA 2E7WA 1YYVA 2YU9J 4MNUA 3RKQA 2EZHA 4XOTA 2I5UA 4G7ZF 2VT2A 4IXAA 3LSPA 4H0EA 3BPVA 3F8MA 4AVZA 4D0PA 1G3SA 3GTPJ 3KP5A 1ZRFA 2X48A 3KEOA 5E1ZB 3OL3A 3AG2H 4QIWN 1BW5A 2WTEA 1X1AA 2DOFA 3CCVI 1XSDA 1ETQA 2DDBA 2LYCA 5IPAA 1OR7C 2VE8A 1QZEA 2LKSA 2XF7A 2ZNZA 3PFIA 3FISA 1FZPB 1UELB 2E34A 3KZYA 4PFPA 3BR3A 4AD9A 3E5UA 2TDXA 4QSHA 1HW5A 1IAWA 4XK4A 2KIUA 3BLYA 2RGVA 1N78A 3ABTA 3CUQC 1HXDA 1YRNB 2LOOA 2XGDA 4IHWA 2ACJA 3KYLA 1XN7A 4QPOA 1EH8A 1O4XA 3EYIA 1VQ7I 3EPZA 2K02A 5IOZA 5J4YA 5E18F 2L7FP 4XRFA 3S93A 5K7FA 4IEJA 1FP1D 2PEXA 3BQYA 1KZHA 4KITB 4G7HF 2IGKA 4CO8A 1H88C 2DN0A 2RNJA 3HJEA 3TQNA 4IX7A 1USSA 1WH5A 3FXQA 3GTOJ 1DU6A 2KDOA 5A2QK 3V42A 1WSUA 4EV0A 1AA7A 2XAGA 2EH3A 2OQRA 4A5MA 2STWA 4RGSA 5LHHA 2R7TA 4E4HA 3CDLA 1IXSB 1AKHA 2GZWA 1XTAA 2QF7A 5L3CA 3FXJA 5B3SH 1O57A 1A36A 2BY1A 4Y17A 1JUMA 4KUMA 2GM4A 2CW7A 2KISA 1V5FA 2M2EA 1MMGA 2BE5F 2DFFA 3KX2A 4A3BJ 3I59A 2E2HJ 3TDUC 3WTZA 3BJOA 1I1SA 1SFEA 2Q2EA 3I55I 4HEA2 2E36A 4RLFA 2NOGA 2CG4A 2W25A 2M1BA 3GEZA 1IXCA 3WTSC 3K4BA 4MHGA 4N0BA 2HFHA 2V9PA 3S3OA 2ZXHA 3A1YA 3JRIA 4Z6YA 2DYRH 1V5EA 3G1LA 1BOBA 4FE7A 1M1EB 4DQ2A 3OSGA 4KN4X 3KEQA 3ASOH 4IRIA 4HDUA 3I0TA 4JYKA 3N4MA 1TWAJ 1VNDA 1ERDA 1Z05A 1PJRA 4LD5A 2FSWA 4FETA 2QBYB 2VUMJ 5E79C 3IAS2 3REOA 2LH9A 3L1PA 4I2OA 3RYPA 2QLZA 1T0FC 3FMSA 2Z99A 4PGHA 5FRMA 4R79A 5E3OA 3AAFA 4C3JJ 3F8CA 1EH7A 4RDUA 2PG4A 2NVXJ 4HV5A 4LB5A 3BCBA 2L9NA 2FUG2 1FLIA 5K5OA 2LR8A 5GAHJ 4U87A 3S2DJ 4AYBA 2BW3B 1BI3A 2X6YA 4J19A 3OYFA 4BY7J 2IPQX 3JAMZ 2R4GA 2LLKA 3BR0A 4HA8A 2JA8J 2CWEA 1U78A 1KQ9A 1KU9A 3GUDA 1HOMA 5EYRA 3HSFA 1K61A 4LG3A 3JSPA 2KFDA 3IC7A 1O7LA 2CFOA 5CVUA 4OIOF 3DFGA 2F5EA 1XG1A 3HSRA 3GZ6A 3FZVA 2BV6A 5FFZA
chains in the Genus database with same CATH topology
3GTJJ 2CJJA 1U9NA 1JKRC 5IP6A 3GBGA 2VPRA 4MFDA 2O7OA 4CYCB 2HOTA 5IP7J 4FE4A 1ZR4A 3S1QJ 2DA1A 2DA2A 1QPIA 2DMPA 5C3EJ 3FKIJ 2ECBA 4BKXA 4IHYA 4NDLA 3RZOJ 1B72A 2HXIA 2WAQN 3LSJA 2DMTA 2L7MP 2DA3A 4FCYA 4IHXA 1IDZA 2JMWA 1S7EA 1HF0A 1TWHJ 4D7MA 1SANA 1ETVA 4AYBN 5K7HA 3B6AA 2B63J 4A3EJ 3TP0A 2E1OA 2ME6A 3BT9A 5J1RA 5E3NA 2AHQA 3OOUA 4M3EA 3PO3J 3HOZJ 3ZQLA 2XB5A 3A03A 2HQ5A 1E3OC 5IOYA 2ME0A 2L7ZA 2DA7A 1ZK8A 3Q0VA 5DTDA 3LNQA 5GPAA 5JLXA 5FLMJ 1TC3C 3S2HJ 5F1JA 4C3IJ 1WH7A 5EG0B 4A3MJ 3GTGJ 3BR5A 3BR1A 5C4JJ 1GVDA 2DA4A 3I4MJ 3HDDA 2Y31A 3CQZJ 4M3FA 4W97A 3GTMJ 3IH2A 4LOCA 3ZQGA 4M6VA 3IH3A 1JT6A 3OIOA 2JK3A 1X58A 4UUTA 4A3DJ 2XPVA 4D5CA 5M3MJ 2EZLA 1RKTA 1FTTA 4JX6A 3JRBA 3FIWA 1VFCA 2DMNA 3HEFA 3BTJA 4JX4A 4HNVA 3Q0UA 1PUFB 2WV1A 3HKZN 1GT0C 3UKGA 2ELKA 1TWFJ 3DCFA 4W1UA 1IGNA 1NK2P 1IG7A 3BTIA 3I4NJ 2XSDC 1UMQA 1U9OA 5M5YJ 1LE8B 1WPKA 1Y1WJ 5J3LA 1WCMJ 5C44J 2OF7A 5GP9A 2G0EA 3ZQHA 2K40A 4L5EA 5M5WJ 4FTHA 2M0CA 1HLVA 1QVTA 3ZQFA 4DYCA 1T56A 2DA6A 2NVTJ 3NARA 3MVPA 2LP0A 5FLVA 2LK2A 2CU7A 3HOUJ 1MH3A 3CCYA 9ANTA 2M34A 1H89C 2JA5J 3VPRA 3F0CA 3JRCA 3PM1A 4XRSA 4A3LJ 1MBGA 1VI0A 5EGOA 4S0HB 2IEKA 1IV6A 2XGEA 4I76A 1IRZA 5F08A 1FIAA 3QPLA 3TEDA 1XC5A 1MBHA 4BBRJ 3E7LA 2CQQA 2MG4A 2E19A 5EEAA 2XGCA 5J1YA 3JRDA 2R93J 5EF6A 1OCTC 4XRSG 1I6HJ 1Z0XA 2DMQA 3FK6A 1JTYA 3IH4A 4M3GA 5IP9J 1ZGWA 1MBFA 3LSGA 2MGQA 4DYRA 1MBKA 1Z77A 4UUSA 1F36A 2ID3A 2W48A 5BNGA 2LVSA 4ABZA 1IDYA 3S1RJ 3H0GJ 1EF4A 4EEFG 3BR6A 3RQIA 3LSRA 3GTLJ 2JWTA 1ETOA 1LE8A 1R9TJ 1I50J 1P7JA 2YS9A 2K9NA 3HB9A 5K7ZA 5EZGA 1FIPA 1G2HA 2VI6A 4V2FA 3GTKJ 1ITYA 2LY9A 3TW6A 3G1OA 1JUSA 5M5XJ 1JGGA 3M4OJ 2Y9ZA 4B4CA 3DEWA 2KT0A 5IYBJ 1RPWA 1TWGJ 1ZKGA 5C4XJ 1WI3A 2Y30A 3S16J 1P7IA 1Q1VA 3BG5A 5JLWA 3RZDJ 1LFUP 3JRAA 3IV5A 1FJLA 4DW6A 2FJ1A 4MIMA 3HM5A 2HI3A 2I10A 1JJ8C 3S1NJ 1ETWA 4XIDA 4AC0A 5M3FJ 3ZQCA 5HODA 1GV5A 3QQAA 3BG3A 5FKNA 4BBSJ 3JRFA 4MO7A 5FKOA 3QPSA 1MNMC 1HDDC 3JR9A 2H8RA 1ZTRA 2LD5A 3H3VK 4M3BA 4XICA 1B8IB 1X2NA 5J1UA 3HOXJ 3HGYA 4G12A 4JX5A 2R5ZA 4DZJA 1AU7A 1MSFC 4Y7NJ 4UUSB 1ORKA 1QRYA 1ETKA 2OPTA 1CQTA 4C2MJ 1POGA 2WB1N 3JREA 2LKXA 4A3FJ 3WHBA 1ZR2A 4JP0A 5FKMA 1JKPC 3BG9A 4FISA 1BA5A 1RETA 1ETXA 1B72B 5F27A 2JJ7A 3WHCA 2FD5A 3PO2J 2R5ZB 1YRNA 3FK7A 4D7NA 3Q3SA 1W0TA 1ETYA 1LFBA 2CUFA 2QCOA 1RESA 2X6OA 3BR2A 1I3QJ 2EBIA 2N8GA 3O8HA 4M3DA 4V2GA 3W6VA 5GPCA 1H8AC 2CQXA 3BQZA 4A3CJ 1SFOJ 2MW8A 1XS9A 3K7AJ 1OCPA 1UHSA 5F04A 1BW6A 4BXXJ 1K83J 2MSYA 1JKQC 2FQ4A 2YUSA 3S1MJ 2DMUA 2R7ZJ 3HOYJ 2HOAA 1AHDP 2Y2ZA 4IHVA 2XB0X 3SDGA 4X1EA 5EDNA 2GBYA 1D5YA 2ECCA 2L9RA 1RR7A 2E2IJ 2R5YB 1MBJA 2DA5A 2HOSA 1HDPA 2YU9J 3RKQA 2EZHA 2HYJA 3LSPA 1X2MA 2VKEA 1MSEC 2M8GX 3GTPJ 2X48A 2R0QC 2NS8A 3O8GA 1B8IA 3B6CA 3MN2A 4QIWN 1BW5A 4DZPA 2K9QA 2M9HA 2X9DA 1ETQA 5IPAA 4RBOA 5IYCJ 2AO9A 2HDDA 1QVUA 3GTQJ 3FISA 3OSFA 4A3IJ 4MLOA 3BR3A 2CUEA 5FKLA 2NS7A 3TP3A 4QSHA 5E3LA 1F43A 3HOWJ 1A5JA 2KDZA 4XK4A 5DS9A 5F0HA 2D5VA 2NVQJ 2HXOA 1YRNB 2XGDA 4IHWA 1O4XA 4D5FA 3D1NI 1IUFA 5IOZA 1APLC 2L7FP 5K7FA 1GDTA 3NAUA 4IEJA 3SJMA 3BQYA 1H88C 4X6AJ 2DN0A 5FKKA 3BTLA 2P81A 1HCRA 1U8BA 1RKWA 4A69C 1GV2A 1WH5A 3GTOJ 1JTXA 4B1RA 4A3JJ 2COBA 5F0FA 2NVYJ 3CMYA 1IC8A 2FX0A 1DU6A 2XRLA 4AUXA 2EH3A 2XPWA 2IAIA 1UG2A 1ENHA 3HBLA 1BL0A 3HOVJ 5F0CA 4MFEA 2JN6A 2TRTA 3CDLA 3ZOBA 1AKHA 3S17J 2QF7A 2DJNA 1JUMA 2EQRA 2ID6A 2GM4A 3K2AA 2H1KA 2M2EA 4CYCA 4A3BJ 2RAEA 3BTCA 2E2HJ 2GLOA 1GUUA 2K9SA 4B3AA 2VKVA 2XPUA 3A02A 1T33A 2NOGA 4XRMA 1IJWC 2EZKA 1JUPA 2Y9YA 1PUFA 1ZQ3P 5E3MA 5EGOB 2L0KA 2CRGA 3SFIA 3JRIA 3S14J 1W0UA 3HGGA 1MBEA 3G1LA 4QTRA 3JRHA 4FE7A 3OSGA 1OJLA 2IBDA 2PMZN 4DYQA 4JYKA 5EZHA 1DU0A 1NK3P 1TWAJ 1WGXA 1VNDA 3G1MA 1JT0A 4A3GJ 4C3HJ 3A01B 2VUMJ 3S15J 2O8KA 2LTPA 2E2JJ 2O9LA 1FTZA 2Y0SN 3L1PA 2EZIA 1JJ6C 4Y52J 4A3KJ 1TWCJ 5EG0A 3LOCA 3A01A 1NTCA 1AKHB 3ZQIA 5E3OA 1BJZA 4C3JJ 1A6IA 4RDUA 2NVXJ 4I6ZA 4GFBA 2JA6J 2TCTA 1VF9A 1JKOC 2LR8A 3JRGA 3S2DJ 3M3YJ 1OFCX 2ZB9A 4J19A 4BY7J 2JA7J 1Y1VJ 3C2BA 1MH4A 4A93J 2LFBA 2LLKA 2DTZA 3BR0A 2JA8J 1U78A 2R5YA 2R92J 1HOMA 5EYRA 3TW7A 3Q0WA 1K61A 3MKLA 1XG1A 4BY1J 5FJ8J 5IYDJ 1FEXA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 3GTJ J;  2CJJ A;  1U9N A;  1JKR C;  5IP6 A;  3GBG A;  2VPR A;  4MFD A;  2O7O A;  4CYC B;  2HOT A;  5IP7 J;  4FE4 A;  1ZR4 A;  3S1Q J;  2DA1 A;  2DA2 A;  1QPI A;  2DMP A;  5C3E J;  3FKI J;  2ECB A;  4BKX A;  4IHY A;  4NDL A;  3RZO J;  1B72 A;  2HXI A;  2WAQ N;  3LSJ A;  2DMT A;  2L7M P;  2DA3 A;  4FCY A;  4IHX A;  1IDZ A;  2JMW A;  1S7E A;  1HF0 A;  1TWH J;  4D7M A;  1SAN A;  1ETV A;  4AYB N;  5K7H A;  3B6A A;  2B63 J;  4A3E J;  3TP0 A;  2E1O A;  2ME6 A;  3BT9 A;  5J1R A;  5E3N A;  2AHQ A;  3OOU A;  4M3E A;  3PO3 J;  3HOZ J;  3ZQL A;  2XB5 A;  3A03 A;  2HQ5 A;  1E3O C;  5IOY A;  2ME0 A;  2L7Z A;  2DA7 A;  1ZK8 A;  3Q0V A;  5DTD A;  3LNQ A;  5GPA A;  5JLX A;  5FLM J;  1TC3 C;  3S2H J;  5F1J A;  4C3I J;  1WH7 A;  5EG0 B;  4A3M J;  3GTG J;  3BR5 A;  3BR1 A;  5C4J J;  1GVD A;  2DA4 A;  3I4M J;  3HDD A;  2Y31 A;  3CQZ J;  4M3F A;  4W97 A;  3GTM J;  3IH2 A;  4LOC A;  3ZQG A;  4M6V A;  3IH3 A;  1JT6 A;  3OIO A;  2JK3 A;  1X58 A;  4UUT A;  4A3D J;  2XPV A;  4D5C A;  5M3M J;  2EZL A;  1RKT A;  1FTT A;  4JX6 A;  3JRB A;  3FIW A;  1VFC A;  2DMN A;  3HEF A;  3BTJ A;  4JX4 A;  4HNV A;  3Q0U A;  1PUF B;  2WV1 A;  3HKZ N;  1GT0 C;  3UKG A;  2ELK A;  1TWF J;  3DCF A;  4W1U A;  1IGN A;  1NK2 P;  1IG7 A;  3BTI A;  3I4N J;  2XSD C;  1UMQ A;  1U9O A;  5M5Y J;  1LE8 B;  1WPK A;  1Y1W J;  5J3L A;  1WCM J;  5C44 J;  2OF7 A;  5GP9 A;  2G0E A;  3ZQH A;  2K40 A;  4L5E A;  5M5W J;  4FTH A;  2M0C A;  1HLV A;  1QVT A;  3ZQF A;  4DYC A;  1T56 A;  2DA6 A;  2NVT J;  3NAR A;  3MVP A;  2LP0 A;  5FLV A;  2LK2 A;  2CU7 A;  3HOU J;  1MH3 A;  3CCY A;  9ANT A;  2M34 A;  1H89 C;  2JA5 J;  3VPR A;  3F0C A;  3JRC A;  3PM1 A;  4XRS A;  4A3L J;  1MBG A;  1VI0 A;  5EGO A;  4S0H B;  2IEK A;  1IV6 A;  2XGE A;  4I76 A;  1IRZ A;  5F08 A;  1FIA A;  3QPL A;  3TED A;  1XC5 A;  1MBH A;  4BBR J;  3E7L A;  2CQQ A;  2MG4 A;  2E19 A;  5EEA A;  2XGC A;  5J1Y A;  3JRD A;  2R93 J;  5EF6 A;  1OCT C;  4XRS G;  1I6H J;  1Z0X A;  2DMQ A;  3FK6 A;  1JTY A;  3IH4 A;  4M3G A;  5IP9 J;  1ZGW A;  1MBF A;  3LSG A;  2MGQ A;  4DYR A;  1MBK A;  1Z77 A;  4UUS A;  1F36 A;  2ID3 A;  2W48 A;  5BNG A;  2LVS A;  4ABZ A;  1IDY A;  3S1R J;  3H0G J;  1EF4 A;  4EEF G;  3BR6 A;  3RQI A;  3LSR A;  3GTL J;  2JWT A;  1ETO A;  1LE8 A;  1R9T J;  1I50 J;  1P7J A;  2YS9 A;  2K9N A;  3HB9 A;  5K7Z A;  5EZG A;  1FIP A;  1G2H A;  2VI6 A;  4V2F A;  3GTK J;  1ITY A;  2LY9 A;  3TW6 A;  3G1O A;  1JUS A;  5M5X J;  1JGG A;  3M4O J;  2Y9Z A;  4B4C A;  3DEW A;  2KT0 A;  5IYB J;  1RPW A;  1TWG J;  1ZKG A;  5C4X J;  1WI3 A;  2Y30 A;  3S16 J;  1P7I A;  1Q1V A;  3BG5 A;  5JLW A;  3RZD J;  1LFU P;  3JRA A;  3IV5 A;  1FJL A;  4DW6 A;  2FJ1 A;  4MIM A;  3HM5 A;  2HI3 A;  2I10 A;  1JJ8 C;  3S1N J;  1ETW A;  4XID A;  4AC0 A;  5M3F J;  3ZQC A;  5HOD A;  1GV5 A;  3QQA A;  3BG3 A;  5FKN A;  4BBS J;  3JRF A;  4MO7 A;  5FKO A;  3QPS A;  1MNM C;  1HDD C;  3JR9 A;  2H8R A;  1ZTR A;  2LD5 A;  3H3V K;  4M3B A;  4XIC A;  1B8I B;  1X2N A;  5J1U A;  3HOX J;  3HGY A;  4G12 A;  4JX5 A;  2R5Z A;  4DZJ A;  1AU7 A;  1MSF C;  4Y7N J;  4UUS B;  1ORK A;  1QRY A;  1ETK A;  2OPT A;  1CQT A;  4C2M J;  1POG A;  2WB1 N;  3JRE A;  2LKX A;  4A3F J;  3WHB A;  1ZR2 A;  4JP0 A;  5FKM A;  1JKP C;  3BG9 A;  4FIS A;  1BA5 A;  1RET A;  1ETX A;  1B72 B;  5F27 A;  2JJ7 A;  3WHC A;  2FD5 A;  3PO2 J;  2R5Z B;  1YRN A;  3FK7 A;  4D7N A;  3Q3S A;  1W0T A;  1ETY A;  1LFB A;  2CUF A;  2QCO A;  1RES A;  2X6O A;  3BR2 A;  1I3Q J;  2EBI A;  2N8G A;  3O8H A;  4M3D A;  4V2G A;  3W6V A;  5GPC A;  1H8A C;  2CQX A;  3BQZ A;  4A3C J;  1SFO J;  2MW8 A;  1XS9 A;  3K7A J;  1OCP A;  1UHS A;  5F04 A;  1BW6 A;  4BXX J;  1K83 J;  2MSY A;  1JKQ C;  2FQ4 A;  2YUS A;  3S1M J;  2DMU A;  2R7Z J;  3HOY J;  2HOA A;  1AHD P;  2Y2Z A;  4IHV A;  2XB0 X;  3SDG A;  4X1E A;  5EDN A;  2GBY A;  1D5Y A;  2ECC A;  2L9R A;  1RR7 A;  2E2I J;  2R5Y B;  1MBJ A;  2DA5 A;  2HOS A;  1HDP A;  2YU9 J;  3RKQ A;  2EZH A;  2HYJ A;  3LSP A;  1X2M A;  2VKE A;  1MSE C;  2M8G X;  3GTP J;  2X48 A;  2R0Q C;  2NS8 A;  3O8G A;  1B8I A;  3B6C A;  3MN2 A;  4QIW N;  1BW5 A;  4DZP A;  2K9Q A;  2M9H A;  2X9D A;  1ETQ A;  5IPA A;  4RBO A;  5IYC J;  2AO9 A;  2HDD A;  1QVU A;  3GTQ J;  3FIS A;  3OSF A;  4A3I J;  4MLO A;  3BR3 A;  2CUE A;  5FKL A;  2NS7 A;  3TP3 A;  4QSH A;  5E3L A;  1F43 A;  3HOW J;  1A5J A;  2KDZ A;  4XK4 A;  5DS9 A;  5F0H A;  2D5V A;  2NVQ J;  2HXO A;  1YRN B;  2XGD A;  4IHW A;  1O4X A;  4D5F A;  3D1N I;  1IUF A;  5IOZ A;  1APL C;  2L7F P;  5K7F A;  1GDT A;  3NAU A;  4IEJ A;  3SJM A;  3BQY A;  1H88 C;  4X6A J;  2DN0 A;  5FKK A;  3BTL A;  2P81 A;  1HCR A;  1U8B A;  1RKW A;  4A69 C;  1GV2 A;  1WH5 A;  3GTO J;  1JTX A;  4B1R A;  4A3J J;  2COB A;  5F0F A;  2NVY J;  3CMY A;  1IC8 A;  2FX0 A;  1DU6 A;  2XRL A;  4AUX A;  2EH3 A;  2XPW A;  2IAI A;  1UG2 A;  1ENH A;  3HBL A;  1BL0 A;  3HOV J;  5F0C A;  4MFE A;  2JN6 A;  2TRT A;  3CDL A;  3ZOB A;  1AKH A;  3S17 J;  2QF7 A;  2DJN A;  1JUM A;  2EQR A;  2ID6 A;  2GM4 A;  3K2A A;  2H1K A;  2M2E A;  4CYC A;  4A3B J;  2RAE A;  3BTC A;  2E2H J;  2GLO A;  1GUU A;  2K9S A;  4B3A A;  2VKV A;  2XPU A;  3A02 A;  1T33 A;  2NOG A;  4XRM A;  1IJW C;  2EZK A;  1JUP A;  2Y9Y A;  1PUF A;  1ZQ3 P;  5E3M A;  5EGO B;  2L0K A;  2CRG A;  3SFI A;  3JRI A;  3S14 J;  1W0U A;  3HGG A;  1MBE A;  3G1L A;  4QTR A;  3JRH A;  4FE7 A;  3OSG A;  1OJL A;  2IBD A;  2PMZ N;  4DYQ A;  4JYK A;  5EZH A;  1DU0 A;  1NK3 P;  1TWA J;  1WGX A;  1VND A;  3G1M A;  1JT0 A;  4A3G J;  4C3H J;  3A01 B;  2VUM J;  3S15 J;  2O8K A;  2LTP A;  2E2J J;  2O9L A;  1FTZ A;  2Y0S N;  3L1P A;  2EZI A;  1JJ6 C;  4Y52 J;  4A3K J;  1TWC J;  5EG0 A;  3LOC A;  3A01 A;  1NTC A;  1AKH B;  3ZQI A;  5E3O A;  1BJZ A;  4C3J J;  1A6I A;  4RDU A;  2NVX J;  4I6Z A;  4GFB A;  2JA6 J;  2TCT A;  1VF9 A;  1JKO C;  2LR8 A;  3JRG A;  3S2D J;  3M3Y J;  1OFC X;  2ZB9 A;  4J19 A;  4BY7 J;  2JA7 J;  1Y1V J;  3C2B A;  1MH4 A;  4A93 J;  2LFB A;  2LLK A;  2DTZ A;  3BR0 A;  2JA8 J;  1U78 A;  2R5Y A;  2R92 J;  1HOM A;  5EYR A;  3TW7 A;  3Q0W A;  1K61 A;  3MKL A;  1XG1 A;  4BY1 J;  5FJ8 J;  5IYD J;  1FEX A; 
#chains in the Genus database with same CATH topology
 1G6N A;  2DLL A;  3GFI A;  3GTJ J;  2CJJ A;  4S04 A;  1ZGA A;  4G94 A;  4MFD A;  1PP7 U;  2IS2 A;  1J9I A;  3ZR8 X;  2HU9 A;  3P9K A;  4II3 A;  1B6A A;  2EPF A;  2VAS A;  1K4S A;  3S1Q J;  1MW7 A;  2DA2 A;  2P6S A;  5TGT A;  2YX4 A;  4XSX F;  3I4P A;  4N9H A;  4XKW A;  1VQ8 I;  5JVG F;  4L9J A;  3QU6 A;  4IHY A;  4Y3O A;  1W1W E;  1EJ9 A;  2NAZ A;  3ECH A;  2V26 A;  3LSJ A;  1FYL A;  2HQR A;  4FCY A;  3SFZ A;  3DKY A;  2JMW A;  4QWQ A;  5JVT A;  4AWX B;  1YW7 A;  2RC4 A;  4XN0 A;  1VZ0 A;  2GQQ A;  3G2B A;  1T95 A;  2KLO A;  2L5Q A;  3OYM A;  4M9S A;  2ETH A;  4CHU A;  3OIP A;  3BT9 A;  1OPC A;  5E3N A;  3SZT A;  1XCB A;  2AHQ A;  3OOU A;  2KMU A;  1X19 A;  2MAB A;  3PO3 J;  1I6X A;  3ZQL A;  2XRN A;  1FX7 A;  3M7G A;  1K78 A;  4HF2 A;  3HOZ J;  2HQ5 A;  2OCE A;  3M1E A;  3ABM H;  2L7Z A;  2DA7 A;  2B0L A;  4QLC U;  2LRD A;  1X4P A;  1WWX A;  1J0R A;  4E7J A;  5FLM J;  3FHZ A;  2WAE A;  2PFB A;  4ZYD A;  4C3I J;  3RPU A;  5EG0 B;  4A3M J;  3ZMV A;  4A6E A;  3GTG J;  3HYI A;  5D8L B;  3BR1 A;  1GVD A;  4KIG A;  2ELH A;  3I4M J;  2Z2S B;  4XOR A;  1V3F A;  5K5Q A;  4W97 A;  4BS9 A;  1U2W A;  2K4B A;  4M6V A;  3OS0 A;  2R3S A;  4NB5 A;  2BHY A;  1X58 A;  5IT9 K;  2XPV A;  2PJP A;  3LST A;  3L09 A;  5M3M J;  1ULY A;  5LLQ A;  2E1M C;  3GVA A;  1OCR H;  3ELK A;  1JE8 A;  2P8T A;  4U0W A;  2VB6 A;  3M9A A;  4HV6 A;  1S8N A;  3K1P A;  2A61 A;  4CGZ A;  3NEU A;  3R4K A;  1VQ4 I;  1TBX A;  2H1L A;  1QZY A;  1S7A A;  4A5N A;  4LMY A;  1SD6 A;  2V4J C;  3LSH A;  1U9O A;  2LG4 A;  4RB1 A;  3DPT A;  5H6Q A;  2ADU A;  1R36 A;  2QGU A;  1Y1W J;  5J3L A;  3GX4 X;  1OR7 A;  2G0E A;  3DKX A;  1YW8 A;  3T8T A;  1J7K A;  3BRO A;  3D5R C;  3FXL A;  3WTX C;  1XCV A;  1BR4 A;  1XDU A;  2E5N A;  5CPR B;  1SVO A;  2DA6 A;  3PFY A;  1D0Z A;  2V1D A;  4HNT A;  4CSW A;  4M6Y A;  1HKS A;  2LP0 A;  1MH3 A;  3CCY A;  3HPG A;  4UV8 A;  2CYY A;  2M34 A;  4ZYH A;  2JA5 J;  2PMH A;  1W36 D;  3VPR A;  1R00 A;  4F92 B;  3PM1 A;  4A3L J;  4GCV A;  1MBG A;  3EQL F;  4S0H B;  5LD2 C;  3CCU I;  1ZGJ A;  1IV6 A;  2DQL A;  1FWZ A;  1FIA A;  3QOE A;  3G3Z A;  3QPL A;  1Y6I A;  1T39 A;  1T6S A;  3K10 A;  4ZYA A;  3MAJ A;  3A0B C;  2IS6 A;  2OD5 A;  3SEQ A;  4BGD A;  2O0Y A;  2XGC A;  3JRD A;  2BVM A;  1RZ4 A;  1YHQ I;  1FSE A;  2NXN B;  1Z0X A;  2IGM A;  3CDH A;  4P1W A;  4UVB A;  1GHC A;  1OCZ H;  1OYY A;  5KAI C;  5IP9 J;  3LSG A;  1O3T A;  1FOK A;  2MGQ A;  4ZH4 F;  3K9T A;  2M5W A;  2VKH A;  3F3X A;  4RAZ A;  1YE9 A;  3C1D A;  1KU2 A;  2F4O B;  3HIF A;  4ABZ A;  2M3A A;  2W85 A;  3S1R J;  3QYF A;  3HL2 A;  2BEO A;  4IZZ A;  2M0M A;  1LEA A;  3G71 I;  1SAU A;  1ETO A;  1T2K A;  1IW7 F;  1LE8 A;  3E97 A;  1I50 J;  5DM6 F;  3AG1 H;  1A04 A;  2HKX A;  2LY2 A;  2OTJ I;  1UG0 A;  2GWR A;  4RB2 C;  3HB9 A;  1FNN A;  1HKQ A;  2GIZ A;  5K7Z A;  2OZ6 A;  3IL2 A;  1G2H A;  2VI6 A;  3CCQ I;  3GTK J;  1ITY A;  3DLA A;  4LIT A;  2Z33 A;  4A2U A;  2QWW A;  3JW4 A;  2Y9Z A;  4YIF A;  5JHF A;  1D1C A;  2CQ7 A;  3M8J A;  1WI3 A;  2Y30 A;  4G9Y A;  2H6C A;  3Q9S A;  4KT6 A;  1P7I A;  4B48 A;  3KPH A;  1FJL A;  4EM2 A;  2CUZ A;  3PNY A;  2D1V A;  1O3Q A;  1F9N A;  4XBF A;  1KU3 A;  3GZN B;  2VJ5 A;  1KON A;  1TNT A;  3MQ0 A;  2I10 A;  3HRU A;  3S1N J;  3OR2 C;  3BZK A;  3EDP A;  3ZQC A;  3QQA A;  2EA4 A;  4FHT A;  4MO7 A;  1RC9 A;  2A05 A;  5FKO A;  1BN5 A;  3JR9 A;  3KP6 A;  1YTY A;  2KRC A;  3H3V K;  1W5C C;  3PNV A;  3DTE A;  4HZF A;  5J1U A;  2BBY A;  3ML6 A;  3CF5 F;  3M1C A;  4DZJ A;  4I01 A;  4Y13 A;  3ZMZ A;  2MH9 A;  1ORK A;  2EK5 A;  4UNO A;  1ETK A;  2OPT A;  5HS8 A;  1CQT A;  5DUI A;  3OMY A;  4C2T A;  3GLL A;  1LVA A;  3P5J A;  1P4A A;  3JRE A;  1LFP A;  4XLA A;  4EVI A;  2LKX A;  4A3F J;  3J81 K;  3OYD A;  5L3G A;  3GFM A;  3FXM A;  4X0G A;  3FWE A;  3VYT B;  5DUK A;  2OC6 A;  1J2X A;  1FT9 A;  2CQN A;  1E0E A;  1SD4 A;  2JPC A;  3E5Q A;  2F5C A;  4BEH B;  4IOC F;  3WHC A;  2IT0 A;  4DGW B;  3VOD A;  3R61 A;  3CUQ B;  5GAD J;  2FD5 A;  2XF6 A;  1X1D A;  4II2 A;  1YRN A;  2VXD A;  3Q3S A;  1ETY A;  3ERE D;  1W0T A;  3V7C A;  4LIV A;  5BMZ A;  5HLG A;  2XAF A;  2LMD A;  2CUF A;  2QCO A;  3OIQ A;  3TL4 X;  3ZXS A;  4KJZ A;  1YG2 A;  1R49 A;  1W7P D;  4KIF A;  4M3D A;  4V19 K;  2VE9 A;  5F04 A;  1BW6 A;  3IRR A;  2ZME A;  2ZME B;  3PQK A;  3S3N A;  3FM5 A;  3MKZ A;  3HOY J;  4XLP F;  5CQG A;  1YX5 A;  2Y2Z A;  3SDG A;  2EA2 A;  3J80 K;  2HTJ A;  2YPR A;  3CO6 C;  3I56 I;  1D5Y A;  2E2I J;  1RR7 A;  3ASN H;  5ILV A;  2DA5 A;  2WA0 A;  4KYW A;  1HDP A;  1K79 A;  4MQV A;  3GYH X;  5CVV A;  3CC7 I;  4ITV A;  3LA2 A;  4E7S A;  2P5K A;  2VON A;  2DT6 A;  1MMA A;  1OYW A;  3GCM A;  3VB2 A;  2R0Q C;  2NS8 A;  3D0S A;  1B8I A;  2E5Z A;  4E7K A;  3FBN B;  2OAZ A;  5B1B H;  2BY3 A;  2D1H A;  5FRO A;  3MD2 A;  3OYH A;  1MDM A;  2CS3 A;  2DI3 A;  4I7H A;  2R7W A;  1XMX A;  1QVU A;  2GOX B;  4NHJ A;  5FD5 A;  2PBI A;  3DXJ F;  5HLI A;  1KU7 A;  3MKW B;  2C6Y A;  4L5I A;  3CME I;  4KIS A;  5CVJ A;  3VOE A;  5E3L A;  4BE0 A;  1F43 A;  2KDZ A;  2HTS A;  2LNB A;  5LGT A;  2CH0 A;  3CDI A;  3OR1 C;  5DS9 A;  5KCM A;  2D5V A;  3Q9V A;  4FX4 A;  4ESB A;  3AFH A;  1Z67 A;  2ISY A;  1KQ8 A;  2VN2 A;  2H94 A;  3HUG B;  1ZRE A;  1Y8R B;  5ICF A;  4B3X A;  1QQI A;  1F4K A;  2JTV A;  3HC7 A;  4RA2 A;  1IUF A;  1WVR A;  1APL C;  1MJ9 A;  2RQP A;  2EFP A;  4Q5S F;  1T0F A;  4GRI A;  4X6A J;  3BTL A;  1RKW A;  4A69 C;  4B1R A;  2W7N A;  2COB A;  3CMY A;  4HF0 A;  2FX0 A;  4DOZ A;  1D0Y A;  2CW0 F;  4XON A;  5LHG A;  2XPW A;  1ENH A;  4I99 C;  2ZBK A;  1BL0 A;  1ZRD A;  2FU4 A;  1QPM A;  2TRT A;  2MC3 A;  4XKC A;  2DJN A;  1KYZ A;  2EQR A;  1FBU A;  3K4N A;  2A69 F;  3K2A A;  1P9Q C;  2RN7 A;  3JAM K;  1LPQ A;  1FY7 A;  4PCQ A;  3HKZ A;  2K9S A;  2DT5 A;  3I5U A;  2XPU A;  4ON0 A;  4ZDO A;  2EFO A;  4GXO A;  4MQ9 F;  4ENJ A;  3IP4 B;  2DW4 A;  2EZK A;  1QO0 D;  2O6G E;  3I3L A;  1TTY A;  2H8W A;  4DBR A;  5EGO B;  1RUO A;  4YFX F;  3BP8 A;  3VFZ A;  4KFC A;  5D5X B;  3F21 A;  5FFX A;  3VEP A;  3JRH A;  3J7A Y;  3BPX A;  3IWF A;  1OJL A;  5HDN A;  2V9K A;  3PL8 A;  4UY8 I;  4PSX A;  3ONQ A;  1NK3 P;  1Z7U A;  1ZG3 A;  3G1M A;  3QWL A;  4CCJ A;  5FD6 A;  4Q4Z F;  2VL8 A;  1IN4 A;  1R4M B;  3A01 B;  1XGM A;  3S15 J;  3H36 A;  4M74 A;  1S72 I;  1FYM A;  2K9L A;  2O8K A;  2LTP A;  2X51 A;  1TLH B;  1LDJ A;  2O9L A;  2VPL A;  4F55 A;  2EZI A;  1OYI A;  2Q8K A;  4Y52 J;  1P4X A;  5EG0 A;  4L0Z B;  4B8X A;  4ANJ A;  3MMY B;  3A01 A;  1NTC A;  2BY0 A;  1YOV B;  1BJZ A;  3ZMD A;  2DYS H;  1Z6T A;  3TGN A;  4I6Z A;  4GFB A;  4F93 B;  2TCT A;  4EJT A;  2P5V A;  1QGP A;  3JRG A;  1JGS A;  3CC4 I;  4P9U A;  2CGP A;  2JA7 J;  1ACI A;  1Y1V J;  4UUV A;  1MH4 A;  3B02 A;  2LFB A;  2NVU B;  3V8J A;  1YJW I;  4AM3 A;  2NOJ B;  3WTT C;  5D5V B;  3TW7 A;  3QRF F;  3Q0W A;  1IZ1 A;  1J5Y A;  3IKV A;  3IHU A;  4PUS A;  2GAU A;  1WHU A;  2KIM A;  2JA2 A;  1CF7 B;  4BDY A;  3WTV C;  3O3K A;  2M4K A;  1ZAR A;  1J59 A;  1TQP A;  1ZR4 A;  3M07 A;  2STT A;  4RM2 A;  6PAX A;  3MZY A;  2ZCW A;  2DMP A;  2VBX A;  3FKI J;  5C3E J;  1HSJ A;  1G59 A;  4CYD A;  2MA3 A;  3HZJ A;  4PDK A;  4OIQ F;  4NDL A;  3WOD F;  2DPU A;  3QYB A;  2M7A A;  3RZO J;  1B72 A;  4HBL A;  2HXI A;  3H35 A;  5DCM B;  3WE3 A;  4IHX A;  3W6K B;  3WTU C;  3OYI A;  3L00 A;  1ETV A;  4AYB N;  5K7H A;  3I53 A;  3W2W A;  4EM0 B;  5H6R A;  3OYN A;  2JSP A;  4YEL A;  2EV5 A;  4EJV A;  2QEX I;  4RMN A;  2VXZ A;  1BM9 A;  2A6E F;  3A03 A;  1E3O C;  4HLX A;  4Y15 A;  1R23 A;  1XB4 A;  2YR2 A;  5DTD A;  3LNQ A;  5GPA A;  4XLN F;  2J5O A;  1NH3 A;  4L18 B;  1WH7 A;  1W5S A;  2DA4 A;  3HDD A;  4CCO A;  4J01 A;  1LNW A;  1E17 A;  3LAP A;  4M3F A;  2KHM A;  3ABU A;  3IH2 A;  1TNS A;  4QPQ A;  3U1K A;  3ZQG A;  1MMD A;  2V6C A;  1JT6 A;  2ZXW H;  2JK3 A;  4U88 A;  3ZMT A;  4UUT A;  3TOA A;  4A3D J;  1MDM B;  1Z3Y A;  4UB8 C;  2DCE A;  2EZL A;  3J7Z I;  3NWT A;  4JX6 A;  3JRB A;  1WZ2 A;  1TZL A;  3D5S C;  1U8R A;  4G6D A;  1K4T A;  1DP7 P;  2EFQ A;  3Q0U A;  3ZCO A;  2P7C B;  3HKZ N;  2G7H A;  2ELK A;  1TWF J;  3NWS A;  4W1U A;  3KP2 A;  2L2O A;  4DIQ A;  4XR6 A;  3BY6 A;  2RVC A;  2KP6 A;  3BTI A;  5AIQ A;  2FXA A;  3A2K A;  3I4N J;  1UMQ A;  4NQW B;  5HDG A;  2HQN A;  5HLH A;  1YIO A;  1VQN I;  3UR3 C;  1WPK A;  1F5T A;  4OAY A;  1I5Z A;  1V54 H;  1KA8 A;  2E1C A;  3TO6 A;  2OF7 A;  5GP9 A;  1O3R A;  1VQL I;  3MZH A;  4FTH A;  4TV7 A;  4PJN A;  3C3W A;  3ZQF A;  2UWM A;  1ODD A;  4DYC A;  1T56 A;  4KIB A;  3NAR A;  1HW2 A;  1QA6 A;  3MVP A;  2GOM A;  2V7F A;  5HLT A;  2HYF A;  2OU2 A;  5FLV A;  4C2U A;  3WG9 A;  1H89 C;  4JQF A;  3F0C A;  3JRC A;  3F8B A;  3K1M A;  1PP8 F;  2K3P A;  2F6C A;  2IEK A;  2V6E A;  1TW2 A;  4I76 A;  4LJZ F;  1R71 A;  4BEH A;  3TED A;  5FGM A;  1UZC A;  3NRV A;  1TT0 A;  1K7A A;  3E3V A;  4BBR J;  2XSJ C;  3CES A;  3E7L A;  5HNH A;  2E19 A;  2R93 J;  3I64 A;  2WB1 A;  2XDV A;  1OKR A;  3OYE A;  1VQP I;  3FK6 A;  1JTY A;  3IH4 A;  3CO7 C;  2X1D A;  2D2W A;  4XLH A;  3V4G A;  4ETS A;  1SFU A;  4DYR A;  3R0A A;  1H9T A;  2ID3 A;  3HSE A;  2W48 A;  4CCL A;  4CZZ A;  3OS2 A;  1S29 A;  4EGY A;  4YRV A;  2H27 A;  3H0G J;  1W7P A;  1EF4 A;  2XAH A;  4EMS A;  1VQM I;  2RDP A;  3RQI A;  3LSR A;  1SFX A;  3I59 B;  2A5Y B;  3GTL J;  3A0H C;  2KZV A;  4LK0 F;  1ZAO A;  2M4G A;  1Z3X A;  2WY8 Q;  2ZKZ A;  3MFK A;  1G3W A;  4OAZ A;  3G6E I;  1QHH D;  4BQA A;  1JI8 A;  4V2F A;  1MJA A;  2F48 A;  3G1O A;  1FMV A;  2OQG A;  2JUG A;  3E5X A;  2PJR A;  4FQG A;  5HS7 A;  1HQC A;  1BI0 A;  5J40 A;  3ULQ B;  1RPW A;  1QNT A;  1ZKG A;  3N05 A;  4HST A;  4BNC A;  5K5R A;  1Q1V A;  1N75 A;  3IWZ A;  4BJ5 C;  2J5P A;  5DV5 A;  2EFN A;  1LFU P;  3JRA A;  2UXX A;  3BG6 A;  4L9V A;  4GYG A;  3DV8 A;  2EIJ H;  3M8F A;  1UST A;  3HTS B;  3V7S A;  2OTL I;  1FOW A;  1S9H A;  3R6S A;  2HI3 A;  4HYE A;  5ILU A;  1ETW A;  2E1M B;  4N4O B;  5M3F J;  2HZT A;  1RRJ A;  3F6V A;  3JCU C;  5KK1 A;  3DU6 A;  3KEY A;  4DBQ A;  3JRF A;  2ZSI B;  3ROU A;  1VQ6 I;  3QPS A;  3TOB A;  1XD7 A;  1D8K A;  2H8R A;  1ZTR A;  2XAQ A;  3WU1 B;  3TMO A;  3BZ6 A;  2EV6 A;  1I39 A;  2EWN A;  3H9G A;  3HOX J;  1UCR A;  1FSH A;  4H4K C;  1GXP A;  3LFU A;  3HGY A;  3MZ8 A;  2FBI A;  1RUN A;  4JX5 A;  3GXO A;  5B1A H;  1TP4 A;  4N9I A;  1AU7 A;  4Y7N J;  3DLL F;  4RLQ A;  2BHZ A;  3GFJ A;  2QSF X;  3ISP A;  3LA3 A;  4HQM A;  5HOO A;  4Q48 A;  3ZGK A;  3GLX A;  2W82 A;  4NQW A;  1A31 A;  3O6B B;  3DP7 A;  3WHB A;  2QQA A;  3L2U A;  2HEO A;  5FKM A;  1K6Y A;  3BG9 A;  2BZT A;  3DF8 A;  1BR1 A;  1U5T C;  4RB0 A;  1ETX A;  1B72 B;  2EIL H;  2KJC A;  2V79 A;  2XV4 S;  2L9S A;  3E1S A;  4AID A;  4G6T B;  1YLF A;  2KZG A;  3PO2 J;  2R5Z B;  3FK7 A;  1T38 A;  2QQ8 A;  4JK1 X;  3VDX A;  4BL0 B;  4HDV A;  4LIU A;  4MGR A;  3W2A A;  3EUA A;  3OYA A;  5AON A;  2N8G A;  5FB2 A;  3W6V A;  3CCM I;  1H8A C;  3BQZ A;  1SFO J;  2MW8 A;  3IRQ A;  2FML A;  1OCP A;  1UHS A;  4LGW A;  2QKL B;  2CQK A;  2MSY A;  1X1P A;  3H5A A;  3DEU A;  3HPH A;  3LQQ A;  2VC1 A;  2HOA A;  1AHD P;  1VQK I;  2QZ8 A;  2NNN A;  4X1E A;  1YS6 A;  2ECC A;  2LBF B;  2LDU A;  2QKM B;  4IJA A;  1MBJ A;  5DDG A;  3QPT A;  1LEB A;  5DYM A;  2RRE A;  2H09 A;  3SYT A;  1GLN A;  2M45 A;  4AU7 A;  1MMS A;  3K70 C;  2HYJ A;  4XNF A;  1X2M A;  4Q47 A;  1BOA A;  2HVQ A;  4LG0 B;  2FOK A;  4G6Q A;  3RPQ A;  2AQF A;  2M8G X;  3RKW A;  4GGG A;  4E7Z A;  3WTW C;  3O8G A;  3B6C A;  2A68 F;  4EM1 A;  3FMQ A;  3HHG A;  4LLL A;  4DZP A;  2Y69 H;  1WQ2 A;  3KFW X;  4ZYG A;  4XKV A;  4A6D A;  1Y56 A;  2X9D A;  2Y0M A;  2R7F A;  4IQ4 A;  4PSW A;  5DEQ A;  1L0O C;  2RV8 A;  2FNA A;  2LC2 A;  3DWL E;  2HYG D;  3BDD A;  4OMZ A;  5IYC J;  2YSR A;  2HDD A;  2LSO A;  3GTQ J;  4EJO A;  3OSF A;  2CUJ A;  1XPX A;  2P6T A;  2G9W A;  2GXG A;  5FKL A;  2ICW G;  3E0J B;  3MCZ A;  2IVM A;  1S3J A;  3T1B A;  1E3P A;  1OLT A;  4M71 A;  2QEN A;  2RNG A;  2K5C A;  3U1D A;  1Z21 A;  1ZN2 A;  2YU3 A;  4I09 A;  5J8F A;  3C2G A;  2KQR A;  2VT3 A;  4UXN A;  3L2C A;  3H9J A;  3DBR B;  2EB7 A;  1Q1H A;  2V1X A;  4RB3 C;  3FHN A;  4CCM A;  1B1B A;  4G7O F;  4E7L A;  3D1N I;  4WXH A;  3PNT A;  4PJ0 C;  3BWG A;  3ZN0 A;  5D4S A;  3NAU A;  3TKY A;  2CV1 A;  2XUB A;  2VJ4 A;  4ZYE A;  3VYR B;  1JHH A;  3AG3 H;  5FKK A;  1HCR A;  2P81 A;  1U8B A;  4YFK F;  5TJJ A;  4HG2 A;  1S6L A;  5F0F A;  1IC8 A;  2BYV E;  2PQ8 A;  3RYR A;  4WK8 F;  2QUF A;  2PI0 A;  2XRL A;  1XGN A;  2G7U A;  1IF1 A;  2GXB A;  4AUX A;  3K4K A;  4A0Z A;  4RS8 A;  2IAI A;  1UG2 A;  3OYL A;  2UXN A;  3DPU A;  2LF8 A;  5ED4 A;  3CJT B;  2XGX A;  2LKP A;  2R7U A;  3P7N A;  3RI4 A;  5F0C A;  4HLY A;  4MFE A;  1HA8 A;  2JN6 A;  1JHF A;  2K3F A;  4M6X A;  5TIS C;  3ZOB A;  3S17 J;  5F64 A;  2QSH X;  3L2Q A;  4F52 A;  2ID6 A;  1R1V A;  3HRS A;  1PUE E;  2H1K A;  3QP5 A;  1U3E M;  2RAE A;  3BTC A;  1EA3 A;  2CSO A;  2GLO A;  2KJB A;  2R7V A;  1GUU A;  4B3A A;  3A02 A;  1NG6 A;  2DT7 B;  3U9G A;  2ZO4 A;  4XRM A;  1QZZ A;  1IJW C;  2B9S A;  1Y8Q B;  2F5V A;  2JVG A;  4A0Y A;  4XLE A;  3F22 A;  3GZ5 A;  4B47 A;  4LG0 A;  1W36 C;  1ZQ3 P;  1SMT A;  1OCO H;  3OYC A;  2VQL A;  1DQU A;  2W00 A;  2ZSH B;  3ZP5 A;  3FXO A;  3VSL A;  3S14 J;  1W0U A;  2R7O A;  1VQ9 I;  3SZG A;  1MBE A;  1P4W A;  2ZXI A;  3CJN A;  5J47 A;  1SMY F;  2VBW A;  3ZMS A;  2PMZ N;  1UAA A;  3I9V 2;  1FMW A;  5K1Y A;  1WI9 A;  4ASN A;  4A3G J;  2BY2 A;  3K4M A;  4UHT A;  4ZDP A;  2E2J J;  1FTZ A;  1AOY A;  2HQA A;  2MC4 A;  1JJ6 C;  1X4O A;  2CFX A;  2JT1 A;  3CLO A;  2QQ9 A;  1X1B A;  3CUO A;  2K27 A;  2ZME C;  3H3Z A;  3H92 A;  3S8P A;  3ZQI A;  3DU5 A;  2X0L A;  3F72 A;  3VYS B;  2FF4 A;  4P5O A;  4EQQ A;  1VF9 A;  3CTA A;  4BJT A;  3OL4 A;  1LQ1 A;  4CCK A;  1HC8 A;  2VQC A;  2WC2 A;  4ENK A;  2BXZ A;  2LY1 A;  3C2B A;  4A93 J;  5KAF C;  1U0J A;  5J6X A;  3IKT A;  4B09 A;  4BY1 J;  3HXL A;  3G73 A;  3CJQ B;  1JKR C;  1U9N A;  2F5F A;  1XDS A;  3RTR A;  3Q5F A;  3GBG A;  2VPR A;  1MJB A;  2ZJ2 A;  1EH6 A;  4PJL A;  1V5G A;  3ZPL A;  3ESW B;  2VBZ A;  2QSG X;  5E1X A;  2R7R A;  2DA1 A;  1LVK A;  1TQM A;  5B66 C;  2X6W A;  5E17 F;  2ZJR F;  4BKX A;  2VQH A;  1D1B A;  3KZI C;  2GA1 A;  1NHA A;  3DEE A;  4UB6 C;  1SFK A;  3H5N A;  2MH2 A;  4KDP A;  2DMT A;  3PJR A;  1WJB A;  4ENM A;  1IDZ A;  3KCC A;  4CA0 A;  4HF1 A;  4IOA F;  1S7E A;  1HF0 A;  3CCE I;  1TWH J;  4D7M A;  1SAN A;  4A3E J;  3TP0 A;  2ME6 A;  3CCL I;  1G8X A;  5JI6 A;  1DUX C;  2R7S A;  2LF7 A;  2CV0 A;  3T0Y A;  1IRG A;  2QM3 A;  5HS9 A;  4PK4 A;  2XB5 A;  5L3D A;  4LK1 F;  3RCO A;  4GDF A;  2IXS A;  2ME0 A;  1ZK8 A;  2DK5 A;  1Z7L A;  3GW2 A;  4L5J A;  1SVM A;  3Q0V A;  5HVQ C;  5JLX A;  5F1J A;  5BS6 A;  3L2V A;  1LJ9 A;  1D5V A;  4A0X A;  4L9N A;  5LEJ A;  1ON2 A;  2DOA A;  3ZQQ A;  5A2Q Z;  3GFL A;  2A6H F;  1J09 A;  1S5L C;  1U6G A;  2VIX A;  1W7P B;  3K70 D;  5FO5 A;  2VQG A;  4GYI A;  2HVS A;  3IH3 A;  4I02 A;  3RIR A;  4HW0 A;  1R22 A;  4D5C A;  4B43 A;  1RKT A;  1FTT A;  1D3Y A;  2PMZ A;  3I71 A;  4XQF A;  3OYJ A;  3HEF A;  1X3Z B;  3CUQ A;  3QYE A;  1I1G A;  1PUF B;  2WV1 A;  3T8R A;  2Z16 A;  3UKG A;  3KZZ A;  2CW8 A;  3DCF A;  3PSF A;  4WWC A;  2JRM A;  2RQQ A;  3WU2 C;  3H3U A;  5KHD A;  2JPB A;  3QAH A;  2DOE A;  3FXK A;  2W84 A;  1UHM A;  2OZU A;  5M5Y J;  1BI2 A;  1LE8 B;  3BOQ A;  3PIP F;  4FT8 A;  2V9V A;  3CP2 A;  1OQY A;  3GME A;  3ZQH A;  2K40 A;  4PFO A;  3OYB A;  2QVO A;  5CJ9 A;  2M0C A;  3E6M A;  1HLV A;  2CMP A;  2JZY A;  3FMR A;  1QHG A;  2EIM H;  2LRE A;  4HX7 A;  1IRF A;  2NVT J;  3CZ6 A;  3COA C;  4IF4 A;  2KL4 A;  2KRF A;  2NYX A;  1R5G A;  4YFN F;  3L2W A;  2UV1 A;  3KP3 A;  3H9Q A;  1VI0 A;  1FC3 A;  4BE2 A;  3CMA I;  2ZFW A;  5H2F C;  4MEY F;  4LFU A;  1S7O A;  3LMM A;  1XC5 A;  3DTI A;  2CQQ A;  2MG4 A;  4EJU A;  5EF6 A;  1Z1D A;  5AIP A;  4F7Z A;  4XRS G;  2HWV A;  4BJ6 C;  1MMN A;  2WWY A;  1EV7 A;  1TT5 B;  4R1H A;  3U2R A;  4M3G A;  3H5R A;  3GF2 A;  3BG7 A;  3F8N A;  3SHF A;  2DK8 A;  2ZJP F;  2ISZ A;  4E7H A;  2F4M B;  4JOM A;  1MBK A;  1F36 A;  2Y48 A;  4Y33 A;  2LVS A;  3HOS A;  1C0W A;  1IDY A;  3RJP A;  3C7J A;  1XSV A;  1LUJ B;  4RAF A;  2DO7 A;  3MEX A;  4OIP F;  4EAT A;  1HKT A;  1XMA A;  3V8K A;  2OBP A;  3K4J A;  5J8C A;  2YS9 A;  2K9N A;  2K85 A;  4XLF A;  5EZG A;  4YG2 F;  3OYK A;  2YX7 A;  2LY9 A;  3E6B A;  3TW6 A;  1QBJ A;  1KQ0 A;  3T5X A;  3BJA A;  2L4A A;  4B4C A;  3DEW A;  1IN8 A;  3F23 A;  2KT0 A;  5IYB J;  1TWG J;  5C4X J;  2L01 A;  1BJA A;  1XSX A;  1WRJ A;  3OV8 A;  2PMU A;  4CXF A;  3FM3 A;  4KNY A;  3J7Y J;  4BHP A;  2E1N A;  2WAQ A;  2VOD A;  2O5R A;  3DTK A;  2ZC2 A;  4MIM A;  5GAE J;  3HM5 A;  2DTR A;  4LLN A;  1G4D A;  1D8J A;  4XID A;  4AC0 A;  1R1T A;  2DDA A;  3NQO A;  2HDC A;  1VTN C;  1SAX A;  4YEJ A;  4OMY A;  4A12 A;  1ONV A;  2LD5 A;  1LDK B;  2V1U A;  2DBB A;  2W1O A;  1CGP A;  2A3S A;  4M9Z A;  4MTE A;  4G8X A;  1N25 A;  1MSF C;  1KYW A;  3VYU B;  4UUS B;  1QRY A;  1YO5 C;  1K78 B;  1ZEL A;  1RR8 C;  4HRI A;  1HBX G;  2KRH A;  2MD5 A;  4HSR A;  4XL9 A;  4BAC A;  2EIK H;  5IT9 Z;  4KIC A;  4NUB A;  2LBF A;  2HPI A;  3P9I A;  2W4S A;  2JSC A;  3LWF A;  2FBH A;  1R4N B;  2ZXJ A;  4PJJ A;  3G4S I;  2D45 A;  1ZR2 A;  1UHW A;  4JP0 A;  3JTH A;  3CCS I;  5FRN A;  1JXS A;  2XKP A;  3W6J B;  1RET A;  1R5I D;  1T98 A;  2VOO A;  3B73 A;  2XRO A;  2Z9O A;  4BHC A;  2W24 A;  1Y0U A;  1DPR A;  1BIB A;  2DAO A;  2HDW A;  1LFB A;  2MFZ A;  4ENN A;  1RES A;  2B7E A;  2X6O A;  3BZC A;  1XGO A;  5GPC A;  4A3C J;  2CQX A;  4PJM A;  5GTI C;  4O3M A;  3S2W A;  2DQR A;  2FRH A;  5LRS A;  4BYY A;  2YUS A;  4U0V A;  5TRD A;  5D5U B;  5HDK A;  2XB0 X;  5E1W A;  2GBY A;  2IA0 A;  2IA1 A;  3PSI A;  4M9X A;  4EGZ A;  2L9V A;  1NG7 A;  5BPD A;  4F91 B;  5ILS A;  2NS0 A;  3DBH B;  3WG7 H;  1DDN A;  1IN5 A;  4S05 A;  2F4I A;  1OCC H;  1WJC A;  4HPQ A;  2CV2 A;  3KIO A;  3BCA A;  4IQJ A;  1X1C A;  1W4M A;  2VKE A;  4CDG A;  3ABL H;  2Q1Z B;  3CMM A;  1MSE C;  3P9C A;  5CVI A;  2FBK A;  3PUF A;  1IN6 A;  1XMK A;  3RSN A;  4M72 A;  4BU2 A;  2E7X A;  1YS7 A;  3KLN A;  1ZG5 A;  3MN2 A;  1GXQ A;  3CP8 A;  2K9Q A;  2M9H A;  4IVN A;  3DQV C;  1I27 A;  1YI2 I;  4Y4R A;  4RBO A;  1D1A A;  2FEZ A;  3SXY A;  2ZFU A;  2NRA C;  1L3L A;  2M8E A;  2AO9 A;  1B9N A;  4A3I J;  5HNF A;  1IRX A;  4MLO A;  2CUE A;  1K6O A;  2NS7 A;  4WX9 A;  3VWB A;  2ZJQ F;  3TP3 A;  2L4M A;  3HOW J;  3FXU A;  1A5J A;  1IXR C;  2O03 A;  3JTG A;  1WFX A;  4IHT A;  5EEH A;  1MIJ A;  5F0H A;  2NVQ J;  1BR2 A;  2HXO A;  3M8E A;  1B9M A;  3F8F A;  1HST A;  1E2X A;  3EET A;  1DGR M;  2ESH A;  2PJR B;  4D5F A;  2P4W A;  3GO5 A;  5JFR A;  1PVE A;  4GO1 A;  4BQQ A;  2OUM A;  1DP3 A;  4OU0 A;  2HOE A;  5D8K B;  2EV0 A;  3EUH A;  1YFH A;  1GDT A;  4K2E A;  4IPA A;  5DD4 A;  2Q2E B;  3SJM A;  1WJE A;  1ZLJ A;  3HTU A;  2R7Q A;  5BOX A;  1GV2 A;  3O2P E;  2M30 A;  1JTX A;  4A3J J;  3K6G A;  2NVY J;  4CZC A;  5KNL A;  1RIO H;  4OIR F;  2KIF A;  2VOP A;  4E70 A;  3F6O A;  3V7R A;  3OS1 A;  1QU3 A;  2HVR A;  3HBL A;  4IRH A;  3HOV J;  2M7B A;  4LB6 B;  1IO2 A;  2MLG A;  3R60 A;  5CVR A;  5D4R A;  3HHH A;  2P7V B;  3PQJ A;  4EJW A;  2NNY A;  3FF5 A;  3KYD B;  4ZTJ A;  1G3T A;  3CLQ A;  4P96 A;  1MND A;  4CYC A;  3SDB A;  3CD6 I;  4BUP A;  3QU3 A;  4DJA A;  3L9F A;  1UFM A;  4HNU A;  3AKZ A;  2VKV A;  3S3M A;  4KMF A;  4I0B A;  1MNE A;  3OY9 A;  1N77 A;  1T33 A;  3I58 A;  3QP6 A;  5CKT A;  2R7D A;  5LGN A;  1JUP A;  3LSM A;  4O5V A;  2Y9Y A;  1PUF A;  1T8I A;  3RKX A;  5E3M A;  3HG9 A;  2DU9 A;  3FX3 A;  1RNL A;  2L0K A;  2CRG A;  3SFI A;  2XIG A;  5KVR A;  2X4H A;  2OJE D;  3HGG A;  3X2Q H;  2AXT C;  4D1Q A;  1OMI A;  4QTR A;  3K2Z A;  1LDD A;  2MYS A;  2Z1D A;  3W3C A;  2IBD A;  4ZDL A;  3KP4 A;  2UZK A;  3LL7 A;  3U21 A;  2VBY A;  4DYQ A;  1HW1 A;  2BVL A;  5EZH A;  4NNJ A;  3C18 A;  1DU0 A;  4BXF A;  1WGX A;  3C2H A;  4XLC A;  3FXR A;  3IUO A;  2DJI A;  5D6F A;  1EKE A;  1JT0 A;  1Z91 A;  4C3H J;  4OWR B;  3LA7 A;  4UVA A;  1BC7 C;  1BI1 A;  4ZTF A;  2VKD A;  2HKO A;  2Y0S N;  3H1C A;  4KN7 X;  3DPL C;  4A3K J;  4RM3 A;  2AXL A;  1TWC J;  4AIJ A;  3LOC A;  4HQE A;  3EUK L;  1AKH B;  4FX0 A;  3RDI A;  3MKY B;  1A6I A;  1P2F A;  2XHK A;  1WJF A;  1ZHF A;  3LSK A;  3WTY C;  2QYO A;  2JA6 J;  2PN6 A;  5CQE A;  2PLY A;  2XC7 A;  1JKO C;  5IY5 H;  3M3Y J;  1OFC X;  2ZB9 A;  1T08 B;  2OCC H;  2UUZ A;  5ICC A;  2DTZ A;  2L02 A;  5ICG A;  2VJI A;  2R5Y A;  4AIK A;  2R92 J;  2FNP A;  2F2E A;  1MZB A;  2IGO A;  2R7X A;  2OV7 A;  4L0Y B;  2HZD A;  1MD0 A;  4PZJ A;  2X1C A;  3MKL A;  2WY7 Q;  1Z9C A;  2WAF A;  5LHI A;  5FJ8 J;  3TO7 A;  3PIO F;  4R8H A;  4MEX F;  5IYD J;  1FEX A;  3J7A O;  1SVL A;  4BHB A;  1FP2 A;  5LGU A;  5IP6 A;  4BQN A;  5DM7 F;  1R7J A;  2O7O A;  4LLG F;  4CYC B;  3KLO A;  1OIS A;  2HOT A;  3K0L A;  5IP7 J;  3JSO A;  1WJA A;  3OWT A;  4FE4 A;  2K9M A;  3V8L A;  1SD7 A;  1AWC A;  1QPI A;  4ZC3 A;  1PYV A;  4N4N B;  2DXI A;  2XAS A;  4BQO A;  2ECB A;  3AL0 C;  2ELJ A;  4XSZ F;  4AIH A;  3E6C C;  5FLX K;  3BJ6 A;  3K4L A;  1FPQ A;  3L7W A;  2Z5U A;  3VSK A;  3CCJ I;  2O8X A;  3SEZ A;  3KE2 A;  1WJ5 A;  4IRG A;  5H20 A;  2IS4 A;  3HRM A;  2WAQ N;  2L7M P;  2M87 A;  2DA3 A;  4BH9 A;  1X3W B;  2WV0 A;  3E6D A;  3WGH A;  4O6J A;  1D0X A;  2K7L A;  1KGS A;  5BQT A;  1B4A A;  4ESJ A;  4IHS A;  2B63 J;  3B6A A;  5LBQ A;  2E1O A;  5E8G A;  3RQ4 A;  2WAD A;  1FOY A;  4WF2 A;  4DNC A;  1ZG1 A;  5J1R A;  4J00 A;  1YQA A;  1Z6R A;  4MTD A;  4M3E A;  1FBQ A;  1V4R A;  2IRF G;  3WGG A;  2HGC A;  5IOY A;  3CJR B;  2I8D A;  1UJ8 A;  1SD5 A;  4CUG A;  4RGX A;  2JRT A;  4ZJZ A;  5F6F A;  5ICE A;  1TC3 C;  3S2H J;  2K4J A;  1MKM A;  2ZNY A;  2Y75 A;  3BR5 A;  4P55 A;  4WXD A;  5C4J J;  2Z3Y A;  1YX3 A;  2Y31 A;  3CQZ J;  1U5T B;  5E8I A;  4U0Y A;  3GTM J;  3AL0 B;  1Y0N A;  4XOP A;  4LOC A;  5D6E A;  3RKY A;  3RPU D;  5FLX Z;  2BGC A;  1CF7 A;  3OOP A;  4UVC A;  5JR3 A;  3LAJ A;  3OIO A;  3DKW A;  4YIR X;  2HNH A;  2QA4 I;  4AVP A;  5LEK A;  1H9G A;  3UNG C;  1VQ5 I;  4OIN F;  2FOW A;  3FIW A;  3SZP A;  1VFC A;  2W57 A;  3K4C A;  3CC2 I;  2DMN A;  3BTJ A;  3D5L A;  1IN7 A;  3FDY A;  3ZRG A;  4FAS D;  4JX4 A;  4HNV A;  1B59 A;  1TQI A;  3TO9 A;  1SEU A;  4BXU A;  1GT0 C;  5B5E C;  2O3F A;  4HAM A;  2IP2 A;  4RAY A;  3TDZ C;  4HX8 A;  4YII A;  1IGN A;  1NK2 P;  1IG7 A;  2JQ7 A;  2P5L C;  2AS5 F;  2EIN H;  2XSD C;  2OA4 A;  4L9T A;  1REP C;  2BOL A;  4CH7 A;  2GIV A;  2V1N A;  1R6R A;  1WCM J;  2E71 A;  5C44 J;  1DPU A;  5DCM A;  3EYY A;  4HX4 A;  4L5E A;  4E6K G;  5M5W J;  2A6T A;  1IUY A;  1QVT A;  3KP7 A;  1O3S A;  3A4C A;  1ZRC A;  4NC8 A;  3HOT A;  5IT3 A;  3AG4 H;  1UB9 A;  2DFH A;  4IKF A;  2DFI A;  2MBF A;  2LK2 A;  3HRT A;  2CU7 A;  3HOU J;  9ANT A;  3DBL B;  4PGG A;  2KPM A;  2X85 A;  4C30 A;  2IA2 A;  4XRS A;  5L3E A;  4U7D A;  4RGR A;  2VJJ A;  3K69 A;  1TL8 A;  1R1U A;  4XN3 A;  5CLS A;  3QPH A;  5EGO A;  4XMY A;  2Y0S A;  2XGE A;  1IRZ A;  5F08 A;  1FYK A;  4F3Q A;  5DD8 A;  4KMU X;  3J81 Z;  4RGU A;  1MBH A;  5J4V A;  3K1N A;  4NC7 A;  2GA2 A;  4XM3 A;  5EJC A;  3I54 A;  5J1Y A;  5EEA A;  1OCT C;  1BIA A;  3LSI A;  1YW9 A;  1I6H J;  1ON1 A;  1A6Q A;  4NC6 A;  2VLA A;  2DMQ A;  1FOX A;  3ZMU A;  1ZGW A;  3SQN A;  4OOI A;  3GWZ A;  1MBF A;  4P9F A;  2KIQ A;  1FBS A;  2VC0 A;  3BC8 A;  3LQR A;  1Z77 A;  4UUS A;  5F1R A;  1Y39 A;  2L54 A;  4CIC A;  5BNG A;  3LFK A;  5ERI A;  2CO5 A;  1P92 A;  3WGI A;  2PX9 A;  1GVJ A;  4EEF G;  3BR6 A;  5L3F A;  5L3B A;  2RKH A;  2FMY A;  2FE3 A;  2JWT A;  3KYC B;  1E3H A;  1R9T J;  3J80 Z;  3ERM A;  2L3D A;  2K86 A;  3CCR I;  1P7J A;  1W5T A;  2X1E A;  1FIP A;  5DCF A;  1G3Y A;  3QOP A;  1JUS A;  5M5X J;  2XAJ A;  1YJN I;  3HUG A;  4RAG A;  1JGG A;  3M4O J;  1ZYR F;  2IW5 A;  3ZN1 A;  2EJR A;  1R58 A;  3S16 J;  3BG5 A;  5JLW A;  3RZD J;  3S32 A;  3IAM 2;  3IV5 A;  2FA5 A;  4WXC A;  4DW6 A;  1STZ A;  4I98 B;  4BDZ A;  4NBQ A;  4KA4 A;  2DOD A;  1VQO I;  3QOD A;  2Q0O A;  2DPD A;  1IV8 A;  2COM A;  2FJ1 A;  2L7K A;  1JJ8 C;  2H6B A;  1U5T A;  2HS5 A;  3FKJ A;  5HOD A;  1GV5 A;  4C9Y A;  2A5W A;  3BG3 A;  1LB2 A;  5FKN A;  4BBS J;  1F1Z A;  1DGW Y;  3ZQ7 A;  3EUH C;  3PUB A;  1YIJ I;  4I0A A;  1MNM C;  2MD0 A;  1HDD C;  1J75 A;  1I3A A;  1TW3 A;  2AQE A;  1YIT I;  3ABK H;  3WU0 A;  4M3B A;  4XIC A;  1B8I B;  1X2N A;  4KT5 C;  2IJL A;  4D9J A;  1R5H A;  4G12 A;  3F9K A;  4BAY A;  5JHU A;  2R5Z A;  1LKX A;  5E20 A;  2HPM A;  2DFE A;  4B44 A;  4C2M J;  1WKM A;  2JVH A;  1POG A;  3R0J A;  2WB1 N;  4HOB A;  2E35 A;  4Z2Y A;  2XKO A;  4IO9 F;  4ZZL A;  4E7I A;  1BBY A;  1ZLK A;  3W2V A;  1V55 H;  5LFA A;  3L2R A;  2IGN A;  3WE2 A;  3OYG A;  5BPI A;  2F5D A;  3TBI A;  1JKP C;  4FIS A;  4ESF A;  3ECO A;  1BA5 A;  1XGS A;  4UV9 A;  5GTH C;  2BW3 A;  5F27 A;  2P0W A;  2IS1 A;  1WJD A;  3CF2 A;  2JJ7 A;  4JBA A;  3KET A;  5EEG A;  4ZZD A;  4D7N A;  2O61 A;  1A35 A;  2X6X A;  2ESN A;  2XAU A;  2EFW A;  1SC7 A;  3BR2 A;  1P6R A;  2BXY A;  1I3Q J;  5CYV A;  2EBI A;  3O8H A;  4XKB A;  1H0M A;  1BC8 C;  2A07 F;  4V2G A;  2GXA A;  2WBM A;  3H0D A;  1O7F A;  1YJ9 I;  1XS9 A;  2JUC A;  1MGT A;  3K7A J;  2E60 A;  4BXX J;  1PDN C;  5D5W B;  2FQ3 A;  2QQB A;  1K83 J;  2QBY A;  4CCN A;  2HR3 A;  1JKQ C;  2FQ4 A;  3MWM A;  4BE1 A;  3S1M J;  5LRR A;  2DMU A;  2R7Z J;  2MLK A;  1ZH5 A;  1RI7 A;  1X3U A;  4WCG A;  4IHV A;  1XX5 A;  5GAG J;  5EDN A;  2XF5 A;  2XVC A;  4M73 A;  4U7B A;  4IL6 C;  2KKO A;  2L9R A;  2R5Y B;  3FBI B;  3N97 A;  2HOS A;  2E7W A;  1YYV A;  2YU9 J;  4MNU A;  3RKQ A;  2EZH A;  4XOT A;  2I5U A;  4G7Z F;  2VT2 A;  4IXA A;  3LSP A;  4H0E A;  3BPV A;  3F8M A;  4AVZ A;  4D0P A;  1G3S A;  3GTP J;  3KP5 A;  1ZRF A;  2X48 A;  3KEO A;  5E1Z B;  3OL3 A;  3AG2 H;  4QIW N;  1BW5 A;  2WTE A;  1X1A A;  2DOF A;  3CCV I;  1XSD A;  1ETQ A;  2DDB A;  2LYC A;  5IPA A;  1OR7 C;  2VE8 A;  1QZE A;  2LKS A;  2XF7 A;  2ZNZ A;  3PFI A;  3FIS A;  1FZP B;  1UEL B;  2E34 A;  3KZY A;  4PFP A;  3BR3 A;  4AD9 A;  3E5U A;  2TDX A;  4QSH A;  1HW5 A;  1IAW A;  4XK4 A;  2KIU A;  3BLY A;  2RGV A;  1N78 A;  3ABT A;  3CUQ C;  1HXD A;  1YRN B;  2LOO A;  2XGD A;  4IHW A;  2ACJ A;  3KYL A;  1XN7 A;  4QPO A;  1EH8 A;  1O4X A;  3EYI A;  1VQ7 I;  3EPZ A;  2K02 A;  5IOZ A;  5J4Y A;  5E18 F;  2L7F P;  4XRF A;  3S93 A;  5K7F A;  4IEJ A;  1FP1 D;  2PEX A;  3BQY A;  1KZH A;  4KIT B;  4G7H F;  2IGK A;  4CO8 A;  1H88 C;  2DN0 A;  2RNJ A;  3HJE A;  3TQN A;  4IX7 A;  1USS A;  1WH5 A;  3FXQ A;  3GTO J;  1DU6 A;  2KDO A;  5A2Q K;  3V42 A;  1WSU A;  4EV0 A;  1AA7 A;  2XAG A;  2EH3 A;  2OQR A;  4A5M A;  2STW A;  4RGS A;  5LHH A;  2R7T A;  4E4H A;  3CDL A;  1IXS B;  1AKH A;  2GZW A;  1XTA A;  2QF7 A;  5L3C A;  3FXJ A;  5B3S H;  1O57 A;  1A36 A;  2BY1 A;  4Y17 A;  1JUM A;  4KUM A;  2GM4 A;  2CW7 A;  2KIS A;  1V5F A;  2M2E A;  1MMG A;  2BE5 F;  2DFF A;  3KX2 A;  4A3B J;  3I59 A;  2E2H J;  3TDU C;  3WTZ A;  3BJO A;  1I1S A;  1SFE A;  2Q2E A;  3I55 I;  4HEA 2;  2E36 A;  4RLF A;  2NOG A;  2CG4 A;  2W25 A;  2M1B A;  3GEZ A;  1IXC A;  3WTS C;  3K4B A;  4MHG A;  4N0B A;  2HFH A;  2V9P A;  3S3O A;  2ZXH A;  3A1Y A;  3JRI A;  4Z6Y A;  2DYR H;  1V5E A;  3G1L A;  1BOB A;  4FE7 A;  1M1E B;  4DQ2 A;  3OSG A;  4KN4 X;  3KEQ A;  3ASO H;  4IRI A;  4HDU A;  3I0T A;  4JYK A;  3N4M A;  1TWA J;  1VND A;  1ERD A;  1Z05 A;  1PJR A;  4LD5 A;  2FSW A;  4FET A;  2QBY B;  2VUM J;  5E79 C;  3IAS 2;  3REO A;  2LH9 A;  3L1P A;  4I2O A;  3RYP A;  2QLZ A;  1T0F C;  3FMS A;  2Z99 A;  4PGH A;  5FRM A;  4R79 A;  5E3O A;  3AAF A;  4C3J J;  3F8C A;  1EH7 A;  4RDU A;  2PG4 A;  2NVX J;  4HV5 A;  4LB5 A;  3BCB A;  2L9N A;  2FUG 2;  1FLI A;  5K5O A;  2LR8 A;  5GAH J;  4U87 A;  3S2D J;  4AYB A;  2BW3 B;  1BI3 A;  2X6Y A;  4J19 A;  3OYF A;  4BY7 J;  2IPQ X;  3JAM Z;  2R4G A;  2LLK A;  3BR0 A;  4HA8 A;  2JA8 J;  2CWE A;  1U78 A;  1KQ9 A;  1KU9 A;  3GUD A;  1HOM A;  5EYR A;  3HSF A;  1K61 A;  4LG3 A;  3JSP A;  2KFD A;  3IC7 A;  1O7L A;  2CFO A;  5CVU A;  4OIO F;  3DFG A;  2F5E A;  1XG1 A;  3HSR A;  3GZ6 A;  3FZV A;  2BV6 A;  5FFZ A; 
#chains in the Genus database with same CATH homology
 3GTJ J;  2CJJ A;  1U9N A;  1JKR C;  5IP6 A;  3GBG A;  2VPR A;  4MFD A;  2O7O A;  4CYC B;  2HOT A;  5IP7 J;  4FE4 A;  1ZR4 A;  3S1Q J;  2DA1 A;  2DA2 A;  1QPI A;  2DMP A;  5C3E J;  3FKI J;  2ECB A;  4BKX A;  4IHY A;  4NDL A;  3RZO J;  1B72 A;  2HXI A;  2WAQ N;  3LSJ A;  2DMT A;  2L7M P;  2DA3 A;  4FCY A;  4IHX A;  1IDZ A;  2JMW A;  1S7E A;  1HF0 A;  1TWH J;  4D7M A;  1SAN A;  1ETV A;  4AYB N;  5K7H A;  3B6A A;  2B63 J;  4A3E J;  3TP0 A;  2E1O A;  2ME6 A;  3BT9 A;  5J1R A;  5E3N A;  2AHQ A;  3OOU A;  4M3E A;  3PO3 J;  3HOZ J;  3ZQL A;  2XB5 A;  3A03 A;  2HQ5 A;  1E3O C;  5IOY A;  2ME0 A;  2L7Z A;  2DA7 A;  1ZK8 A;  3Q0V A;  5DTD A;  3LNQ A;  5GPA A;  5JLX A;  5FLM J;  1TC3 C;  3S2H J;  5F1J A;  4C3I J;  1WH7 A;  5EG0 B;  4A3M J;  3GTG J;  3BR5 A;  3BR1 A;  5C4J J;  1GVD A;  2DA4 A;  3I4M J;  3HDD A;  2Y31 A;  3CQZ J;  4M3F A;  4W97 A;  3GTM J;  3IH2 A;  4LOC A;  3ZQG A;  4M6V A;  3IH3 A;  1JT6 A;  3OIO A;  2JK3 A;  1X58 A;  4UUT A;  4A3D J;  2XPV A;  4D5C A;  5M3M J;  2EZL A;  1RKT A;  1FTT A;  4JX6 A;  3JRB A;  3FIW A;  1VFC A;  2DMN A;  3HEF A;  3BTJ A;  4JX4 A;  4HNV A;  3Q0U A;  1PUF B;  2WV1 A;  3HKZ N;  1GT0 C;  3UKG A;  2ELK A;  1TWF J;  3DCF A;  4W1U A;  1IGN A;  1NK2 P;  1IG7 A;  3BTI A;  3I4N J;  2XSD C;  1UMQ A;  1U9O A;  5M5Y J;  1LE8 B;  1WPK A;  1Y1W J;  5J3L A;  1WCM J;  5C44 J;  2OF7 A;  5GP9 A;  2G0E A;  3ZQH A;  2K40 A;  4L5E A;  5M5W J;  4FTH A;  2M0C A;  1HLV A;  1QVT A;  3ZQF A;  4DYC A;  1T56 A;  2DA6 A;  2NVT J;  3NAR A;  3MVP A;  2LP0 A;  5FLV A;  2LK2 A;  2CU7 A;  3HOU J;  1MH3 A;  3CCY A;  9ANT A;  2M34 A;  1H89 C;  2JA5 J;  3VPR A;  3F0C A;  3JRC A;  3PM1 A;  4XRS A;  4A3L J;  1MBG A;  1VI0 A;  5EGO A;  4S0H B;  2IEK A;  1IV6 A;  2XGE A;  4I76 A;  1IRZ A;  5F08 A;  1FIA A;  3QPL A;  3TED A;  1XC5 A;  1MBH A;  4BBR J;  3E7L A;  2CQQ A;  2MG4 A;  2E19 A;  5EEA A;  2XGC A;  5J1Y A;  3JRD A;  2R93 J;  5EF6 A;  1OCT C;  4XRS G;  1I6H J;  1Z0X A;  2DMQ A;  3FK6 A;  1JTY A;  3IH4 A;  4M3G A;  5IP9 J;  1ZGW A;  1MBF A;  3LSG A;  2MGQ A;  4DYR A;  1MBK A;  1Z77 A;  4UUS A;  1F36 A;  2ID3 A;  2W48 A;  5BNG A;  2LVS A;  4ABZ A;  1IDY A;  3S1R J;  3H0G J;  1EF4 A;  4EEF G;  3BR6 A;  3RQI A;  3LSR A;  3GTL J;  2JWT A;  1ETO A;  1LE8 A;  1R9T J;  1I50 J;  1P7J A;  2YS9 A;  2K9N A;  3HB9 A;  5K7Z A;  5EZG A;  1FIP A;  1G2H A;  2VI6 A;  4V2F A;  3GTK J;  1ITY A;  2LY9 A;  3TW6 A;  3G1O A;  1JUS A;  5M5X J;  1JGG A;  3M4O J;  2Y9Z A;  4B4C A;  3DEW A;  2KT0 A;  5IYB J;  1RPW A;  1TWG J;  1ZKG A;  5C4X J;  1WI3 A;  2Y30 A;  3S16 J;  1P7I A;  1Q1V A;  3BG5 A;  5JLW A;  3RZD J;  1LFU P;  3JRA A;  3IV5 A;  1FJL A;  4DW6 A;  2FJ1 A;  4MIM A;  3HM5 A;  2HI3 A;  2I10 A;  1JJ8 C;  3S1N J;  1ETW A;  4XID A;  4AC0 A;  5M3F J;  3ZQC A;  5HOD A;  1GV5 A;  3QQA A;  3BG3 A;  5FKN A;  4BBS J;  3JRF A;  4MO7 A;  5FKO A;  3QPS A;  1MNM C;  1HDD C;  3JR9 A;  2H8R A;  1ZTR A;  2LD5 A;  3H3V K;  4M3B A;  4XIC A;  1B8I B;  1X2N A;  5J1U A;  3HOX J;  3HGY A;  4G12 A;  4JX5 A;  2R5Z A;  4DZJ A;  1AU7 A;  1MSF C;  4Y7N J;  4UUS B;  1ORK A;  1QRY A;  1ETK A;  2OPT A;  1CQT A;  4C2M J;  1POG A;  2WB1 N;  3JRE A;  2LKX A;  4A3F J;  3WHB A;  1ZR2 A;  4JP0 A;  5FKM A;  1JKP C;  3BG9 A;  4FIS A;  1BA5 A;  1RET A;  1ETX A;  1B72 B;  5F27 A;  2JJ7 A;  3WHC A;  2FD5 A;  3PO2 J;  2R5Z B;  1YRN A;  3FK7 A;  4D7N A;  3Q3S A;  1W0T A;  1ETY A;  1LFB A;  2CUF A;  2QCO A;  1RES A;  2X6O A;  3BR2 A;  1I3Q J;  2EBI A;  2N8G A;  3O8H A;  4M3D A;  4V2G A;  3W6V A;  5GPC A;  1H8A C;  2CQX A;  3BQZ A;  4A3C J;  1SFO J;  2MW8 A;  1XS9 A;  3K7A J;  1OCP A;  1UHS A;  5F04 A;  1BW6 A;  4BXX J;  1K83 J;  2MSY A;  1JKQ C;  2FQ4 A;  2YUS A;  3S1M J;  2DMU A;  2R7Z J;  3HOY J;  2HOA A;  1AHD P;  2Y2Z A;  4IHV A;  2XB0 X;  3SDG A;  4X1E A;  5EDN A;  2GBY A;  1D5Y A;  2ECC A;  2L9R A;  1RR7 A;  2E2I J;  2R5Y B;  1MBJ A;  2DA5 A;  2HOS A;  1HDP A;  2YU9 J;  3RKQ A;  2EZH A;  2HYJ A;  3LSP A;  1X2M A;  2VKE A;  1MSE C;  2M8G X;  3GTP J;  2X48 A;  2R0Q C;  2NS8 A;  3O8G A;  1B8I A;  3B6C A;  3MN2 A;  4QIW N;  1BW5 A;  4DZP A;  2K9Q A;  2M9H A;  2X9D A;  1ETQ A;  5IPA A;  4RBO A;  5IYC J;  2AO9 A;  2HDD A;  1QVU A;  3GTQ J;  3FIS A;  3OSF A;  4A3I J;  4MLO A;  3BR3 A;  2CUE A;  5FKL A;  2NS7 A;  3TP3 A;  4QSH A;  5E3L A;  1F43 A;  3HOW J;  1A5J A;  2KDZ A;  4XK4 A;  5DS9 A;  5F0H A;  2D5V A;  2NVQ J;  2HXO A;  1YRN B;  2XGD A;  4IHW A;  1O4X A;  4D5F A;  3D1N I;  1IUF A;  5IOZ A;  1APL C;  2L7F P;  5K7F A;  1GDT A;  3NAU A;  4IEJ A;  3SJM A;  3BQY A;  1H88 C;  4X6A J;  2DN0 A;  5FKK A;  3BTL A;  2P81 A;  1HCR A;  1U8B A;  1RKW A;  4A69 C;  1GV2 A;  1WH5 A;  3GTO J;  1JTX A;  4B1R A;  4A3J J;  2COB A;  5F0F A;  2NVY J;  3CMY A;  1IC8 A;  2FX0 A;  1DU6 A;  2XRL A;  4AUX A;  2EH3 A;  2XPW A;  2IAI A;  1UG2 A;  1ENH A;  3HBL A;  1BL0 A;  3HOV J;  5F0C A;  4MFE A;  2JN6 A;  2TRT A;  3CDL A;  3ZOB A;  1AKH A;  3S17 J;  2QF7 A;  2DJN A;  1JUM A;  2EQR A;  2ID6 A;  2GM4 A;  3K2A A;  2H1K A;  2M2E A;  4CYC A;  4A3B J;  2RAE A;  3BTC A;  2E2H J;  2GLO A;  1GUU A;  2K9S A;  4B3A A;  2VKV A;  2XPU A;  3A02 A;  1T33 A;  2NOG A;  4XRM A;  1IJW C;  2EZK A;  1JUP A;  2Y9Y A;  1PUF A;  1ZQ3 P;  5E3M A;  5EGO B;  2L0K A;  2CRG A;  3SFI A;  3JRI A;  3S14 J;  1W0U A;  3HGG A;  1MBE A;  3G1L A;  4QTR A;  3JRH A;  4FE7 A;  3OSG A;  1OJL A;  2IBD A;  2PMZ N;  4DYQ A;  4JYK A;  5EZH A;  1DU0 A;  1NK3 P;  1TWA J;  1WGX A;  1VND A;  3G1M A;  1JT0 A;  4A3G J;  4C3H J;  3A01 B;  2VUM J;  3S15 J;  2O8K A;  2LTP A;  2E2J J;  2O9L A;  1FTZ A;  2Y0S N;  3L1P A;  2EZI A;  1JJ6 C;  4Y52 J;  4A3K J;  1TWC J;  5EG0 A;  3LOC A;  3A01 A;  1NTC A;  1AKH B;  3ZQI A;  5E3O A;  1BJZ A;  4C3J J;  1A6I A;  4RDU A;  2NVX J;  4I6Z A;  4GFB A;  2JA6 J;  2TCT A;  1VF9 A;  1JKO C;  2LR8 A;  3JRG A;  3S2D J;  3M3Y J;  1OFC X;  2ZB9 A;  4J19 A;  4BY7 J;  2JA7 J;  1Y1V J;  3C2B A;  1MH4 A;  4A93 J;  2LFB A;  2LLK A;  2DTZ A;  3BR0 A;  2JA8 J;  1U78 A;  2R5Y A;  2R92 J;  1HOM A;  5EYR A;  3TW7 A;  3Q0W A;  1K61 A;  3MKL A;  1XG1 A;  4BY1 J;  5FJ8 J;  5IYD J;  1FEX A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...