4A3BJ

Rna polymerase ii initial transcribing complex with a 4nt dna-rna hybrid
Total Genus 16
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
16
sequence length
65
structure length
65
Chain Sequence
b'MIVPVRCFSCGKVVGDKWESYLNLLQEDELDEGTALSRLGLKRYCCRRMILTHVDLIEKFLRYNP'
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-DIRECTED RNA POLYMERASE II SUBUNIT RPB1
publication title Structural basis of initial RNA polymerase II transcription.
pubmed doi rcsb
molecule tags Transcription
total genus 16
structure length 65
sequence length 65
ec nomenclature
pdb deposition date 2011-09-30

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
J PF01194 RNA_pol_N RNA polymerases N / 8 kDa subunit
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.60 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Homeodomain-like 4a3bJ00
1FJLA 3M3YJ 4Y7NJ 2E19A 2DMNA 4A3CJ 1RR7A 1X2MA 1VF9A 3SJMA 1WGXA 2MW8A 5K7ZA 3HGGA 3L1PA 2X6OA 2DJNA 2K40A 2XPVA 3Q0UA 1Z0XA 2E2HJ 1GV2A 1SANA 2CJJA 3C2BA 2H8RA 1IC8A 3JRBA 1D5YA 1YRNA 2ME6A 1R9TJ 3GTPJ 2O7OA 3HEFA 5F0FA 1GUUA 1OJLA 2MG4A 2QF7A 1LFUP 4NDLA 2EH3A 3B6CA 1OCPA 2NOGA 2FJ1A 5J1UA 1AHDP 1TWAJ 2IBDA 1GT0C 1LE8B 1GV5A 1TWFJ 2JA5J 1JUMA 9ANTA 2CRGA 2CUEA 2LD5A 3TW7A 1HOMA 1OFCX 3TP3A 3ZQGA 1JT0A 2KDZA 1Y1VJ 4XK4A 2Y9YA 3HOZJ 3O8HA 1ZQ3P 2LY9A 2Y2ZA 2H1KA 4L5EA 3FK7A 5IOYA 3S14J 1W0TA 1ZK8A 3HOVJ 4D5CA 2YU9J 1BW6A 2EZLA 4AC0A 3IV5A 3S15J 2KT0A 2JWTA 3HOYJ 2CU7A 2JK3A 3K2AA 1G2HA 5GP9A 3VPRA 2FQ4A 1AKHA 3JRAA 5EGOA 4M3BA 4EEFG 1B72B 1WCMJ 2E2IJ 4IHWA 1BA5A 5E3LA 4B3AA 4BBRJ 5F27A 3QPSA 1MBGA 2R5YB 2GLOA 2R5ZA 1MBFA 1CQTA 2X48A 2R92J 4MIMA 3JRGA 3S1NJ 1XG1A 4UUTA 1IG7A 2ID6A 4A3FJ 3RQIA 3OIOA 4BBSJ 4A3LJ 2GM4A 5E3NA 2LVSA 2HDDA 5IYCJ 2AHQA 1H89C 3HOUJ 4UUSA 1FTZA 2M0CA 1TWHJ 3HGYA 5F1JA 4A3IJ 1GDTA 2GBYA 2DA5A 5EG0A 3BTCA 4GFBA 2L0KA 2B63J 1WH7A 1ETVA 2NVTJ 2FX0A 2XB0X 1BW5A 4XRSG 3PM1A 2DTZA 1IUFA 1HLVA 4ABZA 1H88C 2HXOA 1ETOA 4D7NA 2XPUA 1B8IB 1JJ6C 4I76A 3Q0VA 2R93J 1TWGJ 2DN0A 1POGA 3M4OJ 1WPKA 2YS9A 4IHVA 2E2JJ 2VUMJ 3FKIJ 1ETQA 2N8GA 3JRHA 3LSJA 3G1OA 2WAQN 4W1UA 5C3EJ 2CUFA 1U78A 3CQZJ 4BY1J 2DMTA 2EZKA 1RKTA 3B6AA 1JTXA 4V2GA 4DYCA 5M3FJ 3PO3J 3BR2A 2M8GX 1UG2A 3NARA 3RZDJ 2M2EA 3GTLJ 3JRCA 1RPWA 2NS8A 5F0CA 4A3GJ 2ECCA 1K61A 3TW6A 2MSYA 4D5FA 1I50J 2VKEA 2CQQA 1T56A 2NVYJ 2Y30A 2EZHA 5J1RA 1VI0A 3O8GA 1TWCJ 4XICA 4FE7A 2JA7J 4FCYA 2L7FP 5M5YJ 5FJ8J 5JLWA 2CQXA 3ZQFA 3LSPA 1IJWC 4JP0A 3S16J 2DA6A 1U9OA 3GTKJ 1UMQA 1MH4A 5K7FA 5DTDA 2HOSA 4Y52J 1JUSA 1W0UA 4DW6A 1QPIA 3BR5A 1JKOC 1LE8A 2LLKA 1MBEA 3S1QJ 3S2HJ 1ETYA 2IEKA 3SDGA 2ME0A 3ZOBA 1TC3C 3TEDA 1A6IA 1ZR4A 1ZR2A 3BQYA 1X2NA 4B4CA 4BXXJ 4A93J 4M3DA 5EDNA 2VKVA 3BG3A 5FKNA 1XS9A 5J1YA 2XGEA 1ENHA 1MBKA 2Y31A 5IYDJ 2XB5A 1HDDC 3S1RJ 3A03A 3W6VA 3I4MJ 3FK6A 4FTHA 3H0GJ 4IHXA 4X1EA 3WHCA 5IP9J 1MNMC 3GTJJ 1BJZA 3LSGA 1GVDA 3G1LA 1NK3P 4XRSA 1B72A 5FLVA 2P81A 4A3MJ 1QVTA 1IDYA 2O8KA 1K83J 2NVQJ 2DA2A 1RETA 3HBLA 3BTIA 2XSDC 3JRIA 2R5YA 3HM5A 2DMUA 3ZQCA 1NK2P 3DCFA 4C3JJ 3BG9A 1E3OC 1Q1VA 1H8AC 1SFOJ 2XGDA 3QQAA 3HB9A 4C2MJ 4QIWN 2EZIA 3S2DJ 4W97A 4RDUA 4IEJA 3H3VK 2FD5A 2LR8A 2G0EA 4MFEA 3ZQHA 3JR9A 3E7LA 4MLOA 1FEXA 3LNQA 5EEAA 2ZB9A 4D7MA 2K9NA 4A69C 2L9RA 4JYKA 5DS9A 1VFCA 5J3LA 2I10A 2DMQA 2L7MP 4A3JJ 1B8IA 2O9LA 1ZKGA 2JJ7A 3CDLA 1IGNA 2DMPA 5GPAA 2PMZN 4DZJA 3RKQA 4FISA 3F0CA 5K7HA 2ELKA 2WB1N 3GBGA 1S7EA 3S17J 5C44J 2HQ5A 4G12A 4CYCB 3GTGJ 1ZTRA 3S1MJ 2OPTA 3BG5A 1RKWA 4MFDA 1JUPA 3BR3A 3CCYA 3MVPA 4B1RA 4AUXA 3JRDA 5EZGA 1HCRA 1EF4A 1P7JA 2XPWA 1MBJA 3OOUA 5M3MJ 2NS7A 2M34A 4XIDA 2LFBA 5EYRA 4I6ZA 3A01B 3JREA 3DEWA 2DA4A 3G1MA 3NAUA 4A3KJ 3GTQJ 2YUSA 2ECBA 3ZQIA 4IHYA 1FIPA 1U8BA 4DZPA 4DYRA 5IP7J 3BQZA 2ID3A 3BR0A 4A3BJ 4M6VA 1PUFB 2HYJA 3BTLA 3D1NI 3GTMJ 3HOXJ 1I3QJ 1JJ8C 2JA6J 1JKQC 4LOCA 1WH5A 1BL0A 4V2FA 1DU6A 1AU7A 1XC5A 2LP0A 2R0QC 1APLC 3GTOJ 5C4JJ 1FTTA 1U9NA 1DU0A 2XRLA 5M5WJ 1F36A 5E3OA 3IH3A 5IPAA 5C4XJ 4M3GA 3LSRA 3QPLA 3A02A 5F08A 2OF7A 4BY7J 1ETWA 4QSHA 3JRFA 2LKXA 4RBOA 1YRNB 2HOTA 2LK2A 1F43A 3BR6A 1ORKA 2DA3A 3OSGA 4MO7A 2TCTA 2RAEA 1HDPA 3CMYA 1T33A 4JX5A 1JGGA 3I4NJ 1VNDA 2JN6A 5FKLA 1OCTC 3IH2A 4AYBN 4M3EA 2Y0SN 1A5JA 4DYQA 5FKMA 5M5XJ 3RZOJ 5F04A 3MN2A 3HKZN 4QTRA 2VI6A 4A3EJ 4M3FA 2K9SA 5FLMJ 3ZQLA 2NVXJ 3LOCA 1IRZA 1AKHB 1QRYA 2HOAA 5EGOB 1JKPC 2K9QA 4C3HJ 1QVUA 3OSFA 2DA7A 1IV6A 1UHSA 1Y1WJ 3HOWJ 2AO9A 4XRMA 3PO2J 5FKKA 3MKLA 1I6HJ 5EZHA 4S0HB 1ETKA 1NTCA 2QCOA 4C3IJ 3Q3SA 2R5ZB 2LTPA 2HXIA 2MGQA 3FISA 2COBA 4BKXA 1JKRC 2R7ZJ 3UKGA 4HNVA 3BT9A 3TP0A 4A3DJ 5IP6A 2WV1A 1X58A 1Z77A 1ZGWA 2TRTA 5IOZA 1FIAA 1JT6A 2IAIA 2JMWA 3BR1A 2EQRA 3WHBA 4UUSB 4JX4A 2D5VA 5EF6A 1P7IA 1RESA 5HODA 1ETXA 2Y9ZA 1MBHA 4J19A 5EG0B 4CYCA 3SFIA 1ITYA 3FIWA 5FKOA 5F0HA 4JX6A 5IYBJ 2HI3A 5BNGA 2VPRA 3Q0WA 2W48A 2M9HA 1JTYA 1MSFC 1MH3A 1MSEC 1WI3A 3IH4A 1LFBA 3HDDA 2X9DA 3A01A 2EBIA 4FE4A 3BTJA 1HF0A 5GPCA 5JLXA 4X6AJ 5E3MA 2JA8J 1O4XA 3K7AJ 2L7ZA 2XGCA 2E1OA 1PUFA 1IDZA 2DA1A
chains in the Genus database with same CATH superfamily
2EPFA 1K4TA 1HBXG 4M6YA 3HPGA 1Z3XA 1QHGA 5DEQA 3FM3A 4RAFA 4PUSA 3JAMK 2HKXA 3S2WA 5GAGJ 2PLYA 3ZGKA 1Z0XA 2RGVA 2HYFA 3G3ZA 1R49A 2H8RA 1YRNA 3EUHC 2CW0F 2DJIA 2ZXJA 5CKTA 4S04A 3H5NA 4XNFA 4L0YB 3WTSC 3HEFA 1OCOH 2W4SA 2VBXA 2FJ1A 4N4NB 2X6YA 3CC4I 1AHDP 3ASNH 2FBKA 2P4WA 3DU5A 4G7ZF 5LLQA 4L0ZB 3GF2A 1P4WA 4AVZA 1GT0C 2WAQA 1TWFJ 2G7HA 3K4NA 2JA5J 1JUMA 2E34A 2CRGA 1WZ2A 3ABLH 1TQPA 2F5VA 4D0PA 3TP3A 2COMA 3DBLB 3S93A 3I4PA 2VASA 2Y9YA 2P5VA 2K5CA 1G3SA 2LY9A 2Y2ZA 4G8XA 4B09A 2A6EF 3FK7A 3S14J 1ZK8A 2DCEA 3QYBA 4PFOA 1BW6A 2EZLA 1H9GA 4AC0A 3I55I 1R1TA 2KT0A 3BJOA 3M8FA 4HDVA 3HOYJ 2UXXA 2CU7A 2GZWA 4A6DA 2JPCA 5GP9A 2GAUA 1IN6A 1VQ9I 3I54A 1QGPA 3JRAA 5EGOA 2W85A 3VWBA 5FRNA 1R36A 4PJ0C 3KP2A 1ULYA 4F3QA 3COAC 4IHWA 1U3EM 1S5LC 3L9FA 4PDKA 1VZ0A 2V9KA 4UVAA 1VQOI 1R22A 4KT6A 4A5MA 2R5ZA 4RS8A 1BR4A 4MIMA 3S1NJ 3DPLC 2V6EA 2P0WA 3F22A 1ZYRF 3OIOA 1YJNI 2HEOA 5E3NA 2LVSA 2LBFA 5CJ9A 3S32A 2HVSA 5IYCJ 2FQ3A 2QUFA 2AXLA 2LMDA 1XMKA 3X2QH 3LAPA 2KQRA 1TWHJ 4KN7X 3DP7A 2OU2A 2WAFA 2GBYA 3EUHA 2MYSA 1WRJA 3BP8A 1BR2A 1XB4A 2EB7A 2L0KA 2XKOA 3C3WA 4EM1A 3ZP5A 1L3LA 1WH7A 1ETVA 3N05A 3ZMZA 2R7WA 2KISA 3IWZA 4ABZA 4ESBA 2HXOA 1H88C 4D7NA 4YFNF 4LFUA 4ITVA 3CUQB 5DUKA 3Q0VA 1Z67A 2X4HA 1S29A 2DN0A 4LITA 1ZH5A 4B3XA 4QPOA 1MGTA 4HEA2 1OYWA 4XMYA 4IHVA 3Q9SA 2DFFA 1UHMA 3OYKA 2VUMJ 1N25A 2N8GA 3WTUC 2AQEA 2CQNA 3G1OA 3ISPA 4KIBA 2WAQN 4NNJA 2O6GE 5C3EJ 2DOFA 2K7LA 2EFOA 2HWVA 1J9IA 4BY1J 4OIQF 3G71I 3B6AA 4V2GA 2P6SA 3PO3J 3NARA 4AIJA 4IKFA 3DWLE 1CGPA 2M2EA 1KU9A 3H3UA 2KLOA 2DBBA 5GTIC 2KDOA 3QYEA 2LF8A 5F0CA 3OL4A 4HQMA 1K61A 3LFKA 1G3YA 1G6NA 2VKEA 4C30A 4Y15A 3OYGA 3LMMA 1XGMA 1T56A 2Y30A 2HYGD 4M6XA 3H35A 1ZRCA 4ZYHA 2IVMA 4XICA 4E7HA 4FE7A 2H6CA 1IN7A 3RI4A 1LQ1A 5E17F 1REPC 3DTKA 3LSHA 4V19K 2L7FP 3LSPA 5JLWA 1IJWC 4JP0A 2LY1A 2DA6A 2DYRH 4CCOA 5K7FA 5TJJA 3CUQC 4J00A 1S6LA 2VN2A 2VOOA 1P9QC 3CCVI 3FWEA 3ZN1A 2QBYA 3BR5A 1JKOC 3J80K 2GIVA 2BXYA 2BV6A 1O7LA 1Y56A 4Z2YA 1FP2A 3I53A 4CCJA 4HV6A 3S2HJ 1W7PB 3QPHA 3PUBA 4A0ZA 2CGPA 1YJ9I 3BQYA 4XRFA 4C2UA 2M8EA 3R60A 5EDNA 2V79A 3EETA 1TP4A 1WFXA 4U87A 3OYCA 5J4VA 1MBKA 1Q1HA 4J01A 1UAAA 3WE2A 3FK6A 3H0GJ 1EKEA 4UB8C 1X1PA 3L2RA 1TT0A 3FXQA 1E17A 2JSPA 3OMYA 5DCFA 2L3DA 1P2FA 3G1LA 3P9IA 5HS8A 1NK3P 2HFHA 4OIRF 5J47A 4A3MJ 5HDKA 4B43A 2QWWA 2O8KA 4L9NA 2VE8A 1H9TA 3H36A 3JRIA 2BHZA 4NHJA 2DMUA 2EIKH 4LIVA 1NK2P 1YIJI 3F23A 5HLGA 3KP5A 1J7KA 5ILSA 1H8AC 1BI3A 5CQEA 4C2MJ 1T98A 3H1CA 3S2DJ 3H3ZA 2GXBA 4K2EA 3GFMA 2LR8A 5ICGA 1XD7A 4MTEA 3CJRB 3TL4X 3LL7A 4E7LA 3E7LA 4BL0B 3LNQA 1FZPB 2FE3A 2XAGA 3MAJA 4D7MA 2F2EA 2K9NA 1QZYA 4A69C 3W2VA 4KISA 2VL8A 3KZYA 2NRAC 4JYKA 1O3QA 3J81Z 2YU3A 1VFCA 3H92A 5J3LA 3T8RA 3CUQA 2O9LA 1LUJB 2Q1ZB 3PSFA 3CDHA 2HOEA 5TGTA 4F52A 4B47A 3M9AA 4JOMA 4XLCA 3K4MA 4DZJA 1MMSA 2Y69H 3E6MA 4KJZA 3CF5F 3LA7A 2STWA 1SVOA 2VT3A 4ZDPA 5C44J 1TQIA 1BI1A 1KYWA 1VQNI 4CYCB 2CUJA 4BE2A 3GTGJ 2CW7A 4WF2A 5BQTA 2E5ZA 3GZNB 1B6AA 4MFDA 5CVJA 1XX5A 3MVPA 2M3AA 4DQ2A 4B1RA 3E5UA 1HCRA 3M8JA 3DBRB 1P7JA 3CCUI 2W82A 1HW1A 4UVCA 4FETA 4ETSA 1ZARA 5CVUA 2V9VA 3D5SC 3L2VA 3WU2C 3DEWA 3F3XA 3NAUA 2X85A 1VQMI 4HNUA 2ECBA 3F8FA 3PJRA 2XV4S 5IP7J 2R7OA 3U9GA 2M30A 4M6VA 2JRTA 3I9V2 4R79A 3D1NI 3N4MA 2CSOA 2DXIA 1N75A 2EA2A 4XLPF 2F6CA 1VQPI 4CDGA 1DU6A 5HNFA 1XC5A 2VQLA 1W7PA 2XRLA 2OA4A 3IH3A 3K9TA 2D2WA 3MKYB 4M3GA 4IJAA 4ESFA 4ZH4F 3CO6C 1JE8A 4EJTA 1YG2A 4PJLA 4XKBA 2ISZA 1F43A 2I5UA 1E3HA 1ORKA 4RMNA 1IRFA 4MO7A 2TCTA 5H2FC 2B0LA 1J5YA 1HSJA 4KMFA 2DOAA 1GVJA 1LVKA 3OV8A 3DLLF 1JGGA 1FOKA 1FOYA 1VNDA 5FKLA 1X1BA 3EUKL 3DTEA 3DKWA 1OCTC 3IH2A 4CYDA 2EFWA 3GX4X 4M3EA 2NNYA 3V4GA 1R1VA 5FKMA 5DD4A 4XOTA 2VIXA 2JT1A 3AAFA 3FHZA 2XDVA 5CVRA 3MZHA 1ZG3A 1DDNA 4IRIA 3BG7A 2OQRA 4CSWA 1J0RA 2MH2A 3MN2A 4PJMA 2K3PA 1P4AA 2A3SA 4PSWA 1B9NA 3ZQLA 3VFZA 2R7RA 4Q4ZF 2IPQX 5IT9Z 2IS4A 2ZC2A 2BXZA 2Z33A 2E7WA 1QNTA 2IW5A 2UXNA 1F4KA 1IRZA 1QPMA 1Z7LA 4NC7A 4LG3A 1LNWA 2AXTC 2XROA 5D4SA 4P55A 5L3GA 2DA7A 3KFWX 1ZELA 2AO9A 2RC4A 3CCQI 5FKKA 1I6HJ 4OINF 3E6DA 1QU3A 3LA2A 4C3IJ 5D5UB 3I59B 4FASD 3AKZA 1CF7B 3RKYA 2GXGA 1LEAA 4E7ZA 4LGWA 2XUBA 3TGNA 1EJ9A 1WSUA 1D0YA 1SEUA 2JQ7A 1Z77A 2NS0A 2OZ6A 3GUDA 1ZGWA 4U7DA 5E79C 1GLNA 1D1CA 1FIAA 1F9NA 2KJCA 2JA2A 2E60A 2EQRA 4CZZA 3WHBA 2MFZA 5CYVA 2M45A 1SAXA 4JX4A 2D5VA 5K1YA 4BAYA 3BPVA 4LD5A 2LREA 1ETXA 4YRVA 5GAEJ 4CYCA 3CMMA 3SFIA 1PJRA 2XSJC 2Q0OA 4MEXF 2VJ5A 1TNTA 1QA6A 3Q0WA 2M9HA 1LVAA 3E0JB 4AIDA 2ESHA 3IH4A 4EGYA 1T08B 2KRCA 1YW8A 1FP1D 1W36D 1FPQA 5J8FA 2L7KA 4BS9A 2JA8J 1LFPA 4OMZA 2XGCA 3LFUA 4YIFA 1HC8A 3QP6A 2HQNA 3RQ4A 1FSHA 4ENKA 1P4XA 4ZC3A 1SFUA 2FSWA 4RM2A 1YS7A 4Y7NJ 2E19A 5FGMA 4E7KA 2DMNA 3LAJA 4A3CJ 2PBIA 5ICCA 2MW8A 2DFEA 3HGGA 3L1PA 2DFHA 2K40A 2XPVA 2LKSA 3HXLA 1SANA 2CJJA 1XSVA 2DPDA 3DXJF 3JRBA 1D5YA 1P92A 3ML6A 2R7FA 1K6OA 1WKMA 3IL2A 5LEJA 2O7OA 5F0FA 3PFYA 4XORA 1MW7A 2MG4A 2QF7A 3FXUA 4EGZA 4ZDOA 2A6HF 3B6CA 5J40A 5A2QZ 3WTXC 2XIGA 3P9KA 4WWCA 1RR8C 3IC7A 4C2TA 4OIOF 4H0EA 2Z9OA 4RA2A 3E1SA 3TW7A 1OFCX 4XSZF 1XGNA 2VQGA 3ZQGA 1FMWA 4IL6C 5K5OA 3HOZJ 2IA0A 1MZBA 4HZFA 3O8HA 3KYLA 1VTNC 1R1UA 5IOYA 2W00A 4Q48A 2IS1A 2BY3A 3H9QA 1VQLI 3S15J 4M71A 4F92B 4BGDA 2JK3A 4BJ5C 1G2HA 3DV8A 5EEGA 2MLKA 2V1UA 3VOEA 2FQ4A 3IKTA 3L00A 3NQOA 1WWXA 3H5AA 1FYKA 1B72B 4JQFA 2E2IJ 3CD6I 5L3DA 2H09A 3HOTA 1BA5A 3FM5A 4TV7A 1W5CC 2ZNZA 2LOOA 3JW4A 2R5YB 3I59A 3WGHA 2ISYA 3K1MA 3EDPA 1CQTA 2R92J 4IZZA 1CF7A 1S7AA 3KLNA 1XG1A 1SMTA 2K86A 4GYIA 1MJ9A 1IRXA 1MNDA 1DGWY 1B59A 3SEQA 3RQIA 4BBSJ 1T38A 1OCRH 2DK5A 5DM7F 3KE2A 1XDSA 4A3LJ 1BBYA 2HDDA 1W1WE 2AHQA 1EH8A 1O3TA 5F1JA 4CH7A 1MDMB 1LJ9A 1GDTA 3MQ0A 3FMRA 1HW2A 2DA5A 1D8JA 3BTCA 3F72A 2B63J 2XB0X 1BW5A 1QO0D 1IUFA 2L02A 2EFQA 2XPUA 4L5JA 1AA7A 5DYMA 5KCMA 1JJ6C 2KRFA 2WY8Q 4CCNA 1XPXA 3LQQA 1POGA 3GEZA 2QKLB 3FF5A 2YS9A 1I39A 3MZ8A 3E6CC 5HDGA 2DQLA 3OYMA 3K1NA 3A0BC 3FKIJ 3MKZA 1ZREA 3IRQA 4MTDA 2EWNA 2Z5UA 5FRMA 1LEBA 2PQ8A 2OBPA 2KP6A 1XCBA 4P9FA 2E1CA 1JTXA 3D5RC 1YLFA 3BR2A 2M8GX 2IA1A 1V3FA 2W84A 2IXSA 4P96A 3GTLJ 2HZTA 1K7AA 4ASNA 1R23A 3TW6A 3BROA 2MSYA 4D5FA 2CQQA 5LGNA 3U1KA 2EZHA 3K4CA 3U21A 1EA3A 4WXCA 1VI0A 5J1RA 1WJCA 2EV5A 3RKXA 2EFNA 4HV5A 4H4KC 1R00A 2JA7J 2K9MA 5FJ8J 2CQXA 3ZQFA 3CO7C 1AWCA 1HXDA 2K4JA 2X1EA 2VLAA 5D5XB 1U9OA 1UMQA 2K02A 2A6TA 1J75A 3MCZA 2WB1A 4RGRA 3L2CA 1I3AA 2KKOA 5L3CA 2QBYB 3RSNA 2FMLA 1AOYA 5D8KB 1ETYA 3SDGA 2ZJRF 5JFRA 4BDYA 2DQRA 1A6IA 1ZR4A 1ZR2A 1X2NA 2Y75A 2VKVA 3GFJA 3GFLA 1WJAA 2HVQA 2OAZA 3OYFA 1R5ID 3LSTA 1XS9A 4OMYA 1RNLA 3TQNA 5J1YA 1F1ZA 3OYBA 5BPIA 4CICA 1HA8A 1MMDA 2FBHA 2D1HA 3S3NA 5IYDJ 2XB5A 1HDDC 3A03A 3TDZC 2F4OB 1GXPA 1Z91A 4IHXA 5IP9J 1LB2A 1OYYA 4M9ZA 1BC7C 3LSGA 4MHGA 5A2QK 2O8XA 4XRSA 4ZTFA 1B72A 2E1MB 2L9NA 3C1DA 5LHGA 1QVTA 3ZMDA 1IDYA 2QEXI 2M7BA 3F8BA 4ENMA 1RETA 1YTYA 2VC0A 2R5YA 3W3CA 2V1NA 1BI0A 2ZMEB 3FXJA 3ZQCA 4C3JJ 3K69A 4A5NA 2QSFX 1BI2A 4GDFA 1SFOJ 3CCEI 2OD5A 3CESA 1ZHFA 3BCBA 1TW3A 4RAZA 2EZIA 2ZJQF 1USTA 4GCVA 4NC6A 1YW7A 1XTAA 4RDUA 2JPBA 1U0JA 5D5WB 2XAFA 4YIIA 4ZYGA 3DEEA 5DUIA 4MFEA 3ZQHA 3JR9A 3FKJA 4EQQA 1MDMA 1LDDA 2ZKZA 3ZR8X 1KQ8A 1FEXA 5EEAA 3T8TA 1PUEE 4U0YA 3BZKA 5HDNA 2L9RA 3ASOH 3SYTA 1EH7A 2I10A 4A3JJ 5F1RA 3L09A 5BPDA 1ZKGA 3FX3A 3SFZA 2JJ7A 2Z2SB 1IGNA 2E1MC 2DMPA 4L9VA 5FROA 1T0FC 2PEXA 5GPAA 4RB3C 2B9SA 3I58A 1KA8A 3F0CA 5K7HA 2ELKA 2ACJA 2MA3A 2VBZA 3A1YA 2WB1N 2IJLA 4BE0A 4Y4RA 1HQCA 2ZMEC 4E4HA 1FOXA 2G7UA 2Q2EB 2VBYA 4G12A 1YJWI 3TKYA 1C0WA 2FA5A 4AVPA 5B3SH 3QRFF 3A4CA 3BCAA 2X51A 3FMSA 2JVHA 4MEYF 4C9YA 1IN4A 2XRNA 4AUXA 3JRDA 4EJUA 4FX0A 1MBJA 6PAXA 2R7VA 2IGOA 2NS7A 2M34A 2LFBA 4RGSA 2EILH 4O5VA 4I6ZA 2O61A 3A01B 4XONA 3JREA 1FBUA 3HSEA 3K4KA 4A3KJ 4Q47A 1ZN2A 2H8WA 2YUSA 4BHPA 1UFMA 1FIPA 1U8BA 4DZPA 3S3MA 1FY7A 2ID3A 3BR0A 3VDXA 1K4SA 3R61A 3HOXJ 2DODA 1KGSA 4EMSA 1JJ8C 2JA6J 3KLOA 4V2FA 4BQNA 3EUAA 2CUZA 1AU7A 2R0QC 3OY9A 2M4KA 2BE5F 4BU2A 3GTOJ 3I71A 3K2ZA 4GXOA 2DO7A 1Z6RA 2KRHA 4BDZA 2IGNA 5M5WJ 1F36A 1YIOA 5E3OA 2CO5A 3QPLA 3KX2A 4E6KG 4O3MA 1KYZA 3GCMA 4QSHA 3JRFA 3PNYA 4RBOA 2EA4A 2LK2A 1R4NB 1QZEA 2GWRA 5AIQA 5FLXZ 2KZVA 1KU2A 3CMAI 4XLFA 4IQ4A 3EQLF 2OV7A 2QVOA 2RAEA 2WA0A 3OOPA 4F7ZA 3JSOA 2JN6A 1Y8RB 1UELB 2KPMA 5B1BH 5D6FA 3CCRI 1T0FA 3F9KA 4HLXA 1FYLA 4HSTA 4DYQA 1DP3A 2L9VA 3R0AA 1Y0UA 1R5HA 2ZFUA 3VB2A 3PQKA 4IHTA 5M5XJ 4IF4A 4EVIA 3K4BA 2W57A 2ZMEA 4QTRA 2VI6A 3RDIA 3IHUA 5KAFC 2LYCA 1FOWA 3HRMA 4M3FA 5F6FA 2NVXJ 3CDIA 1HKTA 4A6EA 3HOSA 3H9GA 1J09A 3W2AA 4MQVA 2NNNA 1I5ZA 5KK1A 4EJVA 1JKPC 2G9WA 2P8TA 4BJTA 2FXAA 1IV6A 3OWTA 1Y0NA 5IY5H 1OYIA 4XRMA 1QHHD 3MKLA 3PL8A 1MKMA 5EZHA 1W5TA 1NTCA 1XGSA 2QCOA 3Q3SA 2DT5A 4I0BA 3TDUC 2BHYA 3V7SA 2HXIA 3GFIA 3TMOA 1JKRC 2CWEA 2WV0A 3BT9A 3H9JA 1OCCH 3P7NA 5JHUA 2TRTA 2HPMA 4R8HA 4RLQA 1R6RA 1YYVA 3TOAA 4DJAA 1XDUA 4EATA 2JMWA 3V8KA 5ILVA 2OZUA 1MJBA 3BOQA 1FYMA 1YITI 3GVAA 5EF6A 4OOIA 4QLCU 1BIAA 3LSKA 2LC2A 1RESA 2RQPA 2YPRA 3NEUA 5HODA 2Y9ZA 3K1PA 2Q2EA 5EG0B 1OCZH 4RLFA 1U6GA 1LKXA 1K79A 1SVLA 5CVVA 3CCMI 5BNGA 4ZZLA 2LNBA 2VPRA 3KEQA 4ZYDA 4XN3A 1S3JA 1MH3A 4NQWB 2RVCA 1FC3A 4U88A 4D1QA 3HG9A 1UB9A 2X9DA 4LLLA 3QU3A 2VBWA 3A01A 3K70C 5GPCA 2R7SA 1G3WA 4X6AJ 4YIRX 4I09A 1GXQA 5D6EA 3SZGA 2NAZA 4BJ6C 2DI3A 2GOMA 2OTJI 3A0HC 2CMPA 1XSDA 1USSA 3KYCB 1JHFA 4A0XA 3SEZA 1FJLA 4ZJZA 3L2UA 4I98B 1ZRFA 1MJAA 1X2MA 2WBMA 1VF9A 5K7ZA 4XN0A 2A68F 2LY2A 3DPUA 5CPRB 1PDNC 3Q0UA 3VSLA 4RGUA 2RDPA 3C2BA 3CJTB 4UB6C 1IC8A 2UWMA 2CFOA 3WG7H 1R9TJ 1VQ4I 5L3BA 3V7RA 3OYEA 4IRGA 3GTPJ 5CLSA 4L5IA 1GUUA 1LFUP 2VQCA 1WJEA 2EH3A 2PMZA 3D5LA 2NOGA 3DTIA 5J1UA 5GAHJ 2PJRB 3CLQA 1VQ7I 4KDPA 2AS5F 1W5SA 3C2GA 2IBDA 3OYAA 3JTGA 2ESNA 3OYNA 3RKWA 4Y17A 4G7HF 4XM3A 4YELA 4R1HA 2LD5A 4JBAA 1HOMA 4LG0B 2QA4I 3MEXA 3K4LA 1JT0A 3OYHA 4O6JA 3T5XA 1Y1VJ 4XK4A 3BDDA 4FX4A 2OCCH 3RJPA 3GMEA 3GO5A 4M72A 4DIQA 2H1KA 1Y6IA 4ZDLA 2Z99A 1W0TA 1XSXA 1X3WB 3HOVJ 1B1BA 2V6CA 1YHQI 2QZ8A 1G3TA 2YU9J 1WJ5A 4ANJA 3IV5A 1HKQA 3CCLI 3RTRA 2XF7A 2KL4A 3CP2A 5L3EA 4CO8A 4F93B 3SHFA 3VPRA 1X1DA 1Z3YA 3BC8A 1V5EA 3PFIA 5JR3A 2CFXA 4PJJA 2HDCA 3VYRB 2O5RA 3P9CA 2XAJA 1WCMJ 4PGHA 2F48A 2QQ9A 4KN4X 3SZPA 3ZN0A 1W7PD 1I6XA 1L0OC 5E3LA 1JXSA 2VJIA 5F27A 2FU4A 3QPSA 4UHTA 5JVGF 1MBGA 2GLOA 3ZCOA 3F6VA 1MBFA 3HYIA 2XAUA 4NUBA 2A69F 4OAZA 1JI8A 4B44A 4HRIA 2JTVA 3UNGC 3JRGA 4IPAA 4KMUX 3REOA 5LD2C 1DQUA 4BE1A 1XCVA 4CGZA 4UUTA 1IG7A 1ODDA 2ID6A 3F8CA 3F8MA 4A3FJ 4XL9A 2OQGA 4HF1A 4HX8A 3PQJA 4KICA 4M74A 3RPQA 2BY2A 2KFDA 2CV2A 4LK1F 2FOKA 1RUNA 4HF2A 3F8NA 1IN8A 1H89C 3HOUJ 3ELKA 1FTZA 2M0CA 3WU0A 5LGTA 2L5QA 4A3IJ 2FNPA 2KIFA 2Y0MA 3WGIA 1MMAA 3MWMA 2BVLA 4AIKA 5EG0A 5LHHA 4EV0A 3CC7I 2QM3A 3O3KA 2E71A 2NVTJ 1HLVA 2DTZA 1YX3A 1V5FA 1ETOA 3GZ5A 1Z21A 4XQFA 5BOXA 1B8IB 2FNAA 1N78A 4I99C 4WX9A 2JUCA 2R93J 2L4MA 1J2XA 4NQWA 3L7WA 5EEHA 4XLHA 2CG4A 1ZG5A 4PZJA 4LJZF 1WPKA 2VOPA 3J81K 2WADA 1WJFA 2FMYA 4LB6B 2MD0A 2E2JJ 1ETQA 5J4YA 3JRHA 4E7JA 1P6RA 1YS6A 3LA3A 3HTUA 4KT5C 4W1UA 2CUFA 3PNVA 1U78A 2K4BA 5DM6F 3CQZJ 1VQKI 1RKTA 1B9MA 5M3FJ 3CTAA 1RPWA 1KU7A 5B66C 3JSPA 4A3GJ 1X3ZB 2ECCA 4II2A 3KZIC 1K78B 1I50J 2ZXWH 5HS9A 4BHCA 3O8GA 3OYIA 2C6YA 1SD5A 3B73A 1TWCJ 2V4JC 3ZMVA 2B7EA 3WTTC 3TO7A 2V26A 2PI0A 2DAOA 4FCYA 5M5YJ 1UCRA 3RPUA 3S16J 1YFHA 3GTKJ 5H20A 4FHTA 5ICEA 2PJRA 1ZGAA 2HOSA 3QWLA 1ACIA 3R4KA 1TQMA 1W0UA 1QPIA 2ELHA 2PG4A 2MC4A 4F55A 4ZYEA 2LLKA 3QP5A 2E1NA 4EM0B 1B4AA 1WJDA 2BVMA 1TBXA 2IEKA 4LG0A 1MMGA 5L3FA 4LMYA 4CXFA 3CP8A 4BXXJ 3P5JA 4IOCF 1F5TA 4A93J 1T39A 5J8CA 1G4DA 3K10A 2DLLA 3MMYB 2KZGA 3AG3H 5JHFA 1XN7A 5FKNA 2VC1A 3HSFA 3FXOA 4KYWA 1ENHA 2ZXHA 2Y31A 1X1CA 1SFEA 4HOBA 2HU9A 4M73A 2VXDA 5ED4A 3WHCA 1MNMC 2O3FA 3GTJJ 3AG2H 3IWFA 3SQNA 5JVTA 3VODA 2X1CA 3FXRA 3H5RA 3M7GA 5HVQC 5FLVA 2P81A 2PN6A 2W1OA 3ECOA 2STTA 4AU7A 3O6BB 3SXYA 5IT3A 2FEZA 2DA2A 3HBLA 3K0LA 1A04A 2JRMA 3ZRGA 2BBYA 3BTIA 2VE9A 2XSDC 3HPHA 3HM5A 1YE9A 2KHMA 1KU3A 1SVMA 5DV5A 3WU1B 1V54H 2F5FA 2TDXA 3BZCA 3DCFA 3DEUA 3NWTA 3ZMSA 1ZG1A 1E3OC 1Q1VA 2XGDA 2H1LA 4ENNA 3PIOF 4A2UA 3HB9A 1FSEA 1TW2A 5ICFA 1D3YA 1D0ZA 4HNTA 3V7CA 4IEJA 2FD5A 3PNTA 2VONA 2HTJA 4XBFA 1A6QA 1Z7UA 5KNLA 1NH3A 5E1XA 2D45A 3E5QA 1SD7A 3W2WA 3S3OA 2BGCA 2MABA 5IT9K 5E18F 2ZB9A 3HHHA 2XASA 1TT5B 2ETHA 1U5TB 2ZCWA 1TLHB 4XKVA 1NHAA 2BYVE 3ZMTA 2XF6A 4G94A 1B8IA 2L7MP 5BMZA 1BR1A 2RN7A 2ZBKA 4GGGA 1FMVA 3CDLA 5GADJ 2ADUA 2L4AA 3ECHA 4G9YA 2WC2A 2ZSIB 1R71A 3RKQA 4FISA 3ESWB 4DOZA 1PYVA 5J6XA 5K5QA 3V8JA 5HS7A 3S17J 1IZ1A 1ZGJA 3VEPA 4NC8A 4DBQA 5FB2A 1ZTRA 1T2KA 2OPTA 1R5GA 3BG5A 4P1WA 2BY1A 1ON2A 1RKWA 3ABKH 1J59A 3ABTA 4OU0A 2BW3B 1ONVA 5EZGA 2R7TA 2J5PA 1K78A 1ERDA 4XIDA 2EK5A 2X6XA 3J7YJ 2AQFA 2DA4A 2GA2A 2A5YB 4B8XA 3T0YA 1RI7A 3I0TA 1OLTA 3KEYA 4I0AA 3ZQIA 4IHYA 1OMIA 1U5TC 2H6BA 4DYRA 5DCMB 4U0WA 4E7IA 1W4MA 1PUFB 2PMUA 1TZLA 5LGUA 1VQ6I 2XC7A 2DT7B 3OL3A 4F91B 1I3QJ 1JKQC 2NVUB 4LOCA 1BL0A 3ERMA 3OIQA 3CJNA 1UG0A 2XKPA 1FTTA 4UXNA 1DU0A 1ON1A 2MH9A 5C4XJ 2R7UA 3LSRA 4RB0A 1DPUA 3A02A 2GQQA 2OF7A 1ETWA 2HPIA 4BY7J 4I01A 2LKXA 1FLIA 2VJJA 2Z3YA 2HOTA 4XSXF 3BR6A 1WVRA 2DA3A 2F4MB 2VJ4A 2XAQA 3JTHA 5AIPA 1RUOA 2KIMA 4LB5A 3VYUB 1X4OA 4JX5A 3LQRA 3FDYA 1LDKB 4Z6YA 4KITB 4I02A 5HOOA 4N9IA 3OS0A 4XLNF 4N0BA 1U2WA 2M87A 1O3SA 4UV8A 1FBQA 1WQ2A 2OUMA 3FHNA 2P5LC 1A5JA 1I1GA 2WTEA 1SFXA 3LSIA 1BOBA 3HC7A 2E7XA 4DGWB 5HLHA 2QQBA 4A12A 4DBRA 3RZOJ 5F04A 3TBIA 4A3EJ 1IO2A 5KHDA 1E0EA 4E70A 2VQHA 2YR2A 3KPHA 2K9SA 2LSOA 1IRGA 2L01A 1O3RA 3OYJA 3LOCA 4KUMA 1E2XA 4CCLA 5JI6A 3OYDA 1AKHB 1QRYA 4RM3A 3FBIB 1MD0A 2FRHA 2H94A 2K9QA 4HW0A 3OS1A 2JZYA 5AONA 2EV0A 3L2QA 2ZJPF 1UHSA 3G6EI 1Y1WJ 3HOWJ 2Y48A 3QU6A 1FNNA 3PO2J 3ULQB 3SDBA 4HQEA 3I64A 1ETKA 2LF7A 5D5VB 2QQ8A 1U5TA 2EV6A 1D8KA 1S7OA 4G6QA 4WCGA 3BZ6A 2MGQA 3U2RA 3AFHA 2R7ZJ 1BIBA 2D1VA 3DPTA 5IP6A 3BJAA 1MMNA 1X58A 3KP7A 2JUGA 4CZCA 2HDWA 2CQ7A 2IAIA 3NWSA 3NRVA 3DF8A 1G8XA 3PSIA 3BR1A 4GYGA 2VODA 3DBHB 4BUPA 4UUSB 3J7AO 2KJBA 1UZCA 2DW4A 4QWQA 4RGXA 1MBHA 4J19A 1T8IA 3FBNB 1ITYA 3FIWA 3HIFA 5F0HA 3ROUA 4JX6A 2V7FA 5IYBJ 2KMUA 2QGUA 4CCMA 1IW7F 2BW3A 2W48A 2A05A 2R7DA 1MSFC 2DYSH 5KAIC 1K6YA 1WI3A 4YEJA 3ERED 4HG2A 1MNEA 2EBIA 3WGGA 4FE4A 3BTJA 4Y13A 2OCEA 2WY7Q 1HF0A 4PCQA 5JLXA 1I1SA 2W7NA 4N9HA 4PSXA 3E6BA 2DTRA 5DCMA 5E20A 1O4XA 3K7AJ 2DT6A 3UR3C 2E1OA 1PUFA 5LRRA 4KIFA 2DA1A 1IDZA 2ZFWA 5E8GA 1V5GA 1A35A 3FXLA 4OIPF 2PX9A 1T6SA 4HDUA 1S9HA 2F4IA 3Q9VA 4HPQA 2A07F 3M3YJ 1RR7A 4E7SA 1JHHA 3SJMA 1WGXA 3IAS2 1YI2I 2GA1A 3HHGA 5B1AH 1D5VA 2X6OA 2DJNA 1RRJA 2E2HJ 4U7BA 1GV2A 3ABUA 5CVIA 1DUXC 1Z6TA 2CW8A 2ME6A 4AD9A 1N77A 5HLIA 4Y3OA 3CF2A 3KEOA 1OJLA 3DU6A 4HA8A 4NDLA 1OCPA 3J7ZI 1SAUA 3DKYA 3M07A 1YOVB 5CQGA 1I27A 1TWAJ 4CHUA 1QZZA 3WODF 4YFXF 1LE8B 1GV5A 1PP8F 9ANTA 3RCOA 5K5RA 2CUEA 1O57A 3QYFA 4IHSA 1PP7U 2J5OA 2HNHA 2KDZA 4UY8I 3GXOA 3RYPA 1ZQ3P 4KIGA 4L5EA 5B5EC 3BG6A 3QODA 4D5CA 1JGSA 2FOWA 2RREA 5BS6A 1X19A 2JWTA 2FF4A 2UV1A 3C7JA 3TO6A 3HJEA 2ZSHB 3K2AA 5FFZA 4WXHA 3HUGB 4ENJA 1SD6A 1AKHA 4XLAA 5F64A 1U8RA 4HAMA 3MFKA 2M0MA 4M3BA 2MBFA 4EEFG 1WHUA 2VXZA 3A2KA 4LLGF 2XAHA 1V4RA 3OR1C 4B3AA 2VB6A 4BBRJ 3BJ6A 2HVRA 4LK0F 5HNHA 3WTWC 3AG1H 4ZYAA 4X0GA 3MD2A 3QOPA 2A61A 2X48A 4I2OA 4L9JA 4XKCA 4UV9A 3D0SA 3QAHA 1FWZA 2LRDA 1NG6A 2P5KA 1Z9CA 4BEHB 5KVRA 3S8PA 3KP4A 2GM4A 1R58A 3KZZA 4ESJA 1S8NA 2MD5A 5E8IA 4UUSA 4GRIA 4EM2A 1OQYA 3HGYA 2V1DA 5LHIA 2Q8KA 5DDGA 3AL0B 3OS2A 1A31A 3CUOA 4RB1A 4MNUA 4GFBA 3VSKA 4CA0A 3FXKA 5HLTA 4AM3A 3WTZA 2FX0A 2OC6A 2LH9A 4XRSG 2R3SA 3PM1A 4A0YA 2JSCA 1YX5A 1EH6A 2CS3A 1SFKA 1S72I 4I76A 3Q5FA 1TWGJ 1NG7A 3KCCA 4PK4A 3ZXSA 4EJOA 2L2OA 3M4OJ 3OR2C 3DKXA 2LG4A 4CUGA 3ZQQA 2ZO4A 1YO5C 4YG2F 3CCSI 3C2HA 2DFIA 3LSJA 5ERIA 1SC7A 4BH9A 3BPXA 4BXUA 3C18A 3GLLA 1VQ5I 2OTLI 1DPRA 2DMTA 2EZKA 3QPTA 4DYCA 2EJRA 3V42A 4WK8F 2DDAA 2WWYA 3RZDJ 1UG2A 2QSGX 3JRCA 2NS8A 3GZ6A 4PGGA 1IXSB 4G7OF 1Z1DA 4PJNA 1XMAA 2YSRA 3PUFA 3IRRA 1W36C 2NVYJ 1O7FA 2PMHA 3U1DA 3GW2A 3IP4B 3AL0C 2RV8A 1EV7A 2R7XA 5FFXA 1R7JA 2PJPA 2IRFG 4B48A 1RC9A 3N97A 2HS5A 2Z1DA 4HYEA 1R4MB 1SMYF 2V1XA 1T95A 2ZXIA 1MH4A 2W24A 4LLNA 5GTHC 1BC8C 3ZQ7A 2A5WA 2LKPA 4IQJA 5DTDA 1Y39A 3M1EA 4Y52J 1JUSA 1V55H 4DW6A 2I8DA 1LE8A 1G59A 4RB2C 4DNCA 2ICWG 4FQGA 1MBEA 1IAWA 1DGRM 3S1QJ 2E35A 2K3FA 2ME0A 2NXNB 2V9PA 3BLYA 3KYDB 3ZOBA 4AIHA 5FO5A 1TC3C 3TEDA 4IX7A 4B4CA 2F5DA 4MGRA 2UZKA 4RAYA 5DD8A 4QPQA 4M3DA 3HRSA 1WI9A 3ABMH 3BG3A 2L9SA 1IUYA 3ZPLA 3FXMA 1A36A 2XGEA 3BY6A 2EINH 1TNSA 2X1DA 3IUOA 4JK1X 4P5OA 1QBJA 1DP7P 1FBSA 3WG9A 3S1RJ 2P6TA 3W6VA 3I4MJ 1LDJA 4FTHA 2GOXB 1BJAA 3MZYA 2EFPA 1LPQA 3HUGA 2IS2A 4X1EA 1GHCA 2XVCA 2BOLA 2HR3A 2RNGA 1BJZA 3V8LA 2GIZA 2K85A 3ZMUA 4UNOA 1GVDA 2IGMA 5FLXK 2KIUA 3VYTB 1SD4A 2K9LA 1TL8A 3BWGA 3F21A 4CCKA 4FT8A 1K83J 2NVQJ 2NYXA 5TRDA 5EJCA 2M1BA 2FUG2 3WE3A 1OPCA 3I4NJ 3HTSB 2IA2A 3BG9A 1FT9A 4RAGA 4XOPA 3R6SA 3DFGA 3QQAA 3QOEA 5D8LB 3E97A 2ZNYA 4BEHA 5D4RA 2BEOA 4QIWN 4OAYA 3H0DA 4XLEA 5FD6A 3CC2I 3ONQA 2QKMB 4W97A 3H3VK 2W25A 3WTVC 4YFKF 2G0EA 3L2WA 1IV8A 2PFBA 1IXRC 4MLOA 3HRUA 5H6QA 3RIRA 4M9SA 3RYRA 4AWXB 3SZTA 3FMQA 1KONA 2VKDA 1STZA 2XF5A 4KFCA 1KQ9A 4KA4A 4ZTJA 2M4GA 2KIQA 4IXAA 4AYBA 5LBQA 2Y0SA 5DS9A 4XKWA 4Q5SF 2DMQA 1KQ0A 2YX7A 3G73A 3KP3A 2UUZA 3MKWB 2RNJA 2ZJ2A 3OYLA 3HKZA 2PMZN 4NBQA 3CMEI 1IN5A 2QLZA 4BQAA 2HQRA 2QYOA 4HX7A 2VPLA 2F5EA 2MLGA 4GO1A 3KIOA 4LIUA 4UVBA 3GBGA 1S7EA 1BOAA 1ZRDA 2HQ5A 1YQAA 2EIMH 3JAMZ 2DOEA 3K70D 1OR7C 2K27A 4HF0A 3TOBA 4I7HA 3S1MJ 2HTSA 3I3LA 3R0JA 4HSRA 4MQ9F 1JUPA 3JCUC 3CCYA 3BR3A 2O03A 3W6KB 3HRTA 3WTYC 3KP6A 3GYHX 2VKHA 1EF4A 2XPWA 3EYIA 1RZ4A 3OOUA 4G6TB 5M3MJ 1BN5A 5EYRA 1D1AA 3DQVC 1ZAOA 3G1MA 5LEKA 3GTQJ 2VT2A 2P7CB 1HW5A 4D9JA 5LRSA 3J7AY 5TISC 3BQZA 2DU9A 3M1CA 4A3BJ 1YW9A 2HYJA 3BTLA 4Y33A 2ELJA 3GTMJ 2M7AA 4M9XA 4U0VA 4P9UA 1WH5A 2JVGA 3OIPA 2BY0A 2LP0A 4BACA 1APLC 5C4JJ 1U9NA 5IPAA 1XMXA 1M1EB 2R4GA 1Z05A 2DK8A 3FZVA 5F08A 5H6RA 3G4SI 1YRNB 3GLXA 4II3A 3PIPF 3W6JB 2F5CA 3HL2A 4UUVA 3OSGA 4KNYA 1HDPA 3CMYA 1T33A 2IS6A 2LDUA 4PFPA 4S05A 1VQ8I 3DLAA 2CQKA 1KZHA 2HZDA 3CZ6A 2X6WA 3T1BA 2QQAA 2QSHX 4AYBN 1UJ8A 5E1WA 2Y0SN 3AG4H 2GXAA 2CH0A 3EYYA 2BZTA 2CV0A 2EIJH 1ZLKA 2E36A 1OISA 2QENA 4BQOA 3HKZN 3M8EA 4G6DA 1D0XA 1OR7A 2XGXA 3RPUD 1E3PA 2P7VB 3KETA 2IP2A 1HKSA 3B02A 5FLMJ 2FBIA 2MC3A 3E5XA 2CV1A 1X4PA 1H0MA 2R7QA 2CYYA 1FX7A 1Y8QB 2O0YA 1OKRA 2HOAA 3VYSB 5EGOB 4L9TA 4C3HJ 1QVUA 3OSFA 2OJED 4IO9F 3CJQB 1IF1A 4IRHA 2IT0A 4S0HB 3LWFA 2H27A 2R5ZB 1HSTA 2HQAA 4ON0A 2LTPA 4IOAF 3FISA 2COBA 4BKXA 1D1BA 5FD5A 1WJBA 3UKGA 3I5UA 4HNVA 2DDBA 2HKOA 3HSRA 1X1AA 3TP0A 4A3DJ 4BNCA 2WV1A 2X0LA 1RIOH 4OWRB 4HX4A 1MIJA 2L54A 3EPZA 3CLOA 2E5NA 5IOZA 1JT6A 5E1ZB 2LBFB 3K4JA 2M5WA 1X3UA 3GWZA 1BM9A 1ZLJA 1PVEA 4HBLA 1P7IA 2XHKA 3IKVA 1UHWA 2RKHA 3CCJI 2YX4A 4NB5A 2NOJB 4BYYA 5FKOA 1XGOA 5ILUA 3O2PE 2HI3A 3F6OA 3LSMA 2DPUA 2RQQA 2WAEA 5LFAA 3HZJA 1JTYA 1MSEC 4BQQA 2IGKA 4BHBA 4ZZDA 1LFBA 3IAM2 1TTYA 3HDDA 4HLYA 2Z16A 1QQIA 4IVNA 4XR6A 4N4OB 3I56I 3TO9A 4WXDA 1IXCA 2HGCA 5E3MA 4BXFA 3J80Z 4L18B 2L7ZA 3G2BA 3E3VA 4EJWA 3K6GA
chains in the Genus database with same CATH topology
1FJLA 3M3YJ 4Y7NJ 2E19A 2DMNA 4A3CJ 1RR7A 1X2MA 1VF9A 3SJMA 1WGXA 2MW8A 5K7ZA 3HGGA 3L1PA 2X6OA 2DJNA 2K40A 2XPVA 3Q0UA 1Z0XA 2E2HJ 1GV2A 1SANA 2CJJA 3C2BA 2H8RA 1IC8A 3JRBA 1D5YA 1YRNA 2ME6A 1R9TJ 3GTPJ 2O7OA 3HEFA 5F0FA 1GUUA 1OJLA 2MG4A 2QF7A 1LFUP 4NDLA 2EH3A 3B6CA 1OCPA 2NOGA 2FJ1A 5J1UA 1AHDP 1TWAJ 2IBDA 1GT0C 1LE8B 1GV5A 1TWFJ 2JA5J 1JUMA 9ANTA 2CRGA 2CUEA 2LD5A 3TW7A 1HOMA 1OFCX 3TP3A 3ZQGA 1JT0A 2KDZA 1Y1VJ 4XK4A 2Y9YA 3HOZJ 3O8HA 1ZQ3P 2LY9A 2Y2ZA 2H1KA 4L5EA 3FK7A 5IOYA 3S14J 1W0TA 1ZK8A 3HOVJ 4D5CA 2YU9J 1BW6A 2EZLA 4AC0A 3IV5A 3S15J 2KT0A 2JWTA 3HOYJ 2CU7A 2JK3A 3K2AA 1G2HA 5GP9A 3VPRA 2FQ4A 1AKHA 3JRAA 5EGOA 4M3BA 4EEFG 1B72B 1WCMJ 2E2IJ 4IHWA 1BA5A 5E3LA 4B3AA 4BBRJ 5F27A 3QPSA 1MBGA 2R5YB 2GLOA 2R5ZA 1MBFA 1CQTA 2X48A 2R92J 4MIMA 3JRGA 3S1NJ 1XG1A 4UUTA 1IG7A 2ID6A 4A3FJ 3RQIA 3OIOA 4BBSJ 4A3LJ 2GM4A 5E3NA 2LVSA 2HDDA 5IYCJ 2AHQA 1H89C 3HOUJ 4UUSA 1FTZA 2M0CA 1TWHJ 3HGYA 5F1JA 4A3IJ 1GDTA 2GBYA 2DA5A 5EG0A 3BTCA 4GFBA 2L0KA 2B63J 1WH7A 1ETVA 2NVTJ 2FX0A 2XB0X 1BW5A 4XRSG 3PM1A 2DTZA 1IUFA 1HLVA 4ABZA 1H88C 2HXOA 1ETOA 4D7NA 2XPUA 1B8IB 1JJ6C 4I76A 3Q0VA 2R93J 1TWGJ 2DN0A 1POGA 3M4OJ 1WPKA 2YS9A 4IHVA 2E2JJ 2VUMJ 3FKIJ 1ETQA 2N8GA 3JRHA 3LSJA 3G1OA 2WAQN 4W1UA 5C3EJ 2CUFA 1U78A 3CQZJ 4BY1J 2DMTA 2EZKA 1RKTA 3B6AA 1JTXA 4V2GA 4DYCA 5M3FJ 3PO3J 3BR2A 2M8GX 1UG2A 3NARA 3RZDJ 2M2EA 3GTLJ 3JRCA 1RPWA 2NS8A 5F0CA 4A3GJ 2ECCA 1K61A 3TW6A 2MSYA 4D5FA 1I50J 2VKEA 2CQQA 1T56A 2NVYJ 2Y30A 2EZHA 5J1RA 1VI0A 3O8GA 1TWCJ 4XICA 4FE7A 2JA7J 4FCYA 2L7FP 5M5YJ 5FJ8J 5JLWA 2CQXA 3ZQFA 3LSPA 1IJWC 4JP0A 3S16J 2DA6A 1U9OA 3GTKJ 1UMQA 1MH4A 5K7FA 5DTDA 2HOSA 4Y52J 1JUSA 1W0UA 4DW6A 1QPIA 3BR5A 1JKOC 1LE8A 2LLKA 1MBEA 3S1QJ 3S2HJ 1ETYA 2IEKA 3SDGA 2ME0A 3ZOBA 1TC3C 3TEDA 1A6IA 1ZR4A 1ZR2A 3BQYA 1X2NA 4B4CA 4BXXJ 4A93J 4M3DA 5EDNA 2VKVA 3BG3A 5FKNA 1XS9A 5J1YA 2XGEA 1ENHA 1MBKA 2Y31A 5IYDJ 2XB5A 1HDDC 3S1RJ 3A03A 3W6VA 3I4MJ 3FK6A 4FTHA 3H0GJ 4IHXA 4X1EA 3WHCA 5IP9J 1MNMC 3GTJJ 1BJZA 3LSGA 1GVDA 3G1LA 1NK3P 4XRSA 1B72A 5FLVA 2P81A 4A3MJ 1QVTA 1IDYA 2O8KA 1K83J 2NVQJ 2DA2A 1RETA 3HBLA 3BTIA 2XSDC 3JRIA 2R5YA 3HM5A 2DMUA 3ZQCA 1NK2P 3DCFA 4C3JJ 3BG9A 1E3OC 1Q1VA 1H8AC 1SFOJ 2XGDA 3QQAA 3HB9A 4C2MJ 4QIWN 2EZIA 3S2DJ 4W97A 4RDUA 4IEJA 3H3VK 2FD5A 2LR8A 2G0EA 4MFEA 3ZQHA 3JR9A 3E7LA 4MLOA 1FEXA 3LNQA 5EEAA 2ZB9A 4D7MA 2K9NA 4A69C 2L9RA 4JYKA 5DS9A 1VFCA 5J3LA 2I10A 2DMQA 2L7MP 4A3JJ 1B8IA 2O9LA 1ZKGA 2JJ7A 3CDLA 1IGNA 2DMPA 5GPAA 2PMZN 4DZJA 3RKQA 4FISA 3F0CA 5K7HA 2ELKA 2WB1N 3GBGA 1S7EA 3S17J 5C44J 2HQ5A 4G12A 4CYCB 3GTGJ 1ZTRA 3S1MJ 2OPTA 3BG5A 1RKWA 4MFDA 1JUPA 3BR3A 3CCYA 3MVPA 4B1RA 4AUXA 3JRDA 5EZGA 1HCRA 1EF4A 1P7JA 2XPWA 1MBJA 3OOUA 5M3MJ 2NS7A 2M34A 4XIDA 2LFBA 5EYRA 4I6ZA 3A01B 3JREA 3DEWA 2DA4A 3G1MA 3NAUA 4A3KJ 3GTQJ 2YUSA 2ECBA 3ZQIA 4IHYA 1FIPA 1U8BA 4DZPA 4DYRA 5IP7J 3BQZA 2ID3A 3BR0A 4A3BJ 4M6VA 1PUFB 2HYJA 3BTLA 3D1NI 3GTMJ 3HOXJ 1I3QJ 1JJ8C 2JA6J 1JKQC 4LOCA 1WH5A 1BL0A 4V2FA 1DU6A 1AU7A 1XC5A 2LP0A 2R0QC 1APLC 3GTOJ 5C4JJ 1FTTA 1U9NA 1DU0A 2XRLA 5M5WJ 1F36A 5E3OA 3IH3A 5IPAA 5C4XJ 4M3GA 3LSRA 3QPLA 3A02A 5F08A 2OF7A 4BY7J 1ETWA 4QSHA 3JRFA 2LKXA 4RBOA 1YRNB 2HOTA 2LK2A 1F43A 3BR6A 1ORKA 2DA3A 3OSGA 4MO7A 2TCTA 2RAEA 1HDPA 3CMYA 1T33A 4JX5A 1JGGA 3I4NJ 1VNDA 2JN6A 5FKLA 1OCTC 3IH2A 4AYBN 4M3EA 2Y0SN 1A5JA 4DYQA 5FKMA 5M5XJ 3RZOJ 5F04A 3MN2A 3HKZN 4QTRA 2VI6A 4A3EJ 4M3FA 2K9SA 5FLMJ 3ZQLA 2NVXJ 3LOCA 1IRZA 1AKHB 1QRYA 2HOAA 5EGOB 1JKPC 2K9QA 4C3HJ 1QVUA 3OSFA 2DA7A 1IV6A 1UHSA 1Y1WJ 3HOWJ 2AO9A 4XRMA 3PO2J 5FKKA 3MKLA 1I6HJ 5EZHA 4S0HB 1ETKA 1NTCA 2QCOA 4C3IJ 3Q3SA 2R5ZB 2LTPA 2HXIA 2MGQA 3FISA 2COBA 4BKXA 1JKRC 2R7ZJ 3UKGA 4HNVA 3BT9A 3TP0A 4A3DJ 5IP6A 2WV1A 1X58A 1Z77A 1ZGWA 2TRTA 5IOZA 1FIAA 1JT6A 2IAIA 2JMWA 3BR1A 2EQRA 3WHBA 4UUSB 4JX4A 2D5VA 5EF6A 1P7IA 1RESA 5HODA 1ETXA 2Y9ZA 1MBHA 4J19A 5EG0B 4CYCA 3SFIA 1ITYA 3FIWA 5FKOA 5F0HA 4JX6A 5IYBJ 2HI3A 5BNGA 2VPRA 3Q0WA 2W48A 2M9HA 1JTYA 1MSFC 1MH3A 1MSEC 1WI3A 3IH4A 1LFBA 3HDDA 2X9DA 3A01A 2EBIA 4FE4A 3BTJA 1HF0A 5GPCA 5JLXA 4X6AJ 5E3MA 2JA8J 1O4XA 3K7AJ 2L7ZA 2XGCA 2E1OA 1PUFA 1IDZA 2DA1A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 1FJL A;  3M3Y J;  4Y7N J;  2E19 A;  2DMN A;  4A3C J;  1RR7 A;  1X2M A;  1VF9 A;  3SJM A;  1WGX A;  2MW8 A;  5K7Z A;  3HGG A;  3L1P A;  2X6O A;  2DJN A;  2K40 A;  2XPV A;  3Q0U A;  1Z0X A;  2E2H J;  1GV2 A;  1SAN A;  2CJJ A;  3C2B A;  2H8R A;  1IC8 A;  3JRB A;  1D5Y A;  1YRN A;  2ME6 A;  1R9T J;  3GTP J;  2O7O A;  3HEF A;  5F0F A;  1GUU A;  1OJL A;  2MG4 A;  2QF7 A;  1LFU P;  4NDL A;  2EH3 A;  3B6C A;  1OCP A;  2NOG A;  2FJ1 A;  5J1U A;  1AHD P;  1TWA J;  2IBD A;  1GT0 C;  1LE8 B;  1GV5 A;  1TWF J;  2JA5 J;  1JUM A;  9ANT A;  2CRG A;  2CUE A;  2LD5 A;  3TW7 A;  1HOM A;  1OFC X;  3TP3 A;  3ZQG A;  1JT0 A;  2KDZ A;  1Y1V J;  4XK4 A;  2Y9Y A;  3HOZ J;  3O8H A;  1ZQ3 P;  2LY9 A;  2Y2Z A;  2H1K A;  4L5E A;  3FK7 A;  5IOY A;  3S14 J;  1W0T A;  1ZK8 A;  3HOV J;  4D5C A;  2YU9 J;  1BW6 A;  2EZL A;  4AC0 A;  3IV5 A;  3S15 J;  2KT0 A;  2JWT A;  3HOY J;  2CU7 A;  2JK3 A;  3K2A A;  1G2H A;  5GP9 A;  3VPR A;  2FQ4 A;  1AKH A;  3JRA A;  5EGO A;  4M3B A;  4EEF G;  1B72 B;  1WCM J;  2E2I J;  4IHW A;  1BA5 A;  5E3L A;  4B3A A;  4BBR J;  5F27 A;  3QPS A;  1MBG A;  2R5Y B;  2GLO A;  2R5Z A;  1MBF A;  1CQT A;  2X48 A;  2R92 J;  4MIM A;  3JRG A;  3S1N J;  1XG1 A;  4UUT A;  1IG7 A;  2ID6 A;  4A3F J;  3RQI A;  3OIO A;  4BBS J;  4A3L J;  2GM4 A;  5E3N A;  2LVS A;  2HDD A;  5IYC J;  2AHQ A;  1H89 C;  3HOU J;  4UUS A;  1FTZ A;  2M0C A;  1TWH J;  3HGY A;  5F1J A;  4A3I J;  1GDT A;  2GBY A;  2DA5 A;  5EG0 A;  3BTC A;  4GFB A;  2L0K A;  2B63 J;  1WH7 A;  1ETV A;  2NVT J;  2FX0 A;  2XB0 X;  1BW5 A;  4XRS G;  3PM1 A;  2DTZ A;  1IUF A;  1HLV A;  4ABZ A;  1H88 C;  2HXO A;  1ETO A;  4D7N A;  2XPU A;  1B8I B;  1JJ6 C;  4I76 A;  3Q0V A;  2R93 J;  1TWG J;  2DN0 A;  1POG A;  3M4O J;  1WPK A;  2YS9 A;  4IHV A;  2E2J J;  2VUM J;  3FKI J;  1ETQ A;  2N8G A;  3JRH A;  3LSJ A;  3G1O A;  2WAQ N;  4W1U A;  5C3E J;  2CUF A;  1U78 A;  3CQZ J;  4BY1 J;  2DMT A;  2EZK A;  1RKT A;  3B6A A;  1JTX A;  4V2G A;  4DYC A;  5M3F J;  3PO3 J;  3BR2 A;  2M8G X;  1UG2 A;  3NAR A;  3RZD J;  2M2E A;  3GTL J;  3JRC A;  1RPW A;  2NS8 A;  5F0C A;  4A3G J;  2ECC A;  1K61 A;  3TW6 A;  2MSY A;  4D5F A;  1I50 J;  2VKE A;  2CQQ A;  1T56 A;  2NVY J;  2Y30 A;  2EZH A;  5J1R A;  1VI0 A;  3O8G A;  1TWC J;  4XIC A;  4FE7 A;  2JA7 J;  4FCY A;  2L7F P;  5M5Y J;  5FJ8 J;  5JLW A;  2CQX A;  3ZQF A;  3LSP A;  1IJW C;  4JP0 A;  3S16 J;  2DA6 A;  1U9O A;  3GTK J;  1UMQ A;  1MH4 A;  5K7F A;  5DTD A;  2HOS A;  4Y52 J;  1JUS A;  1W0U A;  4DW6 A;  1QPI A;  3BR5 A;  1JKO C;  1LE8 A;  2LLK A;  1MBE A;  3S1Q J;  3S2H J;  1ETY A;  2IEK A;  3SDG A;  2ME0 A;  3ZOB A;  1TC3 C;  3TED A;  1A6I A;  1ZR4 A;  1ZR2 A;  3BQY A;  1X2N A;  4B4C A;  4BXX J;  4A93 J;  4M3D A;  5EDN A;  2VKV A;  3BG3 A;  5FKN A;  1XS9 A;  5J1Y A;  2XGE A;  1ENH A;  1MBK A;  2Y31 A;  5IYD J;  2XB5 A;  1HDD C;  3S1R J;  3A03 A;  3W6V A;  3I4M J;  3FK6 A;  4FTH A;  3H0G J;  4IHX A;  4X1E A;  3WHC A;  5IP9 J;  1MNM C;  3GTJ J;  1BJZ A;  3LSG A;  1GVD A;  3G1L A;  1NK3 P;  4XRS A;  1B72 A;  5FLV A;  2P81 A;  4A3M J;  1QVT A;  1IDY A;  2O8K A;  1K83 J;  2NVQ J;  2DA2 A;  1RET A;  3HBL A;  3BTI A;  2XSD C;  3JRI A;  2R5Y A;  3HM5 A;  2DMU A;  3ZQC A;  1NK2 P;  3DCF A;  4C3J J;  3BG9 A;  1E3O C;  1Q1V A;  1H8A C;  1SFO J;  2XGD A;  3QQA A;  3HB9 A;  4C2M J;  4QIW N;  2EZI A;  3S2D J;  4W97 A;  4RDU A;  4IEJ A;  3H3V K;  2FD5 A;  2LR8 A;  2G0E A;  4MFE A;  3ZQH A;  3JR9 A;  3E7L A;  4MLO A;  1FEX A;  3LNQ A;  5EEA A;  2ZB9 A;  4D7M A;  2K9N A;  4A69 C;  2L9R A;  4JYK A;  5DS9 A;  1VFC A;  5J3L A;  2I10 A;  2DMQ A;  2L7M P;  4A3J J;  1B8I A;  2O9L A;  1ZKG A;  2JJ7 A;  3CDL A;  1IGN A;  2DMP A;  5GPA A;  2PMZ N;  4DZJ A;  3RKQ A;  4FIS A;  3F0C A;  5K7H A;  2ELK A;  2WB1 N;  3GBG A;  1S7E A;  3S17 J;  5C44 J;  2HQ5 A;  4G12 A;  4CYC B;  3GTG J;  1ZTR A;  3S1M J;  2OPT A;  3BG5 A;  1RKW A;  4MFD A;  1JUP A;  3BR3 A;  3CCY A;  3MVP A;  4B1R A;  4AUX A;  3JRD A;  5EZG A;  1HCR A;  1EF4 A;  1P7J A;  2XPW A;  1MBJ A;  3OOU A;  5M3M J;  2NS7 A;  2M34 A;  4XID A;  2LFB A;  5EYR A;  4I6Z A;  3A01 B;  3JRE A;  3DEW A;  2DA4 A;  3G1M A;  3NAU A;  4A3K J;  3GTQ J;  2YUS A;  2ECB A;  3ZQI A;  4IHY A;  1FIP A;  1U8B A;  4DZP A;  4DYR A;  5IP7 J;  3BQZ A;  2ID3 A;  3BR0 A;  4A3B J;  4M6V A;  1PUF B;  2HYJ A;  3BTL A;  3D1N I;  3GTM J;  3HOX J;  1I3Q J;  1JJ8 C;  2JA6 J;  1JKQ C;  4LOC A;  1WH5 A;  1BL0 A;  4V2F A;  1DU6 A;  1AU7 A;  1XC5 A;  2LP0 A;  2R0Q C;  1APL C;  3GTO J;  5C4J J;  1FTT A;  1U9N A;  1DU0 A;  2XRL A;  5M5W J;  1F36 A;  5E3O A;  3IH3 A;  5IPA A;  5C4X J;  4M3G A;  3LSR A;  3QPL A;  3A02 A;  5F08 A;  2OF7 A;  4BY7 J;  1ETW A;  4QSH A;  3JRF A;  2LKX A;  4RBO A;  1YRN B;  2HOT A;  2LK2 A;  1F43 A;  3BR6 A;  1ORK A;  2DA3 A;  3OSG A;  4MO7 A;  2TCT A;  2RAE A;  1HDP A;  3CMY A;  1T33 A;  4JX5 A;  1JGG A;  3I4N J;  1VND A;  2JN6 A;  5FKL A;  1OCT C;  3IH2 A;  4AYB N;  4M3E A;  2Y0S N;  1A5J A;  4DYQ A;  5FKM A;  5M5X J;  3RZO J;  5F04 A;  3MN2 A;  3HKZ N;  4QTR A;  2VI6 A;  4A3E J;  4M3F A;  2K9S A;  5FLM J;  3ZQL A;  2NVX J;  3LOC A;  1IRZ A;  1AKH B;  1QRY A;  2HOA A;  5EGO B;  1JKP C;  2K9Q A;  4C3H J;  1QVU A;  3OSF A;  2DA7 A;  1IV6 A;  1UHS A;  1Y1W J;  3HOW J;  2AO9 A;  4XRM A;  3PO2 J;  5FKK A;  3MKL A;  1I6H J;  5EZH A;  4S0H B;  1ETK A;  1NTC A;  2QCO A;  4C3I J;  3Q3S A;  2R5Z B;  2LTP A;  2HXI A;  2MGQ A;  3FIS A;  2COB A;  4BKX A;  1JKR C;  2R7Z J;  3UKG A;  4HNV A;  3BT9 A;  3TP0 A;  4A3D J;  5IP6 A;  2WV1 A;  1X58 A;  1Z77 A;  1ZGW A;  2TRT A;  5IOZ A;  1FIA A;  1JT6 A;  2IAI A;  2JMW A;  3BR1 A;  2EQR A;  3WHB A;  4UUS B;  4JX4 A;  2D5V A;  5EF6 A;  1P7I A;  1RES A;  5HOD A;  1ETX A;  2Y9Z A;  1MBH A;  4J19 A;  5EG0 B;  4CYC A;  3SFI A;  1ITY A;  3FIW A;  5FKO A;  5F0H A;  4JX6 A;  5IYB J;  2HI3 A;  5BNG A;  2VPR A;  3Q0W A;  2W48 A;  2M9H A;  1JTY A;  1MSF C;  1MH3 A;  1MSE C;  1WI3 A;  3IH4 A;  1LFB A;  3HDD A;  2X9D A;  3A01 A;  2EBI A;  4FE4 A;  3BTJ A;  1HF0 A;  5GPC A;  5JLX A;  4X6A J;  5E3M A;  2JA8 J;  1O4X A;  3K7A J;  2L7Z A;  2XGC A;  2E1O A;  1PUF A;  1IDZ A;  2DA1 A; 
#chains in the Genus database with same CATH topology
 2EPF A;  1K4T A;  1HBX G;  4M6Y A;  3HPG A;  1Z3X A;  1QHG A;  5DEQ A;  3FM3 A;  4RAF A;  4PUS A;  3JAM K;  2HKX A;  3S2W A;  5GAG J;  2PLY A;  3ZGK A;  1Z0X A;  2RGV A;  2HYF A;  3G3Z A;  1R49 A;  2H8R A;  1YRN A;  3EUH C;  2CW0 F;  2DJI A;  2ZXJ A;  5CKT A;  4S04 A;  3H5N A;  4XNF A;  4L0Y B;  3WTS C;  3HEF A;  1OCO H;  2W4S A;  2VBX A;  2FJ1 A;  4N4N B;  2X6Y A;  3CC4 I;  1AHD P;  3ASN H;  2FBK A;  2P4W A;  3DU5 A;  4G7Z F;  5LLQ A;  4L0Z B;  3GF2 A;  1P4W A;  4AVZ A;  1GT0 C;  2WAQ A;  1TWF J;  2G7H A;  3K4N A;  2JA5 J;  1JUM A;  2E34 A;  2CRG A;  1WZ2 A;  3ABL H;  1TQP A;  2F5V A;  4D0P A;  3TP3 A;  2COM A;  3DBL B;  3S93 A;  3I4P A;  2VAS A;  2Y9Y A;  2P5V A;  2K5C A;  1G3S A;  2LY9 A;  2Y2Z A;  4G8X A;  4B09 A;  2A6E F;  3FK7 A;  3S14 J;  1ZK8 A;  2DCE A;  3QYB A;  4PFO A;  1BW6 A;  2EZL A;  1H9G A;  4AC0 A;  3I55 I;  1R1T A;  2KT0 A;  3BJO A;  3M8F A;  4HDV A;  3HOY J;  2UXX A;  2CU7 A;  2GZW A;  4A6D A;  2JPC A;  5GP9 A;  2GAU A;  1IN6 A;  1VQ9 I;  3I54 A;  1QGP A;  3JRA A;  5EGO A;  2W85 A;  3VWB A;  5FRN A;  1R36 A;  4PJ0 C;  3KP2 A;  1ULY A;  4F3Q A;  3COA C;  4IHW A;  1U3E M;  1S5L C;  3L9F A;  4PDK A;  1VZ0 A;  2V9K A;  4UVA A;  1VQO I;  1R22 A;  4KT6 A;  4A5M A;  2R5Z A;  4RS8 A;  1BR4 A;  4MIM A;  3S1N J;  3DPL C;  2V6E A;  2P0W A;  3F22 A;  1ZYR F;  3OIO A;  1YJN I;  2HEO A;  5E3N A;  2LVS A;  2LBF A;  5CJ9 A;  3S32 A;  2HVS A;  5IYC J;  2FQ3 A;  2QUF A;  2AXL A;  2LMD A;  1XMK A;  3X2Q H;  3LAP A;  2KQR A;  1TWH J;  4KN7 X;  3DP7 A;  2OU2 A;  2WAF A;  2GBY A;  3EUH A;  2MYS A;  1WRJ A;  3BP8 A;  1BR2 A;  1XB4 A;  2EB7 A;  2L0K A;  2XKO A;  3C3W A;  4EM1 A;  3ZP5 A;  1L3L A;  1WH7 A;  1ETV A;  3N05 A;  3ZMZ A;  2R7W A;  2KIS A;  3IWZ A;  4ABZ A;  4ESB A;  2HXO A;  1H88 C;  4D7N A;  4YFN F;  4LFU A;  4ITV A;  3CUQ B;  5DUK A;  3Q0V A;  1Z67 A;  2X4H A;  1S29 A;  2DN0 A;  4LIT A;  1ZH5 A;  4B3X A;  4QPO A;  1MGT A;  4HEA 2;  1OYW A;  4XMY A;  4IHV A;  3Q9S A;  2DFF A;  1UHM A;  3OYK A;  2VUM J;  1N25 A;  2N8G A;  3WTU C;  2AQE A;  2CQN A;  3G1O A;  3ISP A;  4KIB A;  2WAQ N;  4NNJ A;  2O6G E;  5C3E J;  2DOF A;  2K7L A;  2EFO A;  2HWV A;  1J9I A;  4BY1 J;  4OIQ F;  3G71 I;  3B6A A;  4V2G A;  2P6S A;  3PO3 J;  3NAR A;  4AIJ A;  4IKF A;  3DWL E;  1CGP A;  2M2E A;  1KU9 A;  3H3U A;  2KLO A;  2DBB A;  5GTI C;  2KDO A;  3QYE A;  2LF8 A;  5F0C A;  3OL4 A;  4HQM A;  1K61 A;  3LFK A;  1G3Y A;  1G6N A;  2VKE A;  4C30 A;  4Y15 A;  3OYG A;  3LMM A;  1XGM A;  1T56 A;  2Y30 A;  2HYG D;  4M6X A;  3H35 A;  1ZRC A;  4ZYH A;  2IVM A;  4XIC A;  4E7H A;  4FE7 A;  2H6C A;  1IN7 A;  3RI4 A;  1LQ1 A;  5E17 F;  1REP C;  3DTK A;  3LSH A;  4V19 K;  2L7F P;  3LSP A;  5JLW A;  1IJW C;  4JP0 A;  2LY1 A;  2DA6 A;  2DYR H;  4CCO A;  5K7F A;  5TJJ A;  3CUQ C;  4J00 A;  1S6L A;  2VN2 A;  2VOO A;  1P9Q C;  3CCV I;  3FWE A;  3ZN1 A;  2QBY A;  3BR5 A;  1JKO C;  3J80 K;  2GIV A;  2BXY A;  2BV6 A;  1O7L A;  1Y56 A;  4Z2Y A;  1FP2 A;  3I53 A;  4CCJ A;  4HV6 A;  3S2H J;  1W7P B;  3QPH A;  3PUB A;  4A0Z A;  2CGP A;  1YJ9 I;  3BQY A;  4XRF A;  4C2U A;  2M8E A;  3R60 A;  5EDN A;  2V79 A;  3EET A;  1TP4 A;  1WFX A;  4U87 A;  3OYC A;  5J4V A;  1MBK A;  1Q1H A;  4J01 A;  1UAA A;  3WE2 A;  3FK6 A;  3H0G J;  1EKE A;  4UB8 C;  1X1P A;  3L2R A;  1TT0 A;  3FXQ A;  1E17 A;  2JSP A;  3OMY A;  5DCF A;  2L3D A;  1P2F A;  3G1L A;  3P9I A;  5HS8 A;  1NK3 P;  2HFH A;  4OIR F;  5J47 A;  4A3M J;  5HDK A;  4B43 A;  2QWW A;  2O8K A;  4L9N A;  2VE8 A;  1H9T A;  3H36 A;  3JRI A;  2BHZ A;  4NHJ A;  2DMU A;  2EIK H;  4LIV A;  1NK2 P;  1YIJ I;  3F23 A;  5HLG A;  3KP5 A;  1J7K A;  5ILS A;  1H8A C;  1BI3 A;  5CQE A;  4C2M J;  1T98 A;  3H1C A;  3S2D J;  3H3Z A;  2GXB A;  4K2E A;  3GFM A;  2LR8 A;  5ICG A;  1XD7 A;  4MTE A;  3CJR B;  3TL4 X;  3LL7 A;  4E7L A;  3E7L A;  4BL0 B;  3LNQ A;  1FZP B;  2FE3 A;  2XAG A;  3MAJ A;  4D7M A;  2F2E A;  2K9N A;  1QZY A;  4A69 C;  3W2V A;  4KIS A;  2VL8 A;  3KZY A;  2NRA C;  4JYK A;  1O3Q A;  3J81 Z;  2YU3 A;  1VFC A;  3H92 A;  5J3L A;  3T8R A;  3CUQ A;  2O9L A;  1LUJ B;  2Q1Z B;  3PSF A;  3CDH A;  2HOE A;  5TGT A;  4F52 A;  4B47 A;  3M9A A;  4JOM A;  4XLC A;  3K4M A;  4DZJ A;  1MMS A;  2Y69 H;  3E6M A;  4KJZ A;  3CF5 F;  3LA7 A;  2STW A;  1SVO A;  2VT3 A;  4ZDP A;  5C44 J;  1TQI A;  1BI1 A;  1KYW A;  1VQN I;  4CYC B;  2CUJ A;  4BE2 A;  3GTG J;  2CW7 A;  4WF2 A;  5BQT A;  2E5Z A;  3GZN B;  1B6A A;  4MFD A;  5CVJ A;  1XX5 A;  3MVP A;  2M3A A;  4DQ2 A;  4B1R A;  3E5U A;  1HCR A;  3M8J A;  3DBR B;  1P7J A;  3CCU I;  2W82 A;  1HW1 A;  4UVC A;  4FET A;  4ETS A;  1ZAR A;  5CVU A;  2V9V A;  3D5S C;  3L2V A;  3WU2 C;  3DEW A;  3F3X A;  3NAU A;  2X85 A;  1VQM I;  4HNU A;  2ECB A;  3F8F A;  3PJR A;  2XV4 S;  5IP7 J;  2R7O A;  3U9G A;  2M30 A;  4M6V A;  2JRT A;  3I9V 2;  4R79 A;  3D1N I;  3N4M A;  2CSO A;  2DXI A;  1N75 A;  2EA2 A;  4XLP F;  2F6C A;  1VQP I;  4CDG A;  1DU6 A;  5HNF A;  1XC5 A;  2VQL A;  1W7P A;  2XRL A;  2OA4 A;  3IH3 A;  3K9T A;  2D2W A;  3MKY B;  4M3G A;  4IJA A;  4ESF A;  4ZH4 F;  3CO6 C;  1JE8 A;  4EJT A;  1YG2 A;  4PJL A;  4XKB A;  2ISZ A;  1F43 A;  2I5U A;  1E3H A;  1ORK A;  4RMN A;  1IRF A;  4MO7 A;  2TCT A;  5H2F C;  2B0L A;  1J5Y A;  1HSJ A;  4KMF A;  2DOA A;  1GVJ A;  1LVK A;  3OV8 A;  3DLL F;  1JGG A;  1FOK A;  1FOY A;  1VND A;  5FKL A;  1X1B A;  3EUK L;  3DTE A;  3DKW A;  1OCT C;  3IH2 A;  4CYD A;  2EFW A;  3GX4 X;  4M3E A;  2NNY A;  3V4G A;  1R1V A;  5FKM A;  5DD4 A;  4XOT A;  2VIX A;  2JT1 A;  3AAF A;  3FHZ A;  2XDV A;  5CVR A;  3MZH A;  1ZG3 A;  1DDN A;  4IRI A;  3BG7 A;  2OQR A;  4CSW A;  1J0R A;  2MH2 A;  3MN2 A;  4PJM A;  2K3P A;  1P4A A;  2A3S A;  4PSW A;  1B9N A;  3ZQL A;  3VFZ A;  2R7R A;  4Q4Z F;  2IPQ X;  5IT9 Z;  2IS4 A;  2ZC2 A;  2BXZ A;  2Z33 A;  2E7W A;  1QNT A;  2IW5 A;  2UXN A;  1F4K A;  1IRZ A;  1QPM A;  1Z7L A;  4NC7 A;  4LG3 A;  1LNW A;  2AXT C;  2XRO A;  5D4S A;  4P55 A;  5L3G A;  2DA7 A;  3KFW X;  1ZEL A;  2AO9 A;  2RC4 A;  3CCQ I;  5FKK A;  1I6H J;  4OIN F;  3E6D A;  1QU3 A;  3LA2 A;  4C3I J;  5D5U B;  3I59 B;  4FAS D;  3AKZ A;  1CF7 B;  3RKY A;  2GXG A;  1LEA A;  4E7Z A;  4LGW A;  2XUB A;  3TGN A;  1EJ9 A;  1WSU A;  1D0Y A;  1SEU A;  2JQ7 A;  1Z77 A;  2NS0 A;  2OZ6 A;  3GUD A;  1ZGW A;  4U7D A;  5E79 C;  1GLN A;  1D1C A;  1FIA A;  1F9N A;  2KJC A;  2JA2 A;  2E60 A;  2EQR A;  4CZZ A;  3WHB A;  2MFZ A;  5CYV A;  2M45 A;  1SAX A;  4JX4 A;  2D5V A;  5K1Y A;  4BAY A;  3BPV A;  4LD5 A;  2LRE A;  1ETX A;  4YRV A;  5GAE J;  4CYC A;  3CMM A;  3SFI A;  1PJR A;  2XSJ C;  2Q0O A;  4MEX F;  2VJ5 A;  1TNT A;  1QA6 A;  3Q0W A;  2M9H A;  1LVA A;  3E0J B;  4AID A;  2ESH A;  3IH4 A;  4EGY A;  1T08 B;  2KRC A;  1YW8 A;  1FP1 D;  1W36 D;  1FPQ A;  5J8F A;  2L7K A;  4BS9 A;  2JA8 J;  1LFP A;  4OMZ A;  2XGC A;  3LFU A;  4YIF A;  1HC8 A;  3QP6 A;  2HQN A;  3RQ4 A;  1FSH A;  4ENK A;  1P4X A;  4ZC3 A;  1SFU A;  2FSW A;  4RM2 A;  1YS7 A;  4Y7N J;  2E19 A;  5FGM A;  4E7K A;  2DMN A;  3LAJ A;  4A3C J;  2PBI A;  5ICC A;  2MW8 A;  2DFE A;  3HGG A;  3L1P A;  2DFH A;  2K40 A;  2XPV A;  2LKS A;  3HXL A;  1SAN A;  2CJJ A;  1XSV A;  2DPD A;  3DXJ F;  3JRB A;  1D5Y A;  1P92 A;  3ML6 A;  2R7F A;  1K6O A;  1WKM A;  3IL2 A;  5LEJ A;  2O7O A;  5F0F A;  3PFY A;  4XOR A;  1MW7 A;  2MG4 A;  2QF7 A;  3FXU A;  4EGZ A;  4ZDO A;  2A6H F;  3B6C A;  5J40 A;  5A2Q Z;  3WTX C;  2XIG A;  3P9K A;  4WWC A;  1RR8 C;  3IC7 A;  4C2T A;  4OIO F;  4H0E A;  2Z9O A;  4RA2 A;  3E1S A;  3TW7 A;  1OFC X;  4XSZ F;  1XGN A;  2VQG A;  3ZQG A;  1FMW A;  4IL6 C;  5K5O A;  3HOZ J;  2IA0 A;  1MZB A;  4HZF A;  3O8H A;  3KYL A;  1VTN C;  1R1U A;  5IOY A;  2W00 A;  4Q48 A;  2IS1 A;  2BY3 A;  3H9Q A;  1VQL I;  3S15 J;  4M71 A;  4F92 B;  4BGD A;  2JK3 A;  4BJ5 C;  1G2H A;  3DV8 A;  5EEG A;  2MLK A;  2V1U A;  3VOE A;  2FQ4 A;  3IKT A;  3L00 A;  3NQO A;  1WWX A;  3H5A A;  1FYK A;  1B72 B;  4JQF A;  2E2I J;  3CD6 I;  5L3D A;  2H09 A;  3HOT A;  1BA5 A;  3FM5 A;  4TV7 A;  1W5C C;  2ZNZ A;  2LOO A;  3JW4 A;  2R5Y B;  3I59 A;  3WGH A;  2ISY A;  3K1M A;  3EDP A;  1CQT A;  2R92 J;  4IZZ A;  1CF7 A;  1S7A A;  3KLN A;  1XG1 A;  1SMT A;  2K86 A;  4GYI A;  1MJ9 A;  1IRX A;  1MND A;  1DGW Y;  1B59 A;  3SEQ A;  3RQI A;  4BBS J;  1T38 A;  1OCR H;  2DK5 A;  5DM7 F;  3KE2 A;  1XDS A;  4A3L J;  1BBY A;  2HDD A;  1W1W E;  2AHQ A;  1EH8 A;  1O3T A;  5F1J A;  4CH7 A;  1MDM B;  1LJ9 A;  1GDT A;  3MQ0 A;  3FMR A;  1HW2 A;  2DA5 A;  1D8J A;  3BTC A;  3F72 A;  2B63 J;  2XB0 X;  1BW5 A;  1QO0 D;  1IUF A;  2L02 A;  2EFQ A;  2XPU A;  4L5J A;  1AA7 A;  5DYM A;  5KCM A;  1JJ6 C;  2KRF A;  2WY8 Q;  4CCN A;  1XPX A;  3LQQ A;  1POG A;  3GEZ A;  2QKL B;  3FF5 A;  2YS9 A;  1I39 A;  3MZ8 A;  3E6C C;  5HDG A;  2DQL A;  3OYM A;  3K1N A;  3A0B C;  3FKI J;  3MKZ A;  1ZRE A;  3IRQ A;  4MTD A;  2EWN A;  2Z5U A;  5FRM A;  1LEB A;  2PQ8 A;  2OBP A;  2KP6 A;  1XCB A;  4P9F A;  2E1C A;  1JTX A;  3D5R C;  1YLF A;  3BR2 A;  2M8G X;  2IA1 A;  1V3F A;  2W84 A;  2IXS A;  4P96 A;  3GTL J;  2HZT A;  1K7A A;  4ASN A;  1R23 A;  3TW6 A;  3BRO A;  2MSY A;  4D5F A;  2CQQ A;  5LGN A;  3U1K A;  2EZH A;  3K4C A;  3U21 A;  1EA3 A;  4WXC A;  1VI0 A;  5J1R A;  1WJC A;  2EV5 A;  3RKX A;  2EFN A;  4HV5 A;  4H4K C;  1R00 A;  2JA7 J;  2K9M A;  5FJ8 J;  2CQX A;  3ZQF A;  3CO7 C;  1AWC A;  1HXD A;  2K4J A;  2X1E A;  2VLA A;  5D5X B;  1U9O A;  1UMQ A;  2K02 A;  2A6T A;  1J75 A;  3MCZ A;  2WB1 A;  4RGR A;  3L2C A;  1I3A A;  2KKO A;  5L3C A;  2QBY B;  3RSN A;  2FML A;  1AOY A;  5D8K B;  1ETY A;  3SDG A;  2ZJR F;  5JFR A;  4BDY A;  2DQR A;  1A6I A;  1ZR4 A;  1ZR2 A;  1X2N A;  2Y75 A;  2VKV A;  3GFJ A;  3GFL A;  1WJA A;  2HVQ A;  2OAZ A;  3OYF A;  1R5I D;  3LST A;  1XS9 A;  4OMY A;  1RNL A;  3TQN A;  5J1Y A;  1F1Z A;  3OYB A;  5BPI A;  4CIC A;  1HA8 A;  1MMD A;  2FBH A;  2D1H A;  3S3N A;  5IYD J;  2XB5 A;  1HDD C;  3A03 A;  3TDZ C;  2F4O B;  1GXP A;  1Z91 A;  4IHX A;  5IP9 J;  1LB2 A;  1OYY A;  4M9Z A;  1BC7 C;  3LSG A;  4MHG A;  5A2Q K;  2O8X A;  4XRS A;  4ZTF A;  1B72 A;  2E1M B;  2L9N A;  3C1D A;  5LHG A;  1QVT A;  3ZMD A;  1IDY A;  2QEX I;  2M7B A;  3F8B A;  4ENM A;  1RET A;  1YTY A;  2VC0 A;  2R5Y A;  3W3C A;  2V1N A;  1BI0 A;  2ZME B;  3FXJ A;  3ZQC A;  4C3J J;  3K69 A;  4A5N A;  2QSF X;  1BI2 A;  4GDF A;  1SFO J;  3CCE I;  2OD5 A;  3CES A;  1ZHF A;  3BCB A;  1TW3 A;  4RAZ A;  2EZI A;  2ZJQ F;  1UST A;  4GCV A;  4NC6 A;  1YW7 A;  1XTA A;  4RDU A;  2JPB A;  1U0J A;  5D5W B;  2XAF A;  4YII A;  4ZYG A;  3DEE A;  5DUI A;  4MFE A;  3ZQH A;  3JR9 A;  3FKJ A;  4EQQ A;  1MDM A;  1LDD A;  2ZKZ A;  3ZR8 X;  1KQ8 A;  1FEX A;  5EEA A;  3T8T A;  1PUE E;  4U0Y A;  3BZK A;  5HDN A;  2L9R A;  3ASO H;  3SYT A;  1EH7 A;  2I10 A;  4A3J J;  5F1R A;  3L09 A;  5BPD A;  1ZKG A;  3FX3 A;  3SFZ A;  2JJ7 A;  2Z2S B;  1IGN A;  2E1M C;  2DMP A;  4L9V A;  5FRO A;  1T0F C;  2PEX A;  5GPA A;  4RB3 C;  2B9S A;  3I58 A;  1KA8 A;  3F0C A;  5K7H A;  2ELK A;  2ACJ A;  2MA3 A;  2VBZ A;  3A1Y A;  2WB1 N;  2IJL A;  4BE0 A;  4Y4R A;  1HQC A;  2ZME C;  4E4H A;  1FOX A;  2G7U A;  2Q2E B;  2VBY A;  4G12 A;  1YJW I;  3TKY A;  1C0W A;  2FA5 A;  4AVP A;  5B3S H;  3QRF F;  3A4C A;  3BCA A;  2X51 A;  3FMS A;  2JVH A;  4MEY F;  4C9Y A;  1IN4 A;  2XRN A;  4AUX A;  3JRD A;  4EJU A;  4FX0 A;  1MBJ A;  6PAX A;  2R7V A;  2IGO A;  2NS7 A;  2M34 A;  2LFB A;  4RGS A;  2EIL H;  4O5V A;  4I6Z A;  2O61 A;  3A01 B;  4XON A;  3JRE A;  1FBU A;  3HSE A;  3K4K A;  4A3K J;  4Q47 A;  1ZN2 A;  2H8W A;  2YUS A;  4BHP A;  1UFM A;  1FIP A;  1U8B A;  4DZP A;  3S3M A;  1FY7 A;  2ID3 A;  3BR0 A;  3VDX A;  1K4S A;  3R61 A;  3HOX J;  2DOD A;  1KGS A;  4EMS A;  1JJ8 C;  2JA6 J;  3KLO A;  4V2F A;  4BQN A;  3EUA A;  2CUZ A;  1AU7 A;  2R0Q C;  3OY9 A;  2M4K A;  2BE5 F;  4BU2 A;  3GTO J;  3I71 A;  3K2Z A;  4GXO A;  2DO7 A;  1Z6R A;  2KRH A;  4BDZ A;  2IGN A;  5M5W J;  1F36 A;  1YIO A;  5E3O A;  2CO5 A;  3QPL A;  3KX2 A;  4E6K G;  4O3M A;  1KYZ A;  3GCM A;  4QSH A;  3JRF A;  3PNY A;  4RBO A;  2EA4 A;  2LK2 A;  1R4N B;  1QZE A;  2GWR A;  5AIQ A;  5FLX Z;  2KZV A;  1KU2 A;  3CMA I;  4XLF A;  4IQ4 A;  3EQL F;  2OV7 A;  2QVO A;  2RAE A;  2WA0 A;  3OOP A;  4F7Z A;  3JSO A;  2JN6 A;  1Y8R B;  1UEL B;  2KPM A;  5B1B H;  5D6F A;  3CCR I;  1T0F A;  3F9K A;  4HLX A;  1FYL A;  4HST A;  4DYQ A;  1DP3 A;  2L9V A;  3R0A A;  1Y0U A;  1R5H A;  2ZFU A;  3VB2 A;  3PQK A;  4IHT A;  5M5X J;  4IF4 A;  4EVI A;  3K4B A;  2W57 A;  2ZME A;  4QTR A;  2VI6 A;  3RDI A;  3IHU A;  5KAF C;  2LYC A;  1FOW A;  3HRM A;  4M3F A;  5F6F A;  2NVX J;  3CDI A;  1HKT A;  4A6E A;  3HOS A;  3H9G A;  1J09 A;  3W2A A;  4MQV A;  2NNN A;  1I5Z A;  5KK1 A;  4EJV A;  1JKP C;  2G9W A;  2P8T A;  4BJT A;  2FXA A;  1IV6 A;  3OWT A;  1Y0N A;  5IY5 H;  1OYI A;  4XRM A;  1QHH D;  3MKL A;  3PL8 A;  1MKM A;  5EZH A;  1W5T A;  1NTC A;  1XGS A;  2QCO A;  3Q3S A;  2DT5 A;  4I0B A;  3TDU C;  2BHY A;  3V7S A;  2HXI A;  3GFI A;  3TMO A;  1JKR C;  2CWE A;  2WV0 A;  3BT9 A;  3H9J A;  1OCC H;  3P7N A;  5JHU A;  2TRT A;  2HPM A;  4R8H A;  4RLQ A;  1R6R A;  1YYV A;  3TOA A;  4DJA A;  1XDU A;  4EAT A;  2JMW A;  3V8K A;  5ILV A;  2OZU A;  1MJB A;  3BOQ A;  1FYM A;  1YIT I;  3GVA A;  5EF6 A;  4OOI A;  4QLC U;  1BIA A;  3LSK A;  2LC2 A;  1RES A;  2RQP A;  2YPR A;  3NEU A;  5HOD A;  2Y9Z A;  3K1P A;  2Q2E A;  5EG0 B;  1OCZ H;  4RLF A;  1U6G A;  1LKX A;  1K79 A;  1SVL A;  5CVV A;  3CCM I;  5BNG A;  4ZZL A;  2LNB A;  2VPR A;  3KEQ A;  4ZYD A;  4XN3 A;  1S3J A;  1MH3 A;  4NQW B;  2RVC A;  1FC3 A;  4U88 A;  4D1Q A;  3HG9 A;  1UB9 A;  2X9D A;  4LLL A;  3QU3 A;  2VBW A;  3A01 A;  3K70 C;  5GPC A;  2R7S A;  1G3W A;  4X6A J;  4YIR X;  4I09 A;  1GXQ A;  5D6E A;  3SZG A;  2NAZ A;  4BJ6 C;  2DI3 A;  2GOM A;  2OTJ I;  3A0H C;  2CMP A;  1XSD A;  1USS A;  3KYC B;  1JHF A;  4A0X A;  3SEZ A;  1FJL A;  4ZJZ A;  3L2U A;  4I98 B;  1ZRF A;  1MJA A;  1X2M A;  2WBM A;  1VF9 A;  5K7Z A;  4XN0 A;  2A68 F;  2LY2 A;  3DPU A;  5CPR B;  1PDN C;  3Q0U A;  3VSL A;  4RGU A;  2RDP A;  3C2B A;  3CJT B;  4UB6 C;  1IC8 A;  2UWM A;  2CFO A;  3WG7 H;  1R9T J;  1VQ4 I;  5L3B A;  3V7R A;  3OYE A;  4IRG A;  3GTP J;  5CLS A;  4L5I A;  1GUU A;  1LFU P;  2VQC A;  1WJE A;  2EH3 A;  2PMZ A;  3D5L A;  2NOG A;  3DTI A;  5J1U A;  5GAH J;  2PJR B;  3CLQ A;  1VQ7 I;  4KDP A;  2AS5 F;  1W5S A;  3C2G A;  2IBD A;  3OYA A;  3JTG A;  2ESN A;  3OYN A;  3RKW A;  4Y17 A;  4G7H F;  4XM3 A;  4YEL A;  4R1H A;  2LD5 A;  4JBA A;  1HOM A;  4LG0 B;  2QA4 I;  3MEX A;  3K4L A;  1JT0 A;  3OYH A;  4O6J A;  3T5X A;  1Y1V J;  4XK4 A;  3BDD A;  4FX4 A;  2OCC H;  3RJP A;  3GME A;  3GO5 A;  4M72 A;  4DIQ A;  2H1K A;  1Y6I A;  4ZDL A;  2Z99 A;  1W0T A;  1XSX A;  1X3W B;  3HOV J;  1B1B A;  2V6C A;  1YHQ I;  2QZ8 A;  1G3T A;  2YU9 J;  1WJ5 A;  4ANJ A;  3IV5 A;  1HKQ A;  3CCL I;  3RTR A;  2XF7 A;  2KL4 A;  3CP2 A;  5L3E A;  4CO8 A;  4F93 B;  3SHF A;  3VPR A;  1X1D A;  1Z3Y A;  3BC8 A;  1V5E A;  3PFI A;  5JR3 A;  2CFX A;  4PJJ A;  2HDC A;  3VYR B;  2O5R A;  3P9C A;  2XAJ A;  1WCM J;  4PGH A;  2F48 A;  2QQ9 A;  4KN4 X;  3SZP A;  3ZN0 A;  1W7P D;  1I6X A;  1L0O C;  5E3L A;  1JXS A;  2VJI A;  5F27 A;  2FU4 A;  3QPS A;  4UHT A;  5JVG F;  1MBG A;  2GLO A;  3ZCO A;  3F6V A;  1MBF A;  3HYI A;  2XAU A;  4NUB A;  2A69 F;  4OAZ A;  1JI8 A;  4B44 A;  4HRI A;  2JTV A;  3UNG C;  3JRG A;  4IPA A;  4KMU X;  3REO A;  5LD2 C;  1DQU A;  4BE1 A;  1XCV A;  4CGZ A;  4UUT A;  1IG7 A;  1ODD A;  2ID6 A;  3F8C A;  3F8M A;  4A3F J;  4XL9 A;  2OQG A;  4HF1 A;  4HX8 A;  3PQJ A;  4KIC A;  4M74 A;  3RPQ A;  2BY2 A;  2KFD A;  2CV2 A;  4LK1 F;  2FOK A;  1RUN A;  4HF2 A;  3F8N A;  1IN8 A;  1H89 C;  3HOU J;  3ELK A;  1FTZ A;  2M0C A;  3WU0 A;  5LGT A;  2L5Q A;  4A3I J;  2FNP A;  2KIF A;  2Y0M A;  3WGI A;  1MMA A;  3MWM A;  2BVL A;  4AIK A;  5EG0 A;  5LHH A;  4EV0 A;  3CC7 I;  2QM3 A;  3O3K A;  2E71 A;  2NVT J;  1HLV A;  2DTZ A;  1YX3 A;  1V5F A;  1ETO A;  3GZ5 A;  1Z21 A;  4XQF A;  5BOX A;  1B8I B;  2FNA A;  1N78 A;  4I99 C;  4WX9 A;  2JUC A;  2R93 J;  2L4M A;  1J2X A;  4NQW A;  3L7W A;  5EEH A;  4XLH A;  2CG4 A;  1ZG5 A;  4PZJ A;  4LJZ F;  1WPK A;  2VOP A;  3J81 K;  2WAD A;  1WJF A;  2FMY A;  4LB6 B;  2MD0 A;  2E2J J;  1ETQ A;  5J4Y A;  3JRH A;  4E7J A;  1P6R A;  1YS6 A;  3LA3 A;  3HTU A;  4KT5 C;  4W1U A;  2CUF A;  3PNV A;  1U78 A;  2K4B A;  5DM6 F;  3CQZ J;  1VQK I;  1RKT A;  1B9M A;  5M3F J;  3CTA A;  1RPW A;  1KU7 A;  5B66 C;  3JSP A;  4A3G J;  1X3Z B;  2ECC A;  4II2 A;  3KZI C;  1K78 B;  1I50 J;  2ZXW H;  5HS9 A;  4BHC A;  3O8G A;  3OYI A;  2C6Y A;  1SD5 A;  3B73 A;  1TWC J;  2V4J C;  3ZMV A;  2B7E A;  3WTT C;  3TO7 A;  2V26 A;  2PI0 A;  2DAO A;  4FCY A;  5M5Y J;  1UCR A;  3RPU A;  3S16 J;  1YFH A;  3GTK J;  5H20 A;  4FHT A;  5ICE A;  2PJR A;  1ZGA A;  2HOS A;  3QWL A;  1ACI A;  3R4K A;  1TQM A;  1W0U A;  1QPI A;  2ELH A;  2PG4 A;  2MC4 A;  4F55 A;  4ZYE A;  2LLK A;  3QP5 A;  2E1N A;  4EM0 B;  1B4A A;  1WJD A;  2BVM A;  1TBX A;  2IEK A;  4LG0 A;  1MMG A;  5L3F A;  4LMY A;  4CXF A;  3CP8 A;  4BXX J;  3P5J A;  4IOC F;  1F5T A;  4A93 J;  1T39 A;  5J8C A;  1G4D A;  3K10 A;  2DLL A;  3MMY B;  2KZG A;  3AG3 H;  5JHF A;  1XN7 A;  5FKN A;  2VC1 A;  3HSF A;  3FXO A;  4KYW A;  1ENH A;  2ZXH A;  2Y31 A;  1X1C A;  1SFE A;  4HOB A;  2HU9 A;  4M73 A;  2VXD A;  5ED4 A;  3WHC A;  1MNM C;  2O3F A;  3GTJ J;  3AG2 H;  3IWF A;  3SQN A;  5JVT A;  3VOD A;  2X1C A;  3FXR A;  3H5R A;  3M7G A;  5HVQ C;  5FLV A;  2P81 A;  2PN6 A;  2W1O A;  3ECO A;  2STT A;  4AU7 A;  3O6B B;  3SXY A;  5IT3 A;  2FEZ A;  2DA2 A;  3HBL A;  3K0L A;  1A04 A;  2JRM A;  3ZRG A;  2BBY A;  3BTI A;  2VE9 A;  2XSD C;  3HPH A;  3HM5 A;  1YE9 A;  2KHM A;  1KU3 A;  1SVM A;  5DV5 A;  3WU1 B;  1V54 H;  2F5F A;  2TDX A;  3BZC A;  3DCF A;  3DEU A;  3NWT A;  3ZMS A;  1ZG1 A;  1E3O C;  1Q1V A;  2XGD A;  2H1L A;  4ENN A;  3PIO F;  4A2U A;  3HB9 A;  1FSE A;  1TW2 A;  5ICF A;  1D3Y A;  1D0Z A;  4HNT A;  3V7C A;  4IEJ A;  2FD5 A;  3PNT A;  2VON A;  2HTJ A;  4XBF A;  1A6Q A;  1Z7U A;  5KNL A;  1NH3 A;  5E1X A;  2D45 A;  3E5Q A;  1SD7 A;  3W2W A;  3S3O A;  2BGC A;  2MAB A;  5IT9 K;  5E18 F;  2ZB9 A;  3HHH A;  2XAS A;  1TT5 B;  2ETH A;  1U5T B;  2ZCW A;  1TLH B;  4XKV A;  1NHA A;  2BYV E;  3ZMT A;  2XF6 A;  4G94 A;  1B8I A;  2L7M P;  5BMZ A;  1BR1 A;  2RN7 A;  2ZBK A;  4GGG A;  1FMV A;  3CDL A;  5GAD J;  2ADU A;  2L4A A;  3ECH A;  4G9Y A;  2WC2 A;  2ZSI B;  1R71 A;  3RKQ A;  4FIS A;  3ESW B;  4DOZ A;  1PYV A;  5J6X A;  5K5Q A;  3V8J A;  5HS7 A;  3S17 J;  1IZ1 A;  1ZGJ A;  3VEP A;  4NC8 A;  4DBQ A;  5FB2 A;  1ZTR A;  1T2K A;  2OPT A;  1R5G A;  3BG5 A;  4P1W A;  2BY1 A;  1ON2 A;  1RKW A;  3ABK H;  1J59 A;  3ABT A;  4OU0 A;  2BW3 B;  1ONV A;  5EZG A;  2R7T A;  2J5P A;  1K78 A;  1ERD A;  4XID A;  2EK5 A;  2X6X A;  3J7Y J;  2AQF A;  2DA4 A;  2GA2 A;  2A5Y B;  4B8X A;  3T0Y A;  1RI7 A;  3I0T A;  1OLT A;  3KEY A;  4I0A A;  3ZQI A;  4IHY A;  1OMI A;  1U5T C;  2H6B A;  4DYR A;  5DCM B;  4U0W A;  4E7I A;  1W4M A;  1PUF B;  2PMU A;  1TZL A;  5LGU A;  1VQ6 I;  2XC7 A;  2DT7 B;  3OL3 A;  4F91 B;  1I3Q J;  1JKQ C;  2NVU B;  4LOC A;  1BL0 A;  3ERM A;  3OIQ A;  3CJN A;  1UG0 A;  2XKP A;  1FTT A;  4UXN A;  1DU0 A;  1ON1 A;  2MH9 A;  5C4X J;  2R7U A;  3LSR A;  4RB0 A;  1DPU A;  3A02 A;  2GQQ A;  2OF7 A;  1ETW A;  2HPI A;  4BY7 J;  4I01 A;  2LKX A;  1FLI A;  2VJJ A;  2Z3Y A;  2HOT A;  4XSX F;  3BR6 A;  1WVR A;  2DA3 A;  2F4M B;  2VJ4 A;  2XAQ A;  3JTH A;  5AIP A;  1RUO A;  2KIM A;  4LB5 A;  3VYU B;  1X4O A;  4JX5 A;  3LQR A;  3FDY A;  1LDK B;  4Z6Y A;  4KIT B;  4I02 A;  5HOO A;  4N9I A;  3OS0 A;  4XLN F;  4N0B A;  1U2W A;  2M87 A;  1O3S A;  4UV8 A;  1FBQ A;  1WQ2 A;  2OUM A;  3FHN A;  2P5L C;  1A5J A;  1I1G A;  2WTE A;  1SFX A;  3LSI A;  1BOB A;  3HC7 A;  2E7X A;  4DGW B;  5HLH A;  2QQB A;  4A12 A;  4DBR A;  3RZO J;  5F04 A;  3TBI A;  4A3E J;  1IO2 A;  5KHD A;  1E0E A;  4E70 A;  2VQH A;  2YR2 A;  3KPH A;  2K9S A;  2LSO A;  1IRG A;  2L01 A;  1O3R A;  3OYJ A;  3LOC A;  4KUM A;  1E2X A;  4CCL A;  5JI6 A;  3OYD A;  1AKH B;  1QRY A;  4RM3 A;  3FBI B;  1MD0 A;  2FRH A;  2H94 A;  2K9Q A;  4HW0 A;  3OS1 A;  2JZY A;  5AON A;  2EV0 A;  3L2Q A;  2ZJP F;  1UHS A;  3G6E I;  1Y1W J;  3HOW J;  2Y48 A;  3QU6 A;  1FNN A;  3PO2 J;  3ULQ B;  3SDB A;  4HQE A;  3I64 A;  1ETK A;  2LF7 A;  5D5V B;  2QQ8 A;  1U5T A;  2EV6 A;  1D8K A;  1S7O A;  4G6Q A;  4WCG A;  3BZ6 A;  2MGQ A;  3U2R A;  3AFH A;  2R7Z J;  1BIB A;  2D1V A;  3DPT A;  5IP6 A;  3BJA A;  1MMN A;  1X58 A;  3KP7 A;  2JUG A;  4CZC A;  2HDW A;  2CQ7 A;  2IAI A;  3NWS A;  3NRV A;  3DF8 A;  1G8X A;  3PSI A;  3BR1 A;  4GYG A;  2VOD A;  3DBH B;  4BUP A;  4UUS B;  3J7A O;  2KJB A;  1UZC A;  2DW4 A;  4QWQ A;  4RGX A;  1MBH A;  4J19 A;  1T8I A;  3FBN B;  1ITY A;  3FIW A;  3HIF A;  5F0H A;  3ROU A;  4JX6 A;  2V7F A;  5IYB J;  2KMU A;  2QGU A;  4CCM A;  1IW7 F;  2BW3 A;  2W48 A;  2A05 A;  2R7D A;  1MSF C;  2DYS H;  5KAI C;  1K6Y A;  1WI3 A;  4YEJ A;  3ERE D;  4HG2 A;  1MNE A;  2EBI A;  3WGG A;  4FE4 A;  3BTJ A;  4Y13 A;  2OCE A;  2WY7 Q;  1HF0 A;  4PCQ A;  5JLX A;  1I1S A;  2W7N A;  4N9H A;  4PSX A;  3E6B A;  2DTR A;  5DCM A;  5E20 A;  1O4X A;  3K7A J;  2DT6 A;  3UR3 C;  2E1O A;  1PUF A;  5LRR A;  4KIF A;  2DA1 A;  1IDZ A;  2ZFW A;  5E8G A;  1V5G A;  1A35 A;  3FXL A;  4OIP F;  2PX9 A;  1T6S A;  4HDU A;  1S9H A;  2F4I A;  3Q9V A;  4HPQ A;  2A07 F;  3M3Y J;  1RR7 A;  4E7S A;  1JHH A;  3SJM A;  1WGX A;  3IAS 2;  1YI2 I;  2GA1 A;  3HHG A;  5B1A H;  1D5V A;  2X6O A;  2DJN A;  1RRJ A;  2E2H J;  4U7B A;  1GV2 A;  3ABU A;  5CVI A;  1DUX C;  1Z6T A;  2CW8 A;  2ME6 A;  4AD9 A;  1N77 A;  5HLI A;  4Y3O A;  3CF2 A;  3KEO A;  1OJL A;  3DU6 A;  4HA8 A;  4NDL A;  1OCP A;  3J7Z I;  1SAU A;  3DKY A;  3M07 A;  1YOV B;  5CQG A;  1I27 A;  1TWA J;  4CHU A;  1QZZ A;  3WOD F;  4YFX F;  1LE8 B;  1GV5 A;  1PP8 F;  9ANT A;  3RCO A;  5K5R A;  2CUE A;  1O57 A;  3QYF A;  4IHS A;  1PP7 U;  2J5O A;  2HNH A;  2KDZ A;  4UY8 I;  3GXO A;  3RYP A;  1ZQ3 P;  4KIG A;  4L5E A;  5B5E C;  3BG6 A;  3QOD A;  4D5C A;  1JGS A;  2FOW A;  2RRE A;  5BS6 A;  1X19 A;  2JWT A;  2FF4 A;  2UV1 A;  3C7J A;  3TO6 A;  3HJE A;  2ZSH B;  3K2A A;  5FFZ A;  4WXH A;  3HUG B;  4ENJ A;  1SD6 A;  1AKH A;  4XLA A;  5F64 A;  1U8R A;  4HAM A;  3MFK A;  2M0M A;  4M3B A;  2MBF A;  4EEF G;  1WHU A;  2VXZ A;  3A2K A;  4LLG F;  2XAH A;  1V4R A;  3OR1 C;  4B3A A;  2VB6 A;  4BBR J;  3BJ6 A;  2HVR A;  4LK0 F;  5HNH A;  3WTW C;  3AG1 H;  4ZYA A;  4X0G A;  3MD2 A;  3QOP A;  2A61 A;  2X48 A;  4I2O A;  4L9J A;  4XKC A;  4UV9 A;  3D0S A;  3QAH A;  1FWZ A;  2LRD A;  1NG6 A;  2P5K A;  1Z9C A;  4BEH B;  5KVR A;  3S8P A;  3KP4 A;  2GM4 A;  1R58 A;  3KZZ A;  4ESJ A;  1S8N A;  2MD5 A;  5E8I A;  4UUS A;  4GRI A;  4EM2 A;  1OQY A;  3HGY A;  2V1D A;  5LHI A;  2Q8K A;  5DDG A;  3AL0 B;  3OS2 A;  1A31 A;  3CUO A;  4RB1 A;  4MNU A;  4GFB A;  3VSK A;  4CA0 A;  3FXK A;  5HLT A;  4AM3 A;  3WTZ A;  2FX0 A;  2OC6 A;  2LH9 A;  4XRS G;  2R3S A;  3PM1 A;  4A0Y A;  2JSC A;  1YX5 A;  1EH6 A;  2CS3 A;  1SFK A;  1S72 I;  4I76 A;  3Q5F A;  1TWG J;  1NG7 A;  3KCC A;  4PK4 A;  3ZXS A;  4EJO A;  2L2O A;  3M4O J;  3OR2 C;  3DKX A;  2LG4 A;  4CUG A;  3ZQQ A;  2ZO4 A;  1YO5 C;  4YG2 F;  3CCS I;  3C2H A;  2DFI A;  3LSJ A;  5ERI A;  1SC7 A;  4BH9 A;  3BPX A;  4BXU A;  3C18 A;  3GLL A;  1VQ5 I;  2OTL I;  1DPR A;  2DMT A;  2EZK A;  3QPT A;  4DYC A;  2EJR A;  3V42 A;  4WK8 F;  2DDA A;  2WWY A;  3RZD J;  1UG2 A;  2QSG X;  3JRC A;  2NS8 A;  3GZ6 A;  4PGG A;  1IXS B;  4G7O F;  1Z1D A;  4PJN A;  1XMA A;  2YSR A;  3PUF A;  3IRR A;  1W36 C;  2NVY J;  1O7F A;  2PMH A;  3U1D A;  3GW2 A;  3IP4 B;  3AL0 C;  2RV8 A;  1EV7 A;  2R7X A;  5FFX A;  1R7J A;  2PJP A;  2IRF G;  4B48 A;  1RC9 A;  3N97 A;  2HS5 A;  2Z1D A;  4HYE A;  1R4M B;  1SMY F;  2V1X A;  1T95 A;  2ZXI A;  1MH4 A;  2W24 A;  4LLN A;  5GTH C;  1BC8 C;  3ZQ7 A;  2A5W A;  2LKP A;  4IQJ A;  5DTD A;  1Y39 A;  3M1E A;  4Y52 J;  1JUS A;  1V55 H;  4DW6 A;  2I8D A;  1LE8 A;  1G59 A;  4RB2 C;  4DNC A;  2ICW G;  4FQG A;  1MBE A;  1IAW A;  1DGR M;  3S1Q J;  2E35 A;  2K3F A;  2ME0 A;  2NXN B;  2V9P A;  3BLY A;  3KYD B;  3ZOB A;  4AIH A;  5FO5 A;  1TC3 C;  3TED A;  4IX7 A;  4B4C A;  2F5D A;  4MGR A;  2UZK A;  4RAY A;  5DD8 A;  4QPQ A;  4M3D A;  3HRS A;  1WI9 A;  3ABM H;  3BG3 A;  2L9S A;  1IUY A;  3ZPL A;  3FXM A;  1A36 A;  2XGE A;  3BY6 A;  2EIN H;  1TNS A;  2X1D A;  3IUO A;  4JK1 X;  4P5O A;  1QBJ A;  1DP7 P;  1FBS A;  3WG9 A;  3S1R J;  2P6T A;  3W6V A;  3I4M J;  1LDJ A;  4FTH A;  2GOX B;  1BJA A;  3MZY A;  2EFP A;  1LPQ A;  3HUG A;  2IS2 A;  4X1E A;  1GHC A;  2XVC A;  2BOL A;  2HR3 A;  2RNG A;  1BJZ A;  3V8L A;  2GIZ A;  2K85 A;  3ZMU A;  4UNO A;  1GVD A;  2IGM A;  5FLX K;  2KIU A;  3VYT B;  1SD4 A;  2K9L A;  1TL8 A;  3BWG A;  3F21 A;  4CCK A;  4FT8 A;  1K83 J;  2NVQ J;  2NYX A;  5TRD A;  5EJC A;  2M1B A;  2FUG 2;  3WE3 A;  1OPC A;  3I4N J;  3HTS B;  2IA2 A;  3BG9 A;  1FT9 A;  4RAG A;  4XOP A;  3R6S A;  3DFG A;  3QQA A;  3QOE A;  5D8L B;  3E97 A;  2ZNY A;  4BEH A;  5D4R A;  2BEO A;  4QIW N;  4OAY A;  3H0D A;  4XLE A;  5FD6 A;  3CC2 I;  3ONQ A;  2QKM B;  4W97 A;  3H3V K;  2W25 A;  3WTV C;  4YFK F;  2G0E A;  3L2W A;  1IV8 A;  2PFB A;  1IXR C;  4MLO A;  3HRU A;  5H6Q A;  3RIR A;  4M9S A;  3RYR A;  4AWX B;  3SZT A;  3FMQ A;  1KON A;  2VKD A;  1STZ A;  2XF5 A;  4KFC A;  1KQ9 A;  4KA4 A;  4ZTJ A;  2M4G A;  2KIQ A;  4IXA A;  4AYB A;  5LBQ A;  2Y0S A;  5DS9 A;  4XKW A;  4Q5S F;  2DMQ A;  1KQ0 A;  2YX7 A;  3G73 A;  3KP3 A;  2UUZ A;  3MKW B;  2RNJ A;  2ZJ2 A;  3OYL A;  3HKZ A;  2PMZ N;  4NBQ A;  3CME I;  1IN5 A;  2QLZ A;  4BQA A;  2HQR A;  2QYO A;  4HX7 A;  2VPL A;  2F5E A;  2MLG A;  4GO1 A;  3KIO A;  4LIU A;  4UVB A;  3GBG A;  1S7E A;  1BOA A;  1ZRD A;  2HQ5 A;  1YQA A;  2EIM H;  3JAM Z;  2DOE A;  3K70 D;  1OR7 C;  2K27 A;  4HF0 A;  3TOB A;  4I7H A;  3S1M J;  2HTS A;  3I3L A;  3R0J A;  4HSR A;  4MQ9 F;  1JUP A;  3JCU C;  3CCY A;  3BR3 A;  2O03 A;  3W6K B;  3HRT A;  3WTY C;  3KP6 A;  3GYH X;  2VKH A;  1EF4 A;  2XPW A;  3EYI A;  1RZ4 A;  3OOU A;  4G6T B;  5M3M J;  1BN5 A;  5EYR A;  1D1A A;  3DQV C;  1ZAO A;  3G1M A;  5LEK A;  3GTQ J;  2VT2 A;  2P7C B;  1HW5 A;  4D9J A;  5LRS A;  3J7A Y;  5TIS C;  3BQZ A;  2DU9 A;  3M1C A;  4A3B J;  1YW9 A;  2HYJ A;  3BTL A;  4Y33 A;  2ELJ A;  3GTM J;  2M7A A;  4M9X A;  4U0V A;  4P9U A;  1WH5 A;  2JVG A;  3OIP A;  2BY0 A;  2LP0 A;  4BAC A;  1APL C;  5C4J J;  1U9N A;  5IPA A;  1XMX A;  1M1E B;  2R4G A;  1Z05 A;  2DK8 A;  3FZV A;  5F08 A;  5H6R A;  3G4S I;  1YRN B;  3GLX A;  4II3 A;  3PIP F;  3W6J B;  2F5C A;  3HL2 A;  4UUV A;  3OSG A;  4KNY A;  1HDP A;  3CMY A;  1T33 A;  2IS6 A;  2LDU A;  4PFP A;  4S05 A;  1VQ8 I;  3DLA A;  2CQK A;  1KZH A;  2HZD A;  3CZ6 A;  2X6W A;  3T1B A;  2QQA A;  2QSH X;  4AYB N;  1UJ8 A;  5E1W A;  2Y0S N;  3AG4 H;  2GXA A;  2CH0 A;  3EYY A;  2BZT A;  2CV0 A;  2EIJ H;  1ZLK A;  2E36 A;  1OIS A;  2QEN A;  4BQO A;  3HKZ N;  3M8E A;  4G6D A;  1D0X A;  1OR7 A;  2XGX A;  3RPU D;  1E3P A;  2P7V B;  3KET A;  2IP2 A;  1HKS A;  3B02 A;  5FLM J;  2FBI A;  2MC3 A;  3E5X A;  2CV1 A;  1X4P A;  1H0M A;  2R7Q A;  2CYY A;  1FX7 A;  1Y8Q B;  2O0Y A;  1OKR A;  2HOA A;  3VYS B;  5EGO B;  4L9T A;  4C3H J;  1QVU A;  3OSF A;  2OJE D;  4IO9 F;  3CJQ B;  1IF1 A;  4IRH A;  2IT0 A;  4S0H B;  3LWF A;  2H27 A;  2R5Z B;  1HST A;  2HQA A;  4ON0 A;  2LTP A;  4IOA F;  3FIS A;  2COB A;  4BKX A;  1D1B A;  5FD5 A;  1WJB A;  3UKG A;  3I5U A;  4HNV A;  2DDB A;  2HKO A;  3HSR A;  1X1A A;  3TP0 A;  4A3D J;  4BNC A;  2WV1 A;  2X0L A;  1RIO H;  4OWR B;  4HX4 A;  1MIJ A;  2L54 A;  3EPZ A;  3CLO A;  2E5N A;  5IOZ A;  1JT6 A;  5E1Z B;  2LBF B;  3K4J A;  2M5W A;  1X3U A;  3GWZ A;  1BM9 A;  1ZLJ A;  1PVE A;  4HBL A;  1P7I A;  2XHK A;  3IKV A;  1UHW A;  2RKH A;  3CCJ I;  2YX4 A;  4NB5 A;  2NOJ B;  4BYY A;  5FKO A;  1XGO A;  5ILU A;  3O2P E;  2HI3 A;  3F6O A;  3LSM A;  2DPU A;  2RQQ A;  2WAE A;  5LFA A;  3HZJ A;  1JTY A;  1MSE C;  4BQQ A;  2IGK A;  4BHB A;  4ZZD A;  1LFB A;  3IAM 2;  1TTY A;  3HDD A;  4HLY A;  2Z16 A;  1QQI A;  4IVN A;  4XR6 A;  4N4O B;  3I56 I;  3TO9 A;  4WXD A;  1IXC A;  2HGC A;  5E3M A;  4BXF A;  3J80 Z;  4L18 B;  2L7Z A;  3G2B A;  3E3V A;  4EJW A;  3K6G A; 
#chains in the Genus database with same CATH homology
 1FJL A;  3M3Y J;  4Y7N J;  2E19 A;  2DMN A;  4A3C J;  1RR7 A;  1X2M A;  1VF9 A;  3SJM A;  1WGX A;  2MW8 A;  5K7Z A;  3HGG A;  3L1P A;  2X6O A;  2DJN A;  2K40 A;  2XPV A;  3Q0U A;  1Z0X A;  2E2H J;  1GV2 A;  1SAN A;  2CJJ A;  3C2B A;  2H8R A;  1IC8 A;  3JRB A;  1D5Y A;  1YRN A;  2ME6 A;  1R9T J;  3GTP J;  2O7O A;  3HEF A;  5F0F A;  1GUU A;  1OJL A;  2MG4 A;  2QF7 A;  1LFU P;  4NDL A;  2EH3 A;  3B6C A;  1OCP A;  2NOG A;  2FJ1 A;  5J1U A;  1AHD P;  1TWA J;  2IBD A;  1GT0 C;  1LE8 B;  1GV5 A;  1TWF J;  2JA5 J;  1JUM A;  9ANT A;  2CRG A;  2CUE A;  2LD5 A;  3TW7 A;  1HOM A;  1OFC X;  3TP3 A;  3ZQG A;  1JT0 A;  2KDZ A;  1Y1V J;  4XK4 A;  2Y9Y A;  3HOZ J;  3O8H A;  1ZQ3 P;  2LY9 A;  2Y2Z A;  2H1K A;  4L5E A;  3FK7 A;  5IOY A;  3S14 J;  1W0T A;  1ZK8 A;  3HOV J;  4D5C A;  2YU9 J;  1BW6 A;  2EZL A;  4AC0 A;  3IV5 A;  3S15 J;  2KT0 A;  2JWT A;  3HOY J;  2CU7 A;  2JK3 A;  3K2A A;  1G2H A;  5GP9 A;  3VPR A;  2FQ4 A;  1AKH A;  3JRA A;  5EGO A;  4M3B A;  4EEF G;  1B72 B;  1WCM J;  2E2I J;  4IHW A;  1BA5 A;  5E3L A;  4B3A A;  4BBR J;  5F27 A;  3QPS A;  1MBG A;  2R5Y B;  2GLO A;  2R5Z A;  1MBF A;  1CQT A;  2X48 A;  2R92 J;  4MIM A;  3JRG A;  3S1N J;  1XG1 A;  4UUT A;  1IG7 A;  2ID6 A;  4A3F J;  3RQI A;  3OIO A;  4BBS J;  4A3L J;  2GM4 A;  5E3N A;  2LVS A;  2HDD A;  5IYC J;  2AHQ A;  1H89 C;  3HOU J;  4UUS A;  1FTZ A;  2M0C A;  1TWH J;  3HGY A;  5F1J A;  4A3I J;  1GDT A;  2GBY A;  2DA5 A;  5EG0 A;  3BTC A;  4GFB A;  2L0K A;  2B63 J;  1WH7 A;  1ETV A;  2NVT J;  2FX0 A;  2XB0 X;  1BW5 A;  4XRS G;  3PM1 A;  2DTZ A;  1IUF A;  1HLV A;  4ABZ A;  1H88 C;  2HXO A;  1ETO A;  4D7N A;  2XPU A;  1B8I B;  1JJ6 C;  4I76 A;  3Q0V A;  2R93 J;  1TWG J;  2DN0 A;  1POG A;  3M4O J;  1WPK A;  2YS9 A;  4IHV A;  2E2J J;  2VUM J;  3FKI J;  1ETQ A;  2N8G A;  3JRH A;  3LSJ A;  3G1O A;  2WAQ N;  4W1U A;  5C3E J;  2CUF A;  1U78 A;  3CQZ J;  4BY1 J;  2DMT A;  2EZK A;  1RKT A;  3B6A A;  1JTX A;  4V2G A;  4DYC A;  5M3F J;  3PO3 J;  3BR2 A;  2M8G X;  1UG2 A;  3NAR A;  3RZD J;  2M2E A;  3GTL J;  3JRC A;  1RPW A;  2NS8 A;  5F0C A;  4A3G J;  2ECC A;  1K61 A;  3TW6 A;  2MSY A;  4D5F A;  1I50 J;  2VKE A;  2CQQ A;  1T56 A;  2NVY J;  2Y30 A;  2EZH A;  5J1R A;  1VI0 A;  3O8G A;  1TWC J;  4XIC A;  4FE7 A;  2JA7 J;  4FCY A;  2L7F P;  5M5Y J;  5FJ8 J;  5JLW A;  2CQX A;  3ZQF A;  3LSP A;  1IJW C;  4JP0 A;  3S16 J;  2DA6 A;  1U9O A;  3GTK J;  1UMQ A;  1MH4 A;  5K7F A;  5DTD A;  2HOS A;  4Y52 J;  1JUS A;  1W0U A;  4DW6 A;  1QPI A;  3BR5 A;  1JKO C;  1LE8 A;  2LLK A;  1MBE A;  3S1Q J;  3S2H J;  1ETY A;  2IEK A;  3SDG A;  2ME0 A;  3ZOB A;  1TC3 C;  3TED A;  1A6I A;  1ZR4 A;  1ZR2 A;  3BQY A;  1X2N A;  4B4C A;  4BXX J;  4A93 J;  4M3D A;  5EDN A;  2VKV A;  3BG3 A;  5FKN A;  1XS9 A;  5J1Y A;  2XGE A;  1ENH A;  1MBK A;  2Y31 A;  5IYD J;  2XB5 A;  1HDD C;  3S1R J;  3A03 A;  3W6V A;  3I4M J;  3FK6 A;  4FTH A;  3H0G J;  4IHX A;  4X1E A;  3WHC A;  5IP9 J;  1MNM C;  3GTJ J;  1BJZ A;  3LSG A;  1GVD A;  3G1L A;  1NK3 P;  4XRS A;  1B72 A;  5FLV A;  2P81 A;  4A3M J;  1QVT A;  1IDY A;  2O8K A;  1K83 J;  2NVQ J;  2DA2 A;  1RET A;  3HBL A;  3BTI A;  2XSD C;  3JRI A;  2R5Y A;  3HM5 A;  2DMU A;  3ZQC A;  1NK2 P;  3DCF A;  4C3J J;  3BG9 A;  1E3O C;  1Q1V A;  1H8A C;  1SFO J;  2XGD A;  3QQA A;  3HB9 A;  4C2M J;  4QIW N;  2EZI A;  3S2D J;  4W97 A;  4RDU A;  4IEJ A;  3H3V K;  2FD5 A;  2LR8 A;  2G0E A;  4MFE A;  3ZQH A;  3JR9 A;  3E7L A;  4MLO A;  1FEX A;  3LNQ A;  5EEA A;  2ZB9 A;  4D7M A;  2K9N A;  4A69 C;  2L9R A;  4JYK A;  5DS9 A;  1VFC A;  5J3L A;  2I10 A;  2DMQ A;  2L7M P;  4A3J J;  1B8I A;  2O9L A;  1ZKG A;  2JJ7 A;  3CDL A;  1IGN A;  2DMP A;  5GPA A;  2PMZ N;  4DZJ A;  3RKQ A;  4FIS A;  3F0C A;  5K7H A;  2ELK A;  2WB1 N;  3GBG A;  1S7E A;  3S17 J;  5C44 J;  2HQ5 A;  4G12 A;  4CYC B;  3GTG J;  1ZTR A;  3S1M J;  2OPT A;  3BG5 A;  1RKW A;  4MFD A;  1JUP A;  3BR3 A;  3CCY A;  3MVP A;  4B1R A;  4AUX A;  3JRD A;  5EZG A;  1HCR A;  1EF4 A;  1P7J A;  2XPW A;  1MBJ A;  3OOU A;  5M3M J;  2NS7 A;  2M34 A;  4XID A;  2LFB A;  5EYR A;  4I6Z A;  3A01 B;  3JRE A;  3DEW A;  2DA4 A;  3G1M A;  3NAU A;  4A3K J;  3GTQ J;  2YUS A;  2ECB A;  3ZQI A;  4IHY A;  1FIP A;  1U8B A;  4DZP A;  4DYR A;  5IP7 J;  3BQZ A;  2ID3 A;  3BR0 A;  4A3B J;  4M6V A;  1PUF B;  2HYJ A;  3BTL A;  3D1N I;  3GTM J;  3HOX J;  1I3Q J;  1JJ8 C;  2JA6 J;  1JKQ C;  4LOC A;  1WH5 A;  1BL0 A;  4V2F A;  1DU6 A;  1AU7 A;  1XC5 A;  2LP0 A;  2R0Q C;  1APL C;  3GTO J;  5C4J J;  1FTT A;  1U9N A;  1DU0 A;  2XRL A;  5M5W J;  1F36 A;  5E3O A;  3IH3 A;  5IPA A;  5C4X J;  4M3G A;  3LSR A;  3QPL A;  3A02 A;  5F08 A;  2OF7 A;  4BY7 J;  1ETW A;  4QSH A;  3JRF A;  2LKX A;  4RBO A;  1YRN B;  2HOT A;  2LK2 A;  1F43 A;  3BR6 A;  1ORK A;  2DA3 A;  3OSG A;  4MO7 A;  2TCT A;  2RAE A;  1HDP A;  3CMY A;  1T33 A;  4JX5 A;  1JGG A;  3I4N J;  1VND A;  2JN6 A;  5FKL A;  1OCT C;  3IH2 A;  4AYB N;  4M3E A;  2Y0S N;  1A5J A;  4DYQ A;  5FKM A;  5M5X J;  3RZO J;  5F04 A;  3MN2 A;  3HKZ N;  4QTR A;  2VI6 A;  4A3E J;  4M3F A;  2K9S A;  5FLM J;  3ZQL A;  2NVX J;  3LOC A;  1IRZ A;  1AKH B;  1QRY A;  2HOA A;  5EGO B;  1JKP C;  2K9Q A;  4C3H J;  1QVU A;  3OSF A;  2DA7 A;  1IV6 A;  1UHS A;  1Y1W J;  3HOW J;  2AO9 A;  4XRM A;  3PO2 J;  5FKK A;  3MKL A;  1I6H J;  5EZH A;  4S0H B;  1ETK A;  1NTC A;  2QCO A;  4C3I J;  3Q3S A;  2R5Z B;  2LTP A;  2HXI A;  2MGQ A;  3FIS A;  2COB A;  4BKX A;  1JKR C;  2R7Z J;  3UKG A;  4HNV A;  3BT9 A;  3TP0 A;  4A3D J;  5IP6 A;  2WV1 A;  1X58 A;  1Z77 A;  1ZGW A;  2TRT A;  5IOZ A;  1FIA A;  1JT6 A;  2IAI A;  2JMW A;  3BR1 A;  2EQR A;  3WHB A;  4UUS B;  4JX4 A;  2D5V A;  5EF6 A;  1P7I A;  1RES A;  5HOD A;  1ETX A;  2Y9Z A;  1MBH A;  4J19 A;  5EG0 B;  4CYC A;  3SFI A;  1ITY A;  3FIW A;  5FKO A;  5F0H A;  4JX6 A;  5IYB J;  2HI3 A;  5BNG A;  2VPR A;  3Q0W A;  2W48 A;  2M9H A;  1JTY A;  1MSF C;  1MH3 A;  1MSE C;  1WI3 A;  3IH4 A;  1LFB A;  3HDD A;  2X9D A;  3A01 A;  2EBI A;  4FE4 A;  3BTJ A;  1HF0 A;  5GPC A;  5JLX A;  4X6A J;  5E3M A;  2JA8 J;  1O4X A;  3K7A J;  2L7Z A;  2XGC A;  2E1O A;  1PUF A;  1IDZ A;  2DA1 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...