2RV8A

Solution structure of the phop dna-binding domain from mycobacterium tuberculosis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule keywords DNA-binding response regulator
publication title Solution structure of the PhoP DNA-binding domain from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis cas/nitr204
molecule tags Dna binding protein
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rv8A00
2LDUA 2P5KA 4I98B 5TJJA 3KEQA 2DK5A 4HW0A 4WX9A 4G9YA 2E7XA 4H0EA 4LD5A 1BI1A 4BNCA 2LNBA 1KYWA 2KRFA 4A5NA 2QENA 1FPQA 2RDPA 4YFXF 4OINF 5HS8A 3ZPLA 3ZMZA 3WTYC 1XGSA 3MQ0A 4U88A 3M1EA 4UVCA 3QRFF 3AAFA 4AIKA 4L9VA 4A5MA 3H3UA 5H20A 3I59B 3QU3A 1R58A 3GZ6A 3QPTA 2P5VA 1YG2A 1KQ9A 3EQLF 2F5EA 3WE3A 3DKWA 5CYVA 5LGTA 1LDKB 1YLFA 3T1BA 1YW8A 3EYYA 4PGGA 3IC7A 1BN5A 1LDJA 4GYIA 2FMYA 5CVVA 4LMYA 4XSXF 4EM2A 1U5TA 2W85A 5F64A 3F21A 2P6SA 2ACJA 2O6GE 1HBXG 5H6QA 1OYWA 3WTUC 1RZ4A 2LF7A 2FXAA 1QO0D 2EB7A 1TW2A 3LSTA 2QQ9A 3KP5A 3T8TA 5K5QA 4G8XA 2OZ6A 3RYRA 2XAGA 2KIFA 3GWZA 5IT9Z 1MDMA 3WTWC 1T39A 3DP7A 1UFMA 4WK8F 4K2EA 2Y75A 4OU0A 4RS8A 2DAOA 3LAPA 1SD7A 3BP8A 4ENKA 3ABUA 4I7HA 4Y17A 5D5UB 3ERED 4DQ2A 1LJ9A 2PQ8A 4HZFA 5ICFA 3P9IA 4A2UA 4IRGA 2COMA 3LQQA 3GEZA 1Z1DA 2IP2A 4Y15A 3B73A 4A0ZA 4JQFA 2FSWA 4LLLA 1LEAA 4M73A 5EEGA 1IN8A 2R7FA 3L00A 2VBYA 2FA5A 2MA3A 1J75A 4XLPF 3OOPA 2PG4A 4UUVA 4RB3C 1YIOA 1REPC 1KQ8A 4EGZA 4KMFA 3RKYA 1R23A 2KIMA 2L4AA 1CF7B 3T8RA 2VC1A 4EVIA 5ICEA 1FP2A 1WWXA 4M6YA 4I01A 1BOAA 3F8MA 2PEXA 5JFRA 2FNPA 1IXSB 3PQKA 4MGRA 3NQOA 4LGWA 4FT8A 2ESHA 5HLGA 2PJPA 3HIFA 1YS6A 1JXSA 3HRTA 4EM1A 2CO5A 3J80Z 3FF5A 1TTYA 3BDDA 2GZWA 2VBWA 2HQNA 3I54A 3C1DA 1J7KA 5D4SA 2DTRA 3GFLA 4FHTA 3FMRA 4MHGA 4HAMA 2KJBA 5BOXA 2HFHA 3L2CA 4L9JA 2UZKA 2X0LA 1D8JA 5KVRA 4Z2YA 1KQ0A 3QP5A 5AIQA 2M1BA 3FHZA 1G3SA 3CJNA 3ZP5A 1IW7F 4PZJA 2OQRA 4N9IA 2VT3A 1HSJA 2F5CA 5HS7A 2A6HF 5BQTA 4WXCA 2BBYA 3BZ6A 3W6JB 3HOSA 1D3YA 2PBIA 5FLXK 2EFPA 4KN4X 2V6CA 4CO8A 1UB9A 4PGHA 1Z91A 4YFNF 1KU7A 2FBHA 1Z6RA 3IWZA 3KP3A 4FX4A 4KA4A 3TDZC 2NS0A 3QPHA 3V8LA 2XASA 1CGPA 1FYKA 1ULYA 1X3UA 3WTXC 1TNSA 2FBKA 2Y48A 2ZNYA 2JT1A 1EH8A 3FMQA 1AOYA 1BC8C 5CVJA 2ZMEA 3O2PE 2EFQA 2ESNA 2ZCWA 3KE2A 1B4AA 1MKMA 2H6CA 2FU4A 3JW4A 4HLYA 4L0ZB 3VB2A 3CTAA 3KP7A 2WV0A 3F6OA 1BBYA 4HDVA 2CGPA 3G3ZA 3F8FA 1DPUA 4UXNA 3CO6C 2FF4A 3ZMVA 1H9TA 4EJTA 1K6OA 5ICGA 2K86A 2BGCA 2QLZA 3F8BA 3GYHX 1XGNA 1WQ2A 2XAFA 2IPQX 2M45A 1LQ1A 1W5TA 1L3LA 3HHHA 3E6DA 4IF4A 1BI0A 4Q48A 1LNWA 2HS5A 2ADUA 2HOEA 1Z9CA 1ZRCA 2HTSA 4L5JA 4EV0A 4P5OA 4BQAA 4KIFA 4RGSA 4OMZA 2HKXA 4F7ZA 4ZYGA 2H27A 5L3DA 3R60A 4KIGA 2K7LA 3K1PA 4I0BA 2M87A 4LB5A 3MZYA 4G94A 3BJOA 1TQMA 2XHKA 1R22A 2IT0A 4LLNA 1KU3A 1PP7U 5ERIA 3BJ6A 2Q8KA 3V7RA 3ABTA 2Z9OA 3RDIA 3H3ZA 5AONA 4P96A 4MQVA 1P92A 1DPRA 1ZN2A 3F22A 5DCMB 5DDGA 4OOIA 3HRMA 3F8CA 2GIVA 4HF0A 3WTZA 4L18B 3L09A 5E1WA 1I6XA 2VC0A 1IF1A 2D2WA 2J5OA 3F72A 2HZTA 3JAMK 3P9KA 5EEHA 1HKTA 4IRHA 2H09A 3MCZA 1ODDA 4P55A 2VOPA 3ZQ7A 2HR3A 3FWEA 2LKPA 3CUQC 1D5VA 4BHCA 1G6NA 4ZH4F 1E17A 1QNTA 1AWCA 5H6RA 3ECHA 2AS5F 1FT9A 1LVAA 4BH9A 1B9NA 1ZRDA 1QZZA 3IHUA 2W57A 5D5VB 1VTNC 5DD4A 3TGNA 3TO7A 3SFZA 1BIAA 3SHFA 3FXQA 1FC3A 1GHCA 3SXYA 1HKSA 1LDDA 3Q5FA 3HRUA 2ELHA 1HW2A 5CVIA 2RC4A 2RV8A 2P5LC 1OYYA 1ZG5A 3HYIA 4RAZA 4B09A 1LB2A 3I4PA 4AWXB 2ISZA 4MEYF 5ILSA 3RKXA 3V8KA 2UXXA 2FE3A 3GZ5A 3PQJA 3S2WA 4DNCA 4XSZF 2L4MA 4NQWA 2MD5A 2MH2A 3ML6A 2QWWA 1IN6A 5TRDA 2BYVE 1FOKA 3VODA 1Z7UA 2QQAA 5L3GA 4M9XA 2CG4A 4I0AA 4L9NA 2P7CB 4GO1A 1GXPA 5J6XA 3B02A 5IT9K 4LG0B 1TW3A 3GF2A 3H92A 2CQKA 2L54A 1WI9A 3CUOA 1R00A 1D8KA 2ISYA 2MH9A 2M8EA 2VXZA 1T2KA 3HTUA 4HOBA 3RKWA 1STZA 2FQ3A 5FFXA 1YS7A 4P9UA 4UVAA 2L3DA 2V1UA 3Q9VA 1ZHFA 5BS6A 5HOOA 2XAHA 4HX4A 1WSUA 3NRVA 4HLXA 1U78A 3L9FA 3F8NA 5ILVA 4ENNA 2ZXJA 1XDUA 4OMYA 1ZYRF 1HQCA 3KP4A 5HDNA 3HOTA 1P6RA 3BWGA 1QBJA 1V3FA 3P7NA 2NAZA 4I2OA 3CLOA 1ZG3A 1IXCA 3ZN1A 3TOAA 3R61A 2XGXA 1P4XA 2JPCA 2JSCA 3IRQA 1S29A 3U9GA 2QYOA 2GXGA 4U0VA 1W7PA 2M5WA 5KK1A 5HLIA 4CYDA 4IJAA 3J80K 4CHUA 3GFJA 5F6FA 3DV8A 1USTA 2EFOA 1PP8F 3KP6A 1F1ZA 3LA3A 5LRSA 2DPDA 2G7HA 4AVPA 5FD6A 4KDPA 1J5YA 1S8NA 3KCCA 3GW2A 3BJAA 3TKYA 2CW0F 2WC2A 3I0TA 4JBAA 2H94A 2HWVA 3R4KA 1HSTA 1Q1HA 2DW4A 1KU2A 3I53A 4KT5C 1YQAA 5JR3A 4MTDA 1R5GA 3MZHA 1R5HA 2VT2A 3BOQA 1TLHB 1ON2A 1ONVA 2A68F 5FFZA 3DPLC 3BY6A 3JTHA 4QWQA 1OR7A 1SD4A 4D0PA 3I59A 1R7JA 4GGGA 2D1VA 3JTGA 1HW5A 3C7JA 2QVOA 2P6TA 4BYYA 2Z5UA 1XN7A 1U8RA 1YW9A 4EJOA 4ETSA 5LGNA 1DUXC 1S7OA 4O5VA 1E2XA 3RJPA 1DDNA 2PLYA 2DK8A 1MJBA 3U1DA 2RVCA 2OQGA 4IPAA 5BPIA 1O3TA 1O7LA 3I5UA 1ZRFA 2YX4A 1SMYF 3WE2A 1Y0UA 1RIOH 2F2EA 2XV4S 3OV8A 5D6EA 2GA2A 5A2QZ 3LA7A 5L3EA 1ZH5A 3O3KA 2JRTA 4YIFA 3R6SA 1B6AA 1P4AA 2AXLA 2O0YA 1UHWA 1O3SA 2Z3YA 1J2XA 2F5DA 4HX7A 3DFGA 4PCQA 4EM0B 4OIQF 3G73A 4UVBA 5LHGA 2ETHA 2G9WA 2NNYA 2QZ8A 1KU9A 3QP6A 1O3RA 4XLNF 3ZMUA 2CSOA 1FZPB 1BJAA 1IXRC 1K78B 1S6LA 4LK1F 2O8XA 3F23A 5LEKA 4EJVA 1W5SA 3RPQA 2RNJA 5E8IA 4G6QA 1O7FA 2O3FA 1MZBA 5D8KB 3Q9SA 2HKOA 2JTVA 3SQNA 1IUYA 4KYWA 2ZBKA 1FYMA 4I09A 2EV6A 4ZZLA 1CF7A 4CXFA 1OPCA 4IHSA 5E1XA 3FM3A 4LJZF 3KZZA 1FLIA 2XKOA 2GXBA 4R1HA 4GXOA 1QZYA 2OA4A 1S7AA 2STTA 3W6KB 2ZJ2A 2D45A 2MC3A 1SAXA 4EQQA 4A0YA 1JHFA 2VE8A 2WTEA 5J8CA 1I1SA 3VEPA 1TQIA 1XDSA 4I02A 1RNLA 2OBPA 2XRNA 4ASNA 4ENMA 2EFWA 2LF8A 5JI6A 5J8FA 1T98A 3E5XA 4HDUA 2IJLA 2QUFA 2Q0OA 5HDKA 3ZMTA 3TOBA 3E6MA 1JGSA 1G3YA 3HSRA 4ESFA 1DP7P 2YU3A 1IN5A 4UV8A 2CYYA 2HYFA 4HV6A 1FP1D 4RB2C 2PI0A 4XRFA 5HVQC 2DO7A 2G7UA 1F4KA 1RI7A 2VE9A 4GYGA 4G7ZF 4KNYA 2IVMA 3ROUA 3RTRA 2PFBA 2RQPA 1K7AA 4FX0A 1IRGA 1C0WA 4WWCA 1ZARA 3N97A 4KICA 5L3BA 2EV0A 4MTEA 1TBXA 3F3XA 4KN7X 2O03A 1YO5C 2VN2A 2P8TA 2XAQA 4Q47A 5L3FA 1QQIA 1KGSA 3FXRA 3E6CC 3PFIA 3GFIA 2BV6A 1SD6A 2NYXA 3L7WA 2J5PA 1P2FA 1TNTA 5E8GA 1V4RA 1U6GA 5E17F 1OMIA 4UHTA 4RGXA 2UXNA 3EETA 3KEOA 4HF1A 2EWNA 4P9FA 1HKQA 2IA0A 1P4WA 1U5TB 5BMZA 2HGCA 1ZLJA 1F5TA 1OYIA 3K1NA 4ZZDA 2ZKZA 2YR2A 3IRRA 3K1MA 4WF2A 3QU6A 1ZGJA 1ZAOA 1T38A 1MDMB 1MJ9A 4WXDA 4QLCU 2HTJA 1FBSA 3QAHA 2EV5A 4IRIA 2DQLA 1MJAA 1R1UA 1K79A 3I64A 2UWMA 1SFXA 3FMSA 3GXOA 3EUHA 4BHBA 2DPUA 3JSPA 2KKOA 3VOEA 4S05A 3TQNA 2F5FA 1Z6TA 5DUKA 3WU0A 3J81Z 4N9HA 4YFKF 3K9TA 4EJUA 2XROA 1U5TC 2IA2A 5HDGA 1FYLA 3RI4A 4HX8A 5DEQA 1G3TA 1BIBA 1R36A 4Y13A 2BEOA 1IAWA 2STWA 2ZFWA 3O6BB 3WGHA 2XKPA 1XB4A 4N0BA 2FMLA 3E3VA 4MEXF 4IVNA 3CUQA 5LHIA 5L3CA 2K02A 3I58A 4HA8A 5BPDA 3C3WA 1ON1A 4KUMA 5K5RA 4R79A 4ESBA 2DU9A 3ZMDA 1L0OC 2JPBA 1T0FA 4CGZA 3K2ZA 4NHJA 2OD5A 2ZO4A 2E1NA 5DCMA 5LBQA 5D5XB 1SFEA 1ZGAA 5HS9A 1HW1A 2EA2A 3R0AA 3KZYA 2CWEA 1IN4A 3WTTC 2A3SA 1WRJA 5ED4A 1B1BA 2KJCA 2MLGA 1XCBA 1GXQA 4U7DA 3TO6A 1U2WA 2QM3A 3DEUA 2QBYA 4O6JA 2L01A 1PDNC 4ZYEA 3N4MA 4OIOF 3REOA 2VONA 4CDGA 1BI3A 1RUOA 3GLXA 2VOOA 2W24A 1Z05A 2V9VA 3FZVA 2LSOA 2H6BA 4ZYHA 2TDXA 4A12A 3M8EA 4HQMA 5LEJA 3LQRA 2XVCA 2Y0MA 3HHGA 1WKMA 2PN6A 4LFUA 4O3MA 1FY7A 2R7DA 2K27A 2YSRA 5FGMA 3FXUA 4M74A 1G3WA 1FSEA 4NB5A 3RIRA 2HDCA 3K69A 1ZLKA 6PAXA 3BROA 3E6BA 3DQVC 1J0RA 2GAUA 1O57A 3TDUC 3D5LA 3VFZA 2L02A 4WXHA 1YW7A 5FD5A 4RGUA 3MWMA 2HEOA 4RB1A 2E7WA 2JZYA 1XCVA 1I27A 2XUBA 3ISPA 5LLQA 1XSDA 3WTSC 4BXUA 2DLLA 5HLHA 1H0MA 3ULQB 4MNUA 1TQPA 1B9MA 4CICA 3ELKA 4HBLA 2YPRA 2VBZA 4LLGF 2OAZA 3V7CA 1KYZA 2RGVA 2ZMEB 3J7AO 5ICCA 5FB2A 1MGTA 1IZ1A 4IXAA 3HSFA 1A04A 3SZPA 3ZMSA 1GVJA 4L5IA 5JHUA 3SZTA 3IKTA 1XMKA 5A2QK 5D4RA 4LG0A 2A5YB 3RYPA 3KLOA 4WCGA 4G7HF 1FNNA 2IW5A 3GO5A 2A07F 5DD8A 2DBBA 4M71A 2VBXA 4ON0A 1IN7A 4TV7A 1IRFA 3LWFA 1XMAA 4AD9A 3LAJA 5IT3A 5K5OA 2OZUA 1XGOA 3M8FA 1T6SA 1USSA 1XSXA 1FWZA 3GVAA 2PMUA 1W4MA 3D0SA 4E70A 4PDKA 2W84A 2GA1A 1J59A 1UCRA 1S3JA 5D6FA 4BHPA 4G7OF 1ZREA 3NEUA 3BPVA 4HV5A 2DT5A 5AIPA 3GFMA 5DV5A 5CVUA 4KMUX 3R0JA 1UHMA 3CDHA 4L0YB 2V79A 2VODA 1B59A 5DUIA 5DCFA 1JHHA 3E97A 2RN7A 3T0YA 1OKRA 2A61A 4S04A 2IRFG 1BM9A 3WTVC 2Z99A 2X4HA 3IL2A 2A69F 2K4JA 2PMHA 3HRSA 2W25A 3RPUA 5CLSA 4ENJA 1BC7C 3C18A 1I5ZA 4YG2F 3WODF 4YIIA 4RB0A 5E1ZB 1H9GA 1XSVA 2HQRA 1F9NA 3KP2A 5D8LB 2V1DA 3V7SA 4RGRA 2FRHA 2QQBA 4RAYA 1PUEE 3HUGA 4BAYA 5FLXZ 4G6DA 1FBQA 4M9ZA 1YYVA 3KLNA 4B8XA 2XAJA 4EJWA 3EDPA 2NNNA 1O3QA 4Q4ZF 5FO5A 5E20A 1YFHA 3ZN0A 3QOPA 4Q5SF 4GCVA 1FSHA 1QPMA 4OIPF 2B0LA 4M6XA 4OIRF 2DI3A 1YTYA 4R8HA 1W7PD 1BI2A 3K0LA 3FM5A 4U0YA 5K1YA 4AIHA 3E5QA 1JE8A 3MEXA 4A0XA 1HXDA 2Z33A 5CVRA 3WU1B 1SFUA 3GUDA 4AIJA 5DYMA 3MFKA 5LRRA 2RKHA 4ZYDA 2OU2A 4LK0F 4A6EA 2MBFA 2CFXA 4UNOA 4L9TA 1J9IA 4CZZA 3HSEA 2P7VB 2IA1A 3TO9A 1MD0A 3T5XA 3MAJA 2E1CA 1U3EM 3BPXA 2C6YA 1SD5A 4XBFA 3KFWX 3U2RA 3DPTA 1XD7A 3COAC 4EMSA 1XGMA 3CUQB 2A6EF 5LGUA 3M7GA 3JSOA 3WGIA 4U0WA 1FX7A 2GQQA 2M30A 3F6VA 2DFIA 3HTSB 3CO7C 4JK1X 4KIBA 1NHAA 1KA8A 4IHTA 1K78A 1EH7A 4HF2A 5ILUA 2EA4A 3WG9A 3M9AA 5D5WB 1LEBA 1ZG1A 5LHHA 3IKVA 2KIUA 2O61A 3LA2A 2DQRA 2FOKA 3DXJF 3J81K 2GWRA 2V1XA 2BE5F 1FBUA 1I1GA 1QGPA 1SMTA 4M9SA 2R3SA 2QBYB 4A6DA 3ECOA 3WGGA 5E18F 2K4BA 2ZNZA 4UV9A 4HQEA 2FNAA 4MQ9F 3GX4X 4M72A 1G4DA 2NRAC 2YX7A 5F1RA 3LFKA 3I71A 4LB6B 1RUNA 2WWYA 1EH6A 4KFCA 3DF8A 4ESJA 4HYEA 2XIGA 3IWFA 2Q2EA 2MLKA 3JAMZ 2P4WA 3E5UA 3FX3A 3EYIA 2D1HA 3P9CA 2EFNA 4EGYA 2HYGD 2EK5A 1EV7A 3KETA 3V8JA 2EJRA 1R1TA 3V4GA 1W7PB 2FBIA 2FEZA 1R1VA 4U7BA 5JVTA 5CJ9A
chains in the Genus database with same CATH superfamily
1RC9A 2JMWA 2LDUA 2XRLA 3GTJJ 1VQ9I 2P5KA 4I98B 5TJJA 2DN0A 3KEQA 3CCQI 2DK5A 4HW0A 3JRAA 3ZR8X 3F0CA 5B66C 4WX9A 4G9YA 4B3XA 4RA2A 2E7XA 2JA6J 1JUPA 4H0EA 2LK2A 4LD5A 3OMYA 1BI1A 4BNCA 4M3BA 2LNBA 1X3WB 4CCMA 1VQ6I 3FXLA 1KYWA 3A0HC 3CMEI 2KRFA 4A5NA 2VKHA 2QENA 2NS8A 1FPQA 3CCUI 2RDPA 3K4CA 4YFXF 1ZQ3P 2JVHA 2GXAA 3MKLA 4ZYAA 2V4JC 4ZTFA 3OL4A 2VXDA 4OINF 2DMNA 5HS8A 3ZPLA 3ZMZA 4KITB 1XGSA 3WTYC 3H5RA 3MQ0A 3TL4X 4U88A 4XRSA 3M1EA 4UVCA 1AHDP 3GTKJ 4E7LA 4Y7NJ 3FBNB 3QRFF 1VQ4I 5C4XJ 1WJAA 1E3PA 1XG1A 3AAFA 4AIKA 2CUJA 4E7HA 4L9VA 4PJJA 3H5AA 3P5JA 4A5MA 1WVRA 3H3UA 5H20A 3I59B 3QU3A 1R4NB 1R58A 3GZ6A 1SEUA 1B8IA 2LFBA 2OCEA 2VJ4A 1K4TA 4I6ZA 4B1RA 4BL0B 3L2WA 3QPTA 2P5VA 1YG2A 2OC6A 1KQ9A 3EQLF 2WADA 2F5EA 3WE3A 3L2QA 3DKWA 3CMAI 5CYVA 3QQAA 2ME0A 1JTYA 1LDKB 1YLFA 5LGTA 2GOXB 2LY2A 3T1BA 3HOUJ 3HC7A 1YW8A 3EYYA 4PGGA 3IC7A 1BN5A 1LDJA 4GYIA 2FMYA 5CVVA 4MO7A 3WG7H 5JVGF 4LMYA 4XSXF 3HPGA 4EM2A 1IRXA 4HG2A 1U5TA 2W85A 1W0UA 5F64A 3A03A 3F21A 2P6SA 2ACJA 2O6GE 1HBXG 5H6QA 1OYWA 3WTUC 1RZ4A 2IS1A 2LF7A 2FXAA 1QO0D 2WY7Q 2EB7A 2JA5J 3KX2A 4PJLA 1TW2A 3LSTA 4J19A 2QQ9A 3KP5A 3DTEA 3T8TA 5K5QA 4G8XA 2OZ6A 1FOXA 3RYRA 2XAGA 1JKQC 1Y6IA 4GFBA 1AU7A 2KIFA 3B6CA 3IAM2 1RR8C 3GWZA 5IT9Z 3I3LA 1MDMA 1OR7C 3N05A 3WTWC 1T39A 2IEKA 3DP7A 1LPQA 1F43A 1GVDA 4EEFG 1IRZA 1UFMA 2EH3A 4DYCA 4WK8F 4K2EA 2Y75A 3SEQA 1UAAA 1RETA 4XIDA 4OU0A 4BBSJ 4RS8A 5J1UA 2DAOA 2LG4A 4CA0A 3LAPA 1SD7A 3BP8A 4ENKA 3ABUA 3S1QJ 4I7HA 4Y17A 5D5UB 1VQKI 3ERED 3IP4B 3K4JA 3SJMA 4IX7A 4DQ2A 1LJ9A 2K5CA 2PQ8A 4HZFA 4A3CJ 3A01B 2EIJH 3KEYA 5ICFA 4JX5A 3FXOA 3P9IA 4IRGA 4A2UA 1TC3C 2COMA 2KDOA 2DA3A 3LQQA 4ZJZA 3GEZA 5JHFA 5FKOA 1Z1DA 2IP2A 4Y15A 3B73A 4A0ZA 4JQFA 2OV7A 2FSWA 4LLLA 1LEAA 3FIWA 4M73A 5EEGA 1IN8A 2HQAA 5TISC 4BY1J 3M07A 5F04A 3CF2A 2E71A 2R7FA 5GAEJ 1UZCA 1UMQA 3L00A 3FKJA 4F55A 2HDDA 3OYNA 1PYVA 2VBYA 2CV1A 2FA5A 2MA3A 1J75A 4IHXA 4XLPF 3OOPA 2PG4A 1ETXA 3ABMH 4MFEA 4UUVA 1ETVA 1UHSA 4RB3C 1YIOA 1REPC 1KQ8A 3IH3A 3ESWB 4EGZA 4KMFA 3U21A 1OCOH 1VQ8I 3RKYA 1T33A 1R23A 2KIMA 2L4AA 1CF7B 3T8RA 2VC1A 4EVIA 3OS2A 2KMUA 4RBOA 3DLLF 5ICEA 1FP2A 1I50J 1OCCH 4G6TB 1WWXA 2WAEA 3S16J 1WJ5A 4M6YA 4I01A 1BOAA 4A3IJ 1U8BA 3F8MA 4A3DJ 2PEXA 5JFRA 2FNPA 1IXSB 3PQKA 1MBEA 5F27A 3DCFA 4C3JJ 5M5YJ 3RSNA 1MNMC 2IGNA 4MGRA 4Z6YA 2MYSA 3NQOA 5IYCJ 3JCUC 2HVQA 2KL4A 4LGWA 2EZKA 4FT8A 2ESHA 5HLGA 2PJPA 1N78A 3HIFA 2B7EA 1LFUP 1YS6A 3QYBA 3CCYA 1FIAA 3HRTA 1JXSA 3F9KA 1BR1A 4EM1A 1D0ZA 2DODA 3K4LA 1WZ2A 1SVLA 3ASNH 1X2MA 1N75A 2CO5A 3J80Z 3FF5A 4XICA 1TTYA 3BDDA 2RQQA 2GZWA 1LFPA 2VASA 1E3OC 5IP6A 2VBWA 2HQNA 3I54A 3C1DA 1J7KA 2DA7A 5D4SA 2X6YA 1SVMA 2DTRA 3GFLA 3FK7A 4FHTA 4UY8I 3BCAA 3FMRA 4MHGA 4IQJA 3CCJI 4HAMA 2KJBA 5BOXA 3S32A 1BJZA 2HFHA 2CJJA 3A2KA 3L2CA 2LBFA 4L9JA 2IGMA 3DEEA 2UZKA 4C30A 4CCOA 1OLTA 2X0LA 5FJ8J 1D8JA 5KVRA 4Z2YA 2K9NA 1KQ0A 4IEJA 3CCLI 3QODA 3QP5A 2E35A 5AIQA 2WA0A 1FJLA 3DKYA 5J4YA 2M1BA 3BTCA 3FHZA 4YRVA 5K7HA 1G3SA 4DZPA 3AG3H 3CJNA 1HF0A 3ZP5A 1IW7F 2IBDA 1GLNA 2N8GA 2OQRA 4N9IA 4PZJA 4DJAA 3OYFA 2VT3A 1HSJA 2Y0SA 3I55I 2F5CA 4LOCA 3Q3SA 2FUG2 4LIUA 5HS7A 3K4KA 2A6HF 5BQTA 3EUAA 5EGOA 2XPVA 4WXCA 2BBYA 3BZ6A 2VJJA 3VSKA 4IQ4A 5E3MA 3W6JB 3HOSA 1D3YA 2PBIA 5FLXK 2E34A 2EFPA 5FRNA 3K7AJ 4KN4X 1W0TA 2V6CA 4CO8A 1UB9A 3Q0WA 4X6AJ 4PGHA 1K83J 1Z91A 4YFNF 1BW5A 2LR8A 1KU7A 2FBHA 4E7JA 2OCCH 3BG6A 1NTCA 1JUMA 1Z6RA 3IWZA 2E1MB 3KP3A 3VYUB 2R7TA 4FX4A 2E36A 1FOWA 3H0DA 2R5YA 1H8AC 5EJCA 4KA4A 3TDZC 1HC8A 1B72A 1QVUA 2NS0A 2AHQA 3DU6A 3OIQA 3QPHA 3JR9A 3GTOJ 4LG3A 3V8LA 1OFCX 2XASA 4AM3A 1CGPA 4I76A 1V55H 2DTZA 5CJ9A 1FYKA 1JT0A 1D5YA 3LOCA 4OWRB 3GTQJ 1ULYA 1X3UA 1UG2A 3WTXC 2BY0A 4XORA 1TWGJ 1TNSA 4MIMA 3G1MA 2LP0A 2FBKA 2Y48A 1H88C 2L0KA 1HLVA 2ZNYA 2Y9ZA 2JT1A 1EH8A 4C2MJ 4FTHA 3FMQA 1AOYA 1BC8C 2FD5A 4PK4A 5CVJA 4E7SA 2ZMEA 1FOYA 3O2PE 2EFQA 3CD6I 3K6GA 2M0CA 2RREA 2ESNA 2ZCWA 3KE2A 4DZJA 4YIRX 1B4AA 1MKMA 2H6CA 2HQ5A 4BDYA 2FU4A 2VPRA 3JW4A 5B5EC 4HLYA 4X0GA 4L0ZB 1EA3A 3VB2A 3CTAA 2ZB9A 3HG9A 2DMQA 3KP7A 2WV0A 2E1MC 4JX4A 3F6OA 2NVTJ 1BBYA 4HDVA 3GZNB 2CGPA 2XPWA 3G3ZA 5JLXA 4AC0A 2X6WA 3F8FA 2H1LA 5CQEA 1K6YA 1DPUA 4UXNA 3CO6C 2HXOA 2FF4A 3D5RC 3ZMVA 5BNGA 1H9TA 2X6OA 4NC8A 2QSFX 3L2RA 4EJTA 1K6OA 2VJ5A 5J4VA 5ICGA 2K86A 2BGCA 2QLZA 3F8BA 1VQOI 3GYHX 3S93A 1XGNA 3CESA 1WQ2A 1IJWC 2XAFA 2IPQX 4C9YA 2M45A 3C2BA 1LQ1A 1W5TA 1L3LA 4FQGA 1QRYA 2ZXHA 2R5ZB 3MN2A 5EG0B 3HHHA 3E6DA 4IF4A 1BI0A 2ICWG 3GTMJ 4Q48A 1XTAA 4BBRJ 1A35A 1LNWA 4JX6A 2M7BA 2HS5A 5F0HA 1RKWA 2ADUA 2EBIA 2HOEA 3TMOA 1Z9CA 1ZRCA 4XLFA 2HTSA 4L5JA 4EV0A 4PFPA 4P5OA 1PUFB 4W1UA 4BQAA 4KIFA 4RGSA 3S14J 2LY9A 4OMZA 2HKXA 4F7ZA 2CUFA 4ZYGA 1T8IA 4IOCF 2H27A 1YJNI 5L3DA 2ELJA 3K4BA 3R60A 1M1EB 4KIGA 2K7LA 3K1PA 2X9DA 4I0BA 2M87A 4XN3A 3BLYA 4LB5A 3MZYA 4G94A 1GUUA 3ABKH 1N25A 2FQ4A 3BJOA 1TQMA 1YX3A 2XHKA 1R22A 2IT0A 3BTIA 3NARA 1YITI 4IOAF 4LLNA 2X48A 1KU3A 3EUHC 2BW3A 2MGQA 2QEXI 2DXIA 2IS4A 2JVGA 1PP7U 1Y8QB 2M3AA 5EZGA 3HKZA 1PVEA 1IDYA 2EQRA 5ERIA 3BJ6A 2Q8KA 5FKMA 3V7RA 3ABTA 4E7ZA 2Z9OA 1IDZA 2ZSIB 2LLKA 3H3ZA 3RDIA 2QKMB 1TT5B 2UV1A 1HDDC 5AONA 1XS9A 4P96A 4MQVA 1P92A 4NBQA 1DPRA 3OYIA 2WAQN 1ZN2A 1WFXA 2LY1A 3F22A 2GLOA 2VJIA 5DCMB 3BZCA 5DDGA 4OOIA 4PUSA 3HRMA 2Z1DA 3F8CA 2GIVA 4B48A 4HF0A 3WTZA 4L18B 3L09A 5E1WA 1I6XA 2VC0A 4M6VA 3RZDJ 1IF1A 3PM1A 2MABA 2JA7J 2D2WA 1AA7A 4F91B 4F92B 4M3FA 4W97A 2J5OA 3F72A 2HZTA 5KAIC 3JAMK 1X1BA 3CCMI 2YUSA 3P9KA 1K4SA 5EEHA 5EEAA 2JUGA 1HKTA 4IRHA 2H09A 3MCZA 1ODDA 2X6XA 4P55A 2VOPA 4YELA 5DM7F 3ZQ7A 1LKXA 2HR3A 2LKPA 3FWEA 3IV5A 3CUQC 2X1DA 2JSPA 1WH7A 4NC7A 1OCZH 1G59A 2PJRB 1D5VA 2HDWA 3UKGA 4BHCA 1G6NA 4ZH4F 4DYQA 1E17A 1QNTA 2XF6A 1DP3A 1OJLA 2H8WA 3TP3A 1IO2A 2NOGA 4D5CA 1T0FC 1AWCA 5H6RA 2GBYA 3ECHA 3GCMA 1ACIA 5DTDA 2AS5F 1FT9A 1R6RA 2QF7A 2HOSA 1LVAA 4BH9A 1B9NA 1VZ0A 2O7OA 3HB9A 1ZRDA 2ZSHB 1QZZA 3LSIA 3OYCA 3IHUA 3S1MJ 2W57A 2VQLA 2ZC2A 4BEHA 5D5VB 3BG5A 2FX0A 3W2VA 1DGRM 1VTNC 5DD4A 3TGNA 3VDXA 3TO7A 4IL6C 3SFZA 1ZK8A 3RPUD 1VQLI 1Y0NA 1BIAA 3AL0B 3SHFA 2LYCA 5EZHA 3FXQA 3OYMA 4XK4A 1FC3A 3ONQA 1GHCA 4XN0A 5TGTA 3SXYA 5F0FA 4Y3OA 4I99C 3H35A 5IY5H 1HKSA 5M3FJ 2B9SA 1LDDA 3Q5FA 3MVPA 3FDYA 3HRUA 2ELHA 1HW2A 2DOFA 4FE4A 1X1DA 5CVIA 2RC4A 2RV8A 2P5LC 2HVRA 4PJMA 4ZDPA 3CCEI 1OYYA 4BE1A 5IYDJ 1DU6A 4BY7J 1Z3YA 1JJ8C 2CV2A 4NC6A 1ZG5A 2EIMH 3HYIA 4RAZA 4B09A 3I4PA 4B43A 1LB2A 4AWXB 4XLEA 2ISZA 2CU7A 2KZVA 4MEYF 5ILSA 3PSIA 2DYRH 3RKXA 4LITA 4RMNA 3V8KA 2UXXA 2FE3A 2Z16A 3GZ5A 3PQJA 3S2WA 3OSFA 3J7AY 2BHZA 3OY9A 4DNCA 3OYGA 1E3HA 4XSZF 2L4MA 1GV2A 4NQWA 1D0XA 1Y39A 3E0JB 2LTPA 2MD5A 2MH2A 3ML6A 1NG7A 2QWWA 1Z3XA 1XX5A 1IN6A 1SFOJ 3S1RJ 5IP9J 1ZGWA 3OYLA 3AL0C 5TRDA 2BYVE 1FOKA 3S3NA 2AQFA 3WHBA 1CQTA 2VIXA 3VODA 1Z7UA 2QQAA 4NUBA 3S1NJ 2K9QA 5F1JA 3S2DJ 1QPIA 1T08B 5CKTA 2NS7A 3HOYJ 5L3GA 2DT6A 4M9XA 3CJTB 2CG4A 4RM3A 4I0AA 4L9NA 2P7CB 2V6EA 2WB1A 4GO1A 2OF7A 4D9JA 1GXPA 2EPFA 3HJEA 5J6XA 3B02A 3BR2A 2IAIA 5IT9K 3MMYB 1D1BA 3BR0A 4LG0B 1ETQA 1TW3A 3GF2A 5M5WJ 3H92A 2CQKA 1TWFJ 3O8GA 2L54A 3JRCA 1WI9A 3CUOA 1R00A 1D8KA 2ISYA 1I3QJ 2M8EA 2MH9A 2VXZA 1T2KA 3HTUA 4HOBA 3CCRI 3RKWA 1STZA 2FQ3A 3B6AA 2V26A 5FFXA 3JRBA 3OYAA 1IV6A 2Y9YA 4P9UA 4UVAA 3G71I 2L3DA 2LC2A 2V1UA 1K61A 1LE8A 2VQGA 3Q9VA 1FMVA 1ZHFA 4M3EA 3IAS2 3CDLA 3CC7I 5BS6A 1A6IA 5HOOA 2XAHA 4BUPA 3HOZJ 4MLOA 4XONA 3PUFA 3S3OA 4HX4A 3W3CA 1WSUA 2RNGA 3NRVA 4HLXA 1U78A 3L9FA 3F8NA 5ILVA 2L2OA 4ENNA 1X58A 4F93B 2ZXJA 1XDUA 4OMYA 1ZYRF 1HQCA 2XB0X 5FLMJ 3KP4A 4RM2A 5HDNA 3H3VK 3HOTA 1S7EA 1P6RA 2K3FA 3BWGA 3VYTB 1QBJA 1V3FA 4DBRA 3S3MA 2XC7A 4GDFA 1X1AA 3P7NA 2NAZA 3ASOH 4II3A 4I2OA 3CLOA 1X19A 1W36D 2QCOA 4PJ0C 4DGWB 2FOWA 4B47A 5J1YA 4CZCA 3OYDA 2JJ7A 3OYKA 1RRJA 1ZG3A 2WBMA 2OTJI 1IXCA 3ZN1A 3TOAA 3CCSI 3R61A 2XGXA 2WV1A 2CMPA 1P4XA 1EKEA 2E1OA 2JPCA 2DMUA 2JSCA 3IRQA 1S29A 3Q0UA 2KLOA 5B1AH 2E2JJ 3U9GA 1YI2I 2QYOA 1LVKA 2GXGA 4U0VA 2YS9A 1IV8A 1W7PA 2M7AA 3G1OA 2M5WA 3H1CA 5KK1A 3LFUA 1LUJB 2XAUA 2HNHA 3BC8A 5HLIA 4CYDA 9ANTA 3JRGA 4IJAA 3J80K 3U1KA 3CC2I 3ZXSA 5JLWA 4CHUA 3GFJA 2X51A 5F6FA 3EPZA 4HEA2 4S0HB 2XDVA 3DV8A 1USTA 2EFOA 1PP8F 2JN6A 3KP6A 1F1ZA 3LA3A 5LRSA 2DPDA 5F0CA 2VI6A 2G7HA 4AVPA 3NWSA 3I56I 3LSGA 1ETKA 4NNJA 2O9LA 5FD6A 3PO3J 1TWHJ 4KDPA 1J5YA 1S8NA 3KCCA 4PJNA 1RESA 3GW2A 5C4JJ 3HUGB 1FIPA 3FXJA 2QA4I 3BJAA 3TKYA 2CW0F 1T56A 3DTKA 1MSFC 2WC2A 3I0TA 4JBAA 4FASD 4D1QA 3TEDA 3LNQA 1HDPA 2QGUA 1MH3A 2H94A 1MBHA 2HWVA 3R4KA 1HSTA 1KZHA 2L7ZA 1Q1HA 2DW4A 1KU2A 2L7FP 3I53A 4KT5C 1YQAA 3D1NI 1JKRC 5JR3A 4MTDA 1R5GA 2LVSA 3MZHA 4XKCA 1R5HA 2VT2A 1HOMA 2CV0A 3BOQA 1TLHB 1VQPI 1ON2A 1ONVA 2A68F 5FFZA 3DPLC 2DOAA 5J40A 3ZQCA 3BY6A 1FMWA 3JTHA 3GMEA 2HOAA 4QWQA 1OR7A 3AKZA 1JUSA 1SD4A 4D0PA 3I59A 2NVUB 2OPTA 4D7MA 1R7JA 4GGGA 5J3LA 2D1VA 3JTGA 2O8KA 1QHGA 4XRMA 1HW5A 3C7JA 2R7XA 2QVOA 2P6TA 4BYYA 2Z5UA 1XN7A 1WJEA 2BVMA 2X85A 4KISA 2HZDA 3IH2A 2ZJQF 4HSRA 1U8RA 1DU0A 1YW9A 4XNFA 2EINH 1GT0C 1MMNA 5FKLA 4EJOA 5DM6F 4ETSA 1AKHB 2HPIA 5LGNA 1V5FA 2XPUA 1S7OA 1DUXC 5CQGA 4UUTA 4AU7A 4O5VA 1E2XA 3JRFA 3RJPA 1DDNA 4XQFA 2PLYA 2DK8A 1Z0XA 5FLVA 1MJBA 3U1DA 2RVCA 1WI3A 2VB6A 3VYSB 2OQGA 2VKEA 4IPAA 3I4NJ 2DT7B 4D5FA 5BPIA 4B3AA 2BVLA 1O3TA 1TWCJ 1O7LA 3I5UA 4UUSB 1ZRFA 2W82A 2YX4A 1SMYF 3WE2A 1V5GA 1Y0UA 1RIOH 2F2EA 2XV4S 4PFOA 2EILH 1WGXA 3OV8A 5D6EA 2GA2A 2DJNA 2XB5A 5A2QZ 3LA7A 3JREA 5L3EA 1ZH5A 3O3KA 2JRTA 1ZR2A 4YIFA 3R6SA 1B6AA 1P4AA 1TP4A 3BG7A 2AXLA 1S72I 2LKSA 2O0YA 1UHWA 2OJED 1O3SA 3BR3A 2Z3YA 1J2XA 2L7MP 4A3KJ 2F5DA 4HX7A 2ID3A 3DFGA 1ETYA 3OIPA 3AG2H 4PCQA 1O4XA 1XMXA 3KYCB 4EM0B 4OIQF 3G73A 1UG0A 4IZZA 2W48A 3K2AA 4UVBA 5LHGA 2ETHA 2G9WA 4F3QA 2BXZA 2VUMJ 4QTRA 2NNYA 3A01A 2QZ8A 2DA2A 5IYBJ 2MW8A 3HZJA 1BA5A 1KU9A 3QP6A 4L5EA 1O3RA 1WJBA 4XLNF 3CCVI 2JWTA 1ZTRA 2V9KA 3ZMUA 1MNEA 4KJZA 4BJ6C 2CSOA 4QPQA 5B3SH 4HNTA 1FZPB 3AG1H 3ZQQA 1BJAA 1IXRC 1K78B 3VWBA 1P9QC 4M3GA 1S6LA 4LK1F 2O8XA 3F23A 5LEKA 4EJVA 1W5SA 3MKWB 1R49A 3VSLA 3BG9A 3RPQA 2RNJA 1IGNA 4XMYA 2MC4A 3O8HA 5E8IA 4FETA 4G6QA 1O7FA 3VYRB 5GTHC 1X4OA 2L9SA 3SDBA 3GTLJ 2O3FA 1MZBA 5D8KB 3Q9SA 2HKOA 2JTVA 3SQNA 1IUYA 4KYWA 2ZBKA 1FYMA 4I09A 3BZKA 3H9GA 2EV6A 4ZZLA 1CF7A 4CXFA 1OCPA 1ETOA 1OPCA 2DMTA 2M2EA 1WJDA 3LSKA 1WCMJ 5E1XA 3FM3A 1ERDA 4LJZF 1D0YA 3KZZA 1FLIA 4J00A 2XKOA 2GXBA 4R1HA 4GXOA 1TWAJ 1QZYA 2OA4A 1S7AA 4CYCB 1X4PA 2STTA 3CMMA 3W6KB 5EF6A 2XSJC 2ZJ2A 2D45A 2E5ZA 1XC5A 1OCRH 1I6HJ 3L2VA 3BTLA 5IOZA 2MC3A 3OS0A 1VQ7I 2E2IJ 1SAXA 4EQQA 4Y52J 4A0YA 1JHFA 1Y56A 3HEFA 2VE8A 2V1NA 2WTEA 5J8CA 1JJ6C 1I1SA 3E7LA 5J1RA 3K4NA 1W36C 2HVSA 3TBIA 4M3DA 3VEPA 1TQIA 2KRHA 4ITVA 4AVZA 1XDSA 3HDDA 1T95A 4I02A 1RNLA 2OBPA 3RZOJ 2KZGA 2XRNA 4ASNA 1UJ8A 1MSEC 2Q1ZB 1QA6A 3CDIA 2PMZN 1A36A 3HM5A 4ENMA 2EFWA 2LF8A 2M9HA 2Q2EB 5JI6A 2BHYA 3S2HJ 5J8FA 1T98A 1Z67A 4CSWA 2CFOA 3E5XA 2CQXA 2IJLA 4HDUA 2QUFA 5E3LA 2Q0OA 1OCTC 4FE7A 4RLFA 5HDKA 3W2WA 3ZMTA 3TOBA 2ID6A 3E6MA 1JGSA 3SFIA 1G3YA 3HSRA 4ESFA 1DP7P 2YU3A 1IN5A 3M1CA 4DYRA 4UV8A 2CYYA 2HYFA 2R93J 4HV6A 1FP1D 3H9QA 4RB2C 2DFEA 1YRNB 2PI0A 4XRFA 4IHVA 5HVQC 2VQCA 2KT0A 2E19A 2DDBA 1ZELA 2DO7A 1VQMI 2G7UA 2KHMA 2CUEA 3RQ4A 2F48A 1F4KA 1DGWY 5GPAA 2E2HJ 3HBLA 1RI7A 2VE9A 4HPQA 4GYGA 4G7ZF 3G6EI 1QVTA 3BG3A 4KNYA 2IVMA 3ROUA 3UR3C 1V54H 2L7KA 3K4MA 3RTRA 2PFBA 1IUFA 4HNUA 2YU9J 3ZRGA 2VKVA 3X2QH 2RQPA 1K7AA 4FX0A 2KISA 1IRGA 3LSPA 2CW8A 1C0WA 4WWCA 1ZARA 3GLLA 3N97A 1VQNI 2R7ZJ 4KICA 5L3BA 2EV0A 2NVXJ 3CC4I 4MTEA 5IP7J 3AG4H 1TBXA 3WU2C 3F3XA 4KN7X 1YOVB 3FK6A 2O03A 1YO5C 2VN2A 2P8TA 2XAQA 3HXLA 1HCRA 3A1YA 4Q47A 2A05A 5L3FA 1QQIA 1KGSA 3FXRA 2VKDA 3E6CC 3PFIA 1BOBA 1VQ5I 3GFIA 2BV6A 2AQEA 2K9LA 1SD6A 2BZTA 2NYXA 3L7WA 2Y2ZA 2J5PA 5HNHA 1FTTA 1P2FA 1TNTA 1MBKA 1V4RA 5E8GA 1U6GA 3ZQGA 5E17F 2L5QA 1OMIA 4UHTA 1YHQI 4RGXA 1B8IB 3EUKL 1YJ9I 3M3YJ 2UXNA 2F4IA 5HODA 3EETA 4RAGA 2CH0A 3KEOA 2EWNA 3PJRA 4HF1A 4P9FA 3OWTA 1HKQA 2R92J 2IA0A 2V7FA 2R7VA 2XGEA 1Z77A 2VL8A 5C3EJ 2LKXA 3S17J 2DMPA 2PMZA 5GADJ 4N4NB 3A02A 2VQHA 4HRIA 3PO2J 2E5NA 2ZFUA 1G2HA 1P4WA 1U5TB 3HOXJ 5BMZA 2HGCA 1ZLJA 4E7IA 2G0EA 1OYIA 3K1NA 4OAYA 4ZZDA 1F5TA 2JA8J 2M4GA 2ZKZA 2LMDA 4ZC3A 3G1LA 2YR2A 3IRRA 2P81A 3K1MA 2R7WA 4WF2A 4A3GJ 4E7KA 3QU6A 1ZGJA 3BCBA 3BR6A 3BR1A 1ZAOA 1T38A 1MDMB 1MJ9A 3CQZJ 4WXDA 3OR2C 4QLCU 2HTJA 1FBSA 3QAHA 2EV5A 4IRIA 1MH4A 2DQLA 1MJAA 1TZLA 1IG7A 1R1UA 1K79A 3I64A 1MMAA 4ZDOA 2EZHA 1QU3A 2UWMA 1SFXA 3FMSA 3GXOA 3HPHA 3EUHA 2MFZA 3GTPJ 4BHBA 2DPUA 4A3BJ 3JSPA 2KKOA 2F5VA 3VOEA 4S05A 3TQNA 2F5FA 1X1PA 1Z6TA 2DOEA 5CPRB 2CUZA 2JUCA 5DUKA 3WU0A 3J81Z 4N9HA 4YFKF 3K9TA 2R5ZA 5EG0A 2DDAA 4JYKA 4EJUA 2XROA 1P7IA 1U5TC 1Q1VA 2IA2A 3PIOF 5HDGA 2COBA 1FYLA 3I4MJ 2M0MA 3RI4A 4HX8A 4PSWA 2WAQA 1YJWI 3CP8A 2V9PA 1PUFA 5DEQA 1R4MB 1G3TA 1BIBA 1R36A 2TCTA 1NK3P 2B63J 4Y13A 2KFDA 5GAGJ 1WJFA 2BEOA 2BXYA 5KAFC 1IAWA 4CH7A 2Y30A 2STWA 2XF5A 2I5UA 2ZFWA 3O6BB 2QSHX 1H89C 4QIWN 4DW6A 1JI8A 3WGHA 2XKPA 1XB4A 4N0BA 1XPXA 2FMLA 2DCEA 3E3VA 2ZJPF 4MEXF 4IVNA 1VF9A 2K40A 3CUQA 1MBGA 3PUBA 5LHIA 5L3CA 2K02A 3I58A 5GTIC 4HA8A 3NWTA 5BPDA 1I3AA 1ON1A 3C3WA 5HLTA 4E4HA 1QZEA 4KUMA 5K5RA 2CRGA 4R79A 2KP6A 3L1PA 5K7ZA 3TW7A 4ESBA 2DU9A 4F52A 3ZMDA 2WAFA 2WY8Q 5GP9A 5IPAA 1MMSA 3HGYA 1FEXA 1L0OC 2JPBA 1T0FA 3NAUA 4CGZA 5FKNA 3K2ZA 3DKXA 2R7RA 4NHJA 2OD5A 2ZO4A 1RKTA 1R9TJ 4C2UA 2E1NA 5DCMA 3DLAA 5LBQA 5D5XB 1SFEA 1ZGAA 2GOMA 3RKQA 2HPMA 3IUOA 5HS9A 3CF5F 4BS9A 1HW1A 2EZLA 2EA2A 2QKLB 3KZYA 3R0AA 2CWEA 1RR7A 1IN4A 3WTTC 3RCOA 2A3SA 4XLHA 4A3EJ 3MZ8A 4BGDA 2K3PA 1KONA 1WRJA 4A3MJ 5ED4A 4C3HJ 3FXKA 1B1BA 2L9VA 2W7NA 3GTGJ 1WPKA 2KJCA 2MLGA 1XCBA 1GXQA 4V19K 4U7DA 4BXXJ 3TO6A 3JRDA 1U2WA 1A6QA 2QM3A 3KPHA 4IKFA 3DEUA 4FCYA 1JKOC 2QBYA 4O6JA 2PJRA 2L01A 2CQNA 3OYEA 1PDNC 1U9NA 4XR6A 4ZYEA 1LFBA 3N4MA 3HOWJ 2CW7A 2LBFB 4OIOF 3REOA 2VONA 5C44J 1TL8A 3TW6A 4CDGA 3OIOA 1BI3A 1RUOA 2BY3A 3GLXA 4XKVA 2VOOA 2W24A 3DEWA 1Z05A 1VNDA 2V9VA 3FZVA 3ERMA 2LSOA 2H6BA 4XKWA 4A93J 4ZYHA 2TDXA 4A12A 3M8EA 2BY1A 4HQMA 5LEJA 1J09A 3TP0A 3OYJA 3HGGA 3LQRA 2XVCA 5DS9A 2DA1A 2Y0MA 3HHGA 1WKMA 2PN6A 4BJTA 4LFUA 4O3MA 1FY7A 1APLC 2HOTA 2R7DA 2K27A 2YSRA 3ZCOA 2NVQJ 3BTJA 2DA5A 5FGMA 3FXUA 4C2TA 4M74A 1G3WA 5KCMA 2OTLI 3DBHB 1FSEA 4NB5A 2Y31A 3RIRA 5EGOB 2HDCA 1NG6A 2ELKA 3K69A 1UELB 1ZLKA 1MBFA 3E1SA 6PAXA 4LIVA 3BROA 3E6BA 3BQZA 3DQVC 1J0RA 2GAUA 2ZJRF 4A3LJ 2QQ8A 3LMMA 1O57A 5GAHJ 3TDUC 3D5LA 2Y69H 4ZDLA 2ME6A 3VFZA 2MG4A 4DIQA 1ITYA 2L02A 4WXHA 1JTXA 1YW7A 2IGOA 5FD5A 2H1KA 4RGUA 1FTZA 1F36A 3MWMA 3GBGA 5KNLA 2HEOA 2R5YB 3H36A 4RB1A 2E7WA 1B72B 2JZYA 1XCVA 1I27A 2XUBA 2ZXWH 3ISPA 3ZQHA 5LLQA 3IH4A 3OR1C 3WTSC 4MFDA 1XSDA 4BXUA 3I9V2 2R4GA 1OQYA 1Y1VJ 3PNTA 1OISA 2DLLA 2EZIA 3DBRB 5HLHA 1H0MA 3ULQB 3QYFA 4MNUA 2Y0SN 5F08A 1TQPA 3ZOBA 4IHYA 1B9MA 1S5LC 2ECCA 4CICA 3K10A 3ELKA 4HBLA 4JOMA 2YPRA 4N4OB 2VBZA 4LLGF 3KYDB 2HYJA 4RDUA 4C3IJ 2H8RA 1ZKGA 2OAZA 4P1WA 3CP2A 3V7CA 4UB6C 1KYZA 2ECBA 2R7QA 3DTIA 2RGVA 4XM3A 2ZMEB 5H2FC 4RAFA 3A4CA 2LD5A 3J7AO 3FISA 5ICCA 3QPSA 4A3JJ 2GM4A 1TT0A 5FB2A 1MGTA 1IZ1A 4IXAA 3HSFA 1A04A 3SZPA 4A3FJ 1Y8RB 3ZMSA 1GVJA 4L5IA 1WJCA 1Z21A 4CUGA 5JHUA 5FRMA 2GIZA 2CQ7A 3AFHA 2DA6A 3H5NA 3SZTA 3IKTA 1POGA 3HL2A 1XMKA 2FJ1A 5A2QK 4II2A 5D4RA 3C2HA 2A5YB 4LG0A 3BT9A 3RYPA 2X1EA 3KLOA 4WCGA 4G7HF 1FNNA 3K70D 3JRIA 3MD2A 3PSFA 1PJRA 4BJ5C 4IHWA 2IW5A 3GO5A 2A07F 2W00A 2D5VA 4JP0A 4D7NA 5DD8A 2DA4A 1IC8A 1X3ZB 2F4MB 2DBBA 4M71A 2VBXA 4ANJA 2XGCA 4NDLA 4ON0A 1IN7A 3KIOA 4TV7A 1IRFA 2RAEA 4BE0A 3LWFA 1XMAA 1W5CC 2UUZA 2XGDA 4AD9A 3CJRB 3LAJA 5IT3A 5M5XJ 2ZMEC 4B44A 5K5OA 2QSGX 4H4KC 2OZUA 1VFCA 1XGOA 3G4SI 3M8FA 2JRMA 2DYSH 1T6SA 1MMGA 2HXIA 1USSA 1XSXA 1FWZA 3GVAA 2PMUA 3OL3A 4E6KG 2NOJB 1W4MA 3D0SA 4E70A 1GDTA 4PDKA 2W84A 3OS1A 2GA1A 1EJ9A 3J7YJ 2M8GX 1ORKA 1J59A 3QYEA 1UCRA 1S3JA 5D6FA 3BR5A 4BHPA 1ZREA 4G7OF 3NEUA 3BPVA 2F4OB 2IGKA 4HV5A 3SEZA 1DQUA 2DT5A 3LSJA 2HU9A 5AIPA 3DPUA 3GFMA 3LL7A 3M8JA 5LFAA 1V5EA 4XL9A 5DV5A 1WHUA 5CVUA 4Y4RA 2BY2A 4DOZA 4KMUX 1E0EA 2BW3B 3CJQB 3R0JA 1UHMA 3CDHA 4L0YB 2V79A 2VODA 2KIQA 1B59A 1BR2A 3QOEA 3UNGC 5DUIA 3FKIJ 3G2BA 4DBQA 5DCFA 1JHHA 3MKZA 1SVOA 4AIDA 3E97A 2RN7A 3T0YA 1OKRA 3QPLA 2A61A 2M34A 1JGGA 4S04A 2IRFG 1BM9A 3WTVC 2Z99A 2X4HA 3PNVA 3IL2A 2A69F 2K4JA 2PMHA 3HRSA 2W25A 3V42A 3RPUA 4PSXA 5CLSA 4ENJA 1BC7C 3C18A 3ABLH 1I5ZA 1GV5A 4YG2F 1R5ID 3WODF 4YIIA 4CCKA 3LSRA 2W4SA 4RB0A 5E1ZB 1H9GA 5E79C 1BR4A 1XSVA 2KDZA 2HQRA 1F9NA 3KP2A 5D8LB 2V1DA 5LD2C 2L9NA 3V7SA 4RGRA 5J47A 2FRHA 1X1CA 4XLAA 3KZIC 3DU5A 3Q0VA 5IOYA 2QQBA 1Z7LA 4RAYA 1NK2P 1PUEE 4XLCA 3HKZN 3D5SC 2K9SA 3HUGA 4BAYA 5FLXZ 3ZQIA 4G6DA 3RQIA 1MNDA 2JK3A 1FBQA 4BDZA 2EIKH 4M9ZA 1YYVA 3KLNA 4B8XA 2VPLA 2XAJA 1I39A 3W2AA 4EJWA 1SAUA 3EDPA 2CQQA 3CMYA 2OUMA 2NNNA 1SFKA 3FBIB 3ZQLA 1O3QA 4FISA 4Q4ZF 2R7SA 5FO5A 1RPWA 2KPMA 4B4CA 2MD0A 2R7UA 5E20A 2JA2A 5KHDA 1YFHA 1Y1WJ 3ZN0A 5B1BH 2O5RA 5FROA 4BEHB 2BOLA 3QOPA 4Q5SF 4BE2A 4GCVA 1FSHA 1QPMA 4BQQA 1MW7A 4OIPF 2B0LA 2R7OA 4M6XA 4OIRF 2DI3A 4AYBN 1YTYA 4YEJA 2I10A 4R8HA 1W7PD 3A0BC 1BI2A 1JT6A 3K0LA 3FM5A 4U0YA 4Y33A 4QPOA 5K1YA 4AIHA 5E3NA 3E5QA 3PFYA 1JE8A 1P7JA 3MEXA 4A0XA 1HXDA 1AKHA 1EF4A 2Z33A 1HA8A 5CVRA 5EYRA 5K7FA 3WU1B 1SFUA 3GUDA 4AIJA 3CZ6A 3KYLA 1YIJI 5DYMA 3MFKA 4QSHA 2LREA 2K85A 2MSYA 5EDNA 5LRRA 2RKHA 4CCJA 4ZYDA 3BQYA 4BQOA 2OU2A 4AUXA 4LK0F 1D1AA 4A6EA 3OYBA 2MBFA 2CFXA 3WHCA 3HOVJ 5E3OA 4UNOA 4L9TA 4UUSA 1MBJA 3QWLA 2IS2A 3H0GJ 1VI0A 1J9IA 3LSHA 4G12A 4CZZA 4BQNA 4J01A 3HSEA 1NH3A 2P7VB 2PX9A 2IA1A 3PL8A 4BXFA 3TO9A 1R71A 1MD0A 3T5XA 3MAJA 2E1CA 2F6CA 2R0QC 4NQWB 1U3EM 1SC7A 3BPXA 4ZTJA 2C6YA 2TRTA 4XOTA 3S8PA 1SD5A 4A69C 1ZR4A 1S9HA 4XBFA 3KFWX 3U2RA 3J7ZI 3DPTA 2NXNB 1XD7A 2XF7A 3COAC 4HSTA 2A5WA 4EMSA 1XGMA 4CCNA 3CUQB 2A6EF 2Z2SB 4HNVA 5LGUA 3M7GA 1BL0A 3JSOA 3WGIA 4U0WA 1FX7A 2A6TA 2GQQA 2KRCA 2M30A 3SZGA 4IO9F 1A5JA 4V2GA 4XKBA 1SANA 3F6VA 2DFIA 3SYTA 3HTSB 3K70C 2VLAA 3CO7C 4JK1X 2HI3A 4ABZA 4KIBA 1NHAA 1KA8A 4IHTA 3VPRA 1YX5A 1K78A 2CS3A 3FXMA 1BW6A 1EH7A 4HF2A 2IS6A 1MIJA 5ILUA 2EA4A 3OSGA 3OOUA 2KQRA 3WG9A 2IXSA 3M9AA 5D5WB 1LEBA 1ZG1A 1W1WE 5LHHA 3IKVA 1ETWA 2KIUA 4GRIA 4UB8C 1N77A 2O61A 4OAZA 1JKPC 3LA2A 4BU2A 2DJIA 4IHSA 2DQRA 3DBLB 1QHHD 2FOKA 3PNYA 4KT6A 1WH5A 3DXJF 3FHNA 3M4OJ 3SDGA 1X2NA 3J81K 3ZQFA 2LH9A 2GWRA 2V1XA 4U87A 4AYBA 5FKKA 2BE5F 1LE8B 2LOOA 2E60A 5GPCA 3LSMA 5HNFA 1FBUA 1I1GA 1QGPA 2ZXIA 1SMTA 4M9SA 1U0JA 5M3MJ 2R3SA 2QBYB 4BACA 4A6DA 3ECOA 3WGGA 3CLQA 5E18F 2K4BA 2ZNZA 4CYCA 2WB1N 4UV9A 4HQEA 3S15J 2FNAA 4MQ9F 3GX4X 4M72A 3C2GA 1D1CA 3W6VA 1G4DA 3DWLE 2AXTC 2YX7A 5F1RA 3LFKA 2JQ7A 2NRAC 4XRSG 3I71A 2NVYJ 4LB6B 3L2UA 1RUNA 2WWYA 4X1EA 1EH6A 1MMDA 4KFCA 3DF8A 2LRDA 4ESJA 1G8XA 2X1CA 4V2FA 2L9RA 2M4KA 2XSDC 4HYEA 2XIGA 3ZGKA 4XOPA 3IWFA 2Q2EA 2MLKA 3JAMZ 1U9OA 4RLQA 2P4WA 3E5UA 3FX3A 3EYIA 3H9JA 1YE9A 2D1HA 1ENHA 2I8DA 2K9MA 2EFNA 3P9CA 1A31A 3JRHA 4EGYA 2W1OA 2DFHA 2P0WA 4EATA 2HYGD 2EK5A 1EV7A 4BKXA 3KETA 3V8JA 3OYHA 2DFFA 2EJRA 1R1TA 1YRNA 2AO9A 4CCLA 3V4GA 1W7PB 2FBIA 3PIPF 2FEZA 1R1VA 4U7BA 5JVTA 3MKYB 1YS7A
chains in the Genus database with same CATH topology
2LDUA 2P5KA 4I98B 5TJJA 3KEQA 2DK5A 4HW0A 4WX9A 4G9YA 2E7XA 4H0EA 4LD5A 1BI1A 4BNCA 2LNBA 1KYWA 2KRFA 4A5NA 2QENA 1FPQA 2RDPA 4YFXF 4OINF 5HS8A 3ZPLA 3ZMZA 3WTYC 1XGSA 3MQ0A 4U88A 3M1EA 4UVCA 3QRFF 3AAFA 4AIKA 4L9VA 4A5MA 3H3UA 5H20A 3I59B 3QU3A 1R58A 3GZ6A 3QPTA 2P5VA 1YG2A 1KQ9A 3EQLF 2F5EA 3WE3A 3DKWA 5CYVA 5LGTA 1LDKB 1YLFA 3T1BA 1YW8A 3EYYA 4PGGA 3IC7A 1BN5A 1LDJA 4GYIA 2FMYA 5CVVA 4LMYA 4XSXF 4EM2A 1U5TA 2W85A 5F64A 3F21A 2P6SA 2ACJA 2O6GE 1HBXG 5H6QA 1OYWA 3WTUC 1RZ4A 2LF7A 2FXAA 1QO0D 2EB7A 1TW2A 3LSTA 2QQ9A 3KP5A 3T8TA 5K5QA 4G8XA 2OZ6A 3RYRA 2XAGA 2KIFA 3GWZA 5IT9Z 1MDMA 3WTWC 1T39A 3DP7A 1UFMA 4WK8F 4K2EA 2Y75A 4OU0A 4RS8A 2DAOA 3LAPA 1SD7A 3BP8A 4ENKA 3ABUA 4I7HA 4Y17A 5D5UB 3ERED 4DQ2A 1LJ9A 2PQ8A 4HZFA 5ICFA 3P9IA 4A2UA 4IRGA 2COMA 3LQQA 3GEZA 1Z1DA 2IP2A 4Y15A 3B73A 4A0ZA 4JQFA 2FSWA 4LLLA 1LEAA 4M73A 5EEGA 1IN8A 2R7FA 3L00A 2VBYA 2FA5A 2MA3A 1J75A 4XLPF 3OOPA 2PG4A 4UUVA 4RB3C 1YIOA 1REPC 1KQ8A 4EGZA 4KMFA 3RKYA 1R23A 2KIMA 2L4AA 1CF7B 3T8RA 2VC1A 4EVIA 5ICEA 1FP2A 1WWXA 4M6YA 4I01A 1BOAA 3F8MA 2PEXA 5JFRA 2FNPA 1IXSB 3PQKA 4MGRA 3NQOA 4LGWA 4FT8A 2ESHA 5HLGA 2PJPA 3HIFA 1YS6A 1JXSA 3HRTA 4EM1A 2CO5A 3J80Z 3FF5A 1TTYA 3BDDA 2GZWA 2VBWA 2HQNA 3I54A 3C1DA 1J7KA 5D4SA 2DTRA 3GFLA 4FHTA 3FMRA 4MHGA 4HAMA 2KJBA 5BOXA 2HFHA 3L2CA 4L9JA 2UZKA 2X0LA 1D8JA 5KVRA 4Z2YA 1KQ0A 3QP5A 5AIQA 2M1BA 3FHZA 1G3SA 3CJNA 3ZP5A 1IW7F 4PZJA 2OQRA 4N9IA 2VT3A 1HSJA 2F5CA 5HS7A 2A6HF 5BQTA 4WXCA 2BBYA 3BZ6A 3W6JB 3HOSA 1D3YA 2PBIA 5FLXK 2EFPA 4KN4X 2V6CA 4CO8A 1UB9A 4PGHA 1Z91A 4YFNF 1KU7A 2FBHA 1Z6RA 3IWZA 3KP3A 4FX4A 4KA4A 3TDZC 2NS0A 3QPHA 3V8LA 2XASA 1CGPA 1FYKA 1ULYA 1X3UA 3WTXC 1TNSA 2FBKA 2Y48A 2ZNYA 2JT1A 1EH8A 3FMQA 1AOYA 1BC8C 5CVJA 2ZMEA 3O2PE 2EFQA 2ESNA 2ZCWA 3KE2A 1B4AA 1MKMA 2H6CA 2FU4A 3JW4A 4HLYA 4L0ZB 3VB2A 3CTAA 3KP7A 2WV0A 3F6OA 1BBYA 4HDVA 2CGPA 3G3ZA 3F8FA 1DPUA 4UXNA 3CO6C 2FF4A 3ZMVA 1H9TA 4EJTA 1K6OA 5ICGA 2K86A 2BGCA 2QLZA 3F8BA 3GYHX 1XGNA 1WQ2A 2XAFA 2IPQX 2M45A 1LQ1A 1W5TA 1L3LA 3HHHA 3E6DA 4IF4A 1BI0A 4Q48A 1LNWA 2HS5A 2ADUA 2HOEA 1Z9CA 1ZRCA 2HTSA 4L5JA 4EV0A 4P5OA 4BQAA 4KIFA 4RGSA 4OMZA 2HKXA 4F7ZA 4ZYGA 2H27A 5L3DA 3R60A 4KIGA 2K7LA 3K1PA 4I0BA 2M87A 4LB5A 3MZYA 4G94A 3BJOA 1TQMA 2XHKA 1R22A 2IT0A 4LLNA 1KU3A 1PP7U 5ERIA 3BJ6A 2Q8KA 3V7RA 3ABTA 2Z9OA 3RDIA 3H3ZA 5AONA 4P96A 4MQVA 1P92A 1DPRA 1ZN2A 3F22A 5DCMB 5DDGA 4OOIA 3HRMA 3F8CA 2GIVA 4HF0A 3WTZA 4L18B 3L09A 5E1WA 1I6XA 2VC0A 1IF1A 2D2WA 2J5OA 3F72A 2HZTA 3JAMK 3P9KA 5EEHA 1HKTA 4IRHA 2H09A 3MCZA 1ODDA 4P55A 2VOPA 3ZQ7A 2HR3A 3FWEA 2LKPA 3CUQC 1D5VA 4BHCA 1G6NA 4ZH4F 1E17A 1QNTA 1AWCA 5H6RA 3ECHA 2AS5F 1FT9A 1LVAA 4BH9A 1B9NA 1ZRDA 1QZZA 3IHUA 2W57A 5D5VB 1VTNC 5DD4A 3TGNA 3TO7A 3SFZA 1BIAA 3SHFA 3FXQA 1FC3A 1GHCA 3SXYA 1HKSA 1LDDA 3Q5FA 3HRUA 2ELHA 1HW2A 5CVIA 2RC4A 2RV8A 2P5LC 1OYYA 1ZG5A 3HYIA 4RAZA 4B09A 1LB2A 3I4PA 4AWXB 2ISZA 4MEYF 5ILSA 3RKXA 3V8KA 2UXXA 2FE3A 3GZ5A 3PQJA 3S2WA 4DNCA 4XSZF 2L4MA 4NQWA 2MD5A 2MH2A 3ML6A 2QWWA 1IN6A 5TRDA 2BYVE 1FOKA 3VODA 1Z7UA 2QQAA 5L3GA 4M9XA 2CG4A 4I0AA 4L9NA 2P7CB 4GO1A 1GXPA 5J6XA 3B02A 5IT9K 4LG0B 1TW3A 3GF2A 3H92A 2CQKA 2L54A 1WI9A 3CUOA 1R00A 1D8KA 2ISYA 2MH9A 2M8EA 2VXZA 1T2KA 3HTUA 4HOBA 3RKWA 1STZA 2FQ3A 5FFXA 1YS7A 4P9UA 4UVAA 2L3DA 2V1UA 3Q9VA 1ZHFA 5BS6A 5HOOA 2XAHA 4HX4A 1WSUA 3NRVA 4HLXA 1U78A 3L9FA 3F8NA 5ILVA 4ENNA 2ZXJA 1XDUA 4OMYA 1ZYRF 1HQCA 3KP4A 5HDNA 3HOTA 1P6RA 3BWGA 1QBJA 1V3FA 3P7NA 2NAZA 4I2OA 3CLOA 1ZG3A 1IXCA 3ZN1A 3TOAA 3R61A 2XGXA 1P4XA 2JPCA 2JSCA 3IRQA 1S29A 3U9GA 2QYOA 2GXGA 4U0VA 1W7PA 2M5WA 5KK1A 5HLIA 4CYDA 4IJAA 3J80K 4CHUA 3GFJA 5F6FA 3DV8A 1USTA 2EFOA 1PP8F 3KP6A 1F1ZA 3LA3A 5LRSA 2DPDA 2G7HA 4AVPA 5FD6A 4KDPA 1J5YA 1S8NA 3KCCA 3GW2A 3BJAA 3TKYA 2CW0F 2WC2A 3I0TA 4JBAA 2H94A 2HWVA 3R4KA 1HSTA 1Q1HA 2DW4A 1KU2A 3I53A 4KT5C 1YQAA 5JR3A 4MTDA 1R5GA 3MZHA 1R5HA 2VT2A 3BOQA 1TLHB 1ON2A 1ONVA 2A68F 5FFZA 3DPLC 3BY6A 3JTHA 4QWQA 1OR7A 1SD4A 4D0PA 3I59A 1R7JA 4GGGA 2D1VA 3JTGA 1HW5A 3C7JA 2QVOA 2P6TA 4BYYA 2Z5UA 1XN7A 1U8RA 1YW9A 4EJOA 4ETSA 5LGNA 1DUXC 1S7OA 4O5VA 1E2XA 3RJPA 1DDNA 2PLYA 2DK8A 1MJBA 3U1DA 2RVCA 2OQGA 4IPAA 5BPIA 1O3TA 1O7LA 3I5UA 1ZRFA 2YX4A 1SMYF 3WE2A 1Y0UA 1RIOH 2F2EA 2XV4S 3OV8A 5D6EA 2GA2A 5A2QZ 3LA7A 5L3EA 1ZH5A 3O3KA 2JRTA 4YIFA 3R6SA 1B6AA 1P4AA 2AXLA 2O0YA 1UHWA 1O3SA 2Z3YA 1J2XA 2F5DA 4HX7A 3DFGA 4PCQA 4EM0B 4OIQF 3G73A 4UVBA 5LHGA 2ETHA 2G9WA 2NNYA 2QZ8A 1KU9A 3QP6A 1O3RA 4XLNF 3ZMUA 2CSOA 1FZPB 1BJAA 1IXRC 1K78B 1S6LA 4LK1F 2O8XA 3F23A 5LEKA 4EJVA 1W5SA 3RPQA 2RNJA 5E8IA 4G6QA 1O7FA 2O3FA 1MZBA 5D8KB 3Q9SA 2HKOA 2JTVA 3SQNA 1IUYA 4KYWA 2ZBKA 1FYMA 4I09A 2EV6A 4ZZLA 1CF7A 4CXFA 1OPCA 4IHSA 5E1XA 3FM3A 4LJZF 3KZZA 1FLIA 2XKOA 2GXBA 4R1HA 4GXOA 1QZYA 2OA4A 1S7AA 2STTA 3W6KB 2ZJ2A 2D45A 2MC3A 1SAXA 4EQQA 4A0YA 1JHFA 2VE8A 2WTEA 5J8CA 1I1SA 3VEPA 1TQIA 1XDSA 4I02A 1RNLA 2OBPA 2XRNA 4ASNA 4ENMA 2EFWA 2LF8A 5JI6A 5J8FA 1T98A 3E5XA 4HDUA 2IJLA 2QUFA 2Q0OA 5HDKA 3ZMTA 3TOBA 3E6MA 1JGSA 1G3YA 3HSRA 4ESFA 1DP7P 2YU3A 1IN5A 4UV8A 2CYYA 2HYFA 4HV6A 1FP1D 4RB2C 2PI0A 4XRFA 5HVQC 2DO7A 2G7UA 1F4KA 1RI7A 2VE9A 4GYGA 4G7ZF 4KNYA 2IVMA 3ROUA 3RTRA 2PFBA 2RQPA 1K7AA 4FX0A 1IRGA 1C0WA 4WWCA 1ZARA 3N97A 4KICA 5L3BA 2EV0A 4MTEA 1TBXA 3F3XA 4KN7X 2O03A 1YO5C 2VN2A 2P8TA 2XAQA 4Q47A 5L3FA 1QQIA 1KGSA 3FXRA 3E6CC 3PFIA 3GFIA 2BV6A 1SD6A 2NYXA 3L7WA 2J5PA 1P2FA 1TNTA 5E8GA 1V4RA 1U6GA 5E17F 1OMIA 4UHTA 4RGXA 2UXNA 3EETA 3KEOA 4HF1A 2EWNA 4P9FA 1HKQA 2IA0A 1P4WA 1U5TB 5BMZA 2HGCA 1ZLJA 1F5TA 1OYIA 3K1NA 4ZZDA 2ZKZA 2YR2A 3IRRA 3K1MA 4WF2A 3QU6A 1ZGJA 1ZAOA 1T38A 1MDMB 1MJ9A 4WXDA 4QLCU 2HTJA 1FBSA 3QAHA 2EV5A 4IRIA 2DQLA 1MJAA 1R1UA 1K79A 3I64A 2UWMA 1SFXA 3FMSA 3GXOA 3EUHA 4BHBA 2DPUA 3JSPA 2KKOA 3VOEA 4S05A 3TQNA 2F5FA 1Z6TA 5DUKA 3WU0A 3J81Z 4N9HA 4YFKF 3K9TA 4EJUA 2XROA 1U5TC 2IA2A 5HDGA 1FYLA 3RI4A 4HX8A 5DEQA 1G3TA 1BIBA 1R36A 4Y13A 2BEOA 1IAWA 2STWA 2ZFWA 3O6BB 3WGHA 2XKPA 1XB4A 4N0BA 2FMLA 3E3VA 4MEXF 4IVNA 3CUQA 5LHIA 5L3CA 2K02A 3I58A 4HA8A 5BPDA 3C3WA 1ON1A 4KUMA 5K5RA 4R79A 4ESBA 2DU9A 3ZMDA 1L0OC 2JPBA 1T0FA 4CGZA 3K2ZA 4NHJA 2OD5A 2ZO4A 2E1NA 5DCMA 5LBQA 5D5XB 1SFEA 1ZGAA 5HS9A 1HW1A 2EA2A 3R0AA 3KZYA 2CWEA 1IN4A 3WTTC 2A3SA 1WRJA 5ED4A 1B1BA 2KJCA 2MLGA 1XCBA 1GXQA 4U7DA 3TO6A 1U2WA 2QM3A 3DEUA 2QBYA 4O6JA 2L01A 1PDNC 4ZYEA 3N4MA 4OIOF 3REOA 2VONA 4CDGA 1BI3A 1RUOA 3GLXA 2VOOA 2W24A 1Z05A 2V9VA 3FZVA 2LSOA 2H6BA 4ZYHA 2TDXA 4A12A 3M8EA 4HQMA 5LEJA 3LQRA 2XVCA 2Y0MA 3HHGA 1WKMA 2PN6A 4LFUA 4O3MA 1FY7A 2R7DA 2K27A 2YSRA 5FGMA 3FXUA 4M74A 1G3WA 1FSEA 4NB5A 3RIRA 2HDCA 3K69A 1ZLKA 6PAXA 3BROA 3E6BA 3DQVC 1J0RA 2GAUA 1O57A 3TDUC 3D5LA 3VFZA 2L02A 4WXHA 1YW7A 5FD5A 4RGUA 3MWMA 2HEOA 4RB1A 2E7WA 2JZYA 1XCVA 1I27A 2XUBA 3ISPA 5LLQA 1XSDA 3WTSC 4BXUA 2DLLA 5HLHA 1H0MA 3ULQB 4MNUA 1TQPA 1B9MA 4CICA 3ELKA 4HBLA 2YPRA 2VBZA 4LLGF 2OAZA 3V7CA 1KYZA 2RGVA 2ZMEB 3J7AO 5ICCA 5FB2A 1MGTA 1IZ1A 4IXAA 3HSFA 1A04A 3SZPA 3ZMSA 1GVJA 4L5IA 5JHUA 3SZTA 3IKTA 1XMKA 5A2QK 5D4RA 4LG0A 2A5YB 3RYPA 3KLOA 4WCGA 4G7HF 1FNNA 2IW5A 3GO5A 2A07F 5DD8A 2DBBA 4M71A 2VBXA 4ON0A 1IN7A 4TV7A 1IRFA 3LWFA 1XMAA 4AD9A 3LAJA 5IT3A 5K5OA 2OZUA 1XGOA 3M8FA 1T6SA 1USSA 1XSXA 1FWZA 3GVAA 2PMUA 1W4MA 3D0SA 4E70A 4PDKA 2W84A 2GA1A 1J59A 1UCRA 1S3JA 5D6FA 4BHPA 4G7OF 1ZREA 3NEUA 3BPVA 4HV5A 2DT5A 5AIPA 3GFMA 5DV5A 5CVUA 4KMUX 3R0JA 1UHMA 3CDHA 4L0YB 2V79A 2VODA 1B59A 5DUIA 5DCFA 1JHHA 3E97A 2RN7A 3T0YA 1OKRA 2A61A 4S04A 2IRFG 1BM9A 3WTVC 2Z99A 2X4HA 3IL2A 2A69F 2K4JA 2PMHA 3HRSA 2W25A 3RPUA 5CLSA 4ENJA 1BC7C 3C18A 1I5ZA 4YG2F 3WODF 4YIIA 4RB0A 5E1ZB 1H9GA 1XSVA 2HQRA 1F9NA 3KP2A 5D8LB 2V1DA 3V7SA 4RGRA 2FRHA 2QQBA 4RAYA 1PUEE 3HUGA 4BAYA 5FLXZ 4G6DA 1FBQA 4M9ZA 1YYVA 3KLNA 4B8XA 2XAJA 4EJWA 3EDPA 2NNNA 1O3QA 4Q4ZF 5FO5A 5E20A 1YFHA 3ZN0A 3QOPA 4Q5SF 4GCVA 1FSHA 1QPMA 4OIPF 2B0LA 4M6XA 4OIRF 2DI3A 1YTYA 4R8HA 1W7PD 1BI2A 3K0LA 3FM5A 4U0YA 5K1YA 4AIHA 3E5QA 1JE8A 3MEXA 4A0XA 1HXDA 2Z33A 5CVRA 3WU1B 1SFUA 3GUDA 4AIJA 5DYMA 3MFKA 5LRRA 2RKHA 4ZYDA 2OU2A 4LK0F 4A6EA 2MBFA 2CFXA 4UNOA 4L9TA 1J9IA 4CZZA 3HSEA 2P7VB 2IA1A 3TO9A 1MD0A 3T5XA 3MAJA 2E1CA 1U3EM 3BPXA 2C6YA 1SD5A 4XBFA 3KFWX 3U2RA 3DPTA 1XD7A 3COAC 4EMSA 1XGMA 3CUQB 2A6EF 5LGUA 3M7GA 3JSOA 3WGIA 4U0WA 1FX7A 2GQQA 2M30A 3F6VA 2DFIA 3HTSB 3CO7C 4JK1X 4KIBA 1NHAA 1KA8A 4IHTA 1K78A 1EH7A 4HF2A 5ILUA 2EA4A 3WG9A 3M9AA 5D5WB 1LEBA 1ZG1A 5LHHA 3IKVA 2KIUA 2O61A 3LA2A 2DQRA 2FOKA 3DXJF 3J81K 2GWRA 2V1XA 2BE5F 1FBUA 1I1GA 1QGPA 1SMTA 4M9SA 2R3SA 2QBYB 4A6DA 3ECOA 3WGGA 5E18F 2K4BA 2ZNZA 4UV9A 4HQEA 2FNAA 4MQ9F 3GX4X 4M72A 1G4DA 2NRAC 2YX7A 5F1RA 3LFKA 3I71A 4LB6B 1RUNA 2WWYA 1EH6A 4KFCA 3DF8A 4ESJA 4HYEA 2XIGA 3IWFA 2Q2EA 2MLKA 3JAMZ 2P4WA 3E5UA 3FX3A 3EYIA 2D1HA 3P9CA 2EFNA 4EGYA 2HYGD 2EK5A 1EV7A 3KETA 3V8JA 2EJRA 1R1TA 3V4GA 1W7PB 2FBIA 2FEZA 1R1VA 4U7BA 5JVTA 5CJ9A
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2LDU A;  2P5K A;  4I98 B;  5TJJ A;  3KEQ A;  2DK5 A;  4HW0 A;  4WX9 A;  4G9Y A;  2E7X A;  4H0E A;  4LD5 A;  1BI1 A;  4BNC A;  2LNB A;  1KYW A;  2KRF A;  4A5N A;  2QEN A;  1FPQ A;  2RDP A;  4YFX F;  4OIN F;  5HS8 A;  3ZPL A;  3ZMZ A;  3WTY C;  1XGS A;  3MQ0 A;  4U88 A;  3M1E A;  4UVC A;  3QRF F;  3AAF A;  4AIK A;  4L9V A;  4A5M A;  3H3U A;  5H20 A;  3I59 B;  3QU3 A;  1R58 A;  3GZ6 A;  3QPT A;  2P5V A;  1YG2 A;  1KQ9 A;  3EQL F;  2F5E A;  3WE3 A;  3DKW A;  5CYV A;  5LGT A;  1LDK B;  1YLF A;  3T1B A;  1YW8 A;  3EYY A;  4PGG A;  3IC7 A;  1BN5 A;  1LDJ A;  4GYI A;  2FMY A;  5CVV A;  4LMY A;  4XSX F;  4EM2 A;  1U5T A;  2W85 A;  5F64 A;  3F21 A;  2P6S A;  2ACJ A;  2O6G E;  1HBX G;  5H6Q A;  1OYW A;  3WTU C;  1RZ4 A;  2LF7 A;  2FXA A;  1QO0 D;  2EB7 A;  1TW2 A;  3LST A;  2QQ9 A;  3KP5 A;  3T8T A;  5K5Q A;  4G8X A;  2OZ6 A;  3RYR A;  2XAG A;  2KIF A;  3GWZ A;  5IT9 Z;  1MDM A;  3WTW C;  1T39 A;  3DP7 A;  1UFM A;  4WK8 F;  4K2E A;  2Y75 A;  4OU0 A;  4RS8 A;  2DAO A;  3LAP A;  1SD7 A;  3BP8 A;  4ENK A;  3ABU A;  4I7H A;  4Y17 A;  5D5U B;  3ERE D;  4DQ2 A;  1LJ9 A;  2PQ8 A;  4HZF A;  5ICF A;  3P9I A;  4A2U A;  4IRG A;  2COM A;  3LQQ A;  3GEZ A;  1Z1D A;  2IP2 A;  4Y15 A;  3B73 A;  4A0Z A;  4JQF A;  2FSW A;  4LLL A;  1LEA A;  4M73 A;  5EEG A;  1IN8 A;  2R7F A;  3L00 A;  2VBY A;  2FA5 A;  2MA3 A;  1J75 A;  4XLP F;  3OOP A;  2PG4 A;  4UUV A;  4RB3 C;  1YIO A;  1REP C;  1KQ8 A;  4EGZ A;  4KMF A;  3RKY A;  1R23 A;  2KIM A;  2L4A A;  1CF7 B;  3T8R A;  2VC1 A;  4EVI A;  5ICE A;  1FP2 A;  1WWX A;  4M6Y A;  4I01 A;  1BOA A;  3F8M A;  2PEX A;  5JFR A;  2FNP A;  1IXS B;  3PQK A;  4MGR A;  3NQO A;  4LGW A;  4FT8 A;  2ESH A;  5HLG A;  2PJP A;  3HIF A;  1YS6 A;  1JXS A;  3HRT A;  4EM1 A;  2CO5 A;  3J80 Z;  3FF5 A;  1TTY A;  3BDD A;  2GZW A;  2VBW A;  2HQN A;  3I54 A;  3C1D A;  1J7K A;  5D4S A;  2DTR A;  3GFL A;  4FHT A;  3FMR A;  4MHG A;  4HAM A;  2KJB A;  5BOX A;  2HFH A;  3L2C A;  4L9J A;  2UZK A;  2X0L A;  1D8J A;  5KVR A;  4Z2Y A;  1KQ0 A;  3QP5 A;  5AIQ A;  2M1B A;  3FHZ A;  1G3S A;  3CJN A;  3ZP5 A;  1IW7 F;  4PZJ A;  2OQR A;  4N9I A;  2VT3 A;  1HSJ A;  2F5C A;  5HS7 A;  2A6H F;  5BQT A;  4WXC A;  2BBY A;  3BZ6 A;  3W6J B;  3HOS A;  1D3Y A;  2PBI A;  5FLX K;  2EFP A;  4KN4 X;  2V6C A;  4CO8 A;  1UB9 A;  4PGH A;  1Z91 A;  4YFN F;  1KU7 A;  2FBH A;  1Z6R A;  3IWZ A;  3KP3 A;  4FX4 A;  4KA4 A;  3TDZ C;  2NS0 A;  3QPH A;  3V8L A;  2XAS A;  1CGP A;  1FYK A;  1ULY A;  1X3U A;  3WTX C;  1TNS A;  2FBK A;  2Y48 A;  2ZNY A;  2JT1 A;  1EH8 A;  3FMQ A;  1AOY A;  1BC8 C;  5CVJ A;  2ZME A;  3O2P E;  2EFQ A;  2ESN A;  2ZCW A;  3KE2 A;  1B4A A;  1MKM A;  2H6C A;  2FU4 A;  3JW4 A;  4HLY A;  4L0Z B;  3VB2 A;  3CTA A;  3KP7 A;  2WV0 A;  3F6O A;  1BBY A;  4HDV A;  2CGP A;  3G3Z A;  3F8F A;  1DPU A;  4UXN A;  3CO6 C;  2FF4 A;  3ZMV A;  1H9T A;  4EJT A;  1K6O A;  5ICG A;  2K86 A;  2BGC A;  2QLZ A;  3F8B A;  3GYH X;  1XGN A;  1WQ2 A;  2XAF A;  2IPQ X;  2M45 A;  1LQ1 A;  1W5T A;  1L3L A;  3HHH A;  3E6D A;  4IF4 A;  1BI0 A;  4Q48 A;  1LNW A;  2HS5 A;  2ADU A;  2HOE A;  1Z9C A;  1ZRC A;  2HTS A;  4L5J A;  4EV0 A;  4P5O A;  4BQA A;  4KIF A;  4RGS A;  4OMZ A;  2HKX A;  4F7Z A;  4ZYG A;  2H27 A;  5L3D A;  3R60 A;  4KIG A;  2K7L A;  3K1P A;  4I0B A;  2M87 A;  4LB5 A;  3MZY A;  4G94 A;  3BJO A;  1TQM A;  2XHK A;  1R22 A;  2IT0 A;  4LLN A;  1KU3 A;  1PP7 U;  5ERI A;  3BJ6 A;  2Q8K A;  3V7R A;  3ABT A;  2Z9O A;  3RDI A;  3H3Z A;  5AON A;  4P96 A;  4MQV A;  1P92 A;  1DPR A;  1ZN2 A;  3F22 A;  5DCM B;  5DDG A;  4OOI A;  3HRM A;  3F8C A;  2GIV A;  4HF0 A;  3WTZ A;  4L18 B;  3L09 A;  5E1W A;  1I6X A;  2VC0 A;  1IF1 A;  2D2W A;  2J5O A;  3F72 A;  2HZT A;  3JAM K;  3P9K A;  5EEH A;  1HKT A;  4IRH A;  2H09 A;  3MCZ A;  1ODD A;  4P55 A;  2VOP A;  3ZQ7 A;  2HR3 A;  3FWE A;  2LKP A;  3CUQ C;  1D5V A;  4BHC A;  1G6N A;  4ZH4 F;  1E17 A;  1QNT A;  1AWC A;  5H6R A;  3ECH A;  2AS5 F;  1FT9 A;  1LVA A;  4BH9 A;  1B9N A;  1ZRD A;  1QZZ A;  3IHU A;  2W57 A;  5D5V B;  1VTN C;  5DD4 A;  3TGN A;  3TO7 A;  3SFZ A;  1BIA A;  3SHF A;  3FXQ A;  1FC3 A;  1GHC A;  3SXY A;  1HKS A;  1LDD A;  3Q5F A;  3HRU A;  2ELH A;  1HW2 A;  5CVI A;  2RC4 A;  2RV8 A;  2P5L C;  1OYY A;  1ZG5 A;  3HYI A;  4RAZ A;  4B09 A;  1LB2 A;  3I4P A;  4AWX B;  2ISZ A;  4MEY F;  5ILS A;  3RKX A;  3V8K A;  2UXX A;  2FE3 A;  3GZ5 A;  3PQJ A;  3S2W A;  4DNC A;  4XSZ F;  2L4M A;  4NQW A;  2MD5 A;  2MH2 A;  3ML6 A;  2QWW A;  1IN6 A;  5TRD A;  2BYV E;  1FOK A;  3VOD A;  1Z7U A;  2QQA A;  5L3G A;  4M9X A;  2CG4 A;  4I0A A;  4L9N A;  2P7C B;  4GO1 A;  1GXP A;  5J6X A;  3B02 A;  5IT9 K;  4LG0 B;  1TW3 A;  3GF2 A;  3H92 A;  2CQK A;  2L54 A;  1WI9 A;  3CUO A;  1R00 A;  1D8K A;  2ISY A;  2MH9 A;  2M8E A;  2VXZ A;  1T2K A;  3HTU A;  4HOB A;  3RKW A;  1STZ A;  2FQ3 A;  5FFX A;  1YS7 A;  4P9U A;  4UVA A;  2L3D A;  2V1U A;  3Q9V A;  1ZHF A;  5BS6 A;  5HOO A;  2XAH A;  4HX4 A;  1WSU A;  3NRV A;  4HLX A;  1U78 A;  3L9F A;  3F8N A;  5ILV A;  4ENN A;  2ZXJ A;  1XDU A;  4OMY A;  1ZYR F;  1HQC A;  3KP4 A;  5HDN A;  3HOT A;  1P6R A;  3BWG A;  1QBJ A;  1V3F A;  3P7N A;  2NAZ A;  4I2O A;  3CLO A;  1ZG3 A;  1IXC A;  3ZN1 A;  3TOA A;  3R61 A;  2XGX A;  1P4X A;  2JPC A;  2JSC A;  3IRQ A;  1S29 A;  3U9G A;  2QYO A;  2GXG A;  4U0V A;  1W7P A;  2M5W A;  5KK1 A;  5HLI A;  4CYD A;  4IJA A;  3J80 K;  4CHU A;  3GFJ A;  5F6F A;  3DV8 A;  1UST A;  2EFO A;  1PP8 F;  3KP6 A;  1F1Z A;  3LA3 A;  5LRS A;  2DPD A;  2G7H A;  4AVP A;  5FD6 A;  4KDP A;  1J5Y A;  1S8N A;  3KCC A;  3GW2 A;  3BJA A;  3TKY A;  2CW0 F;  2WC2 A;  3I0T A;  4JBA A;  2H94 A;  2HWV A;  3R4K A;  1HST A;  1Q1H A;  2DW4 A;  1KU2 A;  3I53 A;  4KT5 C;  1YQA A;  5JR3 A;  4MTD A;  1R5G A;  3MZH A;  1R5H A;  2VT2 A;  3BOQ A;  1TLH B;  1ON2 A;  1ONV A;  2A68 F;  5FFZ A;  3DPL C;  3BY6 A;  3JTH A;  4QWQ A;  1OR7 A;  1SD4 A;  4D0P A;  3I59 A;  1R7J A;  4GGG A;  2D1V A;  3JTG A;  1HW5 A;  3C7J A;  2QVO A;  2P6T A;  4BYY A;  2Z5U A;  1XN7 A;  1U8R A;  1YW9 A;  4EJO A;  4ETS A;  5LGN A;  1DUX C;  1S7O A;  4O5V A;  1E2X A;  3RJP A;  1DDN A;  2PLY A;  2DK8 A;  1MJB A;  3U1D A;  2RVC A;  2OQG A;  4IPA A;  5BPI A;  1O3T A;  1O7L A;  3I5U A;  1ZRF A;  2YX4 A;  1SMY F;  3WE2 A;  1Y0U A;  1RIO H;  2F2E A;  2XV4 S;  3OV8 A;  5D6E A;  2GA2 A;  5A2Q Z;  3LA7 A;  5L3E A;  1ZH5 A;  3O3K A;  2JRT A;  4YIF A;  3R6S A;  1B6A A;  1P4A A;  2AXL A;  2O0Y A;  1UHW A;  1O3S A;  2Z3Y A;  1J2X A;  2F5D A;  4HX7 A;  3DFG A;  4PCQ A;  4EM0 B;  4OIQ F;  3G73 A;  4UVB A;  5LHG A;  2ETH A;  2G9W A;  2NNY A;  2QZ8 A;  1KU9 A;  3QP6 A;  1O3R A;  4XLN F;  3ZMU A;  2CSO A;  1FZP B;  1BJA A;  1IXR C;  1K78 B;  1S6L A;  4LK1 F;  2O8X A;  3F23 A;  5LEK A;  4EJV A;  1W5S A;  3RPQ A;  2RNJ A;  5E8I A;  4G6Q A;  1O7F A;  2O3F A;  1MZB A;  5D8K B;  3Q9S A;  2HKO A;  2JTV A;  3SQN A;  1IUY A;  4KYW A;  2ZBK A;  1FYM A;  4I09 A;  2EV6 A;  4ZZL A;  1CF7 A;  4CXF A;  1OPC A;  4IHS A;  5E1X A;  3FM3 A;  4LJZ F;  3KZZ A;  1FLI A;  2XKO A;  2GXB A;  4R1H A;  4GXO A;  1QZY A;  2OA4 A;  1S7A A;  2STT A;  3W6K B;  2ZJ2 A;  2D45 A;  2MC3 A;  1SAX A;  4EQQ A;  4A0Y A;  1JHF A;  2VE8 A;  2WTE A;  5J8C A;  1I1S A;  3VEP A;  1TQI A;  1XDS A;  4I02 A;  1RNL A;  2OBP A;  2XRN A;  4ASN A;  4ENM A;  2EFW A;  2LF8 A;  5JI6 A;  5J8F A;  1T98 A;  3E5X A;  4HDU A;  2IJL A;  2QUF A;  2Q0O A;  5HDK A;  3ZMT A;  3TOB A;  3E6M A;  1JGS A;  1G3Y A;  3HSR A;  4ESF A;  1DP7 P;  2YU3 A;  1IN5 A;  4UV8 A;  2CYY A;  2HYF A;  4HV6 A;  1FP1 D;  4RB2 C;  2PI0 A;  4XRF A;  5HVQ C;  2DO7 A;  2G7U A;  1F4K A;  1RI7 A;  2VE9 A;  4GYG A;  4G7Z F;  4KNY A;  2IVM A;  3ROU A;  3RTR A;  2PFB A;  2RQP A;  1K7A A;  4FX0 A;  1IRG A;  1C0W A;  4WWC A;  1ZAR A;  3N97 A;  4KIC A;  5L3B A;  2EV0 A;  4MTE A;  1TBX A;  3F3X A;  4KN7 X;  2O03 A;  1YO5 C;  2VN2 A;  2P8T A;  2XAQ A;  4Q47 A;  5L3F A;  1QQI A;  1KGS A;  3FXR A;  3E6C C;  3PFI A;  3GFI A;  2BV6 A;  1SD6 A;  2NYX A;  3L7W A;  2J5P A;  1P2F A;  1TNT A;  5E8G A;  1V4R A;  1U6G A;  5E17 F;  1OMI A;  4UHT A;  4RGX A;  2UXN A;  3EET A;  3KEO A;  4HF1 A;  2EWN A;  4P9F A;  1HKQ A;  2IA0 A;  1P4W A;  1U5T B;  5BMZ A;  2HGC A;  1ZLJ A;  1F5T A;  1OYI A;  3K1N A;  4ZZD A;  2ZKZ A;  2YR2 A;  3IRR A;  3K1M A;  4WF2 A;  3QU6 A;  1ZGJ A;  1ZAO A;  1T38 A;  1MDM B;  1MJ9 A;  4WXD A;  4QLC U;  2HTJ A;  1FBS A;  3QAH A;  2EV5 A;  4IRI A;  2DQL A;  1MJA A;  1R1U A;  1K79 A;  3I64 A;  2UWM A;  1SFX A;  3FMS A;  3GXO A;  3EUH A;  4BHB A;  2DPU A;  3JSP A;  2KKO A;  3VOE A;  4S05 A;  3TQN A;  2F5F A;  1Z6T A;  5DUK A;  3WU0 A;  3J81 Z;  4N9H A;  4YFK F;  3K9T A;  4EJU A;  2XRO A;  1U5T C;  2IA2 A;  5HDG A;  1FYL A;  3RI4 A;  4HX8 A;  5DEQ A;  1G3T A;  1BIB A;  1R36 A;  4Y13 A;  2BEO A;  1IAW A;  2STW A;  2ZFW A;  3O6B B;  3WGH A;  2XKP A;  1XB4 A;  4N0B A;  2FML A;  3E3V A;  4MEX F;  4IVN A;  3CUQ A;  5LHI A;  5L3C A;  2K02 A;  3I58 A;  4HA8 A;  5BPD A;  3C3W A;  1ON1 A;  4KUM A;  5K5R A;  4R79 A;  4ESB A;  2DU9 A;  3ZMD A;  1L0O C;  2JPB A;  1T0F A;  4CGZ A;  3K2Z A;  4NHJ A;  2OD5 A;  2ZO4 A;  2E1N A;  5DCM A;  5LBQ A;  5D5X B;  1SFE A;  1ZGA A;  5HS9 A;  1HW1 A;  2EA2 A;  3R0A A;  3KZY A;  2CWE A;  1IN4 A;  3WTT C;  2A3S A;  1WRJ A;  5ED4 A;  1B1B A;  2KJC A;  2MLG A;  1XCB A;  1GXQ A;  4U7D A;  3TO6 A;  1U2W A;  2QM3 A;  3DEU A;  2QBY A;  4O6J A;  2L01 A;  1PDN C;  4ZYE A;  3N4M A;  4OIO F;  3REO A;  2VON A;  4CDG A;  1BI3 A;  1RUO A;  3GLX A;  2VOO A;  2W24 A;  1Z05 A;  2V9V A;  3FZV A;  2LSO A;  2H6B A;  4ZYH A;  2TDX A;  4A12 A;  3M8E A;  4HQM A;  5LEJ A;  3LQR A;  2XVC A;  2Y0M A;  3HHG A;  1WKM A;  2PN6 A;  4LFU A;  4O3M A;  1FY7 A;  2R7D A;  2K27 A;  2YSR A;  5FGM A;  3FXU A;  4M74 A;  1G3W A;  1FSE A;  4NB5 A;  3RIR A;  2HDC A;  3K69 A;  1ZLK A;  6PAX A;  3BRO A;  3E6B A;  3DQV C;  1J0R A;  2GAU A;  1O57 A;  3TDU C;  3D5L A;  3VFZ A;  2L02 A;  4WXH A;  1YW7 A;  5FD5 A;  4RGU A;  3MWM A;  2HEO A;  4RB1 A;  2E7W A;  2JZY A;  1XCV A;  1I27 A;  2XUB A;  3ISP A;  5LLQ A;  1XSD A;  3WTS C;  4BXU A;  2DLL A;  5HLH A;  1H0M A;  3ULQ B;  4MNU A;  1TQP A;  1B9M A;  4CIC A;  3ELK A;  4HBL A;  2YPR A;  2VBZ A;  4LLG F;  2OAZ A;  3V7C A;  1KYZ A;  2RGV A;  2ZME B;  3J7A O;  5ICC A;  5FB2 A;  1MGT A;  1IZ1 A;  4IXA A;  3HSF A;  1A04 A;  3SZP A;  3ZMS A;  1GVJ A;  4L5I A;  5JHU A;  3SZT A;  3IKT A;  1XMK A;  5A2Q K;  5D4R A;  4LG0 A;  2A5Y B;  3RYP A;  3KLO A;  4WCG A;  4G7H F;  1FNN A;  2IW5 A;  3GO5 A;  2A07 F;  5DD8 A;  2DBB A;  4M71 A;  2VBX A;  4ON0 A;  1IN7 A;  4TV7 A;  1IRF A;  3LWF A;  1XMA A;  4AD9 A;  3LAJ A;  5IT3 A;  5K5O A;  2OZU A;  1XGO A;  3M8F A;  1T6S A;  1USS A;  1XSX A;  1FWZ A;  3GVA A;  2PMU A;  1W4M A;  3D0S A;  4E70 A;  4PDK A;  2W84 A;  2GA1 A;  1J59 A;  1UCR A;  1S3J A;  5D6F A;  4BHP A;  4G7O F;  1ZRE A;  3NEU A;  3BPV A;  4HV5 A;  2DT5 A;  5AIP A;  3GFM A;  5DV5 A;  5CVU A;  4KMU X;  3R0J A;  1UHM A;  3CDH A;  4L0Y B;  2V79 A;  2VOD A;  1B59 A;  5DUI A;  5DCF A;  1JHH A;  3E97 A;  2RN7 A;  3T0Y A;  1OKR A;  2A61 A;  4S04 A;  2IRF G;  1BM9 A;  3WTV C;  2Z99 A;  2X4H A;  3IL2 A;  2A69 F;  2K4J A;  2PMH A;  3HRS A;  2W25 A;  3RPU A;  5CLS A;  4ENJ A;  1BC7 C;  3C18 A;  1I5Z A;  4YG2 F;  3WOD F;  4YII A;  4RB0 A;  5E1Z B;  1H9G A;  1XSV A;  2HQR A;  1F9N A;  3KP2 A;  5D8L B;  2V1D A;  3V7S A;  4RGR A;  2FRH A;  2QQB A;  4RAY A;  1PUE E;  3HUG A;  4BAY A;  5FLX Z;  4G6D A;  1FBQ A;  4M9Z A;  1YYV A;  3KLN A;  4B8X A;  2XAJ A;  4EJW A;  3EDP A;  2NNN A;  1O3Q A;  4Q4Z F;  5FO5 A;  5E20 A;  1YFH A;  3ZN0 A;  3QOP A;  4Q5S F;  4GCV A;  1FSH A;  1QPM A;  4OIP F;  2B0L A;  4M6X A;  4OIR F;  2DI3 A;  1YTY A;  4R8H A;  1W7P D;  1BI2 A;  3K0L A;  3FM5 A;  4U0Y A;  5K1Y A;  4AIH A;  3E5Q A;  1JE8 A;  3MEX A;  4A0X A;  1HXD A;  2Z33 A;  5CVR A;  3WU1 B;  1SFU A;  3GUD A;  4AIJ A;  5DYM A;  3MFK A;  5LRR A;  2RKH A;  4ZYD A;  2OU2 A;  4LK0 F;  4A6E A;  2MBF A;  2CFX A;  4UNO A;  4L9T A;  1J9I A;  4CZZ A;  3HSE A;  2P7V B;  2IA1 A;  3TO9 A;  1MD0 A;  3T5X A;  3MAJ A;  2E1C A;  1U3E M;  3BPX A;  2C6Y A;  1SD5 A;  4XBF A;  3KFW X;  3U2R A;  3DPT A;  1XD7 A;  3COA C;  4EMS A;  1XGM A;  3CUQ B;  2A6E F;  5LGU A;  3M7G A;  3JSO A;  3WGI A;  4U0W A;  1FX7 A;  2GQQ A;  2M30 A;  3F6V A;  2DFI A;  3HTS B;  3CO7 C;  4JK1 X;  4KIB A;  1NHA A;  1KA8 A;  4IHT A;  1K78 A;  1EH7 A;  4HF2 A;  5ILU A;  2EA4 A;  3WG9 A;  3M9A A;  5D5W B;  1LEB A;  1ZG1 A;  5LHH A;  3IKV A;  2KIU A;  2O61 A;  3LA2 A;  2DQR A;  2FOK A;  3DXJ F;  3J81 K;  2GWR A;  2V1X A;  2BE5 F;  1FBU A;  1I1G A;  1QGP A;  1SMT A;  4M9S A;  2R3S A;  2QBY B;  4A6D A;  3ECO A;  3WGG A;  5E18 F;  2K4B A;  2ZNZ A;  4UV9 A;  4HQE A;  2FNA A;  4MQ9 F;  3GX4 X;  4M72 A;  1G4D A;  2NRA C;  2YX7 A;  5F1R A;  3LFK A;  3I71 A;  4LB6 B;  1RUN A;  2WWY A;  1EH6 A;  4KFC A;  3DF8 A;  4ESJ A;  4HYE A;  2XIG A;  3IWF A;  2Q2E A;  2MLK A;  3JAM Z;  2P4W A;  3E5U A;  3FX3 A;  3EYI A;  2D1H A;  3P9C A;  2EFN A;  4EGY A;  2HYG D;  2EK5 A;  1EV7 A;  3KET A;  3V8J A;  2EJR A;  1R1T A;  3V4G A;  1W7P B;  2FBI A;  2FEZ A;  1R1V A;  4U7B A;  5JVT A;  5CJ9 A; 
#chains in the Genus database with same CATH topology
 1RC9 A;  2JMW A;  2LDU A;  2XRL A;  3GTJ J;  1VQ9 I;  2P5K A;  4I98 B;  5TJJ A;  2DN0 A;  3KEQ A;  3CCQ I;  2DK5 A;  4HW0 A;  3JRA A;  3ZR8 X;  3F0C A;  5B66 C;  4WX9 A;  4G9Y A;  4B3X A;  4RA2 A;  2E7X A;  2JA6 J;  1JUP A;  4H0E A;  2LK2 A;  4LD5 A;  3OMY A;  1BI1 A;  4BNC A;  4M3B A;  2LNB A;  1X3W B;  4CCM A;  1VQ6 I;  3FXL A;  1KYW A;  3A0H C;  3CME I;  2KRF A;  4A5N A;  2VKH A;  2QEN A;  2NS8 A;  1FPQ A;  3CCU I;  2RDP A;  3K4C A;  4YFX F;  1ZQ3 P;  2JVH A;  2GXA A;  3MKL A;  4ZYA A;  2V4J C;  4ZTF A;  3OL4 A;  2VXD A;  4OIN F;  2DMN A;  5HS8 A;  3ZPL A;  3ZMZ A;  4KIT B;  1XGS A;  3WTY C;  3H5R A;  3MQ0 A;  3TL4 X;  4U88 A;  4XRS A;  3M1E A;  4UVC A;  1AHD P;  3GTK J;  4E7L A;  4Y7N J;  3FBN B;  3QRF F;  1VQ4 I;  5C4X J;  1WJA A;  1E3P A;  1XG1 A;  3AAF A;  4AIK A;  2CUJ A;  4E7H A;  4L9V A;  4PJJ A;  3H5A A;  3P5J A;  4A5M A;  1WVR A;  3H3U A;  5H20 A;  3I59 B;  3QU3 A;  1R4N B;  1R58 A;  3GZ6 A;  1SEU A;  1B8I A;  2LFB A;  2OCE A;  2VJ4 A;  1K4T A;  4I6Z A;  4B1R A;  4BL0 B;  3L2W A;  3QPT A;  2P5V A;  1YG2 A;  2OC6 A;  1KQ9 A;  3EQL F;  2WAD A;  2F5E A;  3WE3 A;  3L2Q A;  3DKW A;  3CMA I;  5CYV A;  3QQA A;  2ME0 A;  1JTY A;  1LDK B;  1YLF A;  5LGT A;  2GOX B;  2LY2 A;  3T1B A;  3HOU J;  3HC7 A;  1YW8 A;  3EYY A;  4PGG A;  3IC7 A;  1BN5 A;  1LDJ A;  4GYI A;  2FMY A;  5CVV A;  4MO7 A;  3WG7 H;  5JVG F;  4LMY A;  4XSX F;  3HPG A;  4EM2 A;  1IRX A;  4HG2 A;  1U5T A;  2W85 A;  1W0U A;  5F64 A;  3A03 A;  3F21 A;  2P6S A;  2ACJ A;  2O6G E;  1HBX G;  5H6Q A;  1OYW A;  3WTU C;  1RZ4 A;  2IS1 A;  2LF7 A;  2FXA A;  1QO0 D;  2WY7 Q;  2EB7 A;  2JA5 J;  3KX2 A;  4PJL A;  1TW2 A;  3LST A;  4J19 A;  2QQ9 A;  3KP5 A;  3DTE A;  3T8T A;  5K5Q A;  4G8X A;  2OZ6 A;  1FOX A;  3RYR A;  2XAG A;  1JKQ C;  1Y6I A;  4GFB A;  1AU7 A;  2KIF A;  3B6C A;  3IAM 2;  1RR8 C;  3GWZ A;  5IT9 Z;  3I3L A;  1MDM A;  1OR7 C;  3N05 A;  3WTW C;  1T39 A;  2IEK A;  3DP7 A;  1LPQ A;  1F43 A;  1GVD A;  4EEF G;  1IRZ A;  1UFM A;  2EH3 A;  4DYC A;  4WK8 F;  4K2E A;  2Y75 A;  3SEQ A;  1UAA A;  1RET A;  4XID A;  4OU0 A;  4BBS J;  4RS8 A;  5J1U A;  2DAO A;  2LG4 A;  4CA0 A;  3LAP A;  1SD7 A;  3BP8 A;  4ENK A;  3ABU A;  3S1Q J;  4I7H A;  4Y17 A;  5D5U B;  1VQK I;  3ERE D;  3IP4 B;  3K4J A;  3SJM A;  4IX7 A;  4DQ2 A;  1LJ9 A;  2K5C A;  2PQ8 A;  4HZF A;  4A3C J;  3A01 B;  2EIJ H;  3KEY A;  5ICF A;  4JX5 A;  3FXO A;  3P9I A;  4IRG A;  4A2U A;  1TC3 C;  2COM A;  2KDO A;  2DA3 A;  3LQQ A;  4ZJZ A;  3GEZ A;  5JHF A;  5FKO A;  1Z1D A;  2IP2 A;  4Y15 A;  3B73 A;  4A0Z A;  4JQF A;  2OV7 A;  2FSW A;  4LLL A;  1LEA A;  3FIW A;  4M73 A;  5EEG A;  1IN8 A;  2HQA A;  5TIS C;  4BY1 J;  3M07 A;  5F04 A;  3CF2 A;  2E71 A;  2R7F A;  5GAE J;  1UZC A;  1UMQ A;  3L00 A;  3FKJ A;  4F55 A;  2HDD A;  3OYN A;  1PYV A;  2VBY A;  2CV1 A;  2FA5 A;  2MA3 A;  1J75 A;  4IHX A;  4XLP F;  3OOP A;  2PG4 A;  1ETX A;  3ABM H;  4MFE A;  4UUV A;  1ETV A;  1UHS A;  4RB3 C;  1YIO A;  1REP C;  1KQ8 A;  3IH3 A;  3ESW B;  4EGZ A;  4KMF A;  3U21 A;  1OCO H;  1VQ8 I;  3RKY A;  1T33 A;  1R23 A;  2KIM A;  2L4A A;  1CF7 B;  3T8R A;  2VC1 A;  4EVI A;  3OS2 A;  2KMU A;  4RBO A;  3DLL F;  5ICE A;  1FP2 A;  1I50 J;  1OCC H;  4G6T B;  1WWX A;  2WAE A;  3S16 J;  1WJ5 A;  4M6Y A;  4I01 A;  1BOA A;  4A3I J;  1U8B A;  3F8M A;  4A3D J;  2PEX A;  5JFR A;  2FNP A;  1IXS B;  3PQK A;  1MBE A;  5F27 A;  3DCF A;  4C3J J;  5M5Y J;  3RSN A;  1MNM C;  2IGN A;  4MGR A;  4Z6Y A;  2MYS A;  3NQO A;  5IYC J;  3JCU C;  2HVQ A;  2KL4 A;  4LGW A;  2EZK A;  4FT8 A;  2ESH A;  5HLG A;  2PJP A;  1N78 A;  3HIF A;  2B7E A;  1LFU P;  1YS6 A;  3QYB A;  3CCY A;  1FIA A;  3HRT A;  1JXS A;  3F9K A;  1BR1 A;  4EM1 A;  1D0Z A;  2DOD A;  3K4L A;  1WZ2 A;  1SVL A;  3ASN H;  1X2M A;  1N75 A;  2CO5 A;  3J80 Z;  3FF5 A;  4XIC A;  1TTY A;  3BDD A;  2RQQ A;  2GZW A;  1LFP A;  2VAS A;  1E3O C;  5IP6 A;  2VBW A;  2HQN A;  3I54 A;  3C1D A;  1J7K A;  2DA7 A;  5D4S A;  2X6Y A;  1SVM A;  2DTR A;  3GFL A;  3FK7 A;  4FHT A;  4UY8 I;  3BCA A;  3FMR A;  4MHG A;  4IQJ A;  3CCJ I;  4HAM A;  2KJB A;  5BOX A;  3S32 A;  1BJZ A;  2HFH A;  2CJJ A;  3A2K A;  3L2C A;  2LBF A;  4L9J A;  2IGM A;  3DEE A;  2UZK A;  4C30 A;  4CCO A;  1OLT A;  2X0L A;  5FJ8 J;  1D8J A;  5KVR A;  4Z2Y A;  2K9N A;  1KQ0 A;  4IEJ A;  3CCL I;  3QOD A;  3QP5 A;  2E35 A;  5AIQ A;  2WA0 A;  1FJL A;  3DKY A;  5J4Y A;  2M1B A;  3BTC A;  3FHZ A;  4YRV A;  5K7H A;  1G3S A;  4DZP A;  3AG3 H;  3CJN A;  1HF0 A;  3ZP5 A;  1IW7 F;  2IBD A;  1GLN A;  2N8G A;  2OQR A;  4N9I A;  4PZJ A;  4DJA A;  3OYF A;  2VT3 A;  1HSJ A;  2Y0S A;  3I55 I;  2F5C A;  4LOC A;  3Q3S A;  2FUG 2;  4LIU A;  5HS7 A;  3K4K A;  2A6H F;  5BQT A;  3EUA A;  5EGO A;  2XPV A;  4WXC A;  2BBY A;  3BZ6 A;  2VJJ A;  3VSK A;  4IQ4 A;  5E3M A;  3W6J B;  3HOS A;  1D3Y A;  2PBI A;  5FLX K;  2E34 A;  2EFP A;  5FRN A;  3K7A J;  4KN4 X;  1W0T A;  2V6C A;  4CO8 A;  1UB9 A;  3Q0W A;  4X6A J;  4PGH A;  1K83 J;  1Z91 A;  4YFN F;  1BW5 A;  2LR8 A;  1KU7 A;  2FBH A;  4E7J A;  2OCC H;  3BG6 A;  1NTC A;  1JUM A;  1Z6R A;  3IWZ A;  2E1M B;  3KP3 A;  3VYU B;  2R7T A;  4FX4 A;  2E36 A;  1FOW A;  3H0D A;  2R5Y A;  1H8A C;  5EJC A;  4KA4 A;  3TDZ C;  1HC8 A;  1B72 A;  1QVU A;  2NS0 A;  2AHQ A;  3DU6 A;  3OIQ A;  3QPH A;  3JR9 A;  3GTO J;  4LG3 A;  3V8L A;  1OFC X;  2XAS A;  4AM3 A;  1CGP A;  4I76 A;  1V55 H;  2DTZ A;  5CJ9 A;  1FYK A;  1JT0 A;  1D5Y A;  3LOC A;  4OWR B;  3GTQ J;  1ULY A;  1X3U A;  1UG2 A;  3WTX C;  2BY0 A;  4XOR A;  1TWG J;  1TNS A;  4MIM A;  3G1M A;  2LP0 A;  2FBK A;  2Y48 A;  1H88 C;  2L0K A;  1HLV A;  2ZNY A;  2Y9Z A;  2JT1 A;  1EH8 A;  4C2M J;  4FTH A;  3FMQ A;  1AOY A;  1BC8 C;  2FD5 A;  4PK4 A;  5CVJ A;  4E7S A;  2ZME A;  1FOY A;  3O2P E;  2EFQ A;  3CD6 I;  3K6G A;  2M0C A;  2RRE A;  2ESN A;  2ZCW A;  3KE2 A;  4DZJ A;  4YIR X;  1B4A A;  1MKM A;  2H6C A;  2HQ5 A;  4BDY A;  2FU4 A;  2VPR A;  3JW4 A;  5B5E C;  4HLY A;  4X0G A;  4L0Z B;  1EA3 A;  3VB2 A;  3CTA A;  2ZB9 A;  3HG9 A;  2DMQ A;  3KP7 A;  2WV0 A;  2E1M C;  4JX4 A;  3F6O A;  2NVT J;  1BBY A;  4HDV A;  3GZN B;  2CGP A;  2XPW A;  3G3Z A;  5JLX A;  4AC0 A;  2X6W A;  3F8F A;  2H1L A;  5CQE A;  1K6Y A;  1DPU A;  4UXN A;  3CO6 C;  2HXO A;  2FF4 A;  3D5R C;  3ZMV A;  5BNG A;  1H9T A;  2X6O A;  4NC8 A;  2QSF X;  3L2R A;  4EJT A;  1K6O A;  2VJ5 A;  5J4V A;  5ICG A;  2K86 A;  2BGC A;  2QLZ A;  3F8B A;  1VQO I;  3GYH X;  3S93 A;  1XGN A;  3CES A;  1WQ2 A;  1IJW C;  2XAF A;  2IPQ X;  4C9Y A;  2M45 A;  3C2B A;  1LQ1 A;  1W5T A;  1L3L A;  4FQG A;  1QRY A;  2ZXH A;  2R5Z B;  3MN2 A;  5EG0 B;  3HHH A;  3E6D A;  4IF4 A;  1BI0 A;  2ICW G;  3GTM J;  4Q48 A;  1XTA A;  4BBR J;  1A35 A;  1LNW A;  4JX6 A;  2M7B A;  2HS5 A;  5F0H A;  1RKW A;  2ADU A;  2EBI A;  2HOE A;  3TMO A;  1Z9C A;  1ZRC A;  4XLF A;  2HTS A;  4L5J A;  4EV0 A;  4PFP A;  4P5O A;  1PUF B;  4W1U A;  4BQA A;  4KIF A;  4RGS A;  3S14 J;  2LY9 A;  4OMZ A;  2HKX A;  4F7Z A;  2CUF A;  4ZYG A;  1T8I A;  4IOC F;  2H27 A;  1YJN I;  5L3D A;  2ELJ A;  3K4B A;  3R60 A;  1M1E B;  4KIG A;  2K7L A;  3K1P A;  2X9D A;  4I0B A;  2M87 A;  4XN3 A;  3BLY A;  4LB5 A;  3MZY A;  4G94 A;  1GUU A;  3ABK H;  1N25 A;  2FQ4 A;  3BJO A;  1TQM A;  1YX3 A;  2XHK A;  1R22 A;  2IT0 A;  3BTI A;  3NAR A;  1YIT I;  4IOA F;  4LLN A;  2X48 A;  1KU3 A;  3EUH C;  2BW3 A;  2MGQ A;  2QEX I;  2DXI A;  2IS4 A;  2JVG A;  1PP7 U;  1Y8Q B;  2M3A A;  5EZG A;  3HKZ A;  1PVE A;  1IDY A;  2EQR A;  5ERI A;  3BJ6 A;  2Q8K A;  5FKM A;  3V7R A;  3ABT A;  4E7Z A;  2Z9O A;  1IDZ A;  2ZSI B;  2LLK A;  3H3Z A;  3RDI A;  2QKM B;  1TT5 B;  2UV1 A;  1HDD C;  5AON A;  1XS9 A;  4P96 A;  4MQV A;  1P92 A;  4NBQ A;  1DPR A;  3OYI A;  2WAQ N;  1ZN2 A;  1WFX A;  2LY1 A;  3F22 A;  2GLO A;  2VJI A;  5DCM B;  3BZC A;  5DDG A;  4OOI A;  4PUS A;  3HRM A;  2Z1D A;  3F8C A;  2GIV A;  4B48 A;  4HF0 A;  3WTZ A;  4L18 B;  3L09 A;  5E1W A;  1I6X A;  2VC0 A;  4M6V A;  3RZD J;  1IF1 A;  3PM1 A;  2MAB A;  2JA7 J;  2D2W A;  1AA7 A;  4F91 B;  4F92 B;  4M3F A;  4W97 A;  2J5O A;  3F72 A;  2HZT A;  5KAI C;  3JAM K;  1X1B A;  3CCM I;  2YUS A;  3P9K A;  1K4S A;  5EEH A;  5EEA A;  2JUG A;  1HKT A;  4IRH A;  2H09 A;  3MCZ A;  1ODD A;  2X6X A;  4P55 A;  2VOP A;  4YEL A;  5DM7 F;  3ZQ7 A;  1LKX A;  2HR3 A;  2LKP A;  3FWE A;  3IV5 A;  3CUQ C;  2X1D A;  2JSP A;  1WH7 A;  4NC7 A;  1OCZ H;  1G59 A;  2PJR B;  1D5V A;  2HDW A;  3UKG A;  4BHC A;  1G6N A;  4ZH4 F;  4DYQ A;  1E17 A;  1QNT A;  2XF6 A;  1DP3 A;  1OJL A;  2H8W A;  3TP3 A;  1IO2 A;  2NOG A;  4D5C A;  1T0F C;  1AWC A;  5H6R A;  2GBY A;  3ECH A;  3GCM A;  1ACI A;  5DTD A;  2AS5 F;  1FT9 A;  1R6R A;  2QF7 A;  2HOS A;  1LVA A;  4BH9 A;  1B9N A;  1VZ0 A;  2O7O A;  3HB9 A;  1ZRD A;  2ZSH B;  1QZZ A;  3LSI A;  3OYC A;  3IHU A;  3S1M J;  2W57 A;  2VQL A;  2ZC2 A;  4BEH A;  5D5V B;  3BG5 A;  2FX0 A;  3W2V A;  1DGR M;  1VTN C;  5DD4 A;  3TGN A;  3VDX A;  3TO7 A;  4IL6 C;  3SFZ A;  1ZK8 A;  3RPU D;  1VQL I;  1Y0N A;  1BIA A;  3AL0 B;  3SHF A;  2LYC A;  5EZH A;  3FXQ A;  3OYM A;  4XK4 A;  1FC3 A;  3ONQ A;  1GHC A;  4XN0 A;  5TGT A;  3SXY A;  5F0F A;  4Y3O A;  4I99 C;  3H35 A;  5IY5 H;  1HKS A;  5M3F J;  2B9S A;  1LDD A;  3Q5F A;  3MVP A;  3FDY A;  3HRU A;  2ELH A;  1HW2 A;  2DOF A;  4FE4 A;  1X1D A;  5CVI A;  2RC4 A;  2RV8 A;  2P5L C;  2HVR A;  4PJM A;  4ZDP A;  3CCE I;  1OYY A;  4BE1 A;  5IYD J;  1DU6 A;  4BY7 J;  1Z3Y A;  1JJ8 C;  2CV2 A;  4NC6 A;  1ZG5 A;  2EIM H;  3HYI A;  4RAZ A;  4B09 A;  3I4P A;  4B43 A;  1LB2 A;  4AWX B;  4XLE A;  2ISZ A;  2CU7 A;  2KZV A;  4MEY F;  5ILS A;  3PSI A;  2DYR H;  3RKX A;  4LIT A;  4RMN A;  3V8K A;  2UXX A;  2FE3 A;  2Z16 A;  3GZ5 A;  3PQJ A;  3S2W A;  3OSF A;  3J7A Y;  2BHZ A;  3OY9 A;  4DNC A;  3OYG A;  1E3H A;  4XSZ F;  2L4M A;  1GV2 A;  4NQW A;  1D0X A;  1Y39 A;  3E0J B;  2LTP A;  2MD5 A;  2MH2 A;  3ML6 A;  1NG7 A;  2QWW A;  1Z3X A;  1XX5 A;  1IN6 A;  1SFO J;  3S1R J;  5IP9 J;  1ZGW A;  3OYL A;  3AL0 C;  5TRD A;  2BYV E;  1FOK A;  3S3N A;  2AQF A;  3WHB A;  1CQT A;  2VIX A;  3VOD A;  1Z7U A;  2QQA A;  4NUB A;  3S1N J;  2K9Q A;  5F1J A;  3S2D J;  1QPI A;  1T08 B;  5CKT A;  2NS7 A;  3HOY J;  5L3G A;  2DT6 A;  4M9X A;  3CJT B;  2CG4 A;  4RM3 A;  4I0A A;  4L9N A;  2P7C B;  2V6E A;  2WB1 A;  4GO1 A;  2OF7 A;  4D9J A;  1GXP A;  2EPF A;  3HJE A;  5J6X A;  3B02 A;  3BR2 A;  2IAI A;  5IT9 K;  3MMY B;  1D1B A;  3BR0 A;  4LG0 B;  1ETQ A;  1TW3 A;  3GF2 A;  5M5W J;  3H92 A;  2CQK A;  1TWF J;  3O8G A;  2L54 A;  3JRC A;  1WI9 A;  3CUO A;  1R00 A;  1D8K A;  2ISY A;  1I3Q J;  2M8E A;  2MH9 A;  2VXZ A;  1T2K A;  3HTU A;  4HOB A;  3CCR I;  3RKW A;  1STZ A;  2FQ3 A;  3B6A A;  2V26 A;  5FFX A;  3JRB A;  3OYA A;  1IV6 A;  2Y9Y A;  4P9U A;  4UVA A;  3G71 I;  2L3D A;  2LC2 A;  2V1U A;  1K61 A;  1LE8 A;  2VQG A;  3Q9V A;  1FMV A;  1ZHF A;  4M3E A;  3IAS 2;  3CDL A;  3CC7 I;  5BS6 A;  1A6I A;  5HOO A;  2XAH A;  4BUP A;  3HOZ J;  4MLO A;  4XON A;  3PUF A;  3S3O A;  4HX4 A;  3W3C A;  1WSU A;  2RNG A;  3NRV A;  4HLX A;  1U78 A;  3L9F A;  3F8N A;  5ILV A;  2L2O A;  4ENN A;  1X58 A;  4F93 B;  2ZXJ A;  1XDU A;  4OMY A;  1ZYR F;  1HQC A;  2XB0 X;  5FLM J;  3KP4 A;  4RM2 A;  5HDN A;  3H3V K;  3HOT A;  1S7E A;  1P6R A;  2K3F A;  3BWG A;  3VYT B;  1QBJ A;  1V3F A;  4DBR A;  3S3M A;  2XC7 A;  4GDF A;  1X1A A;  3P7N A;  2NAZ A;  3ASO H;  4II3 A;  4I2O A;  3CLO A;  1X19 A;  1W36 D;  2QCO A;  4PJ0 C;  4DGW B;  2FOW A;  4B47 A;  5J1Y A;  4CZC A;  3OYD A;  2JJ7 A;  3OYK A;  1RRJ A;  1ZG3 A;  2WBM A;  2OTJ I;  1IXC A;  3ZN1 A;  3TOA A;  3CCS I;  3R61 A;  2XGX A;  2WV1 A;  2CMP A;  1P4X A;  1EKE A;  2E1O A;  2JPC A;  2DMU A;  2JSC A;  3IRQ A;  1S29 A;  3Q0U A;  2KLO A;  5B1A H;  2E2J J;  3U9G A;  1YI2 I;  2QYO A;  1LVK A;  2GXG A;  4U0V A;  2YS9 A;  1IV8 A;  1W7P A;  2M7A A;  3G1O A;  2M5W A;  3H1C A;  5KK1 A;  3LFU A;  1LUJ B;  2XAU A;  2HNH A;  3BC8 A;  5HLI A;  4CYD A;  9ANT A;  3JRG A;  4IJA A;  3J80 K;  3U1K A;  3CC2 I;  3ZXS A;  5JLW A;  4CHU A;  3GFJ A;  2X51 A;  5F6F A;  3EPZ A;  4HEA 2;  4S0H B;  2XDV A;  3DV8 A;  1UST A;  2EFO A;  1PP8 F;  2JN6 A;  3KP6 A;  1F1Z A;  3LA3 A;  5LRS A;  2DPD A;  5F0C A;  2VI6 A;  2G7H A;  4AVP A;  3NWS A;  3I56 I;  3LSG A;  1ETK A;  4NNJ A;  2O9L A;  5FD6 A;  3PO3 J;  1TWH J;  4KDP A;  1J5Y A;  1S8N A;  3KCC A;  4PJN A;  1RES A;  3GW2 A;  5C4J J;  3HUG B;  1FIP A;  3FXJ A;  2QA4 I;  3BJA A;  3TKY A;  2CW0 F;  1T56 A;  3DTK A;  1MSF C;  2WC2 A;  3I0T A;  4JBA A;  4FAS D;  4D1Q A;  3TED A;  3LNQ A;  1HDP A;  2QGU A;  1MH3 A;  2H94 A;  1MBH A;  2HWV A;  3R4K A;  1HST A;  1KZH A;  2L7Z A;  1Q1H A;  2DW4 A;  1KU2 A;  2L7F P;  3I53 A;  4KT5 C;  1YQA A;  3D1N I;  1JKR C;  5JR3 A;  4MTD A;  1R5G A;  2LVS A;  3MZH A;  4XKC A;  1R5H A;  2VT2 A;  1HOM A;  2CV0 A;  3BOQ A;  1TLH B;  1VQP I;  1ON2 A;  1ONV A;  2A68 F;  5FFZ A;  3DPL C;  2DOA A;  5J40 A;  3ZQC A;  3BY6 A;  1FMW A;  3JTH A;  3GME A;  2HOA A;  4QWQ A;  1OR7 A;  3AKZ A;  1JUS A;  1SD4 A;  4D0P A;  3I59 A;  2NVU B;  2OPT A;  4D7M A;  1R7J A;  4GGG A;  5J3L A;  2D1V A;  3JTG A;  2O8K A;  1QHG A;  4XRM A;  1HW5 A;  3C7J A;  2R7X A;  2QVO A;  2P6T A;  4BYY A;  2Z5U A;  1XN7 A;  1WJE A;  2BVM A;  2X85 A;  4KIS A;  2HZD A;  3IH2 A;  2ZJQ F;  4HSR A;  1U8R A;  1DU0 A;  1YW9 A;  4XNF A;  2EIN H;  1GT0 C;  1MMN A;  5FKL A;  4EJO A;  5DM6 F;  4ETS A;  1AKH B;  2HPI A;  5LGN A;  1V5F A;  2XPU A;  1S7O A;  1DUX C;  5CQG A;  4UUT A;  4AU7 A;  4O5V A;  1E2X A;  3JRF A;  3RJP A;  1DDN A;  4XQF A;  2PLY A;  2DK8 A;  1Z0X A;  5FLV A;  1MJB A;  3U1D A;  2RVC A;  1WI3 A;  2VB6 A;  3VYS B;  2OQG A;  2VKE A;  4IPA A;  3I4N J;  2DT7 B;  4D5F A;  5BPI A;  4B3A A;  2BVL A;  1O3T A;  1TWC J;  1O7L A;  3I5U A;  4UUS B;  1ZRF A;  2W82 A;  2YX4 A;  1SMY F;  3WE2 A;  1V5G A;  1Y0U A;  1RIO H;  2F2E A;  2XV4 S;  4PFO A;  2EIL H;  1WGX A;  3OV8 A;  5D6E A;  2GA2 A;  2DJN A;  2XB5 A;  5A2Q Z;  3LA7 A;  3JRE A;  5L3E A;  1ZH5 A;  3O3K A;  2JRT A;  1ZR2 A;  4YIF A;  3R6S A;  1B6A A;  1P4A A;  1TP4 A;  3BG7 A;  2AXL A;  1S72 I;  2LKS A;  2O0Y A;  1UHW A;  2OJE D;  1O3S A;  3BR3 A;  2Z3Y A;  1J2X A;  2L7M P;  4A3K J;  2F5D A;  4HX7 A;  2ID3 A;  3DFG A;  1ETY A;  3OIP A;  3AG2 H;  4PCQ A;  1O4X A;  1XMX A;  3KYC B;  4EM0 B;  4OIQ F;  3G73 A;  1UG0 A;  4IZZ A;  2W48 A;  3K2A A;  4UVB A;  5LHG A;  2ETH A;  2G9W A;  4F3Q A;  2BXZ A;  2VUM J;  4QTR A;  2NNY A;  3A01 A;  2QZ8 A;  2DA2 A;  5IYB J;  2MW8 A;  3HZJ A;  1BA5 A;  1KU9 A;  3QP6 A;  4L5E A;  1O3R A;  1WJB A;  4XLN F;  3CCV I;  2JWT A;  1ZTR A;  2V9K A;  3ZMU A;  1MNE A;  4KJZ A;  4BJ6 C;  2CSO A;  4QPQ A;  5B3S H;  4HNT A;  1FZP B;  3AG1 H;  3ZQQ A;  1BJA A;  1IXR C;  1K78 B;  3VWB A;  1P9Q C;  4M3G A;  1S6L A;  4LK1 F;  2O8X A;  3F23 A;  5LEK A;  4EJV A;  1W5S A;  3MKW B;  1R49 A;  3VSL A;  3BG9 A;  3RPQ A;  2RNJ A;  1IGN A;  4XMY A;  2MC4 A;  3O8H A;  5E8I A;  4FET A;  4G6Q A;  1O7F A;  3VYR B;  5GTH C;  1X4O A;  2L9S A;  3SDB A;  3GTL J;  2O3F A;  1MZB A;  5D8K B;  3Q9S A;  2HKO A;  2JTV A;  3SQN A;  1IUY A;  4KYW A;  2ZBK A;  1FYM A;  4I09 A;  3BZK A;  3H9G A;  2EV6 A;  4ZZL A;  1CF7 A;  4CXF A;  1OCP A;  1ETO A;  1OPC A;  2DMT A;  2M2E A;  1WJD A;  3LSK A;  1WCM J;  5E1X A;  3FM3 A;  1ERD A;  4LJZ F;  1D0Y A;  3KZZ A;  1FLI A;  4J00 A;  2XKO A;  2GXB A;  4R1H A;  4GXO A;  1TWA J;  1QZY A;  2OA4 A;  1S7A A;  4CYC B;  1X4P A;  2STT A;  3CMM A;  3W6K B;  5EF6 A;  2XSJ C;  2ZJ2 A;  2D45 A;  2E5Z A;  1XC5 A;  1OCR H;  1I6H J;  3L2V A;  3BTL A;  5IOZ A;  2MC3 A;  3OS0 A;  1VQ7 I;  2E2I J;  1SAX A;  4EQQ A;  4Y52 J;  4A0Y A;  1JHF A;  1Y56 A;  3HEF A;  2VE8 A;  2V1N A;  2WTE A;  5J8C A;  1JJ6 C;  1I1S A;  3E7L A;  5J1R A;  3K4N A;  1W36 C;  2HVS A;  3TBI A;  4M3D A;  3VEP A;  1TQI A;  2KRH A;  4ITV A;  4AVZ A;  1XDS A;  3HDD A;  1T95 A;  4I02 A;  1RNL A;  2OBP A;  3RZO J;  2KZG A;  2XRN A;  4ASN A;  1UJ8 A;  1MSE C;  2Q1Z B;  1QA6 A;  3CDI A;  2PMZ N;  1A36 A;  3HM5 A;  4ENM A;  2EFW A;  2LF8 A;  2M9H A;  2Q2E B;  5JI6 A;  2BHY A;  3S2H J;  5J8F A;  1T98 A;  1Z67 A;  4CSW A;  2CFO A;  3E5X A;  2CQX A;  2IJL A;  4HDU A;  2QUF A;  5E3L A;  2Q0O A;  1OCT C;  4FE7 A;  4RLF A;  5HDK A;  3W2W A;  3ZMT A;  3TOB A;  2ID6 A;  3E6M A;  1JGS A;  3SFI A;  1G3Y A;  3HSR A;  4ESF A;  1DP7 P;  2YU3 A;  1IN5 A;  3M1C A;  4DYR A;  4UV8 A;  2CYY A;  2HYF A;  2R93 J;  4HV6 A;  1FP1 D;  3H9Q A;  4RB2 C;  2DFE A;  1YRN B;  2PI0 A;  4XRF A;  4IHV A;  5HVQ C;  2VQC A;  2KT0 A;  2E19 A;  2DDB A;  1ZEL A;  2DO7 A;  1VQM I;  2G7U A;  2KHM A;  2CUE A;  3RQ4 A;  2F48 A;  1F4K A;  1DGW Y;  5GPA A;  2E2H J;  3HBL A;  1RI7 A;  2VE9 A;  4HPQ A;  4GYG A;  4G7Z F;  3G6E I;  1QVT A;  3BG3 A;  4KNY A;  2IVM A;  3ROU A;  3UR3 C;  1V54 H;  2L7K A;  3K4M A;  3RTR A;  2PFB A;  1IUF A;  4HNU A;  2YU9 J;  3ZRG A;  2VKV A;  3X2Q H;  2RQP A;  1K7A A;  4FX0 A;  2KIS A;  1IRG A;  3LSP A;  2CW8 A;  1C0W A;  4WWC A;  1ZAR A;  3GLL A;  3N97 A;  1VQN I;  2R7Z J;  4KIC A;  5L3B A;  2EV0 A;  2NVX J;  3CC4 I;  4MTE A;  5IP7 J;  3AG4 H;  1TBX A;  3WU2 C;  3F3X A;  4KN7 X;  1YOV B;  3FK6 A;  2O03 A;  1YO5 C;  2VN2 A;  2P8T A;  2XAQ A;  3HXL A;  1HCR A;  3A1Y A;  4Q47 A;  2A05 A;  5L3F A;  1QQI A;  1KGS A;  3FXR A;  2VKD A;  3E6C C;  3PFI A;  1BOB A;  1VQ5 I;  3GFI A;  2BV6 A;  2AQE A;  2K9L A;  1SD6 A;  2BZT A;  2NYX A;  3L7W A;  2Y2Z A;  2J5P A;  5HNH A;  1FTT A;  1P2F A;  1TNT A;  1MBK A;  1V4R A;  5E8G A;  1U6G A;  3ZQG A;  5E17 F;  2L5Q A;  1OMI A;  4UHT A;  1YHQ I;  4RGX A;  1B8I B;  3EUK L;  1YJ9 I;  3M3Y J;  2UXN A;  2F4I A;  5HOD A;  3EET A;  4RAG A;  2CH0 A;  3KEO A;  2EWN A;  3PJR A;  4HF1 A;  4P9F A;  3OWT A;  1HKQ A;  2R92 J;  2IA0 A;  2V7F A;  2R7V A;  2XGE A;  1Z77 A;  2VL8 A;  5C3E J;  2LKX A;  3S17 J;  2DMP A;  2PMZ A;  5GAD J;  4N4N B;  3A02 A;  2VQH A;  4HRI A;  3PO2 J;  2E5N A;  2ZFU A;  1G2H A;  1P4W A;  1U5T B;  3HOX J;  5BMZ A;  2HGC A;  1ZLJ A;  4E7I A;  2G0E A;  1OYI A;  3K1N A;  4OAY A;  4ZZD A;  1F5T A;  2JA8 J;  2M4G A;  2ZKZ A;  2LMD A;  4ZC3 A;  3G1L A;  2YR2 A;  3IRR A;  2P81 A;  3K1M A;  2R7W A;  4WF2 A;  4A3G J;  4E7K A;  3QU6 A;  1ZGJ A;  3BCB A;  3BR6 A;  3BR1 A;  1ZAO A;  1T38 A;  1MDM B;  1MJ9 A;  3CQZ J;  4WXD A;  3OR2 C;  4QLC U;  2HTJ A;  1FBS A;  3QAH A;  2EV5 A;  4IRI A;  1MH4 A;  2DQL A;  1MJA A;  1TZL A;  1IG7 A;  1R1U A;  1K79 A;  3I64 A;  1MMA A;  4ZDO A;  2EZH A;  1QU3 A;  2UWM A;  1SFX A;  3FMS A;  3GXO A;  3HPH A;  3EUH A;  2MFZ A;  3GTP J;  4BHB A;  2DPU A;  4A3B J;  3JSP A;  2KKO A;  2F5V A;  3VOE A;  4S05 A;  3TQN A;  2F5F A;  1X1P A;  1Z6T A;  2DOE A;  5CPR B;  2CUZ A;  2JUC A;  5DUK A;  3WU0 A;  3J81 Z;  4N9H A;  4YFK F;  3K9T A;  2R5Z A;  5EG0 A;  2DDA A;  4JYK A;  4EJU A;  2XRO A;  1P7I A;  1U5T C;  1Q1V A;  2IA2 A;  3PIO F;  5HDG A;  2COB A;  1FYL A;  3I4M J;  2M0M A;  3RI4 A;  4HX8 A;  4PSW A;  2WAQ A;  1YJW I;  3CP8 A;  2V9P A;  1PUF A;  5DEQ A;  1R4M B;  1G3T A;  1BIB A;  1R36 A;  2TCT A;  1NK3 P;  2B63 J;  4Y13 A;  2KFD A;  5GAG J;  1WJF A;  2BEO A;  2BXY A;  5KAF C;  1IAW A;  4CH7 A;  2Y30 A;  2STW A;  2XF5 A;  2I5U A;  2ZFW A;  3O6B B;  2QSH X;  1H89 C;  4QIW N;  4DW6 A;  1JI8 A;  3WGH A;  2XKP A;  1XB4 A;  4N0B A;  1XPX A;  2FML A;  2DCE A;  3E3V A;  2ZJP F;  4MEX F;  4IVN A;  1VF9 A;  2K40 A;  3CUQ A;  1MBG A;  3PUB A;  5LHI A;  5L3C A;  2K02 A;  3I58 A;  5GTI C;  4HA8 A;  3NWT A;  5BPD A;  1I3A A;  1ON1 A;  3C3W A;  5HLT A;  4E4H A;  1QZE A;  4KUM A;  5K5R A;  2CRG A;  4R79 A;  2KP6 A;  3L1P A;  5K7Z A;  3TW7 A;  4ESB A;  2DU9 A;  4F52 A;  3ZMD A;  2WAF A;  2WY8 Q;  5GP9 A;  5IPA A;  1MMS A;  3HGY A;  1FEX A;  1L0O C;  2JPB A;  1T0F A;  3NAU A;  4CGZ A;  5FKN A;  3K2Z A;  3DKX A;  2R7R A;  4NHJ A;  2OD5 A;  2ZO4 A;  1RKT A;  1R9T J;  4C2U A;  2E1N A;  5DCM A;  3DLA A;  5LBQ A;  5D5X B;  1SFE A;  1ZGA A;  2GOM A;  3RKQ A;  2HPM A;  3IUO A;  5HS9 A;  3CF5 F;  4BS9 A;  1HW1 A;  2EZL A;  2EA2 A;  2QKL B;  3KZY A;  3R0A A;  2CWE A;  1RR7 A;  1IN4 A;  3WTT C;  3RCO A;  2A3S A;  4XLH A;  4A3E J;  3MZ8 A;  4BGD A;  2K3P A;  1KON A;  1WRJ A;  4A3M J;  5ED4 A;  4C3H J;  3FXK A;  1B1B A;  2L9V A;  2W7N A;  3GTG J;  1WPK A;  2KJC A;  2MLG A;  1XCB A;  1GXQ A;  4V19 K;  4U7D A;  4BXX J;  3TO6 A;  3JRD A;  1U2W A;  1A6Q A;  2QM3 A;  3KPH A;  4IKF A;  3DEU A;  4FCY A;  1JKO C;  2QBY A;  4O6J A;  2PJR A;  2L01 A;  2CQN A;  3OYE A;  1PDN C;  1U9N A;  4XR6 A;  4ZYE A;  1LFB A;  3N4M A;  3HOW J;  2CW7 A;  2LBF B;  4OIO F;  3REO A;  2VON A;  5C44 J;  1TL8 A;  3TW6 A;  4CDG A;  3OIO A;  1BI3 A;  1RUO A;  2BY3 A;  3GLX A;  4XKV A;  2VOO A;  2W24 A;  3DEW A;  1Z05 A;  1VND A;  2V9V A;  3FZV A;  3ERM A;  2LSO A;  2H6B A;  4XKW A;  4A93 J;  4ZYH A;  2TDX A;  4A12 A;  3M8E A;  2BY1 A;  4HQM A;  5LEJ A;  1J09 A;  3TP0 A;  3OYJ A;  3HGG A;  3LQR A;  2XVC A;  5DS9 A;  2DA1 A;  2Y0M A;  3HHG A;  1WKM A;  2PN6 A;  4BJT A;  4LFU A;  4O3M A;  1FY7 A;  1APL C;  2HOT A;  2R7D A;  2K27 A;  2YSR A;  3ZCO A;  2NVQ J;  3BTJ A;  2DA5 A;  5FGM A;  3FXU A;  4C2T A;  4M74 A;  1G3W A;  5KCM A;  2OTL I;  3DBH B;  1FSE A;  4NB5 A;  2Y31 A;  3RIR A;  5EGO B;  2HDC A;  1NG6 A;  2ELK A;  3K69 A;  1UEL B;  1ZLK A;  1MBF A;  3E1S A;  6PAX A;  4LIV A;  3BRO A;  3E6B A;  3BQZ A;  3DQV C;  1J0R A;  2GAU A;  2ZJR F;  4A3L J;  2QQ8 A;  3LMM A;  1O57 A;  5GAH J;  3TDU C;  3D5L A;  2Y69 H;  4ZDL A;  2ME6 A;  3VFZ A;  2MG4 A;  4DIQ A;  1ITY A;  2L02 A;  4WXH A;  1JTX A;  1YW7 A;  2IGO A;  5FD5 A;  2H1K A;  4RGU A;  1FTZ A;  1F36 A;  3MWM A;  3GBG A;  5KNL A;  2HEO A;  2R5Y B;  3H36 A;  4RB1 A;  2E7W A;  1B72 B;  2JZY A;  1XCV A;  1I27 A;  2XUB A;  2ZXW H;  3ISP A;  3ZQH A;  5LLQ A;  3IH4 A;  3OR1 C;  3WTS C;  4MFD A;  1XSD A;  4BXU A;  3I9V 2;  2R4G A;  1OQY A;  1Y1V J;  3PNT A;  1OIS A;  2DLL A;  2EZI A;  3DBR B;  5HLH A;  1H0M A;  3ULQ B;  3QYF A;  4MNU A;  2Y0S N;  5F08 A;  1TQP A;  3ZOB A;  4IHY A;  1B9M A;  1S5L C;  2ECC A;  4CIC A;  3K10 A;  3ELK A;  4HBL A;  4JOM A;  2YPR A;  4N4O B;  2VBZ A;  4LLG F;  3KYD B;  2HYJ A;  4RDU A;  4C3I J;  2H8R A;  1ZKG A;  2OAZ A;  4P1W A;  3CP2 A;  3V7C A;  4UB6 C;  1KYZ A;  2ECB A;  2R7Q A;  3DTI A;  2RGV A;  4XM3 A;  2ZME B;  5H2F C;  4RAF A;  3A4C A;  2LD5 A;  3J7A O;  3FIS A;  5ICC A;  3QPS A;  4A3J J;  2GM4 A;  1TT0 A;  5FB2 A;  1MGT A;  1IZ1 A;  4IXA A;  3HSF A;  1A04 A;  3SZP A;  4A3F J;  1Y8R B;  3ZMS A;  1GVJ A;  4L5I A;  1WJC A;  1Z21 A;  4CUG A;  5JHU A;  5FRM A;  2GIZ A;  2CQ7 A;  3AFH A;  2DA6 A;  3H5N A;  3SZT A;  3IKT A;  1POG A;  3HL2 A;  1XMK A;  2FJ1 A;  5A2Q K;  4II2 A;  5D4R A;  3C2H A;  2A5Y B;  4LG0 A;  3BT9 A;  3RYP A;  2X1E A;  3KLO A;  4WCG A;  4G7H F;  1FNN A;  3K70 D;  3JRI A;  3MD2 A;  3PSF A;  1PJR A;  4BJ5 C;  4IHW A;  2IW5 A;  3GO5 A;  2A07 F;  2W00 A;  2D5V A;  4JP0 A;  4D7N A;  5DD8 A;  2DA4 A;  1IC8 A;  1X3Z B;  2F4M B;  2DBB A;  4M71 A;  2VBX A;  4ANJ A;  2XGC A;  4NDL A;  4ON0 A;  1IN7 A;  3KIO A;  4TV7 A;  1IRF A;  2RAE A;  4BE0 A;  3LWF A;  1XMA A;  1W5C C;  2UUZ A;  2XGD A;  4AD9 A;  3CJR B;  3LAJ A;  5IT3 A;  5M5X J;  2ZME C;  4B44 A;  5K5O A;  2QSG X;  4H4K C;  2OZU A;  1VFC A;  1XGO A;  3G4S I;  3M8F A;  2JRM A;  2DYS H;  1T6S A;  1MMG A;  2HXI A;  1USS A;  1XSX A;  1FWZ A;  3GVA A;  2PMU A;  3OL3 A;  4E6K G;  2NOJ B;  1W4M A;  3D0S A;  4E70 A;  1GDT A;  4PDK A;  2W84 A;  3OS1 A;  2GA1 A;  1EJ9 A;  3J7Y J;  2M8G X;  1ORK A;  1J59 A;  3QYE A;  1UCR A;  1S3J A;  5D6F A;  3BR5 A;  4BHP A;  1ZRE A;  4G7O F;  3NEU A;  3BPV A;  2F4O B;  2IGK A;  4HV5 A;  3SEZ A;  1DQU A;  2DT5 A;  3LSJ A;  2HU9 A;  5AIP A;  3DPU A;  3GFM A;  3LL7 A;  3M8J A;  5LFA A;  1V5E A;  4XL9 A;  5DV5 A;  1WHU A;  5CVU A;  4Y4R A;  2BY2 A;  4DOZ A;  4KMU X;  1E0E A;  2BW3 B;  3CJQ B;  3R0J A;  1UHM A;  3CDH A;  4L0Y B;  2V79 A;  2VOD A;  2KIQ A;  1B59 A;  1BR2 A;  3QOE A;  3UNG C;  5DUI A;  3FKI J;  3G2B A;  4DBQ A;  5DCF A;  1JHH A;  3MKZ A;  1SVO A;  4AID A;  3E97 A;  2RN7 A;  3T0Y A;  1OKR A;  3QPL A;  2A61 A;  2M34 A;  1JGG A;  4S04 A;  2IRF G;  1BM9 A;  3WTV C;  2Z99 A;  2X4H A;  3PNV A;  3IL2 A;  2A69 F;  2K4J A;  2PMH A;  3HRS A;  2W25 A;  3V42 A;  3RPU A;  4PSX A;  5CLS A;  4ENJ A;  1BC7 C;  3C18 A;  3ABL H;  1I5Z A;  1GV5 A;  4YG2 F;  1R5I D;  3WOD F;  4YII A;  4CCK A;  3LSR A;  2W4S A;  4RB0 A;  5E1Z B;  1H9G A;  5E79 C;  1BR4 A;  1XSV A;  2KDZ A;  2HQR A;  1F9N A;  3KP2 A;  5D8L B;  2V1D A;  5LD2 C;  2L9N A;  3V7S A;  4RGR A;  5J47 A;  2FRH A;  1X1C A;  4XLA A;  3KZI C;  3DU5 A;  3Q0V A;  5IOY A;  2QQB A;  1Z7L A;  4RAY A;  1NK2 P;  1PUE E;  4XLC A;  3HKZ N;  3D5S C;  2K9S A;  3HUG A;  4BAY A;  5FLX Z;  3ZQI A;  4G6D A;  3RQI A;  1MND A;  2JK3 A;  1FBQ A;  4BDZ A;  2EIK H;  4M9Z A;  1YYV A;  3KLN A;  4B8X A;  2VPL A;  2XAJ A;  1I39 A;  3W2A A;  4EJW A;  1SAU A;  3EDP A;  2CQQ A;  3CMY A;  2OUM A;  2NNN A;  1SFK A;  3FBI B;  3ZQL A;  1O3Q A;  4FIS A;  4Q4Z F;  2R7S A;  5FO5 A;  1RPW A;  2KPM A;  4B4C A;  2MD0 A;  2R7U A;  5E20 A;  2JA2 A;  5KHD A;  1YFH A;  1Y1W J;  3ZN0 A;  5B1B H;  2O5R A;  5FRO A;  4BEH B;  2BOL A;  3QOP A;  4Q5S F;  4BE2 A;  4GCV A;  1FSH A;  1QPM A;  4BQQ A;  1MW7 A;  4OIP F;  2B0L A;  2R7O A;  4M6X A;  4OIR F;  2DI3 A;  4AYB N;  1YTY A;  4YEJ A;  2I10 A;  4R8H A;  1W7P D;  3A0B C;  1BI2 A;  1JT6 A;  3K0L A;  3FM5 A;  4U0Y A;  4Y33 A;  4QPO A;  5K1Y A;  4AIH A;  5E3N A;  3E5Q A;  3PFY A;  1JE8 A;  1P7J A;  3MEX A;  4A0X A;  1HXD A;  1AKH A;  1EF4 A;  2Z33 A;  1HA8 A;  5CVR A;  5EYR A;  5K7F A;  3WU1 B;  1SFU A;  3GUD A;  4AIJ A;  3CZ6 A;  3KYL A;  1YIJ I;  5DYM A;  3MFK A;  4QSH A;  2LRE A;  2K85 A;  2MSY A;  5EDN A;  5LRR A;  2RKH A;  4CCJ A;  4ZYD A;  3BQY A;  4BQO A;  2OU2 A;  4AUX A;  4LK0 F;  1D1A A;  4A6E A;  3OYB A;  2MBF A;  2CFX A;  3WHC A;  3HOV J;  5E3O A;  4UNO A;  4L9T A;  4UUS A;  1MBJ A;  3QWL A;  2IS2 A;  3H0G J;  1VI0 A;  1J9I A;  3LSH A;  4G12 A;  4CZZ A;  4BQN A;  4J01 A;  3HSE A;  1NH3 A;  2P7V B;  2PX9 A;  2IA1 A;  3PL8 A;  4BXF A;  3TO9 A;  1R71 A;  1MD0 A;  3T5X A;  3MAJ A;  2E1C A;  2F6C A;  2R0Q C;  4NQW B;  1U3E M;  1SC7 A;  3BPX A;  4ZTJ A;  2C6Y A;  2TRT A;  4XOT A;  3S8P A;  1SD5 A;  4A69 C;  1ZR4 A;  1S9H A;  4XBF A;  3KFW X;  3U2R A;  3J7Z I;  3DPT A;  2NXN B;  1XD7 A;  2XF7 A;  3COA C;  4HST A;  2A5W A;  4EMS A;  1XGM A;  4CCN A;  3CUQ B;  2A6E F;  2Z2S B;  4HNV A;  5LGU A;  3M7G A;  1BL0 A;  3JSO A;  3WGI A;  4U0W A;  1FX7 A;  2A6T A;  2GQQ A;  2KRC A;  2M30 A;  3SZG A;  4IO9 F;  1A5J A;  4V2G A;  4XKB A;  1SAN A;  3F6V A;  2DFI A;  3SYT A;  3HTS B;  3K70 C;  2VLA A;  3CO7 C;  4JK1 X;  2HI3 A;  4ABZ A;  4KIB A;  1NHA A;  1KA8 A;  4IHT A;  3VPR A;  1YX5 A;  1K78 A;  2CS3 A;  3FXM A;  1BW6 A;  1EH7 A;  4HF2 A;  2IS6 A;  1MIJ A;  5ILU A;  2EA4 A;  3OSG A;  3OOU A;  2KQR A;  3WG9 A;  2IXS A;  3M9A A;  5D5W B;  1LEB A;  1ZG1 A;  1W1W E;  5LHH A;  3IKV A;  1ETW A;  2KIU A;  4GRI A;  4UB8 C;  1N77 A;  2O61 A;  4OAZ A;  1JKP C;  3LA2 A;  4BU2 A;  2DJI A;  4IHS A;  2DQR A;  3DBL B;  1QHH D;  2FOK A;  3PNY A;  4KT6 A;  1WH5 A;  3DXJ F;  3FHN A;  3M4O J;  3SDG A;  1X2N A;  3J81 K;  3ZQF A;  2LH9 A;  2GWR A;  2V1X A;  4U87 A;  4AYB A;  5FKK A;  2BE5 F;  1LE8 B;  2LOO A;  2E60 A;  5GPC A;  3LSM A;  5HNF A;  1FBU A;  1I1G A;  1QGP A;  2ZXI A;  1SMT A;  4M9S A;  1U0J A;  5M3M J;  2R3S A;  2QBY B;  4BAC A;  4A6D A;  3ECO A;  3WGG A;  3CLQ A;  5E18 F;  2K4B A;  2ZNZ A;  4CYC A;  2WB1 N;  4UV9 A;  4HQE A;  3S15 J;  2FNA A;  4MQ9 F;  3GX4 X;  4M72 A;  3C2G A;  1D1C A;  3W6V A;  1G4D A;  3DWL E;  2AXT C;  2YX7 A;  5F1R A;  3LFK A;  2JQ7 A;  2NRA C;  4XRS G;  3I71 A;  2NVY J;  4LB6 B;  3L2U A;  1RUN A;  2WWY A;  4X1E A;  1EH6 A;  1MMD A;  4KFC A;  3DF8 A;  2LRD A;  4ESJ A;  1G8X A;  2X1C A;  4V2F A;  2L9R A;  2M4K A;  2XSD C;  4HYE A;  2XIG A;  3ZGK A;  4XOP A;  3IWF A;  2Q2E A;  2MLK A;  3JAM Z;  1U9O A;  4RLQ A;  2P4W A;  3E5U A;  3FX3 A;  3EYI A;  3H9J A;  1YE9 A;  2D1H A;  1ENH A;  2I8D A;  2K9M A;  2EFN A;  3P9C A;  1A31 A;  3JRH A;  4EGY A;  2W1O A;  2DFH A;  2P0W A;  4EAT A;  2HYG D;  2EK5 A;  1EV7 A;  4BKX A;  3KET A;  3V8J A;  3OYH A;  2DFF A;  2EJR A;  1R1T A;  1YRN A;  2AO9 A;  4CCL A;  3V4G A;  1W7P B;  2FBI A;  3PIP F;  2FEZ A;  1R1V A;  4U7B A;  5JVT A;  3MKY B;  1YS7 A; 
#chains in the Genus database with same CATH homology
 2LDU A;  2P5K A;  4I98 B;  5TJJ A;  3KEQ A;  2DK5 A;  4HW0 A;  4WX9 A;  4G9Y A;  2E7X A;  4H0E A;  4LD5 A;  1BI1 A;  4BNC A;  2LNB A;  1KYW A;  2KRF A;  4A5N A;  2QEN A;  1FPQ A;  2RDP A;  4YFX F;  4OIN F;  5HS8 A;  3ZPL A;  3ZMZ A;  3WTY C;  1XGS A;  3MQ0 A;  4U88 A;  3M1E A;  4UVC A;  3QRF F;  3AAF A;  4AIK A;  4L9V A;  4A5M A;  3H3U A;  5H20 A;  3I59 B;  3QU3 A;  1R58 A;  3GZ6 A;  3QPT A;  2P5V A;  1YG2 A;  1KQ9 A;  3EQL F;  2F5E A;  3WE3 A;  3DKW A;  5CYV A;  5LGT A;  1LDK B;  1YLF A;  3T1B A;  1YW8 A;  3EYY A;  4PGG A;  3IC7 A;  1BN5 A;  1LDJ A;  4GYI A;  2FMY A;  5CVV A;  4LMY A;  4XSX F;  4EM2 A;  1U5T A;  2W85 A;  5F64 A;  3F21 A;  2P6S A;  2ACJ A;  2O6G E;  1HBX G;  5H6Q A;  1OYW A;  3WTU C;  1RZ4 A;  2LF7 A;  2FXA A;  1QO0 D;  2EB7 A;  1TW2 A;  3LST A;  2QQ9 A;  3KP5 A;  3T8T A;  5K5Q A;  4G8X A;  2OZ6 A;  3RYR A;  2XAG A;  2KIF A;  3GWZ A;  5IT9 Z;  1MDM A;  3WTW C;  1T39 A;  3DP7 A;  1UFM A;  4WK8 F;  4K2E A;  2Y75 A;  4OU0 A;  4RS8 A;  2DAO A;  3LAP A;  1SD7 A;  3BP8 A;  4ENK A;  3ABU A;  4I7H A;  4Y17 A;  5D5U B;  3ERE D;  4DQ2 A;  1LJ9 A;  2PQ8 A;  4HZF A;  5ICF A;  3P9I A;  4A2U A;  4IRG A;  2COM A;  3LQQ A;  3GEZ A;  1Z1D A;  2IP2 A;  4Y15 A;  3B73 A;  4A0Z A;  4JQF A;  2FSW A;  4LLL A;  1LEA A;  4M73 A;  5EEG A;  1IN8 A;  2R7F A;  3L00 A;  2VBY A;  2FA5 A;  2MA3 A;  1J75 A;  4XLP F;  3OOP A;  2PG4 A;  4UUV A;  4RB3 C;  1YIO A;  1REP C;  1KQ8 A;  4EGZ A;  4KMF A;  3RKY A;  1R23 A;  2KIM A;  2L4A A;  1CF7 B;  3T8R A;  2VC1 A;  4EVI A;  5ICE A;  1FP2 A;  1WWX A;  4M6Y A;  4I01 A;  1BOA A;  3F8M A;  2PEX A;  5JFR A;  2FNP A;  1IXS B;  3PQK A;  4MGR A;  3NQO A;  4LGW A;  4FT8 A;  2ESH A;  5HLG A;  2PJP A;  3HIF A;  1YS6 A;  1JXS A;  3HRT A;  4EM1 A;  2CO5 A;  3J80 Z;  3FF5 A;  1TTY A;  3BDD A;  2GZW A;  2VBW A;  2HQN A;  3I54 A;  3C1D A;  1J7K A;  5D4S A;  2DTR A;  3GFL A;  4FHT A;  3FMR A;  4MHG A;  4HAM A;  2KJB A;  5BOX A;  2HFH A;  3L2C A;  4L9J A;  2UZK A;  2X0L A;  1D8J A;  5KVR A;  4Z2Y A;  1KQ0 A;  3QP5 A;  5AIQ A;  2M1B A;  3FHZ A;  1G3S A;  3CJN A;  3ZP5 A;  1IW7 F;  4PZJ A;  2OQR A;  4N9I A;  2VT3 A;  1HSJ A;  2F5C A;  5HS7 A;  2A6H F;  5BQT A;  4WXC A;  2BBY A;  3BZ6 A;  3W6J B;  3HOS A;  1D3Y A;  2PBI A;  5FLX K;  2EFP A;  4KN4 X;  2V6C A;  4CO8 A;  1UB9 A;  4PGH A;  1Z91 A;  4YFN F;  1KU7 A;  2FBH A;  1Z6R A;  3IWZ A;  3KP3 A;  4FX4 A;  4KA4 A;  3TDZ C;  2NS0 A;  3QPH A;  3V8L A;  2XAS A;  1CGP A;  1FYK A;  1ULY A;  1X3U A;  3WTX C;  1TNS A;  2FBK A;  2Y48 A;  2ZNY A;  2JT1 A;  1EH8 A;  3FMQ A;  1AOY A;  1BC8 C;  5CVJ A;  2ZME A;  3O2P E;  2EFQ A;  2ESN A;  2ZCW A;  3KE2 A;  1B4A A;  1MKM A;  2H6C A;  2FU4 A;  3JW4 A;  4HLY A;  4L0Z B;  3VB2 A;  3CTA A;  3KP7 A;  2WV0 A;  3F6O A;  1BBY A;  4HDV A;  2CGP A;  3G3Z A;  3F8F A;  1DPU A;  4UXN A;  3CO6 C;  2FF4 A;  3ZMV A;  1H9T A;  4EJT A;  1K6O A;  5ICG A;  2K86 A;  2BGC A;  2QLZ A;  3F8B A;  3GYH X;  1XGN A;  1WQ2 A;  2XAF A;  2IPQ X;  2M45 A;  1LQ1 A;  1W5T A;  1L3L A;  3HHH A;  3E6D A;  4IF4 A;  1BI0 A;  4Q48 A;  1LNW A;  2HS5 A;  2ADU A;  2HOE A;  1Z9C A;  1ZRC A;  2HTS A;  4L5J A;  4EV0 A;  4P5O A;  4BQA A;  4KIF A;  4RGS A;  4OMZ A;  2HKX A;  4F7Z A;  4ZYG A;  2H27 A;  5L3D A;  3R60 A;  4KIG A;  2K7L A;  3K1P A;  4I0B A;  2M87 A;  4LB5 A;  3MZY A;  4G94 A;  3BJO A;  1TQM A;  2XHK A;  1R22 A;  2IT0 A;  4LLN A;  1KU3 A;  1PP7 U;  5ERI A;  3BJ6 A;  2Q8K A;  3V7R A;  3ABT A;  2Z9O A;  3RDI A;  3H3Z A;  5AON A;  4P96 A;  4MQV A;  1P92 A;  1DPR A;  1ZN2 A;  3F22 A;  5DCM B;  5DDG A;  4OOI A;  3HRM A;  3F8C A;  2GIV A;  4HF0 A;  3WTZ A;  4L18 B;  3L09 A;  5E1W A;  1I6X A;  2VC0 A;  1IF1 A;  2D2W A;  2J5O A;  3F72 A;  2HZT A;  3JAM K;  3P9K A;  5EEH A;  1HKT A;  4IRH A;  2H09 A;  3MCZ A;  1ODD A;  4P55 A;  2VOP A;  3ZQ7 A;  2HR3 A;  3FWE A;  2LKP A;  3CUQ C;  1D5V A;  4BHC A;  1G6N A;  4ZH4 F;  1E17 A;  1QNT A;  1AWC A;  5H6R A;  3ECH A;  2AS5 F;  1FT9 A;  1LVA A;  4BH9 A;  1B9N A;  1ZRD A;  1QZZ A;  3IHU A;  2W57 A;  5D5V B;  1VTN C;  5DD4 A;  3TGN A;  3TO7 A;  3SFZ A;  1BIA A;  3SHF A;  3FXQ A;  1FC3 A;  1GHC A;  3SXY A;  1HKS A;  1LDD A;  3Q5F A;  3HRU A;  2ELH A;  1HW2 A;  5CVI A;  2RC4 A;  2RV8 A;  2P5L C;  1OYY A;  1ZG5 A;  3HYI A;  4RAZ A;  4B09 A;  1LB2 A;  3I4P A;  4AWX B;  2ISZ A;  4MEY F;  5ILS A;  3RKX A;  3V8K A;  2UXX A;  2FE3 A;  3GZ5 A;  3PQJ A;  3S2W A;  4DNC A;  4XSZ F;  2L4M A;  4NQW A;  2MD5 A;  2MH2 A;  3ML6 A;  2QWW A;  1IN6 A;  5TRD A;  2BYV E;  1FOK A;  3VOD A;  1Z7U A;  2QQA A;  5L3G A;  4M9X A;  2CG4 A;  4I0A A;  4L9N A;  2P7C B;  4GO1 A;  1GXP A;  5J6X A;  3B02 A;  5IT9 K;  4LG0 B;  1TW3 A;  3GF2 A;  3H92 A;  2CQK A;  2L54 A;  1WI9 A;  3CUO A;  1R00 A;  1D8K A;  2ISY A;  2MH9 A;  2M8E A;  2VXZ A;  1T2K A;  3HTU A;  4HOB A;  3RKW A;  1STZ A;  2FQ3 A;  5FFX A;  1YS7 A;  4P9U A;  4UVA A;  2L3D A;  2V1U A;  3Q9V A;  1ZHF A;  5BS6 A;  5HOO A;  2XAH A;  4HX4 A;  1WSU A;  3NRV A;  4HLX A;  1U78 A;  3L9F A;  3F8N A;  5ILV A;  4ENN A;  2ZXJ A;  1XDU A;  4OMY A;  1ZYR F;  1HQC A;  3KP4 A;  5HDN A;  3HOT A;  1P6R A;  3BWG A;  1QBJ A;  1V3F A;  3P7N A;  2NAZ A;  4I2O A;  3CLO A;  1ZG3 A;  1IXC A;  3ZN1 A;  3TOA A;  3R61 A;  2XGX A;  1P4X A;  2JPC A;  2JSC A;  3IRQ A;  1S29 A;  3U9G A;  2QYO A;  2GXG A;  4U0V A;  1W7P A;  2M5W A;  5KK1 A;  5HLI A;  4CYD A;  4IJA A;  3J80 K;  4CHU A;  3GFJ A;  5F6F A;  3DV8 A;  1UST A;  2EFO A;  1PP8 F;  3KP6 A;  1F1Z A;  3LA3 A;  5LRS A;  2DPD A;  2G7H A;  4AVP A;  5FD6 A;  4KDP A;  1J5Y A;  1S8N A;  3KCC A;  3GW2 A;  3BJA A;  3TKY A;  2CW0 F;  2WC2 A;  3I0T A;  4JBA A;  2H94 A;  2HWV A;  3R4K A;  1HST A;  1Q1H A;  2DW4 A;  1KU2 A;  3I53 A;  4KT5 C;  1YQA A;  5JR3 A;  4MTD A;  1R5G A;  3MZH A;  1R5H A;  2VT2 A;  3BOQ A;  1TLH B;  1ON2 A;  1ONV A;  2A68 F;  5FFZ A;  3DPL C;  3BY6 A;  3JTH A;  4QWQ A;  1OR7 A;  1SD4 A;  4D0P A;  3I59 A;  1R7J A;  4GGG A;  2D1V A;  3JTG A;  1HW5 A;  3C7J A;  2QVO A;  2P6T A;  4BYY A;  2Z5U A;  1XN7 A;  1U8R A;  1YW9 A;  4EJO A;  4ETS A;  5LGN A;  1DUX C;  1S7O A;  4O5V A;  1E2X A;  3RJP A;  1DDN A;  2PLY A;  2DK8 A;  1MJB A;  3U1D A;  2RVC A;  2OQG A;  4IPA A;  5BPI A;  1O3T A;  1O7L A;  3I5U A;  1ZRF A;  2YX4 A;  1SMY F;  3WE2 A;  1Y0U A;  1RIO H;  2F2E A;  2XV4 S;  3OV8 A;  5D6E A;  2GA2 A;  5A2Q Z;  3LA7 A;  5L3E A;  1ZH5 A;  3O3K A;  2JRT A;  4YIF A;  3R6S A;  1B6A A;  1P4A A;  2AXL A;  2O0Y A;  1UHW A;  1O3S A;  2Z3Y A;  1J2X A;  2F5D A;  4HX7 A;  3DFG A;  4PCQ A;  4EM0 B;  4OIQ F;  3G73 A;  4UVB A;  5LHG A;  2ETH A;  2G9W A;  2NNY A;  2QZ8 A;  1KU9 A;  3QP6 A;  1O3R A;  4XLN F;  3ZMU A;  2CSO A;  1FZP B;  1BJA A;  1IXR C;  1K78 B;  1S6L A;  4LK1 F;  2O8X A;  3F23 A;  5LEK A;  4EJV A;  1W5S A;  3RPQ A;  2RNJ A;  5E8I A;  4G6Q A;  1O7F A;  2O3F A;  1MZB A;  5D8K B;  3Q9S A;  2HKO A;  2JTV A;  3SQN A;  1IUY A;  4KYW A;  2ZBK A;  1FYM A;  4I09 A;  2EV6 A;  4ZZL A;  1CF7 A;  4CXF A;  1OPC A;  4IHS A;  5E1X A;  3FM3 A;  4LJZ F;  3KZZ A;  1FLI A;  2XKO A;  2GXB A;  4R1H A;  4GXO A;  1QZY A;  2OA4 A;  1S7A A;  2STT A;  3W6K B;  2ZJ2 A;  2D45 A;  2MC3 A;  1SAX A;  4EQQ A;  4A0Y A;  1JHF A;  2VE8 A;  2WTE A;  5J8C A;  1I1S A;  3VEP A;  1TQI A;  1XDS A;  4I02 A;  1RNL A;  2OBP A;  2XRN A;  4ASN A;  4ENM A;  2EFW A;  2LF8 A;  5JI6 A;  5J8F A;  1T98 A;  3E5X A;  4HDU A;  2IJL A;  2QUF A;  2Q0O A;  5HDK A;  3ZMT A;  3TOB A;  3E6M A;  1JGS A;  1G3Y A;  3HSR A;  4ESF A;  1DP7 P;  2YU3 A;  1IN5 A;  4UV8 A;  2CYY A;  2HYF A;  4HV6 A;  1FP1 D;  4RB2 C;  2PI0 A;  4XRF A;  5HVQ C;  2DO7 A;  2G7U A;  1F4K A;  1RI7 A;  2VE9 A;  4GYG A;  4G7Z F;  4KNY A;  2IVM A;  3ROU A;  3RTR A;  2PFB A;  2RQP A;  1K7A A;  4FX0 A;  1IRG A;  1C0W A;  4WWC A;  1ZAR A;  3N97 A;  4KIC A;  5L3B A;  2EV0 A;  4MTE A;  1TBX A;  3F3X A;  4KN7 X;  2O03 A;  1YO5 C;  2VN2 A;  2P8T A;  2XAQ A;  4Q47 A;  5L3F A;  1QQI A;  1KGS A;  3FXR A;  3E6C C;  3PFI A;  3GFI A;  2BV6 A;  1SD6 A;  2NYX A;  3L7W A;  2J5P A;  1P2F A;  1TNT A;  5E8G A;  1V4R A;  1U6G A;  5E17 F;  1OMI A;  4UHT A;  4RGX A;  2UXN A;  3EET A;  3KEO A;  4HF1 A;  2EWN A;  4P9F A;  1HKQ A;  2IA0 A;  1P4W A;  1U5T B;  5BMZ A;  2HGC A;  1ZLJ A;  1F5T A;  1OYI A;  3K1N A;  4ZZD A;  2ZKZ A;  2YR2 A;  3IRR A;  3K1M A;  4WF2 A;  3QU6 A;  1ZGJ A;  1ZAO A;  1T38 A;  1MDM B;  1MJ9 A;  4WXD A;  4QLC U;  2HTJ A;  1FBS A;  3QAH A;  2EV5 A;  4IRI A;  2DQL A;  1MJA A;  1R1U A;  1K79 A;  3I64 A;  2UWM A;  1SFX A;  3FMS A;  3GXO A;  3EUH A;  4BHB A;  2DPU A;  3JSP A;  2KKO A;  3VOE A;  4S05 A;  3TQN A;  2F5F A;  1Z6T A;  5DUK A;  3WU0 A;  3J81 Z;  4N9H A;  4YFK F;  3K9T A;  4EJU A;  2XRO A;  1U5T C;  2IA2 A;  5HDG A;  1FYL A;  3RI4 A;  4HX8 A;  5DEQ A;  1G3T A;  1BIB A;  1R36 A;  4Y13 A;  2BEO A;  1IAW A;  2STW A;  2ZFW A;  3O6B B;  3WGH A;  2XKP A;  1XB4 A;  4N0B A;  2FML A;  3E3V A;  4MEX F;  4IVN A;  3CUQ A;  5LHI A;  5L3C A;  2K02 A;  3I58 A;  4HA8 A;  5BPD A;  3C3W A;  1ON1 A;  4KUM A;  5K5R A;  4R79 A;  4ESB A;  2DU9 A;  3ZMD A;  1L0O C;  2JPB A;  1T0F A;  4CGZ A;  3K2Z A;  4NHJ A;  2OD5 A;  2ZO4 A;  2E1N A;  5DCM A;  5LBQ A;  5D5X B;  1SFE A;  1ZGA A;  5HS9 A;  1HW1 A;  2EA2 A;  3R0A A;  3KZY A;  2CWE A;  1IN4 A;  3WTT C;  2A3S A;  1WRJ A;  5ED4 A;  1B1B A;  2KJC A;  2MLG A;  1XCB A;  1GXQ A;  4U7D A;  3TO6 A;  1U2W A;  2QM3 A;  3DEU A;  2QBY A;  4O6J A;  2L01 A;  1PDN C;  4ZYE A;  3N4M A;  4OIO F;  3REO A;  2VON A;  4CDG A;  1BI3 A;  1RUO A;  3GLX A;  2VOO A;  2W24 A;  1Z05 A;  2V9V A;  3FZV A;  2LSO A;  2H6B A;  4ZYH A;  2TDX A;  4A12 A;  3M8E A;  4HQM A;  5LEJ A;  3LQR A;  2XVC A;  2Y0M A;  3HHG A;  1WKM A;  2PN6 A;  4LFU A;  4O3M A;  1FY7 A;  2R7D A;  2K27 A;  2YSR A;  5FGM A;  3FXU A;  4M74 A;  1G3W A;  1FSE A;  4NB5 A;  3RIR A;  2HDC A;  3K69 A;  1ZLK A;  6PAX A;  3BRO A;  3E6B A;  3DQV C;  1J0R A;  2GAU A;  1O57 A;  3TDU C;  3D5L A;  3VFZ A;  2L02 A;  4WXH A;  1YW7 A;  5FD5 A;  4RGU A;  3MWM A;  2HEO A;  4RB1 A;  2E7W A;  2JZY A;  1XCV A;  1I27 A;  2XUB A;  3ISP A;  5LLQ A;  1XSD A;  3WTS C;  4BXU A;  2DLL A;  5HLH A;  1H0M A;  3ULQ B;  4MNU A;  1TQP A;  1B9M A;  4CIC A;  3ELK A;  4HBL A;  2YPR A;  2VBZ A;  4LLG F;  2OAZ A;  3V7C A;  1KYZ A;  2RGV A;  2ZME B;  3J7A O;  5ICC A;  5FB2 A;  1MGT A;  1IZ1 A;  4IXA A;  3HSF A;  1A04 A;  3SZP A;  3ZMS A;  1GVJ A;  4L5I A;  5JHU A;  3SZT A;  3IKT A;  1XMK A;  5A2Q K;  5D4R A;  4LG0 A;  2A5Y B;  3RYP A;  3KLO A;  4WCG A;  4G7H F;  1FNN A;  2IW5 A;  3GO5 A;  2A07 F;  5DD8 A;  2DBB A;  4M71 A;  2VBX A;  4ON0 A;  1IN7 A;  4TV7 A;  1IRF A;  3LWF A;  1XMA A;  4AD9 A;  3LAJ A;  5IT3 A;  5K5O A;  2OZU A;  1XGO A;  3M8F A;  1T6S A;  1USS A;  1XSX A;  1FWZ A;  3GVA A;  2PMU A;  1W4M A;  3D0S A;  4E70 A;  4PDK A;  2W84 A;  2GA1 A;  1J59 A;  1UCR A;  1S3J A;  5D6F A;  4BHP A;  4G7O F;  1ZRE A;  3NEU A;  3BPV A;  4HV5 A;  2DT5 A;  5AIP A;  3GFM A;  5DV5 A;  5CVU A;  4KMU X;  3R0J A;  1UHM A;  3CDH A;  4L0Y B;  2V79 A;  2VOD A;  1B59 A;  5DUI A;  5DCF A;  1JHH A;  3E97 A;  2RN7 A;  3T0Y A;  1OKR A;  2A61 A;  4S04 A;  2IRF G;  1BM9 A;  3WTV C;  2Z99 A;  2X4H A;  3IL2 A;  2A69 F;  2K4J A;  2PMH A;  3HRS A;  2W25 A;  3RPU A;  5CLS A;  4ENJ A;  1BC7 C;  3C18 A;  1I5Z A;  4YG2 F;  3WOD F;  4YII A;  4RB0 A;  5E1Z B;  1H9G A;  1XSV A;  2HQR A;  1F9N A;  3KP2 A;  5D8L B;  2V1D A;  3V7S A;  4RGR A;  2FRH A;  2QQB A;  4RAY A;  1PUE E;  3HUG A;  4BAY A;  5FLX Z;  4G6D A;  1FBQ A;  4M9Z A;  1YYV A;  3KLN A;  4B8X A;  2XAJ A;  4EJW A;  3EDP A;  2NNN A;  1O3Q A;  4Q4Z F;  5FO5 A;  5E20 A;  1YFH A;  3ZN0 A;  3QOP A;  4Q5S F;  4GCV A;  1FSH A;  1QPM A;  4OIP F;  2B0L A;  4M6X A;  4OIR F;  2DI3 A;  1YTY A;  4R8H A;  1W7P D;  1BI2 A;  3K0L A;  3FM5 A;  4U0Y A;  5K1Y A;  4AIH A;  3E5Q A;  1JE8 A;  3MEX A;  4A0X A;  1HXD A;  2Z33 A;  5CVR A;  3WU1 B;  1SFU A;  3GUD A;  4AIJ A;  5DYM A;  3MFK A;  5LRR A;  2RKH A;  4ZYD A;  2OU2 A;  4LK0 F;  4A6E A;  2MBF A;  2CFX A;  4UNO A;  4L9T A;  1J9I A;  4CZZ A;  3HSE A;  2P7V B;  2IA1 A;  3TO9 A;  1MD0 A;  3T5X A;  3MAJ A;  2E1C A;  1U3E M;  3BPX A;  2C6Y A;  1SD5 A;  4XBF A;  3KFW X;  3U2R A;  3DPT A;  1XD7 A;  3COA C;  4EMS A;  1XGM A;  3CUQ B;  2A6E F;  5LGU A;  3M7G A;  3JSO A;  3WGI A;  4U0W A;  1FX7 A;  2GQQ A;  2M30 A;  3F6V A;  2DFI A;  3HTS B;  3CO7 C;  4JK1 X;  4KIB A;  1NHA A;  1KA8 A;  4IHT A;  1K78 A;  1EH7 A;  4HF2 A;  5ILU A;  2EA4 A;  3WG9 A;  3M9A A;  5D5W B;  1LEB A;  1ZG1 A;  5LHH A;  3IKV A;  2KIU A;  2O61 A;  3LA2 A;  2DQR A;  2FOK A;  3DXJ F;  3J81 K;  2GWR A;  2V1X A;  2BE5 F;  1FBU A;  1I1G A;  1QGP A;  1SMT A;  4M9S A;  2R3S A;  2QBY B;  4A6D A;  3ECO A;  3WGG A;  5E18 F;  2K4B A;  2ZNZ A;  4UV9 A;  4HQE A;  2FNA A;  4MQ9 F;  3GX4 X;  4M72 A;  1G4D A;  2NRA C;  2YX7 A;  5F1R A;  3LFK A;  3I71 A;  4LB6 B;  1RUN A;  2WWY A;  1EH6 A;  4KFC A;  3DF8 A;  4ESJ A;  4HYE A;  2XIG A;  3IWF A;  2Q2E A;  2MLK A;  3JAM Z;  2P4W A;  3E5U A;  3FX3 A;  3EYI A;  2D1H A;  3P9C A;  2EFN A;  4EGY A;  2HYG D;  2EK5 A;  1EV7 A;  3KET A;  3V8J A;  2EJR A;  1R1T A;  3V4G A;  1W7P B;  2FBI A;  2FEZ A;  1R1V A;  4U7B A;  5JVT A;  5CJ9 A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...