2RV8A

Solution structure of the phop dna-binding domain from mycobacterium tuberculosis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
molecule tags Dna binding protein
molecule keywords DNA-binding response regulator
publication title Solution structure of the PhoP DNA-binding domain from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis cas/nitr204
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rv8A00
2ESNA 4HZFA 2DTRA 5D5WB 2E1CA 3WTSC 3V4GA 3CO6C 3LA3A 2E7WA 1WWXA 1Z9CA 3ZN0A 4L18B 1LQ1A 2V79A 1LDKB 1ZARA 3V7SA 1U8RA 2RV8A 3MAJA 2EFPA 1P2FA 1ZG1A 1A04A 2ZNZA 1SD4A 4I98B 1AOYA 3GWZA 4K2EA 2R7DA 5DD8A 1TQPA 5HDGA 4ON0A 1HQCA 3C3WA 5L3GA 3LQRA 4U0YA 3GO5A 3R0JA 1K7AA 2CW0F 3QAHA 4EM0B 4Z2YA 1UHWA 3E5UA 1T98A 4A0YA 1FBSA 2PQ8A 3WGIA 2QBYB 4HX4A 3V8LA 3GFJA 4IVNA 1KA8A 1I27A 5CVRA 1T6SA 1O3QA 5BS6A 5L3EA 4KN7X 2FMLA 4OIRF 3BWGA 1LEAA 2DAOA 3FMSA 5L3DA 1H9GA 1F9NA 2E1NA 1Z91A 2HZTA 2HOEA 5E8IA 4AVPA 1LDDA 1R00A 4EJOA 4YFNF 4YIIA 3R4KA 1U2WA 2FNPA 2STWA 1G3TA 2Q0OA 2GAUA 1IRGA 5H6QA 3RPUA 4O6JA 1FP2A 3JAMK 1U78A 5D6EA 4MTEA 4YIFA 3VFZA 3QPHA 1HBXG 3MZHA 4BH9A 3F72A 3J80K 3LAJA 3HOTA 1HW2A 5D4RA 1IW7F 1WRJA 1BM9A 2R3SA 5JFRA 1ZYRF 1KQ9A 5LHHA 1FP1D 5JHUA 5F64A 3U9GA 4M73A 2AS5F 3K1NA 4A0XA 3M7GA 1ON2A 3WTVC 2EJRA 1EV7A 4EM2A 3ZMSA 1I1SA 3I59A 3CJNA 1FY7A 3RKXA 3BP8A 3DPLC 3IKVA 3R60A 1LNWA 1F5TA 3T8TA 3O3KA 3EQLF 1YYVA 3KEQA 2H27A 4HDUA 4Y17A 2HR3A 4MHGA 1JHFA 1GVJA 3I59B 2BGCA 1K79A 2K4BA 2MA3A 4EQQA 1Y0UA 5F1RA 1LVAA 2HQRA 3HSEA 2Z5UA 4M6YA 1JE8A 1QO0D 2FBKA 3OV8A 4L9NA 1ZAOA 2STTA 2FF4A 1MJAA 5LHIA 4OMZA 3QU6A 2OZUA 4LLGF 3LA2A 2P6SA 1L0OC 5D5VB 4N9HA 1FX7A 3EYIA 4XSXF 3SHFA 4I7HA 4RAYA 4A0ZA 1W5SA 1B6AA 1RI7A 3VODA 3KP3A 1YS6A 4XLPF 3O2PE 2ACJA 3KP7A 3J81K 5FGMA 1ONVA 2NNYA 1OPCA 2KRFA 3HIFA 4KT5C 1XMKA 3V7RA 1YIOA 3SXYA 3HTSB 5EEGA 2HWVA 2BBYA 4BQAA 3B73A 1BC7C 2ADUA 4XRFA 4RS8A 3WU0A 4R8HA 4BAYA 2A61A 1DUXC 2ZJ2A 4N9IA 5E17F 4PGGA 1WI9A 1ZN2A 4PZJA 2QZ8A 3F23A 1HW5A 5JI6A 2DU9A 3SZPA 2XV4S 2HGCA 3P9IA 1EH8A 4S04A 3QOPA 2VE8A 5HS9A 4GXOA 1TW3A 4UV8A 1MJBA 2Z3YA 3P9KA 2DT5A 3RPQA 3JW4A 4Q47A 3WTTC 4UXNA 1QBJA 1TTYA 3V8JA 1TQIA 4BHPA 2LF8A 4WXHA 2JZYA 2MH2A 3FWEA 3T8RA 5H6RA 5AONA 2J5OA 4M9ZA 5DV5A 2COMA 5LBQA 1BI0A 2P7CB 1FSHA 4PGHA 1KU2A 4CICA 1QQIA 3GZ6A 1J7KA 5ED4A 1TW2A 4UHTA 2ZNYA 1FBQA 3HYIA 1I1GA 4F7ZA 3WGHA 2L4AA 2P5LC 4D0PA 2PI0A 1UFMA 2A5YB 1J0RA 4ENKA 1IN6A 2GWRA 5CVJA 2KIFA 4EJWA 1SFUA 2H6CA 5A2QK 1YTYA 3GFMA 3GUDA 2JPBA 2CFXA 4QWQA 1HKSA 1XSDA 2QWWA 3E6CC 3KP2A 1MDMB 3Q9VA 2DK8A 2HS5A 4UV9A 3L00A 1K6OA 4LB5A 4LG0B 2YPRA 1R1TA 1RNLA 2C6YA 5CLSA 5BMZA 2OQGA 4WXDA 4UUVA 3HRUA 3QRFF 2F5DA 2OA4A 2Y0MA 1O7FA 4UVCA 4AD9A 4A12A 4PCQA 1TQMA 1ZHFA 3E5QA 5ILVA 5L3FA 2VBXA 1XGNA 2H94A 1T38A 1G4DA 6PAXA 2M8EA 4A5MA 2VBWA 2RQPA 1LB2A 3ZMDA 1IAWA 3FMQA 2F2EA 1XSVA 1KQ0A 4ZH4F 4ASNA 1U5TA 1ZG5A 3K69A 5CJ9A 4LD5A 3PQJA 2L3DA 4RGRA 1VTNC 1U3EM 1P6RA 4I02A 4EM1A 5IT9K 1YLFA 1ZLJA 3FXUA 1ZRFA 4G6DA 2FE3A 4ENNA 3V8KA 3WODF 1ODDA 1OKRA 3T1BA 3LAPA 3TDUC 1YW9A 1P4WA 3RKWA 4IRGA 3M8EA 3MCZA 1B1BA 3E3VA 1FYKA 3WTUC 1HKQA 3R0AA 1JHHA 2FEZA 1MD0A 2V1XA 4KMFA 2IPQX 2VE9A 1R58A 2PLYA 4G6QA 4H0EA 1XSXA 4HW0A 1RUOA 3FXRA 3KCCA 2DPUA 1USSA 2Z9OA 5AIPA 4CO8A 1J75A 1ZRCA 3E6MA 2P5VA 4OOIA 2XRNA 1J2XA 3SZTA 1KGSA 1BI1A 2G7UA 3C18A 4MGRA 2XAQA 3S2WA 4YFXF 4JBAA 5ICEA 4P5OA 1YO5C 2Z33A 3F8FA 3CUQC 3QPTA 2EK5A 3PFIA 4GYGA 4CXFA 3K2ZA 4OIPF 4RB3C 5K5RA 2WWYA 3H3ZA 2DPDA 1IZ1A 1FOKA 4M72A 3ML6A 1T39A 1XDSA 2W84A 5HLGA 1HSJA 1FLIA 3GFIA 2IJLA 1DP7P 4I09A 1D8JA 1SD5A 2P4WA 4G9YA 2QQAA 4L5IA 5F6FA 5LRSA 1R23A 4L9TA 5J6XA 5FLXK 2HFHA 3W6KB 4U7BA 4AWXB 2ZFWA 2QBYA 4XSZF 4WCGA 4U7DA 2DK5A 1S29A 2QM3A 1IN8A 3U2RA 2X4HA 3L09A 4PDKA 1PP7U 1B9NA 1R5HA 3J7AO 4HQMA 4HOBA 4YFKF 5LEKA 5K5OA 1UB9A 2ELHA 4Q5SF 4ZZDA 2IA2A 2DFIA 3QU3A 4LGWA 2GQQA 1XMAA 5D5XB 4M9SA 3REOA 2D45A 2WV0A 3CUQA 2K7LA 3GF2A 1ZH5A 5FFXA 5FFZA 4IF4A 2JTVA 2KKOA 3RKYA 2XASA 2CO5A 4KFCA 1TNSA 2EFQA 3GEZA 3ZQ7A 4EV0A 1KU3A 3CUQB 4HV6A 4Q48A 4M71A 4CGZA 1IRFA 3BJOA 3EYYA 3ECHA 2DO7A 1ZGJA 2LDUA 5DDGA 2EA2A 1F4KA 3I4PA 4NQWA 4I2OA 3GZ5A 2HYFA 2WC2A 4IRIA 5L3BA 2O61A 3I64A 3BJAA 2V6CA 5LGNA 1O3TA 1D3YA 2F5FA 4FX4A 3T5XA 2W25A 3TGNA 5DCMA 5E18F 4QLCU 1U6GA 1KU7A 1BOAA 3I71A 2UXXA 4P96A 3KZZA 1W7PA 3KFWX 1IN5A 3AAFA 5DCMB 4RGXA 1B9MA 3TKYA 4IHSA 5JVTA 2XAHA 3L9FA 3I5UA 4CYDA 4MQVA 2L4MA 2MLGA 4OIOF 5HLIA 1W7PB 1FC3A 2JSCA 2XKPA 1J9IA 2RGVA 4BNCA 3ABTA 1L3LA 1FBUA 5BQTA 4GCVA 4IPAA 1TBXA 3DXJF 4BYYA 1BIAA 4HV5A 1UCRA 1Z05A 3COAC 1CF7B 5DYMA 5ILUA 3ABUA 3JSPA 3K1MA 4MQ9F 2O3FA 4L0ZB 4OMYA 2VC0A 2CQKA 4M6XA 2DQLA 1P92A 3ZMTA 2ZMEB 2P5KA 3RJPA 5CYVA 3N4MA 2M1BA 5LGUA 3IWFA 2RN7A 2ZBKA 2GA1A 2MH9A 1Q1HA 3MZYA 4HYEA 2W57A 3DEUA 3O6BB 2VOOA 2YX7A 2A68F 4YG2F 4HF1A 2J5PA 4EMSA 3BPVA 1DPUA 4ZZLA 3SQNA 2EWNA 4KIFA 4OU0A 1S3JA 1IXSB 2PMHA 3RI4A 3JAMZ 2FQ3A 4IRHA 3D5LA 5DD4A 1T2KA 3IC7A 1BN5A 3FF5A 2ZXJA 5DUIA 1OYIA 4BHCA 1BIBA 1RZ4A 1P4AA 2HKXA 2YU3A 1IN4A 1IN7A 3J80Z 1LEBA 3L7WA 2ISYA 1XCVA 1KYWA 1XD7A 3FX3A 3ULQB 2FU4A 3K1PA 1KQ8A 1I6XA 1ULYA 4G94A 2GXBA 2FBHA 1O57A 1JGSA 2LSOA 3HHHA 2ISZA 3M1EA 3ROUA 1X3UA 2QQ9A 1IUYA 4UVBA 3JTHA 3TO7A 1OR7A 1S7AA 4NB5A 2D1VA 1UHMA 4LLLA 2PFBA 1YW7A 3KLOA 1R36A 1D5VA 2VN2A 4BHBA 1ON1A 5ERIA 4LFUA 3MQ0A 3HTUA 4ESJA 1ZRDA 3QP5A 4O3MA 5ICCA 2HQNA 1QZYA 1Z6RA 2HKOA 2LKPA 3DFGA 4HA8A 5LGTA 1ZLKA 2NRAC 1MDMA 2O03A 3IWZA 4WWCA 5E1XA 2IVMA 2XKOA 4LG0A 2EV6A 2QVOA 2BE5F 2E7XA 3SFZA 2HYGD 2LF7A 1GXQA 3ZPLA 2ZCWA 3DQVC 3E5XA 4OINF 3P7NA 2DQRA 5E1ZB 3TO9A 3RTRA 4RB2C 1B59A 4GGGA 3T0YA 3Q5FA 3J81Z 2OU2A 1S6LA 1QGPA 2OBPA 2XAGA 1QNTA 4P9FA 1GXPA 1TNTA 3WTWC 4EJUA 4A6EA 2P8TA 4ZYGA 2ETHA 2EFWA 1SD7A 1SFEA 1FWZA 3KP4A 4N0BA 1H0MA 3EDPA 2VC1A 2RC4A 3IRQA 3H3UA 3WE3A 2L54A 1YW8A 1ZG3A 5CVUA 5HS7A 1V4RA 2QLZA 2XIGA 1HXDA 3VB2A 3F6OA 3LWFA 1G3SA 2VXZA 3V7CA 1D8KA 1DDNA 4MNUA 2Z99A 4LJZF 3FMRA 3KETA 3W6JB 2RNJA 3IL2A 4UVAA 2EFNA 4M74A 2EFOA 3RIRA 4R1HA 5E8GA 5TRDA 5CVIA 5BOXA 5HLHA 4KNYA 1XB4A 3MEXA 3EUHA 4G7OF 3ZP5A 5DUKA 4AIHA 1QZZA 2UWMA 4Q4ZF 2XVCA 2UXNA 3G3ZA 1OYWA 2MLKA 3R6SA 2HDCA 2M30A 1ZGAA 2IRFG 4L9VA 2F5EA 2D1HA 3QP6A 1WSUA 4KIGA 5A2QZ 1IXRC 1P4XA 2H6BA 2PBIA 1PDNC 4R79A 3LFKA 3CTAA 2A3SA 4M9XA 3M8FA 1Z7UA 1FT9A 3I53A 2G9WA 2GXGA 2M5WA 3MFKA 2RDPA 2B0LA 3GXOA 3LQQA 4RB0A 4U0WA 1FZPB 3K9TA 5K1YA 5CVVA 5IT3A 3E97A 2EB7A 2OAZA 3I54A 1KU9A 3JSOA 4L0YB 5HVQC 4HBLA 4KICA 4HLXA 4ENJA 4ESBA 4I0BA 2R7FA 1IF1A 2F5CA 5HS8A 3CUOA 4GO1A 5ICFA 3I0TA 2HTSA 2GA2A 5DCFA 3WU1B 3DF8A 3FM3A 3HSRA 3JTGA 3K0LA 5J8CA 2PEXA 4JQFA 1XN7A 2CWEA 3FXQA 2CGPA 5IT9Z 2IP2A 2D2WA 3R61A 1LJ9A 5ICGA 3DP7A 1W4MA 3FZVA 4TV7A 3WGGA 5EEHA 3CO7C 1XGOA 3MWMA 2K4JA 2VBZA 4A6DA 3IKTA 1YS7A 3HOSA 1G6NA 1STZA 4L9JA 1RUNA 3KLNA 2GIVA 1QPMA 3VOEA 3WTZA 3GW2A 2A6EF 1C0WA 1J5YA 5E20A 1OMIA 2Y48A 5BPDA 3I58A 1FNNA 2RKHA 2CG4A 1B4AA 2K27A 4LK0F 4CHUA 5H20A 3IHUA 2MC3A 4A5NA 4WK8F 3TO6A 2DW4A 4HX7A 3KZYA 2MBFA 2O8XA 3KE2A 4OIQF 1R5GA 1E17A 1CGPA 2VT3A 2XAFA 2P6TA 2ZO4A 2EV5A 2XAJA 4HQEA 4UNOA 1MKMA 3BJ6A 2EA4A 2CSOA 3ZMZA 1G3YA 3TOBA 3GYHX 1E2XA 2WTEA 1V3FA 2FBIA 2TDXA 1R1UA 3KP6A 3ERED 3HRSA 2KIMA 4WF2A 1J59A 2W24A 3ZN1A 1YQAA 4CDGA 1BI2A 2KJCA 3GLXA 2ESHA 5KVRA 1NHAA 2QQBA 3DPTA 1CF7A 2IW5A 1W7PD 5D8LB 3VEPA 3F3XA 2FA5A 2PJPA 1R1VA 4A2UA 2ZMEA 2HTJA 4CZZA 5FLXZ 1WQ2A 2DBBA 4ZYEA 1H9TA 4WX9A 2RVCA 2A6HF 3OOPA 1SFXA 2P7VB 2VONA 1G3WA 2DLLA 4ZYDA 3N97A 3M9AA 3ZMVA 5J8FA 3L2CA 1Z6TA 3E6DA 3ELKA 2IT0A 4U88A 4HX8A 4I01A 2LNBA 4WXCA 4LB6B 1SAXA 4L5JA 3G73A 3ECOA 5E1WA 2FMYA 5K5QA 5HDNA 4JK1X 2L02A 2XROA 1XCBA 5LHGA 3F6VA 2JT1A 2PMUA 5JR3A 2OQRA 4AIJA 3CLOA 2PN6A 4ETSA 1SMYF 4XBFA 2IA1A 4EJVA 2OD5A 1YFHA 3LSTA 4HF0A 5L3CA 5HDKA 2Y75A 4RGSA 4EGZA 4HDVA 3NQOA 4LLNA 3F8BA 4Y13A 4GYIA 4ZYHA 3FHZA 3CDHA 4RB1A 5HOOA 2QUFA 1EH6A 1O3RA 5D8KB 2FXAA 2NNNA 2JPCA 3RDIA 1R22A 4B8XA 5FO5A 1BI3A 4IXAA 3RYPA 4ESFA 3GFLA 4MEYF 4LMYA 4EJTA 2JRTA 3PQKA 3LA7A 4G8XA 2VOPA 1DPRA 4Y15A 2YR2A 5DEQA 5LRRA 3D0SA 1BJAA 1F1ZA 4DQ2A 1WKMA 4KN4X 4G7HF 3IRRA 1XGSA 2FRHA 3C1DA 4FX0A 3ZMUA 2BEOA 5KK1A 3WTYC 4LK1F 4EVIA 4P55A 2G7HA 1FPQA 2V1UA 2QENA 1OYYA 2AXLA 4MEXF 1T0FA 3WE2A 5AIQA 2VODA 3E6BA 1XDUA 2M87A 5FD5A 4HAMA 3BROA 1RIOH 3HRMA 4I0AA 1PP8F 2V1DA 1MGTA 1U5TC 2X0LA 2NAZA 5BPIA 2ZKZA 3HSFA 3H92A 4MTDA 5FB2A 2YX4A 5LLQA 5LEJA 3F8NA 3WG9A 1IXCA 5FD6A 1FYMA 2NS0A 3BDDA 4O5VA 4HLYA 3TQNA 4KYWA 2MD5A 2OZ6A 3NEUA 2HEOA 4NHJA 2DI3A 2V9VA 3Q9SA 1BC8C 3EETA 3GX4X 4KIBA 2CYYA 5D6FA 2NYXA 1ZREA 1BBYA 1PUEE 3KEOA 1O7LA 1REPC 1EH7A 1S7OA 3TDZC 2H09A 2UZKA 3C7JA 1HW1A 1USTA 1YG2A 2IA0A 3HHGA 5ILSA 2XUBA 4FT8A 3NRVA 1TLHB 4B09A 4U0VA 4BXUA 1O3SA 3TOAA 4HF2A 1SMTA 4KDPA 1MJ9A 2FOKA 3F21A 1U5TB 1HKTA 1S8NA 4IJAA 1FYLA 2BV6A 2EV0A 2M45A 1SD6A 4EGYA 2GZWA 2QYOA 3B02A 3F8MA 3BZ6A 3U1DA 2XGXA 3DV8A 2BYVE 4FHTA 3BPXA 2FSWA 1K78A 5D4SA 2VBYA 2PG4A 2L01A 1LDJA 2K02A 1R7JA 2K86A 2A07F 1Z1DA 3BOQA 4DNCA 4S05A 2O0YA 5TJJA 3HUGA 4E70A 1MZBA 1GHCA 1K78B 3RYRA 1AWCA 1W5TA 3P9CA 1I5ZA 4AIKA 3KP5A 1HSTA 4KA4A 4P9UA 2YSRA 2O6GE 4RAZA 2KJBA 3WTXC 3GVAA 1KYZA 1FSEA 3HRTA 2Q8KA 4ENMA 4XLNF 4KUMA 4KMUX 2KIUA 2XHKA 2Q2EA 3BY6A 4IHTA 3F8CA 3ISPA 2VT2A 2FNAA 1JXSA 3FM5A 2A69F 5D5UB 3DKWA 2W85A 1XGMA 3F22A 4G7ZF 4RGUA
chains in the Genus database with same CATH superfamily
1MNDA 2ESNA 3CF2A 4HZFA 2W4SA 4KISA 2DTRA 3H1CA 5D5WB 2E1CA 1X1CA 4BUPA 3V4GA 3WTSC 4NUBA 3A0BC 4PJLA 3CO6C 5IP9J 3CCUI 3LA3A 2E7WA 1WWXA 3DCFA 1Z9CA 3ZN0A 5IYBJ 4L18B 1LQ1A 1UAAA 1V5EA 1LFUP 2V79A 3CMAI 2BVLA 1LDKB 1ZARA 1JJ8C 2NS8A 3V7SA 4XMYA 4B1RA 1VNDA 2H1LA 1U8RA 2YU9J 1QHGA 2RV8A 3DWLE 3MAJA 2EFPA 1SVOA 1P2FA 1ZG1A 4BEHA 4DYRA 2JA6J 1A04A 2ZNZA 1SD4A 4I98B 1D5YA 2GM4A 1AOYA 3GWZA 4K2EA 3D5SC 1A31A 2ZJPF 5LD2C 3W2AA 3MVPA 2ICWG 2R7DA 5DD8A 1U8BA 4XRSA 1WVRA 1RETA 1TQPA 5HDGA 5J4YA 4ON0A 1HQCA 3C3WA 5L3GA 3LQRA 3A02A 3Q0VA 4U0YA 3GO5A 3R0JA 1YRNB 2HXOA 1K7AA 2CH0A 2KZGA 2CW0F 3BT9A 2DOAA 3QAHA 4EM0B 4Z2YA 1UHWA 2JUGA 1SC7A 3E5UA 1T98A 4A0YA 1FBSA 2PQ8A 3WGIA 5M3MJ 2QBYB 3K4NA 4HX4A 3V8LA 2W82A 3GFJA 4IVNA 1KA8A 1R9TJ 1I27A 5CVRA 1T6SA 1O3QA 2EIKH 2VJ5A 1W1WE 3AG3H 1JGGA 2L9VA 5BS6A 3PO3J 5L3EA 5HLTA 1GV2A 4KN7X 3BG7A 4IOCF 2FMLA 4OIRF 3BWGA 1LEAA 4I76A 2DAOA 3OY9A 3BCAA 3JRGA 3FMSA 5L3DA 4ZDOA 1H9GA 4UUTA 3G1MA 1F9NA 2DA3A 5FKNA 3A01B 2E1NA 1Z91A 2HZTA 2HOEA 5E8IA 4AVPA 1LDDA 1R00A 2DODA 3MKLA 4Y33A 3VYUB 2IGNA 4EJOA 4YFNF 4YIIA 3IP4B 3R4KA 2LKXA 4M3BA 1U2WA 2FNPA 4B4CA 3S15J 3FISA 2NVTJ 2STWA 1U9OA 1G3TA 1SVMA 1QZEA 3ZQQA 2Q0OA 4BACA 1Y1VJ 3BR6A 1E3OC 2GAUA 1YITI 1IRGA 5H6QA 3RPUA 4CCLA 4O6JA 1FP2A 4FCYA 5LFAA 4BXXJ 3JAMK 2UUZA 1U78A 1ZKGA 5D6EA 4MTEA 4YIFA 3CJQB 3VFZA 3QPHA 1FIPA 1HBXG 3MZHA 2DXIA 4BH9A 1LUJB 4CA0A 1OCRH 3PUFA 3F72A 2IAIA 3J80K 3LAJA 3HOTA 3KX2A 1HW2A 5D4RA 1IW7F 2DTZA 2WY8Q 2XC7A 3OL3A 4RM2A 3ZQCA 1WRJA 1MBKA 1BM9A 2R3SA 2O7OA 3E0JB 5JFRA 1ZYRF 4A3MJ 2LY2A 3BQYA 4NNJA 1KQ9A 5LHHA 2X6WA 1FP1D 3SFIA 5JHUA 4F93B 4HPQA 4XL9A 5F64A 4BS9A 3P5JA 3FIWA 2XPWA 3U9GA 4M73A 2AS5F 3K1NA 1H89C 1OJLA 2DFFA 3M7GA 2XB0X 1ON2A 4A0XA 3WTVC 4M6VA 2EJRA 1Y6IA 1EV7A 4XRMA 3B6CA 4EM2A 3PUBA 3ZMSA 2QA4I 2IS4A 2KT0A 1I1SA 3I59A 3CJNA 1FY7A 4PJNA 3RKXA 2OJED 2ID6A 3BP8A 2Y9YA 3DPLC 3HC7A 3IKVA 3R60A 1LNWA 4DGWB 3Q3SA 1F5TA 2M4KA 2F48A 3T8TA 3O3KA 3EQLF 5IYCJ 1YYVA 3KEQA 5BNGA 2H27A 2IBDA 4HDUA 3M1CA 4Y17A 2JN6A 5F08A 2HR3A 4MHGA 1JHFA 1IRXA 1GVJA 5GPCA 3I59B 2EZHA 2BGCA 1K79A 2K4BA 2MA3A 4EQQA 1Y0UA 4XN0A 5F1RA 4A3EJ 2LP0A 2DT7B 1LVAA 2HQRA 3PFYA 2E1MC 3HSEA 2Z5UA 4M6YA 1JE8A 1QO0D 2K9MA 2FBKA 2LOOA 3CCEI 3OV8A 1X3WB 4L9NA 1X19A 5EEAA 3IAM2 3MZ8A 1V5FA 3TW7A 1ZAOA 3UR3C 2FF4A 2STTA 1MJAA 5LHIA 4L5EA 4OMZA 3QU6A 2Y0SN 2OZUA 4XOTA 4LLGF 3LA2A 1VQMI 2P6SA 1L0OC 2W7NA 3LSGA 2I8DA 5D5VB 2AQFA 4N9HA 3RQIA 1FX7A 2DYSH 3EYIA 1FEXA 3BCBA 2XSDC 5FKMA 1DGRM 4XSXF 5E3OA 2EZKA 2F4OB 1OR7C 3K4CA 3SHFA 5HODA 4I7HA 3N05A 2BW3A 1SFOJ 3CLQA 4Y52J 1G8XA 2HPIA 4PJ0C 4RAYA 1W5SA 4A0ZA 1B6AA 2EZLA 1RI7A 2N8GA 3VODA 3KP3A 1YS6A 3HGYA 2QCOA 4XLPF 3O2PE 2ACJA 3HBLA 3KP7A 3J81K 5FGMA 3SYTA 4D5CA 1ONVA 2NNYA 1OPCA 1Z3YA 2VI6A 2XDVA 3BG5A 2BW3B 4PFPA 2KRFA 3HIFA 4KT5C 1O4XA 1XMKA 1ZR2A 1MBEA 2IGOA 1U9NA 3V7RA 1YIOA 3TP3A 3OYBA 1VFCA 2WA0A 3SXYA 3HTSB 3BTLA 5EEGA 2HWVA 1TL8A 2BBYA 4HNUA 4BQAA 3B73A 5F1JA 1BC7C 2NOJB 2XSJC 2ADUA 4XRFA 1QVUA 2P81A 3BR1A 4RS8A 3WU0A 4R8HA 3CCJI 2LREA 2Y69H 4BAYA 3H9GA 2A61A 4MLOA 1DUXC 4FQGA 2DA7A 4PK4A 4QIWN 2ZJ2A 4N9IA 3RQ4A 3KYDB 2WAEA 1NH3A 5E17F 4PGGA 1R4MB 1WI9A 3GCMA 1ZN2A 4PZJA 1EJ9A 4DYCA 2QZ8A 4I6ZA 3F23A 2LBFB 1HW5A 1BW5A 2DU9A 5JI6A 3SZPA 1TWFJ 3I4MJ 2XV4S 2HGCA 3P9IA 1EH8A 4S04A 3VWBA 3QOPA 3EUKL 2VE8A 4HG2A 5HS9A 4GXOA 1VQ4I 1TW3A 4UV8A 1MJBA 2X6YA 1HOMA 3LOCA 2Z3YA 3P9KA 3U1KA 2HDWA 2DT5A 2KMUA 3RPQA 3JW4A 3DEWA 2VIXA 4Q47A 1F36A 3WTTC 3HB9A 4UXNA 4D7NA 1QBJA 1TTYA 4RAGA 5TISC 3CMEI 3V8JA 1BW6A 1TQIA 2E1MB 2WBMA 4IOAF 1N25A 4BHPA 4C9YA 2LF8A 4LITA 4WXHA 5F04A 2JZYA 2MH2A 3ASNH 3FWEA 3T8RA 5H6RA 2GOXB 1I3AA 3CMMA 2VQHA 4JX6A 5AONA 1V5GA 2DOEA 2J5OA 2K3PA 4M9ZA 2M4GA 5DV5A 3ZXSA 3FXLA 3TP0A 2COMA 5LBQA 1BI0A 1LE8A 5EGOB 2P7CB 1FSHA 3OYCA 1W0TA 2VQCA 3ESWB 1WJEA 4PGHA 4KJZA 1KU2A 4CICA 4A3DJ 1QQIA 3JRCA 5IYDJ 3GZ6A 1J7KA 1EF4A 5ED4A 1TW2A 4UHTA 1HDDC 2ZNYA 1FBQA 3ABKH 2BY2A 3HYIA 1I1GA 4F7ZA 1LE8B 3WGHA 2L4AA 2P5LC 3H0GJ 4D0PA 3TMOA 3UNGC 3TL4X 1OCCH 2G0EA 2PI0A 1UFMA 2A5YB 1J0RA 2QKLB 1FOYA 4ENKA 1TZLA 4QPQA 1IN6A 2GWRA 5CVJA 2KIFA 4EJWA 1SFUA 2H6CA 5A2QK 1X1BA 1YTYA 3CD6I 2R7VA 3GFMA 3CESA 3GUDA 4B48A 4HEA2 1PVEA 2JPBA 2CFXA 4QWQA 1HKSA 4CYCB 1XSDA 2KQRA 4ZJZA 2QWWA 3E6CC 3RSNA 4B3XA 3KP2A 1ETKA 1TT5B 1MDMB 2CQNA 3QPLA 3BR3A 4A3CJ 3NARA 2LMDA 3S1RJ 3Q9VA 2DK8A 2HS5A 3GTMJ 1K6YA 4UV9A 3L00A 3K4MA 1K6OA 4LB5A 2DFHA 2VKVA 4NC7A 4LG0B 2YPRA 3OSGA 1R1TA 3JRHA 1RNLA 3NAUA 3CCSI 2C6YA 2X9DA 3DBHB 5CLSA 5J40A 5BMZA 2OQGA 1T8IA 4WXDA 4UUVA 3IAS2 5CQEA 3HRUA 3QRFF 5FRMA 2QSGX 2F5DA 2OA4A 4HNTA 2L9RA 2Y0MA 1O7FA 4J19A 3C2GA 4AYBN 4D1QA 3ZCOA 4UVCA 1ORKA 4AD9A 3A03A 1UHSA 4A12A 4PCQA 1TQMA 1ZHFA 3ONQA 2CQXA 1D1AA 3DBLB 3E5QA 5ILVA 5L3FA 3G6EI 2VBXA 5DTDA 1HCRA 1XGNA 2H94A 1T38A 4D7MA 1G4DA 2M8EA 6PAXA 4A5MA 3GLLA 2VBWA 3SDGA 2RQPA 1LB2A 1NK3P 1NTCA 3ZMDA 1IAWA 2B9SA 3FMQA 2MG4A 5JHFA 3AG1H 1UZCA 5FRNA 2F2EA 1XSVA 1KQ0A 4ZH4F 3JRFA 4ASNA 3S3NA 1U5TA 4AUXA 1ZG5A 1MH4A 3K69A 1IV8A 4XLFA 1XMXA 2E19A 2WB1A 1X1DA 5IP6A 5CJ9A 4BE0A 3CCYA 4LD5A 3PQJA 1G2HA 3FXKA 3CCRI 2L3DA 4RGRA 1VTNC 2WAQA 1U3EM 1Z77A 1P6RA 4I02A 2VPLA 2E2IJ 4EM1A 1VF9A 5IT9K 2RNGA 1YLFA 1ZLJA 3FXUA 1ZRFA 4G6DA 1PUFA 2CV1A 2R93J 4YRVA 2FE3A 2CFOA 2GLOA 4ENNA 3V8KA 3J7ZI 3WODF 1ODDA 4N4NB 2KFDA 1OKRA 3WHBA 3T1BA 2HDDA 3LAPA 2F4MB 4JX4A 3DLLF 2Y0SA 3TDUC 2E35A 5C4XJ 1YW9A 1P4WA 2ZSHB 3RKWA 4IRGA 3M8EA 4CCJA 3MCZA 4B47A 1AA7A 1B1BA 3E3VA 1FYKA 3WTUC 3OIQA 1HKQA 2OCEA 4BL0B 5J3LA 3R0AA 1JHHA 1D1BA 2FEZA 1LKXA 3FDYA 1MD0A 4BXFA 2M3AA 2V1XA 4KMFA 2IPQX 1KONA 3HKZA 3BZCA 2QGUA 1R58A 2VE9A 4G6QA 3OYAA 4H0EA 2PLYA 1JTXA 1XSXA 2GOMA 3HOWJ 3LFUA 1AU7A 3DU6A 4HW0A 4FTHA 3PJRA 5M5XJ 1RUOA 3FXRA 3KCCA 2DPUA 3KZIC 3BR2A 3A2KA 3E7LA 1B8IB 3FKIJ 4JOMA 2OV7A 1USSA 2X48A 2AXTC 4XOPA 3F9KA 2A6TA 2Z9OA 5AIPA 4CO8A 1YJ9I 1J75A 4F55A 3I3LA 1ZRCA 1QRYA 3E6MA 4X6AJ 1ETXA 2P5VA 4BU2A 3LNQA 3JCUC 4OOIA 3EPZA 2XRNA 4IHVA 3KYLA 1J2XA 1Q1VA 3SZTA 1KGSA 1BI1A 2G7UA 3C18A 4MGRA 2XAQA 2KRCA 4P1WA 1JT6A 2OUMA 3PSFA 3S2WA 4YFXF 1JI8A 4JBAA 5ICEA 2CV0A 3MKZA 2DYRH 4DBRA 2AO9A 4P5OA 2BVMA 1MNEA 3VSKA 1YO5C 1EKEA 2Z33A 4IHYA 2R7ZJ 2NVYJ 3GMEA 1BR4A 2V1NA 3F8FA 3ZOBA 3CUQC 3QPTA 2HVSA 2EK5A 3K70D 1QHHD 3PFIA 4GYGA 4CXFA 4RDUA 2WY7Q 4H4KC 3K2ZA 1K61A 4OIPF 4RB3C 5K5RA 4OAYA 1R4NB 2JA2A 2WWYA 3H3ZA 1T08B 2DPDA 2EZIA 1CQTA 1IZ1A 1K4TA 4CCNA 4M72A 2CMPA 3ML6A 5FKKA 4Z6YA 1FOKA 2HNHA 1T39A 1JJ6C 1XDSA 1UG0A 2W84A 5HLGA 1HSJA 3OYMA 2ELKA 1FLIA 2HYJA 3GFIA 3HXLA 2ZJQF 2IJLA 3Q0WA 1DP7P 2DMPA 4XR6A 4I09A 1D8JA 3OR2C 3K4BA 1IDZA 1SD5A 2P4WA 1VQ5I 4HSRA 1TC3C 2LRDA 3ASOH 2LFBA 3OSFA 2R7OA 1OISA 4G9YA 4M3DA 1Z21A 4BKXA 4E7KA 2JA8J 3QODA 4M3GA 2QQAA 3OYGA 4L5IA 2QKMB 2QSHX 5F6FA 4ABZA 1R23A 4L9TA 5LRSA 4JX5A 1YRNA 4BQQA 2JSPA 5J6XA 5FLXK 2HFHA 3W6KB 4U7BA 2LYCA 4AWXB 2ZFWA 1Y8QB 1WFXA 2QBYA 4MIMA 4BDZA 4XSZF 1FIAA 5F0HA 4WCGA 4U7DA 2DK5A 1S29A 1GT0C 1V54H 2QM3A 1IN8A 3BTIA 4ZYAA 4V2GA 3U2RA 3IH2A 2X4HA 1I50J 3L09A 4PDKA 1PP7U 3OOUA 1B9NA 1R5HA 1I39A 4C2TA 3J7AO 3S1MJ 4HQMA 4LG3A 1YX5A 4HOBA 4YFKF 3A01A 5LEKA 5K5OA 1UB9A 2ELHA 1Y39A 1EA3A 2L5QA 2TCTA 1VQKI 4Q5SF 4KITB 3OYJA 1ETWA 2K5CA 2E60A 4ZZDA 2IA2A 3HOXJ 1D1CA 2FJ1A 2VB6A 2DFIA 4QSHA 3QU3A 2CS3A 4LGWA 2GQQA 1XMAA 2FD5A 5D5XB 4DZJA 3S1QJ 1V55H 4M9SA 3REOA 2D45A 2WV0A 1TP4A 1RR7A 3CUQA 1RPWA 2K7LA 3OIPA 3GF2A 1RESA 5C3EJ 2WAFA 2JMWA 5FFXA 4C3IJ 5FFZA 4IF4A 3KPHA 4BGDA 2JA5J 2CW8A 2JTVA 2KKOA 3RKYA 5B5EC 2L7KA 4IQJA 3A1YA 3L2VA 2XASA 3S3MA 1QPIA 2CO5A 4KFCA 2JUCA 1TNSA 2EFQA 3GEZA 3ZQ7A 1HLVA 4EV0A 2ZMEC 1KU3A 3CUQB 4HV6A 4Q48A 4M71A 2M0CA 4CGZA 2HQAA 1IRFA 3BJOA 4BJ5C 5M5YJ 1AKHA 3EYYA 3VYSB 3ECHA 3GTKJ 2DO7A 4AYBA 1ZGJA 2LDUA 5DDGA 1DU6A 2EA2A 2M8GX 2VUMJ 3K4LA 3NWSA 1F4KA 2HPMA 3I4PA 4NQWA 1ENHA 4I2OA 3HOZJ 2KHMA 2HYFA 3GZ5A 4A3FJ 2CUJA 4XORA 3W3CA 2WC2A 2HU9A 3JRAA 4IRIA 3RPUD 2EH3A 1AKHB 2A5WA 3OWTA 3QOEA 4CUGA 5L3BA 2O61A 3I64A 3BJAA 2V6CA 5LGNA 4PSXA 1O3TA 1D3YA 2F5FA 2AHQA 2ZXIA 4FX4A 4NQWB 3T5XA 4XONA 2W25A 3TGNA 1BR2A 1WJCA 5DCMA 5E18F 4QLCU 4ZC3A 1U6GA 1FTTA 1KU7A 1BOAA 3I71A 2VASA 2UXXA 1WJ5A 4P96A 1ZTRA 3KZZA 4LIVA 1W7PA 1ITYA 3KFWX 3AL0C 1XS9A 1IN5A 3AFHA 4RGXA 1B9MA 4V2FA 5DCMB 3TKYA 4BJ6C 3AAFA 4IHSA 5KNLA 3MMYB 5JVTA 2XAHA 3L9FA 4IX7A 3I5UA 4CYDA 3CC2I 3M3YJ 4MQVA 2L4MA 2MLGA 2QSFX 3CZ6A 4OIOF 5HLIA 1DU0A 1IO2A 4E4HA 3CDLA 1W7PB 1XX5A 2CUEA 1FC3A 2JSCA 2VJIA 2XKPA 1JT0A 4GDFA 4A3GJ 1J9IA 2RGVA 3LSPA 2H8WA 4S0HB 4PJJA 1JTYA 4BNCA 3ABTA 1I6HJ 4XM3A 2IS6A 1L3LA 2JVGA 3A0HC 2WB1N 1FBUA 4RMNA 5BQTA 3GTOJ 4GCVA 4IPAA 1TBXA 3DXJF 2BHYA 4BYYA 1BIAA 2H8RA 2WAQN 5DM6F 4HV5A 1UCRA 3BTCA 1Z05A 2A05A 3COAC 1CF7B 5DYMA 5ILUA 1WCMJ 5KAFC 1J09A 1WPKA 3H5AA 5CKTA 3S2DJ 2K9QA 2JVHA 3ABUA 2WADA 3JSPA 3TEDA 3K1MA 5FKOA 4MQ9F 2O3FA 3JREA 2MC4A 4L0ZB 4OMYA 3VDXA 2VC0A 2CQKA 4M6XA 2E5NA 2DQLA 1P92A 2XGCA 3ZMTA 2ZMEB 1FMWA 2P5KA 3RJPA 3ABLH 3J7AY 5CYVA 5F27A 3N4MA 2XF6A 1VZ0A 1I3QJ 1N78A 5C44J 2HQ5A 2M1BA 4J00A 1Y56A 5LGUA 3CP2A 3IWFA 2JRMA 2RN7A 2ZBKA 2GA1A 2MH9A 1Q1HA 3MZYA 4E6KG 2R7UA 4HYEA 4FASD 1GVDA 2E34A 1SFKA 2W57A 2DA2A 3DEUA 3HKZN 3O6BB 2ZFUA 2VOOA 3S14J 4NDLA 1MMSA 1WHUA 2A68F 2YX7A 1NK2P 1HF0A 2Y9ZA 3HOYJ 4YG2F 1Z67A 4HF1A 1RKWA 3BG9A 2J5PA 3D5RC 4EMSA 3BPVA 4UB8C 1DPUA 4ZZLA 2ZXHA 2OF7A 2DDAA 3I9V2 3SQNA 2EWNA 3OS2A 4KIFA 4IHXA 4OU0A 1S3JA 1IXSB 1MMNA 2Q1ZB 4CCKA 1YE9A 3L2QA 1ACIA 2PMHA 3RI4A 3JAMZ 3EUAA 4W97A 2NVQJ 2FQ3A 4IRHA 1IV6A 2O8KA 3CDIA 3L2UA 3D5LA 4IHWA 5DD4A 3AL0B 1MMDA 2L7MP 1T2KA 2X51A 2LBFA 3IC7A 1BN5A 2LY1A 3FF5A 3HOVJ 2ZXJA 1T95A 5GPAA 5DUIA 1OYIA 1BIBA 1RZ4A 1P4AA 3IH3A 3K2AA 4AVZA 2HKXA 4BHCA 4AM3A 2YU3A 2JA7J 1PJRA 3AKZA 1IN4A 1IN7A 2COBA 3J80Z 5J4VA 1A6QA 1OCPA 4Y7NJ 3CF5F 1LEBA 3L7WA 5GAGJ 2ISYA 1XTAA 1YI2I 1XCVA 1KYWA 5IY5H 1XD7A 2EINH 3FX3A 3ULQB 3H3VK 1GUUA 5E79C 2FU4A 1YX3A 1GLNA 3K1PA 5B66C 1IJWC 1FTZA 3G2BA 1ERDA 1KQ8A 5H2FC 1I6XA 1ULYA 4G94A 3A4CA 2GXBA 1X3ZB 3GTPJ 2CQ7A 1Y0NA 2FBHA 1O57A 2JWTA 2VPRA 1JGSA 2LSOA 3HHHA 2ISZA 1MW7A 2X1DA 3M1EA 3BR0A 3CMYA 1P7IA 2W1OA 2XF5A 1TWCJ 5EGOA 5JLWA 2ELJA 1JKQC 3ROUA 4X0GA 4GFBA 1JUPA 1VI0A 1X3UA 2QQ9A 4XLCA 2E2HJ 1IUYA 1A36A 4UVBA 1S7EA 3JTHA 3TO7A 3HOUJ 3CJRB 1OR7A 1VQ6I 1S7AA 4NB5A 2D1VA 3CC7I 1UHMA 2HOAA 5EYRA 4LLLA 3TW6A 3HZJA 4MFDA 3UKGA 3ERMA 1JUMA 4XN3A 2PFBA 1YW7A 3KLOA 2L0KA 3CP8A 1R36A 2XGEA 1D5VA 1ZGWA 2VN2A 4BHBA 1ON1A 5ERIA 4LFUA 3MQ0A 4E7SA 3HTUA 4ESJA 1ZRDA 3QP5A 3KYCB 4O3MA 4PSWA 2KISA 3FKJA 4CZCA 5ICCA 2HQNA 2R7XA 4CCOA 5GAHJ 3ZGKA 4CYCA 1QZYA 1WGXA 1Z6RA 3S32A 5GADJ 2HKOA 2LKPA 3DFGA 4HA8A 1P7JA 2L9SA 3S93A 5LGTA 1ZLKA 2LY9A 2NRAC 1MDMA 1VQNI 2O03A 3G1LA 3IWZA 2DMTA 4LIUA 4C30A 4BBRJ 2MYSA 1T56A 2R7QA 3I4NJ 4WWCA 3SDBA 5E1XA 2IVMA 1WH7A 1XC5A 1W5CC 2XKOA 4LG0A 2EV6A 2QVOA 2BE5F 2E7XA 2ECBA 3SFZA 2HYGD 2X1CA 2LF7A 3AG2H 4HSTA 1GXQA 3ZPLA 4HRIA 2ZCWA 3DQVC 2DT6A 3E5XA 4X1EA 4OINF 3W2VA 3P7NA 2NVXJ 4M3EA 2DQRA 3K7AJ 4E7HA 4LOCA 1WJBA 2W48A 1W36C 5E1ZB 5EG0B 3TO9A 3RTRA 2BHZA 4RB2C 1B59A 2JQ7A 1HC8A 3EUHC 1Y1WJ 4GGGA 2NOGA 2DMQA 3T0YA 3Q5FA 3ZRGA 4PFOA 2E5ZA 3J81Z 2OU2A 1Z3XA 3O8GA 1S6LA 4IL6C 1QGPA 2VL8A 3W2WA 3HL2A 2LR8A 3G1OA 2OBPA 2R0QC 2XAGA 1QNTA 3ZQGA 4P9FA 1GXPA 1JKOC 1TNTA 2VJ4A 3WTWC 4EJUA 1QA6A 4A6EA 1X4PA 2P8TA 4AC0A 3O8HA 4ZYGA 2ETHA 2EFWA 2R7RA 1SD7A 1SFEA 2LKSA 1FWZA 3KP4A 4N0BA 4ZTFA 5GTHC 1H0MA 1FJLA 1TWAJ 3GTJJ 2DMNA 2X6XA 2BY3A 3EDPA 1IUFA 1F43A 2VC1A 3OYKA 1OCZH 3SEQA 2RC4A 3HGGA 4E7LA 5K7ZA 5GP9A 3IRQA 3H3UA 3U21A 4BY7J 3WE3A 3L2RA 2K9NA 3CCMI 1MBJA 2L54A 1YW8A 1ZG3A 3ABMH 1R6RA 5CVUA 5HS7A 1V4RA 3H9QA 3GTGJ 2QLZA 4A3IJ 2XIGA 1HXDA 1U0JA 3CCVI 2EQRA 3VB2A 4V19K 3K70C 1D0XA 2KLOA 3GBGA 3F6OA 3LWFA 1G3SA 2VXZA 3V7CA 2E2JJ 1D8KA 1MSEC 1DDNA 3PIOF 2UV1A 4MNUA 2Z99A 4LJZF 1TWGJ 4EEFG 3HPHA 3FMRA 3K10A 4JYKA 3KETA 1X1PA 5K7FA 2ZC2A 4C2MJ 3W6JB 2M2EA 2RNJA 3IUOA 2M0MA 2XRLA 4I99C 3IL2A 3HJEA 4UVAA 2QQ8A 2DOFA 2EFNA 1WJAA 4DOZA 4M74A 2EFOA 3RIRA 1B72B 2QEXI 3RKQA 4R1HA 5E8GA 1BR1A 1NG7A 5TRDA 5CVIA 5BOXA 5HLHA 2DMUA 1B8IA 4KNYA 5IOZA 1T33A 4A3KJ 1MSFC 1XB4A 4BBSJ 3PL8A 3MEXA 3EUHA 1X4OA 4A3JJ 4G7OF 1BOBA 5JLXA 3ZP5A 2DJIA 5DUKA 2GBYA 4AIHA 2OTJI 4ITVA 1QZZA 2MFZA 2UWMA 3OIOA 4Q4ZF 2XVCA 2UXNA 3G3ZA 1OYWA 2FQ4A 2FUG2 2MLKA 3R6SA 2HDCA 3M4OJ 3QPSA 2CUZA 4RLQA 2VLAA 2M30A 1ZGAA 2IRFG 4L9VA 2F5EA 2D1HA 3QP6A 5TGTA 2XB5A 3OMYA 3VSLA 1Y8RB 5F0CA 1WSUA 2K3FA 1TWHJ 4KIGA 3DBRB 4N4OB 3DPUA 5A2QZ 1IXRC 4NC8A 1P4XA 2H6BA 2PBIA 1PDNC 4R79A 3LFKA 4BY1J 3FBNB 4FISA 2YUSA 3CTAA 1RC9A 3ZQFA 2A3SA 4M9XA 1VQ8I 3M8FA 4OAZA 2R5ZA 1Z7UA 1FT9A 3G71I 5C4JJ 5EZHA 4DYQA 3I53A 4KT6A 2G9WA 4B43A 2GXGA 2M5WA 3MFKA 2RDPA 2B0LA 3GXOA 3LQQA 2HI3A 4RB0A 4U0WA 3M8JA 3QYFA 1FZPB 3K9TA 5K1YA 1ZK8A 3MKWB 5CVVA 5IT3A 4XICA 3E97A 2EB7A 2DA1A 2OAZA 3I54A 1KU9A 3JSOA 4L0YB 5HVQC 2R5ZB 3S3OA 4HBLA 3GTQJ 4KICA 4HLXA 2CU7A 4ENJA 2R5YB 1JKPC 1APLC 4II3A 4ESBA 1MBGA 4Y3OA 3H5NA 3KEYA 4I0BA 2R7FA 3DKXA 4FE4A 1IF1A 2F5CA 3BC8A 5HS8A 2IGMA 1JKRC 4CSWA 1H88C 3CUOA 1X2MA 2Q2EB 4GO1A 2E71A 1D0YA 5ICFA 3B6AA 3L1PA 5J1RA 3I0TA 1DQUA 2HTSA 2GA2A 2MD0A 5DCFA 1YIJI 2DCEA 3PSIA 3VYTB 3WU1B 1MBHA 3JR9A 4IQ4A 5FLVA 2KL4A 4J01A 3DF8A 2KRHA 2ZB9A 3FM3A 1OFCX 3S1NJ 3HSRA 2DA6A 3JTGA 3RCOA 4XKVA 2HXIA 2XF7A 3W6VA 4CCMA 3K0LA 5J8CA 5KHDA 2PEXA 4JQFA 1XN7A 3CCLI 2CWEA 3FXQA 2CGPA 2H1KA 5IT9Z 2IP2A 2ID3A 2D2WA 1OCTC 2PMZA 3R61A 4RAFA 1LJ9A 1N75A 2EPFA 1QU3A 5ICGA 2BZTA 3FXMA 1LFBA 4F3QA 4XKBA 3DP7A 3OYNA 1POGA 1W4MA 3FZVA 1DGWY 4BEHB 4TV7A 1M1EB 3WGGA 5DM7F 4BE2A 4XRSG 5EEHA 5FJ8J 3CO7C 3S16J 1XGOA 3MWMA 4IKFA 5CPRB 2K4JA 2VBZA 2K9SA 4A6DA 4C3HJ 3IKTA 1VQOI 3FBIB 1YS7A 4A3LJ 3HOSA 2K85A 1A5JA 1G6NA 1STZA 2O5RA 4L9JA 1RUNA 2KZVA 3KLNA 2GIVA 1QPMA 3VOEA 3WTZA 3GZNB 3KIOA 3GW2A 1BA5A 1SEUA 2E36A 4F91B 3BR5A 2A6EF 1X58A 3VPRA 4B44A 3K6GA 2HVQA 3MN2A 1C0WA 1R71A 2ZSIB 1J5YA 5E20A 1OMIA 2Y48A 3H0DA 5BPDA 4NC6A 3I58A 1FNNA 1UJ8A 2I5UA 2IXSA 2RKHA 2CG4A 4QTRA 5FROA 1B4AA 3CQZJ 2K27A 2K9LA 2LTPA 1X1AA 2M9HA 4LK0F 5H20A 1YOVB 3SJMA 3IHUA 4MFEA 2ZXWH 4DZPA 2MC3A 4A5NA 4WK8F 3TO6A 2DW4A 2JJ7A 1MIJA 4AU7A 1K4SA 4YEJA 4HX7A 2X85A 3KZYA 2MBFA 2O8XA 1ETVA 4IO9F 3KE2A 3LSKA 5B1AH 2I10A 1R5GA 3H9JA 4OIQF 1E3HA 3QYEA 1E17A 1CGPA 2VT3A 2XAFA 4G12A 3E1SA 2P6TA 2ZO4A 3V42A 2EV5A 3L2WA 2WV1A 2XAJA 1ZQ3P 5FKLA 2Z16A 4HQEA 4UNOA 1MKMA 3BJ6A 2MSYA 3I55I 2EA4A 1HA8A 4FE7A 2L2OA 2DDBA 3FK7A 4F52A 3JRBA 2CSOA 1FMVA 3ZMZA 4DJAA 5B1BH 1G3YA 2TRTA 3TOBA 3F0CA 3GYHX 1E2XA 2WTEA 5IPAA 2X6OA 1V3FA 2FBIA 2TDXA 3DTKA 1R1UA 3KP6A 3ERED 2KP6A 2M34A 3HRSA 2KIMA 4WF2A 3OYDA 1J59A 3CC4I 2RAEA 4GRIA 1A35A 2W24A 3ZQLA 3ZN1A 2YS9A 2NS7A 1YQAA 4CDGA 2KPMA 4BDYA 2MW8A 1BI2A 4DW6A 2KJCA 2FOWA 3GLXA 3LSHA 2ESHA 3H35A 1TT0A 5KVRA 1UMQA 3G4SI 1NHAA 2R7WA 2QQBA 1VQ7I 3DPTA 1CF7A 4UB6C 4DIQA 2IW5A 1W7PD 4NBQA 4XIDA 2BY1A 5D8LB 3VEPA 3F3XA 2CRGA 2FA5A 2PJPA 1R1VA 4A2UA 2QF7A 2ZMEA 2DJNA 2HTJA 2BXZA 4CZZA 5FLXZ 1WQ2A 2DBBA 4ZYEA 1LVKA 1BL0A 2HZDA 3H36A 4WX9A 1H9TA 2RVCA 2M7BA 2A6HF 3OYLA 3OOPA 1IC8A 1SFXA 3QQAA 2P7VB 2VONA 2NVUB 1G3WA 2DLLA 1RKTA 2MABA 2Y2ZA 4ZYDA 3N97A 1ETQA 2RREA 3M9AA 1YJNI 2KDOA 3ZMVA 5J8FA 3L2CA 5IP7J 1Z6TA 3E6DA 1LFPA 3ELKA 4D9JA 2IT0A 2EBIA 4U88A 4U87A 2D5VA 4HX8A 2GXAA 4I01A 3DEEA 2LNBA 4WXCA 4LB6B 2R7TA 1SAXA 4L5JA 3G73A 3ECOA 3QWLA 5E1WA 1D0ZA 2FMYA 5K5QA 5HDNA 1GV5A 5DS9A 1RR8C 4YELA 3BZKA 4JK1X 2CW7A 3AG4H 3HDDA 2L02A 4Y4RA 2XROA 1XCBA 5LHGA 4FETA 3F6VA 2JT1A 2PMUA 5JR3A 2OQRA 1T0FC 4AIJA 3CLOA 2PN6A 1VQLI 1ETYA 4ETSA 1SMYF 4XBFA 3HPGA 2KDZA 2IA1A 1SVLA 2OD5A 4EJVA 1YFHA 5EJCA 1AHDP 3OL4A 3LSTA 4HF0A 5L3CA 1MH3A 3OS0A 5HDKA 2Y75A 1G59A 3MD2A 2MGQA 4RGSA 3OYEA 4EGZA 4HDVA 3NQOA 4LLNA 2DN0A 3F8BA 4Y13A 3IH4A 4GYIA 1WZ2A 4ZYHA 2E1OA 3FHZA 5IOYA 3M07A 3CDHA 2EILH 2VXDA 4RB1A 1WI3A 5HOOA 3C2HA 2QUFA 1EH6A 1O3RA 5D8KB 3TBIA 1OCOH 2FXAA 2NNNA 4ZDLA 2JPCA 4BQNA 3RDIA 2ME0A 1R22A 3LSMA 2OPTA 3OYFA 4B8XA 3SEZA 5FO5A 1BI3A 4IXAA 1LPQA 3CJTB 3RZOJ 1VQPI 5HNHA 2BY0A 3RYPA 1YHQI 4ESFA 2W00A 3ZQHA 3GFLA 4MEYF 2LVSA 3K4JA 1DP3A 3J7YJ 3BLYA 3PO2J 3D1NI 4LMYA 5M5WJ 1IDYA 2V7FA 4EJTA 2JRTA 3PQKA 2Y30A 4ANJA 3LA7A 4A69C 4B3AA 4UY8I 4G8XA 2JK3A 2VOPA 1DPRA 2DA5A 4Y15A 2YR2A 5DEQA 1KZHA 5LRRA 4XLAA 3FHNA 3D0SA 2EIJH 1BJAA 1F1ZA 1IGNA 4DQ2A 1WKMA 4KN4X 2LC2A 4II2A 3NWTA 3ZQIA 4G7HF 2LH9A 4HNVA 3IRRA 1XGSA 2FRHA 3C1DA 3PIPF 4FX0A 2LG4A 3ZMUA 5GAEJ 2BEOA 5KK1A 3WTYC 5JVGF 4LK1F 1SANA 4EVIA 2V9KA 4P55A 2G7HA 1FPQA 2V1UA 5GTIC 2QENA 3QYBA 1OYYA 1S5LC 3VYRB 1BJZA 2AXLA 4MEXF 2VKEA 1T0FA 2XAUA 3WE2A 3JRDA 3Q0UA 3X2QH 5AIQA 4BQOA 1S9HA 2VODA 3E6BA 4XLEA 1XDUA 3I56I 2M87A 5EDNA 1OLTA 4F92B 1X2NA 5FD5A 2EIMH 1MBFA 4HAMA 1ZR4A 4BE1A 2PMZN 2F6CA 3BROA 1RIOH 3HRMA 2O9LA 2B63J 1OQYA 4I0AA 1PP8F 2V1DA 1MGTA 2LK2A 4RLFA 1WH5A 1U5TC 2X0LA 2ZJRF 2NAZA 2VKHA 3HM5A 1UELB 3BTJA 5BPIA 2ZKZA 3HSFA 4OWRB 3DTIA 1YJWI 2CUFA 2L9NA 4RA2A 3H92A 3WU2C 5EG0A 4MTDA 2CQQA 5FB2A 2YX4A 1N77A 4YIRX 3LSJA 1UG2A 5LLQA 1MMAA 4QPOA 5LEJA 3PM1A 3F8NA 4XK4A 3LMMA 3WG9A 3GTLJ 1IXCA 5E3MA 5FD6A 5J47A 1FYMA 3DTEA 2NS0A 3BDDA 3HG9A 3OS1A 5K7HA 5EF6A 4O5VA 1ZELA 4HLYA 3TQNA 2F5VA 1XPXA 4KYWA 2MD5A 2OZ6A 3MKYB 3NEUA 2HEOA 4NHJA 2OC6A 1R5ID 2AQEA 2DI3A 3C2BA 1R49A 1ZH5A 1NG6A 2V9VA 3PNVA 2XPUA 1MMGA 2CJJA 3LSRA 1MNMC 3Q9SA 2HOSA 1BC8C 3EETA 4RM3A 3ZR8X 3GX4X 4KIBA 3BG6A 2CYYA 2Z2SB 5D6FA 2NYXA 4CH7A 1ZREA 1BBYA 5FLMJ 1PUEE 3KEOA 2V6EA 2FX0A 1O7LA 1Z7LA 2Z1DA 2LLKA 3BQZA 4ZDPA 1REPC 3S8PA 3OYHA 3SZGA 1EH7A 1S7OA 3TDZC 1JUSA 2R7SA 2H09A 5CQGA 4PJMA 2UZKA 3C7JA 1ETOA 2Y31A 1H8AC 1HW1A 1USTA 2F4IA 1YG2A 4XLHA 2PX9A 2LD5A 3H5RA 2VQLA 4DBQA 2IA0A 3PNYA 3HHGA 5ILSA 2XUBA 4IEJA 2L7FP 4FT8A 4C2UA 2IS2A 3NRVA 1TLHB 4B09A 4U0VA 4BXUA 1O3SA 1P9QC 1B72A 9ANTA 3LL7A 3TOAA 5E3NA 4HF2A 1SMTA 3K4KA 2M7AA 5EZGA 4A3BJ 2OTLI 2OCCH 4KDPA 5M3FJ 2R92J 2IS1A 3FXJA 1MJ9A 4XKCA 1W0UA 4E7IA 2R4GA 2FOKA 4AIDA 1VQ9I 3LSIA 1U5TB 3F21A 1HKTA 1S8NA 2V26A 3DKYA 4IJAA 2P0WA 1FOWA 3S17J 1FYLA 1PYVA 1A6IA 2BV6A 4M3FA 2EV0A 1IRZA 2DFEA 2ME6A 2K40A 2GIZA 2M45A 3JRIA 1S72I 1K83J 1SD6A 2IEKA 1WJDA 4EGYA 4IZZA 2HOTA 4XKWA 4E7ZA 1PUFB 2GZWA 2QYOA 3B02A 4EATA 3F8MA 3WG7H 3BZ6A 3U1DA 2XGXA 3DV8A 2RQQA 2BYVE 3OR1C 2IGKA 4FHTA 4MO7A 3BPXA 2FSWA 2XPVA 1W36D 2V4JC 3IV5A 3OYIA 1K78A 5D4SA 4XNFA 1HDPA 2DA4A 3DU5A 2VBYA 2PG4A 2L01A 1LDJA 2K02A 1R7JA 2K86A 4BJTA 2A07F 1QVTA 1Z1DA 3RZDJ 3BOQA 4DNCA 4S05A 2O0YA 3FK6A 5TJJA 1GDTA 2CV2A 4CHUA 3HUGA 4E70A 1MZBA 1SAUA 1GHCA 1K78B 4XQFA 3RYRA 2V9PA 2X1EA 5J1UA 2B7EA 1RRJA 1AWCA 1W5TA 1FOXA 5B3SH 3P9CA 4RBOA 1I5ZA 4AIKA 3KP5A 2L7ZA 3PNTA 3WHCA 2HVRA 1HSTA 2PJRA 4KA4A 5KCMA 3BG3A 4P9UA 1IG7A 2YSRA 2O6GE 4RAZA 1Z0XA 2KJBA 2R5YA 3WTXC 3HUGB 2BXYA 4ZTJA 3GVAA 1KYZA 4C3JJ 4JP0A 4A93J 1FSEA 3FXOA 1WJFA 3HRTA 2BOLA 4UUSA 2KIQA 2Q8KA 4ENMA 2ECCA 4XLNF 4KUMA 5J1YA 4KMUX 2KIUA 2XHKA 2Q2EA 2PJRB 3DLAA 5KAIC 4E7JA 1E3PA 3BY6A 3CCQI 4IHTA 5HNFA 2NXNB 3F8CA 3HEFA 3ISPA 4G6TB 2VT2A 2FNAA 5E3LA 2VKDA 4PUSA 1E0EA 1XG1A 3FM5A 4UUSB 2A69F 5F0FA 5D5UB 3DKWA 4D5FA 1JXSA 2VQGA 4W1UA 2W85A 2VJJA 3S2HJ 1XGMA 3F22A 4G7ZF 2XGDA 4RGUA
chains in the Genus database with same CATH topology
2ESNA 4HZFA 2DTRA 5D5WB 2E1CA 3WTSC 3V4GA 3CO6C 3LA3A 2E7WA 1WWXA 1Z9CA 3ZN0A 4L18B 1LQ1A 2V79A 1LDKB 1ZARA 3V7SA 1U8RA 2RV8A 3MAJA 2EFPA 1P2FA 1ZG1A 1A04A 2ZNZA 1SD4A 4I98B 1AOYA 3GWZA 4K2EA 2R7DA 5DD8A 1TQPA 5HDGA 4ON0A 1HQCA 3C3WA 5L3GA 3LQRA 4U0YA 3GO5A 3R0JA 1K7AA 2CW0F 3QAHA 4EM0B 4Z2YA 1UHWA 3E5UA 1T98A 4A0YA 1FBSA 2PQ8A 3WGIA 2QBYB 4HX4A 3V8LA 3GFJA 4IVNA 1KA8A 1I27A 5CVRA 1T6SA 1O3QA 5BS6A 5L3EA 4KN7X 2FMLA 4OIRF 3BWGA 1LEAA 2DAOA 3FMSA 5L3DA 1H9GA 1F9NA 2E1NA 1Z91A 2HZTA 2HOEA 5E8IA 4AVPA 1LDDA 1R00A 4EJOA 4YFNF 4YIIA 3R4KA 1U2WA 2FNPA 2STWA 1G3TA 2Q0OA 2GAUA 1IRGA 5H6QA 3RPUA 4O6JA 1FP2A 3JAMK 1U78A 5D6EA 4MTEA 4YIFA 3VFZA 3QPHA 1HBXG 3MZHA 4BH9A 3F72A 3J80K 3LAJA 3HOTA 1HW2A 5D4RA 1IW7F 1WRJA 1BM9A 2R3SA 5JFRA 1ZYRF 1KQ9A 5LHHA 1FP1D 5JHUA 5F64A 3U9GA 4M73A 2AS5F 3K1NA 4A0XA 3M7GA 1ON2A 3WTVC 2EJRA 1EV7A 4EM2A 3ZMSA 1I1SA 3I59A 3CJNA 1FY7A 3RKXA 3BP8A 3DPLC 3IKVA 3R60A 1LNWA 1F5TA 3T8TA 3O3KA 3EQLF 1YYVA 3KEQA 2H27A 4HDUA 4Y17A 2HR3A 4MHGA 1JHFA 1GVJA 3I59B 2BGCA 1K79A 2K4BA 2MA3A 4EQQA 1Y0UA 5F1RA 1LVAA 2HQRA 3HSEA 2Z5UA 4M6YA 1JE8A 1QO0D 2FBKA 3OV8A 4L9NA 1ZAOA 2STTA 2FF4A 1MJAA 5LHIA 4OMZA 3QU6A 2OZUA 4LLGF 3LA2A 2P6SA 1L0OC 5D5VB 4N9HA 1FX7A 3EYIA 4XSXF 3SHFA 4I7HA 4RAYA 4A0ZA 1W5SA 1B6AA 1RI7A 3VODA 3KP3A 1YS6A 4XLPF 3O2PE 2ACJA 3KP7A 3J81K 5FGMA 1ONVA 2NNYA 1OPCA 2KRFA 3HIFA 4KT5C 1XMKA 3V7RA 1YIOA 3SXYA 3HTSB 5EEGA 2HWVA 2BBYA 4BQAA 3B73A 1BC7C 2ADUA 4XRFA 4RS8A 3WU0A 4R8HA 4BAYA 2A61A 1DUXC 2ZJ2A 4N9IA 5E17F 4PGGA 1WI9A 1ZN2A 4PZJA 2QZ8A 3F23A 1HW5A 5JI6A 2DU9A 3SZPA 2XV4S 2HGCA 3P9IA 1EH8A 4S04A 3QOPA 2VE8A 5HS9A 4GXOA 1TW3A 4UV8A 1MJBA 2Z3YA 3P9KA 2DT5A 3RPQA 3JW4A 4Q47A 3WTTC 4UXNA 1QBJA 1TTYA 3V8JA 1TQIA 4BHPA 2LF8A 4WXHA 2JZYA 2MH2A 3FWEA 3T8RA 5H6RA 5AONA 2J5OA 4M9ZA 5DV5A 2COMA 5LBQA 1BI0A 2P7CB 1FSHA 4PGHA 1KU2A 4CICA 1QQIA 3GZ6A 1J7KA 5ED4A 1TW2A 4UHTA 2ZNYA 1FBQA 3HYIA 1I1GA 4F7ZA 3WGHA 2L4AA 2P5LC 4D0PA 2PI0A 1UFMA 2A5YB 1J0RA 4ENKA 1IN6A 2GWRA 5CVJA 2KIFA 4EJWA 1SFUA 2H6CA 5A2QK 1YTYA 3GFMA 3GUDA 2JPBA 2CFXA 4QWQA 1HKSA 1XSDA 2QWWA 3E6CC 3KP2A 1MDMB 3Q9VA 2DK8A 2HS5A 4UV9A 3L00A 1K6OA 4LB5A 4LG0B 2YPRA 1R1TA 1RNLA 2C6YA 5CLSA 5BMZA 2OQGA 4WXDA 4UUVA 3HRUA 3QRFF 2F5DA 2OA4A 2Y0MA 1O7FA 4UVCA 4AD9A 4A12A 4PCQA 1TQMA 1ZHFA 3E5QA 5ILVA 5L3FA 2VBXA 1XGNA 2H94A 1T38A 1G4DA 6PAXA 2M8EA 4A5MA 2VBWA 2RQPA 1LB2A 3ZMDA 1IAWA 3FMQA 2F2EA 1XSVA 1KQ0A 4ZH4F 4ASNA 1U5TA 1ZG5A 3K69A 5CJ9A 4LD5A 3PQJA 2L3DA 4RGRA 1VTNC 1U3EM 1P6RA 4I02A 4EM1A 5IT9K 1YLFA 1ZLJA 3FXUA 1ZRFA 4G6DA 2FE3A 4ENNA 3V8KA 3WODF 1ODDA 1OKRA 3T1BA 3LAPA 3TDUC 1YW9A 1P4WA 3RKWA 4IRGA 3M8EA 3MCZA 1B1BA 3E3VA 1FYKA 3WTUC 1HKQA 3R0AA 1JHHA 2FEZA 1MD0A 2V1XA 4KMFA 2IPQX 2VE9A 1R58A 2PLYA 4G6QA 4H0EA 1XSXA 4HW0A 1RUOA 3FXRA 3KCCA 2DPUA 1USSA 2Z9OA 5AIPA 4CO8A 1J75A 1ZRCA 3E6MA 2P5VA 4OOIA 2XRNA 1J2XA 3SZTA 1KGSA 1BI1A 2G7UA 3C18A 4MGRA 2XAQA 3S2WA 4YFXF 4JBAA 5ICEA 4P5OA 1YO5C 2Z33A 3F8FA 3CUQC 3QPTA 2EK5A 3PFIA 4GYGA 4CXFA 3K2ZA 4OIPF 4RB3C 5K5RA 2WWYA 3H3ZA 2DPDA 1IZ1A 1FOKA 4M72A 3ML6A 1T39A 1XDSA 2W84A 5HLGA 1HSJA 1FLIA 3GFIA 2IJLA 1DP7P 4I09A 1D8JA 1SD5A 2P4WA 4G9YA 2QQAA 4L5IA 5F6FA 5LRSA 1R23A 4L9TA 5J6XA 5FLXK 2HFHA 3W6KB 4U7BA 4AWXB 2ZFWA 2QBYA 4XSZF 4WCGA 4U7DA 2DK5A 1S29A 2QM3A 1IN8A 3U2RA 2X4HA 3L09A 4PDKA 1PP7U 1B9NA 1R5HA 3J7AO 4HQMA 4HOBA 4YFKF 5LEKA 5K5OA 1UB9A 2ELHA 4Q5SF 4ZZDA 2IA2A 2DFIA 3QU3A 4LGWA 2GQQA 1XMAA 5D5XB 4M9SA 3REOA 2D45A 2WV0A 3CUQA 2K7LA 3GF2A 1ZH5A 5FFXA 5FFZA 4IF4A 2JTVA 2KKOA 3RKYA 2XASA 2CO5A 4KFCA 1TNSA 2EFQA 3GEZA 3ZQ7A 4EV0A 1KU3A 3CUQB 4HV6A 4Q48A 4M71A 4CGZA 1IRFA 3BJOA 3EYYA 3ECHA 2DO7A 1ZGJA 2LDUA 5DDGA 2EA2A 1F4KA 3I4PA 4NQWA 4I2OA 3GZ5A 2HYFA 2WC2A 4IRIA 5L3BA 2O61A 3I64A 3BJAA 2V6CA 5LGNA 1O3TA 1D3YA 2F5FA 4FX4A 3T5XA 2W25A 3TGNA 5DCMA 5E18F 4QLCU 1U6GA 1KU7A 1BOAA 3I71A 2UXXA 4P96A 3KZZA 1W7PA 3KFWX 1IN5A 3AAFA 5DCMB 4RGXA 1B9MA 3TKYA 4IHSA 5JVTA 2XAHA 3L9FA 3I5UA 4CYDA 4MQVA 2L4MA 2MLGA 4OIOF 5HLIA 1W7PB 1FC3A 2JSCA 2XKPA 1J9IA 2RGVA 4BNCA 3ABTA 1L3LA 1FBUA 5BQTA 4GCVA 4IPAA 1TBXA 3DXJF 4BYYA 1BIAA 4HV5A 1UCRA 1Z05A 3COAC 1CF7B 5DYMA 5ILUA 3ABUA 3JSPA 3K1MA 4MQ9F 2O3FA 4L0ZB 4OMYA 2VC0A 2CQKA 4M6XA 2DQLA 1P92A 3ZMTA 2ZMEB 2P5KA 3RJPA 5CYVA 3N4MA 2M1BA 5LGUA 3IWFA 2RN7A 2ZBKA 2GA1A 2MH9A 1Q1HA 3MZYA 4HYEA 2W57A 3DEUA 3O6BB 2VOOA 2YX7A 2A68F 4YG2F 4HF1A 2J5PA 4EMSA 3BPVA 1DPUA 4ZZLA 3SQNA 2EWNA 4KIFA 4OU0A 1S3JA 1IXSB 2PMHA 3RI4A 3JAMZ 2FQ3A 4IRHA 3D5LA 5DD4A 1T2KA 3IC7A 1BN5A 3FF5A 2ZXJA 5DUIA 1OYIA 4BHCA 1BIBA 1RZ4A 1P4AA 2HKXA 2YU3A 1IN4A 1IN7A 3J80Z 1LEBA 3L7WA 2ISYA 1XCVA 1KYWA 1XD7A 3FX3A 3ULQB 2FU4A 3K1PA 1KQ8A 1I6XA 1ULYA 4G94A 2GXBA 2FBHA 1O57A 1JGSA 2LSOA 3HHHA 2ISZA 3M1EA 3ROUA 1X3UA 2QQ9A 1IUYA 4UVBA 3JTHA 3TO7A 1OR7A 1S7AA 4NB5A 2D1VA 1UHMA 4LLLA 2PFBA 1YW7A 3KLOA 1R36A 1D5VA 2VN2A 4BHBA 1ON1A 5ERIA 4LFUA 3MQ0A 3HTUA 4ESJA 1ZRDA 3QP5A 4O3MA 5ICCA 2HQNA 1QZYA 1Z6RA 2HKOA 2LKPA 3DFGA 4HA8A 5LGTA 1ZLKA 2NRAC 1MDMA 2O03A 3IWZA 4WWCA 5E1XA 2IVMA 2XKOA 4LG0A 2EV6A 2QVOA 2BE5F 2E7XA 3SFZA 2HYGD 2LF7A 1GXQA 3ZPLA 2ZCWA 3DQVC 3E5XA 4OINF 3P7NA 2DQRA 5E1ZB 3TO9A 3RTRA 4RB2C 1B59A 4GGGA 3T0YA 3Q5FA 3J81Z 2OU2A 1S6LA 1QGPA 2OBPA 2XAGA 1QNTA 4P9FA 1GXPA 1TNTA 3WTWC 4EJUA 4A6EA 2P8TA 4ZYGA 2ETHA 2EFWA 1SD7A 1SFEA 1FWZA 3KP4A 4N0BA 1H0MA 3EDPA 2VC1A 2RC4A 3IRQA 3H3UA 3WE3A 2L54A 1YW8A 1ZG3A 5CVUA 5HS7A 1V4RA 2QLZA 2XIGA 1HXDA 3VB2A 3F6OA 3LWFA 1G3SA 2VXZA 3V7CA 1D8KA 1DDNA 4MNUA 2Z99A 4LJZF 3FMRA 3KETA 3W6JB 2RNJA 3IL2A 4UVAA 2EFNA 4M74A 2EFOA 3RIRA 4R1HA 5E8GA 5TRDA 5CVIA 5BOXA 5HLHA 4KNYA 1XB4A 3MEXA 3EUHA 4G7OF 3ZP5A 5DUKA 4AIHA 1QZZA 2UWMA 4Q4ZF 2XVCA 2UXNA 3G3ZA 1OYWA 2MLKA 3R6SA 2HDCA 2M30A 1ZGAA 2IRFG 4L9VA 2F5EA 2D1HA 3QP6A 1WSUA 4KIGA 5A2QZ 1IXRC 1P4XA 2H6BA 2PBIA 1PDNC 4R79A 3LFKA 3CTAA 2A3SA 4M9XA 3M8FA 1Z7UA 1FT9A 3I53A 2G9WA 2GXGA 2M5WA 3MFKA 2RDPA 2B0LA 3GXOA 3LQQA 4RB0A 4U0WA 1FZPB 3K9TA 5K1YA 5CVVA 5IT3A 3E97A 2EB7A 2OAZA 3I54A 1KU9A 3JSOA 4L0YB 5HVQC 4HBLA 4KICA 4HLXA 4ENJA 4ESBA 4I0BA 2R7FA 1IF1A 2F5CA 5HS8A 3CUOA 4GO1A 5ICFA 3I0TA 2HTSA 2GA2A 5DCFA 3WU1B 3DF8A 3FM3A 3HSRA 3JTGA 3K0LA 5J8CA 2PEXA 4JQFA 1XN7A 2CWEA 3FXQA 2CGPA 5IT9Z 2IP2A 2D2WA 3R61A 1LJ9A 5ICGA 3DP7A 1W4MA 3FZVA 4TV7A 3WGGA 5EEHA 3CO7C 1XGOA 3MWMA 2K4JA 2VBZA 4A6DA 3IKTA 1YS7A 3HOSA 1G6NA 1STZA 4L9JA 1RUNA 3KLNA 2GIVA 1QPMA 3VOEA 3WTZA 3GW2A 2A6EF 1C0WA 1J5YA 5E20A 1OMIA 2Y48A 5BPDA 3I58A 1FNNA 2RKHA 2CG4A 1B4AA 2K27A 4LK0F 4CHUA 5H20A 3IHUA 2MC3A 4A5NA 4WK8F 3TO6A 2DW4A 4HX7A 3KZYA 2MBFA 2O8XA 3KE2A 4OIQF 1R5GA 1E17A 1CGPA 2VT3A 2XAFA 2P6TA 2ZO4A 2EV5A 2XAJA 4HQEA 4UNOA 1MKMA 3BJ6A 2EA4A 2CSOA 3ZMZA 1G3YA 3TOBA 3GYHX 1E2XA 2WTEA 1V3FA 2FBIA 2TDXA 1R1UA 3KP6A 3ERED 3HRSA 2KIMA 4WF2A 1J59A 2W24A 3ZN1A 1YQAA 4CDGA 1BI2A 2KJCA 3GLXA 2ESHA 5KVRA 1NHAA 2QQBA 3DPTA 1CF7A 2IW5A 1W7PD 5D8LB 3VEPA 3F3XA 2FA5A 2PJPA 1R1VA 4A2UA 2ZMEA 2HTJA 4CZZA 5FLXZ 1WQ2A 2DBBA 4ZYEA 1H9TA 4WX9A 2RVCA 2A6HF 3OOPA 1SFXA 2P7VB 2VONA 1G3WA 2DLLA 4ZYDA 3N97A 3M9AA 3ZMVA 5J8FA 3L2CA 1Z6TA 3E6DA 3ELKA 2IT0A 4U88A 4HX8A 4I01A 2LNBA 4WXCA 4LB6B 1SAXA 4L5JA 3G73A 3ECOA 5E1WA 2FMYA 5K5QA 5HDNA 4JK1X 2L02A 2XROA 1XCBA 5LHGA 3F6VA 2JT1A 2PMUA 5JR3A 2OQRA 4AIJA 3CLOA 2PN6A 4ETSA 1SMYF 4XBFA 2IA1A 4EJVA 2OD5A 1YFHA 3LSTA 4HF0A 5L3CA 5HDKA 2Y75A 4RGSA 4EGZA 4HDVA 3NQOA 4LLNA 3F8BA 4Y13A 4GYIA 4ZYHA 3FHZA 3CDHA 4RB1A 5HOOA 2QUFA 1EH6A 1O3RA 5D8KB 2FXAA 2NNNA 2JPCA 3RDIA 1R22A 4B8XA 5FO5A 1BI3A 4IXAA 3RYPA 4ESFA 3GFLA 4MEYF 4LMYA 4EJTA 2JRTA 3PQKA 3LA7A 4G8XA 2VOPA 1DPRA 4Y15A 2YR2A 5DEQA 5LRRA 3D0SA 1BJAA 1F1ZA 4DQ2A 1WKMA 4KN4X 4G7HF 3IRRA 1XGSA 2FRHA 3C1DA 4FX0A 3ZMUA 2BEOA 5KK1A 3WTYC 4LK1F 4EVIA 4P55A 2G7HA 1FPQA 2V1UA 2QENA 1OYYA 2AXLA 4MEXF 1T0FA 3WE2A 5AIQA 2VODA 3E6BA 1XDUA 2M87A 5FD5A 4HAMA 3BROA 1RIOH 3HRMA 4I0AA 1PP8F 2V1DA 1MGTA 1U5TC 2X0LA 2NAZA 5BPIA 2ZKZA 3HSFA 3H92A 4MTDA 5FB2A 2YX4A 5LLQA 5LEJA 3F8NA 3WG9A 1IXCA 5FD6A 1FYMA 2NS0A 3BDDA 4O5VA 4HLYA 3TQNA 4KYWA 2MD5A 2OZ6A 3NEUA 2HEOA 4NHJA 2DI3A 2V9VA 3Q9SA 1BC8C 3EETA 3GX4X 4KIBA 2CYYA 5D6FA 2NYXA 1ZREA 1BBYA 1PUEE 3KEOA 1O7LA 1REPC 1EH7A 1S7OA 3TDZC 2H09A 2UZKA 3C7JA 1HW1A 1USTA 1YG2A 2IA0A 3HHGA 5ILSA 2XUBA 4FT8A 3NRVA 1TLHB 4B09A 4U0VA 4BXUA 1O3SA 3TOAA 4HF2A 1SMTA 4KDPA 1MJ9A 2FOKA 3F21A 1U5TB 1HKTA 1S8NA 4IJAA 1FYLA 2BV6A 2EV0A 2M45A 1SD6A 4EGYA 2GZWA 2QYOA 3B02A 3F8MA 3BZ6A 3U1DA 2XGXA 3DV8A 2BYVE 4FHTA 3BPXA 2FSWA 1K78A 5D4SA 2VBYA 2PG4A 2L01A 1LDJA 2K02A 1R7JA 2K86A 2A07F 1Z1DA 3BOQA 4DNCA 4S05A 2O0YA 5TJJA 3HUGA 4E70A 1MZBA 1GHCA 1K78B 3RYRA 1AWCA 1W5TA 3P9CA 1I5ZA 4AIKA 3KP5A 1HSTA 4KA4A 4P9UA 2YSRA 2O6GE 4RAZA 2KJBA 3WTXC 3GVAA 1KYZA 1FSEA 3HRTA 2Q8KA 4ENMA 4XLNF 4KUMA 4KMUX 2KIUA 2XHKA 2Q2EA 3BY6A 4IHTA 3F8CA 3ISPA 2VT2A 2FNAA 1JXSA 3FM5A 2A69F 5D5UB 3DKWA 2W85A 1XGMA 3F22A 4G7ZF 4RGUA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 2ESN A;  4HZF A;  2DTR A;  5D5W B;  2E1C A;  3WTS C;  3V4G A;  3CO6 C;  3LA3 A;  2E7W A;  1WWX A;  1Z9C A;  3ZN0 A;  4L18 B;  1LQ1 A;  2V79 A;  1LDK B;  1ZAR A;  3V7S A;  1U8R A;  2RV8 A;  3MAJ A;  2EFP A;  1P2F A;  1ZG1 A;  1A04 A;  2ZNZ A;  1SD4 A;  4I98 B;  1AOY A;  3GWZ A;  4K2E A;  2R7D A;  5DD8 A;  1TQP A;  5HDG A;  4ON0 A;  1HQC A;  3C3W A;  5L3G A;  3LQR A;  4U0Y A;  3GO5 A;  3R0J A;  1K7A A;  2CW0 F;  3QAH A;  4EM0 B;  4Z2Y A;  1UHW A;  3E5U A;  1T98 A;  4A0Y A;  1FBS A;  2PQ8 A;  3WGI A;  2QBY B;  4HX4 A;  3V8L A;  3GFJ A;  4IVN A;  1KA8 A;  1I27 A;  5CVR A;  1T6S A;  1O3Q A;  5BS6 A;  5L3E A;  4KN7 X;  2FML A;  4OIR F;  3BWG A;  1LEA A;  2DAO A;  3FMS A;  5L3D A;  1H9G A;  1F9N A;  2E1N A;  1Z91 A;  2HZT A;  2HOE A;  5E8I A;  4AVP A;  1LDD A;  1R00 A;  4EJO A;  4YFN F;  4YII A;  3R4K A;  1U2W A;  2FNP A;  2STW A;  1G3T A;  2Q0O A;  2GAU A;  1IRG A;  5H6Q A;  3RPU A;  4O6J A;  1FP2 A;  3JAM K;  1U78 A;  5D6E A;  4MTE A;  4YIF A;  3VFZ A;  3QPH A;  1HBX G;  3MZH A;  4BH9 A;  3F72 A;  3J80 K;  3LAJ A;  3HOT A;  1HW2 A;  5D4R A;  1IW7 F;  1WRJ A;  1BM9 A;  2R3S A;  5JFR A;  1ZYR F;  1KQ9 A;  5LHH A;  1FP1 D;  5JHU A;  5F64 A;  3U9G A;  4M73 A;  2AS5 F;  3K1N A;  4A0X A;  3M7G A;  1ON2 A;  3WTV C;  2EJR A;  1EV7 A;  4EM2 A;  3ZMS A;  1I1S A;  3I59 A;  3CJN A;  1FY7 A;  3RKX A;  3BP8 A;  3DPL C;  3IKV A;  3R60 A;  1LNW A;  1F5T A;  3T8T A;  3O3K A;  3EQL F;  1YYV A;  3KEQ A;  2H27 A;  4HDU A;  4Y17 A;  2HR3 A;  4MHG A;  1JHF A;  1GVJ A;  3I59 B;  2BGC A;  1K79 A;  2K4B A;  2MA3 A;  4EQQ A;  1Y0U A;  5F1R A;  1LVA A;  2HQR A;  3HSE A;  2Z5U A;  4M6Y A;  1JE8 A;  1QO0 D;  2FBK A;  3OV8 A;  4L9N A;  1ZAO A;  2STT A;  2FF4 A;  1MJA A;  5LHI A;  4OMZ A;  3QU6 A;  2OZU A;  4LLG F;  3LA2 A;  2P6S A;  1L0O C;  5D5V B;  4N9H A;  1FX7 A;  3EYI A;  4XSX F;  3SHF A;  4I7H A;  4RAY A;  4A0Z A;  1W5S A;  1B6A A;  1RI7 A;  3VOD A;  3KP3 A;  1YS6 A;  4XLP F;  3O2P E;  2ACJ A;  3KP7 A;  3J81 K;  5FGM A;  1ONV A;  2NNY A;  1OPC A;  2KRF A;  3HIF A;  4KT5 C;  1XMK A;  3V7R A;  1YIO A;  3SXY A;  3HTS B;  5EEG A;  2HWV A;  2BBY A;  4BQA A;  3B73 A;  1BC7 C;  2ADU A;  4XRF A;  4RS8 A;  3WU0 A;  4R8H A;  4BAY A;  2A61 A;  1DUX C;  2ZJ2 A;  4N9I A;  5E17 F;  4PGG A;  1WI9 A;  1ZN2 A;  4PZJ A;  2QZ8 A;  3F23 A;  1HW5 A;  5JI6 A;  2DU9 A;  3SZP A;  2XV4 S;  2HGC A;  3P9I A;  1EH8 A;  4S04 A;  3QOP A;  2VE8 A;  5HS9 A;  4GXO A;  1TW3 A;  4UV8 A;  1MJB A;  2Z3Y A;  3P9K A;  2DT5 A;  3RPQ A;  3JW4 A;  4Q47 A;  3WTT C;  4UXN A;  1QBJ A;  1TTY A;  3V8J A;  1TQI A;  4BHP A;  2LF8 A;  4WXH A;  2JZY A;  2MH2 A;  3FWE A;  3T8R A;  5H6R A;  5AON A;  2J5O A;  4M9Z A;  5DV5 A;  2COM A;  5LBQ A;  1BI0 A;  2P7C B;  1FSH A;  4PGH A;  1KU2 A;  4CIC A;  1QQI A;  3GZ6 A;  1J7K A;  5ED4 A;  1TW2 A;  4UHT A;  2ZNY A;  1FBQ A;  3HYI A;  1I1G A;  4F7Z A;  3WGH A;  2L4A A;  2P5L C;  4D0P A;  2PI0 A;  1UFM A;  2A5Y B;  1J0R A;  4ENK A;  1IN6 A;  2GWR A;  5CVJ A;  2KIF A;  4EJW A;  1SFU A;  2H6C A;  5A2Q K;  1YTY A;  3GFM A;  3GUD A;  2JPB A;  2CFX A;  4QWQ A;  1HKS A;  1XSD A;  2QWW A;  3E6C C;  3KP2 A;  1MDM B;  3Q9V A;  2DK8 A;  2HS5 A;  4UV9 A;  3L00 A;  1K6O A;  4LB5 A;  4LG0 B;  2YPR A;  1R1T A;  1RNL A;  2C6Y A;  5CLS A;  5BMZ A;  2OQG A;  4WXD A;  4UUV A;  3HRU A;  3QRF F;  2F5D A;  2OA4 A;  2Y0M A;  1O7F A;  4UVC A;  4AD9 A;  4A12 A;  4PCQ A;  1TQM A;  1ZHF A;  3E5Q A;  5ILV A;  5L3F A;  2VBX A;  1XGN A;  2H94 A;  1T38 A;  1G4D A;  6PAX A;  2M8E A;  4A5M A;  2VBW A;  2RQP A;  1LB2 A;  3ZMD A;  1IAW A;  3FMQ A;  2F2E A;  1XSV A;  1KQ0 A;  4ZH4 F;  4ASN A;  1U5T A;  1ZG5 A;  3K69 A;  5CJ9 A;  4LD5 A;  3PQJ A;  2L3D A;  4RGR A;  1VTN C;  1U3E M;  1P6R A;  4I02 A;  4EM1 A;  5IT9 K;  1YLF A;  1ZLJ A;  3FXU A;  1ZRF A;  4G6D A;  2FE3 A;  4ENN A;  3V8K A;  3WOD F;  1ODD A;  1OKR A;  3T1B A;  3LAP A;  3TDU C;  1YW9 A;  1P4W A;  3RKW A;  4IRG A;  3M8E A;  3MCZ A;  1B1B A;  3E3V A;  1FYK A;  3WTU C;  1HKQ A;  3R0A A;  1JHH A;  2FEZ A;  1MD0 A;  2V1X A;  4KMF A;  2IPQ X;  2VE9 A;  1R58 A;  2PLY A;  4G6Q A;  4H0E A;  1XSX A;  4HW0 A;  1RUO A;  3FXR A;  3KCC A;  2DPU A;  1USS A;  2Z9O A;  5AIP A;  4CO8 A;  1J75 A;  1ZRC A;  3E6M A;  2P5V A;  4OOI A;  2XRN A;  1J2X A;  3SZT A;  1KGS A;  1BI1 A;  2G7U A;  3C18 A;  4MGR A;  2XAQ A;  3S2W A;  4YFX F;  4JBA A;  5ICE A;  4P5O A;  1YO5 C;  2Z33 A;  3F8F A;  3CUQ C;  3QPT A;  2EK5 A;  3PFI A;  4GYG A;  4CXF A;  3K2Z A;  4OIP F;  4RB3 C;  5K5R A;  2WWY A;  3H3Z A;  2DPD A;  1IZ1 A;  1FOK A;  4M72 A;  3ML6 A;  1T39 A;  1XDS A;  2W84 A;  5HLG A;  1HSJ A;  1FLI A;  3GFI A;  2IJL A;  1DP7 P;  4I09 A;  1D8J A;  1SD5 A;  2P4W A;  4G9Y A;  2QQA A;  4L5I A;  5F6F A;  5LRS A;  1R23 A;  4L9T A;  5J6X A;  5FLX K;  2HFH A;  3W6K B;  4U7B A;  4AWX B;  2ZFW A;  2QBY A;  4XSZ F;  4WCG A;  4U7D A;  2DK5 A;  1S29 A;  2QM3 A;  1IN8 A;  3U2R A;  2X4H A;  3L09 A;  4PDK A;  1PP7 U;  1B9N A;  1R5H A;  3J7A O;  4HQM A;  4HOB A;  4YFK F;  5LEK A;  5K5O A;  1UB9 A;  2ELH A;  4Q5S F;  4ZZD A;  2IA2 A;  2DFI A;  3QU3 A;  4LGW A;  2GQQ A;  1XMA A;  5D5X B;  4M9S A;  3REO A;  2D45 A;  2WV0 A;  3CUQ A;  2K7L A;  3GF2 A;  1ZH5 A;  5FFX A;  5FFZ A;  4IF4 A;  2JTV A;  2KKO A;  3RKY A;  2XAS A;  2CO5 A;  4KFC A;  1TNS A;  2EFQ A;  3GEZ A;  3ZQ7 A;  4EV0 A;  1KU3 A;  3CUQ B;  4HV6 A;  4Q48 A;  4M71 A;  4CGZ A;  1IRF A;  3BJO A;  3EYY A;  3ECH A;  2DO7 A;  1ZGJ A;  2LDU A;  5DDG A;  2EA2 A;  1F4K A;  3I4P A;  4NQW A;  4I2O A;  3GZ5 A;  2HYF A;  2WC2 A;  4IRI A;  5L3B A;  2O61 A;  3I64 A;  3BJA A;  2V6C A;  5LGN A;  1O3T A;  1D3Y A;  2F5F A;  4FX4 A;  3T5X A;  2W25 A;  3TGN A;  5DCM A;  5E18 F;  4QLC U;  1U6G A;  1KU7 A;  1BOA A;  3I71 A;  2UXX A;  4P96 A;  3KZZ A;  1W7P A;  3KFW X;  1IN5 A;  3AAF A;  5DCM B;  4RGX A;  1B9M A;  3TKY A;  4IHS A;  5JVT A;  2XAH A;  3L9F A;  3I5U A;  4CYD A;  4MQV A;  2L4M A;  2MLG A;  4OIO F;  5HLI A;  1W7P B;  1FC3 A;  2JSC A;  2XKP A;  1J9I A;  2RGV A;  4BNC A;  3ABT A;  1L3L A;  1FBU A;  5BQT A;  4GCV A;  4IPA A;  1TBX A;  3DXJ F;  4BYY A;  1BIA A;  4HV5 A;  1UCR A;  1Z05 A;  3COA C;  1CF7 B;  5DYM A;  5ILU A;  3ABU A;  3JSP A;  3K1M A;  4MQ9 F;  2O3F A;  4L0Z B;  4OMY A;  2VC0 A;  2CQK A;  4M6X A;  2DQL A;  1P92 A;  3ZMT A;  2ZME B;  2P5K A;  3RJP A;  5CYV A;  3N4M A;  2M1B A;  5LGU A;  3IWF A;  2RN7 A;  2ZBK A;  2GA1 A;  2MH9 A;  1Q1H A;  3MZY A;  4HYE A;  2W57 A;  3DEU A;  3O6B B;  2VOO A;  2YX7 A;  2A68 F;  4YG2 F;  4HF1 A;  2J5P A;  4EMS A;  3BPV A;  1DPU A;  4ZZL A;  3SQN A;  2EWN A;  4KIF A;  4OU0 A;  1S3J A;  1IXS B;  2PMH A;  3RI4 A;  3JAM Z;  2FQ3 A;  4IRH A;  3D5L A;  5DD4 A;  1T2K A;  3IC7 A;  1BN5 A;  3FF5 A;  2ZXJ A;  5DUI A;  1OYI A;  4BHC A;  1BIB A;  1RZ4 A;  1P4A A;  2HKX A;  2YU3 A;  1IN4 A;  1IN7 A;  3J80 Z;  1LEB A;  3L7W A;  2ISY A;  1XCV A;  1KYW A;  1XD7 A;  3FX3 A;  3ULQ B;  2FU4 A;  3K1P A;  1KQ8 A;  1I6X A;  1ULY A;  4G94 A;  2GXB A;  2FBH A;  1O57 A;  1JGS A;  2LSO A;  3HHH A;  2ISZ A;  3M1E A;  3ROU A;  1X3U A;  2QQ9 A;  1IUY A;  4UVB A;  3JTH A;  3TO7 A;  1OR7 A;  1S7A A;  4NB5 A;  2D1V A;  1UHM A;  4LLL A;  2PFB A;  1YW7 A;  3KLO A;  1R36 A;  1D5V A;  2VN2 A;  4BHB A;  1ON1 A;  5ERI A;  4LFU A;  3MQ0 A;  3HTU A;  4ESJ A;  1ZRD A;  3QP5 A;  4O3M A;  5ICC A;  2HQN A;  1QZY A;  1Z6R A;  2HKO A;  2LKP A;  3DFG A;  4HA8 A;  5LGT A;  1ZLK A;  2NRA C;  1MDM A;  2O03 A;  3IWZ A;  4WWC A;  5E1X A;  2IVM A;  2XKO A;  4LG0 A;  2EV6 A;  2QVO A;  2BE5 F;  2E7X A;  3SFZ A;  2HYG D;  2LF7 A;  1GXQ A;  3ZPL A;  2ZCW A;  3DQV C;  3E5X A;  4OIN F;  3P7N A;  2DQR A;  5E1Z B;  3TO9 A;  3RTR A;  4RB2 C;  1B59 A;  4GGG A;  3T0Y A;  3Q5F A;  3J81 Z;  2OU2 A;  1S6L A;  1QGP A;  2OBP A;  2XAG A;  1QNT A;  4P9F A;  1GXP A;  1TNT A;  3WTW C;  4EJU A;  4A6E A;  2P8T A;  4ZYG A;  2ETH A;  2EFW A;  1SD7 A;  1SFE A;  1FWZ A;  3KP4 A;  4N0B A;  1H0M A;  3EDP A;  2VC1 A;  2RC4 A;  3IRQ A;  3H3U A;  3WE3 A;  2L54 A;  1YW8 A;  1ZG3 A;  5CVU A;  5HS7 A;  1V4R A;  2QLZ A;  2XIG A;  1HXD A;  3VB2 A;  3F6O A;  3LWF A;  1G3S A;  2VXZ A;  3V7C A;  1D8K A;  1DDN A;  4MNU A;  2Z99 A;  4LJZ F;  3FMR A;  3KET A;  3W6J B;  2RNJ A;  3IL2 A;  4UVA A;  2EFN A;  4M74 A;  2EFO A;  3RIR A;  4R1H A;  5E8G A;  5TRD A;  5CVI A;  5BOX A;  5HLH A;  4KNY A;  1XB4 A;  3MEX A;  3EUH A;  4G7O F;  3ZP5 A;  5DUK A;  4AIH A;  1QZZ A;  2UWM A;  4Q4Z F;  2XVC A;  2UXN A;  3G3Z A;  1OYW A;  2MLK A;  3R6S A;  2HDC A;  2M30 A;  1ZGA A;  2IRF G;  4L9V A;  2F5E A;  2D1H A;  3QP6 A;  1WSU A;  4KIG A;  5A2Q Z;  1IXR C;  1P4X A;  2H6B A;  2PBI A;  1PDN C;  4R79 A;  3LFK A;  3CTA A;  2A3S A;  4M9X A;  3M8F A;  1Z7U A;  1FT9 A;  3I53 A;  2G9W A;  2GXG A;  2M5W A;  3MFK A;  2RDP A;  2B0L A;  3GXO A;  3LQQ A;  4RB0 A;  4U0W A;  1FZP B;  3K9T A;  5K1Y A;  5CVV A;  5IT3 A;  3E97 A;  2EB7 A;  2OAZ A;  3I54 A;  1KU9 A;  3JSO A;  4L0Y B;  5HVQ C;  4HBL A;  4KIC A;  4HLX A;  4ENJ A;  4ESB A;  4I0B A;  2R7F A;  1IF1 A;  2F5C A;  5HS8 A;  3CUO A;  4GO1 A;  5ICF A;  3I0T A;  2HTS A;  2GA2 A;  5DCF A;  3WU1 B;  3DF8 A;  3FM3 A;  3HSR A;  3JTG A;  3K0L A;  5J8C A;  2PEX A;  4JQF A;  1XN7 A;  2CWE A;  3FXQ A;  2CGP A;  5IT9 Z;  2IP2 A;  2D2W A;  3R61 A;  1LJ9 A;  5ICG A;  3DP7 A;  1W4M A;  3FZV A;  4TV7 A;  3WGG A;  5EEH A;  3CO7 C;  1XGO A;  3MWM A;  2K4J A;  2VBZ A;  4A6D A;  3IKT A;  1YS7 A;  3HOS A;  1G6N A;  1STZ A;  4L9J A;  1RUN A;  3KLN A;  2GIV A;  1QPM A;  3VOE A;  3WTZ A;  3GW2 A;  2A6E F;  1C0W A;  1J5Y A;  5E20 A;  1OMI A;  2Y48 A;  5BPD A;  3I58 A;  1FNN A;  2RKH A;  2CG4 A;  1B4A A;  2K27 A;  4LK0 F;  4CHU A;  5H20 A;  3IHU A;  2MC3 A;  4A5N A;  4WK8 F;  3TO6 A;  2DW4 A;  4HX7 A;  3KZY A;  2MBF A;  2O8X A;  3KE2 A;  4OIQ F;  1R5G A;  1E17 A;  1CGP A;  2VT3 A;  2XAF A;  2P6T A;  2ZO4 A;  2EV5 A;  2XAJ A;  4HQE A;  4UNO A;  1MKM A;  3BJ6 A;  2EA4 A;  2CSO A;  3ZMZ A;  1G3Y A;  3TOB A;  3GYH X;  1E2X A;  2WTE A;  1V3F A;  2FBI A;  2TDX A;  1R1U A;  3KP6 A;  3ERE D;  3HRS A;  2KIM A;  4WF2 A;  1J59 A;  2W24 A;  3ZN1 A;  1YQA A;  4CDG A;  1BI2 A;  2KJC A;  3GLX A;  2ESH A;  5KVR A;  1NHA A;  2QQB A;  3DPT A;  1CF7 A;  2IW5 A;  1W7P D;  5D8L B;  3VEP A;  3F3X A;  2FA5 A;  2PJP A;  1R1V A;  4A2U A;  2ZME A;  2HTJ A;  4CZZ A;  5FLX Z;  1WQ2 A;  2DBB A;  4ZYE A;  1H9T A;  4WX9 A;  2RVC A;  2A6H F;  3OOP A;  1SFX A;  2P7V B;  2VON A;  1G3W A;  2DLL A;  4ZYD A;  3N97 A;  3M9A A;  3ZMV A;  5J8F A;  3L2C A;  1Z6T A;  3E6D A;  3ELK A;  2IT0 A;  4U88 A;  4HX8 A;  4I01 A;  2LNB A;  4WXC A;  4LB6 B;  1SAX A;  4L5J A;  3G73 A;  3ECO A;  5E1W A;  2FMY A;  5K5Q A;  5HDN A;  4JK1 X;  2L02 A;  2XRO A;  1XCB A;  5LHG A;  3F6V A;  2JT1 A;  2PMU A;  5JR3 A;  2OQR A;  4AIJ A;  3CLO A;  2PN6 A;  4ETS A;  1SMY F;  4XBF A;  2IA1 A;  4EJV A;  2OD5 A;  1YFH A;  3LST A;  4HF0 A;  5L3C A;  5HDK A;  2Y75 A;  4RGS A;  4EGZ A;  4HDV A;  3NQO A;  4LLN A;  3F8B A;  4Y13 A;  4GYI A;  4ZYH A;  3FHZ A;  3CDH A;  4RB1 A;  5HOO A;  2QUF A;  1EH6 A;  1O3R A;  5D8K B;  2FXA A;  2NNN A;  2JPC A;  3RDI A;  1R22 A;  4B8X A;  5FO5 A;  1BI3 A;  4IXA A;  3RYP A;  4ESF A;  3GFL A;  4MEY F;  4LMY A;  4EJT A;  2JRT A;  3PQK A;  3LA7 A;  4G8X A;  2VOP A;  1DPR A;  4Y15 A;  2YR2 A;  5DEQ A;  5LRR A;  3D0S A;  1BJA A;  1F1Z A;  4DQ2 A;  1WKM A;  4KN4 X;  4G7H F;  3IRR A;  1XGS A;  2FRH A;  3C1D A;  4FX0 A;  3ZMU A;  2BEO A;  5KK1 A;  3WTY C;  4LK1 F;  4EVI A;  4P55 A;  2G7H A;  1FPQ A;  2V1U A;  2QEN A;  1OYY A;  2AXL A;  4MEX F;  1T0F A;  3WE2 A;  5AIQ A;  2VOD A;  3E6B A;  1XDU A;  2M87 A;  5FD5 A;  4HAM A;  3BRO A;  1RIO H;  3HRM A;  4I0A A;  1PP8 F;  2V1D A;  1MGT A;  1U5T C;  2X0L A;  2NAZ A;  5BPI A;  2ZKZ A;  3HSF A;  3H92 A;  4MTD A;  5FB2 A;  2YX4 A;  5LLQ A;  5LEJ A;  3F8N A;  3WG9 A;  1IXC A;  5FD6 A;  1FYM A;  2NS0 A;  3BDD A;  4O5V A;  4HLY A;  3TQN A;  4KYW A;  2MD5 A;  2OZ6 A;  3NEU A;  2HEO A;  4NHJ A;  2DI3 A;  2V9V A;  3Q9S A;  1BC8 C;  3EET A;  3GX4 X;  4KIB A;  2CYY A;  5D6F A;  2NYX A;  1ZRE A;  1BBY A;  1PUE E;  3KEO A;  1O7L A;  1REP C;  1EH7 A;  1S7O A;  3TDZ C;  2H09 A;  2UZK A;  3C7J A;  1HW1 A;  1UST A;  1YG2 A;  2IA0 A;  3HHG A;  5ILS A;  2XUB A;  4FT8 A;  3NRV A;  1TLH B;  4B09 A;  4U0V A;  4BXU A;  1O3S A;  3TOA A;  4HF2 A;  1SMT A;  4KDP A;  1MJ9 A;  2FOK A;  3F21 A;  1U5T B;  1HKT A;  1S8N A;  4IJA A;  1FYL A;  2BV6 A;  2EV0 A;  2M45 A;  1SD6 A;  4EGY A;  2GZW A;  2QYO A;  3B02 A;  3F8M A;  3BZ6 A;  3U1D A;  2XGX A;  3DV8 A;  2BYV E;  4FHT A;  3BPX A;  2FSW A;  1K78 A;  5D4S A;  2VBY A;  2PG4 A;  2L01 A;  1LDJ A;  2K02 A;  1R7J A;  2K86 A;  2A07 F;  1Z1D A;  3BOQ A;  4DNC A;  4S05 A;  2O0Y A;  5TJJ A;  3HUG A;  4E70 A;  1MZB A;  1GHC A;  1K78 B;  3RYR A;  1AWC A;  1W5T A;  3P9C A;  1I5Z A;  4AIK A;  3KP5 A;  1HST A;  4KA4 A;  4P9U A;  2YSR A;  2O6G E;  4RAZ A;  2KJB A;  3WTX C;  3GVA A;  1KYZ A;  1FSE A;  3HRT A;  2Q8K A;  4ENM A;  4XLN F;  4KUM A;  4KMU X;  2KIU A;  2XHK A;  2Q2E A;  3BY6 A;  4IHT A;  3F8C A;  3ISP A;  2VT2 A;  2FNA A;  1JXS A;  3FM5 A;  2A69 F;  5D5U B;  3DKW A;  2W85 A;  1XGM A;  3F22 A;  4G7Z F;  4RGU A; 
#chains in the Genus database with same CATH topology
 1MND A;  2ESN A;  3CF2 A;  4HZF A;  2W4S A;  4KIS A;  2DTR A;  3H1C A;  5D5W B;  2E1C A;  1X1C A;  4BUP A;  3V4G A;  3WTS C;  4NUB A;  3A0B C;  4PJL A;  3CO6 C;  5IP9 J;  3CCU I;  3LA3 A;  2E7W A;  1WWX A;  3DCF A;  1Z9C A;  3ZN0 A;  5IYB J;  4L18 B;  1LQ1 A;  1UAA A;  1V5E A;  1LFU P;  2V79 A;  3CMA I;  2BVL A;  1LDK B;  1ZAR A;  1JJ8 C;  2NS8 A;  3V7S A;  4XMY A;  4B1R A;  1VND A;  2H1L A;  1U8R A;  2YU9 J;  1QHG A;  2RV8 A;  3DWL E;  3MAJ A;  2EFP A;  1SVO A;  1P2F A;  1ZG1 A;  4BEH A;  4DYR A;  2JA6 J;  1A04 A;  2ZNZ A;  1SD4 A;  4I98 B;  1D5Y A;  2GM4 A;  1AOY A;  3GWZ A;  4K2E A;  3D5S C;  1A31 A;  2ZJP F;  5LD2 C;  3W2A A;  3MVP A;  2ICW G;  2R7D A;  5DD8 A;  1U8B A;  4XRS A;  1WVR A;  1RET A;  1TQP A;  5HDG A;  5J4Y A;  4ON0 A;  1HQC A;  3C3W A;  5L3G A;  3LQR A;  3A02 A;  3Q0V A;  4U0Y A;  3GO5 A;  3R0J A;  1YRN B;  2HXO A;  1K7A A;  2CH0 A;  2KZG A;  2CW0 F;  3BT9 A;  2DOA A;  3QAH A;  4EM0 B;  4Z2Y A;  1UHW A;  2JUG A;  1SC7 A;  3E5U A;  1T98 A;  4A0Y A;  1FBS A;  2PQ8 A;  3WGI A;  5M3M J;  2QBY B;  3K4N A;  4HX4 A;  3V8L A;  2W82 A;  3GFJ A;  4IVN A;  1KA8 A;  1R9T J;  1I27 A;  5CVR A;  1T6S A;  1O3Q A;  2EIK H;  2VJ5 A;  1W1W E;  3AG3 H;  1JGG A;  2L9V A;  5BS6 A;  3PO3 J;  5L3E A;  5HLT A;  1GV2 A;  4KN7 X;  3BG7 A;  4IOC F;  2FML A;  4OIR F;  3BWG A;  1LEA A;  4I76 A;  2DAO A;  3OY9 A;  3BCA A;  3JRG A;  3FMS A;  5L3D A;  4ZDO A;  1H9G A;  4UUT A;  3G1M A;  1F9N A;  2DA3 A;  5FKN A;  3A01 B;  2E1N A;  1Z91 A;  2HZT A;  2HOE A;  5E8I A;  4AVP A;  1LDD A;  1R00 A;  2DOD A;  3MKL A;  4Y33 A;  3VYU B;  2IGN A;  4EJO A;  4YFN F;  4YII A;  3IP4 B;  3R4K A;  2LKX A;  4M3B A;  1U2W A;  2FNP A;  4B4C A;  3S15 J;  3FIS A;  2NVT J;  2STW A;  1U9O A;  1G3T A;  1SVM A;  1QZE A;  3ZQQ A;  2Q0O A;  4BAC A;  1Y1V J;  3BR6 A;  1E3O C;  2GAU A;  1YIT I;  1IRG A;  5H6Q A;  3RPU A;  4CCL A;  4O6J A;  1FP2 A;  4FCY A;  5LFA A;  4BXX J;  3JAM K;  2UUZ A;  1U78 A;  1ZKG A;  5D6E A;  4MTE A;  4YIF A;  3CJQ B;  3VFZ A;  3QPH A;  1FIP A;  1HBX G;  3MZH A;  2DXI A;  4BH9 A;  1LUJ B;  4CA0 A;  1OCR H;  3PUF A;  3F72 A;  2IAI A;  3J80 K;  3LAJ A;  3HOT A;  3KX2 A;  1HW2 A;  5D4R A;  1IW7 F;  2DTZ A;  2WY8 Q;  2XC7 A;  3OL3 A;  4RM2 A;  3ZQC A;  1WRJ A;  1MBK A;  1BM9 A;  2R3S A;  2O7O A;  3E0J B;  5JFR A;  1ZYR F;  4A3M J;  2LY2 A;  3BQY A;  4NNJ A;  1KQ9 A;  5LHH A;  2X6W A;  1FP1 D;  3SFI A;  5JHU A;  4F93 B;  4HPQ A;  4XL9 A;  5F64 A;  4BS9 A;  3P5J A;  3FIW A;  2XPW A;  3U9G A;  4M73 A;  2AS5 F;  3K1N A;  1H89 C;  1OJL A;  2DFF A;  3M7G A;  2XB0 X;  1ON2 A;  4A0X A;  3WTV C;  4M6V A;  2EJR A;  1Y6I A;  1EV7 A;  4XRM A;  3B6C A;  4EM2 A;  3PUB A;  3ZMS A;  2QA4 I;  2IS4 A;  2KT0 A;  1I1S A;  3I59 A;  3CJN A;  1FY7 A;  4PJN A;  3RKX A;  2OJE D;  2ID6 A;  3BP8 A;  2Y9Y A;  3DPL C;  3HC7 A;  3IKV A;  3R60 A;  1LNW A;  4DGW B;  3Q3S A;  1F5T A;  2M4K A;  2F48 A;  3T8T A;  3O3K A;  3EQL F;  5IYC J;  1YYV A;  3KEQ A;  5BNG A;  2H27 A;  2IBD A;  4HDU A;  3M1C A;  4Y17 A;  2JN6 A;  5F08 A;  2HR3 A;  4MHG A;  1JHF A;  1IRX A;  1GVJ A;  5GPC A;  3I59 B;  2EZH A;  2BGC A;  1K79 A;  2K4B A;  2MA3 A;  4EQQ A;  1Y0U A;  4XN0 A;  5F1R A;  4A3E J;  2LP0 A;  2DT7 B;  1LVA A;  2HQR A;  3PFY A;  2E1M C;  3HSE A;  2Z5U A;  4M6Y A;  1JE8 A;  1QO0 D;  2K9M A;  2FBK A;  2LOO A;  3CCE I;  3OV8 A;  1X3W B;  4L9N A;  1X19 A;  5EEA A;  3IAM 2;  3MZ8 A;  1V5F A;  3TW7 A;  1ZAO A;  3UR3 C;  2FF4 A;  2STT A;  1MJA A;  5LHI A;  4L5E A;  4OMZ A;  3QU6 A;  2Y0S N;  2OZU A;  4XOT A;  4LLG F;  3LA2 A;  1VQM I;  2P6S A;  1L0O C;  2W7N A;  3LSG A;  2I8D A;  5D5V B;  2AQF A;  4N9H A;  3RQI A;  1FX7 A;  2DYS H;  3EYI A;  1FEX A;  3BCB A;  2XSD C;  5FKM A;  1DGR M;  4XSX F;  5E3O A;  2EZK A;  2F4O B;  1OR7 C;  3K4C A;  3SHF A;  5HOD A;  4I7H A;  3N05 A;  2BW3 A;  1SFO J;  3CLQ A;  4Y52 J;  1G8X A;  2HPI A;  4PJ0 C;  4RAY A;  1W5S A;  4A0Z A;  1B6A A;  2EZL A;  1RI7 A;  2N8G A;  3VOD A;  3KP3 A;  1YS6 A;  3HGY A;  2QCO A;  4XLP F;  3O2P E;  2ACJ A;  3HBL A;  3KP7 A;  3J81 K;  5FGM A;  3SYT A;  4D5C A;  1ONV A;  2NNY A;  1OPC A;  1Z3Y A;  2VI6 A;  2XDV A;  3BG5 A;  2BW3 B;  4PFP A;  2KRF A;  3HIF A;  4KT5 C;  1O4X A;  1XMK A;  1ZR2 A;  1MBE A;  2IGO A;  1U9N A;  3V7R A;  1YIO A;  3TP3 A;  3OYB A;  1VFC A;  2WA0 A;  3SXY A;  3HTS B;  3BTL A;  5EEG A;  2HWV A;  1TL8 A;  2BBY A;  4HNU A;  4BQA A;  3B73 A;  5F1J A;  1BC7 C;  2NOJ B;  2XSJ C;  2ADU A;  4XRF A;  1QVU A;  2P81 A;  3BR1 A;  4RS8 A;  3WU0 A;  4R8H A;  3CCJ I;  2LRE A;  2Y69 H;  4BAY A;  3H9G A;  2A61 A;  4MLO A;  1DUX C;  4FQG A;  2DA7 A;  4PK4 A;  4QIW N;  2ZJ2 A;  4N9I A;  3RQ4 A;  3KYD B;  2WAE A;  1NH3 A;  5E17 F;  4PGG A;  1R4M B;  1WI9 A;  3GCM A;  1ZN2 A;  4PZJ A;  1EJ9 A;  4DYC A;  2QZ8 A;  4I6Z A;  3F23 A;  2LBF B;  1HW5 A;  1BW5 A;  2DU9 A;  5JI6 A;  3SZP A;  1TWF J;  3I4M J;  2XV4 S;  2HGC A;  3P9I A;  1EH8 A;  4S04 A;  3VWB A;  3QOP A;  3EUK L;  2VE8 A;  4HG2 A;  5HS9 A;  4GXO A;  1VQ4 I;  1TW3 A;  4UV8 A;  1MJB A;  2X6Y A;  1HOM A;  3LOC A;  2Z3Y A;  3P9K A;  3U1K A;  2HDW A;  2DT5 A;  2KMU A;  3RPQ A;  3JW4 A;  3DEW A;  2VIX A;  4Q47 A;  1F36 A;  3WTT C;  3HB9 A;  4UXN A;  4D7N A;  1QBJ A;  1TTY A;  4RAG A;  5TIS C;  3CME I;  3V8J A;  1BW6 A;  1TQI A;  2E1M B;  2WBM A;  4IOA F;  1N25 A;  4BHP A;  4C9Y A;  2LF8 A;  4LIT A;  4WXH A;  5F04 A;  2JZY A;  2MH2 A;  3ASN H;  3FWE A;  3T8R A;  5H6R A;  2GOX B;  1I3A A;  3CMM A;  2VQH A;  4JX6 A;  5AON A;  1V5G A;  2DOE A;  2J5O A;  2K3P A;  4M9Z A;  2M4G A;  5DV5 A;  3ZXS A;  3FXL A;  3TP0 A;  2COM A;  5LBQ A;  1BI0 A;  1LE8 A;  5EGO B;  2P7C B;  1FSH A;  3OYC A;  1W0T A;  2VQC A;  3ESW B;  1WJE A;  4PGH A;  4KJZ A;  1KU2 A;  4CIC A;  4A3D J;  1QQI A;  3JRC A;  5IYD J;  3GZ6 A;  1J7K A;  1EF4 A;  5ED4 A;  1TW2 A;  4UHT A;  1HDD C;  2ZNY A;  1FBQ A;  3ABK H;  2BY2 A;  3HYI A;  1I1G A;  4F7Z A;  1LE8 B;  3WGH A;  2L4A A;  2P5L C;  3H0G J;  4D0P A;  3TMO A;  3UNG C;  3TL4 X;  1OCC H;  2G0E A;  2PI0 A;  1UFM A;  2A5Y B;  1J0R A;  2QKL B;  1FOY A;  4ENK A;  1TZL A;  4QPQ A;  1IN6 A;  2GWR A;  5CVJ A;  2KIF A;  4EJW A;  1SFU A;  2H6C A;  5A2Q K;  1X1B A;  1YTY A;  3CD6 I;  2R7V A;  3GFM A;  3CES A;  3GUD A;  4B48 A;  4HEA 2;  1PVE A;  2JPB A;  2CFX A;  4QWQ A;  1HKS A;  4CYC B;  1XSD A;  2KQR A;  4ZJZ A;  2QWW A;  3E6C C;  3RSN A;  4B3X A;  3KP2 A;  1ETK A;  1TT5 B;  1MDM B;  2CQN A;  3QPL A;  3BR3 A;  4A3C J;  3NAR A;  2LMD A;  3S1R J;  3Q9V A;  2DK8 A;  2HS5 A;  3GTM J;  1K6Y A;  4UV9 A;  3L00 A;  3K4M A;  1K6O A;  4LB5 A;  2DFH A;  2VKV A;  4NC7 A;  4LG0 B;  2YPR A;  3OSG A;  1R1T A;  3JRH A;  1RNL A;  3NAU A;  3CCS I;  2C6Y A;  2X9D A;  3DBH B;  5CLS A;  5J40 A;  5BMZ A;  2OQG A;  1T8I A;  4WXD A;  4UUV A;  3IAS 2;  5CQE A;  3HRU A;  3QRF F;  5FRM A;  2QSG X;  2F5D A;  2OA4 A;  4HNT A;  2L9R A;  2Y0M A;  1O7F A;  4J19 A;  3C2G A;  4AYB N;  4D1Q A;  3ZCO A;  4UVC A;  1ORK A;  4AD9 A;  3A03 A;  1UHS A;  4A12 A;  4PCQ A;  1TQM A;  1ZHF A;  3ONQ A;  2CQX A;  1D1A A;  3DBL B;  3E5Q A;  5ILV A;  5L3F A;  3G6E I;  2VBX A;  5DTD A;  1HCR A;  1XGN A;  2H94 A;  1T38 A;  4D7M A;  1G4D A;  2M8E A;  6PAX A;  4A5M A;  3GLL A;  2VBW A;  3SDG A;  2RQP A;  1LB2 A;  1NK3 P;  1NTC A;  3ZMD A;  1IAW A;  2B9S A;  3FMQ A;  2MG4 A;  5JHF A;  3AG1 H;  1UZC A;  5FRN A;  2F2E A;  1XSV A;  1KQ0 A;  4ZH4 F;  3JRF A;  4ASN A;  3S3N A;  1U5T A;  4AUX A;  1ZG5 A;  1MH4 A;  3K69 A;  1IV8 A;  4XLF A;  1XMX A;  2E19 A;  2WB1 A;  1X1D A;  5IP6 A;  5CJ9 A;  4BE0 A;  3CCY A;  4LD5 A;  3PQJ A;  1G2H A;  3FXK A;  3CCR I;  2L3D A;  4RGR A;  1VTN C;  2WAQ A;  1U3E M;  1Z77 A;  1P6R A;  4I02 A;  2VPL A;  2E2I J;  4EM1 A;  1VF9 A;  5IT9 K;  2RNG A;  1YLF A;  1ZLJ A;  3FXU A;  1ZRF A;  4G6D A;  1PUF A;  2CV1 A;  2R93 J;  4YRV A;  2FE3 A;  2CFO A;  2GLO A;  4ENN A;  3V8K A;  3J7Z I;  3WOD F;  1ODD A;  4N4N B;  2KFD A;  1OKR A;  3WHB A;  3T1B A;  2HDD A;  3LAP A;  2F4M B;  4JX4 A;  3DLL F;  2Y0S A;  3TDU C;  2E35 A;  5C4X J;  1YW9 A;  1P4W A;  2ZSH B;  3RKW A;  4IRG A;  3M8E A;  4CCJ A;  3MCZ A;  4B47 A;  1AA7 A;  1B1B A;  3E3V A;  1FYK A;  3WTU C;  3OIQ A;  1HKQ A;  2OCE A;  4BL0 B;  5J3L A;  3R0A A;  1JHH A;  1D1B A;  2FEZ A;  1LKX A;  3FDY A;  1MD0 A;  4BXF A;  2M3A A;  2V1X A;  4KMF A;  2IPQ X;  1KON A;  3HKZ A;  3BZC A;  2QGU A;  1R58 A;  2VE9 A;  4G6Q A;  3OYA A;  4H0E A;  2PLY A;  1JTX A;  1XSX A;  2GOM A;  3HOW J;  3LFU A;  1AU7 A;  3DU6 A;  4HW0 A;  4FTH A;  3PJR A;  5M5X J;  1RUO A;  3FXR A;  3KCC A;  2DPU A;  3KZI C;  3BR2 A;  3A2K A;  3E7L A;  1B8I B;  3FKI J;  4JOM A;  2OV7 A;  1USS A;  2X48 A;  2AXT C;  4XOP A;  3F9K A;  2A6T A;  2Z9O A;  5AIP A;  4CO8 A;  1YJ9 I;  1J75 A;  4F55 A;  3I3L A;  1ZRC A;  1QRY A;  3E6M A;  4X6A J;  1ETX A;  2P5V A;  4BU2 A;  3LNQ A;  3JCU C;  4OOI A;  3EPZ A;  2XRN A;  4IHV A;  3KYL A;  1J2X A;  1Q1V A;  3SZT A;  1KGS A;  1BI1 A;  2G7U A;  3C18 A;  4MGR A;  2XAQ A;  2KRC A;  4P1W A;  1JT6 A;  2OUM A;  3PSF A;  3S2W A;  4YFX F;  1JI8 A;  4JBA A;  5ICE A;  2CV0 A;  3MKZ A;  2DYR H;  4DBR A;  2AO9 A;  4P5O A;  2BVM A;  1MNE A;  3VSK A;  1YO5 C;  1EKE A;  2Z33 A;  4IHY A;  2R7Z J;  2NVY J;  3GME A;  1BR4 A;  2V1N A;  3F8F A;  3ZOB A;  3CUQ C;  3QPT A;  2HVS A;  2EK5 A;  3K70 D;  1QHH D;  3PFI A;  4GYG A;  4CXF A;  4RDU A;  2WY7 Q;  4H4K C;  3K2Z A;  1K61 A;  4OIP F;  4RB3 C;  5K5R A;  4OAY A;  1R4N B;  2JA2 A;  2WWY A;  3H3Z A;  1T08 B;  2DPD A;  2EZI A;  1CQT A;  1IZ1 A;  1K4T A;  4CCN A;  4M72 A;  2CMP A;  3ML6 A;  5FKK A;  4Z6Y A;  1FOK A;  2HNH A;  1T39 A;  1JJ6 C;  1XDS A;  1UG0 A;  2W84 A;  5HLG A;  1HSJ A;  3OYM A;  2ELK A;  1FLI A;  2HYJ A;  3GFI A;  3HXL A;  2ZJQ F;  2IJL A;  3Q0W A;  1DP7 P;  2DMP A;  4XR6 A;  4I09 A;  1D8J A;  3OR2 C;  3K4B A;  1IDZ A;  1SD5 A;  2P4W A;  1VQ5 I;  4HSR A;  1TC3 C;  2LRD A;  3ASO H;  2LFB A;  3OSF A;  2R7O A;  1OIS A;  4G9Y A;  4M3D A;  1Z21 A;  4BKX A;  4E7K A;  2JA8 J;  3QOD A;  4M3G A;  2QQA A;  3OYG A;  4L5I A;  2QKM B;  2QSH X;  5F6F A;  4ABZ A;  1R23 A;  4L9T A;  5LRS A;  4JX5 A;  1YRN A;  4BQQ A;  2JSP A;  5J6X A;  5FLX K;  2HFH A;  3W6K B;  4U7B A;  2LYC A;  4AWX B;  2ZFW A;  1Y8Q B;  1WFX A;  2QBY A;  4MIM A;  4BDZ A;  4XSZ F;  1FIA A;  5F0H A;  4WCG A;  4U7D A;  2DK5 A;  1S29 A;  1GT0 C;  1V54 H;  2QM3 A;  1IN8 A;  3BTI A;  4ZYA A;  4V2G A;  3U2R A;  3IH2 A;  2X4H A;  1I50 J;  3L09 A;  4PDK A;  1PP7 U;  3OOU A;  1B9N A;  1R5H A;  1I39 A;  4C2T A;  3J7A O;  3S1M J;  4HQM A;  4LG3 A;  1YX5 A;  4HOB A;  4YFK F;  3A01 A;  5LEK A;  5K5O A;  1UB9 A;  2ELH A;  1Y39 A;  1EA3 A;  2L5Q A;  2TCT A;  1VQK I;  4Q5S F;  4KIT B;  3OYJ A;  1ETW A;  2K5C A;  2E60 A;  4ZZD A;  2IA2 A;  3HOX J;  1D1C A;  2FJ1 A;  2VB6 A;  2DFI A;  4QSH A;  3QU3 A;  2CS3 A;  4LGW A;  2GQQ A;  1XMA A;  2FD5 A;  5D5X B;  4DZJ A;  3S1Q J;  1V55 H;  4M9S A;  3REO A;  2D45 A;  2WV0 A;  1TP4 A;  1RR7 A;  3CUQ A;  1RPW A;  2K7L A;  3OIP A;  3GF2 A;  1RES A;  5C3E J;  2WAF A;  2JMW A;  5FFX A;  4C3I J;  5FFZ A;  4IF4 A;  3KPH A;  4BGD A;  2JA5 J;  2CW8 A;  2JTV A;  2KKO A;  3RKY A;  5B5E C;  2L7K A;  4IQJ A;  3A1Y A;  3L2V A;  2XAS A;  3S3M A;  1QPI A;  2CO5 A;  4KFC A;  2JUC A;  1TNS A;  2EFQ A;  3GEZ A;  3ZQ7 A;  1HLV A;  4EV0 A;  2ZME C;  1KU3 A;  3CUQ B;  4HV6 A;  4Q48 A;  4M71 A;  2M0C A;  4CGZ A;  2HQA A;  1IRF A;  3BJO A;  4BJ5 C;  5M5Y J;  1AKH A;  3EYY A;  3VYS B;  3ECH A;  3GTK J;  2DO7 A;  4AYB A;  1ZGJ A;  2LDU A;  5DDG A;  1DU6 A;  2EA2 A;  2M8G X;  2VUM J;  3K4L A;  3NWS A;  1F4K A;  2HPM A;  3I4P A;  4NQW A;  1ENH A;  4I2O A;  3HOZ J;  2KHM A;  2HYF A;  3GZ5 A;  4A3F J;  2CUJ A;  4XOR A;  3W3C A;  2WC2 A;  2HU9 A;  3JRA A;  4IRI A;  3RPU D;  2EH3 A;  1AKH B;  2A5W A;  3OWT A;  3QOE A;  4CUG A;  5L3B A;  2O61 A;  3I64 A;  3BJA A;  2V6C A;  5LGN A;  4PSX A;  1O3T A;  1D3Y A;  2F5F A;  2AHQ A;  2ZXI A;  4FX4 A;  4NQW B;  3T5X A;  4XON A;  2W25 A;  3TGN A;  1BR2 A;  1WJC A;  5DCM A;  5E18 F;  4QLC U;  4ZC3 A;  1U6G A;  1FTT A;  1KU7 A;  1BOA A;  3I71 A;  2VAS A;  2UXX A;  1WJ5 A;  4P96 A;  1ZTR A;  3KZZ A;  4LIV A;  1W7P A;  1ITY A;  3KFW X;  3AL0 C;  1XS9 A;  1IN5 A;  3AFH A;  4RGX A;  1B9M A;  4V2F A;  5DCM B;  3TKY A;  4BJ6 C;  3AAF A;  4IHS A;  5KNL A;  3MMY B;  5JVT A;  2XAH A;  3L9F A;  4IX7 A;  3I5U A;  4CYD A;  3CC2 I;  3M3Y J;  4MQV A;  2L4M A;  2MLG A;  2QSF X;  3CZ6 A;  4OIO F;  5HLI A;  1DU0 A;  1IO2 A;  4E4H A;  3CDL A;  1W7P B;  1XX5 A;  2CUE A;  1FC3 A;  2JSC A;  2VJI A;  2XKP A;  1JT0 A;  4GDF A;  4A3G J;  1J9I A;  2RGV A;  3LSP A;  2H8W A;  4S0H B;  4PJJ A;  1JTY A;  4BNC A;  3ABT A;  1I6H J;  4XM3 A;  2IS6 A;  1L3L A;  2JVG A;  3A0H C;  2WB1 N;  1FBU A;  4RMN A;  5BQT A;  3GTO J;  4GCV A;  4IPA A;  1TBX A;  3DXJ F;  2BHY A;  4BYY A;  1BIA A;  2H8R A;  2WAQ N;  5DM6 F;  4HV5 A;  1UCR A;  3BTC A;  1Z05 A;  2A05 A;  3COA C;  1CF7 B;  5DYM A;  5ILU A;  1WCM J;  5KAF C;  1J09 A;  1WPK A;  3H5A A;  5CKT A;  3S2D J;  2K9Q A;  2JVH A;  3ABU A;  2WAD A;  3JSP A;  3TED A;  3K1M A;  5FKO A;  4MQ9 F;  2O3F A;  3JRE A;  2MC4 A;  4L0Z B;  4OMY A;  3VDX A;  2VC0 A;  2CQK A;  4M6X A;  2E5N A;  2DQL A;  1P92 A;  2XGC A;  3ZMT A;  2ZME B;  1FMW A;  2P5K A;  3RJP A;  3ABL H;  3J7A Y;  5CYV A;  5F27 A;  3N4M A;  2XF6 A;  1VZ0 A;  1I3Q J;  1N78 A;  5C44 J;  2HQ5 A;  2M1B A;  4J00 A;  1Y56 A;  5LGU A;  3CP2 A;  3IWF A;  2JRM A;  2RN7 A;  2ZBK A;  2GA1 A;  2MH9 A;  1Q1H A;  3MZY A;  4E6K G;  2R7U A;  4HYE A;  4FAS D;  1GVD A;  2E34 A;  1SFK A;  2W57 A;  2DA2 A;  3DEU A;  3HKZ N;  3O6B B;  2ZFU A;  2VOO A;  3S14 J;  4NDL A;  1MMS A;  1WHU A;  2A68 F;  2YX7 A;  1NK2 P;  1HF0 A;  2Y9Z A;  3HOY J;  4YG2 F;  1Z67 A;  4HF1 A;  1RKW A;  3BG9 A;  2J5P A;  3D5R C;  4EMS A;  3BPV A;  4UB8 C;  1DPU A;  4ZZL A;  2ZXH A;  2OF7 A;  2DDA A;  3I9V 2;  3SQN A;  2EWN A;  3OS2 A;  4KIF A;  4IHX A;  4OU0 A;  1S3J A;  1IXS B;  1MMN A;  2Q1Z B;  4CCK A;  1YE9 A;  3L2Q A;  1ACI A;  2PMH A;  3RI4 A;  3JAM Z;  3EUA A;  4W97 A;  2NVQ J;  2FQ3 A;  4IRH A;  1IV6 A;  2O8K A;  3CDI A;  3L2U A;  3D5L A;  4IHW A;  5DD4 A;  3AL0 B;  1MMD A;  2L7M P;  1T2K A;  2X51 A;  2LBF A;  3IC7 A;  1BN5 A;  2LY1 A;  3FF5 A;  3HOV J;  2ZXJ A;  1T95 A;  5GPA A;  5DUI A;  1OYI A;  1BIB A;  1RZ4 A;  1P4A A;  3IH3 A;  3K2A A;  4AVZ A;  2HKX A;  4BHC A;  4AM3 A;  2YU3 A;  2JA7 J;  1PJR A;  3AKZ A;  1IN4 A;  1IN7 A;  2COB A;  3J80 Z;  5J4V A;  1A6Q A;  1OCP A;  4Y7N J;  3CF5 F;  1LEB A;  3L7W A;  5GAG J;  2ISY A;  1XTA A;  1YI2 I;  1XCV A;  1KYW A;  5IY5 H;  1XD7 A;  2EIN H;  3FX3 A;  3ULQ B;  3H3V K;  1GUU A;  5E79 C;  2FU4 A;  1YX3 A;  1GLN A;  3K1P A;  5B66 C;  1IJW C;  1FTZ A;  3G2B A;  1ERD A;  1KQ8 A;  5H2F C;  1I6X A;  1ULY A;  4G94 A;  3A4C A;  2GXB A;  1X3Z B;  3GTP J;  2CQ7 A;  1Y0N A;  2FBH A;  1O57 A;  2JWT A;  2VPR A;  1JGS A;  2LSO A;  3HHH A;  2ISZ A;  1MW7 A;  2X1D A;  3M1E A;  3BR0 A;  3CMY A;  1P7I A;  2W1O A;  2XF5 A;  1TWC J;  5EGO A;  5JLW A;  2ELJ A;  1JKQ C;  3ROU A;  4X0G A;  4GFB A;  1JUP A;  1VI0 A;  1X3U A;  2QQ9 A;  4XLC A;  2E2H J;  1IUY A;  1A36 A;  4UVB A;  1S7E A;  3JTH A;  3TO7 A;  3HOU J;  3CJR B;  1OR7 A;  1VQ6 I;  1S7A A;  4NB5 A;  2D1V A;  3CC7 I;  1UHM A;  2HOA A;  5EYR A;  4LLL A;  3TW6 A;  3HZJ A;  4MFD A;  3UKG A;  3ERM A;  1JUM A;  4XN3 A;  2PFB A;  1YW7 A;  3KLO A;  2L0K A;  3CP8 A;  1R36 A;  2XGE A;  1D5V A;  1ZGW A;  2VN2 A;  4BHB A;  1ON1 A;  5ERI A;  4LFU A;  3MQ0 A;  4E7S A;  3HTU A;  4ESJ A;  1ZRD A;  3QP5 A;  3KYC B;  4O3M A;  4PSW A;  2KIS A;  3FKJ A;  4CZC A;  5ICC A;  2HQN A;  2R7X A;  4CCO A;  5GAH J;  3ZGK A;  4CYC A;  1QZY A;  1WGX A;  1Z6R A;  3S32 A;  5GAD J;  2HKO A;  2LKP A;  3DFG A;  4HA8 A;  1P7J A;  2L9S A;  3S93 A;  5LGT A;  1ZLK A;  2LY9 A;  2NRA C;  1MDM A;  1VQN I;  2O03 A;  3G1L A;  3IWZ A;  2DMT A;  4LIU A;  4C30 A;  4BBR J;  2MYS A;  1T56 A;  2R7Q A;  3I4N J;  4WWC A;  3SDB A;  5E1X A;  2IVM A;  1WH7 A;  1XC5 A;  1W5C C;  2XKO A;  4LG0 A;  2EV6 A;  2QVO A;  2BE5 F;  2E7X A;  2ECB A;  3SFZ A;  2HYG D;  2X1C A;  2LF7 A;  3AG2 H;  4HST A;  1GXQ A;  3ZPL A;  4HRI A;  2ZCW A;  3DQV C;  2DT6 A;  3E5X A;  4X1E A;  4OIN F;  3W2V A;  3P7N A;  2NVX J;  4M3E A;  2DQR A;  3K7A J;  4E7H A;  4LOC A;  1WJB A;  2W48 A;  1W36 C;  5E1Z B;  5EG0 B;  3TO9 A;  3RTR A;  2BHZ A;  4RB2 C;  1B59 A;  2JQ7 A;  1HC8 A;  3EUH C;  1Y1W J;  4GGG A;  2NOG A;  2DMQ A;  3T0Y A;  3Q5F A;  3ZRG A;  4PFO A;  2E5Z A;  3J81 Z;  2OU2 A;  1Z3X A;  3O8G A;  1S6L A;  4IL6 C;  1QGP A;  2VL8 A;  3W2W A;  3HL2 A;  2LR8 A;  3G1O A;  2OBP A;  2R0Q C;  2XAG A;  1QNT A;  3ZQG A;  4P9F A;  1GXP A;  1JKO C;  1TNT A;  2VJ4 A;  3WTW C;  4EJU A;  1QA6 A;  4A6E A;  1X4P A;  2P8T A;  4AC0 A;  3O8H A;  4ZYG A;  2ETH A;  2EFW A;  2R7R A;  1SD7 A;  1SFE A;  2LKS A;  1FWZ A;  3KP4 A;  4N0B A;  4ZTF A;  5GTH C;  1H0M A;  1FJL A;  1TWA J;  3GTJ J;  2DMN A;  2X6X A;  2BY3 A;  3EDP A;  1IUF A;  1F43 A;  2VC1 A;  3OYK A;  1OCZ H;  3SEQ A;  2RC4 A;  3HGG A;  4E7L A;  5K7Z A;  5GP9 A;  3IRQ A;  3H3U A;  3U21 A;  4BY7 J;  3WE3 A;  3L2R A;  2K9N A;  3CCM I;  1MBJ A;  2L54 A;  1YW8 A;  1ZG3 A;  3ABM H;  1R6R A;  5CVU A;  5HS7 A;  1V4R A;  3H9Q A;  3GTG J;  2QLZ A;  4A3I J;  2XIG A;  1HXD A;  1U0J A;  3CCV I;  2EQR A;  3VB2 A;  4V19 K;  3K70 C;  1D0X A;  2KLO A;  3GBG A;  3F6O A;  3LWF A;  1G3S A;  2VXZ A;  3V7C A;  2E2J J;  1D8K A;  1MSE C;  1DDN A;  3PIO F;  2UV1 A;  4MNU A;  2Z99 A;  4LJZ F;  1TWG J;  4EEF G;  3HPH A;  3FMR A;  3K10 A;  4JYK A;  3KET A;  1X1P A;  5K7F A;  2ZC2 A;  4C2M J;  3W6J B;  2M2E A;  2RNJ A;  3IUO A;  2M0M A;  2XRL A;  4I99 C;  3IL2 A;  3HJE A;  4UVA A;  2QQ8 A;  2DOF A;  2EFN A;  1WJA A;  4DOZ A;  4M74 A;  2EFO A;  3RIR A;  1B72 B;  2QEX I;  3RKQ A;  4R1H A;  5E8G A;  1BR1 A;  1NG7 A;  5TRD A;  5CVI A;  5BOX A;  5HLH A;  2DMU A;  1B8I A;  4KNY A;  5IOZ A;  1T33 A;  4A3K J;  1MSF C;  1XB4 A;  4BBS J;  3PL8 A;  3MEX A;  3EUH A;  1X4O A;  4A3J J;  4G7O F;  1BOB A;  5JLX A;  3ZP5 A;  2DJI A;  5DUK A;  2GBY A;  4AIH A;  2OTJ I;  4ITV A;  1QZZ A;  2MFZ A;  2UWM A;  3OIO A;  4Q4Z F;  2XVC A;  2UXN A;  3G3Z A;  1OYW A;  2FQ4 A;  2FUG 2;  2MLK A;  3R6S A;  2HDC A;  3M4O J;  3QPS A;  2CUZ A;  4RLQ A;  2VLA A;  2M30 A;  1ZGA A;  2IRF G;  4L9V A;  2F5E A;  2D1H A;  3QP6 A;  5TGT A;  2XB5 A;  3OMY A;  3VSL A;  1Y8R B;  5F0C A;  1WSU A;  2K3F A;  1TWH J;  4KIG A;  3DBR B;  4N4O B;  3DPU A;  5A2Q Z;  1IXR C;  4NC8 A;  1P4X A;  2H6B A;  2PBI A;  1PDN C;  4R79 A;  3LFK A;  4BY1 J;  3FBN B;  4FIS A;  2YUS A;  3CTA A;  1RC9 A;  3ZQF A;  2A3S A;  4M9X A;  1VQ8 I;  3M8F A;  4OAZ A;  2R5Z A;  1Z7U A;  1FT9 A;  3G71 I;  5C4J J;  5EZH A;  4DYQ A;  3I53 A;  4KT6 A;  2G9W A;  4B43 A;  2GXG A;  2M5W A;  3MFK A;  2RDP A;  2B0L A;  3GXO A;  3LQQ A;  2HI3 A;  4RB0 A;  4U0W A;  3M8J A;  3QYF A;  1FZP B;  3K9T A;  5K1Y A;  1ZK8 A;  3MKW B;  5CVV A;  5IT3 A;  4XIC A;  3E97 A;  2EB7 A;  2DA1 A;  2OAZ A;  3I54 A;  1KU9 A;  3JSO A;  4L0Y B;  5HVQ C;  2R5Z B;  3S3O A;  4HBL A;  3GTQ J;  4KIC A;  4HLX A;  2CU7 A;  4ENJ A;  2R5Y B;  1JKP C;  1APL C;  4II3 A;  4ESB A;  1MBG A;  4Y3O A;  3H5N A;  3KEY A;  4I0B A;  2R7F A;  3DKX A;  4FE4 A;  1IF1 A;  2F5C A;  3BC8 A;  5HS8 A;  2IGM A;  1JKR C;  4CSW A;  1H88 C;  3CUO A;  1X2M A;  2Q2E B;  4GO1 A;  2E71 A;  1D0Y A;  5ICF A;  3B6A A;  3L1P A;  5J1R A;  3I0T A;  1DQU A;  2HTS A;  2GA2 A;  2MD0 A;  5DCF A;  1YIJ I;  2DCE A;  3PSI A;  3VYT B;  3WU1 B;  1MBH A;  3JR9 A;  4IQ4 A;  5FLV A;  2KL4 A;  4J01 A;  3DF8 A;  2KRH A;  2ZB9 A;  3FM3 A;  1OFC X;  3S1N J;  3HSR A;  2DA6 A;  3JTG A;  3RCO A;  4XKV A;  2HXI A;  2XF7 A;  3W6V A;  4CCM A;  3K0L A;  5J8C A;  5KHD A;  2PEX A;  4JQF A;  1XN7 A;  3CCL I;  2CWE A;  3FXQ A;  2CGP A;  2H1K A;  5IT9 Z;  2IP2 A;  2ID3 A;  2D2W A;  1OCT C;  2PMZ A;  3R61 A;  4RAF A;  1LJ9 A;  1N75 A;  2EPF A;  1QU3 A;  5ICG A;  2BZT A;  3FXM A;  1LFB A;  4F3Q A;  4XKB A;  3DP7 A;  3OYN A;  1POG A;  1W4M A;  3FZV A;  1DGW Y;  4BEH B;  4TV7 A;  1M1E B;  3WGG A;  5DM7 F;  4BE2 A;  4XRS G;  5EEH A;  5FJ8 J;  3CO7 C;  3S16 J;  1XGO A;  3MWM A;  4IKF A;  5CPR B;  2K4J A;  2VBZ A;  2K9S A;  4A6D A;  4C3H J;  3IKT A;  1VQO I;  3FBI B;  1YS7 A;  4A3L J;  3HOS A;  2K85 A;  1A5J A;  1G6N A;  1STZ A;  2O5R A;  4L9J A;  1RUN A;  2KZV A;  3KLN A;  2GIV A;  1QPM A;  3VOE A;  3WTZ A;  3GZN B;  3KIO A;  3GW2 A;  1BA5 A;  1SEU A;  2E36 A;  4F91 B;  3BR5 A;  2A6E F;  1X58 A;  3VPR A;  4B44 A;  3K6G A;  2HVQ A;  3MN2 A;  1C0W A;  1R71 A;  2ZSI B;  1J5Y A;  5E20 A;  1OMI A;  2Y48 A;  3H0D A;  5BPD A;  4NC6 A;  3I58 A;  1FNN A;  1UJ8 A;  2I5U A;  2IXS A;  2RKH A;  2CG4 A;  4QTR A;  5FRO A;  1B4A A;  3CQZ J;  2K27 A;  2K9L A;  2LTP A;  1X1A A;  2M9H A;  4LK0 F;  5H20 A;  1YOV B;  3SJM A;  3IHU A;  4MFE A;  2ZXW H;  4DZP A;  2MC3 A;  4A5N A;  4WK8 F;  3TO6 A;  2DW4 A;  2JJ7 A;  1MIJ A;  4AU7 A;  1K4S A;  4YEJ A;  4HX7 A;  2X85 A;  3KZY A;  2MBF A;  2O8X A;  1ETV A;  4IO9 F;  3KE2 A;  3LSK A;  5B1A H;  2I10 A;  1R5G A;  3H9J A;  4OIQ F;  1E3H A;  3QYE A;  1E17 A;  1CGP A;  2VT3 A;  2XAF A;  4G12 A;  3E1S A;  2P6T A;  2ZO4 A;  3V42 A;  2EV5 A;  3L2W A;  2WV1 A;  2XAJ A;  1ZQ3 P;  5FKL A;  2Z16 A;  4HQE A;  4UNO A;  1MKM A;  3BJ6 A;  2MSY A;  3I55 I;  2EA4 A;  1HA8 A;  4FE7 A;  2L2O A;  2DDB A;  3FK7 A;  4F52 A;  3JRB A;  2CSO A;  1FMV A;  3ZMZ A;  4DJA A;  5B1B H;  1G3Y A;  2TRT A;  3TOB A;  3F0C A;  3GYH X;  1E2X A;  2WTE A;  5IPA A;  2X6O A;  1V3F A;  2FBI A;  2TDX A;  3DTK A;  1R1U A;  3KP6 A;  3ERE D;  2KP6 A;  2M34 A;  3HRS A;  2KIM A;  4WF2 A;  3OYD A;  1J59 A;  3CC4 I;  2RAE A;  4GRI A;  1A35 A;  2W24 A;  3ZQL A;  3ZN1 A;  2YS9 A;  2NS7 A;  1YQA A;  4CDG A;  2KPM A;  4BDY A;  2MW8 A;  1BI2 A;  4DW6 A;  2KJC A;  2FOW A;  3GLX A;  3LSH A;  2ESH A;  3H35 A;  1TT0 A;  5KVR A;  1UMQ A;  3G4S I;  1NHA A;  2R7W A;  2QQB A;  1VQ7 I;  3DPT A;  1CF7 A;  4UB6 C;  4DIQ A;  2IW5 A;  1W7P D;  4NBQ A;  4XID A;  2BY1 A;  5D8L B;  3VEP A;  3F3X A;  2CRG A;  2FA5 A;  2PJP A;  1R1V A;  4A2U A;  2QF7 A;  2ZME A;  2DJN A;  2HTJ A;  2BXZ A;  4CZZ A;  5FLX Z;  1WQ2 A;  2DBB A;  4ZYE A;  1LVK A;  1BL0 A;  2HZD A;  3H36 A;  4WX9 A;  1H9T A;  2RVC A;  2M7B A;  2A6H F;  3OYL A;  3OOP A;  1IC8 A;  1SFX A;  3QQA A;  2P7V B;  2VON A;  2NVU B;  1G3W A;  2DLL A;  1RKT A;  2MAB A;  2Y2Z A;  4ZYD A;  3N97 A;  1ETQ A;  2RRE A;  3M9A A;  1YJN I;  2KDO A;  3ZMV A;  5J8F A;  3L2C A;  5IP7 J;  1Z6T A;  3E6D A;  1LFP A;  3ELK A;  4D9J A;  2IT0 A;  2EBI A;  4U88 A;  4U87 A;  2D5V A;  4HX8 A;  2GXA A;  4I01 A;  3DEE A;  2LNB A;  4WXC A;  4LB6 B;  2R7T A;  1SAX A;  4L5J A;  3G73 A;  3ECO A;  3QWL A;  5E1W A;  1D0Z A;  2FMY A;  5K5Q A;  5HDN A;  1GV5 A;  5DS9 A;  1RR8 C;  4YEL A;  3BZK A;  4JK1 X;  2CW7 A;  3AG4 H;  3HDD A;  2L02 A;  4Y4R A;  2XRO A;  1XCB A;  5LHG A;  4FET A;  3F6V A;  2JT1 A;  2PMU A;  5JR3 A;  2OQR A;  1T0F C;  4AIJ A;  3CLO A;  2PN6 A;  1VQL I;  1ETY A;  4ETS A;  1SMY F;  4XBF A;  3HPG A;  2KDZ A;  2IA1 A;  1SVL A;  2OD5 A;  4EJV A;  1YFH A;  5EJC A;  1AHD P;  3OL4 A;  3LST A;  4HF0 A;  5L3C A;  1MH3 A;  3OS0 A;  5HDK A;  2Y75 A;  1G59 A;  3MD2 A;  2MGQ A;  4RGS A;  3OYE A;  4EGZ A;  4HDV A;  3NQO A;  4LLN A;  2DN0 A;  3F8B A;  4Y13 A;  3IH4 A;  4GYI A;  1WZ2 A;  4ZYH A;  2E1O A;  3FHZ A;  5IOY A;  3M07 A;  3CDH A;  2EIL H;  2VXD A;  4RB1 A;  1WI3 A;  5HOO A;  3C2H A;  2QUF A;  1EH6 A;  1O3R A;  5D8K B;  3TBI A;  1OCO H;  2FXA A;  2NNN A;  4ZDL A;  2JPC A;  4BQN A;  3RDI A;  2ME0 A;  1R22 A;  3LSM A;  2OPT A;  3OYF A;  4B8X A;  3SEZ A;  5FO5 A;  1BI3 A;  4IXA A;  1LPQ A;  3CJT B;  3RZO J;  1VQP I;  5HNH A;  2BY0 A;  3RYP A;  1YHQ I;  4ESF A;  2W00 A;  3ZQH A;  3GFL A;  4MEY F;  2LVS A;  3K4J A;  1DP3 A;  3J7Y J;  3BLY A;  3PO2 J;  3D1N I;  4LMY A;  5M5W J;  1IDY A;  2V7F A;  4EJT A;  2JRT A;  3PQK A;  2Y30 A;  4ANJ A;  3LA7 A;  4A69 C;  4B3A A;  4UY8 I;  4G8X A;  2JK3 A;  2VOP A;  1DPR A;  2DA5 A;  4Y15 A;  2YR2 A;  5DEQ A;  1KZH A;  5LRR A;  4XLA A;  3FHN A;  3D0S A;  2EIJ H;  1BJA A;  1F1Z A;  1IGN A;  4DQ2 A;  1WKM A;  4KN4 X;  2LC2 A;  4II2 A;  3NWT A;  3ZQI A;  4G7H F;  2LH9 A;  4HNV A;  3IRR A;  1XGS A;  2FRH A;  3C1D A;  3PIP F;  4FX0 A;  2LG4 A;  3ZMU A;  5GAE J;  2BEO A;  5KK1 A;  3WTY C;  5JVG F;  4LK1 F;  1SAN A;  4EVI A;  2V9K A;  4P55 A;  2G7H A;  1FPQ A;  2V1U A;  5GTI C;  2QEN A;  3QYB A;  1OYY A;  1S5L C;  3VYR B;  1BJZ A;  2AXL A;  4MEX F;  2VKE A;  1T0F A;  2XAU A;  3WE2 A;  3JRD A;  3Q0U A;  3X2Q H;  5AIQ A;  4BQO A;  1S9H A;  2VOD A;  3E6B A;  4XLE A;  1XDU A;  3I56 I;  2M87 A;  5EDN A;  1OLT A;  4F92 B;  1X2N A;  5FD5 A;  2EIM H;  1MBF A;  4HAM A;  1ZR4 A;  4BE1 A;  2PMZ N;  2F6C A;  3BRO A;  1RIO H;  3HRM A;  2O9L A;  2B63 J;  1OQY A;  4I0A A;  1PP8 F;  2V1D A;  1MGT A;  2LK2 A;  4RLF A;  1WH5 A;  1U5T C;  2X0L A;  2ZJR F;  2NAZ A;  2VKH A;  3HM5 A;  1UEL B;  3BTJ A;  5BPI A;  2ZKZ A;  3HSF A;  4OWR B;  3DTI A;  1YJW I;  2CUF A;  2L9N A;  4RA2 A;  3H92 A;  3WU2 C;  5EG0 A;  4MTD A;  2CQQ A;  5FB2 A;  2YX4 A;  1N77 A;  4YIR X;  3LSJ A;  1UG2 A;  5LLQ A;  1MMA A;  4QPO A;  5LEJ A;  3PM1 A;  3F8N A;  4XK4 A;  3LMM A;  3WG9 A;  3GTL J;  1IXC A;  5E3M A;  5FD6 A;  5J47 A;  1FYM A;  3DTE A;  2NS0 A;  3BDD A;  3HG9 A;  3OS1 A;  5K7H A;  5EF6 A;  4O5V A;  1ZEL A;  4HLY A;  3TQN A;  2F5V A;  1XPX A;  4KYW A;  2MD5 A;  2OZ6 A;  3MKY B;  3NEU A;  2HEO A;  4NHJ A;  2OC6 A;  1R5I D;  2AQE A;  2DI3 A;  3C2B A;  1R49 A;  1ZH5 A;  1NG6 A;  2V9V A;  3PNV A;  2XPU A;  1MMG A;  2CJJ A;  3LSR A;  1MNM C;  3Q9S A;  2HOS A;  1BC8 C;  3EET A;  4RM3 A;  3ZR8 X;  3GX4 X;  4KIB A;  3BG6 A;  2CYY A;  2Z2S B;  5D6F A;  2NYX A;  4CH7 A;  1ZRE A;  1BBY A;  5FLM J;  1PUE E;  3KEO A;  2V6E A;  2FX0 A;  1O7L A;  1Z7L A;  2Z1D A;  2LLK A;  3BQZ A;  4ZDP A;  1REP C;  3S8P A;  3OYH A;  3SZG A;  1EH7 A;  1S7O A;  3TDZ C;  1JUS A;  2R7S A;  2H09 A;  5CQG A;  4PJM A;  2UZK A;  3C7J A;  1ETO A;  2Y31 A;  1H8A C;  1HW1 A;  1UST A;  2F4I A;  1YG2 A;  4XLH A;  2PX9 A;  2LD5 A;  3H5R A;  2VQL A;  4DBQ A;  2IA0 A;  3PNY A;  3HHG A;  5ILS A;  2XUB A;  4IEJ A;  2L7F P;  4FT8 A;  4C2U A;  2IS2 A;  3NRV A;  1TLH B;  4B09 A;  4U0V A;  4BXU A;  1O3S A;  1P9Q C;  1B72 A;  9ANT A;  3LL7 A;  3TOA A;  5E3N A;  4HF2 A;  1SMT A;  3K4K A;  2M7A A;  5EZG A;  4A3B J;  2OTL I;  2OCC H;  4KDP A;  5M3F J;  2R92 J;  2IS1 A;  3FXJ A;  1MJ9 A;  4XKC A;  1W0U A;  4E7I A;  2R4G A;  2FOK A;  4AID A;  1VQ9 I;  3LSI A;  1U5T B;  3F21 A;  1HKT A;  1S8N A;  2V26 A;  3DKY A;  4IJA A;  2P0W A;  1FOW A;  3S17 J;  1FYL A;  1PYV A;  1A6I A;  2BV6 A;  4M3F A;  2EV0 A;  1IRZ A;  2DFE A;  2ME6 A;  2K40 A;  2GIZ A;  2M45 A;  3JRI A;  1S72 I;  1K83 J;  1SD6 A;  2IEK A;  1WJD A;  4EGY A;  4IZZ A;  2HOT A;  4XKW A;  4E7Z A;  1PUF B;  2GZW A;  2QYO A;  3B02 A;  4EAT A;  3F8M A;  3WG7 H;  3BZ6 A;  3U1D A;  2XGX A;  3DV8 A;  2RQQ A;  2BYV E;  3OR1 C;  2IGK A;  4FHT A;  4MO7 A;  3BPX A;  2FSW A;  2XPV A;  1W36 D;  2V4J C;  3IV5 A;  3OYI A;  1K78 A;  5D4S A;  4XNF A;  1HDP A;  2DA4 A;  3DU5 A;  2VBY A;  2PG4 A;  2L01 A;  1LDJ A;  2K02 A;  1R7J A;  2K86 A;  4BJT A;  2A07 F;  1QVT A;  1Z1D A;  3RZD J;  3BOQ A;  4DNC A;  4S05 A;  2O0Y A;  3FK6 A;  5TJJ A;  1GDT A;  2CV2 A;  4CHU A;  3HUG A;  4E70 A;  1MZB A;  1SAU A;  1GHC A;  1K78 B;  4XQF A;  3RYR A;  2V9P A;  2X1E A;  5J1U A;  2B7E A;  1RRJ A;  1AWC A;  1W5T A;  1FOX A;  5B3S H;  3P9C A;  4RBO A;  1I5Z A;  4AIK A;  3KP5 A;  2L7Z A;  3PNT A;  3WHC A;  2HVR A;  1HST A;  2PJR A;  4KA4 A;  5KCM A;  3BG3 A;  4P9U A;  1IG7 A;  2YSR A;  2O6G E;  4RAZ A;  1Z0X A;  2KJB A;  2R5Y A;  3WTX C;  3HUG B;  2BXY A;  4ZTJ A;  3GVA A;  1KYZ A;  4C3J J;  4JP0 A;  4A93 J;  1FSE A;  3FXO A;  1WJF A;  3HRT A;  2BOL A;  4UUS A;  2KIQ A;  2Q8K A;  4ENM A;  2ECC A;  4XLN F;  4KUM A;  5J1Y A;  4KMU X;  2KIU A;  2XHK A;  2Q2E A;  2PJR B;  3DLA A;  5KAI C;  4E7J A;  1E3P A;  3BY6 A;  3CCQ I;  4IHT A;  5HNF A;  2NXN B;  3F8C A;  3HEF A;  3ISP A;  4G6T B;  2VT2 A;  2FNA A;  5E3L A;  2VKD A;  4PUS A;  1E0E A;  1XG1 A;  3FM5 A;  4UUS B;  2A69 F;  5F0F A;  5D5U B;  3DKW A;  4D5F A;  1JXS A;  2VQG A;  4W1U A;  2W85 A;  2VJJ A;  3S2H J;  1XGM A;  3F22 A;  4G7Z F;  2XGD A;  4RGU A; 
#chains in the Genus database with same CATH homology
 2ESN A;  4HZF A;  2DTR A;  5D5W B;  2E1C A;  3WTS C;  3V4G A;  3CO6 C;  3LA3 A;  2E7W A;  1WWX A;  1Z9C A;  3ZN0 A;  4L18 B;  1LQ1 A;  2V79 A;  1LDK B;  1ZAR A;  3V7S A;  1U8R A;  2RV8 A;  3MAJ A;  2EFP A;  1P2F A;  1ZG1 A;  1A04 A;  2ZNZ A;  1SD4 A;  4I98 B;  1AOY A;  3GWZ A;  4K2E A;  2R7D A;  5DD8 A;  1TQP A;  5HDG A;  4ON0 A;  1HQC A;  3C3W A;  5L3G A;  3LQR A;  4U0Y A;  3GO5 A;  3R0J A;  1K7A A;  2CW0 F;  3QAH A;  4EM0 B;  4Z2Y A;  1UHW A;  3E5U A;  1T98 A;  4A0Y A;  1FBS A;  2PQ8 A;  3WGI A;  2QBY B;  4HX4 A;  3V8L A;  3GFJ A;  4IVN A;  1KA8 A;  1I27 A;  5CVR A;  1T6S A;  1O3Q A;  5BS6 A;  5L3E A;  4KN7 X;  2FML A;  4OIR F;  3BWG A;  1LEA A;  2DAO A;  3FMS A;  5L3D A;  1H9G A;  1F9N A;  2E1N A;  1Z91 A;  2HZT A;  2HOE A;  5E8I A;  4AVP A;  1LDD A;  1R00 A;  4EJO A;  4YFN F;  4YII A;  3R4K A;  1U2W A;  2FNP A;  2STW A;  1G3T A;  2Q0O A;  2GAU A;  1IRG A;  5H6Q A;  3RPU A;  4O6J A;  1FP2 A;  3JAM K;  1U78 A;  5D6E A;  4MTE A;  4YIF A;  3VFZ A;  3QPH A;  1HBX G;  3MZH A;  4BH9 A;  3F72 A;  3J80 K;  3LAJ A;  3HOT A;  1HW2 A;  5D4R A;  1IW7 F;  1WRJ A;  1BM9 A;  2R3S A;  5JFR A;  1ZYR F;  1KQ9 A;  5LHH A;  1FP1 D;  5JHU A;  5F64 A;  3U9G A;  4M73 A;  2AS5 F;  3K1N A;  4A0X A;  3M7G A;  1ON2 A;  3WTV C;  2EJR A;  1EV7 A;  4EM2 A;  3ZMS A;  1I1S A;  3I59 A;  3CJN A;  1FY7 A;  3RKX A;  3BP8 A;  3DPL C;  3IKV A;  3R60 A;  1LNW A;  1F5T A;  3T8T A;  3O3K A;  3EQL F;  1YYV A;  3KEQ A;  2H27 A;  4HDU A;  4Y17 A;  2HR3 A;  4MHG A;  1JHF A;  1GVJ A;  3I59 B;  2BGC A;  1K79 A;  2K4B A;  2MA3 A;  4EQQ A;  1Y0U A;  5F1R A;  1LVA A;  2HQR A;  3HSE A;  2Z5U A;  4M6Y A;  1JE8 A;  1QO0 D;  2FBK A;  3OV8 A;  4L9N A;  1ZAO A;  2STT A;  2FF4 A;  1MJA A;  5LHI A;  4OMZ A;  3QU6 A;  2OZU A;  4LLG F;  3LA2 A;  2P6S A;  1L0O C;  5D5V B;  4N9H A;  1FX7 A;  3EYI A;  4XSX F;  3SHF A;  4I7H A;  4RAY A;  4A0Z A;  1W5S A;  1B6A A;  1RI7 A;  3VOD A;  3KP3 A;  1YS6 A;  4XLP F;  3O2P E;  2ACJ A;  3KP7 A;  3J81 K;  5FGM A;  1ONV A;  2NNY A;  1OPC A;  2KRF A;  3HIF A;  4KT5 C;  1XMK A;  3V7R A;  1YIO A;  3SXY A;  3HTS B;  5EEG A;  2HWV A;  2BBY A;  4BQA A;  3B73 A;  1BC7 C;  2ADU A;  4XRF A;  4RS8 A;  3WU0 A;  4R8H A;  4BAY A;  2A61 A;  1DUX C;  2ZJ2 A;  4N9I A;  5E17 F;  4PGG A;  1WI9 A;  1ZN2 A;  4PZJ A;  2QZ8 A;  3F23 A;  1HW5 A;  5JI6 A;  2DU9 A;  3SZP A;  2XV4 S;  2HGC A;  3P9I A;  1EH8 A;  4S04 A;  3QOP A;  2VE8 A;  5HS9 A;  4GXO A;  1TW3 A;  4UV8 A;  1MJB A;  2Z3Y A;  3P9K A;  2DT5 A;  3RPQ A;  3JW4 A;  4Q47 A;  3WTT C;  4UXN A;  1QBJ A;  1TTY A;  3V8J A;  1TQI A;  4BHP A;  2LF8 A;  4WXH A;  2JZY A;  2MH2 A;  3FWE A;  3T8R A;  5H6R A;  5AON A;  2J5O A;  4M9Z A;  5DV5 A;  2COM A;  5LBQ A;  1BI0 A;  2P7C B;  1FSH A;  4PGH A;  1KU2 A;  4CIC A;  1QQI A;  3GZ6 A;  1J7K A;  5ED4 A;  1TW2 A;  4UHT A;  2ZNY A;  1FBQ A;  3HYI A;  1I1G A;  4F7Z A;  3WGH A;  2L4A A;  2P5L C;  4D0P A;  2PI0 A;  1UFM A;  2A5Y B;  1J0R A;  4ENK A;  1IN6 A;  2GWR A;  5CVJ A;  2KIF A;  4EJW A;  1SFU A;  2H6C A;  5A2Q K;  1YTY A;  3GFM A;  3GUD A;  2JPB A;  2CFX A;  4QWQ A;  1HKS A;  1XSD A;  2QWW A;  3E6C C;  3KP2 A;  1MDM B;  3Q9V A;  2DK8 A;  2HS5 A;  4UV9 A;  3L00 A;  1K6O A;  4LB5 A;  4LG0 B;  2YPR A;  1R1T A;  1RNL A;  2C6Y A;  5CLS A;  5BMZ A;  2OQG A;  4WXD A;  4UUV A;  3HRU A;  3QRF F;  2F5D A;  2OA4 A;  2Y0M A;  1O7F A;  4UVC A;  4AD9 A;  4A12 A;  4PCQ A;  1TQM A;  1ZHF A;  3E5Q A;  5ILV A;  5L3F A;  2VBX A;  1XGN A;  2H94 A;  1T38 A;  1G4D A;  6PAX A;  2M8E A;  4A5M A;  2VBW A;  2RQP A;  1LB2 A;  3ZMD A;  1IAW A;  3FMQ A;  2F2E A;  1XSV A;  1KQ0 A;  4ZH4 F;  4ASN A;  1U5T A;  1ZG5 A;  3K69 A;  5CJ9 A;  4LD5 A;  3PQJ A;  2L3D A;  4RGR A;  1VTN C;  1U3E M;  1P6R A;  4I02 A;  4EM1 A;  5IT9 K;  1YLF A;  1ZLJ A;  3FXU A;  1ZRF A;  4G6D A;  2FE3 A;  4ENN A;  3V8K A;  3WOD F;  1ODD A;  1OKR A;  3T1B A;  3LAP A;  3TDU C;  1YW9 A;  1P4W A;  3RKW A;  4IRG A;  3M8E A;  3MCZ A;  1B1B A;  3E3V A;  1FYK A;  3WTU C;  1HKQ A;  3R0A A;  1JHH A;  2FEZ A;  1MD0 A;  2V1X A;  4KMF A;  2IPQ X;  2VE9 A;  1R58 A;  2PLY A;  4G6Q A;  4H0E A;  1XSX A;  4HW0 A;  1RUO A;  3FXR A;  3KCC A;  2DPU A;  1USS A;  2Z9O A;  5AIP A;  4CO8 A;  1J75 A;  1ZRC A;  3E6M A;  2P5V A;  4OOI A;  2XRN A;  1J2X A;  3SZT A;  1KGS A;  1BI1 A;  2G7U A;  3C18 A;  4MGR A;  2XAQ A;  3S2W A;  4YFX F;  4JBA A;  5ICE A;  4P5O A;  1YO5 C;  2Z33 A;  3F8F A;  3CUQ C;  3QPT A;  2EK5 A;  3PFI A;  4GYG A;  4CXF A;  3K2Z A;  4OIP F;  4RB3 C;  5K5R A;  2WWY A;  3H3Z A;  2DPD A;  1IZ1 A;  1FOK A;  4M72 A;  3ML6 A;  1T39 A;  1XDS A;  2W84 A;  5HLG A;  1HSJ A;  1FLI A;  3GFI A;  2IJL A;  1DP7 P;  4I09 A;  1D8J A;  1SD5 A;  2P4W A;  4G9Y A;  2QQA A;  4L5I A;  5F6F A;  5LRS A;  1R23 A;  4L9T A;  5J6X A;  5FLX K;  2HFH A;  3W6K B;  4U7B A;  4AWX B;  2ZFW A;  2QBY A;  4XSZ F;  4WCG A;  4U7D A;  2DK5 A;  1S29 A;  2QM3 A;  1IN8 A;  3U2R A;  2X4H A;  3L09 A;  4PDK A;  1PP7 U;  1B9N A;  1R5H A;  3J7A O;  4HQM A;  4HOB A;  4YFK F;  5LEK A;  5K5O A;  1UB9 A;  2ELH A;  4Q5S F;  4ZZD A;  2IA2 A;  2DFI A;  3QU3 A;  4LGW A;  2GQQ A;  1XMA A;  5D5X B;  4M9S A;  3REO A;  2D45 A;  2WV0 A;  3CUQ A;  2K7L A;  3GF2 A;  1ZH5 A;  5FFX A;  5FFZ A;  4IF4 A;  2JTV A;  2KKO A;  3RKY A;  2XAS A;  2CO5 A;  4KFC A;  1TNS A;  2EFQ A;  3GEZ A;  3ZQ7 A;  4EV0 A;  1KU3 A;  3CUQ B;  4HV6 A;  4Q48 A;  4M71 A;  4CGZ A;  1IRF A;  3BJO A;  3EYY A;  3ECH A;  2DO7 A;  1ZGJ A;  2LDU A;  5DDG A;  2EA2 A;  1F4K A;  3I4P A;  4NQW A;  4I2O A;  3GZ5 A;  2HYF A;  2WC2 A;  4IRI A;  5L3B A;  2O61 A;  3I64 A;  3BJA A;  2V6C A;  5LGN A;  1O3T A;  1D3Y A;  2F5F A;  4FX4 A;  3T5X A;  2W25 A;  3TGN A;  5DCM A;  5E18 F;  4QLC U;  1U6G A;  1KU7 A;  1BOA A;  3I71 A;  2UXX A;  4P96 A;  3KZZ A;  1W7P A;  3KFW X;  1IN5 A;  3AAF A;  5DCM B;  4RGX A;  1B9M A;  3TKY A;  4IHS A;  5JVT A;  2XAH A;  3L9F A;  3I5U A;  4CYD A;  4MQV A;  2L4M A;  2MLG A;  4OIO F;  5HLI A;  1W7P B;  1FC3 A;  2JSC A;  2XKP A;  1J9I A;  2RGV A;  4BNC A;  3ABT A;  1L3L A;  1FBU A;  5BQT A;  4GCV A;  4IPA A;  1TBX A;  3DXJ F;  4BYY A;  1BIA A;  4HV5 A;  1UCR A;  1Z05 A;  3COA C;  1CF7 B;  5DYM A;  5ILU A;  3ABU A;  3JSP A;  3K1M A;  4MQ9 F;  2O3F A;  4L0Z B;  4OMY A;  2VC0 A;  2CQK A;  4M6X A;  2DQL A;  1P92 A;  3ZMT A;  2ZME B;  2P5K A;  3RJP A;  5CYV A;  3N4M A;  2M1B A;  5LGU A;  3IWF A;  2RN7 A;  2ZBK A;  2GA1 A;  2MH9 A;  1Q1H A;  3MZY A;  4HYE A;  2W57 A;  3DEU A;  3O6B B;  2VOO A;  2YX7 A;  2A68 F;  4YG2 F;  4HF1 A;  2J5P A;  4EMS A;  3BPV A;  1DPU A;  4ZZL A;  3SQN A;  2EWN A;  4KIF A;  4OU0 A;  1S3J A;  1IXS B;  2PMH A;  3RI4 A;  3JAM Z;  2FQ3 A;  4IRH A;  3D5L A;  5DD4 A;  1T2K A;  3IC7 A;  1BN5 A;  3FF5 A;  2ZXJ A;  5DUI A;  1OYI A;  4BHC A;  1BIB A;  1RZ4 A;  1P4A A;  2HKX A;  2YU3 A;  1IN4 A;  1IN7 A;  3J80 Z;  1LEB A;  3L7W A;  2ISY A;  1XCV A;  1KYW A;  1XD7 A;  3FX3 A;  3ULQ B;  2FU4 A;  3K1P A;  1KQ8 A;  1I6X A;  1ULY A;  4G94 A;  2GXB A;  2FBH A;  1O57 A;  1JGS A;  2LSO A;  3HHH A;  2ISZ A;  3M1E A;  3ROU A;  1X3U A;  2QQ9 A;  1IUY A;  4UVB A;  3JTH A;  3TO7 A;  1OR7 A;  1S7A A;  4NB5 A;  2D1V A;  1UHM A;  4LLL A;  2PFB A;  1YW7 A;  3KLO A;  1R36 A;  1D5V A;  2VN2 A;  4BHB A;  1ON1 A;  5ERI A;  4LFU A;  3MQ0 A;  3HTU A;  4ESJ A;  1ZRD A;  3QP5 A;  4O3M A;  5ICC A;  2HQN A;  1QZY A;  1Z6R A;  2HKO A;  2LKP A;  3DFG A;  4HA8 A;  5LGT A;  1ZLK A;  2NRA C;  1MDM A;  2O03 A;  3IWZ A;  4WWC A;  5E1X A;  2IVM A;  2XKO A;  4LG0 A;  2EV6 A;  2QVO A;  2BE5 F;  2E7X A;  3SFZ A;  2HYG D;  2LF7 A;  1GXQ A;  3ZPL A;  2ZCW A;  3DQV C;  3E5X A;  4OIN F;  3P7N A;  2DQR A;  5E1Z B;  3TO9 A;  3RTR A;  4RB2 C;  1B59 A;  4GGG A;  3T0Y A;  3Q5F A;  3J81 Z;  2OU2 A;  1S6L A;  1QGP A;  2OBP A;  2XAG A;  1QNT A;  4P9F A;  1GXP A;  1TNT A;  3WTW C;  4EJU A;  4A6E A;  2P8T A;  4ZYG A;  2ETH A;  2EFW A;  1SD7 A;  1SFE A;  1FWZ A;  3KP4 A;  4N0B A;  1H0M A;  3EDP A;  2VC1 A;  2RC4 A;  3IRQ A;  3H3U A;  3WE3 A;  2L54 A;  1YW8 A;  1ZG3 A;  5CVU A;  5HS7 A;  1V4R A;  2QLZ A;  2XIG A;  1HXD A;  3VB2 A;  3F6O A;  3LWF A;  1G3S A;  2VXZ A;  3V7C A;  1D8K A;  1DDN A;  4MNU A;  2Z99 A;  4LJZ F;  3FMR A;  3KET A;  3W6J B;  2RNJ A;  3IL2 A;  4UVA A;  2EFN A;  4M74 A;  2EFO A;  3RIR A;  4R1H A;  5E8G A;  5TRD A;  5CVI A;  5BOX A;  5HLH A;  4KNY A;  1XB4 A;  3MEX A;  3EUH A;  4G7O F;  3ZP5 A;  5DUK A;  4AIH A;  1QZZ A;  2UWM A;  4Q4Z F;  2XVC A;  2UXN A;  3G3Z A;  1OYW A;  2MLK A;  3R6S A;  2HDC A;  2M30 A;  1ZGA A;  2IRF G;  4L9V A;  2F5E A;  2D1H A;  3QP6 A;  1WSU A;  4KIG A;  5A2Q Z;  1IXR C;  1P4X A;  2H6B A;  2PBI A;  1PDN C;  4R79 A;  3LFK A;  3CTA A;  2A3S A;  4M9X A;  3M8F A;  1Z7U A;  1FT9 A;  3I53 A;  2G9W A;  2GXG A;  2M5W A;  3MFK A;  2RDP A;  2B0L A;  3GXO A;  3LQQ A;  4RB0 A;  4U0W A;  1FZP B;  3K9T A;  5K1Y A;  5CVV A;  5IT3 A;  3E97 A;  2EB7 A;  2OAZ A;  3I54 A;  1KU9 A;  3JSO A;  4L0Y B;  5HVQ C;  4HBL A;  4KIC A;  4HLX A;  4ENJ A;  4ESB A;  4I0B A;  2R7F A;  1IF1 A;  2F5C A;  5HS8 A;  3CUO A;  4GO1 A;  5ICF A;  3I0T A;  2HTS A;  2GA2 A;  5DCF A;  3WU1 B;  3DF8 A;  3FM3 A;  3HSR A;  3JTG A;  3K0L A;  5J8C A;  2PEX A;  4JQF A;  1XN7 A;  2CWE A;  3FXQ A;  2CGP A;  5IT9 Z;  2IP2 A;  2D2W A;  3R61 A;  1LJ9 A;  5ICG A;  3DP7 A;  1W4M A;  3FZV A;  4TV7 A;  3WGG A;  5EEH A;  3CO7 C;  1XGO A;  3MWM A;  2K4J A;  2VBZ A;  4A6D A;  3IKT A;  1YS7 A;  3HOS A;  1G6N A;  1STZ A;  4L9J A;  1RUN A;  3KLN A;  2GIV A;  1QPM A;  3VOE A;  3WTZ A;  3GW2 A;  2A6E F;  1C0W A;  1J5Y A;  5E20 A;  1OMI A;  2Y48 A;  5BPD A;  3I58 A;  1FNN A;  2RKH A;  2CG4 A;  1B4A A;  2K27 A;  4LK0 F;  4CHU A;  5H20 A;  3IHU A;  2MC3 A;  4A5N A;  4WK8 F;  3TO6 A;  2DW4 A;  4HX7 A;  3KZY A;  2MBF A;  2O8X A;  3KE2 A;  4OIQ F;  1R5G A;  1E17 A;  1CGP A;  2VT3 A;  2XAF A;  2P6T A;  2ZO4 A;  2EV5 A;  2XAJ A;  4HQE A;  4UNO A;  1MKM A;  3BJ6 A;  2EA4 A;  2CSO A;  3ZMZ A;  1G3Y A;  3TOB A;  3GYH X;  1E2X A;  2WTE A;  1V3F A;  2FBI A;  2TDX A;  1R1U A;  3KP6 A;  3ERE D;  3HRS A;  2KIM A;  4WF2 A;  1J59 A;  2W24 A;  3ZN1 A;  1YQA A;  4CDG A;  1BI2 A;  2KJC A;  3GLX A;  2ESH A;  5KVR A;  1NHA A;  2QQB A;  3DPT A;  1CF7 A;  2IW5 A;  1W7P D;  5D8L B;  3VEP A;  3F3X A;  2FA5 A;  2PJP A;  1R1V A;  4A2U A;  2ZME A;  2HTJ A;  4CZZ A;  5FLX Z;  1WQ2 A;  2DBB A;  4ZYE A;  1H9T A;  4WX9 A;  2RVC A;  2A6H F;  3OOP A;  1SFX A;  2P7V B;  2VON A;  1G3W A;  2DLL A;  4ZYD A;  3N97 A;  3M9A A;  3ZMV A;  5J8F A;  3L2C A;  1Z6T A;  3E6D A;  3ELK A;  2IT0 A;  4U88 A;  4HX8 A;  4I01 A;  2LNB A;  4WXC A;  4LB6 B;  1SAX A;  4L5J A;  3G73 A;  3ECO A;  5E1W A;  2FMY A;  5K5Q A;  5HDN A;  4JK1 X;  2L02 A;  2XRO A;  1XCB A;  5LHG A;  3F6V A;  2JT1 A;  2PMU A;  5JR3 A;  2OQR A;  4AIJ A;  3CLO A;  2PN6 A;  4ETS A;  1SMY F;  4XBF A;  2IA1 A;  4EJV A;  2OD5 A;  1YFH A;  3LST A;  4HF0 A;  5L3C A;  5HDK A;  2Y75 A;  4RGS A;  4EGZ A;  4HDV A;  3NQO A;  4LLN A;  3F8B A;  4Y13 A;  4GYI A;  4ZYH A;  3FHZ A;  3CDH A;  4RB1 A;  5HOO A;  2QUF A;  1EH6 A;  1O3R A;  5D8K B;  2FXA A;  2NNN A;  2JPC A;  3RDI A;  1R22 A;  4B8X A;  5FO5 A;  1BI3 A;  4IXA A;  3RYP A;  4ESF A;  3GFL A;  4MEY F;  4LMY A;  4EJT A;  2JRT A;  3PQK A;  3LA7 A;  4G8X A;  2VOP A;  1DPR A;  4Y15 A;  2YR2 A;  5DEQ A;  5LRR A;  3D0S A;  1BJA A;  1F1Z A;  4DQ2 A;  1WKM A;  4KN4 X;  4G7H F;  3IRR A;  1XGS A;  2FRH A;  3C1D A;  4FX0 A;  3ZMU A;  2BEO A;  5KK1 A;  3WTY C;  4LK1 F;  4EVI A;  4P55 A;  2G7H A;  1FPQ A;  2V1U A;  2QEN A;  1OYY A;  2AXL A;  4MEX F;  1T0F A;  3WE2 A;  5AIQ A;  2VOD A;  3E6B A;  1XDU A;  2M87 A;  5FD5 A;  4HAM A;  3BRO A;  1RIO H;  3HRM A;  4I0A A;  1PP8 F;  2V1D A;  1MGT A;  1U5T C;  2X0L A;  2NAZ A;  5BPI A;  2ZKZ A;  3HSF A;  3H92 A;  4MTD A;  5FB2 A;  2YX4 A;  5LLQ A;  5LEJ A;  3F8N A;  3WG9 A;  1IXC A;  5FD6 A;  1FYM A;  2NS0 A;  3BDD A;  4O5V A;  4HLY A;  3TQN A;  4KYW A;  2MD5 A;  2OZ6 A;  3NEU A;  2HEO A;  4NHJ A;  2DI3 A;  2V9V A;  3Q9S A;  1BC8 C;  3EET A;  3GX4 X;  4KIB A;  2CYY A;  5D6F A;  2NYX A;  1ZRE A;  1BBY A;  1PUE E;  3KEO A;  1O7L A;  1REP C;  1EH7 A;  1S7O A;  3TDZ C;  2H09 A;  2UZK A;  3C7J A;  1HW1 A;  1UST A;  1YG2 A;  2IA0 A;  3HHG A;  5ILS A;  2XUB A;  4FT8 A;  3NRV A;  1TLH B;  4B09 A;  4U0V A;  4BXU A;  1O3S A;  3TOA A;  4HF2 A;  1SMT A;  4KDP A;  1MJ9 A;  2FOK A;  3F21 A;  1U5T B;  1HKT A;  1S8N A;  4IJA A;  1FYL A;  2BV6 A;  2EV0 A;  2M45 A;  1SD6 A;  4EGY A;  2GZW A;  2QYO A;  3B02 A;  3F8M A;  3BZ6 A;  3U1D A;  2XGX A;  3DV8 A;  2BYV E;  4FHT A;  3BPX A;  2FSW A;  1K78 A;  5D4S A;  2VBY A;  2PG4 A;  2L01 A;  1LDJ A;  2K02 A;  1R7J A;  2K86 A;  2A07 F;  1Z1D A;  3BOQ A;  4DNC A;  4S05 A;  2O0Y A;  5TJJ A;  3HUG A;  4E70 A;  1MZB A;  1GHC A;  1K78 B;  3RYR A;  1AWC A;  1W5T A;  3P9C A;  1I5Z A;  4AIK A;  3KP5 A;  1HST A;  4KA4 A;  4P9U A;  2YSR A;  2O6G E;  4RAZ A;  2KJB A;  3WTX C;  3GVA A;  1KYZ A;  1FSE A;  3HRT A;  2Q8K A;  4ENM A;  4XLN F;  4KUM A;  4KMU X;  2KIU A;  2XHK A;  2Q2E A;  3BY6 A;  4IHT A;  3F8C A;  3ISP A;  2VT2 A;  2FNA A;  1JXS A;  3FM5 A;  2A69 F;  5D5U B;  3DKW A;  2W85 A;  1XGM A;  3F22 A;  4G7Z F;  4RGU A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...