2RV8A

Solution structure of the phop dna-binding domain from mycobacterium tuberculosis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PhoP DNA-binding domain from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis cas/nitr204
molecule tags Dna binding protein
molecule keywords DNA-binding response regulator
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rv8A00
4AVPA 2K4BA 2NRAC 2W57A 1EH8A 1Z6TA 4R1HA 3GFMA 4U88A 1XD7A 3T8RA 5LEKA 2XGXA 1HSTA 2EJRA 2CSOA 3KE2A 1OMIA 2MH9A 3BDDA 5FB2A 4IRIA 1I1SA 3EYYA 3H92A 4I7HA 5EEHA 5F6FA 1FT9A 2MLGA 3R6SA 3REOA 2DQRA 5DCMB 2OD5A 2QQBA 4G94A 3DV8A 5L3EA 3KP6A 3K9TA 2BYVE 2P4WA 1WKMA 1FC3A 1OYIA 2PN6A 1KYWA 5DCMA 5AIPA 1RIOH 1OPCA 4LK1F 2D1VA 2TDXA 2FU4A 1K78B 1DUXC 2A07F 5L3BA 5CVJA 1IN7A 4FX0A 1DPRA 3I0TA 3L7WA 2QYOA 1QO0D 4KFCA 1USTA 3ML6A 2H6CA 1W7PB 4ZYDA 4ZYHA 3B02A 4Q47A 1Z7UA 2KRFA 2ZNZA 3WE2A 2A3SA 4L9TA 4LD5A 3F21A 3U1DA 1USSA 5DEQA 3GEZA 1QNTA 4LLLA 2HR3A 1PP8F 3M9AA 2W85A 2PJPA 3KZZA 1R23A 4NHJA 4WXHA 3VB2A 4HDUA 5FLXK 4RB2C 2W24A 5L3DA 2VE9A 3LAJA 3ZPLA 3FZVA 3RIRA 2DK5A 2XKOA 1J75A 2EV6A 3GFLA 2ETHA 1GVJA 1ZGAA 3D5LA 3EQLF 3HHHA 4QLCU 2VC1A 3KP4A 4B09A 3R0JA 3WU0A 4OIRF 4AIHA 3F8MA 2D1HA 4BHBA 1ZG5A 3OOPA 1S8NA 3SXYA 4YG2F 5HS8A 2ZNYA 3K69A 1BIAA 4HLXA 2O3FA 3KETA 2XROA 2UWMA 1LEBA 1ZREA 1D8KA 2LF7A 1SD6A 2OAZA 4KA4A 1BBYA 3WGGA 4MTDA 1R7JA 2O03A 2VBWA 3E5UA 3E6MA 1LVAA 2Z9OA 2CYYA 3WTTC 1TBXA 4ASNA 3F22A 3ZMUA 2NNNA 1O7FA 5HS7A 1J9IA 1MKMA 2X0LA 1JE8A 1UCRA 3CLOA 3EDPA 2FA5A 5HLGA 2FOKA 1XSXA 2G7HA 1RZ4A 2ZCWA 2DU9A 3QAHA 2YX7A 1HQCA 1QBJA 3HRTA 4P96A 2P5VA 3WGHA 4GCVA 1Z05A 3QU6A 1H0MA 1IN4A 4HYEA 4UVBA 4IF4A 4KIFA 1U8RA 3P9KA 2P7CB 4A0XA 3KP2A 4LB6B 1IN8A 2EK5A 3TDZC 2K86A 4KN7X 3WTWC 4DNCA 3GO5A 3ZQ7A 4K2EA 2DBBA 1KQ0A 2P6SA 2PBIA 3CDHA 3ABTA 2EA4A 2AS5F 4PGHA 3N97A 2ESNA 1QGPA 2XUBA 1HKSA 3MWMA 4CYDA 4R79A 4UV8A 2HQNA 2OZ6A 4D0PA 1BI3A 2RGVA 3SFZA 4OINF 4OIOF 2C6YA 5E1WA 1FSHA 2G7UA 2Q0OA 3EETA 2XHKA 2UXXA 3FXRA 4AIJA 2FMYA 2F5FA 2O0YA 3KP3A 1U2WA 4U0VA 2DO7A 4HW0A 1E2XA 1SD4A 4E70A 1O3TA 4P5OA 4G8XA 5BOXA 3QU3A 5IT9Z 3FM5A 2WWYA 4EGZA 2QZ8A 1Y0UA 3VODA 2Z5UA 2KKOA 3KLNA 4EM2A 1GXQA 4HDVA 5D5UB 1QQIA 3C1DA 1SFXA 5D5XB 3V7SA 1SD5A 3BROA 1KQ8A 2FSWA 3TO7A 3AAFA 3ZMVA 5KK1A 2FQ3A 3I54A 2HZTA 4UV9A 1F5TA 2ZXJA 3JTGA 1XGMA 4UNOA 3HYIA 4BQAA 3NRVA 3BOQA 2VT2A 1STZA 5L3CA 3ABUA 1R58A 3CUQA 3DFGA 5FD6A 3GX4X 4ETSA 1I1GA 1QZYA 4XRFA 4EQQA 1JGSA 4XBFA 4ENNA 5E8GA 4HBLA 1IXRC 4IRHA 3FHZA 2V6CA 2Q8KA 3DXJF 2IJLA 3MZYA 2GXBA 4Z2YA 1NHAA 4RB0A 4GO1A 4LMYA 3G3ZA 3MZHA 2STWA 4CXFA 1AWCA 3J80K 2ZMEB 2DW4A 1IZ1A 3F8FA 2VBYA 4NB5A 5H6QA 3ULQB 1XCBA 1H9GA 3HTUA 1ZN2A 4N9IA 1XGNA 4EVIA 5FLXZ 4HQEA 5CVRA 1XDSA 1W4MA 4CO8A 1YLFA 1G3WA 4LK0F 2M45A 3BPXA 5JVTA 2FNAA 2FF4A 3IC7A 2KIFA 4GXOA 5D5VB 2STTA 5DDGA 1YFHA 2IPQX 2XAGA 4PZJA 3BJ6A 4F7ZA 5LHHA 1HW5A 3V8KA 1XGOA 1S7OA 2BGCA 2P6TA 2RQPA 4RGUA 4PGGA 2V1UA 2CFXA 4YIIA 2ZKZA 3PQKA 3GUDA 5IT3A 3JW4A 1U5TC 2A6EF 2VONA 1KU2A 4G6QA 1I5ZA 1KGSA 3DKWA 4XLPF 3F23A 3KCCA 4XSZF 3I53A 4L18B 3M7GA 3KZYA 4M9SA 3VFZA 4IXAA 4UUVA 2IA1A 2R3SA 3FMSA 2L54A 2ZBKA 2J5OA 2RC4A 3CTAA 4LGWA 3RDIA 1LJ9A 1P4WA 2KIUA 2EV0A 3L9FA 3ROUA 1E17A 2XAHA 2R7FA 3VEPA 5FO5A 4ON0A 3JAMZ 3CUQC 4JK1X 1ON2A 2L3DA 2V1DA 3WTUC 4MGRA 2Y48A 5K1YA 4RS8A 1U3EM 2W84A 3NEUA 4UXNA 3ZN0A 5LLQA 1LQ1A 3G73A 2BE5F 3SQNA 3GLXA 1P2FA 1W7PD 4BNCA 2Q2EA 1SAXA 1TQIA 1EH6A 4H0EA 1R36A 3HRMA 4M6XA 3K1NA 1MGTA 1F9NA 2P7VB 5ILUA 1HW1A 4HOBA 1BJAA 1U78A 5L3FA 4XLNF 2IRFG 3M1EA 5LHGA 5ERIA 2VXZA 3BY6A 3FXQA 4P9UA 2H6BA 3DP7A 5FGMA 3Q9SA 2CWEA 5JI6A 1K6OA 2EFPA 4OMZA 2HEOA 4L9NA 4XSXF 1B9NA 2QENA 1ZHFA 4EJTA 2E7WA 1FZPB 1O3RA 1Q1HA 4I98B 6PAXA 1XDUA 4Y17A 4I0BA 2BBYA 2O6GE 3BWGA 3WTSC 4ENMA 1RNLA 1DP7P 5HLHA 2FBHA 1KU3A 3COAC 4ZYEA 4BH9A 4EJOA 1JHHA 1Z9CA 4CICA 2DI3A 2YR2A 3IWZA 3RTRA 3WTYC 4IHTA 2P8TA 5J6XA 1V4RA 1A04A 5LGTA 4RB3C 5ICGA 3J81K 3EUHA 5JR3A 4TV7A 4WK8F 2HWVA 2X4HA 4O3MA 5DUKA 2RKHA 2M1BA 4WCGA 3F8CA 1B9MA 4I02A 3N4MA 1BI2A 3D0SA 2QWWA 4L9VA 3CUQB 2XASA 5E1ZB 2EB7A 3B73A 5D8KB 4R8HA 5FD5A 1Z1DA 5BQTA 3J80Z 4EJUA 1FSEA 4OMYA 2ACJA 3K0LA 1BI1A 3I64A 2GIVA 2YU3A 1YO5C 5J8CA 5F1RA 5H20A 1HSJA 1XB4A 3P7NA 4I01A 4MTEA 4G7OF 5JHUA 3ZN1A 5DD8A 2BEOA 3WODF 2IVMA 3LWFA 1P4AA 2K4JA 3LQQA 2XVCA 4Y13A 2O8XA 5LEJA 2FMLA 5BPDA 1W5TA 1WRJA 1OYYA 2VBZA 2GA2A 4LLNA 1O3SA 3RYPA 2VBXA 1RUOA 2IA0A 2E1CA 1YS6A 2MA3A 3JAMK 1YIOA 1IF1A 4HAMA 4IHSA 4EGYA 2HKOA 5DYMA 2RN7A 4YIFA 2K27A 2DT5A 4GGGA 2GAUA 2HYFA 4I09A 3PFIA 3OV8A 1R5HA 4O6JA 5CVVA 3MEXA 2XV4S 1MJ9A 1RI7A 1YW8A 2Z3YA 4BHCA 1IXSB 1ZLJA 3R4KA 1IXCA 1D3YA 3R60A 2K02A 4RGRA 3LA7A 5LRRA 1LNWA 1F1ZA 3C18A 4M6YA 1B1BA 1SFEA 1G3YA 1D5VA 1HBXG 4NQWA 2OQGA 3HSFA 3P9CA 1YQAA 3R61A 2Z33A 1SMTA 3CUOA 3HSEA 2VT3A 2Y0MA 3KEOA 5TJJA 4MQ9F 1R1TA 5DV5A 1ZG1A 5LBQA 3ZMSA 2EFNA 3GFIA 3ERED 1R1UA 1YTYA 4L9JA 2EA2A 1LDJA 1C0WA 3RKXA 3HUGA 4KDPA 3W6JB 3T5XA 3O3KA 1XCVA 4BHPA 2QUFA 4EM1A 3WE3A 5HLIA 2KIMA 1TLHB 4A5NA 2UXNA 5LRSA 2FE3A 4M72A 1BIBA 3M8EA 3GVAA 2VN2A 4HX8A 3ZMZA 2F5EA 1MZBA 1J2XA 1FBSA 2F5CA 3RPQA 1EH7A 2DFIA 2IP2A 2CW0F 3E6CC 1FP1D 4HV5A 5ILVA 3HOTA 4WXDA 3GW2A 1G3SA 5HDKA 4BAYA 4BXUA 4YFNF 4U7DA 1LEAA 3MQ0A 2WTEA 3HOSA 1IN5A 2HFHA 2CGPA 1R5GA 1BC7C 1MD0A 3F8NA 2JSCA 4ENKA 5FFXA 4MEYF 5DD4A 5D6FA 3HTSB 3KP5A 2HOEA 1YYVA 2JZYA 4IJAA 3E3VA 2PMUA 4HX4A 1FYLA 5D4SA 1WI9A 2FBKA 2KJCA 3RYRA 5LGNA 3J81Z 2ISYA 3NQOA 2W25A 1FBUA 2FEZA 1S3JA 2D2WA 4FX4A 2M87A 4A5MA 4EMSA 1S29A 3H3ZA 4IRGA 4G6DA 2RVCA 2J5PA 2ADUA 5K5RA 1YG2A 1OKRA 4P55A 2P5KA 5HDNA 4A6EA 3MAJA 1ZH5A 1UHMA 1UFMA 3F6VA 1SFUA 5LHIA 1ON1A 3FXUA 4BYYA 4U0YA 5JFRA 1GHCA 1R22A 4WF2A 5L3GA 2UZKA 3DEUA 2RDPA 4ZH4F 5EEGA 2OBPA 3I4PA 1KQ9A 2IW5A 1SMYF 2VC0A 3GYHX 2VOOA 4LG0B 5LGUA 5IT9K 5BPIA 2JRTA 3IL2A 3DPTA 1IRGA 1YW7A 1MJBA 1FNNA 3HSRA 1T6SA 1FYKA 1FLIA 3E6BA 2JTVA 3TO9A 1EV7A 1K79A 3HRUA 4MNUA 2E1NA 3IRRA 1ZYRF 4P9FA 1TQPA 2P5LC 3WGIA 2L02A 3DF8A 2VOPA 2QBYA 5HS9A 1KA8A 1JXSA 2IA2A 4CDGA 2GZWA 1L0OC 4L0YB 2M8EA 1S6LA 2G9WA 3E6DA 3RKWA 1UHWA 2QBYB 4ZYGA 4JBAA 2ESHA 1ZG3A 3FWEA 3R0AA 4M71A 3V4GA 3RI4A 3Q5FA 3WTZA 2XAQA 4I0AA 2ZO4A 3T1BA 2DTRA 3ZMTA 3ISPA 2MLKA 4A12A 1B59A 4U7BA 1Z6RA 1X3UA 4ENJA 4FT8A 4UVCA 5A2QK 2H09A 3KP7A 4I2OA 4LB5A 2LSOA 1FOKA 1OYWA 2PFBA 5A2QZ 2NYXA 1FPQA 1HW2A 3HHGA 4B8XA 3V7RA 1G6NA 3ELKA 3ZMDA 3CO7C 4KUMA 5ICFA 1T2KA 4UHTA 3F8BA 3T0YA 2RNJA 4MQVA 3J7AO 1FY7A 2XAJA 1XN7A 3RKYA 3S2WA 3I71A 3FMRA 4KNYA 1FBQA 5KVRA 3BJOA 4AWXB 1KU9A 3QRFF 3W6KB 1J59A 5ICCA 2H27A 4YFXF 4RAYA 2WC2A 5D8LB 1REPC 3ECHA 5DUIA 3QPTA 2QVOA 4EV0A 2DQLA 4O5VA 2M5WA 3FF5A 4KIBA 1TNTA 3ECOA 3LQRA 1PP7U 4U0WA 5AONA 3E5QA 1AOYA 3LSTA 1I27A 1MDMA 4WXCA 4PDKA 1ZGJA 3C7JA 1P92A 2ZJ2A 3BZ6A 2O61A 2QQ9A 4UVAA 3L00A 3VOEA 2PQ8A 2DPUA 3TDUC 1KU7A 2NNYA 2A69F 2D45A 4HF1A 4HLYA 5E20A 1ZLKA 1MJAA 5CVIA 4L5IA 4N0BA 3BJAA 1CGPA 5BMZA 5CJ9A 5CVUA 3K2ZA 1WQ2A 4A0YA 5ILSA 5AIQA 3WTXC 3GXOA 4KIGA 2OU2A 2HKXA 3LAPA 3SZPA 4S04A 4HA8A 4S05A 4Q48A 3U2RA 4ZZDA 3C3WA 2R7DA 4ZZLA 1KYZA 3GWZA 4MHGA 4AIKA 3SZTA 1IRFA 3F3XA 5D4RA 2XAFA 4LJZF 4CZZA 2GXGA 2L01A 5E17F 4ESBA 2A61A 2FXAA 3QP6A 3F6OA 2CG4A 3Q9VA 2PLYA 4GYIA 1YW9A 2MD5A 2JT1A 1O3QA 1T39A 5H6RA 2EFQA 3F72A 1PDNC 2OQRA 2V9VA 4ESJA 1BM9A 1FWZA 1J7KA 3CJNA 5HOOA 2NAZA 3KLOA 1P6RA 3MCZA 4KT5C 5D6EA 5TRDA 1ZRDA 1T0FA 4G9YA 4LG0A 2PMHA 1O7LA 3QPHA 4M9XA 3SHFA 4KYWA 1OR7A 2F2EA 5F64A 1P4XA 1Z91A 5HVQC 1U5TA 1PUEE 3O6BB 3KEQA 4L0ZB 3WTVC 5HDGA 2COMA 3JSOA 1DDNA 4PCQA 3O2PE 3I59B 3GZ5A 1V3FA 4FHTA 5K5QA 4JQFA 2VODA 2BV6A 5E1XA 4KMUX 1WSUA 4Q5SF 4HZFA 1ONVA 1QPMA 1I6XA 1XGSA 4IPAA 1S7AA 3V8LA 2JPBA 1J5YA 1TW3A 1XMKA 4KICA 1FP2A 2XRNA 3H3UA 4KMFA 1TNSA 4CGZA 1ZARA 4HF0A 2ZMEA 1BN5A 2ZFWA 1XMAA 5D5WB 1R00A 1K7AA 2FBIA 4RGSA 2M30A 3LA3A 1ZRFA 2Z99A 1FYMA 4WWCA 1W5SA 2IT0A 4N9HA 4DQ2A 2V1XA 2LNBA 2L4AA 2YSRA 5CYVA 5E8IA 4MEXF 3K1PA 1H9TA 1ZAOA 3K1MA 2AXLA 5DCFA 5K5OA 1YS7A 2B0LA 2MH2A 1UB9A 1K78A 4A6DA 1SD7A 2MBFA 1F4KA 4OIPF 1DPUA 5FFZA 2QQAA 1ULYA 3EYIA 4ESFA 4LLGF 4Q4ZF 2PI0A 1T98A 2K7LA 4M74A 3IKTA 1W7PA 1IW7F 2YX4A 3TO6A 5ED4A 3JSPA 2QM3A 1HXDA 3FX3A 2JPCA 3E5XA 3IKVA 1U6GA 2QLZA 2LDUA 4A0ZA 3PQJA 1HKTA 3QP5A 2ISZA 2FNPA 4WX9A 1L3LA 1IN6A 3V8JA 2H94A 2EV5A 4RB1A 1B4AA 4M9ZA 1IUYA 3WU1B 4QWQA 1CF7B 5ICEA 3V7CA 2OA4A 4G7ZF 4AD9A 4YFKF 3RJPA 2A5YB 2CO5A 2DK8A 4OU0A 3T8TA 4EJWA 1CF7A 4HX7A 3KFWX 3QOPA 1O57A 4G7HF 1LDDA 3MFKA 4RGXA 2Y75A 2HS5A 3M8FA 2FRHA 2RV8A 4IVNA 2WV0A 2PEXA 3IWFA 1ODDA 5CLSA 3P9IA 1ZRCA 1VTNC 3FM3A 2HTSA 2V79A 3FMQA 2MC3A 2EFOA 3LFKA 1LB2A 1J0RA 2L4MA 1G3TA 3IRQA 1TQMA 1RUNA 1TW2A 4Y15A 2YPRA 2KJBA 2OZUA 3L09A 2LKPA 2XKPA 2GQQA 1B6AA 4GYGA 1IAWA 2DAOA 2DPDA 4EM0B 3E97A 3WG9A 2HTJA 2GA1A 2HYGD 1TTYA 2EWNA 1QZZA 1JHFA 5BS6A 1XSVA 3HRSA 1BI0A 1BC8C 3U9GA 3GF2A 1G4DA 2NS0A 4KN4X 3TKYA 3TQNA 1T38A 2XIGA 3TOAA 2F5DA 1MDMB 2EFWA 4LFUA 2HQRA 5E18F 4HV6A 1WWXA 1LDKB 1D8JA 3L2CA 5J8FA 2HGCA 3RPUA 2DLLA 4OOIA 2E7XA 3GFJA 2ELHA 3JTHA 4M73A 3LA2A 4RAZA 1BOAA 1U5TB 3TOBA 1R1VA 3ZP5A 4OIQF 2A68F 2HDCA 3CO6C 3I59A 2PG4A 4EJVA 3IHUA 4CHUA 2VE8A 4L5JA 1GXPA 2CQKA 4HQMA 3I5UA 3DQVC 2GWRA 3GZ6A 1FX7A 4A2UA 1HKQA 1XSDA 3BP8A 2A6HF 3DPLC 3TGNA 2LF8A 3BPVA 4HF2A 3I58A 3HIFA
chains in the Genus database with same CATH superfamily
2HXOA 2DJNA 1U9OA 2K4BA 4AVPA 2NRAC 1POGA 2W57A 2KQRA 2WAQA 1EH8A 1W36D 1Z6TA 4R1HA 3VYRB 4EATA 3H3VK 3ZQGA 3GFMA 2JUCA 4U88A 3VYUB 1WJ5A 1XD7A 3T8RA 4PUSA 2X1CA 5GAGJ 3QYBA 5LEKA 3JR9A 2XGXA 1HSTA 2EJRA 1ETOA 2CSOA 2HQ5A 3KE2A 1OMIA 1QHHD 1RC9A 2MH9A 3BDDA 3CCJI 5FB2A 2PX9A 4IRIA 1I1SA 3EYYA 2AXTC 3H92A 1IDYA 2DFEA 5F1JA 4I7HA 5EEHA 5F6FA 1FT9A 2HPMA 2MLGA 3R6SA 3REOA 2DQRA 5DCMB 2OD5A 4RDUA 2QQBA 3M1CA 2CV1A 5GAHJ 4G94A 3DV8A 5L3EA 3FHNA 3JCUC 4BXFA 3KP6A 3K9TA 2BYVE 2P4WA 1WKMA 4E7ZA 1FC3A 1OYIA 2PN6A 4BXXJ 4I99C 2VJJA 1KYWA 5DCMA 5AIPA 3PNVA 1D1CA 4XOPA 1RIOH 2LMDA 4XRSA 1OPCA 4LK1F 3OIOA 1QPIA 1OISA 2D1VA 2TDXA 3A2KA 2QSGX 2FU4A 1MH3A 1K78B 1LFBA 1PJRA 1DUXC 3QOEA 2A07F 2VI6A 5FKOA 3JRGA 5L3BA 5CVJA 3HOWJ 1IN7A 3PSIA 5EG0B 4JX6A 4FX0A 2X48A 1RRJA 1DPRA 3I0TA 3L7WA 2QYOA 4PK4A 2JUGA 1RKWA 1QO0D 4RA2A 2F4IA 2BZTA 4A3IJ 4KFCA 3HOUJ 2RNGA 3Q0VA 1USTA 1V54H 3ML6A 2COBA 2H6CA 1W7PB 2KHMA 4ZYDA 4ZYHA 2DODA 3B02A 4Q47A 1ZR4A 1VQ4I 1Z7UA 4PFPA 4CSWA 1PUFA 1VF9A 1I39A 2KRFA 2ZNZA 4ABZA 4D7MA 3WE2A 2A3SA 4BQNA 4L9TA 4LD5A 3MKYB 4IKFA 3LSJA 1P9QC 2X51A 3F21A 4W97A 3U1DA 1NH3A 1USSA 1ETXA 1YE9A 3GEZA 5DEQA 1QNTA 2F4MB 4LLLA 2HR3A 5F0HA 2E71A 2WADA 5CQEA 1PP8F 3M9AA 1JUMA 1Y8RB 2W85A 3A0BC 3M3YJ 2DJIA 3S2DJ 1W36C 2PJPA 3L2WA 1WJEA 5KNLA 3KZZA 5F04A 1R23A 4NC8A 4NHJA 4WXHA 3VB2A 3GMEA 4HDUA 5FLXK 4RB2C 1QVUA 2W24A 4HPQA 3JRHA 5L3DA 2VE9A 4U87A 3LAJA 5C4XJ 3ZPLA 3FZVA 3RIRA 2DK5A 2XKOA 1J75A 1ETWA 4AM3A 4IOCF 4N4NB 2EV6A 3GFLA 4W1UA 2ETHA 1GVJA 1ZGAA 1RR7A 1I3AA 3D5LA 3OYNA 3EQLF 4AYBA 3AKZA 2X6XA 1JKPC 3HHHA 4QLCU 3DU6A 4IHYA 2VC1A 3KP4A 3OYHA 4B47A 3FK7A 4B09A 2HXIA 1PVEA 2GOMA 3OYIA 3CCYA 3R0JA 2DCEA 3WU0A 4OIRF 3BTIA 3F8MA 4AIHA 3ZOBA 4IZZA 2D1HA 1HOMA 3WHBA 4F55A 2E1MB 3LOCA 2B63J 4BHBA 1ZG5A 1OCCH 1TT5B 3OOPA 1S8NA 3ZGKA 3SXYA 4YG2F 2YU9J 5HS8A 2ZNYA 3K69A 1BIAA 3UKGA 2JJ7A 4HLXA 2L2OA 2O3FA 1DGWY 3KETA 1UELB 2XROA 4IX7A 1JJ8C 2UWMA 1LEBA 3G71I 4E7KA 1ZREA 1D8KA 2LF7A 1SD6A 2OAZA 4KA4A 1BBYA 2K40A 1JKOC 1MBKA 1EKEA 3WGGA 4MTDA 1R7JA 2O03A 2VBWA 4RLFA 1ZELA 3E5UA 3E6MA 3KIOA 1LVAA 1YITI 2Z9OA 2CYYA 3WTTC 2LYCA 2Y0SA 2R5ZA 1TBXA 4ASNA 3K70D 3F22A 3G2BA 3ZMUA 2NNNA 4D9JA 4CCKA 1O7FA 4B43A 3LNQA 2EIMH 3GLLA 2PMZA 5HS7A 1J9IA 4XMYA 1Y0NA 3G4SI 1MKMA 2X0LA 1JE8A 2AHQA 2Y2ZA 1WVRA 2LKSA 5B5EC 1MIJA 2CW8A 2HDDA 1UCRA 1BR2A 2CH0A 2ICWG 3CLOA 3EDPA 1JKRC 4YRVA 2FA5A 3HEFA 2FOKA 2FOWA 5HLGA 1XSXA 1E3OC 4IQJA 2K9SA 1RZ4A 2ZCWA 3ABLH 2DU9A 3QAHA 2YX7A 1KZHA 1HQCA 2WAEA 3H0DA 4IO9F 4E7LA 1QBJA 4JOMA 3HRTA 4P96A 4LIVA 3ERMA 2A05A 3CCQI 2P5VA 2DYSH 4PJLA 3WGHA 1IJWC 3TP0A 4GCVA 1Z05A 2XF6A 3QU6A 4BJTA 1H0MA 1IN4A 4HYEA 2R7VA 4UVBA 4IF4A 3HZJA 4KIFA 2IBDA 2XSDC 1U8RA 3P9KA 2W48A 2P7CB 4A0XA 3KP2A 1OFCX 3S1RJ 4I6ZA 2K3PA 4LB6B 1IN8A 2EK5A 3TDZC 3LL7A 2KDZA 1VQ7I 2K86A 2OF7A 1BL0A 4DZJA 1D0ZA 3PO3J 2W4SA 2KISA 4A3LJ 2M2EA 1VNDA 4KN7X 4XL9A 3WTWC 3LSGA 4DNCA 3GO5A 3SEQA 2QA4I 3ZQ7A 1FMVA 5HODA 1N25A 2GBYA 4XOTA 4DJAA 4K2EA 1MNDA 2DBBA 3PL8A 4OAZA 1KQ0A 1D0YA 2P6SA 3CDLA 2PBIA 3CDHA 2LY1A 3OY9A 2DA2A 2R7WA 2WAQN 2MYSA 3ABTA 2EA4A 2Y0SN 2AS5F 4PGHA 3N97A 2ESNA 1QGPA 2XUBA 3HM5A 1HKSA 3HKZA 3MWMA 4CYDA 4R79A 4UV8A 2HQNA 2OZ6A 4D0PA 1BI3A 3OMYA 2R7SA 1GUUA 2RGVA 3SFZA 4OINF 4OIOF 2QEXI 1WPKA 2JRMA 5E1WA 2C6YA 2DXIA 5M5WJ 4HSTA 1ETQA 4Z6YA 4PJ0C 1FSHA 2ME6A 1JTXA 1LE8A 3CCEI 2G7UA 5IY5H 2Q0OA 3EETA 1MMDA 2XHKA 2UXXA 3FXRA 4AIJA 4QSHA 2FMYA 5IPAA 3L2QA 4F52A 2F5FA 2LOOA 1XG1A 2LKXA 1IRZA 2O0YA 3EUHC 1WJAA 3KP3A 4ZJZA 1U2WA 2L9SA 4U0VA 4CUGA 2DO7A 3OYKA 2GXAA 2CUFA 4HW0A 1E2XA 3VYSB 3QQAA 4FQGA 1SD4A 4OAYA 3BR0A 2DA6A 3E7LA 2Y31A 3FKIJ 4E70A 1O3TA 2QCOA 1BW5A 2X6OA 4P5OA 4G8XA 3K4KA 5BOXA 3QU3A 3VPRA 3S1MJ 1Z21A 5IT9Z 3FM5A 3I4NJ 3GTGJ 3BC8A 3OYEA 2EIKH 2WWYA 2I8DA 4EGZA 3SYTA 1T08B 3G6EI 2QZ8A 4RMNA 2M9HA 4Y7NJ 1R5ID 1Y0UA 3X2QH 3VODA 3I3LA 3RQ4A 2MFZA 2Z5UA 2KKOA 2EQRA 3KLNA 5J1YA 4EM2A 1GXQA 4HDVA 1UAAA 2VIXA 3K6GA 5D5UB 2TRTA 1QQIA 2E2HJ 3C1DA 3D5RC 1SFXA 5D5XB 2QQ8A 3BQYA 2ZXWH 4BBRJ 3BZCA 3PFYA 3V7SA 2NVQJ 1SD5A 2CJJA 1S7EA 3BROA 1KQ8A 2FSWA 3TO7A 3LSMA 5KHDA 3AAFA 3ZMVA 1BOBA 5KK1A 2FQ3A 3I54A 2IGKA 2HZTA 2O5RA 4UV9A 1B8IA 1F5TA 1XPXA 2ZXJA 3JTGA 1AKHB 1XGMA 3JRCA 2KLOA 4UNOA 2KZVA 5KAFC 1SVOA 3HYIA 4BQAA 3SJMA 1FIAA 3QODA 3NRVA 1B8IB 2AQEA 3BOQA 3ZR8X 4RM2A 1ZKGA 2VT2A 3LSKA 1YRNA 1STZA 1R9TJ 5L3CA 3ABUA 1HDDC 2ECCA 1R58A 3RPUD 3CUQA 3DFGA 1Z3YA 5FD6A 3GX4X 4ETSA 1I1GA 1QZYA 4XRFA 4EQQA 1JGSA 4XBFA 4G6TB 3FIWA 4ENNA 1OLTA 5E8GA 1BA5A 2BHYA 4CCNA 2M4KA 4XKBA 4HBLA 5IOYA 3DBHB 2Y30A 2OTLI 1IXRC 1V5EA 4IRHA 3FHZA 2V6CA 2Q8KA 3PNTA 3DXJF 2IJLA 3N05A 3MZYA 4PFOA 2GXBA 4Z2YA 3CQZJ 4UB8C 1NHAA 1QU3A 5FROA 3L1PA 4RB0A 3S8PA 4GO1A 4LMYA 2EBIA 2EINH 3G3ZA 1I3QJ 3MZHA 3RZOJ 2STWA 4CXFA 1AWCA 3J80K 2ZMEB 2DW4A 1IZ1A 3F8FA 2VBYA 3OIPA 4NB5A 2CUZA 5H6QA 1YI2I 3S93A 3ULQB 1XCBA 3M07A 2IGNA 1FMWA 1H9GA 3HTUA 2EZHA 4V2GA 3PO2J 1ZN2A 4N9IA 1XGNA 4EVIA 5FLXZ 4HQEA 3GTKJ 1GV2A 1LVKA 5CVRA 1XDSA 1WJFA 3OYMA 3JREA 1OCPA 3AG3H 1IRXA 3H36A 1W4MA 2IXSA 3OYGA 3WU2C 4CO8A 2R5YA 1YLFA 1G3WA 2EH3A 4LK0F 2M45A 3FISA 1WGXA 3BPXA 1ZTRA 4A93J 5JVTA 2FNAA 2FF4A 3IC7A 1AA7A 2KIFA 3BR2A 4GXOA 5D5VB 5IOZA 2R5YB 4BQOA 1UG2A 2STTA 1TC3C 5DDGA 3VSLA 3HXLA 4BU2A 1YFHA 3HPHA 2OTJI 5M5XJ 2IPQX 2XAGA 5J40A 2TCTA 2MG4A 4CCOA 4PZJA 4B44A 3BJ6A 4CZCA 4AU7A 4F7ZA 5LHHA 3IV5A 4ANJA 1HW5A 3TL4X 1MMGA 3ASOH 3V8KA 1K61A 1XGOA 1T8IA 1S7OA 2BGCA 2E34A 2P6TA 1VQNI 2RQPA 2IAIA 4RGUA 4PGGA 3ZRGA 1WHUA 2XGDA 1FOWA 4A3JJ 4A3MJ 1PUFB 2V1UA 2CFXA 4YIIA 2ZKZA 2HVRA 3PQKA 3GUDA 5IT3A 2HU9A 3JW4A 4IHXA 1U5TC 1B72B 3PSFA 1TWFJ 2KFDA 3GZNB 2A6EF 3CMYA 2K5CA 1HCRA 2CFOA 2VONA 4CA0A 1KU2A 3OS0A 4G6QA 4F92B 1I5ZA 1KGSA 3DKWA 3C2BA 4XLPF 3F23A 1FOYA 3KCCA 1B72A 2IGMA 4XSZF 1QRYA 2Q1ZB 5HLTA 2KL4A 4HRIA 3E1SA 3TW7A 2LY9A 3I53A 4L18B 3M7GA 3QPSA 4C2UA 3C2HA 4GDFA 3KZYA 4M9SA 3VFZA 2OCCH 4IXAA 2M3AA 4HG2A 4UUVA 2IA1A 2R3SA 3GBGA 3BR1A 4DBRA 3FMSA 2L54A 2ZBKA 2J5OA 2RC4A 2VPRA 3CTAA 4LGWA 2VJIA 3RDIA 1LJ9A 4XLCA 3EPZA 1S72I 1P4WA 3CDIA 5EEAA 3KZIC 1I6HJ 2KIUA 2EV0A 3L9FA 3ROUA 2W00A 1E17A 2XAHA 2R7FA 1QA6A 3VSKA 3VEPA 4NC6A 5FO5A 4ON0A 3LSPA 3JAMZ 2M0MA 3CUQC 4IQ4A 1HDPA 3HB9A 4II2A 2IS4A 4JK1X 1ON2A 2H8WA 2L3DA 4XNFA 2V1DA 3WTUC 1Y39A 4AVZA 1SVMA 5C44J 3CCMI 2JA6J 5E79C 1VQPI 2M8GX 4MGRA 1ETVA 2Y48A 5K1YA 4RS8A 1U3EM 3OYBA 2W84A 1JT6A 5KAIC 2OUMA 3NEUA 4UXNA 3ZN0A 5LLQA 1LQ1A 1S5LC 1QZEA 3QWLA 3G73A 1OCTC 2BE5F 3SQNA 3SZGA 3GLXA 1P2FA 1W7PD 4BNCA 1DGRM 1J09A 2Q2EA 1SAXA 1TQIA 1EH6A 4H0EA 1YJNI 2HOTA 2HVSA 1R36A 2ZB9A 3HRMA 3ZXSA 3IP4B 2K85A 4M6XA 3K1NA 1MGTA 1F9NA 2M4GA 2P7VB 2Q2EB 2A6TA 5ILUA 3A01B 2JA7J 1HW1A 3OWTA 3WG7H 4HOBA 1BJAA 1U78A 5L3FA 2RQQA 4PJJA 4XLNF 2IRFG 3B6AA 3M1EA 5LHGA 4ZTJA 5ERIA 1FEXA 5E3LA 4BGDA 3BTCA 2VXZA 3BY6A 2UUZA 3FXQA 3A01A 4P9UA 2H6BA 4J01A 4XKCA 2HPIA 1TWCJ 1Y8QB 3DP7A 5FGMA 2FQ4A 1JGGA 1N75A 3Q9SA 2DMPA 3L2VA 5BNGA 2CWEA 3H9QA 5JI6A 1K6OA 2EFPA 4OMZA 3A03A 2LVSA 4L9NA 2MSYA 4XSXF 2HEOA 3HDDA 4XN0A 1LFPA 1B9NA 1X4OA 3O8GA 2E35A 2HI3A 1U9NA 3OYAA 4CYCA 2DOFA 2QENA 5J1RA 1ZHFA 2NOJB 2QKMB 4EJTA 2HVQA 2E7WA 3A1YA 1FZPB 1O3RA 3FXMA 1Q1HA 4I98B 5C4JJ 2ZJPF 6PAXA 1XDUA 4Y17A 2X6WA 4I0BA 2BBYA 2GM4A 4HNUA 2BY3A 2O6GE 3BWGA 3WTSC 4DYCA 2KT0A 4ENMA 4FCYA 1RNLA 5GPAA 2MW8A 1DP7P 3GTMJ 2BY0A 5HLHA 2M7BA 4M3EA 4BDZA 1FOXA 2K3FA 2FBHA 4XM3A 5J47A 1KU3A 3COAC 2LFBA 3FXJA 4ZYEA 4BH9A 4EJOA 1JHHA 1DP3A 3HGGA 2VKVA 1Z9CA 2GOXB 4CICA 4FTHA 2V9KA 4EEFG 5DS9A 2DI3A 2YR2A 3IWZA 3RTRA 3WTYC 4IHTA 3PUFA 2DDAA 2P8TA 2LBFB 5J6XA 4C3HJ 1V4RA 4UUSA 3UNGC 3BTLA 1ZQ3P 1A04A 5LGTA 4RB3C 1O4XA 3V42A 5ICGA 3K7AJ 1Y6IA 3J81K 4I76A 3EUHA 4MO7A 4RLQA 3I55I 1A35A 5JR3A 1MNEA 4TV7A 4WK8F 4B48A 2HWVA 2X4HA 3RSNA 4O3MA 5DUKA 1MBJA 2LG4A 1YHQI 5J4VA 2RKHA 2M1BA 4WCGA 3F8CA 1B9MA 4I02A 3N4MA 2ZSIB 1BI2A 2DMUA 4A3KJ 2AQFA 3D0SA 1YRNB 3DWLE 3PIPF 2QWWA 2VL8A 4L9VA 1T0FC 3CUQB 2XB0X 2XASA 5E1ZB 3DLLF 1S9HA 2EB7A 2O9LA 4AC0A 3ABMH 3B73A 5D8KB 4R8HA 5FD5A 1Z1DA 5BQTA 1V5FA 4E4HA 2ZC2A 3J80Z 2VJ4A 3TEDA 4EJUA 4F91B 1FSEA 4OMYA 1X1PA 2ACJA 2ZFUA 4ZC3A 3KYLA 3K0LA 3C2GA 5FLMJ 1BI1A 2BVMA 2XGEA 3H0GJ 2GIVA 3I64A 2YU3A 1YO5C 5J8CA 5F1RA 3BT9A 5H20A 1HSJA 1XB4A 3P7NA 1UJ8A 2P0WA 4I01A 4MTEA 1SC7A 4G7OF 5JHUA 5FKMA 3ZN1A 5DD8A 2BEOA 3WODF 2LP0A 3ZQIA 2IVMA 3LWFA 1P4AA 2K4JA 5F27A 3GTLJ 3LQQA 4L5EA 2XVCA 4Y13A 2HOAA 1JJ6C 2O8XA 2LTPA 5LEJA 5EJCA 2FMLA 3IUOA 1W5TA 5BPDA 1WRJA 3DBRB 1OYYA 4X0GA 2BW3B 2VBZA 2M34A 1MNMC 2GA2A 5E3OA 2VLAA 1G2HA 5B3SH 2GLOA 2WY7Q 5F08A 4LLNA 1O3SA 4B4CA 3RYPA 2VBXA 2ZJQF 4XONA 4JX5A 3S32A 1FJLA 1RUOA 3CF5F 1Y1WJ 3HOZJ 2IA0A 2E1CA 1YS6A 2MA3A 4BACA 3JAMK 2QSHX 1RKTA 1YIOA 1GV5A 1IF1A 1APLC 4HAMA 3U1KA 5IYBJ 2CQXA 3CMAI 4IHSA 2QGUA 4BKXA 3H5NA 3NAUA 1DQUA 1MBEA 3IH2A 4BS9A 3RKQA 4EGYA 3OSGA 2HKOA 1G59A 2JQ7A 1ACIA 4DYQA 1WJBA 5DYMA 2RN7A 5EYRA 1WJDA 4YIFA 2K27A 2DT5A 4GGGA 2GAUA 2HYFA 4IOAF 4I09A 2DN0A 1AKHA 3PFIA 3OV8A 1R5HA 1N78A 2EIJH 4O6JA 2NVYJ 3CC7I 3W2AA 3FK6A 4Y33A 4E7JA 1U8BA 3S17J 2X85A 5CVVA 4MFDA 3MEXA 3BG7A 2XV4S 2LK2A 1MJ9A 1A6IA 1RI7A 1YW8A 4HEA2 2Z3YA 4BHCA 1IXSB 2EZKA 1ZLJA 3J7ZI 2VKHA 1EJ9A 3R4KA 3J7AY 1IXCA 1WI3A 1D3YA 3OS2A 4ZTFA 4XLFA 3R60A 3OR2C 2Y9YA 2K02A 2GIZA 4RGRA 2X1EA 4QPQA 3LA7A 5LRRA 3TBIA 1LNWA 4OWRB 1F1ZA 3C18A 4M6YA 1B1BA 4BE1A 1SFEA 5B66C 1G3YA 2QF7A 3S14J 1D5VA 1HBXG 4NQWA 2OQGA 4XLHA 4XR6A 1JKQC 3HSFA 3P9CA 1YQAA 3R61A 3GTOJ 4X6AJ 4DZPA 2Z33A 5JLXA 4M6VA 3ZQQA 1SAUA 3OYCA 3TP3A 4NQWB 1JT0A 5JLWA 1SMTA 4V2FA 4XRSG 3CUOA 1H89C 3HSEA 5CPRB 2JK3A 3VYTB 2VT3A 2Y0MA 3KEOA 3PJRA 3HUGB 3NWTA 1R1TA 2LLKA 4MQ9F 5TJJA 5DV5A 3HGYA 1ZG1A 5LBQA 3ZMSA 2CS3A 2DTZA 2MD0A 2ID3A 2EFNA 3GFIA 3ERED 1R1UA 5JVGF 1YTYA 4L9JA 2EA2A 1LDJA 1C0WA 3RKXA 3HUGA 4KDPA 3W6JB 2R92J 3T5XA 5K7ZA 5M5YJ 3O3KA 1XCVA 2XPVA 4BHPA 2KRHA 2DA4A 1VQKI 2QUFA 2K9QA 1IC8A 4EM1A 2V7FA 3WE3A 4LOCA 5FKLA 3CLQA 5HLIA 2KIMA 1TLHB 4A5NA 2UXNA 5LRSA 2FE3A 4M72A 1BIBA 2BY1A 3WHCA 3M8EA 3GVAA 2VN2A 4HX8A 3ZMZA 1MSEC 1UZCA 2F5EA 4RBOA 1MZBA 1J2XA 1FBSA 2F5CA 3IH4A 3RPQA 1EH7A 2DFIA 2IP2A 1ERDA 2CW0F 3E6CC 1FP1D 3BR3A 4QIWN 1YIJI 3HOVJ 4HV5A 5ILVA 3HOTA 2IS1A 2DT6A 4WXDA 3AFHA 2E60A 3GW2A 1G3SA 3A0HC 4BAYA 5HDKA 2M7AA 4BXUA 2E36A 4YFNF 1XMXA 4U7DA 1LEAA 1HLVA 3TMOA 3BZKA 3MQ0A 2ZMEC 2L5QA 1EF4A 2WTEA 3HOSA 4AUXA 2V4JC 1IN5A 2HFHA 5EF6A 2CGPA 4CCMA 3CMEI 2IS2A 1R5GA 3GTJJ 3FBIB 1BC7C 3SEZA 1MD0A 1Z77A 3F8NA 2JSCA 1A6QA 4ENKA 5F0FA 5FFXA 4MEYF 3CCUI 5DD4A 5D6FA 3HTSB 3KP5A 5FKNA 3SDGA 5C3EJ 4LIUA 2HOEA 3CF2A 1YYVA 5GAEJ 4A3DJ 2JZYA 1TWGJ 5DM6F 4CYCB 4IJAA 2VJ5A 3E3VA 2PMZN 1MW7A 3VDXA 2PMUA 4HX4A 2O7OA 3CCSI 1FYLA 5D4SA 1WI9A 3AG2H 1VFCA 2LY2A 2FBKA 2KJCA 2ID6A 3RYRA 2P81A 2B9SA 2DYRH 5LGNA 3J81Z 2MC4A 1X4PA 2ISYA 3NQOA 3JRFA 2BY2A 2B7EA 2DMQA 3LMMA 5CQGA 3S16J 2W25A 1SFKA 1FBUA 2FEZA 1T56A 5EZHA 1S3JA 2D2WA 4FX4A 2M87A 4A5MA 2H8RA 1SFOJ 3K4BA 4EMSA 3K4CA 3H5RA 1S29A 4XIDA 1OCRH 3JRDA 3BLYA 3H3ZA 4E7HA 4IRGA 4G6DA 2RVCA 3DU5A 2J5PA 3MKWB 4DYRA 2VQLA 2VB6A 3Q0WA 2D5VA 3H35A 2ADUA 5K5RA 1M1EB 3H9JA 1YG2A 2OCEA 1OKRA 4P55A 2P5KA 3D5SC 5HDNA 4XKWA 5GTIC 4A6EA 2NOGA 3MAJA 2WB1N 3W6VA 2L7KA 3LSIA 1ZH5A 1UHMA 3MZ8A 1UFMA 2WV1A 1X1CA 3F6VA 4DBQA 1XS9A 1SFUA 4XLEA 1OR7C 2OV7A 5LHIA 3LSRA 1PYVA 1ON1A 4X1EA 4XQFA 3FXUA 4BQQA 2R7TA 4BYYA 1Z3XA 1ZGWA 3OSFA 4UUTA 5J1UA 4U0YA 5JFRA 3CJQB 5IP6A 1GHCA 3CP8A 1R22A 2JVHA 4WF2A 2NVTJ 3J7YJ 5L3GA 2UZKA 3FKJA 3DEUA 2KP6A 1MH4A 3Q0UA 3GTQJ 2LRDA 2RDPA 3M8JA 1JUPA 1P7IA 3G1MA 4ZH4F 5EEGA 2Y69H 2OBPA 2DDBA 3I4PA 1KQ9A 2XAUA 3MVPA 2V1NA 2IW5A 1SMYF 1VQ8I 3DKYA 2VC0A 3GYHX 3G1OA 2VOOA 3BG3A 4LG0B 3OIQA 3EUAA 5LGUA 2L7FP 1UG0A 5IT9K 5BPIA 5FRMA 1JUSA 2JRTA 3IL2A 2KDOA 3DPTA 1IRGA 1YW7A 1MJBA 3JRAA 1FNNA 3HSRA 1T6SA 1K4SA 1MMNA 1FYKA 1FLIA 3E6BA 2JTVA 2O8KA 3TO9A 1OCOH 1EV7A 1K79A 3PM1A 5EGOB 4D5FA 3HRUA 4MNUA 2E2IJ 2E1NA 3CCVI 3IRRA 1ZYRF 4P9FA 1TQPA 1XTAA 2NXNB 2P5LC 2WY8Q 3WGIA 2VQGA 2L02A 2ELJA 3DF8A 1DU0A 2VOPA 2QBYA 2WAFA 5HS9A 4C2MJ 1KA8A 1JXSA 4FE7A 2IA2A 4RAGA 4CDGA 2GZWA 1L0OC 1OCZH 1TT0A 4L0YB 1Z0XA 2M8EA 4A3EJ 1S6LA 1SVLA 2G9WA 3E6DA 3BCBA 1UHWA 5FKKA 3RKWA 4J19A 2QBYB 4ZYGA 2LH9A 5HNFA 4JBAA 2ESHA 1WCMJ 2F6CA 3CZ6A 1VQLI 2M0CA 2XRLA 3PUBA 1ZG3A 1YJWI 4JX4A 3FWEA 3R0AA 4M71A 3V4GA 3BTJA 4KJZA 3RI4A 3Q5FA 3DPUA 3WTZA 2XAQA 4I0AA 1MBFA 1JTYA 2YUSA 4P1WA 2HNHA 1WJCA 2ZO4A 3T1BA 1WH5A 2DTRA 3ESWB 3I9V2 3ZMTA 4D7NA 3ISPA 3MD2A 4DGWB 2MLKA 4A12A 1B59A 3DTIA 1K83J 4U7BA 1BJZA 3BR5A 1TWAJ 2CU7A 1RR8C 2DA5A 1IV6A 1Z6RA 4C3JJ 3BCAA 2NVXJ 1X3UA 2X9DA 4RM3A 4ENJA 1MMSA 1X19A 4FT8A 4UVCA 5A2QK 2E1OA 2H09A 3KP7A 4I2OA 4LB5A 2CMPA 2LSOA 1FOKA 1OYWA 3KEYA 2PFBA 1EA3A 1V5GA 5A2QZ 1QHGA 2ME0A 2NYXA 3ZQCA 3FXKA 1FPQA 1AU7A 4XK4A 2DA3A 1X1BA 5M3FJ 1HW2A 3HHGA 2VKEA 4B8XA 3V7RA 5TISC 3H9GA 1R71A 2R5ZB 1V55H 1G6NA 3ELKA 3ZMDA 3CO7C 1FIPA 4KUMA 5ICFA 4N4OB 1T2KA 2E1MC 3W2WA 4UHTA 3F8BA 4BJ5C 3NARA 4LG3A 1T95A 3PNYA 2X1DA 1E3HA 4HF2A 3CCRI 3T0YA 1LUJB 2RNJA 3RCOA 4MQVA 2IGOA 3J7AO 3S1NJ 5KCMA 1AHDP 4PSXA 1FY7A 3FDYA 4KITB 3SDBA 4B1RA 2XAJA 1XN7A 3RKYA 2ZXIA 3RQIA 3S2WA 4IHVA 3A02A 3I71A 3FMRA 3DEEA 2PJRA 1K4TA 4KNYA 4JP0A 1FBQA 5KVRA 4BJ6C 1VZ0A 3KYDB 4QTRA 3F9KA 1LPQA 3BJOA 4AWXB 1KU9A 3TW6A 3QRFF 3DLAA 3W6KB 1J59A 5ICCA 2H27A 2G0EA 4YFXF 5EDNA 2JWTA 2R0QC 4RAYA 2L9NA 2WC2A 3OL4A 4H4KC 3IAS2 5D8LB 1REPC 1D0XA 3ECHA 4M3DA 5DUIA 2X6YA 4XLAA 3QPTA 2QVOA 4Y3OA 1A31A 4EV0A 2R7ZJ 2DQLA 4O5VA 2M5WA 1SEUA 3FF5A 5F0CA 5B1BH 4KIBA 1TNTA 4DOZA 2DOAA 3ECOA 3LQRA 1PP7U 4U0WA 5AONA 3E5QA 1X2MA 2CQQA 3K4NA 3RZDJ 1AOYA 3LSTA 1I27A 1MDMA 1TL8A 2NS8A 3OR1C 1I50J 1TP4A 4WXCA 4BL0B 4PDKA 4NC7A 1ZGJA 3C7JA 1P92A 4BDYA 2ZJ2A 3BZ6A 3D1NI 2O61A 4HNVA 2QQ9A 2HYJA 4HNTA 4UVAA 1A5JA 1T33A 3L00A 4ITVA 1IGNA 2HZDA 1TZLA 1VQ5I 3VOEA 2ECBA 2PQ8A 2R4GA 5EZGA 2DPUA 3TDUC 1KU7A 5IYCJ 1W0TA 5GPCA 3CD6I 4A3BJ 2NNYA 1HC8A 1F36A 2A69F 3KYCB 3ABKH 3I56I 1WFXA 2FD5A 2VQCA 2D45A 3MKLA 4HF1A 2JA8J 1NK3P 4HLYA 2VUMJ 5E20A 1ZLKA 3JRIA 2K9LA 1MBGA 1MJAA 3LSHA 5CVIA 3ZQFA 4L5IA 2OJED 4N0BA 4A3CJ 1A36A 1E3PA 2JA5J 2MGQA 3BJAA 1CGPA 4XRMA 5CJ9A 5BMZA 5CVUA 2JVGA 3K2ZA 1WQ2A 4A0YA 3H1CA 5ILSA 5AIQA 3WTXC 1YJ9I 4ZDOA 3GXOA 2DMNA 2VQHA 4V19K 4KIGA 2VXDA 2OU2A 2HKXA 4BE2A 3LAPA 3SZPA 4M3BA 4S04A 4HA8A 4A3GJ 2A5WA 4S05A 1N77A 4Q48A 3I58A 2MABA 3QYEA 5TGTA 2XPWA 3U2RA 4ZZDA 1RPWA 2N8GA 3C3WA 2R7DA 4ZZLA 3FXOA 1KYZA 3GWZA 1UMQA 1NG6A 4MHGA 3HOYJ 4PJNA 3OYLA 4AIKA 2LREA 3SZTA 2DA1A 1IRFA 2I10A 2KIQA 3OS1A 3F3XA 5D4RA 1YOVB 2Y9ZA 2XAFA 3PIOF 5H2FC 2NS7A 4LJZF 1QVTA 2E5ZA 4CZZA 4XICA 2VKDA 2GXGA 3NWSA 2L01A 4JYKA 2XDVA 4LITA 4C2TA 5E17F 2L0KA 4ESBA 2A61A 2FXAA 3QP6A 4IHWA 3CC2I 3F6OA 2CG4A 3Q9VA 5IP9J 2PLYA 4KISA 4GYIA 1YW9A 2L7MP 2MD5A 2WBMA 2DOEA 2JT1A 3S15J 4DW6A 1NTCA 1X3ZB 5E3MA 2L9VA 2XGCA 1O3QA 1T39A 3L2RA 5H6RA 2EFQA 1X1AA 5CKTA 3HG9A 1IG7A 2RREA 5GTHC 3F72A 2CUEA 4D5CA 2BHZA 1PDNC 2OQRA 2V9VA 1W0UA 2VPLA 4ESJA 1E0EA 1ETKA 3MMYB 1BM9A 1X3WB 1FWZA 1J7KA 4FETA 2R7XA 3CJNA 5HOOA 2NAZA 1NG7A 3KLOA 2FX0A 1P6RA 3CJTB 2H1LA 1FTTA 3MCZA 2HDWA 4KT5C 3Q3SA 5D6EA 5TRDA 1ZRDA 1T0FA 1G8XA 4ZYAA 2HOSA 4G9YA 4LG0A 2PMHA 1O7LA 2H1KA 2R7UA 3LFUA 3QPHA 4M9XA 3SHFA 4KYWA 1OR7A 2F2EA 5EG0A 1IO2A 5F64A 3GTPJ 1P4XA 1Z91A 3IAM2 4B3AA 2QKLB 2BXZA 4BUPA 3DTKA 5HVQC 3K4JA 1U5TA 1H88C 2ELKA 1RETA 1PUEE 3O6BB 3I4MJ 3ZQHA 3KEQA 4L0ZB 3DKXA 4B3XA 3WTVC 5HDGA 2COMA 3JSOA 5IYDJ 1DDNA 4PCQA 3O2PE 4E7IA 3I59B 3S3OA 1GT0C 3L2UA 2LR8A 2LD5A 3HBLA 3GZ5A 1V3FA 2R7RA 1W5CC 1R6RA 4FHTA 4BEHB 5K5QA 1GDTA 1SANA 4JQFA 2VODA 2WB1A 2BV6A 2DFHA 2F4OB 3B6CA 5E1XA 4KMUX 2BOLA 1WSUA 4Q5SF 4HZFA 1ONVA 1FTZA 1QPMA 2R7OA 1I6XA 1XGSA 4IPAA 1WZ2A 1S7AA 2RAEA 3CESA 3V8LA 2JPBA 4AIDA 1MSFC 1J5YA 1TW3A 1XMKA 4KICA 1FP2A 3HKZN 5J4YA 2XRNA 3H3UA 1LFUP 4GFBA 4KMFA 2QSFX 2XF7A 1TNSA 1U0JA 4F93B 1X58A 1ZARA 4M3GA 4CGZA 4HF0A 5K7FA 1D1AA 4UUSB 2ZMEA 5M3MJ 1H8AC 1BR1A 1BN5A 2ZFWA 2IS6A 1XMAA 2R93J 5D5WB 1R00A 1K7AA 4YIRX 2FBIA 4RGSA 1ITYA 4MIMA 4XN3A 2M30A 1HF0A 1CQTA 2VASA 3LA3A 1D1BA 1ZRFA 1X1DA 2Z99A 1FYMA 4ZDLA 4WWCA 1W5SA 2W1OA 2IT0A 4N9HA 4DQ2A 2V1XA 2KZGA 3OYDA 2LNBA 3BQZA 2L4AA 2YSRA 5CYVA 5E8IA 4MEXF 2ZXHA 1Z7LA 3K1PA 4II3A 5GADJ 4A69C 1H9TA 3G1LA 1ZAOA 2LC2A 2AXLA 3K1MA 3K2AA 5DCFA 5K5OA 1ZR2A 4PSWA 4CH7A 2CQ7A 1YS7A 2B0LA 3CP2A 2MH2A 3AL0B 1UB9A 1K78A 4NUBA 2E5NA 5LD2C 4A6DA 1X2NA 2CUJA 1SD7A 2NVUB 1KONA 2JMWA 3S3MA 2MBFA 4QPOA 1F4KA 2CQNA 4OIPF 1ORKA 1DPUA 5FFZA 4CCLA 2QQAA 3VWBA 1ULYA 3OYFA 3EYIA 2FJ1A 2DT7B 2JN6A 4ESFA 4LLGF 3OL3A 4Q4ZF 2PI0A 3QPLA 5EGOA 4XORA 2W7NA 1T98A 1ETYA 2DA7A 3HJEA 1VQ9I 4BY1J 2K7LA 4M74A 3IKTA 4RAFA 3BG9A 1W7PA 1IUFA 3ONQA 1IW7F 3S3NA 1DU6A 2YX4A 5IP7J 3TO6A 5ED4A 4FE4A 4CCJA 2WA0A 3JSPA 3DBLB 3DEWA 2QM3A 2Z2SB 1HXDA 3BR6A 3FX3A 1NK2P 2JPCA 3E5XA 3CCLI 3IKVA 1U6GA 1IV8A 4S0HB 2QLZA 2BW3A 2LDUA 4A0ZA 2FUG2 3PQJA 5GP9A 2PJRB 1HKTA 2CW7A 4MFEA 3QP5A 2ISZA 2FNPA 2V26A 3AG1H 4WX9A 3K10A 2YS9A 1L3LA 1GVDA 1Y56A 4YELA 1IN6A 2E19A 3U21A 1R4NB 3V8JA 2H94A 5DTDA 3DTEA 2EV5A 1Y1VJ 4RB1A 1B4AA 1W1WE 4DIQA 1HA8A 4M9ZA 3HOXJ 3WU1B 4A3FJ 4QWQA 1CF7B 1IUYA 3AL0C 1P7JA 4XKVA 2JSPA 5ICEA 3ASNH 3V7CA 1D5YA 2OA4A 4YEJA 4G7ZF 1BW6A 4AD9A 4YFKF 2OPTA 3RJPA 2A5YB 2CO5A 2DK8A 4OU0A 3T8TA 4EJWA 1CF7A 5HNHA 3P5JA 4AYBN 4HX7A 3KFWX 3QOPA 1O57A 4G7HF 1LDDA 4D1QA 3MFKA 4RGXA 2Y75A 2CRGA 3EUKL 3K70C 2HS5A 3M8FA 4BE0A 1BR4A 2FRHA 2V9PA 4HSRA 1LKXA 3K4MA 3KPHA 2R7QA 2RV8A 4IVNA 2WV0A 2PEXA 3IWFA 1ODDA 5CLSA 3P9IA 5FJ8J 2Z16A 1ZRCA 1VTNC 3FM3A 3HL2A 2HTSA 2V79A 3FMQA 2MC3A 1XX5A 2EZLA 3CJRB 1OJLA 3K4LA 3FBNB 2EFOA 5B1AH 1UHSA 3W2VA 4FASD 4FISA 4UB6C 3LFKA 4NBQA 4C9YA 1Q1VA 4MLOA 3GCMA 1LB2A 1J0RA 2L4MA 5FRNA 1G3TA 3IRQA 1ENHA 3UR3C 1TQMA 1ZK8A 1RUNA 9ANTA 1TW2A 4Y15A 1VQ6I 2F48A 2XB5A 2YPRA 2KJBA 2OZUA 3BG6A 3L09A 4BY7J 4G12A 5JHFA 2EZIA 2LKPA 2BXYA 4C3IJ 1LE8B 1MMAA 4UY8I 3F0CA 4J00A 4Y4RA 3ZQLA 2GQQA 1B6AA 2XF5A 2KMUA 4GYGA 1IAWA 2F5VA 3IH3A 2DAOA 2DPDA 4EM0B 3E97A 1WH7A 4E6KG 3WG9A 2ZJRF 1F43A 2HTJA 2GA1A 2HYGD 3W3CA 4E7SA 4BBSJ 1TTYA 2EWNA 4GRIA 3AG4H 1Z67A 1QZZA 1JHFA 5BS6A 1IDZA 1XSVA 2K9MA 3HRSA 2V6EA 3M4OJ 3S1QJ 2E2JJ 1BI0A 1BC8C 3CMMA 3U9GA 3GF2A 5LFAA 1MBHA 5E3NA 5FLVA 2L7ZA 2OC6A 2NS0A 3MKZA 1G4DA 2HQAA 3H5AA 4KN4X 3TKYA 3TQNA 1XC5A 2ZSHB 1JI8A 3DCFA 2XC7A 3SFIA 2K9NA 2CV2A 1T38A 2DMTA 2IEKA 2XIGA 3TOAA 3JRBA 1YX5A 2JA2A 2F5DA 1MDMB 2XPUA 4Y52J 3KX2A 5DM7F 2EFWA 4LFUA 2HQRA 2CV0A 5E18F 4F3QA 4HV6A 2LBFA 2EPFA 1RESA 3OOUA 4IL6C 4KT6A 2EILH 1WWXA 5J3LA 4C30A 1LDKB 1D8JA 3O8HA 3L2CA 5J8FA 2L9RA 4ZDPA 2HGCA 3RPUA 2DLLA 4OOIA 2E7XA 3GFJA 2Z1DA 1R4MB 1TWHJ 2DFFA 2ELHA 3JTHA 4M73A 3LA2A 4RAZA 3HPGA 1BOAA 2XSJC 1U5TB 3TOBA 1R1VA 4NNJA 3ZP5A 2AO9A 4OIQF 3A4CA 2A68F 3CO6C 2HDCA 1VQMI 1VI0A 3MN2A 1OQYA 3I59A 3S2HJ 3OYJA 3HC7A 2BVLA 2PG4A 5K7HA 4EJVA 3FXLA 4BEHA 3ZCOA 3IHUA 4CHUA 2VE8A 1R49A 4NDLA 4IEJA 4L5JA 3CC4I 4M3FA 1GXPA 1K6YA 2CQKA 4HQMA 1GLNA 1VQOI 2UV1A 3E0JB 3I5UA 1YX3A 3DQVC 2GWRA 3GZ6A 1FX7A 3QYFA 2KRCA 1HKQA 3BP8A 2A6HF 3BG5A 3DPLC 4PJMA 3TGNA 4A2UA 1XSDA 2LF8A 2KPMA 3BPVA 2XKPA 2I5UA 2G7HA 3HIFA 2W82A
chains in the Genus database with same CATH topology
4AVPA 2K4BA 2NRAC 2W57A 1EH8A 1Z6TA 4R1HA 3GFMA 4U88A 1XD7A 3T8RA 5LEKA 2XGXA 1HSTA 2EJRA 2CSOA 3KE2A 1OMIA 2MH9A 3BDDA 5FB2A 4IRIA 1I1SA 3EYYA 3H92A 4I7HA 5EEHA 5F6FA 1FT9A 2MLGA 3R6SA 3REOA 2DQRA 5DCMB 2OD5A 2QQBA 4G94A 3DV8A 5L3EA 3KP6A 3K9TA 2BYVE 2P4WA 1WKMA 1FC3A 1OYIA 2PN6A 1KYWA 5DCMA 5AIPA 1RIOH 1OPCA 4LK1F 2D1VA 2TDXA 2FU4A 1K78B 1DUXC 2A07F 5L3BA 5CVJA 1IN7A 4FX0A 1DPRA 3I0TA 3L7WA 2QYOA 1QO0D 4KFCA 1USTA 3ML6A 2H6CA 1W7PB 4ZYDA 4ZYHA 3B02A 4Q47A 1Z7UA 2KRFA 2ZNZA 3WE2A 2A3SA 4L9TA 4LD5A 3F21A 3U1DA 1USSA 5DEQA 3GEZA 1QNTA 4LLLA 2HR3A 1PP8F 3M9AA 2W85A 2PJPA 3KZZA 1R23A 4NHJA 4WXHA 3VB2A 4HDUA 5FLXK 4RB2C 2W24A 5L3DA 2VE9A 3LAJA 3ZPLA 3FZVA 3RIRA 2DK5A 2XKOA 1J75A 2EV6A 3GFLA 2ETHA 1GVJA 1ZGAA 3D5LA 3EQLF 3HHHA 4QLCU 2VC1A 3KP4A 4B09A 3R0JA 3WU0A 4OIRF 4AIHA 3F8MA 2D1HA 4BHBA 1ZG5A 3OOPA 1S8NA 3SXYA 4YG2F 5HS8A 2ZNYA 3K69A 1BIAA 4HLXA 2O3FA 3KETA 2XROA 2UWMA 1LEBA 1ZREA 1D8KA 2LF7A 1SD6A 2OAZA 4KA4A 1BBYA 3WGGA 4MTDA 1R7JA 2O03A 2VBWA 3E5UA 3E6MA 1LVAA 2Z9OA 2CYYA 3WTTC 1TBXA 4ASNA 3F22A 3ZMUA 2NNNA 1O7FA 5HS7A 1J9IA 1MKMA 2X0LA 1JE8A 1UCRA 3CLOA 3EDPA 2FA5A 5HLGA 2FOKA 1XSXA 2G7HA 1RZ4A 2ZCWA 2DU9A 3QAHA 2YX7A 1HQCA 1QBJA 3HRTA 4P96A 2P5VA 3WGHA 4GCVA 1Z05A 3QU6A 1H0MA 1IN4A 4HYEA 4UVBA 4IF4A 4KIFA 1U8RA 3P9KA 2P7CB 4A0XA 3KP2A 4LB6B 1IN8A 2EK5A 3TDZC 2K86A 4KN7X 3WTWC 4DNCA 3GO5A 3ZQ7A 4K2EA 2DBBA 1KQ0A 2P6SA 2PBIA 3CDHA 3ABTA 2EA4A 2AS5F 4PGHA 3N97A 2ESNA 1QGPA 2XUBA 1HKSA 3MWMA 4CYDA 4R79A 4UV8A 2HQNA 2OZ6A 4D0PA 1BI3A 2RGVA 3SFZA 4OINF 4OIOF 2C6YA 5E1WA 1FSHA 2G7UA 2Q0OA 3EETA 2XHKA 2UXXA 3FXRA 4AIJA 2FMYA 2F5FA 2O0YA 3KP3A 1U2WA 4U0VA 2DO7A 4HW0A 1E2XA 1SD4A 4E70A 1O3TA 4P5OA 4G8XA 5BOXA 3QU3A 5IT9Z 3FM5A 2WWYA 4EGZA 2QZ8A 1Y0UA 3VODA 2Z5UA 2KKOA 3KLNA 4EM2A 1GXQA 4HDVA 5D5UB 1QQIA 3C1DA 1SFXA 5D5XB 3V7SA 1SD5A 3BROA 1KQ8A 2FSWA 3TO7A 3AAFA 3ZMVA 5KK1A 2FQ3A 3I54A 2HZTA 4UV9A 1F5TA 2ZXJA 3JTGA 1XGMA 4UNOA 3HYIA 4BQAA 3NRVA 3BOQA 2VT2A 1STZA 5L3CA 3ABUA 1R58A 3CUQA 3DFGA 5FD6A 3GX4X 4ETSA 1I1GA 1QZYA 4XRFA 4EQQA 1JGSA 4XBFA 4ENNA 5E8GA 4HBLA 1IXRC 4IRHA 3FHZA 2V6CA 2Q8KA 3DXJF 2IJLA 3MZYA 2GXBA 4Z2YA 1NHAA 4RB0A 4GO1A 4LMYA 3G3ZA 3MZHA 2STWA 4CXFA 1AWCA 3J80K 2ZMEB 2DW4A 1IZ1A 3F8FA 2VBYA 4NB5A 5H6QA 3ULQB 1XCBA 1H9GA 3HTUA 1ZN2A 4N9IA 1XGNA 4EVIA 5FLXZ 4HQEA 5CVRA 1XDSA 1W4MA 4CO8A 1YLFA 1G3WA 4LK0F 2M45A 3BPXA 5JVTA 2FNAA 2FF4A 3IC7A 2KIFA 4GXOA 5D5VB 2STTA 5DDGA 1YFHA 2IPQX 2XAGA 4PZJA 3BJ6A 4F7ZA 5LHHA 1HW5A 3V8KA 1XGOA 1S7OA 2BGCA 2P6TA 2RQPA 4RGUA 4PGGA 2V1UA 2CFXA 4YIIA 2ZKZA 3PQKA 3GUDA 5IT3A 3JW4A 1U5TC 2A6EF 2VONA 1KU2A 4G6QA 1I5ZA 1KGSA 3DKWA 4XLPF 3F23A 3KCCA 4XSZF 3I53A 4L18B 3M7GA 3KZYA 4M9SA 3VFZA 4IXAA 4UUVA 2IA1A 2R3SA 3FMSA 2L54A 2ZBKA 2J5OA 2RC4A 3CTAA 4LGWA 3RDIA 1LJ9A 1P4WA 2KIUA 2EV0A 3L9FA 3ROUA 1E17A 2XAHA 2R7FA 3VEPA 5FO5A 4ON0A 3JAMZ 3CUQC 4JK1X 1ON2A 2L3DA 2V1DA 3WTUC 4MGRA 2Y48A 5K1YA 4RS8A 1U3EM 2W84A 3NEUA 4UXNA 3ZN0A 5LLQA 1LQ1A 3G73A 2BE5F 3SQNA 3GLXA 1P2FA 1W7PD 4BNCA 2Q2EA 1SAXA 1TQIA 1EH6A 4H0EA 1R36A 3HRMA 4M6XA 3K1NA 1MGTA 1F9NA 2P7VB 5ILUA 1HW1A 4HOBA 1BJAA 1U78A 5L3FA 4XLNF 2IRFG 3M1EA 5LHGA 5ERIA 2VXZA 3BY6A 3FXQA 4P9UA 2H6BA 3DP7A 5FGMA 3Q9SA 2CWEA 5JI6A 1K6OA 2EFPA 4OMZA 2HEOA 4L9NA 4XSXF 1B9NA 2QENA 1ZHFA 4EJTA 2E7WA 1FZPB 1O3RA 1Q1HA 4I98B 6PAXA 1XDUA 4Y17A 4I0BA 2BBYA 2O6GE 3BWGA 3WTSC 4ENMA 1RNLA 1DP7P 5HLHA 2FBHA 1KU3A 3COAC 4ZYEA 4BH9A 4EJOA 1JHHA 1Z9CA 4CICA 2DI3A 2YR2A 3IWZA 3RTRA 3WTYC 4IHTA 2P8TA 5J6XA 1V4RA 1A04A 5LGTA 4RB3C 5ICGA 3J81K 3EUHA 5JR3A 4TV7A 4WK8F 2HWVA 2X4HA 4O3MA 5DUKA 2RKHA 2M1BA 4WCGA 3F8CA 1B9MA 4I02A 3N4MA 1BI2A 3D0SA 2QWWA 4L9VA 3CUQB 2XASA 5E1ZB 2EB7A 3B73A 5D8KB 4R8HA 5FD5A 1Z1DA 5BQTA 3J80Z 4EJUA 1FSEA 4OMYA 2ACJA 3K0LA 1BI1A 3I64A 2GIVA 2YU3A 1YO5C 5J8CA 5F1RA 5H20A 1HSJA 1XB4A 3P7NA 4I01A 4MTEA 4G7OF 5JHUA 3ZN1A 5DD8A 2BEOA 3WODF 2IVMA 3LWFA 1P4AA 2K4JA 3LQQA 2XVCA 4Y13A 2O8XA 5LEJA 2FMLA 5BPDA 1W5TA 1WRJA 1OYYA 2VBZA 2GA2A 4LLNA 1O3SA 3RYPA 2VBXA 1RUOA 2IA0A 2E1CA 1YS6A 2MA3A 3JAMK 1YIOA 1IF1A 4HAMA 4IHSA 4EGYA 2HKOA 5DYMA 2RN7A 4YIFA 2K27A 2DT5A 4GGGA 2GAUA 2HYFA 4I09A 3PFIA 3OV8A 1R5HA 4O6JA 5CVVA 3MEXA 2XV4S 1MJ9A 1RI7A 1YW8A 2Z3YA 4BHCA 1IXSB 1ZLJA 3R4KA 1IXCA 1D3YA 3R60A 2K02A 4RGRA 3LA7A 5LRRA 1LNWA 1F1ZA 3C18A 4M6YA 1B1BA 1SFEA 1G3YA 1D5VA 1HBXG 4NQWA 2OQGA 3HSFA 3P9CA 1YQAA 3R61A 2Z33A 1SMTA 3CUOA 3HSEA 2VT3A 2Y0MA 3KEOA 5TJJA 4MQ9F 1R1TA 5DV5A 1ZG1A 5LBQA 3ZMSA 2EFNA 3GFIA 3ERED 1R1UA 1YTYA 4L9JA 2EA2A 1LDJA 1C0WA 3RKXA 3HUGA 4KDPA 3W6JB 3T5XA 3O3KA 1XCVA 4BHPA 2QUFA 4EM1A 3WE3A 5HLIA 2KIMA 1TLHB 4A5NA 2UXNA 5LRSA 2FE3A 4M72A 1BIBA 3M8EA 3GVAA 2VN2A 4HX8A 3ZMZA 2F5EA 1MZBA 1J2XA 1FBSA 2F5CA 3RPQA 1EH7A 2DFIA 2IP2A 2CW0F 3E6CC 1FP1D 4HV5A 5ILVA 3HOTA 4WXDA 3GW2A 1G3SA 5HDKA 4BAYA 4BXUA 4YFNF 4U7DA 1LEAA 3MQ0A 2WTEA 3HOSA 1IN5A 2HFHA 2CGPA 1R5GA 1BC7C 1MD0A 3F8NA 2JSCA 4ENKA 5FFXA 4MEYF 5DD4A 5D6FA 3HTSB 3KP5A 2HOEA 1YYVA 2JZYA 4IJAA 3E3VA 2PMUA 4HX4A 1FYLA 5D4SA 1WI9A 2FBKA 2KJCA 3RYRA 5LGNA 3J81Z 2ISYA 3NQOA 2W25A 1FBUA 2FEZA 1S3JA 2D2WA 4FX4A 2M87A 4A5MA 4EMSA 1S29A 3H3ZA 4IRGA 4G6DA 2RVCA 2J5PA 2ADUA 5K5RA 1YG2A 1OKRA 4P55A 2P5KA 5HDNA 4A6EA 3MAJA 1ZH5A 1UHMA 1UFMA 3F6VA 1SFUA 5LHIA 1ON1A 3FXUA 4BYYA 4U0YA 5JFRA 1GHCA 1R22A 4WF2A 5L3GA 2UZKA 3DEUA 2RDPA 4ZH4F 5EEGA 2OBPA 3I4PA 1KQ9A 2IW5A 1SMYF 2VC0A 3GYHX 2VOOA 4LG0B 5LGUA 5IT9K 5BPIA 2JRTA 3IL2A 3DPTA 1IRGA 1YW7A 1MJBA 1FNNA 3HSRA 1T6SA 1FYKA 1FLIA 3E6BA 2JTVA 3TO9A 1EV7A 1K79A 3HRUA 4MNUA 2E1NA 3IRRA 1ZYRF 4P9FA 1TQPA 2P5LC 3WGIA 2L02A 3DF8A 2VOPA 2QBYA 5HS9A 1KA8A 1JXSA 2IA2A 4CDGA 2GZWA 1L0OC 4L0YB 2M8EA 1S6LA 2G9WA 3E6DA 3RKWA 1UHWA 2QBYB 4ZYGA 4JBAA 2ESHA 1ZG3A 3FWEA 3R0AA 4M71A 3V4GA 3RI4A 3Q5FA 3WTZA 2XAQA 4I0AA 2ZO4A 3T1BA 2DTRA 3ZMTA 3ISPA 2MLKA 4A12A 1B59A 4U7BA 1Z6RA 1X3UA 4ENJA 4FT8A 4UVCA 5A2QK 2H09A 3KP7A 4I2OA 4LB5A 2LSOA 1FOKA 1OYWA 2PFBA 5A2QZ 2NYXA 1FPQA 1HW2A 3HHGA 4B8XA 3V7RA 1G6NA 3ELKA 3ZMDA 3CO7C 4KUMA 5ICFA 1T2KA 4UHTA 3F8BA 3T0YA 2RNJA 4MQVA 3J7AO 1FY7A 2XAJA 1XN7A 3RKYA 3S2WA 3I71A 3FMRA 4KNYA 1FBQA 5KVRA 3BJOA 4AWXB 1KU9A 3QRFF 3W6KB 1J59A 5ICCA 2H27A 4YFXF 4RAYA 2WC2A 5D8LB 1REPC 3ECHA 5DUIA 3QPTA 2QVOA 4EV0A 2DQLA 4O5VA 2M5WA 3FF5A 4KIBA 1TNTA 3ECOA 3LQRA 1PP7U 4U0WA 5AONA 3E5QA 1AOYA 3LSTA 1I27A 1MDMA 4WXCA 4PDKA 1ZGJA 3C7JA 1P92A 2ZJ2A 3BZ6A 2O61A 2QQ9A 4UVAA 3L00A 3VOEA 2PQ8A 2DPUA 3TDUC 1KU7A 2NNYA 2A69F 2D45A 4HF1A 4HLYA 5E20A 1ZLKA 1MJAA 5CVIA 4L5IA 4N0BA 3BJAA 1CGPA 5BMZA 5CJ9A 5CVUA 3K2ZA 1WQ2A 4A0YA 5ILSA 5AIQA 3WTXC 3GXOA 4KIGA 2OU2A 2HKXA 3LAPA 3SZPA 4S04A 4HA8A 4S05A 4Q48A 3U2RA 4ZZDA 3C3WA 2R7DA 4ZZLA 1KYZA 3GWZA 4MHGA 4AIKA 3SZTA 1IRFA 3F3XA 5D4RA 2XAFA 4LJZF 4CZZA 2GXGA 2L01A 5E17F 4ESBA 2A61A 2FXAA 3QP6A 3F6OA 2CG4A 3Q9VA 2PLYA 4GYIA 1YW9A 2MD5A 2JT1A 1O3QA 1T39A 5H6RA 2EFQA 3F72A 1PDNC 2OQRA 2V9VA 4ESJA 1BM9A 1FWZA 1J7KA 3CJNA 5HOOA 2NAZA 3KLOA 1P6RA 3MCZA 4KT5C 5D6EA 5TRDA 1ZRDA 1T0FA 4G9YA 4LG0A 2PMHA 1O7LA 3QPHA 4M9XA 3SHFA 4KYWA 1OR7A 2F2EA 5F64A 1P4XA 1Z91A 5HVQC 1U5TA 1PUEE 3O6BB 3KEQA 4L0ZB 3WTVC 5HDGA 2COMA 3JSOA 1DDNA 4PCQA 3O2PE 3I59B 3GZ5A 1V3FA 4FHTA 5K5QA 4JQFA 2VODA 2BV6A 5E1XA 4KMUX 1WSUA 4Q5SF 4HZFA 1ONVA 1QPMA 1I6XA 1XGSA 4IPAA 1S7AA 3V8LA 2JPBA 1J5YA 1TW3A 1XMKA 4KICA 1FP2A 2XRNA 3H3UA 4KMFA 1TNSA 4CGZA 1ZARA 4HF0A 2ZMEA 1BN5A 2ZFWA 1XMAA 5D5WB 1R00A 1K7AA 2FBIA 4RGSA 2M30A 3LA3A 1ZRFA 2Z99A 1FYMA 4WWCA 1W5SA 2IT0A 4N9HA 4DQ2A 2V1XA 2LNBA 2L4AA 2YSRA 5CYVA 5E8IA 4MEXF 3K1PA 1H9TA 1ZAOA 3K1MA 2AXLA 5DCFA 5K5OA 1YS7A 2B0LA 2MH2A 1UB9A 1K78A 4A6DA 1SD7A 2MBFA 1F4KA 4OIPF 1DPUA 5FFZA 2QQAA 1ULYA 3EYIA 4ESFA 4LLGF 4Q4ZF 2PI0A 1T98A 2K7LA 4M74A 3IKTA 1W7PA 1IW7F 2YX4A 3TO6A 5ED4A 3JSPA 2QM3A 1HXDA 3FX3A 2JPCA 3E5XA 3IKVA 1U6GA 2QLZA 2LDUA 4A0ZA 3PQJA 1HKTA 3QP5A 2ISZA 2FNPA 4WX9A 1L3LA 1IN6A 3V8JA 2H94A 2EV5A 4RB1A 1B4AA 4M9ZA 1IUYA 3WU1B 4QWQA 1CF7B 5ICEA 3V7CA 2OA4A 4G7ZF 4AD9A 4YFKF 3RJPA 2A5YB 2CO5A 2DK8A 4OU0A 3T8TA 4EJWA 1CF7A 4HX7A 3KFWX 3QOPA 1O57A 4G7HF 1LDDA 3MFKA 4RGXA 2Y75A 2HS5A 3M8FA 2FRHA 2RV8A 4IVNA 2WV0A 2PEXA 3IWFA 1ODDA 5CLSA 3P9IA 1ZRCA 1VTNC 3FM3A 2HTSA 2V79A 3FMQA 2MC3A 2EFOA 3LFKA 1LB2A 1J0RA 2L4MA 1G3TA 3IRQA 1TQMA 1RUNA 1TW2A 4Y15A 2YPRA 2KJBA 2OZUA 3L09A 2LKPA 2XKPA 2GQQA 1B6AA 4GYGA 1IAWA 2DAOA 2DPDA 4EM0B 3E97A 3WG9A 2HTJA 2GA1A 2HYGD 1TTYA 2EWNA 1QZZA 1JHFA 5BS6A 1XSVA 3HRSA 1BI0A 1BC8C 3U9GA 3GF2A 1G4DA 2NS0A 4KN4X 3TKYA 3TQNA 1T38A 2XIGA 3TOAA 2F5DA 1MDMB 2EFWA 4LFUA 2HQRA 5E18F 4HV6A 1WWXA 1LDKB 1D8JA 3L2CA 5J8FA 2HGCA 3RPUA 2DLLA 4OOIA 2E7XA 3GFJA 2ELHA 3JTHA 4M73A 3LA2A 4RAZA 1BOAA 1U5TB 3TOBA 1R1VA 3ZP5A 4OIQF 2A68F 2HDCA 3CO6C 3I59A 2PG4A 4EJVA 3IHUA 4CHUA 2VE8A 4L5JA 1GXPA 2CQKA 4HQMA 3I5UA 3DQVC 2GWRA 3GZ6A 1FX7A 4A2UA 1HKQA 1XSDA 3BP8A 2A6HF 3DPLC 3TGNA 2LF8A 3BPVA 4HF2A 3I58A 3HIFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4AVP A;  2K4B A;  2NRA C;  2W57 A;  1EH8 A;  1Z6T A;  4R1H A;  3GFM A;  4U88 A;  1XD7 A;  3T8R A;  5LEK A;  2XGX A;  1HST A;  2EJR A;  2CSO A;  3KE2 A;  1OMI A;  2MH9 A;  3BDD A;  5FB2 A;  4IRI A;  1I1S A;  3EYY A;  3H92 A;  4I7H A;  5EEH A;  5F6F A;  1FT9 A;  2MLG A;  3R6S A;  3REO A;  2DQR A;  5DCM B;  2OD5 A;  2QQB A;  4G94 A;  3DV8 A;  5L3E A;  3KP6 A;  3K9T A;  2BYV E;  2P4W A;  1WKM A;  1FC3 A;  1OYI A;  2PN6 A;  1KYW A;  5DCM A;  5AIP A;  1RIO H;  1OPC A;  4LK1 F;  2D1V A;  2TDX A;  2FU4 A;  1K78 B;  1DUX C;  2A07 F;  5L3B A;  5CVJ A;  1IN7 A;  4FX0 A;  1DPR A;  3I0T A;  3L7W A;  2QYO A;  1QO0 D;  4KFC A;  1UST A;  3ML6 A;  2H6C A;  1W7P B;  4ZYD A;  4ZYH A;  3B02 A;  4Q47 A;  1Z7U A;  2KRF A;  2ZNZ A;  3WE2 A;  2A3S A;  4L9T A;  4LD5 A;  3F21 A;  3U1D A;  1USS A;  5DEQ A;  3GEZ A;  1QNT A;  4LLL A;  2HR3 A;  1PP8 F;  3M9A A;  2W85 A;  2PJP A;  3KZZ A;  1R23 A;  4NHJ A;  4WXH A;  3VB2 A;  4HDU A;  5FLX K;  4RB2 C;  2W24 A;  5L3D A;  2VE9 A;  3LAJ A;  3ZPL A;  3FZV A;  3RIR A;  2DK5 A;  2XKO A;  1J75 A;  2EV6 A;  3GFL A;  2ETH A;  1GVJ A;  1ZGA A;  3D5L A;  3EQL F;  3HHH A;  4QLC U;  2VC1 A;  3KP4 A;  4B09 A;  3R0J A;  3WU0 A;  4OIR F;  4AIH A;  3F8M A;  2D1H A;  4BHB A;  1ZG5 A;  3OOP A;  1S8N A;  3SXY A;  4YG2 F;  5HS8 A;  2ZNY A;  3K69 A;  1BIA A;  4HLX A;  2O3F A;  3KET A;  2XRO A;  2UWM A;  1LEB A;  1ZRE A;  1D8K A;  2LF7 A;  1SD6 A;  2OAZ A;  4KA4 A;  1BBY A;  3WGG A;  4MTD A;  1R7J A;  2O03 A;  2VBW A;  3E5U A;  3E6M A;  1LVA A;  2Z9O A;  2CYY A;  3WTT C;  1TBX A;  4ASN A;  3F22 A;  3ZMU A;  2NNN A;  1O7F A;  5HS7 A;  1J9I A;  1MKM A;  2X0L A;  1JE8 A;  1UCR A;  3CLO A;  3EDP A;  2FA5 A;  5HLG A;  2FOK A;  1XSX A;  2G7H A;  1RZ4 A;  2ZCW A;  2DU9 A;  3QAH A;  2YX7 A;  1HQC A;  1QBJ A;  3HRT A;  4P96 A;  2P5V A;  3WGH A;  4GCV A;  1Z05 A;  3QU6 A;  1H0M A;  1IN4 A;  4HYE A;  4UVB A;  4IF4 A;  4KIF A;  1U8R A;  3P9K A;  2P7C B;  4A0X A;  3KP2 A;  4LB6 B;  1IN8 A;  2EK5 A;  3TDZ C;  2K86 A;  4KN7 X;  3WTW C;  4DNC A;  3GO5 A;  3ZQ7 A;  4K2E A;  2DBB A;  1KQ0 A;  2P6S A;  2PBI A;  3CDH A;  3ABT A;  2EA4 A;  2AS5 F;  4PGH A;  3N97 A;  2ESN A;  1QGP A;  2XUB A;  1HKS A;  3MWM A;  4CYD A;  4R79 A;  4UV8 A;  2HQN A;  2OZ6 A;  4D0P A;  1BI3 A;  2RGV A;  3SFZ A;  4OIN F;  4OIO F;  2C6Y A;  5E1W A;  1FSH A;  2G7U A;  2Q0O A;  3EET A;  2XHK A;  2UXX A;  3FXR A;  4AIJ A;  2FMY A;  2F5F A;  2O0Y A;  3KP3 A;  1U2W A;  4U0V A;  2DO7 A;  4HW0 A;  1E2X A;  1SD4 A;  4E70 A;  1O3T A;  4P5O A;  4G8X A;  5BOX A;  3QU3 A;  5IT9 Z;  3FM5 A;  2WWY A;  4EGZ A;  2QZ8 A;  1Y0U A;  3VOD A;  2Z5U A;  2KKO A;  3KLN A;  4EM2 A;  1GXQ A;  4HDV A;  5D5U B;  1QQI A;  3C1D A;  1SFX A;  5D5X B;  3V7S A;  1SD5 A;  3BRO A;  1KQ8 A;  2FSW A;  3TO7 A;  3AAF A;  3ZMV A;  5KK1 A;  2FQ3 A;  3I54 A;  2HZT A;  4UV9 A;  1F5T A;  2ZXJ A;  3JTG A;  1XGM A;  4UNO A;  3HYI A;  4BQA A;  3NRV A;  3BOQ A;  2VT2 A;  1STZ A;  5L3C A;  3ABU A;  1R58 A;  3CUQ A;  3DFG A;  5FD6 A;  3GX4 X;  4ETS A;  1I1G A;  1QZY A;  4XRF A;  4EQQ A;  1JGS A;  4XBF A;  4ENN A;  5E8G A;  4HBL A;  1IXR C;  4IRH A;  3FHZ A;  2V6C A;  2Q8K A;  3DXJ F;  2IJL A;  3MZY A;  2GXB A;  4Z2Y A;  1NHA A;  4RB0 A;  4GO1 A;  4LMY A;  3G3Z A;  3MZH A;  2STW A;  4CXF A;  1AWC A;  3J80 K;  2ZME B;  2DW4 A;  1IZ1 A;  3F8F A;  2VBY A;  4NB5 A;  5H6Q A;  3ULQ B;  1XCB A;  1H9G A;  3HTU A;  1ZN2 A;  4N9I A;  1XGN A;  4EVI A;  5FLX Z;  4HQE A;  5CVR A;  1XDS A;  1W4M A;  4CO8 A;  1YLF A;  1G3W A;  4LK0 F;  2M45 A;  3BPX A;  5JVT A;  2FNA A;  2FF4 A;  3IC7 A;  2KIF A;  4GXO A;  5D5V B;  2STT A;  5DDG A;  1YFH A;  2IPQ X;  2XAG A;  4PZJ A;  3BJ6 A;  4F7Z A;  5LHH A;  1HW5 A;  3V8K A;  1XGO A;  1S7O A;  2BGC A;  2P6T A;  2RQP A;  4RGU A;  4PGG A;  2V1U A;  2CFX A;  4YII A;  2ZKZ A;  3PQK A;  3GUD A;  5IT3 A;  3JW4 A;  1U5T C;  2A6E F;  2VON A;  1KU2 A;  4G6Q A;  1I5Z A;  1KGS A;  3DKW A;  4XLP F;  3F23 A;  3KCC A;  4XSZ F;  3I53 A;  4L18 B;  3M7G A;  3KZY A;  4M9S A;  3VFZ A;  4IXA A;  4UUV A;  2IA1 A;  2R3S A;  3FMS A;  2L54 A;  2ZBK A;  2J5O A;  2RC4 A;  3CTA A;  4LGW A;  3RDI A;  1LJ9 A;  1P4W A;  2KIU A;  2EV0 A;  3L9F A;  3ROU A;  1E17 A;  2XAH A;  2R7F A;  3VEP A;  5FO5 A;  4ON0 A;  3JAM Z;  3CUQ C;  4JK1 X;  1ON2 A;  2L3D A;  2V1D A;  3WTU C;  4MGR A;  2Y48 A;  5K1Y A;  4RS8 A;  1U3E M;  2W84 A;  3NEU A;  4UXN A;  3ZN0 A;  5LLQ A;  1LQ1 A;  3G73 A;  2BE5 F;  3SQN A;  3GLX A;  1P2F A;  1W7P D;  4BNC A;  2Q2E A;  1SAX A;  1TQI A;  1EH6 A;  4H0E A;  1R36 A;  3HRM A;  4M6X A;  3K1N A;  1MGT A;  1F9N A;  2P7V B;  5ILU A;  1HW1 A;  4HOB A;  1BJA A;  1U78 A;  5L3F A;  4XLN F;  2IRF G;  3M1E A;  5LHG A;  5ERI A;  2VXZ A;  3BY6 A;  3FXQ A;  4P9U A;  2H6B A;  3DP7 A;  5FGM A;  3Q9S A;  2CWE A;  5JI6 A;  1K6O A;  2EFP A;  4OMZ A;  2HEO A;  4L9N A;  4XSX F;  1B9N A;  2QEN A;  1ZHF A;  4EJT A;  2E7W A;  1FZP B;  1O3R A;  1Q1H A;  4I98 B;  6PAX A;  1XDU A;  4Y17 A;  4I0B A;  2BBY A;  2O6G E;  3BWG A;  3WTS C;  4ENM A;  1RNL A;  1DP7 P;  5HLH A;  2FBH A;  1KU3 A;  3COA C;  4ZYE A;  4BH9 A;  4EJO A;  1JHH A;  1Z9C A;  4CIC A;  2DI3 A;  2YR2 A;  3IWZ A;  3RTR A;  3WTY C;  4IHT A;  2P8T A;  5J6X A;  1V4R A;  1A04 A;  5LGT A;  4RB3 C;  5ICG A;  3J81 K;  3EUH A;  5JR3 A;  4TV7 A;  4WK8 F;  2HWV A;  2X4H A;  4O3M A;  5DUK A;  2RKH A;  2M1B A;  4WCG A;  3F8C A;  1B9M A;  4I02 A;  3N4M A;  1BI2 A;  3D0S A;  2QWW A;  4L9V A;  3CUQ B;  2XAS A;  5E1Z B;  2EB7 A;  3B73 A;  5D8K B;  4R8H A;  5FD5 A;  1Z1D A;  5BQT A;  3J80 Z;  4EJU A;  1FSE A;  4OMY A;  2ACJ A;  3K0L A;  1BI1 A;  3I64 A;  2GIV A;  2YU3 A;  1YO5 C;  5J8C A;  5F1R A;  5H20 A;  1HSJ A;  1XB4 A;  3P7N A;  4I01 A;  4MTE A;  4G7O F;  5JHU A;  3ZN1 A;  5DD8 A;  2BEO A;  3WOD F;  2IVM A;  3LWF A;  1P4A A;  2K4J A;  3LQQ A;  2XVC A;  4Y13 A;  2O8X A;  5LEJ A;  2FML A;  5BPD A;  1W5T A;  1WRJ A;  1OYY A;  2VBZ A;  2GA2 A;  4LLN A;  1O3S A;  3RYP A;  2VBX A;  1RUO A;  2IA0 A;  2E1C A;  1YS6 A;  2MA3 A;  3JAM K;  1YIO A;  1IF1 A;  4HAM A;  4IHS A;  4EGY A;  2HKO A;  5DYM A;  2RN7 A;  4YIF A;  2K27 A;  2DT5 A;  4GGG A;  2GAU A;  2HYF A;  4I09 A;  3PFI A;  3OV8 A;  1R5H A;  4O6J A;  5CVV A;  3MEX A;  2XV4 S;  1MJ9 A;  1RI7 A;  1YW8 A;  2Z3Y A;  4BHC A;  1IXS B;  1ZLJ A;  3R4K A;  1IXC A;  1D3Y A;  3R60 A;  2K02 A;  4RGR A;  3LA7 A;  5LRR A;  1LNW A;  1F1Z A;  3C18 A;  4M6Y A;  1B1B A;  1SFE A;  1G3Y A;  1D5V A;  1HBX G;  4NQW A;  2OQG A;  3HSF A;  3P9C A;  1YQA A;  3R61 A;  2Z33 A;  1SMT A;  3CUO A;  3HSE A;  2VT3 A;  2Y0M A;  3KEO A;  5TJJ A;  4MQ9 F;  1R1T A;  5DV5 A;  1ZG1 A;  5LBQ A;  3ZMS A;  2EFN A;  3GFI A;  3ERE D;  1R1U A;  1YTY A;  4L9J A;  2EA2 A;  1LDJ A;  1C0W A;  3RKX A;  3HUG A;  4KDP A;  3W6J B;  3T5X A;  3O3K A;  1XCV A;  4BHP A;  2QUF A;  4EM1 A;  3WE3 A;  5HLI A;  2KIM A;  1TLH B;  4A5N A;  2UXN A;  5LRS A;  2FE3 A;  4M72 A;  1BIB A;  3M8E A;  3GVA A;  2VN2 A;  4HX8 A;  3ZMZ A;  2F5E A;  1MZB A;  1J2X A;  1FBS A;  2F5C A;  3RPQ A;  1EH7 A;  2DFI A;  2IP2 A;  2CW0 F;  3E6C C;  1FP1 D;  4HV5 A;  5ILV A;  3HOT A;  4WXD A;  3GW2 A;  1G3S A;  5HDK A;  4BAY A;  4BXU A;  4YFN F;  4U7D A;  1LEA A;  3MQ0 A;  2WTE A;  3HOS A;  1IN5 A;  2HFH A;  2CGP A;  1R5G A;  1BC7 C;  1MD0 A;  3F8N A;  2JSC A;  4ENK A;  5FFX A;  4MEY F;  5DD4 A;  5D6F A;  3HTS B;  3KP5 A;  2HOE A;  1YYV A;  2JZY A;  4IJA A;  3E3V A;  2PMU A;  4HX4 A;  1FYL A;  5D4S A;  1WI9 A;  2FBK A;  2KJC A;  3RYR A;  5LGN A;  3J81 Z;  2ISY A;  3NQO A;  2W25 A;  1FBU A;  2FEZ A;  1S3J A;  2D2W A;  4FX4 A;  2M87 A;  4A5M A;  4EMS A;  1S29 A;  3H3Z A;  4IRG A;  4G6D A;  2RVC A;  2J5P A;  2ADU A;  5K5R A;  1YG2 A;  1OKR A;  4P55 A;  2P5K A;  5HDN A;  4A6E A;  3MAJ A;  1ZH5 A;  1UHM A;  1UFM A;  3F6V A;  1SFU A;  5LHI A;  1ON1 A;  3FXU A;  4BYY A;  4U0Y A;  5JFR A;  1GHC A;  1R22 A;  4WF2 A;  5L3G A;  2UZK A;  3DEU A;  2RDP A;  4ZH4 F;  5EEG A;  2OBP A;  3I4P A;  1KQ9 A;  2IW5 A;  1SMY F;  2VC0 A;  3GYH X;  2VOO A;  4LG0 B;  5LGU A;  5IT9 K;  5BPI A;  2JRT A;  3IL2 A;  3DPT A;  1IRG A;  1YW7 A;  1MJB A;  1FNN A;  3HSR A;  1T6S A;  1FYK A;  1FLI A;  3E6B A;  2JTV A;  3TO9 A;  1EV7 A;  1K79 A;  3HRU A;  4MNU A;  2E1N A;  3IRR A;  1ZYR F;  4P9F A;  1TQP A;  2P5L C;  3WGI A;  2L02 A;  3DF8 A;  2VOP A;  2QBY A;  5HS9 A;  1KA8 A;  1JXS A;  2IA2 A;  4CDG A;  2GZW A;  1L0O C;  4L0Y B;  2M8E A;  1S6L A;  2G9W A;  3E6D A;  3RKW A;  1UHW A;  2QBY B;  4ZYG A;  4JBA A;  2ESH A;  1ZG3 A;  3FWE A;  3R0A A;  4M71 A;  3V4G A;  3RI4 A;  3Q5F A;  3WTZ A;  2XAQ A;  4I0A A;  2ZO4 A;  3T1B A;  2DTR A;  3ZMT A;  3ISP A;  2MLK A;  4A12 A;  1B59 A;  4U7B A;  1Z6R A;  1X3U A;  4ENJ A;  4FT8 A;  4UVC A;  5A2Q K;  2H09 A;  3KP7 A;  4I2O A;  4LB5 A;  2LSO A;  1FOK A;  1OYW A;  2PFB A;  5A2Q Z;  2NYX A;  1FPQ A;  1HW2 A;  3HHG A;  4B8X A;  3V7R A;  1G6N A;  3ELK A;  3ZMD A;  3CO7 C;  4KUM A;  5ICF A;  1T2K A;  4UHT A;  3F8B A;  3T0Y A;  2RNJ A;  4MQV A;  3J7A O;  1FY7 A;  2XAJ A;  1XN7 A;  3RKY A;  3S2W A;  3I71 A;  3FMR A;  4KNY A;  1FBQ A;  5KVR A;  3BJO A;  4AWX B;  1KU9 A;  3QRF F;  3W6K B;  1J59 A;  5ICC A;  2H27 A;  4YFX F;  4RAY A;  2WC2 A;  5D8L B;  1REP C;  3ECH A;  5DUI A;  3QPT A;  2QVO A;  4EV0 A;  2DQL A;  4O5V A;  2M5W A;  3FF5 A;  4KIB A;  1TNT A;  3ECO A;  3LQR A;  1PP7 U;  4U0W A;  5AON A;  3E5Q A;  1AOY A;  3LST A;  1I27 A;  1MDM A;  4WXC A;  4PDK A;  1ZGJ A;  3C7J A;  1P92 A;  2ZJ2 A;  3BZ6 A;  2O61 A;  2QQ9 A;  4UVA A;  3L00 A;  3VOE A;  2PQ8 A;  2DPU A;  3TDU C;  1KU7 A;  2NNY A;  2A69 F;  2D45 A;  4HF1 A;  4HLY A;  5E20 A;  1ZLK A;  1MJA A;  5CVI A;  4L5I A;  4N0B A;  3BJA A;  1CGP A;  5BMZ A;  5CJ9 A;  5CVU A;  3K2Z A;  1WQ2 A;  4A0Y A;  5ILS A;  5AIQ A;  3WTX C;  3GXO A;  4KIG A;  2OU2 A;  2HKX A;  3LAP A;  3SZP A;  4S04 A;  4HA8 A;  4S05 A;  4Q48 A;  3U2R A;  4ZZD A;  3C3W A;  2R7D A;  4ZZL A;  1KYZ A;  3GWZ A;  4MHG A;  4AIK A;  3SZT A;  1IRF A;  3F3X A;  5D4R A;  2XAF A;  4LJZ F;  4CZZ A;  2GXG A;  2L01 A;  5E17 F;  4ESB A;  2A61 A;  2FXA A;  3QP6 A;  3F6O A;  2CG4 A;  3Q9V A;  2PLY A;  4GYI A;  1YW9 A;  2MD5 A;  2JT1 A;  1O3Q A;  1T39 A;  5H6R A;  2EFQ A;  3F72 A;  1PDN C;  2OQR A;  2V9V A;  4ESJ A;  1BM9 A;  1FWZ A;  1J7K A;  3CJN A;  5HOO A;  2NAZ A;  3KLO A;  1P6R A;  3MCZ A;  4KT5 C;  5D6E A;  5TRD A;  1ZRD A;  1T0F A;  4G9Y A;  4LG0 A;  2PMH A;  1O7L A;  3QPH A;  4M9X A;  3SHF A;  4KYW A;  1OR7 A;  2F2E A;  5F64 A;  1P4X A;  1Z91 A;  5HVQ C;  1U5T A;  1PUE E;  3O6B B;  3KEQ A;  4L0Z B;  3WTV C;  5HDG A;  2COM A;  3JSO A;  1DDN A;  4PCQ A;  3O2P E;  3I59 B;  3GZ5 A;  1V3F A;  4FHT A;  5K5Q A;  4JQF A;  2VOD A;  2BV6 A;  5E1X A;  4KMU X;  1WSU A;  4Q5S F;  4HZF A;  1ONV A;  1QPM A;  1I6X A;  1XGS A;  4IPA A;  1S7A A;  3V8L A;  2JPB A;  1J5Y A;  1TW3 A;  1XMK A;  4KIC A;  1FP2 A;  2XRN A;  3H3U A;  4KMF A;  1TNS A;  4CGZ A;  1ZAR A;  4HF0 A;  2ZME A;  1BN5 A;  2ZFW A;  1XMA A;  5D5W B;  1R00 A;  1K7A A;  2FBI A;  4RGS A;  2M30 A;  3LA3 A;  1ZRF A;  2Z99 A;  1FYM A;  4WWC A;  1W5S A;  2IT0 A;  4N9H A;  4DQ2 A;  2V1X A;  2LNB A;  2L4A A;  2YSR A;  5CYV A;  5E8I A;  4MEX F;  3K1P A;  1H9T A;  1ZAO A;  3K1M A;  2AXL A;  5DCF A;  5K5O A;  1YS7 A;  2B0L A;  2MH2 A;  1UB9 A;  1K78 A;  4A6D A;  1SD7 A;  2MBF A;  1F4K A;  4OIP F;  1DPU A;  5FFZ A;  2QQA A;  1ULY A;  3EYI A;  4ESF A;  4LLG F;  4Q4Z F;  2PI0 A;  1T98 A;  2K7L A;  4M74 A;  3IKT A;  1W7P A;  1IW7 F;  2YX4 A;  3TO6 A;  5ED4 A;  3JSP A;  2QM3 A;  1HXD A;  3FX3 A;  2JPC A;  3E5X A;  3IKV A;  1U6G A;  2QLZ A;  2LDU A;  4A0Z A;  3PQJ A;  1HKT A;  3QP5 A;  2ISZ A;  2FNP A;  4WX9 A;  1L3L A;  1IN6 A;  3V8J A;  2H94 A;  2EV5 A;  4RB1 A;  1B4A A;  4M9Z A;  1IUY A;  3WU1 B;  4QWQ A;  1CF7 B;  5ICE A;  3V7C A;  2OA4 A;  4G7Z F;  4AD9 A;  4YFK F;  3RJP A;  2A5Y B;  2CO5 A;  2DK8 A;  4OU0 A;  3T8T A;  4EJW A;  1CF7 A;  4HX7 A;  3KFW X;  3QOP A;  1O57 A;  4G7H F;  1LDD A;  3MFK A;  4RGX A;  2Y75 A;  2HS5 A;  3M8F A;  2FRH A;  2RV8 A;  4IVN A;  2WV0 A;  2PEX A;  3IWF A;  1ODD A;  5CLS A;  3P9I A;  1ZRC A;  1VTN C;  3FM3 A;  2HTS A;  2V79 A;  3FMQ A;  2MC3 A;  2EFO A;  3LFK A;  1LB2 A;  1J0R A;  2L4M A;  1G3T A;  3IRQ A;  1TQM A;  1RUN A;  1TW2 A;  4Y15 A;  2YPR A;  2KJB A;  2OZU A;  3L09 A;  2LKP A;  2XKP A;  2GQQ A;  1B6A A;  4GYG A;  1IAW A;  2DAO A;  2DPD A;  4EM0 B;  3E97 A;  3WG9 A;  2HTJ A;  2GA1 A;  2HYG D;  1TTY A;  2EWN A;  1QZZ A;  1JHF A;  5BS6 A;  1XSV A;  3HRS A;  1BI0 A;  1BC8 C;  3U9G A;  3GF2 A;  1G4D A;  2NS0 A;  4KN4 X;  3TKY A;  3TQN A;  1T38 A;  2XIG A;  3TOA A;  2F5D A;  1MDM B;  2EFW A;  4LFU A;  2HQR A;  5E18 F;  4HV6 A;  1WWX A;  1LDK B;  1D8J A;  3L2C A;  5J8F A;  2HGC A;  3RPU A;  2DLL A;  4OOI A;  2E7X A;  3GFJ A;  2ELH A;  3JTH A;  4M73 A;  3LA2 A;  4RAZ A;  1BOA A;  1U5T B;  3TOB A;  1R1V A;  3ZP5 A;  4OIQ F;  2A68 F;  2HDC A;  3CO6 C;  3I59 A;  2PG4 A;  4EJV A;  3IHU A;  4CHU A;  2VE8 A;  4L5J A;  1GXP A;  2CQK A;  4HQM A;  3I5U A;  3DQV C;  2GWR A;  3GZ6 A;  1FX7 A;  4A2U A;  1HKQ A;  1XSD A;  3BP8 A;  2A6H F;  3DPL C;  3TGN A;  2LF8 A;  3BPV A;  4HF2 A;  3I58 A;  3HIF A; 
#chains in the Genus database with same CATH topology
 2HXO A;  2DJN A;  1U9O A;  2K4B A;  4AVP A;  2NRA C;  1POG A;  2W57 A;  2KQR A;  2WAQ A;  1EH8 A;  1W36 D;  1Z6T A;  4R1H A;  3VYR B;  4EAT A;  3H3V K;  3ZQG A;  3GFM A;  2JUC A;  4U88 A;  3VYU B;  1WJ5 A;  1XD7 A;  3T8R A;  4PUS A;  2X1C A;  5GAG J;  3QYB A;  5LEK A;  3JR9 A;  2XGX A;  1HST A;  2EJR A;  1ETO A;  2CSO A;  2HQ5 A;  3KE2 A;  1OMI A;  1QHH D;  1RC9 A;  2MH9 A;  3BDD A;  3CCJ I;  5FB2 A;  2PX9 A;  4IRI A;  1I1S A;  3EYY A;  2AXT C;  3H92 A;  1IDY A;  2DFE A;  5F1J A;  4I7H A;  5EEH A;  5F6F A;  1FT9 A;  2HPM A;  2MLG A;  3R6S A;  3REO A;  2DQR A;  5DCM B;  2OD5 A;  4RDU A;  2QQB A;  3M1C A;  2CV1 A;  5GAH J;  4G94 A;  3DV8 A;  5L3E A;  3FHN A;  3JCU C;  4BXF A;  3KP6 A;  3K9T A;  2BYV E;  2P4W A;  1WKM A;  4E7Z A;  1FC3 A;  1OYI A;  2PN6 A;  4BXX J;  4I99 C;  2VJJ A;  1KYW A;  5DCM A;  5AIP A;  3PNV A;  1D1C A;  4XOP A;  1RIO H;  2LMD A;  4XRS A;  1OPC A;  4LK1 F;  3OIO A;  1QPI A;  1OIS A;  2D1V A;  2TDX A;  3A2K A;  2QSG X;  2FU4 A;  1MH3 A;  1K78 B;  1LFB A;  1PJR A;  1DUX C;  3QOE A;  2A07 F;  2VI6 A;  5FKO A;  3JRG A;  5L3B A;  5CVJ A;  3HOW J;  1IN7 A;  3PSI A;  5EG0 B;  4JX6 A;  4FX0 A;  2X48 A;  1RRJ A;  1DPR A;  3I0T A;  3L7W A;  2QYO A;  4PK4 A;  2JUG A;  1RKW A;  1QO0 D;  4RA2 A;  2F4I A;  2BZT A;  4A3I J;  4KFC A;  3HOU J;  2RNG A;  3Q0V A;  1UST A;  1V54 H;  3ML6 A;  2COB A;  2H6C A;  1W7P B;  2KHM A;  4ZYD A;  4ZYH A;  2DOD A;  3B02 A;  4Q47 A;  1ZR4 A;  1VQ4 I;  1Z7U A;  4PFP A;  4CSW A;  1PUF A;  1VF9 A;  1I39 A;  2KRF A;  2ZNZ A;  4ABZ A;  4D7M A;  3WE2 A;  2A3S A;  4BQN A;  4L9T A;  4LD5 A;  3MKY B;  4IKF A;  3LSJ A;  1P9Q C;  2X51 A;  3F21 A;  4W97 A;  3U1D A;  1NH3 A;  1USS A;  1ETX A;  1YE9 A;  3GEZ A;  5DEQ A;  1QNT A;  2F4M B;  4LLL A;  2HR3 A;  5F0H A;  2E71 A;  2WAD A;  5CQE A;  1PP8 F;  3M9A A;  1JUM A;  1Y8R B;  2W85 A;  3A0B C;  3M3Y J;  2DJI A;  3S2D J;  1W36 C;  2PJP A;  3L2W A;  1WJE A;  5KNL A;  3KZZ A;  5F04 A;  1R23 A;  4NC8 A;  4NHJ A;  4WXH A;  3VB2 A;  3GME A;  4HDU A;  5FLX K;  4RB2 C;  1QVU A;  2W24 A;  4HPQ A;  3JRH A;  5L3D A;  2VE9 A;  4U87 A;  3LAJ A;  5C4X J;  3ZPL A;  3FZV A;  3RIR A;  2DK5 A;  2XKO A;  1J75 A;  1ETW A;  4AM3 A;  4IOC F;  4N4N B;  2EV6 A;  3GFL A;  4W1U A;  2ETH A;  1GVJ A;  1ZGA A;  1RR7 A;  1I3A A;  3D5L A;  3OYN A;  3EQL F;  4AYB A;  3AKZ A;  2X6X A;  1JKP C;  3HHH A;  4QLC U;  3DU6 A;  4IHY A;  2VC1 A;  3KP4 A;  3OYH A;  4B47 A;  3FK7 A;  4B09 A;  2HXI A;  1PVE A;  2GOM A;  3OYI A;  3CCY A;  3R0J A;  2DCE A;  3WU0 A;  4OIR F;  3BTI A;  3F8M A;  4AIH A;  3ZOB A;  4IZZ A;  2D1H A;  1HOM A;  3WHB A;  4F55 A;  2E1M B;  3LOC A;  2B63 J;  4BHB A;  1ZG5 A;  1OCC H;  1TT5 B;  3OOP A;  1S8N A;  3ZGK A;  3SXY A;  4YG2 F;  2YU9 J;  5HS8 A;  2ZNY A;  3K69 A;  1BIA A;  3UKG A;  2JJ7 A;  4HLX A;  2L2O A;  2O3F A;  1DGW Y;  3KET A;  1UEL B;  2XRO A;  4IX7 A;  1JJ8 C;  2UWM A;  1LEB A;  3G71 I;  4E7K A;  1ZRE A;  1D8K A;  2LF7 A;  1SD6 A;  2OAZ A;  4KA4 A;  1BBY A;  2K40 A;  1JKO C;  1MBK A;  1EKE A;  3WGG A;  4MTD A;  1R7J A;  2O03 A;  2VBW A;  4RLF A;  1ZEL A;  3E5U A;  3E6M A;  3KIO A;  1LVA A;  1YIT I;  2Z9O A;  2CYY A;  3WTT C;  2LYC A;  2Y0S A;  2R5Z A;  1TBX A;  4ASN A;  3K70 D;  3F22 A;  3G2B A;  3ZMU A;  2NNN A;  4D9J A;  4CCK A;  1O7F A;  4B43 A;  3LNQ A;  2EIM H;  3GLL A;  2PMZ A;  5HS7 A;  1J9I A;  4XMY A;  1Y0N A;  3G4S I;  1MKM A;  2X0L A;  1JE8 A;  2AHQ A;  2Y2Z A;  1WVR A;  2LKS A;  5B5E C;  1MIJ A;  2CW8 A;  2HDD A;  1UCR A;  1BR2 A;  2CH0 A;  2ICW G;  3CLO A;  3EDP A;  1JKR C;  4YRV A;  2FA5 A;  3HEF A;  2FOK A;  2FOW A;  5HLG A;  1XSX A;  1E3O C;  4IQJ A;  2K9S A;  1RZ4 A;  2ZCW A;  3ABL H;  2DU9 A;  3QAH A;  2YX7 A;  1KZH A;  1HQC A;  2WAE A;  3H0D A;  4IO9 F;  4E7L A;  1QBJ A;  4JOM A;  3HRT A;  4P96 A;  4LIV A;  3ERM A;  2A05 A;  3CCQ I;  2P5V A;  2DYS H;  4PJL A;  3WGH A;  1IJW C;  3TP0 A;  4GCV A;  1Z05 A;  2XF6 A;  3QU6 A;  4BJT A;  1H0M A;  1IN4 A;  4HYE A;  2R7V A;  4UVB A;  4IF4 A;  3HZJ A;  4KIF A;  2IBD A;  2XSD C;  1U8R A;  3P9K A;  2W48 A;  2P7C B;  4A0X A;  3KP2 A;  1OFC X;  3S1R J;  4I6Z A;  2K3P A;  4LB6 B;  1IN8 A;  2EK5 A;  3TDZ C;  3LL7 A;  2KDZ A;  1VQ7 I;  2K86 A;  2OF7 A;  1BL0 A;  4DZJ A;  1D0Z A;  3PO3 J;  2W4S A;  2KIS A;  4A3L J;  2M2E A;  1VND A;  4KN7 X;  4XL9 A;  3WTW C;  3LSG A;  4DNC A;  3GO5 A;  3SEQ A;  2QA4 I;  3ZQ7 A;  1FMV A;  5HOD A;  1N25 A;  2GBY A;  4XOT A;  4DJA A;  4K2E A;  1MND A;  2DBB A;  3PL8 A;  4OAZ A;  1KQ0 A;  1D0Y A;  2P6S A;  3CDL A;  2PBI A;  3CDH A;  2LY1 A;  3OY9 A;  2DA2 A;  2R7W A;  2WAQ N;  2MYS A;  3ABT A;  2EA4 A;  2Y0S N;  2AS5 F;  4PGH A;  3N97 A;  2ESN A;  1QGP A;  2XUB A;  3HM5 A;  1HKS A;  3HKZ A;  3MWM A;  4CYD A;  4R79 A;  4UV8 A;  2HQN A;  2OZ6 A;  4D0P A;  1BI3 A;  3OMY A;  2R7S A;  1GUU A;  2RGV A;  3SFZ A;  4OIN F;  4OIO F;  2QEX I;  1WPK A;  2JRM A;  5E1W A;  2C6Y A;  2DXI A;  5M5W J;  4HST A;  1ETQ A;  4Z6Y A;  4PJ0 C;  1FSH A;  2ME6 A;  1JTX A;  1LE8 A;  3CCE I;  2G7U A;  5IY5 H;  2Q0O A;  3EET A;  1MMD A;  2XHK A;  2UXX A;  3FXR A;  4AIJ A;  4QSH A;  2FMY A;  5IPA A;  3L2Q A;  4F52 A;  2F5F A;  2LOO A;  1XG1 A;  2LKX A;  1IRZ A;  2O0Y A;  3EUH C;  1WJA A;  3KP3 A;  4ZJZ A;  1U2W A;  2L9S A;  4U0V A;  4CUG A;  2DO7 A;  3OYK A;  2GXA A;  2CUF A;  4HW0 A;  1E2X A;  3VYS B;  3QQA A;  4FQG A;  1SD4 A;  4OAY A;  3BR0 A;  2DA6 A;  3E7L A;  2Y31 A;  3FKI J;  4E70 A;  1O3T A;  2QCO A;  1BW5 A;  2X6O A;  4P5O A;  4G8X A;  3K4K A;  5BOX A;  3QU3 A;  3VPR A;  3S1M J;  1Z21 A;  5IT9 Z;  3FM5 A;  3I4N J;  3GTG J;  3BC8 A;  3OYE A;  2EIK H;  2WWY A;  2I8D A;  4EGZ A;  3SYT A;  1T08 B;  3G6E I;  2QZ8 A;  4RMN A;  2M9H A;  4Y7N J;  1R5I D;  1Y0U A;  3X2Q H;  3VOD A;  3I3L A;  3RQ4 A;  2MFZ A;  2Z5U A;  2KKO A;  2EQR A;  3KLN A;  5J1Y A;  4EM2 A;  1GXQ A;  4HDV A;  1UAA A;  2VIX A;  3K6G A;  5D5U B;  2TRT A;  1QQI A;  2E2H J;  3C1D A;  3D5R C;  1SFX A;  5D5X B;  2QQ8 A;  3BQY A;  2ZXW H;  4BBR J;  3BZC A;  3PFY A;  3V7S A;  2NVQ J;  1SD5 A;  2CJJ A;  1S7E A;  3BRO A;  1KQ8 A;  2FSW A;  3TO7 A;  3LSM A;  5KHD A;  3AAF A;  3ZMV A;  1BOB A;  5KK1 A;  2FQ3 A;  3I54 A;  2IGK A;  2HZT A;  2O5R A;  4UV9 A;  1B8I A;  1F5T A;  1XPX A;  2ZXJ A;  3JTG A;  1AKH B;  1XGM A;  3JRC A;  2KLO A;  4UNO A;  2KZV A;  5KAF C;  1SVO A;  3HYI A;  4BQA A;  3SJM A;  1FIA A;  3QOD A;  3NRV A;  1B8I B;  2AQE A;  3BOQ A;  3ZR8 X;  4RM2 A;  1ZKG A;  2VT2 A;  3LSK A;  1YRN A;  1STZ A;  1R9T J;  5L3C A;  3ABU A;  1HDD C;  2ECC A;  1R58 A;  3RPU D;  3CUQ A;  3DFG A;  1Z3Y A;  5FD6 A;  3GX4 X;  4ETS A;  1I1G A;  1QZY A;  4XRF A;  4EQQ A;  1JGS A;  4XBF A;  4G6T B;  3FIW A;  4ENN A;  1OLT A;  5E8G A;  1BA5 A;  2BHY A;  4CCN A;  2M4K A;  4XKB A;  4HBL A;  5IOY A;  3DBH B;  2Y30 A;  2OTL I;  1IXR C;  1V5E A;  4IRH A;  3FHZ A;  2V6C A;  2Q8K A;  3PNT A;  3DXJ F;  2IJL A;  3N05 A;  3MZY A;  4PFO A;  2GXB A;  4Z2Y A;  3CQZ J;  4UB8 C;  1NHA A;  1QU3 A;  5FRO A;  3L1P A;  4RB0 A;  3S8P A;  4GO1 A;  4LMY A;  2EBI A;  2EIN H;  3G3Z A;  1I3Q J;  3MZH A;  3RZO J;  2STW A;  4CXF A;  1AWC A;  3J80 K;  2ZME B;  2DW4 A;  1IZ1 A;  3F8F A;  2VBY A;  3OIP A;  4NB5 A;  2CUZ A;  5H6Q A;  1YI2 I;  3S93 A;  3ULQ B;  1XCB A;  3M07 A;  2IGN A;  1FMW A;  1H9G A;  3HTU A;  2EZH A;  4V2G A;  3PO2 J;  1ZN2 A;  4N9I A;  1XGN A;  4EVI A;  5FLX Z;  4HQE A;  3GTK J;  1GV2 A;  1LVK A;  5CVR A;  1XDS A;  1WJF A;  3OYM A;  3JRE A;  1OCP A;  3AG3 H;  1IRX A;  3H36 A;  1W4M A;  2IXS A;  3OYG A;  3WU2 C;  4CO8 A;  2R5Y A;  1YLF A;  1G3W A;  2EH3 A;  4LK0 F;  2M45 A;  3FIS A;  1WGX A;  3BPX A;  1ZTR A;  4A93 J;  5JVT A;  2FNA A;  2FF4 A;  3IC7 A;  1AA7 A;  2KIF A;  3BR2 A;  4GXO A;  5D5V B;  5IOZ A;  2R5Y B;  4BQO A;  1UG2 A;  2STT A;  1TC3 C;  5DDG A;  3VSL A;  3HXL A;  4BU2 A;  1YFH A;  3HPH A;  2OTJ I;  5M5X J;  2IPQ X;  2XAG A;  5J40 A;  2TCT A;  2MG4 A;  4CCO A;  4PZJ A;  4B44 A;  3BJ6 A;  4CZC A;  4AU7 A;  4F7Z A;  5LHH A;  3IV5 A;  4ANJ A;  1HW5 A;  3TL4 X;  1MMG A;  3ASO H;  3V8K A;  1K61 A;  1XGO A;  1T8I A;  1S7O A;  2BGC A;  2E34 A;  2P6T A;  1VQN I;  2RQP A;  2IAI A;  4RGU A;  4PGG A;  3ZRG A;  1WHU A;  2XGD A;  1FOW A;  4A3J J;  4A3M J;  1PUF B;  2V1U A;  2CFX A;  4YII A;  2ZKZ A;  2HVR A;  3PQK A;  3GUD A;  5IT3 A;  2HU9 A;  3JW4 A;  4IHX A;  1U5T C;  1B72 B;  3PSF A;  1TWF J;  2KFD A;  3GZN B;  2A6E F;  3CMY A;  2K5C A;  1HCR A;  2CFO A;  2VON A;  4CA0 A;  1KU2 A;  3OS0 A;  4G6Q A;  4F92 B;  1I5Z A;  1KGS A;  3DKW A;  3C2B A;  4XLP F;  3F23 A;  1FOY A;  3KCC A;  1B72 A;  2IGM A;  4XSZ F;  1QRY A;  2Q1Z B;  5HLT A;  2KL4 A;  4HRI A;  3E1S A;  3TW7 A;  2LY9 A;  3I53 A;  4L18 B;  3M7G A;  3QPS A;  4C2U A;  3C2H A;  4GDF A;  3KZY A;  4M9S A;  3VFZ A;  2OCC H;  4IXA A;  2M3A A;  4HG2 A;  4UUV A;  2IA1 A;  2R3S A;  3GBG A;  3BR1 A;  4DBR A;  3FMS A;  2L54 A;  2ZBK A;  2J5O A;  2RC4 A;  2VPR A;  3CTA A;  4LGW A;  2VJI A;  3RDI A;  1LJ9 A;  4XLC A;  3EPZ A;  1S72 I;  1P4W A;  3CDI A;  5EEA A;  3KZI C;  1I6H J;  2KIU A;  2EV0 A;  3L9F A;  3ROU A;  2W00 A;  1E17 A;  2XAH A;  2R7F A;  1QA6 A;  3VSK A;  3VEP A;  4NC6 A;  5FO5 A;  4ON0 A;  3LSP A;  3JAM Z;  2M0M A;  3CUQ C;  4IQ4 A;  1HDP A;  3HB9 A;  4II2 A;  2IS4 A;  4JK1 X;  1ON2 A;  2H8W A;  2L3D A;  4XNF A;  2V1D A;  3WTU C;  1Y39 A;  4AVZ A;  1SVM A;  5C44 J;  3CCM I;  2JA6 J;  5E79 C;  1VQP I;  2M8G X;  4MGR A;  1ETV A;  2Y48 A;  5K1Y A;  4RS8 A;  1U3E M;  3OYB A;  2W84 A;  1JT6 A;  5KAI C;  2OUM A;  3NEU A;  4UXN A;  3ZN0 A;  5LLQ A;  1LQ1 A;  1S5L C;  1QZE A;  3QWL A;  3G73 A;  1OCT C;  2BE5 F;  3SQN A;  3SZG A;  3GLX A;  1P2F A;  1W7P D;  4BNC A;  1DGR M;  1J09 A;  2Q2E A;  1SAX A;  1TQI A;  1EH6 A;  4H0E A;  1YJN I;  2HOT A;  2HVS A;  1R36 A;  2ZB9 A;  3HRM A;  3ZXS A;  3IP4 B;  2K85 A;  4M6X A;  3K1N A;  1MGT A;  1F9N A;  2M4G A;  2P7V B;  2Q2E B;  2A6T A;  5ILU A;  3A01 B;  2JA7 J;  1HW1 A;  3OWT A;  3WG7 H;  4HOB A;  1BJA A;  1U78 A;  5L3F A;  2RQQ A;  4PJJ A;  4XLN F;  2IRF G;  3B6A A;  3M1E A;  5LHG A;  4ZTJ A;  5ERI A;  1FEX A;  5E3L A;  4BGD A;  3BTC A;  2VXZ A;  3BY6 A;  2UUZ A;  3FXQ A;  3A01 A;  4P9U A;  2H6B A;  4J01 A;  4XKC A;  2HPI A;  1TWC J;  1Y8Q B;  3DP7 A;  5FGM A;  2FQ4 A;  1JGG A;  1N75 A;  3Q9S A;  2DMP A;  3L2V A;  5BNG A;  2CWE A;  3H9Q A;  5JI6 A;  1K6O A;  2EFP A;  4OMZ A;  3A03 A;  2LVS A;  4L9N A;  2MSY A;  4XSX F;  2HEO A;  3HDD A;  4XN0 A;  1LFP A;  1B9N A;  1X4O A;  3O8G A;  2E35 A;  2HI3 A;  1U9N A;  3OYA A;  4CYC A;  2DOF A;  2QEN A;  5J1R A;  1ZHF A;  2NOJ B;  2QKM B;  4EJT A;  2HVQ A;  2E7W A;  3A1Y A;  1FZP B;  1O3R A;  3FXM A;  1Q1H A;  4I98 B;  5C4J J;  2ZJP F;  6PAX A;  1XDU A;  4Y17 A;  2X6W A;  4I0B A;  2BBY A;  2GM4 A;  4HNU A;  2BY3 A;  2O6G E;  3BWG A;  3WTS C;  4DYC A;  2KT0 A;  4ENM A;  4FCY A;  1RNL A;  5GPA A;  2MW8 A;  1DP7 P;  3GTM J;  2BY0 A;  5HLH A;  2M7B A;  4M3E A;  4BDZ A;  1FOX A;  2K3F A;  2FBH A;  4XM3 A;  5J47 A;  1KU3 A;  3COA C;  2LFB A;  3FXJ A;  4ZYE A;  4BH9 A;  4EJO A;  1JHH A;  1DP3 A;  3HGG A;  2VKV A;  1Z9C A;  2GOX B;  4CIC A;  4FTH A;  2V9K A;  4EEF G;  5DS9 A;  2DI3 A;  2YR2 A;  3IWZ A;  3RTR A;  3WTY C;  4IHT A;  3PUF A;  2DDA A;  2P8T A;  2LBF B;  5J6X A;  4C3H J;  1V4R A;  4UUS A;  3UNG C;  3BTL A;  1ZQ3 P;  1A04 A;  5LGT A;  4RB3 C;  1O4X A;  3V42 A;  5ICG A;  3K7A J;  1Y6I A;  3J81 K;  4I76 A;  3EUH A;  4MO7 A;  4RLQ A;  3I55 I;  1A35 A;  5JR3 A;  1MNE A;  4TV7 A;  4WK8 F;  4B48 A;  2HWV A;  2X4H A;  3RSN A;  4O3M A;  5DUK A;  1MBJ A;  2LG4 A;  1YHQ I;  5J4V A;  2RKH A;  2M1B A;  4WCG A;  3F8C A;  1B9M A;  4I02 A;  3N4M A;  2ZSI B;  1BI2 A;  2DMU A;  4A3K J;  2AQF A;  3D0S A;  1YRN B;  3DWL E;  3PIP F;  2QWW A;  2VL8 A;  4L9V A;  1T0F C;  3CUQ B;  2XB0 X;  2XAS A;  5E1Z B;  3DLL F;  1S9H A;  2EB7 A;  2O9L A;  4AC0 A;  3ABM H;  3B73 A;  5D8K B;  4R8H A;  5FD5 A;  1Z1D A;  5BQT A;  1V5F A;  4E4H A;  2ZC2 A;  3J80 Z;  2VJ4 A;  3TED A;  4EJU A;  4F91 B;  1FSE A;  4OMY A;  1X1P A;  2ACJ A;  2ZFU A;  4ZC3 A;  3KYL A;  3K0L A;  3C2G A;  5FLM J;  1BI1 A;  2BVM A;  2XGE A;  3H0G J;  2GIV A;  3I64 A;  2YU3 A;  1YO5 C;  5J8C A;  5F1R A;  3BT9 A;  5H20 A;  1HSJ A;  1XB4 A;  3P7N A;  1UJ8 A;  2P0W A;  4I01 A;  4MTE A;  1SC7 A;  4G7O F;  5JHU A;  5FKM A;  3ZN1 A;  5DD8 A;  2BEO A;  3WOD F;  2LP0 A;  3ZQI A;  2IVM A;  3LWF A;  1P4A A;  2K4J A;  5F27 A;  3GTL J;  3LQQ A;  4L5E A;  2XVC A;  4Y13 A;  2HOA A;  1JJ6 C;  2O8X A;  2LTP A;  5LEJ A;  5EJC A;  2FML A;  3IUO A;  1W5T A;  5BPD A;  1WRJ A;  3DBR B;  1OYY A;  4X0G A;  2BW3 B;  2VBZ A;  2M34 A;  1MNM C;  2GA2 A;  5E3O A;  2VLA A;  1G2H A;  5B3S H;  2GLO A;  2WY7 Q;  5F08 A;  4LLN A;  1O3S A;  4B4C A;  3RYP A;  2VBX A;  2ZJQ F;  4XON A;  4JX5 A;  3S32 A;  1FJL A;  1RUO A;  3CF5 F;  1Y1W J;  3HOZ J;  2IA0 A;  2E1C A;  1YS6 A;  2MA3 A;  4BAC A;  3JAM K;  2QSH X;  1RKT A;  1YIO A;  1GV5 A;  1IF1 A;  1APL C;  4HAM A;  3U1K A;  5IYB J;  2CQX A;  3CMA I;  4IHS A;  2QGU A;  4BKX A;  3H5N A;  3NAU A;  1DQU A;  1MBE A;  3IH2 A;  4BS9 A;  3RKQ A;  4EGY A;  3OSG A;  2HKO A;  1G59 A;  2JQ7 A;  1ACI A;  4DYQ A;  1WJB A;  5DYM A;  2RN7 A;  5EYR A;  1WJD A;  4YIF A;  2K27 A;  2DT5 A;  4GGG A;  2GAU A;  2HYF A;  4IOA F;  4I09 A;  2DN0 A;  1AKH A;  3PFI A;  3OV8 A;  1R5H A;  1N78 A;  2EIJ H;  4O6J A;  2NVY J;  3CC7 I;  3W2A A;  3FK6 A;  4Y33 A;  4E7J A;  1U8B A;  3S17 J;  2X85 A;  5CVV A;  4MFD A;  3MEX A;  3BG7 A;  2XV4 S;  2LK2 A;  1MJ9 A;  1A6I A;  1RI7 A;  1YW8 A;  4HEA 2;  2Z3Y A;  4BHC A;  1IXS B;  2EZK A;  1ZLJ A;  3J7Z I;  2VKH A;  1EJ9 A;  3R4K A;  3J7A Y;  1IXC A;  1WI3 A;  1D3Y A;  3OS2 A;  4ZTF A;  4XLF A;  3R60 A;  3OR2 C;  2Y9Y A;  2K02 A;  2GIZ A;  4RGR A;  2X1E A;  4QPQ A;  3LA7 A;  5LRR A;  3TBI A;  1LNW A;  4OWR B;  1F1Z A;  3C18 A;  4M6Y A;  1B1B A;  4BE1 A;  1SFE A;  5B66 C;  1G3Y A;  2QF7 A;  3S14 J;  1D5V A;  1HBX G;  4NQW A;  2OQG A;  4XLH A;  4XR6 A;  1JKQ C;  3HSF A;  3P9C A;  1YQA A;  3R61 A;  3GTO J;  4X6A J;  4DZP A;  2Z33 A;  5JLX A;  4M6V A;  3ZQQ A;  1SAU A;  3OYC A;  3TP3 A;  4NQW B;  1JT0 A;  5JLW A;  1SMT A;  4V2F A;  4XRS G;  3CUO A;  1H89 C;  3HSE A;  5CPR B;  2JK3 A;  3VYT B;  2VT3 A;  2Y0M A;  3KEO A;  3PJR A;  3HUG B;  3NWT A;  1R1T A;  2LLK A;  4MQ9 F;  5TJJ A;  5DV5 A;  3HGY A;  1ZG1 A;  5LBQ A;  3ZMS A;  2CS3 A;  2DTZ A;  2MD0 A;  2ID3 A;  2EFN A;  3GFI A;  3ERE D;  1R1U A;  5JVG F;  1YTY A;  4L9J A;  2EA2 A;  1LDJ A;  1C0W A;  3RKX A;  3HUG A;  4KDP A;  3W6J B;  2R92 J;  3T5X A;  5K7Z A;  5M5Y J;  3O3K A;  1XCV A;  2XPV A;  4BHP A;  2KRH A;  2DA4 A;  1VQK I;  2QUF A;  2K9Q A;  1IC8 A;  4EM1 A;  2V7F A;  3WE3 A;  4LOC A;  5FKL A;  3CLQ A;  5HLI A;  2KIM A;  1TLH B;  4A5N A;  2UXN A;  5LRS A;  2FE3 A;  4M72 A;  1BIB A;  2BY1 A;  3WHC A;  3M8E A;  3GVA A;  2VN2 A;  4HX8 A;  3ZMZ A;  1MSE C;  1UZC A;  2F5E A;  4RBO A;  1MZB A;  1J2X A;  1FBS A;  2F5C A;  3IH4 A;  3RPQ A;  1EH7 A;  2DFI A;  2IP2 A;  1ERD A;  2CW0 F;  3E6C C;  1FP1 D;  3BR3 A;  4QIW N;  1YIJ I;  3HOV J;  4HV5 A;  5ILV A;  3HOT A;  2IS1 A;  2DT6 A;  4WXD A;  3AFH A;  2E60 A;  3GW2 A;  1G3S A;  3A0H C;  4BAY A;  5HDK A;  2M7A A;  4BXU A;  2E36 A;  4YFN F;  1XMX A;  4U7D A;  1LEA A;  1HLV A;  3TMO A;  3BZK A;  3MQ0 A;  2ZME C;  2L5Q A;  1EF4 A;  2WTE A;  3HOS A;  4AUX A;  2V4J C;  1IN5 A;  2HFH A;  5EF6 A;  2CGP A;  4CCM A;  3CME I;  2IS2 A;  1R5G A;  3GTJ J;  3FBI B;  1BC7 C;  3SEZ A;  1MD0 A;  1Z77 A;  3F8N A;  2JSC A;  1A6Q A;  4ENK A;  5F0F A;  5FFX A;  4MEY F;  3CCU I;  5DD4 A;  5D6F A;  3HTS B;  3KP5 A;  5FKN A;  3SDG A;  5C3E J;  4LIU A;  2HOE A;  3CF2 A;  1YYV A;  5GAE J;  4A3D J;  2JZY A;  1TWG J;  5DM6 F;  4CYC B;  4IJA A;  2VJ5 A;  3E3V A;  2PMZ N;  1MW7 A;  3VDX A;  2PMU A;  4HX4 A;  2O7O A;  3CCS I;  1FYL A;  5D4S A;  1WI9 A;  3AG2 H;  1VFC A;  2LY2 A;  2FBK A;  2KJC A;  2ID6 A;  3RYR A;  2P81 A;  2B9S A;  2DYR H;  5LGN A;  3J81 Z;  2MC4 A;  1X4P A;  2ISY A;  3NQO A;  3JRF A;  2BY2 A;  2B7E A;  2DMQ A;  3LMM A;  5CQG A;  3S16 J;  2W25 A;  1SFK A;  1FBU A;  2FEZ A;  1T56 A;  5EZH A;  1S3J A;  2D2W A;  4FX4 A;  2M87 A;  4A5M A;  2H8R A;  1SFO J;  3K4B A;  4EMS A;  3K4C A;  3H5R A;  1S29 A;  4XID A;  1OCR H;  3JRD A;  3BLY A;  3H3Z A;  4E7H A;  4IRG A;  4G6D A;  2RVC A;  3DU5 A;  2J5P A;  3MKW B;  4DYR A;  2VQL A;  2VB6 A;  3Q0W A;  2D5V A;  3H35 A;  2ADU A;  5K5R A;  1M1E B;  3H9J A;  1YG2 A;  2OCE A;  1OKR A;  4P55 A;  2P5K A;  3D5S C;  5HDN A;  4XKW A;  5GTI C;  4A6E A;  2NOG A;  3MAJ A;  2WB1 N;  3W6V A;  2L7K A;  3LSI A;  1ZH5 A;  1UHM A;  3MZ8 A;  1UFM A;  2WV1 A;  1X1C A;  3F6V A;  4DBQ A;  1XS9 A;  1SFU A;  4XLE A;  1OR7 C;  2OV7 A;  5LHI A;  3LSR A;  1PYV A;  1ON1 A;  4X1E A;  4XQF A;  3FXU A;  4BQQ A;  2R7T A;  4BYY A;  1Z3X A;  1ZGW A;  3OSF A;  4UUT A;  5J1U A;  4U0Y A;  5JFR A;  3CJQ B;  5IP6 A;  1GHC A;  3CP8 A;  1R22 A;  2JVH A;  4WF2 A;  2NVT J;  3J7Y J;  5L3G A;  2UZK A;  3FKJ A;  3DEU A;  2KP6 A;  1MH4 A;  3Q0U A;  3GTQ J;  2LRD A;  2RDP A;  3M8J A;  1JUP A;  1P7I A;  3G1M A;  4ZH4 F;  5EEG A;  2Y69 H;  2OBP A;  2DDB A;  3I4P A;  1KQ9 A;  2XAU A;  3MVP A;  2V1N A;  2IW5 A;  1SMY F;  1VQ8 I;  3DKY A;  2VC0 A;  3GYH X;  3G1O A;  2VOO A;  3BG3 A;  4LG0 B;  3OIQ A;  3EUA A;  5LGU A;  2L7F P;  1UG0 A;  5IT9 K;  5BPI A;  5FRM A;  1JUS A;  2JRT A;  3IL2 A;  2KDO A;  3DPT A;  1IRG A;  1YW7 A;  1MJB A;  3JRA A;  1FNN A;  3HSR A;  1T6S A;  1K4S A;  1MMN A;  1FYK A;  1FLI A;  3E6B A;  2JTV A;  2O8K A;  3TO9 A;  1OCO H;  1EV7 A;  1K79 A;  3PM1 A;  5EGO B;  4D5F A;  3HRU A;  4MNU A;  2E2I J;  2E1N A;  3CCV I;  3IRR A;  1ZYR F;  4P9F A;  1TQP A;  1XTA A;  2NXN B;  2P5L C;  2WY8 Q;  3WGI A;  2VQG A;  2L02 A;  2ELJ A;  3DF8 A;  1DU0 A;  2VOP A;  2QBY A;  2WAF A;  5HS9 A;  4C2M J;  1KA8 A;  1JXS A;  4FE7 A;  2IA2 A;  4RAG A;  4CDG A;  2GZW A;  1L0O C;  1OCZ H;  1TT0 A;  4L0Y B;  1Z0X A;  2M8E A;  4A3E J;  1S6L A;  1SVL A;  2G9W A;  3E6D A;  3BCB A;  1UHW A;  5FKK A;  3RKW A;  4J19 A;  2QBY B;  4ZYG A;  2LH9 A;  5HNF A;  4JBA A;  2ESH A;  1WCM J;  2F6C A;  3CZ6 A;  1VQL I;  2M0C A;  2XRL A;  3PUB A;  1ZG3 A;  1YJW I;  4JX4 A;  3FWE A;  3R0A A;  4M71 A;  3V4G A;  3BTJ A;  4KJZ A;  3RI4 A;  3Q5F A;  3DPU A;  3WTZ A;  2XAQ A;  4I0A A;  1MBF A;  1JTY A;  2YUS A;  4P1W A;  2HNH A;  1WJC A;  2ZO4 A;  3T1B A;  1WH5 A;  2DTR A;  3ESW B;  3I9V 2;  3ZMT A;  4D7N A;  3ISP A;  3MD2 A;  4DGW B;  2MLK A;  4A12 A;  1B59 A;  3DTI A;  1K83 J;  4U7B A;  1BJZ A;  3BR5 A;  1TWA J;  2CU7 A;  1RR8 C;  2DA5 A;  1IV6 A;  1Z6R A;  4C3J J;  3BCA A;  2NVX J;  1X3U A;  2X9D A;  4RM3 A;  4ENJ A;  1MMS A;  1X19 A;  4FT8 A;  4UVC A;  5A2Q K;  2E1O A;  2H09 A;  3KP7 A;  4I2O A;  4LB5 A;  2CMP A;  2LSO A;  1FOK A;  1OYW A;  3KEY A;  2PFB A;  1EA3 A;  1V5G A;  5A2Q Z;  1QHG A;  2ME0 A;  2NYX A;  3ZQC A;  3FXK A;  1FPQ A;  1AU7 A;  4XK4 A;  2DA3 A;  1X1B A;  5M3F J;  1HW2 A;  3HHG A;  2VKE A;  4B8X A;  3V7R A;  5TIS C;  3H9G A;  1R71 A;  2R5Z B;  1V55 H;  1G6N A;  3ELK A;  3ZMD A;  3CO7 C;  1FIP A;  4KUM A;  5ICF A;  4N4O B;  1T2K A;  2E1M C;  3W2W A;  4UHT A;  3F8B A;  4BJ5 C;  3NAR A;  4LG3 A;  1T95 A;  3PNY A;  2X1D A;  1E3H A;  4HF2 A;  3CCR I;  3T0Y A;  1LUJ B;  2RNJ A;  3RCO A;  4MQV A;  2IGO A;  3J7A O;  3S1N J;  5KCM A;  1AHD P;  4PSX A;  1FY7 A;  3FDY A;  4KIT B;  3SDB A;  4B1R A;  2XAJ A;  1XN7 A;  3RKY A;  2ZXI A;  3RQI A;  3S2W A;  4IHV A;  3A02 A;  3I71 A;  3FMR A;  3DEE A;  2PJR A;  1K4T A;  4KNY A;  4JP0 A;  1FBQ A;  5KVR A;  4BJ6 C;  1VZ0 A;  3KYD B;  4QTR A;  3F9K A;  1LPQ A;  3BJO A;  4AWX B;  1KU9 A;  3TW6 A;  3QRF F;  3DLA A;  3W6K B;  1J59 A;  5ICC A;  2H27 A;  2G0E A;  4YFX F;  5EDN A;  2JWT A;  2R0Q C;  4RAY A;  2L9N A;  2WC2 A;  3OL4 A;  4H4K C;  3IAS 2;  5D8L B;  1REP C;  1D0X A;  3ECH A;  4M3D A;  5DUI A;  2X6Y A;  4XLA A;  3QPT A;  2QVO A;  4Y3O A;  1A31 A;  4EV0 A;  2R7Z J;  2DQL A;  4O5V A;  2M5W A;  1SEU A;  3FF5 A;  5F0C A;  5B1B H;  4KIB A;  1TNT A;  4DOZ A;  2DOA A;  3ECO A;  3LQR A;  1PP7 U;  4U0W A;  5AON A;  3E5Q A;  1X2M A;  2CQQ A;  3K4N A;  3RZD J;  1AOY A;  3LST A;  1I27 A;  1MDM A;  1TL8 A;  2NS8 A;  3OR1 C;  1I50 J;  1TP4 A;  4WXC A;  4BL0 B;  4PDK A;  4NC7 A;  1ZGJ A;  3C7J A;  1P92 A;  4BDY A;  2ZJ2 A;  3BZ6 A;  3D1N I;  2O61 A;  4HNV A;  2QQ9 A;  2HYJ A;  4HNT A;  4UVA A;  1A5J A;  1T33 A;  3L00 A;  4ITV A;  1IGN A;  2HZD A;  1TZL A;  1VQ5 I;  3VOE A;  2ECB A;  2PQ8 A;  2R4G A;  5EZG A;  2DPU A;  3TDU C;  1KU7 A;  5IYC J;  1W0T A;  5GPC A;  3CD6 I;  4A3B J;  2NNY A;  1HC8 A;  1F36 A;  2A69 F;  3KYC B;  3ABK H;  3I56 I;  1WFX A;  2FD5 A;  2VQC A;  2D45 A;  3MKL A;  4HF1 A;  2JA8 J;  1NK3 P;  4HLY A;  2VUM J;  5E20 A;  1ZLK A;  3JRI A;  2K9L A;  1MBG A;  1MJA A;  3LSH A;  5CVI A;  3ZQF A;  4L5I A;  2OJE D;  4N0B A;  4A3C J;  1A36 A;  1E3P A;  2JA5 J;  2MGQ A;  3BJA A;  1CGP A;  4XRM A;  5CJ9 A;  5BMZ A;  5CVU A;  2JVG A;  3K2Z A;  1WQ2 A;  4A0Y A;  3H1C A;  5ILS A;  5AIQ A;  3WTX C;  1YJ9 I;  4ZDO A;  3GXO A;  2DMN A;  2VQH A;  4V19 K;  4KIG A;  2VXD A;  2OU2 A;  2HKX A;  4BE2 A;  3LAP A;  3SZP A;  4M3B A;  4S04 A;  4HA8 A;  4A3G J;  2A5W A;  4S05 A;  1N77 A;  4Q48 A;  3I58 A;  2MAB A;  3QYE A;  5TGT A;  2XPW A;  3U2R A;  4ZZD A;  1RPW A;  2N8G A;  3C3W A;  2R7D A;  4ZZL A;  3FXO A;  1KYZ A;  3GWZ A;  1UMQ A;  1NG6 A;  4MHG A;  3HOY J;  4PJN A;  3OYL A;  4AIK A;  2LRE A;  3SZT A;  2DA1 A;  1IRF A;  2I10 A;  2KIQ A;  3OS1 A;  3F3X A;  5D4R A;  1YOV B;  2Y9Z A;  2XAF A;  3PIO F;  5H2F C;  2NS7 A;  4LJZ F;  1QVT A;  2E5Z A;  4CZZ A;  4XIC A;  2VKD A;  2GXG A;  3NWS A;  2L01 A;  4JYK A;  2XDV A;  4LIT A;  4C2T A;  5E17 F;  2L0K A;  4ESB A;  2A61 A;  2FXA A;  3QP6 A;  4IHW A;  3CC2 I;  3F6O A;  2CG4 A;  3Q9V A;  5IP9 J;  2PLY A;  4KIS A;  4GYI A;  1YW9 A;  2L7M P;  2MD5 A;  2WBM A;  2DOE A;  2JT1 A;  3S15 J;  4DW6 A;  1NTC A;  1X3Z B;  5E3M A;  2L9V A;  2XGC A;  1O3Q A;  1T39 A;  3L2R A;  5H6R A;  2EFQ A;  1X1A A;  5CKT A;  3HG9 A;  1IG7 A;  2RRE A;  5GTH C;  3F72 A;  2CUE A;  4D5C A;  2BHZ A;  1PDN C;  2OQR A;  2V9V A;  1W0U A;  2VPL A;  4ESJ A;  1E0E A;  1ETK A;  3MMY B;  1BM9 A;  1X3W B;  1FWZ A;  1J7K A;  4FET A;  2R7X A;  3CJN A;  5HOO A;  2NAZ A;  1NG7 A;  3KLO A;  2FX0 A;  1P6R A;  3CJT B;  2H1L A;  1FTT A;  3MCZ A;  2HDW A;  4KT5 C;  3Q3S A;  5D6E A;  5TRD A;  1ZRD A;  1T0F A;  1G8X A;  4ZYA A;  2HOS A;  4G9Y A;  4LG0 A;  2PMH A;  1O7L A;  2H1K A;  2R7U A;  3LFU A;  3QPH A;  4M9X A;  3SHF A;  4KYW A;  1OR7 A;  2F2E A;  5EG0 A;  1IO2 A;  5F64 A;  3GTP J;  1P4X A;  1Z91 A;  3IAM 2;  4B3A A;  2QKL B;  2BXZ A;  4BUP A;  3DTK A;  5HVQ C;  3K4J A;  1U5T A;  1H88 C;  2ELK A;  1RET A;  1PUE E;  3O6B B;  3I4M J;  3ZQH A;  3KEQ A;  4L0Z B;  3DKX A;  4B3X A;  3WTV C;  5HDG A;  2COM A;  3JSO A;  5IYD J;  1DDN A;  4PCQ A;  3O2P E;  4E7I A;  3I59 B;  3S3O A;  1GT0 C;  3L2U A;  2LR8 A;  2LD5 A;  3HBL A;  3GZ5 A;  1V3F A;  2R7R A;  1W5C C;  1R6R A;  4FHT A;  4BEH B;  5K5Q A;  1GDT A;  1SAN A;  4JQF A;  2VOD A;  2WB1 A;  2BV6 A;  2DFH A;  2F4O B;  3B6C A;  5E1X A;  4KMU X;  2BOL A;  1WSU A;  4Q5S F;  4HZF A;  1ONV A;  1FTZ A;  1QPM A;  2R7O A;  1I6X A;  1XGS A;  4IPA A;  1WZ2 A;  1S7A A;  2RAE A;  3CES A;  3V8L A;  2JPB A;  4AID A;  1MSF C;  1J5Y A;  1TW3 A;  1XMK A;  4KIC A;  1FP2 A;  3HKZ N;  5J4Y A;  2XRN A;  3H3U A;  1LFU P;  4GFB A;  4KMF A;  2QSF X;  2XF7 A;  1TNS A;  1U0J A;  4F93 B;  1X58 A;  1ZAR A;  4M3G A;  4CGZ A;  4HF0 A;  5K7F A;  1D1A A;  4UUS B;  2ZME A;  5M3M J;  1H8A C;  1BR1 A;  1BN5 A;  2ZFW A;  2IS6 A;  1XMA A;  2R93 J;  5D5W B;  1R00 A;  1K7A A;  4YIR X;  2FBI A;  4RGS A;  1ITY A;  4MIM A;  4XN3 A;  2M30 A;  1HF0 A;  1CQT A;  2VAS A;  3LA3 A;  1D1B A;  1ZRF A;  1X1D A;  2Z99 A;  1FYM A;  4ZDL A;  4WWC A;  1W5S A;  2W1O A;  2IT0 A;  4N9H A;  4DQ2 A;  2V1X A;  2KZG A;  3OYD A;  2LNB A;  3BQZ A;  2L4A A;  2YSR A;  5CYV A;  5E8I A;  4MEX F;  2ZXH A;  1Z7L A;  3K1P A;  4II3 A;  5GAD J;  4A69 C;  1H9T A;  3G1L A;  1ZAO A;  2LC2 A;  2AXL A;  3K1M A;  3K2A A;  5DCF A;  5K5O A;  1ZR2 A;  4PSW A;  4CH7 A;  2CQ7 A;  1YS7 A;  2B0L A;  3CP2 A;  2MH2 A;  3AL0 B;  1UB9 A;  1K78 A;  4NUB A;  2E5N A;  5LD2 C;  4A6D A;  1X2N A;  2CUJ A;  1SD7 A;  2NVU B;  1KON A;  2JMW A;  3S3M A;  2MBF A;  4QPO A;  1F4K A;  2CQN A;  4OIP F;  1ORK A;  1DPU A;  5FFZ A;  4CCL A;  2QQA A;  3VWB A;  1ULY A;  3OYF A;  3EYI A;  2FJ1 A;  2DT7 B;  2JN6 A;  4ESF A;  4LLG F;  3OL3 A;  4Q4Z F;  2PI0 A;  3QPL A;  5EGO A;  4XOR A;  2W7N A;  1T98 A;  1ETY A;  2DA7 A;  3HJE A;  1VQ9 I;  4BY1 J;  2K7L A;  4M74 A;  3IKT A;  4RAF A;  3BG9 A;  1W7P A;  1IUF A;  3ONQ A;  1IW7 F;  3S3N A;  1DU6 A;  2YX4 A;  5IP7 J;  3TO6 A;  5ED4 A;  4FE4 A;  4CCJ A;  2WA0 A;  3JSP A;  3DBL B;  3DEW A;  2QM3 A;  2Z2S B;  1HXD A;  3BR6 A;  3FX3 A;  1NK2 P;  2JPC A;  3E5X A;  3CCL I;  3IKV A;  1U6G A;  1IV8 A;  4S0H B;  2QLZ A;  2BW3 A;  2LDU A;  4A0Z A;  2FUG 2;  3PQJ A;  5GP9 A;  2PJR B;  1HKT A;  2CW7 A;  4MFE A;  3QP5 A;  2ISZ A;  2FNP A;  2V26 A;  3AG1 H;  4WX9 A;  3K10 A;  2YS9 A;  1L3L A;  1GVD A;  1Y56 A;  4YEL A;  1IN6 A;  2E19 A;  3U21 A;  1R4N B;  3V8J A;  2H94 A;  5DTD A;  3DTE A;  2EV5 A;  1Y1V J;  4RB1 A;  1B4A A;  1W1W E;  4DIQ A;  1HA8 A;  4M9Z A;  3HOX J;  3WU1 B;  4A3F J;  4QWQ A;  1CF7 B;  1IUY A;  3AL0 C;  1P7J A;  4XKV A;  2JSP A;  5ICE A;  3ASN H;  3V7C A;  1D5Y A;  2OA4 A;  4YEJ A;  4G7Z F;  1BW6 A;  4AD9 A;  4YFK F;  2OPT A;  3RJP A;  2A5Y B;  2CO5 A;  2DK8 A;  4OU0 A;  3T8T A;  4EJW A;  1CF7 A;  5HNH A;  3P5J A;  4AYB N;  4HX7 A;  3KFW X;  3QOP A;  1O57 A;  4G7H F;  1LDD A;  4D1Q A;  3MFK A;  4RGX A;  2Y75 A;  2CRG A;  3EUK L;  3K70 C;  2HS5 A;  3M8F A;  4BE0 A;  1BR4 A;  2FRH A;  2V9P A;  4HSR A;  1LKX A;  3K4M A;  3KPH A;  2R7Q A;  2RV8 A;  4IVN A;  2WV0 A;  2PEX A;  3IWF A;  1ODD A;  5CLS A;  3P9I A;  5FJ8 J;  2Z16 A;  1ZRC A;  1VTN C;  3FM3 A;  3HL2 A;  2HTS A;  2V79 A;  3FMQ A;  2MC3 A;  1XX5 A;  2EZL A;  3CJR B;  1OJL A;  3K4L A;  3FBN B;  2EFO A;  5B1A H;  1UHS A;  3W2V A;  4FAS D;  4FIS A;  4UB6 C;  3LFK A;  4NBQ A;  4C9Y A;  1Q1V A;  4MLO A;  3GCM A;  1LB2 A;  1J0R A;  2L4M A;  5FRN A;  1G3T A;  3IRQ A;  1ENH A;  3UR3 C;  1TQM A;  1ZK8 A;  1RUN A;  9ANT A;  1TW2 A;  4Y15 A;  1VQ6 I;  2F48 A;  2XB5 A;  2YPR A;  2KJB A;  2OZU A;  3BG6 A;  3L09 A;  4BY7 J;  4G12 A;  5JHF A;  2EZI A;  2LKP A;  2BXY A;  4C3I J;  1LE8 B;  1MMA A;  4UY8 I;  3F0C A;  4J00 A;  4Y4R A;  3ZQL A;  2GQQ A;  1B6A A;  2XF5 A;  2KMU A;  4GYG A;  1IAW A;  2F5V A;  3IH3 A;  2DAO A;  2DPD A;  4EM0 B;  3E97 A;  1WH7 A;  4E6K G;  3WG9 A;  2ZJR F;  1F43 A;  2HTJ A;  2GA1 A;  2HYG D;  3W3C A;  4E7S A;  4BBS J;  1TTY A;  2EWN A;  4GRI A;  3AG4 H;  1Z67 A;  1QZZ A;  1JHF A;  5BS6 A;  1IDZ A;  1XSV A;  2K9M A;  3HRS A;  2V6E A;  3M4O J;  3S1Q J;  2E2J J;  1BI0 A;  1BC8 C;  3CMM A;  3U9G A;  3GF2 A;  5LFA A;  1MBH A;  5E3N A;  5FLV A;  2L7Z A;  2OC6 A;  2NS0 A;  3MKZ A;  1G4D A;  2HQA A;  3H5A A;  4KN4 X;  3TKY A;  3TQN A;  1XC5 A;  2ZSH B;  1JI8 A;  3DCF A;  2XC7 A;  3SFI A;  2K9N A;  2CV2 A;  1T38 A;  2DMT A;  2IEK A;  2XIG A;  3TOA A;  3JRB A;  1YX5 A;  2JA2 A;  2F5D A;  1MDM B;  2XPU A;  4Y52 J;  3KX2 A;  5DM7 F;  2EFW A;  4LFU A;  2HQR A;  2CV0 A;  5E18 F;  4F3Q A;  4HV6 A;  2LBF A;  2EPF A;  1RES A;  3OOU A;  4IL6 C;  4KT6 A;  2EIL H;  1WWX A;  5J3L A;  4C30 A;  1LDK B;  1D8J A;  3O8H A;  3L2C A;  5J8F A;  2L9R A;  4ZDP A;  2HGC A;  3RPU A;  2DLL A;  4OOI A;  2E7X A;  3GFJ A;  2Z1D A;  1R4M B;  1TWH J;  2DFF A;  2ELH A;  3JTH A;  4M73 A;  3LA2 A;  4RAZ A;  3HPG A;  1BOA A;  2XSJ C;  1U5T B;  3TOB A;  1R1V A;  4NNJ A;  3ZP5 A;  2AO9 A;  4OIQ F;  3A4C A;  2A68 F;  3CO6 C;  2HDC A;  1VQM I;  1VI0 A;  3MN2 A;  1OQY A;  3I59 A;  3S2H J;  3OYJ A;  3HC7 A;  2BVL A;  2PG4 A;  5K7H A;  4EJV A;  3FXL A;  4BEH A;  3ZCO A;  3IHU A;  4CHU A;  2VE8 A;  1R49 A;  4NDL A;  4IEJ A;  4L5J A;  3CC4 I;  4M3F A;  1GXP A;  1K6Y A;  2CQK A;  4HQM A;  1GLN A;  1VQO I;  2UV1 A;  3E0J B;  3I5U A;  1YX3 A;  3DQV C;  2GWR A;  3GZ6 A;  1FX7 A;  3QYF A;  2KRC A;  1HKQ A;  3BP8 A;  2A6H F;  3BG5 A;  3DPL C;  4PJM A;  3TGN A;  4A2U A;  1XSD A;  2LF8 A;  2KPM A;  3BPV A;  2XKP A;  2I5U A;  2G7H A;  3HIF A;  2W82 A; 
#chains in the Genus database with same CATH homology
 4AVP A;  2K4B A;  2NRA C;  2W57 A;  1EH8 A;  1Z6T A;  4R1H A;  3GFM A;  4U88 A;  1XD7 A;  3T8R A;  5LEK A;  2XGX A;  1HST A;  2EJR A;  2CSO A;  3KE2 A;  1OMI A;  2MH9 A;  3BDD A;  5FB2 A;  4IRI A;  1I1S A;  3EYY A;  3H92 A;  4I7H A;  5EEH A;  5F6F A;  1FT9 A;  2MLG A;  3R6S A;  3REO A;  2DQR A;  5DCM B;  2OD5 A;  2QQB A;  4G94 A;  3DV8 A;  5L3E A;  3KP6 A;  3K9T A;  2BYV E;  2P4W A;  1WKM A;  1FC3 A;  1OYI A;  2PN6 A;  1KYW A;  5DCM A;  5AIP A;  1RIO H;  1OPC A;  4LK1 F;  2D1V A;  2TDX A;  2FU4 A;  1K78 B;  1DUX C;  2A07 F;  5L3B A;  5CVJ A;  1IN7 A;  4FX0 A;  1DPR A;  3I0T A;  3L7W A;  2QYO A;  1QO0 D;  4KFC A;  1UST A;  3ML6 A;  2H6C A;  1W7P B;  4ZYD A;  4ZYH A;  3B02 A;  4Q47 A;  1Z7U A;  2KRF A;  2ZNZ A;  3WE2 A;  2A3S A;  4L9T A;  4LD5 A;  3F21 A;  3U1D A;  1USS A;  5DEQ A;  3GEZ A;  1QNT A;  4LLL A;  2HR3 A;  1PP8 F;  3M9A A;  2W85 A;  2PJP A;  3KZZ A;  1R23 A;  4NHJ A;  4WXH A;  3VB2 A;  4HDU A;  5FLX K;  4RB2 C;  2W24 A;  5L3D A;  2VE9 A;  3LAJ A;  3ZPL A;  3FZV A;  3RIR A;  2DK5 A;  2XKO A;  1J75 A;  2EV6 A;  3GFL A;  2ETH A;  1GVJ A;  1ZGA A;  3D5L A;  3EQL F;  3HHH A;  4QLC U;  2VC1 A;  3KP4 A;  4B09 A;  3R0J A;  3WU0 A;  4OIR F;  4AIH A;  3F8M A;  2D1H A;  4BHB A;  1ZG5 A;  3OOP A;  1S8N A;  3SXY A;  4YG2 F;  5HS8 A;  2ZNY A;  3K69 A;  1BIA A;  4HLX A;  2O3F A;  3KET A;  2XRO A;  2UWM A;  1LEB A;  1ZRE A;  1D8K A;  2LF7 A;  1SD6 A;  2OAZ A;  4KA4 A;  1BBY A;  3WGG A;  4MTD A;  1R7J A;  2O03 A;  2VBW A;  3E5U A;  3E6M A;  1LVA A;  2Z9O A;  2CYY A;  3WTT C;  1TBX A;  4ASN A;  3F22 A;  3ZMU A;  2NNN A;  1O7F A;  5HS7 A;  1J9I A;  1MKM A;  2X0L A;  1JE8 A;  1UCR A;  3CLO A;  3EDP A;  2FA5 A;  5HLG A;  2FOK A;  1XSX A;  2G7H A;  1RZ4 A;  2ZCW A;  2DU9 A;  3QAH A;  2YX7 A;  1HQC A;  1QBJ A;  3HRT A;  4P96 A;  2P5V A;  3WGH A;  4GCV A;  1Z05 A;  3QU6 A;  1H0M A;  1IN4 A;  4HYE A;  4UVB A;  4IF4 A;  4KIF A;  1U8R A;  3P9K A;  2P7C B;  4A0X A;  3KP2 A;  4LB6 B;  1IN8 A;  2EK5 A;  3TDZ C;  2K86 A;  4KN7 X;  3WTW C;  4DNC A;  3GO5 A;  3ZQ7 A;  4K2E A;  2DBB A;  1KQ0 A;  2P6S A;  2PBI A;  3CDH A;  3ABT A;  2EA4 A;  2AS5 F;  4PGH A;  3N97 A;  2ESN A;  1QGP A;  2XUB A;  1HKS A;  3MWM A;  4CYD A;  4R79 A;  4UV8 A;  2HQN A;  2OZ6 A;  4D0P A;  1BI3 A;  2RGV A;  3SFZ A;  4OIN F;  4OIO F;  2C6Y A;  5E1W A;  1FSH A;  2G7U A;  2Q0O A;  3EET A;  2XHK A;  2UXX A;  3FXR A;  4AIJ A;  2FMY A;  2F5F A;  2O0Y A;  3KP3 A;  1U2W A;  4U0V A;  2DO7 A;  4HW0 A;  1E2X A;  1SD4 A;  4E70 A;  1O3T A;  4P5O A;  4G8X A;  5BOX A;  3QU3 A;  5IT9 Z;  3FM5 A;  2WWY A;  4EGZ A;  2QZ8 A;  1Y0U A;  3VOD A;  2Z5U A;  2KKO A;  3KLN A;  4EM2 A;  1GXQ A;  4HDV A;  5D5U B;  1QQI A;  3C1D A;  1SFX A;  5D5X B;  3V7S A;  1SD5 A;  3BRO A;  1KQ8 A;  2FSW A;  3TO7 A;  3AAF A;  3ZMV A;  5KK1 A;  2FQ3 A;  3I54 A;  2HZT A;  4UV9 A;  1F5T A;  2ZXJ A;  3JTG A;  1XGM A;  4UNO A;  3HYI A;  4BQA A;  3NRV A;  3BOQ A;  2VT2 A;  1STZ A;  5L3C A;  3ABU A;  1R58 A;  3CUQ A;  3DFG A;  5FD6 A;  3GX4 X;  4ETS A;  1I1G A;  1QZY A;  4XRF A;  4EQQ A;  1JGS A;  4XBF A;  4ENN A;  5E8G A;  4HBL A;  1IXR C;  4IRH A;  3FHZ A;  2V6C A;  2Q8K A;  3DXJ F;  2IJL A;  3MZY A;  2GXB A;  4Z2Y A;  1NHA A;  4RB0 A;  4GO1 A;  4LMY A;  3G3Z A;  3MZH A;  2STW A;  4CXF A;  1AWC A;  3J80 K;  2ZME B;  2DW4 A;  1IZ1 A;  3F8F A;  2VBY A;  4NB5 A;  5H6Q A;  3ULQ B;  1XCB A;  1H9G A;  3HTU A;  1ZN2 A;  4N9I A;  1XGN A;  4EVI A;  5FLX Z;  4HQE A;  5CVR A;  1XDS A;  1W4M A;  4CO8 A;  1YLF A;  1G3W A;  4LK0 F;  2M45 A;  3BPX A;  5JVT A;  2FNA A;  2FF4 A;  3IC7 A;  2KIF A;  4GXO A;  5D5V B;  2STT A;  5DDG A;  1YFH A;  2IPQ X;  2XAG A;  4PZJ A;  3BJ6 A;  4F7Z A;  5LHH A;  1HW5 A;  3V8K A;  1XGO A;  1S7O A;  2BGC A;  2P6T A;  2RQP A;  4RGU A;  4PGG A;  2V1U A;  2CFX A;  4YII A;  2ZKZ A;  3PQK A;  3GUD A;  5IT3 A;  3JW4 A;  1U5T C;  2A6E F;  2VON A;  1KU2 A;  4G6Q A;  1I5Z A;  1KGS A;  3DKW A;  4XLP F;  3F23 A;  3KCC A;  4XSZ F;  3I53 A;  4L18 B;  3M7G A;  3KZY A;  4M9S A;  3VFZ A;  4IXA A;  4UUV A;  2IA1 A;  2R3S A;  3FMS A;  2L54 A;  2ZBK A;  2J5O A;  2RC4 A;  3CTA A;  4LGW A;  3RDI A;  1LJ9 A;  1P4W A;  2KIU A;  2EV0 A;  3L9F A;  3ROU A;  1E17 A;  2XAH A;  2R7F A;  3VEP A;  5FO5 A;  4ON0 A;  3JAM Z;  3CUQ C;  4JK1 X;  1ON2 A;  2L3D A;  2V1D A;  3WTU C;  4MGR A;  2Y48 A;  5K1Y A;  4RS8 A;  1U3E M;  2W84 A;  3NEU A;  4UXN A;  3ZN0 A;  5LLQ A;  1LQ1 A;  3G73 A;  2BE5 F;  3SQN A;  3GLX A;  1P2F A;  1W7P D;  4BNC A;  2Q2E A;  1SAX A;  1TQI A;  1EH6 A;  4H0E A;  1R36 A;  3HRM A;  4M6X A;  3K1N A;  1MGT A;  1F9N A;  2P7V B;  5ILU A;  1HW1 A;  4HOB A;  1BJA A;  1U78 A;  5L3F A;  4XLN F;  2IRF G;  3M1E A;  5LHG A;  5ERI A;  2VXZ A;  3BY6 A;  3FXQ A;  4P9U A;  2H6B A;  3DP7 A;  5FGM A;  3Q9S A;  2CWE A;  5JI6 A;  1K6O A;  2EFP A;  4OMZ A;  2HEO A;  4L9N A;  4XSX F;  1B9N A;  2QEN A;  1ZHF A;  4EJT A;  2E7W A;  1FZP B;  1O3R A;  1Q1H A;  4I98 B;  6PAX A;  1XDU A;  4Y17 A;  4I0B A;  2BBY A;  2O6G E;  3BWG A;  3WTS C;  4ENM A;  1RNL A;  1DP7 P;  5HLH A;  2FBH A;  1KU3 A;  3COA C;  4ZYE A;  4BH9 A;  4EJO A;  1JHH A;  1Z9C A;  4CIC A;  2DI3 A;  2YR2 A;  3IWZ A;  3RTR A;  3WTY C;  4IHT A;  2P8T A;  5J6X A;  1V4R A;  1A04 A;  5LGT A;  4RB3 C;  5ICG A;  3J81 K;  3EUH A;  5JR3 A;  4TV7 A;  4WK8 F;  2HWV A;  2X4H A;  4O3M A;  5DUK A;  2RKH A;  2M1B A;  4WCG A;  3F8C A;  1B9M A;  4I02 A;  3N4M A;  1BI2 A;  3D0S A;  2QWW A;  4L9V A;  3CUQ B;  2XAS A;  5E1Z B;  2EB7 A;  3B73 A;  5D8K B;  4R8H A;  5FD5 A;  1Z1D A;  5BQT A;  3J80 Z;  4EJU A;  1FSE A;  4OMY A;  2ACJ A;  3K0L A;  1BI1 A;  3I64 A;  2GIV A;  2YU3 A;  1YO5 C;  5J8C A;  5F1R A;  5H20 A;  1HSJ A;  1XB4 A;  3P7N A;  4I01 A;  4MTE A;  4G7O F;  5JHU A;  3ZN1 A;  5DD8 A;  2BEO A;  3WOD F;  2IVM A;  3LWF A;  1P4A A;  2K4J A;  3LQQ A;  2XVC A;  4Y13 A;  2O8X A;  5LEJ A;  2FML A;  5BPD A;  1W5T A;  1WRJ A;  1OYY A;  2VBZ A;  2GA2 A;  4LLN A;  1O3S A;  3RYP A;  2VBX A;  1RUO A;  2IA0 A;  2E1C A;  1YS6 A;  2MA3 A;  3JAM K;  1YIO A;  1IF1 A;  4HAM A;  4IHS A;  4EGY A;  2HKO A;  5DYM A;  2RN7 A;  4YIF A;  2K27 A;  2DT5 A;  4GGG A;  2GAU A;  2HYF A;  4I09 A;  3PFI A;  3OV8 A;  1R5H A;  4O6J A;  5CVV A;  3MEX A;  2XV4 S;  1MJ9 A;  1RI7 A;  1YW8 A;  2Z3Y A;  4BHC A;  1IXS B;  1ZLJ A;  3R4K A;  1IXC A;  1D3Y A;  3R60 A;  2K02 A;  4RGR A;  3LA7 A;  5LRR A;  1LNW A;  1F1Z A;  3C18 A;  4M6Y A;  1B1B A;  1SFE A;  1G3Y A;  1D5V A;  1HBX G;  4NQW A;  2OQG A;  3HSF A;  3P9C A;  1YQA A;  3R61 A;  2Z33 A;  1SMT A;  3CUO A;  3HSE A;  2VT3 A;  2Y0M A;  3KEO A;  5TJJ A;  4MQ9 F;  1R1T A;  5DV5 A;  1ZG1 A;  5LBQ A;  3ZMS A;  2EFN A;  3GFI A;  3ERE D;  1R1U A;  1YTY A;  4L9J A;  2EA2 A;  1LDJ A;  1C0W A;  3RKX A;  3HUG A;  4KDP A;  3W6J B;  3T5X A;  3O3K A;  1XCV A;  4BHP A;  2QUF A;  4EM1 A;  3WE3 A;  5HLI A;  2KIM A;  1TLH B;  4A5N A;  2UXN A;  5LRS A;  2FE3 A;  4M72 A;  1BIB A;  3M8E A;  3GVA A;  2VN2 A;  4HX8 A;  3ZMZ A;  2F5E A;  1MZB A;  1J2X A;  1FBS A;  2F5C A;  3RPQ A;  1EH7 A;  2DFI A;  2IP2 A;  2CW0 F;  3E6C C;  1FP1 D;  4HV5 A;  5ILV A;  3HOT A;  4WXD A;  3GW2 A;  1G3S A;  5HDK A;  4BAY A;  4BXU A;  4YFN F;  4U7D A;  1LEA A;  3MQ0 A;  2WTE A;  3HOS A;  1IN5 A;  2HFH A;  2CGP A;  1R5G A;  1BC7 C;  1MD0 A;  3F8N A;  2JSC A;  4ENK A;  5FFX A;  4MEY F;  5DD4 A;  5D6F A;  3HTS B;  3KP5 A;  2HOE A;  1YYV A;  2JZY A;  4IJA A;  3E3V A;  2PMU A;  4HX4 A;  1FYL A;  5D4S A;  1WI9 A;  2FBK A;  2KJC A;  3RYR A;  5LGN A;  3J81 Z;  2ISY A;  3NQO A;  2W25 A;  1FBU A;  2FEZ A;  1S3J A;  2D2W A;  4FX4 A;  2M87 A;  4A5M A;  4EMS A;  1S29 A;  3H3Z A;  4IRG A;  4G6D A;  2RVC A;  2J5P A;  2ADU A;  5K5R A;  1YG2 A;  1OKR A;  4P55 A;  2P5K A;  5HDN A;  4A6E A;  3MAJ A;  1ZH5 A;  1UHM A;  1UFM A;  3F6V A;  1SFU A;  5LHI A;  1ON1 A;  3FXU A;  4BYY A;  4U0Y A;  5JFR A;  1GHC A;  1R22 A;  4WF2 A;  5L3G A;  2UZK A;  3DEU A;  2RDP A;  4ZH4 F;  5EEG A;  2OBP A;  3I4P A;  1KQ9 A;  2IW5 A;  1SMY F;  2VC0 A;  3GYH X;  2VOO A;  4LG0 B;  5LGU A;  5IT9 K;  5BPI A;  2JRT A;  3IL2 A;  3DPT A;  1IRG A;  1YW7 A;  1MJB A;  1FNN A;  3HSR A;  1T6S A;  1FYK A;  1FLI A;  3E6B A;  2JTV A;  3TO9 A;  1EV7 A;  1K79 A;  3HRU A;  4MNU A;  2E1N A;  3IRR A;  1ZYR F;  4P9F A;  1TQP A;  2P5L C;  3WGI A;  2L02 A;  3DF8 A;  2VOP A;  2QBY A;  5HS9 A;  1KA8 A;  1JXS A;  2IA2 A;  4CDG A;  2GZW A;  1L0O C;  4L0Y B;  2M8E A;  1S6L A;  2G9W A;  3E6D A;  3RKW A;  1UHW A;  2QBY B;  4ZYG A;  4JBA A;  2ESH A;  1ZG3 A;  3FWE A;  3R0A A;  4M71 A;  3V4G A;  3RI4 A;  3Q5F A;  3WTZ A;  2XAQ A;  4I0A A;  2ZO4 A;  3T1B A;  2DTR A;  3ZMT A;  3ISP A;  2MLK A;  4A12 A;  1B59 A;  4U7B A;  1Z6R A;  1X3U A;  4ENJ A;  4FT8 A;  4UVC A;  5A2Q K;  2H09 A;  3KP7 A;  4I2O A;  4LB5 A;  2LSO A;  1FOK A;  1OYW A;  2PFB A;  5A2Q Z;  2NYX A;  1FPQ A;  1HW2 A;  3HHG A;  4B8X A;  3V7R A;  1G6N A;  3ELK A;  3ZMD A;  3CO7 C;  4KUM A;  5ICF A;  1T2K A;  4UHT A;  3F8B A;  3T0Y A;  2RNJ A;  4MQV A;  3J7A O;  1FY7 A;  2XAJ A;  1XN7 A;  3RKY A;  3S2W A;  3I71 A;  3FMR A;  4KNY A;  1FBQ A;  5KVR A;  3BJO A;  4AWX B;  1KU9 A;  3QRF F;  3W6K B;  1J59 A;  5ICC A;  2H27 A;  4YFX F;  4RAY A;  2WC2 A;  5D8L B;  1REP C;  3ECH A;  5DUI A;  3QPT A;  2QVO A;  4EV0 A;  2DQL A;  4O5V A;  2M5W A;  3FF5 A;  4KIB A;  1TNT A;  3ECO A;  3LQR A;  1PP7 U;  4U0W A;  5AON A;  3E5Q A;  1AOY A;  3LST A;  1I27 A;  1MDM A;  4WXC A;  4PDK A;  1ZGJ A;  3C7J A;  1P92 A;  2ZJ2 A;  3BZ6 A;  2O61 A;  2QQ9 A;  4UVA A;  3L00 A;  3VOE A;  2PQ8 A;  2DPU A;  3TDU C;  1KU7 A;  2NNY A;  2A69 F;  2D45 A;  4HF1 A;  4HLY A;  5E20 A;  1ZLK A;  1MJA A;  5CVI A;  4L5I A;  4N0B A;  3BJA A;  1CGP A;  5BMZ A;  5CJ9 A;  5CVU A;  3K2Z A;  1WQ2 A;  4A0Y A;  5ILS A;  5AIQ A;  3WTX C;  3GXO A;  4KIG A;  2OU2 A;  2HKX A;  3LAP A;  3SZP A;  4S04 A;  4HA8 A;  4S05 A;  4Q48 A;  3U2R A;  4ZZD A;  3C3W A;  2R7D A;  4ZZL A;  1KYZ A;  3GWZ A;  4MHG A;  4AIK A;  3SZT A;  1IRF A;  3F3X A;  5D4R A;  2XAF A;  4LJZ F;  4CZZ A;  2GXG A;  2L01 A;  5E17 F;  4ESB A;  2A61 A;  2FXA A;  3QP6 A;  3F6O A;  2CG4 A;  3Q9V A;  2PLY A;  4GYI A;  1YW9 A;  2MD5 A;  2JT1 A;  1O3Q A;  1T39 A;  5H6R A;  2EFQ A;  3F72 A;  1PDN C;  2OQR A;  2V9V A;  4ESJ A;  1BM9 A;  1FWZ A;  1J7K A;  3CJN A;  5HOO A;  2NAZ A;  3KLO A;  1P6R A;  3MCZ A;  4KT5 C;  5D6E A;  5TRD A;  1ZRD A;  1T0F A;  4G9Y A;  4LG0 A;  2PMH A;  1O7L A;  3QPH A;  4M9X A;  3SHF A;  4KYW A;  1OR7 A;  2F2E A;  5F64 A;  1P4X A;  1Z91 A;  5HVQ C;  1U5T A;  1PUE E;  3O6B B;  3KEQ A;  4L0Z B;  3WTV C;  5HDG A;  2COM A;  3JSO A;  1DDN A;  4PCQ A;  3O2P E;  3I59 B;  3GZ5 A;  1V3F A;  4FHT A;  5K5Q A;  4JQF A;  2VOD A;  2BV6 A;  5E1X A;  4KMU X;  1WSU A;  4Q5S F;  4HZF A;  1ONV A;  1QPM A;  1I6X A;  1XGS A;  4IPA A;  1S7A A;  3V8L A;  2JPB A;  1J5Y A;  1TW3 A;  1XMK A;  4KIC A;  1FP2 A;  2XRN A;  3H3U A;  4KMF A;  1TNS A;  4CGZ A;  1ZAR A;  4HF0 A;  2ZME A;  1BN5 A;  2ZFW A;  1XMA A;  5D5W B;  1R00 A;  1K7A A;  2FBI A;  4RGS A;  2M30 A;  3LA3 A;  1ZRF A;  2Z99 A;  1FYM A;  4WWC A;  1W5S A;  2IT0 A;  4N9H A;  4DQ2 A;  2V1X A;  2LNB A;  2L4A A;  2YSR A;  5CYV A;  5E8I A;  4MEX F;  3K1P A;  1H9T A;  1ZAO A;  3K1M A;  2AXL A;  5DCF A;  5K5O A;  1YS7 A;  2B0L A;  2MH2 A;  1UB9 A;  1K78 A;  4A6D A;  1SD7 A;  2MBF A;  1F4K A;  4OIP F;  1DPU A;  5FFZ A;  2QQA A;  1ULY A;  3EYI A;  4ESF A;  4LLG F;  4Q4Z F;  2PI0 A;  1T98 A;  2K7L A;  4M74 A;  3IKT A;  1W7P A;  1IW7 F;  2YX4 A;  3TO6 A;  5ED4 A;  3JSP A;  2QM3 A;  1HXD A;  3FX3 A;  2JPC A;  3E5X A;  3IKV A;  1U6G A;  2QLZ A;  2LDU A;  4A0Z A;  3PQJ A;  1HKT A;  3QP5 A;  2ISZ A;  2FNP A;  4WX9 A;  1L3L A;  1IN6 A;  3V8J A;  2H94 A;  2EV5 A;  4RB1 A;  1B4A A;  4M9Z A;  1IUY A;  3WU1 B;  4QWQ A;  1CF7 B;  5ICE A;  3V7C A;  2OA4 A;  4G7Z F;  4AD9 A;  4YFK F;  3RJP A;  2A5Y B;  2CO5 A;  2DK8 A;  4OU0 A;  3T8T A;  4EJW A;  1CF7 A;  4HX7 A;  3KFW X;  3QOP A;  1O57 A;  4G7H F;  1LDD A;  3MFK A;  4RGX A;  2Y75 A;  2HS5 A;  3M8F A;  2FRH A;  2RV8 A;  4IVN A;  2WV0 A;  2PEX A;  3IWF A;  1ODD A;  5CLS A;  3P9I A;  1ZRC A;  1VTN C;  3FM3 A;  2HTS A;  2V79 A;  3FMQ A;  2MC3 A;  2EFO A;  3LFK A;  1LB2 A;  1J0R A;  2L4M A;  1G3T A;  3IRQ A;  1TQM A;  1RUN A;  1TW2 A;  4Y15 A;  2YPR A;  2KJB A;  2OZU A;  3L09 A;  2LKP A;  2XKP A;  2GQQ A;  1B6A A;  4GYG A;  1IAW A;  2DAO A;  2DPD A;  4EM0 B;  3E97 A;  3WG9 A;  2HTJ A;  2GA1 A;  2HYG D;  1TTY A;  2EWN A;  1QZZ A;  1JHF A;  5BS6 A;  1XSV A;  3HRS A;  1BI0 A;  1BC8 C;  3U9G A;  3GF2 A;  1G4D A;  2NS0 A;  4KN4 X;  3TKY A;  3TQN A;  1T38 A;  2XIG A;  3TOA A;  2F5D A;  1MDM B;  2EFW A;  4LFU A;  2HQR A;  5E18 F;  4HV6 A;  1WWX A;  1LDK B;  1D8J A;  3L2C A;  5J8F A;  2HGC A;  3RPU A;  2DLL A;  4OOI A;  2E7X A;  3GFJ A;  2ELH A;  3JTH A;  4M73 A;  3LA2 A;  4RAZ A;  1BOA A;  1U5T B;  3TOB A;  1R1V A;  3ZP5 A;  4OIQ F;  2A68 F;  2HDC A;  3CO6 C;  3I59 A;  2PG4 A;  4EJV A;  3IHU A;  4CHU A;  2VE8 A;  4L5J A;  1GXP A;  2CQK A;  4HQM A;  3I5U A;  3DQV C;  2GWR A;  3GZ6 A;  1FX7 A;  4A2U A;  1HKQ A;  1XSD A;  3BP8 A;  2A6H F;  3DPL C;  3TGN A;  2LF8 A;  3BPV A;  4HF2 A;  3I58 A;  3HIF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...