2RV8A

Solution structure of the phop dna-binding domain from mycobacterium tuberculosis
Total Genus 19
Loading diagram...

The genus trace: a function that shows values of genus (vertical axis) for subchains spanned between the first residue, and all other residues (shown on horizontal axis). The number of the latter residue and the genus of a given subchain are shown interactively.

Total Genus
19
sequence length
128
structure length
128
Chain Sequence
MGSSHHHHHHSSGLVPRGSHMKGNKEPRNVRLTFADIELDEETHEVWKAGQPVSLSPTEFTLLRYFVINAGTVLSKPKILDHVWRYDFGGDVNVVESYVSYLRRKIDTGEKRLLHTLRGVGYVLREPR
Loading diagram...

The genus matrix. At position (x,y) a genus value for a subchain spanned between x’th and y’th residue is shown. Values of the genus are represented by color, according to the scale given on the right.

Structure visualization

After clicking on a point (x,y) in the genus matrix above, a subchain from x to y is shown in color.

Chord Diagram
{{ tooltip.sname }} connected with {{ tooltip.tname }} : {{qFormat(tooltip.svalue) }}
publication title Solution structure of the PhoP DNA-binding domain from Mycobacterium tuberculosis
pubmed doi rcsb
source organism Mycobacterium tuberculosis cas/nitr204
molecule tags Dna binding protein
molecule keywords DNA-binding response regulator
total genus 19
structure length 128
sequence length 128
ec nomenclature
pdb deposition date 2015-04-17

pfam database annotations

chain Pfam Accession Code Pfam Family Identifier Pfam Description
A PF00486 Trans_reg_C Transcriptional regulatory protein, C terminal
Image from the rcsb pdb (www.rcsb.org)
cath code
ClassArchitectureTopologyHomologyDomain
1.10.10.10 Mainly Alpha Orthogonal Bundle Arc Repressor Mutant, subunit A Winged helix-like DNA-binding domain superfamily/Winged helix DNA-binding domain 2rv8A00
4KMFA 4BHPA 1MJBA 2P6SA 1MGTA 2P5VA 3K1NA 3AAFA 2WV0A 3FXUA 2GIVA 3C1DA 2EFOA 4FHTA 5DD4A 2Z99A 2L4AA 2MH9A 1IRGA 2COMA 5D4SA 5FD6A 2MA3A 2V1XA 4I01A 1MZBA 2K4JA 3VFZA 4N9HA 1G6NA 1FLIA 1ZRDA 4RB1A 2QVOA 4HBLA 2A61A 3BOQA 5CLSA 2TDXA 3WGGA 3F6VA 3KP5A 2RGVA 1Z7UA 4HQMA 4IHSA 5ICGA 1RZ4A 5D5UB 2W24A 1U8RA 2YX4A 3Q9SA 1Z6TA 1H9TA 4HV6A 3FM5A 3O2PE 4OIQF 3F72A 3SQNA 2LSOA 1BOAA 2JT1A 4RB0A 1WI9A 2FMYA 4CHUA 3GVAA 4WXHA 4A0YA 5CVUA 1HW5A 3GLXA 1DP7P 2GZWA 3H3UA 2P8TA 1JHFA 3W6KB 2HYGD 5LRRA 4G94A 5DCMA 1DDNA 2EWNA 4UXNA 2KJBA 5BQTA 5ICCA 3BJOA 2RKHA 4L9VA 4K2EA 1IW7F 3K1MA 3RTRA 3COAC 1KGSA 2LDUA 1K7AA 1J59A 4UUVA 3WGHA 4KN4X 1XN7A 4BNCA 4HF0A 3E3VA 1T98A 5JR3A 5DEQA 2P4WA 3CO7C 1P4XA 3RKWA 3MWMA 1TQMA 5E8IA 1STZA 2K02A 1PP7U 1ONVA 4U0WA 5DV5A 3P9IA 4OINF 4IVNA 3J80Z 2V1DA 4HDUA 1IXRC 2F2EA 4PGGA 2XUBA 3HTUA 1BI1A 1F9NA 3L9FA 1YYVA 3WTUC 5A2QK 3WTVC 4ENNA 4YFKF 1YO5C 5LEJA 1H0MA 2O8XA 3SHFA 2DAOA 2DO7A 1OYYA 3V7RA 4EVIA 2DFIA 4LD5A 1ZAOA 2IA1A 4NHJA 3K0LA 1IF1A 1FZPB 3PFIA 1ZYRF 4FT8A 1I1SA 3GXOA 3IHUA 4WXCA 4RB2C 5HLHA 2L01A 2ZJ2A 2YU3A 5L3EA 2XROA 4HYEA 2RN7A 2BE5F 2VODA 1ZLJA 2FBKA 3D0SA 3QU3A 5ICEA 2L3DA 4IRIA 4EJOA 2XV4S 1B9MA 4WF2A 3JAMK 3K1PA 1WQ2A 1IN4A 4IRHA 3H3ZA 1XCVA 2EB7A 5E1WA 2JRTA 3T1BA 4ZYHA 1R36A 3KFWX 1OYIA 1FBSA 2ETHA 1W5TA 1BIAA 4BXUA 4AVPA 1VTNC 4OOIA 3B73A 4RB3C 1R5HA 3HRUA 2D1HA 4YFXF 2L4MA 1LDDA 2Q0OA 3T0YA 4S05A 4A5MA 1IN6A 4M9SA 3FXQA 5FO5A 3LQRA 3FM3A 1TTYA 4LLNA 3EYYA 1K6OA 3LQQA 1YQAA 4U0VA 1O3SA 2STTA 4NQWA 4L18B 5ILUA 3TDUC 2STWA 3REOA 1O3QA 3JTHA 3J7AO 3CDHA 5ILVA 2BEOA 1ZGJA 4XRFA 4EJWA 2RQPA 5HDNA 2UXNA 4M6XA 2ISZA 1FX7A 3HHGA 3JSOA 4KNYA 1XCBA 3KZZA 1HW2A 2XAJA 2IPQX 3GO5A 4G8XA 4ZZDA 3IC7A 1FP2A 3SXYA 4WWCA 2W25A 4FX4A 1KYWA 1SAXA 3SFZA 2MC3A 2XRNA 3PQJA 2A69F 3VB2A 1O3RA 2CGPA 4EM2A 1HQCA 3HYIA 4CO8A 2MD5A 4WCGA 3N97A 2FRHA 2OU2A 2VXZA 1G4DA 3V8KA 2HYFA 5DUKA 1ON2A 1RUOA 1SD6A 2ZNZA 3KP6A 2G7UA 1ZG1A 1FOKA 4LLLA 3FMRA 2EFWA 2OQGA 4AIHA 1R22A 2XHKA 4JK1X 2LNBA 1HSTA 2DBBA 2XIGA 4LG0B 1I27A 3E5QA 4F7ZA 3KLOA 5LBQA 2JZYA 3V8LA 1ZRCA 4M74A 4CICA 2PMHA 2RVCA 4A0XA 4ZH4F 1ZN2A 4ENKA 2HEOA 3E6BA 4KIGA 4AIJA 3ELKA 2HFHA 3E6MA 5KVRA 3N4MA 1T38A 3QRFF 3E5UA 3CUQB 5DCMB 3NRVA 1UB9A 2Z33A 5BMZA 4FX0A 5D8KB 2D2WA 1BC8C 5HVQC 5LGTA 3KETA 4HA8A 1R1UA 1J0RA 2F5DA 1BI0A 1FY7A 2ELHA 2UZKA 1NHAA 3KP2A 4M71A 2IW5A 2VE8A 5HLIA 1R7JA 4U88A 3IKTA 2IVMA 1CF7A 3C7JA 2DQLA 3BP8A 1U78A 3EDPA 4RS8A 1XGNA 5LEKA 2VE9A 1HXDA 4ETSA 1KQ8A 2HZTA 2IT0A 5L3DA 4A2UA 2P7VB 4AD9A 4EMSA 2X0LA 4A12A 1U3EM 3WU1B 2NAZA 1IN7A 5K1YA 2V1UA 4S04A 1SD7A 3FF5A 5K5RA 3U1DA 1I1GA 5L3CA 2A68F 5IT9Z 3J81K 3R4KA 2EV6A 5FLXK 2NNNA 4L0ZB 2IJLA 3V7CA 4BHCA 3BY6A 3I58A 1MKMA 2PI0A 1QBJA 2QQBA 3LA7A 4G7HF 3V8JA 2VC1A 5HLGA 2FNAA 4GXOA 4A5NA 3L7WA 2HOEA 1LJ9A 4RGSA 2EV5A 4B8XA 5DYMA 1MDMA 3BJAA 1PUEE 4ZYGA 1OKRA 1U5TB 1O57A 2EFQA 4IXAA 5A2QZ 2VOOA 1RIOH 4Y15A 2JTVA 3IWZA 1XB4A 1LB2A 4I02A 2QWWA 3WTYC 4OIPF 2J5PA 2QUFA 1B6AA 2A07F 1G3WA 3FZVA 3IWFA 4AIKA 1FP1D 1B59A 1FWZA 2XAHA 4E70A 1IN8A 4Z2YA 3VEPA 1UHMA 4HX8A 2L02A 5JHUA 5D5WB 4MGRA 1USTA 1UFMA 4IJAA 5FFXA 3I5UA 2EV0A 1R58A 3F3XA 1J5YA 3ZMUA 1FNNA 3LFKA 2LF8A 4NB5A 4P9UA 4ESBA 4HF1A 4QLCU 1WKMA 2Z5UA 1USSA 3FXRA 5CVRA 1IZ1A 1QGPA 3PQKA 3MAJA 2EK5A 1G3TA 3DV8A 2EJRA 5E1XA 4A6EA 3DXJF 4R8HA 3GWZA 4O6JA 2ADUA 1EH6A 1F4KA 3CUQC 1OR7A 2K86A 3L00A 3F21A 2RDPA 2MLKA 5TJJA 4UNOA 5ILSA 2H6BA 3ZQ7A 4OIRF 3HSRA 1SD5A 2RV8A 1F1ZA 3W6JB 1YLFA 4M9XA 4N9IA 4JQFA 3BPVA 4ON0A 1YG2A 3CUQA 2E1CA 2FA5A 3KP4A 4MEYF 2Q8KA 2DK8A 1YIOA 4YG2F 3T8RA 4KT5C 4KDPA 1FSHA 1BI3A 3O3KA 3NEUA 5J8FA 3HTSB 4B09A 2M8EA 2QYOA 4EJUA 3F6OA 3HRSA 1WSUA 1GXQA 2EA2A 1DUXC 2JPCA 1KU3A 1TLHB 5FGMA 1FYLA 2IP2A 4P55A 2FMLA 5HOOA 2IA0A 1QNTA 2QLZA 4KIBA 4Q48A 3JTGA 5H6QA 2XAFA 1V3FA 2M5WA 1R5GA 3HSEA 2UXXA 1AOYA 1ODDA 2XKOA 3M9AA 5IT3A 5LGNA 3KEQA 1Q1HA 3ZMDA 1Z6RA 1W7PD 2DQRA 1FT9A 4G9YA 4XSZF 2CG4A 1GVJA 3LAPA 1KU2A 5E20A 4YIFA 1XGSA 2QBYB 3RI4A 1WRJA 1BC7C 2KIUA 1CGPA 2OAZA 3GYHX 1XDSA 2KIMA 2QZ8A 5FLXZ 3LA3A 2XAQA 1E2XA 3F22A 1D3YA 2M30A 5CVVA 2XAGA 3RKXA 1O7LA 3E97A 3IRQA 2L54A 2DW4A 2KKOA 1KYZA 3OOPA 3EYIA 4LJZF 2Y48A 1RNLA 4HX7A 2BYVE 1U5TC 3ISPA 1KU7A 4AWXB 2DK5A 5LGUA 4ENJA 4P96A 2WWYA 2WC2A 4O3MA 3EUHA 3I59B 5HS9A 2IA2A 1T0FA 3QOPA 1LNWA 1TQIA 4M9ZA 1R00A 3J81Z 2ACJA 4H0EA 3ULQB 1K78B 4I2OA 4Y17A 1MDMB 3T8TA 4LG0A 1OPCA 3HHHA 1SFEA 2DU9A 3TKYA 3FHZA 5H6RA 1QQIA 2ZXJA 3R6SA 3C3WA 3JAMZ 2DT5A 5FFZA 3T5XA 5LHIA 1OYWA 2F5EA 3HRMA 1TQPA 4MEXF 2F5CA 3P9CA 5HS8A 2AXLA 2E7XA 3CO6C 3MFKA 3TO9A 4R79A 2BV6A 4WXDA 4L5JA 2FEZA 4MHGA 1ZGAA 3FX3A 3ML6A 2RC4A 2M1BA 3DPLC 1S29A 3MQ0A 3GZ5A 5LHHA 3FWEA 2KJCA 2MH2A 2Y75A 3DKWA 5TRDA 2ESHA 2E1NA 3F8MA 1XD7A 2XVCA 2O0YA 1XGMA 2ZMEA 1HBXG 3RYRA 4IPAA 1O3TA 3RDIA 1YS6A 1BN5A 3M1EA 2HTSA 4EGYA 3HRTA 4U0YA 4KMUX 3E6DA 2RNJA 2ESNA 1LDKB 1HSJA 1YS7A 1L3LA 1LVAA 4I0BA 1RUNA 1S8NA 3DQVC 5F1RA 3FMSA 1J75A 4EV0A 2W85A 3TO6A 1XMKA 5HDKA 2K4BA 1MD0A 2M87A 2HKXA 2PN6A 3ZMVA 2A6EF 2H6CA 2MLGA 5K5QA 1IXCA 3F8FA 1XSXA 1I6XA 4MQVA 3L09A 1SMYF 1B1BA 5J6XA 3BPXA 2Q2EA 1JGSA 1R23A 1P4WA 4A0ZA 1FYKA 1HW1A 5JFRA 4Q4ZF 2ISYA 1B9NA 4MNUA 3I53A 2VN2A 2CQKA 2D45A 2QQAA 3ROUA 3GEZA 4WK8F 2K7LA 1UCRA 2ZCWA 3Q5FA 4PCQA 2A6HF 3CTAA 3DFGA 5LLQA 1GXPA 5CVIA 3GZ6A 3G3ZA 3D5LA 1IAWA 3Q9VA 2QBYA 1SFUA 1W4MA 2FU4A 4UVAA 4YIIA 3C18A 3QP5A 3RYPA 1Z91A 4ZYDA 1QZYA 3TO7A 2EA4A 2CO5A 2OBPA 2HQNA 1GHCA 4D0PA 2KIFA 3HIFA 3BJ6A 1U6GA 2R7FA 3ABUA 5E17F 2PG4A 4N0BA 3ZPLA 2ZFWA 4LFUA 1LQ1A 5DCFA 3LAJA 3HSFA 3QPTA 1XDUA 3TOAA 4EM1A 3GFMA 4ESFA 1FPQA 4HX4A 4TV7A 1G3YA 5D6FA 3TGNA 2LF7A 1ULYA 1CF7B 1P92A 3LA2A 3BWGA 1FYMA 3ZN1A 1AWCA 5LRSA 1LEBA 2VBWA 5HDGA 4QWQA 4EQQA 3I64A 3NQOA 4CXFA 1MJ9A 1TW3A 2O3FA 5AONA 4KFCA 2FE3A 2QENA 2DTRA 2G7HA 2GXGA 3HOTA 2GQQA 3TDZC 3QP6A 4RAYA 4LK1F 1BI2A 1EH7A 3U9GA 2NNYA 1TW2A 4HLYA 5E1ZB 1S7OA 2W84A 2YX7A 3GW2A 4HF2A 4KA4A 5JI6A 5KK1A 2FSWA 2H94A 5DUIA 4XLNF 4OMZA 4ZYEA 3KP3A 4CDGA 1LDJA 1XMAA 1C0WA 2FOKA 1EH8A 1G3SA 3GFJA 3WG9A 1FC3A 5CYVA 2JPBA 3KLNA 5F6FA 5FB2A 1JXSA 1XSDA 4MTEA 4ZZLA 2NYXA 1ZH5A 2GA1A 2CW0F 1ZG5A 2ZKZA 2A5YB 3F8BA 1YTYA 4UV8A 4OMYA 2Y0MA 1J9IA 1PP8F 3WTTC 2EFNA 4HLXA 5F64A 1U5TA 3TOBA 4GYIA 1T6SA 2OA4A 3R60A 1XGOA 1D8JA 3I0TA 5D4RA 4PDKA 4XSXF 4Q47A 3E6CC 4LGWA 2VBXA 3F8NA 1FSEA 4LMYA 4R1HA 1IXSB 2P7CB 5E8GA 4RGUA 5J8CA 3ECHA 2VOPA 4UVBA 2BGCA 5FD5A 2P5KA 3CJNA 2FNPA 1W7PA 1KQ9A 4EJTA 5BS6A 4HV5A 2GWRA 2LKPA 1TBXA 2A3SA 4ENMA 1HKTA 1TNSA 1T2KA 3MEXA 2V9VA 2O61A 4IF4A 1LEAA 1IRFA 3BZ6A 5IT9K 4L9NA 3OV8A 2Z3YA 3ZMTA 3WTWC 1DPRA 1O7FA 3WE3A 2DPDA 5D6EA 4KUMA 6PAXA 4KN7X 1P2FA 2F5FA 3F8CA 2FBIA 3K69A 1OMIA 1QO0D 3DPTA 3V4GA 3WTSC 5BPDA 4P9FA 2H09A 3L2CA 3ABTA 2CSOA 1HKSA 4XLPF 5ED4A 1WWXA 4KICA 4DNCA 5D5XB 5L3GA 4BYYA 1ZREA 4CYDA 2VT2A 1R1VA 2HR3A 3EQLF 1QZZA 3GFIA 2NS0A 2O03A 3ZMZA 1F5TA 1SFXA 2XKPA 1Z9CA 4HQEA 1JHHA 4G7ZF 3HOSA 1W7PB 3RPUA 2C6YA 1BBYA 2PBIA 3I59A 2ZNYA 2IRFG 4G6QA 5DD8A 3P7NA 1FBUA 3DF8A 3G73A 2HQRA 4M72A 2CFXA 4YFNF 4WX9A 4RGXA 2PJPA 4OIOF 3CUOA 1KU9A 1BIBA 4I09A 4L9TA 2ZO4A 5EEGA 2VBYA 3J80K 2K27A 5HS7A 2XASA 1TNTA 1K78A 2GXBA 2OZUA 1MJAA 2WTEA 4GGGA 1Z05A 3BDDA 1BM9A 1JE8A 1QPMA 2OQRA 3ECOA 3WE2A 2HDCA 4G7OF 4M73A 5ERIA 1SMTA 3WODF 2B0LA 3E5XA 5CJ9A 3WTZA 4LB5A 4HDVA 2DPUA 4P5OA 2UWMA 3KEOA 2ZBKA 4MTDA 2PQ8A 3KZYA 3LSTA 3BROA 2M45A 5L3FA 1D8KA 4HOBA 3HUGA 1ZRFA 4XBFA 3R0JA 3GFLA 1V4RA 3M7GA 4PGHA 2V6CA 2FXAA 2HWVA 3CLOA 4UV9A 1YW9A 1U2WA 4DQ2A 5AIPA 1IN5A 2V79A 1EV7A 1FBQA 3QU6A 4I0AA 3KE2A 3QPHA 4PZJA 4HAMA 2HTJA 2CWEA 3U2RA 1HKQA 4Y13A 3H92A 2GAUA 3K2ZA 2R3SA 2J5OA 3GX4X 3JSPA 2VT3A 4BHBA 3EETA 4LK0F 3SZPA 4G6DA 3F23A 3I4PA 5H20A 5ICFA 3RKYA 4CZZA 5BPIA 1RI7A 2JSCA 4L5IA 3P9KA 3V7SA 4UHTA 4LB6B 1W5SA 1REPC 1D5VA 3GF2A 3WGIA 1J2XA 1P6RA 4GYGA 3DEUA 1S7AA 3WU0A 1PDNC 1YW7A 2GA2A 4EJVA 4GCVA 3MZHA 3VOEA 2FF4A 2HKOA 5D5VB 3VODA 5BOXA 2W57A 2HS5A 2YSRA 3IRRA 1IUYA 2ZMEB 3ZN0A 1Y0UA 2OD5A 1P4AA 5D8LB 4M6YA 2PFBA 1T39A 2XGXA 2YPRA 5AIQA 4O5VA 2OZ6A 4EM0B 2NRAC 3B02A 1L0OC 1BJAA 3M8EA 1KA8A 3SZTA 4Q5SF 1YFHA 3RIRA 4BQAA 1B4AA 1KQ0A 5LHGA 4I7HA 3RPQA 2HGCA 4OU0A 1J7KA 5EEHA 3ZP5A 3KP7A 3S2WA 2G9WA 4LLGF 1K79A 4A6DA 2VONA 2DI3A 3R0AA 2PMUA 3R61A 4L0YB 4ESJA 5L3BA 2CYYA 3DP7A 2O6GE 3IL2A 2Z9OA 2H27A 1I5ZA 3FMQA 4HZFA 2KRFA 3ERED 3ZMSA 2YR2A 1ZG3A 3WTXC 1ON1A 5K5OA 2P6TA 1DPUA 1S3JA 4L9JA 3MCZA 4IRGA 3I54A 1YW8A 4GO1A 2QQ9A 1ZARA 4KIFA 1X3UA 4ASNA 3MZYA 3JW4A 2DLLA 1R1TA 2EFPA 4HW0A 5E18F 1H9GA 1ZHFA 4RGRA 3QAHA 1ZLKA 2PEXA 4RAZA 3KCCA 2P5LC 4BH9A 4JBAA 3M8FA 3RJPA 4U7DA 4MQ9F 2VC0A 1E17A 2QM3A 4I98B 4U7BA 1UHWA 2R7DA 1SD4A 3K9TA 4EGZA 1S6LA 3LWFA 2E7WA 3GUDA 3I71A 2FQ3A 5DDGA 2FBHA 4CGZA 2BBYA 4KYWA 5JVTA 1Z1DA 2AS5F 1A04A 3O6BB 3TQNA 2VBZA 2PLYA 3IKVA 2X4HA 4BAYA 2D1VA 4UVCA 4IHTA 1XSVA 5CVJA 2MBFA
chains in the Genus database with same CATH superfamily
3OYEA 2JN6A 3ZQIA 4BHPA 2CQXA 2O8KA 4KMFA 2XGEA 5EZHA 4D7MA 4FE7A 1MJBA 1OCZH 2P6SA 1MGTA 3CJRB 2NVUB 3BCBA 2P5VA 3K1NA 3AAFA 2WV0A 3FXUA 1JKQC 2L5QA 3H36A 2GIVA 3C1DA 3HPGA 1RC9A 1B8IB 3UNGC 4A3JJ 2EFOA 3PUFA 4XORA 5EJCA 4BXFA 4FHTA 4CCKA 5DD4A 2Z99A 1OFCX 2L4AA 2MH9A 1IRGA 1VQNI 2COMA 2W48A 1JTYA 3A1YA 3HDDA 2BY1A 1TL8A 5D4SA 5FD6A 3A02A 5IOZA 2MA3A 5LFAA 2V1XA 4I01A 1MZBA 3Q0UA 2K4JA 1G2HA 3VFZA 2Y0SN 4N9HA 1G6NA 1FLIA 1ZRDA 4RB1A 2QVOA 2K85A 4HBLA 2A61A 4XKBA 5CKTA 1GVDA 3BOQA 5CLSA 2TDXA 3WGGA 3F6VA 3HKZA 3KP5A 3ESWB 2RGVA 2VXDA 2VJ4A 2CQNA 3DU6A 5E3OA 2E34A 4I6ZA 1Z7UA 2L9NA 4HQMA 4U87A 1YJNI 4IHSA 5ICGA 5J1UA 1TWAJ 3KYLA 5FKNA 1RZ4A 3LSJA 5D5UB 5EDNA 2W24A 1U8RA 2VQLA 2BW3B 2YX4A 3Q9SA 5EGOA 1Z6TA 1S9HA 3BG6A 5KAIC 2CUZA 1H9TA 4HV6A 1QHGA 4IHVA 4BGDA 3FM5A 4AVZA 3O2PE 4NDLA 4OIQF 3F72A 1QPIA 3SQNA 4NNJA 2UUZA 2GM4A 2O9LA 4XICA 2X1CA 2LSOA 2IS4A 1BOAA 2E5ZA 2JT1A 4RB0A 4XOPA 1WI9A 3MKZA 2FMYA 4CHUA 3GVAA 4WXHA 4A0YA 5CVUA 1HW5A 3GLXA 3TW6A 1DP7P 2GZWA 4Y4RA 3MN2A 1MH3A 2VI6A 3H3UA 2P8TA 1JHFA 3W6KB 2ZSIB 2ZJQF 2HYGD 5LRRA 4G94A 5DCMA 3K4NA 2JWTA 1DDNA 1PYVA 5F0HA 3I55I 2EWNA 3OYAA 4UXNA 2KJBA 5BQTA 5ICCA 3BJOA 2RKHA 3LOCA 3CP2A 4D1QA 1HLVA 3A4CA 4V2GA 4L9VA 4K2EA 2BY2A 1I50J 1IW7F 3K1MA 4J19A 3RTRA 3BZKA 3COAC 1KGSA 1UZCA 2V9PA 4Y33A 4FQGA 2KISA 1P9QC 2EPFA 2LDUA 1K7AA 1J59A 4UUVA 2VPRA 4KN4X 4MFDA 3WGHA 1A36A 1XN7A 4BNCA 1Z21A 4ANJA 4DW6A 5EEAA 4XN0A 4HF0A 3E3VA 4A3GJ 2R4GA 1QZEA 2OTLI 1T98A 5JR3A 2HNHA 3K4LA 5DEQA 2P4WA 3CO7C 1P4XA 1VZ0A 2E1MB 3RKWA 1AHDP 3MWMA 1TQMA 2DN0A 1S72I 2R7SA 5E8IA 1STZA 2K02A 1PP7U 3QODA 1ONVA 1VQ8I 4U0WA 5DV5A 2ZXHA 2HXIA 3P9IA 3SEZA 4OINF 1MBKA 3I4MJ 2F5VA 4IVNA 3J80Z 2V1DA 4PSXA 4HDUA 1IXRC 2F2EA 2JQ7A 3QYEA 4PGGA 2XUBA 3HTUA 1BI1A 1F9NA 1MBFA 1T0FC 3J7ZI 3MKLA 3L9FA 5F0FA 1YYVA 3TL4X 5A2QK 3WTUC 3WTVC 4ENNA 3HXLA 2R7UA 4YFKF 4M3DA 1YO5C 5LEJA 1H0MA 3CZ6A 2O8XA 1GUUA 5M5YJ 3DU5A 1X1CA 3IAS2 4IX7A 4PUSA 3SHFA 2DAOA 2CV2A 2DO7A 1OYYA 3TEDA 1X1DA 1KZHA 5JLXA 2LC2A 2E1MC 2NVXJ 1MNDA 3V7RA 4EVIA 2DFIA 4LD5A 3ZOBA 1ZAOA 1VQMI 3HOYJ 2IA1A 4NHJA 3GZNB 4PFOA 3K0LA 4G12A 1IF1A 1YIJI 3PFIA 1ZYRF 4BE1A 1FZPB 4GFBA 4FT8A 1I1SA 3GXOA 2HXOA 3IHUA 4WXCA 1JJ6C 3D5RC 2IGKA 4RB2C 1WH7A 3BR2A 4UUTA 2K5CA 5HLHA 2L01A 1XPXA 2ZJ2A 1JT0A 1JKRC 2LRDA 2FQ4A 2YU3A 1TC3C 1ACIA 5L3EA 3C2GA 1PUFB 3HKZN 2XROA 4HYEA 4F52A 2RN7A 3AG2H 2BE5F 2VODA 3BZCA 1ZLJA 2FBKA 3W2WA 3D0SA 3BTIA 3QU3A 4FETA 4MO7A 3RQ4A 5ICEA 3VWBA 2L3DA 2LMDA 2HVSA 4IRIA 4CCMA 4EJOA 3CMAI 2XV4S 1MSEC 3K6GA 4DYCA 1B9MA 4WF2A 3JAMK 3K1PA 1WQ2A 4F91B 1V5EA 1IC8A 4BEHB 1HDPA 1IN4A 4IRHA 3H3ZA 3UR3C 1XCVA 1Z3XA 2EB7A 2LP0A 2Y69H 5E1WA 2JRTA 3HL2A 1VQLI 1TWHJ 1XMXA 3SDGA 3T1BA 2R5ZA 1IGNA 4ZYHA 3S15J 1R36A 3KFWX 1OYIA 1FBSA 2ETHA 1F36A 1W5TA 2FJ1A 1Y8RB 1BIAA 4BXUA 5EG0A 4AVPA 1VTNC 2DMQA 4OOIA 4LIUA 3B73A 4RB3C 1R5HA 3HRUA 2D1HA 4YFXF 3Q0WA 2L4MA 2NS7A 2PJRB 1LDDA 2Q0OA 3T0YA 2ZJRF 4JP0A 2L9SA 4S05A 2CFOA 4A5MA 1IN6A 4HPQA 2E19A 2RNGA 4E7ZA 4BJTA 4M9SA 3FXQA 4XLFA 5FO5A 3EPZA 3LQRA 2M8GX 3FM3A 4F93B 3H1CA 1TTYA 2D5VA 4LLNA 2F4IA 3DBHB 3EYYA 1K6OA 3LQQA 2OJED 5B5EC 2CS3A 3HOXJ 1YQAA 2Q1ZB 2WB1N 4U0VA 1O3SA 2STTA 4NQWA 2H8WA 2M3AA 1IDYA 4D5FA 5ILUA 4L18B 1A6IA 3REOA 1ZK8A 3TDUC 2E60A 2STWA 1O3QA 1WJFA 4AM3A 3JTHA 3AL0B 3J7AO 3FXMA 5EYRA 3CDHA 5ILVA 4A3BJ 2BEOA 2E1OA 2MSYA 5B66C 5HNFA 1AKHA 1ZGJA 4XRFA 4EJWA 2L7MP 2RQPA 2KMUA 5HDNA 2UXNA 5CPRB 1OCPA 4M6XA 2ISZA 2QQ8A 1FX7A 3HHGA 5KAFC 2W00A 1N25A 3JSOA 4KNYA 4HRIA 4CYCB 3HOUJ 1XCBA 3KZZA 1HW2A 2XGDA 3PIOF 3BTLA 2ICWG 1MH4A 4XNFA 2XAJA 2IPQX 3GO5A 4G8XA 4ZZDA 3S17J 3M1CA 1I6HJ 3OSFA 3IC7A 1FP2A 3SXYA 4WWCA 2W25A 4PSWA 3L2RA 4FX4A 1KYWA 4XLAA 3CCRI 3BR1A 1SAXA 3SFZA 2Y2ZA 2MC3A 2XRNA 3CQZJ 3RSNA 3PQJA 3PNYA 1SAUA 1V5GA 2A69F 3VYTB 2NOJB 2BOLA 3MVPA 4BJ5C 3VB2A 1O3RA 2V26A 2CGPA 1FMWA 4XQFA 4YIRX 4EM2A 4IHWA 1N75A 3ZCOA 1HQCA 3HYIA 4CO8A 2MD5A 1CQTA 4XMYA 1V55H 1U9NA 4WCGA 3G6EI 3ZR8X 3AG1H 2FRHA 3N97A 2OU2A 2VXZA 1G4DA 3V8KA 1IV6A 1RKTA 2HYFA 1TP4A 5DUKA 3CD6I 1ON2A 2NVTJ 4BQOA 1RUOA 1T8IA 4XKCA 1SD6A 2PX9A 4C3JJ 4ZYAA 2YUSA 2ZNZA 1BJZA 2DODA 3KP6A 1B72A 2G7UA 1R71A 4E7LA 1ZG1A 5F04A 1FOKA 3LSMA 1ETVA 1Z67A 3CCUI 2RAEA 3F9KA 4LLLA 4BACA 3FMRA 2MABA 4A3EJ 3GTKJ 2EFWA 2NVQJ 2OQGA 4AIHA 2JUCA 1R22A 2XHKA 4JK1X 3PIPF 2ZMEC 2LNBA 1OJLA 1X3ZB 3KX2A 1HSTA 2DBBA 4E7JA 2XIGA 4LG0B 4JX4A 1I27A 3E5QA 4F7ZA 3DEEA 3Q0VA 1E3PA 3CCMI 3IAM2 3KLOA 5LBQA 2JZYA 4RA2A 3S3OA 3AKZA 5IOYA 2HVQA 3V8LA 1ZRCA 4M74A 3ABKH 4CICA 3CC2I 2PMHA 3BC8A 3LSKA 2RVCA 1W36D 2HZDA 4A0XA 4PJJA 3H5AA 4ZH4F 1ZN2A 4ENKA 3J7YJ 2HEOA 1Y0NA 3CF2A 1H88C 3E6BA 1ZKGA 4J00A 4KIGA 1IRZA 4AIJA 3ELKA 5DM6F 2LY9A 2HFHA 3E6MA 5KVRA 3N4MA 1T38A 3QRFF 2K3FA 5B3SH 5FJ8J 2E35A 3E5UA 3CUQB 5DCMB 4E7SA 2WY7Q 1R4NB 3NRVA 3BG3A 2K9NA 3Q3SA 1UB9A 2Z33A 5BMZA 3BLYA 2DJIA 4FX0A 3CCYA 2BXZA 1FOWA 2OC6A 1E3OC 1O4XA 4KT6A 2ZFUA 2DMNA 5D8KB 2D2WA 2EILH 5HVQC 5LGTA 3KETA 1BC8C 4HA8A 1R1UA 1J0RA 2F5DA 3GCMA 4KJZA 2L9VA 4DYRA 1BI0A 2KZGA 1FY7A 1HC8A 3JRAA 1GV2A 1SANA 2ELHA 2UZKA 1NHAA 3KP2A 4M71A 1E0EA 2QCOA 3QWLA 4YRVA 2IW5A 2VE8A 5HLIA 1R7JA 2R5ZB 4U88A 3UKGA 4JX6A 2VJJA 1D0YA 1R6RA 2IVMA 3IKTA 3KZIC 1CF7A 1GT0C 3C7JA 2MGQA 2DQLA 4CCLA 1LFPA 3BP8A 1U78A 3EDPA 4RS8A 1XGNA 5LEKA 2VE9A 1HXDA 4ETSA 1KQ8A 4S0HB 2HZTA 3OYBA 2IT0A 5M5WJ 5L3DA 3G4SI 4A2UA 2P7VB 2CQ7A 4LIVA 4AD9A 3DTEA 4EMSA 2X0LA 4A12A 4ZTJA 1U3EM 4A3IJ 3WU1B 2NAZA 1FTZA 2XB0X 1A31A 2DA4A 2RREA 1WPKA 5IYCJ 1D1CA 1IN7A 5K1YA 2V1UA 3DTKA 4S04A 1SD7A 3FF5A 2ID6A 5K5RA 2HOTA 3U1DA 1I1GA 1WJAA 1KONA 3GTPJ 3RZOJ 1A35A 5L3CA 3DPUA 2A68F 5IT9Z 3K4CA 3J81K 3R4KA 2KLOA 1HA8A 2EV6A 1TWCJ 2NNNA 4L0ZB 5FLXK 3JRCA 1MMAA 2P81A 2IJLA 2KRHA 1JTXA 3O8HA 3V7CA 3BY6A 4BHCA 2GBYA 4DBQA 3A2KA 3I58A 1K6YA 1MKMA 2WBMA 1UG0A 3MZ8A 1D0XA 2PI0A 1QBJA 3TBIA 5HNHA 2R93J 3CCJI 2QQBA 3W6VA 4Y52J 3LA7A 3ZQQA 4G7HF 3S2DJ 2VKVA 2VC1A 3V8JA 4N4OB 5HLGA 2FNAA 4GXOA 2LY1A 4A5NA 3L7WA 2HOEA 3I56I 1LJ9A 3OIQA 5KCMA 4RGSA 4BQNA 2EV5A 3OWTA 5DYMA 2VQHA 4B8XA 1MDMA 1B72B 1Y1VJ 2XF7A 2DOAA 2F48A 5CQGA 1DQUA 3BJAA 1PUEE 2LYCA 3FBNB 3K4MA 4ZYGA 1YRNA 1OKRA 3MKYB 1U5TB 1O57A 2EFQA 4IXAA 5A2QZ 4FCYA 1UHSA 2VOOA 1RIOH 3ABLH 4XLCA 4Y15A 2JTVA 3IWZA 2QKLB 1XB4A 1LB2A 4BDYA 2VPLA 4I02A 2QWWA 4RAFA 3WTYC 1MMGA 2NOGA 4RMNA 4CUGA 4OIPF 1WZ2A 1AA7A 3GTJJ 2NVYJ 4BU2A 2VASA 4XIDA 1W0TA 2AQFA 3MMYB 2J5PA 2IEKA 2QUFA 1G59A 1MBGA 1B6AA 2A07F 1G3WA 1T33A 3FZVA 3IWFA 1LE8B 1W1WE 2COBA 4AIKA 1YRNB 1WJEA 4YEJA 1FP1D 4ZC3A 1B59A 1FWZA 2KPMA 3O8GA 2XAHA 4E70A 1IN8A 4Z2YA 3VEPA 2O7OA 1UHMA 4HX8A 2L02A 5F08A 3L2QA 5JHUA 5D5WB 2KZVA 3U1KA 3TMOA 4MGRA 1HOMA 2PJRA 1USTA 1UFMA 4IJAA 2X48A 5FFXA 3I5UA 2EV0A 2M7BA 1R58A 3F3XA 4C30A 2DFHA 3H9QA 2M34A 3OYDA 1J5YA 3ZMUA 1FNNA 3LFKA 2LF8A 4NB5A 2EIJH 2ZC2A 4P9UA 4ESBA 4HF1A 3BQZA 2BY0A 2X6YA 5HLTA 4B3AA 4QLCU 1WKMA 2NXNB 3FXRA 1USSA 2Z5UA 3W2VA 2QEXI 1PVEA 5CVRA 1VQ5I 1IZ1A 4BY1J 1QGPA 3PQKA 2M2EA 2XRLA 4L5EA 3K70D 2R5YA 3MAJA 2EK5A 2VL8A 1G3TA 3DTIA 3DV8A 3BT9A 2EJRA 5E1XA 2DOFA 2VKHA 3DXJF 4A6EA 1GDTA 2W82A 3HOZJ 4C2UA 2VKDA 3OIPA 4R8HA 3DLLF 3GWZA 4O6JA 3U21A 4AYBA 2ADUA 1EH6A 3C2BA 2V4JC 1F4KA 2AXTC 3GTQJ 3CUQC 3JCUC 1OR7A 1WCMJ 2K86A 3L00A 3F21A 2RDPA 2X6WA 2MLKA 3LSGA 1APLC 5TJJA 3M3YJ 4UNOA 5ILSA 2CUJA 2H6BA 3ZQ7A 4OIRF 3HSRA 4B3XA 1SD5A 2RV8A 1F1ZA 2CH0A 1P7JA 2KFDA 3W6JB 2KT0A 2XB5A 1EF4A 3S3MA 1YX3A 5M3MJ 4E7HA 3CMMA 3FISA 2VUMJ 1YLFA 4M9XA 3OMYA 2G0EA 1BR1A 5IP7J 4N9IA 2LG4A 3BPVA 4JQFA 2ME6A 4ON0A 1YG2A 3CUQA 2E1CA 3A0HC 2FA5A 3GMEA 3KP4A 4MEYF 5F1JA 1X2NA 2Q8KA 2DK8A 2W4SA 1YIOA 3M8JA 4LITA 3ZXSA 4YG2F 4OWRB 3T8RA 4KT5C 1IRXA 2GLOA 4KDPA 1BL0A 1FSHA 1BW6A 1BI3A 3QPLA 5DTDA 1X1PA 3O3KA 3NEUA 3PSIA 5J8FA 4Y3OA 5EG0B 1LVKA 4B09A 3HTSB 1UMQA 4PK4A 2M8EA 2QYOA 5FRMA 3SZGA 1VQ6I 5F27A 3IP4B 4EJUA 4A3DJ 3F6OA 2LREA 3HRSA 1U9OA 2AQEA 2IGOA 1WSUA 3OYFA 1GXQA 2EA2A 1OCCH 1DUXC 2OUMA 2P0WA 2JPCA 3HZJA 4A3MJ 1KU3A 1TLHB 5FGMA 1FYLA 1QVTA 2IP2A 4P55A 2FMLA 5HOOA 1DU6A 2IA0A 3WHBA 4M3BA 2I5UA 3WU2C 1QNTA 2QLZA 4KIBA 4Q48A 4BBRJ 2ME0A 3JTGA 1HF0A 4W97A 3OYHA 5H6QA 2XAFA 1V3FA 2E2JJ 2M5WA 1R5GA 2OF7A 3HSEA 2IXSA 2UXXA 4IOCF 1AOYA 1ODDA 2XKOA 3M9AA 5IT3A 5LGNA 4FASD 3LSPA 3KEQA 1B8IA 2MG4A 1Q1HA 3ZMDA 1Y56A 1Z6RA 2KIQA 2X51A 1W7PD 2JMWA 3HM5A 2DQRA 4DYQA 1FT9A 1POGA 1K4TA 4IQJA 2DT6A 1YJ9I 4G9YA 4XSZF 2DJNA 3FXJA 3OIOA 2CG4A 2KL4A 3OR1C 3FXLA 1GVJA 3A01B 3CLQA 3LAPA 3OYGA 4FISA 2WA0A 1T56A 3G1OA 1KU2A 5E20A 4YIFA 4RM2A 1XGSA 4BDZA 2QBYB 3E0JB 3RI4A 1WRJA 3SEQA 1BC7C 4XRMA 2KIUA 4LG3A 1N78A 3HEFA 1GLNA 3RPUD 3A0BC 1CGPA 2OAZA 3WHCA 4DJAA 3GYHX 1A6QA 1XDSA 1YI2I 4X6AJ 2KIMA 2QZ8A 1I3AA 5FLXZ 2X6OA 3LA3A 2XAQA 1E2XA 3F22A 1D3YA 2M30A 1GV5A 3M4OJ 1TT5B 2Y0SA 2HI3A 3H5RA 4C9YA 5CVVA 1ETWA 2XAGA 3RKXA 4XM3A 1O7LA 4D9JA 4CYCA 3E97A 3IRQA 1I39A 4ITVA 1U0JA 1S5LC 2DW4A 2L54A 2KKOA 1KYZA 2O5RA 2DYSH 3OOPA 1TZLA 1MMDA 4LOCA 3EYIA 3CP8A 3EUHC 2WAQA 2Y48A 4LJZF 1RNLA 2VIXA 4HX7A 2BYVE 3NWTA 4V19K 2YS9A 3PO3J 1U5TC 4RAGA 2Y30A 3ISPA 1KU7A 4AWXB 5E79C 3S1MJ 4V2FA 2DK5A 5HODA 2QSHX 1E3HA 2K9QA 5LGUA 2BY3A 4ENJA 4P96A 4E4HA 3FK7A 2WWYA 1WGXA 2A6TA 2WC2A 5M3FJ 4O3MA 1YITI 3I9V2 3G1LA 3EUHA 1FJLA 4UB8C 4DZPA 3CMYA 1WFXA 1NG7A 2JUGA 3I59B 5HS9A 2IA2A 4ZDLA 1T0FA 3QOPA 1LNWA 4A93J 3JRIA 2ZSHB 1TQIA 3L1PA 4IQ4A 4M9ZA 1R00A 1OCTC 3J81Z 2LBFB 5B1BH 2ACJA 4H0EA 2DT7B 3TW7A 3ULQB 1K78B 3H9JA 1MBHA 1X4PA 3PNVA 4I2OA 2Y31A 3BG9A 2GIZA 1V54H 1UG2A 4Y17A 1MDMB 4B48A 3T8TA 2E2HJ 1D0ZA 2R0QC 4LG0A 4A3FJ 1OPCA 1ETXA 3HHHA 1J09A 1SFEA 1VFCA 2DU9A 5GP9A 3TKYA 3FHZA 1QA6A 3PO2J 2DFFA 5H6RA 1QQIA 2ZXJA 3H0GJ 3R6SA 2AO9A 3C3WA 3BR0A 3K10A 2BVLA 5EF6A 2BXYA 3JAMZ 3BTJA 2DT5A 5FFZA 3T5XA 5LHIA 4XKWA 1OYWA 2F5EA 3HRMA 1TQPA 1SVLA 1LFUP 4ZDOA 1K4SA 4MEXF 2F5CA 1ZQ3P 3TP0A 5GPAA 1WVRA 1ZGWA 3P9CA 5HS8A 4RLQA 1NTCA 5GAGJ 2AXLA 1SC7A 2E7XA 2MC4A 3HG9A 1PJRA 2QSFX 1QU3A 4JOMA 3CO6C 3MFKA 3TO9A 1MIJA 4R79A 2R7TA 2BV6A 4WXDA 4L5JA 2FEZA 4MHGA 4CZCA 1ZGAA 3FX3A 3ML6A 5J1RA 1LPQA 2RC4A 2M1BA 4NUBA 3DPLC 2XSDC 1S29A 3MQ0A 4BE0A 1JKOC 1PUFA 1ETYA 2LFBA 4E7IA 3GZ5A 3K70C 2X85A 5LHHA 3CF5F 3FWEA 2KJCA 2MH2A 1Z3YA 4AC0A 2Y75A 3DKWA 5TRDA 4B43A 2ESHA 3EUKL 2E1NA 1MBJA 2XGCA 3F8MA 3BR3A 2EZHA 3P5JA 1XD7A 4ZTFA 1FMVA 3OSGA 2XVCA 2O0YA 4E7KA 1K83J 3CDIA 3CESA 1XGMA 2ZMEA 4FE4A 1HBXG 3RYRA 2A05A 4BE2A 3H35A 4IPAA 1ENHA 4CCOA 1O3TA 3ASNH 2JA7J 1ETQA 3RDIA 1LKXA 1YS6A 3H9GA 1BN5A 1SVOA 2HTSA 3M1EA 5JLWA 4EGYA 2HOAA 3HRTA 3HGGA 2WAQN 3ZQHA 2ZB9A 1MW7A 1NG6A 2CJJA 4U0YA 4KMUX 2EINH 3CC4I 3E6DA 3GLLA 4XLEA 5J1YA 2RNJA 2IGMA 5EZGA 2M4KA 3S1NJ 4DZJA 2ESNA 2LVSA 2KQRA 1LDKB 5K7HA 1W0UA 4CSWA 2LKSA 3IH3A 1HSJA 1Y8QB 3B6AA 1TWGJ 1YS7A 2HQ5A 3CJTB 1L3LA 1LVAA 2WB1A 1VI0A 1RR7A 2ZXWH 4I0BA 4XRSG 1RUNA 1Q1VA 3S2HJ 4W1UA 1S8NA 5GTIC 4IO9F 3DQVC 5F1RA 3FMSA 2Z1DA 1J75A 4EV0A 2W85A 3TO6A 1FIAA 1XMKA 5HDKA 2CU7A 2K4BA 1MD0A 2JA2A 2M87A 2HKXA 2B63J 2DA1A 2PN6A 3ZMVA 4NQWB 2A6EF 2KHMA 2H6CA 2E36A 1XG1A 4RBOA 3I3LA 3QOEA 2MLGA 5K5QA 4QPOA 3HC7A 4GDFA 1IXCA 2QKMB 1YJWI 3F8FA 1XSXA 2DYRH 4XL9A 1I6XA 4MQVA 3L09A 2L0KA 3FIWA 1Z0XA 1SMYF 1B1BA 5J6XA 3BPXA 2JVGA 2Q2EA 3OOUA 1JGSA 2OCCH 1R23A 1P4WA 4HSTA 3ONQA 3LNQA 2DMUA 2LKXA 2K3PA 4A0ZA 4UY8I 3HOVJ 1FYKA 1X58A 1HW1A 5JFRA 4B4CA 4Q4ZF 1Z77A 2ISYA 1DGWY 1B9NA 3VDXA 4MNUA 2DTZA 3I53A 2VN2A 1OCOH 2CQKA 3G2BA 2D45A 2QQAA 3ROUA 4CH7A 2DCEA 3GEZA 5H2FC 4WK8F 1RRJA 2K7LA 1XC5A 1UCRA 2ZCWA 1BR2A 4BS9A 3JRFA 3Q5FA 4PCQA 2A6HF 2L7FP 2EH3A 4BBSJ 3CTAA 3DFGA 3PL8A 5LLQA 5CVIA 4I99C 3VYRB 3GZ6A 2IAIA 3D5LA 3G3ZA 2JA8J 2R7XA 3OYCA 1IAWA 3Q9VA 2QBYA 1W4MA 2CUEA 2FU4A 4UVAA 1SFUA 5LD2C 2QSGX 4YIIA 2VKEA 3C18A 3QP5A 3S93A 3H5NA 3RYPA 3IH2A 1Z91A 2KDOA 2HPIA 2Y9YA 1QZYA 4ZYDA 2R7RA 4H4KC 3TO7A 2EA4A 4IKFA 2CO5A 2OBPA 1X19A 2E71A 2MD0A 2IGNA 2HQNA 2VB6A 1R5ID 5JVGF 1GHCA 4D0PA 2KIFA 3HIFA 3K4KA 1JJ8C 3BJ6A 1U6GA 2R7FA 5F0CA 3ABUA 5E17F 2LY2A 3GTOJ 2PG4A 4N0BA 3ZPLA 1W36C 2ZFWA 4LFUA 5FRNA 1LQ1A 5DCFA 3LAJA 1VQOI 3HSFA 2DA3A 3QPTA 1SFOJ 1XDUA 3TOAA 4EM1A 3KPHA 4M6VA 3GFMA 2EZLA 3PNTA 4Y7NJ 4ESFA 4MLOA 2ID3A 2F4MB 1FPQA 4HX4A 3GTMJ 4TV7A 1G3YA 2H8RA 1FEXA 5K7ZA 5D6FA 5KHDA 3TGNA 1BOBA 2LF7A 1ULYA 3DEWA 1CF7B 2CW7A 3ZQGA 1P92A 3LA2A 1U8BA 2WAFA 3AG4H 2FUG2 3BWGA 1FYMA 2AHQA 3K4BA 3H3VK 3ZN1A 3FKJA 2TRTA 4XOTA 3JRHA 1AWCA 2HQAA 5LRSA 1LEBA 2JVHA 2VBWA 5HDGA 3TP3A 4QWQA 4EQQA 3ZRGA 3I64A 3NQOA 4CXFA 4KISA 5BNGA 1MJ9A 1TW3A 2O3FA 2LK2A 3S1RJ 5AONA 4KFCA 2FE3A 3LSHA 3RQIA 5GAHJ 2QENA 2LBFA 4F3QA 3AG3H 4C3HJ 3S16J 5J4YA 2DTRA 2G7HA 2GXGA 3HOTA 4KITB 2GQQA 3TDZC 3QP6A 4AUXA 2DFEA 3LMMA 3BR5A 2R7OA 4LK1F 1BI2A 4RAYA 3CDLA 1EH7A 3U9GA 3OS1A 1QHHD 4BUPA 4CA0A 1S7EA 3HPHA 2NNYA 1TW2A 4HLYA 5E1ZB 1S7OA 2W84A 4BEHA 3OYLA 5DM7F 2YX7A 1H8AC 3GW2A 2DDBA 3FXOA 4HF2A 4I76A 4KA4A 3FK6A 2PMZA 3RZDJ 5JI6A 4C2TA 5KK1A 2FSWA 2H94A 1A5JA 3CCQI 3K7AJ 4UUSB 3HOWJ 3JRDA 5DUIA 4N4NB 4XLNF 4Z6YA 4OMZA 4ZYEA 1NH3A 1XX5A 1AU7A 3KP3A 4CDGA 1LDJA 4JX5A 1X1BA 1XMAA 1C0WA 2FOKA 1UELB 2BW3A 3WG7H 1IV8A 1EH8A 4NC8A 1G3SA 5FLVA 3S8PA 3GFJA 3QQAA 1ERDA 3WG9A 4AIDA 1FC3A 5CYVA 2JPBA 3KLNA 1VNDA 5F6FA 3VYSB 1HDDC 5FB2A 1JXSA 4B47A 1XSDA 4MTEA 4ZZLA 2R92J 1OQYA 2HYJA 2NYXA 3GBGA 3JRGA 5EGOB 3PFYA 3E1SA 3EUAA 1IUFA 1ZH5A 2GA1A 2CW0F 1ZG5A 3SDBA 2ZKZA 2A5WA 2A5YB 3F8BA 1YTYA 4M3EA 2DA5A 4UV8A 4RLFA 4OMYA 2Y0MA 1J9IA 3WTTC 1PP8F 2EFNA 4HLXA 4XK4A 3OR2C 5F64A 4AU7A 1ITYA 1UJ8A 1U5TA 3TOBA 1SVMA 4GYIA 2W1OA 3JRBA 1T6SA 2DMPA 2OA4A 3BQYA 1Y39A 3R60A 1XGOA 2JA5J 1D8JA 3I0TA 5D4RA 2LLKA 4PDKA 1G8XA 5C3EJ 3S32A 3VPRA 3MKWB 4XSXF 4Q47A 2XDVA 4UUSA 4RDUA 3E6CC 3L2UA 4YELA 1JI8A 4LGWA 2VBXA 3F8NA 1VQKI 2QA4I 5C4JJ 1FSEA 4LMYA 9ANTA 3LSRA 4R1HA 1IXSB 2VQCA 1TWFJ 2P7CB 2CMPA 5E8GA 4MFEA 4RGUA 2HU9A 5J8CA 3ECHA 2VOPA 2V9KA 4UVBA 5IP6A 2BGCA 5FD5A 1DU0A 2ZXIA 1WHUA 2P5KA 3CJNA 4CCJA 4IHYA 2FNPA 1MNEA 1W7PA 1KQ9A 4EJTA 2NS8A 5BS6A 1T95A 2F4OB 4HV5A 3LL7A 2GWRA 2DA2A 4DBRA 1TT0A 2LKPA 1TBXA 5J4VA 2QF7A 2A3SA 4ENMA 3IUOA 5J40A 1HKTA 1TNSA 1T2KA 1MNMC 2FD5A 3MEXA 2V9VA 1BA5A 3GTGJ 2O61A 5GPCA 4IF4A 1LEAA 2R7VA 1WJ5A 2IS2A 5IY5H 1IRFA 3BZ6A 5IT9K 1YX5A 4L9NA 5E3LA 3K2AA 4A3LJ 1Z7LA 1IG7A 3OV8A 4XN3A 2X1DA 4RM3A 1X1AA 2Z3YA 3ZMTA 4BY7J 1LFBA 3WTWC 1DPRA 1O7FA 3WE3A 2OCEA 2DPDA 2JJ7A 5D6EA 4KUMA 3LFUA 1IJWC 6PAXA 1RKWA 1RR8C 4KN7X 1P2FA 2F5FA 3BCAA 3F8CA 2FBIA 4CCNA 3K69A 4BL0B 3SJMA 4C2MJ 2FOWA 4BKXA 3HBLA 4DOZA 1OMIA 4D5CA 1QO0D 3DPTA 3V4GA 3L2WA 4X0GA 2OTJI 1V5FA 2L7ZA 3WTSC 1VQPI 5BPDA 3DKYA 4P9FA 2H09A 3L2CA 3ABTA 4HG2A 1RESA 3B6CA 4XONA 2CSOA 1HKSA 1RETA 3HB9A 5ED4A 4XLPF 1SFKA 1WWXA 4KICA 4DNCA 2WY8Q 2B9SA 2MYSA 5D5XB 5L3GA 4OAYA 3X2QH 2EQRA 1FOXA 2EIMH 4BYYA 3E7LA 1ZREA 4CYDA 2EZKA 2VT2A 1R1VA 3CCLI 5M5XJ 3OYMA 2IS6A 2MFZA 2GXAA 2HR3A 2W7NA 3EQLF 1AKHB 1QZZA 2BHYA 2WADA 3GFIA 2NS0A 4QTRA 2M9HA 3HUGB 2O03A 3ZMZA 1F5TA 1SFXA 2XKPA 5IPAA 4ABZA 1Z9CA 4HQEA 1JHHA 2V1NA 4G7ZF 1BR4A 2EBIA 2QGUA 4EATA 3CCVI 3HOSA 1W7PB 3OL4A 3RPUA 3OYIA 2C6YA 1BBYA 4A69C 3ABMH 3DWLE 2PBIA 3I59A 4NC6A 2KP6A 1QVUA 1YOVB 2ZNYA 2H1LA 4DGWB 3CC7I 2EIKH 2IRFG 2DMTA 3QYFA 4B1RA 1EJ9A 1MSFC 1I3QJ 4BXXJ 5CQEA 5FKKA 3KYCB 4G6TB 4G6QA 3G71I 3S1QJ 5DD8A 1N77A 3P7NA 5GAEJ 3KYDB 1FBUA 5FLMJ 3DF8A 3DBLB 4II3A 3G73A 2HOSA 2V7FA 2HQRA 4M72A 2CFXA 4YFNF 4WX9A 4RGXA 1RPWA 2PJPA 3CUOA 4OIOF 1KU9A 1BIBA 4I09A 5E3MA 4A3KJ 4L9TA 2ZO4A 2M0CA 5EEGA 2VBYA 1HCRA 4IOAF 3J80K 2K27A 5HS7A 2XASA 1TNTA 1K78A 2ELKA 1F43A 3CCSI 3PUBA 4XKVA 2OZUA 2GXBA 1MJAA 2L9RA 2WTEA 4GGGA 4B44A 1Z05A 3BDDA 4ZJZA 2V6EA 3RCOA 3PM1A 5TISC 3M07A 1M1EB 1BM9A 2JRMA 2K9MA 3KEYA 1X3WB 3JR9A 3HJEA 1JE8A 3ZQFA 1QPMA 1R9TJ 2OQRA 3ECOA 3WE2A 2HDCA 4XR6A 1UAAA 3G1MA 4G7OF 4NC7A 4M73A 2CV1A 1D1AA 2B7EA 5ERIA 3MD2A 3KIOA 1ZTRA 1SMTA 3DCFA 3WODF 1XS9A 2B0LA 3E5XA 5CJ9A 3OL3A 3WTZA 1K61A 4LB5A 4HDVA 3ZGKA 2DPUA 4P5OA 2UWMA 3KEOA 4DIQA 3OY9A 2ZBKA 2Q2EB 4MTDA 2PQ8A 3OS0A 3KZYA 3LSTA 2XF5A 3BROA 2M45A 5L3FA 2TCTA 2RQQA 1D8KA 2L7KA 3W3CA 4HOBA 2K40A 1Y1WJ 3HUGA 4QPQA 1ZRFA 4UB6C 4XBFA 2LTPA 3S14J 3R0JA 3GFLA 3J7AY 1XTAA 1V4RA 3M7GA 4HSRA 5J3LA 1VF9A 3D5SC 4PGHA 4FTHA 3OS2A 2V6CA 2FXAA 2HWVA 1R4MB 4GRIA 5K7FA 3CLOA 4UV9A 5JHFA 2EZIA 3BR6A 3K4JA 4J01A 1YW9A 3H0DA 4HNUA 2JSPA 1U2WA 4DQ2A 5AIPA 3V42A 4NBQA 1IN5A 3NAUA 2HVRA 2V79A 5IYDJ 2M4GA 4HEA2 1EV7A 3NARA 4EEFG 5B1AH 5C44J 3A01A 2DOEA 1FBQA 3QU6A 3JREA 4I0AA 3KE2A 1OISA 2KDZA 3QPHA 1MBEA 4PZJA 4HAMA 2HTJA 2CWEA 3U2RA 1HKQA 4Y13A 3H92A 2GAUA 3IV5A 3K2ZA 2R3SA 2J5OA 4X1EA 1WJDA 3GTLJ 4BJ6C 2CW8A 2XPWA 3GX4X 2DXIA 3FKIJ 3JSPA 2VT3A 4BHBA 3EETA 2ELJA 4LK0F 4D7NA 3RKQA 1DGRM 1YE9A 3SZPA 4G6DA 3F23A 3I4PA 2E5NA 5H20A 5ICFA 3RKYA 4CZZA 5BPIA 1RI7A 2JSCA 1FOYA 3A03A 4L5IA 3P9KA 3V7SA 3L2VA 2X1EA 4IEJA 4UHTA 4LB6B 1W5SA 1REPC 5GTHC 4E6KG 1D5VA 3GF2A 3DBRB 3WGIA 1J2XA 1P6RA 3BG7A 2ZJPF 2ECBA 2BVMA 4GYGA 2BHZA 3DEUA 3C2HA 1S7AA 4PJ0C 1ETOA 3WU0A 3QPSA 1PDNC 4XRSA 1YW7A 2GA2A 4EJVA 4GCVA 4BQQA 3MZHA 1WH5A 3VOEA 2FF4A 2HKOA 1WJCA 4F55A 5D5VB 1OLTA 3DLAA 3VODA 2DDAA 3ASOH 5BOXA 2XPVA 2W57A 2HS5A 2YSRA 3IRRA 1IUYA 2ZMEB 2KRCA 3ZN0A 2GOMA 1Y0UA 2OD5A 1NK3P 1P4AA 2LOOA 1BW5A 3FXKA 5D8LB 2XC7A 4M6YA 2PFBA 1JT6A 1T39A 1ORKA 1Y6IA 3ERMA 2XGXA 2R7QA 2YPRA 2BZTA 5AIQA 4O5VA 2OZ6A 4ZDPA 4EM0B 2VJ5A 3B02A 2NRAC 1FTTA 4OAZA 3FDYA 1L0OC 2ECCA 2DA6A 1D5YA 1DP3A 2E2IJ 1SEUA 4M3GA 1FIPA 1LUJB 1BJAA 2VQGA 3M8EA 3QYBA 5FKMA 1KA8A 5C4XJ 1IDZA 2VLAA 2FX0A 1JKPC 3F0CA 5IP9J 1IO2A 3SZTA 4Q5SF 3AL0C 1VQ9I 1EKEA 3RIRA 1YFHA 3SYTA 2LD5A 2PMZN 4BQAA 1B4AA 1KQ0A 5LHGA 5FKLA 4I7HA 3RPQA 1R49A 1NK2P 1EA3A 3NWSA 3SFIA 2HGCA 4OU0A 4P1WA 1J7KA 5EEHA 4HNTA 3D1NI 3ZP5A 3KP7A 3FHNA 3S2WA 2G9WA 4LLGF 3CCEI 1VQ4I 1K79A 4IHXA 1P7IA 4A6DA 3IH4A 2UV1A 2VONA 2IBDA 3ZQLA 2DI3A 3R0AA 2Z16A 2PMUA 4II2A 4IZZA 3R61A 1ZR2A 4L0YB 4ESJA 5L3BA 2CYYA 2R5YB 3DP7A 3BTCA 2O6GE 1ZELA 3IL2A 2M0MA 2F6CA 2Z9OA 2H27A 1I5ZA 3FMQA 2XAUA 5FROA 1GXPA 2WAEA 4PJLA 4HZFA 4F92B 2KRFA 3ERED 3ZMSA 5DS9A 2X6XA 2YR2A 1ZG3A 5IYBJ 2M7AA 1WI3A 2R7WA 3WTXC 1ON1A 5K5OA 1JUSA 2MW8A 2OV7A 3FBIB 2VJIA 2DA7A 2P6TA 3VSLA 1DPUA 1S3JA 4L9JA 3MCZA 4IRGA 2Z2SB 3I54A 1YW8A 4GO1A 3OYNA 4XLHA 2QQ9A 1D1BA 1ZARA 4KIFA 1X3UA 4ASNA 5KNLA 3MZYA 2YU9J 3JW4A 2DLLA 4A3CJ 3ZQCA 2XPUA 1R1TA 1WJBA 2LR8A 4PJMA 2X9DA 3I4NJ 2R7ZJ 4C3IJ 2EFPA 1MMNA 5GADJ 3N05A 3OYJA 4HW0A 5E18F 1H9GA 1ZHFA 4RGRA 3W2AA 3QAHA 1ZLKA 2PEXA 4RAZA 3KCCA 2XF6A 2LH9A 2P5LC 3PJRA 4BH9A 2N8GA 3S3NA 4JBAA 2WV1A 1T08B 1JGGA 4M3FA 4PFPA 3M8FA 3RJPA 4U7DA 3DKXA 4MQ9F 2VC0A 1OR7C 5TGTA 1E17A 2QM3A 4I98B 4U7BA 1H89C 1UHWA 3LSIA 2CUFA 2R7DA 1SD4A 1X4OA 1X2MA 1QRYA 3K9TA 4IL6C 2HDDA 5FKOA 3PSFA 2H1KA 2XSJC 4EGZA 2Y9ZA 2HPMA 2L2OA 4HNVA 2CQQA 2K9LA 2K9SA 1S6LA 2CRGA 2CV0A 3LWFA 1JUPA 2E7WA 1ZR4A 3HGYA 3GUDA 2OPTA 3I71A 2FQ3A 1OCRH 5DDGA 1LE8A 2FBHA 4CGZA 4PJNA 2BBYA 4MIMA 4KYWA 1VQ7I 5JVTA 1MMSA 2GOXB 3AFHA 2HDWA 1Z1DA 3VSKA 3TQNA 1A04A 3O6BB 3OYKA 2AS5F 2JK3A 2VBZA 2PLYA 3IKVA 1YHQI 4QIWN 2X4HA 4BAYA 3VYUB 2I8DA 2IS1A 3BG5A 2D1VA 4UVCA 5E3NA 3CMEI 4JYKA 4IHTA 2I10A 4QSHA 1JUMA 3CJQB 1XSVA 4AYBN 5CVJA 1W5CC 5J47A 2JA6J 2MBFA 1ETKA
chains in the Genus database with same CATH topology
4KMFA 4BHPA 1MJBA 2P6SA 1MGTA 2P5VA 3K1NA 3AAFA 2WV0A 3FXUA 2GIVA 3C1DA 2EFOA 4FHTA 5DD4A 2Z99A 2L4AA 2MH9A 1IRGA 2COMA 5D4SA 5FD6A 2MA3A 2V1XA 4I01A 1MZBA 2K4JA 3VFZA 4N9HA 1G6NA 1FLIA 1ZRDA 4RB1A 2QVOA 4HBLA 2A61A 3BOQA 5CLSA 2TDXA 3WGGA 3F6VA 3KP5A 2RGVA 1Z7UA 4HQMA 4IHSA 5ICGA 1RZ4A 5D5UB 2W24A 1U8RA 2YX4A 3Q9SA 1Z6TA 1H9TA 4HV6A 3FM5A 3O2PE 4OIQF 3F72A 3SQNA 2LSOA 1BOAA 2JT1A 4RB0A 1WI9A 2FMYA 4CHUA 3GVAA 4WXHA 4A0YA 5CVUA 1HW5A 3GLXA 1DP7P 2GZWA 3H3UA 2P8TA 1JHFA 3W6KB 2HYGD 5LRRA 4G94A 5DCMA 1DDNA 2EWNA 4UXNA 2KJBA 5BQTA 5ICCA 3BJOA 2RKHA 4L9VA 4K2EA 1IW7F 3K1MA 3RTRA 3COAC 1KGSA 2LDUA 1K7AA 1J59A 4UUVA 3WGHA 4KN4X 1XN7A 4BNCA 4HF0A 3E3VA 1T98A 5JR3A 5DEQA 2P4WA 3CO7C 1P4XA 3RKWA 3MWMA 1TQMA 5E8IA 1STZA 2K02A 1PP7U 1ONVA 4U0WA 5DV5A 3P9IA 4OINF 4IVNA 3J80Z 2V1DA 4HDUA 1IXRC 2F2EA 4PGGA 2XUBA 3HTUA 1BI1A 1F9NA 3L9FA 1YYVA 3WTUC 5A2QK 3WTVC 4ENNA 4YFKF 1YO5C 5LEJA 1H0MA 2O8XA 3SHFA 2DAOA 2DO7A 1OYYA 3V7RA 4EVIA 2DFIA 4LD5A 1ZAOA 2IA1A 4NHJA 3K0LA 1IF1A 1FZPB 3PFIA 1ZYRF 4FT8A 1I1SA 3GXOA 3IHUA 4WXCA 4RB2C 5HLHA 2L01A 2ZJ2A 2YU3A 5L3EA 2XROA 4HYEA 2RN7A 2BE5F 2VODA 1ZLJA 2FBKA 3D0SA 3QU3A 5ICEA 2L3DA 4IRIA 4EJOA 2XV4S 1B9MA 4WF2A 3JAMK 3K1PA 1WQ2A 1IN4A 4IRHA 3H3ZA 1XCVA 2EB7A 5E1WA 2JRTA 3T1BA 4ZYHA 1R36A 3KFWX 1OYIA 1FBSA 2ETHA 1W5TA 1BIAA 4BXUA 4AVPA 1VTNC 4OOIA 3B73A 4RB3C 1R5HA 3HRUA 2D1HA 4YFXF 2L4MA 1LDDA 2Q0OA 3T0YA 4S05A 4A5MA 1IN6A 4M9SA 3FXQA 5FO5A 3LQRA 3FM3A 1TTYA 4LLNA 3EYYA 1K6OA 3LQQA 1YQAA 4U0VA 1O3SA 2STTA 4NQWA 4L18B 5ILUA 3TDUC 2STWA 3REOA 1O3QA 3JTHA 3J7AO 3CDHA 5ILVA 2BEOA 1ZGJA 4XRFA 4EJWA 2RQPA 5HDNA 2UXNA 4M6XA 2ISZA 1FX7A 3HHGA 3JSOA 4KNYA 1XCBA 3KZZA 1HW2A 2XAJA 2IPQX 3GO5A 4G8XA 4ZZDA 3IC7A 1FP2A 3SXYA 4WWCA 2W25A 4FX4A 1KYWA 1SAXA 3SFZA 2MC3A 2XRNA 3PQJA 2A69F 3VB2A 1O3RA 2CGPA 4EM2A 1HQCA 3HYIA 4CO8A 2MD5A 4WCGA 3N97A 2FRHA 2OU2A 2VXZA 1G4DA 3V8KA 2HYFA 5DUKA 1ON2A 1RUOA 1SD6A 2ZNZA 3KP6A 2G7UA 1ZG1A 1FOKA 4LLLA 3FMRA 2EFWA 2OQGA 4AIHA 1R22A 2XHKA 4JK1X 2LNBA 1HSTA 2DBBA 2XIGA 4LG0B 1I27A 3E5QA 4F7ZA 3KLOA 5LBQA 2JZYA 3V8LA 1ZRCA 4M74A 4CICA 2PMHA 2RVCA 4A0XA 4ZH4F 1ZN2A 4ENKA 2HEOA 3E6BA 4KIGA 4AIJA 3ELKA 2HFHA 3E6MA 5KVRA 3N4MA 1T38A 3QRFF 3E5UA 3CUQB 5DCMB 3NRVA 1UB9A 2Z33A 5BMZA 4FX0A 5D8KB 2D2WA 1BC8C 5HVQC 5LGTA 3KETA 4HA8A 1R1UA 1J0RA 2F5DA 1BI0A 1FY7A 2ELHA 2UZKA 1NHAA 3KP2A 4M71A 2IW5A 2VE8A 5HLIA 1R7JA 4U88A 3IKTA 2IVMA 1CF7A 3C7JA 2DQLA 3BP8A 1U78A 3EDPA 4RS8A 1XGNA 5LEKA 2VE9A 1HXDA 4ETSA 1KQ8A 2HZTA 2IT0A 5L3DA 4A2UA 2P7VB 4AD9A 4EMSA 2X0LA 4A12A 1U3EM 3WU1B 2NAZA 1IN7A 5K1YA 2V1UA 4S04A 1SD7A 3FF5A 5K5RA 3U1DA 1I1GA 5L3CA 2A68F 5IT9Z 3J81K 3R4KA 2EV6A 5FLXK 2NNNA 4L0ZB 2IJLA 3V7CA 4BHCA 3BY6A 3I58A 1MKMA 2PI0A 1QBJA 2QQBA 3LA7A 4G7HF 3V8JA 2VC1A 5HLGA 2FNAA 4GXOA 4A5NA 3L7WA 2HOEA 1LJ9A 4RGSA 2EV5A 4B8XA 5DYMA 1MDMA 3BJAA 1PUEE 4ZYGA 1OKRA 1U5TB 1O57A 2EFQA 4IXAA 5A2QZ 2VOOA 1RIOH 4Y15A 2JTVA 3IWZA 1XB4A 1LB2A 4I02A 2QWWA 3WTYC 4OIPF 2J5PA 2QUFA 1B6AA 2A07F 1G3WA 3FZVA 3IWFA 4AIKA 1FP1D 1B59A 1FWZA 2XAHA 4E70A 1IN8A 4Z2YA 3VEPA 1UHMA 4HX8A 2L02A 5JHUA 5D5WB 4MGRA 1USTA 1UFMA 4IJAA 5FFXA 3I5UA 2EV0A 1R58A 3F3XA 1J5YA 3ZMUA 1FNNA 3LFKA 2LF8A 4NB5A 4P9UA 4ESBA 4HF1A 4QLCU 1WKMA 2Z5UA 1USSA 3FXRA 5CVRA 1IZ1A 1QGPA 3PQKA 3MAJA 2EK5A 1G3TA 3DV8A 2EJRA 5E1XA 4A6EA 3DXJF 4R8HA 3GWZA 4O6JA 2ADUA 1EH6A 1F4KA 3CUQC 1OR7A 2K86A 3L00A 3F21A 2RDPA 2MLKA 5TJJA 4UNOA 5ILSA 2H6BA 3ZQ7A 4OIRF 3HSRA 1SD5A 2RV8A 1F1ZA 3W6JB 1YLFA 4M9XA 4N9IA 4JQFA 3BPVA 4ON0A 1YG2A 3CUQA 2E1CA 2FA5A 3KP4A 4MEYF 2Q8KA 2DK8A 1YIOA 4YG2F 3T8RA 4KT5C 4KDPA 1FSHA 1BI3A 3O3KA 3NEUA 5J8FA 3HTSB 4B09A 2M8EA 2QYOA 4EJUA 3F6OA 3HRSA 1WSUA 1GXQA 2EA2A 1DUXC 2JPCA 1KU3A 1TLHB 5FGMA 1FYLA 2IP2A 4P55A 2FMLA 5HOOA 2IA0A 1QNTA 2QLZA 4KIBA 4Q48A 3JTGA 5H6QA 2XAFA 1V3FA 2M5WA 1R5GA 3HSEA 2UXXA 1AOYA 1ODDA 2XKOA 3M9AA 5IT3A 5LGNA 3KEQA 1Q1HA 3ZMDA 1Z6RA 1W7PD 2DQRA 1FT9A 4G9YA 4XSZF 2CG4A 1GVJA 3LAPA 1KU2A 5E20A 4YIFA 1XGSA 2QBYB 3RI4A 1WRJA 1BC7C 2KIUA 1CGPA 2OAZA 3GYHX 1XDSA 2KIMA 2QZ8A 5FLXZ 3LA3A 2XAQA 1E2XA 3F22A 1D3YA 2M30A 5CVVA 2XAGA 3RKXA 1O7LA 3E97A 3IRQA 2L54A 2DW4A 2KKOA 1KYZA 3OOPA 3EYIA 4LJZF 2Y48A 1RNLA 4HX7A 2BYVE 1U5TC 3ISPA 1KU7A 4AWXB 2DK5A 5LGUA 4ENJA 4P96A 2WWYA 2WC2A 4O3MA 3EUHA 3I59B 5HS9A 2IA2A 1T0FA 3QOPA 1LNWA 1TQIA 4M9ZA 1R00A 3J81Z 2ACJA 4H0EA 3ULQB 1K78B 4I2OA 4Y17A 1MDMB 3T8TA 4LG0A 1OPCA 3HHHA 1SFEA 2DU9A 3TKYA 3FHZA 5H6RA 1QQIA 2ZXJA 3R6SA 3C3WA 3JAMZ 2DT5A 5FFZA 3T5XA 5LHIA 1OYWA 2F5EA 3HRMA 1TQPA 4MEXF 2F5CA 3P9CA 5HS8A 2AXLA 2E7XA 3CO6C 3MFKA 3TO9A 4R79A 2BV6A 4WXDA 4L5JA 2FEZA 4MHGA 1ZGAA 3FX3A 3ML6A 2RC4A 2M1BA 3DPLC 1S29A 3MQ0A 3GZ5A 5LHHA 3FWEA 2KJCA 2MH2A 2Y75A 3DKWA 5TRDA 2ESHA 2E1NA 3F8MA 1XD7A 2XVCA 2O0YA 1XGMA 2ZMEA 1HBXG 3RYRA 4IPAA 1O3TA 3RDIA 1YS6A 1BN5A 3M1EA 2HTSA 4EGYA 3HRTA 4U0YA 4KMUX 3E6DA 2RNJA 2ESNA 1LDKB 1HSJA 1YS7A 1L3LA 1LVAA 4I0BA 1RUNA 1S8NA 3DQVC 5F1RA 3FMSA 1J75A 4EV0A 2W85A 3TO6A 1XMKA 5HDKA 2K4BA 1MD0A 2M87A 2HKXA 2PN6A 3ZMVA 2A6EF 2H6CA 2MLGA 5K5QA 1IXCA 3F8FA 1XSXA 1I6XA 4MQVA 3L09A 1SMYF 1B1BA 5J6XA 3BPXA 2Q2EA 1JGSA 1R23A 1P4WA 4A0ZA 1FYKA 1HW1A 5JFRA 4Q4ZF 2ISYA 1B9NA 4MNUA 3I53A 2VN2A 2CQKA 2D45A 2QQAA 3ROUA 3GEZA 4WK8F 2K7LA 1UCRA 2ZCWA 3Q5FA 4PCQA 2A6HF 3CTAA 3DFGA 5LLQA 1GXPA 5CVIA 3GZ6A 3G3ZA 3D5LA 1IAWA 3Q9VA 2QBYA 1SFUA 1W4MA 2FU4A 4UVAA 4YIIA 3C18A 3QP5A 3RYPA 1Z91A 4ZYDA 1QZYA 3TO7A 2EA4A 2CO5A 2OBPA 2HQNA 1GHCA 4D0PA 2KIFA 3HIFA 3BJ6A 1U6GA 2R7FA 3ABUA 5E17F 2PG4A 4N0BA 3ZPLA 2ZFWA 4LFUA 1LQ1A 5DCFA 3LAJA 3HSFA 3QPTA 1XDUA 3TOAA 4EM1A 3GFMA 4ESFA 1FPQA 4HX4A 4TV7A 1G3YA 5D6FA 3TGNA 2LF7A 1ULYA 1CF7B 1P92A 3LA2A 3BWGA 1FYMA 3ZN1A 1AWCA 5LRSA 1LEBA 2VBWA 5HDGA 4QWQA 4EQQA 3I64A 3NQOA 4CXFA 1MJ9A 1TW3A 2O3FA 5AONA 4KFCA 2FE3A 2QENA 2DTRA 2G7HA 2GXGA 3HOTA 2GQQA 3TDZC 3QP6A 4RAYA 4LK1F 1BI2A 1EH7A 3U9GA 2NNYA 1TW2A 4HLYA 5E1ZB 1S7OA 2W84A 2YX7A 3GW2A 4HF2A 4KA4A 5JI6A 5KK1A 2FSWA 2H94A 5DUIA 4XLNF 4OMZA 4ZYEA 3KP3A 4CDGA 1LDJA 1XMAA 1C0WA 2FOKA 1EH8A 1G3SA 3GFJA 3WG9A 1FC3A 5CYVA 2JPBA 3KLNA 5F6FA 5FB2A 1JXSA 1XSDA 4MTEA 4ZZLA 2NYXA 1ZH5A 2GA1A 2CW0F 1ZG5A 2ZKZA 2A5YB 3F8BA 1YTYA 4UV8A 4OMYA 2Y0MA 1J9IA 1PP8F 3WTTC 2EFNA 4HLXA 5F64A 1U5TA 3TOBA 4GYIA 1T6SA 2OA4A 3R60A 1XGOA 1D8JA 3I0TA 5D4RA 4PDKA 4XSXF 4Q47A 3E6CC 4LGWA 2VBXA 3F8NA 1FSEA 4LMYA 4R1HA 1IXSB 2P7CB 5E8GA 4RGUA 5J8CA 3ECHA 2VOPA 4UVBA 2BGCA 5FD5A 2P5KA 3CJNA 2FNPA 1W7PA 1KQ9A 4EJTA 5BS6A 4HV5A 2GWRA 2LKPA 1TBXA 2A3SA 4ENMA 1HKTA 1TNSA 1T2KA 3MEXA 2V9VA 2O61A 4IF4A 1LEAA 1IRFA 3BZ6A 5IT9K 4L9NA 3OV8A 2Z3YA 3ZMTA 3WTWC 1DPRA 1O7FA 3WE3A 2DPDA 5D6EA 4KUMA 6PAXA 4KN7X 1P2FA 2F5FA 3F8CA 2FBIA 3K69A 1OMIA 1QO0D 3DPTA 3V4GA 3WTSC 5BPDA 4P9FA 2H09A 3L2CA 3ABTA 2CSOA 1HKSA 4XLPF 5ED4A 1WWXA 4KICA 4DNCA 5D5XB 5L3GA 4BYYA 1ZREA 4CYDA 2VT2A 1R1VA 2HR3A 3EQLF 1QZZA 3GFIA 2NS0A 2O03A 3ZMZA 1F5TA 1SFXA 2XKPA 1Z9CA 4HQEA 1JHHA 4G7ZF 3HOSA 1W7PB 3RPUA 2C6YA 1BBYA 2PBIA 3I59A 2ZNYA 2IRFG 4G6QA 5DD8A 3P7NA 1FBUA 3DF8A 3G73A 2HQRA 4M72A 2CFXA 4YFNF 4WX9A 4RGXA 2PJPA 4OIOF 3CUOA 1KU9A 1BIBA 4I09A 4L9TA 2ZO4A 5EEGA 2VBYA 3J80K 2K27A 5HS7A 2XASA 1TNTA 1K78A 2GXBA 2OZUA 1MJAA 2WTEA 4GGGA 1Z05A 3BDDA 1BM9A 1JE8A 1QPMA 2OQRA 3ECOA 3WE2A 2HDCA 4G7OF 4M73A 5ERIA 1SMTA 3WODF 2B0LA 3E5XA 5CJ9A 3WTZA 4LB5A 4HDVA 2DPUA 4P5OA 2UWMA 3KEOA 2ZBKA 4MTDA 2PQ8A 3KZYA 3LSTA 3BROA 2M45A 5L3FA 1D8KA 4HOBA 3HUGA 1ZRFA 4XBFA 3R0JA 3GFLA 1V4RA 3M7GA 4PGHA 2V6CA 2FXAA 2HWVA 3CLOA 4UV9A 1YW9A 1U2WA 4DQ2A 5AIPA 1IN5A 2V79A 1EV7A 1FBQA 3QU6A 4I0AA 3KE2A 3QPHA 4PZJA 4HAMA 2HTJA 2CWEA 3U2RA 1HKQA 4Y13A 3H92A 2GAUA 3K2ZA 2R3SA 2J5OA 3GX4X 3JSPA 2VT3A 4BHBA 3EETA 4LK0F 3SZPA 4G6DA 3F23A 3I4PA 5H20A 5ICFA 3RKYA 4CZZA 5BPIA 1RI7A 2JSCA 4L5IA 3P9KA 3V7SA 4UHTA 4LB6B 1W5SA 1REPC 1D5VA 3GF2A 3WGIA 1J2XA 1P6RA 4GYGA 3DEUA 1S7AA 3WU0A 1PDNC 1YW7A 2GA2A 4EJVA 4GCVA 3MZHA 3VOEA 2FF4A 2HKOA 5D5VB 3VODA 5BOXA 2W57A 2HS5A 2YSRA 3IRRA 1IUYA 2ZMEB 3ZN0A 1Y0UA 2OD5A 1P4AA 5D8LB 4M6YA 2PFBA 1T39A 2XGXA 2YPRA 5AIQA 4O5VA 2OZ6A 4EM0B 2NRAC 3B02A 1L0OC 1BJAA 3M8EA 1KA8A 3SZTA 4Q5SF 1YFHA 3RIRA 4BQAA 1B4AA 1KQ0A 5LHGA 4I7HA 3RPQA 2HGCA 4OU0A 1J7KA 5EEHA 3ZP5A 3KP7A 3S2WA 2G9WA 4LLGF 1K79A 4A6DA 2VONA 2DI3A 3R0AA 2PMUA 3R61A 4L0YB 4ESJA 5L3BA 2CYYA 3DP7A 2O6GE 3IL2A 2Z9OA 2H27A 1I5ZA 3FMQA 4HZFA 2KRFA 3ERED 3ZMSA 2YR2A 1ZG3A 3WTXC 1ON1A 5K5OA 2P6TA 1DPUA 1S3JA 4L9JA 3MCZA 4IRGA 3I54A 1YW8A 4GO1A 2QQ9A 1ZARA 4KIFA 1X3UA 4ASNA 3MZYA 3JW4A 2DLLA 1R1TA 2EFPA 4HW0A 5E18F 1H9GA 1ZHFA 4RGRA 3QAHA 1ZLKA 2PEXA 4RAZA 3KCCA 2P5LC 4BH9A 4JBAA 3M8FA 3RJPA 4U7DA 4MQ9F 2VC0A 1E17A 2QM3A 4I98B 4U7BA 1UHWA 2R7DA 1SD4A 3K9TA 4EGZA 1S6LA 3LWFA 2E7WA 3GUDA 3I71A 2FQ3A 5DDGA 2FBHA 4CGZA 2BBYA 4KYWA 5JVTA 1Z1DA 2AS5F 1A04A 3O6BB 3TQNA 2VBZA 2PLYA 3IKVA 2X4HA 4BAYA 2D1VA 4UVCA 4IHTA 1XSVA 5CVJA 2MBFA
chains in the Genus database with same CATH homology


 
#chains in the Genus database with same CATH superfamily
 4KMF A;  4BHP A;  1MJB A;  2P6S A;  1MGT A;  2P5V A;  3K1N A;  3AAF A;  2WV0 A;  3FXU A;  2GIV A;  3C1D A;  2EFO A;  4FHT A;  5DD4 A;  2Z99 A;  2L4A A;  2MH9 A;  1IRG A;  2COM A;  5D4S A;  5FD6 A;  2MA3 A;  2V1X A;  4I01 A;  1MZB A;  2K4J A;  3VFZ A;  4N9H A;  1G6N A;  1FLI A;  1ZRD A;  4RB1 A;  2QVO A;  4HBL A;  2A61 A;  3BOQ A;  5CLS A;  2TDX A;  3WGG A;  3F6V A;  3KP5 A;  2RGV A;  1Z7U A;  4HQM A;  4IHS A;  5ICG A;  1RZ4 A;  5D5U B;  2W24 A;  1U8R A;  2YX4 A;  3Q9S A;  1Z6T A;  1H9T A;  4HV6 A;  3FM5 A;  3O2P E;  4OIQ F;  3F72 A;  3SQN A;  2LSO A;  1BOA A;  2JT1 A;  4RB0 A;  1WI9 A;  2FMY A;  4CHU A;  3GVA A;  4WXH A;  4A0Y A;  5CVU A;  1HW5 A;  3GLX A;  1DP7 P;  2GZW A;  3H3U A;  2P8T A;  1JHF A;  3W6K B;  2HYG D;  5LRR A;  4G94 A;  5DCM A;  1DDN A;  2EWN A;  4UXN A;  2KJB A;  5BQT A;  5ICC A;  3BJO A;  2RKH A;  4L9V A;  4K2E A;  1IW7 F;  3K1M A;  3RTR A;  3COA C;  1KGS A;  2LDU A;  1K7A A;  1J59 A;  4UUV A;  3WGH A;  4KN4 X;  1XN7 A;  4BNC A;  4HF0 A;  3E3V A;  1T98 A;  5JR3 A;  5DEQ A;  2P4W A;  3CO7 C;  1P4X A;  3RKW A;  3MWM A;  1TQM A;  5E8I A;  1STZ A;  2K02 A;  1PP7 U;  1ONV A;  4U0W A;  5DV5 A;  3P9I A;  4OIN F;  4IVN A;  3J80 Z;  2V1D A;  4HDU A;  1IXR C;  2F2E A;  4PGG A;  2XUB A;  3HTU A;  1BI1 A;  1F9N A;  3L9F A;  1YYV A;  3WTU C;  5A2Q K;  3WTV C;  4ENN A;  4YFK F;  1YO5 C;  5LEJ A;  1H0M A;  2O8X A;  3SHF A;  2DAO A;  2DO7 A;  1OYY A;  3V7R A;  4EVI A;  2DFI A;  4LD5 A;  1ZAO A;  2IA1 A;  4NHJ A;  3K0L A;  1IF1 A;  1FZP B;  3PFI A;  1ZYR F;  4FT8 A;  1I1S A;  3GXO A;  3IHU A;  4WXC A;  4RB2 C;  5HLH A;  2L01 A;  2ZJ2 A;  2YU3 A;  5L3E A;  2XRO A;  4HYE A;  2RN7 A;  2BE5 F;  2VOD A;  1ZLJ A;  2FBK A;  3D0S A;  3QU3 A;  5ICE A;  2L3D A;  4IRI A;  4EJO A;  2XV4 S;  1B9M A;  4WF2 A;  3JAM K;  3K1P A;  1WQ2 A;  1IN4 A;  4IRH A;  3H3Z A;  1XCV A;  2EB7 A;  5E1W A;  2JRT A;  3T1B A;  4ZYH A;  1R36 A;  3KFW X;  1OYI A;  1FBS A;  2ETH A;  1W5T A;  1BIA A;  4BXU A;  4AVP A;  1VTN C;  4OOI A;  3B73 A;  4RB3 C;  1R5H A;  3HRU A;  2D1H A;  4YFX F;  2L4M A;  1LDD A;  2Q0O A;  3T0Y A;  4S05 A;  4A5M A;  1IN6 A;  4M9S A;  3FXQ A;  5FO5 A;  3LQR A;  3FM3 A;  1TTY A;  4LLN A;  3EYY A;  1K6O A;  3LQQ A;  1YQA A;  4U0V A;  1O3S A;  2STT A;  4NQW A;  4L18 B;  5ILU A;  3TDU C;  2STW A;  3REO A;  1O3Q A;  3JTH A;  3J7A O;  3CDH A;  5ILV A;  2BEO A;  1ZGJ A;  4XRF A;  4EJW A;  2RQP A;  5HDN A;  2UXN A;  4M6X A;  2ISZ A;  1FX7 A;  3HHG A;  3JSO A;  4KNY A;  1XCB A;  3KZZ A;  1HW2 A;  2XAJ A;  2IPQ X;  3GO5 A;  4G8X A;  4ZZD A;  3IC7 A;  1FP2 A;  3SXY A;  4WWC A;  2W25 A;  4FX4 A;  1KYW A;  1SAX A;  3SFZ A;  2MC3 A;  2XRN A;  3PQJ A;  2A69 F;  3VB2 A;  1O3R A;  2CGP A;  4EM2 A;  1HQC A;  3HYI A;  4CO8 A;  2MD5 A;  4WCG A;  3N97 A;  2FRH A;  2OU2 A;  2VXZ A;  1G4D A;  3V8K A;  2HYF A;  5DUK A;  1ON2 A;  1RUO A;  1SD6 A;  2ZNZ A;  3KP6 A;  2G7U A;  1ZG1 A;  1FOK A;  4LLL A;  3FMR A;  2EFW A;  2OQG A;  4AIH A;  1R22 A;  2XHK A;  4JK1 X;  2LNB A;  1HST A;  2DBB A;  2XIG A;  4LG0 B;  1I27 A;  3E5Q A;  4F7Z A;  3KLO A;  5LBQ A;  2JZY A;  3V8L A;  1ZRC A;  4M74 A;  4CIC A;  2PMH A;  2RVC A;  4A0X A;  4ZH4 F;  1ZN2 A;  4ENK A;  2HEO A;  3E6B A;  4KIG A;  4AIJ A;  3ELK A;  2HFH A;  3E6M A;  5KVR A;  3N4M A;  1T38 A;  3QRF F;  3E5U A;  3CUQ B;  5DCM B;  3NRV A;  1UB9 A;  2Z33 A;  5BMZ A;  4FX0 A;  5D8K B;  2D2W A;  1BC8 C;  5HVQ C;  5LGT A;  3KET A;  4HA8 A;  1R1U A;  1J0R A;  2F5D A;  1BI0 A;  1FY7 A;  2ELH A;  2UZK A;  1NHA A;  3KP2 A;  4M71 A;  2IW5 A;  2VE8 A;  5HLI A;  1R7J A;  4U88 A;  3IKT A;  2IVM A;  1CF7 A;  3C7J A;  2DQL A;  3BP8 A;  1U78 A;  3EDP A;  4RS8 A;  1XGN A;  5LEK A;  2VE9 A;  1HXD A;  4ETS A;  1KQ8 A;  2HZT A;  2IT0 A;  5L3D A;  4A2U A;  2P7V B;  4AD9 A;  4EMS A;  2X0L A;  4A12 A;  1U3E M;  3WU1 B;  2NAZ A;  1IN7 A;  5K1Y A;  2V1U A;  4S04 A;  1SD7 A;  3FF5 A;  5K5R A;  3U1D A;  1I1G A;  5L3C A;  2A68 F;  5IT9 Z;  3J81 K;  3R4K A;  2EV6 A;  5FLX K;  2NNN A;  4L0Z B;  2IJL A;  3V7C A;  4BHC A;  3BY6 A;  3I58 A;  1MKM A;  2PI0 A;  1QBJ A;  2QQB A;  3LA7 A;  4G7H F;  3V8J A;  2VC1 A;  5HLG A;  2FNA A;  4GXO A;  4A5N A;  3L7W A;  2HOE A;  1LJ9 A;  4RGS A;  2EV5 A;  4B8X A;  5DYM A;  1MDM A;  3BJA A;  1PUE E;  4ZYG A;  1OKR A;  1U5T B;  1O57 A;  2EFQ A;  4IXA A;  5A2Q Z;  2VOO A;  1RIO H;  4Y15 A;  2JTV A;  3IWZ A;  1XB4 A;  1LB2 A;  4I02 A;  2QWW A;  3WTY C;  4OIP F;  2J5P A;  2QUF A;  1B6A A;  2A07 F;  1G3W A;  3FZV A;  3IWF A;  4AIK A;  1FP1 D;  1B59 A;  1FWZ A;  2XAH A;  4E70 A;  1IN8 A;  4Z2Y A;  3VEP A;  1UHM A;  4HX8 A;  2L02 A;  5JHU A;  5D5W B;  4MGR A;  1UST A;  1UFM A;  4IJA A;  5FFX A;  3I5U A;  2EV0 A;  1R58 A;  3F3X A;  1J5Y A;  3ZMU A;  1FNN A;  3LFK A;  2LF8 A;  4NB5 A;  4P9U A;  4ESB A;  4HF1 A;  4QLC U;  1WKM A;  2Z5U A;  1USS A;  3FXR A;  5CVR A;  1IZ1 A;  1QGP A;  3PQK A;  3MAJ A;  2EK5 A;  1G3T A;  3DV8 A;  2EJR A;  5E1X A;  4A6E A;  3DXJ F;  4R8H A;  3GWZ A;  4O6J A;  2ADU A;  1EH6 A;  1F4K A;  3CUQ C;  1OR7 A;  2K86 A;  3L00 A;  3F21 A;  2RDP A;  2MLK A;  5TJJ A;  4UNO A;  5ILS A;  2H6B A;  3ZQ7 A;  4OIR F;  3HSR A;  1SD5 A;  2RV8 A;  1F1Z A;  3W6J B;  1YLF A;  4M9X A;  4N9I A;  4JQF A;  3BPV A;  4ON0 A;  1YG2 A;  3CUQ A;  2E1C A;  2FA5 A;  3KP4 A;  4MEY F;  2Q8K A;  2DK8 A;  1YIO A;  4YG2 F;  3T8R A;  4KT5 C;  4KDP A;  1FSH A;  1BI3 A;  3O3K A;  3NEU A;  5J8F A;  3HTS B;  4B09 A;  2M8E A;  2QYO A;  4EJU A;  3F6O A;  3HRS A;  1WSU A;  1GXQ A;  2EA2 A;  1DUX C;  2JPC A;  1KU3 A;  1TLH B;  5FGM A;  1FYL A;  2IP2 A;  4P55 A;  2FML A;  5HOO A;  2IA0 A;  1QNT A;  2QLZ A;  4KIB A;  4Q48 A;  3JTG A;  5H6Q A;  2XAF A;  1V3F A;  2M5W A;  1R5G A;  3HSE A;  2UXX A;  1AOY A;  1ODD A;  2XKO A;  3M9A A;  5IT3 A;  5LGN A;  3KEQ A;  1Q1H A;  3ZMD A;  1Z6R A;  1W7P D;  2DQR A;  1FT9 A;  4G9Y A;  4XSZ F;  2CG4 A;  1GVJ A;  3LAP A;  1KU2 A;  5E20 A;  4YIF A;  1XGS A;  2QBY B;  3RI4 A;  1WRJ A;  1BC7 C;  2KIU A;  1CGP A;  2OAZ A;  3GYH X;  1XDS A;  2KIM A;  2QZ8 A;  5FLX Z;  3LA3 A;  2XAQ A;  1E2X A;  3F22 A;  1D3Y A;  2M30 A;  5CVV A;  2XAG A;  3RKX A;  1O7L A;  3E97 A;  3IRQ A;  2L54 A;  2DW4 A;  2KKO A;  1KYZ A;  3OOP A;  3EYI A;  4LJZ F;  2Y48 A;  1RNL A;  4HX7 A;  2BYV E;  1U5T C;  3ISP A;  1KU7 A;  4AWX B;  2DK5 A;  5LGU A;  4ENJ A;  4P96 A;  2WWY A;  2WC2 A;  4O3M A;  3EUH A;  3I59 B;  5HS9 A;  2IA2 A;  1T0F A;  3QOP A;  1LNW A;  1TQI A;  4M9Z A;  1R00 A;  3J81 Z;  2ACJ A;  4H0E A;  3ULQ B;  1K78 B;  4I2O A;  4Y17 A;  1MDM B;  3T8T A;  4LG0 A;  1OPC A;  3HHH A;  1SFE A;  2DU9 A;  3TKY A;  3FHZ A;  5H6R A;  1QQI A;  2ZXJ A;  3R6S A;  3C3W A;  3JAM Z;  2DT5 A;  5FFZ A;  3T5X A;  5LHI A;  1OYW A;  2F5E A;  3HRM A;  1TQP A;  4MEX F;  2F5C A;  3P9C A;  5HS8 A;  2AXL A;  2E7X A;  3CO6 C;  3MFK A;  3TO9 A;  4R79 A;  2BV6 A;  4WXD A;  4L5J A;  2FEZ A;  4MHG A;  1ZGA A;  3FX3 A;  3ML6 A;  2RC4 A;  2M1B A;  3DPL C;  1S29 A;  3MQ0 A;  3GZ5 A;  5LHH A;  3FWE A;  2KJC A;  2MH2 A;  2Y75 A;  3DKW A;  5TRD A;  2ESH A;  2E1N A;  3F8M A;  1XD7 A;  2XVC A;  2O0Y A;  1XGM A;  2ZME A;  1HBX G;  3RYR A;  4IPA A;  1O3T A;  3RDI A;  1YS6 A;  1BN5 A;  3M1E A;  2HTS A;  4EGY A;  3HRT A;  4U0Y A;  4KMU X;  3E6D A;  2RNJ A;  2ESN A;  1LDK B;  1HSJ A;  1YS7 A;  1L3L A;  1LVA A;  4I0B A;  1RUN A;  1S8N A;  3DQV C;  5F1R A;  3FMS A;  1J75 A;  4EV0 A;  2W85 A;  3TO6 A;  1XMK A;  5HDK A;  2K4B A;  1MD0 A;  2M87 A;  2HKX A;  2PN6 A;  3ZMV A;  2A6E F;  2H6C A;  2MLG A;  5K5Q A;  1IXC A;  3F8F A;  1XSX A;  1I6X A;  4MQV A;  3L09 A;  1SMY F;  1B1B A;  5J6X A;  3BPX A;  2Q2E A;  1JGS A;  1R23 A;  1P4W A;  4A0Z A;  1FYK A;  1HW1 A;  5JFR A;  4Q4Z F;  2ISY A;  1B9N A;  4MNU A;  3I53 A;  2VN2 A;  2CQK A;  2D45 A;  2QQA A;  3ROU A;  3GEZ A;  4WK8 F;  2K7L A;  1UCR A;  2ZCW A;  3Q5F A;  4PCQ A;  2A6H F;  3CTA A;  3DFG A;  5LLQ A;  1GXP A;  5CVI A;  3GZ6 A;  3G3Z A;  3D5L A;  1IAW A;  3Q9V A;  2QBY A;  1SFU A;  1W4M A;  2FU4 A;  4UVA A;  4YII A;  3C18 A;  3QP5 A;  3RYP A;  1Z91 A;  4ZYD A;  1QZY A;  3TO7 A;  2EA4 A;  2CO5 A;  2OBP A;  2HQN A;  1GHC A;  4D0P A;  2KIF A;  3HIF A;  3BJ6 A;  1U6G A;  2R7F A;  3ABU A;  5E17 F;  2PG4 A;  4N0B A;  3ZPL A;  2ZFW A;  4LFU A;  1LQ1 A;  5DCF A;  3LAJ A;  3HSF A;  3QPT A;  1XDU A;  3TOA A;  4EM1 A;  3GFM A;  4ESF A;  1FPQ A;  4HX4 A;  4TV7 A;  1G3Y A;  5D6F A;  3TGN A;  2LF7 A;  1ULY A;  1CF7 B;  1P92 A;  3LA2 A;  3BWG A;  1FYM A;  3ZN1 A;  1AWC A;  5LRS A;  1LEB A;  2VBW A;  5HDG A;  4QWQ A;  4EQQ A;  3I64 A;  3NQO A;  4CXF A;  1MJ9 A;  1TW3 A;  2O3F A;  5AON A;  4KFC A;  2FE3 A;  2QEN A;  2DTR A;  2G7H A;  2GXG A;  3HOT A;  2GQQ A;  3TDZ C;  3QP6 A;  4RAY A;  4LK1 F;  1BI2 A;  1EH7 A;  3U9G A;  2NNY A;  1TW2 A;  4HLY A;  5E1Z B;  1S7O A;  2W84 A;  2YX7 A;  3GW2 A;  4HF2 A;  4KA4 A;  5JI6 A;  5KK1 A;  2FSW A;  2H94 A;  5DUI A;  4XLN F;  4OMZ A;  4ZYE A;  3KP3 A;  4CDG A;  1LDJ A;  1XMA A;  1C0W A;  2FOK A;  1EH8 A;  1G3S A;  3GFJ A;  3WG9 A;  1FC3 A;  5CYV A;  2JPB A;  3KLN A;  5F6F A;  5FB2 A;  1JXS A;  1XSD A;  4MTE A;  4ZZL A;  2NYX A;  1ZH5 A;  2GA1 A;  2CW0 F;  1ZG5 A;  2ZKZ A;  2A5Y B;  3F8B A;  1YTY A;  4UV8 A;  4OMY A;  2Y0M A;  1J9I A;  1PP8 F;  3WTT C;  2EFN A;  4HLX A;  5F64 A;  1U5T A;  3TOB A;  4GYI A;  1T6S A;  2OA4 A;  3R60 A;  1XGO A;  1D8J A;  3I0T A;  5D4R A;  4PDK A;  4XSX F;  4Q47 A;  3E6C C;  4LGW A;  2VBX A;  3F8N A;  1FSE A;  4LMY A;  4R1H A;  1IXS B;  2P7C B;  5E8G A;  4RGU A;  5J8C A;  3ECH A;  2VOP A;  4UVB A;  2BGC A;  5FD5 A;  2P5K A;  3CJN A;  2FNP A;  1W7P A;  1KQ9 A;  4EJT A;  5BS6 A;  4HV5 A;  2GWR A;  2LKP A;  1TBX A;  2A3S A;  4ENM A;  1HKT A;  1TNS A;  1T2K A;  3MEX A;  2V9V A;  2O61 A;  4IF4 A;  1LEA A;  1IRF A;  3BZ6 A;  5IT9 K;  4L9N A;  3OV8 A;  2Z3Y A;  3ZMT A;  3WTW C;  1DPR A;  1O7F A;  3WE3 A;  2DPD A;  5D6E A;  4KUM A;  6PAX A;  4KN7 X;  1P2F A;  2F5F A;  3F8C A;  2FBI A;  3K69 A;  1OMI A;  1QO0 D;  3DPT A;  3V4G A;  3WTS C;  5BPD A;  4P9F A;  2H09 A;  3L2C A;  3ABT A;  2CSO A;  1HKS A;  4XLP F;  5ED4 A;  1WWX A;  4KIC A;  4DNC A;  5D5X B;  5L3G A;  4BYY A;  1ZRE A;  4CYD A;  2VT2 A;  1R1V A;  2HR3 A;  3EQL F;  1QZZ A;  3GFI A;  2NS0 A;  2O03 A;  3ZMZ A;  1F5T A;  1SFX A;  2XKP A;  1Z9C A;  4HQE A;  1JHH A;  4G7Z F;  3HOS A;  1W7P B;  3RPU A;  2C6Y A;  1BBY A;  2PBI A;  3I59 A;  2ZNY A;  2IRF G;  4G6Q A;  5DD8 A;  3P7N A;  1FBU A;  3DF8 A;  3G73 A;  2HQR A;  4M72 A;  2CFX A;  4YFN F;  4WX9 A;  4RGX A;  2PJP A;  4OIO F;  3CUO A;  1KU9 A;  1BIB A;  4I09 A;  4L9T A;  2ZO4 A;  5EEG A;  2VBY A;  3J80 K;  2K27 A;  5HS7 A;  2XAS A;  1TNT A;  1K78 A;  2GXB A;  2OZU A;  1MJA A;  2WTE A;  4GGG A;  1Z05 A;  3BDD A;  1BM9 A;  1JE8 A;  1QPM A;  2OQR A;  3ECO A;  3WE2 A;  2HDC A;  4G7O F;  4M73 A;  5ERI A;  1SMT A;  3WOD F;  2B0L A;  3E5X A;  5CJ9 A;  3WTZ A;  4LB5 A;  4HDV A;  2DPU A;  4P5O A;  2UWM A;  3KEO A;  2ZBK A;  4MTD A;  2PQ8 A;  3KZY A;  3LST A;  3BRO A;  2M45 A;  5L3F A;  1D8K A;  4HOB A;  3HUG A;  1ZRF A;  4XBF A;  3R0J A;  3GFL A;  1V4R A;  3M7G A;  4PGH A;  2V6C A;  2FXA A;  2HWV A;  3CLO A;  4UV9 A;  1YW9 A;  1U2W A;  4DQ2 A;  5AIP A;  1IN5 A;  2V79 A;  1EV7 A;  1FBQ A;  3QU6 A;  4I0A A;  3KE2 A;  3QPH A;  4PZJ A;  4HAM A;  2HTJ A;  2CWE A;  3U2R A;  1HKQ A;  4Y13 A;  3H92 A;  2GAU A;  3K2Z A;  2R3S A;  2J5O A;  3GX4 X;  3JSP A;  2VT3 A;  4BHB A;  3EET A;  4LK0 F;  3SZP A;  4G6D A;  3F23 A;  3I4P A;  5H20 A;  5ICF A;  3RKY A;  4CZZ A;  5BPI A;  1RI7 A;  2JSC A;  4L5I A;  3P9K A;  3V7S A;  4UHT A;  4LB6 B;  1W5S A;  1REP C;  1D5V A;  3GF2 A;  3WGI A;  1J2X A;  1P6R A;  4GYG A;  3DEU A;  1S7A A;  3WU0 A;  1PDN C;  1YW7 A;  2GA2 A;  4EJV A;  4GCV A;  3MZH A;  3VOE A;  2FF4 A;  2HKO A;  5D5V B;  3VOD A;  5BOX A;  2W57 A;  2HS5 A;  2YSR A;  3IRR A;  1IUY A;  2ZME B;  3ZN0 A;  1Y0U A;  2OD5 A;  1P4A A;  5D8L B;  4M6Y A;  2PFB A;  1T39 A;  2XGX A;  2YPR A;  5AIQ A;  4O5V A;  2OZ6 A;  4EM0 B;  2NRA C;  3B02 A;  1L0O C;  1BJA A;  3M8E A;  1KA8 A;  3SZT A;  4Q5S F;  1YFH A;  3RIR A;  4BQA A;  1B4A A;  1KQ0 A;  5LHG A;  4I7H A;  3RPQ A;  2HGC A;  4OU0 A;  1J7K A;  5EEH A;  3ZP5 A;  3KP7 A;  3S2W A;  2G9W A;  4LLG F;  1K79 A;  4A6D A;  2VON A;  2DI3 A;  3R0A A;  2PMU A;  3R61 A;  4L0Y B;  4ESJ A;  5L3B A;  2CYY A;  3DP7 A;  2O6G E;  3IL2 A;  2Z9O A;  2H27 A;  1I5Z A;  3FMQ A;  4HZF A;  2KRF A;  3ERE D;  3ZMS A;  2YR2 A;  1ZG3 A;  3WTX C;  1ON1 A;  5K5O A;  2P6T A;  1DPU A;  1S3J A;  4L9J A;  3MCZ A;  4IRG A;  3I54 A;  1YW8 A;  4GO1 A;  2QQ9 A;  1ZAR A;  4KIF A;  1X3U A;  4ASN A;  3MZY A;  3JW4 A;  2DLL A;  1R1T A;  2EFP A;  4HW0 A;  5E18 F;  1H9G A;  1ZHF A;  4RGR A;  3QAH A;  1ZLK A;  2PEX A;  4RAZ A;  3KCC A;  2P5L C;  4BH9 A;  4JBA A;  3M8F A;  3RJP A;  4U7D A;  4MQ9 F;  2VC0 A;  1E17 A;  2QM3 A;  4I98 B;  4U7B A;  1UHW A;  2R7D A;  1SD4 A;  3K9T A;  4EGZ A;  1S6L A;  3LWF A;  2E7W A;  3GUD A;  3I71 A;  2FQ3 A;  5DDG A;  2FBH A;  4CGZ A;  2BBY A;  4KYW A;  5JVT A;  1Z1D A;  2AS5 F;  1A04 A;  3O6B B;  3TQN A;  2VBZ A;  2PLY A;  3IKV A;  2X4H A;  4BAY A;  2D1V A;  4UVC A;  4IHT A;  1XSV A;  5CVJ A;  2MBF A; 
#chains in the Genus database with same CATH topology
 3OYE A;  2JN6 A;  3ZQI A;  4BHP A;  2CQX A;  2O8K A;  4KMF A;  2XGE A;  5EZH A;  4D7M A;  4FE7 A;  1MJB A;  1OCZ H;  2P6S A;  1MGT A;  3CJR B;  2NVU B;  3BCB A;  2P5V A;  3K1N A;  3AAF A;  2WV0 A;  3FXU A;  1JKQ C;  2L5Q A;  3H36 A;  2GIV A;  3C1D A;  3HPG A;  1RC9 A;  1B8I B;  3UNG C;  4A3J J;  2EFO A;  3PUF A;  4XOR A;  5EJC A;  4BXF A;  4FHT A;  4CCK A;  5DD4 A;  2Z99 A;  1OFC X;  2L4A A;  2MH9 A;  1IRG A;  1VQN I;  2COM A;  2W48 A;  1JTY A;  3A1Y A;  3HDD A;  2BY1 A;  1TL8 A;  5D4S A;  5FD6 A;  3A02 A;  5IOZ A;  2MA3 A;  5LFA A;  2V1X A;  4I01 A;  1MZB A;  3Q0U A;  2K4J A;  1G2H A;  3VFZ A;  2Y0S N;  4N9H A;  1G6N A;  1FLI A;  1ZRD A;  4RB1 A;  2QVO A;  2K85 A;  4HBL A;  2A61 A;  4XKB A;  5CKT A;  1GVD A;  3BOQ A;  5CLS A;  2TDX A;  3WGG A;  3F6V A;  3HKZ A;  3KP5 A;  3ESW B;  2RGV A;  2VXD A;  2VJ4 A;  2CQN A;  3DU6 A;  5E3O A;  2E34 A;  4I6Z A;  1Z7U A;  2L9N A;  4HQM A;  4U87 A;  1YJN I;  4IHS A;  5ICG A;  5J1U A;  1TWA J;  3KYL A;  5FKN A;  1RZ4 A;  3LSJ A;  5D5U B;  5EDN A;  2W24 A;  1U8R A;  2VQL A;  2BW3 B;  2YX4 A;  3Q9S A;  5EGO A;  1Z6T A;  1S9H A;  3BG6 A;  5KAI C;  2CUZ A;  1H9T A;  4HV6 A;  1QHG A;  4IHV A;  4BGD A;  3FM5 A;  4AVZ A;  3O2P E;  4NDL A;  4OIQ F;  3F72 A;  1QPI A;  3SQN A;  4NNJ A;  2UUZ A;  2GM4 A;  2O9L A;  4XIC A;  2X1C A;  2LSO A;  2IS4 A;  1BOA A;  2E5Z A;  2JT1 A;  4RB0 A;  4XOP A;  1WI9 A;  3MKZ A;  2FMY A;  4CHU A;  3GVA A;  4WXH A;  4A0Y A;  5CVU A;  1HW5 A;  3GLX A;  3TW6 A;  1DP7 P;  2GZW A;  4Y4R A;  3MN2 A;  1MH3 A;  2VI6 A;  3H3U A;  2P8T A;  1JHF A;  3W6K B;  2ZSI B;  2ZJQ F;  2HYG D;  5LRR A;  4G94 A;  5DCM A;  3K4N A;  2JWT A;  1DDN A;  1PYV A;  5F0H A;  3I55 I;  2EWN A;  3OYA A;  4UXN A;  2KJB A;  5BQT A;  5ICC A;  3BJO A;  2RKH A;  3LOC A;  3CP2 A;  4D1Q A;  1HLV A;  3A4C A;  4V2G A;  4L9V A;  4K2E A;  2BY2 A;  1I50 J;  1IW7 F;  3K1M A;  4J19 A;  3RTR A;  3BZK A;  3COA C;  1KGS A;  1UZC A;  2V9P A;  4Y33 A;  4FQG A;  2KIS A;  1P9Q C;  2EPF A;  2LDU A;  1K7A A;  1J59 A;  4UUV A;  2VPR A;  4KN4 X;  4MFD A;  3WGH A;  1A36 A;  1XN7 A;  4BNC A;  1Z21 A;  4ANJ A;  4DW6 A;  5EEA A;  4XN0 A;  4HF0 A;  3E3V A;  4A3G J;  2R4G A;  1QZE A;  2OTL I;  1T98 A;  5JR3 A;  2HNH A;  3K4L A;  5DEQ A;  2P4W A;  3CO7 C;  1P4X A;  1VZ0 A;  2E1M B;  3RKW A;  1AHD P;  3MWM A;  1TQM A;  2DN0 A;  1S72 I;  2R7S A;  5E8I A;  1STZ A;  2K02 A;  1PP7 U;  3QOD A;  1ONV A;  1VQ8 I;  4U0W A;  5DV5 A;  2ZXH A;  2HXI A;  3P9I A;  3SEZ A;  4OIN F;  1MBK A;  3I4M J;  2F5V A;  4IVN A;  3J80 Z;  2V1D A;  4PSX A;  4HDU A;  1IXR C;  2F2E A;  2JQ7 A;  3QYE A;  4PGG A;  2XUB A;  3HTU A;  1BI1 A;  1F9N A;  1MBF A;  1T0F C;  3J7Z I;  3MKL A;  3L9F A;  5F0F A;  1YYV A;  3TL4 X;  5A2Q K;  3WTU C;  3WTV C;  4ENN A;  3HXL A;  2R7U A;  4YFK F;  4M3D A;  1YO5 C;  5LEJ A;  1H0M A;  3CZ6 A;  2O8X A;  1GUU A;  5M5Y J;  3DU5 A;  1X1C A;  3IAS 2;  4IX7 A;  4PUS A;  3SHF A;  2DAO A;  2CV2 A;  2DO7 A;  1OYY A;  3TED A;  1X1D A;  1KZH A;  5JLX A;  2LC2 A;  2E1M C;  2NVX J;  1MND A;  3V7R A;  4EVI A;  2DFI A;  4LD5 A;  3ZOB A;  1ZAO A;  1VQM I;  3HOY J;  2IA1 A;  4NHJ A;  3GZN B;  4PFO A;  3K0L A;  4G12 A;  1IF1 A;  1YIJ I;  3PFI A;  1ZYR F;  4BE1 A;  1FZP B;  4GFB A;  4FT8 A;  1I1S A;  3GXO A;  2HXO A;  3IHU A;  4WXC A;  1JJ6 C;  3D5R C;  2IGK A;  4RB2 C;  1WH7 A;  3BR2 A;  4UUT A;  2K5C A;  5HLH A;  2L01 A;  1XPX A;  2ZJ2 A;  1JT0 A;  1JKR C;  2LRD A;  2FQ4 A;  2YU3 A;  1TC3 C;  1ACI A;  5L3E A;  3C2G A;  1PUF B;  3HKZ N;  2XRO A;  4HYE A;  4F52 A;  2RN7 A;  3AG2 H;  2BE5 F;  2VOD A;  3BZC A;  1ZLJ A;  2FBK A;  3W2W A;  3D0S A;  3BTI A;  3QU3 A;  4FET A;  4MO7 A;  3RQ4 A;  5ICE A;  3VWB A;  2L3D A;  2LMD A;  2HVS A;  4IRI A;  4CCM A;  4EJO A;  3CMA I;  2XV4 S;  1MSE C;  3K6G A;  4DYC A;  1B9M A;  4WF2 A;  3JAM K;  3K1P A;  1WQ2 A;  4F91 B;  1V5E A;  1IC8 A;  4BEH B;  1HDP A;  1IN4 A;  4IRH A;  3H3Z A;  3UR3 C;  1XCV A;  1Z3X A;  2EB7 A;  2LP0 A;  2Y69 H;  5E1W A;  2JRT A;  3HL2 A;  1VQL I;  1TWH J;  1XMX A;  3SDG A;  3T1B A;  2R5Z A;  1IGN A;  4ZYH A;  3S15 J;  1R36 A;  3KFW X;  1OYI A;  1FBS A;  2ETH A;  1F36 A;  1W5T A;  2FJ1 A;  1Y8R B;  1BIA A;  4BXU A;  5EG0 A;  4AVP A;  1VTN C;  2DMQ A;  4OOI A;  4LIU A;  3B73 A;  4RB3 C;  1R5H A;  3HRU A;  2D1H A;  4YFX F;  3Q0W A;  2L4M A;  2NS7 A;  2PJR B;  1LDD A;  2Q0O A;  3T0Y A;  2ZJR F;  4JP0 A;  2L9S A;  4S05 A;  2CFO A;  4A5M A;  1IN6 A;  4HPQ A;  2E19 A;  2RNG A;  4E7Z A;  4BJT A;  4M9S A;  3FXQ A;  4XLF A;  5FO5 A;  3EPZ A;  3LQR A;  2M8G X;  3FM3 A;  4F93 B;  3H1C A;  1TTY A;  2D5V A;  4LLN A;  2F4I A;  3DBH B;  3EYY A;  1K6O A;  3LQQ A;  2OJE D;  5B5E C;  2CS3 A;  3HOX J;  1YQA A;  2Q1Z B;  2WB1 N;  4U0V A;  1O3S A;  2STT A;  4NQW A;  2H8W A;  2M3A A;  1IDY A;  4D5F A;  5ILU A;  4L18 B;  1A6I A;  3REO A;  1ZK8 A;  3TDU C;  2E60 A;  2STW A;  1O3Q A;  1WJF A;  4AM3 A;  3JTH A;  3AL0 B;  3J7A O;  3FXM A;  5EYR A;  3CDH A;  5ILV A;  4A3B J;  2BEO A;  2E1O A;  2MSY A;  5B66 C;  5HNF A;  1AKH A;  1ZGJ A;  4XRF A;  4EJW A;  2L7M P;  2RQP A;  2KMU A;  5HDN A;  2UXN A;  5CPR B;  1OCP A;  4M6X A;  2ISZ A;  2QQ8 A;  1FX7 A;  3HHG A;  5KAF C;  2W00 A;  1N25 A;  3JSO A;  4KNY A;  4HRI A;  4CYC B;  3HOU J;  1XCB A;  3KZZ A;  1HW2 A;  2XGD A;  3PIO F;  3BTL A;  2ICW G;  1MH4 A;  4XNF A;  2XAJ A;  2IPQ X;  3GO5 A;  4G8X A;  4ZZD A;  3S17 J;  3M1C A;  1I6H J;  3OSF A;  3IC7 A;  1FP2 A;  3SXY A;  4WWC A;  2W25 A;  4PSW A;  3L2R A;  4FX4 A;  1KYW A;  4XLA A;  3CCR I;  3BR1 A;  1SAX A;  3SFZ A;  2Y2Z A;  2MC3 A;  2XRN A;  3CQZ J;  3RSN A;  3PQJ A;  3PNY A;  1SAU A;  1V5G A;  2A69 F;  3VYT B;  2NOJ B;  2BOL A;  3MVP A;  4BJ5 C;  3VB2 A;  1O3R A;  2V26 A;  2CGP A;  1FMW A;  4XQF A;  4YIR X;  4EM2 A;  4IHW A;  1N75 A;  3ZCO A;  1HQC A;  3HYI A;  4CO8 A;  2MD5 A;  1CQT A;  4XMY A;  1V55 H;  1U9N A;  4WCG A;  3G6E I;  3ZR8 X;  3AG1 H;  2FRH A;  3N97 A;  2OU2 A;  2VXZ A;  1G4D A;  3V8K A;  1IV6 A;  1RKT A;  2HYF A;  1TP4 A;  5DUK A;  3CD6 I;  1ON2 A;  2NVT J;  4BQO A;  1RUO A;  1T8I A;  4XKC A;  1SD6 A;  2PX9 A;  4C3J J;  4ZYA A;  2YUS A;  2ZNZ A;  1BJZ A;  2DOD A;  3KP6 A;  1B72 A;  2G7U A;  1R71 A;  4E7L A;  1ZG1 A;  5F04 A;  1FOK A;  3LSM A;  1ETV A;  1Z67 A;  3CCU I;  2RAE A;  3F9K A;  4LLL A;  4BAC A;  3FMR A;  2MAB A;  4A3E J;  3GTK J;  2EFW A;  2NVQ J;  2OQG A;  4AIH A;  2JUC A;  1R22 A;  2XHK A;  4JK1 X;  3PIP F;  2ZME C;  2LNB A;  1OJL A;  1X3Z B;  3KX2 A;  1HST A;  2DBB A;  4E7J A;  2XIG A;  4LG0 B;  4JX4 A;  1I27 A;  3E5Q A;  4F7Z A;  3DEE A;  3Q0V A;  1E3P A;  3CCM I;  3IAM 2;  3KLO A;  5LBQ A;  2JZY A;  4RA2 A;  3S3O A;  3AKZ A;  5IOY A;  2HVQ A;  3V8L A;  1ZRC A;  4M74 A;  3ABK H;  4CIC A;  3CC2 I;  2PMH A;  3BC8 A;  3LSK A;  2RVC A;  1W36 D;  2HZD A;  4A0X A;  4PJJ A;  3H5A A;  4ZH4 F;  1ZN2 A;  4ENK A;  3J7Y J;  2HEO A;  1Y0N A;  3CF2 A;  1H88 C;  3E6B A;  1ZKG A;  4J00 A;  4KIG A;  1IRZ A;  4AIJ A;  3ELK A;  5DM6 F;  2LY9 A;  2HFH A;  3E6M A;  5KVR A;  3N4M A;  1T38 A;  3QRF F;  2K3F A;  5B3S H;  5FJ8 J;  2E35 A;  3E5U A;  3CUQ B;  5DCM B;  4E7S A;  2WY7 Q;  1R4N B;  3NRV A;  3BG3 A;  2K9N A;  3Q3S A;  1UB9 A;  2Z33 A;  5BMZ A;  3BLY A;  2DJI A;  4FX0 A;  3CCY A;  2BXZ A;  1FOW A;  2OC6 A;  1E3O C;  1O4X A;  4KT6 A;  2ZFU A;  2DMN A;  5D8K B;  2D2W A;  2EIL H;  5HVQ C;  5LGT A;  3KET A;  1BC8 C;  4HA8 A;  1R1U A;  1J0R A;  2F5D A;  3GCM A;  4KJZ A;  2L9V A;  4DYR A;  1BI0 A;  2KZG A;  1FY7 A;  1HC8 A;  3JRA A;  1GV2 A;  1SAN A;  2ELH A;  2UZK A;  1NHA A;  3KP2 A;  4M71 A;  1E0E A;  2QCO A;  3QWL A;  4YRV A;  2IW5 A;  2VE8 A;  5HLI A;  1R7J A;  2R5Z B;  4U88 A;  3UKG A;  4JX6 A;  2VJJ A;  1D0Y A;  1R6R A;  2IVM A;  3IKT A;  3KZI C;  1CF7 A;  1GT0 C;  3C7J A;  2MGQ A;  2DQL A;  4CCL A;  1LFP A;  3BP8 A;  1U78 A;  3EDP A;  4RS8 A;  1XGN A;  5LEK A;  2VE9 A;  1HXD A;  4ETS A;  1KQ8 A;  4S0H B;  2HZT A;  3OYB A;  2IT0 A;  5M5W J;  5L3D A;  3G4S I;  4A2U A;  2P7V B;  2CQ7 A;  4LIV A;  4AD9 A;  3DTE A;  4EMS A;  2X0L A;  4A12 A;  4ZTJ A;  1U3E M;  4A3I J;  3WU1 B;  2NAZ A;  1FTZ A;  2XB0 X;  1A31 A;  2DA4 A;  2RRE A;  1WPK A;  5IYC J;  1D1C A;  1IN7 A;  5K1Y A;  2V1U A;  3DTK A;  4S04 A;  1SD7 A;  3FF5 A;  2ID6 A;  5K5R A;  2HOT A;  3U1D A;  1I1G A;  1WJA A;  1KON A;  3GTP J;  3RZO J;  1A35 A;  5L3C A;  3DPU A;  2A68 F;  5IT9 Z;  3K4C A;  3J81 K;  3R4K A;  2KLO A;  1HA8 A;  2EV6 A;  1TWC J;  2NNN A;  4L0Z B;  5FLX K;  3JRC A;  1MMA A;  2P81 A;  2IJL A;  2KRH A;  1JTX A;  3O8H A;  3V7C A;  3BY6 A;  4BHC A;  2GBY A;  4DBQ A;  3A2K A;  3I58 A;  1K6Y A;  1MKM A;  2WBM A;  1UG0 A;  3MZ8 A;  1D0X A;  2PI0 A;  1QBJ A;  3TBI A;  5HNH A;  2R93 J;  3CCJ I;  2QQB A;  3W6V A;  4Y52 J;  3LA7 A;  3ZQQ A;  4G7H F;  3S2D J;  2VKV A;  2VC1 A;  3V8J A;  4N4O B;  5HLG A;  2FNA A;  4GXO A;  2LY1 A;  4A5N A;  3L7W A;  2HOE A;  3I56 I;  1LJ9 A;  3OIQ A;  5KCM A;  4RGS A;  4BQN A;  2EV5 A;  3OWT A;  5DYM A;  2VQH A;  4B8X A;  1MDM A;  1B72 B;  1Y1V J;  2XF7 A;  2DOA A;  2F48 A;  5CQG A;  1DQU A;  3BJA A;  1PUE E;  2LYC A;  3FBN B;  3K4M A;  4ZYG A;  1YRN A;  1OKR A;  3MKY B;  1U5T B;  1O57 A;  2EFQ A;  4IXA A;  5A2Q Z;  4FCY A;  1UHS A;  2VOO A;  1RIO H;  3ABL H;  4XLC A;  4Y15 A;  2JTV A;  3IWZ A;  2QKL B;  1XB4 A;  1LB2 A;  4BDY A;  2VPL A;  4I02 A;  2QWW A;  4RAF A;  3WTY C;  1MMG A;  2NOG A;  4RMN A;  4CUG A;  4OIP F;  1WZ2 A;  1AA7 A;  3GTJ J;  2NVY J;  4BU2 A;  2VAS A;  4XID A;  1W0T A;  2AQF A;  3MMY B;  2J5P A;  2IEK A;  2QUF A;  1G59 A;  1MBG A;  1B6A A;  2A07 F;  1G3W A;  1T33 A;  3FZV A;  3IWF A;  1LE8 B;  1W1W E;  2COB A;  4AIK A;  1YRN B;  1WJE A;  4YEJ A;  1FP1 D;  4ZC3 A;  1B59 A;  1FWZ A;  2KPM A;  3O8G A;  2XAH A;  4E70 A;  1IN8 A;  4Z2Y A;  3VEP A;  2O7O A;  1UHM A;  4HX8 A;  2L02 A;  5F08 A;  3L2Q A;  5JHU A;  5D5W B;  2KZV A;  3U1K A;  3TMO A;  4MGR A;  1HOM A;  2PJR A;  1UST A;  1UFM A;  4IJA A;  2X48 A;  5FFX A;  3I5U A;  2EV0 A;  2M7B A;  1R58 A;  3F3X A;  4C30 A;  2DFH A;  3H9Q A;  2M34 A;  3OYD A;  1J5Y A;  3ZMU A;  1FNN A;  3LFK A;  2LF8 A;  4NB5 A;  2EIJ H;  2ZC2 A;  4P9U A;  4ESB A;  4HF1 A;  3BQZ A;  2BY0 A;  2X6Y A;  5HLT A;  4B3A A;  4QLC U;  1WKM A;  2NXN B;  3FXR A;  1USS A;  2Z5U A;  3W2V A;  2QEX I;  1PVE A;  5CVR A;  1VQ5 I;  1IZ1 A;  4BY1 J;  1QGP A;  3PQK A;  2M2E A;  2XRL A;  4L5E A;  3K70 D;  2R5Y A;  3MAJ A;  2EK5 A;  2VL8 A;  1G3T A;  3DTI A;  3DV8 A;  3BT9 A;  2EJR A;  5E1X A;  2DOF A;  2VKH A;  3DXJ F;  4A6E A;  1GDT A;  2W82 A;  3HOZ J;  4C2U A;  2VKD A;  3OIP A;  4R8H A;  3DLL F;  3GWZ A;  4O6J A;  3U21 A;  4AYB A;  2ADU A;  1EH6 A;  3C2B A;  2V4J C;  1F4K A;  2AXT C;  3GTQ J;  3CUQ C;  3JCU C;  1OR7 A;  1WCM J;  2K86 A;  3L00 A;  3F21 A;  2RDP A;  2X6W A;  2MLK A;  3LSG A;  1APL C;  5TJJ A;  3M3Y J;  4UNO A;  5ILS A;  2CUJ A;  2H6B A;  3ZQ7 A;  4OIR F;  3HSR A;  4B3X A;  1SD5 A;  2RV8 A;  1F1Z A;  2CH0 A;  1P7J A;  2KFD A;  3W6J B;  2KT0 A;  2XB5 A;  1EF4 A;  3S3M A;  1YX3 A;  5M3M J;  4E7H A;  3CMM A;  3FIS A;  2VUM J;  1YLF A;  4M9X A;  3OMY A;  2G0E A;  1BR1 A;  5IP7 J;  4N9I A;  2LG4 A;  3BPV A;  4JQF A;  2ME6 A;  4ON0 A;  1YG2 A;  3CUQ A;  2E1C A;  3A0H C;  2FA5 A;  3GME A;  3KP4 A;  4MEY F;  5F1J A;  1X2N A;  2Q8K A;  2DK8 A;  2W4S A;  1YIO A;  3M8J A;  4LIT A;  3ZXS A;  4YG2 F;  4OWR B;  3T8R A;  4KT5 C;  1IRX A;  2GLO A;  4KDP A;  1BL0 A;  1FSH A;  1BW6 A;  1BI3 A;  3QPL A;  5DTD A;  1X1P A;  3O3K A;  3NEU A;  3PSI A;  5J8F A;  4Y3O A;  5EG0 B;  1LVK A;  4B09 A;  3HTS B;  1UMQ A;  4PK4 A;  2M8E A;  2QYO A;  5FRM A;  3SZG A;  1VQ6 I;  5F27 A;  3IP4 B;  4EJU A;  4A3D J;  3F6O A;  2LRE A;  3HRS A;  1U9O A;  2AQE A;  2IGO A;  1WSU A;  3OYF A;  1GXQ A;  2EA2 A;  1OCC H;  1DUX C;  2OUM A;  2P0W A;  2JPC A;  3HZJ A;  4A3M J;  1KU3 A;  1TLH B;  5FGM A;  1FYL A;  1QVT A;  2IP2 A;  4P55 A;  2FML A;  5HOO A;  1DU6 A;  2IA0 A;  3WHB A;  4M3B A;  2I5U A;  3WU2 C;  1QNT A;  2QLZ A;  4KIB A;  4Q48 A;  4BBR J;  2ME0 A;  3JTG A;  1HF0 A;  4W97 A;  3OYH A;  5H6Q A;  2XAF A;  1V3F A;  2E2J J;  2M5W A;  1R5G A;  2OF7 A;  3HSE A;  2IXS A;  2UXX A;  4IOC F;  1AOY A;  1ODD A;  2XKO A;  3M9A A;  5IT3 A;  5LGN A;  4FAS D;  3LSP A;  3KEQ A;  1B8I A;  2MG4 A;  1Q1H A;  3ZMD A;  1Y56 A;  1Z6R A;  2KIQ A;  2X51 A;  1W7P D;  2JMW A;  3HM5 A;  2DQR A;  4DYQ A;  1FT9 A;  1POG A;  1K4T A;  4IQJ A;  2DT6 A;  1YJ9 I;  4G9Y A;  4XSZ F;  2DJN A;  3FXJ A;  3OIO A;  2CG4 A;  2KL4 A;  3OR1 C;  3FXL A;  1GVJ A;  3A01 B;  3CLQ A;  3LAP A;  3OYG A;  4FIS A;  2WA0 A;  1T56 A;  3G1O A;  1KU2 A;  5E20 A;  4YIF A;  4RM2 A;  1XGS A;  4BDZ A;  2QBY B;  3E0J B;  3RI4 A;  1WRJ A;  3SEQ A;  1BC7 C;  4XRM A;  2KIU A;  4LG3 A;  1N78 A;  3HEF A;  1GLN A;  3RPU D;  3A0B C;  1CGP A;  2OAZ A;  3WHC A;  4DJA A;  3GYH X;  1A6Q A;  1XDS A;  1YI2 I;  4X6A J;  2KIM A;  2QZ8 A;  1I3A A;  5FLX Z;  2X6O A;  3LA3 A;  2XAQ A;  1E2X A;  3F22 A;  1D3Y A;  2M30 A;  1GV5 A;  3M4O J;  1TT5 B;  2Y0S A;  2HI3 A;  3H5R A;  4C9Y A;  5CVV A;  1ETW A;  2XAG A;  3RKX A;  4XM3 A;  1O7L A;  4D9J A;  4CYC A;  3E97 A;  3IRQ A;  1I39 A;  4ITV A;  1U0J A;  1S5L C;  2DW4 A;  2L54 A;  2KKO A;  1KYZ A;  2O5R A;  2DYS H;  3OOP A;  1TZL A;  1MMD A;  4LOC A;  3EYI A;  3CP8 A;  3EUH C;  2WAQ A;  2Y48 A;  4LJZ F;  1RNL A;  2VIX A;  4HX7 A;  2BYV E;  3NWT A;  4V19 K;  2YS9 A;  3PO3 J;  1U5T C;  4RAG A;  2Y30 A;  3ISP A;  1KU7 A;  4AWX B;  5E79 C;  3S1M J;  4V2F A;  2DK5 A;  5HOD A;  2QSH X;  1E3H A;  2K9Q A;  5LGU A;  2BY3 A;  4ENJ A;  4P96 A;  4E4H A;  3FK7 A;  2WWY A;  1WGX A;  2A6T A;  2WC2 A;  5M3F J;  4O3M A;  1YIT I;  3I9V 2;  3G1L A;  3EUH A;  1FJL A;  4UB8 C;  4DZP A;  3CMY A;  1WFX A;  1NG7 A;  2JUG A;  3I59 B;  5HS9 A;  2IA2 A;  4ZDL A;  1T0F A;  3QOP A;  1LNW A;  4A93 J;  3JRI A;  2ZSH B;  1TQI A;  3L1P A;  4IQ4 A;  4M9Z A;  1R00 A;  1OCT C;  3J81 Z;  2LBF B;  5B1B H;  2ACJ A;  4H0E A;  2DT7 B;  3TW7 A;  3ULQ B;  1K78 B;  3H9J A;  1MBH A;  1X4P A;  3PNV A;  4I2O A;  2Y31 A;  3BG9 A;  2GIZ A;  1V54 H;  1UG2 A;  4Y17 A;  1MDM B;  4B48 A;  3T8T A;  2E2H J;  1D0Z A;  2R0Q C;  4LG0 A;  4A3F J;  1OPC A;  1ETX A;  3HHH A;  1J09 A;  1SFE A;  1VFC A;  2DU9 A;  5GP9 A;  3TKY A;  3FHZ A;  1QA6 A;  3PO2 J;  2DFF A;  5H6R A;  1QQI A;  2ZXJ A;  3H0G J;  3R6S A;  2AO9 A;  3C3W A;  3BR0 A;  3K10 A;  2BVL A;  5EF6 A;  2BXY A;  3JAM Z;  3BTJ A;  2DT5 A;  5FFZ A;  3T5X A;  5LHI A;  4XKW A;  1OYW A;  2F5E A;  3HRM A;  1TQP A;  1SVL A;  1LFU P;  4ZDO A;  1K4S A;  4MEX F;  2F5C A;  1ZQ3 P;  3TP0 A;  5GPA A;  1WVR A;  1ZGW A;  3P9C A;  5HS8 A;  4RLQ A;  1NTC A;  5GAG J;  2AXL A;  1SC7 A;  2E7X A;  2MC4 A;  3HG9 A;  1PJR A;  2QSF X;  1QU3 A;  4JOM A;  3CO6 C;  3MFK A;  3TO9 A;  1MIJ A;  4R79 A;  2R7T A;  2BV6 A;  4WXD A;  4L5J A;  2FEZ A;  4MHG A;  4CZC A;  1ZGA A;  3FX3 A;  3ML6 A;  5J1R A;  1LPQ A;  2RC4 A;  2M1B A;  4NUB A;  3DPL C;  2XSD C;  1S29 A;  3MQ0 A;  4BE0 A;  1JKO C;  1PUF A;  1ETY A;  2LFB A;  4E7I A;  3GZ5 A;  3K70 C;  2X85 A;  5LHH A;  3CF5 F;  3FWE A;  2KJC A;  2MH2 A;  1Z3Y A;  4AC0 A;  2Y75 A;  3DKW A;  5TRD A;  4B43 A;  2ESH A;  3EUK L;  2E1N A;  1MBJ A;  2XGC A;  3F8M A;  3BR3 A;  2EZH A;  3P5J A;  1XD7 A;  4ZTF A;  1FMV A;  3OSG A;  2XVC A;  2O0Y A;  4E7K A;  1K83 J;  3CDI A;  3CES A;  1XGM A;  2ZME A;  4FE4 A;  1HBX G;  3RYR A;  2A05 A;  4BE2 A;  3H35 A;  4IPA A;  1ENH A;  4CCO A;  1O3T A;  3ASN H;  2JA7 J;  1ETQ A;  3RDI A;  1LKX A;  1YS6 A;  3H9G A;  1BN5 A;  1SVO A;  2HTS A;  3M1E A;  5JLW A;  4EGY A;  2HOA A;  3HRT A;  3HGG A;  2WAQ N;  3ZQH A;  2ZB9 A;  1MW7 A;  1NG6 A;  2CJJ A;  4U0Y A;  4KMU X;  2EIN H;  3CC4 I;  3E6D A;  3GLL A;  4XLE A;  5J1Y A;  2RNJ A;  2IGM A;  5EZG A;  2M4K A;  3S1N J;  4DZJ A;  2ESN A;  2LVS A;  2KQR A;  1LDK B;  5K7H A;  1W0U A;  4CSW A;  2LKS A;  3IH3 A;  1HSJ A;  1Y8Q B;  3B6A A;  1TWG J;  1YS7 A;  2HQ5 A;  3CJT B;  1L3L A;  1LVA A;  2WB1 A;  1VI0 A;  1RR7 A;  2ZXW H;  4I0B A;  4XRS G;  1RUN A;  1Q1V A;  3S2H J;  4W1U A;  1S8N A;  5GTI C;  4IO9 F;  3DQV C;  5F1R A;  3FMS A;  2Z1D A;  1J75 A;  4EV0 A;  2W85 A;  3TO6 A;  1FIA A;  1XMK A;  5HDK A;  2CU7 A;  2K4B A;  1MD0 A;  2JA2 A;  2M87 A;  2HKX A;  2B63 J;  2DA1 A;  2PN6 A;  3ZMV A;  4NQW B;  2A6E F;  2KHM A;  2H6C A;  2E36 A;  1XG1 A;  4RBO A;  3I3L A;  3QOE A;  2MLG A;  5K5Q A;  4QPO A;  3HC7 A;  4GDF A;  1IXC A;  2QKM B;  1YJW I;  3F8F A;  1XSX A;  2DYR H;  4XL9 A;  1I6X A;  4MQV A;  3L09 A;  2L0K A;  3FIW A;  1Z0X A;  1SMY F;  1B1B A;  5J6X A;  3BPX A;  2JVG A;  2Q2E A;  3OOU A;  1JGS A;  2OCC H;  1R23 A;  1P4W A;  4HST A;  3ONQ A;  3LNQ A;  2DMU A;  2LKX A;  2K3P A;  4A0Z A;  4UY8 I;  3HOV J;  1FYK A;  1X58 A;  1HW1 A;  5JFR A;  4B4C A;  4Q4Z F;  1Z77 A;  2ISY A;  1DGW Y;  1B9N A;  3VDX A;  4MNU A;  2DTZ A;  3I53 A;  2VN2 A;  1OCO H;  2CQK A;  3G2B A;  2D45 A;  2QQA A;  3ROU A;  4CH7 A;  2DCE A;  3GEZ A;  5H2F C;  4WK8 F;  1RRJ A;  2K7L A;  1XC5 A;  1UCR A;  2ZCW A;  1BR2 A;  4BS9 A;  3JRF A;  3Q5F A;  4PCQ A;  2A6H F;  2L7F P;  2EH3 A;  4BBS J;  3CTA A;  3DFG A;  3PL8 A;  5LLQ A;  5CVI A;  4I99 C;  3VYR B;  3GZ6 A;  2IAI A;  3D5L A;  3G3Z A;  2JA8 J;  2R7X A;  3OYC A;  1IAW A;  3Q9V A;  2QBY A;  1W4M A;  2CUE A;  2FU4 A;  4UVA A;  1SFU A;  5LD2 C;  2QSG X;  4YII A;  2VKE A;  3C18 A;  3QP5 A;  3S93 A;  3H5N A;  3RYP A;  3IH2 A;  1Z91 A;  2KDO A;  2HPI A;  2Y9Y A;  1QZY A;  4ZYD A;  2R7R A;  4H4K C;  3TO7 A;  2EA4 A;  4IKF A;  2CO5 A;  2OBP A;  1X19 A;  2E71 A;  2MD0 A;  2IGN A;  2HQN A;  2VB6 A;  1R5I D;  5JVG F;  1GHC A;  4D0P A;  2KIF A;  3HIF A;  3K4K A;  1JJ8 C;  3BJ6 A;  1U6G A;  2R7F A;  5F0C A;  3ABU A;  5E17 F;  2LY2 A;  3GTO J;  2PG4 A;  4N0B A;  3ZPL A;  1W36 C;  2ZFW A;  4LFU A;  5FRN A;  1LQ1 A;  5DCF A;  3LAJ A;  1VQO I;  3HSF A;  2DA3 A;  3QPT A;  1SFO J;  1XDU A;  3TOA A;  4EM1 A;  3KPH A;  4M6V A;  3GFM A;  2EZL A;  3PNT A;  4Y7N J;  4ESF A;  4MLO A;  2ID3 A;  2F4M B;  1FPQ A;  4HX4 A;  3GTM J;  4TV7 A;  1G3Y A;  2H8R A;  1FEX A;  5K7Z A;  5D6F A;  5KHD A;  3TGN A;  1BOB A;  2LF7 A;  1ULY A;  3DEW A;  1CF7 B;  2CW7 A;  3ZQG A;  1P92 A;  3LA2 A;  1U8B A;  2WAF A;  3AG4 H;  2FUG 2;  3BWG A;  1FYM A;  2AHQ A;  3K4B A;  3H3V K;  3ZN1 A;  3FKJ A;  2TRT A;  4XOT A;  3JRH A;  1AWC A;  2HQA A;  5LRS A;  1LEB A;  2JVH A;  2VBW A;  5HDG A;  3TP3 A;  4QWQ A;  4EQQ A;  3ZRG A;  3I64 A;  3NQO A;  4CXF A;  4KIS A;  5BNG A;  1MJ9 A;  1TW3 A;  2O3F A;  2LK2 A;  3S1R J;  5AON A;  4KFC A;  2FE3 A;  3LSH A;  3RQI A;  5GAH J;  2QEN A;  2LBF A;  4F3Q A;  3AG3 H;  4C3H J;  3S16 J;  5J4Y A;  2DTR A;  2G7H A;  2GXG A;  3HOT A;  4KIT B;  2GQQ A;  3TDZ C;  3QP6 A;  4AUX A;  2DFE A;  3LMM A;  3BR5 A;  2R7O A;  4LK1 F;  1BI2 A;  4RAY A;  3CDL A;  1EH7 A;  3U9G A;  3OS1 A;  1QHH D;  4BUP A;  4CA0 A;  1S7E A;  3HPH A;  2NNY A;  1TW2 A;  4HLY A;  5E1Z B;  1S7O A;  2W84 A;  4BEH A;  3OYL A;  5DM7 F;  2YX7 A;  1H8A C;  3GW2 A;  2DDB A;  3FXO A;  4HF2 A;  4I76 A;  4KA4 A;  3FK6 A;  2PMZ A;  3RZD J;  5JI6 A;  4C2T A;  5KK1 A;  2FSW A;  2H94 A;  1A5J A;  3CCQ I;  3K7A J;  4UUS B;  3HOW J;  3JRD A;  5DUI A;  4N4N B;  4XLN F;  4Z6Y A;  4OMZ A;  4ZYE A;  1NH3 A;  1XX5 A;  1AU7 A;  3KP3 A;  4CDG A;  1LDJ A;  4JX5 A;  1X1B A;  1XMA A;  1C0W A;  2FOK A;  1UEL B;  2BW3 A;  3WG7 H;  1IV8 A;  1EH8 A;  4NC8 A;  1G3S A;  5FLV A;  3S8P A;  3GFJ A;  3QQA A;  1ERD A;  3WG9 A;  4AID A;  1FC3 A;  5CYV A;  2JPB A;  3KLN A;  1VND A;  5F6F A;  3VYS B;  1HDD C;  5FB2 A;  1JXS A;  4B47 A;  1XSD A;  4MTE A;  4ZZL A;  2R92 J;  1OQY A;  2HYJ A;  2NYX A;  3GBG A;  3JRG A;  5EGO B;  3PFY A;  3E1S A;  3EUA A;  1IUF A;  1ZH5 A;  2GA1 A;  2CW0 F;  1ZG5 A;  3SDB A;  2ZKZ A;  2A5W A;  2A5Y B;  3F8B A;  1YTY A;  4M3E A;  2DA5 A;  4UV8 A;  4RLF A;  4OMY A;  2Y0M A;  1J9I A;  3WTT C;  1PP8 F;  2EFN A;  4HLX A;  4XK4 A;  3OR2 C;  5F64 A;  4AU7 A;  1ITY A;  1UJ8 A;  1U5T A;  3TOB A;  1SVM A;  4GYI A;  2W1O A;  3JRB A;  1T6S A;  2DMP A;  2OA4 A;  3BQY A;  1Y39 A;  3R60 A;  1XGO A;  2JA5 J;  1D8J A;  3I0T A;  5D4R A;  2LLK A;  4PDK A;  1G8X A;  5C3E J;  3S32 A;  3VPR A;  3MKW B;  4XSX F;  4Q47 A;  2XDV A;  4UUS A;  4RDU A;  3E6C C;  3L2U A;  4YEL A;  1JI8 A;  4LGW A;  2VBX A;  3F8N A;  1VQK I;  2QA4 I;  5C4J J;  1FSE A;  4LMY A;  9ANT A;  3LSR A;  4R1H A;  1IXS B;  2VQC A;  1TWF J;  2P7C B;  2CMP A;  5E8G A;  4MFE A;  4RGU A;  2HU9 A;  5J8C A;  3ECH A;  2VOP A;  2V9K A;  4UVB A;  5IP6 A;  2BGC A;  5FD5 A;  1DU0 A;  2ZXI A;  1WHU A;  2P5K A;  3CJN A;  4CCJ A;  4IHY A;  2FNP A;  1MNE A;  1W7P A;  1KQ9 A;  4EJT A;  2NS8 A;  5BS6 A;  1T95 A;  2F4O B;  4HV5 A;  3LL7 A;  2GWR A;  2DA2 A;  4DBR A;  1TT0 A;  2LKP A;  1TBX A;  5J4V A;  2QF7 A;  2A3S A;  4ENM A;  3IUO A;  5J40 A;  1HKT A;  1TNS A;  1T2K A;  1MNM C;  2FD5 A;  3MEX A;  2V9V A;  1BA5 A;  3GTG J;  2O61 A;  5GPC A;  4IF4 A;  1LEA A;  2R7V A;  1WJ5 A;  2IS2 A;  5IY5 H;  1IRF A;  3BZ6 A;  5IT9 K;  1YX5 A;  4L9N A;  5E3L A;  3K2A A;  4A3L J;  1Z7L A;  1IG7 A;  3OV8 A;  4XN3 A;  2X1D A;  4RM3 A;  1X1A A;  2Z3Y A;  3ZMT A;  4BY7 J;  1LFB A;  3WTW C;  1DPR A;  1O7F A;  3WE3 A;  2OCE A;  2DPD A;  2JJ7 A;  5D6E A;  4KUM A;  3LFU A;  1IJW C;  6PAX A;  1RKW A;  1RR8 C;  4KN7 X;  1P2F A;  2F5F A;  3BCA A;  3F8C A;  2FBI A;  4CCN A;  3K69 A;  4BL0 B;  3SJM A;  4C2M J;  2FOW A;  4BKX A;  3HBL A;  4DOZ A;  1OMI A;  4D5C A;  1QO0 D;  3DPT A;  3V4G A;  3L2W A;  4X0G A;  2OTJ I;  1V5F A;  2L7Z A;  3WTS C;  1VQP I;  5BPD A;  3DKY A;  4P9F A;  2H09 A;  3L2C A;  3ABT A;  4HG2 A;  1RES A;  3B6C A;  4XON A;  2CSO A;  1HKS A;  1RET A;  3HB9 A;  5ED4 A;  4XLP F;  1SFK A;  1WWX A;  4KIC A;  4DNC A;  2WY8 Q;  2B9S A;  2MYS A;  5D5X B;  5L3G A;  4OAY A;  3X2Q H;  2EQR A;  1FOX A;  2EIM H;  4BYY A;  3E7L A;  1ZRE A;  4CYD A;  2EZK A;  2VT2 A;  1R1V A;  3CCL I;  5M5X J;  3OYM A;  2IS6 A;  2MFZ A;  2GXA A;  2HR3 A;  2W7N A;  3EQL F;  1AKH B;  1QZZ A;  2BHY A;  2WAD A;  3GFI A;  2NS0 A;  4QTR A;  2M9H A;  3HUG B;  2O03 A;  3ZMZ A;  1F5T A;  1SFX A;  2XKP A;  5IPA A;  4ABZ A;  1Z9C A;  4HQE A;  1JHH A;  2V1N A;  4G7Z F;  1BR4 A;  2EBI A;  2QGU A;  4EAT A;  3CCV I;  3HOS A;  1W7P B;  3OL4 A;  3RPU A;  3OYI A;  2C6Y A;  1BBY A;  4A69 C;  3ABM H;  3DWL E;  2PBI A;  3I59 A;  4NC6 A;  2KP6 A;  1QVU A;  1YOV B;  2ZNY A;  2H1L A;  4DGW B;  3CC7 I;  2EIK H;  2IRF G;  2DMT A;  3QYF A;  4B1R A;  1EJ9 A;  1MSF C;  1I3Q J;  4BXX J;  5CQE A;  5FKK A;  3KYC B;  4G6T B;  4G6Q A;  3G71 I;  3S1Q J;  5DD8 A;  1N77 A;  3P7N A;  5GAE J;  3KYD B;  1FBU A;  5FLM J;  3DF8 A;  3DBL B;  4II3 A;  3G73 A;  2HOS A;  2V7F A;  2HQR A;  4M72 A;  2CFX A;  4YFN F;  4WX9 A;  4RGX A;  1RPW A;  2PJP A;  3CUO A;  4OIO F;  1KU9 A;  1BIB A;  4I09 A;  5E3M A;  4A3K J;  4L9T A;  2ZO4 A;  2M0C A;  5EEG A;  2VBY A;  1HCR A;  4IOA F;  3J80 K;  2K27 A;  5HS7 A;  2XAS A;  1TNT A;  1K78 A;  2ELK A;  1F43 A;  3CCS I;  3PUB A;  4XKV A;  2OZU A;  2GXB A;  1MJA A;  2L9R A;  2WTE A;  4GGG A;  4B44 A;  1Z05 A;  3BDD A;  4ZJZ A;  2V6E A;  3RCO A;  3PM1 A;  5TIS C;  3M07 A;  1M1E B;  1BM9 A;  2JRM A;  2K9M A;  3KEY A;  1X3W B;  3JR9 A;  3HJE A;  1JE8 A;  3ZQF A;  1QPM A;  1R9T J;  2OQR A;  3ECO A;  3WE2 A;  2HDC A;  4XR6 A;  1UAA A;  3G1M A;  4G7O F;  4NC7 A;  4M73 A;  2CV1 A;  1D1A A;  2B7E A;  5ERI A;  3MD2 A;  3KIO A;  1ZTR A;  1SMT A;  3DCF A;  3WOD F;  1XS9 A;  2B0L A;  3E5X A;  5CJ9 A;  3OL3 A;  3WTZ A;  1K61 A;  4LB5 A;  4HDV A;  3ZGK A;  2DPU A;  4P5O A;  2UWM A;  3KEO A;  4DIQ A;  3OY9 A;  2ZBK A;  2Q2E B;  4MTD A;  2PQ8 A;  3OS0 A;  3KZY A;  3LST A;  2XF5 A;  3BRO A;  2M45 A;  5L3F A;  2TCT A;  2RQQ A;  1D8K A;  2L7K A;  3W3C A;  4HOB A;  2K40 A;  1Y1W J;  3HUG A;  4QPQ A;  1ZRF A;  4UB6 C;  4XBF A;  2LTP A;  3S14 J;  3R0J A;  3GFL A;  3J7A Y;  1XTA A;  1V4R A;  3M7G A;  4HSR A;  5J3L A;  1VF9 A;  3D5S C;  4PGH A;  4FTH A;  3OS2 A;  2V6C A;  2FXA A;  2HWV A;  1R4M B;  4GRI A;  5K7F A;  3CLO A;  4UV9 A;  5JHF A;  2EZI A;  3BR6 A;  3K4J A;  4J01 A;  1YW9 A;  3H0D A;  4HNU A;  2JSP A;  1U2W A;  4DQ2 A;  5AIP A;  3V42 A;  4NBQ A;  1IN5 A;  3NAU A;  2HVR A;  2V79 A;  5IYD J;  2M4G A;  4HEA 2;  1EV7 A;  3NAR A;  4EEF G;  5B1A H;  5C44 J;  3A01 A;  2DOE A;  1FBQ A;  3QU6 A;  3JRE A;  4I0A A;  3KE2 A;  1OIS A;  2KDZ A;  3QPH A;  1MBE A;  4PZJ A;  4HAM A;  2HTJ A;  2CWE A;  3U2R A;  1HKQ A;  4Y13 A;  3H92 A;  2GAU A;  3IV5 A;  3K2Z A;  2R3S A;  2J5O A;  4X1E A;  1WJD A;  3GTL J;  4BJ6 C;  2CW8 A;  2XPW A;  3GX4 X;  2DXI A;  3FKI J;  3JSP A;  2VT3 A;  4BHB A;  3EET A;  2ELJ A;  4LK0 F;  4D7N A;  3RKQ A;  1DGR M;  1YE9 A;  3SZP A;  4G6D A;  3F23 A;  3I4P A;  2E5N A;  5H20 A;  5ICF A;  3RKY A;  4CZZ A;  5BPI A;  1RI7 A;  2JSC A;  1FOY A;  3A03 A;  4L5I A;  3P9K A;  3V7S A;  3L2V A;  2X1E A;  4IEJ A;  4UHT A;  4LB6 B;  1W5S A;  1REP C;  5GTH C;  4E6K G;  1D5V A;  3GF2 A;  3DBR B;  3WGI A;  1J2X A;  1P6R A;  3BG7 A;  2ZJP F;  2ECB A;  2BVM A;  4GYG A;  2BHZ A;  3DEU A;  3C2H A;  1S7A A;  4PJ0 C;  1ETO A;  3WU0 A;  3QPS A;  1PDN C;  4XRS A;  1YW7 A;  2GA2 A;  4EJV A;  4GCV A;  4BQQ A;  3MZH A;  1WH5 A;  3VOE A;  2FF4 A;  2HKO A;  1WJC A;  4F55 A;  5D5V B;  1OLT A;  3DLA A;  3VOD A;  2DDA A;  3ASO H;  5BOX A;  2XPV A;  2W57 A;  2HS5 A;  2YSR A;  3IRR A;  1IUY A;  2ZME B;  2KRC A;  3ZN0 A;  2GOM A;  1Y0U A;  2OD5 A;  1NK3 P;  1P4A A;  2LOO A;  1BW5 A;  3FXK A;  5D8L B;  2XC7 A;  4M6Y A;  2PFB A;  1JT6 A;  1T39 A;  1ORK A;  1Y6I A;  3ERM A;  2XGX A;  2R7Q A;  2YPR A;  2BZT A;  5AIQ A;  4O5V A;  2OZ6 A;  4ZDP A;  4EM0 B;  2VJ5 A;  3B02 A;  2NRA C;  1FTT A;  4OAZ A;  3FDY A;  1L0O C;  2ECC A;  2DA6 A;  1D5Y A;  1DP3 A;  2E2I J;  1SEU A;  4M3G A;  1FIP A;  1LUJ B;  1BJA A;  2VQG A;  3M8E A;  3QYB A;  5FKM A;  1KA8 A;  5C4X J;  1IDZ A;  2VLA A;  2FX0 A;  1JKP C;  3F0C A;  5IP9 J;  1IO2 A;  3SZT A;  4Q5S F;  3AL0 C;  1VQ9 I;  1EKE A;  3RIR A;  1YFH A;  3SYT A;  2LD5 A;  2PMZ N;  4BQA A;  1B4A A;  1KQ0 A;  5LHG A;  5FKL A;  4I7H A;  3RPQ A;  1R49 A;  1NK2 P;  1EA3 A;  3NWS A;  3SFI A;  2HGC A;  4OU0 A;  4P1W A;  1J7K A;  5EEH A;  4HNT A;  3D1N I;  3ZP5 A;  3KP7 A;  3FHN A;  3S2W A;  2G9W A;  4LLG F;  3CCE I;  1VQ4 I;  1K79 A;  4IHX A;  1P7I A;  4A6D A;  3IH4 A;  2UV1 A;  2VON A;  2IBD A;  3ZQL A;  2DI3 A;  3R0A A;  2Z16 A;  2PMU A;  4II2 A;  4IZZ A;  3R61 A;  1ZR2 A;  4L0Y B;  4ESJ A;  5L3B A;  2CYY A;  2R5Y B;  3DP7 A;  3BTC A;  2O6G E;  1ZEL A;  3IL2 A;  2M0M A;  2F6C A;  2Z9O A;  2H27 A;  1I5Z A;  3FMQ A;  2XAU A;  5FRO A;  1GXP A;  2WAE A;  4PJL A;  4HZF A;  4F92 B;  2KRF A;  3ERE D;  3ZMS A;  5DS9 A;  2X6X A;  2YR2 A;  1ZG3 A;  5IYB J;  2M7A A;  1WI3 A;  2R7W A;  3WTX C;  1ON1 A;  5K5O A;  1JUS A;  2MW8 A;  2OV7 A;  3FBI B;  2VJI A;  2DA7 A;  2P6T A;  3VSL A;  1DPU A;  1S3J A;  4L9J A;  3MCZ A;  4IRG A;  2Z2S B;  3I54 A;  1YW8 A;  4GO1 A;  3OYN A;  4XLH A;  2QQ9 A;  1D1B A;  1ZAR A;  4KIF A;  1X3U A;  4ASN A;  5KNL A;  3MZY A;  2YU9 J;  3JW4 A;  2DLL A;  4A3C J;  3ZQC A;  2XPU A;  1R1T A;  1WJB A;  2LR8 A;  4PJM A;  2X9D A;  3I4N J;  2R7Z J;  4C3I J;  2EFP A;  1MMN A;  5GAD J;  3N05 A;  3OYJ A;  4HW0 A;  5E18 F;  1H9G A;  1ZHF A;  4RGR A;  3W2A A;  3QAH A;  1ZLK A;  2PEX A;  4RAZ A;  3KCC A;  2XF6 A;  2LH9 A;  2P5L C;  3PJR A;  4BH9 A;  2N8G A;  3S3N A;  4JBA A;  2WV1 A;  1T08 B;  1JGG A;  4M3F A;  4PFP A;  3M8F A;  3RJP A;  4U7D A;  3DKX A;  4MQ9 F;  2VC0 A;  1OR7 C;  5TGT A;  1E17 A;  2QM3 A;  4I98 B;  4U7B A;  1H89 C;  1UHW A;  3LSI A;  2CUF A;  2R7D A;  1SD4 A;  1X4O A;  1X2M A;  1QRY A;  3K9T A;  4IL6 C;  2HDD A;  5FKO A;  3PSF A;  2H1K A;  2XSJ C;  4EGZ A;  2Y9Z A;  2HPM A;  2L2O A;  4HNV A;  2CQQ A;  2K9L A;  2K9S A;  1S6L A;  2CRG A;  2CV0 A;  3LWF A;  1JUP A;  2E7W A;  1ZR4 A;  3HGY A;  3GUD A;  2OPT A;  3I71 A;  2FQ3 A;  1OCR H;  5DDG A;  1LE8 A;  2FBH A;  4CGZ A;  4PJN A;  2BBY A;  4MIM A;  4KYW A;  1VQ7 I;  5JVT A;  1MMS A;  2GOX B;  3AFH A;  2HDW A;  1Z1D A;  3VSK A;  3TQN A;  1A04 A;  3O6B B;  3OYK A;  2AS5 F;  2JK3 A;  2VBZ A;  2PLY A;  3IKV A;  1YHQ I;  4QIW N;  2X4H A;  4BAY A;  3VYU B;  2I8D A;  2IS1 A;  3BG5 A;  2D1V A;  4UVC A;  5E3N A;  3CME I;  4JYK A;  4IHT A;  2I10 A;  4QSH A;  1JUM A;  3CJQ B;  1XSV A;  4AYB N;  5CVJ A;  1W5C C;  5J47 A;  2JA6 J;  2MBF A;  1ETK A; 
#chains in the Genus database with same CATH homology
 4KMF A;  4BHP A;  1MJB A;  2P6S A;  1MGT A;  2P5V A;  3K1N A;  3AAF A;  2WV0 A;  3FXU A;  2GIV A;  3C1D A;  2EFO A;  4FHT A;  5DD4 A;  2Z99 A;  2L4A A;  2MH9 A;  1IRG A;  2COM A;  5D4S A;  5FD6 A;  2MA3 A;  2V1X A;  4I01 A;  1MZB A;  2K4J A;  3VFZ A;  4N9H A;  1G6N A;  1FLI A;  1ZRD A;  4RB1 A;  2QVO A;  4HBL A;  2A61 A;  3BOQ A;  5CLS A;  2TDX A;  3WGG A;  3F6V A;  3KP5 A;  2RGV A;  1Z7U A;  4HQM A;  4IHS A;  5ICG A;  1RZ4 A;  5D5U B;  2W24 A;  1U8R A;  2YX4 A;  3Q9S A;  1Z6T A;  1H9T A;  4HV6 A;  3FM5 A;  3O2P E;  4OIQ F;  3F72 A;  3SQN A;  2LSO A;  1BOA A;  2JT1 A;  4RB0 A;  1WI9 A;  2FMY A;  4CHU A;  3GVA A;  4WXH A;  4A0Y A;  5CVU A;  1HW5 A;  3GLX A;  1DP7 P;  2GZW A;  3H3U A;  2P8T A;  1JHF A;  3W6K B;  2HYG D;  5LRR A;  4G94 A;  5DCM A;  1DDN A;  2EWN A;  4UXN A;  2KJB A;  5BQT A;  5ICC A;  3BJO A;  2RKH A;  4L9V A;  4K2E A;  1IW7 F;  3K1M A;  3RTR A;  3COA C;  1KGS A;  2LDU A;  1K7A A;  1J59 A;  4UUV A;  3WGH A;  4KN4 X;  1XN7 A;  4BNC A;  4HF0 A;  3E3V A;  1T98 A;  5JR3 A;  5DEQ A;  2P4W A;  3CO7 C;  1P4X A;  3RKW A;  3MWM A;  1TQM A;  5E8I A;  1STZ A;  2K02 A;  1PP7 U;  1ONV A;  4U0W A;  5DV5 A;  3P9I A;  4OIN F;  4IVN A;  3J80 Z;  2V1D A;  4HDU A;  1IXR C;  2F2E A;  4PGG A;  2XUB A;  3HTU A;  1BI1 A;  1F9N A;  3L9F A;  1YYV A;  3WTU C;  5A2Q K;  3WTV C;  4ENN A;  4YFK F;  1YO5 C;  5LEJ A;  1H0M A;  2O8X A;  3SHF A;  2DAO A;  2DO7 A;  1OYY A;  3V7R A;  4EVI A;  2DFI A;  4LD5 A;  1ZAO A;  2IA1 A;  4NHJ A;  3K0L A;  1IF1 A;  1FZP B;  3PFI A;  1ZYR F;  4FT8 A;  1I1S A;  3GXO A;  3IHU A;  4WXC A;  4RB2 C;  5HLH A;  2L01 A;  2ZJ2 A;  2YU3 A;  5L3E A;  2XRO A;  4HYE A;  2RN7 A;  2BE5 F;  2VOD A;  1ZLJ A;  2FBK A;  3D0S A;  3QU3 A;  5ICE A;  2L3D A;  4IRI A;  4EJO A;  2XV4 S;  1B9M A;  4WF2 A;  3JAM K;  3K1P A;  1WQ2 A;  1IN4 A;  4IRH A;  3H3Z A;  1XCV A;  2EB7 A;  5E1W A;  2JRT A;  3T1B A;  4ZYH A;  1R36 A;  3KFW X;  1OYI A;  1FBS A;  2ETH A;  1W5T A;  1BIA A;  4BXU A;  4AVP A;  1VTN C;  4OOI A;  3B73 A;  4RB3 C;  1R5H A;  3HRU A;  2D1H A;  4YFX F;  2L4M A;  1LDD A;  2Q0O A;  3T0Y A;  4S05 A;  4A5M A;  1IN6 A;  4M9S A;  3FXQ A;  5FO5 A;  3LQR A;  3FM3 A;  1TTY A;  4LLN A;  3EYY A;  1K6O A;  3LQQ A;  1YQA A;  4U0V A;  1O3S A;  2STT A;  4NQW A;  4L18 B;  5ILU A;  3TDU C;  2STW A;  3REO A;  1O3Q A;  3JTH A;  3J7A O;  3CDH A;  5ILV A;  2BEO A;  1ZGJ A;  4XRF A;  4EJW A;  2RQP A;  5HDN A;  2UXN A;  4M6X A;  2ISZ A;  1FX7 A;  3HHG A;  3JSO A;  4KNY A;  1XCB A;  3KZZ A;  1HW2 A;  2XAJ A;  2IPQ X;  3GO5 A;  4G8X A;  4ZZD A;  3IC7 A;  1FP2 A;  3SXY A;  4WWC A;  2W25 A;  4FX4 A;  1KYW A;  1SAX A;  3SFZ A;  2MC3 A;  2XRN A;  3PQJ A;  2A69 F;  3VB2 A;  1O3R A;  2CGP A;  4EM2 A;  1HQC A;  3HYI A;  4CO8 A;  2MD5 A;  4WCG A;  3N97 A;  2FRH A;  2OU2 A;  2VXZ A;  1G4D A;  3V8K A;  2HYF A;  5DUK A;  1ON2 A;  1RUO A;  1SD6 A;  2ZNZ A;  3KP6 A;  2G7U A;  1ZG1 A;  1FOK A;  4LLL A;  3FMR A;  2EFW A;  2OQG A;  4AIH A;  1R22 A;  2XHK A;  4JK1 X;  2LNB A;  1HST A;  2DBB A;  2XIG A;  4LG0 B;  1I27 A;  3E5Q A;  4F7Z A;  3KLO A;  5LBQ A;  2JZY A;  3V8L A;  1ZRC A;  4M74 A;  4CIC A;  2PMH A;  2RVC A;  4A0X A;  4ZH4 F;  1ZN2 A;  4ENK A;  2HEO A;  3E6B A;  4KIG A;  4AIJ A;  3ELK A;  2HFH A;  3E6M A;  5KVR A;  3N4M A;  1T38 A;  3QRF F;  3E5U A;  3CUQ B;  5DCM B;  3NRV A;  1UB9 A;  2Z33 A;  5BMZ A;  4FX0 A;  5D8K B;  2D2W A;  1BC8 C;  5HVQ C;  5LGT A;  3KET A;  4HA8 A;  1R1U A;  1J0R A;  2F5D A;  1BI0 A;  1FY7 A;  2ELH A;  2UZK A;  1NHA A;  3KP2 A;  4M71 A;  2IW5 A;  2VE8 A;  5HLI A;  1R7J A;  4U88 A;  3IKT A;  2IVM A;  1CF7 A;  3C7J A;  2DQL A;  3BP8 A;  1U78 A;  3EDP A;  4RS8 A;  1XGN A;  5LEK A;  2VE9 A;  1HXD A;  4ETS A;  1KQ8 A;  2HZT A;  2IT0 A;  5L3D A;  4A2U A;  2P7V B;  4AD9 A;  4EMS A;  2X0L A;  4A12 A;  1U3E M;  3WU1 B;  2NAZ A;  1IN7 A;  5K1Y A;  2V1U A;  4S04 A;  1SD7 A;  3FF5 A;  5K5R A;  3U1D A;  1I1G A;  5L3C A;  2A68 F;  5IT9 Z;  3J81 K;  3R4K A;  2EV6 A;  5FLX K;  2NNN A;  4L0Z B;  2IJL A;  3V7C A;  4BHC A;  3BY6 A;  3I58 A;  1MKM A;  2PI0 A;  1QBJ A;  2QQB A;  3LA7 A;  4G7H F;  3V8J A;  2VC1 A;  5HLG A;  2FNA A;  4GXO A;  4A5N A;  3L7W A;  2HOE A;  1LJ9 A;  4RGS A;  2EV5 A;  4B8X A;  5DYM A;  1MDM A;  3BJA A;  1PUE E;  4ZYG A;  1OKR A;  1U5T B;  1O57 A;  2EFQ A;  4IXA A;  5A2Q Z;  2VOO A;  1RIO H;  4Y15 A;  2JTV A;  3IWZ A;  1XB4 A;  1LB2 A;  4I02 A;  2QWW A;  3WTY C;  4OIP F;  2J5P A;  2QUF A;  1B6A A;  2A07 F;  1G3W A;  3FZV A;  3IWF A;  4AIK A;  1FP1 D;  1B59 A;  1FWZ A;  2XAH A;  4E70 A;  1IN8 A;  4Z2Y A;  3VEP A;  1UHM A;  4HX8 A;  2L02 A;  5JHU A;  5D5W B;  4MGR A;  1UST A;  1UFM A;  4IJA A;  5FFX A;  3I5U A;  2EV0 A;  1R58 A;  3F3X A;  1J5Y A;  3ZMU A;  1FNN A;  3LFK A;  2LF8 A;  4NB5 A;  4P9U A;  4ESB A;  4HF1 A;  4QLC U;  1WKM A;  2Z5U A;  1USS A;  3FXR A;  5CVR A;  1IZ1 A;  1QGP A;  3PQK A;  3MAJ A;  2EK5 A;  1G3T A;  3DV8 A;  2EJR A;  5E1X A;  4A6E A;  3DXJ F;  4R8H A;  3GWZ A;  4O6J A;  2ADU A;  1EH6 A;  1F4K A;  3CUQ C;  1OR7 A;  2K86 A;  3L00 A;  3F21 A;  2RDP A;  2MLK A;  5TJJ A;  4UNO A;  5ILS A;  2H6B A;  3ZQ7 A;  4OIR F;  3HSR A;  1SD5 A;  2RV8 A;  1F1Z A;  3W6J B;  1YLF A;  4M9X A;  4N9I A;  4JQF A;  3BPV A;  4ON0 A;  1YG2 A;  3CUQ A;  2E1C A;  2FA5 A;  3KP4 A;  4MEY F;  2Q8K A;  2DK8 A;  1YIO A;  4YG2 F;  3T8R A;  4KT5 C;  4KDP A;  1FSH A;  1BI3 A;  3O3K A;  3NEU A;  5J8F A;  3HTS B;  4B09 A;  2M8E A;  2QYO A;  4EJU A;  3F6O A;  3HRS A;  1WSU A;  1GXQ A;  2EA2 A;  1DUX C;  2JPC A;  1KU3 A;  1TLH B;  5FGM A;  1FYL A;  2IP2 A;  4P55 A;  2FML A;  5HOO A;  2IA0 A;  1QNT A;  2QLZ A;  4KIB A;  4Q48 A;  3JTG A;  5H6Q A;  2XAF A;  1V3F A;  2M5W A;  1R5G A;  3HSE A;  2UXX A;  1AOY A;  1ODD A;  2XKO A;  3M9A A;  5IT3 A;  5LGN A;  3KEQ A;  1Q1H A;  3ZMD A;  1Z6R A;  1W7P D;  2DQR A;  1FT9 A;  4G9Y A;  4XSZ F;  2CG4 A;  1GVJ A;  3LAP A;  1KU2 A;  5E20 A;  4YIF A;  1XGS A;  2QBY B;  3RI4 A;  1WRJ A;  1BC7 C;  2KIU A;  1CGP A;  2OAZ A;  3GYH X;  1XDS A;  2KIM A;  2QZ8 A;  5FLX Z;  3LA3 A;  2XAQ A;  1E2X A;  3F22 A;  1D3Y A;  2M30 A;  5CVV A;  2XAG A;  3RKX A;  1O7L A;  3E97 A;  3IRQ A;  2L54 A;  2DW4 A;  2KKO A;  1KYZ A;  3OOP A;  3EYI A;  4LJZ F;  2Y48 A;  1RNL A;  4HX7 A;  2BYV E;  1U5T C;  3ISP A;  1KU7 A;  4AWX B;  2DK5 A;  5LGU A;  4ENJ A;  4P96 A;  2WWY A;  2WC2 A;  4O3M A;  3EUH A;  3I59 B;  5HS9 A;  2IA2 A;  1T0F A;  3QOP A;  1LNW A;  1TQI A;  4M9Z A;  1R00 A;  3J81 Z;  2ACJ A;  4H0E A;  3ULQ B;  1K78 B;  4I2O A;  4Y17 A;  1MDM B;  3T8T A;  4LG0 A;  1OPC A;  3HHH A;  1SFE A;  2DU9 A;  3TKY A;  3FHZ A;  5H6R A;  1QQI A;  2ZXJ A;  3R6S A;  3C3W A;  3JAM Z;  2DT5 A;  5FFZ A;  3T5X A;  5LHI A;  1OYW A;  2F5E A;  3HRM A;  1TQP A;  4MEX F;  2F5C A;  3P9C A;  5HS8 A;  2AXL A;  2E7X A;  3CO6 C;  3MFK A;  3TO9 A;  4R79 A;  2BV6 A;  4WXD A;  4L5J A;  2FEZ A;  4MHG A;  1ZGA A;  3FX3 A;  3ML6 A;  2RC4 A;  2M1B A;  3DPL C;  1S29 A;  3MQ0 A;  3GZ5 A;  5LHH A;  3FWE A;  2KJC A;  2MH2 A;  2Y75 A;  3DKW A;  5TRD A;  2ESH A;  2E1N A;  3F8M A;  1XD7 A;  2XVC A;  2O0Y A;  1XGM A;  2ZME A;  1HBX G;  3RYR A;  4IPA A;  1O3T A;  3RDI A;  1YS6 A;  1BN5 A;  3M1E A;  2HTS A;  4EGY A;  3HRT A;  4U0Y A;  4KMU X;  3E6D A;  2RNJ A;  2ESN A;  1LDK B;  1HSJ A;  1YS7 A;  1L3L A;  1LVA A;  4I0B A;  1RUN A;  1S8N A;  3DQV C;  5F1R A;  3FMS A;  1J75 A;  4EV0 A;  2W85 A;  3TO6 A;  1XMK A;  5HDK A;  2K4B A;  1MD0 A;  2M87 A;  2HKX A;  2PN6 A;  3ZMV A;  2A6E F;  2H6C A;  2MLG A;  5K5Q A;  1IXC A;  3F8F A;  1XSX A;  1I6X A;  4MQV A;  3L09 A;  1SMY F;  1B1B A;  5J6X A;  3BPX A;  2Q2E A;  1JGS A;  1R23 A;  1P4W A;  4A0Z A;  1FYK A;  1HW1 A;  5JFR A;  4Q4Z F;  2ISY A;  1B9N A;  4MNU A;  3I53 A;  2VN2 A;  2CQK A;  2D45 A;  2QQA A;  3ROU A;  3GEZ A;  4WK8 F;  2K7L A;  1UCR A;  2ZCW A;  3Q5F A;  4PCQ A;  2A6H F;  3CTA A;  3DFG A;  5LLQ A;  1GXP A;  5CVI A;  3GZ6 A;  3G3Z A;  3D5L A;  1IAW A;  3Q9V A;  2QBY A;  1SFU A;  1W4M A;  2FU4 A;  4UVA A;  4YII A;  3C18 A;  3QP5 A;  3RYP A;  1Z91 A;  4ZYD A;  1QZY A;  3TO7 A;  2EA4 A;  2CO5 A;  2OBP A;  2HQN A;  1GHC A;  4D0P A;  2KIF A;  3HIF A;  3BJ6 A;  1U6G A;  2R7F A;  3ABU A;  5E17 F;  2PG4 A;  4N0B A;  3ZPL A;  2ZFW A;  4LFU A;  1LQ1 A;  5DCF A;  3LAJ A;  3HSF A;  3QPT A;  1XDU A;  3TOA A;  4EM1 A;  3GFM A;  4ESF A;  1FPQ A;  4HX4 A;  4TV7 A;  1G3Y A;  5D6F A;  3TGN A;  2LF7 A;  1ULY A;  1CF7 B;  1P92 A;  3LA2 A;  3BWG A;  1FYM A;  3ZN1 A;  1AWC A;  5LRS A;  1LEB A;  2VBW A;  5HDG A;  4QWQ A;  4EQQ A;  3I64 A;  3NQO A;  4CXF A;  1MJ9 A;  1TW3 A;  2O3F A;  5AON A;  4KFC A;  2FE3 A;  2QEN A;  2DTR A;  2G7H A;  2GXG A;  3HOT A;  2GQQ A;  3TDZ C;  3QP6 A;  4RAY A;  4LK1 F;  1BI2 A;  1EH7 A;  3U9G A;  2NNY A;  1TW2 A;  4HLY A;  5E1Z B;  1S7O A;  2W84 A;  2YX7 A;  3GW2 A;  4HF2 A;  4KA4 A;  5JI6 A;  5KK1 A;  2FSW A;  2H94 A;  5DUI A;  4XLN F;  4OMZ A;  4ZYE A;  3KP3 A;  4CDG A;  1LDJ A;  1XMA A;  1C0W A;  2FOK A;  1EH8 A;  1G3S A;  3GFJ A;  3WG9 A;  1FC3 A;  5CYV A;  2JPB A;  3KLN A;  5F6F A;  5FB2 A;  1JXS A;  1XSD A;  4MTE A;  4ZZL A;  2NYX A;  1ZH5 A;  2GA1 A;  2CW0 F;  1ZG5 A;  2ZKZ A;  2A5Y B;  3F8B A;  1YTY A;  4UV8 A;  4OMY A;  2Y0M A;  1J9I A;  1PP8 F;  3WTT C;  2EFN A;  4HLX A;  5F64 A;  1U5T A;  3TOB A;  4GYI A;  1T6S A;  2OA4 A;  3R60 A;  1XGO A;  1D8J A;  3I0T A;  5D4R A;  4PDK A;  4XSX F;  4Q47 A;  3E6C C;  4LGW A;  2VBX A;  3F8N A;  1FSE A;  4LMY A;  4R1H A;  1IXS B;  2P7C B;  5E8G A;  4RGU A;  5J8C A;  3ECH A;  2VOP A;  4UVB A;  2BGC A;  5FD5 A;  2P5K A;  3CJN A;  2FNP A;  1W7P A;  1KQ9 A;  4EJT A;  5BS6 A;  4HV5 A;  2GWR A;  2LKP A;  1TBX A;  2A3S A;  4ENM A;  1HKT A;  1TNS A;  1T2K A;  3MEX A;  2V9V A;  2O61 A;  4IF4 A;  1LEA A;  1IRF A;  3BZ6 A;  5IT9 K;  4L9N A;  3OV8 A;  2Z3Y A;  3ZMT A;  3WTW C;  1DPR A;  1O7F A;  3WE3 A;  2DPD A;  5D6E A;  4KUM A;  6PAX A;  4KN7 X;  1P2F A;  2F5F A;  3F8C A;  2FBI A;  3K69 A;  1OMI A;  1QO0 D;  3DPT A;  3V4G A;  3WTS C;  5BPD A;  4P9F A;  2H09 A;  3L2C A;  3ABT A;  2CSO A;  1HKS A;  4XLP F;  5ED4 A;  1WWX A;  4KIC A;  4DNC A;  5D5X B;  5L3G A;  4BYY A;  1ZRE A;  4CYD A;  2VT2 A;  1R1V A;  2HR3 A;  3EQL F;  1QZZ A;  3GFI A;  2NS0 A;  2O03 A;  3ZMZ A;  1F5T A;  1SFX A;  2XKP A;  1Z9C A;  4HQE A;  1JHH A;  4G7Z F;  3HOS A;  1W7P B;  3RPU A;  2C6Y A;  1BBY A;  2PBI A;  3I59 A;  2ZNY A;  2IRF G;  4G6Q A;  5DD8 A;  3P7N A;  1FBU A;  3DF8 A;  3G73 A;  2HQR A;  4M72 A;  2CFX A;  4YFN F;  4WX9 A;  4RGX A;  2PJP A;  4OIO F;  3CUO A;  1KU9 A;  1BIB A;  4I09 A;  4L9T A;  2ZO4 A;  5EEG A;  2VBY A;  3J80 K;  2K27 A;  5HS7 A;  2XAS A;  1TNT A;  1K78 A;  2GXB A;  2OZU A;  1MJA A;  2WTE A;  4GGG A;  1Z05 A;  3BDD A;  1BM9 A;  1JE8 A;  1QPM A;  2OQR A;  3ECO A;  3WE2 A;  2HDC A;  4G7O F;  4M73 A;  5ERI A;  1SMT A;  3WOD F;  2B0L A;  3E5X A;  5CJ9 A;  3WTZ A;  4LB5 A;  4HDV A;  2DPU A;  4P5O A;  2UWM A;  3KEO A;  2ZBK A;  4MTD A;  2PQ8 A;  3KZY A;  3LST A;  3BRO A;  2M45 A;  5L3F A;  1D8K A;  4HOB A;  3HUG A;  1ZRF A;  4XBF A;  3R0J A;  3GFL A;  1V4R A;  3M7G A;  4PGH A;  2V6C A;  2FXA A;  2HWV A;  3CLO A;  4UV9 A;  1YW9 A;  1U2W A;  4DQ2 A;  5AIP A;  1IN5 A;  2V79 A;  1EV7 A;  1FBQ A;  3QU6 A;  4I0A A;  3KE2 A;  3QPH A;  4PZJ A;  4HAM A;  2HTJ A;  2CWE A;  3U2R A;  1HKQ A;  4Y13 A;  3H92 A;  2GAU A;  3K2Z A;  2R3S A;  2J5O A;  3GX4 X;  3JSP A;  2VT3 A;  4BHB A;  3EET A;  4LK0 F;  3SZP A;  4G6D A;  3F23 A;  3I4P A;  5H20 A;  5ICF A;  3RKY A;  4CZZ A;  5BPI A;  1RI7 A;  2JSC A;  4L5I A;  3P9K A;  3V7S A;  4UHT A;  4LB6 B;  1W5S A;  1REP C;  1D5V A;  3GF2 A;  3WGI A;  1J2X A;  1P6R A;  4GYG A;  3DEU A;  1S7A A;  3WU0 A;  1PDN C;  1YW7 A;  2GA2 A;  4EJV A;  4GCV A;  3MZH A;  3VOE A;  2FF4 A;  2HKO A;  5D5V B;  3VOD A;  5BOX A;  2W57 A;  2HS5 A;  2YSR A;  3IRR A;  1IUY A;  2ZME B;  3ZN0 A;  1Y0U A;  2OD5 A;  1P4A A;  5D8L B;  4M6Y A;  2PFB A;  1T39 A;  2XGX A;  2YPR A;  5AIQ A;  4O5V A;  2OZ6 A;  4EM0 B;  2NRA C;  3B02 A;  1L0O C;  1BJA A;  3M8E A;  1KA8 A;  3SZT A;  4Q5S F;  1YFH A;  3RIR A;  4BQA A;  1B4A A;  1KQ0 A;  5LHG A;  4I7H A;  3RPQ A;  2HGC A;  4OU0 A;  1J7K A;  5EEH A;  3ZP5 A;  3KP7 A;  3S2W A;  2G9W A;  4LLG F;  1K79 A;  4A6D A;  2VON A;  2DI3 A;  3R0A A;  2PMU A;  3R61 A;  4L0Y B;  4ESJ A;  5L3B A;  2CYY A;  3DP7 A;  2O6G E;  3IL2 A;  2Z9O A;  2H27 A;  1I5Z A;  3FMQ A;  4HZF A;  2KRF A;  3ERE D;  3ZMS A;  2YR2 A;  1ZG3 A;  3WTX C;  1ON1 A;  5K5O A;  2P6T A;  1DPU A;  1S3J A;  4L9J A;  3MCZ A;  4IRG A;  3I54 A;  1YW8 A;  4GO1 A;  2QQ9 A;  1ZAR A;  4KIF A;  1X3U A;  4ASN A;  3MZY A;  3JW4 A;  2DLL A;  1R1T A;  2EFP A;  4HW0 A;  5E18 F;  1H9G A;  1ZHF A;  4RGR A;  3QAH A;  1ZLK A;  2PEX A;  4RAZ A;  3KCC A;  2P5L C;  4BH9 A;  4JBA A;  3M8F A;  3RJP A;  4U7D A;  4MQ9 F;  2VC0 A;  1E17 A;  2QM3 A;  4I98 B;  4U7B A;  1UHW A;  2R7D A;  1SD4 A;  3K9T A;  4EGZ A;  1S6L A;  3LWF A;  2E7W A;  3GUD A;  3I71 A;  2FQ3 A;  5DDG A;  2FBH A;  4CGZ A;  2BBY A;  4KYW A;  5JVT A;  1Z1D A;  2AS5 F;  1A04 A;  3O6B B;  3TQN A;  2VBZ A;  2PLY A;  3IKV A;  2X4H A;  4BAY A;  2D1V A;  4UVC A;  4IHT A;  1XSV A;  5CVJ A;  2MBF A; 
...loading similar chains, please wait...
similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
similar chains in the pdb database (?% sequence similarity)

 
#similar chains in the Genus database (?% sequence similarity)
...loading similar chains, please wait...
#similar chains, but unknotted
...loading similar chains, please wait...
#similar chains in the pdb database (?% sequence similarity)
...loading similar chains, please wait...